1OLME

Supernatant protein factor in complex with rrr-alpha-tocopherylquinone: a link between oxidized vitamin e and cholesterol biosynthesis
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
397
structure length
397
Chain Sequence
MSGRVGDLSPRQKEALAKFRENVQDVLPALPNPDDYFLLRWLRARSFDLQKSEAMLRKHVEFRKQKDIDNIISWQPPEVIQQYLSGGMCGYDLDGCPVWYDIIGPLDAKGLLFSASKQDLLRTKMRECELLLQECAHQTTKLGRKVETITIIYDCEGLGLKHLWKPAVEAYGEFLCMFEENYPETLKRLFVVKAPKLFPVAYNLIKPFLSEDTRKKIMVLGANWKEVLLKHISPDQVPVEYGGTMTDPDGNPKCKSKINYGGDIPRKYYVRDQVKQQYEHSVQISRGSSHQVEYEILFPGCVLRWQFMSDGADVGFGIFLKKKMGERQRAGEMTEVLPNQRYNSHLVPEDGTLTCSDPGIYVLRFDNTYSFIHAKKVNFTVEVLLPDKASEEKMKQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lipid binding protein
molecule keywords SEC14-LIKE PROTEIN 2
publication title Supernatant Protein Factor in Complex with Rrr-Alpha-Tocopherylquinone: A Link between Oxidized Vitamin E and Cholesterol Biosynthesis
pubmed doi rcsb
source organism Homo sapiens
total genus 134
structure length 397
sequence length 397
ec nomenclature
pdb deposition date 2003-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00650 CRAL_TRIO CRAL/TRIO domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.680 Mainly Beta Sandwich Jelly Rolls GOLD domain 1olmE02
3.40.525.10 Alpha Beta 3-Layer(aba) Sandwich Phosphatidylinositol Transfer Protein Sec14p CRAL-TRIO lipid binding domain 1olmE01
4OMKA 3P7ZA 5LZ6A 3B7ZA 3W68A 4CJ6A 1OLMA 3HY5A 4J7QA 4FMMA 4CIZA 1O6UA 2D4QA 1OIZA 4UYBA 4M8ZA 2E2XA 3W67A 3PG7A 3PEGA 3B7QA 1AUAA 4OMJA 1R5LA 3Q8GA 3HX3A 4TLGA 3B7NA 1OIPA 3B74A 4J7PA 1OLME
chains in the Genus database with same CATH superfamily
3N9QA 2WS92 5FY9A 2FMYA 4Z92B 3KV4A 2JDPA 2WABA 2LW8A 4Q2FA 5BNQA 1NCQA 3OYWA 1GOHA 2DURA 4LBJA 5C7GA 1TQ5A 4UFHA 5GM0A 3VZLA 4BXFA 3FBMA 1GLHA 2NMOA 5JOXA 3FE5A 1MVQA 2WKKA 3JB8A 2R30A 3H7JA 2B5HA 2WNEA 2JD9A 5DN2A 5L7OB 2W94A 2ARXA 3JXSA 3PUHA 1PGSA 4FSJA 1AR82 2QQUA 3C7OA 1W0PA 2XGXA 1ASJ1 2HWB2 1DGRN 1H1AA 1K5MA 2YMZA 3IT8A 4JDOA 2WFF3 4Y20B 4RA0A 3MIGA 2N7GA 5G04L 1DHKB 4NHMA 5BNPB 1OD5A 1OMIA 4COYA 3AKQA 3AFKA 1LOFC 2GN7A 4XE9A 1X50A 1DFQA 3HR9A 3L2YA 2A5ZA 3PUIA 4GALA 2NQYA 5T54A 3KLSA 2WS91 1RINA 1AJOA 2EIDA 5LW9A 1PX4A 2IXIA 1RXFA 4BK5A 1ND3C 2F17A 2VXJA 4JTOA 3W58A 4N8MA 4QX1A 2PN5A 3IB3A 1PO22 2QQNA 2F4LA 3K3OA 4LK6A 2JKXA 3EO6A 4QM9A 1JYIA 3CU7A 5G05L 3T0AA 1UZZA 3KQRA 1CD3G 3I49A 1AR81 4CP1A 3A0KA 2WL1A 3O0XA 3JQXA 4C1XA 2QQKA 4B7KA 3D82A 3QACA 4YVWC 1J84A 4W8JA 2OS2A 2BFUL 3LPGA 3U4SA 5JUVA 1ACCA 3HT1A 4HZFA 2DBNA 3WV6A 4HN1A 1RUI3 4UFIA 1LOFA 2K2SA 4N9IA 2HEYF 3VHRA 1MQTB 2MPFA 4UT5A 3WR0A 2VZRA 3DECA 4AI9A 2Z4FA 3CBNA 3FLTA 1XYNA 4UBHA 3IPVA 1V6JA 4LE3A 1C8M3 1ND3A 1OA3A 1UY2A 1VBD3 3KGZA 2Q8CA 3RYKA 3RWNA 3IAQA 4PIZA 5IK8A 3WUCA 3WQ0A 3S5QA 1ZBA2 3ST7A 2ZACA 5A1LA 4AI8A 2C0ZA 4AOCA 1F2NA 1CAVA 2ZMNA 4B4PA 4I0BA 4NVPA 1PGW1 1PM4A 3EQEA 2RDQA 4P9YA 4XEZA 4AEMA 4RS5B 3U37A 1GICA 2DF7A 5KHHA 3SEPA 5FYHA 4OI0A 1NE6A 1JXNA 1SPPB 2HEWF 4UOJA 3QD6A 3T4VA 4UXAA 3MW2A 1OF3A 2C9AA 2J1VA 3K4AA 1BCXA 4YG3A 1KJRA 1UY0A 5F9TA 3POGA 2ARBA 4JV4A 1TG7A 2XVGA 3BODA 2P17A 4ZZ5A 1C28A 1YUDA 2YV8A 3A21A 3DKQA 5J37A 5FZCA 2WQ4A 2WO2A 3NNJA 4TWTA 3EB7A 4YFWA 1NLQA 2JWPA 3OGJA 3VKOA 1MS1A 3W5MA 4B8EA 1RUE3 1GBGA 5FR3A 1GV9A 3V65A 4BQ2A 2LROA 4M3CA 1C57A 2Y38A 4RQPA 4JX0A 2FDIA 1MS9A 1ZRIA 4KU8A 2BBAA 5L7OC 4GWJA 4XXPA 4YPJA 4MV2A 4YRDA 1D0GA 2QDNA 3LOIA 4NHLA 5ACA2 1STMA 1VBC3 5FOJB 3RMYA 3N36A 1YJKA 4S2DA 5IVEA 2R043 5HXVA 4AK3A 2E53A 5A6QA 5BNPC 4EE2A 5EV7A 5LBCA 2OQ6A 3RFRA 5BYNA 1WWYA 3R4DB 4AE2A 1NZIA 4CCKA 4KBZA 4LBNA 4GIQA 1EP0A 3CKHA 2WLPA 2WZEA 3FHIB 2WBKA 5DDJ2 3HMYA 3ZDSA 1CX1A 4BDVB 4XHBA 2BRTA 1PVC2 1O5LA 4ZXKA 2VM9A 3HPNA 5A3UA 3VD3A 3NAPB 1GWLA 5F37A 2E7AA 2PHWA 5L7OA 4DRVA 3SH4A 2RS13 1RUG1 5D2AA 5KBFA 3LDBA 5J09A 4B7EA 3SISA 3E5QA 4AI2A 2W08A 1YFWA 2O1QA 3DCQA 3KCCA 4IW3A 3AB0A 1KRIA 3MICA 3BTAA 1LTEA 4Y20A 4I2OA 1IZ3A 4N9HA 4OI1A 2X10A 5FTTC 3N9PA 5BNPA 3OD0A 5FZEA 2VCBA 1CN1A 1AF9A 1UMHA 3PMSA 5IT6A 2W1QA 4ZPIA 2IVJA 1REDA 2JICA 3CO2A 1J58A 4YW6A 1MQTC 3SC7X 3T2PA 4BH9A 5C3PA 4HN0A 4KG0A 2O8OA 5DDJ1 1W8FA 1VB2A 5E89A 3KV5A 4K8FA 4KBBA 1YI9A 5F3CA 4D6SA 1PVC1 2CAUA 2UYAA 2J22A 1BK0A 3AL6A 1WA6X 1BHGA 4GKXA 3AMMA 4A3XA 1JU3A 3BALA 2FCVA 3W5NA 3CDZB 3HQXA 1OLMA 3NJVA 4MYEA 5HV0A 5J3UA 4WZCA 3MUZ1 5FO8B 5B2GB 1LENA 4KGQA 1HDKA 1HJGA 4RS5C 3FLPA 4YM1A 4RD7A 2GZWA 4IEOA 5EYXA 1D7PM 2OUJA 4NHKA 1Z7S3 1LEDA 1VMFA 1ZVFA 2ADEA 1QJFA 1VAKA 4U36A 2A6WA 4XOGA 4COZA 2E2XA 1SLBA 1TMF3 4XFGA 3ZXKA 2VNGA 1Y43B 1MQTA 4JHZA 3RNSA 2GMEA 4DEVA 4Q8KA 5JOYA 4LA2A 4MGQA 1UKRA 2YFZA 1JOJA 2QQLA 1RUH2 3KT4A 4A6SA 3N7KA 4URAA 2WZ8A 2J1AA 4HVOA 5DUUA 4QKDA 2VAUA 2VJXA 5JXHA 2VG9A 4CDXB 3GHNA 4LHKA 4JQRA 2QZ3A 1AXZA 4QHOA 4YZ4A 2HYXA 5K7PA 4PLOA 4UWDA 1A3KA 4RS5A 1XJAA 2XL7A 4XCBA 1E57A 1W3VA 1SPPA 1YWKA 3AYDA 5JSRA 4NIHA 3N9NA 4XF4A 3B02A 5F5AA 1EUUA 2YBSA 1UY1A 4LBQB 1S0JA 1GU3A 5FPAA 3FWEA 4NE9A 2JDYA 5HXMA 5LCWL 1SCRA 1JU4A 1S2EA 3FL7A 1LHWA 4IESA 1FPN1 2UWCA 5T5JA 3BYWA 3ZXLA 1RUH1 2WFPA 4QGMA 4XIKA 5FCCA 5FP8A 3C7HA 2XQXA 3B9IA 3ZXJA 2E51A 4O65A 5DUWA 2GNTA 3KMHA 3SNMA 2HWE1 1XE7A 3NAPC 3BKZA 5DXDA 5AC93 2FZ2A 1X36A 3LKJA 2O14A 3P6BA 4LIUA 3WVJA 1AL22 1D4M3 2D6NA 2Y60A 2WR9A 5FMBA 2W3JA 3USSA 4AQTA 3LQCA 3ZYBA 1N1SA 3WINE 5EJZB 1UXXX 5H9SA 2PHFA 2E33A 4XZUG 1LOAA 2CL2A 2G19A 1NLSA 4LMFA 4DXRA 5KHJA 2PELA 4XAEA 1QY4A 3NJZA 2SLIA 5FZOB 3CZJA 5FO9B 3JCIA 2B8MA 1V6OA 2W1SA 4J25A 4A41A 1FMD3 3KZ4C 4DIQA 4MOAA 2HYKA 5I8YA 4GMP1 2ZHNA 5CKQA 5FYIA 1YFUA 1H2LA 1AHSA 3MHZA 4C91A 1QJX2 3LPFA 1U5XA 1CIWA 4XJ9A 4XJ8A 1VBE1 3E6BA 3VD9A 3NAPA 1Q43A 2IXHA 1O3QA 2ZABA 4PBOA 4CTEA 3I3BA 1ZBE3 1WLWA 5FZHA 4CEYB 3P3NA 5LA0A 2YC4A 1JS9A 2AENA 4GWMA 3BTYA 4WZFA 4PI2A 3VD5A 2Q1FA 3HBKA 1WW5A 1UYZA 3K4DA 1HB2A 2RS53 1RMU2 1X8EA 3CZUA 3PTYA 1G9BA 1W6OB 4Y5Z0 3ZIWA 5LASA 2D5HA 4DPNA 3SQOA 5BV6A 3PHMA 1V6MA 2JDNA 1X7NA 4UW3A 4LBMA 3WNNA 4AQ6A 5DAXA 1E5IA 3WP3A 2W68A 4AHXA 4Y1VA 4ONUA 3TB0A 2G1MA 5J36A 1H2NA 1RUF1 2IZWA 1S2KA 4IE0A 2DTWA 4P9JA 2C9KA 4AEDB 3R4SA 3WNOA 2DYCA 1LOGA 2A6VA 2OPWA 2ZGRA 3PNAA 4CDXC 4NHYA 3GJBA 4GD4A 1NE4A 1GNYA 3FFQA 4UAPA 1JHNA 1EUTA 1PIV2 1YYNA 3JD72 1OVPA 2C26A 2RR12 5FKCA 3KV6A 3MIHA 5LWBA 4CU6A 2XL9A 3AZVA 1MZ6A 5A7SA 4OHYA 2DCKA 4M00A 5FYZA 4Y1YA 1DGWA 5CADA 2XJSA 5LRSA 1V6IA 4NAMA 3WD5A 3H8UA 4NRMA 4J7QA 1CAUB 4QDQA 1I3HA 5EP9A 3E5UA 4LLOA 2AACA 2Z42A 2XKOA 2XMLA 2DU1A 1KS5A 1OOPB 4ORFA 1RXGA 2Q8EA 5CZKA 2LRPA 2DVGA 4CCNA 1VAVA 3MLJA 2DWRA 1XOYA 5AVAA 2ATFA 1H4HA 4CDXA 2AUYA 4DEQA 2NPIA 2FBEA 2GC1A 4AXOA 1BBT2 2WQ8A 1UN1A 3AP5A 2XUMA 4XJUA 1LHVA 3RZKA 1Q8QA 3A0NA 1F15A 5FMCA 3ZSJA 1W05A 2WO1A 4EN7B 4F7ZA 3MFCA 3DF0A 5A7QA 4CVUA 3HNMA 1F4AA 5CIRA 2HWD3 5GKAC 5LBEA 4YSFA 4XIOA 1LOBA 1W28A 4LOTA 2FMDA 4L99A 1AJKA 1S1AA 2VMGA 3WEZA 3AKTA 4LBQA 3ZYJB 1JYWA 1S4CA 1F5JA 3RPQA 2BV4A 1GZWB 4GWIA 4Q0QA 4X8PA 1BZWA 2B9VA 2BVBA 4JZRA 4FQ4A 4EN9B 1S0EA 1OVSA 1RUD2 2C6SA 4HSJA 3HN1A 5CFDB 4QKFA 2B7YA 4E2GA 5GZGA 3POIA 1BBT1 1AXYA 2DV9A 5JR2A 4ZONA 3SCFA 3WP5A 2EIEA 4CCEA 2RM23 3B7ZA 4S2GA 2WA4A 1ZX5A 2VZTA 4JAAA 5KXCA 3UV9A 2PA7A 5FMOS 4LBQD 1WGPA 3HJRA 2VTXJ 3WDWA 2GMMA 1HX6A 4O7XA 1LOCA 4MO3M 4R9AA 1FI2A 4XC9A 1RUJ3 1Z0HA 2Y64A 5EYYA 5BNOA 2BNOA 5FZOA 3OGGA 4HXCA 3S7IA 2F6BA 4GULA 1HLCA 4RR3B 4D7SA 4HT1T 3WCRA 1E5SA 3WG2A 5CISA 3AP6A 1JYNA 1AR61 2K9ZA 4AEDC 2BGPA 3AKPA 2FZ1A 3P3PA 2AR6A 1W6NB 2UURA 3T09A 1OI6A 1COV2 1GR3A 2QFEA 4ARXA 3MFAA 2EAKA 1AYM2 4XDOA 5DZEA 3MZHA 4CJ6A 1L7LA 3E97A 2Y0OA 3LIHA 4V2VA 1OXCA 2G9FA 1SG3A 3T0DA 3LEIA 3TBDA 4QB1A 5FZIA 1DQ4A 4FMMA 4FTBA 4DZGA 1GMMA 1W6OA 1QOOA 2AREA 3NRUA 4B3NA 1O8SA 4R9CA 5DAPA 5IVYA 1RJ7A 4E4HA 4OI4A 2PHRA 3VBFB 4HANA 4IETA 5E6HA 3SLIA 4B1LA 2Q0AA 1S0BA 1OQDA 2J42A 5H9PA 3WDVA 5F6KA 2Q30A 2RMU2 3GHMA 5AFBA 2BJSA 1OOPC 5I0UA 1A8MA 3RI9A 5FYCA 4AGGA 4BCUA 4J7PA 4N7IA 4BA6A 4MGYE 1CZSA 4IEYA 4AEDA 2XUEA 4XJWA 5T50A 2ZGUA 1Q8SA 2TNFA 3J7HA 3I2IA 5I0RA 3AVRA 1SFYA 3OSDA 3H8OA 1XB9A 4FP3A 5FFOC 1OC1A 3E5XA 3NO8A 2WT0A 2H6BA 5A6YA 5FDBA 3VKNA 2PHDA 2OZJA 2YPDA 4QU1A 3SKVA 1W8ZA 3U14A 3UKTA 3VZOA 2JECA 1UO9A 3RI8A 2ZGSA 3C7FA 3I97A 3I2FA 2RHPA 2QQOA 2WWUA 3A4UA 1LHNA 2AC1A 2WFF1 3K75B 2VMCA 1CAUA 1U5IA 4KWLA 1FV3A 4K20A 3DEMA 4LBLA 4Q27A 4XABA 2J1SA 4RHV2 4NHXA 2ORXA 5E8AA 4AF9A 3OBAA 5FJKA 4CP9B 3GGLA 1OOPA 4LIVA 3P7ZA 3RZZA 4AGRA 4UBGA 4AVTA 5LZ6A 3M3OA 5E88A 3TEWA 1N1YA 3IDEA 3RZMA 3I3DA 5F3GA 2BZDA 4BWOA 1FOD2 1UL9A 3VBSB 4F3JA 4FOYA 3TNPB 5CFDC 3HQRA 1H2KA 2PFWA 1E5RA 3VLBB 4I01A 2GNBA 2E9QA 2W9XA 3OG2A 2DBIA 2G4IA 2R072 4LKFA 1JOBA 4OULA 5FPXA 4AFAA 3GJAA 1UPSA 5JXIA 4M3CE 3WG3A 4L0PA 1XSRA 1DYOA 1MZFA 1AR73 4BXSV 2YGLA 1H9WA 3ZYPA 4FO9A 2WT2A 4JHTA 2XJPA 4ZS2A 4QKBA 4EWAA 3EBRA 4OUEA 4BQYA 4C1WA 1ULDA 2EAAA 2HWF3 4JRAA 3H42B 1V9U2 3KF5A 4RHV1 4RR3C 4XACA 3CQOA 1GZWA 4B1MA 1VP6A 1QU0A 3DYMA 1ENQA 4AVBA 1ZRRA 5J98B 2P6CA 4CE8A 1FOD1 1QNWA 5CFDA 5T52A 3OPWA 1C8M1 3OJBA 1VBD1 2WNVB 1GP5A 5A6XA 5FZ7A 3S7EA 3TN92 2GP3A 1ENSA 2QTWB 3HIFA 2BTVC 3BOWA 4GXLA 5EHDA 2J1TA 2DU0A 2CNAA 3CNAA 4JKKA 5A7NA 2B46X 1UOFA 3AYCA 1YEWA 4OLLA 4TSVA 3D6EA 4IXLA 1VBB2 2D6LX 4QDRA 3VL9A 1M06G 1RUOA 3VBFC 3ETQA 3ATGA 2UY9A 3K46A 1GOGA 2WRAA 2Y26A 3V0AB 3GM8A 1F4HA 2VUDA 1ZA7A 4QGNA 3ZYHA 5ISLA 4K21A 3J26N 5F8PA 4RR3A 1DZQA 1JH5A 3H1MA 4AQ2A 1DQ6A 5J7MA 4IE7A 4JGYB 4OQ9A 2WWJA 3E6DA 1LGBA 1QOTA 1DYPA 5IK5A 4MSVA 3NSTA 3ES4A 1EV12 3WHUA 5IVJA 2CV6A 4CU7A 5C3QA 1W6NA 2R0FA 3VHNA 1R092 4YG0A 3JBG2 1RUE1 3N35A 3AM2A 4XXAA 1AUAA 4OHXA 5GLZA 3VDAA 3SKJE 5JSOA 5J1XA 2UYBA 1W90A 3IPVB 5F2SA 3ILFA 1RJ8A 4ZXEA 1OLME 3PUSA 1ZA4A 4IEQA 3WNXA 5CB7A 4Q4X3 2WYSA 3DUIA 1LCLA 1CVNA 1VBC1 3VBFA 1HN0A 3TEXA 2VVDA 3J8F2 1YHFA 3L2HA 1IQAA 1OH3A 4UFJA 1WA4A 2R041 2FQPA 3JZVA 3MYXA 2VNRA 5FBZA 5GALA 3N9OA 4O61A 4EWEA 3BIEA 1ZM1A 1IS5A 3W9AA 4MG2A 3IAPA 5C5UA 3RS6A 1LEMA 3MPBA 5FZKA 3LE0A 3VBSC 1BVP1 3V0BB 3MW3A 5JLVA 3AFGA 1CAWB 5LA2A 3RG0A 3PU8A 1H8VA 1PVXA 2I45A 5IATA 3RJRA 2R1BA 1JI6A 4LO6B 1K45A 4MGTA 4Z1VA 4AFDA 2ARCA 3AC0A 2DUPA 2RS11 4WVMB 5GLTA 3LA2A 1CGPA 2W87A 3BUCA 2R49A 5DG1A 1YIPA 3WW3A 4XCAA 4D6RA 5JZGB 3KHCA 3FX3A 2JDKA 5JWPA 2IUWA 2AYHA 4ET7A 4FT8A 4GA9A 1QJY3 4FP2A 4IDZA 2UY8A 4QQOA 4RQPB 1YC61 4I3PA 4Y1ZA 2ZEZA 3RQ0A 2HWC3 3OBRA 1MS4A 4QXBA 2B4KA 2EVXA 3AVSA 1Q8PA 5FY1A 4CP9A 1ASJ2 1GNZA 2WT1A 1CPMA 2D5FA 4BIFA 4BK4A 3LF7A 5FYTA 4L2NA 3VBSA 5LK7B 4XMAA 1IS4A 4LPLA 4I02A 4PI0A 5ANQA 4QDSA 4ATEA 3RSJA 2Y0IA 2I74A 1J3RA 2QNKA 1W99A 2TBVA 2WNVC 4R4ZA 5IHRA 3JQWA 5FQ0B 3AMNA 4SBVA 4TYSA 5H9QA 3HAGA 5FXXA 4HFSA 4G3YC 4AFCA 1VIWB 3J7NA 4A7KA 3H8RA 4C8DA 5GLVA 1I1EA 4FXGB 3ZYRA 1VPHA 1N1TA 1RUC3 2JG8B 1RVF3 2VUAA 3RDIA 1BEV3 1HQLA 3ZSEA 1QEXA 2ZMKA 1YI7A 1UYPA 2X53S 4X6RB 1D0HA 2D43A 4CUAA 4NROA 1UIKA 5F32A 3LA7A 5EPAA 1EAH3 1WZXA 1O7FA 3H1WA 4FFIA 4JGYC 1TMF1 2BWAA 2VMEA 5KHIA 3VKMA 3WF4A 4INDA 3FZ3A 4K1YA 4MXVA 4Y3OA 1JUHA 1DLCA 2ZX4A 5T5PA 5IWFA 4Q4W3 2P4EA 2WNVA 5A7OA 1LU2A 1NAEA 1R1ZA 1GWKA 2XBO3 2Q4SA 4YW2A 4RGKA 4YW4A 1QJU2 3IBMA 4ES9A 3OBZA 3V64A 4QQHA 1HXS2 3MEPA 5JVVA 5EIYB 4IE4A 1NXMA 4OFGA 1R64A 5FK7A 3ZKUA 2A7AA 3Q8CA 1FNZA 5A3OA 1US2A 1UWWA 2OQ7A 3SH5A 1R1A3 3UL2A 1G7YA 5L9RA 4MGKE 2R16A 3TNQA 3V0AA 3IDCB 4H55A 3T2TA 4LXLA 4AI3A 1AX2A 3UGHA 3WQBA 1LKNA 1PGW2 2RS33 1XNTA 5LY2A 3QOPA 1XPWA 4JGYA 5EZWA 4M3CF 3UGGA 3QBQA 1JODA 1K3IA 1TE1B 2YROA 3NV3A 5TSWA 3VKLA 3LWCA 4BQXA 3T30A 2GC0A 1WMEA 5FY4A 3ZSKA 4QX7A 2YU2A 3HWJA 1YNAA 4V2WA 4XTPA 3T1MA 3ABZA 4YW3A 5F1RA 3POFA 1QJU1 5AC91 1TME3 1UYYA 1QQP3 1HXS1 5JAXA 3I59B 1VRH3 1D4M1 5F3IA 1KDMA 1W2NA 4OHVA 1UOJA 5JZGC 2ZHKA 3ZR6A 1NG0A 5K4LA 1TNFA 1POV3 3WP4A 4RQPC 3VDCA 3B7QA 5LA9A 2DVDA 1X9PA 1MVEA 4M4RA 1UXZA 1RITA 5A32B 3T2OA 4YGDA 4Q5OA 1CIYA 1HRI3 1NUKA 2JE8A 2A71A 4BHPA 1HRV3 2RG4A 4NPMA 3WF1A 4RFRB 1HB3A 5A3MA 1HB4A 2IXKA 3D0JA 1FMD1 1DQ2A 3POWA 3V0BA 2WZR3 4G4FA 1YJLA 4ZHNA 1VALA 1XE8A 2ZX1A 4MGSA 1V70A 5FAXA 4Z8BA 1CAWA 5IFPA 2W39A 1KQRA 4ASKA 3LAGA 1OT5A 2JJ6A 4LEJA 1DLLA 2LALA 4DXSA 5HCFA 4XW3A 2GSYA 5GLWA 4YZ2A 2ETEA 2V5DA 1GOFA 1AR93 1SLLA 4WVMA 1KFUL 2LM3A 3MLKA 1ZBE1 3PUAA 2WNOA 3AXEA 3WNLA 5JZGA 4JDNA 5KC6A 3Q8GA 2JG8C 4IGQA 1WCSA 4JC1A 2MEV3 3AX4A 3ZN6B 1DQ1A 2RS51 4CYDA 5FY7A 2V73A 4Q4Y3 2P3KA 5BY5A 2DCZA 3AYAA 3VV1A 5JR7B 1RUG2 4DY5A 2Z2SB 4BLJA 3KS7A 4CP2A 5GLUA 1I6XA 1LRHA 1I9RA 2HJIA 1PZ9A 3TAYA 5A7WB 4FPYA 4FXKB 1W8WA 1XQNA 3TRSB 1N47A 3OCPA 5HV4A 4CU8A 2JB8A 3T1LA 4PJYA 4LO4B 4QPIB 1DGLA 5FQ0A 1GFF2 2R1DA 4M01A 4BQ3A 2YGMA 4CXXA 4UI9L 4EN0A 3OB8A 5LA1A 1OA4A 1NY72 4JRLA 2GU9A 4LKDA 3JU9A 1VBA2 3HT2A 5JXJA 2JG8A 4Q0PA 5FMDA 1GQPA 1UW8A 4WM7B 4XETA 2HWD2 1RB8G 5APAA 3BOPA 1UIJA 2VW1A 1HB1A 4QB2A 4CU9A 4LORA 1QXPA 1T6BX 1GYKA 3G7DA 2B9UA 4OMCA 3TWIA 1HQWA 3VDBA 5IVCA 1SMVA 3IDBB 1SLTA 1N1VA 2DVAA 2JIGA 2KXLA 1AL0G 1WD3A 4R4XA 4HLTA 2FD8A 1V0AA 2R063 3LEMA 5FYBA 1JBCA 3LFIA 4YGCA 4Y1UA 4Z2WA 1NY71 3MV01 1JZ7A 3VUOA 3BU0A 1VBA1 4FBFA 1POV0 2RM22 2WZPP 3VZMA 3E1F1 4PDWA 2WYFA 3VGIA 5GZCA 2BDRA 4XJAA 1W8TA 3WHTA 3UT0A 1G86A 2A1XA 2VQAA 4UFLA 2HWD1 4BE3A 3GDBA 5FP4A 1CJDA 1XYPA 5FLIA 1PX3A 1TNRA 3DKWA 4DS0A 4YFZA 5FO7B 4CZSA 4P5HA 1AUYA 1ND2A 2LS6A 1W2OA 4TTGA 2VL4A 2A70A 1DF0A 1DQ5A 2AZ5A 2VZ1A 2VMFA 1XU2A 4OUMA 4YW5A 4DINB 1ULGA 3OUHA 3EXUA 1QDCA 4GQ7A 1LECA 4MH0E 1OIZA 1RHI3 3WSOA 3AZWA 4GH4B 2A3XA 4FFFA 2QQMA 4FFGA 2ET7A 5CG9A 1HN1A 2XJTA 3W21A 4IEUA 3PJQA 5FZ0A 1XNCA 1FPN2 2D3PA 5FP7A 4DNYA 1NLRA 4K3UA 1RGSA 2RM21 3I59A 4BPZA 2VTXA 1NA1B 2D93A 3F2ZA 1W6MA 2YXSA 5A80A 4D3WA 3LEKA 2DUQA 2JXAA 4H14A 4A2UA 2HWE2 1ODMA 1W9FA 4H2AA 4ASMB 4HOOA 3ZIXA 4HL0A 5A32A 1QGLA 1XYOA 1Y7BA 1A34A 3IDAA 1RUJ1 2FDJA 3WDUA 1XBFA 4YZ3A 1DP0A 2KD7A 1RL3A 3VBOB 1WMDA 3DPRA 1BK1A 3DXTA 4FPGA 4P08A 4QPIC 4MUVA 4YLZA 4COVA 1A8DA 3RYPA 4CSWA 3B94A 1YFYA 4HVQA 1ONAA 5I0DA 4Q1PA 2X09A 2XQRA 1AX0A 5CAZA 4CCOA 4SLIA 3M2MA 5DZGA 5A3LA 1CESA 1ENXA 2YY1A 4MZUA 2RDNA 3RMXA 3ZN6A 1VBE2 4MXWB 3S30A 3MDPA 3M1HA 4WM7C 4YM0A 2D6MA 2ZX0A 5SV8A 1VRBA 2QQJA 1QDOA 4NO4A 4JCKA 4UYBA 1NQJA 1F9KA 2WO3A 5JSPA 1IS3A 2WLQA 4AFMA 4Y5SA 5A7WA 2GH2A 2HWB3 3HX3A 5C3SA 4XTMA 3WLUA 3OPTA 2YUEA 3GBWA 4IERA 2VGDA 4A3ZA 4QU2A 1EY2A 1R083 1URXA 4DO0A 4QPIA 5BNOB 3POYA 2EXHA 4XYXA 1ZZBA 1KD7A 2PAEA 5F5CA 2B45X 1UOGA 4NRPA 5I91A 2MNGA 3MV11 1JTZX 1RUF2 5L9BA 3USUB 2XWJB 3ETPA 3WDXA 2X29A 1FATA 1ULPA 3APBA 3N9LA 1W2TA 1PO23 4TXWA 3WNMA 2WSUA 2BGCA 3ACFA 4ITCA 2TEPA 3OUIA 4ISRA 4WM7A 5A33B 4WVWA 4L9BA 5EWSA 5AVPA 4BYYA 4CCDA 1AR72 4XDPA 1BYHA 1NKGA 4ZZ8A 4XURA 4FPFA 4AHZA 4W6XA 5F7UA 3PU3A 2NYYA 4LHSA 3HEIA 3J9SA 3BU7A 2HWF2 2VOWA 5CNAA 3R4UA 5F39A 1VE0A 4NR1A 1DZTA 3QH6A 1UU5A 1VJ2A 3AP4A 3THPA 1X9TA 4NIGA 1EYBA 5DG2A 4DB5A 4KMQA 2OPKA 1J3PA 2HBUA 2KA3A 3TEYA 1BJQA 4YZ1A 2ZGTA 1NA1C 3GCXA 4BQWA 5JPNB 2R0HA 1OF4A 1PO12 4ZS3A 1UKGA 2PHXA 1JYVA 1ZBA3 4COUA 3SMHA 1XNAA 3N9MA 4C0BA 3ZDVA 5FYUA 1AR71 2NM1A 4YNIA 4J1XA 1KITA 4K9SA 5GJ6A 5KXBA 1W06A 3OPZA 1JHJA 4FQZA 1W3XA 5C6CA 3O14A 4ASLA 4OMKA 1V00A 1SDWA 2WDBA 4Q0VA 2HWF1 4QAWA 3ZXGA 2WAAA 3VBOC 3ZXAC 4MGIE 5FK8A 1W2AX 4XAAA 1TZOA 2GDFA 3GBGA 5A3PA 4GH4A 3D5OA 3KM5A 2VBBA 4HKLA 4P9XA 5KHGA 5IVBA 2P3IA 5FWEA 1IQDC 1B09A 1CAXB 3GZEA 3K48A 4UW6A 4F83A 1TEIA 4B29A 2C4XA 1T6GC 3IKWA 3FUQA 2NMNA 1NQDA 1BMV2 1M4WA 2VCAA 4PIXA 3W67A 1NA1A 4MHUA 2YZ4A 1PO11 1L7QA 5FWJA 2P3JA 2VNOA 3O12A 5A3WA 1GP4A 4GZ9A 4W50A 4FTEA 4ZKTB 1JZ8A 4QPYA 1UOBA 1XRUA 3KSCA 2R6QA 4Y24A 4KGGA 1QKQA 5KWRA 1X33A 3N4MA 2E32A 3B3QE 3H3ZA 1O4YA 4I0WB 3KVAA 5ACA3 3GCWA 4MVTA 4NJ4A 3B9CA 1MS8A 2VC9A 4HETA 2TUNA 3VBOA 3DYOA 1F8VA 4EV0A 2ZEYA 3FHQA 5CU1A 4ZU7A 1MR5A 5BNOC 4YW7A 2VOTA 2YB7A 1WCKA 1BMV1 5DDJ3 1R5LA 3ZLIA 5FZDA 2P6HA 1AR62 1CWPA 1HV1A 2IXCA 2NZ9A 4LNVA 1SCSA 3PVOA 2D40A 1PVC3 1WMFA 4FPJA 5LY1A 2GC3A 4DXZA 4MXWA 2QQIA 4PF1A 2Y6GA 2DUOA 5FREA 2ET1A 1GQGA 4QGLA 4Q4X1 4CDWB 4E4SA 1XU1A 2GNMA 4EZHA 3RZJA 3AZZA 4NIAA 3R6SA 4BMEA 4Q1RA 4I0AA 4Q4V3 2FHRA 2XXZA 2PHTA 3M4FA 3K4ZA 2VBDA 3Q8BA 2VOVA 4YYOA 3WP6A 4LO7A 1QF3A 2XLFA 5HBAA 2D4QA 1AX1A 2V5YA 2X5IA 3B69A 3N7MA 1NZCA 3OEAA 4XF3A 3W20A 1Q3EA 2XR4A 1CPNA 1SLAA 1GZTA 2CTVA 3GF6A 2W0XA 3LSDA 1WBLA 5C8CB 4LTAA 4HSLA 5JI9A 2R32A 4WM8B 3IZOA 5IVFA 4KU7A 2FCTA 4KI5M 4QM8A 2JIJA 2ZX3A 3USUA 2Y6HA 3RRDA 2QJVA 2GH8A 4LBKA 3PMEA 1OFNA 5A33A 2VQUA 4N7UA 1PGL1 4IE5A 4ZY9A 4IV3B 3GZUC 4UW5A 4XFIA 1GWMA 3T08A 1SACA 1QJY1 3BCWA 5JOZA 1BEV2 3AKSA 4CIZA 2FDKA 2CAVA 3FLRA 1W8UA 2C1FA 3HBZA 2HWC1 2VU9A 2VCCA 2WSVA 1PHMA 1IOAA 4XBNA 3THCA 2CYFA 1JUIA 1Q56A 4HONA 1K42A 3KV9A 1S0IA 4M4PA 2OUHA 1HKDA 1ST8A 2CDPA 4HPKB 4CUGA 1S0DA 5GZFA 2WFF2 4Y1XA 3O1PA 1RUNA 4LT5A 3LSEA 1BXHA 4META 5LRRA 5FZFA 3DL3A 3O1VA 2Z5WA 5B4XA 4D0QA 4R52A 4MLOA 2YC0A 2RJ2A 3AMHA 4EWDA 3A7QA 2ZJCA 4IL7A 3ME2A 3UJQA 2VZOA 3O1OA 4M0HA 3MGUA 3KHBA 3NV4A 4WV8A 4BQ1A 1RUC1 2YPJA 5DZFA 1MS0A 4A6OA 1RVF1 2ZGKA 5EFUA 1BEV1 4DFSA 3URFA 4CUCA 4DUVA 1REFA 2XKPA 1AYN3 2RS32 1EAH1 3M3CA 2D98A 5FUPA 4ISQA 3BPSA 1OSGA 2QQPA 5IK7A 2C5DA 5FOBB 2EXJA 3O1MA 2VR4A 2UWBA 3S5AA 1G8WA 1CAXA 3LDRA 4URTA 4FPLA 5BUVA 4Q4W1 1OQ1A 1GSLA 2AGSA 1ZRDA 1RUI2 2XH6A 1PNGA 4CXYA 1DBNA 1G9FA 1V6NA 2CGOA 4D8MA 1NXD1 3EJKA 2WJSA 4LQRA 1C8M2 1U5YA 4PF5A 1VBD2 2HEVF 3WX5A 4CDWC 1B35A 5T55A 1C4RA 4FOWA 1IHMA 3O1SA 1AL23 1R1A1 4AL9A 3HN3A 3CJIB 3M3EA 3MIDA 4CCJA 5KC5A 4KQ7A 2VMHA 5CYYA 3I3MA 1I5ZA 3WW1A 1YO8A 2K46A 4S2HA 5FY8A 3UGFA 5DUVA 5FZ8A 1PMJX 1WCQA 2RS31 3DN7A 3VZKA 3VZNA 1WD4A 4AVVA 1ZRCA 1BQPA 4I09A 4XDQA 4EJRA 3ITQA 1CJPA 2E7TA 3IMMA 3MO4A 4P9WA 5F2WA 5C8CC 5L9VA 4NWWA 1S2BA 4WM8C 1RUI1 4L8QA 4IV1B 2LTNA 4X8NA 2ZHLA 2D6PA 1RIRA 3M3IA 4EN6B 1GQHA 1TME1 1QJX3 5FKBA 2BFUS 1AR92 1IPKA 3NQHA 3ZYIB 1I5PA 1VRH1 2P3YA 4NWVA 1RUE2 4IV3C 3SHRA 4FFHA 4LHLA 4CDWA 3O0VA 2Y6FA 2WNUB 1OLRA 2MEV2 1POV1 1Q5OA 2W95A 1MPXA 2XJRA 3K2OA 3IN9A 1QMJA 4KG8A 4Q4Y2 2K0GA 3LZZA 3MLLA 2XVKA 2D6KA 3PURA 4Y22A 5KHKA 3ACHA 4NPRA 5HCHA 5E16A 1ODNA 1RMU3 1VLNA 1W6PA 1HRI1 2Q5TA 3AZYA 4LK7A 4FI9A 2ZKNA 5C3OA 1HRV1 1POQA 1VBC2 3UJOA 4YGBA 1WW4A 1H30A 3I2HA 2R042 3KB5A 2WZR1 2XOMA 3ZVXA 5C8CA 2WQZC 4NIDA 4U2AA 2RJKA 2VECA 4WM8A 2VY0A 2SBAA 3KT7A 5C3RA 1C8NA 5A7PA 2FCUA 4AAPA 2FDFA 1UAIA 3U11A 3U1XA 2JEMA 3UYJA 2Z79A 1AR91 3OEBA 5F5QA 3PG7A 3LIGA 4FOVA 4IV3A 3ZN5A 2B42B 4H7MA 2EICA 2I2SA 1YCIA 2MEV1 1US3A 5M0TA 4Q4Y1 1PIV3 2WO7A 1L3JA 3JD73 3P5BA 3ZYGA 1OIPA 2RR13 2RS12 1DIWA 2BNNA 3J7MA 2XPJA 1MZEA 5LBBA 2X05A 3UK9A 1O3RA 3X29B 3L9JT 1KDKA 5EJ1B 4HPKA 1O4TA 5SV5A 3VBRB 3HY5A 3ORJA 5LB6A 1FAYA 4Y26A 1ZRFA 1GZCA 2V4AA 3OGSA 3MF9A 3WW2A 1FT9A 4AR2A 1Y9MA 1VB4A 4H7LA 2A3WA 2QKDA 1IG0A 5B4NA 2XHNA 3BI3A 4XZPA 2BW8A 5DMYA 2W5FA 5I0SA 5JIUA 1OQEA 3UETA 2EF6A 2Y6LA 2ZHMA 1NCRB 4LLFA 4XUQA 2WN3A 2OVUA 1BBT3 4XFCA 4LO8A 2FDGA 1ZZ9A 5C4WB 1JZ4A 2QBXA 3MPPG 3CJIC 3GYDA 3H3UA 1JN2P 5EQUA 1O5UA 1A78A 1DGWX 1MS5A 1JZ5A 3ZOIA 5FY5A 3NJYA 1DQ0A 1AXKA 3MIFA 4QB6A 4GAZA 2XLAA 2DFBA 3DV8A 3ASIA 3LGRA 4E4DX 5FXWA 1KGYA 2ENRA 2VULA 1Z7S2 2A3YA 1X8MA 3NV1A 2GMPA 2JDZA 4XQ4A 5BNNB 2XJVA 2R061 2GN3A 2ZGNA 3INAA 3KWVA 1LU1A 1TMF2 3H9AA 4IV1C 5FV3A 1MZ5A 4OCTA 4GJZA 1QIQA 1OA2A 3S57A 5LBFA 3JB4C 2Q1ZB 1RUD3 2E63A 1K5JA 3A23A 3LCPA 2WNUC 4QWNA 5T5OA 1HV0A 5F5IA 1DZRA 3CJIA 2ORZA 3I4IA 3FC0A 1PK6B 1WCDJ 4RN5A 1J3QA 2V4VA 4MX3A 3QCWA 5IYYA 5L19A 1UYXA 3GXUA 2XB6C 2ZGMA 2HKXA 2JG9B 1YIFA 4HKOA 5ABJB 2XWBB 4EROA 1QOSA 1FYUA 3HNYM 2GALA 1Z7S1 4HVRA 1RHI1 5FZ4A 4D7YA 4IV1A 4LR4A 3PIGA 3PLQA 5J48A 5CA6A 1W04A 4FPEA 2B39A 4XMIA 1H8TB 3K51A 1APNA 3ZX7A 2W52A 3FBYA 1GZ9A 2PMWB 1DYKA 3UKNA 4JKMA 2CU5A 4GWNA 3FFZA 4KWJA 1COV3 1YLLA 4N90A 3ZMNA 3VZJA 1AYM3 4XFAA 2WNUA 3U0ZA 5A1AA 1CZTA 1UQXA 1JMUB 3BTXA 1KS4A 5AC92 3D8CA 3NNLA 2G9ZA 2CY6A 2D7FA 4PIYA 3WUDA 1D4M2 4PDWB 4W6WA 1SEFA 2V72A 1LAJA 1SQ4A 3BN6A 1LODA 2YU1A 1UU4A 3O7OA 3VBRC 3WW4A 5JDBA 3I2OA 2ARAA 2PLV3 3KVBA 1C5IA 4PLMA 2OIIA 3POEA 4WVVA 2RMU3 2VBPA 1R082 1S0FA 4Y5TA 1ND2B 4HK9A 1ULFA 5FYVA 4QPWA 4BMBA 2AEYA 2CDOA 1FMD2 2ES3A 3FUOA 4GJYA 3VDDB 4YM2A 3SEEA 3ACGA 3SCHA 1XNDA 4OHWA 1A6CA 2EXKA 4CEYC 2IFRA 1NCRC 3VKFC 4F8AA 4QD2A 1OBNA 3OBTA 5C4WC 1G6NA 3ENRA 5E1RA 4C90A 3LB9A 1W9WA 2ZS6B 2E6VA 1ZBE2 3VBHB 2WUHA 3E6CC 1W6MB 5I8SA 1O3SA 4FAGA 3BVCA 3I2JA 4CCLA 2RJLA 2Y6JA 1L7RA 3VBRA 2RS52 2HWB1 3EHKA 5JIAA 4D7TA 1JOPA 2VOKA 4UF0B 5FZMA 1RYYA 1PMHX 3CEWA 4W4ZA 5BNNC 1R081 3ZFGB 2YC2A 4RGAA 3CJXA 1WLCA 4LE4A 4RHV3 2LUWA 2Y33A 4ZU5A 4TN7A 5CEHA 3DPRB 3F95A 1FOD3 1W9SA 4AFBA 4DQAA 5JMOA 2W2IA 4E4ZA 4CEYA 1NCRA 4DUXA 1Y4WA 1U5ZA 5DABA 1GNHA 1ZZ6A 1PO21 4CA9A 2R073 1XNBA 3LFMA 2DFCA 5C4WA 3H7YA 3FJSA 3U10A 3ZKYA 4XFBA 1U0AA 1PK6C 3GZTB 2VZVA 5DQ0A 5C71A 4XQWA 4A7YA 2XG3A 1PZ8A 2VH9A 3VHOA 2BPA2 2XONA 5ABJC 2JG9C 3CIHA 3Q8AA 3T4HB 1NX9A 4FCAA 1H1IA 3BTZA 1X82A 2QVSB 1MEC3 3GZAA 2UU8A 4WBBA 4YVWA 5KR7A 5A3TA 3I3EA 1H4GA 3WNPA 2VO5A 5BNNA 4MHRA 2ZOEB 1V9U3 3KQ4B 1N3OA 4HKWA 4A42A 4XBLA 3DGTA 3B00A 2AEZA 2NLRA 1H8TC 1W9TA 1O6UA 2BEOA 1W6QB 4X6QB 3SH3A 2ID4A 1JZ6A 2PXJA 4YWAA 4LO5B 4ES8A 1LGNA 1MACA 4IUGA 1LHOA 4XILA 4A44A 5FZBA 4LKEA 2QQVA 4BQ5A 5I93A 4COWA 3TN93 2J1EA 3ZN4A 1ZBA1 4OMJA 2OXBA 1ZZ7A 2CHHA 1XXNA 2WC2A 1JYCA 1PK6A 3ZO0B 1BLZA 5FUNA 1P8JA 4FAHA 2NP0A 1UMIA 1VBB3 4PDWC 1YQCA 3H3LA 4BM8A 3ZSMA 5ABJA 2JG9A 4OI2A 3WF2A 4FPOB 1UPIA 2E26A 1UCXA 4EZ4A 1C3HA 1WLTA 2YYOA 3ZFEB 2OYZA 5HCAA 2W92A 3AK0A 2VD7A 5FXVA 1LGCA 1ND2C 2V09A 2VVFA 3WOGA 2Y34A 1HIXA 1OUSA 1CR7A 1H8TA 4OZOA 4RSUA 5FZGA 1EV13 4XFHA 4I3GA 3VDDC 3UNPA 5D8AB 2RE9A 2JB4A 4DUWA 1W39A 1R093 3ZPYA 3JBG3 3VB9A 1ZNPA 4CP0A 5FXZA 2DTYA 2VTFA 4YG6A 2VW0A 3QH7A 4ARYA 4Y4YA 5CKNA 4XF1A 5H9RA 1SBEA 5FZ6A 5C9AB 3VBHC 3HNBM 3ECQA 3NJXA 3NWKA 3OOXA 3TYJA 4Q4V2 2BWCA 1OKOA 5FZ1A 5ACA1 4GB33 2PTMA 4Q29A 4QX5A 4R8HA 3J8F3 1WMXA 5IJRA 3NL1A 1UD1A 4P9LA 5JOWA 3Q8EA 1H6YA 4BZ4A 3UESA 3ZFGC 5C8WA 1QJZA 2YBPA 4EQVA 5K8SA 1RUJ2 2Q8OA 5CFCB 1UMZA 3P1IA 4QX8A 3RZLA 3VDDA 1QHDA 2KM2A 2P37A 2G9GA 1HQNA 1ZZCA 3DPRC 5LEKA 5CG8A 1GP6A 2W47A 2ZX2A 4CCMA 3QLQA 1RTVA 4CDUB 1KEXA 2OX0A 3O5SA 2ZAHA 4JQTA 1HJFA 1G9DA 1SZBA 2ADDA 5DAWA 1FNYA 4QHZA 1JZ2A 3WG4A 1OH4A 3VBHA 2VUJA 1BVVA 2YDEA 4Q4V1 2F4PA 4DMIA 3GBFA 5DPNA 1VAMA 4PQQA 1ULEA 4UF0A 5FYSA 5GZDA 3ZR5A 2R7EB 4QMAA 5EXOA 1IG3A 1W9YA 1OUXA 3ALQA 1O91A 3AYEA 2W1UA 3ZFGA 3T2QA 3ZFFB 4Y4RA 3WZ1A 3WXPA 4RGGA 5HCBA 1ASJ3 1XNKA 2CGPA 3SXWA 1D4VB 1CZVA 4QQLA 5IW0A 1QXJA 4BOWA 1XE0A 3ZMOA 2CSGA 3WT3A 4N43B 2GP5A 5DAQA 1O4ZA 1F35A 3BGAA 4J1WA 1YFXA 5CVRA 2RDRA 1T2XA 4UW4A 4L11A 3AZXA 4BISA 2WS93 2BVVA 3ZYFA 1OURA 2VUCA 2UWAA 2BERA 1WCUA 2YHJA 4TZDA 4XHXA 1H2MA 2XJQA 2ZEWA 4IEZA 2OZ6A 4QPGB 5FZ9A 3ZM8A 4AI1A 1AYN2 4J6GA 4LOSA 2Z69A 4PHZA 2PYTA 3ZFEC 2YBKA 1SHWB 3OTFA 2EALA 2J1RA 1WW7A 4XVHA 1AR83 3MBWA 4RL7A 4M0NA 2QDRA 5JXGA 4TLGA 1YXWA 5FPLA 2IWGB 1W6QA 4K7JA 2BOIA 4PT6A 2VXRA 2X5IB 5D8AC 1OKQA 3SITA 5LEJA 5C70A 1SDDB 3CLPA 3ZXFA 3J7LA 1ALYA 3HVDA 1ZZ8A 3BB6A 1W8NA 1SLCA 4QT6A 1TVGA 1UU6A 4AG4A 4AGVA 1BKZA 1QJU3 2DVBA 5C9AC 1D2SA 1HXS3 3ACLA 3I2KA 2I07B 3PTRB 3U78A 1OHFA 3I2DA 1G9CA 4E2SA 1DU3D 4KL1A 4Q8LA 1LULA 3PVBB 1AYN1 1J83A 2VVEA 3PEGA 1CQ9A 4KNCA 2H0VA 3ZFEA 3HQUA 2JDUA 3ZPOA 4XF0A 3NNFA 4LKSA 5CFCC 1XSQA 3TOJA 3I8TA 2D97A 4CEWA 3R0RA 3U07A 2AH2A 4AQSA 2GC2A 2ZPXA 5D1IA 2XHKA 3LDKA 2JKBA 1V6LA 4GH4C 5D8AA 4CDUC 1SBFA 4XQDA 4CUBA 3H50A 4AVCA 5FIXA 3J4UH 4KH9A 1J1TA 2IC1A 3T0BA 5K0UB 1ENRA 1DGRA 3C8XA 4NIIA 5C9AA 5JPMB 4AWDA 1IPJA 3KT1A 1AL21 2IVIB 5CBLA 1PMIA 4LA3A 1W8OA 2ZTNA 3THDA 4JGZB 4L92A 2XJUA 5L36A 3THTA 3OY8B 3NNMA 2WWSA 3ZFFC 5IFTA 4CPBA 4BB3A 2NN8A 5CFCA 1WBFA 4IEXA 5FY0A 3PIJA 1FX5A 2WAOA 4NOTA 1IKQA 4IEWA 3U4XA 1OPOA 4DY3A 5AFEA 2ZEXA 4K6BA 1Q8VA 4CDUA 3AP9A 3B5LB 3PVEA 3KCYA 4N43C 2Y8KA 2ZZQA 5FPZA 3MUY1 4YM3A 1QJX1 3KD4A 1UZ0A 1ULCA 3O1RA 3LA3A 3AL5A 4Q0UA 4S2FA 4M8ZA 3WDYA 5A1FA 5KXDA 3O0WA 1JZ3A 1DG6A 3I54A 2ZGQA 4FOQA 3G6JB 5A3NA 2XLGA 1W8HA 4QPGC 4K8RB 4CPBD 5C33A 2P1BA 1RMU1 2JE9A 4Q4X2 1B35B 2L9LA 3WF3A 1RUG3 1DCSA 3ZFFA 1H6XA 2EIBA 3C2UA 3S6PA 3ELNA 5FYMA 2ZCWA 5IVVA 2ZGLA 4KWKA 4LUMA 4O9GA 3O1UA 1W0NA 2D6OX 4EYUA 1LESA 2X5IC 3BIWE 4QHBA 4N43A 1UY4A 2DCTA 3OGVA 3UKVA 2A75A 5A70A 4AYUA 1OD3A 2H0BA 1LNSA 1WLDA 1UF2C 4BIOA 3AKRA 3HD8B 4EN8B 4QQPA 3KGLA 2ZA9A 2VMDA 4A7ZA 2A6XA 2XVLA 2EIGA 4BJ0A 2VZ3A 1LJ7A 5FP9A 1OFSA 4AHWA 1VBA3 3WNKA 1KJLA 4AW7A 1J1LA 1PIV1 2C24A 3AXDA 3JD71 3M70A 1MS3A 2FDHA 2RR11 2EA7A 1N3QA 4QPGA 3VN4A 3PDQA 1PGL2 2BGOA 4AZZA 5K9YA 5T5LA 2ZGPA 3ILRA 5KXEA 2D3RA 1C1LA 1QJY2 2P34A 2YFUA 4KWUA 2WA3A 5BXXA 5C5TA 1QH7A 4O9EA 4Y22B 4UFKA 2W46A 1WKYA 2HWC2 5FZLA 1V6KA 4ATFA 3C7GA 3DXUA 1W6PB 2W1WA 4E8DA 4MGZE 1SLIA 2JE7A 3V56A 5I0TA 4D94A 5DUXA 1EPWA 3D4KA 4YW1A 3PJYA 5LK5A 3KCXA 2E7QA 1KFXL 3CHXA 1Y3TA 4P5YA 5K0UC 4QX0A 3MI8A 4QX2A 3WDTA 1S55A 4P14A 2PQQA 1QH6A 4QQ2A 3VBUB 3OF1A 2CGNA 4OVEA 3H1YA 3ON7A 3W68A 4JGZC 4LULA 4FPCA 1UX7A 1RUC2 1RVF2 3N3HA 2VOXA 1REEA 4OYUA 4XUOA 4XFFA 5LATA 4AHYA 1UZYA 1DDLA 1F31A 2JX9A 3K77A 3PL0A 4MADA 4YVSB 5FPUA 4IEVA 4Z2AA 4ZU4A 2IFWA 1EAH2 4NUBA 1JW6A 1UZWA 1S0CA 1S0GA 5FYYA 4IEPA 1WUVA 3C3VA 5FLHA 1IS6A 4B4QA 4OQ8A 1RUD1 3MF6A 4RFT0 3PVNA 2GNDA 4JDMA 1NT0A 2MHFA 4P9IA 4Q4W2 1PNFA 4QXHA 5K0UA 1FPN3 2RV9A 3ES1A 2ZKLA 1RUH3 2XBO2 4AAXA 4QX3A 1Z78A 3B01A 5HI0A 1GUIA 4FPHA 4JGZA 3VHPA 2HWE3 2O0OA 5I8TA 1H9PA 3N7JA 3BPZA 4V1PA 3MIEA 1B35C 3OY8A 2VW2A 4AVAA 1O59A 2ZBJA 5JMCA 1R1A2 4IQPA 3RVHA 1Y9GA 1YQ2A 2WIIB 2PLV2 3NVCA 4PLNA 5DAVA 4AEJA 4CDQB 2ZAAA 2VMIA 4N53B 4E27A 3FN9A 3NV2A 1N3PA 3K3NA 4NPLA 2PAKA 3OUJA 2J1UA 5FZ3A 1SFNA 2RDSA 4WVZA 5FRAA 3B93A 3ZSLA 5IK4A 2WN2A 1IPSA 2VPVA 4QXCA 2Q8DA 2ZXQA 3B74A 1YRZA 1PZ7A 2DCYA 3IWZA 4JTNA 2BNMA 4LBOA 4AEKA 3POBA 5IAVA 3LOBA 4R9DA 3I3QA 1COV1 1J59A 1AYM1 3D3AA 2EXIA 4AVSA 2OT7A 2XBO1 3B7MA 2ZZJA 4GMP3 5J96B 1UX6A 5GZEA 4XF9A 2HLEA 2Q1MA 1TME2 5FBJA 4NMIA 3NKTA 4CRQA 3LD8A 1QQP2 1VBE3 4LUKA 1VRH2 4OHZA 4P02B 3R05A 1AZDA 2QQWA 3MW4A 3VL8A 1F5FA 3FMGA 2BP6A 2JDHA 2PLV1 4PQ9A 4UFMA 1KXGA 1QXRA 2VQTA 2ERFA 4Y33A 3JUUA 3WG1A 1LHUA 4B4RA 4D6QA 1RC6A 2PQSA 2RMU1 5EJ3A 1UY3A 3B7NA 3IIAA 1HRI2 1UNBA 1W03A 2VCMA 1HRV2 2W91A 3AMQA 1EPZA 3DYPA 5F3EA 3RJ2X 2DCJA 2WZR2 2QCSB 3LEGA 4FPKA 1FV2A 4OZXA 4XUPA 4K40A 2JENA 4BU2A 2VE1A 1IKPA 4XUTA 2PAMA 3CMGA 1RUF3 5HPOA 4HMZA 4W65A 3OD4A 4XPVA 3VBUC 4CEWB 3A22A 3IMNA 3Q9OA 1QQP1 1C5HA 1NCQB 1XC6A 3CL1A 1QWRA 3OYWB 4XJZA 1OLQA 2YG0A 5BPXA 1LB2A 1NYWA 5FPBA 1PM7A 3TEZA 2HBTA 1O3TA 2KR2A 2VZSA 2VZQA 3M8LA 3ROUA 1MEC2 4YVSC 2QUOA 3IIIA 5ANNA 4P9GA 3ACIA 3PUQA 1SFPA 1ZYBA 1QJEA 2VZUA 3O1TA 1FXZA 4H3WA 1SBDA 2Y6KA 3KF3A 4W6YA 4P00B 4K1ZA 1W2UA 1H0BA 1K5MB 4HK8A 4IGOA 2OKXA 4BLIA 2E31A 1IGOA 4G9SB 4TLFA 4DXTA 4YARA 4DRRA 2D3SA 1G9AA 4QKNA 5IAXA 4I30A 2J7MA 5JI7A 4NAOA 1QNYA 5F6LB 3T3YA 1VMHA 3FHAA 2R071 2JDMA 5FJHA 3VBUA 3NKGA 3IM0A 1Y9QA 3I7DA 1PO13 5FZAA 2BQPA 1W0OA 3W59A 4Q26A 3WQ1A 4XUNA 1C1FA 4JKLA 4CXWA 4E9KA 3U75A 1U12A 2DVFA 2BU9A 3AMPA 3M7AA 4CDQC 4D69A 1MEC1 4IGPA 4YVSA 2BBVA 1JYTA 4N53C 4L97A 3AJYA 2OA2A 1V9U1 4YZ5A 2VQ0A 2GAUA 3AP7A 3WF0A 3WQ7A 1AVBA 3C7EA 4A4AA 4OMDA 4LITA 1CONA 2BOJA 2BUKA 2WINB 5CKMA 3SCGA 2QE3A 1YQ8A 3D0SA 1LR5A 4GMP0 2R062 1GKBA 3OGRA 4BQ4A 3VD4A 2ZGOA 4NRQA 3POJA 3TN91 5D21A 2A6ZA 5T3NA 3RZGA 2HH9A 1Q8OA 1H1MA 5L73A 3RGBA 3H8XA 2A6YA 4HBNA 4NN0A 1ND3B 1VBB1 5FMOL 2A73B 2X8KA 3EYPA 4GB32 3NMBA 1CX4A 3MIBA 4E8CA 2XDVA 4CDQA 4JVAA 4RYDA 2PHUA 4N53A 2OW4A 3ZXDA 1CAVB 3Q8FA 4CCCA 3S0MA 3RYRA 2CWSA 2BYVE 2VNVA 3HOBA 3M3QA 1K12A 4QXKA 3I2GA 1E5HA 1O8PA 1EV11 4HG6B 1YQ5A 4A45A 5A6ZA 4YVWB 2JD4A 1RHI2 1WW6A 4PBPA 1VR3A 4Z07A 1GANA 1R091 3JBG1 4XBQA 1YQ6A 5FLJA 4PCRA 1AR63 1JYXA 4CEWC 3NW4A 4Z82A 3WCSA 3AJZA 3POSA 5FUIA 3GNEA 2O8QA 4IE6A 1NCQC 2CWMA 2DDUA 2PHLA 3NNGA 3CF6E 3EMRA 4LHNA 4OUSA 3RWKX 1OPMA 2IXLA 5FP3A 4GB31 4M3CB 4R9BA 3J8F1 3WY6A 3ILNA 2D44A 2JDAA 2P2KA 3H0OA 4GKYA 4DOUA 2IXJA 4E2QA 3RZHA 2ILMA 2P5BA 3VD7A 2QZ2A 1ULOA 5FPVA 1K5MC 4C0HA 3N7LA 1UZVA 1ZREA 1VMJA 1D2QA 4FTSA 5JCTA 4AI0A 2RVAA 2VZPA 2ZMLA 4FVVA 5ERLA 1HW5A 3ZXEA 1NOVA 2H6CA 4YGEA 5IUQA 1LOEA 4LJHA 4Q0SA 3GALA
chains in the Genus database with same CATH topology
4OMKA 3P7ZA 5LZ6A 3B7ZA 3W68A 4CJ6A 1OLMA 3HY5A 4J7QA 4FMMA 4CIZA 1O6UA 2D4QA 1OIZA 4UYBA 4M8ZA 2E2XA 3W67A 3PG7A 3PEGA 3B7QA 1AUAA 4OMJA 1R5LA 3Q8GA 3HX3A 4TLGA 3B7NA 1OIPA 3B74A 4J7PA 1OLME
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OMK A;  3P7Z A;  5LZ6 A;  3B7Z A;  3W68 A;  4CJ6 A;  1OLM A;  3HY5 A;  4J7Q A;  4FMM A;  4CIZ A;  1O6U A;  2D4Q A;  1OIZ A;  4UYB A;  4M8Z A;  2E2X A;  3W67 A;  3PG7 A;  3PEG A;  3B7Q A;  1AUA A;  4OMJ A;  1R5L A;  3Q8G A;  3HX3 A;  4TLG A;  3B7N A;  1OIP A;  3B74 A;  4J7P A;  1OLM E; 
#chains in the Genus database with same CATH topology
 3N9Q A;  2WS9 2;  5FY9 A;  2FMY A;  4Z92 B;  3KV4 A;  2JDP A;  2WAB A;  2LW8 A;  4Q2F A;  5BNQ A;  1NCQ A;  3OYW A;  1GOH A;  2DUR A;  4LBJ A;  5C7G A;  1TQ5 A;  4UFH A;  5GM0 A;  3VZL A;  4BXF A;  3FBM A;  1GLH A;  2NMO A;  5JOX A;  3FE5 A;  1MVQ A;  2WKK A;  3JB8 A;  2R30 A;  3H7J A;  2B5H A;  2WNE A;  2JD9 A;  5DN2 A;  5L7O B;  2W94 A;  2ARX A;  3JXS A;  3PUH A;  1PGS A;  4FSJ A;  1AR8 2;  2QQU A;  3C7O A;  1W0P A;  2XGX A;  1ASJ 1;  2HWB 2;  1DGR N;  1H1A A;  1K5M A;  2YMZ A;  3IT8 A;  4JDO A;  2WFF 3;  4Y20 B;  4RA0 A;  3MIG A;  2N7G A;  5G04 L;  1DHK B;  4NHM A;  5BNP B;  1OD5 A;  1OMI A;  4COY A;  3AKQ A;  3AFK A;  1LOF C;  2GN7 A;  4XE9 A;  1X50 A;  1DFQ A;  3HR9 A;  3L2Y A;  2A5Z A;  3PUI A;  4GAL A;  2NQY A;  5T54 A;  3KLS A;  2WS9 1;  1RIN A;  1AJO A;  2EID A;  5LW9 A;  1PX4 A;  2IXI A;  1RXF A;  4BK5 A;  1ND3 C;  2F17 A;  2VXJ A;  4JTO A;  3W58 A;  4N8M A;  4QX1 A;  2PN5 A;  3IB3 A;  1PO2 2;  2QQN A;  2F4L A;  3K3O A;  4LK6 A;  2JKX A;  3EO6 A;  4QM9 A;  1JYI A;  3CU7 A;  5G05 L;  3T0A A;  1UZZ A;  3KQR A;  1CD3 G;  3I49 A;  1AR8 1;  4CP1 A;  3A0K A;  2WL1 A;  3O0X A;  3JQX A;  4C1X A;  2QQK A;  4B7K A;  3D82 A;  3QAC A;  4YVW C;  1J84 A;  4W8J A;  2OS2 A;  2BFU L;  3LPG A;  3U4S A;  5JUV A;  1ACC A;  3HT1 A;  4HZF A;  2DBN A;  3WV6 A;  4HN1 A;  1RUI 3;  4UFI A;  1LOF A;  2K2S A;  4N9I A;  2HEY F;  3VHR A;  1MQT B;  2MPF A;  4UT5 A;  3WR0 A;  2VZR A;  3DEC A;  4AI9 A;  2Z4F A;  3CBN A;  3FLT A;  1XYN A;  4UBH A;  3IPV A;  1V6J A;  4LE3 A;  1C8M 3;  1ND3 A;  1OA3 A;  1UY2 A;  1VBD 3;  3KGZ A;  2Q8C A;  3RYK A;  3RWN A;  3IAQ A;  4PIZ A;  5IK8 A;  3WUC A;  3WQ0 A;  3S5Q A;  1ZBA 2;  3ST7 A;  2ZAC A;  5A1L A;  4AI8 A;  2C0Z A;  4AOC A;  1F2N A;  1CAV A;  2ZMN A;  4B4P A;  4I0B A;  4NVP A;  1PGW 1;  1PM4 A;  3EQE A;  2RDQ A;  4P9Y A;  4XEZ A;  4AEM A;  4RS5 B;  3U37 A;  1GIC A;  2DF7 A;  5KHH A;  3SEP A;  5FYH A;  4OI0 A;  1NE6 A;  1JXN A;  1SPP B;  2HEW F;  4UOJ A;  3QD6 A;  3T4V A;  4UXA A;  3MW2 A;  1OF3 A;  2C9A A;  2J1V A;  3K4A A;  1BCX A;  4YG3 A;  1KJR A;  1UY0 A;  5F9T A;  3POG A;  2ARB A;  4JV4 A;  1TG7 A;  2XVG A;  3BOD A;  2P17 A;  4ZZ5 A;  1C28 A;  1YUD A;  2YV8 A;  3A21 A;  3DKQ A;  5J37 A;  5FZC A;  2WQ4 A;  2WO2 A;  3NNJ A;  4TWT A;  3EB7 A;  4YFW A;  1NLQ A;  2JWP A;  3OGJ A;  3VKO A;  1MS1 A;  3W5M A;  4B8E A;  1RUE 3;  1GBG A;  5FR3 A;  1GV9 A;  3V65 A;  4BQ2 A;  2LRO A;  4M3C A;  1C57 A;  2Y38 A;  4RQP A;  4JX0 A;  2FDI A;  1MS9 A;  1ZRI A;  4KU8 A;  2BBA A;  5L7O C;  4GWJ A;  4XXP A;  4YPJ A;  4MV2 A;  4YRD A;  1D0G A;  2QDN A;  3LOI A;  4NHL A;  5ACA 2;  1STM A;  1VBC 3;  5FOJ B;  3RMY A;  3N36 A;  1YJK A;  4S2D A;  5IVE A;  2R04 3;  5HXV A;  4AK3 A;  2E53 A;  5A6Q A;  5BNP C;  4EE2 A;  5EV7 A;  5LBC A;  2OQ6 A;  3RFR A;  5BYN A;  1WWY A;  3R4D B;  4AE2 A;  1NZI A;  4CCK A;  4KBZ A;  4LBN A;  4GIQ A;  1EP0 A;  3CKH A;  2WLP A;  2WZE A;  3FHI B;  2WBK A;  5DDJ 2;  3HMY A;  3ZDS A;  1CX1 A;  4BDV B;  4XHB A;  2BRT A;  1PVC 2;  1O5L A;  4ZXK A;  2VM9 A;  3HPN A;  5A3U A;  3VD3 A;  3NAP B;  1GWL A;  5F37 A;  2E7A A;  2PHW A;  5L7O A;  4DRV A;  3SH4 A;  2RS1 3;  1RUG 1;  5D2A A;  5KBF A;  3LDB A;  5J09 A;  4B7E A;  3SIS A;  3E5Q A;  4AI2 A;  2W08 A;  1YFW A;  2O1Q A;  3DCQ A;  3KCC A;  4IW3 A;  3AB0 A;  1KRI A;  3MIC A;  3BTA A;  1LTE A;  4Y20 A;  4I2O A;  1IZ3 A;  4N9H A;  4OI1 A;  2X10 A;  5FTT C;  3N9P A;  5BNP A;  3OD0 A;  5FZE A;  2VCB A;  1CN1 A;  1AF9 A;  1UMH A;  3PMS A;  5IT6 A;  2W1Q A;  4ZPI A;  2IVJ A;  1RED A;  2JIC A;  3CO2 A;  1J58 A;  4YW6 A;  1MQT C;  3SC7 X;  3T2P A;  4BH9 A;  5C3P A;  4HN0 A;  4KG0 A;  2O8O A;  5DDJ 1;  1W8F A;  1VB2 A;  5E89 A;  3KV5 A;  4K8F A;  4KBB A;  1YI9 A;  5F3C A;  4D6S A;  1PVC 1;  2CAU A;  2UYA A;  2J22 A;  1BK0 A;  3AL6 A;  1WA6 X;  1BHG A;  4GKX A;  3AMM A;  4A3X A;  1JU3 A;  3BAL A;  2FCV A;  3W5N A;  3CDZ B;  3HQX A;  1OLM A;  3NJV A;  4MYE A;  5HV0 A;  5J3U A;  4WZC A;  3MUZ 1;  5FO8 B;  5B2G B;  1LEN A;  4KGQ A;  1HDK A;  1HJG A;  4RS5 C;  3FLP A;  4YM1 A;  4RD7 A;  2GZW A;  4IEO A;  5EYX A;  1D7P M;  2OUJ A;  4NHK A;  1Z7S 3;  1LED A;  1VMF A;  1ZVF A;  2ADE A;  1QJF A;  1VAK A;  4U36 A;  2A6W A;  4XOG A;  4COZ A;  2E2X A;  1SLB A;  1TMF 3;  4XFG A;  3ZXK A;  2VNG A;  1Y43 B;  1MQT A;  4JHZ A;  3RNS A;  2GME A;  4DEV A;  4Q8K A;  5JOY A;  4LA2 A;  4MGQ A;  1UKR A;  2YFZ A;  1JOJ A;  2QQL A;  1RUH 2;  3KT4 A;  4A6S A;  3N7K A;  4URA A;  2WZ8 A;  2J1A A;  4HVO A;  5DUU A;  4QKD A;  2VAU A;  2VJX A;  5JXH A;  2VG9 A;  4CDX B;  3GHN A;  4LHK A;  4JQR A;  2QZ3 A;  1AXZ A;  4QHO A;  4YZ4 A;  2HYX A;  5K7P A;  4PLO A;  4UWD A;  1A3K A;  4RS5 A;  1XJA A;  2XL7 A;  4XCB A;  1E57 A;  1W3V A;  1SPP A;  1YWK A;  3AYD A;  5JSR A;  4NIH A;  3N9N A;  4XF4 A;  3B02 A;  5F5A A;  1EUU A;  2YBS A;  1UY1 A;  4LBQ B;  1S0J A;  1GU3 A;  5FPA A;  3FWE A;  4NE9 A;  2JDY A;  5HXM A;  5LCW L;  1SCR A;  1JU4 A;  1S2E A;  3FL7 A;  1LHW A;  4IES A;  1FPN 1;  2UWC A;  5T5J A;  3BYW A;  3ZXL A;  1RUH 1;  2WFP A;  4QGM A;  4XIK A;  5FCC A;  5FP8 A;  3C7H A;  2XQX A;  3B9I A;  3ZXJ A;  2E51 A;  4O65 A;  5DUW A;  2GNT A;  3KMH A;  3SNM A;  2HWE 1;  1XE7 A;  3NAP C;  3BKZ A;  5DXD A;  5AC9 3;  2FZ2 A;  1X36 A;  3LKJ A;  2O14 A;  3P6B A;  4LIU A;  3WVJ A;  1AL2 2;  1D4M 3;  2D6N A;  2Y60 A;  2WR9 A;  5FMB A;  2W3J A;  3USS A;  4AQT A;  3LQC A;  3ZYB A;  1N1S A;  3WIN E;  5EJZ B;  1UXX X;  5H9S A;  2PHF A;  2E33 A;  4XZU G;  1LOA A;  2CL2 A;  2G19 A;  1NLS A;  4LMF A;  4DXR A;  5KHJ A;  2PEL A;  4XAE A;  1QY4 A;  3NJZ A;  2SLI A;  5FZO B;  3CZJ A;  5FO9 B;  3JCI A;  2B8M A;  1V6O A;  2W1S A;  4J25 A;  4A41 A;  1FMD 3;  3KZ4 C;  4DIQ A;  4MOA A;  2HYK A;  5I8Y A;  4GMP 1;  2ZHN A;  5CKQ A;  5FYI A;  1YFU A;  1H2L A;  1AHS A;  3MHZ A;  4C91 A;  1QJX 2;  3LPF A;  1U5X A;  1CIW A;  4XJ9 A;  4XJ8 A;  1VBE 1;  3E6B A;  3VD9 A;  3NAP A;  1Q43 A;  2IXH A;  1O3Q A;  2ZAB A;  4PBO A;  4CTE A;  3I3B A;  1ZBE 3;  1WLW A;  5FZH A;  4CEY B;  3P3N A;  5LA0 A;  2YC4 A;  1JS9 A;  2AEN A;  4GWM A;  3BTY A;  4WZF A;  4PI2 A;  3VD5 A;  2Q1F A;  3HBK A;  1WW5 A;  1UYZ A;  3K4D A;  1HB2 A;  2RS5 3;  1RMU 2;  1X8E A;  3CZU A;  3PTY A;  1G9B A;  1W6O B;  4Y5Z 0;  3ZIW A;  5LAS A;  2D5H A;  4DPN A;  3SQO A;  5BV6 A;  3PHM A;  1V6M A;  2JDN A;  1X7N A;  4UW3 A;  4LBM A;  3WNN A;  4AQ6 A;  5DAX A;  1E5I A;  3WP3 A;  2W68 A;  4AHX A;  4Y1V A;  4ONU A;  3TB0 A;  2G1M A;  5J36 A;  1H2N A;  1RUF 1;  2IZW A;  1S2K A;  4IE0 A;  2DTW A;  4P9J A;  2C9K A;  4AED B;  3R4S A;  3WNO A;  2DYC A;  1LOG A;  2A6V A;  2OPW A;  2ZGR A;  3PNA A;  4CDX C;  4NHY A;  3GJB A;  4GD4 A;  1NE4 A;  1GNY A;  3FFQ A;  4UAP A;  1JHN A;  1EUT A;  1PIV 2;  1YYN A;  3JD7 2;  1OVP A;  2C26 A;  2RR1 2;  5FKC A;  3KV6 A;  3MIH A;  5LWB A;  4CU6 A;  2XL9 A;  3AZV A;  1MZ6 A;  5A7S A;  4OHY A;  2DCK A;  4M00 A;  5FYZ A;  4Y1Y A;  1DGW A;  5CAD A;  2XJS A;  5LRS A;  1V6I A;  4NAM A;  3WD5 A;  3H8U A;  4NRM A;  4J7Q A;  1CAU B;  4QDQ A;  1I3H A;  5EP9 A;  3E5U A;  4LLO A;  2AAC A;  2Z42 A;  2XKO A;  2XML A;  2DU1 A;  1KS5 A;  1OOP B;  4ORF A;  1RXG A;  2Q8E A;  5CZK A;  2LRP A;  2DVG A;  4CCN A;  1VAV A;  3MLJ A;  2DWR A;  1XOY A;  5AVA A;  2ATF A;  1H4H A;  4CDX A;  2AUY A;  4DEQ A;  2NPI A;  2FBE A;  2GC1 A;  4AXO A;  1BBT 2;  2WQ8 A;  1UN1 A;  3AP5 A;  2XUM A;  4XJU A;  1LHV A;  3RZK A;  1Q8Q A;  3A0N A;  1F15 A;  5FMC A;  3ZSJ A;  1W05 A;  2WO1 A;  4EN7 B;  4F7Z A;  3MFC A;  3DF0 A;  5A7Q A;  4CVU A;  3HNM A;  1F4A A;  5CIR A;  2HWD 3;  5GKA C;  5LBE A;  4YSF A;  4XIO A;  1LOB A;  1W28 A;  4LOT A;  2FMD A;  4L99 A;  1AJK A;  1S1A A;  2VMG A;  3WEZ A;  3AKT A;  4LBQ A;  3ZYJ B;  1JYW A;  1S4C A;  1F5J A;  3RPQ A;  2BV4 A;  1GZW B;  4GWI A;  4Q0Q A;  4X8P A;  1BZW A;  2B9V A;  2BVB A;  4JZR A;  4FQ4 A;  4EN9 B;  1S0E A;  1OVS A;  1RUD 2;  2C6S A;  4HSJ A;  3HN1 A;  5CFD B;  4QKF A;  2B7Y A;  4E2G A;  5GZG A;  3POI A;  1BBT 1;  1AXY A;  2DV9 A;  5JR2 A;  4ZON A;  3SCF A;  3WP5 A;  2EIE A;  4CCE A;  2RM2 3;  3B7Z A;  4S2G A;  2WA4 A;  1ZX5 A;  2VZT A;  4JAA A;  5KXC A;  3UV9 A;  2PA7 A;  5FMO S;  4LBQ D;  1WGP A;  3HJR A;  2VTX J;  3WDW A;  2GMM A;  1HX6 A;  4O7X A;  1LOC A;  4MO3 M;  4R9A A;  1FI2 A;  4XC9 A;  1RUJ 3;  1Z0H A;  2Y64 A;  5EYY A;  5BNO A;  2BNO A;  5FZO A;  3OGG A;  4HXC A;  3S7I A;  2F6B A;  4GUL A;  1HLC A;  4RR3 B;  4D7S A;  4HT1 T;  3WCR A;  1E5S A;  3WG2 A;  5CIS A;  3AP6 A;  1JYN A;  1AR6 1;  2K9Z A;  4AED C;  2BGP A;  3AKP A;  2FZ1 A;  3P3P A;  2AR6 A;  1W6N B;  2UUR A;  3T09 A;  1OI6 A;  1COV 2;  1GR3 A;  2QFE A;  4ARX A;  3MFA A;  2EAK A;  1AYM 2;  4XDO A;  5DZE A;  3MZH A;  4CJ6 A;  1L7L A;  3E97 A;  2Y0O A;  3LIH A;  4V2V A;  1OXC A;  2G9F A;  1SG3 A;  3T0D A;  3LEI A;  3TBD A;  4QB1 A;  5FZI A;  1DQ4 A;  4FMM A;  4FTB A;  4DZG A;  1GMM A;  1W6O A;  1QOO A;  2ARE A;  3NRU A;  4B3N A;  1O8S A;  4R9C A;  5DAP A;  5IVY A;  1RJ7 A;  4E4H A;  4OI4 A;  2PHR A;  3VBF B;  4HAN A;  4IET A;  5E6H A;  3SLI A;  4B1L A;  2Q0A A;  1S0B A;  1OQD A;  2J42 A;  5H9P A;  3WDV A;  5F6K A;  2Q30 A;  2RMU 2;  3GHM A;  5AFB A;  2BJS A;  1OOP C;  5I0U A;  1A8M A;  3RI9 A;  5FYC A;  4AGG A;  4BCU A;  4J7P A;  4N7I A;  4BA6 A;  4MGY E;  1CZS A;  4IEY A;  4AED A;  2XUE A;  4XJW A;  5T50 A;  2ZGU A;  1Q8S A;  2TNF A;  3J7H A;  3I2I A;  5I0R A;  3AVR A;  1SFY A;  3OSD A;  3H8O A;  1XB9 A;  4FP3 A;  5FFO C;  1OC1 A;  3E5X A;  3NO8 A;  2WT0 A;  2H6B A;  5A6Y A;  5FDB A;  3VKN A;  2PHD A;  2OZJ A;  2YPD A;  4QU1 A;  3SKV A;  1W8Z A;  3U14 A;  3UKT A;  3VZO A;  2JEC A;  1UO9 A;  3RI8 A;  2ZGS A;  3C7F A;  3I97 A;  3I2F A;  2RHP A;  2QQO A;  2WWU A;  3A4U A;  1LHN A;  2AC1 A;  2WFF 1;  3K75 B;  2VMC A;  1CAU A;  1U5I A;  4KWL A;  1FV3 A;  4K20 A;  3DEM A;  4LBL A;  4Q27 A;  4XAB A;  2J1S A;  4RHV 2;  4NHX A;  2ORX A;  5E8A A;  4AF9 A;  3OBA A;  5FJK A;  4CP9 B;  3GGL A;  1OOP A;  4LIV A;  3P7Z A;  3RZZ A;  4AGR A;  4UBG A;  4AVT A;  5LZ6 A;  3M3O A;  5E88 A;  3TEW A;  1N1Y A;  3IDE A;  3RZM A;  3I3D A;  5F3G A;  2BZD A;  4BWO A;  1FOD 2;  1UL9 A;  3VBS B;  4F3J A;  4FOY A;  3TNP B;  5CFD C;  3HQR A;  1H2K A;  2PFW A;  1E5R A;  3VLB B;  4I01 A;  2GNB A;  2E9Q A;  2W9X A;  3OG2 A;  2DBI A;  2G4I A;  2R07 2;  4LKF A;  1JOB A;  4OUL A;  5FPX A;  4AFA A;  3GJA A;  1UPS A;  5JXI A;  4M3C E;  3WG3 A;  4L0P A;  1XSR A;  1DYO A;  1MZF A;  1AR7 3;  4BXS V;  2YGL A;  1H9W A;  3ZYP A;  4FO9 A;  2WT2 A;  4JHT A;  2XJP A;  4ZS2 A;  4QKB A;  4EWA A;  3EBR A;  4OUE A;  4BQY A;  4C1W A;  1ULD A;  2EAA A;  2HWF 3;  4JRA A;  3H42 B;  1V9U 2;  3KF5 A;  4RHV 1;  4RR3 C;  4XAC A;  3CQO A;  1GZW A;  4B1M A;  1VP6 A;  1QU0 A;  3DYM A;  1ENQ A;  4AVB A;  1ZRR A;  5J98 B;  2P6C A;  4CE8 A;  1FOD 1;  1QNW A;  5CFD A;  5T52 A;  3OPW A;  1C8M 1;  3OJB A;  1VBD 1;  2WNV B;  1GP5 A;  5A6X A;  5FZ7 A;  3S7E A;  3TN9 2;  2GP3 A;  1ENS A;  2QTW B;  3HIF A;  2BTV C;  3BOW A;  4GXL A;  5EHD A;  2J1T A;  2DU0 A;  2CNA A;  3CNA A;  4JKK A;  5A7N A;  2B46 X;  1UOF A;  3AYC A;  1YEW A;  4OLL A;  4TSV A;  3D6E A;  4IXL A;  1VBB 2;  2D6L X;  4QDR A;  3VL9 A;  1M06 G;  1RUO A;  3VBF C;  3ETQ A;  3ATG A;  2UY9 A;  3K46 A;  1GOG A;  2WRA A;  2Y26 A;  3V0A B;  3GM8 A;  1F4H A;  2VUD A;  1ZA7 A;  4QGN A;  3ZYH A;  5ISL A;  4K21 A;  3J26 N;  5F8P A;  4RR3 A;  1DZQ A;  1JH5 A;  3H1M A;  4AQ2 A;  1DQ6 A;  5J7M A;  4IE7 A;  4JGY B;  4OQ9 A;  2WWJ A;  3E6D A;  1LGB A;  1QOT A;  1DYP A;  5IK5 A;  4MSV A;  3NST A;  3ES4 A;  1EV1 2;  3WHU A;  5IVJ A;  2CV6 A;  4CU7 A;  5C3Q A;  1W6N A;  2R0F A;  3VHN A;  1R09 2;  4YG0 A;  3JBG 2;  1RUE 1;  3N35 A;  3AM2 A;  4XXA A;  1AUA A;  4OHX A;  5GLZ A;  3VDA A;  3SKJ E;  5JSO A;  5J1X A;  2UYB A;  1W90 A;  3IPV B;  5F2S A;  3ILF A;  1RJ8 A;  4ZXE A;  1OLM E;  3PUS A;  1ZA4 A;  4IEQ A;  3WNX A;  5CB7 A;  4Q4X 3;  2WYS A;  3DUI A;  1LCL A;  1CVN A;  1VBC 1;  3VBF A;  1HN0 A;  3TEX A;  2VVD A;  3J8F 2;  1YHF A;  3L2H A;  1IQA A;  1OH3 A;  4UFJ A;  1WA4 A;  2R04 1;  2FQP A;  3JZV A;  3MYX A;  2VNR A;  5FBZ A;  5GAL A;  3N9O A;  4O61 A;  4EWE A;  3BIE A;  1ZM1 A;  1IS5 A;  3W9A A;  4MG2 A;  3IAP A;  5C5U A;  3RS6 A;  1LEM A;  3MPB A;  5FZK A;  3LE0 A;  3VBS C;  1BVP 1;  3V0B B;  3MW3 A;  5JLV A;  3AFG A;  1CAW B;  5LA2 A;  3RG0 A;  3PU8 A;  1H8V A;  1PVX A;  2I45 A;  5IAT A;  3RJR A;  2R1B A;  1JI6 A;  4LO6 B;  1K45 A;  4MGT A;  4Z1V A;  4AFD A;  2ARC A;  3AC0 A;  2DUP A;  2RS1 1;  4WVM B;  5GLT A;  3LA2 A;  1CGP A;  2W87 A;  3BUC A;  2R49 A;  5DG1 A;  1YIP A;  3WW3 A;  4XCA A;  4D6R A;  5JZG B;  3KHC A;  3FX3 A;  2JDK A;  5JWP A;  2IUW A;  2AYH A;  4ET7 A;  4FT8 A;  4GA9 A;  1QJY 3;  4FP2 A;  4IDZ A;  2UY8 A;  4QQO A;  4RQP B;  1YC6 1;  4I3P A;  4Y1Z A;  2ZEZ A;  3RQ0 A;  2HWC 3;  3OBR A;  1MS4 A;  4QXB A;  2B4K A;  2EVX A;  3AVS A;  1Q8P A;  5FY1 A;  4CP9 A;  1ASJ 2;  1GNZ A;  2WT1 A;  1CPM A;  2D5F A;  4BIF A;  4BK4 A;  3LF7 A;  5FYT A;  4L2N A;  3VBS A;  5LK7 B;  4XMA A;  1IS4 A;  4LPL A;  4I02 A;  4PI0 A;  5ANQ A;  4QDS A;  4ATE A;  3RSJ A;  2Y0I A;  2I74 A;  1J3R A;  2QNK A;  1W99 A;  2TBV A;  2WNV C;  4R4Z A;  5IHR A;  3JQW A;  5FQ0 B;  3AMN A;  4SBV A;  4TYS A;  5H9Q A;  3HAG A;  5FXX A;  4HFS A;  4G3Y C;  4AFC A;  1VIW B;  3J7N A;  4A7K A;  3H8R A;  4C8D A;  5GLV A;  1I1E A;  4FXG B;  3ZYR A;  1VPH A;  1N1T A;  1RUC 3;  2JG8 B;  1RVF 3;  2VUA A;  3RDI A;  1BEV 3;  1HQL A;  3ZSE A;  1QEX A;  2ZMK A;  1YI7 A;  1UYP A;  2X53 S;  4X6R B;  1D0H A;  2D43 A;  4CUA A;  4NRO A;  1UIK A;  5F32 A;  3LA7 A;  5EPA A;  1EAH 3;  1WZX A;  1O7F A;  3H1W A;  4FFI A;  4JGY C;  1TMF 1;  2BWA A;  2VME A;  5KHI A;  3VKM A;  3WF4 A;  4IND A;  3FZ3 A;  4K1Y A;  4MXV A;  4Y3O A;  1JUH A;  1DLC A;  2ZX4 A;  5T5P A;  5IWF A;  4Q4W 3;  2P4E A;  2WNV A;  5A7O A;  1LU2 A;  1NAE A;  1R1Z A;  1GWK A;  2XBO 3;  2Q4S A;  4YW2 A;  4RGK A;  4YW4 A;  1QJU 2;  3IBM A;  4ES9 A;  3OBZ A;  3V64 A;  4QQH A;  1HXS 2;  3MEP A;  5JVV A;  5EIY B;  4IE4 A;  1NXM A;  4OFG A;  1R64 A;  5FK7 A;  3ZKU A;  2A7A A;  3Q8C A;  1FNZ A;  5A3O A;  1US2 A;  1UWW A;  2OQ7 A;  3SH5 A;  1R1A 3;  3UL2 A;  1G7Y A;  5L9R A;  4MGK E;  2R16 A;  3TNQ A;  3V0A A;  3IDC B;  4H55 A;  3T2T A;  4LXL A;  4AI3 A;  1AX2 A;  3UGH A;  3WQB A;  1LKN A;  1PGW 2;  2RS3 3;  1XNT A;  5LY2 A;  3QOP A;  1XPW A;  4JGY A;  5EZW A;  4M3C F;  3UGG A;  3QBQ A;  1JOD A;  1K3I A;  1TE1 B;  2YRO A;  3NV3 A;  5TSW A;  3VKL A;  3LWC A;  4BQX A;  3T30 A;  2GC0 A;  1WME A;  5FY4 A;  3ZSK A;  4QX7 A;  2YU2 A;  3HWJ A;  1YNA A;  4V2W A;  4XTP A;  3T1M A;  3ABZ A;  4YW3 A;  5F1R A;  3POF A;  1QJU 1;  5AC9 1;  1TME 3;  1UYY A;  1QQP 3;  1HXS 1;  5JAX A;  3I59 B;  1VRH 3;  1D4M 1;  5F3I A;  1KDM A;  1W2N A;  4OHV A;  1UOJ A;  5JZG C;  2ZHK A;  3ZR6 A;  1NG0 A;  5K4L A;  1TNF A;  1POV 3;  3WP4 A;  4RQP C;  3VDC A;  3B7Q A;  5LA9 A;  2DVD A;  1X9P A;  1MVE A;  4M4R A;  1UXZ A;  1RIT A;  5A32 B;  3T2O A;  4YGD A;  4Q5O A;  1CIY A;  1HRI 3;  1NUK A;  2JE8 A;  2A71 A;  4BHP A;  1HRV 3;  2RG4 A;  4NPM A;  3WF1 A;  4RFR B;  1HB3 A;  5A3M A;  1HB4 A;  2IXK A;  3D0J A;  1FMD 1;  1DQ2 A;  3POW A;  3V0B A;  2WZR 3;  4G4F A;  1YJL A;  4ZHN A;  1VAL A;  1XE8 A;  2ZX1 A;  4MGS A;  1V70 A;  5FAX A;  4Z8B A;  1CAW A;  5IFP A;  2W39 A;  1KQR A;  4ASK A;  3LAG A;  1OT5 A;  2JJ6 A;  4LEJ A;  1DLL A;  2LAL A;  4DXS A;  5HCF A;  4XW3 A;  2GSY A;  5GLW A;  4YZ2 A;  2ETE A;  2V5D A;  1GOF A;  1AR9 3;  1SLL A;  4WVM A;  1KFU L;  2LM3 A;  3MLK A;  1ZBE 1;  3PUA A;  2WNO A;  3AXE A;  3WNL A;  5JZG A;  4JDN A;  5KC6 A;  3Q8G A;  2JG8 C;  4IGQ A;  1WCS A;  4JC1 A;  2MEV 3;  3AX4 A;  3ZN6 B;  1DQ1 A;  2RS5 1;  4CYD A;  5FY7 A;  2V73 A;  4Q4Y 3;  2P3K A;  5BY5 A;  2DCZ A;  3AYA A;  3VV1 A;  5JR7 B;  1RUG 2;  4DY5 A;  2Z2S B;  4BLJ A;  3KS7 A;  4CP2 A;  5GLU A;  1I6X A;  1LRH A;  1I9R A;  2HJI A;  1PZ9 A;  3TAY A;  5A7W B;  4FPY A;  4FXK B;  1W8W A;  1XQN A;  3TRS B;  1N47 A;  3OCP A;  5HV4 A;  4CU8 A;  2JB8 A;  3T1L A;  4PJY A;  4LO4 B;  4QPI B;  1DGL A;  5FQ0 A;  1GFF 2;  2R1D A;  4M01 A;  4BQ3 A;  2YGM A;  4CXX A;  4UI9 L;  4EN0 A;  3OB8 A;  5LA1 A;  1OA4 A;  1NY7 2;  4JRL A;  2GU9 A;  4LKD A;  3JU9 A;  1VBA 2;  3HT2 A;  5JXJ A;  2JG8 A;  4Q0P A;  5FMD A;  1GQP A;  1UW8 A;  4WM7 B;  4XET A;  2HWD 2;  1RB8 G;  5APA A;  3BOP A;  1UIJ A;  2VW1 A;  1HB1 A;  4QB2 A;  4CU9 A;  4LOR A;  1QXP A;  1T6B X;  1GYK A;  3G7D A;  2B9U A;  4OMC A;  3TWI A;  1HQW A;  3VDB A;  5IVC A;  1SMV A;  3IDB B;  1SLT A;  1N1V A;  2DVA A;  2JIG A;  2KXL A;  1AL0 G;  1WD3 A;  4R4X A;  4HLT A;  2FD8 A;  1V0A A;  2R06 3;  3LEM A;  5FYB A;  1JBC A;  3LFI A;  4YGC A;  4Y1U A;  4Z2W A;  1NY7 1;  3MV0 1;  1JZ7 A;  3VUO A;  3BU0 A;  1VBA 1;  4FBF A;  1POV 0;  2RM2 2;  2WZP P;  3VZM A;  3E1F 1;  4PDW A;  2WYF A;  3VGI A;  5GZC A;  2BDR A;  4XJA A;  1W8T A;  3WHT A;  3UT0 A;  1G86 A;  2A1X A;  2VQA A;  4UFL A;  2HWD 1;  4BE3 A;  3GDB A;  5FP4 A;  1CJD A;  1XYP A;  5FLI A;  1PX3 A;  1TNR A;  3DKW A;  4DS0 A;  4YFZ A;  5FO7 B;  4CZS A;  4P5H A;  1AUY A;  1ND2 A;  2LS6 A;  1W2O A;  4TTG A;  2VL4 A;  2A70 A;  1DF0 A;  1DQ5 A;  2AZ5 A;  2VZ1 A;  2VMF A;  1XU2 A;  4OUM A;  4YW5 A;  4DIN B;  1ULG A;  3OUH A;  3EXU A;  1QDC A;  4GQ7 A;  1LEC A;  4MH0 E;  1OIZ A;  1RHI 3;  3WSO A;  3AZW A;  4GH4 B;  2A3X A;  4FFF A;  2QQM A;  4FFG A;  2ET7 A;  5CG9 A;  1HN1 A;  2XJT A;  3W21 A;  4IEU A;  3PJQ A;  5FZ0 A;  1XNC A;  1FPN 2;  2D3P A;  5FP7 A;  4DNY A;  1NLR A;  4K3U A;  1RGS A;  2RM2 1;  3I59 A;  4BPZ A;  2VTX A;  1NA1 B;  2D93 A;  3F2Z A;  1W6M A;  2YXS A;  5A80 A;  4D3W A;  3LEK A;  2DUQ A;  2JXA A;  4H14 A;  4A2U A;  2HWE 2;  1ODM A;  1W9F A;  4H2A A;  4ASM B;  4HOO A;  3ZIX A;  4HL0 A;  5A32 A;  1QGL A;  1XYO A;  1Y7B A;  1A34 A;  3IDA A;  1RUJ 1;  2FDJ A;  3WDU A;  1XBF A;  4YZ3 A;  1DP0 A;  2KD7 A;  1RL3 A;  3VBO B;  1WMD A;  3DPR A;  1BK1 A;  3DXT A;  4FPG A;  4P08 A;  4QPI C;  4MUV A;  4YLZ A;  4COV A;  1A8D A;  3RYP A;  4CSW A;  3B94 A;  1YFY A;  4HVQ A;  1ONA A;  5I0D A;  4Q1P A;  2X09 A;  2XQR A;  1AX0 A;  5CAZ A;  4CCO A;  4SLI A;  3M2M A;  5DZG A;  5A3L A;  1CES A;  1ENX A;  2YY1 A;  4MZU A;  2RDN A;  3RMX A;  3ZN6 A;  1VBE 2;  4MXW B;  3S30 A;  3MDP A;  3M1H A;  4WM7 C;  4YM0 A;  2D6M A;  2ZX0 A;  5SV8 A;  1VRB A;  2QQJ A;  1QDO A;  4NO4 A;  4JCK A;  4UYB A;  1NQJ A;  1F9K A;  2WO3 A;  5JSP A;  1IS3 A;  2WLQ A;  4AFM A;  4Y5S A;  5A7W A;  2GH2 A;  2HWB 3;  3HX3 A;  5C3S A;  4XTM A;  3WLU A;  3OPT A;  2YUE A;  3GBW A;  4IER A;  2VGD A;  4A3Z A;  4QU2 A;  1EY2 A;  1R08 3;  1URX A;  4DO0 A;  4QPI A;  5BNO B;  3POY A;  2EXH A;  4XYX A;  1ZZB A;  1KD7 A;  2PAE A;  5F5C A;  2B45 X;  1UOG A;  4NRP A;  5I91 A;  2MNG A;  3MV1 1;  1JTZ X;  1RUF 2;  5L9B A;  3USU B;  2XWJ B;  3ETP A;  3WDX A;  2X29 A;  1FAT A;  1ULP A;  3APB A;  3N9L A;  1W2T A;  1PO2 3;  4TXW A;  3WNM A;  2WSU A;  2BGC A;  3ACF A;  4ITC A;  2TEP A;  3OUI A;  4ISR A;  4WM7 A;  5A33 B;  4WVW A;  4L9B A;  5EWS A;  5AVP A;  4BYY A;  4CCD A;  1AR7 2;  4XDP A;  1BYH A;  1NKG A;  4ZZ8 A;  4XUR A;  4FPF A;  4AHZ A;  4W6X A;  5F7U A;  3PU3 A;  2NYY A;  4LHS A;  3HEI A;  3J9S A;  3BU7 A;  2HWF 2;  2VOW A;  5CNA A;  3R4U A;  5F39 A;  1VE0 A;  4NR1 A;  1DZT A;  3QH6 A;  1UU5 A;  1VJ2 A;  3AP4 A;  3THP A;  1X9T A;  4NIG A;  1EYB A;  5DG2 A;  4DB5 A;  4KMQ A;  2OPK A;  1J3P A;  2HBU A;  2KA3 A;  3TEY A;  1BJQ A;  4YZ1 A;  2ZGT A;  1NA1 C;  3GCX A;  4BQW A;  5JPN B;  2R0H A;  1OF4 A;  1PO1 2;  4ZS3 A;  1UKG A;  2PHX A;  1JYV A;  1ZBA 3;  4COU A;  3SMH A;  1XNA A;  3N9M A;  4C0B A;  3ZDV A;  5FYU A;  1AR7 1;  2NM1 A;  4YNI A;  4J1X A;  1KIT A;  4K9S A;  5GJ6 A;  5KXB A;  1W06 A;  3OPZ A;  1JHJ A;  4FQZ A;  1W3X A;  5C6C A;  3O14 A;  4ASL A;  4OMK A;  1V00 A;  1SDW A;  2WDB A;  4Q0V A;  2HWF 1;  4QAW A;  3ZXG A;  2WAA A;  3VBO C;  3ZXA C;  4MGI E;  5FK8 A;  1W2A X;  4XAA A;  1TZO A;  2GDF A;  3GBG A;  5A3P A;  4GH4 A;  3D5O A;  3KM5 A;  2VBB A;  4HKL A;  4P9X A;  5KHG A;  5IVB A;  2P3I A;  5FWE A;  1IQD C;  1B09 A;  1CAX B;  3GZE A;  3K48 A;  4UW6 A;  4F83 A;  1TEI A;  4B29 A;  2C4X A;  1T6G C;  3IKW A;  3FUQ A;  2NMN A;  1NQD A;  1BMV 2;  1M4W A;  2VCA A;  4PIX A;  3W67 A;  1NA1 A;  4MHU A;  2YZ4 A;  1PO1 1;  1L7Q A;  5FWJ A;  2P3J A;  2VNO A;  3O12 A;  5A3W A;  1GP4 A;  4GZ9 A;  4W50 A;  4FTE A;  4ZKT B;  1JZ8 A;  4QPY A;  1UOB A;  1XRU A;  3KSC A;  2R6Q A;  4Y24 A;  4KGG A;  1QKQ A;  5KWR A;  1X33 A;  3N4M A;  2E32 A;  3B3Q E;  3H3Z A;  1O4Y A;  4I0W B;  3KVA A;  5ACA 3;  3GCW A;  4MVT A;  4NJ4 A;  3B9C A;  1MS8 A;  2VC9 A;  4HET A;  2TUN A;  3VBO A;  3DYO A;  1F8V A;  4EV0 A;  2ZEY A;  3FHQ A;  5CU1 A;  4ZU7 A;  1MR5 A;  5BNO C;  4YW7 A;  2VOT A;  2YB7 A;  1WCK A;  1BMV 1;  5DDJ 3;  1R5L A;  3ZLI A;  5FZD A;  2P6H A;  1AR6 2;  1CWP A;  1HV1 A;  2IXC A;  2NZ9 A;  4LNV A;  1SCS A;  3PVO A;  2D40 A;  1PVC 3;  1WMF A;  4FPJ A;  5LY1 A;  2GC3 A;  4DXZ A;  4MXW A;  2QQI A;  4PF1 A;  2Y6G A;  2DUO A;  5FRE A;  2ET1 A;  1GQG A;  4QGL A;  4Q4X 1;  4CDW B;  4E4S A;  1XU1 A;  2GNM A;  4EZH A;  3RZJ A;  3AZZ A;  4NIA A;  3R6S A;  4BME A;  4Q1R A;  4I0A A;  4Q4V 3;  2FHR A;  2XXZ A;  2PHT A;  3M4F A;  3K4Z A;  2VBD A;  3Q8B A;  2VOV A;  4YYO A;  3WP6 A;  4LO7 A;  1QF3 A;  2XLF A;  5HBA A;  2D4Q A;  1AX1 A;  2V5Y A;  2X5I A;  3B69 A;  3N7M A;  1NZC A;  3OEA A;  4XF3 A;  3W20 A;  1Q3E A;  2XR4 A;  1CPN A;  1SLA A;  1GZT A;  2CTV A;  3GF6 A;  2W0X A;  3LSD A;  1WBL A;  5C8C B;  4LTA A;  4HSL A;  5JI9 A;  2R32 A;  4WM8 B;  3IZO A;  5IVF A;  4KU7 A;  2FCT A;  4KI5 M;  4QM8 A;  2JIJ A;  2ZX3 A;  3USU A;  2Y6H A;  3RRD A;  2QJV A;  2GH8 A;  4LBK A;  3PME A;  1OFN A;  5A33 A;  2VQU A;  4N7U A;  1PGL 1;  4IE5 A;  4ZY9 A;  4IV3 B;  3GZU C;  4UW5 A;  4XFI A;  1GWM A;  3T08 A;  1SAC A;  1QJY 1;  3BCW A;  5JOZ A;  1BEV 2;  3AKS A;  4CIZ A;  2FDK A;  2CAV A;  3FLR A;  1W8U A;  2C1F A;  3HBZ A;  2HWC 1;  2VU9 A;  2VCC A;  2WSV A;  1PHM A;  1IOA A;  4XBN A;  3THC A;  2CYF A;  1JUI A;  1Q56 A;  4HON A;  1K42 A;  3KV9 A;  1S0I A;  4M4P A;  2OUH A;  1HKD A;  1ST8 A;  2CDP A;  4HPK B;  4CUG A;  1S0D A;  5GZF A;  2WFF 2;  4Y1X A;  3O1P A;  1RUN A;  4LT5 A;  3LSE A;  1BXH A;  4MET A;  5LRR A;  5FZF A;  3DL3 A;  3O1V A;  2Z5W A;  5B4X A;  4D0Q A;  4R52 A;  4MLO A;  2YC0 A;  2RJ2 A;  3AMH A;  4EWD A;  3A7Q A;  2ZJC A;  4IL7 A;  3ME2 A;  3UJQ A;  2VZO A;  3O1O A;  4M0H A;  3MGU A;  3KHB A;  3NV4 A;  4WV8 A;  4BQ1 A;  1RUC 1;  2YPJ A;  5DZF A;  1MS0 A;  4A6O A;  1RVF 1;  2ZGK A;  5EFU A;  1BEV 1;  4DFS A;  3URF A;  4CUC A;  4DUV A;  1REF A;  2XKP A;  1AYN 3;  2RS3 2;  1EAH 1;  3M3C A;  2D98 A;  5FUP A;  4ISQ A;  3BPS A;  1OSG A;  2QQP A;  5IK7 A;  2C5D A;  5FOB B;  2EXJ A;  3O1M A;  2VR4 A;  2UWB A;  3S5A A;  1G8W A;  1CAX A;  3LDR A;  4URT A;  4FPL A;  5BUV A;  4Q4W 1;  1OQ1 A;  1GSL A;  2AGS A;  1ZRD A;  1RUI 2;  2XH6 A;  1PNG A;  4CXY A;  1DBN A;  1G9F A;  1V6N A;  2CGO A;  4D8M A;  1NXD 1;  3EJK A;  2WJS A;  4LQR A;  1C8M 2;  1U5Y A;  4PF5 A;  1VBD 2;  2HEV F;  3WX5 A;  4CDW C;  1B35 A;  5T55 A;  1C4R A;  4FOW A;  1IHM A;  3O1S A;  1AL2 3;  1R1A 1;  4AL9 A;  3HN3 A;  3CJI B;  3M3E A;  3MID A;  4CCJ A;  5KC5 A;  4KQ7 A;  2VMH A;  5CYY A;  3I3M A;  1I5Z A;  3WW1 A;  1YO8 A;  2K46 A;  4S2H A;  5FY8 A;  3UGF A;  5DUV A;  5FZ8 A;  1PMJ X;  1WCQ A;  2RS3 1;  3DN7 A;  3VZK A;  3VZN A;  1WD4 A;  4AVV A;  1ZRC A;  1BQP A;  4I09 A;  4XDQ A;  4EJR A;  3ITQ A;  1CJP A;  2E7T A;  3IMM A;  3MO4 A;  4P9W A;  5F2W A;  5C8C C;  5L9V A;  4NWW A;  1S2B A;  4WM8 C;  1RUI 1;  4L8Q A;  4IV1 B;  2LTN A;  4X8N A;  2ZHL A;  2D6P A;  1RIR A;  3M3I A;  4EN6 B;  1GQH A;  1TME 1;  1QJX 3;  5FKB A;  2BFU S;  1AR9 2;  1IPK A;  3NQH A;  3ZYI B;  1I5P A;  1VRH 1;  2P3Y A;  4NWV A;  1RUE 2;  4IV3 C;  3SHR A;  4FFH A;  4LHL A;  4CDW A;  3O0V A;  2Y6F A;  2WNU B;  1OLR A;  2MEV 2;  1POV 1;  1Q5O A;  2W95 A;  1MPX A;  2XJR A;  3K2O A;  3IN9 A;  1QMJ A;  4KG8 A;  4Q4Y 2;  2K0G A;  3LZZ A;  3MLL A;  2XVK A;  2D6K A;  3PUR A;  4Y22 A;  5KHK A;  3ACH A;  4NPR A;  5HCH A;  5E16 A;  1ODN A;  1RMU 3;  1VLN A;  1W6P A;  1HRI 1;  2Q5T A;  3AZY A;  4LK7 A;  4FI9 A;  2ZKN A;  5C3O A;  1HRV 1;  1POQ A;  1VBC 2;  3UJO A;  4YGB A;  1WW4 A;  1H30 A;  3I2H A;  2R04 2;  3KB5 A;  2WZR 1;  2XOM A;  3ZVX A;  5C8C A;  2WQZ C;  4NID A;  4U2A A;  2RJK A;  2VEC A;  4WM8 A;  2VY0 A;  2SBA A;  3KT7 A;  5C3R A;  1C8N A;  5A7P A;  2FCU A;  4AAP A;  2FDF A;  1UAI A;  3U11 A;  3U1X A;  2JEM A;  3UYJ A;  2Z79 A;  1AR9 1;  3OEB A;  5F5Q A;  3PG7 A;  3LIG A;  4FOV A;  4IV3 A;  3ZN5 A;  2B42 B;  4H7M A;  2EIC A;  2I2S A;  1YCI A;  2MEV 1;  1US3 A;  5M0T A;  4Q4Y 1;  1PIV 3;  2WO7 A;  1L3J A;  3JD7 3;  3P5B A;  3ZYG A;  1OIP A;  2RR1 3;  2RS1 2;  1DIW A;  2BNN A;  3J7M A;  2XPJ A;  1MZE A;  5LBB A;  2X05 A;  3UK9 A;  1O3R A;  3X29 B;  3L9J T;  1KDK A;  5EJ1 B;  4HPK A;  1O4T A;  5SV5 A;  3VBR B;  3HY5 A;  3ORJ A;  5LB6 A;  1FAY A;  4Y26 A;  1ZRF A;  1GZC A;  2V4A A;  3OGS A;  3MF9 A;  3WW2 A;  1FT9 A;  4AR2 A;  1Y9M A;  1VB4 A;  4H7L A;  2A3W A;  2QKD A;  1IG0 A;  5B4N A;  2XHN A;  3BI3 A;  4XZP A;  2BW8 A;  5DMY A;  2W5F A;  5I0S A;  5JIU A;  1OQE A;  3UET A;  2EF6 A;  2Y6L A;  2ZHM A;  1NCR B;  4LLF A;  4XUQ A;  2WN3 A;  2OVU A;  1BBT 3;  4XFC A;  4LO8 A;  2FDG A;  1ZZ9 A;  5C4W B;  1JZ4 A;  2QBX A;  3MPP G;  3CJI C;  3GYD A;  3H3U A;  1JN2 P;  5EQU A;  1O5U A;  1A78 A;  1DGW X;  1MS5 A;  1JZ5 A;  3ZOI A;  5FY5 A;  3NJY A;  1DQ0 A;  1AXK A;  3MIF A;  4QB6 A;  4GAZ A;  2XLA A;  2DFB A;  3DV8 A;  3ASI A;  3LGR A;  4E4D X;  5FXW A;  1KGY A;  2ENR A;  2VUL A;  1Z7S 2;  2A3Y A;  1X8M A;  3NV1 A;  2GMP A;  2JDZ A;  4XQ4 A;  5BNN B;  2XJV A;  2R06 1;  2GN3 A;  2ZGN A;  3INA A;  3KWV A;  1LU1 A;  1TMF 2;  3H9A A;  4IV1 C;  5FV3 A;  1MZ5 A;  4OCT A;  4GJZ A;  1QIQ A;  1OA2 A;  3S57 A;  5LBF A;  3JB4 C;  2Q1Z B;  1RUD 3;  2E63 A;  1K5J A;  3A23 A;  3LCP A;  2WNU C;  4QWN A;  5T5O A;  1HV0 A;  5F5I A;  1DZR A;  3CJI A;  2ORZ A;  3I4I A;  3FC0 A;  1PK6 B;  1WCD J;  4RN5 A;  1J3Q A;  2V4V A;  4MX3 A;  3QCW A;  5IYY A;  5L19 A;  1UYX A;  3GXU A;  2XB6 C;  2ZGM A;  2HKX A;  2JG9 B;  1YIF A;  4HKO A;  5ABJ B;  2XWB B;  4ERO A;  1QOS A;  1FYU A;  3HNY M;  2GAL A;  1Z7S 1;  4HVR A;  1RHI 1;  5FZ4 A;  4D7Y A;  4IV1 A;  4LR4 A;  3PIG A;  3PLQ A;  5J48 A;  5CA6 A;  1W04 A;  4FPE A;  2B39 A;  4XMI A;  1H8T B;  3K51 A;  1APN A;  3ZX7 A;  2W52 A;  3FBY A;  1GZ9 A;  2PMW B;  1DYK A;  3UKN A;  4JKM A;  2CU5 A;  4GWN A;  3FFZ A;  4KWJ A;  1COV 3;  1YLL A;  4N90 A;  3ZMN A;  3VZJ A;  1AYM 3;  4XFA A;  2WNU A;  3U0Z A;  5A1A A;  1CZT A;  1UQX A;  1JMU B;  3BTX A;  1KS4 A;  5AC9 2;  3D8C A;  3NNL A;  2G9Z A;  2CY6 A;  2D7F A;  4PIY A;  3WUD A;  1D4M 2;  4PDW B;  4W6W A;  1SEF A;  2V72 A;  1LAJ A;  1SQ4 A;  3BN6 A;  1LOD A;  2YU1 A;  1UU4 A;  3O7O A;  3VBR C;  3WW4 A;  5JDB A;  3I2O A;  2ARA A;  2PLV 3;  3KVB A;  1C5I A;  4PLM A;  2OII A;  3POE A;  4WVV A;  2RMU 3;  2VBP A;  1R08 2;  1S0F A;  4Y5T A;  1ND2 B;  4HK9 A;  1ULF A;  5FYV A;  4QPW A;  4BMB A;  2AEY A;  2CDO A;  1FMD 2;  2ES3 A;  3FUO A;  4GJY A;  3VDD B;  4YM2 A;  3SEE A;  3ACG A;  3SCH A;  1XND A;  4OHW A;  1A6C A;  2EXK A;  4CEY C;  2IFR A;  1NCR C;  3VKF C;  4F8A A;  4QD2 A;  1OBN A;  3OBT A;  5C4W C;  1G6N A;  3ENR A;  5E1R A;  4C90 A;  3LB9 A;  1W9W A;  2ZS6 B;  2E6V A;  1ZBE 2;  3VBH B;  2WUH A;  3E6C C;  1W6M B;  5I8S A;  1O3S A;  4FAG A;  3BVC A;  3I2J A;  4CCL A;  2RJL A;  2Y6J A;  1L7R A;  3VBR A;  2RS5 2;  2HWB 1;  3EHK A;  5JIA A;  4D7T A;  1JOP A;  2VOK A;  4UF0 B;  5FZM A;  1RYY A;  1PMH X;  3CEW A;  4W4Z A;  5BNN C;  1R08 1;  3ZFG B;  2YC2 A;  4RGA A;  3CJX A;  1WLC A;  4LE4 A;  4RHV 3;  2LUW A;  2Y33 A;  4ZU5 A;  4TN7 A;  5CEH A;  3DPR B;  3F95 A;  1FOD 3;  1W9S A;  4AFB A;  4DQA A;  5JMO A;  2W2I A;  4E4Z A;  4CEY A;  1NCR A;  4DUX A;  1Y4W A;  1U5Z A;  5DAB A;  1GNH A;  1ZZ6 A;  1PO2 1;  4CA9 A;  2R07 3;  1XNB A;  3LFM A;  2DFC A;  5C4W A;  3H7Y A;  3FJS A;  3U10 A;  3ZKY A;  4XFB A;  1U0A A;  1PK6 C;  3GZT B;  2VZV A;  5DQ0 A;  5C71 A;  4XQW A;  4A7Y A;  2XG3 A;  1PZ8 A;  2VH9 A;  3VHO A;  2BPA 2;  2XON A;  5ABJ C;  2JG9 C;  3CIH A;  3Q8A A;  3T4H B;  1NX9 A;  4FCA A;  1H1I A;  3BTZ A;  1X82 A;  2QVS B;  1MEC 3;  3GZA A;  2UU8 A;  4WBB A;  4YVW A;  5KR7 A;  5A3T A;  3I3E A;  1H4G A;  3WNP A;  2VO5 A;  5BNN A;  4MHR A;  2ZOE B;  1V9U 3;  3KQ4 B;  1N3O A;  4HKW A;  4A42 A;  4XBL A;  3DGT A;  3B00 A;  2AEZ A;  2NLR A;  1H8T C;  1W9T A;  1O6U A;  2BEO A;  1W6Q B;  4X6Q B;  3SH3 A;  2ID4 A;  1JZ6 A;  2PXJ A;  4YWA A;  4LO5 B;  4ES8 A;  1LGN A;  1MAC A;  4IUG A;  1LHO A;  4XIL A;  4A44 A;  5FZB A;  4LKE A;  2QQV A;  4BQ5 A;  5I93 A;  4COW A;  3TN9 3;  2J1E A;  3ZN4 A;  1ZBA 1;  4OMJ A;  2OXB A;  1ZZ7 A;  2CHH A;  1XXN A;  2WC2 A;  1JYC A;  1PK6 A;  3ZO0 B;  1BLZ A;  5FUN A;  1P8J A;  4FAH A;  2NP0 A;  1UMI A;  1VBB 3;  4PDW C;  1YQC A;  3H3L A;  4BM8 A;  3ZSM A;  5ABJ A;  2JG9 A;  4OI2 A;  3WF2 A;  4FPO B;  1UPI A;  2E26 A;  1UCX A;  4EZ4 A;  1C3H A;  1WLT A;  2YYO A;  3ZFE B;  2OYZ A;  5HCA A;  2W92 A;  3AK0 A;  2VD7 A;  5FXV A;  1LGC A;  1ND2 C;  2V09 A;  2VVF A;  3WOG A;  2Y34 A;  1HIX A;  1OUS A;  1CR7 A;  1H8T A;  4OZO A;  4RSU A;  5FZG A;  1EV1 3;  4XFH A;  4I3G A;  3VDD C;  3UNP A;  5D8A B;  2RE9 A;  2JB4 A;  4DUW A;  1W39 A;  1R09 3;  3ZPY A;  3JBG 3;  3VB9 A;  1ZNP A;  4CP0 A;  5FXZ A;  2DTY A;  2VTF A;  4YG6 A;  2VW0 A;  3QH7 A;  4ARY A;  4Y4Y A;  5CKN A;  4XF1 A;  5H9R A;  1SBE A;  5FZ6 A;  5C9A B;  3VBH C;  3HNB M;  3ECQ A;  3NJX A;  3NWK A;  3OOX A;  3TYJ A;  4Q4V 2;  2BWC A;  1OKO A;  5FZ1 A;  5ACA 1;  4GB3 3;  2PTM A;  4Q29 A;  4QX5 A;  4R8H A;  3J8F 3;  1WMX A;  5IJR A;  3NL1 A;  1UD1 A;  4P9L A;  5JOW A;  3Q8E A;  1H6Y A;  4BZ4 A;  3UES A;  3ZFG C;  5C8W A;  1QJZ A;  2YBP A;  4EQV A;  5K8S A;  1RUJ 2;  2Q8O A;  5CFC B;  1UMZ A;  3P1I A;  4QX8 A;  3RZL A;  3VDD A;  1QHD A;  2KM2 A;  2P37 A;  2G9G A;  1HQN A;  1ZZC A;  3DPR C;  5LEK A;  5CG8 A;  1GP6 A;  2W47 A;  2ZX2 A;  4CCM A;  3QLQ A;  1RTV A;  4CDU B;  1KEX A;  2OX0 A;  3O5S A;  2ZAH A;  4JQT A;  1HJF A;  1G9D A;  1SZB A;  2ADD A;  5DAW A;  1FNY A;  4QHZ A;  1JZ2 A;  3WG4 A;  1OH4 A;  3VBH A;  2VUJ A;  1BVV A;  2YDE A;  4Q4V 1;  2F4P A;  4DMI A;  3GBF A;  5DPN A;  1VAM A;  4PQQ A;  1ULE A;  4UF0 A;  5FYS A;  5GZD A;  3ZR5 A;  2R7E B;  4QMA A;  5EXO A;  1IG3 A;  1W9Y A;  1OUX A;  3ALQ A;  1O91 A;  3AYE A;  2W1U A;  3ZFG A;  3T2Q A;  3ZFF B;  4Y4R A;  3WZ1 A;  3WXP A;  4RGG A;  5HCB A;  1ASJ 3;  1XNK A;  2CGP A;  3SXW A;  1D4V B;  1CZV A;  4QQL A;  5IW0 A;  1QXJ A;  4BOW A;  1XE0 A;  3ZMO A;  2CSG A;  3WT3 A;  4N43 B;  2GP5 A;  5DAQ A;  1O4Z A;  1F35 A;  3BGA A;  4J1W A;  1YFX A;  5CVR A;  2RDR A;  1T2X A;  4UW4 A;  4L11 A;  3AZX A;  4BIS A;  2WS9 3;  2BVV A;  3ZYF A;  1OUR A;  2VUC A;  2UWA A;  2BER A;  1WCU A;  2YHJ A;  4TZD A;  4XHX A;  1H2M A;  2XJQ A;  2ZEW A;  4IEZ A;  2OZ6 A;  4QPG B;  5FZ9 A;  3ZM8 A;  4AI1 A;  1AYN 2;  4J6G A;  4LOS A;  2Z69 A;  4PHZ A;  2PYT A;  3ZFE C;  2YBK A;  1SHW B;  3OTF A;  2EAL A;  2J1R A;  1WW7 A;  4XVH A;  1AR8 3;  3MBW A;  4RL7 A;  4M0N A;  2QDR A;  5JXG A;  4TLG A;  1YXW A;  5FPL A;  2IWG B;  1W6Q A;  4K7J A;  2BOI A;  4PT6 A;  2VXR A;  2X5I B;  5D8A C;  1OKQ A;  3SIT A;  5LEJ A;  5C70 A;  1SDD B;  3CLP A;  3ZXF A;  3J7L A;  1ALY A;  3HVD A;  1ZZ8 A;  3BB6 A;  1W8N A;  1SLC A;  4QT6 A;  1TVG A;  1UU6 A;  4AG4 A;  4AGV A;  1BKZ A;  1QJU 3;  2DVB A;  5C9A C;  1D2S A;  1HXS 3;  3ACL A;  3I2K A;  2I07 B;  3PTR B;  3U78 A;  1OHF A;  3I2D A;  1G9C A;  4E2S A;  1DU3 D;  4KL1 A;  4Q8L A;  1LUL A;  3PVB B;  1AYN 1;  1J83 A;  2VVE A;  3PEG A;  1CQ9 A;  4KNC A;  2H0V A;  3ZFE A;  3HQU A;  2JDU A;  3ZPO A;  4XF0 A;  3NNF A;  4LKS A;  5CFC C;  1XSQ A;  3TOJ A;  3I8T A;  2D97 A;  4CEW A;  3R0R A;  3U07 A;  2AH2 A;  4AQS A;  2GC2 A;  2ZPX A;  5D1I A;  2XHK A;  3LDK A;  2JKB A;  1V6L A;  4GH4 C;  5D8A A;  4CDU C;  1SBF A;  4XQD A;  4CUB A;  3H50 A;  4AVC A;  5FIX A;  3J4U H;  4KH9 A;  1J1T A;  2IC1 A;  3T0B A;  5K0U B;  1ENR A;  1DGR A;  3C8X A;  4NII A;  5C9A A;  5JPM B;  4AWD A;  1IPJ A;  3KT1 A;  1AL2 1;  2IVI B;  5CBL A;  1PMI A;  4LA3 A;  1W8O A;  2ZTN A;  3THD A;  4JGZ B;  4L92 A;  2XJU A;  5L36 A;  3THT A;  3OY8 B;  3NNM A;  2WWS A;  3ZFF C;  5IFT A;  4CPB A;  4BB3 A;  2NN8 A;  5CFC A;  1WBF A;  4IEX A;  5FY0 A;  3PIJ A;  1FX5 A;  2WAO A;  4NOT A;  1IKQ A;  4IEW A;  3U4X A;  1OPO A;  4DY3 A;  5AFE A;  2ZEX A;  4K6B A;  1Q8V A;  4CDU A;  3AP9 A;  3B5L B;  3PVE A;  3KCY A;  4N43 C;  2Y8K A;  2ZZQ A;  5FPZ A;  3MUY 1;  4YM3 A;  1QJX 1;  3KD4 A;  1UZ0 A;  1ULC A;  3O1R A;  3LA3 A;  3AL5 A;  4Q0U A;  4S2F A;  4M8Z A;  3WDY A;  5A1F A;  5KXD A;  3O0W A;  1JZ3 A;  1DG6 A;  3I54 A;  2ZGQ A;  4FOQ A;  3G6J B;  5A3N A;  2XLG A;  1W8H A;  4QPG C;  4K8R B;  4CPB D;  5C33 A;  2P1B A;  1RMU 1;  2JE9 A;  4Q4X 2;  1B35 B;  2L9L A;  3WF3 A;  1RUG 3;  1DCS A;  3ZFF A;  1H6X A;  2EIB A;  3C2U A;  3S6P A;  3ELN A;  5FYM A;  2ZCW A;  5IVV A;  2ZGL A;  4KWK A;  4LUM A;  4O9G A;  3O1U A;  1W0N A;  2D6O X;  4EYU A;  1LES A;  2X5I C;  3BIW E;  4QHB A;  4N43 A;  1UY4 A;  2DCT A;  3OGV A;  3UKV A;  2A75 A;  5A70 A;  4AYU A;  1OD3 A;  2H0B A;  1LNS A;  1WLD A;  1UF2 C;  4BIO A;  3AKR A;  3HD8 B;  4EN8 B;  4QQP A;  3KGL A;  2ZA9 A;  2VMD A;  4A7Z A;  2A6X A;  2XVL A;  2EIG A;  4BJ0 A;  2VZ3 A;  1LJ7 A;  5FP9 A;  1OFS A;  4AHW A;  1VBA 3;  3WNK A;  1KJL A;  4AW7 A;  1J1L A;  1PIV 1;  2C24 A;  3AXD A;  3JD7 1;  3M70 A;  1MS3 A;  2FDH A;  2RR1 1;  2EA7 A;  1N3Q A;  4QPG A;  3VN4 A;  3PDQ A;  1PGL 2;  2BGO A;  4AZZ A;  5K9Y A;  5T5L A;  2ZGP A;  3ILR A;  5KXE A;  2D3R A;  1C1L A;  1QJY 2;  2P34 A;  2YFU A;  4KWU A;  2WA3 A;  5BXX A;  5C5T A;  1QH7 A;  4O9E A;  4Y22 B;  4UFK A;  2W46 A;  1WKY A;  2HWC 2;  5FZL A;  1V6K A;  4ATF A;  3C7G A;  3DXU A;  1W6P B;  2W1W A;  4E8D A;  4MGZ E;  1SLI A;  2JE7 A;  3V56 A;  5I0T A;  4D94 A;  5DUX A;  1EPW A;  3D4K A;  4YW1 A;  3PJY A;  5LK5 A;  3KCX A;  2E7Q A;  1KFX L;  3CHX A;  1Y3T A;  4P5Y A;  5K0U C;  4QX0 A;  3MI8 A;  4QX2 A;  3WDT A;  1S55 A;  4P14 A;  2PQQ A;  1QH6 A;  4QQ2 A;  3VBU B;  3OF1 A;  2CGN A;  4OVE A;  3H1Y A;  3ON7 A;  3W68 A;  4JGZ C;  4LUL A;  4FPC A;  1UX7 A;  1RUC 2;  1RVF 2;  3N3H A;  2VOX A;  1REE A;  4OYU A;  4XUO A;  4XFF A;  5LAT A;  4AHY A;  1UZY A;  1DDL A;  1F31 A;  2JX9 A;  3K77 A;  3PL0 A;  4MAD A;  4YVS B;  5FPU A;  4IEV A;  4Z2A A;  4ZU4 A;  2IFW A;  1EAH 2;  4NUB A;  1JW6 A;  1UZW A;  1S0C A;  1S0G A;  5FYY A;  4IEP A;  1WUV A;  3C3V A;  5FLH A;  1IS6 A;  4B4Q A;  4OQ8 A;  1RUD 1;  3MF6 A;  4RFT 0;  3PVN A;  2GND A;  4JDM A;  1NT0 A;  2MHF A;  4P9I A;  4Q4W 2;  1PNF A;  4QXH A;  5K0U A;  1FPN 3;  2RV9 A;  3ES1 A;  2ZKL A;  1RUH 3;  2XBO 2;  4AAX A;  4QX3 A;  1Z78 A;  3B01 A;  5HI0 A;  1GUI A;  4FPH A;  4JGZ A;  3VHP A;  2HWE 3;  2O0O A;  5I8T A;  1H9P A;  3N7J A;  3BPZ A;  4V1P A;  3MIE A;  1B35 C;  3OY8 A;  2VW2 A;  4AVA A;  1O59 A;  2ZBJ A;  5JMC A;  1R1A 2;  4IQP A;  3RVH A;  1Y9G A;  1YQ2 A;  2WII B;  2PLV 2;  3NVC A;  4PLN A;  5DAV A;  4AEJ A;  4CDQ B;  2ZAA A;  2VMI A;  4N53 B;  4E27 A;  3FN9 A;  3NV2 A;  1N3P A;  3K3N A;  4NPL A;  2PAK A;  3OUJ A;  2J1U A;  5FZ3 A;  1SFN A;  2RDS A;  4WVZ A;  5FRA A;  3B93 A;  3ZSL A;  5IK4 A;  2WN2 A;  1IPS A;  2VPV A;  4QXC A;  2Q8D A;  2ZXQ A;  3B74 A;  1YRZ A;  1PZ7 A;  2DCY A;  3IWZ A;  4JTN A;  2BNM A;  4LBO A;  4AEK A;  3POB A;  5IAV A;  3LOB A;  4R9D A;  3I3Q A;  1COV 1;  1J59 A;  1AYM 1;  3D3A A;  2EXI A;  4AVS A;  2OT7 A;  2XBO 1;  3B7M A;  2ZZJ A;  4GMP 3;  5J96 B;  1UX6 A;  5GZE A;  4XF9 A;  2HLE A;  2Q1M A;  1TME 2;  5FBJ A;  4NMI A;  3NKT A;  4CRQ A;  3LD8 A;  1QQP 2;  1VBE 3;  4LUK A;  1VRH 2;  4OHZ A;  4P02 B;  3R05 A;  1AZD A;  2QQW A;  3MW4 A;  3VL8 A;  1F5F A;  3FMG A;  2BP6 A;  2JDH A;  2PLV 1;  4PQ9 A;  4UFM A;  1KXG A;  1QXR A;  2VQT A;  2ERF A;  4Y33 A;  3JUU A;  3WG1 A;  1LHU A;  4B4R A;  4D6Q A;  1RC6 A;  2PQS A;  2RMU 1;  5EJ3 A;  1UY3 A;  3B7N A;  3IIA A;  1HRI 2;  1UNB A;  1W03 A;  2VCM A;  1HRV 2;  2W91 A;  3AMQ A;  1EPZ A;  3DYP A;  5F3E A;  3RJ2 X;  2DCJ A;  2WZR 2;  2QCS B;  3LEG A;  4FPK A;  1FV2 A;  4OZX A;  4XUP A;  4K40 A;  2JEN A;  4BU2 A;  2VE1 A;  1IKP A;  4XUT A;  2PAM A;  3CMG A;  1RUF 3;  5HPO A;  4HMZ A;  4W65 A;  3OD4 A;  4XPV A;  3VBU C;  4CEW B;  3A22 A;  3IMN A;  3Q9O A;  1QQP 1;  1C5H A;  1NCQ B;  1XC6 A;  3CL1 A;  1QWR A;  3OYW B;  4XJZ A;  1OLQ A;  2YG0 A;  5BPX A;  1LB2 A;  1NYW A;  5FPB A;  1PM7 A;  3TEZ A;  2HBT A;  1O3T A;  2KR2 A;  2VZS A;  2VZQ A;  3M8L A;  3ROU A;  1MEC 2;  4YVS C;  2QUO A;  3III A;  5ANN A;  4P9G A;  3ACI A;  3PUQ A;  1SFP A;  1ZYB A;  1QJE A;  2VZU A;  3O1T A;  1FXZ A;  4H3W A;  1SBD A;  2Y6K A;  3KF3 A;  4W6Y A;  4P00 B;  4K1Z A;  1W2U A;  1H0B A;  1K5M B;  4HK8 A;  4IGO A;  2OKX A;  4BLI A;  2E31 A;  1IGO A;  4G9S B;  4TLF A;  4DXT A;  4YAR A;  4DRR A;  2D3S A;  1G9A A;  4QKN A;  5IAX A;  4I30 A;  2J7M A;  5JI7 A;  4NAO A;  1QNY A;  5F6L B;  3T3Y A;  1VMH A;  3FHA A;  2R07 1;  2JDM A;  5FJH A;  3VBU A;  3NKG A;  3IM0 A;  1Y9Q A;  3I7D A;  1PO1 3;  5FZA A;  2BQP A;  1W0O A;  3W59 A;  4Q26 A;  3WQ1 A;  4XUN A;  1C1F A;  4JKL A;  4CXW A;  4E9K A;  3U75 A;  1U12 A;  2DVF A;  2BU9 A;  3AMP A;  3M7A A;  4CDQ C;  4D69 A;  1MEC 1;  4IGP A;  4YVS A;  2BBV A;  1JYT A;  4N53 C;  4L97 A;  3AJY A;  2OA2 A;  1V9U 1;  4YZ5 A;  2VQ0 A;  2GAU A;  3AP7 A;  3WF0 A;  3WQ7 A;  1AVB A;  3C7E A;  4A4A A;  4OMD A;  4LIT A;  1CON A;  2BOJ A;  2BUK A;  2WIN B;  5CKM A;  3SCG A;  2QE3 A;  1YQ8 A;  3D0S A;  1LR5 A;  4GMP 0;  2R06 2;  1GKB A;  3OGR A;  4BQ4 A;  3VD4 A;  2ZGO A;  4NRQ A;  3POJ A;  3TN9 1;  5D21 A;  2A6Z A;  5T3N A;  3RZG A;  2HH9 A;  1Q8O A;  1H1M A;  5L73 A;  3RGB A;  3H8X A;  2A6Y A;  4HBN A;  4NN0 A;  1ND3 B;  1VBB 1;  5FMO L;  2A73 B;  2X8K A;  3EYP A;  4GB3 2;  3NMB A;  1CX4 A;  3MIB A;  4E8C A;  2XDV A;  4CDQ A;  4JVA A;  4RYD A;  2PHU A;  4N53 A;  2OW4 A;  3ZXD A;  1CAV B;  3Q8F A;  4CCC A;  3S0M A;  3RYR A;  2CWS A;  2BYV E;  2VNV A;  3HOB A;  3M3Q A;  1K12 A;  4QXK A;  3I2G A;  1E5H A;  1O8P A;  1EV1 1;  4HG6 B;  1YQ5 A;  4A45 A;  5A6Z A;  4YVW B;  2JD4 A;  1RHI 2;  1WW6 A;  4PBP A;  1VR3 A;  4Z07 A;  1GAN A;  1R09 1;  3JBG 1;  4XBQ A;  1YQ6 A;  5FLJ A;  4PCR A;  1AR6 3;  1JYX A;  4CEW C;  3NW4 A;  4Z82 A;  3WCS A;  3AJZ A;  3POS A;  5FUI A;  3GNE A;  2O8Q A;  4IE6 A;  1NCQ C;  2CWM A;  2DDU A;  2PHL A;  3NNG A;  3CF6 E;  3EMR A;  4LHN A;  4OUS A;  3RWK X;  1OPM A;  2IXL A;  5FP3 A;  4GB3 1;  4M3C B;  4R9B A;  3J8F 1;  3WY6 A;  3ILN A;  2D44 A;  2JDA A;  2P2K A;  3H0O A;  4GKY A;  4DOU A;  2IXJ A;  4E2Q A;  3RZH A;  2ILM A;  2P5B A;  3VD7 A;  2QZ2 A;  1ULO A;  5FPV A;  1K5M C;  4C0H A;  3N7L A;  1UZV A;  1ZRE A;  1VMJ A;  1D2Q A;  4FTS A;  5JCT A;  4AI0 A;  2RVA A;  2VZP A;  2ZML A;  4FVV A;  5ERL A;  1HW5 A;  3ZXE A;  1NOV A;  2H6C A;  4YGE A;  5IUQ A;  1LOE A;  4LJH A;  4Q0S A;  3GAL A; 
#chains in the Genus database with same CATH homology
 4OMK A;  3P7Z A;  5LZ6 A;  3B7Z A;  3W68 A;  4CJ6 A;  1OLM A;  3HY5 A;  4J7Q A;  4FMM A;  4CIZ A;  1O6U A;  2D4Q A;  1OIZ A;  4UYB A;  4M8Z A;  2E2X A;  3W67 A;  3PG7 A;  3PEG A;  3B7Q A;  1AUA A;  4OMJ A;  1R5L A;  3Q8G A;  3HX3 A;  4TLG A;  3B7N A;  1OIP A;  3B74 A;  4J7P A;  1OLM E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...