1A3TA

Staphylococcal nuclease, v23c variant, complex with 2-fluoroethane thiol and 3',5'-thymidine diphosphate
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
135
structure length
134
Chain Sequence
LHKEPATLIKAIDGDTKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Comparison of straight chain and cyclic unnatural amino acids embedded in the core of staphylococcal nuclease.
pubmed rcsb
source organism Staphylococcus aureus
molecule tags Nuclease
molecule keywords STAPHYLOCOCCAL NUCLEASE
total genus 31
structure length 134
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1998-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1a3tA00
5IGGA 4ZQ3A 4RKLA 5I9PA 3NP8A 3MHBA 4LAAA 1F2YA 4RKBA 3SK4A 4B9XA 2F3VA 2PZUA 4DFAA 4H7BA 5KIXA 4J6HA 2EYFA 4J1MA 2KHSA 2M00A 1EY0A 4K5VA 4WRDA 5EGTA 4EQNA 5HURA 2F0EA 1SNOA 3TP8A 1KABA 5C3WA 3RUZA 4K8IA 3OSOA 1EY7A 5F2DA 5K5PA 5I6WA 3EVQA 1KDBA 5C6AA 4R8NA 5EKKA 5KEEA 1STBA 5C4HA 2F0PA 3R3OA 1JORA 3NQTA 1STHA 2EYPA 1F2ZA 3S9WA 3TP5A 5IOCA 1EY4A 5CGKA 1SNMA 3MXPA 5IIFA 4OL7A 2PZTA 1JOOA 4HMIA 4NMZA 5C4ZA 2SNSA 5IGFA 4K5WA 2EXZA 3TP6A 4N9PA 2F3WA 1AEXA 4K8JA 1EYAA 5CV8A 4S3SA 3T13A 4B9WA 1SNCA 4ZUJA 1NSNS 5KGUA 1EY8A 4HMJA 1STYA 2EYMA 2F0MA 5JAVA 5EKLA 2PZWA 1A3UA 4KY5A 1F2MA 4DGZA 4QMGA 3D4WA 2EYHA 2QDBA 2EYLA 3EROA 4G57A 5IGDA 1SNQA 4K6DA 4KV6A 4IALA 4PNYA 1NUCA 3BDCA 4I65A 5CV4A 2PYKA 3D6CA 1KAAA 2F0DA 4KY6A 4NP5A 2PW5A 1EYDA 2EY6A 4PMBA 4YIJA 5KYIA 2RBMA 1U9RA 5JOBA 1SYEA 3BDLA 5C5MA 1SYBA 4TRDA 3PMFA 5E1FA 4ME5A 3DHQA 4ID6A 3MEHA 5J1ZA 1EZ6A 5HGTA 3SK5A 2F0SA 2OEOA 4NDXA 3HZXA 3LX0A 3DMUA 5DAUA 5KYLA 1STNA 4KJOA 3SK8A 4QB4A 2F0VA 4HTHA 3QB3A 2EY2A 2F0KA 1TQOA 1EY5A 5NUCA 3HEJA 3MZ5A 1EYCA 3U9OA 4K14A 5J39A 1STAA 2LKVA 5IGBA 5E3FA 3QOLA 1II3A 3EJIA 3TP7A 2RDFA 4MIUA 5I6YA 2ENBA 5CV6A 3NXWA 3SR1A 1SYGA 1ENAA 2EY1A 1A2TA 2F0GA 2F0WA 5CV7A 2O4XA 4DU9A 4IUNA 4ODGA 1KDCA 3NUCA 4NKLA 4KJNA 2WACA 1JOKA 1SNPA 2SNMA 3E5SA 3VA5A 1A3VA 3SHLA 4EQOA 5IGCA 2EY5A 3TMEA 5C3XA 5CC4A 3QOJA 1ENCA 4EQPA 5DEHA 5J22A 1EQVA 3D4DA 3P75A 2F0OA 3P1HA 2F0HA 4KHVA 5I9OA 2OF1A 3NHHA 3C1EA 4KD4A 5IODA 2F0UA 4KY7A 5ISRA 1STGA 4K5XA 2OXPA 5IGEA 1A2UA 4KTAA 5C5LA 2F0FA 3C1FA 5CV5A 1KDAA 1RKNA 3H6MA 3OMCA 4K2KA 2EYJA 2PQEA 1TR5A 2PW7A 3SK6A 4F7XA 1SNDA 2EYOA 1EZ8A 3D8GA 1EY9A 5CV9A 3T16A 2SOBA 3V2TA 1A3TA 4KD3A 2F0JA 3ERQA 4QF4A 1TT2A 4F8MA 1JOQA 1IHZA 3MVVA 2F0IA 1SYFA 2F0TA 4DF7A 1EY6A 1SYDA 1SYCA 4PMCA 4WORA 5M9OA 4K2LA 3ITPA 4E6IA 2F0QA 4EVOA 2HQEA 2NUCA 3SXHA 3NK9A 2KQ3A 3OWFA 4IZ8A 2F0NA 5CR3A 4ZUIA 3OMGA 4N9TA 2RKSA 2F0LA 5KRUA
chains in the Genus database with same CATH superfamily
1SN8A 2IHFA 4RKLA 3I4NB 3SK4A 5LL6S 5CORA 4HCEA 1KQSA 4DUYL 3GTQB 1HUMA 1YITA 4ZAIA 1B3QA 2JA8G 2JA8H 2E2HB 2Z8LA 3IFTA 1QZHA 1G91A 2Z1CA 1M1KC 3Q0AA 1K73C 4GKKQ 4KHZA 4LW1A 2N3SA 3S17H 1I6HH 1YNNC 1FVIA 1CA5A 4LF7Q 1HUNA 5AJ3Q 1HA6A 5C3EG 2NN6G 2K52A 3I4MB 2R3ZA 3BDCA 1QUQB 3DWPA 3PSIA 1GXDC 4N8FA 3AU7A 3A8JE 2MO0A 2MPMA 4TQUS 2KECA 2O5IC 1OTCA 2DJFC 1XYIA 2B63G 3L3OC 1MI2A 2HHHL 5J1ZA 4IUVA 5AJ3L 5DAUA 4LMQD 1TVXA 3D3RA 2VQEL 2Q2UA 5NUCA 4O2DA 3J7YW 3FRPB 3M4PA 1MSGA 4K14A 1HH2P 4GKKL 4JI3Q 1YNXA 1PRTF 4EX5A 4LF4L 1X55A 3GTGH 4JI3L 4ILWA 1ZEQX 2R7DA 1X32A 1VQHA 2XIWA 4A93G 2XRSD 4DU9A 3GV6A 3HOUG 1JJGA 2M2LA 1HA5A 2RQXA 1NR4A 2E2JH 4DR6L 1ENCA 2R7ZG 2RSOA 2JEAI 1IBLQ 1RKNA 4JI5Q 1U4RA 1CHQD 1XNRL 4DUZQ 4C1NK 4X64L 2F4IA 1PH7A 4OEMB 2L55A 2K5DA 2CVRA 4C3HG 1PH1A 3QWNA 3FDTA 4FXGC 1KLGD 4OX9L 1Y1WH 1UEBA 3DXJC 2DY8A 3KLSA 2MJ8A 1NMGA 5C4JH 1ICWA 3UE0A 2DN8A 3KOJA 1KLUD 4I7ZC 1DM0B 2Y0SB 3TP8A 4A3EB 4K8IA 3D0FA 1L2FA 2BDOA 3A55A 4QUCA 5C6AA 2E5LL 4A3GG 3HOWG 3ULLA 4DAPA 4LUVA 3NWTA 1F2ZA 4DR3L 4B3TQ 4Y52H 4CJ2C 2PZTA 4HMIA 3R8BA 4G7ZC 1IKMA 1K28A 3NEMA 4G4KA 2F3WA 3L9AX 4XTCS 1VCIA 5CYUA 1LTSD 3AMUA 4NXNL 2N8NA 2K5HA 4FF2A 1D8LA 3S1MH 3VYTA 2K05A 3RZDH 2MHVA 1JWUD 1SNQA 1QE6A 1Y8OB 2D2CC 4CDFC 3RR5A 4HJ8A 2PW5A 1JE4A 1LTLA 2D62A 4H44C 4DAVA 3S2HH 1I6HB 2NYZD 4MTNA 2G9HD 2F0SA 4JYAQ 4BBSG 1M4VA 1E2WA 1WTQA 1PV4A 4OELB 1GO3E 2E2IB 3U4VA 1HQMC 1OXUA 3JAML 1VQ5A 3F8TA 1AFPA 1II3A 1SMYC 4APVA 4R8IA 4AQYL 4MIUA 2K50A 2ENBA 1GJXA 3IFDA 3CRKC 1AE3A 1VS0A 2ATWA 4L5SA 1PTOF 3PO3H 3UDIA 2KEDA 4OIJA 2SNMA 4UHVA 2EE1A 1KAWA 4EQOA 2IL8A 2Y0SE 2IX1A 3CC7A 3M4OH 2UXCL 4FO2A 4DR1L 1SBBB 4LF4Q 3NPPA 1C7YA 5ISRA 1LTRD 3TDQA 2OXPA 2RHQB 1WFQA 2EYJA 4X3TA 1GUSA 2XWJB 2VL6A 4FDBA 4QIWE 1CM9A 3OW7A 4DR1Q 3M4YA 4YY3Q 1WCMB 2EIFA 3D6WA 3CP0A 4J8QA 1AZPA 4L5QA 3MVVA 4DR2Q 5IYCG 1LTAD 2R93H 4IPDA 3DWQA 4RHSA 4DV1Q 2ZXRA 2JA7B 4LFAQ 2CW0C 2CW0D 1EFWA 5EAYA 1PZKD 3I3CA 2K5VA 5I2XA 3K0YA 1HNXQ 4EQNA 1FR3A 1HCZA 4A3MG 2VQFL 4DA2A 4IURA 1N32Q 4NXML 2A6HC 1Z47A 2PPBC 1TS3A 1IYVA 4BY7B 1ONLA 1IW7D 3S9WA 3NWSA 3R2TA 3HOZG 3MXPA 2B29A 5C4ZA 2EVBA 1IYUA 2JK8A 2C35B 1SNCA 1GUWA 2NZOA 5EKLA 2B2TA 4C1NI 3VA7A 2LSSA 1IBLL 1XTDA 2A68D 4RA8A 2CWPA 2AQ1B 4IUQA 1B9NA 2RBMA 1LM0A 2I5LX 4IUPA 1AW7A 1SE2A 4FNFA 1AH9A 3HKSA 1I5FA 2KUMA 2VB3X 3OTOQ 1G291 4K0KQ 1LYLA 2K7VA 3PUVA 3SK8A 1LABA 2C5CA 2EJGC 2EPBA 1K8AC 1Q3LA 5L37A 1TS2A 5EKIA 4HSPA 3IRBA 3SGIA 3RZOH 4J15A 2D0OA 1MD2D 1U4PA 1R9TB 4GZYC 2Z0SA 3GTJH 5CC4A 5CBEE 3RN2A 3KYHC 3TN2A 4LFAL 3F2UA 1S3OA 2WB1G 4K5XA 3GP7A 1HR0W 1VQGA 2NVQH 2F0FA 3K7AB 1HXYD 1KDAA 4K2KA 4P72A 3PO3B 3X3NA 1EEID 1CA6A 2GVBA 1FJGQ 1DOMA 3L0OA 1A3TA 5JJZA 3KUPA 4QGUA 3ZYYX 2F0JA 1PZID 1XTCD 3I70A 1IHZA 1YNND 2GA4B 4CKCA 1FGBD 4DF7A 4BY7G 1M8AA 1TXYA 4TKOB 5E7NA 1HPCA 5CR3A 3T56B 4UPAA 4DAYB 1TWAH 3O13A 1N33L 1O80A 4L5RC 4YCWA 1CZGA 4A3EH 4FXKC 1EWHA 1B70B 2PZUA 3GTMB 4H7BA 3URYA 4OO1G 3J80i 2M00A 1W2BA 3M7NA 5HURA 3PUXA 4DR3Q 1CKOA 1QVCA 3HOXG 3HOXH 3HGBA 4F87A 1KRSA 5EKKA 3F2BA 2XNAC 2NN6I 2WB1E 4RFBA 1EQRA 1FD7D 1LTBD 1WTVA 1A8VA 3FP9A 3OIPA 3T13A 4GOPC 1WTXA 1VQ6A 5BR8Q 4IJHA 5JAVA 1B50A 3RZOB 2N78A 2IW3A 3CHBD 1CQVA 4AYBE 1Y1VB 3W3AA 1D7QA 4V0BA 3S2HB 4OO1H 3TRZA 1FNVA 3ULPA 5IE8A 3BDLA 1TY0A 4JK1C 1DJRD 4ME5A 1NNXA 1L0WA 4LF8L 5M5WB 4WFN3 4ID6A 3SK5A 2K1BA 4HIMA 4DV4Q 1XMOQ 1FNWA 3ND9A 4IPHA 2F0VA 4RGNA 4XT3B 4DR4L 1EIHA 1MKHA 2F4VQ 3CXCA 1F9PA 5GAHC 1IW7C 1KHIA 3EQLC 2G5DA 2N55A 3IKJA 2CCZA 2Q2IA 3GTKB 3NXWA 3PGZA 2HDMA 4OWTB 3S1RB 3NELA 2K75A 1PTOH 2B2YC 5IGCA 2EQSA 3Q6SA 1DCZA 2N88A 3HKZG 2B2VC 1F9RA 1C4QA 4ZK9B 4A3DB 3P75A 1ASZA 3HKZB 2L11A 2AUJD 3HFZB 3S16H 4KY7A 1CZWA 2Z4IA 3HOWB 3KBXA 3OMCA 3KF6B 5COYA 3SK6A 5IP9G 5T1IA 2D5DA 1HNZQ 2QF7A 3KBGA 2KEEA 4C3JB 3I4LA 4R1JA 4K2LA 1VQLA 3IAYA 4R4IA 5ELCA 5JVH3 4R4TA 3RZDB 4JI1Q 3WOEA 3PUYA 3S17B 2PNRC 2EJMA 3TZDA 3J80L 1SDFA 3JAMc 2L0CA 4KK7A 2VXWA 3IL8A 1SFOH 4R4CA 3MXNA 4RH6A 4WJ3M 2ZT9C 3OSOA 1MBYA 1JWMD 2Q8TA 4H02A 3PO2B 4GLXA 4P2CB 4A3KG 3MC0B 5CGKA 1B7YB 4IPGA 1KRTA 3PO2H 1Z9FA 3GTPB 4DV3Q 3RNUA 2V1CC 2UUBL 1CFMA 3BG3A 1YIJA 3H3VH 3SDZA 2QEXA 2O5JC 5D3DA 4DV6L 1TWFB 2OQKA 1SR3A 4K6DA 4HEDA 4A93B 3GQBA 2F0DA 1VQCA 1EYDA 5I2YA 1MSHA 2K5WA 2P5ZX 1KL9A 1O78A 3NE5B 2K4KA 3R2IA 3I56A 4QIWB 1EL0A 2OWOA 2DJGC 4RAUC 2AKWB 5J3BA 1GM5A 2PI2A 1VF7A 3HEJA 3RLOA 1EYCA 5IYDH 1VQIA 3M9BA 3STBC 3TP7A 4UDUC 4HCSA 3NTIA 4A93H 5BN4A 5I4DA 1SMYD 2Z6KC 4KJNA 1XX8A 2R6GA 4IUUA 2DY7A 4M8AA 2UUAQ 2NVYB 4JVZA 1ML0D 3VR5A 5C4XG 4LF6Q 1BKBA 2F0UA 1EIFA 3PO2G 1QJOA 4C56C 1PH9A 4GN4B 2CQOA 1TR5A 4JBWA 3J7ZC 3OIQA 1K0SA 4KHPQ 1E7ZA 2NVTB 3T16A 3UI2A 3PV0A 2RCNA 4LF8Q 4A3EG 1TT2A 1IZ6A 4HN7A 5M9OA 1E2ZA 2Z4HA 4E6IA 4IZ8A 1IXRA 3K58A 4JI8Q 1L0YB 3BZKA 5I9PA 3VR3A 2OTLA 4JI2L 1FGUA 1SXTA 2YV5A 2EYFA 4Q5VA 2A19A 1X9NA 3G4SA 5C0XI 1CT1D 1G6ZA 2CH4W 5I6WA 2N49A 1UE7A 1SEBD 3BZDB 2M9VA 4IQZA 1CKMA 1K83H 3NBHA 4IO9A 1BNZA 2KCTA 2NTTA 5IY0A 2EXZA 3CPFA 2E2IH 4K8JA 5CV8A 5GQOA 4POFA 1IL8A 1WD0A 1Y1WG 3I2ZA 4YHHL 1D5ZC 5C44B 5IGDA 3T4AC 3S14H 2K5QA 5EPKA 3V05A 1Q46A 3I55A 3M7GA 4OONA 1KNEA 3CF5A 2QDLA 3I73A 3P20A 4GNXB 1W6JA 1UEAB 4BXXG 1UE1A 4QB4A 2K03A 4HTHA 4BA2I 1PH3A 3E6ZX 1GOZA 3MXGA 1Q86C 1VQ8A 3HOZH 2PQAA 2R93G 2VB2X 3VYRA 1WTHA 3BU2A 2F0WA 2Z6BA 3J80E 2E5LQ 1H95A 3NUCA 5T1GA 1QWYA 1Q1BA 1JOKA 4AYBG 1ILQA 2JXMB 3BJUA 3A5ZB 4ZKBB 1L1OB 2H5XA 1PH5A 1LV9A 4GLAC 3S15B 3EN2A 2JP1A 1VF5C 1G6PA 2ES2A 1RTNA 5CBAE 4MN3A 4NW2A 4GLVB 2PW7A 1ESRA 2I5HA 4KKSA 5CV9A 3S24A 1J5EQ 2JQOA 2PI2E 3ERQA 4QF4A 4V190 2ZJRA 4NXNQ 1D2BA 3UDXA 4LF6L 1YHBA 3H91A 1ZYRC 1X3QA 2QCPX 4X65L 4A3CG 3T1HL 4XYQA 4IN3A 4IFDH 1EQTA 5GADC 4ULLA 2RKSA 1STHA 1OO9B 4A3IG 3U4ZA 4RKBA 2F3VA 1S5CD 1S5BD 3KDFA 2JSOA 5EGTA 4BY1B 1LT6D 2B2YA 1A62A 4DR5L 2ID0A 3K5LA 1VQ9A 1OXSC 2X6GA 2UXDL 1VQFA 2E2DC 3HG9A 1N36L 1EIGA 2F0PA 3C46A 5LMUL 5IOCA 1EY4A 1SNMA 5FO7B 2LS01 4LFCQ 4BY1G 4DV1L 4S3SA 4GOPA 3K5OA 3BYYB 1VMPA 4DK0A 1CQFA 4RWSC 2BOSA 1MGSA 4ZYSA 2NZ1D 1W6KA 2MO1A 1Y1VG 2NBFA 4PZ8A 3GDEA 5JJKA 3ULJA 2XTIA 3K5MA 1AE2A 2B39A 4YY3L 2R92B 3DMUA 2CFMA 3KLWA 3HOYG 1VQ4A 1E0BA 5G3LF 5C0XJ 1JB3A 1VQNA 5M3FH 1YNJD 4JW0A 3EBEA 1F9QA 2ZTCA 4XDXA 1SYGA 5IYBG 1A2TA 5IP7G 5CV7A 4LF5L 2A5HA 1SROA 4Y7NH 1PRTB 2VUMB 2PNHA 1DOLA 1I4GA 2VQEQ 1FYCA 3EIVA 5C0XG 3DUZA 3M85A 1YJNA 5JJIA 1TIID 2WINB 2QGQA 3D4DA 1ZYRD 1K0RA 1F2LA 2YTVA 3AFPA 4HIOA 3DEOA 4JYAL 1JWSD 3HOUB 4YWLA 3VYUA 4LF7L 3PQIA 3HOUH 1LUZA 3TS0A 4IFDI 4LWCA 3MWYW 1H9JA 5IP7H 4F8MA 2YU9H 1XPRA 3BVGA 3DWAA 3VR4A 4FF4A 2RCFA 4X66Q 2KCCA 3GTMH 1YEZA 1K8OA 1RTOA 2ZTEA 4ZQ3A 1Y14B 1V8QA 4C3HH 1BXTA 2AWOA 3UDFA 5KIXA 1PTOD 1NTGA 4NXMQ 2F0EA 4CDEC 1EY7A 3N52A 2XWBB 1PFSA 3TSSA 4AIMA 1S5ED 5M3FG 2NN6H 4X65Q 1VMCA 5C4HA 3L2PA 5A2QL 3AFQA 1H9SA 3OW2A 3HOYB 5IGFA 2CWAA 4KLKA 1AEXA 1S40A 2MQHA 1BBXC 3M3YH 1A15A 2FINB 2MGSA 4DGZA 5M5YH 4QMGA 2MP1A 1Q12A 2EYHA 3EROA 4G57A 2NZHA 4GN5A 1SSOA 3KJPA 4DR7Q 2NVYH 1SLJA 1YHQA 3TBIB 1IBKQ 4X64Q 3QO2A 1SYEA 4A3KB 1ENFA 3L7ZC 4YWKA 5C5MA 2AQ2B 3PMFA 4DKAC 5C3EH 1SE4A 4NPSA 1CHPD 1D1KA 3LX0A 4QUFA 5KYLA 1HJPA 1I4QA 3HOYH 4XQNA 3A5UA 5BR8L 4A3IH 4PV1C 3A0JA 3B6YA 3C3LA 3KJOA 4OGQC 4LUZA 2XGTA 5EPJA 4JOIC 5JPMC 1OXTA 3MXNB 3PUZA 5E3FA 2QKIC 1HZAA 2LXKA 1Y1VH 3J81E 2KOLA 1X3EA 1ENAA 2BH8A 5EPLA 3I8ZA 1X65A 5EBDA 3J80c 2NVXH 1UUPA 4RGOS 4GKJL 3KLRA 2R7ZB 3MXUA 1N34Q 4BBSB 1N33Q 2QA4A 4DNRB 3OYYA 4A3DH 2RVLA 2VZAA 1S5FD 1S4ZA 3T1YL 2EY5A 2WFWA 1WJJA 5LHY1 2BDNA 4LF5Q 1BCPD 1XJVA 1EQVA 1K3RA 1UWVA 5C4XH 4IOCA 3CCUA 5C44G 4KTAA 5ELBA 5CV5A 4Z9CB 4C3IH 3GTLH 1H9MA 2PQEA 1I50H 3RLNA 2B8GA 4DV2Q 2K6AA 3N6RA 1BF4A 4XXEA 4HIDA 2NVXB 5KNDA 4KD3A 3G6JB 4FF3A 1F9SA 2F3IA 3CAMA 1B1ZA 4N8X1 2F0IA 2F0TA 3J7A5 4PMCA 4RCOA 5BN3A 1XXGA 2ZJQA 3MFYA 3PCOB 4MZ9A 3CD6A 3G7LA 3FKIB 3VDYA 2ICIA 3KF8A 3A54A 1UE6A 4DK3C 4DNTB 5KRUA 1HZBA 4AQYQ 1LTID 1F2YA 2JA7H 1WVLA 2A69C 1V1PB 4DFAA 2TSSA 1LTTD 1KNAA 1NMFA 4K5VA 5GAEC 1SNOA 3F2CA 2B2TC 2JE6I 1KXLA 4HIKA 1YI2A 3K7AH 1N8RC 3I7FA 1WCMH 4R8NA 2LXJA 1Q7YC 4XYOA 4JI2Q 2JA6G 5M3MG 1PHJA 2HCCA 2NVTH 4X3KA 3K59A 2O2LD 1Z6HA 4OL7A 1JOOA 3J7AF 1BQQT 2R61A 4A3KH 3TP6A 4LK1C 1A63A 1I4XA 1EY8A 1STYA 4UY8C 1G2TA 1E24A 1SJHD 2NB0A 1TWHB 2UU9L 4A3JH 2UUCQ 4PNYA 5FOBB 1RF2D 1JJ2A 1HFNA 1QNUA 5KYIA 3K7UC 1HHVA 1TWGB 2BE5C 2K33A 3W1BA 1R9TH 3OWEB 2F52A 1RCVD 3MEHA 1MIUA 1QCBD 2OEOA 1STEA 5M5XH 1EEFD 3OHXC 4BXXH 5GROA 1KTKA 4CBVA 1R4PB 2F0KA 5EQ0A 2A68C 1U4MA 2DGYA 2UXDQ 3LWUA 3WDNA 4A3GB 5IGBA 2G9DA 3GTOH 3DEPA 2KHIA 1DD2A 2A73B 4IUNA 4ODGA 1Q90A 3GD7A 3X3MA 5G3LD 3CCQA 1Y8PB 1B3AA 1SNPA 5DLQE 2L4NA 1B4OA 3PUWA 1C9OA 2D9UA 4EQPA 2ZM6Q 5DEHA 3JAME 4G7OC 1G51A 3CQZH 2F0HA 2DNCA 4A4IA 1X54A 1EWIA 4B3ML 3K57A 3NTKA 2J0TD 2FMCA 4HSVA 3M4OB 4P74A 1SNDA 2EYOA 3H15A 1C48A 2BCOA 5IT9L 4LFBL 1VQ7A 1RODA 3BVMA 4DV3L 1K8MA 3BYTB 2WP8J 1JCKB 3GTKH 2RF4A 1SYFA 1SYDA 2K01A 4BY1H 2OTJA 2AQ3B 2K14A 4FF1A 2UXBQ 5C4JB 4LFBQ 1HTPA 4JI6L 3A74A 3CC4A 3E0EA 4A3CH 1JICA 3A8KE 3HKZE 1KABA 1GUGA 1E1OA 5H1SE 5F2DA 1H9RA 5IYDG 1V9PA 2YTXA 1EWCA 1GKHA 2E75C 4JI1L 2Z9HA 4NMZA 2JA9A 1MJEA 4DAYA 1P8LA 3ZJYC 3DM1A 3OOCA 5A2QE 4JBJA 4DV0Q 4JOIA 2E2HH 1WTRA 2F0MA 1CKNB 5FJ8G 2XVSA 1QNKA 3MFGA 1NUCA 3H94A 5FLXc 5CV4A 4B3RQ 4NP5A 5M5YB 4KY6A 1D6EC 4HJ5A 1EOVA 1GD7A 1LACA 3NQIA 3HOXB 2WAQB 4IUTA 5FLXE 1SYBA 1Q81C 1R4QB 1A0IA 4JBKA 4IOAA 1ASYA 1J9OA 3J81j 4Y7NB 5ELFA 4H0LC 5FLMH 4A3BH 3QB3A 1EIYB 3M3YB 1KC8C 1KD1C 2GN5A 1D1IA 4JI0Q 3I72A 4JI0L 3U50C 2WB1B 2HD3A 3A56A 3QJYA 4PZ7A 3NENA 3STBD 1V43A 4L6TB 3C2PA 1PLFA 5IP9H 3TS2A 2CKZB 2FMMA 1B44D 1PH4A 5C3XA 1IL2A 3P1HA 1E3PA 2OF1A 1IBKL 3K8AA 3H3VI 1E2VA 2I07B 4L5TA 4RHRA 2MFIA 3I4NG 3LGJA 3HRZC 3I4OA 4F7XA 1BBWA 1LT3D 2MNAA 1EY9A 1B8AA 1I50B 2WKCA 1P16A 2CQAA 4DV5L 2A8VA 4F88A 3I91A 5D14A 2HQEA 2F03A 2UUCL 1E22A 5K36G 1D5MC 2VNUD 1VQMA 1I6VC 3MTSA 2B8FA 2UUAL 3A7LA 4LF9Q 5IGGA 1SJED 1YVCA 1SMXA 4OWXB 2UUBQ 1TS5A 4OWWB 5JVG3 4BA1I 3CQZB 2B2UC 4DXGA 1EY0A 2I0QA 1PFNA 1GVPA 1N32L 4RMFA 4FP5D 2VQFQ 2IY5B 4EQ5A 4R9WA 1G2SA 1NCVA 3HS0C 2ZXOA 5IWAL 3NQTA 4JI6Q 5LMNL 3TP5A 2IHEA 3MEFA 1J8IA 5BN5A 2EZVA 5KNBA 2YU9B 4DN4M 4MHEA 3TZUA 4CJ0B 1GHJA 4N9PA 1ZXTA 3F2DA 5C3EB 4ZUJA 1RL2A 4IFDG 5FK9C 3CCSA 4Q0FA 4EGVA 3GTPH 1PTOC 4KY5A 2HHHQ 2SDFA 1V1PA 4JG2A 4GS3A 3GV3A 1X6OA 1DYQA 3KF8B 5E1FA 4JBMA 4HJAA 1QOHA 5HGTA 2VUMG 1JR0D 1YBYA 2QW7A 4NB3A 1STNA 3T51B 5LMUQ 2PCFB 2Y0SG 2XN9C 3KDFB 1HQRD 4JI4Q 2A69D 1RD9D 4LFCL 2JA5B 3NTHA 2JA5G 1PXUA 2I46A 4GOPB 1UAPA 3KF6A 1YJWA 3FKIG 2UXBL 3U9SA 1BR9A 1PH8A 2BH2A 1QVFA 4A3BB 4DR5Q 4DNIA 2ALYB 4X3UA 3CC2A 2K32A 3SHLA 1I3QH 4MNOA 4C3JG 4QQBX 4ZCKA 1JJCB 1HRJA 3KK7A 4WJWA 4LF9L 3C1EA 3DLLA 1I94Q 3OTOL 4JV5Q 1VQBA 3CMEA 2AUKA 2R92G 2PO4A 4R4QA 1J5EL 2ZXPA 3GTGB 3D31A 2HIXA 4DV4L 1EFID 1ET6A 3S1NH 2XSCA 4PZ6A 2FXQA 4WJ4A 1VQOA 5C4XB 1L0XB 3H0GH 1Y1WB 3HOVB 1QB5D 2IX0A 3S1NB 2WKDA 1SFOB 3ITPA 2LMCB 2E74C 4HJ9A 4RG1A 4G7HC 4EVOA 1DZ1A 1JE5A 4BBSH 1RHPA 2XRQD 1Q1EA 2AWNA 1T9HA 2VY3A 3MA2B 2IJ0A 3HOVG 1X3PA 1HFGA 3Q23A 3CCLA 5FO8B 4H13C 3D4RA 3EVQA 2F4VL 1I4PA 1QVGA 1HZ9A 4A3MB 1WD1A 3S1QH 4DR4Q 3R3OA 1MHWC 1JORA 2JJQA 4JC0A 1BCPB 3I4MH 5K36H 1ZKOA 5JJLA 1VQJA 4K5WA 4ALPA 3S1MB 1CKNA 4HMJA 2PZWA 5M5XB 1BVSA 1F2MA 5EBCA 3M4QA 2FFKB 4KV6A 3PIP3 4I65A 1M90C 3KLSX 3I4NH 1V1OA 1U9RA 5JOBA 2WAQE 3E3XA 3PF5A 5JEAG 3E0JA 3R93A 4YHHQ 1AZQA 4X6AH 2MUYA 3J7AV 2Q2HA 2WIIB 2HUGA 3JC66 5M3MH 2DNEA 2KCMA 1JQYD 4KMUC 4DV7Q 1XMQL 4B3MQ 5IT9E 4X62Q 4OXPA 1PTOB 3EJIA 1PZJD 4YCVA 5I6YA 3SR1A 5LMNW 5FLXL 3W2DA 3LWEA 4NKLA 2ICEC 1VQAA 3AYHB 1PFBA 5LMNQ 1WYDA 2JN4A 4U68A 4DV7L 5ELEA 1XMQQ 4FVMA 3CKIB 4M1UB 1EQQA 1SRUA 4I7AA 4P73A 2GVAA 1WOCA 2L9HA 5IYCH 1STGA 3CCJA 1PMRA 4BBRB 1QZGA 4DR7L 1FNUA 4KKTA 2J4XA 1EZ8A 1TKWB 3V2TA 4UP9A 1IBMQ 2Z6KA 4MTKA 3QG1A 2HIVA 3SVMA 2VS1A 1LO5D 4WORA 1N34L 1C8CA 4XT1B 2YYZA 3CCMA 4ZUIA 2B3GA 3CRLC 4N9TA 4HJ7A 1X56A 3K6OA 4UP7A 3GTJB 1XWEA 1HTLD 5FO9B 4LAAA 3PO3G 4B9XA 4IPCA 2B2UA 5JEAH 4J1MA 5DM63 5J22A 1HZCA 3TQYA 5IT9c 1TY2A 2A1AA 1YJ9A 2CHBD 3I90A 3LNNA 2YTYA 1TWAB 3J81c 1F77A 4UP8A 1PYBA 1XNQQ 2B2WA 5IIFA 3VR6A 3EFXD 3UDGA 1Q8IA 4B9WA 1KIXA 1CSQA 2IX3A 4DR2L 4O42A 3D4WA 3HP3A 3PF4A 4JI5L 4QY7A 3W1GA 4A3LH 1Q8KA 1KAAA 2H1EA 4PMBA 2ASBA 2JA8B 2L1BA 4CKBA 1VDZA 2L12A 4JV5L 3S16B 4DR6Q 1U0LA 2UU9Q 3E9IA 3AQQA 3H3VC 1BUVT 2KBNA 4B3RL 3PIPA 1EY5A 3MZ5A 3BVZA 4PG3A 1STAA 1Y8NB 2LKVA 3T53B 3QOLA 1BO0A 4CHTB 1A6XA 2EXDA 3Q8DA 5CV6A 5M3FB 5TSSA 4POGA 2O4XA 1KDCA 1LT4D 3T1YQ 3K80C 2WACA 4X3SA 4C3IB 3GTLB 4A3LG 5A35A 3E5SA 3VA5A 4LNQA 4GKJQ 2OQ0A 3G71A 3QOJA 3QR8A 2RA4A 1IYJB 5D65A 2F0OA 1RJTA 3OPOA 4XQQA 4B08A 3I4MG 1YZ6A 3NHHA 3TEHB 4X62L 5IODA 4P75A 1U5KA 5IGEA 4A3GH 2R7ZH 3PIOA 1PRTC 1UNSA 2AMCB 1Y69U 1U4LA 4A3IB 4KN7C 3H0GG 4JI7L 3H0GB 3HOVH 1OXXK 1B2TA 1AN8A 1H9KA 3S1QB 1NJIC 2RDGA 1O7IA 1SYCA 4OHJA 5FLMG 2SEBD 1K83B 2F0QA 2LY7A 3SXHA 3NK9A 2KQ3A 2H4OA 1TWHH 2OCEA 3ERSX 3OMGA 4DAMA 5CMDA 2F0LA 3P7JA 1Z7TA 1JOQA 2F1MA 5HY6A 4BS9A 1CK1A 1L1OC 1S72A 2KHJA 2QILA 4O1NA 4C3HB 4A3MH 3RUZA 1Q82C 1KDBA 1CSPA 4OIKA 3CPWA 1STBA 4PQXA 1PYSB 4DK1A 4HR7B 5HGQA 1HNWQ 1JC7A 2SNSA 4C3JH 4DV5Q 1EYAA 1NSNS 4KN4C 3WWVA 4O0AA 4GN3B 1XMOL 4R4OA 4BY7H 3FKIH 3VYSA 1L1OA 1WTWA 1EUJA 2RHSB 3RN5A 4P71A 1XNQL 2JA5H 1BCPF 3NBIA 1LTGD 4C2MH 4TRDA 3J81L 4A75A 1XNRQ 3S2DH 3FPPA 3GTQH 1EZ6A 1G8ZD 1PH2A 4FXDA 3HZXA 4KJOA 2PQAB 4B3TL 2RSNA 2VUMH 4CDDC 4A3DG 1HNXL 1TS4A 5J39A 2E8GA 2KVMA 4ZKCB 5E4XA 1B53A 1DONA 1TWCB 3V96A 4L63B 4GNXA 1DGSA 2KENA 4CKEA 2K28A 2HT1A 4KI0A 1H9SB 1GUTA 1A3VA 1SE3A 3CCVA 2Q8RE 1EU3A 1IBML 4A3FB 5JEAJ 1VQEA 3FPUB 3BZCA 5FKAC 3K5NA 4KHVA 5I9OA 3ER0A 4A3FG 1YHAA 1X3FA 4X66L 5C5LA 2BE5D 1T5XD 2X69A 2NWGA 3NBHB 5ELNA 1E1TA 1YNJC 4DXFA 2VW9A 4L8JA 3HOWH 5GAGC 2E2JB 1PA6A 4DV0L 1PYWD 3TREA 1O7ZA 3G6EA 2EDGA 2NTSA 1K3BC 1PVOA 1CUKA 4DV6Q 2NUCA 1QILA 4DV2L 4HAEA 3FVQA 2LFNA 1WI5A 1TU2B 2V4DA 3SE0A 3KFUA 3NP8A 2ZM6L 1PFMA 2TMPA 3ND8A 4ABNA 4J6HA 4A3JB 1BOSA 1QG7A 4KKUA 1NAPA 5C3WA 4A3JG 5ELDA 2KCNA 3AEVA 4LJZC 1ET9A 1JT8A 5KEEA 1NR2A 2UXCQ 3WOFA 3FHWA 3UE1A 2R93B 2R92H 4BBRG 2JA7G 1MJCA 3BDOA 4RGMA 4UAIA 4DUYQ 4QCLA 4K0KL 2A6ED 2RDHA 1V1QA 2DUDA 2KJXA 5JPNC 4TSSA 1DXMA 2X6LA 5M5WH 4IFDJ 3BS1A 1NY4A 2JEBI 1IKLA 2EYMA 2ZTDA 4K6LA 1BBUA 1WCMG 3Q22A 4XQJA 1RIPA 3E9HA 4IALA 2A74C 2PYKA 1CTMA 1GHKA 5KNCA 2QEJC 1NE3A 3CU7A 1GUOA 3DHQA 4A76A 2JA6B 1TWCH 4A3BG 4NDXA 4LUOA 1K9MC 3CCRA 1JMCA 2EY2A 1TQOA 1N36Q 1D5XC 1RDPD 5AFWA 3J81i 2C9OA 2RDFA 2PMZB 4PMWA 1C0AA 5ELOA 5IYBH 2F0GA 2A6HD 5FJ8H 2AHOB 4QL5A 3RLFA 2K5NA 1GUNA 3ICEA 5DNFA 4XIGS 2IPKD 2D0PA 4JI4L 3A8IE 2IWHA 2FHTA 1I3QB 4QJFA 4KD4A 3AB9A 2BA1A 4RCNA 1I4HA 3H6MA 3VR2A 4AH6A 2WAQG 3QIAA 1EYGA 1EU4A 2NVQB 1J6QA 4CGYB 1VQKA 2OT2A 3FEWX 1I4RA 1XPOA 2R7FA 1WTPA 2HQLA 4RGTA 2Q2TA 1UE5A 4BWGB 4YCUA 3K0XA 4CJ1B 1SAPA 1VQPA 3OWFA 4B3SQ 2IT1A 4DPGA 5E4WC 1ILPA 2J7ZA 2JYOA 3EA6A 1JB7A 1FJGL 3MHBA 1NBWA 2CH4A 3S15H 3RMHA 1DOKA 2KHSA 4WRDA 3U58A 3CMAA 2WV6D 5K5PA 3CW2C 4TVAB 3MAQA 3A7AB 2EYPA 2HCIA 3GTOB 3DM3A 1PRTD 4JI7Q 5KGUA 1HR0L 1HNZL 1PH6A 2I5MX 1PDQA 2L15A 3Q24A 3S14B 1EOTA 1A3UA 3F1ZA 4JI8L 4JPBW 4ZRZA 3RD4A 4B3SL 2QDBA 2EYLA 1SE8A 2E76C 4YWMA 1N9WA 1O7YA 4OO1I 3D6CA 4YIJA 2EY6A 4ME3A 3K81C 1LT5D 5DM73 5IWAQ 1HR0Q 3JAMi 4AYBB 5LL6X 4DK6C 2BA0A 2B2WC 5EJWA 2Q8IB 1TWFH 1AP0A 3U9OA 1T5EA 1TWGH 3S1RH 5M3MB 3PIO3 2L5TA 2JA6H 3H09A 2EY1A 4IJLA 5C0XH 4GNXC 1ESFA 3GO5A 1BDOA 1X3GA 2A6EC 4C2MB 3S2DB 1VQDA 1WTOA 2EJFC 1ICFB 2EOTA 3TMEA 5D3IB 4C3IG 2PMZE 1XPUA 1CI3M 2KA7A 4CDCC 4BBRH 3CCEA 1O7LA 2K04A 3HOZB 1A2UA 3C1FA 2ZJPA 2B63B 4OX9Q 1LLRD 3SEBA 3NSWA 4KHPL 3G48A 1S5DD 3D8GA 2B63H 1BCPC 2SOBA 1K8GA 4U673 1QUQA 3T1HQ 4FYDA 2B2VA 1EY6A 4DUZL 1OXVA 3FMCA 1B9MA 4ZLTF 4A3FH 1W3SA 2FJ2A 1FL0A 3ONAB 3W5OA 5C44H 2F0NA 4JCVE 1I94L 1HNWL 2HDLA
chains in the Genus database with same CATH topology
4RKLA 3I4NB 3SK4A 5LL6S 5CORA 4HCEA 3GTQB 1HUMA 4ZAIA 2E2HB 2Z8LA 3IFTA 1G91A 2Z1CA 3Q0AA 4KHZA 1YNNC 1CA5A 1HUNA 1HA6A 2NN6G 3I4MB 2R3ZA 3BDCA 3DWPA 1GXDC 3AU7A 3A8JE 2MPMA 4TQUS 2KECA 2O5IC 1XYIA 3L3OC 1MI2A 5J1ZA 4IUVA 5DAUA 4LMQD 1TVXA 3D3RA 5NUCA 3J7YW 3FRPB 4K14A 1MSGA 1PRTF 4ILWA 1ZEQX 1X32A 2XIWA 2XRSD 4DU9A 3GV6A 2M2LA 1HA5A 2RQXA 1NR4A 1ENCA 2RSOA 2JEAI 1RKNA 1U4RA 1CHQD 4C1NK 2F4IA 2L55A 2K5DA 2CVRA 4C3HG 3QWNA 3FDTA 4FXGC 1KLGD 3DXJC 2DY8A 3KLSA 2MJ8A 1ICWA 2DN8A 1KLUD 4I7ZC 1DM0B 2Y0SB 3TP8A 4A3EB 4K8IA 2BDOA 3A55A 4QUCA 5C6AA 4DAPA 3NWTA 1F2ZA 4CJ2C 2PZTA 4HMIA 3R8BA 4G7ZC 1IKMA 4G4KA 2F3WA 3L9AX 4XTCS 1VCIA 5CYUA 1LTSD 3AMUA 4FF2A 3VYTA 2K05A 2MHVA 1JWUD 1SNQA 1QE6A 1Y8OB 2D2CC 2PW5A 1JE4A 2D62A 4H44C 4DAVA 1I6HB 2NYZD 2G9HD 2F0SA 1M4VA 1E2WA 1WTQA 2E2IB 1HQMC 1OXUA 3JAML 1AFPA 1II3A 1SMYC 4R8IA 4MIUA 2ENBA 1GJXA 3IFDA 3CRKC 1PTOF 2KEDA 4OIJA 2SNMA 2EE1A 4EQOA 2IL8A 2IX1A 4FO2A 1SBBB 3NPPA 5ISRA 1LTRD 3TDQA 2OXPA 2EYJA 4X3TA 1GUSA 2XWJB 1CM9A 3OW7A 3M4YA 1WCMB 4J8QA 3D6WA 1AZPA 3MVVA 1LTAD 3DWQA 4RHSA 2ZXRA 2JA7B 2CW0C 2CW0D 1PZKD 3I3CA 5I2XA 3K0YA 4EQNA 1FR3A 1HCZA 4DA2A 4IURA 2A6HC 1Z47A 2PPBC 1TS3A 1IYVA 4BY7B 1ONLA 1IW7D 3S9WA 3NWSA 3R2TA 3MXPA 5C4ZA 2EVBA 1IYUA 1SNCA 1GUWA 5EKLA 2B2TA 4C1NI 3VA7A 2A68D 4RA8A 4IUQA 2AQ1B 1B9NA 2RBMA 4IUPA 1AW7A 1SE2A 4FNFA 2KUMA 2VB3X 1G291 2K7VA 3PUVA 3SK8A 1LABA 2C5CA 2EJGC 2EPBA 1Q3LA 1TS2A 5EKIA 4HSPA 1MD2D 1U4PA 1R9TB 4GZYC 5CC4A 5CBEE 3TN2A 3F2UA 4K5XA 3GP7A 2F0FA 3K7AB 1HXYD 1KDAA 4K2KA 3PO3B 3X3NA 1EEID 1CA6A 1DOMA 1A3TA 5JJZA 3KUPA 3ZYYX 2F0JA 1PZID 1XTCD 1IHZA 1YNND 2GA4B 3I70A 4CKCA 1FGBD 4DF7A 1M8AA 4TKOB 1HPCA 5CR3A 3T56B 3O13A 1O80A 1CZGA 3GTMB 1EWHA 4FXKC 2PZUA 4H7BA 3URYA 4OO1G 2M00A 3M7NA 5HURA 3PUXA 3HGBA 4F87A 5EKKA 2XNAC 2NN6I 4RFBA 1LTBD 1FD7D 1WTVA 3OIPA 3T13A 1WTXA 5JAVA 1B50A 3RZOB 2IW3A 3CHBD 1CQVA 1Y1VB 3W3AA 4V0BA 3S2HB 4OO1H 1FNVA 3BDLA 1TY0A 4JK1C 1DJRD 4ME5A 5M5WB 4WFN3 4ID6A 3SK5A 2K1BA 1FNWA 3ND9A 2F0VA 4RGNA 4XT3B 1EIHA 1F9PA 1IW7C 3EQLC 2N55A 3IKJA 3GTKB 3NXWA 3S1RB 2HDMA 1PTOH 2B2YC 5IGCA 3Q6SA 1DCZA 2N88A 2B2VC 1F9RA 1C4QA 4ZK9B 4A3DB 3P75A 3HKZB 2L11A 2AUJD 4KY7A 1CZWA 2Z4IA 3HOWB 3KBXA 3OMCA 5COYA 3SK6A 5T1IA 2D5DA 2QF7A 3KBGA 2KEEA 4C3JB 3I4LA 4K2LA 3IAYA 5ELCA 5JVH3 3RZDB 3WOEA 3PUYA 3S17B 2PNRC 2EJMA 3TZDA 3J80L 1SDFA 2L0CA 4KK7A 2VXWA 3IL8A 4RH6A 3MXNA 2ZT9C 3OSOA 1MBYA 1JWMD 2Q8TA 3PO2B 4P2CB 3MC0B 5CGKA 3GTPB 1CFMA 3BG3A 3SDZA 2O5JC 5D3DA 1TWFB 4K6DA 4HEDA 4A93B 3GQBA 2F0DA 1EYDA 5I2YA 1MSHA 2K5WA 1O78A 3NE5B 3R2IA 4QIWB 1EL0A 4RAUC 1VF7A 3HEJA 1EYCA 3TP7A 4UDUC 4HCSA 3NTIA 5BN4A 5I4DA 1SMYD 4KJNA 1XX8A 2R6GA 4IUUA 2DY7A 4M8AA 2NVYB 1ML0D 3VR5A 2F0UA 1QJOA 4C56C 1TR5A 4JBWA 3OIQA 2NVTB 3T16A 3UI2A 3PV0A 1TT2A 4HN7A 5M9OA 1E2ZA 2Z4HA 4E6IA 4IZ8A 3K58A 1L0YB 5I9PA 3VR3A 1SXTA 4Q5VA 2EYFA 5C0XI 1CT1D 1G6ZA 5I6WA 1SEBD 3BZDB 2M9VA 4IQZA 3NBHA 1BNZA 2NTTA 2EXZA 4K8JA 5CV8A 1IL8A 1WD0A 1D5ZC 5C44B 5IGDA 3T4AC 2K5QA 5EPKA 3V05A 3M7GA 1KNEA 3P20A 3I73A 1W6JA 1UEAB 4QB4A 2K03A 4HTHA 4BA2I 3E6ZX 1GOZA 3MXGA 2VB2X 3VYRA 2F0WA 3J80E 3NUCA 5T1GA 1QWYA 1Q1BA 1JOKA 1ILQA 2JXMB 4ZKBB 1LV9A 3S15B 2JP1A 1VF5C 1RTNA 5CBAE 4MN3A 4NW2A 2PW7A 1ESRA 4KKSA 5CV9A 3ERQA 4QF4A 4V190 1D2BA 3H91A 1ZYRC 1X3QA 2QCPX 4XYQA 4IN3A 4IFDH 1EQTA 4ULLA 2RKSA 1STHA 1OO9B 4RKBA 2F3VA 1S5CD 1S5BD 2JSOA 5EGTA 4BY1B 1LT6D 2B2YA 2ID0A 3K5LA 1OXSC 2X6GA 2E2DC 3HG9A 1EIGA 2F0PA 3C46A 5IOCA 1EY4A 1SNMA 5FO7B 2LS01 4S3SA 3K5OA 3BYYB 1VMPA 4DK0A 1CQFA 4RWSC 2BOSA 1MGSA 4ZYSA 2NZ1D 1W6KA 2NBFA 3K5MA 2B39A 2R92B 3DMUA 1E0BA 5G3LF 5C0XJ 1JB3A 1YNJD 1F9QA 4XDXA 1SYGA 1A2TA 5CV7A 2A5HA 1PRTB 2VUMB 1DOLA 1I4GA 1FYCA 5C0XG 3DUZA 3M85A 1TIID 2WINB 3D4DA 1ZYRD 1F2LA 3DEOA 1JWSD 3HOUB 3VYUA 4IFDI 3MWYW 1H9JA 4F8MA 3BVGA 3DWAA 3VR4A 4FF4A 2KCCA 1K8OA 1RTOA 4ZQ3A 1V8QA 1BXTA 2AWOA 5KIXA 1PTOD 2F0EA 1EY7A 3N52A 2XWBB 3TSSA 1S5ED 2NN6H 1VMCA 5C4HA 5A2QL 1H9SA 3HOYB 5IGFA 1AEXA 1BBXC 1A15A 2FINB 4DGZA 2MGSA 4QMGA 2MP1A 1Q12A 2EYHA 3EROA 4G57A 1SSOA 3TBIB 3QO2A 1SYEA 4A3KB 1ENFA 3L7ZC 5C5MA 2AQ2B 3PMFA 1SE4A 1CHPD 1D1KA 3LX0A 4QUFA 5KYLA 1I4QA 4XQNA 4PV1C 3C3LA 4OGQC 5EPJA 5JPMC 1OXTA 3PUZA 5E3FA 2QKIC 3J81E 2KOLA 1ENAA 5EPLA 3I8ZA 5EBDA 1UUPA 4RGOS 3KLRA 2R7ZB 3MXUA 4BBSB 4DNRB 2RVLA 1S5FD 1S4ZA 2EY5A 5LHY1 2BDNA 1BCPD 1EQVA 4KTAA 5ELBA 5CV5A 4Z9CB 1H9MA 2PQEA 2B8GA 2K6AA 3N6RA 1BF4A 4XXEA 2NVXB 5KNDA 4KD3A 3G6JB 4FF3A 1F9SA 1B1ZA 2F0IA 2F0TA 4PMCA 4RCOA 5BN3A 1XXGA 3MFYA 3G7LA 3FKIB 2ICIA 3KF8A 3A54A 5KRUA 4DNTB 1LTID 1F2YA 1WVLA 2A69C 1V1PB 4DFAA 2TSSA 1LTTD 1KNAA 4K5VA 1SNOA 2B2TC 2JE6I 4R8NA 4XYOA 2HCCA 4X3KA 3K59A 2O2LD 1Z6HA 4OL7A 1JOOA 3J7AF 1BQQT 2R61A 3TP6A 4LK1C 1I4XA 1EY8A 1STYA 1G2TA 1SJHD 2NB0A 1TWHB 4PNYA 5FOBB 1RF2D 1HFNA 1QNUA 5KYIA 1HHVA 1TWGB 2BE5C 2K33A 3OWEB 1RCVD 3MEHA 1QCBD 2OEOA 1STEA 1EEFD 3OHXC 1KTKA 4CBVA 1R4PB 2F0KA 5EQ0A 2A68C 1U4MA 3LWUA 3WDNA 4A3GB 5IGBA 2G9DA 3DEPA 1DD2A 2A73B 4IUNA 4ODGA 1Q90A 3GD7A 3X3MA 5G3LD 1Y8PB 1B3AA 1SNPA 2L4NA 1B4OA 3PUWA 2D9UA 4EQPA 5DEHA 3JAME 4G7OC 2F0HA 2DNCA 3K57A 3NTKA 2J0TD 2FMCA 4HSVA 3M4OB 1SNDA 2EYOA 1C48A 2BCOA 5IT9L 1RODA 3BVMA 1K8MA 3BYTB 2WP8J 1JCKB 1SYFA 1SYDA 2K01A 2AQ3B 4FF1A 5C4JB 1HTPA 1JICA 3A8KE 1KABA 1GUGA 5F2DA 1H9RA 1EWCA 2E75C 4NMZA 4DAYA 3DM1A 3OOCA 5A2QE 1WTRA 2F0MA 2XVSA 1QNKA 3MFGA 1NUCA 3H94A 5CV4A 4NP5A 5M5YB 4KY6A 1D6EC 3HOXB 3NQIA 1LACA 2WAQB 4IUTA 5FLXE 1SYBA 1R4QB 1J9OA 4Y7NB 5ELFA 4H0LC 3QB3A 3M3YB 1D1IA 3I72A 2WB1B 3A56A 3QJYA 3C2PA 1V43A 4L6TB 1PLFA 2FMMA 1B44D 5C3XA 3P1HA 2OF1A 1E2VA 2I07B 4RHRA 3HRZC 4F7XA 1LT3D 1EY9A 1I50B 2WKCA 2CQAA 4F88A 3I91A 5D14A 2HQEA 2F03A 5K36G 1D5MC 2VNUD 1I6VC 3MTSA 2B8FA 3A7LA 5IGGA 1SJED 1TS5A 5JVG3 4BA1I 3CQZB 2B2UC 4DXGA 1EY0A 1PFNA 4FP5D 4R9WA 1G2SA 1NCVA 3HS0C 2ZXOA 3NQTA 3TP5A 1J8IA 5BN5A 2EZVA 2YU9B 5KNBA 4DN4M 4MHEA 3TZUA 4CJ0B 1GHJA 4N9PA 1ZXTA 5C3EB 4ZUJA 4IFDG 5FK9C 4EGVA 4Q0FA 1PTOC 4KY5A 2SDFA 1V1PA 3GV3A 1DYQA 5E1FA 1QOHA 5HGTA 1JR0D 1STNA 3T51B 2PCFB 2XN9C 1HQRD 2A69D 1RD9D 2JA5B 3NTHA 1PXUA 2I46A 1UAPA 3U9SA 1BR9A 4A3BB 4X3UA 2K32A 3SHLA 4C3JG 1HRJA 3KK7A 4WJWA 3C1EA 2AUKA 2PO4A 3GTGB 2ZXPA 3D31A 1EFID 1ET6A 2XSCA 5C4XB 1Y1WB 1L0XB 3HOVB 1QB5D 2IX0A 3S1NB 2WKDA 1SFOB 3ITPA 2LMCB 2E74C 4G7HC 4EVOA 1DZ1A 1RHPA 2XRQD 1Q1EA 2AWNA 3MA2B 2IJ0A 1X3PA 1HFGA 3Q23A 5FO8B 4H13C 3D4RA 3EVQA 1I4PA 4A3MB 1WD1A 3R3OA 1JORA 1BCPB 5K36H 1ZKOA 4K5WA 3S1MB 4HMJA 2PZWA 5M5XB 1F2MA 5EBCA 2FFKB 4KV6A 3PIP3 4I65A 3KLSX 1V1OA 1U9RA 5JOBA 5JEAG 3E0JA 1AZQA 3R93A 2MUYA 3J7AV 2WIIB 2HUGA 2DNEA 4KMUC 1JQYD 5IT9E 1PTOB 3EJIA 1PZJD 5I6YA 3SR1A 5FLXL 3W2DA 3LWEA 4NKLA 2ICEC 1PFBA 4U68A 5ELEA 4FVMA 3CKIB 4M1UB 2L9HA 1STGA 1PMRA 4BBRB 1FNUA 4KKTA 2J4XA 1EZ8A 1TKWB 3V2TA 3QG1A 3SVMA 1LO5D 4WORA 1C8CA 4XT1B 2YYZA 4ZUIA 3CRLC 4N9TA 3GTJB 3K6OA 1XWEA 1HTLD 5FO9B 4LAAA 4B9XA 2B2UA 5JEAH 4J1MA 5DM63 5J22A 1TY2A 2CHBD 3I90A 3LNNA 1TWAB 1F77A 2B2WA 5IIFA 3VR6A 3EFXD 1Q8IA 4B9WA 2IX3A 4O42A 3D4WA 3HP3A 1KAAA 2H1EA 4PMBA 2JA8B 2L1BA 4CKBA 1VDZA 2L12A 3S16B 3H3VC 1BUVT 1EY5A 3BVZA 3MZ5A 1STAA 1Y8NB 2LKVA 3T53B 3QOLA 1BO0A 4CHTB 1A6XA 5CV6A 5M3FB 5TSSA 2O4XA 1KDCA 1LT4D 2WACA 4X3SA 3GTLB 4C3IB 5A35A 3E5SA 3VA5A 3QOJA 2RA4A 5D65A 2F0OA 1RJTA 3OPOA 4XQQA 4B08A 3NHHA 5IODA 5IGEA 1PRTC 1UNSA 1Y69U 1U4LA 4A3IB 4KN7C 3H0GB 1OXXK 1B2TA 1AN8A 1H9KA 3S1QB 2RDGA 1SYCA 4OHJA 2SEBD 1K83B 2F0QA 2LY7A 3SXHA 3NK9A 2KQ3A 2H4OA 3OMGA 5CMDA 2F0LA 3P7JA 1Z7TA 1JOQA 2F1MA 4BS9A 1CK1A 2QILA 4O1NA 4C3HB 3RUZA 1KDBA 4OIKA 1STBA 4PQXA 4DK1A 4HR7B 1JC7A 2SNSA 1EYAA 1NSNS 4KN4C 3VYSA 1WTWA 1BCPF 3NBIA 1LTGD 4TRDA 3J81L 3FPPA 1EZ6A 1G8ZD 4FXDA 3HZXA 4KJOA 2RSNA 1TS4A 5J39A 2KVMA 4ZKCB 5E4XA 1B53A 1DONA 1TWCB 3V96A 4L63B 4CKEA 2K28A 4KI0A 1H9SB 1GUTA 1A3VA 1SE3A 2Q8RE 1EU3A 4A3FB 5JEAJ 3FPUB 3K5NA 5FKAC 4KHVA 5I9OA 5C5LA 2BE5D 1T5XD 2X69A 2NWGA 1YNJC 4DXFA 4L8JA 2E2JB 1PYWD 1O7ZA 2EDGA 2NTSA 2NUCA 1QILA 4HAEA 3FVQA 2LFNA 1TU2B 2V4DA 3SE0A 3NP8A 1PFMA 2TMPA 3ND8A 4ABNA 4J6HA 4A3JB 1BOSA 1QG7A 4KKUA 1NAPA 5C3WA 5ELDA 2KCNA 4LJZC 1ET9A 5KEEA 1NR2A 3WOFA 2R93B 4RGMA 3BDOA 4UAIA 4QCLA 2A6ED 2RDHA 2KJXA 5JPNC 4TSSA 1DXMA 2X6LA 4IFDJ 3BS1A 2JEBI 1IKLA 2EYMA 4K6LA 3Q22A 4XQJA 4IALA 2A74C 2PYKA 1CTMA 1GHKA 5KNCA 2QEJC 3CU7A 1GUOA 3DHQA 2JA6B 4NDXA 2EY2A 1TQOA 1D5XC 1RDPD 5AFWA 2C9OA 2RDFA 2PMZB 4PMWA 2F0GA 2A6HD 3RLFA 1GUNA 5DNFA 4XIGS 2IPKD 3A8IE 2IWHA 2FHTA 1I3QB 4KD4A 3AB9A 2BA1A 4RCNA 1I4HA 3H6MA 3VR2A 3QIAA 1EU4A 2NVQB 4CGYB 2OT2A 3FEWX 1I4RA 1WTPA 4RGTA 4BWGB 4CJ1B 1SAPA 3OWFA 2IT1A 5E4WC 1ILPA 2J7ZA 2JYOA 3EA6A 3MHBA 3RMHA 1DOKA 2KHSA 4WRDA 2WV6D 5K5PA 3MAQA 3A7AB 2EYPA 2HCIA 3GTOB 1PRTD 5KGUA 1PDQA 3S14B 3Q24A 1EOTA 1A3UA 4ZRZA 3RD4A 2QDBA 2EYLA 2E76C 1O7YA 4OO1I 3D6CA 4YIJA 2EY6A 1LT5D 5DM73 4AYBB 5LL6X 2BA0A 2B2WC 5EJWA 2Q8IB 1AP0A 3U9OA 1T5EA 5M3MB 3PIO3 2L5TA 3H09A 2EY1A 5C0XH 1ESFA 3GO5A 1BDOA 2A6EC 4C2MB 3S2DB 1WTOA 2EJFC 2EOTA 3TMEA 5D3IB 4C3IG 1CI3M 2KA7A 1O7LA 2K04A 3HOZB 1A2UA 3C1FA 2B63B 1LLRD 3SEBA 3NSWA 1S5DD 3D8GA 1BCPC 2SOBA 4U673 4FYDA 2B2VA 1EY6A 1OXVA 3FMCA 1B9MA 4ZLTF 2FJ2A 3ONAB 2F0NA 2HDLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IGG A;  4ZQ3 A;  4RKL A;  5I9P A;  3NP8 A;  3MHB A;  4LAA A;  1F2Y A;  4RKB A;  3SK4 A;  4B9X A;  2F3V A;  2PZU A;  4DFA A;  4H7B A;  5KIX A;  4J6H A;  2EYF A;  4J1M A;  2KHS A;  2M00 A;  1EY0 A;  4K5V A;  4WRD A;  5EGT A;  4EQN A;  5HUR A;  2F0E A;  1SNO A;  3TP8 A;  1KAB A;  5C3W A;  3RUZ A;  4K8I A;  3OSO A;  1EY7 A;  5F2D A;  5K5P A;  5I6W A;  3EVQ A;  1KDB A;  5C6A A;  4R8N A;  5EKK A;  5KEE A;  1STB A;  5C4H A;  2F0P A;  3R3O A;  1JOR A;  3NQT A;  1STH A;  2EYP A;  1F2Z A;  3S9W A;  3TP5 A;  5IOC A;  1EY4 A;  5CGK A;  1SNM A;  3MXP A;  5IIF A;  4OL7 A;  2PZT A;  1JOO A;  4HMI A;  4NMZ A;  5C4Z A;  2SNS A;  5IGF A;  4K5W A;  2EXZ A;  3TP6 A;  4N9P A;  2F3W A;  1AEX A;  4K8J A;  1EYA A;  5CV8 A;  4S3S A;  3T13 A;  4B9W A;  1SNC A;  4ZUJ A;  1NSN S;  5KGU A;  1EY8 A;  4HMJ A;  1STY A;  2EYM A;  2F0M A;  5JAV A;  5EKL A;  2PZW A;  1A3U A;  4KY5 A;  1F2M A;  4DGZ A;  4QMG A;  3D4W A;  2EYH A;  2QDB A;  2EYL A;  3ERO A;  4G57 A;  5IGD A;  1SNQ A;  4K6D A;  4KV6 A;  4IAL A;  4PNY A;  1NUC A;  3BDC A;  4I65 A;  5CV4 A;  2PYK A;  3D6C A;  1KAA A;  2F0D A;  4KY6 A;  4NP5 A;  2PW5 A;  1EYD A;  2EY6 A;  4PMB A;  4YIJ A;  5KYI A;  2RBM A;  1U9R A;  5JOB A;  1SYE A;  3BDL A;  5C5M A;  1SYB A;  4TRD A;  3PMF A;  5E1F A;  4ME5 A;  3DHQ A;  4ID6 A;  3MEH A;  5J1Z A;  1EZ6 A;  5HGT A;  3SK5 A;  2F0S A;  2OEO A;  4NDX A;  3HZX A;  3LX0 A;  3DMU A;  5DAU A;  5KYL A;  1STN A;  4KJO A;  3SK8 A;  4QB4 A;  2F0V A;  4HTH A;  3QB3 A;  2EY2 A;  2F0K A;  1TQO A;  1EY5 A;  5NUC A;  3HEJ A;  3MZ5 A;  1EYC A;  3U9O A;  4K14 A;  5J39 A;  1STA A;  2LKV A;  5IGB A;  5E3F A;  3QOL A;  1II3 A;  3EJI A;  3TP7 A;  2RDF A;  4MIU A;  5I6Y A;  2ENB A;  5CV6 A;  3NXW A;  3SR1 A;  1SYG A;  1ENA A;  2EY1 A;  1A2T A;  2F0G A;  2F0W A;  5CV7 A;  2O4X A;  4DU9 A;  4IUN A;  4ODG A;  1KDC A;  3NUC A;  4NKL A;  4KJN A;  2WAC A;  1JOK A;  1SNP A;  2SNM A;  3E5S A;  3VA5 A;  1A3V A;  3SHL A;  4EQO A;  5IGC A;  2EY5 A;  3TME A;  5C3X A;  5CC4 A;  3QOJ A;  1ENC A;  4EQP A;  5DEH A;  5J22 A;  1EQV A;  3D4D A;  3P75 A;  2F0O A;  3P1H A;  2F0H A;  4KHV A;  5I9O A;  2OF1 A;  3NHH A;  3C1E A;  4KD4 A;  5IOD A;  2F0U A;  4KY7 A;  5ISR A;  1STG A;  4K5X A;  2OXP A;  5IGE A;  1A2U A;  4KTA A;  5C5L A;  2F0F A;  3C1F A;  5CV5 A;  1KDA A;  1RKN A;  3H6M A;  3OMC A;  4K2K A;  2EYJ A;  2PQE A;  1TR5 A;  2PW7 A;  3SK6 A;  4F7X A;  1SND A;  2EYO A;  1EZ8 A;  3D8G A;  1EY9 A;  5CV9 A;  3T16 A;  2SOB A;  3V2T A;  1A3T A;  4KD3 A;  2F0J A;  3ERQ A;  4QF4 A;  1TT2 A;  4F8M A;  1JOQ A;  1IHZ A;  3MVV A;  2F0I A;  1SYF A;  2F0T A;  4DF7 A;  1EY6 A;  1SYD A;  1SYC A;  4PMC A;  4WOR A;  5M9O A;  4K2L A;  3ITP A;  4E6I A;  2F0Q A;  4EVO A;  2HQE A;  2NUC A;  3SXH A;  3NK9 A;  2KQ3 A;  3OWF A;  4IZ8 A;  2F0N A;  5CR3 A;  4ZUI A;  3OMG A;  4N9T A;  2RKS A;  2F0L A;  5KRU A; 
#chains in the Genus database with same CATH topology
 1SN8 A;  2IHF A;  4RKL A;  3I4N B;  3SK4 A;  5LL6 S;  5COR A;  4HCE A;  1KQS A;  4DUY L;  3GTQ B;  1HUM A;  1YIT A;  4ZAI A;  1B3Q A;  2JA8 G;  2JA8 H;  2E2H B;  2Z8L A;  3IFT A;  1QZH A;  1G91 A;  2Z1C A;  1M1K C;  3Q0A A;  1K73 C;  4GKK Q;  4KHZ A;  4LW1 A;  2N3S A;  3S17 H;  1I6H H;  1YNN C;  1FVI A;  1CA5 A;  4LF7 Q;  1HUN A;  5AJ3 Q;  1HA6 A;  5C3E G;  2NN6 G;  2K52 A;  3I4M B;  2R3Z A;  3BDC A;  1QUQ B;  3DWP A;  3PSI A;  1GXD C;  4N8F A;  3AU7 A;  3A8J E;  2MO0 A;  2MPM A;  4TQU S;  2KEC A;  2O5I C;  1OTC A;  2DJF C;  1XYI A;  2B63 G;  3L3O C;  1MI2 A;  2HHH L;  5J1Z A;  4IUV A;  5AJ3 L;  5DAU A;  4LMQ D;  1TVX A;  3D3R A;  2VQE L;  2Q2U A;  5NUC A;  4O2D A;  3J7Y W;  3FRP B;  3M4P A;  1MSG A;  4K14 A;  1HH2 P;  4GKK L;  4JI3 Q;  1YNX A;  1PRT F;  4EX5 A;  4LF4 L;  1X55 A;  3GTG H;  4JI3 L;  4ILW A;  1ZEQ X;  2R7D A;  1X32 A;  1VQH A;  2XIW A;  4A93 G;  2XRS D;  4DU9 A;  3GV6 A;  3HOU G;  1JJG A;  2M2L A;  1HA5 A;  2RQX A;  1NR4 A;  2E2J H;  4DR6 L;  1ENC A;  2R7Z G;  2RSO A;  2JEA I;  1IBL Q;  1RKN A;  4JI5 Q;  1U4R A;  1CHQ D;  1XNR L;  4DUZ Q;  4C1N K;  4X64 L;  2F4I A;  1PH7 A;  4OEM B;  2L55 A;  2K5D A;  2CVR A;  4C3H G;  1PH1 A;  3QWN A;  3FDT A;  4FXG C;  1KLG D;  4OX9 L;  1Y1W H;  1UEB A;  3DXJ C;  2DY8 A;  3KLS A;  2MJ8 A;  1NMG A;  5C4J H;  1ICW A;  3UE0 A;  2DN8 A;  3KOJ A;  1KLU D;  4I7Z C;  1DM0 B;  2Y0S B;  3TP8 A;  4A3E B;  4K8I A;  3D0F A;  1L2F A;  2BDO A;  3A55 A;  4QUC A;  5C6A A;  2E5L L;  4A3G G;  3HOW G;  3ULL A;  4DAP A;  4LUV A;  3NWT A;  1F2Z A;  4DR3 L;  4B3T Q;  4Y52 H;  4CJ2 C;  2PZT A;  4HMI A;  3R8B A;  4G7Z C;  1IKM A;  1K28 A;  3NEM A;  4G4K A;  2F3W A;  3L9A X;  4XTC S;  1VCI A;  5CYU A;  1LTS D;  3AMU A;  4NXN L;  2N8N A;  2K5H A;  4FF2 A;  1D8L A;  3S1M H;  3VYT A;  2K05 A;  3RZD H;  2MHV A;  1JWU D;  1SNQ A;  1QE6 A;  1Y8O B;  2D2C C;  4CDF C;  3RR5 A;  4HJ8 A;  2PW5 A;  1JE4 A;  1LTL A;  2D62 A;  4H44 C;  4DAV A;  3S2H H;  1I6H B;  2NYZ D;  4MTN A;  2G9H D;  2F0S A;  4JYA Q;  4BBS G;  1M4V A;  1E2W A;  1WTQ A;  1PV4 A;  4OEL B;  1GO3 E;  2E2I B;  3U4V A;  1HQM C;  1OXU A;  3JAM L;  1VQ5 A;  3F8T A;  1AFP A;  1II3 A;  1SMY C;  4APV A;  4R8I A;  4AQY L;  4MIU A;  2K50 A;  2ENB A;  1GJX A;  3IFD A;  3CRK C;  1AE3 A;  1VS0 A;  2ATW A;  4L5S A;  1PTO F;  3PO3 H;  3UDI A;  2KED A;  4OIJ A;  2SNM A;  4UHV A;  2EE1 A;  1KAW A;  4EQO A;  2IL8 A;  2Y0S E;  2IX1 A;  3CC7 A;  3M4O H;  2UXC L;  4FO2 A;  4DR1 L;  1SBB B;  4LF4 Q;  3NPP A;  1C7Y A;  5ISR A;  1LTR D;  3TDQ A;  2OXP A;  2RHQ B;  1WFQ A;  2EYJ A;  4X3T A;  1GUS A;  2XWJ B;  2VL6 A;  4FDB A;  4QIW E;  1CM9 A;  3OW7 A;  4DR1 Q;  3M4Y A;  4YY3 Q;  1WCM B;  2EIF A;  3D6W A;  3CP0 A;  4J8Q A;  1AZP A;  4L5Q A;  3MVV A;  4DR2 Q;  5IYC G;  1LTA D;  2R93 H;  4IPD A;  3DWQ A;  4RHS A;  4DV1 Q;  2ZXR A;  2JA7 B;  4LFA Q;  2CW0 C;  2CW0 D;  1EFW A;  5EAY A;  1PZK D;  3I3C A;  2K5V A;  5I2X A;  3K0Y A;  1HNX Q;  4EQN A;  1FR3 A;  1HCZ A;  4A3M G;  2VQF L;  4DA2 A;  4IUR A;  1N32 Q;  4NXM L;  2A6H C;  1Z47 A;  2PPB C;  1TS3 A;  1IYV A;  4BY7 B;  1ONL A;  1IW7 D;  3S9W A;  3NWS A;  3R2T A;  3HOZ G;  3MXP A;  2B29 A;  5C4Z A;  2EVB A;  1IYU A;  2JK8 A;  2C35 B;  1SNC A;  1GUW A;  2NZO A;  5EKL A;  2B2T A;  4C1N I;  3VA7 A;  2LSS A;  1IBL L;  1XTD A;  2A68 D;  4RA8 A;  2CWP A;  2AQ1 B;  4IUQ A;  1B9N A;  2RBM A;  1LM0 A;  2I5L X;  4IUP A;  1AW7 A;  1SE2 A;  4FNF A;  1AH9 A;  3HKS A;  1I5F A;  2KUM A;  2VB3 X;  3OTO Q;  1G29 1;  4K0K Q;  1LYL A;  2K7V A;  3PUV A;  3SK8 A;  1LAB A;  2C5C A;  2EJG C;  2EPB A;  1K8A C;  1Q3L A;  5L37 A;  1TS2 A;  5EKI A;  4HSP A;  3IRB A;  3SGI A;  3RZO H;  4J15 A;  2D0O A;  1MD2 D;  1U4P A;  1R9T B;  4GZY C;  2Z0S A;  3GTJ H;  5CC4 A;  5CBE E;  3RN2 A;  3KYH C;  3TN2 A;  4LFA L;  3F2U A;  1S3O A;  2WB1 G;  4K5X A;  3GP7 A;  1HR0 W;  1VQG A;  2NVQ H;  2F0F A;  3K7A B;  1HXY D;  1KDA A;  4K2K A;  4P72 A;  3PO3 B;  3X3N A;  1EEI D;  1CA6 A;  2GVB A;  1FJG Q;  1DOM A;  3L0O A;  1A3T A;  5JJZ A;  3KUP A;  4QGU A;  3ZYY X;  2F0J A;  1PZI D;  1XTC D;  3I70 A;  1IHZ A;  1YNN D;  2GA4 B;  4CKC A;  1FGB D;  4DF7 A;  4BY7 G;  1M8A A;  1TXY A;  4TKO B;  5E7N A;  1HPC A;  5CR3 A;  3T56 B;  4UPA A;  4DAY B;  1TWA H;  3O13 A;  1N33 L;  1O80 A;  4L5R C;  4YCW A;  1CZG A;  4A3E H;  4FXK C;  1EWH A;  1B70 B;  2PZU A;  3GTM B;  4H7B A;  3URY A;  4OO1 G;  3J80 i;  2M00 A;  1W2B A;  3M7N A;  5HUR A;  3PUX A;  4DR3 Q;  1CKO A;  1QVC A;  3HOX G;  3HOX H;  3HGB A;  4F87 A;  1KRS A;  5EKK A;  3F2B A;  2XNA C;  2NN6 I;  2WB1 E;  4RFB A;  1EQR A;  1FD7 D;  1LTB D;  1WTV A;  1A8V A;  3FP9 A;  3OIP A;  3T13 A;  4GOP C;  1WTX A;  1VQ6 A;  5BR8 Q;  4IJH A;  5JAV A;  1B50 A;  3RZO B;  2N78 A;  2IW3 A;  3CHB D;  1CQV A;  4AYB E;  1Y1V B;  3W3A A;  1D7Q A;  4V0B A;  3S2H B;  4OO1 H;  3TRZ A;  1FNV A;  3ULP A;  5IE8 A;  3BDL A;  1TY0 A;  4JK1 C;  1DJR D;  4ME5 A;  1NNX A;  1L0W A;  4LF8 L;  5M5W B;  4WFN 3;  4ID6 A;  3SK5 A;  2K1B A;  4HIM A;  4DV4 Q;  1XMO Q;  1FNW A;  3ND9 A;  4IPH A;  2F0V A;  4RGN A;  4XT3 B;  4DR4 L;  1EIH A;  1MKH A;  2F4V Q;  3CXC A;  1F9P A;  5GAH C;  1IW7 C;  1KHI A;  3EQL C;  2G5D A;  2N55 A;  3IKJ A;  2CCZ A;  2Q2I A;  3GTK B;  3NXW A;  3PGZ A;  2HDM A;  4OWT B;  3S1R B;  3NEL A;  2K75 A;  1PTO H;  2B2Y C;  5IGC A;  2EQS A;  3Q6S A;  1DCZ A;  2N88 A;  3HKZ G;  2B2V C;  1F9R A;  1C4Q A;  4ZK9 B;  4A3D B;  3P75 A;  1ASZ A;  3HKZ B;  2L11 A;  2AUJ D;  3HFZ B;  3S16 H;  4KY7 A;  1CZW A;  2Z4I A;  3HOW B;  3KBX A;  3OMC A;  3KF6 B;  5COY A;  3SK6 A;  5IP9 G;  5T1I A;  2D5D A;  1HNZ Q;  2QF7 A;  3KBG A;  2KEE A;  4C3J B;  3I4L A;  4R1J A;  4K2L A;  1VQL A;  3IAY A;  4R4I A;  5ELC A;  5JVH 3;  4R4T A;  3RZD B;  4JI1 Q;  3WOE A;  3PUY A;  3S17 B;  2PNR C;  2EJM A;  3TZD A;  3J80 L;  1SDF A;  3JAM c;  2L0C A;  4KK7 A;  2VXW A;  3IL8 A;  1SFO H;  4R4C A;  3MXN A;  4RH6 A;  4WJ3 M;  2ZT9 C;  3OSO A;  1MBY A;  1JWM D;  2Q8T A;  4H02 A;  3PO2 B;  4GLX A;  4P2C B;  4A3K G;  3MC0 B;  5CGK A;  1B7Y B;  4IPG A;  1KRT A;  3PO2 H;  1Z9F A;  3GTP B;  4DV3 Q;  3RNU A;  2V1C C;  2UUB L;  1CFM A;  3BG3 A;  1YIJ A;  3H3V H;  3SDZ A;  2QEX A;  2O5J C;  5D3D A;  4DV6 L;  1TWF B;  2OQK A;  1SR3 A;  4K6D A;  4HED A;  4A93 B;  3GQB A;  2F0D A;  1VQC A;  1EYD A;  5I2Y A;  1MSH A;  2K5W A;  2P5Z X;  1KL9 A;  1O78 A;  3NE5 B;  2K4K A;  3R2I A;  3I56 A;  4QIW B;  1EL0 A;  2OWO A;  2DJG C;  4RAU C;  2AKW B;  5J3B A;  1GM5 A;  2PI2 A;  1VF7 A;  3HEJ A;  3RLO A;  1EYC A;  5IYD H;  1VQI A;  3M9B A;  3STB C;  3TP7 A;  4UDU C;  4HCS A;  3NTI A;  4A93 H;  5BN4 A;  5I4D A;  1SMY D;  2Z6K C;  4KJN A;  1XX8 A;  2R6G A;  4IUU A;  2DY7 A;  4M8A A;  2UUA Q;  2NVY B;  4JVZ A;  1ML0 D;  3VR5 A;  5C4X G;  4LF6 Q;  1BKB A;  2F0U A;  1EIF A;  3PO2 G;  1QJO A;  4C56 C;  1PH9 A;  4GN4 B;  2CQO A;  1TR5 A;  4JBW A;  3J7Z C;  3OIQ A;  1K0S A;  4KHP Q;  1E7Z A;  2NVT B;  3T16 A;  3UI2 A;  3PV0 A;  2RCN A;  4LF8 Q;  4A3E G;  1TT2 A;  1IZ6 A;  4HN7 A;  5M9O A;  1E2Z A;  2Z4H A;  4E6I A;  4IZ8 A;  1IXR A;  3K58 A;  4JI8 Q;  1L0Y B;  3BZK A;  5I9P A;  3VR3 A;  2OTL A;  4JI2 L;  1FGU A;  1SXT A;  2YV5 A;  2EYF A;  4Q5V A;  2A19 A;  1X9N A;  3G4S A;  5C0X I;  1CT1 D;  1G6Z A;  2CH4 W;  5I6W A;  2N49 A;  1UE7 A;  1SEB D;  3BZD B;  2M9V A;  4IQZ A;  1CKM A;  1K83 H;  3NBH A;  4IO9 A;  1BNZ A;  2KCT A;  2NTT A;  5IY0 A;  2EXZ A;  3CPF A;  2E2I H;  4K8J A;  5CV8 A;  5GQO A;  4POF A;  1IL8 A;  1WD0 A;  1Y1W G;  3I2Z A;  4YHH L;  1D5Z C;  5C44 B;  5IGD A;  3T4A C;  3S14 H;  2K5Q A;  5EPK A;  3V05 A;  1Q46 A;  3I55 A;  3M7G A;  4OON A;  1KNE A;  3CF5 A;  2QDL A;  3I73 A;  3P20 A;  4GNX B;  1W6J A;  1UEA B;  4BXX G;  1UE1 A;  4QB4 A;  2K03 A;  4HTH A;  4BA2 I;  1PH3 A;  3E6Z X;  1GOZ A;  3MXG A;  1Q86 C;  1VQ8 A;  3HOZ H;  2PQA A;  2R93 G;  2VB2 X;  3VYR A;  1WTH A;  3BU2 A;  2F0W A;  2Z6B A;  3J80 E;  2E5L Q;  1H95 A;  3NUC A;  5T1G A;  1QWY A;  1Q1B A;  1JOK A;  4AYB G;  1ILQ A;  2JXM B;  3BJU A;  3A5Z B;  4ZKB B;  1L1O B;  2H5X A;  1PH5 A;  1LV9 A;  4GLA C;  3S15 B;  3EN2 A;  2JP1 A;  1VF5 C;  1G6P A;  2ES2 A;  1RTN A;  5CBA E;  4MN3 A;  4NW2 A;  4GLV B;  2PW7 A;  1ESR A;  2I5H A;  4KKS A;  5CV9 A;  3S24 A;  1J5E Q;  2JQO A;  2PI2 E;  3ERQ A;  4QF4 A;  4V19 0;  2ZJR A;  4NXN Q;  1D2B A;  3UDX A;  4LF6 L;  1YHB A;  3H91 A;  1ZYR C;  1X3Q A;  2QCP X;  4X65 L;  4A3C G;  3T1H L;  4XYQ A;  4IN3 A;  4IFD H;  1EQT A;  5GAD C;  4ULL A;  2RKS A;  1STH A;  1OO9 B;  4A3I G;  3U4Z A;  4RKB A;  2F3V A;  1S5C D;  1S5B D;  3KDF A;  2JSO A;  5EGT A;  4BY1 B;  1LT6 D;  2B2Y A;  1A62 A;  4DR5 L;  2ID0 A;  3K5L A;  1VQ9 A;  1OXS C;  2X6G A;  2UXD L;  1VQF A;  2E2D C;  3HG9 A;  1N36 L;  1EIG A;  2F0P A;  3C46 A;  5LMU L;  5IOC A;  1EY4 A;  1SNM A;  5FO7 B;  2LS0 1;  4LFC Q;  4BY1 G;  4DV1 L;  4S3S A;  4GOP A;  3K5O A;  3BYY B;  1VMP A;  4DK0 A;  1CQF A;  4RWS C;  2BOS A;  1MGS A;  4ZYS A;  2NZ1 D;  1W6K A;  2MO1 A;  1Y1V G;  2NBF A;  4PZ8 A;  3GDE A;  5JJK A;  3ULJ A;  2XTI A;  3K5M A;  1AE2 A;  2B39 A;  4YY3 L;  2R92 B;  3DMU A;  2CFM A;  3KLW A;  3HOY G;  1VQ4 A;  1E0B A;  5G3L F;  5C0X J;  1JB3 A;  1VQN A;  5M3F H;  1YNJ D;  4JW0 A;  3EBE A;  1F9Q A;  2ZTC A;  4XDX A;  1SYG A;  5IYB G;  1A2T A;  5IP7 G;  5CV7 A;  4LF5 L;  2A5H A;  1SRO A;  4Y7N H;  1PRT B;  2VUM B;  2PNH A;  1DOL A;  1I4G A;  2VQE Q;  1FYC A;  3EIV A;  5C0X G;  3DUZ A;  3M85 A;  1YJN A;  5JJI A;  1TII D;  2WIN B;  2QGQ A;  3D4D A;  1ZYR D;  1K0R A;  1F2L A;  2YTV A;  3AFP A;  4HIO A;  3DEO A;  4JYA L;  1JWS D;  3HOU B;  4YWL A;  3VYU A;  4LF7 L;  3PQI A;  3HOU H;  1LUZ A;  3TS0 A;  4IFD I;  4LWC A;  3MWY W;  1H9J A;  5IP7 H;  4F8M A;  2YU9 H;  1XPR A;  3BVG A;  3DWA A;  3VR4 A;  4FF4 A;  2RCF A;  4X66 Q;  2KCC A;  3GTM H;  1YEZ A;  1K8O A;  1RTO A;  2ZTE A;  4ZQ3 A;  1Y14 B;  1V8Q A;  4C3H H;  1BXT A;  2AWO A;  3UDF A;  5KIX A;  1PTO D;  1NTG A;  4NXM Q;  2F0E A;  4CDE C;  1EY7 A;  3N52 A;  2XWB B;  1PFS A;  3TSS A;  4AIM A;  1S5E D;  5M3F G;  2NN6 H;  4X65 Q;  1VMC A;  5C4H A;  3L2P A;  5A2Q L;  3AFQ A;  1H9S A;  3OW2 A;  3HOY B;  5IGF A;  2CWA A;  4KLK A;  1AEX A;  1S40 A;  2MQH A;  1BBX C;  3M3Y H;  1A15 A;  2FIN B;  2MGS A;  4DGZ A;  5M5Y H;  4QMG A;  2MP1 A;  1Q12 A;  2EYH A;  3ERO A;  4G57 A;  2NZH A;  4GN5 A;  1SSO A;  3KJP A;  4DR7 Q;  2NVY H;  1SLJ A;  1YHQ A;  3TBI B;  1IBK Q;  4X64 Q;  3QO2 A;  1SYE A;  4A3K B;  1ENF A;  3L7Z C;  4YWK A;  5C5M A;  2AQ2 B;  3PMF A;  4DKA C;  5C3E H;  1SE4 A;  4NPS A;  1CHP D;  1D1K A;  3LX0 A;  4QUF A;  5KYL A;  1HJP A;  1I4Q A;  3HOY H;  4XQN A;  3A5U A;  5BR8 L;  4A3I H;  4PV1 C;  3A0J A;  3B6Y A;  3C3L A;  3KJO A;  4OGQ C;  4LUZ A;  2XGT A;  5EPJ A;  4JOI C;  5JPM C;  1OXT A;  3MXN B;  3PUZ A;  5E3F A;  2QKI C;  1HZA A;  2LXK A;  1Y1V H;  3J81 E;  2KOL A;  1X3E A;  1ENA A;  2BH8 A;  5EPL A;  3I8Z A;  1X65 A;  5EBD A;  3J80 c;  2NVX H;  1UUP A;  4RGO S;  4GKJ L;  3KLR A;  2R7Z B;  3MXU A;  1N34 Q;  4BBS B;  1N33 Q;  2QA4 A;  4DNR B;  3OYY A;  4A3D H;  2RVL A;  2VZA A;  1S5F D;  1S4Z A;  3T1Y L;  2EY5 A;  2WFW A;  1WJJ A;  5LHY 1;  2BDN A;  4LF5 Q;  1BCP D;  1XJV A;  1EQV A;  1K3R A;  1UWV A;  5C4X H;  4IOC A;  3CCU A;  5C44 G;  4KTA A;  5ELB A;  5CV5 A;  4Z9C B;  4C3I H;  3GTL H;  1H9M A;  2PQE A;  1I50 H;  3RLN A;  2B8G A;  4DV2 Q;  2K6A A;  3N6R A;  1BF4 A;  4XXE A;  4HID A;  2NVX B;  5KND A;  4KD3 A;  3G6J B;  4FF3 A;  1F9S A;  2F3I A;  3CAM A;  1B1Z A;  4N8X 1;  2F0I A;  2F0T A;  3J7A 5;  4PMC A;  4RCO A;  5BN3 A;  1XXG A;  2ZJQ A;  3MFY A;  3PCO B;  4MZ9 A;  3CD6 A;  3G7L A;  3FKI B;  3VDY A;  2ICI A;  3KF8 A;  3A54 A;  1UE6 A;  4DK3 C;  4DNT B;  5KRU A;  1HZB A;  4AQY Q;  1LTI D;  1F2Y A;  2JA7 H;  1WVL A;  2A69 C;  1V1P B;  4DFA A;  2TSS A;  1LTT D;  1KNA A;  1NMF A;  4K5V A;  5GAE C;  1SNO A;  3F2C A;  2B2T C;  2JE6 I;  1KXL A;  4HIK A;  1YI2 A;  3K7A H;  1N8R C;  3I7F A;  1WCM H;  4R8N A;  2LXJ A;  1Q7Y C;  4XYO A;  4JI2 Q;  2JA6 G;  5M3M G;  1PHJ A;  2HCC A;  2NVT H;  4X3K A;  3K59 A;  2O2L D;  1Z6H A;  4OL7 A;  1JOO A;  3J7A F;  1BQQ T;  2R61 A;  4A3K H;  3TP6 A;  4LK1 C;  1A63 A;  1I4X A;  1EY8 A;  1STY A;  4UY8 C;  1G2T A;  1E24 A;  1SJH D;  2NB0 A;  1TWH B;  2UU9 L;  4A3J H;  2UUC Q;  4PNY A;  5FOB B;  1RF2 D;  1JJ2 A;  1HFN A;  1QNU A;  5KYI A;  3K7U C;  1HHV A;  1TWG B;  2BE5 C;  2K33 A;  3W1B A;  1R9T H;  3OWE B;  2F52 A;  1RCV D;  3MEH A;  1MIU A;  1QCB D;  2OEO A;  1STE A;  5M5X H;  1EEF D;  3OHX C;  4BXX H;  5GRO A;  1KTK A;  4CBV A;  1R4P B;  2F0K A;  5EQ0 A;  2A68 C;  1U4M A;  2DGY A;  2UXD Q;  3LWU A;  3WDN A;  4A3G B;  5IGB A;  2G9D A;  3GTO H;  3DEP A;  2KHI A;  1DD2 A;  2A73 B;  4IUN A;  4ODG A;  1Q90 A;  3GD7 A;  3X3M A;  5G3L D;  3CCQ A;  1Y8P B;  1B3A A;  1SNP A;  5DLQ E;  2L4N A;  1B4O A;  3PUW A;  1C9O A;  2D9U A;  4EQP A;  2ZM6 Q;  5DEH A;  3JAM E;  4G7O C;  1G51 A;  3CQZ H;  2F0H A;  2DNC A;  4A4I A;  1X54 A;  1EWI A;  4B3M L;  3K57 A;  3NTK A;  2J0T D;  2FMC A;  4HSV A;  3M4O B;  4P74 A;  1SND A;  2EYO A;  3H15 A;  1C48 A;  2BCO A;  5IT9 L;  4LFB L;  1VQ7 A;  1ROD A;  3BVM A;  4DV3 L;  1K8M A;  3BYT B;  2WP8 J;  1JCK B;  3GTK H;  2RF4 A;  1SYF A;  1SYD A;  2K01 A;  4BY1 H;  2OTJ A;  2AQ3 B;  2K14 A;  4FF1 A;  2UXB Q;  5C4J B;  4LFB Q;  1HTP A;  4JI6 L;  3A74 A;  3CC4 A;  3E0E A;  4A3C H;  1JIC A;  3A8K E;  3HKZ E;  1KAB A;  1GUG A;  1E1O A;  5H1S E;  5F2D A;  1H9R A;  5IYD G;  1V9P A;  2YTX A;  1EWC A;  1GKH A;  2E75 C;  4JI1 L;  2Z9H A;  4NMZ A;  2JA9 A;  1MJE A;  4DAY A;  1P8L A;  3ZJY C;  3DM1 A;  3OOC A;  5A2Q E;  4JBJ A;  4DV0 Q;  4JOI A;  2E2H H;  1WTR A;  2F0M A;  1CKN B;  5FJ8 G;  2XVS A;  1QNK A;  3MFG A;  1NUC A;  3H94 A;  5FLX c;  5CV4 A;  4B3R Q;  4NP5 A;  5M5Y B;  4KY6 A;  1D6E C;  4HJ5 A;  1EOV A;  1GD7 A;  1LAC A;  3NQI A;  3HOX B;  2WAQ B;  4IUT A;  5FLX E;  1SYB A;  1Q81 C;  1R4Q B;  1A0I A;  4JBK A;  4IOA A;  1ASY A;  1J9O A;  3J81 j;  4Y7N B;  5ELF A;  4H0L C;  5FLM H;  4A3B H;  3QB3 A;  1EIY B;  3M3Y B;  1KC8 C;  1KD1 C;  2GN5 A;  1D1I A;  4JI0 Q;  3I72 A;  4JI0 L;  3U50 C;  2WB1 B;  2HD3 A;  3A56 A;  3QJY A;  4PZ7 A;  3NEN A;  3STB D;  1V43 A;  4L6T B;  3C2P A;  1PLF A;  5IP9 H;  3TS2 A;  2CKZ B;  2FMM A;  1B44 D;  1PH4 A;  5C3X A;  1IL2 A;  3P1H A;  1E3P A;  2OF1 A;  1IBK L;  3K8A A;  3H3V I;  1E2V A;  2I07 B;  4L5T A;  4RHR A;  2MFI A;  3I4N G;  3LGJ A;  3HRZ C;  3I4O A;  4F7X A;  1BBW A;  1LT3 D;  2MNA A;  1EY9 A;  1B8A A;  1I50 B;  2WKC A;  1P16 A;  2CQA A;  4DV5 L;  2A8V A;  4F88 A;  3I91 A;  5D14 A;  2HQE A;  2F03 A;  2UUC L;  1E22 A;  5K36 G;  1D5M C;  2VNU D;  1VQM A;  1I6V C;  3MTS A;  2B8F A;  2UUA L;  3A7L A;  4LF9 Q;  5IGG A;  1SJE D;  1YVC A;  1SMX A;  4OWX B;  2UUB Q;  1TS5 A;  4OWW B;  5JVG 3;  4BA1 I;  3CQZ B;  2B2U C;  4DXG A;  1EY0 A;  2I0Q A;  1PFN A;  1GVP A;  1N32 L;  4RMF A;  4FP5 D;  2VQF Q;  2IY5 B;  4EQ5 A;  4R9W A;  1G2S A;  1NCV A;  3HS0 C;  2ZXO A;  5IWA L;  3NQT A;  4JI6 Q;  5LMN L;  3TP5 A;  2IHE A;  3MEF A;  1J8I A;  5BN5 A;  2EZV A;  5KNB A;  2YU9 B;  4DN4 M;  4MHE A;  3TZU A;  4CJ0 B;  1GHJ A;  4N9P A;  1ZXT A;  3F2D A;  5C3E B;  4ZUJ A;  1RL2 A;  4IFD G;  5FK9 C;  3CCS A;  4Q0F A;  4EGV A;  3GTP H;  1PTO C;  4KY5 A;  2HHH Q;  2SDF A;  1V1P A;  4JG2 A;  4GS3 A;  3GV3 A;  1X6O A;  1DYQ A;  3KF8 B;  5E1F A;  4JBM A;  4HJA A;  1QOH A;  5HGT A;  2VUM G;  1JR0 D;  1YBY A;  2QW7 A;  4NB3 A;  1STN A;  3T51 B;  5LMU Q;  2PCF B;  2Y0S G;  2XN9 C;  3KDF B;  1HQR D;  4JI4 Q;  2A69 D;  1RD9 D;  4LFC L;  2JA5 B;  3NTH A;  2JA5 G;  1PXU A;  2I46 A;  4GOP B;  1UAP A;  3KF6 A;  1YJW A;  3FKI G;  2UXB L;  3U9S A;  1BR9 A;  1PH8 A;  2BH2 A;  1QVF A;  4A3B B;  4DR5 Q;  4DNI A;  2ALY B;  4X3U A;  3CC2 A;  2K32 A;  3SHL A;  1I3Q H;  4MNO A;  4C3J G;  4QQB X;  4ZCK A;  1JJC B;  1HRJ A;  3KK7 A;  4WJW A;  4LF9 L;  3C1E A;  3DLL A;  1I94 Q;  3OTO L;  4JV5 Q;  1VQB A;  3CME A;  2AUK A;  2R92 G;  2PO4 A;  4R4Q A;  1J5E L;  2ZXP A;  3GTG B;  3D31 A;  2HIX A;  4DV4 L;  1EFI D;  1ET6 A;  3S1N H;  2XSC A;  4PZ6 A;  2FXQ A;  4WJ4 A;  1VQO A;  5C4X B;  1L0X B;  3H0G H;  1Y1W B;  3HOV B;  1QB5 D;  2IX0 A;  3S1N B;  2WKD A;  1SFO B;  3ITP A;  2LMC B;  2E74 C;  4HJ9 A;  4RG1 A;  4G7H C;  4EVO A;  1DZ1 A;  1JE5 A;  4BBS H;  1RHP A;  2XRQ D;  1Q1E A;  2AWN A;  1T9H A;  2VY3 A;  3MA2 B;  2IJ0 A;  3HOV G;  1X3P A;  1HFG A;  3Q23 A;  3CCL A;  5FO8 B;  4H13 C;  3D4R A;  3EVQ A;  2F4V L;  1I4P A;  1QVG A;  1HZ9 A;  4A3M B;  1WD1 A;  3S1Q H;  4DR4 Q;  3R3O A;  1MHW C;  1JOR A;  2JJQ A;  4JC0 A;  1BCP B;  3I4M H;  5K36 H;  1ZKO A;  5JJL A;  1VQJ A;  4K5W A;  4ALP A;  3S1M B;  1CKN A;  4HMJ A;  2PZW A;  5M5X B;  1BVS A;  1F2M A;  5EBC A;  3M4Q A;  2FFK B;  4KV6 A;  3PIP 3;  4I65 A;  1M90 C;  3KLS X;  3I4N H;  1V1O A;  1U9R A;  5JOB A;  2WAQ E;  3E3X A;  3PF5 A;  5JEA G;  3E0J A;  3R93 A;  4YHH Q;  1AZQ A;  4X6A H;  2MUY A;  3J7A V;  2Q2H A;  2WII B;  2HUG A;  3JC6 6;  5M3M H;  2DNE A;  2KCM A;  1JQY D;  4KMU C;  4DV7 Q;  1XMQ L;  4B3M Q;  5IT9 E;  4X62 Q;  4OXP A;  1PTO B;  3EJI A;  1PZJ D;  4YCV A;  5I6Y A;  3SR1 A;  5LMN W;  5FLX L;  3W2D A;  3LWE A;  4NKL A;  2ICE C;  1VQA A;  3AYH B;  1PFB A;  5LMN Q;  1WYD A;  2JN4 A;  4U68 A;  4DV7 L;  5ELE A;  1XMQ Q;  4FVM A;  3CKI B;  4M1U B;  1EQQ A;  1SRU A;  4I7A A;  4P73 A;  2GVA A;  1WOC A;  2L9H A;  5IYC H;  1STG A;  3CCJ A;  1PMR A;  4BBR B;  1QZG A;  4DR7 L;  1FNU A;  4KKT A;  2J4X A;  1EZ8 A;  1TKW B;  3V2T A;  4UP9 A;  1IBM Q;  2Z6K A;  4MTK A;  3QG1 A;  2HIV A;  3SVM A;  2VS1 A;  1LO5 D;  4WOR A;  1N34 L;  1C8C A;  4XT1 B;  2YYZ A;  3CCM A;  4ZUI A;  2B3G A;  3CRL C;  4N9T A;  4HJ7 A;  1X56 A;  3K6O A;  4UP7 A;  3GTJ B;  1XWE A;  1HTL D;  5FO9 B;  4LAA A;  3PO3 G;  4B9X A;  4IPC A;  2B2U A;  5JEA H;  4J1M A;  5DM6 3;  5J22 A;  1HZC A;  3TQY A;  5IT9 c;  1TY2 A;  2A1A A;  1YJ9 A;  2CHB D;  3I90 A;  3LNN A;  2YTY A;  1TWA B;  3J81 c;  1F77 A;  4UP8 A;  1PYB A;  1XNQ Q;  2B2W A;  5IIF A;  3VR6 A;  3EFX D;  3UDG A;  1Q8I A;  4B9W A;  1KIX A;  1CSQ A;  2IX3 A;  4DR2 L;  4O42 A;  3D4W A;  3HP3 A;  3PF4 A;  4JI5 L;  4QY7 A;  3W1G A;  4A3L H;  1Q8K A;  1KAA A;  2H1E A;  4PMB A;  2ASB A;  2JA8 B;  2L1B A;  4CKB A;  1VDZ A;  2L12 A;  4JV5 L;  3S16 B;  4DR6 Q;  1U0L A;  2UU9 Q;  3E9I A;  3AQQ A;  3H3V C;  1BUV T;  2KBN A;  4B3R L;  3PIP A;  1EY5 A;  3MZ5 A;  3BVZ A;  4PG3 A;  1STA A;  1Y8N B;  2LKV A;  3T53 B;  3QOL A;  1BO0 A;  4CHT B;  1A6X A;  2EXD A;  3Q8D A;  5CV6 A;  5M3F B;  5TSS A;  4POG A;  2O4X A;  1KDC A;  1LT4 D;  3T1Y Q;  3K80 C;  2WAC A;  4X3S A;  4C3I B;  3GTL B;  4A3L G;  5A35 A;  3E5S A;  3VA5 A;  4LNQ A;  4GKJ Q;  2OQ0 A;  3G71 A;  3QOJ A;  3QR8 A;  2RA4 A;  1IYJ B;  5D65 A;  2F0O A;  1RJT A;  3OPO A;  4XQQ A;  4B08 A;  3I4M G;  1YZ6 A;  3NHH A;  3TEH B;  4X62 L;  5IOD A;  4P75 A;  1U5K A;  5IGE A;  4A3G H;  2R7Z H;  3PIO A;  1PRT C;  1UNS A;  2AMC B;  1Y69 U;  1U4L A;  4A3I B;  4KN7 C;  3H0G G;  4JI7 L;  3H0G B;  3HOV H;  1OXX K;  1B2T A;  1AN8 A;  1H9K A;  3S1Q B;  1NJI C;  2RDG A;  1O7I A;  1SYC A;  4OHJ A;  5FLM G;  2SEB D;  1K83 B;  2F0Q A;  2LY7 A;  3SXH A;  3NK9 A;  2KQ3 A;  2H4O A;  1TWH H;  2OCE A;  3ERS X;  3OMG A;  4DAM A;  5CMD A;  2F0L A;  3P7J A;  1Z7T A;  1JOQ A;  2F1M A;  5HY6 A;  4BS9 A;  1CK1 A;  1L1O C;  1S72 A;  2KHJ A;  2QIL A;  4O1N A;  4C3H B;  4A3M H;  3RUZ A;  1Q82 C;  1KDB A;  1CSP A;  4OIK A;  3CPW A;  1STB A;  4PQX A;  1PYS B;  4DK1 A;  4HR7 B;  5HGQ A;  1HNW Q;  1JC7 A;  2SNS A;  4C3J H;  4DV5 Q;  1EYA A;  1NSN S;  4KN4 C;  3WWV A;  4O0A A;  4GN3 B;  1XMO L;  4R4O A;  4BY7 H;  3FKI H;  3VYS A;  1L1O A;  1WTW A;  1EUJ A;  2RHS B;  3RN5 A;  4P71 A;  1XNQ L;  2JA5 H;  1BCP F;  3NBI A;  1LTG D;  4C2M H;  4TRD A;  3J81 L;  4A75 A;  1XNR Q;  3S2D H;  3FPP A;  3GTQ H;  1EZ6 A;  1G8Z D;  1PH2 A;  4FXD A;  3HZX A;  4KJO A;  2PQA B;  4B3T L;  2RSN A;  2VUM H;  4CDD C;  4A3D G;  1HNX L;  1TS4 A;  5J39 A;  2E8G A;  2KVM A;  4ZKC B;  5E4X A;  1B53 A;  1DON A;  1TWC B;  3V96 A;  4L63 B;  4GNX A;  1DGS A;  2KEN A;  4CKE A;  2K28 A;  2HT1 A;  4KI0 A;  1H9S B;  1GUT A;  1A3V A;  1SE3 A;  3CCV A;  2Q8R E;  1EU3 A;  1IBM L;  4A3F B;  5JEA J;  1VQE A;  3FPU B;  3BZC A;  5FKA C;  3K5N A;  4KHV A;  5I9O A;  3ER0 A;  4A3F G;  1YHA A;  1X3F A;  4X66 L;  5C5L A;  2BE5 D;  1T5X D;  2X69 A;  2NWG A;  3NBH B;  5ELN A;  1E1T A;  1YNJ C;  4DXF A;  2VW9 A;  4L8J A;  3HOW H;  5GAG C;  2E2J B;  1PA6 A;  4DV0 L;  1PYW D;  3TRE A;  1O7Z A;  3G6E A;  2EDG A;  2NTS A;  1K3B C;  1PVO A;  1CUK A;  4DV6 Q;  2NUC A;  1QIL A;  4DV2 L;  4HAE A;  3FVQ A;  2LFN A;  1WI5 A;  1TU2 B;  2V4D A;  3SE0 A;  3KFU A;  3NP8 A;  2ZM6 L;  1PFM A;  2TMP A;  3ND8 A;  4ABN A;  4J6H A;  4A3J B;  1BOS A;  1QG7 A;  4KKU A;  1NAP A;  5C3W A;  4A3J G;  5ELD A;  2KCN A;  3AEV A;  4LJZ C;  1ET9 A;  1JT8 A;  5KEE A;  1NR2 A;  2UXC Q;  3WOF A;  3FHW A;  3UE1 A;  2R93 B;  2R92 H;  4BBR G;  2JA7 G;  1MJC A;  3BDO A;  4RGM A;  4UAI A;  4DUY Q;  4QCL A;  4K0K L;  2A6E D;  2RDH A;  1V1Q A;  2DUD A;  2KJX A;  5JPN C;  4TSS A;  1DXM A;  2X6L A;  5M5W H;  4IFD J;  3BS1 A;  1NY4 A;  2JEB I;  1IKL A;  2EYM A;  2ZTD A;  4K6L A;  1BBU A;  1WCM G;  3Q22 A;  4XQJ A;  1RIP A;  3E9H A;  4IAL A;  2A74 C;  2PYK A;  1CTM A;  1GHK A;  5KNC A;  2QEJ C;  1NE3 A;  3CU7 A;  1GUO A;  3DHQ A;  4A76 A;  2JA6 B;  1TWC H;  4A3B G;  4NDX A;  4LUO A;  1K9M C;  3CCR A;  1JMC A;  2EY2 A;  1TQO A;  1N36 Q;  1D5X C;  1RDP D;  5AFW A;  3J81 i;  2C9O A;  2RDF A;  2PMZ B;  4PMW A;  1C0A A;  5ELO A;  5IYB H;  2F0G A;  2A6H D;  5FJ8 H;  2AHO B;  4QL5 A;  3RLF A;  2K5N A;  1GUN A;  3ICE A;  5DNF A;  4XIG S;  2IPK D;  2D0P A;  4JI4 L;  3A8I E;  2IWH A;  2FHT A;  1I3Q B;  4QJF A;  4KD4 A;  3AB9 A;  2BA1 A;  4RCN A;  1I4H A;  3H6M A;  3VR2 A;  4AH6 A;  2WAQ G;  3QIA A;  1EYG A;  1EU4 A;  2NVQ B;  1J6Q A;  4CGY B;  1VQK A;  2OT2 A;  3FEW X;  1I4R A;  1XPO A;  2R7F A;  1WTP A;  2HQL A;  4RGT A;  2Q2T A;  1UE5 A;  4BWG B;  4YCU A;  3K0X A;  4CJ1 B;  1SAP A;  1VQP A;  3OWF A;  4B3S Q;  2IT1 A;  4DPG A;  5E4W C;  1ILP A;  2J7Z A;  2JYO A;  3EA6 A;  1JB7 A;  1FJG L;  3MHB A;  1NBW A;  2CH4 A;  3S15 H;  3RMH A;  1DOK A;  2KHS A;  4WRD A;  3U58 A;  3CMA A;  2WV6 D;  5K5P A;  3CW2 C;  4TVA B;  3MAQ A;  3A7A B;  2EYP A;  2HCI A;  3GTO B;  3DM3 A;  1PRT D;  4JI7 Q;  5KGU A;  1HR0 L;  1HNZ L;  1PH6 A;  2I5M X;  1PDQ A;  2L15 A;  3Q24 A;  3S14 B;  1EOT A;  1A3U A;  3F1Z A;  4JI8 L;  4JPB W;  4ZRZ A;  3RD4 A;  4B3S L;  2QDB A;  2EYL A;  1SE8 A;  2E76 C;  4YWM A;  1N9W A;  1O7Y A;  4OO1 I;  3D6C A;  4YIJ A;  2EY6 A;  4ME3 A;  3K81 C;  1LT5 D;  5DM7 3;  5IWA Q;  1HR0 Q;  3JAM i;  4AYB B;  5LL6 X;  4DK6 C;  2BA0 A;  2B2W C;  5EJW A;  2Q8I B;  1TWF H;  1AP0 A;  3U9O A;  1T5E A;  1TWG H;  3S1R H;  5M3M B;  3PIO 3;  2L5T A;  2JA6 H;  3H09 A;  2EY1 A;  4IJL A;  5C0X H;  4GNX C;  1ESF A;  3GO5 A;  1BDO A;  1X3G A;  2A6E C;  4C2M B;  3S2D B;  1VQD A;  1WTO A;  2EJF C;  1ICF B;  2EOT A;  3TME A;  5D3I B;  4C3I G;  2PMZ E;  1XPU A;  1CI3 M;  2KA7 A;  4CDC C;  4BBR H;  3CCE A;  1O7L A;  2K04 A;  3HOZ B;  1A2U A;  3C1F A;  2ZJP A;  2B63 B;  4OX9 Q;  1LLR D;  3SEB A;  3NSW A;  4KHP L;  3G48 A;  1S5D D;  3D8G A;  2B63 H;  1BCP C;  2SOB A;  1K8G A;  4U67 3;  1QUQ A;  3T1H Q;  4FYD A;  2B2V A;  1EY6 A;  4DUZ L;  1OXV A;  3FMC A;  1B9M A;  4ZLT F;  4A3F H;  1W3S A;  2FJ2 A;  1FL0 A;  3ONA B;  3W5O A;  5C44 H;  2F0N A;  4JCV E;  1I94 L;  1HNW L;  2HDL A; 
#chains in the Genus database with same CATH homology
 4RKL A;  3I4N B;  3SK4 A;  5LL6 S;  5COR A;  4HCE A;  3GTQ B;  1HUM A;  4ZAI A;  2E2H B;  2Z8L A;  3IFT A;  1G91 A;  2Z1C A;  3Q0A A;  4KHZ A;  1YNN C;  1CA5 A;  1HUN A;  1HA6 A;  2NN6 G;  3I4M B;  2R3Z A;  3BDC A;  3DWP A;  1GXD C;  3AU7 A;  3A8J E;  2MPM A;  4TQU S;  2KEC A;  2O5I C;  1XYI A;  3L3O C;  1MI2 A;  5J1Z A;  4IUV A;  5DAU A;  4LMQ D;  1TVX A;  3D3R A;  5NUC A;  3J7Y W;  3FRP B;  4K14 A;  1MSG A;  1PRT F;  4ILW A;  1ZEQ X;  1X32 A;  2XIW A;  2XRS D;  4DU9 A;  3GV6 A;  2M2L A;  1HA5 A;  2RQX A;  1NR4 A;  1ENC A;  2RSO A;  2JEA I;  1RKN A;  1U4R A;  1CHQ D;  4C1N K;  2F4I A;  2L55 A;  2K5D A;  2CVR A;  4C3H G;  3QWN A;  3FDT A;  4FXG C;  1KLG D;  3DXJ C;  2DY8 A;  3KLS A;  2MJ8 A;  1ICW A;  2DN8 A;  1KLU D;  4I7Z C;  1DM0 B;  2Y0S B;  3TP8 A;  4A3E B;  4K8I A;  2BDO A;  3A55 A;  4QUC A;  5C6A A;  4DAP A;  3NWT A;  1F2Z A;  4CJ2 C;  2PZT A;  4HMI A;  3R8B A;  4G7Z C;  1IKM A;  4G4K A;  2F3W A;  3L9A X;  4XTC S;  1VCI A;  5CYU A;  1LTS D;  3AMU A;  4FF2 A;  3VYT A;  2K05 A;  2MHV A;  1JWU D;  1SNQ A;  1QE6 A;  1Y8O B;  2D2C C;  2PW5 A;  1JE4 A;  2D62 A;  4H44 C;  4DAV A;  1I6H B;  2NYZ D;  2G9H D;  2F0S A;  1M4V A;  1E2W A;  1WTQ A;  2E2I B;  1HQM C;  1OXU A;  3JAM L;  1AFP A;  1II3 A;  1SMY C;  4R8I A;  4MIU A;  2ENB A;  1GJX A;  3IFD A;  3CRK C;  1PTO F;  2KED A;  4OIJ A;  2SNM A;  2EE1 A;  4EQO A;  2IL8 A;  2IX1 A;  4FO2 A;  1SBB B;  3NPP A;  5ISR A;  1LTR D;  3TDQ A;  2OXP A;  2EYJ A;  4X3T A;  1GUS A;  2XWJ B;  1CM9 A;  3OW7 A;  3M4Y A;  1WCM B;  4J8Q A;  3D6W A;  1AZP A;  3MVV A;  1LTA D;  3DWQ A;  4RHS A;  2ZXR A;  2JA7 B;  2CW0 C;  2CW0 D;  1PZK D;  3I3C A;  5I2X A;  3K0Y A;  4EQN A;  1FR3 A;  1HCZ A;  4DA2 A;  4IUR A;  2A6H C;  1Z47 A;  2PPB C;  1TS3 A;  1IYV A;  4BY7 B;  1ONL A;  1IW7 D;  3S9W A;  3NWS A;  3R2T A;  3MXP A;  5C4Z A;  2EVB A;  1IYU A;  1SNC A;  1GUW A;  5EKL A;  2B2T A;  4C1N I;  3VA7 A;  2A68 D;  4RA8 A;  4IUQ A;  2AQ1 B;  1B9N A;  2RBM A;  4IUP A;  1AW7 A;  1SE2 A;  4FNF A;  2KUM A;  2VB3 X;  1G29 1;  2K7V A;  3PUV A;  3SK8 A;  1LAB A;  2C5C A;  2EJG C;  2EPB A;  1Q3L A;  1TS2 A;  5EKI A;  4HSP A;  1MD2 D;  1U4P A;  1R9T B;  4GZY C;  5CC4 A;  5CBE E;  3TN2 A;  3F2U A;  4K5X A;  3GP7 A;  2F0F A;  3K7A B;  1HXY D;  1KDA A;  4K2K A;  3PO3 B;  3X3N A;  1EEI D;  1CA6 A;  1DOM A;  1A3T A;  5JJZ A;  3KUP A;  3ZYY X;  2F0J A;  1PZI D;  1XTC D;  1IHZ A;  1YNN D;  2GA4 B;  3I70 A;  4CKC A;  1FGB D;  4DF7 A;  1M8A A;  4TKO B;  1HPC A;  5CR3 A;  3T56 B;  3O13 A;  1O80 A;  1CZG A;  3GTM B;  1EWH A;  4FXK C;  2PZU A;  4H7B A;  3URY A;  4OO1 G;  2M00 A;  3M7N A;  5HUR A;  3PUX A;  3HGB A;  4F87 A;  5EKK A;  2XNA C;  2NN6 I;  4RFB A;  1LTB D;  1FD7 D;  1WTV A;  3OIP A;  3T13 A;  1WTX A;  5JAV A;  1B50 A;  3RZO B;  2IW3 A;  3CHB D;  1CQV A;  1Y1V B;  3W3A A;  4V0B A;  3S2H B;  4OO1 H;  1FNV A;  3BDL A;  1TY0 A;  4JK1 C;  1DJR D;  4ME5 A;  5M5W B;  4WFN 3;  4ID6 A;  3SK5 A;  2K1B A;  1FNW A;  3ND9 A;  2F0V A;  4RGN A;  4XT3 B;  1EIH A;  1F9P A;  1IW7 C;  3EQL C;  2N55 A;  3IKJ A;  3GTK B;  3NXW A;  3S1R B;  2HDM A;  1PTO H;  2B2Y C;  5IGC A;  3Q6S A;  1DCZ A;  2N88 A;  2B2V C;  1F9R A;  1C4Q A;  4ZK9 B;  4A3D B;  3P75 A;  3HKZ B;  2L11 A;  2AUJ D;  4KY7 A;  1CZW A;  2Z4I A;  3HOW B;  3KBX A;  3OMC A;  5COY A;  3SK6 A;  5T1I A;  2D5D A;  2QF7 A;  3KBG A;  2KEE A;  4C3J B;  3I4L A;  4K2L A;  3IAY A;  5ELC A;  5JVH 3;  3RZD B;  3WOE A;  3PUY A;  3S17 B;  2PNR C;  2EJM A;  3TZD A;  3J80 L;  1SDF A;  2L0C A;  4KK7 A;  2VXW A;  3IL8 A;  4RH6 A;  3MXN A;  2ZT9 C;  3OSO A;  1MBY A;  1JWM D;  2Q8T A;  3PO2 B;  4P2C B;  3MC0 B;  5CGK A;  3GTP B;  1CFM A;  3BG3 A;  3SDZ A;  2O5J C;  5D3D A;  1TWF B;  4K6D A;  4HED A;  4A93 B;  3GQB A;  2F0D A;  1EYD A;  5I2Y A;  1MSH A;  2K5W A;  1O78 A;  3NE5 B;  3R2I A;  4QIW B;  1EL0 A;  4RAU C;  1VF7 A;  3HEJ A;  1EYC A;  3TP7 A;  4UDU C;  4HCS A;  3NTI A;  5BN4 A;  5I4D A;  1SMY D;  4KJN A;  1XX8 A;  2R6G A;  4IUU A;  2DY7 A;  4M8A A;  2NVY B;  1ML0 D;  3VR5 A;  2F0U A;  1QJO A;  4C56 C;  1TR5 A;  4JBW A;  3OIQ A;  2NVT B;  3T16 A;  3UI2 A;  3PV0 A;  1TT2 A;  4HN7 A;  5M9O A;  1E2Z A;  2Z4H A;  4E6I A;  4IZ8 A;  3K58 A;  1L0Y B;  5I9P A;  3VR3 A;  1SXT A;  4Q5V A;  2EYF A;  5C0X I;  1CT1 D;  1G6Z A;  5I6W A;  1SEB D;  3BZD B;  2M9V A;  4IQZ A;  3NBH A;  1BNZ A;  2NTT A;  2EXZ A;  4K8J A;  5CV8 A;  1IL8 A;  1WD0 A;  1D5Z C;  5C44 B;  5IGD A;  3T4A C;  2K5Q A;  5EPK A;  3V05 A;  3M7G A;  1KNE A;  3P20 A;  3I73 A;  1W6J A;  1UEA B;  4QB4 A;  2K03 A;  4HTH A;  4BA2 I;  3E6Z X;  1GOZ A;  3MXG A;  2VB2 X;  3VYR A;  2F0W A;  3J80 E;  3NUC A;  5T1G A;  1QWY A;  1Q1B A;  1JOK A;  1ILQ A;  2JXM B;  4ZKB B;  1LV9 A;  3S15 B;  2JP1 A;  1VF5 C;  1RTN A;  5CBA E;  4MN3 A;  4NW2 A;  2PW7 A;  1ESR A;  4KKS A;  5CV9 A;  3ERQ A;  4QF4 A;  4V19 0;  1D2B A;  3H91 A;  1ZYR C;  1X3Q A;  2QCP X;  4XYQ A;  4IN3 A;  4IFD H;  1EQT A;  4ULL A;  2RKS A;  1STH A;  1OO9 B;  4RKB A;  2F3V A;  1S5C D;  1S5B D;  2JSO A;  5EGT A;  4BY1 B;  1LT6 D;  2B2Y A;  2ID0 A;  3K5L A;  1OXS C;  2X6G A;  2E2D C;  3HG9 A;  1EIG A;  2F0P A;  3C46 A;  5IOC A;  1EY4 A;  1SNM A;  5FO7 B;  2LS0 1;  4S3S A;  3K5O A;  3BYY B;  1VMP A;  4DK0 A;  1CQF A;  4RWS C;  2BOS A;  1MGS A;  4ZYS A;  2NZ1 D;  1W6K A;  2NBF A;  3K5M A;  2B39 A;  2R92 B;  3DMU A;  1E0B A;  5G3L F;  5C0X J;  1JB3 A;  1YNJ D;  1F9Q A;  4XDX A;  1SYG A;  1A2T A;  5CV7 A;  2A5H A;  1PRT B;  2VUM B;  1DOL A;  1I4G A;  1FYC A;  5C0X G;  3DUZ A;  3M85 A;  1TII D;  2WIN B;  3D4D A;  1ZYR D;  1F2L A;  3DEO A;  1JWS D;  3HOU B;  3VYU A;  4IFD I;  3MWY W;  1H9J A;  4F8M A;  3BVG A;  3DWA A;  3VR4 A;  4FF4 A;  2KCC A;  1K8O A;  1RTO A;  4ZQ3 A;  1V8Q A;  1BXT A;  2AWO A;  5KIX A;  1PTO D;  2F0E A;  1EY7 A;  3N52 A;  2XWB B;  3TSS A;  1S5E D;  2NN6 H;  1VMC A;  5C4H A;  5A2Q L;  1H9S A;  3HOY B;  5IGF A;  1AEX A;  1BBX C;  1A15 A;  2FIN B;  4DGZ A;  2MGS A;  4QMG A;  2MP1 A;  1Q12 A;  2EYH A;  3ERO A;  4G57 A;  1SSO A;  3TBI B;  3QO2 A;  1SYE A;  4A3K B;  1ENF A;  3L7Z C;  5C5M A;  2AQ2 B;  3PMF A;  1SE4 A;  1CHP D;  1D1K A;  3LX0 A;  4QUF A;  5KYL A;  1I4Q A;  4XQN A;  4PV1 C;  3C3L A;  4OGQ C;  5EPJ A;  5JPM C;  1OXT A;  3PUZ A;  5E3F A;  2QKI C;  3J81 E;  2KOL A;  1ENA A;  5EPL A;  3I8Z A;  5EBD A;  1UUP A;  4RGO S;  3KLR A;  2R7Z B;  3MXU A;  4BBS B;  4DNR B;  2RVL A;  1S5F D;  1S4Z A;  2EY5 A;  5LHY 1;  2BDN A;  1BCP D;  1EQV A;  4KTA A;  5ELB A;  5CV5 A;  4Z9C B;  1H9M A;  2PQE A;  2B8G A;  2K6A A;  3N6R A;  1BF4 A;  4XXE A;  2NVX B;  5KND A;  4KD3 A;  3G6J B;  4FF3 A;  1F9S A;  1B1Z A;  2F0I A;  2F0T A;  4PMC A;  4RCO A;  5BN3 A;  1XXG A;  3MFY A;  3G7L A;  3FKI B;  2ICI A;  3KF8 A;  3A54 A;  5KRU A;  4DNT B;  1LTI D;  1F2Y A;  1WVL A;  2A69 C;  1V1P B;  4DFA A;  2TSS A;  1LTT D;  1KNA A;  4K5V A;  1SNO A;  2B2T C;  2JE6 I;  4R8N A;  4XYO A;  2HCC A;  4X3K A;  3K59 A;  2O2L D;  1Z6H A;  4OL7 A;  1JOO A;  3J7A F;  1BQQ T;  2R61 A;  3TP6 A;  4LK1 C;  1I4X A;  1EY8 A;  1STY A;  1G2T A;  1SJH D;  2NB0 A;  1TWH B;  4PNY A;  5FOB B;  1RF2 D;  1HFN A;  1QNU A;  5KYI A;  1HHV A;  1TWG B;  2BE5 C;  2K33 A;  3OWE B;  1RCV D;  3MEH A;  1QCB D;  2OEO A;  1STE A;  1EEF D;  3OHX C;  1KTK A;  4CBV A;  1R4P B;  2F0K A;  5EQ0 A;  2A68 C;  1U4M A;  3LWU A;  3WDN A;  4A3G B;  5IGB A;  2G9D A;  3DEP A;  1DD2 A;  2A73 B;  4IUN A;  4ODG A;  1Q90 A;  3GD7 A;  3X3M A;  5G3L D;  1Y8P B;  1B3A A;  1SNP A;  2L4N A;  1B4O A;  3PUW A;  2D9U A;  4EQP A;  5DEH A;  3JAM E;  4G7O C;  2F0H A;  2DNC A;  3K57 A;  3NTK A;  2J0T D;  2FMC A;  4HSV A;  3M4O B;  1SND A;  2EYO A;  1C48 A;  2BCO A;  5IT9 L;  1ROD A;  3BVM A;  1K8M A;  3BYT B;  2WP8 J;  1JCK B;  1SYF A;  1SYD A;  2K01 A;  2AQ3 B;  4FF1 A;  5C4J B;  1HTP A;  1JIC A;  3A8K E;  1KAB A;  1GUG A;  5F2D A;  1H9R A;  1EWC A;  2E75 C;  4NMZ A;  4DAY A;  3DM1 A;  3OOC A;  5A2Q E;  1WTR A;  2F0M A;  2XVS A;  1QNK A;  3MFG A;  1NUC A;  3H94 A;  5CV4 A;  4NP5 A;  5M5Y B;  4KY6 A;  1D6E C;  3HOX B;  3NQI A;  1LAC A;  2WAQ B;  4IUT A;  5FLX E;  1SYB A;  1R4Q B;  1J9O A;  4Y7N B;  5ELF A;  4H0L C;  3QB3 A;  3M3Y B;  1D1I A;  3I72 A;  2WB1 B;  3A56 A;  3QJY A;  3C2P A;  1V43 A;  4L6T B;  1PLF A;  2FMM A;  1B44 D;  5C3X A;  3P1H A;  2OF1 A;  1E2V A;  2I07 B;  4RHR A;  3HRZ C;  4F7X A;  1LT3 D;  1EY9 A;  1I50 B;  2WKC A;  2CQA A;  4F88 A;  3I91 A;  5D14 A;  2HQE A;  2F03 A;  5K36 G;  1D5M C;  2VNU D;  1I6V C;  3MTS A;  2B8F A;  3A7L A;  5IGG A;  1SJE D;  1TS5 A;  5JVG 3;  4BA1 I;  3CQZ B;  2B2U C;  4DXG A;  1EY0 A;  1PFN A;  4FP5 D;  4R9W A;  1G2S A;  1NCV A;  3HS0 C;  2ZXO A;  3NQT A;  3TP5 A;  1J8I A;  5BN5 A;  2EZV A;  2YU9 B;  5KNB A;  4DN4 M;  4MHE A;  3TZU A;  4CJ0 B;  1GHJ A;  4N9P A;  1ZXT A;  5C3E B;  4ZUJ A;  4IFD G;  5FK9 C;  4EGV A;  4Q0F A;  1PTO C;  4KY5 A;  2SDF A;  1V1P A;  3GV3 A;  1DYQ A;  5E1F A;  1QOH A;  5HGT A;  1JR0 D;  1STN A;  3T51 B;  2PCF B;  2XN9 C;  1HQR D;  2A69 D;  1RD9 D;  2JA5 B;  3NTH A;  1PXU A;  2I46 A;  1UAP A;  3U9S A;  1BR9 A;  4A3B B;  4X3U A;  2K32 A;  3SHL A;  4C3J G;  1HRJ A;  3KK7 A;  4WJW A;  3C1E A;  2AUK A;  2PO4 A;  3GTG B;  2ZXP A;  3D31 A;  1EFI D;  1ET6 A;  2XSC A;  5C4X B;  1Y1W B;  1L0X B;  3HOV B;  1QB5 D;  2IX0 A;  3S1N B;  2WKD A;  1SFO B;  3ITP A;  2LMC B;  2E74 C;  4G7H C;  4EVO A;  1DZ1 A;  1RHP A;  2XRQ D;  1Q1E A;  2AWN A;  3MA2 B;  2IJ0 A;  1X3P A;  1HFG A;  3Q23 A;  5FO8 B;  4H13 C;  3D4R A;  3EVQ A;  1I4P A;  4A3M B;  1WD1 A;  3R3O A;  1JOR A;  1BCP B;  5K36 H;  1ZKO A;  4K5W A;  3S1M B;  4HMJ A;  2PZW A;  5M5X B;  1F2M A;  5EBC A;  2FFK B;  4KV6 A;  3PIP 3;  4I65 A;  3KLS X;  1V1O A;  1U9R A;  5JOB A;  5JEA G;  3E0J A;  1AZQ A;  3R93 A;  2MUY A;  3J7A V;  2WII B;  2HUG A;  2DNE A;  4KMU C;  1JQY D;  5IT9 E;  1PTO B;  3EJI A;  1PZJ D;  5I6Y A;  3SR1 A;  5FLX L;  3W2D A;  3LWE A;  4NKL A;  2ICE C;  1PFB A;  4U68 A;  5ELE A;  4FVM A;  3CKI B;  4M1U B;  2L9H A;  1STG A;  1PMR A;  4BBR B;  1FNU A;  4KKT A;  2J4X A;  1EZ8 A;  1TKW B;  3V2T A;  3QG1 A;  3SVM A;  1LO5 D;  4WOR A;  1C8C A;  4XT1 B;  2YYZ A;  4ZUI A;  3CRL C;  4N9T A;  3GTJ B;  3K6O A;  1XWE A;  1HTL D;  5FO9 B;  4LAA A;  4B9X A;  2B2U A;  5JEA H;  4J1M A;  5DM6 3;  5J22 A;  1TY2 A;  2CHB D;  3I90 A;  3LNN A;  1TWA B;  1F77 A;  2B2W A;  5IIF A;  3VR6 A;  3EFX D;  1Q8I A;  4B9W A;  2IX3 A;  4O42 A;  3D4W A;  3HP3 A;  1KAA A;  2H1E A;  4PMB A;  2JA8 B;  2L1B A;  4CKB A;  1VDZ A;  2L12 A;  3S16 B;  3H3V C;  1BUV T;  1EY5 A;  3BVZ A;  3MZ5 A;  1STA A;  1Y8N B;  2LKV A;  3T53 B;  3QOL A;  1BO0 A;  4CHT B;  1A6X A;  5CV6 A;  5M3F B;  5TSS A;  2O4X A;  1KDC A;  1LT4 D;  2WAC A;  4X3S A;  3GTL B;  4C3I B;  5A35 A;  3E5S A;  3VA5 A;  3QOJ A;  2RA4 A;  5D65 A;  2F0O A;  1RJT A;  3OPO A;  4XQQ A;  4B08 A;  3NHH A;  5IOD A;  5IGE A;  1PRT C;  1UNS A;  1Y69 U;  1U4L A;  4A3I B;  4KN7 C;  3H0G B;  1OXX K;  1B2T A;  1AN8 A;  1H9K A;  3S1Q B;  2RDG A;  1SYC A;  4OHJ A;  2SEB D;  1K83 B;  2F0Q A;  2LY7 A;  3SXH A;  3NK9 A;  2KQ3 A;  2H4O A;  3OMG A;  5CMD A;  2F0L A;  3P7J A;  1Z7T A;  1JOQ A;  2F1M A;  4BS9 A;  1CK1 A;  2QIL A;  4O1N A;  4C3H B;  3RUZ A;  1KDB A;  4OIK A;  1STB A;  4PQX A;  4DK1 A;  4HR7 B;  1JC7 A;  2SNS A;  1EYA A;  1NSN S;  4KN4 C;  3VYS A;  1WTW A;  1BCP F;  3NBI A;  1LTG D;  4TRD A;  3J81 L;  3FPP A;  1EZ6 A;  1G8Z D;  4FXD A;  3HZX A;  4KJO A;  2RSN A;  1TS4 A;  5J39 A;  2KVM A;  4ZKC B;  5E4X A;  1B53 A;  1DON A;  1TWC B;  3V96 A;  4L63 B;  4CKE A;  2K28 A;  4KI0 A;  1H9S B;  1GUT A;  1A3V A;  1SE3 A;  2Q8R E;  1EU3 A;  4A3F B;  5JEA J;  3FPU B;  3K5N A;  5FKA C;  4KHV A;  5I9O A;  5C5L A;  2BE5 D;  1T5X D;  2X69 A;  2NWG A;  1YNJ C;  4DXF A;  4L8J A;  2E2J B;  1PYW D;  1O7Z A;  2EDG A;  2NTS A;  2NUC A;  1QIL A;  4HAE A;  3FVQ A;  2LFN A;  1TU2 B;  2V4D A;  3SE0 A;  3NP8 A;  1PFM A;  2TMP A;  3ND8 A;  4ABN A;  4J6H A;  4A3J B;  1BOS A;  1QG7 A;  4KKU A;  1NAP A;  5C3W A;  5ELD A;  2KCN A;  4LJZ C;  1ET9 A;  5KEE A;  1NR2 A;  3WOF A;  2R93 B;  4RGM A;  3BDO A;  4UAI A;  4QCL A;  2A6E D;  2RDH A;  2KJX A;  5JPN C;  4TSS A;  1DXM A;  2X6L A;  4IFD J;  3BS1 A;  2JEB I;  1IKL A;  2EYM A;  4K6L A;  3Q22 A;  4XQJ A;  4IAL A;  2A74 C;  2PYK A;  1CTM A;  1GHK A;  5KNC A;  2QEJ C;  3CU7 A;  1GUO A;  3DHQ A;  2JA6 B;  4NDX A;  2EY2 A;  1TQO A;  1D5X C;  1RDP D;  5AFW A;  2C9O A;  2RDF A;  2PMZ B;  4PMW A;  2F0G A;  2A6H D;  3RLF A;  1GUN A;  5DNF A;  4XIG S;  2IPK D;  3A8I E;  2IWH A;  2FHT A;  1I3Q B;  4KD4 A;  3AB9 A;  2BA1 A;  4RCN A;  1I4H A;  3H6M A;  3VR2 A;  3QIA A;  1EU4 A;  2NVQ B;  4CGY B;  2OT2 A;  3FEW X;  1I4R A;  1WTP A;  4RGT A;  4BWG B;  4CJ1 B;  1SAP A;  3OWF A;  2IT1 A;  5E4W C;  1ILP A;  2J7Z A;  2JYO A;  3EA6 A;  3MHB A;  3RMH A;  1DOK A;  2KHS A;  4WRD A;  2WV6 D;  5K5P A;  3MAQ A;  3A7A B;  2EYP A;  2HCI A;  3GTO B;  1PRT D;  5KGU A;  1PDQ A;  3S14 B;  3Q24 A;  1EOT A;  1A3U A;  4ZRZ A;  3RD4 A;  2QDB A;  2EYL A;  2E76 C;  1O7Y A;  4OO1 I;  3D6C A;  4YIJ A;  2EY6 A;  1LT5 D;  5DM7 3;  4AYB B;  5LL6 X;  2BA0 A;  2B2W C;  5EJW A;  2Q8I B;  1AP0 A;  3U9O A;  1T5E A;  5M3M B;  3PIO 3;  2L5T A;  3H09 A;  2EY1 A;  5C0X H;  1ESF A;  3GO5 A;  1BDO A;  2A6E C;  4C2M B;  3S2D B;  1WTO A;  2EJF C;  2EOT A;  3TME A;  5D3I B;  4C3I G;  1CI3 M;  2KA7 A;  1O7L A;  2K04 A;  3HOZ B;  1A2U A;  3C1F A;  2B63 B;  1LLR D;  3SEB A;  3NSW A;  1S5D D;  3D8G A;  1BCP C;  2SOB A;  4U67 3;  4FYD A;  2B2V A;  1EY6 A;  1OXV A;  3FMC A;  1B9M A;  4ZLT F;  2FJ2 A;  3ONA B;  2F0N A;  2HDL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...