4M7AA

Crystal structure of lsm2-8 complex bound to the 3' end sequence of u6 snrna
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
64
structure length
64
Chain Sequence
b'TLKDYLNKRVVIILVDGESLIASLNGFDKNTNLFLTNVFNRISKEFISKAQLLRGSEIALVGLI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U6 snRNA-associated Sm-like protein LSm8
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
total genus 13
structure length 64
sequence length 64
chains with identical sequence H
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m7aA00
3AHUA 2EJGA 4M77A 4EMKA 4M77C 4EMKC 1LNXA 4M7DA 4M7DC 4PJOD 2DEQA 4C8QD 2E1HA 4NOYA 2DTOA 4XTUA 5GAOq 2VC8A 2RM4A 4PJOF 2CGHA 4NL2A 4OP0A 4C8QF 5GMKm 3BFMA 2EJ9A 4XQ3A 4EMGA 4RCCA 4J6YA 4JUVA 3JCMJ 1I4K1 2Y90A 4M7AB 5GAMe 4F7UG 3JCMh 5GAN6 3JCMW 2E64A 4M7DF 4M77D 3RKYA 4M7AE 3INZA 1LJOA 3BDUA 3PGGA 5LJ3e 2DTIA 2DZCA 4M7DD 5GAMj 5DY9A 2EJFA 4M77F 4HT8A 3QSUA 5CAIA 1YCYA 3SWNA 4QVCA 1JBMA 4XU3A 2DKGA 3SWNC 4X9CA 5LJ3j 5GMKl 5LJ5f 4Y91A 4C8QB 4NL3A 5GAN2 4PJOB 1WQ7A 4PJOE 4XU2A 4C8QE 4A53A 3BY7A 5GMKe 1LOJA 5GANj 4M78G 5LJ5d 3RKXA 1Y96B 3FIFA 1B34B 5GMKi 3BW1A 3RIRA 5GMKj 4J5YA 3JCMg 1HXDA 1BIBA 2EAYA 4M77B 4EMKB 4M7DB 4M77E 2RA2A 3EFRA 4XU0A 4J6WA 3JB9D 1KQ2A 4M7DE 3QUIA 3VU3C 5GAN7 3JB9H 3JCMX 5GAMf 3JB9F 4JLIA 2QTXA 3FJPA 4C92D 3M4GA 4M75F 2ZGWA 4MMLA 5GAN3 3HFNA 4F7UA 5LJ3f 4C92F 2DXTA 5GAMh 2DTHA 1JRIA 1D3BA 3HFOA 1BIAA 4XU1A 5GAOp 5GAMd 1WPYA 4X9DA 3HSBA 4XTZA 3RKWA 3JB9I 3V8LA 5GANf 2HNIA 5LJ3d 3V8JA 3EFSA 4M7DG 4M75A 3JCMQ 3SWNB 4M75C 3L1AA 4DQ2A 3JCMc 2YHTA 4WF2A 4C92A 5LJ5h 5GANh 4C92C 1WQWA 2DZ9A 4M78A 5GANd 4M78C 2DVEA 5GAOl 4M7AG 3V7SA 1MGQA 4C92B 2I2LA 2VXEA 4HT9A 2JN0A 4F7UF 4QVDA 2RD1A 1I5LA 3JCMe 3L2ZA 3RUXA 2E65A 1HK9A 1X01A 3V7CA 5GAN8 4M75D 2DXUA 4PJOG 4RCBA 4C8QG 4V2SA 3QHSA 1N9SA 4PNOA 1I8FA 4M78D 5GAOr 1M8VA 5GAOm 3RERA 2VXFA 4MMKA 2EWNA 4M78F 3RESA 4JRIA 3JCMV 5LJ3h 4F7UB 2YLCA 1D3BB 4M77G 3FB9A 4HA8A 1TH7A 2RB6A 4XTYA 5GAN5 4M75B 1WNLA 4EMHA 5GMKh 1N9RA 2FB7A 4M75E 1U1SA 2YLBA 1I81A 4A54A 4XTWA 4M7AA 4M7AC 3QO3A 3JCMf 4C92E 4M78B 4J6XA 1H641 2FYKA 3V7RA 5GAMg 3GIBA 1U1TA 4M78E 4N0AA 4N0AC 3JCMP 2E10A 5LJ3g 1M5Q1 5GAN4 3JCMd 3JB9J 5GAOn 4PJOA 2E41A 4C8QA 4PJOC 4C8QC 4XTXA 3JCMb 2K57A 4JRKA 3SB2A 5LJ5g 5GANg 4XTVA 3V8KA 3JB9G 4M75G 5GANe 5I21A 5LJ5e 4M7AD 2DJZA 1Y96A 4C92G 1B34A 4M7AF 1KQ1A 4F7UE 5LJ5j
chains in the Genus database with same CATH superfamily
2DJQA 3G4SQ 3L2QA 1G3TA 1WLPB 3UDCA 4XTUA 3PIOA 1RI0A 2VC8A 4M4ZA 4C8QF 1W70A 1QVGP 3M0RA 1VQKA 1YITT 4BE0A 3E9GA 2PNIA 4KUDK 1OQKA 2IIMA 3TQ7P 3OB9A 1Q82R 1BCOA 3RMQA 5LJ3j 1WDXA 1GXIE 3A8MB 4BDZA 3UA7A 5GANj 1OU9A 1I1JA 1Y96B 3OYLA 4E6RA 1HXDA 2P0QA 3G6ET 1KD1U 1K4US 2COYA 3MP1A 4C92D 1VQPT 4M75F 4CRIA 1HD3A 5GAMh 1B7TA 3HFOA 1OOTA 2ZPBB 3JB9I 4CC2A 5J39A 4QT7A 3CPWA 4J9GA 1YJ9T 4OB3B 4B9XA 2YHTA 3EGXB 3DLLA 1MUZA 2DVEA 4M7AG 1AOJA 3V7SA 2VXEA 1AZGB 3CBOA 5D6WA 5KYUA 1X75C 2RHUA 3MEUA 2HKQB 1NLPC 3PTAA 1Y07A 1G2BA 4PNOA 1Q81C 2HMAA 3RERA 2LC4A 3FDRA 2EGCA 4C0GA 5DLOA 2LJ0A 2F1LA 1JU5C 4LD9K 3HHTB 1PKTA 4EPCA 3CCEQ 3CCQT 1Y0MA 1JXMA 3NGPA 3LWHA 1JXOA 1GCQA 4LUDA 4FL6A 4OVAA 2AT1B 4J7FA 1VIEA 1AWWA 5KCHA 4RG2A 3RNJA 4FW2A 1IHVA 1NJIC 2V1QA 1MMDA 3LGLA 3OSSC 2KNBB 2DLPA 2DBKA 4KGZB 2HL3A 2E1HA 2CT4A 2RM4A 1RADB 2P84A 3MCAB 4KGXB 1IREB 2JT4A 1Q7YR 1IRXA 1YHQT 2KRSA 1LJOA 3I35A 3HP9A 5CQYA 1PD0A 3SWNA 3P8HA 5LJ5f 1TU0B 5KYXB 2OX7A 4PFPA 3O5ZA 1KHCA 2CREA 1PKSA 1BI3A 3EFOA 3RIRA 1BB9A 5A0GA 2COWA 1YJNQ 2L3SA 1TXQA 3MEVA 2BIVA 3LH5A 4ZN1A 3CCMT 4FYWB 2DRKA 2PU9B 2V8JA 1WHJA 3WXMB 4DQ2A 1HSQA 4C92C 4F17A 2NLUA 4M78A 3CC7Q 2OTJQ 1SSFA 3VS1A 1YNZA 4X1VA 1T0JA 3ASKA 2DXUA 4N4HA 4IIOA 1VQ4T 1VA7A 5KH6A 5FU6C 3ZFJA 2ZPFB 3OSVA 2K9GA 4JRIA 2RI5A 1Y71A 2IPOB 5KCOA 1WGSA 2VGNA 5FU7C 1S72T 2EW3A 4Y92A 3OYNA 2K3BA 4MDXA 1AEYA 4XTYA 1NEBA 2FB7A 4J9DA 1UJ0A 4XTWA 4E7JA 4A63B 3V7RA 1H641 2LP5A 1J3TA 4JZ4A 1PSFA 2J7IA 2LNHB 5GAN4 3CCLA 2NUZA 4XTVA 4LDYA 1AHJB 2ESWA 3MKDA 3G71Q 4F04B 5LJ5j 4M77C 4KULA 1K8AR 1N6AA 3ZEHA 2C0TA 2HBWA 4O6JA 1KD1C 4ZGDB 4EMGA 2D6FA 4ZN3A 3UT1A 4K11A 5ECAA 5GAN6 1BI1A 5CVIA 2AKLA 2P0KA 2XDPA 2DTIA 3REAB 5CAIA 2K2MA 3TCJA 1ZA1B 1SPKA 4ZGEB 1VYUA 2E6ZA 2QEXA 4M78G 2NUPA 3RKXA 2LNVA 1ZUYA 1M1KC 2RQRA 3VU3C 3G7ZA 3QXEB 2XDDA 2M02A 1BIAA 3LLRA 4BI3A 3IQLA 2W10A 4FSXA 3VUZA 4N4IA 2YRDA 4BY6C 2EGAA 1SF9A 2AK5A 4RTWA 1UFFA 1YITQ 1PD1A 2E65A 2MF2A 4B9WA 4OGCA 1AT1B 2SEMA 4E7HA 1WYXA 3M56A 3BDLA 1M8VA 1BBZA 2F69A 4J7IA 3VS6A 3OYMA 2RJEA 3CMET 3LH0A 3C4SA 1N27A 2KY9A 3RMSA 1JEGA 1SHFA 3EHRA 3G4ST 1FX7A 2LCCA 3OQ5A 1E7OA 3CCVT 3THKA 3EG2A 3QKJA 3GOXA 2E41A 2MK5A 4E2FB 2K57A 1JB0E 4IKFA 3H8ZA 3CXCA 3A8HB 1VQ7A 4C92G 3A8OB 1UGRB 3CXCS 3MP6A 2KK4A 4BI4A 4EDUA 1GRIA 2PVDB 1KQSA 4C8QD 3OYYA 1YWPA 1KQSS 4OMNA 2M1HA 1NYGA 2ZCFB 2RNAA 4VUBA 3JCMW 2RK1A 2QTVA 2E64A 2H3JA 1Q82C 3BDUA 2K3YA 1RABB 2EJFA 4M77F 2EYZA 5GMKl 4C8QE 3BY7A 5CKBA 1K8AU 3CCQQ 2JMCA 2H3EB 4J5YA 1BIBA 1U3OA 1KQ2A 1PRLC 2EYYA 1TSFA 1GL5A 2YUPA 1M9SA 4QQGA 3HFNA 5CQXA 2RF0A 2KROA 2Y4XA 4XU1A 2BE7D 3UA6A 5GAMd 1PSEA 2DL8A 3V8LA 1RAAB 3CD6T 4IUUA 5GJWB 2X4XA 3EFSA 2E6NA 4B6MA 3OYFA 1TG0A 2DZ9A 3OYGA 1YIJA 1U8RA 1UHFA 2LCLA 3WVEB 5EC7A 1VQ8A 4PKCC 4QVDA 2XIDA 3ER0A 1YHQQ 3CCET 2KGTA 2BKDN 2QQ9A 3M0UA 5DM7R 2KAFA 2QQRA 1VQLA 2FRYA 1YI2A 2DMOA 2QG9B 1Y57A 3CMAQ 3C95A 1TH7A 2JTMA 4FCYA 1MMNA 5IH2A 2DX1A 4JJCA 3H9NA 1M5Q1 3UATA 4PJOC 3CCRA 2XK0A 2RMOA 2DIQA 5I21A 3OS5A 5FRNA 1C0MA 2QYZA 4EMKA 4Z89A 1Y7XA 3AHUA 3I9QA 4HVUA 1ZSZB 4OMMA 1F1BB 3OW2A 1Q7YC 3F70A 2E5QA 4TVRA 3OW2S 4D8DA 3VKIA 1VQ6T 2EKOA 2CDTA 1CSKA 4M7AB 3ZL7C 5GAMe 3LWIA 1OV3A 3INZA 1YJNT 5FW9A 4JJBA 3TVTA 4QVCA 2HL5C 2OTLA 4C0DC 5GAN2 2VWFA 3EGUA 4J8OA 2PUOB 2DNUA 4XAXB 3FC3A 2HQHA 1LOJA 2HD0A 3JCMg 4HXJA 1AWJA 1FMKA 2BTTA 4L59A 2CSIA 1GFCA 3CC7T 2OTJT 4WCIA 1IB8A 2DFUA 2HSPA 2XKOC 1XNIA 4PL6A 1ACMB 5AT1B 2DL3A 1BKBA 1WFWA 2LRQA 4BB7A 4M75C 3L1AA 5J3BA 3CPFA 2I2LA 2CP3A 2C0IA 1K73R 2EYWA 1X6GA 2P4RA 1HK9A 4O5VA 1UE9A 1VUBA 4V2SA 2FRWA 2FZKB 2PZ1A 4C0ZA 2G6FX 1YN8A 1XOVA 3M5AA 1TWBA 1VIFA 1OYXA 3CCUQ 1RAFB 1V76A 4FSSA 1RAIB 3H6ZA 3LX7A 1I81A 4RTYA 1VQMA 1BCMA 1YP5A 2KDSA 3Q1JA 4JRPA 5KYUB 1QW1A 3JB9J 4GBQA 4C8QA 2X9HA 3WVDB 1Q95G 2JNGA 2YRCA 1B34A 1K8AC 2FPEA 2GTOA 4FT2A 4IURA 5A0DA 2QEXQ 4M7DC 3EAEA 4PJOF 4OP0A 1M8MA 1YJWT 1QVPA 3E9FA 2B8AA 1XJWB 2KYMA 1QLYA 1IGUA 1FYNA 5HY6A 2RH2A 4Y28E 3CEYA 1QQJA 2D8JA 2MOXA 3MJXA 4PJNA 2K79A 3KUFA 4AFSC 1ZUUA 1KHIA 3M9QA 1VQNA 2KXCA 5GMKe 1W1FA 3CCJA 2VVKA 3GNGA 1UGQB 1EZZB 1VQ9Q 1N8RR 3CCVQ 1WI7A 1G83A 3MP8A 3JB9H 4QKUA 2ZGWA 5GAN3 1CKBA 1QWFA 2DRMA 1VQ5A 3FLGA 3M0SA 4MZMA 1OU8A 3G6EA 3TU4K 2HBPA 3EG1A 2CZ0B 2K2VA 1MMGA 4UC4A 3SWNB 4X34A 2CP0A 3JAME 4WF2A 1VQPA 1M90U 3BE3A 2BZXA 1IZ6A 4F7UF 2MWPA 3EFOB 1UGVA 1QCOA 1YJ9A 4C8QG 2FHDA 2E12A 1HYOA 5GAOm 3QDRB 2EWNA 2JUFA 1WHGA 2JTFA 4DBQA 1PC0A 2E5KA 2DF6A 1X43A 2GQVA 2QQBA 2QK0A 1NLOC 3CPWS 5I2MA 4JS4A 1VQ7Q 2A0FB 2YRVA 1OX9A 2HSEB 2YLBA 1K73U 2QGGA 2CZ1B 4C92E 4M78B 1D0ZA 3G1JA 2ENMA 2ECZA 1AZEA 2JS0A 3CD6Q 4LDUA 4M75G 1K9MR 2L0AA 5A0LA 1KQ1A 3VRZA 2O9VA 3U23A 2CZ6B 3PVQA 5GJVB 1X6OA 2M9UA 9ATCB 2A7YA 2J6FA 1UJYA 2PTKA 4M77D 3FEOA 3QYHB 2DZCA 2PVOB 2LTOA 2NWMA 1WXBA 4M7DF 3CC2Q 3PT9A 1YCSB 1D09B 4Y91A 2AZVA 3CCSA 2X4WA 2KYBA 2QA4Q 3REBB 4DEYA 3TEEA 4M77E 2RA2A 4J83A 4JJDA 2CYZB 4PJJA 2JJ9A 2QTXA 3M4GA 4JZ3A 2DTHA 2CP7A 4Z88A 3HSBA 5C6SA 1XTDA 3HPWA 1NE8A 3VUBA 4M7DG 3JCMQ 3DKMA 4OMOA 4HCKA 3I55A 2DYIA 3M4YA 3CMAT 1IHWA 2RHIA 4C92B 1N8RU 2VGMA 2PQWA 3CCMA 2NUPB 3ME9A 1VQ6Q 2KRMA 5DLQE 2QQSA 4C5EA 2ABLA 2MWOA 1SRLA 1FMVA 2RN8A 5I2SA 3QZ5B 1ABOA 4MMKA 1G5VA 3RR6A 1KSWA 3JRZA 3I56A 2L2PA 1N9RA 5GMKh 1OPLA 4CC7A 2OI3A 1GBQA 4KRTA 1RACB 1WHMA 1WA7A 2CH4W 1M3CA 4J9EA 3H41A 4CC4B 2HEQA 3V8KA 5GANe 1Q86R 2DXCA 4DOWA 2EQKA 4OMPA 1M2VA 1JJ2P 2CSQA 1U06A 3I5RA 1WHKA 1PHTA 3X20B 2VYTA 5GAOq 2X3XD 3AT1B 2DAQA 5FLXE 1W6XA 4PJLA 3JCMJ 1W2BP 2DL4A 1NPPA 3KFVA 2ZPIB 2LT1A 1K9MU 2FG0A 4RTVA 4A53A 3M57A 1S1NA 4HCBA 3OMCA 2O88A 1NEGA 2DE0X 2RI2A 3D7SB 3PFSA 2V8IA 4XU0A 1KC8R 5GAMf 3JB9F 1TOVA 2EKHA 2AHJB 2CH4A 2MIOA 1JRIA 4GLKA 1WPYA 2IVWA 2FEIA 2ZPGB 3V8JA 3VV0A 1WJQA 2QGFB 4HVVA 3SEMA 4C92A 1WHLA 1SG5A 3N5BB 3CCLT 3CCUT 2RO0A 1YJWQ 1K76A 1K73C 4BY6B 2R57A 2A28A 1ZHIA 4LDXA 1UB4A 2RQUA 3QJYA 2COZA 1VQMQ 2VV5A 1H3ZA 1KFZA 2JOYA 1AWXA 2DBMA 2ROLA 3S3MA 3QBYA 2YDLA 3OBYA 2YLCA 2LJ1A 2K5FA 3NFCA 3HRSA 2RB6A 5GAN5 2QEXT 1E6GA 5IN1A 2RQTA 3M58A 5LJ3g 2ED0A 2DD4A 1QCFA 4N4GA 1O9SA 3JCMd 5GAOn 1QVGA 3OA6A 3EGDB 5GANg 2DO3A 4J9FA 3G4SA 1QVGS 4M77A 4E7IA 3JSCA 3CC4A 1VQNQ 4PJOD 1SRMA 4NOYA 2L3QA 3OYBA 3BFMA 4RCCA 1KG1A 3C0CA 1VQ9T 2RJDA 1D0YA 5GAMj 4C0FA 1WXUA 1ZBJA 2E3IA 1VQKQ 1G3SA 2Y4YA 1Q86U 4X9CA 2E70A 3EH2A 1M1GA 3HL8A 3OY9A 4PJOE 4RTTA 2HKNA 1TS9A 4AFQC 3VS3A 1N8RC 3E2UA 1BI2A 4EMKB 4IUQA 2PVGB 3PIPA 1UGSB 5CCAA 4RTUA 3L2WA 5HKCA 2RHZA 5IHNA 2DA9A 2O31A 2LX9A 2LCSA 5GANh 5KYYA 2HAXA 1RAGB 5GAOl 2XU8A 1MGQA 2MAMA 2O2OA 2JN0A 1VQ7T 3JCMe 5KYWA 2CT3A 1KC8U 4M75D 4D6WA 2M0OA 4LDWA 3JCMV 1WJSA 4NS5A 3CCEA 2FVUA 4FU6A 1NJIR 4M77G 2X3WD 1TUCA 1VYVA 1AVZC 2X35A 4ZTJA 3S3OA 3R6OA 4M75E 1I5OB 1BI0A 1RLQC 1WZOA 3LW5E 3DB4A 3I5SA 2JZ2A 1RL2A 4N0AC 2P0PA 3EGDA 3HKSA 3GNFB 1SEMA 4OF1A 4ME7A 3JCMb 1K9MC 1R0BG 4KUIA 1ZQ1A 3UWNA 5CK9A 3CC2T 2EYQA 4DBFA 2DEQA 1Z9ZA 2K3XA 2QASA 2QA4T 4ESRA 4AG1C 1I4K1 2JM8A 2CKKA 1A0NB 1PM3A 3PGGA 4QW2A 4M7DD 5CKEA 1QCNA 1WIEA 4AG2C 3UPUA 2R5MA 1M3BA 2LQWA 1VOMA 3URGA 2KT1A 4C8QB 5IXFA 1WQ7A 4CC3A 4DA4A 2ZPHB 2K7AA 2EQMA 3PMIA 1B34B 2YXYA 5GMKj 2KE9A 3A8LB 4RG8A 1H8KA 2BUDA 1VQLT 1YI2T 2CUBA 4M7DE 2SRCA 5GAN7 4JJNK 1MNEA 2P4TA 3EG3A 2GTJA 1K9AA 3QG1A 2DXTA 3QWYA 1D3BA 4MZTA 1V29B 4XTZA 3CC7A 2OTJA 2AIRB 3O8VA 3CBMA 3TSWA 4FT4A 3TREA 1M90R 2EQUA 1GCPA 2D8HA 1JJ2A 4HCCA 3OYEA 3X25B 1MHNA 4II1A 2GQIA 1KK7A 4A4HA 1OX8A 2O4XA 2LQKA 5AYFA 1R0CB 5CKHA 3EG9A 3JV3A 1ZSZC 4IUVA 1VQOA 1ZA2B 1Z9QA 4A54A 4E7ZA 4M7AC 2FYKA 2WSFE 3PVLA 2K6DA 3QIIA 4PJOA 2HZYA 3G71A 2OAWA 1G3WA 1Q86C 4KBMB 1EX4A 1NJIU 4E47A 1MNDA 6AT1B 4J9IA 1GBRA 2F2VA 2J6KA 3CCLQ 2GFAA 2X4YA 2XG8D 3GP8A 2F5TX 4RKUE 1RAHB 2Y90A 3JCMh 3VYGA 1X6BA 2R58A 4BI8B 3HRTA 1QP3A 2BZ8A 5IAYA 1YCYA 2C06A 1R8OB 4NL3A 4XU2A 4IUPA 2RHXA 1UTIA 1MV3A 2RK2A 2FL7A 4MDWA 4C5HA 1KC8C 2RQWA 3JB9D 2GGRA 5L8RE 4C5GA 2XD0A 2L89A 3GLXA 4BUGA 2A08A 4F7UA 1VQMT 3S3NA 2HNIA 4J9HA 3QPHA 2LJ3A 4M75A 2G3RA 2GF7A 5CKFA 1I0CA 4FYYB 1YITA 2KSSA 2JM9A 1UDLA 2I0NA 4HVWA 4JDSA 4HT9A 4JS5A 1I5LA 3M0PA 1K0SA 3E1SA 2A37A 2VKNA 3OS2A 1UEBA 4PJOG 2F5KA 2VXFA 2L3RA 1D0XA 1W4SA 2DEUA 2CZ7B 3FB9A 2KT8A 2JMAA 4A4EA 1ABQA 2FZGB 3FJ5A 1OZ2A 2KR3A 3QO3A 4CI0C 1VQNT 3CC4Q 4ATOA 5CIUA 4RTXA 1GCQC 4KGVB 1UUEA 3CCJT 2NUTB 2H8HA 1X27A 2EVRA 4XTXA 1M2OA 5KE3A 1K1ZA 4JPBW 4LUEA 1YBYA 2DM1A 1VQKT 2DERA 4M7AF 1TUGB 1UG1A 4OB2B 4M7DA 1VQ5T 2IG0A 5FROA 5GMKm 1UHCA 3J80E 4J6YA 2M0YA 4F7UG 3CXCP 5CKDA 2DK3A 3VS4A 3GF5A 2EQJA 3SWNC 1WX6A 3CCQA 1UGPB 1FXXA 1KQSP 3P8BB 1IO6A 4Q5WA 1OEBA 1X2QA 2QI2A 2HQXA 3BW1A 5IHIA 1M1KU 1M2VB 2FO0A 1PG5B 4HCZA 1H3HA 4PK4A 4OMLA 3OYHA 4GLMA 2HCKA 3T9NA 2RQVA 3MPUB 4AMCA 5LJ3d 2KVQG 3QZ9B 3JCMc 2B86A 4F16A 1YHQA 1M1FA 4AT1B 4C5IA 5GANd 2LT4A 4M78C 2F2XA 2A3LA 3RUXA 3L2RA 1YIJQ 1X01A 2DETA 3KBGA 1G3YA 1VQ8Q 5FWCA 3MEWA 2AKKA 3NPFA 3CMAA 3META 2K5IA 2C0OA 2MMPA 1NYFA 1QKWA 4PLIA 1I07A 2CP5A 3TSZA 3VJPA 5I22A 4HA8A 2DPPB 1QP2A 3A5ZB 1FMWA 3L42A 1VQLQ 2YWWA 3C12A 3EG0A 1SSHA 1YI2Q 4FIBA 3SDZA 3VS5A 1TUDA 1AWOA 3JCMf 4J6XA 3CCST 3GIBA 2NUTA 1PRMC 2W0ZA 1C1AA 2OJ2A 3DB3A 4KH0B 3JCMP 4R0KA 4RMOA 3NHNA 2CP2A 3M0QA 3OS1A 3OYCA 1Y96A 5FU6B 3CCRQ 2DILA 2QDYB 2XHCA 1KJWA 2D0NA 4LD6A 1VQ4A 5FU7B 4LNPA 3LYIA 5FWBA 3QWXX 3UF4A 1WHHA 2DL5A 4BDYA 3VYHB 3I55T 1O75A 3RKYA 1OPKA 1NG2A 1S72A 5LJ3e 1Q82U 4KT0E 3A8GB 2M16A 3KXTA 2DKGA 3EGXA 3GBQA 3OW2P 2OTLQ 3NMZC 1OULA 4PLLA 4A4GA 2EQIA 4M77B 5HK3A 5A2QE 1ZUKA 4ELYC 4OMFB 1LCKA 1MV0B 2RHYA 2KEAA 1BYMA 2JW4A 1ZLMA 3DLMA 5IHKA 3CBPA 3EH1A 3VS2A 4MMLA 5CR2A 3I56T 2YT6A 2A36A 1RLPC 3RKWA 2ZZDA 2R5AA 4DOVA 3X28B 1EFNA 5LL6S 1T3SA 4DBRA 2X4JA 1M90C 3J7AF 2L8DA 1XQHA 1EIFA 1IGQA 4GY5A 3HRUA 2RD1A 1VQOQ 3V7CA 1LPLA 4RCBA 5I11A 1LVKA 1MMAA 2D0QB 1I8FA 3CCUA 2LVMA 2XMFA 4M78F 3RESA 2ROTA 4L6V5 2KBTA 5KE2A 1PCXA 1QWEA 4R56A 3ZBDA 4EMHA 5KYYB 1U1SA 2Z0WA 1RAEB 2XDBA 3M55A 1U1TA 2VB6A 2YSQA 1B07A 2XI9A 5J26A 5KYWB 1ZSGA 4ORZA 5KYXA 4E7SA 3JB9G 2GCXA 2YUQA 3X24B 4BE1A 2DJZA 2BE9B 2GFUA 3M0TA 5HCKA 5IXBA 3NTIA 3ULRB 2KRNA 3MHXA 4FYXB 3H0HA 2CGHA 4NL2A 1Q7YU 2VUBA 4J9BA 3X26B 2V1RA 1M27C 3CMEA 3J81E 3A1PA 1N5ZA 5DY9A 1JBMA 2M51A 3FRNA 1QKXA 2BZYA 3VS0A 4LDVA 4BE2A 1VQ9A 1YWOA 2RI3A 3CCVA 1WXTA 5LJ5d 2WACA 2WSEE 3FIFA 5GMKi 4E7LA 3HTRA 2E4HA 2EAYA 5D7UA 4LXCA 3EFRA 4J6WA 3CCJQ 3QUIA 2GBQA 3JCMX 5D6XA 4JLIA 3R6NA 1QVFP 4C92F 2FPDA 5EG2A 2L5QA 1ZBXA 2RPNA 3OBWA 1T0HA 3VRYA 2O01E 1VQ5Q 3PE0A 4LE9A 3G6EQ 3RBBB 3OYJA 1YFNA 3SHWA 1M4ZA 2LDMA 1VQPQ 1WJRA 2JVVA 1NZ9A 2J6OA 3SD4A 3CC4T 3QHSA 4Z8AA 1C6VX 1D1CA 3OMGA 2GNCA 1Q81R 1YJ9Q 3M59A 3L2VA 2KQWA 4JLGA 2MCNA 5LJ3h 4PFOA 1D3BB 1VYTA 2CUDA 1HJDA 2RJFA 1B3QA 2YUNA 1WNLA 3H0FA 1PWTA 3C94A 3RDVA 3CD6A 4MZPA 2LX7A 5CO7A 4XK8E 1KIKA 5KYNA 3CPWP 3LGFA 4JRKA 2DIGA 2F2WA 3SB2A 5LJ5e 1GFDA 3A98A 4M7AD 2DL7A 2EGEA 2O4XB 7AT1B 4L5GA 2QAZA 4F7UE 1FWZA 2EJGA 4EMKC 1LNXA 1UECA 3EG9B 2DTOA 4F14A 2EJ9A 3M54A 4XQ3A 2K4YA 2QQAA 4JUVA 2YUOA 3CC2A 3SFMA 4E7KA 1RI9A 4M7AE 2HDAA 2J06A 4Z02A 4HT8A 1TTHB 3QSUA 4XU3A 2LZ6B 2PUKB 4JRQA 4PFZA 4PJOB 2RJCA 2QA4A 3QDFA 3EHQA 2MI6A 4IIMA 3MEAA 2LQNA 4WTOB 4BACA 1PNJA 1V1CA 4IUTA 4OB0B 2FZCB 3CCSQ 1D1BA 2LMJA 4BD3A 1NBEB 2K5LA 4OMQA 4ZGJB 1YIJT 4YTLA 1VQ8T 2HQEA 2V26A 4X9DA 2DD5A 1ARKA 1T3LA 3OYDA 4OGEA 1M30A 4C0DB 1H92A 1VQ6A 1K0XA 2DXBA 1YJNA 4OB1B 3I55Q 4ELZC 2AZSA 4HKEA 4FW1A 3CCMQ 4EIKA 5HK0A 4R55A 2JTEA 2KI7A 3OS0A 4F7UB 4AFUC 3OYKA 3CQTA 4M75B 3CCRT 2JXBA 2V8KA 2KXDA 1VQ4Q 3OYIA 1JJ2S 4N0AA 3I56Q 1RUWA 2ATCB 2VASA 1D1AA 1ZX6A 1BU1A 2D9TA 2NYSA 5IT9E 2EIFA 4C8QC 1Q81U 5LJ5g 2D1XA 1W2BA 1DJ7B 3S6WA 2CP6A 1S72Q 1W2BS 2LQ8A 5D6YA 3OYAA 3E19A 4QVZA 3PNWC 5FRMA 1OZ3A 2MPXC 2OTLT 3H0IA 2X51A 3GPLA 1KD1R 4J9CA 4D8KA 4PJMA 2JS2A 2OAUA 1JQQA 1X69A 3QYGB 3P8DA 1QMCA 5L23A 2J05A 4DEXA 4ANJA 1U5SA 1CKAA 4RUGA 1SHGA 1M1KR 4M7DB 2XICA 4DBHA 1R77A 3FJPA 1VQOT 4P5NA 3NTHA 5LJ3f 5GAOp 4QQ6A 4FM4B 3L2UA 5GANf 4LN2A 1YJWA 4KH1B 3M53A 5LJ5h 1SKUB 1OI1A 2ZPEB 3G71T 4QQDA 1WQWA 8AT1B 1X2KA 2DYBA 2EBPA 2O9SA 3NTKA 3L2ZA 2E3HA 2QXFA 8ATCB 5GAN8 1NM7A 1N9SA 4ZNXA 2ZAEA 1BK2A 4M78D 5GAOr 2EFIA 1IXDA 2CS7A 2EPDA 4FYVB 1ZSZA 1NPRA 2FPFA 2DVJA 4AFZC 5M9OA 1E6HA 1G8XA 1M3AA 4M7AA 2EYXA 2WSCE 5GAMg 4RTZA 4M78E 2ED1A 2E10A 2QDLA 1JO8A 3MO8A 2KMTA 1AD5A 5C0MA 3PMTA 4ZTFA 2L3PA 2MYSA 3CMEQ 4A4FA 1QVFA 3QJ6A 1P92A 3VS7A 1QVFS 4A4KA
chains in the Genus database with same CATH topology
3AHUA 4M77A 4EMKA 1Y7XA 2QDYB 2XHCA 4LD6A 3JSCA 3L2QA 4E7IA 1VQ4A 3CC4A 1G3TA 4PJOD 4NOYA 4XTUA 5FU7B 3UDCA 1RI0A 2VC8A 3PIOA 3OYBA 3F70A 3LYIA 4C8QF 3OW2A 2E5QA 1Q7YC 3BFMA 4TVRA 3OW2S 4RCCA 1KG1A 4BDYA 1VQKA 3VKIA 1VQ9T 1YITT 1VQ6T 3VYHB 4BE0A 2EKOA 3E9GA 2RJDA 4M7AB 5GAMe 3I55T 3LWIA 4KUDK 1O75A 3RKYA 3INZA 1Q82U 1YJNT 1S72A 5LJ3e 3OB9A 5GAMj 4C0FA 4KT0E 1G3SA 3A8GB 2M16A 2Y4YA 4QVCA 3KXTA 2DKGA 3RMQA 4X9CA 5LJ3j 4C0DC 2E70A 1Q86U 2OTLA 5GAN2 4J8OA 1M1GA 3HL8A 3OY9A 4PJOE 1GXIE 2PUOB 3A8MB 3FC3A 4XAXB 4BDZA 1LOJA 5GANj 2HD0A 1Y96B 3OYLA 1N8RC 3JCMg 1HXDA 4PLLA 1BI2A 4A4GA 4M77B 4EMKB 5HK3A 5A2QE 2P0QA 3G6ET 4IUQA 4ELYC 4OMFB 2PVGB 4L59A 3PIPA 1KD1U 3CC7T 2RHYA 2OTJT 1BYMA 1UGSB 3DLMA 3MP1A 3CBPA 4C92D 1VQPT 4M75F 4CRIA 2XKOC 1XNIA 4MMLA 4PL6A 5CCAA 5CR2A 3I56T 5GAMh 3L2WA 3HFOA 5HKCA 2RHZA 1BKBA 2ZPBB 2LRQA 3RKWA 2ZZDA 5J39A 2R5AA 3JB9I 2LX9A 4DOVA 4BB7A 3X28B 3CPWA 1YJ9T 4M75C 4OB3B 5LL6S 4B9XA 3L1AA 5GANh 2YHTA 2X4JA 3DLLA 1M90C 2HAXA 5J3BA 3J7AF 2DVEA 3CPFA 5GAOl 4M7AG 2L8DA 2XU8A 1MGQA 3V7SA 1XQHA 2VXEA 2I2LA 1EIFA 2JN0A 2MAMA 3HRUA 3CBOA 4GY5A 2RD1A 5D6WA 3JCMe 1VQ7T 1X75C 2RHUA 3MEUA 1HK9A 4O5VA 1KC8U 3V7CA 4M75D 4RCBA 3PTAA 1Y07A 1VUBA 2D0QB 2M0OA 4D6WA 4V2SA 4PNOA 1Q81C 1I8FA 3CCUA 3RERA 4M7AE 2LVMA 4LDWA 2LC4A 4C0ZA 3FDRA 4M78F 1XOVA 3RESA 3JCMV 1WJSA 3M5AA 4NS5A 4C0GA 1VIFA 5DLOA 2FVUA 1OYXA 4FU6A 3CCEA 4M77G 4L6V5 5KE2A 4LD9K 2X35A 3HHTB 4ZTJA 4R56A 3S3OA 3R6OA 3H6ZA 3ZBDA 4EPCA 3LX7A 4EMHA 3CCQT 4M75E 1U1SA 1BI0A 1I81A 1VQMA 3LW5E 3LWHA 3DB4A 2XDBA 3M55A 1U1TA 2JZ2A 1RL2A 4N0AC 2KDSA 2XI9A 3Q1JA 5J26A 4JRPA 2P0PA 4FL6A 1QW1A 3HKSA 4OVAA 3JB9J 3GNFB 4C8QA 4J7FA 4OF1A 1VIEA 4ME7A 3JCMb 1VQ7A 3WVDB 3JB9G 5KCHA 1K9MC 2GCXA 4RG2A 3X24B 4KUIA 4BE1A 1NJIC 1ZQ1A 2JNGA 2DJZA 3UWNA 2GFUA 5CK9A 1B34A 1K8AC 3CC2T 3LGLA 3OSSC 2EYQA 4FT2A 4IURA 5A0DA 4M7DC 2DEQA 2E1HA 3EAEA 3NTIA 3MHXA 2K3XA 2RM4A 2CGHA 4NL2A 4OP0A 4PJOF 2VUBA 1Q7YU 3MCAB 1QVPA 1YJWT 1IREB 3E9FA 3X26B 2QA4T 2B8AA 5HY6A 2RH2A 1YHQT 4Y28E 1I4K1 2CKKA 3CMEA 3J81E 3CEYA 1LJOA 3PGGA 4QW2A 3HP9A 4M7DD 5CKEA 5CQYA 5DY9A 3SWNA 3UPUA 2R5MA 1JBMA 3P8HA 3URGA 5LJ5f 3FRNA 3KUFA 4C8QB 1KHIA 1WQ7A 3M9QA 1VQNA 4LDVA 4BE2A 4DA4A 2ZPHB 1VQ9A 2RI3A 5GMKe 1KHCA 3CCVA 2EQMA 3PMIA 5LJ5d 2WACA 2WSEE 3FIFA 1B34B 1BI3A 5GMKi 3RIRA 3CCJA 5GMKj 4E7LA 5A0GA 3A8LB 1UGQB 3GNGA 2BUDA 2EAYA 4RG8A 1VQLT 1YI2T 3EFRA 4J6WA 4M7DE 3QUIA 4JJNK 5GAN7 3MP8A 3JB9H 3JCMX 2P4TA 5D6XA 4JLIA 3MEVA 2ZGWA 2BIVA 5GAN3 3QG1A 4C92F 2DXTA 1VQ5A 1D3BA 5EG2A 3FLGA 4ZN1A 2L5QA 1ZBXA 4MZTA 3CCMT 4MZMA 3OBWA 1V29B 4XTZA 3G6EA 3TU4K 2PU9B 2HBPA 2O01E 2CZ0B 2K2VA 3CC7A 2OTJA 4UC4A 3O8VA 2V8JA 3CBMA 4X34A 3SWNB 3WXMB 4DQ2A 3JAME 4FT4A 4WF2A 1VQPA 4C92C 1M90U 3TREA 2NLUA 4M78A 3OYJA 2EQUA 1IZ6A 1SSFA 4F7UF 1JJ2A 1M4ZA 2MWPA 2LDMA 4HCCA 3OYEA 3X25B 1WJRA 2JVVA 1NZ9A 1YJ9A 1MHNA 3ASKA 2DXUA 4II1A 4N4HA 3SD4A 4C8QG 3CC4T 2FHDA 3QHSA 2E12A 1VQ4T 4A4HA 2O4XA 3OMGA 5KH6A 5GAOm 2LQKA 5AYFA 3QDRB 5FU6C 2ZPFB 2EWNA 3OSVA 2JUFA 5CKHA 3M59A 3ZFJA 4JRIA 3L2VA 2KQWA 2RI5A 1Y71A 2JTFA 4JLGA 5LJ3h 1WGSA 5KCOA 1D3BB 2GQVA 2QQBA 2VGNA 5FU7C 3CPWS 5I2MA 1S72T 2RJFA 4IUVA 4JS4A 3OYNA 1VQOA 4MDXA 4XTYA 1WNLA 2YRVA 2FB7A 2YLBA 4A54A 4XTWA 1K73U 4M7AC 2CZ1B 4E7JA 4C92E 4M78B 3V7RA 1H641 2FYKA 3C94A 2WSFE 3CD6A 1PSFA 4MZPA 5CO7A 4XK8E 5GAN4 3QIIA 4PJOA 3G71A 3LGFA 1G3WA 2DIGA 4JRKA 3SB2A 3CCLA 1Q86C 4KBMB 4XTVA 4LDUA 4LDYA 4M75G 5LJ5e 1AHJB 4M7AD 1NJIU 4E47A 2O4XB 4L5GA 5A0LA 1KQ1A 4F7UE 5LJ5j 1FWZA 2EJGA 4M77C 4KULA 1LNXA 4EMKC 2GFAA 1N6AA 2X4YA 2CZ6B 3ZEHA 2DTOA 2XG8D 1X6OA 4O6JA 1KD1C 2M9UA 4ZGDB 3GP8A 2EJ9A 3M54A 2F5TX 4RKUE 4XQ3A 2K4YA 3UT1A 4EMGA 4ZN3A 2D6FA 2A7YA 2QQAA 4JUVA 3CC2A 2Y90A 5GAN6 3JCMh 3VYGA 3SFMA 4M77D 1BI1A 4E7KA 3FEOA 3QYHB 2XDPA 2P0KA 5CVIA 2DTIA 2DZCA 2R58A 1QP3A 3HRTA 4BI8B 2PVOB 4Z02A 4HT8A 2LTOA 5IAYA 5CAIA 3QSUA 1YCYA 3TCJA 3PT9A 4XU3A 1R8OB 2PUKB 2C06A 4JRQA 4M7DF 4PJOB 4Y91A 4NL3A 4ZGEB 2RJCA 2QA4A 2E6ZA 2QEXA 4XU2A 3CCSA 2MI6A 3MEAA 2X4WA 4M78G 4IUPA 4BACA 2RHXA 4IUTA 3RKXA 2LNVA 4OB0B 1M1KC 2RK2A 3TEEA 2FL7A 4MDWA 4M77E 2RA2A 4C5HA 1KC8C 4J83A 3JB9D 2CYZB 3G7ZA 3VU3C 5L8RE 4BD3A 2K5LA 3QXEB 4C5GA 4ZGJB 2XD0A 2QTXA 2L89A 3GLXA 3M4GA 2XDDA 4BUGA 1YIJT 4F7UA 4YTLA 2DTHA 1VQ8T 2HQEA 1BIAA 1VQMT 3S3NA 4X9DA 3HSBA 3LLRA 2DD5A 4BI3A 5C6SA 1XTDA 3HPWA 2HNIA 1NE8A 3QPHA 3VUBA 3OYDA 4FSXA 4M75A 3VUZA 2G3RA 3DKMA 4OGEA 2GF7A 3JCMQ 5CKFA 4C0DB 1YITA 1VQ6A 4N4IA 3I55A 4BY6C 2KSSA 3M4YA 2DXBA 3CMAT 1YJNA 2RHIA 4C92B 4HT9A 4JDSA 1N8RU 2VGMA 2PQWA 3CCMA 4JS5A 1I5LA 3ME9A 4OB1B 4ELZC 5DLQE 2E65A 2MF2A 2QQSA 3E1SA 4B9WA 4OGCA 4C5EA 4HKEA 3OS2A 1UEBA 4PJOG 4E7HA 2MWOA 3M56A 2F5KA 3BDLA 5HK0A 4R55A 1M8VA 5I2SA 2VXFA 3QZ5B 4MMKA 1G5VA 2F69A 2L3RA 4J7IA 3OS0A 4F7UB 1W4SA 2CZ7B 3OYMA 2RJEA 3CMET 1U8RA 3FB9A 3LH0A 3C4SA 3OYKA 1N27A 2KY9A 3RMSA 4A4EA 3JRZA 4M75B 3CCRT 3I56A 5GMKh 1N9RA 3G4ST 1OZ2A 1FX7A 2LCCA 3OQ5A 3QO3A 4CI0C 2V8KA 1VQNT 4ATOA 5CIUA 3OYIA 1JJ2S 4N0AA 3CCVT 3CCJT 3QKJA 3GOXA 2D9TA 5IT9E 2E41A 2EIFA 4C8QC 4XTXA 2K57A 1Q81U 1JB0E 5KE3A 5LJ5g 4IKFA 3V8KA 1W2BA 1DJ7B 5GANe 3H8ZA 3CXCA 3S6WA 3A8HB 2DXCA 4DOWA 2LQ8A 5D6YA 1W2BS 4C92G 3A8OB 1UGRB 1YBYA 2EQKA 3MP6A 3CXCS 1VQKT 4M7AF 2KK4A 4BI4A 4EDUA 3OYAA 3E19A 2PVDB 4OB2B 3PNWC 4QVZA 1VQ5T 2IG0A 1OZ3A 1KQSA 5FRMA 4M7DA 3X20B 4C8QD 5FROA 3OYYA 1KQSS 2VYTA 5GAOq 2OTLT 5GMKm 2M1HA 2DAQA 2ZCFB 3J80E 5FLXE 3GPLA 4J6YA 3JCMJ 4VUBA 3JCMW 2OAUA 2RK1A 4F7UG 2E64A 2H3JA 1Q82C 3BDUA 2K3YA 1NPPA 2DK3A 5CKDA 2EJFA 2EQJA 3GF5A 4M77F 2ZPIB 3SWNC 3QYGB 1UGPB 2LT1A 3CCQA 5GMKl 1K9MU 1FXXA 3P8DA 3P8BB 4C8QE 4A53A 3BY7A 4Q5WA 5CKBA 3M57A 1K8AU 4HCBA 3OMCA 2QI2A 2RI2A 2HQXA 3BW1A 4J5YA 3PFSA 1M1KU 1BIBA 2V8IA 4M7DB 2XICA 4XU0A 1KQ2A 4HCZA 5GAMf 3JB9F 1VQOT 3FJPA 1M9SA 4QQGA 3OYHA 2AHJB 3HFNA 4P5NA 3NTHA 5CQXA 5LJ3f 2Y4XA 1JRIA 4GLKA 4XU1A 5GAOp 4QQ6A 4FM4B 5GAMd 1WPYA 2IVWA 3L2UA 1PSEA 3V8LA 3T9NA 5GANf 3CD6T 2ZPGB 4IUUA 5LJ3d 3V8JA 3VV0A 2X4XA 3EFSA 1YJWA 3M53A 2KVQG 3QZ9B 2E6NA 1WJQA 5LJ5h 3JCMc 1YHQA 1OI1A 4C92A 3OYFA 2ZPEB 3G71T 4QQDA 1M1FA 4C5IA 1WQWA 2DZ9A 3N5BB 3OYGA 5GANd 3CCLT 3CCUT 2LT4A 2RO0A 4M78C 1YIJA 2LCLA 3WVEB 1K73C 4BY6B 1VQ8A 2R57A 4PKCC 4QVDA 2XIDA 3ER0A 1ZHIA 4LDXA 2A3LA 3L2ZA 3NTKA 1UB4A 3RUXA 3L2RA 3CCET 2QXFA 1X01A 2BKDN 5GAN8 3QJYA 3KBGA 1G3YA 2QQ9A 4M7DG 2VV5A 3MEWA 1N9SA 1H3ZA 5DM7R 4M78D 3CMAA 2JOYA 2K5IA 2EFIA 2KAFA 3META 5GAOr 2MMPA 2QQRA 3S3MA 4PLIA 3QBYA 2CS7A 1VQLA 3OBYA 2YLCA 3VJPA 1YI2A 2K5FA 3NFCA 4HA8A 2DPPB 3C95A 1TH7A 1QP2A 1NPRA 3A5ZB 3HRSA 3L42A 2JTMA 3C12A 2RB6A 5M9OA 5GAN5 4FIBA 3SDZA 4M7AA 2WSCE 3JCMf 2QEXT 5IN1A 4J6XA 5GAMg 3CCST 3GIBA 4M78E 3DB3A 3M58A 3JCMP 2E10A 5LJ3g 4RMOA 1M5Q1 4N4GA 2DD4A 1O9SA 3MO8A 3JCMd 5GAOn 2KMTA 4PJOC 1QVGA 3OA6A 5C0MA 2XK0A 3PMTA 3CCRA 4ZTFA 5GANg 3G4SA 2DO3A 1QVGS 2DIQA 5I21A 4A4FA 3OS5A 3OS1A 3OYCA 1QVFA 3QJ6A 1Y96A 1P92A 1QVFS 5FU6B 5FRNA 4A4KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AHU A;  2EJG A;  4M77 A;  4EMK A;  4M77 C;  4EMK C;  1LNX A;  4M7D A;  4M7D C;  4PJO D;  2DEQ A;  4C8Q D;  2E1H A;  4NOY A;  2DTO A;  4XTU A;  5GAO q;  2VC8 A;  2RM4 A;  4PJO F;  2CGH A;  4NL2 A;  4OP0 A;  4C8Q F;  5GMK m;  3BFM A;  2EJ9 A;  4XQ3 A;  4EMG A;  4RCC A;  4J6Y A;  4JUV A;  3JCM J;  1I4K 1;  2Y90 A;  4M7A B;  5GAM e;  4F7U G;  3JCM h;  5GAN 6;  3JCM W;  2E64 A;  4M7D F;  4M77 D;  3RKY A;  4M7A E;  3INZ A;  1LJO A;  3BDU A;  3PGG A;  5LJ3 e;  2DTI A;  2DZC A;  4M7D D;  5GAM j;  5DY9 A;  2EJF A;  4M77 F;  4HT8 A;  3QSU A;  5CAI A;  1YCY A;  3SWN A;  4QVC A;  1JBM A;  4XU3 A;  2DKG A;  3SWN C;  4X9C A;  5LJ3 j;  5GMK l;  5LJ5 f;  4Y91 A;  4C8Q B;  4NL3 A;  5GAN 2;  4PJO B;  1WQ7 A;  4PJO E;  4XU2 A;  4C8Q E;  4A53 A;  3BY7 A;  5GMK e;  1LOJ A;  5GAN j;  4M78 G;  5LJ5 d;  3RKX A;  1Y96 B;  3FIF A;  1B34 B;  5GMK i;  3BW1 A;  3RIR A;  5GMK j;  4J5Y A;  3JCM g;  1HXD A;  1BIB A;  2EAY A;  4M77 B;  4EMK B;  4M7D B;  4M77 E;  2RA2 A;  3EFR A;  4XU0 A;  4J6W A;  3JB9 D;  1KQ2 A;  4M7D E;  3QUI A;  3VU3 C;  5GAN 7;  3JB9 H;  3JCM X;  5GAM f;  3JB9 F;  4JLI A;  2QTX A;  3FJP A;  4C92 D;  3M4G A;  4M75 F;  2ZGW A;  4MML A;  5GAN 3;  3HFN A;  4F7U A;  5LJ3 f;  4C92 F;  2DXT A;  5GAM h;  2DTH A;  1JRI A;  1D3B A;  3HFO A;  1BIA A;  4XU1 A;  5GAO p;  5GAM d;  1WPY A;  4X9D A;  3HSB A;  4XTZ A;  3RKW A;  3JB9 I;  3V8L A;  5GAN f;  2HNI A;  5LJ3 d;  3V8J A;  3EFS A;  4M7D G;  4M75 A;  3JCM Q;  3SWN B;  4M75 C;  3L1A A;  4DQ2 A;  3JCM c;  2YHT A;  4WF2 A;  4C92 A;  5LJ5 h;  5GAN h;  4C92 C;  1WQW A;  2DZ9 A;  4M78 A;  5GAN d;  4M78 C;  2DVE A;  5GAO l;  4M7A G;  3V7S A;  1MGQ A;  4C92 B;  2I2L A;  2VXE A;  4HT9 A;  2JN0 A;  4F7U F;  4QVD A;  2RD1 A;  1I5L A;  3JCM e;  3L2Z A;  3RUX A;  2E65 A;  1HK9 A;  1X01 A;  3V7C A;  5GAN 8;  4M75 D;  2DXU A;  4PJO G;  4RCB A;  4C8Q G;  4V2S A;  3QHS A;  1N9S A;  4PNO A;  1I8F A;  4M78 D;  5GAO r;  1M8V A;  5GAO m;  3RER A;  2VXF A;  4MMK A;  2EWN A;  4M78 F;  3RES A;  4JRI A;  3JCM V;  5LJ3 h;  4F7U B;  2YLC A;  1D3B B;  4M77 G;  3FB9 A;  4HA8 A;  1TH7 A;  2RB6 A;  4XTY A;  5GAN 5;  4M75 B;  1WNL A;  4EMH A;  5GMK h;  1N9R A;  2FB7 A;  4M75 E;  1U1S A;  2YLB A;  1I81 A;  4A54 A;  4XTW A;  4M7A A;  4M7A C;  3QO3 A;  3JCM f;  4C92 E;  4M78 B;  4J6X A;  1H64 1;  2FYK A;  3V7R A;  5GAM g;  3GIB A;  1U1T A;  4M78 E;  4N0A A;  4N0A C;  3JCM P;  2E10 A;  5LJ3 g;  1M5Q 1;  5GAN 4;  3JCM d;  3JB9 J;  5GAO n;  4PJO A;  2E41 A;  4C8Q A;  4PJO C;  4C8Q C;  4XTX A;  3JCM b;  2K57 A;  4JRK A;  3SB2 A;  5LJ5 g;  5GAN g;  4XTV A;  3V8K A;  3JB9 G;  4M75 G;  5GAN e;  5I21 A;  5LJ5 e;  4M7A D;  2DJZ A;  1Y96 A;  4C92 G;  1B34 A;  4M7A F;  1KQ1 A;  4F7U E;  5LJ5 j; 
#chains in the Genus database with same CATH topology
 2DJQ A;  3G4S Q;  3L2Q A;  1G3T A;  1WLP B;  3UDC A;  4XTU A;  3PIO A;  1RI0 A;  2VC8 A;  4M4Z A;  4C8Q F;  1W70 A;  1QVG P;  3M0R A;  1VQK A;  1YIT T;  4BE0 A;  3E9G A;  2PNI A;  4KUD K;  1OQK A;  2IIM A;  3TQ7 P;  3OB9 A;  1Q82 R;  1BCO A;  3RMQ A;  5LJ3 j;  1WDX A;  1GXI E;  3A8M B;  4BDZ A;  3UA7 A;  5GAN j;  1OU9 A;  1I1J A;  1Y96 B;  3OYL A;  4E6R A;  1HXD A;  2P0Q A;  3G6E T;  1KD1 U;  1K4U S;  2COY A;  3MP1 A;  4C92 D;  1VQP T;  4M75 F;  4CRI A;  1HD3 A;  5GAM h;  1B7T A;  3HFO A;  1OOT A;  2ZPB B;  3JB9 I;  4CC2 A;  5J39 A;  4QT7 A;  3CPW A;  4J9G A;  1YJ9 T;  4OB3 B;  4B9X A;  2YHT A;  3EGX B;  3DLL A;  1MUZ A;  2DVE A;  4M7A G;  1AOJ A;  3V7S A;  2VXE A;  1AZG B;  3CBO A;  5D6W A;  5KYU A;  1X75 C;  2RHU A;  3MEU A;  2HKQ B;  1NLP C;  3PTA A;  1Y07 A;  1G2B A;  4PNO A;  1Q81 C;  2HMA A;  3RER A;  2LC4 A;  3FDR A;  2EGC A;  4C0G A;  5DLO A;  2LJ0 A;  2F1L A;  1JU5 C;  4LD9 K;  3HHT B;  1PKT A;  4EPC A;  3CCE Q;  3CCQ T;  1Y0M A;  1JXM A;  3NGP A;  3LWH A;  1JXO A;  1GCQ A;  4LUD A;  4FL6 A;  4OVA A;  2AT1 B;  4J7F A;  1VIE A;  1AWW A;  5KCH A;  4RG2 A;  3RNJ A;  4FW2 A;  1IHV A;  1NJI C;  2V1Q A;  1MMD A;  3LGL A;  3OSS C;  2KNB B;  2DLP A;  2DBK A;  4KGZ B;  2HL3 A;  2E1H A;  2CT4 A;  2RM4 A;  1RAD B;  2P84 A;  3MCA B;  4KGX B;  1IRE B;  2JT4 A;  1Q7Y R;  1IRX A;  1YHQ T;  2KRS A;  1LJO A;  3I35 A;  3HP9 A;  5CQY A;  1PD0 A;  3SWN A;  3P8H A;  5LJ5 f;  1TU0 B;  5KYX B;  2OX7 A;  4PFP A;  3O5Z A;  1KHC A;  2CRE A;  1PKS A;  1BI3 A;  3EFO A;  3RIR A;  1BB9 A;  5A0G A;  2COW A;  1YJN Q;  2L3S A;  1TXQ A;  3MEV A;  2BIV A;  3LH5 A;  4ZN1 A;  3CCM T;  4FYW B;  2DRK A;  2PU9 B;  2V8J A;  1WHJ A;  3WXM B;  4DQ2 A;  1HSQ A;  4C92 C;  4F17 A;  2NLU A;  4M78 A;  3CC7 Q;  2OTJ Q;  1SSF A;  3VS1 A;  1YNZ A;  4X1V A;  1T0J A;  3ASK A;  2DXU A;  4N4H A;  4IIO A;  1VQ4 T;  1VA7 A;  5KH6 A;  5FU6 C;  3ZFJ A;  2ZPF B;  3OSV A;  2K9G A;  4JRI A;  2RI5 A;  1Y71 A;  2IPO B;  5KCO A;  1WGS A;  2VGN A;  5FU7 C;  1S72 T;  2EW3 A;  4Y92 A;  3OYN A;  2K3B A;  4MDX A;  1AEY A;  4XTY A;  1NEB A;  2FB7 A;  4J9D A;  1UJ0 A;  4XTW A;  4E7J A;  4A63 B;  3V7R A;  1H64 1;  2LP5 A;  1J3T A;  4JZ4 A;  1PSF A;  2J7I A;  2LNH B;  5GAN 4;  3CCL A;  2NUZ A;  4XTV A;  4LDY A;  1AHJ B;  2ESW A;  3MKD A;  3G71 Q;  4F04 B;  5LJ5 j;  4M77 C;  4KUL A;  1K8A R;  1N6A A;  3ZEH A;  2C0T A;  2HBW A;  4O6J A;  1KD1 C;  4ZGD B;  4EMG A;  2D6F A;  4ZN3 A;  3UT1 A;  4K11 A;  5ECA A;  5GAN 6;  1BI1 A;  5CVI A;  2AKL A;  2P0K A;  2XDP A;  2DTI A;  3REA B;  5CAI A;  2K2M A;  3TCJ A;  1ZA1 B;  1SPK A;  4ZGE B;  1VYU A;  2E6Z A;  2QEX A;  4M78 G;  2NUP A;  3RKX A;  2LNV A;  1ZUY A;  1M1K C;  2RQR A;  3VU3 C;  3G7Z A;  3QXE B;  2XDD A;  2M02 A;  1BIA A;  3LLR A;  4BI3 A;  3IQL A;  2W10 A;  4FSX A;  3VUZ A;  4N4I A;  2YRD A;  4BY6 C;  2EGA A;  1SF9 A;  2AK5 A;  4RTW A;  1UFF A;  1YIT Q;  1PD1 A;  2E65 A;  2MF2 A;  4B9W A;  4OGC A;  1AT1 B;  2SEM A;  4E7H A;  1WYX A;  3M56 A;  3BDL A;  1M8V A;  1BBZ A;  2F69 A;  4J7I A;  3VS6 A;  3OYM A;  2RJE A;  3CME T;  3LH0 A;  3C4S A;  1N27 A;  2KY9 A;  3RMS A;  1JEG A;  1SHF A;  3EHR A;  3G4S T;  1FX7 A;  2LCC A;  3OQ5 A;  1E7O A;  3CCV T;  3THK A;  3EG2 A;  3QKJ A;  3GOX A;  2E41 A;  2MK5 A;  4E2F B;  2K57 A;  1JB0 E;  4IKF A;  3H8Z A;  3CXC A;  3A8H B;  1VQ7 A;  4C92 G;  3A8O B;  1UGR B;  3CXC S;  3MP6 A;  2KK4 A;  4BI4 A;  4EDU A;  1GRI A;  2PVD B;  1KQS A;  4C8Q D;  3OYY A;  1YWP A;  1KQS S;  4OMN A;  2M1H A;  1NYG A;  2ZCF B;  2RNA A;  4VUB A;  3JCM W;  2RK1 A;  2QTV A;  2E64 A;  2H3J A;  1Q82 C;  3BDU A;  2K3Y A;  1RAB B;  2EJF A;  4M77 F;  2EYZ A;  5GMK l;  4C8Q E;  3BY7 A;  5CKB A;  1K8A U;  3CCQ Q;  2JMC A;  2H3E B;  4J5Y A;  1BIB A;  1U3O A;  1KQ2 A;  1PRL C;  2EYY A;  1TSF A;  1GL5 A;  2YUP A;  1M9S A;  4QQG A;  3HFN A;  5CQX A;  2RF0 A;  2KRO A;  2Y4X A;  4XU1 A;  2BE7 D;  3UA6 A;  5GAM d;  1PSE A;  2DL8 A;  3V8L A;  1RAA B;  3CD6 T;  4IUU A;  5GJW B;  2X4X A;  3EFS A;  2E6N A;  4B6M A;  3OYF A;  1TG0 A;  2DZ9 A;  3OYG A;  1YIJ A;  1U8R A;  1UHF A;  2LCL A;  3WVE B;  5EC7 A;  1VQ8 A;  4PKC C;  4QVD A;  2XID A;  3ER0 A;  1YHQ Q;  3CCE T;  2KGT A;  2BKD N;  2QQ9 A;  3M0U A;  5DM7 R;  2KAF A;  2QQR A;  1VQL A;  2FRY A;  1YI2 A;  2DMO A;  2QG9 B;  1Y57 A;  3CMA Q;  3C95 A;  1TH7 A;  2JTM A;  4FCY A;  1MMN A;  5IH2 A;  2DX1 A;  4JJC A;  3H9N A;  1M5Q 1;  3UAT A;  4PJO C;  3CCR A;  2XK0 A;  2RMO A;  2DIQ A;  5I21 A;  3OS5 A;  5FRN A;  1C0M A;  2QYZ A;  4EMK A;  4Z89 A;  1Y7X A;  3AHU A;  3I9Q A;  4HVU A;  1ZSZ B;  4OMM A;  1F1B B;  3OW2 A;  1Q7Y C;  3F70 A;  2E5Q A;  4TVR A;  3OW2 S;  4D8D A;  3VKI A;  1VQ6 T;  2EKO A;  2CDT A;  1CSK A;  4M7A B;  3ZL7 C;  5GAM e;  3LWI A;  1OV3 A;  3INZ A;  1YJN T;  5FW9 A;  4JJB A;  3TVT A;  4QVC A;  2HL5 C;  2OTL A;  4C0D C;  5GAN 2;  2VWF A;  3EGU A;  4J8O A;  2PUO B;  2DNU A;  4XAX B;  3FC3 A;  2HQH A;  1LOJ A;  2HD0 A;  3JCM g;  4HXJ A;  1AWJ A;  1FMK A;  2BTT A;  4L59 A;  2CSI A;  1GFC A;  3CC7 T;  2OTJ T;  4WCI A;  1IB8 A;  2DFU A;  2HSP A;  2XKO C;  1XNI A;  4PL6 A;  1ACM B;  5AT1 B;  2DL3 A;  1BKB A;  1WFW A;  2LRQ A;  4BB7 A;  4M75 C;  3L1A A;  5J3B A;  3CPF A;  2I2L A;  2CP3 A;  2C0I A;  1K73 R;  2EYW A;  1X6G A;  2P4R A;  1HK9 A;  4O5V A;  1UE9 A;  1VUB A;  4V2S A;  2FRW A;  2FZK B;  2PZ1 A;  4C0Z A;  2G6F X;  1YN8 A;  1XOV A;  3M5A A;  1TWB A;  1VIF A;  1OYX A;  3CCU Q;  1RAF B;  1V76 A;  4FSS A;  1RAI B;  3H6Z A;  3LX7 A;  1I81 A;  4RTY A;  1VQM A;  1BCM A;  1YP5 A;  2KDS A;  3Q1J A;  4JRP A;  5KYU B;  1QW1 A;  3JB9 J;  4GBQ A;  4C8Q A;  2X9H A;  3WVD B;  1Q95 G;  2JNG A;  2YRC A;  1B34 A;  1K8A C;  2FPE A;  2GTO A;  4FT2 A;  4IUR A;  5A0D A;  2QEX Q;  4M7D C;  3EAE A;  4PJO F;  4OP0 A;  1M8M A;  1YJW T;  1QVP A;  3E9F A;  2B8A A;  1XJW B;  2KYM A;  1QLY A;  1IGU A;  1FYN A;  5HY6 A;  2RH2 A;  4Y28 E;  3CEY A;  1QQJ A;  2D8J A;  2MOX A;  3MJX A;  4PJN A;  2K79 A;  3KUF A;  4AFS C;  1ZUU A;  1KHI A;  3M9Q A;  1VQN A;  2KXC A;  5GMK e;  1W1F A;  3CCJ A;  2VVK A;  3GNG A;  1UGQ B;  1EZZ B;  1VQ9 Q;  1N8R R;  3CCV Q;  1WI7 A;  1G83 A;  3MP8 A;  3JB9 H;  4QKU A;  2ZGW A;  5GAN 3;  1CKB A;  1QWF A;  2DRM A;  1VQ5 A;  3FLG A;  3M0S A;  4MZM A;  1OU8 A;  3G6E A;  3TU4 K;  2HBP A;  3EG1 A;  2CZ0 B;  2K2V A;  1MMG A;  4UC4 A;  3SWN B;  4X34 A;  2CP0 A;  3JAM E;  4WF2 A;  1VQP A;  1M90 U;  3BE3 A;  2BZX A;  1IZ6 A;  4F7U F;  2MWP A;  3EFO B;  1UGV A;  1QCO A;  1YJ9 A;  4C8Q G;  2FHD A;  2E12 A;  1HYO A;  5GAO m;  3QDR B;  2EWN A;  2JUF A;  1WHG A;  2JTF A;  4DBQ A;  1PC0 A;  2E5K A;  2DF6 A;  1X43 A;  2GQV A;  2QQB A;  2QK0 A;  1NLO C;  3CPW S;  5I2M A;  4JS4 A;  1VQ7 Q;  2A0F B;  2YRV A;  1OX9 A;  2HSE B;  2YLB A;  1K73 U;  2QGG A;  2CZ1 B;  4C92 E;  4M78 B;  1D0Z A;  3G1J A;  2ENM A;  2ECZ A;  1AZE A;  2JS0 A;  3CD6 Q;  4LDU A;  4M75 G;  1K9M R;  2L0A A;  5A0L A;  1KQ1 A;  3VRZ A;  2O9V A;  3U23 A;  2CZ6 B;  3PVQ A;  5GJV B;  1X6O A;  2M9U A;  9ATC B;  2A7Y A;  2J6F A;  1UJY A;  2PTK A;  4M77 D;  3FEO A;  3QYH B;  2DZC A;  2PVO B;  2LTO A;  2NWM A;  1WXB A;  4M7D F;  3CC2 Q;  3PT9 A;  1YCS B;  1D09 B;  4Y91 A;  2AZV A;  3CCS A;  2X4W A;  2KYB A;  2QA4 Q;  3REB B;  4DEY A;  3TEE A;  4M77 E;  2RA2 A;  4J83 A;  4JJD A;  2CYZ B;  4PJJ A;  2JJ9 A;  2QTX A;  3M4G A;  4JZ3 A;  2DTH A;  2CP7 A;  4Z88 A;  3HSB A;  5C6S A;  1XTD A;  3HPW A;  1NE8 A;  3VUB A;  4M7D G;  3JCM Q;  3DKM A;  4OMO A;  4HCK A;  3I55 A;  2DYI A;  3M4Y A;  3CMA T;  1IHW A;  2RHI A;  4C92 B;  1N8R U;  2VGM A;  2PQW A;  3CCM A;  2NUP B;  3ME9 A;  1VQ6 Q;  2KRM A;  5DLQ E;  2QQS A;  4C5E A;  2ABL A;  2MWO A;  1SRL A;  1FMV A;  2RN8 A;  5I2S A;  3QZ5 B;  1ABO A;  4MMK A;  1G5V A;  3RR6 A;  1KSW A;  3JRZ A;  3I56 A;  2L2P A;  1N9R A;  5GMK h;  1OPL A;  4CC7 A;  2OI3 A;  1GBQ A;  4KRT A;  1RAC B;  1WHM A;  1WA7 A;  2CH4 W;  1M3C A;  4J9E A;  3H41 A;  4CC4 B;  2HEQ A;  3V8K A;  5GAN e;  1Q86 R;  2DXC A;  4DOW A;  2EQK A;  4OMP A;  1M2V A;  1JJ2 P;  2CSQ A;  1U06 A;  3I5R A;  1WHK A;  1PHT A;  3X20 B;  2VYT A;  5GAO q;  2X3X D;  3AT1 B;  2DAQ A;  5FLX E;  1W6X A;  4PJL A;  3JCM J;  1W2B P;  2DL4 A;  1NPP A;  3KFV A;  2ZPI B;  2LT1 A;  1K9M U;  2FG0 A;  4RTV A;  4A53 A;  3M57 A;  1S1N A;  4HCB A;  3OMC A;  2O88 A;  1NEG A;  2DE0 X;  2RI2 A;  3D7S B;  3PFS A;  2V8I A;  4XU0 A;  1KC8 R;  5GAM f;  3JB9 F;  1TOV A;  2EKH A;  2AHJ B;  2CH4 A;  2MIO A;  1JRI A;  4GLK A;  1WPY A;  2IVW A;  2FEI A;  2ZPG B;  3V8J A;  3VV0 A;  1WJQ A;  2QGF B;  4HVV A;  3SEM A;  4C92 A;  1WHL A;  1SG5 A;  3N5B B;  3CCL T;  3CCU T;  2RO0 A;  1YJW Q;  1K76 A;  1K73 C;  4BY6 B;  2R57 A;  2A28 A;  1ZHI A;  4LDX A;  1UB4 A;  2RQU A;  3QJY A;  2COZ A;  1VQM Q;  2VV5 A;  1H3Z A;  1KFZ A;  2JOY A;  1AWX A;  2DBM A;  2ROL A;  3S3M A;  3QBY A;  2YDL A;  3OBY A;  2YLC A;  2LJ1 A;  2K5F A;  3NFC A;  3HRS A;  2RB6 A;  5GAN 5;  2QEX T;  1E6G A;  5IN1 A;  2RQT A;  3M58 A;  5LJ3 g;  2ED0 A;  2DD4 A;  1QCF A;  4N4G A;  1O9S A;  3JCM d;  5GAO n;  1QVG A;  3OA6 A;  3EGD B;  5GAN g;  2DO3 A;  4J9F A;  3G4S A;  1QVG S;  4M77 A;  4E7I A;  3JSC A;  3CC4 A;  1VQN Q;  4PJO D;  1SRM A;  4NOY A;  2L3Q A;  3OYB A;  3BFM A;  4RCC A;  1KG1 A;  3C0C A;  1VQ9 T;  2RJD A;  1D0Y A;  5GAM j;  4C0F A;  1WXU A;  1ZBJ A;  2E3I A;  1VQK Q;  1G3S A;  2Y4Y A;  1Q86 U;  4X9C A;  2E70 A;  3EH2 A;  1M1G A;  3HL8 A;  3OY9 A;  4PJO E;  4RTT A;  2HKN A;  1TS9 A;  4AFQ C;  3VS3 A;  1N8R C;  3E2U A;  1BI2 A;  4EMK B;  4IUQ A;  2PVG B;  3PIP A;  1UGS B;  5CCA A;  4RTU A;  3L2W A;  5HKC A;  2RHZ A;  5IHN A;  2DA9 A;  2O31 A;  2LX9 A;  2LCS A;  5GAN h;  5KYY A;  2HAX A;  1RAG B;  5GAO l;  2XU8 A;  1MGQ A;  2MAM A;  2O2O A;  2JN0 A;  1VQ7 T;  3JCM e;  5KYW A;  2CT3 A;  1KC8 U;  4M75 D;  4D6W A;  2M0O A;  4LDW A;  3JCM V;  1WJS A;  4NS5 A;  3CCE A;  2FVU A;  4FU6 A;  1NJI R;  4M77 G;  2X3W D;  1TUC A;  1VYV A;  1AVZ C;  2X35 A;  4ZTJ A;  3S3O A;  3R6O A;  4M75 E;  1I5O B;  1BI0 A;  1RLQ C;  1WZO A;  3LW5 E;  3DB4 A;  3I5S A;  2JZ2 A;  1RL2 A;  4N0A C;  2P0P A;  3EGD A;  3HKS A;  3GNF B;  1SEM A;  4OF1 A;  4ME7 A;  3JCM b;  1K9M C;  1R0B G;  4KUI A;  1ZQ1 A;  3UWN A;  5CK9 A;  3CC2 T;  2EYQ A;  4DBF A;  2DEQ A;  1Z9Z A;  2K3X A;  2QAS A;  2QA4 T;  4ESR A;  4AG1 C;  1I4K 1;  2JM8 A;  2CKK A;  1A0N B;  1PM3 A;  3PGG A;  4QW2 A;  4M7D D;  5CKE A;  1QCN A;  1WIE A;  4AG2 C;  3UPU A;  2R5M A;  1M3B A;  2LQW A;  1VOM A;  3URG A;  2KT1 A;  4C8Q B;  5IXF A;  1WQ7 A;  4CC3 A;  4DA4 A;  2ZPH B;  2K7A A;  2EQM A;  3PMI A;  1B34 B;  2YXY A;  5GMK j;  2KE9 A;  3A8L B;  4RG8 A;  1H8K A;  2BUD A;  1VQL T;  1YI2 T;  2CUB A;  4M7D E;  2SRC A;  5GAN 7;  4JJN K;  1MNE A;  2P4T A;  3EG3 A;  2GTJ A;  1K9A A;  3QG1 A;  2DXT A;  3QWY A;  1D3B A;  4MZT A;  1V29 B;  4XTZ A;  3CC7 A;  2OTJ A;  2AIR B;  3O8V A;  3CBM A;  3TSW A;  4FT4 A;  3TRE A;  1M90 R;  2EQU A;  1GCP A;  2D8H A;  1JJ2 A;  4HCC A;  3OYE A;  3X25 B;  1MHN A;  4II1 A;  2GQI A;  1KK7 A;  4A4H A;  1OX8 A;  2O4X A;  2LQK A;  5AYF A;  1R0C B;  5CKH A;  3EG9 A;  3JV3 A;  1ZSZ C;  4IUV A;  1VQO A;  1ZA2 B;  1Z9Q A;  4A54 A;  4E7Z A;  4M7A C;  2FYK A;  2WSF E;  3PVL A;  2K6D A;  3QII A;  4PJO A;  2HZY A;  3G71 A;  2OAW A;  1G3W A;  1Q86 C;  4KBM B;  1EX4 A;  1NJI U;  4E47 A;  1MND A;  6AT1 B;  4J9I A;  1GBR A;  2F2V A;  2J6K A;  3CCL Q;  2GFA A;  2X4Y A;  2XG8 D;  3GP8 A;  2F5T X;  4RKU E;  1RAH B;  2Y90 A;  3JCM h;  3VYG A;  1X6B A;  2R58 A;  4BI8 B;  3HRT A;  1QP3 A;  2BZ8 A;  5IAY A;  1YCY A;  2C06 A;  1R8O B;  4NL3 A;  4XU2 A;  4IUP A;  2RHX A;  1UTI A;  1MV3 A;  2RK2 A;  2FL7 A;  4MDW A;  4C5H A;  1KC8 C;  2RQW A;  3JB9 D;  2GGR A;  5L8R E;  4C5G A;  2XD0 A;  2L89 A;  3GLX A;  4BUG A;  2A08 A;  4F7U A;  1VQM T;  3S3N A;  2HNI A;  4J9H A;  3QPH A;  2LJ3 A;  4M75 A;  2G3R A;  2GF7 A;  5CKF A;  1I0C A;  4FYY B;  1YIT A;  2KSS A;  2JM9 A;  1UDL A;  2I0N A;  4HVW A;  4JDS A;  4HT9 A;  4JS5 A;  1I5L A;  3M0P A;  1K0S A;  3E1S A;  2A37 A;  2VKN A;  3OS2 A;  1UEB A;  4PJO G;  2F5K A;  2VXF A;  2L3R A;  1D0X A;  1W4S A;  2DEU A;  2CZ7 B;  3FB9 A;  2KT8 A;  2JMA A;  4A4E A;  1ABQ A;  2FZG B;  3FJ5 A;  1OZ2 A;  2KR3 A;  3QO3 A;  4CI0 C;  1VQN T;  3CC4 Q;  4ATO A;  5CIU A;  4RTX A;  1GCQ C;  4KGV B;  1UUE A;  3CCJ T;  2NUT B;  2H8H A;  1X27 A;  2EVR A;  4XTX A;  1M2O A;  5KE3 A;  1K1Z A;  4JPB W;  4LUE A;  1YBY A;  2DM1 A;  1VQK T;  2DER A;  4M7A F;  1TUG B;  1UG1 A;  4OB2 B;  4M7D A;  1VQ5 T;  2IG0 A;  5FRO A;  5GMK m;  1UHC A;  3J80 E;  4J6Y A;  2M0Y A;  4F7U G;  3CXC P;  5CKD A;  2DK3 A;  3VS4 A;  3GF5 A;  2EQJ A;  3SWN C;  1WX6 A;  3CCQ A;  1UGP B;  1FXX A;  1KQS P;  3P8B B;  1IO6 A;  4Q5W A;  1OEB A;  1X2Q A;  2QI2 A;  2HQX A;  3BW1 A;  5IHI A;  1M1K U;  1M2V B;  2FO0 A;  1PG5 B;  4HCZ A;  1H3H A;  4PK4 A;  4OML A;  3OYH A;  4GLM A;  2HCK A;  3T9N A;  2RQV A;  3MPU B;  4AMC A;  5LJ3 d;  2KVQ G;  3QZ9 B;  3JCM c;  2B86 A;  4F16 A;  1YHQ A;  1M1F A;  4AT1 B;  4C5I A;  5GAN d;  2LT4 A;  4M78 C;  2F2X A;  2A3L A;  3RUX A;  3L2R A;  1YIJ Q;  1X01 A;  2DET A;  3KBG A;  1G3Y A;  1VQ8 Q;  5FWC A;  3MEW A;  2AKK A;  3NPF A;  3CMA A;  3MET A;  2K5I A;  2C0O A;  2MMP A;  1NYF A;  1QKW A;  4PLI A;  1I07 A;  2CP5 A;  3TSZ A;  3VJP A;  5I22 A;  4HA8 A;  2DPP B;  1QP2 A;  3A5Z B;  1FMW A;  3L42 A;  1VQL Q;  2YWW A;  3C12 A;  3EG0 A;  1SSH A;  1YI2 Q;  4FIB A;  3SDZ A;  3VS5 A;  1TUD A;  1AWO A;  3JCM f;  4J6X A;  3CCS T;  3GIB A;  2NUT A;  1PRM C;  2W0Z A;  1C1A A;  2OJ2 A;  3DB3 A;  4KH0 B;  3JCM P;  4R0K A;  4RMO A;  3NHN A;  2CP2 A;  3M0Q A;  3OS1 A;  3OYC A;  1Y96 A;  5FU6 B;  3CCR Q;  2DIL A;  2QDY B;  2XHC A;  1KJW A;  2D0N A;  4LD6 A;  1VQ4 A;  5FU7 B;  4LNP A;  3LYI A;  5FWB A;  3QWX X;  3UF4 A;  1WHH A;  2DL5 A;  4BDY A;  3VYH B;  3I55 T;  1O75 A;  3RKY A;  1OPK A;  1NG2 A;  1S72 A;  5LJ3 e;  1Q82 U;  4KT0 E;  3A8G B;  2M16 A;  3KXT A;  2DKG A;  3EGX A;  3GBQ A;  3OW2 P;  2OTL Q;  3NMZ C;  1OUL A;  4PLL A;  4A4G A;  2EQI A;  4M77 B;  5HK3 A;  5A2Q E;  1ZUK A;  4ELY C;  4OMF B;  1LCK A;  1MV0 B;  2RHY A;  2KEA A;  1BYM A;  2JW4 A;  1ZLM A;  3DLM A;  5IHK A;  3CBP A;  3EH1 A;  3VS2 A;  4MML A;  5CR2 A;  3I56 T;  2YT6 A;  2A36 A;  1RLP C;  3RKW A;  2ZZD A;  2R5A A;  4DOV A;  3X28 B;  1EFN A;  5LL6 S;  1T3S A;  4DBR A;  2X4J A;  1M90 C;  3J7A F;  2L8D A;  1XQH A;  1EIF A;  1IGQ A;  4GY5 A;  3HRU A;  2RD1 A;  1VQO Q;  3V7C A;  1LPL A;  4RCB A;  5I11 A;  1LVK A;  1MMA A;  2D0Q B;  1I8F A;  3CCU A;  2LVM A;  2XMF A;  4M78 F;  3RES A;  2ROT A;  4L6V 5;  2KBT A;  5KE2 A;  1PCX A;  1QWE A;  4R56 A;  3ZBD A;  4EMH A;  5KYY B;  1U1S A;  2Z0W A;  1RAE B;  2XDB A;  3M55 A;  1U1T A;  2VB6 A;  2YSQ A;  1B07 A;  2XI9 A;  5J26 A;  5KYW B;  1ZSG A;  4ORZ A;  5KYX A;  4E7S A;  3JB9 G;  2GCX A;  2YUQ A;  3X24 B;  4BE1 A;  2DJZ A;  2BE9 B;  2GFU A;  3M0T A;  5HCK A;  5IXB A;  3NTI A;  3ULR B;  2KRN A;  3MHX A;  4FYX B;  3H0H A;  2CGH A;  4NL2 A;  1Q7Y U;  2VUB A;  4J9B A;  3X26 B;  2V1R A;  1M27 C;  3CME A;  3J81 E;  3A1P A;  1N5Z A;  5DY9 A;  1JBM A;  2M51 A;  3FRN A;  1QKX A;  2BZY A;  3VS0 A;  4LDV A;  4BE2 A;  1VQ9 A;  1YWO A;  2RI3 A;  3CCV A;  1WXT A;  5LJ5 d;  2WAC A;  2WSE E;  3FIF A;  5GMK i;  4E7L A;  3HTR A;  2E4H A;  2EAY A;  5D7U A;  4LXC A;  3EFR A;  4J6W A;  3CCJ Q;  3QUI A;  2GBQ A;  3JCM X;  5D6X A;  4JLI A;  3R6N A;  1QVF P;  4C92 F;  2FPD A;  5EG2 A;  2L5Q A;  1ZBX A;  2RPN A;  3OBW A;  1T0H A;  3VRY A;  2O01 E;  1VQ5 Q;  3PE0 A;  4LE9 A;  3G6E Q;  3RBB B;  3OYJ A;  1YFN A;  3SHW A;  1M4Z A;  2LDM A;  1VQP Q;  1WJR A;  2JVV A;  1NZ9 A;  2J6O A;  3SD4 A;  3CC4 T;  3QHS A;  4Z8A A;  1C6V X;  1D1C A;  3OMG A;  2GNC A;  1Q81 R;  1YJ9 Q;  3M59 A;  3L2V A;  2KQW A;  4JLG A;  2MCN A;  5LJ3 h;  4PFO A;  1D3B B;  1VYT A;  2CUD A;  1HJD A;  2RJF A;  1B3Q A;  2YUN A;  1WNL A;  3H0F A;  1PWT A;  3C94 A;  3RDV A;  3CD6 A;  4MZP A;  2LX7 A;  5CO7 A;  4XK8 E;  1KIK A;  5KYN A;  3CPW P;  3LGF A;  4JRK A;  2DIG A;  2F2W A;  3SB2 A;  5LJ5 e;  1GFD A;  3A98 A;  4M7A D;  2DL7 A;  2EGE A;  2O4X B;  7AT1 B;  4L5G A;  2QAZ A;  4F7U E;  1FWZ A;  2EJG A;  4EMK C;  1LNX A;  1UEC A;  3EG9 B;  2DTO A;  4F14 A;  2EJ9 A;  3M54 A;  4XQ3 A;  2K4Y A;  2QQA A;  4JUV A;  2YUO A;  3CC2 A;  3SFM A;  4E7K A;  1RI9 A;  4M7A E;  2HDA A;  2J06 A;  4Z02 A;  4HT8 A;  1TTH B;  3QSU A;  4XU3 A;  2LZ6 B;  2PUK B;  4JRQ A;  4PFZ A;  4PJO B;  2RJC A;  2QA4 A;  3QDF A;  3EHQ A;  2MI6 A;  4IIM A;  3MEA A;  2LQN A;  4WTO B;  4BAC A;  1PNJ A;  1V1C A;  4IUT A;  4OB0 B;  2FZC B;  3CCS Q;  1D1B A;  2LMJ A;  4BD3 A;  1NBE B;  2K5L A;  4OMQ A;  4ZGJ B;  1YIJ T;  4YTL A;  1VQ8 T;  2HQE A;  2V26 A;  4X9D A;  2DD5 A;  1ARK A;  1T3L A;  3OYD A;  4OGE A;  1M30 A;  4C0D B;  1H92 A;  1VQ6 A;  1K0X A;  2DXB A;  1YJN A;  4OB1 B;  3I55 Q;  4ELZ C;  2AZS A;  4HKE A;  4FW1 A;  3CCM Q;  4EIK A;  5HK0 A;  4R55 A;  2JTE A;  2KI7 A;  3OS0 A;  4F7U B;  4AFU C;  3OYK A;  3CQT A;  4M75 B;  3CCR T;  2JXB A;  2V8K A;  2KXD A;  1VQ4 Q;  3OYI A;  1JJ2 S;  4N0A A;  3I56 Q;  1RUW A;  2ATC B;  2VAS A;  1D1A A;  1ZX6 A;  1BU1 A;  2D9T A;  2NYS A;  5IT9 E;  2EIF A;  4C8Q C;  1Q81 U;  5LJ5 g;  2D1X A;  1W2B A;  1DJ7 B;  3S6W A;  2CP6 A;  1S72 Q;  1W2B S;  2LQ8 A;  5D6Y A;  3OYA A;  3E19 A;  4QVZ A;  3PNW C;  5FRM A;  1OZ3 A;  2MPX C;  2OTL T;  3H0I A;  2X51 A;  3GPL A;  1KD1 R;  4J9C A;  4D8K A;  4PJM A;  2JS2 A;  2OAU A;  1JQQ A;  1X69 A;  3QYG B;  3P8D A;  1QMC A;  5L23 A;  2J05 A;  4DEX A;  4ANJ A;  1U5S A;  1CKA A;  4RUG A;  1SHG A;  1M1K R;  4M7D B;  2XIC A;  4DBH A;  1R77 A;  3FJP A;  1VQO T;  4P5N A;  3NTH A;  5LJ3 f;  5GAO p;  4QQ6 A;  4FM4 B;  3L2U A;  5GAN f;  4LN2 A;  1YJW A;  4KH1 B;  3M53 A;  5LJ5 h;  1SKU B;  1OI1 A;  2ZPE B;  3G71 T;  4QQD A;  1WQW A;  8AT1 B;  1X2K A;  2DYB A;  2EBP A;  2O9S A;  3NTK A;  3L2Z A;  2E3H A;  2QXF A;  8ATC B;  5GAN 8;  1NM7 A;  1N9S A;  4ZNX A;  2ZAE A;  1BK2 A;  4M78 D;  5GAO r;  2EFI A;  1IXD A;  2CS7 A;  2EPD A;  4FYV B;  1ZSZ A;  1NPR A;  2FPF A;  2DVJ A;  4AFZ C;  5M9O A;  1E6H A;  1G8X A;  1M3A A;  4M7A A;  2EYX A;  2WSC E;  5GAM g;  4RTZ A;  4M78 E;  2ED1 A;  2E10 A;  2QDL A;  1JO8 A;  3MO8 A;  2KMT A;  1AD5 A;  5C0M A;  3PMT A;  4ZTF A;  2L3P A;  2MYS A;  3CME Q;  4A4F A;  1QVF A;  3QJ6 A;  1P92 A;  3VS7 A;  1QVF S;  4A4K A; 
#chains in the Genus database with same CATH homology
 3AHU A;  4M77 A;  4EMK A;  1Y7X A;  2QDY B;  2XHC A;  4LD6 A;  3JSC A;  3L2Q A;  4E7I A;  1VQ4 A;  3CC4 A;  1G3T A;  4PJO D;  4NOY A;  4XTU A;  5FU7 B;  3UDC A;  1RI0 A;  2VC8 A;  3PIO A;  3OYB A;  3F70 A;  3LYI A;  4C8Q F;  3OW2 A;  2E5Q A;  1Q7Y C;  3BFM A;  4TVR A;  3OW2 S;  4RCC A;  1KG1 A;  4BDY A;  1VQK A;  3VKI A;  1VQ9 T;  1YIT T;  1VQ6 T;  3VYH B;  4BE0 A;  2EKO A;  3E9G A;  2RJD A;  4M7A B;  5GAM e;  3I55 T;  3LWI A;  4KUD K;  1O75 A;  3RKY A;  3INZ A;  1Q82 U;  1YJN T;  1S72 A;  5LJ3 e;  3OB9 A;  5GAM j;  4C0F A;  4KT0 E;  1G3S A;  3A8G B;  2M16 A;  2Y4Y A;  4QVC A;  3KXT A;  2DKG A;  3RMQ A;  4X9C A;  5LJ3 j;  4C0D C;  2E70 A;  1Q86 U;  2OTL A;  5GAN 2;  4J8O A;  1M1G A;  3HL8 A;  3OY9 A;  4PJO E;  1GXI E;  2PUO B;  3A8M B;  3FC3 A;  4XAX B;  4BDZ A;  1LOJ A;  5GAN j;  2HD0 A;  1Y96 B;  3OYL A;  1N8R C;  3JCM g;  1HXD A;  4PLL A;  1BI2 A;  4A4G A;  4M77 B;  4EMK B;  5HK3 A;  5A2Q E;  2P0Q A;  3G6E T;  4IUQ A;  4ELY C;  4OMF B;  2PVG B;  4L59 A;  3PIP A;  1KD1 U;  3CC7 T;  2RHY A;  2OTJ T;  1BYM A;  1UGS B;  3DLM A;  3MP1 A;  3CBP A;  4C92 D;  1VQP T;  4M75 F;  4CRI A;  2XKO C;  1XNI A;  4MML A;  4PL6 A;  5CCA A;  5CR2 A;  3I56 T;  5GAM h;  3L2W A;  3HFO A;  5HKC A;  2RHZ A;  1BKB A;  2ZPB B;  2LRQ A;  3RKW A;  2ZZD A;  5J39 A;  2R5A A;  3JB9 I;  2LX9 A;  4DOV A;  4BB7 A;  3X28 B;  3CPW A;  1YJ9 T;  4M75 C;  4OB3 B;  5LL6 S;  4B9X A;  3L1A A;  5GAN h;  2YHT A;  2X4J A;  3DLL A;  1M90 C;  2HAX A;  5J3B A;  3J7A F;  2DVE A;  3CPF A;  5GAO l;  4M7A G;  2L8D A;  2XU8 A;  1MGQ A;  3V7S A;  1XQH A;  2VXE A;  2I2L A;  1EIF A;  2JN0 A;  2MAM A;  3HRU A;  3CBO A;  4GY5 A;  2RD1 A;  5D6W A;  3JCM e;  1VQ7 T;  1X75 C;  2RHU A;  3MEU A;  1HK9 A;  4O5V A;  1KC8 U;  3V7C A;  4M75 D;  4RCB A;  3PTA A;  1Y07 A;  1VUB A;  2D0Q B;  2M0O A;  4D6W A;  4V2S A;  4PNO A;  1Q81 C;  1I8F A;  3CCU A;  3RER A;  4M7A E;  2LVM A;  4LDW A;  2LC4 A;  4C0Z A;  3FDR A;  4M78 F;  1XOV A;  3RES A;  3JCM V;  1WJS A;  3M5A A;  4NS5 A;  4C0G A;  1VIF A;  5DLO A;  2FVU A;  1OYX A;  4FU6 A;  3CCE A;  4M77 G;  4L6V 5;  5KE2 A;  4LD9 K;  2X35 A;  3HHT B;  4ZTJ A;  4R56 A;  3S3O A;  3R6O A;  3H6Z A;  3ZBD A;  4EPC A;  3LX7 A;  4EMH A;  3CCQ T;  4M75 E;  1U1S A;  1BI0 A;  1I81 A;  1VQM A;  3LW5 E;  3LWH A;  3DB4 A;  2XDB A;  3M55 A;  1U1T A;  2JZ2 A;  1RL2 A;  4N0A C;  2KDS A;  2XI9 A;  3Q1J A;  5J26 A;  4JRP A;  2P0P A;  4FL6 A;  1QW1 A;  3HKS A;  4OVA A;  3JB9 J;  3GNF B;  4C8Q A;  4J7F A;  4OF1 A;  1VIE A;  4ME7 A;  3JCM b;  1VQ7 A;  3WVD B;  3JB9 G;  5KCH A;  1K9M C;  2GCX A;  4RG2 A;  3X24 B;  4KUI A;  4BE1 A;  1NJI C;  1ZQ1 A;  2JNG A;  2DJZ A;  3UWN A;  2GFU A;  5CK9 A;  1B34 A;  1K8A C;  3CC2 T;  3LGL A;  3OSS C;  2EYQ A;  4FT2 A;  4IUR A;  5A0D A;  4M7D C;  2DEQ A;  2E1H A;  3EAE A;  3NTI A;  3MHX A;  2K3X A;  2RM4 A;  2CGH A;  4NL2 A;  4OP0 A;  4PJO F;  2VUB A;  1Q7Y U;  3MCA B;  1QVP A;  1YJW T;  1IRE B;  3E9F A;  3X26 B;  2QA4 T;  2B8A A;  5HY6 A;  2RH2 A;  1YHQ T;  4Y28 E;  1I4K 1;  2CKK A;  3CME A;  3J81 E;  3CEY A;  1LJO A;  3PGG A;  4QW2 A;  3HP9 A;  4M7D D;  5CKE A;  5CQY A;  5DY9 A;  3SWN A;  3UPU A;  2R5M A;  1JBM A;  3P8H A;  3URG A;  5LJ5 f;  3FRN A;  3KUF A;  4C8Q B;  1KHI A;  1WQ7 A;  3M9Q A;  1VQN A;  4LDV A;  4BE2 A;  4DA4 A;  2ZPH B;  1VQ9 A;  2RI3 A;  5GMK e;  1KHC A;  3CCV A;  2EQM A;  3PMI A;  5LJ5 d;  2WAC A;  2WSE E;  3FIF A;  1B34 B;  1BI3 A;  5GMK i;  3RIR A;  3CCJ A;  5GMK j;  4E7L A;  5A0G A;  3A8L B;  1UGQ B;  3GNG A;  2BUD A;  2EAY A;  4RG8 A;  1VQL T;  1YI2 T;  3EFR A;  4J6W A;  4M7D E;  3QUI A;  4JJN K;  5GAN 7;  3MP8 A;  3JB9 H;  3JCM X;  2P4T A;  5D6X A;  4JLI A;  3MEV A;  2ZGW A;  2BIV A;  5GAN 3;  3QG1 A;  4C92 F;  2DXT A;  1VQ5 A;  1D3B A;  5EG2 A;  3FLG A;  4ZN1 A;  2L5Q A;  1ZBX A;  4MZT A;  3CCM T;  4MZM A;  3OBW A;  1V29 B;  4XTZ A;  3G6E A;  3TU4 K;  2PU9 B;  2HBP A;  2O01 E;  2CZ0 B;  2K2V A;  3CC7 A;  2OTJ A;  4UC4 A;  3O8V A;  2V8J A;  3CBM A;  4X34 A;  3SWN B;  3WXM B;  4DQ2 A;  3JAM E;  4FT4 A;  4WF2 A;  1VQP A;  4C92 C;  1M90 U;  3TRE A;  2NLU A;  4M78 A;  3OYJ A;  2EQU A;  1IZ6 A;  1SSF A;  4F7U F;  1JJ2 A;  1M4Z A;  2MWP A;  2LDM A;  4HCC A;  3OYE A;  3X25 B;  1WJR A;  2JVV A;  1NZ9 A;  1YJ9 A;  1MHN A;  3ASK A;  2DXU A;  4II1 A;  4N4H A;  3SD4 A;  4C8Q G;  3CC4 T;  2FHD A;  3QHS A;  2E12 A;  1VQ4 T;  4A4H A;  2O4X A;  3OMG A;  5KH6 A;  5GAO m;  2LQK A;  5AYF A;  3QDR B;  5FU6 C;  2ZPF B;  2EWN A;  3OSV A;  2JUF A;  5CKH A;  3M59 A;  3ZFJ A;  4JRI A;  3L2V A;  2KQW A;  2RI5 A;  1Y71 A;  2JTF A;  4JLG A;  5LJ3 h;  1WGS A;  5KCO A;  1D3B B;  2GQV A;  2QQB A;  2VGN A;  5FU7 C;  3CPW S;  5I2M A;  1S72 T;  2RJF A;  4IUV A;  4JS4 A;  3OYN A;  1VQO A;  4MDX A;  4XTY A;  1WNL A;  2YRV A;  2FB7 A;  2YLB A;  4A54 A;  4XTW A;  1K73 U;  4M7A C;  2CZ1 B;  4E7J A;  4C92 E;  4M78 B;  3V7R A;  1H64 1;  2FYK A;  3C94 A;  2WSF E;  3CD6 A;  1PSF A;  4MZP A;  5CO7 A;  4XK8 E;  5GAN 4;  3QII A;  4PJO A;  3G71 A;  3LGF A;  1G3W A;  2DIG A;  4JRK A;  3SB2 A;  3CCL A;  1Q86 C;  4KBM B;  4XTV A;  4LDU A;  4LDY A;  4M75 G;  5LJ5 e;  1AHJ B;  4M7A D;  1NJI U;  4E47 A;  2O4X B;  4L5G A;  5A0L A;  1KQ1 A;  4F7U E;  5LJ5 j;  1FWZ A;  2EJG A;  4M77 C;  4KUL A;  1LNX A;  4EMK C;  2GFA A;  1N6A A;  2X4Y A;  2CZ6 B;  3ZEH A;  2DTO A;  2XG8 D;  1X6O A;  4O6J A;  1KD1 C;  2M9U A;  4ZGD B;  3GP8 A;  2EJ9 A;  3M54 A;  2F5T X;  4RKU E;  4XQ3 A;  2K4Y A;  3UT1 A;  4EMG A;  4ZN3 A;  2D6F A;  2A7Y A;  2QQA A;  4JUV A;  3CC2 A;  2Y90 A;  5GAN 6;  3JCM h;  3VYG A;  3SFM A;  4M77 D;  1BI1 A;  4E7K A;  3FEO A;  3QYH B;  2XDP A;  2P0K A;  5CVI A;  2DTI A;  2DZC A;  2R58 A;  1QP3 A;  3HRT A;  4BI8 B;  2PVO B;  4Z02 A;  4HT8 A;  2LTO A;  5IAY A;  5CAI A;  3QSU A;  1YCY A;  3TCJ A;  3PT9 A;  4XU3 A;  1R8O B;  2PUK B;  2C06 A;  4JRQ A;  4M7D F;  4PJO B;  4Y91 A;  4NL3 A;  4ZGE B;  2RJC A;  2QA4 A;  2E6Z A;  2QEX A;  4XU2 A;  3CCS A;  2MI6 A;  3MEA A;  2X4W A;  4M78 G;  4IUP A;  4BAC A;  2RHX A;  4IUT A;  3RKX A;  2LNV A;  4OB0 B;  1M1K C;  2RK2 A;  3TEE A;  2FL7 A;  4MDW A;  4M77 E;  2RA2 A;  4C5H A;  1KC8 C;  4J83 A;  3JB9 D;  2CYZ B;  3G7Z A;  3VU3 C;  5L8R E;  4BD3 A;  2K5L A;  3QXE B;  4C5G A;  4ZGJ B;  2XD0 A;  2QTX A;  2L89 A;  3GLX A;  3M4G A;  2XDD A;  4BUG A;  1YIJ T;  4F7U A;  4YTL A;  2DTH A;  1VQ8 T;  2HQE A;  1BIA A;  1VQM T;  3S3N A;  4X9D A;  3HSB A;  3LLR A;  2DD5 A;  4BI3 A;  5C6S A;  1XTD A;  3HPW A;  2HNI A;  1NE8 A;  3QPH A;  3VUB A;  3OYD A;  4FSX A;  4M75 A;  3VUZ A;  2G3R A;  3DKM A;  4OGE A;  2GF7 A;  3JCM Q;  5CKF A;  4C0D B;  1YIT A;  1VQ6 A;  4N4I A;  3I55 A;  4BY6 C;  2KSS A;  3M4Y A;  2DXB A;  3CMA T;  1YJN A;  2RHI A;  4C92 B;  4HT9 A;  4JDS A;  1N8R U;  2VGM A;  2PQW A;  3CCM A;  4JS5 A;  1I5L A;  3ME9 A;  4OB1 B;  4ELZ C;  5DLQ E;  2E65 A;  2MF2 A;  2QQS A;  3E1S A;  4B9W A;  4OGC A;  4C5E A;  4HKE A;  3OS2 A;  1UEB A;  4PJO G;  4E7H A;  2MWO A;  3M56 A;  2F5K A;  3BDL A;  5HK0 A;  4R55 A;  1M8V A;  5I2S A;  2VXF A;  3QZ5 B;  4MMK A;  1G5V A;  2F69 A;  2L3R A;  4J7I A;  3OS0 A;  4F7U B;  1W4S A;  2CZ7 B;  3OYM A;  2RJE A;  3CME T;  1U8R A;  3FB9 A;  3LH0 A;  3C4S A;  3OYK A;  1N27 A;  2KY9 A;  3RMS A;  4A4E A;  3JRZ A;  4M75 B;  3CCR T;  3I56 A;  5GMK h;  1N9R A;  3G4S T;  1OZ2 A;  1FX7 A;  2LCC A;  3OQ5 A;  3QO3 A;  4CI0 C;  2V8K A;  1VQN T;  4ATO A;  5CIU A;  3OYI A;  1JJ2 S;  4N0A A;  3CCV T;  3CCJ T;  3QKJ A;  3GOX A;  2D9T A;  5IT9 E;  2E41 A;  2EIF A;  4C8Q C;  4XTX A;  2K57 A;  1Q81 U;  1JB0 E;  5KE3 A;  5LJ5 g;  4IKF A;  3V8K A;  1W2B A;  1DJ7 B;  5GAN e;  3H8Z A;  3CXC A;  3S6W A;  3A8H B;  2DXC A;  4DOW A;  2LQ8 A;  5D6Y A;  1W2B S;  4C92 G;  3A8O B;  1UGR B;  1YBY A;  2EQK A;  3MP6 A;  3CXC S;  1VQK T;  4M7A F;  2KK4 A;  4BI4 A;  4EDU A;  3OYA A;  3E19 A;  2PVD B;  4OB2 B;  3PNW C;  4QVZ A;  1VQ5 T;  2IG0 A;  1OZ3 A;  1KQS A;  5FRM A;  4M7D A;  3X20 B;  4C8Q D;  5FRO A;  3OYY A;  1KQS S;  2VYT A;  5GAO q;  2OTL T;  5GMK m;  2M1H A;  2DAQ A;  2ZCF B;  3J80 E;  5FLX E;  3GPL A;  4J6Y A;  3JCM J;  4VUB A;  3JCM W;  2OAU A;  2RK1 A;  4F7U G;  2E64 A;  2H3J A;  1Q82 C;  3BDU A;  2K3Y A;  1NPP A;  2DK3 A;  5CKD A;  2EJF A;  2EQJ A;  3GF5 A;  4M77 F;  2ZPI B;  3SWN C;  3QYG B;  1UGP B;  2LT1 A;  3CCQ A;  5GMK l;  1K9M U;  1FXX A;  3P8D A;  3P8B B;  4C8Q E;  4A53 A;  3BY7 A;  4Q5W A;  5CKB A;  3M57 A;  1K8A U;  4HCB A;  3OMC A;  2QI2 A;  2RI2 A;  2HQX A;  3BW1 A;  4J5Y A;  3PFS A;  1M1K U;  1BIB A;  2V8I A;  4M7D B;  2XIC A;  4XU0 A;  1KQ2 A;  4HCZ A;  5GAM f;  3JB9 F;  1VQO T;  3FJP A;  1M9S A;  4QQG A;  3OYH A;  2AHJ B;  3HFN A;  4P5N A;  3NTH A;  5CQX A;  5LJ3 f;  2Y4X A;  1JRI A;  4GLK A;  4XU1 A;  5GAO p;  4QQ6 A;  4FM4 B;  5GAM d;  1WPY A;  2IVW A;  3L2U A;  1PSE A;  3V8L A;  3T9N A;  5GAN f;  3CD6 T;  2ZPG B;  4IUU A;  5LJ3 d;  3V8J A;  3VV0 A;  2X4X A;  3EFS A;  1YJW A;  3M53 A;  2KVQ G;  3QZ9 B;  2E6N A;  1WJQ A;  5LJ5 h;  3JCM c;  1YHQ A;  1OI1 A;  4C92 A;  3OYF A;  2ZPE B;  3G71 T;  4QQD A;  1M1F A;  4C5I A;  1WQW A;  2DZ9 A;  3N5B B;  3OYG A;  5GAN d;  3CCL T;  3CCU T;  2LT4 A;  2RO0 A;  4M78 C;  1YIJ A;  2LCL A;  3WVE B;  1K73 C;  4BY6 B;  1VQ8 A;  2R57 A;  4PKC C;  4QVD A;  2XID A;  3ER0 A;  1ZHI A;  4LDX A;  2A3L A;  3L2Z A;  3NTK A;  1UB4 A;  3RUX A;  3L2R A;  3CCE T;  2QXF A;  1X01 A;  2BKD N;  5GAN 8;  3QJY A;  3KBG A;  1G3Y A;  2QQ9 A;  4M7D G;  2VV5 A;  3MEW A;  1N9S A;  1H3Z A;  5DM7 R;  4M78 D;  3CMA A;  2JOY A;  2K5I A;  2EFI A;  2KAF A;  3MET A;  5GAO r;  2MMP A;  2QQR A;  3S3M A;  4PLI A;  3QBY A;  2CS7 A;  1VQL A;  3OBY A;  2YLC A;  3VJP A;  1YI2 A;  2K5F A;  3NFC A;  4HA8 A;  2DPP B;  3C95 A;  1TH7 A;  1QP2 A;  1NPR A;  3A5Z B;  3HRS A;  3L42 A;  2JTM A;  3C12 A;  2RB6 A;  5M9O A;  5GAN 5;  4FIB A;  3SDZ A;  4M7A A;  2WSC E;  3JCM f;  2QEX T;  5IN1 A;  4J6X A;  5GAM g;  3CCS T;  3GIB A;  4M78 E;  3DB3 A;  3M58 A;  3JCM P;  2E10 A;  5LJ3 g;  4RMO A;  1M5Q 1;  4N4G A;  2DD4 A;  1O9S A;  3MO8 A;  3JCM d;  5GAO n;  2KMT A;  4PJO C;  1QVG A;  3OA6 A;  5C0M A;  2XK0 A;  3PMT A;  3CCR A;  4ZTF A;  5GAN g;  3G4S A;  2DO3 A;  1QVG S;  2DIQ A;  5I21 A;  4A4F A;  3OS5 A;  3OS1 A;  3OYC A;  1QVF A;  3QJ6 A;  1Y96 A;  1P92 A;  1QVF S;  5FU6 B;  5FRN A;  4A4K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...