1SFOH

Rna polymerase ii strand separated elongation complex
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
145
structure length
133
Chain Sequence
b'SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA STRAND
publication title Structural Basis of Transcription: Separation of RNA from DNA by RNA Polymerase II
pubmed doi rcsb
molecule tags Transcription/dna-rna hybrid
total genus 15
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2004-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1sfoH00
5GADC 1VQEA 1AE3A 2JE6I 4IFDI 3NELA 5FJ8G 4AH6A 1YHAA 3K8AA 4JI7Q 4GKJL 3TEHB 2JA5G 2EIFA 3CPFA 2V1CC 4NXNL 2UUBQ 2ZTCA 1VQFA 4DV6Q 3BZCA 1G291 2RHSB 2KBNA 1KQSA 4GS3A 2LXKA 2ASBA 3HKSA 2BH2A 3ULPA 5GQOA 4JI5Q 4A93H 3Q8DA 4GLAC 4K0KL 1N33L 4PG3A 2PNHA 4JI2L 3KDFA 3F2BA 3GDEA 5IYCH 4DKAC 4Y7NH 3SGIA 2WFWA 4DR4Q 4DR7Q 2C35B 2ES2A 1Y1VG 1VS0A 2I5LX 1NMFA 2IX0A 3A0JA 2E2HH 2UUAL 2IHEA 1DGSA 2ZTEA 3J80c 3CC4A 5IYBG 3L2PA 1HZAA 2UXBQ 4YCVA 4TVAB 2ZM6Q 4JI0Q 3AYHB 1XPRA 4B3TQ 3HOVG 3HOZG 4A3DG 4DV5Q 3KF6A 4R4CA 1UE7A 2B63G 4A3JH 1SN8A 4LF4L 5C0XJ 4YWLA 4AIMA 1X9NA 2OCEA 4BXXG 4JI1L 1XTDA 2JK8A 4A3EG 2ZJPA 1SMXA 3D31A 3J7ZC 3M3YH 2UU9Q 1VQMA 4JBMA 1BBUA 1FVIA 1VQ4A 3PF4A 4DV1Q 3H0GG 2B3GA 2BH8A 4HIDA 3G4SA 3KJOA 1QUQA 2R92H 1HZBA 4L5QA 1YHBA 4JI8L 3EBEA 1VQGA 1UWVA 1MJCA 2E2IH 4YY3L 1VQHA 1SFOH 2QGQA 4BY1G 4OO1G 1XMQQ 3TREA 3CCUA 3A5ZB 4JBKA 1N34Q 2RHQB 4B3ML 5IP7G 1VQ5A 1L2FA 4GOPC 3I4NH 4JV5Q 1JE5A 3KLWA 1SRUA 1Q7YC 1WJJA 1N9WA 4UPAA 1HJPA 4DR5Q 1N36Q 1HNXL 3GTOH 2Q2IA 1HZCA 2CWAA 4O0AA 3CCVA 3OTOL 5JJKA 2IHFA 3ZJYC 1TWAH 1A8VA 4QIWE 2WB1E 3UDXA 4JI6L 4R4TA 2AMCB 1GVPA 2D0OA 2D62A 5FLMG 1EUJA 1UEBA 1PHJA 1PH8A 4EX5A 5C44G 4C3HH 4HIKA 1PH6A 4DNIA 1SLJA 2NN6G 4WJ3M 2PQAA 1PH3A 3K80C 2NVYH 1MJEA 2XGTA 5FLXc 1YVCA 4IFDG 1ASYA 4QY7A 1VQ6A 5ELNA 2KHIA 3STBD 2AWNA 3PUYA 4PZ8A 1R9TH 3PO3H 1BVSA 3CCEA 3HOWG 4UY8C 1JMCA 1IXRA 3CC7A 4A3FG 5JJLA 2PI2E 1HNZQ 2K5HA 1L0WA 1UE6A 1VQNA 1P16A 4LWCA 4HJ5A 4IPHA 3S14H 3RR5A 1IL2A 1PYSB 3NBHB 2VQFQ 4P74A 2IT1A 4DUYL 5BR8L 5M3MH 4DR1L 5DLQE 1YITA 5IE8A 5LMNQ 1PFSA 4YWKA 3T1YL 2N8NA 5H1SE 2R93H 3J7A5 3PO2G 3HOUG 1I6HH 3RLNA 2H5XA 4FDBA 3E0EA 4DUZL 1YJNA 3CF5A 1SE8A 3D0FA 3PGZA 1NY4A 2JA5H 3ER0A 1M90C 2GN5A 4X64Q 1W3SA 1OXUA 3A74A 1KXLA 2F4VQ 2YTYA 4YCUA 1HNWQ 2UXDQ 3TS0A 5IWAL 2OTJA 4P72A 1VQPA 1J5EL 4POGA 5IYDG 4A3CG 2I0QA 3CW2C 4OWXB 3ULLA 1X55A 1PH4A 1N32Q 1W2BA 1XPOA 3S1RH 1FGUA 2K75A 5M3FG 1OTCA 4JI4Q 3GTMH 1Y1VH 3FKIG 5JEAG 2PQAB 1OXTA 2K14A 4KI0A 2KCMA 1I94L 1VQIA 3AEVA 2IY5B 1S72A 5IYBH 1MIUA 1MKHA 1BBWA 3KF8B 4NB3A 3HOVH 3HOZH 4A3DH 4B3RQ 1IBML 4GKKQ 1CKMA 1Q1EA 4YCWA 4HJAA 4JG2A 2B63H 4BA1I 3VDYA 1WFQA 3HKZG 1ASZA 3I4MG 2K52A 1IBLL 2QEXA 1V43A 3PUXA 1Q82C 3M85A 1QVGA 2NVXH 4TQUS 1X3GA 3CXCA 1PH5A 4BXXH 4K0KQ 1U5KA 4GOPB 1A63A 4JI2Q 4C2MH 4YHHQ 4MZ9A 4A3EH 4DR2Q 3CPWA 1Q81C 1QVCA 3UE1A 4GLXA 4JOIA 3RNUA 2OTLA 1Q12A 4LF7L 1C0AA 1XJVA 4OWWB 1E1TA 4ME3A 4PMWA 4DV2L 3H0GH 1EFWA 1XNRL 3ICEA 3J81i 4LFCQ 4C3JH 4A3MH 2E5LQ 1CKNA 2Q2UA 2RCNA 4R4QA 3DM3A 1L1OC 4DR6L 4BY1H 1X6OA 3CCSA 2ZJQA 1K8AC 2UXCQ 3FHWA 4JI1Q 4OX9L 2Y0SE 3KYHC 5IP7H 5AJ3Q 4IJLA 4DV4Q 5GROA 4A4IA 4R4IA 1K3RA 4B3SQ 3FP9A 1X3FA 4IOCA 1TWCH 4JI5L 4JC0A 1YI2A 1CSQA 2FXQA 4DR7L 4X6AH 5FLMH 4DV3L 4LF8Q 1PVOA 1J6QA 2D0PA 4YY3Q 3S16H 2PMZE 1KRSA 3CCLA 3GTQH 4Y52H 1NE3A 4LF9Q 3RN5A 2JQOA 5C0XG 4KHPQ 4JI0L 3PV0A 3M4PA 4A3BG 4GN4B 2I5HA 3TS2A 3GTKH 1WYDA 1EIYB 1NBWA 4DV5L 4R1JA 1Z47A 1HNXQ 2AKWB 4LF6Q 4X66L 3HOYG 1YJWA 1YIJA 3HOWH 1B8AA 1VQBA 4JI3Q 5M5YH 4A3FH 2HIXA 4LNQA 3M4OH 3B6YA 3H3VH 4JI6Q 1LM0A 3RLOA 3HOXH 4C3IH 1KHIA 4X65L 1CSPA 1IBKQ 5C3EG 3F2CA 2R7ZG 3UDGA 2OWOA 1EIFA 1CKNB 2ATWA 2WAQE 4MNOA 2K4KA 1S3OA 3W1GA 2ID0A 4DV1L 4NXML 2CQOA 4DR3Q 4IO9A 3STBC 2GVAA 2E2JH 3PO2H 1QVFA 2MO0A 4JYAQ 2RF4A 5M5XH 3K7UC 5JJIA 3I56A 4J15A 4BBSH 1V1QA 4DV7L 1XMQL 2K5VA 4AYBE 1KD1C 1OXXK 3T1HL 4X62L 3ERSX 1Y1WG 2UUCQ 2JA8H 1C9OA 4L5SA 3MXNB 3UDIA 2F52A 3CCRA 3AQQA 4JV5L 3NENA 3CCMA 3F1ZA 3DLLA 2VW9A 4OXPA 3S15H 1G6PA 1KRTA 4UP9A 4AQYQ 4DUYQ 1N36L 4A3CH 5BR8Q 5IYDH 2HT1A 2E8GA 1TWGH 2JEAI 1XNQQ 4L5TA 2JA6G 4GOPA 2HIVA 2HQLA 5C4XG 1AH9A 1KL9A 3PIPA 3T1YQ 3I55A 1QZHA 4A3IH 4XIGS 4GLVB 1YNXA 2N3SA 2YTXA 1PV4A 4A3LG 1PH7A 2HHHL 3CQZH 1XPUA 4BY7G 4JBJA 3IRBA 1D7QA 2NZHA 2A1AA 1XMOQ 4LFAL 1L1OB 2VQEQ 1WOCA 5FJ8H 5LMUQ 1HR0W 1E1OA 3I4NG 5IWAQ 5LMNW 4KHZA 1J5EQ 4IJHA 1GD7A 2VUMG 4A3GG 4P73A 4GNXC 1EYGA 1NTGA 1O7IA 1E22A 4DV0Q 4JCVE 1Q46A 3S2DH 2Z6KC 5K36G 1KIXA 4LFBL 3CC2A 4BA2I 4LUVA 1HZ9A 1Q8KA 1GM5A 3L0OA 1HR0L 3PCOB 1PA6A 4MTNA 3AFQA 4P71A 5LMNL 2NVQH 5J3BA 1OXVA 4OO1I 2R6GA 1X65A 3PF5A 3JAMi 4APVA 5IP9G 4GKJQ 3MEFA 2MFIA 4NXNQ 3RZOH 4QQBX 1JJCB 1YEZA 1X56A 1S40A 2R7FA 4LUZA 4IPGA 3PIOA 4A76A 3TRZA 4LF5L 4LW1A 2WP8J 4X64L 3I7FA 1VQOA 2VL6A 2N49A 2F4VL 1NJIC 1CKOA 2B29A 3I2ZA 4ALPA 3S17H 1HNWL 1JT8A 1N33Q 3L7ZC 1T9HA 4LF7Q 3S2HH 1FJGL 1X3EA 3PUZA 4GN3B 1I50H 1XNRQ 3H15A 2JA7G 1N32L 2K5NA 1K73C 2AHOB 3S1NH 2NN6I 1PH9A 3U4ZA 2UUAQ 4JI4L 5GAHC 3BZKA 1WI5A 1WCMG 1I5FA 4HIMA 4O2DA 2R93G 4DR6Q 2Z6KA 3M9BA 3K81C 3RN2A 1YHQA 2F3IA 1G51A 4UP7A 3PUWA 4DPGA 4BBRG 3J80i 2VS1A 3U4VA 1NMGA 4A75A 2YV5A 1SR3A 3PUVA 4LF4Q 4OX9Q 4A3BH 2VNUD 3AFPA 2L15A 4GKKL 4JI7L 4IOAA 3E9HA 3K7AH 3H3VI 3HOYH 2UUBL 3GO5A 3HFZB 4A3KG 2KENA 1I3QH 5EAYA 1VQ8A 2Z0SA 4QGUA 4DV6L 2Q2HA 2XTIA 1V9PA 1EOVA 4YHHL 2CFMA 3J81c 3CMAA 4DR2L 4DV3Q 4OONA 5C3EH 4P75A 3J81j 4HIOA 4WJ4A 3GTGH 1PYBA 1GO3E 3KOJA 2DGYA 2R7ZH 1Z9FA 4DR4L 4JI8Q 3W1BA 3KFUA 4H02A 2EXDA 1QZGA 5E7NA 4LFCL 5C44H 3CP0A 1PH2A 3CCQA 2E5LL 5IT9c 1LYLA 1EQRA 3EIVA 2UXBL 4R4OA 1M1KC 1VQ7A 1B70B 2ZM6L 4HJ9A 1D8LA 2Y0SG 2VY3A 4GN5A 5HY6A 4X66Q 1VQLA 4B3TL 3LGJA 3OW2A 4B3MQ 4IPDA 1Y1WH 2UXCL 3K0XA 1C7YA 3JC66 1L1OA 1UE5A 3U58A 5AJ3L 2LXJA 4DV4L 1X54A 4X65Q 4A93G 3OTOQ 1TXYA 1K0RA 4GNXB 1PH1A 1VQ9A 2BA1A 4B3SL 3S1QH 1A62A 5HGQA 5IYCG 3UE0A 1N8RC 3M4QA 2JA6H 4QL5A 4PZ7A 4NXMQ 5C4XH 1EWIA 4A3MG 2VZAA 2UU9L 3F2DA 4B3RL 1UE1A 3GTPH 1P8LA 1VQCA 2OQ0A 1A0IA 1Y14B 4POFA 4DK3C 3RLFA 3KJPA 4LF8L 3F8TA 4OWTB 1TWFH 2JA9A 2PI2A 2KCTA 4A3LH 2BA0A 3GTLH 1Q1BA 4DV7Q 3S1MH 4BY7H 3HOUH 3T1HQ 1IYJB 3OYYA 4XTCS 4X62Q 4LF9L 1VCIA 4KHPL 2MNAA 3EN2A 4A3JG 1JJGA 3UDFA 1BKBA 3GD7A 1VQAA 1U0LA 1H95A 1N34L 3GTJH 4IFDJ 5IY0A 4LF6L 1IZ6A 2VUMH 4DK6C 3KDFB 4A3GH 4HJ8A 4JI3L 1E3PA 3M7NA 2JJQA 2NZOA 5GAGC 2YU9H 4DR5L 2WB1G 2NVTH 2YTVA 4DR1Q 2EQSA 2WAQG 2DUDA 1IBKL 1YZ6A 2R92G 5M3FH 2MQHA 3CCJA 2HHHQ 3FKIH 5M5WH 3KF6B 2ZTDA 4DR3L 1E7ZA 3BU2A 4DUZQ 3RZDH 4LFAQ 1CUKA 5GAEC 2ZJRA 4AYBG 5IP9H 4JYAL 1LTLA 2ALYB 3TQYA 4UP8A 3G71A 1K8GA 3ULJA 1OXSC 4EQ5A 2I5MX 2UUCL 4RMFA 2YYZA 1KAWA 3I4MH 3G6EA 4PZ6A 4RG1A 2JEBI 3HOXG 3I4OA 2CWPA 1K9MC 2IX1A 1HNZL 4LFBQ 4AQYL 4LUOA 1RIPA 2K50A 1LUZA 1QUQB 1TWHH 2A19A 1VQKA 3W5OA 1YJ9A 4L5RC 1XNQL 1HR0Q 4NPSA 1I94Q 2JA7H 2VQFL 1E24A 2A8VA 1KC8C 1JJ2A 1VQJA 2MO1A 3S24A 1AE2A 1WCMH 5C0XI 3U50C 3CAMA 4DAMA 2CKZB 3PSIA 5JEAJ 2OQKA 2R7DA 1IBMQ 2N78A 4BBSG 4BBRH 1EQQA 4LF5Q 3CD6A 1Q86C 2JA8G 2GVBA 4QJFA 4IPCA 1XMOL 1IBLQ 3PO3G 5LMUL 2VQEL 2QA4A 1K83H 1HH2P 4JOIC 1JB7A 1SROA 3G48A 4A3KH 2CCZA 1FJGQ 1B7YB 4KLKA 3A5UA 3HKZE 2UXDL 3NEMA 4DV0L 3E9IA 2KHJA 2Q2TA 3CMEA 4HJ7A 4DV2Q 5M3MG 3BJUA 1FL0A 2LSSA 1YBYA 1VQDA 5ELOA 2AWOA 4GNXA 4A3IG 4JBWA 4YWMA 3JAMc 1GKHA 1RL2A 5C4JH 3WWVA 4DAYB
chains in the Genus database with same CATH superfamily
2XN9C 5E3FA 1SNPA 1VQEA 4IUNA 1AE3A 1L0YB 5IGEA 3K8AA 2V1CC 2ZTCA 2K7VA 1VQFA 3NWSA 1UNSA 1G291 2EY5A 2KBNA 2LXKA 4A93H 4JI5Q 1N33L 2AQ2B 2MPMA 3F2BA 4DR4Q 2B8GA 4KKTA 3PIP3 1SYDA 1Y1VG 2E2HH 3J80c 3AYHB 5K5PA 2J0TD 3KLRA 4KKUA 4M8AA 4R9WA 1LACA 4DV5Q 3KF6A 2SDFA 4RGMA 1UE7A 4RHSA 2MUYA 4YWLA 1PFMA 1X9NA 3J80L 1ZXTA 1E2WA 2L12A 4JI1L 4A3DB 4A3EG 1SMXA 3Q22A 1BBUA 5G3LF 4IZ8A 3H0GG 3NBHA 4K8JA 2BH8A 4HIDA 2NVXB 2JYOA 1YHBA 2F1MA 3A7AB 1UWVA 3BZDB 3CKIB 2QDBA 3SXHA 3CCUA 1IHZA 3A5ZB 1N34Q 4JBKA 4C3JB 2QCPX 1G2SA 2FMCA 3NSWA 1JE5A 1SRUA 1F2MA 2EJGC 1HNXL 1HJPA 1N36Q 1O7ZA 5CBEE 1IKMA 2Q2IA 1A3VA 3CCVA 2HUGA 2WB1E 4R4TA 1GVPA 5K36H 4EX5A 4C3HH 4WJ3M 4J6HA 1TWCB 1JOOA 2L55A 1YVCA 4IFDG 3FMCA 3I8ZA 4H0LC 1F9SA 1VQ6A 1F9QA 4EGVA 4DU9A 2AWNA 5CYUA 3CCEA 2R92B 1AZQA 1OO9B 4KY7A 1CHQD 4IPHA 5IODA 3RR5A 4AYBB 2VQFQ 3SK6A 2IT1A 5BN3A 1C4QA 4I7AA 1HA5A 2BCOA 1YITA 5FK9C 3MAQA 5LMNQ 4A3FB 3HOXB 3RLNA 5EKIA 1DONA 4FDBA 1WD1A 1SE8A 1ZYRD 3A74A 1SBBB 3O13A 4YCUA 2IL8A 2UXDQ 1HFNA 3PO2B 1EL0A 2LMCB 1J5EL 3IKJA 1X55A 1N32Q 3GV3A 3R3OA 5M3FG 1H9KA 1OTCA 4HSPA 2JA8B 2PQAB 3AEVA 4CHTB 1PRTB 3J7AF 2M00A 1MKHA 1BBWA 4NB3A 3E6ZX 4A3DH 4B3RQ 4OHJA 4GKKQ 4HJAA 1FYCA 4XXEA 4DAPA 3VDYA 2SNMA 3PUXA 2NVXH 4BXXH 2K05A 1PH5A 3LWUA 4QF4A 4JI2Q 1EY8A 1X3QA 3MXGA 4YHHQ 2B2YC 4GLXA 2OTLA 1C0AA 3TDQA 2JA5B 1TY0A 1XJVA 2RBMA 1EFWA 4LFCQ 4C3JH 4CJ1B 2E5LQ 2HQEA 1CKNA 1IKLA 2AUKA 3DM3A 5IGDA 4OO1H 3S1RB 1BO0A 2UXCQ 3FHWA 4IJLA 4DV4Q 4R4IA 3DEOA 4B3SQ 2OF1A 3FP9A 1TWCH 4Q0FA 2F0GA 4JC0A 2A6HC 3L3OC 4X6AH 4DV3L 2BOSA 1WTXA 2NN6H 3CCLA 2K6AA 4Y52H 4LF9Q 1EIHA 1NBWA 5FOBB 1PZJD 1F2YA 2M2LA 3HOYG 1YJWA 1VQBA 5M5YH 4A3FH 1D1IA 2EYMA 4JI6Q 1PTOC 3HOXH 1B50A 2MP1A 1LTID 2PNRC 3K6OA 2XSCA 3E0JA 2R7ZG 1EIFA 4N8FA 5KNCA 4DV1L 4RWSC 2CQOA 4ZKBB 5IGCA 1SNOA 4XQQA 1IYUA 3PO2H 2RF4A 3K7UC 1A3UA 4B08A 4DXGA 4J15A 4N9TA 1V1QA 2CH4A 2UUCQ 1OXXK 1Y1WG 4X62L 2Z9HA 2JA8H 3KBXA 5C44B 3CCRA 3AQQA 1AW7A 2FHTA 2JSOA 3F1ZA 3NENA 4F8MA 3DLLA 3GTQB 1G6PA 3PMFA 2KCCA 3MFYA 5IIFA 4DUYQ 4A3CH 5IYDH 1BBXC 5E1FA 2JEAI 4L5TA 3PIPA 1QZHA 4L8JA 5JEAH 1BXTA 1LT3D 1YNXA 1PV4A 1G8ZD 4ID6A 2EXZA 2A1AA 1SEBD 5EKKA 2VQEQ 1E1OA 3MTSA 3I4NG 5LMNW 3GTPB 1GD7A 1EYGA 4IN3A 1KTKA 1O7IA 4DV0Q 5BN5A 1LTGD 3SR1A 1HUNA 3TSSA 3Q0AA 1BCPB 4BA2I 4JVZA 1Q8KA 4A3GB 3L0OA 5FO7B 4OO1I 2YU9B 1YNJD 2R6GA 2IX3A 1PZID 5JPNC 1EIGA 3VA5A 3AB9A 3ZYYX 4A76A 1D6EC 2A74C 2EYOA 4X64L 2VL6A 3A56A 1FGBD 4FF1A 1CKOA 3J81E 2H4OA 3L7ZC 1T9HA 4LF7Q 4X3KA 1V1PB 2N88A 4CDFC 3I3CA 2K5NA 2NN6I 3NBIA 1SYGA 3HKZB 3H94A 5IT9E 1WI5A 1I5FA 4O2DA 4DR6Q 3QR8A 1YHQA 1M8AA 3PUWA 4WRDA 3T16A 3J80i 4OX9Q 2JA7B 4RH6A 4NMZA 3JAML 1EYCA 4JI7L 3MXPA 3K7AH 4A3KG 1SJED 1PFNA 5EAYA 1Y8NB 1VQ8A 4DAVA 4FYDA 4DV6L 2Q2HA 3D6WA 1RF2D 1EOVA 4X3TA 4U673 3J81c 5A35A 3CMAA 3GTGH 1GO3E 2DGYA 3AU7A 4I7ZC 5C44H 3CP0A 2B2YA 1PH2A 3CCQA 4ABNA 5IT9c 1GHJA 1VQ7A 2ZM6L 4HJ9A 4KV6A 1D8LA 4MIUA 3D4RA 3SEBA 4ILWA 5C4JB 3K0XA 3JC66 3D3RA 5AJ3L 4IUTA 5EPKA 1X54A 3OTOQ 2A68C 1TXYA 2KA7A 1EYAA 5HGQA 3M4QA 1EYDA 4E6IA 4A3MG 1PTOF 3NWTA 3GTPH 1VQCA 3X3NA 3RLFA 3KJPA 4FO2A 1TWFH 1TIID 1VF5C 1K28A 2KCTA 4KJNA 1PRTD 1Q1BA 4A3LH 4IUVA 1IYJB 4XTCS 1MI2A 1JJGA 3UDFA 1H95A 4LF6L 4CGYB 1S4ZA 2F0KA 4A3GH 3KDFB 2JJQA 2NZOA 3VR6A 2YU9H 2OT2A 2O5IC 4CBVA 4DR1Q 2WAQG 2CW0D 1STEA 1T5XD 5L37A 1Z7TA 2B2VC 2MQHA 3CCJA 2HHHQ 2IJ0A 1E7ZA 4DUZQ 3RZDH 4LFAQ 1CUKA 2WB1B 1CQVA 3E5SA 5IP9H 2RDFA 1PTOH 2F0WA 2YYZA 3MA2B 3J7AV 2LFNA 1MD2D 2JEBI 1Y69U 1JOKA 3S1MB 1DJRD 4N9PA 3W5OA 1YJ9A 1WD0A 2JA7H 1HR0Q 4HTHA 2QF7A 2MO1A 4C1NI 3GTOB 2CKZB 4XDXA 1NR2A 4BBSG 2NVTB 4BBRH 2QKIC 2JN4A 4IPCA 5LMUL 1B3AA 1SROA 4PV1C 1B7YB 4KLKA 5CMDA 3K58A 1FJGQ 3E9IA 4ZYSA 2RCFA 3UI2A 3EROA 4LMQD 1WTVA 5KGUA 5ELOA 2AWOA 4YWMA 1GKHA 4RCNA 4WFN3 5C4JH 1R4PB 3S14B 4PMCA 2N55A 5DM73 2JE6I 2Q8IB 4RKBA 1TWHB 1YHAA 1B3QA 4NXNL 2UUBQ 3HGBA 3OIQA 1WCMB 1IW7C 1I6HB 5DM63 4GS3A 2ASBA 3HKSA 3I72A 4GLAC 2O4XA 2PNHA 3KDFA 3GDEA 4DKAC 3SGIA 2WFWA 4DR7Q 1HQRD 2RKSA 1NMFA 2UUAL 1DGSA 2UXBQ 3L2PA 2OXPA 4YCVA 4B3TQ 3HOVG 3HOZG 1HA6A 1Y1VB 2B63G 4A3JH 3N52A 3H6MA 5A2QL 5C0XJ 1PXUA 2OCEA 3K59A 4WORA 5KNDA 1VMPA 1AFPA 1RODA 2F0FA 2UU9Q 1VQMA 3PF4A 5I6WA 3VA7A 2F0HA 3G4SA 3DXJC 3KJOA 4YIJA 2IW3A 1BCPD 1KNEA 1MJCA 4A3EB 1VQHA 3LNNA 3ND8A 2QGQA 1H9JA 2A6HD 4BY1G 1PYWD 1FNWA 4QUFA 1XMQQ 1HQMC 2LKVA 3PIO3 5IP7G 1VQ5A 4GOPC 4G7ZC 1WJJA 4K5XA 1DCZA 2B2WC 4UPAA 5CV7A 4DR5Q 3GTOH 2IWHA 4N8X1 4O0AA 2CWAA 2IHFA 3UDXA 2AMCB 4U68A 2D0OA 2D62A 1PHJA 1PH8A 1PH6A 1B53A 1SLJA 4FNFA 3URYA 2NVYH 2X6GA 3RMHA 1WTOA 1MJEA 1CA5A 4K2LA 4DN4M 3HS0C 4DK1A 1SSOA 3PUYA 4Z9CB 4FP5D 3VYUA 3HOWG 4UY8C 2XWJB 1JMCA 3CC7A 5JJLA 1HNZQ 1CK1A 2K5HA 1L0WA 1P16A 3S14H 1EWCA 1AZPA 1PYSB 3NBHB 4P2CB 4P74A 2X6LA 3D4WA 2WKDA 1PFSA 4YWKA 2N8NA 1E2VA 1CHPD 3J7A5 1I6HH 1SAPA 4C3IB 1AN8A 3E0EA 3PGZA 1NY4A 1M90C 3IFTA 2F4VQ 5IWAL 2NWGA 4POGA 2FMMA 3CW2C 4KN7C 4OWXB 1TU2B 3ULLA 1CFMA 1NCVA 1FNVA 4EQOA 5LL6S 4Q5VA 1Y1VH 4KI0A 1I94L 2NTSA 5I2YA 3K5OA 1MIUA 1STHA 2M9VA 1A2UA 3KF8B 5TSSA 2D5DA 2F0IA 4YCWA 2XRQD 4JG2A 3T13A 4BA1I 1WFQA 4RGNA 1ASZA 3I4MG 2K52A 1IBLL 1QVGA 1HRJA 1X3GA 3V2TA 1IL8A 5KYLA 2CH4W 4GOPB 3K5NA 5CV6A 4A3EH 2GA4B 2ZXRA 3CPWA 1QVCA 4HSVA 4PMWA 2L9HA 2BE5C 3H0GH 1XNRL 1S5DD 3J81i 4H13C 1ILPA 1EQTA 2O2LD 1ICFB 3I90A 3CHBD 1UUPA 4M1UB 2I07B 1EY0A 5EBCA 3RUZA 5J39A 2ZJQA 1EY4A 1PFBA 4JI1Q 2Y0SE 3KYHC 3BVZA 4A4IA 4JI5L 3KLSX 2ICIA 1PVOA 4LF8Q 1TQOA 1EZ8A 2EY2A 2PMZE 5KNBA 4K14A 4KHPQ 1QJOA 3PV0A 1RTNA 4OIJA 4GN4B 4A3BG 1WTQA 1EIYB 5BN4A 4DV5L 5C6AA 1HNXQ 1YNNC 1B8AA 2A69C 4JI3Q 1NSNS 2NB0A 3J7YW 4J8QA 2WV6D 4C3IH 1CSPA 5I9OA 1RD9D 5C3EG 4LAAA 5KEEA 2DY8A 3UDGA 3HOYB 1CKNB 3FPUB 2ATWA 1I3QB 1BQQT 2EE1A 3T53B 2E2JH 4KD3A 2MO0A 1HXYD 3I56A 4C56C 4DV7L 2RA4A 1KD1C 3KF8A 3T1HL 3ERSX 3TZUA 5T1GA 3MXNB 2F52A 3TP8A 1N36L 1A6XA 2HT1A 1TWGH 1SE4A 2JA6G 4GOPA 5I6YA 5C4XG 3W3AA 2F4IA 2B2WA 4ZUIA 2ZXOA 1ET9A 1F9RA 4GLVB 2Q8RE 2YTXA 5M5YB 3KUPA 3SK8A 4RCOA 1PH7A 3Q23A 3S1QB 1XPUA 1F2LA 4CDEC 5FJ8H 1J5EQ 3GQBA 2VUMG 4X3SA 1NTGA 1TT2A 3HOUB 4JCVE 1KDCA 3X3MA 5K36G 1KIXA 4LFBL 4C3HG 3GTJB 3V05A 2Z4HA 1GM5A 1D5XC 1PA6A 4MTNA 5LMNL 2NVQH 4PQXA 1OXVA 5J3BA 4K2KA 1X65A 3PF5A 4KN4C 4APVA 4GKJQ 4ZRZA 3EVQA 2A5HA 4EVOA 1X56A 1S40A 5JPMC 3PIOA 1O78A 3FKIB 4LW1A 1Q3LA 2ICEC 2N49A 1E0BA 2JP1A 2B29A 1O80A 5EKLA 2MGSA 5KRUA 4GN3B 1N32L 1GOZA 3NPPA 2A73B 2DNEA 5D3DA 3VR2A 1PH9A 5GAHC 3BZKA 4HIMA 3DWAA 2HCIA 2HDLA 1MBYA 2VS1A 1QNUA 1NMGA 4LF4Q 4B3RL 3PUVA 4HEDA 1Q90A 5LHY1 1AP0A 4IALA 4KD4A 4GKKL 3LWEA 1U4PA 2H1EA 1STBA 1SYFA 3D6CA 3HOYH 3HFZB 2KENA 1I3QH 2F0LA 2WIIB 2F0VA 4QGUA 5EGTA 2XTIA 3MXNA 1V9PA 1SE2A 1DOLA 4YHHL 4DV3Q 4UAIA 4CJ0B 2KUMA 1PYBA 2EY1A 3K5MA 2R7ZH 1LTTD 4JI8Q 3KFUA 1JB3A 2EXDA 5CV8A 2F3WA 4LFCL 1SXTA 5ISRA 1GUGA 2E5LL 1CT1D 4R8IA 1EQRA 2IPKD 2L0CA 4FXKC 1K0SA 3P7JA 1M1KC 1H9MA 4B3MQ 2VY3A 5HY6A 3VR3A 1V8QA 4DXFA 4IPDA 4GZYC 1QILA 1Y1WH 2UXCL 5HGTA 5ELFA 3BYTB 4DF7A 3U58A 4DV4L 3M7GA 3C3LA 1RJTA 4B3SL 3S1QH 5IYCG 1L0XB 4KK7A 2WACA 1N8RC 1BNZA 1BOSA 1EWIA 2VZAA 3D4DA 3K7AB 5G3LD 1UE1A 1CA6A 1P8LA 2OQ0A 4DK3C 4OWTB 2A6ED 4WJWA 3BVGA 4Y7NB 2R61A 4LF9L 4X62Q 3HOUH 1F77A 1DZ1A 4DNRB 3EN2A 2MNAA 3QIAA 3GTGB 2NUCA 3GD7A 1VQAA 2KVMA 1U0LA 3GTJH 5NUCA 5DEHA 2K33A 3MVVA 1B1ZA 2ZXPA 2YTVA 2DUDA 3I91A 2R92G 1EZ6A 3FKIH 4JPBW 2K5QA 1KNAA 3BU2A 2LY7A 4DAYA 3EA6A 4AYBG 3M3YB 2ALYB 4UP8A 3ULJA 2TSSA 4RHRA 4JW0A 4EQ5A 2I5MX 2UUCL 2XVSA 5FLXL 1TWFB 4RG1A 3HOXG 4LK1C 1GUOA 5CV5A 5CC4A 1WTRA 3NQIA 1SYCA 4LUOA 2K50A 1QUQB 3JAME 4L5RC 2RQXA 2FJ2A 4NPSA 3FVQA 1CI3M 3IFDA 2PYKA 1PLFA 3U50C 3CAMA 2B2UC 5JEAJ 1IBMQ 2OQKA 2R7DA 4QB4A 4R8NA 4DFAA 1Q86C 2JA8G 2GVBA 1R4QB 1JWSD 3PO3G 2VQEL 4JOIC 4HAEA 4QMGA 4A3KH 3G48A 3DWQA 4ME5A 3RZDB 4F88A 4DV0L 2Q2TA 2K32A 3OW7A 4HJ7A 4DV2Q 5M3MG 1PTOB 3BJUA 1R9TB 1CQFA 3BDOA 2LSSA 1BDOA 5I2XA 3JAMc 2ES2A 3WWVA 5GADC 1ML0D 3H91A 4AH6A 4JI7Q 2JA5G 2EIFA 1XX8A 1O7LA 4DV6Q 1EY6A 2R93B 1KQSA 2EZVA 3ULPA 5GQOA 3Q8DA 1SMYC 4LJZC 4K0KL 4PG3A 4BBRB 4Y7NH 4HR7B 1ONLA 2C35B 4IURA 2RSNA 4XYQA 1EWHA 4RKLA 2I5LX 2NTTA 4TRDA 2IX0A 1UAPA 3A0JA 2ZTEA 5IYBG 2ZM6Q 1I4GA 4JI0Q 1XPRA 1J9OA 3MHBA 3TBIB 1RKNA 3BDLA 2VB2X 4MN3A 4C1NK 3FPPA 4L6TB 3HOVB 2ZJPA 3AMUA 3M3YH 2SEBD 4JBMA 1VQ4A 2Y0SB 2B63B 1X32A 4DNTB 2D2CC 2B3GA 5C5MA 1QUQA 2WINB 1HZBA 1HCZA 3SE0A 2Z1CA 3EBEA 1B2TA 4OIKA 1VQGA 2E2IH 4YY3L 5KIXA 1TKWB 2Z8LA 3TREA 5J22A 2QDLA 3FDTA 2RHQB 5CBAE 2PMZB 1L2FA 1A15A 4JV5Q 3KLWA 1Q7YC 4K6LA 2AUJD 1N9WA 4CDDC 1RDPD 1I4PA 3QOLA 3OTOL 5JJKA 1YNND 2KJXA 3ZJYC 1A8VA 4QIWE 4A3JB 5FLMG 5CR3A 5C44G 1DOMA 4HIKA 1PH3A 5ELCA 2EYFA 2EVBA 3TP5A 4HCSA 4QY7A 5ELNA 1NR4A 2FFKB 4ZKCB 2Z6BA 4PZ8A 1R9TH 2AQ3B 3HZXA 5FO9B 1UE6A 1LT6D 3U9OA 1VQNA 1I4RA 4LWCA 4HJ5A 1IL2A 4XQNA 5BR8L 1HHVA 4UHVA 1DYQA 4DR1L 4KJOA 3HOWB 3T1YL 5LL6X 1ZYRC 2R93H 5EPJA 3BS1A 1KABA 2H5XA 2L4NA 4PNYA 3DWPA 4DUZL 3WOFA 3D0FA 4ZCKA 3ER0A 1HNWQ 1PMRA 1K3BC 3TS0A 2OTJA 4P72A 2X69A 2NVYB 4S3SA 2KHSA 5M5XB 2I0QA 2EYLA 3D8GA 1W2BA 3QOJA 1TY2A 2G9DA 2VB3X 1FGUA 1HTPA 1QWYA 1Y8OB 2K75A 5A2QE 4JI4Q 1OXTA 2KCMA 3L9AX 3BVMA 4ZK9B 1S72A 2B2TC 1VMCA 4OL7A 3HOVH 3HOZH 5EQ0A 2KEDA 4O42A 2B63H 3RD4A 4A3IB 3HKZG 2B2UA 2QEXA 1A63A 1JCKB 4TQUS 1U5KA 1S5BD 1WVLA 4DR2Q 1Q81C 3UE1A 4JOIA 2G9HD 4OWWB 3ICEA 3U9SA 1IYVA 3A8IE 1K8MA 4HMIA 5EJWA 3SK4A 1TS5A 2PZUA 5HURA 2RCNA 1L1OC 2F0TA 2I46A 5I9PA 4BY1H 1X6OA 3K5LA 1I4XA 1K8AC 1ZKOA 5IP7H 4DA2A 3H09A 4IOCA 1C48A 2FINB 2NBFA 4NKLA 1YI2A 1CSQA 1DM0B 3ITPA 2FXQA 5F2DA 4DR7L 2D0PA 5E4XA 3S16H 1KRSA 1JORA 4ZLTF 4RGOS 2JQOA 2KCNA 5C0XG 1I50B 4FF3A 1RTOA 2I5HA 3WDNA 3S1NB 3H0GB 4R1JA 2P5ZX 4X66L 1YIJA 3HOWH 1MSHA 4LNQA 3M4OH 3B6YA 5EBDA 1SYBA 4IUPA 4X65L 1IBKQ 2O5JC 2CQAA 5J1ZA 3OHXC 2XIWA 2KECA 3F2CA 2WAQE 1S3OA 2K4KA 3W1GA 4KKSA 4NXML 1PTOD 4DR3Q 4RFBA 2F0NA 3BYYB 3STBC 2DJFC 1QVFA 4JYAQ 1EU3A 5M5XH 1G6ZA 3VR4A 1XMQL 2K5VA 1GJXA 1SDFA 4BS9A 3GV6A 1RCVD 4OXPA 3N6RA 4RGTA 4AQYQ 2E8GA 4XT1B 1D2BA 3I4LA 1XNQQ 1RHPA 2HIVA 1FNUA 1JWUD 2HQLA 4CDCC 1AH9A 1A3TA 2RDHA 3I55A 1FR3A 1FD7D 4A3IH 1CZWA 1LTRD 2QEJC 2PO4A 3SHLA 3R2IA 3S9WA 2EJMA 3CQZH 4BY7G 1Y8PB 4JBJA 3IRBA 3NQTA 2JA6B 1D7QA 1XMOQ 5C4XB 1L1OB 3MC0B 1HR0W 1D5ZC 5IWAQ 1B44D 3HEJA 1XYIA 3NTKA 3EJIA 3KLSA 3NE5B 2E2JB 2D9UA 1Q46A 3S2DH 1ESFA 3NTIA 2QILA 4NDXA 3CC2A 1C8CA 1HZ9A 4G57A 1JWMD 3PCOB 1EEID 2MHVA 3JAMi 3MEFA 1TWGB 1JE4A 4K5VA 5M3FB 3TRZA 4LF5L 2WP8J 1VQOA 4BWGB 5C3XA 1EEFD 2F4VL 3I2ZA 4ALPA 1JT8A 1N33Q 1SE3A 1M4VA 3PUZA 1I50H 4K5WA 3H15A 1XNRQ 3T4AC 3S1NH 3MEHA 3U4ZA 1CZGA 1STGA 2F0OA 1WCMG 1A2TA 3WOEA 2Z6KA 3M9BA 3RN2A 4HMJA 2F3IA 1Q8IA 4UP7A 4DPGA 3U4VA 4A3BH 4A75A 2YV5A 2VNUD 2CVRA 2L15A 2K01A 4IOAA 2B2TA 3GO5A 4ULLA 2NYZD 4J1MA 2EYPA 2WKCA 2NVQB 2Z0SA 3QG1A 4FXGC 4IUQA 2BDNA 4L63B 4MTKA 1LT4D 4MHEA 1QOHA 2PW5A 1TR5A 5C3EH 3J81j 4HIOA 1K83B 5CGKA 4DR4L 1Z9FA 3W1BA 1J8IA 2EOTA 1SMYD 4H02A 1QZGA 5E7NA 3SK5A 1KAAA 4KMUC 5ELEA 2PPBC 2NZ1D 1EQVA 3EIVA 1B70B 3OMCA 1VQLA 3P1HA 1GHKA 3OW2A 1KDBA 4IFDH 1ENAA 2LS01 2F0SA 3R93A 2J4XA 1C7YA 2K03A 1L1OA 1UE5A 3KBGA 4A93G 1S5FD 1ESRA 1VQ9A 2BA1A 1A62A 1LT5D 3UE0A 1LTSD 2JA6H 1PRTC 2F0DA 4QL5A 5C4XH 3CU7A 1K8OA 3F2DA 2CHBD 2A68D 2L11A 1A0IA 1Y14B 4LF8L 3F8TA 2PI2A 1CTMA 1LABA 3G6JB 3GTLH 4DV7Q 2HCCA 3Q6SA 3T1HQ 1VDZA 3OYYA 2K04A 1VCIA 4KHPL 1U4LA 1GUWA 4OELB 2G5DA 1ET6A 3BDCA 2R7ZB 1EY9A 2DY7A 4V0BA 5AFWA 1N34L 4IFDJ 2CW0C 2VUMH 3OIPA 1ENCA 4JI3L 1E3PA 3M7NA 2B8FA 4NW2A 2EQSA 4PMBA 4DGZA 1Y1WB 1KLUD 1YZ6A 3R8BA 5M3FH 1ICWA 5M5WH 1X3PA 4QIWB 1LTLA 2Q8TA 3TQYA 1HPCA 4JK1C 1OXSC 1JR0D 3A8JE 1U4MA 3OWEB 2C5CA 3G6EA 1SFOB 5T1IA 4C3IG 2CWPA 1K9MC 4LFBQ 1GUSA 2A19A 2XWBB 5C4ZA 1XWEA 2KQ3A 3I4NB 2VQFL 5I4DA 1KC8C 1JJ2A 1VQJA 5M9OA 4KHVA 3W2DA 1TWAB 3QB3A 3CD6A 1DOKA 1MHWC 5ELBA 1K83H 2QA4A 1JB7A 3PQIA 3VYSA 1JOQA 3A5UA 4H7BA 2UXDL 3HP3A 4FVMA 1I4QA 1DD2A 3CMEA 3NP8A 3A8KE 3PO3B 3IL8A 1SNDA 1VQKA 1VQDA 1RL2A 4DAYB 2PZWA 3FEWX 4OEMB 5C4HA 4IFDI 4XQJA 3NELA 5FJ8G 5M3MB 4GKJL 3TEHB 3CPFA 1D5MC 1SNMA 1QNKA 4QCLA 3BZCA 2RHSB 1ENFA 2BH2A 2DN8A 4RAUC 1EFID 2QW7A 4JI2L 1SYEA 5IYCH 4FF2A 1EY5A 1IW7D 1VS0A 1UEAB 3H3VC 1F2ZA 4TKOB 4A3KB 2IHEA 3CC4A 4V190 1HZAA 4TVAB 4A3DG 1MSGA 1W6KA 1JQYD 4R4CA 1W6JA 3GTMB 1LTBD 1SN8A 4LF4L 4AIMA 3V96A 1STYA 3DHQA 3OMGA 4HCEA 4BXXG 3P20A 3DUZA 1ILQA 1XTDA 2JK8A 5D14A 5D65A 2EDGA 2F0MA 1BCPC 4NP5A 3D31A 4KY6A 4CKBA 3J7ZC 1FVIA 1HTLD 1LTAD 4DV1Q 3C46A 4C3JG 2R92H 4L5QA 1KDAA 1PRTF 2V4DA 4JI8L 5FLXE 3OPOA 2EYJA 4C2MB 1WTHA 1SFOH 4OO1G 2F3VA 2RVLA 5IGFA 1GXDC 4B3ML 4A3MB 3T51B 3I4NH 1B9MA 2E2DC 1LO5D 3VR5A 1HZCA 1U9RA 4JI6L 1TWAH 4FXDA 4FF4A 2F0EA 2MJ8A 3VYRA 1EUJA 1UEBA 2F0PA 1TS4A 4DNIA 1MGSA 2NN6G 1TS2A 1E2ZA 2PQAA 3K80C 5IGBA 1O7YA 2XGTA 1I4HA 3HRZC 5FLXc 4RA8A 1ASYA 2WAQB 2KHIA 3STBD 1V1OA 3PO3H 1BVSA 1STNA 3SDZA 2PCFB 1IXRA 3LX0A 3QWNA 4A3FG 3M4YA 2PI2E 4F87A 2E2IB 3QJYA 3GTKB 4DUYL 3ND9A 5M3MH 3EFXD 5DLQE 1S5ED 5IE8A 2L1BA 1XTCD 5H1SE 1GUNA 1T5EA 3PO2G 3HOUG 3F2UA 4EQNA 1D1KA 1YJNA 3CF5A 5JVG3 2JA5H 2ZT9C 3TZDA 2GN5A 4CJ2C 4X64Q 1W3SA 1OXUA 2J7ZA 1KXLA 2XNAC 2YTYA 1QCBD 3OOCA 1VQPA 2E74C 5IYDG 4A3CG 1PH4A 2PZTA 1XPOA 4BBSB 3S1RH 4O1NA 3GTMH 4KY5A 4XYOA 3FKIG 5JEAG 2K14A 2IY5B 1VQIA 3S15B 1CM9A 3MZ5A 5IYBH 3C1EA 4G7OC 4UDUC 1IBML 1CKMA 1Q1EA 5JOBA 4CKCA 4ZUJA 1Q82C 1V43A 5D3IB 2KEEA 3M85A 1LV9A 5ELDA 3CXCA 4K0KQ 4C2MH 3G7LA 4MZ9A 3RNUA 4LF7L 1Q12A 1HUMA 1E1TA 4ME3A 4DV2L 1ZEQX 3CRKC 2R3ZA 3A55A 4A3MH 2E76C 1HFGA 4OGQC 5CORA 2Q2UA 4R4QA 4DR6L 3NK9A 2BE5D 1XXGA 1I6VC 3CCSA 2F03A 4OX9L 5AJ3Q 5GROA 2L5TA 1K3RA 1Z6HA 1X3FA 2BDOA 3HOZB 3RZOB 4IQZA 2E75C 2PW7A 5FLMH 1BCPF 3E3XA 1J6QA 4YY3Q 3S17B 3K0YA 3S2HB 3J81L 3GTQH 1NE3A 3RN5A 4DK0A 1PZKD 2EJFC 2F0JA 3M4PA 4JI0L 3TS2A 3GTKH 1WYDA 3CRLC 3VYTA 4LF6Q 1Z47A 2AKWB 5IT9L 1DXMA 1GUTA 2HIXA 3TP7A 3H3VH 2EPBA 1LM0A 3RLOA 4BY1B 1KHIA 2A69D 3DEPA 4CKEA 2OWOA 4MNOA 2ID0A 3TP6A 4KTAA 4IO9A 2K5DA 2GVAA 5DAUA 4XT3B 1VF7A 5JJIA 4K6DA 1BF4A 4BBSH 1QB5D 4AYBE 4EQPA 4K8IA 1C9OA 4L5SA 3UDIA 1QG7A 3S16B 4JV5L 3CCMA 3S15H 1LLRD 2VW9A 1KRTA 4UP9A 2SNSA 5BR8Q 2DNCA 2EYHA 3FRPB 1JICA 1V1PA 1KL9A 2VXWA 3T1YQ 1G91A 4XIGS 2N3SA 3M4OB 4A3LG 2HHHL 2DJGC 1WTPA 5IOCA 2NZHA 4LFAL 1B4OA 5LMUQ 1WOCA 4KHZA 4IJHA 4A3GG 4P73A 4GNXC 2HD3A 5JAVA 1E22A 4BY7B 2KOLA 3NHHA 3MXUA 2Z6KC 4LUVA 4TSSA 5FO8B 4F7XA 1HR0L 3AFQA 4P71A 1AEXA 3DM1A 5IP9G 3NXWA 1EU4A 2ENBA 2MFIA 4NXNQ 3RZOH 4QQBX 1JJCB 1YEZA 1EY7A 2R7FA 4LUZA 3NTHA 4IPGA 3I7FA 2K5WA 1NJIC 4QUCA 3S17H 1HNWL 4ZQ3A 3I70A 3S2HH 3CQZB 1FJGL 2K28A 1X3EA 4I65A 2XRSD 5E4WC 5KYIA 1F9PA 3K57A 2JA7G 1K73C 2AHOB 3ONAB 2UUAQ 4G4KA 4JI4L 3I4MB 1B9NA 2R93G 3K81C 2EY6A 1G51A 3S2DB 5C0XH 1TS3A 3ERQA 4BBRG 3C2PA 1SR3A 1EOTA 3AFPA 5JJZA 3E9HA 3H3VI 5JVH3 2UUBL 1TVXA 3TMEA 1BR9A 2F0QA 2CFMA 4DR2L 4OONA 4P75A 5FKAC 4WJ4A 3KOJA 2RSOA 2JXMB 2F0UA 1LYLA 2UXBL 4R4OA 2Y0SG 4B3TL 3SVMA 4GN5A 4X66Q 3A54A 1WTWA 3LGJA 4H44C 3MWYW 2OEOA 2LXJA 4X65Q 1H9SB 1K0RA 1H9RA 4GNXB 1PH1A 1PDQA 4A3BB 2A6EC 3T56B 2PQEA 3TN2A 5EPLA 4NXMQ 4PZ7A 5C5LA 2UU9L 2Z4IA 1JC7A 4POFA 3BG3A 4A93B 2JA9A 2SOBA 2BA0A 3S1MH 4BY7H 1G2TA 3OWFA 5COYA 5C3EB 2TMPA 4A3JG 4ZAIA 1NUCA 1SNQA 1BKBA 1KLGD 2E2HB 5IY0A 1IZ6A 4DK6C 4HJ8A 4G7HC 5GAGC 3QO2A 4DR5L 1U4RA 2WB1G 2NVTH 4X3UA 4ODGA 1SJHD 1IBKL 5DNFA 3P75A 3KF6B 2ZTDA 4DR3L 1NAPA 1QE6A 2ZJRA 5GAEC 3MFGA 5CV4A 3EQLC 4JYAL 3G71A 1K8GA 2HDMA 1STAA 1II3A 4RMFA 3A7LA 3R2TA 4HN7A 3I4MH 1KAWA 4PZ6A 3HG9A 3I4OA 3KK7A 3NUCA 3GTLB 2IX1A 1HNZL 4AQYL 1RIPA 1LUZA 1TWHH 2C9OA 1BUVT 1YNJC 1XNQL 1I94Q 5C3WA 1E24A 2AQ1B 2A8VA 3OSOA 3S24A 3IAYA 1AE2A 1WCMH 4B9WA 5C0XI 2VUMB 4IUUA 4DAMA 3PSIA 1SNCA 2N78A 2B2VA 3Q24A 1EQQA 4LF5Q 4QJFA 1XMOL 1IBLQ 1S5CD 3GP7A 1NNXA 4C3HB 1HH2P 2K1BA 3I73A 2CCZA 5M5WB 3HKZE 2B39A 3DMUA 3C1FA 5IGGA 3NEMA 2KHJA 5CV9A 1H9SA 1FL0A 4B9XA 1YBYA 3J80E 4GNXA 4A3IG 4JBWA 2RDGA
chains in the Genus database with same CATH topology
5GADC 1VQEA 1AE3A 2JE6I 4IFDI 3NELA 5FJ8G 4AH6A 1YHAA 3K8AA 4JI7Q 4GKJL 3TEHB 2JA5G 2EIFA 3CPFA 2V1CC 4NXNL 2UUBQ 2ZTCA 1VQFA 4DV6Q 3BZCA 1G291 2RHSB 2KBNA 1KQSA 4GS3A 2LXKA 2ASBA 3HKSA 2BH2A 3ULPA 5GQOA 4JI5Q 4A93H 3Q8DA 4GLAC 4K0KL 1N33L 4PG3A 2PNHA 4JI2L 3KDFA 3F2BA 3GDEA 5IYCH 4DKAC 4Y7NH 3SGIA 2WFWA 4DR4Q 4DR7Q 2C35B 2ES2A 1Y1VG 1VS0A 2I5LX 1NMFA 2IX0A 3A0JA 2E2HH 2UUAL 2IHEA 1DGSA 2ZTEA 3J80c 3CC4A 5IYBG 3L2PA 1HZAA 2UXBQ 4YCVA 4TVAB 2ZM6Q 4JI0Q 3AYHB 1XPRA 4B3TQ 3HOVG 3HOZG 4A3DG 4DV5Q 3KF6A 4R4CA 1UE7A 2B63G 4A3JH 1SN8A 4LF4L 5C0XJ 4YWLA 4AIMA 1X9NA 2OCEA 4BXXG 4JI1L 1XTDA 2JK8A 4A3EG 2ZJPA 1SMXA 3D31A 3J7ZC 3M3YH 2UU9Q 1VQMA 4JBMA 1BBUA 1FVIA 1VQ4A 3PF4A 4DV1Q 3H0GG 2B3GA 2BH8A 4HIDA 3G4SA 3KJOA 1QUQA 2R92H 1HZBA 4L5QA 1YHBA 4JI8L 3EBEA 1VQGA 1UWVA 1MJCA 2E2IH 4YY3L 1VQHA 1SFOH 2QGQA 4BY1G 4OO1G 1XMQQ 3TREA 3CCUA 3A5ZB 4JBKA 1N34Q 2RHQB 4B3ML 5IP7G 1VQ5A 1L2FA 4GOPC 3I4NH 4JV5Q 1JE5A 3KLWA 1SRUA 1Q7YC 1WJJA 1N9WA 4UPAA 1HJPA 4DR5Q 1N36Q 1HNXL 3GTOH 2Q2IA 1HZCA 2CWAA 4O0AA 3CCVA 3OTOL 5JJKA 2IHFA 3ZJYC 1TWAH 1A8VA 4QIWE 2WB1E 3UDXA 4JI6L 4R4TA 2AMCB 1GVPA 2D0OA 2D62A 5FLMG 1EUJA 1UEBA 1PHJA 1PH8A 4EX5A 5C44G 4C3HH 4HIKA 1PH6A 4DNIA 1SLJA 2NN6G 4WJ3M 2PQAA 1PH3A 3K80C 2NVYH 1MJEA 2XGTA 5FLXc 1YVCA 4IFDG 1ASYA 4QY7A 1VQ6A 5ELNA 2KHIA 3STBD 2AWNA 3PUYA 4PZ8A 1R9TH 3PO3H 1BVSA 3CCEA 3HOWG 4UY8C 1JMCA 1IXRA 3CC7A 4A3FG 5JJLA 2PI2E 1HNZQ 2K5HA 1L0WA 1UE6A 1VQNA 1P16A 4LWCA 4HJ5A 4IPHA 3S14H 3RR5A 1IL2A 1PYSB 3NBHB 2VQFQ 4P74A 2IT1A 4DUYL 5BR8L 5M3MH 4DR1L 5DLQE 1YITA 5IE8A 5LMNQ 1PFSA 4YWKA 3T1YL 2N8NA 5H1SE 2R93H 3J7A5 3PO2G 3HOUG 1I6HH 3RLNA 2H5XA 4FDBA 3E0EA 4DUZL 1YJNA 3CF5A 1SE8A 3D0FA 3PGZA 1NY4A 2JA5H 3ER0A 1M90C 2GN5A 4X64Q 1W3SA 1OXUA 3A74A 1KXLA 2F4VQ 2YTYA 4YCUA 1HNWQ 2UXDQ 3TS0A 5IWAL 2OTJA 4P72A 1VQPA 1J5EL 4POGA 5IYDG 4A3CG 2I0QA 3CW2C 4OWXB 3ULLA 1X55A 1PH4A 1N32Q 1W2BA 1XPOA 3S1RH 1FGUA 2K75A 5M3FG 1OTCA 4JI4Q 3GTMH 1Y1VH 3FKIG 5JEAG 2PQAB 1OXTA 2K14A 4KI0A 2KCMA 1I94L 1VQIA 3AEVA 2IY5B 1S72A 5IYBH 1MIUA 1MKHA 1BBWA 3KF8B 4NB3A 3HOVH 3HOZH 4A3DH 4B3RQ 1IBML 4GKKQ 1CKMA 1Q1EA 4YCWA 4HJAA 4JG2A 2B63H 4BA1I 3VDYA 1WFQA 3HKZG 1ASZA 3I4MG 2K52A 1IBLL 2QEXA 1V43A 3PUXA 1Q82C 3M85A 1QVGA 2NVXH 4TQUS 1X3GA 3CXCA 1PH5A 4BXXH 4K0KQ 1U5KA 4GOPB 1A63A 4JI2Q 4C2MH 4YHHQ 4MZ9A 4A3EH 4DR2Q 3CPWA 1Q81C 1QVCA 3UE1A 4GLXA 4JOIA 3RNUA 2OTLA 1Q12A 4LF7L 1C0AA 1XJVA 4OWWB 1E1TA 4ME3A 4PMWA 4DV2L 3H0GH 1EFWA 1XNRL 3ICEA 3J81i 4LFCQ 4C3JH 4A3MH 2E5LQ 1CKNA 2Q2UA 2RCNA 4R4QA 3DM3A 1L1OC 4DR6L 4BY1H 1X6OA 3CCSA 2ZJQA 1K8AC 2UXCQ 3FHWA 4JI1Q 4OX9L 2Y0SE 3KYHC 5IP7H 5AJ3Q 4IJLA 4DV4Q 5GROA 4A4IA 4R4IA 1K3RA 4B3SQ 3FP9A 1X3FA 4IOCA 1TWCH 4JI5L 4JC0A 1YI2A 1CSQA 2FXQA 4DR7L 4X6AH 5FLMH 4DV3L 4LF8Q 1PVOA 1J6QA 2D0PA 4YY3Q 3S16H 2PMZE 1KRSA 3CCLA 3GTQH 4Y52H 1NE3A 4LF9Q 3RN5A 2JQOA 5C0XG 4KHPQ 4JI0L 3PV0A 3M4PA 4A3BG 4GN4B 2I5HA 3TS2A 3GTKH 1WYDA 1EIYB 1NBWA 4DV5L 4R1JA 1Z47A 1HNXQ 2AKWB 4LF6Q 4X66L 3HOYG 1YJWA 1YIJA 3HOWH 1B8AA 1VQBA 4JI3Q 5M5YH 4A3FH 2HIXA 4LNQA 3M4OH 3B6YA 3H3VH 4JI6Q 1LM0A 3RLOA 3HOXH 4C3IH 1KHIA 4X65L 1CSPA 1IBKQ 5C3EG 3F2CA 2R7ZG 3UDGA 2OWOA 1EIFA 1CKNB 2ATWA 2WAQE 4MNOA 2K4KA 1S3OA 3W1GA 2ID0A 4DV1L 4NXML 2CQOA 4DR3Q 4IO9A 3STBC 2GVAA 2E2JH 3PO2H 1QVFA 2MO0A 4JYAQ 2RF4A 5M5XH 3K7UC 5JJIA 3I56A 4J15A 4BBSH 1V1QA 4DV7L 1XMQL 2K5VA 4AYBE 1KD1C 1OXXK 3T1HL 4X62L 3ERSX 1Y1WG 2UUCQ 2JA8H 1C9OA 4L5SA 3MXNB 3UDIA 2F52A 3CCRA 3AQQA 4JV5L 3NENA 3CCMA 3F1ZA 3DLLA 2VW9A 4OXPA 3S15H 1G6PA 1KRTA 4UP9A 4AQYQ 4DUYQ 1N36L 4A3CH 5BR8Q 5IYDH 2HT1A 2E8GA 1TWGH 2JEAI 1XNQQ 4L5TA 2JA6G 4GOPA 2HIVA 2HQLA 5C4XG 1AH9A 1KL9A 3PIPA 3T1YQ 3I55A 1QZHA 4A3IH 4XIGS 4GLVB 1YNXA 2N3SA 2YTXA 1PV4A 4A3LG 1PH7A 2HHHL 3CQZH 1XPUA 4BY7G 4JBJA 3IRBA 1D7QA 2NZHA 2A1AA 1XMOQ 4LFAL 1L1OB 2VQEQ 1WOCA 5FJ8H 5LMUQ 1HR0W 1E1OA 3I4NG 5IWAQ 5LMNW 4KHZA 1J5EQ 4IJHA 1GD7A 2VUMG 4A3GG 4P73A 4GNXC 1EYGA 1NTGA 1O7IA 1E22A 4DV0Q 4JCVE 1Q46A 3S2DH 2Z6KC 5K36G 1KIXA 4LFBL 3CC2A 4BA2I 4LUVA 1HZ9A 1Q8KA 1GM5A 3L0OA 1HR0L 3PCOB 1PA6A 4MTNA 3AFQA 4P71A 5LMNL 2NVQH 5J3BA 1OXVA 4OO1I 2R6GA 1X65A 3PF5A 3JAMi 4APVA 5IP9G 4GKJQ 3MEFA 2MFIA 4NXNQ 3RZOH 4QQBX 1JJCB 1YEZA 1X56A 1S40A 2R7FA 4LUZA 4IPGA 3PIOA 4A76A 3TRZA 4LF5L 4LW1A 2WP8J 4X64L 3I7FA 1VQOA 2VL6A 2N49A 2F4VL 1NJIC 1CKOA 2B29A 3I2ZA 4ALPA 3S17H 1HNWL 1JT8A 1N33Q 3L7ZC 1T9HA 4LF7Q 3S2HH 1FJGL 1X3EA 3PUZA 4GN3B 1I50H 1XNRQ 3H15A 2JA7G 1N32L 2K5NA 1K73C 2AHOB 3S1NH 2NN6I 1PH9A 3U4ZA 2UUAQ 4JI4L 5GAHC 3BZKA 1WI5A 1WCMG 1I5FA 4HIMA 4O2DA 2R93G 4DR6Q 2Z6KA 3M9BA 3K81C 3RN2A 1YHQA 2F3IA 1G51A 4UP7A 3PUWA 4DPGA 4BBRG 3J80i 2VS1A 3U4VA 1NMGA 4A75A 2YV5A 1SR3A 3PUVA 4LF4Q 4OX9Q 4A3BH 2VNUD 3AFPA 2L15A 4GKKL 4JI7L 4IOAA 3E9HA 3K7AH 3H3VI 3HOYH 2UUBL 3GO5A 3HFZB 4A3KG 2KENA 1I3QH 5EAYA 1VQ8A 2Z0SA 4QGUA 4DV6L 2Q2HA 2XTIA 1V9PA 1EOVA 4YHHL 2CFMA 3J81c 3CMAA 4DR2L 4DV3Q 4OONA 5C3EH 4P75A 3J81j 4HIOA 4WJ4A 3GTGH 1PYBA 1GO3E 3KOJA 2DGYA 2R7ZH 1Z9FA 4DR4L 4JI8Q 3W1BA 3KFUA 4H02A 2EXDA 1QZGA 5E7NA 4LFCL 5C44H 3CP0A 1PH2A 3CCQA 2E5LL 5IT9c 1LYLA 1EQRA 3EIVA 2UXBL 4R4OA 1M1KC 1VQ7A 1B70B 2ZM6L 4HJ9A 1D8LA 2Y0SG 2VY3A 4GN5A 5HY6A 4X66Q 1VQLA 4B3TL 3LGJA 3OW2A 4B3MQ 4IPDA 1Y1WH 2UXCL 3K0XA 1C7YA 3JC66 1L1OA 1UE5A 3U58A 5AJ3L 2LXJA 4DV4L 1X54A 4X65Q 4A93G 3OTOQ 1TXYA 1K0RA 4GNXB 1PH1A 1VQ9A 2BA1A 4B3SL 3S1QH 1A62A 5HGQA 5IYCG 3UE0A 1N8RC 3M4QA 2JA6H 4QL5A 4PZ7A 4NXMQ 5C4XH 1EWIA 4A3MG 2VZAA 2UU9L 3F2DA 4B3RL 1UE1A 3GTPH 1P8LA 1VQCA 2OQ0A 1A0IA 1Y14B 4POFA 4DK3C 3RLFA 3KJPA 4LF8L 3F8TA 4OWTB 1TWFH 2JA9A 2PI2A 2KCTA 4A3LH 2BA0A 3GTLH 1Q1BA 4DV7Q 3S1MH 4BY7H 3HOUH 3T1HQ 1IYJB 3OYYA 4XTCS 4X62Q 4LF9L 1VCIA 4KHPL 2MNAA 3EN2A 4A3JG 1JJGA 3UDFA 1BKBA 3GD7A 1VQAA 1U0LA 1H95A 1N34L 3GTJH 4IFDJ 5IY0A 4LF6L 1IZ6A 2VUMH 4DK6C 3KDFB 4A3GH 4HJ8A 4JI3L 1E3PA 3M7NA 2JJQA 2NZOA 5GAGC 2YU9H 4DR5L 2WB1G 2NVTH 2YTVA 4DR1Q 2EQSA 2WAQG 2DUDA 1IBKL 1YZ6A 2R92G 5M3FH 2MQHA 3CCJA 2HHHQ 3FKIH 5M5WH 3KF6B 2ZTDA 4DR3L 1E7ZA 3BU2A 4DUZQ 3RZDH 4LFAQ 1CUKA 5GAEC 2ZJRA 4AYBG 5IP9H 4JYAL 1LTLA 2ALYB 3TQYA 4UP8A 3G71A 1K8GA 3ULJA 1OXSC 4EQ5A 2I5MX 2UUCL 4RMFA 2YYZA 1KAWA 3I4MH 3G6EA 4PZ6A 4RG1A 2JEBI 3HOXG 3I4OA 2CWPA 1K9MC 2IX1A 1HNZL 4LFBQ 4AQYL 4LUOA 1RIPA 2K50A 1LUZA 1QUQB 1TWHH 2A19A 1VQKA 3W5OA 1YJ9A 4L5RC 1XNQL 1HR0Q 4NPSA 1I94Q 2JA7H 2VQFL 1E24A 2A8VA 1KC8C 1JJ2A 1VQJA 2MO1A 3S24A 1AE2A 1WCMH 5C0XI 3U50C 3CAMA 4DAMA 2CKZB 3PSIA 5JEAJ 2OQKA 2R7DA 1IBMQ 2N78A 4BBSG 4BBRH 1EQQA 4LF5Q 3CD6A 1Q86C 2JA8G 2GVBA 4QJFA 4IPCA 1XMOL 1IBLQ 3PO3G 5LMUL 2VQEL 2QA4A 1K83H 1HH2P 4JOIC 1JB7A 1SROA 3G48A 4A3KH 2CCZA 1FJGQ 1B7YB 4KLKA 3A5UA 3HKZE 2UXDL 3NEMA 4DV0L 3E9IA 2KHJA 2Q2TA 3CMEA 4HJ7A 4DV2Q 5M3MG 3BJUA 1FL0A 2LSSA 1YBYA 1VQDA 5ELOA 2AWOA 4GNXA 4A3IG 4JBWA 4YWMA 3JAMc 1GKHA 1RL2A 5C4JH 3WWVA 4DAYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GAD C;  1VQE A;  1AE3 A;  2JE6 I;  4IFD I;  3NEL A;  5FJ8 G;  4AH6 A;  1YHA A;  3K8A A;  4JI7 Q;  4GKJ L;  3TEH B;  2JA5 G;  2EIF A;  3CPF A;  2V1C C;  4NXN L;  2UUB Q;  2ZTC A;  1VQF A;  4DV6 Q;  3BZC A;  1G29 1;  2RHS B;  2KBN A;  1KQS A;  4GS3 A;  2LXK A;  2ASB A;  3HKS A;  2BH2 A;  3ULP A;  5GQO A;  4JI5 Q;  4A93 H;  3Q8D A;  4GLA C;  4K0K L;  1N33 L;  4PG3 A;  2PNH A;  4JI2 L;  3KDF A;  3F2B A;  3GDE A;  5IYC H;  4DKA C;  4Y7N H;  3SGI A;  2WFW A;  4DR4 Q;  4DR7 Q;  2C35 B;  2ES2 A;  1Y1V G;  1VS0 A;  2I5L X;  1NMF A;  2IX0 A;  3A0J A;  2E2H H;  2UUA L;  2IHE A;  1DGS A;  2ZTE A;  3J80 c;  3CC4 A;  5IYB G;  3L2P A;  1HZA A;  2UXB Q;  4YCV A;  4TVA B;  2ZM6 Q;  4JI0 Q;  3AYH B;  1XPR A;  4B3T Q;  3HOV G;  3HOZ G;  4A3D G;  4DV5 Q;  3KF6 A;  4R4C A;  1UE7 A;  2B63 G;  4A3J H;  1SN8 A;  4LF4 L;  5C0X J;  4YWL A;  4AIM A;  1X9N A;  2OCE A;  4BXX G;  4JI1 L;  1XTD A;  2JK8 A;  4A3E G;  2ZJP A;  1SMX A;  3D31 A;  3J7Z C;  3M3Y H;  2UU9 Q;  1VQM A;  4JBM A;  1BBU A;  1FVI A;  1VQ4 A;  3PF4 A;  4DV1 Q;  3H0G G;  2B3G A;  2BH8 A;  4HID A;  3G4S A;  3KJO A;  1QUQ A;  2R92 H;  1HZB A;  4L5Q A;  1YHB A;  4JI8 L;  3EBE A;  1VQG A;  1UWV A;  1MJC A;  2E2I H;  4YY3 L;  1VQH A;  1SFO H;  2QGQ A;  4BY1 G;  4OO1 G;  1XMQ Q;  3TRE A;  3CCU A;  3A5Z B;  4JBK A;  1N34 Q;  2RHQ B;  4B3M L;  5IP7 G;  1VQ5 A;  1L2F A;  4GOP C;  3I4N H;  4JV5 Q;  1JE5 A;  3KLW A;  1SRU A;  1Q7Y C;  1WJJ A;  1N9W A;  4UPA A;  1HJP A;  4DR5 Q;  1N36 Q;  1HNX L;  3GTO H;  2Q2I A;  1HZC A;  2CWA A;  4O0A A;  3CCV A;  3OTO L;  5JJK A;  2IHF A;  3ZJY C;  1TWA H;  1A8V A;  4QIW E;  2WB1 E;  3UDX A;  4JI6 L;  4R4T A;  2AMC B;  1GVP A;  2D0O A;  2D62 A;  5FLM G;  1EUJ A;  1UEB A;  1PHJ A;  1PH8 A;  4EX5 A;  5C44 G;  4C3H H;  4HIK A;  1PH6 A;  4DNI A;  1SLJ A;  2NN6 G;  4WJ3 M;  2PQA A;  1PH3 A;  3K80 C;  2NVY H;  1MJE A;  2XGT A;  5FLX c;  1YVC A;  4IFD G;  1ASY A;  4QY7 A;  1VQ6 A;  5ELN A;  2KHI A;  3STB D;  2AWN A;  3PUY A;  4PZ8 A;  1R9T H;  3PO3 H;  1BVS A;  3CCE A;  3HOW G;  4UY8 C;  1JMC A;  1IXR A;  3CC7 A;  4A3F G;  5JJL A;  2PI2 E;  1HNZ Q;  2K5H A;  1L0W A;  1UE6 A;  1VQN A;  1P16 A;  4LWC A;  4HJ5 A;  4IPH A;  3S14 H;  3RR5 A;  1IL2 A;  1PYS B;  3NBH B;  2VQF Q;  4P74 A;  2IT1 A;  4DUY L;  5BR8 L;  5M3M H;  4DR1 L;  5DLQ E;  1YIT A;  5IE8 A;  5LMN Q;  1PFS A;  4YWK A;  3T1Y L;  2N8N A;  5H1S E;  2R93 H;  3J7A 5;  3PO2 G;  3HOU G;  1I6H H;  3RLN A;  2H5X A;  4FDB A;  3E0E A;  4DUZ L;  1YJN A;  3CF5 A;  1SE8 A;  3D0F A;  3PGZ A;  1NY4 A;  2JA5 H;  3ER0 A;  1M90 C;  2GN5 A;  4X64 Q;  1W3S A;  1OXU A;  3A74 A;  1KXL A;  2F4V Q;  2YTY A;  4YCU A;  1HNW Q;  2UXD Q;  3TS0 A;  5IWA L;  2OTJ A;  4P72 A;  1VQP A;  1J5E L;  4POG A;  5IYD G;  4A3C G;  2I0Q A;  3CW2 C;  4OWX B;  3ULL A;  1X55 A;  1PH4 A;  1N32 Q;  1W2B A;  1XPO A;  3S1R H;  1FGU A;  2K75 A;  5M3F G;  1OTC A;  4JI4 Q;  3GTM H;  1Y1V H;  3FKI G;  5JEA G;  2PQA B;  1OXT A;  2K14 A;  4KI0 A;  2KCM A;  1I94 L;  1VQI A;  3AEV A;  2IY5 B;  1S72 A;  5IYB H;  1MIU A;  1MKH A;  1BBW A;  3KF8 B;  4NB3 A;  3HOV H;  3HOZ H;  4A3D H;  4B3R Q;  1IBM L;  4GKK Q;  1CKM A;  1Q1E A;  4YCW A;  4HJA A;  4JG2 A;  2B63 H;  4BA1 I;  3VDY A;  1WFQ A;  3HKZ G;  1ASZ A;  3I4M G;  2K52 A;  1IBL L;  2QEX A;  1V43 A;  3PUX A;  1Q82 C;  3M85 A;  1QVG A;  2NVX H;  4TQU S;  1X3G A;  3CXC A;  1PH5 A;  4BXX H;  4K0K Q;  1U5K A;  4GOP B;  1A63 A;  4JI2 Q;  4C2M H;  4YHH Q;  4MZ9 A;  4A3E H;  4DR2 Q;  3CPW A;  1Q81 C;  1QVC A;  3UE1 A;  4GLX A;  4JOI A;  3RNU A;  2OTL A;  1Q12 A;  4LF7 L;  1C0A A;  1XJV A;  4OWW B;  1E1T A;  4ME3 A;  4PMW A;  4DV2 L;  3H0G H;  1EFW A;  1XNR L;  3ICE A;  3J81 i;  4LFC Q;  4C3J H;  4A3M H;  2E5L Q;  1CKN A;  2Q2U A;  2RCN A;  4R4Q A;  3DM3 A;  1L1O C;  4DR6 L;  4BY1 H;  1X6O A;  3CCS A;  2ZJQ A;  1K8A C;  2UXC Q;  3FHW A;  4JI1 Q;  4OX9 L;  2Y0S E;  3KYH C;  5IP7 H;  5AJ3 Q;  4IJL A;  4DV4 Q;  5GRO A;  4A4I A;  4R4I A;  1K3R A;  4B3S Q;  3FP9 A;  1X3F A;  4IOC A;  1TWC H;  4JI5 L;  4JC0 A;  1YI2 A;  1CSQ A;  2FXQ A;  4DR7 L;  4X6A H;  5FLM H;  4DV3 L;  4LF8 Q;  1PVO A;  1J6Q A;  2D0P A;  4YY3 Q;  3S16 H;  2PMZ E;  1KRS A;  3CCL A;  3GTQ H;  4Y52 H;  1NE3 A;  4LF9 Q;  3RN5 A;  2JQO A;  5C0X G;  4KHP Q;  4JI0 L;  3PV0 A;  3M4P A;  4A3B G;  4GN4 B;  2I5H A;  3TS2 A;  3GTK H;  1WYD A;  1EIY B;  1NBW A;  4DV5 L;  4R1J A;  1Z47 A;  1HNX Q;  2AKW B;  4LF6 Q;  4X66 L;  3HOY G;  1YJW A;  1YIJ A;  3HOW H;  1B8A A;  1VQB A;  4JI3 Q;  5M5Y H;  4A3F H;  2HIX A;  4LNQ A;  3M4O H;  3B6Y A;  3H3V H;  4JI6 Q;  1LM0 A;  3RLO A;  3HOX H;  4C3I H;  1KHI A;  4X65 L;  1CSP A;  1IBK Q;  5C3E G;  3F2C A;  2R7Z G;  3UDG A;  2OWO A;  1EIF A;  1CKN B;  2ATW A;  2WAQ E;  4MNO A;  2K4K A;  1S3O A;  3W1G A;  2ID0 A;  4DV1 L;  4NXM L;  2CQO A;  4DR3 Q;  4IO9 A;  3STB C;  2GVA A;  2E2J H;  3PO2 H;  1QVF A;  2MO0 A;  4JYA Q;  2RF4 A;  5M5X H;  3K7U C;  5JJI A;  3I56 A;  4J15 A;  4BBS H;  1V1Q A;  4DV7 L;  1XMQ L;  2K5V A;  4AYB E;  1KD1 C;  1OXX K;  3T1H L;  4X62 L;  3ERS X;  1Y1W G;  2UUC Q;  2JA8 H;  1C9O A;  4L5S A;  3MXN B;  3UDI A;  2F52 A;  3CCR A;  3AQQ A;  4JV5 L;  3NEN A;  3CCM A;  3F1Z A;  3DLL A;  2VW9 A;  4OXP A;  3S15 H;  1G6P A;  1KRT A;  4UP9 A;  4AQY Q;  4DUY Q;  1N36 L;  4A3C H;  5BR8 Q;  5IYD H;  2HT1 A;  2E8G A;  1TWG H;  2JEA I;  1XNQ Q;  4L5T A;  2JA6 G;  4GOP A;  2HIV A;  2HQL A;  5C4X G;  1AH9 A;  1KL9 A;  3PIP A;  3T1Y Q;  3I55 A;  1QZH A;  4A3I H;  4XIG S;  4GLV B;  1YNX A;  2N3S A;  2YTX A;  1PV4 A;  4A3L G;  1PH7 A;  2HHH L;  3CQZ H;  1XPU A;  4BY7 G;  4JBJ A;  3IRB A;  1D7Q A;  2NZH A;  2A1A A;  1XMO Q;  4LFA L;  1L1O B;  2VQE Q;  1WOC A;  5FJ8 H;  5LMU Q;  1HR0 W;  1E1O A;  3I4N G;  5IWA Q;  5LMN W;  4KHZ A;  1J5E Q;  4IJH A;  1GD7 A;  2VUM G;  4A3G G;  4P73 A;  4GNX C;  1EYG A;  1NTG A;  1O7I A;  1E22 A;  4DV0 Q;  4JCV E;  1Q46 A;  3S2D H;  2Z6K C;  5K36 G;  1KIX A;  4LFB L;  3CC2 A;  4BA2 I;  4LUV A;  1HZ9 A;  1Q8K A;  1GM5 A;  3L0O A;  1HR0 L;  3PCO B;  1PA6 A;  4MTN A;  3AFQ A;  4P71 A;  5LMN L;  2NVQ H;  5J3B A;  1OXV A;  4OO1 I;  2R6G A;  1X65 A;  3PF5 A;  3JAM i;  4APV A;  5IP9 G;  4GKJ Q;  3MEF A;  2MFI A;  4NXN Q;  3RZO H;  4QQB X;  1JJC B;  1YEZ A;  1X56 A;  1S40 A;  2R7F A;  4LUZ A;  4IPG A;  3PIO A;  4A76 A;  3TRZ A;  4LF5 L;  4LW1 A;  2WP8 J;  4X64 L;  3I7F A;  1VQO A;  2VL6 A;  2N49 A;  2F4V L;  1NJI C;  1CKO A;  2B29 A;  3I2Z A;  4ALP A;  3S17 H;  1HNW L;  1JT8 A;  1N33 Q;  3L7Z C;  1T9H A;  4LF7 Q;  3S2H H;  1FJG L;  1X3E A;  3PUZ A;  4GN3 B;  1I50 H;  1XNR Q;  3H15 A;  2JA7 G;  1N32 L;  2K5N A;  1K73 C;  2AHO B;  3S1N H;  2NN6 I;  1PH9 A;  3U4Z A;  2UUA Q;  4JI4 L;  5GAH C;  3BZK A;  1WI5 A;  1WCM G;  1I5F A;  4HIM A;  4O2D A;  2R93 G;  4DR6 Q;  2Z6K A;  3M9B A;  3K81 C;  3RN2 A;  1YHQ A;  2F3I A;  1G51 A;  4UP7 A;  3PUW A;  4DPG A;  4BBR G;  3J80 i;  2VS1 A;  3U4V A;  1NMG A;  4A75 A;  2YV5 A;  1SR3 A;  3PUV A;  4LF4 Q;  4OX9 Q;  4A3B H;  2VNU D;  3AFP A;  2L15 A;  4GKK L;  4JI7 L;  4IOA A;  3E9H A;  3K7A H;  3H3V I;  3HOY H;  2UUB L;  3GO5 A;  3HFZ B;  4A3K G;  2KEN A;  1I3Q H;  5EAY A;  1VQ8 A;  2Z0S A;  4QGU A;  4DV6 L;  2Q2H A;  2XTI A;  1V9P A;  1EOV A;  4YHH L;  2CFM A;  3J81 c;  3CMA A;  4DR2 L;  4DV3 Q;  4OON A;  5C3E H;  4P75 A;  3J81 j;  4HIO A;  4WJ4 A;  3GTG H;  1PYB A;  1GO3 E;  3KOJ A;  2DGY A;  2R7Z H;  1Z9F A;  4DR4 L;  4JI8 Q;  3W1B A;  3KFU A;  4H02 A;  2EXD A;  1QZG A;  5E7N A;  4LFC L;  5C44 H;  3CP0 A;  1PH2 A;  3CCQ A;  2E5L L;  5IT9 c;  1LYL A;  1EQR A;  3EIV A;  2UXB L;  4R4O A;  1M1K C;  1VQ7 A;  1B70 B;  2ZM6 L;  4HJ9 A;  1D8L A;  2Y0S G;  2VY3 A;  4GN5 A;  5HY6 A;  4X66 Q;  1VQL A;  4B3T L;  3LGJ A;  3OW2 A;  4B3M Q;  4IPD A;  1Y1W H;  2UXC L;  3K0X A;  1C7Y A;  3JC6 6;  1L1O A;  1UE5 A;  3U58 A;  5AJ3 L;  2LXJ A;  4DV4 L;  1X54 A;  4X65 Q;  4A93 G;  3OTO Q;  1TXY A;  1K0R A;  4GNX B;  1PH1 A;  1VQ9 A;  2BA1 A;  4B3S L;  3S1Q H;  1A62 A;  5HGQ A;  5IYC G;  3UE0 A;  1N8R C;  3M4Q A;  2JA6 H;  4QL5 A;  4PZ7 A;  4NXM Q;  5C4X H;  1EWI A;  4A3M G;  2VZA A;  2UU9 L;  3F2D A;  4B3R L;  1UE1 A;  3GTP H;  1P8L A;  1VQC A;  2OQ0 A;  1A0I A;  1Y14 B;  4POF A;  4DK3 C;  3RLF A;  3KJP A;  4LF8 L;  3F8T A;  4OWT B;  1TWF H;  2JA9 A;  2PI2 A;  2KCT A;  4A3L H;  2BA0 A;  3GTL H;  1Q1B A;  4DV7 Q;  3S1M H;  4BY7 H;  3HOU H;  3T1H Q;  1IYJ B;  3OYY A;  4XTC S;  4X62 Q;  4LF9 L;  1VCI A;  4KHP L;  2MNA A;  3EN2 A;  4A3J G;  1JJG A;  3UDF A;  1BKB A;  3GD7 A;  1VQA A;  1U0L A;  1H95 A;  1N34 L;  3GTJ H;  4IFD J;  5IY0 A;  4LF6 L;  1IZ6 A;  2VUM H;  4DK6 C;  3KDF B;  4A3G H;  4HJ8 A;  4JI3 L;  1E3P A;  3M7N A;  2JJQ A;  2NZO A;  5GAG C;  2YU9 H;  4DR5 L;  2WB1 G;  2NVT H;  2YTV A;  4DR1 Q;  2EQS A;  2WAQ G;  2DUD A;  1IBK L;  1YZ6 A;  2R92 G;  5M3F H;  2MQH A;  3CCJ A;  2HHH Q;  3FKI H;  5M5W H;  3KF6 B;  2ZTD A;  4DR3 L;  1E7Z A;  3BU2 A;  4DUZ Q;  3RZD H;  4LFA Q;  1CUK A;  5GAE C;  2ZJR A;  4AYB G;  5IP9 H;  4JYA L;  1LTL A;  2ALY B;  3TQY A;  4UP8 A;  3G71 A;  1K8G A;  3ULJ A;  1OXS C;  4EQ5 A;  2I5M X;  2UUC L;  4RMF A;  2YYZ A;  1KAW A;  3I4M H;  3G6E A;  4PZ6 A;  4RG1 A;  2JEB I;  3HOX G;  3I4O A;  2CWP A;  1K9M C;  2IX1 A;  1HNZ L;  4LFB Q;  4AQY L;  4LUO A;  1RIP A;  2K50 A;  1LUZ A;  1QUQ B;  1TWH H;  2A19 A;  1VQK A;  3W5O A;  1YJ9 A;  4L5R C;  1XNQ L;  1HR0 Q;  4NPS A;  1I94 Q;  2JA7 H;  2VQF L;  1E24 A;  2A8V A;  1KC8 C;  1JJ2 A;  1VQJ A;  2MO1 A;  3S24 A;  1AE2 A;  1WCM H;  5C0X I;  3U50 C;  3CAM A;  4DAM A;  2CKZ B;  3PSI A;  5JEA J;  2OQK A;  2R7D A;  1IBM Q;  2N78 A;  4BBS G;  4BBR H;  1EQQ A;  4LF5 Q;  3CD6 A;  1Q86 C;  2JA8 G;  2GVB A;  4QJF A;  4IPC A;  1XMO L;  1IBL Q;  3PO3 G;  5LMU L;  2VQE L;  2QA4 A;  1K83 H;  1HH2 P;  4JOI C;  1JB7 A;  1SRO A;  3G48 A;  4A3K H;  2CCZ A;  1FJG Q;  1B7Y B;  4KLK A;  3A5U A;  3HKZ E;  2UXD L;  3NEM A;  4DV0 L;  3E9I A;  2KHJ A;  2Q2T A;  3CME A;  4HJ7 A;  4DV2 Q;  5M3M G;  3BJU A;  1FL0 A;  2LSS A;  1YBY A;  1VQD A;  5ELO A;  2AWO A;  4GNX A;  4A3I G;  4JBW A;  4YWM A;  3JAM c;  1GKH A;  1RL2 A;  5C4J H;  3WWV A;  4DAY B; 
#chains in the Genus database with same CATH topology
 2XN9 C;  5E3F A;  1SNP A;  1VQE A;  4IUN A;  1AE3 A;  1L0Y B;  5IGE A;  3K8A A;  2V1C C;  2ZTC A;  2K7V A;  1VQF A;  3NWS A;  1UNS A;  1G29 1;  2EY5 A;  2KBN A;  2LXK A;  4A93 H;  4JI5 Q;  1N33 L;  2AQ2 B;  2MPM A;  3F2B A;  4DR4 Q;  2B8G A;  4KKT A;  3PIP 3;  1SYD A;  1Y1V G;  2E2H H;  3J80 c;  3AYH B;  5K5P A;  2J0T D;  3KLR A;  4KKU A;  4M8A A;  4R9W A;  1LAC A;  4DV5 Q;  3KF6 A;  2SDF A;  4RGM A;  1UE7 A;  4RHS A;  2MUY A;  4YWL A;  1PFM A;  1X9N A;  3J80 L;  1ZXT A;  1E2W A;  2L12 A;  4JI1 L;  4A3D B;  4A3E G;  1SMX A;  3Q22 A;  1BBU A;  5G3L F;  4IZ8 A;  3H0G G;  3NBH A;  4K8J A;  2BH8 A;  4HID A;  2NVX B;  2JYO A;  1YHB A;  2F1M A;  3A7A B;  1UWV A;  3BZD B;  3CKI B;  2QDB A;  3SXH A;  3CCU A;  1IHZ A;  3A5Z B;  1N34 Q;  4JBK A;  4C3J B;  2QCP X;  1G2S A;  2FMC A;  3NSW A;  1JE5 A;  1SRU A;  1F2M A;  2EJG C;  1HNX L;  1HJP A;  1N36 Q;  1O7Z A;  5CBE E;  1IKM A;  2Q2I A;  1A3V A;  3CCV A;  2HUG A;  2WB1 E;  4R4T A;  1GVP A;  5K36 H;  4EX5 A;  4C3H H;  4WJ3 M;  4J6H A;  1TWC B;  1JOO A;  2L55 A;  1YVC A;  4IFD G;  3FMC A;  3I8Z A;  4H0L C;  1F9S A;  1VQ6 A;  1F9Q A;  4EGV A;  4DU9 A;  2AWN A;  5CYU A;  3CCE A;  2R92 B;  1AZQ A;  1OO9 B;  4KY7 A;  1CHQ D;  4IPH A;  5IOD A;  3RR5 A;  4AYB B;  2VQF Q;  3SK6 A;  2IT1 A;  5BN3 A;  1C4Q A;  4I7A A;  1HA5 A;  2BCO A;  1YIT A;  5FK9 C;  3MAQ A;  5LMN Q;  4A3F B;  3HOX B;  3RLN A;  5EKI A;  1DON A;  4FDB A;  1WD1 A;  1SE8 A;  1ZYR D;  3A74 A;  1SBB B;  3O13 A;  4YCU A;  2IL8 A;  2UXD Q;  1HFN A;  3PO2 B;  1EL0 A;  2LMC B;  1J5E L;  3IKJ A;  1X55 A;  1N32 Q;  3GV3 A;  3R3O A;  5M3F G;  1H9K A;  1OTC A;  4HSP A;  2JA8 B;  2PQA B;  3AEV A;  4CHT B;  1PRT B;  3J7A F;  2M00 A;  1MKH A;  1BBW A;  4NB3 A;  3E6Z X;  4A3D H;  4B3R Q;  4OHJ A;  4GKK Q;  4HJA A;  1FYC A;  4XXE A;  4DAP A;  3VDY A;  2SNM A;  3PUX A;  2NVX H;  4BXX H;  2K05 A;  1PH5 A;  3LWU A;  4QF4 A;  4JI2 Q;  1EY8 A;  1X3Q A;  3MXG A;  4YHH Q;  2B2Y C;  4GLX A;  2OTL A;  1C0A A;  3TDQ A;  2JA5 B;  1TY0 A;  1XJV A;  2RBM A;  1EFW A;  4LFC Q;  4C3J H;  4CJ1 B;  2E5L Q;  2HQE A;  1CKN A;  1IKL A;  2AUK A;  3DM3 A;  5IGD A;  4OO1 H;  3S1R B;  1BO0 A;  2UXC Q;  3FHW A;  4IJL A;  4DV4 Q;  4R4I A;  3DEO A;  4B3S Q;  2OF1 A;  3FP9 A;  1TWC H;  4Q0F A;  2F0G A;  4JC0 A;  2A6H C;  3L3O C;  4X6A H;  4DV3 L;  2BOS A;  1WTX A;  2NN6 H;  3CCL A;  2K6A A;  4Y52 H;  4LF9 Q;  1EIH A;  1NBW A;  5FOB B;  1PZJ D;  1F2Y A;  2M2L A;  3HOY G;  1YJW A;  1VQB A;  5M5Y H;  4A3F H;  1D1I A;  2EYM A;  4JI6 Q;  1PTO C;  3HOX H;  1B50 A;  2MP1 A;  1LTI D;  2PNR C;  3K6O A;  2XSC A;  3E0J A;  2R7Z G;  1EIF A;  4N8F A;  5KNC A;  4DV1 L;  4RWS C;  2CQO A;  4ZKB B;  5IGC A;  1SNO A;  4XQQ A;  1IYU A;  3PO2 H;  2RF4 A;  3K7U C;  1A3U A;  4B08 A;  4DXG A;  4J15 A;  4N9T A;  1V1Q A;  2CH4 A;  2UUC Q;  1OXX K;  1Y1W G;  4X62 L;  2Z9H A;  2JA8 H;  3KBX A;  5C44 B;  3CCR A;  3AQQ A;  1AW7 A;  2FHT A;  2JSO A;  3F1Z A;  3NEN A;  4F8M A;  3DLL A;  3GTQ B;  1G6P A;  3PMF A;  2KCC A;  3MFY A;  5IIF A;  4DUY Q;  4A3C H;  5IYD H;  1BBX C;  5E1F A;  2JEA I;  4L5T A;  3PIP A;  1QZH A;  4L8J A;  5JEA H;  1BXT A;  1LT3 D;  1YNX A;  1PV4 A;  1G8Z D;  4ID6 A;  2EXZ A;  2A1A A;  1SEB D;  5EKK A;  2VQE Q;  1E1O A;  3MTS A;  3I4N G;  5LMN W;  3GTP B;  1GD7 A;  1EYG A;  4IN3 A;  1KTK A;  1O7I A;  4DV0 Q;  5BN5 A;  1LTG D;  3SR1 A;  1HUN A;  3TSS A;  3Q0A A;  1BCP B;  4BA2 I;  4JVZ A;  1Q8K A;  4A3G B;  3L0O A;  5FO7 B;  4OO1 I;  2YU9 B;  1YNJ D;  2R6G A;  2IX3 A;  1PZI D;  5JPN C;  1EIG A;  3VA5 A;  3AB9 A;  3ZYY X;  4A76 A;  1D6E C;  2A74 C;  2EYO A;  4X64 L;  2VL6 A;  3A56 A;  1FGB D;  4FF1 A;  1CKO A;  3J81 E;  2H4O A;  3L7Z C;  1T9H A;  4LF7 Q;  4X3K A;  1V1P B;  2N88 A;  4CDF C;  3I3C A;  2K5N A;  2NN6 I;  3NBI A;  1SYG A;  3HKZ B;  3H94 A;  5IT9 E;  1WI5 A;  1I5F A;  4O2D A;  4DR6 Q;  3QR8 A;  1YHQ A;  1M8A A;  3PUW A;  4WRD A;  3T16 A;  3J80 i;  4OX9 Q;  2JA7 B;  4RH6 A;  4NMZ A;  3JAM L;  1EYC A;  4JI7 L;  3MXP A;  3K7A H;  4A3K G;  1SJE D;  1PFN A;  5EAY A;  1Y8N B;  1VQ8 A;  4DAV A;  4FYD A;  4DV6 L;  2Q2H A;  3D6W A;  1RF2 D;  1EOV A;  4X3T A;  4U67 3;  3J81 c;  5A35 A;  3CMA A;  3GTG H;  1GO3 E;  2DGY A;  3AU7 A;  4I7Z C;  5C44 H;  3CP0 A;  2B2Y A;  1PH2 A;  3CCQ A;  4ABN A;  5IT9 c;  1GHJ A;  1VQ7 A;  2ZM6 L;  4HJ9 A;  4KV6 A;  1D8L A;  4MIU A;  3D4R A;  3SEB A;  4ILW A;  5C4J B;  3K0X A;  3JC6 6;  3D3R A;  5AJ3 L;  4IUT A;  5EPK A;  1X54 A;  3OTO Q;  2A68 C;  1TXY A;  2KA7 A;  1EYA A;  5HGQ A;  3M4Q A;  1EYD A;  4E6I A;  4A3M G;  1PTO F;  3NWT A;  3GTP H;  1VQC A;  3X3N A;  3RLF A;  3KJP A;  4FO2 A;  1TWF H;  1TII D;  1VF5 C;  1K28 A;  2KCT A;  4KJN A;  1PRT D;  1Q1B A;  4A3L H;  4IUV A;  1IYJ B;  4XTC S;  1MI2 A;  1JJG A;  3UDF A;  1H95 A;  4LF6 L;  4CGY B;  1S4Z A;  2F0K A;  4A3G H;  3KDF B;  2JJQ A;  2NZO A;  3VR6 A;  2YU9 H;  2OT2 A;  2O5I C;  4CBV A;  4DR1 Q;  2WAQ G;  2CW0 D;  1STE A;  1T5X D;  5L37 A;  1Z7T A;  2B2V C;  2MQH A;  3CCJ A;  2HHH Q;  2IJ0 A;  1E7Z A;  4DUZ Q;  3RZD H;  4LFA Q;  1CUK A;  2WB1 B;  1CQV A;  3E5S A;  5IP9 H;  2RDF A;  1PTO H;  2F0W A;  2YYZ A;  3MA2 B;  3J7A V;  2LFN A;  1MD2 D;  2JEB I;  1Y69 U;  1JOK A;  3S1M B;  1DJR D;  4N9P A;  3W5O A;  1YJ9 A;  1WD0 A;  2JA7 H;  1HR0 Q;  4HTH A;  2QF7 A;  2MO1 A;  4C1N I;  3GTO B;  2CKZ B;  4XDX A;  1NR2 A;  4BBS G;  2NVT B;  4BBR H;  2QKI C;  2JN4 A;  4IPC A;  5LMU L;  1B3A A;  1SRO A;  4PV1 C;  1B7Y B;  4KLK A;  5CMD A;  3K58 A;  1FJG Q;  3E9I A;  4ZYS A;  2RCF A;  3UI2 A;  3ERO A;  4LMQ D;  1WTV A;  5KGU A;  5ELO A;  2AWO A;  4YWM A;  1GKH A;  4RCN A;  4WFN 3;  5C4J H;  1R4P B;  3S14 B;  4PMC A;  2N55 A;  5DM7 3;  2JE6 I;  2Q8I B;  4RKB A;  1TWH B;  1YHA A;  1B3Q A;  4NXN L;  2UUB Q;  3HGB A;  3OIQ A;  1WCM B;  1IW7 C;  1I6H B;  5DM6 3;  4GS3 A;  2ASB A;  3HKS A;  3I72 A;  4GLA C;  2O4X A;  2PNH A;  3KDF A;  3GDE A;  4DKA C;  3SGI A;  2WFW A;  4DR7 Q;  1HQR D;  2RKS A;  1NMF A;  2UUA L;  1DGS A;  2UXB Q;  3L2P A;  2OXP A;  4YCV A;  4B3T Q;  3HOV G;  3HOZ G;  1HA6 A;  1Y1V B;  2B63 G;  4A3J H;  3N52 A;  3H6M A;  5A2Q L;  5C0X J;  1PXU A;  2OCE A;  3K59 A;  4WOR A;  5KND A;  1VMP A;  1AFP A;  1ROD A;  2F0F A;  2UU9 Q;  1VQM A;  3PF4 A;  5I6W A;  3VA7 A;  2F0H A;  3G4S A;  3DXJ C;  3KJO A;  4YIJ A;  2IW3 A;  1BCP D;  1KNE A;  1MJC A;  4A3E B;  1VQH A;  3LNN A;  3ND8 A;  2QGQ A;  1H9J A;  2A6H D;  4BY1 G;  1PYW D;  1FNW A;  4QUF A;  1XMQ Q;  1HQM C;  2LKV A;  3PIO 3;  5IP7 G;  1VQ5 A;  4GOP C;  4G7Z C;  1WJJ A;  4K5X A;  1DCZ A;  2B2W C;  4UPA A;  5CV7 A;  4DR5 Q;  3GTO H;  2IWH A;  4N8X 1;  4O0A A;  2CWA A;  2IHF A;  3UDX A;  2AMC B;  4U68 A;  2D0O A;  2D62 A;  1PHJ A;  1PH8 A;  1PH6 A;  1B53 A;  1SLJ A;  4FNF A;  3URY A;  2NVY H;  2X6G A;  3RMH A;  1WTO A;  1MJE A;  1CA5 A;  4K2L A;  4DN4 M;  3HS0 C;  4DK1 A;  1SSO A;  3PUY A;  4Z9C B;  4FP5 D;  3VYU A;  3HOW G;  4UY8 C;  2XWJ B;  1JMC A;  3CC7 A;  5JJL A;  1HNZ Q;  1CK1 A;  2K5H A;  1L0W A;  1P16 A;  3S14 H;  1EWC A;  1AZP A;  1PYS B;  3NBH B;  4P2C B;  4P74 A;  2X6L A;  3D4W A;  2WKD A;  1PFS A;  4YWK A;  2N8N A;  1E2V A;  1CHP D;  3J7A 5;  1I6H H;  1SAP A;  4C3I B;  1AN8 A;  3E0E A;  3PGZ A;  1NY4 A;  1M90 C;  3IFT A;  2F4V Q;  5IWA L;  2NWG A;  4POG A;  2FMM A;  3CW2 C;  4KN7 C;  4OWX B;  1TU2 B;  3ULL A;  1CFM A;  1NCV A;  1FNV A;  4EQO A;  5LL6 S;  4Q5V A;  1Y1V H;  4KI0 A;  1I94 L;  2NTS A;  5I2Y A;  3K5O A;  1MIU A;  1STH A;  2M9V A;  1A2U A;  3KF8 B;  5TSS A;  2D5D A;  2F0I A;  4YCW A;  2XRQ D;  4JG2 A;  3T13 A;  4BA1 I;  1WFQ A;  4RGN A;  1ASZ A;  3I4M G;  2K52 A;  1IBL L;  1QVG A;  1HRJ A;  1X3G A;  3V2T A;  1IL8 A;  5KYL A;  2CH4 W;  4GOP B;  3K5N A;  5CV6 A;  4A3E H;  2GA4 B;  2ZXR A;  3CPW A;  1QVC A;  4HSV A;  4PMW A;  2L9H A;  2BE5 C;  3H0G H;  1XNR L;  1S5D D;  3J81 i;  4H13 C;  1ILP A;  1EQT A;  2O2L D;  1ICF B;  3I90 A;  3CHB D;  1UUP A;  4M1U B;  2I07 B;  1EY0 A;  5EBC A;  3RUZ A;  5J39 A;  2ZJQ A;  1EY4 A;  1PFB A;  4JI1 Q;  2Y0S E;  3KYH C;  3BVZ A;  4A4I A;  4JI5 L;  3KLS X;  2ICI A;  1PVO A;  4LF8 Q;  1TQO A;  1EZ8 A;  2EY2 A;  2PMZ E;  5KNB A;  4K14 A;  4KHP Q;  1QJO A;  3PV0 A;  1RTN A;  4OIJ A;  4GN4 B;  4A3B G;  1WTQ A;  1EIY B;  5BN4 A;  4DV5 L;  5C6A A;  1HNX Q;  1YNN C;  1B8A A;  2A69 C;  4JI3 Q;  1NSN S;  2NB0 A;  3J7Y W;  4J8Q A;  2WV6 D;  4C3I H;  1CSP A;  5I9O A;  1RD9 D;  5C3E G;  4LAA A;  5KEE A;  2DY8 A;  3UDG A;  3HOY B;  1CKN B;  3FPU B;  2ATW A;  1I3Q B;  1BQQ T;  2EE1 A;  3T53 B;  2E2J H;  4KD3 A;  2MO0 A;  1HXY D;  3I56 A;  4C56 C;  4DV7 L;  2RA4 A;  1KD1 C;  3KF8 A;  3T1H L;  3ERS X;  3TZU A;  5T1G A;  3MXN B;  2F52 A;  3TP8 A;  1N36 L;  1A6X A;  2HT1 A;  1TWG H;  1SE4 A;  2JA6 G;  4GOP A;  5I6Y A;  5C4X G;  3W3A A;  2F4I A;  2B2W A;  4ZUI A;  2ZXO A;  1ET9 A;  1F9R A;  4GLV B;  2Q8R E;  2YTX A;  5M5Y B;  3KUP A;  3SK8 A;  4RCO A;  1PH7 A;  3Q23 A;  3S1Q B;  1XPU A;  1F2L A;  4CDE C;  5FJ8 H;  1J5E Q;  3GQB A;  2VUM G;  4X3S A;  1NTG A;  1TT2 A;  3HOU B;  4JCV E;  1KDC A;  3X3M A;  5K36 G;  1KIX A;  4LFB L;  4C3H G;  3GTJ B;  3V05 A;  2Z4H A;  1GM5 A;  1D5X C;  1PA6 A;  4MTN A;  5LMN L;  2NVQ H;  4PQX A;  1OXV A;  5J3B A;  4K2K A;  1X65 A;  3PF5 A;  4KN4 C;  4APV A;  4GKJ Q;  4ZRZ A;  3EVQ A;  2A5H A;  4EVO A;  1X56 A;  1S40 A;  5JPM C;  3PIO A;  1O78 A;  3FKI B;  4LW1 A;  1Q3L A;  2ICE C;  2N49 A;  1E0B A;  2JP1 A;  2B29 A;  1O80 A;  5EKL A;  2MGS A;  5KRU A;  4GN3 B;  1N32 L;  1GOZ A;  3NPP A;  2A73 B;  2DNE A;  5D3D A;  3VR2 A;  1PH9 A;  5GAH C;  3BZK A;  4HIM A;  3DWA A;  2HCI A;  2HDL A;  1MBY A;  2VS1 A;  1QNU A;  1NMG A;  4LF4 Q;  4B3R L;  3PUV A;  4HED A;  1Q90 A;  5LHY 1;  1AP0 A;  4IAL A;  4KD4 A;  4GKK L;  3LWE A;  1U4P A;  2H1E A;  1STB A;  1SYF A;  3D6C A;  3HOY H;  3HFZ B;  2KEN A;  1I3Q H;  2F0L A;  2WII B;  2F0V A;  4QGU A;  5EGT A;  2XTI A;  3MXN A;  1V9P A;  1SE2 A;  1DOL A;  4YHH L;  4DV3 Q;  4UAI A;  4CJ0 B;  2KUM A;  1PYB A;  2EY1 A;  3K5M A;  2R7Z H;  1LTT D;  4JI8 Q;  3KFU A;  1JB3 A;  2EXD A;  5CV8 A;  2F3W A;  4LFC L;  1SXT A;  5ISR A;  1GUG A;  2E5L L;  1CT1 D;  4R8I A;  1EQR A;  2IPK D;  2L0C A;  4FXK C;  1K0S A;  3P7J A;  1M1K C;  1H9M A;  4B3M Q;  2VY3 A;  5HY6 A;  3VR3 A;  1V8Q A;  4DXF A;  4IPD A;  4GZY C;  1QIL A;  1Y1W H;  2UXC L;  5HGT A;  5ELF A;  3BYT B;  4DF7 A;  3U58 A;  4DV4 L;  3M7G A;  3C3L A;  1RJT A;  4B3S L;  3S1Q H;  5IYC G;  1L0X B;  4KK7 A;  2WAC A;  1N8R C;  1BNZ A;  1BOS A;  1EWI A;  2VZA A;  3D4D A;  3K7A B;  5G3L D;  1UE1 A;  1CA6 A;  1P8L A;  2OQ0 A;  4DK3 C;  4OWT B;  2A6E D;  4WJW A;  3BVG A;  4Y7N B;  2R61 A;  4LF9 L;  4X62 Q;  3HOU H;  1F77 A;  1DZ1 A;  4DNR B;  3EN2 A;  2MNA A;  3QIA A;  3GTG B;  2NUC A;  3GD7 A;  1VQA A;  2KVM A;  1U0L A;  3GTJ H;  5NUC A;  5DEH A;  2K33 A;  3MVV A;  1B1Z A;  2ZXP A;  2YTV A;  2DUD A;  3I91 A;  2R92 G;  1EZ6 A;  3FKI H;  4JPB W;  2K5Q A;  1KNA A;  3BU2 A;  2LY7 A;  4DAY A;  3EA6 A;  4AYB G;  3M3Y B;  2ALY B;  4UP8 A;  3ULJ A;  2TSS A;  4RHR A;  4JW0 A;  4EQ5 A;  2I5M X;  2UUC L;  2XVS A;  5FLX L;  1TWF B;  4RG1 A;  3HOX G;  4LK1 C;  1GUO A;  5CV5 A;  5CC4 A;  1WTR A;  3NQI A;  1SYC A;  4LUO A;  2K50 A;  1QUQ B;  3JAM E;  4L5R C;  2RQX A;  2FJ2 A;  4NPS A;  3FVQ A;  1CI3 M;  3IFD A;  2PYK A;  1PLF A;  3U50 C;  3CAM A;  2B2U C;  5JEA J;  1IBM Q;  2OQK A;  2R7D A;  4QB4 A;  4R8N A;  4DFA A;  1Q86 C;  2JA8 G;  2GVB A;  1R4Q B;  1JWS D;  3PO3 G;  2VQE L;  4JOI C;  4HAE A;  4QMG A;  4A3K H;  3G48 A;  3DWQ A;  4ME5 A;  3RZD B;  4F88 A;  4DV0 L;  2Q2T A;  2K32 A;  3OW7 A;  4HJ7 A;  4DV2 Q;  5M3M G;  1PTO B;  3BJU A;  1R9T B;  1CQF A;  3BDO A;  2LSS A;  1BDO A;  5I2X A;  3JAM c;  2ES2 A;  3WWV A;  5GAD C;  1ML0 D;  3H91 A;  4AH6 A;  4JI7 Q;  2JA5 G;  2EIF A;  1XX8 A;  1O7L A;  4DV6 Q;  1EY6 A;  2R93 B;  1KQS A;  2EZV A;  3ULP A;  5GQO A;  3Q8D A;  1SMY C;  4LJZ C;  4K0K L;  4PG3 A;  4BBR B;  4Y7N H;  4HR7 B;  1ONL A;  2C35 B;  4IUR A;  2RSN A;  4XYQ A;  1EWH A;  4RKL A;  2I5L X;  2NTT A;  4TRD A;  2IX0 A;  1UAP A;  3A0J A;  2ZTE A;  5IYB G;  2ZM6 Q;  1I4G A;  4JI0 Q;  1XPR A;  1J9O A;  3MHB A;  3TBI B;  1RKN A;  3BDL A;  2VB2 X;  4MN3 A;  4C1N K;  3FPP A;  4L6T B;  3HOV B;  2ZJP A;  3AMU A;  3M3Y H;  2SEB D;  4JBM A;  1VQ4 A;  2Y0S B;  2B63 B;  1X32 A;  4DNT B;  2D2C C;  2B3G A;  5C5M A;  1QUQ A;  2WIN B;  1HZB A;  1HCZ A;  3SE0 A;  2Z1C A;  3EBE A;  1B2T A;  4OIK A;  1VQG A;  2E2I H;  4YY3 L;  5KIX A;  1TKW B;  2Z8L A;  3TRE A;  5J22 A;  2QDL A;  3FDT A;  2RHQ B;  5CBA E;  2PMZ B;  1L2F A;  1A15 A;  4JV5 Q;  3KLW A;  1Q7Y C;  4K6L A;  2AUJ D;  1N9W A;  4CDD C;  1RDP D;  1I4P A;  3QOL A;  3OTO L;  5JJK A;  1YNN D;  2KJX A;  3ZJY C;  1A8V A;  4QIW E;  4A3J B;  5FLM G;  5CR3 A;  5C44 G;  1DOM A;  4HIK A;  1PH3 A;  5ELC A;  2EYF A;  2EVB A;  3TP5 A;  4HCS A;  4QY7 A;  5ELN A;  1NR4 A;  2FFK B;  4ZKC B;  2Z6B A;  4PZ8 A;  1R9T H;  2AQ3 B;  3HZX A;  5FO9 B;  1UE6 A;  1LT6 D;  3U9O A;  1VQN A;  1I4R A;  4LWC A;  4HJ5 A;  1IL2 A;  4XQN A;  5BR8 L;  1HHV A;  4UHV A;  1DYQ A;  4DR1 L;  4KJO A;  3HOW B;  3T1Y L;  5LL6 X;  1ZYR C;  2R93 H;  5EPJ A;  3BS1 A;  1KAB A;  2H5X A;  2L4N A;  4PNY A;  3DWP A;  4DUZ L;  3WOF A;  3D0F A;  4ZCK A;  3ER0 A;  1HNW Q;  1PMR A;  1K3B C;  3TS0 A;  2OTJ A;  4P72 A;  2X69 A;  2NVY B;  4S3S A;  2KHS A;  5M5X B;  2I0Q A;  2EYL A;  3D8G A;  1W2B A;  3QOJ A;  1TY2 A;  2G9D A;  2VB3 X;  1FGU A;  1HTP A;  1QWY A;  1Y8O B;  2K75 A;  5A2Q E;  4JI4 Q;  1OXT A;  2KCM A;  3L9A X;  3BVM A;  4ZK9 B;  1S72 A;  2B2T C;  1VMC A;  4OL7 A;  3HOV H;  3HOZ H;  5EQ0 A;  2KED A;  4O42 A;  2B63 H;  3RD4 A;  4A3I B;  3HKZ G;  2B2U A;  2QEX A;  1A63 A;  1JCK B;  4TQU S;  1U5K A;  1S5B D;  1WVL A;  4DR2 Q;  1Q81 C;  3UE1 A;  4JOI A;  2G9H D;  4OWW B;  3ICE A;  3U9S A;  1IYV A;  3A8I E;  1K8M A;  4HMI A;  5EJW A;  3SK4 A;  1TS5 A;  2PZU A;  5HUR A;  2RCN A;  1L1O C;  2F0T A;  2I46 A;  5I9P A;  4BY1 H;  1X6O A;  3K5L A;  1I4X A;  1K8A C;  1ZKO A;  5IP7 H;  4DA2 A;  3H09 A;  4IOC A;  1C48 A;  2FIN B;  2NBF A;  4NKL A;  1YI2 A;  1CSQ A;  1DM0 B;  3ITP A;  2FXQ A;  5F2D A;  4DR7 L;  2D0P A;  5E4X A;  3S16 H;  1KRS A;  1JOR A;  4ZLT F;  4RGO S;  2JQO A;  2KCN A;  5C0X G;  1I50 B;  4FF3 A;  1RTO A;  2I5H A;  3WDN A;  3S1N B;  3H0G B;  4R1J A;  2P5Z X;  4X66 L;  1YIJ A;  3HOW H;  1MSH A;  4LNQ A;  3M4O H;  3B6Y A;  5EBD A;  1SYB A;  4IUP A;  4X65 L;  1IBK Q;  2O5J C;  2CQA A;  5J1Z A;  3OHX C;  2XIW A;  2KEC A;  3F2C A;  2WAQ E;  1S3O A;  2K4K A;  3W1G A;  4KKS A;  4NXM L;  1PTO D;  4DR3 Q;  4RFB A;  2F0N A;  3BYY B;  3STB C;  2DJF C;  1QVF A;  4JYA Q;  1EU3 A;  5M5X H;  1G6Z A;  3VR4 A;  1XMQ L;  2K5V A;  1GJX A;  1SDF A;  4BS9 A;  3GV6 A;  1RCV D;  4OXP A;  3N6R A;  4RGT A;  4AQY Q;  2E8G A;  4XT1 B;  1D2B A;  3I4L A;  1XNQ Q;  1RHP A;  2HIV A;  1FNU A;  1JWU D;  2HQL A;  4CDC C;  1AH9 A;  1A3T A;  2RDH A;  3I55 A;  1FR3 A;  1FD7 D;  4A3I H;  1CZW A;  1LTR D;  2QEJ C;  2PO4 A;  3SHL A;  3R2I A;  3S9W A;  2EJM A;  3CQZ H;  4BY7 G;  1Y8P B;  4JBJ A;  3IRB A;  3NQT A;  2JA6 B;  1D7Q A;  1XMO Q;  5C4X B;  1L1O B;  3MC0 B;  1HR0 W;  1D5Z C;  5IWA Q;  1B44 D;  3HEJ A;  1XYI A;  3NTK A;  3EJI A;  3KLS A;  3NE5 B;  2E2J B;  2D9U A;  1Q46 A;  3S2D H;  1ESF A;  3NTI A;  2QIL A;  4NDX A;  3CC2 A;  1C8C A;  1HZ9 A;  4G57 A;  1JWM D;  3PCO B;  1EEI D;  2MHV A;  3JAM i;  3MEF A;  1TWG B;  1JE4 A;  4K5V A;  5M3F B;  3TRZ A;  4LF5 L;  2WP8 J;  1VQO A;  4BWG B;  5C3X A;  1EEF D;  2F4V L;  3I2Z A;  4ALP A;  1JT8 A;  1N33 Q;  1SE3 A;  1M4V A;  3PUZ A;  1I50 H;  4K5W A;  3H15 A;  1XNR Q;  3T4A C;  3S1N H;  3MEH A;  3U4Z A;  1CZG A;  1STG A;  2F0O A;  1WCM G;  1A2T A;  3WOE A;  2Z6K A;  3M9B A;  3RN2 A;  4HMJ A;  2F3I A;  1Q8I A;  4UP7 A;  4DPG A;  3U4V A;  4A3B H;  4A75 A;  2YV5 A;  2VNU D;  2CVR A;  2L15 A;  2K01 A;  4IOA A;  2B2T A;  3GO5 A;  4ULL A;  2NYZ D;  4J1M A;  2EYP A;  2WKC A;  2NVQ B;  2Z0S A;  3QG1 A;  4FXG C;  4IUQ A;  2BDN A;  4L63 B;  4MTK A;  1LT4 D;  4MHE A;  1QOH A;  2PW5 A;  1TR5 A;  5C3E H;  3J81 j;  4HIO A;  1K83 B;  5CGK A;  4DR4 L;  1Z9F A;  3W1B A;  1J8I A;  2EOT A;  1SMY D;  4H02 A;  1QZG A;  5E7N A;  3SK5 A;  1KAA A;  4KMU C;  5ELE A;  2PPB C;  2NZ1 D;  1EQV A;  3EIV A;  1B70 B;  3OMC A;  1VQL A;  3P1H A;  1GHK A;  3OW2 A;  1KDB A;  4IFD H;  1ENA A;  2LS0 1;  2F0S A;  3R93 A;  2J4X A;  1C7Y A;  2K03 A;  1L1O A;  1UE5 A;  3KBG A;  4A93 G;  1S5F D;  1ESR A;  1VQ9 A;  2BA1 A;  1A62 A;  1LT5 D;  3UE0 A;  1LTS D;  2JA6 H;  1PRT C;  2F0D A;  4QL5 A;  5C4X H;  3CU7 A;  1K8O A;  3F2D A;  2CHB D;  2A68 D;  2L11 A;  1A0I A;  1Y14 B;  4LF8 L;  3F8T A;  2PI2 A;  1CTM A;  1LAB A;  3G6J B;  3GTL H;  4DV7 Q;  2HCC A;  3Q6S A;  3T1H Q;  1VDZ A;  3OYY A;  2K04 A;  1VCI A;  4KHP L;  1U4L A;  1GUW A;  4OEL B;  2G5D A;  1ET6 A;  3BDC A;  2R7Z B;  1EY9 A;  2DY7 A;  4V0B A;  5AFW A;  1N34 L;  4IFD J;  2CW0 C;  2VUM H;  3OIP A;  1ENC A;  4JI3 L;  1E3P A;  3M7N A;  2B8F A;  4NW2 A;  2EQS A;  4PMB A;  4DGZ A;  1Y1W B;  1KLU D;  1YZ6 A;  3R8B A;  5M3F H;  1ICW A;  5M5W H;  1X3P A;  4QIW B;  1LTL A;  2Q8T A;  3TQY A;  1HPC A;  4JK1 C;  1OXS C;  1JR0 D;  3A8J E;  1U4M A;  3OWE B;  2C5C A;  3G6E A;  1SFO B;  5T1I A;  4C3I G;  2CWP A;  1K9M C;  4LFB Q;  1GUS A;  2A19 A;  2XWB B;  5C4Z A;  1XWE A;  2KQ3 A;  3I4N B;  2VQF L;  5I4D A;  1KC8 C;  1JJ2 A;  1VQJ A;  5M9O A;  4KHV A;  3W2D A;  1TWA B;  3QB3 A;  3CD6 A;  1DOK A;  1MHW C;  5ELB A;  1K83 H;  2QA4 A;  1JB7 A;  3PQI A;  3VYS A;  1JOQ A;  3A5U A;  4H7B A;  2UXD L;  3HP3 A;  4FVM A;  1I4Q A;  1DD2 A;  3CME A;  3NP8 A;  3A8K E;  3PO3 B;  3IL8 A;  1SND A;  1VQK A;  1VQD A;  1RL2 A;  4DAY B;  2PZW A;  3FEW X;  4OEM B;  5C4H A;  4IFD I;  4XQJ A;  3NEL A;  5FJ8 G;  5M3M B;  4GKJ L;  3TEH B;  3CPF A;  1D5M C;  1SNM A;  1QNK A;  4QCL A;  3BZC A;  2RHS B;  1ENF A;  2BH2 A;  2DN8 A;  4RAU C;  1EFI D;  2QW7 A;  4JI2 L;  1SYE A;  5IYC H;  4FF2 A;  1EY5 A;  1IW7 D;  1VS0 A;  1UEA B;  3H3V C;  1F2Z A;  4TKO B;  4A3K B;  2IHE A;  3CC4 A;  4V19 0;  1HZA A;  4TVA B;  4A3D G;  1MSG A;  1W6K A;  1JQY D;  4R4C A;  1W6J A;  3GTM B;  1LTB D;  1SN8 A;  4LF4 L;  4AIM A;  3V96 A;  1STY A;  3DHQ A;  3OMG A;  4HCE A;  4BXX G;  3P20 A;  3DUZ A;  1ILQ A;  1XTD A;  2JK8 A;  5D14 A;  5D65 A;  2EDG A;  2F0M A;  1BCP C;  4NP5 A;  3D31 A;  4KY6 A;  4CKB A;  3J7Z C;  1FVI A;  1HTL D;  1LTA D;  4DV1 Q;  3C46 A;  4C3J G;  2R92 H;  4L5Q A;  1KDA A;  1PRT F;  2V4D A;  4JI8 L;  5FLX E;  3OPO A;  2EYJ A;  4C2M B;  1WTH A;  1SFO H;  4OO1 G;  2F3V A;  2RVL A;  5IGF A;  1GXD C;  4B3M L;  4A3M B;  3T51 B;  3I4N H;  1B9M A;  2E2D C;  1LO5 D;  3VR5 A;  1HZC A;  1U9R A;  4JI6 L;  1TWA H;  4FXD A;  4FF4 A;  2F0E A;  2MJ8 A;  3VYR A;  1EUJ A;  1UEB A;  2F0P A;  1TS4 A;  4DNI A;  1MGS A;  2NN6 G;  1TS2 A;  1E2Z A;  2PQA A;  3K80 C;  5IGB A;  1O7Y A;  2XGT A;  1I4H A;  3HRZ C;  5FLX c;  4RA8 A;  1ASY A;  2WAQ B;  2KHI A;  3STB D;  1V1O A;  3PO3 H;  1BVS A;  1STN A;  3SDZ A;  2PCF B;  1IXR A;  3LX0 A;  3QWN A;  4A3F G;  3M4Y A;  2PI2 E;  4F87 A;  2E2I B;  3QJY A;  3GTK B;  4DUY L;  3ND9 A;  5M3M H;  3EFX D;  5DLQ E;  1S5E D;  5IE8 A;  2L1B A;  1XTC D;  5H1S E;  1GUN A;  1T5E A;  3PO2 G;  3HOU G;  3F2U A;  4EQN A;  1D1K A;  1YJN A;  3CF5 A;  5JVG 3;  2JA5 H;  2ZT9 C;  3TZD A;  2GN5 A;  4CJ2 C;  4X64 Q;  1W3S A;  1OXU A;  2J7Z A;  1KXL A;  2XNA C;  2YTY A;  1QCB D;  3OOC A;  1VQP A;  2E74 C;  5IYD G;  4A3C G;  1PH4 A;  2PZT A;  1XPO A;  4BBS B;  3S1R H;  4O1N A;  3GTM H;  4KY5 A;  4XYO A;  3FKI G;  5JEA G;  2K14 A;  2IY5 B;  1VQI A;  3S15 B;  1CM9 A;  3MZ5 A;  5IYB H;  3C1E A;  4G7O C;  4UDU C;  1IBM L;  1CKM A;  1Q1E A;  5JOB A;  4CKC A;  4ZUJ A;  1Q82 C;  1V43 A;  5D3I B;  2KEE A;  3M85 A;  1LV9 A;  5ELD A;  3CXC A;  4K0K Q;  4C2M H;  3G7L A;  4MZ9 A;  3RNU A;  4LF7 L;  1Q12 A;  1HUM A;  1E1T A;  4ME3 A;  4DV2 L;  1ZEQ X;  3CRK C;  2R3Z A;  3A55 A;  4A3M H;  2E76 C;  1HFG A;  4OGQ C;  5COR A;  2Q2U A;  4R4Q A;  4DR6 L;  3NK9 A;  2BE5 D;  1XXG A;  1I6V C;  3CCS A;  2F03 A;  4OX9 L;  5AJ3 Q;  5GRO A;  2L5T A;  1K3R A;  1Z6H A;  1X3F A;  2BDO A;  3HOZ B;  3RZO B;  4IQZ A;  2E75 C;  2PW7 A;  5FLM H;  1BCP F;  3E3X A;  1J6Q A;  4YY3 Q;  3S17 B;  3K0Y A;  3S2H B;  3J81 L;  3GTQ H;  1NE3 A;  3RN5 A;  4DK0 A;  1PZK D;  2EJF C;  2F0J A;  3M4P A;  4JI0 L;  3TS2 A;  3GTK H;  1WYD A;  3CRL C;  3VYT A;  4LF6 Q;  1Z47 A;  2AKW B;  5IT9 L;  1DXM A;  1GUT A;  2HIX A;  3TP7 A;  3H3V H;  2EPB A;  1LM0 A;  3RLO A;  4BY1 B;  1KHI A;  2A69 D;  3DEP A;  4CKE A;  2OWO A;  4MNO A;  2ID0 A;  3TP6 A;  4KTA A;  4IO9 A;  2K5D A;  2GVA A;  5DAU A;  4XT3 B;  1VF7 A;  5JJI A;  4K6D A;  1BF4 A;  4BBS H;  1QB5 D;  4AYB E;  4EQP A;  4K8I A;  1C9O A;  4L5S A;  3UDI A;  1QG7 A;  3S16 B;  4JV5 L;  3CCM A;  3S15 H;  1LLR D;  2VW9 A;  1KRT A;  4UP9 A;  2SNS A;  5BR8 Q;  2DNC A;  2EYH A;  3FRP B;  1JIC A;  1V1P A;  1KL9 A;  2VXW A;  3T1Y Q;  1G91 A;  4XIG S;  2N3S A;  3M4O B;  4A3L G;  2HHH L;  2DJG C;  1WTP A;  5IOC A;  2NZH A;  4LFA L;  1B4O A;  5LMU Q;  1WOC A;  4KHZ A;  4IJH A;  4A3G G;  4P73 A;  4GNX C;  2HD3 A;  5JAV A;  1E22 A;  4BY7 B;  2KOL A;  3NHH A;  3MXU A;  2Z6K C;  4LUV A;  4TSS A;  5FO8 B;  4F7X A;  1HR0 L;  3AFQ A;  4P71 A;  1AEX A;  3DM1 A;  5IP9 G;  3NXW A;  1EU4 A;  2ENB A;  2MFI A;  4NXN Q;  3RZO H;  4QQB X;  1JJC B;  1YEZ A;  1EY7 A;  2R7F A;  4LUZ A;  3NTH A;  4IPG A;  3I7F A;  2K5W A;  1NJI C;  4QUC A;  3S17 H;  1HNW L;  4ZQ3 A;  3I70 A;  3S2H H;  3CQZ B;  1FJG L;  2K28 A;  1X3E A;  4I65 A;  2XRS D;  5E4W C;  5KYI A;  1F9P A;  3K57 A;  2JA7 G;  1K73 C;  2AHO B;  3ONA B;  2UUA Q;  4G4K A;  4JI4 L;  3I4M B;  1B9N A;  2R93 G;  3K81 C;  2EY6 A;  1G51 A;  3S2D B;  5C0X H;  1TS3 A;  3ERQ A;  4BBR G;  3C2P A;  1SR3 A;  1EOT A;  3AFP A;  5JJZ A;  3E9H A;  3H3V I;  5JVH 3;  2UUB L;  1TVX A;  3TME A;  1BR9 A;  2F0Q A;  2CFM A;  4DR2 L;  4OON A;  4P75 A;  5FKA C;  4WJ4 A;  3KOJ A;  2RSO A;  2JXM B;  2F0U A;  1LYL A;  2UXB L;  4R4O A;  2Y0S G;  4B3T L;  3SVM A;  4GN5 A;  4X66 Q;  3A54 A;  1WTW A;  3LGJ A;  4H44 C;  3MWY W;  2OEO A;  2LXJ A;  4X65 Q;  1H9S B;  1K0R A;  1H9R A;  4GNX B;  1PH1 A;  1PDQ A;  4A3B B;  2A6E C;  3T56 B;  2PQE A;  3TN2 A;  5EPL A;  4NXM Q;  4PZ7 A;  5C5L A;  2UU9 L;  2Z4I A;  1JC7 A;  4POF A;  3BG3 A;  4A93 B;  2JA9 A;  2SOB A;  2BA0 A;  3S1M H;  4BY7 H;  1G2T A;  3OWF A;  5COY A;  5C3E B;  2TMP A;  4A3J G;  4ZAI A;  1NUC A;  1SNQ A;  1BKB A;  1KLG D;  2E2H B;  5IY0 A;  1IZ6 A;  4DK6 C;  4HJ8 A;  4G7H C;  5GAG C;  3QO2 A;  4DR5 L;  1U4R A;  2WB1 G;  2NVT H;  4X3U A;  4ODG A;  1SJH D;  1IBK L;  5DNF A;  3P75 A;  3KF6 B;  2ZTD A;  4DR3 L;  1NAP A;  1QE6 A;  2ZJR A;  5GAE C;  3MFG A;  5CV4 A;  3EQL C;  4JYA L;  3G71 A;  1K8G A;  2HDM A;  1STA A;  1II3 A;  4RMF A;  3A7L A;  3R2T A;  4HN7 A;  3I4M H;  1KAW A;  4PZ6 A;  3HG9 A;  3I4O A;  3KK7 A;  3NUC A;  3GTL B;  2IX1 A;  1HNZ L;  4AQY L;  1RIP A;  1LUZ A;  1TWH H;  2C9O A;  1BUV T;  1YNJ C;  1XNQ L;  1I94 Q;  5C3W A;  1E24 A;  2AQ1 B;  2A8V A;  3OSO A;  3S24 A;  3IAY A;  1AE2 A;  1WCM H;  4B9W A;  5C0X I;  2VUM B;  4IUU A;  4DAM A;  3PSI A;  1SNC A;  2N78 A;  2B2V A;  3Q24 A;  1EQQ A;  4LF5 Q;  4QJF A;  1XMO L;  1IBL Q;  1S5C D;  3GP7 A;  1NNX A;  4C3H B;  1HH2 P;  2K1B A;  3I73 A;  2CCZ A;  5M5W B;  3HKZ E;  2B39 A;  3DMU A;  3C1F A;  5IGG A;  3NEM A;  2KHJ A;  5CV9 A;  1H9S A;  1FL0 A;  4B9X A;  1YBY A;  3J80 E;  4GNX A;  4A3I G;  4JBW A;  2RDG A; 
#chains in the Genus database with same CATH homology
 5GAD C;  1VQE A;  1AE3 A;  2JE6 I;  4IFD I;  3NEL A;  5FJ8 G;  4AH6 A;  1YHA A;  3K8A A;  4JI7 Q;  4GKJ L;  3TEH B;  2JA5 G;  2EIF A;  3CPF A;  2V1C C;  4NXN L;  2UUB Q;  2ZTC A;  1VQF A;  4DV6 Q;  3BZC A;  1G29 1;  2RHS B;  2KBN A;  1KQS A;  4GS3 A;  2LXK A;  2ASB A;  3HKS A;  2BH2 A;  3ULP A;  5GQO A;  4JI5 Q;  4A93 H;  3Q8D A;  4GLA C;  4K0K L;  1N33 L;  4PG3 A;  2PNH A;  4JI2 L;  3KDF A;  3F2B A;  3GDE A;  5IYC H;  4DKA C;  4Y7N H;  3SGI A;  2WFW A;  4DR4 Q;  4DR7 Q;  2C35 B;  2ES2 A;  1Y1V G;  1VS0 A;  2I5L X;  1NMF A;  2IX0 A;  3A0J A;  2E2H H;  2UUA L;  2IHE A;  1DGS A;  2ZTE A;  3J80 c;  3CC4 A;  5IYB G;  3L2P A;  1HZA A;  2UXB Q;  4YCV A;  4TVA B;  2ZM6 Q;  4JI0 Q;  3AYH B;  1XPR A;  4B3T Q;  3HOV G;  3HOZ G;  4A3D G;  4DV5 Q;  3KF6 A;  4R4C A;  1UE7 A;  2B63 G;  4A3J H;  1SN8 A;  4LF4 L;  5C0X J;  4YWL A;  4AIM A;  1X9N A;  2OCE A;  4BXX G;  4JI1 L;  1XTD A;  2JK8 A;  4A3E G;  2ZJP A;  1SMX A;  3D31 A;  3J7Z C;  3M3Y H;  2UU9 Q;  1VQM A;  4JBM A;  1BBU A;  1FVI A;  1VQ4 A;  3PF4 A;  4DV1 Q;  3H0G G;  2B3G A;  2BH8 A;  4HID A;  3G4S A;  3KJO A;  1QUQ A;  2R92 H;  1HZB A;  4L5Q A;  1YHB A;  4JI8 L;  3EBE A;  1VQG A;  1UWV A;  1MJC A;  2E2I H;  4YY3 L;  1VQH A;  1SFO H;  2QGQ A;  4BY1 G;  4OO1 G;  1XMQ Q;  3TRE A;  3CCU A;  3A5Z B;  4JBK A;  1N34 Q;  2RHQ B;  4B3M L;  5IP7 G;  1VQ5 A;  1L2F A;  4GOP C;  3I4N H;  4JV5 Q;  1JE5 A;  3KLW A;  1SRU A;  1Q7Y C;  1WJJ A;  1N9W A;  4UPA A;  1HJP A;  4DR5 Q;  1N36 Q;  1HNX L;  3GTO H;  2Q2I A;  1HZC A;  2CWA A;  4O0A A;  3CCV A;  3OTO L;  5JJK A;  2IHF A;  3ZJY C;  1TWA H;  1A8V A;  4QIW E;  2WB1 E;  3UDX A;  4JI6 L;  4R4T A;  2AMC B;  1GVP A;  2D0O A;  2D62 A;  5FLM G;  1EUJ A;  1UEB A;  1PHJ A;  1PH8 A;  4EX5 A;  5C44 G;  4C3H H;  4HIK A;  1PH6 A;  4DNI A;  1SLJ A;  2NN6 G;  4WJ3 M;  2PQA A;  1PH3 A;  3K80 C;  2NVY H;  1MJE A;  2XGT A;  5FLX c;  1YVC A;  4IFD G;  1ASY A;  4QY7 A;  1VQ6 A;  5ELN A;  2KHI A;  3STB D;  2AWN A;  3PUY A;  4PZ8 A;  1R9T H;  3PO3 H;  1BVS A;  3CCE A;  3HOW G;  4UY8 C;  1JMC A;  1IXR A;  3CC7 A;  4A3F G;  5JJL A;  2PI2 E;  1HNZ Q;  2K5H A;  1L0W A;  1UE6 A;  1VQN A;  1P16 A;  4LWC A;  4HJ5 A;  4IPH A;  3S14 H;  3RR5 A;  1IL2 A;  1PYS B;  3NBH B;  2VQF Q;  4P74 A;  2IT1 A;  4DUY L;  5BR8 L;  5M3M H;  4DR1 L;  5DLQ E;  1YIT A;  5IE8 A;  5LMN Q;  1PFS A;  4YWK A;  3T1Y L;  2N8N A;  5H1S E;  2R93 H;  3J7A 5;  3PO2 G;  3HOU G;  1I6H H;  3RLN A;  2H5X A;  4FDB A;  3E0E A;  4DUZ L;  1YJN A;  3CF5 A;  1SE8 A;  3D0F A;  3PGZ A;  1NY4 A;  2JA5 H;  3ER0 A;  1M90 C;  2GN5 A;  4X64 Q;  1W3S A;  1OXU A;  3A74 A;  1KXL A;  2F4V Q;  2YTY A;  4YCU A;  1HNW Q;  2UXD Q;  3TS0 A;  5IWA L;  2OTJ A;  4P72 A;  1VQP A;  1J5E L;  4POG A;  5IYD G;  4A3C G;  2I0Q A;  3CW2 C;  4OWX B;  3ULL A;  1X55 A;  1PH4 A;  1N32 Q;  1W2B A;  1XPO A;  3S1R H;  1FGU A;  2K75 A;  5M3F G;  1OTC A;  4JI4 Q;  3GTM H;  1Y1V H;  3FKI G;  5JEA G;  2PQA B;  1OXT A;  2K14 A;  4KI0 A;  2KCM A;  1I94 L;  1VQI A;  3AEV A;  2IY5 B;  1S72 A;  5IYB H;  1MIU A;  1MKH A;  1BBW A;  3KF8 B;  4NB3 A;  3HOV H;  3HOZ H;  4A3D H;  4B3R Q;  1IBM L;  4GKK Q;  1CKM A;  1Q1E A;  4YCW A;  4HJA A;  4JG2 A;  2B63 H;  4BA1 I;  3VDY A;  1WFQ A;  3HKZ G;  1ASZ A;  3I4M G;  2K52 A;  1IBL L;  2QEX A;  1V43 A;  3PUX A;  1Q82 C;  3M85 A;  1QVG A;  2NVX H;  4TQU S;  1X3G A;  3CXC A;  1PH5 A;  4BXX H;  4K0K Q;  1U5K A;  4GOP B;  1A63 A;  4JI2 Q;  4C2M H;  4YHH Q;  4MZ9 A;  4A3E H;  4DR2 Q;  3CPW A;  1Q81 C;  1QVC A;  3UE1 A;  4GLX A;  4JOI A;  3RNU A;  2OTL A;  1Q12 A;  4LF7 L;  1C0A A;  1XJV A;  4OWW B;  1E1T A;  4ME3 A;  4PMW A;  4DV2 L;  3H0G H;  1EFW A;  1XNR L;  3ICE A;  3J81 i;  4LFC Q;  4C3J H;  4A3M H;  2E5L Q;  1CKN A;  2Q2U A;  2RCN A;  4R4Q A;  3DM3 A;  1L1O C;  4DR6 L;  4BY1 H;  1X6O A;  3CCS A;  2ZJQ A;  1K8A C;  2UXC Q;  3FHW A;  4JI1 Q;  4OX9 L;  2Y0S E;  3KYH C;  5IP7 H;  5AJ3 Q;  4IJL A;  4DV4 Q;  5GRO A;  4A4I A;  4R4I A;  1K3R A;  4B3S Q;  3FP9 A;  1X3F A;  4IOC A;  1TWC H;  4JI5 L;  4JC0 A;  1YI2 A;  1CSQ A;  2FXQ A;  4DR7 L;  4X6A H;  5FLM H;  4DV3 L;  4LF8 Q;  1PVO A;  1J6Q A;  2D0P A;  4YY3 Q;  3S16 H;  2PMZ E;  1KRS A;  3CCL A;  3GTQ H;  4Y52 H;  1NE3 A;  4LF9 Q;  3RN5 A;  2JQO A;  5C0X G;  4KHP Q;  4JI0 L;  3PV0 A;  3M4P A;  4A3B G;  4GN4 B;  2I5H A;  3TS2 A;  3GTK H;  1WYD A;  1EIY B;  1NBW A;  4DV5 L;  4R1J A;  1Z47 A;  1HNX Q;  2AKW B;  4LF6 Q;  4X66 L;  3HOY G;  1YJW A;  1YIJ A;  3HOW H;  1B8A A;  1VQB A;  4JI3 Q;  5M5Y H;  4A3F H;  2HIX A;  4LNQ A;  3M4O H;  3B6Y A;  3H3V H;  4JI6 Q;  1LM0 A;  3RLO A;  3HOX H;  4C3I H;  1KHI A;  4X65 L;  1CSP A;  1IBK Q;  5C3E G;  3F2C A;  2R7Z G;  3UDG A;  2OWO A;  1EIF A;  1CKN B;  2ATW A;  2WAQ E;  4MNO A;  2K4K A;  1S3O A;  3W1G A;  2ID0 A;  4DV1 L;  4NXM L;  2CQO A;  4DR3 Q;  4IO9 A;  3STB C;  2GVA A;  2E2J H;  3PO2 H;  1QVF A;  2MO0 A;  4JYA Q;  2RF4 A;  5M5X H;  3K7U C;  5JJI A;  3I56 A;  4J15 A;  4BBS H;  1V1Q A;  4DV7 L;  1XMQ L;  2K5V A;  4AYB E;  1KD1 C;  1OXX K;  3T1H L;  4X62 L;  3ERS X;  1Y1W G;  2UUC Q;  2JA8 H;  1C9O A;  4L5S A;  3MXN B;  3UDI A;  2F52 A;  3CCR A;  3AQQ A;  4JV5 L;  3NEN A;  3CCM A;  3F1Z A;  3DLL A;  2VW9 A;  4OXP A;  3S15 H;  1G6P A;  1KRT A;  4UP9 A;  4AQY Q;  4DUY Q;  1N36 L;  4A3C H;  5BR8 Q;  5IYD H;  2HT1 A;  2E8G A;  1TWG H;  2JEA I;  1XNQ Q;  4L5T A;  2JA6 G;  4GOP A;  2HIV A;  2HQL A;  5C4X G;  1AH9 A;  1KL9 A;  3PIP A;  3T1Y Q;  3I55 A;  1QZH A;  4A3I H;  4XIG S;  4GLV B;  1YNX A;  2N3S A;  2YTX A;  1PV4 A;  4A3L G;  1PH7 A;  2HHH L;  3CQZ H;  1XPU A;  4BY7 G;  4JBJ A;  3IRB A;  1D7Q A;  2NZH A;  2A1A A;  1XMO Q;  4LFA L;  1L1O B;  2VQE Q;  1WOC A;  5FJ8 H;  5LMU Q;  1HR0 W;  1E1O A;  3I4N G;  5IWA Q;  5LMN W;  4KHZ A;  1J5E Q;  4IJH A;  1GD7 A;  2VUM G;  4A3G G;  4P73 A;  4GNX C;  1EYG A;  1NTG A;  1O7I A;  1E22 A;  4DV0 Q;  4JCV E;  1Q46 A;  3S2D H;  2Z6K C;  5K36 G;  1KIX A;  4LFB L;  3CC2 A;  4BA2 I;  4LUV A;  1HZ9 A;  1Q8K A;  1GM5 A;  3L0O A;  1HR0 L;  3PCO B;  1PA6 A;  4MTN A;  3AFQ A;  4P71 A;  5LMN L;  2NVQ H;  5J3B A;  1OXV A;  4OO1 I;  2R6G A;  1X65 A;  3PF5 A;  3JAM i;  4APV A;  5IP9 G;  4GKJ Q;  3MEF A;  2MFI A;  4NXN Q;  3RZO H;  4QQB X;  1JJC B;  1YEZ A;  1X56 A;  1S40 A;  2R7F A;  4LUZ A;  4IPG A;  3PIO A;  4A76 A;  3TRZ A;  4LF5 L;  4LW1 A;  2WP8 J;  4X64 L;  3I7F A;  1VQO A;  2VL6 A;  2N49 A;  2F4V L;  1NJI C;  1CKO A;  2B29 A;  3I2Z A;  4ALP A;  3S17 H;  1HNW L;  1JT8 A;  1N33 Q;  3L7Z C;  1T9H A;  4LF7 Q;  3S2H H;  1FJG L;  1X3E A;  3PUZ A;  4GN3 B;  1I50 H;  1XNR Q;  3H15 A;  2JA7 G;  1N32 L;  2K5N A;  1K73 C;  2AHO B;  3S1N H;  2NN6 I;  1PH9 A;  3U4Z A;  2UUA Q;  4JI4 L;  5GAH C;  3BZK A;  1WI5 A;  1WCM G;  1I5F A;  4HIM A;  4O2D A;  2R93 G;  4DR6 Q;  2Z6K A;  3M9B A;  3K81 C;  3RN2 A;  1YHQ A;  2F3I A;  1G51 A;  4UP7 A;  3PUW A;  4DPG A;  4BBR G;  3J80 i;  2VS1 A;  3U4V A;  1NMG A;  4A75 A;  2YV5 A;  1SR3 A;  3PUV A;  4LF4 Q;  4OX9 Q;  4A3B H;  2VNU D;  3AFP A;  2L15 A;  4GKK L;  4JI7 L;  4IOA A;  3E9H A;  3K7A H;  3H3V I;  3HOY H;  2UUB L;  3GO5 A;  3HFZ B;  4A3K G;  2KEN A;  1I3Q H;  5EAY A;  1VQ8 A;  2Z0S A;  4QGU A;  4DV6 L;  2Q2H A;  2XTI A;  1V9P A;  1EOV A;  4YHH L;  2CFM A;  3J81 c;  3CMA A;  4DR2 L;  4DV3 Q;  4OON A;  5C3E H;  4P75 A;  3J81 j;  4HIO A;  4WJ4 A;  3GTG H;  1PYB A;  1GO3 E;  3KOJ A;  2DGY A;  2R7Z H;  1Z9F A;  4DR4 L;  4JI8 Q;  3W1B A;  3KFU A;  4H02 A;  2EXD A;  1QZG A;  5E7N A;  4LFC L;  5C44 H;  3CP0 A;  1PH2 A;  3CCQ A;  2E5L L;  5IT9 c;  1LYL A;  1EQR A;  3EIV A;  2UXB L;  4R4O A;  1M1K C;  1VQ7 A;  1B70 B;  2ZM6 L;  4HJ9 A;  1D8L A;  2Y0S G;  2VY3 A;  4GN5 A;  5HY6 A;  4X66 Q;  1VQL A;  4B3T L;  3LGJ A;  3OW2 A;  4B3M Q;  4IPD A;  1Y1W H;  2UXC L;  3K0X A;  1C7Y A;  3JC6 6;  1L1O A;  1UE5 A;  3U58 A;  5AJ3 L;  2LXJ A;  4DV4 L;  1X54 A;  4X65 Q;  4A93 G;  3OTO Q;  1TXY A;  1K0R A;  4GNX B;  1PH1 A;  1VQ9 A;  2BA1 A;  4B3S L;  3S1Q H;  1A62 A;  5HGQ A;  5IYC G;  3UE0 A;  1N8R C;  3M4Q A;  2JA6 H;  4QL5 A;  4PZ7 A;  4NXM Q;  5C4X H;  1EWI A;  4A3M G;  2VZA A;  2UU9 L;  3F2D A;  4B3R L;  1UE1 A;  3GTP H;  1P8L A;  1VQC A;  2OQ0 A;  1A0I A;  1Y14 B;  4POF A;  4DK3 C;  3RLF A;  3KJP A;  4LF8 L;  3F8T A;  4OWT B;  1TWF H;  2JA9 A;  2PI2 A;  2KCT A;  4A3L H;  2BA0 A;  3GTL H;  1Q1B A;  4DV7 Q;  3S1M H;  4BY7 H;  3HOU H;  3T1H Q;  1IYJ B;  3OYY A;  4XTC S;  4X62 Q;  4LF9 L;  1VCI A;  4KHP L;  2MNA A;  3EN2 A;  4A3J G;  1JJG A;  3UDF A;  1BKB A;  3GD7 A;  1VQA A;  1U0L A;  1H95 A;  1N34 L;  3GTJ H;  4IFD J;  5IY0 A;  4LF6 L;  1IZ6 A;  2VUM H;  4DK6 C;  3KDF B;  4A3G H;  4HJ8 A;  4JI3 L;  1E3P A;  3M7N A;  2JJQ A;  2NZO A;  5GAG C;  2YU9 H;  4DR5 L;  2WB1 G;  2NVT H;  2YTV A;  4DR1 Q;  2EQS A;  2WAQ G;  2DUD A;  1IBK L;  1YZ6 A;  2R92 G;  5M3F H;  2MQH A;  3CCJ A;  2HHH Q;  3FKI H;  5M5W H;  3KF6 B;  2ZTD A;  4DR3 L;  1E7Z A;  3BU2 A;  4DUZ Q;  3RZD H;  4LFA Q;  1CUK A;  5GAE C;  2ZJR A;  4AYB G;  5IP9 H;  4JYA L;  1LTL A;  2ALY B;  3TQY A;  4UP8 A;  3G71 A;  1K8G A;  3ULJ A;  1OXS C;  4EQ5 A;  2I5M X;  2UUC L;  4RMF A;  2YYZ A;  1KAW A;  3I4M H;  3G6E A;  4PZ6 A;  4RG1 A;  2JEB I;  3HOX G;  3I4O A;  2CWP A;  1K9M C;  2IX1 A;  1HNZ L;  4LFB Q;  4AQY L;  4LUO A;  1RIP A;  2K50 A;  1LUZ A;  1QUQ B;  1TWH H;  2A19 A;  1VQK A;  3W5O A;  1YJ9 A;  4L5R C;  1XNQ L;  1HR0 Q;  4NPS A;  1I94 Q;  2JA7 H;  2VQF L;  1E24 A;  2A8V A;  1KC8 C;  1JJ2 A;  1VQJ A;  2MO1 A;  3S24 A;  1AE2 A;  1WCM H;  5C0X I;  3U50 C;  3CAM A;  4DAM A;  2CKZ B;  3PSI A;  5JEA J;  2OQK A;  2R7D A;  1IBM Q;  2N78 A;  4BBS G;  4BBR H;  1EQQ A;  4LF5 Q;  3CD6 A;  1Q86 C;  2JA8 G;  2GVB A;  4QJF A;  4IPC A;  1XMO L;  1IBL Q;  3PO3 G;  5LMU L;  2VQE L;  2QA4 A;  1K83 H;  1HH2 P;  4JOI C;  1JB7 A;  1SRO A;  3G48 A;  4A3K H;  2CCZ A;  1FJG Q;  1B7Y B;  4KLK A;  3A5U A;  3HKZ E;  2UXD L;  3NEM A;  4DV0 L;  3E9I A;  2KHJ A;  2Q2T A;  3CME A;  4HJ7 A;  4DV2 Q;  5M3M G;  3BJU A;  1FL0 A;  2LSS A;  1YBY A;  1VQD A;  5ELO A;  2AWO A;  4GNX A;  4A3I G;  4JBW A;  4YWM A;  3JAM c;  1GKH A;  1RL2 A;  5C4J H;  3WWV A;  4DAY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...