2RSOA

Solution structure of the chromodomain of swi6
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
92
structure length
92
Chain Sequence
GSHMESKSSSKKLKENAKEEEGGEEEEEDEYVVEKVLKHRMARKGGGYEYLLKWEGYDDPSDNTWSSEADCSGCKQLIEAYWNEHGGRPEPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Intrinsic nucleic Acid-binding activity of chp1 chromodomain is required for heterochromatic gene silencing
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Transcription
molecule keywords Chromatin-associated protein swi6
total genus 7
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2012-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2rsoA00
1DONA 2RSOA 2JP1A 1NR2A 4X3UA 4ZLTF 1EOTA 2H1EA 1DOLA 2KUMA 1VMPA 1WTQA 2DY7A 1CA5A 4IUPA 4R9WA 1SDFA 1ILQA 2NWGA 2B2VC 1C8CA 1JE4A 2FHTA 3IFDA 2B2YC 2K1BA 1KNAA 1B2TA 1IKMA 2B2UC 1KNEA 1IKLA 5D65A 5EPJA 4DN4M 1AZQA 1MSGA 2L11A 1RHPA 2MJ8A 3FPUB 3MWYW 1QE6A 1PFBA 2KEEA 1O7ZA 4MN3A 1DOKA 2K28A 4OIJA 1B50A 5COYA 2X6GA 1ML0D 5T1IA 1PFNA 4ZKCB 2HUGA 1U4RA 4HAEA 5AFWA 2CVRA 2X6LA 3DM1A 4X3SA 1WTOA 2EPBA 1MI2A 1G2TA 1WTXA 4CJ2C 3TZDA 2FJ2A 5E4WC 5E4XA 2KECA 4ZK9B 2B2YA 3UI2A 2N88A 1MSHA 4U68A 4MHEA 4XT3B 1WD1A 3I91A 1TVXA 4IUQA 2HDLA 1U4PA 2L9HA 2HCCA 2RVLA 5JJZA 4R8IA 1RTOA 2Q8TA 5T1GA 1B53A 1MGSA 1QNKA 4IURA 3QO2A 2B2TA 3R93A 1F2LA 3N52A 2K01A 2K03A 2NZ1D 4IUUA 5DNFA 2MPMA 3IL8A 2FINB 3LWEA 4UAIA 1PLFA 2HDMA 1HRJA 4RAUC 2K05A 1WTVA 1F9QA 2BDNA 1X3QA 2EOTA 2VXWA 3GV3A 3Q6SA 4OIKA 1RTNA 1LV9A 2D9UA 1WD0A 2FFKB 1WTWA 1HUMA 2JYOA 5EPKA 1BF4A 1B4OA 1DOMA 2B2UA 1AZPA 1O80A 2X69A 1CM9A 3KBXA 2RSNA 1AP0A 1XX8A 2SDFA 1SSOA 4QUFA 5EKIA 2L12A 2KEDA 1S4ZA 2L4NA 5CORA 1NR4A 4CJ0B 4HEDA 1Q3LA 1O7YA 4HSVA 3DEOA 1BBXC 1GUWA 1G6ZA 2MP1A 2B2WC 1ICWA 1HA6A 4X3KA 4IUTA 1ESRA 2B2VA 2XIWA 1A15A 3GV6A 3FDTA 3MTSA 4LMQD 4XT1B 3I8ZA 3P7JA 1PFMA 1F9SA 1ZXTA 2R3ZA 4RWSC 5EQ0A 4RA8A 1EQTA 1RJTA 1U4LA 1WTRA 1DZ1A 3H91A 4HCSA 1RODA 2K04A 1HHVA 1IL8A 2FMMA 3ONAB 5CBAE 3I3CA 1QG7A 2B2TC 1BO0A 2B2WA 2DY8A 2IL8A 1X3PA 2M2LA 2Q8RE 1B3AA 2N55A 2NYZD 2RA4A 3DEPA 4QUCA 3TN2A 1VMCA 5CBEE 1NCVA 5CMDA 1BNZA 1ILPA 3D6WA 2KOLA 2KVMA 1NAPA 5D14A 2J7ZA 4ZAIA 1HFNA 2MGSA 1EL0A 1F9PA 1G2SA 1EIHA 1X32A 2L1BA 3G7LA 3KUPA 3F2UA 1J9OA 1CA6A 1J8IA 4O42A 5EPLA 1PDQA 1WTPA 4IUVA 3HP3A 4NW2A 1HFGA 1U4MA 3I90A 1EIGA 1JICA 4ZKBB 1G91A 4X3TA 1M8AA 3SVMA 2HCIA 4CJ1B 1HUNA 1F9RA 4XDXA 5EJWA 1XYIA 1E0BA 1SAPA 1WVLA 2EE1A
chains in the Genus database with same CATH superfamily
3C46A 3CAMA 1IBKQ 4X3UA 1B44D 1K0RA 4R4QA 2PPBC 3HOYB 5C4XB 4IUPA 3RLFA 3S17H 1RD9D 3B6YA 1K83B 1VS0A 4KY5A 2C35B 2GVBA 3FPPA 4YWLA 4C3JG 3I4MB 3GTQH 2DN8A 3QOLA 2KHIA 3PQIA 3Q24A 3PO3B 3FPUB 2RBMA 4FF4A 4NXMQ 1HJPA 4KI0A 5T1IA 1ASZA 3CF5A 4LFCQ 3URYA 2F0OA 4APVA 4C1NI 3DM1A 3M7NA 2NTTA 4LF4L 4B08A 2BA1A 2JE6I 3WWVA 1VQ7A 2B39A 3D4RA 4CJ2C 3A8JE 2XRSD 2JA7G 4KY6A 4DR4Q 4A3GH 3A7LA 4M8AA 3UI2A 1Y1VG 3GQBA 2L5TA 4IUQA 4UY8C 4R8IA 3NEMA 2FXQA 4KHVA 3PCOB 3S15B 2B2TA 3D4WA 3HOWH 5M3MB 3STBC 4DA2A 2ZTDA 1G291 4RMFA 3J81i 5CV6A 1PLFA 4KJOA 2NVYH 3N6RA 3M3YH 5IGDA 4QGUA 2K05A 3V96A 4HN7A 3H15A 4OIKA 3SK8A 4P74A 4JI1Q 4DV7Q 4A4IA 4HJ8A 1IYVA 3A5UA 3KBXA 3ULPA 1GUSA 4A3FH 2MQHA 1F2ZA 3I4NB 1OO9B 3MC0B 1PH1A 3AEVA 3SXHA 4BBSG 1LTGD 3GV6A 4F87A 4LF7L 1PFMA 4KD3A 3J7AF 4POFA 4OGQC 1Q46A 4LFBL 1EY0A 4QIWE 3EQLC 1RODA 3TQYA 4FDBA 1I50B 2B2WA 4IPDA 2DY8A 2Q8RE 1W2BA 3IFTA 3TEHB 3MEFA 1ICFB 3BDCA 4MZ9A 1XJVA 2K52A 4PNYA 1VQEA 3CRKC 2J4XA 2Q2TA 5JOBA 1EL0A 3H0GG 4A3GB 2UU9Q 1OXSC 3U9OA 1J9OA 2F0GA 2KQ3A 2UXBQ 1SYDA 4DR6Q 1EY6A 3NWTA 1XYIA 2BCOA 1HXYD 2F0LA 5ELDA 3NK9A 1VCIA 1NR2A 3MFGA 3K57A 2ENBA 2N78A 3C2PA 1M1KC 1JOOA 1B3QA 1I5FA 4G7OC 1TWAH 2F0FA 3J81c 5ELNA 4P71A 3KBGA 4C3JB 5CV7A 4ZUJA 1I4HA 2CWPA 4LFAQ 4A3DG 1CSPA 3R2IA 3K5NA 4L6TB 3BVMA 5JPMC 2NVYB 1YJNA 2WIIB 2IX1A 3W1GA 2PZUA 3KOJA 1WTXA 2NTSA 5E4WC 1SMXA 4EX5A 2KECA 5DM63 2VUMG 1C48A 3NPPA 4GKKQ 3F1ZA 1TVXA 2RVLA 2VQEQ 3FKIB 4QCLA 5FLMG 5IWAQ 4HJAA 2TMPA 2KBNA 1SN8A 3G71A 1LTSD 2PI2E 3F2CA 2HDMA 4OO1G 2A6HD 4AYBB 3T13A 3GTJB 3BZCA 2F4VL 4OO1I 3HOWG 1KAWA 4KLKA 2D9UA 1EY4A 3SK5A 2JYOA 3CCUA 2B2UA 1AZPA 3BDLA 1K73C 2N3SA 1QZHA 3D0FA 2RCFA 1PZJD 1CZWA 5FOBB 3OIPA 2EYLA 4B9WA 4L63B 4UPAA 1BVSA 3AYHB 3HGBA 1V1PA 2KCCA 5A35A 1K8OA 1PV4A 2SNMA 4YCUA 1JWUD 3I7FA 2CW0D 2EJFC 4HCSA 2K04A 4UP7A 1PH3A 3KLSA 1N32Q 1V1QA 1JJCB 2F0HA 1S5FD 1S5DD 4X65L 2NBFA 4DV2Q 3HEJA 2RDFA 3ULLA 1X9NA 3T1HQ 5ELFA 2ZT9C 1VQ9A 2IX0A 4PG3A 4O2DA 3ER0A 3KF6B 2JA6G 3CD6A 2AHOB 4NPSA 4JI0L 1STGA 2H4OA 1DONA 1TY0A 2GN5A 1YBYA 1ILQA 2NWGA 3PO2B 2C5CA 1JE4A 3TDQA 1T5XD 4KKSA 4IALA 1PH6A 4X64Q 1H9MA 4DU9A 4E6IA 3RMHA 4WORA 1B50A 5COYA 3GTLB 1IW7C 1XMOL 4JYAQ 3J80i 3PUYA 2A1AA 1EWIA 4X3SA 5KYIA 1LTBD 4RGNA 1J6QA 3NBHB 4MHEA 3RLOA 4DV0L 1I94L 1GKHA 2D62A 2PMZB 1UUPA 3TS2A 1IZ6A 3PO2H 1KRSA 3BJUA 5CR3A 1S5CD 2K01A 4FVMA 5BR8Q 1QUQB 3ULJA 1EY7A 4FXKC 4I7AA 3KLRA 4GLVB 3UE0A 1Q86C 2UUCL 4BBRH 4A3BB 4DR3L 2K7VA 1EY8A 5FJ8H 4A93H 1DXMA 1X65A 1AP0A 2SDFA 5KIXA 5EKIA 2E2IH 2J0TD 1QCBD 1K8AC 1GVPA 2PI2A 4L8JA 1XTDA 4A3MG 5I9PA 3T51B 4A93B 4NXML 3OW7A 1KLUD 1B9MA 1QVGA 4BBRB 4FP5D 4L5TA 2A69D 2R3ZA 1EQTA 1B70B 1GUOA 4C3HG 1JJ2A 1ZYRD 3S9WA 1BO0A 2NYZD 3W2DA 2F0KA 2F0JA 4C3IH 3I4MH 3E3XA 1NAPA 4R4CA 3MEHA 4GN4B 2AKWB 2RHSB 2EYPA 4O0AA 2ZJPA 2DJGC 1A62A 5DM73 4FF1A 1WTPA 4BXXH 1WYDA 4X3TA 1M8AA 4IFDH 3GTJH 3F2DA 2EE1A 2RSOA 4ZCKA 5J1ZA 5EBCA 4JOIC 4K0KQ 3K6OA 3GTKH 5K36H 4IJHA 1XPUA 3CMAA 1VQ8A 4UHVA 3OOCA 1D5XC 2K5QA 2B2UC 1S40A 2VW9A 2F0WA 2MJ8A 2E2JH 1QE6A 2OQ0A 4A3BH 1D8LA 1SJHD 2BH2A 1PRTB 5C4ZA 2O5IC 5IOCA 1F77A 5M3FG 1UE6A 3M3YB 4IN3A 2K5DA 5L37A 1EIYB 3HFZB 1NNXA 3J7AV 2E2JB 2ATWA 2WV6D 1QVFA 3E9HA 3HS0C 3NE5B 1ESFA 1EY9A 2PYKA 2F03A 2HDLA 4GKKL 2VNUD 2HCCA 4IPHA 4QF4A 2JA5B 4DK6C 2UUAL 2RQXA 4C3IG 1XPOA 4XYOA 4RFBA 1RL2A 4AH6A 1PXUA 2UUBQ 2MPMA 2EY6A 1F2YA 3LWEA 4P75A 4UAIA 4FXDA 4C3HH 4QL5A 4RAUC 2Q2HA 1HR0Q 4MNOA 3EA6A 1WTWA 4G7HC 4BY1H 2NVXB 1CM9A 3K8AA 1LUZA 4KMUC 5CORA 2KEDA 2L4NA 1CKNA 3K0YA 4Y7NB 3JAMc 2MP1A 2OT2A 1OXTA 5BN5A 5M5YH 1JOKA 4IUTA 2K32A 4ME5A 2F0TA 4K6DA 3SE0A 2F0SA 1Q12A 1TT2A 1LT5D 3PV0A 4RA8A 1U4LA 2CHBD 1DZ1A 4X66L 3MXPA 2F3WA 4XTCS 5JAVA 1LT6D 4JBJA 2QDLA 2XRQD 5IT9c 2B2TC 1STYA 4QUCA 5JJLA 4EQPA 1JORA 2XWJB 1I4RA 1LTRD 1HFNA 1VQMA 2QEJC 3FKIG 4WRDA 2KJXA 2XSCA 4MTNA 3ZJYC 3CCQA 1A0IA 1AE2A 4HCEA 1G91A 2Z6KA 3SVMA 4CJ1B 3CCSA 4H13C 4DK3C 4DUZQ 5J22A 2NUCA 1EEID 2K1BA 1KHIA 4GOPB 3TP5A 1KTKA 1K9MC 1C8CA 5CV8A 5KNCA 1N33Q 1G6PA 4ZUIA 2DJFC 5M5WH 3OTOQ 4RHRA 3OMGA 4DN4M 3RR5A 1Q1EA 3NUCA 1XMQQ 2ICEC 4DV7L 4N9TA 1DOKA 3X3MA 1GM5A 1F2MA 3CHBD 3NENA 3JAME 2CKZB 2Z9HA 5ELCA 3I2ZA 2HQEA 4JI3L 3TZDA 5C5MA 4H44C 1EU4A 3CPWA 3W3AA 1TS3A 4O1NA 2JA5G 1D5MC 2DNCA 3PO3H 2WINB 1TWCH 3NBIA 3E9IA 1N32L 4UP9A 1MBYA 2CFMA 1SYBA 2RCNA 4GN3B 4JI8Q 3K0XA 3F8TA 1GXDC 3S1NH 4OO1H 1Y8OB 3TP7A 3T16A 1HRJA 1Q81C 3PF5A 5CV5A 3V2TA 1SYCA 5C3EG 1AN8A 3GDEA 1WD0A 1D7QA 4JBWA 1SE2A 1SYGA 1II3A 1SROA 1QVCA 3NQTA 3LWUA 3ZYYX 1EU3A 1Z9FA 1HNZL 4Z9CB 3DEOA 2RF4A 1GUWA 2EXZA 1XNQL 1WCMB 1TS4A 1SFOB 4YCVA 1VQCA 1I3QH 4DV5Q 2CWAA 4LMQD 1YNXA 5H1SE 1AE3A 2WAQB 5C6AA 3EBEA 3BYTB 2CCZA 1RJTA 1PRTF 2UUCQ 4TVAB 2A5HA 2ZXRA 2Q8IB 1CKMA 5C0XG 1DCZA 2IHEA 2N55A 5KEEA 4L5SA 2JA5H 1QILA 2KHSA 3MXNB 4PZ6A 3L0OA 4HJ9A 2NZHA 3L3OC 4RCOA 3SK4A 4GZYC 2R93G 2RKSA 1VDZA 3AU7A 3WOEA 2JA6B 1SYFA 2HCIA 4K2LA 4FXGC 5KYLA 5ISRA 3KF6A 3LX0A 3KF8A 2JP1A 1IXRA 1WCMH 3R3OA 2CQOA 4R9WA 1YJWA 2XTIA 3H3VH 2WB1E 2OCEA 5AJ3L 1PTOH 3CQZB 3VYTA 1N36L 5IT9L 3BVZA 1AZQA 2XGTA 1MSGA 5IT9E 5ELEA 4K5XA 1Q82C 1PFNA 2PNRC 5I2YA 1YHAA 5EKLA 1Q8IA 2F0DA 5GAGC 3J80L 5FLMH 1JB3A 1OXUA 3CMEA 2ES2A 2EY2A 1TXYA 1U4PA 5JJZA 1KD1C 3A56A 5EBDA 3UDGA 3PMFA 3BS1A 2JQOA 2IT1A 5KNBA 2JN4A 3CXCA 4LFBQ 4KY7A 1D6EC 4K2KA 4PV1C 1X54A 3WDNA 5M3FH 1VQHA 4PQXA 4LF7Q 5HGQA 2B63B 1SNPA 4OHJA 4HSPA 1H95A 3T4AC 4JI7Q 5A2QL 1L0WA 1O80A 2XN9C 1HTLD 4Q5VA 5LL6X 1GJXA 1SE8A 1SSOA 4WJ4A 2A8VA 1W6KA 3PUZA 3HRZC 1Y1VH 4PMBA 3S1QB 4CHTB 3I4NG 2NVQB 2B2VA 4K0KL 3HOUH 1BCPB 3QIAA 1FNUA 5KGUA 2NVTB 4K14A 4JI6L 2O2LD 4CBVA 2HIXA 1KDBA 3QR8A 2F4VQ 3PIP3 4LJZC 4A3IG 1LO5D 2IL8A 2JEBI 1PVOA 2A6HC 3IRBA 3J81j 2NN6G 4G57A 1HPCA 1A3UA 4BA1I 2OQKA 2Z1CA 4J6HA 3D6WA 1VQDA 2IWHA 2VQEL 5IYBG 1EUJA 1HZCA 3PUWA 1RKNA 1G2SA 2AWOA 1VQNA 2DUDA 3J7ZC 1Q90A 2K33A 2OXPA 3HP3A 3S2DH 4GNXA 2Q2UA 3TP6A 2XNAC 3MFYA 4ABNA 3SEBA 4DR7L 1WVLA 2BH8A 1VQJA 4ID6A 1SR3A 3CC7A 1O7LA 4ZLTF 2H1EA 2DNEA 2Z4HA 1QB5D 2NVQH 1A6XA 5G3LF 4XYQA 3HKSA 1M4VA 4YY3L 1FR3A 3EIVA 3UDXA 4KV6A 1IL2A 4JI4L 4JI8L 3GTKB 1IBKL 1N34L 4A93G 3FHWA 1RHPA 1MD2D 5C0XI 4MN3A 2JA8G 1KDCA 4Q0FA 3ICEA 3CW2C 1I4PA 3FMCA 3QG1A 1HQRD 4BY7H 1NTGA 3GTOH 1AEXA 2F0MA 1EEFD 4OWXB 2B2YA 4U68A 3PSIA 5IODA 5IGFA 2AMCB 4JOIA 1Y1WB 4C1NK 3S17B 1B53A 1PYSB 5C44H 1L2FA 1ZEQX 4OL7A 1KIXA 1EFID 3Q6SA 2D0PA 1E7ZA 1R4QB 1JWMD 5C44B 4DR3Q 1W3SA 1JC7A 3CKIB 4KN7C 4DUZL 1QNUA 3HOYG 5C4XG 2G5DA 1KABA 5ELBA 5TSSA 3ERQA 4JI3Q 1BQQT 1TWCB 2VUMH 1VF5C 4HSVA 4B3SQ 3R2TA 3G6EA 1HA6A 4JI6Q 2JEAI 2VQFQ 4GOPC 4KKTA 2F0IA 1A3VA 2SNSA 4OWWB 2JA8B 5IP7G 4TRDA 3OTOL 2JA6H 3TP8A 1KAAA 2WB1B 5CBAE 3I3CA 4IJLA 1V9PA 1ILPA 4X65Q 4ZAIA 1OXVA 2E2DC 3KFUA 1TWFH 2C9OA 2MFIA 4ULLA 3M4YA 2E5LQ 3P1HA 2EYJA 1C0AA 1JICA 3DM3A 3J81L 5FO7B 1EOTA 1KL9A 4EQ5A 4A3KG 3WOFA 1NBWA 3RZDH 1XTCD 1YNND 5NUCA 4PMCA 1H9KA 2FHTA 4LK1C 3DWPA 2GA4B 3MWYW 3T1HL 3CCRA 5FO8B 5JVH3 4BS9A 2A19A 3HKZG 1BCPF 2I5HA 4QQBX 2VZAA 5FKAC 3IKJA 1ENFA 3STBD 2R93H 1PH7A 5M3MH 3OSOA 3SHLA 4EGVA 4A3EG 2KA7A 4IFDI 1OXXK 1RTOA 3RZDB 1R9TB 2RDGA 5M3MG 4FO2A 5E7NA 2EYHA 5CV4A 3IAYA 4LNQA 4LUOA 5I9OA 1H9SB 2HIVA 4GNXC 1Q7YC 4KKUA 1STAA 5C4JB 1QWYA 2VXWA 1VQGA 2NB0A 3K5OA 1EYAA 4JG2A 2XWBB 4K8IA 4P73A 2Q2IA 1R9TH 1SBBB 3TRZA 4A3LG 2L12A 1KQSA 1D5ZC 3PUXA 2N49A 3NTKA 1BBXC 1HNXL 1MHWC 2EYFA 3OHXC 3VDYA 1WCMG 3T1YQ 3VR3A 2NN6I 1PFSA 3I8ZA 1JCKB 1V1PB 5LL6S 4XQQA 1IBMQ 1L0YB 1EZ8A 1O7IA 2A6EC 3FP9A 5G3LD 2K50A 1YNJC 2RA4A 3DEPA 2K6AA 1VQLA 4I65A 3I4NH 2OWOA 2YYZA 4A3LH 5CYUA 1NE3A 2K4KA 1PZID 2KCTA 3L9AX 5C0XH 5J3BA 1HR0W 3Q0AA 4R4TA 1DJRD 3GD7A 3P20A 2VS1A 3EROA 3TMEA 4DFAA 2M00A 2Y0SE 2X6GA 1CQFA 2B29A 4F7XA 4JI2L 4A3KB 1UE1A 1XNQQ 5LMUQ 2PCFB 1MJEA 1D1IA 2DY7A 1FD7D 1Y1WH 5C3WA 1X6OA 3RNUA 3S16H 1I4XA 1DGSA 4POGA 4I7ZC 2UXBL 1KNAA 1ET6A 3A54A 4BBSB 3I55A 2B3GA 1ML0D 2F4IA 3KJOA 2TSSA 4DV0Q 3MA2B 4R4OA 3SR1A 4RGOS 3KLWA 2MNAA 4B3RL 3GTMB 1YHBA 4DXGA 3MZ5A 4EQNA 1SEBD 1GHJA 3DHQA 2QDBA 2A6ED 4HJ5A 2N88A 1BXTA 2R7FA 3CCMA 1FNWA 2JJQA 1CUKA 4HMJA 2E2IB 2R6GA 1I4QA 1K0SA 2JSOA 5EKKA 1GOZA 2DGYA 3H0GB 4LAAA 2JA7H 1F2LA 4TKOB 3VYRA 2I46A 4DNTB 4EQOA 2R93B 2EXDA 4BY7G 2FINB 1TIID 3MAQA 1TS2A 1PRTD 2BE5D 5C5LA 1X3QA 5JPNC 1XMQL 4G4KA 3JAMi 4GS3A 5EPKA 3A7AB 1B9NA 4JI5L 1PYWD 2AUKA 2VY3A 4DXFA 1LACA 1NY4A 1Y8NB 5FK9C 1ESRA 4JW0A 1PMRA 1XMOQ 4JYAL 1A15A 1UE7A 1SNDA 4DV2L 2ZTEA 3C3LA 5IGBA 3MTSA 2VB3X 1RCVD 4IQZA 5IYDG 2KHJA 2MO1A 5EQ0A 4ALPA 1E1TA 1STNA 4A3JH 3CC2A 2NVTH 2ZM6Q 1SE4A 2EYMA 1BOSA 4OWTB 3NQIA 3PF4A 3H94A 1ZKOA 2M2LA 3HZXA 3A55A 1B3AA 3OMCA 3D31A 1S5ED 4N9PA 4CGYB 1FYCA 1HR0L 2PNHA 1VQKA 1KRTA 4DR5L 5C4XH 3HOYH 4KHPL 5CV9A 3M4OB 3L7ZC 2L0CA 3V05A 4IUVA 1E24A 4DV4Q 5JJIA 1U4MA 4U673 5LHY1 2EJGC 1IBML 5C4JH 4DV3L 2VB2X 5EJWA 1CFMA 1LTLA 1IYUA 4JBMA 3HG9A 3S2DB 3CPFA 1BCPC 4ZYSA 2D5DA 1EOVA 2AQ2B 4UDUC 2F3IA 3NSWA 2B2YC 4Y52H 4RKLA 1IKLA 4YY3Q 3PO3G 1U9RA 3BU2A 1H9RA 2I07B 5K36G 4C2MH 2AWNA 1BKBA 1RIPA 3U4VA 5IYDH 2CVRA 4CDCC 5HY6A 4F88A 4CDDC 3U9SA 4CDFC 1JT8A 2M9VA 2YV5A 4IFDG 4HIMA 3RD4A 3M4PA 1CKNB 4WJWA 2K5VA 1LLRD 3A5ZB 1QNKA 4LFAL 3X3NA 1HNXQ 3ND9A 2F0NA 2WKDA 3J81E 1YITA 1PH9A 1X55A 2RDHA 4YIJA 3EVQA 3K7UC 1IBLQ 4RGTA 2KCMA 3HOZH 1TWHB 3CU7A 3GV3A 1DM0B 3GTPB 3BDOA 2EIFA 2Y0SG 1TQOA 4BA2I 2QF7A 4CKBA 2YU9B 3E6ZX 4A3MH 4QUFA 3FKIH 3RN5A 2ID0A 3TBIB 4IFDJ 2EY5A 3D8GA 3HOXH 4QIWB 4AYBE 1I50H 4X3KA 5IYCH 3S14H 5EGTA 1L1OA 4LWCA 4PZ8A 2XIWA 1KXLA 1EYCA 1HZAA 4A3IH 1LTAD 3KDFA 5FO9B 4RCNA 3FDTA 5IE8A 3G48A 1L1OB 3P7JA 4RWSC 1F9SA 3U4ZA 4BBRG 1A8VA 1CK1A 4DGZA 1RDPD 3R8BA 2JA8H 1HHVA 3MXGA 4LUVA 1IL8A 2E75C 4LW1A 3KJPA 4ZRZA 2D0OA 2CH4W 1O78A 1P8LA 1YIJA 2J7ZA 4LF8Q 3DUZA 1FJGL 2MGSA 3PUVA 4ME3A 1EIHA 3G7LA 1EWHA 3KUPA 5BR8L 5C0XJ 3A74A 2LKVA 1S72A 1NSNS 2PW5A 3CCVA 4NP5A 4JI5Q 2EVBA 1SAPA 3HOWB 2IHFA 2Z4IA 3PGZA 3AQQA 1K8GA 1WOCA 2QW7A 2Y0SB 4GOPA 1PH2A 4LF6L 5E3FA 4R8NA 1N36Q 1VQIA 2L11A 3UDFA 1XNRL 3KYHC 4K5VA 2CH4A 2VL6A 2AQ3B 3F2BA 4DV1L 5C3EH 5AFWA 4A3JB 2WACA 4HJ7A 3HKZE 2O4XA 1MI2A 2R7ZB 2WB1G 4M1UB 2E2HH 4ZK9B 2F1MA 4XT3B 4LFCL 3I91A 5JEAJ 4C3IB 4FF3A 5J39A 3NWSA 3C1FA 2WFWA 4P2CB 2Z8LA 2Z0SA 2PZTA 3KK7A 1VQ4A 3N52A 3VR2A 1IHZA 5DNFA 1ASYA 4QMGA 1MIUA 1FNVA 4K6LA 3OWFA 1X56A 4NXNQ 2EOTA 5A2QE 1LV9A 1C9OA 1BF4A 4JI2Q 1YZ6A 2LXKA 5HGTA 1K8MA 1HTPA 3OPOA 4QB4A 1XX8A 3HOXB 2EYOA 1H9SA 1V43A 2EDGA 4CJ0B 1E22A 2R92G 1PTOB 2QILA 3RUZA 1A2TA 2B2WC 4XQJA 2Z6BA 2K5WA 3I72A 1TWGB 3ND8A 1ET9A 3HOVB 5DEHA 4A3JG 4K5WA 4OX9L 3H91A 4H0LC 1EQRA 1SNOA 1G8ZD 4ILWA 3S2HH 1JWSD 1CHPD 4NB3A 3MXUA 1E3PA 5CBEE 4HIOA 1Y1VB 4V0BA 1BNZA 2YTXA 4JBKA 2V4DA 1VQFA 1Z47A 3A8KE 4DPGA 1N34Q 1BCPD 3VYUA 1X3GA 2A68C 5M5XB 4KK7A 4KD4A 1BR9A 2KCNA 4F8MA 2IJ0A 4TQUS 4C2MB 3GTLH 5I6YA 3QWNA 1SDFA 3AFQA 2AQ1B 1LYLA 3PO2G 2O5JC 5FLXL 5EPJA 3H3VI 1J5EL 1ZYRC 1EWCA 3DLLA 1O7ZA 1I6HB 2ZJQA 1IBLL 1GHKA 1U5KA 5IP7H 1N9WA 2PMZE 2A74C 4RGMA 3CC4A 2X6LA 4RH6A 4AIMA 2R7ZG 2D2CC 4A3IB 2K5NA 3CP0A 2PQAB 2BA0A 4DR2L 4JV5Q 5D3DA 1PH4A 4V190 5DAUA 4B3TL 1YVCA 2F0QA 1DD2A 3AMUA 1T5EA 2F0PA 3DMUA 2YTYA 3M9BA 5CC4A 3CCEA 4OX9Q 1Q1BA 4DNIA 4MTKA 3S1MH 4BWGB 1KDAA 4KHPQ 1PRTC 2BE5C 4AQYQ 4X66Q 5GADC 4DAYB 4R4IA 5C44G 1HZBA 4XIGS 2RHQB 2X69A 3H09A 4C56C 4BBSH 1G6ZA 1JMCA 4DKAC 3J7A5 1TY2A 3K5MA 3GTQB 1O7YA 4IOCA 1S3OA 2FMCA 3C1EA 3DWAA 5C4HA 3VR6A 1EFWA 3S2HB 3K5LA 1EQVA 1VQAA 1FGBD 4NXNL 3RZOB 2GVAA 4ZQ3A 4DR6L 2WAQG 4XT1B 3NP8A 4DUYQ 3ERSX 1XXGA 3HOZB 2JK8A 3AB9A 5IGEA 2ALYB 5I4DA 3OW2A 4DAVA 4P72A 3H6MA 5M3FB 4DR1L 5KRUA 3H3VC 4DR5Q 1E2VA 1SLJA 4PZ7A 2UUBL 2FMMA 3ONAB 2LY7A 3FEWX 3H0GH 5D14A 1I94Q 1SMYD 1GUGA 4DAYA 2VUMB 4UP8A 5CMDA 4JI1L 2UUAQ 1D1KA 1SE3A 1KC8C 2UXDQ 2B8GA 1WI5A 3KF8B 3K7AB 5IP9H 1M90C 3F2UA 1PDQA 1RF2D 1D2BA 1GO3E 1NMGA 3M7GA 4A3BG 3TSSA 5IP9G 1AFPA 1JR0D 1DOLA 1ENCA 1VMPA 4DR4L 2QEXA 4CDEC 1Y69U 1LABA 2B2VC 3W1BA 5M5WB 4YWMA 1J5EQ 4LF6Q 1ENAA 1HNZQ 1KNEA 1PTOF 4X62L 3HKZB 1ONLA 2K28A 1H9JA 1MJCA 2IX3A 2B63H 3JAML 2QA4A 2HUGA 2F0EA 3TZUA 5BN3A 4J15A 4LF5L 3LGJA 4JPBW 1X3EA 4C3HB 1WTOA 4IZ8A 3HOUG 1E2WA 2NZOA 1E1OA 3QOJA 1CQVA 5E4XA 4A3EB 4HTHA 4DK1A 5LMUL 4GKJL 1K3BC 1WD1A 1XPRA 2SOBA 3KDFB 4XQNA 4A3FB 2BOSA 4H7BA 2B8FA 3S16B 3I4OA 2K03A 2F0VA 3UDIA 5K5PA 4A3KH 4B9XA 1PA6A 1AW7A 3BG3A 1DYQA 1EZ6A 1WTVA 3BZDB 3SGIA 4R1JA 2FFKB 3PIOA 4KJNA 3S15H 1DOMA 3P75A 1JE5A 2QCPX 3MHBA 3CQZH 1PH5A 4IO9A 3BYYB 5FJ8G 1PYBA 1UEBA 3O13A 4KN4C 3PIPA 3GTGH 2A73B 1UNSA 1VQOA 3NTHA 1K3RA 3J80E 1Y8PB 4JI4Q 4GKJQ 1ZXTA 1K28A 4KTAA 2HT1A 4DAPA 5HURA 5IWAL 3HOZG 2QGQA 4JC0A 3S1NB 3M4OH 2QKIC 2IW3A 1EYDA 1PZKD 4QY7A 4HIDA 4IURA 2JA7B 1X3PA 4LF5Q 4GN5A 4OONA 1K83H 4DR7Q 3NXWA 1GUTA 2AUJD 2HQLA 3VYSA 4WFN3 3UE1A 2MHVA 1KLGD 4BY1B 1AH9A 1CSQA 3A8IE 1HFGA 3I73A 4ZKBB 4AYBG 1N33L 5KNDA 2B63G 4IOAA 5LMNL 3E0JA 4CKEA 1STHA 3T1YL 1I3QB 5LMNW 4JI7L 5JVG3 4BXXG 1I6HH 1OTCA 2YTVA 4NDXA 3BVGA 1UEAB 1WFQA 1WTQA 3CCLA 2OTJA 1QOHA 2F52A 3RLNA 3SK6A 3I4MG 1Q8KA 3HOXG 4X64L 4FF2A 1HQMC 2IY5B 5GROA 5D65A 2OTLA 4HR7B 4LF9L 2UXDL 1PFBA 1FGUA 3MVVA 2PQAA 3EFXD 1U4RA 3KLSX 5M5XH 2MUYA 1WJJA 2PW7A 2Z6KC 4JI0Q 1QJOA 4DR1Q 1MKHA 1CI3M 5D3IB 1HA5A 2R92H 1UAPA 3K7AH 4OELB 2ZXOA 5I6WA 4LF8L 1FJGQ 1Z6HA 2ICIA 5F2DA 2LMCB 1Y1WG 1YI2A 1YJ9A 4MIUA 3CCJA 1HNWL 2E5LL 3S1RH 2R7ZH 3U50C 4BY7B 1PHJA 1F9QA 3AFPA 5C3XA 2PQEA 5C3EB 1HUMA 2G9HD 2ZJRA 1TS5A 3MXNA 1QZGA 1VQPA 4YHHL 5M5YB 1G51A 1Q3LA 4N8X1 4IPCA 5IIFA 3S24A 4A3DB 3J7YW 2K75A 3LNNA 2NVXH 4X6AH 1VQBA 1I4GA 1V1OA 2VQFL 2BDOA 1STBA 2ASBA 4DR2Q 4JV5L 4A76A 1TKWB 2V1CC 1WTRA 3HOVG 2R7DA 3BZKA 3S1MB 3VA5A 2MO0A 1SFOH 2PO4A 4JVZA 5IGGA 4OXPA 3J80c 2JA9A 1NCVA 4DNRB 3GO5A 2KOLA 2KVMA 5LMNQ 4PMWA 3T56B 3PIO3 1IW7D 1CZGA 1X32A 2L1BA 4A3CH 1CA6A 3CRLC 4O42A 2HD3A 3DWQA 3GTOB 3I90A 1CT1D 5FLXc 1EIGA 4EVOA 2EZVA 4JCVE 3NTIA 1NUCA 2A68D 4XDXA 2LS01 1LM0A 1C4QA 1FL0A 1YNNC 2KUMA 1TWFB 1SXTA 3Q8DA 3Q23A 4B3SL 3S14B 3ITPA 3JC66 1EIFA 4K8JA 1B2TA 1B8AA 1A2UA 1JOQA 4A3EH 4G7ZC 2E2HB 4WJ3M 4TSSA 2I0QA 1TU2B 3M85A 4ZKCB 3K58A 3GTPH 2A69C 4HAEA 4JK1C 3GP7A 4RKBA 4KHZA 4DV6Q 4A75A 4B3ML 1A3TA 5IY0A 2EPBA 4DV3Q 1BBUA 1P16A 1CHQD 1G2TA 1LTID 4DV4L 2ZTCA 4NMZA 4A3CG 2UU9L 5IGCA 2I5LX 1CTMA 2P5ZX 2K14A 5T1GA 3EJIA 4A3GG 3E0EA 4J8QA 1MGSA 2I5MX 3D6CA 3E5SA 3QB3A 5JEAG 3QO2A 2K5HA 3R93A 1YEZA 2NZ1D 4IUUA 3IL8A 3NHHA 2HHHQ 4HIKA 3HOVH 1RTNA 1YNJD 1CKOA 5JJKA 4N8FA 1B4OA 3D3RA 1L1OC 1SNCA 2WKCA 4FYDA 3G6JB 3NBHA 1IYJB 1NJIC 1S4ZA 1NR4A 1HZ9A 4HEDA 4CKCA 1ICWA 2EY1A 3G4SA 4L5QA 1VQ6A 3T53B 1B1ZA 1HH2P 1R4PB 4RG1A 3VR5A 1L0XB 1TWHH 3I4LA 4IUNA 4X62Q 2H5XA 3S1RB 2ZXPA 3RZOH 2L55A 1X3FA 4YHHQ 1QG7A 3RN2A 4A3DH 5BN4A 4Y7NH 3TN2A 4DUYL 1JJGA 5M9OA 1SRUA 4DAMA 4DV1Q 2OF1A 2JXMB 1SJED 4A3FG 1XNRQ 3K80C 2YU9H 3I70A 5CGKA 3VA7A 1UWVA 4IPGA 4XXEA 3TREA 1HNWQ 1J8IA 1TR5A 5EPLA 4NW2A 2XVSA 1LT4D 1HUNA 1F9RA 2E76C 4B3RQ 1E2ZA 1BUVT 1TWGH 1E0BA 4LF4Q 1SNQA 1WTHA 5IYCG 4YWKA 4DF7A 5ELOA 1CA5A 1YHQA 3L2PA 4AQYL 1T9HA 4C3JH 2LSSA 5FLXE 3IFDA 5JEAH 1Z7TA 1JQYD 2EJMA 1IKMA 2PZWA 4H02A 2E8GA 1GD7A 1EY5A 2SEBD 2LFNA 2KEEA 1STEA 2F0UA 4OIJA 4LF9Q 1LTTD 1LT3D 3K81C 5EAYA 1U0LA 2N8NA 1EYGA 4QJFA 1SMYC 3HOUB 4L5RC 2FJ2A 5DLQE 1VQ5A 3S1QH 1MSHA 4DK0A 1C7YA 2L9HA 4HMIA 1A63A 2Q8TA 3VR4A 1TWAB 1QUQA 3SDZA 1SNMA 2F3VA 3OYYA 3A0JA 2UXCQ 1NMFA 2EQSA 3DXJC 1PTOC 4GLAC 1EQQA 2BDNA 3K59A 1SYEA 1BBWA 4B3TQ 5GAEC 2CQAA 3GTGB 2IPKD 4RHSA 2OEOA 2RSNA 5AJ3Q 5IYBH 5GAHC 4GLXA 1BDOA 4NKLA 2NN6H 4LUZA 1HCZA 2G9DA 3I56A 2E74C 4A3MB 3FVQA 1Y14B 2R92B 1W6JA 4J1MA 2WP8J 2WAQE 3TS0A 1JB7A 1B7YB 4DV5L 1UE5A 5I2XA 2CW0C 3FRPB 4S3SA 2HHHL 1PH8A 3OWEB 1VF7A 1N8RC 2LXJA 3Q22A 4FNFA 3D4DA 4OEMB 3NELA 4ODGA 3U58A 2KENA 1XWEA 2UXCL 1I6VC 1VMCA 3EN2A 4YCWA 5E1FA 3W5OA 1PTOD 4GNXB 3OIQA 1GUNA 2R61A 1F9PA 1V8QA 3GTMH 4B3MQ 4DV6L 4BY1G 5GQOA 2ZM6L 1FVIA 2L15A 3QJYA 3M4QA 1S5BD
chains in the Genus database with same CATH topology
3C46A 4X3UA 1B44D 2PPBC 3HOYB 5C4XB 4IUPA 3RLFA 1RD9D 1K83B 4KY5A 3FPPA 4C3JG 3I4MB 2DN8A 3QOLA 3Q24A 3PO3B 3FPUB 2RBMA 4FF4A 4KI0A 5T1IA 3URYA 2F0OA 4C1NI 3DM1A 3M7NA 2NTTA 4B08A 2BA1A 2JE6I 2B39A 3D4RA 4CJ2C 3A8JE 2XRSD 4KY6A 3A7LA 4M8AA 3UI2A 3GQBA 2L5TA 4IUQA 4R8IA 4KHVA 3S15B 2B2TA 3D4WA 5M3MB 4DA2A 1G291 5CV6A 1PLFA 4KJOA 3N6RA 5IGDA 2K05A 3V96A 4HN7A 4OIKA 3SK8A 1IYVA 3KBXA 1GUSA 1F2ZA 3I4NB 1OO9B 3MC0B 3SXHA 1LTGD 3GV6A 4F87A 1PFMA 4KD3A 3J7AF 4OGQC 1EY0A 3EQLC 1RODA 1I50B 2B2WA 2DY8A 2Q8RE 3IFTA 3BDCA 4PNYA 3CRKC 2J4XA 5JOBA 1EL0A 4A3GB 1OXSC 3U9OA 1J9OA 2F0GA 2KQ3A 1SYDA 1EY6A 3NWTA 1XYIA 2BCOA 1HXYD 2F0LA 5ELDA 3NK9A 1VCIA 1NR2A 3MFGA 3K57A 2ENBA 3C2PA 1JOOA 4G7OC 2F0FA 3KBGA 4C3JB 5CV7A 4ZUJA 1I4HA 3R2IA 3K5NA 4L6TB 3BVMA 5JPMC 2NVYB 2WIIB 2IX1A 2PZUA 1WTXA 2NTSA 5E4WC 2KECA 5DM63 1C48A 3NPPA 1TVXA 2RVLA 3FKIB 4QCLA 2TMPA 1LTSD 2HDMA 4OO1G 2A6HD 4AYBB 3T13A 3GTJB 4OO1I 2D9UA 1EY4A 3SK5A 2JYOA 2B2UA 1AZPA 3BDLA 1CZWA 1PZJD 5FOBB 3OIPA 2EYLA 4B9WA 4L63B 3HGBA 1V1PA 2KCCA 5A35A 1K8OA 2SNMA 1JWUD 2CW0D 2EJFC 4HCSA 2K04A 3KLSA 2F0HA 1S5FD 1S5DD 2NBFA 3HEJA 2RDFA 5ELFA 2ZT9C 2IX0A 1STGA 2H4OA 1DONA 1TY0A 1ILQA 2NWGA 3PO2B 2C5CA 1JE4A 3TDQA 1T5XD 4KKSA 4IALA 1H9MA 4DU9A 4E6IA 3RMHA 4WORA 1B50A 5COYA 3GTLB 1IW7C 3PUYA 4X3SA 5KYIA 1LTBD 4RGNA 4MHEA 2D62A 2PMZB 1UUPA 5CR3A 1S5CD 2K01A 4FVMA 1EY7A 4FXKC 3KLRA 4A3BB 2K7VA 1EY8A 1DXMA 1AP0A 2SDFA 5KIXA 5EKIA 2J0TD 1QCBD 4L8JA 5I9PA 3T51B 4A93B 3OW7A 1KLUD 1B9MA 4BBRB 4FP5D 2A69D 2R3ZA 1EQTA 1GUOA 4C3HG 1ZYRD 3S9WA 1BO0A 2NYZD 3W2DA 2F0KA 2F0JA 1NAPA 3MEHA 2EYPA 5DM73 4FF1A 1WTPA 4X3TA 1M8AA 4IFDH 2EE1A 2RSOA 5J1ZA 5EBCA 3K6OA 5K36H 3OOCA 1D5XC 2K5QA 2B2UC 2F0WA 2MJ8A 1QE6A 1SJHD 1PRTB 5C4ZA 2O5IC 5IOCA 1F77A 3M3YB 4IN3A 2K5DA 3J7AV 2E2JB 2WV6D 3HS0C 3NE5B 1ESFA 1EY9A 2PYKA 2F03A 2HDLA 2VNUD 2HCCA 2JA5B 4QF4A 2RQXA 4C3IG 4XYOA 4RFBA 1PXUA 2MPMA 2EY6A 1F2YA 3LWEA 4UAIA 4FXDA 4RAUC 3EA6A 1WTWA 4G7HC 2NVXB 1CM9A 4KMUC 5CORA 2KEDA 2L4NA 3K0YA 4Y7NB 2MP1A 2OT2A 1OXTA 5BN5A 1JOKA 4IUTA 2K32A 4ME5A 2F0TA 4K6DA 3SE0A 2F0SA 1Q12A 1TT2A 1LT5D 3PV0A 4RA8A 1U4LA 2CHBD 1DZ1A 3MXPA 2F3WA 4XTCS 5JAVA 1LT6D 2XRQD 2B2TC 1STYA 4QUCA 4EQPA 1JORA 2XWJB 1I4RA 1LTRD 1HFNA 2QEJC 4WRDA 2KJXA 2XSCA 4HCEA 1G91A 3SVMA 4CJ1B 4H13C 5J22A 2NUCA 1EEID 2K1BA 3TP5A 1KTKA 1C8CA 5CV8A 5KNCA 4ZUIA 4RHRA 3OMGA 4DN4M 1Q1EA 3NUCA 2ICEC 4N9TA 1DOKA 3X3MA 1F2MA 3CHBD 3JAME 5ELCA 2HQEA 3TZDA 5C5MA 4H44C 1EU4A 3W3AA 1TS3A 4O1NA 1D5MC 2DNCA 2WINB 3NBIA 1MBYA 1SYBA 1GXDC 4OO1H 1Y8OB 3TP7A 3T16A 1HRJA 5CV5A 3V2TA 1SYCA 1AN8A 1WD0A 4JBWA 1SE2A 1SYGA 1II3A 3NQTA 3LWUA 3ZYYX 1EU3A 4Z9CB 3DEOA 1GUWA 2EXZA 1WCMB 1TS4A 1SFOB 4LMQD 2WAQB 5C6AA 3BYTB 1RJTA 1PRTF 2A5HA 2ZXRA 2Q8IB 5C0XG 1DCZA 5KEEA 2N55A 1QILA 2KHSA 3L3OC 4RCOA 3SK4A 4GZYC 2RKSA 1VDZA 3AU7A 3WOEA 2JA6B 1SYFA 2HCIA 4K2LA 4FXGC 5ISRA 5KYLA 3LX0A 3KF8A 2JP1A 3R3OA 4R9WA 1PTOH 3CQZB 3VYTA 5IT9L 3BVZA 1AZQA 1MSGA 5IT9E 5ELEA 4K5XA 1PFNA 2PNRC 5I2YA 5EKLA 1Q8IA 2F0DA 3J80L 1JB3A 1OXUA 2EY2A 1U4PA 5JJZA 3A56A 5EBDA 3PMFA 3BS1A 2IT1A 5KNBA 4KY7A 1D6EC 4K2KA 4PV1C 3WDNA 4PQXA 2B63B 1SNPA 4OHJA 4HSPA 3T4AC 5A2QL 1O80A 2XN9C 1HTLD 4Q5VA 5LL6X 1GJXA 1SSOA 1W6KA 3PUZA 3HRZC 4PMBA 3S1QB 4CHTB 2NVQB 2B2VA 1BCPB 3QIAA 1FNUA 5KGUA 2NVTB 4K14A 2O2LD 4CBVA 1KDBA 3PIP3 4LJZC 1LO5D 2IL8A 2JEBI 2A6HC 2NN6G 4G57A 1HPCA 1A3UA 4BA1I 2Z1CA 4J6HA 3D6WA 2IWHA 3PUWA 1RKNA 1G2SA 2AWOA 1Q90A 2K33A 2OXPA 3HP3A 3TP6A 2XNAC 3MFYA 4ABNA 3SEBA 1WVLA 4ID6A 1O7LA 4ZLTF 2H1EA 2DNEA 2Z4HA 1QB5D 1A6XA 5G3LF 4XYQA 1M4VA 1FR3A 4KV6A 3GTKB 1RHPA 1MD2D 5C0XI 4MN3A 1KDCA 4Q0FA 1I4PA 3FMCA 3QG1A 1HQRD 1AEXA 2F0MA 1EEFD 2B2YA 4U68A 5IODA 5IGFA 1Y1WB 4C1NK 3S17B 1B53A 1ZEQX 4OL7A 1EFID 3Q6SA 1R4QB 1JWMD 5C44B 1JC7A 3CKIB 4KN7C 1QNUA 1KABA 5ELBA 5TSSA 3ERQA 1BQQT 1TWCB 1VF5C 4HSVA 3R2TA 1HA6A 2JEAI 4KKTA 2F0IA 1A3VA 2SNSA 2JA8B 4TRDA 3TP8A 1KAAA 2WB1B 5CBAE 3I3CA 1ILPA 4ZAIA 1OXVA 2E2DC 2C9OA 4ULLA 3M4YA 3P1HA 2EYJA 1JICA 3J81L 5FO7B 1EOTA 3WOFA 1XTCD 1YNND 5NUCA 4PMCA 1H9KA 2FHTA 4LK1C 3DWPA 2GA4B 3MWYW 5FO8B 5JVH3 4BS9A 1BCPF 5FKAC 3IKJA 1ENFA 3OSOA 3SHLA 4EGVA 2KA7A 4IFDI 1OXXK 1RTOA 3RZDB 1R9TB 2RDGA 4FO2A 2EYHA 5CV4A 3IAYA 5I9OA 1H9SB 4KKUA 1STAA 5C4JB 1QWYA 2VXWA 2NB0A 3K5OA 1EYAA 2XWBB 4K8IA 1SBBB 2L12A 1D5ZC 3PUXA 3NTKA 1BBXC 2EYFA 3OHXC 3VR3A 2NN6I 3I8ZA 1JCKB 1V1PB 5LL6S 4XQQA 1L0YB 1EZ8A 2A6EC 5G3LD 1YNJC 2RA4A 3DEPA 2K6AA 4I65A 2YYZA 5CYUA 1PZID 3L9AX 5C0XH 3Q0AA 1DJRD 3GD7A 3P20A 3EROA 3TMEA 4DFAA 2M00A 2X6GA 1CQFA 4F7XA 4A3KB 2PCFB 1D1IA 2DY7A 1FD7D 5C3WA 1I4XA 4I7ZC 1KNAA 1ET6A 3A54A 4BBSB 1ML0D 2F4IA 2TSSA 3MA2B 3SR1A 4RGOS 3GTMB 4DXGA 3MZ5A 4EQNA 1SEBD 1GHJA 3DHQA 2QDBA 2A6ED 2N88A 1BXTA 1FNWA 4HMJA 2E2IB 2R6GA 1I4QA 2JSOA 5EKKA 1GOZA 3H0GB 4LAAA 1F2LA 4TKOB 3VYRA 2I46A 4DNTB 4EQOA 2R93B 2FINB 1TIID 3MAQA 1TS2A 1PRTD 2BE5D 5C5LA 1X3QA 5JPNC 4G4KA 5EPKA 3A7AB 1B9NA 1PYWD 2AUKA 4DXFA 1LACA 1Y8NB 5FK9C 1ESRA 1PMRA 1A15A 1SNDA 3C3LA 5IGBA 3MTSA 2VB3X 1RCVD 4IQZA 5EQ0A 1STNA 1SE4A 2EYMA 1BOSA 3NQIA 3H94A 1ZKOA 2M2LA 3HZXA 3A55A 1B3AA 3OMCA 3D31A 1S5ED 4N9PA 4CGYB 1FYCA 5CV9A 3M4OB 3L7ZC 2L0CA 3V05A 4IUVA 1U4MA 4U673 5LHY1 2EJGC 2VB2X 5EJWA 1CFMA 1IYUA 3HG9A 3S2DB 1BCPC 4ZYSA 2D5DA 2AQ2B 4UDUC 3NSWA 2B2YC 4RKLA 1IKLA 1U9RA 1H9RA 2I07B 5K36G 2AWNA 2CVRA 4F88A 3U9SA 2M9VA 4IFDG 3RD4A 4WJWA 1LLRD 1QNKA 3X3NA 3ND9A 2F0NA 2WKDA 3J81E 2RDHA 4YIJA 3EVQA 4RGTA 1TWHB 3CU7A 3GV3A 1DM0B 3GTPB 3BDOA 1TQOA 4BA2I 2QF7A 4CKBA 2YU9B 3E6ZX 4QUFA 4IFDJ 2ID0A 3TBIB 2EY5A 3D8GA 4QIWB 4X3KA 5EGTA 2XIWA 1EYCA 1LTAD 5FO9B 4RCNA 3FDTA 3P7JA 4RWSC 1F9SA 1CK1A 4DGZA 1RDPD 3R8BA 1HHVA 3MXGA 1IL8A 2E75C 4ZRZA 1O78A 2J7ZA 3DUZA 2MGSA 3PUVA 1EIHA 3G7LA 1EWHA 3KUPA 5C0XJ 2LKVA 1NSNS 2PW5A 4NP5A 2EVBA 1SAPA 3HOWB 2Z4IA 2Y0SB 5E3FA 4R8NA 2L11A 4K5VA 2AQ3B 5AFWA 4A3JB 2WACA 2O4XA 1MI2A 2R7ZB 4M1UB 4ZK9B 2F1MA 4XT3B 3I91A 5JEAJ 4C3IB 4FF3A 5J39A 3NWSA 3C1FA 2Z8LA 3KK7A 4P2CB 2PZTA 3N52A 3VR2A 1IHZA 5DNFA 4QMGA 1FNVA 4K6LA 3OWFA 2EOTA 5A2QE 1LV9A 1BF4A 5HGTA 1K8MA 1HTPA 3OPOA 4QB4A 1XX8A 3HOXB 2EYOA 1H9SA 1V43A 2EDGA 4CJ0B 1PTOB 2QILA 3RUZA 1A2TA 2B2WC 4XQJA 2K5WA 3I72A 1TWGB 3ND8A 1ET9A 3HOVB 5DEHA 4K5WA 3H91A 4H0LC 1SNOA 1G8ZD 4ILWA 1JWSD 1CHPD 3MXUA 5CBEE 1Y1VB 4V0BA 1BNZA 2V4DA 1Z47A 3A8KE 1BCPD 3VYUA 2A68C 5M5XB 4KK7A 4KD4A 1BR9A 2KCNA 4F8MA 2IJ0A 4TQUS 4C2MB 5I6YA 3QWNA 1SDFA 2AQ1B 2O5JC 5FLXL 5EPJA 1ZYRC 1EWCA 1O7ZA 1I6HB 1GHKA 2A74C 4RGMA 2X6LA 4RH6A 2D2CC 4A3IB 2BA0A 5D3DA 4V190 5DAUA 2F0QA 1DD2A 3AMUA 1T5EA 2F0PA 3DMUA 5CC4A 1Q1BA 4BWGB 1KDAA 1PRTC 2BE5C 4XIGS 2X69A 3H09A 4C56C 3K5MA 1TY2A 3GTQB 1O7YA 2FMCA 3C1EA 5C4HA 3DWAA 3VR6A 3S2HB 3K5LA 1EQVA 1FGBD 3RZOB 4ZQ3A 4XT1B 3NP8A 1XXGA 3HOZB 3AB9A 5IGEA 5I4DA 4DAVA 5M3FB 3H6MA 3H3VC 5KRUA 1E2VA 2FMMA 2LY7A 3FEWX 3ONAB 5D14A 1SMYD 1GUGA 4DAYA 2VUMB 5CMDA 1D1KA 1SE3A 2B8GA 3K7AB 3F2UA 1PDQA 1RF2D 1D2BA 3M7GA 3TSSA 1AFPA 1JR0D 1DOLA 1ENCA 1VMPA 1Y69U 1LABA 2B2VC 5M5WB 1ENAA 1KNEA 1PTOF 3HKZB 1ONLA 2K28A 1H9JA 2IX3A 3JAML 2HUGA 2F0EA 3TZUA 5BN3A 4C3HB 1WTOA 4IZ8A 1E2WA 3QOJA 1CQVA 5E4XA 4A3EB 4HTHA 4DK1A 1WD1A 2SOBA 4XQNA 4A3FB 2BOSA 4H7BA 2B8FA 3S16B 2K03A 2F0VA 5K5PA 4B9XA 1AW7A 3BG3A 1DYQA 1EZ6A 1WTVA 3BZDB 2FFKB 4KJNA 1DOMA 3P75A 2QCPX 3MHBA 3BYYB 3O13A 4KN4C 2A73B 1UNSA 3NTHA 3J80E 1Y8PB 1ZXTA 4KTAA 4DAPA 5HURA 3S1NB 2QKIC 2IW3A 1EYDA 1PZKD 4IURA 2JA7B 1X3PA 3NXWA 1GUTA 2AUJD 3VYSA 4WFN3 2MHVA 1KLGD 4BY1B 3A8IE 1HFGA 3I73A 4ZKBB 5KNDA 3E0JA 4CKEA 1STHA 1I3QB 5JVG3 4NDXA 3BVGA 1UEAB 1WTQA 1QOHA 3SK6A 4FF2A 1HQMC 5D65A 4HR7B 1PFBA 3MVVA 3EFXD 1U4RA 3KLSX 2MUYA 2PW7A 1QJOA 1CI3M 5D3IB 1HA5A 1UAPA 2ZXOA 5I6WA 1Z6HA 2ICIA 5F2DA 2LMCB 4MIUA 4BY7B 1F9QA 5C3XA 2PQEA 5C3EB 1HUMA 2G9HD 1TS5A 3MXNA 5M5YB 1Q3LA 5IIFA 4A3DB 3J7YW 3LNNA 1I4GA 1V1OA 2BDOA 1STBA 1TKWB 1WTRA 3S1MB 3VA5A 2PO4A 5IGGA 1NCVA 4DNRB 3GO5A 2KOLA 2KVMA 4PMWA 3T56B 3PIO3 1IW7D 1CZGA 1X32A 2L1BA 1CA6A 3CRLC 4O42A 3GTOB 3DWQA 3I90A 1CT1D 1EIGA 4EVOA 2EZVA 3NTIA 1NUCA 2A68D 4XDXA 2LS01 1C4QA 1YNNC 2KUMA 1TWFB 1SXTA 3Q23A 3S14B 3ITPA 4K8JA 1B2TA 1A2UA 1JOQA 4G7ZC 2E2HB 4TSSA 1TU2B 3M85A 4ZKCB 3K58A 2A69C 4HAEA 3GP7A 4JK1C 4RKBA 4KHZA 1A3TA 2EPBA 1CHQD 1G2TA 1LTID 4NMZA 5IGCA 1CTMA 5T1GA 3EJIA 5JEAG 1MGSA 3QB3A 4J8QA 3D6CA 3E5SA 3QO2A 3R93A 2NZ1D 4IUUA 3IL8A 3NHHA 1RTNA 1YNJD 1B4OA 3D3RA 1SNCA 2WKCA 4FYDA 3G6JB 3NBHA 1S4ZA 1NR4A 4HEDA 4CKCA 1ICWA 2EY1A 3T53B 1R4PB 1B1ZA 3VR5A 1L0XB 3I4LA 4IUNA 3S1RB 2ZXPA 2L55A 1QG7A 5BN4A 3TN2A 5M9OA 2OF1A 2JXMB 1SJED 3I70A 5CGKA 3VA7A 4XXEA 1J8IA 1TR5A 5EPLA 4NW2A 2XVSA 1LT4D 1HUNA 1F9RA 2E76C 1E2ZA 1BUVT 1E0BA 1SNQA 4DF7A 1CA5A 5FLXE 3IFDA 5JEAH 1Z7TA 1JQYD 2EJMA 1IKMA 2PZWA 1EY5A 2SEBD 2LFNA 2KEEA 1STEA 2F0UA 4OIJA 1LTTD 1LT3D 1SMYC 3HOUB 2FJ2A 1MSHA 4DK0A 2L9HA 4HMIA 2Q8TA 3VR4A 1TWAB 3SDZA 1SNMA 2F3VA 3DXJC 1PTOC 2BDNA 3K59A 1SYEA 2CQAA 3GTGB 2IPKD 4RHSA 2OEOA 2RSNA 1BDOA 4NKLA 2NN6H 1HCZA 2G9DA 2R92B 1G6ZA 4A3MB 2E74C 3FVQA 1W6JA 4J1MA 2WP8J 5I2XA 2CW0C 3FRPB 4S3SA 3OWEB 1VF7A 3Q22A 4FNFA 3D4DA 4ODGA 1XWEA 1I6VC 1VMCA 5E1FA 1PTOD 3OIQA 1GUNA 2R61A 1F9PA 1V8QA 3QJYA 1S5BD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DON A;  2RSO A;  2JP1 A;  1NR2 A;  4X3U A;  4ZLT F;  1EOT A;  2H1E A;  1DOL A;  2KUM A;  1VMP A;  1WTQ A;  2DY7 A;  1CA5 A;  4IUP A;  4R9W A;  1SDF A;  1ILQ A;  2NWG A;  2B2V C;  1C8C A;  1JE4 A;  2FHT A;  3IFD A;  2B2Y C;  2K1B A;  1KNA A;  1B2T A;  1IKM A;  2B2U C;  1KNE A;  1IKL A;  5D65 A;  5EPJ A;  4DN4 M;  1AZQ A;  1MSG A;  2L11 A;  1RHP A;  2MJ8 A;  3FPU B;  3MWY W;  1QE6 A;  1PFB A;  2KEE A;  1O7Z A;  4MN3 A;  1DOK A;  2K28 A;  4OIJ A;  1B50 A;  5COY A;  2X6G A;  1ML0 D;  5T1I A;  1PFN A;  4ZKC B;  2HUG A;  1U4R A;  4HAE A;  5AFW A;  2CVR A;  2X6L A;  3DM1 A;  4X3S A;  1WTO A;  2EPB A;  1MI2 A;  1G2T A;  1WTX A;  4CJ2 C;  3TZD A;  2FJ2 A;  5E4W C;  5E4X A;  2KEC A;  4ZK9 B;  2B2Y A;  3UI2 A;  2N88 A;  1MSH A;  4U68 A;  4MHE A;  4XT3 B;  1WD1 A;  3I91 A;  1TVX A;  4IUQ A;  2HDL A;  1U4P A;  2L9H A;  2HCC A;  2RVL A;  5JJZ A;  4R8I A;  1RTO A;  2Q8T A;  5T1G A;  1B53 A;  1MGS A;  1QNK A;  4IUR A;  3QO2 A;  2B2T A;  3R93 A;  1F2L A;  3N52 A;  2K01 A;  2K03 A;  2NZ1 D;  4IUU A;  5DNF A;  2MPM A;  3IL8 A;  2FIN B;  3LWE A;  4UAI A;  1PLF A;  2HDM A;  1HRJ A;  4RAU C;  2K05 A;  1WTV A;  1F9Q A;  2BDN A;  1X3Q A;  2EOT A;  2VXW A;  3GV3 A;  3Q6S A;  4OIK A;  1RTN A;  1LV9 A;  2D9U A;  1WD0 A;  2FFK B;  1WTW A;  1HUM A;  2JYO A;  5EPK A;  1BF4 A;  1B4O A;  1DOM A;  2B2U A;  1AZP A;  1O80 A;  2X69 A;  1CM9 A;  3KBX A;  2RSN A;  1AP0 A;  1XX8 A;  2SDF A;  1SSO A;  4QUF A;  5EKI A;  2L12 A;  2KED A;  1S4Z A;  2L4N A;  5COR A;  1NR4 A;  4CJ0 B;  4HED A;  1Q3L A;  1O7Y A;  4HSV A;  3DEO A;  1BBX C;  1GUW A;  1G6Z A;  2MP1 A;  2B2W C;  1ICW A;  1HA6 A;  4X3K A;  4IUT A;  1ESR A;  2B2V A;  2XIW A;  1A15 A;  3GV6 A;  3FDT A;  3MTS A;  4LMQ D;  4XT1 B;  3I8Z A;  3P7J A;  1PFM A;  1F9S A;  1ZXT A;  2R3Z A;  4RWS C;  5EQ0 A;  4RA8 A;  1EQT A;  1RJT A;  1U4L A;  1WTR A;  1DZ1 A;  3H91 A;  4HCS A;  1ROD A;  2K04 A;  1HHV A;  1IL8 A;  2FMM A;  3ONA B;  5CBA E;  3I3C A;  1QG7 A;  2B2T C;  1BO0 A;  2B2W A;  2DY8 A;  2IL8 A;  1X3P A;  2M2L A;  2Q8R E;  1B3A A;  2N55 A;  2NYZ D;  2RA4 A;  3DEP A;  4QUC A;  3TN2 A;  1VMC A;  5CBE E;  1NCV A;  5CMD A;  1BNZ A;  1ILP A;  3D6W A;  2KOL A;  2KVM A;  1NAP A;  5D14 A;  2J7Z A;  4ZAI A;  1HFN A;  2MGS A;  1EL0 A;  1F9P A;  1G2S A;  1EIH A;  1X32 A;  2L1B A;  3G7L A;  3KUP A;  3F2U A;  1J9O A;  1CA6 A;  1J8I A;  4O42 A;  5EPL A;  1PDQ A;  1WTP A;  4IUV A;  3HP3 A;  4NW2 A;  1HFG A;  1U4M A;  3I90 A;  1EIG A;  1JIC A;  4ZKB B;  1G91 A;  4X3T A;  1M8A A;  3SVM A;  2HCI A;  4CJ1 B;  1HUN A;  1F9R A;  4XDX A;  5EJW A;  1XYI A;  1E0B A;  1SAP A;  1WVL A;  2EE1 A; 
#chains in the Genus database with same CATH topology
 3C46 A;  3CAM A;  1IBK Q;  4X3U A;  1B44 D;  1K0R A;  4R4Q A;  2PPB C;  3HOY B;  5C4X B;  4IUP A;  3RLF A;  3S17 H;  1RD9 D;  3B6Y A;  1K83 B;  1VS0 A;  4KY5 A;  2C35 B;  2GVB A;  3FPP A;  4YWL A;  4C3J G;  3I4M B;  3GTQ H;  2DN8 A;  3QOL A;  2KHI A;  3PQI A;  3Q24 A;  3PO3 B;  3FPU B;  2RBM A;  4FF4 A;  4NXM Q;  1HJP A;  4KI0 A;  5T1I A;  1ASZ A;  3CF5 A;  4LFC Q;  3URY A;  2F0O A;  4APV A;  4C1N I;  3DM1 A;  3M7N A;  2NTT A;  4LF4 L;  4B08 A;  2BA1 A;  2JE6 I;  3WWV A;  1VQ7 A;  2B39 A;  3D4R A;  4CJ2 C;  3A8J E;  2XRS D;  2JA7 G;  4KY6 A;  4DR4 Q;  4A3G H;  3A7L A;  4M8A A;  3UI2 A;  1Y1V G;  3GQB A;  2L5T A;  4IUQ A;  4UY8 C;  4R8I A;  3NEM A;  2FXQ A;  4KHV A;  3PCO B;  3S15 B;  2B2T A;  3D4W A;  3HOW H;  5M3M B;  3STB C;  4DA2 A;  2ZTD A;  1G29 1;  4RMF A;  3J81 i;  5CV6 A;  1PLF A;  4KJO A;  2NVY H;  3N6R A;  3M3Y H;  5IGD A;  4QGU A;  2K05 A;  3V96 A;  4HN7 A;  3H15 A;  4OIK A;  3SK8 A;  4P74 A;  4JI1 Q;  4DV7 Q;  4A4I A;  4HJ8 A;  1IYV A;  3A5U A;  3KBX A;  3ULP A;  1GUS A;  4A3F H;  2MQH A;  1F2Z A;  3I4N B;  1OO9 B;  3MC0 B;  1PH1 A;  3AEV A;  3SXH A;  4BBS G;  1LTG D;  3GV6 A;  4F87 A;  4LF7 L;  1PFM A;  4KD3 A;  3J7A F;  4POF A;  4OGQ C;  1Q46 A;  4LFB L;  1EY0 A;  4QIW E;  3EQL C;  1ROD A;  3TQY A;  4FDB A;  1I50 B;  2B2W A;  4IPD A;  2DY8 A;  2Q8R E;  1W2B A;  3IFT A;  3TEH B;  3MEF A;  1ICF B;  3BDC A;  4MZ9 A;  1XJV A;  2K52 A;  4PNY A;  1VQE A;  3CRK C;  2J4X A;  2Q2T A;  5JOB A;  1EL0 A;  3H0G G;  4A3G B;  2UU9 Q;  1OXS C;  3U9O A;  1J9O A;  2F0G A;  2KQ3 A;  2UXB Q;  1SYD A;  4DR6 Q;  1EY6 A;  3NWT A;  1XYI A;  2BCO A;  1HXY D;  2F0L A;  5ELD A;  3NK9 A;  1VCI A;  1NR2 A;  3MFG A;  3K57 A;  2ENB A;  2N78 A;  3C2P A;  1M1K C;  1JOO A;  1B3Q A;  1I5F A;  4G7O C;  1TWA H;  2F0F A;  3J81 c;  5ELN A;  4P71 A;  3KBG A;  4C3J B;  5CV7 A;  4ZUJ A;  1I4H A;  2CWP A;  4LFA Q;  4A3D G;  1CSP A;  3R2I A;  3K5N A;  4L6T B;  3BVM A;  5JPM C;  2NVY B;  1YJN A;  2WII B;  2IX1 A;  3W1G A;  2PZU A;  3KOJ A;  1WTX A;  2NTS A;  5E4W C;  1SMX A;  4EX5 A;  2KEC A;  5DM6 3;  2VUM G;  1C48 A;  3NPP A;  4GKK Q;  3F1Z A;  1TVX A;  2RVL A;  2VQE Q;  3FKI B;  4QCL A;  5FLM G;  5IWA Q;  4HJA A;  2TMP A;  2KBN A;  1SN8 A;  3G71 A;  1LTS D;  2PI2 E;  3F2C A;  2HDM A;  4OO1 G;  2A6H D;  4AYB B;  3T13 A;  3GTJ B;  3BZC A;  2F4V L;  4OO1 I;  3HOW G;  1KAW A;  4KLK A;  2D9U A;  1EY4 A;  3SK5 A;  2JYO A;  3CCU A;  2B2U A;  1AZP A;  3BDL A;  1K73 C;  2N3S A;  1QZH A;  3D0F A;  2RCF A;  1PZJ D;  1CZW A;  5FOB B;  3OIP A;  2EYL A;  4B9W A;  4L63 B;  4UPA A;  1BVS A;  3AYH B;  3HGB A;  1V1P A;  2KCC A;  5A35 A;  1K8O A;  1PV4 A;  2SNM A;  4YCU A;  1JWU D;  3I7F A;  2CW0 D;  2EJF C;  4HCS A;  2K04 A;  4UP7 A;  1PH3 A;  3KLS A;  1N32 Q;  1V1Q A;  1JJC B;  2F0H A;  1S5F D;  1S5D D;  4X65 L;  2NBF A;  4DV2 Q;  3HEJ A;  2RDF A;  3ULL A;  1X9N A;  3T1H Q;  5ELF A;  2ZT9 C;  1VQ9 A;  2IX0 A;  4PG3 A;  4O2D A;  3ER0 A;  3KF6 B;  2JA6 G;  3CD6 A;  2AHO B;  4NPS A;  4JI0 L;  1STG A;  2H4O A;  1DON A;  1TY0 A;  2GN5 A;  1YBY A;  1ILQ A;  2NWG A;  3PO2 B;  2C5C A;  1JE4 A;  3TDQ A;  1T5X D;  4KKS A;  4IAL A;  1PH6 A;  4X64 Q;  1H9M A;  4DU9 A;  4E6I A;  3RMH A;  4WOR A;  1B50 A;  5COY A;  3GTL B;  1IW7 C;  1XMO L;  4JYA Q;  3J80 i;  3PUY A;  2A1A A;  1EWI A;  4X3S A;  5KYI A;  1LTB D;  4RGN A;  1J6Q A;  3NBH B;  4MHE A;  3RLO A;  4DV0 L;  1I94 L;  1GKH A;  2D62 A;  2PMZ B;  1UUP A;  3TS2 A;  1IZ6 A;  3PO2 H;  1KRS A;  3BJU A;  5CR3 A;  1S5C D;  2K01 A;  4FVM A;  5BR8 Q;  1QUQ B;  3ULJ A;  1EY7 A;  4FXK C;  4I7A A;  3KLR A;  4GLV B;  3UE0 A;  1Q86 C;  2UUC L;  4BBR H;  4A3B B;  4DR3 L;  2K7V A;  1EY8 A;  5FJ8 H;  4A93 H;  1DXM A;  1X65 A;  1AP0 A;  2SDF A;  5KIX A;  5EKI A;  2E2I H;  2J0T D;  1QCB D;  1K8A C;  1GVP A;  2PI2 A;  4L8J A;  1XTD A;  4A3M G;  5I9P A;  3T51 B;  4A93 B;  4NXM L;  3OW7 A;  1KLU D;  1B9M A;  1QVG A;  4BBR B;  4FP5 D;  4L5T A;  2A69 D;  2R3Z A;  1EQT A;  1B70 B;  1GUO A;  4C3H G;  1JJ2 A;  1ZYR D;  3S9W A;  1BO0 A;  2NYZ D;  3W2D A;  2F0K A;  2F0J A;  4C3I H;  3I4M H;  3E3X A;  1NAP A;  4R4C A;  3MEH A;  4GN4 B;  2AKW B;  2RHS B;  2EYP A;  4O0A A;  2ZJP A;  2DJG C;  1A62 A;  5DM7 3;  4FF1 A;  1WTP A;  4BXX H;  1WYD A;  4X3T A;  1M8A A;  4IFD H;  3GTJ H;  3F2D A;  2EE1 A;  2RSO A;  4ZCK A;  5J1Z A;  5EBC A;  4JOI C;  4K0K Q;  3K6O A;  3GTK H;  5K36 H;  4IJH A;  1XPU A;  3CMA A;  1VQ8 A;  4UHV A;  3OOC A;  1D5X C;  2K5Q A;  2B2U C;  1S40 A;  2VW9 A;  2F0W A;  2MJ8 A;  2E2J H;  1QE6 A;  2OQ0 A;  4A3B H;  1D8L A;  1SJH D;  2BH2 A;  1PRT B;  5C4Z A;  2O5I C;  5IOC A;  1F77 A;  5M3F G;  1UE6 A;  3M3Y B;  4IN3 A;  2K5D A;  5L37 A;  1EIY B;  3HFZ B;  1NNX A;  3J7A V;  2E2J B;  2ATW A;  2WV6 D;  1QVF A;  3E9H A;  3HS0 C;  3NE5 B;  1ESF A;  1EY9 A;  2PYK A;  2F03 A;  2HDL A;  4GKK L;  2VNU D;  2HCC A;  4IPH A;  4QF4 A;  2JA5 B;  4DK6 C;  2UUA L;  2RQX A;  4C3I G;  1XPO A;  4XYO A;  4RFB A;  1RL2 A;  4AH6 A;  1PXU A;  2UUB Q;  2MPM A;  2EY6 A;  1F2Y A;  3LWE A;  4P75 A;  4UAI A;  4FXD A;  4C3H H;  4QL5 A;  4RAU C;  2Q2H A;  1HR0 Q;  4MNO A;  3EA6 A;  1WTW A;  4G7H C;  4BY1 H;  2NVX B;  1CM9 A;  3K8A A;  1LUZ A;  4KMU C;  5COR A;  2KED A;  2L4N A;  1CKN A;  3K0Y A;  4Y7N B;  3JAM c;  2MP1 A;  2OT2 A;  1OXT A;  5BN5 A;  5M5Y H;  1JOK A;  4IUT A;  2K32 A;  4ME5 A;  2F0T A;  4K6D A;  3SE0 A;  2F0S A;  1Q12 A;  1TT2 A;  1LT5 D;  3PV0 A;  4RA8 A;  1U4L A;  2CHB D;  1DZ1 A;  4X66 L;  3MXP A;  2F3W A;  4XTC S;  5JAV A;  1LT6 D;  4JBJ A;  2QDL A;  2XRQ D;  5IT9 c;  2B2T C;  1STY A;  4QUC A;  5JJL A;  4EQP A;  1JOR A;  2XWJ B;  1I4R A;  1LTR D;  1HFN A;  1VQM A;  2QEJ C;  3FKI G;  4WRD A;  2KJX A;  2XSC A;  4MTN A;  3ZJY C;  3CCQ A;  1A0I A;  1AE2 A;  4HCE A;  1G91 A;  2Z6K A;  3SVM A;  4CJ1 B;  3CCS A;  4H13 C;  4DK3 C;  4DUZ Q;  5J22 A;  2NUC A;  1EEI D;  2K1B A;  1KHI A;  4GOP B;  3TP5 A;  1KTK A;  1K9M C;  1C8C A;  5CV8 A;  5KNC A;  1N33 Q;  1G6P A;  4ZUI A;  2DJF C;  5M5W H;  3OTO Q;  4RHR A;  3OMG A;  4DN4 M;  3RR5 A;  1Q1E A;  3NUC A;  1XMQ Q;  2ICE C;  4DV7 L;  4N9T A;  1DOK A;  3X3M A;  1GM5 A;  1F2M A;  3CHB D;  3NEN A;  3JAM E;  2CKZ B;  2Z9H A;  5ELC A;  3I2Z A;  2HQE A;  4JI3 L;  3TZD A;  5C5M A;  4H44 C;  1EU4 A;  3CPW A;  3W3A A;  1TS3 A;  4O1N A;  2JA5 G;  1D5M C;  2DNC A;  3PO3 H;  2WIN B;  1TWC H;  3NBI A;  3E9I A;  1N32 L;  4UP9 A;  1MBY A;  2CFM A;  1SYB A;  2RCN A;  4GN3 B;  4JI8 Q;  3K0X A;  3F8T A;  1GXD C;  3S1N H;  4OO1 H;  1Y8O B;  3TP7 A;  3T16 A;  1HRJ A;  1Q81 C;  3PF5 A;  5CV5 A;  3V2T A;  1SYC A;  5C3E G;  1AN8 A;  3GDE A;  1WD0 A;  1D7Q A;  4JBW A;  1SE2 A;  1SYG A;  1II3 A;  1SRO A;  1QVC A;  3NQT A;  3LWU A;  3ZYY X;  1EU3 A;  1Z9F A;  1HNZ L;  4Z9C B;  3DEO A;  2RF4 A;  1GUW A;  2EXZ A;  1XNQ L;  1WCM B;  1TS4 A;  1SFO B;  4YCV A;  1VQC A;  1I3Q H;  4DV5 Q;  2CWA A;  4LMQ D;  1YNX A;  5H1S E;  1AE3 A;  2WAQ B;  5C6A A;  3EBE A;  3BYT B;  2CCZ A;  1RJT A;  1PRT F;  2UUC Q;  4TVA B;  2A5H A;  2ZXR A;  2Q8I B;  1CKM A;  5C0X G;  1DCZ A;  2IHE A;  2N55 A;  5KEE A;  4L5S A;  2JA5 H;  1QIL A;  2KHS A;  3MXN B;  4PZ6 A;  3L0O A;  4HJ9 A;  2NZH A;  3L3O C;  4RCO A;  3SK4 A;  4GZY C;  2R93 G;  2RKS A;  1VDZ A;  3AU7 A;  3WOE A;  2JA6 B;  1SYF A;  2HCI A;  4K2L A;  4FXG C;  5KYL A;  5ISR A;  3KF6 A;  3LX0 A;  3KF8 A;  2JP1 A;  1IXR A;  1WCM H;  3R3O A;  2CQO A;  4R9W A;  1YJW A;  2XTI A;  3H3V H;  2WB1 E;  2OCE A;  5AJ3 L;  1PTO H;  3CQZ B;  3VYT A;  1N36 L;  5IT9 L;  3BVZ A;  1AZQ A;  2XGT A;  1MSG A;  5IT9 E;  5ELE A;  4K5X A;  1Q82 C;  1PFN A;  2PNR C;  5I2Y A;  1YHA A;  5EKL A;  1Q8I A;  2F0D A;  5GAG C;  3J80 L;  5FLM H;  1JB3 A;  1OXU A;  3CME A;  2ES2 A;  2EY2 A;  1TXY A;  1U4P A;  5JJZ A;  1KD1 C;  3A56 A;  5EBD A;  3UDG A;  3PMF A;  3BS1 A;  2JQO A;  2IT1 A;  5KNB A;  2JN4 A;  3CXC A;  4LFB Q;  4KY7 A;  1D6E C;  4K2K A;  4PV1 C;  1X54 A;  3WDN A;  5M3F H;  1VQH A;  4PQX A;  4LF7 Q;  5HGQ A;  2B63 B;  1SNP A;  4OHJ A;  4HSP A;  1H95 A;  3T4A C;  4JI7 Q;  5A2Q L;  1L0W A;  1O80 A;  2XN9 C;  1HTL D;  4Q5V A;  5LL6 X;  1GJX A;  1SE8 A;  1SSO A;  4WJ4 A;  2A8V A;  1W6K A;  3PUZ A;  3HRZ C;  1Y1V H;  4PMB A;  3S1Q B;  4CHT B;  3I4N G;  2NVQ B;  2B2V A;  4K0K L;  3HOU H;  1BCP B;  3QIA A;  1FNU A;  5KGU A;  2NVT B;  4K14 A;  4JI6 L;  2O2L D;  4CBV A;  2HIX A;  1KDB A;  3QR8 A;  2F4V Q;  3PIP 3;  4LJZ C;  4A3I G;  1LO5 D;  2IL8 A;  2JEB I;  1PVO A;  2A6H C;  3IRB A;  3J81 j;  2NN6 G;  4G57 A;  1HPC A;  1A3U A;  4BA1 I;  2OQK A;  2Z1C A;  4J6H A;  3D6W A;  1VQD A;  2IWH A;  2VQE L;  5IYB G;  1EUJ A;  1HZC A;  3PUW A;  1RKN A;  1G2S A;  2AWO A;  1VQN A;  2DUD A;  3J7Z C;  1Q90 A;  2K33 A;  2OXP A;  3HP3 A;  3S2D H;  4GNX A;  2Q2U A;  3TP6 A;  2XNA C;  3MFY A;  4ABN A;  3SEB A;  4DR7 L;  1WVL A;  2BH8 A;  1VQJ A;  4ID6 A;  1SR3 A;  3CC7 A;  1O7L A;  4ZLT F;  2H1E A;  2DNE A;  2Z4H A;  1QB5 D;  2NVQ H;  1A6X A;  5G3L F;  4XYQ A;  3HKS A;  1M4V A;  4YY3 L;  1FR3 A;  3EIV A;  3UDX A;  4KV6 A;  1IL2 A;  4JI4 L;  4JI8 L;  3GTK B;  1IBK L;  1N34 L;  4A93 G;  3FHW A;  1RHP A;  1MD2 D;  5C0X I;  4MN3 A;  2JA8 G;  1KDC A;  4Q0F A;  3ICE A;  3CW2 C;  1I4P A;  3FMC A;  3QG1 A;  1HQR D;  4BY7 H;  1NTG A;  3GTO H;  1AEX A;  2F0M A;  1EEF D;  4OWX B;  2B2Y A;  4U68 A;  3PSI A;  5IOD A;  5IGF A;  2AMC B;  4JOI A;  1Y1W B;  4C1N K;  3S17 B;  1B53 A;  1PYS B;  5C44 H;  1L2F A;  1ZEQ X;  4OL7 A;  1KIX A;  1EFI D;  3Q6S A;  2D0P A;  1E7Z A;  1R4Q B;  1JWM D;  5C44 B;  4DR3 Q;  1W3S A;  1JC7 A;  3CKI B;  4KN7 C;  4DUZ L;  1QNU A;  3HOY G;  5C4X G;  2G5D A;  1KAB A;  5ELB A;  5TSS A;  3ERQ A;  4JI3 Q;  1BQQ T;  1TWC B;  2VUM H;  1VF5 C;  4HSV A;  4B3S Q;  3R2T A;  3G6E A;  1HA6 A;  4JI6 Q;  2JEA I;  2VQF Q;  4GOP C;  4KKT A;  2F0I A;  1A3V A;  2SNS A;  4OWW B;  2JA8 B;  5IP7 G;  4TRD A;  3OTO L;  2JA6 H;  3TP8 A;  1KAA A;  2WB1 B;  5CBA E;  3I3C A;  4IJL A;  1V9P A;  1ILP A;  4X65 Q;  4ZAI A;  1OXV A;  2E2D C;  3KFU A;  1TWF H;  2C9O A;  2MFI A;  4ULL A;  3M4Y A;  2E5L Q;  3P1H A;  2EYJ A;  1C0A A;  1JIC A;  3DM3 A;  3J81 L;  5FO7 B;  1EOT A;  1KL9 A;  4EQ5 A;  4A3K G;  3WOF A;  1NBW A;  3RZD H;  1XTC D;  1YNN D;  5NUC A;  4PMC A;  1H9K A;  2FHT A;  4LK1 C;  3DWP A;  2GA4 B;  3MWY W;  3T1H L;  3CCR A;  5FO8 B;  5JVH 3;  4BS9 A;  2A19 A;  3HKZ G;  1BCP F;  2I5H A;  4QQB X;  2VZA A;  5FKA C;  3IKJ A;  1ENF A;  3STB D;  2R93 H;  1PH7 A;  5M3M H;  3OSO A;  3SHL A;  4EGV A;  4A3E G;  2KA7 A;  4IFD I;  1OXX K;  1RTO A;  3RZD B;  1R9T B;  2RDG A;  5M3M G;  4FO2 A;  5E7N A;  2EYH A;  5CV4 A;  3IAY A;  4LNQ A;  4LUO A;  5I9O A;  1H9S B;  2HIV A;  4GNX C;  1Q7Y C;  4KKU A;  1STA A;  5C4J B;  1QWY A;  2VXW A;  1VQG A;  2NB0 A;  3K5O A;  1EYA A;  4JG2 A;  2XWB B;  4K8I A;  4P73 A;  2Q2I A;  1R9T H;  1SBB B;  3TRZ A;  4A3L G;  2L12 A;  1KQS A;  1D5Z C;  3PUX A;  2N49 A;  3NTK A;  1BBX C;  1HNX L;  1MHW C;  2EYF A;  3OHX C;  3VDY A;  1WCM G;  3T1Y Q;  3VR3 A;  2NN6 I;  1PFS A;  3I8Z A;  1JCK B;  1V1P B;  5LL6 S;  4XQQ A;  1IBM Q;  1L0Y B;  1EZ8 A;  1O7I A;  2A6E C;  3FP9 A;  5G3L D;  2K50 A;  1YNJ C;  2RA4 A;  3DEP A;  2K6A A;  1VQL A;  4I65 A;  3I4N H;  2OWO A;  2YYZ A;  4A3L H;  5CYU A;  1NE3 A;  2K4K A;  1PZI D;  2KCT A;  3L9A X;  5C0X H;  5J3B A;  1HR0 W;  3Q0A A;  4R4T A;  1DJR D;  3GD7 A;  3P20 A;  2VS1 A;  3ERO A;  3TME A;  4DFA A;  2M00 A;  2Y0S E;  2X6G A;  1CQF A;  2B29 A;  4F7X A;  4JI2 L;  4A3K B;  1UE1 A;  1XNQ Q;  5LMU Q;  2PCF B;  1MJE A;  1D1I A;  2DY7 A;  1FD7 D;  1Y1W H;  5C3W A;  1X6O A;  3RNU A;  3S16 H;  1I4X A;  1DGS A;  4POG A;  4I7Z C;  2UXB L;  1KNA A;  1ET6 A;  3A54 A;  4BBS B;  3I55 A;  2B3G A;  1ML0 D;  2F4I A;  3KJO A;  2TSS A;  4DV0 Q;  3MA2 B;  4R4O A;  3SR1 A;  4RGO S;  3KLW A;  2MNA A;  4B3R L;  3GTM B;  1YHB A;  4DXG A;  3MZ5 A;  4EQN A;  1SEB D;  1GHJ A;  3DHQ A;  2QDB A;  2A6E D;  4HJ5 A;  2N88 A;  1BXT A;  2R7F A;  3CCM A;  1FNW A;  2JJQ A;  1CUK A;  4HMJ A;  2E2I B;  2R6G A;  1I4Q A;  1K0S A;  2JSO A;  5EKK A;  1GOZ A;  2DGY A;  3H0G B;  4LAA A;  2JA7 H;  1F2L A;  4TKO B;  3VYR A;  2I46 A;  4DNT B;  4EQO A;  2R93 B;  2EXD A;  4BY7 G;  2FIN B;  1TII D;  3MAQ A;  1TS2 A;  1PRT D;  2BE5 D;  5C5L A;  1X3Q A;  5JPN C;  1XMQ L;  4G4K A;  3JAM i;  4GS3 A;  5EPK A;  3A7A B;  1B9N A;  4JI5 L;  1PYW D;  2AUK A;  2VY3 A;  4DXF A;  1LAC A;  1NY4 A;  1Y8N B;  5FK9 C;  1ESR A;  4JW0 A;  1PMR A;  1XMO Q;  4JYA L;  1A15 A;  1UE7 A;  1SND A;  4DV2 L;  2ZTE A;  3C3L A;  5IGB A;  3MTS A;  2VB3 X;  1RCV D;  4IQZ A;  5IYD G;  2KHJ A;  2MO1 A;  5EQ0 A;  4ALP A;  1E1T A;  1STN A;  4A3J H;  3CC2 A;  2NVT H;  2ZM6 Q;  1SE4 A;  2EYM A;  1BOS A;  4OWT B;  3NQI A;  3PF4 A;  3H94 A;  1ZKO A;  2M2L A;  3HZX A;  3A55 A;  1B3A A;  3OMC A;  3D31 A;  1S5E D;  4N9P A;  4CGY B;  1FYC A;  1HR0 L;  2PNH A;  1VQK A;  1KRT A;  4DR5 L;  5C4X H;  3HOY H;  4KHP L;  5CV9 A;  3M4O B;  3L7Z C;  2L0C A;  3V05 A;  4IUV A;  1E24 A;  4DV4 Q;  5JJI A;  1U4M A;  4U67 3;  5LHY 1;  2EJG C;  1IBM L;  5C4J H;  4DV3 L;  2VB2 X;  5EJW A;  1CFM A;  1LTL A;  1IYU A;  4JBM A;  3HG9 A;  3S2D B;  3CPF A;  1BCP C;  4ZYS A;  2D5D A;  1EOV A;  2AQ2 B;  4UDU C;  2F3I A;  3NSW A;  2B2Y C;  4Y52 H;  4RKL A;  1IKL A;  4YY3 Q;  3PO3 G;  1U9R A;  3BU2 A;  1H9R A;  2I07 B;  5K36 G;  4C2M H;  2AWN A;  1BKB A;  1RIP A;  3U4V A;  5IYD H;  2CVR A;  4CDC C;  5HY6 A;  4F88 A;  4CDD C;  3U9S A;  4CDF C;  1JT8 A;  2M9V A;  2YV5 A;  4IFD G;  4HIM A;  3RD4 A;  3M4P A;  1CKN B;  4WJW A;  2K5V A;  1LLR D;  3A5Z B;  1QNK A;  4LFA L;  3X3N A;  1HNX Q;  3ND9 A;  2F0N A;  2WKD A;  3J81 E;  1YIT A;  1PH9 A;  1X55 A;  2RDH A;  4YIJ A;  3EVQ A;  3K7U C;  1IBL Q;  4RGT A;  2KCM A;  3HOZ H;  1TWH B;  3CU7 A;  3GV3 A;  1DM0 B;  3GTP B;  3BDO A;  2EIF A;  2Y0S G;  1TQO A;  4BA2 I;  2QF7 A;  4CKB A;  2YU9 B;  3E6Z X;  4A3M H;  4QUF A;  3FKI H;  3RN5 A;  2ID0 A;  3TBI B;  4IFD J;  2EY5 A;  3D8G A;  3HOX H;  4QIW B;  4AYB E;  1I50 H;  4X3K A;  5IYC H;  3S14 H;  5EGT A;  1L1O A;  4LWC A;  4PZ8 A;  2XIW A;  1KXL A;  1EYC A;  1HZA A;  4A3I H;  1LTA D;  3KDF A;  5FO9 B;  4RCN A;  3FDT A;  5IE8 A;  3G48 A;  1L1O B;  3P7J A;  4RWS C;  1F9S A;  3U4Z A;  4BBR G;  1A8V A;  1CK1 A;  4DGZ A;  1RDP D;  3R8B A;  2JA8 H;  1HHV A;  3MXG A;  4LUV A;  1IL8 A;  2E75 C;  4LW1 A;  3KJP A;  4ZRZ A;  2D0O A;  2CH4 W;  1O78 A;  1P8L A;  1YIJ A;  2J7Z A;  4LF8 Q;  3DUZ A;  1FJG L;  2MGS A;  3PUV A;  4ME3 A;  1EIH A;  3G7L A;  1EWH A;  3KUP A;  5BR8 L;  5C0X J;  3A74 A;  2LKV A;  1S72 A;  1NSN S;  2PW5 A;  3CCV A;  4NP5 A;  4JI5 Q;  2EVB A;  1SAP A;  3HOW B;  2IHF A;  2Z4I A;  3PGZ A;  3AQQ A;  1K8G A;  1WOC A;  2QW7 A;  2Y0S B;  4GOP A;  1PH2 A;  4LF6 L;  5E3F A;  4R8N A;  1N36 Q;  1VQI A;  2L11 A;  3UDF A;  1XNR L;  3KYH C;  4K5V A;  2CH4 A;  2VL6 A;  2AQ3 B;  3F2B A;  4DV1 L;  5C3E H;  5AFW A;  4A3J B;  2WAC A;  4HJ7 A;  3HKZ E;  2O4X A;  1MI2 A;  2R7Z B;  2WB1 G;  4M1U B;  2E2H H;  4ZK9 B;  2F1M A;  4XT3 B;  4LFC L;  3I91 A;  5JEA J;  4C3I B;  4FF3 A;  5J39 A;  3NWS A;  3C1F A;  2WFW A;  4P2C B;  2Z8L A;  2Z0S A;  2PZT A;  3KK7 A;  1VQ4 A;  3N52 A;  3VR2 A;  1IHZ A;  5DNF A;  1ASY A;  4QMG A;  1MIU A;  1FNV A;  4K6L A;  3OWF A;  1X56 A;  4NXN Q;  2EOT A;  5A2Q E;  1LV9 A;  1C9O A;  1BF4 A;  4JI2 Q;  1YZ6 A;  2LXK A;  5HGT A;  1K8M A;  1HTP A;  3OPO A;  4QB4 A;  1XX8 A;  3HOX B;  2EYO A;  1H9S A;  1V43 A;  2EDG A;  4CJ0 B;  1E22 A;  2R92 G;  1PTO B;  2QIL A;  3RUZ A;  1A2T A;  2B2W C;  4XQJ A;  2Z6B A;  2K5W A;  3I72 A;  1TWG B;  3ND8 A;  1ET9 A;  3HOV B;  5DEH A;  4A3J G;  4K5W A;  4OX9 L;  3H91 A;  4H0L C;  1EQR A;  1SNO A;  1G8Z D;  4ILW A;  3S2H H;  1JWS D;  1CHP D;  4NB3 A;  3MXU A;  1E3P A;  5CBE E;  4HIO A;  1Y1V B;  4V0B A;  1BNZ A;  2YTX A;  4JBK A;  2V4D A;  1VQF A;  1Z47 A;  3A8K E;  4DPG A;  1N34 Q;  1BCP D;  3VYU A;  1X3G A;  2A68 C;  5M5X B;  4KK7 A;  4KD4 A;  1BR9 A;  2KCN A;  4F8M A;  2IJ0 A;  4TQU S;  4C2M B;  3GTL H;  5I6Y A;  3QWN A;  1SDF A;  3AFQ A;  2AQ1 B;  1LYL A;  3PO2 G;  2O5J C;  5FLX L;  5EPJ A;  3H3V I;  1J5E L;  1ZYR C;  1EWC A;  3DLL A;  1O7Z A;  1I6H B;  2ZJQ A;  1IBL L;  1GHK A;  1U5K A;  5IP7 H;  1N9W A;  2PMZ E;  2A74 C;  4RGM A;  3CC4 A;  2X6L A;  4RH6 A;  4AIM A;  2R7Z G;  2D2C C;  4A3I B;  2K5N A;  3CP0 A;  2PQA B;  2BA0 A;  4DR2 L;  4JV5 Q;  5D3D A;  1PH4 A;  4V19 0;  5DAU A;  4B3T L;  1YVC A;  2F0Q A;  1DD2 A;  3AMU A;  1T5E A;  2F0P A;  3DMU A;  2YTY A;  3M9B A;  5CC4 A;  3CCE A;  4OX9 Q;  1Q1B A;  4DNI A;  4MTK A;  3S1M H;  4BWG B;  1KDA A;  4KHP Q;  1PRT C;  2BE5 C;  4AQY Q;  4X66 Q;  5GAD C;  4DAY B;  4R4I A;  5C44 G;  1HZB A;  4XIG S;  2RHQ B;  2X69 A;  3H09 A;  4C56 C;  4BBS H;  1G6Z A;  1JMC A;  4DKA C;  3J7A 5;  1TY2 A;  3K5M A;  3GTQ B;  1O7Y A;  4IOC A;  1S3O A;  2FMC A;  3C1E A;  3DWA A;  5C4H A;  3VR6 A;  1EFW A;  3S2H B;  3K5L A;  1EQV A;  1VQA A;  1FGB D;  4NXN L;  3RZO B;  2GVA A;  4ZQ3 A;  4DR6 L;  2WAQ G;  4XT1 B;  3NP8 A;  4DUY Q;  3ERS X;  1XXG A;  3HOZ B;  2JK8 A;  3AB9 A;  5IGE A;  2ALY B;  5I4D A;  3OW2 A;  4DAV A;  4P72 A;  3H6M A;  5M3F B;  4DR1 L;  5KRU A;  3H3V C;  4DR5 Q;  1E2V A;  1SLJ A;  4PZ7 A;  2UUB L;  2FMM A;  3ONA B;  2LY7 A;  3FEW X;  3H0G H;  5D14 A;  1I94 Q;  1SMY D;  1GUG A;  4DAY A;  2VUM B;  4UP8 A;  5CMD A;  4JI1 L;  2UUA Q;  1D1K A;  1SE3 A;  1KC8 C;  2UXD Q;  2B8G A;  1WI5 A;  3KF8 B;  3K7A B;  5IP9 H;  1M90 C;  3F2U A;  1PDQ A;  1RF2 D;  1D2B A;  1GO3 E;  1NMG A;  3M7G A;  4A3B G;  3TSS A;  5IP9 G;  1AFP A;  1JR0 D;  1DOL A;  1ENC A;  1VMP A;  4DR4 L;  2QEX A;  4CDE C;  1Y69 U;  1LAB A;  2B2V C;  3W1B A;  5M5W B;  4YWM A;  1J5E Q;  4LF6 Q;  1ENA A;  1HNZ Q;  1KNE A;  1PTO F;  4X62 L;  3HKZ B;  1ONL A;  2K28 A;  1H9J A;  1MJC A;  2IX3 A;  2B63 H;  3JAM L;  2QA4 A;  2HUG A;  2F0E A;  3TZU A;  5BN3 A;  4J15 A;  4LF5 L;  3LGJ A;  4JPB W;  1X3E A;  4C3H B;  1WTO A;  4IZ8 A;  3HOU G;  1E2W A;  2NZO A;  1E1O A;  3QOJ A;  1CQV A;  5E4X A;  4A3E B;  4HTH A;  4DK1 A;  5LMU L;  4GKJ L;  1K3B C;  1WD1 A;  1XPR A;  2SOB A;  3KDF B;  4XQN A;  4A3F B;  2BOS A;  4H7B A;  2B8F A;  3S16 B;  3I4O A;  2K03 A;  2F0V A;  3UDI A;  5K5P A;  4A3K H;  4B9X A;  1PA6 A;  1AW7 A;  3BG3 A;  1DYQ A;  1EZ6 A;  1WTV A;  3BZD B;  3SGI A;  4R1J A;  2FFK B;  3PIO A;  4KJN A;  3S15 H;  1DOM A;  3P75 A;  1JE5 A;  2QCP X;  3MHB A;  3CQZ H;  1PH5 A;  4IO9 A;  3BYY B;  5FJ8 G;  1PYB A;  1UEB A;  3O13 A;  4KN4 C;  3PIP A;  3GTG H;  2A73 B;  1UNS A;  1VQO A;  3NTH A;  1K3R A;  3J80 E;  1Y8P B;  4JI4 Q;  4GKJ Q;  1ZXT A;  1K28 A;  4KTA A;  2HT1 A;  4DAP A;  5HUR A;  5IWA L;  3HOZ G;  2QGQ A;  4JC0 A;  3S1N B;  3M4O H;  2QKI C;  2IW3 A;  1EYD A;  1PZK D;  4QY7 A;  4HID A;  4IUR A;  2JA7 B;  1X3P A;  4LF5 Q;  4GN5 A;  4OON A;  1K83 H;  4DR7 Q;  3NXW A;  1GUT A;  2AUJ D;  2HQL A;  3VYS A;  4WFN 3;  3UE1 A;  2MHV A;  1KLG D;  4BY1 B;  1AH9 A;  1CSQ A;  3A8I E;  1HFG A;  3I73 A;  4ZKB B;  4AYB G;  1N33 L;  5KND A;  2B63 G;  4IOA A;  5LMN L;  3E0J A;  4CKE A;  1STH A;  3T1Y L;  1I3Q B;  5LMN W;  4JI7 L;  5JVG 3;  4BXX G;  1I6H H;  1OTC A;  2YTV A;  4NDX A;  3BVG A;  1UEA B;  1WFQ A;  1WTQ A;  3CCL A;  2OTJ A;  1QOH A;  2F52 A;  3RLN A;  3SK6 A;  3I4M G;  1Q8K A;  3HOX G;  4X64 L;  4FF2 A;  1HQM C;  2IY5 B;  5GRO A;  5D65 A;  2OTL A;  4HR7 B;  4LF9 L;  2UXD L;  1PFB A;  1FGU A;  3MVV A;  2PQA A;  3EFX D;  1U4R A;  3KLS X;  5M5X H;  2MUY A;  1WJJ A;  2PW7 A;  2Z6K C;  4JI0 Q;  1QJO A;  4DR1 Q;  1MKH A;  1CI3 M;  5D3I B;  1HA5 A;  2R92 H;  1UAP A;  3K7A H;  4OEL B;  2ZXO A;  5I6W A;  4LF8 L;  1FJG Q;  1Z6H A;  2ICI A;  5F2D A;  2LMC B;  1Y1W G;  1YI2 A;  1YJ9 A;  4MIU A;  3CCJ A;  1HNW L;  2E5L L;  3S1R H;  2R7Z H;  3U50 C;  4BY7 B;  1PHJ A;  1F9Q A;  3AFP A;  5C3X A;  2PQE A;  5C3E B;  1HUM A;  2G9H D;  2ZJR A;  1TS5 A;  3MXN A;  1QZG A;  1VQP A;  4YHH L;  5M5Y B;  1G51 A;  1Q3L A;  4N8X 1;  4IPC A;  5IIF A;  3S24 A;  4A3D B;  3J7Y W;  2K75 A;  3LNN A;  2NVX H;  4X6A H;  1VQB A;  1I4G A;  1V1O A;  2VQF L;  2BDO A;  1STB A;  2ASB A;  4DR2 Q;  4JV5 L;  4A76 A;  1TKW B;  2V1C C;  1WTR A;  3HOV G;  2R7D A;  3BZK A;  3S1M B;  3VA5 A;  2MO0 A;  1SFO H;  2PO4 A;  4JVZ A;  5IGG A;  4OXP A;  3J80 c;  2JA9 A;  1NCV A;  4DNR B;  3GO5 A;  2KOL A;  2KVM A;  5LMN Q;  4PMW A;  3T56 B;  3PIO 3;  1IW7 D;  1CZG A;  1X32 A;  2L1B A;  4A3C H;  1CA6 A;  3CRL C;  4O42 A;  2HD3 A;  3DWQ A;  3GTO B;  3I90 A;  1CT1 D;  5FLX c;  1EIG A;  4EVO A;  2EZV A;  4JCV E;  3NTI A;  1NUC A;  2A68 D;  4XDX A;  2LS0 1;  1LM0 A;  1C4Q A;  1FL0 A;  1YNN C;  2KUM A;  1TWF B;  1SXT A;  3Q8D A;  3Q23 A;  4B3S L;  3S14 B;  3ITP A;  3JC6 6;  1EIF A;  4K8J A;  1B2T A;  1B8A A;  1A2U A;  1JOQ A;  4A3E H;  4G7Z C;  2E2H B;  4WJ3 M;  4TSS A;  2I0Q A;  1TU2 B;  3M85 A;  4ZKC B;  3K58 A;  3GTP H;  2A69 C;  4HAE A;  4JK1 C;  3GP7 A;  4RKB A;  4KHZ A;  4DV6 Q;  4A75 A;  4B3M L;  1A3T A;  5IY0 A;  2EPB A;  4DV3 Q;  1BBU A;  1P16 A;  1CHQ D;  1G2T A;  1LTI D;  4DV4 L;  2ZTC A;  4NMZ A;  4A3C G;  2UU9 L;  5IGC A;  2I5L X;  1CTM A;  2P5Z X;  2K14 A;  5T1G A;  3EJI A;  4A3G G;  3E0E A;  4J8Q A;  1MGS A;  2I5M X;  3D6C A;  3E5S A;  3QB3 A;  5JEA G;  3QO2 A;  2K5H A;  3R93 A;  1YEZ A;  2NZ1 D;  4IUU A;  3IL8 A;  3NHH A;  2HHH Q;  4HIK A;  3HOV H;  1RTN A;  1YNJ D;  1CKO A;  5JJK A;  4N8F A;  1B4O A;  3D3R A;  1L1O C;  1SNC A;  2WKC A;  4FYD A;  3G6J B;  3NBH A;  1IYJ B;  1NJI C;  1S4Z A;  1NR4 A;  1HZ9 A;  4HED A;  4CKC A;  1ICW A;  2EY1 A;  3G4S A;  4L5Q A;  1VQ6 A;  3T53 B;  1B1Z A;  1HH2 P;  1R4P B;  4RG1 A;  3VR5 A;  1L0X B;  1TWH H;  3I4L A;  4IUN A;  4X62 Q;  2H5X A;  3S1R B;  2ZXP A;  3RZO H;  2L55 A;  1X3F A;  4YHH Q;  1QG7 A;  3RN2 A;  4A3D H;  5BN4 A;  4Y7N H;  3TN2 A;  4DUY L;  1JJG A;  5M9O A;  1SRU A;  4DAM A;  4DV1 Q;  2OF1 A;  2JXM B;  1SJE D;  4A3F G;  1XNR Q;  3K80 C;  2YU9 H;  3I70 A;  5CGK A;  3VA7 A;  1UWV A;  4IPG A;  4XXE A;  3TRE A;  1HNW Q;  1J8I A;  1TR5 A;  5EPL A;  4NW2 A;  2XVS A;  1LT4 D;  1HUN A;  1F9R A;  2E76 C;  4B3R Q;  1E2Z A;  1BUV T;  1TWG H;  1E0B A;  4LF4 Q;  1SNQ A;  1WTH A;  5IYC G;  4YWK A;  4DF7 A;  5ELO A;  1CA5 A;  1YHQ A;  3L2P A;  4AQY L;  1T9H A;  4C3J H;  2LSS A;  5FLX E;  3IFD A;  5JEA H;  1Z7T A;  1JQY D;  2EJM A;  1IKM A;  2PZW A;  4H02 A;  2E8G A;  1GD7 A;  1EY5 A;  2SEB D;  2LFN A;  2KEE A;  1STE A;  2F0U A;  4OIJ A;  4LF9 Q;  1LTT D;  1LT3 D;  3K81 C;  5EAY A;  1U0L A;  2N8N A;  1EYG A;  4QJF A;  1SMY C;  3HOU B;  4L5R C;  2FJ2 A;  5DLQ E;  1VQ5 A;  3S1Q H;  1MSH A;  4DK0 A;  1C7Y A;  2L9H A;  4HMI A;  1A63 A;  2Q8T A;  3VR4 A;  1TWA B;  1QUQ A;  3SDZ A;  1SNM A;  2F3V A;  3OYY A;  3A0J A;  2UXC Q;  1NMF A;  2EQS A;  3DXJ C;  1PTO C;  4GLA C;  1EQQ A;  2BDN A;  3K59 A;  1SYE A;  1BBW A;  4B3T Q;  5GAE C;  2CQA A;  3GTG B;  2IPK D;  4RHS A;  2OEO A;  2RSN A;  5AJ3 Q;  5IYB H;  5GAH C;  4GLX A;  1BDO A;  4NKL A;  2NN6 H;  4LUZ A;  1HCZ A;  2G9D A;  3I56 A;  2E74 C;  4A3M B;  3FVQ A;  1Y14 B;  2R92 B;  1W6J A;  4J1M A;  2WP8 J;  2WAQ E;  3TS0 A;  1JB7 A;  1B7Y B;  4DV5 L;  1UE5 A;  5I2X A;  2CW0 C;  3FRP B;  4S3S A;  2HHH L;  1PH8 A;  3OWE B;  1VF7 A;  1N8R C;  2LXJ A;  3Q22 A;  4FNF A;  3D4D A;  4OEM B;  3NEL A;  4ODG A;  3U58 A;  2KEN A;  1XWE A;  2UXC L;  1I6V C;  1VMC A;  3EN2 A;  4YCW A;  5E1F A;  3W5O A;  1PTO D;  4GNX B;  3OIQ A;  1GUN A;  2R61 A;  1F9P A;  1V8Q A;  3GTM H;  4B3M Q;  4DV6 L;  4BY1 G;  5GQO A;  2ZM6 L;  1FVI A;  2L15 A;  3QJY A;  3M4Q A;  1S5B D; 
#chains in the Genus database with same CATH homology
 3C46 A;  4X3U A;  1B44 D;  2PPB C;  3HOY B;  5C4X B;  4IUP A;  3RLF A;  1RD9 D;  1K83 B;  4KY5 A;  3FPP A;  4C3J G;  3I4M B;  2DN8 A;  3QOL A;  3Q24 A;  3PO3 B;  3FPU B;  2RBM A;  4FF4 A;  4KI0 A;  5T1I A;  3URY A;  2F0O A;  4C1N I;  3DM1 A;  3M7N A;  2NTT A;  4B08 A;  2BA1 A;  2JE6 I;  2B39 A;  3D4R A;  4CJ2 C;  3A8J E;  2XRS D;  4KY6 A;  3A7L A;  4M8A A;  3UI2 A;  3GQB A;  2L5T A;  4IUQ A;  4R8I A;  4KHV A;  3S15 B;  2B2T A;  3D4W A;  5M3M B;  4DA2 A;  1G29 1;  5CV6 A;  1PLF A;  4KJO A;  3N6R A;  5IGD A;  2K05 A;  3V96 A;  4HN7 A;  4OIK A;  3SK8 A;  1IYV A;  3KBX A;  1GUS A;  1F2Z A;  3I4N B;  1OO9 B;  3MC0 B;  3SXH A;  1LTG D;  3GV6 A;  4F87 A;  1PFM A;  4KD3 A;  3J7A F;  4OGQ C;  1EY0 A;  3EQL C;  1ROD A;  1I50 B;  2B2W A;  2DY8 A;  2Q8R E;  3IFT A;  3BDC A;  4PNY A;  3CRK C;  2J4X A;  5JOB A;  1EL0 A;  4A3G B;  1OXS C;  3U9O A;  1J9O A;  2F0G A;  2KQ3 A;  1SYD A;  1EY6 A;  3NWT A;  1XYI A;  2BCO A;  1HXY D;  2F0L A;  5ELD A;  3NK9 A;  1VCI A;  1NR2 A;  3MFG A;  3K57 A;  2ENB A;  3C2P A;  1JOO A;  4G7O C;  2F0F A;  3KBG A;  4C3J B;  5CV7 A;  4ZUJ A;  1I4H A;  3R2I A;  3K5N A;  4L6T B;  3BVM A;  5JPM C;  2NVY B;  2WII B;  2IX1 A;  2PZU A;  1WTX A;  2NTS A;  5E4W C;  2KEC A;  5DM6 3;  1C48 A;  3NPP A;  1TVX A;  2RVL A;  3FKI B;  4QCL A;  2TMP A;  1LTS D;  2HDM A;  4OO1 G;  2A6H D;  4AYB B;  3T13 A;  3GTJ B;  4OO1 I;  2D9U A;  1EY4 A;  3SK5 A;  2JYO A;  2B2U A;  1AZP A;  3BDL A;  1CZW A;  1PZJ D;  5FOB B;  3OIP A;  2EYL A;  4B9W A;  4L63 B;  3HGB A;  1V1P A;  2KCC A;  5A35 A;  1K8O A;  2SNM A;  1JWU D;  2CW0 D;  2EJF C;  4HCS A;  2K04 A;  3KLS A;  2F0H A;  1S5F D;  1S5D D;  2NBF A;  3HEJ A;  2RDF A;  5ELF A;  2ZT9 C;  2IX0 A;  1STG A;  2H4O A;  1DON A;  1TY0 A;  1ILQ A;  2NWG A;  3PO2 B;  2C5C A;  1JE4 A;  3TDQ A;  1T5X D;  4KKS A;  4IAL A;  1H9M A;  4DU9 A;  4E6I A;  3RMH A;  4WOR A;  1B50 A;  5COY A;  3GTL B;  1IW7 C;  3PUY A;  4X3S A;  5KYI A;  1LTB D;  4RGN A;  4MHE A;  2D62 A;  2PMZ B;  1UUP A;  5CR3 A;  1S5C D;  2K01 A;  4FVM A;  1EY7 A;  4FXK C;  3KLR A;  4A3B B;  2K7V A;  1EY8 A;  1DXM A;  1AP0 A;  2SDF A;  5KIX A;  5EKI A;  2J0T D;  1QCB D;  4L8J A;  5I9P A;  3T51 B;  4A93 B;  3OW7 A;  1KLU D;  1B9M A;  4BBR B;  4FP5 D;  2A69 D;  2R3Z A;  1EQT A;  1GUO A;  4C3H G;  1ZYR D;  3S9W A;  1BO0 A;  2NYZ D;  3W2D A;  2F0K A;  2F0J A;  1NAP A;  3MEH A;  2EYP A;  5DM7 3;  4FF1 A;  1WTP A;  4X3T A;  1M8A A;  4IFD H;  2EE1 A;  2RSO A;  5J1Z A;  5EBC A;  3K6O A;  5K36 H;  3OOC A;  1D5X C;  2K5Q A;  2B2U C;  2F0W A;  2MJ8 A;  1QE6 A;  1SJH D;  1PRT B;  5C4Z A;  2O5I C;  5IOC A;  1F77 A;  3M3Y B;  4IN3 A;  2K5D A;  3J7A V;  2E2J B;  2WV6 D;  3HS0 C;  3NE5 B;  1ESF A;  1EY9 A;  2PYK A;  2F03 A;  2HDL A;  2VNU D;  2HCC A;  2JA5 B;  4QF4 A;  2RQX A;  4C3I G;  4XYO A;  4RFB A;  1PXU A;  2MPM A;  2EY6 A;  1F2Y A;  3LWE A;  4UAI A;  4FXD A;  4RAU C;  3EA6 A;  1WTW A;  4G7H C;  2NVX B;  1CM9 A;  4KMU C;  5COR A;  2KED A;  2L4N A;  3K0Y A;  4Y7N B;  2MP1 A;  2OT2 A;  1OXT A;  5BN5 A;  1JOK A;  4IUT A;  2K32 A;  4ME5 A;  2F0T A;  4K6D A;  3SE0 A;  2F0S A;  1Q12 A;  1TT2 A;  1LT5 D;  3PV0 A;  4RA8 A;  1U4L A;  2CHB D;  1DZ1 A;  3MXP A;  2F3W A;  4XTC S;  5JAV A;  1LT6 D;  2XRQ D;  2B2T C;  1STY A;  4QUC A;  4EQP A;  1JOR A;  2XWJ B;  1I4R A;  1LTR D;  1HFN A;  2QEJ C;  4WRD A;  2KJX A;  2XSC A;  4HCE A;  1G91 A;  3SVM A;  4CJ1 B;  4H13 C;  5J22 A;  2NUC A;  1EEI D;  2K1B A;  3TP5 A;  1KTK A;  1C8C A;  5CV8 A;  5KNC A;  4ZUI A;  4RHR A;  3OMG A;  4DN4 M;  1Q1E A;  3NUC A;  2ICE C;  4N9T A;  1DOK A;  3X3M A;  1F2M A;  3CHB D;  3JAM E;  5ELC A;  2HQE A;  3TZD A;  5C5M A;  4H44 C;  1EU4 A;  3W3A A;  1TS3 A;  4O1N A;  1D5M C;  2DNC A;  2WIN B;  3NBI A;  1MBY A;  1SYB A;  1GXD C;  4OO1 H;  1Y8O B;  3TP7 A;  3T16 A;  1HRJ A;  5CV5 A;  3V2T A;  1SYC A;  1AN8 A;  1WD0 A;  4JBW A;  1SE2 A;  1SYG A;  1II3 A;  3NQT A;  3LWU A;  3ZYY X;  1EU3 A;  4Z9C B;  3DEO A;  1GUW A;  2EXZ A;  1WCM B;  1TS4 A;  1SFO B;  4LMQ D;  2WAQ B;  5C6A A;  3BYT B;  1RJT A;  1PRT F;  2A5H A;  2ZXR A;  2Q8I B;  5C0X G;  1DCZ A;  5KEE A;  2N55 A;  1QIL A;  2KHS A;  3L3O C;  4RCO A;  3SK4 A;  4GZY C;  2RKS A;  1VDZ A;  3AU7 A;  3WOE A;  2JA6 B;  1SYF A;  2HCI A;  4K2L A;  4FXG C;  5ISR A;  5KYL A;  3LX0 A;  3KF8 A;  2JP1 A;  3R3O A;  4R9W A;  1PTO H;  3CQZ B;  3VYT A;  5IT9 L;  3BVZ A;  1AZQ A;  1MSG A;  5IT9 E;  5ELE A;  4K5X A;  1PFN A;  2PNR C;  5I2Y A;  5EKL A;  1Q8I A;  2F0D A;  3J80 L;  1JB3 A;  1OXU A;  2EY2 A;  1U4P A;  5JJZ A;  3A56 A;  5EBD A;  3PMF A;  3BS1 A;  2IT1 A;  5KNB A;  4KY7 A;  1D6E C;  4K2K A;  4PV1 C;  3WDN A;  4PQX A;  2B63 B;  1SNP A;  4OHJ A;  4HSP A;  3T4A C;  5A2Q L;  1O80 A;  2XN9 C;  1HTL D;  4Q5V A;  5LL6 X;  1GJX A;  1SSO A;  1W6K A;  3PUZ A;  3HRZ C;  4PMB A;  3S1Q B;  4CHT B;  2NVQ B;  2B2V A;  1BCP B;  3QIA A;  1FNU A;  5KGU A;  2NVT B;  4K14 A;  2O2L D;  4CBV A;  1KDB A;  3PIP 3;  4LJZ C;  1LO5 D;  2IL8 A;  2JEB I;  2A6H C;  2NN6 G;  4G57 A;  1HPC A;  1A3U A;  4BA1 I;  2Z1C A;  4J6H A;  3D6W A;  2IWH A;  3PUW A;  1RKN A;  1G2S A;  2AWO A;  1Q90 A;  2K33 A;  2OXP A;  3HP3 A;  3TP6 A;  2XNA C;  3MFY A;  4ABN A;  3SEB A;  1WVL A;  4ID6 A;  1O7L A;  4ZLT F;  2H1E A;  2DNE A;  2Z4H A;  1QB5 D;  1A6X A;  5G3L F;  4XYQ A;  1M4V A;  1FR3 A;  4KV6 A;  3GTK B;  1RHP A;  1MD2 D;  5C0X I;  4MN3 A;  1KDC A;  4Q0F A;  1I4P A;  3FMC A;  3QG1 A;  1HQR D;  1AEX A;  2F0M A;  1EEF D;  2B2Y A;  4U68 A;  5IOD A;  5IGF A;  1Y1W B;  4C1N K;  3S17 B;  1B53 A;  1ZEQ X;  4OL7 A;  1EFI D;  3Q6S A;  1R4Q B;  1JWM D;  5C44 B;  1JC7 A;  3CKI B;  4KN7 C;  1QNU A;  1KAB A;  5ELB A;  5TSS A;  3ERQ A;  1BQQ T;  1TWC B;  1VF5 C;  4HSV A;  3R2T A;  1HA6 A;  2JEA I;  4KKT A;  2F0I A;  1A3V A;  2SNS A;  2JA8 B;  4TRD A;  3TP8 A;  1KAA A;  2WB1 B;  5CBA E;  3I3C A;  1ILP A;  4ZAI A;  1OXV A;  2E2D C;  2C9O A;  4ULL A;  3M4Y A;  3P1H A;  2EYJ A;  1JIC A;  3J81 L;  5FO7 B;  1EOT A;  3WOF A;  1XTC D;  1YNN D;  5NUC A;  4PMC A;  1H9K A;  2FHT A;  4LK1 C;  3DWP A;  2GA4 B;  3MWY W;  5FO8 B;  5JVH 3;  4BS9 A;  1BCP F;  5FKA C;  3IKJ A;  1ENF A;  3OSO A;  3SHL A;  4EGV A;  2KA7 A;  4IFD I;  1OXX K;  1RTO A;  3RZD B;  1R9T B;  2RDG A;  4FO2 A;  2EYH A;  5CV4 A;  3IAY A;  5I9O A;  1H9S B;  4KKU A;  1STA A;  5C4J B;  1QWY A;  2VXW A;  2NB0 A;  3K5O A;  1EYA A;  2XWB B;  4K8I A;  1SBB B;  2L12 A;  1D5Z C;  3PUX A;  3NTK A;  1BBX C;  2EYF A;  3OHX C;  3VR3 A;  2NN6 I;  3I8Z A;  1JCK B;  1V1P B;  5LL6 S;  4XQQ A;  1L0Y B;  1EZ8 A;  2A6E C;  5G3L D;  1YNJ C;  2RA4 A;  3DEP A;  2K6A A;  4I65 A;  2YYZ A;  5CYU A;  1PZI D;  3L9A X;  5C0X H;  3Q0A A;  1DJR D;  3GD7 A;  3P20 A;  3ERO A;  3TME A;  4DFA A;  2M00 A;  2X6G A;  1CQF A;  4F7X A;  4A3K B;  2PCF B;  1D1I A;  2DY7 A;  1FD7 D;  5C3W A;  1I4X A;  4I7Z C;  1KNA A;  1ET6 A;  3A54 A;  4BBS B;  1ML0 D;  2F4I A;  2TSS A;  3MA2 B;  3SR1 A;  4RGO S;  3GTM B;  4DXG A;  3MZ5 A;  4EQN A;  1SEB D;  1GHJ A;  3DHQ A;  2QDB A;  2A6E D;  2N88 A;  1BXT A;  1FNW A;  4HMJ A;  2E2I B;  2R6G A;  1I4Q A;  2JSO A;  5EKK A;  1GOZ A;  3H0G B;  4LAA A;  1F2L A;  4TKO B;  3VYR A;  2I46 A;  4DNT B;  4EQO A;  2R93 B;  2FIN B;  1TII D;  3MAQ A;  1TS2 A;  1PRT D;  2BE5 D;  5C5L A;  1X3Q A;  5JPN C;  4G4K A;  5EPK A;  3A7A B;  1B9N A;  1PYW D;  2AUK A;  4DXF A;  1LAC A;  1Y8N B;  5FK9 C;  1ESR A;  1PMR A;  1A15 A;  1SND A;  3C3L A;  5IGB A;  3MTS A;  2VB3 X;  1RCV D;  4IQZ A;  5EQ0 A;  1STN A;  1SE4 A;  2EYM A;  1BOS A;  3NQI A;  3H94 A;  1ZKO A;  2M2L A;  3HZX A;  3A55 A;  1B3A A;  3OMC A;  3D31 A;  1S5E D;  4N9P A;  4CGY B;  1FYC A;  5CV9 A;  3M4O B;  3L7Z C;  2L0C A;  3V05 A;  4IUV A;  1U4M A;  4U67 3;  5LHY 1;  2EJG C;  2VB2 X;  5EJW A;  1CFM A;  1IYU A;  3HG9 A;  3S2D B;  1BCP C;  4ZYS A;  2D5D A;  2AQ2 B;  4UDU C;  3NSW A;  2B2Y C;  4RKL A;  1IKL A;  1U9R A;  1H9R A;  2I07 B;  5K36 G;  2AWN A;  2CVR A;  4F88 A;  3U9S A;  2M9V A;  4IFD G;  3RD4 A;  4WJW A;  1LLR D;  1QNK A;  3X3N A;  3ND9 A;  2F0N A;  2WKD A;  3J81 E;  2RDH A;  4YIJ A;  3EVQ A;  4RGT A;  1TWH B;  3CU7 A;  3GV3 A;  1DM0 B;  3GTP B;  3BDO A;  1TQO A;  4BA2 I;  2QF7 A;  4CKB A;  2YU9 B;  3E6Z X;  4QUF A;  4IFD J;  2ID0 A;  3TBI B;  2EY5 A;  3D8G A;  4QIW B;  4X3K A;  5EGT A;  2XIW A;  1EYC A;  1LTA D;  5FO9 B;  4RCN A;  3FDT A;  3P7J A;  4RWS C;  1F9S A;  1CK1 A;  4DGZ A;  1RDP D;  3R8B A;  1HHV A;  3MXG A;  1IL8 A;  2E75 C;  4ZRZ A;  1O78 A;  2J7Z A;  3DUZ A;  2MGS A;  3PUV A;  1EIH A;  3G7L A;  1EWH A;  3KUP A;  5C0X J;  2LKV A;  1NSN S;  2PW5 A;  4NP5 A;  2EVB A;  1SAP A;  3HOW B;  2Z4I A;  2Y0S B;  5E3F A;  4R8N A;  2L11 A;  4K5V A;  2AQ3 B;  5AFW A;  4A3J B;  2WAC A;  2O4X A;  1MI2 A;  2R7Z B;  4M1U B;  4ZK9 B;  2F1M A;  4XT3 B;  3I91 A;  5JEA J;  4C3I B;  4FF3 A;  5J39 A;  3NWS A;  3C1F A;  2Z8L A;  3KK7 A;  4P2C B;  2PZT A;  3N52 A;  3VR2 A;  1IHZ A;  5DNF A;  4QMG A;  1FNV A;  4K6L A;  3OWF A;  2EOT A;  5A2Q E;  1LV9 A;  1BF4 A;  5HGT A;  1K8M A;  1HTP A;  3OPO A;  4QB4 A;  1XX8 A;  3HOX B;  2EYO A;  1H9S A;  1V43 A;  2EDG A;  4CJ0 B;  1PTO B;  2QIL A;  3RUZ A;  1A2T A;  2B2W C;  4XQJ A;  2K5W A;  3I72 A;  1TWG B;  3ND8 A;  1ET9 A;  3HOV B;  5DEH A;  4K5W A;  3H91 A;  4H0L C;  1SNO A;  1G8Z D;  4ILW A;  1JWS D;  1CHP D;  3MXU A;  5CBE E;  1Y1V B;  4V0B A;  1BNZ A;  2V4D A;  1Z47 A;  3A8K E;  1BCP D;  3VYU A;  2A68 C;  5M5X B;  4KK7 A;  4KD4 A;  1BR9 A;  2KCN A;  4F8M A;  2IJ0 A;  4TQU S;  4C2M B;  5I6Y A;  3QWN A;  1SDF A;  2AQ1 B;  2O5J C;  5FLX L;  5EPJ A;  1ZYR C;  1EWC A;  1O7Z A;  1I6H B;  1GHK A;  2A74 C;  4RGM A;  2X6L A;  4RH6 A;  2D2C C;  4A3I B;  2BA0 A;  5D3D A;  4V19 0;  5DAU A;  2F0Q A;  1DD2 A;  3AMU A;  1T5E A;  2F0P A;  3DMU A;  5CC4 A;  1Q1B A;  4BWG B;  1KDA A;  1PRT C;  2BE5 C;  4XIG S;  2X69 A;  3H09 A;  4C56 C;  3K5M A;  1TY2 A;  3GTQ B;  1O7Y A;  2FMC A;  3C1E A;  5C4H A;  3DWA A;  3VR6 A;  3S2H B;  3K5L A;  1EQV A;  1FGB D;  3RZO B;  4ZQ3 A;  4XT1 B;  3NP8 A;  1XXG A;  3HOZ B;  3AB9 A;  5IGE A;  5I4D A;  4DAV A;  5M3F B;  3H6M A;  3H3V C;  5KRU A;  1E2V A;  2FMM A;  2LY7 A;  3FEW X;  3ONA B;  5D14 A;  1SMY D;  1GUG A;  4DAY A;  2VUM B;  5CMD A;  1D1K A;  1SE3 A;  2B8G A;  3K7A B;  3F2U A;  1PDQ A;  1RF2 D;  1D2B A;  3M7G A;  3TSS A;  1AFP A;  1JR0 D;  1DOL A;  1ENC A;  1VMP A;  1Y69 U;  1LAB A;  2B2V C;  5M5W B;  1ENA A;  1KNE A;  1PTO F;  3HKZ B;  1ONL A;  2K28 A;  1H9J A;  2IX3 A;  3JAM L;  2HUG A;  2F0E A;  3TZU A;  5BN3 A;  4C3H B;  1WTO A;  4IZ8 A;  1E2W A;  3QOJ A;  1CQV A;  5E4X A;  4A3E B;  4HTH A;  4DK1 A;  1WD1 A;  2SOB A;  4XQN A;  4A3F B;  2BOS A;  4H7B A;  2B8F A;  3S16 B;  2K03 A;  2F0V A;  5K5P A;  4B9X A;  1AW7 A;  3BG3 A;  1DYQ A;  1EZ6 A;  1WTV A;  3BZD B;  2FFK B;  4KJN A;  1DOM A;  3P75 A;  2QCP X;  3MHB A;  3BYY B;  3O13 A;  4KN4 C;  2A73 B;  1UNS A;  3NTH A;  3J80 E;  1Y8P B;  1ZXT A;  4KTA A;  4DAP A;  5HUR A;  3S1N B;  2QKI C;  2IW3 A;  1EYD A;  1PZK D;  4IUR A;  2JA7 B;  1X3P A;  3NXW A;  1GUT A;  2AUJ D;  3VYS A;  4WFN 3;  2MHV A;  1KLG D;  4BY1 B;  3A8I E;  1HFG A;  3I73 A;  4ZKB B;  5KND A;  3E0J A;  4CKE A;  1STH A;  1I3Q B;  5JVG 3;  4NDX A;  3BVG A;  1UEA B;  1WTQ A;  1QOH A;  3SK6 A;  4FF2 A;  1HQM C;  5D65 A;  4HR7 B;  1PFB A;  3MVV A;  3EFX D;  1U4R A;  3KLS X;  2MUY A;  2PW7 A;  1QJO A;  1CI3 M;  5D3I B;  1HA5 A;  1UAP A;  2ZXO A;  5I6W A;  1Z6H A;  2ICI A;  5F2D A;  2LMC B;  4MIU A;  4BY7 B;  1F9Q A;  5C3X A;  2PQE A;  5C3E B;  1HUM A;  2G9H D;  1TS5 A;  3MXN A;  5M5Y B;  1Q3L A;  5IIF A;  4A3D B;  3J7Y W;  3LNN A;  1I4G A;  1V1O A;  2BDO A;  1STB A;  1TKW B;  1WTR A;  3S1M B;  3VA5 A;  2PO4 A;  5IGG A;  1NCV A;  4DNR B;  3GO5 A;  2KOL A;  2KVM A;  4PMW A;  3T56 B;  3PIO 3;  1IW7 D;  1CZG A;  1X32 A;  2L1B A;  1CA6 A;  3CRL C;  4O42 A;  3GTO B;  3DWQ A;  3I90 A;  1CT1 D;  1EIG A;  4EVO A;  2EZV A;  3NTI A;  1NUC A;  2A68 D;  4XDX A;  2LS0 1;  1C4Q A;  1YNN C;  2KUM A;  1TWF B;  1SXT A;  3Q23 A;  3S14 B;  3ITP A;  4K8J A;  1B2T A;  1A2U A;  1JOQ A;  4G7Z C;  2E2H B;  4TSS A;  1TU2 B;  3M85 A;  4ZKC B;  3K58 A;  2A69 C;  4HAE A;  3GP7 A;  4JK1 C;  4RKB A;  4KHZ A;  1A3T A;  2EPB A;  1CHQ D;  1G2T A;  1LTI D;  4NMZ A;  5IGC A;  1CTM A;  5T1G A;  3EJI A;  5JEA G;  1MGS A;  3QB3 A;  4J8Q A;  3D6C A;  3E5S A;  3QO2 A;  3R93 A;  2NZ1 D;  4IUU A;  3IL8 A;  3NHH A;  1RTN A;  1YNJ D;  1B4O A;  3D3R A;  1SNC A;  2WKC A;  4FYD A;  3G6J B;  3NBH A;  1S4Z A;  1NR4 A;  4HED A;  4CKC A;  1ICW A;  2EY1 A;  3T53 B;  1R4P B;  1B1Z A;  3VR5 A;  1L0X B;  3I4L A;  4IUN A;  3S1R B;  2ZXP A;  2L55 A;  1QG7 A;  5BN4 A;  3TN2 A;  5M9O A;  2OF1 A;  2JXM B;  1SJE D;  3I70 A;  5CGK A;  3VA7 A;  4XXE A;  1J8I A;  1TR5 A;  5EPL A;  4NW2 A;  2XVS A;  1LT4 D;  1HUN A;  1F9R A;  2E76 C;  1E2Z A;  1BUV T;  1E0B A;  1SNQ A;  4DF7 A;  1CA5 A;  5FLX E;  3IFD A;  5JEA H;  1Z7T A;  1JQY D;  2EJM A;  1IKM A;  2PZW A;  1EY5 A;  2SEB D;  2LFN A;  2KEE A;  1STE A;  2F0U A;  4OIJ A;  1LTT D;  1LT3 D;  1SMY C;  3HOU B;  2FJ2 A;  1MSH A;  4DK0 A;  2L9H A;  4HMI A;  2Q8T A;  3VR4 A;  1TWA B;  3SDZ A;  1SNM A;  2F3V A;  3DXJ C;  1PTO C;  2BDN A;  3K59 A;  1SYE A;  2CQA A;  3GTG B;  2IPK D;  4RHS A;  2OEO A;  2RSN A;  1BDO A;  4NKL A;  2NN6 H;  1HCZ A;  2G9D A;  2R92 B;  1G6Z A;  4A3M B;  2E74 C;  3FVQ A;  1W6J A;  4J1M A;  2WP8 J;  5I2X A;  2CW0 C;  3FRP B;  4S3S A;  3OWE B;  1VF7 A;  3Q22 A;  4FNF A;  3D4D A;  4ODG A;  1XWE A;  1I6V C;  1VMC A;  5E1F A;  1PTO D;  3OIQ A;  1GUN A;  2R61 A;  1F9P A;  1V8Q A;  3QJY A;  1S5B D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...