2RSOA

Solution structure of the chromodomain of swi6
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
92
structure length
92
Chain Sequence
b'GSHMESKSSSKKLKENAKEEEGGEEEEEDEYVVEKVLKHRMARKGGGYEYLLKWEGYDDPSDNTWSSEADCSGCKQLIEAYWNEHGGRPEPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Intrinsic nucleic Acid-binding activity of chp1 chromodomain is required for heterochromatic gene silencing
pubmed doi rcsb
molecule keywords Chromatin-associated protein swi6
source organism Schizosaccharomyces pombe
molecule tags Transcription
total genus 7
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2012-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2rsoA00
1ML0D 1HFGA 4ZKCB 2EOTA 1M8AA 1PFMA 1U4MA 1ZXTA 1F9PA 2J7ZA 4UAIA 4XT1B 2VXWA 2KEDA 1ILQA 1O7YA 1X32A 2N88A 3DM1A 4OIJA 1C8CA 1O80A 2L4NA 1SSOA 3D6WA 4X3SA 5T1GA 4IUPA 1JE4A 2DY8A 2X69A 1MSHA 1KNEA 2B2TC 2D9UA 2FJ2A 1RTNA 2MJ8A 3DEPA 3IFDA 3KBXA 4RAUC 1NCVA 1AZQA 5EJWA 1WTQA 3G7LA 4RA8A 1BF4A 5EPKA 1CA5A 1B50A 3H91A 3TZDA 3ONAB 5EPJA 1WTVA 1G2TA 2B2UC 1ESRA 5CORA 1BNZA 3Q6SA 1EOTA 1G91A 1VMPA 2MP1A 1ICWA 2IL8A 2HCCA 1G6ZA 2SDFA 2B2TA 1F2LA 2M2LA 4X3KA 1WVLA 2B2WC 1PLFA 1RJTA 4ZKBB 1EIHA 3I91A 2B2UA 4OIKA 5D65A 1LV9A 2B2YA 2L1BA 2N55A 4U68A 1RHPA 4RWSC 4NW2A 2K1BA 4IUTA 1AZPA 2HDMA 1KNAA 4CJ2C 1HA6A 2NYZD 1HFNA 1WTXA 3KUPA 2K01A 5COYA 2XIWA 1SDFA 1QNKA 3R93A 1F9RA 1DONA 1HRJA 1CA6A 2KECA 1MSGA 1HHVA 1EIGA 1U4RA 3P7JA 1WTRA 1G2SA 2EPBA 5JJZA 3QO2A 2L12A 1JICA 1HUMA 2K05A 4X3TA 2NZ1D 4ZLTF 2K04A 1DOKA 1WD1A 3MTSA 4IUQA 4ZAIA 4CJ1B 4MN3A 3LWEA 4QUFA 3SVMA 1EL0A 1NR2A 5CBEE 2HCIA 1WTWA 2B2VC 1S4ZA 2L11A 1F9QA 2R3ZA 2DY7A 1WTPA 2HDLA 1EQTA 1DOLA 1XX8A 1HUNA 2KVMA 1GUWA 2RSOA 1B4OA 3I3CA 1WD0A 4HEDA 2MGSA 4LMQD 1PDQA 1PFNA 2JYOA 5E4XA 1BO0A 1WTOA 2MPMA 5CMDA 4O42A 2B2WA 1B3AA 1MGSA 3FDTA 1B53A 4DN4M 2FMMA 1IKLA 1NR4A 2B2VA 3I90A 1B2TA 3TN2A 3IL8A 5E4WC 2K03A 2RSNA 4CJ0B 2FINB 1DZ1A 1SAPA 5EKIA 1XYIA 3FPUB 2NWGA 3MWYW 2H1EA 1E0BA 1NAPA 2HUGA 2Q8RE 2RVLA 2FHTA 4HCSA 4X3UA 5T1IA 1J9OA 1O7ZA 3GV3A 4XT3B 1IKMA 2JP1A 1RODA 1CM9A 1X3QA 2KUMA 4R9WA 1J8IA 1DOMA 1RTOA 5EQ0A 1ILPA 3GV6A 3F2UA 5EPLA 4IUVA 1VMCA 4XDXA 5CBAE 1BBXC 4HAEA 1AP0A 1U4LA 5D14A 2RA4A 2L9HA 2FFKB 1X3PA 3HP3A 1Q3LA 4HSVA 1A15A 5DNFA 2X6GA 1MI2A 2Q8TA 1U4PA 1IL8A 2CVRA 3I8ZA 1QE6A 1PFBA 2EE1A 3DEOA 2X6LA 5AFWA 3N52A 1QG7A 4QUCA 1F9SA 2B2YC 2K28A 3UI2A 2BDNA 4IURA 4MHEA 2KEEA 4ZK9B 4R8IA 2KOLA 1TVXA 4IUUA
chains in the Genus database with same CATH superfamily
3R2TA 3CC4A 5ISRA 3F1ZA 4V0BA 1YJWA 1BCPD 4DNTB 2CQOA 2VW9A 4RGMA 1SFOB 4IUPA 4L6TB 4ZYSA 2L5TA 2GVBA 1AZQA 4QGUA 2V1CC 4R4CA 2QGQA 4KN4C 3TZDA 4F8MA 3ONAB 3DMUA 4G7ZC 1RL2A 2KQ3A 1TWHB 4IOAA 5LMUL 3ND8A 2G9DA 1ICWA 3J81j 1JWMD 4A3IB 1RD9D 1ONLA 2EYOA 2YU9H 5M5YH 1SR3A 4JW0A 4QL5A 1STYA 2NVYB 3AQQA 3KDFB 4LUVA 1PH1A 3F2BA 4FVMA 4A3IG 1KTKA 2A69D 4BY7H 1RHPA 3HRZC 2GN5A 1DD2A 3L7ZC 4C3HH 1GUSA 1O7IA 5FK9C 4RGNA 3DWAA 5C3WA 3BDCA 1XMOQ 3HEJA 1HH2P 1PVOA 4LUOA 2BE5D 1JOQA 1HUMA 2NZ1D 3FPPA 3J7YW 4AQYQ 4MN3A 1D1KA 4QUFA 2NZOA 1A2TA 4HMJA 2WFWA 3H09A 4X62Q 5BR8Q 2MO1A 4L63B 1YHBA 2XN9C 3PUZA 3AB9A 2LKVA 2QCPX 4IALA 4GNXC 1GUOA 1TS3A 3R2IA 1FNWA 1ZYRC 3A8JE 3OW2A 1C48A 1PRTD 3MWYW 1E2VA 2F0DA 1VQLA 3PO3H 5IP9H 3K80C 5EQ0A 1ILPA 4IJHA 3OOCA 4JI7Q 4BY1H 5M3FH 2QKIC 3RR5A 3FP9A 2RA4A 1WYDA 1CZGA 1SJED 2A68D 3HP3A 3BVMA 2O4XA 1HQRD 3T53B 1EY4A 3FMCA 4QUCA 3W1BA 1SMYD 2EYPA 4I7AA 1A3TA 2ATWA 1KDCA 3SEBA 4Z9CB 2KOLA 3T1HL 3ZJYC 1K28A 2UUBQ 4QIWB 1UEBA 4A3EH 2UXDL 1NNXA 2EOTA 3RMHA 2J7ZA 2K4KA 3S1QB 2B3GA 3S1MH 2K75A 1AH9A 1R4QB 2CW0D 1K9MC 4YY3L 1HR0L 1MSHA 1KNEA 1I4XA 2B2TC 3ERQA 1E22A 1SXTA 2B63B 1WTQA 4A3DB 4DU9A 1EEFD 1V1PB 2PZUA 1BNZA 1XPUA 2B63G 4A3DG 1CSPA 3MXUA 1S5ED 4IZ8A 4JI6L 1Y8PB 1TR5A 2B8FA 1LABA 1NMFA 4P74A 5DM73 2O5JC 1R9TB 5K5PA 4GKJL 2CH4W 1A8VA 3VR5A 2CWAA 2XIWA 4R8NA 5A35A 1PRTF 1YVCA 2OCEA 2ALYB 2KCTA 3GDEA 4A3FB 4DAMA 3T4AC 3O13A 1VQNA 4KD4A 1HNZL 3CMEA 4A3FG 4C3IB 1S3OA 1EU3A 1VCIA 4A3KH 1A2UA 4QCLA 3PSIA 4X64Q 4LWCA 1EYCA 4RKBA 3K5LA 2H5XA 2WAQB 4C3IG 4GKKL 5HGTA 4A3MH 1X6OA 3KFUA 1MGSA 1Q1BA 2EIFA 2DJGC 2B2VA 4R4TA 4UP7A 3H15A 3S16H 4POFA 1VQPA 4P73A 2RKSA 1S40A 4X65Q 3NQIA 1O7ZA 3C1EA 3Q23A 2OF1A 3F2UA 4KV6A 3KBGA 1JJCB 4XDXA 1AP0A 5D14A 3KJPA 3CCVA 3W5OA 3HKSA 2L9HA 2QDBA 1X3PA 2JA9A 2RCNA 4YCUA 1EYGA 4BA2I 4C1NI 2WIIB 2RHSB 2PZTA 1IXRA 4IURA 1Z47A 1EYAA 4MHEA 4BWGB 1XNRL 2GVAA 4LF6L 3KLWA 1ZYRD 4DV1L 4HJ8A 1M4VA 4DUYQ 4JOIC 1ZXTA 4XT1B 1GOZA 4QIWE 1S5CD 2F1MA 5T1GA 2DUDA 3RZOH 1IL2A 1BBWA 1E7ZA 3NELA 5KYIA 1XWEA 3EN2A 3IFDA 4GOPC 1I94Q 2Q2TA 1EWIA 5IGCA 1FJGQ 3TS2A 3C1FA 4KHVA 5EPKA 4DXGA 3BG3A 2F0VA 3AMUA 4K0KL 2YU9B 4JI4Q 1N32Q 5M5YB 2MO0A 1F2YA 3M9BA 3NE5B 3T13A 2QW7A 4C1NK 1KIXA 4RCOA 4BY7B 1E3PA 1WFQA 4RCNA 3S1NH 3PUVA 2EY6A 4AYBE 3CC7A 3NBHB 1SNCA 2R7FA 4C3HB 3KDFA 4A3LH 4BY7G 3EQLC 5ELDA 1AZPA 3HKZB 1KNAA 3KUPA 3EFXD 1DONA 1LTRD 4DA2A 1EEID 3DHQA 4KMUC 3S1RH 5FKAC 1JE5A 2KENA 4I65A 4BA1I 3HKZG 4HR7B 3RLFA 3G6JB 1MIUA 4LF4Q 2B29A 3LWEA 3J7A5 1EL0A 4L5SA 5EKKA 5IIFA 3TBIB 2L11A 1SNDA 2N8NA 1HNWL 2KCNA 2IWHA 1BDOA 2F0LA 2WKCA 3IKJA 3TMEA 4K2KA 1VQAA 2MGSA 2JYOA 1KDBA 1KAWA 1VQIA 2K5HA 4CGYB 2MUYA 4HJ9A 1LO5D 3BZKA 3FDTA 2WAQE 3D3RA 1X9NA 2ZXRA 1CK1A 3PO3B 4V190 4DR3L 4JBJA 2FINB 3WOEA 1AE3A 1NAPA 2HUGA 2KHSA 2FHTA 2VZAA 4BY1B 2NVTH 4XT3B 5M3FB 3PO3G 5IP9G 4DR7L 5EBCA 4WJWA 5IWAL 1WI5A 4BY1G 4DR1L 5HGQA 2AWOA 1MJEA 3TEHB 5GAEC 1XNQQ 2N3SA 4A3EB 2C35B 1G8ZD 4B08A 2QILA 5C0XH 2C5CA 1V43A 4JI0Q 3J81i 1SE3A 1VQEA 5KGUA 3S1MB 1PFMA 2R61A 4A3EG 5LMNQ 4NKLA 3DM1A 1STBA 3MVVA 3QWNA 1O80A 4B3TQ 1M90C 5KNBA 2F4VL 5E4WC 4CJ0B 2FJ2A 3DEPA 2FMCA 3V96A 2F3WA 2EQSA 1BXTA 3I70A 3I4NG 3D31A 2BH8A 1WOCA 2ENBA 1EIYB 1LLRD 2IL8A 3ERSX 3LWUA 4WORA 1V1PA 1VQMA 4ODGA 1QVFA 1LACA 1XMQQ 1L1OB 3BYTB 4CBVA 1S5DD 1Q8IA 4CKCA 1EIHA 2WKDA 3BVZA 3PUXA 4DV2Q 3HOVH 1KD1C 4QF4A 2XRSD 4ALPA 2KJXA 4LF8L 1QNKA 1SYDA 3ER0A 5H1SE 2N49A 4LF5Q 3J80L 4KN7C 4A3KB 1JCKB 1YJ9A 2F0QA 2NTSA 3TSSA 3QOLA 4AIMA 3W2DA 4HTHA 2UUCQ 2E2IH 1I6VC 1WTPA 4A3KG 2KVMA 5J3BA 4BS9A 1Q7YC 4A3MB 3GTQH 5I9PA 1GXDC 2I07B 2IX1A 1PFNA 1SE2A 5E4XA 5CR3A 3S16B 5CMDA 4OONA 4A3MG 3VR6A 1HTLD 1D2BA 2UUAL 2E8GA 1HFNA 1TQOA 5JJKA 1FL0A 3GTKH 4FP5D 1LTTD 1IBLL 5E1FA 2VQFL 4CHTB 3OTOQ 5KIXA 1N34L 1JT8A 4HAEA 4R4IA 2F0EA 1II3A 1YIJA 4CDCC 3FRPB 3OMGA 2EE1A 2P5ZX 3JAML 2Y0SE 1NTGA 2EYLA 2K5QA 1XTCD 3GTMH 4DUZQ 1G51A 1HFGA 4LNQA 3H3VH 3RZOB 1BCPC 2KHJA 1BOSA 1O7YA 1X32A 3OHXC 3P75A 5LL6X 4FF1A 2Z0SA 1JWUD 1JMCA 1TWFH 2D9UA 1PYBA 4KKSA 3HFZB 1Q82C 4DV7Q 3H91A 1VQ8A 2A74C 2PMZE 4EGVA 3CMAA 5CORA 2F0MA 2I46A 3ULLA 1I4RA 1I4QA 1B1ZA 2CH4A 2EY2A 3UE0A 3S1NB 3NP8A 1Y8NB 4NXNL 2R92H 5J39A 2BA0A 4O0AA 4DAVA 5GADC 2FXQA 2LSSA 1V9PA 3TQYA 2O2LD 1C0AA 4A3LG 3S1RB 1KHIA 2K01A 4WFN3 1HA5A 3B6YA 1TWGH 3RN5A 5GAGC 1ZEQX 4NDXA 5IOCA 5ELOA 1DOKA 2K7VA 1GM5A 4YHHL 3S15H 4JV5Q 2XRQD 3VA7A 1D5XC 1S4ZA 3E9IA 4DR4Q 2PQAB 3GD7A 3HOXG 3BVGA 4FYDA 3CQZH 4HEDA 4LF9L 4KHPL 2NVQH 3K5NA 3DWQA 5C0XI 2NVTB 3PUYA 1DZ1A 4XIGS 1CQFA 1KL9A 1KLUD 3S2DH 5KEEA 1QILA 2RVLA 5T1IA 3D8GA 2SNMA 4C2MH 4B3MQ 2MNAA 4R9WA 3SHLA 2RDHA 1A62A 4AH6A 2K5NA 2ZTDA 4S3SA 4LFBL 1Q3LA 3MFYA 5EBDA 1U4PA 3U9OA 4NXMQ 5M5XH 3NXWA 2KCMA 4B3SQ 2X6LA 4A75A 1W6KA 3IFTA 1TVXA 5C0XG 4IUUA 3WWVA 1P16A 5F2DA 1U4MA 1VQ5A 2JA7H 5AJ3Q 2JSOA 3NQTA 5J1ZA 3C46A 2NB0A 5CV5A 1SRUA 4RKLA 3CF5A 2DY8A 3Q0AA 1Q81C 1RTNA 2EXZA 3J80E 2R93H 1BF4A 1ET6A 4DV6Q 1EY8A 3TS0A 3ULJA 1LT6D 1SYFA 4M1UB 4RMFA 1TWCH 2MP1A 5CGKA 1SEBD 4J6HA 1JB3A 3HOVB 1K3RA 1XMOL 4LFAL 3GQBA 1D7QA 3G6EA 1L1OA 2B2YA 4AQYL 1QVGA 3HOVG 1CQVA 3C3LA 3JAMi 1FVIA 1F9RA 1J5EQ 3VYSA 5I9OA 4X62L 1JR0D 3QIAA 1TS5A 1SYEA 5BR8L 3M7NA 1YNNC 1B9NA 2EPBA 3EROA 3CC2A 2ZXPA 3Q24A 4L8JA 1VQDA 2XGTA 3HOZG 2E2IB 1JB7A 5FLMH 1KRTA 3GTQB 1ET9A 4XQJA 3GO5A 4JVZA 1GKHA 1F9QA 2JJQA 2ZJRA 4ABNA 2UU9Q 2ZTEA 3NEMA 1GUWA 3KLSX 3RLNA 4Q5VA 3VYUA 2DN8A 3SK4A 3GTJH 1IW7C 2MPMA 4JI7L 3MZ5A 2B2WA 4R4OA 4P71A 2FMMA 4LF7Q 2GA4B 1MD2D 2VUMG 4H0LC 1VS0A 4FXKC 4JI2L 3GTKB 3FPUB 4IQZA 1LTID 3H3VI 5C4HA 1RKNA 3PIOA 5DLQE 4UY8C 4HMIA 3GV3A 4IO9A 1FD7D 1CM9A 3KF6B 2RDFA 4JI1Q 5EPLA 1SE8A 4OEMB 2UUBL 4WJ4A 1K83H 1STHA 2A8VA 4IPCA 4NB3A 3HOUH 1E1TA 1TS2A 5ELCA 4JYAL 5BN4A 3GTMB 4B3RQ 2LMCB 2JE6I 3A5UA 1PH5A 4HCEA 2WV6D 4ZKCB 5I2XA 3TZUA 1BCPF 4GN5A 4UAIA 3I2ZA 2R7DA 3VA5A 4OIJA 1TWFB 1PH7A 1SSOA 3D6WA 3S2HH 3G71A 4BBRH 1Y69U 3J80c 4R1JA 3A7AB 4LJZC 1Y1WG 2B2UC 1EWHA 4DV0L 2JEAI 5DM63 1CHPD 2EDGA 3SK6A 1B7YB 2AUKA 2R92B 4MZ9A 2B2TA 5ELNA 3A74A 4X3KA 3ZYYX 3KLSA 3HOYH 4DXFA 1JC7A 3MC0B 4LFCL 4WRDA 2R92G 1PTOC 4F88A 1OXXK 5IGBA 1H9RA 1JOKA 1FGUA 1SNQA 2AQ2B 1SNPA 2J0TD 4GN3B 2NYZD 1TWGB 4OGQC 1SDFA 3I4NH 1STNA 4X64L 1WTRA 1P8LA 3S15B 1H9KA 4N9PA 1PHJA 2IY5B 1TXYA 3CCRA 2QEXA 1GVPA 2ZXOA 3EIVA 5JVH3 3PO2H 3UDXA 4G7HC 1XPOA 5IP7H 2F4IA 3CQZB 3JAMc 2NVQB 1IYJB 4X65L 2L0CA 3T51B 1RDPD 5DAUA 1QNUA 1VQ7A 3T1YQ 3CP0A 2PQAA 1I4HA 3UDGA 1N33L 3S2DB 5C5MA 1JORA 1VQGA 4C2MB 1PXUA 1K8MA 3HGBA 4FXGC 5C5LA 1YNND 2KHIA 4KJNA 1IBMQ 3J81L 1HCZA 2AQ3B 2QF7A 3CCQA 4ZUIA 3STBD 5M5XB 1SE4A 5C44H 2EYJA 4DUYL 1VF7A 1QE6A 4JG2A 4LUZA 5AFWA 1GO3E 1QG7A 1IW7D 1J6QA 1I94L 2JA7B 2F0NA 1FJGL 1LTBD 2F0UA 2D5DA 1F9PA 3GTPH 2KEDA 3DUZA 4J8QA 1TS4A 2JA7G 4JI4L 1N32L 2R93B 1JE4A 2F0FA 1BCPB 2YTYA 1KAAA 1TWCB 4JI6Q 1CHQD 5C4JH 1E2WA 1EOVA 2R93G 1WTVA 3PIPA 3NENA 3EBEA 1AN8A 1VF5C 2Z6BA 3MXGA 2HIVA 1B70B 1I50H 4FF4A 4DR6Q 2L55A 2A73B 3PGZA 4GKJQ 4HSPA 4XTCS 1STAA 4GN4B 1L2FA 3A7LA 3A56A 3FEWX 1HQMC 1W6JA 4LF4L 1EY9A 2IT1A 2K1BA 2G9HD 2CWPA 1N8RC 1CA6A 1EIGA 1HZBA 2AMCB 5C4XH 5BN3A 3HOWG 2K04A 1Z7TA 4H13C 4GKKQ 2HCIA 5FLMG 1AE2A 2RHQB 1F2MA 3K7AH 2R6GA 4EQNA 1DOLA 3K58A 3GTJB 3BJUA 1PTOD 3M3YH 4FF3A 4Y7NH 4KD3A 2EJMA 5FLXL 5HURA 3I3CA 3NWTA 1EFID 4HIMA 3I73A 3HZXA 4NP5A 4K6LA 5LMNW 3RZDH 1B3AA 4N8X1 1B53A 4RHSA 5IYBG 3RNUA 2PW7A 3QOJA 1XYIA 1EYDA 1XNQL 2IX0A 1RODA 2PI2A 4RGTA 4F7XA 1K83B 1ASYA 1GUNA 1PRTB 2NN6H 4GS3A 1DYQA 5C3XA 3HOUB 2E5LL 2VQEL 4JI0L 3SK8A 1SYCA 3KF6A 1OXTA 3HOXH 3TRZA 3LX0A 2HQLA 3NSWA 3P20A 4HSVA 4RFBA 5M9OA 5IY0A 4DV1Q 4LF6Q 3HOUG 3MXPA 3U9SA 4JK1C 4PG3A 1BKBA 4UHVA 1E1OA 5G3LD 4XYQA 2ZJQA 3SXHA 3D4WA 4IOCA 3J7AV 3S2HB 3OW7A 1SYBA 1RF2D 1C8CA 4BBSH 4BBRB 2L4NA 2RCFA 3PV0A 1Z9FA 5CC4A 1UE5A 1PZKD 1AFPA 4EQOA 3I55A 2K5DA 1S72A 4RAUC 4BBRG 1NCVA 5JEAG 3H0GG 3TP8A 4QY7A 2OEOA 5EPJA 4DV2L 4KTAA 5CYUA 4O1NA 3HOYB 2PPBC 3AFPA 4KI0A 4CKEA 1G6ZA 2I5LX 5IYCH 2WB1B 5JVG3 2JEBI 1RJTA 2XSCA 4L5QA 3HOYG 1PTOF 1LTAD 3CRKC 4DNIA 4LF5L 1YI2A 2WB1G 3PMFA 4U68A 4JI8Q 2ICIA 4NW2A 3I4NB 4ID6A 4OX9Q 4A3BG 4CJ2C 2YTVA 2Z6KC 1Y14B 2F0KA 4KHZA 3R93A 3J81E 4C56C 1MSGA 1HHVA 5J22A 3OSOA 1EY5A 4YWMA 3PO2B 2PCFB 2UXBQ 5CBEE 1IYUA 1SNOA 2JN4A 3MA2B 1WTWA 5GROA 3PO2G 2R7ZH 2E2DC 2HDLA 3J7AF 2MHVA 5IP7G 4N9TA 2K6AA 5G3LF 3GTLH 5NUCA 3AYHB 1BO0A 4HJAA 4EQ5A 5IGGA 2HHHQ 3SGIA 4BXXH 3I90A 3HKZE 1KC8C 2K03A 3CKIB 2OTLA 5IWAQ 1SNMA 4JBKA 1FNVA 4JI3Q 3HOZH 5KYLA 5K36G 4DR1Q 5C0XJ 4X3UA 4CKBA 5C44B 1CTMA 1DOMA 2B39A 3I4OA 3L9AX 4TQUS 4IPHA 1MKHA 2FFKB 5C44G 1HXYD 1Q1EA 3OIQA 1C7YA 4N8FA 2BOSA 4IFDI 3DEOA 4OELB 5KNCA 4Y52H 1QJOA 3MXNB 2VUMH 2EZVA 4ZK9B 2VB2X 3GTPB 1HZCA 1F2ZA 4DV7L 4ZCKA 4DR2Q 4K8IA 3ITPA 2NUCA 5IODA 3SE0A 5L37A 4GNXB 3M85A 4DV4Q 4DGZA 5JJIA 3DXJC 5C4JB 2ID0A 2D0OA 3KBXA 2Q8IB 3A8IE 3G7LA 2ZM6Q 1I50B 1B50A 3I7FA 4I7ZC 3GTOH 4DAYB 2BDOA 3HS0C 4IFDG 1G91A 1VMPA 2JQOA 5KNDA 2UXCQ 1K0SA 1DM0B 1FGBD 3KJOA 5FJ8H 1T9HA 4LF8Q 2EYFA 3GTGH 1UNSA 3PCOB 2Z1CA 2IW3A 1KRSA 1I6HH 5HY6A 3KLRA 3FKIH 3L2PA 4JV5L 2E76C 2ZJPA 5JAVA 2B8GA 5COYA 1Y1WH 2WP8J 3MHBA 2QDLA 4DR4L 5C4XB 3I4MH 3J81c 1U4RA 5JJZA 1VQKA 3QO2A 2L12A 1QZHA 5C4XG 3NTIA 3MTSA 4KKTA 4NPSA 3RLOA 3K7AB 4KY7A 2F0TA 3PIO3 2NN6I 1NR2A 3M3YB 4Y7NB 1G291 2OWOA 3BU2A 1VQJA 2IPKD 1XX8A 2DNCA 4DR5Q 3CU7A 3RZDB 2TMPA 3JC66 3FHWA 4PZ6A 1KDAA 4XQNA 4DN4M 3EJIA 1IBLQ 3TN2A 1FYCA 2RQXA 5CV4A 5EKIA 4NXML 4B3SL 3NUCA 2JXMB 3TP6A 3HOXB 4DV3Q 1M1KC 1VMCA 2NN6G 3D6CA 5ELBA 1I5FA 5CBAE 2K32A 1A15A 5DNFA 3QB3A 5AJ3L 3RD4A 1ENFA 3QJYA 1L0WA 1SYGA 2ES2A 4GZYC 2BA1A 3A5ZB 2BDNA 4R8IA 4IJLA 1A6XA 1HPCA 4FXDA 4BBSB 1YEZA 2IJ0A 2Z8LA 4J15A 2I0QA 3U58A 1LM0A 2WACA 2JK8A 4PMWA 5C6AA 5FO9B 4ULLA 3M4YA 1X56A 4X3SA 3S14H 4BBSG 1UWVA 1PH8A 1MBYA 1Q46A 1N36Q 4A3JG 3E0JA 4RA8A 1ASZA 1CA5A 1DCZA 4NXNQ 2EJFC 1JJGA 4X66Q 1LT4D 3CXCA 2I5HA 2SOBA 3M4QA 2Z4HA 1F2LA 4ZQ3A 1WVLA 1UE6A 5IYCG 5FLXc 1PH6A 3G48A 1K8GA 1O7LA 1LTSD 4QMGA 4A4IA 1STGA 4A3GG 2LS01 2XWBB 1QB5D 2HDMA 1O78A 2RBMA 2AKWB 4YHHQ 1S5BD 1LT5D 4EVOA 2UU9L 4GOPB 4YWLA 1T5XD 3OMCA 3F2CA 3KF8B 2EXDA 3E6ZX 4XQQA 1WD1A 4DK3C 4CJ1B 3A8KE 3MAQA 2R7ZB 1JQYD 4R4QA 4DV5Q 3DWPA 4LF7L 3GTLB 3OWFA 2NZHA 4DFAA 1PA6A 4FNFA 5JPNC 2R7ZG 2WINB 2VNUD 2IHEA 1A0IA 3V2TA 1WD0A 1V1OA 4JI1L 1X3GA 4YIJA 4O42A 3HOZB 1B2TA 3L3OC 4ME5A 4BXXG 4LW1A 2PYKA 1NSNS 4H02A 3HOWH 3D0FA 5IGFA 4LFBQ 5IGEA 1UAPA 4PZ8A 4B3RL 2JP1A 1IKMA 5CV7A 1X3QA 4OWTB 4IUVA 3STBC 1IBKQ 1BBXC 1TY0A 2VB3X 3A55A 3JAME 3F2DA 4JI5Q 2ICEC 2F3VA 2Q8TA 2VUMB 1PFBA 1T5EA 3CW2C 1VQOA 1CT1D 1DJRD 1H9SB 1F9SA 5IYBH 1L1OC 2B2YC 3NPPA 1NY4A 1EFWA 4JCVE 3KYHC 1B44D 3PIP3 1WTHA 1HNXQ 3MXNA 5FO7B 4HIDA 4P2CB 4FO2A 1YNJC 3RUZA 4IPDA 5C3EH 2DGYA 1YZ6A 1VQ6A 1OXSC 1DGSA 5CV6A 1YITA 4GNXA 1Q12A 2K33A 3GTOB 3OWEB 2EY5A 5EKLA 4B9XA 1NUCA 1QUQB 2IX3A 3CCMA 4LFAQ 1X3FA 4QQBX 2YV5A 1EOTA 3K81C 4Q0FA 4FDBA 1SBBB 4DAYA 3GTGB 1WJJA 1K0RA 2B2WC 5FJ8G 5IT9L 1KABA 1ZKOA 1I6HB 2B2UA 2M9VA 3FKIB 4ME3A 2RF4A 4OIKA 5D65A 1IHZA 3BZDB 5LMUQ 2F0WA 1Y1WB 4RGOS 1EY7A 5JEAH 4CDFC 3I4MB 3H0GH 3FKIG 1BVSA 4OHJA 1TY2A 5CV8A 2K5VA 1C4QA 2KECA 1KXLA 4FF2A 4IPGA 2Q2IA 3I4MG 1G2SA 1HZAA 4K2LA 4X3TA 2AUJD 3EA6A 2LXKA 3T1YL 3LNNA 5LL6S 2PZWA 3K0YA 1KLGD 1B8AA 3F8TA 2DY7A 1PH9A 1YNXA 4KY5A 4JI2Q 2F0HA 2Z9HA 1X3EA 5M3MH 1HR0W 1IBML 4JBWA 4OXPA 4A3BH 1HTPA 1PDQA 3WOFA 1H9MA 1VDZA 4X6AH 3KK7A 5JJLA 5BN5A 1TKWB 3ND9A 2E75C 3IL8A 3J7ZC 2E2JH 3S9WA 5DEHA 4G4KA 2H1EA 2BH2A 2OT2A 2Q8RE 4GLAC 2TSSA 3M4PA 1ICFB 2XNAC 4JYAQ 2MFIA 3SDZA 2YYZA 5CV9A 1STEA 2F0JA 4L5TA 1YBYA 1DXMA 3NK9A 4OO1H 3BDOA 2JA8H 2NVXH 1EIFA 2CKZB 3M7GA 2X6GA 1R4PB 1X65A 2OQ0A 5JEAJ 2EYMA 2V4DA 3VYTA 1PFSA 2A6HC 2D2CC 1MHWC 5M5WH 1BUVT 1U9RA 1EZ8A 3G4SA 3U4ZA 5K36H 4AYBB 3VR2A 3VR3A 5LHY1 1VQBA 3S14B 2RDGA 2CHBD 2PI2E 3Q8DA 1VQ9A 4K5XA 3PUWA 2F0IA 2Q2HA 4DR6L 2LY7A 1BBUA 4AYBG 4TKOB 4DV0Q 3ULPA 4B9WA 5A2QL 1MJCA 2PQEA 2MJ8A 1K73C 3UDIA 3T1HQ 5EJWA 2UXDQ 1NBWA 1EU4A 3I56A 4A3CH 4LFCQ 3FVQA 3Q6SA 1G6PA 5I4DA 1HJPA 4DK1A 2F52A 4YY3Q 1HR0Q 4ILWA 1F77A 4LAAA 3TP5A 5E7NA 1SN8A 1OXUA 1JOOA 2ZTCA 4HIOA 3I91A 3HG9A 1YNJD 2F3IA 4MTNA 3N6RA 3VYRA 1QVCA 1V1QA 4JOIA 2Q2UA 2PNHA 1PMRA 1XTDA 4GLVB 2JA5H 2WAQG 4IFDH 3S17H 1IZ6A 2QEJC 1OO9B 1JICA 5EGTA 3AEVA 1KQSA 4PQXA 3E9HA 4K5VA 1BR9A 2PNRC 3L0OA 4IUQA 1N9WA 4GOPA 1VQHA 2C9OA 3R8BA 3KF8A 4OWWB 4YWKA 5I6WA 2B2VC 1N33Q 4G57A 1HUNA 3EVQA 3LGJA 4KKUA 1K8OA 1PYWD 3CAMA 2HT1A 4K5WA 4QB4A 3HOWB 2G5DA 1HNZQ 1CI3M 1IKLA 1PH2A 3C2PA 1I4PA 3UDFA 3A0JA 4DF7A 1PTOH 3D4RA 2F0PA 3OIPA 4U673 1E0BA 3CCSA 4UPAA 3TREA 1J9OA 2KCCA 1GJXA 2I5MX 2EVBA 1JJ2A 1J8IA 2VY3A 3IRBA 4PNYA 3KOJA 4P72A 1SJHD 3TP7A 1U4LA 1Y8OB 3CPFA 2A1AA 4HJ7A 4WJ3M 1QOHA 4PZ7A 2SNSA 4CDEC 5IT9E 4O2DA 4A93H 1AW7A 2L15A 1B9MA 5E3FA 4MIUA 1ESFA 3W1GA 1Z6HA 4IFDJ 1H9SA 1UUPA 5FO8B 5C3EB 1GUTA 3QR8A 1V8QA 2VS1A 3AU7A 2ZT9C 4OL7A 2A5HA 4GLXA 2N88A 5ELEA 4HIKA 4RHRA 5C3EG 5IYDH 1PH4A 1XNRQ 3CRLC 3MEFA 5LMNL 2K52A 1C9OA 4C3HG 1G2TA 3E5SA 4B3TL 4RH6A 2K14A 3H94A 2SEBD 3CCEA 1PV4A 2A6HD 4JI8L 1TWAH 3AFQA 1QUQA 4OX9L 4G7OC 2A19A 4P75A 2SDFA 2M2LA 4NMZA 4JPBW 3M4OH 3SR1A 1A3VA 5KRUA 1EWCA 1I4GA 3H0GB 2Z4IA 4K0KQ 3S24A 2CQAA 1I3QH 4QJFA 1H9JA 2NTTA 3BYYB 2UXBL 4A3JH 3DM3A 1XMQL 4XYOA 1ENCA 1UEAB 4DPGA 3CHBD 1D5ZC 3I4LA 4C3JH 3W3AA 1D6EC 3SK5A 4DKAC 3MEHA 1YJNA 1SMXA 4ZAIA 1Q86C 1UE1A 3CPWA 2HHHL 2Z6KA 2AWNA 1EQVA 1Y1VH 2A6EC 1FR3A 5M3MB 5GQOA 4OO1I 1EQQA 4A3BB 2R3ZA 3K7UC 3NWSA 5M3FG 4A3GH 3URYA 4JI3L 1NE3A 4RG1A 1CKNB 2RSOA 4DK6C 3H3VC 1WCMH 1GHJA 1CKMA 1EY6A 2CFMA 2K5WA 2Y0SB 4ZRZA 5M3MG 1WTOA 2D62A 5C4ZA 2E2JB 4YCVA 3PF5A 2M00A 3U50C 2UUCL 1NR4A 1Q8KA 2Y0SG 2VQEQ 2E5LQ 1GHKA 1LT3D 2RSNA 1HNWQ 1GD7A 1CSQA 5A2QE 1L0YB 1QZGA 4MNOA 2KUMA 2JA6H 2JA8B 1RTOA 2NVXB 4K6DA 2AQ1B 2E2HH 4OO1G 4DR3Q 1LTLA 2PMZB 4DR2L 2JA8G 1VQ4A 2LXJA 4KK7A 5M5WB 5I2YA 1CFMA 4DV4L 3E3XA 3OTOL 1X55A 2OTJA 3K5OA 1OTCA 4DR7Q 2YTXA 5IT9c 1EUJA 1ML0D 2ZM6L 4TRDA 2F0GA 4CDDC 3CCLA 3R3OA 3QG1A 3T16A 2UXCL 4F87A 4DUZL 3VDYA 3E0EA 3U4VA 2X69A 3T56B 2PO4A 3X3NA 4XXEA 5EAYA 1XXGA 1SFOH 2XVSA 3PQIA 1LUZA 4KY6A 2D0PA 3A54A 3P1HA 2EYHA 4DNRB 4A76A 1RIPA 1ESRA 4A3CG 1XJVA 1XPRA 3BS1A 3TDQA 1X54A 1TWHH 1HZ9A 1YHQA 1CUKA 5FOBB 5JPMC 2F4VQ 1PLFA 2F0SA 4IUNA 4A3IH 3NBIA 1LV9A 3OYYA 1H95A 2NVYH 2AHOB 1TIID 4RWSC 4IUTA 2JA5B 1HA6A 3S17B 1LTGD 1FNUA 4DAPA 4POGA 3BDLA 4DR5L 3P7JA 2PW5A 2JA5G 2KBNA 1Q90A 4HJ5A 3D4DA 2K05A 3Q22A 2EY1A 5FLXE 1U0LA 5IGDA 4DK0A 3NTKA 2F0OA 4UP9A 2WB1E 5I6YA 1EQTA 1D5MC 2N78A 4TVAB 1B4OA 4ZUJA 4LMQD 1BQQT 4JC0A 4DV3L 1PTOB 1E2ZA 2ASBA 1CKOA 2CCZA 3VR4A 1PH3A 4EX5A 2F03A 5IE8A 2NWGA 2MQHA 4JBMA 2DNEA 4HCSA 1YHAA 4PV1C 1PYSB 2A6ED 3UE1A 3CCUA 1TU2B 3PF4A 1LYLA 4E6IA 3K0XA 4B3ML 1U5KA 1MI2A 2NBFA 2UUAQ 4A93B 3I8ZA 1L0XB 1QWYA 3MFGA 3IAYA 3K6OA 3N52A 1VQCA 5ELFA 2E74C 2K28A 4A93G 3UI2A 5GAHC 2VQFQ 4UDUC 1N36L 1N34Q 1IL8A 4KJOA 1NJIC 5D3IB 1QCBD 1M8AA 2VXWA 2BCOA 1ILQA 1K3BC 4X66L 1SLJA 3K5MA 2A69C 3OPOA 2IHFA 3K57A 3NHHA 4K8JA 2OXPA 5IYDG 3S1QH 1SROA 1TT2A 1D8LA 4EQPA 2DJFC 3NBHA 1TWAB 2QA4A 1IYVA 4H44C 2BE5C 2B63H 4A3DH 3M4OB 1A63A 5D3DA 2HCCA 1RCVD 3WDNA 3NTHA 4DV6L 1JWSD 1I3QB 1PZJD 4ZKBB 2H4OA 4UP8A 4A3JB 3K59A 1EQRA 3GP7A 4M8AA 4H7BA 2L1BA 2N55A 1NMGA 4DV5L 1R9TH 2K50A 1WTXA 2LFNA 4C3JB 3RN2A 1HRJA 4OWXB 1GUGA 1PZID 5TSSA 3H6MA 2HIXA 4PMCA 1PRTC 3CCJA 2OQKA 4C3JG 1Y1VB 4ZLTF 4IN3A 4PMBA 4A3FH 3SVMA 4K14A 4A3GB 4LK1C 3DLLA 1J5EL 3X3MA 1Y1VG 1A3UA 1WCMB 4J1MA 2A68C 3ICEA 2XWJB 4C3IH 4MTKA 3CD6A 5JOBA 1WCMG 1CZWA 1SMYC 1W3SA 1AEXA 1CKNA 1IBKL 3J80i 4APVA 3I72A 4TSSA 4JI5L 3K8AA 4YCWA 1SAPA 1UE7A 2JA6B 1VQFA 1OXVA 4L5RC 2E2HB 1E24A 2XTIA 1K8AC 2HD3A 2CW0C 4LF9Q 1B3QA 2J4XA 3GV6A 2JA6G 4KHPQ 1D1IA 1HNXL 2HQEA 3BZCA 2KA7A 1S5FD 4KLKA 4HN7A 2CVRA 1ENAA 1EZ6A 2EJGC 1W2BA 2O5IC 2VL6A 2KEEA 1EY0A 3V05A
chains in the Genus database with same CATH topology
3R2TA 5ISRA 4V0BA 1BCPD 4DNTB 4RGMA 1SFOB 4IUPA 4L6TB 4ZYSA 2L5TA 1AZQA 4KN4C 3TZDA 4F8MA 3ONAB 3DMUA 4G7ZC 2KQ3A 1TWHB 3ND8A 2G9DA 1ICWA 1JWMD 4A3IB 1RD9D 1ONLA 2EYOA 1STYA 2NVYB 4FVMA 1KTKA 2A69D 1RHPA 3HRZC 1DD2A 3L7ZC 1GUSA 5FK9C 4RGNA 3DWAA 5C3WA 3BDCA 3HEJA 2BE5D 1JOQA 1HUMA 2NZ1D 3FPPA 3J7YW 4MN3A 1D1KA 4QUFA 1A2TA 4HMJA 3H09A 4L63B 2XN9C 3PUZA 3AB9A 2LKVA 2QCPX 4IALA 1GUOA 1TS3A 3R2IA 1FNWA 1ZYRC 3A8JE 1C48A 1PRTD 3MWYW 1E2VA 2F0DA 5EQ0A 1ILPA 3OOCA 2QKIC 2RA4A 1CZGA 1SJED 2A68D 3HP3A 3BVMA 2O4XA 1HQRD 3T53B 1EY4A 3FMCA 4QUCA 1SMYD 2EYPA 1A3TA 1KDCA 3SEBA 4Z9CB 2KOLA 4QIWB 2EOTA 3RMHA 2J7ZA 3S1QB 1R4QB 2CW0D 1MSHA 1KNEA 1I4XA 2B2TC 3ERQA 1SXTA 2B63B 1WTQA 4A3DB 4DU9A 1EEFD 1V1PB 2PZUA 1BNZA 3MXUA 1S5ED 4IZ8A 1Y8PB 1TR5A 2B8FA 1LABA 5DM73 2O5JC 1R9TB 5K5PA 3VR5A 2XIWA 4R8NA 5A35A 1PRTF 4A3FB 3T4AC 3O13A 4KD4A 4C3IB 1VCIA 1EU3A 1A2UA 4QCLA 1EYCA 4RKBA 3K5LA 2WAQB 4C3IG 5HGTA 1MGSA 1Q1BA 2B2VA 2RKSA 3NQIA 1O7ZA 3C1EA 3Q23A 2OF1A 3F2UA 4KV6A 3KBGA 4XDXA 1AP0A 5D14A 2L9HA 2QDBA 1X3PA 4BA2I 4C1NI 2WIIB 2PZTA 4IURA 1Z47A 1EYAA 4MHEA 4BWGB 1ZYRD 1M4VA 1ZXTA 4XT1B 1GOZA 1S5CD 2F1MA 5T1GA 5KYIA 1XWEA 3IFDA 5IGCA 3C1FA 4KHVA 5EPKA 4DXGA 3BG3A 2F0VA 3AMUA 2YU9B 5M5YB 1F2YA 3NE5B 3T13A 4C1NK 4RCOA 4BY7B 4RCNA 3PUVA 2EY6A 1SNCA 4C3HB 3EQLC 5ELDA 1AZPA 3HKZB 1KNAA 3KUPA 3EFXD 1DONA 1LTRD 4DA2A 1EEID 3DHQA 4KMUC 5FKAC 4I65A 4BA1I 4HR7B 3RLFA 3G6JB 3LWEA 1EL0A 5EKKA 5IIFA 3TBIB 2L11A 1SNDA 2KCNA 2IWHA 1BDOA 2F0LA 2WKCA 3IKJA 3TMEA 4K2KA 2MGSA 2JYOA 1KDBA 4CGYB 2MUYA 1LO5D 3FDTA 3D3RA 2ZXRA 1CK1A 3PO3B 4V190 2FINB 3WOEA 1NAPA 2HUGA 2KHSA 2FHTA 4BY1B 4XT3B 5M3FB 5EBCA 4WJWA 2AWOA 4A3EB 1G8ZD 4B08A 2QILA 5C0XH 2C5CA 1V43A 1SE3A 5KGUA 3S1MB 1PFMA 2R61A 4NKLA 3DM1A 1STBA 3MVVA 3QWNA 1O80A 5KNBA 5E4WC 4CJ0B 2FJ2A 3DEPA 2FMCA 3V96A 2F3WA 1BXTA 3I70A 3D31A 2ENBA 1LLRD 2IL8A 4WORA 3LWUA 1V1PA 4ODGA 1LACA 3BYTB 4CBVA 1S5DD 1Q8IA 4CKCA 1EIHA 2WKDA 3BVZA 3PUXA 4QF4A 2XRSD 2KJXA 1QNKA 1SYDA 3J80L 4KN7C 4A3KB 1JCKB 2F0QA 2NTSA 3TSSA 3QOLA 3W2DA 4HTHA 1I6VC 1WTPA 2KVMA 4BS9A 4A3MB 5I9PA 1GXDC 2I07B 2IX1A 5E4XA 1PFNA 1SE2A 5CR3A 3S16B 5CMDA 3VR6A 1HTLD 1D2BA 1HFNA 1TQOA 4FP5D 1LTTD 5E1FA 4CHTB 5KIXA 4HAEA 2F0EA 1II3A 3FRPB 3OMGA 2EE1A 3JAML 2EYLA 2K5QA 1XTCD 1HFGA 3RZOB 1BCPC 1BOSA 1O7YA 1X32A 3OHXC 3P75A 5LL6X 4FF1A 1JWUD 2D9UA 4KKSA 3H91A 2A74C 4EGVA 5CORA 2F0MA 2I46A 1I4RA 1I4QA 1B1ZA 2EY2A 3S1NB 3NP8A 1Y8NB 5J39A 2BA0A 4DAVA 2O2LD 3S1RB 2K01A 4WFN3 1HA5A 1ZEQX 4NDXA 5IOCA 1DOKA 2K7VA 2XRQD 3VA7A 1D5XC 1S4ZA 3GD7A 3BVGA 4FYDA 4HEDA 3K5NA 3DWQA 5C0XI 2NVTB 3PUYA 1DZ1A 4XIGS 1CQFA 1KLUD 5KEEA 1QILA 2RVLA 5T1IA 3D8GA 2SNMA 4R9WA 3SHLA 2RDHA 4S3SA 1Q3LA 3MFYA 5EBDA 1U4PA 3U9OA 3NXWA 2X6LA 1W6KA 3IFTA 1TVXA 5C0XG 4IUUA 5F2DA 1U4MA 2JSOA 3NQTA 5J1ZA 3C46A 2NB0A 5CV5A 4RKLA 2DY8A 3Q0AA 1RTNA 2EXZA 3J80E 1BF4A 1ET6A 1EY8A 1LT6D 1SYFA 4M1UB 2MP1A 5CGKA 1SEBD 4J6HA 1JB3A 3HOVB 3GQBA 2B2YA 1CQVA 3C3LA 1F9RA 3VYSA 5I9OA 1JR0D 3QIAA 1TS5A 1SYEA 3M7NA 1YNNC 1B9NA 2EPBA 3EROA 2ZXPA 3Q24A 4L8JA 2E2IB 3GTQB 1ET9A 4XQJA 3GO5A 1F9QA 4ABNA 1GUWA 3KLSX 4Q5VA 3VYUA 2DN8A 3SK4A 1IW7C 2MPMA 3MZ5A 2B2WA 2FMMA 2GA4B 1MD2D 4H0LC 4FXKC 3GTKB 3FPUB 4IQZA 1LTID 5C4HA 1RKNA 4HMIA 3GV3A 1FD7D 1CM9A 2RDFA 5EPLA 1STHA 1TS2A 5ELCA 5BN4A 3GTMB 2LMCB 2JE6I 4HCEA 2WV6D 4ZKCB 5I2XA 3TZUA 1BCPF 4UAIA 3VA5A 4OIJA 1TWFB 1SSOA 3D6WA 1Y69U 3A7AB 4LJZC 2B2UC 1EWHA 2JEAI 5DM63 1CHPD 2EDGA 3SK6A 2AUKA 2R92B 2B2TA 4X3KA 3ZYYX 3KLSA 4DXFA 1JC7A 3MC0B 4WRDA 1PTOC 4F88A 1OXXK 5IGBA 1H9RA 1JOKA 2AQ2B 1SNQA 1SNPA 2J0TD 2NYZD 1TWGB 4OGQC 1SDFA 1STNA 1WTRA 3S15B 1H9KA 4N9PA 2ZXOA 5JVH3 4G7HC 2F4IA 3CQZB 2NVQB 2L0CA 3T51B 1RDPD 5DAUA 1QNUA 1I4HA 3S2DB 5C5MA 1JORA 4C2MB 1PXUA 1K8MA 3HGBA 4FXGC 5C5LA 1YNND 4KJNA 3J81L 1HCZA 2AQ3B 2QF7A 4ZUIA 5M5XB 1SE4A 2EYJA 1VF7A 1QE6A 5AFWA 1QG7A 1IW7D 2JA7B 2F0NA 1LTBD 2F0UA 2D5DA 1F9PA 2KEDA 3DUZA 4J8QA 1TS4A 2R93B 1JE4A 2F0FA 1BCPB 1KAAA 1TWCB 1CHQD 1E2WA 1WTVA 1AN8A 1VF5C 3MXGA 4FF4A 2L55A 2A73B 4HSPA 4XTCS 1STAA 3A7LA 3A56A 3FEWX 1HQMC 1W6JA 1EY9A 2IT1A 2K1BA 2G9HD 1CA6A 1EIGA 5BN3A 2K04A 1Z7TA 4H13C 2HCIA 1F2MA 2R6GA 4EQNA 1DOLA 3K58A 3GTJB 1PTOD 4FF3A 4KD3A 2EJMA 5FLXL 5HURA 3I3CA 3NWTA 1EFID 3I73A 3HZXA 4NP5A 4K6LA 1B3AA 1B53A 4RHSA 2PW7A 3QOJA 1XYIA 1EYDA 2IX0A 1RODA 4RGTA 4F7XA 1K83B 1GUNA 1PRTB 2NN6H 5C3XA 1DYQA 3HOUB 3SK8A 1SYCA 1OXTA 3LX0A 3NSWA 5M9OA 3P20A 4HSVA 4RFBA 3MXPA 3U9SA 4JK1C 5G3LD 4XYQA 3SXHA 3D4WA 3J7AV 3S2HB 3OW7A 1SYBA 1RF2D 1C8CA 4BBRB 2L4NA 3PV0A 5CC4A 1PZKD 1AFPA 4EQOA 2K5DA 4RAUC 5JEAG 1NCVA 3TP8A 2OEOA 5EPJA 4KTAA 5CYUA 4O1NA 3HOYB 2PPBC 4KI0A 4CKEA 1G6ZA 2WB1B 5JVG3 2JEBI 1RJTA 2XSCA 1PTOF 1LTAD 3CRKC 3PMFA 4U68A 2ICIA 4NW2A 3I4NB 4ID6A 4CJ2C 2F0KA 4KHZA 3R93A 3J81E 4C56C 1MSGA 1HHVA 5J22A 3OSOA 1EY5A 3PO2B 2PCFB 5CBEE 1IYUA 1SNOA 3MA2B 1WTWA 2E2DC 2HDLA 3J7AF 2MHVA 4N9TA 2K6AA 5G3LF 5NUCA 1BO0A 5IGGA 3I90A 2K03A 3CKIB 1SNMA 1FNVA 5K36G 5KYLA 5C0XJ 4X3UA 4CKBA 5C44B 1CTMA 1DOMA 2B39A 3L9AX 4TQUS 2FFKB 1HXYD 1Q1EA 3OIQA 2BOSA 4IFDI 3DEOA 5KNCA 1QJOA 2EZVA 4ZK9B 2VB2X 3GTPB 1F2ZA 4K8IA 3ITPA 2NUCA 5IODA 3SE0A 3M85A 4DGZA 3DXJC 5C4JB 2ID0A 3KBXA 2Q8IB 3A8IE 3G7LA 1I50B 1B50A 4I7ZC 2BDOA 3HS0C 4IFDG 1G91A 1VMPA 5KNDA 1DM0B 1FGBD 2EYFA 1UNSA 2Z1CA 2IW3A 3KLRA 2E76C 5JAVA 2B8GA 5COYA 5C4XB 2WP8J 3MHBA 1U4RA 5JJZA 3QO2A 2L12A 3NTIA 3MTSA 4KKTA 3K7AB 4KY7A 2F0TA 3PIO3 2NN6I 1NR2A 3M3YB 4Y7NB 1G291 2IPKD 1XX8A 2DNCA 3CU7A 3RZDB 2TMPA 1KDAA 4XQNA 4DN4M 3EJIA 3TN2A 1FYCA 2RQXA 5CV4A 5EKIA 3NUCA 2JXMB 3TP6A 3HOXB 1VMCA 2NN6G 3D6CA 5ELBA 5CBAE 2K32A 1A15A 5DNFA 3QB3A 3RD4A 1ENFA 3QJYA 1SYGA 4GZYC 2BA1A 2BDNA 4R8IA 1A6XA 1HPCA 4FXDA 4BBSB 2Z8LA 2IJ0A 2WACA 5C6AA 4PMWA 5FO9B 4ULLA 3M4YA 4X3SA 1MBYA 3E0JA 4RA8A 1CA5A 1DCZA 2EJFC 1LT4D 2SOBA 2Z4HA 1F2LA 4ZQ3A 1WVLA 1O7LA 1LTSD 4QMGA 1STGA 2LS01 2XWBB 1QB5D 2HDMA 1O78A 2RBMA 1S5BD 1LT5D 4EVOA 1T5XD 3OMCA 3E6ZX 4XQQA 1WD1A 4CJ1B 3A8KE 3MAQA 2R7ZB 1JQYD 3DWPA 3GTLB 3OWFA 4DFAA 5JPNC 4FNFA 2WINB 2VNUD 3V2TA 1WD0A 1V1OA 4YIJA 4O42A 3HOZB 1B2TA 3L3OC 4ME5A 2PYKA 1NSNS 5IGFA 5IGEA 1UAPA 1IKMA 2JP1A 5CV7A 1X3QA 4IUVA 1BBXC 1TY0A 2VB3X 3A55A 3JAME 2ICEC 2F3VA 2Q8TA 2VUMB 1PFBA 1T5EA 1CT1D 1DJRD 1H9SB 1F9SA 3NPPA 2B2YC 3PIP3 1B44D 3MXNA 5FO7B 4P2CB 4FO2A 1YNJC 3RUZA 1OXSC 5CV6A 1Q12A 2K33A 3GTOB 3OWEB 2EY5A 5EKLA 4B9XA 1NUCA 2IX3A 1EOTA 4Q0FA 1SBBB 4DAYA 3GTGB 2B2WC 5IT9L 1KABA 1ZKOA 1I6HB 2B2UA 2M9VA 3FKIB 4OIKA 5D65A 1IHZA 3BZDB 2F0WA 1Y1WB 4RGOS 1EY7A 5JEAH 3I4MB 4OHJA 1TY2A 5CV8A 1C4QA 2KECA 4FF2A 1G2SA 4K2LA 4X3TA 2AUJD 3EA6A 3LNNA 5LL6S 2PZWA 3K0YA 1KLGD 2DY7A 4KY5A 2F0HA 4JBWA 1HTPA 1PDQA 3WOFA 1H9MA 1VDZA 3KK7A 5BN5A 1TKWB 3ND9A 2E75C 3IL8A 3S9WA 5DEHA 4G4KA 2H1EA 2OT2A 2Q8RE 2TSSA 2XNAC 3SDZA 2YYZA 5CV9A 1STEA 2F0JA 1DXMA 3NK9A 4OO1H 3BDOA 3M7GA 2X6GA 1R4PB 5JEAJ 2EYMA 2V4DA 3VYTA 2A6HC 2D2CC 1BUVT 1U9RA 1EZ8A 5K36H 4AYBB 3VR2A 3VR3A 5LHY1 3S14B 2RDGA 2CHBD 4K5XA 3PUWA 2F0IA 2LY7A 4TKOB 4B9WA 5A2QL 2PQEA 2MJ8A 5EJWA 1EU4A 3FVQA 3Q6SA 5I4DA 4DK1A 4ILWA 1F77A 4LAAA 3TP5A 1OXUA 1JOOA 3I91A 3HG9A 1YNJD 3N6RA 3VYRA 1PMRA 4IFDH 2QEJC 1OO9B 1JICA 5EGTA 4PQXA 4K5VA 1BR9A 2PNRC 4IUQA 2C9OA 3R8BA 3KF8A 5I6WA 2B2VC 4G57A 1HUNA 3EVQA 4KKUA 1K8OA 1PYWD 4K5WA 4QB4A 3HOWB 1CI3M 1IKLA 3C2PA 1I4PA 4DF7A 1PTOH 3D4RA 2F0PA 3OIPA 4U673 1E0BA 1J9OA 2KCCA 1GJXA 2EVBA 1J8IA 4PNYA 1SJHD 3TP7A 1U4LA 1Y8OB 1QOHA 2SNSA 5IT9E 1AW7A 1B9MA 5E3FA 4MIUA 1ESFA 1Z6HA 4IFDJ 1H9SA 1UUPA 5FO8B 5C3EB 1GUTA 1V8QA 3AU7A 4OL7A 2ZT9C 2A5HA 2N88A 5ELEA 4RHRA 3CRLC 4C3HG 1G2TA 3E5SA 4RH6A 3H94A 2SEBD 2A6HD 4G7OC 2SDFA 2M2LA 4NMZA 3SR1A 1A3VA 5KRUA 1EWCA 1I4GA 3H0GB 2Z4IA 2CQAA 1H9JA 2NTTA 3BYYB 4XYOA 1ENCA 1UEAB 3CHBD 1D5ZC 3I4LA 3W3AA 1D6EC 3SK5A 3MEHA 4ZAIA 2AWNA 1EQVA 2A6EC 1FR3A 5M3MB 4OO1I 4A3BB 2R3ZA 3NWSA 3URYA 2RSOA 3H3VC 2K5WA 1GHJA 1EY6A 2Y0SB 4ZRZA 1WTOA 2D62A 5C4ZA 2E2JB 2M00A 1NR4A 1GHKA 1LT3D 2RSNA 5A2QE 1L0YB 2KUMA 2JA8B 1RTOA 2NVXB 4K6DA 2AQ1B 4OO1G 2PMZB 4KK7A 5M5WB 5I2YA 1CFMA 3K5OA 1ML0D 4TRDA 2F0GA 3R3OA 3QG1A 3T16A 4F87A 2X69A 3T56B 2PO4A 3X3NA 4XXEA 1XXGA 2XVSA 4KY6A 3A54A 3P1HA 2EYHA 4DNRB 1ESRA 3BS1A 3TDQA 5FOBB 5JPMC 1PLFA 2F0SA 4IUNA 3NBIA 1LV9A 1TIID 4RWSC 4IUTA 2JA5B 1HA6A 3S17B 1LTGD 1FNUA 4DAPA 3BDLA 3P7JA 2PW5A 1Q90A 3D4DA 2K05A 3Q22A 2EY1A 5FLXE 5IGDA 4DK0A 3NTKA 2F0OA 5I6YA 1EQTA 1D5MC 1B4OA 4ZUJA 4LMQD 1BQQT 1PTOB 1E2ZA 3VR4A 2F03A 2NWGA 2DNEA 4HCSA 4PV1C 2A6ED 1TU2B 4E6IA 2NBFA 1MI2A 4A93B 3I8ZA 1L0XB 1QWYA 3MFGA 3IAYA 3K6OA 3N52A 5ELFA 2E74C 2K28A 3UI2A 4UDUC 1IL8A 4KJOA 5D3IB 1QCBD 1M8AA 2VXWA 2BCOA 1ILQA 3K5MA 2A69C 3OPOA 3K57A 3NHHA 4K8JA 2OXPA 1TT2A 4EQPA 3NBHA 1TWAB 1IYVA 4H44C 2BE5C 3M4OB 5D3DA 2HCCA 1RCVD 3WDNA 3NTHA 1JWSD 1I3QB 1PZJD 4ZKBB 2H4OA 4A3JB 3K59A 3GP7A 4M8AA 4H7BA 2L1BA 2N55A 1WTXA 2LFNA 4C3JB 1HRJA 1GUGA 1PZID 5TSSA 3H6MA 4PMCA 1PRTC 4C3JG 1Y1VB 4ZLTF 4IN3A 4PMBA 3SVMA 4K14A 4A3GB 4LK1C 3X3MA 1A3UA 1WCMB 4J1MA 2A68C 2XWJB 5JOBA 1CZWA 1SMYC 1AEXA 3I72A 4TSSA 1SAPA 2JA6B 1OXVA 2E2HB 2CW0C 2J4XA 3GV6A 1D1IA 2HQEA 2KA7A 1S5FD 4HN7A 2CVRA 1ENAA 1EZ6A 2EJGC 2O5IC 2KEEA 1EY0A 3V05A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ML0 D;  1HFG A;  4ZKC B;  2EOT A;  1M8A A;  1PFM A;  1U4M A;  1ZXT A;  1F9P A;  2J7Z A;  4UAI A;  4XT1 B;  2VXW A;  2KED A;  1ILQ A;  1O7Y A;  1X32 A;  2N88 A;  3DM1 A;  4OIJ A;  1C8C A;  1O80 A;  2L4N A;  1SSO A;  3D6W A;  4X3S A;  5T1G A;  4IUP A;  1JE4 A;  2DY8 A;  2X69 A;  1MSH A;  1KNE A;  2B2T C;  2D9U A;  2FJ2 A;  1RTN A;  2MJ8 A;  3DEP A;  3IFD A;  3KBX A;  4RAU C;  1NCV A;  1AZQ A;  5EJW A;  1WTQ A;  3G7L A;  4RA8 A;  1BF4 A;  5EPK A;  1CA5 A;  1B50 A;  3H91 A;  3TZD A;  3ONA B;  5EPJ A;  1WTV A;  1G2T A;  2B2U C;  1ESR A;  5COR A;  1BNZ A;  3Q6S A;  1EOT A;  1G91 A;  1VMP A;  2MP1 A;  1ICW A;  2IL8 A;  2HCC A;  1G6Z A;  2SDF A;  2B2T A;  1F2L A;  2M2L A;  4X3K A;  1WVL A;  2B2W C;  1PLF A;  1RJT A;  4ZKB B;  1EIH A;  3I91 A;  2B2U A;  4OIK A;  5D65 A;  1LV9 A;  2B2Y A;  2L1B A;  2N55 A;  4U68 A;  1RHP A;  4RWS C;  4NW2 A;  2K1B A;  4IUT A;  1AZP A;  2HDM A;  1KNA A;  4CJ2 C;  1HA6 A;  2NYZ D;  1HFN A;  1WTX A;  3KUP A;  2K01 A;  5COY A;  2XIW A;  1SDF A;  1QNK A;  3R93 A;  1F9R A;  1DON A;  1HRJ A;  1CA6 A;  2KEC A;  1MSG A;  1HHV A;  1EIG A;  1U4R A;  3P7J A;  1WTR A;  1G2S A;  2EPB A;  5JJZ A;  3QO2 A;  2L12 A;  1JIC A;  1HUM A;  2K05 A;  4X3T A;  2NZ1 D;  4ZLT F;  2K04 A;  1DOK A;  1WD1 A;  3MTS A;  4IUQ A;  4ZAI A;  4CJ1 B;  4MN3 A;  3LWE A;  4QUF A;  3SVM A;  1EL0 A;  1NR2 A;  5CBE E;  2HCI A;  1WTW A;  2B2V C;  1S4Z A;  2L11 A;  1F9Q A;  2R3Z A;  2DY7 A;  1WTP A;  2HDL A;  1EQT A;  1DOL A;  1XX8 A;  1HUN A;  2KVM A;  1GUW A;  2RSO A;  1B4O A;  3I3C A;  1WD0 A;  4HED A;  2MGS A;  4LMQ D;  1PDQ A;  1PFN A;  2JYO A;  5E4X A;  1BO0 A;  1WTO A;  2MPM A;  5CMD A;  4O42 A;  2B2W A;  1B3A A;  1MGS A;  3FDT A;  1B53 A;  4DN4 M;  2FMM A;  1IKL A;  1NR4 A;  2B2V A;  3I90 A;  1B2T A;  3TN2 A;  3IL8 A;  5E4W C;  2K03 A;  2RSN A;  4CJ0 B;  2FIN B;  1DZ1 A;  1SAP A;  5EKI A;  1XYI A;  3FPU B;  2NWG A;  3MWY W;  2H1E A;  1E0B A;  1NAP A;  2HUG A;  2Q8R E;  2RVL A;  2FHT A;  4HCS A;  4X3U A;  5T1I A;  1J9O A;  1O7Z A;  3GV3 A;  4XT3 B;  1IKM A;  2JP1 A;  1ROD A;  1CM9 A;  1X3Q A;  2KUM A;  4R9W A;  1J8I A;  1DOM A;  1RTO A;  5EQ0 A;  1ILP A;  3GV6 A;  3F2U A;  5EPL A;  4IUV A;  1VMC A;  4XDX A;  5CBA E;  1BBX C;  4HAE A;  1AP0 A;  1U4L A;  5D14 A;  2RA4 A;  2L9H A;  2FFK B;  1X3P A;  3HP3 A;  1Q3L A;  4HSV A;  1A15 A;  5DNF A;  2X6G A;  1MI2 A;  2Q8T A;  1U4P A;  1IL8 A;  2CVR A;  3I8Z A;  1QE6 A;  1PFB A;  2EE1 A;  3DEO A;  2X6L A;  5AFW A;  3N52 A;  1QG7 A;  4QUC A;  1F9S A;  2B2Y C;  2K28 A;  3UI2 A;  2BDN A;  4IUR A;  4MHE A;  2KEE A;  4ZK9 B;  4R8I A;  2KOL A;  1TVX A;  4IUU A; 
#chains in the Genus database with same CATH topology
 3R2T A;  3CC4 A;  5ISR A;  3F1Z A;  4V0B A;  1YJW A;  1BCP D;  4DNT B;  2CQO A;  2VW9 A;  4RGM A;  1SFO B;  4IUP A;  4L6T B;  4ZYS A;  2L5T A;  2GVB A;  1AZQ A;  4QGU A;  2V1C C;  4R4C A;  2QGQ A;  4KN4 C;  3TZD A;  4F8M A;  3ONA B;  3DMU A;  4G7Z C;  1RL2 A;  2KQ3 A;  1TWH B;  4IOA A;  5LMU L;  3ND8 A;  2G9D A;  1ICW A;  3J81 j;  1JWM D;  4A3I B;  1RD9 D;  1ONL A;  2EYO A;  2YU9 H;  5M5Y H;  1SR3 A;  4JW0 A;  4QL5 A;  1STY A;  2NVY B;  3AQQ A;  3KDF B;  4LUV A;  1PH1 A;  3F2B A;  4FVM A;  4A3I G;  1KTK A;  2A69 D;  4BY7 H;  1RHP A;  3HRZ C;  2GN5 A;  1DD2 A;  3L7Z C;  4C3H H;  1GUS A;  1O7I A;  5FK9 C;  4RGN A;  3DWA A;  5C3W A;  3BDC A;  1XMO Q;  3HEJ A;  1HH2 P;  1PVO A;  4LUO A;  2BE5 D;  1JOQ A;  1HUM A;  2NZ1 D;  3FPP A;  3J7Y W;  4AQY Q;  4MN3 A;  1D1K A;  4QUF A;  2NZO A;  1A2T A;  4HMJ A;  2WFW A;  3H09 A;  4X62 Q;  5BR8 Q;  2MO1 A;  4L63 B;  1YHB A;  2XN9 C;  3PUZ A;  3AB9 A;  2LKV A;  2QCP X;  4IAL A;  4GNX C;  1GUO A;  1TS3 A;  3R2I A;  1FNW A;  1ZYR C;  3A8J E;  3OW2 A;  1C48 A;  1PRT D;  3MWY W;  1E2V A;  2F0D A;  1VQL A;  3PO3 H;  5IP9 H;  3K80 C;  5EQ0 A;  1ILP A;  4IJH A;  3OOC A;  4JI7 Q;  4BY1 H;  5M3F H;  2QKI C;  3RR5 A;  3FP9 A;  2RA4 A;  1WYD A;  1CZG A;  1SJE D;  2A68 D;  3HP3 A;  3BVM A;  2O4X A;  1HQR D;  3T53 B;  1EY4 A;  3FMC A;  4QUC A;  3W1B A;  1SMY D;  2EYP A;  4I7A A;  1A3T A;  2ATW A;  1KDC A;  3SEB A;  4Z9C B;  2KOL A;  3T1H L;  3ZJY C;  1K28 A;  2UUB Q;  4QIW B;  1UEB A;  4A3E H;  2UXD L;  1NNX A;  2EOT A;  3RMH A;  2J7Z A;  2K4K A;  3S1Q B;  2B3G A;  3S1M H;  2K75 A;  1AH9 A;  1R4Q B;  2CW0 D;  1K9M C;  4YY3 L;  1HR0 L;  1MSH A;  1KNE A;  1I4X A;  2B2T C;  3ERQ A;  1E22 A;  1SXT A;  2B63 B;  1WTQ A;  4A3D B;  4DU9 A;  1EEF D;  1V1P B;  2PZU A;  1BNZ A;  1XPU A;  2B63 G;  4A3D G;  1CSP A;  3MXU A;  1S5E D;  4IZ8 A;  4JI6 L;  1Y8P B;  1TR5 A;  2B8F A;  1LAB A;  1NMF A;  4P74 A;  5DM7 3;  2O5J C;  1R9T B;  5K5P A;  4GKJ L;  2CH4 W;  1A8V A;  3VR5 A;  2CWA A;  2XIW A;  4R8N A;  5A35 A;  1PRT F;  1YVC A;  2OCE A;  2ALY B;  2KCT A;  3GDE A;  4A3F B;  4DAM A;  3T4A C;  3O13 A;  1VQN A;  4KD4 A;  1HNZ L;  3CME A;  4A3F G;  4C3I B;  1S3O A;  1EU3 A;  1VCI A;  4A3K H;  1A2U A;  4QCL A;  3PSI A;  4X64 Q;  4LWC A;  1EYC A;  4RKB A;  3K5L A;  2H5X A;  2WAQ B;  4C3I G;  4GKK L;  5HGT A;  4A3M H;  1X6O A;  3KFU A;  1MGS A;  1Q1B A;  2EIF A;  2DJG C;  2B2V A;  4R4T A;  4UP7 A;  3H15 A;  3S16 H;  4POF A;  1VQP A;  4P73 A;  2RKS A;  1S40 A;  4X65 Q;  3NQI A;  1O7Z A;  3C1E A;  3Q23 A;  2OF1 A;  3F2U A;  4KV6 A;  3KBG A;  1JJC B;  4XDX A;  1AP0 A;  5D14 A;  3KJP A;  3CCV A;  3W5O A;  3HKS A;  2L9H A;  2QDB A;  1X3P A;  2JA9 A;  2RCN A;  4YCU A;  1EYG A;  4BA2 I;  4C1N I;  2WII B;  2RHS B;  2PZT A;  1IXR A;  4IUR A;  1Z47 A;  1EYA A;  4MHE A;  4BWG B;  1XNR L;  2GVA A;  4LF6 L;  3KLW A;  1ZYR D;  4DV1 L;  4HJ8 A;  1M4V A;  4DUY Q;  4JOI C;  1ZXT A;  4XT1 B;  1GOZ A;  4QIW E;  1S5C D;  2F1M A;  5T1G A;  2DUD A;  3RZO H;  1IL2 A;  1BBW A;  1E7Z A;  3NEL A;  5KYI A;  1XWE A;  3EN2 A;  3IFD A;  4GOP C;  1I94 Q;  2Q2T A;  1EWI A;  5IGC A;  1FJG Q;  3TS2 A;  3C1F A;  4KHV A;  5EPK A;  4DXG A;  3BG3 A;  2F0V A;  3AMU A;  4K0K L;  2YU9 B;  4JI4 Q;  1N32 Q;  5M5Y B;  2MO0 A;  1F2Y A;  3M9B A;  3NE5 B;  3T13 A;  2QW7 A;  4C1N K;  1KIX A;  4RCO A;  4BY7 B;  1E3P A;  1WFQ A;  4RCN A;  3S1N H;  3PUV A;  2EY6 A;  4AYB E;  3CC7 A;  3NBH B;  1SNC A;  2R7F A;  4C3H B;  3KDF A;  4A3L H;  4BY7 G;  3EQL C;  5ELD A;  1AZP A;  3HKZ B;  1KNA A;  3KUP A;  3EFX D;  1DON A;  1LTR D;  4DA2 A;  1EEI D;  3DHQ A;  4KMU C;  3S1R H;  5FKA C;  1JE5 A;  2KEN A;  4I65 A;  4BA1 I;  3HKZ G;  4HR7 B;  3RLF A;  3G6J B;  1MIU A;  4LF4 Q;  2B29 A;  3LWE A;  3J7A 5;  1EL0 A;  4L5S A;  5EKK A;  5IIF A;  3TBI B;  2L11 A;  1SND A;  2N8N A;  1HNW L;  2KCN A;  2IWH A;  1BDO A;  2F0L A;  2WKC A;  3IKJ A;  3TME A;  4K2K A;  1VQA A;  2MGS A;  2JYO A;  1KDB A;  1KAW A;  1VQI A;  2K5H A;  4CGY B;  2MUY A;  4HJ9 A;  1LO5 D;  3BZK A;  3FDT A;  2WAQ E;  3D3R A;  1X9N A;  2ZXR A;  1CK1 A;  3PO3 B;  4V19 0;  4DR3 L;  4JBJ A;  2FIN B;  3WOE A;  1AE3 A;  1NAP A;  2HUG A;  2KHS A;  2FHT A;  2VZA A;  4BY1 B;  2NVT H;  4XT3 B;  5M3F B;  3PO3 G;  5IP9 G;  4DR7 L;  5EBC A;  4WJW A;  5IWA L;  1WI5 A;  4BY1 G;  4DR1 L;  5HGQ A;  2AWO A;  1MJE A;  3TEH B;  5GAE C;  1XNQ Q;  2N3S A;  4A3E B;  2C35 B;  1G8Z D;  4B08 A;  2QIL A;  5C0X H;  2C5C A;  1V43 A;  4JI0 Q;  3J81 i;  1SE3 A;  1VQE A;  5KGU A;  3S1M B;  1PFM A;  2R61 A;  4A3E G;  5LMN Q;  4NKL A;  3DM1 A;  1STB A;  3MVV A;  3QWN A;  1O80 A;  4B3T Q;  1M90 C;  5KNB A;  2F4V L;  5E4W C;  4CJ0 B;  2FJ2 A;  3DEP A;  2FMC A;  3V96 A;  2F3W A;  2EQS A;  1BXT A;  3I70 A;  3I4N G;  3D31 A;  2BH8 A;  1WOC A;  2ENB A;  1EIY B;  1LLR D;  2IL8 A;  3ERS X;  3LWU A;  4WOR A;  1V1P A;  1VQM A;  4ODG A;  1QVF A;  1LAC A;  1XMQ Q;  1L1O B;  3BYT B;  4CBV A;  1S5D D;  1Q8I A;  4CKC A;  1EIH A;  2WKD A;  3BVZ A;  3PUX A;  4DV2 Q;  3HOV H;  1KD1 C;  4QF4 A;  2XRS D;  4ALP A;  2KJX A;  4LF8 L;  1QNK A;  1SYD A;  3ER0 A;  5H1S E;  2N49 A;  4LF5 Q;  3J80 L;  4KN7 C;  4A3K B;  1JCK B;  1YJ9 A;  2F0Q A;  2NTS A;  3TSS A;  3QOL A;  4AIM A;  3W2D A;  4HTH A;  2UUC Q;  2E2I H;  1I6V C;  1WTP A;  4A3K G;  2KVM A;  5J3B A;  4BS9 A;  1Q7Y C;  4A3M B;  3GTQ H;  5I9P A;  1GXD C;  2I07 B;  2IX1 A;  1PFN A;  1SE2 A;  5E4X A;  5CR3 A;  3S16 B;  5CMD A;  4OON A;  4A3M G;  3VR6 A;  1HTL D;  1D2B A;  2UUA L;  2E8G A;  1HFN A;  1TQO A;  5JJK A;  1FL0 A;  3GTK H;  4FP5 D;  1LTT D;  1IBL L;  5E1F A;  2VQF L;  4CHT B;  3OTO Q;  5KIX A;  1N34 L;  1JT8 A;  4HAE A;  4R4I A;  2F0E A;  1II3 A;  1YIJ A;  4CDC C;  3FRP B;  3OMG A;  2EE1 A;  2P5Z X;  3JAM L;  2Y0S E;  1NTG A;  2EYL A;  2K5Q A;  1XTC D;  3GTM H;  4DUZ Q;  1G51 A;  1HFG A;  4LNQ A;  3H3V H;  3RZO B;  1BCP C;  2KHJ A;  1BOS A;  1O7Y A;  1X32 A;  3OHX C;  3P75 A;  5LL6 X;  4FF1 A;  2Z0S A;  1JWU D;  1JMC A;  1TWF H;  2D9U A;  1PYB A;  4KKS A;  3HFZ B;  1Q82 C;  4DV7 Q;  3H91 A;  1VQ8 A;  2A74 C;  2PMZ E;  4EGV A;  3CMA A;  5COR A;  2F0M A;  2I46 A;  3ULL A;  1I4R A;  1I4Q A;  1B1Z A;  2CH4 A;  2EY2 A;  3UE0 A;  3S1N B;  3NP8 A;  1Y8N B;  4NXN L;  2R92 H;  5J39 A;  2BA0 A;  4O0A A;  4DAV A;  5GAD C;  2FXQ A;  2LSS A;  1V9P A;  3TQY A;  2O2L D;  1C0A A;  4A3L G;  3S1R B;  1KHI A;  2K01 A;  4WFN 3;  1HA5 A;  3B6Y A;  1TWG H;  3RN5 A;  5GAG C;  1ZEQ X;  4NDX A;  5IOC A;  5ELO A;  1DOK A;  2K7V A;  1GM5 A;  4YHH L;  3S15 H;  4JV5 Q;  2XRQ D;  3VA7 A;  1D5X C;  1S4Z A;  3E9I A;  4DR4 Q;  2PQA B;  3GD7 A;  3HOX G;  3BVG A;  4FYD A;  3CQZ H;  4HED A;  4LF9 L;  4KHP L;  2NVQ H;  3K5N A;  3DWQ A;  5C0X I;  2NVT B;  3PUY A;  1DZ1 A;  4XIG S;  1CQF A;  1KL9 A;  1KLU D;  3S2D H;  5KEE A;  1QIL A;  2RVL A;  5T1I A;  3D8G A;  2SNM A;  4C2M H;  4B3M Q;  2MNA A;  4R9W A;  3SHL A;  2RDH A;  1A62 A;  4AH6 A;  2K5N A;  2ZTD A;  4S3S A;  4LFB L;  1Q3L A;  3MFY A;  5EBD A;  1U4P A;  3U9O A;  4NXM Q;  5M5X H;  3NXW A;  2KCM A;  4B3S Q;  2X6L A;  4A75 A;  1W6K A;  3IFT A;  1TVX A;  5C0X G;  4IUU A;  3WWV A;  1P16 A;  5F2D A;  1U4M A;  1VQ5 A;  2JA7 H;  5AJ3 Q;  2JSO A;  3NQT A;  5J1Z A;  3C46 A;  2NB0 A;  5CV5 A;  1SRU A;  4RKL A;  3CF5 A;  2DY8 A;  3Q0A A;  1Q81 C;  1RTN A;  2EXZ A;  3J80 E;  2R93 H;  1BF4 A;  1ET6 A;  4DV6 Q;  1EY8 A;  3TS0 A;  3ULJ A;  1LT6 D;  1SYF A;  4M1U B;  4RMF A;  1TWC H;  2MP1 A;  5CGK A;  1SEB D;  4J6H A;  1JB3 A;  3HOV B;  1K3R A;  1XMO L;  4LFA L;  3GQB A;  1D7Q A;  3G6E A;  1L1O A;  2B2Y A;  4AQY L;  1QVG A;  3HOV G;  1CQV A;  3C3L A;  3JAM i;  1FVI A;  1F9R A;  1J5E Q;  3VYS A;  5I9O A;  4X62 L;  1JR0 D;  3QIA A;  1TS5 A;  1SYE A;  5BR8 L;  3M7N A;  1YNN C;  1B9N A;  2EPB A;  3ERO A;  3CC2 A;  2ZXP A;  3Q24 A;  4L8J A;  1VQD A;  2XGT A;  3HOZ G;  2E2I B;  1JB7 A;  5FLM H;  1KRT A;  3GTQ B;  1ET9 A;  4XQJ A;  3GO5 A;  4JVZ A;  1GKH A;  1F9Q A;  2JJQ A;  2ZJR A;  4ABN A;  2UU9 Q;  2ZTE A;  3NEM A;  1GUW A;  3KLS X;  3RLN A;  4Q5V A;  3VYU A;  2DN8 A;  3SK4 A;  3GTJ H;  1IW7 C;  2MPM A;  4JI7 L;  3MZ5 A;  2B2W A;  4R4O A;  4P71 A;  2FMM A;  4LF7 Q;  2GA4 B;  1MD2 D;  2VUM G;  4H0L C;  1VS0 A;  4FXK C;  4JI2 L;  3GTK B;  3FPU B;  4IQZ A;  1LTI D;  3H3V I;  5C4H A;  1RKN A;  3PIO A;  5DLQ E;  4UY8 C;  4HMI A;  3GV3 A;  4IO9 A;  1FD7 D;  1CM9 A;  3KF6 B;  2RDF A;  4JI1 Q;  5EPL A;  1SE8 A;  4OEM B;  2UUB L;  4WJ4 A;  1K83 H;  1STH A;  2A8V A;  4IPC A;  4NB3 A;  3HOU H;  1E1T A;  1TS2 A;  5ELC A;  4JYA L;  5BN4 A;  3GTM B;  4B3R Q;  2LMC B;  2JE6 I;  3A5U A;  1PH5 A;  4HCE A;  2WV6 D;  4ZKC B;  5I2X A;  3TZU A;  1BCP F;  4GN5 A;  4UAI A;  3I2Z A;  2R7D A;  3VA5 A;  4OIJ A;  1TWF B;  1PH7 A;  1SSO A;  3D6W A;  3S2H H;  3G71 A;  4BBR H;  1Y69 U;  3J80 c;  4R1J A;  3A7A B;  4LJZ C;  1Y1W G;  2B2U C;  1EWH A;  4DV0 L;  2JEA I;  5DM6 3;  1CHP D;  2EDG A;  3SK6 A;  1B7Y B;  2AUK A;  2R92 B;  4MZ9 A;  2B2T A;  5ELN A;  3A74 A;  4X3K A;  3ZYY X;  3KLS A;  3HOY H;  4DXF A;  1JC7 A;  3MC0 B;  4LFC L;  4WRD A;  2R92 G;  1PTO C;  4F88 A;  1OXX K;  5IGB A;  1H9R A;  1JOK A;  1FGU A;  1SNQ A;  2AQ2 B;  1SNP A;  2J0T D;  4GN3 B;  2NYZ D;  1TWG B;  4OGQ C;  1SDF A;  3I4N H;  1STN A;  4X64 L;  1WTR A;  1P8L A;  3S15 B;  1H9K A;  4N9P A;  1PHJ A;  2IY5 B;  1TXY A;  3CCR A;  2QEX A;  1GVP A;  2ZXO A;  3EIV A;  5JVH 3;  3PO2 H;  3UDX A;  4G7H C;  1XPO A;  5IP7 H;  2F4I A;  3CQZ B;  3JAM c;  2NVQ B;  1IYJ B;  4X65 L;  2L0C A;  3T51 B;  1RDP D;  5DAU A;  1QNU A;  1VQ7 A;  3T1Y Q;  3CP0 A;  2PQA A;  1I4H A;  3UDG A;  1N33 L;  3S2D B;  5C5M A;  1JOR A;  1VQG A;  4C2M B;  1PXU A;  1K8M A;  3HGB A;  4FXG C;  5C5L A;  1YNN D;  2KHI A;  4KJN A;  1IBM Q;  3J81 L;  1HCZ A;  2AQ3 B;  2QF7 A;  3CCQ A;  4ZUI A;  3STB D;  5M5X B;  1SE4 A;  5C44 H;  2EYJ A;  4DUY L;  1VF7 A;  1QE6 A;  4JG2 A;  4LUZ A;  5AFW A;  1GO3 E;  1QG7 A;  1IW7 D;  1J6Q A;  1I94 L;  2JA7 B;  2F0N A;  1FJG L;  1LTB D;  2F0U A;  2D5D A;  1F9P A;  3GTP H;  2KED A;  3DUZ A;  4J8Q A;  1TS4 A;  2JA7 G;  4JI4 L;  1N32 L;  2R93 B;  1JE4 A;  2F0F A;  1BCP B;  2YTY A;  1KAA A;  1TWC B;  4JI6 Q;  1CHQ D;  5C4J H;  1E2W A;  1EOV A;  2R93 G;  1WTV A;  3PIP A;  3NEN A;  3EBE A;  1AN8 A;  1VF5 C;  2Z6B A;  3MXG A;  2HIV A;  1B70 B;  1I50 H;  4FF4 A;  4DR6 Q;  2L55 A;  2A73 B;  3PGZ A;  4GKJ Q;  4HSP A;  4XTC S;  1STA A;  4GN4 B;  1L2F A;  3A7L A;  3A56 A;  3FEW X;  1HQM C;  1W6J A;  4LF4 L;  1EY9 A;  2IT1 A;  2K1B A;  2G9H D;  2CWP A;  1N8R C;  1CA6 A;  1EIG A;  1HZB A;  2AMC B;  5C4X H;  5BN3 A;  3HOW G;  2K04 A;  1Z7T A;  4H13 C;  4GKK Q;  2HCI A;  5FLM G;  1AE2 A;  2RHQ B;  1F2M A;  3K7A H;  2R6G A;  4EQN A;  1DOL A;  3K58 A;  3GTJ B;  3BJU A;  1PTO D;  3M3Y H;  4FF3 A;  4Y7N H;  4KD3 A;  2EJM A;  5FLX L;  5HUR A;  3I3C A;  3NWT A;  1EFI D;  4HIM A;  3I73 A;  3HZX A;  4NP5 A;  4K6L A;  5LMN W;  3RZD H;  1B3A A;  4N8X 1;  1B53 A;  4RHS A;  5IYB G;  3RNU A;  2PW7 A;  3QOJ A;  1XYI A;  1EYD A;  1XNQ L;  2IX0 A;  1ROD A;  2PI2 A;  4RGT A;  4F7X A;  1K83 B;  1ASY A;  1GUN A;  1PRT B;  2NN6 H;  4GS3 A;  1DYQ A;  5C3X A;  3HOU B;  2E5L L;  2VQE L;  4JI0 L;  3SK8 A;  1SYC A;  3KF6 A;  1OXT A;  3HOX H;  3TRZ A;  3LX0 A;  2HQL A;  3NSW A;  3P20 A;  4HSV A;  4RFB A;  5M9O A;  5IY0 A;  4DV1 Q;  4LF6 Q;  3HOU G;  3MXP A;  3U9S A;  4JK1 C;  4PG3 A;  1BKB A;  4UHV A;  1E1O A;  5G3L D;  4XYQ A;  2ZJQ A;  3SXH A;  3D4W A;  4IOC A;  3J7A V;  3S2H B;  3OW7 A;  1SYB A;  1RF2 D;  1C8C A;  4BBS H;  4BBR B;  2L4N A;  2RCF A;  3PV0 A;  1Z9F A;  5CC4 A;  1UE5 A;  1PZK D;  1AFP A;  4EQO A;  3I55 A;  2K5D A;  1S72 A;  4RAU C;  4BBR G;  1NCV A;  5JEA G;  3H0G G;  3TP8 A;  4QY7 A;  2OEO A;  5EPJ A;  4DV2 L;  4KTA A;  5CYU A;  4O1N A;  3HOY B;  2PPB C;  3AFP A;  4KI0 A;  4CKE A;  1G6Z A;  2I5L X;  5IYC H;  2WB1 B;  5JVG 3;  2JEB I;  1RJT A;  2XSC A;  4L5Q A;  3HOY G;  1PTO F;  1LTA D;  3CRK C;  4DNI A;  4LF5 L;  1YI2 A;  2WB1 G;  3PMF A;  4U68 A;  4JI8 Q;  2ICI A;  4NW2 A;  3I4N B;  4ID6 A;  4OX9 Q;  4A3B G;  4CJ2 C;  2YTV A;  2Z6K C;  1Y14 B;  2F0K A;  4KHZ A;  3R93 A;  3J81 E;  4C56 C;  1MSG A;  1HHV A;  5J22 A;  3OSO A;  1EY5 A;  4YWM A;  3PO2 B;  2PCF B;  2UXB Q;  5CBE E;  1IYU A;  1SNO A;  2JN4 A;  3MA2 B;  1WTW A;  5GRO A;  3PO2 G;  2R7Z H;  2E2D C;  2HDL A;  3J7A F;  2MHV A;  5IP7 G;  4N9T A;  2K6A A;  5G3L F;  3GTL H;  5NUC A;  3AYH B;  1BO0 A;  4HJA A;  4EQ5 A;  5IGG A;  2HHH Q;  3SGI A;  4BXX H;  3I90 A;  3HKZ E;  1KC8 C;  2K03 A;  3CKI B;  2OTL A;  5IWA Q;  1SNM A;  4JBK A;  1FNV A;  4JI3 Q;  3HOZ H;  5KYL A;  5K36 G;  4DR1 Q;  5C0X J;  4X3U A;  4CKB A;  5C44 B;  1CTM A;  1DOM A;  2B39 A;  3I4O A;  3L9A X;  4TQU S;  4IPH A;  1MKH A;  2FFK B;  5C44 G;  1HXY D;  1Q1E A;  3OIQ A;  1C7Y A;  4N8F A;  2BOS A;  4IFD I;  3DEO A;  4OEL B;  5KNC A;  4Y52 H;  1QJO A;  3MXN B;  2VUM H;  2EZV A;  4ZK9 B;  2VB2 X;  3GTP B;  1HZC A;  1F2Z A;  4DV7 L;  4ZCK A;  4DR2 Q;  4K8I A;  3ITP A;  2NUC A;  5IOD A;  3SE0 A;  5L37 A;  4GNX B;  3M85 A;  4DV4 Q;  4DGZ A;  5JJI A;  3DXJ C;  5C4J B;  2ID0 A;  2D0O A;  3KBX A;  2Q8I B;  3A8I E;  3G7L A;  2ZM6 Q;  1I50 B;  1B50 A;  3I7F A;  4I7Z C;  3GTO H;  4DAY B;  2BDO A;  3HS0 C;  4IFD G;  1G91 A;  1VMP A;  2JQO A;  5KND A;  2UXC Q;  1K0S A;  1DM0 B;  1FGB D;  3KJO A;  5FJ8 H;  1T9H A;  4LF8 Q;  2EYF A;  3GTG H;  1UNS A;  3PCO B;  2Z1C A;  2IW3 A;  1KRS A;  1I6H H;  5HY6 A;  3KLR A;  3FKI H;  3L2P A;  4JV5 L;  2E76 C;  2ZJP A;  5JAV A;  2B8G A;  5COY A;  1Y1W H;  2WP8 J;  3MHB A;  2QDL A;  4DR4 L;  5C4X B;  3I4M H;  3J81 c;  1U4R A;  5JJZ A;  1VQK A;  3QO2 A;  2L12 A;  1QZH A;  5C4X G;  3NTI A;  3MTS A;  4KKT A;  4NPS A;  3RLO A;  3K7A B;  4KY7 A;  2F0T A;  3PIO 3;  2NN6 I;  1NR2 A;  3M3Y B;  4Y7N B;  1G29 1;  2OWO A;  3BU2 A;  1VQJ A;  2IPK D;  1XX8 A;  2DNC A;  4DR5 Q;  3CU7 A;  3RZD B;  2TMP A;  3JC6 6;  3FHW A;  4PZ6 A;  1KDA A;  4XQN A;  4DN4 M;  3EJI A;  1IBL Q;  3TN2 A;  1FYC A;  2RQX A;  5CV4 A;  5EKI A;  4NXM L;  4B3S L;  3NUC A;  2JXM B;  3TP6 A;  3HOX B;  4DV3 Q;  1M1K C;  1VMC A;  2NN6 G;  3D6C A;  5ELB A;  1I5F A;  5CBA E;  2K32 A;  1A15 A;  5DNF A;  3QB3 A;  5AJ3 L;  3RD4 A;  1ENF A;  3QJY A;  1L0W A;  1SYG A;  2ES2 A;  4GZY C;  2BA1 A;  3A5Z B;  2BDN A;  4R8I A;  4IJL A;  1A6X A;  1HPC A;  4FXD A;  4BBS B;  1YEZ A;  2IJ0 A;  2Z8L A;  4J15 A;  2I0Q A;  3U58 A;  1LM0 A;  2WAC A;  2JK8 A;  4PMW A;  5C6A A;  5FO9 B;  4ULL A;  3M4Y A;  1X56 A;  4X3S A;  3S14 H;  4BBS G;  1UWV A;  1PH8 A;  1MBY A;  1Q46 A;  1N36 Q;  4A3J G;  3E0J A;  4RA8 A;  1ASZ A;  1CA5 A;  1DCZ A;  4NXN Q;  2EJF C;  1JJG A;  4X66 Q;  1LT4 D;  3CXC A;  2I5H A;  2SOB A;  3M4Q A;  2Z4H A;  1F2L A;  4ZQ3 A;  1WVL A;  1UE6 A;  5IYC G;  5FLX c;  1PH6 A;  3G48 A;  1K8G A;  1O7L A;  1LTS D;  4QMG A;  4A4I A;  1STG A;  4A3G G;  2LS0 1;  2XWB B;  1QB5 D;  2HDM A;  1O78 A;  2RBM A;  2AKW B;  4YHH Q;  1S5B D;  1LT5 D;  4EVO A;  2UU9 L;  4GOP B;  4YWL A;  1T5X D;  3OMC A;  3F2C A;  3KF8 B;  2EXD A;  3E6Z X;  4XQQ A;  1WD1 A;  4DK3 C;  4CJ1 B;  3A8K E;  3MAQ A;  2R7Z B;  1JQY D;  4R4Q A;  4DV5 Q;  3DWP A;  4LF7 L;  3GTL B;  3OWF A;  2NZH A;  4DFA A;  1PA6 A;  4FNF A;  5JPN C;  2R7Z G;  2WIN B;  2VNU D;  2IHE A;  1A0I A;  3V2T A;  1WD0 A;  1V1O A;  4JI1 L;  1X3G A;  4YIJ A;  4O42 A;  3HOZ B;  1B2T A;  3L3O C;  4ME5 A;  4BXX G;  4LW1 A;  2PYK A;  1NSN S;  4H02 A;  3HOW H;  3D0F A;  5IGF A;  4LFB Q;  5IGE A;  1UAP A;  4PZ8 A;  4B3R L;  2JP1 A;  1IKM A;  5CV7 A;  1X3Q A;  4OWT B;  4IUV A;  3STB C;  1IBK Q;  1BBX C;  1TY0 A;  2VB3 X;  3A55 A;  3JAM E;  3F2D A;  4JI5 Q;  2ICE C;  2F3V A;  2Q8T A;  2VUM B;  1PFB A;  1T5E A;  3CW2 C;  1VQO A;  1CT1 D;  1DJR D;  1H9S B;  1F9S A;  5IYB H;  1L1O C;  2B2Y C;  3NPP A;  1NY4 A;  1EFW A;  4JCV E;  3KYH C;  1B44 D;  3PIP 3;  1WTH A;  1HNX Q;  3MXN A;  5FO7 B;  4HID A;  4P2C B;  4FO2 A;  1YNJ C;  3RUZ A;  4IPD A;  5C3E H;  2DGY A;  1YZ6 A;  1VQ6 A;  1OXS C;  1DGS A;  5CV6 A;  1YIT A;  4GNX A;  1Q12 A;  2K33 A;  3GTO B;  3OWE B;  2EY5 A;  5EKL A;  4B9X A;  1NUC A;  1QUQ B;  2IX3 A;  3CCM A;  4LFA Q;  1X3F A;  4QQB X;  2YV5 A;  1EOT A;  3K81 C;  4Q0F A;  4FDB A;  1SBB B;  4DAY A;  3GTG B;  1WJJ A;  1K0R A;  2B2W C;  5FJ8 G;  5IT9 L;  1KAB A;  1ZKO A;  1I6H B;  2B2U A;  2M9V A;  3FKI B;  4ME3 A;  2RF4 A;  4OIK A;  5D65 A;  1IHZ A;  3BZD B;  5LMU Q;  2F0W A;  1Y1W B;  4RGO S;  1EY7 A;  5JEA H;  4CDF C;  3I4M B;  3H0G H;  3FKI G;  1BVS A;  4OHJ A;  1TY2 A;  5CV8 A;  2K5V A;  1C4Q A;  2KEC A;  1KXL A;  4FF2 A;  4IPG A;  2Q2I A;  3I4M G;  1G2S A;  1HZA A;  4K2L A;  4X3T A;  2AUJ D;  3EA6 A;  2LXK A;  3T1Y L;  3LNN A;  5LL6 S;  2PZW A;  3K0Y A;  1KLG D;  1B8A A;  3F8T A;  2DY7 A;  1PH9 A;  1YNX A;  4KY5 A;  4JI2 Q;  2F0H A;  2Z9H A;  1X3E A;  5M3M H;  1HR0 W;  1IBM L;  4JBW A;  4OXP A;  4A3B H;  1HTP A;  1PDQ A;  3WOF A;  1H9M A;  1VDZ A;  4X6A H;  3KK7 A;  5JJL A;  5BN5 A;  1TKW B;  3ND9 A;  2E75 C;  3IL8 A;  3J7Z C;  2E2J H;  3S9W A;  5DEH A;  4G4K A;  2H1E A;  2BH2 A;  2OT2 A;  2Q8R E;  4GLA C;  2TSS A;  3M4P A;  1ICF B;  2XNA C;  4JYA Q;  2MFI A;  3SDZ A;  2YYZ A;  5CV9 A;  1STE A;  2F0J A;  4L5T A;  1YBY A;  1DXM A;  3NK9 A;  4OO1 H;  3BDO A;  2JA8 H;  2NVX H;  1EIF A;  2CKZ B;  3M7G A;  2X6G A;  1R4P B;  1X65 A;  2OQ0 A;  5JEA J;  2EYM A;  2V4D A;  3VYT A;  1PFS A;  2A6H C;  2D2C C;  1MHW C;  5M5W H;  1BUV T;  1U9R A;  1EZ8 A;  3G4S A;  3U4Z A;  5K36 H;  4AYB B;  3VR2 A;  3VR3 A;  5LHY 1;  1VQB A;  3S14 B;  2RDG A;  2CHB D;  2PI2 E;  3Q8D A;  1VQ9 A;  4K5X A;  3PUW A;  2F0I A;  2Q2H A;  4DR6 L;  2LY7 A;  1BBU A;  4AYB G;  4TKO B;  4DV0 Q;  3ULP A;  4B9W A;  5A2Q L;  1MJC A;  2PQE A;  2MJ8 A;  1K73 C;  3UDI A;  3T1H Q;  5EJW A;  2UXD Q;  1NBW A;  1EU4 A;  3I56 A;  4A3C H;  4LFC Q;  3FVQ A;  3Q6S A;  1G6P A;  5I4D A;  1HJP A;  4DK1 A;  2F52 A;  4YY3 Q;  1HR0 Q;  4ILW A;  1F77 A;  4LAA A;  3TP5 A;  5E7N A;  1SN8 A;  1OXU A;  1JOO A;  2ZTC A;  4HIO A;  3I91 A;  3HG9 A;  1YNJ D;  2F3I A;  4MTN A;  3N6R A;  3VYR A;  1QVC A;  1V1Q A;  4JOI A;  2Q2U A;  2PNH A;  1PMR A;  1XTD A;  4GLV B;  2JA5 H;  2WAQ G;  4IFD H;  3S17 H;  1IZ6 A;  2QEJ C;  1OO9 B;  1JIC A;  5EGT A;  3AEV A;  1KQS A;  4PQX A;  3E9H A;  4K5V A;  1BR9 A;  2PNR C;  3L0O A;  4IUQ A;  1N9W A;  4GOP A;  1VQH A;  2C9O A;  3R8B A;  3KF8 A;  4OWW B;  4YWK A;  5I6W A;  2B2V C;  1N33 Q;  4G57 A;  1HUN A;  3EVQ A;  3LGJ A;  4KKU A;  1K8O A;  1PYW D;  3CAM A;  2HT1 A;  4K5W A;  4QB4 A;  3HOW B;  2G5D A;  1HNZ Q;  1CI3 M;  1IKL A;  1PH2 A;  3C2P A;  1I4P A;  3UDF A;  3A0J A;  4DF7 A;  1PTO H;  3D4R A;  2F0P A;  3OIP A;  4U67 3;  1E0B A;  3CCS A;  4UPA A;  3TRE A;  1J9O A;  2KCC A;  1GJX A;  2I5M X;  2EVB A;  1JJ2 A;  1J8I A;  2VY3 A;  3IRB A;  4PNY A;  3KOJ A;  4P72 A;  1SJH D;  3TP7 A;  1U4L A;  1Y8O B;  3CPF A;  2A1A A;  4HJ7 A;  4WJ3 M;  1QOH A;  4PZ7 A;  2SNS A;  4CDE C;  5IT9 E;  4O2D A;  4A93 H;  1AW7 A;  2L15 A;  1B9M A;  5E3F A;  4MIU A;  1ESF A;  3W1G A;  1Z6H A;  4IFD J;  1H9S A;  1UUP A;  5FO8 B;  5C3E B;  1GUT A;  3QR8 A;  1V8Q A;  2VS1 A;  3AU7 A;  2ZT9 C;  4OL7 A;  2A5H A;  4GLX A;  2N88 A;  5ELE A;  4HIK A;  4RHR A;  5C3E G;  5IYD H;  1PH4 A;  1XNR Q;  3CRL C;  3MEF A;  5LMN L;  2K52 A;  1C9O A;  4C3H G;  1G2T A;  3E5S A;  4B3T L;  4RH6 A;  2K14 A;  3H94 A;  2SEB D;  3CCE A;  1PV4 A;  2A6H D;  4JI8 L;  1TWA H;  3AFQ A;  1QUQ A;  4OX9 L;  4G7O C;  2A19 A;  4P75 A;  2SDF A;  2M2L A;  4NMZ A;  4JPB W;  3M4O H;  3SR1 A;  1A3V A;  5KRU A;  1EWC A;  1I4G A;  3H0G B;  2Z4I A;  4K0K Q;  3S24 A;  2CQA A;  1I3Q H;  4QJF A;  1H9J A;  2NTT A;  3BYY B;  2UXB L;  4A3J H;  3DM3 A;  1XMQ L;  4XYO A;  1ENC A;  1UEA B;  4DPG A;  3CHB D;  1D5Z C;  3I4L A;  4C3J H;  3W3A A;  1D6E C;  3SK5 A;  4DKA C;  3MEH A;  1YJN A;  1SMX A;  4ZAI A;  1Q86 C;  1UE1 A;  3CPW A;  2HHH L;  2Z6K A;  2AWN A;  1EQV A;  1Y1V H;  2A6E C;  1FR3 A;  5M3M B;  5GQO A;  4OO1 I;  1EQQ A;  4A3B B;  2R3Z A;  3K7U C;  3NWS A;  5M3F G;  4A3G H;  3URY A;  4JI3 L;  1NE3 A;  4RG1 A;  1CKN B;  2RSO A;  4DK6 C;  3H3V C;  1WCM H;  1GHJ A;  1CKM A;  1EY6 A;  2CFM A;  2K5W A;  2Y0S B;  4ZRZ A;  5M3M G;  1WTO A;  2D62 A;  5C4Z A;  2E2J B;  4YCV A;  3PF5 A;  2M00 A;  3U50 C;  2UUC L;  1NR4 A;  1Q8K A;  2Y0S G;  2VQE Q;  2E5L Q;  1GHK A;  1LT3 D;  2RSN A;  1HNW Q;  1GD7 A;  1CSQ A;  5A2Q E;  1L0Y B;  1QZG A;  4MNO A;  2KUM A;  2JA6 H;  2JA8 B;  1RTO A;  2NVX B;  4K6D A;  2AQ1 B;  2E2H H;  4OO1 G;  4DR3 Q;  1LTL A;  2PMZ B;  4DR2 L;  2JA8 G;  1VQ4 A;  2LXJ A;  4KK7 A;  5M5W B;  5I2Y A;  1CFM A;  4DV4 L;  3E3X A;  3OTO L;  1X55 A;  2OTJ A;  3K5O A;  1OTC A;  4DR7 Q;  2YTX A;  5IT9 c;  1EUJ A;  1ML0 D;  2ZM6 L;  4TRD A;  2F0G A;  4CDD C;  3CCL A;  3R3O A;  3QG1 A;  3T16 A;  2UXC L;  4F87 A;  4DUZ L;  3VDY A;  3E0E A;  3U4V A;  2X69 A;  3T56 B;  2PO4 A;  3X3N A;  4XXE A;  5EAY A;  1XXG A;  1SFO H;  2XVS A;  3PQI A;  1LUZ A;  4KY6 A;  2D0P A;  3A54 A;  3P1H A;  2EYH A;  4DNR B;  4A76 A;  1RIP A;  1ESR A;  4A3C G;  1XJV A;  1XPR A;  3BS1 A;  3TDQ A;  1X54 A;  1TWH H;  1HZ9 A;  1YHQ A;  1CUK A;  5FOB B;  5JPM C;  2F4V Q;  1PLF A;  2F0S A;  4IUN A;  4A3I H;  3NBI A;  1LV9 A;  3OYY A;  1H95 A;  2NVY H;  2AHO B;  1TII D;  4RWS C;  4IUT A;  2JA5 B;  1HA6 A;  3S17 B;  1LTG D;  1FNU A;  4DAP A;  4POG A;  3BDL A;  4DR5 L;  3P7J A;  2PW5 A;  2JA5 G;  2KBN A;  1Q90 A;  4HJ5 A;  3D4D A;  2K05 A;  3Q22 A;  2EY1 A;  5FLX E;  1U0L A;  5IGD A;  4DK0 A;  3NTK A;  2F0O A;  4UP9 A;  2WB1 E;  5I6Y A;  1EQT A;  1D5M C;  2N78 A;  4TVA B;  1B4O A;  4ZUJ A;  4LMQ D;  1BQQ T;  4JC0 A;  4DV3 L;  1PTO B;  1E2Z A;  2ASB A;  1CKO A;  2CCZ A;  3VR4 A;  1PH3 A;  4EX5 A;  2F03 A;  5IE8 A;  2NWG A;  2MQH A;  4JBM A;  2DNE A;  4HCS A;  1YHA A;  4PV1 C;  1PYS B;  2A6E D;  3UE1 A;  3CCU A;  1TU2 B;  3PF4 A;  1LYL A;  4E6I A;  3K0X A;  4B3M L;  1U5K A;  1MI2 A;  2NBF A;  2UUA Q;  4A93 B;  3I8Z A;  1L0X B;  1QWY A;  3MFG A;  3IAY A;  3K6O A;  3N52 A;  1VQC A;  5ELF A;  2E74 C;  2K28 A;  4A93 G;  3UI2 A;  5GAH C;  2VQF Q;  4UDU C;  1N36 L;  1N34 Q;  1IL8 A;  4KJO A;  1NJI C;  5D3I B;  1QCB D;  1M8A A;  2VXW A;  2BCO A;  1ILQ A;  1K3B C;  4X66 L;  1SLJ A;  3K5M A;  2A69 C;  3OPO A;  2IHF A;  3K57 A;  3NHH A;  4K8J A;  2OXP A;  5IYD G;  3S1Q H;  1SRO A;  1TT2 A;  1D8L A;  4EQP A;  2DJF C;  3NBH A;  1TWA B;  2QA4 A;  1IYV A;  4H44 C;  2BE5 C;  2B63 H;  4A3D H;  3M4O B;  1A63 A;  5D3D A;  2HCC A;  1RCV D;  3WDN A;  3NTH A;  4DV6 L;  1JWS D;  1I3Q B;  1PZJ D;  4ZKB B;  2H4O A;  4UP8 A;  4A3J B;  3K59 A;  1EQR A;  3GP7 A;  4M8A A;  4H7B A;  2L1B A;  2N55 A;  1NMG A;  4DV5 L;  1R9T H;  2K50 A;  1WTX A;  2LFN A;  4C3J B;  3RN2 A;  1HRJ A;  4OWX B;  1GUG A;  1PZI D;  5TSS A;  3H6M A;  2HIX A;  4PMC A;  1PRT C;  3CCJ A;  2OQK A;  4C3J G;  1Y1V B;  4ZLT F;  4IN3 A;  4PMB A;  4A3F H;  3SVM A;  4K14 A;  4A3G B;  4LK1 C;  3DLL A;  1J5E L;  3X3M A;  1Y1V G;  1A3U A;  1WCM B;  4J1M A;  2A68 C;  3ICE A;  2XWJ B;  4C3I H;  4MTK A;  3CD6 A;  5JOB A;  1WCM G;  1CZW A;  1SMY C;  1W3S A;  1AEX A;  1CKN A;  1IBK L;  3J80 i;  4APV A;  3I72 A;  4TSS A;  4JI5 L;  3K8A A;  4YCW A;  1SAP A;  1UE7 A;  2JA6 B;  1VQF A;  1OXV A;  4L5R C;  2E2H B;  1E24 A;  2XTI A;  1K8A C;  2HD3 A;  2CW0 C;  4LF9 Q;  1B3Q A;  2J4X A;  3GV6 A;  2JA6 G;  4KHP Q;  1D1I A;  1HNX L;  2HQE A;  3BZC A;  2KA7 A;  1S5F D;  4KLK A;  4HN7 A;  2CVR A;  1ENA A;  1EZ6 A;  2EJG C;  1W2B A;  2O5I C;  2VL6 A;  2KEE A;  1EY0 A;  3V05 A; 
#chains in the Genus database with same CATH homology
 3R2T A;  5ISR A;  4V0B A;  1BCP D;  4DNT B;  4RGM A;  1SFO B;  4IUP A;  4L6T B;  4ZYS A;  2L5T A;  1AZQ A;  4KN4 C;  3TZD A;  4F8M A;  3ONA B;  3DMU A;  4G7Z C;  2KQ3 A;  1TWH B;  3ND8 A;  2G9D A;  1ICW A;  1JWM D;  4A3I B;  1RD9 D;  1ONL A;  2EYO A;  1STY A;  2NVY B;  4FVM A;  1KTK A;  2A69 D;  1RHP A;  3HRZ C;  1DD2 A;  3L7Z C;  1GUS A;  5FK9 C;  4RGN A;  3DWA A;  5C3W A;  3BDC A;  3HEJ A;  2BE5 D;  1JOQ A;  1HUM A;  2NZ1 D;  3FPP A;  3J7Y W;  4MN3 A;  1D1K A;  4QUF A;  1A2T A;  4HMJ A;  3H09 A;  4L63 B;  2XN9 C;  3PUZ A;  3AB9 A;  2LKV A;  2QCP X;  4IAL A;  1GUO A;  1TS3 A;  3R2I A;  1FNW A;  1ZYR C;  3A8J E;  1C48 A;  1PRT D;  3MWY W;  1E2V A;  2F0D A;  5EQ0 A;  1ILP A;  3OOC A;  2QKI C;  2RA4 A;  1CZG A;  1SJE D;  2A68 D;  3HP3 A;  3BVM A;  2O4X A;  1HQR D;  3T53 B;  1EY4 A;  3FMC A;  4QUC A;  1SMY D;  2EYP A;  1A3T A;  1KDC A;  3SEB A;  4Z9C B;  2KOL A;  4QIW B;  2EOT A;  3RMH A;  2J7Z A;  3S1Q B;  1R4Q B;  2CW0 D;  1MSH A;  1KNE A;  1I4X A;  2B2T C;  3ERQ A;  1SXT A;  2B63 B;  1WTQ A;  4A3D B;  4DU9 A;  1EEF D;  1V1P B;  2PZU A;  1BNZ A;  3MXU A;  1S5E D;  4IZ8 A;  1Y8P B;  1TR5 A;  2B8F A;  1LAB A;  5DM7 3;  2O5J C;  1R9T B;  5K5P A;  3VR5 A;  2XIW A;  4R8N A;  5A35 A;  1PRT F;  4A3F B;  3T4A C;  3O13 A;  4KD4 A;  4C3I B;  1VCI A;  1EU3 A;  1A2U A;  4QCL A;  1EYC A;  4RKB A;  3K5L A;  2WAQ B;  4C3I G;  5HGT A;  1MGS A;  1Q1B A;  2B2V A;  2RKS A;  3NQI A;  1O7Z A;  3C1E A;  3Q23 A;  2OF1 A;  3F2U A;  4KV6 A;  3KBG A;  4XDX A;  1AP0 A;  5D14 A;  2L9H A;  2QDB A;  1X3P A;  4BA2 I;  4C1N I;  2WII B;  2PZT A;  4IUR A;  1Z47 A;  1EYA A;  4MHE A;  4BWG B;  1ZYR D;  1M4V A;  1ZXT A;  4XT1 B;  1GOZ A;  1S5C D;  2F1M A;  5T1G A;  5KYI A;  1XWE A;  3IFD A;  5IGC A;  3C1F A;  4KHV A;  5EPK A;  4DXG A;  3BG3 A;  2F0V A;  3AMU A;  2YU9 B;  5M5Y B;  1F2Y A;  3NE5 B;  3T13 A;  4C1N K;  4RCO A;  4BY7 B;  4RCN A;  3PUV A;  2EY6 A;  1SNC A;  4C3H B;  3EQL C;  5ELD A;  1AZP A;  3HKZ B;  1KNA A;  3KUP A;  3EFX D;  1DON A;  1LTR D;  4DA2 A;  1EEI D;  3DHQ A;  4KMU C;  5FKA C;  4I65 A;  4BA1 I;  4HR7 B;  3RLF A;  3G6J B;  3LWE A;  1EL0 A;  5EKK A;  5IIF A;  3TBI B;  2L11 A;  1SND A;  2KCN A;  2IWH A;  1BDO A;  2F0L A;  2WKC A;  3IKJ A;  3TME A;  4K2K A;  2MGS A;  2JYO A;  1KDB A;  4CGY B;  2MUY A;  1LO5 D;  3FDT A;  3D3R A;  2ZXR A;  1CK1 A;  3PO3 B;  4V19 0;  2FIN B;  3WOE A;  1NAP A;  2HUG A;  2KHS A;  2FHT A;  4BY1 B;  4XT3 B;  5M3F B;  5EBC A;  4WJW A;  2AWO A;  4A3E B;  1G8Z D;  4B08 A;  2QIL A;  5C0X H;  2C5C A;  1V43 A;  1SE3 A;  5KGU A;  3S1M B;  1PFM A;  2R61 A;  4NKL A;  3DM1 A;  1STB A;  3MVV A;  3QWN A;  1O80 A;  5KNB A;  5E4W C;  4CJ0 B;  2FJ2 A;  3DEP A;  2FMC A;  3V96 A;  2F3W A;  1BXT A;  3I70 A;  3D31 A;  2ENB A;  1LLR D;  2IL8 A;  4WOR A;  3LWU A;  1V1P A;  4ODG A;  1LAC A;  3BYT B;  4CBV A;  1S5D D;  1Q8I A;  4CKC A;  1EIH A;  2WKD A;  3BVZ A;  3PUX A;  4QF4 A;  2XRS D;  2KJX A;  1QNK A;  1SYD A;  3J80 L;  4KN7 C;  4A3K B;  1JCK B;  2F0Q A;  2NTS A;  3TSS A;  3QOL A;  3W2D A;  4HTH A;  1I6V C;  1WTP A;  2KVM A;  4BS9 A;  4A3M B;  5I9P A;  1GXD C;  2I07 B;  2IX1 A;  5E4X A;  1PFN A;  1SE2 A;  5CR3 A;  3S16 B;  5CMD A;  3VR6 A;  1HTL D;  1D2B A;  1HFN A;  1TQO A;  4FP5 D;  1LTT D;  5E1F A;  4CHT B;  5KIX A;  4HAE A;  2F0E A;  1II3 A;  3FRP B;  3OMG A;  2EE1 A;  3JAM L;  2EYL A;  2K5Q A;  1XTC D;  1HFG A;  3RZO B;  1BCP C;  1BOS A;  1O7Y A;  1X32 A;  3OHX C;  3P75 A;  5LL6 X;  4FF1 A;  1JWU D;  2D9U A;  4KKS A;  3H91 A;  2A74 C;  4EGV A;  5COR A;  2F0M A;  2I46 A;  1I4R A;  1I4Q A;  1B1Z A;  2EY2 A;  3S1N B;  3NP8 A;  1Y8N B;  5J39 A;  2BA0 A;  4DAV A;  2O2L D;  3S1R B;  2K01 A;  4WFN 3;  1HA5 A;  1ZEQ X;  4NDX A;  5IOC A;  1DOK A;  2K7V A;  2XRQ D;  3VA7 A;  1D5X C;  1S4Z A;  3GD7 A;  3BVG A;  4FYD A;  4HED A;  3K5N A;  3DWQ A;  5C0X I;  2NVT B;  3PUY A;  1DZ1 A;  4XIG S;  1CQF A;  1KLU D;  5KEE A;  1QIL A;  2RVL A;  5T1I A;  3D8G A;  2SNM A;  4R9W A;  3SHL A;  2RDH A;  4S3S A;  1Q3L A;  3MFY A;  5EBD A;  1U4P A;  3U9O A;  3NXW A;  2X6L A;  1W6K A;  3IFT A;  1TVX A;  5C0X G;  4IUU A;  5F2D A;  1U4M A;  2JSO A;  3NQT A;  5J1Z A;  3C46 A;  2NB0 A;  5CV5 A;  4RKL A;  2DY8 A;  3Q0A A;  1RTN A;  2EXZ A;  3J80 E;  1BF4 A;  1ET6 A;  1EY8 A;  1LT6 D;  1SYF A;  4M1U B;  2MP1 A;  5CGK A;  1SEB D;  4J6H A;  1JB3 A;  3HOV B;  3GQB A;  2B2Y A;  1CQV A;  3C3L A;  1F9R A;  3VYS A;  5I9O A;  1JR0 D;  3QIA A;  1TS5 A;  1SYE A;  3M7N A;  1YNN C;  1B9N A;  2EPB A;  3ERO A;  2ZXP A;  3Q24 A;  4L8J A;  2E2I B;  3GTQ B;  1ET9 A;  4XQJ A;  3GO5 A;  1F9Q A;  4ABN A;  1GUW A;  3KLS X;  4Q5V A;  3VYU A;  2DN8 A;  3SK4 A;  1IW7 C;  2MPM A;  3MZ5 A;  2B2W A;  2FMM A;  2GA4 B;  1MD2 D;  4H0L C;  4FXK C;  3GTK B;  3FPU B;  4IQZ A;  1LTI D;  5C4H A;  1RKN A;  4HMI A;  3GV3 A;  1FD7 D;  1CM9 A;  2RDF A;  5EPL A;  1STH A;  1TS2 A;  5ELC A;  5BN4 A;  3GTM B;  2LMC B;  2JE6 I;  4HCE A;  2WV6 D;  4ZKC B;  5I2X A;  3TZU A;  1BCP F;  4UAI A;  3VA5 A;  4OIJ A;  1TWF B;  1SSO A;  3D6W A;  1Y69 U;  3A7A B;  4LJZ C;  2B2U C;  1EWH A;  2JEA I;  5DM6 3;  1CHP D;  2EDG A;  3SK6 A;  2AUK A;  2R92 B;  2B2T A;  4X3K A;  3ZYY X;  3KLS A;  4DXF A;  1JC7 A;  3MC0 B;  4WRD A;  1PTO C;  4F88 A;  1OXX K;  5IGB A;  1H9R A;  1JOK A;  2AQ2 B;  1SNQ A;  1SNP A;  2J0T D;  2NYZ D;  1TWG B;  4OGQ C;  1SDF A;  1STN A;  1WTR A;  3S15 B;  1H9K A;  4N9P A;  2ZXO A;  5JVH 3;  4G7H C;  2F4I A;  3CQZ B;  2NVQ B;  2L0C A;  3T51 B;  1RDP D;  5DAU A;  1QNU A;  1I4H A;  3S2D B;  5C5M A;  1JOR A;  4C2M B;  1PXU A;  1K8M A;  3HGB A;  4FXG C;  5C5L A;  1YNN D;  4KJN A;  3J81 L;  1HCZ A;  2AQ3 B;  2QF7 A;  4ZUI A;  5M5X B;  1SE4 A;  2EYJ A;  1VF7 A;  1QE6 A;  5AFW A;  1QG7 A;  1IW7 D;  2JA7 B;  2F0N A;  1LTB D;  2F0U A;  2D5D A;  1F9P A;  2KED A;  3DUZ A;  4J8Q A;  1TS4 A;  2R93 B;  1JE4 A;  2F0F A;  1BCP B;  1KAA A;  1TWC B;  1CHQ D;  1E2W A;  1WTV A;  1AN8 A;  1VF5 C;  3MXG A;  4FF4 A;  2L55 A;  2A73 B;  4HSP A;  4XTC S;  1STA A;  3A7L A;  3A56 A;  3FEW X;  1HQM C;  1W6J A;  1EY9 A;  2IT1 A;  2K1B A;  2G9H D;  1CA6 A;  1EIG A;  5BN3 A;  2K04 A;  1Z7T A;  4H13 C;  2HCI A;  1F2M A;  2R6G A;  4EQN A;  1DOL A;  3K58 A;  3GTJ B;  1PTO D;  4FF3 A;  4KD3 A;  2EJM A;  5FLX L;  5HUR A;  3I3C A;  3NWT A;  1EFI D;  3I73 A;  3HZX A;  4NP5 A;  4K6L A;  1B3A A;  1B53 A;  4RHS A;  2PW7 A;  3QOJ A;  1XYI A;  1EYD A;  2IX0 A;  1ROD A;  4RGT A;  4F7X A;  1K83 B;  1GUN A;  1PRT B;  2NN6 H;  5C3X A;  1DYQ A;  3HOU B;  3SK8 A;  1SYC A;  1OXT A;  3LX0 A;  3NSW A;  5M9O A;  3P20 A;  4HSV A;  4RFB A;  3MXP A;  3U9S A;  4JK1 C;  5G3L D;  4XYQ A;  3SXH A;  3D4W A;  3J7A V;  3S2H B;  3OW7 A;  1SYB A;  1RF2 D;  1C8C A;  4BBR B;  2L4N A;  3PV0 A;  5CC4 A;  1PZK D;  1AFP A;  4EQO A;  2K5D A;  4RAU C;  5JEA G;  1NCV A;  3TP8 A;  2OEO A;  5EPJ A;  4KTA A;  5CYU A;  4O1N A;  3HOY B;  2PPB C;  4KI0 A;  4CKE A;  1G6Z A;  2WB1 B;  5JVG 3;  2JEB I;  1RJT A;  2XSC A;  1PTO F;  1LTA D;  3CRK C;  3PMF A;  4U68 A;  2ICI A;  4NW2 A;  3I4N B;  4ID6 A;  4CJ2 C;  2F0K A;  4KHZ A;  3R93 A;  3J81 E;  4C56 C;  1MSG A;  1HHV A;  5J22 A;  3OSO A;  1EY5 A;  3PO2 B;  2PCF B;  5CBE E;  1IYU A;  1SNO A;  3MA2 B;  1WTW A;  2E2D C;  2HDL A;  3J7A F;  2MHV A;  4N9T A;  2K6A A;  5G3L F;  5NUC A;  1BO0 A;  5IGG A;  3I90 A;  2K03 A;  3CKI B;  1SNM A;  1FNV A;  5K36 G;  5KYL A;  5C0X J;  4X3U A;  4CKB A;  5C44 B;  1CTM A;  1DOM A;  2B39 A;  3L9A X;  4TQU S;  2FFK B;  1HXY D;  1Q1E A;  3OIQ A;  2BOS A;  4IFD I;  3DEO A;  5KNC A;  1QJO A;  2EZV A;  4ZK9 B;  2VB2 X;  3GTP B;  1F2Z A;  4K8I A;  3ITP A;  2NUC A;  5IOD A;  3SE0 A;  3M85 A;  4DGZ A;  3DXJ C;  5C4J B;  2ID0 A;  3KBX A;  2Q8I B;  3A8I E;  3G7L A;  1I50 B;  1B50 A;  4I7Z C;  2BDO A;  3HS0 C;  4IFD G;  1G91 A;  1VMP A;  5KND A;  1DM0 B;  1FGB D;  2EYF A;  1UNS A;  2Z1C A;  2IW3 A;  3KLR A;  2E76 C;  5JAV A;  2B8G A;  5COY A;  5C4X B;  2WP8 J;  3MHB A;  1U4R A;  5JJZ A;  3QO2 A;  2L12 A;  3NTI A;  3MTS A;  4KKT A;  3K7A B;  4KY7 A;  2F0T A;  3PIO 3;  2NN6 I;  1NR2 A;  3M3Y B;  4Y7N B;  1G29 1;  2IPK D;  1XX8 A;  2DNC A;  3CU7 A;  3RZD B;  2TMP A;  1KDA A;  4XQN A;  4DN4 M;  3EJI A;  3TN2 A;  1FYC A;  2RQX A;  5CV4 A;  5EKI A;  3NUC A;  2JXM B;  3TP6 A;  3HOX B;  1VMC A;  2NN6 G;  3D6C A;  5ELB A;  5CBA E;  2K32 A;  1A15 A;  5DNF A;  3QB3 A;  3RD4 A;  1ENF A;  3QJY A;  1SYG A;  4GZY C;  2BA1 A;  2BDN A;  4R8I A;  1A6X A;  1HPC A;  4FXD A;  4BBS B;  2Z8L A;  2IJ0 A;  2WAC A;  5C6A A;  4PMW A;  5FO9 B;  4ULL A;  3M4Y A;  4X3S A;  1MBY A;  3E0J A;  4RA8 A;  1CA5 A;  1DCZ A;  2EJF C;  1LT4 D;  2SOB A;  2Z4H A;  1F2L A;  4ZQ3 A;  1WVL A;  1O7L A;  1LTS D;  4QMG A;  1STG A;  2LS0 1;  2XWB B;  1QB5 D;  2HDM A;  1O78 A;  2RBM A;  1S5B D;  1LT5 D;  4EVO A;  1T5X D;  3OMC A;  3E6Z X;  4XQQ A;  1WD1 A;  4CJ1 B;  3A8K E;  3MAQ A;  2R7Z B;  1JQY D;  3DWP A;  3GTL B;  3OWF A;  4DFA A;  5JPN C;  4FNF A;  2WIN B;  2VNU D;  3V2T A;  1WD0 A;  1V1O A;  4YIJ A;  4O42 A;  3HOZ B;  1B2T A;  3L3O C;  4ME5 A;  2PYK A;  1NSN S;  5IGF A;  5IGE A;  1UAP A;  1IKM A;  2JP1 A;  5CV7 A;  1X3Q A;  4IUV A;  1BBX C;  1TY0 A;  2VB3 X;  3A55 A;  3JAM E;  2ICE C;  2F3V A;  2Q8T A;  2VUM B;  1PFB A;  1T5E A;  1CT1 D;  1DJR D;  1H9S B;  1F9S A;  3NPP A;  2B2Y C;  3PIP 3;  1B44 D;  3MXN A;  5FO7 B;  4P2C B;  4FO2 A;  1YNJ C;  3RUZ A;  1OXS C;  5CV6 A;  1Q12 A;  2K33 A;  3GTO B;  3OWE B;  2EY5 A;  5EKL A;  4B9X A;  1NUC A;  2IX3 A;  1EOT A;  4Q0F A;  1SBB B;  4DAY A;  3GTG B;  2B2W C;  5IT9 L;  1KAB A;  1ZKO A;  1I6H B;  2B2U A;  2M9V A;  3FKI B;  4OIK A;  5D65 A;  1IHZ A;  3BZD B;  2F0W A;  1Y1W B;  4RGO S;  1EY7 A;  5JEA H;  3I4M B;  4OHJ A;  1TY2 A;  5CV8 A;  1C4Q A;  2KEC A;  4FF2 A;  1G2S A;  4K2L A;  4X3T A;  2AUJ D;  3EA6 A;  3LNN A;  5LL6 S;  2PZW A;  3K0Y A;  1KLG D;  2DY7 A;  4KY5 A;  2F0H A;  4JBW A;  1HTP A;  1PDQ A;  3WOF A;  1H9M A;  1VDZ A;  3KK7 A;  5BN5 A;  1TKW B;  3ND9 A;  2E75 C;  3IL8 A;  3S9W A;  5DEH A;  4G4K A;  2H1E A;  2OT2 A;  2Q8R E;  2TSS A;  2XNA C;  3SDZ A;  2YYZ A;  5CV9 A;  1STE A;  2F0J A;  1DXM A;  3NK9 A;  4OO1 H;  3BDO A;  3M7G A;  2X6G A;  1R4P B;  5JEA J;  2EYM A;  2V4D A;  3VYT A;  2A6H C;  2D2C C;  1BUV T;  1U9R A;  1EZ8 A;  5K36 H;  4AYB B;  3VR2 A;  3VR3 A;  5LHY 1;  3S14 B;  2RDG A;  2CHB D;  4K5X A;  3PUW A;  2F0I A;  2LY7 A;  4TKO B;  4B9W A;  5A2Q L;  2PQE A;  2MJ8 A;  5EJW A;  1EU4 A;  3FVQ A;  3Q6S A;  5I4D A;  4DK1 A;  4ILW A;  1F77 A;  4LAA A;  3TP5 A;  1OXU A;  1JOO A;  3I91 A;  3HG9 A;  1YNJ D;  3N6R A;  3VYR A;  1PMR A;  4IFD H;  2QEJ C;  1OO9 B;  1JIC A;  5EGT A;  4PQX A;  4K5V A;  1BR9 A;  2PNR C;  4IUQ A;  2C9O A;  3R8B A;  3KF8 A;  5I6W A;  2B2V C;  4G57 A;  1HUN A;  3EVQ A;  4KKU A;  1K8O A;  1PYW D;  4K5W A;  4QB4 A;  3HOW B;  1CI3 M;  1IKL A;  3C2P A;  1I4P A;  4DF7 A;  1PTO H;  3D4R A;  2F0P A;  3OIP A;  4U67 3;  1E0B A;  1J9O A;  2KCC A;  1GJX A;  2EVB A;  1J8I A;  4PNY A;  1SJH D;  3TP7 A;  1U4L A;  1Y8O B;  1QOH A;  2SNS A;  5IT9 E;  1AW7 A;  1B9M A;  5E3F A;  4MIU A;  1ESF A;  1Z6H A;  4IFD J;  1H9S A;  1UUP A;  5FO8 B;  5C3E B;  1GUT A;  1V8Q A;  3AU7 A;  4OL7 A;  2ZT9 C;  2A5H A;  2N88 A;  5ELE A;  4RHR A;  3CRL C;  4C3H G;  1G2T A;  3E5S A;  4RH6 A;  3H94 A;  2SEB D;  2A6H D;  4G7O C;  2SDF A;  2M2L A;  4NMZ A;  3SR1 A;  1A3V A;  5KRU A;  1EWC A;  1I4G A;  3H0G B;  2Z4I A;  2CQA A;  1H9J A;  2NTT A;  3BYY B;  4XYO A;  1ENC A;  1UEA B;  3CHB D;  1D5Z C;  3I4L A;  3W3A A;  1D6E C;  3SK5 A;  3MEH A;  4ZAI A;  2AWN A;  1EQV A;  2A6E C;  1FR3 A;  5M3M B;  4OO1 I;  4A3B B;  2R3Z A;  3NWS A;  3URY A;  2RSO A;  3H3V C;  2K5W A;  1GHJ A;  1EY6 A;  2Y0S B;  4ZRZ A;  1WTO A;  2D62 A;  5C4Z A;  2E2J B;  2M00 A;  1NR4 A;  1GHK A;  1LT3 D;  2RSN A;  5A2Q E;  1L0Y B;  2KUM A;  2JA8 B;  1RTO A;  2NVX B;  4K6D A;  2AQ1 B;  4OO1 G;  2PMZ B;  4KK7 A;  5M5W B;  5I2Y A;  1CFM A;  3K5O A;  1ML0 D;  4TRD A;  2F0G A;  3R3O A;  3QG1 A;  3T16 A;  4F87 A;  2X69 A;  3T56 B;  2PO4 A;  3X3N A;  4XXE A;  1XXG A;  2XVS A;  4KY6 A;  3A54 A;  3P1H A;  2EYH A;  4DNR B;  1ESR A;  3BS1 A;  3TDQ A;  5FOB B;  5JPM C;  1PLF A;  2F0S A;  4IUN A;  3NBI A;  1LV9 A;  1TII D;  4RWS C;  4IUT A;  2JA5 B;  1HA6 A;  3S17 B;  1LTG D;  1FNU A;  4DAP A;  3BDL A;  3P7J A;  2PW5 A;  1Q90 A;  3D4D A;  2K05 A;  3Q22 A;  2EY1 A;  5FLX E;  5IGD A;  4DK0 A;  3NTK A;  2F0O A;  5I6Y A;  1EQT A;  1D5M C;  1B4O A;  4ZUJ A;  4LMQ D;  1BQQ T;  1PTO B;  1E2Z A;  3VR4 A;  2F03 A;  2NWG A;  2DNE A;  4HCS A;  4PV1 C;  2A6E D;  1TU2 B;  4E6I A;  2NBF A;  1MI2 A;  4A93 B;  3I8Z A;  1L0X B;  1QWY A;  3MFG A;  3IAY A;  3K6O A;  3N52 A;  5ELF A;  2E74 C;  2K28 A;  3UI2 A;  4UDU C;  1IL8 A;  4KJO A;  5D3I B;  1QCB D;  1M8A A;  2VXW A;  2BCO A;  1ILQ A;  3K5M A;  2A69 C;  3OPO A;  3K57 A;  3NHH A;  4K8J A;  2OXP A;  1TT2 A;  4EQP A;  3NBH A;  1TWA B;  1IYV A;  4H44 C;  2BE5 C;  3M4O B;  5D3D A;  2HCC A;  1RCV D;  3WDN A;  3NTH A;  1JWS D;  1I3Q B;  1PZJ D;  4ZKB B;  2H4O A;  4A3J B;  3K59 A;  3GP7 A;  4M8A A;  4H7B A;  2L1B A;  2N55 A;  1WTX A;  2LFN A;  4C3J B;  1HRJ A;  1GUG A;  1PZI D;  5TSS A;  3H6M A;  4PMC A;  1PRT C;  4C3J G;  1Y1V B;  4ZLT F;  4IN3 A;  4PMB A;  3SVM A;  4K14 A;  4A3G B;  4LK1 C;  3X3M A;  1A3U A;  1WCM B;  4J1M A;  2A68 C;  2XWJ B;  5JOB A;  1CZW A;  1SMY C;  1AEX A;  3I72 A;  4TSS A;  1SAP A;  2JA6 B;  1OXV A;  2E2H B;  2CW0 C;  2J4X A;  3GV6 A;  1D1I A;  2HQE A;  2KA7 A;  1S5F D;  4HN7 A;  2CVR A;  1ENA A;  1EZ6 A;  2EJG C;  2O5I C;  2KEE A;  1EY0 A;  3V05 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...