1OLME

Supernatant protein factor in complex with rrr-alpha-tocopherylquinone: a link between oxidized vitamin e and cholesterol biosynthesis
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
397
structure length
397
Chain Sequence
MSGRVGDLSPRQKEALAKFRENVQDVLPALPNPDDYFLLRWLRARSFDLQKSEAMLRKHVEFRKQKDIDNIISWQPPEVIQQYLSGGMCGYDLDGCPVWYDIIGPLDAKGLLFSASKQDLLRTKMRECELLLQECAHQTTKLGRKVETITIIYDCEGLGLKHLWKPAVEAYGEFLCMFEENYPETLKRLFVVKAPKLFPVAYNLIKPFLSEDTRKKIMVLGANWKEVLLKHISPDQVPVEYGGTMTDPDGNPKCKSKINYGGDIPRKYYVRDQVKQQYEHSVQISRGSSHQVEYEILFPGCVLRWQFMSDGADVGFGIFLKKKMGERQRAGEMTEVLPNQRYNSHLVPEDGTLTCSDPGIYVLRFDNTYSFIHAKKVNFTVEVLLPDKASEEKMKQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SEC14-LIKE PROTEIN 2
publication title Supernatant Protein Factor in Complex with Rrr-Alpha-Tocopherylquinone: A Link between Oxidized Vitamin E and Cholesterol Biosynthesis
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lipid binding protein
total genus 134
structure length 397
sequence length 397
ec nomenclature
pdb deposition date 2003-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00650 CRAL_TRIO CRAL/TRIO domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.680 Mainly Beta Sandwich Jelly Rolls GOLD domain 1olmE02
3.40.525.10 Alpha Beta 3-Layer(aba) Sandwich Phosphatidylinositol Transfer Protein Sec14p CRAL-TRIO lipid binding domain 1olmE01
4CJ6A 3PEGA 4OMJA 1OLME 1O6UA 4TLGA 4CIZA 4J7PA 3B7QA 1AUAA 1OIZA 3B74A 3PG7A 4OMKA 2D4QA 4J7QA 3B7NA 1OIPA 4FMMA 3W67A 3Q8GA 3HY5A 3P7ZA 3W68A 4UYBA 1R5LA 4M8ZA 2E2XA 1OLMA 5LZ6A 3B7ZA 3HX3A
chains in the Genus database with same CATH superfamily
4OI1A 4FVVA 3UK9A 1K5MB 3BI3A 5FZ0A 2D44A 5CVRA 5A7PA 3B93A 4CTEA 1GWLA 2HEWF 1MZFA 4ARXA 1VLNA 4UFJA 3E6CC 2YGLA 2W95A 4EJRA 4UW3A 5CFDB 1JOJA 4RL7A 3VDDC 4MADA 1BEV1 2EA7A 3IKWA 1VBD2 4FFGA 4FTBA 1RUE3 4X8NA 4BQ2A 4XPVA 1RINA 1MPXA 2ZX0A 3O0WA 5FP3A 1SACA 1TEIA 2AGSA 3GCXA 1GZCA 2E63A 4YWAA 4CUCA 3MIGA 3K77A 3I3EA 1V6MA 4CEWC 1GOGA 1UU5A 3JCIA 1AR62 3WX5A 5EJZB 2VW0A 1OF3A 5FBZA 2Q8DA 5IK7A 3BTXA 3LKJA 4QXKA 1O3RA 1C8NA 3SKJE 1TMF2 3AZXA 4ZY9A 3IPVB 4WBBA 1UXZA 2YMZA 1FPN3 1W8OA 4BOWA 4RQPC 4E2SA 2RG4A 1ACCA 2XR4A 1JZ3A 4XIKA 3TB0A 1J3PA 5T50A 1PNGA 2XB6C 3R05A 3P7ZA 5FOBB 1VBD1 3VKMA 1KDKA 3BB6A 2Y33A 1QXJA 2HWB2 4ITCA 2YG0A 4HLTA 1XSRA 1HDKA 4L0PA 2OKXA 3E1F1 3WNNA 5DDJ1 1YFWA 2E31A 3KCCA 3NMBA 1YNAA 3VHNA 1D0GA 3OBAA 4E4SA 3KGZA 3WW2A 1ND2A 3PL0A 3RZKA 1LECA 5JLVA 2PHWA 5IUQA 1AHSA 2WLPA 3PNAA 3OD0A 1ZBE1 4ZHNA 3EYPA 4Z92B 1GNYA 3C7OA 1YQCA 4JV4A 1FI2A 5FBJA 4J1XA 5DUVA 2E7QA 1RUI1 4W6WA 1PM7A 2WYSA 4HZFA 5FKCA 4W6YA 1HV1A 3PTYA 4XILA 4AOCA 2VW2A 3LIGA 3SITA 4ZZ8A 5BYNA 1K42A 1J3QA 4NHXA 3T1MA 1KFXL 2DCJA 3RS6A 3LSDA 3BTYA 1LHOA 4FPHA 4OHWA 4F83A 2R49A 2W1QA 4Y20A 1RVF3 2KR2A 3AMNA 3K51A 4JTNA 5FCCA 5FPLA 2XJSA 2YC4A 3Q8FA 4KWKA 4OHYA 5L7OA 2VQUA 4P08A 3NJYA 3VUOA 2UWCA 2E9QA 3P5BA 4UI9L 2DF7A 3IZOA 4TSVA 3ZVXA 2VZ3A 3JBG1 4CPBA 3M4FA 2FQPA 4EROA 4EWAA 3W58A 1IHMA 4CCDA 5ISLA 1EV13 1F31A 4QGLA 4A3ZA 2D4QA 4AGVA 5L9RA 4OHXA 3AP7A 3M3EA 1O3QA 1WMDA 2G1MA 2HEYF 3I2FA 5A7QA 2OX0A 2A6XA 2EIEA 4EN7B 3A4UA 1AR72 1REFA 3WDWA 4DNYA 3APBA 2UYAA 3TEXA 4C90A 3P3NA 3CL1A 4XQ4A 3LCPA 5F5QA 4CDUA 4V2WA 1W6NA 3HBZA 1C8M1 5FJHA 4LQRA 4NWVA 2GZWA 1HB3A 4LLFA 2D6LX 4AHXA 1S0GA 1DGRN 4XBNA 2NPIA 4COWA 3VD3A 5KXBA 3P6BA 5KHHA 5FMBA 5KC5A 2RJKA 5LCWL 2YU2A 2L9LA 4JGZB 2C26A 4IXLA 1UZWA 1JU3A 1GNHA 2XQXA 4FFFA 5AC93 4KBZA 4NR1A 4LO8A 3ABZA 3OUJA 2OVUA 1QJX3 3LWCA 1VAVA 3NRUA 4QU2A 3THTA 3OGVA 4ZU5A 2BNNA 3TRSB 3HT1A 1MS5A 1AR71 1J58A 3ZFFC 4AVTA 2PHTA 4XJWA 2AH2A 4QB6A 4EYUA 1T2XA 2R041 3D0SA 3UETA 5IT6A 1H2NA 2PA7A 1RUJ2 3ETQA 1UW8A 3SC7X 3ZXKA 1V0AA 3ZOIA 3S57A 3LA7A 1OI6A 3UKVA 2PQSA 3TEZA 3W5NA 4KQ7A 1H0BA 4YM3A 1J1LA 1FV2A 4YW6A 3LOBA 1O5LA 3T0BA 3E5XA 2PMWB 4YZ3A 2V4AA 1W90A 5GJ6A 1EUUA 1RUD2 2P6CA 4KG8A 5T3NA 2W1SA 2PHRA 5FPXA 1IKPA 2XBO3 1SFPA 4MXWB 2DUOA 2JECA 4AI3A 4CUBA 4DXRA 3ROUA 4FOYA 1ZZ8A 3N9PA 4FPCA 1US2A 3D4KA 2WT1A 1UOJA 3GYDA 4XFGA 4RFT0 2VU9A 3BKZA 3AXDA 4DINB 1LCLA 2GH2A 3MYXA 3MLKA 4Y4YA 4P9YA 2EXJA 4Q4V3 3AFGA 3Q8EA 2VMFA 1O4TA 2JG9C 3NKTA 2ETEA 1UD1A 3AP4A 1RUJ1 1NZIA 4CP9B 3MFAA 5HCBA 5JMCA 4HKLA 1DDLA 2YFUA 2FBEA 1O3SA 1DQ0A 2BGOA 1H4GA 5DQ0A 4YYOA 2BNOA 1V6IA 4CYDA 2X5IA 4JRAA 1URXA 5EP9A 1Y9MA 1Z0HA 2RR11 4LK6A 2P3IA 5AFEA 1D0HA 1GUIA 4KMQA 3O1OA 1HRI3 5LRRA 4OCTA 2LTNA 1NCRC 4RR3B 1OLME 3KD4A 5FUPA 2YXSA 2FZ1A 1CAXB 1CIWA 2A5ZA 4XIOA 4I3PA 2XONA 3IMMA 3M3QA 3IM0A 3MW2A 3OY8A 2ET7A 4MGQA 5FPVA 5C4WA 3RGBA 3WV6A 2OQ7A 2WL1A 3KT7A 4MV2A 1GKBA 1WA6X 2FHRA 4N9HA 1YIPA 4ZS3A 4BXSV 5A3UA 3M3OA 5FMOS 5FZBA 3GDBA 3ITQA 5EFUA 3SCHA 3ACLA 3CJIA 5I91A 3NKGA 1ASJ3 2KXLA 4GB32 3DN7A 1OOPC 5A70A 1JZ4A 3VBOC 4CU6A 4YRDA 2OPKA 1LOBA 1XC6A 1DIWA 2DVAA 1DQ4A 4RFRB 5JOWA 5EJ1B 3AC0A 4UYBA 4KU7A 1DBNA 1QH7A 5ANNA 4X6QB 5HI0A 1SPPB 3SCFA 1LRHA 2F4PA 3HD8B 1W6QB 2ZHLA 1MS4A 1OHFA 4Y22A 2NP0A 1DQ5A 1OLRA 1XNCA 4LBLA 2ADDA 4NPRA 5F5CA 4CU8A 1XB9A 2R073 4N53A 3TOJA 3ON7A 4AEKA 4CEYB 5FZ3A 1PZ7A 2R30A 2HWC3 1AX2A 1LEDA 3MPPG 3HWJA 1B35C 2VXRA 1PMIA 1YJKA 2BU9A 1HN1A 1SLCA 1QHDA 1X8EA 3CIHA 2UYBA 1YJLA 4NHMA 1JYTA 2QQWA 1OQDA 1F9KA 4BLIA 1WCQA 2AREA 4RYDA 5LBCA 4U2AA 2AEYA 3M3CA 5DPNA 1WCKA 3ZFGC 1WUVA 1PK6B 4XVHA 2A3YA 5CEHA 4K20A 1JZ8A 4IV1A 5KWRA 5FPAA 4WV8A 4YZ4A 1LOFA 5A3OA 4Y1ZA 4QX8A 3ST7A 1UZYA 3TN93 3UV9A 3H8OA 2W08A 4QKDA 2X53S 2K9ZA 4L97A 4QX7A 1X7NA 3SH4A 2WNVC 3NVCA 3GJBA 3THPA 1PX4A 3VDCA 1IQDC 1QJU2 1N3PA 2RS11 2SLIA 3RYRA 2O14A 5JSOA 3FHIB 3ZIWA 3KF3A 1SLLA 1ZRFA 1RYYA 3LPFA 3I3BA 4NN0A 4LOSA 2TUNA 1TNFA 3K4ZA 3AVRA 4GULA 3O1UA 1RMU1 4GA9A 4YW5A 2ZJCA 1W04A 1XE7A 3CF6E 4HKOA 1JBCA 1LHUA 2TEPA 1O8PA 5F8PA 3HJRA 4OHZA 4A6OA 4QPYA 4URTA 4IE0A 1C57A 1OLMA 1V00A 3BYWA 1BK1A 3LFIA 1C1LA 2H0BA 2K2SA 5FJKA 4PF5A 4V1PA 1RTVA 5JPMB 2X09A 1HXS3 4YW7A 1GZWA 2RMU3 1PZ9A 3HEIA 3UKNA 2ZX2A 3B7QA 3CZJA 3EBRA 4I02A 4YPJA 1A34A 2JEMA 4OUSA 5LK7B 2ZGRA 4ES8A 3J7NA 4MOAA 1RHI2 2VG9A 3JB4C 4HPKB 5JSPA 1J59A 4JHTA 4Q4Y3 2WZR1 3AKQA 4CUAA 4XFBA 4RGAA 4AYUA 1RC6A 4BQWA 3EB7A 3GGLA 3VBUA 2P2KA 2HWE2 5C8CC 1GP4A 5LBFA 3USUB 4BK5A 5T55A 1ULFA 1PNFA 3KCYA 4LKSA 2JDKA 3BVCA 3ZX7A 4Z82A 4M00A 4R9BA 3TYJA 4WVWA 1BMV2 3QH7A 5IJRA 2YBSA 3I2DA 3N7LA 1EAH1 4UWDA 2LRPA 4QPIA 1W3VA 4EE2A 1H9WA 2K0GA 4AHWA 3D82A 3K4AA 1AR83 2P3JA 1RUH3 5JWPA 4QX0A 5IAXA 2GNDA 1IS6A 4IESA 4E4HA 4CCNA 3IDEA 5B4NA 2OT7A 1VBA3 2EICA 1NCQC 1RUC3 3HN1A 4P9JA 5J98B 3I97A 5GKAC 4B1MA 4HK8A 2IXKA 4NIHA 1FOD3 1S2EA 1VP6A 5IYYA 3GXUA 5I0UA 1O4ZA 1AVBA 2GMMA 4YFZA 5GZEA 1H8TA 1B09A 1C1FA 2ZGOA 4XFAA 3SH5A 5DAWA 4OVEA 2D6PA 4FAGA 4OFGA 4Q8KA 4A7KA 3AJZA 2HWE1 2MNGA 5KXCA 3TWIA 3ZSKA 4XACA 4GMP3 3B74A 4C91A 3ZDVA 2W1WA 2WLQA 5A6ZA 3I4IA 5A7NA 1APNA 3JU9A 1XYOA 1UYPA 3ZSEA 2WYFA 2R16A 4K21A 4QB1A 4XAAA 4FMMA 1JHNA 2E53A 5FXWA 4EN8B 3ZYGA 1F2NA 2PYTA 1UZ0A 2B4KA 4BXFA 1CQ9A 1H1AA 4DRRA 1I5PA 1IPJA 1Z7S1 1VBC2 2VD7A 2ZGNA 3KGLA 4YG3A 1IQAA 4FPGA 1MQTB 5FP7A 1OH3A 2RJ2A 3PU3A 4QPGB 5DZGA 1QXPA 1A78A 4AZZA 1R1A2 3JD72 3DL3A 3GZTB 5J09A 4QM9A 1BVVA 3KV6A 1V9U1 4AK3A 3HNYM 2R061 5FZOB 4GD4A 1TG7A 2BV4A 1N1TA 1AXYA 2OW4A 3C8XA 4FPKA 1AR92 1C5HA 5I0TA 2A6ZA 4CDQC 5FQ0A 5F6LB 2B9VA 4LEJA 1POV0 4M3CE 4LXLA 2XLFA 1YLLA 2VQTA 3EMRA 3HMYA 2B39A 1ZBA3 1AUYA 2JG8C 1LODA 3S7EA 3MZHA 3N35A 3LD8A 1FOD2 5LASA 1W6OB 3R4DB 5BNOC 1PIV2 3AYAA 3OPWA 4AI9A 4F7ZA 5D8AC 5TSWA 4DFSA 1G86A 1VBC1 3B00A 5JXJA 4QKBA 2X29A 1PO13 1W8WA 1UKRA 4MGYE 3HVDA 4CDXB 4Q4W2 1NUKA 4XAEA 3R6SA 2WFF3 1R1A1 3JD71 2UWAA 4X8PA 4XQWA 3RNSA 1LGCA 1BK0A 1KITA 2OZJA 3CHXA 1D4M2 4LE3A 4O9GA 5IK4A 4Y26A 4ASLA 2GU9A 2RS31 2ZHNA 3GZAA 1PVC2 5F5IA 2W3JA 2VMHA 1JODA 2ZA9A 1AR91 1CPMA 1KEXA 1W6MA 4FP3A 5FZ7A 1E5IA 4BCUA 3T1LA 3ZFEA 4XE9A 4A7YA 1KGYA 1BBT2 2ZMLA 3IAQA 2W94A 2QQIA 4XYXA 1SLTA 2OA2A 2WIIB 2E33A 3NJXA 1SDWA 3DPRA 4L11A 3HX3A 1AL22 3AVSA 3ZSJA 1PIV1 4WM8A 4XF0A 3ATGA 2C1FA 3FUOA 3WD5A 5C3PA 4A41A 3DYPA 3MDPA 2VCMA 2JIJA 1WGPA 1V6KA 2YUEA 2ARAA 4OMKA 1N3OA 2R0FA 4Q4W1 4CZSA 4GALA 4IEUA 4D6QA 5DXDA 2BQPA 1OIPA 1LHNA 4YFWA 1SCRA 1YUDA 1D4M1 4MZUA 1SLBA 1TME3 2FZ2A 2C4XA 2W9XA 3GZEA 1BQPA 2VNGA 2Q5TA 5J96B 1WBFA 1VBE2 3T30A 2V5DA 5FYHA 2BNMA 4FO9A 4RHV3 2ZMKA 3BPZA 5JCTA 4INDA 1UX6A 3KZ4C 4R4ZA 5EQUA 5G05L 4QT6A 1LB2A 3WP3A 3BOWA 3I3QA 4IEZA 4PDWC 3THDA 3MLLA 1RXGA 5FIXA 2BFUL 3X29B 4MGZE 3BPSA 1K5MC 2ZX1A 2VMCA 5FRAA 3I3MA 2DVDA 5KR7A 4LBMA 4LLOA 1W9SA 3NV3A 4JRLA 4K8FA 1OC1A 4MHRA 3IIIA 3J8F2 5FYMA 3RDIA 5CFDC 1CPNA 1PO21 4N43A 3SNMA 4AQ2A 1G9FA 2D5FA 1KQRA 1HIXA 1ND2B 4PCRA 2D5HA 1OT5A 1Q56A 4CA9A 2Y6LA 4ISRA 4PIXA 4I0AA 2C9KA 4AFCA 1F8VA 2Z79A 4PJYA 1BYHA 1VBB2 4QDSA 2EIGA 2YHJA 1NXMA 3U75A 2XGXA 3MV01 4HK9A 1H9PA 1WMXA 5CA6A 4LKEA 1ENRA 3U0ZA 3EHKA 2QQUA 4DUWA 4LBQA 5T5LA 3AX4A 4DIQA 1PHMA 4ZU4A 1ST8A 1COV1 3LZZA 1XNTA 3AP5A 4Y20B 4BISA 1MS0A 5AVPA 3B94A 3WINE 2VOVA 5JMOA 1AXKA 1JN2P 4DEQA 1F35A 5A33A 1AJKA 4W8JA 4GIQA 5L7OB 1XQNA 2W68A 1VRH2 2XJRA 2B42B 2CNAA 1SFYA 3J8F1 2V72A 4M0NA 1UQXA 5FKBA 3GHMA 1UU4A 3HQXA 4MYEA 1W28A 4S2FA 2GC1A 2WN3A 1I9RA 3MEPA 1UPSA 2R0HA 5J36A 5ANQA 3UL2A 2VTXA 3MPBA 4ZPIA 4A4AA 5JIAA 5F3CA 4UF0A 4CP2A 4D7YA 1VBB1 3IMNA 1OIZA 1QNWA 5FY7A 1WWYA 1OFNA 5A3WA 5A3LA 3KV4A 3VL8A 4CDUB 5IVCA 5JXGA 4RD7A 4RS5A 4SLIA 4RA0A 1HRV3 1W6NB 4OYUA 5T52A 1X8MA 4JHZA 3H1MA 2PLV2 1DYOA 3VBSA 4K6BA 1R093 4B1LA 3WR0A 2WUHA 2WJSA 2OUJA 3LIHA 2OUHA 4I30A 1TNRA 5GLZA 2WO7A 1W9FA 1WLCA 1FMD1 1VRH1 2Q8EA 3NV1A 3SEPA 4C0BA 3ZKYA 4OMJA 5HXMA 1XNKA 1UIKA 3JXSA 4XCBA 2XVGA 5E16A 5IVYA 1RB8G 2WINB 3VN4A 5I8TA 1I6XA 2XVKA 5D2AA 4LK7A 4H14A 1HW5A 2O8OA 1GQHA 1WD4A 2ID4A 3POEA 4GWIA 1AYN3 1K5JA 3NW4A 5FOJB 2C6SA 2VQ0A 2HWF2 2VNRA 1RUF2 2KA3A 1F4AA 2CWSA 1CAWA 2XOMA 3CBNA 3POIA 2PLV1 4Q1PA 4Y1YA 4LMFA 2ERFA 1AYM1 1UYYA 2VUJA 5L73A 2BWCA 1O7FA 2ZEXA 3CQOA 1CR7A 1IKQA 2E7TA 2R32A 3FFQA 2FD8A 3ZXAC 3Q8CA 4QGNA 5FPZA 2Y6GA 1IPKA 3T4VA 3VBHA 4ES9A 1A8DA 2WO1A 2WT2A 2VZPA 4K1ZA 3UYJA 4J7QA 3J4UH 2YU1A 2V09A 2D93A 1AX0A 3HNMA 3MBWA 4JGZC 4QXBA 2I74A 2WZEA 1DQ6A 4IEOA 3FHAA 4LHKA 5IVEA 5DDJ3 3DYOA 2DU1A 1Y3TA 1BKZA 1RUF1 3L2HA 5FZ6A 4HSJA 4W4ZA 3IB3A 4LBKA 3PEGA 2Z2SB 2W52A 4FBFA 1ZBE3 1LU2A 5DUXA 2FCVA 4CU7A 1RUG3 1RUI3 1J83A 2P34A 3N7JA 4XURA 4C1XA 2ARXA 2LM3A 3D5OA 2J1EA 2VVEA 4K3UA 2Y6HA 5SV5A 1QNYA 1YXWA 2DBNA 2QZ2A 2X5IB 5FZKA 3RZGA 4LPLA 1HJFA 1YIFA 3OBTA 2IXHA 4DPNA 2RM23 1CAVA 3FLTA 5DAPA 4BQ5A 5A6QA 3Q8GA 1LJ7A 5FP4A 4B4PA 5C9AA 2QQKA 2WS92 4XUPA 3WOGA 4J6GA 3O1TA 4Q4X3 1W8HA 4MX3A 1UY4A 1PGW2 2W91A 2QQLA 4P02B 4ASKA 4CCOA 1SZBA 3MUY1 1IG0A 2YPDA 3OY8B 4RSUA 1GZ9A 4DS0A 1IS3A 5FYCA 1W3XA 2XJPA 3QLQA 1ZYBA 3RQ0A 1Y9QA 1KJLA 2IUWA 3CJIB 4A2UA 4XF9A 3SLIA 2D6NA 3PUIA 4QD2A 1QWRA 1ULDA 1XU1A 2HBTA 2XKOA 2JXAA 3LFMA 4Q0SA 4QPWA 1GNZA 1QQP2 2TNFA 3H8RA 4LULA 3F95A 1C8M3 1OKQA 1NY72 5FZHA 4Y22B 1H2LA 2HWD2 1F5FA 2CYFA 4N53B 2WS91 3E6DA 3ZYHA 1A6CA 2QKDA 3PUHA 1Y43B 2FDHA 1LGBA 3OEBA 4MGKE 4UFLA 5M0TA 5FYIA 1PGW1 2W1UA 3BCWA 5E89A 2Y60A 4NHYA 1ZREA 2KM2A 3UJOA 2GAUA 2Z5WA 3IIAA 4CCMA 4RR3C 4YVSA 1W8FA 2PHXA 5BNNA 1AR61 4GH4C 3UNPA 1RUE2 3ZXJA 2CV6A 4AFMA 2YY1A 2JE7A 5K4LA 1NAEA 4IV1B 1SHWB 1OMIA 1TMF1 3KF5A 2LALA 1OKOA 1N1YA 5HCHA 1AUAA 2QDNA 2Q1FA 1GOHA 3RVHA 3WCSA 1QQP1 3FN9A 1QDCA 1CJDA 3C3VA 4XUTA 2R043 4GQ7A 1PMHX 1XNAA 3J26N 4AEJA 2Y6KA 4QX3A 1NY71 2JIGA 3ELNA 5ACA3 1WLTA 1G9CA 5EYXA 3B5LB 2RS53 2IFRA 2HWB1 2VCAA 1IGOA 4IV3A 4D8MA 1WW5A 2VBBA 3OBRA 5J48A 3POGA 4IGOA 4EQVA 5EPAA 1FPN2 3NWKA 1CWPA 1TZOA 5FZ4A 4CEYC 3MICA 2B5HA 3PURA 3N9QA 4Y1VA 3FJSA 4R9AA 2C0ZA 4DEVA 2EIDA 1NOVA 4A42A 1DGRA 1GWKA 4A45A 4CRQA 1O4YA 1RUE1 1XE0A 2KD7A 1DZQA 1UY0A 3AKTA 3ZXGA 2IVIB 1YFYA 4WM7A 3FBYA 1MZ5A 1GZWB 1X33A 4XZUG 4P9WA 1ZZ6A 5A6YA 2JDMA 1PK6C 1UMIA 3T0AA 3LA3A 2F4LA 2AUYA 5LB6A 2Q8CA 3AL5A 3HR9A 1GU3A 1S0BA 4AI8A 4AEDA 3POSA 1SCSA 3ZN6A 1AZDA 1F4HA 3VBRA 4AL9A 1DP0A 2C5DA 5I8YA 2NZ9A 1DU3D 1XRUA 3ACGA 4CXYA 4R52A 3VD7A 2XJTA 4AFBA 4XMIA 4NAMA 3D3AA 1QXRA 4BPZA 1LEMA 2RR13 1FPN1 3ZYIB 3VBUB 4IW3A 5ABJA 1RVF2 4CVUA 4RN5A 4D7SA 2GDFA 3M3IA 4AG4A 2Q1ZB 3NJZA 5IVFA 1C3HA 4AVSA 1XU2A 3ZR6A 2ZEYA 1LKNA 4JC1A 2VZQA 2DU0A 3PUSA 4HONA 4QPIB 5G04L 5BV6A 1OPMA 2E6VA 4JQTA 5F32A 3GALA 1GR3A 1EV12 4LA2A 1Z78A 2QJVA 3T4HB 3KVAA 3VZNA 3WQBA 1HLCA 3EQEA 5C6CA 5LZ6A 3OSDA 2BEOA 1JTZX 3PVNA 1ENQA 4CDWA 2Y64A 2F6BA 1YYNA 3ILRA 3SHRA 4MGSA 2VZOA 4JTOA 4QU1A 2FDJA 3BU7A 1H8TB 3RYKA 1GLHA 1OQ1A 1JUIA 2WNUA 1V6JA 1OUXA 1RVF1 1S1AA 3MIEA 5GLVA 2IXJA 5LBEA 3B02A 3Q9OA 4FPEA 1QOTA 4H55A 4D94A 2DWRA 4P9GA 3UGGA 4HFSA 2QQVA 2Y8KA 2ZCWA 4RGGA 5A1AA 1AL0G 5AC92 1MZ6A 3PTRB 2YV8A 5CFCA 5KXDA 3RYPA 4O61A 1QJX2 3SQOA 1O5UA 2OPWA 4XOGA 4CXWA 2ILMA 3B7NA 2W47A 3SMHA 4X6RB 2BERA 5J37A 5FY0A 1Q8QA 4R9CA 1TQ5A 1HKDA 3O0VA 4NHKA 5JDBA 2H6BA 3DECA 4B4QA 4BWOA 1PX3A 1CZVA 4NPMA 4BYYA 1H6XA 4OHVA 1RUD1 3IT8A 4AQTA 2MEV3 3POWA 1H1IA 3GNEA 3PUAA 2DCYA 1LTEA 2JE8A 3O1VA 2WNEA 4XBLA 5I0DA 2RS13 2WQ8A 5FQ0B 3WEZA 1XYPA 2WRAA 3LDKA 1EP0A 5DUWA 5BNQA 1BHGA 4YW1A 1NXD1 1JHJA 1KJRA 4QB2A 5FMDA 2JDHA 1RMU3 3WZ1A 1ND3A 3VDAA 2JD4A 4HXCA 2XBO2 2BFUS 3PDQA 1SBFA 1LOEA 1XBFA 3AKPA 1VB2A 4MXVA 2O8QA 2XJQA 1NQJA 3SEEA 1DGWA 1OD5A 3DCQA 3V65A 1O3TA 5IK8A 5C8WA 1OVPA 5FPBA 5A7WA 1XNDA 5EIYB 2J1VA 2VE1A 3U11A 1ZA7A 1MQTC 4TLGA 4Q4V2 2DTYA 4QPGC 2FDGA 4YGDA 4XJ8A 4YZ1A 3WDVA 5I0RA 3A23A 4FXKB 4OUEA 3S5QA 4R9DA 2PTMA 3AZVA 4PQQA 1W6MB 4R4XA 1NA1A 3ZFEB 5AFBA 3WP5A 4W65A 3WLUA 2VO5A 3W67A 3BN6A 4DQAA 2QQOA 2WDBA 4FCAA 2DUPA 2VZ1A 3S30A 2GC2A 3WG4A 2WZR3 4WVVA 3C7FA 1W6PA 3IDAA 1SBDA 1HJGA 2VOTA 2AEZA 3DPRB 3WQ7A 3ZM8A 1YC61 1CVNA 3NNFA 3HY5A 1ZZBA 2VAUA 4MHUA 4QXHA 4WM8B 4ATFA 3HAGA 3MFCA 1Y7BA 2XBO1 1SLIA 4GXLA 4GB31 1HRI2 2YPJA 5FXXA 5JVVA 5FY5A 4O7XA 4Y33A 3LGRA 4CPBD 1F5JA 4DMIA 2VUAA 4FTSA 2GN7A 2JE9A 3HIFA 5CKMA 5GLUA 4H3WA 4XFHA 2XMLA 1UY1A 4Q4V1 4CDXC 1WKYA 4EN9B 4KI5M 3R0RA 4XF4A 3AYDA 3FHQA 4OI2A 4AQ6A 1ASJ2 3N7KA 4AXOA 1D2QA 4EZ4A 1Q8PA 1S0JA 2Z69A 3CNAA 2ES3A 1ALYA 2VZVA 5EJ3A 1MR5A 4Z07A 4DXSA 3WW1A 3ZO0B 5FYYA 3RI8A 3A0NA 4JGYA 2A7AA 4GJZA 3WHUA 5KHGA 1ZVFA 4BLJA 4M8ZA 2NMOA 5IHRA 4AAPA 5C3SA 3FUQA 5CG9A 3RWNA 4NRMA 1YRZA 1W2TA 5C70A 3DKWA 1Q43A 1HRI1 1SQ4A 2R072 5BNPA 4WVMB 3HN3A 1O8SA 1OPOA 3FX3A 4JX0A 4KWLA 3OGJA 2HWC2 4MGIE 3U4XA 2R6QA 3R4SA 4N43B 4I0WB 4ISQA 1W03A 4OI4A 3VZJA 2Q30A 4XDOA 2DDUA 4UBGA 2DVGA 4QKFA 4AWDA 2DBIA 4NRPA 5DABA 1QJU1 4GKXA 3NAPA 5K0UA 2EXKA 1Z7S3 2ZGTA 3IDBB 4XBQA 1ZA4A 2PFWA 3Q8AA 3UT0A 2CGPA 1ZNPA 1DHKB 3WSOA 1GSLA 1ASJ1 3PVBB 5L9VA 1UKGA 1I3HA 2QNKA 5L36A 3TN92 3ZN4A 2E2XA 3ZMOA 1V9U3 5HXVA 3VBFB 2R063 1K3IA 2PN5A 2A70A 4K8RB 1DFQA 4LO7A 4COVA 4LBQB 5L9BA 3AMMA 4M4PA 5LA2A 3ENRA 4G4FA 4TWTA 2IFWA 4UFMA 1EPZA 3VHPA 4A44A 4YSFA 2HYKA 4Y4RA 4LT5A 1YO8A 4TYSA 3RG0A 5E1RA 1P8JA 1ULPA 1ZZ9A 5A33B 4YVWA 4GMP0 3LOIA 2VNOA 2P3KA 4YNIA 4UFIA 4QGMA 4NHLA 4QQ2A 5LK5A 4BQXA 2HWC1 3VL9A 1NE4A 2D6KA 1JW6A 2DVBA 3FWEA 3OUHA 3KV5A 4GZ9A 5HCAA 2VZUA 3NV2A 4BMEA 2XWBB 3UJQA 4LIVA 1L3JA 3EJKA 3ES1A 5BUVA 3O1SA 1WCSA 3OD4A 2O0OA 1RHI1 5H9QA 4UF0B 1DGWX 3AZWA 1EUTA 4XW3A 1ND2C 2VL4A 1HXS2 2XH6A 3TN91 2RMU2 3OGGA 1L7RA 4RS5B 4PLNA 2QQMA 1S0DA 3WG3A 2RS33 1R083 2DUQA 1G7YA 1BXHA 2XVLA 2ZGQA 3KLSA 3T08A 3VBSB 4LUMA 2CHHA 2OS2A 2SBAA 3C7EA 3JZVA 1SG3A 2GNMA 1JYNA 3T2OA 1PVXA 3VDDA 3OTFA 3HOBA 3MO4A 2C9AA 2WT0A 3NJVA 4YZ5A 3KMHA 1BMV1 1QJY3 3VKLA 1CZTA 1MS8A 2WA4A 1AF9A 4NROA 2JWPA 1MEC3 2XUEA 4Q4Y2 1UL9A 2W5FA 4S2HA 4YW3A 4DB5A 5FO8B 3W68A 4HSLA 4XJAA 3HQRA 1UYXA 5L7OC 5A1LA 4ZKTB 5FZFA 1U5IA 3V64A 2J7MA 4L99A 2GSYA 3U37A 4CEWA 4H2AA 1KD7A 1REDA 1UF2C 5F3EA 2JD9A 2RDQA 2RDRA 3WDUA 5FO7B 2GMEA 4QDRA 3GBWA 2V73A 4UW4A 3USSA 4F3JA 2QQNA 2RMU1 2G9FA 3I2HA 1H8VA 1AR82 1RUH2 1CAWB 2P1BA 3MGUA 4MG2A 4JDNA 1RXFA 2JKBA 3EO6A 3ZYBA 2PHUA 4PF1A 1VBA2 4RQPA 4XFIA 2NN8A 4YG6A 3NL1A 3VZKA 1RUC2 2DCZA 4CDUC 2VPVA 1VPHA 5JZGB 5JAXA 1S55A 1MS1A 1IOAA 2Q4SA 4NPLA 1KS4A 1V6LA 4KWJA 1W8UA 4Q4Y1 1UZVA 2ZPXA 4FQ4A 4JKLA 1XYNA 2B45X 4P5HA 4Q0VA 4QQHA 3B01A 1T6GC 3VBHB 3A22A 2CL2A 1Q8SA 5DZEA 4UFHA 3L9JT 4Q1RA 4NMIA 2A73B 3B7MA 3O14A 2JDNA 1MACA 1D4VB 2DV9A 4RR3A 3D0JA 2CWMA 2VTFA 4BIFA 5GALA 4LO4B 1X50A 1YCIA 4GH4A 1PO23 1W39A 1QEXA 2PAKA 2ZEZA 2ZGSA 1JZ2A 4FSJA 2AC1A 4R8HA 2ZGKA 1G9BA 1CN1A 3WY6A 2JENA 1JOBA 1YI7A 1RUH1 4UOJA 3R4UA 2FDFA 4ZU7A 1UYZA 3MUZ1 4HVRA 4FTEA 3VV1A 2A3XA 4A6SA 3KHCA 1OA2A 1VBA1 1WD3A 1IZ3A 3ILNA 4FFHA 1JU4A 1POQA 1NQDA 1UZZA 1XE8A 3ZPOA 2CGNA 2DFBA 2O1QA 2J1UA 2QBXA 4FOVA 4HG6B 4CCEA 4UBHA 3VHOA 1RL3A 1FOD1 1UMHA 4C1WA 4B4RA 3WF3A 2RDSA 3MIHA 4D69A 3KCXA 4XFCA 1DLCA 3WNXA 2C24A 4FT8A 4XC9A 2QVSB 1COV3 4LE4A 3I59A 1CAVB 1S0IA 2VMEA 4G3YC 5C9AB 1K12A 1J84A 1E5SA 4GMP1 1ZBA2 2VBDA 5FYVA 2QZ3A 4ZS2A 4KH9A 4OMDA 5LY2A 2F17A 3WP4A 4NIGA 5EV7A 2ZACA 3N9LA 4G9SB 4XMAA 4CCJA 3LPGA 1PVC1 4AAXA 3HPNA 4BIOA 1R5LA 1OFSA 2D6MA 2NM1A 4XEZA 2ZZJA 3KT1A 3SXWA 4D6RA 5GLWA 3IAPA 1PO12 3H7JA 1BBT1 3U78A 4YM2A 2AZ5A 4B8EA 1L7QA 2WFF2 2E7AA 1LNSA 5FK7A 4LA3A 1BZWA 2Q8OA 2IC1A 3N9MA 3LB9A 2W87A 1JYIA 3QH6A 2J1AA 1AL21 3B9CA 4ZONA 1K45A 4COUA 1U12A 4KGGA 5I93A 4FXGB 4M3CA 1QMJA 1T6BX 3POFA 4QM8A 4BM8A 4COYA 3EXUA 2PHLA 2IWGB 4JCKA 3ALQA 1BJQA 4M4RA 4QKNA 1YQ5A 2X5IC 3V0BA 1FMD3 1MS3A 3OF1A 4FOWA 2RDNA 3SISA 1ZBA1 4I3GA 5H9RA 1YHFA 2CSGA 2BPA2 4XF1A 3KVBA 3ZXLA 3LDRA 4ZZ5A 3ZFFA 4BDVB 1LULA 3A0KA 4I0BA 4YVSB 3O12A 5CNAA 5BNNB 1VBE1 2E26A 2V4VA 5GZCA 4UFKA 2UURA 5BY5A 4LBOA 4HMZA 2IXCA 5A1FA 1PO11 2HLEA 3NSTA 5F5AA 5JOZA 2OYZA 1CONA 2WFF1 4PBPA 5FO9B 3E5QA 3H8XA 4XJ9A 2OIIA 4YM0A 3CJIC 1TME2 3AL6A 2AYHA 4META 3AZYA 4MSVA 3ZMNA 1POV1 4CXXA 1DZTA 1UWWA 4W6XA 1AYM3 1V6OA 5EWSA 4B7EA 2ZX4A 2WSVA 4RHV2 5H9SA 3S5AA 1OVSA 4IV3B 5EYYA 3C7HA 2NYYA 1ZZ7A 2PAEA 5FV3A 2DCTA 3B7ZA 4Q8LA 1UX7A 4DXZA 4WZFA 2QFEA 1G9AA 1DG6A 2BOIA 5FZAA 3H3LA 2EAKA 1NT0A 1O59A 2J22A 2IXLA 1PMJX 3DF0A 3NNGA 5HPOA 1WLWA 2ZS6B 2JG9A 4ZXEA 3POJA 5F3GA 3POYA 2GC3A 2XWJB 3N9NA 2Z4FA 3FZ3A 3CLPA 2H0VA 5CYYA 1XXNA 3G7DA 3VZOA 4WM7B 5C33A 3K4DA 5B2GB 1W0OA 3RMYA 2WQ4A 2NLRA 4OQ9A 4IV1C 4AEDB 1AX1A 1OXCA 1DYKA 3NNLA 2B46X 1ENXA 5JPNB 3CZUA 5FZ1A 1OD3A 3AYEA 3ORJA 3VBRB 2BUKA 3ZN6B 4B7KA 3C7GA 4AHZA 3LA2A 4RHV1 5FYUA 3FBMA 2VQAA 2ZGMA 1NLSA 1NCRA 2VULA 2XHNA 2DCKA 3FE5A 1X9PA 4IERA 5D21A 4ARYA 2WFPA 3I49A 4U36A 3H0OA 3RZZA 2BZDA 4AQSA 1BEV3 2ZGLA 3H42B 3LQCA 5C7GA 1HQLA 4M01A 1VALA 5ABJB 3AK0A 4PI0A 4AI1A 5ERLA 1XPWA 1UU6A 5IFTA 4TTGA 5B4XA 5C71A 3E6BA 2JDPA 2I2SA 5CB7A 4DUVA 4LKDA 1OOPA 3ZR5A 1FATA 4XDQA 4P00B 3VBOA 4QX5A 2D40A 2JDYA 2VCBA 4IETA 3IN9A 4HN0A 3WCRA 4PQ9A 4KG0A 3VGIA 4N8MA 3WUDA 3BTAA 5LEKA 3LDBA 4M0HA 3VKFC 5KHIA 1QY4A 3RJ2X 3THCA 1WMFA 3CEWA 4FPJA 4DOUA 4CDWB 3T0DA 3U14A 3KSCA 3DV8A 1STMA 3V0AA 4IQPA 1V6NA 3RI9A 1B35A 4KGQA 5FZGA 2UY8A 1HRV2 3U10A 2WABA 1CESA 4MO3M 1VBD3 2WNUB 3M2MA 4K7JA 4DZGA 5IFPA 1R092 1OBNA 4XCAA 2FDIA 3AKSA 1NLRA 1W9YA 2VECA 5CISA 5IW0A 2Q0AA 3AMHA 3BGAA 3ZFGA 5HV0A 2YC2A 4BQ1A 4E2QA 1W8TA 3VBUC 1RITA 4YM1A 2HWF1 3W21A 4CUGA 3QACA 1TVGA 4JAAA 5CFCB 2JB8A 4BH9A 1AR63 4HVOA 5IWFA 2WNVA 4NVPA 4DRVA 3VKOA 3UESA 1LHWA 4QPIC 3VD4A 1DYPA 1S0FA 5EZWA 1TMF3 4TXWA 2X05A 4BHPA 1SLAA 1AYN2 3H1YA 4OULA 1JH5A 3CDZB 1WCDJ 1HRV1 4YGBA 1VAMA 2DVFA 5T54A 2XLGA 2EAAA 4UW5A 1ZM1A 1ULCA 1HB2A 3ASIA 1HB4A 2HWB3 1Y9GA 2ARBA 5JUVA 4WZCA 2GNBA 1UMZA 4Y24A 1DLLA 5C5UA 2IXIA 1H8TC 1IS4A 5CU1A 3GHNA 3JBG3 5A6XA 5CG8A 4YGEA 5FFOC 5C4WB 2XG3A 3TEWA 3PVEA 1GV9A 2K46A 2NQYA 2R1DA 4BA6A 1ND3B 4JKKA 1KDMA 2MHFA 3GF6A 5GLTA 5LWBA 1CX4A 3WNOA 5FP8A 4HT1T 3PMSA 2JDZA 1HQNA 4NIAA 4Y1UA 1N1SA 1S2KA 2WC2A 2HH9A 2ZXQA 1EY2A 4K40A 2LROA 3T2TA 5A7WB 3ACFA 1GBGA 1PZ8A 1O91A 5DDJ2 3F2ZA 4C8DA 1AYN1 4O9EA 1UO9A 4BZ4A 3D8CA 1N1VA 2HYXA 4Y3OA 5DAQA 5FZDA 1DQ2A 1G6NA 1D7PM 1UIJA 4MH0E 1JYWA 2Y6FA 4OI0A 4NOTA 2VR4A 1ZBE2 4BB3A 5C8CA 5C3OA 4FI9A 4Z1VA 1NA1B 4LTAA 4AVBA 1RUG2 1RUI2 2VW1A 4TLFA 1OQEA 1CGPA 2FCUA 3KQ4B 4LBQD 1OSGA 4Q5OA 1ULGA 4HANA 2BOJA 1W6PB 2GNTA 4ONUA 1XSQA 4LUKA 3VHRA 2QUOA 4E4DX 4L8QA 1QJFA 4L2NA 4H7MA 2RM22 3DXUA 3AM2A 3K3OA 5FZIA 1MVEA 2BTVC 2VM9A 4AFAA 2D97A 1JZ6A 1AR73 2XJVA 1G9DA 3O1PA 5FY9A 2GP3A 1MVQA 2XL9A 4Q4X2 1NCQA 1S2BA 1QOSA 2PHDA 1J1TA 3A7QA 2RV9A 4XFFA 4XABA 3JBG2 3ZIXA 1W9WA 3E5UA 1JYCA 3KS7A 4XUOA 2H6CA 1FNYA 5DUUA 5FZEA 4ASMB 3OPTA 2OZ6A 5JI7A 2YDEA 5F7UA 2HWD1 2BP6A 4IDZA 1IPSA 4LR4A 4O65A 1QGLA 1W2OA 2P5BA 3OCPA 2XPJA 3DYMA 1GMMA 2XKPA 1RUG1 3PVOA 2HBUA 3WHTA 3ECQA 3N4MA 3MW3A 4YARA 2ARCA 3T3YA 3H8UA 4JGYB 1H6YA 1C8M2 3ZXFA 3BIEA 1ENSA 3ZFEC 2RM21 2JB4A 5LBBA 5F1RA 5BNPB 1HB1A 1HV0A 2ZKLA 5DAVA 5F6KA 3AFKA 4OZXA 3DPRC 1REEA 1W0PA 3WG1A 1UXXX 4Q4X1 1JYVA 4WM8C 3FLRA 1O6UA 2GN3A 3WF4A 1M06G 2QE3A 2YGMA 1NKGA 3WW4A 3O5SA 2CY6A 2ZABA 3S7IA 1RUJ3 3WDYA 3NAPB 3H50A 4GAZA 5K0UB 2Y0OA 4Q2FA 1UPIA 2I45A 2OXBA 4GKYA 4NWWA 5A7SA 4CDQA 3OJBA 4N7UA 2WWUA 3RZHA 1GICA 2BVBA 4BQ3A 3VKNA 3FLPA 2E51A 3POBA 4IEWA 1KRIA 2WBKA 2JG8A 4NIDA 1RUD3 3OGSA 3UKTA 4SBVA 5FZLA 3WF1A 2R042 4GWMA 4LNVA 5C3QA 4JVAA 5BNOA 2IVJA 2WR9A 2EXIA 3MF9A 2CAUA 5ACA2 2WWSA 2ZHKA 1EYBA 2RS52 5D8AA 2GC0A 5FLJA 1CD3G 4YVWB 4A7ZA 4Z2WA 3U4SA 4RGKA 5GZGA 2D43A 5FYTA 4KWUA 3OB8A 1FT9A 2DYCA 5FPUA 1GQPA 2RE9A 3I7DA 3M7AA 2CU5A 4CSWA 4LBNA 1GYKA 3H3UA 1VAKA 4JDOA 4QXCA 1FYUA 4N7IA 2XJUA 3AYCA 3RSJA 2UY9A 3AMPA 3ILFA 3GZUC 1LESA 4N43C 5JOYA 5HBAA 2GP5A 1PGL2 1SBEA 3OYWA 2XLAA 1CAUA 1OH4A 5CKNA 2WA3A 1WW6A 2ZTNA 2YBPA 1H30A 3LEGA 3NNJA 3WVJA 4CCKA 1GQGA 2GMPA 4IEXA 4AGGA 5FLHA 1FX5A 1UNBA 3PJQA 5FAXA 2WZ8A 4IE5A 5A32A 5FMCA 3WF0A 3HT2A 4NE9A 1LOGA 1VB4A 5ACA1 1SMVA 3VDDB 3VBFC 3LEKA 2RS51 4QMAA 1QIQA 4XUNA 2ATFA 1S0EA 4QWNA 3FL7A 3I54A 4IEPA 4QX2A 1JYXA 5FP9A 1EV11 5FR3A 2RR12 3GM8A 1W9TA 4L92A 2ET1A 3MLJA 4YGCA 3WDXA 5K8SA 2FCTA 3NNMA 4B29A 2QQPA 4GB33 5K7PA 4CEWB 4AW7A 5A3TA 1YQ2A 3CJXA 3J7HA 1NX9A 5FXZA 4XF3A 1LR5A 1UAIA 3WDTA 1RJ8A 1PGL1 2JX9A 2AR6A 4ZXKA 2D7FA 1HQWA 3WT3A 2A75A 4KL1A 4PDWA 3ZLIA 3I2OA 3RZMA 2Y6JA 1PM4A 5F2SA 2VJXA 1WA4A 2VOWA 3JB8A 5E8AA 4YW2A 5F39A 4RQPB 3WW3A 5F3IA 1K5MA 4Q26A 2D3PA 2VY0A 2ENRA 3MHZA 4AI2A 4RS5C 4DXTA 4S2GA 1RGSA 5AC91 3VBSC 5DMYA 5CFDA 4E9KA 3JUUA 2RJLA 2CDOA 1QJX1 4J1WA 4IL7A 4XHBA 4EN0A 4QDQA 1W2NA 2ORZA 2WQZC 3WNPA 5FWJA 3QBQA 2PQQA 1VMHA 3O7OA 2VC9A 1KS5A 1US3A 3H1WA 5IATA 2WAOA 1SDDB 5AVAA 2XQRA 1N3QA 1ODNA 3W9AA 3J7LA 1M4WA 5LA0A 4GH4B 1ZRCA 5IK5A 1QJZA 5FWEA 3BODA 2CGOA 1CIYA 2YROA 3KWVA 1GWMA 1U0AA 1QJU3 1YEWA 2E32A 2VMGA 4E4ZA 4ET7A 2DFCA 1JZ5A 3PG7A 3M1HA 1D2SA 3LF7A 1VMFA 4Q29A 3VB9A 1OF4A 2VMDA 5FREA 1ONAA 2HJIA 2VZSA 4MVTA 4BK4A 3J9SA 1WLDA 2BJSA 4D0QA 5JXIA 1S4CA 1UN1A 1JMUB 1HN0A 3IPVA 1NG0A 4LITA 2RVAA 2W39A 3K3NA 4EZHA 2MEV2 4YZ2A 3Q8BA 2BRTA 2XL7A 2VH9A 2ZEWA 3T09A 3WNMA 1X82A 5JIUA 2VGDA 5J1XA 2LS6A 2RS12 3I59B 5JZGC 1ULEA 4AVVA 4HVQA 4LIUA 4YW4A 3FC0A 1H4HA 2WO2A 3U1XA 4Z8BA 3DKQA 2WKKA 3DUIA 1EAH3 1U5XA 3VBHC 1BCXA 5CKQA 4DY5A 2YC0A 2J1TA 4QX1A 4P9LA 2G9ZA 2XHKA 5BPXA 1RMU2 1W2UA 2W92A 4XJZA 4IE6A 4BJ0A 4UT5A 5T5JA 1Y4WA 5FXVA 2YFZA 1LHVA 2PXJA 5LRSA 5A3MA 2WZPP 3WG2A 4WVZA 2NMNA 1RHI3 4FAHA 3AZZA 1WMEA 2CTVA 1KFUL 1PGSA 2QCSB 4MLOA 5KHKA 3N36A 3W59A 2EIBA 2QDRA 4LJHA 3B69A 1CX1A 1E5RA 2JDUA 3K2OA 1OLQA 1UY3A 1ZRIA 2Y0IA 3BUCA 4CJ6A 5FK8A 1H1MA 2FMYA 5FDBA 2A3WA 2HWE3 2MEV1 4M3CB 1YI9A 2G4IA 3ME2A 2Y26A 1W8NA 4AHYA 4BU2A 1XOYA 4OZOA 2ZKNA 3SKVA 4CU9A 3W5MA 3V0BB 5FYBA 1GP6A 4MUVA 3FMGA 1X36A 2LW8A 3O0XA 2ZOEB 5EHDA 2WZR2 4IEQA 4OMCA 2P17A 4LBJA 3ZFFB 1I1EA 4E8DA 2EALA 1C4RA 5C9AC 3PHMA 5FZMA 4QHBA 2VXJA 2CDPA 2XXZA 2PAMA 3HBKA 4L9BA 3NV4A 4UW6A 5DZFA 2EXHA 3OOXA 2A6YA 5A80A 3ZXDA 1EPWA 4HKWA 1A8MA 1FNZA 2A6VA 1SEFA 3DXTA 4I09A 1WZXA 4NJ4A 3A21A 5FUNA 3UGFA 1F15A 1EAH2 3BALA 3NQHA 2VCCA 3S0MA 2Y34A 3L2YA 1GFF2 3KQRA 4PIZA 4E8CA 5D1IA 2J1RA 1VIWB 4HBNA 1UOFA 4FPFA 2YYOA 3I2IA 4GWJA 1DF0A 2R071 3MW4A 4AFDA 3IWZA 4FPYA 4P14A 1X9TA 5F9TA 1HX6A 1W05A 2R7EB 2OQ6A 3P3PA 4JGZA 4PIYA 4K1YA 5FZ8A 3U07A 2R1BA 3BOPA 4AR2A 2RHPA 3OBZA 2YBKA 3OGRA 3CKHA 4Q27A 1VBC3 2XDVA 2BGCA 1A3KA 2V5YA 4JDMA 1ZX5A 4FOQA 2ADEA 1OA4A 4HN1A 2PHFA 3MV11 3RZLA 2JG9B 4EN6B 5BXXA 3AB0A 1W8ZA 1R1A3 3JD73 5CBLA 3AP6A 4FP2A 2D98A 4Q0PA 5CIRA 5HCFA 3BTZA 2MPFA 4IGQA 4CIZA 1TE1B 3K75B 4YVSC 3VD5A 5CADA 5BNNC 2HKXA 3AMQA 1NZCA 3FFZA 2DTWA 1AR93 4EV0A 1C28A 1Z7S2 5SV8A 3INAA 4E27A 3H9AA 5FUIA 2XUMA 2ZZQA 3QOPA 4BMBA 3ZDSA 3B9IA 4CCLA 1IS5A 1MZEA 1U5ZA 3AP9A 1NYWA 4IE7A 1NCRB 1V9U2 2R062 1YQ6A 2ZBJA 3GBGA 1PIV3 3D6EA 4GJYA 2BVVA 4XXPA 5FTTC 3RJRA 4Y5Z0 3OPZA 2W46A 4MXWA 3RWKX 4GWNA 4IV3C 2JDAA 4PT6A 1VJ2A 4TN7A 3SH3A 1FXZA 2A1XA 2Y38A 5F37A 4Q4W3 1FV3A 2P37A 3OUIA 1V70A 1LGNA 4LO6B 4J7PA 4AF9A 4IEVA 1HXS1 1OOPB 1VR3A 1D4M3 3VBOB 4CE8A 5I8SA 1YFUA 4YG0A 3DEMA 2ZX3A 3CO2A 1PVC3 2J42A 1CJPA 4H7LA 5A7OA 2W2IA 5T5OA 1RUNA 1GOFA 4IUGA 4CP9A 2FDKA 2UWBA 1QOOA 2I07B 1RJ7A 4WM7C 3ACHA 4AE2A 1BBT3 1QU0A 5IVBA 3RRDA 5FY1A 5DAXA 4D7TA 1YFXA 1GANA 2D3RA 2X8KA 4AEDC 3V0AB 1H2MA 1AL23 1B35B 2HEVF 3I2KA 2P4EA 5T5PA 2RS32 1R082 3VBRC 1R64A 1DZRA 5I0SA 3ZYRA 2ZHMA 3RPQA 3TNPB 1SFNA 1CAXA 4OUMA 5DG2A 4LHSA 1QJY2 2ZMNA 3ZFGB 4C0HA 1JXNA 3H7YA 3PIJA 4UAPA 5KXEA 1MEC2 1KXGA 4S2DA 3HQUA 4LHNA 5ABJC 3JQWA 2JJ6A 1AR81 3M8LA 2BBAA 3VZLA 1H2KA 2AACA 5CZKA 5E6HA 4Z2AA 1Q5OA 2IZWA 2ZGPA 2BW8A 3I2JA 1VBE3 3ZKUA 4DY3A 4JZRA 2WNVB 1RUC1 1OURA 4J25A 1VE0A 5FZCA 2VTXJ 1N47A 3QD6A 2P3YA 5GZDA 5EXOA 2VZRA 3RMXA 1JI6A 3S6PA 4D3WA 2LUWA 4OQ8A 2WNOA 4B3NA 1SPPA 1GZTA 1W6QA 3OEAA 1ODMA 3PUQA 4DUXA 4JQRA 3O1RA 3ZYJB 3AKRA 1R081 1POV3 2VNVA 3PIGA 4HL0A 3C2UA 1JZ7A 4MGTA 1CZSA 2WWJA 4CDWC 1W0NA 1J3RA 3KV9A 1W06A 3IBMA 4AVAA 4CEYA 5JI9A 4KBBA 3J8F3 4FFIA 2AENA 2Z42A 1QJY1 3MIBA 1IG3A 4NAOA 2GALA 5FY8A 1MEC1 2WNUC 4COZA 4PLOA 2ZAHA 1C5IA 4PHZA 1NLQA 4JKMA 1W99A 2BGPA 1OA3A 3ZPYA 3LAGA 2JKXA 1PK6A 2DURA 5HV4A 4XXAA 5FZ9A 1VBB3 3AJYA 1WW4A 1YQ8A 4LHLA 5K9YA 4KNCA 1UOBA 2QQJA 5GM0A 3MI8A 5H9PA 1NE6A 3V56A 4AGRA 1UOGA 4XHXA 5CFCC 3WNKA 1PO22 4F8AA 3J7MA 5APAA 3PJYA 5GZFA 1QH6A 3GCWA 4FPOB 3O1MA 5A3NA 4IGPA 3MIFA 4BQ4A 1QF3A 1W2AX 4NUBA 4NO4A 3GJAA 1WBLA 4P9XA 1VRH3 5C8CB 1XNBA 3LE0A 2WO3A 1E5HA 4KU8A 5FLIA 4XDPA 4Q0QA 3PLQA 2D3SA 4ORFA 4IE4A 3MIDA 5IAVA 4PLMA 3I2GA 4CCCA 3AXEA 3MF6A 5FMOL 4HOOA 2BBVA 1JS9A 1GP5A 1YWKA 2VMIA 5C3RA 1COV2 1FAYA 1RIRA 2X10A 3LSEA 3M70A 5C4WC 1VMJA 4XUQA 1WCUA 3I8TA 4LORA 4WVMA 4ATEA 4DO0A 3ZYFA 3ZSMA 5IVVA 2VOXA 1ND3C 1NCQB 1WW7A 2VVDA 5LY1A 5E88A 2PLV3 3K46A 3RFRA 3W20A 4I01A 2EVXA 3IDCB 4QHOA 5LATA 5LW9A 2BYVE 1Q8VA 3I3DA 3VDBA 4HPKA 4QHZA 1QDOA 3KT4A 3P1IA 3TBDA 2GH8A 4V2VA 4FPLA 3DGTA 3VBFA 4N53C 5KBFA 4P5YA 4N90A 4Y5SA 3GBFA 4XTMA 2CAVA 3KM5A 4QQOA 2WAAA 1NA1C 2N7GA 2A71A 3USUA 3SCGA 2WSUA 2J1SA 4NRQA 1MS9A 2TBVA 2P6HA 4Q0UA 4BQYA 5JOXA 5FYZA 3N7MA 3ZSLA 1FMD2 3N9OA 3WF2A 1ZZCA 1Q3EA 2HWF3 5J7MA 1RUF3 1TME1 3VLBB 1Q8OA 2BDRA 2B9UA 4URAA 5IVJA 1LOFC 3T2QA 1I5ZA 3HNBM 3PMEA 3NO8A 4EWEA 4CDQB 3PU8A 5L19A 4P9IA 4Y5TA 1ULOA 4M3CF 4FQZA 2UU8A 3CMGA 4QQPA 4YLZA 3CU7A 3ES4A 4LO5B 2JG8B 5JR2A 3TNQA 1LOCA 1DCSA 2QTWB 4NIIA 2VVFA 4XQDA 2Q1MA 2ZAAA 4EWDA 4PBOA 5BNOB 3RZJA 2BWAA 1AXZA 4QQLA 1AYM2 1LENA 3WQ0A 3WNLA 5CAZA 1JOPA 3H3ZA 5D8AB 2ZGUA 5A3PA 5C5TA 1BVP1 4LOTA 3OG2A 4JGYC 2B7YA 3LEMA 3VZMA 4CP0A 4XZPA 2A6WA 1LAJA 5LA1A 1QKQA 2B8MA 3E97A 1BLZA 1U5YA 1S0CA 3G6JB 4XETA 3B3QE 4AEMA 5BNPC 4Y1XA 3JQXA 1MQTA 3ETPA 4IEYA 5FY4A 5JXHA 1AJOA 4QPGA 2G19A 5LEJA 5F2WA 3BU0A 4I2OA 3T2PA 2W0XA 1QJEA 3ZXEA 3OYWB 2G9GA 4XJUA 5FYSA 5FZOA 3LEIA 1CAUB 1UCXA 3TAYA 3NAPC 4AVCA 5K0UC 5KHJA 1ZRRA 1E57A 4XTPA 1LU1A 4QAWA 4W50A 1LOAA 4UXAA 1G8WA 2EF6A 1OUSA 5A32B 3WQ1A 2YB7A 3VD9A 2WS93 3TEYA 4D6SA 3K48A 4OLLA 5JZGA 2FMDA 2JICA 1W6OA 1ZRDA 2VOKA 3ZN5A 5DN2A 4K9SA 4A3XA 1XJAA 1DGLA 4TZDA 2PELA 3BIWE 5DG1A 1DQ1A 1BEV2 4N9IA 4AI0A 4YVWC 3QCWA 4LKFA 4CP1A 3N3HA 4CDXA 3ZYPA 2WN2A 5LA9A 2VUDA 2D6OX 3KHBA 1R1ZA 4HETA 3WXPA 2ORXA 2YZ4A 3ACIA 4E2GA 2VZTA 1QQP3 1L7LA 1VRBA 1RUOA 3UGHA 4BE3A 5JR7B 3WUCA 2VUCA 3URFA 5J3UA 1JUHA 4PDWB 5JSRA 1UY2A 2HWD3 3KB5A 4PI2A 1R091 5KC6A 2VBPA 3WP6A
chains in the Genus database with same CATH topology
4CJ6A 3PEGA 4OMJA 1OLME 1O6UA 4TLGA 4CIZA 4J7PA 3B7QA 1AUAA 1OIZA 3B74A 3PG7A 4OMKA 2D4QA 4J7QA 3B7NA 1OIPA 4FMMA 3W67A 3Q8GA 3HY5A 3P7ZA 3W68A 4UYBA 1R5LA 4M8ZA 2E2XA 1OLMA 5LZ6A 3B7ZA 3HX3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CJ6 A;  3PEG A;  4OMJ A;  1OLM E;  1O6U A;  4TLG A;  4CIZ A;  4J7P A;  3B7Q A;  1AUA A;  1OIZ A;  3B74 A;  3PG7 A;  4OMK A;  2D4Q A;  4J7Q A;  3B7N A;  1OIP A;  4FMM A;  3W67 A;  3Q8G A;  3HY5 A;  3P7Z A;  3W68 A;  4UYB A;  1R5L A;  4M8Z A;  2E2X A;  1OLM A;  5LZ6 A;  3B7Z A;  3HX3 A; 
#chains in the Genus database with same CATH topology
 4OI1 A;  4FVV A;  3UK9 A;  1K5M B;  3BI3 A;  5FZ0 A;  2D44 A;  5CVR A;  5A7P A;  3B93 A;  4CTE A;  1GWL A;  2HEW F;  1MZF A;  4ARX A;  1VLN A;  4UFJ A;  3E6C C;  2YGL A;  2W95 A;  4EJR A;  4UW3 A;  5CFD B;  1JOJ A;  4RL7 A;  3VDD C;  4MAD A;  1BEV 1;  2EA7 A;  3IKW A;  1VBD 2;  4FFG A;  4FTB A;  1RUE 3;  4X8N A;  4BQ2 A;  4XPV A;  1RIN A;  1MPX A;  2ZX0 A;  3O0W A;  5FP3 A;  1SAC A;  1TEI A;  2AGS A;  3GCX A;  1GZC A;  2E63 A;  4YWA A;  4CUC A;  3MIG A;  3K77 A;  3I3E A;  1V6M A;  4CEW C;  1GOG A;  1UU5 A;  3JCI A;  1AR6 2;  3WX5 A;  5EJZ B;  2VW0 A;  1OF3 A;  5FBZ A;  2Q8D A;  5IK7 A;  3BTX A;  3LKJ A;  4QXK A;  1O3R A;  1C8N A;  3SKJ E;  1TMF 2;  3AZX A;  4ZY9 A;  3IPV B;  4WBB A;  1UXZ A;  2YMZ A;  1FPN 3;  1W8O A;  4BOW A;  4RQP C;  4E2S A;  2RG4 A;  1ACC A;  2XR4 A;  1JZ3 A;  4XIK A;  3TB0 A;  1J3P A;  5T50 A;  1PNG A;  2XB6 C;  3R05 A;  3P7Z A;  5FOB B;  1VBD 1;  3VKM A;  1KDK A;  3BB6 A;  2Y33 A;  1QXJ A;  2HWB 2;  4ITC A;  2YG0 A;  4HLT A;  1XSR A;  1HDK A;  4L0P A;  2OKX A;  3E1F 1;  3WNN A;  5DDJ 1;  1YFW A;  2E31 A;  3KCC A;  3NMB A;  1YNA A;  3VHN A;  1D0G A;  3OBA A;  4E4S A;  3KGZ A;  3WW2 A;  1ND2 A;  3PL0 A;  3RZK A;  1LEC A;  5JLV A;  2PHW A;  5IUQ A;  1AHS A;  2WLP A;  3PNA A;  3OD0 A;  1ZBE 1;  4ZHN A;  3EYP A;  4Z92 B;  1GNY A;  3C7O A;  1YQC A;  4JV4 A;  1FI2 A;  5FBJ A;  4J1X A;  5DUV A;  2E7Q A;  1RUI 1;  4W6W A;  1PM7 A;  2WYS A;  4HZF A;  5FKC A;  4W6Y A;  1HV1 A;  3PTY A;  4XIL A;  4AOC A;  2VW2 A;  3LIG A;  3SIT A;  4ZZ8 A;  5BYN A;  1K42 A;  1J3Q A;  4NHX A;  3T1M A;  1KFX L;  2DCJ A;  3RS6 A;  3LSD A;  3BTY A;  1LHO A;  4FPH A;  4OHW A;  4F83 A;  2R49 A;  2W1Q A;  4Y20 A;  1RVF 3;  2KR2 A;  3AMN A;  3K51 A;  4JTN A;  5FCC A;  5FPL A;  2XJS A;  2YC4 A;  3Q8F A;  4KWK A;  4OHY A;  5L7O A;  2VQU A;  4P08 A;  3NJY A;  3VUO A;  2UWC A;  2E9Q A;  3P5B A;  4UI9 L;  2DF7 A;  3IZO A;  4TSV A;  3ZVX A;  2VZ3 A;  3JBG 1;  4CPB A;  3M4F A;  2FQP A;  4ERO A;  4EWA A;  3W58 A;  1IHM A;  4CCD A;  5ISL A;  1EV1 3;  1F31 A;  4QGL A;  4A3Z A;  2D4Q A;  4AGV A;  5L9R A;  4OHX A;  3AP7 A;  3M3E A;  1O3Q A;  1WMD A;  2G1M A;  2HEY F;  3I2F A;  5A7Q A;  2OX0 A;  2A6X A;  2EIE A;  4EN7 B;  3A4U A;  1AR7 2;  1REF A;  3WDW A;  4DNY A;  3APB A;  2UYA A;  3TEX A;  4C90 A;  3P3N A;  3CL1 A;  4XQ4 A;  3LCP A;  5F5Q A;  4CDU A;  4V2W A;  1W6N A;  3HBZ A;  1C8M 1;  5FJH A;  4LQR A;  4NWV A;  2GZW A;  1HB3 A;  4LLF A;  2D6L X;  4AHX A;  1S0G A;  1DGR N;  4XBN A;  2NPI A;  4COW A;  3VD3 A;  5KXB A;  3P6B A;  5KHH A;  5FMB A;  5KC5 A;  2RJK A;  5LCW L;  2YU2 A;  2L9L A;  4JGZ B;  2C26 A;  4IXL A;  1UZW A;  1JU3 A;  1GNH A;  2XQX A;  4FFF A;  5AC9 3;  4KBZ A;  4NR1 A;  4LO8 A;  3ABZ A;  3OUJ A;  2OVU A;  1QJX 3;  3LWC A;  1VAV A;  3NRU A;  4QU2 A;  3THT A;  3OGV A;  4ZU5 A;  2BNN A;  3TRS B;  3HT1 A;  1MS5 A;  1AR7 1;  1J58 A;  3ZFF C;  4AVT A;  2PHT A;  4XJW A;  2AH2 A;  4QB6 A;  4EYU A;  1T2X A;  2R04 1;  3D0S A;  3UET A;  5IT6 A;  1H2N A;  2PA7 A;  1RUJ 2;  3ETQ A;  1UW8 A;  3SC7 X;  3ZXK A;  1V0A A;  3ZOI A;  3S57 A;  3LA7 A;  1OI6 A;  3UKV A;  2PQS A;  3TEZ A;  3W5N A;  4KQ7 A;  1H0B A;  4YM3 A;  1J1L A;  1FV2 A;  4YW6 A;  3LOB A;  1O5L A;  3T0B A;  3E5X A;  2PMW B;  4YZ3 A;  2V4A A;  1W90 A;  5GJ6 A;  1EUU A;  1RUD 2;  2P6C A;  4KG8 A;  5T3N A;  2W1S A;  2PHR A;  5FPX A;  1IKP A;  2XBO 3;  1SFP A;  4MXW B;  2DUO A;  2JEC A;  4AI3 A;  4CUB A;  4DXR A;  3ROU A;  4FOY A;  1ZZ8 A;  3N9P A;  4FPC A;  1US2 A;  3D4K A;  2WT1 A;  1UOJ A;  3GYD A;  4XFG A;  4RFT 0;  2VU9 A;  3BKZ A;  3AXD A;  4DIN B;  1LCL A;  2GH2 A;  3MYX A;  3MLK A;  4Y4Y A;  4P9Y A;  2EXJ A;  4Q4V 3;  3AFG A;  3Q8E A;  2VMF A;  1O4T A;  2JG9 C;  3NKT A;  2ETE A;  1UD1 A;  3AP4 A;  1RUJ 1;  1NZI A;  4CP9 B;  3MFA A;  5HCB A;  5JMC A;  4HKL A;  1DDL A;  2YFU A;  2FBE A;  1O3S A;  1DQ0 A;  2BGO A;  1H4G A;  5DQ0 A;  4YYO A;  2BNO A;  1V6I A;  4CYD A;  2X5I A;  4JRA A;  1URX A;  5EP9 A;  1Y9M A;  1Z0H A;  2RR1 1;  4LK6 A;  2P3I A;  5AFE A;  1D0H A;  1GUI A;  4KMQ A;  3O1O A;  1HRI 3;  5LRR A;  4OCT A;  2LTN A;  1NCR C;  4RR3 B;  1OLM E;  3KD4 A;  5FUP A;  2YXS A;  2FZ1 A;  1CAX B;  1CIW A;  2A5Z A;  4XIO A;  4I3P A;  2XON A;  3IMM A;  3M3Q A;  3IM0 A;  3MW2 A;  3OY8 A;  2ET7 A;  4MGQ A;  5FPV A;  5C4W A;  3RGB A;  3WV6 A;  2OQ7 A;  2WL1 A;  3KT7 A;  4MV2 A;  1GKB A;  1WA6 X;  2FHR A;  4N9H A;  1YIP A;  4ZS3 A;  4BXS V;  5A3U A;  3M3O A;  5FMO S;  5FZB A;  3GDB A;  3ITQ A;  5EFU A;  3SCH A;  3ACL A;  3CJI A;  5I91 A;  3NKG A;  1ASJ 3;  2KXL A;  4GB3 2;  3DN7 A;  1OOP C;  5A70 A;  1JZ4 A;  3VBO C;  4CU6 A;  4YRD A;  2OPK A;  1LOB A;  1XC6 A;  1DIW A;  2DVA A;  1DQ4 A;  4RFR B;  5JOW A;  5EJ1 B;  3AC0 A;  4UYB A;  4KU7 A;  1DBN A;  1QH7 A;  5ANN A;  4X6Q B;  5HI0 A;  1SPP B;  3SCF A;  1LRH A;  2F4P A;  3HD8 B;  1W6Q B;  2ZHL A;  1MS4 A;  1OHF A;  4Y22 A;  2NP0 A;  1DQ5 A;  1OLR A;  1XNC A;  4LBL A;  2ADD A;  4NPR A;  5F5C A;  4CU8 A;  1XB9 A;  2R07 3;  4N53 A;  3TOJ A;  3ON7 A;  4AEK A;  4CEY B;  5FZ3 A;  1PZ7 A;  2R30 A;  2HWC 3;  1AX2 A;  1LED A;  3MPP G;  3HWJ A;  1B35 C;  2VXR A;  1PMI A;  1YJK A;  2BU9 A;  1HN1 A;  1SLC A;  1QHD A;  1X8E A;  3CIH A;  2UYB A;  1YJL A;  4NHM A;  1JYT A;  2QQW A;  1OQD A;  1F9K A;  4BLI A;  1WCQ A;  2ARE A;  4RYD A;  5LBC A;  4U2A A;  2AEY A;  3M3C A;  5DPN A;  1WCK A;  3ZFG C;  1WUV A;  1PK6 B;  4XVH A;  2A3Y A;  5CEH A;  4K20 A;  1JZ8 A;  4IV1 A;  5KWR A;  5FPA A;  4WV8 A;  4YZ4 A;  1LOF A;  5A3O A;  4Y1Z A;  4QX8 A;  3ST7 A;  1UZY A;  3TN9 3;  3UV9 A;  3H8O A;  2W08 A;  4QKD A;  2X53 S;  2K9Z A;  4L97 A;  4QX7 A;  1X7N A;  3SH4 A;  2WNV C;  3NVC A;  3GJB A;  3THP A;  1PX4 A;  3VDC A;  1IQD C;  1QJU 2;  1N3P A;  2RS1 1;  2SLI A;  3RYR A;  2O14 A;  5JSO A;  3FHI B;  3ZIW A;  3KF3 A;  1SLL A;  1ZRF A;  1RYY A;  3LPF A;  3I3B A;  4NN0 A;  4LOS A;  2TUN A;  1TNF A;  3K4Z A;  3AVR A;  4GUL A;  3O1U A;  1RMU 1;  4GA9 A;  4YW5 A;  2ZJC A;  1W04 A;  1XE7 A;  3CF6 E;  4HKO A;  1JBC A;  1LHU A;  2TEP A;  1O8P A;  5F8P A;  3HJR A;  4OHZ A;  4A6O A;  4QPY A;  4URT A;  4IE0 A;  1C57 A;  1OLM A;  1V00 A;  3BYW A;  1BK1 A;  3LFI A;  1C1L A;  2H0B A;  2K2S A;  5FJK A;  4PF5 A;  4V1P A;  1RTV A;  5JPM B;  2X09 A;  1HXS 3;  4YW7 A;  1GZW A;  2RMU 3;  1PZ9 A;  3HEI A;  3UKN A;  2ZX2 A;  3B7Q A;  3CZJ A;  3EBR A;  4I02 A;  4YPJ A;  1A34 A;  2JEM A;  4OUS A;  5LK7 B;  2ZGR A;  4ES8 A;  3J7N A;  4MOA A;  1RHI 2;  2VG9 A;  3JB4 C;  4HPK B;  5JSP A;  1J59 A;  4JHT A;  4Q4Y 3;  2WZR 1;  3AKQ A;  4CUA A;  4XFB A;  4RGA A;  4AYU A;  1RC6 A;  4BQW A;  3EB7 A;  3GGL A;  3VBU A;  2P2K A;  2HWE 2;  5C8C C;  1GP4 A;  5LBF A;  3USU B;  4BK5 A;  5T55 A;  1ULF A;  1PNF A;  3KCY A;  4LKS A;  2JDK A;  3BVC A;  3ZX7 A;  4Z82 A;  4M00 A;  4R9B A;  3TYJ A;  4WVW A;  1BMV 2;  3QH7 A;  5IJR A;  2YBS A;  3I2D A;  3N7L A;  1EAH 1;  4UWD A;  2LRP A;  4QPI A;  1W3V A;  4EE2 A;  1H9W A;  2K0G A;  4AHW A;  3D82 A;  3K4A A;  1AR8 3;  2P3J A;  1RUH 3;  5JWP A;  4QX0 A;  5IAX A;  2GND A;  1IS6 A;  4IES A;  4E4H A;  4CCN A;  3IDE A;  5B4N A;  2OT7 A;  1VBA 3;  2EIC A;  1NCQ C;  1RUC 3;  3HN1 A;  4P9J A;  5J98 B;  3I97 A;  5GKA C;  4B1M A;  4HK8 A;  2IXK A;  4NIH A;  1FOD 3;  1S2E A;  1VP6 A;  5IYY A;  3GXU A;  5I0U A;  1O4Z A;  1AVB A;  2GMM A;  4YFZ A;  5GZE A;  1H8T A;  1B09 A;  1C1F A;  2ZGO A;  4XFA A;  3SH5 A;  5DAW A;  4OVE A;  2D6P A;  4FAG A;  4OFG A;  4Q8K A;  4A7K A;  3AJZ A;  2HWE 1;  2MNG A;  5KXC A;  3TWI A;  3ZSK A;  4XAC A;  4GMP 3;  3B74 A;  4C91 A;  3ZDV A;  2W1W A;  2WLQ A;  5A6Z A;  3I4I A;  5A7N A;  1APN A;  3JU9 A;  1XYO A;  1UYP A;  3ZSE A;  2WYF A;  2R16 A;  4K21 A;  4QB1 A;  4XAA A;  4FMM A;  1JHN A;  2E53 A;  5FXW A;  4EN8 B;  3ZYG A;  1F2N A;  2PYT A;  1UZ0 A;  2B4K A;  4BXF A;  1CQ9 A;  1H1A A;  4DRR A;  1I5P A;  1IPJ A;  1Z7S 1;  1VBC 2;  2VD7 A;  2ZGN A;  3KGL A;  4YG3 A;  1IQA A;  4FPG A;  1MQT B;  5FP7 A;  1OH3 A;  2RJ2 A;  3PU3 A;  4QPG B;  5DZG A;  1QXP A;  1A78 A;  4AZZ A;  1R1A 2;  3JD7 2;  3DL3 A;  3GZT B;  5J09 A;  4QM9 A;  1BVV A;  3KV6 A;  1V9U 1;  4AK3 A;  3HNY M;  2R06 1;  5FZO B;  4GD4 A;  1TG7 A;  2BV4 A;  1N1T A;  1AXY A;  2OW4 A;  3C8X A;  4FPK A;  1AR9 2;  1C5H A;  5I0T A;  2A6Z A;  4CDQ C;  5FQ0 A;  5F6L B;  2B9V A;  4LEJ A;  1POV 0;  4M3C E;  4LXL A;  2XLF A;  1YLL A;  2VQT A;  3EMR A;  3HMY A;  2B39 A;  1ZBA 3;  1AUY A;  2JG8 C;  1LOD A;  3S7E A;  3MZH A;  3N35 A;  3LD8 A;  1FOD 2;  5LAS A;  1W6O B;  3R4D B;  5BNO C;  1PIV 2;  3AYA A;  3OPW A;  4AI9 A;  4F7Z A;  5D8A C;  5TSW A;  4DFS A;  1G86 A;  1VBC 1;  3B00 A;  5JXJ A;  4QKB A;  2X29 A;  1PO1 3;  1W8W A;  1UKR A;  4MGY E;  3HVD A;  4CDX B;  4Q4W 2;  1NUK A;  4XAE A;  3R6S A;  2WFF 3;  1R1A 1;  3JD7 1;  2UWA A;  4X8P A;  4XQW A;  3RNS A;  1LGC A;  1BK0 A;  1KIT A;  2OZJ A;  3CHX A;  1D4M 2;  4LE3 A;  4O9G A;  5IK4 A;  4Y26 A;  4ASL A;  2GU9 A;  2RS3 1;  2ZHN A;  3GZA A;  1PVC 2;  5F5I A;  2W3J A;  2VMH A;  1JOD A;  2ZA9 A;  1AR9 1;  1CPM A;  1KEX A;  1W6M A;  4FP3 A;  5FZ7 A;  1E5I A;  4BCU A;  3T1L A;  3ZFE A;  4XE9 A;  4A7Y A;  1KGY A;  1BBT 2;  2ZML A;  3IAQ A;  2W94 A;  2QQI A;  4XYX A;  1SLT A;  2OA2 A;  2WII B;  2E33 A;  3NJX A;  1SDW A;  3DPR A;  4L11 A;  3HX3 A;  1AL2 2;  3AVS A;  3ZSJ A;  1PIV 1;  4WM8 A;  4XF0 A;  3ATG A;  2C1F A;  3FUO A;  3WD5 A;  5C3P A;  4A41 A;  3DYP A;  3MDP A;  2VCM A;  2JIJ A;  1WGP A;  1V6K A;  2YUE A;  2ARA A;  4OMK A;  1N3O A;  2R0F A;  4Q4W 1;  4CZS A;  4GAL A;  4IEU A;  4D6Q A;  5DXD A;  2BQP A;  1OIP A;  1LHN A;  4YFW A;  1SCR A;  1YUD A;  1D4M 1;  4MZU A;  1SLB A;  1TME 3;  2FZ2 A;  2C4X A;  2W9X A;  3GZE A;  1BQP A;  2VNG A;  2Q5T A;  5J96 B;  1WBF A;  1VBE 2;  3T30 A;  2V5D A;  5FYH A;  2BNM A;  4FO9 A;  4RHV 3;  2ZMK A;  3BPZ A;  5JCT A;  4IND A;  1UX6 A;  3KZ4 C;  4R4Z A;  5EQU A;  5G05 L;  4QT6 A;  1LB2 A;  3WP3 A;  3BOW A;  3I3Q A;  4IEZ A;  4PDW C;  3THD A;  3MLL A;  1RXG A;  5FIX A;  2BFU L;  3X29 B;  4MGZ E;  3BPS A;  1K5M C;  2ZX1 A;  2VMC A;  5FRA A;  3I3M A;  2DVD A;  5KR7 A;  4LBM A;  4LLO A;  1W9S A;  3NV3 A;  4JRL A;  4K8F A;  1OC1 A;  4MHR A;  3III A;  3J8F 2;  5FYM A;  3RDI A;  5CFD C;  1CPN A;  1PO2 1;  4N43 A;  3SNM A;  4AQ2 A;  1G9F A;  2D5F A;  1KQR A;  1HIX A;  1ND2 B;  4PCR A;  2D5H A;  1OT5 A;  1Q56 A;  4CA9 A;  2Y6L A;  4ISR A;  4PIX A;  4I0A A;  2C9K A;  4AFC A;  1F8V A;  2Z79 A;  4PJY A;  1BYH A;  1VBB 2;  4QDS A;  2EIG A;  2YHJ A;  1NXM A;  3U75 A;  2XGX A;  3MV0 1;  4HK9 A;  1H9P A;  1WMX A;  5CA6 A;  4LKE A;  1ENR A;  3U0Z A;  3EHK A;  2QQU A;  4DUW A;  4LBQ A;  5T5L A;  3AX4 A;  4DIQ A;  1PHM A;  4ZU4 A;  1ST8 A;  1COV 1;  3LZZ A;  1XNT A;  3AP5 A;  4Y20 B;  4BIS A;  1MS0 A;  5AVP A;  3B94 A;  3WIN E;  2VOV A;  5JMO A;  1AXK A;  1JN2 P;  4DEQ A;  1F35 A;  5A33 A;  1AJK A;  4W8J A;  4GIQ A;  5L7O B;  1XQN A;  2W68 A;  1VRH 2;  2XJR A;  2B42 B;  2CNA A;  1SFY A;  3J8F 1;  2V72 A;  4M0N A;  1UQX A;  5FKB A;  3GHM A;  1UU4 A;  3HQX A;  4MYE A;  1W28 A;  4S2F A;  2GC1 A;  2WN3 A;  1I9R A;  3MEP A;  1UPS A;  2R0H A;  5J36 A;  5ANQ A;  3UL2 A;  2VTX A;  3MPB A;  4ZPI A;  4A4A A;  5JIA A;  5F3C A;  4UF0 A;  4CP2 A;  4D7Y A;  1VBB 1;  3IMN A;  1OIZ A;  1QNW A;  5FY7 A;  1WWY A;  1OFN A;  5A3W A;  5A3L A;  3KV4 A;  3VL8 A;  4CDU B;  5IVC A;  5JXG A;  4RD7 A;  4RS5 A;  4SLI A;  4RA0 A;  1HRV 3;  1W6N B;  4OYU A;  5T52 A;  1X8M A;  4JHZ A;  3H1M A;  2PLV 2;  1DYO A;  3VBS A;  4K6B A;  1R09 3;  4B1L A;  3WR0 A;  2WUH A;  2WJS A;  2OUJ A;  3LIH A;  2OUH A;  4I30 A;  1TNR A;  5GLZ A;  2WO7 A;  1W9F A;  1WLC A;  1FMD 1;  1VRH 1;  2Q8E A;  3NV1 A;  3SEP A;  4C0B A;  3ZKY A;  4OMJ A;  5HXM A;  1XNK A;  1UIK A;  3JXS A;  4XCB A;  2XVG A;  5E16 A;  5IVY A;  1RB8 G;  2WIN B;  3VN4 A;  5I8T A;  1I6X A;  2XVK A;  5D2A A;  4LK7 A;  4H14 A;  1HW5 A;  2O8O A;  1GQH A;  1WD4 A;  2ID4 A;  3POE A;  4GWI A;  1AYN 3;  1K5J A;  3NW4 A;  5FOJ B;  2C6S A;  2VQ0 A;  2HWF 2;  2VNR A;  1RUF 2;  2KA3 A;  1F4A A;  2CWS A;  1CAW A;  2XOM A;  3CBN A;  3POI A;  2PLV 1;  4Q1P A;  4Y1Y A;  4LMF A;  2ERF A;  1AYM 1;  1UYY A;  2VUJ A;  5L73 A;  2BWC A;  1O7F A;  2ZEX A;  3CQO A;  1CR7 A;  1IKQ A;  2E7T A;  2R32 A;  3FFQ A;  2FD8 A;  3ZXA C;  3Q8C A;  4QGN A;  5FPZ A;  2Y6G A;  1IPK A;  3T4V A;  3VBH A;  4ES9 A;  1A8D A;  2WO1 A;  2WT2 A;  2VZP A;  4K1Z A;  3UYJ A;  4J7Q A;  3J4U H;  2YU1 A;  2V09 A;  2D93 A;  1AX0 A;  3HNM A;  3MBW A;  4JGZ C;  4QXB A;  2I74 A;  2WZE A;  1DQ6 A;  4IEO A;  3FHA A;  4LHK A;  5IVE A;  5DDJ 3;  3DYO A;  2DU1 A;  1Y3T A;  1BKZ A;  1RUF 1;  3L2H A;  5FZ6 A;  4HSJ A;  4W4Z A;  3IB3 A;  4LBK A;  3PEG A;  2Z2S B;  2W52 A;  4FBF A;  1ZBE 3;  1LU2 A;  5DUX A;  2FCV A;  4CU7 A;  1RUG 3;  1RUI 3;  1J83 A;  2P34 A;  3N7J A;  4XUR A;  4C1X A;  2ARX A;  2LM3 A;  3D5O A;  2J1E A;  2VVE A;  4K3U A;  2Y6H A;  5SV5 A;  1QNY A;  1YXW A;  2DBN A;  2QZ2 A;  2X5I B;  5FZK A;  3RZG A;  4LPL A;  1HJF A;  1YIF A;  3OBT A;  2IXH A;  4DPN A;  2RM2 3;  1CAV A;  3FLT A;  5DAP A;  4BQ5 A;  5A6Q A;  3Q8G A;  1LJ7 A;  5FP4 A;  4B4P A;  5C9A A;  2QQK A;  2WS9 2;  4XUP A;  3WOG A;  4J6G A;  3O1T A;  4Q4X 3;  1W8H A;  4MX3 A;  1UY4 A;  1PGW 2;  2W91 A;  2QQL A;  4P02 B;  4ASK A;  4CCO A;  1SZB A;  3MUY 1;  1IG0 A;  2YPD A;  3OY8 B;  4RSU A;  1GZ9 A;  4DS0 A;  1IS3 A;  5FYC A;  1W3X A;  2XJP A;  3QLQ A;  1ZYB A;  3RQ0 A;  1Y9Q A;  1KJL A;  2IUW A;  3CJI B;  4A2U A;  4XF9 A;  3SLI A;  2D6N A;  3PUI A;  4QD2 A;  1QWR A;  1ULD A;  1XU1 A;  2HBT A;  2XKO A;  2JXA A;  3LFM A;  4Q0S A;  4QPW A;  1GNZ A;  1QQP 2;  2TNF A;  3H8R A;  4LUL A;  3F95 A;  1C8M 3;  1OKQ A;  1NY7 2;  5FZH A;  4Y22 B;  1H2L A;  2HWD 2;  1F5F A;  2CYF A;  4N53 B;  2WS9 1;  3E6D A;  3ZYH A;  1A6C A;  2QKD A;  3PUH A;  1Y43 B;  2FDH A;  1LGB A;  3OEB A;  4MGK E;  4UFL A;  5M0T A;  5FYI A;  1PGW 1;  2W1U A;  3BCW A;  5E89 A;  2Y60 A;  4NHY A;  1ZRE A;  2KM2 A;  3UJO A;  2GAU A;  2Z5W A;  3IIA A;  4CCM A;  4RR3 C;  4YVS A;  1W8F A;  2PHX A;  5BNN A;  1AR6 1;  4GH4 C;  3UNP A;  1RUE 2;  3ZXJ A;  2CV6 A;  4AFM A;  2YY1 A;  2JE7 A;  5K4L A;  1NAE A;  4IV1 B;  1SHW B;  1OMI A;  1TMF 1;  3KF5 A;  2LAL A;  1OKO A;  1N1Y A;  5HCH A;  1AUA A;  2QDN A;  2Q1F A;  1GOH A;  3RVH A;  3WCS A;  1QQP 1;  3FN9 A;  1QDC A;  1CJD A;  3C3V A;  4XUT A;  2R04 3;  4GQ7 A;  1PMH X;  1XNA A;  3J26 N;  4AEJ A;  2Y6K A;  4QX3 A;  1NY7 1;  2JIG A;  3ELN A;  5ACA 3;  1WLT A;  1G9C A;  5EYX A;  3B5L B;  2RS5 3;  2IFR A;  2HWB 1;  2VCA A;  1IGO A;  4IV3 A;  4D8M A;  1WW5 A;  2VBB A;  3OBR A;  5J48 A;  3POG A;  4IGO A;  4EQV A;  5EPA A;  1FPN 2;  3NWK A;  1CWP A;  1TZO A;  5FZ4 A;  4CEY C;  3MIC A;  2B5H A;  3PUR A;  3N9Q A;  4Y1V A;  3FJS A;  4R9A A;  2C0Z A;  4DEV A;  2EID A;  1NOV A;  4A42 A;  1DGR A;  1GWK A;  4A45 A;  4CRQ A;  1O4Y A;  1RUE 1;  1XE0 A;  2KD7 A;  1DZQ A;  1UY0 A;  3AKT A;  3ZXG A;  2IVI B;  1YFY A;  4WM7 A;  3FBY A;  1MZ5 A;  1GZW B;  1X33 A;  4XZU G;  4P9W A;  1ZZ6 A;  5A6Y A;  2JDM A;  1PK6 C;  1UMI A;  3T0A A;  3LA3 A;  2F4L A;  2AUY A;  5LB6 A;  2Q8C A;  3AL5 A;  3HR9 A;  1GU3 A;  1S0B A;  4AI8 A;  4AED A;  3POS A;  1SCS A;  3ZN6 A;  1AZD A;  1F4H A;  3VBR A;  4AL9 A;  1DP0 A;  2C5D A;  5I8Y A;  2NZ9 A;  1DU3 D;  1XRU A;  3ACG A;  4CXY A;  4R52 A;  3VD7 A;  2XJT A;  4AFB A;  4XMI A;  4NAM A;  3D3A A;  1QXR A;  4BPZ A;  1LEM A;  2RR1 3;  1FPN 1;  3ZYI B;  3VBU B;  4IW3 A;  5ABJ A;  1RVF 2;  4CVU A;  4RN5 A;  4D7S A;  2GDF A;  3M3I A;  4AG4 A;  2Q1Z B;  3NJZ A;  5IVF A;  1C3H A;  4AVS A;  1XU2 A;  3ZR6 A;  2ZEY A;  1LKN A;  4JC1 A;  2VZQ A;  2DU0 A;  3PUS A;  4HON A;  4QPI B;  5G04 L;  5BV6 A;  1OPM A;  2E6V A;  4JQT A;  5F32 A;  3GAL A;  1GR3 A;  1EV1 2;  4LA2 A;  1Z78 A;  2QJV A;  3T4H B;  3KVA A;  3VZN A;  3WQB A;  1HLC A;  3EQE A;  5C6C A;  5LZ6 A;  3OSD A;  2BEO A;  1JTZ X;  3PVN A;  1ENQ A;  4CDW A;  2Y64 A;  2F6B A;  1YYN A;  3ILR A;  3SHR A;  4MGS A;  2VZO A;  4JTO A;  4QU1 A;  2FDJ A;  3BU7 A;  1H8T B;  3RYK A;  1GLH A;  1OQ1 A;  1JUI A;  2WNU A;  1V6J A;  1OUX A;  1RVF 1;  1S1A A;  3MIE A;  5GLV A;  2IXJ A;  5LBE A;  3B02 A;  3Q9O A;  4FPE A;  1QOT A;  4H55 A;  4D94 A;  2DWR A;  4P9G A;  3UGG A;  4HFS A;  2QQV A;  2Y8K A;  2ZCW A;  4RGG A;  5A1A A;  1AL0 G;  5AC9 2;  1MZ6 A;  3PTR B;  2YV8 A;  5CFC A;  5KXD A;  3RYP A;  4O61 A;  1QJX 2;  3SQO A;  1O5U A;  2OPW A;  4XOG A;  4CXW A;  2ILM A;  3B7N A;  2W47 A;  3SMH A;  4X6R B;  2BER A;  5J37 A;  5FY0 A;  1Q8Q A;  4R9C A;  1TQ5 A;  1HKD A;  3O0V A;  4NHK A;  5JDB A;  2H6B A;  3DEC A;  4B4Q A;  4BWO A;  1PX3 A;  1CZV A;  4NPM A;  4BYY A;  1H6X A;  4OHV A;  1RUD 1;  3IT8 A;  4AQT A;  2MEV 3;  3POW A;  1H1I A;  3GNE A;  3PUA A;  2DCY A;  1LTE A;  2JE8 A;  3O1V A;  2WNE A;  4XBL A;  5I0D A;  2RS1 3;  2WQ8 A;  5FQ0 B;  3WEZ A;  1XYP A;  2WRA A;  3LDK A;  1EP0 A;  5DUW A;  5BNQ A;  1BHG A;  4YW1 A;  1NXD 1;  1JHJ A;  1KJR A;  4QB2 A;  5FMD A;  2JDH A;  1RMU 3;  3WZ1 A;  1ND3 A;  3VDA A;  2JD4 A;  4HXC A;  2XBO 2;  2BFU S;  3PDQ A;  1SBF A;  1LOE A;  1XBF A;  3AKP A;  1VB2 A;  4MXV A;  2O8Q A;  2XJQ A;  1NQJ A;  3SEE A;  1DGW A;  1OD5 A;  3DCQ A;  3V65 A;  1O3T A;  5IK8 A;  5C8W A;  1OVP A;  5FPB A;  5A7W A;  1XND A;  5EIY B;  2J1V A;  2VE1 A;  3U11 A;  1ZA7 A;  1MQT C;  4TLG A;  4Q4V 2;  2DTY A;  4QPG C;  2FDG A;  4YGD A;  4XJ8 A;  4YZ1 A;  3WDV A;  5I0R A;  3A23 A;  4FXK B;  4OUE A;  3S5Q A;  4R9D A;  2PTM A;  3AZV A;  4PQQ A;  1W6M B;  4R4X A;  1NA1 A;  3ZFE B;  5AFB A;  3WP5 A;  4W65 A;  3WLU A;  2VO5 A;  3W67 A;  3BN6 A;  4DQA A;  2QQO A;  2WDB A;  4FCA A;  2DUP A;  2VZ1 A;  3S30 A;  2GC2 A;  3WG4 A;  2WZR 3;  4WVV A;  3C7F A;  1W6P A;  3IDA A;  1SBD A;  1HJG A;  2VOT A;  2AEZ A;  3DPR B;  3WQ7 A;  3ZM8 A;  1YC6 1;  1CVN A;  3NNF A;  3HY5 A;  1ZZB A;  2VAU A;  4MHU A;  4QXH A;  4WM8 B;  4ATF A;  3HAG A;  3MFC A;  1Y7B A;  2XBO 1;  1SLI A;  4GXL A;  4GB3 1;  1HRI 2;  2YPJ A;  5FXX A;  5JVV A;  5FY5 A;  4O7X A;  4Y33 A;  3LGR A;  4CPB D;  1F5J A;  4DMI A;  2VUA A;  4FTS A;  2GN7 A;  2JE9 A;  3HIF A;  5CKM A;  5GLU A;  4H3W A;  4XFH A;  2XML A;  1UY1 A;  4Q4V 1;  4CDX C;  1WKY A;  4EN9 B;  4KI5 M;  3R0R A;  4XF4 A;  3AYD A;  3FHQ A;  4OI2 A;  4AQ6 A;  1ASJ 2;  3N7K A;  4AXO A;  1D2Q A;  4EZ4 A;  1Q8P A;  1S0J A;  2Z69 A;  3CNA A;  2ES3 A;  1ALY A;  2VZV A;  5EJ3 A;  1MR5 A;  4Z07 A;  4DXS A;  3WW1 A;  3ZO0 B;  5FYY A;  3RI8 A;  3A0N A;  4JGY A;  2A7A A;  4GJZ A;  3WHU A;  5KHG A;  1ZVF A;  4BLJ A;  4M8Z A;  2NMO A;  5IHR A;  4AAP A;  5C3S A;  3FUQ A;  5CG9 A;  3RWN A;  4NRM A;  1YRZ A;  1W2T A;  5C70 A;  3DKW A;  1Q43 A;  1HRI 1;  1SQ4 A;  2R07 2;  5BNP A;  4WVM B;  3HN3 A;  1O8S A;  1OPO A;  3FX3 A;  4JX0 A;  4KWL A;  3OGJ A;  2HWC 2;  4MGI E;  3U4X A;  2R6Q A;  3R4S A;  4N43 B;  4I0W B;  4ISQ A;  1W03 A;  4OI4 A;  3VZJ A;  2Q30 A;  4XDO A;  2DDU A;  4UBG A;  2DVG A;  4QKF A;  4AWD A;  2DBI A;  4NRP A;  5DAB A;  1QJU 1;  4GKX A;  3NAP A;  5K0U A;  2EXK A;  1Z7S 3;  2ZGT A;  3IDB B;  4XBQ A;  1ZA4 A;  2PFW A;  3Q8A A;  3UT0 A;  2CGP A;  1ZNP A;  1DHK B;  3WSO A;  1GSL A;  1ASJ 1;  3PVB B;  5L9V A;  1UKG A;  1I3H A;  2QNK A;  5L36 A;  3TN9 2;  3ZN4 A;  2E2X A;  3ZMO A;  1V9U 3;  5HXV A;  3VBF B;  2R06 3;  1K3I A;  2PN5 A;  2A70 A;  4K8R B;  1DFQ A;  4LO7 A;  4COV A;  4LBQ B;  5L9B A;  3AMM A;  4M4P A;  5LA2 A;  3ENR A;  4G4F A;  4TWT A;  2IFW A;  4UFM A;  1EPZ A;  3VHP A;  4A44 A;  4YSF A;  2HYK A;  4Y4R A;  4LT5 A;  1YO8 A;  4TYS A;  3RG0 A;  5E1R A;  1P8J A;  1ULP A;  1ZZ9 A;  5A33 B;  4YVW A;  4GMP 0;  3LOI A;  2VNO A;  2P3K A;  4YNI A;  4UFI A;  4QGM A;  4NHL A;  4QQ2 A;  5LK5 A;  4BQX A;  2HWC 1;  3VL9 A;  1NE4 A;  2D6K A;  1JW6 A;  2DVB A;  3FWE A;  3OUH A;  3KV5 A;  4GZ9 A;  5HCA A;  2VZU A;  3NV2 A;  4BME A;  2XWB B;  3UJQ A;  4LIV A;  1L3J A;  3EJK A;  3ES1 A;  5BUV A;  3O1S A;  1WCS A;  3OD4 A;  2O0O A;  1RHI 1;  5H9Q A;  4UF0 B;  1DGW X;  3AZW A;  1EUT A;  4XW3 A;  1ND2 C;  2VL4 A;  1HXS 2;  2XH6 A;  3TN9 1;  2RMU 2;  3OGG A;  1L7R A;  4RS5 B;  4PLN A;  2QQM A;  1S0D A;  3WG3 A;  2RS3 3;  1R08 3;  2DUQ A;  1G7Y A;  1BXH A;  2XVL A;  2ZGQ A;  3KLS A;  3T08 A;  3VBS B;  4LUM A;  2CHH A;  2OS2 A;  2SBA A;  3C7E A;  3JZV A;  1SG3 A;  2GNM A;  1JYN A;  3T2O A;  1PVX A;  3VDD A;  3OTF A;  3HOB A;  3MO4 A;  2C9A A;  2WT0 A;  3NJV A;  4YZ5 A;  3KMH A;  1BMV 1;  1QJY 3;  3VKL A;  1CZT A;  1MS8 A;  2WA4 A;  1AF9 A;  4NRO A;  2JWP A;  1MEC 3;  2XUE A;  4Q4Y 2;  1UL9 A;  2W5F A;  4S2H A;  4YW3 A;  4DB5 A;  5FO8 B;  3W68 A;  4HSL A;  4XJA A;  3HQR A;  1UYX A;  5L7O C;  5A1L A;  4ZKT B;  5FZF A;  1U5I A;  3V64 A;  2J7M A;  4L99 A;  2GSY A;  3U37 A;  4CEW A;  4H2A A;  1KD7 A;  1RED A;  1UF2 C;  5F3E A;  2JD9 A;  2RDQ A;  2RDR A;  3WDU A;  5FO7 B;  2GME A;  4QDR A;  3GBW A;  2V73 A;  4UW4 A;  3USS A;  4F3J A;  2QQN A;  2RMU 1;  2G9F A;  3I2H A;  1H8V A;  1AR8 2;  1RUH 2;  1CAW B;  2P1B A;  3MGU A;  4MG2 A;  4JDN A;  1RXF A;  2JKB A;  3EO6 A;  3ZYB A;  2PHU A;  4PF1 A;  1VBA 2;  4RQP A;  4XFI A;  2NN8 A;  4YG6 A;  3NL1 A;  3VZK A;  1RUC 2;  2DCZ A;  4CDU C;  2VPV A;  1VPH A;  5JZG B;  5JAX A;  1S55 A;  1MS1 A;  1IOA A;  2Q4S A;  4NPL A;  1KS4 A;  1V6L A;  4KWJ A;  1W8U A;  4Q4Y 1;  1UZV A;  2ZPX A;  4FQ4 A;  4JKL A;  1XYN A;  2B45 X;  4P5H A;  4Q0V A;  4QQH A;  3B01 A;  1T6G C;  3VBH B;  3A22 A;  2CL2 A;  1Q8S A;  5DZE A;  4UFH A;  3L9J T;  4Q1R A;  4NMI A;  2A73 B;  3B7M A;  3O14 A;  2JDN A;  1MAC A;  1D4V B;  2DV9 A;  4RR3 A;  3D0J A;  2CWM A;  2VTF A;  4BIF A;  5GAL A;  4LO4 B;  1X50 A;  1YCI A;  4GH4 A;  1PO2 3;  1W39 A;  1QEX A;  2PAK A;  2ZEZ A;  2ZGS A;  1JZ2 A;  4FSJ A;  2AC1 A;  4R8H A;  2ZGK A;  1G9B A;  1CN1 A;  3WY6 A;  2JEN A;  1JOB A;  1YI7 A;  1RUH 1;  4UOJ A;  3R4U A;  2FDF A;  4ZU7 A;  1UYZ A;  3MUZ 1;  4HVR A;  4FTE A;  3VV1 A;  2A3X A;  4A6S A;  3KHC A;  1OA2 A;  1VBA 1;  1WD3 A;  1IZ3 A;  3ILN A;  4FFH A;  1JU4 A;  1POQ A;  1NQD A;  1UZZ A;  1XE8 A;  3ZPO A;  2CGN A;  2DFB A;  2O1Q A;  2J1U A;  2QBX A;  4FOV A;  4HG6 B;  4CCE A;  4UBH A;  3VHO A;  1RL3 A;  1FOD 1;  1UMH A;  4C1W A;  4B4R A;  3WF3 A;  2RDS A;  3MIH A;  4D69 A;  3KCX A;  4XFC A;  1DLC A;  3WNX A;  2C24 A;  4FT8 A;  4XC9 A;  2QVS B;  1COV 3;  4LE4 A;  3I59 A;  1CAV B;  1S0I A;  2VME A;  4G3Y C;  5C9A B;  1K12 A;  1J84 A;  1E5S A;  4GMP 1;  1ZBA 2;  2VBD A;  5FYV A;  2QZ3 A;  4ZS2 A;  4KH9 A;  4OMD A;  5LY2 A;  2F17 A;  3WP4 A;  4NIG A;  5EV7 A;  2ZAC A;  3N9L A;  4G9S B;  4XMA A;  4CCJ A;  3LPG A;  1PVC 1;  4AAX A;  3HPN A;  4BIO A;  1R5L A;  1OFS A;  2D6M A;  2NM1 A;  4XEZ A;  2ZZJ A;  3KT1 A;  3SXW A;  4D6R A;  5GLW A;  3IAP A;  1PO1 2;  3H7J A;  1BBT 1;  3U78 A;  4YM2 A;  2AZ5 A;  4B8E A;  1L7Q A;  2WFF 2;  2E7A A;  1LNS A;  5FK7 A;  4LA3 A;  1BZW A;  2Q8O A;  2IC1 A;  3N9M A;  3LB9 A;  2W87 A;  1JYI A;  3QH6 A;  2J1A A;  1AL2 1;  3B9C A;  4ZON A;  1K45 A;  4COU A;  1U12 A;  4KGG A;  5I93 A;  4FXG B;  4M3C A;  1QMJ A;  1T6B X;  3POF A;  4QM8 A;  4BM8 A;  4COY A;  3EXU A;  2PHL A;  2IWG B;  4JCK A;  3ALQ A;  1BJQ A;  4M4R A;  4QKN A;  1YQ5 A;  2X5I C;  3V0B A;  1FMD 3;  1MS3 A;  3OF1 A;  4FOW A;  2RDN A;  3SIS A;  1ZBA 1;  4I3G A;  5H9R A;  1YHF A;  2CSG A;  2BPA 2;  4XF1 A;  3KVB A;  3ZXL A;  3LDR A;  4ZZ5 A;  3ZFF A;  4BDV B;  1LUL A;  3A0K A;  4I0B A;  4YVS B;  3O12 A;  5CNA A;  5BNN B;  1VBE 1;  2E26 A;  2V4V A;  5GZC A;  4UFK A;  2UUR A;  5BY5 A;  4LBO A;  4HMZ A;  2IXC A;  5A1F A;  1PO1 1;  2HLE A;  3NST A;  5F5A A;  5JOZ A;  2OYZ A;  1CON A;  2WFF 1;  4PBP A;  5FO9 B;  3E5Q A;  3H8X A;  4XJ9 A;  2OII A;  4YM0 A;  3CJI C;  1TME 2;  3AL6 A;  2AYH A;  4MET A;  3AZY A;  4MSV A;  3ZMN A;  1POV 1;  4CXX A;  1DZT A;  1UWW A;  4W6X A;  1AYM 3;  1V6O A;  5EWS A;  4B7E A;  2ZX4 A;  2WSV A;  4RHV 2;  5H9S A;  3S5A A;  1OVS A;  4IV3 B;  5EYY A;  3C7H A;  2NYY A;  1ZZ7 A;  2PAE A;  5FV3 A;  2DCT A;  3B7Z A;  4Q8L A;  1UX7 A;  4DXZ A;  4WZF A;  2QFE A;  1G9A A;  1DG6 A;  2BOI A;  5FZA A;  3H3L A;  2EAK A;  1NT0 A;  1O59 A;  2J22 A;  2IXL A;  1PMJ X;  3DF0 A;  3NNG A;  5HPO A;  1WLW A;  2ZS6 B;  2JG9 A;  4ZXE A;  3POJ A;  5F3G A;  3POY A;  2GC3 A;  2XWJ B;  3N9N A;  2Z4F A;  3FZ3 A;  3CLP A;  2H0V A;  5CYY A;  1XXN A;  3G7D A;  3VZO A;  4WM7 B;  5C33 A;  3K4D A;  5B2G B;  1W0O A;  3RMY A;  2WQ4 A;  2NLR A;  4OQ9 A;  4IV1 C;  4AED B;  1AX1 A;  1OXC A;  1DYK A;  3NNL A;  2B46 X;  1ENX A;  5JPN B;  3CZU A;  5FZ1 A;  1OD3 A;  3AYE A;  3ORJ A;  3VBR B;  2BUK A;  3ZN6 B;  4B7K A;  3C7G A;  4AHZ A;  3LA2 A;  4RHV 1;  5FYU A;  3FBM A;  2VQA A;  2ZGM A;  1NLS A;  1NCR A;  2VUL A;  2XHN A;  2DCK A;  3FE5 A;  1X9P A;  4IER A;  5D21 A;  4ARY A;  2WFP A;  3I49 A;  4U36 A;  3H0O A;  3RZZ A;  2BZD A;  4AQS A;  1BEV 3;  2ZGL A;  3H42 B;  3LQC A;  5C7G A;  1HQL A;  4M01 A;  1VAL A;  5ABJ B;  3AK0 A;  4PI0 A;  4AI1 A;  5ERL A;  1XPW A;  1UU6 A;  5IFT A;  4TTG A;  5B4X A;  5C71 A;  3E6B A;  2JDP A;  2I2S A;  5CB7 A;  4DUV A;  4LKD A;  1OOP A;  3ZR5 A;  1FAT A;  4XDQ A;  4P00 B;  3VBO A;  4QX5 A;  2D40 A;  2JDY A;  2VCB A;  4IET A;  3IN9 A;  4HN0 A;  3WCR A;  4PQ9 A;  4KG0 A;  3VGI A;  4N8M A;  3WUD A;  3BTA A;  5LEK A;  3LDB A;  4M0H A;  3VKF C;  5KHI A;  1QY4 A;  3RJ2 X;  3THC A;  1WMF A;  3CEW A;  4FPJ A;  4DOU A;  4CDW B;  3T0D A;  3U14 A;  3KSC A;  3DV8 A;  1STM A;  3V0A A;  4IQP A;  1V6N A;  3RI9 A;  1B35 A;  4KGQ A;  5FZG A;  2UY8 A;  1HRV 2;  3U10 A;  2WAB A;  1CES A;  4MO3 M;  1VBD 3;  2WNU B;  3M2M A;  4K7J A;  4DZG A;  5IFP A;  1R09 2;  1OBN A;  4XCA A;  2FDI A;  3AKS A;  1NLR A;  1W9Y A;  2VEC A;  5CIS A;  5IW0 A;  2Q0A A;  3AMH A;  3BGA A;  3ZFG A;  5HV0 A;  2YC2 A;  4BQ1 A;  4E2Q A;  1W8T A;  3VBU C;  1RIT A;  4YM1 A;  2HWF 1;  3W21 A;  4CUG A;  3QAC A;  1TVG A;  4JAA A;  5CFC B;  2JB8 A;  4BH9 A;  1AR6 3;  4HVO A;  5IWF A;  2WNV A;  4NVP A;  4DRV A;  3VKO A;  3UES A;  1LHW A;  4QPI C;  3VD4 A;  1DYP A;  1S0F A;  5EZW A;  1TMF 3;  4TXW A;  2X05 A;  4BHP A;  1SLA A;  1AYN 2;  3H1Y A;  4OUL A;  1JH5 A;  3CDZ B;  1WCD J;  1HRV 1;  4YGB A;  1VAM A;  2DVF A;  5T54 A;  2XLG A;  2EAA A;  4UW5 A;  1ZM1 A;  1ULC A;  1HB2 A;  3ASI A;  1HB4 A;  2HWB 3;  1Y9G A;  2ARB A;  5JUV A;  4WZC A;  2GNB A;  1UMZ A;  4Y24 A;  1DLL A;  5C5U A;  2IXI A;  1H8T C;  1IS4 A;  5CU1 A;  3GHN A;  3JBG 3;  5A6X A;  5CG8 A;  4YGE A;  5FFO C;  5C4W B;  2XG3 A;  3TEW A;  3PVE A;  1GV9 A;  2K46 A;  2NQY A;  2R1D A;  4BA6 A;  1ND3 B;  4JKK A;  1KDM A;  2MHF A;  3GF6 A;  5GLT A;  5LWB A;  1CX4 A;  3WNO A;  5FP8 A;  4HT1 T;  3PMS A;  2JDZ A;  1HQN A;  4NIA A;  4Y1U A;  1N1S A;  1S2K A;  2WC2 A;  2HH9 A;  2ZXQ A;  1EY2 A;  4K40 A;  2LRO A;  3T2T A;  5A7W B;  3ACF A;  1GBG A;  1PZ8 A;  1O91 A;  5DDJ 2;  3F2Z A;  4C8D A;  1AYN 1;  4O9E A;  1UO9 A;  4BZ4 A;  3D8C A;  1N1V A;  2HYX A;  4Y3O A;  5DAQ A;  5FZD A;  1DQ2 A;  1G6N A;  1D7P M;  1UIJ A;  4MH0 E;  1JYW A;  2Y6F A;  4OI0 A;  4NOT A;  2VR4 A;  1ZBE 2;  4BB3 A;  5C8C A;  5C3O A;  4FI9 A;  4Z1V A;  1NA1 B;  4LTA A;  4AVB A;  1RUG 2;  1RUI 2;  2VW1 A;  4TLF A;  1OQE A;  1CGP A;  2FCU A;  3KQ4 B;  4LBQ D;  1OSG A;  4Q5O A;  1ULG A;  4HAN A;  2BOJ A;  1W6P B;  2GNT A;  4ONU A;  1XSQ A;  4LUK A;  3VHR A;  2QUO A;  4E4D X;  4L8Q A;  1QJF A;  4L2N A;  4H7M A;  2RM2 2;  3DXU A;  3AM2 A;  3K3O A;  5FZI A;  1MVE A;  2BTV C;  2VM9 A;  4AFA A;  2D97 A;  1JZ6 A;  1AR7 3;  2XJV A;  1G9D A;  3O1P A;  5FY9 A;  2GP3 A;  1MVQ A;  2XL9 A;  4Q4X 2;  1NCQ A;  1S2B A;  1QOS A;  2PHD A;  1J1T A;  3A7Q A;  2RV9 A;  4XFF A;  4XAB A;  3JBG 2;  3ZIX A;  1W9W A;  3E5U A;  1JYC A;  3KS7 A;  4XUO A;  2H6C A;  1FNY A;  5DUU A;  5FZE A;  4ASM B;  3OPT A;  2OZ6 A;  5JI7 A;  2YDE A;  5F7U A;  2HWD 1;  2BP6 A;  4IDZ A;  1IPS A;  4LR4 A;  4O65 A;  1QGL A;  1W2O A;  2P5B A;  3OCP A;  2XPJ A;  3DYM A;  1GMM A;  2XKP A;  1RUG 1;  3PVO A;  2HBU A;  3WHT A;  3ECQ A;  3N4M A;  3MW3 A;  4YAR A;  2ARC A;  3T3Y A;  3H8U A;  4JGY B;  1H6Y A;  1C8M 2;  3ZXF A;  3BIE A;  1ENS A;  3ZFE C;  2RM2 1;  2JB4 A;  5LBB A;  5F1R A;  5BNP B;  1HB1 A;  1HV0 A;  2ZKL A;  5DAV A;  5F6K A;  3AFK A;  4OZX A;  3DPR C;  1REE A;  1W0P A;  3WG1 A;  1UXX X;  4Q4X 1;  1JYV A;  4WM8 C;  3FLR A;  1O6U A;  2GN3 A;  3WF4 A;  1M06 G;  2QE3 A;  2YGM A;  1NKG A;  3WW4 A;  3O5S A;  2CY6 A;  2ZAB A;  3S7I A;  1RUJ 3;  3WDY A;  3NAP B;  3H50 A;  4GAZ A;  5K0U B;  2Y0O A;  4Q2F A;  1UPI A;  2I45 A;  2OXB A;  4GKY A;  4NWW A;  5A7S A;  4CDQ A;  3OJB A;  4N7U A;  2WWU A;  3RZH A;  1GIC A;  2BVB A;  4BQ3 A;  3VKN A;  3FLP A;  2E51 A;  3POB A;  4IEW A;  1KRI A;  2WBK A;  2JG8 A;  4NID A;  1RUD 3;  3OGS A;  3UKT A;  4SBV A;  5FZL A;  3WF1 A;  2R04 2;  4GWM A;  4LNV A;  5C3Q A;  4JVA A;  5BNO A;  2IVJ A;  2WR9 A;  2EXI A;  3MF9 A;  2CAU A;  5ACA 2;  2WWS A;  2ZHK A;  1EYB A;  2RS5 2;  5D8A A;  2GC0 A;  5FLJ A;  1CD3 G;  4YVW B;  4A7Z A;  4Z2W A;  3U4S A;  4RGK A;  5GZG A;  2D43 A;  5FYT A;  4KWU A;  3OB8 A;  1FT9 A;  2DYC A;  5FPU A;  1GQP A;  2RE9 A;  3I7D A;  3M7A A;  2CU5 A;  4CSW A;  4LBN A;  1GYK A;  3H3U A;  1VAK A;  4JDO A;  4QXC A;  1FYU A;  4N7I A;  2XJU A;  3AYC A;  3RSJ A;  2UY9 A;  3AMP A;  3ILF A;  3GZU C;  1LES A;  4N43 C;  5JOY A;  5HBA A;  2GP5 A;  1PGL 2;  1SBE A;  3OYW A;  2XLA A;  1CAU A;  1OH4 A;  5CKN A;  2WA3 A;  1WW6 A;  2ZTN A;  2YBP A;  1H30 A;  3LEG A;  3NNJ A;  3WVJ A;  4CCK A;  1GQG A;  2GMP A;  4IEX A;  4AGG A;  5FLH A;  1FX5 A;  1UNB A;  3PJQ A;  5FAX A;  2WZ8 A;  4IE5 A;  5A32 A;  5FMC A;  3WF0 A;  3HT2 A;  4NE9 A;  1LOG A;  1VB4 A;  5ACA 1;  1SMV A;  3VDD B;  3VBF C;  3LEK A;  2RS5 1;  4QMA A;  1QIQ A;  4XUN A;  2ATF A;  1S0E A;  4QWN A;  3FL7 A;  3I54 A;  4IEP A;  4QX2 A;  1JYX A;  5FP9 A;  1EV1 1;  5FR3 A;  2RR1 2;  3GM8 A;  1W9T A;  4L92 A;  2ET1 A;  3MLJ A;  4YGC A;  3WDX A;  5K8S A;  2FCT A;  3NNM A;  4B29 A;  2QQP A;  4GB3 3;  5K7P A;  4CEW B;  4AW7 A;  5A3T A;  1YQ2 A;  3CJX A;  3J7H A;  1NX9 A;  5FXZ A;  4XF3 A;  1LR5 A;  1UAI A;  3WDT A;  1RJ8 A;  1PGL 1;  2JX9 A;  2AR6 A;  4ZXK A;  2D7F A;  1HQW A;  3WT3 A;  2A75 A;  4KL1 A;  4PDW A;  3ZLI A;  3I2O A;  3RZM A;  2Y6J A;  1PM4 A;  5F2S A;  2VJX A;  1WA4 A;  2VOW A;  3JB8 A;  5E8A A;  4YW2 A;  5F39 A;  4RQP B;  3WW3 A;  5F3I A;  1K5M A;  4Q26 A;  2D3P A;  2VY0 A;  2ENR A;  3MHZ A;  4AI2 A;  4RS5 C;  4DXT A;  4S2G A;  1RGS A;  5AC9 1;  3VBS C;  5DMY A;  5CFD A;  4E9K A;  3JUU A;  2RJL A;  2CDO A;  1QJX 1;  4J1W A;  4IL7 A;  4XHB A;  4EN0 A;  4QDQ A;  1W2N A;  2ORZ A;  2WQZ C;  3WNP A;  5FWJ A;  3QBQ A;  2PQQ A;  1VMH A;  3O7O A;  2VC9 A;  1KS5 A;  1US3 A;  3H1W A;  5IAT A;  2WAO A;  1SDD B;  5AVA A;  2XQR A;  1N3Q A;  1ODN A;  3W9A A;  3J7L A;  1M4W A;  5LA0 A;  4GH4 B;  1ZRC A;  5IK5 A;  1QJZ A;  5FWE A;  3BOD A;  2CGO A;  1CIY A;  2YRO A;  3KWV A;  1GWM A;  1U0A A;  1QJU 3;  1YEW A;  2E32 A;  2VMG A;  4E4Z A;  4ET7 A;  2DFC A;  1JZ5 A;  3PG7 A;  3M1H A;  1D2S A;  3LF7 A;  1VMF A;  4Q29 A;  3VB9 A;  1OF4 A;  2VMD A;  5FRE A;  1ONA A;  2HJI A;  2VZS A;  4MVT A;  4BK4 A;  3J9S A;  1WLD A;  2BJS A;  4D0Q A;  5JXI A;  1S4C A;  1UN1 A;  1JMU B;  1HN0 A;  3IPV A;  1NG0 A;  4LIT A;  2RVA A;  2W39 A;  3K3N A;  4EZH A;  2MEV 2;  4YZ2 A;  3Q8B A;  2BRT A;  2XL7 A;  2VH9 A;  2ZEW A;  3T09 A;  3WNM A;  1X82 A;  5JIU A;  2VGD A;  5J1X A;  2LS6 A;  2RS1 2;  3I59 B;  5JZG C;  1ULE A;  4AVV A;  4HVQ A;  4LIU A;  4YW4 A;  3FC0 A;  1H4H A;  2WO2 A;  3U1X A;  4Z8B A;  3DKQ A;  2WKK A;  3DUI A;  1EAH 3;  1U5X A;  3VBH C;  1BCX A;  5CKQ A;  4DY5 A;  2YC0 A;  2J1T A;  4QX1 A;  4P9L A;  2G9Z A;  2XHK A;  5BPX A;  1RMU 2;  1W2U A;  2W92 A;  4XJZ A;  4IE6 A;  4BJ0 A;  4UT5 A;  5T5J A;  1Y4W A;  5FXV A;  2YFZ A;  1LHV A;  2PXJ A;  5LRS A;  5A3M A;  2WZP P;  3WG2 A;  4WVZ A;  2NMN A;  1RHI 3;  4FAH A;  3AZZ A;  1WME A;  2CTV A;  1KFU L;  1PGS A;  2QCS B;  4MLO A;  5KHK A;  3N36 A;  3W59 A;  2EIB A;  2QDR A;  4LJH A;  3B69 A;  1CX1 A;  1E5R A;  2JDU A;  3K2O A;  1OLQ A;  1UY3 A;  1ZRI A;  2Y0I A;  3BUC A;  4CJ6 A;  5FK8 A;  1H1M A;  2FMY A;  5FDB A;  2A3W A;  2HWE 3;  2MEV 1;  4M3C B;  1YI9 A;  2G4I A;  3ME2 A;  2Y26 A;  1W8N A;  4AHY A;  4BU2 A;  1XOY A;  4OZO A;  2ZKN A;  3SKV A;  4CU9 A;  3W5M A;  3V0B B;  5FYB A;  1GP6 A;  4MUV A;  3FMG A;  1X36 A;  2LW8 A;  3O0X A;  2ZOE B;  5EHD A;  2WZR 2;  4IEQ A;  4OMC A;  2P17 A;  4LBJ A;  3ZFF B;  1I1E A;  4E8D A;  2EAL A;  1C4R A;  5C9A C;  3PHM A;  5FZM A;  4QHB A;  2VXJ A;  2CDP A;  2XXZ A;  2PAM A;  3HBK A;  4L9B A;  3NV4 A;  4UW6 A;  5DZF A;  2EXH A;  3OOX A;  2A6Y A;  5A80 A;  3ZXD A;  1EPW A;  4HKW A;  1A8M A;  1FNZ A;  2A6V A;  1SEF A;  3DXT A;  4I09 A;  1WZX A;  4NJ4 A;  3A21 A;  5FUN A;  3UGF A;  1F15 A;  1EAH 2;  3BAL A;  3NQH A;  2VCC A;  3S0M A;  2Y34 A;  3L2Y A;  1GFF 2;  3KQR A;  4PIZ A;  4E8C A;  5D1I A;  2J1R A;  1VIW B;  4HBN A;  1UOF A;  4FPF A;  2YYO A;  3I2I A;  4GWJ A;  1DF0 A;  2R07 1;  3MW4 A;  4AFD A;  3IWZ A;  4FPY A;  4P14 A;  1X9T A;  5F9T A;  1HX6 A;  1W05 A;  2R7E B;  2OQ6 A;  3P3P A;  4JGZ A;  4PIY A;  4K1Y A;  5FZ8 A;  3U07 A;  2R1B A;  3BOP A;  4AR2 A;  2RHP A;  3OBZ A;  2YBK A;  3OGR A;  3CKH A;  4Q27 A;  1VBC 3;  2XDV A;  2BGC A;  1A3K A;  2V5Y A;  4JDM A;  1ZX5 A;  4FOQ A;  2ADE A;  1OA4 A;  4HN1 A;  2PHF A;  3MV1 1;  3RZL A;  2JG9 B;  4EN6 B;  5BXX A;  3AB0 A;  1W8Z A;  1R1A 3;  3JD7 3;  5CBL A;  3AP6 A;  4FP2 A;  2D98 A;  4Q0P A;  5CIR A;  5HCF A;  3BTZ A;  2MPF A;  4IGQ A;  4CIZ A;  1TE1 B;  3K75 B;  4YVS C;  3VD5 A;  5CAD A;  5BNN C;  2HKX A;  3AMQ A;  1NZC A;  3FFZ A;  2DTW A;  1AR9 3;  4EV0 A;  1C28 A;  1Z7S 2;  5SV8 A;  3INA A;  4E27 A;  3H9A A;  5FUI A;  2XUM A;  2ZZQ A;  3QOP A;  4BMB A;  3ZDS A;  3B9I A;  4CCL A;  1IS5 A;  1MZE A;  1U5Z A;  3AP9 A;  1NYW A;  4IE7 A;  1NCR B;  1V9U 2;  2R06 2;  1YQ6 A;  2ZBJ A;  3GBG A;  1PIV 3;  3D6E A;  4GJY A;  2BVV A;  4XXP A;  5FTT C;  3RJR A;  4Y5Z 0;  3OPZ A;  2W46 A;  4MXW A;  3RWK X;  4GWN A;  4IV3 C;  2JDA A;  4PT6 A;  1VJ2 A;  4TN7 A;  3SH3 A;  1FXZ A;  2A1X A;  2Y38 A;  5F37 A;  4Q4W 3;  1FV3 A;  2P37 A;  3OUI A;  1V70 A;  1LGN A;  4LO6 B;  4J7P A;  4AF9 A;  4IEV A;  1HXS 1;  1OOP B;  1VR3 A;  1D4M 3;  3VBO B;  4CE8 A;  5I8S A;  1YFU A;  4YG0 A;  3DEM A;  2ZX3 A;  3CO2 A;  1PVC 3;  2J42 A;  1CJP A;  4H7L A;  5A7O A;  2W2I A;  5T5O A;  1RUN A;  1GOF A;  4IUG A;  4CP9 A;  2FDK A;  2UWB A;  1QOO A;  2I07 B;  1RJ7 A;  4WM7 C;  3ACH A;  4AE2 A;  1BBT 3;  1QU0 A;  5IVB A;  3RRD A;  5FY1 A;  5DAX A;  4D7T A;  1YFX A;  1GAN A;  2D3R A;  2X8K A;  4AED C;  3V0A B;  1H2M A;  1AL2 3;  1B35 B;  2HEV F;  3I2K A;  2P4E A;  5T5P A;  2RS3 2;  1R08 2;  3VBR C;  1R64 A;  1DZR A;  5I0S A;  3ZYR A;  2ZHM A;  3RPQ A;  3TNP B;  1SFN A;  1CAX A;  4OUM A;  5DG2 A;  4LHS A;  1QJY 2;  2ZMN A;  3ZFG B;  4C0H A;  1JXN A;  3H7Y A;  3PIJ A;  4UAP A;  5KXE A;  1MEC 2;  1KXG A;  4S2D A;  3HQU A;  4LHN A;  5ABJ C;  3JQW A;  2JJ6 A;  1AR8 1;  3M8L A;  2BBA A;  3VZL A;  1H2K A;  2AAC A;  5CZK A;  5E6H A;  4Z2A A;  1Q5O A;  2IZW A;  2ZGP A;  2BW8 A;  3I2J A;  1VBE 3;  3ZKU A;  4DY3 A;  4JZR A;  2WNV B;  1RUC 1;  1OUR A;  4J25 A;  1VE0 A;  5FZC A;  2VTX J;  1N47 A;  3QD6 A;  2P3Y A;  5GZD A;  5EXO A;  2VZR A;  3RMX A;  1JI6 A;  3S6P A;  4D3W A;  2LUW A;  4OQ8 A;  2WNO A;  4B3N A;  1SPP A;  1GZT A;  1W6Q A;  3OEA A;  1ODM A;  3PUQ A;  4DUX A;  4JQR A;  3O1R A;  3ZYJ B;  3AKR A;  1R08 1;  1POV 3;  2VNV A;  3PIG A;  4HL0 A;  3C2U A;  1JZ7 A;  4MGT A;  1CZS A;  2WWJ A;  4CDW C;  1W0N A;  1J3R A;  3KV9 A;  1W06 A;  3IBM A;  4AVA A;  4CEY A;  5JI9 A;  4KBB A;  3J8F 3;  4FFI A;  2AEN A;  2Z42 A;  1QJY 1;  3MIB A;  1IG3 A;  4NAO A;  2GAL A;  5FY8 A;  1MEC 1;  2WNU C;  4COZ A;  4PLO A;  2ZAH A;  1C5I A;  4PHZ A;  1NLQ A;  4JKM A;  1W99 A;  2BGP A;  1OA3 A;  3ZPY A;  3LAG A;  2JKX A;  1PK6 A;  2DUR A;  5HV4 A;  4XXA A;  5FZ9 A;  1VBB 3;  3AJY A;  1WW4 A;  1YQ8 A;  4LHL A;  5K9Y A;  4KNC A;  1UOB A;  2QQJ A;  5GM0 A;  3MI8 A;  5H9P A;  1NE6 A;  3V56 A;  4AGR A;  1UOG A;  4XHX A;  5CFC C;  3WNK A;  1PO2 2;  4F8A A;  3J7M A;  5APA A;  3PJY A;  5GZF A;  1QH6 A;  3GCW A;  4FPO B;  3O1M A;  5A3N A;  4IGP A;  3MIF A;  4BQ4 A;  1QF3 A;  1W2A X;  4NUB A;  4NO4 A;  3GJA A;  1WBL A;  4P9X A;  1VRH 3;  5C8C B;  1XNB A;  3LE0 A;  2WO3 A;  1E5H A;  4KU8 A;  5FLI A;  4XDP A;  4Q0Q A;  3PLQ A;  2D3S A;  4ORF A;  4IE4 A;  3MID A;  5IAV A;  4PLM A;  3I2G A;  4CCC A;  3AXE A;  3MF6 A;  5FMO L;  4HOO A;  2BBV A;  1JS9 A;  1GP5 A;  1YWK A;  2VMI A;  5C3R A;  1COV 2;  1FAY A;  1RIR A;  2X10 A;  3LSE A;  3M70 A;  5C4W C;  1VMJ A;  4XUQ A;  1WCU A;  3I8T A;  4LOR A;  4WVM A;  4ATE A;  4DO0 A;  3ZYF A;  3ZSM A;  5IVV A;  2VOX A;  1ND3 C;  1NCQ B;  1WW7 A;  2VVD A;  5LY1 A;  5E88 A;  2PLV 3;  3K46 A;  3RFR A;  3W20 A;  4I01 A;  2EVX A;  3IDC B;  4QHO A;  5LAT A;  5LW9 A;  2BYV E;  1Q8V A;  3I3D A;  3VDB A;  4HPK A;  4QHZ A;  1QDO A;  3KT4 A;  3P1I A;  3TBD A;  2GH8 A;  4V2V A;  4FPL A;  3DGT A;  3VBF A;  4N53 C;  5KBF A;  4P5Y A;  4N90 A;  4Y5S A;  3GBF A;  4XTM A;  2CAV A;  3KM5 A;  4QQO A;  2WAA A;  1NA1 C;  2N7G A;  2A71 A;  3USU A;  3SCG A;  2WSU A;  2J1S A;  4NRQ A;  1MS9 A;  2TBV A;  2P6H A;  4Q0U A;  4BQY A;  5JOX A;  5FYZ A;  3N7M A;  3ZSL A;  1FMD 2;  3N9O A;  3WF2 A;  1ZZC A;  1Q3E A;  2HWF 3;  5J7M A;  1RUF 3;  1TME 1;  3VLB B;  1Q8O A;  2BDR A;  2B9U A;  4URA A;  5IVJ A;  1LOF C;  3T2Q A;  1I5Z A;  3HNB M;  3PME A;  3NO8 A;  4EWE A;  4CDQ B;  3PU8 A;  5L19 A;  4P9I A;  4Y5T A;  1ULO A;  4M3C F;  4FQZ A;  2UU8 A;  3CMG A;  4QQP A;  4YLZ A;  3CU7 A;  3ES4 A;  4LO5 B;  2JG8 B;  5JR2 A;  3TNQ A;  1LOC A;  1DCS A;  2QTW B;  4NII A;  2VVF A;  4XQD A;  2Q1M A;  2ZAA A;  4EWD A;  4PBO A;  5BNO B;  3RZJ A;  2BWA A;  1AXZ A;  4QQL A;  1AYM 2;  1LEN A;  3WQ0 A;  3WNL A;  5CAZ A;  1JOP A;  3H3Z A;  5D8A B;  2ZGU A;  5A3P A;  5C5T A;  1BVP 1;  4LOT A;  3OG2 A;  4JGY C;  2B7Y A;  3LEM A;  3VZM A;  4CP0 A;  4XZP A;  2A6W A;  1LAJ A;  5LA1 A;  1QKQ A;  2B8M A;  3E97 A;  1BLZ A;  1U5Y A;  1S0C A;  3G6J B;  4XET A;  3B3Q E;  4AEM A;  5BNP C;  4Y1X A;  3JQX A;  1MQT A;  3ETP A;  4IEY A;  5FY4 A;  5JXH A;  1AJO A;  4QPG A;  2G19 A;  5LEJ A;  5F2W A;  3BU0 A;  4I2O A;  3T2P A;  2W0X A;  1QJE A;  3ZXE A;  3OYW B;  2G9G A;  4XJU A;  5FYS A;  5FZO A;  3LEI A;  1CAU B;  1UCX A;  3TAY A;  3NAP C;  4AVC A;  5K0U C;  5KHJ A;  1ZRR A;  1E57 A;  4XTP A;  1LU1 A;  4QAW A;  4W50 A;  1LOA A;  4UXA A;  1G8W A;  2EF6 A;  1OUS A;  5A32 B;  3WQ1 A;  2YB7 A;  3VD9 A;  2WS9 3;  3TEY A;  4D6S A;  3K48 A;  4OLL A;  5JZG A;  2FMD A;  2JIC A;  1W6O A;  1ZRD A;  2VOK A;  3ZN5 A;  5DN2 A;  4K9S A;  4A3X A;  1XJA A;  1DGL A;  4TZD A;  2PEL A;  3BIW E;  5DG1 A;  1DQ1 A;  1BEV 2;  4N9I A;  4AI0 A;  4YVW C;  3QCW A;  4LKF A;  4CP1 A;  3N3H A;  4CDX A;  3ZYP A;  2WN2 A;  5LA9 A;  2VUD A;  2D6O X;  3KHB A;  1R1Z A;  4HET A;  3WXP A;  2ORX A;  2YZ4 A;  3ACI A;  4E2G A;  2VZT A;  1QQP 3;  1L7L A;  1VRB A;  1RUO A;  3UGH A;  4BE3 A;  5JR7 B;  3WUC A;  2VUC A;  3URF A;  5J3U A;  1JUH A;  4PDW B;  5JSR A;  1UY2 A;  2HWD 3;  3KB5 A;  4PI2 A;  1R09 1;  5KC6 A;  2VBP A;  3WP6 A; 
#chains in the Genus database with same CATH homology
 4CJ6 A;  3PEG A;  4OMJ A;  1OLM E;  1O6U A;  4TLG A;  4CIZ A;  4J7P A;  3B7Q A;  1AUA A;  1OIZ A;  3B74 A;  3PG7 A;  4OMK A;  2D4Q A;  4J7Q A;  3B7N A;  1OIP A;  4FMM A;  3W67 A;  3Q8G A;  3HY5 A;  3P7Z A;  3W68 A;  4UYB A;  1R5L A;  4M8Z A;  2E2X A;  1OLM A;  5LZ6 A;  3B7Z A;  3HX3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...