1A3TA

Staphylococcal nuclease, v23c variant, complex with 2-fluoroethane thiol and 3',5'-thymidine diphosphate
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
135
structure length
134
Chain Sequence
LHKEPATLIKAIDGDTKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Comparison of straight chain and cyclic unnatural amino acids embedded in the core of staphylococcal nuclease.
pubmed rcsb
source organism Staphylococcus aureus
molecule tags Nuclease
molecule keywords STAPHYLOCOCCAL NUCLEASE
total genus 31
structure length 134
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1998-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1a3tA00
2PW5A 1EQVA 1EY0A 3DHQA 3TMEA 1KAAA 2HQEA 1SNOA 5DEHA 4KHVA 4RKBA 2F0EA 5NUCA 4F8MA 4J6HA 5EKKA 2PZTA 3P1HA 5K5PA 2OEOA 1TQOA 3SXHA 2F0DA 5J39A 4IUNA 4N9PA 1SNDA 1II3A 3MEHA 1STGA 1EY4A 2ENBA 4N9TA 5CV9A 5C5MA 4PMCA 1JOQA 4I65A 1EZ6A 4K6DA 2F0PA 1NUCA 2F0MA 3QB3A 2EYLA 3TP8A 2KQ3A 2WACA 4DGZA 5C3XA 2F0QA 4K14A 1A3VA 4NDXA 1SYFA 5CV6A 2F0UA 3VA5A 3SK6A 5C4HA 1ENCA 4WORA 5KYLA 3MZ5A 4KY7A 3DMUA 1EY9A 3SK8A 4K5VA 2QDBA 1F2YA 4ZUJA 2EY1A 1A2TA 3TP5A 5CC4A 4QF4A 1EYDA 4KTAA 4ID6A 5I6WA 1STYA 2EYPA 1SNQA 2PW7A 2F0VA 4WRDA 5CV8A 4MIUA 4EQNA 5KGUA 1SYCA 2F0WA 5CR3A 2SNSA 5DAUA 1RKNA 2F0GA 2PYKA 3MHBA 2EYJA 3H6MA 2F0KA 4NP5A 5I9OA 3C1EA 3OSOA 5CV7A 2F0FA 3NHHA 5I6YA 5IGBA 5IGFA 5IODA 5KYIA 2PZWA 3RUZA 2SOBA 2SNMA 1IHZA 2KHSA 4H7BA 2NUCA 3D8GA 4K2KA 4KJOA 5IOCA 2EY5A 1KDBA 5IIFA 4QB4A 5J22A 3QOLA 1KDAA 3BDCA 1U9RA 2F0LA 5JOBA 4LAAA 3MXPA 2O4XA 3BDLA 3P75A 4K8JA 3U9OA 4QMGA 5J1ZA 4ME5A 1SNMA 3D6CA 4DFAA 1EY7A 1NSNS 1A3UA 1STHA 2OXPA 3E5SA 3OMCA 2EY6A 2F0SA 3HZXA 2F0HA 1JOOA 4G57A 5C6AA 5KRUA 1SNCA 4B9XA 4EQPA 5CGKA 5HURA 3OWFA 5KEEA 1STNA 2RBMA 4S3SA 1A2UA 1SYBA 3NP8A 4PMBA 3SR1A 2F0OA 2EY2A 2LKVA 4HTHA 3MVVA 1SYGA 3R3OA 1SNPA 4HMIA 3EROA 3PMFA 1KABA 3T16A 4DU9A 1EYAA 5C3WA 3D4DA 5C5LA 4NKLA 4OL7A 3EJIA 2EYFA 2EXZA 5I9PA 5IGDA 5ISRA 3QOJA 1F2MA 5E1FA 1TT2A 2OF1A 4E6IA 5IGEA 3LX0A 1KDCA 4DF7A 5JAVA 2RDFA 1EY6A 4J1MA 1STAA 3SK5A 4IALA 3V2TA 3NUCA 2EYOA 3NK9A 2F3WA 4PNYA 2F0IA 5F2DA 2F0TA 2EYHA 1SYEA 4K2LA 3ITPA 1F2ZA 4KY6A 4YIJA 4F7XA 1STBA 5C4ZA 1ENAA 1EZ8A 1AEXA 4RKLA 3TP6A 4K5XA 4B9WA 5EGTA 5E3FA 2RKSA 4NMZA 2PQEA 5M9OA 3NQTA 5KIXA 3S9WA 5EKLA 4ZUIA 2F0JA 3OMGA 4KJNA 3T13A 4R8NA 1TR5A 4TRDA 5HGTA 4EQOA 3SK4A 3ERQA 4EVOA 4K5WA 2F3VA 1JOKA 3D4WA 1EY8A 1EYCA 1SYDA 5CV5A 5IGCA 1A3TA 3HEJA 4KY5A 3EVQA 3SHLA 5IGGA 1JORA 2F0NA 3NXWA 3C1FA 4ODGA 4KV6A 4IZ8A 4HMJA 4ZQ3A 2PZUA 2M00A 3TP7A 4K8IA 4KD4A 2EYMA 5CV4A 4KD3A 1EY5A
chains in the Genus database with same CATH superfamily
4FNFA 3DHQA 3I4NB 5IYDH 2UUAL 3TBIB 3SGIA 3VR5A 1P8LA 1GJXA 4A3EH 4DK0A 1JQYD 4O42A 4DV2L 4HIMA 3K81C 3MFGA 1SXTA 1EWIA 1V43A 3CQZB 1DJRD 1I3QB 3DMUA 3MAQA 2CKZB 4MTNA 2FMMA 1OXSC 5CC4A 2HHHQ 1EYDA 1GHJA 4KTAA 4LFCQ 4A93H 1YEZA 1JWSD 4J15A 3CPWA 2ZM6Q 3J7AV 4JI4Q 2ICIA 3ND8A 1K3BC 3KBGA 1BCPD 3HOUH 2UUBQ 5IODA 3G4SA 3G7LA 1WI5A 1PFNA 2DN8A 1FNUA 2NUCA 4LFBQ 1PMRA 1WFQA 1GUSA 1SSOA 2K33A 3HOWG 1ILPA 4RCOA 3GV6A 1FGUA 2XN9C 1DXMA 1YNXA 3DLLA 1XWEA 5I2XA 4C3JG 3CCUA 4HJ5A 2JYOA 1PZKD 1SNMA 1X32A 4DR7Q 5BN4A 4LFAQ 1X65A 3PUZA 2KEEA 4EQPA 4L5RC 1BXTA 1PH8A 5KNCA 4R4IA 1F9PA 2EY2A 2IX0A 2KVMA 3S1NH 2K14A 4DAPA 4HMIA 3GTPB 3EROA 3OTOL 1BBUA 3NE5B 3T16A 2K50A 4ABNA 5JEAG 2B63H 3LX0A 2R92H 1K0SA 1N32L 3PIO3 3K57A 4CDFC 1HNXQ 2E2HB 3GTOB 2D0OA 2FXQA 2F0IA 2PPBC 1SYEA 1VQIA 3N52A 2VL6A 2M9VA 4F7XA 4GKKQ 4B9WA 1JCKB 1JR0D 2CCZA 1E1OA 4OELB 4H44C 2MQHA 2A69D 4QJFA 2OTLA 3NTHA 1D5XC 2YU9H 1VQ8A 1R4PB 1K9MC 2XNAC 4DNIA 2EJGC 1LABA 4HSVA 1T9HA 1DM0B 3DWAA 4KHVA 3K7AH 5JJLA 3P1HA 4GLVB 2UUAQ 3WOFA 1LT6D 4LF6Q 1WD1A 3VR6A 5ELFA 3T1HL 2J7ZA 2FMCA 1BOSA 1CFMA 1KD1C 1A3VA 4BXXH 2D62A 5FK9C 4JYAL 2KEDA 1EY9A 3S17H 4GOPC 3GTLH 2QW7A 4YY3L 1S4ZA 3A8IE 4JI4L 5G3LF 3PGZA 4Z9CB 2DY7A 2E2JB 1CQVA 1H9SB 5CV7A 2QILA 1ONLA 3M9BA 3CCEA 2A73B 1E2VA 3HOYB 3AQQA 5LL6S 3BZKA 4KK7A 1EOVA 3F8TA 3J81i 2F52A 4IUUA 1PH1A 4C3IB 4DR6Q 2BE5D 5J1ZA 4DFAA 1WTQA 3E5SA 3I55A 4FXDA 1HR0L 1PA6A 2HUGA 5CGKA 2DJGC 4O2DA 4R4TA 3KFUA 3HOYH 2B8FA 1XPOA 3SE0A 3U50C 3GTQH 3T56B 3OTOQ 4L5SA 1Y14B 3Q24A 1PRTB 4J8QA 4NKLA 1EIGA 1B7YB 1RF2D 1FNVA 1XJVA 1HFNA 1N32Q 3V2TA 1PVOA 5CYUA 3K58A 5IWAQ 2B2WC 3K7UC 3BS1A 4H0LC 4K2LA 4KLKA 4XXEA 2K6AA 3I4LA 5AJ3Q 2R7ZB 3MFYA 3PIOA 4POGA 4NMZA 3NQTA 1LT3D 4QY7A 3SDZA 2UXDQ 4X3KA 2IW3A 3OMGA 4DUZQ 3PSIA 2RSOA 1C9OA 3NTIA 3S2HH 2F3IA 4LUZA 4EQOA 5AFWA 1VQPA 3PO2G 2RA4A 3HP3A 1SAPA 3DEOA 1EYCA 3J81j 5CV5A 3MTSA 2VW9A 1PV4A 3I4NH 2VUMH 2ID0A 1N34Q 3JAME 4HMJA 2CW0D 3CW2C 3I4NG 1BCPF 4LUVA 3EIVA 4IFDH 1SE4A 2VUMB 4AYBE 1R9TH 4J6HA 1XMOL 3I7FA 1Z7TA 2K52A 1N36Q 1STGA 1EY4A 2EZVA 1RDPD 1B3QA 2PMZB 4IN3A 1QVFA 2JA8H 4DGZA 4K14A 4JI5L 2NZ1D 1HUMA 3TS0A 2I07B 3MZ5A 1R4QB 1C8CA 2OWOA 3IFDA 4FXKC 5JPMC 2F03A 3F2UA 2ZJPA 1W3SA 2R93G 2PW7A 3Q6SA 2ZM6L 4DV6L 4EQNA 1BQQT 5M5YH 2LFNA 5DAUA 3K8AA 4BY1H 5JVG3 2EYJA 2R93H 1A6XA 3D31A 5I9OA 3M7GA 1CM9A 4PZ6A 1TWFB 1E0BA 1W6JA 3QOLA 4A3JH 1QZGA 3A74A 2CW0C 2ZTDA 3A5ZB 2RHQB 3TZDA 3P75A 2KCCA 4IPGA 1SLJA 4ME5A 4A3DH 5FO9B 1WCMB 2OXPA 4GNXA 1HR0Q 1TXYA 1TWFH 1C7YA 1NMGA 4DR3Q 2L11A 4IO9A 1I94L 1G6PA 2E2DC 4A3MG 2VB2X 5IP7G 1AFPA 2O2LD 3EA6A 4L5QA 5M5WH 1STAA 3IRBA 4X3UA 3SK5A 4C3HH 4DXFA 5C4JB 1YHQA 5IP7H 3RLFA 2B63G 1Q81C 2Z4IA 5AJ3L 4KI0A 1Y8NB 5ELDA 3RZDB 2PQEA 3VA7A 3I72A 2FHTA 2MJ8A 5FJ8G 5JVH3 1VQ5A 3SK4A 1M1KC 2E74C 1PYWD 1TU2B 4OXPA 3CCJA 3BDOA 3NXWA 5EQ0A 1EL0A 3S1RH 1RJTA 3OIQA 5GAEC 4WJ4A 1IW7C 1S5CD 3I91A 1L1OC 2KOLA 4X62L 2PW5A 1HNZQ 2A6ED 2LSSA 4BS9A 2PQAA 2EIFA 1FL0A 1NJIC 2JJQA 2NBFA 4APVA 4FF3A 2EOTA 1XTDA 1U5KA 1PHJA 4DR7L 4IPDA 2CQAA 4A3LH 2F0UA 4JI5Q 1SE8A 4RGTA 2Q8IB 3D6WA 2VQEL 1F2YA 4QF4A 1G8ZD 3L3OC 2L9HA 4WRDA 5BN5A 2R7FA 3WDNA 1YNNC 1B53A 4DV6Q 3FRPB 3KBXA 3LNNA 2JQOA 2L15A 3MHBA 3G6JB 4CJ2C 3NHHA 1O78A 5FLMH 5C0XH 3S1NB 4H7BA 2NN6I 1RCVD 5IOCA 4LW1A 5E4XA 1KDAA 4R8IA 1U9RA 3AMUA 4P74A 3KJOA 3CCVA 2NVQH 1WYDA 1JWUD 1AZPA 2F0SA 4N8FA 1VCIA 1SBBB 4S3SA 1TY2A 2B2WA 1SYGA 1WTWA 2B8GA 2G5DA 4JBKA 5GQOA 3PIP3 2D0PA 3RZDH 1L1OA 3EN2A 5I2YA 1Y1WG 3HOVB 3QOJA 3CMAA 2R7ZH 1FYCA 4E6IA 4DXGA 4CKEA 3A7LA 4MNOA 1K28A 4XYOA 1CKOA 5E4WC 4A93B 4DK3C 3ITPA 2R7ZG 3R2IA 5FOBB 4Y7NB 3TP6A 4K5XA 1B50A 2RKSA 3STBD 5KIXA 4R1JA 2UXDL 2FFKB 3CC7A 3FVQA 3PUYA 5ELNA 4KJNA 1HZAA 1PTOD 4B3TL 1OO9B 4BBRB 4YY3Q 1FNWA 1LYLA 2K7VA 3RD4A 4UY8C 4K5WA 3UDFA 2Q2TA 1IW7D 4A3MH 3S16H 1AH9A 4CJ0B 4RG1A 1KQSA 1VQHA 1B8AA 3OYYA 1N34L 5CMDA 1TWHH 3GDEA 1AZQA 4ZQ3A 3CXCA 1LTAD 1JT8A 3PO3B 4YCUA 1MIUA 1NR4A 1HNZL 1CTMA 1EFID 3DEPA 1XMOQ 4XIGS 4A3MB 4KKSA 3S16B 1TQOA 4A3GB 2F0DA 3MEHA 4N9TA 1TKWB 4DR6L 4JI2L 4IFDG 4K6DA 2EXDA 2EVBA 3H15A 4HCSA 1BF4A 2UXCL 3CC2A 1HA5A 4HIDA 1PTOH 2H4OA 1MHWC 3GV3A 1ZKOA 2N8NA 2Y0SG 3NENA 1HUNA 4DUYQ 5M5XB 1TWGB 2PNRC 3CCMA 1HZCA 4G7ZC 2LS01 5CV8A 2QCPX 1XNQQ 3DM3A 4BA2I 4NB3A 5M3MB 4AQYQ 3MA2B 2AWOA 3GTGB 1GKHA 5E7NA 4IURA 4B08A 2F0KA 2ZT9C 1YHAA 2IT1A 2WB1E 2IJ0A 4LK1C 4WJ3M 3J7A5 4CDDC 1IHZA 4GNXC 3TEHB 1HPCA 1FVIA 4H13C 5JOBA 2MO1A 1WCMH 2XIWA 4A3LG 4L6TB 1IYJB 3D6CA 1NSNS 1SMYD 3MC0B 5KRUA 1H9KA 3NEMA 1X3FA 4B9XA 1CKNB 2LXKA 1SE2A 1I94Q 4OHJA 2B2TC 2RQXA 2V1CC 3CRKC 1OXVA 3PMFA 3VYTA 3N6RA 3J7YW 5C3WA 3D4DA 5IGDA 4UP8A 2AQ1B 5M3MH 5J3BA 4V190 4K6LA 1PRTD 3J81c 4X66L 3MXGA 2A8VA 4PNYA 1NY4A 1NAPA 3K59A 3KLSA 4OGQC 1EZ8A 4XDXA 3BVMA 2MHVA 5C44B 4WJWA 4YHHL 1UEBA 2TSSA 3I4OA 4UAIA 1EQRA 3FKIH 4JBJA 1EUJA 2E75C 4OONA 4M8AA 3D4WA 4A3GH 4NXNL 3HEJA 1CA5A 2NVYH 2IY5B 4C3IH 3C1FA 2Z6KA 1ENFA 2WB1G 3Q8DA 2O5IC 1PFSA 2UU9L 4C3JB 1KAAA 2HQEA 1X3EA 2F4VQ 4RKBA 5ELOA 1II3A 4CBVA 1VQCA 4BY1B 1KLUD 1NTGA 3KOJA 2N49A 2F0MA 3HG9A 5C4XH 1ML0D 1SYFA 4F87A 1S3OA 2K4KA 4LJZC 1KRSA 4PMWA 3TREA 2UXCQ 3HGBA 1I6VC 3RMHA 5C44H 1NBWA 4QUCA 3S17B 1F2LA 5GROA 2EQSA 2MO0A 4ID6A 4QIWB 2B2TA 1SROA 2DUDA 1G51A 3Q23A 2RF4A 2E5LQ 2C9OA 1K8OA 2ZTCA 1UAPA 1WJJA 5IGBA 5KYIA 2PZWA 3RUZA 3GTQB 1DONA 1GUOA 1XNRL 4CHTB 1D1KA 1VMCA 1SRUA 2IPKD 1SEBD 3PO3H 1CSPA 2L5TA 4QQBX 2F0LA 2JA8G 2VNUD 4HEDA 1FJGL 1CI3M 4GZYC 4IUVA 1GO3E 3M4PA 2DGYA 3OMCA 3KF8A 5JJKA 1YZ6A 5HURA 3T53B 1Z6HA 3SR1A 1PYSB 3K0YA 2F0OA 2EE1A 2IL8A 1E3PA 3GP7A 1FR3A 1IBKL 2N88A 1EQQA 4PG3A 3I70A 1F2MA 1TT2A 1UUPA 3KF6A 2X6LA 4G7HC 2QEXA 3HOWB 1EWHA 1HZ9A 2EYHA 3OWEB 2K5HA 1JB7A 1MBYA 3WOEA 1ESFA 4YWKA 2JA7H 4X3SA 1AEXA 2MP1A 3RZOH 1Q46A 5GADC 4BA1I 3CMEA 1S5BD 3QJYA 4KMUC 4Q5VA 2OTJA 4CGYB 3GTJB 4YHHQ 2JA8B 1G6ZA 1K0RA 2HHHL 1VQDA 3FPPA 3HOZG 2D5DA 2SDFA 4DR1L 4OO1H 2NN6G 4GN3B 1A15A 4HIKA 3JAML 2JXMB 2YYZA 4EX5A 1VQ7A 2RDHA 4OX9Q 1I4PA 5EKIA 1B4OA 2I0QA 3K6OA 3HKZG 1GVPA 4A3EG 1SNOA 1MGSA 1V1QA 5NUCA 4F8MA 1ASZA 1A62A 1MSHA 1ET9A 1XPRA 4IUNA 1SNDA 4XQJA 1I4GA 3CCSA 1SN8A 5EBDA 1WOCA 4AYBG 3D3RA 2F0PA 3RLOA 1HRJA 4OEMB 4DAVA 3S1MH 2PNHA 4LFAL 3DM1A 1CK1A 3FKIG 1V9PA 1ENCA 5KYLA 5C3EB 4DV3L 4JK1C 5M3FG 2A6EC 4FDBA 2QDBA 3TP5A 3UDGA 1A2TA 2A1AA 4HR7B 4HJ9A 2XTIA 2B2UC 2F0VA 3C3LA 2KHIA 3I2ZA 2HT1A 3QG1A 1XNQL 3I4MG 3G48A 2EJFC 2E5LL 3J80E 1HNXL 3I73A 1CSQA 1JMCA 4HIOA 2RSNA 3T1YL 1LLRD 2LXJA 3BZCA 4XQNA 3CD6A 1LT4D 3H09A 1X3QA 3CP0A 1LACA 4LAAA 1S5ED 3BDLA 3I90A 1BUVT 2JA5B 1X56A 2WKCA 2AUJD 4H02A 4IUPA 2VQFL 3M4OH 1ZEQX 1EIYB 5BN3A 4CDEC 4LF8L 2XRQD 1PH7A 4DV4L 3K5LA 2LKVA 4QCLA 3A56A 1AN8A 1A8VA 3NSWA 1NNXA 1ICFB 2LMCB 4QL5A 1IBKQ 4A3KH 2NWGA 1U4PA 1I5FA 1DD2A 5FLMG 5C0XG 1IBLQ 1RTNA 1HQMC 2BH2A 4O0AA 4ZCKA 2BOSA 4A3KG 4JI7L 3S2DH 3OW2A 5F2DA 3PO3G 2YTVA 2YV5A 4GN4B 3HRZC 4YIJA 2N3SA 4PZ8A 4JYAQ 1VQOA 4IPCA 4DUYL 1GUTA 5DM73 3VYUA 3QO2A 3RN5A 5M3FB 4NXNQ 3KYHC 3U4ZA 3K80C 3TQYA 2JEBI 3FPUB 4ULLA 1W2BA 3ONAB 4ODGA 4IZ8A 3M3YB 1T5XD 5EPLA 4K8IA 4HN7A 3DWQA 3RLNA 4DR4Q 4AYBB 2F4VL 1RIPA 2ZTEA 4BBSG 4B3ML 1A63A 5C5MA 4BXXG 2Z6KC 2R3ZA 3M4QA 1EZ6A 3QB3A 4NW2A 2L1BA 2F0QA 2VS1A 3AFQA 1IKMA 1VQAA 4IUQA 1KLGD 1AP0A 4QUFA 3RZOB 2KCMA 1YJNA 2PCFB 5FO7B 2G9DA 5I6WA 2UXBQ 1I50H 1IKLA 2H5XA 2VXWA 4LF5Q 3A0JA 4K0KL 1SNQA 3PQIA 2HDMA 5C4XB 3S1MB 1K8GA 1Q90A 3DUZA 5KGUA 1MJEA 2R92B 2SNSA 1DGSA 2B2VC 2F0GA 2NTSA 5HY6A 4X66Q 5IWAL 2E8GA 3OSOA 4YCWA 3STBC 1WVLA 2CWPA 1Q8IA 1KC8C 4FP5D 1STEA 3NWTA 1B3AA 1NE3A 4DUZL 1K83H 1O7LA 1D6EC 1L0XB 1X9NA 3FMCA 1EY7A 3CCRA 5IYCG 1S40A 2EJMA 2RBMA 1EU3A 1C4QA 4PMBA 3MVVA 5FKAC 4LWCA 1GXDC 2K5QA 1D2BA 4DR2L 5E1FA 2OF1A 2WIIB 2HIXA 4JW0A 1GUGA 3AFPA 3NUCA 4JI7Q 2WFWA 4A3BB 4DPGA 3H0GB 1Q86C 1YITA 4FF2A 5M9OA 4Y52H 2I5HA 3S9WA 1RTOA 3R2TA 3B6YA 5EBCA 2JA7G 2ZXRA 4TRDA 1WTVA 2ZJQA 5K36G 4DR1Q 2ASBA 1H9SA 1EY8A 4A3FH 5LMNW 1EIHA 4X3TA 2L12A 1PLFA 5M3MG 2A6HC 1XNRQ 3E9HA 1VQ6A 3S1RB 4XT3B 2K01A 3S24A 4KKTA 2QDLA 4IOAA 4KKUA 3PUVA 4A3FB 5J39A 5LHY1 1W6KA 1V8QA 2GVBA 4MZ9A 3BVGA 3H0GG 4DV1Q 2GN5A 1E1TA 3SK6A 1VQFA 3RNUA 4DV3Q 2A5HA 3H0GH 4P71A 1JWMD 1XX8A 2EY1A 1HCZA 3E0EA 3K5NA 1C0AA 3A8KE 4DV7Q 1IYUA 2F0WA 2MUYA 1B44D 3BG3A 4F88A 1U4MA 2NZOA 3OOCA 4NP5A 4A3KB 3C1EA 2F0FA 1IL8A 3KLWA 4IFDI 4O1NA 1TWAH 1V1PA 3QR8A 1V1PB 2ZXPA 1GOZA 3D8GA 2ZXOA 4BBRG 3R8BA 3W3AA 3F2DA 5EAYA 3O13A 3MXPA 1CQFA 1SE3A 1Y8OB 4GKJQ 3BU2A 4KN7C 4UHVA 2JA6G 2OT2A 2Z0SA 1K73C 2RDGA 5JJZA 4A3JB 1SNCA 1XTCD 1QUQB 2Q8TA 4DV4Q 1STNA 3FKIB 4TQUS 1SYBA 3S14H 3CHBD 3KUPA 2R61A 1JJGA 2AHOB 5TSSA 4P75A 1QNUA 4OX9L 3D4RA 2B2YA 3GTJH 1BBWA 1JJCB 1LTBD 2K5WA 2QGQA 5EJWA 4C3HG 1ZXTA 4YCVA 4X62Q 3Q22A 4KHZA 4HJ7A 4OL7A 4RGOS 1BDOA 5FLXL 1ET6A 4P72A 1IBLL 2JN4A 2PI2E 5D3IB 1KHIA 4JOIC 3PF5A 1PH2A 1WTPA 1MD2D 2JSOA 4KY6A 5C4ZA 1ENAA 4RKLA 3HOVH 2VY3A 4GOPB 3SEBA 5EKLA 4ZUIA 2Z6BA 3K5MA 3H91A 1HZBA 1DOLA 3KLRA 4IFDJ 1YI2A 2KCTA 3HKSA 4AIMA 2GVAA 2X69A 2L4NA 3MXNB 3J81L 3AYHB 2F0NA 4IJHA 1Q7YC 1PH4A 4LF7L 1YNJC 1G91A 1MKHA 2NVTB 4KD4A 2SEBD 1GM5A 1LTTD 1EY5A 3VYSA 4DR4L 1LT5D 2XRSD 1LTGD 1RODA 4XT1B 4JI3L 1CKMA 3F2BA 1WTHA 3PUXA 4I7ZC 4N9PA 3CC4A 1DOKA 4ME3A 5CV9A 4PMCA 2DY8A 2VQFQ 2CFMA 3TP8A 1HNWQ 4NDXA 5CV6A 4IUTA 4DAYA 3V96A 4MTKA 1TWGH 3GTKH 4LF4L 3SK8A 1BNZA 2JA6B 1ESRA 1DCZA 4ZUJA 3MXNA 1PTOB 1STYA 1TY0A 2I5MX 1ASYA 2AQ2B 4JCVE 1Y1VG 1BCPC 2KHJA 4CDCC 3W5OA 1RKNA 1GHKA 2PYKA 4A3IG 1E24A 3H6MA 1EIFA 1X54A 2A68C 3MXUA 1PTOC 4KJOA 4DKAC 1U0LA 2RCNA 1GUNA 1I4QA 3I8ZA 3M3YH 2WV6D 4A4IA 4FO2A 4K8JA 4JV5L 3NBHB 5D65A 1VQJA 4UPAA 1EU4A 3V05A 1N33Q 2FINB 5IGFA 1EFWA 5BR8Q 4OIKA 3W1GA 1B1ZA 4YWMA 1YVCA 3VYRA 1TWAB 5LMUL 1EYGA 2ES2A 3R3OA 2OQ0A 3I4MH 1XXGA 3FDTA 4GNXB 3T51B 2BA1A 2EXZA 4DR2Q 3GQBA 4DV0Q 4JI0L 2BE5C 4FF1A 1F9RA 4DF7A 5JAVA 1YIJA 2EYOA 4C3HB 2IX3A 1I50B 1TVXA 3BJUA 2PO4A 1NR2A 1F2ZA 3VR3A 1E2ZA 1QWYA 1Y8PB 2Z9HA 4R4OA 3KJPA 1J8IA 1H9JA 1C48A 3BYTB 4CJ1B 3ULPA 3CCLA 1KAWA 4ZKBB 2A69C 4LF5L 1H95A 2D9UA 4FF4A 3BYYB 1HJPA 2NTTA 3X3NA 4C1NI 1A3TA 1L0WA 1ZYRD 1BO0A 4DV5L 5IT9c 2M00A 3ULJA 4UP9A 2E76C 1TWHB 1RL2A 1JICA 1J6QA 4DN4M 5CBEE 5K5PA 2EDGA 4M1UB 3OW7A 1EWCA 4BY7H 1Q12A 2L55A 2L0CA 2V4DA 3H94A 1HHVA 1S72A 1F77A 4LF9Q 4ZRZA 2TMPA 4BY7G 1PTOF 1HTLD 3VR2A 2F1MA 4A75A 1EEID 1FD7D 1PH9A 3GTLB 3I56A 4K5VA 3G6EA 5J22A 3HKZE 1TS3A 2EYPA 1D5ZC 2KBNA 5C0XJ 2MNAA 1BR9A 4DV7L 1UE5A 2WB1B 1J5EQ 1XPUA 5EPKA 1D8LA 4B3SL 4IQZA 2CHBD 5DM63 1UWVA 4BWGB 5D14A 5KNBA 1WCMG 2VZAA 3HOUG 1EQTA 2CH4A 1MI2A 2K5DA 1QNKA 3UE1A 1O7YA 3MEFA 3ND9A 3A55A 1QB5D 4QMGA 2I46A 2ZJRA 1A3UA 1STHA 4DV2Q 1HXYD 1NCVA 3TSSA 2F0HA 3CPFA 5BR8L 4ZKCB 2WAQB 1A2UA 3IFTA 4A3DG 1VS0A 5CORA 5HGQA 1QCBD 2VB3X 5GAGC 4A3IH 3KLSX 2R93B 5JPNC 2DJFC 2HQLA 3M4YA 1WTRA 1KDCA 1QUQA 1LUZA 5EPJA 1HR0W 1F9SA 1EY6A 1P16A 3ZJYC 3S2DB 3NK9A 2BDNA 2F3WA 1X6OA 4DV1L 2R92G 3ICEA 5GAHC 5IE8A 2N78A 5IYCH 3G71A 2Y0SE 3LWEA 4ALPA 2IWHA 4DNTB 1ZYRC 3HOYG 3EFXD 3ERQA 3F1ZA 4ZK9B 2NYZD 5FJ8H 2B3GA 3K7AB 2C35B 4FYDA 2WINB 2JA5H 1K83B 2R7DA 2JEAI 4KV6A 2O5JC 1LTRD 3QIAA 1B70B 1I6HB 1EY0A 4EGVA 2JA5G 3TMEA 2CH4W 2BDOA 1VQEA 1GD7A 5IP9H 5C4XG 1XMQQ 1FJGQ 3A8JE 1E2WA 2NB0A 5C44G 1HNWL 3D0FA 1CZGA 3NBHA 3OIPA 1HH2P 1HQRD 1WTOA 3J7AF 3GD7A 1UEAB 1U4LA 4A3BH 3JAMc 1WD0A 5LMNL 2ATWA 4HCEA 2C5CA 4HSPA 2KJXA 3AEVA 2QF7A 1VDZA 1ILQA 2N55A 2XWJB 4XTCS 2SOBA 3PCOB 4DR5Q 4L63B 2NVXH 4HJAA 2XSCA 4DAYB 4C56C 2OCEA 1N8RC 2Q2UA 4LF6L 4A3DB 1VQNA 2XVSA 3IL8A 2WAQG 1N33L 3J81E 4JI1L 1TS2A 2QEJC 2BCOA 2K5NA 2Z4HA 4A93G 3FP9A 5KEEA 2NVXB 5ELCA 2PI2A 2PQAB 4LF7Q 1JB3A 1O7ZA 3AU7A 2QKIC 1KXLA 5C5LA 3HOUB 4C3IG 3EJIA 2EYFA 5ISRA 4DV0L 1IBMQ 4JI3Q 2B2UA 1QVCA 1K3RA 4LMQD 1K8MA 3TN2A 4A3CH 2RDFA 1ICWA 3URYA 4IALA 2K75A 3H3VC 1Y1WH 2F0TA 1KRTA 3HOWH 4L8JA 4RWSC 1STBA 1TIID 1SJHD 3J80i 4JPBW 1SJED 4CKBA 3M7NA 1U4RA 2BA0A 2CQOA 4GLAC 1GUWA 2F0JA 4LF4Q 4GOPA 3T13A 4JI8Q 1OXUA 4NXML 5ELBA 1PDQA 3TRZA 3PO2B 1PZID 4WFN3 3U9SA 1LTSD 4X65Q 1HTPA 3WWVA 1SYDA 5IT9L 4TSSA 2B2VA 4KY5A 1PH6A 1IXRA 3CF5A 4DV5Q 2PZUA 2Q2IA 1BCPB 3E9IA 3VR4A 4BBSB 3T1YQ 3BVZA 3PUWA 4PZ7A 4JOIA 4JC0A 5DEHA 1Q82C 1D7QA 5EKKA 5IYBH 1AE2A 3SXHA 3QWNA 2AUKA 1XMQL 2IHFA 4TKOB 3A5UA 2B39A 4JV5Q 4X6AH 1Z9FA 4LF9L 2KQ3A 4PV1C 4TVAB 4LF8Q 1PZJD 5C4HA 2ICEC 2E2IH 2PMZE 4WORA 1N9WA 1UE1A 5LMUQ 4MN3A 1Y1VB 1YNND 2E2IB 1VF5C 2MFIA 4JI0Q 1QZHA 1G2SA 5M5WB 1J5EL 1S5FD 3PIPA 2QA4A 3HKZB 2AWNA 5I6YA 3GTPH 5T1GA 1PRTC 4ILWA 1I4HA 2KA7A 4BY1G 1KDBA 5IIFA 1JJ2A 3AB9A 4ZAIA 3BDCA 4UDUC 2R6GA 2GA4B 1N36L 3HOXG 3U9OA 3LWUA 1O7IA 4G7OC 1VQMA 3CU7A 4JG2A 1EEFD 1IZ6A 4V0BA 5K36H 3NELA 1TS4A 1KNAA 1SNPA 4B3RQ 1CHQD 1YNJD 1J9OA 3GTGH 3HOXB 4JBMA 2IX1A 1Q3LA 2HCCA 3VDYA 1VMPA 4B3MQ 2E2HH 3IKJA 2J0TD 5IY0A 1PH5A 4GS3A 3S15B 2KECA 3PF4A 1SFOH 2JK8A 1OXXK 3GTMH 2DNEA 5A2QE 4R8NA 4NXMQ 2K32A 1I4RA 5HGTA 2UXBL 2K28A 4K0KQ 3TDQA 2WKDA 4EVOA 3K0XA 4X64Q 1LTID 2F3VA 1JOKA 3EBEA 4DAMA 4POFA 3ERSX 1E7ZA 4HAEA 2HDLA 3CAMA 5KNDA 1QVGA 5CV4A 1VQGA 3K5OA 4ZLTF 2NVYB 3S1QB 2PZTA 2FJ2A 3M85A 5DLQE 3LGJA 3ULLA 2LY7A 1JOQA 3F2CA 4CKCA 1HA6A 1DZ1A 2EYLA 1Q1BA 1L1OB 5IP9G 2WP8J 4G4KA 2UUCL 3HOZB 1Z47A 1SR3A 3E6ZX 2JA6H 2CWAA 3I3CA 3CQZH 3E3XA 2RHSB 1L0YB 3KDFA 2VUMG 1B9MA 1MJCA 4MHEA 1YBYA 4DK6C 3C2PA 3OHXC 4A3EB 3HS0C 1V1OA 5LL6X 1PYBA 4FXGC 4A3IB 1BBXC 1VQ4A 4GLXA 3I4MB 3X3MA 2KHSA 2OQKA 2YTYA 1JC7A 4DR5L 3UDXA 3S1QH 3C46A 4QB4A 4FVMA 2B29A 2NVTH 1JE5A 2J4XA 4RHSA 1G2TA 1PFBA 1UE7A 4PQXA 4JI1Q 3KK7A 5C6AA 1X3GA 2YTXA 1QJOA 1T5EA 2AMCB 3NBIA 3ZYYX 4OWXB 4HTHA 2Z8LA 1QOHA 2VQEQ 1D1IA 4B3RL 1CKNA 3ER0A 4QIWE 3GTMB 3E0JA 1IBML 4Y7NH 5I4DA 2JA7B 3S15H 4XYQA 1LO5D 4KHPQ 4J1MA 3NTKA 2UUBL 3GTOH 2A19A 1SMYC 2CVRA 1H9MA 4LUOA 4A3CG 3HOXH 4RCNA 3HOZH 2ALYB 2K1BA 2HD3A 5FLXE 2Y0SB 1TR5A 3DXJC 3W2DA 5LMNQ 1VQLA 5COYA 2G9HD 1RHPA 1IYVA 4P73A 3M4OB 5IGCA 1TWCB 2F4IA 1CA6A 3EVQA 4OO1I 3CCQA 4N8X1 3NWSA 1PXUA 1OTCA 1AE3A 5FO8B 4P2CB 2NN6H 2YU9B 5L37A 5ELEA 1EQVA 4IOCA 4RA8A 3DWPA 1YHBA 2K05A 1RD9D 1VQ9A 3P7JA 1VF7A 2XWBB 3W1BA 1UNSA 1QE6A 4GKJL 2E2JH 1MSGA 1NUCA 3UE0A 4NPSA 3S2HB 5C3XA 3VA5A 1VQKA 1Q8KA 2UUCQ 1SFOB 1X3PA 1M90C 1NMFA 2MGSA 4C1NK 5IT9E 4B3TQ 4MIUA 1YJWA 1SYCA 1KNEA 4U68A 4RGNA 3OPOA 5JJIA 4BY7B 1B2TA 1PRTF 3UDIA 2SNMA 3A54A 1L2FA 4C3JH 4LFBL 2EY5A 1O80A 1I6HH 2P5ZX 2IHEA 2A68D 4JI8L 3GO5A 4GN5A 3L2PA 4JI2Q 1TS5A 1LV9A 4RH6A 4X65L 3FHWA 3L9AX 1CT1D 2A74C 4G57A 3HZXA 1IL2A 1JOOA 4LNQA 3OWFA 4I7AA 3UI2A 3PO2H 4RFBA 4YWLA 4R4QA 4QGUA 5A35A 4A3FG 1S5DD 3EQLC 1EYAA 4UP7A 1KIXA 1PFMA 4L5TA 5I9PA 4JVZA 2K04A 4AQYL 1Y1WB 3HOVG 1FGBD 1B9NA 5C0XI 2KENA 2JE6I 4JBWA 2B63B 3GTKB 2K5VA 1AW7A 5EGTA 2AKWB 4R9WA 3FEWX 1EOTA 1YJ9A 3MWYW 3TS2A 3J80c 4X64L 2Q2HA 1Q1EA 3KDFB 2XGTA 4JI6Q 5IGGA 2NVQB 4RGMA 3KF6B 2JA9A 1VQBA 1Y69U 2AQ3B 4BBSH 3NPPA 4A3GG 4RMFA 2X6GA 1M4VA 2JP1A 2F0EA 1I4XA 3P20A 1TWCH 2OEOA 4XQQA 1XYIA 1UE6A 3KF8B 2ENBA 1DYQA 3CRLC 4IPHA 4Q0FA 4BBRH 4I65A 3T1HQ 5M5YB 1CZWA 4A3JG 4ZYSA 4IJLA 5A2QL 2WACA 3H3VH 4EQ5A 3SVMA 3R93A 1Y1VH 4KY7A 3JC66 4OWWB 1SMXA 3T4AC 3JAMi 4LFCL 4RAUC 2BH8A 2HIVA 2MPMA 1WTXA 3Q0AA 5CR3A 3TZUA 1JE4A 1CUKA 1G291 5JEAH 1H9RA 2KUMA 2HCIA 2DNCA 3PV0A 5IYBG 5FLXc 4HJ8A 3CKIB 3J80L 4K2KA 2UU9Q 3BZDB 3S14B 1LTLA 4R4CA 2O4XA 1LM0A 4A76A 3U58A 2RCFA 1QG7A 3IAYA 3HFZB 2B2YC 2Z1CA 2I5LX 5M3FH 1X55A 2EY6A 3NQIA 4U673 2WAQE 1K8AC 3NP8A 5G3LD 1CHPD 5DNFA 1BVSA 4AH6A 2M2LA 1KABA 2K03A 3L0OA 3A7AB 4DU9A 3J7ZC 1PH3A 1F9QA 4C2MB 5CBAE 5D3DA 4DNRB 5H1SE 1E22A 5IGEA 4KHPL 5T1IA 1SDFA 2KCNA 2D2CC 5C4JH 2RVLA 4DK1A 5M5XH 1I3QH 4GKKL 5C3EH 4C2MH 5E3FA 5JEAJ 4DA2A 1A0IA 1M8AA 2A6HD 1KTKA 4KN4C 3RR5A 1OXTA 1QILA 5C3EG 2Q8RE 1HFGA 3RN2A 1DOMA 2EPBA 2NZHA 1BKBA 4A3BG 1R9TB 4B3SQ 3SHLA 1KL9A 1JORA 4JI6L 4DR3L 3H3VI 1D5MC 3U4VA 4OWTB 5IYDG 3TP7A 4OO1G 2EYMA 4OIJA 4KD3A 3L7ZC 4RHRA 2H1EA
chains in the Genus database with same CATH topology
4FNFA 3DHQA 3I4NB 3TBIB 3VR5A 1GJXA 4DK0A 1JQYD 4O42A 3MFGA 1SXTA 1V43A 3CQZB 1DJRD 1I3QB 3DMUA 3MAQA 2FMMA 1OXSC 5CC4A 1EYDA 1GHJA 4KTAA 1JWSD 3J7AV 2ICIA 3ND8A 3KBGA 1BCPD 5IODA 3G7LA 1PFNA 2DN8A 1FNUA 2NUCA 1PMRA 1GUSA 1SSOA 2K33A 1ILPA 4RCOA 3GV6A 2XN9C 1DXMA 1XWEA 5I2XA 4C3JG 2JYOA 1PZKD 1SNMA 1X32A 5BN4A 3PUZA 2KEEA 4EQPA 1BXTA 5KNCA 1F9PA 2EY2A 2IX0A 2KVMA 4DAPA 4HMIA 3GTPB 3EROA 3NE5B 3T16A 4ABNA 5JEAG 3LX0A 3PIO3 3K57A 2E2HB 3GTOB 2F0IA 2PPBC 1SYEA 3N52A 2M9VA 4F7XA 4B9WA 1JCKB 1JR0D 4H44C 2A69D 3NTHA 1D5XC 1R4PB 2XNAC 2EJGC 1LABA 4HSVA 1DM0B 3DWAA 4KHVA 3P1HA 3WOFA 1LT6D 1WD1A 3VR6A 5ELFA 2J7ZA 2FMCA 1BOSA 1CFMA 1A3VA 2D62A 5FK9C 2KEDA 1EY9A 1S4ZA 3A8IE 5G3LF 4Z9CB 2DY7A 2E2JB 1CQVA 1H9SB 5CV7A 2QILA 1ONLA 2A73B 1E2VA 3HOYB 5LL6S 4KK7A 4IUUA 4C3IB 2BE5D 5J1ZA 4DFAA 1WTQA 3E5SA 4FXDA 2HUGA 5CGKA 2B8FA 3SE0A 3T56B 3Q24A 1PRTB 4J8QA 4NKLA 1EIGA 1RF2D 1FNVA 1HFNA 3V2TA 5CYUA 3K58A 3BS1A 2B2WC 4H0LC 4K2LA 4XXEA 2K6AA 3I4LA 2R7ZB 3MFYA 4NMZA 3NQTA 1LT3D 3SDZA 4X3KA 2IW3A 3OMGA 2RSOA 3NTIA 4EQOA 5AFWA 2RA4A 3HP3A 1SAPA 3DEOA 1EYCA 5CV5A 3MTSA 2ID0A 3JAME 4HMJA 2CW0D 1BCPF 4IFDH 2VUMB 1SE4A 4J6HA 1Z7TA 1STGA 1EY4A 2EZVA 1RDPD 2PMZB 4IN3A 4DGZA 4K14A 2NZ1D 1HUMA 2I07B 3MZ5A 1R4QB 1C8CA 3IFDA 4FXKC 5JPMC 2F03A 3F2UA 2PW7A 3Q6SA 4EQNA 1BQQT 2LFNA 5DAUA 5JVG3 2EYJA 1A6XA 3D31A 5I9OA 3M7GA 1CM9A 1TWFB 1E0BA 1W6JA 3QOLA 2CW0C 3TZDA 3P75A 2KCCA 4ME5A 5FO9B 1WCMB 2OXPA 2L11A 2E2DC 2VB2X 1AFPA 2O2LD 3EA6A 5C4JB 1STAA 4X3UA 3SK5A 4DXFA 3RLFA 2Z4IA 4KI0A 1Y8NB 5ELDA 3RZDB 2PQEA 3VA7A 3I72A 2FHTA 2MJ8A 5JVH3 3SK4A 2E74C 1PYWD 1TU2B 3BDOA 3NXWA 5EQ0A 1EL0A 1RJTA 3OIQA 1IW7C 1S5CD 3I91A 2KOLA 2PW5A 2A6ED 4BS9A 2NBFA 4FF3A 2EOTA 2CQAA 2F0UA 4RGTA 2Q8IB 3D6WA 1F2YA 4QF4A 1G8ZD 3L3OC 2L9HA 4WRDA 5BN5A 3WDNA 1YNNC 1B53A 3FRPB 3KBXA 3LNNA 3MHBA 3G6JB 4CJ2C 3NHHA 1O78A 5C0XH 3S1NB 4H7BA 2NN6I 1RCVD 5IOCA 5E4XA 1KDAA 4R8IA 1U9RA 3AMUA 1JWUD 1AZPA 2F0SA 1VCIA 1SBBB 4S3SA 1TY2A 2B2WA 1SYGA 1WTWA 2B8GA 3PIP3 5I2YA 3HOVB 3QOJA 1FYCA 4E6IA 4DXGA 4CKEA 3A7LA 4XYOA 5E4WC 4A93B 3ITPA 3R2IA 5FOBB 4Y7NB 3TP6A 4K5XA 1B50A 2RKSA 5KIXA 2FFKB 3FVQA 3PUYA 4KJNA 1PTOD 1OO9B 4BBRB 1FNWA 2K7VA 3RD4A 4K5WA 1IW7D 4CJ0B 5CMDA 1AZQA 4ZQ3A 1LTAD 3PO3B 1NR4A 1CTMA 1EFID 3DEPA 4XIGS 4A3MB 4KKSA 3S16B 1TQOA 4A3GB 2F0DA 3MEHA 4N9TA 1TKWB 4IFDG 4K6DA 2EVBA 4HCSA 1BF4A 1HA5A 1PTOH 2H4OA 3GV3A 1ZKOA 1HUNA 5M5XB 1TWGB 2PNRC 4G7ZC 2LS01 5CV8A 2QCPX 4BA2I 5M3MB 3MA2B 2AWOA 3GTGB 4B08A 4IURA 2F0KA 2ZT9C 2IT1A 2IJ0A 4LK1C 1IHZA 1HPCA 4H13C 5JOBA 2XIWA 4L6TB 3D6CA 1NSNS 1SMYD 3MC0B 5KRUA 1H9KA 4B9XA 1SE2A 4OHJA 2B2TC 2RQXA 3VYTA 3CRKC 1OXVA 3PMFA 3N6RA 3J7YW 5C3WA 3D4DA 5IGDA 2AQ1B 4V190 4K6LA 1PRTD 3MXGA 4PNYA 1NAPA 3K59A 3KLSA 4OGQC 1EZ8A 4XDXA 3BVMA 2MHVA 5C44B 4WJWA 2TSSA 4UAIA 2E75C 4M8AA 3D4WA 3HEJA 1CA5A 3C1FA 1ENFA 2O5IC 4C3JB 1KAAA 2HQEA 4RKBA 1II3A 4CBVA 4BY1B 1KLUD 2F0MA 3HG9A 1ML0D 1SYFA 4F87A 4PMWA 4LJZC 3HGBA 1I6VC 3RMHA 3S17B 4QUCA 1F2LA 4ID6A 4QIWB 2B2TA 3Q23A 1K8OA 2C9OA 1UAPA 5IGBA 5KYIA 2PZWA 3RUZA 3GTQB 1DONA 1GUOA 4CHTB 1D1KA 1VMCA 2IPKD 1SEBD 2L5TA 2F0LA 2VNUD 4HEDA 1CI3M 4GZYC 4IUVA 3OMCA 3KF8A 5HURA 3T53B 1Z6HA 3SR1A 3K0YA 2F0OA 2EE1A 2IL8A 3GP7A 1FR3A 2N88A 3I70A 1F2MA 1TT2A 1UUPA 2X6LA 4G7HC 3HOWB 1EWHA 2EYHA 3OWEB 1MBYA 3WOEA 1ESFA 4X3SA 1AEXA 2MP1A 4BA1I 1S5BD 3QJYA 4KMUC 4Q5VA 4CGYB 3GTJB 2JA8B 1G6ZA 3FPPA 2D5DA 2SDFA 4OO1H 2NN6G 1A15A 3JAML 2JXMB 2YYZA 2RDHA 1I4PA 5EKIA 1B4OA 3K6OA 1SNOA 1MGSA 5NUCA 4F8MA 1MSHA 1ET9A 4IUNA 1SNDA 4XQJA 1I4GA 5EBDA 3D3RA 2F0PA 1HRJA 4DAVA 3DM1A 1CK1A 1ENCA 5KYLA 5C3EB 4JK1C 2A6EC 2QDBA 3TP5A 1A2TA 4HR7B 2B2UC 2F0VA 3C3LA 3QG1A 2EJFC 3J80E 3I73A 2RSNA 1LLRD 4XQNA 1LT4D 3H09A 1X3QA 1LACA 4LAAA 1S5ED 3BDLA 3I90A 1BUVT 2JA5B 2WKCA 4IUPA 2AUJD 1ZEQX 5BN3A 2XRQD 3K5LA 2LKVA 4QCLA 3A56A 1AN8A 3NSWA 2LMCB 2NWGA 1U4PA 1DD2A 5C0XG 1RTNA 1HQMC 2BOSA 5F2DA 3HRZC 4YIJA 1GUTA 5DM73 3VYUA 3QO2A 5M3FB 2JEBI 3FPUB 4ULLA 3ONAB 4ODGA 4IZ8A 3M3YB 1T5XD 5EPLA 4K8IA 4HN7A 3DWQA 4AYBB 5C5MA 2R3ZA 1EZ6A 3QB3A 4NW2A 2L1BA 2F0QA 1IKMA 4IUQA 1KLGD 1AP0A 4QUFA 3RZOB 2PCFB 5FO7B 2G9DA 5I6WA 1IKLA 2VXWA 1SNQA 2HDMA 5C4XB 3S1MB 5KGUA 1Q90A 3DUZA 2R92B 2SNSA 2B2VC 2NTSA 2F0GA 3OSOA 1WVLA 1Q8IA 4FP5D 1STEA 3NWTA 1B3AA 1O7LA 1D6EC 1L0XB 3FMCA 1EY7A 2EJMA 2RBMA 1EU3A 1C4QA 4PMBA 3MVVA 5FKAC 1GXDC 2K5QA 1D2BA 5E1FA 2OF1A 2WIIB 1GUGA 3NUCA 4A3BB 3H0GB 4FF2A 5M9OA 3S9WA 1RTOA 3R2TA 5EBCA 2ZXRA 4TRDA 1WTVA 5K36G 1H9SA 1EY8A 1EIHA 4X3TA 2L12A 1PLFA 2A6HC 3S1RB 4XT3B 2K01A 4KKTA 4KKUA 3PUVA 4A3FB 5J39A 5LHY1 1W6KA 1V8QA 3BVGA 3SK6A 2A5HA 1JWMD 1XX8A 2EY1A 1HCZA 3K5NA 3A8KE 1IYUA 2F0WA 2MUYA 1B44D 3BG3A 4F88A 1U4MA 3OOCA 4NP5A 4A3KB 3C1EA 2F0FA 1IL8A 4IFDI 4O1NA 1V1PA 1V1PB 2ZXPA 1GOZA 3D8GA 2ZXOA 3R8BA 3W3AA 3O13A 3MXPA 1CQFA 1SE3A 1Y8OB 4KN7C 2OT2A 2RDGA 5JJZA 4A3JB 1SNCA 1XTCD 2Q8TA 1STNA 3FKIB 4TQUS 1SYBA 3CHBD 3KUPA 2R61A 5TSSA 1QNUA 3D4RA 2B2YA 1LTBD 2K5WA 5EJWA 4C3HG 3Q22A 1ZXTA 4KHZA 4OL7A 4RGOS 1BDOA 5FLXL 1ET6A 5D3IB 1WTPA 1MD2D 2JSOA 4KY6A 5C4ZA 1ENAA 4RKLA 3SEBA 5EKLA 4ZUIA 3K5MA 3H91A 1DOLA 3KLRA 4IFDJ 2X69A 2L4NA 3J81L 2F0NA 1YNJC 1G91A 2NVTB 4KD4A 2SEBD 1LTTD 1EY5A 3VYSA 1LT5D 2XRSD 1LTGD 1RODA 4XT1B 3PUXA 4I7ZC 4N9PA 1DOKA 5CV9A 4PMCA 2DY8A 3TP8A 4NDXA 5CV6A 4IUTA 4DAYA 3V96A 3SK8A 1BNZA 2JA6B 1ESRA 1DCZA 4ZUJA 3MXNA 1PTOB 1STYA 1TY0A 2AQ2B 1BCPC 1RKNA 1GHKA 2PYKA 3H6MA 2A68C 3MXUA 1PTOC 4KJOA 1GUNA 1I4QA 3I8ZA 2WV6D 4FO2A 4K8JA 5D65A 1EU4A 3V05A 2FINB 5IGFA 4OIKA 1B1ZA 3VYRA 1TWAB 3R3OA 1XXGA 3FDTA 3T51B 2BA1A 2EXZA 3GQBA 2BE5C 4FF1A 1F9RA 4DF7A 5JAVA 2EYOA 4C3HB 2IX3A 1I50B 1TVXA 2PO4A 1NR2A 1F2ZA 3VR3A 1E2ZA 1QWYA 1Y8PB 1J8IA 1H9JA 1C48A 3BYTB 4CJ1B 4ZKBB 2A69C 2D9UA 4FF4A 3BYYB 2NTTA 3X3NA 4C1NI 1A3TA 1ZYRD 1BO0A 2M00A 2E76C 1TWHB 1JICA 5K5PA 5CBEE 4DN4M 2EDGA 4M1UB 3OW7A 1EWCA 1Q12A 2L55A 2L0CA 2V4DA 3H94A 1HHVA 1F77A 4ZRZA 2TMPA 1PTOF 1HTLD 3VR2A 2F1MA 1EEID 1FD7D 3GTLB 4K5VA 5J22A 1TS3A 2EYPA 1D5ZC 5C0XJ 1BR9A 2WB1B 5EPKA 4IQZA 2CHBD 5DM63 4BWGB 5D14A 5KNBA 1EQTA 1MI2A 2K5DA 1QNKA 1O7YA 3ND9A 3A55A 1QB5D 4QMGA 2I46A 1A3UA 1STHA 1HXYD 1NCVA 3TSSA 2F0HA 4ZKCB 2WAQB 1A2UA 3IFTA 5CORA 1QCBD 2VB3X 3KLSX 2R93B 5JPNC 3M4YA 1WTRA 1KDCA 5EPJA 1F9SA 1EY6A 3S2DB 3NK9A 2BDNA 2F3WA 3LWEA 2IWHA 4DNTB 1ZYRC 3EFXD 3ERQA 4ZK9B 2NYZD 3K7AB 4FYDA 2WINB 1K83B 2JEAI 4KV6A 2O5JC 1LTRD 3QIAA 1I6HB 1EY0A 4EGVA 3TMEA 2BDOA 3A8JE 1E2WA 2NB0A 1CZGA 3NBHA 3OIPA 1HQRD 1WTOA 3J7AF 3GD7A 1UEAB 1U4LA 1WD0A 4HCEA 2C5CA 4HSPA 2KJXA 2QF7A 1VDZA 1ILQA 2N55A 2XWJB 4XTCS 2SOBA 4L63B 2XSCA 4C56C 4A3DB 2XVSA 3IL8A 3J81E 1TS2A 2QEJC 2BCOA 2Z4HA 5KEEA 2NVXB 5ELCA 1JB3A 1O7ZA 3AU7A 2QKIC 5C5LA 3HOUB 4C3IG 3EJIA 2EYFA 5ISRA 2B2UA 4LMQD 1K8MA 3TN2A 2RDFA 1ICWA 3URYA 4IALA 3H3VC 2F0TA 4L8JA 4RWSC 1STBA 1TIID 1SJHD 1SJED 4CKBA 3M7NA 1U4RA 2BA0A 1GUWA 2F0JA 3T13A 1OXUA 5ELBA 1PDQA 3PO2B 1PZID 4WFN3 3U9SA 1LTSD 1HTPA 1SYDA 5IT9L 4TSSA 2B2VA 4KY5A 2PZUA 1BCPB 3VR4A 4BBSB 3BVZA 3PUWA 5DEHA 5EKKA 3SXHA 3QWNA 2AUKA 4TKOB 2B39A 2KQ3A 4PV1C 1PZJD 5C4HA 2ICEC 4WORA 4MN3A 1Y1VB 1YNND 2E2IB 1VF5C 1G2SA 5M5WB 1S5FD 3HKZB 2AWNA 5I6YA 5T1GA 1PRTC 4ILWA 1I4HA 2KA7A 1KDBA 5IIFA 3AB9A 4ZAIA 3BDCA 4UDUC 2R6GA 2GA4B 3U9OA 3LWUA 4G7OC 3CU7A 1EEFD 4V0BA 5K36H 1TS4A 1KNAA 1SNPA 1CHQD 1YNJD 1J9OA 3HOXB 2IX1A 1Q3LA 2HCCA 1VMPA 3IKJA 2J0TD 3S15B 2KECA 1OXXK 2DNEA 5A2QE 4R8NA 2K32A 1I4RA 5HGTA 2K28A 3TDQA 2WKDA 4EVOA 1LTID 2F3VA 1JOKA 4HAEA 2HDLA 5KNDA 5CV4A 3K5OA 4ZLTF 2NVYB 3S1QB 2PZTA 2FJ2A 3M85A 1JOQA 2LY7A 4CKCA 1HA6A 1DZ1A 2EYLA 1Q1BA 2WP8J 4G4KA 3HOZB 1Z47A 3E6ZX 3I3CA 1L0YB 1B9MA 4MHEA 3C2PA 3OHXC 4A3EB 3HS0C 1V1OA 5LL6X 4FXGC 4A3IB 1BBXC 3I4MB 3X3MA 2KHSA 1JC7A 3C46A 4QB4A 4FVMA 2J4XA 4RHSA 1G2TA 1PFBA 4PQXA 3KK7A 5C6AA 1QJOA 1T5EA 3NBIA 3ZYYX 4HTHA 2Z8LA 1QOHA 1D1IA 3GTMB 3E0JA 5I4DA 2JA7B 4XYQA 1LO5D 4J1MA 3NTKA 1SMYC 2CVRA 1H9MA 4RCNA 2K1BA 5FLXE 2Y0SB 1TR5A 3DXJC 3W2DA 5COYA 2G9HD 1RHPA 1IYVA 3M4OB 5IGCA 1TWCB 2F4IA 1CA6A 3EVQA 4OO1I 3NWSA 1PXUA 5FO8B 4P2CB 2NN6H 2YU9B 5ELEA 1EQVA 4RA8A 3DWPA 2K05A 1RD9D 3P7JA 1VF7A 2XWBB 1UNSA 1QE6A 1MSGA 1NUCA 3S2HB 5C3XA 3VA5A 1SFOB 1X3PA 2MGSA 4C1NK 5IT9E 4MIUA 1SYCA 1KNEA 4U68A 4RGNA 3OPOA 4BY7B 1B2TA 1PRTF 2SNMA 3A54A 2EY5A 1O80A 2A68D 3GO5A 1TS5A 1LV9A 4RH6A 3L9AX 1CT1D 2A74C 4G57A 3HZXA 1JOOA 3OWFA 3UI2A 4RFBA 5A35A 1S5DD 3EQLC 1EYAA 1PFMA 5I9PA 2K04A 1Y1WB 1FGBD 1B9NA 5C0XI 2JE6I 4JBWA 2B63B 3GTKB 1AW7A 5EGTA 4R9WA 3FEWX 1EOTA 3MWYW 1Q1EA 5IGGA 2NVQB 4RGMA 1Y69U 2AQ3B 3NPPA 2X6GA 1M4VA 2JP1A 2F0EA 1I4XA 3P20A 2OEOA 4XQQA 1XYIA 2ENBA 1DYQA 3CRLC 4Q0FA 4I65A 5M5YB 1CZWA 4ZYSA 5A2QL 2WACA 3SVMA 3R93A 4KY7A 3T4AC 4RAUC 2MPMA 1WTXA 3Q0AA 5CR3A 3TZUA 1JE4A 1G291 5JEAH 1H9RA 2KUMA 2HCIA 2DNCA 3PV0A 3CKIB 3J80L 4K2KA 3BZDB 3S14B 2O4XA 1QG7A 3IAYA 2B2YC 2Z1CA 2EY6A 3NQIA 4U673 3NP8A 5G3LD 1CHPD 5DNFA 2M2LA 1KABA 2K03A 4DU9A 3A7AB 1F9QA 4C2MB 5CBAE 5D3DA 4DNRB 5IGEA 5T1IA 1SDFA 2KCNA 2D2CC 2RVLA 4DK1A 5E3FA 5JEAJ 4DA2A 2A6HD 1M8AA 1KTKA 4KN4C 1OXTA 1QILA 2Q8RE 1HFGA 1DOMA 2EPBA 1R9TB 3SHLA 1JORA 1D5MC 3TP7A 4OO1G 2EYMA 4OIJA 4KD3A 3L7ZC 4RHRA 2H1EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PW5 A;  1EQV A;  1EY0 A;  3DHQ A;  3TME A;  1KAA A;  2HQE A;  1SNO A;  5DEH A;  4KHV A;  4RKB A;  2F0E A;  5NUC A;  4F8M A;  4J6H A;  5EKK A;  2PZT A;  3P1H A;  5K5P A;  2OEO A;  1TQO A;  3SXH A;  2F0D A;  5J39 A;  4IUN A;  4N9P A;  1SND A;  1II3 A;  3MEH A;  1STG A;  1EY4 A;  2ENB A;  4N9T A;  5CV9 A;  5C5M A;  4PMC A;  1JOQ A;  4I65 A;  1EZ6 A;  4K6D A;  2F0P A;  1NUC A;  2F0M A;  3QB3 A;  2EYL A;  3TP8 A;  2KQ3 A;  2WAC A;  4DGZ A;  5C3X A;  2F0Q A;  4K14 A;  1A3V A;  4NDX A;  1SYF A;  5CV6 A;  2F0U A;  3VA5 A;  3SK6 A;  5C4H A;  1ENC A;  4WOR A;  5KYL A;  3MZ5 A;  4KY7 A;  3DMU A;  1EY9 A;  3SK8 A;  4K5V A;  2QDB A;  1F2Y A;  4ZUJ A;  2EY1 A;  1A2T A;  3TP5 A;  5CC4 A;  4QF4 A;  1EYD A;  4KTA A;  4ID6 A;  5I6W A;  1STY A;  2EYP A;  1SNQ A;  2PW7 A;  2F0V A;  4WRD A;  5CV8 A;  4MIU A;  4EQN A;  5KGU A;  1SYC A;  2F0W A;  5CR3 A;  2SNS A;  5DAU A;  1RKN A;  2F0G A;  2PYK A;  3MHB A;  2EYJ A;  3H6M A;  2F0K A;  4NP5 A;  5I9O A;  3C1E A;  3OSO A;  5CV7 A;  2F0F A;  3NHH A;  5I6Y A;  5IGB A;  5IGF A;  5IOD A;  5KYI A;  2PZW A;  3RUZ A;  2SOB A;  2SNM A;  1IHZ A;  2KHS A;  4H7B A;  2NUC A;  3D8G A;  4K2K A;  4KJO A;  5IOC A;  2EY5 A;  1KDB A;  5IIF A;  4QB4 A;  5J22 A;  3QOL A;  1KDA A;  3BDC A;  1U9R A;  2F0L A;  5JOB A;  4LAA A;  3MXP A;  2O4X A;  3BDL A;  3P75 A;  4K8J A;  3U9O A;  4QMG A;  5J1Z A;  4ME5 A;  1SNM A;  3D6C A;  4DFA A;  1EY7 A;  1NSN S;  1A3U A;  1STH A;  2OXP A;  3E5S A;  3OMC A;  2EY6 A;  2F0S A;  3HZX A;  2F0H A;  1JOO A;  4G57 A;  5C6A A;  5KRU A;  1SNC A;  4B9X A;  4EQP A;  5CGK A;  5HUR A;  3OWF A;  5KEE A;  1STN A;  2RBM A;  4S3S A;  1A2U A;  1SYB A;  3NP8 A;  4PMB A;  3SR1 A;  2F0O A;  2EY2 A;  2LKV A;  4HTH A;  3MVV A;  1SYG A;  3R3O A;  1SNP A;  4HMI A;  3ERO A;  3PMF A;  1KAB A;  3T16 A;  4DU9 A;  1EYA A;  5C3W A;  3D4D A;  5C5L A;  4NKL A;  4OL7 A;  3EJI A;  2EYF A;  2EXZ A;  5I9P A;  5IGD A;  5ISR A;  3QOJ A;  1F2M A;  5E1F A;  1TT2 A;  2OF1 A;  4E6I A;  5IGE A;  3LX0 A;  1KDC A;  4DF7 A;  5JAV A;  2RDF A;  1EY6 A;  4J1M A;  1STA A;  3SK5 A;  4IAL A;  3V2T A;  3NUC A;  2EYO A;  3NK9 A;  2F3W A;  4PNY A;  2F0I A;  5F2D A;  2F0T A;  2EYH A;  1SYE A;  4K2L A;  3ITP A;  1F2Z A;  4KY6 A;  4YIJ A;  4F7X A;  1STB A;  5C4Z A;  1ENA A;  1EZ8 A;  1AEX A;  4RKL A;  3TP6 A;  4K5X A;  4B9W A;  5EGT A;  5E3F A;  2RKS A;  4NMZ A;  2PQE A;  5M9O A;  3NQT A;  5KIX A;  3S9W A;  5EKL A;  4ZUI A;  2F0J A;  3OMG A;  4KJN A;  3T13 A;  4R8N A;  1TR5 A;  4TRD A;  5HGT A;  4EQO A;  3SK4 A;  3ERQ A;  4EVO A;  4K5W A;  2F3V A;  1JOK A;  3D4W A;  1EY8 A;  1EYC A;  1SYD A;  5CV5 A;  5IGC A;  1A3T A;  3HEJ A;  4KY5 A;  3EVQ A;  3SHL A;  5IGG A;  1JOR A;  2F0N A;  3NXW A;  3C1F A;  4ODG A;  4KV6 A;  4IZ8 A;  4HMJ A;  4ZQ3 A;  2PZU A;  2M00 A;  3TP7 A;  4K8I A;  4KD4 A;  2EYM A;  5CV4 A;  4KD3 A;  1EY5 A; 
#chains in the Genus database with same CATH topology
 4FNF A;  3DHQ A;  3I4N B;  5IYD H;  2UUA L;  3TBI B;  3SGI A;  3VR5 A;  1P8L A;  1GJX A;  4A3E H;  4DK0 A;  1JQY D;  4O42 A;  4DV2 L;  4HIM A;  3K81 C;  3MFG A;  1SXT A;  1EWI A;  1V43 A;  3CQZ B;  1DJR D;  1I3Q B;  3DMU A;  3MAQ A;  2CKZ B;  4MTN A;  2FMM A;  1OXS C;  5CC4 A;  2HHH Q;  1EYD A;  1GHJ A;  4KTA A;  4LFC Q;  4A93 H;  1YEZ A;  1JWS D;  4J15 A;  3CPW A;  2ZM6 Q;  3J7A V;  4JI4 Q;  2ICI A;  3ND8 A;  1K3B C;  3KBG A;  1BCP D;  3HOU H;  2UUB Q;  5IOD A;  3G4S A;  3G7L A;  1WI5 A;  1PFN A;  2DN8 A;  1FNU A;  2NUC A;  4LFB Q;  1PMR A;  1WFQ A;  1GUS A;  1SSO A;  2K33 A;  3HOW G;  1ILP A;  4RCO A;  3GV6 A;  1FGU A;  2XN9 C;  1DXM A;  1YNX A;  3DLL A;  1XWE A;  5I2X A;  4C3J G;  3CCU A;  4HJ5 A;  2JYO A;  1PZK D;  1SNM A;  1X32 A;  4DR7 Q;  5BN4 A;  4LFA Q;  1X65 A;  3PUZ A;  2KEE A;  4EQP A;  4L5R C;  1BXT A;  1PH8 A;  5KNC A;  4R4I A;  1F9P A;  2EY2 A;  2IX0 A;  2KVM A;  3S1N H;  2K14 A;  4DAP A;  4HMI A;  3GTP B;  3ERO A;  3OTO L;  1BBU A;  3NE5 B;  3T16 A;  2K50 A;  4ABN A;  5JEA G;  2B63 H;  3LX0 A;  2R92 H;  1K0S A;  1N32 L;  3PIO 3;  3K57 A;  4CDF C;  1HNX Q;  2E2H B;  3GTO B;  2D0O A;  2FXQ A;  2F0I A;  2PPB C;  1SYE A;  1VQI A;  3N52 A;  2VL6 A;  2M9V A;  4F7X A;  4GKK Q;  4B9W A;  1JCK B;  1JR0 D;  2CCZ A;  1E1O A;  4OEL B;  4H44 C;  2MQH A;  2A69 D;  4QJF A;  2OTL A;  3NTH A;  1D5X C;  2YU9 H;  1VQ8 A;  1R4P B;  1K9M C;  2XNA C;  4DNI A;  2EJG C;  1LAB A;  4HSV A;  1T9H A;  1DM0 B;  3DWA A;  4KHV A;  3K7A H;  5JJL A;  3P1H A;  4GLV B;  2UUA Q;  3WOF A;  1LT6 D;  4LF6 Q;  1WD1 A;  3VR6 A;  5ELF A;  3T1H L;  2J7Z A;  2FMC A;  1BOS A;  1CFM A;  1KD1 C;  1A3V A;  4BXX H;  2D62 A;  5FK9 C;  4JYA L;  2KED A;  1EY9 A;  3S17 H;  4GOP C;  3GTL H;  2QW7 A;  4YY3 L;  1S4Z A;  3A8I E;  4JI4 L;  5G3L F;  3PGZ A;  4Z9C B;  2DY7 A;  2E2J B;  1CQV A;  1H9S B;  5CV7 A;  2QIL A;  1ONL A;  3M9B A;  3CCE A;  2A73 B;  1E2V A;  3HOY B;  3AQQ A;  5LL6 S;  3BZK A;  4KK7 A;  1EOV A;  3F8T A;  3J81 i;  2F52 A;  4IUU A;  1PH1 A;  4C3I B;  4DR6 Q;  2BE5 D;  5J1Z A;  4DFA A;  1WTQ A;  3E5S A;  3I55 A;  4FXD A;  1HR0 L;  1PA6 A;  2HUG A;  5CGK A;  2DJG C;  4O2D A;  4R4T A;  3KFU A;  3HOY H;  2B8F A;  1XPO A;  3SE0 A;  3U50 C;  3GTQ H;  3T56 B;  3OTO Q;  4L5S A;  1Y14 B;  3Q24 A;  1PRT B;  4J8Q A;  4NKL A;  1EIG A;  1B7Y B;  1RF2 D;  1FNV A;  1XJV A;  1HFN A;  1N32 Q;  3V2T A;  1PVO A;  5CYU A;  3K58 A;  5IWA Q;  2B2W C;  3K7U C;  3BS1 A;  4H0L C;  4K2L A;  4KLK A;  4XXE A;  2K6A A;  3I4L A;  5AJ3 Q;  2R7Z B;  3MFY A;  3PIO A;  4POG A;  4NMZ A;  3NQT A;  1LT3 D;  4QY7 A;  3SDZ A;  2UXD Q;  4X3K A;  2IW3 A;  3OMG A;  4DUZ Q;  3PSI A;  2RSO A;  1C9O A;  3NTI A;  3S2H H;  2F3I A;  4LUZ A;  4EQO A;  5AFW A;  1VQP A;  3PO2 G;  2RA4 A;  3HP3 A;  1SAP A;  3DEO A;  1EYC A;  3J81 j;  5CV5 A;  3MTS A;  2VW9 A;  1PV4 A;  3I4N H;  2VUM H;  2ID0 A;  1N34 Q;  3JAM E;  4HMJ A;  2CW0 D;  3CW2 C;  3I4N G;  1BCP F;  4LUV A;  3EIV A;  4IFD H;  1SE4 A;  2VUM B;  4AYB E;  1R9T H;  4J6H A;  1XMO L;  3I7F A;  1Z7T A;  2K52 A;  1N36 Q;  1STG A;  1EY4 A;  2EZV A;  1RDP D;  1B3Q A;  2PMZ B;  4IN3 A;  1QVF A;  2JA8 H;  4DGZ A;  4K14 A;  4JI5 L;  2NZ1 D;  1HUM A;  3TS0 A;  2I07 B;  3MZ5 A;  1R4Q B;  1C8C A;  2OWO A;  3IFD A;  4FXK C;  5JPM C;  2F03 A;  3F2U A;  2ZJP A;  1W3S A;  2R93 G;  2PW7 A;  3Q6S A;  2ZM6 L;  4DV6 L;  4EQN A;  1BQQ T;  5M5Y H;  2LFN A;  5DAU A;  3K8A A;  4BY1 H;  5JVG 3;  2EYJ A;  2R93 H;  1A6X A;  3D31 A;  5I9O A;  3M7G A;  1CM9 A;  4PZ6 A;  1TWF B;  1E0B A;  1W6J A;  3QOL A;  4A3J H;  1QZG A;  3A74 A;  2CW0 C;  2ZTD A;  3A5Z B;  2RHQ B;  3TZD A;  3P75 A;  2KCC A;  4IPG A;  1SLJ A;  4ME5 A;  4A3D H;  5FO9 B;  1WCM B;  2OXP A;  4GNX A;  1HR0 Q;  1TXY A;  1TWF H;  1C7Y A;  1NMG A;  4DR3 Q;  2L11 A;  4IO9 A;  1I94 L;  1G6P A;  2E2D C;  4A3M G;  2VB2 X;  5IP7 G;  1AFP A;  2O2L D;  3EA6 A;  4L5Q A;  5M5W H;  1STA A;  3IRB A;  4X3U A;  3SK5 A;  4C3H H;  4DXF A;  5C4J B;  1YHQ A;  5IP7 H;  3RLF A;  2B63 G;  1Q81 C;  2Z4I A;  5AJ3 L;  4KI0 A;  1Y8N B;  5ELD A;  3RZD B;  2PQE A;  3VA7 A;  3I72 A;  2FHT A;  2MJ8 A;  5FJ8 G;  5JVH 3;  1VQ5 A;  3SK4 A;  1M1K C;  2E74 C;  1PYW D;  1TU2 B;  4OXP A;  3CCJ A;  3BDO A;  3NXW A;  5EQ0 A;  1EL0 A;  3S1R H;  1RJT A;  3OIQ A;  5GAE C;  4WJ4 A;  1IW7 C;  1S5C D;  3I91 A;  1L1O C;  2KOL A;  4X62 L;  2PW5 A;  1HNZ Q;  2A6E D;  2LSS A;  4BS9 A;  2PQA A;  2EIF A;  1FL0 A;  1NJI C;  2JJQ A;  2NBF A;  4APV A;  4FF3 A;  2EOT A;  1XTD A;  1U5K A;  1PHJ A;  4DR7 L;  4IPD A;  2CQA A;  4A3L H;  2F0U A;  4JI5 Q;  1SE8 A;  4RGT A;  2Q8I B;  3D6W A;  2VQE L;  1F2Y A;  4QF4 A;  1G8Z D;  3L3O C;  2L9H A;  4WRD A;  5BN5 A;  2R7F A;  3WDN A;  1YNN C;  1B53 A;  4DV6 Q;  3FRP B;  3KBX A;  3LNN A;  2JQO A;  2L15 A;  3MHB A;  3G6J B;  4CJ2 C;  3NHH A;  1O78 A;  5FLM H;  5C0X H;  3S1N B;  4H7B A;  2NN6 I;  1RCV D;  5IOC A;  4LW1 A;  5E4X A;  1KDA A;  4R8I A;  1U9R A;  3AMU A;  4P74 A;  3KJO A;  3CCV A;  2NVQ H;  1WYD A;  1JWU D;  1AZP A;  2F0S A;  4N8F A;  1VCI A;  1SBB B;  4S3S A;  1TY2 A;  2B2W A;  1SYG A;  1WTW A;  2B8G A;  2G5D A;  4JBK A;  5GQO A;  3PIP 3;  2D0P A;  3RZD H;  1L1O A;  3EN2 A;  5I2Y A;  1Y1W G;  3HOV B;  3QOJ A;  3CMA A;  2R7Z H;  1FYC A;  4E6I A;  4DXG A;  4CKE A;  3A7L A;  4MNO A;  1K28 A;  4XYO A;  1CKO A;  5E4W C;  4A93 B;  4DK3 C;  3ITP A;  2R7Z G;  3R2I A;  5FOB B;  4Y7N B;  3TP6 A;  4K5X A;  1B50 A;  2RKS A;  3STB D;  5KIX A;  4R1J A;  2UXD L;  2FFK B;  3CC7 A;  3FVQ A;  3PUY A;  5ELN A;  4KJN A;  1HZA A;  1PTO D;  4B3T L;  1OO9 B;  4BBR B;  4YY3 Q;  1FNW A;  1LYL A;  2K7V A;  3RD4 A;  4UY8 C;  4K5W A;  3UDF A;  2Q2T A;  1IW7 D;  4A3M H;  3S16 H;  1AH9 A;  4CJ0 B;  4RG1 A;  1KQS A;  1VQH A;  1B8A A;  3OYY A;  1N34 L;  5CMD A;  1TWH H;  3GDE A;  1AZQ A;  4ZQ3 A;  3CXC A;  1LTA D;  1JT8 A;  3PO3 B;  4YCU A;  1MIU A;  1NR4 A;  1HNZ L;  1CTM A;  1EFI D;  3DEP A;  1XMO Q;  4XIG S;  4A3M B;  4KKS A;  3S16 B;  1TQO A;  4A3G B;  2F0D A;  3MEH A;  4N9T A;  1TKW B;  4DR6 L;  4JI2 L;  4IFD G;  4K6D A;  2EXD A;  2EVB A;  3H15 A;  4HCS A;  1BF4 A;  2UXC L;  3CC2 A;  1HA5 A;  4HID A;  1PTO H;  2H4O A;  1MHW C;  3GV3 A;  1ZKO A;  2N8N A;  2Y0S G;  3NEN A;  1HUN A;  4DUY Q;  5M5X B;  1TWG B;  2PNR C;  3CCM A;  1HZC A;  4G7Z C;  2LS0 1;  5CV8 A;  2QCP X;  1XNQ Q;  3DM3 A;  4BA2 I;  4NB3 A;  5M3M B;  4AQY Q;  3MA2 B;  2AWO A;  3GTG B;  1GKH A;  5E7N A;  4IUR A;  4B08 A;  2F0K A;  2ZT9 C;  1YHA A;  2IT1 A;  2WB1 E;  2IJ0 A;  4LK1 C;  4WJ3 M;  3J7A 5;  4CDD C;  1IHZ A;  4GNX C;  3TEH B;  1HPC A;  1FVI A;  4H13 C;  5JOB A;  2MO1 A;  1WCM H;  2XIW A;  4A3L G;  4L6T B;  1IYJ B;  3D6C A;  1NSN S;  1SMY D;  3MC0 B;  5KRU A;  1H9K A;  3NEM A;  1X3F A;  4B9X A;  1CKN B;  2LXK A;  1SE2 A;  1I94 Q;  4OHJ A;  2B2T C;  2RQX A;  2V1C C;  3CRK C;  1OXV A;  3PMF A;  3VYT A;  3N6R A;  3J7Y W;  5C3W A;  3D4D A;  5IGD A;  4UP8 A;  2AQ1 B;  5M3M H;  5J3B A;  4V19 0;  4K6L A;  1PRT D;  3J81 c;  4X66 L;  3MXG A;  2A8V A;  4PNY A;  1NY4 A;  1NAP A;  3K59 A;  3KLS A;  4OGQ C;  1EZ8 A;  4XDX A;  3BVM A;  2MHV A;  5C44 B;  4WJW A;  4YHH L;  1UEB A;  2TSS A;  3I4O A;  4UAI A;  1EQR A;  3FKI H;  4JBJ A;  1EUJ A;  2E75 C;  4OON A;  4M8A A;  3D4W A;  4A3G H;  4NXN L;  3HEJ A;  1CA5 A;  2NVY H;  2IY5 B;  4C3I H;  3C1F A;  2Z6K A;  1ENF A;  2WB1 G;  3Q8D A;  2O5I C;  1PFS A;  2UU9 L;  4C3J B;  1KAA A;  2HQE A;  1X3E A;  2F4V Q;  4RKB A;  5ELO A;  1II3 A;  4CBV A;  1VQC A;  4BY1 B;  1KLU D;  1NTG A;  3KOJ A;  2N49 A;  2F0M A;  3HG9 A;  5C4X H;  1ML0 D;  1SYF A;  4F87 A;  1S3O A;  2K4K A;  4LJZ C;  1KRS A;  4PMW A;  3TRE A;  2UXC Q;  3HGB A;  1I6V C;  3RMH A;  5C44 H;  1NBW A;  4QUC A;  3S17 B;  1F2L A;  5GRO A;  2EQS A;  2MO0 A;  4ID6 A;  4QIW B;  2B2T A;  1SRO A;  2DUD A;  1G51 A;  3Q23 A;  2RF4 A;  2E5L Q;  2C9O A;  1K8O A;  2ZTC A;  1UAP A;  1WJJ A;  5IGB A;  5KYI A;  2PZW A;  3RUZ A;  3GTQ B;  1DON A;  1GUO A;  1XNR L;  4CHT B;  1D1K A;  1VMC A;  1SRU A;  2IPK D;  1SEB D;  3PO3 H;  1CSP A;  2L5T A;  4QQB X;  2F0L A;  2JA8 G;  2VNU D;  4HED A;  1FJG L;  1CI3 M;  4GZY C;  4IUV A;  1GO3 E;  3M4P A;  2DGY A;  3OMC A;  3KF8 A;  5JJK A;  1YZ6 A;  5HUR A;  3T53 B;  1Z6H A;  3SR1 A;  1PYS B;  3K0Y A;  2F0O A;  2EE1 A;  2IL8 A;  1E3P A;  3GP7 A;  1FR3 A;  1IBK L;  2N88 A;  1EQQ A;  4PG3 A;  3I70 A;  1F2M A;  1TT2 A;  1UUP A;  3KF6 A;  2X6L A;  4G7H C;  2QEX A;  3HOW B;  1EWH A;  1HZ9 A;  2EYH A;  3OWE B;  2K5H A;  1JB7 A;  1MBY A;  3WOE A;  1ESF A;  4YWK A;  2JA7 H;  4X3S A;  1AEX A;  2MP1 A;  3RZO H;  1Q46 A;  5GAD C;  4BA1 I;  3CME A;  1S5B D;  3QJY A;  4KMU C;  4Q5V A;  2OTJ A;  4CGY B;  3GTJ B;  4YHH Q;  2JA8 B;  1G6Z A;  1K0R A;  2HHH L;  1VQD A;  3FPP A;  3HOZ G;  2D5D A;  2SDF A;  4DR1 L;  4OO1 H;  2NN6 G;  4GN3 B;  1A15 A;  4HIK A;  3JAM L;  2JXM B;  2YYZ A;  4EX5 A;  1VQ7 A;  2RDH A;  4OX9 Q;  1I4P A;  5EKI A;  1B4O A;  2I0Q A;  3K6O A;  3HKZ G;  1GVP A;  4A3E G;  1SNO A;  1MGS A;  1V1Q A;  5NUC A;  4F8M A;  1ASZ A;  1A62 A;  1MSH A;  1ET9 A;  1XPR A;  4IUN A;  1SND A;  4XQJ A;  1I4G A;  3CCS A;  1SN8 A;  5EBD A;  1WOC A;  4AYB G;  3D3R A;  2F0P A;  3RLO A;  1HRJ A;  4OEM B;  4DAV A;  3S1M H;  2PNH A;  4LFA L;  3DM1 A;  1CK1 A;  3FKI G;  1V9P A;  1ENC A;  5KYL A;  5C3E B;  4DV3 L;  4JK1 C;  5M3F G;  2A6E C;  4FDB A;  2QDB A;  3TP5 A;  3UDG A;  1A2T A;  2A1A A;  4HR7 B;  4HJ9 A;  2XTI A;  2B2U C;  2F0V A;  3C3L A;  2KHI A;  3I2Z A;  2HT1 A;  3QG1 A;  1XNQ L;  3I4M G;  3G48 A;  2EJF C;  2E5L L;  3J80 E;  1HNX L;  3I73 A;  1CSQ A;  1JMC A;  4HIO A;  2RSN A;  3T1Y L;  1LLR D;  2LXJ A;  3BZC A;  4XQN A;  3CD6 A;  1LT4 D;  3H09 A;  1X3Q A;  3CP0 A;  1LAC A;  4LAA A;  1S5E D;  3BDL A;  3I90 A;  1BUV T;  2JA5 B;  1X56 A;  2WKC A;  2AUJ D;  4H02 A;  4IUP A;  2VQF L;  3M4O H;  1ZEQ X;  1EIY B;  5BN3 A;  4CDE C;  4LF8 L;  2XRQ D;  1PH7 A;  4DV4 L;  3K5L A;  2LKV A;  4QCL A;  3A56 A;  1AN8 A;  1A8V A;  3NSW A;  1NNX A;  1ICF B;  2LMC B;  4QL5 A;  1IBK Q;  4A3K H;  2NWG A;  1U4P A;  1I5F A;  1DD2 A;  5FLM G;  5C0X G;  1IBL Q;  1RTN A;  1HQM C;  2BH2 A;  4O0A A;  4ZCK A;  2BOS A;  4A3K G;  4JI7 L;  3S2D H;  3OW2 A;  5F2D A;  3PO3 G;  2YTV A;  2YV5 A;  4GN4 B;  3HRZ C;  4YIJ A;  2N3S A;  4PZ8 A;  4JYA Q;  1VQO A;  4IPC A;  4DUY L;  1GUT A;  5DM7 3;  3VYU A;  3QO2 A;  3RN5 A;  5M3F B;  4NXN Q;  3KYH C;  3U4Z A;  3K80 C;  3TQY A;  2JEB I;  3FPU B;  4ULL A;  1W2B A;  3ONA B;  4ODG A;  4IZ8 A;  3M3Y B;  1T5X D;  5EPL A;  4K8I A;  4HN7 A;  3DWQ A;  3RLN A;  4DR4 Q;  4AYB B;  2F4V L;  1RIP A;  2ZTE A;  4BBS G;  4B3M L;  1A63 A;  5C5M A;  4BXX G;  2Z6K C;  2R3Z A;  3M4Q A;  1EZ6 A;  3QB3 A;  4NW2 A;  2L1B A;  2F0Q A;  2VS1 A;  3AFQ A;  1IKM A;  1VQA A;  4IUQ A;  1KLG D;  1AP0 A;  4QUF A;  3RZO B;  2KCM A;  1YJN A;  2PCF B;  5FO7 B;  2G9D A;  5I6W A;  2UXB Q;  1I50 H;  1IKL A;  2H5X A;  2VXW A;  4LF5 Q;  3A0J A;  4K0K L;  1SNQ A;  3PQI A;  2HDM A;  5C4X B;  3S1M B;  1K8G A;  1Q90 A;  3DUZ A;  5KGU A;  1MJE A;  2R92 B;  2SNS A;  1DGS A;  2B2V C;  2F0G A;  2NTS A;  5HY6 A;  4X66 Q;  5IWA L;  2E8G A;  3OSO A;  4YCW A;  3STB C;  1WVL A;  2CWP A;  1Q8I A;  1KC8 C;  4FP5 D;  1STE A;  3NWT A;  1B3A A;  1NE3 A;  4DUZ L;  1K83 H;  1O7L A;  1D6E C;  1L0X B;  1X9N A;  3FMC A;  1EY7 A;  3CCR A;  5IYC G;  1S40 A;  2EJM A;  2RBM A;  1EU3 A;  1C4Q A;  4PMB A;  3MVV A;  5FKA C;  4LWC A;  1GXD C;  2K5Q A;  1D2B A;  4DR2 L;  5E1F A;  2OF1 A;  2WII B;  2HIX A;  4JW0 A;  1GUG A;  3AFP A;  3NUC A;  4JI7 Q;  2WFW A;  4A3B B;  4DPG A;  3H0G B;  1Q86 C;  1YIT A;  4FF2 A;  5M9O A;  4Y52 H;  2I5H A;  3S9W A;  1RTO A;  3R2T A;  3B6Y A;  5EBC A;  2JA7 G;  2ZXR A;  4TRD A;  1WTV A;  2ZJQ A;  5K36 G;  4DR1 Q;  2ASB A;  1H9S A;  1EY8 A;  4A3F H;  5LMN W;  1EIH A;  4X3T A;  2L12 A;  1PLF A;  5M3M G;  2A6H C;  1XNR Q;  3E9H A;  1VQ6 A;  3S1R B;  4XT3 B;  2K01 A;  3S24 A;  4KKT A;  2QDL A;  4IOA A;  4KKU A;  3PUV A;  4A3F B;  5J39 A;  5LHY 1;  1W6K A;  1V8Q A;  2GVB A;  4MZ9 A;  3BVG A;  3H0G G;  4DV1 Q;  2GN5 A;  1E1T A;  3SK6 A;  1VQF A;  3RNU A;  4DV3 Q;  2A5H A;  3H0G H;  4P71 A;  1JWM D;  1XX8 A;  2EY1 A;  1HCZ A;  3E0E A;  3K5N A;  1C0A A;  3A8K E;  4DV7 Q;  1IYU A;  2F0W A;  2MUY A;  1B44 D;  3BG3 A;  4F88 A;  1U4M A;  2NZO A;  3OOC A;  4NP5 A;  4A3K B;  3C1E A;  2F0F A;  1IL8 A;  3KLW A;  4IFD I;  4O1N A;  1TWA H;  1V1P A;  3QR8 A;  1V1P B;  2ZXP A;  1GOZ A;  3D8G A;  2ZXO A;  4BBR G;  3R8B A;  3W3A A;  3F2D A;  5EAY A;  3O13 A;  3MXP A;  1CQF A;  1SE3 A;  1Y8O B;  4GKJ Q;  3BU2 A;  4KN7 C;  4UHV A;  2JA6 G;  2OT2 A;  2Z0S A;  1K73 C;  2RDG A;  5JJZ A;  4A3J B;  1SNC A;  1XTC D;  1QUQ B;  2Q8T A;  4DV4 Q;  1STN A;  3FKI B;  4TQU S;  1SYB A;  3S14 H;  3CHB D;  3KUP A;  2R61 A;  1JJG A;  2AHO B;  5TSS A;  4P75 A;  1QNU A;  4OX9 L;  3D4R A;  2B2Y A;  3GTJ H;  1BBW A;  1JJC B;  1LTB D;  2K5W A;  2QGQ A;  5EJW A;  4C3H G;  1ZXT A;  4YCV A;  4X62 Q;  3Q22 A;  4KHZ A;  4HJ7 A;  4OL7 A;  4RGO S;  1BDO A;  5FLX L;  1ET6 A;  4P72 A;  1IBL L;  2JN4 A;  2PI2 E;  5D3I B;  1KHI A;  4JOI C;  3PF5 A;  1PH2 A;  1WTP A;  1MD2 D;  2JSO A;  4KY6 A;  5C4Z A;  1ENA A;  4RKL A;  3HOV H;  2VY3 A;  4GOP B;  3SEB A;  5EKL A;  4ZUI A;  2Z6B A;  3K5M A;  3H91 A;  1HZB A;  1DOL A;  3KLR A;  4IFD J;  1YI2 A;  2KCT A;  3HKS A;  4AIM A;  2GVA A;  2X69 A;  2L4N A;  3MXN B;  3J81 L;  3AYH B;  2F0N A;  4IJH A;  1Q7Y C;  1PH4 A;  4LF7 L;  1YNJ C;  1G91 A;  1MKH A;  2NVT B;  4KD4 A;  2SEB D;  1GM5 A;  1LTT D;  1EY5 A;  3VYS A;  4DR4 L;  1LT5 D;  2XRS D;  1LTG D;  1ROD A;  4XT1 B;  4JI3 L;  1CKM A;  3F2B A;  1WTH A;  3PUX A;  4I7Z C;  4N9P A;  3CC4 A;  1DOK A;  4ME3 A;  5CV9 A;  4PMC A;  2DY8 A;  2VQF Q;  2CFM A;  3TP8 A;  1HNW Q;  4NDX A;  5CV6 A;  4IUT A;  4DAY A;  3V96 A;  4MTK A;  1TWG H;  3GTK H;  4LF4 L;  3SK8 A;  1BNZ A;  2JA6 B;  1ESR A;  1DCZ A;  4ZUJ A;  3MXN A;  1PTO B;  1STY A;  1TY0 A;  2I5M X;  1ASY A;  2AQ2 B;  4JCV E;  1Y1V G;  1BCP C;  2KHJ A;  4CDC C;  3W5O A;  1RKN A;  1GHK A;  2PYK A;  4A3I G;  1E24 A;  3H6M A;  1EIF A;  1X54 A;  2A68 C;  3MXU A;  1PTO C;  4KJO A;  4DKA C;  1U0L A;  2RCN A;  1GUN A;  1I4Q A;  3I8Z A;  3M3Y H;  2WV6 D;  4A4I A;  4FO2 A;  4K8J A;  4JV5 L;  3NBH B;  5D65 A;  1VQJ A;  4UPA A;  1EU4 A;  3V05 A;  1N33 Q;  2FIN B;  5IGF A;  1EFW A;  5BR8 Q;  4OIK A;  3W1G A;  1B1Z A;  4YWM A;  1YVC A;  3VYR A;  1TWA B;  5LMU L;  1EYG A;  2ES2 A;  3R3O A;  2OQ0 A;  3I4M H;  1XXG A;  3FDT A;  4GNX B;  3T51 B;  2BA1 A;  2EXZ A;  4DR2 Q;  3GQB A;  4DV0 Q;  4JI0 L;  2BE5 C;  4FF1 A;  1F9R A;  4DF7 A;  5JAV A;  1YIJ A;  2EYO A;  4C3H B;  2IX3 A;  1I50 B;  1TVX A;  3BJU A;  2PO4 A;  1NR2 A;  1F2Z A;  3VR3 A;  1E2Z A;  1QWY A;  1Y8P B;  2Z9H A;  4R4O A;  3KJP A;  1J8I A;  1H9J A;  1C48 A;  3BYT B;  4CJ1 B;  3ULP A;  3CCL A;  1KAW A;  4ZKB B;  2A69 C;  4LF5 L;  1H95 A;  2D9U A;  4FF4 A;  3BYY B;  1HJP A;  2NTT A;  3X3N A;  4C1N I;  1A3T A;  1L0W A;  1ZYR D;  1BO0 A;  4DV5 L;  5IT9 c;  2M00 A;  3ULJ A;  4UP9 A;  2E76 C;  1TWH B;  1RL2 A;  1JIC A;  1J6Q A;  4DN4 M;  5CBE E;  5K5P A;  2EDG A;  4M1U B;  3OW7 A;  1EWC A;  4BY7 H;  1Q12 A;  2L55 A;  2L0C A;  2V4D A;  3H94 A;  1HHV A;  1S72 A;  1F77 A;  4LF9 Q;  4ZRZ A;  2TMP A;  4BY7 G;  1PTO F;  1HTL D;  3VR2 A;  2F1M A;  4A75 A;  1EEI D;  1FD7 D;  1PH9 A;  3GTL B;  3I56 A;  4K5V A;  3G6E A;  5J22 A;  3HKZ E;  1TS3 A;  2EYP A;  1D5Z C;  2KBN A;  5C0X J;  2MNA A;  1BR9 A;  4DV7 L;  1UE5 A;  2WB1 B;  1J5E Q;  1XPU A;  5EPK A;  1D8L A;  4B3S L;  4IQZ A;  2CHB D;  5DM6 3;  1UWV A;  4BWG B;  5D14 A;  5KNB A;  1WCM G;  2VZA A;  3HOU G;  1EQT A;  2CH4 A;  1MI2 A;  2K5D A;  1QNK A;  3UE1 A;  1O7Y A;  3MEF A;  3ND9 A;  3A55 A;  1QB5 D;  4QMG A;  2I46 A;  2ZJR A;  1A3U A;  1STH A;  4DV2 Q;  1HXY D;  1NCV A;  3TSS A;  2F0H A;  3CPF A;  5BR8 L;  4ZKC B;  2WAQ B;  1A2U A;  3IFT A;  4A3D G;  1VS0 A;  5COR A;  5HGQ A;  1QCB D;  2VB3 X;  5GAG C;  4A3I H;  3KLS X;  2R93 B;  5JPN C;  2DJF C;  2HQL A;  3M4Y A;  1WTR A;  1KDC A;  1QUQ A;  1LUZ A;  5EPJ A;  1HR0 W;  1F9S A;  1EY6 A;  1P16 A;  3ZJY C;  3S2D B;  3NK9 A;  2BDN A;  2F3W A;  1X6O A;  4DV1 L;  2R92 G;  3ICE A;  5GAH C;  5IE8 A;  2N78 A;  5IYC H;  3G71 A;  2Y0S E;  3LWE A;  4ALP A;  2IWH A;  4DNT B;  1ZYR C;  3HOY G;  3EFX D;  3ERQ A;  3F1Z A;  4ZK9 B;  2NYZ D;  5FJ8 H;  2B3G A;  3K7A B;  2C35 B;  4FYD A;  2WIN B;  2JA5 H;  1K83 B;  2R7D A;  2JEA I;  4KV6 A;  2O5J C;  1LTR D;  3QIA A;  1B70 B;  1I6H B;  1EY0 A;  4EGV A;  2JA5 G;  3TME A;  2CH4 W;  2BDO A;  1VQE A;  1GD7 A;  5IP9 H;  5C4X G;  1XMQ Q;  1FJG Q;  3A8J E;  1E2W A;  2NB0 A;  5C44 G;  1HNW L;  3D0F A;  1CZG A;  3NBH A;  3OIP A;  1HH2 P;  1HQR D;  1WTO A;  3J7A F;  3GD7 A;  1UEA B;  1U4L A;  4A3B H;  3JAM c;  1WD0 A;  5LMN L;  2ATW A;  4HCE A;  2C5C A;  4HSP A;  2KJX A;  3AEV A;  2QF7 A;  1VDZ A;  1ILQ A;  2N55 A;  2XWJ B;  4XTC S;  2SOB A;  3PCO B;  4DR5 Q;  4L63 B;  2NVX H;  4HJA A;  2XSC A;  4DAY B;  4C56 C;  2OCE A;  1N8R C;  2Q2U A;  4LF6 L;  4A3D B;  1VQN A;  2XVS A;  3IL8 A;  2WAQ G;  1N33 L;  3J81 E;  4JI1 L;  1TS2 A;  2QEJ C;  2BCO A;  2K5N A;  2Z4H A;  4A93 G;  3FP9 A;  5KEE A;  2NVX B;  5ELC A;  2PI2 A;  2PQA B;  4LF7 Q;  1JB3 A;  1O7Z A;  3AU7 A;  2QKI C;  1KXL A;  5C5L A;  3HOU B;  4C3I G;  3EJI A;  2EYF A;  5ISR A;  4DV0 L;  1IBM Q;  4JI3 Q;  2B2U A;  1QVC A;  1K3R A;  4LMQ D;  1K8M A;  3TN2 A;  4A3C H;  2RDF A;  1ICW A;  3URY A;  4IAL A;  2K75 A;  3H3V C;  1Y1W H;  2F0T A;  1KRT A;  3HOW H;  4L8J A;  4RWS C;  1STB A;  1TII D;  1SJH D;  3J80 i;  4JPB W;  1SJE D;  4CKB A;  3M7N A;  1U4R A;  2BA0 A;  2CQO A;  4GLA C;  1GUW A;  2F0J A;  4LF4 Q;  4GOP A;  3T13 A;  4JI8 Q;  1OXU A;  4NXM L;  5ELB A;  1PDQ A;  3TRZ A;  3PO2 B;  1PZI D;  4WFN 3;  3U9S A;  1LTS D;  4X65 Q;  1HTP A;  3WWV A;  1SYD A;  5IT9 L;  4TSS A;  2B2V A;  4KY5 A;  1PH6 A;  1IXR A;  3CF5 A;  4DV5 Q;  2PZU A;  2Q2I A;  1BCP B;  3E9I A;  3VR4 A;  4BBS B;  3T1Y Q;  3BVZ A;  3PUW A;  4PZ7 A;  4JOI A;  4JC0 A;  5DEH A;  1Q82 C;  1D7Q A;  5EKK A;  5IYB H;  1AE2 A;  3SXH A;  3QWN A;  2AUK A;  1XMQ L;  2IHF A;  4TKO B;  3A5U A;  2B39 A;  4JV5 Q;  4X6A H;  1Z9F A;  4LF9 L;  2KQ3 A;  4PV1 C;  4TVA B;  4LF8 Q;  1PZJ D;  5C4H A;  2ICE C;  2E2I H;  2PMZ E;  4WOR A;  1N9W A;  1UE1 A;  5LMU Q;  4MN3 A;  1Y1V B;  1YNN D;  2E2I B;  1VF5 C;  2MFI A;  4JI0 Q;  1QZH A;  1G2S A;  5M5W B;  1J5E L;  1S5F D;  3PIP A;  2QA4 A;  3HKZ B;  2AWN A;  5I6Y A;  3GTP H;  5T1G A;  1PRT C;  4ILW A;  1I4H A;  2KA7 A;  4BY1 G;  1KDB A;  5IIF A;  1JJ2 A;  3AB9 A;  4ZAI A;  3BDC A;  4UDU C;  2R6G A;  2GA4 B;  1N36 L;  3HOX G;  3U9O A;  3LWU A;  1O7I A;  4G7O C;  1VQM A;  3CU7 A;  4JG2 A;  1EEF D;  1IZ6 A;  4V0B A;  5K36 H;  3NEL A;  1TS4 A;  1KNA A;  1SNP A;  4B3R Q;  1CHQ D;  1YNJ D;  1J9O A;  3GTG H;  3HOX B;  4JBM A;  2IX1 A;  1Q3L A;  2HCC A;  3VDY A;  1VMP A;  4B3M Q;  2E2H H;  3IKJ A;  2J0T D;  5IY0 A;  1PH5 A;  4GS3 A;  3S15 B;  2KEC A;  3PF4 A;  1SFO H;  2JK8 A;  1OXX K;  3GTM H;  2DNE A;  5A2Q E;  4R8N A;  4NXM Q;  2K32 A;  1I4R A;  5HGT A;  2UXB L;  2K28 A;  4K0K Q;  3TDQ A;  2WKD A;  4EVO A;  3K0X A;  4X64 Q;  1LTI D;  2F3V A;  1JOK A;  3EBE A;  4DAM A;  4POF A;  3ERS X;  1E7Z A;  4HAE A;  2HDL A;  3CAM A;  5KND A;  1QVG A;  5CV4 A;  1VQG A;  3K5O A;  4ZLT F;  2NVY B;  3S1Q B;  2PZT A;  2FJ2 A;  3M85 A;  5DLQ E;  3LGJ A;  3ULL A;  2LY7 A;  1JOQ A;  3F2C A;  4CKC A;  1HA6 A;  1DZ1 A;  2EYL A;  1Q1B A;  1L1O B;  5IP9 G;  2WP8 J;  4G4K A;  2UUC L;  3HOZ B;  1Z47 A;  1SR3 A;  3E6Z X;  2JA6 H;  2CWA A;  3I3C A;  3CQZ H;  3E3X A;  2RHS B;  1L0Y B;  3KDF A;  2VUM G;  1B9M A;  1MJC A;  4MHE A;  1YBY A;  4DK6 C;  3C2P A;  3OHX C;  4A3E B;  3HS0 C;  1V1O A;  5LL6 X;  1PYB A;  4FXG C;  4A3I B;  1BBX C;  1VQ4 A;  4GLX A;  3I4M B;  3X3M A;  2KHS A;  2OQK A;  2YTY A;  1JC7 A;  4DR5 L;  3UDX A;  3S1Q H;  3C46 A;  4QB4 A;  4FVM A;  2B29 A;  2NVT H;  1JE5 A;  2J4X A;  4RHS A;  1G2T A;  1PFB A;  1UE7 A;  4PQX A;  4JI1 Q;  3KK7 A;  5C6A A;  1X3G A;  2YTX A;  1QJO A;  1T5E A;  2AMC B;  3NBI A;  3ZYY X;  4OWX B;  4HTH A;  2Z8L A;  1QOH A;  2VQE Q;  1D1I A;  4B3R L;  1CKN A;  3ER0 A;  4QIW E;  3GTM B;  3E0J A;  1IBM L;  4Y7N H;  5I4D A;  2JA7 B;  3S15 H;  4XYQ A;  1LO5 D;  4KHP Q;  4J1M A;  3NTK A;  2UUB L;  3GTO H;  2A19 A;  1SMY C;  2CVR A;  1H9M A;  4LUO A;  4A3C G;  3HOX H;  4RCN A;  3HOZ H;  2ALY B;  2K1B A;  2HD3 A;  5FLX E;  2Y0S B;  1TR5 A;  3DXJ C;  3W2D A;  5LMN Q;  1VQL A;  5COY A;  2G9H D;  1RHP A;  1IYV A;  4P73 A;  3M4O B;  5IGC A;  1TWC B;  2F4I A;  1CA6 A;  3EVQ A;  4OO1 I;  3CCQ A;  4N8X 1;  3NWS A;  1PXU A;  1OTC A;  1AE3 A;  5FO8 B;  4P2C B;  2NN6 H;  2YU9 B;  5L37 A;  5ELE A;  1EQV A;  4IOC A;  4RA8 A;  3DWP A;  1YHB A;  2K05 A;  1RD9 D;  1VQ9 A;  3P7J A;  1VF7 A;  2XWB B;  3W1B A;  1UNS A;  1QE6 A;  4GKJ L;  2E2J H;  1MSG A;  1NUC A;  3UE0 A;  4NPS A;  3S2H B;  5C3X A;  3VA5 A;  1VQK A;  1Q8K A;  2UUC Q;  1SFO B;  1X3P A;  1M90 C;  1NMF A;  2MGS A;  4C1N K;  5IT9 E;  4B3T Q;  4MIU A;  1YJW A;  1SYC A;  1KNE A;  4U68 A;  4RGN A;  3OPO A;  5JJI A;  4BY7 B;  1B2T A;  1PRT F;  3UDI A;  2SNM A;  3A54 A;  1L2F A;  4C3J H;  4LFB L;  2EY5 A;  1O80 A;  1I6H H;  2P5Z X;  2IHE A;  2A68 D;  4JI8 L;  3GO5 A;  4GN5 A;  3L2P A;  4JI2 Q;  1TS5 A;  1LV9 A;  4RH6 A;  4X65 L;  3FHW A;  3L9A X;  1CT1 D;  2A74 C;  4G57 A;  3HZX A;  1IL2 A;  1JOO A;  4LNQ A;  3OWF A;  4I7A A;  3UI2 A;  3PO2 H;  4RFB A;  4YWL A;  4R4Q A;  4QGU A;  5A35 A;  4A3F G;  1S5D D;  3EQL C;  1EYA A;  4UP7 A;  1KIX A;  1PFM A;  4L5T A;  5I9P A;  4JVZ A;  2K04 A;  4AQY L;  1Y1W B;  3HOV G;  1FGB D;  1B9N A;  5C0X I;  2KEN A;  2JE6 I;  4JBW A;  2B63 B;  3GTK B;  2K5V A;  1AW7 A;  5EGT A;  2AKW B;  4R9W A;  3FEW X;  1EOT A;  1YJ9 A;  3MWY W;  3TS2 A;  3J80 c;  4X64 L;  2Q2H A;  1Q1E A;  3KDF B;  2XGT A;  4JI6 Q;  5IGG A;  2NVQ B;  4RGM A;  3KF6 B;  2JA9 A;  1VQB A;  1Y69 U;  2AQ3 B;  4BBS H;  3NPP A;  4A3G G;  4RMF A;  2X6G A;  1M4V A;  2JP1 A;  2F0E A;  1I4X A;  3P20 A;  1TWC H;  2OEO A;  4XQQ A;  1XYI A;  1UE6 A;  3KF8 B;  2ENB A;  1DYQ A;  3CRL C;  4IPH A;  4Q0F A;  4BBR H;  4I65 A;  3T1H Q;  5M5Y B;  1CZW A;  4A3J G;  4ZYS A;  4IJL A;  5A2Q L;  2WAC A;  3H3V H;  4EQ5 A;  3SVM A;  3R93 A;  1Y1V H;  4KY7 A;  3JC6 6;  4OWW B;  1SMX A;  3T4A C;  3JAM i;  4LFC L;  4RAU C;  2BH8 A;  2HIV A;  2MPM A;  1WTX A;  3Q0A A;  5CR3 A;  3TZU A;  1JE4 A;  1CUK A;  1G29 1;  5JEA H;  1H9R A;  2KUM A;  2HCI A;  2DNC A;  3PV0 A;  5IYB G;  5FLX c;  4HJ8 A;  3CKI B;  3J80 L;  4K2K A;  2UU9 Q;  3BZD B;  3S14 B;  1LTL A;  4R4C A;  2O4X A;  1LM0 A;  4A76 A;  3U58 A;  2RCF A;  1QG7 A;  3IAY A;  3HFZ B;  2B2Y C;  2Z1C A;  2I5L X;  5M3F H;  1X55 A;  2EY6 A;  3NQI A;  4U67 3;  2WAQ E;  1K8A C;  3NP8 A;  5G3L D;  1CHP D;  5DNF A;  1BVS A;  4AH6 A;  2M2L A;  1KAB A;  2K03 A;  3L0O A;  3A7A B;  4DU9 A;  3J7Z C;  1PH3 A;  1F9Q A;  4C2M B;  5CBA E;  5D3D A;  4DNR B;  5H1S E;  1E22 A;  5IGE A;  4KHP L;  5T1I A;  1SDF A;  2KCN A;  2D2C C;  5C4J H;  2RVL A;  4DK1 A;  5M5X H;  1I3Q H;  4GKK L;  5C3E H;  4C2M H;  5E3F A;  5JEA J;  4DA2 A;  1A0I A;  1M8A A;  2A6H D;  1KTK A;  4KN4 C;  3RR5 A;  1OXT A;  1QIL A;  5C3E G;  2Q8R E;  1HFG A;  3RN2 A;  1DOM A;  2EPB A;  2NZH A;  1BKB A;  4A3B G;  1R9T B;  4B3S Q;  3SHL A;  1KL9 A;  1JOR A;  4JI6 L;  4DR3 L;  3H3V I;  1D5M C;  3U4V A;  4OWT B;  5IYD G;  3TP7 A;  4OO1 G;  2EYM A;  4OIJ A;  4KD3 A;  3L7Z C;  4RHR A;  2H1E A; 
#chains in the Genus database with same CATH homology
 4FNF A;  3DHQ A;  3I4N B;  3TBI B;  3VR5 A;  1GJX A;  4DK0 A;  1JQY D;  4O42 A;  3MFG A;  1SXT A;  1V43 A;  3CQZ B;  1DJR D;  1I3Q B;  3DMU A;  3MAQ A;  2FMM A;  1OXS C;  5CC4 A;  1EYD A;  1GHJ A;  4KTA A;  1JWS D;  3J7A V;  2ICI A;  3ND8 A;  3KBG A;  1BCP D;  5IOD A;  3G7L A;  1PFN A;  2DN8 A;  1FNU A;  2NUC A;  1PMR A;  1GUS A;  1SSO A;  2K33 A;  1ILP A;  4RCO A;  3GV6 A;  2XN9 C;  1DXM A;  1XWE A;  5I2X A;  4C3J G;  2JYO A;  1PZK D;  1SNM A;  1X32 A;  5BN4 A;  3PUZ A;  2KEE A;  4EQP A;  1BXT A;  5KNC A;  1F9P A;  2EY2 A;  2IX0 A;  2KVM A;  4DAP A;  4HMI A;  3GTP B;  3ERO A;  3NE5 B;  3T16 A;  4ABN A;  5JEA G;  3LX0 A;  3PIO 3;  3K57 A;  2E2H B;  3GTO B;  2F0I A;  2PPB C;  1SYE A;  3N52 A;  2M9V A;  4F7X A;  4B9W A;  1JCK B;  1JR0 D;  4H44 C;  2A69 D;  3NTH A;  1D5X C;  1R4P B;  2XNA C;  2EJG C;  1LAB A;  4HSV A;  1DM0 B;  3DWA A;  4KHV A;  3P1H A;  3WOF A;  1LT6 D;  1WD1 A;  3VR6 A;  5ELF A;  2J7Z A;  2FMC A;  1BOS A;  1CFM A;  1A3V A;  2D62 A;  5FK9 C;  2KED A;  1EY9 A;  1S4Z A;  3A8I E;  5G3L F;  4Z9C B;  2DY7 A;  2E2J B;  1CQV A;  1H9S B;  5CV7 A;  2QIL A;  1ONL A;  2A73 B;  1E2V A;  3HOY B;  5LL6 S;  4KK7 A;  4IUU A;  4C3I B;  2BE5 D;  5J1Z A;  4DFA A;  1WTQ A;  3E5S A;  4FXD A;  2HUG A;  5CGK A;  2B8F A;  3SE0 A;  3T56 B;  3Q24 A;  1PRT B;  4J8Q A;  4NKL A;  1EIG A;  1RF2 D;  1FNV A;  1HFN A;  3V2T A;  5CYU A;  3K58 A;  3BS1 A;  2B2W C;  4H0L C;  4K2L A;  4XXE A;  2K6A A;  3I4L A;  2R7Z B;  3MFY A;  4NMZ A;  3NQT A;  1LT3 D;  3SDZ A;  4X3K A;  2IW3 A;  3OMG A;  2RSO A;  3NTI A;  4EQO A;  5AFW A;  2RA4 A;  3HP3 A;  1SAP A;  3DEO A;  1EYC A;  5CV5 A;  3MTS A;  2ID0 A;  3JAM E;  4HMJ A;  2CW0 D;  1BCP F;  4IFD H;  2VUM B;  1SE4 A;  4J6H A;  1Z7T A;  1STG A;  1EY4 A;  2EZV A;  1RDP D;  2PMZ B;  4IN3 A;  4DGZ A;  4K14 A;  2NZ1 D;  1HUM A;  2I07 B;  3MZ5 A;  1R4Q B;  1C8C A;  3IFD A;  4FXK C;  5JPM C;  2F03 A;  3F2U A;  2PW7 A;  3Q6S A;  4EQN A;  1BQQ T;  2LFN A;  5DAU A;  5JVG 3;  2EYJ A;  1A6X A;  3D31 A;  5I9O A;  3M7G A;  1CM9 A;  1TWF B;  1E0B A;  1W6J A;  3QOL A;  2CW0 C;  3TZD A;  3P75 A;  2KCC A;  4ME5 A;  5FO9 B;  1WCM B;  2OXP A;  2L11 A;  2E2D C;  2VB2 X;  1AFP A;  2O2L D;  3EA6 A;  5C4J B;  1STA A;  4X3U A;  3SK5 A;  4DXF A;  3RLF A;  2Z4I A;  4KI0 A;  1Y8N B;  5ELD A;  3RZD B;  2PQE A;  3VA7 A;  3I72 A;  2FHT A;  2MJ8 A;  5JVH 3;  3SK4 A;  2E74 C;  1PYW D;  1TU2 B;  3BDO A;  3NXW A;  5EQ0 A;  1EL0 A;  1RJT A;  3OIQ A;  1IW7 C;  1S5C D;  3I91 A;  2KOL A;  2PW5 A;  2A6E D;  4BS9 A;  2NBF A;  4FF3 A;  2EOT A;  2CQA A;  2F0U A;  4RGT A;  2Q8I B;  3D6W A;  1F2Y A;  4QF4 A;  1G8Z D;  3L3O C;  2L9H A;  4WRD A;  5BN5 A;  3WDN A;  1YNN C;  1B53 A;  3FRP B;  3KBX A;  3LNN A;  3MHB A;  3G6J B;  4CJ2 C;  3NHH A;  1O78 A;  5C0X H;  3S1N B;  4H7B A;  2NN6 I;  1RCV D;  5IOC A;  5E4X A;  1KDA A;  4R8I A;  1U9R A;  3AMU A;  1JWU D;  1AZP A;  2F0S A;  1VCI A;  1SBB B;  4S3S A;  1TY2 A;  2B2W A;  1SYG A;  1WTW A;  2B8G A;  3PIP 3;  5I2Y A;  3HOV B;  3QOJ A;  1FYC A;  4E6I A;  4DXG A;  4CKE A;  3A7L A;  4XYO A;  5E4W C;  4A93 B;  3ITP A;  3R2I A;  5FOB B;  4Y7N B;  3TP6 A;  4K5X A;  1B50 A;  2RKS A;  5KIX A;  2FFK B;  3FVQ A;  3PUY A;  4KJN A;  1PTO D;  1OO9 B;  4BBR B;  1FNW A;  2K7V A;  3RD4 A;  4K5W A;  1IW7 D;  4CJ0 B;  5CMD A;  1AZQ A;  4ZQ3 A;  1LTA D;  3PO3 B;  1NR4 A;  1CTM A;  1EFI D;  3DEP A;  4XIG S;  4A3M B;  4KKS A;  3S16 B;  1TQO A;  4A3G B;  2F0D A;  3MEH A;  4N9T A;  1TKW B;  4IFD G;  4K6D A;  2EVB A;  4HCS A;  1BF4 A;  1HA5 A;  1PTO H;  2H4O A;  3GV3 A;  1ZKO A;  1HUN A;  5M5X B;  1TWG B;  2PNR C;  4G7Z C;  2LS0 1;  5CV8 A;  2QCP X;  4BA2 I;  5M3M B;  3MA2 B;  2AWO A;  3GTG B;  4B08 A;  4IUR A;  2F0K A;  2ZT9 C;  2IT1 A;  2IJ0 A;  4LK1 C;  1IHZ A;  1HPC A;  4H13 C;  5JOB A;  2XIW A;  4L6T B;  3D6C A;  1NSN S;  1SMY D;  3MC0 B;  5KRU A;  1H9K A;  4B9X A;  1SE2 A;  4OHJ A;  2B2T C;  2RQX A;  3VYT A;  3CRK C;  1OXV A;  3PMF A;  3N6R A;  3J7Y W;  5C3W A;  3D4D A;  5IGD A;  2AQ1 B;  4V19 0;  4K6L A;  1PRT D;  3MXG A;  4PNY A;  1NAP A;  3K59 A;  3KLS A;  4OGQ C;  1EZ8 A;  4XDX A;  3BVM A;  2MHV A;  5C44 B;  4WJW A;  2TSS A;  4UAI A;  2E75 C;  4M8A A;  3D4W A;  3HEJ A;  1CA5 A;  3C1F A;  1ENF A;  2O5I C;  4C3J B;  1KAA A;  2HQE A;  4RKB A;  1II3 A;  4CBV A;  4BY1 B;  1KLU D;  2F0M A;  3HG9 A;  1ML0 D;  1SYF A;  4F87 A;  4PMW A;  4LJZ C;  3HGB A;  1I6V C;  3RMH A;  3S17 B;  4QUC A;  1F2L A;  4ID6 A;  4QIW B;  2B2T A;  3Q23 A;  1K8O A;  2C9O A;  1UAP A;  5IGB A;  5KYI A;  2PZW A;  3RUZ A;  3GTQ B;  1DON A;  1GUO A;  4CHT B;  1D1K A;  1VMC A;  2IPK D;  1SEB D;  2L5T A;  2F0L A;  2VNU D;  4HED A;  1CI3 M;  4GZY C;  4IUV A;  3OMC A;  3KF8 A;  5HUR A;  3T53 B;  1Z6H A;  3SR1 A;  3K0Y A;  2F0O A;  2EE1 A;  2IL8 A;  3GP7 A;  1FR3 A;  2N88 A;  3I70 A;  1F2M A;  1TT2 A;  1UUP A;  2X6L A;  4G7H C;  3HOW B;  1EWH A;  2EYH A;  3OWE B;  1MBY A;  3WOE A;  1ESF A;  4X3S A;  1AEX A;  2MP1 A;  4BA1 I;  1S5B D;  3QJY A;  4KMU C;  4Q5V A;  4CGY B;  3GTJ B;  2JA8 B;  1G6Z A;  3FPP A;  2D5D A;  2SDF A;  4OO1 H;  2NN6 G;  1A15 A;  3JAM L;  2JXM B;  2YYZ A;  2RDH A;  1I4P A;  5EKI A;  1B4O A;  3K6O A;  1SNO A;  1MGS A;  5NUC A;  4F8M A;  1MSH A;  1ET9 A;  4IUN A;  1SND A;  4XQJ A;  1I4G A;  5EBD A;  3D3R A;  2F0P A;  1HRJ A;  4DAV A;  3DM1 A;  1CK1 A;  1ENC A;  5KYL A;  5C3E B;  4JK1 C;  2A6E C;  2QDB A;  3TP5 A;  1A2T A;  4HR7 B;  2B2U C;  2F0V A;  3C3L A;  3QG1 A;  2EJF C;  3J80 E;  3I73 A;  2RSN A;  1LLR D;  4XQN A;  1LT4 D;  3H09 A;  1X3Q A;  1LAC A;  4LAA A;  1S5E D;  3BDL A;  3I90 A;  1BUV T;  2JA5 B;  2WKC A;  4IUP A;  2AUJ D;  1ZEQ X;  5BN3 A;  2XRQ D;  3K5L A;  2LKV A;  4QCL A;  3A56 A;  1AN8 A;  3NSW A;  2LMC B;  2NWG A;  1U4P A;  1DD2 A;  5C0X G;  1RTN A;  1HQM C;  2BOS A;  5F2D A;  3HRZ C;  4YIJ A;  1GUT A;  5DM7 3;  3VYU A;  3QO2 A;  5M3F B;  2JEB I;  3FPU B;  4ULL A;  3ONA B;  4ODG A;  4IZ8 A;  3M3Y B;  1T5X D;  5EPL A;  4K8I A;  4HN7 A;  3DWQ A;  4AYB B;  5C5M A;  2R3Z A;  1EZ6 A;  3QB3 A;  4NW2 A;  2L1B A;  2F0Q A;  1IKM A;  4IUQ A;  1KLG D;  1AP0 A;  4QUF A;  3RZO B;  2PCF B;  5FO7 B;  2G9D A;  5I6W A;  1IKL A;  2VXW A;  1SNQ A;  2HDM A;  5C4X B;  3S1M B;  5KGU A;  1Q90 A;  3DUZ A;  2R92 B;  2SNS A;  2B2V C;  2NTS A;  2F0G A;  3OSO A;  1WVL A;  1Q8I A;  4FP5 D;  1STE A;  3NWT A;  1B3A A;  1O7L A;  1D6E C;  1L0X B;  3FMC A;  1EY7 A;  2EJM A;  2RBM A;  1EU3 A;  1C4Q A;  4PMB A;  3MVV A;  5FKA C;  1GXD C;  2K5Q A;  1D2B A;  5E1F A;  2OF1 A;  2WII B;  1GUG A;  3NUC A;  4A3B B;  3H0G B;  4FF2 A;  5M9O A;  3S9W A;  1RTO A;  3R2T A;  5EBC A;  2ZXR A;  4TRD A;  1WTV A;  5K36 G;  1H9S A;  1EY8 A;  1EIH A;  4X3T A;  2L12 A;  1PLF A;  2A6H C;  3S1R B;  4XT3 B;  2K01 A;  4KKT A;  4KKU A;  3PUV A;  4A3F B;  5J39 A;  5LHY 1;  1W6K A;  1V8Q A;  3BVG A;  3SK6 A;  2A5H A;  1JWM D;  1XX8 A;  2EY1 A;  1HCZ A;  3K5N A;  3A8K E;  1IYU A;  2F0W A;  2MUY A;  1B44 D;  3BG3 A;  4F88 A;  1U4M A;  3OOC A;  4NP5 A;  4A3K B;  3C1E A;  2F0F A;  1IL8 A;  4IFD I;  4O1N A;  1V1P A;  1V1P B;  2ZXP A;  1GOZ A;  3D8G A;  2ZXO A;  3R8B A;  3W3A A;  3O13 A;  3MXP A;  1CQF A;  1SE3 A;  1Y8O B;  4KN7 C;  2OT2 A;  2RDG A;  5JJZ A;  4A3J B;  1SNC A;  1XTC D;  2Q8T A;  1STN A;  3FKI B;  4TQU S;  1SYB A;  3CHB D;  3KUP A;  2R61 A;  5TSS A;  1QNU A;  3D4R A;  2B2Y A;  1LTB D;  2K5W A;  5EJW A;  4C3H G;  3Q22 A;  1ZXT A;  4KHZ A;  4OL7 A;  4RGO S;  1BDO A;  5FLX L;  1ET6 A;  5D3I B;  1WTP A;  1MD2 D;  2JSO A;  4KY6 A;  5C4Z A;  1ENA A;  4RKL A;  3SEB A;  5EKL A;  4ZUI A;  3K5M A;  3H91 A;  1DOL A;  3KLR A;  4IFD J;  2X69 A;  2L4N A;  3J81 L;  2F0N A;  1YNJ C;  1G91 A;  2NVT B;  4KD4 A;  2SEB D;  1LTT D;  1EY5 A;  3VYS A;  1LT5 D;  2XRS D;  1LTG D;  1ROD A;  4XT1 B;  3PUX A;  4I7Z C;  4N9P A;  1DOK A;  5CV9 A;  4PMC A;  2DY8 A;  3TP8 A;  4NDX A;  5CV6 A;  4IUT A;  4DAY A;  3V96 A;  3SK8 A;  1BNZ A;  2JA6 B;  1ESR A;  1DCZ A;  4ZUJ A;  3MXN A;  1PTO B;  1STY A;  1TY0 A;  2AQ2 B;  1BCP C;  1RKN A;  1GHK A;  2PYK A;  3H6M A;  2A68 C;  3MXU A;  1PTO C;  4KJO A;  1GUN A;  1I4Q A;  3I8Z A;  2WV6 D;  4FO2 A;  4K8J A;  5D65 A;  1EU4 A;  3V05 A;  2FIN B;  5IGF A;  4OIK A;  1B1Z A;  3VYR A;  1TWA B;  3R3O A;  1XXG A;  3FDT A;  3T51 B;  2BA1 A;  2EXZ A;  3GQB A;  2BE5 C;  4FF1 A;  1F9R A;  4DF7 A;  5JAV A;  2EYO A;  4C3H B;  2IX3 A;  1I50 B;  1TVX A;  2PO4 A;  1NR2 A;  1F2Z A;  3VR3 A;  1E2Z A;  1QWY A;  1Y8P B;  1J8I A;  1H9J A;  1C48 A;  3BYT B;  4CJ1 B;  4ZKB B;  2A69 C;  2D9U A;  4FF4 A;  3BYY B;  2NTT A;  3X3N A;  4C1N I;  1A3T A;  1ZYR D;  1BO0 A;  2M00 A;  2E76 C;  1TWH B;  1JIC A;  5K5P A;  5CBE E;  4DN4 M;  2EDG A;  4M1U B;  3OW7 A;  1EWC A;  1Q12 A;  2L55 A;  2L0C A;  2V4D A;  3H94 A;  1HHV A;  1F77 A;  4ZRZ A;  2TMP A;  1PTO F;  1HTL D;  3VR2 A;  2F1M A;  1EEI D;  1FD7 D;  3GTL B;  4K5V A;  5J22 A;  1TS3 A;  2EYP A;  1D5Z C;  5C0X J;  1BR9 A;  2WB1 B;  5EPK A;  4IQZ A;  2CHB D;  5DM6 3;  4BWG B;  5D14 A;  5KNB A;  1EQT A;  1MI2 A;  2K5D A;  1QNK A;  1O7Y A;  3ND9 A;  3A55 A;  1QB5 D;  4QMG A;  2I46 A;  1A3U A;  1STH A;  1HXY D;  1NCV A;  3TSS A;  2F0H A;  4ZKC B;  2WAQ B;  1A2U A;  3IFT A;  5COR A;  1QCB D;  2VB3 X;  3KLS X;  2R93 B;  5JPN C;  3M4Y A;  1WTR A;  1KDC A;  5EPJ A;  1F9S A;  1EY6 A;  3S2D B;  3NK9 A;  2BDN A;  2F3W A;  3LWE A;  2IWH A;  4DNT B;  1ZYR C;  3EFX D;  3ERQ A;  4ZK9 B;  2NYZ D;  3K7A B;  4FYD A;  2WIN B;  1K83 B;  2JEA I;  4KV6 A;  2O5J C;  1LTR D;  3QIA A;  1I6H B;  1EY0 A;  4EGV A;  3TME A;  2BDO A;  3A8J E;  1E2W A;  2NB0 A;  1CZG A;  3NBH A;  3OIP A;  1HQR D;  1WTO A;  3J7A F;  3GD7 A;  1UEA B;  1U4L A;  1WD0 A;  4HCE A;  2C5C A;  4HSP A;  2KJX A;  2QF7 A;  1VDZ A;  1ILQ A;  2N55 A;  2XWJ B;  4XTC S;  2SOB A;  4L63 B;  2XSC A;  4C56 C;  4A3D B;  2XVS A;  3IL8 A;  3J81 E;  1TS2 A;  2QEJ C;  2BCO A;  2Z4H A;  5KEE A;  2NVX B;  5ELC A;  1JB3 A;  1O7Z A;  3AU7 A;  2QKI C;  5C5L A;  3HOU B;  4C3I G;  3EJI A;  2EYF A;  5ISR A;  2B2U A;  4LMQ D;  1K8M A;  3TN2 A;  2RDF A;  1ICW A;  3URY A;  4IAL A;  3H3V C;  2F0T A;  4L8J A;  4RWS C;  1STB A;  1TII D;  1SJH D;  1SJE D;  4CKB A;  3M7N A;  1U4R A;  2BA0 A;  1GUW A;  2F0J A;  3T13 A;  1OXU A;  5ELB A;  1PDQ A;  3PO2 B;  1PZI D;  4WFN 3;  3U9S A;  1LTS D;  1HTP A;  1SYD A;  5IT9 L;  4TSS A;  2B2V A;  4KY5 A;  2PZU A;  1BCP B;  3VR4 A;  4BBS B;  3BVZ A;  3PUW A;  5DEH A;  5EKK A;  3SXH A;  3QWN A;  2AUK A;  4TKO B;  2B39 A;  2KQ3 A;  4PV1 C;  1PZJ D;  5C4H A;  2ICE C;  4WOR A;  4MN3 A;  1Y1V B;  1YNN D;  2E2I B;  1VF5 C;  1G2S A;  5M5W B;  1S5F D;  3HKZ B;  2AWN A;  5I6Y A;  5T1G A;  1PRT C;  4ILW A;  1I4H A;  2KA7 A;  1KDB A;  5IIF A;  3AB9 A;  4ZAI A;  3BDC A;  4UDU C;  2R6G A;  2GA4 B;  3U9O A;  3LWU A;  4G7O C;  3CU7 A;  1EEF D;  4V0B A;  5K36 H;  1TS4 A;  1KNA A;  1SNP A;  1CHQ D;  1YNJ D;  1J9O A;  3HOX B;  2IX1 A;  1Q3L A;  2HCC A;  1VMP A;  3IKJ A;  2J0T D;  3S15 B;  2KEC A;  1OXX K;  2DNE A;  5A2Q E;  4R8N A;  2K32 A;  1I4R A;  5HGT A;  2K28 A;  3TDQ A;  2WKD A;  4EVO A;  1LTI D;  2F3V A;  1JOK A;  4HAE A;  2HDL A;  5KND A;  5CV4 A;  3K5O A;  4ZLT F;  2NVY B;  3S1Q B;  2PZT A;  2FJ2 A;  3M85 A;  1JOQ A;  2LY7 A;  4CKC A;  1HA6 A;  1DZ1 A;  2EYL A;  1Q1B A;  2WP8 J;  4G4K A;  3HOZ B;  1Z47 A;  3E6Z X;  3I3C A;  1L0Y B;  1B9M A;  4MHE A;  3C2P A;  3OHX C;  4A3E B;  3HS0 C;  1V1O A;  5LL6 X;  4FXG C;  4A3I B;  1BBX C;  3I4M B;  3X3M A;  2KHS A;  1JC7 A;  3C46 A;  4QB4 A;  4FVM A;  2J4X A;  4RHS A;  1G2T A;  1PFB A;  4PQX A;  3KK7 A;  5C6A A;  1QJO A;  1T5E A;  3NBI A;  3ZYY X;  4HTH A;  2Z8L A;  1QOH A;  1D1I A;  3GTM B;  3E0J A;  5I4D A;  2JA7 B;  4XYQ A;  1LO5 D;  4J1M A;  3NTK A;  1SMY C;  2CVR A;  1H9M A;  4RCN A;  2K1B A;  5FLX E;  2Y0S B;  1TR5 A;  3DXJ C;  3W2D A;  5COY A;  2G9H D;  1RHP A;  1IYV A;  3M4O B;  5IGC A;  1TWC B;  2F4I A;  1CA6 A;  3EVQ A;  4OO1 I;  3NWS A;  1PXU A;  5FO8 B;  4P2C B;  2NN6 H;  2YU9 B;  5ELE A;  1EQV A;  4RA8 A;  3DWP A;  2K05 A;  1RD9 D;  3P7J A;  1VF7 A;  2XWB B;  1UNS A;  1QE6 A;  1MSG A;  1NUC A;  3S2H B;  5C3X A;  3VA5 A;  1SFO B;  1X3P A;  2MGS A;  4C1N K;  5IT9 E;  4MIU A;  1SYC A;  1KNE A;  4U68 A;  4RGN A;  3OPO A;  4BY7 B;  1B2T A;  1PRT F;  2SNM A;  3A54 A;  2EY5 A;  1O80 A;  2A68 D;  3GO5 A;  1TS5 A;  1LV9 A;  4RH6 A;  3L9A X;  1CT1 D;  2A74 C;  4G57 A;  3HZX A;  1JOO A;  3OWF A;  3UI2 A;  4RFB A;  5A35 A;  1S5D D;  3EQL C;  1EYA A;  1PFM A;  5I9P A;  2K04 A;  1Y1W B;  1FGB D;  1B9N A;  5C0X I;  2JE6 I;  4JBW A;  2B63 B;  3GTK B;  1AW7 A;  5EGT A;  4R9W A;  3FEW X;  1EOT A;  3MWY W;  1Q1E A;  5IGG A;  2NVQ B;  4RGM A;  1Y69 U;  2AQ3 B;  3NPP A;  2X6G A;  1M4V A;  2JP1 A;  2F0E A;  1I4X A;  3P20 A;  2OEO A;  4XQQ A;  1XYI A;  2ENB A;  1DYQ A;  3CRL C;  4Q0F A;  4I65 A;  5M5Y B;  1CZW A;  4ZYS A;  5A2Q L;  2WAC A;  3SVM A;  3R93 A;  4KY7 A;  3T4A C;  4RAU C;  2MPM A;  1WTX A;  3Q0A A;  5CR3 A;  3TZU A;  1JE4 A;  1G29 1;  5JEA H;  1H9R A;  2KUM A;  2HCI A;  2DNC A;  3PV0 A;  3CKI B;  3J80 L;  4K2K A;  3BZD B;  3S14 B;  2O4X A;  1QG7 A;  3IAY A;  2B2Y C;  2Z1C A;  2EY6 A;  3NQI A;  4U67 3;  3NP8 A;  5G3L D;  1CHP D;  5DNF A;  2M2L A;  1KAB A;  2K03 A;  4DU9 A;  3A7A B;  1F9Q A;  4C2M B;  5CBA E;  5D3D A;  4DNR B;  5IGE A;  5T1I A;  1SDF A;  2KCN A;  2D2C C;  2RVL A;  4DK1 A;  5E3F A;  5JEA J;  4DA2 A;  2A6H D;  1M8A A;  1KTK A;  4KN4 C;  1OXT A;  1QIL A;  2Q8R E;  1HFG A;  1DOM A;  2EPB A;  1R9T B;  3SHL A;  1JOR A;  1D5M C;  3TP7 A;  4OO1 G;  2EYM A;  4OIJ A;  4KD3 A;  3L7Z C;  4RHR A;  2H1E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...