1WTWA

Hyperthermophile chromosomal protein sac7d single mutant v26a in complex with dna gcgatcgc
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
66
structure length
66
Chain Sequence
MVKVKFKYKGEEKEVDTSKIKKVWRAGKMVSFTYDDNGKTGRGAVSEKDAPKELLDMLARAEREKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Probing the DNA kink structure induced by the hyperthermophilic chromosomal protein Sac7d
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
molecule tags Dna binding protein/dna
molecule keywords 5'-D(*GP*CP*GP*AP*TP*CP*GP*C)-3'
total genus 13
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2004-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02294 7kD_DNA_binding 7kD DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1wtwA00
2EE1A 3SVMA 2HDLA 4HAEA 3I8ZA 1MSHA 2B2VC 4RWSC 1F9PA 2KEDA 1B50A 2HCIA 4X3KA 3TN2A 3ONAB 1PDQA 3DEOA 4ZKCB 1U4MA 2MPMA 1KNEA 1C8CA 1CA5A 4X3UA 1IKMA 2K1BA 1MSGA 2D9UA 2RA4A 1DOKA 1RTNA 1DZ1A 3G7LA 1WTQA 2IL8A 5EPKA 1U4RA 1F2LA 2B2VA 1WVLA 1G2SA 2FINB 5EKIA 5CORA 5CMDA 2JYOA 1ESRA 1M8AA 2K05A 2X6LA 4HSVA 1RHPA 1ILPA 1RODA 2B2UC 4NW2A 3GV3A 4IUQA 1PFMA 2B2TC 4HEDA 4ZAIA 1X3PA 2NZ1D 4IUTA 4X3TA 2KUMA 2K01A 3QO2A 1G91A 1HA6A 1HFNA 2Q8TA 2L11A 5EJWA 5COYA 1B4OA 1J9OA 2MGSA 2DY8A 3FDTA 2L12A 4IURA 3F2UA 2X69A 2B2YC 5CBEE 2J7ZA 1O7ZA 2DY7A 2RSOA 4OIJA 2NWGA 2NYZD 3MWYW 5T1GA 5AFWA 1U4PA 5CBAE 3P7JA 4ZLTF 1WTXA 3HP3A 1O7YA 1S4ZA 1EOTA 1LV9A 2FJ2A 2B2WC 1RJTA 1F9SA 3KUPA 4XDXA 1WTRA 5E4XA 1AZQA 2XIWA 2K28A 1ML0D 1KNAA 1X32A 3FPUB 2L1BA 2RSNA 2FMMA 1WTOA 1EIGA 1HRJA 1MGSA 1B53A 2H1EA 2R3ZA 1WTVA 1AP0A 1ILQA 2SDFA 1O80A 1NR4A 1VMCA 3DEPA 3DM1A 1F9RA 1SDFA 1WD0A 2MP1A 3I90A 5E4WC 5DNFA 1WTWA 1RTOA 1VMPA 1BNZA 1XX8A 2K03A 2K04A 3H91A 5D65A 1F9QA 4CJ2C 4IUVA 5D14A 1NAPA 3TZDA 1PLFA 2VXWA 3KBXA 1MI2A 1WTPA 1CM9A 1E0BA 5JJZA 1SAPA 2KECA 4O42A 4R8IA 4RA8A 1BBXC 5EQ0A 1CA6A 1QG7A 5EPLA 1G6ZA 4CJ1B 4QUCA 1NR2A 1U4LA 3MTSA 1HHVA 4UAIA 3IL8A 2Q8RE 1QE6A 1BF4A 1JE4A 1HFGA 3GV6A 1J8IA 1B3AA 1BO0A 1IL8A 1PFBA 2HDMA 1PFNA 4LMQD 2CVRA 2HUGA 4OIKA 1WD1A 2FHTA 2HCCA 5T1IA 4MN3A 1Q3LA 2L9HA 1HUNA 1ICWA 1NCVA 3UI2A 1X3QA 2B2WA 2KEEA 2KVMA 4DN4M 1JICA 2N55A 3I3CA 3D6WA 4XT1B 1DOMA 1TVXA 2X6GA 4X3SA 4CJ0B 4R9WA 4XT3B 5EPJA 1ZXTA 1EQTA 1IKLA 1HUMA 2B2YA 2BDNA 4MHEA 3I91A 2EOTA 1EL0A 1DONA 1EIHA 4IUPA 2JP1A 2KOLA 4ZKBB 1SSOA 4HCSA 2RVLA 1XYIA 3R93A 4ZK9B 3Q6SA 4U68A 2B2TA 2L4NA 4IUUA 2B2UA 3N52A 4RAUC 4QUFA 1B2TA 1G2TA 2FFKB 2N88A 1A15A 1DOLA 1QNKA 1AZPA 1GUWA 3LWEA 2M2LA 2MJ8A 3IFDA 2EPBA
chains in the Genus database with same CATH superfamily
2HDLA 3VA7A 4N8FA 4A3IH 2MO1A 4DV3Q 1D1IA 3J81E 3TN2A 5FLXL 3DEOA 1XPUA 4EVOA 1OXTA 2R61A 4KLKA 3P20A 5DAUA 3D4WA 2VW9A 4N8X1 1HNZQ 3L0OA 2ZM6L 3FPPA 5CV6A 4HSVA 4IPCA 3ERSX 1LTRD 4J1MA 1E22A 4DV0L 1KDBA 1S5BD 1JORA 4XIGS 3HOWH 2Q8TA 1Q46A 1VQJA 1CQFA 1BCPB 2PO4A 1XNRL 1HZ9A 2BA0A 2OXPA 1YNND 4DV1L 2UU9Q 3SDZA 4PMWA 1KAWA 3HOXB 1A62A 3MXPA 1YNJD 3FRPB 3JAMi 3FKIB 4X65L 4HJ5A 2B2WC 3MEFA 2Q2UA 1WTRA 1XTCD 2R7ZB 1XMOQ 1VQ5A 4CDEC 1YIJA 1HRJA 2VY3A 5M5WH 1X56A 2OT2A 3U4ZA 4A76A 3QJYA 1N32Q 1E3PA 1WTWA 2RF4A 1HH2P 2HD3A 2B63G 4TQUS 4K2LA 1R9TB 1X65A 1X54A 3KBXA 2D0PA 4POGA 1ONLA 2AWOA 3CQZH 4OONA 2AUJD 1KDCA 1GUOA 3W5OA 5JEAJ 5IGEA 2F0EA 4GN3B 2PQAB 4QMGA 3DUZA 5E3FA 1D8LA 2HDMA 1IL8A 1XMOL 1SNOA 2EIFA 4IQZA 4LFBQ 3OMGA 2Z0SA 3W1BA 4XQJA 3GTPB 1KHIA 2F0JA 4NXMQ 2CH4W 1HXYD 1QVCA 1K83B 4XT1B 3A8IE 3T1YL 5EPJA 4F8MA 1KQSA 4R4OA 2BDNA 3LX0A 2R7DA 3OWEB 2WB1B 5JOBA 1YJWA 1HTPA 1VS0A 3CF5A 4YCVA 1SSOA 2HHHQ 1TWGH 2LSSA 1LO5D 4IPDA 5H1SE 4BBRB 2EQSA 3N52A 1SXTA 3BVMA 1DOLA 1GUWA 3TP6A 3DLLA 2NVQH 2XRQD 3CP0A 3R8BA 2K75A 3BZCA 5M3MB 1E2ZA 2KEDA 3Q23A 4JI7Q 3ONAB 1U4MA 3CCMA 1CI3M 3OTOQ 2CW0D 5CGKA 3K57A 1IKMA 1EWIA 2UUCQ 4DV2Q 4X64Q 4FVMA 2ZJPA 2QILA 1C48A 2YU9B 2KJXA 4A3IB 1HR0W 2XSCA 2ID0A 3B6YA 1RIPA 2OTJA 2NTSA 3EROA 2XTIA 5IT9L 4ZQ3A 1ENFA 1L2FA 3KF8B 1IL2A 4A3LH 2D5DA 1H9SA 2MGSA 4BY7G 4A93G 1TS3A 3BVGA 5FLMG 1O7ZA 2A68D 2NYZD 1PRTC 4FXKC 3S17H 1EWHA 1WOCA 3TRZA 5C4XG 3T56B 4XXEA 4CKBA 2DN8A 3U4VA 2CQOA 1V43A 3GDEA 4B3RL 5KYIA 1O80A 3GTMB 4A3KG 2ES2A 4LF9L 1A2TA 3A7AB 1F9QA 3KLSA 4DPGA 3NHHA 4JBJA 5C3EB 1B44D 1Y1VB 5C4JB 3NQIA 3OW2A 4A3KB 4DA2A 3K5NA 2UXBQ 1UUPA 4O42A 1Q81C 4AQYQ 4OX9Q 3K6OA 3VR3A 5FO7B 1U0LA 2A6EC 2JQOA 3I55A 2GVAA 4DR1L 1SEBD 5JVG3 5GQOA 4BY1H 2YU9H 1M1KC 1TKWB 4OIKA 4NMZA 1W6JA 3KLRA 5T1IA 4HTHA 1HUNA 1L1OB 1K3BC 2E8GA 2KCMA 2MHVA 3MZ5A 1IYUA 4G57A 4XQQA 4A93B 1BOSA 3BU2A 4LUZA 4X3SA 1EL0A 3MA2B 2EYPA 2VB2X 2VQFL 2ATWA 1EIHA 3A8JE 1I6HH 5FLXE 1SMYD 3RZDH 4JOIA 2KQ3A 4GN5A 1QNUA 4A3MG 3BZKA 1GKHA 3Q6SA 2EY5A 3SR1A 1BR9A 4HJAA 1PH6A 2E74C 1R4QB 4DAYA 2YYZA 1XMQQ 2K6AA 4MZ9A 3JAML 2JA6H 3CCQA 2PMZB 5JEAH 1KNEA 4OWXB 1CT1D 1PYSB 2RA4A 1EYAA 3PQIA 2UXCL 5I4DA 3HOZH 3EVQA 2F0WA 2AUKA 2FINB 4RH6A 2P5ZX 2IHEA 3F2BA 3Q22A 3S1QB 1RHPA 4DV5Q 4NW2A 1SJHD 1KD1C 2EDGA 5A2QL 2CW0C 2JK8A 1R9TH 4F87A 3NBHB 5COYA 4RGOS 1GD7A 2R92B 1JB3A 5T1GA 1HR0Q 2BE5D 3G6JB 2Z6KC 4Z9CB 5IYBH 3GTGB 1I6HB 3RMHA 2OTLA 3PGZA 2UXCQ 5JAVA 3SK8A 4GKJQ 3AB9A 1HQRD 2JA7B 2K50A 4C2MB 2EYHA 2PNRC 1WTVA 2Y0SG 5CV7A 4DK1A 3M7GA 5CV4A 5K36G 2SOBA 4DV6Q 1SYDA 4DV7Q 5D65A 3KF8A 4ME3A 2BCOA 3EJIA 4CJ2C 4IUVA 3G4SA 1YBYA 3A0JA 4KY7A 4QUCA 2I5MX 2M9VA 2EJFC 3CCLA 4C3IH 2L0CA 2VQFQ 2F0TA 3HOYH 3S1QH 2IHFA 5C4JH 4LWCA 2FHTA 3R2IA 2SNSA 2L9HA 3CD6A 2RKSA 3V05A 4BBSB 2C9OA 3UDFA 4KD4A 1O7IA 3E5SA 4R4QA 1QVGA 1HNZL 1A3TA 1L0YB 3J81i 3TDQA 2PCFB 5C5MA 1D6EC 4B08A 1N33L 1T5XD 4RAUC 2B2UA 3KFUA 2F0IA 2M00A 3PSIA 3C46A 5FOBB 3SEBA 1R4PB 4B3TQ 4LF4Q 1L1OA 2HCIA 5IP7G 2ZXOA 2GVBA 3CRLC 4IJLA 1X3GA 3L7ZC 3EA6A 1EY7A 1PH7A 2Q2HA 1VQMA 2EY2A 1FGUA 2JSOA 2JYOA 3K5MA 1IYVA 4DR5L 1K0RA 2NTTA 2F0SA 2K14A 4LF7Q 2K5HA 3IAYA 3OSOA 1NJIC 3SGIA 3H15A 3KBGA 1LTLA 2MNAA 1Q86C 1B8AA 5EJWA 5GAEC 2BA1A 4JK1C 3J80E 4C3JB 2ICIA 3RUZA 4LF4L 4PZ6A 5IWAL 2WV6D 1JOQA 4GKJL 2IWHA 2UUBQ 3KYHC 5D3IB 2QEJC 2IT1A 5A2QE 1HA5A 2R7ZG 4GKKQ 4YWKA 2K33A 1FGBD 2F0LA 1EYGA 5IP7H 3DEPA 3ULJA 2IX0A 2GN5A 4JI7L 2E76C 5E4WC 4BS9A 2K7VA 2VS1A 2K04A 3PIP3 3GTGH 1CHPD 2CQAA 3X3NA 3ZJYC 1E1OA 4L8JA 5KEEA 1VQ8A 3MHBA 4IPHA 4QIWB 1BBXC 3A7LA 1LM0A 3MXNB 1PYBA 4H7BA 1G8ZD 1OXXK 1QE6A 1JOOA 4DR7L 2MFIA 3BVZA 2LFNA 1IW7D 1NCVA 3DM3A 2JA5H 4O1NA 1SYGA 4DN4M 3CMAA 4WJ4A 1TWAH 2K5NA 4EQOA 3BZDB 3BYTB 4PV1C 2F0OA 1RDPD 5IGGA 4B3TL 2CCZA 3GTLH 3I4NH 2F3VA 1RCVD 4IZ8A 2KCTA 2NN6G 1PH5A 4DV0Q 3GTOH 2OQKA 3RZOH 4BA2I 1GHJA 5CYUA 2IX1A 4X3UA 4LF8L 2IX3A 5DEHA 1EIYB 1EZ8A 4UP9A 1CZGA 4A3BB 1YZ6A 4DXGA 1WTQA 1YJ9A 4LF5Q 5IT9E 3VYUA 1QOHA 4EQNA 3J80c 1D7QA 2N8NA 1EUJA 2L15A 4HIDA 5M3FB 3QO2A 1WTHA 3KDFB 2NN6I 3S15B 4IURA 1VQHA 4XYOA 3OOCA 2J7ZA 2RSOA 4H13C 3MWYW 1N34L 2XWJB 2BH2A 1B3QA 1MD2D 1KDAA 1LUZA 1S4ZA 1AE2A 1SYCA 2JA7H 2VUMG 3M4YA 1F9SA 3QWNA 1RF2D 5DM73 3HOZG 2RDGA 2K32A 1TIID 1MHWC 1TT2A 4DNTB 1GUTA 2NVXB 1QCBD 2KBNA 1MGSA 4BBSH 2RHQB 4IALA 3K0XA 3UDXA 1XPOA 2PI2A 3HFZB 4K5VA 2K03A 3HOYB 1JWMD 5HGTA 5NUCA 5C44B 5L37A 1HNWQ 2R93G 2EYLA 2K5QA 2OF1A 1NNXA 5GROA 4QGUA 1I3QB 2QDBA 3W3AA 2VQEQ 4DV4Q 3G48A 1MIUA 4ZUIA 1VQBA 1JOKA 1BCPC 2ZJRA 5ELEA 1ZEQX 2CVRA 5GAGC 4IFDH 1WCMH 3CQZB 5ELOA 1ICWA 2JA8G 5KNCA 1U5KA 1V8QA 2ZXPA 1KAAA 4NDXA 1ZXTA 4ODGA 3PF5A 4EQPA 5A35A 2Z1CA 4DU9A 1PRTF 3ULLA 1IBMQ 3FP9A 2PW7A 5IYCH 2DUDA 1Q1BA 3D4RA 2A68C 3EFXD 4C2MH 5KRUA 1NE3A 1B2TA 3TEHB 1AZPA 4DR6L 3J81L 2EE1A 1JWSD 3EBEA 1TWFH 2OQ0A 4RWSC 3H3VH 1JJCB 1IBLQ 3Q8DA 1TY2A 4OO1I 1CHQD 3AQQA 1YVCA 2EZVA 1DOKA 5CR3A 2F0PA 2O5JC 2JA9A 3K7UC 1V1PA 1SFOB 2J0TD 1LLRD 3GTJB 4S3SA 2HHHL 5C4XH 4A3FG 4KTAA 2F4VQ 5AJ3Q 3AEVA 4HJ8A 1H9MA 1G6PA 4JI2Q 3RN2A 1HA6A 1H9RA 1WI5A 1YHBA 1MBYA 3MFYA 3S2HH 3HOXH 1PH2A 1AW7A 1IHZA 1VQPA 5M3MG 3H0GH 3CCEA 1HZCA 3FHWA 1K3RA 4KI0A 5CV5A 4X66Q 3GO5A 3GTKB 3I7FA 4B3ML 3P7JA 4ZLTF 2EVBA 4L5TA 3HP3A 3VA5A 1PZJD 1ASZA 5G3LD 4FF3A 1FNWA 1B9NA 2PI2E 4ULLA 1CSQA 1SNQA 1Y14B 4LFCL 2UUBL 4ME5A 4MNOA 1BBWA 4FP5D 1O7LA 1ET9A 5LHY1 1F9RA 3I90A 4JI5L 4DK6C 3C2PA 4BY7B 3RLOA 3OHXC 1PHJA 1DYQA 4KKSA 2F03A 1SAPA 2ZM6Q 4R8IA 1I5FA 4IPGA 4RA8A 3MXGA 1J5EL 4R4TA 1LT4D 1SFOH 4LUOA 5I2XA 1EIFA 1B3AA 1LABA 2XN9C 1P8LA 2HUGA 3X3MA 2WACA 1TWGB 2E2HB 3IKJA 2F0NA 1XNRQ 2JA7G 5KIXA 2NVYH 3A55A 3O13A 2Y0SE 2PYKA 4XT3B 1NUCA 3I4NB 3H3VI 4P73A 1CZWA 3H0GG 4GOPC 3ITPA 1JWUD 2JP1A 1Q12A 2KOLA 2MUYA 4HCSA 2XRSD 3CCVA 1CKMA 1OXSC 1EU3A 2BE5C 4LF7L 4JV5L 4QUFA 3Q24A 2C35B 1FD7D 3PO3G 3HKZE 1IBKL 5TSSA 2WB1G 2E5LQ 4DR4L 2ZXRA 1LT6D 5GAHC 2H4OA 2UXDQ 4PG3A 2UXBL 1CQVA 5HURA 1LYLA 1I94Q 4WJWA 3BDOA 1TU2B 1VQOA 3RLNA 2NN6H 3KJOA 1Q8IA 2F0QA 1PTOF 3OTOL 2EJGC 1XTDA 1RODA 4LJZC 4WORA 3GV3A 4JV5Q 3S15H 1X3PA 3HOVB 1G91A 2K5DA 2O5IC 3HOWG 4DFAA 5G3LF 5I9PA 3E0EA 4DV3L 2NVYB 3DMUA 2A69C 3HOUB 1I4QA 2CH4A 1VQDA 5CBAE 3OW7A 1UE1A 2N78A 4XTCS 1GHKA 2F0HA 2XVSA 2NVXH 4JVZA 1AEXA 1RJTA 2JA8H 1HNWL 4A3EG 3KUPA 1SBBB 1JMCA 4IFDG 4OHJA 4YHHQ 4NXML 1H9SB 2JJQA 4JCVE 1RL2A 3ND8A 1RKNA 4A3IG 3T16A 4J15A 1KRSA 4LF8Q 1E24A 3JAME 3I72A 3VR2A 1SE8A 5ELNA 1KABA 3QOLA 1JC7A 2K52A 1NR2A 4FXDA 1LTAD 1HHVA 2CWAA 1LTTD 3PMFA 4LAAA 4R4CA 4RMFA 3S24A 4JI5Q 3PO2G 1EU4A 3M4OB 1PFBA 5IP9G 1WD1A 3MEHA 3WOFA 4YWMA 3I70A 1I50H 5JJLA 4BY1B 1I4RA 3OIQA 2VUMH 4DNRB 4GLVB 3QIAA 1J5EQ 1TWCH 3FMCA 1Q90A 2QW7A 2E2IH 2JA6B 3QOJA 4ZKBB 2R6GA 3ER0A 1XYIA 1STHA 4I7ZC 3QG1A 4QQBX 1SMXA 4IUUA 4KV6A 2FFKB 4GN4B 1TS5A 1SLJA 1I4GA 3TMEA 3S1MH 1KRTA 1PRTB 4JW0A 2ICEC 3ERQA 5J22A 1MKHA 3HOZB 1VF7A 2PW5A 3OWFA 4Y7NH 4PMCA 3I4MB 4JC0A 3Q0AA 1MSGA 3CMEA 2B8FA 5C4XB 3DWPA 3FVQA 3C1FA 4A3FB 1Y8OB 3E9IA 4IFDJ 4FXGC 3I4OA 2PZTA 2F0DA 4DUZQ 2PZWA 1ILPA 3NBHA 1STBA 1PTOB 1XJVA 3UE1A 3KOJA 3M4OH 1Q82C 5EBDA 4DV1Q 1GXDC 4RHSA 1UEBA 4DF7A 3GTKH 2LKVA 1J9OA 4CKEA 4QY7A 1VQFA 2X69A 3BS1A 4KHVA 1BUVT 5EKLA 1NMFA 1ENCA 1Y69U 2PQAA 4G7HC 2JA5G 2F0KA 3WDNA 4HSPA 4JPBW 3T1HL 4C1NK 3CPFA 3KF6A 4JI1L 1ML0D 4RGTA 2L1BA 2E2HH 1WTOA 4LW1A 1SYBA 1SYFA 2JXMB 1ILQA 1VF5C 1HJPA 1EY4A 3M9BA 2JA8B 4K2KA 5D14A 2OCEA 2EYMA 1NTGA 2VXWA 4JI6Q 1IBML 3M3YH 2Z4IA 2KECA 2JE6I 4IO9A 5IWAQ 4LF9Q 1A6XA 1Y8PB 3CC4A 4HMIA 2RCNA 2BDOA 1XPRA 1KIXA 3ICEA 1Y8NB 4DAMA 2AWNA 1YHAA 3VYRA 1YNNC 1HFGA 3L2PA 4ZUJA 4K8IA 1VQNA 2R7ZH 4RKBA 5LMUL 2IY5B 1JCKB 3STBC 1EY6A 2A1AA 2ASBA 2N3SA 3AFQA 5IYBG 4Q5VA 1VQ6A 5HGQA 1VQ9A 3S16B 4H02A 2CHBD 2XGTA 3MFGA 1DJRD 3NQTA 4HN7A 1K73C 2KCNA 2D0OA 2LS01 4ZK9B 5JPMC 3CCRA 1IW7C 1S3OA 2FXQA 3M4QA 4KY6A 2A6HC 1E1TA 3CCUA 1EQVA 2IW3A 3SK6A 5IODA 5M5WB 1SE2A 2BH8A 1VQLA 3PF4A 1WYDA 3KLWA 4A3GB 4LFBL 1HR0L 1IBKQ 5IP9H 4JI3L 3TS0A 4DUZL 3EN2A 1K83H 2O4XA 1OXUA 2YTXA 3NBIA 5M9OA 3PO2H 1OTCA 1L1OC 1BDOA 4A3JH 2RBMA 3G7LA 1Y1WG 1HNXL 1V1QA 3K8AA 1PXUA 1BCPF 1VQ7A 4JBWA 3GP7A 3HOWB 4UP8A 2B2UC 1ZKOA 4G4KA 1TQOA 4EQ5A 4UP7A 2EY6A 3PV0A 4JOIC 4CDCC 3NELA 4DUYL 2DJFC 1A3UA 2XNAC 5BN3A 2R7FA 4NKLA 3S16H 2DY7A 3VR4A 4KMUC 3N6RA 1Z7TA 1WTXA 3V96A 4A3EH 5EKKA 4C3JH 4Y7NB 1GVPA 1QJOA 1UNSA 4E6IA 2FJ2A 3A74A 1PMRA 1X3EA 5LMNW 4FO2A 3BYYB 4ZRZA 1UE7A 1K9MC 4C3IG 4BY1G 2F4VL 3KK7A 1IZ6A 1DCZA 1SDFA 3G6EA 1TXYA 4QIWE 2E75C 4PQXA 4RCNA 1H9JA 3S1NB 4IOCA 4A3GH 5IGFA 4NXNQ 4X6AH 4DUYQ 1K28A 2VZAA 1STNA 5I6YA 1KTKA 1QG7A 4JG2A 5EPLA 4O0AA 3PO2B 2CWPA 5K36H 1QUQB 3MTSA 1N32L 4R1JA 2E2IB 5C0XI 2F0VA 2TSSA 2VUMB 1UE5A 4DR2Q 2A8VA 3URYA 1F2ZA 3S14H 3HEJA 1JR0D 2Z6KA 3IRBA 3J7YW 4OO1H 3PUVA 3PO3H 2NBFA 5FKAC 3S1RH 5C3WA 4L6TB 3H6MA 4DAPA 4YWLA 1ENAA 5GADC 3A8KE 4WFN3 1VQKA 4GOPA 3D6CA 2L4NA 3PCOB 3A5UA 2K5WA 3F1ZA 3CC7A 2N88A 1GUSA 3T4AC 2MJ8A 4NP5A 4OL7A 1KLGD 2KHJA 3SVMA 3T51B 1MSHA 1XNQQ 1P16A 1O78A 4AYBB 1PTOH 1ZYRC 4UDUC 3S1NH 5IT9c 3E3XA 1CA5A 5JEAG 1S72A 4NPSA 5ELFA 4IFDI 5EPKA 5EKIA 5CMDA 5CORA 1M8AA 5C6AA 4DNIA 4HIOA 4LF6L 4JI0L 1J6QA 4ZAIA 4MTNA 2Q8IB 4OWWB 1S5FD 4CHTB 3U58A 2EY1A 1JJGA 1TWCB 2L12A 3F2UA 3PIO3 4OIJA 2QEXA 4JI8L 5BR8Q 4KHZA 2ZJQA 5I6WA 4JI3Q 4GLAC 3NEMA 4HIKA 4RKLA 3MVVA 2EYJA 3S17B 2Z4HA 4QCLA 1EIGA 4QJFA 2G5DA 1SMYC 3OIPA 1SJED 5M3MH 1PTOD 2SDFA 3HOXG 3KDFA 1FJGL 2Y0SB 1RTOA 4WRDA 1CTMA 3TZDA 2NVTB 1YNXA 2QA4A 3C3LA 4A3FH 3MAQA 4K6LA 4IOAA 4JI8Q 5BR8L 4B3MQ 2Z6BA 1ZYRD 1U4LA 5EAYA 4A3KH 2LY7A 4LFAQ 4JBKA 3ZYYX 2HIXA 4M1UB 1JB7A 1Q3LA 2B2WA 3VR5A 1B1ZA 3AU7A 1ICFB 3C1EA 3P1HA 3SK4A 1KLUD 4CJ0B 1WCMB 2LXJA 4R9WA 4RHRA 4A3JB 1EQQA 4BY7H 3HG9A 4X62Q 2RDHA 1QWYA 2A74C 5IYCG 4A3LG 3EIVA 2C5CA 1AE3A 1C4QA 1WJJA 3DHQA 3GTMH 4GNXB 4R8NA 3LGJA 2M2LA 1YJNA 3IFDA 2EPBA 1HCZA 1EEFD 4IJHA 4NB3A 3J81c 1WFQA 1B50A 1WCMG 2UU9L 4X3KA 3I4LA 1VQAA 2K1BA 2D9UA 4NXNL 3UDIA 5KGUA 1N36L 1A0IA 1G51A 1VQEA 2I46A 3CHBD 5ELDA 1G2SA 1ESRA 1QZGA 2AKWB 4DAVA 4DR1Q 2ZT9C 2R93H 1ESFA 2G9DA 3GTJH 3TQYA 2A73B 4DR2L 4X66L 4IUTA 3W1GA 1BVSA 2KUMA 1QZHA 1HFNA 2L11A 2F3IA 1B4OA 3QB3A 3FDTA 2F3WA 4BBSG 2E2JB 1GUNA 4JI2L 5IGDA 3NXWA 4DV4L 1E2VA 5AFWA 4DV5L 1TWHB 5AJ3L 4JBMA 1PVOA 4A3MB 2I07B 5ELBA 3HZXA 3OMCA 1GM5A 1CKOA 5E4XA 1X32A 3D31A 3A5ZB 2VL6A 2N49A 4TRDA 2R3ZA 1F2YA 1OXVA 4DR5Q 3PUZA 1DD2A 1IBLL 4KD3A 4M8AA 1VQ4A 2RHSB 4QF4A 3PUWA 2BOSA 3EQLC 1PV4A 1VQCA 2HQEA 2F0MA 1GUGA 4RGNA 1CM9A 5HY6A 1WTPA 3DWQA 1STGA 1PTOC 1SROA 2O2LD 1W3SA 3S14B 2AHOB 1QB5D 1PFNA 4QL5A 4LMQD 2NVTH 1B9MA 3UDGA 1N33Q 3UI2A 5EGTA 5ELCA 3F2DA 1STAA 2N55A 3JC66 4J8QA 1HZBA 4AYBG 3ULPA 3RN5A 3I4NG 1LTGD 4CBVA 4FF4A 3E9HA 1IKLA 2J4XA 5M5YB 1SE3A 3I91A 1Z6HA 1DONA 3F8TA 3SXHA 3K59A 1I50B 1SNMA 5DLQE 2F52A 4A3BG 4DR3Q 4TSSA 1MJEA 1G2TA 1A2UA 1RD9D 3CPWA 2F0UA 1K8GA 1DGSA 3TP8A 1QNKA 4BA1I 1CKNB 1B70B 5IIFA 2WAQE 1PH9A 1I94L 1QVFA 2R92H 4JI4Q 3OPOA 4PNYA 5LMNL 4EGVA 1D5MC 2MPMA 3NSWA 4KJNA 4KN4C 2A19A 1SE4A 3CW2C 3HGBA 4J6HA 4GLXA 3S9WA 1KXLA 1U4RA 2B2VA 3I4MG 1A8VA 1EY0A 5IYDG 4L5RC 3M7NA 1VCIA 1W2BA 1FYCA 2ZTEA 5FO8B 1X3FA 3CCSA 4F7XA 3HOVG 3J81j 1YI2A 3NTKA 4B9WA 1X55A 2K01A 4GZYC 2TMPA 4DK3C 4DAYB 4LF6Q 2WKDA 2YTVA 4GS3A 1NBWA 2RCFA 2K4KA 4OGQC 1XXGA 1V1PB 3NE5B 2E2DC 2VB3X 3LWUA 4K0KQ 2WKCA 4MIUA 5IY0A 2B8GA 1FL0A 1FNUA 1KNAA 1FR3A 3FPUB 4LF5L 2Z9HA 4K5WA 1PH1A 5C3XA 4JYAL 4O2DA 1TY0A 1LTSD 2MP1A 5C3EG 1E2WA 1SR3A 5FO9B 5K5PA 2WFWA 4BXXG 1OO9B 2KENA 4IUNA 5C0XJ 1UWVA 2EYOA 5FJ8G 4ALPA 1CA6A 5JVH3 2E2JH 1PZID 4A3CH 1H9KA 2YV5A 1BBUA 5KNBA 1S5ED 3NTHA 4YY3Q 2CFMA 1J8IA 3BG3A 1D5XC 1XMQL 1EYCA 3VR6A 2HCCA 1PRTD 1NSNS 1X6OA 2OEOA 2YTYA 4JYAQ 1VDZA 1BQQT 1KC8C 1I4HA 1PH4A 2B2YA 2RDFA 1BKBA 4K5XA 4Q0FA 4IUPA 2I5LX 4K14A 2PMZE 3R2TA 1FNVA 3HOUG 3SHLA 5I9OA 3J7A5 2PPBC 1SN8A 4F88A 4CDFC 4BBRG 2B2TA 4JI4L 1S5CD 1X9NA 3J80i 3ND9A 1C7YA 2UUAQ 4B3RQ 5J3BA 3I8ZA 5LL6X 3GTLB 1CK1A 2B3GA 4H44C 4YCWA 3WOEA 4ZKCB 4DXFA 3HOYG 3SK5A 1CUKA 3K7AB 3RLFA 2CKZB 4AYBE 2KCCA 1PA6A 3RR5A 3W2DA 1H95A 4FYDA 1SNPA 4XYQA 2K05A 1G291 3L3OC 3K58A 4FF2A 4IUQA 3MC0B 4RG1A 2KA7A 4HIMA 4X3TA 2DNEA 1CKNA 2B39A 2DGYA 3RD4A 4K0KL 2KHIA 1EY9A 2B63B 1TWFB 3CAMA 3I2ZA 3QR8A 3TREA 3NPPA 4L63B 1LV9A 3VDYA 3NUCA 4AIMA 3S2DB 4KN7C 2XIWA 5J39A 3J7AV 3L9AX 1Z9FA 4DV6L 4N9PA 4AQYL 1I6VC 1MJCA 2A5HA 4ILWA 5IYDH 4TVAB 2OWOA 4RFBA 1QILA 3D4DA 4U673 4KK7A 2Z8LA 4A3DG 3RZOB 3HKSA 2AQ1B 4Y52H 2UUCL 1D5ZC 4YIJA 1BXTA 1LACA 3NWTA 3TS2A 5JJZA 4LNQA 2MO0A 5EQ0A 3K7AH 1K8OA 3GTQB 3T13A 5C44H 1STYA 2K5VA 3CC2A 4JI6L 2ZTDA 4A3EB 4G7ZC 1JE4A 1ET6A 1SRUA 2D2CC 3BJUA 1EY5A 2Q2IA 4QB4A 4AH6A 4DK0A 3KLSX 4MN3A 1PH8A 3TSSA 4GNXA 2JA6G 5M5XB 2KEEA 2QKIC 3I3CA 1TVXA 3S2HB 2NVQB 5C4HA 4A3MH 5FK9C 2Q2TA 5C0XG 1L0XB 1Y1VG 2DJGC 4APVA 1LT5D 2L55A 5M3FH 3AMUA 3RZDB 4LFCQ 3HRZC 5CV8A 2ZTCA 1YEZA 3LWEA 2RQXA 4RCOA 3J80L 2FMCA 4HAEA 3S1RB 3PIOA 3NTIA 1F2MA 2EXZA 3OYYA 1T5EA 5BN4A 4KHPQ 5E1FA 5IGBA 4KKUA 4XQNA 3BDLA 1Y1WB 1DZ1A 2A6HD 2MQHA 1IXRA 4LK1C 3M85A 1K0SA 3GTQH 3V2TA 4FF1A 3A56A 4C3HH 1PFMA 3D3RA 5M3FG 4P75A 3H0GB 2PNHA 3H3VC 1Y1VH 3DXJC 5C0XH 3PIPA 3U50C 2JN4A 5C5LA 3HS0C 1UE6A 5M5YH 2KHSA 1I3QH 1Q8KA 1XNQL 1Q1EA 1S40A 4UY8C 5CBEE 2NWGA 3E0JA 1S5DD 3E6ZX 1EEID 4CKCA 1SNCA 1O7YA 3AFPA 2IJ0A 2JEBI 4WJ3M 4RGMA 4P71A 2WINB 1EQRA 4ZYSA 3MXNA 3T53B 5FLMH 2ENBA 3I56A 2UUAL 4A93H 1TS4A 4PMBA 1VMCA 1AH9A 1C0AA 1TS2A 5IE8A 1BNZA 2F1MA 3J7AF 3RNUA 3H91A 3S2DH 1PLFA 2EYFA 2JEAI 3PUXA 4V190 1MI2A 4K8JA 1E0BA 4P2CB 1HZAA 1SNDA 3KF6B 4A3DH 1JE5A 1NY4A 2DNCA 3GV6A 4DR6Q 2V1CC 3AYHB 2PQEA 1GOZA 4HJ7A 1HTLD 4OO1G 3K80C 4YY3L 4KY5A 4G7OC 1FJGQ 1DOMA 2X6GA 4ABNA 3IFTA 2L5TA 4P72A 4V0BA 1T9HA 1EQTA 1EYDA 2EJMA 4X64L 4B3SQ 5C4ZA 3J7ZC 3PO3B 3DWAA 3R93A 4CDDC 4KHPL 4DKAC 4UHVA 4POFA 3K5OA 1K8AC 5F2DA 5EBCA 4C3HG 4L5QA 5JJIA 4A3GG 4XDXA 4A75A 2QGQA 5BN5A 2QDLA 2NUCA 1PDQA 4P74A 4FDBA 5D3DA 1U9RA 1RTNA 3U9OA 2LXKA 3GQBA 2IL8A 1WVLA 1EFID 4LFAL 4C3JG 4HCEA 2E5LL 4K6DA 3CKIB 1HNXQ 2B2TC 5JJKA 1M90C 2B63H 4OWTB 2NZ1D 1D1KA 3HOUH 5E7NA 1DM0B 1VQGA 1HQMC 4KJOA 2B29A 1SYEA 4CGYB 2DY8A 2F0FA 3KJPA 1KL9A 3UE0A 1EOVA 2VQEL 1V1OA 4JI1Q 2XWBB 1U4PA 4N9TA 4JI0Q 1JQYD 1JT8A 1EZ6A 4C3IB 1EOTA 3NP8A 4GNXC 1CFMA 4B9XA 1Y1WH 2H5XA 1AZQA 4A3JG 3NENA 3CCJA 2AQ2B 2RSNA 2FMMA 5IOCA 5M5XH 1B53A 2H1EA 1EFWA 5I2YA 1NR4A 3GD7A 3LNNA 3JAMc 2UXDL 1II3A 5C44G 2R93B 1GJXA 1XX8A 3F2CA 2QF7A 2PZUA 1PH3A 3GTOB 4KKTA 3HKZB 3K0YA 4OXPA 1A63A 1N8RC 3NK9A 2HT1A 4TKOB 4A4IA 1TWHH 3NWSA 3IL8A 4C1NI 1D2BA 1BF4A 2NZOA 4B3SL 2WAQB 1YITA 1BO0A 1FVIA 1GO3E 1YNJC 5KNDA 4C56C 1PYWD 2KVMA 3MXUA 3P75A 3D6WA 2GA4B 4L5SA 1LTBD 1HUMA 2F4IA 4MHEA 1EY8A 2EOTA 1Q7YC 3SE0A 3R3OA 1I4XA 3PUYA 2RVLA 1TWAB 3M3YB 5J1ZA 3GTPH 2WAQG 2QCPX 2AMCB 4I7AA 4U68A 4X62L 1F77A 3HOVH 5FLXc 4I65A 3TP7A 4A3DB 1N36Q 3WWVA 4HMJA 4OELB 2A69D 3H94A 3U9SA 3FEWX 2AQ3B 4LUVA 3I4MH 1BCPD 2B2VC 2SNMA 2WB1E 1F9PA 2F0GA 2HIVA 3HKZG 2A6ED 5ISRA 1IYJB 1V9PA 1QUQA 3FKIH 1C8CA 3D0FA 4ID6A 4C3HB 4GOPB 2I0QA 1C9OA 1F2LA 2R92G 4DGZA 2X6LA 3CXCA 4HJ9A 2V4DA 1PFSA 4BBRH 5JPNC 4HEDA 3D8GA 4DR7Q 4H0LC 4A3BH 5CC4A 2SEBD 4BWGB 2LMCB 4OEMB 1W6KA 2G9HD 2B2YC 2NB0A 3STBD 3H09A 1NMGA 1K8MA 1Z47A 4PZ8A 2HQLA 3A54A 2K28A 4DR3L 2ALYB 3K5LA 5LL6S 1JJ2A 4R4IA 4X65Q 2EXDA 2JA5B 3S1MB 1A3VA 1EWCA 1AP0A 1TR5A 3DM1A 1WD0A 3VYTA 4A3CG 5DNFA 4OX9L 4GKKL 1PZKD 2NZHA 1VMPA 5DM63 5FJ8H 1AFPA 4IN3A 3CRKC 1NAPA 3T1HQ 1XWEA 1CSPA 4YHHL 4BXXH 2I5HA 5LMNQ 5CV9A 1STEA 1G6ZA 2D62A 3TZUA 4CJ1B 5IGCA 5C3EH 3BDCA 3I73A 4ZCKA 4UAIA 3TP5A 1VQIA 2Q8RE 4FNFA 1L0WA 3K81C 4HR7B 3FKIG 1UEAB 1YHQA 4DR4Q 2IPKD 1X3QA 1JICA 1N9WA 1LTID 1LT3D 3TBIB 1AN8A 4DV7L 4EX5A 1B7YB 4YCUA 2VNUD 2WIIB 3CU7A 1N34Q 5LMUQ 3G71A 1M4VA 4UPAA 3VYSA 1I4PA 4MTKA 1ASYA 1DXMA 2WP8J 4DV2L 1A15A 1E7ZA 1UAPA 3T1YQ 4PZ7A 3M4PA 1HPCA 5KYLA
chains in the Genus database with same CATH topology
2HDLA 3VA7A 1D1IA 3J81E 3TN2A 5FLXL 3DEOA 4EVOA 1OXTA 2R61A 5DAUA 3P20A 3D4WA 3FPPA 5CV6A 4HSVA 1LTRD 4J1MA 1KDBA 1S5BD 1JORA 4XIGS 2Q8TA 1CQFA 1BCPB 2PO4A 2BA0A 2OXPA 1YNND 3SDZA 4PMWA 3HOXB 3MXPA 1YNJD 3FRPB 3FKIB 2B2WC 1WTRA 1XTCD 2R7ZB 1HRJA 2OT2A 3QJYA 1WTWA 4TQUS 4K2LA 1R9TB 3KBXA 1ONLA 2AWOA 2AUJD 1KDCA 1GUOA 5JEAJ 5IGEA 2F0EA 4QMGA 3DUZA 5E3FA 2HDMA 1IL8A 1SNOA 4IQZA 3OMGA 4XQJA 3GTPB 2F0JA 1HXYD 1K83B 4XT1B 3A8IE 5EPJA 4F8MA 2BDNA 3LX0A 3OWEB 5JOBA 2WB1B 1HTPA 1SSOA 1LO5D 4BBRB 3N52A 1SXTA 3BVMA 1DOLA 1GUWA 3TP6A 2XRQD 3R8BA 5M3MB 1E2ZA 2KEDA 3Q23A 3ONAB 1U4MA 1CI3M 2CW0D 5CGKA 3K57A 1IKMA 4FVMA 2QILA 1C48A 2YU9B 2KJXA 4A3IB 2XSCA 2ID0A 2NTSA 3EROA 5IT9L 4ZQ3A 1ENFA 2D5DA 1H9SA 2MGSA 1TS3A 3BVGA 1O7ZA 2A68D 2NYZD 1PRTC 4FXKC 1EWHA 3T56B 4XXEA 4CKBA 2DN8A 1V43A 5KYIA 1O80A 3GTMB 1A2TA 3A7AB 1F9QA 3KLSA 3NHHA 5C3EB 1B44D 1Y1VB 5C4JB 3NQIA 4A3KB 4DA2A 3K5NA 1UUPA 4O42A 3K6OA 3VR3A 5FO7B 2A6EC 1SEBD 5JVG3 1TKWB 4OIKA 4NMZA 1W6JA 3KLRA 5T1IA 4HTHA 1HUNA 2MHVA 3MZ5A 4G57A 1IYUA 4XQQA 4A93B 1BOSA 4X3SA 1EL0A 3MA2B 2EYPA 2VB2X 1EIHA 3A8JE 5FLXE 1SMYD 2KQ3A 1QNUA 3Q6SA 2EY5A 3SR1A 1BR9A 2E74C 1R4QB 4DAYA 2YYZA 2K6AA 3JAML 2PMZB 5JEAH 1KNEA 1CT1D 2RA4A 1EYAA 5I4DA 3EVQA 2F0WA 2AUKA 2FINB 4RH6A 3Q22A 3S1QB 1RHPA 4NW2A 1SJHD 2EDGA 5A2QL 2CW0C 4F87A 5COYA 4RGOS 2R92B 1JB3A 5T1GA 2BE5D 3G6JB 4Z9CB 3GTGB 1I6HB 3RMHA 5JAVA 3SK8A 3AB9A 1HQRD 2JA7B 4C2MB 2EYHA 2PNRC 1WTVA 5CV7A 4DK1A 3M7GA 5CV4A 5K36G 2SOBA 1SYDA 5D65A 3KF8A 2BCOA 3EJIA 4CJ2C 4IUVA 4KY7A 4QUCA 2M9VA 2EJFC 2L0CA 2F0TA 2FHTA 3R2IA 2SNSA 2L9HA 2RKSA 3V05A 4BBSB 2C9OA 4KD4A 3E5SA 1A3TA 1L0YB 3TDQA 2PCFB 5C5MA 1D6EC 4B08A 1T5XD 4RAUC 2B2UA 2F0IA 2M00A 3C46A 5FOBB 3SEBA 1R4PB 2HCIA 2ZXOA 3CRLC 3EA6A 3L7ZC 1EY7A 2EY2A 2JSOA 2JYOA 3K5MA 1IYVA 2NTTA 2F0SA 3IAYA 3OSOA 3KBGA 5EJWA 2BA1A 4JK1C 3J80E 4C3JB 2ICIA 3RUZA 2WV6D 1JOQA 2IWHA 5D3IB 2QEJC 2IT1A 5A2QE 1HA5A 2K33A 1FGBD 2F0LA 3DEPA 2IX0A 2E76C 5E4WC 4BS9A 2K7VA 2K04A 3PIP3 3X3NA 1CHPD 2CQAA 4L8JA 5KEEA 3MHBA 4QIWB 1BBXC 3A7LA 4H7BA 1G8ZD 1OXXK 1QE6A 1JOOA 3BVZA 2LFNA 1IW7D 1NCVA 4O1NA 1SYGA 4DN4M 4EQOA 3BZDB 3BYTB 4PV1C 2F0OA 1RDPD 5IGGA 2F3VA 1RCVD 4IZ8A 2NN6G 4BA2I 1GHJA 5CYUA 2IX1A 4X3UA 2IX3A 5DEHA 1EZ8A 4A3BB 1CZGA 4DXGA 1WTQA 5IT9E 3VYUA 1QOHA 4EQNA 5M3FB 3QO2A 2NN6I 3S15B 4IURA 4XYOA 3OOCA 2J7ZA 2RSOA 4H13C 3MWYW 2XWJB 1MD2D 1KDAA 1S4ZA 1SYCA 3M4YA 1F9SA 3QWNA 1RF2D 5DM73 2RDGA 2K32A 1TIID 1TT2A 4DNTB 1GUTA 2NVXB 1QCBD 1MGSA 4IALA 4K5VA 2K03A 3HOYB 1JWMD 5HGTA 5NUCA 5C44B 2EYLA 2K5QA 2OF1A 1I3QB 2QDBA 3W3AA 4ZUIA 1JOKA 1BCPC 5ELEA 1ZEQX 2CVRA 4IFDH 3CQZB 1ICWA 5KNCA 1V8QA 2ZXPA 1KAAA 4NDXA 1ZXTA 4ODGA 4EQPA 5A35A 2Z1CA 4DU9A 1PRTF 2PW7A 1Q1BA 3D4RA 2A68C 3EFXD 5KRUA 1B2TA 1AZPA 3J81L 2EE1A 1JWSD 4RWSC 1TY2A 4OO1I 1CHQD 2EZVA 1DOKA 5CR3A 2F0PA 2O5JC 1V1PA 1SFOB 2J0TD 1LLRD 3GTJB 4S3SA 4KTAA 1H9MA 1HA6A 1H9RA 1MBYA 3MFYA 1AW7A 1IHZA 4KI0A 5CV5A 3GTKB 3GO5A 3P7JA 4ZLTF 2EVBA 3HP3A 3VA5A 1PZJD 5G3LD 4FF3A 1FNWA 1B9NA 4ULLA 1SNQA 4ME5A 4FP5D 1O7LA 1ET9A 5LHY1 1F9RA 3I90A 3C2PA 4BY7B 3OHXC 1DYQA 4KKSA 2F03A 1SAPA 4R8IA 4RA8A 3MXGA 1LT4D 5I2XA 1B3AA 1LABA 2XN9C 2HUGA 3X3MA 2WACA 1TWGB 2E2HB 3IKJA 2F0NA 5KIXA 3A55A 3O13A 2PYKA 4XT3B 1NUCA 3I4NB 1CZWA 3ITPA 1JWUD 2JP1A 1Q12A 2KOLA 2MUYA 4HCSA 2XRSD 1OXSC 1EU3A 2BE5C 4QUFA 3Q24A 1FD7D 5TSSA 2ZXRA 1LT6D 2H4OA 1CQVA 5HURA 4WJWA 3BDOA 1TU2B 2NN6H 1Q8IA 2F0QA 1PTOF 2EJGC 1RODA 4LJZC 4WORA 3GV3A 1X3PA 3HOVB 1G91A 2K5DA 2O5IC 4DFAA 5G3LF 5I9PA 2NVYB 3DMUA 2A69C 3HOUB 1I4QA 5CBAE 3OW7A 4XTCS 1GHKA 2F0HA 2XVSA 1AEXA 1RJTA 3KUPA 1SBBB 4IFDG 4OHJA 1H9SB 3ND8A 1RKNA 3T16A 3JAME 3I72A 3VR2A 1KABA 3QOLA 1JC7A 1NR2A 4FXDA 1LTAD 1HHVA 4LAAA 1LTTD 3PMFA 1EU4A 3M4OB 1PFBA 1WD1A 3MEHA 3WOFA 3I70A 4BY1B 1I4RA 3OIQA 4DNRB 3QIAA 3FMCA 1Q90A 2JA6B 3QOJA 4ZKBB 2R6GA 1XYIA 1STHA 4I7ZC 3QG1A 4IUUA 4KV6A 2FFKB 1TS5A 1I4GA 3TMEA 1PRTB 2ICEC 3ERQA 5J22A 3HOZB 1VF7A 2PW5A 3OWFA 4PMCA 3I4MB 3Q0AA 1MSGA 5C4XB 2B8FA 3DWPA 3FVQA 3C1FA 4A3FB 1Y8OB 4IFDJ 4FXGC 2PZTA 2F0DA 1ILPA 2PZWA 3NBHA 1STBA 1PTOB 5EBDA 1GXDC 4RHSA 4DF7A 2LKVA 1J9OA 4CKEA 2X69A 3BS1A 4KHVA 1BUVT 5EKLA 1ENCA 1Y69U 4G7HC 2F0KA 3WDNA 4HSPA 4C1NK 1ML0D 4RGTA 2L1BA 1WTOA 1SYBA 1SYFA 2JXMB 1ILQA 1VF5C 1EY4A 2JA8B 4K2KA 5D14A 2EYMA 2VXWA 2Z4IA 2KECA 2JE6I 1A6XA 1Y8PB 4HMIA 2BDOA 1Y8NB 2AWNA 3VYRA 1YNNC 1HFGA 4ZUJA 4K8IA 4RKBA 1JCKB 1EY6A 4Q5VA 3S16B 2CHBD 3MFGA 1DJRD 3NQTA 4HN7A 2KCNA 2LS01 4ZK9B 5JPMC 1IW7C 4KY6A 2A6HC 1EQVA 3SK6A 5M5WB 2IW3A 5IODA 1SE2A 4A3GB 2O4XA 5M9OA 1OXUA 3NBIA 1BDOA 2RBMA 3G7LA 1PXUA 1BCPF 3GP7A 4JBWA 3HOWB 2B2UC 1ZKOA 4G4KA 1TQOA 2EY6A 3PV0A 1A3UA 2XNAC 5BN3A 4NKLA 2DY7A 3VR4A 4KMUC 3N6RA 1Z7TA 1WTXA 3V96A 5EKKA 4Y7NB 1QJOA 1UNSA 4E6IA 2FJ2A 1PMRA 4FO2A 3BYYB 4ZRZA 4C3IG 3KK7A 1DCZA 1SDFA 2E75C 4PQXA 4RCNA 1H9JA 3S1NB 5IGFA 1STNA 5I6YA 1KTKA 1QG7A 5EPLA 3PO2B 5K36H 3MTSA 5C0XI 2F0VA 2TSSA 2VUMB 3URYA 1F2ZA 3HEJA 1JR0D 3J7YW 4OO1H 3PUVA 2NBFA 5FKAC 5C3WA 4L6TB 3H6MA 4DAPA 1ENAA 3A8KE 4WFN3 3D6CA 2L4NA 2K5WA 2N88A 1GUSA 3T4AC 2MJ8A 4NP5A 4OL7A 1KLGD 3SVMA 3T51B 1MSHA 1O78A 4AYBB 1PTOH 1ZYRC 4UDUC 1CA5A 5JEAG 5ELFA 4IFDI 5EPKA 5EKIA 5CMDA 5CORA 1M8AA 5C6AA 4ZAIA 2Q8IB 1S5FD 4CHTB 2EY1A 1TWCB 2L12A 3F2UA 3PIO3 4OIJA 4KHZA 5I6WA 4RKLA 3MVVA 2EYJA 3S17B 2Z4HA 4QCLA 1EIGA 1SMYC 3OIPA 1SJED 1PTOD 2SDFA 2Y0SB 1RTOA 4WRDA 1CTMA 3TZDA 2NVTB 3C3LA 3MAQA 4K6LA 1ZYRD 1U4LA 2LY7A 3ZYYX 4M1UB 1Q3LA 2B2WA 3VR5A 1B1ZA 3AU7A 3C1EA 3P1HA 3SK4A 1KLUD 4CJ0B 1WCMB 4R9WA 4RHRA 4A3JB 3HG9A 2RDHA 1QWYA 2A74C 2C5CA 1C4QA 3DHQA 4R8NA 2M2LA 3IFDA 2EPBA 1HCZA 1EEFD 1B50A 4X3KA 3I4LA 2K1BA 2D9UA 5KGUA 2I46A 5ELDA 3CHBD 1G2SA 1ESRA 4DAVA 2ZT9C 1ESFA 2G9DA 2A73B 4IUTA 2KUMA 1HFNA 2L11A 1B4OA 3QB3A 3FDTA 2F3WA 2E2JB 1GUNA 5IGDA 3NXWA 1E2VA 5AFWA 1TWHB 4A3MB 2I07B 5ELBA 3HZXA 3OMCA 5E4XA 1X32A 3D31A 4TRDA 2R3ZA 1F2YA 1OXVA 3PUZA 1DD2A 4KD3A 4M8AA 4QF4A 3PUWA 2BOSA 3EQLC 2HQEA 2F0MA 1GUGA 4RGNA 1CM9A 1WTPA 3DWQA 1STGA 1PTOC 2O2LD 3S14B 1QB5D 1PFNA 4LMQD 1B9MA 3UI2A 5EGTA 5ELCA 1STAA 2N55A 4J8QA 1LTGD 4CBVA 4FF4A 1IKLA 2J4XA 5M5YB 1SE3A 3I91A 1Z6HA 1DONA 3SXHA 3K59A 1I50B 1SNMA 4TSSA 1G2TA 1A2UA 1RD9D 2F0UA 3TP8A 4BA1I 1QNKA 5IIFA 3OPOA 4PNYA 4EGVA 1D5MC 2MPMA 3NSWA 4KJNA 4KN4C 1SE4A 4J6HA 3HGBA 3S9WA 1U4RA 2B2VA 1EY0A 3M7NA 1VCIA 1FYCA 5FO8B 4F7XA 3NTKA 4B9WA 2K01A 4GZYC 2TMPA 2WKDA 4OGQC 1XXGA 1V1PB 3NE5B 2E2DC 2VB3X 3LWUA 2WKCA 4MIUA 2B8GA 1FNUA 1KNAA 1FR3A 3FPUB 4K5WA 5C3XA 1TY0A 1LTSD 2MP1A 1E2WA 5FO9B 5K5PA 1OO9B 1CA6A 4IUNA 5C0XJ 2EYOA 5JVH3 1PZID 1H9KA 5KNBA 1S5ED 3NTHA 1J8IA 3BG3A 1D5XC 1EYCA 3VR6A 2HCCA 1PRTD 1NSNS 2OEOA 1VDZA 1BQQT 1I4HA 2B2YA 2RDFA 4K5XA 4Q0FA 4IUPA 4K14A 3R2TA 1FNVA 3SHLA 5I9OA 2PPBC 4F88A 2B2TA 1S5CD 3ND9A 3I8ZA 5LL6X 3GTLB 1CK1A 4H44C 3WOEA 4ZKCB 4DXFA 3SK5A 3K7AB 3RLFA 2KCCA 3W2DA 4FYDA 1SNPA 4XYQA 2K05A 1G291 3L3OC 3K58A 4FF2A 4IUQA 3MC0B 2KA7A 4X3TA 2DNEA 2B39A 3RD4A 1EY9A 2B63B 1TWFB 3NPPA 4L63B 1LV9A 3NUCA 3S2DB 4KN7C 2XIWA 5J39A 3J7AV 3L9AX 4N9PA 1I6VC 2A5HA 4ILWA 4RFBA 1QILA 3D4DA 4U673 4KK7A 2Z8LA 3RZOB 2AQ1B 1D5ZC 4YIJA 1BXTA 1LACA 3NWTA 5JJZA 5EQ0A 1K8OA 3GTQB 3T13A 1STYA 4A3EB 4G7ZC 1JE4A 1ET6A 2D2CC 1EY5A 4QB4A 4DK0A 3KLSX 4MN3A 3TSSA 5M5XB 2KEEA 2QKIC 3I3CA 1TVXA 3S2HB 2NVQB 5C4HA 5FK9C 5C0XG 1L0XB 1LT5D 2L55A 3AMUA 3RZDB 3HRZC 5CV8A 3LWEA 2RQXA 4RCOA 3J80L 2FMCA 4HAEA 3S1RB 3NTIA 1F2MA 2EXZA 1T5EA 5BN4A 5E1FA 5IGBA 4KKUA 4XQNA 3BDLA 1Y1WB 1DZ1A 2A6HD 4LK1C 3M85A 3V2TA 4FF1A 3A56A 1PFMA 3D3RA 3H0GB 3H3VC 3DXJC 5C0XH 5C5LA 3HS0C 2KHSA 1Q1EA 5CBEE 2NWGA 3E0JA 1S5DD 3E6ZX 1EEID 4CKCA 1SNCA 1O7YA 2IJ0A 2JEBI 4RGMA 2WINB 4ZYSA 3MXNA 3T53B 2ENBA 1TS4A 4PMBA 1VMCA 1TS2A 1BNZA 3J7AF 2F1MA 3H91A 1PLFA 2EYFA 2JEAI 3PUXA 4V190 1MI2A 4K8JA 1E0BA 4P2CB 1SNDA 2DNCA 3GV6A 2PQEA 1GOZA 1HTLD 4OO1G 4KY5A 4G7OC 1DOMA 2X6GA 4ABNA 3IFTA 2L5TA 4V0BA 1EQTA 1EYDA 2EJMA 5C4ZA 3PO3B 3DWAA 3R93A 3K5OA 5F2DA 5EBCA 4C3HG 4XDXA 5BN5A 2NUCA 1PDQA 5D3DA 1U9RA 1RTNA 3U9OA 3GQBA 2IL8A 1WVLA 1EFID 4C3JG 4HCEA 4K6DA 3CKIB 2B2TC 2NZ1D 1D1KA 1DM0B 1HQMC 4KJOA 4CGYB 1SYEA 2DY8A 2F0FA 1V1OA 2XWBB 1U4PA 4N9TA 1JQYD 1EZ6A 4C3IB 1EOTA 3NP8A 1CFMA 4B9XA 1AZQA 2AQ2B 2RSNA 2FMMA 5IOCA 1B53A 2H1EA 5I2YA 1NR4A 3GD7A 3LNNA 1II3A 2R93B 1GJXA 1XX8A 2QF7A 2PZUA 3GTOB 4KKTA 3HKZB 3K0YA 3NK9A 4TKOB 3NWSA 3IL8A 4C1NI 1D2BA 1BF4A 2WAQB 1BO0A 1YNJC 5KNDA 4C56C 1PYWD 2KVMA 3MXUA 3P75A 3D6WA 2GA4B 1LTBD 1HUMA 2F4IA 1EY8A 4MHEA 2EOTA 3SE0A 3R3OA 1I4XA 3PUYA 2RVLA 1TWAB 3M3YB 5J1ZA 2QCPX 4U68A 2E2IB 1F77A 4A3DB 4I65A 3TP7A 4HMJA 2A69D 3H94A 3U9SA 3FEWX 2AQ3B 1BCPD 2B2VC 2SNMA 1F9PA 2F0GA 2A6ED 5ISRA 1C8CA 4ID6A 4C3HB 1F2LA 4DGZA 2X6LA 2V4DA 5JPNC 4HEDA 3D8GA 4H0LC 5CC4A 2SEBD 4BWGB 2LMCB 1W6KA 2G9HD 2B2YC 2NB0A 3H09A 1K8MA 1Z47A 3A54A 2K28A 3K5LA 5LL6S 2JA5B 3S1MB 1A3VA 1EWCA 1AP0A 1TR5A 3DM1A 1WD0A 3VYTA 5DNFA 1PZKD 1VMPA 5DM63 1AFPA 4IN3A 3CRKC 1NAPA 1XWEA 5CV9A 1STEA 1G6ZA 2D62A 3TZUA 4CJ1B 5IGCA 3BDCA 3I73A 3TP5A 4UAIA 4FNFA 2Q8RE 4HR7B 1UEAB 2IPKD 1X3QA 1JICA 1LTID 1LT3D 3TBIB 1AN8A 2VNUD 2WIIB 3CU7A 1M4VA 3VYSA 1I4PA 1DXMA 2WP8J 1A15A 1UAPA 1HPCA 5KYLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EE1 A;  3SVM A;  2HDL A;  4HAE A;  3I8Z A;  1MSH A;  2B2V C;  4RWS C;  1F9P A;  2KED A;  1B50 A;  2HCI A;  4X3K A;  3TN2 A;  3ONA B;  1PDQ A;  3DEO A;  4ZKC B;  1U4M A;  2MPM A;  1KNE A;  1C8C A;  1CA5 A;  4X3U A;  1IKM A;  2K1B A;  1MSG A;  2D9U A;  2RA4 A;  1DOK A;  1RTN A;  1DZ1 A;  3G7L A;  1WTQ A;  2IL8 A;  5EPK A;  1U4R A;  1F2L A;  2B2V A;  1WVL A;  1G2S A;  2FIN B;  5EKI A;  5COR A;  5CMD A;  2JYO A;  1ESR A;  1M8A A;  2K05 A;  2X6L A;  4HSV A;  1RHP A;  1ILP A;  1ROD A;  2B2U C;  4NW2 A;  3GV3 A;  4IUQ A;  1PFM A;  2B2T C;  4HED A;  4ZAI A;  1X3P A;  2NZ1 D;  4IUT A;  4X3T A;  2KUM A;  2K01 A;  3QO2 A;  1G91 A;  1HA6 A;  1HFN A;  2Q8T A;  2L11 A;  5EJW A;  5COY A;  1B4O A;  1J9O A;  2MGS A;  2DY8 A;  3FDT A;  2L12 A;  4IUR A;  3F2U A;  2X69 A;  2B2Y C;  5CBE E;  2J7Z A;  1O7Z A;  2DY7 A;  2RSO A;  4OIJ A;  2NWG A;  2NYZ D;  3MWY W;  5T1G A;  5AFW A;  1U4P A;  5CBA E;  3P7J A;  4ZLT F;  1WTX A;  3HP3 A;  1O7Y A;  1S4Z A;  1EOT A;  1LV9 A;  2FJ2 A;  2B2W C;  1RJT A;  1F9S A;  3KUP A;  4XDX A;  1WTR A;  5E4X A;  1AZQ A;  2XIW A;  2K28 A;  1ML0 D;  1KNA A;  1X32 A;  3FPU B;  2L1B A;  2RSN A;  2FMM A;  1WTO A;  1EIG A;  1HRJ A;  1MGS A;  1B53 A;  2H1E A;  2R3Z A;  1WTV A;  1AP0 A;  1ILQ A;  2SDF A;  1O80 A;  1NR4 A;  1VMC A;  3DEP A;  3DM1 A;  1F9R A;  1SDF A;  1WD0 A;  2MP1 A;  3I90 A;  5E4W C;  5DNF A;  1WTW A;  1RTO A;  1VMP A;  1BNZ A;  1XX8 A;  2K03 A;  2K04 A;  3H91 A;  5D65 A;  1F9Q A;  4CJ2 C;  4IUV A;  5D14 A;  1NAP A;  3TZD A;  1PLF A;  2VXW A;  3KBX A;  1MI2 A;  1WTP A;  1CM9 A;  1E0B A;  5JJZ A;  1SAP A;  2KEC A;  4O42 A;  4R8I A;  4RA8 A;  1BBX C;  5EQ0 A;  1CA6 A;  1QG7 A;  5EPL A;  1G6Z A;  4CJ1 B;  4QUC A;  1NR2 A;  1U4L A;  3MTS A;  1HHV A;  4UAI A;  3IL8 A;  2Q8R E;  1QE6 A;  1BF4 A;  1JE4 A;  1HFG A;  3GV6 A;  1J8I A;  1B3A A;  1BO0 A;  1IL8 A;  1PFB A;  2HDM A;  1PFN A;  4LMQ D;  2CVR A;  2HUG A;  4OIK A;  1WD1 A;  2FHT A;  2HCC A;  5T1I A;  4MN3 A;  1Q3L A;  2L9H A;  1HUN A;  1ICW A;  1NCV A;  3UI2 A;  1X3Q A;  2B2W A;  2KEE A;  2KVM A;  4DN4 M;  1JIC A;  2N55 A;  3I3C A;  3D6W A;  4XT1 B;  1DOM A;  1TVX A;  2X6G A;  4X3S A;  4CJ0 B;  4R9W A;  4XT3 B;  5EPJ A;  1ZXT A;  1EQT A;  1IKL A;  1HUM A;  2B2Y A;  2BDN A;  4MHE A;  3I91 A;  2EOT A;  1EL0 A;  1DON A;  1EIH A;  4IUP A;  2JP1 A;  2KOL A;  4ZKB B;  1SSO A;  4HCS A;  2RVL A;  1XYI A;  3R93 A;  4ZK9 B;  3Q6S A;  4U68 A;  2B2T A;  2L4N A;  4IUU A;  2B2U A;  3N52 A;  4RAU C;  4QUF A;  1B2T A;  1G2T A;  2FFK B;  2N88 A;  1A15 A;  1DOL A;  1QNK A;  1AZP A;  1GUW A;  3LWE A;  2M2L A;  2MJ8 A;  3IFD A;  2EPB A; 
#chains in the Genus database with same CATH topology
 2HDL A;  3VA7 A;  4N8F A;  4A3I H;  2MO1 A;  4DV3 Q;  1D1I A;  3J81 E;  3TN2 A;  5FLX L;  3DEO A;  1XPU A;  4EVO A;  1OXT A;  2R61 A;  4KLK A;  3P20 A;  5DAU A;  3D4W A;  2VW9 A;  4N8X 1;  1HNZ Q;  3L0O A;  2ZM6 L;  3FPP A;  5CV6 A;  4HSV A;  4IPC A;  3ERS X;  1LTR D;  4J1M A;  1E22 A;  4DV0 L;  1KDB A;  1S5B D;  1JOR A;  4XIG S;  3HOW H;  2Q8T A;  1Q46 A;  1VQJ A;  1CQF A;  1BCP B;  2PO4 A;  1XNR L;  1HZ9 A;  2BA0 A;  2OXP A;  1YNN D;  4DV1 L;  2UU9 Q;  3SDZ A;  4PMW A;  1KAW A;  3HOX B;  1A62 A;  3MXP A;  1YNJ D;  3FRP B;  3JAM i;  3FKI B;  4X65 L;  4HJ5 A;  2B2W C;  3MEF A;  2Q2U A;  1WTR A;  1XTC D;  2R7Z B;  1XMO Q;  1VQ5 A;  4CDE C;  1YIJ A;  1HRJ A;  2VY3 A;  5M5W H;  1X56 A;  2OT2 A;  3U4Z A;  4A76 A;  3QJY A;  1N32 Q;  1E3P A;  1WTW A;  2RF4 A;  1HH2 P;  2HD3 A;  2B63 G;  4TQU S;  4K2L A;  1R9T B;  1X65 A;  1X54 A;  3KBX A;  2D0P A;  4POG A;  1ONL A;  2AWO A;  3CQZ H;  4OON A;  2AUJ D;  1KDC A;  1GUO A;  3W5O A;  5JEA J;  5IGE A;  2F0E A;  4GN3 B;  2PQA B;  4QMG A;  3DUZ A;  5E3F A;  1D8L A;  2HDM A;  1IL8 A;  1XMO L;  1SNO A;  2EIF A;  4IQZ A;  4LFB Q;  3OMG A;  2Z0S A;  3W1B A;  4XQJ A;  3GTP B;  1KHI A;  2F0J A;  4NXM Q;  2CH4 W;  1HXY D;  1QVC A;  1K83 B;  4XT1 B;  3A8I E;  3T1Y L;  5EPJ A;  4F8M A;  1KQS A;  4R4O A;  2BDN A;  3LX0 A;  2R7D A;  3OWE B;  2WB1 B;  5JOB A;  1YJW A;  1HTP A;  1VS0 A;  3CF5 A;  4YCV A;  1SSO A;  2HHH Q;  1TWG H;  2LSS A;  1LO5 D;  4IPD A;  5H1S E;  4BBR B;  2EQS A;  3N52 A;  1SXT A;  3BVM A;  1DOL A;  1GUW A;  3TP6 A;  3DLL A;  2NVQ H;  2XRQ D;  3CP0 A;  3R8B A;  2K75 A;  3BZC A;  5M3M B;  1E2Z A;  2KED A;  3Q23 A;  4JI7 Q;  3ONA B;  1U4M A;  3CCM A;  1CI3 M;  3OTO Q;  2CW0 D;  5CGK A;  3K57 A;  1IKM A;  1EWI A;  2UUC Q;  4DV2 Q;  4X64 Q;  4FVM A;  2ZJP A;  2QIL A;  1C48 A;  2YU9 B;  2KJX A;  4A3I B;  1HR0 W;  2XSC A;  2ID0 A;  3B6Y A;  1RIP A;  2OTJ A;  2NTS A;  3ERO A;  2XTI A;  5IT9 L;  4ZQ3 A;  1ENF A;  1L2F A;  3KF8 B;  1IL2 A;  4A3L H;  2D5D A;  1H9S A;  2MGS A;  4BY7 G;  4A93 G;  1TS3 A;  3BVG A;  5FLM G;  1O7Z A;  2A68 D;  2NYZ D;  1PRT C;  4FXK C;  3S17 H;  1EWH A;  1WOC A;  3TRZ A;  5C4X G;  3T56 B;  4XXE A;  4CKB A;  2DN8 A;  3U4V A;  2CQO A;  1V43 A;  3GDE A;  4B3R L;  5KYI A;  1O80 A;  3GTM B;  4A3K G;  2ES2 A;  4LF9 L;  1A2T A;  3A7A B;  1F9Q A;  3KLS A;  4DPG A;  3NHH A;  4JBJ A;  5C3E B;  1B44 D;  1Y1V B;  5C4J B;  3NQI A;  3OW2 A;  4A3K B;  4DA2 A;  3K5N A;  2UXB Q;  1UUP A;  4O42 A;  1Q81 C;  4AQY Q;  4OX9 Q;  3K6O A;  3VR3 A;  5FO7 B;  1U0L A;  2A6E C;  2JQO A;  3I55 A;  2GVA A;  4DR1 L;  1SEB D;  5JVG 3;  5GQO A;  4BY1 H;  2YU9 H;  1M1K C;  1TKW B;  4OIK A;  4NMZ A;  1W6J A;  3KLR A;  5T1I A;  4HTH A;  1HUN A;  1L1O B;  1K3B C;  2E8G A;  2KCM A;  2MHV A;  3MZ5 A;  1IYU A;  4G57 A;  4XQQ A;  4A93 B;  1BOS A;  3BU2 A;  4LUZ A;  4X3S A;  1EL0 A;  3MA2 B;  2EYP A;  2VB2 X;  2VQF L;  2ATW A;  1EIH A;  3A8J E;  1I6H H;  5FLX E;  1SMY D;  3RZD H;  4JOI A;  2KQ3 A;  4GN5 A;  1QNU A;  4A3M G;  3BZK A;  1GKH A;  3Q6S A;  2EY5 A;  3SR1 A;  1BR9 A;  4HJA A;  1PH6 A;  2E74 C;  1R4Q B;  4DAY A;  2YYZ A;  1XMQ Q;  2K6A A;  4MZ9 A;  3JAM L;  2JA6 H;  3CCQ A;  2PMZ B;  5JEA H;  1KNE A;  4OWX B;  1CT1 D;  1PYS B;  2RA4 A;  1EYA A;  3PQI A;  2UXC L;  5I4D A;  3HOZ H;  3EVQ A;  2F0W A;  2AUK A;  2FIN B;  4RH6 A;  2P5Z X;  2IHE A;  3F2B A;  3Q22 A;  3S1Q B;  1RHP A;  4DV5 Q;  4NW2 A;  1SJH D;  1KD1 C;  2EDG A;  5A2Q L;  2CW0 C;  2JK8 A;  1R9T H;  4F87 A;  3NBH B;  5COY A;  4RGO S;  1GD7 A;  2R92 B;  1JB3 A;  5T1G A;  1HR0 Q;  2BE5 D;  3G6J B;  2Z6K C;  4Z9C B;  5IYB H;  3GTG B;  1I6H B;  3RMH A;  2OTL A;  3PGZ A;  2UXC Q;  5JAV A;  3SK8 A;  4GKJ Q;  3AB9 A;  1HQR D;  2JA7 B;  2K50 A;  4C2M B;  2EYH A;  2PNR C;  1WTV A;  2Y0S G;  5CV7 A;  4DK1 A;  3M7G A;  5CV4 A;  5K36 G;  2SOB A;  4DV6 Q;  1SYD A;  4DV7 Q;  5D65 A;  3KF8 A;  4ME3 A;  2BCO A;  3EJI A;  4CJ2 C;  4IUV A;  3G4S A;  1YBY A;  3A0J A;  4KY7 A;  4QUC A;  2I5M X;  2M9V A;  2EJF C;  3CCL A;  4C3I H;  2L0C A;  2VQF Q;  2F0T A;  3HOY H;  3S1Q H;  2IHF A;  5C4J H;  4LWC A;  2FHT A;  3R2I A;  2SNS A;  2L9H A;  3CD6 A;  2RKS A;  3V05 A;  4BBS B;  2C9O A;  3UDF A;  4KD4 A;  1O7I A;  3E5S A;  4R4Q A;  1QVG A;  1HNZ L;  1A3T A;  1L0Y B;  3J81 i;  3TDQ A;  2PCF B;  5C5M A;  1D6E C;  4B08 A;  1N33 L;  1T5X D;  4RAU C;  2B2U A;  3KFU A;  2F0I A;  2M00 A;  3PSI A;  3C46 A;  5FOB B;  3SEB A;  1R4P B;  4B3T Q;  4LF4 Q;  1L1O A;  2HCI A;  5IP7 G;  2ZXO A;  2GVB A;  3CRL C;  4IJL A;  1X3G A;  3L7Z C;  3EA6 A;  1EY7 A;  1PH7 A;  2Q2H A;  1VQM A;  2EY2 A;  1FGU A;  2JSO A;  2JYO A;  3K5M A;  1IYV A;  4DR5 L;  1K0R A;  2NTT A;  2F0S A;  2K14 A;  4LF7 Q;  2K5H A;  3IAY A;  3OSO A;  1NJI C;  3SGI A;  3H15 A;  3KBG A;  1LTL A;  2MNA A;  1Q86 C;  1B8A A;  5EJW A;  5GAE C;  2BA1 A;  4JK1 C;  3J80 E;  4C3J B;  2ICI A;  3RUZ A;  4LF4 L;  4PZ6 A;  5IWA L;  2WV6 D;  1JOQ A;  4GKJ L;  2IWH A;  2UUB Q;  3KYH C;  5D3I B;  2QEJ C;  2IT1 A;  5A2Q E;  1HA5 A;  2R7Z G;  4GKK Q;  4YWK A;  2K33 A;  1FGB D;  2F0L A;  1EYG A;  5IP7 H;  3DEP A;  3ULJ A;  2IX0 A;  2GN5 A;  4JI7 L;  2E76 C;  5E4W C;  4BS9 A;  2K7V A;  2VS1 A;  2K04 A;  3PIP 3;  3GTG H;  1CHP D;  2CQA A;  3X3N A;  3ZJY C;  1E1O A;  4L8J A;  5KEE A;  1VQ8 A;  3MHB A;  4IPH A;  4QIW B;  1BBX C;  3A7L A;  1LM0 A;  3MXN B;  1PYB A;  4H7B A;  1G8Z D;  1OXX K;  1QE6 A;  1JOO A;  4DR7 L;  2MFI A;  3BVZ A;  2LFN A;  1IW7 D;  1NCV A;  3DM3 A;  2JA5 H;  4O1N A;  1SYG A;  4DN4 M;  3CMA A;  4WJ4 A;  1TWA H;  2K5N A;  4EQO A;  3BZD B;  3BYT B;  4PV1 C;  2F0O A;  1RDP D;  5IGG A;  4B3T L;  2CCZ A;  3GTL H;  3I4N H;  2F3V A;  1RCV D;  4IZ8 A;  2KCT A;  2NN6 G;  1PH5 A;  4DV0 Q;  3GTO H;  2OQK A;  3RZO H;  4BA2 I;  1GHJ A;  5CYU A;  2IX1 A;  4X3U A;  4LF8 L;  2IX3 A;  5DEH A;  1EIY B;  1EZ8 A;  4UP9 A;  1CZG A;  4A3B B;  1YZ6 A;  4DXG A;  1WTQ A;  1YJ9 A;  4LF5 Q;  5IT9 E;  3VYU A;  1QOH A;  4EQN A;  3J80 c;  1D7Q A;  2N8N A;  1EUJ A;  2L15 A;  4HID A;  5M3F B;  3QO2 A;  1WTH A;  3KDF B;  2NN6 I;  3S15 B;  4IUR A;  1VQH A;  4XYO A;  3OOC A;  2J7Z A;  2RSO A;  4H13 C;  3MWY W;  1N34 L;  2XWJ B;  2BH2 A;  1B3Q A;  1MD2 D;  1KDA A;  1LUZ A;  1S4Z A;  1AE2 A;  1SYC A;  2JA7 H;  2VUM G;  3M4Y A;  1F9S A;  3QWN A;  1RF2 D;  5DM7 3;  3HOZ G;  2RDG A;  2K32 A;  1TII D;  1MHW C;  1TT2 A;  4DNT B;  1GUT A;  2NVX B;  1QCB D;  2KBN A;  1MGS A;  4BBS H;  2RHQ B;  4IAL A;  3K0X A;  3UDX A;  1XPO A;  2PI2 A;  3HFZ B;  4K5V A;  2K03 A;  3HOY B;  1JWM D;  5HGT A;  5NUC A;  5C44 B;  5L37 A;  1HNW Q;  2R93 G;  2EYL A;  2K5Q A;  2OF1 A;  1NNX A;  5GRO A;  4QGU A;  1I3Q B;  2QDB A;  3W3A A;  2VQE Q;  4DV4 Q;  3G48 A;  1MIU A;  4ZUI A;  1VQB A;  1JOK A;  1BCP C;  2ZJR A;  5ELE A;  1ZEQ X;  2CVR A;  5GAG C;  4IFD H;  1WCM H;  3CQZ B;  5ELO A;  1ICW A;  2JA8 G;  5KNC A;  1U5K A;  1V8Q A;  2ZXP A;  1KAA A;  4NDX A;  1ZXT A;  4ODG A;  3PF5 A;  4EQP A;  5A35 A;  2Z1C A;  4DU9 A;  1PRT F;  3ULL A;  1IBM Q;  3FP9 A;  2PW7 A;  5IYC H;  2DUD A;  1Q1B A;  3D4R A;  2A68 C;  3EFX D;  4C2M H;  5KRU A;  1NE3 A;  1B2T A;  3TEH B;  1AZP A;  4DR6 L;  3J81 L;  2EE1 A;  1JWS D;  3EBE A;  1TWF H;  2OQ0 A;  4RWS C;  3H3V H;  1JJC B;  1IBL Q;  3Q8D A;  1TY2 A;  4OO1 I;  1CHQ D;  3AQQ A;  1YVC A;  2EZV A;  1DOK A;  5CR3 A;  2F0P A;  2O5J C;  2JA9 A;  3K7U C;  1V1P A;  1SFO B;  2J0T D;  1LLR D;  3GTJ B;  4S3S A;  2HHH L;  5C4X H;  4A3F G;  4KTA A;  2F4V Q;  5AJ3 Q;  3AEV A;  4HJ8 A;  1H9M A;  1G6P A;  4JI2 Q;  3RN2 A;  1HA6 A;  1H9R A;  1WI5 A;  1YHB A;  1MBY A;  3MFY A;  3S2H H;  3HOX H;  1PH2 A;  1AW7 A;  1IHZ A;  1VQP A;  5M3M G;  3H0G H;  3CCE A;  1HZC A;  3FHW A;  1K3R A;  4KI0 A;  5CV5 A;  4X66 Q;  3GO5 A;  3GTK B;  3I7F A;  4B3M L;  3P7J A;  4ZLT F;  2EVB A;  4L5T A;  3HP3 A;  3VA5 A;  1PZJ D;  1ASZ A;  5G3L D;  4FF3 A;  1FNW A;  1B9N A;  2PI2 E;  4ULL A;  1CSQ A;  1SNQ A;  1Y14 B;  4LFC L;  2UUB L;  4ME5 A;  4MNO A;  1BBW A;  4FP5 D;  1O7L A;  1ET9 A;  5LHY 1;  1F9R A;  3I90 A;  4JI5 L;  4DK6 C;  3C2P A;  4BY7 B;  3RLO A;  3OHX C;  1PHJ A;  1DYQ A;  4KKS A;  2F03 A;  1SAP A;  2ZM6 Q;  4R8I A;  1I5F A;  4IPG A;  4RA8 A;  3MXG A;  1J5E L;  4R4T A;  1LT4 D;  1SFO H;  4LUO A;  5I2X A;  1EIF A;  1B3A A;  1LAB A;  2XN9 C;  1P8L A;  2HUG A;  3X3M A;  2WAC A;  1TWG B;  2E2H B;  3IKJ A;  2F0N A;  1XNR Q;  2JA7 G;  5KIX A;  2NVY H;  3A55 A;  3O13 A;  2Y0S E;  2PYK A;  4XT3 B;  1NUC A;  3I4N B;  3H3V I;  4P73 A;  1CZW A;  3H0G G;  4GOP C;  3ITP A;  1JWU D;  2JP1 A;  1Q12 A;  2KOL A;  2MUY A;  4HCS A;  2XRS D;  3CCV A;  1CKM A;  1OXS C;  1EU3 A;  2BE5 C;  4LF7 L;  4JV5 L;  4QUF A;  3Q24 A;  2C35 B;  1FD7 D;  3PO3 G;  3HKZ E;  1IBK L;  5TSS A;  2WB1 G;  2E5L Q;  4DR4 L;  2ZXR A;  1LT6 D;  5GAH C;  2H4O A;  2UXD Q;  4PG3 A;  2UXB L;  1CQV A;  5HUR A;  1LYL A;  1I94 Q;  4WJW A;  3BDO A;  1TU2 B;  1VQO A;  3RLN A;  2NN6 H;  3KJO A;  1Q8I A;  2F0Q A;  1PTO F;  3OTO L;  2EJG C;  1XTD A;  1ROD A;  4LJZ C;  4WOR A;  3GV3 A;  4JV5 Q;  3S15 H;  1X3P A;  3HOV B;  1G91 A;  2K5D A;  2O5I C;  3HOW G;  4DFA A;  5G3L F;  5I9P A;  3E0E A;  4DV3 L;  2NVY B;  3DMU A;  2A69 C;  3HOU B;  1I4Q A;  2CH4 A;  1VQD A;  5CBA E;  3OW7 A;  1UE1 A;  2N78 A;  4XTC S;  1GHK A;  2F0H A;  2XVS A;  2NVX H;  4JVZ A;  1AEX A;  1RJT A;  2JA8 H;  1HNW L;  4A3E G;  3KUP A;  1SBB B;  1JMC A;  4IFD G;  4OHJ A;  4YHH Q;  4NXM L;  1H9S B;  2JJQ A;  4JCV E;  1RL2 A;  3ND8 A;  1RKN A;  4A3I G;  3T16 A;  4J15 A;  1KRS A;  4LF8 Q;  1E24 A;  3JAM E;  3I72 A;  3VR2 A;  1SE8 A;  5ELN A;  1KAB A;  3QOL A;  1JC7 A;  2K52 A;  1NR2 A;  4FXD A;  1LTA D;  1HHV A;  2CWA A;  1LTT D;  3PMF A;  4LAA A;  4R4C A;  4RMF A;  3S24 A;  4JI5 Q;  3PO2 G;  1EU4 A;  3M4O B;  1PFB A;  5IP9 G;  1WD1 A;  3MEH A;  3WOF A;  4YWM A;  3I70 A;  1I50 H;  5JJL A;  4BY1 B;  1I4R A;  3OIQ A;  2VUM H;  4DNR B;  4GLV B;  3QIA A;  1J5E Q;  1TWC H;  3FMC A;  1Q90 A;  2QW7 A;  2E2I H;  2JA6 B;  3QOJ A;  4ZKB B;  2R6G A;  3ER0 A;  1XYI A;  1STH A;  4I7Z C;  3QG1 A;  4QQB X;  1SMX A;  4IUU A;  4KV6 A;  2FFK B;  4GN4 B;  1TS5 A;  1SLJ A;  1I4G A;  3TME A;  3S1M H;  1KRT A;  1PRT B;  4JW0 A;  2ICE C;  3ERQ A;  5J22 A;  1MKH A;  3HOZ B;  1VF7 A;  2PW5 A;  3OWF A;  4Y7N H;  4PMC A;  3I4M B;  4JC0 A;  3Q0A A;  1MSG A;  3CME A;  2B8F A;  5C4X B;  3DWP A;  3FVQ A;  3C1F A;  4A3F B;  1Y8O B;  3E9I A;  4IFD J;  4FXG C;  3I4O A;  2PZT A;  2F0D A;  4DUZ Q;  2PZW A;  1ILP A;  3NBH A;  1STB A;  1PTO B;  1XJV A;  3UE1 A;  3KOJ A;  3M4O H;  1Q82 C;  5EBD A;  4DV1 Q;  1GXD C;  4RHS A;  1UEB A;  4DF7 A;  3GTK H;  2LKV A;  1J9O A;  4CKE A;  4QY7 A;  1VQF A;  2X69 A;  3BS1 A;  4KHV A;  1BUV T;  5EKL A;  1NMF A;  1ENC A;  1Y69 U;  2PQA A;  4G7H C;  2JA5 G;  2F0K A;  3WDN A;  4HSP A;  4JPB W;  3T1H L;  4C1N K;  3CPF A;  3KF6 A;  4JI1 L;  1ML0 D;  4RGT A;  2L1B A;  2E2H H;  1WTO A;  4LW1 A;  1SYB A;  1SYF A;  2JXM B;  1ILQ A;  1VF5 C;  1HJP A;  1EY4 A;  3M9B A;  2JA8 B;  4K2K A;  5D14 A;  2OCE A;  2EYM A;  1NTG A;  2VXW A;  4JI6 Q;  1IBM L;  3M3Y H;  2Z4I A;  2KEC A;  2JE6 I;  4IO9 A;  5IWA Q;  4LF9 Q;  1A6X A;  1Y8P B;  3CC4 A;  4HMI A;  2RCN A;  2BDO A;  1XPR A;  1KIX A;  3ICE A;  1Y8N B;  4DAM A;  2AWN A;  1YHA A;  3VYR A;  1YNN C;  1HFG A;  3L2P A;  4ZUJ A;  4K8I A;  1VQN A;  2R7Z H;  4RKB A;  5LMU L;  2IY5 B;  1JCK B;  3STB C;  1EY6 A;  2A1A A;  2ASB A;  2N3S A;  3AFQ A;  5IYB G;  4Q5V A;  1VQ6 A;  5HGQ A;  1VQ9 A;  3S16 B;  4H02 A;  2CHB D;  2XGT A;  3MFG A;  1DJR D;  3NQT A;  4HN7 A;  1K73 C;  2KCN A;  2D0O A;  2LS0 1;  4ZK9 B;  5JPM C;  3CCR A;  1IW7 C;  1S3O A;  2FXQ A;  3M4Q A;  4KY6 A;  2A6H C;  1E1T A;  3CCU A;  1EQV A;  2IW3 A;  3SK6 A;  5IOD A;  5M5W B;  1SE2 A;  2BH8 A;  1VQL A;  3PF4 A;  1WYD A;  3KLW A;  4A3G B;  4LFB L;  1HR0 L;  1IBK Q;  5IP9 H;  4JI3 L;  3TS0 A;  4DUZ L;  3EN2 A;  1K83 H;  2O4X A;  1OXU A;  2YTX A;  3NBI A;  5M9O A;  3PO2 H;  1OTC A;  1L1O C;  1BDO A;  4A3J H;  2RBM A;  3G7L A;  1Y1W G;  1HNX L;  1V1Q A;  3K8A A;  1PXU A;  1BCP F;  1VQ7 A;  4JBW A;  3GP7 A;  3HOW B;  4UP8 A;  2B2U C;  1ZKO A;  4G4K A;  1TQO A;  4EQ5 A;  4UP7 A;  2EY6 A;  3PV0 A;  4JOI C;  4CDC C;  3NEL A;  4DUY L;  2DJF C;  1A3U A;  2XNA C;  5BN3 A;  2R7F A;  4NKL A;  3S16 H;  2DY7 A;  3VR4 A;  4KMU C;  3N6R A;  1Z7T A;  1WTX A;  3V96 A;  4A3E H;  5EKK A;  4C3J H;  4Y7N B;  1GVP A;  1QJO A;  1UNS A;  4E6I A;  2FJ2 A;  3A74 A;  1PMR A;  1X3E A;  5LMN W;  4FO2 A;  3BYY B;  4ZRZ A;  1UE7 A;  1K9M C;  4C3I G;  4BY1 G;  2F4V L;  3KK7 A;  1IZ6 A;  1DCZ A;  1SDF A;  3G6E A;  1TXY A;  4QIW E;  2E75 C;  4PQX A;  4RCN A;  1H9J A;  3S1N B;  4IOC A;  4A3G H;  5IGF A;  4NXN Q;  4X6A H;  4DUY Q;  1K28 A;  2VZA A;  1STN A;  5I6Y A;  1KTK A;  1QG7 A;  4JG2 A;  5EPL A;  4O0A A;  3PO2 B;  2CWP A;  5K36 H;  1QUQ B;  3MTS A;  1N32 L;  4R1J A;  2E2I B;  5C0X I;  2F0V A;  2TSS A;  2VUM B;  1UE5 A;  4DR2 Q;  2A8V A;  3URY A;  1F2Z A;  3S14 H;  3HEJ A;  1JR0 D;  2Z6K A;  3IRB A;  3J7Y W;  4OO1 H;  3PUV A;  3PO3 H;  2NBF A;  5FKA C;  3S1R H;  5C3W A;  4L6T B;  3H6M A;  4DAP A;  4YWL A;  1ENA A;  5GAD C;  3A8K E;  4WFN 3;  1VQK A;  4GOP A;  3D6C A;  2L4N A;  3PCO B;  3A5U A;  2K5W A;  3F1Z A;  3CC7 A;  2N88 A;  1GUS A;  3T4A C;  2MJ8 A;  4NP5 A;  4OL7 A;  1KLG D;  2KHJ A;  3SVM A;  3T51 B;  1MSH A;  1XNQ Q;  1P16 A;  1O78 A;  4AYB B;  1PTO H;  1ZYR C;  4UDU C;  3S1N H;  5IT9 c;  3E3X A;  1CA5 A;  5JEA G;  1S72 A;  4NPS A;  5ELF A;  4IFD I;  5EPK A;  5EKI A;  5CMD A;  5COR A;  1M8A A;  5C6A A;  4DNI A;  4HIO A;  4LF6 L;  4JI0 L;  1J6Q A;  4ZAI A;  4MTN A;  2Q8I B;  4OWW B;  1S5F D;  4CHT B;  3U58 A;  2EY1 A;  1JJG A;  1TWC B;  2L12 A;  3F2U A;  3PIO 3;  4OIJ A;  2QEX A;  4JI8 L;  5BR8 Q;  4KHZ A;  2ZJQ A;  5I6W A;  4JI3 Q;  4GLA C;  3NEM A;  4HIK A;  4RKL A;  3MVV A;  2EYJ A;  3S17 B;  2Z4H A;  4QCL A;  1EIG A;  4QJF A;  2G5D A;  1SMY C;  3OIP A;  1SJE D;  5M3M H;  1PTO D;  2SDF A;  3HOX G;  3KDF A;  1FJG L;  2Y0S B;  1RTO A;  4WRD A;  1CTM A;  3TZD A;  2NVT B;  1YNX A;  2QA4 A;  3C3L A;  4A3F H;  3MAQ A;  4K6L A;  4IOA A;  4JI8 Q;  5BR8 L;  4B3M Q;  2Z6B A;  1ZYR D;  1U4L A;  5EAY A;  4A3K H;  2LY7 A;  4LFA Q;  4JBK A;  3ZYY X;  2HIX A;  4M1U B;  1JB7 A;  1Q3L A;  2B2W A;  3VR5 A;  1B1Z A;  3AU7 A;  1ICF B;  3C1E A;  3P1H A;  3SK4 A;  1KLU D;  4CJ0 B;  1WCM B;  2LXJ A;  4R9W A;  4RHR A;  4A3J B;  1EQQ A;  4BY7 H;  3HG9 A;  4X62 Q;  2RDH A;  1QWY A;  2A74 C;  5IYC G;  4A3L G;  3EIV A;  2C5C A;  1AE3 A;  1C4Q A;  1WJJ A;  3DHQ A;  3GTM H;  4GNX B;  4R8N A;  3LGJ A;  2M2L A;  1YJN A;  3IFD A;  2EPB A;  1HCZ A;  1EEF D;  4IJH A;  4NB3 A;  3J81 c;  1WFQ A;  1B50 A;  1WCM G;  2UU9 L;  4X3K A;  3I4L A;  1VQA A;  2K1B A;  2D9U A;  4NXN L;  3UDI A;  5KGU A;  1N36 L;  1A0I A;  1G51 A;  1VQE A;  2I46 A;  3CHB D;  5ELD A;  1G2S A;  1ESR A;  1QZG A;  2AKW B;  4DAV A;  4DR1 Q;  2ZT9 C;  2R93 H;  1ESF A;  2G9D A;  3GTJ H;  3TQY A;  2A73 B;  4DR2 L;  4X66 L;  4IUT A;  3W1G A;  1BVS A;  2KUM A;  1QZH A;  1HFN A;  2L11 A;  2F3I A;  1B4O A;  3QB3 A;  3FDT A;  2F3W A;  4BBS G;  2E2J B;  1GUN A;  4JI2 L;  5IGD A;  3NXW A;  4DV4 L;  1E2V A;  5AFW A;  4DV5 L;  1TWH B;  5AJ3 L;  4JBM A;  1PVO A;  4A3M B;  2I07 B;  5ELB A;  3HZX A;  3OMC A;  1GM5 A;  1CKO A;  5E4X A;  1X32 A;  3D31 A;  3A5Z B;  2VL6 A;  2N49 A;  4TRD A;  2R3Z A;  1F2Y A;  1OXV A;  4DR5 Q;  3PUZ A;  1DD2 A;  1IBL L;  4KD3 A;  4M8A A;  1VQ4 A;  2RHS B;  4QF4 A;  3PUW A;  2BOS A;  3EQL C;  1PV4 A;  1VQC A;  2HQE A;  2F0M A;  1GUG A;  4RGN A;  1CM9 A;  5HY6 A;  1WTP A;  3DWQ A;  1STG A;  1PTO C;  1SRO A;  2O2L D;  1W3S A;  3S14 B;  2AHO B;  1QB5 D;  1PFN A;  4QL5 A;  4LMQ D;  2NVT H;  1B9M A;  3UDG A;  1N33 Q;  3UI2 A;  5EGT A;  5ELC A;  3F2D A;  1STA A;  2N55 A;  3JC6 6;  4J8Q A;  1HZB A;  4AYB G;  3ULP A;  3RN5 A;  3I4N G;  1LTG D;  4CBV A;  4FF4 A;  3E9H A;  1IKL A;  2J4X A;  5M5Y B;  1SE3 A;  3I91 A;  1Z6H A;  1DON A;  3F8T A;  3SXH A;  3K59 A;  1I50 B;  1SNM A;  5DLQ E;  2F52 A;  4A3B G;  4DR3 Q;  4TSS A;  1MJE A;  1G2T A;  1A2U A;  1RD9 D;  3CPW A;  2F0U A;  1K8G A;  1DGS A;  3TP8 A;  1QNK A;  4BA1 I;  1CKN B;  1B70 B;  5IIF A;  2WAQ E;  1PH9 A;  1I94 L;  1QVF A;  2R92 H;  4JI4 Q;  3OPO A;  4PNY A;  5LMN L;  4EGV A;  1D5M C;  2MPM A;  3NSW A;  4KJN A;  4KN4 C;  2A19 A;  1SE4 A;  3CW2 C;  3HGB A;  4J6H A;  4GLX A;  3S9W A;  1KXL A;  1U4R A;  2B2V A;  3I4M G;  1A8V A;  1EY0 A;  5IYD G;  4L5R C;  3M7N A;  1VCI A;  1W2B A;  1FYC A;  2ZTE A;  5FO8 B;  1X3F A;  3CCS A;  4F7X A;  3HOV G;  3J81 j;  1YI2 A;  3NTK A;  4B9W A;  1X55 A;  2K01 A;  4GZY C;  2TMP A;  4DK3 C;  4DAY B;  4LF6 Q;  2WKD A;  2YTV A;  4GS3 A;  1NBW A;  2RCF A;  2K4K A;  4OGQ C;  1XXG A;  1V1P B;  3NE5 B;  2E2D C;  2VB3 X;  3LWU A;  4K0K Q;  2WKC A;  4MIU A;  5IY0 A;  2B8G A;  1FL0 A;  1FNU A;  1KNA A;  1FR3 A;  3FPU B;  4LF5 L;  2Z9H A;  4K5W A;  1PH1 A;  5C3X A;  4JYA L;  4O2D A;  1TY0 A;  1LTS D;  2MP1 A;  5C3E G;  1E2W A;  1SR3 A;  5FO9 B;  5K5P A;  2WFW A;  4BXX G;  1OO9 B;  2KEN A;  4IUN A;  5C0X J;  1UWV A;  2EYO A;  5FJ8 G;  4ALP A;  1CA6 A;  5JVH 3;  2E2J H;  1PZI D;  4A3C H;  1H9K A;  2YV5 A;  1BBU A;  5KNB A;  1S5E D;  3NTH A;  4YY3 Q;  2CFM A;  1J8I A;  3BG3 A;  1D5X C;  1XMQ L;  1EYC A;  3VR6 A;  2HCC A;  1PRT D;  1NSN S;  1X6O A;  2OEO A;  2YTY A;  4JYA Q;  1VDZ A;  1BQQ T;  1KC8 C;  1I4H A;  1PH4 A;  2B2Y A;  2RDF A;  1BKB A;  4K5X A;  4Q0F A;  4IUP A;  2I5L X;  4K14 A;  2PMZ E;  3R2T A;  1FNV A;  3HOU G;  3SHL A;  5I9O A;  3J7A 5;  2PPB C;  1SN8 A;  4F88 A;  4CDF C;  4BBR G;  2B2T A;  4JI4 L;  1S5C D;  1X9N A;  3J80 i;  3ND9 A;  1C7Y A;  2UUA Q;  4B3R Q;  5J3B A;  3I8Z A;  5LL6 X;  3GTL B;  1CK1 A;  2B3G A;  4H44 C;  4YCW A;  3WOE A;  4ZKC B;  4DXF A;  3HOY G;  3SK5 A;  1CUK A;  3K7A B;  3RLF A;  2CKZ B;  4AYB E;  2KCC A;  1PA6 A;  3RR5 A;  3W2D A;  1H95 A;  4FYD A;  1SNP A;  4XYQ A;  2K05 A;  1G29 1;  3L3O C;  3K58 A;  4FF2 A;  4IUQ A;  3MC0 B;  4RG1 A;  2KA7 A;  4HIM A;  4X3T A;  2DNE A;  1CKN A;  2B39 A;  2DGY A;  3RD4 A;  4K0K L;  2KHI A;  1EY9 A;  2B63 B;  1TWF B;  3CAM A;  3I2Z A;  3QR8 A;  3TRE A;  3NPP A;  4L63 B;  1LV9 A;  3VDY A;  3NUC A;  4AIM A;  3S2D B;  4KN7 C;  2XIW A;  5J39 A;  3J7A V;  3L9A X;  1Z9F A;  4DV6 L;  4N9P A;  4AQY L;  1I6V C;  1MJC A;  2A5H A;  4ILW A;  5IYD H;  4TVA B;  2OWO A;  4RFB A;  1QIL A;  3D4D A;  4U67 3;  4KK7 A;  2Z8L A;  4A3D G;  3RZO B;  3HKS A;  2AQ1 B;  4Y52 H;  2UUC L;  1D5Z C;  4YIJ A;  1BXT A;  1LAC A;  3NWT A;  3TS2 A;  5JJZ A;  4LNQ A;  2MO0 A;  5EQ0 A;  3K7A H;  1K8O A;  3GTQ B;  3T13 A;  5C44 H;  1STY A;  2K5V A;  3CC2 A;  4JI6 L;  2ZTD A;  4A3E B;  4G7Z C;  1JE4 A;  1ET6 A;  1SRU A;  2D2C C;  3BJU A;  1EY5 A;  2Q2I A;  4QB4 A;  4AH6 A;  4DK0 A;  3KLS X;  4MN3 A;  1PH8 A;  3TSS A;  4GNX A;  2JA6 G;  5M5X B;  2KEE A;  2QKI C;  3I3C A;  1TVX A;  3S2H B;  2NVQ B;  5C4H A;  4A3M H;  5FK9 C;  2Q2T A;  5C0X G;  1L0X B;  1Y1V G;  2DJG C;  4APV A;  1LT5 D;  2L55 A;  5M3F H;  3AMU A;  3RZD B;  4LFC Q;  3HRZ C;  5CV8 A;  2ZTC A;  1YEZ A;  3LWE A;  2RQX A;  4RCO A;  3J80 L;  2FMC A;  4HAE A;  3S1R B;  3PIO A;  3NTI A;  1F2M A;  2EXZ A;  3OYY A;  1T5E A;  5BN4 A;  4KHP Q;  5E1F A;  5IGB A;  4KKU A;  4XQN A;  3BDL A;  1Y1W B;  1DZ1 A;  2A6H D;  2MQH A;  1IXR A;  4LK1 C;  3M85 A;  1K0S A;  3GTQ H;  3V2T A;  4FF1 A;  3A56 A;  4C3H H;  1PFM A;  3D3R A;  5M3F G;  4P75 A;  3H0G B;  2PNH A;  3H3V C;  1Y1V H;  3DXJ C;  5C0X H;  3PIP A;  3U50 C;  2JN4 A;  5C5L A;  3HS0 C;  1UE6 A;  5M5Y H;  2KHS A;  1I3Q H;  1Q8K A;  1XNQ L;  1Q1E A;  1S40 A;  4UY8 C;  5CBE E;  2NWG A;  3E0J A;  1S5D D;  3E6Z X;  1EEI D;  4CKC A;  1SNC A;  1O7Y A;  3AFP A;  2IJ0 A;  2JEB I;  4WJ3 M;  4RGM A;  4P71 A;  2WIN B;  1EQR A;  4ZYS A;  3MXN A;  3T53 B;  5FLM H;  2ENB A;  3I56 A;  2UUA L;  4A93 H;  1TS4 A;  4PMB A;  1VMC A;  1AH9 A;  1C0A A;  1TS2 A;  5IE8 A;  1BNZ A;  2F1M A;  3J7A F;  3RNU A;  3H91 A;  3S2D H;  1PLF A;  2EYF A;  2JEA I;  3PUX A;  4V19 0;  1MI2 A;  4K8J A;  1E0B A;  4P2C B;  1HZA A;  1SND A;  3KF6 B;  4A3D H;  1JE5 A;  1NY4 A;  2DNC A;  3GV6 A;  4DR6 Q;  2V1C C;  3AYH B;  2PQE A;  1GOZ A;  4HJ7 A;  1HTL D;  4OO1 G;  3K80 C;  4YY3 L;  4KY5 A;  4G7O C;  1FJG Q;  1DOM A;  2X6G A;  4ABN A;  3IFT A;  2L5T A;  4P72 A;  4V0B A;  1T9H A;  1EQT A;  1EYD A;  2EJM A;  4X64 L;  4B3S Q;  5C4Z A;  3J7Z C;  3PO3 B;  3DWA A;  3R93 A;  4CDD C;  4KHP L;  4DKA C;  4UHV A;  4POF A;  3K5O A;  1K8A C;  5F2D A;  5EBC A;  4C3H G;  4L5Q A;  5JJI A;  4A3G G;  4XDX A;  4A75 A;  2QGQ A;  5BN5 A;  2QDL A;  2NUC A;  1PDQ A;  4P74 A;  4FDB A;  5D3D A;  1U9R A;  1RTN A;  3U9O A;  2LXK A;  3GQB A;  2IL8 A;  1WVL A;  1EFI D;  4LFA L;  4C3J G;  4HCE A;  2E5L L;  4K6D A;  3CKI B;  1HNX Q;  2B2T C;  5JJK A;  1M90 C;  2B63 H;  4OWT B;  2NZ1 D;  1D1K A;  3HOU H;  5E7N A;  1DM0 B;  1VQG A;  1HQM C;  4KJO A;  2B29 A;  1SYE A;  4CGY B;  2DY8 A;  2F0F A;  3KJP A;  1KL9 A;  3UE0 A;  1EOV A;  2VQE L;  1V1O A;  4JI1 Q;  2XWB B;  1U4P A;  4N9T A;  4JI0 Q;  1JQY D;  1JT8 A;  1EZ6 A;  4C3I B;  1EOT A;  3NP8 A;  4GNX C;  1CFM A;  4B9X A;  1Y1W H;  2H5X A;  1AZQ A;  4A3J G;  3NEN A;  3CCJ A;  2AQ2 B;  2RSN A;  2FMM A;  5IOC A;  5M5X H;  1B53 A;  2H1E A;  1EFW A;  5I2Y A;  1NR4 A;  3GD7 A;  3LNN A;  3JAM c;  2UXD L;  1II3 A;  5C44 G;  2R93 B;  1GJX A;  1XX8 A;  3F2C A;  2QF7 A;  2PZU A;  1PH3 A;  3GTO B;  4KKT A;  3HKZ B;  3K0Y A;  4OXP A;  1A63 A;  1N8R C;  3NK9 A;  2HT1 A;  4TKO B;  4A4I A;  1TWH H;  3NWS A;  3IL8 A;  4C1N I;  1D2B A;  1BF4 A;  2NZO A;  4B3S L;  2WAQ B;  1YIT A;  1BO0 A;  1FVI A;  1GO3 E;  1YNJ C;  5KND A;  4C56 C;  1PYW D;  2KVM A;  3MXU A;  3P75 A;  3D6W A;  2GA4 B;  4L5S A;  1LTB D;  1HUM A;  2F4I A;  4MHE A;  1EY8 A;  2EOT A;  1Q7Y C;  3SE0 A;  3R3O A;  1I4X A;  3PUY A;  2RVL A;  1TWA B;  3M3Y B;  5J1Z A;  3GTP H;  2WAQ G;  2QCP X;  2AMC B;  4I7A A;  4U68 A;  4X62 L;  1F77 A;  3HOV H;  5FLX c;  4I65 A;  3TP7 A;  4A3D B;  1N36 Q;  3WWV A;  4HMJ A;  4OEL B;  2A69 D;  3H94 A;  3U9S A;  3FEW X;  2AQ3 B;  4LUV A;  3I4M H;  1BCP D;  2B2V C;  2SNM A;  2WB1 E;  1F9P A;  2F0G A;  2HIV A;  3HKZ G;  2A6E D;  5ISR A;  1IYJ B;  1V9P A;  1QUQ A;  3FKI H;  1C8C A;  3D0F A;  4ID6 A;  4C3H B;  4GOP B;  2I0Q A;  1C9O A;  1F2L A;  2R92 G;  4DGZ A;  2X6L A;  3CXC A;  4HJ9 A;  2V4D A;  1PFS A;  4BBR H;  5JPN C;  4HED A;  3D8G A;  4DR7 Q;  4H0L C;  4A3B H;  5CC4 A;  2SEB D;  4BWG B;  2LMC B;  4OEM B;  1W6K A;  2G9H D;  2B2Y C;  2NB0 A;  3STB D;  3H09 A;  1NMG A;  1K8M A;  1Z47 A;  4PZ8 A;  2HQL A;  3A54 A;  2K28 A;  4DR3 L;  2ALY B;  3K5L A;  5LL6 S;  1JJ2 A;  4R4I A;  4X65 Q;  2EXD A;  2JA5 B;  3S1M B;  1A3V A;  1EWC A;  1AP0 A;  1TR5 A;  3DM1 A;  1WD0 A;  3VYT A;  4A3C G;  5DNF A;  4OX9 L;  4GKK L;  1PZK D;  2NZH A;  1VMP A;  5DM6 3;  5FJ8 H;  1AFP A;  4IN3 A;  3CRK C;  1NAP A;  3T1H Q;  1XWE A;  1CSP A;  4YHH L;  4BXX H;  2I5H A;  5LMN Q;  5CV9 A;  1STE A;  1G6Z A;  2D62 A;  3TZU A;  4CJ1 B;  5IGC A;  5C3E H;  3BDC A;  3I73 A;  4ZCK A;  4UAI A;  3TP5 A;  1VQI A;  2Q8R E;  4FNF A;  1L0W A;  3K81 C;  4HR7 B;  3FKI G;  1UEA B;  1YHQ A;  4DR4 Q;  2IPK D;  1X3Q A;  1JIC A;  1N9W A;  1LTI D;  1LT3 D;  3TBI B;  1AN8 A;  4DV7 L;  4EX5 A;  1B7Y B;  4YCU A;  2VNU D;  2WII B;  3CU7 A;  1N34 Q;  5LMU Q;  3G71 A;  1M4V A;  4UPA A;  3VYS A;  1I4P A;  4MTK A;  1ASY A;  1DXM A;  2WP8 J;  4DV2 L;  1A15 A;  1E7Z A;  1UAP A;  3T1Y Q;  4PZ7 A;  3M4P A;  1HPC A;  5KYL A; 
#chains in the Genus database with same CATH homology
 2HDL A;  3VA7 A;  1D1I A;  3J81 E;  3TN2 A;  5FLX L;  3DEO A;  4EVO A;  1OXT A;  2R61 A;  5DAU A;  3P20 A;  3D4W A;  3FPP A;  5CV6 A;  4HSV A;  1LTR D;  4J1M A;  1KDB A;  1S5B D;  1JOR A;  4XIG S;  2Q8T A;  1CQF A;  1BCP B;  2PO4 A;  2BA0 A;  2OXP A;  1YNN D;  3SDZ A;  4PMW A;  3HOX B;  3MXP A;  1YNJ D;  3FRP B;  3FKI B;  2B2W C;  1WTR A;  1XTC D;  2R7Z B;  1HRJ A;  2OT2 A;  3QJY A;  1WTW A;  4TQU S;  4K2L A;  1R9T B;  3KBX A;  1ONL A;  2AWO A;  2AUJ D;  1KDC A;  1GUO A;  5JEA J;  5IGE A;  2F0E A;  4QMG A;  3DUZ A;  5E3F A;  2HDM A;  1IL8 A;  1SNO A;  4IQZ A;  3OMG A;  4XQJ A;  3GTP B;  2F0J A;  1HXY D;  1K83 B;  4XT1 B;  3A8I E;  5EPJ A;  4F8M A;  2BDN A;  3LX0 A;  3OWE B;  5JOB A;  2WB1 B;  1HTP A;  1SSO A;  1LO5 D;  4BBR B;  3N52 A;  1SXT A;  3BVM A;  1DOL A;  1GUW A;  3TP6 A;  2XRQ D;  3R8B A;  5M3M B;  1E2Z A;  2KED A;  3Q23 A;  3ONA B;  1U4M A;  1CI3 M;  2CW0 D;  5CGK A;  3K57 A;  1IKM A;  4FVM A;  2QIL A;  1C48 A;  2YU9 B;  2KJX A;  4A3I B;  2XSC A;  2ID0 A;  2NTS A;  3ERO A;  5IT9 L;  4ZQ3 A;  1ENF A;  2D5D A;  1H9S A;  2MGS A;  1TS3 A;  3BVG A;  1O7Z A;  2A68 D;  2NYZ D;  1PRT C;  4FXK C;  1EWH A;  3T56 B;  4XXE A;  4CKB A;  2DN8 A;  1V43 A;  5KYI A;  1O80 A;  3GTM B;  1A2T A;  3A7A B;  1F9Q A;  3KLS A;  3NHH A;  5C3E B;  1B44 D;  1Y1V B;  5C4J B;  3NQI A;  4A3K B;  4DA2 A;  3K5N A;  1UUP A;  4O42 A;  3K6O A;  3VR3 A;  5FO7 B;  2A6E C;  1SEB D;  5JVG 3;  1TKW B;  4OIK A;  4NMZ A;  1W6J A;  3KLR A;  5T1I A;  4HTH A;  1HUN A;  2MHV A;  3MZ5 A;  4G57 A;  1IYU A;  4XQQ A;  4A93 B;  1BOS A;  4X3S A;  1EL0 A;  3MA2 B;  2EYP A;  2VB2 X;  1EIH A;  3A8J E;  5FLX E;  1SMY D;  2KQ3 A;  1QNU A;  3Q6S A;  2EY5 A;  3SR1 A;  1BR9 A;  2E74 C;  1R4Q B;  4DAY A;  2YYZ A;  2K6A A;  3JAM L;  2PMZ B;  5JEA H;  1KNE A;  1CT1 D;  2RA4 A;  1EYA A;  5I4D A;  3EVQ A;  2F0W A;  2AUK A;  2FIN B;  4RH6 A;  3Q22 A;  3S1Q B;  1RHP A;  4NW2 A;  1SJH D;  2EDG A;  5A2Q L;  2CW0 C;  4F87 A;  5COY A;  4RGO S;  2R92 B;  1JB3 A;  5T1G A;  2BE5 D;  3G6J B;  4Z9C B;  3GTG B;  1I6H B;  3RMH A;  5JAV A;  3SK8 A;  3AB9 A;  1HQR D;  2JA7 B;  4C2M B;  2EYH A;  2PNR C;  1WTV A;  5CV7 A;  4DK1 A;  3M7G A;  5CV4 A;  5K36 G;  2SOB A;  1SYD A;  5D65 A;  3KF8 A;  2BCO A;  3EJI A;  4CJ2 C;  4IUV A;  4KY7 A;  4QUC A;  2M9V A;  2EJF C;  2L0C A;  2F0T A;  2FHT A;  3R2I A;  2SNS A;  2L9H A;  2RKS A;  3V05 A;  4BBS B;  2C9O A;  4KD4 A;  3E5S A;  1A3T A;  1L0Y B;  3TDQ A;  2PCF B;  5C5M A;  1D6E C;  4B08 A;  1T5X D;  4RAU C;  2B2U A;  2F0I A;  2M00 A;  3C46 A;  5FOB B;  3SEB A;  1R4P B;  2HCI A;  2ZXO A;  3CRL C;  3EA6 A;  3L7Z C;  1EY7 A;  2EY2 A;  2JSO A;  2JYO A;  3K5M A;  1IYV A;  2NTT A;  2F0S A;  3IAY A;  3OSO A;  3KBG A;  5EJW A;  2BA1 A;  4JK1 C;  3J80 E;  4C3J B;  2ICI A;  3RUZ A;  2WV6 D;  1JOQ A;  2IWH A;  5D3I B;  2QEJ C;  2IT1 A;  5A2Q E;  1HA5 A;  2K33 A;  1FGB D;  2F0L A;  3DEP A;  2IX0 A;  2E76 C;  5E4W C;  4BS9 A;  2K7V A;  2K04 A;  3PIP 3;  3X3N A;  1CHP D;  2CQA A;  4L8J A;  5KEE A;  3MHB A;  4QIW B;  1BBX C;  3A7L A;  4H7B A;  1G8Z D;  1OXX K;  1QE6 A;  1JOO A;  3BVZ A;  2LFN A;  1IW7 D;  1NCV A;  4O1N A;  1SYG A;  4DN4 M;  4EQO A;  3BZD B;  3BYT B;  4PV1 C;  2F0O A;  1RDP D;  5IGG A;  2F3V A;  1RCV D;  4IZ8 A;  2NN6 G;  4BA2 I;  1GHJ A;  5CYU A;  2IX1 A;  4X3U A;  2IX3 A;  5DEH A;  1EZ8 A;  4A3B B;  1CZG A;  4DXG A;  1WTQ A;  5IT9 E;  3VYU A;  1QOH A;  4EQN A;  5M3F B;  3QO2 A;  2NN6 I;  3S15 B;  4IUR A;  4XYO A;  3OOC A;  2J7Z A;  2RSO A;  4H13 C;  3MWY W;  2XWJ B;  1MD2 D;  1KDA A;  1S4Z A;  1SYC A;  3M4Y A;  1F9S A;  3QWN A;  1RF2 D;  5DM7 3;  2RDG A;  2K32 A;  1TII D;  1TT2 A;  4DNT B;  1GUT A;  2NVX B;  1QCB D;  1MGS A;  4IAL A;  4K5V A;  2K03 A;  3HOY B;  1JWM D;  5HGT A;  5NUC A;  5C44 B;  2EYL A;  2K5Q A;  2OF1 A;  1I3Q B;  2QDB A;  3W3A A;  4ZUI A;  1JOK A;  1BCP C;  5ELE A;  1ZEQ X;  2CVR A;  4IFD H;  3CQZ B;  1ICW A;  5KNC A;  1V8Q A;  2ZXP A;  1KAA A;  4NDX A;  1ZXT A;  4ODG A;  4EQP A;  5A35 A;  2Z1C A;  4DU9 A;  1PRT F;  2PW7 A;  1Q1B A;  3D4R A;  2A68 C;  3EFX D;  5KRU A;  1B2T A;  1AZP A;  3J81 L;  2EE1 A;  1JWS D;  4RWS C;  1TY2 A;  4OO1 I;  1CHQ D;  2EZV A;  1DOK A;  5CR3 A;  2F0P A;  2O5J C;  1V1P A;  1SFO B;  2J0T D;  1LLR D;  3GTJ B;  4S3S A;  4KTA A;  1H9M A;  1HA6 A;  1H9R A;  1MBY A;  3MFY A;  1AW7 A;  1IHZ A;  4KI0 A;  5CV5 A;  3GTK B;  3GO5 A;  3P7J A;  4ZLT F;  2EVB A;  3HP3 A;  3VA5 A;  1PZJ D;  5G3L D;  4FF3 A;  1FNW A;  1B9N A;  4ULL A;  1SNQ A;  4ME5 A;  4FP5 D;  1O7L A;  1ET9 A;  5LHY 1;  1F9R A;  3I90 A;  3C2P A;  4BY7 B;  3OHX C;  1DYQ A;  4KKS A;  2F03 A;  1SAP A;  4R8I A;  4RA8 A;  3MXG A;  1LT4 D;  5I2X A;  1B3A A;  1LAB A;  2XN9 C;  2HUG A;  3X3M A;  2WAC A;  1TWG B;  2E2H B;  3IKJ A;  2F0N A;  5KIX A;  3A55 A;  3O13 A;  2PYK A;  4XT3 B;  1NUC A;  3I4N B;  1CZW A;  3ITP A;  1JWU D;  2JP1 A;  1Q12 A;  2KOL A;  2MUY A;  4HCS A;  2XRS D;  1OXS C;  1EU3 A;  2BE5 C;  4QUF A;  3Q24 A;  1FD7 D;  5TSS A;  2ZXR A;  1LT6 D;  2H4O A;  1CQV A;  5HUR A;  4WJW A;  3BDO A;  1TU2 B;  2NN6 H;  1Q8I A;  2F0Q A;  1PTO F;  2EJG C;  1ROD A;  4LJZ C;  4WOR A;  3GV3 A;  1X3P A;  3HOV B;  1G91 A;  2K5D A;  2O5I C;  4DFA A;  5G3L F;  5I9P A;  2NVY B;  3DMU A;  2A69 C;  3HOU B;  1I4Q A;  5CBA E;  3OW7 A;  4XTC S;  1GHK A;  2F0H A;  2XVS A;  1AEX A;  1RJT A;  3KUP A;  1SBB B;  4IFD G;  4OHJ A;  1H9S B;  3ND8 A;  1RKN A;  3T16 A;  3JAM E;  3I72 A;  3VR2 A;  1KAB A;  3QOL A;  1JC7 A;  1NR2 A;  4FXD A;  1LTA D;  1HHV A;  4LAA A;  1LTT D;  3PMF A;  1EU4 A;  3M4O B;  1PFB A;  1WD1 A;  3MEH A;  3WOF A;  3I70 A;  4BY1 B;  1I4R A;  3OIQ A;  4DNR B;  3QIA A;  3FMC A;  1Q90 A;  2JA6 B;  3QOJ A;  4ZKB B;  2R6G A;  1XYI A;  1STH A;  4I7Z C;  3QG1 A;  4IUU A;  4KV6 A;  2FFK B;  1TS5 A;  1I4G A;  3TME A;  1PRT B;  2ICE C;  3ERQ A;  5J22 A;  3HOZ B;  1VF7 A;  2PW5 A;  3OWF A;  4PMC A;  3I4M B;  3Q0A A;  1MSG A;  5C4X B;  2B8F A;  3DWP A;  3FVQ A;  3C1F A;  4A3F B;  1Y8O B;  4IFD J;  4FXG C;  2PZT A;  2F0D A;  1ILP A;  2PZW A;  3NBH A;  1STB A;  1PTO B;  5EBD A;  1GXD C;  4RHS A;  4DF7 A;  2LKV A;  1J9O A;  4CKE A;  2X69 A;  3BS1 A;  4KHV A;  1BUV T;  5EKL A;  1ENC A;  1Y69 U;  4G7H C;  2F0K A;  3WDN A;  4HSP A;  4C1N K;  1ML0 D;  4RGT A;  2L1B A;  1WTO A;  1SYB A;  1SYF A;  2JXM B;  1ILQ A;  1VF5 C;  1EY4 A;  2JA8 B;  4K2K A;  5D14 A;  2EYM A;  2VXW A;  2Z4I A;  2KEC A;  2JE6 I;  1A6X A;  1Y8P B;  4HMI A;  2BDO A;  1Y8N B;  2AWN A;  3VYR A;  1YNN C;  1HFG A;  4ZUJ A;  4K8I A;  4RKB A;  1JCK B;  1EY6 A;  4Q5V A;  3S16 B;  2CHB D;  3MFG A;  1DJR D;  3NQT A;  4HN7 A;  2KCN A;  2LS0 1;  4ZK9 B;  5JPM C;  1IW7 C;  4KY6 A;  2A6H C;  1EQV A;  3SK6 A;  5M5W B;  2IW3 A;  5IOD A;  1SE2 A;  4A3G B;  2O4X A;  5M9O A;  1OXU A;  3NBI A;  1BDO A;  2RBM A;  3G7L A;  1PXU A;  1BCP F;  3GP7 A;  4JBW A;  3HOW B;  2B2U C;  1ZKO A;  4G4K A;  1TQO A;  2EY6 A;  3PV0 A;  1A3U A;  2XNA C;  5BN3 A;  4NKL A;  2DY7 A;  3VR4 A;  4KMU C;  3N6R A;  1Z7T A;  1WTX A;  3V96 A;  5EKK A;  4Y7N B;  1QJO A;  1UNS A;  4E6I A;  2FJ2 A;  1PMR A;  4FO2 A;  3BYY B;  4ZRZ A;  4C3I G;  3KK7 A;  1DCZ A;  1SDF A;  2E75 C;  4PQX A;  4RCN A;  1H9J A;  3S1N B;  5IGF A;  1STN A;  5I6Y A;  1KTK A;  1QG7 A;  5EPL A;  3PO2 B;  5K36 H;  3MTS A;  5C0X I;  2F0V A;  2TSS A;  2VUM B;  3URY A;  1F2Z A;  3HEJ A;  1JR0 D;  3J7Y W;  4OO1 H;  3PUV A;  2NBF A;  5FKA C;  5C3W A;  4L6T B;  3H6M A;  4DAP A;  1ENA A;  3A8K E;  4WFN 3;  3D6C A;  2L4N A;  2K5W A;  2N88 A;  1GUS A;  3T4A C;  2MJ8 A;  4NP5 A;  4OL7 A;  1KLG D;  3SVM A;  3T51 B;  1MSH A;  1O78 A;  4AYB B;  1PTO H;  1ZYR C;  4UDU C;  1CA5 A;  5JEA G;  5ELF A;  4IFD I;  5EPK A;  5EKI A;  5CMD A;  5COR A;  1M8A A;  5C6A A;  4ZAI A;  2Q8I B;  1S5F D;  4CHT B;  2EY1 A;  1TWC B;  2L12 A;  3F2U A;  3PIO 3;  4OIJ A;  4KHZ A;  5I6W A;  4RKL A;  3MVV A;  2EYJ A;  3S17 B;  2Z4H A;  4QCL A;  1EIG A;  1SMY C;  3OIP A;  1SJE D;  1PTO D;  2SDF A;  2Y0S B;  1RTO A;  4WRD A;  1CTM A;  3TZD A;  2NVT B;  3C3L A;  3MAQ A;  4K6L A;  1ZYR D;  1U4L A;  2LY7 A;  3ZYY X;  4M1U B;  1Q3L A;  2B2W A;  3VR5 A;  1B1Z A;  3AU7 A;  3C1E A;  3P1H A;  3SK4 A;  1KLU D;  4CJ0 B;  1WCM B;  4R9W A;  4RHR A;  4A3J B;  3HG9 A;  2RDH A;  1QWY A;  2A74 C;  2C5C A;  1C4Q A;  3DHQ A;  4R8N A;  2M2L A;  3IFD A;  2EPB A;  1HCZ A;  1EEF D;  1B50 A;  4X3K A;  3I4L A;  2K1B A;  2D9U A;  5KGU A;  2I46 A;  5ELD A;  3CHB D;  1G2S A;  1ESR A;  4DAV A;  2ZT9 C;  1ESF A;  2G9D A;  2A73 B;  4IUT A;  2KUM A;  1HFN A;  2L11 A;  1B4O A;  3QB3 A;  3FDT A;  2F3W A;  2E2J B;  1GUN A;  5IGD A;  3NXW A;  1E2V A;  5AFW A;  1TWH B;  4A3M B;  2I07 B;  5ELB A;  3HZX A;  3OMC A;  5E4X A;  1X32 A;  3D31 A;  4TRD A;  2R3Z A;  1F2Y A;  1OXV A;  3PUZ A;  1DD2 A;  4KD3 A;  4M8A A;  4QF4 A;  3PUW A;  2BOS A;  3EQL C;  2HQE A;  2F0M A;  1GUG A;  4RGN A;  1CM9 A;  1WTP A;  3DWQ A;  1STG A;  1PTO C;  2O2L D;  3S14 B;  1QB5 D;  1PFN A;  4LMQ D;  1B9M A;  3UI2 A;  5EGT A;  5ELC A;  1STA A;  2N55 A;  4J8Q A;  1LTG D;  4CBV A;  4FF4 A;  1IKL A;  2J4X A;  5M5Y B;  1SE3 A;  3I91 A;  1Z6H A;  1DON A;  3SXH A;  3K59 A;  1I50 B;  1SNM A;  4TSS A;  1G2T A;  1A2U A;  1RD9 D;  2F0U A;  3TP8 A;  4BA1 I;  1QNK A;  5IIF A;  3OPO A;  4PNY A;  4EGV A;  1D5M C;  2MPM A;  3NSW A;  4KJN A;  4KN4 C;  1SE4 A;  4J6H A;  3HGB A;  3S9W A;  1U4R A;  2B2V A;  1EY0 A;  3M7N A;  1VCI A;  1FYC A;  5FO8 B;  4F7X A;  3NTK A;  4B9W A;  2K01 A;  4GZY C;  2TMP A;  2WKD A;  4OGQ C;  1XXG A;  1V1P B;  3NE5 B;  2E2D C;  2VB3 X;  3LWU A;  2WKC A;  4MIU A;  2B8G A;  1FNU A;  1KNA A;  1FR3 A;  3FPU B;  4K5W A;  5C3X A;  1TY0 A;  1LTS D;  2MP1 A;  1E2W A;  5FO9 B;  5K5P A;  1OO9 B;  1CA6 A;  4IUN A;  5C0X J;  2EYO A;  5JVH 3;  1PZI D;  1H9K A;  5KNB A;  1S5E D;  3NTH A;  1J8I A;  3BG3 A;  1D5X C;  1EYC A;  3VR6 A;  2HCC A;  1PRT D;  1NSN S;  2OEO A;  1VDZ A;  1BQQ T;  1I4H A;  2B2Y A;  2RDF A;  4K5X A;  4Q0F A;  4IUP A;  4K14 A;  3R2T A;  1FNV A;  3SHL A;  5I9O A;  2PPB C;  4F88 A;  2B2T A;  1S5C D;  3ND9 A;  3I8Z A;  5LL6 X;  3GTL B;  1CK1 A;  4H44 C;  3WOE A;  4ZKC B;  4DXF A;  3SK5 A;  3K7A B;  3RLF A;  2KCC A;  3W2D A;  4FYD A;  1SNP A;  4XYQ A;  2K05 A;  1G29 1;  3L3O C;  3K58 A;  4FF2 A;  4IUQ A;  3MC0 B;  2KA7 A;  4X3T A;  2DNE A;  2B39 A;  3RD4 A;  1EY9 A;  2B63 B;  1TWF B;  3NPP A;  4L63 B;  1LV9 A;  3NUC A;  3S2D B;  4KN7 C;  2XIW A;  5J39 A;  3J7A V;  3L9A X;  4N9P A;  1I6V C;  2A5H A;  4ILW A;  4RFB A;  1QIL A;  3D4D A;  4U67 3;  4KK7 A;  2Z8L A;  3RZO B;  2AQ1 B;  1D5Z C;  4YIJ A;  1BXT A;  1LAC A;  3NWT A;  5JJZ A;  5EQ0 A;  1K8O A;  3GTQ B;  3T13 A;  1STY A;  4A3E B;  4G7Z C;  1JE4 A;  1ET6 A;  2D2C C;  1EY5 A;  4QB4 A;  4DK0 A;  3KLS X;  4MN3 A;  3TSS A;  5M5X B;  2KEE A;  2QKI C;  3I3C A;  1TVX A;  3S2H B;  2NVQ B;  5C4H A;  5FK9 C;  5C0X G;  1L0X B;  1LT5 D;  2L55 A;  3AMU A;  3RZD B;  3HRZ C;  5CV8 A;  3LWE A;  2RQX A;  4RCO A;  3J80 L;  2FMC A;  4HAE A;  3S1R B;  3NTI A;  1F2M A;  2EXZ A;  1T5E A;  5BN4 A;  5E1F A;  5IGB A;  4KKU A;  4XQN A;  3BDL A;  1Y1W B;  1DZ1 A;  2A6H D;  4LK1 C;  3M85 A;  3V2T A;  4FF1 A;  3A56 A;  1PFM A;  3D3R A;  3H0G B;  3H3V C;  3DXJ C;  5C0X H;  5C5L A;  3HS0 C;  2KHS A;  1Q1E A;  5CBE E;  2NWG A;  3E0J A;  1S5D D;  3E6Z X;  1EEI D;  4CKC A;  1SNC A;  1O7Y A;  2IJ0 A;  2JEB I;  4RGM A;  2WIN B;  4ZYS A;  3MXN A;  3T53 B;  2ENB A;  1TS4 A;  4PMB A;  1VMC A;  1TS2 A;  1BNZ A;  3J7A F;  2F1M A;  3H91 A;  1PLF A;  2EYF A;  2JEA I;  3PUX A;  4V19 0;  1MI2 A;  4K8J A;  1E0B A;  4P2C B;  1SND A;  2DNC A;  3GV6 A;  2PQE A;  1GOZ A;  1HTL D;  4OO1 G;  4KY5 A;  4G7O C;  1DOM A;  2X6G A;  4ABN A;  3IFT A;  2L5T A;  4V0B A;  1EQT A;  1EYD A;  2EJM A;  5C4Z A;  3PO3 B;  3DWA A;  3R93 A;  3K5O A;  5F2D A;  5EBC A;  4C3H G;  4XDX A;  5BN5 A;  2NUC A;  1PDQ A;  5D3D A;  1U9R A;  1RTN A;  3U9O A;  3GQB A;  2IL8 A;  1WVL A;  1EFI D;  4C3J G;  4HCE A;  4K6D A;  3CKI B;  2B2T C;  2NZ1 D;  1D1K A;  1DM0 B;  1HQM C;  4KJO A;  4CGY B;  1SYE A;  2DY8 A;  2F0F A;  1V1O A;  2XWB B;  1U4P A;  4N9T A;  1JQY D;  1EZ6 A;  4C3I B;  1EOT A;  3NP8 A;  1CFM A;  4B9X A;  1AZQ A;  2AQ2 B;  2RSN A;  2FMM A;  5IOC A;  1B53 A;  2H1E A;  5I2Y A;  1NR4 A;  3GD7 A;  3LNN A;  1II3 A;  2R93 B;  1GJX A;  1XX8 A;  2QF7 A;  2PZU A;  3GTO B;  4KKT A;  3HKZ B;  3K0Y A;  3NK9 A;  4TKO B;  3NWS A;  3IL8 A;  4C1N I;  1D2B A;  1BF4 A;  2WAQ B;  1BO0 A;  1YNJ C;  5KND A;  4C56 C;  1PYW D;  2KVM A;  3MXU A;  3P75 A;  3D6W A;  2GA4 B;  1LTB D;  1HUM A;  2F4I A;  1EY8 A;  4MHE A;  2EOT A;  3SE0 A;  3R3O A;  1I4X A;  3PUY A;  2RVL A;  1TWA B;  3M3Y B;  5J1Z A;  2QCP X;  4U68 A;  2E2I B;  1F77 A;  4A3D B;  4I65 A;  3TP7 A;  4HMJ A;  2A69 D;  3H94 A;  3U9S A;  3FEW X;  2AQ3 B;  1BCP D;  2B2V C;  2SNM A;  1F9P A;  2F0G A;  2A6E D;  5ISR A;  1C8C A;  4ID6 A;  4C3H B;  1F2L A;  4DGZ A;  2X6L A;  2V4D A;  5JPN C;  4HED A;  3D8G A;  4H0L C;  5CC4 A;  2SEB D;  4BWG B;  2LMC B;  1W6K A;  2G9H D;  2B2Y C;  2NB0 A;  3H09 A;  1K8M A;  1Z47 A;  3A54 A;  2K28 A;  3K5L A;  5LL6 S;  2JA5 B;  3S1M B;  1A3V A;  1EWC A;  1AP0 A;  1TR5 A;  3DM1 A;  1WD0 A;  3VYT A;  5DNF A;  1PZK D;  1VMP A;  5DM6 3;  1AFP A;  4IN3 A;  3CRK C;  1NAP A;  1XWE A;  5CV9 A;  1STE A;  1G6Z A;  2D62 A;  3TZU A;  4CJ1 B;  5IGC A;  3BDC A;  3I73 A;  3TP5 A;  4UAI A;  4FNF A;  2Q8R E;  4HR7 B;  1UEA B;  2IPK D;  1X3Q A;  1JIC A;  1LTI D;  1LT3 D;  3TBI B;  1AN8 A;  2VNU D;  2WII B;  3CU7 A;  1M4V A;  3VYS A;  1I4P A;  1DXM A;  2WP8 J;  1A15 A;  1UAP A;  1HPC A;  5KYL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...