2XD0A

A processed non-coding rna regulates a bacterial antiviral system
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
162
structure length
162
Chain Sequence
b'MKFYTISSKYIEYLKEFDDKVPNSEDPTYQNPKAFIGIVLEIQGHKYLAPLTSPKKWHNNVKESSLSCFKLHENGVPENQLGLINLKFMIPIIEAEVSLLDLGNMPNTPYKRMLYKQLQFIRANSDKIASKSDTLRNLVLQGKMQGTCNFSLLEEKYRDFGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TOXN
publication title A processed noncoding RNA regulates an altruistic bacterial antiviral system.
pubmed doi rcsb
source organism Pectobacterium atrosepticum
molecule tags Toxin/rna
total genus 47
structure length 162
sequence length 162
chains with identical sequence B, E, X, Y, Z
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2010-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13958 ToxN_toxin Toxin ToxN, type III toxin-antitoxin system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.890 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2xd0A00
2XDBA 2XDDA 4RMOA 4GLKA 2XD0A 4ATOA
chains in the Genus database with same CATH superfamily
2XMFA 1K0XA 1XNIA 2AZSA 4HCKA 2K79A 3CCSQ 2BTTA 2KMTA 3CC7Q 1K9AA 3DLMA 3I55Q 1H3HA 3EH2A 2FB7A 4QT7A 3VYHB 3CCMA 3OYJA 1UGQB 3OYCA 3CCUQ 3CC4A 1LCKA 1WFWA 4N0AC 3M56A 4ZGJB 2MK5A 5FU6C 5GANg 5L8RE 1YI2T 3A8LB 5KYWA 2DTOA 2NLUA 4C92C 3MEWA 3L42A 4CC3A 3UF4A 2YSQA 2LCSA 3TSWA 1SHFA 4LDVA 3A8HB 1FMKA 4DA4A 1T0JA 2YLCA 2F5KA 4ZN3A 4JRKA 4OMOA 1D0XA 3PIPA 1V1CA 1WI7A 2EWNA 4HKEA 2M51A 1EZZB 2WSCE 2K9GA 1B7TA 2X4YA 2MF2A 1AZGB 5AT1B 3PGGA 3PMIA 3JCMV 5IN1A 1TU0B 1K4US 1SRLA 1MMNA 1TSFA 3L2QA 3EGDA 1OEBA 4OMQA 1Q82R 1BB9A 1H641 4WF2A 3CC2T 4UC4A 3QUIA 2L0AA 4E7IA 2DYIA 3VS5A 4PFOA 4N4HA 1U8RA 2VASA 2CSQA 4F7UE 3QO3A 1VOMA 1LOJA 3JB9H 4E7ZA 2YLBA 1X6OA 3A5ZB 5GAN8 1Y7XA 1VQ7A 4AG2C 4M77C 2C06A 2RMOA 2CH4A 3OMCA 4M7DC 3SWNC 1VQNA 1BU1A 1YFNA 2NUTA 4JLIA 2E41A 1ZBJA 2VV5A 3OS2A 2XD0A 2DFUA 5KYYA 1TS9A 4OMPA 1N8RU 1NEBA 1NM7A 1Q86C 3EG2A 3REAB 1UGPB 4M7AD 5GAN7 1YI2Q 1KQ2A 2DL7A 1PHTA 1RAHB 2CP5A 3EHQA 4BE2A 2DE0X 2L2PA 3O8VA 2V26A 2EIFA 2XG8D 1TWBA 2E5KA 1PRMC 3GF5A 1BI0A 3OYEA 4PFZA 2M1HA 4F7UA 3OY9A 5FLXE 5GANe 3G71A 5CKFA 1YJWA 2FZCB 3BFMA 2KI7A 3X25B 3NMZC 3IQLA 2P4RA 5CIUA 2LCCA 3CCEA 3CCJA 2D0NA 3S3NA 4ELYC 2CREA 2BUDA 2YUQA 1QCFA 2QGGA 1NBEB 5GAOl 1Q7YU 5GJWB 3HRSA 2EQMA 1W4SA 4FCYA 1X6GA 2E6NA 2E10A 3H0HA 2O2OA 3CC2Q 4DEXA 4C0FA 1AOJA 2ROTA 4NL3A 2V8KA 1VQKT 1VQOQ 2K3YA 3UPUA 1M2VB 3DLLA 2L3QA 3UA7A 2HKQB 4J8OA 2A0FB 3OS1A 2W0ZA 1BI1A 1M2OA 5KYNA 4J5YA 1A0NB 2KEAA 2O9VA 3HL8A 2JT4A 5LJ5h 1AZEA 4MMKA 4F04B 2LQKA 2VXEA 1KJWA 1CSKA 3MP1A 4C8QG 3PIOA 1M90R 4C8QE 1KC8U 3RDVA 5IXFA 1JRIA 2LJ1A 2KXCA 3U23A 1VQNT 5HK0A 3OS0A 3VV0A 1G2BA 1Q81R 1SSFA 1WJSA 2ZPFB 1PKTA 3NTHA 1ABOA 1QVFA 1C0MA 2HNIA 4ZGEB 4LE9A 1EFNA 2RPNA 2PUOB 2AIRB 2KT8A 1D1BA 5GANj 1AWOA 5GAMh 4C92G 4OP0A 4KH1B 2LJ3A 3ASKA 1UHCA 2CUBA 5GAN2 3E1SA 4E47A 2RHZA 2DA9A 1BBZA 4E7SA 1RAFB 4Y91A 4K11A 1MUZA 2DLPA 1VQMA 5FRNA 2O4XA 1AWWA 2DMOA 5LJ3f 2X3WD 4C8QA 1YNZA 2F2WA 2CZ6B 1QCOA 5LJ3g 4MDXA 3KBGA 1G3YA 3CCJT 2DETA 2RI5A 1VQKQ 2E70A 3JAME 2E4HA 2VYTA 4RTWA 2V1QA 2PUKB 4PKCC 5CR2A 3X26B 1FYNA 3P8BB 5AYFA 1OX8A 1SRMA 3A98A 2DL4A 5GJVB 5LJ3d 2F2XA 4N4IA 1VQ5T 2E12A 2KBTA 3A8OB 2GNCA 3ZL7C 4F7UF 2L3RA 4BDYA 1VQ6A 1UGSB 5CK9A 4X9DA 4M7AC 3JB9J 1KQSS 4M75C 1NG2A 2RQTA 2EKOA 2RB6A 1VIFA 5I11A 4M77G 1S1NA 2L5QA 4M77E 4QQ6A 3M0UA 5LJ5j 1VQNQ 1SPKA 1WDXA 3CD6T 2GGRA 3QDRB 4JRQA 3CCQA 5KYXB 5GMKm 2K3XA 4KGZB 2PVGB 1PSFA 1T3LA 3MEVA 5DLQE 4M78A 5FU7C 2CZ1B 2D1XA 2HDAA 1OZ3A 2X51A 4OB3B 4R56A 1D3BA 2VKNA 4F16A 1WGSA 3MCAB 2K6DA 2QQBA 2KK4A 3RKWA 3I9QA 1YJ9T 3JCMJ 2MPXC 2I0NA 1PCXA 3M0RA 2RK2A 1RAIB 3I56T 3CCSA 1I0CA 2DKGA 3CC7A 1K8AR 2V8JA 3J7AF 1GL5A 3I55A 1AWXA 1M3CA 2RJFA 2PVDB 5A0DA 1R77A 5D6YA 1MMDA 2KY9A 2QQAA 1SHGA 4RTZA 4JRPA 2OTJT 3CCJQ 3RERA 2PVOB 3JCMf 1Q82C 2F2VA 1PM3A 4X1VA 2P0PA 3OYKA 2FZKB 2HZYA 1NJIU 5KCOA 3CCLT 1SF9A 2CP2A 2CZ7B 2HSPA 3CBOA 3PTAA 1JJ2S 1VQ5Q 5LJ3e 2E5QA 2HAXA 1PRLC 4E6RA 3JCMd 5KYWB 3OBYA 2FRWA 2EGEA 2DXUA 2CUDA 2E64A 2K5FA 1Q95G 1AEYA 4ELZC 2D8JA 2MYSA 3VJPA 2CT3A 3HFNA 3OYDA 1ZLMA 4BI8B 3EGUA 3CD6Q 4IKFA 4XAXB 4GY5A 1GCQC 4C8QF 1RAGB 3OQ5A 1B3QA 2DYBA 2X9HA 3S3OA 1D1AA 1IRXA 5EC7A 1PC0A 1E6GA 2XI9A 1N8RR 2KYBA 1PG5B 1YN8A 2Y4XA 3EGDB 1YJ9Q 1WHLA 2EKHA 3QJYA 2QGFB 3VS2A 3VS1A 1QQJA 1U5SA 5GAOn 1WXTA 4ZN1A 2HBWA 2KAFA 3A8MB 4ZTJA 2DVEA 2KGTA 3URGA 1NE8A 3G7ZA 4D8KA 2OTJQ 4E2FB 1K1ZA 3JB9G 1Y57A 1OOTA 2PU9B 4ATOA 5KH6A 2GQVA 2EVRA 3CXCA 5D6WA 4ORZA 2NUTB 2CP6A 3CCLQ 2QQSA 5KYYB 3M54A 4M7DD 1Q7YR 4M78F 4Y92A 2RK1A 4J9IA 2JOYA 1MMAA 1OI1A 1AT1B 2ENMA 3L2UA 2ZGWA 4E7JA 5GAOr 2QTXA 3X24B 1JEGA 3NTKA 3VRYA 1RLPC 2JJ9A 3QYHB 2DTHA 1NYGA 3H41A 3I35A 4VUBA 1IO6A 3MP8A 2NUPA 4OMNA 3S6WA 1K73R 1WHJA 2QQ9A 1I5OB 2M02A 1ABQA 1M90C 1VQ6Q 4F7UB 4KRTA 3NFCA 4M7AG 4M75G 1IHWA 4M7AE 1KG1A 1YCSB 2L8DA 2RD1A 3CC2A 1WPYA 3QXEB 1Q81C 4J9FA 2RNAA 1KC8R 3GBQA 4F17A 1QVPA 4BI3A 1HJDA 2O88A 1WHMA 4DOWA 4CI0C 4J9BA 3TEEA 1ZQ1A 4D6WA 1YIJT 4N4GA 4Z8AA 1VQPT 2HQXA 2FG0A 3OYHA 1BYMA 1VQ8T 1T3SA 3OYNA 2LX9A 2GF7A 2ABLA 4JZ3A 3MEAA 2LZ6B 3GOXA 4WTOB 2DM1A 3EGXA 4BI4A 1TXQA 3FDRA 4IUVA 2MOXA 3META 4PK4A 2XDBA 1TUCA 3HRUA 3WVEB 3OW2P 3N5BB 1NPRA 1WQWA 1WIEA 3JSCA 1ZSZC 2IG0A 3LH0A 3OYBA 4WCIA 2EYWA 1ARKA 3CEYA 1U1TA 2ZPBB 3PVLA 1AWJA 4RTUA 4EMKA 1YJNA 5GANf 3C0CA 4DBHA 2EJFA 1D0ZA 3INZA 2HQHA 3EG0A 3QWXX 1KIKA 2H8HA 1MNDA 2MIOA 5ECAA 4DBQA 3V8KA 3P8DA 5J26A 5M9OA 4KULA 2D8HA 2KRSA 2EYQA 1XOVA 1LVKA 3M4YA 4RTXA 5GMKl 5GANd 3OYIA 5GAN6 2A3LA 2KDSA 3CMET 1WHHA 1UG1A 1M8VA 3F70A 5KCHA 1VQKA 4FYXB 2RM4A 1QVGP 3CCVT 3TVTA 1R8OB 1TOVA 1TTHB 2O9SA 3QJ6A 3EG9A 3JB9D 2IVWA 2RF0A 2O4XB 3OW2S 1F1BB 1KQSA 4C8QB 3LYIA 4XTVA 1YIJQ 3BE3A 4OGEA 1N5ZA 1Q86U 1VQPQ 3PVQA 5KYUA 4AFSC 2AKKA 1D1CA 2KT1A 2DRMA 3BW1A 1VQ8Q 1W2BP 1K8AC 4PJOD 5LJ5f 4C0ZA 3GIBA 2VXFA 5LJ5g 1BIAA 3OYGA 2V8IA 1WLPB 5GAN5 1VQ9A 4JPBW 1AVZC 2LNHB 4FSXA 3PMTA 3JCMc 2A7YA 2LQNA 2RJEA 1VQ4T 2MMPA 4PLLA 4HVWA 3RNJA 1NPPA 2NYSA 3CBPA 3G6ET 1QKXA 2JVVA 4J9DA 3QSUA 1X75C 1BI3A 4TVRA 5LJ5d 3RKYA 1P92A 1M1KR 4DOVA 4M75D 2JXBA 3FRNA 4FM4B 1GCQA 2PTKA 4RG2A 5GMKi 4OB0B 1QVGS 4XU1A 1PD0A 2JN0A 1YJNT 2DIQA 2A37A 2RJCA 3EFSA 5GAMg 1I8FA 4M78B 4XTXA 1NJIR 1D3BB 2M0YA 1V29B 3CMEQ 2LCLA 1V76A 1G3SA 1PD1A 3EG1A 2RQRA 4PJMA 4JS4A 4RCBA 3GPLA 2LTOA 3EHRA 1W2BS 1JJ2A 2KQWA 2HL5C 2BZXA 3MP6A 3JCMP 1GCPA 2EW3A 4BY6C 2C0IA 3E2UA 3RKXA 2FZGB 3SB2A 3ULRB 3M57A 2DBMA 1VQ5A 3REBB 5J39A 3L2RA 1KQ1A 5DY9A 4AFUC 3TU4K 1OULA 3JCMb 4BB7A 2OJ2A 5CAIA 5A0LA 2E65A 2A36A 3M4GA 4FYWB 1Y71A 2X4WA 1ZUYA 6AT1B 4FW1A 1M9SA 5I21A 5KE3A 3CD6A 1UECA 3PNWC 3J81E 3X28B 1E7OA 4GBQA 3LW5E 4A53A 3EFOA 1VQ4Q 1JO8A 5GMKh 3CPWA 1TUDA 1QW1A 3MJXA 3JCMQ 3G6EQ 2RI2A 2J06A 1HXDA 2GFAA 1VQ9T 4PJJA 5LJ5e 1Q7YC 2VUBA 1OZ2A 2EFIA 2ZZDA 2DZ9A 1YJ9A 4A4KA 1YJNQ 2LDMA 4RG8A 2E3IA 1YITT 3I56A 3HPWA 3OYLA 1QP3A 1K9MU 3MPUB 4E7KA 4C92E 1K73C 1S72T 4C5EA 4LNPA 2VC8A 2Y4YA 5FRMA 3UATA 2OTJA 4EIKA 1UTIA 5D6XA 1QMCA 3WXMB 4XTWA 3FEOA 2QYZA 5GAMe 4OGCA 2DJZA 2FO0A 2RH2A 3QWYA 1NZ9A 1G3TA 2LQWA 3CCLA 4JRIA 2RHXA 2P0KA 1KC8C 4X34A 1E6HA 2JM8A 1T0HA 4PJOC 1WNLA 4AG1C 4LDWA 1VYVA 2DEQA 1ZSZA 1X2KA 2BZ8A 2X4JA 1M3AA 4KH0B 4FSSA 2RN8A 4RTYA 4HCBA 7AT1B 2QI2A 3D7SB 1X01A 1PSEA 5CVIA 4N0AA 2HKNA 1XJWB 3JV3A 4BE0A 2PQWA 4X9CA 2KRMA 4C92A 1Y96B 4HVVA 4DQ2A 2L3PA 4Q5WA 4IUPA 5I2MA 3AHUA 2NUPB 4L5GA 1VQ9Q 5HKCA 4M7DG 2FVUA 4M7DE 2MWPA 1VQLT 2HEQA 1M30A 3LX7A 2JS0A 1M8MA 5FWBA 1YITQ 1KFZA 1G83A 2P4TA 4LDUA 1R0CB 5HCKA 4FL6A 4OVAA 4RKUE 3OYMA 2QDLA 2RQVA 2XU8A 4J9EA 1S72Q 2JM9A 1ZX6A 4JS5A 4OF1A 2LT1A 4RCCA 5IAYA 2YHTA 2EGCA 4Y28E 3P8HA 4C0DB 2VB6A 2DAQA 5GAMj 2K2VA 4PJNA 1KSWA 4MZTA 4Z89A 1VYTA 3Q1JA 3OYAA 1LJOA 5CKHA 1I5LA 4XU0A 3QZ5B 2GBQA 4LUDA 4OB1B 1QWFA 4M77A 3LGLA 4QVZA 3EGXB 3T9NA 4M7DA 3SWNA 1IGUA 5LL6S 3CCRT 2GTJA 1RABB 3DB3A 4J9CA 2XHCA 1BIBA 1IXDA 1LNXA 1K0SA 4EMKB 2YXYA 4YTLA 3J80E 2RQUA 2DL3A 2DJQA 8ATCB 1ZUKA 4MZPA 3PT9A 5LJ3h 4EMGA 2EYYA 3G4ST 4BUGA 1J3TA 2ZAEA 5A0GA 2OI3A 3OW2A 3LLRA 2YT6A 1MV3A 5FU7B 2DO3A 1K76A 1N6AA 3HP9A 4R55A 2D9TA 4AFZC 2DIGA 2NWMA 1M27C 1VQLQ 3RMQA 4JJNK 1IZ6A 4GLKA 1M1KC 2ED1A 4LDXA 1G5VA 2F5TX 4PJLA 1YIJA 2OTLT 4KGXB 3JCMW 4JZ4A 1C6VX 1VQPA 1QLYA 3H9NA 1OPLA 4ESRA 1O75A 2K5LA 1OYXA 2COWA 4LDYA 3EG9B 1QCNA 1VQ8A 1WXBA 2CS7A 2L89A 3I56Q 4XU2A 2G6FX 1N9RA 1D09B 1UGRB 2ZPEB 5CCAA 2Z0WA 4C92F 1GFDA 1SG5A 5KYUB 2BE9B 5L23A 1C1AA 1SEMA 3NPFA 2CP0A 4M78D 4JDSA 3E9GA 5KE2A 4XQ3A 4FYVB 5CKDA 3QYGB 1OU9A 4CC4B 1QWEA 2LVMA 2R58A 3CCRQ 1M90U 1LPLA 2D6FA 2DRKA 4LN2A 3BDLA 3X20B 3DB4A 3JB9I 3V7RA 3C95A 2X35A 5IHIA 4CRIA 2K5IA 3VYGA 4ANJA 4FW2A 3OYYA 4PJOG 1Q81U 4C5GA 1G3WA 2DNUA 3MKDA 4J6YA 1W2BA 4PJOE 2AZVA 4A4HA 3THKA 3H8ZA 2HSEB 1X69A 2X3XD 2M16A 1MMGA 1KD1U 3RUXA 5FW9A 3G4SQ 3CMEA 2QA4T 2ROLA 2B8AA 3NTIA 3JCMh 1FMVA 2X4XA 3GNFB 2KYMA 5D7UA 1UJYA 2FYKA 3CCUT 2WSFE 1H92A 3CMAT 4R0KA 4P5NA 3CCVA 3S3MA 3PFSA 5CQXA 4M75E 1U06A 4ZTFA 2ZPIB 4M77F 2SEMA 3I5SA 2OTLQ 4M7DF 1U3OA 1BKBA 3RIRA 2BKDN 3CPFA 2QTVA 2GFUA 1KHIA 2FEIA 1Z9QA 2GQIA 2EQUA 2MCNA 4PLIA 3UT1A 2JZ2A 4PJOA 3QKJA 1WQ7A 2YWWA 2FL7A 2CGHA 1B34A 5GAN3 4HCCA 3EAEA 2EYXA 1FMWA 1W6XA 2KSSA 1VQ4A 3HSBA 4EMHA 5IHNA 1K9MR 3G6EA 2LQ8A 4MZMA 5CKBA 3RR6A 2QEXT 2A28A 2J6OA 4M7AA 4M75A 1SSHA 1EX4A 3EFOB 2YRVA 2HBPA 1QKWA 3TCJA 4C8QC 1N9SA 2D0QB 3VKIA 9ATCB 1IHVA 5GAOq 2CZ0B 4DBRA 1WXUA 1JB0E 1RAEB 2H3JA 1VIEA 2QA4Q 3OBWA 4B9WA 3O5ZA 5J3BA 2E3HA 2P0QA 1ZBXA 4PFPA 4CC7A 2V1RA 2JS2A 2F1LA 2JTMA 4D8DA 4Z02A 1BCMA 3CMAQ 2HL3A 1W70A 2CT4A 4E7LA 3M0SA 1OQKA 4EDUA 4PL6A 1PWTA 2XDDA 1OV3A 2JW4A 1K8AU 2ED0A 2GTOA 2DILA 2KRNA 1ZHIA 3TREA 3GLXA 4KUDK 2DL8A 4II1A 3SHWA 3L2WA 1RI9A 1YCYA 2K3BA 5HY6A 2PNIA 3C94A 2F69A 3QHSA 1WZOA 2CDTA 2BZYA 1MHNA 2IIMA 3LGFA 2RO0A 3SDZA 3BDUA 4A4GA 1QP2A 2LC4A 3R6OA 3AT1B 3I5RA 5FROA 3CBMA 4QKUA 2DTIA 3L2ZA 4ZNXA 4FT4A 4M78C 2J7IA 4C0GA 1IREB 2YUOA 4HA8A 2EGAA 1ZSZB 3LH5A 4V2SA 5CKEA 4KT0E 3CXCP 3ZBDA 2K57A 3PE0A 2OAWA 2JTFA 5FU6B 1KHCA 1VQOT 2EJGA 3QIIA 3HTRA 4FU6A 2QEXQ 4C92B 2KNBB 4F7UG 1CKBA 1JXOA 4NS5A 1VUBA 2ZPHB 3HKSA 3JB9F 4E7HA 1NLPC 3V7SA 1YITA 1NLOC 4LD9K 1UUEA 3LWHA 4HXJA 1M4ZA 1JXMA 4BACA 3CQTA 2FPDA 4RTVA 1WYXA 1S72A 1PKSA 5IHKA 2FHDA 1X2QA 3QBYA 5GAMf 1MNEA 1Y0MA 3RBBB 3RESA 4PJOF 4FIBA 1YHQA 2AT1B 4OMLA 1KK7A 1IGQA 3G1JA 1RADB 1WA7A 3CCMT 2QQRA 1H8KA 5GANh 3M55A 3NHNA 1UHFA 1WX6A 3VS3A 1M5Q1 2AK5A 2YUPA 3TSZA 1SKUB 3CC4T 2DK3A 1IB8A 4JJDA 5GAMd 2ATCB 4ZGDB 3CCVQ 3CXCS 4M7AF 4BD3A 2CP7A 4M75F 3FIFA 2A08A 1N8RC 3DKMA 2EYZA 4LXCA 4FYYB 4HCZA 4HVUA 4JJCA 4M77B 3HFOA 1AHJB 3QG1A 3SWNB 3VU3C 4M7DB 1UE9A 2KR3A 3VRZA 4A4EA 1VYUA 3VS4A 1TUGB 1ZA2B 4J83A 4QVDA 1M3BA 3H0FA 1CKAA 4XTYA 2YDLA 1G8XA 4PNOA 3R6NA 3UA6A 1VQLA 1K73U 2BIVA 1R0BG 2K7AA 2LNVA 1RAAB 1GBRA 2H3EB 2DERA 3TQ7P 5FWCA 2IPOB 2KE9A 2JTEA 4MMLA 1I1JA 5GMKe 2YRDA 4LUEA 2K2MA 4C5IA 2EAYA 1I07A 1VQ7T 2RA2A 4AT1B 2DZCA 2JNGA 2EJ9A 2L3SA 3CCMQ 4BY6B 1DJ7B 2RI3A 3OYFA 1YHQT 1GXIE 3CC4Q 1KD1R 3HHTB 3FC3A 2EBPA 2EPDA 2QASA 1WJQA 2COYA 4KGVB 1KQSP 5A2QE 3CCRA 2CP3A 2FPEA 2MAMA 3JRZA 2O31A 1XTDA 4FT2A 2XIDA 2RHYA 2EQJA 5IXBA 1D0YA 4IUTA 1TH7A 2ESWA 1X6BA 2KROA 5GAN4 1U1SA 1RI0A 3RMSA 4LD6A 2J05A 5DLOA 4J6XA 2J6FA 2AKLA 2JMAA 3LWIA 2LJ0A 3QZ9B 2R57A 1YBYA 3G4SA 3G71T 1YJWT 3MO8A 2QXFA 1MV0B 4OB2B 2MI6A 3GNGA 3M59A 3CCET 4M78G 1AD5A 4C0DC 2AHJB 4M78E 2DXTA 1JBMA 1K9MC 1HK9A 2VVKA 1N27A 3WVDB 4HT9A 4IUQA 2DBKA 1RACB 1GBQA 2NUZA 3FB9A 1Y07A 4O5VA 2OTLA 2QK0A 3MHXA 1UDLA 1Z9ZA 5I22A 2LT4A 5GMKj 8AT1B 5HK3A 4J9GA 2DD4A 2BE7D 4DEYA 1VQ7Q 4J6WA 2DL5A 4EMKC 1B07A 1GRIA 1WHKA 2CYZB 5IH2A 1Q82U 2O01E 3E19A 2XKOC 2RHUA 2RQWA 1H3ZA 3M0QA 3EG3A 4CC2A 4ME7A 3E9FA 4NL2A 3FLGA 1JJ2P 2FPFA 1FXXA 3OSVA 4F14A 1YHQQ 4PJOB 1BK2A 5C0MA 3OMGA 3OS5A 4A54A 3M58A 3M0PA 3KFVA 1B34B 2GCXA 1UJ0A 4DBFA 3H0IA 2VGNA 4IIOA 3EFRA 4KBMB 2CKKA 2XK0A 5GAOp 3ME9A 3QDFA 3OA6A 2ZCFB 3UWNA 3FJ5A 1YWPA 1WHGA 2ECZA 1XQHA 1NYFA 3V7CA 4XU3A 4M7AB 2RHIA 3G71Q 2QA4A 4M75B 1YJWQ 4JLGA 1FX7A 1I81A 1UGVA 1M1KU 2OX7A 2PZ1A 4AFQC 3CCEQ 3CCUA 2EQIA 2KXDA 1M2VA 3CMAA 2KVQG 3KUFA 2Y90A 4IUUA 2XDPA 3CPWP 4O6JA 3JCMg 3UDCA 4C8QD 2E6ZA 2JUFA 4XK8E 1VQMT 1X43A 3OB9A 1HYOA 1Q86R 3M53A 4NOYA 1UB4A 1OU8A 1PNJA 1NEGA 4RUGA 2WACA 4B6MA 2R5MA 2HMAA 2YRCA 1QVFP 2VGMA 2QAZA 2EQKA 1RLQC 1BCOA 4HT8A 2LMJA 4JJBA 4L59A 2M9UA 2J6KA 3KXTA 4C92D 4M4ZA 4RMOA 1RL2A 3VS7A 4J7FA 4BE1A 2E1HA 2LRQA 4XTUA 1VQ6T 3ER0A 1NJIC 1YP5A 3A1PA 2K4YA 4J9HA 2HQEA 4AMCA 4QW2A 2DF6A 4B9XA 5I2SA 4QQDA 2G3RA 4A63B 1ZSGA 4Z88A 2QEXA 3ZEHA 3CCQT 1UEBA 3NGPA 4MDWA 1X27A 1QVGA 3H6ZA 3CPWS 5GAOm 1JQQA 2I2LA 3VS0A 3C12A 1RUWA 2JMCA 3ZFJA 1YWOA 1M1FA 2XICA 4XTZA 3BY7A 2M0OA 2DD5A 3SEMA 3L2VA 5CO7A 1OPKA 4OMFB 2WSEE 1ZA1B 5CQYA 1EIFA 4EPCA 3VS6A 1OX9A 2W10A 2CSIA 3M0TA 4QQGA 2DX1A 4GLMA 1QVFS 1MGQA 3HRTA 2HCKA 3CCST 2MWOA 3SFMA 3CC7T 4OMMA 4J7IA 2DEUA 1TG0A 1VA7A 3I55T 3JCMX 1YI2A 1UFFA 1VQMQ 4RTTA 2SRCA 2LX7A 3V8JA 3L1AA 4M77D 3A8GB 4A4FA 1ACMB 3VUBA 2B86A 5LJ3j 3C4SA 4BDZA 1W1FA 5EG2A 3MEUA 1Y96A 1HD3A 2RJDA 5DM7R 2OAUA 2QDYB 2DXBA 1FWZA 4L6V5 3JCMe 1JU5C 3M5AA 2ZPGB 4QVCA 3EH1A 2P84A 3M9QA 4KUIA 2LP5A 1O9SA 2YUNA 3GP8A 5C6SA 5KYXA 2DPPB 2HD0A 4C5HA 5IT9E 2C0TA 1BI2A 2R5AA 1HSQA 2QG9B 1WJRA 1VQOA 2COZA 4IURA 3QPHA 1M1GA 1GFCA 2CH4W 1I4K1 3CCQQ 1ZUUA 1KD1C 2VWFA 2C0OA 2DXCA 3VUZA 2DVJA 4JUVA 3SD4A 2FRYA 3V8LA 3OSSC 4IIMA 3FJPA
chains in the Genus database with same CATH topology
4IKFA 4XAXB 4GY5A 2X4JA 3CCMT 2QQRA 5GANh 4C8QF 3M55A 3OQ5A 1XNIA 3S3OA 4HCBA 1M5Q1 2QI2A 1X01A 1PSEA 5CVIA 4N0AA 3CC4T 2DK3A 2KMTA 5GAMd 4BE0A 2PQWA 4ZGDB 3DLMA 2XI9A 3CXCS 4X9CA 4C92A 2FB7A 4M7AF 4BD3A 1Y96B 4M75F 3VYHB 3CCMA 4DQ2A 2Y4XA 3FIFA 3OYJA 1N8RC 4Q5WA 3DKMA 1UGQB 4IUPA 4HCZA 3OYCA 3QJYA 5I2MA 3AHUA 3CC4A 4M77B 4N0AC 3M56A 4ZGJB 4L5GA 3HFOA 1AHJB 3QG1A 2FVUA 5FU6C 5L8RE 3SWNB 3VU3C 5HKCA 5GANg 4M7DB 5GAOn 1YI2T 4M7DE 3A8LB 4A4EA 4ZN1A 2DTOA 2MWPA 2KAFA 2NLUA 3A8MB 3MEWA 4C92C 1VQLT 3L42A 4ZTJA 2DVEA 3LX7A 4M7DG 3URGA 1NE8A 3G7ZA 4LDVA 3A8HB 4J83A 3JB9G 4DA4A 2PU9B 4ATOA 4QVDA 2P4TA 4LDUA 2YLCA 2F5KA 5KH6A 4ZN3A 2GQVA 4XTYA 3CXCA 4JRKA 5D6WA 4FL6A 3PIPA 4OVAA 4PNOA 4RKUE 3OYMA 2EWNA 2XU8A 1VQLA 1K73U 2BIVA 4PJOE 4HKEA 2QQSA 4JS5A 4OF1A 2LT1A 2LNVA 4RCCA 2WSCE 3M54A 1S72T 4M7DD 5IAYA 2YHTA 4M78F 4Y28E 3P8HA 4C0DB 2X4YA 2MF2A 2DAQA 3PGGA 3PMIA 5GAMj 2K2VA 2RK1A 3JCMV 5IN1A 2JOYA 1OI1A 4MZTA 3L2QA 3L2UA 2ZGWA 4E7JA 4MMLA 5GAOr 2QTXA 3Q1JA 3X24B 3NTKA 1LJOA 3OYAA 5GMKe 5CKHA 1H641 4WF2A 1I5LA 4XU0A 3QYHB 3CC2T 2DTHA 3QZ5B 4UC4A 4VUBA 3QUIA 4OB1B 4C5IA 2EAYA 4E7IA 3MP8A 4M77A 3LGLA 1VQ7T 4QVZA 3S6WA 3T9NA 2RA2A 2QQ9A 4M7DA 3SWNA 5LL6S 4N4HA 2DZCA 1U8RA 1M90C 3CCRT 2JNGA 2EJ9A 4F7UB 3NFCA 4F7UE 3QO3A 3DB3A 4M7AG 4M75G 1KG1A 4M7AE 2XHCA 4BY6B 1LOJA 1DJ7B 2L8DA 2RD1A 1BIBA 3JB9H 2RI3A 3OYFA 3CC2A 2YLBA 1X6OA 3A5ZB 1LNXA 1Y7XA 4EMKB 1WPYA 5GAN8 1YHQT 1VQ7A 3QXEB 1GXIE 1Q81C 4YTLA 4M77C 3J80E 3HHTB 3FC3A 2C06A 1WJQA 3OMCA 4M7DC 3SWNC 4MZPA 5A2QE 1VQNA 3PT9A 3CCRA 2MAMA 3JRZA 5LJ3h 4EMGA 1QVPA 4JLIA 2E41A 1XTDA 4BI3A 3OS2A 2VV5A 2XIDA 2RHYA 4FT2A 4BUGA 3G4ST 2XD0A 2EQJA 4DOWA 5A0GA 4CI0C 4IUTA 1TH7A 3TEEA 1ZQ1A 3OW2A 1N8RU 4D6WA 5GAN4 1U1SA 3LLRA 1YIJT 1RI0A 5FU7B 3RMSA 4LD6A 2DO3A 4N4GA 1Q86C 1N6AA 3HP9A 4R55A 2D9TA 1UGPB 5DLOA 1VQPT 4M7AD 2HQXA 2DIGA 5GAN7 4J6XA 3LWIA 3QZ9B 1KQ2A 2R57A 1YBYA 3RMQA 3OYHA 3G4SA 4JJNK 3G71T 1BYMA 1IZ6A 4BE2A 1YJWT 4GLKA 1VQ8T 3MO8A 3OYNA 1M1KC 4LDXA 3O8VA 2LX9A 1G5VA 2QXFA 2F5TX 4OB2B 2GF7A 2MI6A 2EIFA 3GNGA 3MEAA 1YIJA 3GOXA 3M59A 3CCET 4M78G 2XG8D 3FDRA 4BI4A 4IUVA 4C0DC 2AHJB 3META 4M78E 3JCMW 2OTLT 2DXTA 3GF5A 1BI0A 1JBMA 1VQPA 2XDBA 1O75A 3HRUA 2K5LA 3WVEB 3OYEA 1OYXA 3N5BB 1K9MC 1NPRA 2M1HA 1WQWA 3JSCA 1HK9A 4LDYA 2IG0A 4F7UA 3LH0A 3OYBA 3OY9A 1N27A 5FLXE 1NJIU 5GANe 3G71A 5CKFA 1YJWA 1VQ8A 3WVDB 3BFMA 4HT9A 4IUQA 3CEYA 1U1TA 3FB9A 3X25B 2ZPBB 1Y07A 2CS7A 4EMKA 2L89A 4O5VA 1YJNA 5GANf 4XU2A 5CIUA 2LCCA 3CCEA 3CCJA 1N9RA 2OTLA 3S3NA 1UGRB 4ELYC 3MHXA 2ZPEB 5CCAA 2BUDA 4C92F 5GAOl 2EJFA 1Q7YU 2LT4A 3HRSA 3INZA 5GMKj 2EQMA 1W4SA 5HK3A 4M78D 2E6NA 2E10A 2DD4A 4JDSA 3V8KA 4C0FA 3E9GA 3P8DA 4XQ3A 5KE2A 5J26A 4J6WA 5M9OA 4NL3A 4KULA 4EMKC 2V8KA 5CKDA 1VQKT 1Q82U 2CYZB 2EYQA 2K3YA 3QYGB 4A53A 3UPUA 2O01E 1XOVA 3DLLA 3M4YA 5GMKl 3E19A 5GANd 2LVMA 2R58A 2RHUA 2XKOC 5GAN6 3OYIA 1M90U 2A3LA 2D6FA 1H3ZA 2KDSA 3BDLA 3CMET 4J8OA 4ME7A 3X20B 3E9FA 4M7AC 4NL2A 3OS1A 3DB4A 3FLGA 3JB9I 1M8VA 3V7RA 1FXXA 3C95A 3OSVA 3F70A 2X35A 4CRIA 2K5IA 1BI1A 3VYGA 4PJOG 3OYYA 1Q81U 5KCHA 4PJOB 4C5GA 1G3WA 4J6YA 1W2BA 1VQKA 4J5YA 5C0MA 3OMGA 3OS5A 2RM4A 4A54A 4A4HA 3CCVT 3M58A 3HL8A 3H8ZA 1R8OB 2M16A 5LJ5h 3QJ6A 1B34B 4MMKA 1KD1U 2GCXA 3RUXA 2LQKA 3JB9D 2IVWA 3CMEA 2QA4T 2VXEA 2B8AA 2O4XB 3OW2S 3MP1A 4C8QG 1KQSA 4C8QB 3NTIA 2VGNA 3JCMh 3GNFB 2X4XA 3EFRA 3LYIA 4KBMB 2CKKA 4XTVA 4C8QE 1KC8U 1JRIA 2XK0A 2FYKA 4OGEA 3ME9A 5GAOp 3CCUT 3OA6A 2WSFE 2ZCFB 3UWNA 1Q86U 3CMAT 4P5NA 3CCVA 3S3MA 1XQHA 3PFSA 1VQNT 5HK0A 3V7CA 3OS0A 5CQXA 3VV0A 4XU3A 1SSFA 1WJSA 2RHIA 3BW1A 4M7AB 4M75B 2ZPFB 2QA4A 4JLGA 1I81A 1FX7A 3NTHA 4M75E 1K8AC 1M1KU 4PJOD 4ZTFA 5LJ5f 2ZPIB 4C0ZA 1QVFA 3GIBA 4M77F 2VXFA 5LJ5g 3CCUA 1BIAA 3OYGA 2V8IA 2HNIA 4M7DF 4ZGEB 3CMAA 2KVQG 1BKBA 3RIRA 5GAN5 3KUFA 2Y90A 2PUOB 4IUUA 2XDPA 1VQ9A 4O6JA 3JCMg 3UDCA 4C8QD 2E6ZA 2BKDN 5GAMh 4FSXA 3PMTA 2JUFA 4XK8E 4OP0A 3JCMc 4C92G 1VQMT 2A7YA 3CPFA 3OB9A 3ASKA 5GANj 2RJEA 1VQ4T 2GFUA 1KHIA 3M53A 5GAN2 2MMPA 3E1SA 4PLLA 2EQUA 3PIOA 1NPPA 4NOYA 2RHZA 4PLIA 4E47A 3UT1A 2JZ2A 3CBPA 3G6ET 1UB4A 2JVVA 3QSUA 4PJOA 1X75C 1BI3A 3QKJA 4TVRA 5LJ5d 1WQ7A 2WACA 1P92A 3RKYA 2FL7A 2R5MA 4DOVA 2CGHA 4M75D 3FRNA 4Y91A 1B34A 4FM4B 5GAN3 2VGMA 4HCCA 3EAEA 4RG2A 1VQMA 5GMKi 2KSSA 5FRNA 4OB0B 2EQKA 4XU1A 2O4XA 1VQ4A 1QVGS 2JN0A 5LJ3f 4C8QA 4HT8A 3HSBA 4EMHA 1YJNT 2CZ6B 2DIQA 2RJCA 5LJ3g 4MDXA 3EFSA 3KBGA 4L59A 5GAMg 3G6EA 1G3YA 1I8FA 2M9UA 4M78B 4XTXA 2LQ8A 2RI5A 4C92D 3KXTA 3CCJT 4RMOA 1RL2A 2E70A 4MZMA 3JAME 5CKBA 1D3BB 4J7FA 4BE1A 2E1HA 2VYTA 2QEXT 2LRQA 4XTUA 1V29B 1VQ6T 4M7AA 2PUKB 4M75A 3ER0A 1NJIC 2LCLA 4PKCC 1G3SA 2YRVA 5CR2A 3X26B 2HBPA 3P8BB 2K4YA 5AYFA 3TCJA 4C8QC 4JS4A 4RCBA 3GPLA 1N9SA 2LTOA 2HQEA 2D0QB 3VKIA 5LJ3d 1W2BS 5GAOq 4QW2A 2CZ0B 4N4IA 4B9XA 5I2SA 2E12A 2G3RA 3A8OB 4QQDA 1JJ2A 1VQ5T 2KQWA 4F7UF 2L3RA 1JB0E 3MP6A 4BDYA 2QEXA 3JCMP 2H3JA 3ZEHA 1VQ6A 3CCQT 1VIEA 1UGSB 1UEBA 4MDWA 5CK9A 4X9DA 1QVGA 3OBWA 4B9WA 5J3BA 3H6ZA 4M75C 5GAOm 3CPWS 3JB9J 2EKOA 2RB6A 4BY6C 2P0QA 2I2LA 1ZBXA 1VIFA 3RKXA 3SB2A 3M57A 3C12A 4M77G 2JTMA 3ZFJA 2L5QA 4Z02A 4M77E 4QQ6A 1M1FA 4BI8B 4E7LA 5LJ5j 2XICA 1VQ5A 4XTZA 5J39A 3L2RA 3CD6T 1KQ1A 3BY7A 2M0OA 4PL6A 5DY9A 4EDUA 2DD5A 3TU4K 3L2VA 3QDRB 5CO7A 4OMFB 4BB7A 3JCMb 2WSEE 4JRQA 3CCQA 5CQYA 1EIFA 4EPCA 5A0LA 5CAIA 2XDDA 2E65A 5GMKm 2K3XA 1K8AU 2PVGB 1PSFA 4QQGA 3M4GA 1QVFS 1MGQA 1ZHIA 3HRTA 3TREA 3GLXA 3MEVA 4KUDK 5DLQE 4M78A 4II1A 5FU7C 1Y71A 2X4WA 3CCST 2CZ1B 3L2WA 2MWOA 3SFMA 3CC7T 1OZ3A 1YCYA 4J7IA 5HY6A 4OB3B 1M9SA 3C94A 5I21A 4R56A 1D3BA 2F69A 5KE3A 3I55T 3QHSA 3CD6A 3JCMX 1YI2A 3PNWC 1WGSA 3MCAB 3J81E 3X28B 2QQBA 3LW5E 3V8JA 3L1AA 1MHNA 2KK4A 3RKWA 3LGFA 2RO0A 3SDZA 3BDUA 4M77D 1QP2A 4A4GA 5GMKh 3CPWA 1QW1A 2LC4A 3R6OA 3JCMJ 1YJ9T 3A8GB 4A4FA 5FROA 3JCMQ 3CBMA 2DTIA 2RI2A 3L2ZA 2RK2A 4FT4A 3I56T 3CCSA 1HXDA 3VUBA 2GFAA 4M78C 2DKGA 3CC7A 5LJ3j 3C4SA 2V8JA 4C0GA 4BDZA 3J7AF 1IREB 1VQ9T 4HA8A 5EG2A 3I55A 5LJ5e 1Q7YC 2RJFA 2VUBA 1Y96A 3MEUA 2PVDB 5A0DA 2RJDA 5D6YA 1OZ2A 5DM7R 2EFIA 2OAUA 2QDYB 2DXBA 1FWZA 2DZ9A 2ZZDA 4L6V5 2KY9A 2QQAA 5CKEA 3JCMe 1YJ9A 4V2SA 3M5AA 4KT0E 2ZPGB 4A4KA 2LDMA 4QVCA 4JRPA 2OTJT 4RG8A 3ZBDA 3M9QA 1YITT 2K57A 3I56A 3HPWA 3OYLA 2PVOB 4KUIA 3RERA 1QP3A 3JCMf 2JTFA 5FU6B 1KHCA 1Q82C 1VQOT 2EJGA 3QIIA 2P0PA 1O9SA 1K9MU 4FU6A 4C92B 4E7KA 4C92E 3OYKA 4F7UG 3GP8A 1K73C 5C6SA 4NS5A 1VUBA 2DPPB 2VC8A 2ZPHB 4C5EA 5KCOA 2HD0A 4C5HA 3CCLT 5IT9E 3HKSA 2Y4YA 3JB9F 5FRMA 2CZ7B 4E7HA 2OTJA 1YITA 3V7SA 1BI2A 2R5AA 3CBOA 4LD9K 3PTAA 5D6XA 3LWHA 3WXMB 4XTWA 1WJRA 3FEOA 1VQOA 1JJ2S 1M4ZA 4IURA 3QPHA 4BACA 5LJ3e 2E5QA 1M1GA 5GAMe 2HAXA 1I4K1 2DJZA 4OGCA 3JCMd 2RH2A 3OBYA 1KD1C 1NZ9A 1G3TA 1S72A 3CCLA 2FHDA 3QBYA 5GAMf 4JRIA 2RHXA 2DXUA 3VUZA 2DXCA 2P0KA 2E64A 4X34A 2K5FA 1KC8C 3RESA 4PJOF 1KQSS 4ELZC 4FIBA 1YHQA 4JUVA 3SD4A 4PJOC 3V8LA 1WNLA 3VJPA 4LDWA 3HFNA 3OSSC 3FJPA 3OYDA 2DEQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XDB A;  2XDD A;  4RMO A;  4GLK A;  2XD0 A;  4ATO A; 
#chains in the Genus database with same CATH topology
 2XMF A;  1K0X A;  1XNI A;  2AZS A;  4HCK A;  2K79 A;  3CCS Q;  2BTT A;  2KMT A;  3CC7 Q;  1K9A A;  3DLM A;  3I55 Q;  1H3H A;  3EH2 A;  2FB7 A;  4QT7 A;  3VYH B;  3CCM A;  3OYJ A;  1UGQ B;  3OYC A;  3CCU Q;  3CC4 A;  1LCK A;  1WFW A;  4N0A C;  3M56 A;  4ZGJ B;  2MK5 A;  5FU6 C;  5GAN g;  5L8R E;  1YI2 T;  3A8L B;  5KYW A;  2DTO A;  2NLU A;  4C92 C;  3MEW A;  3L42 A;  4CC3 A;  3UF4 A;  2YSQ A;  2LCS A;  3TSW A;  1SHF A;  4LDV A;  3A8H B;  1FMK A;  4DA4 A;  1T0J A;  2YLC A;  2F5K A;  4ZN3 A;  4JRK A;  4OMO A;  1D0X A;  3PIP A;  1V1C A;  1WI7 A;  2EWN A;  4HKE A;  2M51 A;  1EZZ B;  2WSC E;  2K9G A;  1B7T A;  2X4Y A;  2MF2 A;  1AZG B;  5AT1 B;  3PGG A;  3PMI A;  3JCM V;  5IN1 A;  1TU0 B;  1K4U S;  1SRL A;  1MMN A;  1TSF A;  3L2Q A;  3EGD A;  1OEB A;  4OMQ A;  1Q82 R;  1BB9 A;  1H64 1;  4WF2 A;  3CC2 T;  4UC4 A;  3QUI A;  2L0A A;  4E7I A;  2DYI A;  3VS5 A;  4PFO A;  4N4H A;  1U8R A;  2VAS A;  2CSQ A;  4F7U E;  3QO3 A;  1VOM A;  1LOJ A;  3JB9 H;  4E7Z A;  2YLB A;  1X6O A;  3A5Z B;  5GAN 8;  1Y7X A;  1VQ7 A;  4AG2 C;  4M77 C;  2C06 A;  2RMO A;  2CH4 A;  3OMC A;  4M7D C;  3SWN C;  1VQN A;  1BU1 A;  1YFN A;  2NUT A;  4JLI A;  2E41 A;  1ZBJ A;  2VV5 A;  3OS2 A;  2XD0 A;  2DFU A;  5KYY A;  1TS9 A;  4OMP A;  1N8R U;  1NEB A;  1NM7 A;  1Q86 C;  3EG2 A;  3REA B;  1UGP B;  4M7A D;  5GAN 7;  1YI2 Q;  1KQ2 A;  2DL7 A;  1PHT A;  1RAH B;  2CP5 A;  3EHQ A;  4BE2 A;  2DE0 X;  2L2P A;  3O8V A;  2V26 A;  2EIF A;  2XG8 D;  1TWB A;  2E5K A;  1PRM C;  3GF5 A;  1BI0 A;  3OYE A;  4PFZ A;  2M1H A;  4F7U A;  3OY9 A;  5FLX E;  5GAN e;  3G71 A;  5CKF A;  1YJW A;  2FZC B;  3BFM A;  2KI7 A;  3X25 B;  3NMZ C;  3IQL A;  2P4R A;  5CIU A;  2LCC A;  3CCE A;  3CCJ A;  2D0N A;  3S3N A;  4ELY C;  2CRE A;  2BUD A;  2YUQ A;  1QCF A;  2QGG A;  1NBE B;  5GAO l;  1Q7Y U;  5GJW B;  3HRS A;  2EQM A;  1W4S A;  4FCY A;  1X6G A;  2E6N A;  2E10 A;  3H0H A;  2O2O A;  3CC2 Q;  4DEX A;  4C0F A;  1AOJ A;  2ROT A;  4NL3 A;  2V8K A;  1VQK T;  1VQO Q;  2K3Y A;  3UPU A;  1M2V B;  3DLL A;  2L3Q A;  3UA7 A;  2HKQ B;  4J8O A;  2A0F B;  3OS1 A;  2W0Z A;  1BI1 A;  1M2O A;  5KYN A;  4J5Y A;  1A0N B;  2KEA A;  2O9V A;  3HL8 A;  2JT4 A;  5LJ5 h;  1AZE A;  4MMK A;  4F04 B;  2LQK A;  2VXE A;  1KJW A;  1CSK A;  3MP1 A;  4C8Q G;  3PIO A;  1M90 R;  4C8Q E;  1KC8 U;  3RDV A;  5IXF A;  1JRI A;  2LJ1 A;  2KXC A;  3U23 A;  1VQN T;  5HK0 A;  3OS0 A;  3VV0 A;  1G2B A;  1Q81 R;  1SSF A;  1WJS A;  2ZPF B;  1PKT A;  3NTH A;  1ABO A;  1QVF A;  1C0M A;  2HNI A;  4ZGE B;  4LE9 A;  1EFN A;  2RPN A;  2PUO B;  2AIR B;  2KT8 A;  1D1B A;  5GAN j;  1AWO A;  5GAM h;  4C92 G;  4OP0 A;  4KH1 B;  2LJ3 A;  3ASK A;  1UHC A;  2CUB A;  5GAN 2;  3E1S A;  4E47 A;  2RHZ A;  2DA9 A;  1BBZ A;  4E7S A;  1RAF B;  4Y91 A;  4K11 A;  1MUZ A;  2DLP A;  1VQM A;  5FRN A;  2O4X A;  1AWW A;  2DMO A;  5LJ3 f;  2X3W D;  4C8Q A;  1YNZ A;  2F2W A;  2CZ6 B;  1QCO A;  5LJ3 g;  4MDX A;  3KBG A;  1G3Y A;  3CCJ T;  2DET A;  2RI5 A;  1VQK Q;  2E70 A;  3JAM E;  2E4H A;  2VYT A;  4RTW A;  2V1Q A;  2PUK B;  4PKC C;  5CR2 A;  3X26 B;  1FYN A;  3P8B B;  5AYF A;  1OX8 A;  1SRM A;  3A98 A;  2DL4 A;  5GJV B;  5LJ3 d;  2F2X A;  4N4I A;  1VQ5 T;  2E12 A;  2KBT A;  3A8O B;  2GNC A;  3ZL7 C;  4F7U F;  2L3R A;  4BDY A;  1VQ6 A;  1UGS B;  5CK9 A;  4X9D A;  4M7A C;  3JB9 J;  1KQS S;  4M75 C;  1NG2 A;  2RQT A;  2EKO A;  2RB6 A;  1VIF A;  5I11 A;  4M77 G;  1S1N A;  2L5Q A;  4M77 E;  4QQ6 A;  3M0U A;  5LJ5 j;  1VQN Q;  1SPK A;  1WDX A;  3CD6 T;  2GGR A;  3QDR B;  4JRQ A;  3CCQ A;  5KYX B;  5GMK m;  2K3X A;  4KGZ B;  2PVG B;  1PSF A;  1T3L A;  3MEV A;  5DLQ E;  4M78 A;  5FU7 C;  2CZ1 B;  2D1X A;  2HDA A;  1OZ3 A;  2X51 A;  4OB3 B;  4R56 A;  1D3B A;  2VKN A;  4F16 A;  1WGS A;  3MCA B;  2K6D A;  2QQB A;  2KK4 A;  3RKW A;  3I9Q A;  1YJ9 T;  3JCM J;  2MPX C;  2I0N A;  1PCX A;  3M0R A;  2RK2 A;  1RAI B;  3I56 T;  3CCS A;  1I0C A;  2DKG A;  3CC7 A;  1K8A R;  2V8J A;  3J7A F;  1GL5 A;  3I55 A;  1AWX A;  1M3C A;  2RJF A;  2PVD B;  5A0D A;  1R77 A;  5D6Y A;  1MMD A;  2KY9 A;  2QQA A;  1SHG A;  4RTZ A;  4JRP A;  2OTJ T;  3CCJ Q;  3RER A;  2PVO B;  3JCM f;  1Q82 C;  2F2V A;  1PM3 A;  4X1V A;  2P0P A;  3OYK A;  2FZK B;  2HZY A;  1NJI U;  5KCO A;  3CCL T;  1SF9 A;  2CP2 A;  2CZ7 B;  2HSP A;  3CBO A;  3PTA A;  1JJ2 S;  1VQ5 Q;  5LJ3 e;  2E5Q A;  2HAX A;  1PRL C;  4E6R A;  3JCM d;  5KYW B;  3OBY A;  2FRW A;  2EGE A;  2DXU A;  2CUD A;  2E64 A;  2K5F A;  1Q95 G;  1AEY A;  4ELZ C;  2D8J A;  2MYS A;  3VJP A;  2CT3 A;  3HFN A;  3OYD A;  1ZLM A;  4BI8 B;  3EGU A;  3CD6 Q;  4IKF A;  4XAX B;  4GY5 A;  1GCQ C;  4C8Q F;  1RAG B;  3OQ5 A;  1B3Q A;  2DYB A;  2X9H A;  3S3O A;  1D1A A;  1IRX A;  5EC7 A;  1PC0 A;  1E6G A;  2XI9 A;  1N8R R;  2KYB A;  1PG5 B;  1YN8 A;  2Y4X A;  3EGD B;  1YJ9 Q;  1WHL A;  2EKH A;  3QJY A;  2QGF B;  3VS2 A;  3VS1 A;  1QQJ A;  1U5S A;  5GAO n;  1WXT A;  4ZN1 A;  2HBW A;  2KAF A;  3A8M B;  4ZTJ A;  2DVE A;  2KGT A;  3URG A;  1NE8 A;  3G7Z A;  4D8K A;  2OTJ Q;  4E2F B;  1K1Z A;  3JB9 G;  1Y57 A;  1OOT A;  2PU9 B;  4ATO A;  5KH6 A;  2GQV A;  2EVR A;  3CXC A;  5D6W A;  4ORZ A;  2NUT B;  2CP6 A;  3CCL Q;  2QQS A;  5KYY B;  3M54 A;  4M7D D;  1Q7Y R;  4M78 F;  4Y92 A;  2RK1 A;  4J9I A;  2JOY A;  1MMA A;  1OI1 A;  1AT1 B;  2ENM A;  3L2U A;  2ZGW A;  4E7J A;  5GAO r;  2QTX A;  3X24 B;  1JEG A;  3NTK A;  3VRY A;  1RLP C;  2JJ9 A;  3QYH B;  2DTH A;  1NYG A;  3H41 A;  3I35 A;  4VUB A;  1IO6 A;  3MP8 A;  2NUP A;  4OMN A;  3S6W A;  1K73 R;  1WHJ A;  2QQ9 A;  1I5O B;  2M02 A;  1ABQ A;  1M90 C;  1VQ6 Q;  4F7U B;  4KRT A;  3NFC A;  4M7A G;  4M75 G;  1IHW A;  4M7A E;  1KG1 A;  1YCS B;  2L8D A;  2RD1 A;  3CC2 A;  1WPY A;  3QXE B;  1Q81 C;  4J9F A;  2RNA A;  1KC8 R;  3GBQ A;  4F17 A;  1QVP A;  4BI3 A;  1HJD A;  2O88 A;  1WHM A;  4DOW A;  4CI0 C;  4J9B A;  3TEE A;  1ZQ1 A;  4D6W A;  1YIJ T;  4N4G A;  4Z8A A;  1VQP T;  2HQX A;  2FG0 A;  3OYH A;  1BYM A;  1VQ8 T;  1T3S A;  3OYN A;  2LX9 A;  2GF7 A;  2ABL A;  4JZ3 A;  3MEA A;  2LZ6 B;  3GOX A;  4WTO B;  2DM1 A;  3EGX A;  4BI4 A;  1TXQ A;  3FDR A;  4IUV A;  2MOX A;  3MET A;  4PK4 A;  2XDB A;  1TUC A;  3HRU A;  3WVE B;  3OW2 P;  3N5B B;  1NPR A;  1WQW A;  1WIE A;  3JSC A;  1ZSZ C;  2IG0 A;  3LH0 A;  3OYB A;  4WCI A;  2EYW A;  1ARK A;  3CEY A;  1U1T A;  2ZPB B;  3PVL A;  1AWJ A;  4RTU A;  4EMK A;  1YJN A;  5GAN f;  3C0C A;  4DBH A;  2EJF A;  1D0Z A;  3INZ A;  2HQH A;  3EG0 A;  3QWX X;  1KIK A;  2H8H A;  1MND A;  2MIO A;  5ECA A;  4DBQ A;  3V8K A;  3P8D A;  5J26 A;  5M9O A;  4KUL A;  2D8H A;  2KRS A;  2EYQ A;  1XOV A;  1LVK A;  3M4Y A;  4RTX A;  5GMK l;  5GAN d;  3OYI A;  5GAN 6;  2A3L A;  2KDS A;  3CME T;  1WHH A;  1UG1 A;  1M8V A;  3F70 A;  5KCH A;  1VQK A;  4FYX B;  2RM4 A;  1QVG P;  3CCV T;  3TVT A;  1R8O B;  1TOV A;  1TTH B;  2O9S A;  3QJ6 A;  3EG9 A;  3JB9 D;  2IVW A;  2RF0 A;  2O4X B;  3OW2 S;  1F1B B;  1KQS A;  4C8Q B;  3LYI A;  4XTV A;  1YIJ Q;  3BE3 A;  4OGE A;  1N5Z A;  1Q86 U;  1VQP Q;  3PVQ A;  5KYU A;  4AFS C;  2AKK A;  1D1C A;  2KT1 A;  2DRM A;  3BW1 A;  1VQ8 Q;  1W2B P;  1K8A C;  4PJO D;  5LJ5 f;  4C0Z A;  3GIB A;  2VXF A;  5LJ5 g;  1BIA A;  3OYG A;  2V8I A;  1WLP B;  5GAN 5;  1VQ9 A;  4JPB W;  1AVZ C;  2LNH B;  4FSX A;  3PMT A;  3JCM c;  2A7Y A;  2LQN A;  2RJE A;  1VQ4 T;  2MMP A;  4PLL A;  4HVW A;  3RNJ A;  1NPP A;  2NYS A;  3CBP A;  3G6E T;  1QKX A;  2JVV A;  4J9D A;  3QSU A;  1X75 C;  1BI3 A;  4TVR A;  5LJ5 d;  3RKY A;  1P92 A;  1M1K R;  4DOV A;  4M75 D;  2JXB A;  3FRN A;  4FM4 B;  1GCQ A;  2PTK A;  4RG2 A;  5GMK i;  4OB0 B;  1QVG S;  4XU1 A;  1PD0 A;  2JN0 A;  1YJN T;  2DIQ A;  2A37 A;  2RJC A;  3EFS A;  5GAM g;  1I8F A;  4M78 B;  4XTX A;  1NJI R;  1D3B B;  2M0Y A;  1V29 B;  3CME Q;  2LCL A;  1V76 A;  1G3S A;  1PD1 A;  3EG1 A;  2RQR A;  4PJM A;  4JS4 A;  4RCB A;  3GPL A;  2LTO A;  3EHR A;  1W2B S;  1JJ2 A;  2KQW A;  2HL5 C;  2BZX A;  3MP6 A;  3JCM P;  1GCP A;  2EW3 A;  4BY6 C;  2C0I A;  3E2U A;  3RKX A;  2FZG B;  3SB2 A;  3ULR B;  3M57 A;  2DBM A;  1VQ5 A;  3REB B;  5J39 A;  3L2R A;  1KQ1 A;  5DY9 A;  4AFU C;  3TU4 K;  1OUL A;  3JCM b;  4BB7 A;  2OJ2 A;  5CAI A;  5A0L A;  2E65 A;  2A36 A;  3M4G A;  4FYW B;  1Y71 A;  2X4W A;  1ZUY A;  6AT1 B;  4FW1 A;  1M9S A;  5I21 A;  5KE3 A;  3CD6 A;  1UEC A;  3PNW C;  3J81 E;  3X28 B;  1E7O A;  4GBQ A;  3LW5 E;  4A53 A;  3EFO A;  1VQ4 Q;  1JO8 A;  5GMK h;  3CPW A;  1TUD A;  1QW1 A;  3MJX A;  3JCM Q;  3G6E Q;  2RI2 A;  2J06 A;  1HXD A;  2GFA A;  1VQ9 T;  4PJJ A;  5LJ5 e;  1Q7Y C;  2VUB A;  1OZ2 A;  2EFI A;  2ZZD A;  2DZ9 A;  1YJ9 A;  4A4K A;  1YJN Q;  2LDM A;  4RG8 A;  2E3I A;  1YIT T;  3I56 A;  3HPW A;  3OYL A;  1QP3 A;  1K9M U;  3MPU B;  4E7K A;  4C92 E;  1K73 C;  1S72 T;  4C5E A;  4LNP A;  2VC8 A;  2Y4Y A;  5FRM A;  3UAT A;  2OTJ A;  4EIK A;  1UTI A;  5D6X A;  1QMC A;  3WXM B;  4XTW A;  3FEO A;  2QYZ A;  5GAM e;  4OGC A;  2DJZ A;  2FO0 A;  2RH2 A;  3QWY A;  1NZ9 A;  1G3T A;  2LQW A;  3CCL A;  4JRI A;  2RHX A;  2P0K A;  1KC8 C;  4X34 A;  1E6H A;  2JM8 A;  1T0H A;  4PJO C;  1WNL A;  4AG1 C;  4LDW A;  1VYV A;  2DEQ A;  1ZSZ A;  1X2K A;  2BZ8 A;  2X4J A;  1M3A A;  4KH0 B;  4FSS A;  2RN8 A;  4RTY A;  4HCB A;  7AT1 B;  2QI2 A;  3D7S B;  1X01 A;  1PSE A;  5CVI A;  4N0A A;  2HKN A;  1XJW B;  3JV3 A;  4BE0 A;  2PQW A;  4X9C A;  2KRM A;  4C92 A;  1Y96 B;  4HVV A;  4DQ2 A;  2L3P A;  4Q5W A;  4IUP A;  5I2M A;  3AHU A;  2NUP B;  4L5G A;  1VQ9 Q;  5HKC A;  4M7D G;  2FVU A;  4M7D E;  2MWP A;  1VQL T;  2HEQ A;  1M30 A;  3LX7 A;  2JS0 A;  1M8M A;  5FWB A;  1YIT Q;  1KFZ A;  1G83 A;  2P4T A;  4LDU A;  1R0C B;  5HCK A;  4FL6 A;  4OVA A;  4RKU E;  3OYM A;  2QDL A;  2RQV A;  2XU8 A;  4J9E A;  1S72 Q;  2JM9 A;  1ZX6 A;  4JS5 A;  4OF1 A;  2LT1 A;  4RCC A;  5IAY A;  2YHT A;  2EGC A;  4Y28 E;  3P8H A;  4C0D B;  2VB6 A;  2DAQ A;  5GAM j;  2K2V A;  4PJN A;  1KSW A;  4MZT A;  4Z89 A;  1VYT A;  3Q1J A;  3OYA A;  1LJO A;  5CKH A;  1I5L A;  4XU0 A;  3QZ5 B;  2GBQ A;  4LUD A;  4OB1 B;  1QWF A;  4M77 A;  3LGL A;  4QVZ A;  3EGX B;  3T9N A;  4M7D A;  3SWN A;  1IGU A;  5LL6 S;  3CCR T;  2GTJ A;  1RAB B;  3DB3 A;  4J9C A;  2XHC A;  1BIB A;  1IXD A;  1LNX A;  1K0S A;  4EMK B;  2YXY A;  4YTL A;  3J80 E;  2RQU A;  2DL3 A;  2DJQ A;  8ATC B;  1ZUK A;  4MZP A;  3PT9 A;  5LJ3 h;  4EMG A;  2EYY A;  3G4S T;  4BUG A;  1J3T A;  2ZAE A;  5A0G A;  2OI3 A;  3OW2 A;  3LLR A;  2YT6 A;  1MV3 A;  5FU7 B;  2DO3 A;  1K76 A;  1N6A A;  3HP9 A;  4R55 A;  2D9T A;  4AFZ C;  2DIG A;  2NWM A;  1M27 C;  1VQL Q;  3RMQ A;  4JJN K;  1IZ6 A;  4GLK A;  1M1K C;  2ED1 A;  4LDX A;  1G5V A;  2F5T X;  4PJL A;  1YIJ A;  2OTL T;  4KGX B;  3JCM W;  4JZ4 A;  1C6V X;  1VQP A;  1QLY A;  3H9N A;  1OPL A;  4ESR A;  1O75 A;  2K5L A;  1OYX A;  2COW A;  4LDY A;  3EG9 B;  1QCN A;  1VQ8 A;  1WXB A;  2CS7 A;  2L89 A;  3I56 Q;  4XU2 A;  2G6F X;  1N9R A;  1D09 B;  1UGR B;  2ZPE B;  5CCA A;  2Z0W A;  4C92 F;  1GFD A;  1SG5 A;  5KYU B;  2BE9 B;  5L23 A;  1C1A A;  1SEM A;  3NPF A;  2CP0 A;  4M78 D;  4JDS A;  3E9G A;  5KE2 A;  4XQ3 A;  4FYV B;  5CKD A;  3QYG B;  1OU9 A;  4CC4 B;  1QWE A;  2LVM A;  2R58 A;  3CCR Q;  1M90 U;  1LPL A;  2D6F A;  2DRK A;  4LN2 A;  3BDL A;  3X20 B;  3DB4 A;  3JB9 I;  3V7R A;  3C95 A;  2X35 A;  5IHI A;  4CRI A;  2K5I A;  3VYG A;  4ANJ A;  4FW2 A;  3OYY A;  4PJO G;  1Q81 U;  4C5G A;  1G3W A;  2DNU A;  3MKD A;  4J6Y A;  1W2B A;  4PJO E;  2AZV A;  4A4H A;  3THK A;  3H8Z A;  2HSE B;  1X69 A;  2X3X D;  2M16 A;  1MMG A;  1KD1 U;  3RUX A;  5FW9 A;  3G4S Q;  3CME A;  2QA4 T;  2ROL A;  2B8A A;  3NTI A;  3JCM h;  1FMV A;  2X4X A;  3GNF B;  2KYM A;  5D7U A;  1UJY A;  2FYK A;  3CCU T;  2WSF E;  1H92 A;  3CMA T;  4R0K A;  4P5N A;  3CCV A;  3S3M A;  3PFS A;  5CQX A;  4M75 E;  1U06 A;  4ZTF A;  2ZPI B;  4M77 F;  2SEM A;  3I5S A;  2OTL Q;  4M7D F;  1U3O A;  1BKB A;  3RIR A;  2BKD N;  3CPF A;  2QTV A;  2GFU A;  1KHI A;  2FEI A;  1Z9Q A;  2GQI A;  2EQU A;  2MCN A;  4PLI A;  3UT1 A;  2JZ2 A;  4PJO A;  3QKJ A;  1WQ7 A;  2YWW A;  2FL7 A;  2CGH A;  1B34 A;  5GAN 3;  4HCC A;  3EAE A;  2EYX A;  1FMW A;  1W6X A;  2KSS A;  1VQ4 A;  3HSB A;  4EMH A;  5IHN A;  1K9M R;  3G6E A;  2LQ8 A;  4MZM A;  5CKB A;  3RR6 A;  2QEX T;  2A28 A;  2J6O A;  4M7A A;  4M75 A;  1SSH A;  1EX4 A;  3EFO B;  2YRV A;  2HBP A;  1QKW A;  3TCJ A;  4C8Q C;  1N9S A;  2D0Q B;  3VKI A;  9ATC B;  1IHV A;  5GAO q;  2CZ0 B;  4DBR A;  1WXU A;  1JB0 E;  1RAE B;  2H3J A;  1VIE A;  2QA4 Q;  3OBW A;  4B9W A;  3O5Z A;  5J3B A;  2E3H A;  2P0Q A;  1ZBX A;  4PFP A;  4CC7 A;  2V1R A;  2JS2 A;  2F1L A;  2JTM A;  4D8D A;  4Z02 A;  1BCM A;  3CMA Q;  2HL3 A;  1W70 A;  2CT4 A;  4E7L A;  3M0S A;  1OQK A;  4EDU A;  4PL6 A;  1PWT A;  2XDD A;  1OV3 A;  2JW4 A;  1K8A U;  2ED0 A;  2GTO A;  2DIL A;  2KRN A;  1ZHI A;  3TRE A;  3GLX A;  4KUD K;  2DL8 A;  4II1 A;  3SHW A;  3L2W A;  1RI9 A;  1YCY A;  2K3B A;  5HY6 A;  2PNI A;  3C94 A;  2F69 A;  3QHS A;  1WZO A;  2CDT A;  2BZY A;  1MHN A;  2IIM A;  3LGF A;  2RO0 A;  3SDZ A;  3BDU A;  4A4G A;  1QP2 A;  2LC4 A;  3R6O A;  3AT1 B;  3I5R A;  5FRO A;  3CBM A;  4QKU A;  2DTI A;  3L2Z A;  4ZNX A;  4FT4 A;  4M78 C;  2J7I A;  4C0G A;  1IRE B;  2YUO A;  4HA8 A;  2EGA A;  1ZSZ B;  3LH5 A;  4V2S A;  5CKE A;  4KT0 E;  3CXC P;  3ZBD A;  2K57 A;  3PE0 A;  2OAW A;  2JTF A;  5FU6 B;  1KHC A;  1VQO T;  2EJG A;  3QII A;  3HTR A;  4FU6 A;  2QEX Q;  4C92 B;  2KNB B;  4F7U G;  1CKB A;  1JXO A;  4NS5 A;  1VUB A;  2ZPH B;  3HKS A;  3JB9 F;  4E7H A;  1NLP C;  3V7S A;  1YIT A;  1NLO C;  4LD9 K;  1UUE A;  3LWH A;  4HXJ A;  1M4Z A;  1JXM A;  4BAC A;  3CQT A;  2FPD A;  4RTV A;  1WYX A;  1S72 A;  1PKS A;  5IHK A;  2FHD A;  1X2Q A;  3QBY A;  5GAM f;  1MNE A;  1Y0M A;  3RBB B;  3RES A;  4PJO F;  4FIB A;  1YHQ A;  2AT1 B;  4OML A;  1KK7 A;  1IGQ A;  3G1J A;  1RAD B;  1WA7 A;  3CCM T;  2QQR A;  1H8K A;  5GAN h;  3M55 A;  3NHN A;  1UHF A;  1WX6 A;  3VS3 A;  1M5Q 1;  2AK5 A;  2YUP A;  3TSZ A;  1SKU B;  3CC4 T;  2DK3 A;  1IB8 A;  4JJD A;  5GAM d;  2ATC B;  4ZGD B;  3CCV Q;  3CXC S;  4M7A F;  4BD3 A;  2CP7 A;  4M75 F;  3FIF A;  2A08 A;  1N8R C;  3DKM A;  2EYZ A;  4LXC A;  4FYY B;  4HCZ A;  4HVU A;  4JJC A;  4M77 B;  3HFO A;  1AHJ B;  3QG1 A;  3SWN B;  3VU3 C;  4M7D B;  1UE9 A;  2KR3 A;  3VRZ A;  4A4E A;  1VYU A;  3VS4 A;  1TUG B;  1ZA2 B;  4J83 A;  4QVD A;  1M3B A;  3H0F A;  1CKA A;  4XTY A;  2YDL A;  1G8X A;  4PNO A;  3R6N A;  3UA6 A;  1VQL A;  1K73 U;  2BIV A;  1R0B G;  2K7A A;  2LNV A;  1RAA B;  1GBR A;  2H3E B;  2DER A;  3TQ7 P;  5FWC A;  2IPO B;  2KE9 A;  2JTE A;  4MML A;  1I1J A;  5GMK e;  2YRD A;  4LUE A;  2K2M A;  4C5I A;  2EAY A;  1I07 A;  1VQ7 T;  2RA2 A;  4AT1 B;  2DZC A;  2JNG A;  2EJ9 A;  2L3S A;  3CCM Q;  4BY6 B;  1DJ7 B;  2RI3 A;  3OYF A;  1YHQ T;  1GXI E;  3CC4 Q;  1KD1 R;  3HHT B;  3FC3 A;  2EBP A;  2EPD A;  2QAS A;  1WJQ A;  2COY A;  4KGV B;  1KQS P;  5A2Q E;  3CCR A;  2CP3 A;  2FPE A;  2MAM A;  3JRZ A;  2O31 A;  1XTD A;  4FT2 A;  2XID A;  2RHY A;  2EQJ A;  5IXB A;  1D0Y A;  4IUT A;  1TH7 A;  2ESW A;  1X6B A;  2KRO A;  5GAN 4;  1U1S A;  1RI0 A;  3RMS A;  4LD6 A;  2J05 A;  5DLO A;  4J6X A;  2J6F A;  2AKL A;  2JMA A;  3LWI A;  2LJ0 A;  3QZ9 B;  2R57 A;  1YBY A;  3G4S A;  3G71 T;  1YJW T;  3MO8 A;  2QXF A;  1MV0 B;  4OB2 B;  2MI6 A;  3GNG A;  3M59 A;  3CCE T;  4M78 G;  1AD5 A;  4C0D C;  2AHJ B;  4M78 E;  2DXT A;  1JBM A;  1K9M C;  1HK9 A;  2VVK A;  1N27 A;  3WVD B;  4HT9 A;  4IUQ A;  2DBK A;  1RAC B;  1GBQ A;  2NUZ A;  3FB9 A;  1Y07 A;  4O5V A;  2OTL A;  2QK0 A;  3MHX A;  1UDL A;  1Z9Z A;  5I22 A;  2LT4 A;  5GMK j;  8AT1 B;  5HK3 A;  4J9G A;  2DD4 A;  2BE7 D;  4DEY A;  1VQ7 Q;  4J6W A;  2DL5 A;  4EMK C;  1B07 A;  1GRI A;  1WHK A;  2CYZ B;  5IH2 A;  1Q82 U;  2O01 E;  3E19 A;  2XKO C;  2RHU A;  2RQW A;  1H3Z A;  3M0Q A;  3EG3 A;  4CC2 A;  4ME7 A;  3E9F A;  4NL2 A;  3FLG A;  1JJ2 P;  2FPF A;  1FXX A;  3OSV A;  4F14 A;  1YHQ Q;  4PJO B;  1BK2 A;  5C0M A;  3OMG A;  3OS5 A;  4A54 A;  3M58 A;  3M0P A;  3KFV A;  1B34 B;  2GCX A;  1UJ0 A;  4DBF A;  3H0I A;  2VGN A;  4IIO A;  3EFR A;  4KBM B;  2CKK A;  2XK0 A;  5GAO p;  3ME9 A;  3QDF A;  3OA6 A;  2ZCF B;  3UWN A;  3FJ5 A;  1YWP A;  1WHG A;  2ECZ A;  1XQH A;  1NYF A;  3V7C A;  4XU3 A;  4M7A B;  2RHI A;  3G71 Q;  2QA4 A;  4M75 B;  1YJW Q;  4JLG A;  1FX7 A;  1I81 A;  1UGV A;  1M1K U;  2OX7 A;  2PZ1 A;  4AFQ C;  3CCE Q;  3CCU A;  2EQI A;  2KXD A;  1M2V A;  3CMA A;  2KVQ G;  3KUF A;  2Y90 A;  4IUU A;  2XDP A;  3CPW P;  4O6J A;  3JCM g;  3UDC A;  4C8Q D;  2E6Z A;  2JUF A;  4XK8 E;  1VQM T;  1X43 A;  3OB9 A;  1HYO A;  1Q86 R;  3M53 A;  4NOY A;  1UB4 A;  1OU8 A;  1PNJ A;  1NEG A;  4RUG A;  2WAC A;  4B6M A;  2R5M A;  2HMA A;  2YRC A;  1QVF P;  2VGM A;  2QAZ A;  2EQK A;  1RLQ C;  1BCO A;  4HT8 A;  2LMJ A;  4JJB A;  4L59 A;  2M9U A;  2J6K A;  3KXT A;  4C92 D;  4M4Z A;  4RMO A;  1RL2 A;  3VS7 A;  4J7F A;  4BE1 A;  2E1H A;  2LRQ A;  4XTU A;  1VQ6 T;  3ER0 A;  1NJI C;  1YP5 A;  3A1P A;  2K4Y A;  4J9H A;  2HQE A;  4AMC A;  4QW2 A;  2DF6 A;  4B9X A;  5I2S A;  4QQD A;  2G3R A;  4A63 B;  1ZSG A;  4Z88 A;  2QEX A;  3ZEH A;  3CCQ T;  1UEB A;  3NGP A;  4MDW A;  1X27 A;  1QVG A;  3H6Z A;  3CPW S;  5GAO m;  1JQQ A;  2I2L A;  3VS0 A;  3C12 A;  1RUW A;  2JMC A;  3ZFJ A;  1YWO A;  1M1F A;  2XIC A;  4XTZ A;  3BY7 A;  2M0O A;  2DD5 A;  3SEM A;  3L2V A;  5CO7 A;  1OPK A;  4OMF B;  2WSE E;  1ZA1 B;  5CQY A;  1EIF A;  4EPC A;  3VS6 A;  1OX9 A;  2W10 A;  2CSI A;  3M0T A;  4QQG A;  2DX1 A;  4GLM A;  1QVF S;  1MGQ A;  3HRT A;  2HCK A;  3CCS T;  2MWO A;  3SFM A;  3CC7 T;  4OMM A;  4J7I A;  2DEU A;  1TG0 A;  1VA7 A;  3I55 T;  3JCM X;  1YI2 A;  1UFF A;  1VQM Q;  4RTT A;  2SRC A;  2LX7 A;  3V8J A;  3L1A A;  4M77 D;  3A8G B;  4A4F A;  1ACM B;  3VUB A;  2B86 A;  5LJ3 j;  3C4S A;  4BDZ A;  1W1F A;  5EG2 A;  3MEU A;  1Y96 A;  1HD3 A;  2RJD A;  5DM7 R;  2OAU A;  2QDY B;  2DXB A;  1FWZ A;  4L6V 5;  3JCM e;  1JU5 C;  3M5A A;  2ZPG B;  4QVC A;  3EH1 A;  2P84 A;  3M9Q A;  4KUI A;  2LP5 A;  1O9S A;  2YUN A;  3GP8 A;  5C6S A;  5KYX A;  2DPP B;  2HD0 A;  4C5H A;  5IT9 E;  2C0T A;  1BI2 A;  2R5A A;  1HSQ A;  2QG9 B;  1WJR A;  1VQO A;  2COZ A;  4IUR A;  3QPH A;  1M1G A;  1GFC A;  2CH4 W;  1I4K 1;  3CCQ Q;  1ZUU A;  1KD1 C;  2VWF A;  2C0O A;  2DXC A;  3VUZ A;  2DVJ A;  4JUV A;  3SD4 A;  2FRY A;  3V8L A;  3OSS C;  4IIM A;  3FJP A; 
#chains in the Genus database with same CATH homology
 4IKF A;  4XAX B;  4GY5 A;  2X4J A;  3CCM T;  2QQR A;  5GAN h;  4C8Q F;  3M55 A;  3OQ5 A;  1XNI A;  3S3O A;  4HCB A;  1M5Q 1;  2QI2 A;  1X01 A;  1PSE A;  5CVI A;  4N0A A;  3CC4 T;  2DK3 A;  2KMT A;  5GAM d;  4BE0 A;  2PQW A;  4ZGD B;  3DLM A;  2XI9 A;  3CXC S;  4X9C A;  4C92 A;  2FB7 A;  4M7A F;  4BD3 A;  1Y96 B;  4M75 F;  3VYH B;  3CCM A;  4DQ2 A;  2Y4X A;  3FIF A;  3OYJ A;  1N8R C;  4Q5W A;  3DKM A;  1UGQ B;  4IUP A;  4HCZ A;  3OYC A;  3QJY A;  5I2M A;  3AHU A;  3CC4 A;  4M77 B;  4N0A C;  3M56 A;  4ZGJ B;  4L5G A;  3HFO A;  1AHJ B;  3QG1 A;  2FVU A;  5FU6 C;  5L8R E;  3SWN B;  3VU3 C;  5HKC A;  5GAN g;  4M7D B;  5GAO n;  1YI2 T;  4M7D E;  3A8L B;  4A4E A;  4ZN1 A;  2DTO A;  2MWP A;  2KAF A;  2NLU A;  3A8M B;  3MEW A;  4C92 C;  1VQL T;  3L42 A;  4ZTJ A;  2DVE A;  3LX7 A;  4M7D G;  3URG A;  1NE8 A;  3G7Z A;  4LDV A;  3A8H B;  4J83 A;  3JB9 G;  4DA4 A;  2PU9 B;  4ATO A;  4QVD A;  2P4T A;  4LDU A;  2YLC A;  2F5K A;  5KH6 A;  4ZN3 A;  2GQV A;  4XTY A;  3CXC A;  4JRK A;  5D6W A;  4FL6 A;  3PIP A;  4OVA A;  4PNO A;  4RKU E;  3OYM A;  2EWN A;  2XU8 A;  1VQL A;  1K73 U;  2BIV A;  4PJO E;  4HKE A;  2QQS A;  4JS5 A;  4OF1 A;  2LT1 A;  2LNV A;  4RCC A;  2WSC E;  3M54 A;  1S72 T;  4M7D D;  5IAY A;  2YHT A;  4M78 F;  4Y28 E;  3P8H A;  4C0D B;  2X4Y A;  2MF2 A;  2DAQ A;  3PGG A;  3PMI A;  5GAM j;  2K2V A;  2RK1 A;  3JCM V;  5IN1 A;  2JOY A;  1OI1 A;  4MZT A;  3L2Q A;  3L2U A;  2ZGW A;  4E7J A;  4MML A;  5GAO r;  2QTX A;  3Q1J A;  3X24 B;  3NTK A;  1LJO A;  3OYA A;  5GMK e;  5CKH A;  1H64 1;  4WF2 A;  1I5L A;  4XU0 A;  3QYH B;  3CC2 T;  2DTH A;  3QZ5 B;  4UC4 A;  4VUB A;  3QUI A;  4OB1 B;  4C5I A;  2EAY A;  4E7I A;  3MP8 A;  4M77 A;  3LGL A;  1VQ7 T;  4QVZ A;  3S6W A;  3T9N A;  2RA2 A;  2QQ9 A;  4M7D A;  3SWN A;  5LL6 S;  4N4H A;  2DZC A;  1U8R A;  1M90 C;  3CCR T;  2JNG A;  2EJ9 A;  4F7U B;  3NFC A;  4F7U E;  3QO3 A;  3DB3 A;  4M7A G;  4M75 G;  1KG1 A;  4M7A E;  2XHC A;  4BY6 B;  1LOJ A;  1DJ7 B;  2L8D A;  2RD1 A;  1BIB A;  3JB9 H;  2RI3 A;  3OYF A;  3CC2 A;  2YLB A;  1X6O A;  3A5Z B;  1LNX A;  1Y7X A;  4EMK B;  1WPY A;  5GAN 8;  1YHQ T;  1VQ7 A;  3QXE B;  1GXI E;  1Q81 C;  4YTL A;  4M77 C;  3J80 E;  3HHT B;  3FC3 A;  2C06 A;  1WJQ A;  3OMC A;  4M7D C;  3SWN C;  4MZP A;  5A2Q E;  1VQN A;  3PT9 A;  3CCR A;  2MAM A;  3JRZ A;  5LJ3 h;  4EMG A;  1QVP A;  4JLI A;  2E41 A;  1XTD A;  4BI3 A;  3OS2 A;  2VV5 A;  2XID A;  2RHY A;  4FT2 A;  4BUG A;  3G4S T;  2XD0 A;  2EQJ A;  4DOW A;  5A0G A;  4CI0 C;  4IUT A;  1TH7 A;  3TEE A;  1ZQ1 A;  3OW2 A;  1N8R U;  4D6W A;  5GAN 4;  1U1S A;  3LLR A;  1YIJ T;  1RI0 A;  5FU7 B;  3RMS A;  4LD6 A;  2DO3 A;  4N4G A;  1Q86 C;  1N6A A;  3HP9 A;  4R55 A;  2D9T A;  1UGP B;  5DLO A;  1VQP T;  4M7A D;  2HQX A;  2DIG A;  5GAN 7;  4J6X A;  3LWI A;  3QZ9 B;  1KQ2 A;  2R57 A;  1YBY A;  3RMQ A;  3OYH A;  3G4S A;  4JJN K;  3G71 T;  1BYM A;  1IZ6 A;  4BE2 A;  1YJW T;  4GLK A;  1VQ8 T;  3MO8 A;  3OYN A;  1M1K C;  4LDX A;  3O8V A;  2LX9 A;  1G5V A;  2QXF A;  2F5T X;  4OB2 B;  2GF7 A;  2MI6 A;  2EIF A;  3GNG A;  3MEA A;  1YIJ A;  3GOX A;  3M59 A;  3CCE T;  4M78 G;  2XG8 D;  3FDR A;  4BI4 A;  4IUV A;  4C0D C;  2AHJ B;  3MET A;  4M78 E;  3JCM W;  2OTL T;  2DXT A;  3GF5 A;  1BI0 A;  1JBM A;  1VQP A;  2XDB A;  1O75 A;  3HRU A;  2K5L A;  3WVE B;  3OYE A;  1OYX A;  3N5B B;  1K9M C;  1NPR A;  2M1H A;  1WQW A;  3JSC A;  1HK9 A;  4LDY A;  2IG0 A;  4F7U A;  3LH0 A;  3OYB A;  3OY9 A;  1N27 A;  5FLX E;  1NJI U;  5GAN e;  3G71 A;  5CKF A;  1YJW A;  1VQ8 A;  3WVD B;  3BFM A;  4HT9 A;  4IUQ A;  3CEY A;  1U1T A;  3FB9 A;  3X25 B;  2ZPB B;  1Y07 A;  2CS7 A;  4EMK A;  2L89 A;  4O5V A;  1YJN A;  5GAN f;  4XU2 A;  5CIU A;  2LCC A;  3CCE A;  3CCJ A;  1N9R A;  2OTL A;  3S3N A;  1UGR B;  4ELY C;  3MHX A;  2ZPE B;  5CCA A;  2BUD A;  4C92 F;  5GAO l;  2EJF A;  1Q7Y U;  2LT4 A;  3HRS A;  3INZ A;  5GMK j;  2EQM A;  1W4S A;  5HK3 A;  4M78 D;  2E6N A;  2E10 A;  2DD4 A;  4JDS A;  3V8K A;  4C0F A;  3E9G A;  3P8D A;  4XQ3 A;  5KE2 A;  5J26 A;  4J6W A;  5M9O A;  4NL3 A;  4KUL A;  4EMK C;  2V8K A;  5CKD A;  1VQK T;  1Q82 U;  2CYZ B;  2EYQ A;  2K3Y A;  3QYG B;  4A53 A;  3UPU A;  2O01 E;  1XOV A;  3DLL A;  3M4Y A;  5GMK l;  3E19 A;  5GAN d;  2LVM A;  2R58 A;  2RHU A;  2XKO C;  5GAN 6;  3OYI A;  1M90 U;  2A3L A;  2D6F A;  1H3Z A;  2KDS A;  3BDL A;  3CME T;  4J8O A;  4ME7 A;  3X20 B;  3E9F A;  4M7A C;  4NL2 A;  3OS1 A;  3DB4 A;  3FLG A;  3JB9 I;  1M8V A;  3V7R A;  1FXX A;  3C95 A;  3OSV A;  3F70 A;  2X35 A;  4CRI A;  2K5I A;  1BI1 A;  3VYG A;  4PJO G;  3OYY A;  1Q81 U;  5KCH A;  4PJO B;  4C5G A;  1G3W A;  4J6Y A;  1W2B A;  1VQK A;  4J5Y A;  5C0M A;  3OMG A;  3OS5 A;  2RM4 A;  4A54 A;  4A4H A;  3CCV T;  3M58 A;  3HL8 A;  3H8Z A;  1R8O B;  2M16 A;  5LJ5 h;  3QJ6 A;  1B34 B;  4MMK A;  1KD1 U;  2GCX A;  3RUX A;  2LQK A;  3JB9 D;  2IVW A;  3CME A;  2QA4 T;  2VXE A;  2B8A A;  2O4X B;  3OW2 S;  3MP1 A;  4C8Q G;  1KQS A;  4C8Q B;  3NTI A;  2VGN A;  3JCM h;  3GNF B;  2X4X A;  3EFR A;  3LYI A;  4KBM B;  2CKK A;  4XTV A;  4C8Q E;  1KC8 U;  1JRI A;  2XK0 A;  2FYK A;  4OGE A;  3ME9 A;  5GAO p;  3CCU T;  3OA6 A;  2WSF E;  2ZCF B;  3UWN A;  1Q86 U;  3CMA T;  4P5N A;  3CCV A;  3S3M A;  1XQH A;  3PFS A;  1VQN T;  5HK0 A;  3V7C A;  3OS0 A;  5CQX A;  3VV0 A;  4XU3 A;  1SSF A;  1WJS A;  2RHI A;  3BW1 A;  4M7A B;  4M75 B;  2ZPF B;  2QA4 A;  4JLG A;  1I81 A;  1FX7 A;  3NTH A;  4M75 E;  1K8A C;  1M1K U;  4PJO D;  4ZTF A;  5LJ5 f;  2ZPI B;  4C0Z A;  1QVF A;  3GIB A;  4M77 F;  2VXF A;  5LJ5 g;  3CCU A;  1BIA A;  3OYG A;  2V8I A;  2HNI A;  4M7D F;  4ZGE B;  3CMA A;  2KVQ G;  1BKB A;  3RIR A;  5GAN 5;  3KUF A;  2Y90 A;  2PUO B;  4IUU A;  2XDP A;  1VQ9 A;  4O6J A;  3JCM g;  3UDC A;  4C8Q D;  2E6Z A;  2BKD N;  5GAM h;  4FSX A;  3PMT A;  2JUF A;  4XK8 E;  4OP0 A;  3JCM c;  4C92 G;  1VQM T;  2A7Y A;  3CPF A;  3OB9 A;  3ASK A;  5GAN j;  2RJE A;  1VQ4 T;  2GFU A;  1KHI A;  3M53 A;  5GAN 2;  2MMP A;  3E1S A;  4PLL A;  2EQU A;  3PIO A;  1NPP A;  4NOY A;  2RHZ A;  4PLI A;  4E47 A;  3UT1 A;  2JZ2 A;  3CBP A;  3G6E T;  1UB4 A;  2JVV A;  3QSU A;  4PJO A;  1X75 C;  1BI3 A;  3QKJ A;  4TVR A;  5LJ5 d;  1WQ7 A;  2WAC A;  1P92 A;  3RKY A;  2FL7 A;  2R5M A;  4DOV A;  2CGH A;  4M75 D;  3FRN A;  4Y91 A;  1B34 A;  4FM4 B;  5GAN 3;  2VGM A;  4HCC A;  3EAE A;  4RG2 A;  1VQM A;  5GMK i;  2KSS A;  5FRN A;  4OB0 B;  2EQK A;  4XU1 A;  2O4X A;  1VQ4 A;  1QVG S;  2JN0 A;  5LJ3 f;  4C8Q A;  4HT8 A;  3HSB A;  4EMH A;  1YJN T;  2CZ6 B;  2DIQ A;  2RJC A;  5LJ3 g;  4MDX A;  3EFS A;  3KBG A;  4L59 A;  5GAM g;  3G6E A;  1G3Y A;  1I8F A;  2M9U A;  4M78 B;  4XTX A;  2LQ8 A;  2RI5 A;  4C92 D;  3KXT A;  3CCJ T;  4RMO A;  1RL2 A;  2E70 A;  4MZM A;  3JAM E;  5CKB A;  1D3B B;  4J7F A;  4BE1 A;  2E1H A;  2VYT A;  2QEX T;  2LRQ A;  4XTU A;  1V29 B;  1VQ6 T;  4M7A A;  2PUK B;  4M75 A;  3ER0 A;  1NJI C;  2LCL A;  4PKC C;  1G3S A;  2YRV A;  5CR2 A;  3X26 B;  2HBP A;  3P8B B;  2K4Y A;  5AYF A;  3TCJ A;  4C8Q C;  4JS4 A;  4RCB A;  3GPL A;  1N9S A;  2LTO A;  2HQE A;  2D0Q B;  3VKI A;  5LJ3 d;  1W2B S;  5GAO q;  4QW2 A;  2CZ0 B;  4N4I A;  4B9X A;  5I2S A;  2E12 A;  2G3R A;  3A8O B;  4QQD A;  1JJ2 A;  1VQ5 T;  2KQW A;  4F7U F;  2L3R A;  1JB0 E;  3MP6 A;  4BDY A;  2QEX A;  3JCM P;  2H3J A;  3ZEH A;  1VQ6 A;  3CCQ T;  1VIE A;  1UGS B;  1UEB A;  4MDW A;  5CK9 A;  4X9D A;  1QVG A;  3OBW A;  4B9W A;  5J3B A;  3H6Z A;  4M75 C;  5GAO m;  3CPW S;  3JB9 J;  2EKO A;  2RB6 A;  4BY6 C;  2P0Q A;  2I2L A;  1ZBX A;  1VIF A;  3RKX A;  3SB2 A;  3M57 A;  3C12 A;  4M77 G;  2JTM A;  3ZFJ A;  2L5Q A;  4Z02 A;  4M77 E;  4QQ6 A;  1M1F A;  4BI8 B;  4E7L A;  5LJ5 j;  2XIC A;  1VQ5 A;  4XTZ A;  5J39 A;  3L2R A;  3CD6 T;  1KQ1 A;  3BY7 A;  2M0O A;  4PL6 A;  5DY9 A;  4EDU A;  2DD5 A;  3TU4 K;  3L2V A;  3QDR B;  5CO7 A;  4OMF B;  4BB7 A;  3JCM b;  2WSE E;  4JRQ A;  3CCQ A;  5CQY A;  1EIF A;  4EPC A;  5A0L A;  5CAI A;  2XDD A;  2E65 A;  5GMK m;  2K3X A;  1K8A U;  2PVG B;  1PSF A;  4QQG A;  3M4G A;  1QVF S;  1MGQ A;  1ZHI A;  3HRT A;  3TRE A;  3GLX A;  3MEV A;  4KUD K;  5DLQ E;  4M78 A;  4II1 A;  5FU7 C;  1Y71 A;  2X4W A;  3CCS T;  2CZ1 B;  3L2W A;  2MWO A;  3SFM A;  3CC7 T;  1OZ3 A;  1YCY A;  4J7I A;  5HY6 A;  4OB3 B;  1M9S A;  3C94 A;  5I21 A;  4R56 A;  1D3B A;  2F69 A;  5KE3 A;  3I55 T;  3QHS A;  3CD6 A;  3JCM X;  1YI2 A;  3PNW C;  1WGS A;  3MCA B;  3J81 E;  3X28 B;  2QQB A;  3LW5 E;  3V8J A;  3L1A A;  1MHN A;  2KK4 A;  3RKW A;  3LGF A;  2RO0 A;  3SDZ A;  3BDU A;  4M77 D;  1QP2 A;  4A4G A;  5GMK h;  3CPW A;  1QW1 A;  2LC4 A;  3R6O A;  3JCM J;  1YJ9 T;  3A8G B;  4A4F A;  5FRO A;  3JCM Q;  3CBM A;  2DTI A;  2RI2 A;  3L2Z A;  2RK2 A;  4FT4 A;  3I56 T;  3CCS A;  1HXD A;  3VUB A;  2GFA A;  4M78 C;  2DKG A;  3CC7 A;  5LJ3 j;  3C4S A;  2V8J A;  4C0G A;  4BDZ A;  3J7A F;  1IRE B;  1VQ9 T;  4HA8 A;  5EG2 A;  3I55 A;  5LJ5 e;  1Q7Y C;  2RJF A;  2VUB A;  1Y96 A;  3MEU A;  2PVD B;  5A0D A;  2RJD A;  5D6Y A;  1OZ2 A;  5DM7 R;  2EFI A;  2OAU A;  2QDY B;  2DXB A;  1FWZ A;  2DZ9 A;  2ZZD A;  4L6V 5;  2KY9 A;  2QQA A;  5CKE A;  3JCM e;  1YJ9 A;  4V2S A;  3M5A A;  4KT0 E;  2ZPG B;  4A4K A;  2LDM A;  4QVC A;  4JRP A;  2OTJ T;  4RG8 A;  3ZBD A;  3M9Q A;  1YIT T;  2K57 A;  3I56 A;  3HPW A;  3OYL A;  2PVO B;  4KUI A;  3RER A;  1QP3 A;  3JCM f;  2JTF A;  5FU6 B;  1KHC A;  1Q82 C;  1VQO T;  2EJG A;  3QII A;  2P0P A;  1O9S A;  1K9M U;  4FU6 A;  4C92 B;  4E7K A;  4C92 E;  3OYK A;  4F7U G;  3GP8 A;  1K73 C;  5C6S A;  4NS5 A;  1VUB A;  2DPP B;  2VC8 A;  2ZPH B;  4C5E A;  5KCO A;  2HD0 A;  4C5H A;  3CCL T;  5IT9 E;  3HKS A;  2Y4Y A;  3JB9 F;  5FRM A;  2CZ7 B;  4E7H A;  2OTJ A;  1YIT A;  3V7S A;  1BI2 A;  2R5A A;  3CBO A;  4LD9 K;  3PTA A;  5D6X A;  3LWH A;  3WXM B;  4XTW A;  1WJR A;  3FEO A;  1VQO A;  1JJ2 S;  1M4Z A;  4IUR A;  3QPH A;  4BAC A;  5LJ3 e;  2E5Q A;  1M1G A;  5GAM e;  2HAX A;  1I4K 1;  2DJZ A;  4OGC A;  3JCM d;  2RH2 A;  3OBY A;  1KD1 C;  1NZ9 A;  1G3T A;  1S72 A;  3CCL A;  2FHD A;  3QBY A;  5GAM f;  4JRI A;  2RHX A;  2DXU A;  3VUZ A;  2DXC A;  2P0K A;  2E64 A;  4X34 A;  2K5F A;  1KC8 C;  3RES A;  4PJO F;  1KQS S;  4ELZ C;  4FIB A;  1YHQ A;  4JUV A;  3SD4 A;  4PJO C;  3V8L A;  1WNL A;  3VJP A;  4LDW A;  3HFN A;  3OSS C;  3FJP A;  3OYD A;  2DEQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...