2RSOA

Solution structure of the chromodomain of swi6
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
92
structure length
92
Chain Sequence
b'GSHMESKSSSKKLKENAKEEEGGEEEEEDEYVVEKVLKHRMARKGGGYEYLLKWEGYDDPSDNTWSSEADCSGCKQLIEAYWNEHGGRPEPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chromatin-associated protein swi6
publication title Intrinsic nucleic Acid-binding activity of chp1 chromodomain is required for heterochromatic gene silencing
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Transcription
total genus 7
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2012-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2rsoA00
1AZQA 1XYIA 4X3KA 4X3TA 2MJ8A 4CJ2C 1VMCA 2X6LA 5EKIA 2K04A 1ML0D 2HCCA 5E4XA 3D6WA 2JP1A 2EPBA 2B2WC 4RWSC 2HDLA 2DY7A 4HAEA 2KUMA 1DOMA 3DEPA 5T1GA 3P7JA 2B2UA 2DY8A 3G7LA 4QUFA 4XT3B 2KVMA 1U4LA 1O7YA 2D9UA 3Q6SA 1XX8A 4R9WA 5COYA 1SAPA 5T1IA 1WD0A 2SDFA 4RA8A 2FINB 4X3UA 1EIHA 1E0BA 1ILPA 1WD1A 3I91A 2FHTA 3IL8A 4MHEA 1MSHA 2JYOA 2L4NA 1JICA 1ILQA 1PLFA 1RJTA 1ZXTA 2XIWA 3DEOA 3FPUB 4HEDA 4IUUA 1WTQA 2B2VA 4QUCA 1HRJA 1Q3LA 5EJWA 1BF4A 3MTSA 1SSOA 2NYZD 2N55A 2FFKB 3MWYW 1MI2A 2MPMA 1KNAA 1U4RA 1QNKA 1U4PA 1NR2A 2N88A 2NWGA 3H91A 3R93A 1RODA 2L9HA 2RA4A 4OIJA 1G6ZA 1U4MA 2BDNA 1IKLA 4IUTA 2FJ2A 2B2TA 1A15A 1B53A 1QG7A 3DM1A 3I8ZA 1B2TA 2EOTA 2HCIA 1AZPA 1HFNA 1WTRA 1LV9A 2B2VC 1DOLA 1ICWA 5CBAE 4ZKBB 3QO2A 1F9RA 3GV6A 5EPJA 1CA6A 2K28A 5E4WC 1G91A 1S4ZA 4HCSA 1HFGA 1DZ1A 1G2SA 1DONA 1EQTA 1TVXA 1KNEA 1NR4A 1O80A 5AFWA 1BO0A 2X6GA 3I90A 2Q8TA 1VMPA 1DOKA 1PFBA 2KECA 4CJ1B 2IL8A 1J8IA 2HUGA 3KUPA 1C8CA 2KEEA 1JE4A 1HUMA 1X3PA 2B2UC 2CVRA 2L1BA 5D14A 1HUNA 2B2YA 3N52A 4IUQA 2K1BA 1F2LA 5DNFA 1WVLA 3LWEA 4ZAIA 3TZDA 1RTOA 1SDFA 1PDQA 3KBXA 4CJ0B 2RSOA 3F2UA 2H1EA 3HP3A 2B2WA 2EE1A 1EOTA 1ESRA 5CMDA 1F9QA 1WTOA 5CORA 5D65A 2J7ZA 1IL8A 4RAUC 1NAPA 1NCVA 5EPLA 1EL0A 2VXWA 2RVLA 1F9SA 2R3ZA 1CM9A 1MSGA 4DN4M 1PFMA 2KOLA 1QE6A 3SVMA 4IURA 2HDMA 4O42A 1WTWA 1WTXA 1MGSA 2X69A 4LMQD 3GV3A 2L11A 4OIKA 1M8AA 4IUPA 2RSNA 1WTPA 4ZLTF 2MGSA 2KEDA 1AP0A 2B2TC 4ZK9B 5EPKA 2FMMA 3IFDA 4ZKCB 1BNZA 4MN3A 4X3SA 1RHPA 4HSVA 2K01A 1B3AA 3TN2A 1CA5A 4XDXA 4NW2A 5CBEE 4R8IA 1G2TA 1GUWA 2Q8RE 2K05A 4XT1B 4U68A 2M2LA 1O7ZA 1HA6A 2L12A 1HHVA 1RTNA 1F9PA 1X32A 1PFNA 3I3CA 5EQ0A 1WTVA 2MP1A 4UAIA 1IKMA 3FDTA 4IUVA 1B4OA 1X3QA 1EIGA 2NZ1D 2B2YC 3UI2A 1J9OA 2K03A 5JJZA 1BBXC 1B50A 3ONAB
chains in the Genus database with same CATH superfamily
2VQEQ 1AZQA 4BBSB 2BA1A 4JI0L 2I46A 1I4QA 2B2WC 3TQYA 2HDLA 1XTCD 1VQOA 1G6PA 1K8GA 5DAUA 3G7LA 3ULJA 1E1OA 3CCUA 2VUMB 2JA8H 3GTPH 4AIMA 1V1PA 3FKIG 1PYBA 2SDFA 1W6KA 4KD4A 4JOIA 1YHAA 3T13A 4DNTB 1AW7A 3I91A 1XJVA 1MJEA 2GVAA 1MSHA 2VL6A 1ILQA 1QJOA 2PNHA 2WP8J 5EJWA 5DM63 2KHSA 5C0XG 1W2BA 3WWVA 5FKAC 2N55A 5LHY1 1JORA 1UNSA 3BYYB 4X65L 3MWYW 2HIXA 3I55A 1TS4A 2H5XA 4POGA 1H9RA 4FF4A 3GO5A 4KD3A 1Y1WH 3DM3A 2VS1A 1XPOA 1B53A 4DV2L 1EY0A 3ND9A 3QOLA 2O5IC 2B2VC 1KAAA 5C4ZA 2IT1A 1F9RA 3GV6A 2IJ0A 3S1NB 4CKCA 1I4XA 4KKSA 4UP9A 3RLOA 4FYDA 2NN6I 1FGBD 2R7DA 1PMRA 4BBRB 5A2QL 1L1OC 1NMFA 1Q1EA 4DV3L 3HOVG 5IP7G 3L3OC 1S5FD 4FXGC 3GP7A 4FF3A 2VQEL 2QDBA 3J7YW 3RD4A 1IHZA 2M00A 5CV6A 3GTLH 1VF7A 1BCPD 3SDZA 5FLMH 2F0HA 4ALPA 3KF8A 2Z6BA 4JVZA 2HDMA 5FLXL 4LMQD 4DR2Q 4C1NK 1D8LA 2MGSA 4C3JB 4EQOA 2QF7A 1I6VC 1W6JA 1TWCH 3HKZG 2ATWA 3T4AC 2NVQB 2Z4IA 4UP7A 1VQBA 1XWEA 2K5QA 3JAML 3U4VA 4F87A 3WOEA 1WTVA 2EYFA 2K33A 1SE2A 5DLQE 2K7VA 1X3GA 2OXPA 4DR5Q 4RGOS 1LT6D 2B2YC 4P74A 1VQPA 1EY7A 4PZ6A 3AB9A 5LL6X 2X6LA 1ZYRC 1CSPA 1DJRD 3GTGH 4YWLA 4MNOA 2K5NA 1U9RA 1AFPA 4ID6A 4RFBA 1SYCA 5A35A 4ZYSA 2QCPX 4X3UA 1EIHA 2F0KA 4QQBX 4C56C 5CV5A 3G48A 3OYYA 3WDNA 4BXXG 3JC66 2PI2A 4QL5A 1Q3LA 1C0AA 4FP5D 3H3VH 1Z9FA 3L2PA 1MI2A 3A7AB 3KOJA 1ENFA 3PIO3 1VQMA 4DR2L 3M85A 3HKZE 2BOSA 1HZ9A 4HIOA 1EEFD 4EX5A 4A3DB 1HR0Q 1LV9A 4DR7Q 3HOUB 4IFDG 1K83B 3NBHA 1SNQA 1G91A 4OX9Q 1TWAB 3QOJA 1SE4A 5KGUA 1DONA 2NTTA 1PFBA 2A68D 1I50B 1YZ6A 3S1MH 2A1AA 4H13C 3T1HQ 1C8CA 4DR5L 2MQHA 3L0OA 4A3BB 4JI7L 3AQQA 3N52A 4R8NA 1UAPA 1SJED 1TWGB 1JB7A 4CKEA 5BR8Q 2E2HB 1JJCB 2ZXRA 2RSOA 4IZ8A 2OQ0A 2JA6H 4G7ZC 2Z1CA 3TZUA 3SVMA 4GKKQ 3K58A 4FF1A 2F0IA 3LGJA 3E9IA 5HURA 1M8AA 4ZUIA 2RSNA 4IO9A 4A3MG 3BDLA 3I4MH 4DV1Q 5EGTA 3GDEA 2CKZB 1F2YA 4DV5Q 1HZBA 3NPPA 1X54A 4P2CB 3NTHA 1ENCA 4RKBA 3VA7A 1HHVA 2K5HA 3CCEA 5C44G 3FKIH 5FK9C 4O2DA 5IODA 5I2XA 3OTOL 4K8IA 4HIMA 1YJ9A 2WB1B 5JEAH 1EIGA 1WFQA 1HR0L 4DR7L 2PO4A 5JJZA 1J9OA 3A8JE 5KIXA 4OX9L 1S5ED 4HAEA 4LFCQ 4PQXA 5JPNC 5M3FG 3T1HL 1WCMB 4ODGA 4QUFA 3KF6A 1A62A 5C4XG 1WD0A 1STGA 3HOZG 1K8OA 3C1FA 1WD1A 3GTMB 2NVTB 1TQOA 4RCOA 4BS9A 4OO1I 1QWYA 1EY8A 1I94Q 4R4CA 4GKKL 2ALYB 1RODA 2F0GA 2L9HA 1YHBA 3K0XA 5IP7H 5IT9L 3VR2A 4A3IG 1PRTC 4PNYA 1I3QH 1SE8A 5FLXc 4DV1L 3GTOB 1TS3A 4DV5L 1Q86C 1HFGA 4A3FB 4JI1Q 4X62Q 1N32Q 1YNND 1PTOF 4Q0FA 3CF5A 3H6MA 5D14A 2YU9B 3JAMc 4ZUJA 1VQ5A 3STBC 1F2LA 3H09A 3D31A 1HNWQ 4RKLA 4HJ7A 3TZDA 3DLLA 3J7AF 1RTOA 1JOKA 2HQEA 2E2IH 4WFN3 2B2WA 4KK7A 1EWIA 4LF8Q 3GTQB 4LFCL 2J7ZA 2QA4A 2MO0A 2JA9A 1EL0A 3A0JA 3KLWA 3URYA 3MA2B 1WTXA 3CCVA 1PZJD 2X69A 3U9OA 1Y1VH 4OIKA 4NXML 2EQSA 5JVG3 1AP0A 2F4VQ 4MN3A 4J6HA 4HSVA 5KNDA 2LS01 5GAGC 3QWNA 1I94L 1NBWA 2XSCA 2ZXPA 3A8IE 4U68A 3VR5A 2PW5A 3I3CA 1Q7YC 2JA5G 3CC4A 2SEBD 2MP1A 1HNZQ 5K36G 4P75A 1LTLA 1FJGQ 1B4OA 3S15B 1Q1BA 1PZID 2Y0SG 1V1QA 4XXEA 3W2DA 4QJFA 3TRZA 4BXXH 2R7ZB 1BXTA 4JI1L 1S5DD 4RGNA 1STHA 1KRSA 1X6OA 2JP1A 2Z0SA 2XWJB 4X62L 2WAQG 1QVGA 1N32L 5M3MG 3SEBA 3ERQA 3T53B 3P7JA 4DAVA 5C0XJ 1BCPB 2K14A 4XT3B 1CKNB 4OELB 1HQMC 1HNWL 3FVQA 3FPPA 3RZOH 1JT8A 2Q2UA 3DEOA 4LF8L 3CCRA 3HOXB 1WTQA 2ID0A 4H44C 4A93B 1PRTD 1SSOA 2NN6H 1CT1D 4GN3B 3QG1A 4UHVA 2F4VL 3EROA 4BY1G 4K2LA 2QILA 1HTLD 5M5YB 1EQQA 3UE0A 3MXPA 4F88A 3STBD 2OEOA 1PH8A 1A3UA 3A8KE 2BDOA 1JE5A 1TVXA 2XTIA 1OTCA 2C5CA 4KJOA 1RKNA 2Q8TA 1HNZL 3NUCA 1CQFA 4ME3A 4LWCA 2KEEA 1FJGL 1JE4A 2B2YA 1ONLA 4XQQA 1G51A 1XMOL 3I4LA 4A3MH 4KI0A 3F2UA 2H1EA 1IL2A 3MAQA 4I7AA 2F03A 1EYAA 1YJWA 3BJUA 4LFBQ 4AYBG 1B3QA 4LF5Q 2JA7G 4KHVA 3RN2A 4C3IB 2UXBQ 3CW2C 2R92G 4N8FA 4GKJQ 1CTMA 1Y1WG 2FMMA 1CI3M 2CW0C 4JBMA 1K8AC 4P71A 1L1OB 1Q46A 4J1MA 3CCJA 3PQIA 2EYLA 2ZT9C 5M3FH 5C5LA 1F9PA 5HY6A 1EOVA 3UDGA 3M9BA 5C4XH 3HOZH 1EU4A 2Z9HA 1T5XD 1AN8A 4JBJA 3UI2A 5IT9c 1STAA 2OTJA 4S3SA 1TWHB 1VMCA 2XWBB 1JB3A 3QR8A 2IW3A 2EPBA 2RHQB 5NUCA 3BYTB 3S14B 1MD2D 1VQHA 4KKUA 3MXUA 1U4LA 5COYA 1UE5A 3CP0A 5FLMG 1EU3A 4JI3Q 2KQ3A 3R2IA 5C4JB 5ELFA 4IQZA 3T51B 2K5DA 1JJGA 1PYSB 4K8JA 4IALA 2PZWA 4QIWE 3J81i 3C1EA 3X3MA 4LFBL 4DV0Q 4LF5L 1X3FA 4IFDJ 4NMZA 3PO2G 5EBCA 1ENAA 2UXBL 3K59A 4HMJA 1QUQB 1STYA 1CHQD 2F0EA 4C2MB 1EQVA 3CRKC 3DM1A 3X3NA 3NTKA 1TWFB 2VZAA 1YHQA 4JI5L 1SYDA 3CRLC 3K5LA 3EN2A 4KY6A 2Q8IB 2K32A 4FF2A 3FRPB 1ESFA 1O80A 4O1NA 2A74C 2PMZE 4CJ1B 5IE8A 4A3KH 2JEBI 3HOYH 3K7UC 1STBA 5E3FA 5JJIA 1SE3A 1EEID 4MZ9A 5D65A 2F0JA 4X6AH 3GTJB 3HG9A 3L7ZC 2EXDA 3SK6A 5C0XI 3G6JB 1OXSC 2CW0D 2E5LQ 4HIDA 2I07B 1VQ7A 3V96A 5K36H 2Z8LA 4JI3L 4JI0Q 4GZYC 3R8BA 3P75A 2AWOA 3PIOA 2B2TC 5EBDA 4ZK9B 1EFID 2JA8B 3GTPB 1SN8A 3ULPA 4DV0L 1V43A 2H4OA 5GROA 1VQEA 5ELNA 4GLXA 3K7AB 4HSPA 2F3VA 3I4NB 3V05A 3IRBA 3VR6A 3OWEB 3PSIA 5KYIA 4Y7NH 3F2BA 2OCEA 1B8AA 1X3QA 4JPBW 3O13A 2MFIA 1IYUA 2A6EC 4Z9CB 1QVFA 1D5XC 1YNXA 2VY3A 3F1ZA 2N3SA 4RHRA 1B9MA 4LNQA 1XX8A 1DXMA 1Y8OB 2P5ZX 1YITA 5ISRA 1E24A 3D4DA 1PH5A 1SNDA 3ICEA 4A3GB 2JYOA 1Q8IA 5LMNW 1H9JA 1B44D 2V4DA 4DV3Q 3ERSX 2QKIC 3ULLA 5C3XA 5IWAQ 3MEFA 5K5PA 1CSQA 2E5LL 2ZM6Q 1U4RA 1G6ZA 3OHXC 3I4MG 1N33Q 4IOCA 1PXUA 4JBWA 2D62A 3GTLB 2BDNA 2WIIB 4M1UB 2L55A 2RHSB 4BA2I 2N8NA 5C3EG 1WTRA 3UDFA 4C3HB 5JEAG 3C2PA 4HR7B 4WRDA 4A3EB 3DXJC 5JPMC 3ITPA 3OWFA 1J8IA 3VYRA 2KECA 1I4HA 2JA7H 2IL8A 2KCMA 1R9TB 4UY8C 1TWCB 2HUGA 1HTPA 3RZDH 5I4DA 2B2UC 2EVBA 4B9WA 2R92H 1VQGA 4GS3A 4ZAIA 4MIUA 1D7QA 4R1JA 4XIGS 4LK1C 3A5ZB 1HXYD 1HPCA 3BDOA 1SNPA 2A73B 3AEVA 5CV8A 4DF7A 1PRTB 1S40A 5EKLA 1FL0A 4GOPC 3S16B 3GTGB 1ET6A 2L11A 3AFPA 1H9SB 5IWAL 2B63G 1PHJA 2ZM6L 1LTGD 1IW7C 2I5HA 2J0TD 2K75A 4IFDI 1TU2B 1PRTF 1VS0A 1MBYA 4KTAA 2A68C 1N33L 1O7ZA 2IHFA 3PUWA 5CR3A 2O5JC 2A6ED 3D3RA 5KRUA 5J3BA 1PH1A 1EY6A 3IKJA 3K80C 4KV6A 3J80E 1YJNA 1O78A 4NB3A 1UUPA 3PUXA 1B50A 1B1ZA 4TRDA 4RGTA 4GNXB 2CWAA 5E4XA 4FVMA 1L2FA 3M3YH 1TS5A 4BBSH 2PPBC 4XYOA 5IYBH 3S2DH 3DEPA 3BZCA 4C1NI 3PO2H 2EYPA 1RDPD 2Q2TA 5C4HA 1O7YA 2VUMH 4KLKA 4ILWA 3KDFB 1ILPA 3I7FA 4HCEA 4MHEA 4YCUA 5ELEA 4DXFA 1QNUA 3FPUB 1PLFA 2CHBD 3S1MB 1Y1VG 2AUJD 4JI6Q 5LMUQ 1K0RA 4JI7Q 2PQAB 5BN5A 2FFKB 4JW0A 1NR2A 1C7YA 4QY7A 1PZKD 2O4XA 1IBKQ 3KK7A 2CQOA 2JA6B 1S72A 2G9DA 2VNUD 2CCZA 3UDIA 5I6WA 5M5XH 3HGBA 3PGZA 2B29A 3HOWG 3HEJA 2K28A 5IGDA 1GUSA 1K28A 3S17H 3S2HB 4WJ4A 1KNEA 1NR4A 3H0GB 1PV4A 1BVSA 2X6GA 3I90A 4JV5Q 4L6TB 2OQKA 2RBMA 2EY1A 3K5OA 1XNQQ 4BBRH 2L0CA 1JWUD 2F0QA 3MFYA 3BVZA 2AHOB 1PH7A 3FKIB 4IPGA 3OPOA 4KY7A 3T1YQ 1LTID 2QGQA 3OTOQ 1I4PA 1DYQA 2PYKA 3E0JA 1K8MA 1BR9A 2GN5A 1Y8PB 1GJXA 1A2TA 1PFMA 2ICEC 4IPDA 5BN4A 4IURA 1IW7D 2ZTCA 4PG3A 2NN6G 4IN3A 3NBIA 1O7LA 4JI6L 4X3SA 5LMUL 2MHVA 1SYFA 4DV4Q 1LLRD 3GTKH 3Q22A 4J15A 3VYSA 1VQIA 2HHHQ 2F3IA 4XT1B 1YNNC 1IBKL 2NVQH 3AFQA 4A3LG 1E22A 4LUVA 3H94A 1YNJD 4KMUC 3HOVB 3PUZA 3D4WA 5GAEC 2MJ8A 2EIFA 3W5OA 2KBNA 1ML0D 1I6HH 3MVVA 3D6WA 3U50C 2AWNA 1XPRA 4AQYQ 3PO3G 3OMGA 4JV5L 2R7FA 2NVXB 1E2ZA 1A3VA 1XNQL 3CXCA 3BDCA 2E2JH 3SE0A 1CKOA 3TMEA 5C3EH 4DV7L 3IL8A 2E8GA 2JEAI 3T1YL 2DUDA 2XIWA 1P16A 3D6CA 1H95A 2I5LX 3C3LA 3MTSA 4FXDA 5G3LD 3LX0A 4A3JG 1KLGD 4B3MQ 1CQVA 3CPWA 3OW2A 2F4IA 3HKZB 2AMCB 4K5WA 5IIFA 4R4TA 2F0NA 2FJ2A 2B2TA 2SNMA 3IAYA 1CK1A 1UWVA 4DV4L 4ULLA 4DXGA 4O0AA 3S1QH 2HHHL 1V9PA 3NE5B 3HOUH 1GUTA 4NXMQ 1K83H 3AYHB 4H02A 1J5EQ 1TY0A 4NDXA 1BO0A 1TS2A 1LTRD 4HJ9A 4IUQA 3E6ZX 3ND8A 1WVLA 2IHEA 2EYOA 3LWEA 1PDQA 4DPGA 4CJ0B 2EJMA 2B63H 2RCFA 4AQYL 1CKNA 1TWGH 4I7ZC 2E2HH 2JN4A 1HA5A 1NAPA 2RVLA 1A3TA 2R3ZA 2LKVA 5JJKA 3P1HA 5HGTA 2CWPA 5H1SE 4Q5VA 4H7BA 2EY6A 2AKWB 4F7XA 4ZLTF 2R93G 5FJ8H 2RCNA 3A56A 1JOOA 2K01A 3JAMi 1TY2A 4XDXA 1IYJB 5BN3A 2Q8RE 4B3ML 4G57A 3H3VC 2O2LD 1HZAA 4UAIA 2FMCA 1AE2A 4GNXC 2YV5A 1IZ6A 2I5MX 4TSSA 1PH3A 5GQOA 3TSSA 4A3KG 3HOYG 1B9NA 5D3DA 2FXQA 1J5EL 1MKHA 2LFNA 2ES2A 1WYDA 2DNCA 1JC7A 2KUMA 1DOMA 5T1GA 2B2UA 5C6AA 1II3A 5HGQA 4L5QA 1LYLA 4A76A 1WCMH 3E0EA 3BZDB 3A54A 5C5MA 4JG2A 5J22A 3EJIA 4CDCC 2YYZA 1JICA 1ZXTA 3HOWH 2QEXA 2B2VA 4BY7G 2CQAA 2G5DA 1XMOQ 2NVTH 1LABA 2F0VA 3OMCA 5JEAJ 1JQYD 4A3MB 4L5TA 3TBIB 2EY2A 1U4MA 1F2MA 4OONA 1L1OA 4DKAC 3D4RA 3TDQA 5GAHC 1B2TA 2AQ1B 1N8RC 2XRQD 1PTOH 5C44B 1VQLA 1Q8KA 3UE1A 3E5SA 4JC0A 2XGTA 3KFUA 1DZ1A 4GN4B 1NMGA 3GTOH 4NXNQ 1NNXA 5AFWA 1EWHA 1F77A 3M4OB 1X3PA 1BCPF 4PMBA 1EY4A 4K6LA 2K1BA 2ZTDA 4V0BA 5M3FB 2YU9H 4HJ5A 2BH8A 2F1MA 3PUVA 3C46A 4CDDC 3R3OA 4YWMA 1OO9B 5C4XB 4JCVE 3HP3A 4L8JA 2PQEA 3HOZB 4YHHQ 4WORA 1FGUA 2UXDQ 2CFMA 1JR0D 3MZ5A 1F9SA 2NVYB 3GTQH 2RDHA 2F3WA 4IOAA 4A3LH 2F0DA 1ZKOA 2Y0SE 4Y52H 1A2UA 1BOSA 1JWMD 1GO3E 1YBYA 3NK9A 2YTVA 2KENA 4X64Q 1X3EA 3IFDA 1CUKA 3CC7A 1BBUA 2ZJPA 3DWAA 2EYHA 2WAQE 4A3IB 1QUQA 2KCNA 2BH2A 1B3AA 1SR3A 3PO3H 4LF6L 1GUOA 4I65A 4R4QA 5IGCA 4N9PA 1UEAB 1SEBD 5EQ0A 4L5RC 1SROA 3RN5A 5FO7B 1LTAD 1TT2A 2L5TA 2K03A 4NXNL 2K04A 4GOPB 2R7ZH 4RWSC 1HR0W 5F2DA 1WOCA 4A3JH 1S5CD 2E75C 1OXTA 2IX0A 4CBVA 5E7NA 3M4QA 4JI5Q 1SJHD 2DY8A 3Q6SA 4B3TQ 1SAPA 1EYCA 1SYBA 3H3VI 1BUVT 2NZHA 3AU7A 1E1TA 1FNVA 3FEWX 1SNCA 4YHHL 1EYGA 3A55A 1SMXA 2UXDL 5EAYA 1SLJA 3HKSA 4NKLA 1D1IA 3HOXH 3CCLA 2N88A 1U4PA 1VQJA 2KCTA 5ELDA 4AH6A 1HZCA 1FNUA 1KXLA 1G291 4X64L 5J39A 1FR3A 1QG7A 1SYGA 1ET9A 3WOFA 2JA5B 4NPSA 4WJWA 5EPJA 5IY0A 4AYBE 5M5YH 2RF4A 2Y0SB 1D1KA 2WFWA 1SFOB 1P8LA 5JOBA 1VMPA 4JI8L 3NXWA 4BBSG 3NTIA 1HCZA 2WAQB 5IYBG 3MXNB 5M3MB 1KQSA 2R93H 1SDFA 4EQ5A 1IYVA 3KBXA 1LM0A 4PZ8A 2VUMG 2JE6I 3VR4A 5IGEA 4Y7NB 3BS1A 2F0WA 4FDBA 2NUCA 4YCVA 4C3HG 4EGVA 2E74C 4B3TL 4QCLA 4YIJA 3HS0C 3M7GA 1QE6A 3CHBD 1E2WA 4O42A 3KLSX 3GV3A 4PMCA 5KYLA 3SK5A 1Z6HA 3CQZH 2OTLA 1V8QA 4GLAC 1NJIC 4C3IH 2B3GA 3T16A 4A3CH 1GXDC 4DR6Q 1JJ2A 1CA5A 1Y8NB 4BY1B 1BDOA 3BZKA 3S1RH 2ZJRA 1UE1A 2EJFC 3SK4A 3FDTA 2C9OA 1Z47A 4DK0A 4LF7Q 4EQPA 3ONAB 1K73C 4LF4Q 3SR1A 3E9HA 1LT3D 4BBRG 4CJ2C 5JJLA 4BY7H 2N78A 1OXXK 2B8GA 1EY5A 1LT4D 2F0MA 5J1ZA 2D9UA 3KJOA 2BA0A 4DAPA 3SXHA 1CZGA 1LTTD 3OIQA 4AYBB 1M90C 3D0FA 1B70B 2JA7B 3Q8DA 4IJHA 1VQAA 1CHPD 1JMCA 1FVIA 5C4JH 4QIWB 2R92B 3K5MA 1LUZA 1Y1WB 3J80c 4N8X1 3DWPA 4ZCKA 4FO2A 1H9SA 2ZXOA 3H91A 4L5SA 1K9MC 2PCFB 2F0UA 4C3JG 3DWQA 2J4XA 4OO1H 4RMFA 4OXPA 1IKLA 1JWSD 2SOBA 1X55A 2F0PA 1ZEQX 1HFNA 2EYMA 1GHJA 1SMYD 4DR6L 4ZKBB 2DGYA 3QO2A 1RD9D 1YEZA 1J6QA 1CA6A 4XYQA 1Q90A 4HCSA 1PH2A 1D5MC 1Q12A 1IXRA 2GVBA 1EQTA 3R2TA 1HNXQ 2PMZB 1Y14B 2ZTEA 4DK1A 3KUPA 4GNXA 2L1BA 1FNWA 4LF7L 5ELBA 4RH6A 4LF4L 1AH9A 1UE6A 1C48A 3I56A 2PW7A 1OXUA 5CYUA 5FO8B 3J81E 4QMGA 1PTOD 3KDFA 1IL8A 4BWGB 3GTJH 2I0QA 2UUCQ 4DV6L 2PQAA 3M3YB 1D2BA 1V1OA 4B3SQ 1CZWA 3PCOB 4IUPA 3S2DB 3BU2A 3PO2B 2RDGA 4J8QA 1JOQA 3SGIA 4DFAA 2K05A 3M7NA 4X66Q 1RTNA 4A3DG 1X32A 1ICFB 3PV0A 3RNUA 3HOUG 5IYCG 3K7AH 4L63B 3I4NH 3KBGA 3U9SA 1GM5A 1WJJA 3NELA 1H9MA 3PUYA 1L0XB 1DGSA 3EVQA 1HNXL 3QIAA 3ZYYX 3LWUA 1VQDA 4A3BG 1CFMA 5M5XB 1GUNA 1GHKA 4JI2Q 2MNAA 2IWHA 1RCVD 1KD1C 3S17B 3F2CA 3CPFA 3KYHC 1S3OA 2VB2X 2E2DC 4IJLA 2D2CC 4A75A 1X56A 4QUCA 3NP8A 1Z7TA 4A3GH 4APVA 5FJ8G 1VQ8A 1DD2A 1KNAA 5M5WH 2ZJQA 5I2YA 2UUCL 1S5BD 2RA4A 4B9XA 1G8ZD 2AQ2B 4B3SL 4IPHA 1QB5D 3F8TA 4LUOA 4MTKA 1NUCA 1YNJC 2DN8A 5FO9B 3I2ZA 1ICWA 2JSOA 3TEHB 2JQOA 1S4ZA 1G2SA 4N9TA 4X66L 4C3HH 2BE5C 2WB1G 4HN7A 3J7ZC 2A69D 2DJFC 4K14A 4A3EH 1JCKB 3GTKB 1HUMA 3D8GA 3VYTA 1R9TH 3RUZA 3UDXA 5C3WA 1QCBD 1C9OA 2RKSA 4CKBA 1FD7D 1WCMG 4U673 1AE3A 3W3AA 4PMWA 1V1PB 5I9OA 3AMUA 3VYUA 3TS0A 5EPLA 2Z4HA 1TIID 2VXWA 4JI2L 2MO1A 4PZ7A 4IUNA 4TVAB 4KY5A 1OXVA 4LW1A 5CV9A 3PIP3 3CC2A 3TP6A 1WTWA 1I6HB 1MGSA 3K81C 3S1NH 3K8AA 4FNFA 3S16H 3H15A 1UE7A 4UP8A 2WINB 2A6HC 2KEDA 4YWKA 3I4MB 5EPKA 1VDZA 4TKOB 1NSNS 2LMCB 2F0FA 3TN2A 2E2JB 2VW9A 2UUAQ 5C3EB 4R8IA 5CV4A 2YTXA 2KJXA 4DV7Q 2WKDA 3CKIB 3PF4A 1HA6A 2L12A 1I5FA 4OWWB 1XTDA 4CHTB 4QGUA 1SNOA 1VF5C 2UUBQ 2EXZA 4POFA 4DUZQ 4A3FG 2WB1E 2NZ1D 4E6IA 2PI2E 4OWXB 4ZRZA 1VQNA 1A63A 4H0LC 1EZ8A 2HCCA 3GD7A 3MC0B 3J7AV 4C3JH 4UDUC 3TREA 3S1QB 1SXTA 5T1IA 5KNBA 2Q2IA 3VR3A 5IYDH 2PZTA 4K5VA 4BA1I 1VQ9A 3CCSA 3VDYA 3KF8B 1T5EA 4KKTA 4HEDA 5AJ3Q 1AEXA 2K6AA 4DR4Q 1DCZA 2DJGC 2MPMA 3MFGA 2EYJA 5KNCA 1GUGA 4DU9A 1SYEA 2B63B 1I3QB 4PV1C 4IUTA 1TXYA 4EQNA 3I8ZA 2BE5D 2K52A 3TP8A 1F2ZA 3GQBA 1XMQQ 3RR5A 4KJNA 2UUAL 1LTSD 2OF1A 5E4WC 2F52A 3Q24A 1EYDA 5M9OA 5IP9H 3M4YA 3S2HH 1KRTA 2UUBL 2R7ZG 3H0GH 4DUZL 1LO5D 2NTSA 3DHQA 4F8MA 2E2IB 3LNNA 1KL9A 1X9NA 1SNMA 1SBBB 1QOHA 5CMDA 1EOTA 1ESRA 1F9QA 1WTOA 3J81j 5CORA 5KEEA 1ZYRD 2A6HD 4DN4M 3OSOA 4ZQ3A 1Y1VB 4A3DH 3K5NA 1KIXA 5IYCH 3NQIA 3HOXG 1PH9A 1DM0B 4A93G 3PF5A 1WTPA 5C0XH 1TWAH 2EZVA 2K4KA 4V190 4HTHA 4UPAA 5AJ3L 1IBMQ 1L0YB 1KDBA 3SHLA 1I50H 4QB4A 3K57A 4DR4L 1EIFA 4A3BH 4M8AA 5CBEE 2AQ3B 1A6XA 1M4VA 3HFZB 2M2LA 3HOWB 4JBKA 4OHJA 3BG3A 5BR8L 1NY4A 2K50A 2XRSD 3MHBA 1STNA 3NBHB 5CC4A 5IOCA 1T9HA 5ELOA 1XMQL 5DM73 2Z6KC 1YIJA 3CCQA 4X3TA 5EKIA 1VQKA 4RHSA 3PMFA 2IY5B 3HOVH 4LAAA 2HD3A 4DGZA 2DY7A 1QZGA 1PTOB 1I4GA 1TKWB 1WI5A 3RZOB 2NVXH 3A5UA 4CDEC 1BKBA 2ICIA 2HT1A 1VCIA 4KHZA 4DR3Q 3NQTA 2F0LA 4IUUA 1EQRA 3IFTA 1M1KC 1BF4A 3P20A 1KDCA 4C3IG 1E7ZA 3L9AX 3KLSA 3V2TA 1C4QA 4DA2A 4A3CG 2N49A 2JJQA 3J81L 3DMUA 2BCOA 1PVOA 1A15A 2LXKA 1IBML 3QJYA 1L0WA 3CMAA 1PFSA 4DAMA 3TP5A 4CGYB 3KJPA 1LT5D 4OWTB 4KN4C 4B3RQ 3B6YA 3N6RA 1VQ6A 3U58A 3CAMA 1DOKA 2R6GA 3GTMH 1RF2D 2CVRA 2F0SA 5LMNQ 3EIVA 4GOPA 4LF6Q 3PO3B 3TP7A 1K0SA 5DNFA 2LY7A 1VQCA 2D5DA 4OEMB 4R4IA 1N36Q 4ABNA 4JOIC 3KF6B 5JVH3 1NTGA 2EE1A 3I4OA 4DR1Q 2KA7A 2PZUA 1PYWD 5DEHA 3K0YA 1MIUA 3MEHA 1PA6A 1MSGA 1ASYA 4DNRB 4DNIA 2JXMB 3I70A 3G71A 5IGFA 3HZXA 3I73A 4DR3L 2QEJC 4A3FH 1QILA 4A3JB 3BVGA 2EDGA 1HQRD 4OO1G 2XN9C 1I4RA 1K3RA 1EWCA 1MHWC 5A2QE 1VQ4A 1U5KA 2WACA 3TS2A 4NW2A 3SK8A 1XPUA 5ELCA 3A7LA 1G2TA 4G7OC 1EY9A 3J80L 4LFAQ 3FMCA 1A8VA 4RGMA 1EIYB 2RDFA 4LF9Q 4IFDH 4R4OA 4EVOA 4IPCA 2QW7A 1W3SA 1RL2A 4X3KA 2YTYA 1XYIA 4B3RL 3VA5A 2TSSA 3MXNA 1B7YB 5FLXE 5E1FA 3ZJYC 1X65A 5LMNL 4RG1A 4YCWA 4RA8A 2FINB 4ME5A 1N36L 4JYAQ 1IBLQ 2FHTA 4JI8Q 4DR1L 3JAME 3K6OA 3T56B 2G9HD 1E3PA 5CGKA 1XNRQ 2HQLA 2C35B 1KTKA 2NYZD 2R93B 3S15H 2CH4W 1QNKA 2A5HA 2K5WA 2KHIA 4HJ8A 3R93A 4OIJA 3NEMA 5I6YA 3ER0A 2JA8G 5I9PA 2NBFA 2UU9Q 2B39A 2XNAC 2HCIA 4P73A 5CBAE 3Q0AA 3I4NG 1KC8C 4CDFC 1KDAA 4MTNA 5D3IB 5C44H 3CQZB 5FOBB 5IGBA 4LFAL 5IGGA 2IPKD 2KHJA 4K0KQ 4HJAA 2TMPA 4A3KB 1QZHA 3S9WA 3HOYB 1E2VA 4LF9L 3F2DA 4XQNA 4A93H 3RMHA 3M4OH 3HRZC 3S1RB 3W1GA 2E76C 1KLUD 4K6DA 2PNRC 4HIKA 1EFWA 4A4IA 1VQFA 2VB3X 1A0IA 4RAUC 2HIVA 1QVCA 1Y69U 1HH2P 4KHPQ 4DK6C 2K5VA 2KOLA 2RQXA 3FP9A 4A3GG 4BY7B 1BBWA 2MUYA 4JYAL 2NVYH 1IBLL 4LUZA 3NSWA 1SMYC 1XNRL 5GADC 4WJ3M 2AUKA 1LTBD 1RHPA 1Q81C 3Q23A 2NZOA 1GOZA 4DUYQ 2IX1A 4YY3Q 4A3IH 2LXJA 2VQFQ 2L15A 1Q82C 2UU9L 3DUZA 1PFNA 3M4PA 1R4PB 4K2KA 1R4QB 3NWSA 3J7A5 3OIPA 4IUVA 4JI4Q 3J81c 4P72A 4KN7C 4A3EG 2CH4A 1BQQT 2OT2A 1PTOC 3G4SA 1YI2A 4XQJA 2LSSA 4K0KL 3NHHA 4GKJL 3RLFA 3NENA 2UXCQ 2EY5A 3MXGA 2KVMA 3E3XA 4R9WA 1ASZA 2F0OA 5G3LF 3EFXD 3I72A 1MJCA 1E0BA 2Q2HA 3PIPA 1GKHA 3A74A 4HMIA 3KLRA 4DK3C 2L4NA 4DAYA 1PH4A 1RJTA 2IX3A 1HRJA 1GD7A 3NWTA 3QB3A 1KAWA 4KHPL 5LL6S 4JK1C 3W1BA 2NWGA 1N34Q 1WTHA 5CV7A 4OL7A 1STEA 1TWHH 2JK8A 2R61A 2EOTA 1AZPA 5L37A 2OWOA 1CKMA 3CU7A 1DOLA 1K3BC 2ENBA 3S14H 2DNEA 4QF4A 2M9VA 4K5XA 2A19A 4DV6Q 4DUYL 4YY3L 2JA5H 1HJPA 2VQFL 3S24A 5JAVA 3CMEA 1EUJA 3RZDB 4B08A 2ASBA 1SFOH 4JI4L 3CD6A 1H9KA 3BVMA 3RLNA 1O7IA 1HUNA 1KHIA 4G4KA 1FYCA 3J80i 2Z6KA 1EZ6A 2V1CC 1N9WA 3OW7A 5M3MH 1SRUA 1PH6A 3U4ZA 4XTCS 5IYDG 4LJZC 2KCCA 3CCMA 5IT9E 4GLVB 4C2MH 1NCVA 2WV6D 2UXCL 2F0TA 1CM9A 1KABA 4X65Q 1TWFH 1YVCA 4TQUS 2GA4B 1TR5A 2A8VA 1GVPA 2SNSA 1BCPC 2QDLA 3EA6A 1UEBA 4OGQC 1D5ZC 4DV2Q 4ZKCB 1BNZA 1LACA 3G6EA 3EBEA 3OOCA 2D0PA 4G7HC 2WKCA 2JA6G 5EKKA 2XVSA 1N34L 3EQLC 2A69C 5TSSA 1GUWA 1D6EC 2NB0A 4GN5A 4FXKC 2D0OA 4BY1H 1IKMA 4RCNA 4NP5A 2EJGC 3FHWA 5IP9G 4DAYB 5M5WB 1NE3A 1U0LA 2B8FA 1BBXC 3H0GG 1RIPA 1XXGA
chains in the Genus database with same CATH topology
1AZQA 4BBSB 2BA1A 2I46A 1I4QA 2B2WC 2HDLA 1XTCD 5DAUA 3G7LA 2VUMB 1V1PA 2SDFA 1W6KA 4KD4A 3T13A 4DNTB 1AW7A 3I91A 1MSHA 1ILQA 1QJOA 2WP8J 5EJWA 5DM63 2KHSA 5C0XG 5FKAC 2N55A 5LHY1 1JORA 1UNSA 3BYYB 3MWYW 1TS4A 4FF4A 1H9RA 3GO5A 4KD3A 1B53A 1EY0A 3ND9A 3QOLA 2O5IC 2B2VC 1KAAA 5C4ZA 2IT1A 1F9RA 3GV6A 2IJ0A 3S1NB 4CKCA 1I4XA 4KKSA 4FYDA 2NN6I 1FGBD 1PMRA 4BBRB 5A2QL 1Q1EA 3L3OC 1S5FD 4FXGC 3GP7A 4FF3A 2QDBA 3J7YW 3RD4A 1IHZA 2M00A 5CV6A 1VF7A 1BCPD 3SDZA 2F0HA 3KF8A 2HDMA 5FLXL 4LMQD 4C1NK 2MGSA 4C3JB 4EQOA 2QF7A 1I6VC 1W6JA 3T4AC 2NVQB 2Z4IA 1XWEA 2K5QA 3JAML 4F87A 3WOEA 1WTVA 2EYFA 2K33A 1SE2A 2K7VA 2OXPA 4RGOS 1LT6D 2B2YC 1EY7A 3AB9A 5LL6X 2X6LA 1ZYRC 1DJRD 1U9RA 1AFPA 4ID6A 4RFBA 1SYCA 5A35A 4ZYSA 2QCPX 4X3UA 1EIHA 2F0KA 4C56C 5CV5A 3WDNA 1Q3LA 4FP5D 1MI2A 3A7AB 1ENFA 3PIO3 3M85A 2BOSA 1EEFD 4A3DB 1LV9A 3HOUB 4IFDG 1K83B 3NBHA 1SNQA 1G91A 1TWAB 3QOJA 1SE4A 5KGUA 1DONA 2NTTA 1PFBA 2A68D 1I50B 1C8CA 4H13C 4A3BB 3N52A 4R8NA 1UAPA 1SJED 1TWGB 4CKEA 2E2HB 2ZXRA 2RSOA 4IZ8A 4G7ZC 2Z1CA 3TZUA 3SVMA 3K58A 4FF1A 2F0IA 5HURA 1M8AA 4ZUIA 2RSNA 3BDLA 5EGTA 1F2YA 3NPPA 4P2CB 3NTHA 1ENCA 4RKBA 3VA7A 1HHVA 5FK9C 5IODA 5I2XA 4K8IA 2WB1B 5JEAH 1EIGA 2PO4A 5JJZA 1J9OA 3A8JE 5KIXA 1S5ED 4HAEA 4PQXA 5JPNC 1WCMB 4ODGA 4QUFA 1WD0A 1STGA 1K8OA 3C1FA 1WD1A 3GTMB 2NVTB 1TQOA 4RCOA 4BS9A 4OO1I 1QWYA 1EY8A 1RODA 2F0GA 2L9HA 5IT9L 3VR2A 1PRTC 4PNYA 3GTOB 1TS3A 1HFGA 4A3FB 1YNND 1PTOF 4Q0FA 2YU9B 3H6MA 5D14A 4ZUJA 1F2LA 3H09A 3D31A 4RKLA 3TZDA 3J7AF 1RTOA 1JOKA 2HQEA 4WFN3 2B2WA 4KK7A 3GTQB 2J7ZA 1EL0A 3URYA 3MA2B 1WTXA 1PZJD 2X69A 3U9OA 4OIKA 5JVG3 1AP0A 4MN3A 4J6HA 4HSVA 5KNDA 2LS01 3QWNA 2XSCA 2ZXPA 3A8IE 4U68A 3VR5A 2PW5A 3I3CA 2SEBD 2MP1A 5K36G 1B4OA 3S15B 1Q1BA 1PZID 4XXEA 3W2DA 2R7ZB 1BXTA 1S5DD 4RGNA 1STHA 2JP1A 2XWJB 3SEBA 3ERQA 3T53B 3P7JA 4DAVA 5C0XJ 1BCPB 4XT3B 1HQMC 3FVQA 3FPPA 3DEOA 3HOXB 1WTQA 2ID0A 4H44C 4A93B 1PRTD 1SSOA 2NN6H 1CT1D 3QG1A 3EROA 4K2LA 2QILA 1HTLD 5M5YB 3MXPA 4F88A 2OEOA 1A3UA 3A8KE 2BDOA 1TVXA 2C5CA 4KJOA 1RKNA 2Q8TA 3NUCA 1CQFA 2KEEA 1JE4A 2B2YA 1ONLA 4XQQA 3I4LA 4KI0A 3F2UA 2H1EA 3MAQA 2F03A 1EYAA 4KHVA 4C3IB 1CTMA 2FMMA 1CI3M 2CW0C 4J1MA 2EYLA 2ZT9C 5C5LA 1F9PA 1EU4A 1T5XD 1AN8A 3UI2A 1STAA 4S3SA 1TWHB 1VMCA 2XWBB 1JB3A 2IW3A 2EPBA 5NUCA 3BYTB 3S14B 1MD2D 4KKUA 3MXUA 1U4LA 5COYA 1EU3A 2KQ3A 3R2IA 5C4JB 5ELFA 4IQZA 3T51B 2K5DA 4K8JA 4IALA 2PZWA 3C1EA 3X3MA 4IFDJ 4NMZA 5EBCA 1ENAA 3K59A 4HMJA 1STYA 1CHQD 2F0EA 4C2MB 1EQVA 3CRKC 3DM1A 3X3NA 3NTKA 1TWFB 1SYDA 3CRLC 3K5LA 4KY6A 2Q8IB 2K32A 4FF2A 3FRPB 1ESFA 1O80A 4O1NA 2A74C 4CJ1B 2JEBI 1STBA 5E3FA 1SE3A 1EEID 5D65A 2F0JA 3GTJB 3HG9A 3L7ZC 3SK6A 5C0XI 3G6JB 1OXSC 2CW0D 2I07B 3V96A 5K36H 2Z8LA 4GZYC 3R8BA 3P75A 2AWOA 2B2TC 5EBDA 4ZK9B 1EFID 2JA8B 3GTPB 1V43A 2H4OA 3K7AB 4HSPA 2F3VA 3I4NB 3V05A 3VR6A 3OWEB 5KYIA 1X3QA 3O13A 1IYUA 2A6EC 4Z9CB 1D5XC 4RHRA 1B9MA 1XX8A 1DXMA 1Y8OB 5ISRA 3D4DA 1SNDA 4A3GB 2JYOA 1Q8IA 1H9JA 1B44D 2V4DA 2QKIC 5C3XA 5K5PA 1U4RA 1G6ZA 3OHXC 1PXUA 4JBWA 2D62A 3GTLB 2BDNA 2WIIB 4M1UB 2L55A 4BA2I 1WTRA 4C3HB 5JEAG 3C2PA 4HR7B 4WRDA 4A3EB 3DXJC 5JPMC 3ITPA 3OWFA 1J8IA 3VYRA 2KECA 1I4HA 2IL8A 1R9TB 1TWCB 2HUGA 1HTPA 5I4DA 2B2UC 4B9WA 2EVBA 4ZAIA 4MIUA 4XIGS 4LK1C 1HXYD 1HPCA 3BDOA 1SNPA 2A73B 5CV8A 4DF7A 1PRTB 5EKLA 3S16B 3GTGB 1ET6A 2L11A 1H9SB 1LTGD 1IW7C 2J0TD 4IFDI 1TU2B 1PRTF 1MBYA 4KTAA 2A68C 1O7ZA 3PUWA 5CR3A 2O5JC 2A6ED 3D3RA 5KRUA 1EY6A 3IKJA 4KV6A 3J80E 1O78A 1UUPA 3PUXA 1B50A 1B1ZA 4TRDA 4RGTA 5E4XA 4FVMA 1TS5A 2PPBC 4XYOA 3DEPA 4C1NI 2EYPA 1RDPD 5C4HA 1O7YA 4ILWA 1ILPA 4HCEA 4MHEA 5ELEA 4DXFA 1QNUA 3FPUB 1PLFA 2CHBD 3S1MB 2AUJD 5BN5A 2FFKB 1NR2A 1PZKD 2O4XA 3KK7A 2JA6B 2G9DA 2VNUD 5I6WA 3HGBA 3HEJA 2K28A 5IGDA 1GUSA 3S2HB 1KNEA 1NR4A 3H0GB 2X6GA 3I90A 4L6TB 2RBMA 2EY1A 3K5OA 2L0CA 1JWUD 2F0QA 3MFYA 3BVZA 3FKIB 4KY7A 3OPOA 1LTID 1I4PA 1DYQA 2PYKA 3E0JA 1K8MA 1BR9A 1GJXA 1Y8PB 1A2TA 1PFMA 2ICEC 5BN4A 4IURA 1IW7D 2NN6G 4IN3A 3NBIA 1O7LA 4X3SA 2MHVA 1SYFA 1LLRD 3Q22A 3VYSA 4XT1B 1YNNC 3H94A 1YNJD 4KMUC 3HOVB 3PUZA 3D4WA 2MJ8A 1ML0D 3MVVA 3D6WA 2AWNA 3OMGA 2NVXB 1E2ZA 1A3VA 3BDCA 3SE0A 3TMEA 3IL8A 2JEAI 2XIWA 3D6CA 3C3LA 3MTSA 4FXDA 5G3LD 3LX0A 1KLGD 1CQVA 2F4IA 3HKZB 4K5WA 5IIFA 2F0NA 2FJ2A 2B2TA 2SNMA 3IAYA 1CK1A 4ULLA 4DXGA 3NE5B 1GUTA 1TY0A 4NDXA 1BO0A 1TS2A 1LTRD 4IUQA 3E6ZX 3ND8A 1WVLA 2EYOA 3LWEA 1PDQA 4CJ0B 2EJMA 4I7ZC 1HA5A 1NAPA 2RVLA 1A3TA 2R3ZA 2LKVA 3P1HA 5HGTA 4Q5VA 4H7BA 2EY6A 4F7XA 4ZLTF 3A56A 1JOOA 2K01A 1TY2A 4XDXA 5BN3A 2Q8RE 4G57A 3H3VC 2O2LD 4UAIA 2FMCA 4TSSA 3TSSA 1B9NA 5D3DA 2LFNA 2DNCA 1JC7A 2KUMA 1DOMA 5T1GA 2B2UA 5C6AA 1II3A 3BZDB 3A54A 5C5MA 5J22A 3EJIA 2YYZA 1JICA 1ZXTA 2B2VA 2CQAA 1LABA 2F0VA 3OMCA 5JEAJ 1JQYD 4A3MB 3TBIB 2EY2A 1U4MA 1F2MA 3D4RA 3TDQA 1B2TA 2AQ1B 2XRQD 1PTOH 5C44B 3E5SA 1DZ1A 5AFWA 1EWHA 1F77A 3M4OB 1X3PA 1BCPF 4PMBA 1EY4A 4K6LA 2K1BA 4V0BA 5M3FB 3PUVA 2F1MA 3C46A 3R3OA 1OO9B 5C4XB 3HP3A 4L8JA 2PQEA 3HOZB 4WORA 1JR0D 3MZ5A 1F9SA 2NVYB 2RDHA 2F3WA 2F0DA 1ZKOA 1A2UA 1BOSA 1JWMD 3NK9A 3IFDA 3DWAA 2EYHA 4A3IB 2KCNA 1B3AA 1GUOA 4I65A 5IGCA 4N9PA 1UEAB 1SEBD 5EQ0A 5FO7B 1LTAD 1TT2A 2L5TA 2K03A 2K04A 4RWSC 5F2DA 1S5CD 2E75C 1OXTA 2IX0A 4CBVA 1SJHD 2DY8A 3Q6SA 1SAPA 1EYCA 1SYBA 1BUVT 3AU7A 1FNVA 3FEWX 1SNCA 3A55A 4NKLA 1D1IA 2N88A 1U4PA 5ELDA 1FNUA 1G291 5J39A 1FR3A 1QG7A 1SYGA 1ET9A 3WOFA 2JA5B 4WJWA 5EPJA 2Y0SB 1D1KA 1SFOB 5JOBA 1VMPA 3NXWA 1HCZA 3NTIA 2WAQB 5M3MB 1SDFA 1IYVA 3KBXA 2JE6I 3VR4A 5IGEA 4Y7NB 3BS1A 2F0WA 4EGVA 2NUCA 4C3HG 2E74C 4QCLA 4YIJA 3HS0C 3M7GA 1QE6A 3CHBD 1E2WA 4O42A 3KLSX 3GV3A 4PMCA 5KYLA 3SK5A 1Z6HA 1V8QA 3T16A 1GXDC 1CA5A 1Y8NB 4BY1B 1BDOA 2EJFC 3SK4A 3FDTA 2C9OA 1Z47A 4DK0A 4EQPA 3ONAB 3SR1A 1LT3D 4CJ2C 1OXXK 2B8GA 1EY5A 1LT4D 2F0MA 5J1ZA 2D9UA 2BA0A 4DAPA 3SXHA 1CZGA 1LTTD 3OIQA 4AYBB 2JA7B 1CHPD 2R92B 4QIWB 3K5MA 1Y1WB 3DWPA 4FO2A 1H9SA 2ZXOA 3H91A 2PCFB 2F0UA 4C3JG 3DWQA 2J4XA 4OO1H 1IKLA 1JWSD 2SOBA 2F0PA 1ZEQX 1HFNA 2EYMA 1GHJA 1SMYD 4ZKBB 3QO2A 1RD9D 1CA6A 4XYQA 1Q90A 4HCSA 1D5MC 1Q12A 1EQTA 3R2TA 2PMZB 4DK1A 3KUPA 2L1BA 1FNWA 5ELBA 4RH6A 1C48A 2PW7A 1OXUA 5CYUA 5FO8B 3J81E 4QMGA 1PTOD 1IL8A 4BWGB 3M3YB 1D2BA 1V1OA 1CZWA 4IUPA 3S2DB 3PO2B 2RDGA 4J8QA 1JOQA 4DFAA 2K05A 3M7NA 1RTNA 1X32A 3PV0A 4L63B 3KBGA 3U9SA 1H9MA 3PUYA 1L0XB 3EVQA 3QIAA 3ZYYX 3LWUA 1CFMA 5M5XB 1GUNA 1GHKA 2IWHA 1RCVD 3S17B 2VB2X 2E2DC 2D2CC 4QUCA 3NP8A 1Z7TA 1DD2A 1KNAA 5I2YA 1S5BD 2RA4A 4B9XA 1G8ZD 2AQ2B 1QB5D 1NUCA 1YNJC 2DN8A 5FO9B 1ICWA 2JSOA 1S4ZA 1G2SA 4N9TA 2BE5C 2A69D 4K14A 1JCKB 3GTKB 1HUMA 3D8GA 3VYTA 3RUZA 5C3WA 1QCBD 2RKSA 4CKBA 1FD7D 4U673 3W3AA 4PMWA 1V1PB 5I9OA 3AMUA 3VYUA 5EPLA 1TIID 2Z4HA 2VXWA 4IUNA 4KY5A 1OXVA 5CV9A 3PIP3 3TP6A 1WTWA 1I6HB 1MGSA 4FNFA 2WINB 2A6HC 2KEDA 3I4MB 5EPKA 1VDZA 4TKOB 1NSNS 2LMCB 2F0FA 3TN2A 2E2JB 5C3EB 4R8IA 5CV4A 2KJXA 2WKDA 3CKIB 1HA6A 2L12A 4CHTB 1SNOA 1VF5C 2EXZA 2NZ1D 4E6IA 4ZRZA 4H0LC 1EZ8A 2HCCA 3GD7A 3MC0B 3J7AV 4UDUC 3S1QB 1SXTA 5T1IA 5KNBA 3VR3A 2PZTA 4K5VA 4BA1I 1T5EA 4KKTA 4HEDA 1AEXA 2K6AA 1DCZA 2MPMA 3MFGA 2EYJA 5KNCA 1GUGA 4DU9A 1SYEA 2B63B 1I3QB 4PV1C 4IUTA 4EQNA 3I8ZA 2BE5D 3TP8A 1F2ZA 3GQBA 4KJNA 1LTSD 2OF1A 5E4WC 3Q24A 1EYDA 5M9OA 3M4YA 1LO5D 2NTSA 3DHQA 4F8MA 2E2IB 3LNNA 1SNMA 1SBBB 1QOHA 5CMDA 1EOTA 1ESRA 1F9QA 1WTOA 5CORA 5KEEA 1ZYRD 2A6HD 4DN4M 3OSOA 4ZQ3A 1Y1VB 3K5NA 3NQIA 1DM0B 1WTPA 5C0XH 2EZVA 4V190 4HTHA 1L0YB 1KDBA 3SHLA 4QB4A 3K57A 4M8AA 5CBEE 2AQ3B 1A6XA 1M4VA 2M2LA 3HOWB 4OHJA 3BG3A 3MHBA 2XRSD 1STNA 5CC4A 5IOCA 5DM73 4X3TA 5EKIA 4RHSA 3PMFA 4LAAA 4DGZA 2DY7A 1PTOB 1I4GA 1TKWB 3RZOB 2ICIA 1VCIA 4KHZA 3NQTA 2F0LA 4IUUA 3IFTA 1BF4A 3P20A 1KDCA 4C3IG 3L9AX 3KLSA 3V2TA 1C4QA 4DA2A 3J81L 3DMUA 2BCOA 1A15A 3QJYA 3TP5A 4CGYB 1LT5D 4KN4C 3N6RA 1DOKA 2R6GA 1RF2D 2CVRA 2F0SA 3PO3B 3TP7A 5DNFA 2LY7A 2D5DA 4ABNA 5JVH3 2EE1A 2KA7A 2PZUA 1PYWD 5DEHA 3K0YA 3MEHA 1MSGA 4DNRB 2JXMB 3I70A 5IGFA 3HZXA 3I73A 2QEJC 1QILA 4A3JB 3BVGA 2EDGA 1HQRD 4OO1G 2XN9C 1I4RA 1EWCA 5A2QE 2WACA 4NW2A 3SK8A 5ELCA 3A7LA 1G2TA 4G7OC 1EY9A 3J80L 3FMCA 4RGMA 2RDFA 4IFDH 4EVOA 1XYIA 4X3KA 3VA5A 2TSSA 3MXNA 5FLXE 5E1FA 4RA8A 2FINB 4ME5A 2FHTA 3JAME 3K6OA 3T56B 2G9HD 5CGKA 1KTKA 2NYZD 2R93B 1QNKA 2A5HA 2K5WA 3R93A 4OIJA 5I6YA 5I9PA 2NBFA 2B39A 2XNAC 2HCIA 5CBAE 3Q0AA 1KDAA 5D3IB 3CQZB 5FOBB 5IGBA 5IGGA 2IPKD 2TMPA 4A3KB 3S9WA 3HOYB 1E2VA 4XQNA 3RMHA 3HRZC 3S1RB 2E76C 1KLUD 4K6DA 2PNRC 2VB3X 4RAUC 1Y69U 2KOLA 2RQXA 4BY7B 2MUYA 3NSWA 1SMYC 2AUKA 1LTBD 1RHPA 3Q23A 1GOZA 2IX1A 3DUZA 1PFNA 1R4PB 4K2KA 1R4QB 3NWSA 3OIPA 4IUVA 4KN7C 1BQQT 2OT2A 1PTOC 4XQJA 3NHHA 3RLFA 2EY5A 3MXGA 2KVMA 4R9WA 2F0OA 5G3LF 3EFXD 3I72A 1E0BA 4HMIA 3KLRA 2L4NA 4DAYA 1RJTA 2IX3A 1HRJA 3NWTA 3QB3A 5LL6S 4JK1C 2NWGA 5CV7A 4OL7A 1STEA 2R61A 2EOTA 1AZPA 1DOLA 2ENBA 3CU7A 2DNEA 4QF4A 2M9VA 4K5XA 5JAVA 3RZDB 4B08A 1H9KA 3BVMA 1HUNA 4G4KA 1FYCA 1EZ6A 3OW7A 4XTCS 4LJZC 2KCCA 5IT9E 1NCVA 2WV6D 2F0TA 1CM9A 1KABA 4TQUS 2GA4B 1TR5A 2SNSA 1BCPC 3EA6A 4OGQC 1D5ZC 4ZKCB 1BNZA 1LACA 3OOCA 4G7HC 2WKCA 5EKKA 2XVSA 1GUWA 5TSSA 2A69C 3EQLC 1D6EC 2NB0A 4FXKC 1IKMA 4RCNA 4NP5A 2EJGC 5M5WB 2B8FA 1BBXC 4HN7A 1XXGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AZQ A;  1XYI A;  4X3K A;  4X3T A;  2MJ8 A;  4CJ2 C;  1VMC A;  2X6L A;  5EKI A;  2K04 A;  1ML0 D;  2HCC A;  5E4X A;  3D6W A;  2JP1 A;  2EPB A;  2B2W C;  4RWS C;  2HDL A;  2DY7 A;  4HAE A;  2KUM A;  1DOM A;  3DEP A;  5T1G A;  3P7J A;  2B2U A;  2DY8 A;  3G7L A;  4QUF A;  4XT3 B;  2KVM A;  1U4L A;  1O7Y A;  2D9U A;  3Q6S A;  1XX8 A;  4R9W A;  5COY A;  1SAP A;  5T1I A;  1WD0 A;  2SDF A;  4RA8 A;  2FIN B;  4X3U A;  1EIH A;  1E0B A;  1ILP A;  1WD1 A;  3I91 A;  2FHT A;  3IL8 A;  4MHE A;  1MSH A;  2JYO A;  2L4N A;  1JIC A;  1ILQ A;  1PLF A;  1RJT A;  1ZXT A;  2XIW A;  3DEO A;  3FPU B;  4HED A;  4IUU A;  1WTQ A;  2B2V A;  4QUC A;  1HRJ A;  1Q3L A;  5EJW A;  1BF4 A;  3MTS A;  1SSO A;  2NYZ D;  2N55 A;  2FFK B;  3MWY W;  1MI2 A;  2MPM A;  1KNA A;  1U4R A;  1QNK A;  1U4P A;  1NR2 A;  2N88 A;  2NWG A;  3H91 A;  3R93 A;  1ROD A;  2L9H A;  2RA4 A;  4OIJ A;  1G6Z A;  1U4M A;  2BDN A;  1IKL A;  4IUT A;  2FJ2 A;  2B2T A;  1A15 A;  1B53 A;  1QG7 A;  3DM1 A;  3I8Z A;  1B2T A;  2EOT A;  2HCI A;  1AZP A;  1HFN A;  1WTR A;  1LV9 A;  2B2V C;  1DOL A;  1ICW A;  5CBA E;  4ZKB B;  3QO2 A;  1F9R A;  3GV6 A;  5EPJ A;  1CA6 A;  2K28 A;  5E4W C;  1G91 A;  1S4Z A;  4HCS A;  1HFG A;  1DZ1 A;  1G2S A;  1DON A;  1EQT A;  1TVX A;  1KNE A;  1NR4 A;  1O80 A;  5AFW A;  1BO0 A;  2X6G A;  3I90 A;  2Q8T A;  1VMP A;  1DOK A;  1PFB A;  2KEC A;  4CJ1 B;  2IL8 A;  1J8I A;  2HUG A;  3KUP A;  1C8C A;  2KEE A;  1JE4 A;  1HUM A;  1X3P A;  2B2U C;  2CVR A;  2L1B A;  5D14 A;  1HUN A;  2B2Y A;  3N52 A;  4IUQ A;  2K1B A;  1F2L A;  5DNF A;  1WVL A;  3LWE A;  4ZAI A;  3TZD A;  1RTO A;  1SDF A;  1PDQ A;  3KBX A;  4CJ0 B;  2RSO A;  3F2U A;  2H1E A;  3HP3 A;  2B2W A;  2EE1 A;  1EOT A;  1ESR A;  5CMD A;  1F9Q A;  1WTO A;  5COR A;  5D65 A;  2J7Z A;  1IL8 A;  4RAU C;  1NAP A;  1NCV A;  5EPL A;  1EL0 A;  2VXW A;  2RVL A;  1F9S A;  2R3Z A;  1CM9 A;  1MSG A;  4DN4 M;  1PFM A;  2KOL A;  1QE6 A;  3SVM A;  4IUR A;  2HDM A;  4O42 A;  1WTW A;  1WTX A;  1MGS A;  2X69 A;  4LMQ D;  3GV3 A;  2L11 A;  4OIK A;  1M8A A;  4IUP A;  2RSN A;  1WTP A;  4ZLT F;  2MGS A;  2KED A;  1AP0 A;  2B2T C;  4ZK9 B;  5EPK A;  2FMM A;  3IFD A;  4ZKC B;  1BNZ A;  4MN3 A;  4X3S A;  1RHP A;  4HSV A;  2K01 A;  1B3A A;  3TN2 A;  1CA5 A;  4XDX A;  4NW2 A;  5CBE E;  4R8I A;  1G2T A;  1GUW A;  2Q8R E;  2K05 A;  4XT1 B;  4U68 A;  2M2L A;  1O7Z A;  1HA6 A;  2L12 A;  1HHV A;  1RTN A;  1F9P A;  1X32 A;  1PFN A;  3I3C A;  5EQ0 A;  1WTV A;  2MP1 A;  4UAI A;  1IKM A;  3FDT A;  4IUV A;  1B4O A;  1X3Q A;  1EIG A;  2NZ1 D;  2B2Y C;  3UI2 A;  1J9O A;  2K03 A;  5JJZ A;  1BBX C;  1B50 A;  3ONA B; 
#chains in the Genus database with same CATH topology
 2VQE Q;  1AZQ A;  4BBS B;  2BA1 A;  4JI0 L;  2I46 A;  1I4Q A;  2B2W C;  3TQY A;  2HDL A;  1XTC D;  1VQO A;  1G6P A;  1K8G A;  5DAU A;  3G7L A;  3ULJ A;  1E1O A;  3CCU A;  2VUM B;  2JA8 H;  3GTP H;  4AIM A;  1V1P A;  3FKI G;  1PYB A;  2SDF A;  1W6K A;  4KD4 A;  4JOI A;  1YHA A;  3T13 A;  4DNT B;  1AW7 A;  3I91 A;  1XJV A;  1MJE A;  2GVA A;  1MSH A;  2VL6 A;  1ILQ A;  1QJO A;  2PNH A;  2WP8 J;  5EJW A;  5DM6 3;  2KHS A;  5C0X G;  1W2B A;  3WWV A;  5FKA C;  2N55 A;  5LHY 1;  1JOR A;  1UNS A;  3BYY B;  4X65 L;  3MWY W;  2HIX A;  3I55 A;  1TS4 A;  2H5X A;  4POG A;  1H9R A;  4FF4 A;  3GO5 A;  4KD3 A;  1Y1W H;  3DM3 A;  2VS1 A;  1XPO A;  1B53 A;  4DV2 L;  1EY0 A;  3ND9 A;  3QOL A;  2O5I C;  2B2V C;  1KAA A;  5C4Z A;  2IT1 A;  1F9R A;  3GV6 A;  2IJ0 A;  3S1N B;  4CKC A;  1I4X A;  4KKS A;  4UP9 A;  3RLO A;  4FYD A;  2NN6 I;  1FGB D;  2R7D A;  1PMR A;  4BBR B;  5A2Q L;  1L1O C;  1NMF A;  1Q1E A;  4DV3 L;  3HOV G;  5IP7 G;  3L3O C;  1S5F D;  4FXG C;  3GP7 A;  4FF3 A;  2VQE L;  2QDB A;  3J7Y W;  3RD4 A;  1IHZ A;  2M00 A;  5CV6 A;  3GTL H;  1VF7 A;  1BCP D;  3SDZ A;  5FLM H;  2F0H A;  4ALP A;  3KF8 A;  2Z6B A;  4JVZ A;  2HDM A;  5FLX L;  4LMQ D;  4DR2 Q;  4C1N K;  1D8L A;  2MGS A;  4C3J B;  4EQO A;  2QF7 A;  1I6V C;  1W6J A;  1TWC H;  3HKZ G;  2ATW A;  3T4A C;  2NVQ B;  2Z4I A;  4UP7 A;  1VQB A;  1XWE A;  2K5Q A;  3JAM L;  3U4V A;  4F87 A;  3WOE A;  1WTV A;  2EYF A;  2K33 A;  1SE2 A;  5DLQ E;  2K7V A;  1X3G A;  2OXP A;  4DR5 Q;  4RGO S;  1LT6 D;  2B2Y C;  4P74 A;  1VQP A;  1EY7 A;  4PZ6 A;  3AB9 A;  5LL6 X;  2X6L A;  1ZYR C;  1CSP A;  1DJR D;  3GTG H;  4YWL A;  4MNO A;  2K5N A;  1U9R A;  1AFP A;  4ID6 A;  4RFB A;  1SYC A;  5A35 A;  4ZYS A;  2QCP X;  4X3U A;  1EIH A;  2F0K A;  4QQB X;  4C56 C;  5CV5 A;  3G48 A;  3OYY A;  3WDN A;  4BXX G;  3JC6 6;  2PI2 A;  4QL5 A;  1Q3L A;  1C0A A;  4FP5 D;  3H3V H;  1Z9F A;  3L2P A;  1MI2 A;  3A7A B;  3KOJ A;  1ENF A;  3PIO 3;  1VQM A;  4DR2 L;  3M85 A;  3HKZ E;  2BOS A;  1HZ9 A;  4HIO A;  1EEF D;  4EX5 A;  4A3D B;  1HR0 Q;  1LV9 A;  4DR7 Q;  3HOU B;  4IFD G;  1K83 B;  3NBH A;  1SNQ A;  1G91 A;  4OX9 Q;  1TWA B;  3QOJ A;  1SE4 A;  5KGU A;  1DON A;  2NTT A;  1PFB A;  2A68 D;  1I50 B;  1YZ6 A;  3S1M H;  2A1A A;  4H13 C;  3T1H Q;  1C8C A;  4DR5 L;  2MQH A;  3L0O A;  4A3B B;  4JI7 L;  3AQQ A;  3N52 A;  4R8N A;  1UAP A;  1SJE D;  1TWG B;  1JB7 A;  4CKE A;  5BR8 Q;  2E2H B;  1JJC B;  2ZXR A;  2RSO A;  4IZ8 A;  2OQ0 A;  2JA6 H;  4G7Z C;  2Z1C A;  3TZU A;  3SVM A;  4GKK Q;  3K58 A;  4FF1 A;  2F0I A;  3LGJ A;  3E9I A;  5HUR A;  1M8A A;  4ZUI A;  2RSN A;  4IO9 A;  4A3M G;  3BDL A;  3I4M H;  4DV1 Q;  5EGT A;  3GDE A;  2CKZ B;  1F2Y A;  4DV5 Q;  1HZB A;  3NPP A;  1X54 A;  4P2C B;  3NTH A;  1ENC A;  4RKB A;  3VA7 A;  1HHV A;  2K5H A;  3CCE A;  5C44 G;  3FKI H;  5FK9 C;  4O2D A;  5IOD A;  5I2X A;  3OTO L;  4K8I A;  4HIM A;  1YJ9 A;  2WB1 B;  5JEA H;  1EIG A;  1WFQ A;  1HR0 L;  4DR7 L;  2PO4 A;  5JJZ A;  1J9O A;  3A8J E;  5KIX A;  4OX9 L;  1S5E D;  4HAE A;  4LFC Q;  4PQX A;  5JPN C;  5M3F G;  3T1H L;  1WCM B;  4ODG A;  4QUF A;  3KF6 A;  1A62 A;  5C4X G;  1WD0 A;  1STG A;  3HOZ G;  1K8O A;  3C1F A;  1WD1 A;  3GTM B;  2NVT B;  1TQO A;  4RCO A;  4BS9 A;  4OO1 I;  1QWY A;  1EY8 A;  1I94 Q;  4R4C A;  4GKK L;  2ALY B;  1ROD A;  2F0G A;  2L9H A;  1YHB A;  3K0X A;  5IP7 H;  5IT9 L;  3VR2 A;  4A3I G;  1PRT C;  4PNY A;  1I3Q H;  1SE8 A;  5FLX c;  4DV1 L;  3GTO B;  1TS3 A;  4DV5 L;  1Q86 C;  1HFG A;  4A3F B;  4JI1 Q;  4X62 Q;  1N32 Q;  1YNN D;  1PTO F;  4Q0F A;  3CF5 A;  3H6M A;  5D14 A;  2YU9 B;  3JAM c;  4ZUJ A;  1VQ5 A;  3STB C;  1F2L A;  3H09 A;  3D31 A;  1HNW Q;  4RKL A;  4HJ7 A;  3TZD A;  3DLL A;  3J7A F;  1RTO A;  1JOK A;  2HQE A;  2E2I H;  4WFN 3;  2B2W A;  4KK7 A;  1EWI A;  4LF8 Q;  3GTQ B;  4LFC L;  2J7Z A;  2QA4 A;  2MO0 A;  2JA9 A;  1EL0 A;  3A0J A;  3KLW A;  3URY A;  3MA2 B;  1WTX A;  3CCV A;  1PZJ D;  2X69 A;  3U9O A;  1Y1V H;  4OIK A;  4NXM L;  2EQS A;  5JVG 3;  1AP0 A;  2F4V Q;  4MN3 A;  4J6H A;  4HSV A;  5KND A;  2LS0 1;  5GAG C;  3QWN A;  1I94 L;  1NBW A;  2XSC A;  2ZXP A;  3A8I E;  4U68 A;  3VR5 A;  2PW5 A;  3I3C A;  1Q7Y C;  2JA5 G;  3CC4 A;  2SEB D;  2MP1 A;  1HNZ Q;  5K36 G;  4P75 A;  1LTL A;  1FJG Q;  1B4O A;  3S15 B;  1Q1B A;  1PZI D;  2Y0S G;  1V1Q A;  4XXE A;  3W2D A;  4QJF A;  3TRZ A;  4BXX H;  2R7Z B;  1BXT A;  4JI1 L;  1S5D D;  4RGN A;  1STH A;  1KRS A;  1X6O A;  2JP1 A;  2Z0S A;  2XWJ B;  4X62 L;  2WAQ G;  1QVG A;  1N32 L;  5M3M G;  3SEB A;  3ERQ A;  3T53 B;  3P7J A;  4DAV A;  5C0X J;  1BCP B;  2K14 A;  4XT3 B;  1CKN B;  4OEL B;  1HQM C;  1HNW L;  3FVQ A;  3FPP A;  3RZO H;  1JT8 A;  2Q2U A;  3DEO A;  4LF8 L;  3CCR A;  3HOX B;  1WTQ A;  2ID0 A;  4H44 C;  4A93 B;  1PRT D;  1SSO A;  2NN6 H;  1CT1 D;  4GN3 B;  3QG1 A;  4UHV A;  2F4V L;  3ERO A;  4BY1 G;  4K2L A;  2QIL A;  1HTL D;  5M5Y B;  1EQQ A;  3UE0 A;  3MXP A;  4F88 A;  3STB D;  2OEO A;  1PH8 A;  1A3U A;  3A8K E;  2BDO A;  1JE5 A;  1TVX A;  2XTI A;  1OTC A;  2C5C A;  4KJO A;  1RKN A;  2Q8T A;  1HNZ L;  3NUC A;  1CQF A;  4ME3 A;  4LWC A;  2KEE A;  1FJG L;  1JE4 A;  2B2Y A;  1ONL A;  4XQQ A;  1G51 A;  1XMO L;  3I4L A;  4A3M H;  4KI0 A;  3F2U A;  2H1E A;  1IL2 A;  3MAQ A;  4I7A A;  2F03 A;  1EYA A;  1YJW A;  3BJU A;  4LFB Q;  4AYB G;  1B3Q A;  4LF5 Q;  2JA7 G;  4KHV A;  3RN2 A;  4C3I B;  2UXB Q;  3CW2 C;  2R92 G;  4N8F A;  4GKJ Q;  1CTM A;  1Y1W G;  2FMM A;  1CI3 M;  2CW0 C;  4JBM A;  1K8A C;  4P71 A;  1L1O B;  1Q46 A;  4J1M A;  3CCJ A;  3PQI A;  2EYL A;  2ZT9 C;  5M3F H;  5C5L A;  1F9P A;  5HY6 A;  1EOV A;  3UDG A;  3M9B A;  5C4X H;  3HOZ H;  1EU4 A;  2Z9H A;  1T5X D;  1AN8 A;  4JBJ A;  3UI2 A;  5IT9 c;  1STA A;  2OTJ A;  4S3S A;  1TWH B;  1VMC A;  2XWB B;  1JB3 A;  3QR8 A;  2IW3 A;  2EPB A;  2RHQ B;  5NUC A;  3BYT B;  3S14 B;  1MD2 D;  1VQH A;  4KKU A;  3MXU A;  1U4L A;  5COY A;  1UE5 A;  3CP0 A;  5FLM G;  1EU3 A;  4JI3 Q;  2KQ3 A;  3R2I A;  5C4J B;  5ELF A;  4IQZ A;  3T51 B;  2K5D A;  1JJG A;  1PYS B;  4K8J A;  4IAL A;  2PZW A;  4QIW E;  3J81 i;  3C1E A;  3X3M A;  4LFB L;  4DV0 Q;  4LF5 L;  1X3F A;  4IFD J;  4NMZ A;  3PO2 G;  5EBC A;  1ENA A;  2UXB L;  3K59 A;  4HMJ A;  1QUQ B;  1STY A;  1CHQ D;  2F0E A;  4C2M B;  1EQV A;  3CRK C;  3DM1 A;  3X3N A;  3NTK A;  1TWF B;  2VZA A;  1YHQ A;  4JI5 L;  1SYD A;  3CRL C;  3K5L A;  3EN2 A;  4KY6 A;  2Q8I B;  2K32 A;  4FF2 A;  3FRP B;  1ESF A;  1O80 A;  4O1N A;  2A74 C;  2PMZ E;  4CJ1 B;  5IE8 A;  4A3K H;  2JEB I;  3HOY H;  3K7U C;  1STB A;  5E3F A;  5JJI A;  1SE3 A;  1EEI D;  4MZ9 A;  5D65 A;  2F0J A;  4X6A H;  3GTJ B;  3HG9 A;  3L7Z C;  2EXD A;  3SK6 A;  5C0X I;  3G6J B;  1OXS C;  2CW0 D;  2E5L Q;  4HID A;  2I07 B;  1VQ7 A;  3V96 A;  5K36 H;  2Z8L A;  4JI3 L;  4JI0 Q;  4GZY C;  3R8B A;  3P75 A;  2AWO A;  3PIO A;  2B2T C;  5EBD A;  4ZK9 B;  1EFI D;  2JA8 B;  3GTP B;  1SN8 A;  3ULP A;  4DV0 L;  1V43 A;  2H4O A;  5GRO A;  1VQE A;  5ELN A;  4GLX A;  3K7A B;  4HSP A;  2F3V A;  3I4N B;  3V05 A;  3IRB A;  3VR6 A;  3OWE B;  3PSI A;  5KYI A;  4Y7N H;  3F2B A;  2OCE A;  1B8A A;  1X3Q A;  4JPB W;  3O13 A;  2MFI A;  1IYU A;  2A6E C;  4Z9C B;  1QVF A;  1D5X C;  1YNX A;  2VY3 A;  3F1Z A;  2N3S A;  4RHR A;  1B9M A;  4LNQ A;  1XX8 A;  1DXM A;  1Y8O B;  2P5Z X;  1YIT A;  5ISR A;  1E24 A;  3D4D A;  1PH5 A;  1SND A;  3ICE A;  4A3G B;  2JYO A;  1Q8I A;  5LMN W;  1H9J A;  1B44 D;  2V4D A;  4DV3 Q;  3ERS X;  2QKI C;  3ULL A;  5C3X A;  5IWA Q;  3MEF A;  5K5P A;  1CSQ A;  2E5L L;  2ZM6 Q;  1U4R A;  1G6Z A;  3OHX C;  3I4M G;  1N33 Q;  4IOC A;  1PXU A;  4JBW A;  2D62 A;  3GTL B;  2BDN A;  2WII B;  4M1U B;  2L55 A;  2RHS B;  4BA2 I;  2N8N A;  5C3E G;  1WTR A;  3UDF A;  4C3H B;  5JEA G;  3C2P A;  4HR7 B;  4WRD A;  4A3E B;  3DXJ C;  5JPM C;  3ITP A;  3OWF A;  1J8I A;  3VYR A;  2KEC A;  1I4H A;  2JA7 H;  2IL8 A;  2KCM A;  1R9T B;  4UY8 C;  1TWC B;  2HUG A;  1HTP A;  3RZD H;  5I4D A;  2B2U C;  2EVB A;  4B9W A;  2R92 H;  1VQG A;  4GS3 A;  4ZAI A;  4MIU A;  1D7Q A;  4R1J A;  4XIG S;  4LK1 C;  3A5Z B;  1HXY D;  1HPC A;  3BDO A;  1SNP A;  2A73 B;  3AEV A;  5CV8 A;  4DF7 A;  1PRT B;  1S40 A;  5EKL A;  1FL0 A;  4GOP C;  3S16 B;  3GTG B;  1ET6 A;  2L11 A;  3AFP A;  1H9S B;  5IWA L;  2B63 G;  1PHJ A;  2ZM6 L;  1LTG D;  1IW7 C;  2I5H A;  2J0T D;  2K75 A;  4IFD I;  1TU2 B;  1PRT F;  1VS0 A;  1MBY A;  4KTA A;  2A68 C;  1N33 L;  1O7Z A;  2IHF A;  3PUW A;  5CR3 A;  2O5J C;  2A6E D;  3D3R A;  5KRU A;  5J3B A;  1PH1 A;  1EY6 A;  3IKJ A;  3K80 C;  4KV6 A;  3J80 E;  1YJN A;  1O78 A;  4NB3 A;  1UUP A;  3PUX A;  1B50 A;  1B1Z A;  4TRD A;  4RGT A;  4GNX B;  2CWA A;  5E4X A;  4FVM A;  1L2F A;  3M3Y H;  1TS5 A;  4BBS H;  2PPB C;  4XYO A;  5IYB H;  3S2D H;  3DEP A;  3BZC A;  4C1N I;  3PO2 H;  2EYP A;  1RDP D;  2Q2T A;  5C4H A;  1O7Y A;  2VUM H;  4KLK A;  4ILW A;  3KDF B;  1ILP A;  3I7F A;  4HCE A;  4MHE A;  4YCU A;  5ELE A;  4DXF A;  1QNU A;  3FPU B;  1PLF A;  2CHB D;  3S1M B;  1Y1V G;  2AUJ D;  4JI6 Q;  5LMU Q;  1K0R A;  4JI7 Q;  2PQA B;  5BN5 A;  2FFK B;  4JW0 A;  1NR2 A;  1C7Y A;  4QY7 A;  1PZK D;  2O4X A;  1IBK Q;  3KK7 A;  2CQO A;  2JA6 B;  1S72 A;  2G9D A;  2VNU D;  2CCZ A;  3UDI A;  5I6W A;  5M5X H;  3HGB A;  3PGZ A;  2B29 A;  3HOW G;  3HEJ A;  2K28 A;  5IGD A;  1GUS A;  1K28 A;  3S17 H;  3S2H B;  4WJ4 A;  1KNE A;  1NR4 A;  3H0G B;  1PV4 A;  1BVS A;  2X6G A;  3I90 A;  4JV5 Q;  4L6T B;  2OQK A;  2RBM A;  2EY1 A;  3K5O A;  1XNQ Q;  4BBR H;  2L0C A;  1JWU D;  2F0Q A;  3MFY A;  3BVZ A;  2AHO B;  1PH7 A;  3FKI B;  4IPG A;  3OPO A;  4KY7 A;  3T1Y Q;  1LTI D;  2QGQ A;  3OTO Q;  1I4P A;  1DYQ A;  2PYK A;  3E0J A;  1K8M A;  1BR9 A;  2GN5 A;  1Y8P B;  1GJX A;  1A2T A;  1PFM A;  2ICE C;  4IPD A;  5BN4 A;  4IUR A;  1IW7 D;  2ZTC A;  4PG3 A;  2NN6 G;  4IN3 A;  3NBI A;  1O7L A;  4JI6 L;  4X3S A;  5LMU L;  2MHV A;  1SYF A;  4DV4 Q;  1LLR D;  3GTK H;  3Q22 A;  4J15 A;  3VYS A;  1VQI A;  2HHH Q;  2F3I A;  4XT1 B;  1YNN C;  1IBK L;  2NVQ H;  3AFQ A;  4A3L G;  1E22 A;  4LUV A;  3H94 A;  1YNJ D;  4KMU C;  3HOV B;  3PUZ A;  3D4W A;  5GAE C;  2MJ8 A;  2EIF A;  3W5O A;  2KBN A;  1ML0 D;  1I6H H;  3MVV A;  3D6W A;  3U50 C;  2AWN A;  1XPR A;  4AQY Q;  3PO3 G;  3OMG A;  4JV5 L;  2R7F A;  2NVX B;  1E2Z A;  1A3V A;  1XNQ L;  3CXC A;  3BDC A;  2E2J H;  3SE0 A;  1CKO A;  3TME A;  5C3E H;  4DV7 L;  3IL8 A;  2E8G A;  2JEA I;  3T1Y L;  2DUD A;  2XIW A;  1P16 A;  3D6C A;  1H95 A;  2I5L X;  3C3L A;  3MTS A;  4FXD A;  5G3L D;  3LX0 A;  4A3J G;  1KLG D;  4B3M Q;  1CQV A;  3CPW A;  3OW2 A;  2F4I A;  3HKZ B;  2AMC B;  4K5W A;  5IIF A;  4R4T A;  2F0N A;  2FJ2 A;  2B2T A;  2SNM A;  3IAY A;  1CK1 A;  1UWV A;  4DV4 L;  4ULL A;  4DXG A;  4O0A A;  3S1Q H;  2HHH L;  1V9P A;  3NE5 B;  3HOU H;  1GUT A;  4NXM Q;  1K83 H;  3AYH B;  4H02 A;  1J5E Q;  1TY0 A;  4NDX A;  1BO0 A;  1TS2 A;  1LTR D;  4HJ9 A;  4IUQ A;  3E6Z X;  3ND8 A;  1WVL A;  2IHE A;  2EYO A;  3LWE A;  1PDQ A;  4DPG A;  4CJ0 B;  2EJM A;  2B63 H;  2RCF A;  4AQY L;  1CKN A;  1TWG H;  4I7Z C;  2E2H H;  2JN4 A;  1HA5 A;  1NAP A;  2RVL A;  1A3T A;  2R3Z A;  2LKV A;  5JJK A;  3P1H A;  5HGT A;  2CWP A;  5H1S E;  4Q5V A;  4H7B A;  2EY6 A;  2AKW B;  4F7X A;  4ZLT F;  2R93 G;  5FJ8 H;  2RCN A;  3A56 A;  1JOO A;  2K01 A;  3JAM i;  1TY2 A;  4XDX A;  1IYJ B;  5BN3 A;  2Q8R E;  4B3M L;  4G57 A;  3H3V C;  2O2L D;  1HZA A;  4UAI A;  2FMC A;  1AE2 A;  4GNX C;  2YV5 A;  1IZ6 A;  2I5M X;  4TSS A;  1PH3 A;  5GQO A;  3TSS A;  4A3K G;  3HOY G;  1B9N A;  5D3D A;  2FXQ A;  1J5E L;  1MKH A;  2LFN A;  2ES2 A;  1WYD A;  2DNC A;  1JC7 A;  2KUM A;  1DOM A;  5T1G A;  2B2U A;  5C6A A;  1II3 A;  5HGQ A;  4L5Q A;  1LYL A;  4A76 A;  1WCM H;  3E0E A;  3BZD B;  3A54 A;  5C5M A;  4JG2 A;  5J22 A;  3EJI A;  4CDC C;  2YYZ A;  1JIC A;  1ZXT A;  3HOW H;  2QEX A;  2B2V A;  4BY7 G;  2CQA A;  2G5D A;  1XMO Q;  2NVT H;  1LAB A;  2F0V A;  3OMC A;  5JEA J;  1JQY D;  4A3M B;  4L5T A;  3TBI B;  2EY2 A;  1U4M A;  1F2M A;  4OON A;  1L1O A;  4DKA C;  3D4R A;  3TDQ A;  5GAH C;  1B2T A;  2AQ1 B;  1N8R C;  2XRQ D;  1PTO H;  5C44 B;  1VQL A;  1Q8K A;  3UE1 A;  3E5S A;  4JC0 A;  2XGT A;  3KFU A;  1DZ1 A;  4GN4 B;  1NMG A;  3GTO H;  4NXN Q;  1NNX A;  5AFW A;  1EWH A;  1F77 A;  3M4O B;  1X3P A;  1BCP F;  4PMB A;  1EY4 A;  4K6L A;  2K1B A;  2ZTD A;  4V0B A;  5M3F B;  2YU9 H;  4HJ5 A;  2BH8 A;  2F1M A;  3PUV A;  3C46 A;  4CDD C;  3R3O A;  4YWM A;  1OO9 B;  5C4X B;  4JCV E;  3HP3 A;  4L8J A;  2PQE A;  3HOZ B;  4YHH Q;  4WOR A;  1FGU A;  2UXD Q;  2CFM A;  1JR0 D;  3MZ5 A;  1F9S A;  2NVY B;  3GTQ H;  2RDH A;  2F3W A;  4IOA A;  4A3L H;  2F0D A;  1ZKO A;  2Y0S E;  4Y52 H;  1A2U A;  1BOS A;  1JWM D;  1GO3 E;  1YBY A;  3NK9 A;  2YTV A;  2KEN A;  4X64 Q;  1X3E A;  3IFD A;  1CUK A;  3CC7 A;  1BBU A;  2ZJP A;  3DWA A;  2EYH A;  2WAQ E;  4A3I B;  1QUQ A;  2KCN A;  2BH2 A;  1B3A A;  1SR3 A;  3PO3 H;  4LF6 L;  1GUO A;  4I65 A;  4R4Q A;  5IGC A;  4N9P A;  1UEA B;  1SEB D;  5EQ0 A;  4L5R C;  1SRO A;  3RN5 A;  5FO7 B;  1LTA D;  1TT2 A;  2L5T A;  2K03 A;  4NXN L;  2K04 A;  4GOP B;  2R7Z H;  4RWS C;  1HR0 W;  5F2D A;  1WOC A;  4A3J H;  1S5C D;  2E75 C;  1OXT A;  2IX0 A;  4CBV A;  5E7N A;  3M4Q A;  4JI5 Q;  1SJH D;  2DY8 A;  3Q6S A;  4B3T Q;  1SAP A;  1EYC A;  1SYB A;  3H3V I;  1BUV T;  2NZH A;  3AU7 A;  1E1T A;  1FNV A;  3FEW X;  1SNC A;  4YHH L;  1EYG A;  3A55 A;  1SMX A;  2UXD L;  5EAY A;  1SLJ A;  3HKS A;  4NKL A;  1D1I A;  3HOX H;  3CCL A;  2N88 A;  1U4P A;  1VQJ A;  2KCT A;  5ELD A;  4AH6 A;  1HZC A;  1FNU A;  1KXL A;  1G29 1;  4X64 L;  5J39 A;  1FR3 A;  1QG7 A;  1SYG A;  1ET9 A;  3WOF A;  2JA5 B;  4NPS A;  4WJW A;  5EPJ A;  5IY0 A;  4AYB E;  5M5Y H;  2RF4 A;  2Y0S B;  1D1K A;  2WFW A;  1SFO B;  1P8L A;  5JOB A;  1VMP A;  4JI8 L;  3NXW A;  4BBS G;  3NTI A;  1HCZ A;  2WAQ B;  5IYB G;  3MXN B;  5M3M B;  1KQS A;  2R93 H;  1SDF A;  4EQ5 A;  1IYV A;  3KBX A;  1LM0 A;  4PZ8 A;  2VUM G;  2JE6 I;  3VR4 A;  5IGE A;  4Y7N B;  3BS1 A;  2F0W A;  4FDB A;  2NUC A;  4YCV A;  4C3H G;  4EGV A;  2E74 C;  4B3T L;  4QCL A;  4YIJ A;  3HS0 C;  3M7G A;  1QE6 A;  3CHB D;  1E2W A;  4O42 A;  3KLS X;  3GV3 A;  4PMC A;  5KYL A;  3SK5 A;  1Z6H A;  3CQZ H;  2OTL A;  1V8Q A;  4GLA C;  1NJI C;  4C3I H;  2B3G A;  3T16 A;  4A3C H;  1GXD C;  4DR6 Q;  1JJ2 A;  1CA5 A;  1Y8N B;  4BY1 B;  1BDO A;  3BZK A;  3S1R H;  2ZJR A;  1UE1 A;  2EJF C;  3SK4 A;  3FDT A;  2C9O A;  1Z47 A;  4DK0 A;  4LF7 Q;  4EQP A;  3ONA B;  1K73 C;  4LF4 Q;  3SR1 A;  3E9H A;  1LT3 D;  4BBR G;  4CJ2 C;  5JJL A;  4BY7 H;  2N78 A;  1OXX K;  2B8G A;  1EY5 A;  1LT4 D;  2F0M A;  5J1Z A;  2D9U A;  3KJO A;  2BA0 A;  4DAP A;  3SXH A;  1CZG A;  1LTT D;  3OIQ A;  4AYB B;  1M90 C;  3D0F A;  1B70 B;  2JA7 B;  3Q8D A;  4IJH A;  1VQA A;  1CHP D;  1JMC A;  1FVI A;  5C4J H;  4QIW B;  2R92 B;  3K5M A;  1LUZ A;  1Y1W B;  3J80 c;  4N8X 1;  3DWP A;  4ZCK A;  4FO2 A;  1H9S A;  2ZXO A;  3H91 A;  4L5S A;  1K9M C;  2PCF B;  2F0U A;  4C3J G;  3DWQ A;  2J4X A;  4OO1 H;  4RMF A;  4OXP A;  1IKL A;  1JWS D;  2SOB A;  1X55 A;  2F0P A;  1ZEQ X;  1HFN A;  2EYM A;  1GHJ A;  1SMY D;  4DR6 L;  4ZKB B;  2DGY A;  3QO2 A;  1RD9 D;  1YEZ A;  1J6Q A;  1CA6 A;  4XYQ A;  1Q90 A;  4HCS A;  1PH2 A;  1D5M C;  1Q12 A;  1IXR A;  2GVB A;  1EQT A;  3R2T A;  1HNX Q;  2PMZ B;  1Y14 B;  2ZTE A;  4DK1 A;  3KUP A;  4GNX A;  2L1B A;  1FNW A;  4LF7 L;  5ELB A;  4RH6 A;  4LF4 L;  1AH9 A;  1UE6 A;  1C48 A;  3I56 A;  2PW7 A;  1OXU A;  5CYU A;  5FO8 B;  3J81 E;  4QMG A;  1PTO D;  3KDF A;  1IL8 A;  4BWG B;  3GTJ H;  2I0Q A;  2UUC Q;  4DV6 L;  2PQA A;  3M3Y B;  1D2B A;  1V1O A;  4B3S Q;  1CZW A;  3PCO B;  4IUP A;  3S2D B;  3BU2 A;  3PO2 B;  2RDG A;  4J8Q A;  1JOQ A;  3SGI A;  4DFA A;  2K05 A;  3M7N A;  4X66 Q;  1RTN A;  4A3D G;  1X32 A;  1ICF B;  3PV0 A;  3RNU A;  3HOU G;  5IYC G;  3K7A H;  4L63 B;  3I4N H;  3KBG A;  3U9S A;  1GM5 A;  1WJJ A;  3NEL A;  1H9M A;  3PUY A;  1L0X B;  1DGS A;  3EVQ A;  1HNX L;  3QIA A;  3ZYY X;  3LWU A;  1VQD A;  4A3B G;  1CFM A;  5M5X B;  1GUN A;  1GHK A;  4JI2 Q;  2MNA A;  2IWH A;  1RCV D;  1KD1 C;  3S17 B;  3F2C A;  3CPF A;  3KYH C;  1S3O A;  2VB2 X;  2E2D C;  4IJL A;  2D2C C;  4A75 A;  1X56 A;  4QUC A;  3NP8 A;  1Z7T A;  4A3G H;  4APV A;  5FJ8 G;  1VQ8 A;  1DD2 A;  1KNA A;  5M5W H;  2ZJQ A;  5I2Y A;  2UUC L;  1S5B D;  2RA4 A;  4B9X A;  1G8Z D;  2AQ2 B;  4B3S L;  4IPH A;  1QB5 D;  3F8T A;  4LUO A;  4MTK A;  1NUC A;  1YNJ C;  2DN8 A;  5FO9 B;  3I2Z A;  1ICW A;  2JSO A;  3TEH B;  2JQO A;  1S4Z A;  1G2S A;  4N9T A;  4X66 L;  4C3H H;  2BE5 C;  2WB1 G;  4HN7 A;  3J7Z C;  2A69 D;  2DJF C;  4K14 A;  4A3E H;  1JCK B;  3GTK B;  1HUM A;  3D8G A;  3VYT A;  1R9T H;  3RUZ A;  3UDX A;  5C3W A;  1QCB D;  1C9O A;  2RKS A;  4CKB A;  1FD7 D;  1WCM G;  4U67 3;  1AE3 A;  3W3A A;  4PMW A;  1V1P B;  5I9O A;  3AMU A;  3VYU A;  3TS0 A;  5EPL A;  2Z4H A;  1TII D;  2VXW A;  4JI2 L;  2MO1 A;  4PZ7 A;  4IUN A;  4TVA B;  4KY5 A;  1OXV A;  4LW1 A;  5CV9 A;  3PIP 3;  3CC2 A;  3TP6 A;  1WTW A;  1I6H B;  1MGS A;  3K81 C;  3S1N H;  3K8A A;  4FNF A;  3S16 H;  3H15 A;  1UE7 A;  4UP8 A;  2WIN B;  2A6H C;  2KED A;  4YWK A;  3I4M B;  5EPK A;  1VDZ A;  4TKO B;  1NSN S;  2LMC B;  2F0F A;  3TN2 A;  2E2J B;  2VW9 A;  2UUA Q;  5C3E B;  4R8I A;  5CV4 A;  2YTX A;  2KJX A;  4DV7 Q;  2WKD A;  3CKI B;  3PF4 A;  1HA6 A;  2L12 A;  1I5F A;  4OWW B;  1XTD A;  4CHT B;  4QGU A;  1SNO A;  1VF5 C;  2UUB Q;  2EXZ A;  4POF A;  4DUZ Q;  4A3F G;  2WB1 E;  2NZ1 D;  4E6I A;  2PI2 E;  4OWX B;  4ZRZ A;  1VQN A;  1A63 A;  4H0L C;  1EZ8 A;  2HCC A;  3GD7 A;  3MC0 B;  3J7A V;  4C3J H;  4UDU C;  3TRE A;  3S1Q B;  1SXT A;  5T1I A;  5KNB A;  2Q2I A;  3VR3 A;  5IYD H;  2PZT A;  4K5V A;  4BA1 I;  1VQ9 A;  3CCS A;  3VDY A;  3KF8 B;  1T5E A;  4KKT A;  4HED A;  5AJ3 Q;  1AEX A;  2K6A A;  4DR4 Q;  1DCZ A;  2DJG C;  2MPM A;  3MFG A;  2EYJ A;  5KNC A;  1GUG A;  4DU9 A;  1SYE A;  2B63 B;  1I3Q B;  4PV1 C;  4IUT A;  1TXY A;  4EQN A;  3I8Z A;  2BE5 D;  2K52 A;  3TP8 A;  1F2Z A;  3GQB A;  1XMQ Q;  3RR5 A;  4KJN A;  2UUA L;  1LTS D;  2OF1 A;  5E4W C;  2F52 A;  3Q24 A;  1EYD A;  5M9O A;  5IP9 H;  3M4Y A;  3S2H H;  1KRT A;  2UUB L;  2R7Z G;  3H0G H;  4DUZ L;  1LO5 D;  2NTS A;  3DHQ A;  4F8M A;  2E2I B;  3LNN A;  1KL9 A;  1X9N A;  1SNM A;  1SBB B;  1QOH A;  5CMD A;  1EOT A;  1ESR A;  1F9Q A;  1WTO A;  3J81 j;  5COR A;  5KEE A;  1ZYR D;  2A6H D;  4DN4 M;  3OSO A;  4ZQ3 A;  1Y1V B;  4A3D H;  3K5N A;  1KIX A;  5IYC H;  3NQI A;  3HOX G;  1PH9 A;  1DM0 B;  4A93 G;  3PF5 A;  1WTP A;  5C0X H;  1TWA H;  2EZV A;  2K4K A;  4V19 0;  4HTH A;  4UPA A;  5AJ3 L;  1IBM Q;  1L0Y B;  1KDB A;  3SHL A;  1I50 H;  4QB4 A;  3K57 A;  4DR4 L;  1EIF A;  4A3B H;  4M8A A;  5CBE E;  2AQ3 B;  1A6X A;  1M4V A;  3HFZ B;  2M2L A;  3HOW B;  4JBK A;  4OHJ A;  3BG3 A;  5BR8 L;  1NY4 A;  2K50 A;  2XRS D;  3MHB A;  1STN A;  3NBH B;  5CC4 A;  5IOC A;  1T9H A;  5ELO A;  1XMQ L;  5DM7 3;  2Z6K C;  1YIJ A;  3CCQ A;  4X3T A;  5EKI A;  1VQK A;  4RHS A;  3PMF A;  2IY5 B;  3HOV H;  4LAA A;  2HD3 A;  4DGZ A;  2DY7 A;  1QZG A;  1PTO B;  1I4G A;  1TKW B;  1WI5 A;  3RZO B;  2NVX H;  3A5U A;  4CDE C;  1BKB A;  2ICI A;  2HT1 A;  1VCI A;  4KHZ A;  4DR3 Q;  3NQT A;  2F0L A;  4IUU A;  1EQR A;  3IFT A;  1M1K C;  1BF4 A;  3P20 A;  1KDC A;  4C3I G;  1E7Z A;  3L9A X;  3KLS A;  3V2T A;  1C4Q A;  4DA2 A;  4A3C G;  2N49 A;  2JJQ A;  3J81 L;  3DMU A;  2BCO A;  1PVO A;  1A15 A;  2LXK A;  1IBM L;  3QJY A;  1L0W A;  3CMA A;  1PFS A;  4DAM A;  3TP5 A;  4CGY B;  3KJP A;  1LT5 D;  4OWT B;  4KN4 C;  4B3R Q;  3B6Y A;  3N6R A;  1VQ6 A;  3U58 A;  3CAM A;  1DOK A;  2R6G A;  3GTM H;  1RF2 D;  2CVR A;  2F0S A;  5LMN Q;  3EIV A;  4GOP A;  4LF6 Q;  3PO3 B;  3TP7 A;  1K0S A;  5DNF A;  2LY7 A;  1VQC A;  2D5D A;  4OEM B;  4R4I A;  1N36 Q;  4ABN A;  4JOI C;  3KF6 B;  5JVH 3;  1NTG A;  2EE1 A;  3I4O A;  4DR1 Q;  2KA7 A;  2PZU A;  1PYW D;  5DEH A;  3K0Y A;  1MIU A;  3MEH A;  1PA6 A;  1MSG A;  1ASY A;  4DNR B;  4DNI A;  2JXM B;  3I70 A;  3G71 A;  5IGF A;  3HZX A;  3I73 A;  4DR3 L;  2QEJ C;  4A3F H;  1QIL A;  4A3J B;  3BVG A;  2EDG A;  1HQR D;  4OO1 G;  2XN9 C;  1I4R A;  1K3R A;  1EWC A;  1MHW C;  5A2Q E;  1VQ4 A;  1U5K A;  2WAC A;  3TS2 A;  4NW2 A;  3SK8 A;  1XPU A;  5ELC A;  3A7L A;  1G2T A;  4G7O C;  1EY9 A;  3J80 L;  4LFA Q;  3FMC A;  1A8V A;  4RGM A;  1EIY B;  2RDF A;  4LF9 Q;  4IFD H;  4R4O A;  4EVO A;  4IPC A;  2QW7 A;  1W3S A;  1RL2 A;  4X3K A;  2YTY A;  1XYI A;  4B3R L;  3VA5 A;  2TSS A;  3MXN A;  1B7Y B;  5FLX E;  5E1F A;  3ZJY C;  1X65 A;  5LMN L;  4RG1 A;  4YCW A;  4RA8 A;  2FIN B;  4ME5 A;  1N36 L;  4JYA Q;  1IBL Q;  2FHT A;  4JI8 Q;  4DR1 L;  3JAM E;  3K6O A;  3T56 B;  2G9H D;  1E3P A;  5CGK A;  1XNR Q;  2HQL A;  2C35 B;  1KTK A;  2NYZ D;  2R93 B;  3S15 H;  2CH4 W;  1QNK A;  2A5H A;  2K5W A;  2KHI A;  4HJ8 A;  3R93 A;  4OIJ A;  3NEM A;  5I6Y A;  3ER0 A;  2JA8 G;  5I9P A;  2NBF A;  2UU9 Q;  2B39 A;  2XNA C;  2HCI A;  4P73 A;  5CBA E;  3Q0A A;  3I4N G;  1KC8 C;  4CDF C;  1KDA A;  4MTN A;  5D3I B;  5C44 H;  3CQZ B;  5FOB B;  5IGB A;  4LFA L;  5IGG A;  2IPK D;  2KHJ A;  4K0K Q;  4HJA A;  2TMP A;  4A3K B;  1QZH A;  3S9W A;  3HOY B;  1E2V A;  4LF9 L;  3F2D A;  4XQN A;  4A93 H;  3RMH A;  3M4O H;  3HRZ C;  3S1R B;  3W1G A;  2E76 C;  1KLU D;  4K6D A;  2PNR C;  4HIK A;  1EFW A;  4A4I A;  1VQF A;  2VB3 X;  1A0I A;  4RAU C;  2HIV A;  1QVC A;  1Y69 U;  1HH2 P;  4KHP Q;  4DK6 C;  2K5V A;  2KOL A;  2RQX A;  3FP9 A;  4A3G G;  4BY7 B;  1BBW A;  2MUY A;  4JYA L;  2NVY H;  1IBL L;  4LUZ A;  3NSW A;  1SMY C;  1XNR L;  5GAD C;  4WJ3 M;  2AUK A;  1LTB D;  1RHP A;  1Q81 C;  3Q23 A;  2NZO A;  1GOZ A;  4DUY Q;  2IX1 A;  4YY3 Q;  4A3I H;  2LXJ A;  2VQF Q;  2L15 A;  1Q82 C;  2UU9 L;  3DUZ A;  1PFN A;  3M4P A;  1R4P B;  4K2K A;  1R4Q B;  3NWS A;  3J7A 5;  3OIP A;  4IUV A;  4JI4 Q;  3J81 c;  4P72 A;  4KN7 C;  4A3E G;  2CH4 A;  1BQQ T;  2OT2 A;  1PTO C;  3G4S A;  1YI2 A;  4XQJ A;  2LSS A;  4K0K L;  3NHH A;  4GKJ L;  3RLF A;  3NEN A;  2UXC Q;  2EY5 A;  3MXG A;  2KVM A;  3E3X A;  4R9W A;  1ASZ A;  2F0O A;  5G3L F;  3EFX D;  3I72 A;  1MJC A;  1E0B A;  2Q2H A;  3PIP A;  1GKH A;  3A74 A;  4HMI A;  3KLR A;  4DK3 C;  2L4N A;  4DAY A;  1PH4 A;  1RJT A;  2IX3 A;  1HRJ A;  1GD7 A;  3NWT A;  3QB3 A;  1KAW A;  4KHP L;  5LL6 S;  4JK1 C;  3W1B A;  2NWG A;  1N34 Q;  1WTH A;  5CV7 A;  4OL7 A;  1STE A;  1TWH H;  2JK8 A;  2R61 A;  2EOT A;  1AZP A;  5L37 A;  2OWO A;  1CKM A;  3CU7 A;  1DOL A;  1K3B C;  2ENB A;  3S14 H;  2DNE A;  4QF4 A;  2M9V A;  4K5X A;  2A19 A;  4DV6 Q;  4DUY L;  4YY3 L;  2JA5 H;  1HJP A;  2VQF L;  3S24 A;  5JAV A;  3CME A;  1EUJ A;  3RZD B;  4B08 A;  2ASB A;  1SFO H;  4JI4 L;  3CD6 A;  1H9K A;  3BVM A;  3RLN A;  1O7I A;  1HUN A;  1KHI A;  4G4K A;  1FYC A;  3J80 i;  2Z6K A;  1EZ6 A;  2V1C C;  1N9W A;  3OW7 A;  5M3M H;  1SRU A;  1PH6 A;  3U4Z A;  4XTC S;  5IYD G;  4LJZ C;  2KCC A;  3CCM A;  5IT9 E;  4GLV B;  4C2M H;  1NCV A;  2WV6 D;  2UXC L;  2F0T A;  1CM9 A;  1KAB A;  4X65 Q;  1TWF H;  1YVC A;  4TQU S;  2GA4 B;  1TR5 A;  2A8V A;  1GVP A;  2SNS A;  1BCP C;  2QDL A;  3EA6 A;  1UEB A;  4OGQ C;  1D5Z C;  4DV2 Q;  4ZKC B;  1BNZ A;  1LAC A;  3G6E A;  3EBE A;  3OOC A;  2D0P A;  4G7H C;  2WKC A;  2JA6 G;  5EKK A;  2XVS A;  1N34 L;  3EQL C;  2A69 C;  5TSS A;  1GUW A;  1D6E C;  2NB0 A;  4GN5 A;  4FXK C;  2D0O A;  4BY1 H;  1IKM A;  4RCN A;  4NP5 A;  2EJG C;  3FHW A;  5IP9 G;  4DAY B;  5M5W B;  1NE3 A;  1U0L A;  2B8F A;  1BBX C;  3H0G G;  1RIP A;  1XXG A; 
#chains in the Genus database with same CATH homology
 1AZQ A;  4BBS B;  2BA1 A;  2I46 A;  1I4Q A;  2B2W C;  2HDL A;  1XTC D;  5DAU A;  3G7L A;  2VUM B;  1V1P A;  2SDF A;  1W6K A;  4KD4 A;  3T13 A;  4DNT B;  1AW7 A;  3I91 A;  1MSH A;  1ILQ A;  1QJO A;  2WP8 J;  5EJW A;  5DM6 3;  2KHS A;  5C0X G;  5FKA C;  2N55 A;  5LHY 1;  1JOR A;  1UNS A;  3BYY B;  3MWY W;  1TS4 A;  4FF4 A;  1H9R A;  3GO5 A;  4KD3 A;  1B53 A;  1EY0 A;  3ND9 A;  3QOL A;  2O5I C;  2B2V C;  1KAA A;  5C4Z A;  2IT1 A;  1F9R A;  3GV6 A;  2IJ0 A;  3S1N B;  4CKC A;  1I4X A;  4KKS A;  4FYD A;  2NN6 I;  1FGB D;  1PMR A;  4BBR B;  5A2Q L;  1Q1E A;  3L3O C;  1S5F D;  4FXG C;  3GP7 A;  4FF3 A;  2QDB A;  3J7Y W;  3RD4 A;  1IHZ A;  2M00 A;  5CV6 A;  1VF7 A;  1BCP D;  3SDZ A;  2F0H A;  3KF8 A;  2HDM A;  5FLX L;  4LMQ D;  4C1N K;  2MGS A;  4C3J B;  4EQO A;  2QF7 A;  1I6V C;  1W6J A;  3T4A C;  2NVQ B;  2Z4I A;  1XWE A;  2K5Q A;  3JAM L;  4F87 A;  3WOE A;  1WTV A;  2EYF A;  2K33 A;  1SE2 A;  2K7V A;  2OXP A;  4RGO S;  1LT6 D;  2B2Y C;  1EY7 A;  3AB9 A;  5LL6 X;  2X6L A;  1ZYR C;  1DJR D;  1U9R A;  1AFP A;  4ID6 A;  4RFB A;  1SYC A;  5A35 A;  4ZYS A;  2QCP X;  4X3U A;  1EIH A;  2F0K A;  4C56 C;  5CV5 A;  3WDN A;  1Q3L A;  4FP5 D;  1MI2 A;  3A7A B;  1ENF A;  3PIO 3;  3M85 A;  2BOS A;  1EEF D;  4A3D B;  1LV9 A;  3HOU B;  4IFD G;  1K83 B;  3NBH A;  1SNQ A;  1G91 A;  1TWA B;  3QOJ A;  1SE4 A;  5KGU A;  1DON A;  2NTT A;  1PFB A;  2A68 D;  1I50 B;  1C8C A;  4H13 C;  4A3B B;  3N52 A;  4R8N A;  1UAP A;  1SJE D;  1TWG B;  4CKE A;  2E2H B;  2ZXR A;  2RSO A;  4IZ8 A;  4G7Z C;  2Z1C A;  3TZU A;  3SVM A;  3K58 A;  4FF1 A;  2F0I A;  5HUR A;  1M8A A;  4ZUI A;  2RSN A;  3BDL A;  5EGT A;  1F2Y A;  3NPP A;  4P2C B;  3NTH A;  1ENC A;  4RKB A;  3VA7 A;  1HHV A;  5FK9 C;  5IOD A;  5I2X A;  4K8I A;  2WB1 B;  5JEA H;  1EIG A;  2PO4 A;  5JJZ A;  1J9O A;  3A8J E;  5KIX A;  1S5E D;  4HAE A;  4PQX A;  5JPN C;  1WCM B;  4ODG A;  4QUF A;  1WD0 A;  1STG A;  1K8O A;  3C1F A;  1WD1 A;  3GTM B;  2NVT B;  1TQO A;  4RCO A;  4BS9 A;  4OO1 I;  1QWY A;  1EY8 A;  1ROD A;  2F0G A;  2L9H A;  5IT9 L;  3VR2 A;  1PRT C;  4PNY A;  3GTO B;  1TS3 A;  1HFG A;  4A3F B;  1YNN D;  1PTO F;  4Q0F A;  2YU9 B;  3H6M A;  5D14 A;  4ZUJ A;  1F2L A;  3H09 A;  3D31 A;  4RKL A;  3TZD A;  3J7A F;  1RTO A;  1JOK A;  2HQE A;  4WFN 3;  2B2W A;  4KK7 A;  3GTQ B;  2J7Z A;  1EL0 A;  3URY A;  3MA2 B;  1WTX A;  1PZJ D;  2X69 A;  3U9O A;  4OIK A;  5JVG 3;  1AP0 A;  4MN3 A;  4J6H A;  4HSV A;  5KND A;  2LS0 1;  3QWN A;  2XSC A;  2ZXP A;  3A8I E;  4U68 A;  3VR5 A;  2PW5 A;  3I3C A;  2SEB D;  2MP1 A;  5K36 G;  1B4O A;  3S15 B;  1Q1B A;  1PZI D;  4XXE A;  3W2D A;  2R7Z B;  1BXT A;  1S5D D;  4RGN A;  1STH A;  2JP1 A;  2XWJ B;  3SEB A;  3ERQ A;  3T53 B;  3P7J A;  4DAV A;  5C0X J;  1BCP B;  4XT3 B;  1HQM C;  3FVQ A;  3FPP A;  3DEO A;  3HOX B;  1WTQ A;  2ID0 A;  4H44 C;  4A93 B;  1PRT D;  1SSO A;  2NN6 H;  1CT1 D;  3QG1 A;  3ERO A;  4K2L A;  2QIL A;  1HTL D;  5M5Y B;  3MXP A;  4F88 A;  2OEO A;  1A3U A;  3A8K E;  2BDO A;  1TVX A;  2C5C A;  4KJO A;  1RKN A;  2Q8T A;  3NUC A;  1CQF A;  2KEE A;  1JE4 A;  2B2Y A;  1ONL A;  4XQQ A;  3I4L A;  4KI0 A;  3F2U A;  2H1E A;  3MAQ A;  2F03 A;  1EYA A;  4KHV A;  4C3I B;  1CTM A;  2FMM A;  1CI3 M;  2CW0 C;  4J1M A;  2EYL A;  2ZT9 C;  5C5L A;  1F9P A;  1EU4 A;  1T5X D;  1AN8 A;  3UI2 A;  1STA A;  4S3S A;  1TWH B;  1VMC A;  2XWB B;  1JB3 A;  2IW3 A;  2EPB A;  5NUC A;  3BYT B;  3S14 B;  1MD2 D;  4KKU A;  3MXU A;  1U4L A;  5COY A;  1EU3 A;  2KQ3 A;  3R2I A;  5C4J B;  5ELF A;  4IQZ A;  3T51 B;  2K5D A;  4K8J A;  4IAL A;  2PZW A;  3C1E A;  3X3M A;  4IFD J;  4NMZ A;  5EBC A;  1ENA A;  3K59 A;  4HMJ A;  1STY A;  1CHQ D;  2F0E A;  4C2M B;  1EQV A;  3CRK C;  3DM1 A;  3X3N A;  3NTK A;  1TWF B;  1SYD A;  3CRL C;  3K5L A;  4KY6 A;  2Q8I B;  2K32 A;  4FF2 A;  3FRP B;  1ESF A;  1O80 A;  4O1N A;  2A74 C;  4CJ1 B;  2JEB I;  1STB A;  5E3F A;  1SE3 A;  1EEI D;  5D65 A;  2F0J A;  3GTJ B;  3HG9 A;  3L7Z C;  3SK6 A;  5C0X I;  3G6J B;  1OXS C;  2CW0 D;  2I07 B;  3V96 A;  5K36 H;  2Z8L A;  4GZY C;  3R8B A;  3P75 A;  2AWO A;  2B2T C;  5EBD A;  4ZK9 B;  1EFI D;  2JA8 B;  3GTP B;  1V43 A;  2H4O A;  3K7A B;  4HSP A;  2F3V A;  3I4N B;  3V05 A;  3VR6 A;  3OWE B;  5KYI A;  1X3Q A;  3O13 A;  1IYU A;  2A6E C;  4Z9C B;  1D5X C;  4RHR A;  1B9M A;  1XX8 A;  1DXM A;  1Y8O B;  5ISR A;  3D4D A;  1SND A;  4A3G B;  2JYO A;  1Q8I A;  1H9J A;  1B44 D;  2V4D A;  2QKI C;  5C3X A;  5K5P A;  1U4R A;  1G6Z A;  3OHX C;  1PXU A;  4JBW A;  2D62 A;  3GTL B;  2BDN A;  2WII B;  4M1U B;  2L55 A;  4BA2 I;  1WTR A;  4C3H B;  5JEA G;  3C2P A;  4HR7 B;  4WRD A;  4A3E B;  3DXJ C;  5JPM C;  3ITP A;  3OWF A;  1J8I A;  3VYR A;  2KEC A;  1I4H A;  2IL8 A;  1R9T B;  1TWC B;  2HUG A;  1HTP A;  5I4D A;  2B2U C;  4B9W A;  2EVB A;  4ZAI A;  4MIU A;  4XIG S;  4LK1 C;  1HXY D;  1HPC A;  3BDO A;  1SNP A;  2A73 B;  5CV8 A;  4DF7 A;  1PRT B;  5EKL A;  3S16 B;  3GTG B;  1ET6 A;  2L11 A;  1H9S B;  1LTG D;  1IW7 C;  2J0T D;  4IFD I;  1TU2 B;  1PRT F;  1MBY A;  4KTA A;  2A68 C;  1O7Z A;  3PUW A;  5CR3 A;  2O5J C;  2A6E D;  3D3R A;  5KRU A;  1EY6 A;  3IKJ A;  4KV6 A;  3J80 E;  1O78 A;  1UUP A;  3PUX A;  1B50 A;  1B1Z A;  4TRD A;  4RGT A;  5E4X A;  4FVM A;  1TS5 A;  2PPB C;  4XYO A;  3DEP A;  4C1N I;  2EYP A;  1RDP D;  5C4H A;  1O7Y A;  4ILW A;  1ILP A;  4HCE A;  4MHE A;  5ELE A;  4DXF A;  1QNU A;  3FPU B;  1PLF A;  2CHB D;  3S1M B;  2AUJ D;  5BN5 A;  2FFK B;  1NR2 A;  1PZK D;  2O4X A;  3KK7 A;  2JA6 B;  2G9D A;  2VNU D;  5I6W A;  3HGB A;  3HEJ A;  2K28 A;  5IGD A;  1GUS A;  3S2H B;  1KNE A;  1NR4 A;  3H0G B;  2X6G A;  3I90 A;  4L6T B;  2RBM A;  2EY1 A;  3K5O A;  2L0C A;  1JWU D;  2F0Q A;  3MFY A;  3BVZ A;  3FKI B;  4KY7 A;  3OPO A;  1LTI D;  1I4P A;  1DYQ A;  2PYK A;  3E0J A;  1K8M A;  1BR9 A;  1GJX A;  1Y8P B;  1A2T A;  1PFM A;  2ICE C;  5BN4 A;  4IUR A;  1IW7 D;  2NN6 G;  4IN3 A;  3NBI A;  1O7L A;  4X3S A;  2MHV A;  1SYF A;  1LLR D;  3Q22 A;  3VYS A;  4XT1 B;  1YNN C;  3H94 A;  1YNJ D;  4KMU C;  3HOV B;  3PUZ A;  3D4W A;  2MJ8 A;  1ML0 D;  3MVV A;  3D6W A;  2AWN A;  3OMG A;  2NVX B;  1E2Z A;  1A3V A;  3BDC A;  3SE0 A;  3TME A;  3IL8 A;  2JEA I;  2XIW A;  3D6C A;  3C3L A;  3MTS A;  4FXD A;  5G3L D;  3LX0 A;  1KLG D;  1CQV A;  2F4I A;  3HKZ B;  4K5W A;  5IIF A;  2F0N A;  2FJ2 A;  2B2T A;  2SNM A;  3IAY A;  1CK1 A;  4ULL A;  4DXG A;  3NE5 B;  1GUT A;  1TY0 A;  4NDX A;  1BO0 A;  1TS2 A;  1LTR D;  4IUQ A;  3E6Z X;  3ND8 A;  1WVL A;  2EYO A;  3LWE A;  1PDQ A;  4CJ0 B;  2EJM A;  4I7Z C;  1HA5 A;  1NAP A;  2RVL A;  1A3T A;  2R3Z A;  2LKV A;  3P1H A;  5HGT A;  4Q5V A;  4H7B A;  2EY6 A;  4F7X A;  4ZLT F;  3A56 A;  1JOO A;  2K01 A;  1TY2 A;  4XDX A;  5BN3 A;  2Q8R E;  4G57 A;  3H3V C;  2O2L D;  4UAI A;  2FMC A;  4TSS A;  3TSS A;  1B9N A;  5D3D A;  2LFN A;  2DNC A;  1JC7 A;  2KUM A;  1DOM A;  5T1G A;  2B2U A;  5C6A A;  1II3 A;  3BZD B;  3A54 A;  5C5M A;  5J22 A;  3EJI A;  2YYZ A;  1JIC A;  1ZXT A;  2B2V A;  2CQA A;  1LAB A;  2F0V A;  3OMC A;  5JEA J;  1JQY D;  4A3M B;  3TBI B;  2EY2 A;  1U4M A;  1F2M A;  3D4R A;  3TDQ A;  1B2T A;  2AQ1 B;  2XRQ D;  1PTO H;  5C44 B;  3E5S A;  1DZ1 A;  5AFW A;  1EWH A;  1F77 A;  3M4O B;  1X3P A;  1BCP F;  4PMB A;  1EY4 A;  4K6L A;  2K1B A;  4V0B A;  5M3F B;  3PUV A;  2F1M A;  3C46 A;  3R3O A;  1OO9 B;  5C4X B;  3HP3 A;  4L8J A;  2PQE A;  3HOZ B;  4WOR A;  1JR0 D;  3MZ5 A;  1F9S A;  2NVY B;  2RDH A;  2F3W A;  2F0D A;  1ZKO A;  1A2U A;  1BOS A;  1JWM D;  3NK9 A;  3IFD A;  3DWA A;  2EYH A;  4A3I B;  2KCN A;  1B3A A;  1GUO A;  4I65 A;  5IGC A;  4N9P A;  1UEA B;  1SEB D;  5EQ0 A;  5FO7 B;  1LTA D;  1TT2 A;  2L5T A;  2K03 A;  2K04 A;  4RWS C;  5F2D A;  1S5C D;  2E75 C;  1OXT A;  2IX0 A;  4CBV A;  1SJH D;  2DY8 A;  3Q6S A;  1SAP A;  1EYC A;  1SYB A;  1BUV T;  3AU7 A;  1FNV A;  3FEW X;  1SNC A;  3A55 A;  4NKL A;  1D1I A;  2N88 A;  1U4P A;  5ELD A;  1FNU A;  1G29 1;  5J39 A;  1FR3 A;  1QG7 A;  1SYG A;  1ET9 A;  3WOF A;  2JA5 B;  4WJW A;  5EPJ A;  2Y0S B;  1D1K A;  1SFO B;  5JOB A;  1VMP A;  3NXW A;  1HCZ A;  3NTI A;  2WAQ B;  5M3M B;  1SDF A;  1IYV A;  3KBX A;  2JE6 I;  3VR4 A;  5IGE A;  4Y7N B;  3BS1 A;  2F0W A;  4EGV A;  2NUC A;  4C3H G;  2E74 C;  4QCL A;  4YIJ A;  3HS0 C;  3M7G A;  1QE6 A;  3CHB D;  1E2W A;  4O42 A;  3KLS X;  3GV3 A;  4PMC A;  5KYL A;  3SK5 A;  1Z6H A;  1V8Q A;  3T16 A;  1GXD C;  1CA5 A;  1Y8N B;  4BY1 B;  1BDO A;  2EJF C;  3SK4 A;  3FDT A;  2C9O A;  1Z47 A;  4DK0 A;  4EQP A;  3ONA B;  3SR1 A;  1LT3 D;  4CJ2 C;  1OXX K;  2B8G A;  1EY5 A;  1LT4 D;  2F0M A;  5J1Z A;  2D9U A;  2BA0 A;  4DAP A;  3SXH A;  1CZG A;  1LTT D;  3OIQ A;  4AYB B;  2JA7 B;  1CHP D;  2R92 B;  4QIW B;  3K5M A;  1Y1W B;  3DWP A;  4FO2 A;  1H9S A;  2ZXO A;  3H91 A;  2PCF B;  2F0U A;  4C3J G;  3DWQ A;  2J4X A;  4OO1 H;  1IKL A;  1JWS D;  2SOB A;  2F0P A;  1ZEQ X;  1HFN A;  2EYM A;  1GHJ A;  1SMY D;  4ZKB B;  3QO2 A;  1RD9 D;  1CA6 A;  4XYQ A;  1Q90 A;  4HCS A;  1D5M C;  1Q12 A;  1EQT A;  3R2T A;  2PMZ B;  4DK1 A;  3KUP A;  2L1B A;  1FNW A;  5ELB A;  4RH6 A;  1C48 A;  2PW7 A;  1OXU A;  5CYU A;  5FO8 B;  3J81 E;  4QMG A;  1PTO D;  1IL8 A;  4BWG B;  3M3Y B;  1D2B A;  1V1O A;  1CZW A;  4IUP A;  3S2D B;  3PO2 B;  2RDG A;  4J8Q A;  1JOQ A;  4DFA A;  2K05 A;  3M7N A;  1RTN A;  1X32 A;  3PV0 A;  4L63 B;  3KBG A;  3U9S A;  1H9M A;  3PUY A;  1L0X B;  3EVQ A;  3QIA A;  3ZYY X;  3LWU A;  1CFM A;  5M5X B;  1GUN A;  1GHK A;  2IWH A;  1RCV D;  3S17 B;  2VB2 X;  2E2D C;  2D2C C;  4QUC A;  3NP8 A;  1Z7T A;  1DD2 A;  1KNA A;  5I2Y A;  1S5B D;  2RA4 A;  4B9X A;  1G8Z D;  2AQ2 B;  1QB5 D;  1NUC A;  1YNJ C;  2DN8 A;  5FO9 B;  1ICW A;  2JSO A;  1S4Z A;  1G2S A;  4N9T A;  2BE5 C;  2A69 D;  4K14 A;  1JCK B;  3GTK B;  1HUM A;  3D8G A;  3VYT A;  3RUZ A;  5C3W A;  1QCB D;  2RKS A;  4CKB A;  1FD7 D;  4U67 3;  3W3A A;  4PMW A;  1V1P B;  5I9O A;  3AMU A;  3VYU A;  5EPL A;  1TII D;  2Z4H A;  2VXW A;  4IUN A;  4KY5 A;  1OXV A;  5CV9 A;  3PIP 3;  3TP6 A;  1WTW A;  1I6H B;  1MGS A;  4FNF A;  2WIN B;  2A6H C;  2KED A;  3I4M B;  5EPK A;  1VDZ A;  4TKO B;  1NSN S;  2LMC B;  2F0F A;  3TN2 A;  2E2J B;  5C3E B;  4R8I A;  5CV4 A;  2KJX A;  2WKD A;  3CKI B;  1HA6 A;  2L12 A;  4CHT B;  1SNO A;  1VF5 C;  2EXZ A;  2NZ1 D;  4E6I A;  4ZRZ A;  4H0L C;  1EZ8 A;  2HCC A;  3GD7 A;  3MC0 B;  3J7A V;  4UDU C;  3S1Q B;  1SXT A;  5T1I A;  5KNB A;  3VR3 A;  2PZT A;  4K5V A;  4BA1 I;  1T5E A;  4KKT A;  4HED A;  1AEX A;  2K6A A;  1DCZ A;  2MPM A;  3MFG A;  2EYJ A;  5KNC A;  1GUG A;  4DU9 A;  1SYE A;  2B63 B;  1I3Q B;  4PV1 C;  4IUT A;  4EQN A;  3I8Z A;  2BE5 D;  3TP8 A;  1F2Z A;  3GQB A;  4KJN A;  1LTS D;  2OF1 A;  5E4W C;  3Q24 A;  1EYD A;  5M9O A;  3M4Y A;  1LO5 D;  2NTS A;  3DHQ A;  4F8M A;  2E2I B;  3LNN A;  1SNM A;  1SBB B;  1QOH A;  5CMD A;  1EOT A;  1ESR A;  1F9Q A;  1WTO A;  5COR A;  5KEE A;  1ZYR D;  2A6H D;  4DN4 M;  3OSO A;  4ZQ3 A;  1Y1V B;  3K5N A;  3NQI A;  1DM0 B;  1WTP A;  5C0X H;  2EZV A;  4V19 0;  4HTH A;  1L0Y B;  1KDB A;  3SHL A;  4QB4 A;  3K57 A;  4M8A A;  5CBE E;  2AQ3 B;  1A6X A;  1M4V A;  2M2L A;  3HOW B;  4OHJ A;  3BG3 A;  3MHB A;  2XRS D;  1STN A;  5CC4 A;  5IOC A;  5DM7 3;  4X3T A;  5EKI A;  4RHS A;  3PMF A;  4LAA A;  4DGZ A;  2DY7 A;  1PTO B;  1I4G A;  1TKW B;  3RZO B;  2ICI A;  1VCI A;  4KHZ A;  3NQT A;  2F0L A;  4IUU A;  3IFT A;  1BF4 A;  3P20 A;  1KDC A;  4C3I G;  3L9A X;  3KLS A;  3V2T A;  1C4Q A;  4DA2 A;  3J81 L;  3DMU A;  2BCO A;  1A15 A;  3QJY A;  3TP5 A;  4CGY B;  1LT5 D;  4KN4 C;  3N6R A;  1DOK A;  2R6G A;  1RF2 D;  2CVR A;  2F0S A;  3PO3 B;  3TP7 A;  5DNF A;  2LY7 A;  2D5D A;  4ABN A;  5JVH 3;  2EE1 A;  2KA7 A;  2PZU A;  1PYW D;  5DEH A;  3K0Y A;  3MEH A;  1MSG A;  4DNR B;  2JXM B;  3I70 A;  5IGF A;  3HZX A;  3I73 A;  2QEJ C;  1QIL A;  4A3J B;  3BVG A;  2EDG A;  1HQR D;  4OO1 G;  2XN9 C;  1I4R A;  1EWC A;  5A2Q E;  2WAC A;  4NW2 A;  3SK8 A;  5ELC A;  3A7L A;  1G2T A;  4G7O C;  1EY9 A;  3J80 L;  3FMC A;  4RGM A;  2RDF A;  4IFD H;  4EVO A;  1XYI A;  4X3K A;  3VA5 A;  2TSS A;  3MXN A;  5FLX E;  5E1F A;  4RA8 A;  2FIN B;  4ME5 A;  2FHT A;  3JAM E;  3K6O A;  3T56 B;  2G9H D;  5CGK A;  1KTK A;  2NYZ D;  2R93 B;  1QNK A;  2A5H A;  2K5W A;  3R93 A;  4OIJ A;  5I6Y A;  5I9P A;  2NBF A;  2B39 A;  2XNA C;  2HCI A;  5CBA E;  3Q0A A;  1KDA A;  5D3I B;  3CQZ B;  5FOB B;  5IGB A;  5IGG A;  2IPK D;  2TMP A;  4A3K B;  3S9W A;  3HOY B;  1E2V A;  4XQN A;  3RMH A;  3HRZ C;  3S1R B;  2E76 C;  1KLU D;  4K6D A;  2PNR C;  2VB3 X;  4RAU C;  1Y69 U;  2KOL A;  2RQX A;  4BY7 B;  2MUY A;  3NSW A;  1SMY C;  2AUK A;  1LTB D;  1RHP A;  3Q23 A;  1GOZ A;  2IX1 A;  3DUZ A;  1PFN A;  1R4P B;  4K2K A;  1R4Q B;  3NWS A;  3OIP A;  4IUV A;  4KN7 C;  1BQQ T;  2OT2 A;  1PTO C;  4XQJ A;  3NHH A;  3RLF A;  2EY5 A;  3MXG A;  2KVM A;  4R9W A;  2F0O A;  5G3L F;  3EFX D;  3I72 A;  1E0B A;  4HMI A;  3KLR A;  2L4N A;  4DAY A;  1RJT A;  2IX3 A;  1HRJ A;  3NWT A;  3QB3 A;  5LL6 S;  4JK1 C;  2NWG A;  5CV7 A;  4OL7 A;  1STE A;  2R61 A;  2EOT A;  1AZP A;  1DOL A;  2ENB A;  3CU7 A;  2DNE A;  4QF4 A;  2M9V A;  4K5X A;  5JAV A;  3RZD B;  4B08 A;  1H9K A;  3BVM A;  1HUN A;  4G4K A;  1FYC A;  1EZ6 A;  3OW7 A;  4XTC S;  4LJZ C;  2KCC A;  5IT9 E;  1NCV A;  2WV6 D;  2F0T A;  1CM9 A;  1KAB A;  4TQU S;  2GA4 B;  1TR5 A;  2SNS A;  1BCP C;  3EA6 A;  4OGQ C;  1D5Z C;  4ZKC B;  1BNZ A;  1LAC A;  3OOC A;  4G7H C;  2WKC A;  5EKK A;  2XVS A;  1GUW A;  5TSS A;  2A69 C;  3EQL C;  1D6E C;  2NB0 A;  4FXK C;  1IKM A;  4RCN A;  4NP5 A;  2EJG C;  5M5W B;  2B8F A;  1BBX C;  4HN7 A;  1XXG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...