1SFOH

Rna polymerase ii strand separated elongation complex
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna-rna hybrid
molecule keywords RNA STRAND
publication title Structural Basis of Transcription: Separation of RNA from DNA by RNA Polymerase II
pubmed doi rcsb
total genus 15
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2004-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1sfoH00
2JJQA 4A3LH 3L0OA 2RCNA 5GQOA 1JJCB 3FP9A 1CSPA 2PNHA 3PV0A 4DV0Q 3FKIG 4HJAA 4B3TQ 2B63G 2MO1A 3G48A 4QIWE 3GTLH 1XPOA 2WAQG 1B8AA 2D0PA 5LMNL 3NBHB 3GTKH 1B70B 3CP0A 1L0WA 4R1JA 3H3VI 3WWVA 3UDGA 1OXVA 4DNIA 4X65Q 1X6OA 5IP9H 3KDFA 2RF4A 2YV5A 5IYBH 3RN5A 4PZ7A 1HNXQ 1HNWL 1PH2A 5LMNQ 3K7UC 3CCJA 2YTXA 4OWXB 1PH7A 1MJEA 3CPFA 4YY3L 5C44G 5C3EG 2K75A 3TEHB 2WFWA 3ULPA 3S14H 4ME3A 3H15A 1SFOH 4GNXA 2NZOA 2Y0SG 3PUVA 4A76A 2ZTEA 5IYCH 2NVYH 1E1OA 3JAMi 2MNAA 4YY3Q 1JT8A 1A63A 2JA5G 3S17H 1GKHA 2QGQA 2ZTDA 1BKBA 1J6QA 4YCVA 5GAHC 4GLAC 4JG2A 4LF8L 3TS2A 4LF6Q 2QEXA 5FLMH 1N36L 2I0QA 2E2IH 3CQZH 2WB1G 1Q82C 4P72A 2NVQH 3CC4A 1K73C 1PYBA 3HOYG 4JI7L 1N33L 5IP9G 1J5EL 1NTGA 3A5UA 4LWCA 1M90C 4NXNL 4JI2L 3S15H 4APVA 4DK3C 4DUYL 4LF8Q 3GO5A 1A62A 1EOVA 5FJ8H 4JBJA 3G71A 1Q1BA 1SR3A 2K50A 1VQNA 1UE6A 4IOCA 1JJ2A 4BY1H 3CXCA 1PH9A 3GTQH 2PQAB 1WOCA 1N33Q 1J5EQ 3U4ZA 2JEAI 1OTCA 4L5RC 4DUYQ 4GLVB 1YIJA 1Q81C 4P74A 2E2JH 1QVCA 3M85A 1CKNB 1Y1WG 4DR7L 3D31A 1O7IA 3KYHC 5C0XG 3K0XA 1JE5A 1HZBA 2DGYA 2AMCB 4C3JH 2AHOB 3CAMA 1Q7YC 5FLMG 3ZJYC 3HOUH 3HOVH 4BY7G 4PZ8A 2KCMA 2K52A 3CCLA 1YJ9A 3KJOA 4R4CA 4UP9A 1FL0A 2NVXH 3U4VA 1KRSA 4LF4L 4DR4Q 4DR7Q 1U5KA 4DR3L 1IBML 3STBC 5LMUL 3H0GG 4K0KL 2Z6KA 3HKSA 4DV2L 2JK8A 2UUCL 4MTNA 1VQ7A 3RLNA 3SGIA 1MKHA 4LF4Q 3D0FA 4X66L 1PH6A 5JJLA 5ELOA 4DR3Q 4XIGS 4R4QA 3I7FA 3HOXH 3HOZG 5LMUQ 2VQFL 1P8LA 2PI2E 3CCVA 3J81i 4DR1L 4GOPA 1EIYB 4WJ4A 4R4OA 3RLOA 4LUVA 4DV5L 2OWOA 1VQIA 5C0XI 5IP7G 5H1SE 1TWCH 4JBKA 4A3IH 4UPAA 4X66Q 2EIFA 4C3HH 4HJ5A 4BXXH 1GO3E 5M5YH 2R93G 2VQFQ 4QL5A 3JAMc 3CCUA 3S1NH 4LFBQ 1T9HA 3CD6A 3EBEA 3BU2A 4KI0A 3GTMH 5DLQE 3BJUA 4GKKL 1QZGA 3OTOL 1NBWA 4OX9L 4BA1I 1IL2A 2K5VA 1VQPA 4IPHA 1VQMA 1VCIA 1PYSB 4IJLA 1HJPA 4GS3A 4PG3A 1FGUA 1VQJA 4KHZA 5C0XJ 2AKWB 3KF6A 1G291 4LW1A 3CCQA 3PF5A 4JOIC 3CCMA 2YTVA 4JI1Q 2HQLA 4AQYL 5EAYA 1PH1A 1IYJB 1NMFA 3W5OA 4HIMA 1NY4A 4GKKQ 3OTOQ 3CMAA 1E22A 4L5SA 3AEVA 3ER0A 3PO2G 4RMFA 2YYZA 1Y14B 3HOWH 2D0OA 2JA6G 3F2CA 1MJCA 1AE3A 1VQHA 4AQYQ 5BR8Q 1GVPA 1YHBA 1G51A 4X6AH 3G6EA 1TWAH 3KOJA 2VUMH 3U50C 2XGTA 4FDBA 4X65L 3G4SA 4P71A 1E7ZA 4YWLA 1XJVA 1HNXL 2PMZE 1Z47A 2JA9A 3K8AA 1LUZA 3I4MH 4OO1I 1WCMH 4J15A 3I55A 3PO3G 1Y1VH 1K9MC 4NB3A 1C0AA 2ZJPA 2ASBA 4AIMA 1RIPA 3E0EA 3AFPA 3M9BA 4YCUA 1TWHH 1N32L 4JCVE 3MEFA 4A3BH 3S1QH 1FVIA 3M4OH 3DM3A 3NENA 4JI3L 3DLLA 3T1HQ 4QQBX 4A93G 3I2ZA 2NZHA 1QUQB 3OYYA 2JEBI 4LF5L 4BBSH 1CSQA 1TWFH 3HOWG 1H95A 3K80C 3TS0A 3KFUA 3CW2C 1EUJA 2Y0SE 3MXNB 2L15A 4LF6L 4UY8C 2GVAA 3K7AH 5C4XH 4IJHA 3PIPA 1HNZQ 4A3LG 1L1OC 4DAMA 4LNQA 4HIDA 4JV5Q 4JI3Q 3J81c 1UE7A 2XTIA 1SMXA 1I5FA 4DV6L 4LF5Q 1NE3A 3UDXA 1S3OA 1E24A 1KXLA 2A8VA 2F3IA 1SN8A 1WCMG 3HKZE 2ID0A 1KL9A 5M5XH 3AFQA 1KD1C 3I56A 1YVCA 5AJ3L 4L5TA 2C35B 4IPCA 1XPUA 2KCTA 1VQ9A 5IYBG 3PIOA 4DV6Q 1SE8A 2CCZA 2Q2UA 2UXCQ 1DGSA 4L5QA 3GTJH 2N8NA 2ZJRA 2YU9H 1Q8KA 2JE6I 4P73A 1XNRQ 2PQAA 4JI0Q 4A4IA 1EIFA 3CC7A 2KHJA 5IY0A 2I5MX 3J80c 5AJ3Q 4DUZQ 1YJNA 4YWKA 1HZ9A 2JA8H 3KJPA 2IHFA 3I4NH 1CKNA 4YWMA 4A3FH 4PMWA 2PI2A 3W1GA 5IYCG 1KQSA 3J7ZC 2BA0A 1K8GA 4BBRH 3GD7A 3L7ZC 3BZKA 1Q46A 5ELNA 2EXDA 1UE1A 4LFAL 4DR4L 4A3JH 1IBKL 4JBWA 4XTCS 1VQAA 2A19A 3ULJA 5FLXc 3PGZA 1PH8A 3VDYA 2R7ZH 2E8GA 2Q2HA 4P75A 4A3MH 1XNQQ 1GM5A 1YZ6A 1TWGH 2MFIA 4PZ6A 3T1YL 1PFSA 4LUOA 4LFAQ 1IBKQ 4A3CH 1QVFA 2K14A 4C2MH 1BBWA 3RN2A 1TXYA 1E1TA 5FJ8G 3A0JA 1VQOA 1ASZA 2IX1A 3M3YH 4X64Q 2IT1A 3RZDH 3A5ZB 4BY1G 4JI4L 1EQRA 3PUWA 1VQBA 1S72A 1V1QA 3T1YQ 1VQ6A 2F4VL 2VL6A 2JA8G 3I4NG 3E9HA 4A3FG 2OTLA 2VNUD 1XPRA 4JI8Q 3GTPH 1AH9A 1YHAA 4KLKA 4A3KH 1YI2A 1LTLA 2AWOA 4BBRG 1L2FA 4LFBL 3STBD 4MZ9A 2VS1A 4LUZA 5M3FH 3AYHB 4GN3B 4B3SL 4JI4Q 2F4VQ 1G6PA 5GAEC 3L2PA 1KIXA 2D62A 1I94L 3HOUG 3W1BA 3HOVG 2R7ZG 1SRUA 2NN6G 2ZM6Q 1YEZA 2HIXA 1KC8C 3H3VH 4A3EH 1M1KC 2QA4A 1L1OB 4JI1L 3M4PA 4UP7A 4B3RL 4DK6C 5IWAL 4B3SQ 2ATWA 4A3CG 5K36G 1QVGA 2VW9A 3RZOH 3F2DA 1I94Q 4GNXC 2ZTCA 3JC66 1PA6A 4AYBE 2BH2A 1P16A 5IT9c 1EFWA 2IX0A 3J80i 2BA1A 4LF9L 2JA7H 4B3RQ 5BR8L 4DR5Q 3K81C 5IWAQ 2LXJA 2N78A 3HOXG 3CF5A 3S24A 2R6GA 2B63H 3FKIH 3NEMA 1Q86C 2N49A 3KF8B 4C3IH 1VQEA 2V1CC 4GLXA 2OTJA 5M3FG 1LYLA 4LF9Q 4A3IG 2CWPA 1B7YB 1OXUA 4DV1L 1Q12A 4H02A 3EIVA 4DV3L 1PH3A 5GADC 4DV4Q 4BXXG 2IY5B 2LXKA 2WAQE 4WJ3M 1PVOA 2F52A 4HJ7A 5JJIA 1FJGL 1N34Q 1NMGA 2WP8J 3KF6B 3T1HL 4DV1Q 2MO0A 3PCOB 4DV3Q 2UU9L 4DR6L 5C3EH 1EQQA 2JA7G 2UXBL 1FJGQ 2N3SA 1YBYA 2KBNA 3M7NA 3PO3H 1QUQA 1PV4A 1HNZL 1IBLL 1X54A 3RLFA 3S2HH 4A93H 5M5WH 4JV5L 1D7QA 1YJWA 4HJ9A 4B3MQ 4EX5A 1HR0W 5M3MH 2UU9Q 4IPGA 2JA5H 4DR6Q 1XMOL 4Y52H 3S16H 3OW2A 2UXBQ 4TQUS 1VQKA 4DPGA 1CKOA 4GKJL 1IBLQ 3ICEA 1JMCA 1WFQA 2VUMG 2Z6KC 2B29A 1JJGA 2OCEA 3HOYH 1VQ5A 2CQOA 4R4IA 1N8RC 2R92H 1CKMA 2FXQA 3I4OA 2OQKA 2WB1E 1XMOQ 1BVSA 1X9NA 1QZHA 1XNRL 2OQ0A 3I4MG 4JI0L 4GN4B 2UXCL 3B6YA 3KDFB 3GDEA 3UDIA 2UUAL 4GKJQ 1Y1VG 3ERSX 1U0LA 1S40A 1C7YA 4KHPL 4DUZL 3F8TA 3KLWA 4R4TA 3UDFA 1X3GA 3CMEA 4GOPC 1PHJA 4IPDA 3RR5A 3S2DH 2K5HA 4YHHL 4EQ5A 2JQOA 2HIVA 1KHIA 2KHIA 4HJ8A 1SROA 1OXTA 4ALPA 2HHHL 3GTOH 1HZAA 4A3BG 4IOAA 2E5LL 1HNWQ 2UUAQ 2GVBA 2IHEA 4LF7L 2K5NA 1HZCA 4JOIA 4GNXB 1YITA 1V9PA 2AWNA 1Y1WH 5M3MG 4BBSG 4KHPQ 4IO9A 4A3GH 1I3QH 1X3FA 1K8AC 2UXDL 3PSIA 3F1ZA 3S1MH 1A0IA 4YHHQ 5C4XG 1X3EA 1LM0A 1XTDA 1XNQL 2NVTH 1KAWA 4QGUA 3UE1A 2HHHQ 4BY7H 2I5LX 5JEAG 3CCRA 3PUXA 2E5LQ 3HKZG 3CCSA 1VQCA 4LF7Q 1N32Q 4JC0A 4A3DH 2R92G 3CPWA 4HIOA 1WI5A 2UXDQ 4UP8A 1UEBA 3M4QA 2VQEL 1OXXK 4X64L 1VQ4A 4JBMA 2H5XA 3H0GH 1YHQA 1N36Q 1UE5A 1VQFA 1IZ6A 2ES2A 4DKAC 4JI5L 5LMNW 4OXPA 3U58A 1VQDA 3RNUA 4JI7Q 3PF4A 4MNOA 4QJFA 4O2DA 4X62L 2VZAA 3TRZA 4JI8L 4NXNQ 2LSSA 1ASYA 1W3SA 2CWAA 4NPSA 2K4KA 4JI2Q 4QY7A 2VQEQ 1EYGA 3HOZH 4DR2L 5C4JH 1HH2P 2YTYA 4JI5Q 3E9IA 1D8LA 5IP7H 4A3GG 1I6HH 3HFZB 4O0AA 3LGJA 5J3BA 2MQHA 4IFDG 5JJKA 1E3PA 1V43A 2Q2IA 4X62Q 2ZM6L 4Y7NH 2B3GA 1IXRA 2R93H 2BH8A 1RL2A 1K83H 3AQQA 4DR2Q 1WYDA 1PH5A 3GTGH 4A3JG 4A3DG 5HY6A 1W2BA 1L1OA 4TVAB 4OWWB 1NJIC 3UE0A 4A3MG 3A74A 2ZJQA 2DUDA 1A8VA 3S1RH 2KENA 2VY3A 3TREA 4POFA 4DR5L 5E7NA 5JEAJ 2CKZB 4GN5A 1HR0L 5IYDH 2UUBL 4BA2I 5GROA 1IBMQ 4OONA 3J7A5 1VQ8A 1X56A 5IE8A 3PO2H 3PUYA 4K0KQ 4DV2Q 4LFCL 4NXML 3FHWA 2UUCQ 2R7FA 2Z0SA 1XMQL 1JB7A 3CC2A 2JA6H 4IFDI 4DV7L 1MIUA 2EQSA 4OWTB 1Q1EA 4GOPB 1HR0Q 4DV4L 2GN5A 2UUBQ 2RHQB 2ALYB 1R9TH 4A3KG 4POGA 4AH6A 1WJJA 3NELA 4DR1Q 2RHSB 4YCWA 1N34L 5GAGC 1BBUA 2CFMA 4HIKA 4LFCQ 4NXMQ 4DV5Q 1XMQQ 1KRTA 1UWVA 4DAYB 1K0RA 1N9WA 1AE2A 4DV7Q 5HGQA 1OXSC 2NN6I 1VQGA 2Q2TA 3PUZA 4OO1G 3J81j 1I50H 2R7DA 1GD7A 4A3EG 1EWIA 4IFDJ 1PH4A 4JYAL 4AYBG 1SLJA 4JI6L 1YNXA 3Q8DA 2HT1A 3ULLA 1VQLA 2I5HA 5IYDG 3CCEA 4RG1A 1X55A 4DV0L 4A75A 4B3ML 1CUKA 1C9OA 3BZCA 4OX9Q 3IRBA 3F2BA 1Z9FA 4B3TL 3EN2A 5C44H 3TQYA 2A1AA 4JYAQ 2E2HH 4JI6Q 1X65A 1K3RA 1VS0A
chains in the Genus database with same CATH superfamily
2ZXPA 3FP9A 2B63G 4HJAA 2BDNA 4ABNA 2QCPX 5DNFA 1UNSA 2IWHA 1B8AA 5AFWA 2F0MA 2PYKA 5LMNL 1Y8OB 3K7AB 3CP0A 2WV6D 4R1JA 4DN4M 3UDGA 3NQIA 4I65A 4IUVA 4RFBA 5I2XA 4X65Q 1X6OA 1GUNA 4N8FA 5A2QE 3RN5A 2K7VA 3CCJA 2L12A 1MJEA 3CPFA 3M7GA 3NXWA 1RF2D 1STYA 5ELEA 3S14H 2WKCA 4ME3A 1SFOH 3GTJB 1X32A 5FO9B 3PUVA 1IYUA 3K0YA 5EBDA 1GJXA 5LL6X 2CQAA 3JAMi 2MNAA 4YY3Q 1A63A 4IUUA 1NUCA 2QGQA 1J6QA 4CJ2C 2JA8B 3I4NB 1ESFA 2QEXA 2NVQH 4JI7L 2Z9HA 4C56C 3ND9A 4APVA 4DUYL 3GO5A 4TSSA 2R7ZB 2LMCB 1QCBD 1CZWA 2K50A 2OT2A 3VA5A 3VYRA 4RKLA 1TY0A 2HCIA 5ELDA 2B2UC 1IKLA 2EPBA 1C8CA 4GLVB 4H44C 1Q81C 3RZDB 3BDOA 1MSHA 2PW7A 2A5HA 2F0UA 4DXGA 3K0XA 1JE5A 2DGYA 2AHOB 1UAPA 3ZJYC 5FLMG 1S4ZA 3HOVH 2KCMA 4KV6A 4Q0FA 1EY5A 1EQVA 2HDLA 2KVMA 4DR4Q 3U4VA 4DR3L 1D5XC 2CVRA 3H0GG 2RDHA 4K0KL 4A3EB 2JK8A 2C9OA 3MFYA 3GTMB 2RSOA 2HD3A 3MXUA 4LF4Q 3I90A 5CV9A 1NR4A 2IJ0A 4I7ZC 3NWSA 4L6TB 2I07B 3D3RA 5LMUQ 4XT1B 4DR1L 3CCVA 4WJ4A 2K33A 3L9AX 4BS9A 4DV5L 3MXPA 5H1SE 4UPAA 1LV9A 1H9MA 4X66Q 1KNEA 4ULLA 2VQFQ 1L0XB 3JAMc 3CCUA 4C3IB 1Q90A 3EBEA 3BU2A 1ENAA 2WAQB 3BJUA 1O7YA 4OX9L 2PMZB 1VQPA 3S1QH 2VUMB 1FGUA 3MTSA 3K5NA 3P75A 3PF5A 4FF2A 3CCMA 5ELFA 5IGEA 5EAYA 4HIMA 2N88A 4GKKQ 3OTOQ 4L5SA 1PRTD 3ER0A 2FHTA 4KTAA 1SE4A 3HOWH 4HCSA 2B2UA 3ZYYX 4XYOA 1MJCA 1VQHA 1GVPA 4G7HC 3Q23A 1G51A 5JVG3 4A3BB 2Y0SB 5IGBA 1TWAH 1LLRD 2E74C 1TS3A 4YWLA 1XJVA 1SMYD 1Z47A 2JA9A 3S16B 3FVQA 1BOSA 3K8AA 5IGFA 3QJYA 3I4MH 5C4XB 1WCMH 2K6AA 1Y1VH 1SSOA 1TS2A 5CV5A 1RIPA 1KLGD 1HPCA 4JCVE 1QOHA 1FVIA 1TVXA 3T1HQ 3NENA 1FNUA 3DLLA 3I2ZA 3J7AF 1CFMA 1TWFH 2F0NA 2Q8IB 2YU9B 4UY8C 3K7AH 3GTOB 4A3LG 4DAMA 2E75C 4Q5VA 4JV5Q 2EVBA 5I4DA 2XTIA 4RH6A 1DZ1A 3UDXA 1KAAA 1DXMA 2F0TA 1KL9A 2K04A 2M9VA 1YVCA 4RWSC 4L5TA 4XQJA 2KCTA 1VQ9A 4DV6Q 1D1IA 3GTJH 1PRTF 3FEWX 1F2YA 1LT5D 1EIFA 2KHJA 1LTRD 2F0QA 2I5MX 3J80c 5AJ3Q 4N9TA 4H13C 4DUZQ 4YWKA 1HZ9A 1K8MA 2JA8H 2IHFA 3I4NH 2K32A 1EYDA 5EJWA 1CQFA 5C5MA 1K8GA 1JWUD 3GD7A 3BZKA 4U68A 5M9OA 1J8IA 4JBWA 4RCOA 3TP5A 1VQAA 3KBXA 4PMCA 2R7ZH 2EYPA 4P75A 1XNQQ 3T51B 4KKSA 2DY8A 4UDUC 2MFIA 3T1YL 5I6WA 1PFSA 3A55A 1QG7A 4V190 1IBKQ 2PZUA 4IUTA 1CZGA 2RBMA 3RZDH 1STNA 4BY1G 4JI4L 1S72A 5CV6A 1V1QA 3C2PA 4JPBW 2F4VL 1D6EC 4JI8Q 1AH9A 2PPBC 1WD1A 4A3KH 1YI2A 2VS1A 1STEA 1M8AA 2NTTA 3AYHB 2JYOA 3RUZA 2Z4HA 1I94L 4C3JG 3HOUG 1SYCA 4CBVA 1YEZA 4LJZC 4A3EH 2QA4A 2AQ3B 4DFAA 5KGUA 1XWEA 4PNYA 2ATWA 4A3CG 1QVGA 3OIQA 4AYBE 1P16A 3DXJC 1EFWA 1JICA 2IX0A 4H0LC 1O7LA 3GQBA 5IWAQ 3DHQA 2N78A 3DWQA 3S24A 3FKIH 1U4RA 2G9HD 3J80L 4C3IH 1Y69U 1A3TA 1STGA 2E2HB 4LF9Q 2CWPA 2AQ2B 1Q12A 2F3VA 3EVQA 5T1GA 3EIVA 4DV3L 1PH3A 3GV3A 1R4PB 2F0LA 2WAQE 4DGZA 1MI2A 4WJ3M 1GUSA 4HJ7A 3GTLB 2JA5B 2EYHA 2A68D 1CK1A 3D4RA 3KF6B 4KKUA 2RDFA 1ET6A 2RDGA 2KQ3A 3M7NA 1YBYA 4PQXA 3RLFA 2HUGA 1NNXA 2G9DA 2XN9C 4B3MQ 3K5LA 2UU9Q 4DR6Q 4XXEA 5C3XA 3S16H 3MC0B 4NP5A 4NKLA 3V05A 1VQKA 4KHVA 3X3NA 3ICEA 2B2WA 1WFQA 5JEAH 1AEXA 3J81E 2KOLA 5JVH3 1LTBD 1TR5A 2KCCA 2OCEA 1N8RC 2FXQA 1MBYA 2OQKA 1XMOQ 1BVSA 1X9NA 1QZHA 4CKEA 4K5XA 4JI0L 4BY7B 3UDIA 2E2IB 4KHPL 2I46A 1W6JA 5CR3A 3EROA 3KLWA 4R4TA 1F2MA 1VDZA 1X3GA 3EA6A 2PZWA 3CMEA 3RR5A 1MGSA 5C4ZA 3R2IA 4HJ8A 2UXCQ 3GTOH 4IOAA 2E5LL 2UUAQ 4GNXB 4JOIA 1N32L 3Q24A 3GTQB 5M3MG 4IO9A 2DNEA 2M00A 3PSIA 1HQMC 5C0XH 4FF1A 1LM0A 1KAWA 4QGUA 3UE1A 4G7OC 1GUTA 4X3UA 5C4JB 3H09A 1VQCA 4JC0A 2R92G 5T1IA 1RTOA 1PMRA 5HGTA 2WINB 2UXDQ 5FLXE 4L63B 1QILA 3EJIA 2VB2X 2R93B 1YHQA 1JCKB 1K83B 2ES2A 4DKAC 1U9RA 3RNUA 4JI7Q 3PF4A 4MNOA 2AUJD 4QJFA 1WTXA 3TRZA 4G7ZC 3VYUA 1B1ZA 2CWAA 1C48A 3X3MA 3S1RB 4MHEA 2YTYA 3LWUA 3VR5A 5IP7H 4A3GG 4IFDG 4IUPA 4M8AA 2ZM6L 3HOXB 1E2WA 2B3GA 1RL2A 3H6MA 3FMCA 4A3JG 4A3IB 4O1NA 4OWWB 4C3HB 2F1MA 1A8VA 4B9XA 4DR5L 4POFA 2XWBB 4GN5A 1EU4A 1BF4A 1DOMA 4BA2I 3BZDB 1EY4A 3PUYA 3VR3A 4K0KQ 4LFCL 2L1BA 2R7FA 3Q0AA 1XMQL 5C6AA 4IFDI 4GOPB 1ET9A 3DWAA 2UUBQ 2ALYB 4POGA 2HDMA 4K8JA 4DR1Q 4NXMQ 1W6KA 4NMZA 4DV5Q 2K1BA 5HGQA 1OXSC 2NN6I 1VQGA 4OO1G 2K5QA 1GD7A 4IFDJ 1EWIA 4KD4A 2L55A 4RGNA 5FOBB 2HT1A 4OIJA 2I5HA 3W2DA 4XQNA 4FYDA 2G5DA 1IL8A 4OX9Q 3IRBA 1R4QB 4B3TL 1GXDC 1EY0A 1F9PA 4JYAQ 2E2HH 4JI6Q 1TU2B 4OELB 5GQOA 2F0WA 2PNHA 1S5DD 4QIWE 3TN2A 2DY7A 3GTLH 1XPOA 1U4LA 4HSVA 3D8GA 1B70B 3DUZA 3TP6A 3H3VI 3WWVA 1OXVA 3DMUA 5DM73 4DAPA 3K6OA 2YV5A 4PZ7A 2OEOA 3OHXC 3U9SA 3D6WA 1ML0D 2L0CA 5C3EG 2K75A 5D65A 2WFWA 1LT4D 5IODA 4GNXA 4PV1C 3NTIA 1NR2A 4A76A 5IYCH 4HR7B 3ERQA 3WOFA 1PZJD 2JXMB 2D2CC 5IGCA 3S17H 2ICEC 3OMCA 4YCVA 4LF8L 4JG2A 3QG1A 1L0YB 2E2IH 2KJXA 2WB1G 1Q82C 3HOYG 1N33L 4QMGA 3A5UA 1JB3A 4ZUJA 1IYVA 1EOVA 5FJ8H 4JBJA 1PRTB 1LACA 2EYOA 1Q1BA 1VQNA 1UE6A 1JJ2A 3CXCA 3GTQH 2KHSA 1J5EQ 3U4ZA 4ZCKA 2JEAI 2RA4A 5CMDA 4L5RC 1YIJA 1G8ZD 3M85A 1Y1WG 3PQIA 1BNZA 1ICFB 2SOBA 2X6GA 4DA2A 4DR7L 4K5WA 1HFNA 3CAMA 1QNUA 1Q7YC 4PZ8A 3CCLA 3KJOA 2NVXH 1FL0A 1BXTA 1U5KA 1LABA 5ISRA 4DV2L 3OMGA 4P2CB 2UUCL 4CDEC 2Z8LA 4MTNA 3RLNA 3DWPA 4UHVA 2F0EA 5JJLA 1QJOA 3I7FA 4R4QA 3HOXH 1RKNA 1BDOA 2PI2E 3SVMA 4GOPA 1EIYB 3VA7A 4FVMA 2GA4B 4A3IH 4C3HH 4HJ5A 1FNWA 1T9HA 4KI0A 5DLQE 4IJLA 1HJPA 4GS3A 3BYTB 4PG3A 5EPJA 1H9KA 1YNJC 2AKWB 1G291 4LW1A 2H1EA 1SNDA 1LT3D 4AQYL 1PH1A 2X6LA 1IYJB 2IX3A 1SNOA 1E22A 1I4RA 3AEVA 3PO2G 1V1PB 1HQRD 2JA6G 4A93B 5M5WB 4CKBA 1XTCD 1B53A 1EIHA 1PZID 3MA2B 2EY5A 3U50C 2F0OA 2XGTA 1TWFB 1T5XD 1E7ZA 3E3XA 1LUZA 1K3BC 4F8MA 3NSWA 4KY6A 3I55A 4RGTA 1K9MC 3BS1A 1PLFA 4NB3A 1C0AA 2RSNA 5KNBA 1ENFA 4AIMA 4YCUA 3AFPA 3NTHA 2NTSA 3DM3A 4JI3L 2NZHA 4FXKC 2JEBI 1Z7TA 4BBSH 1CSQA 1H95A 3HOWG 3TS0A 1SJHD 1BO0A 3MXNB 2L15A 2RVLA 4LF6L 1PTOF 5HURA 2GVAA 2L5TA 4IJHA 2TMPA 4ZQ3A 4LNQA 2A74C 3QO2A 1SMXA 1I5FA 2EYJA 4LF5Q 3QB3A 1E24A 1Z6HA 2A8VA 1KXLA 2F3IA 1SN8A 1WCMG 3HKZE 2L4NA 3AFQA 3TP8A 3I56A 2QW7A 1JWMD 4A3DB 5IYBG 2Q2UA 1SE8A 4K14A 2NBFA 3U9OA 2N8NA 4P73A 3FDTA 4JI0Q 4A4IA 1YJNA 5JPNC 2F03A 1S5ED 1GUOA 4YWMA 1M4VA 5L37A 4QB4A 1Q46A 4LFAL 2AUKA 3VDYA 4Y7NB 4A3MH 4A3KB 1GM5A 1E2VA 3A8IE 3GV6A 4HSPA 4ZLTF 2J4XA 1BBWA 2MHVA 3RN2A 1VQOA 1E1TA 3WDNA 1ASZA 2IT1A 4AYBB 3KBGA 2JA8G 3I4NG 2A69C 2B8FA 3I3CA 4JVZA 2OTLA 1STHA 4KLKA 4TKOB 1LTLA 2AWOA 4LFBL 1L2FA 1EFID 3F2UA 4GN3B 2C5CA 2F0VA 3LX0A 2R7ZG 2ZM6Q 2B2TC 3FKIB 4OEMB 3JAME 4B3RL 5A2QL 4B3SQ 5K36G 3F2DA 2PO4A 1TS5A 3JC66 2F0IA 3J80i 3SDZA 2MJ8A 5BR8L 4DR5Q 1V1PA 4HMIA 1CI3M 4C1NK 2PNRC 2LXJA 3CF5A 1B9MA 2B63H 4G57A 5C44B 1VQEA 4EGVA 2EZVA 2KEDA 4X3SA 1AN8A 1ENCA 2J0TD 4BXXG 3TSSA 1H9SB 3L3OC 1NMGA 4XDXA 2WP8J 4DV1Q 1CHQD 1FGBD 4CJ0B 2MO0A 3PCOB 4F88A 1JE4A 1EQQA 2UXBL 1FJGQ 3FPPA 4WORA 3MEHA 1PV4A 1IBLL 4FF3A 4A93H 2QKIC 5M5WH 1YJWA 1O80A 4HJ9A 3A7LA 3MXNA 1TT2A 1HR0W 4IPGA 2P5ZX 3OW2A 4TQUS 1HA6A 4GKJL 1JMCA 2NVYB 2VUMG 2Z6KC 1A6XA 5KNCA 4E6IA 1DONA 2CQOA 4RA8A 1CKMA 3GP7A 2OQ0A 4GN4B 3GDEA 3CQZB 1U0LA 2O5JC 5FO8B 1I4HA 2NZ1D 3HS0C 3UDFA 1II3A 4KN7C 4EQ5A 1WD0A 3S15B 2HIVA 4A3BG 1SROA 1OXTA 2EYFA 2K5NA 1HZCA 3J80E 1YITA 1V9PA 4BY1B 2M2LA 3MFGA 4RGMA 3V2TA 1A0IA 4YHHQ 5C4XG 1XTDA 5J39A 2HHHQ 2E2JB 5JEAG 3CCRA 4N8X1 3CCSA 4LF7Q 1S5FD 4A3DH 5FO7B 1JWSD 2WACA 4C3JB 1F9SA 3HOUB 4X64L 4JBMA 3H0GH 1RTNA 4JI5L 2DJGC 1EYCA 3U58A 1KDAA 4O2DA 2EYMA 2VZAA 1W3SA 1EYGA 2K4KA 4QY7A 2VQEQ 5TSSA 1HH2P 2EYLA 5JAVA 5COYA 1D8LA 4RHRA 5ELCA 3A8JE 5J3BA 5JJKA 1E3PA 4X62Q 3FPUB 4Y7NH 1IXRA 1BR9A 2BH8A 3AQQA 4DR2Q 1PH5A 1WYDA 3K58A 5HY6A 1W2BA 4XT3B 1G2TA 3IKJA 4HEDA 1K0SA 2A69D 2DUDA 2EE1A 3S1NB 4OGQC 5E7NA 5JEAJ 2CKZB 2QDBA 4N9PA 5KYLA 1TS4A 4K6LA 1HR0L 2Q8RE 3PO3B 2KA7A 3J7A5 2DNCA 1EU3A 1V1OA 1VQ8A 1C4QA 4DV2Q 2F0SA 2K5DA 2F4IA 1VMPA 2UUCQ 3CC2A 1TY2A 2EQSA 5KIXA 3AU7A 2B2YC 2RHQB 4JW0A 1AZQA 1QNKA 4IZ8A 1D5ZC 2RHSB 1BBUA 2Z1CA 1KRTA 5DM63 4QIWB 1N9WA 4DV7Q 1AE2A 1H9SA 4H7BA 3J81j 1RDPD 2F0GA 1BQQT 2E2DC 1FYCA 1SLJA 3I70A 3Q8DA 3ULLA 1VQLA 4KN4C 3CCEA 4RG1A 1X55A 4HTHA 1CUKA 3BZCA 1Z9FA 5C44H 3TQYA 1JR0D 5FK9C 4F87A 4EVOA 4G4KA 1Q8IA 3IFDA 2JJQA 5CC4A 4A3LH 2RCNA 4DV0Q 3PV0A 3RZOH 2MO1A 1D1KA 4LK1C 2D0PA 4J8QA 3H94A 1SAPA 4ODGA 1L0WA 1E0BA 1WTPA 2DN8A 3S17B 1SNQA 5IP9H 2RF4A 1DYQA 2PCFB 1PH2A 5LMNQ 3K7UC 2YTXA 4OWXB 3TZUA 1PH7A 4YY3L 4C1NI 3CU7A 1WTVA 2R3ZA 3UI2A 3TEHB 3ULPA 3ND8A 1EY7A 3H15A 3FRPB 1LO5D 2L9HA 2NZOA 1PTOB 2NVYH 1E1OA 3J7AV 1S5BD 4CHTB 2JA5G 1EEID 2ZTDA 2FMCA 4A3FB 4LF6Q 5DEHA 2I0QA 3CQZH 4P72A 4BBRB 1PYBA 2EDGA 1JORA 2BOSA 1KLUD 1B44D 4ZUIA 3S15H 2K03A 3KUPA 1Q3LA 1B50A 4IOCA 4BY1H 1PH9A 3KLSA 2NVXB 2PQAB 4KJNA 1MD2D 2R61A 4C2MB 3M3YB 5KNDA 4DUYQ 2E2JH 1QVCA 1X3QA 3BVGA 5CYUA 4K2KA 5CORA 3KYHC 1HZBA 1XXGA 4C3JH 3HOUH 4BY7G 3VYTA 2MPMA 4XYQA 2FINB 1YJ9A 5M3FB 4R4CA 4LF4L 1KRSA 4RCNA 1IBML 3K5OA 5LMUL 2ENBA 2XSCA 1B9NA 4ZKCB 1PTOC 1MKHA 3D0FA 4X66L 1PH6A 1SJED 5ELOA 4DR3Q 4XIGS 3SEBA 3HOZG 2VQFL 2F0KA 1P8LA 4MTKA 1HRJA 4R8NA 4R4OA 3RLOA 1TQOA 1VQIA 3IL8A 2JA7B 5EPLA 1MSGA 2FFKB 2O5IC 2R93G 4QL5A 3J81L 2ZXRA 3S1NH 4LFBQ 3CD6A 2N55A 4S3SA 4GKKL 1QZGA 3OTOL 4IPHA 3PO3H 1VCIA 1PYSB 3VR4A 1VQJA 4ILWA 2F0HA 3KF6A 3TMEA 3CCQA 2YTVA 2HQLA 4FNFA 1NMFA 2A73B 1NY4A 3CMAA 5C4HA 1SEBD 3NK9A 1QE6A 1Y14B 4IUNA 1G2SA 3G6JB 1PFMA 1JOKA 3S2HB 5BR8Q 4IQZA 1KDBA 1U4MA 3VR2A 3G6EA 4IUQA 5C3WA 4BBSB 3G4SA 4P71A 1HNXL 1BCPC 1LTAD 2LFNA 4OO1I 3H3VC 1FNVA 3HKZB 3HOYB 2ZJPA 2ASBA 3R93A 4RAUC 3M9BA 2B2VC 2NYZD 1TWHH 1F9RA 3MEFA 2KCNA 4QQBX 1QUQB 4IALA 1HUMA 4DNTB 3CW2C 2EJGC 1L1OC 3SK8A 1WTQA 4DV6L 1JOOA 1NE3A 1EWCA 3S1MB 4L8JA 2EJMA 2NVTB 2IL8A 3IFTA 2PW5A 4DK1A 5AJ3L 3DEPA 2K01A 1XPUA 5KYIA 4K5VA 1O78A 3PIOA 1PZKD 2CCZA 1DGSA 2ZJRA 3KLRA 1SE2A 2JE6I 4A3MB 1EY9A 1PTOH 2PQAA 4DK0A 3CC7A 2BCOA 1K28A 3R2TA 2XNAC 5D3IB 3ONAB 5D3DA 4IFDH 4A3FH 4PMWA 2PI2A 4ME5A 3J7ZC 3K59A 2BA0A 4BBRH 3L7ZC 2EXDA 5KRUA 4A3JH 1IBKL 1ILPA 5CGKA 3T53B 2MGSA 1A2TA 3R3OA 1DCZA 3PGZA 3QIAA 2E8GA 2Q2HA 2NN6H 2LY7A 2EJFC 3TP7A 3C1EA 1QVFA 2K14A 4C2MH 1TXYA 3M3YH 4X64Q 1AZPA 3A5ZB 1STBA 1EQRA 1VQBA 4DXFA 3T1YQ 1EZ6A 1LTTD 3NBIA 3I91A 3BG3A 1XPRA 1FR3A 4CGYB 4GZYC 1YHAA 5IIFA 3PO2B 1DD2A 5M3FH 4JI4Q 2JA6B 1SYBA 4MN3A 2F4VQ 2EXZA 1G6PA 5GAEC 3L2PA 3HOVG 5CV7A 4OO1H 1PTOD 5FKAC 1SRUA 2B63B 2HIXA 1KC8C 3H3VH 4LMQD 2RCFA 4KY7A 4JI1L 2NWGA 1XX8A 3M4PA 4UP7A 1WVLA 5IWAL 4FXGC 2VXWA 2VW9A 1I94Q 2ZTCA 2RQXA 3A8KE 1I50B 5IT9c 5JJZA 2F0JA 5E4WC 3E5SA 3N6RA 4LF9L 2JA7H 1EQTA 4O42A 1RD9D 3E0JA 5EKLA 1OO9B 2XIWA 1Q86C 3KF8B 4GLXA 2OTJA 1LYLA 2HQEA 1OXUA 1SYGA 4MIUA 3SK6A 4ZYSA 5GADC 2IY5B 2LXKA 2Z6BA 1PVOA 1KDCA 3KK7A 5JJIA 3C3LA 2MP1A 4OL7A 3BYYB 1A2UA 3HZXA 3J7YW 3GTKB 1UUPA 4DV3Q 2WIIB 3OWEB 3OPOA 3BDLA 4IN3A 4OHJA 2UU9L 5C3EH 4DR6L 3BVMA 3M4YA 1QUQA 2RKSA 1HNZL 3S2HH 1BCPD 4EX5A 3LNNA 1XMOL 1CKOA 1J9OA 3QWNA 4EQOA 4CJ1B 5EBCA 1JJGA 3HOYH 1HUNA 1VQ5A 1A15A 3C1FA 3I4OA 2WB1E 1GOZA 2UXCL 3I4MG 1XNRL 3KDFB 2UUAL 3OOCA 1Y1VG 1C7YA 4CKCA 3QOJA 1PHJA 4IPDA 2Q8TA 2L11A 2K5HA 3S2DH 2F0PA 1HFGA 4ALPA 4A93G 3H0GB 5IT9L 3MWYW 2GVBA 1B3QA 5CV8A 4KHPQ 1Y1WH 2AWNA 3OSOA 3P7JA 1NAPA 4KJOA 2UXDL 3I72A 3S1MH 1TKWB 2NVTH 4LAAA 2IW3A 3T13A 2O4XA 5CBEE 1KTKA 3PUXA 2E5LQ 3RMHA 1N32Q 5BN5A 1EOTA 2LKVA 5JPMC 2SNSA 1V8QA 2H5XA 1UE5A 1VQFA 3E6ZX 1K8OA 3D6CA 3W3AA 5D14A 3HEJA 1SYEA 4OXPA 3VR6A 1VQDA 1I6VC 1BCPF 1ASYA 4NPSA 5JOBA 1ZYRC 5EQ0A 1WTWA 2XRQD 3LGJA 1PYWD 1V43A 2Q2IA 4A3DG 1TWCB 1XYIA 3UE0A 2Z4IA 3A74A 5M5YB 3ITPA 2ZJQA 1DM0B 3P20A 5IYDH 2UUBL 5KEEA 1IBMQ 2A6EC 1VMCA 1UEAB 5IGGA 5IE8A 3PO2H 4NXML 1JB7A 1KABA 1RHPA 2Z0SA 2JA6H 3A56A 1NSNS 4KKTA 1HXYD 1Q1EA 3KF8A 4DV4L 1HHVA 2SDFA 4HCEA 4A3KG 4AH6A 1WJJA 3NELA 1N34L 4YCWA 4LFCQ 5GAGC 2CFMA 1GUGA 4HIKA 2F0DA 5E4XA 2CW0C 1XMQQ 2V4DA 1YNJD 4DAYB 2Q2TA 3RZOB 1CM9A 3PUZA 1I50H 3SHLA 1A3VA 4A3EG 4JYAL 4AYBG 3PIO3 4JI6L 3C46A 4QUCA 5J22A 4A75A 1S5CD 2CH4A 4NDXA 3HGBA 2A68C 3EN2A 5C5LA 3CKIB 3QOLA 2QDLA 1X65A 2J7ZA 1K3RA 1JQYD 4RHSA 3L0OA 1SNMA 3M4OB 1JJCB 1CSPA 3KLSX 3FKIG 4B3TQ 4HMJA 4C3IG 3G48A 2WAQG 1CHPD 2VB3X 3TZDA 3NBHB 3GTKH 4DNIA 1ONLA 1X3PA 3KDFA 5IYBH 1HNXQ 1HNWL 2B2TA 5M5XB 3T16A 5C44G 2ICIA 4FO2A 2CH4W 2Y0SG 2ZTEA 1DOLA 3OWFA 1JT8A 1GKHA 2B8GA 1BKBA 3DM1A 5GAHC 4GLAC 3TS2A 4HAEA 5FLMH 1N36L 5EKIA 3CC4A 3JAML 1K73C 4FXDA 3OW7A 3AMUA 5IP9G 1J5EL 1NTGA 1M90C 4LWCA 1JOQA 4NXNL 2EY1A 2MUYA 4JI2L 4DK3C 4LF8Q 5LL6S 1A62A 1SE3A 3G71A 3NE5B 2XWJB 1SR3A 1TWGB 2CHBD 1WOCA 1N33Q 1G6ZA 2K5WA 1OTCA 1IHZA 4WRDA 4P74A 4RGOS 5BN4A 3Q6SA 3MAQA 1CKNB 1E2ZA 1ICWA 3D31A 1O7IA 5C0XG 2AMCB 1I4PA 3GTPB 5I2YA 3NPPA 2K52A 4KK7A 4WJWA 4KY5A 4UP9A 4DR7Q 1ZYRD 2SNMA 5K36H 3SE0A 3STBC 2Z6KA 3HKSA 3G7LA 2OXPA 1VQ7A 3SGIA 3SXHA 3WOEA 4ZKBB 1PDQA 2B2WC 3J81i 2OWOA 4LUVA 5C0XI 5IP7G 4JBKA 1TWCH 4Z9CB 1BBXC 2EIFA 3P1HA 4BXXH 1GO3E 5M5YH 4DAYA 1U4PA 4FP5D 2WKDA 2A6ED 1D5MC 4WFN3 3GTMH 1IL2A 1NBWA 2X69A 4BA1I 2K5VA 1VQMA 1PH4A 4KHZA 5C0XJ 3R8BA 4JOIC 4QUFA 3CRLC 4JI1Q 3W5OA 1IW7C 2E76C 3A7AB 2CW0D 1Y8PB 4RMFA 2YYZA 2D0OA 1TWHB 3F2CA 1AE3A 1CTMA 2D9UA 4AQYQ 1EWHA 1YHBA 4X6AH 3KOJA 3HP3A 2VUMH 1T5EA 4FDBA 4X65L 2JN4A 3NBHA 1SNPA 5M3MB 2PMZE 4RKBA 5IOCA 4J15A 3EFXD 4X3TA 3PO3G 5K5PA 3NUCA 3E0EA 2R92B 3LWEA 1Y8NB 1AFPA 2NB0A 1BUVT 4A3BH 4HN7A 5F2DA 3M4OH 3OYYA 2BE5C 4FF4A 3OIPA 4LF5L 4QF4A 1WTRA 3K80C 3KFUA 4UAIA 1EUJA 1EYAA 1DOKA 2Y0SE 4ZK9B 1IKMA 1SYDA 1F77A 5C4XH 3PIPA 1HNZQ 4HIDA 3HRZC 4JI3Q 4EQNA 1UE7A 3J81c 1SNCA 4CDDC 4A3GB 1I3QB 2LS01 1S3OA 1VF5C 2B2YA 3MVVA 2ID0A 5M5XH 1KD1C 1TIID 2D5DA 2C35B 4IPCA 4QCLA 4A3JB 2EOTA 1HCZA 3D4WA 2KEEA 4L5QA 2A6HC 2YU9H 1Q8KA 1XNRQ 3CHBD 5IY0A 1VF7A 5LHY1 3S9WA 4IURA 1GHJA 3KJPA 1CKNA 4DF7A 2QEJC 3W1GA 3HOZB 5IYCG 1KQSA 4KD3A 4ZAIA 4F7XA 5BN3A 3MHBA 5ELNA 3DEOA 1UE1A 4DR4L 3SK4A 1F2LA 1FD7D 1I6HB 4XTCS 2A19A 2NUCA 3ULJA 5FLXc 1PH8A 1EEFD 1HTLD 5EPKA 1YZ6A 3HG9A 3N52A 1SBBB 3GTGB 1TWGH 4PZ6A 2FJ2A 4LUOA 3EQLC 4LFAQ 2JP1A 1DJRD 4A3CH 4YIJA 3TBIB 3I8ZA 1AP0A 5FJ8G 1BCPB 3A0JA 2IX1A 3PUWA 1I4QA 2IPKD 1I4XA 4NW2A 1VQ6A 1CT1D 1KNAA 2VL6A 3E9HA 3VYSA 1LTGD 1PFNA 3H91A 3T4AC 4A3FG 3GTPH 2VNUD 1F2ZA 1H9JA 4BBRG 4CDCC 2F0FA 3STBD 4MZ9A 4LUZA 3I4LA 4B3SL 4XQQA 2H4OA 1ILQA 1KIXA 2D62A 5G3LD 3W1BA 4V0BA 1YNNC 4KMUC 1R9TB 2NN6G 2PQEA 1GUWA 1M1KC 1L1OB 1SYFA 1EY6A 1CA6A 1I4GA 4DK6C 3BDCA 1AW7A 4GNXC 1PA6A 2BH2A 1EY8A 2FMMA 2BA1A 2QILA 1EL0A 4B3RQ 5I6YA 2AQ1B 1NCVA 3K81C 4R9WA 3HOXG 2R6GA 4ID6A 5EGTA 5J1ZA 1D2BA 3NEMA 2N49A 5C3EB 4K8IA 2V1CC 5M3FG 1GHKA 4A3IG 1B7YB 1RODA 4DV1L 4C3HG 4H02A 3K57A 4DV4Q 3BVZA 1IW7D 5I9OA 2F52A 1FJGL 4BWGB 1N34Q 2KUMA 5FLXL 3NHHA 3T1HL 1H9RA 1WTHA 2WB1B 5I9PA 1PFBA 3URYA 2JA7G 2N3SA 2KBNA 1EIGA 4X3KA 5E1FA 1X54A 4JV5L 2TSSA 1D7QA 1PXUA 3V96A 5E3FA 5M3MH 2JA5H 3S14B 3S2DB 5G3LF 4Y52H 2UXBQ 1SFOB 2SEBD 2XVSA 3D4DA 4DPGA 1IBLQ 3PMFA 2B29A 4TRDA 1Y1WB 1MHWC 4R4IA 1O7ZA 2R92H 3NP8A 4I7AA 2BE5D 1EZ8A 2BDOA 3B6YA 4GKJQ 2NVQB 3ERSX 3MXGA 1CQVA 4CDFC 1S40A 1F9QA 4DUZL 3F8TA 4GOPC 4JK1C 4YHHL 2JQOA 5CV4A 1KHIA 2KHIA 2HHHL 1HNWQ 1HZAA 2IHEA 3RD4A 4LF7L 1QB5D 4BBSG 4A3GH 1I3QH 1X3FA 1K8AC 4R8IA 3F1ZA 3IAYA 2JSOA 1WTOA 4ZRZA 5IGDA 1X3EA 1XNQL 3O13A 4BY7H 1ESRA 1JC7A 2I5LX 5A35A 2K28A 3NTKA 2A6HD 3HKZG 5DAUA 5EKKA 4B08A 5CBAE 3CPWA 4HIOA 1WI5A 4UP8A 1UEBA 4J6HA 3M4QA 2VQEL 3HOVB 1OXXK 1B4OA 1VQ4A 1N36Q 3MZ5A 3AB9A 1IZ6A 2OF1A 5LMNW 4OIKA 2ZT9C 3A54A 1ZXTA 4X62L 4JI8L 4NXNQ 2LSSA 2XRSD 1A3UA 4JI2Q 1ZEQX 3HOZH 4DR2L 2K05A 5C4JH 2B2VA 4JI5Q 3E9IA 1I6HH 1G91A 4M1UB 3HFZB 5NUCA 4O0AA 2MQHA 3Q22A 2QF7A 1B3AA 3T56B 4PMBA 2R93H 3GTGH 1K83H 1CA5A 2HCCA 4B9WA 1RCVD 4U673 2O2LD 1L1OA 4TVAB 1NJIC 4A3MG 5ELBA 1HA5A 1B2TA 3S1RH 2KENA 2VY3A 3TREA 1LT6D 1SDFA 1LTID 5GROA 3S1QB 4OONA 2DJFC 5IT9E 1X56A 3K5MA 3QR8A 4K6DA 3FHWA 3NQTA 1YNND 2KECA 2EY6A 4DU9A 4DV7L 3PIP3 1MIUA 3CRKC 4OWTB 3SK5A 4DNRB 2F3WA 1HR0Q 2GN5A 4DAVA 2B39A 1R9TH 3HOWB 1PRTC 1UWVA 1K0RA 1STAA 2ZXOA 1TWAB 1SXTA 2R7DA 1LTSD 2PZTA 1HTPA 1YNXA 4J1MA 2EY2A 4EQPA 1RJTA 5IYDG 1QWYA 4K2LA 3I4MB 1WCMB 4DV0L 4B3ML 1ZKOA 1C9OA 3F2BA 1SMYC 1Y1VB 2A1AA 3TDQA 3NWTA 3I73A 3SR1A 1VS0A
chains in the Genus database with same CATH topology
2JJQA 4A3LH 3L0OA 2RCNA 5GQOA 1JJCB 3FP9A 1CSPA 2PNHA 3PV0A 4DV0Q 3FKIG 4HJAA 4B3TQ 2B63G 2MO1A 3G48A 4QIWE 3GTLH 1XPOA 2WAQG 1B8AA 2D0PA 5LMNL 3NBHB 3GTKH 1B70B 3CP0A 1L0WA 4R1JA 3H3VI 3WWVA 3UDGA 1OXVA 4DNIA 4X65Q 1X6OA 5IP9H 3KDFA 2RF4A 2YV5A 5IYBH 3RN5A 4PZ7A 1HNXQ 1HNWL 1PH2A 5LMNQ 3K7UC 3CCJA 2YTXA 4OWXB 1PH7A 1MJEA 3CPFA 4YY3L 5C44G 5C3EG 2K75A 3TEHB 2WFWA 3ULPA 3S14H 4ME3A 3H15A 1SFOH 4GNXA 2NZOA 2Y0SG 3PUVA 4A76A 2ZTEA 5IYCH 2NVYH 1E1OA 3JAMi 2MNAA 4YY3Q 1JT8A 1A63A 2JA5G 3S17H 1GKHA 2QGQA 2ZTDA 1BKBA 1J6QA 4YCVA 5GAHC 4GLAC 4JG2A 4LF8L 3TS2A 4LF6Q 2QEXA 5FLMH 1N36L 2I0QA 2E2IH 3CQZH 2WB1G 1Q82C 4P72A 2NVQH 3CC4A 1K73C 1PYBA 3HOYG 4JI7L 1N33L 5IP9G 1J5EL 1NTGA 3A5UA 4LWCA 1M90C 4NXNL 4JI2L 3S15H 4APVA 4DK3C 4DUYL 4LF8Q 3GO5A 1A62A 1EOVA 5FJ8H 4JBJA 3G71A 1Q1BA 1SR3A 2K50A 1VQNA 1UE6A 4IOCA 1JJ2A 4BY1H 3CXCA 1PH9A 3GTQH 2PQAB 1WOCA 1N33Q 1J5EQ 3U4ZA 2JEAI 1OTCA 4L5RC 4DUYQ 4GLVB 1YIJA 1Q81C 4P74A 2E2JH 1QVCA 3M85A 1CKNB 1Y1WG 4DR7L 3D31A 1O7IA 3KYHC 5C0XG 3K0XA 1JE5A 1HZBA 2DGYA 2AMCB 4C3JH 2AHOB 3CAMA 1Q7YC 5FLMG 3ZJYC 3HOUH 3HOVH 4BY7G 4PZ8A 2KCMA 2K52A 3CCLA 1YJ9A 3KJOA 4R4CA 4UP9A 1FL0A 2NVXH 3U4VA 1KRSA 4LF4L 4DR4Q 4DR7Q 1U5KA 4DR3L 1IBML 3STBC 5LMUL 3H0GG 4K0KL 2Z6KA 3HKSA 4DV2L 2JK8A 2UUCL 4MTNA 1VQ7A 3RLNA 3SGIA 1MKHA 4LF4Q 3D0FA 4X66L 1PH6A 5JJLA 5ELOA 4DR3Q 4XIGS 4R4QA 3I7FA 3HOXH 3HOZG 5LMUQ 2VQFL 1P8LA 2PI2E 3CCVA 3J81i 4DR1L 4GOPA 1EIYB 4WJ4A 4R4OA 3RLOA 4LUVA 4DV5L 2OWOA 1VQIA 5C0XI 5IP7G 5H1SE 1TWCH 4JBKA 4A3IH 4UPAA 4X66Q 2EIFA 4C3HH 4HJ5A 4BXXH 1GO3E 5M5YH 2R93G 2VQFQ 4QL5A 3JAMc 3CCUA 3S1NH 4LFBQ 1T9HA 3CD6A 3EBEA 3BU2A 4KI0A 3GTMH 5DLQE 3BJUA 4GKKL 1QZGA 3OTOL 1NBWA 4OX9L 4BA1I 1IL2A 2K5VA 1VQPA 4IPHA 1VQMA 1VCIA 1PYSB 4IJLA 1HJPA 4GS3A 4PG3A 1FGUA 1VQJA 4KHZA 5C0XJ 2AKWB 3KF6A 1G291 4LW1A 3CCQA 3PF5A 4JOIC 3CCMA 2YTVA 4JI1Q 2HQLA 4AQYL 5EAYA 1PH1A 1IYJB 1NMFA 3W5OA 4HIMA 1NY4A 4GKKQ 3OTOQ 3CMAA 1E22A 4L5SA 3AEVA 3ER0A 3PO2G 4RMFA 2YYZA 1Y14B 3HOWH 2D0OA 2JA6G 3F2CA 1MJCA 1AE3A 1VQHA 4AQYQ 5BR8Q 1GVPA 1YHBA 1G51A 4X6AH 3G6EA 1TWAH 3KOJA 2VUMH 3U50C 2XGTA 4FDBA 4X65L 3G4SA 4P71A 1E7ZA 4YWLA 1XJVA 1HNXL 2PMZE 1Z47A 2JA9A 3K8AA 1LUZA 3I4MH 4OO1I 1WCMH 4J15A 3I55A 3PO3G 1Y1VH 1K9MC 4NB3A 1C0AA 2ZJPA 2ASBA 4AIMA 1RIPA 3E0EA 3AFPA 3M9BA 4YCUA 1TWHH 1N32L 4JCVE 3MEFA 4A3BH 3S1QH 1FVIA 3M4OH 3DM3A 3NENA 4JI3L 3DLLA 3T1HQ 4QQBX 4A93G 3I2ZA 2NZHA 1QUQB 3OYYA 2JEBI 4LF5L 4BBSH 1CSQA 1TWFH 3HOWG 1H95A 3K80C 3TS0A 3KFUA 3CW2C 1EUJA 2Y0SE 3MXNB 2L15A 4LF6L 4UY8C 2GVAA 3K7AH 5C4XH 4IJHA 3PIPA 1HNZQ 4A3LG 1L1OC 4DAMA 4LNQA 4HIDA 4JV5Q 4JI3Q 3J81c 1UE7A 2XTIA 1SMXA 1I5FA 4DV6L 4LF5Q 1NE3A 3UDXA 1S3OA 1E24A 1KXLA 2A8VA 2F3IA 1SN8A 1WCMG 3HKZE 2ID0A 1KL9A 5M5XH 3AFQA 1KD1C 3I56A 1YVCA 5AJ3L 4L5TA 2C35B 4IPCA 1XPUA 2KCTA 1VQ9A 5IYBG 3PIOA 4DV6Q 1SE8A 2CCZA 2Q2UA 2UXCQ 1DGSA 4L5QA 3GTJH 2N8NA 2ZJRA 2YU9H 1Q8KA 2JE6I 4P73A 1XNRQ 2PQAA 4JI0Q 4A4IA 1EIFA 3CC7A 2KHJA 5IY0A 2I5MX 3J80c 5AJ3Q 4DUZQ 1YJNA 4YWKA 1HZ9A 2JA8H 3KJPA 2IHFA 3I4NH 1CKNA 4YWMA 4A3FH 4PMWA 2PI2A 3W1GA 5IYCG 1KQSA 3J7ZC 2BA0A 1K8GA 4BBRH 3GD7A 3L7ZC 3BZKA 1Q46A 5ELNA 2EXDA 1UE1A 4LFAL 4DR4L 4A3JH 1IBKL 4JBWA 4XTCS 1VQAA 2A19A 3ULJA 5FLXc 3PGZA 1PH8A 3VDYA 2R7ZH 2E8GA 2Q2HA 4P75A 4A3MH 1XNQQ 1GM5A 1YZ6A 1TWGH 2MFIA 4PZ6A 3T1YL 1PFSA 4LUOA 4LFAQ 1IBKQ 4A3CH 1QVFA 2K14A 4C2MH 1BBWA 3RN2A 1TXYA 1E1TA 5FJ8G 3A0JA 1VQOA 1ASZA 2IX1A 3M3YH 4X64Q 2IT1A 3RZDH 3A5ZB 4BY1G 4JI4L 1EQRA 3PUWA 1VQBA 1S72A 1V1QA 3T1YQ 1VQ6A 2F4VL 2VL6A 2JA8G 3I4NG 3E9HA 4A3FG 2OTLA 2VNUD 1XPRA 4JI8Q 3GTPH 1AH9A 1YHAA 4KLKA 4A3KH 1YI2A 1LTLA 2AWOA 4BBRG 1L2FA 4LFBL 3STBD 4MZ9A 2VS1A 4LUZA 5M3FH 3AYHB 4GN3B 4B3SL 4JI4Q 2F4VQ 1G6PA 5GAEC 3L2PA 1KIXA 2D62A 1I94L 3HOUG 3W1BA 3HOVG 2R7ZG 1SRUA 2NN6G 2ZM6Q 1YEZA 2HIXA 1KC8C 3H3VH 4A3EH 1M1KC 2QA4A 1L1OB 4JI1L 3M4PA 4UP7A 4B3RL 4DK6C 5IWAL 4B3SQ 2ATWA 4A3CG 5K36G 1QVGA 2VW9A 3RZOH 3F2DA 1I94Q 4GNXC 2ZTCA 3JC66 1PA6A 4AYBE 2BH2A 1P16A 5IT9c 1EFWA 2IX0A 3J80i 2BA1A 4LF9L 2JA7H 4B3RQ 5BR8L 4DR5Q 3K81C 5IWAQ 2LXJA 2N78A 3HOXG 3CF5A 3S24A 2R6GA 2B63H 3FKIH 3NEMA 1Q86C 2N49A 3KF8B 4C3IH 1VQEA 2V1CC 4GLXA 2OTJA 5M3FG 1LYLA 4LF9Q 4A3IG 2CWPA 1B7YB 1OXUA 4DV1L 1Q12A 4H02A 3EIVA 4DV3L 1PH3A 5GADC 4DV4Q 4BXXG 2IY5B 2LXKA 2WAQE 4WJ3M 1PVOA 2F52A 4HJ7A 5JJIA 1FJGL 1N34Q 1NMGA 2WP8J 3KF6B 3T1HL 4DV1Q 2MO0A 3PCOB 4DV3Q 2UU9L 4DR6L 5C3EH 1EQQA 2JA7G 2UXBL 1FJGQ 2N3SA 1YBYA 2KBNA 3M7NA 3PO3H 1QUQA 1PV4A 1HNZL 1IBLL 1X54A 3RLFA 3S2HH 4A93H 5M5WH 4JV5L 1D7QA 1YJWA 4HJ9A 4B3MQ 4EX5A 1HR0W 5M3MH 2UU9Q 4IPGA 2JA5H 4DR6Q 1XMOL 4Y52H 3S16H 3OW2A 2UXBQ 4TQUS 1VQKA 4DPGA 1CKOA 4GKJL 1IBLQ 3ICEA 1JMCA 1WFQA 2VUMG 2Z6KC 2B29A 1JJGA 2OCEA 3HOYH 1VQ5A 2CQOA 4R4IA 1N8RC 2R92H 1CKMA 2FXQA 3I4OA 2OQKA 2WB1E 1XMOQ 1BVSA 1X9NA 1QZHA 1XNRL 2OQ0A 3I4MG 4JI0L 4GN4B 2UXCL 3B6YA 3KDFB 3GDEA 3UDIA 2UUAL 4GKJQ 1Y1VG 3ERSX 1U0LA 1S40A 1C7YA 4KHPL 4DUZL 3F8TA 3KLWA 4R4TA 3UDFA 1X3GA 3CMEA 4GOPC 1PHJA 4IPDA 3RR5A 3S2DH 2K5HA 4YHHL 4EQ5A 2JQOA 2HIVA 1KHIA 2KHIA 4HJ8A 1SROA 1OXTA 4ALPA 2HHHL 3GTOH 1HZAA 4A3BG 4IOAA 2E5LL 1HNWQ 2UUAQ 2GVBA 2IHEA 4LF7L 2K5NA 1HZCA 4JOIA 4GNXB 1YITA 1V9PA 2AWNA 1Y1WH 5M3MG 4BBSG 4KHPQ 4IO9A 4A3GH 1I3QH 1X3FA 1K8AC 2UXDL 3PSIA 3F1ZA 3S1MH 1A0IA 4YHHQ 5C4XG 1X3EA 1LM0A 1XTDA 1XNQL 2NVTH 1KAWA 4QGUA 3UE1A 2HHHQ 4BY7H 2I5LX 5JEAG 3CCRA 3PUXA 2E5LQ 3HKZG 3CCSA 1VQCA 4LF7Q 1N32Q 4JC0A 4A3DH 2R92G 3CPWA 4HIOA 1WI5A 2UXDQ 4UP8A 1UEBA 3M4QA 2VQEL 1OXXK 4X64L 1VQ4A 4JBMA 2H5XA 3H0GH 1YHQA 1N36Q 1UE5A 1VQFA 1IZ6A 2ES2A 4DKAC 4JI5L 5LMNW 4OXPA 3U58A 1VQDA 3RNUA 4JI7Q 3PF4A 4MNOA 4QJFA 4O2DA 4X62L 2VZAA 3TRZA 4JI8L 4NXNQ 2LSSA 1ASYA 1W3SA 2CWAA 4NPSA 2K4KA 4JI2Q 4QY7A 2VQEQ 1EYGA 3HOZH 4DR2L 5C4JH 1HH2P 2YTYA 4JI5Q 3E9IA 1D8LA 5IP7H 4A3GG 1I6HH 3HFZB 4O0AA 3LGJA 5J3BA 2MQHA 4IFDG 5JJKA 1E3PA 1V43A 2Q2IA 4X62Q 2ZM6L 4Y7NH 2B3GA 1IXRA 2R93H 2BH8A 1RL2A 1K83H 3AQQA 4DR2Q 1WYDA 1PH5A 3GTGH 4A3JG 4A3DG 5HY6A 1W2BA 1L1OA 4TVAB 4OWWB 1NJIC 3UE0A 4A3MG 3A74A 2ZJQA 2DUDA 1A8VA 3S1RH 2KENA 2VY3A 3TREA 4POFA 4DR5L 5E7NA 5JEAJ 2CKZB 4GN5A 1HR0L 5IYDH 2UUBL 4BA2I 5GROA 1IBMQ 4OONA 3J7A5 1VQ8A 1X56A 5IE8A 3PO2H 3PUYA 4K0KQ 4DV2Q 4LFCL 4NXML 3FHWA 2UUCQ 2R7FA 2Z0SA 1XMQL 1JB7A 3CC2A 2JA6H 4IFDI 4DV7L 1MIUA 2EQSA 4OWTB 1Q1EA 4GOPB 1HR0Q 4DV4L 2GN5A 2UUBQ 2RHQB 2ALYB 1R9TH 4A3KG 4POGA 4AH6A 1WJJA 3NELA 4DR1Q 2RHSB 4YCWA 1N34L 5GAGC 1BBUA 2CFMA 4HIKA 4LFCQ 4NXMQ 4DV5Q 1XMQQ 1KRTA 1UWVA 4DAYB 1K0RA 1N9WA 1AE2A 4DV7Q 5HGQA 1OXSC 2NN6I 1VQGA 2Q2TA 3PUZA 4OO1G 3J81j 1I50H 2R7DA 1GD7A 4A3EG 1EWIA 4IFDJ 1PH4A 4JYAL 4AYBG 1SLJA 4JI6L 1YNXA 3Q8DA 2HT1A 3ULLA 1VQLA 2I5HA 5IYDG 3CCEA 4RG1A 1X55A 4DV0L 4A75A 4B3ML 1CUKA 1C9OA 3BZCA 4OX9Q 3IRBA 3F2BA 1Z9FA 4B3TL 3EN2A 5C44H 3TQYA 2A1AA 4JYAQ 2E2HH 4JI6Q 1X65A 1K3RA 1VS0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JJQ A;  4A3L H;  3L0O A;  2RCN A;  5GQO A;  1JJC B;  3FP9 A;  1CSP A;  2PNH A;  3PV0 A;  4DV0 Q;  3FKI G;  4HJA A;  4B3T Q;  2B63 G;  2MO1 A;  3G48 A;  4QIW E;  3GTL H;  1XPO A;  2WAQ G;  1B8A A;  2D0P A;  5LMN L;  3NBH B;  3GTK H;  1B70 B;  3CP0 A;  1L0W A;  4R1J A;  3H3V I;  3WWV A;  3UDG A;  1OXV A;  4DNI A;  4X65 Q;  1X6O A;  5IP9 H;  3KDF A;  2RF4 A;  2YV5 A;  5IYB H;  3RN5 A;  4PZ7 A;  1HNX Q;  1HNW L;  1PH2 A;  5LMN Q;  3K7U C;  3CCJ A;  2YTX A;  4OWX B;  1PH7 A;  1MJE A;  3CPF A;  4YY3 L;  5C44 G;  5C3E G;  2K75 A;  3TEH B;  2WFW A;  3ULP A;  3S14 H;  4ME3 A;  3H15 A;  1SFO H;  4GNX A;  2NZO A;  2Y0S G;  3PUV A;  4A76 A;  2ZTE A;  5IYC H;  2NVY H;  1E1O A;  3JAM i;  2MNA A;  4YY3 Q;  1JT8 A;  1A63 A;  2JA5 G;  3S17 H;  1GKH A;  2QGQ A;  2ZTD A;  1BKB A;  1J6Q A;  4YCV A;  5GAH C;  4GLA C;  4JG2 A;  4LF8 L;  3TS2 A;  4LF6 Q;  2QEX A;  5FLM H;  1N36 L;  2I0Q A;  2E2I H;  3CQZ H;  2WB1 G;  1Q82 C;  4P72 A;  2NVQ H;  3CC4 A;  1K73 C;  1PYB A;  3HOY G;  4JI7 L;  1N33 L;  5IP9 G;  1J5E L;  1NTG A;  3A5U A;  4LWC A;  1M90 C;  4NXN L;  4JI2 L;  3S15 H;  4APV A;  4DK3 C;  4DUY L;  4LF8 Q;  3GO5 A;  1A62 A;  1EOV A;  5FJ8 H;  4JBJ A;  3G71 A;  1Q1B A;  1SR3 A;  2K50 A;  1VQN A;  1UE6 A;  4IOC A;  1JJ2 A;  4BY1 H;  3CXC A;  1PH9 A;  3GTQ H;  2PQA B;  1WOC A;  1N33 Q;  1J5E Q;  3U4Z A;  2JEA I;  1OTC A;  4L5R C;  4DUY Q;  4GLV B;  1YIJ A;  1Q81 C;  4P74 A;  2E2J H;  1QVC A;  3M85 A;  1CKN B;  1Y1W G;  4DR7 L;  3D31 A;  1O7I A;  3KYH C;  5C0X G;  3K0X A;  1JE5 A;  1HZB A;  2DGY A;  2AMC B;  4C3J H;  2AHO B;  3CAM A;  1Q7Y C;  5FLM G;  3ZJY C;  3HOU H;  3HOV H;  4BY7 G;  4PZ8 A;  2KCM A;  2K52 A;  3CCL A;  1YJ9 A;  3KJO A;  4R4C A;  4UP9 A;  1FL0 A;  2NVX H;  3U4V A;  1KRS A;  4LF4 L;  4DR4 Q;  4DR7 Q;  1U5K A;  4DR3 L;  1IBM L;  3STB C;  5LMU L;  3H0G G;  4K0K L;  2Z6K A;  3HKS A;  4DV2 L;  2JK8 A;  2UUC L;  4MTN A;  1VQ7 A;  3RLN A;  3SGI A;  1MKH A;  4LF4 Q;  3D0F A;  4X66 L;  1PH6 A;  5JJL A;  5ELO A;  4DR3 Q;  4XIG S;  4R4Q A;  3I7F A;  3HOX H;  3HOZ G;  5LMU Q;  2VQF L;  1P8L A;  2PI2 E;  3CCV A;  3J81 i;  4DR1 L;  4GOP A;  1EIY B;  4WJ4 A;  4R4O A;  3RLO A;  4LUV A;  4DV5 L;  2OWO A;  1VQI A;  5C0X I;  5IP7 G;  5H1S E;  1TWC H;  4JBK A;  4A3I H;  4UPA A;  4X66 Q;  2EIF A;  4C3H H;  4HJ5 A;  4BXX H;  1GO3 E;  5M5Y H;  2R93 G;  2VQF Q;  4QL5 A;  3JAM c;  3CCU A;  3S1N H;  4LFB Q;  1T9H A;  3CD6 A;  3EBE A;  3BU2 A;  4KI0 A;  3GTM H;  5DLQ E;  3BJU A;  4GKK L;  1QZG A;  3OTO L;  1NBW A;  4OX9 L;  4BA1 I;  1IL2 A;  2K5V A;  1VQP A;  4IPH A;  1VQM A;  1VCI A;  1PYS B;  4IJL A;  1HJP A;  4GS3 A;  4PG3 A;  1FGU A;  1VQJ A;  4KHZ A;  5C0X J;  2AKW B;  3KF6 A;  1G29 1;  4LW1 A;  3CCQ A;  3PF5 A;  4JOI C;  3CCM A;  2YTV A;  4JI1 Q;  2HQL A;  4AQY L;  5EAY A;  1PH1 A;  1IYJ B;  1NMF A;  3W5O A;  4HIM A;  1NY4 A;  4GKK Q;  3OTO Q;  3CMA A;  1E22 A;  4L5S A;  3AEV A;  3ER0 A;  3PO2 G;  4RMF A;  2YYZ A;  1Y14 B;  3HOW H;  2D0O A;  2JA6 G;  3F2C A;  1MJC A;  1AE3 A;  1VQH A;  4AQY Q;  5BR8 Q;  1GVP A;  1YHB A;  1G51 A;  4X6A H;  3G6E A;  1TWA H;  3KOJ A;  2VUM H;  3U50 C;  2XGT A;  4FDB A;  4X65 L;  3G4S A;  4P71 A;  1E7Z A;  4YWL A;  1XJV A;  1HNX L;  2PMZ E;  1Z47 A;  2JA9 A;  3K8A A;  1LUZ A;  3I4M H;  4OO1 I;  1WCM H;  4J15 A;  3I55 A;  3PO3 G;  1Y1V H;  1K9M C;  4NB3 A;  1C0A A;  2ZJP A;  2ASB A;  4AIM A;  1RIP A;  3E0E A;  3AFP A;  3M9B A;  4YCU A;  1TWH H;  1N32 L;  4JCV E;  3MEF A;  4A3B H;  3S1Q H;  1FVI A;  3M4O H;  3DM3 A;  3NEN A;  4JI3 L;  3DLL A;  3T1H Q;  4QQB X;  4A93 G;  3I2Z A;  2NZH A;  1QUQ B;  3OYY A;  2JEB I;  4LF5 L;  4BBS H;  1CSQ A;  1TWF H;  3HOW G;  1H95 A;  3K80 C;  3TS0 A;  3KFU A;  3CW2 C;  1EUJ A;  2Y0S E;  3MXN B;  2L15 A;  4LF6 L;  4UY8 C;  2GVA A;  3K7A H;  5C4X H;  4IJH A;  3PIP A;  1HNZ Q;  4A3L G;  1L1O C;  4DAM A;  4LNQ A;  4HID A;  4JV5 Q;  4JI3 Q;  3J81 c;  1UE7 A;  2XTI A;  1SMX A;  1I5F A;  4DV6 L;  4LF5 Q;  1NE3 A;  3UDX A;  1S3O A;  1E24 A;  1KXL A;  2A8V A;  2F3I A;  1SN8 A;  1WCM G;  3HKZ E;  2ID0 A;  1KL9 A;  5M5X H;  3AFQ A;  1KD1 C;  3I56 A;  1YVC A;  5AJ3 L;  4L5T A;  2C35 B;  4IPC A;  1XPU A;  2KCT A;  1VQ9 A;  5IYB G;  3PIO A;  4DV6 Q;  1SE8 A;  2CCZ A;  2Q2U A;  2UXC Q;  1DGS A;  4L5Q A;  3GTJ H;  2N8N A;  2ZJR A;  2YU9 H;  1Q8K A;  2JE6 I;  4P73 A;  1XNR Q;  2PQA A;  4JI0 Q;  4A4I A;  1EIF A;  3CC7 A;  2KHJ A;  5IY0 A;  2I5M X;  3J80 c;  5AJ3 Q;  4DUZ Q;  1YJN A;  4YWK A;  1HZ9 A;  2JA8 H;  3KJP A;  2IHF A;  3I4N H;  1CKN A;  4YWM A;  4A3F H;  4PMW A;  2PI2 A;  3W1G A;  5IYC G;  1KQS A;  3J7Z C;  2BA0 A;  1K8G A;  4BBR H;  3GD7 A;  3L7Z C;  3BZK A;  1Q46 A;  5ELN A;  2EXD A;  1UE1 A;  4LFA L;  4DR4 L;  4A3J H;  1IBK L;  4JBW A;  4XTC S;  1VQA A;  2A19 A;  3ULJ A;  5FLX c;  3PGZ A;  1PH8 A;  3VDY A;  2R7Z H;  2E8G A;  2Q2H A;  4P75 A;  4A3M H;  1XNQ Q;  1GM5 A;  1YZ6 A;  1TWG H;  2MFI A;  4PZ6 A;  3T1Y L;  1PFS A;  4LUO A;  4LFA Q;  1IBK Q;  4A3C H;  1QVF A;  2K14 A;  4C2M H;  1BBW A;  3RN2 A;  1TXY A;  1E1T A;  5FJ8 G;  3A0J A;  1VQO A;  1ASZ A;  2IX1 A;  3M3Y H;  4X64 Q;  2IT1 A;  3RZD H;  3A5Z B;  4BY1 G;  4JI4 L;  1EQR A;  3PUW A;  1VQB A;  1S72 A;  1V1Q A;  3T1Y Q;  1VQ6 A;  2F4V L;  2VL6 A;  2JA8 G;  3I4N G;  3E9H A;  4A3F G;  2OTL A;  2VNU D;  1XPR A;  4JI8 Q;  3GTP H;  1AH9 A;  1YHA A;  4KLK A;  4A3K H;  1YI2 A;  1LTL A;  2AWO A;  4BBR G;  1L2F A;  4LFB L;  3STB D;  4MZ9 A;  2VS1 A;  4LUZ A;  5M3F H;  3AYH B;  4GN3 B;  4B3S L;  4JI4 Q;  2F4V Q;  1G6P A;  5GAE C;  3L2P A;  1KIX A;  2D62 A;  1I94 L;  3HOU G;  3W1B A;  3HOV G;  2R7Z G;  1SRU A;  2NN6 G;  2ZM6 Q;  1YEZ A;  2HIX A;  1KC8 C;  3H3V H;  4A3E H;  1M1K C;  2QA4 A;  1L1O B;  4JI1 L;  3M4P A;  4UP7 A;  4B3R L;  4DK6 C;  5IWA L;  4B3S Q;  2ATW A;  4A3C G;  5K36 G;  1QVG A;  2VW9 A;  3RZO H;  3F2D A;  1I94 Q;  4GNX C;  2ZTC A;  3JC6 6;  1PA6 A;  4AYB E;  2BH2 A;  1P16 A;  5IT9 c;  1EFW A;  2IX0 A;  3J80 i;  2BA1 A;  4LF9 L;  2JA7 H;  4B3R Q;  5BR8 L;  4DR5 Q;  3K81 C;  5IWA Q;  2LXJ A;  2N78 A;  3HOX G;  3CF5 A;  3S24 A;  2R6G A;  2B63 H;  3FKI H;  3NEM A;  1Q86 C;  2N49 A;  3KF8 B;  4C3I H;  1VQE A;  2V1C C;  4GLX A;  2OTJ A;  5M3F G;  1LYL A;  4LF9 Q;  4A3I G;  2CWP A;  1B7Y B;  1OXU A;  4DV1 L;  1Q12 A;  4H02 A;  3EIV A;  4DV3 L;  1PH3 A;  5GAD C;  4DV4 Q;  4BXX G;  2IY5 B;  2LXK A;  2WAQ E;  4WJ3 M;  1PVO A;  2F52 A;  4HJ7 A;  5JJI A;  1FJG L;  1N34 Q;  1NMG A;  2WP8 J;  3KF6 B;  3T1H L;  4DV1 Q;  2MO0 A;  3PCO B;  4DV3 Q;  2UU9 L;  4DR6 L;  5C3E H;  1EQQ A;  2JA7 G;  2UXB L;  1FJG Q;  2N3S A;  1YBY A;  2KBN A;  3M7N A;  3PO3 H;  1QUQ A;  1PV4 A;  1HNZ L;  1IBL L;  1X54 A;  3RLF A;  3S2H H;  4A93 H;  5M5W H;  4JV5 L;  1D7Q A;  1YJW A;  4HJ9 A;  4B3M Q;  4EX5 A;  1HR0 W;  5M3M H;  2UU9 Q;  4IPG A;  2JA5 H;  4DR6 Q;  1XMO L;  4Y52 H;  3S16 H;  3OW2 A;  2UXB Q;  4TQU S;  1VQK A;  4DPG A;  1CKO A;  4GKJ L;  1IBL Q;  3ICE A;  1JMC A;  1WFQ A;  2VUM G;  2Z6K C;  2B29 A;  1JJG A;  2OCE A;  3HOY H;  1VQ5 A;  2CQO A;  4R4I A;  1N8R C;  2R92 H;  1CKM A;  2FXQ A;  3I4O A;  2OQK A;  2WB1 E;  1XMO Q;  1BVS A;  1X9N A;  1QZH A;  1XNR L;  2OQ0 A;  3I4M G;  4JI0 L;  4GN4 B;  2UXC L;  3B6Y A;  3KDF B;  3GDE A;  3UDI A;  2UUA L;  4GKJ Q;  1Y1V G;  3ERS X;  1U0L A;  1S40 A;  1C7Y A;  4KHP L;  4DUZ L;  3F8T A;  3KLW A;  4R4T A;  3UDF A;  1X3G A;  3CME A;  4GOP C;  1PHJ A;  4IPD A;  3RR5 A;  3S2D H;  2K5H A;  4YHH L;  4EQ5 A;  2JQO A;  2HIV A;  1KHI A;  2KHI A;  4HJ8 A;  1SRO A;  1OXT A;  4ALP A;  2HHH L;  3GTO H;  1HZA A;  4A3B G;  4IOA A;  2E5L L;  1HNW Q;  2UUA Q;  2GVB A;  2IHE A;  4LF7 L;  2K5N A;  1HZC A;  4JOI A;  4GNX B;  1YIT A;  1V9P A;  2AWN A;  1Y1W H;  5M3M G;  4BBS G;  4KHP Q;  4IO9 A;  4A3G H;  1I3Q H;  1X3F A;  1K8A C;  2UXD L;  3PSI A;  3F1Z A;  3S1M H;  1A0I A;  4YHH Q;  5C4X G;  1X3E A;  1LM0 A;  1XTD A;  1XNQ L;  2NVT H;  1KAW A;  4QGU A;  3UE1 A;  2HHH Q;  4BY7 H;  2I5L X;  5JEA G;  3CCR A;  3PUX A;  2E5L Q;  3HKZ G;  3CCS A;  1VQC A;  4LF7 Q;  1N32 Q;  4JC0 A;  4A3D H;  2R92 G;  3CPW A;  4HIO A;  1WI5 A;  2UXD Q;  4UP8 A;  1UEB A;  3M4Q A;  2VQE L;  1OXX K;  4X64 L;  1VQ4 A;  4JBM A;  2H5X A;  3H0G H;  1YHQ A;  1N36 Q;  1UE5 A;  1VQF A;  1IZ6 A;  2ES2 A;  4DKA C;  4JI5 L;  5LMN W;  4OXP A;  3U58 A;  1VQD A;  3RNU A;  4JI7 Q;  3PF4 A;  4MNO A;  4QJF A;  4O2D A;  4X62 L;  2VZA A;  3TRZ A;  4JI8 L;  4NXN Q;  2LSS A;  1ASY A;  1W3S A;  2CWA A;  4NPS A;  2K4K A;  4JI2 Q;  4QY7 A;  2VQE Q;  1EYG A;  3HOZ H;  4DR2 L;  5C4J H;  1HH2 P;  2YTY A;  4JI5 Q;  3E9I A;  1D8L A;  5IP7 H;  4A3G G;  1I6H H;  3HFZ B;  4O0A A;  3LGJ A;  5J3B A;  2MQH A;  4IFD G;  5JJK A;  1E3P A;  1V43 A;  2Q2I A;  4X62 Q;  2ZM6 L;  4Y7N H;  2B3G A;  1IXR A;  2R93 H;  2BH8 A;  1RL2 A;  1K83 H;  3AQQ A;  4DR2 Q;  1WYD A;  1PH5 A;  3GTG H;  4A3J G;  4A3D G;  5HY6 A;  1W2B A;  1L1O A;  4TVA B;  4OWW B;  1NJI C;  3UE0 A;  4A3M G;  3A74 A;  2ZJQ A;  2DUD A;  1A8V A;  3S1R H;  2KEN A;  2VY3 A;  3TRE A;  4POF A;  4DR5 L;  5E7N A;  5JEA J;  2CKZ B;  4GN5 A;  1HR0 L;  5IYD H;  2UUB L;  4BA2 I;  5GRO A;  1IBM Q;  4OON A;  3J7A 5;  1VQ8 A;  1X56 A;  5IE8 A;  3PO2 H;  3PUY A;  4K0K Q;  4DV2 Q;  4LFC L;  4NXM L;  3FHW A;  2UUC Q;  2R7F A;  2Z0S A;  1XMQ L;  1JB7 A;  3CC2 A;  2JA6 H;  4IFD I;  4DV7 L;  1MIU A;  2EQS A;  4OWT B;  1Q1E A;  4GOP B;  1HR0 Q;  4DV4 L;  2GN5 A;  2UUB Q;  2RHQ B;  2ALY B;  1R9T H;  4A3K G;  4POG A;  4AH6 A;  1WJJ A;  3NEL A;  4DR1 Q;  2RHS B;  4YCW A;  1N34 L;  5GAG C;  1BBU A;  2CFM A;  4HIK A;  4LFC Q;  4NXM Q;  4DV5 Q;  1XMQ Q;  1KRT A;  1UWV A;  4DAY B;  1K0R A;  1N9W A;  1AE2 A;  4DV7 Q;  5HGQ A;  1OXS C;  2NN6 I;  1VQG A;  2Q2T A;  3PUZ A;  4OO1 G;  3J81 j;  1I50 H;  2R7D A;  1GD7 A;  4A3E G;  1EWI A;  4IFD J;  1PH4 A;  4JYA L;  4AYB G;  1SLJ A;  4JI6 L;  1YNX A;  3Q8D A;  2HT1 A;  3ULL A;  1VQL A;  2I5H A;  5IYD G;  3CCE A;  4RG1 A;  1X55 A;  4DV0 L;  4A75 A;  4B3M L;  1CUK A;  1C9O A;  3BZC A;  4OX9 Q;  3IRB A;  3F2B A;  1Z9F A;  4B3T L;  3EN2 A;  5C44 H;  3TQY A;  2A1A A;  4JYA Q;  2E2H H;  4JI6 Q;  1X65 A;  1K3R A;  1VS0 A; 
#chains in the Genus database with same CATH topology
 2ZXP A;  3FP9 A;  2B63 G;  4HJA A;  2BDN A;  4ABN A;  2QCP X;  5DNF A;  1UNS A;  2IWH A;  1B8A A;  5AFW A;  2F0M A;  2PYK A;  5LMN L;  1Y8O B;  3K7A B;  3CP0 A;  2WV6 D;  4R1J A;  4DN4 M;  3UDG A;  3NQI A;  4I65 A;  4IUV A;  4RFB A;  5I2X A;  4X65 Q;  1X6O A;  1GUN A;  4N8F A;  5A2Q E;  3RN5 A;  2K7V A;  3CCJ A;  2L12 A;  1MJE A;  3CPF A;  3M7G A;  3NXW A;  1RF2 D;  1STY A;  5ELE A;  3S14 H;  2WKC A;  4ME3 A;  1SFO H;  3GTJ B;  1X32 A;  5FO9 B;  3PUV A;  1IYU A;  3K0Y A;  5EBD A;  1GJX A;  5LL6 X;  2CQA A;  3JAM i;  2MNA A;  4YY3 Q;  1A63 A;  4IUU A;  1NUC A;  2QGQ A;  1J6Q A;  4CJ2 C;  2JA8 B;  3I4N B;  1ESF A;  2QEX A;  2NVQ H;  4JI7 L;  2Z9H A;  4C56 C;  3ND9 A;  4APV A;  4DUY L;  3GO5 A;  4TSS A;  2R7Z B;  2LMC B;  1QCB D;  1CZW A;  2K50 A;  2OT2 A;  3VA5 A;  3VYR A;  4RKL A;  1TY0 A;  2HCI A;  5ELD A;  2B2U C;  1IKL A;  2EPB A;  1C8C A;  4GLV B;  4H44 C;  1Q81 C;  3RZD B;  3BDO A;  1MSH A;  2PW7 A;  2A5H A;  2F0U A;  4DXG A;  3K0X A;  1JE5 A;  2DGY A;  2AHO B;  1UAP A;  3ZJY C;  5FLM G;  1S4Z A;  3HOV H;  2KCM A;  4KV6 A;  4Q0F A;  1EY5 A;  1EQV A;  2HDL A;  2KVM A;  4DR4 Q;  3U4V A;  4DR3 L;  1D5X C;  2CVR A;  3H0G G;  2RDH A;  4K0K L;  4A3E B;  2JK8 A;  2C9O A;  3MFY A;  3GTM B;  2RSO A;  2HD3 A;  3MXU A;  4LF4 Q;  3I90 A;  5CV9 A;  1NR4 A;  2IJ0 A;  4I7Z C;  3NWS A;  4L6T B;  2I07 B;  3D3R A;  5LMU Q;  4XT1 B;  4DR1 L;  3CCV A;  4WJ4 A;  2K33 A;  3L9A X;  4BS9 A;  4DV5 L;  3MXP A;  5H1S E;  4UPA A;  1LV9 A;  1H9M A;  4X66 Q;  1KNE A;  4ULL A;  2VQF Q;  1L0X B;  3JAM c;  3CCU A;  4C3I B;  1Q90 A;  3EBE A;  3BU2 A;  1ENA A;  2WAQ B;  3BJU A;  1O7Y A;  4OX9 L;  2PMZ B;  1VQP A;  3S1Q H;  2VUM B;  1FGU A;  3MTS A;  3K5N A;  3P75 A;  3PF5 A;  4FF2 A;  3CCM A;  5ELF A;  5IGE A;  5EAY A;  4HIM A;  2N88 A;  4GKK Q;  3OTO Q;  4L5S A;  1PRT D;  3ER0 A;  2FHT A;  4KTA A;  1SE4 A;  3HOW H;  4HCS A;  2B2U A;  3ZYY X;  4XYO A;  1MJC A;  1VQH A;  1GVP A;  4G7H C;  3Q23 A;  1G51 A;  5JVG 3;  4A3B B;  2Y0S B;  5IGB A;  1TWA H;  1LLR D;  2E74 C;  1TS3 A;  4YWL A;  1XJV A;  1SMY D;  1Z47 A;  2JA9 A;  3S16 B;  3FVQ A;  1BOS A;  3K8A A;  5IGF A;  3QJY A;  3I4M H;  5C4X B;  1WCM H;  2K6A A;  1Y1V H;  1SSO A;  1TS2 A;  5CV5 A;  1RIP A;  1KLG D;  1HPC A;  4JCV E;  1QOH A;  1FVI A;  1TVX A;  3T1H Q;  3NEN A;  1FNU A;  3DLL A;  3I2Z A;  3J7A F;  1CFM A;  1TWF H;  2F0N A;  2Q8I B;  2YU9 B;  4UY8 C;  3K7A H;  3GTO B;  4A3L G;  4DAM A;  2E75 C;  4Q5V A;  4JV5 Q;  2EVB A;  5I4D A;  2XTI A;  4RH6 A;  1DZ1 A;  3UDX A;  1KAA A;  1DXM A;  2F0T A;  1KL9 A;  2K04 A;  2M9V A;  1YVC A;  4RWS C;  4L5T A;  4XQJ A;  2KCT A;  1VQ9 A;  4DV6 Q;  1D1I A;  3GTJ H;  1PRT F;  3FEW X;  1F2Y A;  1LT5 D;  1EIF A;  2KHJ A;  1LTR D;  2F0Q A;  2I5M X;  3J80 c;  5AJ3 Q;  4N9T A;  4H13 C;  4DUZ Q;  4YWK A;  1HZ9 A;  1K8M A;  2JA8 H;  2IHF A;  3I4N H;  2K32 A;  1EYD A;  5EJW A;  1CQF A;  5C5M A;  1K8G A;  1JWU D;  3GD7 A;  3BZK A;  4U68 A;  5M9O A;  1J8I A;  4JBW A;  4RCO A;  3TP5 A;  1VQA A;  3KBX A;  4PMC A;  2R7Z H;  2EYP A;  4P75 A;  1XNQ Q;  3T51 B;  4KKS A;  2DY8 A;  4UDU C;  2MFI A;  3T1Y L;  5I6W A;  1PFS A;  3A55 A;  1QG7 A;  4V19 0;  1IBK Q;  2PZU A;  4IUT A;  1CZG A;  2RBM A;  3RZD H;  1STN A;  4BY1 G;  4JI4 L;  1S72 A;  5CV6 A;  1V1Q A;  3C2P A;  4JPB W;  2F4V L;  1D6E C;  4JI8 Q;  1AH9 A;  2PPB C;  1WD1 A;  4A3K H;  1YI2 A;  2VS1 A;  1STE A;  1M8A A;  2NTT A;  3AYH B;  2JYO A;  3RUZ A;  2Z4H A;  1I94 L;  4C3J G;  3HOU G;  1SYC A;  4CBV A;  1YEZ A;  4LJZ C;  4A3E H;  2QA4 A;  2AQ3 B;  4DFA A;  5KGU A;  1XWE A;  4PNY A;  2ATW A;  4A3C G;  1QVG A;  3OIQ A;  4AYB E;  1P16 A;  3DXJ C;  1EFW A;  1JIC A;  2IX0 A;  4H0L C;  1O7L A;  3GQB A;  5IWA Q;  3DHQ A;  2N78 A;  3DWQ A;  3S24 A;  3FKI H;  1U4R A;  2G9H D;  3J80 L;  4C3I H;  1Y69 U;  1A3T A;  1STG A;  2E2H B;  4LF9 Q;  2CWP A;  2AQ2 B;  1Q12 A;  2F3V A;  3EVQ A;  5T1G A;  3EIV A;  4DV3 L;  1PH3 A;  3GV3 A;  1R4P B;  2F0L A;  2WAQ E;  4DGZ A;  1MI2 A;  4WJ3 M;  1GUS A;  4HJ7 A;  3GTL B;  2JA5 B;  2EYH A;  2A68 D;  1CK1 A;  3D4R A;  3KF6 B;  4KKU A;  2RDF A;  1ET6 A;  2RDG A;  2KQ3 A;  3M7N A;  1YBY A;  4PQX A;  3RLF A;  2HUG A;  1NNX A;  2G9D A;  2XN9 C;  4B3M Q;  3K5L A;  2UU9 Q;  4DR6 Q;  4XXE A;  5C3X A;  3S16 H;  3MC0 B;  4NP5 A;  4NKL A;  3V05 A;  1VQK A;  4KHV A;  3X3N A;  3ICE A;  2B2W A;  1WFQ A;  5JEA H;  1AEX A;  3J81 E;  2KOL A;  5JVH 3;  1LTB D;  1TR5 A;  2KCC A;  2OCE A;  1N8R C;  2FXQ A;  1MBY A;  2OQK A;  1XMO Q;  1BVS A;  1X9N A;  1QZH A;  4CKE A;  4K5X A;  4JI0 L;  4BY7 B;  3UDI A;  2E2I B;  4KHP L;  2I46 A;  1W6J A;  5CR3 A;  3ERO A;  3KLW A;  4R4T A;  1F2M A;  1VDZ A;  1X3G A;  3EA6 A;  2PZW A;  3CME A;  3RR5 A;  1MGS A;  5C4Z A;  3R2I A;  4HJ8 A;  2UXC Q;  3GTO H;  4IOA A;  2E5L L;  2UUA Q;  4GNX B;  4JOI A;  1N32 L;  3Q24 A;  3GTQ B;  5M3M G;  4IO9 A;  2DNE A;  2M00 A;  3PSI A;  1HQM C;  5C0X H;  4FF1 A;  1LM0 A;  1KAW A;  4QGU A;  3UE1 A;  4G7O C;  1GUT A;  4X3U A;  5C4J B;  3H09 A;  1VQC A;  4JC0 A;  2R92 G;  5T1I A;  1RTO A;  1PMR A;  5HGT A;  2WIN B;  2UXD Q;  5FLX E;  4L63 B;  1QIL A;  3EJI A;  2VB2 X;  2R93 B;  1YHQ A;  1JCK B;  1K83 B;  2ES2 A;  4DKA C;  1U9R A;  3RNU A;  4JI7 Q;  3PF4 A;  4MNO A;  2AUJ D;  4QJF A;  1WTX A;  3TRZ A;  4G7Z C;  3VYU A;  1B1Z A;  2CWA A;  1C48 A;  3X3M A;  3S1R B;  4MHE A;  2YTY A;  3LWU A;  3VR5 A;  5IP7 H;  4A3G G;  4IFD G;  4IUP A;  4M8A A;  2ZM6 L;  3HOX B;  1E2W A;  2B3G A;  1RL2 A;  3H6M A;  3FMC A;  4A3J G;  4A3I B;  4O1N A;  4OWW B;  4C3H B;  2F1M A;  1A8V A;  4B9X A;  4DR5 L;  4POF A;  2XWB B;  4GN5 A;  1EU4 A;  1BF4 A;  1DOM A;  4BA2 I;  3BZD B;  1EY4 A;  3PUY A;  3VR3 A;  4K0K Q;  4LFC L;  2L1B A;  2R7F A;  3Q0A A;  1XMQ L;  5C6A A;  4IFD I;  4GOP B;  1ET9 A;  3DWA A;  2UUB Q;  2ALY B;  4POG A;  2HDM A;  4K8J A;  4DR1 Q;  4NXM Q;  1W6K A;  4NMZ A;  4DV5 Q;  2K1B A;  5HGQ A;  1OXS C;  2NN6 I;  1VQG A;  4OO1 G;  2K5Q A;  1GD7 A;  4IFD J;  1EWI A;  4KD4 A;  2L55 A;  4RGN A;  5FOB B;  2HT1 A;  4OIJ A;  2I5H A;  3W2D A;  4XQN A;  4FYD A;  2G5D A;  1IL8 A;  4OX9 Q;  3IRB A;  1R4Q B;  4B3T L;  1GXD C;  1EY0 A;  1F9P A;  4JYA Q;  2E2H H;  4JI6 Q;  1TU2 B;  4OEL B;  5GQO A;  2F0W A;  2PNH A;  1S5D D;  4QIW E;  3TN2 A;  2DY7 A;  3GTL H;  1XPO A;  1U4L A;  4HSV A;  3D8G A;  1B70 B;  3DUZ A;  3TP6 A;  3H3V I;  3WWV A;  1OXV A;  3DMU A;  5DM7 3;  4DAP A;  3K6O A;  2YV5 A;  4PZ7 A;  2OEO A;  3OHX C;  3U9S A;  3D6W A;  1ML0 D;  2L0C A;  5C3E G;  2K75 A;  5D65 A;  2WFW A;  1LT4 D;  5IOD A;  4GNX A;  4PV1 C;  3NTI A;  1NR2 A;  4A76 A;  5IYC H;  4HR7 B;  3ERQ A;  3WOF A;  1PZJ D;  2JXM B;  2D2C C;  5IGC A;  3S17 H;  2ICE C;  3OMC A;  4YCV A;  4LF8 L;  4JG2 A;  3QG1 A;  1L0Y B;  2E2I H;  2KJX A;  2WB1 G;  1Q82 C;  3HOY G;  1N33 L;  4QMG A;  3A5U A;  1JB3 A;  4ZUJ A;  1IYV A;  1EOV A;  5FJ8 H;  4JBJ A;  1PRT B;  1LAC A;  2EYO A;  1Q1B A;  1VQN A;  1UE6 A;  1JJ2 A;  3CXC A;  3GTQ H;  2KHS A;  1J5E Q;  3U4Z A;  4ZCK A;  2JEA I;  2RA4 A;  5CMD A;  4L5R C;  1YIJ A;  1G8Z D;  3M85 A;  1Y1W G;  3PQI A;  1BNZ A;  1ICF B;  2SOB A;  2X6G A;  4DA2 A;  4DR7 L;  4K5W A;  1HFN A;  3CAM A;  1QNU A;  1Q7Y C;  4PZ8 A;  3CCL A;  3KJO A;  2NVX H;  1FL0 A;  1BXT A;  1U5K A;  1LAB A;  5ISR A;  4DV2 L;  3OMG A;  4P2C B;  2UUC L;  4CDE C;  2Z8L A;  4MTN A;  3RLN A;  3DWP A;  4UHV A;  2F0E A;  5JJL A;  1QJO A;  3I7F A;  4R4Q A;  3HOX H;  1RKN A;  1BDO A;  2PI2 E;  3SVM A;  4GOP A;  1EIY B;  3VA7 A;  4FVM A;  2GA4 B;  4A3I H;  4C3H H;  4HJ5 A;  1FNW A;  1T9H A;  4KI0 A;  5DLQ E;  4IJL A;  1HJP A;  4GS3 A;  3BYT B;  4PG3 A;  5EPJ A;  1H9K A;  1YNJ C;  2AKW B;  1G29 1;  4LW1 A;  2H1E A;  1SND A;  1LT3 D;  4AQY L;  1PH1 A;  2X6L A;  1IYJ B;  2IX3 A;  1SNO A;  1E22 A;  1I4R A;  3AEV A;  3PO2 G;  1V1P B;  1HQR D;  2JA6 G;  4A93 B;  5M5W B;  4CKB A;  1XTC D;  1B53 A;  1EIH A;  1PZI D;  3MA2 B;  2EY5 A;  3U50 C;  2F0O A;  2XGT A;  1TWF B;  1T5X D;  1E7Z A;  3E3X A;  1LUZ A;  1K3B C;  4F8M A;  3NSW A;  4KY6 A;  3I55 A;  4RGT A;  1K9M C;  3BS1 A;  1PLF A;  4NB3 A;  1C0A A;  2RSN A;  5KNB A;  1ENF A;  4AIM A;  4YCU A;  3AFP A;  3NTH A;  2NTS A;  3DM3 A;  4JI3 L;  2NZH A;  4FXK C;  2JEB I;  1Z7T A;  4BBS H;  1CSQ A;  1H95 A;  3HOW G;  3TS0 A;  1SJH D;  1BO0 A;  3MXN B;  2L15 A;  2RVL A;  4LF6 L;  1PTO F;  5HUR A;  2GVA A;  2L5T A;  4IJH A;  2TMP A;  4ZQ3 A;  4LNQ A;  2A74 C;  3QO2 A;  1SMX A;  1I5F A;  2EYJ A;  4LF5 Q;  3QB3 A;  1E24 A;  1Z6H A;  2A8V A;  1KXL A;  2F3I A;  1SN8 A;  1WCM G;  3HKZ E;  2L4N A;  3AFQ A;  3TP8 A;  3I56 A;  2QW7 A;  1JWM D;  4A3D B;  5IYB G;  2Q2U A;  1SE8 A;  4K14 A;  2NBF A;  3U9O A;  2N8N A;  4P73 A;  3FDT A;  4JI0 Q;  4A4I A;  1YJN A;  5JPN C;  2F03 A;  1S5E D;  1GUO A;  4YWM A;  1M4V A;  5L37 A;  4QB4 A;  1Q46 A;  4LFA L;  2AUK A;  3VDY A;  4Y7N B;  4A3M H;  4A3K B;  1GM5 A;  1E2V A;  3A8I E;  3GV6 A;  4HSP A;  4ZLT F;  2J4X A;  1BBW A;  2MHV A;  3RN2 A;  1VQO A;  1E1T A;  3WDN A;  1ASZ A;  2IT1 A;  4AYB B;  3KBG A;  2JA8 G;  3I4N G;  2A69 C;  2B8F A;  3I3C A;  4JVZ A;  2OTL A;  1STH A;  4KLK A;  4TKO B;  1LTL A;  2AWO A;  4LFB L;  1L2F A;  1EFI D;  3F2U A;  4GN3 B;  2C5C A;  2F0V A;  3LX0 A;  2R7Z G;  2ZM6 Q;  2B2T C;  3FKI B;  4OEM B;  3JAM E;  4B3R L;  5A2Q L;  4B3S Q;  5K36 G;  3F2D A;  2PO4 A;  1TS5 A;  3JC6 6;  2F0I A;  3J80 i;  3SDZ A;  2MJ8 A;  5BR8 L;  4DR5 Q;  1V1P A;  4HMI A;  1CI3 M;  4C1N K;  2PNR C;  2LXJ A;  3CF5 A;  1B9M A;  2B63 H;  4G57 A;  5C44 B;  1VQE A;  4EGV A;  2EZV A;  2KED A;  4X3S A;  1AN8 A;  1ENC A;  2J0T D;  4BXX G;  3TSS A;  1H9S B;  3L3O C;  1NMG A;  4XDX A;  2WP8 J;  4DV1 Q;  1CHQ D;  1FGB D;  4CJ0 B;  2MO0 A;  3PCO B;  4F88 A;  1JE4 A;  1EQQ A;  2UXB L;  1FJG Q;  3FPP A;  4WOR A;  3MEH A;  1PV4 A;  1IBL L;  4FF3 A;  4A93 H;  2QKI C;  5M5W H;  1YJW A;  1O80 A;  4HJ9 A;  3A7L A;  3MXN A;  1TT2 A;  1HR0 W;  4IPG A;  2P5Z X;  3OW2 A;  4TQU S;  1HA6 A;  4GKJ L;  1JMC A;  2NVY B;  2VUM G;  2Z6K C;  1A6X A;  5KNC A;  4E6I A;  1DON A;  2CQO A;  4RA8 A;  1CKM A;  3GP7 A;  2OQ0 A;  4GN4 B;  3GDE A;  3CQZ B;  1U0L A;  2O5J C;  5FO8 B;  1I4H A;  2NZ1 D;  3HS0 C;  3UDF A;  1II3 A;  4KN7 C;  4EQ5 A;  1WD0 A;  3S15 B;  2HIV A;  4A3B G;  1SRO A;  1OXT A;  2EYF A;  2K5N A;  1HZC A;  3J80 E;  1YIT A;  1V9P A;  4BY1 B;  2M2L A;  3MFG A;  4RGM A;  3V2T A;  1A0I A;  4YHH Q;  5C4X G;  1XTD A;  5J39 A;  2HHH Q;  2E2J B;  5JEA G;  3CCR A;  4N8X 1;  3CCS A;  4LF7 Q;  1S5F D;  4A3D H;  5FO7 B;  1JWS D;  2WAC A;  4C3J B;  1F9S A;  3HOU B;  4X64 L;  4JBM A;  3H0G H;  1RTN A;  4JI5 L;  2DJG C;  1EYC A;  3U58 A;  1KDA A;  4O2D A;  2EYM A;  2VZA A;  1W3S A;  1EYG A;  2K4K A;  4QY7 A;  2VQE Q;  5TSS A;  1HH2 P;  2EYL A;  5JAV A;  5COY A;  1D8L A;  4RHR A;  5ELC A;  3A8J E;  5J3B A;  5JJK A;  1E3P A;  4X62 Q;  3FPU B;  4Y7N H;  1IXR A;  1BR9 A;  2BH8 A;  3AQQ A;  4DR2 Q;  1PH5 A;  1WYD A;  3K58 A;  5HY6 A;  1W2B A;  4XT3 B;  1G2T A;  3IKJ A;  4HED A;  1K0S A;  2A69 D;  2DUD A;  2EE1 A;  3S1N B;  4OGQ C;  5E7N A;  5JEA J;  2CKZ B;  2QDB A;  4N9P A;  5KYL A;  1TS4 A;  4K6L A;  1HR0 L;  2Q8R E;  3PO3 B;  2KA7 A;  3J7A 5;  2DNC A;  1EU3 A;  1V1O A;  1VQ8 A;  1C4Q A;  4DV2 Q;  2F0S A;  2K5D A;  2F4I A;  1VMP A;  2UUC Q;  3CC2 A;  1TY2 A;  2EQS A;  5KIX A;  3AU7 A;  2B2Y C;  2RHQ B;  4JW0 A;  1AZQ A;  1QNK A;  4IZ8 A;  1D5Z C;  2RHS B;  1BBU A;  2Z1C A;  1KRT A;  5DM6 3;  4QIW B;  1N9W A;  4DV7 Q;  1AE2 A;  1H9S A;  4H7B A;  3J81 j;  1RDP D;  2F0G A;  1BQQ T;  2E2D C;  1FYC A;  1SLJ A;  3I70 A;  3Q8D A;  3ULL A;  1VQL A;  4KN4 C;  3CCE A;  4RG1 A;  1X55 A;  4HTH A;  1CUK A;  3BZC A;  1Z9F A;  5C44 H;  3TQY A;  1JR0 D;  5FK9 C;  4F87 A;  4EVO A;  4G4K A;  1Q8I A;  3IFD A;  2JJQ A;  5CC4 A;  4A3L H;  2RCN A;  4DV0 Q;  3PV0 A;  3RZO H;  2MO1 A;  1D1K A;  4LK1 C;  2D0P A;  4J8Q A;  3H94 A;  1SAP A;  4ODG A;  1L0W A;  1E0B A;  1WTP A;  2DN8 A;  3S17 B;  1SNQ A;  5IP9 H;  2RF4 A;  1DYQ A;  2PCF B;  1PH2 A;  5LMN Q;  3K7U C;  2YTX A;  4OWX B;  3TZU A;  1PH7 A;  4YY3 L;  4C1N I;  3CU7 A;  1WTV A;  2R3Z A;  3UI2 A;  3TEH B;  3ULP A;  3ND8 A;  1EY7 A;  3H15 A;  3FRP B;  1LO5 D;  2L9H A;  2NZO A;  1PTO B;  2NVY H;  1E1O A;  3J7A V;  1S5B D;  4CHT B;  2JA5 G;  1EEI D;  2ZTD A;  2FMC A;  4A3F B;  4LF6 Q;  5DEH A;  2I0Q A;  3CQZ H;  4P72 A;  4BBR B;  1PYB A;  2EDG A;  1JOR A;  2BOS A;  1KLU D;  1B44 D;  4ZUI A;  3S15 H;  2K03 A;  3KUP A;  1Q3L A;  1B50 A;  4IOC A;  4BY1 H;  1PH9 A;  3KLS A;  2NVX B;  2PQA B;  4KJN A;  1MD2 D;  2R61 A;  4C2M B;  3M3Y B;  5KND A;  4DUY Q;  2E2J H;  1QVC A;  1X3Q A;  3BVG A;  5CYU A;  4K2K A;  5COR A;  3KYH C;  1HZB A;  1XXG A;  4C3J H;  3HOU H;  4BY7 G;  3VYT A;  2MPM A;  4XYQ A;  2FIN B;  1YJ9 A;  5M3F B;  4R4C A;  4LF4 L;  1KRS A;  4RCN A;  1IBM L;  3K5O A;  5LMU L;  2ENB A;  2XSC A;  1B9N A;  4ZKC B;  1PTO C;  1MKH A;  3D0F A;  4X66 L;  1PH6 A;  1SJE D;  5ELO A;  4DR3 Q;  4XIG S;  3SEB A;  3HOZ G;  2VQF L;  2F0K A;  1P8L A;  4MTK A;  1HRJ A;  4R8N A;  4R4O A;  3RLO A;  1TQO A;  1VQI A;  3IL8 A;  2JA7 B;  5EPL A;  1MSG A;  2FFK B;  2O5I C;  2R93 G;  4QL5 A;  3J81 L;  2ZXR A;  3S1N H;  4LFB Q;  3CD6 A;  2N55 A;  4S3S A;  4GKK L;  1QZG A;  3OTO L;  4IPH A;  3PO3 H;  1VCI A;  1PYS B;  3VR4 A;  1VQJ A;  4ILW A;  2F0H A;  3KF6 A;  3TME A;  3CCQ A;  2YTV A;  2HQL A;  4FNF A;  1NMF A;  2A73 B;  1NY4 A;  3CMA A;  5C4H A;  1SEB D;  3NK9 A;  1QE6 A;  1Y14 B;  4IUN A;  1G2S A;  3G6J B;  1PFM A;  1JOK A;  3S2H B;  5BR8 Q;  4IQZ A;  1KDB A;  1U4M A;  3VR2 A;  3G6E A;  4IUQ A;  5C3W A;  4BBS B;  3G4S A;  4P71 A;  1HNX L;  1BCP C;  1LTA D;  2LFN A;  4OO1 I;  3H3V C;  1FNV A;  3HKZ B;  3HOY B;  2ZJP A;  2ASB A;  3R93 A;  4RAU C;  3M9B A;  2B2V C;  2NYZ D;  1TWH H;  1F9R A;  3MEF A;  2KCN A;  4QQB X;  1QUQ B;  4IAL A;  1HUM A;  4DNT B;  3CW2 C;  2EJG C;  1L1O C;  3SK8 A;  1WTQ A;  4DV6 L;  1JOO A;  1NE3 A;  1EWC A;  3S1M B;  4L8J A;  2EJM A;  2NVT B;  2IL8 A;  3IFT A;  2PW5 A;  4DK1 A;  5AJ3 L;  3DEP A;  2K01 A;  1XPU A;  5KYI A;  4K5V A;  1O78 A;  3PIO A;  1PZK D;  2CCZ A;  1DGS A;  2ZJR A;  3KLR A;  1SE2 A;  2JE6 I;  4A3M B;  1EY9 A;  1PTO H;  2PQA A;  4DK0 A;  3CC7 A;  2BCO A;  1K28 A;  3R2T A;  2XNA C;  5D3I B;  3ONA B;  5D3D A;  4IFD H;  4A3F H;  4PMW A;  2PI2 A;  4ME5 A;  3J7Z C;  3K59 A;  2BA0 A;  4BBR H;  3L7Z C;  2EXD A;  5KRU A;  4A3J H;  1IBK L;  1ILP A;  5CGK A;  3T53 B;  2MGS A;  1A2T A;  3R3O A;  1DCZ A;  3PGZ A;  3QIA A;  2E8G A;  2Q2H A;  2NN6 H;  2LY7 A;  2EJF C;  3TP7 A;  3C1E A;  1QVF A;  2K14 A;  4C2M H;  1TXY A;  3M3Y H;  4X64 Q;  1AZP A;  3A5Z B;  1STB A;  1EQR A;  1VQB A;  4DXF A;  3T1Y Q;  1EZ6 A;  1LTT D;  3NBI A;  3I91 A;  3BG3 A;  1XPR A;  1FR3 A;  4CGY B;  4GZY C;  1YHA A;  5IIF A;  3PO2 B;  1DD2 A;  5M3F H;  4JI4 Q;  2JA6 B;  1SYB A;  4MN3 A;  2F4V Q;  2EXZ A;  1G6P A;  5GAE C;  3L2P A;  3HOV G;  5CV7 A;  4OO1 H;  1PTO D;  5FKA C;  1SRU A;  2B63 B;  2HIX A;  1KC8 C;  3H3V H;  4LMQ D;  2RCF A;  4KY7 A;  4JI1 L;  2NWG A;  1XX8 A;  3M4P A;  4UP7 A;  1WVL A;  5IWA L;  4FXG C;  2VXW A;  2VW9 A;  1I94 Q;  2ZTC A;  2RQX A;  3A8K E;  1I50 B;  5IT9 c;  5JJZ A;  2F0J A;  5E4W C;  3E5S A;  3N6R A;  4LF9 L;  2JA7 H;  1EQT A;  4O42 A;  1RD9 D;  3E0J A;  5EKL A;  1OO9 B;  2XIW A;  1Q86 C;  3KF8 B;  4GLX A;  2OTJ A;  1LYL A;  2HQE A;  1OXU A;  1SYG A;  4MIU A;  3SK6 A;  4ZYS A;  5GAD C;  2IY5 B;  2LXK A;  2Z6B A;  1PVO A;  1KDC A;  3KK7 A;  5JJI A;  3C3L A;  2MP1 A;  4OL7 A;  3BYY B;  1A2U A;  3HZX A;  3J7Y W;  3GTK B;  1UUP A;  4DV3 Q;  2WII B;  3OWE B;  3OPO A;  3BDL A;  4IN3 A;  4OHJ A;  2UU9 L;  5C3E H;  4DR6 L;  3BVM A;  3M4Y A;  1QUQ A;  2RKS A;  1HNZ L;  3S2H H;  1BCP D;  4EX5 A;  3LNN A;  1XMO L;  1CKO A;  1J9O A;  3QWN A;  4EQO A;  4CJ1 B;  5EBC A;  1JJG A;  3HOY H;  1HUN A;  1VQ5 A;  1A15 A;  3C1F A;  3I4O A;  2WB1 E;  1GOZ A;  2UXC L;  3I4M G;  1XNR L;  3KDF B;  2UUA L;  3OOC A;  1Y1V G;  1C7Y A;  4CKC A;  3QOJ A;  1PHJ A;  4IPD A;  2Q8T A;  2L11 A;  2K5H A;  3S2D H;  2F0P A;  1HFG A;  4ALP A;  4A93 G;  3H0G B;  5IT9 L;  3MWY W;  2GVB A;  1B3Q A;  5CV8 A;  4KHP Q;  1Y1W H;  2AWN A;  3OSO A;  3P7J A;  1NAP A;  4KJO A;  2UXD L;  3I72 A;  3S1M H;  1TKW B;  2NVT H;  4LAA A;  2IW3 A;  3T13 A;  2O4X A;  5CBE E;  1KTK A;  3PUX A;  2E5L Q;  3RMH A;  1N32 Q;  5BN5 A;  1EOT A;  2LKV A;  5JPM C;  2SNS A;  1V8Q A;  2H5X A;  1UE5 A;  1VQF A;  3E6Z X;  1K8O A;  3D6C A;  3W3A A;  5D14 A;  3HEJ A;  1SYE A;  4OXP A;  3VR6 A;  1VQD A;  1I6V C;  1BCP F;  1ASY A;  4NPS A;  5JOB A;  1ZYR C;  5EQ0 A;  1WTW A;  2XRQ D;  3LGJ A;  1PYW D;  1V43 A;  2Q2I A;  4A3D G;  1TWC B;  1XYI A;  3UE0 A;  2Z4I A;  3A74 A;  5M5Y B;  3ITP A;  2ZJQ A;  1DM0 B;  3P20 A;  5IYD H;  2UUB L;  5KEE A;  1IBM Q;  2A6E C;  1VMC A;  1UEA B;  5IGG A;  5IE8 A;  3PO2 H;  4NXM L;  1JB7 A;  1KAB A;  1RHP A;  2Z0S A;  2JA6 H;  3A56 A;  1NSN S;  4KKT A;  1HXY D;  1Q1E A;  3KF8 A;  4DV4 L;  1HHV A;  2SDF A;  4HCE A;  4A3K G;  4AH6 A;  1WJJ A;  3NEL A;  1N34 L;  4YCW A;  4LFC Q;  5GAG C;  2CFM A;  1GUG A;  4HIK A;  2F0D A;  5E4X A;  2CW0 C;  1XMQ Q;  2V4D A;  1YNJ D;  4DAY B;  2Q2T A;  3RZO B;  1CM9 A;  3PUZ A;  1I50 H;  3SHL A;  1A3V A;  4A3E G;  4JYA L;  4AYB G;  3PIO 3;  4JI6 L;  3C46 A;  4QUC A;  5J22 A;  4A75 A;  1S5C D;  2CH4 A;  4NDX A;  3HGB A;  2A68 C;  3EN2 A;  5C5L A;  3CKI B;  3QOL A;  2QDL A;  1X65 A;  2J7Z A;  1K3R A;  1JQY D;  4RHS A;  3L0O A;  1SNM A;  3M4O B;  1JJC B;  1CSP A;  3KLS X;  3FKI G;  4B3T Q;  4HMJ A;  4C3I G;  3G48 A;  2WAQ G;  1CHP D;  2VB3 X;  3TZD A;  3NBH B;  3GTK H;  4DNI A;  1ONL A;  1X3P A;  3KDF A;  5IYB H;  1HNX Q;  1HNW L;  2B2T A;  5M5X B;  3T16 A;  5C44 G;  2ICI A;  4FO2 A;  2CH4 W;  2Y0S G;  2ZTE A;  1DOL A;  3OWF A;  1JT8 A;  1GKH A;  2B8G A;  1BKB A;  3DM1 A;  5GAH C;  4GLA C;  3TS2 A;  4HAE A;  5FLM H;  1N36 L;  5EKI A;  3CC4 A;  3JAM L;  1K73 C;  4FXD A;  3OW7 A;  3AMU A;  5IP9 G;  1J5E L;  1NTG A;  1M90 C;  4LWC A;  1JOQ A;  4NXN L;  2EY1 A;  2MUY A;  4JI2 L;  4DK3 C;  4LF8 Q;  5LL6 S;  1A62 A;  1SE3 A;  3G71 A;  3NE5 B;  2XWJ B;  1SR3 A;  1TWG B;  2CHB D;  1WOC A;  1N33 Q;  1G6Z A;  2K5W A;  1OTC A;  1IHZ A;  4WRD A;  4P74 A;  4RGO S;  5BN4 A;  3Q6S A;  3MAQ A;  1CKN B;  1E2Z A;  1ICW A;  3D31 A;  1O7I A;  5C0X G;  2AMC B;  1I4P A;  3GTP B;  5I2Y A;  3NPP A;  2K52 A;  4KK7 A;  4WJW A;  4KY5 A;  4UP9 A;  4DR7 Q;  1ZYR D;  2SNM A;  5K36 H;  3SE0 A;  3STB C;  2Z6K A;  3HKS A;  3G7L A;  2OXP A;  1VQ7 A;  3SGI A;  3SXH A;  3WOE A;  4ZKB B;  1PDQ A;  2B2W C;  3J81 i;  2OWO A;  4LUV A;  5C0X I;  5IP7 G;  4JBK A;  1TWC H;  4Z9C B;  1BBX C;  2EIF A;  3P1H A;  4BXX H;  1GO3 E;  5M5Y H;  4DAY A;  1U4P A;  4FP5 D;  2WKD A;  2A6E D;  1D5M C;  4WFN 3;  3GTM H;  1IL2 A;  1NBW A;  2X69 A;  4BA1 I;  2K5V A;  1VQM A;  1PH4 A;  4KHZ A;  5C0X J;  3R8B A;  4JOI C;  4QUF A;  3CRL C;  4JI1 Q;  3W5O A;  1IW7 C;  2E76 C;  3A7A B;  2CW0 D;  1Y8P B;  4RMF A;  2YYZ A;  2D0O A;  1TWH B;  3F2C A;  1AE3 A;  1CTM A;  2D9U A;  4AQY Q;  1EWH A;  1YHB A;  4X6A H;  3KOJ A;  3HP3 A;  2VUM H;  1T5E A;  4FDB A;  4X65 L;  2JN4 A;  3NBH A;  1SNP A;  5M3M B;  2PMZ E;  4RKB A;  5IOC A;  4J15 A;  3EFX D;  4X3T A;  3PO3 G;  5K5P A;  3NUC A;  3E0E A;  2R92 B;  3LWE A;  1Y8N B;  1AFP A;  2NB0 A;  1BUV T;  4A3B H;  4HN7 A;  5F2D A;  3M4O H;  3OYY A;  2BE5 C;  4FF4 A;  3OIP A;  4LF5 L;  4QF4 A;  1WTR A;  3K80 C;  3KFU A;  4UAI A;  1EUJ A;  1EYA A;  1DOK A;  2Y0S E;  4ZK9 B;  1IKM A;  1SYD A;  1F77 A;  5C4X H;  3PIP A;  1HNZ Q;  4HID A;  3HRZ C;  4JI3 Q;  4EQN A;  1UE7 A;  3J81 c;  1SNC A;  4CDD C;  4A3G B;  1I3Q B;  2LS0 1;  1S3O A;  1VF5 C;  2B2Y A;  3MVV A;  2ID0 A;  5M5X H;  1KD1 C;  1TII D;  2D5D A;  2C35 B;  4IPC A;  4QCL A;  4A3J B;  2EOT A;  1HCZ A;  3D4W A;  2KEE A;  4L5Q A;  2A6H C;  2YU9 H;  1Q8K A;  1XNR Q;  3CHB D;  5IY0 A;  1VF7 A;  5LHY 1;  3S9W A;  4IUR A;  1GHJ A;  3KJP A;  1CKN A;  4DF7 A;  2QEJ C;  3W1G A;  3HOZ B;  5IYC G;  1KQS A;  4KD3 A;  4ZAI A;  4F7X A;  5BN3 A;  3MHB A;  5ELN A;  3DEO A;  1UE1 A;  4DR4 L;  3SK4 A;  1F2L A;  1FD7 D;  1I6H B;  4XTC S;  2A19 A;  2NUC A;  3ULJ A;  5FLX c;  1PH8 A;  1EEF D;  1HTL D;  5EPK A;  1YZ6 A;  3HG9 A;  3N52 A;  1SBB B;  3GTG B;  1TWG H;  4PZ6 A;  2FJ2 A;  4LUO A;  3EQL C;  4LFA Q;  2JP1 A;  1DJR D;  4A3C H;  4YIJ A;  3TBI B;  3I8Z A;  1AP0 A;  5FJ8 G;  1BCP B;  3A0J A;  2IX1 A;  3PUW A;  1I4Q A;  2IPK D;  1I4X A;  4NW2 A;  1VQ6 A;  1CT1 D;  1KNA A;  2VL6 A;  3E9H A;  3VYS A;  1LTG D;  1PFN A;  3H91 A;  3T4A C;  4A3F G;  3GTP H;  2VNU D;  1F2Z A;  1H9J A;  4BBR G;  4CDC C;  2F0F A;  3STB D;  4MZ9 A;  4LUZ A;  3I4L A;  4B3S L;  4XQQ A;  2H4O A;  1ILQ A;  1KIX A;  2D62 A;  5G3L D;  3W1B A;  4V0B A;  1YNN C;  4KMU C;  1R9T B;  2NN6 G;  2PQE A;  1GUW A;  1M1K C;  1L1O B;  1SYF A;  1EY6 A;  1CA6 A;  1I4G A;  4DK6 C;  3BDC A;  1AW7 A;  4GNX C;  1PA6 A;  2BH2 A;  1EY8 A;  2FMM A;  2BA1 A;  2QIL A;  1EL0 A;  4B3R Q;  5I6Y A;  2AQ1 B;  1NCV A;  3K81 C;  4R9W A;  3HOX G;  2R6G A;  4ID6 A;  5EGT A;  5J1Z A;  1D2B A;  3NEM A;  2N49 A;  5C3E B;  4K8I A;  2V1C C;  5M3F G;  1GHK A;  4A3I G;  1B7Y B;  1ROD A;  4DV1 L;  4C3H G;  4H02 A;  3K57 A;  4DV4 Q;  3BVZ A;  1IW7 D;  5I9O A;  2F52 A;  1FJG L;  4BWG B;  1N34 Q;  2KUM A;  5FLX L;  3NHH A;  3T1H L;  1H9R A;  1WTH A;  2WB1 B;  5I9P A;  1PFB A;  3URY A;  2JA7 G;  2N3S A;  2KBN A;  1EIG A;  4X3K A;  5E1F A;  1X54 A;  4JV5 L;  2TSS A;  1D7Q A;  1PXU A;  3V96 A;  5E3F A;  5M3M H;  2JA5 H;  3S14 B;  3S2D B;  5G3L F;  4Y52 H;  2UXB Q;  1SFO B;  2SEB D;  2XVS A;  3D4D A;  4DPG A;  1IBL Q;  3PMF A;  2B29 A;  4TRD A;  1Y1W B;  1MHW C;  4R4I A;  1O7Z A;  2R92 H;  3NP8 A;  4I7A A;  2BE5 D;  1EZ8 A;  2BDO A;  3B6Y A;  4GKJ Q;  2NVQ B;  3ERS X;  3MXG A;  1CQV A;  4CDF C;  1S40 A;  1F9Q A;  4DUZ L;  3F8T A;  4GOP C;  4JK1 C;  4YHH L;  2JQO A;  5CV4 A;  1KHI A;  2KHI A;  2HHH L;  1HNW Q;  1HZA A;  2IHE A;  3RD4 A;  4LF7 L;  1QB5 D;  4BBS G;  4A3G H;  1I3Q H;  1X3F A;  1K8A C;  4R8I A;  3F1Z A;  3IAY A;  2JSO A;  1WTO A;  4ZRZ A;  5IGD A;  1X3E A;  1XNQ L;  3O13 A;  4BY7 H;  1ESR A;  1JC7 A;  2I5L X;  5A35 A;  2K28 A;  3NTK A;  2A6H D;  3HKZ G;  5DAU A;  5EKK A;  4B08 A;  5CBA E;  3CPW A;  4HIO A;  1WI5 A;  4UP8 A;  1UEB A;  4J6H A;  3M4Q A;  2VQE L;  3HOV B;  1OXX K;  1B4O A;  1VQ4 A;  1N36 Q;  3MZ5 A;  3AB9 A;  1IZ6 A;  2OF1 A;  5LMN W;  4OIK A;  2ZT9 C;  3A54 A;  1ZXT A;  4X62 L;  4JI8 L;  4NXN Q;  2LSS A;  2XRS D;  1A3U A;  4JI2 Q;  1ZEQ X;  3HOZ H;  4DR2 L;  2K05 A;  5C4J H;  2B2V A;  4JI5 Q;  3E9I A;  1I6H H;  1G91 A;  4M1U B;  3HFZ B;  5NUC A;  4O0A A;  2MQH A;  3Q22 A;  2QF7 A;  1B3A A;  3T56 B;  4PMB A;  2R93 H;  3GTG H;  1K83 H;  1CA5 A;  2HCC A;  4B9W A;  1RCV D;  4U67 3;  2O2L D;  1L1O A;  4TVA B;  1NJI C;  4A3M G;  5ELB A;  1HA5 A;  1B2T A;  3S1R H;  2KEN A;  2VY3 A;  3TRE A;  1LT6 D;  1SDF A;  1LTI D;  5GRO A;  3S1Q B;  4OON A;  2DJF C;  5IT9 E;  1X56 A;  3K5M A;  3QR8 A;  4K6D A;  3FHW A;  3NQT A;  1YNN D;  2KEC A;  2EY6 A;  4DU9 A;  4DV7 L;  3PIP 3;  1MIU A;  3CRK C;  4OWT B;  3SK5 A;  4DNR B;  2F3W A;  1HR0 Q;  2GN5 A;  4DAV A;  2B39 A;  1R9T H;  3HOW B;  1PRT C;  1UWV A;  1K0R A;  1STA A;  2ZXO A;  1TWA B;  1SXT A;  2R7D A;  1LTS D;  2PZT A;  1HTP A;  1YNX A;  4J1M A;  2EY2 A;  4EQP A;  1RJT A;  5IYD G;  1QWY A;  4K2L A;  3I4M B;  1WCM B;  4DV0 L;  4B3M L;  1ZKO A;  1C9O A;  3F2B A;  1SMY C;  1Y1V B;  2A1A A;  3TDQ A;  3NWT A;  3I73 A;  3SR1 A;  1VS0 A; 
#chains in the Genus database with same CATH homology
 2JJQ A;  4A3L H;  3L0O A;  2RCN A;  5GQO A;  1JJC B;  3FP9 A;  1CSP A;  2PNH A;  3PV0 A;  4DV0 Q;  3FKI G;  4HJA A;  4B3T Q;  2B63 G;  2MO1 A;  3G48 A;  4QIW E;  3GTL H;  1XPO A;  2WAQ G;  1B8A A;  2D0P A;  5LMN L;  3NBH B;  3GTK H;  1B70 B;  3CP0 A;  1L0W A;  4R1J A;  3H3V I;  3WWV A;  3UDG A;  1OXV A;  4DNI A;  4X65 Q;  1X6O A;  5IP9 H;  3KDF A;  2RF4 A;  2YV5 A;  5IYB H;  3RN5 A;  4PZ7 A;  1HNX Q;  1HNW L;  1PH2 A;  5LMN Q;  3K7U C;  3CCJ A;  2YTX A;  4OWX B;  1PH7 A;  1MJE A;  3CPF A;  4YY3 L;  5C44 G;  5C3E G;  2K75 A;  3TEH B;  2WFW A;  3ULP A;  3S14 H;  4ME3 A;  3H15 A;  1SFO H;  4GNX A;  2NZO A;  2Y0S G;  3PUV A;  4A76 A;  2ZTE A;  5IYC H;  2NVY H;  1E1O A;  3JAM i;  2MNA A;  4YY3 Q;  1JT8 A;  1A63 A;  2JA5 G;  3S17 H;  1GKH A;  2QGQ A;  2ZTD A;  1BKB A;  1J6Q A;  4YCV A;  5GAH C;  4GLA C;  4JG2 A;  4LF8 L;  3TS2 A;  4LF6 Q;  2QEX A;  5FLM H;  1N36 L;  2I0Q A;  2E2I H;  3CQZ H;  2WB1 G;  1Q82 C;  4P72 A;  2NVQ H;  3CC4 A;  1K73 C;  1PYB A;  3HOY G;  4JI7 L;  1N33 L;  5IP9 G;  1J5E L;  1NTG A;  3A5U A;  4LWC A;  1M90 C;  4NXN L;  4JI2 L;  3S15 H;  4APV A;  4DK3 C;  4DUY L;  4LF8 Q;  3GO5 A;  1A62 A;  1EOV A;  5FJ8 H;  4JBJ A;  3G71 A;  1Q1B A;  1SR3 A;  2K50 A;  1VQN A;  1UE6 A;  4IOC A;  1JJ2 A;  4BY1 H;  3CXC A;  1PH9 A;  3GTQ H;  2PQA B;  1WOC A;  1N33 Q;  1J5E Q;  3U4Z A;  2JEA I;  1OTC A;  4L5R C;  4DUY Q;  4GLV B;  1YIJ A;  1Q81 C;  4P74 A;  2E2J H;  1QVC A;  3M85 A;  1CKN B;  1Y1W G;  4DR7 L;  3D31 A;  1O7I A;  3KYH C;  5C0X G;  3K0X A;  1JE5 A;  1HZB A;  2DGY A;  2AMC B;  4C3J H;  2AHO B;  3CAM A;  1Q7Y C;  5FLM G;  3ZJY C;  3HOU H;  3HOV H;  4BY7 G;  4PZ8 A;  2KCM A;  2K52 A;  3CCL A;  1YJ9 A;  3KJO A;  4R4C A;  4UP9 A;  1FL0 A;  2NVX H;  3U4V A;  1KRS A;  4LF4 L;  4DR4 Q;  4DR7 Q;  1U5K A;  4DR3 L;  1IBM L;  3STB C;  5LMU L;  3H0G G;  4K0K L;  2Z6K A;  3HKS A;  4DV2 L;  2JK8 A;  2UUC L;  4MTN A;  1VQ7 A;  3RLN A;  3SGI A;  1MKH A;  4LF4 Q;  3D0F A;  4X66 L;  1PH6 A;  5JJL A;  5ELO A;  4DR3 Q;  4XIG S;  4R4Q A;  3I7F A;  3HOX H;  3HOZ G;  5LMU Q;  2VQF L;  1P8L A;  2PI2 E;  3CCV A;  3J81 i;  4DR1 L;  4GOP A;  1EIY B;  4WJ4 A;  4R4O A;  3RLO A;  4LUV A;  4DV5 L;  2OWO A;  1VQI A;  5C0X I;  5IP7 G;  5H1S E;  1TWC H;  4JBK A;  4A3I H;  4UPA A;  4X66 Q;  2EIF A;  4C3H H;  4HJ5 A;  4BXX H;  1GO3 E;  5M5Y H;  2R93 G;  2VQF Q;  4QL5 A;  3JAM c;  3CCU A;  3S1N H;  4LFB Q;  1T9H A;  3CD6 A;  3EBE A;  3BU2 A;  4KI0 A;  3GTM H;  5DLQ E;  3BJU A;  4GKK L;  1QZG A;  3OTO L;  1NBW A;  4OX9 L;  4BA1 I;  1IL2 A;  2K5V A;  1VQP A;  4IPH A;  1VQM A;  1VCI A;  1PYS B;  4IJL A;  1HJP A;  4GS3 A;  4PG3 A;  1FGU A;  1VQJ A;  4KHZ A;  5C0X J;  2AKW B;  3KF6 A;  1G29 1;  4LW1 A;  3CCQ A;  3PF5 A;  4JOI C;  3CCM A;  2YTV A;  4JI1 Q;  2HQL A;  4AQY L;  5EAY A;  1PH1 A;  1IYJ B;  1NMF A;  3W5O A;  4HIM A;  1NY4 A;  4GKK Q;  3OTO Q;  3CMA A;  1E22 A;  4L5S A;  3AEV A;  3ER0 A;  3PO2 G;  4RMF A;  2YYZ A;  1Y14 B;  3HOW H;  2D0O A;  2JA6 G;  3F2C A;  1MJC A;  1AE3 A;  1VQH A;  4AQY Q;  5BR8 Q;  1GVP A;  1YHB A;  1G51 A;  4X6A H;  3G6E A;  1TWA H;  3KOJ A;  2VUM H;  3U50 C;  2XGT A;  4FDB A;  4X65 L;  3G4S A;  4P71 A;  1E7Z A;  4YWL A;  1XJV A;  1HNX L;  2PMZ E;  1Z47 A;  2JA9 A;  3K8A A;  1LUZ A;  3I4M H;  4OO1 I;  1WCM H;  4J15 A;  3I55 A;  3PO3 G;  1Y1V H;  1K9M C;  4NB3 A;  1C0A A;  2ZJP A;  2ASB A;  4AIM A;  1RIP A;  3E0E A;  3AFP A;  3M9B A;  4YCU A;  1TWH H;  1N32 L;  4JCV E;  3MEF A;  4A3B H;  3S1Q H;  1FVI A;  3M4O H;  3DM3 A;  3NEN A;  4JI3 L;  3DLL A;  3T1H Q;  4QQB X;  4A93 G;  3I2Z A;  2NZH A;  1QUQ B;  3OYY A;  2JEB I;  4LF5 L;  4BBS H;  1CSQ A;  1TWF H;  3HOW G;  1H95 A;  3K80 C;  3TS0 A;  3KFU A;  3CW2 C;  1EUJ A;  2Y0S E;  3MXN B;  2L15 A;  4LF6 L;  4UY8 C;  2GVA A;  3K7A H;  5C4X H;  4IJH A;  3PIP A;  1HNZ Q;  4A3L G;  1L1O C;  4DAM A;  4LNQ A;  4HID A;  4JV5 Q;  4JI3 Q;  3J81 c;  1UE7 A;  2XTI A;  1SMX A;  1I5F A;  4DV6 L;  4LF5 Q;  1NE3 A;  3UDX A;  1S3O A;  1E24 A;  1KXL A;  2A8V A;  2F3I A;  1SN8 A;  1WCM G;  3HKZ E;  2ID0 A;  1KL9 A;  5M5X H;  3AFQ A;  1KD1 C;  3I56 A;  1YVC A;  5AJ3 L;  4L5T A;  2C35 B;  4IPC A;  1XPU A;  2KCT A;  1VQ9 A;  5IYB G;  3PIO A;  4DV6 Q;  1SE8 A;  2CCZ A;  2Q2U A;  2UXC Q;  1DGS A;  4L5Q A;  3GTJ H;  2N8N A;  2ZJR A;  2YU9 H;  1Q8K A;  2JE6 I;  4P73 A;  1XNR Q;  2PQA A;  4JI0 Q;  4A4I A;  1EIF A;  3CC7 A;  2KHJ A;  5IY0 A;  2I5M X;  3J80 c;  5AJ3 Q;  4DUZ Q;  1YJN A;  4YWK A;  1HZ9 A;  2JA8 H;  3KJP A;  2IHF A;  3I4N H;  1CKN A;  4YWM A;  4A3F H;  4PMW A;  2PI2 A;  3W1G A;  5IYC G;  1KQS A;  3J7Z C;  2BA0 A;  1K8G A;  4BBR H;  3GD7 A;  3L7Z C;  3BZK A;  1Q46 A;  5ELN A;  2EXD A;  1UE1 A;  4LFA L;  4DR4 L;  4A3J H;  1IBK L;  4JBW A;  4XTC S;  1VQA A;  2A19 A;  3ULJ A;  5FLX c;  3PGZ A;  1PH8 A;  3VDY A;  2R7Z H;  2E8G A;  2Q2H A;  4P75 A;  4A3M H;  1XNQ Q;  1GM5 A;  1YZ6 A;  1TWG H;  2MFI A;  4PZ6 A;  3T1Y L;  1PFS A;  4LUO A;  4LFA Q;  1IBK Q;  4A3C H;  1QVF A;  2K14 A;  4C2M H;  1BBW A;  3RN2 A;  1TXY A;  1E1T A;  5FJ8 G;  3A0J A;  1VQO A;  1ASZ A;  2IX1 A;  3M3Y H;  4X64 Q;  2IT1 A;  3RZD H;  3A5Z B;  4BY1 G;  4JI4 L;  1EQR A;  3PUW A;  1VQB A;  1S72 A;  1V1Q A;  3T1Y Q;  1VQ6 A;  2F4V L;  2VL6 A;  2JA8 G;  3I4N G;  3E9H A;  4A3F G;  2OTL A;  2VNU D;  1XPR A;  4JI8 Q;  3GTP H;  1AH9 A;  1YHA A;  4KLK A;  4A3K H;  1YI2 A;  1LTL A;  2AWO A;  4BBR G;  1L2F A;  4LFB L;  3STB D;  4MZ9 A;  2VS1 A;  4LUZ A;  5M3F H;  3AYH B;  4GN3 B;  4B3S L;  4JI4 Q;  2F4V Q;  1G6P A;  5GAE C;  3L2P A;  1KIX A;  2D62 A;  1I94 L;  3HOU G;  3W1B A;  3HOV G;  2R7Z G;  1SRU A;  2NN6 G;  2ZM6 Q;  1YEZ A;  2HIX A;  1KC8 C;  3H3V H;  4A3E H;  1M1K C;  2QA4 A;  1L1O B;  4JI1 L;  3M4P A;  4UP7 A;  4B3R L;  4DK6 C;  5IWA L;  4B3S Q;  2ATW A;  4A3C G;  5K36 G;  1QVG A;  2VW9 A;  3RZO H;  3F2D A;  1I94 Q;  4GNX C;  2ZTC A;  3JC6 6;  1PA6 A;  4AYB E;  2BH2 A;  1P16 A;  5IT9 c;  1EFW A;  2IX0 A;  3J80 i;  2BA1 A;  4LF9 L;  2JA7 H;  4B3R Q;  5BR8 L;  4DR5 Q;  3K81 C;  5IWA Q;  2LXJ A;  2N78 A;  3HOX G;  3CF5 A;  3S24 A;  2R6G A;  2B63 H;  3FKI H;  3NEM A;  1Q86 C;  2N49 A;  3KF8 B;  4C3I H;  1VQE A;  2V1C C;  4GLX A;  2OTJ A;  5M3F G;  1LYL A;  4LF9 Q;  4A3I G;  2CWP A;  1B7Y B;  1OXU A;  4DV1 L;  1Q12 A;  4H02 A;  3EIV A;  4DV3 L;  1PH3 A;  5GAD C;  4DV4 Q;  4BXX G;  2IY5 B;  2LXK A;  2WAQ E;  4WJ3 M;  1PVO A;  2F52 A;  4HJ7 A;  5JJI A;  1FJG L;  1N34 Q;  1NMG A;  2WP8 J;  3KF6 B;  3T1H L;  4DV1 Q;  2MO0 A;  3PCO B;  4DV3 Q;  2UU9 L;  4DR6 L;  5C3E H;  1EQQ A;  2JA7 G;  2UXB L;  1FJG Q;  2N3S A;  1YBY A;  2KBN A;  3M7N A;  3PO3 H;  1QUQ A;  1PV4 A;  1HNZ L;  1IBL L;  1X54 A;  3RLF A;  3S2H H;  4A93 H;  5M5W H;  4JV5 L;  1D7Q A;  1YJW A;  4HJ9 A;  4B3M Q;  4EX5 A;  1HR0 W;  5M3M H;  2UU9 Q;  4IPG A;  2JA5 H;  4DR6 Q;  1XMO L;  4Y52 H;  3S16 H;  3OW2 A;  2UXB Q;  4TQU S;  1VQK A;  4DPG A;  1CKO A;  4GKJ L;  1IBL Q;  3ICE A;  1JMC A;  1WFQ A;  2VUM G;  2Z6K C;  2B29 A;  1JJG A;  2OCE A;  3HOY H;  1VQ5 A;  2CQO A;  4R4I A;  1N8R C;  2R92 H;  1CKM A;  2FXQ A;  3I4O A;  2OQK A;  2WB1 E;  1XMO Q;  1BVS A;  1X9N A;  1QZH A;  1XNR L;  2OQ0 A;  3I4M G;  4JI0 L;  4GN4 B;  2UXC L;  3B6Y A;  3KDF B;  3GDE A;  3UDI A;  2UUA L;  4GKJ Q;  1Y1V G;  3ERS X;  1U0L A;  1S40 A;  1C7Y A;  4KHP L;  4DUZ L;  3F8T A;  3KLW A;  4R4T A;  3UDF A;  1X3G A;  3CME A;  4GOP C;  1PHJ A;  4IPD A;  3RR5 A;  3S2D H;  2K5H A;  4YHH L;  4EQ5 A;  2JQO A;  2HIV A;  1KHI A;  2KHI A;  4HJ8 A;  1SRO A;  1OXT A;  4ALP A;  2HHH L;  3GTO H;  1HZA A;  4A3B G;  4IOA A;  2E5L L;  1HNW Q;  2UUA Q;  2GVB A;  2IHE A;  4LF7 L;  2K5N A;  1HZC A;  4JOI A;  4GNX B;  1YIT A;  1V9P A;  2AWN A;  1Y1W H;  5M3M G;  4BBS G;  4KHP Q;  4IO9 A;  4A3G H;  1I3Q H;  1X3F A;  1K8A C;  2UXD L;  3PSI A;  3F1Z A;  3S1M H;  1A0I A;  4YHH Q;  5C4X G;  1X3E A;  1LM0 A;  1XTD A;  1XNQ L;  2NVT H;  1KAW A;  4QGU A;  3UE1 A;  2HHH Q;  4BY7 H;  2I5L X;  5JEA G;  3CCR A;  3PUX A;  2E5L Q;  3HKZ G;  3CCS A;  1VQC A;  4LF7 Q;  1N32 Q;  4JC0 A;  4A3D H;  2R92 G;  3CPW A;  4HIO A;  1WI5 A;  2UXD Q;  4UP8 A;  1UEB A;  3M4Q A;  2VQE L;  1OXX K;  4X64 L;  1VQ4 A;  4JBM A;  2H5X A;  3H0G H;  1YHQ A;  1N36 Q;  1UE5 A;  1VQF A;  1IZ6 A;  2ES2 A;  4DKA C;  4JI5 L;  5LMN W;  4OXP A;  3U58 A;  1VQD A;  3RNU A;  4JI7 Q;  3PF4 A;  4MNO A;  4QJF A;  4O2D A;  4X62 L;  2VZA A;  3TRZ A;  4JI8 L;  4NXN Q;  2LSS A;  1ASY A;  1W3S A;  2CWA A;  4NPS A;  2K4K A;  4JI2 Q;  4QY7 A;  2VQE Q;  1EYG A;  3HOZ H;  4DR2 L;  5C4J H;  1HH2 P;  2YTY A;  4JI5 Q;  3E9I A;  1D8L A;  5IP7 H;  4A3G G;  1I6H H;  3HFZ B;  4O0A A;  3LGJ A;  5J3B A;  2MQH A;  4IFD G;  5JJK A;  1E3P A;  1V43 A;  2Q2I A;  4X62 Q;  2ZM6 L;  4Y7N H;  2B3G A;  1IXR A;  2R93 H;  2BH8 A;  1RL2 A;  1K83 H;  3AQQ A;  4DR2 Q;  1WYD A;  1PH5 A;  3GTG H;  4A3J G;  4A3D G;  5HY6 A;  1W2B A;  1L1O A;  4TVA B;  4OWW B;  1NJI C;  3UE0 A;  4A3M G;  3A74 A;  2ZJQ A;  2DUD A;  1A8V A;  3S1R H;  2KEN A;  2VY3 A;  3TRE A;  4POF A;  4DR5 L;  5E7N A;  5JEA J;  2CKZ B;  4GN5 A;  1HR0 L;  5IYD H;  2UUB L;  4BA2 I;  5GRO A;  1IBM Q;  4OON A;  3J7A 5;  1VQ8 A;  1X56 A;  5IE8 A;  3PO2 H;  3PUY A;  4K0K Q;  4DV2 Q;  4LFC L;  4NXM L;  3FHW A;  2UUC Q;  2R7F A;  2Z0S A;  1XMQ L;  1JB7 A;  3CC2 A;  2JA6 H;  4IFD I;  4DV7 L;  1MIU A;  2EQS A;  4OWT B;  1Q1E A;  4GOP B;  1HR0 Q;  4DV4 L;  2GN5 A;  2UUB Q;  2RHQ B;  2ALY B;  1R9T H;  4A3K G;  4POG A;  4AH6 A;  1WJJ A;  3NEL A;  4DR1 Q;  2RHS B;  4YCW A;  1N34 L;  5GAG C;  1BBU A;  2CFM A;  4HIK A;  4LFC Q;  4NXM Q;  4DV5 Q;  1XMQ Q;  1KRT A;  1UWV A;  4DAY B;  1K0R A;  1N9W A;  1AE2 A;  4DV7 Q;  5HGQ A;  1OXS C;  2NN6 I;  1VQG A;  2Q2T A;  3PUZ A;  4OO1 G;  3J81 j;  1I50 H;  2R7D A;  1GD7 A;  4A3E G;  1EWI A;  4IFD J;  1PH4 A;  4JYA L;  4AYB G;  1SLJ A;  4JI6 L;  1YNX A;  3Q8D A;  2HT1 A;  3ULL A;  1VQL A;  2I5H A;  5IYD G;  3CCE A;  4RG1 A;  1X55 A;  4DV0 L;  4A75 A;  4B3M L;  1CUK A;  1C9O A;  3BZC A;  4OX9 Q;  3IRB A;  3F2B A;  1Z9F A;  4B3T L;  3EN2 A;  5C44 H;  3TQY A;  2A1A A;  4JYA Q;  2E2H H;  4JI6 Q;  1X65 A;  1K3R A;  1VS0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...