1A3TA

Staphylococcal nuclease, v23c variant, complex with 2-fluoroethane thiol and 3',5'-thymidine diphosphate
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
135
structure length
134
Chain Sequence
LHKEPATLIKAIDGDTKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title Comparison of straight chain and cyclic unnatural amino acids embedded in the core of staphylococcal nuclease.
pubmed rcsb
source organism Staphylococcus aureus
molecule tags Nuclease
total genus 31
structure length 134
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1998-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1a3tA00
1KABA 2LKVA 5CV5A 5M9OA 4K5XA 4QF4A 4TRDA 4KY5A 5NUCA 1SYDA 2RDFA 3TP7A 4F8MA 1SNMA 1KDCA 3NXWA 5F2DA 5C3WA 2SOBA 3H6MA 2OF1A 3E5SA 4HMIA 4KJOA 1SNPA 3QOLA 1KDBA 3OWFA 1JOKA 4RKLA 2KQ3A 2EY5A 3MVVA 3NP8A 4B9WA 2F0MA 2NUCA 5IIFA 4HTHA 1EY6A 2EYJA 3RUZA 1A3UA 2PQEA 3PMFA 3D4WA 3U9OA 4EQOA 2ENBA 1AEXA 1F2ZA 2EYFA 3EROA 4E6IA 1U9RA 3MHBA 5KYIA 4J1MA 2QDBA 2SNMA 3TMEA 4EQPA 2SNSA 1STAA 2F0OA 2F0WA 1NSNS 4K2KA 3D6CA 3MEHA 1EQVA 4I65A 2EYMA 3SR1A 3QB3A 5IOCA 5IODA 3TP6A 4QMGA 5KYLA 4NP5A 4J6HA 1ENAA 1A2TA 4IUNA 3MXPA 4K8IA 5C5LA 1EZ6A 3SK8A 3SXHA 2F0JA 3VA5A 5J39A 1SYFA 2M00A 4DU9A 1JORA 1JOQA 1SYBA 2EYHA 5CV6A 1EY8A 5C3XA 3SK4A 1SNDA 5ISRA 4IZ8A 3BDLA 4ZQ3A 2F0PA 2PYKA 5JAVA 4K2LA 3T16A 2OEOA 3C1EA 2PZTA 3NHHA 4KD3A 3MZ5A 4K14A 5C4HA 3EVQA 3OSOA 4KTAA 4KY7A 2KHSA 2F0KA 3QOJA 3LX0A 2F0GA 2F0NA 2RBMA 3BDCA 4H7BA 4NMZA 5EGTA 2F0TA 4OL7A 1SYGA 1SYCA 1EY9A 2F0EA 3C1FA 3SHLA 3TP5A 4KJNA 5CR3A 5C4ZA 2F0UA 5I6YA 3DHQA 4ZUJA 1TT2A 3V2TA 5HURA 3OMGA 1SNQA 2F0LA 1KAAA 1EY5A 2F0VA 3DMUA 2F0IA 3P1HA 4K6DA 1RKNA 4R8NA 5DEHA 5KGUA 2WACA 1II3A 1EYAA 3NUCA 3ERQA 4N9TA 2EY2A 2EY6A 4KV6A 5IGEA 4DF7A 4LAAA 4NDXA 1ENCA 1F2MA 3SK6A 4K5WA 2OXPA 3NQTA 4NKLA 5I9OA 4HMJA 3HEJA 4KD4A 3NK9A 4K5VA 5IGGA 4EVOA 4WRDA 5EKKA 1EY4A 3ITPA 1SNOA 1F2YA 2PW7A 4QB4A 5KEEA 5CV9A 5EKLA 3S9WA 4K8JA 2F0HA 4PNYA 4PMBA 1STGA 1SNCA 5CV4A 1A2UA 3SK5A 2EYPA 5KRUA 5J1ZA 3OMCA 5IGDA 2O4XA 1A3VA 5IGFA 3T13A 5IGCA 3HZXA 1EYCA 2RKSA 5I9PA 1TR5A 1NUCA 4EQNA 5C5MA 1IHZA 2PW5A 4F7XA 5CGKA 5K5PA 4G57A 4WORA 2F3WA 1EY0A 4YIJA 3P75A 4B9XA 4DFAA 4DGZA 4RKBA 4ODGA 1JOOA 5CV7A 1STHA 2F0DA 5J22A 4ZUIA 5HGTA 2F0QA 2HQEA 4KY6A 2EY1A 4PMCA 2EYLA 3D8GA 1SYEA 4ME5A 1EZ8A 4KHVA 5CV8A 5CC4A 2F0FA 4N9PA 1STYA 4ID6A 5I6WA 1KDAA 3EJIA 3R3OA 2F3VA 5E3FA 5JOBA 3D4DA 4IALA 1TQOA 2PZWA 5DAUA 5IGBA 5E1FA 4S3SA 2PZUA 2F0SA 3TP8A 5C6AA 2EXZA 4MIUA 1STBA 1EYDA 1EY7A 5KIXA 1A3TA 1STNA 2EYOA
chains in the Genus database with same CATH superfamily
3A5ZB 1L0WA 1U5KA 2NZHA 1STEA 3U58A 3PIO3 2PQAA 1H95A 5BN3A 3E9IA 1F9QA 2EY5A 2EOTA 1B70B 5M3FH 1DYQA 1LTBD 2B2YC 5IP7H 4PV1C 3RUZA 1A3UA 1QNUA 1RTNA 4LF5L 1N36Q 4C3IH 2YYZA 3HKSA 1O7ZA 1RTOA 2MO1A 3TMEA 4B3SQ 3S17H 2UUCL 3BZCA 2GA4B 2BOSA 4K0KQ 3EFXD 3SR1A 3TZDA 5IYCG 3BZDB 1EWCA 2BA0A 2B8GA 2HDMA 3MXPA 2O5IC 1HXYD 2HD3A 1S40A 4JI7L 1J9OA 4IOAA 1E1OA 3RMHA 3MAQA 2L1BA 2CQAA 2HT1A 1VS0A 2R7DA 5FLXL 4KY7A 3HOVB 3DWQA 1VQFA 4NMZA 1BCPC 3WWVA 4LK1C 4IPHA 2UXCQ 4A3IG 3E6ZX 1I4GA 1TS3A 2JEAI 1XTDA 1PH7A 3D6WA 2AUJD 1Q1BA 1Y8OB 1ILQA 4NKLA 4A3BB 1E22A 4RGTA 2IX1A 5EQ0A 2E5LL 1ONLA 3NSWA 1SRUA 1SNOA 3RLNA 3ICEA 3MXNB 5HGQA 4PNYA 2F0HA 3S16B 1GM5A 4KN4C 3K58A 5IGDA 3ER0A 2QF7A 2UUBQ 5M3MG 3G48A 1WD1A 1TR5A 5K5PA 4LWCA 3HOUG 2ZXRA 2IX3A 1JOOA 2RA4A 5T1GA 4N8X1 4OO1H 5M5YB 3LNNA 2NTSA 2H4OA 1TWFB 3AB9A 3QWNA 1QVGA 2ALYB 5FLMH 1VQEA 3NWTA 2A69D 4N9PA 4P71A 1CA5A 5IT9c 4OX9Q 4A3GG 5FJ8G 1HFGA 4IALA 2RQXA 3MXGA 3Q22A 2WINB 2VY3A 1EY7A 3KLSX 1U0LA 1J5EQ 1HNWL 1IYJB 1TWGH 3BG3A 3HRZC 2X69A 1Q8IA 4IPDA 2XWJB 3I4NB 2SOBA 1Y1VB 2M2LA 2Z4IA 4A3CH 1DJRD 1V1QA 2FHTA 1YZ6A 4DR4Q 3CCVA 3NENA 1E1TA 2D0PA 1EFWA 4XQNA 4JV5L 5CYUA 1L1OA 4DV7Q 2C5CA 1N32Q 1NY4A 2JA6H 3K8AA 2ATWA 4IUQA 5E4WC 3U4VA 4DV4L 2XGTA 4A3JG 4MHEA 1WTXA 1EYGA 2SEBD 2KCNA 1KD1C 5C44B 1P8LA 3A8IE 4TVAB 1XMOL 4DAYB 1K3RA 1N34L 2VUMH 1O7IA 4AH6A 1A62A 1YNJC 3JC66 5JAVA 4YWMA 3OTOL 2XSCA 4C1NK 4K14A 1LTID 3PO2G 2JQOA 1UUPA 1S72A 3HOYH 1CUKA 1MHWC 1MJEA 1R9TH 1VQ9A 2CH4W 4ILWA 4R4TA 3PIOA 4BY7H 3S24A 1FJGQ 3OMGA 1L2FA 1KAAA 4GOPB 1X56A 4A75A 2F4IA 4C3JB 1GVPA 4TSSA 5IT9E 2EY6A 1G8ZD 2XRSD 5C4XB 3RLOA 4DR1L 4R4OA 4M8AA 3T1HL 1ZYRD 3RZOH 2N49A 1OXTA 2NVYH 2LFNA 3GTKB 4RHRA 1SE8A 5KEEA 2NVXB 2BDOA 3F8TA 3T1YL 3CP0A 2JA5G 2Y0SB 3PGZA 1I94Q 5M5XB 2EYPA 1PRTB 3K57A 1A3VA 1F9SA 3VYUA 5I9PA 2MNAA 4EQNA 4B3RL 2I5LX 1KL9A 3GTMH 1PTOH 3P75A 4PMWA 4DFAA 5GADC 5HGTA 1SROA 1IL8A 3STBC 3ZJYC 4H0LC 1VQ5A 5CV8A 5CC4A 1XPRA 3HP3A 2A6HD 5EJWA 1KDAA 5IY0A 3R3OA 1PH1A 3HOWB 1WOCA 5IYBG 3I4MH 2F0SA 3KUPA 1HQMC 3BU2A 5G3LD 4HAEA 3I91A 4KY5A 2KVMA 4CDEC 1J6QA 1KDBA 5AJ3L 1PH6A 4IUVA 3PMFA 2Z6KC 4O42A 1F2ZA 2K1BA 2ID0A 1HZAA 4QJFA 3G71A 1JE5A 4XXEA 1WTOA 3IKJA 3J7A5 4L5RC 5FO7B 3VR4A 4JCVE 4A3EB 3SXHA 2TSSA 4HSPA 1G51A 4RGOS 1SYBA 4DR6L 1EY8A 3HOUH 3FHWA 2HIVA 2PYKA 3H0GG 3CCJA 2PZTA 2HCCA 3MZ5A 4I7ZC 4N8FA 1PH4A 2KHSA 2L55A 4OL7A 1RHPA 1TIID 2OT2A 5C4ZA 3TSSA 4DV6Q 5FJ8H 4Q5VA 3VR5A 3J81j 3E3XA 1N33L 1IBLQ 1FGBD 1ET9A 1SJHD 4XQJA 1ASYA 1A6XA 4B08A 5GROA 4J15A 4POFA 1PYSB 4KD4A 1PMRA 4WFN3 1TKWB 2LXKA 3GTJB 2D2CC 4BY1G 3VDYA 2JA8G 1PTOF 1B53A 1VDZA 4JYAQ 1YVCA 4YCVA 1E24A 4DA2A 3K59A 1K28A 4A3DB 4LFCQ 5IGFA 2VQEQ 2CW0D 2KENA 2D9UA 2MJ8A 1NUCA 3M3YB 2PW5A 1GUGA 4QY7A 2NBFA 4DAPA 3I73A 4L5SA 1EY0A 3TRZA 4J8QA 3CCMA 4ZUIA 4X64Q 2IW3A 3CCUA 1UE6A 2EYLA 3DWAA 4QIWE 2Q2TA 2A69C 2IY5B 1RJTA 4QGUA 3KBGA 2VB3X 4NXNQ 3PO2H 1SLJA 1YNND 3AFPA 3OOCA 5IGBA 5DNFA 1H9SB 1JC7A 1EYDA 1HTLD 1LO5D 5KIXA 1PH5A 4FYDA 2YTVA 4TRDA 1AW7A 2HHHL 1SYDA 4A3LH 2FMCA 4F8MA 1IBML 5F2DA 1VQ8A 2Q8RE 4X6AH 1B9MA 5BN5A 1PV4A 3K5LA 3KJPA 1WTHA 1TWFH 4YHHL 1EOTA 5M3FB 2PPBC 3M4OH 3S2DH 3U9OA 5BR8L 1CFMA 1DONA 5LMNL 3I2ZA 1PRTD 2D62A 2MP1A 1U9RA 3FDTA 4LUOA 4C3IB 3J7AV 1RD9D 4UHVA 1YITA 4OIKA 3H3VH 1FD7D 3S1QH 2A1AA 4R4CA 3QB3A 1PZID 3GDEA 2Q8IB 4DK6C 2H5XA 1G6ZA 3V96A 2F4VL 4JI4Q 1L1OC 3C46A 2LMCB 1YI2A 3OW2A 1IW7D 1C48A 4KD3A 3PIP3 3NHHA 3CCRA 1HNXQ 1HZ9A 3FMCA 2G9HD 3LX0A 5EGTA 3WOFA 2OTJA 3Q23A 4DV2Q 1SYGA 2F0EA 2L5TA 1PH8A 3VYRA 3VA7A 2E76C 4NB3A 5IYBH 1SMYD 1LTSD 5DEHA 3DMUA 2F0IA 3UDXA 1N9WA 3I4OA 1K8MA 4X62L 1LTTD 4KKUA 5ELCA 2KJXA 5KNBA 2AWNA 3AFQA 1C9OA 4HSVA 1M1KC 1XX8A 3HOZG 4K5WA 1ZYRC 2ZJPA 2IHEA 4DR3L 1C4QA 1X32A 4WRDA 3VYSA 4AYBG 2OQKA 4QB4A 3RD4A 5CV9A 3K5OA 2QEJC 1HHVA 3ERSX 1CA6A 3C2PA 1WJJA 4HJ7A 2ZTDA 2RF4A 3MFGA 5GQOA 1VQHA 2R92G 3S2HH 2F3WA 4YIJA 3F2CA 1H9MA 1STHA 3R2IA 2DN8A 3BZKA 2WB1G 3W2DA 3A55A 4LF6L 4R9WA 3GTKH 1XMOQ 3H0GH 4KN7C 4DNRB 2A6HC 1XWEA 2NVXH 3ND9A 2VXWA 2K5DA 1IZ6A 5A35A 2FINB 2PNHA 2F52A 3OTOQ 3CC2A 4JBMA 1NJIC 1KAWA 1K8AC 1SE4A 5CV5A 1TWGB 4FXKC 3CU7A 4CBVA 4RWSC 2QDLA 1S5BD 1B2TA 2G9DA 3OWFA 2NWGA 2XTIA 4B9WA 4JPBW 3G6JB 2CFMA 1SSOA 4P75A 4CHTB 4H44C 2ENBA 4ZK9B 1AEXA 4BY1H 2JA8H 3F2BA 2JA6B 5I4DA 1Y1WG 4G4KA 1A8VA 1EQVA 5IODA 5IOCA 4QMGA 4UPAA 5LMNW 4NPSA 5IWAQ 1BBXC 1A2TA 3M4YA 4IO9A 1UE5A 2EYHA 4LUVA 1CKOA 2BA1A 2KCCA 1D5MC 2XWBB 4ME3A 4ZQ3A 4UY8C 2VUMB 2DY8A 1VQPA 2EDGA 1I6HH 3KYHC 3BDOA 1GKHA 5CMDA 5C4HA 4DUZQ 2C9OA 3CCSA 2XRQD 4HIDA 4LJZC 1GUWA 2GN5A 1EY9A 1HTPA 1FNWA 1DZ1A 5JPMC 2D0OA 1JJGA 3K81C 3F1ZA 1UAPA 5A2QL 4BY7B 2L12A 1C7YA 3FPUB 2NN6I 4MNOA 1BO0A 3ERQA 3KLSA 1A63A 2Y0SE 4A3KG 4Y7NH 2I46A 4BBRG 1V1PA 1VMPA 2VZAA 2YU9H 3RZOB 3HEJA 1AN8A 1Q46A 3I8ZA 4HJ5A 1F2YA 2CWPA 4DPGA 2JEBI 4L6TB 4V190 1B9NA 4DR2L 5C3EG 4PMBA 3LGJA 2QKIC 1S4ZA 3OMCA 1FVIA 1U4LA 2WP8J 1UEBA 4RHSA 1X55A 1AZQA 1BNZA 4DV0Q 4LFBQ 5CBEE 3GTMB 3PIPA 1PTOB 4CJ2C 4DGZA 1K0RA 1B3AA 1CQFA 4KY6A 3NBHA 1XYIA 2BDNA 2ZJQA 2CKZB 4WJ4A 1SYEA 4DKAC 1BXTA 4X3TA 3J81L 1L0XB 4B3TL 1XMQQ 4RAUC 4C2MH 1CZWA 2B39A 4DK1A 2EE1A 4RGNA 4G7OC 1EUJA 1STBA 5LHY1 5C4JH 2PI2E 1A3TA 2Q2HA 1J8IA 3BJUA 5I2XA 4K5XA 4A3IB 1GXDC 4RGMA 2Q8TA 4FF3A 3PF4A 3NXWA 1HFNA 1BBWA 3PUYA 3H6MA 2OF1A 3E5SA 1QWYA 1PA6A 4IFDI 4OHJA 4CJ1B 1JOKA 2KQ3A 2A19A 1EY6A 2K5QA 2R6GA 1MKHA 1XNQQ 4EQOA 3EIVA 3HOXG 3MHBA 4PZ7A 4JI3L 1VQOA 5JJLA 2QDBA 2SNMA 3R93A 2E8GA 3BYYB 4RCNA 2KBNA 3R8BA 1CI3M 1E0BA 1HR0Q 3AYHB 4NP5A 5M3MB 4G7HC 5IIFA 5KNDA 3URYA 5AFWA 4APVA 4QIWB 2FMMA 2R92H 4FVMA 5JEAG 1QCBD 3HOUB 4ALPA 1CSQA 1F2LA 1Q8KA 4K2LA 4A3MG 2JA7G 5D14A 1Y69U 2LSSA 3K80C 2FXQA 4IPGA 3PUZA 4BS9A 5GAEC 3K0YA 4GNXA 3A5UA 4A3GB 2VNUD 3CPFA 1WTVA 4GN5A 3P1HA 2ZTEA 4X66L 1RIPA 1EYAA 3L9AX 1BCPF 2UU9L 3KF8A 3J81i 3OWEB 3G4SA 1BR9A 1QUQA 4OWTB 4FXGC 3GP7A 3NK9A 4K5VA 4R8IA 4LF4Q 4IPCA 1MIUA 3NBIA 3ITPA 1YBYA 5DM73 5JVH3 4LF7Q 2R7ZG 2XVSA 4NXML 3IFTA 1JCKB 1IKLA 1CKNB 1PDQA 1Z9FA 1PYBA 2PMZE 1SNCA 1O78A 1GUSA 2K03A 1TS2A 3OIPA 1Y1WH 2Z1CA 4A3JB 3G7LA 4AYBE 4GN3B 5C5MA 4JI8Q 4WORA 4DR5Q 4KK7A 4LF9Q 1W3SA 4ZLTF 1MGSA 3M4PA 2UUAL 1SEBD 4BA2I 3AMUA 2YTXA 2A6ED 2WKDA 1KIXA 1XNRQ 1QJOA 5LL6X 2UXDQ 3D4DA 3PO2B 2OTLA 1VQCA 4YY3L 4XYOA 1HUMA 1H9RA 2RDHA 5JEAJ 2KEEA 2WB1E 4XQQA 2LKVA 4Y52H 1Q90A 3TP7A 2PO4A 3ND8A 4CKBA 2CHBD 3FRPB 4A3KH 2JYOA 4BBRH 3KLWA 3Q24A 2LY7A 4HJ9A 1RDPD 3B6YA 3UDGA 4DR7Q 2PQEA 3M4OB 3S2DB 2KOLA 3M7GA 3SGIA 3HFZB 1ZXTA 4DV5L 5C3EH 3A56A 2MQHA 2JA5B 4GS3A 3M4QA 1PTOD 4FXDA 3S1QB 4IN3A 1TY0A 1W6KA 3S14H 3KF6B 3N6RA 4DU9A 2M00A 2MHVA 5CV6A 5FLXc 4IOCA 1EIGA 1UWVA 2I0QA 3T16A 3RLFA 3IL8A 3PV0A 2E2JH 4WJWA 2F0KA 2IPKD 5EPLA 4YCWA 3DXJC 3L7ZC 3L2PA 3JAMc 2R3ZA 2B2VA 4JBWA 4JI1L 4PZ6A 2K5WA 2BE5D 1SNQA 1X3PA 2VQFL 4AIMA 3M9BA 1PLFA 1KXLA 4O1NA 1ENCA 2B3GA 4UP8A 1TS4A 5JPNC 3HOVG 1LT6D 1Q81C 4UAIA 3PSIA 4BBSH 4EVOA 4DXGA 2XN9C 4LF8Q 1K73C 2MGSA 4EQ5A 2N78A 1R4QB 1BUVT 3HOXH 2A68C 3KK7A 4KHPQ 4JI0Q 1ESFA 1X54A 2B63G 2DNEA 1LTAD 2KHJA 2K33A 3S2HB 1L0YB 1UNSA 2HQEA 1F77A 4ZAIA 4R4IA 1JWMD 5JEAH 3D8GA 1JJCB 3VR3A 4GKJQ 3E0JA 4B3ML 1STYA 3X3MA 3H0GB 2M9VA 3SE0A 5FLXE 2MPMA 1V8QA 5C6AA 2K5VA 2EIFA 1IBKL 2AMCB 3RZDH 3DEOA 5J3BA 4QF4A 3H09A 1SNMA 1KDCA 4GN4B 2B2TA 3JAME 5IYCH 1U4PA 2J7ZA 4X65Q 2E2HH 1RL2A 1OXSC 2A5HA 3X3NA 3D4WA 3KJOA 3MXNA 3EROA 1KRTA 4E6IA 4BY1B 2JA8B 4WJ3M 4X3KA 2R7ZH 1IL2A 4EGVA 1M4VA 1EFID 2WAQG 4RG1A 3PO3G 4AQYL 4C3HG 3I4NG 4CGYB 1HH2P 1TWAB 2XIWA 2HQLA 4I65A 4JC0A 5D65A 4A3IH 3A7LA 3V05A 4CJ0B 1TWHB 3SK8A 1DOLA 2NVQH 3VA5A 4JI2L 1SYFA 2Z8LA 5EPJA 1R4PB 4A3FG 3BDLA 3EBEA 4IUPA 1HNZQ 1ILPA 1CZGA 5M5WB 3AU7A 4V0BA 1I6HB 1NBWA 1KLGD 4GKKQ 5ELNA 2ZT9C 3QOJA 2RBMA 5EAYA 5JJIA 1GHJA 3C1FA 4CKEA 4IUUA 2F0UA 3BVMA 2B2UA 5ELFA 4DV1L 5KGUA 3NTKA 1GOZA 1V9PA 1D8LA 1YJNA 3TEHB 5M3MH 4FF1A 4Y7NB 1CKMA 3DUZA 4LFAL 5LMUQ 3H94A 1BDOA 1JB7A 2YU9B 2F1MA 4RCOA 3BS1A 5EKKA 4JI5Q 2KA7A 1I4HA 3DM1A 5E4XA 3TN2A 4GNXC 1S5CD 1JWSD 1Q3LA 1BCPB 1QG7A 1EQTA 1ZKOA 5C0XI 5J1ZA 4DN4M 4A3GH 5C4XG 1S5DD 4OXPA 3PCOB 5H1SE 2UXBL 4HIKA 3HKZG 4F7XA 1WCMG 4JI6Q 3FP9A 4DAYA 4DUYL 3I7FA 1PFMA 1VQKA 1FNVA 2ZM6L 3GTQH 1UE1A 3DM3A 1KQSA 3VYTA 1EU4A 1Q1EA 1Z6HA 1VQNA 4DNIA 2PNRC 4C2MB 1S3OA 1PFBA 3I3CA 4EX5A 1BOSA 3A54A 1VQMA 5C4JB 1KHIA 3NWSA 4GOPA 4A3JH 1ESRA 4LF5Q 5C3WA 1U4RA 4Z9CB 1YHBA 2UUCQ 1EQQA 3OYYA 3HOZB 2EYJA 1OXUA 2PMZB 3K7AH 4LUZA 1WFQA 1ENFA 1QE6A 1VQJA 4PG3A 3CCLA 1K9MC 4JI7Q 4AYBB 1HZBA 3GTLH 2SNSA 3ULLA 3K0XA 4YWLA 3BVZA 1FGUA 5FKAC 1MJCA 4ZKBB 4A93G 2VS1A 3GV6A 5C5LA 4IUNA 1N36L 1T5EA 2RSOA 3S1NB 2K4KA 1A15A 2R92B 4B3SL 1Q82C 3GTGB 3FKIG 3KDFB 3T51B 4XTCS 4K0KL 2DJGC 3N52A 2WB1B 3PQIA 4H7BA 3KOJA 3O13A 2F0TA 4RMFA 3SHLA 3DEPA 3TP5A 3TREA 3CAMA 3U4ZA 3MA2B 4A3EG 2E5LQ 2XNAC 2JA5H 1D7QA 3OHXC 2JP1A 4MZ9A 1D5XC 5IE8A 1GUTA 1W2BA 4X3SA 1EL0A 4HCSA 5I9OA 1NNXA 2UXCL 1SMXA 3VR2A 3SEBA 1EY4A 1YHQA 5C0XG 4OWWB 2PI2A 1BF4A 2B2VC 4L5QA 4OELB 1Y1WB 5IGCA 1PH9A 3PO3H 4C3HH 3GTPH 3PF5A 4HCEA 1VCIA 3UI2A 4ODGA 4OWXB 1CSPA 5ELDA 1RCVD 1HNWQ 4GLVB 2UUBL 4A3FH 1JB3A 4A4IA 4KHVA 3UE0A 1CHQD 4A3DG 2JE6I 4ZKCB 3T53B 2V1CC 5D3DA 4JV5Q 3CRLC 2AQ1B 1HZCA 3RN2A 1QVFA 3T56B 1G291 4PQXA 4DV4Q 4OX9L 3FEWX 1SNPA 2N55A 4QUFA 4A3KB 2NZ1D 4BBRB 3UDFA 1HCZA 4OO1I 3J80L 1PFNA 1PFSA 4X3UA 1LACA 3CXCA 1HQRD 2RSNA 2CWAA 2ES2A 3GV3A 2BH2A 3CCEA 2JN4A 1N34Q 5KYIA 4J1MA 1I5FA 3CQZH 3CKIB 3DWPA 3RR5A 1PH2A 1I4PA 4UDUC 5C3EB 3D6CA 1EOVA 4DR4L 1DM0B 3AQQA 1AP0A 1I50H 2B2TC 3W3AA 5DLQE 1MBYA 4DV7L 1N32L 1ENAA 4L63B 1EZ6A 3S14B 2VW9A 1JORA 1QB5D 1WCMH 1YJWA 5IP7G 2WAQE 1G2SA 1JT8A 4JW0A 2AQ3B 2OCEA 2KUMA 2E2JB 4DR1Q 1QILA 3T1HQ 1LT3D 3U50C 2ICEC 5CR3A 2MO0A 2EJFC 4ZUJA 2K28A 1H9SA 3V2TA 3RN5A 1TWAH 1Y14B 5EBDA 4R8NA 1E7ZA 2NVTH 4N9TA 1G6PA 1B8AA 1LTGD 1RF2D 2EY2A 2A8VA 1TWHH 2PQAB 3T1YQ 3QO2A 4POGA 4HJ8A 1ASZA 4FP5D 2FFKB 1FJGL 3S1MH 3OPOA 4BBSB 5M5WH 2MFIA 4B3RQ 1SR3A 2AHOB 1QZHA 3MTSA 1NMFA 1FL0A 1TY2A 2B2UC 1X3EA 3HOXB 2H1EA 1NR4A 4DK3C 3QG1A 3J80i 1IKMA 1VQ4A 1E3PA 5COYA 4B9XA 4RKBA 2B2WA 2ZTCA 1SDFA 1I94L 2AQ2B 4RFBA 1OO9B 1DD2A 1EZ8A 4XT3B 3EJIA 3TS0A 2E75C 2Z0SA 1TQOA 5DAUA 4S3SA 5AJ3Q 4GZYC 2I07B 2EJGC 5JJZA 3ZYYX 3RZDB 1Y8PB 2CW0C 1XPUA 1RODA 2GVBA 1YHAA 3ULPA 4UP7A 4OO1G 1SJED 1NTGA 3A74A 1AH9A 1YNJD 3J7AF 1B1ZA 3NP8A 5FLMG 1LUZA 2E2HB 1PZJD 3Q6SA 2HDLA 1LYLA 3J7ZC 2IHFA 1LT5D 5FO9B 1T5XD 1B3QA 4DR6Q 1NCVA 5JJKA 1STAA 5L37A 2R7ZB 1YNNC 1EWIA 4GOPC 3L3OC 1GHKA 3CMAA 3DLLA 1EEFD 1ML0D 1GUOA 2K5NA 1WD0A 3UDIA 1MSGA 2F0JA 2NVQB 3TZUA 3KFUA 2KEDA 1C8CA 1KTKA 1W6JA 4IZ8A 1BQQT 4F88A 2UXBQ 4IJLA 1TU2B 3HOZH 1N33Q 3C1EA 2K14A 3FPPA 3OSOA 2JK8A 4H13C 1JICA 4NW2A 1TWCH 2VL6A 5HY6A 1PRTC 3NTIA 2RCNA 4JBJA 2EZVA 2I5HA 1EY5A 1AE3A 3I90A 4K6DA 4DV3L 1PYWD 3G6EA 1DGSA 4OGQC 4LAAA 4IURA 3S1NH 2N88A 3MWYW 2QA4A 3LWEA 3STBD 1LT4D 4DV6L 3IFDA 3GTGH 2KCMA 1L1OB 3HOYG 3QIAA 1PHJA 1IW7C 2WIIB 1B44D 1IBLL 4CDFC 2K6AA 4BXXG 2NN6G 1MD2D 3L0OA 2BCOA 1SMYC 5EKIA 2E2DC 4BA1I 5I2YA 1HRJA 4RH6A 1VF5C 3MXUA 2ICIA 4JYAL 2Q2IA 1NAPA 3J81c 2EQSA 1KNEA 1V1OA 1K3BC 4LFCL 3GTQB 1YNXA 2E2IH 2VQEL 1VQDA 4I7AA 2HHHQ 1IBMQ 2NB0A 3A8KE 2AWOA 5E3FA 1CQVA 2NTTA 1ICFB 4HJAA 4X64L 5IT9L 3TBIB 4YHHQ 1G91A 2JA9A 5BR8Q 5M9OA 5A2QE 1G2TA 1T9HA 5LMNQ 4HR7B 4TQUS 2R93G 4NXNL 4KKTA 1ZEQX 2WFWA 2NUCA 4DNTB 1AE2A 1Z7TA 3K7AB 3GTOH 3I4MG 1Y8NB 3OIQA 3LWUA 1U4MA 1D1KA 1DCZA 1GUNA 2F4VQ 1WYDA 4XDXA 4R1JA 3GTLB 1A0IA 3A0JA 3MEHA 4U673 3JAML 2KCTA 3E9HA 3S1RH 1OXXK 3TP6A 4IFDG 3PUWA 1X3GA 3ULJA 5J39A 3W5OA 1O7LA 2B63B 2MUYA 4KMUC 4YCUA 1LLRD 2F0PA 3W1BA 2OEOA 3I4LA 4X62Q 1PZKD 1PXUA 1WTRA 3TDQA 4LMQD 1EU3A 2Q2UA 2F0GA 1V43A 2DGYA 4KJNA 3J81E 4XYQA 3DHQA 3VR6A 4JOIA 4DR3Q 4JI4L 5HURA 1MI2A 4OEMB 2KECA 1IYUA 1HNXL 3H3VI 3MFYA 1F9RA 4IQZA 4NDXA 4YWKA 4DV2L 1K0SA 4ZYSA 3EN2A 4R4QA 1I3QH 5IGGA 4QUCA 1ICWA 1HJPA 1VQGA 1VQIA 2AKWB 1MSHA 1BKBA 2C35B 3D3RA 4K8JA 1EIFA 1UEAB 5TSSA 1EEID 4LF6Q 3T13A 2ZJRA 2EJMA 2WKCA 3HZXA 2RDGA 2WAQB 3PO3B 4C3HB 2JSOA 5CGKA 2QCPX 3GTPB 1XTCD 2J0TD 1KRSA 1KLUD 1TXYA 2N8NA 4ULLA 2EY1A 4G7ZC 1KNAA 2HUGA 1VQLA 4A3FB 2GVAA 3CC7A 4JBKA 3JAMi 5LL6S 1TS5A 4IFDJ 4M1UB 5CORA 2A73B 1YEZA 5BN4A 3RNUA 2EYOA 4OIJA 1KABA 4A3BG 2B2WC 4HIOA 4RKLA 3CW2C 4KHZA 1K83H 2L15A 4C56C 4IUTA 3HG9A 4MTNA 2EYFA 4A3MH 2RHSB 2BH8A 2JA7H 3OW7A 1CKNA 3PUVA 1NMGA 3CQZB 4BXXH 2NN6H 4A3LG 4XT1B 1GO3E 4CKCA 2EYMA 2WV6D 5K36G 1I50B 1HA6A 4J6HA 1SFOH 1X3QA 3HKZB 3MC0B 5ISRA 1WCMB 3SK4A 2QILA 2DY7A 1VMCA 2IT1A 2PCFB 1F9PA 1QOHA 3GD7A 4KTAA 2K04A 4PMCA 2EXDA 3BDCA 5IWAL 1SYCA 2NZOA 1XJVA 5FO8B 1LM0A 1BVSA 1RKNA 3CRKC 1II3A 1Y1VG 3NUCA 2NVTB 5FOBB 1OTCA 4DUZL 1CTMA 3KBXA 4DR2Q 3W1GA 2SDFA 2OXPA 2R93H 2Z6BA 3TQYA 2IWHA 3C3LA 3S1MB 1DXMA 4PZ8A 1H9JA 1SXTA 1Z47A 2K50A 4JK1C 1S5FD 1WI5A 1X6OA 3S15H 5C44G 3CPWA 2F03A 2KHIA 2K52A 2NYZD 3MEFA 4B3TQ 1HA5A 4IFDH 3CD6A 3KF6A 4A93B 5CBAE 1O7YA 1SN8A 4LNQA 3TS2A 2F0FA 3FKIB 3AEVA 2ZXPA 4DV0L 2F3VA 5T1IA 4LFBL 4O0AA 5EPKA 1UE7A 1FNUA 2K7VA 4MIUA 4C3JG 5ELBA 1STNA 5EBCA 1VQ6A 2B8FA 2CVRA 5FK9C 4DXFA 5NUCA 1X65A 3M7NA 1XMQL 4KLKA 4JI3Q 3QOLA 1LABA 1VQAA 4HTHA 4DV3Q 2K75A 4K6LA 1QVCA 2A6EC 2Y0SG 3D4RA 4BWGB 4C1NI 1JQYD 2HIXA 1IXRA 4DK0A 1CM9A 2K01A 2F0OA 1H9KA 4IJHA 2RCFA 4P2CB 3CCQA 1XPOA 3I72A 3ONAB 3WOEA 1QZGA 1XNQL 3K6OA 2L0CA 4KI0A 2DNCA 3A7AB 3EQLC 4FO2A 1SNDA 4MN3A 4X66Q 3HOVH 3HOWG 4QCLA 3K5NA 5JOBA 2UU9Q 1HR0L 3NELA 1TWCB 3BVGA 4CDDC 1VQ7A 2F0LA 2R61A 4UP9A 1D6EC 1LTRD 5E7NA 4KV6A 1PTOC 4NXMQ 4DF7A 1F2MA 3SDZA 3T4AC 4A3BH 2VB2X 2B63H 4A76A 2CQOA 4HMJA 4JVZA 2X6LA 4FNFA 1WTWA 2J4XA 4ZRZA 4XIGS 2Z4HA 4JOIC 3S9WA 1B50A 3S16H 5JVG3 1D5ZC 1Q12A 2UUAQ 1EIYB 1HPCA 1YJ9A 3P7JA 2AUKA 4LF4L 2BE5C 1EYCA 1M90C 4U68A 5K36H 4LF7L 3K5MA 4YY3Q 1K8GA 5M5YH 5J22A 2F0DA 1PH3A 1SAPA 4HN7A 2FJ2A 4ABNA 2RHQB 2E2IB 3KLRA 2B2YA 4JI8L 3P20A 1XXGA 4DR5L 4LF9L 3TP8A 3S17B 1GJXA 3U9SA 2R7FA 5IYDG 1DOKA 1XNRL 2HCIA 4Q0FA 5IP9G 3I4NH 2RDFA 3A8JE 1Y1VH 2YV5A 2B29A 2UXDL 1V1PB 4HMIA 2O5JC 1TVXA 4ZCKA 1VQBA 4DV5Q 3CHBD 3MVVA 2OWOA 5KNCA 2QEXA 1I4RA 3GTOB 2ASBA 3IRBA 4P72A 4EQPA 2D5DA 1NR2A 5GAHC 1NSNS 5C44H 2JJQA 1CT1D 3Q0AA 1BBUA 1OXVA 1B7YB 3S1RB 5KYLA 4DR7L 2X6GA 4K8IA 3PUXA 4RA8A 3H91A 1O80A 4JI1Q 3NBHB 2VQFQ 1E2ZA 5ELEA 1J5EL 5G3LF 4HEDA 1CK1A 3UE1A 2A74C 1BCPD 3CC4A 3CF5A 4O2DA 1P16A 5I6YA 3K7UC 4L5TA 1DOMA 4JG2A 1Q7YC 4C3JH 2WACA 4L8JA 3IAYA 1HR0W 4QQBX 2DJFC 1CHPD 4P74A 5C4XH 4QL5A 5IGEA 1JJ2A 3R2TA 2L4NA 5C0XJ 3E0EA 2G5DA 1D2BA 3SK6A 3NPPA 3SVMA 5M3FG 3NQTA 2L9HA 2F3IA 2N3SA 4FF4A 1JE4A 2Z9HA 1C0AA 3CMEA 3NQIA 1I3QB 2QGQA 4C3IG 2PW7A 1M8AA 2QW7A 3D0FA 2L11A 2IJ0A 2JXMB 1FYCA 1STGA 2YTYA 4GLAC 5CV4A 1EWHA 5M5XH 1A2UA 1EQRA 3SK5A 5KRUA 2RVLA 2O4XA 1E2VA 3Q8DA 2IL8A 3QR8A 4B3MQ 1IHZA 4LF8L 4DAVA 4G57A 2P5ZX 3QJYA 2K32A 1IBKQ 2F0QA 2ZXOA 1WTQA 3KDFA 4ME5A 1I6VC 2E74C 3J7YW 4KHPL 1E2WA 4ID6A 4JI0L 3FVQA 3HOWH 2K05A 2DUDA 3BYTB 1WVLA 1EIHA 2PZWA 5E1FA 2PZUA 4GNXB 2EXZA 3H3VC 1S5ED 4MTKA 3I70A 1KC8C 4GKJL 2I5MX 1AZPA 1SE3A 3KF8B 2LXJA 3J80c 4HIMA 4KJOA 4H02A 1QUQB 1X9NA 4A93H 1IYVA 4AQYQ 5GAGC 2F0MA 3I55A 1YIJA 1K83B 1I4XA 3HKZE 3FKIH 3HOYB 4JI2Q 2LS01 4A3MB 5D3IB 1X3FA 1R9TB 2JA7B 1D1IA 4KKSA 2F0WA 4K2KA 4X65L 2EVBA 3F2DA 4A3EH 4LW1A 1I4QA 3NTHA 1SFOB 2V4DA 1JOQA 5C3XA 1JR0D 2CCZA 3H15A 4DV1Q 1PVOA 2NVYB 4FDBA 3EVQA 2EPBA 2F0NA 4F87A 4LFAQ 5C0XH 3I56A 1NE3A 1TT2A 1SBBB 3EA6A 1VF7A 2A68D 1AFPA 2F0VA 1HNZL 3D31A 4OONA 1ET6A 5IYDH 4A3CG 4GKKL 5IP9H 3HGBA 1WTPA 1PRTF 1LTLA 3F2UA 3NE5B 2K5HA 2O2LD 3GTJH 2R93B 1SE2A 4FF2A 2JA6G 3M85A 3J80E 5EKLA 3GQBA 2OQ0A 4P73A 4DUYQ 1JMCA 3I4MB 5LMUL 2ZM6Q 4A3DH 3S15B 1B4OA 5DM63 4GLXA 4CDCC 1LV9A 2RKSA 3M3YH 4JI5L 4DAMA 3HS0C 2VUMG 4BBSG 1QNKA 2CH4A 5CV7A 2IX0A 1K8OA 1HUNA 3NEMA 4TKOB 5I6WA 2TMPA 3WDNA 4JI6L 1GD7A 4BY7G 1N8RC 2Z6KA 3GO5A 5ELOA 1FR3A 1JWUD 1Q86C
chains in the Genus database with same CATH topology
1STEA 3PIO3 5BN3A 1F9QA 2EY5A 2EOTA 1DYQA 1LTBD 2B2YC 4PV1C 3RUZA 1A3UA 1QNUA 1RTNA 2YYZA 1O7ZA 1RTOA 3TMEA 2GA4B 2BOSA 3EFXD 3SR1A 3TZDA 3BZDB 1EWCA 2BA0A 2B8GA 2HDMA 3MXPA 2O5IC 1HXYD 1J9OA 3RMHA 3MAQA 2L1BA 2CQAA 5FLXL 3HOVB 4KY7A 3DWQA 4NMZA 1BCPC 4LK1C 3E6ZX 1I4GA 1TS3A 2JEAI 3D6WA 2AUJD 1Q1BA 1Y8OB 1ILQA 4NKLA 4A3BB 4RGTA 2IX1A 5EQ0A 1ONLA 3NSWA 1SNOA 4PNYA 2F0HA 3S16B 4KN4C 3K58A 5IGDA 2QF7A 1WD1A 1TR5A 5K5PA 2ZXRA 2IX3A 1JOOA 2RA4A 5T1GA 4OO1H 5M5YB 3LNNA 2NTSA 2H4OA 1TWFB 3AB9A 3QWNA 3NWTA 2A69D 4N9PA 1CA5A 1HFGA 4IALA 2RQXA 3MXGA 3Q22A 2WINB 1EY7A 3KLSX 3HRZC 3BG3A 2X69A 1Q8IA 3I4NB 2XWJB 2SOBA 1Y1VB 2M2LA 2Z4IA 1DJRD 2FHTA 4XQNA 5CYUA 2C5CA 4IUQA 5E4WC 4MHEA 1WTXA 2SEBD 2KCNA 5C44B 3A8IE 1YNJC 5JAVA 2XSCA 4C1NK 4K14A 1LTID 1UUPA 4ILWA 3OMGA 1KAAA 2F4IA 4C3JB 4TSSA 5IT9E 2EY6A 1G8ZD 2XRSD 5C4XB 4M8AA 1ZYRD 1OXTA 2LFNA 3GTKB 4RHRA 5KEEA 2NVXB 2BDOA 2Y0SB 5M5XB 2EYPA 1PRTB 3K57A 1A3VA 1F9SA 3VYUA 5I9PA 4EQNA 1PTOH 3P75A 4PMWA 4DFAA 5HGTA 1IL8A 4H0LC 5CV8A 5CC4A 3HP3A 2A6HD 5EJWA 1KDAA 3R3OA 3HOWB 2F0SA 3KUPA 1HQMC 5G3LD 4HAEA 3I91A 4KY5A 2KVMA 1KDBA 4IUVA 3PMFA 4O42A 1F2ZA 2K1BA 2ID0A 4XXEA 1WTOA 3IKJA 5FO7B 3VR4A 4A3EB 3SXHA 2TSSA 4HSPA 4RGOS 1SYBA 1EY8A 2PYKA 2PZTA 2HCCA 3MZ5A 4I7ZC 2KHSA 2L55A 4OL7A 1RHPA 1TIID 2OT2A 5C4ZA 3TSSA 4Q5VA 3VR5A 1FGBD 1ET9A 1SJHD 4XQJA 1A6XA 4B08A 4KD4A 1PMRA 4WFN3 1TKWB 3GTJB 2D2CC 1PTOF 1B53A 1VDZA 4DA2A 3K59A 4A3DB 5IGFA 2CW0D 2D9UA 2MJ8A 1NUCA 3M3YB 2PW5A 1GUGA 2NBFA 4DAPA 3I73A 1EY0A 4J8QA 4ZUIA 2IW3A 2EYLA 3DWAA 2A69C 1RJTA 3KBGA 2VB3X 1YNND 3OOCA 5IGBA 5DNFA 1H9SB 1JC7A 1EYDA 1HTLD 1LO5D 5KIXA 4FYDA 4TRDA 1AW7A 1SYDA 2FMCA 4F8MA 5F2DA 2Q8RE 1B9MA 5BN5A 3K5LA 1EOTA 5M3FB 2PPBC 3U9OA 1CFMA 1DONA 1PRTD 2D62A 2MP1A 1U9RA 3FDTA 4C3IB 3J7AV 1RD9D 4OIKA 1FD7D 3QB3A 1PZID 2Q8IB 1G6ZA 3V96A 3C46A 2LMCB 1IW7D 1C48A 4KD3A 3PIP3 3NHHA 3FMCA 2G9HD 3LX0A 5EGTA 3WOFA 3Q23A 1SYGA 2F0EA 2L5TA 3VYRA 3VA7A 2E76C 1SMYD 1LTSD 5DEHA 3DMUA 2F0IA 1K8MA 1LTTD 4KKUA 5ELCA 2KJXA 5KNBA 2AWNA 4HSVA 1XX8A 4K5WA 1ZYRC 1C4QA 1X32A 4WRDA 3VYSA 4QB4A 3RD4A 5CV9A 3K5OA 2QEJC 1HHVA 1CA6A 3C2PA 3MFGA 2F3WA 4YIJA 1H9MA 1STHA 3R2IA 2DN8A 3W2DA 3A55A 4R9WA 4KN7C 4DNRB 2A6HC 1XWEA 3ND9A 2VXWA 2K5DA 5A35A 2FINB 1SE4A 5CV5A 1TWGB 4FXKC 3CU7A 4CBVA 4RWSC 1S5BD 1B2TA 2G9DA 3OWFA 2NWGA 4B9WA 3G6JB 1SSOA 4CHTB 4H44C 2ENBA 4ZK9B 1AEXA 2JA6B 5I4DA 4G4KA 1EQVA 5IODA 5IOCA 4QMGA 1BBXC 1A2TA 3M4YA 2EYHA 2BA1A 2KCCA 1D5MC 2XWBB 4ZQ3A 2VUMB 2DY8A 2EDGA 3BDOA 5CMDA 5C4HA 2C9OA 2XRQD 4LJZC 1GUWA 1EY9A 1HTPA 1FNWA 1DZ1A 5JPMC 1UAPA 5A2QL 4BY7B 2L12A 3FPUB 2NN6I 1BO0A 3ERQA 3KLSA 2I46A 1V1PA 1VMPA 3RZOB 3HEJA 1AN8A 3I8ZA 1F2YA 2JEBI 4L6TB 4V190 1B9NA 4PMBA 2QKIC 1S4ZA 3OMCA 1U4LA 2WP8J 4RHSA 1AZQA 1BNZA 5CBEE 3GTMB 1PTOB 4CJ2C 4DGZA 1B3AA 1CQFA 4KY6A 3NBHA 1XYIA 2BDNA 1SYEA 1BXTA 4X3TA 3J81L 1L0XB 4RAUC 1CZWA 2B39A 4DK1A 2EE1A 4RGNA 4G7OC 1STBA 5LHY1 1A3TA 1J8IA 5I2XA 4K5XA 4A3IB 1GXDC 4RGMA 2Q8TA 4FF3A 3NXWA 1HFNA 3PUYA 3H6MA 2OF1A 3E5SA 1QWYA 4IFDI 4OHJA 4CJ1B 1JOKA 2KQ3A 1EY6A 2K5QA 2R6GA 4EQOA 3MHBA 2QDBA 2SNMA 3R93A 3BYYB 4RCNA 3R8BA 1CI3M 1E0BA 4NP5A 5M3MB 4G7HC 5IIFA 5KNDA 3URYA 5AFWA 4QIWB 2FMMA 4FVMA 5JEAG 1QCBD 3HOUB 1F2LA 4K2LA 5D14A 1Y69U 3PUZA 4BS9A 3K0YA 4A3GB 2VNUD 1WTVA 3P1HA 1EYAA 3L9AX 1BCPF 3KF8A 3OWEB 1BR9A 4FXGC 3GP7A 3NK9A 4K5VA 4R8IA 3NBIA 3ITPA 5DM73 5JVH3 2XVSA 3IFTA 1JCKB 1IKLA 1PDQA 1SNCA 1O78A 1GUSA 2K03A 1TS2A 3OIPA 2Z1CA 4A3JB 3G7LA 5C5MA 4WORA 4KK7A 4ZLTF 1MGSA 1SEBD 4BA2I 3AMUA 2A6ED 2WKDA 1QJOA 5LL6X 3D4DA 3PO2B 4XYOA 1HUMA 1H9RA 2RDHA 5JEAJ 2KEEA 4XQQA 2LKVA 1Q90A 3TP7A 2PO4A 3ND8A 4CKBA 2CHBD 3FRPB 2JYOA 3Q24A 2LY7A 1RDPD 2PQEA 3M4OB 3S2DB 2KOLA 3M7GA 1ZXTA 3A56A 2JA5B 1PTOD 4FXDA 3S1QB 4IN3A 1TY0A 1W6KA 3N6RA 4DU9A 2M00A 2MHVA 5CV6A 1EIGA 3T16A 3RLFA 3IL8A 3PV0A 4WJWA 2F0KA 2IPKD 5EPLA 3DXJC 3L7ZC 2R3ZA 2B2VA 4JBWA 2K5WA 2BE5D 1SNQA 1X3PA 1PLFA 4O1NA 1ENCA 1TS4A 5JPNC 1LT6D 4UAIA 4EVOA 4DXGA 2XN9C 2MGSA 1R4QB 1BUVT 2A68C 3KK7A 1ESFA 2DNEA 1LTAD 2K33A 3S2HB 1L0YB 1UNSA 2HQEA 1F77A 4ZAIA 1JWMD 5JEAH 3D8GA 3VR3A 3E0JA 1STYA 3X3MA 3H0GB 2M9VA 3SE0A 5FLXE 2MPMA 1V8QA 5C6AA 3DEOA 4QF4A 3H09A 1SNMA 1KDCA 2B2TA 3JAME 1U4PA 2J7ZA 1OXSC 2A5HA 3X3NA 3D4WA 3MXNA 4E6IA 3EROA 4BY1B 2JA8B 4X3KA 4EGVA 1M4VA 1EFID 4C3HG 4CGYB 1TWAB 2XIWA 4I65A 5D65A 3A7LA 3V05A 4CJ0B 1TWHB 3SK8A 1DOLA 3VA5A 1SYFA 2Z8LA 5EPJA 1R4PB 3BDLA 4IUPA 1ILPA 1CZGA 5M5WB 3AU7A 4V0BA 1I6HB 1KLGD 2ZT9C 3QOJA 2RBMA 1GHJA 3C1FA 4CKEA 4IUUA 2F0UA 3BVMA 5ELFA 2B2UA 5KGUA 3NTKA 1GOZA 4FF1A 4Y7NB 3DUZA 3H94A 1BDOA 2YU9B 2F1MA 4RCOA 3BS1A 5EKKA 2KA7A 3TN2A 1I4HA 3DM1A 5E4XA 1S5CD 1JWSD 1Q3LA 1BCPB 1QG7A 1EQTA 1ZKOA 5C0XI 5J1ZA 4DN4M 1S5DD 4F7XA 4DAYA 1PFMA 1FNVA 3VYTA 1EU4A 1Q1EA 1Z6HA 2PNRC 4C2MB 1PFBA 3I3CA 1BOSA 3A54A 5C4JB 3NWSA 1ESRA 5C3WA 1U4RA 4Z9CB 3HOZB 2EYJA 1OXUA 2PMZB 1ENFA 1QE6A 4AYBB 2SNSA 3BVZA 5FKAC 4ZKBB 3GV6A 5C5LA 4IUNA 1T5EA 2RSOA 3S1NB 1A15A 2R92B 3GTGB 3T51B 4XTCS 3N52A 2WB1B 4H7BA 3O13A 3SHLA 2F0TA 3TP5A 3DEPA 3MA2B 2XNAC 3OHXC 2JP1A 1D5XC 1GUTA 4X3SA 1EL0A 4HCSA 5I9OA 3VR2A 3SEBA 1EY4A 5C0XG 1BF4A 2B2VC 1Y1WB 5IGCA 4HCEA 1VCIA 3UI2A 4ODGA 5ELDA 1RCVD 1JB3A 4KHVA 1CHQD 2JE6I 4ZKCB 3T53B 5D3DA 3CRLC 2AQ1B 3T56B 1G291 4PQXA 3FEWX 1SNPA 2N55A 4QUFA 4A3KB 2NZ1D 4BBRB 1HCZA 4OO1I 3J80L 1PFNA 4X3UA 1LACA 1HQRD 2RSNA 3GV3A 5KYIA 4J1MA 3CKIB 3DWPA 1I4PA 4UDUC 5C3EB 3D6CA 1DM0B 1AP0A 2B2TC 3W3AA 1MBYA 1ENAA 4L63B 1EZ6A 3S14B 1JORA 1QB5D 1G2SA 2AQ3B 2E2JB 2KUMA 1QILA 1LT3D 2ICEC 5CR3A 2EJFC 4ZUJA 2K28A 1H9SA 3V2TA 5EBDA 4R8NA 4N9TA 1LTGD 1RF2D 2EY2A 3QO2A 4FP5D 2FFKB 3OPOA 4BBSB 3MTSA 1TY2A 2B2UC 3HOXB 2H1EA 1NR4A 3QG1A 1IKMA 5COYA 4B9XA 4RKBA 2B2WA 1SDFA 2AQ2B 4RFBA 1OO9B 1DD2A 1EZ8A 4XT3B 3EJIA 2E75C 1TQOA 5DAUA 4S3SA 4GZYC 2I07B 2EJGC 5JJZA 3ZYYX 3RZDB 1Y8PB 2CW0C 1RODA 4OO1G 1SJED 1YNJD 3J7AF 1B1ZA 3NP8A 2E2HB 1PZJD 3Q6SA 2HDLA 1LT5D 5FO9B 1T5XD 1NCVA 1STAA 2R7ZB 1YNNC 3L3OC 1GHKA 1EEFD 1ML0D 1GUOA 1WD0A 1MSGA 2F0JA 2NVQB 3TZUA 2KEDA 1C8CA 1KTKA 1W6JA 4IZ8A 1BQQT 4F88A 1TU2B 3C1EA 3FPPA 3OSOA 4H13C 1JICA 4NW2A 1PRTC 3NTIA 2EZVA 1EY5A 3I90A 4K6DA 1PYWD 4OGQC 4LAAA 4IURA 2N88A 3MWYW 3LWEA 1LT4D 3IFDA 3QIAA 1IW7C 2WIIB 1B44D 2K6AA 2NN6G 1MD2D 2BCOA 1SMYC 5EKIA 4BA1I 2E2DC 5I2YA 1HRJA 4RH6A 1VF5C 3MXUA 2ICIA 1NAPA 1KNEA 1V1OA 3GTQB 2NB0A 3A8KE 2AWOA 5E3FA 1CQVA 2NTTA 5IT9L 3TBIB 1G91A 5M9OA 5A2QE 1G2TA 4HR7B 4TQUS 4KKTA 1ZEQX 2NUCA 4DNTB 1Z7TA 3K7AB 1Y8NB 3OIQA 3LWUA 1U4MA 1D1KA 1DCZA 1GUNA 4XDXA 3GTLB 3MEHA 4U673 3JAML 1OXXK 3TP6A 4IFDG 3PUWA 5J39A 1O7LA 2B63B 2MUYA 4KMUC 1LLRD 2F0PA 2OEOA 3I4LA 1PZKD 1PXUA 1WTRA 3TDQA 4LMQD 1EU3A 2F0GA 1V43A 4KJNA 3J81E 4XYQA 3DHQA 3VR6A 5HURA 1MI2A 2KECA 1IYUA 3MFYA 1F9RA 4IQZA 4NDXA 4ZYSA 5IGGA 4QUCA 1ICWA 1MSHA 3D3RA 4K8JA 1UEAB 5TSSA 1EEID 3T13A 2EJMA 2WKCA 3HZXA 2RDGA 2WAQB 3PO3B 4C3HB 2JSOA 5CGKA 2QCPX 3GTPB 1XTCD 2J0TD 1KLUD 4ULLA 2EY1A 4G7ZC 1KNAA 2HUGA 4A3FB 5LL6S 1TS5A 4IFDJ 4M1UB 5CORA 2A73B 5BN4A 2EYOA 4OIJA 1KABA 2B2WC 4RKLA 4KHZA 4C56C 4IUTA 3HG9A 2EYFA 3OW7A 3PUVA 3CQZB 2NN6H 4XT1B 4CKCA 2EYMA 2WV6D 5K36G 1I50B 1HA6A 4J6HA 1X3QA 3HKZB 3MC0B 5ISRA 1WCMB 3SK4A 2QILA 2DY7A 1VMCA 2IT1A 2PCFB 1F9PA 1QOHA 3GD7A 4KTAA 2K04A 4PMCA 3BDCA 1SYCA 5FO8B 1RKNA 3CRKC 1II3A 3NUCA 2NVTB 5FOBB 1CTMA 3KBXA 2SDFA 2OXPA 2IWHA 3C3LA 3S1MB 1DXMA 1H9JA 1SXTA 1Z47A 4JK1C 1S5FD 2F03A 2NYZD 1HA5A 4IFDH 4A93B 5CBAE 1O7YA 2F0FA 3FKIB 2ZXPA 2F3VA 5T1IA 5EPKA 1FNUA 2K7VA 4MIUA 4C3JG 5ELBA 1STNA 5EBCA 2B8FA 2CVRA 5FK9C 4DXFA 5NUCA 3M7NA 3QOLA 1LABA 4HTHA 4K6LA 2A6EC 3D4RA 4BWGB 4C1NI 1JQYD 4DK0A 1CM9A 2K01A 2F0OA 1H9KA 4P2CB 3I72A 3ONAB 3WOEA 3K6OA 2L0CA 4KI0A 2DNCA 3A7AB 3EQLC 4FO2A 1SNDA 4MN3A 4QCLA 3K5NA 5JOBA 1TWCB 3BVGA 2F0LA 2R61A 1D6EC 1LTRD 4KV6A 1PTOC 4DF7A 1F2MA 3SDZA 3T4AC 2VB2X 4HMJA 2X6LA 4FNFA 1WTWA 2J4XA 4ZRZA 4XIGS 2Z4HA 3S9WA 1B50A 5JVG3 1D5ZC 1Q12A 1HPCA 3P7JA 2AUKA 2BE5C 1EYCA 4U68A 5K36H 3K5MA 5J22A 2F0DA 1SAPA 4HN7A 2FJ2A 4ABNA 2E2IB 3KLRA 2B2YA 3P20A 1XXGA 3TP8A 3S17B 1GJXA 3U9SA 1DOKA 2HCIA 4Q0FA 2RDFA 3A8JE 1V1PB 4HMIA 2O5JC 1TVXA 3CHBD 3MVVA 5KNCA 1I4RA 3GTOB 4EQPA 2D5DA 1NR2A 1NSNS 1CT1D 3Q0AA 1OXVA 3S1RB 5KYLA 2X6GA 4K8IA 3PUXA 4RA8A 3H91A 1O80A 1E2ZA 5ELEA 5G3LF 4HEDA 1CK1A 2A74C 1BCPD 5I6YA 1DOMA 2WACA 4L8JA 3IAYA 1CHPD 5IGEA 3R2TA 2L4NA 5C0XJ 1D2BA 3SK6A 3NPPA 3SVMA 3NQTA 2L9HA 4FF4A 1JE4A 3NQIA 1I3QB 4C3IG 2PW7A 1M8AA 2L11A 2IJ0A 2JXMB 1FYCA 1STGA 5CV4A 1EWHA 1A2UA 3SK5A 5KRUA 2RVLA 2O4XA 1E2VA 2IL8A 1IHZA 4DAVA 4G57A 3QJYA 2K32A 2F0QA 2ZXOA 1WTQA 4ME5A 1I6VC 2E74C 3J7YW 1E2WA 4ID6A 3FVQA 2K05A 3BYTB 1WVLA 1EIHA 2PZWA 5E1FA 2PZUA 2EXZA 3H3VC 1S5ED 3I70A 1AZPA 1SE3A 4KJOA 1IYVA 2F0MA 1K83B 1I4XA 3HOYB 2LS01 4A3MB 5D3IB 1R9TB 2JA7B 1D1IA 4KKSA 2F0WA 4K2KA 2EVBA 1I4QA 3NTHA 1SFOB 2V4DA 1JOQA 5C3XA 1JR0D 2NVYB 3EVQA 2EPBA 2F0NA 4F87A 5C0XH 1TT2A 1SBBB 3EA6A 1VF7A 2A68D 1AFPA 2F0VA 3D31A 1ET6A 3HGBA 1WTPA 1PRTF 3F2UA 3NE5B 2O2LD 2R93B 1SE2A 4FF2A 3M85A 3J80E 5EKLA 3GQBA 3I4MB 3S15B 1B4OA 5DM63 1LV9A 2RKSA 3HS0C 1QNKA 5CV7A 2IX0A 1K8OA 1HUNA 5I6WA 4TKOB 2TMPA 3WDNA 3GO5A 1FR3A 1JWUD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KAB A;  2LKV A;  5CV5 A;  5M9O A;  4K5X A;  4QF4 A;  4TRD A;  4KY5 A;  5NUC A;  1SYD A;  2RDF A;  3TP7 A;  4F8M A;  1SNM A;  1KDC A;  3NXW A;  5F2D A;  5C3W A;  2SOB A;  3H6M A;  2OF1 A;  3E5S A;  4HMI A;  4KJO A;  1SNP A;  3QOL A;  1KDB A;  3OWF A;  1JOK A;  4RKL A;  2KQ3 A;  2EY5 A;  3MVV A;  3NP8 A;  4B9W A;  2F0M A;  2NUC A;  5IIF A;  4HTH A;  1EY6 A;  2EYJ A;  3RUZ A;  1A3U A;  2PQE A;  3PMF A;  3D4W A;  3U9O A;  4EQO A;  2ENB A;  1AEX A;  1F2Z A;  2EYF A;  3ERO A;  4E6I A;  1U9R A;  3MHB A;  5KYI A;  4J1M A;  2QDB A;  2SNM A;  3TME A;  4EQP A;  2SNS A;  1STA A;  2F0O A;  2F0W A;  1NSN S;  4K2K A;  3D6C A;  3MEH A;  1EQV A;  4I65 A;  2EYM A;  3SR1 A;  3QB3 A;  5IOC A;  5IOD A;  3TP6 A;  4QMG A;  5KYL A;  4NP5 A;  4J6H A;  1ENA A;  1A2T A;  4IUN A;  3MXP A;  4K8I A;  5C5L A;  1EZ6 A;  3SK8 A;  3SXH A;  2F0J A;  3VA5 A;  5J39 A;  1SYF A;  2M00 A;  4DU9 A;  1JOR A;  1JOQ A;  1SYB A;  2EYH A;  5CV6 A;  1EY8 A;  5C3X A;  3SK4 A;  1SND A;  5ISR A;  4IZ8 A;  3BDL A;  4ZQ3 A;  2F0P A;  2PYK A;  5JAV A;  4K2L A;  3T16 A;  2OEO A;  3C1E A;  2PZT A;  3NHH A;  4KD3 A;  3MZ5 A;  4K14 A;  5C4H A;  3EVQ A;  3OSO A;  4KTA A;  4KY7 A;  2KHS A;  2F0K A;  3QOJ A;  3LX0 A;  2F0G A;  2F0N A;  2RBM A;  3BDC A;  4H7B A;  4NMZ A;  5EGT A;  2F0T A;  4OL7 A;  1SYG A;  1SYC A;  1EY9 A;  2F0E A;  3C1F A;  3SHL A;  3TP5 A;  4KJN A;  5CR3 A;  5C4Z A;  2F0U A;  5I6Y A;  3DHQ A;  4ZUJ A;  1TT2 A;  3V2T A;  5HUR A;  3OMG A;  1SNQ A;  2F0L A;  1KAA A;  1EY5 A;  2F0V A;  3DMU A;  2F0I A;  3P1H A;  4K6D A;  1RKN A;  4R8N A;  5DEH A;  5KGU A;  2WAC A;  1II3 A;  1EYA A;  3NUC A;  3ERQ A;  4N9T A;  2EY2 A;  2EY6 A;  4KV6 A;  5IGE A;  4DF7 A;  4LAA A;  4NDX A;  1ENC A;  1F2M A;  3SK6 A;  4K5W A;  2OXP A;  3NQT A;  4NKL A;  5I9O A;  4HMJ A;  3HEJ A;  4KD4 A;  3NK9 A;  4K5V A;  5IGG A;  4EVO A;  4WRD A;  5EKK A;  1EY4 A;  3ITP A;  1SNO A;  1F2Y A;  2PW7 A;  4QB4 A;  5KEE A;  5CV9 A;  5EKL A;  3S9W A;  4K8J A;  2F0H A;  4PNY A;  4PMB A;  1STG A;  1SNC A;  5CV4 A;  1A2U A;  3SK5 A;  2EYP A;  5KRU A;  5J1Z A;  3OMC A;  5IGD A;  2O4X A;  1A3V A;  5IGF A;  3T13 A;  5IGC A;  3HZX A;  1EYC A;  2RKS A;  5I9P A;  1TR5 A;  1NUC A;  4EQN A;  5C5M A;  1IHZ A;  2PW5 A;  4F7X A;  5CGK A;  5K5P A;  4G57 A;  4WOR A;  2F3W A;  1EY0 A;  4YIJ A;  3P75 A;  4B9X A;  4DFA A;  4DGZ A;  4RKB A;  4ODG A;  1JOO A;  5CV7 A;  1STH A;  2F0D A;  5J22 A;  4ZUI A;  5HGT A;  2F0Q A;  2HQE A;  4KY6 A;  2EY1 A;  4PMC A;  2EYL A;  3D8G A;  1SYE A;  4ME5 A;  1EZ8 A;  4KHV A;  5CV8 A;  5CC4 A;  2F0F A;  4N9P A;  1STY A;  4ID6 A;  5I6W A;  1KDA A;  3EJI A;  3R3O A;  2F3V A;  5E3F A;  5JOB A;  3D4D A;  4IAL A;  1TQO A;  2PZW A;  5DAU A;  5IGB A;  5E1F A;  4S3S A;  2PZU A;  2F0S A;  3TP8 A;  5C6A A;  2EXZ A;  4MIU A;  1STB A;  1EYD A;  1EY7 A;  5KIX A;  1A3T A;  1STN A;  2EYO A; 
#chains in the Genus database with same CATH topology
 3A5Z B;  1L0W A;  1U5K A;  2NZH A;  1STE A;  3U58 A;  3PIO 3;  2PQA A;  1H95 A;  5BN3 A;  3E9I A;  1F9Q A;  2EY5 A;  2EOT A;  1B70 B;  5M3F H;  1DYQ A;  1LTB D;  2B2Y C;  5IP7 H;  4PV1 C;  3RUZ A;  1A3U A;  1QNU A;  1RTN A;  4LF5 L;  1N36 Q;  4C3I H;  2YYZ A;  3HKS A;  1O7Z A;  1RTO A;  2MO1 A;  3TME A;  4B3S Q;  3S17 H;  2UUC L;  3BZC A;  2GA4 B;  2BOS A;  4K0K Q;  3EFX D;  3SR1 A;  3TZD A;  5IYC G;  3BZD B;  1EWC A;  2BA0 A;  2B8G A;  2HDM A;  3MXP A;  2O5I C;  1HXY D;  2HD3 A;  1S40 A;  4JI7 L;  1J9O A;  4IOA A;  1E1O A;  3RMH A;  3MAQ A;  2L1B A;  2CQA A;  2HT1 A;  1VS0 A;  2R7D A;  5FLX L;  4KY7 A;  3HOV B;  3DWQ A;  1VQF A;  4NMZ A;  1BCP C;  3WWV A;  4LK1 C;  4IPH A;  2UXC Q;  4A3I G;  3E6Z X;  1I4G A;  1TS3 A;  2JEA I;  1XTD A;  1PH7 A;  3D6W A;  2AUJ D;  1Q1B A;  1Y8O B;  1ILQ A;  4NKL A;  4A3B B;  1E22 A;  4RGT A;  2IX1 A;  5EQ0 A;  2E5L L;  1ONL A;  3NSW A;  1SRU A;  1SNO A;  3RLN A;  3ICE A;  3MXN B;  5HGQ A;  4PNY A;  2F0H A;  3S16 B;  1GM5 A;  4KN4 C;  3K58 A;  5IGD A;  3ER0 A;  2QF7 A;  2UUB Q;  5M3M G;  3G48 A;  1WD1 A;  1TR5 A;  5K5P A;  4LWC A;  3HOU G;  2ZXR A;  2IX3 A;  1JOO A;  2RA4 A;  5T1G A;  4N8X 1;  4OO1 H;  5M5Y B;  3LNN A;  2NTS A;  2H4O A;  1TWF B;  3AB9 A;  3QWN A;  1QVG A;  2ALY B;  5FLM H;  1VQE A;  3NWT A;  2A69 D;  4N9P A;  4P71 A;  1CA5 A;  5IT9 c;  4OX9 Q;  4A3G G;  5FJ8 G;  1HFG A;  4IAL A;  2RQX A;  3MXG A;  3Q22 A;  2WIN B;  2VY3 A;  1EY7 A;  3KLS X;  1U0L A;  1J5E Q;  1HNW L;  1IYJ B;  1TWG H;  3BG3 A;  3HRZ C;  2X69 A;  1Q8I A;  4IPD A;  2XWJ B;  3I4N B;  2SOB A;  1Y1V B;  2M2L A;  2Z4I A;  4A3C H;  1DJR D;  1V1Q A;  2FHT A;  1YZ6 A;  4DR4 Q;  3CCV A;  3NEN A;  1E1T A;  2D0P A;  1EFW A;  4XQN A;  4JV5 L;  5CYU A;  1L1O A;  4DV7 Q;  2C5C A;  1N32 Q;  1NY4 A;  2JA6 H;  3K8A A;  2ATW A;  4IUQ A;  5E4W C;  3U4V A;  4DV4 L;  2XGT A;  4A3J G;  4MHE A;  1WTX A;  1EYG A;  2SEB D;  2KCN A;  1KD1 C;  5C44 B;  1P8L A;  3A8I E;  4TVA B;  1XMO L;  4DAY B;  1K3R A;  1N34 L;  2VUM H;  1O7I A;  4AH6 A;  1A62 A;  1YNJ C;  3JC6 6;  5JAV A;  4YWM A;  3OTO L;  2XSC A;  4C1N K;  4K14 A;  1LTI D;  3PO2 G;  2JQO A;  1UUP A;  1S72 A;  3HOY H;  1CUK A;  1MHW C;  1MJE A;  1R9T H;  1VQ9 A;  2CH4 W;  4ILW A;  4R4T A;  3PIO A;  4BY7 H;  3S24 A;  1FJG Q;  3OMG A;  1L2F A;  1KAA A;  4GOP B;  1X56 A;  4A75 A;  2F4I A;  4C3J B;  1GVP A;  4TSS A;  5IT9 E;  2EY6 A;  1G8Z D;  2XRS D;  5C4X B;  3RLO A;  4DR1 L;  4R4O A;  4M8A A;  3T1H L;  1ZYR D;  3RZO H;  2N49 A;  1OXT A;  2NVY H;  2LFN A;  3GTK B;  4RHR A;  1SE8 A;  5KEE A;  2NVX B;  2BDO A;  3F8T A;  3T1Y L;  3CP0 A;  2JA5 G;  2Y0S B;  3PGZ A;  1I94 Q;  5M5X B;  2EYP A;  1PRT B;  3K57 A;  1A3V A;  1F9S A;  3VYU A;  5I9P A;  2MNA A;  4EQN A;  4B3R L;  2I5L X;  1KL9 A;  3GTM H;  1PTO H;  3P75 A;  4PMW A;  4DFA A;  5GAD C;  5HGT A;  1SRO A;  1IL8 A;  3STB C;  3ZJY C;  4H0L C;  1VQ5 A;  5CV8 A;  5CC4 A;  1XPR A;  3HP3 A;  2A6H D;  5EJW A;  1KDA A;  5IY0 A;  3R3O A;  1PH1 A;  3HOW B;  1WOC A;  5IYB G;  3I4M H;  2F0S A;  3KUP A;  1HQM C;  3BU2 A;  5G3L D;  4HAE A;  3I91 A;  4KY5 A;  2KVM A;  4CDE C;  1J6Q A;  1KDB A;  5AJ3 L;  1PH6 A;  4IUV A;  3PMF A;  2Z6K C;  4O42 A;  1F2Z A;  2K1B A;  2ID0 A;  1HZA A;  4QJF A;  3G71 A;  1JE5 A;  4XXE A;  1WTO A;  3IKJ A;  3J7A 5;  4L5R C;  5FO7 B;  3VR4 A;  4JCV E;  4A3E B;  3SXH A;  2TSS A;  4HSP A;  1G51 A;  4RGO S;  1SYB A;  4DR6 L;  1EY8 A;  3HOU H;  3FHW A;  2HIV A;  2PYK A;  3H0G G;  3CCJ A;  2PZT A;  2HCC A;  3MZ5 A;  4I7Z C;  4N8F A;  1PH4 A;  2KHS A;  2L55 A;  4OL7 A;  1RHP A;  1TII D;  2OT2 A;  5C4Z A;  3TSS A;  4DV6 Q;  5FJ8 H;  4Q5V A;  3VR5 A;  3J81 j;  3E3X A;  1N33 L;  1IBL Q;  1FGB D;  1ET9 A;  1SJH D;  4XQJ A;  1ASY A;  1A6X A;  4B08 A;  5GRO A;  4J15 A;  4POF A;  1PYS B;  4KD4 A;  1PMR A;  4WFN 3;  1TKW B;  2LXK A;  3GTJ B;  2D2C C;  4BY1 G;  3VDY A;  2JA8 G;  1PTO F;  1B53 A;  1VDZ A;  4JYA Q;  1YVC A;  4YCV A;  1E24 A;  4DA2 A;  3K59 A;  1K28 A;  4A3D B;  4LFC Q;  5IGF A;  2VQE Q;  2CW0 D;  2KEN A;  2D9U A;  2MJ8 A;  1NUC A;  3M3Y B;  2PW5 A;  1GUG A;  4QY7 A;  2NBF A;  4DAP A;  3I73 A;  4L5S A;  1EY0 A;  3TRZ A;  4J8Q A;  3CCM A;  4ZUI A;  4X64 Q;  2IW3 A;  3CCU A;  1UE6 A;  2EYL A;  3DWA A;  4QIW E;  2Q2T A;  2A69 C;  2IY5 B;  1RJT A;  4QGU A;  3KBG A;  2VB3 X;  4NXN Q;  3PO2 H;  1SLJ A;  1YNN D;  3AFP A;  3OOC A;  5IGB A;  5DNF A;  1H9S B;  1JC7 A;  1EYD A;  1HTL D;  1LO5 D;  5KIX A;  1PH5 A;  4FYD A;  2YTV A;  4TRD A;  1AW7 A;  2HHH L;  1SYD A;  4A3L H;  2FMC A;  4F8M A;  1IBM L;  5F2D A;  1VQ8 A;  2Q8R E;  4X6A H;  1B9M A;  5BN5 A;  1PV4 A;  3K5L A;  3KJP A;  1WTH A;  1TWF H;  4YHH L;  1EOT A;  5M3F B;  2PPB C;  3M4O H;  3S2D H;  3U9O A;  5BR8 L;  1CFM A;  1DON A;  5LMN L;  3I2Z A;  1PRT D;  2D62 A;  2MP1 A;  1U9R A;  3FDT A;  4LUO A;  4C3I B;  3J7A V;  1RD9 D;  4UHV A;  1YIT A;  4OIK A;  3H3V H;  1FD7 D;  3S1Q H;  2A1A A;  4R4C A;  3QB3 A;  1PZI D;  3GDE A;  2Q8I B;  4DK6 C;  2H5X A;  1G6Z A;  3V96 A;  2F4V L;  4JI4 Q;  1L1O C;  3C46 A;  2LMC B;  1YI2 A;  3OW2 A;  1IW7 D;  1C48 A;  4KD3 A;  3PIP 3;  3NHH A;  3CCR A;  1HNX Q;  1HZ9 A;  3FMC A;  2G9H D;  3LX0 A;  5EGT A;  3WOF A;  2OTJ A;  3Q23 A;  4DV2 Q;  1SYG A;  2F0E A;  2L5T A;  1PH8 A;  3VYR A;  3VA7 A;  2E76 C;  4NB3 A;  5IYB H;  1SMY D;  1LTS D;  5DEH A;  3DMU A;  2F0I A;  3UDX A;  1N9W A;  3I4O A;  1K8M A;  4X62 L;  1LTT D;  4KKU A;  5ELC A;  2KJX A;  5KNB A;  2AWN A;  3AFQ A;  1C9O A;  4HSV A;  1M1K C;  1XX8 A;  3HOZ G;  4K5W A;  1ZYR C;  2ZJP A;  2IHE A;  4DR3 L;  1C4Q A;  1X32 A;  4WRD A;  3VYS A;  4AYB G;  2OQK A;  4QB4 A;  3RD4 A;  5CV9 A;  3K5O A;  2QEJ C;  1HHV A;  3ERS X;  1CA6 A;  3C2P A;  1WJJ A;  4HJ7 A;  2ZTD A;  2RF4 A;  3MFG A;  5GQO A;  1VQH A;  2R92 G;  3S2H H;  2F3W A;  4YIJ A;  3F2C A;  1H9M A;  1STH A;  3R2I A;  2DN8 A;  3BZK A;  2WB1 G;  3W2D A;  3A55 A;  4LF6 L;  4R9W A;  3GTK H;  1XMO Q;  3H0G H;  4KN7 C;  4DNR B;  2A6H C;  1XWE A;  2NVX H;  3ND9 A;  2VXW A;  2K5D A;  1IZ6 A;  5A35 A;  2FIN B;  2PNH A;  2F52 A;  3OTO Q;  3CC2 A;  4JBM A;  1NJI C;  1KAW A;  1K8A C;  1SE4 A;  5CV5 A;  1TWG B;  4FXK C;  3CU7 A;  4CBV A;  4RWS C;  2QDL A;  1S5B D;  1B2T A;  2G9D A;  3OWF A;  2NWG A;  2XTI A;  4B9W A;  4JPB W;  3G6J B;  2CFM A;  1SSO A;  4P75 A;  4CHT B;  4H44 C;  2ENB A;  4ZK9 B;  1AEX A;  4BY1 H;  2JA8 H;  3F2B A;  2JA6 B;  5I4D A;  1Y1W G;  4G4K A;  1A8V A;  1EQV A;  5IOD A;  5IOC A;  4QMG A;  4UPA A;  5LMN W;  4NPS A;  5IWA Q;  1BBX C;  1A2T A;  3M4Y A;  4IO9 A;  1UE5 A;  2EYH A;  4LUV A;  1CKO A;  2BA1 A;  2KCC A;  1D5M C;  2XWB B;  4ME3 A;  4ZQ3 A;  4UY8 C;  2VUM B;  2DY8 A;  1VQP A;  2EDG A;  1I6H H;  3KYH C;  3BDO A;  1GKH A;  5CMD A;  5C4H A;  4DUZ Q;  2C9O A;  3CCS A;  2XRQ D;  4HID A;  4LJZ C;  1GUW A;  2GN5 A;  1EY9 A;  1HTP A;  1FNW A;  1DZ1 A;  5JPM C;  2D0O A;  1JJG A;  3K81 C;  3F1Z A;  1UAP A;  5A2Q L;  4BY7 B;  2L12 A;  1C7Y A;  3FPU B;  2NN6 I;  4MNO A;  1BO0 A;  3ERQ A;  3KLS A;  1A63 A;  2Y0S E;  4A3K G;  4Y7N H;  2I46 A;  4BBR G;  1V1P A;  1VMP A;  2VZA A;  2YU9 H;  3RZO B;  3HEJ A;  1AN8 A;  1Q46 A;  3I8Z A;  4HJ5 A;  1F2Y A;  2CWP A;  4DPG A;  2JEB I;  4L6T B;  4V19 0;  1B9N A;  4DR2 L;  5C3E G;  4PMB A;  3LGJ A;  2QKI C;  1S4Z A;  3OMC A;  1FVI A;  1U4L A;  2WP8 J;  1UEB A;  4RHS A;  1X55 A;  1AZQ A;  1BNZ A;  4DV0 Q;  4LFB Q;  5CBE E;  3GTM B;  3PIP A;  1PTO B;  4CJ2 C;  4DGZ A;  1K0R A;  1B3A A;  1CQF A;  4KY6 A;  3NBH A;  1XYI A;  2BDN A;  2ZJQ A;  2CKZ B;  4WJ4 A;  1SYE A;  4DKA C;  1BXT A;  4X3T A;  3J81 L;  1L0X B;  4B3T L;  1XMQ Q;  4RAU C;  4C2M H;  1CZW A;  2B39 A;  4DK1 A;  2EE1 A;  4RGN A;  4G7O C;  1EUJ A;  1STB A;  5LHY 1;  5C4J H;  2PI2 E;  1A3T A;  2Q2H A;  1J8I A;  3BJU A;  5I2X A;  4K5X A;  4A3I B;  1GXD C;  4RGM A;  2Q8T A;  4FF3 A;  3PF4 A;  3NXW A;  1HFN A;  1BBW A;  3PUY A;  3H6M A;  2OF1 A;  3E5S A;  1QWY A;  1PA6 A;  4IFD I;  4OHJ A;  4CJ1 B;  1JOK A;  2KQ3 A;  2A19 A;  1EY6 A;  2K5Q A;  2R6G A;  1MKH A;  1XNQ Q;  4EQO A;  3EIV A;  3HOX G;  3MHB A;  4PZ7 A;  4JI3 L;  1VQO A;  5JJL A;  2QDB A;  2SNM A;  3R93 A;  2E8G A;  3BYY B;  4RCN A;  2KBN A;  3R8B A;  1CI3 M;  1E0B A;  1HR0 Q;  3AYH B;  4NP5 A;  5M3M B;  4G7H C;  5IIF A;  5KND A;  3URY A;  5AFW A;  4APV A;  4QIW B;  2FMM A;  2R92 H;  4FVM A;  5JEA G;  1QCB D;  3HOU B;  4ALP A;  1CSQ A;  1F2L A;  1Q8K A;  4K2L A;  4A3M G;  2JA7 G;  5D14 A;  1Y69 U;  2LSS A;  3K80 C;  2FXQ A;  4IPG A;  3PUZ A;  4BS9 A;  5GAE C;  3K0Y A;  4GNX A;  3A5U A;  4A3G B;  2VNU D;  3CPF A;  1WTV A;  4GN5 A;  3P1H A;  2ZTE A;  4X66 L;  1RIP A;  1EYA A;  3L9A X;  1BCP F;  2UU9 L;  3KF8 A;  3J81 i;  3OWE B;  3G4S A;  1BR9 A;  1QUQ A;  4OWT B;  4FXG C;  3GP7 A;  3NK9 A;  4K5V A;  4R8I A;  4LF4 Q;  4IPC A;  1MIU A;  3NBI A;  3ITP A;  1YBY A;  5DM7 3;  5JVH 3;  4LF7 Q;  2R7Z G;  2XVS A;  4NXM L;  3IFT A;  1JCK B;  1IKL A;  1CKN B;  1PDQ A;  1Z9F A;  1PYB A;  2PMZ E;  1SNC A;  1O78 A;  1GUS A;  2K03 A;  1TS2 A;  3OIP A;  1Y1W H;  2Z1C A;  4A3J B;  3G7L A;  4AYB E;  4GN3 B;  5C5M A;  4JI8 Q;  4WOR A;  4DR5 Q;  4KK7 A;  4LF9 Q;  1W3S A;  4ZLT F;  1MGS A;  3M4P A;  2UUA L;  1SEB D;  4BA2 I;  3AMU A;  2YTX A;  2A6E D;  2WKD A;  1KIX A;  1XNR Q;  1QJO A;  5LL6 X;  2UXD Q;  3D4D A;  3PO2 B;  2OTL A;  1VQC A;  4YY3 L;  4XYO A;  1HUM A;  1H9R A;  2RDH A;  5JEA J;  2KEE A;  2WB1 E;  4XQQ A;  2LKV A;  4Y52 H;  1Q90 A;  3TP7 A;  2PO4 A;  3ND8 A;  4CKB A;  2CHB D;  3FRP B;  4A3K H;  2JYO A;  4BBR H;  3KLW A;  3Q24 A;  2LY7 A;  4HJ9 A;  1RDP D;  3B6Y A;  3UDG A;  4DR7 Q;  2PQE A;  3M4O B;  3S2D B;  2KOL A;  3M7G A;  3SGI A;  3HFZ B;  1ZXT A;  4DV5 L;  5C3E H;  3A56 A;  2MQH A;  2JA5 B;  4GS3 A;  3M4Q A;  1PTO D;  4FXD A;  3S1Q B;  4IN3 A;  1TY0 A;  1W6K A;  3S14 H;  3KF6 B;  3N6R A;  4DU9 A;  2M00 A;  2MHV A;  5CV6 A;  5FLX c;  4IOC A;  1EIG A;  1UWV A;  2I0Q A;  3T16 A;  3RLF A;  3IL8 A;  3PV0 A;  2E2J H;  4WJW A;  2F0K A;  2IPK D;  5EPL A;  4YCW A;  3DXJ C;  3L7Z C;  3L2P A;  3JAM c;  2R3Z A;  2B2V A;  4JBW A;  4JI1 L;  4PZ6 A;  2K5W A;  2BE5 D;  1SNQ A;  1X3P A;  2VQF L;  4AIM A;  3M9B A;  1PLF A;  1KXL A;  4O1N A;  1ENC A;  2B3G A;  4UP8 A;  1TS4 A;  5JPN C;  3HOV G;  1LT6 D;  1Q81 C;  4UAI A;  3PSI A;  4BBS H;  4EVO A;  4DXG A;  2XN9 C;  4LF8 Q;  1K73 C;  2MGS A;  4EQ5 A;  2N78 A;  1R4Q B;  1BUV T;  3HOX H;  2A68 C;  3KK7 A;  4KHP Q;  4JI0 Q;  1ESF A;  1X54 A;  2B63 G;  2DNE A;  1LTA D;  2KHJ A;  2K33 A;  3S2H B;  1L0Y B;  1UNS A;  2HQE A;  1F77 A;  4ZAI A;  4R4I A;  1JWM D;  5JEA H;  3D8G A;  1JJC B;  3VR3 A;  4GKJ Q;  3E0J A;  4B3M L;  1STY A;  3X3M A;  3H0G B;  2M9V A;  3SE0 A;  5FLX E;  2MPM A;  1V8Q A;  5C6A A;  2K5V A;  2EIF A;  1IBK L;  2AMC B;  3RZD H;  3DEO A;  5J3B A;  4QF4 A;  3H09 A;  1SNM A;  1KDC A;  4GN4 B;  2B2T A;  3JAM E;  5IYC H;  1U4P A;  2J7Z A;  4X65 Q;  2E2H H;  1RL2 A;  1OXS C;  2A5H A;  3X3N A;  3D4W A;  3KJO A;  3MXN A;  3ERO A;  1KRT A;  4E6I A;  4BY1 B;  2JA8 B;  4WJ3 M;  4X3K A;  2R7Z H;  1IL2 A;  4EGV A;  1M4V A;  1EFI D;  2WAQ G;  4RG1 A;  3PO3 G;  4AQY L;  4C3H G;  3I4N G;  4CGY B;  1HH2 P;  1TWA B;  2XIW A;  2HQL A;  4I65 A;  4JC0 A;  5D65 A;  4A3I H;  3A7L A;  3V05 A;  4CJ0 B;  1TWH B;  3SK8 A;  1DOL A;  2NVQ H;  3VA5 A;  4JI2 L;  1SYF A;  2Z8L A;  5EPJ A;  1R4P B;  4A3F G;  3BDL A;  3EBE A;  4IUP A;  1HNZ Q;  1ILP A;  1CZG A;  5M5W B;  3AU7 A;  4V0B A;  1I6H B;  1NBW A;  1KLG D;  4GKK Q;  5ELN A;  2ZT9 C;  3QOJ A;  2RBM A;  5EAY A;  5JJI A;  1GHJ A;  3C1F A;  4CKE A;  4IUU A;  2F0U A;  3BVM A;  2B2U A;  5ELF A;  4DV1 L;  5KGU A;  3NTK A;  1GOZ A;  1V9P A;  1D8L A;  1YJN A;  3TEH B;  5M3M H;  4FF1 A;  4Y7N B;  1CKM A;  3DUZ A;  4LFA L;  5LMU Q;  3H94 A;  1BDO A;  1JB7 A;  2YU9 B;  2F1M A;  4RCO A;  3BS1 A;  5EKK A;  4JI5 Q;  2KA7 A;  1I4H A;  3DM1 A;  5E4X A;  3TN2 A;  4GNX C;  1S5C D;  1JWS D;  1Q3L A;  1BCP B;  1QG7 A;  1EQT A;  1ZKO A;  5C0X I;  5J1Z A;  4DN4 M;  4A3G H;  5C4X G;  1S5D D;  4OXP A;  3PCO B;  5H1S E;  2UXB L;  4HIK A;  3HKZ G;  4F7X A;  1WCM G;  4JI6 Q;  3FP9 A;  4DAY A;  4DUY L;  3I7F A;  1PFM A;  1VQK A;  1FNV A;  2ZM6 L;  3GTQ H;  1UE1 A;  3DM3 A;  1KQS A;  3VYT A;  1EU4 A;  1Q1E A;  1Z6H A;  1VQN A;  4DNI A;  2PNR C;  4C2M B;  1S3O A;  1PFB A;  3I3C A;  4EX5 A;  1BOS A;  3A54 A;  1VQM A;  5C4J B;  1KHI A;  3NWS A;  4GOP A;  4A3J H;  1ESR A;  4LF5 Q;  5C3W A;  1U4R A;  4Z9C B;  1YHB A;  2UUC Q;  1EQQ A;  3OYY A;  3HOZ B;  2EYJ A;  1OXU A;  2PMZ B;  3K7A H;  4LUZ A;  1WFQ A;  1ENF A;  1QE6 A;  1VQJ A;  4PG3 A;  3CCL A;  1K9M C;  4JI7 Q;  4AYB B;  1HZB A;  3GTL H;  2SNS A;  3ULL A;  3K0X A;  4YWL A;  3BVZ A;  1FGU A;  5FKA C;  1MJC A;  4ZKB B;  4A93 G;  2VS1 A;  3GV6 A;  5C5L A;  4IUN A;  1N36 L;  1T5E A;  2RSO A;  3S1N B;  2K4K A;  1A15 A;  2R92 B;  4B3S L;  1Q82 C;  3GTG B;  3FKI G;  3KDF B;  3T51 B;  4XTC S;  4K0K L;  2DJG C;  3N52 A;  2WB1 B;  3PQI A;  4H7B A;  3KOJ A;  3O13 A;  2F0T A;  4RMF A;  3SHL A;  3DEP A;  3TP5 A;  3TRE A;  3CAM A;  3U4Z A;  3MA2 B;  4A3E G;  2E5L Q;  2XNA C;  2JA5 H;  1D7Q A;  3OHX C;  2JP1 A;  4MZ9 A;  1D5X C;  5IE8 A;  1GUT A;  1W2B A;  4X3S A;  1EL0 A;  4HCS A;  5I9O A;  1NNX A;  2UXC L;  1SMX A;  3VR2 A;  3SEB A;  1EY4 A;  1YHQ A;  5C0X G;  4OWW B;  2PI2 A;  1BF4 A;  2B2V C;  4L5Q A;  4OEL B;  1Y1W B;  5IGC A;  1PH9 A;  3PO3 H;  4C3H H;  3GTP H;  3PF5 A;  4HCE A;  1VCI A;  3UI2 A;  4ODG A;  4OWX B;  1CSP A;  5ELD A;  1RCV D;  1HNW Q;  4GLV B;  2UUB L;  4A3F H;  1JB3 A;  4A4I A;  4KHV A;  3UE0 A;  1CHQ D;  4A3D G;  2JE6 I;  4ZKC B;  3T53 B;  2V1C C;  5D3D A;  4JV5 Q;  3CRL C;  2AQ1 B;  1HZC A;  3RN2 A;  1QVF A;  3T56 B;  1G29 1;  4PQX A;  4DV4 Q;  4OX9 L;  3FEW X;  1SNP A;  2N55 A;  4QUF A;  4A3K B;  2NZ1 D;  4BBR B;  3UDF A;  1HCZ A;  4OO1 I;  3J80 L;  1PFN A;  1PFS A;  4X3U A;  1LAC A;  3CXC A;  1HQR D;  2RSN A;  2CWA A;  2ES2 A;  3GV3 A;  2BH2 A;  3CCE A;  2JN4 A;  1N34 Q;  5KYI A;  4J1M A;  1I5F A;  3CQZ H;  3CKI B;  3DWP A;  3RR5 A;  1PH2 A;  1I4P A;  4UDU C;  5C3E B;  3D6C A;  1EOV A;  4DR4 L;  1DM0 B;  3AQQ A;  1AP0 A;  1I50 H;  2B2T C;  3W3A A;  5DLQ E;  1MBY A;  4DV7 L;  1N32 L;  1ENA A;  4L63 B;  1EZ6 A;  3S14 B;  2VW9 A;  1JOR A;  1QB5 D;  1WCM H;  1YJW A;  5IP7 G;  2WAQ E;  1G2S A;  1JT8 A;  4JW0 A;  2AQ3 B;  2OCE A;  2KUM A;  2E2J B;  4DR1 Q;  1QIL A;  3T1H Q;  1LT3 D;  3U50 C;  2ICE C;  5CR3 A;  2MO0 A;  2EJF C;  4ZUJ A;  2K28 A;  1H9S A;  3V2T A;  3RN5 A;  1TWA H;  1Y14 B;  5EBD A;  4R8N A;  1E7Z A;  2NVT H;  4N9T A;  1G6P A;  1B8A A;  1LTG D;  1RF2 D;  2EY2 A;  2A8V A;  1TWH H;  2PQA B;  3T1Y Q;  3QO2 A;  4POG A;  4HJ8 A;  1ASZ A;  4FP5 D;  2FFK B;  1FJG L;  3S1M H;  3OPO A;  4BBS B;  5M5W H;  2MFI A;  4B3R Q;  1SR3 A;  2AHO B;  1QZH A;  3MTS A;  1NMF A;  1FL0 A;  1TY2 A;  2B2U C;  1X3E A;  3HOX B;  2H1E A;  1NR4 A;  4DK3 C;  3QG1 A;  3J80 i;  1IKM A;  1VQ4 A;  1E3P A;  5COY A;  4B9X A;  4RKB A;  2B2W A;  2ZTC A;  1SDF A;  1I94 L;  2AQ2 B;  4RFB A;  1OO9 B;  1DD2 A;  1EZ8 A;  4XT3 B;  3EJI A;  3TS0 A;  2E75 C;  2Z0S A;  1TQO A;  5DAU A;  4S3S A;  5AJ3 Q;  4GZY C;  2I07 B;  2EJG C;  5JJZ A;  3ZYY X;  3RZD B;  1Y8P B;  2CW0 C;  1XPU A;  1ROD A;  2GVB A;  1YHA A;  3ULP A;  4UP7 A;  4OO1 G;  1SJE D;  1NTG A;  3A74 A;  1AH9 A;  1YNJ D;  3J7A F;  1B1Z A;  3NP8 A;  5FLM G;  1LUZ A;  2E2H B;  1PZJ D;  3Q6S A;  2HDL A;  1LYL A;  3J7Z C;  2IHF A;  1LT5 D;  5FO9 B;  1T5X D;  1B3Q A;  4DR6 Q;  1NCV A;  5JJK A;  1STA A;  5L37 A;  2R7Z B;  1YNN C;  1EWI A;  4GOP C;  3L3O C;  1GHK A;  3CMA A;  3DLL A;  1EEF D;  1ML0 D;  1GUO A;  2K5N A;  1WD0 A;  3UDI A;  1MSG A;  2F0J A;  2NVQ B;  3TZU A;  3KFU A;  2KED A;  1C8C A;  1KTK A;  1W6J A;  4IZ8 A;  1BQQ T;  4F88 A;  2UXB Q;  4IJL A;  1TU2 B;  3HOZ H;  1N33 Q;  3C1E A;  2K14 A;  3FPP A;  3OSO A;  2JK8 A;  4H13 C;  1JIC A;  4NW2 A;  1TWC H;  2VL6 A;  5HY6 A;  1PRT C;  3NTI A;  2RCN A;  4JBJ A;  2EZV A;  2I5H A;  1EY5 A;  1AE3 A;  3I90 A;  4K6D A;  4DV3 L;  1PYW D;  3G6E A;  1DGS A;  4OGQ C;  4LAA A;  4IUR A;  3S1N H;  2N88 A;  3MWY W;  2QA4 A;  3LWE A;  3STB D;  1LT4 D;  4DV6 L;  3IFD A;  3GTG H;  2KCM A;  1L1O B;  3HOY G;  3QIA A;  1PHJ A;  1IW7 C;  2WII B;  1B44 D;  1IBL L;  4CDF C;  2K6A A;  4BXX G;  2NN6 G;  1MD2 D;  3L0O A;  2BCO A;  1SMY C;  5EKI A;  2E2D C;  4BA1 I;  5I2Y A;  1HRJ A;  4RH6 A;  1VF5 C;  3MXU A;  2ICI A;  4JYA L;  2Q2I A;  1NAP A;  3J81 c;  2EQS A;  1KNE A;  1V1O A;  1K3B C;  4LFC L;  3GTQ B;  1YNX A;  2E2I H;  2VQE L;  1VQD A;  4I7A A;  2HHH Q;  1IBM Q;  2NB0 A;  3A8K E;  2AWO A;  5E3F A;  1CQV A;  2NTT A;  1ICF B;  4HJA A;  4X64 L;  5IT9 L;  3TBI B;  4YHH Q;  1G91 A;  2JA9 A;  5BR8 Q;  5M9O A;  5A2Q E;  1G2T A;  1T9H A;  5LMN Q;  4HR7 B;  4TQU S;  2R93 G;  4NXN L;  4KKT A;  1ZEQ X;  2WFW A;  2NUC A;  4DNT B;  1AE2 A;  1Z7T A;  3K7A B;  3GTO H;  3I4M G;  1Y8N B;  3OIQ A;  3LWU A;  1U4M A;  1D1K A;  1DCZ A;  1GUN A;  2F4V Q;  1WYD A;  4XDX A;  4R1J A;  3GTL B;  1A0I A;  3A0J A;  3MEH A;  4U67 3;  3JAM L;  2KCT A;  3E9H A;  3S1R H;  1OXX K;  3TP6 A;  4IFD G;  3PUW A;  1X3G A;  3ULJ A;  5J39 A;  3W5O A;  1O7L A;  2B63 B;  2MUY A;  4KMU C;  4YCU A;  1LLR D;  2F0P A;  3W1B A;  2OEO A;  3I4L A;  4X62 Q;  1PZK D;  1PXU A;  1WTR A;  3TDQ A;  4LMQ D;  1EU3 A;  2Q2U A;  2F0G A;  1V43 A;  2DGY A;  4KJN A;  3J81 E;  4XYQ A;  3DHQ A;  3VR6 A;  4JOI A;  4DR3 Q;  4JI4 L;  5HUR A;  1MI2 A;  4OEM B;  2KEC A;  1IYU A;  1HNX L;  3H3V I;  3MFY A;  1F9R A;  4IQZ A;  4NDX A;  4YWK A;  4DV2 L;  1K0S A;  4ZYS A;  3EN2 A;  4R4Q A;  1I3Q H;  5IGG A;  4QUC A;  1ICW A;  1HJP A;  1VQG A;  1VQI A;  2AKW B;  1MSH A;  1BKB A;  2C35 B;  3D3R A;  4K8J A;  1EIF A;  1UEA B;  5TSS A;  1EEI D;  4LF6 Q;  3T13 A;  2ZJR A;  2EJM A;  2WKC A;  3HZX A;  2RDG A;  2WAQ B;  3PO3 B;  4C3H B;  2JSO A;  5CGK A;  2QCP X;  3GTP B;  1XTC D;  2J0T D;  1KRS A;  1KLU D;  1TXY A;  2N8N A;  4ULL A;  2EY1 A;  4G7Z C;  1KNA A;  2HUG A;  1VQL A;  4A3F B;  2GVA A;  3CC7 A;  4JBK A;  3JAM i;  5LL6 S;  1TS5 A;  4IFD J;  4M1U B;  5COR A;  2A73 B;  1YEZ A;  5BN4 A;  3RNU A;  2EYO A;  4OIJ A;  1KAB A;  4A3B G;  2B2W C;  4HIO A;  4RKL A;  3CW2 C;  4KHZ A;  1K83 H;  2L15 A;  4C56 C;  4IUT A;  3HG9 A;  4MTN A;  2EYF A;  4A3M H;  2RHS B;  2BH8 A;  2JA7 H;  3OW7 A;  1CKN A;  3PUV A;  1NMG A;  3CQZ B;  4BXX H;  2NN6 H;  4A3L G;  4XT1 B;  1GO3 E;  4CKC A;  2EYM A;  2WV6 D;  5K36 G;  1I50 B;  1HA6 A;  4J6H A;  1SFO H;  1X3Q A;  3HKZ B;  3MC0 B;  5ISR A;  1WCM B;  3SK4 A;  2QIL A;  2DY7 A;  1VMC A;  2IT1 A;  2PCF B;  1F9P A;  1QOH A;  3GD7 A;  4KTA A;  2K04 A;  4PMC A;  2EXD A;  3BDC A;  5IWA L;  1SYC A;  2NZO A;  1XJV A;  5FO8 B;  1LM0 A;  1BVS A;  1RKN A;  3CRK C;  1II3 A;  1Y1V G;  3NUC A;  2NVT B;  5FOB B;  1OTC A;  4DUZ L;  1CTM A;  3KBX A;  4DR2 Q;  3W1G A;  2SDF A;  2OXP A;  2R93 H;  2Z6B A;  3TQY A;  2IWH A;  3C3L A;  3S1M B;  1DXM A;  4PZ8 A;  1H9J A;  1SXT A;  1Z47 A;  2K50 A;  4JK1 C;  1S5F D;  1WI5 A;  1X6O A;  3S15 H;  5C44 G;  3CPW A;  2F03 A;  2KHI A;  2K52 A;  2NYZ D;  3MEF A;  4B3T Q;  1HA5 A;  4IFD H;  3CD6 A;  3KF6 A;  4A93 B;  5CBA E;  1O7Y A;  1SN8 A;  4LNQ A;  3TS2 A;  2F0F A;  3FKI B;  3AEV A;  2ZXP A;  4DV0 L;  2F3V A;  5T1I A;  4LFB L;  4O0A A;  5EPK A;  1UE7 A;  1FNU A;  2K7V A;  4MIU A;  4C3J G;  5ELB A;  1STN A;  5EBC A;  1VQ6 A;  2B8F A;  2CVR A;  5FK9 C;  4DXF A;  5NUC A;  1X65 A;  3M7N A;  1XMQ L;  4KLK A;  4JI3 Q;  3QOL A;  1LAB A;  1VQA A;  4HTH A;  4DV3 Q;  2K75 A;  4K6L A;  1QVC A;  2A6E C;  2Y0S G;  3D4R A;  4BWG B;  4C1N I;  1JQY D;  2HIX A;  1IXR A;  4DK0 A;  1CM9 A;  2K01 A;  2F0O A;  1H9K A;  4IJH A;  2RCF A;  4P2C B;  3CCQ A;  1XPO A;  3I72 A;  3ONA B;  3WOE A;  1QZG A;  1XNQ L;  3K6O A;  2L0C A;  4KI0 A;  2DNC A;  3A7A B;  3EQL C;  4FO2 A;  1SND A;  4MN3 A;  4X66 Q;  3HOV H;  3HOW G;  4QCL A;  3K5N A;  5JOB A;  2UU9 Q;  1HR0 L;  3NEL A;  1TWC B;  3BVG A;  4CDD C;  1VQ7 A;  2F0L A;  2R61 A;  4UP9 A;  1D6E C;  1LTR D;  5E7N A;  4KV6 A;  1PTO C;  4NXM Q;  4DF7 A;  1F2M A;  3SDZ A;  3T4A C;  4A3B H;  2VB2 X;  2B63 H;  4A76 A;  2CQO A;  4HMJ A;  4JVZ A;  2X6L A;  4FNF A;  1WTW A;  2J4X A;  4ZRZ A;  4XIG S;  2Z4H A;  4JOI C;  3S9W A;  1B50 A;  3S16 H;  5JVG 3;  1D5Z C;  1Q12 A;  2UUA Q;  1EIY B;  1HPC A;  1YJ9 A;  3P7J A;  2AUK A;  4LF4 L;  2BE5 C;  1EYC A;  1M90 C;  4U68 A;  5K36 H;  4LF7 L;  3K5M A;  4YY3 Q;  1K8G A;  5M5Y H;  5J22 A;  2F0D A;  1PH3 A;  1SAP A;  4HN7 A;  2FJ2 A;  4ABN A;  2RHQ B;  2E2I B;  3KLR A;  2B2Y A;  4JI8 L;  3P20 A;  1XXG A;  4DR5 L;  4LF9 L;  3TP8 A;  3S17 B;  1GJX A;  3U9S A;  2R7F A;  5IYD G;  1DOK A;  1XNR L;  2HCI A;  4Q0F A;  5IP9 G;  3I4N H;  2RDF A;  3A8J E;  1Y1V H;  2YV5 A;  2B29 A;  2UXD L;  1V1P B;  4HMI A;  2O5J C;  1TVX A;  4ZCK A;  1VQB A;  4DV5 Q;  3CHB D;  3MVV A;  2OWO A;  5KNC A;  2QEX A;  1I4R A;  3GTO B;  2ASB A;  3IRB A;  4P72 A;  4EQP A;  2D5D A;  1NR2 A;  5GAH C;  1NSN S;  5C44 H;  2JJQ A;  1CT1 D;  3Q0A A;  1BBU A;  1OXV A;  1B7Y B;  3S1R B;  5KYL A;  4DR7 L;  2X6G A;  4K8I A;  3PUX A;  4RA8 A;  3H91 A;  1O80 A;  4JI1 Q;  3NBH B;  2VQF Q;  1E2Z A;  5ELE A;  1J5E L;  5G3L F;  4HED A;  1CK1 A;  3UE1 A;  2A74 C;  1BCP D;  3CC4 A;  3CF5 A;  4O2D A;  1P16 A;  5I6Y A;  3K7U C;  4L5T A;  1DOM A;  4JG2 A;  1Q7Y C;  4C3J H;  2WAC A;  4L8J A;  3IAY A;  1HR0 W;  4QQB X;  2DJF C;  1CHP D;  4P74 A;  5C4X H;  4QL5 A;  5IGE A;  1JJ2 A;  3R2T A;  2L4N A;  5C0X J;  3E0E A;  2G5D A;  1D2B A;  3SK6 A;  3NPP A;  3SVM A;  5M3F G;  3NQT A;  2L9H A;  2F3I A;  2N3S A;  4FF4 A;  1JE4 A;  2Z9H A;  1C0A A;  3CME A;  3NQI A;  1I3Q B;  2QGQ A;  4C3I G;  2PW7 A;  1M8A A;  2QW7 A;  3D0F A;  2L11 A;  2IJ0 A;  2JXM B;  1FYC A;  1STG A;  2YTY A;  4GLA C;  5CV4 A;  1EWH A;  5M5X H;  1A2U A;  1EQR A;  3SK5 A;  5KRU A;  2RVL A;  2O4X A;  1E2V A;  3Q8D A;  2IL8 A;  3QR8 A;  4B3M Q;  1IHZ A;  4LF8 L;  4DAV A;  4G57 A;  2P5Z X;  3QJY A;  2K32 A;  1IBK Q;  2F0Q A;  2ZXO A;  1WTQ A;  3KDF A;  4ME5 A;  1I6V C;  2E74 C;  3J7Y W;  4KHP L;  1E2W A;  4ID6 A;  4JI0 L;  3FVQ A;  3HOW H;  2K05 A;  2DUD A;  3BYT B;  1WVL A;  1EIH A;  2PZW A;  5E1F A;  2PZU A;  4GNX B;  2EXZ A;  3H3V C;  1S5E D;  4MTK A;  3I70 A;  1KC8 C;  4GKJ L;  2I5M X;  1AZP A;  1SE3 A;  3KF8 B;  2LXJ A;  3J80 c;  4HIM A;  4KJO A;  4H02 A;  1QUQ B;  1X9N A;  4A93 H;  1IYV A;  4AQY Q;  5GAG C;  2F0M A;  3I55 A;  1YIJ A;  1K83 B;  1I4X A;  3HKZ E;  3FKI H;  3HOY B;  4JI2 Q;  2LS0 1;  4A3M B;  5D3I B;  1X3F A;  1R9T B;  2JA7 B;  1D1I A;  4KKS A;  2F0W A;  4K2K A;  4X65 L;  2EVB A;  3F2D A;  4A3E H;  4LW1 A;  1I4Q A;  3NTH A;  1SFO B;  2V4D A;  1JOQ A;  5C3X A;  1JR0 D;  2CCZ A;  3H15 A;  4DV1 Q;  1PVO A;  2NVY B;  4FDB A;  3EVQ A;  2EPB A;  2F0N A;  4F87 A;  4LFA Q;  5C0X H;  3I56 A;  1NE3 A;  1TT2 A;  1SBB B;  3EA6 A;  1VF7 A;  2A68 D;  1AFP A;  2F0V A;  1HNZ L;  3D31 A;  4OON A;  1ET6 A;  5IYD H;  4A3C G;  4GKK L;  5IP9 H;  3HGB A;  1WTP A;  1PRT F;  1LTL A;  3F2U A;  3NE5 B;  2K5H A;  2O2L D;  3GTJ H;  2R93 B;  1SE2 A;  4FF2 A;  2JA6 G;  3M85 A;  3J80 E;  5EKL A;  3GQB A;  2OQ0 A;  4P73 A;  4DUY Q;  1JMC A;  3I4M B;  5LMU L;  2ZM6 Q;  4A3D H;  3S15 B;  1B4O A;  5DM6 3;  4GLX A;  4CDC C;  1LV9 A;  2RKS A;  3M3Y H;  4JI5 L;  4DAM A;  3HS0 C;  2VUM G;  4BBS G;  1QNK A;  2CH4 A;  5CV7 A;  2IX0 A;  1K8O A;  1HUN A;  3NEM A;  4TKO B;  5I6W A;  2TMP A;  3WDN A;  4JI6 L;  1GD7 A;  4BY7 G;  1N8R C;  2Z6K A;  3GO5 A;  5ELO A;  1FR3 A;  1JWU D;  1Q86 C; 
#chains in the Genus database with same CATH homology
 1STE A;  3PIO 3;  5BN3 A;  1F9Q A;  2EY5 A;  2EOT A;  1DYQ A;  1LTB D;  2B2Y C;  4PV1 C;  3RUZ A;  1A3U A;  1QNU A;  1RTN A;  2YYZ A;  1O7Z A;  1RTO A;  3TME A;  2GA4 B;  2BOS A;  3EFX D;  3SR1 A;  3TZD A;  3BZD B;  1EWC A;  2BA0 A;  2B8G A;  2HDM A;  3MXP A;  2O5I C;  1HXY D;  1J9O A;  3RMH A;  3MAQ A;  2L1B A;  2CQA A;  5FLX L;  3HOV B;  4KY7 A;  3DWQ A;  4NMZ A;  1BCP C;  4LK1 C;  3E6Z X;  1I4G A;  1TS3 A;  2JEA I;  3D6W A;  2AUJ D;  1Q1B A;  1Y8O B;  1ILQ A;  4NKL A;  4A3B B;  4RGT A;  2IX1 A;  5EQ0 A;  1ONL A;  3NSW A;  1SNO A;  4PNY A;  2F0H A;  3S16 B;  4KN4 C;  3K58 A;  5IGD A;  2QF7 A;  1WD1 A;  1TR5 A;  5K5P A;  2ZXR A;  2IX3 A;  1JOO A;  2RA4 A;  5T1G A;  4OO1 H;  5M5Y B;  3LNN A;  2NTS A;  2H4O A;  1TWF B;  3AB9 A;  3QWN A;  3NWT A;  2A69 D;  4N9P A;  1CA5 A;  1HFG A;  4IAL A;  2RQX A;  3MXG A;  3Q22 A;  2WIN B;  1EY7 A;  3KLS X;  3HRZ C;  3BG3 A;  2X69 A;  1Q8I A;  3I4N B;  2XWJ B;  2SOB A;  1Y1V B;  2M2L A;  2Z4I A;  1DJR D;  2FHT A;  4XQN A;  5CYU A;  2C5C A;  4IUQ A;  5E4W C;  4MHE A;  1WTX A;  2SEB D;  2KCN A;  5C44 B;  3A8I E;  1YNJ C;  5JAV A;  2XSC A;  4C1N K;  4K14 A;  1LTI D;  1UUP A;  4ILW A;  3OMG A;  1KAA A;  2F4I A;  4C3J B;  4TSS A;  5IT9 E;  2EY6 A;  1G8Z D;  2XRS D;  5C4X B;  4M8A A;  1ZYR D;  1OXT A;  2LFN A;  3GTK B;  4RHR A;  5KEE A;  2NVX B;  2BDO A;  2Y0S B;  5M5X B;  2EYP A;  1PRT B;  3K57 A;  1A3V A;  1F9S A;  3VYU A;  5I9P A;  4EQN A;  1PTO H;  3P75 A;  4PMW A;  4DFA A;  5HGT A;  1IL8 A;  4H0L C;  5CV8 A;  5CC4 A;  3HP3 A;  2A6H D;  5EJW A;  1KDA A;  3R3O A;  3HOW B;  2F0S A;  3KUP A;  1HQM C;  5G3L D;  4HAE A;  3I91 A;  4KY5 A;  2KVM A;  1KDB A;  4IUV A;  3PMF A;  4O42 A;  1F2Z A;  2K1B A;  2ID0 A;  4XXE A;  1WTO A;  3IKJ A;  5FO7 B;  3VR4 A;  4A3E B;  3SXH A;  2TSS A;  4HSP A;  4RGO S;  1SYB A;  1EY8 A;  2PYK A;  2PZT A;  2HCC A;  3MZ5 A;  4I7Z C;  2KHS A;  2L55 A;  4OL7 A;  1RHP A;  1TII D;  2OT2 A;  5C4Z A;  3TSS A;  4Q5V A;  3VR5 A;  1FGB D;  1ET9 A;  1SJH D;  4XQJ A;  1A6X A;  4B08 A;  4KD4 A;  1PMR A;  4WFN 3;  1TKW B;  3GTJ B;  2D2C C;  1PTO F;  1B53 A;  1VDZ A;  4DA2 A;  3K59 A;  4A3D B;  5IGF A;  2CW0 D;  2D9U A;  2MJ8 A;  1NUC A;  3M3Y B;  2PW5 A;  1GUG A;  2NBF A;  4DAP A;  3I73 A;  1EY0 A;  4J8Q A;  4ZUI A;  2IW3 A;  2EYL A;  3DWA A;  2A69 C;  1RJT A;  3KBG A;  2VB3 X;  1YNN D;  3OOC A;  5IGB A;  5DNF A;  1H9S B;  1JC7 A;  1EYD A;  1HTL D;  1LO5 D;  5KIX A;  4FYD A;  4TRD A;  1AW7 A;  1SYD A;  2FMC A;  4F8M A;  5F2D A;  2Q8R E;  1B9M A;  5BN5 A;  3K5L A;  1EOT A;  5M3F B;  2PPB C;  3U9O A;  1CFM A;  1DON A;  1PRT D;  2D62 A;  2MP1 A;  1U9R A;  3FDT A;  4C3I B;  3J7A V;  1RD9 D;  4OIK A;  1FD7 D;  3QB3 A;  1PZI D;  2Q8I B;  1G6Z A;  3V96 A;  3C46 A;  2LMC B;  1IW7 D;  1C48 A;  4KD3 A;  3PIP 3;  3NHH A;  3FMC A;  2G9H D;  3LX0 A;  5EGT A;  3WOF A;  3Q23 A;  1SYG A;  2F0E A;  2L5T A;  3VYR A;  3VA7 A;  2E76 C;  1SMY D;  1LTS D;  5DEH A;  3DMU A;  2F0I A;  1K8M A;  1LTT D;  4KKU A;  5ELC A;  2KJX A;  5KNB A;  2AWN A;  4HSV A;  1XX8 A;  4K5W A;  1ZYR C;  1C4Q A;  1X32 A;  4WRD A;  3VYS A;  4QB4 A;  3RD4 A;  5CV9 A;  3K5O A;  2QEJ C;  1HHV A;  1CA6 A;  3C2P A;  3MFG A;  2F3W A;  4YIJ A;  1H9M A;  1STH A;  3R2I A;  2DN8 A;  3W2D A;  3A55 A;  4R9W A;  4KN7 C;  4DNR B;  2A6H C;  1XWE A;  3ND9 A;  2VXW A;  2K5D A;  5A35 A;  2FIN B;  1SE4 A;  5CV5 A;  1TWG B;  4FXK C;  3CU7 A;  4CBV A;  4RWS C;  1S5B D;  1B2T A;  2G9D A;  3OWF A;  2NWG A;  4B9W A;  3G6J B;  1SSO A;  4CHT B;  4H44 C;  2ENB A;  4ZK9 B;  1AEX A;  2JA6 B;  5I4D A;  4G4K A;  1EQV A;  5IOD A;  5IOC A;  4QMG A;  1BBX C;  1A2T A;  3M4Y A;  2EYH A;  2BA1 A;  2KCC A;  1D5M C;  2XWB B;  4ZQ3 A;  2VUM B;  2DY8 A;  2EDG A;  3BDO A;  5CMD A;  5C4H A;  2C9O A;  2XRQ D;  4LJZ C;  1GUW A;  1EY9 A;  1HTP A;  1FNW A;  1DZ1 A;  5JPM C;  1UAP A;  5A2Q L;  4BY7 B;  2L12 A;  3FPU B;  2NN6 I;  1BO0 A;  3ERQ A;  3KLS A;  2I46 A;  1V1P A;  1VMP A;  3RZO B;  3HEJ A;  1AN8 A;  3I8Z A;  1F2Y A;  2JEB I;  4L6T B;  4V19 0;  1B9N A;  4PMB A;  2QKI C;  1S4Z A;  3OMC A;  1U4L A;  2WP8 J;  4RHS A;  1AZQ A;  1BNZ A;  5CBE E;  3GTM B;  1PTO B;  4CJ2 C;  4DGZ A;  1B3A A;  1CQF A;  4KY6 A;  3NBH A;  1XYI A;  2BDN A;  1SYE A;  1BXT A;  4X3T A;  3J81 L;  1L0X B;  4RAU C;  1CZW A;  2B39 A;  4DK1 A;  2EE1 A;  4RGN A;  4G7O C;  1STB A;  5LHY 1;  1A3T A;  1J8I A;  5I2X A;  4K5X A;  4A3I B;  1GXD C;  4RGM A;  2Q8T A;  4FF3 A;  3NXW A;  1HFN A;  3PUY A;  3H6M A;  2OF1 A;  3E5S A;  1QWY A;  4IFD I;  4OHJ A;  4CJ1 B;  1JOK A;  2KQ3 A;  1EY6 A;  2K5Q A;  2R6G A;  4EQO A;  3MHB A;  2QDB A;  2SNM A;  3R93 A;  3BYY B;  4RCN A;  3R8B A;  1CI3 M;  1E0B A;  4NP5 A;  5M3M B;  4G7H C;  5IIF A;  5KND A;  3URY A;  5AFW A;  4QIW B;  2FMM A;  4FVM A;  5JEA G;  1QCB D;  3HOU B;  1F2L A;  4K2L A;  5D14 A;  1Y69 U;  3PUZ A;  4BS9 A;  3K0Y A;  4A3G B;  2VNU D;  1WTV A;  3P1H A;  1EYA A;  3L9A X;  1BCP F;  3KF8 A;  3OWE B;  1BR9 A;  4FXG C;  3GP7 A;  3NK9 A;  4K5V A;  4R8I A;  3NBI A;  3ITP A;  5DM7 3;  5JVH 3;  2XVS A;  3IFT A;  1JCK B;  1IKL A;  1PDQ A;  1SNC A;  1O78 A;  1GUS A;  2K03 A;  1TS2 A;  3OIP A;  2Z1C A;  4A3J B;  3G7L A;  5C5M A;  4WOR A;  4KK7 A;  4ZLT F;  1MGS A;  1SEB D;  4BA2 I;  3AMU A;  2A6E D;  2WKD A;  1QJO A;  5LL6 X;  3D4D A;  3PO2 B;  4XYO A;  1HUM A;  1H9R A;  2RDH A;  5JEA J;  2KEE A;  4XQQ A;  2LKV A;  1Q90 A;  3TP7 A;  2PO4 A;  3ND8 A;  4CKB A;  2CHB D;  3FRP B;  2JYO A;  3Q24 A;  2LY7 A;  1RDP D;  2PQE A;  3M4O B;  3S2D B;  2KOL A;  3M7G A;  1ZXT A;  3A56 A;  2JA5 B;  1PTO D;  4FXD A;  3S1Q B;  4IN3 A;  1TY0 A;  1W6K A;  3N6R A;  4DU9 A;  2M00 A;  2MHV A;  5CV6 A;  1EIG A;  3T16 A;  3RLF A;  3IL8 A;  3PV0 A;  4WJW A;  2F0K A;  2IPK D;  5EPL A;  3DXJ C;  3L7Z C;  2R3Z A;  2B2V A;  4JBW A;  2K5W A;  2BE5 D;  1SNQ A;  1X3P A;  1PLF A;  4O1N A;  1ENC A;  1TS4 A;  5JPN C;  1LT6 D;  4UAI A;  4EVO A;  4DXG A;  2XN9 C;  2MGS A;  1R4Q B;  1BUV T;  2A68 C;  3KK7 A;  1ESF A;  2DNE A;  1LTA D;  2K33 A;  3S2H B;  1L0Y B;  1UNS A;  2HQE A;  1F77 A;  4ZAI A;  1JWM D;  5JEA H;  3D8G A;  3VR3 A;  3E0J A;  1STY A;  3X3M A;  3H0G B;  2M9V A;  3SE0 A;  5FLX E;  2MPM A;  1V8Q A;  5C6A A;  3DEO A;  4QF4 A;  3H09 A;  1SNM A;  1KDC A;  2B2T A;  3JAM E;  1U4P A;  2J7Z A;  1OXS C;  2A5H A;  3X3N A;  3D4W A;  3MXN A;  4E6I A;  3ERO A;  4BY1 B;  2JA8 B;  4X3K A;  4EGV A;  1M4V A;  1EFI D;  4C3H G;  4CGY B;  1TWA B;  2XIW A;  4I65 A;  5D65 A;  3A7L A;  3V05 A;  4CJ0 B;  1TWH B;  3SK8 A;  1DOL A;  3VA5 A;  1SYF A;  2Z8L A;  5EPJ A;  1R4P B;  3BDL A;  4IUP A;  1ILP A;  1CZG A;  5M5W B;  3AU7 A;  4V0B A;  1I6H B;  1KLG D;  2ZT9 C;  3QOJ A;  2RBM A;  1GHJ A;  3C1F A;  4CKE A;  4IUU A;  2F0U A;  3BVM A;  5ELF A;  2B2U A;  5KGU A;  3NTK A;  1GOZ A;  4FF1 A;  4Y7N B;  3DUZ A;  3H94 A;  1BDO A;  2YU9 B;  2F1M A;  4RCO A;  3BS1 A;  5EKK A;  2KA7 A;  3TN2 A;  1I4H A;  3DM1 A;  5E4X A;  1S5C D;  1JWS D;  1Q3L A;  1BCP B;  1QG7 A;  1EQT A;  1ZKO A;  5C0X I;  5J1Z A;  4DN4 M;  1S5D D;  4F7X A;  4DAY A;  1PFM A;  1FNV A;  3VYT A;  1EU4 A;  1Q1E A;  1Z6H A;  2PNR C;  4C2M B;  1PFB A;  3I3C A;  1BOS A;  3A54 A;  5C4J B;  3NWS A;  1ESR A;  5C3W A;  1U4R A;  4Z9C B;  3HOZ B;  2EYJ A;  1OXU A;  2PMZ B;  1ENF A;  1QE6 A;  4AYB B;  2SNS A;  3BVZ A;  5FKA C;  4ZKB B;  3GV6 A;  5C5L A;  4IUN A;  1T5E A;  2RSO A;  3S1N B;  1A15 A;  2R92 B;  3GTG B;  3T51 B;  4XTC S;  3N52 A;  2WB1 B;  4H7B A;  3O13 A;  3SHL A;  2F0T A;  3TP5 A;  3DEP A;  3MA2 B;  2XNA C;  3OHX C;  2JP1 A;  1D5X C;  1GUT A;  4X3S A;  1EL0 A;  4HCS A;  5I9O A;  3VR2 A;  3SEB A;  1EY4 A;  5C0X G;  1BF4 A;  2B2V C;  1Y1W B;  5IGC A;  4HCE A;  1VCI A;  3UI2 A;  4ODG A;  5ELD A;  1RCV D;  1JB3 A;  4KHV A;  1CHQ D;  2JE6 I;  4ZKC B;  3T53 B;  5D3D A;  3CRL C;  2AQ1 B;  3T56 B;  1G29 1;  4PQX A;  3FEW X;  1SNP A;  2N55 A;  4QUF A;  4A3K B;  2NZ1 D;  4BBR B;  1HCZ A;  4OO1 I;  3J80 L;  1PFN A;  4X3U A;  1LAC A;  1HQR D;  2RSN A;  3GV3 A;  5KYI A;  4J1M A;  3CKI B;  3DWP A;  1I4P A;  4UDU C;  5C3E B;  3D6C A;  1DM0 B;  1AP0 A;  2B2T C;  3W3A A;  1MBY A;  1ENA A;  4L63 B;  1EZ6 A;  3S14 B;  1JOR A;  1QB5 D;  1G2S A;  2AQ3 B;  2E2J B;  2KUM A;  1QIL A;  1LT3 D;  2ICE C;  5CR3 A;  2EJF C;  4ZUJ A;  2K28 A;  1H9S A;  3V2T A;  5EBD A;  4R8N A;  4N9T A;  1LTG D;  1RF2 D;  2EY2 A;  3QO2 A;  4FP5 D;  2FFK B;  3OPO A;  4BBS B;  3MTS A;  1TY2 A;  2B2U C;  3HOX B;  2H1E A;  1NR4 A;  3QG1 A;  1IKM A;  5COY A;  4B9X A;  4RKB A;  2B2W A;  1SDF A;  2AQ2 B;  4RFB A;  1OO9 B;  1DD2 A;  1EZ8 A;  4XT3 B;  3EJI A;  2E75 C;  1TQO A;  5DAU A;  4S3S A;  4GZY C;  2I07 B;  2EJG C;  5JJZ A;  3ZYY X;  3RZD B;  1Y8P B;  2CW0 C;  1ROD A;  4OO1 G;  1SJE D;  1YNJ D;  3J7A F;  1B1Z A;  3NP8 A;  2E2H B;  1PZJ D;  3Q6S A;  2HDL A;  1LT5 D;  5FO9 B;  1T5X D;  1NCV A;  1STA A;  2R7Z B;  1YNN C;  3L3O C;  1GHK A;  1EEF D;  1ML0 D;  1GUO A;  1WD0 A;  1MSG A;  2F0J A;  2NVQ B;  3TZU A;  2KED A;  1C8C A;  1KTK A;  1W6J A;  4IZ8 A;  1BQQ T;  4F88 A;  1TU2 B;  3C1E A;  3FPP A;  3OSO A;  4H13 C;  1JIC A;  4NW2 A;  1PRT C;  3NTI A;  2EZV A;  1EY5 A;  3I90 A;  4K6D A;  1PYW D;  4OGQ C;  4LAA A;  4IUR A;  2N88 A;  3MWY W;  3LWE A;  1LT4 D;  3IFD A;  3QIA A;  1IW7 C;  2WII B;  1B44 D;  2K6A A;  2NN6 G;  1MD2 D;  2BCO A;  1SMY C;  5EKI A;  4BA1 I;  2E2D C;  5I2Y A;  1HRJ A;  4RH6 A;  1VF5 C;  3MXU A;  2ICI A;  1NAP A;  1KNE A;  1V1O A;  3GTQ B;  2NB0 A;  3A8K E;  2AWO A;  5E3F A;  1CQV A;  2NTT A;  5IT9 L;  3TBI B;  1G91 A;  5M9O A;  5A2Q E;  1G2T A;  4HR7 B;  4TQU S;  4KKT A;  1ZEQ X;  2NUC A;  4DNT B;  1Z7T A;  3K7A B;  1Y8N B;  3OIQ A;  3LWU A;  1U4M A;  1D1K A;  1DCZ A;  1GUN A;  4XDX A;  3GTL B;  3MEH A;  4U67 3;  3JAM L;  1OXX K;  3TP6 A;  4IFD G;  3PUW A;  5J39 A;  1O7L A;  2B63 B;  2MUY A;  4KMU C;  1LLR D;  2F0P A;  2OEO A;  3I4L A;  1PZK D;  1PXU A;  1WTR A;  3TDQ A;  4LMQ D;  1EU3 A;  2F0G A;  1V43 A;  4KJN A;  3J81 E;  4XYQ A;  3DHQ A;  3VR6 A;  5HUR A;  1MI2 A;  2KEC A;  1IYU A;  3MFY A;  1F9R A;  4IQZ A;  4NDX A;  4ZYS A;  5IGG A;  4QUC A;  1ICW A;  1MSH A;  3D3R A;  4K8J A;  1UEA B;  5TSS A;  1EEI D;  3T13 A;  2EJM A;  2WKC A;  3HZX A;  2RDG A;  2WAQ B;  3PO3 B;  4C3H B;  2JSO A;  5CGK A;  2QCP X;  3GTP B;  1XTC D;  2J0T D;  1KLU D;  4ULL A;  2EY1 A;  4G7Z C;  1KNA A;  2HUG A;  4A3F B;  5LL6 S;  1TS5 A;  4IFD J;  4M1U B;  5COR A;  2A73 B;  5BN4 A;  2EYO A;  4OIJ A;  1KAB A;  2B2W C;  4RKL A;  4KHZ A;  4C56 C;  4IUT A;  3HG9 A;  2EYF A;  3OW7 A;  3PUV A;  3CQZ B;  2NN6 H;  4XT1 B;  4CKC A;  2EYM A;  2WV6 D;  5K36 G;  1I50 B;  1HA6 A;  4J6H A;  1X3Q A;  3HKZ B;  3MC0 B;  5ISR A;  1WCM B;  3SK4 A;  2QIL A;  2DY7 A;  1VMC A;  2IT1 A;  2PCF B;  1F9P A;  1QOH A;  3GD7 A;  4KTA A;  2K04 A;  4PMC A;  3BDC A;  1SYC A;  5FO8 B;  1RKN A;  3CRK C;  1II3 A;  3NUC A;  2NVT B;  5FOB B;  1CTM A;  3KBX A;  2SDF A;  2OXP A;  2IWH A;  3C3L A;  3S1M B;  1DXM A;  1H9J A;  1SXT A;  1Z47 A;  4JK1 C;  1S5F D;  2F03 A;  2NYZ D;  1HA5 A;  4IFD H;  4A93 B;  5CBA E;  1O7Y A;  2F0F A;  3FKI B;  2ZXP A;  2F3V A;  5T1I A;  5EPK A;  1FNU A;  2K7V A;  4MIU A;  4C3J G;  5ELB A;  1STN A;  5EBC A;  2B8F A;  2CVR A;  5FK9 C;  4DXF A;  5NUC A;  3M7N A;  3QOL A;  1LAB A;  4HTH A;  4K6L A;  2A6E C;  3D4R A;  4BWG B;  4C1N I;  1JQY D;  4DK0 A;  1CM9 A;  2K01 A;  2F0O A;  1H9K A;  4P2C B;  3I72 A;  3ONA B;  3WOE A;  3K6O A;  2L0C A;  4KI0 A;  2DNC A;  3A7A B;  3EQL C;  4FO2 A;  1SND A;  4MN3 A;  4QCL A;  3K5N A;  5JOB A;  1TWC B;  3BVG A;  2F0L A;  2R61 A;  1D6E C;  1LTR D;  4KV6 A;  1PTO C;  4DF7 A;  1F2M A;  3SDZ A;  3T4A C;  2VB2 X;  4HMJ A;  2X6L A;  4FNF A;  1WTW A;  2J4X A;  4ZRZ A;  4XIG S;  2Z4H A;  3S9W A;  1B50 A;  5JVG 3;  1D5Z C;  1Q12 A;  1HPC A;  3P7J A;  2AUK A;  2BE5 C;  1EYC A;  4U68 A;  5K36 H;  3K5M A;  5J22 A;  2F0D A;  1SAP A;  4HN7 A;  2FJ2 A;  4ABN A;  2E2I B;  3KLR A;  2B2Y A;  3P20 A;  1XXG A;  3TP8 A;  3S17 B;  1GJX A;  3U9S A;  1DOK A;  2HCI A;  4Q0F A;  2RDF A;  3A8J E;  1V1P B;  4HMI A;  2O5J C;  1TVX A;  3CHB D;  3MVV A;  5KNC A;  1I4R A;  3GTO B;  4EQP A;  2D5D A;  1NR2 A;  1NSN S;  1CT1 D;  3Q0A A;  1OXV A;  3S1R B;  5KYL A;  2X6G A;  4K8I A;  3PUX A;  4RA8 A;  3H91 A;  1O80 A;  1E2Z A;  5ELE A;  5G3L F;  4HED A;  1CK1 A;  2A74 C;  1BCP D;  5I6Y A;  1DOM A;  2WAC A;  4L8J A;  3IAY A;  1CHP D;  5IGE A;  3R2T A;  2L4N A;  5C0X J;  1D2B A;  3SK6 A;  3NPP A;  3SVM A;  3NQT A;  2L9H A;  4FF4 A;  1JE4 A;  3NQI A;  1I3Q B;  4C3I G;  2PW7 A;  1M8A A;  2L11 A;  2IJ0 A;  2JXM B;  1FYC A;  1STG A;  5CV4 A;  1EWH A;  1A2U A;  3SK5 A;  5KRU A;  2RVL A;  2O4X A;  1E2V A;  2IL8 A;  1IHZ A;  4DAV A;  4G57 A;  3QJY A;  2K32 A;  2F0Q A;  2ZXO A;  1WTQ A;  4ME5 A;  1I6V C;  2E74 C;  3J7Y W;  1E2W A;  4ID6 A;  3FVQ A;  2K05 A;  3BYT B;  1WVL A;  1EIH A;  2PZW A;  5E1F A;  2PZU A;  2EXZ A;  3H3V C;  1S5E D;  3I70 A;  1AZP A;  1SE3 A;  4KJO A;  1IYV A;  2F0M A;  1K83 B;  1I4X A;  3HOY B;  2LS0 1;  4A3M B;  5D3I B;  1R9T B;  2JA7 B;  1D1I A;  4KKS A;  2F0W A;  4K2K A;  2EVB A;  1I4Q A;  3NTH A;  1SFO B;  2V4D A;  1JOQ A;  5C3X A;  1JR0 D;  2NVY B;  3EVQ A;  2EPB A;  2F0N A;  4F87 A;  5C0X H;  1TT2 A;  1SBB B;  3EA6 A;  1VF7 A;  2A68 D;  1AFP A;  2F0V A;  3D31 A;  1ET6 A;  3HGB A;  1WTP A;  1PRT F;  3F2U A;  3NE5 B;  2O2L D;  2R93 B;  1SE2 A;  4FF2 A;  3M85 A;  3J80 E;  5EKL A;  3GQB A;  3I4M B;  3S15 B;  1B4O A;  5DM6 3;  1LV9 A;  2RKS A;  3HS0 C;  1QNK A;  5CV7 A;  2IX0 A;  1K8O A;  1HUN A;  5I6W A;  4TKO B;  2TMP A;  3WDN A;  3GO5 A;  1FR3 A;  1JWU D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...