1O6LA

Crystal structure of an activated akt/protein kinase b (pkb-pif chimera) ternary complex with amp-pnp and gsk3 peptide
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
Knots found
sequence length
337
structure length
316
Chain Sequence
KVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAMKILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFHLSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEGISDGATMKFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFELILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQKKLLPPFKPQVTSEVDTRYFDDEFTAQSITQEMFEDFDYIADW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords RAC-BETA SERINE/THREONINE PROTEIN KINASE
publication title Crystal Structure of an Activated Akt/Protein Kinase B Ternary Complex with Gsk-3 Peptide and AMP-Pnp
pubmed doi rcsb
source organism Homo sapiens
total genus 92
structure length 316
sequence length 337
other databases KnotProt 2.0: Artifct K 41
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2002-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00433 Pkinase_C Protein kinase C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1o6lA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1o6lA02
4AA5A 3F5PA 2HY81 4GYIA 3RCJA 1WBTA 3JS2A 3LFSA 3QTQA 4G34A 4L7SA 4DGOA 1OB3A 3E92A 3IDPA 5ANIA 4ALUA 2RIOA 4JRVA 2DUVA 5IEVA 4TWPA 3GVUA 4BTJA 4G16A 2IW8A 4FT5A 4AN3A 5HD4A 4C4FA 4E6QA 3G15A 4A9UA 4D2WA 5A4EA 4QYEA 3E8NA 2G1TA 4Q9ZA 1I09A 5ACKA 3TUDA 2CCHA 3P0MA 4O7LA 4XMOA 4BKJA 3H0YA 5CALA 4MHAA 5HO8A 3VWAA 3MV5A 3FKOA 5KUPA 3S0OA 4Q5EA 3ULZA 4S34A 3E3PA 2GNJA 4FTUA 3Q5ZA 3AC8A 3UIXA 2CKEA 3ODYX 1O6YA 4DC2A 2GPHA 4M0ZA 5KO1A 3TEIA 2Z60A 3VUTA 4HYIA 2G15A 3NCGA 5DLSA 2GU8A 5A3XA 1BI8A 4JR7A 1K2PA 2WMVA 1IASA 3V5PA 3LCDA 3EQRA 2HXLA 5FM3A 3LXKA 2WAJA 4QMWA 4QP1A 3TV7A 1FMKA 2C1AA 3COKA 3DAEA 2X2KA 4RG0A 3A7HA 4O0VA 4W4XA 2O64A 4GRBA 3QUDA 3G9LX 4D1SA 5HO7A 3D5XA 2B9JA 5AP2A 2QOKA 4L3LA 3ZYAA 4EOOA 2JAMA 4HVHA 4EH5A 3U51A 4PL3A 3CE3A 3PPJA 4MK0A 4V05A 2W9ZB 2JIUA 3EQBA 2F2UA 2V5QA 4FT7A 4GFGA 4LOPA 3UC4A 4ANNA 4E6CA 3QWKA 1ZY5A 5TOZA 1PYXA 3WZDA 4GCJA 5HICA 1OL2A 5CSVA 2ZB0A 2WMQA 3DDPA 4FYOA 5LMKA 1J7IA 3MFSA 3P78A 3ORPA 2XBAA 3QCSA 3KMMA 5I0BA 2BZJA 5ETIA 2O63A 4AZWA 4EHVA 3KRWA 2DWBA 5HG9A 3QQUA 4QMXA 3DJ6A 4ZTSA 4GK4A 4U6RA 5BVKA 5HX6A 3SGCA 4JX3A 2HAKA 2PE1A 3CTHA 5KMNA 2Z7SA 3NVKI 3O8PA 4GJ2A 3TN8A 4QO9A 3Q9ZA 4L00A 2ZV7A 2C3IB 1JWHA 4V0GA 4YZ9A 4M14A 5EM7A 4U97A 3LFNA 3IW6A 5EYKA 1LUFA 4DEIA 3H9FA 1YWVA 2UW0A 4FTCA 4IXPA 4FSWA 2BIYA 4NCTC 5HNGA 5KX8A 2XA4A 3K2LA 4GK3A 4EC8A 4YUQA 4OBPA 3UPZA 4CFFA 3A8XA 4AOTA 3LFDA 1R3CA 3A8WA 3C5UA 4NU1A 4RJ8A 5E8ZA 2XVDA 2I0HA 2PZ5A 4D28A 5LQFA 4NFMA 2PMNX 3DBEA 2HY0A 5E1EA 1PXPA 5M4UA 3UDBA 5HZNA 3E8DA 4Y72A 2ERKA 4DG3E 4DINA 4JQEA 2Y4IB 5CTPA 5E92A 3L9MA 1TQPA 3VUKA 2Q0NA 2X2MA 3BHYA 5CNOA 3F2AA 5M4CA 2PU8A 1G5SA 4O0XA 3GI3A 1XBAA 4FMQA 4IM0A 2W1CA 4XOZA 3OCBA 4A4XA 4F0GA 4BR3A 4RZWA 3DV3A 3OUKA 2C5OA 5T3QA 2JBPA 5BVNA 3QAME 1KE9A 2HCKA 4E5WA 5CF8A 4WUNA 2ITPA 4DG0E 2XNBA 4FEQA 4BDHA 2QKWB 4MNFA 5I9XA 3QXPA 3VHEA 2UZUE 1E1VA 2XNOA 1OL7A 1M7NA 4GUEA 2ZB1A 3CQWA 1PXOA 2WU7A 1U54A 2UW7A 2ZM1A 2O3PA 3BRBA 4YPSA 2YM8A 3L8PA 5JKGA 5EI8A 4IVBA 4DLJA 3U55A 2G9XA 3OOMA 4RWKA 4I24A 5CF6A 3ZLWA 4GW8A 1VJYA 3I6WA 2W1EA 4L53A 5EOLA 2VTTA 4LQMA 4IB1A 1NVQA 1URWA 3LJ2A 4ITIA 2WMXA 3TDWA 2F7XE 3HYHA 3PE2A 4FF8A 5D9HA 5ANGA 2YCQA 3ZRMA 4I6HA 4C34A 3UP7A 3ZSGA 2WTKC 4CCBA 4XBRA 2QOHA 2GTMA 3BLQA 4GG7A 4L68A 3ZO2A 4K18A 5EHLA 4GS6A 4G3CA 5DR6A 4JRNA 2C6EA 5TR6A 1SM2A 5CSWA 5FDXA 5IA5A 1KWPA 2KTYA 5AX9A 2UZBA 4PQNA 4DITA 3KCKA 2OJGA 3AGLA 3CJFA 2BDFA 2ITNA 3DFCB 5M55A 5FXRA 3NYOA 3LM5A 3LXLA 1ATPE 2WNTA 1YXTA 4FX3A 4B0GA 4FGBA 1J7UA 5AFVA 3DQXA 3AMAA 3PXFA 2E9UA 3QA0A 3TT0A 3OZ6A 4GK2A 3ORLA 1ZMUA 3NDMA 4YJSA 4USDA 1TQMA 4V0GB 1JNKA 1JVPP 5AA9A 5HTIA 4F65A 5CZHA 5AX3A 4L3JA 3R2BA 4WIHA 4O21A 2OJIA 4IAZA 4GJ3A 2CNQA 2XK4A 3EL8A 5HORA 3JR1A 2PVMA 4WNPA 3VBXA 4USFA 4KS7A 5J5TA 3PP0A 4LI5A 2YFXA 3MJ2A 3VRZA 2QU6A 4IB5A 3R7IA 2VZ6A 2RG5A 4C35A 4Z7HA 1P5EA 1DS5A 4IIRA 3MH1A 4QP6A 3TUBA 4ZSGA 3VUHA 4G6NA 1XH8A 4EZ7A 4CRSA 5HE3A 3RAWA 3R7OA 4HCVA 1H1WA 4ACCA 3QA8A 4F99A 2PVYA 4DBNA 2BIKB 3ALOA 3MS9A 4JBVA 4E4LA 4Q5HA 4EHGA 4EEVA 3LCTA 1YVJA 2QO2A 3P7AA 2B55A 4X2GA 3UG2A 2VX0A 3W2CA 3AG9A 3ZOSA 1V0BA 4LGDA 3R7GA 4X6RA 4DA5A 2KULA 4FZDB 4Y5HA 3R8MA 3ZH8A 3OCSA 4S30A 2Y7JA 3FI4A 1ZWSA 3PVGA 2CNUA 3F7WA 3NX8A 3FHIA 1B6CB 4PNKA 2EB3A 4LGHA 2O65A 4I23A 4MWIA 3MGYA 4TTHB 5FDPA 1U54B 5GZ8A 3TM0A 5I9YA 2WQEA 2W5BA 2J7TA 1U5RA 3BBWA 3KN6A 3MN3A 3HDMA 2UVZA 4U80A 2RF9A 4E3CA 1H1SA 1B39A 5C1QB 1Z9XA 2IG7A 3RNYA 2B7AA 4DF3A 1W83A 2E9PA 3HUCA 1P14A 1PKGA 4IWDA 3R9DA 1T45A 4HVIA 3CD3A 3ATSA 2JKQA 3LXNA 5LVMA 3GFEA 4QRCA 3N4UA 3KRXA 4ZMFA 2XCKA 3LJ0A 3KXZA 4IDVA 4K0YA 3RWPA 1XQZA 4O0YA 4UXQA 1PXJA 1OKVA 4QMMA 4BZNA 2R5TA 5ETFA 3GP0A 4ACGA 4RX9A 4EH2A 3EHAA 1GZ8A 4QYHA 5DWRA 3LKMA 3G0FA 4I5HA 2WQNA 5AP1A 4MXZA 3FMEA 1OIUA 5HBEA 4U43A 2BPMA 3D5WA 5KMJA 5E8UA 4BI0A 4OTRA 3ZO3A 4EHZA 3KY2A 3W2PA 3LZBA 4ZTRA 4NM7A 2SRCA 2X1NA 4FSUA 4K1BA 4LV5A 2IW9A 2VTLA 3WF6A 4DCAA 3W1FA 2FSLX 2QR7A 4XYFA 4U41A 3FMHA 2JIIA 1YOLA 2WIHA 4PWNA 4L44A 2OZOA 4FBXA 1RJBA 3QRKA 4AGWA 1H00A 4FV7A 5JFWA 4IM2A 3VUGA 4RZVA 2RL5A 3S2PA 4UYNA 5E91A 3UVQA 1RQQA 4ASXA 2QO7A 4C3FA 2XZSA 4EHEA 4YR8A 2QOLA 4XHKB 5IUGA 3DNEA 3F5XA 4AZSA 2NNWB 1Z5MA 4M12A 4J53A 1W8CA 4RPVA 4QTEA 3E3BX 4DH3A 1STCE 4A9YA 3PYYA 1FVTA 3HX4A 1Q61A 1FBNA 4N6ZA 5FWKK 5BNJA 3R8ZA 3LIJA 4UMRA 3WF8A 3ZU7A 5J9YA 2IJMA 4WRSA 1OL5A 3GC8A 1NXKA 3IG7A 4YHFA 5L2WA 3K3JA 3VS4A 4C36A 3T8OA 3P7BA 3PVUA 4MAOA 5KCVA 3CTJA 4IAAA 2UW9A 3TNPC 2YDIA 4RJ5A 3WILA 3PY0A 4N70A 1TQIA 2OICA 3ORZA 3NUPA 4F4PA 5DVRA 1GOLA 3R7UA 3L1SA 4DH7A 3TJCA 1PRYA 5F94A 2WTDA 2JAVA 4FKIA 4JAIA 4XG2A 4OTIA 3UVRA 4MQ2A 4QMOA 4DBXA 2WU6A 4M69A 5DG5A 2UZLA 2ITQA 3ZO1A 2PL0A 2IZUA 4JDHA 4ZSEA 2BFYA 2VTJA 2C5XA 5LCJA 2YZLA 3MPAA 5LVLA 1URCA 4IC8A 3JYAA 4FZ7A 4F6SA 3NSZA 4RC4A 4R1YA 3UZRA 1U5QA 3ORXA 4H3QA 3NLBA 5AR4A 2XNPA 2UW5A 5GJFA 5HIEA 4C3PA 1UVRA 4ENYA 2WTVA 3TCPA 3G6GA 5J79A 2VO3A 2XMYA 3TI1A 2PYWA 4CKJA 2VO0A 3BYSA 3TL8A 4KB8A 4X2FA 2VN9A 4S31A 5KMMA 4GT5A 1OPJA 4CTBA 4G2FA 5FTGA 4OW8A 4NM5A 3VBVA 1OIQA 3VW8A 2HW7A 2NO3A 1A06A 1ZYDA 3MY0A 1WBWA 4DH8A 2JC6A 4RX5A 3QU0A 5ANKA 2ETKA 3EQHA 4DLIA 3BGPA 1GZNA 1J1CA 1JBPE 1VZOA 2I0VA 4PDSA 3ANRA 3QZHA 2HWOA 4XV3A 3WYYA 5LMBA 2R9SA 4FV3A 5AAGA 2RGPA 3DAJA 4YSMA 2YWVA 1APME 3VS6A 5DR9A 3ZBFA 4AACA 3BEGA 5IEXA 4OLIA 4UYAA 3PSBA 2C3JA 3Q2JA 4RT7A 3JXWA 2GTNA 4IH8A 5L8JA 5K9IA 2XK9A 2F7ZE 3WZJA 4IHPA 3BZ3A 4YHTA 5BYLA 2B9FA 4ANQA 3ZSIA 3TNQB 3C50A 3FV8A 5CU3A 3QTIA 5B2MA 4BVUA 3QLGA 3ERKA 5LMAA 2I40A 3LLAA 3W18A 5LARA 4FG9A 3OXZA 4TT7A 4WOVA 2WEIA 4QMPA 3ZMMA 2XNEA 3ZEWA 3PPKA 2OF4A 2X4ZA 1R39A 4QMQA 4F08A 3BWFA 4FIIA 3V8TA 3IKAA 2WMTA 3MB6A 4PX6A 5D12A 5B0XA 4JS8A 4BDAA 3KB7A 3NRMA 3E88A 1H27A 4K8AA 3SW7A 2CKOA 4QQJA 2V7OA 4OBQA 3F3UA 1Q8YA 4XLIA 5HNBA 3FQEA 3EQCA 4NM3A 3SDJA 2ITWA 3BLHA 3O17A 4TWCA 4MXAA 3E7VA 1ZY4A 2OZAA 3ZM4A 4D2TA 4L45A 4KUJA 4RQVA 2ZVAA 4JDIA 3R02A 4L3PA 5AV0A 3GCPA 4K9YA 4PNIA 5TKDA 2X4FA 4FTIA 4M69B 4IMYA 3NWWA 1FGIA 2IVTA 4JDJA 4U8ZA 4BCQA 4CZUA 3Q53A 2YM3A 5H8GA 2J0KA 4RC2A 2VAGA 4FVQA 4GU9A 5IA3A 4JQ8A 1SZMA 3R9NA 5J95A 4X7QA 2F9GA 4H58A 4KRCA 4M15A 4BBFA 4IC7A 2X6DA 5IA2A 2XIZA 3BHHA 4F63A 2WOTA 3F66A 5E8SA 4YJTA 5M56A 3UIMA 4A7CA 3TKHA 2XKEA 2R3JA 3MYGA 3ZXZA 1IRKA 4EKKA 3H0ZA 4DGNA 3P23A 3QQLA 5G6VA 4NUSA 2CHLA 1OVEA 5AAFA 4EQCA 4FZ6A 2IWIA 3O0GA 4XJ0A 4RJ4A 4CCUA 3OTVA 5FXSA 3E87A 3RNIA 3CLYA 3PUPA 2VWWA 4RIXA 3AT2A 3AT3A 4UMTA 3BIZA 4AXAA 3CPCA 5A6OA 5IISA 3DGKA 4XV2A 4IAYA 3QFVA 4KSQA 4WG5A 5HOAA 3NIEA 3JY0A 3UMWA 1Q8WA 4V01A 2YAKA 5DR2A 2A1AB 3V04A 5LWMA 2QI8A 2W17A 4WSYA 4EK4A 4W4WA 1SMHA 3A60A 4CTCA 1KSWA 3QHRA 1UU9A 4QQTA 2BKKA 2J5FA 4FTLA 2VWYA 4R3RA 1WVYA 3N9XA 3PXRA 3ZC6A 4HVSA 4BBMA 2CCIA 3DDQA 2WMBA 4EOQA 1UU7A 2BKZA 1H07A 3OVVA 4KD1A 2C6MA 1SVEA 4X3FB 3P1AA 4JBQA 5CYIA 3UOHA 4BCPA 5DI1A 1BYGA 4IAIA 2J0IA 4IM3A 4TRLA 4H05A 5KKRB 3CPBA 2PMIA 3DXNA 2YCRA 1OMWA 3MVJA 3NW6A 5CU6A 2IPXA 3PDTA 3OUNB 3DK3A 2J50A 3DK6A 4UZHA 4KKHA 4GKHA 2G2HA 4NFNA 4J95A 4W4VA 4YPDA 3AOXA 3TIZA 3LCSA 3A4OX 4LV8A 4ZP5A 5AV1A 3HRFA 1VEBA 4H1JA 4YGAA 4EC9A 1VYZA 1CM8A 2R2PA 3RM7A 3VAPA 3I6UA 2E9OA 3PE1A 4DE4A 2FGIA 2BALA 3LLTA 4IEBA 3CKXA 2AC3A 3V01A 4DEDA 4FIHA 3D4QA 1VR2A 4R5SA 1OGUA 4PMTA 3IOPA 4O0RA 3UBDA 4O91A 3SV0A 4A9SA 4R6VA 4L67A 5ACBC 3LQ8A 3C7QA 4QMLA 2ZJWA 4I21A 4CYJA 3PG1A 1FOTA 4RFZA 4C2WA 3RP9A 5EKOA 4UALA 3ZHPC 4TYIA 4FT3A 5M57A 4Y8DA 1CDKA 3FC2A 3C4XA 4L7FA 4BDIA 3WARA 5AP4A 3HNGA 2P33A 4HVDA 3DCVA 4R1VA 2P3GX 4WBBB 5C03A 1DM2A 2XJ0A 3WE4A 4TYGA 2YA9A 4RFMA 1UNGA 4X3FC 4O7RA 5BVWA 3KF7A 5DGZA 1XBCA 2YIRA 3NUUA 2FSTX 3ORTA 5HG5A 3VUMA 3ZSHA 1YHSA 4WT6A 4CG8A 2BRBA 4APCA 5HU3A 1OKZA 5AUVA 4O83A 2VTQA 4RIXB 2VWZA 3OCGA 4M68A 2ITZA 4NCTA 3QALE 3CKWA 3IK3A 4G3DA 4GKIA 5JN2A 1H28A 5EQYA 4IBMA 5DT3A 3M2WA 3NW5A 2XRWA 4G6OA 1WVXA 3BHUA 4LUDA 3Q4TA 5ANDA 3JUHA 4GSBA 3SRVA 4UMUA 2C0TA 4I4FA 4D58A 4H1MA 2XIKA 5KZ0A 4O27B 3VS1A 4EK6A 2XK8A 3K54A 5CU0A 3CSVA 3EFWA 5DBXA 3WZUA 4FYNA 4X3JA 4JG7A 4QYGA 2PHKA 3BLRA 3K3IA 4LRKA 4YJVA 5HCXA 2EXEA 5L6WL 4ASZA 1Q3WA 3Q04A 4HYSA 4TZRA 5IDPA 3HA6A 4JBPA 2YCFA 3FYKX 4FTOA 4EQMA 1CTPE 3A99A 4BHNA 4C33A 1WBPA 2E9NA 5L2QA 1JKTA 2ITTA 2WZJA 5CENA 2CPKE 5LWNA 4YC8A 2R3LA 4QMYA 3TIYA 5KHXA 3R22A 2QO9A 2P2HA 4BCFA 4A4OA 3SOAA 4AP7A 3C4WA 2C3KA 3KXMA 4LG4A 2VRXA 3PZHA 4O0TA 2V22A 5HE0A 2XIRA 3QYWA 4O1PA 2ZDUA 2G01A 4LRMA 5J7BA 1VYWA 4RVTA 4FSRA 4U79A 2PMOX 4BN1A 5E8YA 2JEDA 4D4VA 3RPRA 3R9HA 5B2KA 5CY3A 4RFYA 4MVFA 1JPAA 3V5LA 1ZXEA 4E20A 3AT4A 4EYJA 3KULA 3FDNA 2GHMA 3UYSA 5EH0A 2QVSE 2PZRA 4YHJA 4EOSA 1UWHA 5M53A 2XCHA 1ZRZA 4FR4A 4GT4A 4FGRA 1FMOE 2ITVA 4OT5A 4Z9LA 4QMSA 4EORA 2WXVA 4PMPA 4ZLYA 5IQAA 1XH7A 2BDWA 5F1ZA 3FZTA 2WEVA 3D83A 4JXFA 3PFQA 2C1BA 3TDVA 4CD0A 5DN3A 5EM5A 5FD2A 3FLSA 3GCQA 3B2WA 3DJ7A 5EI6A 4RA5A 1YXVA 3B8QA 4PTEA 4OTQA 3D14A 5CT0A 2C47A 4QPMA 1B38A 2XUUA 3G0EA 2EWAA 5CVGA 3W8QA 5A4QA 1OBDA 2WPAA 4GIIA 2H96A 3QUEA 4G3FA 5AEPA 1M14A 3FSKA 3MTFA 2WTJA 3G5DA 3KC3A 4FKWA 3S4QA 3ROCA 5C26A 5HG8A 4JBOA 3QTUA 3RHXA 3TV6A 4XNEA 4C4HA 5L4QA 2QC6A 2X2LA 4FICA 3MPTA 5JGDA 4I5MA 3FHRA 3EN5A 2YLFA 4KS8A 4YZBA 4F09A 2WQBA 2YDJA 1OKYA 1Q8ZA 3L8XA 5A6NA 3R9OA 2JIVA 4AZFA 5ETAA 4DCEA 3EN9A 4FZFB 3ZRKA 5LVNA 4G9CA 5HI2A 1SVGA 3WIGA 5DT4A 3V5TA 3R1QA 3LM0A 4FKOA 5DFPA 3W8LA 1GIIA 1Z57A 4ASEA 2LAVA 4E93A 5M4FA 2HWPA 3PSDA 3HA8A 2VTIA 3H3CA 4O0SA 3ATTA 4QT1A 3WF5A 3SRVB 1PMVA 3UOLA 5IMEA 3NNXA 4R3CA 4EOLA 4F9CA 4CZYB 3TZMA 2QNJA 3OMVA 3OC1A 2WB8A 3Q60A 4NIFA 2VTHA 4JG8A 1KE6A 4O22A 4AG8A 3OY1A 3NVMB 3MFUA 2W06A 2EXCX 3B8RA 3FUPA 4ALWA 5A14A 5L8KA 2QCSA 2OH4A 4K11A 2YEXA 4FTMA 4J99A 1Q97A 2CGUA 3PXYA 5E1SA 5AWMA 1XWSA 5HCYA 3RWQA 3QD4A 4NEUA 4PF4A 1R0PA 5AV2A 4IX3A 3R83A 3ROYA 3JY9A 3W2OA 4C4JA 1M7QA 3UO5A 1OIYA 2J6MA 1ZOHA 1ZYCA 3K5VA 5DPVA 4QNYA 2JFMA 2PUUA 5ETCA 4E4MA 2BHEA 3Q4ZA 3ZEPA 4AZEA 3F6XA 2ZM4A 3GCSA 4FSYA 4ORKA 3OY3A 3T9IA 3RK9A 4ANSA 4A07A 2I0EA 4IQ6A 5EFQA 2XIYA 4DFNA 5AP6A 5BYYA 2QU5A 2R3OA 3GOPA 4S33A 4I0TA 3F9NA 3KULB 4TXCA 3QL8A 4CT2A 5BVDA 2RFEA 4LL5A 4OTHA 5KZIA 3TJDA 3FLQA 5IQDA 4DH1A 1P4FA 4ITJA 5IQIA 4DH5A 1PXKA 1GJOA 3GFWA 2PPQA 4UEUA 2YIQA 3GGFA 2CLXA 4YNOA 3EFLA 4R3PA 2WFYA 4TNDA 4U44A 1ZYLA 4K2RA 2VX3A 3FZSA 3UO6A 4U42A 2FH9A 2WTKB 3DLZA 3F3ZA 4AT5A 5C8KA 2JDVA 2QOCA 3GQLA 2ZV2A 2BAQA 3FLWA 1WAKA 2HOGA 2YZAA 4IFGA 3NZ0A 2R3RA 3I5NA 4FUYA 4BWXA 2BRNA 3EJ1A 3BE2A 3MDYA 4O86A 1UNHA 4CG9A 2XNNA 2C68A 3TTIA 4F6WA 3Q32A 4IZYA 1BL7A 3OWLA 4FIEA 5IKWA 3DXQA 4UWCA 1YWRA 4F7SA 2JKMA 4RRVA 5ITAA 1G8AA 5CS6A 1A9UA 4X21A 3VS2A 3NNVA 4M67A 4OAUC 3Q4CA 4AX8A 5BMMA 5IQBA 4CKRA 4C4IA 4EUTA 4F1OA 3LE6A 4QP3A 2UVXA 2J0MB 3NEWA 4KRDA 5ANEA 1W7HA 3UODA 4JOAA 3IS5A 2WO6A 2CJMA 3RTPA 2QD9A 2PUPA 5GINE 2FSOX 1OUKA 2UW8A 2R7BA 4JR3A 4PDOA 3RZFA 4FA2A 3TG1A 3G33A 3IECA 3HAVA 3QYZA 4ZXTA 5DYJA 5CEMA 2ZMCA 1QMZA 2BZIB 2XBJA 4JQ7A 4YTCA 4NH1A 4NIFB 4CKIA 2O5KA 2GDOA 3GU7A 4GL9A 5E7RA 4DGLC 3DXPA 3BHVA 3BV3A 4BTMA 4WUAA 3TTJA 3SG8A 4F0FA 5CAQA 3NMUF 3Q6WA 4E1ZA 3SAYA 2BMCA 5I3RA 3W2QA 3LMGA 3C4CA 3Q5IA 5L2TA 4EOMA 4HCUA 3U4UA 5AIKA 3L9NA 4M8TA 3ENMA 4BDJA 3P86A 3RBWA 2VNYA 2XK7A 3R1YA 2BRGA 1ZYJA 3OT3A 1M2PA 3PA5A 3I4BA 5E8VA 3SLSA 3CD8A 3PVWA 1W84A 5CSHA 3E63A 3O8TA 4EOKA 3HDNA 1JKLA 3O23A 3P08A 3QZFA 2QOBA 5BYZA 4C58A 4MCVA 3UJGA 3MFTA 4FEXA 2VD5A 4DTKA 2ESMA 1K3AA 4XEYA 1O6LA 5KBQA 1XO2B 5CF4A 3SX9A 4QMVA 1XR1A 1SNXA 4BCMA 1A48A 4BKYA 5J1VA 3DBQA 1KUTA 5M06A 1QL6A 5TE0A 4D4SA 2Y8OA 3ZS5A 4BCHA 5JSMA 5AIRA 3EH9A 5HTCA 3H9OA 3KCFA 2X9EA 5CANA 3CQUA 3ORKA 4IVCA 3QQGA 4YC6A 4YTHA 3R30A 5DHJA 4BIEA 4USEA 1H25A 3H10A 2HZ0A 5KMKA 5E4HA 2X8DA 2RFSA 4RLKA 4Y95A 3NUSA 4ACHA 2JGZA 3AC5A 1PXLA 4UBAA 4C4EA 4FSNA 4HZSA 2W1HA 3O7LB 5B7VA 5EK7A 2PE0A 1H0VA 4PTGA 4GIHA 1H1QA 1UNLA 3QZIA 4BZDA 3L8VA 4L6QA 4F9YA 4RIWA 3QX2A 4CNHA 4PDYA 3DTCA 5L2IA 3NUAA 1OL1A 3RK7A 4U45A 3ZTXA 3I1AA 2WTIA 3QC4A 4BDBA 3PRFA 4L42A 3UNKA 3FZPA 4TWNA 3IDBA 3V5JA 3ZLYA 1OIRA 2XH5A 2ERZE 1ZMWA 2XJ1A 3PPZA 5HX8A 5AA8A 3VJOA 4QPSA 2IVVA 3AC1A 4C3RA 4H36A 3D5UA 4C62A 4EOJA 2FYSA 3E62A 5GJDA 1UU3A 3ZC5A 2Z8CA 3FMNA 1AD5A 2WD1A 3UGCA 3UO4A 3VUIA 3EIDA 3FBVA 4AN2A 3GU4A 3OEFX 4NTTA 4DFUA 5ANJA 3PLSA 5KMIA 2GMXA 4JDKA 4TNBA 4CGAA 4AW0A 3S3IA 3VNTA 2PVNA 4DYMA 4XG9A 2GS6A 3MA6A 3QWJA 4AA4A 5L2SA 5AM7A 3CC6A 3UG1A 1IAHA 1PXIA 2VNWA 3E8EA 1KV2A 1REKA 4IFCA 2PMLX 3NAXA 5I9ZA 5BVFA 4TN6A 3T3UA 2W4OA 5GZ9A 3I0OA 2WMWA 4EZ5A 4FEUA 3R63A 3V5QA 4F1MA 4XV9A 4R7HA 4E4NA 3QCYA 3R8VA 3R04A 4BCJA 3GQIA 3OW4A 2BILB 3D7TA 3AD4A 3FYJX 1FPUA 3QCQA 4N4SA 4O6EA 4X2NA 3U9NA 4IWPA 4U5JA 3HP5A 3KREA 3QLFA 4UXLA 3MVLA 5K4IA 3JVSA 5KHWA 3BKBA 5CEQA 5DMZA 1ZMVA 3EL7A 4I6QA 4OTGA 2X7GA 3COHA 5AR2A 4ZTQA 1OITA 2YM4A 3G51A 2Z7LA 2XJ2A 4FNYA 3TWJA 4F9AA 5I4NA 3EB0A 5FM2A 4DGGA 5J8IA 1PY5A 5BPYA 3NIZA 4CMOA 3TUCA 3QQJA 4KIKB 4J7BA 3QRUA 4ZJIA 2YCSA 5CAUA 2JDRA 1PMUA 3WOWA 3G9NA 2GQRA 1ZAOA 1WZYA 4ZS0A 3DLSA 2X7FA 5K0KA 4YJQA 5IQHA 2BZKB 1XBBA 4FTAA 2CGXA 2NRYA 5D7AA 3FY0A 3UQCA 4EWHA 4I92A 3C51A 3DBDA 3HECA 2GNLA 4IVDA 4CSVA 5IH5A 3QRJA 1WVWA 3HZTA 4L01A 5IQFA 1YOMA 4QMUA 4B8MA 1Q62A 2A19B 2BRMA 4RIWB 4QMNA 3HV4A 1KV1A 3BYMA 2BTSA 4ZY4A 4UZDA 2FUMA 4AZVA 1S9JA 3Q4UA 5HEZA 4Y46A 1AGWA 3HMIA 3ACJA 4N0SA 4OAVB 2BAJA 4QPAA 4WA9A 3MIYA 4ALVA 3OCTA 5EDQA 2FO0A 3MVMA 5KNJA 2VTSA 2R3FA 3QGYA 3A61A 4HNFA 4I1ZA 4IZ5A 4RIOA 3VS7A 3ZONA 4A06A 5FEQA 4ZSLA 4FSTA 4FV2A 3QRTA 3BHTA 4YZMA 3GB2A 5EW3A 4IANA 3CIKA 3GU6A 3UNZA 3UIUA 5AR7A 2BFXA 2W1IA 3UMXA 2ONLC 4BHZA 2VTMA 3FQHA 3KEXA 4PUZA 5E9EA 2A27A 3POOA 4FODA 5TO8A 2XM8A 4UN0C 4P2KA 4ITHA 2VV9A 3RJCA 3FXWA 4ZOGA 1JSVA 4AE9A 2V7AA 4CFMA 2IW6A 3KXGA 5J9ZA 4FZAB 3R9RA 3DZOA 4BDCA 3A4PA 1KOAA 5FLFA 3IPHA 4IW0A 4QP4A 4D9TA 4OTPA 1J7LA 3HMOA 2XF0A 5A54A 4L9IA 1M2RA 5B2LA 3UZTA 5J1WA 4GEOA 4I22A 3D7TB 3Q3BA 5JT2A 5CNNA 3I5ZA 2BDJA 3R01A 4IJPA 3ELJA 3F5GA 4U7ZA 4QP8A 3QC9A 3MFRA 4MD7E 2WKMA 1IA9A 3BU6A 3VBYA 2XNMA 4HYUA 2YM6A 2FVDA 4A9RA 4XP2A 2Z7RA 5CU4A 2C0IA 5LVOA 4O7NA 3KRLA 3DKGA 4JIAA 4X3FA 1NA7A 2UZVA 3EWHA 4IJ9A 3T9TA 4X2JA 4I93A 3UQFA 2GQGA 2VTNA 5H3QA 3W32A 4WG4A 3THBA 2PVJA 4G9RA 4AA0A 3QD2B 3FI3A 4JAJA 2HZIA 4X2KA 4C59A 5EM8A 4EZ3A 4YSJA 4YZDA 4CMTA 3R1NA 3DT1A 3FLZA 4CFNA 1F0QA 4BC6A 2Y0AA 3HMMA 3DKOA 1CKPA 3R00A 4I6FA 4M13A 2VO6A 4E7WA 3OF0A 3FLYA 1XH9A 2X39A 5L6PA 3SQQA 5HKMA 2GFSA 2WMAA 4IWOA 4O96A 3ZXTA 2C30A 3ACKA 3IW5A 5DEYA 3FPMA 5AV4A 3C4FA 2QQ7A 4PRJA 2UZTA 4F1TA 5FGKA 5BMSA 2XKCA 4CV9A 1QCFA 2XEYA 2OIQA 2XYUA 4FIFA 4HJOA 4BBEA 3ZO4A 2OFUA 4G3EA 1GY3A 2PUNA 3QQFA 3O51A 4C8BA 4O7TA 2JDSA 4BY9E 3V5WA 1MRVA 4LGGA 4CZTA 4BFMA 1YXSA 4BCKA 2R3QA 4EH3A 3BYVA 2P0CA 2H8HA 4RWLA 3L9PA 1J1BA 2QOOA 3VO3A 3C4EA 1DI8A 3HLLA 2W0JA 3HV3A 4MXCA 3CEKA 3PA4A 1OPKA 2PE2A 3V3VA 4YLLA 4EBVA 4OGRA 4BDDA 4BTFA 2Q0BA 2YACA 5JZJA 1UKIA 4DTBA 3LAUA 2QURA 3IQ7A 4QTDA 4TL0A 5F20A 3QKMA 1H1RA 2VO7A 1FVRA 3PJ3A 3Q52A 4GT3A 3LXPA 4B9DA 1FINA 4LMUA 2AC5A 5A9UA 3FQSA 4RX8A 3QTZA 2W1FA 2BAKA 3IDCA 1YDRE 4W9WA 4J71A 4C0TA 3ZDIA 3NGAA 3N51A 3TZ9A 4YJUA 1PXNA 3S00A 3FKLA 2OW3A 4V04A 4AAAA 1DAYA 4KBAA 5K5NA 1JKKA 3SXFA 3CBLA 4JG6A 1UV5A 3AQVA 3OW3A 4FVPA 4DEAA 5L6OA 2W05A 5HBHA 1ZYSA 4J8MA 1GIJA 4FC0A 2GHGA 4MF1A 5EW9A 5FTOA 3RK5A 4Z7GA 5IQCA 2W4JA 2X7OA 2QODA 5EYDA 4ZJVA 2YM5A 2BZHB 4E6AA 5BQ0A 3BX5A 3EN4A 5CLPA 2PVKA 5ICPA 3TZ8A 3DFAA 4YLKA 5DE2A 4ENXA 3SD0A 5AR8A 4QTCA 5DRDA 3DOGA 1YRPA 4MXYA 4YO4A 5AUZA 3HUBA 3VJNA 4ZLZA 3NAYA 5DNRA 4RJ6A 3LFEA 4M3QA 5C8MA 2GNHA 4ZAUA 5FTQA 3BQCA 4IAFA 3TV4A 3R2YA 3QBNA 2P4IA 3OWPA 3S95A 4RWJA 1I44A 4ZY5A 3QCXA 4M0YA 3VS3A 4EH6A 2C0OA 1BL6A 3CR0A 3EQDA 2W7XA 4XP0A 4FIGA 3G90X 1IEPA 3OP5A 4O7ZA 3I0QA 5EYMA 5IA0A 4CMUA 5IUHA 3DAKA 5G1XA 2YAAA 1MUOA 3UC3A 2PVRA 3GUBA 4WG3A 4JVGA 4CLJA 3UIBA 2QKRA 4F6UA 5CF5A 4GU6A 2C5NA 2IZSA 4H3PA 3UZPA 3ZFXA 2HENA 4EK3A 1ZLTA 3GNIB 3R0TA 1JLUE 2Y6OA 4GYGA 3DTWA 5FEDA 4DFZE 1BMKA 3D15A 3CCNA 4QQCA 3E93A 4WSQA 1YDSE 3QGWA 5T6KA 1XH6A 2F57A 4IZ7A 4JNWA 5AP3A 1YOJA 3MY5A 2WQOA 4ZZMA 5FQDC 4EOPA 1CKJA 1WCCA 4IVAA 1YI4A 3JVRA 4KWPA 4UWBA 3U6JA 3PWYA 5BUEA 3F7ZA 4TYHA 4BIDA 4JJRA 4E5BA 3IW7A 5HLNA 5I5ZA 1WBSA 4G31A 2IVUA 2NPQA 4MKCA 4O1OA 4AU8A 4EBWA 3SVVA 3PJ2A 2OXXA 3M42A 5D41A 4FT0A 4BCGA 2R3KA 5KMLA 3AXWA 3NUXA 2WMRA 3BWJA 4GVAA 4ZMEA 4O82A 1MRUA 2PZPA 2W1GA 4XV1A 4BGQA 3VW6A 3DB8A 4AQCA 1M52A 3KQ7A 3ITZA 3FXZA 1SYKA 2GCDA 4GG5A 2Z02A 4EK8A 5AJQA 2VWXA 3QRIA 3QX4A 1Y8GA 4P5ZA 3FPQA 4KBKA 3R1SA 1QPCA 3BCEA 5JFXA 4FI1A 2BCJA 3MY1A 3C1XA 3G2FA 3IONA 3MWUA 3PIZA 4G6LA 4XH6A 5HESA 4BDKA 3KVXA 2QR8A 1G3NA 2UW3A 4O7YA 4FKQA 5CEPA 3GU5A 2R3MA 5TF9A 4QTAA 4KA3A 4EQUA 1DI9A 2R3HA 1WBVA 2XP2A 3GEQA 3QD0A 3QTWA 4AOIA 2QHMA 3RPYA 1Y57A 3OS3A 3TKUA 5IF1A 5BVOA 4UB7A 2QOFA 3KKVA 3PJCA 4L43A 2AYPA 5CEKA 5TT7A 4FV1A 2VGOA 1CSNA 3CXWA 3MH2A 1BKXA 3AD6A 3D5VA 3VF8A 2B4SB 2E9VA 5KMOA 3V6RA 4CT1A 3F2NA 4KKGA 3FMJA 2QLQA 3VBQA 4DN5A 4EKLA 2WMUA 4EONA 5IA4A 4MD9E 3GBZA 5CASA 5A4TA 3SXRA 1RDQE 4WNOA 4FK6A 4EH9A 3N4VA 3LQ5A 5K0XA 4ANLA 4AT4A 2B9IA 4KSPA 3DB6A 5K5XA 4ERWA 4PP9A 1Q5KA 2OXYA 3OFMA 3C5IA 3NYNA 2P2IA 4ONAA 2OSCA 3RVGA 5FRIA 1FVVA 4CQEA 3GC0A 4C4GA 4CLIA 3JPVA 4YP8A 4ZSAA 3BBTB 3PXKA 4H39A 2CSNA 3F61A 2Z7QA 4I3ZA 1RW8A 4W8DA 4AE6A 5LXMA 5DT0A 3MBLA 2GQSA 1YHVA 1XKKA 2XEZA 1OZ1A 4M84A 3KK8A 4TYHB 4RMZA 2R7IA 4IDTA 4WKQA 3TKIA 3S1HA 2C3LA 2J0JA 1XH5A 3I7BA 3LFQA 2QLUA 4XG7A 4KINA 3CY2A 4LOOA 2ZV9A 4FTRA 4PPCA 4D1XA 2YWPA 4IB0A 4RBLA 3VF9A 5DA3A 4YLJA 3Q6UA 2YISA 5EKNA 4HW7A 3C0HA 1YKRA 2J90A 3ORNA 4R77A 4DTAA 2J9MA 2O2UA 3L9LA 1R1WA 3ID6C 5EOBA 4B7TA 3O8UA 4IX4A 1F3MC 3R73A 4I0SA 4B99A 4QNAA 3PG3A 4FG7A 3W33A 2BVAA 3RALA 2PVHA 1M17A 1YDTE 2ETRA 4FKVA 1X8BA 2ZM3A 2A0CX 2YJSA 4O7VA 3M1SA 2OJFE 2VWUA 1YHWA 2GNFA 3P5KA 3QHWA 1BUHA 4WNMA 4XS2A 1HCLA 5K4JA 4HVGA 1GAGA 5IU2A 3LQ3A 5C4KA 2ITOA 4CRLA 5CWZA 3VC4A 5JFSA 3R8LA 4XRLA 3LMHA 3RKBA 3GCVA 2DQ7X 4EI4A 1NVRA 3VBTA 2W1DA 2P55A 2XKFA 4FTNA 5GJGA 4ZZNA 3F2RA 3V8WA 3NR9A 3VQUA 3GC9A 3ODZX 3SXSA 3F3VA 3CY3A 4FOBA 3EFKA 4RVLA 2JFLA 2G2IA 3I79A 4C02A 2V55A 3DS6A 3RM6A 4BZOA 1ND4A 3EKNA 2RG6A 3U6HA 2QG7A 4MYGA 2J2IB 3CJGA 4ZTMA 4YNEA 2I0YA 3WI6A 5AAEA 1DAWA 1W82A 4FL3A 1R78A 2OXDA 4GFMA 4FV0A 2CGVA 4LUEA 2RSVA 3PRIA 3FMDA 4JLCA 2YIXA 3II5A 3G6HA 4S2ZA 4EWQA 5HVKA 4C2VA 1MRYA 5JFVA 3T3VA 4Y73A 3MESA 2IZRA 1OPLA 4BICA 2ZV8A 3W2RA 3E5AA 4DEBA 5HTBA 5JGBA 4NM0A 2R0IA 4K77A 5E8WA 1AQ1A 4RJ7A 3RPOA 5HBJA 4J98A 2W5HA 3FZRA 2ITXA 3I60A 5ANOA 4CFXA 3U54A 2WTWA 4BDGA 2HZ4A 1JSUA 2PK9A 4U3YA 4I5CA 4XX9A 4DFBA 3BYUA 1YQJA 4FTQA 5HO6A 5CQUA 1L3RE 5BX0A 5EQPA 4FV4A 3FKNA 2WMSA 4FEVA 4O38A 3DA6A 4BGHA 4MBIA 3ETAA 1Q8UA 3DQWA 4L46A 4XLVA 4APPA 3PY3A 4S32A 1WBNA 2YHVA 1IG1A 4PMSA 2W9FB 4F64A 4J52A 1Q3DA 5GIOE 2C6OA 4G5JA 5IG1A 2WQMA 3BI6A 4IAKA 4ZSJA 3IGOA 2CDZA 4HGSA 2OJJA 3ZRLA 1S9IA 4ID7A 4TYJA 2UVYA 1KOBA 2Z2WA 4FKPA 2W5AA 3VUDA 2NRUA 2B9HA 2EXMA 2XYNA 4PV0A 4YJRA 3VHKA 1NVSA 1TKIA 3AC4A 4R8QA 4YBKA 4YZCA 5I9VA 1ZZ2A 4CVAA 1PW2A 4OTDA 3FXXA 3CTQA 4L52A 4Z16A 3R8UA 2GHLA 4M7IA 3NW7A 1WMKA 1IA8A 3OXTA 4PDPA 5JRQA 1SVHA 2BRHA 3GU8A 2GFCA 3MA3A 4QQ5A 4RSSA 4ZTLA 4DGMA 3ZFYA 4FKSA 1KE5A 2ZAZA 4DEEA 4ZTHA 5FP6A 3ZUUA 5AUXA 4UMQA 3ENHA 3RZBA 4G1WA 5FG8A 4DAWA 4JX7A 2XM9A 4KIPA 5CI6A 4D4YA 4D4RA 2WIPA 2R3GA 3P79A 3LJ1A 1JKSA 2ZDTA 3PSCA 3VVHA 2BUJA 5CAVA 4K6ZA 2W99B 3QTRA 3U4WA 5IPJA 3POZA 4FSQA 5AP5A 1XHAA 4PL5A 4NJDA 5JRSA 4F7NA 3FWQA 3LCKA 4U40A 4EUUA 2Y4PA 4DT9A 3CQEA 4IX5A 4MNEA 2YIYA 3VS5A 5GHVA 3NNUA 4JIKA 3O7LD 3HGKA 3ZZWA 2XK3A 1ZZLA 2CN5A 4YTFA 2GNGA 4NTSA 2ITUA 3HMNA 4FG8A 4TY1A 5CVHA 2J0LA 5EW8A 3V51A 4CFUA 4OR5A 4XP3A 4YJNA 1OI9A 3KF4A 4FT9A 4JL9A 4X0MA 4BB4A 3KGAA 4U0IA 5CSPA 4I6BA 1OECA 3E64A 5H8EA 4RVKA 3OWKA 1YXUA 4FV6A 4ACDA 1CMKE 2OIDA 4QTBA 2UW6A 2OK1A 5HIDA 2B54A 4BYIA 4E26A 4NWMA 4DFXE 3RGFA 3HL7A 3KFAA 4RLLA 2DYLA 3UTOA 3LHJA 2X9FA 4L8MA 4CV8A 4A9TA 2ONLA 4DEGA 2XIXA 3EZRA 4FK3A 5IZFA 2XNGA 4WO5A 4FV8A 1GZOA 2OKRA 5FUTA 2A4LA 4HCTA 4I0RA 2ZOQA 3PP1A 1PMNA 4HNIA 4MBJA 5HCZA 4BYJA 3UPXA 2F2CB 2W4KA 4O84A 3DU8A 4BRXA 3UVPA 5J9LA 4NYEA 3COMA 4KIKA 4B8LA 4MQ1A 2YIWA 4YZNA 2HXQA 2PVLA 5GZAA 4F9BA 4NT4A 3D94A 3K5UA 3CS9A 2PY3A 5EG3A 2Y4IC 2RFDA 3PWDA 3HV7A 3WF7A 3U6IA 3KMWA 4R7BA 4DG2E 3P7CA 3GOKA 5I9UA 2OU7A 3WBLA 3D0EA 4BCNA 3LMIA 3B2TA 2GNIA 1YXXA 4QMZA 4CFVA 2C4GA 4GMYA 4UV0A 2C6IA 4AFJA 4QP9A 5EDPA 4C38A 5H9BA 3KU2A 5LVPA 1Q8TA 2VWIA 4AF3A 4EJ7A 3EMGA 4B6LA 3EOCA 4HYHA 2C6TA 4B4LA 4NKSA 3W10A 4D5KA 4BWKA 3HV6A 2VTPA 3Q9WA 4HZRA 4RGJA 1MQ4A 4FKJA 4AWIA 4XG8A 3O71A 3GCUA 5AM6A 4WNKA 3FJQE 3FL5A 4KABA 2B52A 1HCKA 3QKLA 3EN7A 1E9HA 3KN5A 4TYEA 4YU2A 1BX6A 4KNBA 4Y83A 3HKOA 3VIDA 5A4CA 2CKQA 4FE2A 5GIPE 4O0WA 5HIBA 3I81A 4MTAA 1IR3A 4FKTA 4XG4A 4MNEB 4E6DA 4RC3A 4FNWA 5C01A 3LPBA 1JQHA 3SA0A 4GFOA 3AC3A 5IH6A 2OBJA 3MTLA 4LRJA 4BKZA 5E90A 4EH8A 1H24A 1R0EA 4D2SA 2DS1A 4DEHA 3DPKA 3SG9A 2AUHA 3ZZEA 3KRRA 5D7VA 2HIWA 2YM7A 1L8TA 1PYEA 4C37A 3O50A 5BVEA 4O2PA 4D55A 5LMKC 4I20A 1LR4A 3ANQA 3OHTA 2YERA 3R21A 3FZOA 3PY1A 4AGUA 3HAMA 3A2CA 2FSMX 4TWOA 4RJ3A 1PHKA 3IO7A 2C5VA 2GS7A 3AMBA 3BGZA 5AUTA 4FTJA 3FZ1A 3TZ7A 3F3TA 4E8AA 3NYXA 3OXIA 4YC3A 3LFFA 3RPSA 3ZFMA 5KBRA 4NK9A 4EOIA 5CEOA 4AOJA 1P4OA 4ZJJA 3TACA 1QPEA 4LYNA 1REJA 4F0IA 4PL4A 3AGMA 3H30A 2JDTA 4FV9A 3FL4A 3VRYA 2FA2A 2VTAA 5AR3A 3EYGA 4P90A 5LJJA 5M4IA 2HK5A 2I1MA 3PJ1A 4AFEA 3QQHA 3QXOA 5EM6A 4YO6A 5LCKA 5CAOA 3RAHA 5HHWA 3DZQA 4F7JA 3FAAA 2JKKA 3PIXA 3AMYA 3HP2A 4X6QC 4J96A 3ZDUA 4QYFA 3MH0A 4KKEA 4TKSA 2O0UA 1H08A 3QQKA 4GVJA 4XOYA 2QHNA 5AUWA 2O8YA 3F88A 3LW0A 5D11A 4AS0A 2WGJA 4RWIA 3F3WA 4I5PA 4D2VA 2H6DA 2REIA 3KL8A 1P2AA 4MXOA 3REPA 5HQ0A 2VTRA 4CYIA 3LOKA 2I7QA 4W4YA 4G17A 4EK5A 5BUIA 3R28A 1E1XA 1KE7A 2Y6MA 5CQWA 2BROA 1OL6A 2Y9QA 2LGCA 3A7FA 3BU3A 4OBOA 4BI1A 4O7WA 3RHKA 3WE8A 4NL0A 4NSTA 1Q4LA 1YI6A 4GUBA 5K3YA 3OD6X 2ACXA 2UZWE 1ZOEA 2CMWA 3DBCA 5AP7A 4F7LA 2A2AA 2VWBA 3GXLA 1NY3A 3ZLXA 2UZEA 2JD5A 4GH2A 1G8SA 4I41A 3ZUTA 2CLQA 3RAIA 2VGPA 2OH0E 4G3GA 3R7EA 2UZDA 3FC1X 4ACMA 4EYMA 3PJ8A 5AP0A 1WBOA 4BI2A 3HVCA 4D1ZA 4J8NA 3QKKA 5AADA 2OG8A 4FKLA 4MWHA 4TPTA 5J5SA 4ZTNA 3Q2MA 4I4EA 4TW9A 4MH7A 5CI7A 3MVHA 3TNIA 4OTFA 1TVOA 2C6LA 2PVFA 4R7IA 5EQEA 3NUNA 4BWPA 4NKAA 3F69A 5EI2A 3WF9A 2WELA 3OWJA 5DIAA 3IGGA 4O81A 2CGWA 2VUWA 3UYTA 5EHOA 3W2SA 1PKDA 4BTKA 4MX9A 2JDOA 4YTIA 3ALNA 3OT8A 2OJ9A 3P9JA 3QF9A 4FUXA 5FP5A 4C7TA 4OTWA 5C8NA 1O9UA 1RE8A 2JBOA 5HU9A 2FB8A 3KXHA 3D7ZA 3KXNA 3QTXA 3DK7A 3N4TA 3MB7A 4O7SA 5CSXA 4XG6A 3ZLSA 2C69A 5GNKA 2EUFB 1U4DA 4P5QA 1OKWA 1BI7A 1UU8A 2CN8A 2WHBA 2R3PA 3BV2A 4W8EA 5HVYA 3PZEA 4DHFA 4DFYA 2R3IA 3DKCA 3OTUA 2WTCA 4ZY6A 1FGKA 2YJRA 2VU3A 5A4LA 4BDFA 3HRCA 4II5A 1JOWB 3QTSA 3VBWA 2OLCA 1GZKA 4LM5A 3LFCA 3TNWA 4MEDA 3HMPA 3HEGA 3R8PA 2B1PA 1YWNA 4AW2A 4BL1A 4PPBA 3NUYA 4FL1A 3PXQA 5FBNC 3FLNC 3SOCA 4UMPA 1UA2A 2JKOA 4WD5A 3EFJA 4D0WA 5JMSA 4UY9A 5JGAA 5AR5A 4XRJA 4YJOA 4CQGA 3EQFA 1Q24A 2UW4A 2B53A 2ZMDA 4N57A 3D2IA 1T46A 2BHHA 2BR1A 4HPTE 4ZZOA 3MIAA 2QG5A 1HOWA 5IUIA 4Y85A 1MP8A 1H4LA 4F70A 4I94A 4LFIA 3FI2A 3RAKA 5D10A 5FBOA 5A46A 3UOKA 2OF2A 3EZVA 5IQEA 3LCOA 4KIQA 2H9VA 5EHYA 5JQ5A 4AZTA 2YDKA 3H9RA 2F4JA 1YI3A 3HV5A 2JLDA 2J5EA 3C9WA 5DOSA 3W55A 4U81A 4FKUA 1W98A 3ZCLA 2F7EE 4FV5A 5BUJA 3M11A 1LEZA 5CT7A 5H2UA 1W0XC 1NW1A 3FY2A 5CEIA 1J91A 3OBGA 3RPVA 1Y91A 3H4JA 5E8XA 1LEWA 3U8WA 3KMUA 5CAPA 4IACA 3AD5A 3EQGA 5C9CA 2W1ZA 2YITA 4AN9A 5AUUA 3HRBA 3BGQA 3EQIA 3ZM9A 5CVFA 4OT6A 3E8CA 1SNUA 4FSZA 2YABA 2J51A 3C0IA 2XKDA 3IW4A 3UP2A 4BF2A 4PP7A 4HPUE 3KRJA 3LFBA 5FXQA 3WZEA 4U3ZA 3CGOA 4EL9A 4QOXA 4Z55A 3MW1A 2GS2A 3BEAA 3QD3A 1UKHA 3I7CA 5I9WA 2OGVA 3KK9A 1ERKA 4AGDA 3P4KA 4R78A 2QOQA 3GC7A 4O0UA 4QP7A 4Q9SA 1EH4A 4M97A 5CXZA 4HOKA 1ZOGA 3A7GA 1XJDA 3SKCA 4IZAA 4ZLOA 3BPRA 2HZNA 5HE1A 1PJKA 4J97A 4IB3A 3NNWA 4Y5QA 4LL0A 3RI1A 4IWQA 4BIBA 4E73A 5HLWA 1XH4A 2ZYBA 4N6YA 3D9VA 2V62A 4MD8E 3V8SA 3EYHA 2UZNA 3MSSA 4W9XA 3RCDA 4R5YA 4CEGA 3COIA 5HG7A 1V1KA 3DKFA 3OROA 1H0WA 2VWVA 2W96B 3F82A 3OOGA 4FL2A 4KAOA 4MF0A 4FEWA 3W16A 4QP2A 4ARKA 2B0QA 4RIYA 4OUCA 4Z3VA 2PTKA 3NCZA 4HGEA 5AMNA 4F9WA 2RKUA 2YN8A 3D2KA 1NT2A 5M09A 3PXZA 3RMFA 5JEBA 4BGGA 3CGFA 5AV3A 1YW2A 3IOKA 5J7HA 3C4ZA 5CX9A 2OI4X 4AT3A 5M44A 4RVMA 3GENA 5LOHA 3ULIA 3FMMA 2J4ZA 4O2ZA 3MPMA 4XBUA 3BE9A 4BCIA 4ERKA 3FI8A 1QPJA 2OO8X 4KIOA 2G2FA 5CZIA 3L8SA 4M66A 4FOCA 3TXOA 4ZIMA 5EYCA 2QONA 3ORIA 4KBCA 3WYXA 2PUIA 3BQRA 3C0GA 2OFVA 4ZS4A 5IA1A 3FMKA 2H34A 3PIYA 5T68A 3PTGA 4NW5A 5M51A 5EDRA 4LOQA 3R7VA 1Q41A 3PA3A 5C27A 5M08A 2E2BA 2XK6A 1M2QA 5F9EA 3LVPA 5DRBA 1WFCA 3O96A 3ZUVA 5C4LA 2VTOA 5HVJA 4IE9A 1UWJA 4D2RA 1U46A 3KXXA 3NPCA 2X81A 2OZAB 3CP9A 5I3OA 1F5QA 4FKGA 4NJ3A 3C13A 2F49A 1H01A 4HGTA 4YURA 1PMEA 2C6KA 3ET7A 3LFAA 4QMTA 1FQ1B 3VQHA 3ZBXA 4C57A 4CFWA 4D9UA 2R4BA 4P4CA 2X8IA 1Y6AA 4ANMA 5IDNA 3A7JA 4GV1A 3KVWA 5L8LA 4G5PA 3V6SA 1JAMA 2OIBA 5AUYA 1ZARA 4ANOA 4FNZA 3OBJA 3UQGA 3SHEA 4BCOA 4D0XA 1CKIA 2R64A 3Q9YA 4RX7A 4AGCA 2ETMA 3A7IA 4CXAA 4WRGA 5IH4A 3VULA 2PWLA 4E4XA 1KE8A 3SC1A 4FIJA 3TNHA 3WIKA 1JSTA 3SW4A 3OG7A 5FEEA 3QZGA 3A62A 4HGLA 4D5HA 2X0GA 3DJ5A 3DY7A 5H8BA 3RINA 4FTTA 3UE4A 2IVSA 1O6KA 4H3BA 5IMXA 5HD7A 4ANBA 2XRUA 3BELA 5IEYA 1LP4A 5F95A 2PSQA 5KE0A 4QYYA 2XB7A 3PVBA 5KKRC 3BU5A 2HYYA 3FMLA 3Q9XA 1Y8YA 4NZWB 4EH4A 4DT8A 3FE3A 4RIYB 2ITYA 2X6EA 4FTKA 4WHZA 3R7YA 4AUAA 4UWYA 3R6XA 2IZTA 4K33A 4E5AX 4YBJA 1IAJA 1PXMA 4J1RA 1BLXA 2HW6A 2WOUA 2UUEA 2Q83A 1H1PA 3MI9A 3U87A 3FEGA 2PZIA 1MQBA 3FSFA 1K9AA 5J87A 1U59A 2VX1A 2UZOA 4MBLA 5CU2A 5F4NA 5JH6A 1OM1A 4FNXA 3MH3A 4JT3A 4D2PA 3DBFA 4UX9A 5M07A 1H8FA 2R3NA 3DNDA 4MXXA 5HNIX 5JQ8A 3VN9A 3VS0A 4FVRA 5HLPA 4EH7A 2CNVA 2C6DA 4WBOA 3WZKA 4EJNA 3O2MA 2GSFA 4YJPA 5DH3A 1QPDA 4JI9A 5JZNA 4O6LA 4FSMA 4PY1A 2JITA 3U9CA 4DFLA 3EQPA 2PULA 4XCUA 5JK3A 2NP8A 5E8TA 1H26A 2I6LA 2YLEA 4IX6A 4AW1A 3GT8A 4Q2AA 1OUYA 4ZEGA 2C5YA 2IN6A 3E7OA 4RQKA 4XG3A 5HE2A 2QOIA 2UV2A 4C61A 4XUFA 3PLAE 3UNJA 2HELA 3BYOA 4ZK5A 4BDEA 2X8EA 2IO6A 5D1JA 2V0DA 1PF8A 4ASDA 3R71A 1Q99A 4FKRA 1V0PA 2OWBA 4IADA 5HGIA 4RA4A 2PZYA 2BTRA 3UOJA 2EVAA 2RFNA 3Q96A 4LMNA 3F5UA 3OEZA 4PTCA 1GIHA 4U9AA 1V0OA 4YMJA 5IQGA 4PMMA 3EN6A 3MJ1A 3NYVA 4NW6A 2XS0A 1GNGA 5CXHA 3ORMA 4A4LA 3EKKA 5L3AA 2R0UA 1J3HA 2EB2A 1Y6BA 4P7EA 2CKPA 3IW8A 1OBGA 2EU9A 3KA0A 3AC2A 3NS9A 1LPUA 4QD6A 4PPAA 4AW5A 3QUPA 5DEWA
chains in the Genus database with same CATH superfamily
4AA5A 3F5PA 2HY81 4GYIA 3RCJA 1WBTA 3JS2A 3LFSA 3QTQA 4G34A 4L7SA 4DGOA 1OB3A 3E92A 3IDPA 5ANIA 4ALUA 2RIOA 4JRVA 2DUVA 5IEVA 4TWPA 3GVUA 4BTJA 4G16A 2IW8A 4FT5A 4AN3A 5HD4A 4C4FA 4E6QA 3G15A 4A9UA 4D2WA 5A4EA 4QYEA 3E8NA 2G1TA 4Q9ZA 1I09A 5ACKA 3TUDA 2CCHA 3P0MA 4O7LA 4XMOA 4BKJA 3H0YA 5CALA 4MHAA 5HO8A 3VWAA 3W0NA 3MV5A 3FKOA 5KUPA 3S0OA 4Q5EA 3ULZA 4S34A 3E3PA 2GNJA 4FTUA 3Q5ZA 3AC8A 3UIXA 2CKEA 3ODYX 1O6YA 4DC2A 2GPHA 4M0ZA 5KO1A 3TEIA 2Z60A 3VUTA 4HYIA 2G15A 3NCGA 5DLSA 2GU8A 5A3XA 1BI8A 4JR7A 1K2PA 2WMVA 1IASA 3V5PA 3LCDA 3EQRA 2HXLA 5FM3A 3LXKA 2WAJA 4QMWA 4QP1A 3TV7A 1FMKA 2C1AA 3COKA 5BV3A 3DAEA 2X2KA 4RG0A 3A7HA 4O0VA 4W4XA 2O64A 4GRBA 3QUDA 3G9LX 4D1SA 5HO7A 3D5XA 2B9JA 5AP2A 2QOKA 4L3LA 3ZYAA 4EOOA 2JAMA 4HVHA 4EH5A 3U51A 4PL3A 3CE3A 3PPJA 4MK0A 4V05A 2W9ZB 2JIUA 3EQBA 2F2UA 2V5QA 4FT7A 4GFGA 4LOPA 3UC4A 4ANNA 4E6CA 3QWKA 1ZY5A 5TOZA 1PYXA 3WZDA 4GCJA 5HICA 1OL2A 5CSVA 2ZB0A 2WMQA 3DDPA 4FYOA 5LMKA 1J7IA 3MFSA 3P78A 3ORPA 2XBAA 3QCSA 3KMMA 5I0BA 2BZJA 5ETIA 2O63A 4AZWA 4EHVA 3KRWA 2DWBA 5HG9A 3QQUA 4QMXA 3DJ6A 4ZTSA 4GK4A 4U6RA 5BVKA 5HX6A 3SGCA 4JX3A 2HAKA 2PE1A 3CTHA 5KMNA 2Z7SA 3NVKI 3O8PA 4GJ2A 3TN8A 4QO9A 3Q9ZA 4L00A 2ZV7A 2C3IB 1JWHA 4V0GA 4YZ9A 4M14A 5EM7A 4U97A 3LFNA 3IW6A 5EYKA 1LUFA 4DEIA 3H9FA 1YWVA 2UW0A 4FTCA 4IXPA 4FSWA 2BIYA 4NCTC 5HNGA 5KX8A 2XA4A 3K2LA 4GK3A 4EC8A 4YUQA 4OBPA 3UPZA 4CFFA 3A8XA 4AOTA 4LV7A 3LFDA 1R3CA 3A8WA 3C5UA 4NU1A 4RJ8A 5E8ZA 2XVDA 2I0HA 2PZ5A 4D28A 5LQFA 4NFMA 2PMNX 3DBEA 2HY0A 5E1EA 1PXPA 5M4UA 3UDBA 5HZNA 3E8DA 4Y72A 2ERKA 4DG3E 4DINA 4JQEA 2Y4IB 5CTPA 5E92A 3L9MA 1TQPA 3VUKA 2Q0NA 2X2MA 3BHYA 5CNOA 3F2AA 5M4CA 2PU8A 1G5SA 4O0XA 3GI3A 1XBAA 4FMQA 4IM0A 2W1CA 4XOZA 3OCBA 4A4XA 4F0GA 4BR3A 4RZWA 3DV3A 3OUKA 2C5OA 5T3QA 1ST0A 2JBPA 5BVNA 3QAME 1KE9A 2HCKA 4E5WA 5CF8A 4WUNA 2ITPA 4DG0E 2XNBA 4FEQA 4BDHA 2QKWB 4MNFA 5I9XA 3QXPA 3VHEA 2UZUE 1E1VA 2XNOA 1OL7A 1M7NA 4GUEA 2ZB1A 1PXOA 3CQWA 2WU7A 1U54A 2UW7A 2ZM1A 2O3PA 3BRBA 4YPSA 2YM8A 3L8PA 5JKGA 5EI8A 4IVBA 4DLJA 3U55A 2G9XA 3OOMA 4RWKA 4I24A 5CF6A 3W0SA 3ZLWA 4GW8A 1VJYA 3I6WA 2W1EA 4L53A 5EOLA 2VTTA 4LQMA 4IB1A 1NVQA 1URWA 3LJ2A 4ITIA 2WMXA 3TDWA 2F7XE 3HYHA 3PE2A 4FF8A 5D9HA 5ANGA 2YCQA 3ZRMA 4I6HA 4C34A 3UP7A 3ZSGA 2WTKC 4CCBA 4XBRA 2QOHA 2GTMA 3BLQA 4GG7A 4L68A 3ZO2A 4K18A 5EHLA 4GS6A 4G3CA 5DR6A 4JRNA 2C6EA 5TR6A 1SM2A 5CSWA 5FDXA 5IA5A 1KWPA 2KTYA 5AX9A 2UZBA 4PQNA 4DITA 3KCKA 2OJGA 3AGLA 3CJFA 2BDFA 2ITNA 3DFCB 5M55A 5FXRA 3NYOA 3LM5A 3LXLA 1ATPE 2WNTA 1YXTA 4FX3A 4B0GA 4FGBA 1J7UA 5AFVA 3DQXA 3AMAA 3PXFA 2E9UA 3QA0A 3TT0A 3OZ6A 4GK2A 3ORLA 1ZMUA 3NDMA 4YJSA 4USDA 1TQMA 4V0GB 1JNKA 1JVPP 5AA9A 5HTIA 4F65A 5CZHA 5AX3A 4L3JA 3R2BA 4WIHA 4O21A 2OJIA 4IAZA 4GJ3A 2CNQA 2XK4A 3EL8A 5HORA 3JR1A 2PVMA 4WNPA 3VBXA 4USFA 4KS7A 5J5TA 3PP0A 4LI5A 2YFXA 3MJ2A 3VRZA 2QU6A 4IB5A 3R7IA 2VZ6A 2RG5A 4C35A 4Z7HA 1P5EA 1DS5A 4IIRA 3MH1A 4QP6A 3TUBA 4ZSGA 3VUHA 4G6NA 1XH8A 4EZ7A 4CRSA 5HE3A 3RAWA 3R7OA 4HCVA 1H1WA 4ACCA 3QA8A 4F99A 2PVYA 4DBNA 2BIKB 3ALOA 3MS9A 4JBVA 4E4LA 4Q5HA 4EHGA 4EEVA 3LCTA 1YVJA 2QO2A 3P7AA 2B55A 4X2GA 3UG2A 2VX0A 3W2CA 3AG9A 3ZOSA 1V0BA 4AXDA 4LGDA 3R7GA 4X6RA 4DA5A 2KULA 4FZDB 4Y5HA 3R8MA 3ZH8A 3OCSA 4S30A 2Y7JA 3FI4A 1ZWSA 3PVGA 2CNUA 3F7WA 3NX8A 3FHIA 1B6CB 4PNKA 2EB3A 4LGHA 2O65A 4I23A 4MWIA 3MGYA 4TTHB 5FDPA 1U54B 5GZ8A 3TM0A 5I9YA 2WQEA 2W5BA 2J7TA 1U5RA 3BBWA 3KN6A 3MN3A 3HDMA 2UVZA 4U80A 2RF9A 4E3CA 1H1SA 1B39A 5C1QB 3UDSA 1Z9XA 2IG7A 3RNYA 2B7AA 4DF3A 1W83A 2E9PA 3HUCA 1P14A 1PKGA 4IWDA 3R9DA 1T45A 4HVIA 3CD3A 3ATSA 2JKQA 3LXNA 5LVMA 3GFEA 3NFFB 4QRCA 3N4UA 3KRXA 4ZMFA 2XCKA 3LJ0A 3KXZA 4IDVA 4K0YA 3RWPA 1XQZA 4DHZA 4O0YA 4UXQA 1PXJA 1OKVA 4QMMA 4BZNA 2R5TA 5ETFA 3GP0A 4ACGA 4RX9A 4EH2A 3EHAA 1GZ8A 4QYHA 5DWRA 3LKMA 3G0FA 4I5HA 2WQNA 5AP1A 4MXZA 3FMEA 1OIUA 5HBEA 4U43A 2BPMA 3D5WA 5KMJA 5E8UA 4BI0A 4OTRA 3ZO3A 4EHZA 3KY2A 3W2PA 3LZBA 4ZTRA 4NM7A 2SRCA 2X1NA 4FSUA 4K1BA 4LV5A 2IW9A 2VTLA 3WF6A 4DCAA 3W1FA 2FSLX 2QR7A 4XYFA 4U41A 3FMHA 2JIIA 1YOLA 2WIHA 4PWNA 4L44A 2OZOA 4FBXA 1RJBA 3QRKA 4AGWA 1H00A 4FV7A 5JFWA 4IM2A 3VUGA 4RZVA 2RL5A 3S2PA 4UYNA 5E91A 3UVQA 1RQQA 4ASXA 2QO7A 4C3FA 2XZSA 4EHEA 4YR8A 2QOLA 4XHKB 5IUGA 3DNEA 3F5XA 4AZSA 3BLAA 2NNWB 1Z5MA 4M12A 4J53A 1W8CA 4RPVA 4QTEA 3E3BX 4DH3A 1STCE 4A9YA 3PYYA 1FVTA 3HX4A 1Q61A 1FBNA 4N6ZA 5FWKK 5BNJA 3R8ZA 3LIJA 4UMRA 3WF8A 3ZU7A 5J9YA 2IJMA 4WRSA 1OL5A 3GC8A 1NXKA 3IG7A 4YHFA 5L2WA 3K3JA 3VS4A 4C36A 3T8OA 3P7BA 3PVUA 4MAOA 5KCVA 3CTJA 4IAAA 2UW9A 3TNPC 2YDIA 4RJ5A 3WILA 3PY0A 4N70A 1TQIA 2OICA 3ORZA 3NUPA 4F4PA 5DVRA 1GOLA 3R7UA 3L1SA 4DH7A 3TJCA 1PRYA 5F94A 2WTDA 2JAVA 4FKIA 4JAIA 4XG2A 4OTIA 1G8JA 3UVRA 4MQ2A 4QMOA 4DBXA 2WU6A 4M69A 5DG5A 2UZLA 2ITQA 3ZO1A 2PL0A 2IZUA 4JDHA 4ZSEA 2BFYA 2VTJA 2C5XA 5LCJA 2YZLA 3MPAA 5LVLA 1URCA 4IC8A 3JYAA 4FZ7A 4F6SA 3NSZA 4RC4A 4R1YA 3UZRA 1U5QA 3ORXA 4H3QA 3NLBA 5AR4A 2XNPA 2UW5A 5GJFA 5HIEA 4C3PA 1UVRA 4ENYA 2WTVA 3TCPA 3G6GA 5J79A 2VO3A 2XMYA 3TI1A 2PYWA 4CKJA 2VO0A 3BYSA 3TL8A 4KB8A 4X2FA 2VN9A 4S31A 5KMMA 4GT5A 1OPJA 4CTBA 4G2FA 5FTGA 4OW8A 4NM5A 3VBVA 1OIQA 3VW8A 2HW7A 2NO3A 1A06A 1ZYDA 3MY0A 1WBWA 4DH8A 2JC6A 4O4CA 4RX5A 3QU0A 5ANKA 2ETKA 3EQHA 4DLIA 3BGPA 1GZNA 1J1CA 1JBPE 1VZOA 2I0VA 4PDSA 3ANRA 3QZHA 2HWOA 4XV3A 3WYYA 5LMBA 2R9SA 4FV3A 5AAGA 2RGPA 3DAJA 4YSMA 2YWVA 1APME 3VS6A 5DR9A 3ZBFA 4AACA 3BEGA 5IEXA 4OLIA 4UYAA 3PSBA 2C3JA 3Q2JA 4RT7A 3JXWA 2GTNA 4IH8A 5L8JA 5K9IA 2XK9A 2F7ZE 3WZJA 4IHPA 3BZ3A 2XALA 4YHTA 5BYLA 2B9FA 4ANQA 3ZSIA 3TNQB 3C50A 3FV8A 5CU3A 3QTIA 5B2MA 4BVUA 3QLGA 3ERKA 5LMAA 2I40A 3LLAA 3W18A 5LARA 4FG9A 3OXZA 4TT7A 4WOVA 2WEIA 4QMPA 3ZMMA 2XNEA 3ZEWA 3PPKA 2OF4A 2X4ZA 1R39A 4QMQA 4F08A 3BWFA 4FIIA 3V8TA 3IKAA 2WMTA 3MB6A 4PX6A 5D12A 5B0XA 4JS8A 4BDAA 3KB7A 3NRMA 3E88A 1H27A 4K8AA 3SW7A 2CKOA 3W0MA 4QQJA 2V7OA 4OBQA 3F3UA 1Q8YA 4XLIA 5HNBA 3FQEA 3EQCA 4NM3A 3SDJA 2ITWA 3BLHA 3O17A 4TWCA 4MXAA 3E7VA 1ZY4A 2OZAA 3ZM4A 4D2TA 4L45A 4KUJA 4RQVA 2ZVAA 4JDIA 3R02A 4L3PA 5AV0A 3GCPA 4K9YA 4PNIA 5TKDA 2X4FA 4FTIA 4M69B 4IMYA 3NWWA 1FGIA 2IVTA 4JDJA 4U8ZA 4BCQA 4CZUA 3Q53A 2YM3A 5H8GA 2J0KA 4RC2A 2VAGA 4FVQA 4GU9A 5IA3A 4JQ8A 1SZMA 3R9NA 5J95A 4X7QA 2F9GA 4H58A 4KRCA 4M15A 4BBFA 4IC7A 2X6DA 5IA2A 2XIZA 3BHHA 4F63A 2WOTA 3F66A 5E8SA 4YJTA 5M56A 3UIMA 4A7CA 3TKHA 2XKEA 2R3JA 3MYGA 3ZXZA 1IRKA 4EKKA 3H0ZA 4DGNA 3P23A 3QQLA 5G6VA 4NUSA 2CHLA 1OVEA 5AAFA 4EQCA 4FZ6A 2IWIA 3O0GA 4XJ0A 4RJ4A 4CCUA 3OTVA 5FXSA 3E87A 3RNIA 3CLYA 3PUPA 2VWWA 4RIXA 3AT2A 3AT3A 4UMTA 3BIZA 4AXAA 3CPCA 5A6OA 5IISA 3DGKA 4XV2A 4IAYA 3QFVA 4KSQA 4WG5A 5HOAA 3NIEA 3JY0A 3UMWA 1Q8WA 4V01A 2YAKA 5DR2A 2A1AB 3V04A 5LWMA 2QI8A 2W17A 4WSYA 4EK4A 4W4WA 1SMHA 3A60A 4CTCA 1KSWA 3QHRA 1UU9A 4QQTA 2BKKA 2J5FA 4FTLA 2VWYA 4R3RA 1WVYA 3N9XA 3PXRA 3ZC6A 4HVSA 4BBMA 2CCIA 3DDQA 2WMBA 4EOQA 1UU7A 2BKZA 1H07A 3OVVA 4KD1A 2C6MA 1SVEA 4X3FB 3P1AA 4JBQA 5CYIA 3UOHA 4BCPA 4AXEA 5DI1A 1BYGA 3O5AA 4IAIA 2J0IA 4IM3A 4TRLA 4H05A 5KKRB 3CPBA 2PMIA 1TZDA 2YCRA 3DXNA 1OMWA 3MVJA 3NW6A 5CU6A 2IPXA 3PDTA 3OUNB 3DK3A 2J50A 3DK6A 4UZHA 4KKHA 4GKHA 2G2HA 4NFNA 4J95A 4W4VA 4YPDA 3AOXA 3TIZA 3LCSA 3A4OX 4LV8A 4ZP5A 5AV1A 3HRFA 1VEBA 4H1JA 4YGAA 4EC9A 1VYZA 1CM8A 2R2PA 3RM7A 3VAPA 3I6UA 2E9OA 3PE1A 4DE4A 2FGIA 2BALA 3LLTA 4IEBA 3CKXA 2AC3A 3V01A 4DEDA 4FIHA 3D4QA 1VR2A 4R5SA 1OGUA 4PMTA 3IOPA 4O0RA 3UBDA 4O91A 3SV0A 4A9SA 4R6VA 4L67A 5ACBC 3LQ8A 3C7QA 2IEWA 4QMLA 2ZJWA 4I21A 4CYJA 3PG1A 1FOTA 4RFZA 4C2WA 3RP9A 4AAYA 5EKOA 4UALA 3ZHPC 4TYIA 4FT3A 5M57A 4Y8DA 1CDKA 3FC2A 3C4XA 4L7FA 4BDIA 3WARA 5AP4A 3HNGA 2P33A 4HVDA 3DCVA 4R1VA 2P3GX 4WBBB 5C03A 1DM2A 2XJ0A 3WE4A 4TYGA 2YA9A 4RFMA 1UNGA 4X3FC 4O7RA 5BVWA 3KF7A 5DGZA 1XBCA 2YIRA 3NUUA 2FSTX 3ORTA 5HG5A 3VUMA 3ZSHA 1YHSA 4WT6A 4CG8A 2BRBA 4APCA 5HU3A 3VONA 1OKZA 5AUVA 4O83A 2VTQA 4RIXB 2VWZA 3OCGA 4M68A 2ITZA 4NCTA 3QALE 3CKWA 3IK3A 4G3DA 4GKIA 5JN2A 1H28A 5EQYA 4IBMA 5DT3A 3M2WA 3NW5A 2XRWA 4G6OA 1WVXA 3BHUA 4LUDA 3Q4TA 5ANDA 3JUHA 4GSBA 3SRVA 4UMUA 2C0TA 4I4FA 4D58A 4H1MA 2XIKA 5KZ0A 4O27B 3VS1A 4EK6A 2XK8A 3K54A 5CU0A 3CSVA 3EFWA 5DBXA 3WZUA 4FYNA 4X3JA 4JG7A 4QYGA 2PHKA 3BLRA 3K3IA 4LRKA 4YJVA 5HCXA 2EXEA 5L6WL 4ASZA 1Q3WA 3Q04A 4HYSA 4O4DA 4TZRA 3HA6A 4JBPA 5IDPA 2YCFA 3FYKX 4FTOA 4EQMA 1CTPE 3A99A 4BHNA 4C33A 1WBPA 2E9NA 5L2QA 1JKTA 2ITTA 2WZJA 5CENA 2CPKE 5LWNA 4YC8A 2R3LA 4QMYA 3TIYA 5KHXA 3R22A 2QO9A 2P2HA 4BCFA 4A4OA 3SOAA 4AP7A 3C4WA 2C3KA 3KXMA 4LG4A 2VRXA 3PZHA 4O0TA 2V22A 5HE0A 2XIRA 3QYWA 4O1PA 2ZDUA 2G01A 4LRMA 5J7BA 1VYWA 4RVTA 4FSRA 4U79A 2PMOX 4BN1A 5E8YA 2JEDA 4D4VA 3RPRA 3R9HA 5B2KA 5CY3A 4RFYA 4MVFA 1JPAA 3V5LA 1ZXEA 4E20A 3AT4A 4EYJA 3KULA 3FDNA 2GHMA 3UYSA 5EH0A 2QVSE 2PZRA 4YHJA 4EOSA 1UWHA 5M53A 2XCHA 1ZRZA 4FR4A 4GT4A 4FGRA 1FMOE 2ITVA 4OT5A 4Z9LA 4QMSA 4EORA 2WXVA 4PMPA 4ZLYA 5IQAA 1XH7A 2BDWA 5F1ZA 3FZTA 2WEVA 3D83A 4JXFA 3PFQA 2C1BA 3TDVA 4CD0A 5DN3A 5EM5A 5FD2A 3FLSA 3GCQA 3B2WA 3DJ7A 5EI6A 4RA5A 1YXVA 3B8QA 4PTEA 4OTQA 3D14A 5CT0A 2C47A 4QPMA 1B38A 2XUUA 3G0EA 2EWAA 5CVGA 3W8QA 5A4QA 1OBDA 2WPAA 4GIIA 2H96A 3QUEA 4G3FA 5AEPA 1M14A 3FSKA 3MTFA 3NFGB 2WTJA 3G5DA 3KC3A 4FKWA 3S4QA 3ROCA 5C26A 5HG8A 4JBOA 3QTUA 3RHXA 3TV6A 4XNEA 4C4HA 5L4QA 2QC6A 2X2LA 4FICA 3MPTA 5JGDA 4I5MA 3FHRA 3EN5A 2YLFA 4KS8A 4YZBA 4F09A 3PUFC 2WQBA 2YDJA 1OKYA 1Q8ZA 3L8XA 5A6NA 3R9OA 2JIVA 4AZFA 5ETAA 4DCEA 3EN9A 4FZFB 3ZRKA 5LVNA 4G9CA 5HI2A 1SVGA 3WIGA 5DT4A 3V5TA 3R1QA 3LM0A 4FKOA 5DFPA 3W8LA 1GIIA 1Z57A 4ASEA 2LAVA 4E93A 5M4FA 2HWPA 3PSDA 3HA8A 2VTIA 3H3CA 4O0SA 3ATTA 4QT1A 3WF5A 3SRVB 1PMVA 3UOLA 5IMEA 3NNXA 4R3CA 1W2DA 4EOLA 4F9CA 4CZYB 4BJJA 3TZMA 2QNJA 3OMVA 3OC1A 2WB8A 3Q60A 2AEGA 4NIFA 2VTHA 4JG8A 1KE6A 4O22A 4AG8A 3OY1A 3NVMB 3MFUA 2W06A 2EXCX 3B8RA 3FUPA 4ALWA 5A14A 5L8KA 2QCSA 2OH4A 4K11A 2YEXA 4FTMA 4J99A 1Q97A 2CGUA 3PXYA 5E1SA 5AWMA 1XWSA 5HCYA 3RWQA 3QD4A 4NEUA 4PF4A 1R0PA 5AV2A 4IX3A 3R83A 3ROYA 3JY9A 3W2OA 4C4JA 1M7QA 3UO5A 1OIYA 2J6MA 1ZOHA 1ZYCA 3K5VA 5DPVA 4QNYA 2JFMA 2PUUA 5ETCA 4E4MA 2BHEA 3Q4ZA 2A98A 3ZEPA 3F6XA 4AZEA 2ZM4A 3GCSA 4FSYA 4ORKA 3OY3A 3T9IA 3RK9A 4ANSA 4A07A 2I0EA 4IQ6A 5EFQA 2XIYA 4DFNA 5AP6A 5BYYA 2QU5A 2R3OA 3GOPA 4S33A 4I0TA 3F9NA 3KULB 4TXCA 3QL8A 4CT2A 5BVDA 2RFEA 4LL5A 4OTHA 5KZIA 3TJDA 3FLQA 5IQDA 4DH1A 1P4FA 4ITJA 5IQIA 4DH5A 1PXKA 1GJOA 4DDIA 3GFWA 2PPQA 4UEUA 2YIQA 3GGFA 2CLXA 4YNOA 3EFLA 4R3PA 2WFYA 4TNDA 4U44A 1ZYLA 4K2RA 2VX3A 3FZSA 3UO6A 4U42A 2FH9A 2WTKB 3DLZA 3F3ZA 4AT5A 5C8KA 4AXCA 2JDVA 2QOCA 3GQLA 2ZV2A 2BAQA 3FLWA 1WAKA 2HOGA 2YZAA 4IFGA 3NZ0A 2R3RA 3I5NA 4FUYA 4BWXA 2BRNA 3EJ1A 3AKKA 3BE2A 3MDYA 4O86A 1UNHA 4CG9A 2XNNA 2C68A 3TTIA 4F6WA 3Q32A 4IZYA 1BL7A 3OWLA 2ZFYA 4FIEA 5IKWA 3DXQA 4UWCA 1YWRA 4F7SA 2JKMA 4RRVA 5ITAA 1G8AA 5CS6A 1A9UA 4X21A 3VS2A 3NNVA 4M67A 4OAUC 3Q4CA 4AX8A 5BMMA 5IQBA 4CKRA 4C4IA 4EUTA 4F1OA 3LE6A 4QP3A 2UVXA 2J0MB 3NEWA 4KRDA 5ANEA 1W7HA 3UODA 4JOAA 3IS5A 2WO6A 2CJMA 3RTPA 2QD9A 2PUPA 5GINE 2FSOX 1OUKA 2UW8A 2R7BA 4JR3A 4PDOA 3RZFA 4FA2A 3TG1A 3G33A 3IECA 3HAVA 3QYZA 4ZXTA 5DYJA 5CEMA 2ZMCA 4BJJB 1QMZA 2BZIB 2XBJA 4JQ7A 4YTCA 4NH1A 4NIFB 4CKIA 2O5KA 2GDOA 3GU7A 4GL9A 5E7RA 4DGLC 3DXPA 3BHVA 3BV3A 4BTMA 4WUAA 3TTJA 3SG8A 4F0FA 5CAQA 3NMUF 3Q6WA 4E1ZA 3SAYA 2BMCA 5I3RA 3W2QA 3LMGA 3C4CA 3Q5IA 5L2TA 4EOMA 4HCUA 3U4UA 5AIKA 3L9NA 4M8TA 3ENMA 4BDJA 3P86A 3RBWA 2VNYA 2XK7A 3R1YA 2BRGA 1ZYJA 3OT3A 1M2PA 3PA5A 3I4BA 5E8VA 3SLSA 3CD8A 3PVWA 1W84A 5CSHA 3E63A 3O8TA 4EOKA 3HDNA 1JKLA 3O23A 3P08A 3QZFA 2QOBA 5BYZA 4C58A 4MCVA 3UJGA 3MFTA 4FEXA 2VD5A 4DTKA 2ESMA 1K3AA 4XEYA 1O6LA 5KBQA 1XO2B 5CF4A 3SX9A 4QMVA 1XR1A 1SNXA 4BCMA 1A48A 4BKYA 5J1VA 3DBQA 1KUTA 5M06A 1QL6A 5TE0A 4D4SA 2Y8OA 1XMLA 3ZS5A 4BCHA 5JSMA 5AIRA 3EH9A 5HTCA 3H9OA 3KCFA 2X9EA 5CANA 3CQUA 3ORKA 4IVCA 3QQGA 4YC6A 4YTHA 3R30A 5DHJA 4BIEA 4USEA 1H25A 3H10A 2HZ0A 5KMKA 5E4HA 2X8DA 2RFSA 4RLKA 4Y95A 3NUSA 4ACHA 2JGZA 3AC5A 1PXLA 4UBAA 4C4EA 4FSNA 4HZSA 2W1HA 3O7LB 5B7VA 5EK7A 2PE0A 1H0VA 4PTGA 4GIHA 1H1QA 1UNLA 3QZIA 4BZDA 3L8VA 4L6QA 4F9YA 4RIWA 3QX2A 4CNHA 4PDYA 3DTCA 5L2IA 3NUAA 1OL1A 3RK7A 4U45A 3ZTXA 3AKJA 3I1AA 2WTIA 3QC4A 4BDBA 3PRFA 4L42A 3UNKA 3FZPA 4TWNA 3IDBA 3V5JA 3ZLYA 1OIRA 2XH5A 2ERZE 1ZMWA 2XJ1A 3PPZA 5HX8A 5AA8A 3VJOA 4QPSA 2IVVA 3AC1A 4C3RA 4H36A 3D5UA 4C62A 4EOJA 2FYSA 3E62A 5GJDA 1UU3A 3ZC5A 2Z8CA 3FMNA 1AD5A 2WD1A 3UGCA 3UO4A 3VUIA 3EIDA 3FBVA 4AN2A 3GU4A 3OEFX 4NTTA 4DFUA 5ANJA 3PLSA 5KMIA 2GMXA 4JDKA 4TNBA 4CGAA 4AW0A 3S3IA 3VNTA 2PVNA 4DYMA 4XG9A 2GS6A 3MA6A 3QWJA 4AA4A 5L2SA 5AM7A 3CC6A 3UG1A 1IAHA 1PXIA 2VNWA 3E8EA 1KV2A 1REKA 3ML1A 4IFCA 2PMLX 3NAXA 5I9ZA 5BVFA 4TN6A 3T3UA 2W4OA 5GZ9A 3I0OA 2WMWA 4EZ5A 4FEUA 3R63A 3V5QA 4F1MA 4XV9A 4R7HA 4E4NA 3QCYA 3R8VA 3R04A 4BCJA 3GQIA 3OW4A 2BILB 3D7TA 3AD4A 3FYJX 1FPUA 3QCQA 4N4SA 4O6EA 4X2NA 3U9NA 4IWPA 4U5JA 3HP5A 3KREA 3QLFA 4UXLA 3MVLA 5K4IA 3JVSA 5KHWA 3BKBA 5CEQA 5DMZA 1ZMVA 3EL7A 4I6QA 4OTGA 2X7GA 3COHA 5AR2A 4ZTQA 1OITA 2YM4A 3G51A 2Z7LA 2XJ2A 4FNYA 3TWJA 4F9AA 5I4NA 3EB0A 5FM2A 4DGGA 5J8IA 1PY5A 5BPYA 3NIZA 4CMOA 3TUCA 3QQJA 4KIKB 4J7BA 4AXFA 3QRUA 4ZJIA 2YCSA 5CAUA 2JDRA 1PMUA 3WOWA 3G9NA 2GQRA 1ZAOA 1WZYA 4ZS0A 3DLSA 2X7FA 5K0KA 4YJQA 5IQHA 2BZKB 1XBBA 4FTAA 2CGXA 2NRYA 5D7AA 3FY0A 3UQCA 4EWHA 4I92A 3C51A 3DBDA 3HECA 2GNLA 4IVDA 4CSVA 5IH5A 3QRJA 1WVWA 3HZTA 4L01A 5IQFA 1YOMA 4QMUA 4B8MA 1Q62A 2A19B 2BRMA 4RIWB 4QMNA 3HV4A 1KV1A 3BYMA 2BTSA 4ZY4A 4UZDA 2FUMA 4AZVA 1S9JA 3Q4UA 5HEZA 4Y46A 1AGWA 3HMIA 3ACJA 4N0SA 4OAVB 2BAJA 4QPAA 4WA9A 3MIYA 4ALVA 3OCTA 5EDQA 2FO0A 3MVMA 5KNJA 2VTSA 2R3FA 3QGYA 3A61A 4HNFA 4I1ZA 4IZ5A 4RIOA