The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
69
|
Knots found |
|
sequence length |
322
|
structure length |
286
|
Chain Sequence |
CRVDNGNCWHFCKHIQCSCAEGYLLGEDGHSCVAGGNFSCGRNIKIVNGMDCKLGECPWQAALVDEKEGVFCGGTILSPIYVLTAAHCINETETISVVVGEIDKSRIETGPLLSVDKIYVHKKFVPPQKAYKFDLAAYDYDIAIIQMKTPIQFSENVVPACLPTADFANQVLMKQDFGIVSGFGRIVEKGPKSKTLKVLKVPYVDRHTCMVSSETPITPNMFCAGYDTLPRDACQGDSGGPHTTVYRDTHFITGIVSSGEGCARNGKYGNYTKLSKFIPWIKRIMR
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Crystal Structure of the Prothrombinase Complex from the Venom of Pseudonaja Textilis.
pubmed doi rcsb |
molecule tags |
Blood clotting
|
source organism |
Pseudonaja textilis
|
molecule keywords |
FACTOR XA
|
total genus |
69
|
structure length |
286
|
sequence length |
322
|
chains with identical sequence |
B
|
other databases |
KnotProt 2.0: S -31
|
ec nomenclature | |
pdb deposition date | 2013-07-16 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00008 | EGF | EGF-like domain |
A | PF00089 | Trypsin | Trypsin |
A | PF00594 | Gla | Vitamin K-dependent carboxylation/gamma-carboxyglutamic (GLA) domain |
A | PF14670 | FXa_inhibition | Coagulation Factor Xa inhibitory site |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Ribbon | Laminin | Laminin | ||
Mainly Beta | Beta Barrel | Thrombin, subunit H | Trypsin-like serine proteases |