1WTWA

Hyperthermophile chromosomal protein sac7d single mutant v26a in complex with dna gcgatcgc
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
66
structure length
66
Chain Sequence
MVKVKFKYKGEEKEVDTSKIKKVWRAGKMVSFTYDDNGKTGRGAVSEKDAPKELLDMLARAEREKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/dna
molecule keywords 5'-D(*GP*CP*GP*AP*TP*CP*GP*C)-3'
publication title Probing the DNA kink structure induced by the hyperthermophilic chromosomal protein Sac7d
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
total genus 13
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2004-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02294 7kD_DNA_binding 7kD DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1wtwA00
2Q8RE 2SDFA 4HCSA 5COYA 1ESRA 3KBXA 1QG7A 2X6LA 4R8IA 1EQTA 1B50A 1HUNA 4U68A 2RSOA 1WTPA 1WVLA 2BDNA 5D65A 1CA5A 1WTOA 3I91A 1SDFA 4X3SA 2RVLA 4X3UA 1BF4A 5DNFA 2FMMA 2B2YA 2B2VA 3FPUB 4XT3B 1NR4A 2KECA 4IUQA 2FINB 2K04A 1DOLA 5E4XA 1DZ1A 4HAEA 2X69A 4CJ1B 1QNKA 1A15A 4IUPA 1B3AA 1XYIA 1CM9A 1VMCA 3ONAB 2L11A 4IUTA 1J9OA 1AZPA 1PFMA 1HUMA 1B53A 1TVXA 3DEPA 4DN4M 5EQ0A 2HUGA 3N52A 1X3QA 2KUMA 1HFGA 3UI2A 5EJWA 1WTQA 1ILQA 1DONA 4HSVA 2FJ2A 2H1EA 1HHVA 1IL8A 2N88A 4XT1B 1F9SA 3IFDA 3Q6SA 4XDXA 5EKIA 3R93A 4ZAIA 5EPLA 2MGSA 1EL0A 2NWGA 3I3CA 1KNAA 1RODA 1MSHA 2KEDA 1XX8A 2L4NA 4QUFA 1IKMA 4ZKBB 1U4LA 2B2WC 3GV6A 1ICWA 1MGSA 2B2YC 2B2VC 1SAPA 4ZK9B 1C8CA 2EPBA 2B2WA 3P7JA 4HEDA 1PFNA 1F2LA 2X6GA 3HP3A 4MHEA 1KNEA 1HA6A 2K1BA 2B2UA 1RJTA 2K03A 3TZDA 1WTWA 3IL8A 1BBXC 2K05A 1X3PA 1LV9A 3MWYW 2NZ1D 5EPKA 2KVMA 1F9PA 1U4RA 1F9QA 2FHTA 2HCIA 1B4OA 2HDMA 2DY8A 3LWEA 1EIHA 1EIGA 1PLFA 1HRJA 1DOKA 2K01A 1IKLA 5E4WC 2Q8TA 1EOTA 4RAUC 1WTVA 4IURA 2EOTA 4NW2A 1NR2A 4ZKCB 2NYZD 3FDTA 2KEEA 5AFWA 3D6WA 5D14A 4CJ0B 1J8IA 4X3TA 4MN3A 2HCCA 2JYOA 2M2LA 1WTRA 3F2UA 1G6ZA 4O42A 1BO0A 4UAIA 1F9RA 2HDLA 2B2TC 4CJ2C 4X3KA 1WD0A 2B2TA 4IUUA 2B2UC 5CMDA 3H91A 3SVMA 4RWSC 1QE6A 5CBAE 4R9WA 1E0BA 2DY7A 1CA6A 1VMPA 1MSGA 3I90A 5T1GA 1PFBA 5CORA 1X32A 2L9HA 2MP1A 1WTXA 3G7LA 1G2SA 1JICA 4QUCA 2VXWA 5T1IA 2EE1A 2J7ZA 3I8ZA 1U4MA 4OIKA 4ZLTF 1B2TA 2D9UA 2RA4A 3QO2A 2L1BA 2R3ZA 1ML0D 2KOLA 2XIWA 3GV3A 4LMQD 4OIJA 1RHPA 1NCVA 1PDQA 2L12A 1U4PA 1SSOA 1O7ZA 2CVRA 1RTOA 4IUVA 1RTNA 3TN2A 3DM1A 1AZQA 4RA8A 1ZXTA 2K28A 1S4ZA 1ILPA 1O7YA 1MI2A 1AP0A 3DEOA 2IL8A 1GUWA 1BNZA 1NAPA 1O80A 1M8AA 1G91A 1Q3LA 1DOMA 2MPMA 1WD1A 2MJ8A 1G2TA 5CBEE 1HFNA 5EPJA 2N55A 2RSNA 3KUPA 2FFKB 2JP1A 5JJZA 1JE4A 3MTSA
chains in the Genus database with same CATH superfamily
2YTYA 4A93B 1V1OA 1SNPA 4KD4A 1CA5A 4JI0Q 3CMAA 4JI7Q 5C5MA 4A3FG 2F0KA 1H9MA 5IT9E 4KJOA 2B2VA 2PNHA 4A3DB 4CDEC 1I4QA 2A6HD 2K04A 5BN3A 2KQ3A 1ET9A 1CSPA 2A6ED 4FP5D 5D3IB 5FK9C 1HQMC 1BCPB 1F2YA 1YIJA 1XPRA 1AZPA 3PMFA 5AJ3L 2KJXA 2HUGA 1LT5D 1A3UA 4KV6A 5CV9A 4B9XA 1EY4A 3BS1A 2F0SA 2VB2X 2E5LQ 4DKAC 3SHLA 1YJNA 3NENA 5LMNW 3MFYA 2AKWB 1SN8A 2ENBA 2MUYA 4DAYA 3GTGB 1E3PA 1W6JA 3D6CA 3GTJH 2N49A 5IP7G 1R4PB 1S5ED 4Z9CB 2PZTA 1ZEQX 5BN4A 4DV3L 3S16B 1GUSA 1GJXA 4R4TA 1YNND 4WJ3M 4OO1I 4O0AA 2PO4A 5D14A 1TWFH 4RGOS 3KYHC 3X3NA 2HCCA 4A3JB 3K80C 4H7BA 2M00A 5G3LF 5K5PA 4F7XA 4CDDC 2C35B 2JE6I 3BG3A 3PUWA 1ICFB 4RWSC 5CBAE 3HGBA 4TQUS 5C3WA 2EYJA 4LF4L 1JWMD 2L9HA 3HS0C 4YY3L 1DM0B 5M5YB 3PV0A 3KDFA 1N34L 2J7ZA 2D9UA 5EPKA 4LMQD 3T13A 1G2TA 2VQEL 1CFMA 3UDXA 2UUBQ 1B9NA 1AFPA 1N32Q 1MJCA 1YZ6A 3LGJA 4HIDA 4KHVA 4C3HB 3DEOA 1CTMA 2CH4W 2I0QA 1RD9D 1VQJA 1YHBA 3FHWA 3PUVA 2JP1A 5JJZA 1NSNS 3A8KE 4GN3B 5COYA 4RG1A 1N8RC 2AMCB 2R93G 4G7ZC 2YU9H 5IYDH 3K58A 1ENAA 4V0BA 5EBCA 2CW0D 5E7NA 2ID0A 2KECA 1TWCH 1DOLA 3PUYA 1UNSA 4DV5L 1R4QB 4K8JA 5EAYA 4CJ1B 5FLXE 3K5MA 2PZWA 5J39A 5M3FH 2ZXPA 2EJFC 1R9TH 3I4MG 1C48A 3TRZA 2H1EA 5J3BA 5IGDA 3IFDA 2CQAA 2MGSA 3I3CA 1LT4D 2H5XA 1JR0D 1UAPA 4JI0L 2QKIC 1Q12A 3GV6A 4GOPB 2B2YC 4JI7L 4A3CH 3GTMB 3A56A 3L7ZC 5IOCA 1DXMA 4LUVA 1F2MA 1PVOA 4LF6Q 1PRTD 4UHVA 1RIPA 1HXYD 1F9PA 4TVAB 1BUVT 3LWEA 2DY8A 3TQYA 4A3IB 4IJHA 2E2IH 2K5DA 1XNRQ 2EY2A 3MFGA 3PO2G 3RLFA 4X64Q 1PTOH 1X3FA 2F0HA 1I6VC 5D3DA 2KEEA 3T4AC 1Q1EA 3Q22A 1PYWD 2E5LL 1NE3A 1HNWQ 3I4NH 2TSSA 3CKIB 4X3KA 1Y1VB 5KNCA 4B3TL 3PO3H 4IUUA 3W2DA 3IRBA 3DLLA 1VMPA 4C3JB 1PFBA 4QJFA 1JICA 3I8ZA 2R7ZG 4N9PA 2NVQH 4PZ6A 3DWPA 1SE2A 2ALYB 1RHPA 2LY7A 5LMNL 3K0YA 3EQLC 5KGUA 4DV0Q 3T53B 4OWWB 4IUVA 1VQMA 3GO5A 1AE2A 3NBHB 4P2CB 1V1PA 2D62A 4J15A 5C5LA 1PH1A 1YVCA 1KABA 2MPMA 2MJ8A 4NB3A 1EY5A 1D2BA 4YCWA 4ZQ3A 3S2DH 4BXXH 5IYCH 1WCMB 2HQLA 4IFDG 1LTID 2PZUA 1GKHA 2VQFQ 4R8IA 1B50A 1S5BD 1IL2A 1C9OA 1JC7A 2I07B 2PQAB 1WVLA 3CCVA 3IFTA 3LX0A 1SDFA 3FVQA 3K81C 4FXGC 1N33Q 4IUQA 4N9TA 3L9AX 4OELB 1AE3A 4OWTB 3EJIA 1YHAA 2Q8IB 5EBDA 3C1EA 3GTQH 1EQVA 4IALA 3OIQA 3UI2A 4L6TB 2B63G 1D8LA 2FJ2A 4DAVA 2F0WA 1B7YB 4ZAIA 1HZCA 2F3VA 4QUFA 3CRKC 2LSSA 2EPBA 3ULPA 3OSOA 1HZ9A 1JB3A 2XGTA 1SMYD 3NWTA 2WV6D 5M9OA 1ASZA 1VQ7A 4UDUC 4P72A 2PMZE 3CRLC 2Y0SE 3OHXC 4HN7A 2A1AA 1SYDA 2WKCA 5IGCA 4RKBA 4QB4A 4A3KG 1S5DD 1J8IA 2P5ZX 3GTJB 1LTSD 4P73A 4BBSH 3J7YW 3BVMA 4LF5L 2RHQB 4UP7A 1SROA 1LTAD 1O7IA 4A3GG 1GUOA 1SR3A 2NTTA 4ZLTF 1EYDA 4CKCA 2RA4A 5ELCA 4AYBG 1ML0D 4P74A 1PDQA 1AW7A 5F2DA 3U58A 2HHHQ 3JAMi 4B9WA 3ZJYC 4CBVA 4AQYQ 1SBBB 2NVYH 2UXCQ 1KRSA 1HNWL 4IFDI 2IY5B 1H9SA 1VQFA 3D3RA 1HA5A 5I9PA 4KKTA 1Q86C 5C44G 3HOXH 4GLXA 2I5HA 5GQOA 4A3MB 4FXKC 2SDFA 4A93G 1CKNB 3J7AF 2RBMA 4X66Q 2IX3A 1XXGA 1LM0A 4X6AH 4A3DG 5E4XA 4YIJA 4J6HA 1N36Q 1VQ8A 2SNSA 3VYTA 3G71A 1D5ZC 1AEXA 3RLNA 2YU9B 2BCOA 1D6EC 1K0SA 2OQ0A 4DNRB 3FEWX 3G6EA 1TWCB 3U9SA 4KN7C 2EXZA 4XDXA 5ELEA 2VQFL 3GQBA 3SDZA 5ELNA 1IW7C 1PZKD 1JORA 4KKUA 1R9TB 1PYSB 3CCEA 2X6GA 1KNEA 1XPUA 5I2YA 3KDFB 5GAEC 1LV9A 2HT1A 3KJOA 4IPHA 4FNFA 1DOKA 4XQQA 2K01A 3VR6A 5E4WC 3MXNA 2IHEA 2K5HA 4EQNA 4CJ0B 4XYOA 4X3TA 1TS2A 4XTCS 2XNAC 4A3JG 2MHVA 3D4RA 3VR2A 1BCPD 1CQVA 1L1OA 2E2IB 1A8VA 1CI3M 1BOSA 4DR6Q 2R92H 3HG9A 1NMFA 1V1QA 2ZTDA 3OMCA 3PIPA 1LUZA 3R2IA 3U50C 2MFIA 4YCVA 3CP0A 1EEFD 3J80L 1H95A 3I4NB 2EVBA 1SNCA 1KAAA 3BDCA 4BY7G 1EY7A 1MIUA 3J80c 3RNUA 1X54A 2O5JC 3PO3B 1A2UA 2RCFA 1PH4A 4DNTB 1T9HA 4C3IG 2GVAA 2UU9L 3EA6A 2Z6KC 3DM1A 1TWHH 3IAYA 4RA8A 1EY9A 1IHZA 4GNXA 4C3HG 1YJ9A 4WFN3 2FMCA 2WB1B 2QGQA 3OTOQ 1KC8C 5DLQE 4OX9Q 5KYLA 2NVQB 1O80A 2NVTH 1K8GA 1L2FA 1VQ5A 4K5XA 3KUPA 3I73A 2DJFC 4O42A 3STBD 4EVOA 2R7DA 3CQZH 1Y69U 1UWVA 3NE5B 4HR7B 1I94L 1RCVD 3CCRA 1ZYRD 2EZVA 5I2XA 2BDNA 1OTCA 1I6HH 1VS0A 3S2DB 5DNFA 1PMRA 4IUNA 2EY5A 2HHHL 4JYAL 3ICEA 2UUAQ 3V96A 1TU2B 2QW7A 1N9WA 1S5CD 4KY6A 3WOEA 1SRUA 5AJ3Q 5CYUA 4DN4M 1EYGA 3URYA 4K8IA 3SR1A 1OXUA 1QUQA 4IN3A 4FO2A 2VY3A 2K50A 3W5OA 3R93A 3TP6A 2OEOA 1BDOA 4Y7NH 3DHQA 3RZOB 3BZDB 3TZUA 1MSHA 4A3LG 1IBLL 1UUPA 1U4LA 5IGFA 4DFAA 4DV7L 4JI1Q 1WJJA 1QB5D 1C0AA 3Q0AA 1CK1A 4DV3Q 1KQSA 4A3IG 2UXDQ 3FKIG 1IKLA 5I9OA 2Q8TA 3K57A 4JOIC 1HR0W 4JOIA 1V1PB 2NBFA 3E0EA 4H02A 3KLRA 2M2LA 3WOFA 2VZAA 1A63A 1HH2P 2O2LD 2A73B 1K0RA 4UAIA 2K75A 1S40A 2Y0SB 4R4IA 4JBJA 4DV2L 2IT1A 1SJED 4A3BH 1IXRA 3ITPA 3KF6A 1FNUA 4LF4Q 1TXYA 4RCOA 3J81j 5CORA 1NUCA 5C3EH 1HR0Q 4BBSB 1N34Q 4DXGA 4OWXB 1T5XD 4RCNA 1MD2D 1XTDA 4RH6A 2LS01 3K5OA 3JAME 3H0GH 5K36H 3H3VH 1BKBA 2LMCB 2YV5A 4DR6L 2XTIA 4OO1G 1S3OA 2PNRC 5GADC 1DOMA 5C3XA 2BE5C 1K28A 1HFNA 4NPSA 5CV8A 5FLMH 3O13A 3QWNA 3MEHA 1WCMG 1E2WA 3EIVA 3MTSA 1P16A 4L5RC 1W2BA 2EYPA 1B1ZA 1WTPA 3SK6A 1LLRD 1STYA 4QCLA 2D2CC 2SNMA 2FMMA 5C0XI 5A2QL 1K9MC 1QJOA 3K6OA 1CM9A 3ONAB 2RKSA 1B3QA 5C4JB 1YNJC 3NELA 4PNYA 1SNDA 5EQ0A 3E9HA 3OOCA 5EJWA 1WTQA 2J4XA 1HNZQ 2JK8A 4R1JA 3SGIA 2B2WC 1EZ8A 2HD3A 2B2VC 2B2WA 4G7OC 3S17H 4TRDA 2F0DA 3J80i 2CHBD 1A62A 4MZ9A 4HJ5A 2UUAL 1SFOB 2ASBA 4RMFA 2K05A 4BY1H 2CWAA 1XPOA 3PUZA 1JT8A 2FHTA 3KF8A 5L37A 5CV5A 1DD2A 4PMWA 4KN4C 1VQDA 4FDBA 1YITA 2F0MA 3K7UC 1PXUA 2N78A 1SEBD 4XYQA 3CC4A 4B3TQ 1LYLA 1HZBA 4F88A 2UXBL 2E2JB 4ABNA 1EQRA 4PV1C 4GKJL 4JI1L 1QE6A 4A3FH 3NXWA 3KLSX 3ULLA 2J0TD 4OEMB 4IZ8A 1G2SA 2R92B 5IYBH 2RDGA 2UXDL 2E8GA 3DMUA 5KRUA 4KHZA 3HOYB 2XIWA 5LMNQ 4JC0A 1D5MC 3V2TA 4YHHL 1KRTA 2IJ0A 3HOVB 3K5LA 3M4OH 3BYYB 1MI2A 1TWAH 2K32A 3KLSA 1SE8A 2B39A 1G91A 3VDYA 5CBEE 2JA7B 1A2TA 4ZRZA 3MVVA 4A3MG 4L5SA 3MEFA 1HR0L 1KD1C 3S1QH 3CCUA 2KA7A 4GN4B 5IP7H 2NVTB 2V1CC 3I91A 3GDEA 1BXTA 4CKBA 2PQEA 1VQCA 4LW1A 1Q8KA 2N8NA 4L8JA 4IFDJ 4QMGA 3MXNB 3S15H 3FRPB 4HMIA 1EUJA 2F4VQ 1PTOC 1PFMA 5I6YA 3TP8A 5IYDG 1I6HB 1CHPD 1PRTF 3SEBA 2CCZA 5JEAH 2F0VA 4QIWE 3F2CA 1KDCA 1J6QA 3AMUA 1FNWA 1JJGA 3C3LA 1NNXA 1UE7A 4HEDA 1FNVA 3W1GA 4BA1I 4Y7NB 1M90C 4H0LC 2L5TA 1OXTA 5IGBA 3NEMA 1EY8A 1HNZL 1CUKA 4LFAQ 2LFNA 3VYUA 2PW5A 4P75A 1VQPA 2EQSA 3F2UA 4ME3A 2F03A 4LF5Q 4DU9A 2HDLA 1STEA 2H4OA 4YWMA 2Z0SA 3HFZB 3J81L 2R61A 2NUCA 4B3SL 5FKAC 4R9WA 3J81c 3I4NG 4OHJA 3QOLA 2AHOB 2IHFA 1X3EA 3BDLA 4HIOA 1X55A 4PZ8A 4A3BB 1TKWB 3ZYYX 3TS2A 3TSSA 1TY0A 2VS1A 5C3EB 4HJ8A 1VQIA 2RDFA 5TSSA 1AH9A 2WAQE 2WB1G 1TT2A 3K5NA 1LT6D 4EQPA 3GTKH 4DR4L 5HGTA 5KEEA 4LF9Q 1EU4A 3T56B 4UY8C 1GUTA 3PUXA 3MXGA 3V05A 3H0GB 2D0PA 5DEHA 1D1KA 3CC7A 1JOQA 3DM3A 2JXMB 2EYFA 4DXFA 1PZJD 1PV4A 4BS9A 2RVLA 3R2TA 5IYCG 2JA5G 2PI2A 1YBYA 3A74A 4AH6A 1GHKA 1KLUD 4JI3Q 1H9RA 4RGTA 2E75C 1LTRD 3CC2A 2K7VA 2ZTEA 1RKNA 2L11A 1B53A 2B3GA 2IPKD 3BYTB 1KXLA 1X3QA 1JWSD 5CV6A 4BWGB 4UP9A 3BZKA 3HOZB 3HKZE 3S1RH 5ELDA 1QZGA 3PSIA 1VQ4A 5C4XH 1TS4A 3E5SA 3VA7A 3J80E 2K33A 4L5TA 4DR7Q 2B2UA 2SEBD 3J7ZC 3EVQA 4M1UB 1U4RA 1F9QA 4GS3A 3RUZA 3CD6A 1PYBA 2F0FA 3N6RA 2F4VL 5C4HA 4KTAA 4RAUC 1E1OA 1GUNA 2JA8H 3GTOH 1TY2A 3C1FA 1X6OA 2WACA 4BY1B 5LL6X 1VF7A 4IPGA 2F0LA 4DR1L 1G6ZA 2I5MX 4HJ7A 2BH2A 2PI2E 2B2TC 3QG1A 5IP9G 2Y0SG 3KOJA 1KDBA 2B2TA 3J7AV 2BA0A 3CU7A 4RKLA 4A76A 4JBKA 1NMGA 2DY7A 2A69C 2BA1A 1X32A 3AB9A 2WKDA 4KHPQ 3UE0A 1D1IA 2RF4A 1O7LA 1TQOA 2JA9A 2NB0A 1YNXA 3M3YH 3SK8A 3CW2C 4LK1C 3NTIA 1Q81C 2UU9Q 4A3FB 4GN5A 4LFAL 2F52A 2A19A 2JA6G 1AZQA 1ZXTA 2B63H 5CGKA 1WOCA 2F0JA 4JVZA 2IL8A 2OT2A 1YJWA 3QB3A 3IKJA 3MA2B 1TWFB 1VQKA 3M4OB 2FFKB 5GAGC 4EQ5A 4HMJA 2Q8RE 1TWAB 1I94Q 1O78A 2YYZA 2F0OA 2RSOA 4AIMA 4UP8A 3JC66 4NMZA 2OWOA 4UPAA 1DGSA 4X3SA 4JYAQ 4DGZA 3W3AA 1ONLA 4KD3A 5M5WH 4XT3B 2QEXA 2WP8J 3S1QB 4IUPA 2XRQD 3PIO3 3I7FA 2F0NA 2FXQA 4LF9L 1VQOA 2G9HD 1PH2A 1ILQA 4HSVA 1X56A 5FLXL 1FJGL 2N88A 5DM73 3CCSA 1T5EA 5FLXc 1IBLQ 1KNAA 1LTTD 1JQYD 3RMHA 3HOWH 3M85A 3D0FA 3C2PA 1E1TA 4R4OA 4A3GH 1FD7D 4AYBE 4DAYB 3WWVA 4RHSA 4DV7Q 2KBNA 4JBWA 1NTGA 4OGQC 1BCPF 4DK6C 5C0XJ 3CCQA 1CKOA 1VF5C 4K6LA 4G4KA 4JI3L 1FVIA 2KVMA 3S2HH 4A3EH 4QGUA 3S14H 1EIGA 2JJQA 1EU3A 3UDIA 4KKSA 2Z6BA 2KHSA 1I5FA 1CKMA 2NYZD 3R8BA 1Q46A 3D6WA 4APVA 1KAWA 2F0UA 3Q24A 1B9MA 5C44H 1SJHD 4KJNA 3SK4A 4Q5VA 5M3FB 2E2HH 4A93H 1LACA 1JJ2A 4DV2Q 1H9KA 1W3SA 1HTLD 3SVMA 3CXCA 2I5LX 4LJZC 3NQTA 4DR7L 1IYJB 2A68C 1L0XB 3VYRA 1G291 1J5EQ 1S5FD 4XQNA 2XN9C 2R92G 3UDGA 4IOAA 3HOYG 5M3MH 3F8TA 1Y8OB 4KMUC 1WYDA 3HOVG 1L1OC 5HGQA 4O1NA 1JCKB 5I6WA 2DN8A 1FGBD 4M8AA 1YEZA 3BU2A 3H09A 4E6IA 1PTOB 3NBIA 2F4IA 1VQLA 1KL9A 2G9DA 1S72A 3RLOA 4C2MH 2JA7G 4DA2A 3MXPA 3E0JA 4KHPL 1E24A 1ESRA 3U9OA 3GTKB 1EIYB 4L63B 3AFPA 2CFMA 2WAQB 1PH9A 1OO9B 1VQHA 2K5VA 5I4DA 4TKOB 3S16H 4GKKQ 2JEAI 3BZCA 1BF4A 2L0CA 4GNXC 2Z9HA 2ZTCA 3FPUB 3GTPH 1I4PA 4ZUIA 3TEHB 2QA4A 1DZ1A 2ZJQA 2EYOA 2CWPA 2X69A 1A15A 2GN5A 1X9NA 2AUKA 3AYHB 2DNCA 2QCPX 1HUMA 1TVXA 2ZXRA 4POGA 1Q82C 3NTHA 1QOHA 1SNMA 2ZT9C 2K14A 4GLVB 1VQ6A 5EPLA 1EL0A 1XX8A 1II3A 4BY7H 1B44D 1DYQA 3I70A 4MTKA 4JBMA 1FYCA 4F87A 1TS3A 3A0JA 4C3IH 3HEJA 1G6PA 1RJTA 1FGUA 1Z7TA 1JMCA 1IW7D 2C9OA 1K73C 1K8MA 1X3PA 3S1RB 2AUJD 4EQOA 1I4GA 4A4IA 3DXJC 3HKZB 4S3SA 4C3HH 5C0XG 5C4XB 1EOTA 4FF2A 5EKLA 4IURA 3KJPA 1NR2A 5FO8B 2K52A 3HZXA 3H3VC 4QY7A 3HOUH 4IPCA 3TREA 1IZ6A 5C4ZA 4L5QA 1BO0A 3GTQB 1CT1D 2NN6H 5NUCA 4JI4Q 2GVBA 4CJ2C 4CDFC 2UXBQ 3NPPA 3GTOB 3A55A 2JA8B 4GKJQ 1V8QA 4HSPA 1VQGA 1I3QH 2DUDA 4NXNQ 1CA6A 4H44C 4O2DA 3ND9A 4CHTB 1I4RA 1Y14B 2EE1A 4BBRH 2A74C 1SE4A 3M7GA 2L1BA 4A3BG 4YHHQ 2TMPA 4JI5Q 5DM63 5JVH3 3HKSA 3F1ZA 3BVZA 1QCBD 1Y1WH 2ZXOA 3RN2A 3RR5A 1S4ZA 5JAVA 2N3SA 1O7YA 2PMZB 1EFWA 4ZUJA 1AP0A 1Y1VG 4DV6Q 1GUWA 1BNZA 3H15A 1PH5A 1GVPA 3E3XA 4A3LH 4B3MQ 3SXHA 3H0GG 5K36G 4C3JG 4G7HC 5IWAL 5ELOA 1PH3A 1GXDC 1STNA 2QDBA 3G4SA 3I4OA 1J5EL 4DUZQ 3A7AB 3VR5A 3LWUA 4POFA 2HIXA 2IWHA 1TIID 2A6HC 4LF7Q 2A6EC 3E6ZX 1UEAB 3A8IE 1W6KA 3QR8A 2AQ2B 1P8LA 3FKIH 4XIGS 2PQAA 4FF4A 4CDCC 3DWQA 1JB7A 3TP7A 2D5DA 1Y8PB 5FOBB 4RGNA 1PZID 1RDPD 5M5WB 2NVYB 1XMOQ 3EROA 4CKEA 3Q8DA 4MTNA 4C56C 3OWEB 4KLKA 1A3VA 3HOZG 3CCMA 2KEDA 2VUMH 1VQBA 1HPCA 4IO9A 2F3WA 3HOXB 2NN6I 3R3OA 1C8CA 2VL6A 4GKKL 3MAQA 1F2LA 1YNNC 3HP3A 1LTBD 1HNXL 3BVGA 3TZDA 3HOWB 2ICEC 5LMUL 2F3IA 4HIMA 1VDZA 1XNQL 1CQFA 3GP7A 5FJ8H 4TSSA 1EWHA 4MN3A 4BY1G 1YI2A 3S2HB 4A3EB 4ID6A 3S14B 2JN4A 1WCMH 4NXMQ 3FPPA 1SYGA 4B3SQ 5CMDA 2C5CA 1E0BA 4DK1A 5C44B 5JJIA 4DR3L 2BH8A 1ASYA 4NKLA 2F1MA 3I4LA 3T51B 1Q1BA 2E2HB 1EYCA 4IOCA 3BJUA 2KHIA 3QO2A 2R3ZA 1EY0A 1X65A 4OIJA 3NK9A 4DV4Q 4JI2L 2DNEA 2CH4A 2ZJRA 4I7ZC 3NSWA 3CPFA 4HIKA 1H9SB 2RHSB 1EOVA 1HJPA 2Z1CA 3H3VI 5IYBG 1EZ6A 3T1HL 4JI4L 4DR4Q 1MKHA 2F0EA 5M3MB 1Q3LA 1K3BC 2GA4B 1EYAA 4PG3A 2RSNA 1C7YA 4NXNL 2SOBA 1DONA 1L0YB 4LUOA 4LFCL 1IBML 1K83H 2QEJC 2B29A 2CW0C 4ULLA 2UUCL 1K8OA 2BE5D 1STBA 3NHHA 3SK5A 5IODA 1CKNA 3QOJA 4C2MB 3NTKA 3VR4A 2IX0A 3P75A 4ME5A 4JI5L 1EWCA 4I7AA 2RQXA 4JCVE 3G48A 2OQKA 1SYFA 4NDXA 1BQQT 4N8FA 4QF4A 1QNKA 1BVSA 1KLGD 1SMXA 5DAUA 3H6MA 1XYIA 4JV5Q 1VMCA 5JOBA 4DV6L 1SE3A 2XWBB 4DPGA 3FMCA 4B3ML 1TWHB 3GTPB 3I55A 1U0LA 3T1YL 1KIXA 1PHJA 1Q8IA 3SE0A 3PCOB 4C1NI 1IL8A 1V9PA 3DWAA 4XT1B 4DUZL 4J1MA 1YNJD 4DNIA 1SNQA 1JOOA 4LF7L 1CZGA 1PRTC 2EYHA 1SLJA 3AEVA 3LNNA 1Y8NB 2YTVA 2VW9A 5JEAG 3CQZB 4LAAA 2K1BA 2XSCA 1IBKL 1BBXC 3PF5A 3ERSX 3MWYW 1BBWA 2HQEA 4DUYQ 1YHQA 3PGZA 4BY7B 4Q0FA 1SYCA 2EOTA 4C3IB 1OXSC 5AFWA 3VYSA 1XMOL 4B08A 1L1OB 2EY6A 1UE1A 4JI6L 5JPNC 4DR1Q 1RL2A 2VNUD 2EYMA 2NZOA 4A3MH 5ELFA 5M3FG 3S1NH 4A75A 4DR5Q 1WFQA 3HOUB 1GD7A 1JE5A 1LO5D 2E2DC 5CV4A 4WJWA 2AWNA 1WTXA 3G7LA 4A3CG 2F0TA 4K5VA 2I46A 2Z8LA 2VXWA 4K2LA 1U4MA 1AN8A 3D4WA 1EWIA 2KOLA 1I3QB 4X62L 2L12A 5G3LD 3T16A 1EY6A 1UE6A 5C6AA 4GNXB 2CVRA 1PTOF 4IJLA 1C4QA 1DCZA 1SYBA 2MO0A 5J22A 1VQEA 3JAML 4BBRB 1H9JA 3A54A 4NXML 3OPOA 4OONA 1NAPA 3ERQA 4RFBA 2ES2A 3JAMc 1WD1A 2R93H 1Q90A 5H1SE 1Y1WB 4KI0A 5FO9B 2N55A 3NWSA 4B3RL 5IY0A 4H13C 2NVXH 2CKZB 5IIFA 2Q2IA 2DJGC 5HY6A 4HCSA 5M5XH 2X6LA 3PO3G 1EQTA 4U68A 1JWUD 3M4PA 2WAQG 1JOKA 2KCNA 2YTXA 2OTJA 4DV4L 2ICIA 4X3UA 4PQXA 2B2YA 4V190 2Q2UA 3I4MH 4DAMA 2FINB 4HAEA 4MIUA 4YWLA 1TS5A 3L2PA 1PH6A 3PF4A 2EJMA 1QUQB 3VR3A 2E74C 3I56A 3DEPA 3FKIB 1STGA 5KIXA 2B8GA 1FL0A 1FJGQ 5HURA 4QL5A 1F9SA 2E76C 1PTOD 1SMYC 3P20A 4ZCKA 3I2ZA 5IGEA 2M9VA 4BXXG 4ZK9B 1Z6HA 4ZYSA 4FF3A 4JK1C 3PO2H 3K8AA 4JI8Q 5FO7B 2K5QA 5IT9L 3IL8A 5LHY1 2WB1E 2VUMB 4JV5L 2HDMA 1HQRD 5IT9c 5C4XG 2R6GA 3HKZG 5JJLA 1WTVA 1QVCA 4NW2A 4DV1Q 1EIFA 4JG2A 3K59A 2Q2TA 1EQQA 1STAA 2JYOA 2V4DA 3NQIA 4N8X1 5E1FA 2O5IC 2LXKA 3DUZA 1XJVA 3EBEA 3GTLH 1NY4A 3KF6B 3QIAA 2QF7A 4FXDA 4GZYC 2JA8G 2R7ZH 3AQQA 2B2UC 1U5KA 3OYYA 4QQBX 3I72A 2OXPA 2XWJB 2JA5H 2K4KA 5J1ZA 3RZDH 1K8AC 4DUYL 2XVSA 3BDOA 1U9RA 2JSOA 4OIKA 3S17B 1I4HA 1CHQD 3GV3A 1NCVA 3AU7A 2UUBL 1U4PA 2L55A 3TN2A 1RTOA 4IPDA 4JPBW 1N32L 3G6JB 3HRZC 4BA2I 2WINB 1PH8A 4IFDH 5KNDA 3UDFA 4LWCA 4DR5L 1XWEA 1WI5A 3A7LA 4FF1A 3P1HA 4KY5A 3MZ5A 3RZOH 1EFID 1XTCD 3D8GA 4KK7A 5EPJA 1GM5A 4JW0A 1JE4A 1GUGA 1ZKOA 1RF2D 2Q2HA 4BBSG 1G8ZD 1Z47A 1E2ZA 2KCCA 3KBXA 5IE8A 3PIP3 3AFQA 3ND8A 3A5UA 5JJKA 3L3OC 3S1MH 1WTOA 1NBWA 5A35A 3J7A5 1IYVA 1FR3A 1K83B 4P71A 2EY1A 3UE1A 5ELBA 3CF5A 4RHRA 4IQZA 3FP9A 4LF8Q 3OIPA 5IP9H 2PPBC 4Y52H 5BR8Q 5CC4A 3HOXG 1ICWA 1SAPA 2JQOA 3S24A 4A3KH 4MHEA 3F2DA 1HA6A 1M4VA 1K3RA 3KF8B 3OMGA 1UE5A 3ULJA 4LF6L 3HOWG 1I50H 2HCIA 2JA6H 1EIHA 1HRJA 4J8QA 2L15A 1WTHA 1BCPC 1BR9A 3S9WA 4ZKCB 1L0WA 1XNRL 1E22A 4X64L 2KCMA 1A3TA 5GAHC 3K7AH 3S15B 3ER0A 4A3EG 1ENCA 5KNBA 3W1BA 4I65A 3J81i 2KHJA 1Z9FA 1LABA 1HZAA 2EYLA 1XMQQ 2Z4IA 2EDGA 3CCLA 3PQIA 2NTSA 4JI8L 4NP5A 2MP1A 3U4ZA 4QIWB 3S1NB 1M1KC 3TP5A 4QUCA 4R8NA 4LFBQ 2AQ3B 2G5DA 4DV1L 2A69D 5C4JH 3MXUA 4K6DA 1SSOA 4K0KQ 1TWGH 4DV0L 2K28A 2F0GA 4DAPA 4ALPA 3OW2A 3STBC 1A6XA 4FYDA 3TDQA 5M3MG 1ZYRC 2K5WA 1MHWC 3CAMA 4F8MA 5IWAQ 5JPMC 2OF1A 2IX1A 4XXEA 4A3DH 1QG7A 1HUNA 1PRTB 2PW7A 1SFOH 4R4QA 2R93B 3GD7A 5D65A 3L0OA 5A2QE 1OXXK 1VQNA 4WORA 1F77A 2NVXB 2BDOA 4WRDA 3U4VA 2OTLA 3VA5A 5M5XB 1GHJA 1NR4A 4HTHA 1N33L 2A8VA 1A0IA 3MHBA 1PH7A 4RGMA 2PCFB 4IUTA 4X65Q 2HIVA 4K2KA 2XRSD 3N52A 4U673 2KUMA 3B6YA 5EKKA 3I4MB 2QILA 2E2JH 1HHVA 3GTGH 3Q6SA 5EKIA 2NWGA 4YCUA 1CSQA 1RODA 2AWOA 2CQOA 3C46A 2L4NA 1V43A 1TR5A 3KBGA 3P7JA 1PFNA 2RCNA 1HNXQ 3HOYH 2QDLA 2K03A 4C1NK 1LT3D 1B8AA 1WTWA 4A3JH 4PMBA 2NZ1D 5LMUQ 3HOVH 1B4OA 3KLWA 4DF7A 4LF8L 1XNQQ 3PO2B 4ILWA 3OW7A 3FDTA 4LNQA 2F0IA 3E9IA 4HCEA 5BR8L 4PMCA 2JA7H 1QILA 1WTRA 1CZWA 2EJGC 1VCIA 1GOZA 5IGGA 2Z6KA 2MQHA 2ZM6Q 5M5YH 2K5NA 3WDNA 4HJ9A 4DR2Q 4GOPC 2PYKA 1I4XA 3HOUG 2NZHA 3TBIB 4GOPA 4DR3Q 5JVG3 1MSGA 3I90A 5T1GA 3TMEA 1QVFA 3GTLB 2NN6G 1DJRD 4K5WA 2B8FA 5T1IA 1QWYA 3CCJA 2R7ZB 3PIOA 2R7FA 1VQ9A 4JI2Q 2A68D 1O7ZA 1PA6A 2JA5B 2VB3X 1E2VA 3T1HQ 3RZDB 4AQYL 2ZJPA 2UXCL 4BBRG 2D0OA 2DGYA 1XMQL 4KY7A 5E3FA 2KCTA 3M4QA 1Y1WG 4LUZA 2O4XA 2K6AA 1IBMQ 2MO1A 4G57A 4LFCQ 1Q7YC 3M4YA 1IYUA 2LKVA 4EGVA 2UUCQ 3X3MA 1QZHA 3CHBD 1KDAA 1HCZA 4LFBL 2F0QA 1D7QA 5BN5A 1MJEA 4X66L 5C0XH 5C3EG 4K0KL 1KTKA 3D31A 3RN5A 2AQ1B 1QVGA 3NP8A 1SYEA 1B3AA 1N36L 3NBHA 2KENA 5ISRA 3M3YB 3S1MB 1J9OA 5KYIA 3GTMH 1HFGA 3T1YQ 1MBYA 3TS0A 2B63B 2OCEA 3F2BA 4GLAC 1GO3E 1LTLA 1ESFA 1D5XC 1E7ZA 1SXTA 1STHA 1ET6A 4DK3C 3M9BA 3CMEA 1IKMA 1ENFA 3D4DA 4ZKBB 4XQJA 5FLMG 4A3IH 1MGSA 3KK7A 1F2ZA 1VQAA 2IW3A 3RD4A 1IBKQ 2RDHA 4EX5A 1EEID 2ATWA 4YY3Q 3Q23A 2VUMG 3A8JE 1PLFA 3MC0B 4X65L 2EIFA 4FVMA 1Y1VH 5CR3A 1B70B 2VQEQ 4A3KB 1QNUA 1HTPA 4PZ7A 4JI6Q 2Z4HA 3EFXD 3A5ZB 5JEAJ 1I50B 4C3JH 3J81E 2JA6B 4CGYB 4ODGA 1NJIC 1F9RA 1WD0A 1UEBA 4OXPA 3M7NA 1G51A 4MNOA 5FJ8G 3H91A 5LL6S 3NUCA 3K7AB 4A3GB 1KHIA 1OXVA 5EGTA 2JEBI 1B2TA 1SNOA 4OO1H 4R4CA 2MNAA 3H94A 4AYBB 1JJCB 4X62Q 4HJAA 1PFSA 2LXJA 3OWFA 3QJYA 3KFUA 2WFWA 4YWKA 1RTNA 2WIIB 4WJ4A 4DK0A 4DV5Q 1ILPA 1X3GA 2ZM6L 2F0PA 3OTOL 1M8AA 4OL7A 4OX9L 3HOZH 2A5HA 2BOSA 3CPWA 4K14A 4DR2L 1BBUA 5GROA 1LTGD 4B3RQ 1TWGB 3K0XA 5CV7A 2EXDA 3EN2A
chains in the Genus database with same CATH topology
4A93B 1V1OA 1SNPA 4KD4A 1CA5A 5C5MA 2F0KA 1H9MA 5IT9E 4KJOA 2B2VA 4A3DB 1I4QA 2A6HD 2K04A 5BN3A 2KQ3A 1ET9A 2A6ED 4FP5D 5D3IB 5FK9C 1HQMC 1BCPB 1F2YA 1AZPA 3PMFA 2KJXA 2HUGA 1LT5D 1A3UA 4KV6A 5CV9A 4B9XA 1EY4A 3BS1A 2F0SA 2VB2X 3SHLA 3MFYA 2ENBA 2MUYA 4DAYA 3GTGB 1W6JA 3D6CA 1R4PB 1S5ED 4Z9CB 2PZTA 1ZEQX 5BN4A 3S16B 1GUSA 1GJXA 1YNND 4OO1I 2PO4A 5D14A 4RGOS 3X3NA 4A3JB 2HCCA 4H7BA 2M00A 5G3LF 5K5PA 4F7XA 2JE6I 3BG3A 3PUWA 4RWSC 5CBAE 3HGBA 4TQUS 5C3WA 2EYJA 1JWMD 2L9HA 3HS0C 1DM0B 5M5YB 3PV0A 2J7ZA 2D9UA 5EPKA 4LMQD 3T13A 1G2TA 1CFMA 1B9NA 1AFPA 4KHVA 4C3HB 3DEOA 1CTMA 1RD9D 3PUVA 2JP1A 5JJZA 1NSNS 3A8KE 5COYA 4G7ZC 3K58A 1ENAA 4V0BA 5EBCA 2CW0D 2ID0A 2KECA 1DOLA 3PUYA 1UNSA 1R4QB 4K8JA 4CJ1B 5FLXE 3K5MA 2PZWA 5J39A 2ZXPA 2EJFC 1C48A 2H1EA 5IGDA 3IFDA 2CQAA 2MGSA 3I3CA 1LT4D 1JR0D 1UAPA 2QKIC 1Q12A 3GV6A 2B2YC 3GTMB 3A56A 3L7ZC 5IOCA 1DXMA 1F2MA 1PRTD 1HXYD 1F9PA 1BUVT 3LWEA 2DY8A 4A3IB 2K5DA 2EY2A 3MFGA 3RLFA 1PTOH 2F0HA 1I6VC 5D3DA 2KEEA 3T4AC 1Q1EA 3Q22A 1PYWD 2TSSA 3CKIB 4X3KA 1Y1VB 5KNCA 4IUUA 3W2DA 1VMPA 4C3JB 1PFBA 1JICA 3I8ZA 4N9PA 3DWPA 1SE2A 1RHPA 2LY7A 3K0YA 3EQLC 5KGUA 3T53B 4IUVA 3GO5A 4P2CB 1V1PA 2D62A 5C5LA 1KABA 2MPMA 2MJ8A 1EY5A 1D2BA 4ZQ3A 1WCMB 4IFDG 1LTID 2PZUA 1B50A 4R8IA 1S5BD 1JC7A 2I07B 1WVLA 3IFTA 3LX0A 1SDFA 3FVQA 4FXGC 4IUQA 4N9TA 3L9AX 2Q8IB 3EJIA 5EBDA 3C1EA 1EQVA 4IALA 3OIQA 3UI2A 4L6TB 2FJ2A 4DAVA 2F0WA 4ZAIA 2F3VA 4QUFA 3CRKC 2EPBA 3OSOA 1JB3A 1SMYD 3NWTA 2WV6D 5M9OA 4UDUC 3CRLC 3OHXC 4HN7A 1SYDA 2WKCA 5IGCA 4RKBA 4QB4A 1S5DD 1J8IA 3GTJB 1LTSD 3J7YW 3BVMA 1LTAD 1GUOA 2NTTA 4ZLTF 1EYDA 4CKCA 2RA4A 5ELCA 1ML0D 1PDQA 1AW7A 5F2DA 4B9WA 4CBVA 1SBBB 4IFDI 1H9SA 3D3RA 1HA5A 5I9PA 4KKTA 4A3MB 4FXKC 2SDFA 3J7AF 2RBMA 2IX3A 1XXGA 5E4XA 4YIJA 4J6HA 2SNSA 3VYTA 1D5ZC 1AEXA 2YU9B 2BCOA 1D6EC 4DNRB 3FEWX 1TWCB 3U9SA 4KN7C 2EXZA 4XDXA 5ELEA 3GQBA 3SDZA 1IW7C 1PZKD 1JORA 4KKUA 1R9TB 2X6GA 1KNEA 5I2YA 1LV9A 4FNFA 1DOKA 4XQQA 2K01A 3VR6A 5E4WC 3MXNA 4EQNA 4CJ0B 4XYOA 4X3TA 1TS2A 4XTCS 2XNAC 2MHVA 3D4RA 3VR2A 1BCPD 1CQVA 2E2IB 1CI3M 1BOSA 3HG9A 3OMCA 3R2IA 1EEFD 3J80L 3I4NB 2EVBA 1SNCA 1KAAA 3BDCA 1EY7A 2O5JC 3PO3B 1A2UA 4DNTB 4C3IG 3EA6A 3DM1A 3IAYA 4RA8A 1EY9A 1IHZA 4C3HG 4WFN3 2FMCA 2WB1B 2NVQB 5KYLA 1O80A 4K5XA 3KUPA 3I73A 4O42A 4EVOA 1Y69U 3NE5B 4HR7B 1RCVD 1ZYRD 2EZVA 5I2XA 2BDNA 3S2DB 5DNFA 1PMRA 4IUNA 2EY5A 3V96A 1TU2B 1S5CD 4KY6A 3WOEA 5CYUA 4DN4M 3URYA 4K8IA 3SR1A 1OXUA 4IN3A 4FO2A 3R93A 3TP6A 2OEOA 1BDOA 3DHQA 3RZOB 3BZDB 3TZUA 1MSHA 1UUPA 1U4LA 5IGFA 4DFAA 1QB5D 3Q0AA 1CK1A 1IKLA 5I9OA 2Q8TA 3K57A 1V1PB 2NBFA 3KLRA 2M2LA 3WOFA 2O2LD 2A73B 4UAIA 2Y0SB 2IT1A 1SJED 3ITPA 1FNUA 4RCOA 5CORA 1NUCA 4BBSB 4DXGA 1T5XD 4RCNA 1MD2D 4RH6A 2LS01 3K5OA 3JAME 5K36H 2LMCB 4OO1G 2PNRC 1DOMA 5C3XA 2BE5C 1HFNA 5CV8A 3O13A 3QWNA 3MEHA 1E2WA 3MTSA 2EYPA 1B1ZA 1WTPA 3SK6A 1LLRD 1STYA 4QCLA 2D2CC 2SNMA 2FMMA 5C0XI 5A2QL 1QJOA 3K6OA 1CM9A 3ONAB 2RKSA 5C4JB 1YNJC 4PNYA 1SNDA 5EQ0A 3OOCA 5EJWA 1WTQA 2J4XA 2B2WC 1EZ8A 2B2VC 2B2WA 4G7OC 4TRDA 2F0DA 2CHBD 1SFOB 2K05A 3PUZA 2FHTA 3KF8A 5CV5A 1DD2A 4PMWA 4KN4C 2F0MA 1PXUA 1SEBD 4XYQA 2E2JB 4F88A 4ABNA 4PV1C 1QE6A 3NXWA 3KLSX 2J0TD 4IZ8A 1G2SA 2R92B 2RDGA 3DMUA 5KRUA 4KHZA 3HOYB 2XIWA 1D5MC 3V2TA 2IJ0A 3HOVB 3K5LA 3BYYB 1MI2A 2K32A 3KLSA 2B39A 1G91A 5CBEE 2JA7B 1A2TA 4ZRZA 3MVVA 2KA7A 2NVTB 3I91A 1BXTA 4CKBA 2PQEA 4L8JA 4IFDJ 4QMGA 3FRPB 4HMIA 1PTOC 1PFMA 5I6YA 3TP8A 1I6HB 1CHPD 1PRTF 3SEBA 5JEAH 2F0VA 1KDCA 3AMUA 1FNWA 3C3LA 4HEDA 1FNVA 4BA1I 4Y7NB 4H0LC 2L5TA 1OXTA 5IGBA 1EY8A 2LFNA 3VYUA 2PW5A 3F2UA 2F03A 4DU9A 2HDLA 1STEA 2H4OA 3J81L 2R61A 2NUCA 5FKAC 4R9WA 4OHJA 3QOLA 3BDLA 4A3BB 1TKWB 3ZYYX 3TSSA 1TY0A 5C3EB 2RDFA 5TSSA 1TT2A 3K5NA 1LT6D 4EQPA 5HGTA 5KEEA 1EU4A 3T56B 1GUTA 3PUXA 3MXGA 3V05A 3H0GB 5DEHA 1D1KA 1JOQA 2JXMB 2EYFA 4DXFA 1PZJD 4BS9A 2RVLA 3R2TA 1GHKA 1KLUD 1H9RA 4RGTA 2E75C 1LTRD 2K7VA 1RKNA 2L11A 1B53A 2IPKD 3BYTB 1X3QA 1JWSD 5CV6A 4BWGB 3HOZB 5ELDA 1TS4A 3E5SA 3VA7A 3J80E 2K33A 2B2UA 2SEBD 3EVQA 4M1UB 1U4RA 1F9QA 3RUZA 2F0FA 3N6RA 5C4HA 4KTAA 4RAUC 1GUNA 1TY2A 3C1FA 2WACA 4BY1B 5LL6X 1VF7A 2F0LA 1G6ZA 2B2TC 3QG1A 1KDBA 2B2TA 3J7AV 2BA0A 3CU7A 4RKLA 2DY7A 2A69C 2BA1A 1X32A 3AB9A 2WKDA 1D1IA 1O7LA 1TQOA 2NB0A 3SK8A 4LK1C 3NTIA 4A3FB 1AZQA 1ZXTA 5CGKA 2F0JA 2IL8A 2OT2A 3QB3A 3IKJA 3MA2B 1TWFB 3M4OB 2FFKB 4HMJA 2Q8RE 1TWAB 1O78A 2YYZA 2F0OA 2RSOA 4NMZA 4X3SA 4DGZA 3W3AA 1ONLA 4KD3A 4XT3B 2WP8J 3S1QB 4IUPA 2XRQD 3PIO3 2F0NA 2G9HD 1ILQA 4HSVA 5FLXL 2N88A 5DM73 1T5EA 1KNAA 1LTTD 1JQYD 3RMHA 3M85A 3C2PA 1FD7D 4RHSA 4JBWA 4OGQC 1BCPF 5C0XJ 1VF5C 4K6LA 4G4KA 2KVMA 1EIGA 1EU3A 4KKSA 2KHSA 2NYZD 3R8BA 3D6WA 2F0UA 3Q24A 1B9MA 1SJHD 4KJNA 3SK4A 4Q5VA 5M3FB 1LACA 1H9KA 1HTLD 3SVMA 4LJZC 3NQTA 2A68C 1L0XB 3VYRA 1G291 1S5FD 4XQNA 2XN9C 1Y8OB 4KMUC 4O1NA 1JCKB 5I6WA 2DN8A 1FGBD 4M8AA 3H09A 4E6IA 1PTOB 3NBIA 2F4IA 2G9DA 4DA2A 3MXPA 3E0JA 1ESRA 3U9OA 3GTKB 4L63B 2WAQB 1OO9B 5I4DA 4TKOB 2JEAI 1BF4A 2L0CA 3FPUB 1I4PA 4ZUIA 1DZ1A 2EYOA 2X69A 1A15A 2AUKA 2DNCA 2QCPX 1HUMA 1TVXA 2ZXRA 3NTHA 1QOHA 1SNMA 2ZT9C 5EPLA 1EL0A 1XX8A 1II3A 1B44D 1DYQA 3I70A 1FYCA 4F87A 1TS3A 3HEJA 1RJTA 1Z7TA 1IW7D 2C9OA 1K8MA 1X3PA 3S1RB 2AUJD 4EQOA 1I4GA 5C4XB 3DXJC 3HKZB 4S3SA 5C0XG 1EOTA 4FF2A 5EKLA 4IURA 1NR2A 5FO8B 3HZXA 3H3VC 5C4ZA 1BO0A 3GTQB 1CT1D 2NN6H 5NUCA 4CJ2C 3NPPA 3GTOB 3A55A 2JA8B 1V8QA 4HSPA 1CA6A 4H44C 3ND9A 4CHTB 1I4RA 2EE1A 2A74C 1SE4A 3M7GA 2L1BA 2TMPA 5DM63 5JVH3 3BVZA 1QCBD 2ZXOA 1S4ZA 5JAVA 1O7YA 2PMZB 4ZUJA 1AP0A 1GUWA 1BNZA 3SXHA 5K36G 4C3JG 4G7HC 1GXDC 1STNA 2QDBA 3A7AB 3VR5A 3LWUA 2IWHA 1TIID 2A6HC 2A6EC 3E6ZX 1UEAB 3A8IE 1W6KA 2AQ2B 4XIGS 4FF4A 3DWQA 3TP7A 2D5DA 1Y8PB 5FOBB 4RGNA 1PZID 1RDPD 5M5WB 2NVYB 3EROA 4CKEA 4C56C 3OWEB 1A3VA 2KEDA 1HPCA 3HOXB 2F3WA 2NN6I 3R3OA 1C8CA 3MAQA 1F2LA 1YNNC 3HP3A 1LTBD 3BVGA 3TZDA 3HOWB 2ICEC 1VDZA 1CQFA 3GP7A 4TSSA 1EWHA 4MN3A 3S2HB 4A3EB 4ID6A 3S14B 3FPPA 1SYGA 5CMDA 2C5CA 1E0BA 4DK1A 5C44B 4NKLA 2F1MA 3I4LA 3T51B 1Q1BA 2E2HB 1EYCA 3QO2A 2R3ZA 1EY0A 4OIJA 3NK9A 2DNEA 4I7ZC 3NSWA 1H9SB 2Z1CA 1EZ6A 2F0EA 5M3MB 1Q3LA 2GA4B 1EYAA 2RSNA 2SOBA 1DONA 1L0YB 2QEJC 2CW0C 4ULLA 1K8OA 2BE5D 1STBA 3NHHA 3SK5A 5IODA 3QOJA 4C2MB 3NTKA 3VR4A 2IX0A 3P75A 4ME5A 1EWCA 2RQXA 1SYFA 4NDXA 1BQQT 4QF4A 5DAUA 1QNKA 1KLGD 1XYIA 3H6MA 1VMCA 5JOBA 1SE3A 2XWBB 3FMCA 1TWHB 3GTPB 1Q8IA 3SE0A 4C1NI 1IL8A 4XT1B 3DWAA 4J1MA 1YNJD 1SNQA 1JOOA 1CZGA 1PRTC 2EYHA 3LNNA 1Y8NB 5JEAG 3CQZB 4LAAA 2K1BA 2XSCA 1BBXC 3MWYW 2HQEA 4BY7B 4Q0FA 1SYCA 2EOTA 4C3IB 1OXSC 5AFWA 3VYSA 4B08A 2EY6A 5JPNC 2VNUD 2EYMA 5ELFA 3HOUB 1LO5D 2E2DC 5CV4A 4WJWA 2AWNA 1WTXA 3G7LA 2F0TA 4K5VA 2I46A 2Z8LA 2VXWA 4K2LA 1U4MA 1AN8A 3D4WA 2KOLA 1I3QB 2L12A 5G3LD 3T16A 1EY6A 5C6AA 2CVRA 1PTOF 1C4QA 1DCZA 1SYBA 5J22A 3JAML 4BBRB 1H9JA 3A54A 3OPOA 1NAPA 3ERQA 4RFBA 1WD1A 1Q90A 1Y1WB 4KI0A 5FO9B 2N55A 3NWSA 4H13C 5IIFA 4HCSA 2X6LA 1EQTA 4U68A 1JWUD 1JOKA 2KCNA 2ICIA 4X3UA 4PQXA 2B2YA 4V190 2FINB 4HAEA 4MIUA 1TS5A 2EJMA 3VR3A 2E74C 3DEPA 3FKIB 1STGA 5KIXA 2B8GA 5HURA 1F9SA 2E76C 1PTOD 1SMYC 3P20A 5IGEA 2M9VA 4ZK9B 1Z6HA 4ZYSA 4FF3A 4JK1C 5FO7B 2K5QA 5IT9L 3IL8A 5LHY1 2VUMB 2HDMA 1HQRD 2R6GA 1WTVA 4NW2A 3K59A 1STAA 2JYOA 2V4DA 3NQIA 5E1FA 2O5IC 3DUZA 3QIAA 2QF7A 4FXDA 4GZYC 2B2UC 3I72A 2OXPA 2XWJB 5J1ZA 2XVSA 3BDOA 1U9RA 2JSOA 4OIKA 3S17B 1I4HA 1CHQD 3GV3A 1NCVA 3AU7A 1U4PA 2L55A 3TN2A 1RTOA 3G6JB 3HRZC 4BA2I 2WINB 4IFDH 5KNDA 1XWEA 3A7LA 4FF1A 3P1HA 4KY5A 3MZ5A 1EFID 1XTCD 3D8GA 4KK7A 5EPJA 1JE4A 1GUGA 1ZKOA 1RF2D 1G8ZD 1Z47A 1E2ZA 2KCCA 3KBXA 3PIP3 3ND8A 3L3OC 1WTOA 5A35A 1IYVA 1FR3A 1K83B 2EY1A 5ELBA 4RHRA 4IQZA 3OIPA 2PPBC 5CC4A 1ICWA 1SAPA 4MHEA 1HA6A 1M4VA 3OMGA 2HCIA 1EIHA 1HRJA 4J8QA 1BCPC 1BR9A 3S9WA 4ZKCB 1A3TA 3S15B 1ENCA 5KNBA 4I65A 1LABA 2EYLA 2Z4IA 2EDGA 2NTSA 4NP5A 2MP1A 4QIWB 3S1NB 3TP5A 4QUCA 4R8NA 2AQ3B 2A69D 3MXUA 4K6DA 1SSOA 2K28A 2F0GA 4DAPA 1A6XA 4FYDA 3TDQA 1ZYRC 2K5WA 4F8MA 5JPMC 2OF1A 2IX1A 4XXEA 1QG7A 1HUNA 1PRTB 2PW7A 2R93B 3GD7A 5D65A 5A2QE 1OXXK 4WORA 1F77A 2NVXB 2BDOA 4WRDA 3VA5A 5M5XB 1GHJA 1NR4A 4HTHA 3MHBA 4RGMA 2PCFB 4IUTA 4K2KA 2XRSD 3N52A 4U673 2KUMA 5EKKA 3I4MB 2QILA 1HHVA 3Q6SA 5EKIA 2NWGA 1RODA 2AWOA 3C46A 2L4NA 1V43A 1TR5A 3KBGA 3P7JA 1PFNA 2K03A 4C1NK 1LT3D 1WTWA 4PMBA 2NZ1D 1B4OA 4DF7A 3PO2B 4ILWA 3OW7A 3FDTA 2F0IA 4HCEA 4PMCA 1QILA 1WTRA 1CZWA 2EJGC 1VCIA 1GOZA 5IGGA 3WDNA 2PYKA 1I4XA 3TBIB 5JVG3 1MSGA 3I90A 5T1GA 3TMEA 3GTLB 2NN6G 1DJRD 4K5WA 2B8FA 5T1IA 1QWYA 2R7ZB 2A68D 1O7ZA 2JA5B 2VB3X 1E2VA 3RZDB 4KY7A 5E3FA 2O4XA 2K6AA 4G57A 3M4YA 1IYUA 2LKVA 4EGVA 3X3MA 3CHBD 1KDAA 1HCZA 2F0QA 5BN5A 5C0XH 1KTKA 3D31A 2AQ1B 3NP8A 1SYEA 1B3AA 3NBHA 5ISRA 3M3YB 3S1MB 1J9OA 5KYIA 1HFGA 1MBYA 2B63B 1ESFA 1D5XC 1SXTA 1STHA 1ET6A 1IKMA 1ENFA 3D4DA 4ZKBB 4XQJA 1MGSA 3KK7A 1F2ZA 2IW3A 3RD4A 2RDHA 1EEID 3Q23A 3A8JE 1PLFA 3MC0B 4FVMA 5CR3A 4A3KB 1QNUA 1HTPA 2Z4HA 3EFXD 5JEAJ 1I50B 3J81E 2JA6B 4CGYB 4ODGA 1F9RA 1WD0A 3M7NA 3H91A 5LL6S 3NUCA 3K7AB 4A3GB 1OXVA 5EGTA 2JEBI 1B2TA 1SNOA 4OO1H 3H94A 4AYBB 3OWFA 3QJYA 1RTNA 2WIIB 4DK0A 1ILPA 2F0PA 1M8AA 4OL7A 2A5HA 2BOSA 4K14A 1LTGD 1TWGB 5CV7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q8R E;  2SDF A;  4HCS A;  5COY A;  1ESR A;  3KBX A;  1QG7 A;  2X6L A;  4R8I A;  1EQT A;  1B50 A;  1HUN A;  4U68 A;  2RSO A;  1WTP A;  1WVL A;  2BDN A;  5D65 A;  1CA5 A;  1WTO A;  3I91 A;  1SDF A;  4X3S A;  2RVL A;  4X3U A;  1BF4 A;  5DNF A;  2FMM A;  2B2Y A;  2B2V A;  3FPU B;  4XT3 B;  1NR4 A;  2KEC A;  4IUQ A;  2FIN B;  2K04 A;  1DOL A;  5E4X A;  1DZ1 A;  4HAE A;  2X69 A;  4CJ1 B;  1QNK A;  1A15 A;  4IUP A;  1B3A A;  1XYI A;  1CM9 A;  1VMC A;  3ONA B;  2L11 A;  4IUT A;  1J9O A;  1AZP A;  1PFM A;  1HUM A;  1B53 A;  1TVX A;  3DEP A;  4DN4 M;  5EQ0 A;  2HUG A;  3N52 A;  1X3Q A;  2KUM A;  1HFG A;  3UI2 A;  5EJW A;  1WTQ A;  1ILQ A;  1DON A;  4HSV A;  2FJ2 A;  2H1E A;  1HHV A;  1IL8 A;  2N88 A;  4XT1 B;  1F9S A;  3IFD A;  3Q6S A;  4XDX A;  5EKI A;  3R93 A;  4ZAI A;  5EPL A;  2MGS A;  1EL0 A;  2NWG A;  3I3C A;  1KNA A;  1ROD A;  1MSH A;  2KED A;  1XX8 A;  2L4N A;  4QUF A;  1IKM A;  4ZKB B;  1U4L A;  2B2W C;  3GV6 A;  1ICW A;  1MGS A;  2B2Y C;  2B2V C;  1SAP A;  4ZK9 B;  1C8C A;  2EPB A;  2B2W A;  3P7J A;  4HED A;  1PFN A;  1F2L A;  2X6G A;  3HP3 A;  4MHE A;  1KNE A;  1HA6 A;  2K1B A;  2B2U A;  1RJT A;  2K03 A;  3TZD A;  1WTW A;  3IL8 A;  1BBX C;  2K05 A;  1X3P A;  1LV9 A;  3MWY W;  2NZ1 D;  5EPK A;  2KVM A;  1F9P A;  1U4R A;  1F9Q A;  2FHT A;  2HCI A;  1B4O A;  2HDM A;  2DY8 A;  3LWE A;  1EIH A;  1EIG A;  1PLF A;  1HRJ A;  1DOK A;  2K01 A;  1IKL A;  5E4W C;  2Q8T A;  1EOT A;  4RAU C;  1WTV A;  4IUR A;  2EOT A;  4NW2 A;  1NR2 A;  4ZKC B;  2NYZ D;  3FDT A;  2KEE A;  5AFW A;  3D6W A;  5D14 A;  4CJ0 B;  1J8I A;  4X3T A;  4MN3 A;  2HCC A;  2JYO A;  2M2L A;  1WTR A;  3F2U A;  1G6Z A;  4O42 A;  1BO0 A;  4UAI A;  1F9R A;  2HDL A;  2B2T C;  4CJ2 C;  4X3K A;  1WD0 A;  2B2T A;  4IUU A;  2B2U C;  5CMD A;  3H91 A;  3SVM A;  4RWS C;  1QE6 A;  5CBA E;  4R9W A;  1E0B A;  2DY7 A;  1CA6 A;  1VMP A;  1MSG A;  3I90 A;  5T1G A;  1PFB A;  5COR A;  1X32 A;  2L9H A;  2MP1 A;  1WTX A;  3G7L A;  1G2S A;  1JIC A;  4QUC A;  2VXW A;  5T1I A;  2EE1 A;  2J7Z A;  3I8Z A;  1U4M A;  4OIK A;  4ZLT F;  1B2T A;  2D9U A;  2RA4 A;  3QO2 A;  2L1B A;  2R3Z A;  1ML0 D;  2KOL A;  2XIW A;  3GV3 A;  4LMQ D;  4OIJ A;  1RHP A;  1NCV A;  1PDQ A;  2L12 A;  1U4P A;  1SSO A;  1O7Z A;  2CVR A;  1RTO A;  4IUV A;  1RTN A;  3TN2 A;  3DM1 A;  1AZQ A;  4RA8 A;  1ZXT A;  2K28 A;  1S4Z A;  1ILP A;  1O7Y A;  1MI2 A;  1AP0 A;  3DEO A;  2IL8 A;  1GUW A;  1BNZ A;  1NAP A;  1O80 A;  1M8A A;  1G91 A;  1Q3L A;  1DOM A;  2MPM A;  1WD1 A;  2MJ8 A;  1G2T A;  5CBE E;  1HFN A;  5EPJ A;  2N55 A;  2RSN A;  3KUP A;  2FFK B;  2JP1 A;  5JJZ A;  1JE4 A;  3MTS A; 
#chains in the Genus database with same CATH topology
 2YTY A;  4A93 B;  1V1O A;  1SNP A;  4KD4 A;  1CA5 A;  4JI0 Q;  3CMA A;  4JI7 Q;  5C5M A;  4A3F G;  2F0K A;  1H9M A;  5IT9 E;  4KJO A;  2B2V A;  2PNH A;  4A3D B;  4CDE C;  1I4Q A;  2A6H D;  2K04 A;  5BN3 A;  2KQ3 A;  1ET9 A;  1CSP A;  2A6E D;  4FP5 D;  5D3I B;  5FK9 C;  1HQM C;  1BCP B;  1F2Y A;  1YIJ A;  1XPR A;  1AZP A;  3PMF A;  5AJ3 L;  2KJX A;  2HUG A;  1LT5 D;  1A3U A;  4KV6 A;  5CV9 A;  4B9X A;  1EY4 A;  3BS1 A;  2F0S A;  2VB2 X;  2E5L Q;  4DKA C;  3SHL A;  1YJN A;  3NEN A;  5LMN W;  3MFY A;  2AKW B;  1SN8 A;  2ENB A;  2MUY A;  4DAY A;  3GTG B;  1E3P A;  1W6J A;  3D6C A;  3GTJ H;  2N49 A;  5IP7 G;  1R4P B;  1S5E D;  4Z9C B;  2PZT A;  1ZEQ X;  5BN4 A;  4DV3 L;  3S16 B;  1GUS A;  1GJX A;  4R4T A;  1YNN D;  4WJ3 M;  4OO1 I;  4O0A A;  2PO4 A;  5D14 A;  1TWF H;  4RGO S;  3KYH C;  3X3N A;  2HCC A;  4A3J B;  3K80 C;  4H7B A;  2M00 A;  5G3L F;  5K5P A;  4F7X A;  4CDD C;  2C35 B;  2JE6 I;  3BG3 A;  3PUW A;  1ICF B;  4RWS C;  5CBA E;  3HGB A;  4TQU S;  5C3W A;  2EYJ A;  4LF4 L;  1JWM D;  2L9H A;  3HS0 C;  4YY3 L;  1DM0 B;  5M5Y B;  3PV0 A;  3KDF A;  1N34 L;  2J7Z A;  2D9U A;  5EPK A;  4LMQ D;  3T13 A;  1G2T A;  2VQE L;  1CFM A;  3UDX A;  2UUB Q;  1B9N A;  1AFP A;  1N32 Q;  1MJC A;  1YZ6 A;  3LGJ A;  4HID A;  4KHV A;  4C3H B;  3DEO A;  1CTM A;  2CH4 W;  2I0Q A;  1RD9 D;  1VQJ A;  1YHB A;  3FHW A;  3PUV A;  2JP1 A;  5JJZ A;  1NSN S;  3A8K E;  4GN3 B;  5COY A;  4RG1 A;  1N8R C;  2AMC B;  2R93 G;  4G7Z C;  2YU9 H;  5IYD H;  3K58 A;  1ENA A;  4V0B A;  5EBC A;  2CW0 D;  5E7N A;  2ID0 A;  2KEC A;  1TWC H;  1DOL A;  3PUY A;  1UNS A;  4DV5 L;  1R4Q B;  4K8J A;  5EAY A;  4CJ1 B;  5FLX E;  3K5M A;  2PZW A;  5J39 A;  5M3F H;  2ZXP A;  2EJF C;  1R9T H;  3I4M G;  1C48 A;  3TRZ A;  2H1E A;  5J3B A;  5IGD A;  3IFD A;  2CQA A;  2MGS A;  3I3C A;  1LT4 D;  2H5X A;  1JR0 D;  1UAP A;  4JI0 L;  2QKI C;  1Q12 A;  3GV6 A;  4GOP B;  2B2Y C;  4JI7 L;  4A3C H;  3GTM B;  3A56 A;  3L7Z C;  5IOC A;  1DXM A;  4LUV A;  1F2M A;  1PVO A;  4LF6 Q;  1PRT D;  4UHV A;  1RIP A;  1HXY D;  1F9P A;  4TVA B;  1BUV T;  3LWE A;  2DY8 A;  3TQY A;  4A3I B;  4IJH A;  2E2I H;  2K5D A;  1XNR Q;  2EY2 A;  3MFG A;  3PO2 G;  3RLF A;  4X64 Q;  1PTO H;  1X3F A;  2F0H A;  1I6V C;  5D3D A;  2KEE A;  3T4A C;  1Q1E A;  3Q22 A;  1PYW D;  2E5L L;  1NE3 A;  1HNW Q;  3I4N H;  2TSS A;  3CKI B;  4X3K A;  1Y1V B;  5KNC A;  4B3T L;  3PO3 H;  4IUU A;  3W2D A;  3IRB A;  3DLL A;  1VMP A;  4C3J B;  1PFB A;  4QJF A;  1JIC A;  3I8Z A;  2R7Z G;  4N9P A;  2NVQ H;  4PZ6 A;  3DWP A;  1SE2 A;  2ALY B;  1RHP A;  2LY7 A;  5LMN L;  3K0Y A;  3EQL C;  5KGU A;  4DV0 Q;  3T53 B;  4OWW B;  4IUV A;  1VQM A;  3GO5 A;  1AE2 A;  3NBH B;  4P2C B;  1V1P A;  2D62 A;  4J15 A;  5C5L A;  1PH1 A;  1YVC A;  1KAB A;  2MPM A;  2MJ8 A;  4NB3 A;  1EY5 A;  1D2B A;  4YCW A;  4ZQ3 A;  3S2D H;  4BXX H;  5IYC H;  1WCM B;  2HQL A;  4IFD G;  1LTI D;  2PZU A;  1GKH A;  2VQF Q;  4R8I A;  1B50 A;  1S5B D;  1IL2 A;  1C9O A;  1JC7 A;  2I07 B;  2PQA B;  1WVL A;  3CCV A;  3IFT A;  3LX0 A;  1SDF A;  3FVQ A;  3K81 C;  4FXG C;  1N33 Q;  4IUQ A;  4N9T A;  3L9A X;  4OEL B;  1AE3 A;  4OWT B;  3EJI A;  1YHA A;  2Q8I B;  5EBD A;  3C1E A;  3GTQ H;  1EQV A;  4IAL A;  3OIQ A;  3UI2 A;  4L6T B;  2B63 G;  1D8L A;  2FJ2 A;  4DAV A;  2F0W A;  1B7Y B;  4ZAI A;  1HZC A;  2F3V A;  4QUF A;  3CRK C;  2LSS A;  2EPB A;  3ULP A;  3OSO A;  1HZ9 A;  1JB3 A;  2XGT A;  1SMY D;  3NWT A;  2WV6 D;  5M9O A;  1ASZ A;  1VQ7 A;  4UDU C;  4P72 A;  2PMZ E;  3CRL C;  2Y0S E;  3OHX C;  4HN7 A;  2A1A A;  1SYD A;  2WKC A;  5IGC A;  4RKB A;  4QB4 A;  4A3K G;  1S5D D;  1J8I A;  2P5Z X;  3GTJ B;  1LTS D;  4P73 A;  4BBS H;  3J7Y W;  3BVM A;  4LF5 L;  2RHQ B;  4UP7 A;  1SRO A;  1LTA D;  1O7I A;  4A3G G;  1GUO A;  1SR3 A;  2NTT A;  4ZLT F;  1EYD A;  4CKC A;  2RA4 A;  5ELC A;  4AYB G;  1ML0 D;  4P74 A;  1PDQ A;  1AW7 A;  5F2D A;  3U58 A;  2HHH Q;  3JAM i;  4B9W A;  3ZJY C;  4CBV A;  4AQY Q;  1SBB B;  2NVY H;  2UXC Q;  1KRS A;  1HNW L;  4IFD I;  2IY5 B;  1H9S A;  1VQF A;  3D3R A;  1HA5 A;  5I9P A;  4KKT A;  1Q86 C;  5C44 G;  3HOX H;  4GLX A;  2I5H A;  5GQO A;  4A3M B;  4FXK C;  2SDF A;  4A93 G;  1CKN B;  3J7A F;  2RBM A;  4X66 Q;  2IX3 A;  1XXG A;  1LM0 A;  4X6A H;  4A3D G;  5E4X A;  4YIJ A;  4J6H A;  1N36 Q;  1VQ8 A;  2SNS A;  3VYT A;  3G71 A;  1D5Z C;  1AEX A;  3RLN A;  2YU9 B;  2BCO A;  1D6E C;  1K0S A;  2OQ0 A;  4DNR B;  3FEW X;  3G6E A;  1TWC B;  3U9S A;  4KN7 C;  2EXZ A;  4XDX A;  5ELE A;  2VQF L;  3GQB A;  3SDZ A;  5ELN A;  1IW7 C;  1PZK D;  1JOR A;  4KKU A;  1R9T B;  1PYS B;  3CCE A;  2X6G A;  1KNE A;  1XPU A;  5I2Y A;  3KDF B;  5GAE C;  1LV9 A;  2HT1 A;  3KJO A;  4IPH A;  4FNF A;  1DOK A;  4XQQ A;  2K01 A;  3VR6 A;  5E4W C;  3MXN A;  2IHE A;  2K5H A;  4EQN A;  4CJ0 B;  4XYO A;  4X3T A;  1TS2 A;  4XTC S;  2XNA C;  4A3J G;  2MHV A;  3D4R A;  3VR2 A;  1BCP D;  1CQV A;  1L1O A;  2E2I B;  1A8V A;  1CI3 M;  1BOS A;  4DR6 Q;  2R92 H;  3HG9 A;  1NMF A;  1V1Q A;  2ZTD A;  3OMC A;  3PIP A;  1LUZ A;  3R2I A;  3U50 C;  2MFI A;  4YCV A;  3CP0 A;  1EEF D;  3J80 L;  1H95 A;  3I4N B;  2EVB A;  1SNC A;  1KAA A;  3BDC A;  4BY7 G;  1EY7 A;  1MIU A;  3J80 c;  3RNU A;  1X54 A;  2O5J C;  3PO3 B;  1A2U A;  2RCF A;  1PH4 A;  4DNT B;  1T9H A;  4C3I G;  2GVA A;  2UU9 L;  3EA6 A;  2Z6K C;  3DM1 A;  1TWH H;  3IAY A;  4RA8 A;  1EY9 A;  1IHZ A;  4GNX A;  4C3H G;  1YJ9 A;  4WFN 3;  2FMC A;  2WB1 B;  2QGQ A;  3OTO Q;  1KC8 C;  5DLQ E;  4OX9 Q;  5KYL A;  2NVQ B;  1O80 A;  2NVT H;  1K8G A;  1L2F A;  1VQ5 A;  4K5X A;  3KUP A;  3I73 A;  2DJF C;  4O42 A;  3STB D;  4EVO A;  2R7D A;  3CQZ H;  1Y69 U;  1UWV A;  3NE5 B;  4HR7 B;  1I94 L;  1RCV D;  3CCR A;  1ZYR D;  2EZV A;  5I2X A;  2BDN A;  1OTC A;  1I6H H;  1VS0 A;  3S2D B;  5DNF A;  1PMR A;  4IUN A;  2EY5 A;  2HHH L;  4JYA L;  3ICE A;  2UUA Q;  3V96 A;  1TU2 B;  2QW7 A;  1N9W A;  1S5C D;  4KY6 A;  3WOE A;  1SRU A;  5AJ3 Q;  5CYU A;  4DN4 M;  1EYG A;  3URY A;  4K8I A;  3SR1 A;  1OXU A;  1QUQ A;  4IN3 A;  4FO2 A;  2VY3 A;  2K50 A;  3W5O A;  3R93 A;  3TP6 A;  2OEO A;  1BDO A;  4Y7N H;  3DHQ A;  3RZO B;  3BZD B;  3TZU A;  1MSH A;  4A3L G;  1IBL L;  1UUP A;  1U4L A;  5IGF A;  4DFA A;  4DV7 L;  4JI1 Q;  1WJJ A;  1QB5 D;  1C0A A;  3Q0A A;  1CK1 A;  4DV3 Q;  1KQS A;  4A3I G;  2UXD Q;  3FKI G;  1IKL A;  5I9O A;  2Q8T A;  3K57 A;  4JOI C;  1HR0 W;  4JOI A;  1V1P B;  2NBF A;  3E0E A;  4H02 A;  3KLR A;  2M2L A;  3WOF A;  2VZA A;  1A63 A;  1HH2 P;  2O2L D;  2A73 B;  1K0R A;  4UAI A;  2K75 A;  1S40 A;  2Y0S B;  4R4I A;  4JBJ A;  4DV2 L;  2IT1 A;  1SJE D;  4A3B H;  1IXR A;  3ITP A;  3KF6 A;  1FNU A;  4LF4 Q;  1TXY A;  4RCO A;  3J81 j;  5COR A;  1NUC A;  5C3E H;  1HR0 Q;  4BBS B;  1N34 Q;  4DXG A;  4OWX B;  1T5X D;  4RCN A;  1MD2 D;  1XTD A;  4RH6 A;  2LS0 1;  3K5O A;  3JAM E;  3H0G H;  5K36 H;  3H3V H;  1BKB A;  2LMC B;  2YV5 A;  4DR6 L;  2XTI A;  4OO1 G;  1S3O A;  2PNR C;  5GAD C;  1DOM A;  5C3X A;  2BE5 C;  1K28 A;  1HFN A;  4NPS A;  5CV8 A;  5FLM H;  3O13 A;  3QWN A;  3MEH A;  1WCM G;  1E2W A;  3EIV A;  3MTS A;  1P16 A;  4L5R C;  1W2B A;  2EYP A;  1B1Z A;  1WTP A;  3SK6 A;  1LLR D;  1STY A;  4QCL A;  2D2C C;  2SNM A;  2FMM A;  5C0X I;  5A2Q L;  1K9M C;  1QJO A;  3K6O A;  1CM9 A;  3ONA B;  2RKS A;  1B3Q A;  5C4J B;  1YNJ C;  3NEL A;  4PNY A;  1SND A;  5EQ0 A;  3E9H A;  3OOC A;  5EJW A;  1WTQ A;  2J4X A;  1HNZ Q;  2JK8 A;  4R1J A;  3SGI A;  2B2W C;  1EZ8 A;  2HD3 A;  2B2V C;  2B2W A;  4G7O C;  3S17 H;  4TRD A;  2F0D A;  3J80 i;  2CHB D;  1A62 A;  4MZ9 A;  4HJ5 A;  2UUA L;  1SFO B;  2ASB A;  4RMF A;  2K05 A;  4BY1 H;  2CWA A;  1XPO A;  3PUZ A;  1JT8 A;  2FHT A;  3KF8 A;  5L37 A;  5CV5 A;  1DD2 A;  4PMW A;  4KN4 C;  1VQD A;  4FDB A;  1YIT A;  2F0M A;  3K7U C;  1PXU A;  2N78 A;  1SEB D;  4XYQ A;  3CC4 A;  4B3T Q;  1LYL A;  1HZB A;  4F88 A;  2UXB L;  2E2J B;  4ABN A;  1EQR A;  4PV1 C;  4GKJ L;  4JI1 L;  1QE6 A;  4A3F H;  3NXW A;  3KLS X;  3ULL A;  2J0T D;  4OEM B;  4IZ8 A;  1G2S A;  2R92 B;  5IYB H;  2RDG A;  2UXD L;  2E8G A;  3DMU A;  5KRU A;  4KHZ A;  3HOY B;  2XIW A;  5LMN Q;  4JC0 A;  1D5M C;  3V2T A;  4YHH L;  1KRT A;  2IJ0 A;  3HOV B;  3K5L A;  3M4O H;  3BYY B;  1MI2 A;  1TWA H;  2K32 A;  3KLS A;  1SE8 A;  2B39 A;  1G91 A;  3VDY A;  5CBE E;  2JA7 B;  1A2T A;  4ZRZ A;  3MVV A;  4A3M G;  4L5S A;  3MEF A;  1HR0 L;  1KD1 C;  3S1Q H;  3CCU A;  2KA7 A;  4GN4 B;  5IP7 H;  2NVT B;  2V1C C;  3I91 A;  3GDE A;  1BXT A;  4CKB A;  2PQE A;  1VQC A;  4LW1 A;  1Q8K A;  2N8N A;  4L8J A;  4IFD J;  4QMG A;  3MXN B;  3S15 H;  3FRP B;  4HMI A;  1EUJ A;  2F4V Q;  1PTO C;  1PFM A;  5I6Y A;  3TP8 A;  5IYD G;  1I6H B;  1CHP D;  1PRT F;  3SEB A;  2CCZ A;  5JEA H;  2F0V A;  4QIW E;  3F2C A;  1KDC A;  1J6Q A;  3AMU A;  1FNW A;  1JJG A;  3C3L A;  1NNX A;  1UE7 A;  4HED A;  1FNV A;  3W1G A;  4BA1 I;  4Y7N B;  1M90 C;  4H0L C;  2L5T A;  1OXT A;  5IGB A;  3NEM A;  1EY8 A;  1HNZ L;  1CUK A;  4LFA Q;  2LFN A;  3VYU A;  2PW5 A;  4P75 A;  1VQP A;  2EQS A;  3F2U A;  4ME3 A;  2F03 A;  4LF5 Q;  4DU9 A;  2HDL A;  1STE A;  2H4O A;  4YWM A;  2Z0S A;  3HFZ B;  3J81 L;  2R61 A;  2NUC A;  4B3S L;  5FKA C;  4R9W A;  3J81 c;  3I4N G;  4OHJ A;  3QOL A;  2AHO B;  2IHF A;  1X3E A;  3BDL A;  4HIO A;  1X55 A;  4PZ8 A;  4A3B B;  1TKW B;  3ZYY X;  3TS2 A;  3TSS A;  1TY0 A;  2VS1 A;  5C3E B;  4HJ8 A;  1VQI A;  2RDF A;  5TSS A;  1AH9 A;  2WAQ E;  2WB1 G;  1TT2 A;  3K5N A;  1LT6 D;  4EQP A;  3GTK H;  4DR4 L;  5HGT A;  5KEE A;  4LF9 Q;  1EU4 A;  3T56 B;  4UY8 C;  1GUT A;  3PUX A;  3MXG A;  3V05 A;  3H0G B;  2D0P A;  5DEH A;  1D1K A;  3CC7 A;  1JOQ A;  3DM3 A;  2JXM B;  2EYF A;  4DXF A;  1PZJ D;  1PV4 A;  4BS9 A;  2RVL A;  3R2T A;  5IYC G;  2JA5 G;  2PI2 A;  1YBY A;  3A74 A;  4AH6 A;  1GHK A;  1KLU D;  4JI3 Q;  1H9R A;  4RGT A;  2E75 C;  1LTR D;  3CC2 A;  2K7V A;  2ZTE A;  1RKN A;  2L11 A;  1B53 A;  2B3G A;  2IPK D;  3BYT B;  1KXL A;  1X3Q A;  1JWS D;  5CV6 A;  4BWG B;  4UP9 A;  3BZK A;  3HOZ B;  3HKZ E;  3S1R H;  5ELD A;  1QZG A;  3PSI A;  1VQ4 A;  5C4X H;  1TS4 A;  3E5S A;  3VA7 A;  3J80 E;  2K33 A;  4L5T A;  4DR7 Q;  2B2U A;  2SEB D;  3J7Z C;  3EVQ A;  4M1U B;  1U4R A;  1F9Q A;  4GS3 A;  3RUZ A;  3CD6 A;  1PYB A;  2F0F A;  3N6R A;  2F4V L;  5C4H A;  4KTA A;  4RAU C;  1E1O A;  1GUN A;  2JA8 H;  3GTO H;  1TY2 A;  3C1F A;  1X6O A;  2WAC A;  4BY1 B;  5LL6 X;  1VF7 A;  4IPG A;  2F0L A;  4DR1 L;  1G6Z A;  2I5M X;  4HJ7 A;  2BH2 A;  2PI2 E;  2B2T C;  3QG1 A;  5IP9 G;  2Y0S G;  3KOJ A;  1KDB A;  2B2T A;  3J7A V;  2BA0 A;  3CU7 A;  4RKL A;  4A76 A;  4JBK A;  1NMG A;  2DY7 A;  2A69 C;  2BA1 A;  1X32 A;  3AB9 A;  2WKD A;  4KHP Q;  3UE0 A;  1D1I A;  2RF4 A;  1O7L A;  1TQO A;  2JA9 A;  2NB0 A;  1YNX A;  3M3Y H;  3SK8 A;  3CW2 C;  4LK1 C;  3NTI A;  1Q81 C;  2UU9 Q;  4A3F B;  4GN5 A;  4LFA L;  2F52 A;  2A19 A;  2JA6 G;  1AZQ A;  1ZXT A;  2B63 H;  5CGK A;  1WOC A;  2F0J A;  4JVZ A;  2IL8 A;  2OT2 A;  1YJW A;  3QB3 A;  3IKJ A;  3MA2 B;  1TWF B;  1VQK A;  3M4O B;  2FFK B;  5GAG C;  4EQ5 A;  4HMJ A;  2Q8R E;  1TWA B;  1I94 Q;  1O78 A;  2YYZ A;  2F0O A;  2RSO A;  4AIM A;  4UP8 A;  3JC6 6;  4NMZ A;  2OWO A;  4UPA A;  1DGS A;  4X3S A;  4JYA Q;  4DGZ A;  3W3A A;  1ONL A;  4KD3 A;  5M5W H;  4XT3 B;  2QEX A;  2WP8 J;  3S1Q B;  4IUP A;  2XRQ D;  3PIO 3;  3I7F A;  2F0N A;  2FXQ A;  4LF9 L;  1VQO A;  2G9H D;  1PH2 A;  1ILQ A;  4HSV A;  1X56 A;  5FLX L;  1FJG L;  2N88 A;  5DM7 3;  3CCS A;  1T5E A;  5FLX c;  1IBL Q;  1KNA A;  1LTT D;  1JQY D;  3RMH A;  3HOW H;  3M85 A;  3D0F A;  3C2P A;  1E1T A;  4R4O A;  4A3G H;  1FD7 D;  4AYB E;  4DAY B;  3WWV A;  4RHS A;  4DV7 Q;  2KBN A;  4JBW A;  1NTG A;  4OGQ C;  1BCP F;  4DK6 C;  5C0X J;  3CCQ A;  1CKO A;  1VF5 C;  4K6L A;  4G4K A;  4JI3 L;  1FVI A;  2KVM A;  3S2H H;  4A3E H;  4QGU A;  3S14 H;  1EIG A;  2JJQ A;  1EU3 A;  3UDI A;  4KKS A;  2Z6B A;  2KHS A;  1I5F A;  1CKM A;  2NYZ D;  3R8B A;  1Q46 A;  3D6W A;  4APV A;  1KAW A;  2F0U A;  3Q24 A;  1B9M A;  5C44 H;  1SJH D;  4KJN A;  3SK4 A;  4Q5V A;  5M3F B;  2E2H H;  4A93 H;  1LAC A;  1JJ2 A;  4DV2 Q;  1H9K A;  1W3S A;  1HTL D;  3SVM A;  3CXC A;  2I5L X;  4LJZ C;  3NQT A;  4DR7 L;  1IYJ B;  2A68 C;  1L0X B;  3VYR A;  1G29 1;  1J5E Q;  1S5F D;  4XQN A;  2XN9 C;  2R92 G;  3UDG A;  4IOA A;  3HOY G;  5M3M H;  3F8T A;  1Y8O B;  4KMU C;  1WYD A;  3HOV G;  1L1O C;  5HGQ A;  4O1N A;  1JCK B;  5I6W A;  2DN8 A;  1FGB D;  4M8A A;  1YEZ A;  3BU2 A;  3H09 A;  4E6I A;  1PTO B;  3NBI A;  2F4I A;  1VQL A;  1KL9 A;  2G9D A;  1S72 A;  3RLO A;  4C2M H;  2JA7 G;  4DA2 A;  3MXP A;  3E0J A;  4KHP L;  1E24 A;  1ESR A;  3U9O A;  3GTK B;  1EIY B;  4L63 B;  3AFP A;  2CFM A;  2WAQ B;  1PH9 A;  1OO9 B;  1VQH A;  2K5V A;  5I4D A;  4TKO B;  3S16 H;  4GKK Q;  2JEA I;  3BZC A;  1BF4 A;  2L0C A;  4GNX C;  2Z9H A;  2ZTC A;  3FPU B;  3GTP H;  1I4P A;  4ZUI A;  3TEH B;  2QA4 A;  1DZ1 A;  2ZJQ A;  2EYO A;  2CWP A;  2X69 A;  1A15 A;  2GN5 A;  1X9N A;  2AUK A;  3AYH B;  2DNC A;  2QCP X;  1HUM A;  1TVX A;  2ZXR A;  4POG A;  1Q82 C;  3NTH A;  1QOH A;  1SNM A;  2ZT9 C;  2K14 A;  4GLV B;  1VQ6 A;  5EPL A;  1EL0 A;  1XX8 A;  1II3 A;  4BY7 H;  1B44 D;  1DYQ A;  3I70 A;  4MTK A;  4JBM A;  1FYC A;  4F87 A;  1TS3 A;  3A0J A;  4C3I H;  3HEJ A;  1G6P A;  1RJT A;  1FGU A;  1Z7T A;  1JMC A;  1IW7 D;  2C9O A;  1K73 C;  1K8M A;  1X3P A;  3S1R B;  2AUJ D;  4EQO A;  1I4G A;  4A4I A;  3DXJ C;  3HKZ B;  4S3S A;  4C3H H;  5C0X G;  5C4X B;  1EOT A;  4FF2 A;  5EKL A;  4IUR A;  3KJP A;  1NR2 A;  5FO8 B;  2K52 A;  3HZX A;  3H3V C;  4QY7 A;  3HOU H;  4IPC A;  3TRE A;  1IZ6 A;  5C4Z A;  4L5Q A;  1BO0 A;  3GTQ B;  1CT1 D;  2NN6 H;  5NUC A;  4JI4 Q;  2GVB A;  4CJ2 C;  4CDF C;  2UXB Q;  3NPP A;  3GTO B;  3A55 A;  2JA8 B;  4GKJ Q;  1V8Q A;  4HSP A;  1VQG A;  1I3Q H;  2DUD A;  4NXN Q;  1CA6 A;  4H44 C;  4O2D A;  3ND9 A;  4CHT B;  1I4R A;  1Y14 B;  2EE1 A;  4BBR H;  2A74 C;  1SE4 A;  3M7G A;  2L1B A;  4A3B G;  4YHH Q;  2TMP A;  4JI5 Q;  5DM6 3;  5JVH 3;  3HKS A;  3F1Z A;  3BVZ A;  1QCB D;  1Y1W H;  2ZXO A;  3RN2 A;  3RR5 A;  1S4Z A;  5JAV A;  2N3S A;  1O7Y A;  2PMZ B;  1EFW A;  4ZUJ A;  1AP0 A;  1Y1V G;  4DV6 Q;  1GUW A;  1BNZ A;  3H15 A;  1PH5 A;  1GVP A;  3E3X A;  4A3L H;  4B3M Q;  3SXH A;  3H0G G;  5K36 G;  4C3J G;  4G7H C;  5IWA L;  5ELO A;  1PH3 A;  1GXD C;  1STN A;  2QDB A;  3G4S A;  3I4O A;  1J5E L;  4DUZ Q;  3A7A B;  3VR5 A;  3LWU A;  4POF A;  2HIX A;  2IWH A;  1TII D;  2A6H C;  4LF7 Q;  2A6E C;  3E6Z X;  1UEA B;  3A8I E;  1W6K A;  3QR8 A;  2AQ2 B;  1P8L A;  3FKI H;  4XIG S;  2PQA A;  4FF4 A;  4CDC C;  3DWQ A;  1JB7 A;  3TP7 A;  2D5D A;  1Y8P B;  5FOB B;  4RGN A;  1PZI D;  1RDP D;  5M5W B;  2NVY B;  1XMO Q;  3ERO A;  4CKE A;  3Q8D A;  4MTN A;  4C56 C;  3OWE B;  4KLK A;  1A3V A;  3HOZ G;  3CCM A;  2KED A;  2VUM H;  1VQB A;  1HPC A;  4IO9 A;  2F3W A;  3HOX B;  2NN6 I;  3R3O A;  1C8C A;  2VL6 A;  4GKK L;  3MAQ A;  1F2L A;  1YNN C;  3HP3 A;  1LTB D;  1HNX L;  3BVG A;  3TZD A;  3HOW B;  2ICE C;  5LMU L;  2F3I A;  4HIM A;  1VDZ A;  1XNQ L;  1CQF A;  3GP7 A;  5FJ8 H;  4TSS A;  1EWH A;  4MN3 A;  4BY1 G;  1YI2 A;  3S2H B;  4A3E B;  4ID6 A;  3S14 B;  2JN4 A;  1WCM H;  4NXM Q;  3FPP A;  1SYG A;  4B3S Q;  5CMD A;  2C5C A;  1E0B A;  4DK1 A;  5C44 B;  5JJI A;  4DR3 L;  2BH8 A;  1ASY A;  4NKL A;  2F1M A;  3I4L A;  3T51 B;  1Q1B A;  2E2H B;  1EYC A;  4IOC A;  3BJU A;  2KHI A;  3QO2 A;  2R3Z A;  1EY0 A;  1X65 A;  4OIJ A;  3NK9 A;  4DV4 Q;  4JI2 L;  2DNE A;  2CH4 A;  2ZJR A;  4I7Z C;  3NSW A;  3CPF A;  4HIK A;  1H9S B;  2RHS B;  1EOV A;  1HJP A;  2Z1C A;  3H3V I;  5IYB G;  1EZ6 A;  3T1H L;  4JI4 L;  4DR4 Q;  1MKH A;  2F0E A;  5M3M B;  1Q3L A;  1K3B C;  2GA4 B;  1EYA A;  4PG3 A;  2RSN A;  1C7Y A;  4NXN L;  2SOB A;  1DON A;  1L0Y B;  4LUO A;  4LFC L;  1IBM L;  1K83 H;  2QEJ C;  2B29 A;  2CW0 C;  4ULL A;  2UUC L;  1K8O A;  2BE5 D;  1STB A;  3NHH A;  3SK5 A;  5IOD A;  1CKN A;  3QOJ A;  4C2M B;  3NTK A;  3VR4 A;  2IX0 A;  3P75 A;  4ME5 A;  4JI5 L;  1EWC A;  4I7A A;  2RQX A;  4JCV E;  3G48 A;  2OQK A;  1SYF A;  4NDX A;  1BQQ T;  4N8F A;  4QF4 A;  1QNK A;  1BVS A;  1KLG D;  1SMX A;  5DAU A;  3H6M A;  1XYI A;  4JV5 Q;  1VMC A;  5JOB A;  4DV6 L;  1SE3 A;  2XWB B;  4DPG A;  3FMC A;  4B3M L;  1TWH B;  3GTP B;  3I55 A;  1U0L A;  3T1Y L;  1KIX A;  1PHJ A;  1Q8I A;  3SE0 A;  3PCO B;  4C1N I;  1IL8 A;  1V9P A;  3DWA A;  4XT1 B;  4DUZ L;  4J1M A;  1YNJ D;  4DNI A;  1SNQ A;  1JOO A;  4LF7 L;  1CZG A;  1PRT C;  2EYH A;  1SLJ A;  3AEV A;  3LNN A;  1Y8N B;  2YTV A;  2VW9 A;  5JEA G;  3CQZ B;  4LAA A;  2K1B A;  2XSC A;  1IBK L;  1BBX C;  3PF5 A;  3ERS X;  3MWY W;  1BBW A;  2HQE A;  4DUY Q;  1YHQ A;  3PGZ A;  4BY7 B;  4Q0F A;  1SYC A;  2EOT A;  4C3I B;  1OXS C;  5AFW A;  3VYS A;  1XMO L;  4B08 A;  1L1O B;  2EY6 A;  1UE1 A;  4JI6 L;  5JPN C;  4DR1 Q;  1RL2 A;  2VNU D;  2EYM A;  2NZO A;  4A3M H;  5ELF A;  5M3F G;  3S1N H;  4A75 A;  4DR5 Q;  1WFQ A;  3HOU B;  1GD7 A;  1JE5 A;  1LO5 D;  2E2D C;  5CV4 A;  4WJW A;  2AWN A;  1WTX A;  3G7L A;  4A3C G;  2F0T A;  4K5V A;  2I46 A;  2Z8L A;  2VXW A;  4K2L A;  1U4M A;  1AN8 A;  3D4W A;  1EWI A;  2KOL A;  1I3Q B;  4X62 L;  2L12 A;  5G3L D;  3T16 A;  1EY6 A;  1UE6 A;  5C6A A;  4GNX B;  2CVR A;  1PTO F;  4IJL A;  1C4Q A;  1DCZ A;  1SYB A;  2MO0 A;  5J22 A;  1VQE A;  3JAM L;  4BBR B;  1H9J A;  3A54 A;  4NXM L;  3OPO A;  4OON A;  1NAP A;  3ERQ A;  4RFB A;  2ES2 A;  3JAM c;  1WD1 A;  2R93 H;  1Q90 A;  5H1S E;  1Y1W B;  4KI0 A;  5FO9 B;  2N55 A;  3NWS A;  4B3R L;  5IY0 A;  4H13 C;  2NVX H;  2CKZ B;  5IIF A;  2Q2I A;  2DJG C;  5HY6 A;  4HCS A;  5M5X H;  2X6L A;  3PO3 G;  1EQT A;  4U68 A;  1JWU D;  3M4P A;  2WAQ G;  1JOK A;  2KCN A;  2YTX A;  2OTJ A;  4DV4 L;  2ICI A;  4X3U A;  4PQX A;  2B2Y A;  4V19 0;  2Q2U A;  3I4M H;  4DAM A;  2FIN B;  4HAE A;  4MIU A;  4YWL A;  1TS5 A;  3L2P A;  1PH6 A;  3PF4 A;  2EJM A;  1QUQ B;  3VR3 A;  2E74 C;  3I56 A;  3DEP A;  3FKI B;  1STG A;  5KIX A;  2B8G A;  1FL0 A;  1FJG Q;  5HUR A;  4QL5 A;  1F9S A;  2E76 C;  1PTO D;  1SMY C;  3P20 A;  4ZCK A;  3I2Z A;  5IGE A;  2M9V A;  4BXX G;  4ZK9 B;  1Z6H A;  4ZYS A;  4FF3 A;  4JK1 C;  3PO2 H;  3K8A A;  4JI8 Q;  5FO7 B;  2K5Q A;  5IT9 L;  3IL8 A;  5LHY 1;  2WB1 E;  2VUM B;  4JV5 L;  2HDM A;  1HQR D;  5IT9 c;  5C4X G;  2R6G A;  3HKZ G;  5JJL A;  1WTV A;  1QVC A;  4NW2 A;  4DV1 Q;  1EIF A;  4JG2 A;  3K59 A;  2Q2T A;  1EQQ A;  1STA A;  2JYO A;  2V4D A;  3NQI A;  4N8X 1;  5E1F A;  2O5I C;  2LXK A;  3DUZ A;  1XJV A;  3EBE A;  3GTL H;  1NY4 A;  3KF6 B;  3QIA A;  2QF7 A;  4FXD A;  4GZY C;  2JA8 G;  2R7Z H;  3AQQ A;  2B2U C;  1U5K A;  3OYY A;  4QQB X;  3I72 A;  2OXP A;  2XWJ B;  2JA5 H;  2K4K A;  5J1Z A;  3RZD H;  1K8A C;  4DUY L;  2XVS A;  3BDO A;  1U9R A;  2JSO A;  4OIK A;  3S17 B;  1I4H A;  1CHQ D;  3GV3 A;  1NCV A;  3AU7 A;  2UUB L;  1U4P A;  2L55 A;  3TN2 A;  1RTO A;  4IPD A;  4JPB W;  1N32 L;  3G6J B;  3HRZ C;  4BA2 I;  2WIN B;  1PH8 A;  4IFD H;  5KND A;  3UDF A;  4LWC A;  4DR5 L;  1XWE A;  1WI5 A;  3A7L A;  4FF1 A;  3P1H A;  4KY5 A;  3MZ5 A;  3RZO H;  1EFI D;  1XTC D;  3D8G A;  4KK7 A;  5EPJ A;  1GM5 A;  4JW0 A;  1JE4 A;  1GUG A;  1ZKO A;  1RF2 D;  2Q2H A;  4BBS G;  1G8Z D;  1Z47 A;  1E2Z A;  2KCC A;  3KBX A;  5IE8 A;  3PIP 3;  3AFQ A;  3ND8 A;  3A5U A;  5JJK A;  3L3O C;  3S1M H;  1WTO A;  1NBW A;  5A35 A;  3J7A 5;  1IYV A;  1FR3 A;  1K83 B;  4P71 A;  2EY1 A;  3UE1 A;  5ELB A;  3CF5 A;  4RHR A;  4IQZ A;  3FP9 A;  4LF8 Q;  3OIP A;  5IP9 H;  2PPB C;  4Y52 H;  5BR8 Q;  5CC4 A;  3HOX G;  1ICW A;  1SAP A;  2JQO A;  3S24 A;  4A3K H;  4MHE A;  3F2D A;  1HA6 A;  1M4V A;  1K3R A;  3KF8 B;  3OMG A;  1UE5 A;  3ULJ A;  4LF6 L;  3HOW G;  1I50 H;  2HCI A;  2JA6 H;  1EIH A;  1HRJ A;  4J8Q A;  2L15 A;  1WTH A;  1BCP C;  1BR9 A;  3S9W A;  4ZKC B;  1L0W A;  1XNR L;  1E22 A;  4X64 L;  2KCM A;  1A3T A;  5GAH C;  3K7A H;  3S15 B;  3ER0 A;  4A3E G;  1ENC A;  5KNB A;  3W1B A;  4I65 A;  3J81 i;  2KHJ A;  1Z9F A;  1LAB A;  1HZA A;  2EYL A;  1XMQ Q;  2Z4I A;  2EDG A;  3CCL A;  3PQI A;  2NTS A;  4JI8 L;  4NP5 A;  2MP1 A;  3U4Z A;  4QIW B;  3S1N B;  1M1K C;  3TP5 A;  4QUC A;  4R8N A;  4LFB Q;  2AQ3 B;  2G5D A;  4DV1 L;  2A69 D;  5C4J H;  3MXU A;  4K6D A;  1SSO A;  4K0K Q;  1TWG H;  4DV0 L;  2K28 A;  2F0G A;  4DAP A;  4ALP A;  3OW2 A;  3STB C;  1A6X A;  4FYD A;  3TDQ A;  5M3M G;  1ZYR C;  2K5W A;  1MHW C;  3CAM A;  4F8M A;  5IWA Q;  5JPM C;  2OF1 A;  2IX1 A;  4XXE A;  4A3D H;  1QG7 A;  1HUN A;  1PRT B;  2PW7 A;  1SFO H;  4R4Q A;  2R93 B;  3GD7 A;  5D65 A;  3L0O A;  5A2Q E;  1OXX K;  1VQN A;  4WOR A;  1F77 A;  2NVX B;  2BDO A;  4WRD A;  3U4V A;  2OTL A;  3VA5 A;  5M5X B;  1GHJ A;  1NR4 A;  4HTH A;  1N33 L;  2A8V A;  1A0I A;  3MHB A;  1PH7 A;  4RGM A;  2PCF B;  4IUT A;  4X65 Q;  2HIV A;  4K2K A;  2XRS D;  3N52 A;  4U67 3;  2KUM A;  3B6Y A;  5EKK A;  3I4M B;  2QIL A;  2E2J H;  1HHV A;  3GTG H;  3Q6S A;  5EKI A;  2NWG A;  4YCU A;  1CSQ A;  1ROD A;  2AWO A;  2CQO A;  3C46 A;  2L4N A;  1V43 A;  1TR5 A;  3KBG A;  3P7J A;  1PFN A;  2RCN A;  1HNX Q;  3HOY H;  2QDL A;  2K03 A;  4C1N K;  1LT3 D;  1B8A A;  1WTW A;  4A3J H;  4PMB A;  2NZ1 D;  5LMU Q;  3HOV H;  1B4O A;  3KLW A;  4DF7 A;  4LF8 L;  1XNQ Q;  3PO2 B;  4ILW A;  3OW7 A;  3FDT A;  4LNQ A;  2F0I A;  3E9I A;  4HCE A;  5BR8 L;  4PMC A;  2JA7 H;  1QIL A;  1WTR A;  1CZW A;  2EJG C;  1VCI A;  1GOZ A;  5IGG A;  2Z6K A;  2MQH A;  2ZM6 Q;  5M5Y H;  2K5N A;  3WDN A;  4HJ9 A;  4DR2 Q;  4GOP C;  2PYK A;  1I4X A;  3HOU G;  2NZH A;  3TBI B;  4GOP A;  4DR3 Q;  5JVG 3;  1MSG A;  3I90 A;  5T1G A;  3TME A;  1QVF A;  3GTL B;  2NN6 G;  1DJR D;  4K5W A;  2B8F A;  5T1I A;  1QWY A;  3CCJ A;  2R7Z B;  3PIO A;  2R7F A;  1VQ9 A;  4JI2 Q;  2A68 D;  1O7Z A;  1PA6 A;  2JA5 B;  2VB3 X;  1E2V A;  3T1H Q;  3RZD B;  4AQY L;  2ZJP A;  2UXC L;  4BBR G;  2D0O A;  2DGY A;  1XMQ L;  4KY7 A;  5E3F A;  2KCT A;  3M4Q A;  1Y1W G;  4LUZ A;  2O4X A;  2K6A A;  1IBM Q;  2MO1 A;  4G57 A;  4LFC Q;  1Q7Y C;  3M4Y A;  1IYU A;  2LKV A;  4EGV A;  2UUC Q;  3X3M A;  1QZH A;  3CHB D;  1KDA A;  1HCZ A;  4LFB L;  2F0Q A;  1D7Q A;  5BN5 A;  1MJE A;  4X66 L;  5C0X H;  5C3E G;  4K0K L;  1KTK A;  3D31 A;  3RN5 A;  2AQ1 B;  1QVG A;  3NP8 A;  1SYE A;  1B3A A;  1N36 L;  3NBH A;  2KEN A;  5ISR A;  3M3Y B;  3S1M B;  1J9O A;  5KYI A;  3GTM H;  1HFG A;  3T1Y Q;  1MBY A;  3TS0 A;  2B63 B;  2OCE A;  3F2B A;  4GLA C;  1GO3 E;  1LTL A;  1ESF A;  1D5X C;  1E7Z A;  1SXT A;  1STH A;  1ET6 A;  4DK3 C;  3M9B A;  3CME A;  1IKM A;  1ENF A;  3D4D A;  4ZKB B;  4XQJ A;  5FLM G;  4A3I H;  1MGS A;  3KK7 A;  1F2Z A;  1VQA A;  2IW3 A;  3RD4 A;  1IBK Q;  2RDH A;  4EX5 A;  1EEI D;  2ATW A;  4YY3 Q;  3Q23 A;  2VUM G;  3A8J E;  1PLF A;  3MC0 B;  4X65 L;  2EIF A;  4FVM A;  1Y1V H;  5CR3 A;  1B70 B;  2VQE Q;  4A3K B;  1QNU A;  1HTP A;  4PZ7 A;  4JI6 Q;  2Z4H A;  3EFX D;  3A5Z B;  5JEA J;  1I50 B;  4C3J H;  3J81 E;  2JA6 B;  4CGY B;  4ODG A;  1NJI C;  1F9R A;  1WD0 A;  1UEB A;  4OXP A;  3M7N A;  1G51 A;  4MNO A;  5FJ8 G;  3H91 A;  5LL6 S;  3NUC A;  3K7A B;  4A3G B;  1KHI A;  1OXV A;  5EGT A;  2JEB I;  1B2T A;  1SNO A;  4OO1 H;  4R4C A;  2MNA A;  3H94 A;  4AYB B;  1JJC B;  4X62 Q;  4HJA A;  1PFS A;  2LXJ A;  3OWF A;  3QJY A;  3KFU A;  2WFW A;  4YWK A;  1RTN A;  2WII B;  4WJ4 A;  4DK0 A;  4DV5 Q;  1ILP A;  1X3G A;  2ZM6 L;  2F0P A;  3OTO L;  1M8A A;  4OL7 A;  4OX9 L;  3HOZ H;  2A5H A;  2BOS A;  3CPW A;  4K14 A;  4DR2 L;  1BBU A;  5GRO A;  1LTG D;  4B3R Q;  1TWG B;  3K0X A;  5CV7 A;  2EXD A;  3EN2 A; 
#chains in the Genus database with same CATH homology
 4A93 B;  1V1O A;  1SNP A;  4KD4 A;  1CA5 A;  5C5M A;  2F0K A;  1H9M A;  5IT9 E;  4KJO A;  2B2V A;  4A3D B;  1I4Q A;  2A6H D;  2K04 A;  5BN3 A;  2KQ3 A;  1ET9 A;  2A6E D;  4FP5 D;  5D3I B;  5FK9 C;  1HQM C;  1BCP B;  1F2Y A;  1AZP A;  3PMF A;  2KJX A;  2HUG A;  1LT5 D;  1A3U A;  4KV6 A;  5CV9 A;  4B9X A;  1EY4 A;  3BS1 A;  2F0S A;  2VB2 X;  3SHL A;  3MFY A;  2ENB A;  2MUY A;  4DAY A;  3GTG B;  1W6J A;  3D6C A;  1R4P B;  1S5E D;  4Z9C B;  2PZT A;  1ZEQ X;  5BN4 A;  3S16 B;  1GUS A;  1GJX A;  1YNN D;  4OO1 I;  2PO4 A;  5D14 A;  4RGO S;  3X3N A;  4A3J B;  2HCC A;  4H7B A;  2M00 A;  5G3L F;  5K5P A;  4F7X A;  2JE6 I;  3BG3 A;  3PUW A;  4RWS C;  5CBA E;  3HGB A;  4TQU S;  5C3W A;  2EYJ A;  1JWM D;  2L9H A;  3HS0 C;  1DM0 B;  5M5Y B;  3PV0 A;  2J7Z A;  2D9U A;  5EPK A;  4LMQ D;  3T13 A;  1G2T A;  1CFM A;  1B9N A;  1AFP A;  4KHV A;  4C3H B;  3DEO A;  1CTM A;  1RD9 D;  3PUV A;  2JP1 A;  5JJZ A;  1NSN S;  3A8K E;  5COY A;  4G7Z C;  3K58 A;  1ENA A;  4V0B A;  5EBC A;  2CW0 D;  2ID0 A;  2KEC A;  1DOL A;  3PUY A;  1UNS A;  1R4Q B;  4K8J A;  4CJ1 B;  5FLX E;  3K5M A;  2PZW A;  5J39 A;  2ZXP A;  2EJF C;  1C48 A;  2H1E A;  5IGD A;  3IFD A;  2CQA A;  2MGS A;  3I3C A;  1LT4 D;  1JR0 D;  1UAP A;  2QKI C;  1Q12 A;  3GV6 A;  2B2Y C;  3GTM B;  3A56 A;  3L7Z C;  5IOC A;  1DXM A;  1F2M A;  1PRT D;  1HXY D;  1F9P A;  1BUV T;  3LWE A;  2DY8 A;  4A3I B;  2K5D A;  2EY2 A;  3MFG A;  3RLF A;  1PTO H;  2F0H A;  1I6V C;  5D3D A;  2KEE A;  3T4A C;  1Q1E A;  3Q22 A;  1PYW D;  2TSS A;  3CKI B;  4X3K A;  1Y1V B;  5KNC A;  4IUU A;  3W2D A;  1VMP A;  4C3J B;  1PFB A;  1JIC A;  3I8Z A;  4N9P A;  3DWP A;  1SE2 A;  1RHP A;  2LY7 A;  3K0Y A;  3EQL C;  5KGU A;  3T53 B;  4IUV A;  3GO5 A;  4P2C B;  1V1P A;  2D62 A;  5C5L A;  1KAB A;  2MPM A;  2MJ8 A;  1EY5 A;  1D2B A;  4ZQ3 A;  1WCM B;  4IFD G;  1LTI D;  2PZU A;  1B50 A;  4R8I A;  1S5B D;  1JC7 A;  2I07 B;  1WVL A;  3IFT A;  3LX0 A;  1SDF A;  3FVQ A;  4FXG C;  4IUQ A;  4N9T A;  3L9A X;  2Q8I B;  3EJI A;  5EBD A;  3C1E A;  1EQV A;  4IAL A;  3OIQ A;  3UI2 A;  4L6T B;  2FJ2 A;  4DAV A;  2F0W A;  4ZAI A;  2F3V A;  4QUF A;  3CRK C;  2EPB A;  3OSO A;  1JB3 A;  1SMY D;  3NWT A;  2WV6 D;  5M9O A;  4UDU C;  3CRL C;  3OHX C;  4HN7 A;  1SYD A;  2WKC A;  5IGC A;  4RKB A;  4QB4 A;  1S5D D;  1J8I A;  3GTJ B;  1LTS D;  3J7Y W;  3BVM A;  1LTA D;  1GUO A;  2NTT A;  4ZLT F;  1EYD A;  4CKC A;  2RA4 A;  5ELC A;  1ML0 D;  1PDQ A;  1AW7 A;  5F2D A;  4B9W A;  4CBV A;  1SBB B;  4IFD I;  1H9S A;  3D3R A;  1HA5 A;  5I9P A;  4KKT A;  4A3M B;  4FXK C;  2SDF A;  3J7A F;  2RBM A;  2IX3 A;  1XXG A;  5E4X A;  4YIJ A;  4J6H A;  2SNS A;  3VYT A;  1D5Z C;  1AEX A;  2YU9 B;  2BCO A;  1D6E C;  4DNR B;  3FEW X;  1TWC B;  3U9S A;  4KN7 C;  2EXZ A;  4XDX A;  5ELE A;  3GQB A;  3SDZ A;  1IW7 C;  1PZK D;  1JOR A;  4KKU A;  1R9T B;  2X6G A;  1KNE A;  5I2Y A;  1LV9 A;  4FNF A;  1DOK A;  4XQQ A;  2K01 A;  3VR6 A;  5E4W C;  3MXN A;  4EQN A;  4CJ0 B;  4XYO A;  4X3T A;  1TS2 A;  4XTC S;  2XNA C;  2MHV A;  3D4R A;  3VR2 A;  1BCP D;  1CQV A;  2E2I B;  1CI3 M;  1BOS A;  3HG9 A;  3OMC A;  3R2I A;  1EEF D;  3J80 L;  3I4N B;  2EVB A;  1SNC A;  1KAA A;  3BDC A;  1EY7 A;  2O5J C;  3PO3 B;  1A2U A;  4DNT B;  4C3I G;  3EA6 A;  3DM1 A;  3IAY A;  4RA8 A;  1EY9 A;  1IHZ A;  4C3H G;  4WFN 3;  2FMC A;  2WB1 B;  2NVQ B;  5KYL A;  1O80 A;  4K5X A;  3KUP A;  3I73 A;  4O42 A;  4EVO A;  1Y69 U;  3NE5 B;  4HR7 B;  1RCV D;  1ZYR D;  2EZV A;  5I2X A;  2BDN A;  3S2D B;  5DNF A;  1PMR A;  4IUN A;  2EY5 A;  3V96 A;  1TU2 B;  1S5C D;  4KY6 A;  3WOE A;  5CYU A;  4DN4 M;  3URY A;  4K8I A;  3SR1 A;  1OXU A;  4IN3 A;  4FO2 A;  3R93 A;  3TP6 A;  2OEO A;  1BDO A;  3DHQ A;  3RZO B;  3BZD B;  3TZU A;  1MSH A;  1UUP A;  1U4L A;  5IGF A;  4DFA A;  1QB5 D;  3Q0A A;  1CK1 A;  1IKL A;  5I9O A;  2Q8T A;  3K57 A;  1V1P B;  2NBF A;  3KLR A;  2M2L A;  3WOF A;  2O2L D;  2A73 B;  4UAI A;  2Y0S B;  2IT1 A;  1SJE D;  3ITP A;  1FNU A;  4RCO A;  5COR A;  1NUC A;  4BBS B;  4DXG A;  1T5X D;  4RCN A;  1MD2 D;  4RH6 A;  2LS0 1;  3K5O A;  3JAM E;  5K36 H;  2LMC B;  4OO1 G;  2PNR C;  1DOM A;  5C3X A;  2BE5 C;  1HFN A;  5CV8 A;  3O13 A;  3QWN A;  3MEH A;  1E2W A;  3MTS A;  2EYP A;  1B1Z A;  1WTP A;  3SK6 A;  1LLR D;  1STY A;  4QCL A;  2D2C C;  2SNM A;  2FMM A;  5C0X I;  5A2Q L;  1QJO A;  3K6O A;  1CM9 A;  3ONA B;  2RKS A;  5C4J B;  1YNJ C;  4PNY A;  1SND A;  5EQ0 A;  3OOC A;  5EJW A;  1WTQ A;  2J4X A;  2B2W C;  1EZ8 A;  2B2V C;  2B2W A;  4G7O C;  4TRD A;  2F0D A;  2CHB D;  1SFO B;  2K05 A;  3PUZ A;  2FHT A;  3KF8 A;  5CV5 A;  1DD2 A;  4PMW A;  4KN4 C;  2F0M A;  1PXU A;  1SEB D;  4XYQ A;  2E2J B;  4F88 A;  4ABN A;  4PV1 C;  1QE6 A;  3NXW A;  3KLS X;  2J0T D;  4IZ8 A;  1G2S A;  2R92 B;  2RDG A;  3DMU A;  5KRU A;  4KHZ A;  3HOY B;  2XIW A;  1D5M C;  3V2T A;  2IJ0 A;  3HOV B;  3K5L A;  3BYY B;  1MI2 A;  2K32 A;  3KLS A;  2B39 A;  1G91 A;  5CBE E;  2JA7 B;  1A2T A;  4ZRZ A;  3MVV A;  2KA7 A;  2NVT B;  3I91 A;  1BXT A;  4CKB A;  2PQE A;  4L8J A;  4IFD J;  4QMG A;  3FRP B;  4HMI A;  1PTO C;  1PFM A;  5I6Y A;  3TP8 A;  1I6H B;  1CHP D;  1PRT F;  3SEB A;  5JEA H;  2F0V A;  1KDC A;  3AMU A;  1FNW A;  3C3L A;  4HED A;  1FNV A;  4BA1 I;  4Y7N B;  4H0L C;  2L5T A;  1OXT A;  5IGB A;  1EY8 A;  2LFN A;  3VYU A;  2PW5 A;  3F2U A;  2F03 A;  4DU9 A;  2HDL A;  1STE A;  2H4O A;  3J81 L;  2R61 A;  2NUC A;  5FKA C;  4R9W A;  4OHJ A;  3QOL A;  3BDL A;  4A3B B;  1TKW B;  3ZYY X;  3TSS A;  1TY0 A;  5C3E B;  2RDF A;  5TSS A;  1TT2 A;  3K5N A;  1LT6 D;  4EQP A;  5HGT A;  5KEE A;  1EU4 A;  3T56 B;  1GUT A;  3PUX A;  3MXG A;  3V05 A;  3H0G B;  5DEH A;  1D1K A;  1JOQ A;  2JXM B;  2EYF A;  4DXF A;  1PZJ D;  4BS9 A;  2RVL A;  3R2T A;  1GHK A;  1KLU D;  1H9R A;  4RGT A;  2E75 C;  1LTR D;  2K7V A;  1RKN A;  2L11 A;  1B53 A;  2IPK D;  3BYT B;  1X3Q A;  1JWS D;  5CV6 A;  4BWG B;  3HOZ B;  5ELD A;  1TS4 A;  3E5S A;  3VA7 A;  3J80 E;  2K33 A;  2B2U A;  2SEB D;  3EVQ A;  4M1U B;  1U4R A;  1F9Q A;  3RUZ A;  2F0F A;  3N6R A;  5C4H A;  4KTA A;  4RAU C;  1GUN A;  1TY2 A;  3C1F A;  2WAC A;  4BY1 B;  5LL6 X;  1VF7 A;  2F0L A;  1G6Z A;  2B2T C;  3QG1 A;  1KDB A;  2B2T A;  3J7A V;  2BA0 A;  3CU7 A;  4RKL A;  2DY7 A;  2A69 C;  2BA1 A;  1X32 A;  3AB9 A;  2WKD A;  1D1I A;  1O7L A;  1TQO A;  2NB0 A;  3SK8 A;  4LK1 C;  3NTI A;  4A3F B;  1AZQ A;  1ZXT A;  5CGK A;  2F0J A;  2IL8 A;  2OT2 A;  3QB3 A;  3IKJ A;  3MA2 B;  1TWF B;  3M4O B;  2FFK B;  4HMJ A;  2Q8R E;  1TWA B;  1O78 A;  2YYZ A;  2F0O A;  2RSO A;  4NMZ A;  4X3S A;  4DGZ A;  3W3A A;  1ONL A;  4KD3 A;  4XT3 B;  2WP8 J;  3S1Q B;  4IUP A;  2XRQ D;  3PIO 3;  2F0N A;  2G9H D;  1ILQ A;  4HSV A;  5FLX L;  2N88 A;  5DM7 3;  1T5E A;  1KNA A;  1LTT D;  1JQY D;  3RMH A;  3M85 A;  3C2P A;  1FD7 D;  4RHS A;  4JBW A;  4OGQ C;  1BCP F;  5C0X J;  1VF5 C;  4K6L A;  4G4K A;  2KVM A;  1EIG A;  1EU3 A;  4KKS A;  2KHS A;  2NYZ D;  3R8B A;  3D6W A;  2F0U A;  3Q24 A;  1B9M A;  1SJH D;  4KJN A;  3SK4 A;  4Q5V A;  5M3F B;  1LAC A;  1H9K A;  1HTL D;  3SVM A;  4LJZ C;  3NQT A;  2A68 C;  1L0X B;  3VYR A;  1G29 1;  1S5F D;  4XQN A;  2XN9 C;  1Y8O B;  4KMU C;  4O1N A;  1JCK B;  5I6W A;  2DN8 A;  1FGB D;  4M8A A;  3H09 A;  4E6I A;  1PTO B;  3NBI A;  2F4I A;  2G9D A;  4DA2 A;  3MXP A;  3E0J A;  1ESR A;  3U9O A;  3GTK B;  4L63 B;  2WAQ B;  1OO9 B;  5I4D A;  4TKO B;  2JEA I;  1BF4 A;  2L0C A;  3FPU B;  1I4P A;  4ZUI A;  1DZ1 A;  2EYO A;  2X69 A;  1A15 A;  2AUK A;  2DNC A;  2QCP X;  1HUM A;  1TVX A;  2ZXR A;  3NTH A;  1QOH A;  1SNM A;  2ZT9 C;  5EPL A;  1EL0 A;  1XX8 A;  1II3 A;  1B44 D;  1DYQ A;  3I70 A;  1FYC A;  4F87 A;  1TS3 A;  3HEJ A;  1RJT A;  1Z7T A;  1IW7 D;  2C9O A;  1K8M A;  1X3P A;  3S1R B;  2AUJ D;  4EQO A;  1I4G A;  5C4X B;  3DXJ C;  3HKZ B;  4S3S A;  5C0X G;  1EOT A;  4FF2 A;  5EKL A;  4IUR A;  1NR2 A;  5FO8 B;  3HZX A;  3H3V C;  5C4Z A;  1BO0 A;  3GTQ B;  1CT1 D;  2NN6 H;  5NUC A;  4CJ2 C;  3NPP A;  3GTO B;  3A55 A;  2JA8 B;  1V8Q A;  4HSP A;  1CA6 A;  4H44 C;  3ND9 A;  4CHT B;  1I4R A;  2EE1 A;  2A74 C;  1SE4 A;  3M7G A;  2L1B A;  2TMP A;  5DM6 3;  5JVH 3;  3BVZ A;  1QCB D;  2ZXO A;  1S4Z A;  5JAV A;  1O7Y A;  2PMZ B;  4ZUJ A;  1AP0 A;  1GUW A;  1BNZ A;  3SXH A;  5K36 G;  4C3J G;  4G7H C;  1GXD C;  1STN A;  2QDB A;  3A7A B;  3VR5 A;  3LWU A;  2IWH A;  1TII D;  2A6H C;  2A6E C;  3E6Z X;  1UEA B;  3A8I E;  1W6K A;  2AQ2 B;  4XIG S;  4FF4 A;  3DWQ A;  3TP7 A;  2D5D A;  1Y8P B;  5FOB B;  4RGN A;  1PZI D;  1RDP D;  5M5W B;  2NVY B;  3ERO A;  4CKE A;  4C56 C;  3OWE B;  1A3V A;  2KED A;  1HPC A;  3HOX B;  2F3W A;  2NN6 I;  3R3O A;  1C8C A;  3MAQ A;  1F2L A;  1YNN C;  3HP3 A;  1LTB D;  3BVG A;  3TZD A;  3HOW B;  2ICE C;  1VDZ A;  1CQF A;  3GP7 A;  4TSS A;  1EWH A;  4MN3 A;  3S2H B;  4A3E B;  4ID6 A;  3S14 B;  3FPP A;  1SYG A;  5CMD A;  2C5C A;  1E0B A;  4DK1 A;  5C44 B;  4NKL A;  2F1M A;  3I4L A;  3T51 B;  1Q1B A;  2E2H B;  1EYC A;  3QO2 A;  2R3Z A;  1EY0 A;  4OIJ A;  3NK9 A;  2DNE A;  4I7Z C;  3NSW A;  1H9S B;  2Z1C A;  1EZ6 A;  2F0E A;  5M3M B;  1Q3L A;  2GA4 B;  1EYA A;  2RSN A;  2SOB A;  1DON A;  1L0Y B;  2QEJ C;  2CW0 C;  4ULL A;  1K8O A;  2BE5 D;  1STB A;  3NHH A;  3SK5 A;  5IOD A;  3QOJ A;  4C2M B;  3NTK A;  3VR4 A;  2IX0 A;  3P75 A;  4ME5 A;  1EWC A;  2RQX A;  1SYF A;  4NDX A;  1BQQ T;  4QF4 A;  5DAU A;  1QNK A;  1KLG D;  1XYI A;  3H6M A;  1VMC A;  5JOB A;  1SE3 A;  2XWB B;  3FMC A;  1TWH B;  3GTP B;  1Q8I A;  3SE0 A;  4C1N I;  1IL8 A;  4XT1 B;  3DWA A;  4J1M A;  1YNJ D;  1SNQ A;  1JOO A;  1CZG A;  1PRT C;  2EYH A;  3LNN A;  1Y8N B;  5JEA G;  3CQZ B;  4LAA A;  2K1B A;  2XSC A;  1BBX C;  3MWY W;  2HQE A;  4BY7 B;  4Q0F A;  1SYC A;  2EOT A;  4C3I B;  1OXS C;  5AFW A;  3VYS A;  4B08 A;  2EY6 A;  5JPN C;  2VNU D;  2EYM A;  5ELF A;  3HOU B;  1LO5 D;  2E2D C;  5CV4 A;  4WJW A;  2AWN A;  1WTX A;  3G7L A;  2F0T A;  4K5V A;  2I46 A;  2Z8L A;  2VXW A;  4K2L A;  1U4M A;  1AN8 A;  3D4W A;  2KOL A;  1I3Q B;  2L12 A;  5G3L D;  3T16 A;  1EY6 A;  5C6A A;  2CVR A;  1PTO F;  1C4Q A;  1DCZ A;  1SYB A;  5J22 A;  3JAM L;  4BBR B;  1H9J A;  3A54 A;  3OPO A;  1NAP A;  3ERQ A;  4RFB A;  1WD1 A;  1Q90 A;  1Y1W B;  4KI0 A;  5FO9 B;  2N55 A;  3NWS A;  4H13 C;  5IIF A;  4HCS A;  2X6L A;  1EQT A;  4U68 A;  1JWU D;  1JOK A;  2KCN A;  2ICI A;  4X3U A;  4PQX A;  2B2Y A;  4V19 0;  2FIN B;  4HAE A;  4MIU A;  1TS5 A;  2EJM A;  3VR3 A;  2E74 C;  3DEP A;  3FKI B;  1STG A;  5KIX A;  2B8G A;  5HUR A;  1F9S A;  2E76 C;  1PTO D;  1SMY C;  3P20 A;  5IGE A;  2M9V A;  4ZK9 B;  1Z6H A;  4ZYS A;  4FF3 A;  4JK1 C;  5FO7 B;  2K5Q A;  5IT9 L;  3IL8 A;  5LHY 1;  2VUM B;  2HDM A;  1HQR D;  2R6G A;  1WTV A;  4NW2 A;  3K59 A;  1STA A;  2JYO A;  2V4D A;  3NQI A;  5E1F A;  2O5I C;  3DUZ A;  3QIA A;  2QF7 A;  4FXD A;  4GZY C;  2B2U C;  3I72 A;  2OXP A;  2XWJ B;  5J1Z A;  2XVS A;  3BDO A;  1U9R A;  2JSO A;  4OIK A;  3S17 B;  1I4H A;  1CHQ D;  3GV3 A;  1NCV A;  3AU7 A;  1U4P A;  2L55 A;  3TN2 A;  1RTO A;  3G6J B;  3HRZ C;  4BA2 I;  2WIN B;  4IFD H;  5KND A;  1XWE A;  3A7L A;  4FF1 A;  3P1H A;  4KY5 A;  3MZ5 A;  1EFI D;  1XTC D;  3D8G A;  4KK7 A;  5EPJ A;  1JE4 A;  1GUG A;  1ZKO A;  1RF2 D;  1G8Z D;  1Z47 A;  1E2Z A;  2KCC A;  3KBX A;  3PIP 3;  3ND8 A;  3L3O C;  1WTO A;  5A35 A;  1IYV A;  1FR3 A;  1K83 B;  2EY1 A;  5ELB A;  4RHR A;  4IQZ A;  3OIP A;  2PPB C;  5CC4 A;  1ICW A;  1SAP A;  4MHE A;  1HA6 A;  1M4V A;  3OMG A;  2HCI A;  1EIH A;  1HRJ A;  4J8Q A;  1BCP C;  1BR9 A;  3S9W A;  4ZKC B;  1A3T A;  3S15 B;  1ENC A;  5KNB A;  4I65 A;  1LAB A;  2EYL A;  2Z4I A;  2EDG A;  2NTS A;  4NP5 A;  2MP1 A;  4QIW B;  3S1N B;  3TP5 A;  4QUC A;  4R8N A;  2AQ3 B;  2A69 D;  3MXU A;  4K6D A;  1SSO A;  2K28 A;  2F0G A;  4DAP A;  1A6X A;  4FYD A;  3TDQ A;  1ZYR C;  2K5W A;  4F8M A;  5JPM C;  2OF1 A;  2IX1 A;  4XXE A;  1QG7 A;  1HUN A;  1PRT B;  2PW7 A;  2R93 B;  3GD7 A;  5D65 A;  5A2Q E;  1OXX K;  4WOR A;  1F77 A;  2NVX B;  2BDO A;  4WRD A;  3VA5 A;  5M5X B;  1GHJ A;  1NR4 A;  4HTH A;  3MHB A;  4RGM A;  2PCF B;  4IUT A;  4K2K A;  2XRS D;  3N52 A;  4U67 3;  2KUM A;  5EKK A;  3I4M B;  2QIL A;  1HHV A;  3Q6S A;  5EKI A;  2NWG A;  1ROD A;  2AWO A;  3C46 A;  2L4N A;  1V43 A;  1TR5 A;  3KBG A;  3P7J A;  1PFN A;  2K03 A;  4C1N K;  1LT3 D;  1WTW A;  4PMB A;  2NZ1 D;  1B4O A;  4DF7 A;  3PO2 B;  4ILW A;  3OW7 A;  3FDT A;  2F0I A;  4HCE A;  4PMC A;  1QIL A;  1WTR A;  1CZW A;  2EJG C;  1VCI A;  1GOZ A;  5IGG A;  3WDN A;  2PYK A;  1I4X A;  3TBI B;  5JVG 3;  1MSG A;  3I90 A;  5T1G A;  3TME A;  3GTL B;  2NN6 G;  1DJR D;  4K5W A;  2B8F A;  5T1I A;  1QWY A;  2R7Z B;  2A68 D;  1O7Z A;  2JA5 B;  2VB3 X;  1E2V A;  3RZD B;  4KY7 A;  5E3F A;  2O4X A;  2K6A A;  4G57 A;  3M4Y A;  1IYU A;  2LKV A;  4EGV A;  3X3M A;  3CHB D;  1KDA A;  1HCZ A;  2F0Q A;  5BN5 A;  5C0X H;  1KTK A;  3D31 A;  2AQ1 B;  3NP8 A;  1SYE A;  1B3A A;  3NBH A;  5ISR A;  3M3Y B;  3S1M B;  1J9O A;  5KYI A;  1HFG A;  1MBY A;  2B63 B;  1ESF A;  1D5X C;  1SXT A;  1STH A;  1ET6 A;  1IKM A;  1ENF A;  3D4D A;  4ZKB B;  4XQJ A;  1MGS A;  3KK7 A;  1F2Z A;  2IW3 A;  3RD4 A;  2RDH A;  1EEI D;  3Q23 A;  3A8J E;  1PLF A;  3MC0 B;  4FVM A;  5CR3 A;  4A3K B;  1QNU A;  1HTP A;  2Z4H A;  3EFX D;  5JEA J;  1I50 B;  3J81 E;  2JA6 B;  4CGY B;  4ODG A;  1F9R A;  1WD0 A;  3M7N A;  3H91 A;  5LL6 S;  3NUC A;  3K7A B;  4A3G B;  1OXV A;  5EGT A;  2JEB I;  1B2T A;  1SNO A;  4OO1 H;  3H94 A;  4AYB B;  3OWF A;  3QJY A;  1RTN A;  2WII B;  4DK0 A;  1ILP A;  2F0P A;  1M8A A;  4OL7 A;  2A5H A;  2BOS A;  4K14 A;  1LTG D;  1TWG B;  5CV7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...