2XH5A

Structure of 4-(4-tert-butylbenzyl)-1-(7h-pyrrolo(2,3-d)pyrimidin-4- yl)piperidin-4-amine bound to pkb
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
Knots found
sequence length
337
structure length
316
Chain Sequence
KVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAMKILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFHLSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEGISDGATMKFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFELILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQKKLLPPFKPQVTSEVDTRYFDDEFTAQSITQEMFEDFDYIADW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords RAC-BETA SERINE/THREONINE-PROTEIN KINASE
publication title Discovery of 4-Amino-1-(7H-Pyrrolo[2,3-D]Pyrimidin-4-Yl)Piperidine-4-Carboxamides as Selective, Orally Active Inhibitors of Protein Kinase B (Akt).
pubmed doi rcsb
source organism Homo sapiens
total genus 84
structure length 316
sequence length 337
other databases KnotProt 2.0: Artifct K 41 41
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00433 Pkinase_C Protein kinase C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2xh5A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2xh5A01
4AW5A 5HG8A 1WCCA 3I1AA 5EHOA 1FQ1B 4RWLA 4E93A 3DB6A 3Q53A 3WOWA 4DTKA 4M0YA 3I5NA 4KBAA 4A9TA 2VTJA 3LXLA 2PUPA 3ZUTA 4AFEA 1J7LA 1KV2A 2PMOX 4L3PA 3G51A 4XUFA 2JIVA 1YDSE 3OD6X 3A99A 5LXMA 1TQIA 4QNYA 5L6WL 1WVXA 2OJGA 4OTPA 3SXSA 1OBGA 4EQUA 4FODA 2JIIA 4E3CA 2PE0A 2Y6OA 4FTKA 4EWHA 5IH6A 4WG4A 3TZ8A 3R9OA 4QTAA 3N4UA 4NKAA 3BZ3A 4L00A 4DT9A 3LLTA 2C1BA 3OT3A 4QQCA 3QRTA 2YITA 4FV7A 3SOCA 4AOJA 4L45A 4MD9E 4JR3A 3AMAA 2CHLA 4RIWB 4RVMA 5CQWA 1V0OA 4E4XA 5DLSA 5FUTA 2H34A 1XH9A 2BFXA 4FOBA 3VBWA 1I44A 2GNHA 2R3FA 4QPMA 1JNKA 5JGBA 4ZLYA 3KU2A 2XJ2A 3MA3A 5CTPA 3HMOA 4CGAA 3EN4A 4IM0A 5DGZA 4PPAA 4FE2A 1R39A 4HPUE 4YHJA 5J79A 1OECA 3ANRA 4DH1A 4Y73A 4DITA 2ZV7A 3TKHA 2YABA 4RIXB 4EEVA 4L3LA 3OWJA 2BZHB 3LCTA 3SKCA 4ZY4A 2YIWA 1Q62A 4EH9A 4CZUA 4EOOA 4Y5HA 4RA5A 4FI1A 2WZJA 3BELA 3DA6A 3UVQA 5DEYA 3R2YA 5TKDA 5E8YA 4YMJA 5JN2A 3HUBA 4E4MA 2I6LA 5C26A 4EQCA 3PDTA 3ZRMA 5CALA 3BE9A 5EM8A 3LPBA 2VTAA 4PTGA 2WMTA 3CD8A 4FTCA 3U51A 4YZNA 2HY81 3W2QA 4P5QA 5DPVA 4M7IA 4AX8A 2EXMA 3SD0A 2UUEA 3V6SA 4WOVA 4FSRA 5IEXA 4QYEA 5IH5A 4QP6A 1RDQE 3MW1A 2YCQA 4ITHA 4F1MA 3GVUA 4I0SA 1PF8A 1H00A 4P90A 1XJDA 5HG9A 3TZMA 4DHFA 4D1XA 2WMUA 4I24A 4W4YA 4IX3A 3GBZA 4NWMA 3HDNA 3NWWA 4TYHB 4FTMA 2ESMA 2IZRA 4GK4A 2UV2A 3TNPC 3VBVA 1LUFA 5DT3A 4X2NA 3H10A 4A4LA 4RBLA 3QHRA 5C9CA 5HNIX 3OHTA 2QOLA 3FKOA 3E8NA 1YDRE 3EN9A 3QBNA 4XYFA 5CSVA 1QPEA 4L9IA 3VHKA 4BDAA 5CEMA 4QQTA 3OS3A 5L2TA 1M2QA 4XRLA 3BQCA 2H9VA 5ANJA 2C1AA 3H9RA 3E7VA 3Q52A 5LCKA 3L9MA 4OTWA 3UO6A 3QA0A 4O0TA 4ANOA 4C37A 4KIPA 2F7EE 4RT7A 3OW4A 2JKOA 5HU3A 3Q04A 4DC2A 4F6WA 2XIYA 3RPOA 5C4LA 5HVJA 4F09A 4NM0A 3UBDA 3FHRA 3UC3A 4CKRA 1PRYA 1ZZ2A 4EUTA 2CGUA 3DGKA 3OTVA 2C5YA 5G6VA 2UW9A 3QZHA 4MHAA 3TJCA 4MBLA 4FSTA 3FJQE 4J8NA 1VEBA 4C38A 5IF1A 5AR3A 2C0OA 2GHGA 3DBCA 2VO0A 3FSKA 4RJ7A 3MBLA 2YDJA 2ZM3A 2GS7A 3TT0A 4EHVA 4EOPA 4GIIA 1Q8WA 3PTGA 2PSQA 3BE2A 3SDJA 4HCTA 1GZ8A 3WE8A 3ZXZA 4BZDA 4FV5A 3Q9ZA 4O1PA 2JDVA 2R7BA 4BN1A 3FC2A 3PPJA 1R0PA 2RKUA 2VX0A 1PKDA 1Y91A 4USEA 3LXKA 4F1TA 5BYLA 3O17A 2J0KA 2R64A 4I6FA 4A7CA 4OTDA 3BYUA 4D28A 5LVLA 2ITWA 2W05A 3MPTA 1VZOA 4F9BA 2R3QA 4U97A 1U5QA 3E7OA 4O96A 3RJCA 4F7JA 2VZ6A 3IQ7A 2R2PA 4O91A 2BAJA 3PY1A 4EYMA 5CY3A 3PA5A 2EVAA 3PPKA 4NJ3A 4NUSA 5HLNA 2ITVA 5EKOA 3UOJA 3HECA 3BGZA 3P1AA 2FSTX 3VS5A 3VUGA 4FG9A 3ROYA 3JVRA 3EQDA 2XNNA 2YM6A 3PVUA 3VUKA 1UKHA 3OEFX 4WKQA 5M44A 4CKJA 4MXXA 5IQEA 2CKQA 4DG3E 3BYSA 1K9AA 3HDMA 4ANBA 3FI2A 4ERWA 4C2WA 4CFVA 2BDJA 5EM7A 2UZOA 2OK1A 3IKAA 3PY3A 3MN3A 5HNBA 4AN3A 3PPZA 3W16A 4FIFA 4X6RA 3NR9A 3NSZA 4FNWA 3MH0A 2YDIA 5TOZA 3V8WA 3HV3A 3UVPA 4H36A 1U4DA 4YPDA 5L8JA 2YCSA 5AMNA 1MUOA 1XH7A 3A7JA 3KMMA 4IFGA 4TZRA 3F7WA 4G6OA 3DAJA 3PVWA 4ACGA 4BKJA 5CI7A 5AUVA 3S4QA 2BIYA 2C6OA 3IDPA 5K3YA 5BVKA 3IOPA 2P3GX 4OW8A 3RPYA 1YKRA 4AP7A 5HCXA 4AACA 3N51A 5KUPA 5AIRA 3OXIA 2CCIA 1CSNA 1PY5A 4YO6A 2BUJA 4M13A 3UPZA 4P4CA 1E1XA 3D7TA 3V5TA 5CXZA 3UIBA 3AC8A 4L67A 3EWHA 4E6DA 3SV0A 2YDKA 1GZKA 2QO9A 2ZV2A 4GUBA 4JDKA 3A8XA 5DR6A 3R8UA 1MP8A 3ZM9A 4KRCA 3O23A 3KXXA 3QTXA 4IWDA 2XK9A 5B2LA 3OWLA 1R0EA 2PVNA 4YZBA 1Q61A 2FUMA 2WMXA 3PSCA 4YJUA 2QG5A 2VX3A 4I4EA 4S2ZA 5HU9A 2QKWB 3GOPA 4FIEA 2CGWA 2XKCA 3E5AA 5H3QA 4D5KA 4XV3A 5CSPA 2PE2A 3A7HA 4L6QA 2J51A 3THBA 4BYJA 4EH8A 3FKLA 3UO5A 4MXZA 4HCUA 3MB6A 4HJOA 5DR2A 2XNPA 2W1DA 4QQ5A 3HRCA 4HW7A 3I0QA 3LMIA 5FTGA 2F2UA 5CF6A 2YFXA 3W33A 3UOKA 3FLZA 3AC3A 1NVQA 4EOQA 2HAKA 3PIYA 2QCSA 2E9PA 4C35A 3MESA 4F9CA 3O7LD 2YA9A 3O8UA 3EFWA 5E8WA 5KBQA 4FNZA 3AMYA 4U40A 4EH2A 1M7NA 2R3KA 3SW4A 4FVPA 3DK3A 2H8HA 3F9NA 3H9FA 4E5BA 2JC6A 3F5PA 4FL2A 3NYVA 3U4WA 5I3OA 3V5WA 4G3FA 3D7ZA 4EOMA 4EZ7A 2ZM1A 4CVAA 2R0UA 2JBPA 2YEXA 3KMUA 2JKMA 4QP2A 2QOKA 4A06A 4DGMA 4TN6A 5ETIA 3OBJA 4IAKA 5EDRA 3GQLA 4D9UA 2X7OA 4CKIA 1PXJA 1X8BA 1IG1A 1ZMVA 5KZIA 3TL8A 3MY1A 3QF9A 4X3JA 2YM7A 1CKJA 5IDNA 4QP9A 3HEGA 1WBPA 2XBAA 2XRWA 3FI8A 3F66A 1RW8A 2XF0A 4IX6A 1H4LA 4M3QA 4UMTA 4MXCA 5M51A 3R7IA 3QTSA 3QRKA 3W18A 1H25A 3HAMA 3PLAE 4XG2A 1JKKA 3ZO3A 1CM8A 3AT3A 1QMZA 4F7LA 2J4ZA 3RK9A 2OKRA 2PUUA 2JFMA 2XNOA 3HA6A 5BUIA 1ZXEA 1ZYDA 3L8PA 5IA0A 1LPUA 5LVOA 2O2UA 4RGJA 4BWKA 4IJ9A 1U5RA 4ALVA 5FD2A 3P79A 4IB0A 4Z55A 4BTMA 3VS4A 5H2UA 3QTIA 3G9NA 1E9HA 4CTCA 4ENXA 4C58A 4FTAA 3SGCA 4NT4A 4ZZMA 3BHYA 4G3DA 4ZZNA 5I3RA 5BVEA 4PF4A 3UZRA 3CGFA 3PP1A 5AP0A 3FZ1A 4O84A 2C6IA 4ALWA 5T6KA 1P5EA 2X81A 3LXNA 5DYJA 3H30A 3Q5ZA 2XBJA 4EOLA 1SYKA 3JS2A 5EM6A 4BCQA 1O6YA 2X9EA 3FYJX 3LFAA 4K9YA 4WNOA 3K3IA 4AAAA 4L46A 5DHJA 4R1YA 4ZLOA 4KSQA 3QRUA 4ZJJA 3TG1A 3EZRA 1MQBA 2XH5A 4EH7A 3H4JA 1KV1A 3K2LA 5I9UA 4ZY5A 5IMXA 3S1HA 4FV9A 1REJA 1SVHA 2A4LA 4YUQA 1BMKA 3U55A 4DFBA 3LQ3A 3U9NA 4B8MA 5E9EA 2FSOX 2BZKB 3BLRA 3HGKA 5E90A 3PA3A 3W2PA 4BIDA 4UV0A 2A1AB 3RZBA 4KIKB 1UWJA 5CZIA 3EN7A 2A19B 3A62A 5BUJA 3WF7A 2R0IA 4FNYA 3AD4A 3SG8A 2YAKA 3Q60A 1XBBA 2JAVA 5AV0A 5E4HA 4RJ8A 3PWYA 2FVDA 3TNWA 2F7ZE 2Z7LA 3G2FA 5IG1A 3PY0A 1FMKA 4EOKA 1LEZA 3VBTA 4BY9E 4TYGA 3D2IA 1M17A 1O6KA 2R3JA 3SX9A 1XH8A 5TO8A 2VGOA 3K3JA 3MH2A 4GRBA 5BUEA 1IAHA 2CCHA 2GNIA 2E9OA 5A4EA 3EQHA 1PW2A 4C4FA 3O7LB 3U6IA 3MJ1A 4FKGA 4NFMA 2EXCX 2WGJA 3FY2A 3MYGA 4E73A 2X0GA 4EBVA 3MVHA 4ERKA 1YHWA 3LJ2A 4BBEA 3KXNA 2HIWA 3E8DA 3ORMA 3FAAA 1WAKA 1H1RA 5I4NA 3O8PA 4TNBA 5D11A 5M56A 2VRXA 4FZFB 3TTJA 4DEBA 2QO2A 3R0TA 2QURA 2O3PA 4H3QA 4YO4A 4MQ2A 3DTCA 5FEDA 3VBQA 2Z7RA 1YXTA 2A27A 4CFNA 2ZVAA 1Y57A 2GHMA 1OKWA 3ZRKA 4YBJA 1IA9A 3EQFA 2E9NA 3K5UA 4M84A 5DRDA 3VN9A 4RWKA 4BGQA 1Q8ZA 4MTAA 2GS2A 1IRKA 3RAKA 3TUCA 3DK6A 1ZYLA 3QX2A 3ZEPA 5CF5A 3MSSA 3LAUA 4GU6A 4L42A 3BYMA 4WSYA 2XK3A 1XKKA 2NRUA 2J9MA 4LMUA 3R83A 4O38A 5AR8A 3ZC5A 3RNIA 3U9CA 4M68A 5DFPA 3FMHA 4U0IA 3WYXA 5KKRC 3VUMA 3ZDUA 5BNJA 2RFNA 3W55A 4CFFA 1B39A 4D2PA 2C69A 3IO7A 3C1XA 4O0UA 3UIMA 3ZLYA 2YERA 1G5SA 5AV3A 4I5PA 4C61A 3W8LA 1BL6A 4KA3A 3TV7A 3SXRA 4FYOA 4N0SA 3FLQA 4FSUA 4UEUA 4MEDA 3ZZWA 4GL9A 4A4XA 1V0BA 4PMMA 2O64A 3EOCA 3JY0A 5F4NA 3ZFYA 3Q2MA 3AD6A 5CAOA 2VN9A 3GU6A 2XIXA 4UMUA 4QMOA 4RQVA 4IEBA 4JIAA 4UWYA 1JPAA 3W10A 3LOKA 2OJ9A 2AC5A 5M07A 1YW2A 2WNTA 1H1SA 4AS0A 5CU0A 3WZEA 4MNFA 4D4VA 3C0IA 1ZOHA 4ANMA 5I0BA 3V8TA 3E92A 3PE2A 4BDDA 3R28A 4FKPA 3FC1X 3NCZA 4G6NA 1OKZA 5D9HA 2WXVA 4UXQA 3LFFA 5F1ZA 5FM3A 2UW5A 4EUUA 1CDKA 3DY7A 3IGGA 3NW7A 2R3RA 3QX4A 5EW8A 3GI3A 3WF6A 4U41A 3NVKI 4AZWA 3OY1A 4NU1A 3DFCB 4KKHA 4IXPA 2X6DA 4FKQA 4QTCA 5JFVA 1HCLA 3BEGA 5HO6A 5LMKC 3VUIA 4B4LA 3GC8A 4QPAA 4BDCA 3KGAA 2W5BA 5A3XA 3WI6A 3DAKA 4I1ZA 5J1VA 5EQEA 3MFRA 2X8EA 3QQFA 4F70A 3MVMA 5AUWA 2BKZA 3F3TA 5CSXA 2QOQA 4RX9A 5AUZA 3ZLWA 5HE3A 3WZUA 5HO7A 2DUVA 2W4OA 3MPAA 4E1ZA 3BKBA 4HZRA 4JQ8A 2FGIA 3P9JA 4HGTA 3O2MA 4D2SA 2WQMA 3RCJA 4FT5A 3Q4UA 4TT7A 5ANOA 2PMNX 3VS1A 4DG2E 3E8CA 2W1EA 3PJ2A 3D5WA 4BDGA 3KRXA 1FVRA 5GZ9A 5GINE 4IVCA 4FTIA 4WNKA 5HCYA 3F7ZA 5HEZA 4IVAA 1V0PA 2WQOA 4E20A 5I5ZA 4MF1A 4EWQA 3LZBA 3ZZEA 2YWVA 4Y85A 2X7FA 1S9JA 4MNEB 3MH1A 4OAVB 2UZVA 4L52A 4RWJA 4KKEA 1RJBA 4NM7A 3U4UA 1QPJA 2P55A 5I9WA 3N4TA 5CEOA 5ANKA 4KIOA 5AP3A 5HOAA 4RC4A 3RK5A 3TV6A 5HVKA 2BMCA 3P23A 4GUEA 3COKA 1ZOEA 3TNQB 4H1MA 3FMMA 3FXZA 3V5LA 2QKRA 3KCFA 4GYGA 3AMBA 4U6RA 5JKGA 4LQMA 2UZNA 4PTEA 4QMYA 3PJ3A 2G2FA 4AGWA 2GNJA 2XMYA 4BL1A 4QMQA 5HZNA 5B2KA 3ENMA 3WIKA 3FYKX 2O0UA 2GPHA 3PWDA 1WVYA 4KIQA 5AUUA 3VC4A 2PUNA 3KK8A 3G90X 1JKSA 4DH8A 4F4PA 4FK6A 4C2VA 1SMHA 5AV2A 2UVYA 4MBIA 1M2PA 4F0FA 2C47A 4I93A 4RG0A 4DEDA 1YDTE 3QKKA 2XEZA 4RRVA 3FDNA 4ZJVA 4O0XA 5LJJA 4M12A 4ZXTA 3A61A 5LARA 2WPAA 1MRUA 4YNOA 4EH3A 5I9XA 3GXLA 2PVKA 2WEIA 4FTUA 5HORA 3BYVA 1U54B 3B2TA 3DQXA 4PL3A 4O7WA 1STCE 5BVNA 5HICA 3C13A 3QXOA 4FK3A 4EHGA 4PP7A 5BPYA 1U59A 3RNYA 2VTSA 3VULA 5JFXA 4E4NA 3MWUA 3TACA 3SHEA 2IVUA 4AT3A 5HX8A 3S0OA 3ZSHA 1I09A 4O6LA 4EOSA 2XS0A 3LHJA 2C0TA 2YWPA 2UVZA 3AC1A 2OU7A 5E8UA 4DEIA 3DKFA 4IACA 4JJRA 5DNRA 4DEAA 3HYHA 2CNQA 4YTCA 4UZHA 3SRVA 4A07A 4ZTMA 3AC4A 3FL4A 4ZSGA 5EOBA 3QWJA 4GJ3A 4ZSJA 1XR1A 2BVAA 3C7QA 4QMMA 3SOAA 2W1ZA 4FKJA 3HLLA 4WIHA 3OCSA 4LFIA 1ZARA 3UG2A 3OOGA 5ETFA 3D4QA 5CF4A 4XP0A 1YWRA 3TZ7A 5AP1A 5TE0A 5L3AA 2VWYA 2JGZA 5ANEA 5CLPA 5AR5A 3CY3A 2PK9A 4AUAA 4IM2A 4OTRA 4UBAA 4UYNA 3BV3A 2C5XA 2XNMA 3FHIA 4YLJA 3E93A 2V62A 2X2KA 1GNGA 2VWUA 4MAOA 4OTQA 5CSWA 4H39A 4AGUA 4OLIA 4Y83A 3COMA 4H3BA 4P2KA 4YJOA 4RFYA 3FZPA 5F94A 3VBYA 5EKNA 3QA8A 3QD2B 2PMLX 3QGYA 4TWPA 2HW7A 2QC6A 1QPCA 2JDTA 4D0XA 4V05A 5LVPA 4AT4A 3E64A 3R7UA 3CE3A 4FTTA 1PXIA 4C3PA 4JI9A 4CG8A 4HGEA 4U44A 2XNBA 3OXZA 5CT7A 2OW3A 4AA4A 4B99A 5E92A 2B9IA 2BDFA 5J8IA 2QOCA 4R8QA 3ZEWA 1QPDA 1BLXA 3HMNA 2UZDA 5CEPA 4C62A 1GJOA 5J5SA 4KS7A 3KREA 2F49A 4HYSA 3Q6WA 3ZYAA 3QD0A 4ACHA 4FSNA 4MXYA 5AV1A 4AQCA 4H3PA 4U7ZA 4LRKA 3T9TA 5CU6A 4USDA 4W9WA 2G1TA 3R7EA 4WG3A 3DS6A 3KXZA 1LP4A 1PXOA 4I41A 2YCRA 2WIHA 4GT4A 1A06A 3C51A 4LGDA 1P14A 1O9UA 5AEPA 3QD3A 1KOBA 3FMEA 1OM1A 3PP0A 1JAMA 4L8MA 4A9SA 2CMWA 1FGKA 3ROCA 4CG9A 1UWHA 4Q9SA 3WARA 4JQEA 1OKYA 4DCAA 1P4FA 3UC4A 3KULA 1FINA 5H8EA 2HXLA 4DGGA 1UU7A 3MS9A 4JG7A 2CLXA 4DGNA 2PVJA 5KKRB 4HNFA 5CYIA 2X8DA 4G3EA 4QMNA 5KCVA 5AP5A 3D9VA 3QRJA 4I21A 4AT5A 2RFEA 3EQIA 2FB8A 4PNIA 4HGLA 3BIZA 4UMQA 4R5SA 4UXLA 5GIOE 4ASDA 3BYOA 2QONA 2Q0NA 3GB2A 3PSBA 3P0MA 5EYMA 3R7OA 2UW0A 3F88A 4LV8A 3TN8A 4A4OA 3CPCA 4I3ZA 3LFNA 3VRYA 5H8GA 4KWPA 4C7TA 4F63A 5BVDA 4L43A 3KEXA 4DLJA 2OO8X 3D5XA 2ITQA 2WMQA 3ELJA 3LCSA 3NNWA 5DR9A 4EC9A 5GZAA 3HA8A 1LEWA 3EKKA 4QYHA 4FT0A 1M14A 1ZYJA 3O96A 4V04A 3CLYA 3KKVA 3QCXA 4XLVA 4E26A 5I9VA 1PJKA 1UU3A 3FKNA 3Q6UA 3TXOA 1XH4A 2CSNA 3MIYA 4K77A 2YJSA 4DFLA 3R8ZA 2ERZE 2BHEA 4LUDA 1R1WA 2ZV8A 4ALUA 2IZSA 4C4EA 4DH5A 4O7VA 2V7AA 1YWNA 4U9AA 1T45A 3EQGA 3DKGA 2OZOA 3IW7A 3R8PA 2XB7A 3FMKA 1YI6A 2Z7QA 4I6QA 5LMAA 2IW8A 4BDIA 4U43A 5JMSA 3JUHA 3PG3A 5HX6A 3A8WA 5GNKA 1R3CA 2ITPA 5HI2A 2OFVA 4FTJA 4BCPA 3POZA 4BC6A 4R77A 2J0LA 4Q5EA 4ZK5A 3F69A 4HVHA 5K5NA 4O7RA 2PHKA 3QCYA 1KUTA 2OGVA 4R78A 5M55A 2HZ0A 3WF5A 3OUNB 3F5XA 4WHZA 3VUTA 3UTOA 4PDOA 3ZO1A 3P7BA 4NK9A 3CEKA 3P08A 3FQEA 4DCEA 3A60A 4CRSA 2UW4A 3LQ8A 4U81A 4A9UA 2RFSA 1VJYA 2BTSA 4S31A 3RBWA 4XG9A 4GKIA 3ORIA 5CNNA 4UMRA 3FL5A 4IAZA 2XNGA 4AA0A 4BZNA 4C34A 1W83A 3C4XA 1FMOE 3FWQA 5BYYA 3R1SA 4L7FA 5LVNA 3DLSA 3R1NA 4K2RA 3TUBA 1M2RA 4IZYA 4AZTA 2I7QA 3PXZA 4BDHA 3R9DA 5AP6A 3V8SA 3V5JA 4CRLA 5DT0A 4X2JA 4BFMA 3SG9A 3BI6A 1KSWA 4IX5A 3HVCA 5ACBC 1OPKA 4DINA 2BIKB 2VWZA 3PSDA 4YTFA 5GJFA 4XV2A 3BU6A 4O83A 4BGGA 5CU3A 5LMBA 4JX3A 4PNKA 2W5AA 2QO7A 4AWIA 4L01A 5FEEA 3I81A 4RVLA 4EYJA 4JR7A 4W8DA 1GOLA 4JVGA 4F6SA 5JEBA 2BZJA 4BI1A 2C68A 5IA5A 3TJDA 2Y4IC 3ZMMA 4HGSA 2W9ZB 2NNWB 4ASZA 3QTZA 3SRVB 1A9UA 1UNGA 3F5GA 3II5A 4KD1A 4KIKA 3WF9A 4FKRA 4LOOA 4CV9A 5M4CA 3CS9A 5FTQA 3V04A 5CSHA 5CEKA 3UMXA 3UVRA 2GFSA 2RSVA 3HP5A 1OITA 4J1RA 4F7SA 4M0ZA 3CPBA 5DN3A 1BUHA 3ITZA 3LFEA 3VS6A 2OJJA 5HLPA 5AAFA 3NPCA 3GCSA 3PYYA 5M53A 3I60A 2J2IB 2W1GA 2HWPA 3DJ5A 3WF8A 5A4QA 5HD4A 4XMOA 5EYKA 5CEIA 5M4FA 3R73A 1H08A 4MVFA 1NT2A 4OT5A 4IWOA 1YHSA 5BYZA 2BFYA 4EC8A 4DAWA 2XYUA 4YJQA 1OL2A 2WTIA 5E8VA 3FSFA 5KMKA 1VR2A 5IDPA 2WOUA 5J9ZA 4QOXA 1Z57A 1OZ1A 4ONAA 4EK4A 2GNLA 2QOBA 1GZNA 2JKQA 2QQ7A 4AZVA 4F9YA 2Y7JA 2ZB0A 5KNJA 2WKMA 3GNIB 4C0TA 4QTBA 3UGCA 4YZ9A 4M97A 5A4TA 2V7OA 4JG8A 3Q32A 4CLJA 3F82A 1ZY4A 3W1FA 4XRJA 5CU4A 3V5PA 3WZDA 1OUYA 2GNGA 3AGLA 2JIUA 2W7XA 3ZTXA 4BCJA 4BTFA 4JBOA 4EONA 3LCKA 2QU6A 2X39A 4PV0A 4EOIA 4FT7A 3ORNA 4BB4A 3EL7A 4G34A 2F2CB 2WFYA 5AX3A 1ERKA 4C3FA 5KMMA 3JVSA 2XKEA 5CAVA 3TM0A 2XCKA 3R01A 1TVOA 4E7WA 5IU2A 4ORKA 4RPVA 4CMTA 3A2CA 2ITZA 2C5NA 3OCBA 4RQKA 4Y72A 5KMJA 3O0GA 3DLZA 2CNUA 4RFMA 5EG3A 2VTNA 3GU7A 3ATSA 3Q5IA 1KE7A 5HE2A 3R7VA 4ACMA 1FPUA 4QRCA 2PZPA 5CZHA 3C4WA 4FG8A 5IQAA 5HLWA 3KULB 5JZNA 3MFUA 4CEGA 4FTLA 5KMOA 4BTKA 2BILB 1MRYA 4HPTE 4Z9LA 2EB3A 2OXDA 4FA2A 2O63A 3M1SA 2JDOA 2UZLA 3HZTA 4IVDA 5IQGA 3KQ7A 4YZDA 1M7QA 3AC2A 1F3MC 4NM5A 2LAVA 2XK8A 2OSCA 3IW8A 1AD5A 3POOA 4Y5QA 4FT3A 3TUDA 2JAMA 3GOKA 3F2AA 2YAAA 4II5A 3ZDIA 4YSJA 5JFSA 4DYMA 3ORLA 1RQQA 4UWCA 4PDPA 5M09A 3DJ7A 3R1YA 4RFZA 4FUXA 3IDCA 2ITOA 4IDVA 4DEEA 4BDEA 4QP8A 4QTDA 4JX7A 5AR7A 3G33A 3REPA 3IW6A 3ZOSA 2OI4X 4LGHA 5FGKA 1KE5A 3LIJA 2HZ4A 3MI9A 3HV6A 4U8ZA 5EYCA 4QP3A 4CD0A 3TNIA 3LVPA 3FI4A 5JQ5A 2B4SB 5AJQA 2WOTA 2XK6A 4G16A 4NM3A 4XEYA 3QQLA 2WELA 4F64A 1S9IA 3PIXA 2YCFA 4ZTLA 3R9RA 1QCFA 3F6XA 2C6EA 5AIKA 4FKVA 4ZJIA 5CX9A 4FV2A 2UW7A 1F5QA 4ANSA 4QMPA 1B6CB 3MPMA 4WRGA 4C59A 4Z3VA 4F1OA 3DDPA 4L68A 5CWZA 3WBLA 5FDPA 3SAYA 1BI7A 5EH0A 4YC6A 2C3KA 4WNMA 5E1EA 4CMUA 4EZ3A 1Y6BA 3DTWA 5EHLA 3RALA 1SVEA 4U80A 5KHXA 4CFXA 3LFQA 5CNOA 4JG6A 5CU2A 4EKLA 4BCMA 3ZCLA 4O7LA 4HCVA 3R00A 2O8YA 2R3HA 2C30A 3B2WA 2HW6A 3RI1A 4W4VA 3ODZX 5GZ8A 1VYWA 3EQPA 5AADA 1YOLA 4LM5A 4GYIA 3VQHA 5IISA 2IPXA 3QTRA 1PYEA 2YIXA 5C8MA 3OUKA 4QMWA 4WA9A 4FZDB 4DEHA 3R8VA 1ZYSA 4MNEA 2PZYA 4F0IA 5JT2A 2XKDA 4NFNA 5M4UA 3L9PA 4PY1A 4JDJA 4WT6A 2BRNA 5I9YA 3GCVA 4EJ7A 4ANQA 4WUAA 5M4IA 3DXNA 4RIOA 4R7BA 4Q2AA 5FM2A 2QI8A 3BBTB 2BRHA 4RC2A 2H96A 4ENYA 4QP1A 3PJCA 3KRJA 3QWKA 4K8AA 4FR4A 5DVRA 2RIOA 5GIPE 2UZBA 4V0GB 3DDQA 3IDBA 2R3IA 4EOJA 4DH3A 2F7XE 3H0YA 4Y95A 1PXKA 3DB8A 3QFVA 4L44A 4MCVA 2ETRA 1OL1A 2R7IA 2EB2A 4XG6A 4NTTA 3QCQA 3H3CA 5J5TA 4I5CA 1ZYCA 1XH6A 4XG8A 2QU5A 2VX1A 4N70A 5C1QB 2QODA 3QC4A 2PVLA 3HV7A 2BTRA 4J98A 1GAGA 4YLLA 3RHXA 5E8SA 5K9IA 5TF9A 2YM4A 3UOLA 2UW3A 4M66A 4FEVA 5HKMA 3RZFA 3M11A 2ACXA 4LL5A 3DKOA 1DI9A 1CMKE 3DT1A 3HV5A 3NNVA 4U5JA 1U54A 2F57A 1PMNA 4X3FC 1XO2B 5AWMA 3L8XA 5FQDC 2JKKA 4YNEA 5KMIA 5FLFA 4XX9A 2B55A 4B6LA 3ZO2A 4TYEA 2ITTA 4RVTA 5HBEA 3FE3A 2HYYA 3EFKA 5D1JA 1GY3A 3P5KA 5HD7A 4CXAA 4TNDA 2VWIA 3PRFA 3QTWA 4OTGA 5FBOA 4GK3A 4NIFA 4RZWA 2OZAB 2ZV9A 3UPXA 3D2KA 3LKMA 2G9XA 3S00A 4FYNA 3UIXA 4FV3A 4K11A 4ZLZA 4IHPA 3HRFA 4YJVA 2BKKA 3ERKA 2VO3A 4RX8A 3EIDA 4XNEA 3KY2A 4FIHA 5AM7A 3CGOA 5ANGA 3RKBA 3UO4A 2WU7A 4LGGA 2W0JA 5IA3A 4ZS4A 3HMPA 2CNVA 3OT8A 2FSLX 3PZEA 5E1SA 4FOCA 2C6TA 5DRBA 4OBQA 3NCGA 2Y4IB 3UYSA 3BWFA 5CT0A 3QALE 2C5VA 3FY0A 4IWQA 5K4IA 2P2IA 4N6ZA 4XHKB 1GIHA 4GKHA 4ITJA 4BCFA 3Q4TA 5E8ZA 3AGMA 1Q99A 3BHUA 4IVBA 4P7EA 2B52A 3DXPA 4BF2A 3MFTA 2FA2A 3Q96A 4UYAA 3RCDA 4BCGA 4LG4A 4BCIA 4F08A 3MJ2A 5JGDA 2CDZA 1YWVA 2Q83A 1ZRZA 5E8XA 3TDWA 3NAYA 3TWJA 4QP7A 3RPVA 3GEQA 2IVSA 5ANIA 2PL0A 5M08A 2QVSE 2GDOA 2F4JA 1OB3A 3FQSA 5T68A 3PLSA 5FEQA 4D4SA 5DEWA 3FLWA 5AP2A 3H0ZA 4ZMEA 5LWMA 1H0WA 1SVGA 4DT8A 4TW9A 2OIQA 2PE1A 4OTHA 5DE2A 2RG5A 5HESA 1UA2A 3I7CA 2PZRA 4FKUA 3VF8A 2WHBA 3QYZA 4DTAA 4IH8A 3RK7A 3ZM4A 5AM6A 3M42A 4CFWA 3DCVA 1XHAA 1PMEA 4IAYA 3W32A 2Z2WA 4O21A 2XIKA 3CSVA 5EI2A 5IQHA 1P4OA 4E4LA 2PWLA 4RVKA 5TT7A 3R1QA 4J96A 1CKIA 2QD9A 3DQWA 4UZDA 4JAJA 2Y8OA 4R6VA 4YP8A 3E87A 2B53A 2IZTA 5ETCA 4IM3A 5JFWA 3C4FA 4OBPA 2H6DA 3QZIA 2OJIA 3PIZA 4DFUA 3CKXA 3EN6A 4AZSA 3NW5A 4ACCA 1URCA 3DBQA 2VTOA 2WMSA 2WTCA 1NVSA 4IFCA 4FZ6A 5L2QA 3LMHA 3OROA 3T8OA 2VTQA 4FX3A 4JBQA 5F9EA 4LI5A 4LUEA 4BCNA 4U3YA 4W8EA 3BGPA 1Q8TA 3E88A 2GQSA 5TR6A 1J91A 4JBVA 3DBDA 3ULZA 3RM6A 3FEGA 2J90A 2P0CA 5EFQA 3ZS5A 2V55A 3HX4A 3DXQA 4O6EA 4R7IA 2XJ0A 3O71A 3N9XA 3UDBA 4FV4A 4BHZA 1FVVA 3FBVA 3RHKA 1UVRA 3KRWA 4FF8A 5A14A 1H0VA 1BYGA 2C5OA 2W99B 4RMZA 3W2RA 5CAPA 1TQPA 4G6LA 1BL7A 4APCA 4V01A 3C0GA 3DFAA 3SXFA 4ZTRA 3DBEA 1PHKA 4FC0A 4FTNA 5EQPA 2BRGA 3E3PA 2YM8A 3I79A 4C57A 5IKWA 3ZRLA 4QYYA 1L8TA 4O0VA 4QYFA 5C01A 3KK9A 2X7GA 4CQGA 4ANLA 1ZMUA 2ITXA 3GC9A 3GCQA 2RL5A 2X8IA 3QQUA 4S34A 4ZTNA 5BQ0A 5DH3A 3NMUF 3IG7A 3WYYA 3ZONA 4CFUA 4YBKA 4RZVA 3GU5A 5LMKA 4I94A 2BCJA 3Q9WA 4U45A 4O81A 1R78A 1KE8A 3OZ6A 2VWXA 5JSMA 4GSBA 1JOWB 3HAVA 2REIA 2SRCA 4U79A 4NZWB 4QMTA 4W4WA 4NW5A 3B8QA 4FSMA 5HVYA 3RAWA 3OVVA 3T9IA 1KWPA 1Q8YA 3CBLA 4FKLA 2IG7A 2PVMA 4BKZA 4EQMA 3CKWA 2W96B 2LGCA 2RFDA 2OXXA 4D5HA 1OUKA 3L9NA 3NAXA 3R63A 3E62A 5LCJA 4F9WA 3R21A 3NIEA 2B54A 3P78A 5AV4A 2YM3A 3ULIA 4TWCA 5IQCA 4DGOA 5IUGA 4O7TA 3C5IA 4O0YA 1SZMA 4YZCA 3NLBA 4I4FA 4ANNA 2EU9A 2XM9A 3ORZA 4D58A 4BGHA 4MWIA 3S2PA 1UKIA 5IEVA 2VTPA 1WBNA 3R8LA 3OWPA 4WBOA 5DIAA 4J95A 4K6ZA 3RWPA 4LOPA 1K2PA 4H1JA 4K33A 4APPA 5EQYA 4I5HA 3ZH8A 2WQNA 2PTKA 3E8EA 1OL5A 2I0YA 4BDKA 1H1QA 1J7IA 2BRBA 4I6HA 4YJPA 3B8RA 1W84A 3NYOA 4I0RA 1Q4LA 3CY2A 2PYWA 1ZY5A 4GT5A 3NUYA 5HHWA 4YHTA 2ZYBA 3UIUA 4ZZOA 3FZOA 3RP9A 1W82A 2WMBA 4O0RA 3UNZA 2PULA 5IUIA 4NL0A 2ZB1A 4YSMA 3HUCA 5F95A 5JZJA 4NIFB 4O27B 4IANA 2CJMA 2Y9QA 3OFMA 2JEDA 3AT2A 3SQQA 4FIGA 2UZWE 4MH7A 1W7HA 2OWBA 1WZYA 3P7AA 4M15A 4X7QA 3RPRA 3RTPA 4DBNA 3IPHA 2VTTA 5KBRA 2BPMA 3UNJA 4F65A 1YI3A 5L2WA 3TTIA 1EH4A 4LRJA 4XH6A 5DWRA 3JYAA 3TIYA 4QPSA 2VNWA 2C6DA 3FMDA 4CQEA 3BHHA 3HMMA 1KOAA 3GT8A 2YIQA 3G6GA 5L2SA 5LOHA 4FSZA 3RVGA 3EL8A 3NW6A 1CTPE 4QO9A 3CJFA 4ZSLA 3CJGA 1WBWA 4M69A 3VS7A 5A4CA 4RJ3A 4KINA 3D14A 3LXPA 4X3FB 1KE9A 3EYGA 3VS2A 4FVQA 3D5VA 2FO0A 3FQHA 4YHFA 2FSMX 4DBXA 1YOMA 4JBPA 2P2HA 4IC8A 3QKLA 4I5MA 4WRSA 4R7HA 5AUXA 2HENA 3V5QA 2WTKC 3ZBFA 4E6QA 4GS6A 3F3ZA 1YXSA 3COIA 4BYIA 2UW6A 3PUPA 4AFJA 5CVHA 2C3IB 3T3UA 4UB7A 4C4HA 5L6PA 3BLQA 4NCTC 4G2FA 3U6JA 2VAGA 3D5UA 4DH7A 4JDHA 5LWNA 4ZTQA 3HKOA 2R3PA 3TEIA 1L3RE 4YTHA 3MGYA 3MY0A 4JLCA 2BALA 3NX8A 2JBOA 1FOTA 1JLUE 3AC5A 4KUJA 5BX0A 4YJSA 4X6QC 2HZIA 3TKUA 4LYNA 2OXYA 5IQDA 2VV9A 3P7CA 4TYIA 4G3CA 4MXOA 3FV8A 3KRRA 4W9XA 1Q3WA 4BTJA 4ZY6A 4H58A 4G5JA 2EXEA 2J0JA 2QOHA 2ITYA 1T46A 4MQ1A 2AYPA 3DV3A 4QD6A 4TL0A 5K0KA 4S33A 4D4YA 4D9TA 2VWWA 2OIDA 3DAEA 4AA5A 2ONLC 4FTOA 3SLSA 5J1WA 4NCTA 1AGWA 3L1SA 1H28A 4TKSA 3PXRA 4AE6A 2WO6A 4BCOA 3SVVA 2XA4A 2JLDA 4D2RA 3U87A 4EJNA 2W4KA 2XVDA 3HP2A 5LVMA 3I0OA 4LV5A 1JVPP 4S30A 4IB5A 4IAAA 4QQJA 5CXHA 5C8KA 2X4ZA 3NUAA 3ZFMA 5CI6A 5BVOA 4NTSA 4AOTA 1G8AA 3PA4A 1IA8A 4FV6A 4MD8E 4H05A 4QMLA 4RC3A 4MD7E 3VVHA 5AAEA 1OIQA 2AC3A 3F3VA 4FIIA 4EBWA 3C50A 4IAIA 4MWHA 4AW1A 4RIYB 4GH2A 4DEGA 1ZZLA 3ZC6A 5G1XA 2BAQA 1KE6A 3N4VA 3R9NA 5A54A 2W4JA 3GFWA 2ZMDA 4DFZE 1J7UA 5IQFA 2E9UA 2YISA 3GP0A 3R71A 4YLKA 3QTQA 4WD5A 2PMIA 2ONLA 2ZDTA 4O22A 4QTEA 2Z8CA 3GCPA 3KRLA 4BKYA 5EW9A 1PXPA 4GG7A 1UU9A 3ZO4A 3R02A 5CAUA 4YURA 3HL7A 1MQ4A 5FXQA 1ND4A 4R3RA 2YIRA 2VD5A 4S32A 4GCJA 3BCEA 4DE4A 2R3MA 1ZAOA 4NH1A 3TZ9A 4J53A 4B7TA 2GMXA 1OPJA 2XKFA 5HCZA 5KE0A 3QKMA 3MV5A 4M67A 5KHWA 2X1NA 2HWOA 2HY0A 4YTIA 1H24A 5FWKK 5EM5A 2G01A 2R5TA 1V1KA 2OBJA 2VWBA 3UP7A 4ZSAA 4U3ZA 2WEVA 2OF2A 3ZXTA 5KX8A 2DS1A 3S3IA 4CZTA 3NIZA 2PY3A 2R3OA 4XV1A 4CT2A 4Z7GA 1OIUA 1YXVA 5DOSA 5A9UA 2CN5A 3G9LX 2CLQA 4TXCA 3VF9A 1XWSA 3UNKA 4OAUC 3EZVA 4I23A 2WAJA 3VBXA 1SNUA 4QMXA 3HMIA 3WIGA 4CCBA 4QT1A 4J52A 2OH4A 2I0VA 4A9YA 5JK3A 4HVDA 1NY3A 4YPSA 1Q41A 3A4PA 3KL8A 3R9HA 3KF7A 3W2OA 4B9DA 3BHVA 5B2MA 3DZQA 3QUEA 5HO8A 1JKTA 3R04A 4JT3A 2YLEA 2Y6MA 4JRNA 3NDMA 4F0GA 2ZDUA 4NSTA 2W1HA 3QD4A 4CZYB 5J7BA 4OTFA 4MX9A 3JXWA 5E8TA 3I6WA 4MK0A 4BRXA 3TV4A 2P4IA 2WIPA 4O0WA 2W17A 4WSQA 1Y6AA 2ETKA 4IBMA 4TRLA 5DI1A 3H9OA 3I6UA 3L8SA 2XEYA 2XUUA 5IA1A 4GFGA 5K0XA 3VNTA 2RGPA 3ETAA 4FKIA 3L8VA 4C4JA 1OGUA 3BU5A 4XOZA 2NO3A 4K0YA 3UZTA 1PMUA 2R9SA 5BVFA 5CANA 4R3CA 4E6AA 4O7ZA 2JITA 3QZFA 4IQ6A 2ZOQA 3AXWA 5J95A 1YRPA 3JY9A 5L2IA 5HE1A 4ASEA 2XIRA 3R22A 4PUZA 4Y46A 4BI0A 5JGAA 1UU8A 2XRUA 4D55A 3SW7A 2B0QA 4V0GA 4FNXA 4O7NA 4CYJA 3AQVA 3EKNA 3KA0A 4XJ0A 1AQ1A 5JRSA 3CXWA 3Q4CA 4P5ZA 3Q9YA 3VUDA 1B38A 5ANDA 4PDSA 3U54A 2X2LA 3QU0A 5L8LA 3QRIA 3UQCA 2C3LA 4FGBA 5AUTA 2ETMA 1OVEA 5B7VA 2BROA 2B9FA 3Q9XA 2YN8A 4AXAA 4D2WA 4X2FA 4C33A 2JDRA 5AR2A 3A7IA 5T3QA 1OPLA 4ZS0A 3QYWA 3W8QA 3WILA 4X2KA 4FICA 5M57A 4ZIMA 3TNHA 3NGAA 3SA0A 2CKPA 4PDYA 4EH4A 3AOXA 4RJ5A 4FUYA 3BX5A 5D7AA 3F3WA 3ANQA 4RA4A 1JSTA 3C4CA 4HOKA 2JFLA 3C0HA 4C4IA 3KVWA 4M69B 4F6UA 3V3VA 2C6KA 1Z9XA 1GIIA 3R2BA 3QGWA 4DTBA 2B9HA 3OOMA 2O65A 4PPCA 5EK7A 3CQEA 3RGFA 2IJMA 1IR3A 3OY3A 1ZOGA 3LFSA 3NNXA 2GTMA 2OZAA 3BEAA 4IZ7A 4YC3A 2WQBA 3EN5A 2W1FA 2VTIA 4ZEGA 2WB8A 2BDWA 2IW9A 1SM2A 3QLFA 3FLSA 3ALOA 4YGAA 2WMRA 4AU8A 4WNPA 4O2ZA 4YJRA 1ZWSA 2B7AA 3VUHA 4C3RA 4EK6A 2YZLA 4KRDA 4D0WA 5A6NA 5K5XA 2X9FA 3KCKA 1OKVA 3QUDA 4PMPA 4Q9ZA 2IW6A 2PVRA 5E7RA 2J0MB 4HYHA 5CEQA 2VO7A 3ACKA 3ALNA 5DMZA 3TDVA 5AR4A 1NVRA 4AW0A 1JWHA 4HYIA 4E5AX 3LJ1A 4O1OA 4EK5A 3IS5A 2C3JA 4FVRA 4A9RA 4BICA 5HTCA 3U6HA 3KN5A 4AN2A 4KKGA 4JDIA 2ERKA 4D1SA 4DFXE 2WTWA 2XK4A 3OEZA 3NYNA 2F9GA 1QL6A 4QMSA 3ORXA 4ZOGA 3TI1A 3EQBA 3MA6A 4YC8A 5FP6A 3OXTA 5HIEA 5C4KA 1J3HA 1IEPA 4L7SA 4XS2A 5FDXA 1ATPE 2YLFA 3D0EA 3PXKA 5FP5A 1E1VA 3ZSIA 2AUHA 3EFJA 1U46A 1PXMA 2ITUA 3A7FA 3SC1A 4Z16A 4PP9A 3DU8A 1OL7A 2WTKB 5L6OA 2J5FA 4HNIA 4N4SA 3K54A 1BKXA 2KTYA 4LRMA 3PXFA 5ETAA 3CTHA 4BIBA 3I7BA 2VTHA 5HBJA 2XCHA 3FXWA 3G6HA 3OWKA 1YOJA 3CCNA 2VTRA 3GQIA 2XZSA 2QOOA 3GGFA 4E6CA 4XBUA 4N6YA 3LLAA 3DKCA 4UMPA 5CENA 4GVJA 4GIHA 3VRZA 2G2IA 2RF9A 3QL8A 4DA5A 5LQFA 4FSWA 4MXAA 2PU8A 3DNEA 2IWIA 4FTQA 3GCUA 4GK2A 3VHEA 4CSVA 2NP8A 3BU3A 1H1PA 1WMKA 5B0XA 3VS0A 2XM8A 2YHVA 1WFCA 2QLUA 2ZMCA 4CNHA 5IUHA 3LM5A 3G5DA 3ID6C 4TYJA 4FMQA 1YQJA 1ZMWA 3EHAA 4G9RA 4XP3A 3GENA 3PXQA 3ZBXA 3M2WA 4KB8A 4D1ZA 3MVJA 3LW0A 2HZNA 3OMVA 3TIZA 4RWIA 3E3BX 5HE0A 4FEUA 1O6LA 4R5YA 5HGIA 4J97A 4O82A 1W98A 5FBNC 3VIDA 4MBJA 4GMYA 4FZAB 4O0SA 3KB7A 3VW8A 4HYUA 3TCPA 2PZ5A 5CASA 5ICPA 2UZTA 3MTFA 4PMSA 4PTCA 1NA7A 3QQJA 4KBCA 3MDYA 2WTJA 4FKTA 4FKOA 4YU2A 2I0EA 2BZIB 3VW6A 2W06A 3F61A 4X21A 5AUYA 3V01A 2P33A 4EI4A 1VYZA 3CTJA 5KMLA 3WZJA 4FT9A 4W4XA 4ITIA 1G8SA 4IC7A 4Y8DA 3OCGA 2PUIA 5HQ0A 1Q8UA 1DS5A 3DJ6A 5K4JA 3PVGA 3BQRA 3FPQA 1DM2A 2PZIA 4B8LA 3W2SA 2Z7SA 4FSYA 5BMMA 4DLIA 2X6EA 3UYTA 3QLGA 3CTQA 4HVSA 4GVAA 2JD5A 3FXXA 1J1BA 3GFEA 2I40A 2WTDA 2QOIA 3LCOA 3QQHA 4BDBA 3PVBA 4QP4A 4GFOA 4KSPA 5I9ZA 3WE4A 4EH6A 1H26A 4FGRA 4ZP5A 4MYGA 4NJDA 4PPBA 4RLKA 4TY1A 3C4EA 4HVGA 1K3AA 4FEWA 5AA9A 3HRBA 4QMUA 3QTUA 1P2AA 5FXSA 2YZAA 2OJFE 4I0TA 4BWXA 4CT1A 5HG5A 1Q97A 5FG8A 2OFUA 3BGQA 5AX9A 4AZFA 5F20A 4FIJA 4ZTHA 1W8CA 3PRIA 4JIKA 3UG1A 3UZPA 4AGCA 4CFMA 2YJRA 2BR1A 4GU9A 3CQWA 4FL3A 5BVWA 4O7SA 3EQRA 3Q3BA 5JH6A 4C02A 4GG5A 2Z60A 2VUWA 2X2MA 4XP2A 4ID7A 4HVIA 4IMYA 2XIZA 4AG8A 1RE8A 3QCSA 3R6XA 3PJ1A 4JS8A 2OF4A 5EI6A 4X2GA 5AFVA 3CD3A 3OBGA 4I22A 3DZOA 4ZSEA 5AAGA 5L4QA 3AT4A 5EDPA 4Q5HA 3RINA 3GC7A 5IZFA 3FLYA 2HCKA 3F5UA 4C36A 5ITAA 3AG9A 3C5UA 3BV2A 3UP2A 4EORA 2QHMA 4EKKA 3BPRA 1FGIA 3OTUA 3KXGA 3LJ0A 4ASXA 3ORPA 4DFYA 5JQ8A 2CGVA 2E2BA 3QHWA 3GU8A 1TQMA 3CC6A 3C9WA 2ITNA 2VNYA 2OICA 3G15A 4E5WA 4X0MA 5J9LA 4RJ6A 4TTHB 3G0EA 3BBWA 2C6MA 3NZ0A 4WUNA 5H8BA 3CP9A 4D2VA 4ZTSA 4WBBB 4XG3A 3R7YA 3UE4A 3S95A 3RAIA 3Q2JA 2QHNA 3ACJA 4IAFA 1MRVA 3ODYX 5KZ0A 2WMAA 3VO3A 5D7VA 5IA2A 1NW1A 1Q5KA 3OG7A 4HZSA 4I92A 3UODA 5J7HA 3QXPA 4OT6A 5HBHA 4JXFA 3EJ1A 4F9AA 3IONA 3ZU7A 3MTLA 1W0XC 4IZAA 1Y8YA 1Y8GA 2NRYA 4MF0A 3QQGA 1PYXA 1WBOA 3FZTA 3UMWA 3NUUA 4YZMA 3E63A 4WG5A 5BMSA 3NVMB 3PXYA 2VGPA 3KF4A 5EOLA 3RM7A 2EWAA 3FMNA 5IQIA 2R3LA 3EFLA 3GU4A 2QOFA 5DG5A 2W5HA 4FG7A 4FL1A 4AF3A 3F2NA 3QC9A 4J99A 4PL4A 4PRJA 4KBKA 4RLLA 4FKSA 4UWBA 4CTBA 4RX5A 4XBRA 2GSFA 3LFDA 3MVLA 2GU8A 3KVXA 4OUCA 3TKIA 2GS6A 3OC1A 2IVVA 3HNGA 4X3FA 3W2CA 2ZJWA 1XQZA 3FUPA 4BCHA 3R7GA 3O50A 2XYNA 2GTNA 1XBAA 1WBTA 2J0IA 1H27A 2R3NA 3A7GA 3FMLA 3O51A 1APME 5D41A 4ACDA 2OLCA 4ZMFA 2W1CA 4UN0C 1OIRA 2IZUA 4CCUA 4M8TA 4OGRA 4B0GA 4GW8A 4FV0A 4BBMA 1OI9A 1GIJA 4PMTA 3DOGA 1Z5MA 3PFQA 1SNXA 4OTIA 2YIYA 3LMGA 3OW3A 3FPMA 2J5EA 4IIRA 3D7TB 2V5QA 4IE9A 5H9BA 5EI8A 3F3UA 3JPVA 3OP5A 5IMEA 2R4BA 1H8FA 3QQKA 5JRQA 2J7TA 3ZUUA 4I6BA 4LL0A 4BVUA 4IB3A 3RMFA 3NUXA 1BI8A 1JBPE 2B1PA 2ZAZA 4JRVA 1REKA 1OIYA 4IX4A 4G1WA 3EH9A 3EMGA 1YHVA 4JAIA 2X4FA 2ZM4A 2XK7A 2VO6A 3NUPA 4D4RA 5EDQA 3GC0A 3KXMA 4XCUA 3EQCA 5HNGA 4YR8A 3LFCA 2VTLA 5CVFA 3V51A 4EK8A 1YI4A 3VJNA 2RG6A 4BWPA 4M14A 5CVGA 5EHYA 3VS3A 4AGDA 3RAHA 3ZFXA 3D15A 3DPKA 4RSSA 4UALA 4EZ5A 4GJ2A 1WBVA 3ET7A 2VWVA 4J71A 5FTOA 5A46A 3IGOA 3ZUVA 4AOIA 4NKSA 1CKPA 2Q0BA 5CS6A 5GHVA 4R3PA 4TPTA 1YXXA 2UZEA 3R30A 4UY9A 3UJGA 1PXLA 5FRIA 3ZLSA 4BDJA 3CIKA 4RX7A 2VTMA 4EHEA 2YM5A 1PXNA 5HIBA 2QR7A 5J87A 1PKGA 4JL9A 4LOQA 2G15A 4K18A 2IO6A 2V0DA 4XLIA 1OMWA 3COHA 5GJDA 4BHNA 4XG4A 1H1WA 2VU3A 1FBNA 5CQUA 5EW3A 2WD1A 2IVTA 3DK7A 1DI8A 4RIYA 4RIWA 4KAOA 2DQ7X 3KFAA 4C4GA 3IW5A 5A4LA 3VWAA 2GHLA 2QR8A 3F2RA 5KMNA 2HELA 3NYXA 3VQUA 2KULA 4EL9A 3MY5A 3FI3A 4AZEA 4PWNA 5HIDA 2I1MA 4QMZA 5CF8A 4XOYA 4ZAUA 4UX9A 2G2HA 4I20A 2Z02A 1Q3DA 3P86A 1OBDA 4RIXA 2WMWA 4CV8A 3MFSA 1UNLA 4IJPA 4CYIA 1JKLA 1JQHA 3P4KA 3KXHA 4FV8A 2O5KA 3NRMA 2DYLA 3OF0A 4PX6A 2W9FB 3AD5A 3LQ5A 3R8MA 2DWBA 1HCKA 2QNJA 3LM0A 4FEXA 3I5ZA 4QNAA 1J1CA 5HG7A 3FMJA 5AP7A 3G0FA 2CGXA 4K1BA 4OR5A 4C8BA 2V22A 3IK3A 4BIEA 3PG1A 2Y0AA 2YACA 3LFBA 2B9JA 2BAKA 4IWPA 4E8AA 3MH3A 3Q4ZA 4AN9A 5DT4A 2UVXA 1PMVA 3BHTA 3DNDA 2A2AA 5IQBA 1TKIA 2PVFA 4F99A 1FVTA 4BR3A 5KO1A 4O2PA 5A6OA 4BDFA 4TWOA 3KN6A 3ORKA 4FKWA 2UW8A 4FBXA 3D83A 4LMNA 4EH5A 3FZSA 2GQGA 2GQRA 4TYHA 2I0HA 1DAWA 4EK3A 5AA8A 3ZHPC 2J6MA 3CR0A 3GUBA 4KS8A 2CPKE 4L3JA 2FYSA 3ZLXA 4JOAA 3ORTA 3UQGA 2PVHA 3IOKA 3BLHA 2HOGA 5DBXA 2PPQA 3RPSA 4BI2A 3I4BA 4YJTA 4EHZA 4O7YA 3DBFA 4G31A 2FH9A 5HTBA 2W1IA 3LE6A 5C27A 4N57A 5E91A 4DGLC 4NEUA 4NYEA 1YXUA 4KABA 2NPQA 2JDSA 2Y4PA 3UOHA 3U8WA 1XBCA 3OCTA 5IEYA 5D10A 3VJOA 4BBFA 4DF3A 1JSUA 4JQ7A 3PE1A 2OH0E 4Z7HA 4FZ7A 3ENHA 1IASA 1OL6A 2BHHA 4OBOA 4XV9A 3NUSA 2XP2A 3QAME 5FXRA 1IAJA 3IW4A 3PJ8A 5ACKA 2BRMA 3FLNC 3NEWA 4BCKA 2QLQA 1GZOA 2E9VA 3FZRA 3QUPA 2WQEA 1WBSA 1LR4A 2UZUE 1ZLTA 1YVJA 2C0IA 2HK5A 3A4OX 4R1VA 4USFA 3BRBA 5J9YA 4J7BA 5C8NA 1H01A 4L53A 1UV5A 4O86A 3LCDA 3L9LA 4FSQA 2HXQA 5HTIA 3MB7A 4XG7A 2C4GA 2R3GA 2WMVA 3HV4A 1UNHA 2C6LA 4CMOA 5L8KA 3NUNA 2CN8A 3WZKA 4G5PA 1JSVA 3O8TA 4G9CA 3UQFA 4IW0A 1BX6A 1M52A 4DN5A 3D94A 4GFMA 2QG7A 1Q24A 2OIBA 4F7NA 1H07A 1XH5A 4PL5A 3K5VA 4D2TA 4IZ5A 4BZOA 4PQNA 5DA3A 2GCDA 3IECA 4MKCA 5IA4A 4QMVA 4G17A 4JNWA 4NW6A 5CAQA 3EYHA 1URWA 3MIAA 5C03A 4CLIA 3NS9A 4GEOA 3VAPA 4TWNA 2XNEA 3PZHA 4G3GA 4GT3A 4WO5A 2OG8A 3KC3A 2GNFA 5GJGA 4DG0E 1G3NA 4FEQA 4IDTA 3NNUA 5IH4A 2EUFB 3C4ZA 2WTVA 4QYGA 2XJ1A 3ATTA 4YJNA 5M06A 4AW2A 2J50A 4U42A 2WU6A 1WVWA 4IADA 3T3VA 4ARKA 3QZGA 3EB0A 4FTRA 4RJ4A 3KMWA 2A0CX 3CQUA 3V6RA 4AE9A 1NXKA 2CKOA 2IN6A 4KNBA 3JR1A 2CKEA 5AP4A 4J8MA 4DFNA 5IPJA 1A48A 1DAYA 4GV1A 3RWQA 1HOWA 5D12A 3BWJA 2GFCA 4FV1A 4IB1A 2PVYA 3ZSGA 5EYDA 1F0QA
chains in the Genus database with same CATH superfamily
4AW5A 5HG8A 1WCCA 3I1AA 5EHOA 1FQ1B 4RWLA 4E93A 3DB6A 3Q53A 3WOWA 4DTKA 4M0YA 3I5NA 4KBAA 4A9TA 2VTJA 3LXLA 2PUPA 3ZUTA 4AFEA 1J7LA 1KV2A 2PMOX 4L3PA 3G51A 4XUFA 2JIVA 1YDSE 3OD6X 3A99A 5LXMA 1TQIA 4QNYA 5L6WL 1WVXA 2OJGA 4OTPA 3SXSA 1OBGA 4EQUA 4FODA 2JIIA 4E3CA 2PE0A 2Y6OA 4FTKA 4EWHA 5IH6A 4WG4A 3TZ8A 3R9OA 4QTAA 3N4UA 4NKAA 3BZ3A 4L00A 4DT9A 3LLTA 2C1BA 3OT3A 4QQCA 3QRTA 2YITA 4FV7A 3SOCA 4AOJA 4L45A 4MD9E 4JR3A 3AMAA 2CHLA 4RIWB 4RVMA 5CQWA 1V0OA 4E4XA 5DLSA 2XANA 2H34A 5FUTA 1XH9A 2BFXA 4FOBA 3VBWA 1I44A 2GNHA 2R3FA 4QPMA 1JNKA 5JGBA 4ZLYA 3KU2A 2XJ2A 3MA3A 5CTPA 3HMOA 4CGAA 3EN4A 4IM0A 5DGZA 4PPAA 4FE2A 1R39A 4HPUE 4YHJA 5J79A 3O5AA 1OECA 3ANRA 4DH1A 4Y73A 4DITA 2ZV7A 3TKHA 2YABA 4RIXB 4EEVA 4L3LA 3OWJA 2BZHB 3LCTA 3SKCA 4ZY4A 2YIWA 1Q62A 4EH9A 4CZUA 4EOOA 4Y5HA 4RA5A 4FI1A 2WZJA 3BELA 3DA6A 3UVQA 5DEYA 3R2YA 5TKDA 5E8YA 4YMJA 5JN2A 3HUBA 4E4MA 2I6LA 5C26A 4EQCA 3PDTA 3ZRMA 5CALA 3BE9A 5EM8A 3LPBA 2VTAA 4PTGA 2WMTA 3CD8A 4FTCA 3U51A 4YZNA 2HY81 3W2QA 4P5QA 5DPVA 4M7IA 4AX8A 2EXMA 3SD0A 2UUEA 3V6SA 4WOVA 4FSRA 5IEXA 4QYEA 5IH5A 4QP6A 1RDQE 3MW1A 2YCQA 4ITHA 4F1MA 3GVUA 4I0SA 1PF8A 1H00A 4P90A 1XJDA 5HG9A 3TZMA 4DHFA 4D1XA 2WMUA 4I24A 4W4YA 1W2CA 4IX3A 3GBZA 4NWMA 3HDNA 3NWWA 4TYHB 4FTMA 2ESMA 2IZRA 4GK4A 2UV2A 3TNPC 3VBVA 1LUFA 5DT3A 4X2NA 3H10A 4A4LA 4RBLA 3QHRA 5C9CA 5HNIX 3OHTA 2QOLA 3FKOA 3E8NA 1YDRE 3EN9A 3QBNA 4XYFA 5CSVA 1QPEA 4L9IA 3VHKA 4BDAA 5CEMA 4QQTA 3OS3A 5L2TA 1M2QA 4XRLA 3BQCA 2H9VA 5ANJA 2C1AA 3H9RA 3E7VA 3Q52A 5LCKA 3L9MA 4OTWA 3UO6A 3QA0A 4O0TA 4ANOA 4C37A 4KIPA 2F7EE 4RT7A 3OW4A 2JKOA 5HU3A 3Q04A 4DC2A 4F6WA 2XIYA 3RPOA 5C4LA 5HVJA 4F09A 4NM0A 3UBDA 3FHRA 3UC3A 4CKRA 1PRYA 1ZZ2A 4EUTA 2CGUA 3DGKA 3OTVA 2C5YA 5G6VA 2UW9A 3QZHA 4MHAA 3TJCA 4MBLA 4FSTA 3FJQE 4J8NA 1VEBA 4C38A 5IF1A 5AR3A 2C0OA 2GHGA 3DBCA 2VO0A 3FSKA 4RJ7A 3MBLA 2YDJA 2ZM3A 2GS7A 3TT0A 4EHVA 4EOPA 4GIIA 1Q8WA 3PTGA 2PSQA 3BE2A 3SDJA 4HCTA 1GZ8A 3WE8A 3ZXZA 4BZDA 4FV5A 3Q9ZA 4O1PA 2JDVA 2R7BA 4BN1A 3FC2A 3PPJA 1R0PA 2RKUA 2VX0A 1PKDA 1Y91A 4USEA 3LXKA 4F1TA 5BYLA 3O17A 2J0KA 2R64A 4I6FA 4A7CA 4OTDA 3BYUA 4D28A 5LVLA 2ITWA 2W05A 3MPTA 1VZOA 4F9BA 2R3QA 4U97A 1U5QA 3E7OA 4O96A 3RJCA 4F7JA 2VZ6A 3IQ7A 2R2PA 4O91A 2BAJA 3PY1A 4EYMA 5CY3A 3PA5A 2EVAA 3PPKA 4NJ3A 4NUSA 5HLNA 2ITVA 5EKOA 3UOJA 3HECA 3BGZA 3P1AA 2FSTX 3VS5A 3VUGA 4FG9A 3ROYA 3JVRA 3EQDA 2XNNA 2YM6A 3PVUA 3VUKA 1UKHA 3OEFX 4WKQA 5M44A 4CKJA 4MXXA 5IQEA 2CKQA 4DG3E 3BYSA 1K9AA 3HDMA 4ANBA 3FI2A 4ERWA 4C2WA 4CFVA 2BDJA 5EM7A 2UZOA 2OK1A 3IKAA 3PY3A 3MN3A 5HNBA 4AN3A 3PPZA 3W16A 4FIFA 4X6RA 3NR9A 3NSZA 4FNWA 3MH0A 2YDIA 5TOZA 3V8WA 3HV3A 3UVPA 4H36A 1U4DA 4YPDA 5L8JA 2YCSA 5AMNA 1MUOA 1XH7A 3A7JA 3KMMA 4IFGA 4TZRA 3F7WA 4G6OA 3DAJA 3PVWA 4ACGA 4BKJA 5CI7A 5AUVA 3S4QA 2BIYA 2C6OA 3IDPA 5K3YA 5BVKA 3IOPA 2P3GX 4OW8A 3RPYA 1YKRA 4AP7A 5HCXA 4AACA 3N51A 5KUPA 5AIRA 3OXIA 2CCIA 1CSNA 1PY5A 4YO6A 2BUJA 4M13A 3UPZA 4P4CA 1E1XA 3D7TA 3V5TA 5CXZA 3UIBA 3AC8A 4L67A 3EWHA 4E6DA 3SV0A 2YDKA 1GZKA 2QO9A 2ZV2A 4GUBA 4JDKA 3A8XA 5DR6A 3R8UA 1MP8A 3ZM9A 4KRCA 3O23A 3KXXA 3QTXA 4IWDA 2XK9A 5B2LA 3OWLA 1R0EA 2PVNA 4YZBA 1Q61A 2FUMA 2WMXA 3PSCA 4YJUA 2QG5A 2VX3A 4I4EA 4S2ZA 5HU9A 2QKWB 3GOPA 4FIEA 2CGWA 2XKCA 3E5AA 5H3QA 4D5KA 4XV3A 5CSPA 2PE2A 3A7HA 4L6QA 2J51A 3THBA 4BYJA 4EH8A 3FKLA 3UO5A 4MXZA 4HCUA 3MB6A 4HJOA 5DR2A 2XNPA 2W1DA 4QQ5A 3HRCA 4HW7A 3I0QA 3LMIA 5FTGA 2F2UA 5CF6A 2YFXA 3W33A 3UOKA 3FLZA 3AC3A 1NVQA 4EOQA 2HAKA 3PIYA 2QCSA 2E9PA 4C35A 3MESA 4F9CA 3O7LD 2YA9A 3O8UA 3EFWA 5E8WA 5KBQA 4FNZA 3AMYA 4U40A 4EH2A 1M7NA 2R3KA 3SW4A 4FVPA 3DK3A 2H8HA 3F9NA 3H9FA 4E5BA 2JC6A 3F5PA 4FL2A 4AXEA 3NYVA 3U4WA 5I3OA 3V5WA 4G3FA 3D7ZA 4EOMA 4EZ7A 2ZM1A 4CVAA 2R0UA 2JBPA 2YEXA 3KMUA 2JKMA 4QP2A 2QOKA 4A06A 4DGMA 4TN6A 5ETIA 3OBJA 4IAKA 5EDRA 3GQLA 4D9UA 2X7OA 4CKIA 1PXJA 1X8BA 1IG1A 1ZMVA 5KZIA 3TL8A 3MY1A 4QDVA 3QF9A 4X3JA 2YM7A 1CKJA 5IDNA 4QP9A 3HEGA 1WBPA 2XBAA 2XRWA 3FI8A 3F66A 1RW8A 2XF0A 4IX6A 1H4LA 4M3QA 4UMTA 4MXCA 5M51A 3R7IA 3QTSA 3QRKA 3W18A 1H25A 3HAMA 3PLAE 4XG2A 1JKKA 3ZO3A 1CM8A 3AT3A 1QMZA 4F7LA 2J4ZA 3RK9A 2OKRA 2PUUA 2JFMA 2XNOA 3HA6A 5BUIA 1ZXEA 1ZYDA 3L8PA 5IA0A 1LPUA 5LVOA 2O2UA 4RGJA 4BWKA 4IJ9A 1U5RA 4ALVA 5FD2A 3P79A 4IB0A 4Z55A 4BTMA 3VS4A 5H2UA 4I6LA 3QTIA 3G9NA 1E9HA 4CTCA 4ENXA 4C58A 4FTAA 3SGCA 4NT4A 4ZZMA 3BHYA 4G3DA 4ZZNA 5I3RA 5BVEA 4PF4A 3UZRA 3CGFA 3PP1A 5AP0A 3FZ1A 4O84A 2C6IA 4ALWA 5T6KA 1P5EA 2X81A 3LXNA 5DYJA 3H30A 3Q5ZA 2XBJA 4EOLA 1SYKA 3JS2A 5EM6A 4BCQA 1O6YA 2X9EA 3FYJX 3W0SA 3LFAA 4K9YA 4WNOA 3K3IA 4AAAA 4L46A 5DHJA 4R1YA 4ZLOA 4KSQA 3QRUA 4ZJJA 3TG1A 3EZRA 1MQBA 2XH5A 4EH7A 3H4JA 1KV1A 3K2LA 5I9UA 4ZY5A 5IMXA 3S1HA 4FV9A 1REJA 1SVHA 2A4LA 4YUQA 1BMKA 3W0MA 3U55A 4DFBA 3LQ3A 3U9NA 4B8MA 5E9EA 2FSOX 2BZKB 3BLRA 3HGKA 5E90A 3PA3A 3W2PA 3NFFB 4BIDA 4UV0A 2A1AB 3RZBA 4KIKB 1UWJA 5CZIA 3EN7A 2A19B 3A62A 5BUJA 3WF7A 2R0IA 4FNYA 3AD4A 3SG8A 2YAKA 3Q60A 1XBBA 2JAVA 5AV0A 2XAOA 4RJ8A 3PWYA 5E4HA 2FVDA 3TNWA 2F7ZE 2Z7LA 3G2FA 5IG1A 3PY0A 1FMKA 4EOKA 1LEZA 3VBTA 4BY9E 4TYGA 3D2IA 1M17A 1O6KA 2R3JA 3SX9A 1XH8A 5TO8A 2VGOA 3K3JA 3MH2A 4GRBA 5BUEA 1IAHA 4AXDA 2CCHA 2GNIA 2E9OA 5A4EA 3EQHA 1PW2A 4C4FA 3O7LB 3U6IA 3MJ1A 4FKGA 4NFMA 2EXCX 2WGJA 3FY2A 3MYGA 4E73A 2X0GA 4EBVA 3MVHA 4ERKA 1YHWA 3LJ2A 4BBEA 3KXNA 2HIWA 3E8DA 3ORMA 3FAAA 1WAKA 1H1RA 5I4NA 3O8PA 4TNBA 5D11A 5M56A 2VRXA 4FZFB 3TTJA 4DEBA 2QO2A 3R0TA 2QURA 2O3PA 4H3QA 4YO4A 4MQ2A 3DTCA 5FEDA 3VBQA 2Z7RA 1YXTA 2A27A 3BL7A 4CFNA 4BJJA 2ZVAA 1Y57A 2GHMA 1OKWA 3ZRKA 4YBJA 1IA9A 3EQFA 2E9NA 3K5UA 4M84A 5DRDA 3VN9A 4RWKA 4BGQA 1Q8ZA 4MTAA 2GS2A 1IRKA 3RAKA 3TUCA 3DK6A 1ZYLA 3QX2A 3ZEPA 5CF5A 3MSSA 3LAUA 4GU6A 4L42A 3BYMA 4WSYA 2XK3A 1XKKA 2NRUA 2J9MA 4LMUA 3R83A 4O38A 5AR8A 3ZC5A 3RNIA 3U9CA 4M68A 5DFPA 3FMHA 4U0IA 3WYXA 5KKRC 3VUMA 3ZDUA 5BNJA 2RFNA 3W55A 4CFFA 1B39A 4D2PA 2C69A 3IO7A 3C1XA 4O0UA 3UIMA 3ZLYA 2YERA 1G5SA 5AV3A 4I5PA 4C61A 3W8LA 4DDIA 1BL6A 4KA3A 3TV7A 3SXRA 4FYOA 4N0SA 3FLQA 4FSUA 4UEUA 4MEDA 3ZZWA 4GL9A 4A4XA 1V0BA 4PMMA 2O64A 3EOCA 3JY0A 5F4NA 3ZFYA 3Q2MA 3AD6A 5CAOA 2VN9A 3GU6A 2XIXA 4UMUA 4QMOA 4RQVA 4IEBA 4JIAA 4UWYA 1JPAA 3W10A 3LOKA 2OJ9A 2AC5A 5M07A 1YW2A 2WNTA 1H1SA 4AS0A 5CU0A 3WZEA 4MNFA 4D4VA 3C0IA 1ZOHA 4ANMA 5I0BA 3V8TA 3E92A 3PE2A 4BDDA 3R28A 4FKPA 3FC1X 3NCZA 4G6NA 1OKZA 5D9HA 2WXVA 4UXQA 4QDEA 3LFFA 5F1ZA 5FM3A 2UW5A 4EUUA 1CDKA 3DY7A 3IGGA 3NW7A 2R3RA 3QX4A 5EW8A 3GI3A 3WF6A 4U41A 3NVKI 4AZWA 3OY1A 4NU1A 3DFCB 4KKHA 4IXPA 2X6DA 4FKQA 4QTCA 5JFVA 1HCLA 3BEGA 5HO6A 5LMKC 3VUIA 4B4LA 3GC8A 4QPAA 4BDCA 3KGAA 2W5BA 5A3XA 3WI6A 3DAKA 4I1ZA 5J1VA 5EQEA 3MFRA 2X8EA 3QQFA 4F70A 3MVMA 5AUWA 2BKZA 3F3TA 5CSXA 2QOQA 4RX9A 5AUZA 3ZLWA 5HE3A 3WZUA 5HO7A 2DUVA 2W4OA 3MPAA 4E1ZA 3BKBA 4HZRA 4JQ8A 2FGIA 3P9JA 4HGTA 3O2MA 4D2SA 2WQMA 3RCJA 4FT5A 3Q4UA 4TT7A 5ANOA 2PMNX 3VS1A 4DG2E 3E8CA 2W1EA 3PJ2A 3D5WA 4BDGA 3KRXA 1FVRA 5GZ9A 5GINE 4IVCA 4FTIA 4WNKA 5HCYA 3F7ZA 5HEZA 4IVAA 1V0PA 2WQOA 4E20A 5I5ZA 4MF1A 4EWQA 3LZBA 3ZZEA 2YWVA 4Y85A 2X7FA 1S9JA 4MNEB 3MH1A 4OAVB 2UZVA 4L52A 4RWJA 4KKEA 1RJBA 4NM7A 3U4UA 1QPJA 2P55A 5I9WA 3N4TA 5CEOA 5ANKA 4KIOA 5AP3A 5HOAA 4RC4A 3RK5A 3TV6A 2AQXA 5HVKA 2BMCA 3P23A 4GUEA 3COKA 1ZOEA 3TNQB 4H1MA 3FMMA 3FXZA 3V5LA 2QKRA 3KCFA 4GYGA 3AMBA 4U6RA 5JKGA 4LQMA 2UZNA 4PTEA 4QMYA 3PJ3A 2G2FA 4AGWA 2GNJA 2XMYA 4BL1A 4QMQA 5HZNA 5B2KA 3ENMA 3WIKA 3FYKX 2O0UA 2GPHA 3AKLA 3PWDA 1WVYA 4KIQA 5AUUA 3VC4A 2PUNA 3KK8A 3G90X 1JKSA 4DH8A 4F4PA 4FK6A 4C2VA 1SMHA 5AV2A 2UVYA 4MBIA 1M2PA 4F0FA 2C47A 4I93A 4RG0A 4DEDA 1YDTE 3QKKA 2XEZA 4RRVA 3FDNA 4ZJVA 4O0XA 5LJJA 4M12A 4ZXTA 3A61A 5LARA 2WPAA 1MRUA 4YNOA 4EH3A 5I9XA 3GXLA 2PVKA 2WEIA 4FTUA 5HORA 3BYVA 1U54B 3B2TA 3DQXA 4PL3A 4O7WA 1STCE 5BVNA 5HICA 3C13A 3QXOA 4FK3A 4EHGA 4PP7A 5BPYA 1U59A 3RNYA 2VTSA 3VULA 5JFXA 4E4NA 3MWUA 3TACA 3SHEA 2IVUA 4AT3A 5HX8A 3S0OA 3ZSHA 1I09A 4O6LA 4EOSA 2XS0A 3LHJA 2C0TA 2YWPA 2UVZA 3AC1A 2OU7A 5E8UA 4DEIA 3DKFA 4IACA 4JJRA 5DNRA 4DEAA 3HYHA 2CNQA 4YTCA 4UZHA 3SRVA 4A07A 4ZTMA 3AC4A 3FL4A 4ZSGA 5EOBA 3QWJA 4GJ3A 4ZSJA 1XR1A 2BVAA 3C7QA 4QMMA 3SOAA 2W1ZA 4FKJA 3HLLA 4WIHA 3OCSA 4LFIA 1ZARA 3UG2A 3OOGA 5ETFA 3D4QA 5CF4A 4XP0A 1YWRA 3TZ7A 5AP1A 5TE0A 5L3AA 2VWYA 2JGZA 5ANEA 5CLPA 5AR5A 3CY3A 2PK9A 4AUAA 4IM2A 4OTRA 4UBAA 4UYNA 3BV3A 2C5XA 4BJJB 2XNMA 3FHIA 4YLJA 3E93A 2V62A 2X2KA 1GNGA 2VWUA 4MAOA 4OTQA 5CSWA 4H39A 4AGUA 4OLIA 4Y83A 3COMA 4H3BA 4P2KA 4YJOA 4RFYA 3FZPA 5F94A 3VBYA 5EKNA 3QA8A 3QD2B 2PMLX 3QGYA 4TWPA 2HW7A 2QC6A 1QPCA 2JDTA 4D0XA 4V05A 5LVPA 4AT4A 3E64A 3R7UA 3CE3A 4FTTA 1PXIA 4C3PA 4JI9A 4CG8A 4HGEA 4U44A 2XNBA 3OXZA 5CT7A 2OW3A 4AA4A 4B99A 5E92A 2B9IA 2BDFA 5J8IA 2QOCA 4R8QA 3ZEWA 1QPDA 1BLXA 3HMNA 2UZDA 5CEPA 4C62A 1GJOA 5J5SA 4KS7A 3KREA 2F49A 4HYSA 3Q6WA 3ZYAA 3QD0A 4ACHA 4FSNA 4MXYA 5AV1A 4AQCA 4H3PA 4U7ZA 4LRKA 3T9TA 5CU6A 4USDA 4W9WA 2G1TA 3R7EA 4WG3A 3DS6A 3KXZA 1LP4A 1PXOA 4I41A 2YCRA 2WIHA 4GT4A 1A06A 3C51A 4LGDA 1P14A 1O9UA 3BLAA 5AEPA 3QD3A 1KOBA 3FMEA 1OM1A 3PP0A 1JAMA 4L8MA 4A9SA 2CMWA 1FGKA 3ROCA 4CG9A 1UWHA 4Q9SA 3WARA 4JQEA 1OKYA 4DCAA 1P4FA 3UC4A 3KULA 1FINA 5H8EA 2HXLA 4DGGA 1UU7A 3MS9A 4JG7A 2CLXA 4DGNA 2PVJA 5KKRB 1XMLA 4HNFA 5CYIA 2X8DA 4G3EA 4QMNA 5KCVA 5AP5A 3D9VA 3QRJA 4I21A 4AT5A 2RFEA 3EQIA 2FB8A 4PNIA 4HGLA 3BIZA 4UMQA 4R5SA 4UXLA 5GIOE 4ASDA 3BYOA 2QONA 2Q0NA 3GB2A 3PSBA 3P0MA 5EYMA 3R7OA 2UW0A 3F88A 4LV8A 3TN8A 4A4OA 3CPCA 4I3ZA 3LFNA 3VRYA 5H8GA 4KWPA 4C7TA 4F63A 5BVDA 4L43A 3KEXA 4DLJA 2OO8X 3D5XA 2ITQA 2WMQA 3ELJA 3LCSA 3NNWA 5DR9A 4EC9A 5GZAA 3HA8A 1LEWA 3EKKA 4QYHA 4FT0A 1M14A 1ZYJA 3O96A 4V04A 3CLYA 1G8JA 3KKVA 3QCXA 4XLVA 4E26A 5I9VA 1PJKA 1UU3A 3FKNA 3Q6UA 3TXOA 1XH4A 2CSNA 3MIYA 4K77A 2YJSA 4DFLA 3R8ZA 2ERZE 2BHEA 4LUDA 1R1WA 2ZV8A 1XMMA 4ALUA 2IZSA 4FRFA 4C4EA 4DH5A 4O7VA 2V7AA 1YWNA 4U9AA 1T45A 3EQGA 3DKGA 2OZOA 3IW7A 3R8PA 2XB7A 3FMKA 1YI6A 2Z7QA 4I6QA 5LMAA 2IW8A 4BDIA 4U43A 5JMSA 3JUHA 3PG3A 5HX6A 3A8WA 5GNKA 1R3CA 2ITPA 5HI2A 2OFVA 4FTJA 4BCPA 3POZA 4BC6A 4R77A 2J0LA 4Q5EA 4ZK5A 3F69A 4HVHA 5K5NA 4O7RA 2PHKA 3QCYA 1KUTA 2OGVA 3TYKA 4R78A 5M55A 2HZ0A 3WF5A 3OUNB 3F5XA 4WHZA 3VUTA 3UTOA 4PDOA 3ZO1A 3AKKA 3P7BA 4NK9A 3CEKA 3P08A 3FQEA 4DCEA 3A60A 4CRSA 2UW4A 3LQ8A 4U81A 4A9UA 2RFSA 1VJYA 2BTSA 4S31A 3RBWA 4XG9A 4GKIA 3ORIA 5CNNA 4UMRA 3FL5A 4IAZA 2XNGA 4AA0A 4BZNA 4C34A 1W2DA 1W83A 3C4XA 1FMOE 3FWQA 5BYYA 3R1SA 4L7FA 5LVNA 3DLSA 3R1NA 4K2RA 3TUBA 1M2RA 4IZYA 4AZTA 2I7QA 3PXZA 4BDHA 3R9DA 5AP6A 3V8SA 3V5JA 4CRLA 5DT0A 4X2JA 4BFMA 3SG9A 3BI6A 1KSWA 4IX5A 3HVCA 5ACBC 1OPKA 4DINA 2BIKB 2VWZA 3PSDA 4YTFA 5GJFA 4XV2A 3BU6A 4O83A 4BGGA 5CU3A 5LMBA 4JX3A 4PNKA 2W5AA 2QO7A 4AWIA 4L01A 5FEEA 3I81A 4RVLA 4EYJA 4JR7A 4W8DA 1GOLA 4JVGA 4F6SA 5JEBA 3UDSA 2BZJA 4BI1A 2C68A 5IA5A 3TJDA 2Y4IC 3ZMMA 4HGSA 2W9ZB 2NNWB 4ASZA 3QTZA 3SRVB 1A9UA 1UNGA 3F5GA 3II5A 4KD1A 4KIKA 3WF9A 4FKRA 4LOOA 4CV9A 5M4CA 3CS9A 5FTQA 3V04A 5CSHA 5CEKA 3UMXA 3UVRA 2GFSA 2RSVA 3HP5A 1OITA 4J1RA 4F7SA 4M0ZA 3CPBA 5DN3A 1BUHA 3ITZA 3LFEA 3VS6A 2OJJA 5HLPA 5AAFA 3NPCA 3GCSA 3PYYA 5M53A 3I60A 2J2IB 2W1GA 2HWPA 3DJ5A 3WF8A 5A4QA 5HD4A 4XMOA 5EYKA 5CEIA 5M4FA 3R73A 1H08A 4MVFA 1NT2A 4OT5A 4IWOA 1YHSA 5BYZA 2BFYA 4EC8A 4DAWA 2XYUA 4YJQA 1OL2A 2WTIA 5E8VA 3FSFA 5KMKA 1VR2A 4QEBA 5IDPA 2WOUA 5J9ZA 4QOXA 1Z57A 1OZ1A 4ONAA 4EK4A 2GNLA 2QOBA 1GZNA 4FJVA 2JKQA 2QQ7A 4AZVA 4F9YA 2Y7JA 2ZB0A 5KNJA 2WKMA 3GNIB 4C0TA 4QTBA 3UGCA 4YZ9A 4M97A 5A4TA 2V7OA 4JG8A 3Q32A 4CLJA 3F82A 1ZY4A 3W1FA 4XRJA 5CU4A 3V5PA 3WZDA 1OUYA 2GNGA 3AGLA 2JIUA 2W7XA 3ZTXA 4BCJA 4BTFA 4JBOA 4EONA 3LCKA 2QU6A 2X39A 4PV0A 4EOIA 4FT7A 3ORNA 4BB4A 3EL7A 4G34A 2F2CB 2WFYA 5AX3A 1ERKA 4C3FA 5KMMA 3JVSA 2XKEA 5CAVA 3TM0A 2XCKA 3R01A 1TVOA 4E7WA 5IU2A 4ORKA 4RPVA 4CMTA 5BV3A 3A2CA 2ITZA 2C5NA 3OCBA 4RQKA 4Y72A 5KMJA 3O0GA 3DLZA 2CNUA 4RFMA 5EG3A 2VTNA 3GU7A 3ATSA 3Q5IA 1KE7A 5HE2A 3R7VA 4ACMA 1FPUA 4QRCA 2PZPA 5CZHA 3C4WA 4FG8A 5IQAA 5HLWA 3KULB 5JZNA 3MFUA 4CEGA 4FTLA 4DHJA 3PFYA 5KMOA 4BTKA 2BILB 1MRYA 4HPTE 4Z9LA 2EB3A 2OXDA 4FA2A 5KX8A 2O63A 3M1SA 2JDOA 2UZLA 3HZTA 4IVDA 5IQGA 3KQ7A 4YZDA 1M7QA 3AC2A 1F3MC 4NM5A 2LAVA 2XK8A 2OSCA 3IW8A 1AD5A 3POOA 4Y5QA 4DHZA 4FT3A 3TUDA 2JAMA 3GOKA 3F2AA 2YAAA 4II5A 3ZDIA 4YSJA 5JFSA 4DYMA 3ORLA 1RQQA 4UWCA 4PDPA 5M09A 3DJ7A 3R1YA 4RFZA 4FUXA 3IDCA 2ITOA 4IDVA 4DEEA 4BDEA 4QP8A 4QTDA 4JX7A 5AR7A 3G33A 3REPA 3IW6A 3ZOSA 2OI4X 4LGHA 5FGKA 1KE5A 3LIJA 2HZ4A 3MI9A 3HV6A 4U8ZA 5EYCA 4QP3A 4CD0A 3TNIA 3LVPA 3FI4A 5JQ5A 2B4SB 5AJQA 2WOTA 2XK6A 4G16A 4NM3A 4XEYA 3QQLA 2WELA 4F64A 1S9IA 3PIXA 2YCFA 4ZTLA 3R9RA 1QCFA 3F6XA 2C6EA 5AIKA 4FKVA 4ZJIA 5CX9A 4FV2A 2UW7A 1F5QA 4ANSA 4QMPA 1B6CB 3MPMA 4WRGA 4C59A 4Z3VA 4F1OA 3DDPA 4L68A 5CWZA 3WBLA 5FDPA 3SAYA 1BI7A 5EH0A 4YC6A 2C3KA 4WNMA 5E1EA 4CMUA 4EZ3A 1Y6BA 3DTWA 5EHLA 4O4CA 3RALA 1SVEA 4U80A 5KHXA 4CFXA 3LFQA 5CNOA 4JG6A 5CU2A 4EKLA 4BCMA 3ZCLA 4O7LA 4HCVA 3R00A 2O8YA 2R3HA 2C30A 3B2WA 2HW6A 3RI1A 4W4VA 3ODZX 5GZ8A 1VYWA 3EQPA 3BL9A 5AADA 1YOLA 4LM5A 4GYIA 3VQHA 5IISA 2IPXA 3QTRA 1PYEA 2YIXA 5C8MA 3OUKA 4QMWA 4WA9A 4FZDB 4DEHA 3R8VA 1ZYSA 4MNEA 2PZYA 4F0IA 5JT2A 2XKDA 4NFNA 5M4UA 3L9PA 4PY1A 4JDJA 4WT6A 2BRNA 5I9YA 3GCVA 4EJ7A 4ANQA 4WUAA 5M4IA 3DXNA 4RIOA 4R7BA 4Q2AA 5FM2A 2QI8A 3BBTB 2BRHA 4RC2A 2H96A 4ENYA 3UDTA 4QP1A 3PJCA 3KRJA 3QWKA 4K8AA 4FR4A 5DVRA 2RIOA 5GIPE 2UZBA 4V0GB 3DDQA 3IDBA 2R3IA 4EOJA 4DH3A 2F7XE 3H0YA 4Y95A 1PXKA 3DB8A 3QFVA 4L44A 4MCVA 2ETRA 1OL1A 2R7IA 2EB2A 4XG6A 4DHIB 4NTTA 3QCQA 3H3CA 5J5TA 4I5CA 1ZYCA 1XH6A 4XG8A 2QU5A 2VX1A 4N70A 5C1QB 2QODA 3QC4A 2PVLA 3HV7A 2BTRA