2RSOA

Solution structure of the chromodomain of swi6
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
92
structure length
92
Chain Sequence
GSHMESKSSSKKLKENAKEEEGGEEEEEDEYVVEKVLKHRMARKGGGYEYLLKWEGYDDPSDNTWSSEADCSGCKQLIEAYWNEHGGRPEPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Chromatin-associated protein swi6
publication title Intrinsic nucleic Acid-binding activity of chp1 chromodomain is required for heterochromatic gene silencing
pubmed doi rcsb
source organism Schizosaccharomyces pombe
total genus 7
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2012-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2rsoA00
3GV6A 4CJ1B 1WTXA 2B2TC 1C8CA 1ILPA 5JJZA 1F9RA 2B2UA 2DY7A 2VXWA 1XYIA 1EL0A 4MN3A 1GUWA 1BO0A 2BDNA 2Q8TA 1RODA 1U4MA 3IFDA 4XT1B 4QUCA 1F2LA 1X3PA 2FINB 1O7YA 1PLFA 1QE6A 3ONAB 4IUPA 3IL8A 5EPKA 4ZK9B 1JICA 1PDQA 3G7LA 2HDMA 4RA8A 4MHEA 1M8AA 1O7ZA 2B2UC 1F9PA 3DEPA 1HFNA 3N52A 1JE4A 1SAPA 2KEDA 3R93A 1U4RA 2K01A 3Q6SA 4X3UA 4CJ0B 1B53A 2K05A 2KVMA 2L11A 4UAIA 5E4XA 5EQ0A 2B2YA 5T1GA 1BBXC 2RSOA 2X6LA 4HEDA 1EIHA 2MP1A 3D6WA 1WTOA 5EPLA 1BF4A 1MSHA 1Q3LA 2SDFA 2XIWA 5D65A 2K04A 1HUMA 4X3TA 2D9UA 1CA5A 4OIJA 2B2WA 1AZPA 1G2TA 2L12A 3DEOA 4R8IA 4OIKA 1RHPA 2JYOA 2L4NA 4LMQD 2K1BA 1WTRA 1HUNA 5T1IA 4IUQA 4CJ2C 4HCSA 2B2YC 3LWEA 4U68A 3UI2A 1PFBA 4DN4M 1LV9A 2HUGA 1DOMA 3DM1A 5CBEE 1U4PA 4O42A 4RAUC 1WTVA 4HSVA 1EQTA 2IL8A 4IURA 1X32A 5CORA 2X6GA 1B4OA 2HCIA 2RVLA 2L1BA 1XX8A 1F9SA 2KUMA 2B2WC 1PFNA 1CA6A 1HA6A 1PFMA 1ESRA 2FJ2A 1U4LA 2JP1A 3I91A 2J7ZA 2R3ZA 4RWSC 5E4WC 1B50A 4IUUA 2K03A 1WD0A 2X69A 2MGSA 1HRJA 1BNZA 1MGSA 1NR4A 2FMMA 5EJWA 1IKMA 2MJ8A 1ZXTA 1MI2A 5DNFA 1ILQA 1ICWA 1RTNA 5EPJA 3TZDA 5CBAE 4QUFA 4HAEA 5CMDA 2EE1A 1EOTA 1IL8A 1O80A 2HCCA 1WTPA 4X3SA 1J8IA 1S4ZA 2N55A 2Q8RE 4ZKBB 2KOLA 1E0BA 2M2LA 2KEEA 2HDLA 5AFWA 4XDXA 1WVLA 1AP0A 1WTQA 1DZ1A 5D14A 1EIGA 3FPUB 1DONA 3MTSA 1SDFA 1CM9A 3MWYW 3QO2A 1J9OA 1AZQA 2L9HA 1SSOA 4IUTA 2H1EA 3F2UA 1MSGA 1NR2A 4XT3B 4ZKCB 2NWGA 2B2VA 4NW2A 3SVMA 3I8ZA 2RSNA 1VMCA 1HHVA 3H91A 3HP3A 2KECA 1DOKA 3I3CA 1X3QA 1WD1A 3TN2A 1G6ZA 1A15A 1F9QA 1HFGA 1VMPA 3GV3A 2FHTA 1B3AA 4IUVA 1B2TA 2RA4A 1G2SA 2B2TA 5COYA 3KBXA 1G91A 1QG7A 1QNKA 2DY8A 1IKLA 1DOLA 1KNEA 2NYZD 2FFKB 5EKIA 2EPBA 1KNAA 1TVXA 2N88A 1WTWA 1RJTA 4X3KA 2B2VC 2EOTA 2MPMA 1ML0D 1NCVA 3FDTA 3P7JA 3I90A 4ZAIA 1NAPA 2NZ1D 4R9WA 4ZLTF 1RTOA 2CVRA 3KUPA 2K28A
chains in the Genus database with same CATH superfamily
1F9RA 4WRDA 3P75A 1C4QA 4BXXH 4K6LA 2PNHA 1J6QA 3NTHA 1ICFB 4KKTA 3AEVA 1U4MA 1Q1BA 3A0JA 3S16B 4EVOA 3I56A 4DPGA 1QE6A 2F4VL 4RA8A 2TSSA 4A3MB 5JJLA 1AE2A 1S5ED 1Q46A 5ELFA 4LF7Q 2UXCQ 3STBD 1F77A 1VQCA 5NUCA 2XWJB 5IIFA 3BVZA 2IX0A 3MHBA 5C4JH 4DV7Q 1QCBD 3MEHA 3OWEB 2MP1A 5C3WA 1XNRL 1MSHA 5JOBA 2VQEQ 3HOUG 1MD2D 5E1FA 1STGA 2QA4A 3Q24A 3ITPA 1V43A 2R93H 2JYOA 3QG1A 3K7AH 4A3KH 4GS3A 2UU9L 1L1OC 1IBKL 1EYDA 4WORA 2QF7A 1U4PA 1TS4A 1UWVA 1PVOA 1K83B 1SFOH 4HJ9A 1TY0A 3CCQA 3K5MA 4OO1G 1ESRA 2FJ2A 1JOKA 3CCJA 1K73C 2UUCL 2WB1G 3K80C 2IHFA 3OIQA 1P8LA 2C5CA 2OEOA 1PH3A 3H09A 5D3DA 1HNXL 2Y0SG 4A3GH 2B39A 3J7ZC 1J8IA 4B3MQ 4OWXB 3GTGH 4MZ9A 3HOXB 4POFA 2PQAA 3HOVH 4IPGA 2EYPA 2QKIC 3BDOA 2PPBC 1AP0A 1VS0A 2PW7A 3OIPA 2K5HA 1XNQL 3MWYW 1MSGA 4IALA 2B2VA 3GTMB 2SNSA 1K28A 1PZKD 4DV3Q 3S24A 2PZTA 5C0XH 1KAAA 2F0NA 3GV3A 1B2TA 1QUQA 4FXDA 3GTOB 4MNOA 4RCNA 4HMIA 3FP9A 5ELBA 4WJ3M 3GTOH 2YU9H 2IWHA 5HY6A 2EYLA 5JPMC 1K8OA 2JA9A 4NDXA 4J8QA 5IGDA 2KJXA 2E2JB 3TP6A 3GTLB 2AMCB 4IFDH 2DNEA 5BR8Q 4POGA 4UDUC 1ASZA 2E2JH 1SBBB 5LHY1 3H3VH 2B2UC 3LX0A 1GM5A 4TQUS 1U4RA 3GTPB 1HQRD 2K05A 3L2PA 3NXWA 4A3BG 4DNTB 1JE5A 4DR6Q 1VQBA 4OXPA 1BDOA 2SDFA 3K59A 1FD7D 2JA7H 3GTPH 1SNMA 3I73A 4FXGC 4ZYSA 3MXUA 4X62L 2ENBA 2XWBB 3D6CA 3CPFA 4A3JB 4OIKA 1TWCH 2JA5G 1G8ZD 2FXQA 1GXDC 4B3RL 4IUQA 3K8AA 3J81c 2RKSA 1QILA 2CKZB 1BQQT 1Z7TA 3KF8A 5IYBH 1JQYD 4ZCKA 2HCIA 1Y1VG 3CC2A 4K0KL 2BCOA 1A6XA 5E4WC 4B08A 4IUUA 4HJ5A 5JJIA 1HR0W 3IKJA 1VDZA 5A2QL 2I07B 4KY5A 3T16A 2CH4W 5DNFA 1D1IA 5CC4A 4C3JB 2XSCA 4HIKA 4APVA 1CQVA 3AYHB 4JI7L 2J4XA 3CW2C 2PNRC 3KBGA 4TVAB 1NJIC 2EJFC 2XTIA 3NQTA 5D14A 3M4QA 4EX5A 2EXDA 4K8IA 2ZM6Q 4IUTA 3QR8A 5IGFA 4GKJL 2B8FA 3BDLA 4R1JA 5DAUA 4JK1C 5LL6X 1SNOA 3F2CA 1AFPA 4XYOA 3Q22A 1B3AA 4IUVA 3CP0A 3NP8A 2QGQA 3J81E 2AWNA 2NVXB 2F0KA 5M5WH 5HGTA 1I4PA 2EPBA 4L5SA 3R93A 1Z9FA 2EOTA 1Y14B 4DGZA 4NXNQ 2H4OA 1IYVA 1VQGA 4IPDA 5I9PA 4CDCC 1FJGL 4UY8C 2QDBA 4J6HA 4QGUA 5DEHA 4P73A 2I5MX 4IPCA 1ILPA 1TWAB 4RH6A 1KC8C 3CMAA 2LFNA 3CQZH 3PUZA 3HOUB 5ELEA 4G7HC 1HZCA 2BDNA 4HIDA 1ASYA 5FJ8G 4XT1B 2UXBL 4JYAL 4H44C 1O7YA 1PLFA 4A3CG 1LUZA 4IUPA 3IL8A 3VDYA 1QB5D 2F0DA 2RHQB 4CDEC 1R9TB 2UUCQ 5EQ0A 1I4GA 5C5MA 3F2BA 3SK5A 1E3PA 4LFBL 2KCCA 5CV6A 1GUGA 2IJ0A 5CV4A 1EIYB 2WB1B 4DAYB 1E7ZA 4C3IH 1EZ6A 3CAMA 4DUYQ 2XNAC 1X3FA 3LNNA 2WP8J 1E1TA 2Y0SB 4O2DA 3LWEA 1VQAA 1KTKA 2BH8A 1YI2A 4Z9CB 2K5QA 4DKAC 3ZYYX 3I4NH 4A75A 1EIFA 2E5LQ 2R61A 3H0GG 1KDBA 1D5MC 3D0FA 2J7ZA 1B7YB 3F1ZA 1XWEA 4HR7B 1EY6A 2F0JA 2ZT9C 5FK9C 4DUZQ 1XPRA 1EYGA 4HAEA 2IX1A 3URYA 3S1MB 3BG3A 3TS0A 1XJVA 1H9JA 3VYTA 3MZ5A 5J22A 5C3EG 1PTOD 2OXPA 1STEA 1WCMH 1GUOA 4ILWA 3MFGA 2HDLA 2Q2UA 2ICIA 1LTLA 4L5QA 5J39A 3TZUA 3CRKC 4ZKCB 5BN4A 1I6HB 1NBWA 5IP7G 2B63G 4X6AH 1NTGA 1X65A 1HPCA 4RGMA 3SK8A 1WD1A 4IOAA 3TN2A 5LMNW 2IPKD 1NNXA 2Z0SA 1SYBA 1QNKA 4Q5VA 1DOLA 5FO7B 1LO5D 1TVXA 1JWUD 2PQAB 4X3KA 3CC7A 4DV2Q 4ZAIA 1LT4D 3I90A 4AQYQ 3CCMA 2PI2E 4IO9A 4A3BB 2R7ZH 4X62Q 2K28A 2I46A 4L5RC 3NE5B 5IT9c 1M4VA 4XXEA 2DY7A 4DAPA 4DR7Q 2O2LD 2Q2IA 2WKCA 3PUYA 4DXGA 1QUQB 2FMCA 5IOCA 2JA5B 1JOQA 2AUJD 2TMPA 4L8JA 3G6JB 4EQ5A 5FLMH 2NZHA 3RD4A 1K8AC 1YIJA 1JWMD 2DUDA 1HFNA 1Y1VB 3I72A 3VYUA 1KAWA 5T1GA 3G6EA 3NQIA 2JA6G 2F0IA 4JI4Q 1YNJC 3KK7A 1A0IA 4KLKA 5I9OA 4WJ4A 4F7XA 3DUZA 4OIJA 3GDEA 2EY2A 2L12A 2EIFA 1HZ9A 1IBLQ 3NBHB 4B3TL 1JJGA 1WTRA 3PO3G 5EAYA 1EUJA 1A2TA 1YHAA 3RN5A 2ASBA 4BA2I 3X3NA 4GKJQ 1F9SA 3OHXC 1X55A 3SK6A 4PQXA 3I91A 4YHHL 2R3ZA 3TS2A 1CHPD 1A62A 3CCSA 3M7GA 2F0SA 1ICWA 4PZ7A 2NN6H 4A3IH 2MHVA 1PH8A 3DWAA 3W2DA 4UP9A 1RKNA 2HCCA 3KF8B 1QVFA 3HOWG 1H95A 2GA4B 4DA2A 2RDGA 1H9KA 1YHQA 1WTQA 4LF8Q 3FPUB 1EIGA 1RCVD 1SDFA 2EDGA 1T9HA 4OX9Q 4FVMA 2UXCL 2R93G 5CV8A 2EXZA 4A3KG 4UPAA 5C5LA 4M8AA 1OXXK 1X3QA 5JEAJ 1PH4A 4DV7L 1HFGA 3BVGA 5DLQE 2XRSD 2VQEL 3RZDH 3WOFA 1II3A 4F87A 2JN4A 3W1BA 1HH2P 2WINB 4KMUC 2B2VC 3K58A 1GD7A 1JB7A 3ULPA 1PMRA 1LT3D 1SYCA 4A3CH 3BJUA 2VY3A 3J80L 2CVRA 4DR1Q 1WTXA 1PH5A 5I6YA 2E8GA 1VQ6A 4A3GG 4Y52H 1RODA 4S3SA 2YTXA 1GHKA 3IFDA 2AQ2B 3HS0C 3M4PA 3R3OA 3HOVG 1EY4A 5G3LF 3BZDB 1M8AA 1LTTD 2KEDA 5CYUA 5M5XH 2EVBA 2ZTDA 3LWUA 4Y7NB 4CJ0B 4K5WA 1MBYA 3K0XA 4P71A 3H0GB 1EWIA 4ODGA 1NSNS 1L0WA 1I94L 2PI2A 4DAMA 1F2MA 4Y7NH 5EGTA 5CR3A 3S15H 2AHOB 3QOLA 2F0MA 3VR6A 2BOSA 1KHIA 3S1RH 2PO4A 1AE3A 1XPOA 1FGBD 3J7YW 4DV3L 2UUAQ 2R7FA 3JAML 2JK8A 1SE8A 1Z47A 5C3EB 4R4CA 2XGTA 2WAQE 2IL8A 5KGUA 3MXNB 4L5TA 4IZ8A 4A3DH 2L1BA 1PFNA 3D31A 2QDLA 4GOPA 1X9NA 1KDAA 1QWYA 4CGYB 5J3BA 4IFDG 3C46A 3ND8A 1IKMA 3S17B 1STBA 4GLXA 3N6RA 5IP7H 2B63H 1N36Q 1MHWC 3RZOH 4JW0A 1WTPA 1DCZA 1K8GA 4YY3Q 4DR4L 4JI1L 4DXFA 3E5SA 4PZ6A 4BY1H 3I70A 5GAEC 3I4MH 5C44G 4DV4Q 2F0UA 2JA7G 2KQ3A 4FF1A 2K7VA 1T5XD 4K8JA 3F8TA 3TEHB 2PMZE 3SEBA 1HHVA 5M9OA 1HXYD 2K52A 5IWAQ 3I3CA 3A5UA 1SE4A 5K36H 3J81L 1KQSA 5IYBG 3E0EA 4HTHA 1EQRA 2PZWA 2FFKB 3CKIB 1WTWA 3M9BA 2D62A 1NCVA 1QNUA 4LF9Q 1I4QA 2A19A 2JA6B 1VQNA 1Q90A 2O4XA 1LTID 3KFUA 1VQHA 5IGEA 4DR3Q 4JI8Q 5C4HA 3S1QH 2F0FA 3NTKA 4HMJA 1W2BA 3ICEA 3SXHA 5CV9A 3KJOA 3PO3B 2HQEA 1SE2A 1YNJD 3FKIH 4ALPA 4G4KA 3DXJC 1HQMC 1I3QB 1F9PA 3PO3H 4H0LC 1SAPA 2G5DA 3H94A 4EQPA 4DK1A 4DV1Q 4G7ZC 3PUXA 2VUMH 1IXRA 4HJ8A 4LFCQ 4JV5Q 2ZJQA 2K14A 1V8QA 3PF4A 2L0CA 3ULLA 2B2WA 4X65Q 2HQLA 2ZM6L 1LABA 3AU7A 3CCUA 1AEXA 4LUOA 1GUSA 1PHJA 1VQ9A 5C6AA 1LV9A 5KYIA 5C4JB 1SE3A 1NY4A 1SEBD 4RAUC 1VQDA 2IY5B 5H1SE 1PTOH 1B4OA 4RKBA 1YJNA 2Z6KA 2KA7A 3HOWH 1HA6A 2YV5A 1SYEA 1F2ZA 4C2MB 3SE0A 4NXNL 2R93B 3K7AB 4A3KB 1RD9D 3CU7A 1JOOA 4C1NK 2MFIA 4C2MH 4RGTA 4QUFA 5BN5A 5LMUQ 3I2ZA 1SFOB 3TDQA 4TKOB 1STHA 3J7A5 4A3LG 1B9MA 5KEEA 2F0LA 4LK1C 2R7DA 4C3IG 3PO2H 4A93G 2F3WA 1BBWA 1GKHA 2F0HA 1Q86C 1Q8KA 1TQOA 4F8MA 3MEFA 2JQOA 2K5WA 2CH4A 1UE7A 4A3GB 1PYWD 2A6HC 3GTGB 2PZUA 3I4NG 2F1MA 3C3LA 3HOVB 3OSOA 2DN8A 3TMEA 3HGBA 4RHRA 1I94Q 3OOCA 3X3MA 4DUYL 4GN4B 1A2UA 1A3TA 2R92H 1N32L 1SNDA 1C9OA 1CTMA 1CT1D 2MO0A 3TRZA 2GN5A 4MN3A 2E5LL 1I5FA 2KCTA 4IUNA 2NVYH 2K4KA 1EWHA 2AUKA 1X3PA 1WCMG 2FINB 5ELDA 4JCVE 2KHJA 1Y1WG 4GN5A 1W6JA 1K0RA 3I7FA 2YU9B 1G6PA 4BBRG 2NZOA 4DUZL 2EY6A 5M3FH 1PH6A 4CHTB 1PRTB 1D8LA 2L11A 3FEWX 4X64Q 3HKZG 2CQOA 2VB2X 1WTOA 2YTVA 4HCEA 4FO2A 4KI0A 4X3TA 5ELNA 1WOCA 1MIUA 2D9UA 3HRZC 2D0OA 2EYMA 1AN8A 1SYGA 3OMGA 3D3RA 3CCRA 4JI1Q 4DR4Q 5T1IA 2L55A 4QIWE 3KOJA 2R7ZG 2HUGA 1G51A 3IRBA 4U673 2MNAA 2CW0C 4HSVA 4JOIC 1Y69U 4BY7G 2RVLA 5C44B 2KUMA 2F0QA 1DJRD 2JA7B 5IT9L 2BA0A 5M5YH 1EY8A 3T4AC 1JC7A 1QJOA 3HOZH 2ZXRA 2SOBA 1EEFD 1TWCB 1CKOA 2ZJPA 1EY9A 1VQJA 3SK4A 5C44H 4DV2L 4AQYL 1VQMA 4OO1I 2N49A 5FLMG 2G9DA 1UNSA 5IGGA 3TQYA 1O80A 3BU2A 3GTQH 4YCUA 4DR7L 5F2DA 1LT6D 1HA5A 3VYRA 2N55A 2M00A 1VCIA 1QOHA 2M2LA 4KY7A 3UDIA 4GOPB 1WVLA 3CCVA 4I7AA 3MTSA 2E76C 1JR0D 5GADC 1DXMA 5CV5A 3ERQA 2E2DC 1V9PA 4XIGS 2RSNA 4DU9A 3U4ZA 3HP3A 3SDZA 2JSOA 4DNRB 1XPUA 1EYAA 4JI4L 1VMPA 2OWOA 1LACA 5COYA 1U9RA 1SNPA 1L0YB 1IBLL 2AQ1B 5I2XA 3M4OH 1NMFA 2ZTCA 1NMGA 5A35A 2SNMA 4KK7A 4EQOA 1KD1C 3RLNA 1N8RC 3KLWA 3HEJA 4OELB 1CZWA 2NN6G 2VXWA 4A3IG 1XYIA 3S14B 5M5WB 1I6VC 2JEAI 2F0TA 1YNNC 4FP5D 3WDNA 1BCPF 2PW5A 2A68C 3S14H 2VL6A 4PMWA 1PRTC 1WI5A 4OGQC 2PYKA 1HCZA 4PZ8A 4C3HH 3CQZB 1PZJD 3J80i 1B53A 1CKMA 2E75C 3Q23A 1XTCD 2B2YA 3HZXA 4HN7A 3W1GA 1S3OA 3K5OA 2OT2A 4F88A 4OWWB 5D65A 3H3VC 3GTKB 1E2VA 2JE6I 3I4OA 4OHJA 4FXKC 4A3FG 2VNUD 1AZPA 4DV5Q 4LF8L 4OX9L 4GKKL 3JC66 1HUNA 4CDDC 1BOSA 4N9PA 3GTKH 3RN2A 1XMOQ 2O5IC 3F2DA 4NXMQ 3W3AA 4JI0L 1KRSA 4QF4A 4C3IB 2IT1A 4RMFA 4A3LH 1QVCA 2A69C 5FO9B 1NR4A 5IODA 2RCFA 1ZXTA 5KYLA 5FLXc 4DR1L 4A93H 2AQ3B 1EQQA 1M1KC 3I4NB 2F3VA 2RDHA 3JAMi 4GOPC 1N32Q 4R4TA 3EVQA 3T1HQ 2KOLA 3QWNA 2A6HD 4XTCS 2CQAA 3OPOA 4HIOA 4LF4Q 5GQOA 1YEZA 1TU2B 4A4IA 2NVTH 3M3YH 1VQIA 3F2UA 3PSIA 4NW2A 1LTGD 3I8ZA 3NTIA 2MUYA 2F0VA 4LW1A 3VA7A 5IP9H 1G6ZA 3W5OA 2CWPA 2QCPX 1GJXA 2D0PA 1ET9A 4ID6A 5IYDH 1FYCA 2DY8A 1WCMB 4A3DG 2EYOA 5EKIA 5EKLA 3EJIA 3PF5A 2EY5A 4BBRB 3S2DH 1KIXA 2VB3X 3K6OA 3V2TA 1Y1WH 1L1OA 1RTOA 3EA6A 1XMQQ 2UUAL 3HKZB 4BBRH 4OWTB 3T1YQ 4BWGB 3AFPA 4XQJA 1KRTA 4K5XA 1GUWA 5FLXE 4KHZA 3J81i 2OTJA 2G9HD 1YVCA 4BY1G 3HFZB 2D2CC 3MAQA 3I4MG 4IQZA 3WWVA 1PDQA 4M1UB 2R7ZB 1STAA 1PYBA 3DEPA 3N52A 1AW7A 4DF7A 2NBFA 4BY7B 1N36L 1SLJA 1TS3A 1CHQD 4HEDA 4GLAC 4YY3L 5EPLA 3S2HH 2HHHQ 2XIWA 5K36G 4BY7H 2CW0D 3NBIA 4DV4L 1B3QA 2PMZB 1B9NA 3BVMA 5C4ZA 2WKDA 4JBWA 4HCSA 1BVSA 4NB3A 5IWAL 1DGSA 4ULLA 3A8JE 1SRUA 4JI5Q 2NVQH 3FVQA 2B2WC 3A56A 4KN4C 1AH9A 3C1FA 3D8GA 3FMCA 1MJCA 2LS01 2UUBQ 5IYCH 1YHBA 1U5KA 3NELA 4LF9L 1UEBA 2X69A 3FKIG 1MGSA 3R2IA 2FMMA 4JI6Q 4ME5A 4X66Q 3PIO3 2QEXA 4J1MA 2UXDQ 5CMDA 3EN2A 2Z6KC 1VQKA 1IL8A 2L5TA 4DR3L 4JI8L 2VUMG 2CWAA 3E9IA 4DV6L 1PA6A 4G7OC 1A8VA 1ENCA 5LL6S 3EBEA 3E6ZX 3KLSX 3QO2A 1J9OA 3OWFA 4K6DA 2K50A 3A8IE 5G3LD 3SVMA 4LJZC 4A3IB 1LT5D 4DV1L 1PTOF 3K5LA 3HKSA 3CCLA 3CRLC 4LFCL 1N9WA 4JV5L 1I50H 1VQFA 2B2TA 3NWTA 4N8X1 3SHLA 1X54A 4TSSA 4UP8A 1KNEA 1SYFA 5EKKA 4X65L 1BCPB 1K9MC 3FPPA 1YNND 1Y8PB 1VQ8A 1J5EQ 2OQKA 1E1OA 2A68D 1PRTD 2LSSA 1CSQA 5JJZA 4GKKQ 1X56A 3RZDB 5C4XH 2CCZA 4IOCA 5DM73 1FNWA 1N34Q 3PUVA 4JI0Q 1RF2D 5DM63 4A3FH 1SXTA 3K5NA 3UE1A 2EZVA 1PXUA 3UE0A 1H9MA 3PO2G 2ICEC 4KTAA 2E2IB 2WACA 5LMUL 1ZYRC 1S40A 4CBVA 4O1NA 1BBXC 2RSOA 2MO1A 5JEAG 3D6WA 3C1EA 2K04A 2E2IH 4JI3Q 1JB3A 1R4QB 1EYCA 1BXTA 2KBNA 2VQFL 4BBSH 1G2TA 1UE1A 3A54A 4ZQ3A 5ELCA 1KL9A 2K1BA 1JJCB 5KNBA 5M5XB 1IW7C 3D4WA 4FF3A 2HIXA 2HT1A 1OTCA 2R92G 2A69D 1DOMA 3UDFA 3PCOB 5FKAC 3CCEA 5HGQA 1CA6A 2RCNA 2Z6BA 3S15B 1CI3M 3S1RB 1X3EA 1VQ4A 3AQQA 5C0XJ 3KDFA 2Y0SE 1RTNA 3A5ZB 2EE1A 5M3FG 4A3DB 3UDGA 3PIP3 3H6MA 4K2KA 2Q2TA 1N33Q 4DK6C 2PCFB 3GTJH 1STNA 1ESFA 1ET6A 3T53B 4HIMA 2L15A 3ER0A 5JAVA 2I5HA 2L9HA 1SNQA 2F0PA 4EGVA 2DNCA 4KV6A 2B63B 4CKEA 4V0BA 3RZOB 2E2HB 4N8FA 4X64L 2NTSA 2EQSA 3OMCA 1G2SA 1BCPC 3MFYA 2CHBD 4JI2L 2IW3A 4BY1B 1TWGH 1U0LA 3VR3A 1VQOA 1JMCA 1LTAD 3I4MB 4IFDJ 2E2HH 2WIIB 3VA5A 4RKLA 3D4DA 4JG2A 4QIWB 4GN3B 3DLLA 1I4XA 3HOZG 2N3SA 4O0AA 2E74C 4QJFA 3DMUA 4C56C 2K32A 2YYZA 5K5PA 3AMUA 5FOBB 1YJ9A 1LYLA 1GOZA 3RNUA 1KDCA 2EJGC 5M3MH 3MXPA 3AFQA 3U9SA 5CGKA 3G7LA 4A3EH 2RQXA 1L1OB 1ENAA 1D5XC 3S1QB 1CSPA 3PMFA 1BF4A 4JPBW 3PIOA 3A74A 1VF7A 5KIXA 4J15A 3S1NH 4YCWA 3FKIB 1OXTA 1YBYA 5C0XI 4QQBX 4DV6Q 1M90C 4YWMA 2F0EA 4NMZA 4JBMA 2DGYA 2B2YC 4DK0A 2VUMB 3NEMA 4CKBA 2Z4HA 2F3IA 4KHPQ 2X6GA 2JA8H 4I65A 1RDPD 1PFMA 3CPWA 1WYDA 1EQVA 1JJ2A 5IGCA 1L0XB 2K5NA 4B3SQ 4R4OA 2QW7A 5I2YA 1UEAB 1KXLA 2MJ8A 1MI2A 1PTOB 3MVVA 4MTKA 4C3HG 4IFDI 4ZUJA 3RMHA 3HOWB 4DK3C 2Q8RE 1TWFH 3H3VI 1K3BC 3G71A 1PFSA 4NPSA 3BS1A 1E24A 2YTYA 4JBJA 5AFWA 4PMCA 1DONA 5J1ZA 3OW2A 4GLVB 2H1EA 1YITA 4V190 2NWGA 1GUTA 1VMCA 1TIID 4WJWA 4DAYA 3H91A 3NUCA 1GHJA 1QZHA 1BUVT 1H9RA 5ISRA 1V1PA 1D1KA 1HNZQ 2OCEA 5IGBA 1ENFA 4DR5Q 4H13C 3RLOA 4DV5L 2HIVA 1R4PB 3S16H 2MPMA 3PO2B 3KF6A 2BE5C 3OTOQ 4LUZA 2RF4A 4A3MH 1EU4A 4HJ7A 2VQFQ 1XMOL 3CD6A 2R6GA 2EYHA 2EYFA 3KLRA 5TSSA 3LGJA 1SMXA 5FLXL 4NXML 3FRPB 1DD2A 1XTDA 3M85A 1RL2A 1ZYRD 5JEAH 3BZCA 4UP7A 1D6EC 3A7AB 4JC0A 4HJAA 5IE8A 3GD7A 2R92B 1JICA 3VR5A 3ND9A 3NENA 1O7ZA 4RFBA 4LF6Q 4K2LA 1IYUA 5E4XA 1VF5C 1TWHB 1IW7D 5IP9G 3J80c 4DAVA 2NVYB 3T51B 1K83H 3T1HL 1HUMA 3K81C 5IYDG 1TWHH 4LF4L 3PIPA 4R8IA 5D3IB 3VR2A 4LMQD 2F0OA 1A3UA 1PV4A 5M3FB 4FF2A 4TRDA 2XRQD 1IBML 4DN4M 4O42A 1WTVA 2WV6D 2WAQG 1STYA 1U4LA 3HOYG 4RWSC 4EQNA 4DR2Q 1YZ6A 3HOXH 3E0JA 1BBUA 1SNCA 4AYBE 4JI2Q 2MGSA 1UUPA 1PTOC 4DFAA 1XMQL 4B9WA 2A73B 3GTMH 1Z6HA 3T1YL 4AIMA 3TREA 1ZKOA 1H9SA 3G4SA 1JT8A 3JAMc 5M5YB 3HOZB 2B8GA 4P75A 3KLSA 2ZXOA 2VW9A 1O7IA 2ALYB 2ZTEA 1BCPD 3B6YA 1CK1A 3NHHA 4QMGA 3J80E 1AZQA 1XXGA 1K0SA 2F0GA 3DWPA 1FNUA 3K0YA 3P20A 3BYYB 4LWCA 3KDFB 4C1NI 2A1AA 2PQEA 4FNFA 1C7YA 3P1HA 5L37A 3GTQB 2Q2HA 1C0AA 3J7AV 2FHTA 2A74C 3NBHA 2HHHL 4MIUA 1IZ6A 1FGUA 1IKLA 1PH2A 1ONLA 3PQIA 1QZGA 3GTLH 1RJTA 3IFTA 3P7JA 1EWCA 5IYCG 1CZGA 1A3VA 4ZLTF 3KUPA 1DM0B 2B2TC 3QB3A 2NTTA 1EY5A 4JI5L 2OQ0A 3K7UC 1S72A 2UUBL 4ZRZA 1EY0A 1SN8A 4QL5A 3M4OB 1B8AA 4A76A 4IN3A 3ONAB 1LLRD 2Z1CA 3VR4A 4A3JH 4JI6L 4X66L 3JAME 4MHEA 4GNXA 3U9OA 1CFMA 4QB4A 2K33A 2ZJRA 2UXDL 2BA1A 3I4LA 1Q8IA 3EFXD 4RHSA 5AJ3Q 1EIHA 5JVG3 2K6AA 1CKNA 2F03A 4FF4A 5GAGC 3TBIB 4LF5L 3OYYA 3EROA 4U68A 4C3HB 4KKUA 1D5ZC 3NSWA 1FR3A 4IURA 4C3JH 5CORA 3U4VA 2Z4IA 4ME3A 2JP1A 5C3XA 5C4XG 2K03A 1Q1EA 2K75A 3KYHC 3RR5A 4I7ZC 2F4VQ 1J5EL 1G291 5I6WA 2Z8LA 2VZAA 1EOTA 5HURA 3HG9A 2BDOA 3DM3A 1TT2A 4UHVA 1DYQA 1XNRQ 1S4ZA 3J7AF 1WFQA 1HR0L 1MJEA 2NVXH 1N34L 5GAHC 1E0BA 3A8KE 1DZ1A 1WTHA 2C35B 4BBSG 1HJPA 2WFWA 4LAAA 4A93B 2A6EC 1Q81C 2Q8IB 3H15A 3CF5A 2UU9Q 1S5DD 1IBKQ 2BE5D 3V96A 3DHQA 1X6OA 4R4IA 2KECA 1KABA 1Y8OB 1TWAH 1F9QA 1HZAA 3RUZA 2H5XA 3TSSA 2ATWA 1G91A 3HOUH 1QG7A 4H7BA 4JI3L 2A5HA 2NYZD 2OTLA 2HD3A 1VQPA 3R2TA 3SR1A 1HNWL 2NVTB 1ML0D 3M3YB 3BYTB 4RGNA 5JPNC 3U58A 3MXNA 3L9AX 3T56B 3UI2A 1R9TH 2VS1A 3FHWA 1HNXQ 1TXYA 1EY7A 5EBCA 2V1CC 3QOJA 4ZUIA 4OO1H 4BS9A 1S5BD 1BO0A 1S5FD 1IBMQ 4FDBA 1V1PB 4P2CB 3S2DB 2D5DA 2ES2A 2OF1A 1UE5A 1F2LA 2NN6I 4QUCA 3KJPA 4R8NA 1KLUD 3WOEA 4ABNA 4P74A 1OO9B 3DWQA 1XNQQ 5EPKA 3KF6B 4Q0FA 1Y1WB 1I4HA 1SMYC 4QY7A 1PYSB 2KENA 4YWKA 1CUKA 1W6KA 2WAQB 3HOYB 1N33L 2ZXPA 3MC0B 3PUWA 4AYBG 3HOYH 1RHPA 2L4NA 1Q12A 4N9TA 4CJ2C 1FNVA 1VQ5A 2AKWB 3DM1A 4L6TB 4IJHA 3S2HB 1X32A 1MKHA 3S1MH 2KHSA 4OEMB 1XX8A 3CHBD 1RIPA 4KKSA 1B50A 1EOVA 3U50C 1X3GA 3BZKA 4KY6A 5M3MG 1V1OA 3OW7A 1HRJA 1CQFA 2RDFA 1C48A 4BA1I 5BN3A 1WJJA 3D4RA 3GP7A 3E9HA 4XQQA 1I6HH 1ILQA 4A3EG 1YJWA 3TZDA 1ZEQX 1GVPA 2NVQB 1EZ8A 4XQNA 4IPHA 4DNIA 1Q7YC 1HZBA 4LUVA 4RG1A 1UAPA 4XDXA 3GQBA 1OXUA 1SYDA 5IY0A 4B3RQ 1SSOA 4XT3B 1NR2A 1NE3A 1IYJB 3VYSA 2NUCA 4A3BH 4NKLA 3L0OA 4HSPA 1IL2A 3R8BA 3M7NA 1LTSD 4K0KQ 1H9SB 3Q0AA 2M9VA 3BDCA 2B29A 1D7QA 1T5EA 2JA8G 1L2FA 2JA5H 3FDTA 5EBDA 2XVSA 4YIJA 1NUCA 2NZ1D 1JWSD 1OXVA 5LMNL 1IHZA 3GV6A 4CJ1B 4LF5Q 4KHPL 2B2UA 1GUNA 1Y1VH 1I50B 4JOIA 1EL0A 1EFID 3TP7A 4JI7Q 2P5ZX 2V4DA 3TP5A 2N78A 4OL7A 4B3SL 4FYDA 4ZK9B 3T13A 4LFAL 5GROA 2HDMA 2RHSB 4E6IA 2GVBA 4DV0L 1S5CD 1HTPA 4OONA 4X3UA 3S9WA 4BXXG 2KVMA 3MXGA 4UAIA 2RBMA 3NWSA 4YWLA 5IT9E 4CDFC 4P72A 1SJED 1PH9A 5C4XB 2F0WA 3QIAA 2DJGC 4KN7C 4WFN3 1PZID 4K14A 1SR3A 1LTBD 2Z9HA 3DEOA 4H02A 4A3FB 3STBC 1KLGD 2LXKA 2I0QA 4IJLA 1TKWB 3C2PA 1HR0Q 1LTRD 3QJYA 2B3GA 3PGZA 4B9XA 4GNXB 1FJGQ 5CV7A 4A3MG 1GO3E 4YCVA 5CBEE 3A7LA 4XYQA 1EQTA 2JXMB 3UDXA 4KJNA 1HNZL 4BBSB 4DR5L 1CKNB 2K5VA 4AH6A 4LF7L 3CXCA 5KRUA 2UXBQ 3K57A 1O78A 4JYAQ 5FO8B 3OTOL 1BNZA 5EJWA 5A2QE 1PH1A 2O5JC 3EQLC 1HNWQ 2BH2A 3RLFA 1A63A 1VQLA 1I4RA 2A8VA 4NP5A 2A6ED 5FJ8H 4X3SA 4LFBQ 2EYJA 1EEID 1UE6A 2KEEA 4RGOS 2MQHA 3E3XA 2LKVA 4KD4A 2LY7A 4G57A 1TS5A 2WB1E 2IX3A 4LF6L 4L63B 1OXSC 2AWOA 1HTLD 3NK9A 1DOKA 2NB0A 4JBKA 4PNYA 2J0TD 2RA4A 3GTJB 1PH7A 3L3OC 1K8MA 1O7LA 1TR5A 1KNAA 5E7NA 2N88A 3M4YA 2LXJA 5CBAE 3HOXG 2K5DA 2C9OA 2LMCB 3ERSX 4R9WA 2QILA 5C0XG 2I5LX 2KCMA 4B3ML 1C8CA 1QVGA 3GO5A 1LM0A 3MA2B 1BKBA 1JORA 1B70B 1SMYD 3H0GH 1TWGB 4AYBB 3TP8A 3J81j 1E2WA 2Q8TA 5KNDA 4DR2L 3Q8DA 1P16A 4PV1C 1PRTF 3V05A 1VQEA 2XN9C 1K3RA 2KCNA 4MTNA 5E3FA 1JE4A 2JJQA 3HKZE 2K01A 3Q6SA 2IHEA 2JEBI 2X6LA 1V1QA 5C3EH 4RCOA 1Q3LA 3A55A 5M3MB 3IAYA 1CA5A 4GNXC 1YNXA 4PMBA 2EY1A 4A3EB 4CKCA 1SJHD 4LNQA 3S17H 1PFBA 3ZJYC 1Q82C 3L7ZC 5BR8L 3S1NB 1EFWA 1VQ7A 3SGIA 1F2YA 2F4IA 3G48A 1E2ZA 4JVZA 2F52A 5KNCA 1WD0A 3EIVA 3I55A 1B44D 1E22A 4GZYC 1D2BA 2ID0A 4DR6L 4A3JG 1Y8NB 5EPJA 1W3SA 4KJOA 2JA8B 2DJFC 5LMNQ 4QCLA 2GVAA 3NPPA 1JCKB 2SEBD 4ZKBB 2QEJC 3O13A 4R4QA 3PV0A 1BR9A 3AB9A 1CM9A 4B3TQ 5JVH3 1FL0A 2EJMA 3ULJA 3CC4A 2JA6H 1EU3A 5AJ3L 4LFAQ 1A15A 4KD3A 1B1ZA 1TS2A 1TWFB 2CFMA 2KHIA 3KBXA 4PG3A 4DV0Q 4KHVA 4C3JG 4K5VA 2N8NA 5ELOA 1FVIA 4YHHQ 1TY2A 5I4DA 1NAPA 1SROA 5JJKA 3CMEA 1I3QH
chains in the Genus database with same CATH topology
1F9RA 4WRDA 3P75A 1C4QA 4K6LA 3NTHA 4KKTA 1U4MA 1Q1BA 3S16B 4EVOA 1QE6A 4RA8A 2TSSA 4A3MB 5ELFA 1S5ED 1F77A 5NUCA 2XWJB 5IIFA 3BVZA 2IX0A 3MHBA 1QCBD 3MEHA 3OWEB 2MP1A 5C3WA 1MSHA 5JOBA 1MD2D 5E1FA 1STGA 3Q24A 3ITPA 1V43A 2JYOA 3QG1A 1EYDA 4WORA 2QF7A 1U4PA 1TS4A 1K83B 1TY0A 3K5MA 4OO1G 1ESRA 2FJ2A 1JOKA 3OIQA 2C5CA 2OEOA 3H09A 5D3DA 2B39A 1J8IA 3HOXB 2EYPA 2QKIC 3BDOA 2PPBC 1AP0A 2PW7A 3OIPA 3MWYW 1MSGA 4IALA 2B2VA 3GTMB 2SNSA 1PZKD 2PZTA 5C0XH 1KAAA 2F0NA 3GV3A 1B2TA 4FXDA 3GTOB 4RCNA 4HMIA 5ELBA 2IWHA 2EYLA 5JPMC 1K8OA 4NDXA 4J8QA 5IGDA 2KJXA 2E2JB 3TP6A 3GTLB 4IFDH 2DNEA 4UDUC 1SBBB 5LHY1 2B2UC 3LX0A 4TQUS 1U4RA 3GTPB 1HQRD 2K05A 3NXWA 4DNTB 1BDOA 2SDFA 3K59A 1FD7D 1SNMA 3I73A 4FXGC 4ZYSA 3MXUA 2ENBA 2XWBB 3D6CA 4A3JB 4OIKA 1G8ZD 1GXDC 4IUQA 2RKSA 1QILA 1BQQT 1Z7TA 3KF8A 1JQYD 2HCIA 2BCOA 1A6XA 5E4WC 4B08A 4IUUA 3IKJA 1VDZA 5A2QL 2I07B 4KY5A 3T16A 5DNFA 1D1IA 5CC4A 4C3JB 2XSCA 1CQVA 2J4XA 2PNRC 3KBGA 2EJFC 3NQTA 5D14A 4K8IA 4IUTA 5IGFA 2B8FA 3BDLA 5DAUA 4JK1C 5LL6X 1SNOA 1AFPA 4XYOA 3Q22A 1B3AA 4IUVA 3NP8A 3J81E 2AWNA 2NVXB 2F0KA 5HGTA 1I4PA 2EPBA 3R93A 4DGZA 2EOTA 2H4OA 1IYVA 5I9PA 2QDBA 4J6HA 5DEHA 1ILPA 1TWAB 4RH6A 2LFNA 3PUZA 3HOUB 5ELEA 4G7HC 2BDNA 4XT1B 4H44C 1O7YA 1PLFA 4IUPA 3IL8A 1QB5D 2F0DA 1R9TB 5EQ0A 1I4GA 5C5MA 3SK5A 2KCCA 5CV6A 1GUGA 2IJ0A 5CV4A 2WB1B 1EZ6A 2XNAC 3LNNA 2WP8J 2Y0SB 3LWEA 1KTKA 4Z9CB 2K5QA 3ZYYX 2R61A 1KDBA 1D5MC 2J7ZA 1XWEA 4HR7B 1EY6A 2F0JA 2ZT9C 5FK9C 4HAEA 2IX1A 3URYA 3S1MB 3BG3A 1H9JA 3VYTA 3MZ5A 5J22A 1PTOD 2OXPA 1STEA 1GUOA 4ILWA 3MFGA 2HDLA 2ICIA 5J39A 3TZUA 3CRKC 4ZKCB 5BN4A 1I6HB 1HPCA 4RGMA 3SK8A 1WD1A 3TN2A 2IPKD 1SYBA 1QNKA 4Q5VA 1DOLA 5FO7B 1LO5D 1TVXA 1JWUD 4X3KA 4ZAIA 1LT4D 3I90A 4A3BB 2K28A 2I46A 3NE5B 1M4VA 4XXEA 2DY7A 4DAPA 2O2LD 2WKCA 3PUYA 4DXGA 2FMCA 5IOCA 2JA5B 1JOQA 2AUJD 2TMPA 4L8JA 3G6JB 3RD4A 1JWMD 1HFNA 1Y1VB 3I72A 3VYUA 5T1GA 3NQIA 2F0IA 1YNJC 3KK7A 5I9OA 4F7XA 3DUZA 4OIJA 2EY2A 2L12A 1WTRA 1A2TA 4BA2I 3X3NA 1F9SA 3OHXC 3SK6A 4PQXA 3I91A 2R3ZA 1CHPD 3M7GA 2F0SA 1ICWA 2NN6H 2MHVA 3DWAA 3W2DA 1RKNA 2HCCA 2GA4B 4DA2A 2RDGA 1H9KA 1WTQA 1EIGA 3FPUB 1RCVD 1SDFA 2EDGA 4FVMA 5CV8A 2EXZA 5C5LA 4M8AA 1OXXK 1X3QA 5JEAJ 1HFGA 3BVGA 2XRSD 3WOFA 1II3A 4F87A 2WINB 4KMUC 2B2VC 3K58A 1PMRA 1LT3D 1SYCA 3J80L 2CVRA 1WTXA 5I6YA 1RODA 4S3SA 1GHKA 3IFDA 2AQ2B 3HS0C 3R3OA 1EY4A 5G3LF 3BZDB 1M8AA 1LTTD 2KEDA 5CYUA 2EVBA 3LWUA 4Y7NB 4CJ0B 4K5WA 1MBYA 3H0GB 4ODGA 1NSNS 1F2MA 5EGTA 5CR3A 3QOLA 2F0MA 3VR6A 2BOSA 2PO4A 1FGBD 3J7YW 3JAML 1Z47A 5C3EB 2IL8A 5KGUA 4IZ8A 2L1BA 1PFNA 3D31A 1KDAA 1QWYA 4CGYB 4IFDG 3C46A 3ND8A 1IKMA 3S17B 1STBA 3N6RA 1WTPA 1DCZA 4DXFA 3E5SA 3I70A 2F0UA 2KQ3A 4FF1A 2K7VA 1T5XD 4K8JA 3SEBA 1HHVA 5M9OA 1HXYD 3I3CA 1SE4A 5K36H 3J81L 4HTHA 2PZWA 2FFKB 3CKIB 1WTWA 2D62A 1NCVA 1QNUA 1I4QA 2JA6B 1Q90A 2O4XA 1LTID 5IGEA 5C4HA 2F0FA 3NTKA 4HMJA 3SXHA 5CV9A 3PO3B 2HQEA 1SE2A 1YNJD 4G4KA 3DXJC 1HQMC 1I3QB 1F9PA 4H0LC 1SAPA 3H94A 4EQPA 4DK1A 4G7ZC 3PUXA 1V8QA 2L0CA 2B2WA 1LABA 3AU7A 1AEXA 1GUSA 5C6AA 1LV9A 5KYIA 5C4JB 1SE3A 1SEBD 4RAUC 1PTOH 1B4OA 4RKBA 2KA7A 1HA6A 1SYEA 1F2ZA 4C2MB 3SE0A 2R93B 3K7AB 4A3KB 1RD9D 3CU7A 1JOOA 4C1NK 4RGTA 4QUFA 5BN5A 1SFOB 3TDQA 4TKOB 1STHA 1B9MA 5KEEA 2F0LA 4LK1C 4C3IG 2F3WA 2F0HA 1TQOA 4F8MA 2K5WA 4A3GB 1PYWD 2A6HC 3GTGB 2PZUA 2F1MA 3C3LA 3HOVB 3OSOA 2DN8A 3TMEA 3HGBA 4RHRA 3OOCA 3X3MA 1A2UA 1A3TA 1SNDA 1CTMA 1CT1D 4MN3A 4IUNA 1EWHA 2AUKA 1X3PA 2FINB 5ELDA 1W6JA 2YU9B 2EY6A 4CHTB 1PRTB 2L11A 3FEWX 2VB2X 1WTOA 4HCEA 4FO2A 4KI0A 4X3TA 2D9UA 3HRZC 2EYMA 1AN8A 1SYGA 3OMGA 3D3RA 5T1IA 2L55A 2HUGA 4U673 2CW0C 4HSVA 1Y69U 2RVLA 5C44B 2KUMA 2F0QA 1DJRD 2JA7B 5IT9L 2BA0A 1EY8A 3T4AC 1JC7A 1QJOA 2ZXRA 2SOBA 1EEFD 1TWCB 1EY9A 3SK4A 4OO1I 2G9DA 1UNSA 5IGGA 1O80A 5F2DA 1LT6D 1HA5A 3VYRA 2N55A 2M00A 1VCIA 1QOHA 2M2LA 4KY7A 1WVLA 3MTSA 2E76C 1JR0D 1DXMA 5CV5A 3ERQA 2E2DC 4XIGS 2RSNA 4DU9A 3HP3A 3SDZA 2JSOA 4DNRB 1EYAA 1VMPA 1LACA 5COYA 1U9RA 1SNPA 1L0YB 2AQ1B 5I2XA 5A35A 2SNMA 4KK7A 4EQOA 3HEJA 1CZWA 2NN6G 2VXWA 1XYIA 3S14B 5M5WB 1I6VC 2JEAI 2F0TA 1YNNC 4FP5D 3WDNA 1BCPF 2PW5A 2A68C 4PMWA 1PRTC 4OGQC 2PYKA 1HCZA 3CQZB 1PZJD 1B53A 3Q23A 2E75C 4HN7A 1XTCD 2B2YA 3HZXA 3K5OA 2OT2A 4F88A 5D65A 3H3VC 3GTKB 1E2VA 2JE6I 4OHJA 4FXKC 2VNUD 1AZPA 1HUNA 1BOSA 4N9PA 2O5IC 3W3AA 4QF4A 4C3IB 2IT1A 2A69C 5FO9B 1NR4A 5IODA 1ZXTA 5KYLA 2AQ3B 3I4NB 2F3VA 2RDHA 3EVQA 2KOLA 3QWNA 2A6HD 4XTCS 2CQAA 3OPOA 1TU2B 3F2UA 4NW2A 1LTGD 3I8ZA 3NTIA 2MUYA 2F0VA 3VA7A 1G6ZA 2QCPX 1GJXA 1ET9A 4ID6A 1FYCA 2DY8A 1WCMB 2EYOA 5EKIA 5EKLA 3EJIA 2EY5A 4BBRB 2VB3X 3K6OA 3V2TA 3EA6A 1RTOA 3HKZB 4BWGB 4XQJA 4K5XA 1GUWA 5FLXE 4KHZA 2G9HD 3MAQA 2D2CC 4IQZA 1PDQA 4M1UB 2R7ZB 1STAA 3DEPA 3N52A 1AW7A 4DF7A 2NBFA 4BY7B 1TS3A 1CHQD 4HEDA 5EPLA 2XIWA 5K36G 2CW0D 3NBIA 2PMZB 1B9NA 3BVMA 5C4ZA 2WKDA 4JBWA 4HCSA 4ULLA 3A8JE 3FVQA 2B2WC 3A56A 4KN4C 3C1FA 3D8GA 3FMCA 2LS01 2X69A 1MGSA 3R2IA 2FMMA 4ME5A 3PIO3 4J1MA 5CMDA 1IL8A 2L5TA 4G7OC 1ENCA 5LL6S 3E6ZX 3KLSX 3QO2A 1J9OA 3OWFA 4K6DA 3A8IE 5G3LD 3SVMA 4LJZC 4A3IB 1LT5D 1PTOF 3K5LA 3CRLC 2B2TA 3NWTA 3SHLA 4TSSA 1KNEA 1SYFA 5EKKA 1BCPB 3FPPA 1YNND 1Y8PB 2A68D 1PRTD 5JJZA 3RZDB 5DM73 1FNWA 3PUVA 1RF2D 5DM63 1SXTA 3K5NA 2EZVA 1PXUA 1H9MA 2ICEC 4KTAA 2E2IB 2WACA 1ZYRC 4CBVA 4O1NA 1BBXC 2RSOA 5JEAG 3D6WA 3C1EA 2K04A 1JB3A 1R4QB 1EYCA 1BXTA 1G2TA 3A54A 4ZQ3A 5ELCA 2K1BA 5KNBA 5M5XB 1IW7C 3D4WA 4FF3A 2A69D 1DOMA 5FKAC 1CA6A 3S15B 1CI3M 3S1RB 5C0XJ 1RTNA 2EE1A 4A3DB 3PIP3 3H6MA 4K2KA 2PCFB 1STNA 1ESFA 1ET6A 3T53B 5JAVA 2L9HA 1SNQA 2F0PA 4EGVA 2DNCA 4KV6A 2B63B 4CKEA 4V0BA 3RZOB 2E2HB 2NTSA 3OMCA 1G2SA 1BCPC 3MFYA 2CHBD 4BY1B 2IW3A 3VR3A 3I4MB 4IFDJ 1LTAD 2WIIB 3VA5A 4RKLA 3D4DA 4QIWB 1I4XA 2E74C 3DMUA 4C56C 2K32A 2YYZA 5K5PA 3AMUA 5FOBB 1GOZA 1KDCA 2EJGC 3MXPA 3U9SA 5CGKA 3G7LA 2RQXA 1ENAA 1D5XC 3S1QB 3PMFA 1BF4A 1VF7A 5KIXA 3FKIB 1OXTA 5C0XI 2F0EA 4NMZA 2B2YC 4DK0A 2VUMB 4CKBA 2Z4HA 2X6GA 4I65A 1RDPD 1PFMA 1EQVA 5IGCA 1L0XB 5I2YA 1UEAB 2MJ8A 1MI2A 1PTOB 3MVVA 4C3HG 4IFDI 4ZUJA 3RMHA 3HOWB 2Q8RE 3BS1A 5AFWA 4PMCA 1DONA 5J1ZA 2H1EA 4V190 2NWGA 1GUTA 1VMCA 1TIID 4WJWA 4DAYA 3H91A 3NUCA 1GHJA 1BUVT 1H9RA 5ISRA 1V1PA 1D1KA 5IGBA 1ENFA 4H13C 1R4PB 2MPMA 3PO2B 2BE5C 1EU4A 2R6GA 2EYHA 2EYFA 3KLRA 5TSSA 5FLXL 3FRPB 1DD2A 3M85A 1ZYRD 5JEAH 1D6EC 3A7AB 3GD7A 2R92B 1JICA 3VR5A 3ND9A 1O7ZA 4RFBA 4K2LA 1IYUA 5E4XA 1VF5C 1TWHB 1IW7D 4DAVA 2NVYB 3T51B 1HUMA 4R8IA 5D3IB 3VR2A 4LMQD 2F0OA 1A3UA 5M3FB 4FF2A 4TRDA 2XRQD 4DN4M 4O42A 1WTVA 2WV6D 1STYA 1U4LA 4RWSC 4EQNA 3E0JA 1SNCA 2MGSA 1UUPA 1PTOC 4DFAA 4B9WA 2A73B 1Z6HA 1ZKOA 1H9SA 5M5YB 3HOZB 2B8GA 3KLSA 2ZXOA 1BCPD 1CK1A 3NHHA 4QMGA 3J80E 1AZQA 1XXGA 2F0GA 3DWPA 1FNUA 3K0YA 3P20A 3BYYB 4C1NI 2PQEA 4FNFA 3P1HA 3GTQB 3J7AV 2FHTA 2A74C 3NBHA 4MIUA 1IKLA 1ONLA 1RJTA 3IFTA 3P7JA 1EWCA 1CZGA 1A3VA 4ZLTF 3KUPA 1DM0B 2B2TC 3QB3A 2NTTA 1EY5A 4ZRZA 1EY0A 3M4OB 4IN3A 3ONAB 1LLRD 2Z1CA 3VR4A 3JAME 4MHEA 3U9OA 1CFMA 4QB4A 2K33A 2BA1A 3I4LA 1Q8IA 3EFXD 4RHSA 1EIHA 5JVG3 2K6AA 2F03A 4FF4A 3TBIB 3EROA 4U68A 4C3HB 4KKUA 1D5ZC 3NSWA 1FR3A 4IURA 5CORA 2Z4IA 2JP1A 5C3XA 2K03A 1Q1EA 4I7ZC 1G291 5I6WA 2Z8LA 1EOTA 5HURA 3HG9A 2BDOA 1TT2A 1DYQA 1S4ZA 3J7AF 1E0BA 3A8KE 1DZ1A 4LAAA 4A93B 2A6EC 2Q8IB 1S5DD 2BE5D 3V96A 3DHQA 2KECA 1KABA 1Y8OB 1F9QA 3RUZA 3TSSA 1G91A 1QG7A 4H7BA 2A5HA 2NYZD 3R2TA 3SR1A 2NVTB 1ML0D 3M3YB 3BYTB 4RGNA 5JPNC 3MXNA 3L9AX 3T56B 3UI2A 1EY7A 5EBCA 3QOJA 4ZUIA 4OO1H 4BS9A 1S5BD 1BO0A 1S5FD 1V1PB 4P2CB 3S2DB 2D5DA 2OF1A 4QUCA 1F2LA 2NN6I 4R8NA 1KLUD 3WOEA 4ABNA 1OO9B 3DWQA 5EPKA 1Y1WB 4Q0FA 1I4HA 1SMYC 1W6KA 2WAQB 3HOYB 2ZXPA 3MC0B 3PUWA 1RHPA 2L4NA 1Q12A 4N9TA 4CJ2C 1FNVA 3DM1A 4L6TB 3S2HB 1X32A 2KHSA 1XX8A 3CHBD 4KKSA 1B50A 4KY6A 1V1OA 3OW7A 1HRJA 1CQFA 2RDFA 1C48A 4BA1I 5BN3A 3D4RA 3GP7A 4XQQA 1ILQA 3TZDA 1ZEQX 2NVQB 1EZ8A 4XQNA 1UAPA 4XDXA 3GQBA 1OXUA 1SYDA 1SSOA 4XT3B 1NR2A 3VYSA 2NUCA 4NKLA 4HSPA 3R8BA 3M7NA 1LTSD 1H9SB 3Q0AA 2M9VA 3BDCA 1T5EA 3FDTA 5EBDA 2XVSA 4YIJA 1NUCA 2NZ1D 1JWSD 1OXVA 1IHZA 3GV6A 4CJ1B 2B2UA 1GUNA 1I50B 1EL0A 1EFID 3TP7A 2V4DA 3TP5A 4OL7A 4FYDA 4ZK9B 3T13A 2HDMA 4E6IA 1S5CD 1HTPA 4X3UA 3S9WA 2KVMA 3MXGA 4UAIA 2RBMA 3NWSA 5IT9E 1SJED 5C4XB 2F0WA 3QIAA 4KN7C 4WFN3 1PZID 4K14A 1LTBD 3DEOA 4A3FB 1KLGD 1TKWB 3C2PA 1LTRD 3QJYA 4B9XA 5CV7A 5CBEE 3A7LA 4XYQA 1EQTA 2JXMB 4KJNA 4BBSB 5KRUA 3K57A 1O78A 5FO8B 1BNZA 5EJWA 5A2QE 2O5JC 3EQLC 3RLFA 1I4RA 4NP5A 2A6ED 4X3SA 2EYJA 1EEID 2KEEA 4RGOS 2LKVA 4KD4A 2LY7A 4G57A 1TS5A 2IX3A 4L63B 1OXSC 2AWOA 1HTLD 3NK9A 1DOKA 2NB0A 4PNYA 2J0TD 2RA4A 3GTJB 3L3OC 1K8MA 1O7LA 1TR5A 1KNAA 2N88A 3M4YA 5CBAE 2K5DA 2C9OA 2LMCB 4R9WA 2QILA 5C0XG 1C8CA 3GO5A 3MA2B 1JORA 1SMYD 1TWGB 4AYBB 3TP8A 1E2WA 2Q8TA 5KNDA 4PV1C 1PRTF 3V05A 2XN9C 2KCNA 5E3FA 1JE4A 2K01A 3Q6SA 2JEBI 2X6LA 4RCOA 1Q3LA 3A55A 5M3MB 3IAYA 1CA5A 4PMBA 2EY1A 4A3EB 4CKCA 1SJHD 1PFBA 3L7ZC 3S1NB 1F2YA 2F4IA 1E2ZA 5KNCA 1WD0A 1B44D 4GZYC 1D2BA 2ID0A 1Y8NB 5EPJA 4KJOA 2JA8B 4QCLA 3NPPA 1JCKB 2SEBD 4ZKBB 2QEJC 3O13A 3PV0A 1BR9A 3AB9A 1CM9A 5JVH3 2EJMA 1EU3A 1A15A 4KD3A 1B1ZA 1TS2A 1TWFB 3KBXA 4KHVA 4C3JG 4K5VA 1TY2A 5I4DA 1NAPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GV6 A;  4CJ1 B;  1WTX A;  2B2T C;  1C8C A;  1ILP A;  5JJZ A;  1F9R A;  2B2U A;  2DY7 A;  2VXW A;  1XYI A;  1EL0 A;  4MN3 A;  1GUW A;  1BO0 A;  2BDN A;  2Q8T A;  1ROD A;  1U4M A;  3IFD A;  4XT1 B;  4QUC A;  1F2L A;  1X3P A;  2FIN B;  1O7Y A;  1PLF A;  1QE6 A;  3ONA B;  4IUP A;  3IL8 A;  5EPK A;  4ZK9 B;  1JIC A;  1PDQ A;  3G7L A;  2HDM A;  4RA8 A;  4MHE A;  1M8A A;  1O7Z A;  2B2U C;  1F9P A;  3DEP A;  1HFN A;  3N52 A;  1JE4 A;  1SAP A;  2KED A;  3R93 A;  1U4R A;  2K01 A;  3Q6S A;  4X3U A;  4CJ0 B;  1B53 A;  2K05 A;  2KVM A;  2L11 A;  4UAI A;  5E4X A;  5EQ0 A;  2B2Y A;  5T1G A;  1BBX C;  2RSO A;  2X6L A;  4HED A;  1EIH A;  2MP1 A;  3D6W A;  1WTO A;  5EPL A;  1BF4 A;  1MSH A;  1Q3L A;  2SDF A;  2XIW A;  5D65 A;  2K04 A;  1HUM A;  4X3T A;  2D9U A;  1CA5 A;  4OIJ A;  2B2W A;  1AZP A;  1G2T A;  2L12 A;  3DEO A;  4R8I A;  4OIK A;  1RHP A;  2JYO A;  2L4N A;  4LMQ D;  2K1B A;  1WTR A;  1HUN A;  5T1I A;  4IUQ A;  4CJ2 C;  4HCS A;  2B2Y C;  3LWE A;  4U68 A;  3UI2 A;  1PFB A;  4DN4 M;  1LV9 A;  2HUG A;  1DOM A;  3DM1 A;  5CBE E;  1U4P A;  4O42 A;  4RAU C;  1WTV A;  4HSV A;  1EQT A;  2IL8 A;  4IUR A;  1X32 A;  5COR A;  2X6G A;  1B4O A;  2HCI A;  2RVL A;  2L1B A;  1XX8 A;  1F9S A;  2KUM A;  2B2W C;  1PFN A;  1CA6 A;  1HA6 A;  1PFM A;  1ESR A;  2FJ2 A;  1U4L A;  2JP1 A;  3I91 A;  2J7Z A;  2R3Z A;  4RWS C;  5E4W C;  1B50 A;  4IUU A;  2K03 A;  1WD0 A;  2X69 A;  2MGS A;  1HRJ A;  1BNZ A;  1MGS A;  1NR4 A;  2FMM A;  5EJW A;  1IKM A;  2MJ8 A;  1ZXT A;  1MI2 A;  5DNF A;  1ILQ A;  1ICW A;  1RTN A;  5EPJ A;  3TZD A;  5CBA E;  4QUF A;  4HAE A;  5CMD A;  2EE1 A;  1EOT A;  1IL8 A;  1O80 A;  2HCC A;  1WTP A;  4X3S A;  1J8I A;  1S4Z A;  2N55 A;  2Q8R E;  4ZKB B;  2KOL A;  1E0B A;  2M2L A;  2KEE A;  2HDL A;  5AFW A;  4XDX A;  1WVL A;  1AP0 A;  1WTQ A;  1DZ1 A;  5D14 A;  1EIG A;  3FPU B;  1DON A;  3MTS A;  1SDF A;  1CM9 A;  3MWY W;  3QO2 A;  1J9O A;  1AZQ A;  2L9H A;  1SSO A;  4IUT A;  2H1E A;  3F2U A;  1MSG A;  1NR2 A;  4XT3 B;  4ZKC B;  2NWG A;  2B2V A;  4NW2 A;  3SVM A;  3I8Z A;  2RSN A;  1VMC A;  1HHV A;  3H91 A;  3HP3 A;  2KEC A;  1DOK A;  3I3C A;  1X3Q A;  1WD1 A;  3TN2 A;  1G6Z A;  1A15 A;  1F9Q A;  1HFG A;  1VMP A;  3GV3 A;  2FHT A;  1B3A A;  4IUV A;  1B2T A;  2RA4 A;  1G2S A;  2B2T A;  5COY A;  3KBX A;  1G91 A;  1QG7 A;  1QNK A;  2DY8 A;  1IKL A;  1DOL A;  1KNE A;  2NYZ D;  2FFK B;  5EKI A;  2EPB A;  1KNA A;  1TVX A;  2N88 A;  1WTW A;  1RJT A;  4X3K A;  2B2V C;  2EOT A;  2MPM A;  1ML0 D;  1NCV A;  3FDT A;  3P7J A;  3I90 A;  4ZAI A;  1NAP A;  2NZ1 D;  4R9W A;  4ZLT F;  1RTO A;  2CVR A;  3KUP A;  2K28 A; 
#chains in the Genus database with same CATH topology
 1F9R A;  4WRD A;  3P75 A;  1C4Q A;  4BXX H;  4K6L A;  2PNH A;  1J6Q A;  3NTH A;  1ICF B;  4KKT A;  3AEV A;  1U4M A;  1Q1B A;  3A0J A;  3S16 B;  4EVO A;  3I56 A;  4DPG A;  1QE6 A;  2F4V L;  4RA8 A;  2TSS A;  4A3M B;  5JJL A;  1AE2 A;  1S5E D;  1Q46 A;  5ELF A;  4LF7 Q;  2UXC Q;  3STB D;  1F77 A;  1VQC A;  5NUC A;  2XWJ B;  5IIF A;  3BVZ A;  2IX0 A;  3MHB A;  5C4J H;  4DV7 Q;  1QCB D;  3MEH A;  3OWE B;  2MP1 A;  5C3W A;  1XNR L;  1MSH A;  5JOB A;  2VQE Q;  3HOU G;  1MD2 D;  5E1F A;  1STG A;  2QA4 A;  3Q24 A;  3ITP A;  1V43 A;  2R93 H;  2JYO A;  3QG1 A;  3K7A H;  4A3K H;  4GS3 A;  2UU9 L;  1L1O C;  1IBK L;  1EYD A;  4WOR A;  2QF7 A;  1U4P A;  1TS4 A;  1UWV A;  1PVO A;  1K83 B;  1SFO H;  4HJ9 A;  1TY0 A;  3CCQ A;  3K5M A;  4OO1 G;  1ESR A;  2FJ2 A;  1JOK A;  3CCJ A;  1K73 C;  2UUC L;  2WB1 G;  3K80 C;  2IHF A;  3OIQ A;  1P8L A;  2C5C A;  2OEO A;  1PH3 A;  3H09 A;  5D3D A;  1HNX L;  2Y0S G;  4A3G H;  2B39 A;  3J7Z C;  1J8I A;  4B3M Q;  4OWX B;  3GTG H;  4MZ9 A;  3HOX B;  4POF A;  2PQA A;  3HOV H;  4IPG A;  2EYP A;  2QKI C;  3BDO A;  2PPB C;  1AP0 A;  1VS0 A;  2PW7 A;  3OIP A;  2K5H A;  1XNQ L;  3MWY W;  1MSG A;  4IAL A;  2B2V A;  3GTM B;  2SNS A;  1K28 A;  1PZK D;  4DV3 Q;  3S24 A;  2PZT A;  5C0X H;  1KAA A;  2F0N A;  3GV3 A;  1B2T A;  1QUQ A;  4FXD A;  3GTO B;  4MNO A;  4RCN A;  4HMI A;  3FP9 A;  5ELB A;  4WJ3 M;  3GTO H;  2YU9 H;  2IWH A;  5HY6 A;  2EYL A;  5JPM C;  1K8O A;  2JA9 A;  4NDX A;  4J8Q A;  5IGD A;  2KJX A;  2E2J B;  3TP6 A;  3GTL B;  2AMC B;  4IFD H;  2DNE A;  5BR8 Q;  4POG A;  4UDU C;  1ASZ A;  2E2J H;  1SBB B;  5LHY 1;  3H3V H;  2B2U C;  3LX0 A;  1GM5 A;  4TQU S;  1U4R A;  3GTP B;  1HQR D;  2K05 A;  3L2P A;  3NXW A;  4A3B G;  4DNT B;  1JE5 A;  4DR6 Q;  1VQB A;  4OXP A;  1BDO A;  2SDF A;  3K59 A;  1FD7 D;  2JA7 H;  3GTP H;  1SNM A;  3I73 A;  4FXG C;  4ZYS A;  3MXU A;  4X62 L;  2ENB A;  2XWB B;  3D6C A;  3CPF A;  4A3J B;  4OIK A;  1TWC H;  2JA5 G;  1G8Z D;  2FXQ A;  1GXD C;  4B3R L;  4IUQ A;  3K8A A;  3J81 c;  2RKS A;  1QIL A;  2CKZ B;  1BQQ T;  1Z7T A;  3KF8 A;  5IYB H;  1JQY D;  4ZCK A;  2HCI A;  1Y1V G;  3CC2 A;  4K0K L;  2BCO A;  1A6X A;  5E4W C;  4B08 A;  4IUU A;  4HJ5 A;  5JJI A;  1HR0 W;  3IKJ A;  1VDZ A;  5A2Q L;  2I07 B;  4KY5 A;  3T16 A;  2CH4 W;  5DNF A;  1D1I A;  5CC4 A;  4C3J B;  2XSC A;  4HIK A;  4APV A;  1CQV A;  3AYH B;  4JI7 L;  2J4X A;  3CW2 C;  2PNR C;  3KBG A;  4TVA B;  1NJI C;  2EJF C;  2XTI A;  3NQT A;  5D14 A;  3M4Q A;  4EX5 A;  2EXD A;  4K8I A;  2ZM6 Q;  4IUT A;  3QR8 A;  5IGF A;  4GKJ L;  2B8F A;  3BDL A;  4R1J A;  5DAU A;  4JK1 C;  5LL6 X;  1SNO A;  3F2C A;  1AFP A;  4XYO A;  3Q22 A;  1B3A A;  4IUV A;  3CP0 A;  3NP8 A;  2QGQ A;  3J81 E;  2AWN A;  2NVX B;  2F0K A;  5M5W H;  5HGT A;  1I4P A;  2EPB A;  4L5S A;  3R93 A;  1Z9F A;  2EOT A;  1Y14 B;  4DGZ A;  4NXN Q;  2H4O A;  1IYV A;  1VQG A;  4IPD A;  5I9P A;  4CDC C;  1FJG L;  4UY8 C;  2QDB A;  4J6H A;  4QGU A;  5DEH A;  4P73 A;  2I5M X;  4IPC A;  1ILP A;  1TWA B;  4RH6 A;  1KC8 C;  3CMA A;  2LFN A;  3CQZ H;  3PUZ A;  3HOU B;  5ELE A;  4G7H C;  1HZC A;  2BDN A;  4HID A;  1ASY A;  5FJ8 G;  4XT1 B;  2UXB L;  4JYA L;  4H44 C;  1O7Y A;  1PLF A;  4A3C G;  1LUZ A;  4IUP A;  3IL8 A;  3VDY A;  1QB5 D;  2F0D A;  2RHQ B;  4CDE C;  1R9T B;  2UUC Q;  5EQ0 A;  1I4G A;  5C5M A;  3F2B A;  3SK5 A;  1E3P A;  4LFB L;  2KCC A;  5CV6 A;  1GUG A;  2IJ0 A;  5CV4 A;  1EIY B;  2WB1 B;  4DAY B;  1E7Z A;  4C3I H;  1EZ6 A;  3CAM A;  4DUY Q;  2XNA C;  1X3F A;  3LNN A;  2WP8 J;  1E1T A;  2Y0S B;  4O2D A;  3LWE A;  1VQA A;  1KTK A;  2BH8 A;  1YI2 A;  4Z9C B;  2K5Q A;  4DKA C;  3ZYY X;  3I4N H;  4A75 A;  1EIF A;  2E5L Q;  2R61 A;  3H0G G;  1KDB A;  1D5M C;  3D0F A;  2J7Z A;  1B7Y B;  3F1Z A;  1XWE A;  4HR7 B;  1EY6 A;  2F0J A;  2ZT9 C;  5FK9 C;  4DUZ Q;  1XPR A;  1EYG A;  4HAE A;  2IX1 A;  3URY A;  3S1M B;  3BG3 A;  3TS0 A;  1XJV A;  1H9J A;  3VYT A;  3MZ5 A;  5J22 A;  5C3E G;  1PTO D;  2OXP A;  1STE A;  1WCM H;  1GUO A;  4ILW A;  3MFG A;  2HDL A;  2Q2U A;  2ICI A;  1LTL A;  4L5Q A;  5J39 A;  3TZU A;  3CRK C;  4ZKC B;  5BN4 A;  1I6H B;  1NBW A;  5IP7 G;  2B63 G;  4X6A H;  1NTG A;  1X65 A;  1HPC A;  4RGM A;  3SK8 A;  1WD1 A;  4IOA A;  3TN2 A;  5LMN W;  2IPK D;  1NNX A;  2Z0S A;  1SYB A;  1QNK A;  4Q5V A;  1DOL A;  5FO7 B;  1LO5 D;  1TVX A;  1JWU D;  2PQA B;  4X3K A;  3CC7 A;  4DV2 Q;  4ZAI A;  1LT4 D;  3I90 A;  4AQY Q;  3CCM A;  2PI2 E;  4IO9 A;  4A3B B;  2R7Z H;  4X62 Q;  2K28 A;  2I46 A;  4L5R C;  3NE5 B;  5IT9 c;  1M4V A;  4XXE A;  2DY7 A;  4DAP A;  4DR7 Q;  2O2L D;  2Q2I A;  2WKC A;  3PUY A;  4DXG A;  1QUQ B;  2FMC A;  5IOC A;  2JA5 B;  1JOQ A;  2AUJ D;  2TMP A;  4L8J A;  3G6J B;  4EQ5 A;  5FLM H;  2NZH A;  3RD4 A;  1K8A C;  1YIJ A;  1JWM D;  2DUD A;  1HFN A;  1Y1V B;  3I72 A;  3VYU A;  1KAW A;  5T1G A;  3G6E A;  3NQI A;  2JA6 G;  2F0I A;  4JI4 Q;  1YNJ C;  3KK7 A;  1A0I A;  4KLK A;  5I9O A;  4WJ4 A;  4F7X A;  3DUZ A;  4OIJ A;  3GDE A;  2EY2 A;  2L12 A;  2EIF A;  1HZ9 A;  1IBL Q;  3NBH B;  4B3T L;  1JJG A;  1WTR A;  3PO3 G;  5EAY A;  1EUJ A;  1A2T A;  1YHA A;  3RN5 A;  2ASB A;  4BA2 I;  3X3N A;  4GKJ Q;  1F9S A;  3OHX C;  1X55 A;  3SK6 A;  4PQX A;  3I91 A;  4YHH L;  2R3Z A;  3TS2 A;  1CHP D;  1A62 A;  3CCS A;  3M7G A;  2F0S A;  1ICW A;  4PZ7 A;  2NN6 H;  4A3I H;  2MHV A;  1PH8 A;  3DWA A;  3W2D A;  4UP9 A;  1RKN A;  2HCC A;  3KF8 B;  1QVF A;  3HOW G;  1H95 A;  2GA4 B;  4DA2 A;  2RDG A;  1H9K A;  1YHQ A;  1WTQ A;  4LF8 Q;  3FPU B;  1EIG A;  1RCV D;  1SDF A;  2EDG A;  1T9H A;  4OX9 Q;  4FVM A;  2UXC L;  2R93 G;  5CV8 A;  2EXZ A;  4A3K G;  4UPA A;  5C5L A;  4M8A A;  1OXX K;  1X3Q A;  5JEA J;  1PH4 A;  4DV7 L;  1HFG A;  3BVG A;  5DLQ E;  2XRS D;  2VQE L;  3RZD H;  3WOF A;  1II3 A;  4F87 A;  2JN4 A;  3W1B A;  1HH2 P;  2WIN B;  4KMU C;  2B2V C;  3K58 A;  1GD7 A;  1JB7 A;  3ULP A;  1PMR A;  1LT3 D;  1SYC A;  4A3C H;  3BJU A;  2VY3 A;  3J80 L;  2CVR A;  4DR1 Q;  1WTX A;  1PH5 A;  5I6Y A;  2E8G A;  1VQ6 A;  4A3G G;  4Y52 H;  1ROD A;  4S3S A;  2YTX A;  1GHK A;  3IFD A;  2AQ2 B;  3HS0 C;  3M4P A;  3R3O A;  3HOV G;  1EY4 A;  5G3L F;  3BZD B;  1M8A A;  1LTT D;  2KED A;  5CYU A;  5M5X H;  2EVB A;  2ZTD A;  3LWU A;  4Y7N B;  4CJ0 B;  4K5W A;  1MBY A;  3K0X A;  4P71 A;  3H0G B;  1EWI A;  4ODG A;  1NSN S;  1L0W A;  1I94 L;  2PI2 A;  4DAM A;  1F2M A;  4Y7N H;  5EGT A;  5CR3 A;  3S15 H;  2AHO B;  3QOL A;  2F0M A;  3VR6 A;  2BOS A;  1KHI A;  3S1R H;  2PO4 A;  1AE3 A;  1XPO A;  1FGB D;  3J7Y W;  4DV3 L;  2UUA Q;  2R7F A;  3JAM L;  2JK8 A;  1SE8 A;  1Z47 A;  5C3E B;  4R4C A;  2XGT A;  2WAQ E;  2IL8 A;  5KGU A;  3MXN B;  4L5T A;  4IZ8 A;  4A3D H;  2L1B A;  1PFN A;  3D31 A;  2QDL A;  4GOP A;  1X9N A;  1KDA A;  1QWY A;  4CGY B;  5J3B A;  4IFD G;  3C46 A;  3ND8 A;  1IKM A;  3S17 B;  1STB A;  4GLX A;  3N6R A;  5IP7 H;  2B63 H;  1N36 Q;  1MHW C;  3RZO H;  4JW0 A;  1WTP A;  1DCZ A;  1K8G A;  4YY3 Q;  4DR4 L;  4JI1 L;  4DXF A;  3E5S A;  4PZ6 A;  4BY1 H;  3I70 A;  5GAE C;  3I4M H;  5C44 G;  4DV4 Q;  2F0U A;  2JA7 G;  2KQ3 A;  4FF1 A;  2K7V A;  1T5X D;  4K8J A;  3F8T A;  3TEH B;  2PMZ E;  3SEB A;  1HHV A;  5M9O A;  1HXY D;  2K52 A;  5IWA Q;  3I3C A;  3A5U A;  1SE4 A;  5K36 H;  3J81 L;  1KQS A;  5IYB G;  3E0E A;  4HTH A;  1EQR A;  2PZW A;  2FFK B;  3CKI B;  1WTW A;  3M9B A;  2D62 A;  1NCV A;  1QNU A;  4LF9 Q;  1I4Q A;  2A19 A;  2JA6 B;  1VQN A;  1Q90 A;  2O4X A;  1LTI D;  3KFU A;  1VQH A;  5IGE A;  4DR3 Q;  4JI8 Q;  5C4H A;  3S1Q H;  2F0F A;  3NTK A;  4HMJ A;  1W2B A;  3ICE A;  3SXH A;  5CV9 A;  3KJO A;  3PO3 B;  2HQE A;  1SE2 A;  1YNJ D;  3FKI H;  4ALP A;  4G4K A;  3DXJ C;  1HQM C;  1I3Q B;  1F9P A;  3PO3 H;  4H0L C;  1SAP A;  2G5D A;  3H94 A;  4EQP A;  4DK1 A;  4DV1 Q;  4G7Z C;  3PUX A;  2VUM H;  1IXR A;  4HJ8 A;  4LFC Q;  4JV5 Q;  2ZJQ A;  2K14 A;  1V8Q A;  3PF4 A;  2L0C A;  3ULL A;  2B2W A;  4X65 Q;  2HQL A;  2ZM6 L;  1LAB A;  3AU7 A;  3CCU A;  1AEX A;  4LUO A;  1GUS A;  1PHJ A;  1VQ9 A;  5C6A A;  1LV9 A;  5KYI A;  5C4J B;  1SE3 A;  1NY4 A;  1SEB D;  4RAU C;  1VQD A;  2IY5 B;  5H1S E;  1PTO H;  1B4O A;  4RKB A;  1YJN A;  2Z6K A;  2KA7 A;  3HOW H;  1HA6 A;  2YV5 A;  1SYE A;  1F2Z A;  4C2M B;  3SE0 A;  4NXN L;  2R93 B;  3K7A B;  4A3K B;  1RD9 D;  3CU7 A;  1JOO A;  4C1N K;  2MFI A;  4C2M H;  4RGT A;  4QUF A;  5BN5 A;  5LMU Q;  3I2Z A;  1SFO B;  3TDQ A;  4TKO B;  1STH A;  3J7A 5;  4A3L G;  1B9M A;  5KEE A;  2F0L A;  4LK1 C;  2R7D A;  4C3I G;  3PO2 H;  4A93 G;  2F3W A;  1BBW A;  1GKH A;  2F0H A;  1Q86 C;  1Q8K A;  1TQO A;  4F8M A;  3MEF A;  2JQO A;  2K5W A;  2CH4 A;  1UE7 A;  4A3G B;  1PYW D;  2A6H C;  3GTG B;  2PZU A;  3I4N G;  2F1M A;  3C3L A;  3HOV B;  3OSO A;  2DN8 A;  3TME A;  3HGB A;  4RHR A;  1I94 Q;  3OOC A;  3X3M A;  4DUY L;  4GN4 B;  1A2U A;  1A3T A;  2R92 H;  1N32 L;  1SND A;  1C9O A;  1CTM A;  1CT1 D;  2MO0 A;  3TRZ A;  2GN5 A;  4MN3 A;  2E5L L;  1I5F A;  2KCT A;  4IUN A;  2NVY H;  2K4K A;  1EWH A;  2AUK A;  1X3P A;  1WCM G;  2FIN B;  5ELD A;  4JCV E;  2KHJ A;  1Y1W G;  4GN5 A;  1W6J A;  1K0R A;  3I7F A;  2YU9 B;  1G6P A;  4BBR G;  2NZO A;  4DUZ L;  2EY6 A;  5M3F H;  1PH6 A;  4CHT B;  1PRT B;  1D8L A;  2L11 A;  3FEW X;  4X64 Q;  3HKZ G;  2CQO A;  2VB2 X;  1WTO A;  2YTV A;  4HCE A;  4FO2 A;  4KI0 A;  4X3T A;  5ELN A;  1WOC A;  1MIU A;  2D9U A;  3HRZ C;  2D0O A;  2EYM A;  1AN8 A;  1SYG A;  3OMG A;  3D3R A;  3CCR A;  4JI1 Q;  4DR4 Q;  5T1I A;  2L55 A;  4QIW E;  3KOJ A;  2R7Z G;  2HUG A;  1G51 A;  3IRB A;  4U67 3;  2MNA A;  2CW0 C;  4HSV A;  4JOI C;  1Y69 U;  4BY7 G;  2RVL A;  5C44 B;  2KUM A;  2F0Q A;  1DJR D;  2JA7 B;  5IT9 L;  2BA0 A;  5M5Y H;  1EY8 A;  3T4A C;  1JC7 A;  1QJO A;  3HOZ H;  2ZXR A;  2SOB A;  1EEF D;  1TWC B;  1CKO A;  2ZJP A;  1EY9 A;  1VQJ A;  3SK4 A;  5C44 H;  4DV2 L;  4AQY L;  1VQM A;  4OO1 I;  2N49 A;  5FLM G;  2G9D A;  1UNS A;  5IGG A;  3TQY A;  1O80 A;  3BU2 A;  3GTQ H;  4YCU A;  4DR7 L;  5F2D A;  1LT6 D;  1HA5 A;  3VYR A;  2N55 A;  2M00 A;  1VCI A;  1QOH A;  2M2L A;  4KY7 A;  3UDI A;  4GOP B;  1WVL A;  3CCV A;  4I7A A;  3MTS A;  2E76 C;  1JR0 D;  5GAD C;  1DXM A;  5CV5 A;  3ERQ A;  2E2D C;  1V9P A;  4XIG S;  2RSN A;  4DU9 A;  3U4Z A;  3HP3 A;  3SDZ A;  2JSO A;  4DNR B;  1XPU A;  1EYA A;  4JI4 L;  1VMP A;  2OWO A;  1LAC A;  5COY A;  1U9R A;  1SNP A;  1L0Y B;  1IBL L;  2AQ1 B;  5I2X A;  3M4O H;  1NMF A;  2ZTC A;  1NMG A;  5A35 A;  2SNM A;  4KK7 A;  4EQO A;  1KD1 C;  3RLN A;  1N8R C;  3KLW A;  3HEJ A;  4OEL B;  1CZW A;  2NN6 G;  2VXW A;  4A3I G;  1XYI A;  3S14 B;  5M5W B;  1I6V C;  2JEA I;  2F0T A;  1YNN C;  4FP5 D;  3WDN A;  1BCP F;  2PW5 A;  2A68 C;  3S14 H;  2VL6 A;  4PMW A;  1PRT C;  1WI5 A;  4OGQ C;  2PYK A;  1HCZ A;  4PZ8 A;  4C3H H;  3CQZ B;  1PZJ D;  3J80 i;  1B53 A;  1CKM A;  2E75 C;  3Q23 A;  1XTC D;  2B2Y A;  3HZX A;  4HN7 A;  3W1G A;  1S3O A;  3K5O A;  2OT2 A;  4F88 A;  4OWW B;  5D65 A;  3H3V C;  3GTK B;  1E2V A;  2JE6 I;  3I4O A;  4OHJ A;  4FXK C;  4A3F G;  2VNU D;  1AZP A;  4DV5 Q;  4LF8 L;  4OX9 L;  4GKK L;  3JC6 6;  1HUN A;  4CDD C;  1BOS A;  4N9P A;  3GTK H;  3RN2 A;  1XMO Q;  2O5I C;  3F2D A;  4NXM Q;  3W3A A;  4JI0 L;  1KRS A;  4QF4 A;  4C3I B;  2IT1 A;  4RMF A;  4A3L H;  1QVC A;  2A69 C;  5FO9 B;  1NR4 A;  5IOD A;  2RCF A;  1ZXT A;  5KYL A;  5FLX c;  4DR1 L;  4A93 H;  2AQ3 B;  1EQQ A;  1M1K C;  3I4N B;  2F3V A;  2RDH A;  3JAM i;  4GOP C;  1N32 Q;  4R4T A;  3EVQ A;  3T1H Q;  2KOL A;  3QWN A;  2A6H D;  4XTC S;  2CQA A;  3OPO A;  4HIO A;  4LF4 Q;  5GQO A;  1YEZ A;  1TU2 B;  4A4I A;  2NVT H;  3M3Y H;  1VQI A;  3F2U A;  3PSI A;  4NW2 A;  1LTG D;  3I8Z A;  3NTI A;  2MUY A;  2F0V A;  4LW1 A;  3VA7 A;  5IP9 H;  1G6Z A;  3W5O A;  2CWP A;  2QCP X;  1GJX A;  2D0P A;  1ET9 A;  4ID6 A;  5IYD H;  1FYC A;  2DY8 A;  1WCM B;  4A3D G;  2EYO A;  5EKI A;  5EKL A;  3EJI A;  3PF5 A;  2EY5 A;  4BBR B;  3S2D H;  1KIX A;  2VB3 X;  3K6O A;  3V2T A;  1Y1W H;  1L1O A;  1RTO A;  3EA6 A;  1XMQ Q;  2UUA L;  3HKZ B;  4BBR H;  4OWT B;  3T1Y Q;  4BWG B;  3AFP A;  4XQJ A;  1KRT A;  4K5X A;  1GUW A;  5FLX E;  4KHZ A;  3J81 i;  2OTJ A;  2G9H D;  1YVC A;  4BY1 G;  3HFZ B;  2D2C C;  3MAQ A;  3I4M G;  4IQZ A;  3WWV A;  1PDQ A;  4M1U B;  2R7Z B;  1STA A;  1PYB A;  3DEP A;  3N52 A;  1AW7 A;  4DF7 A;  2NBF A;  4BY7 B;  1N36 L;  1SLJ A;  1TS3 A;  1CHQ D;  4HED A;  4GLA C;  4YY3 L;  5EPL A;  3S2H H;  2HHH Q;  2XIW A;  5K36 G;  4BY7 H;  2CW0 D;  3NBI A;  4DV4 L;  1B3Q A;  2PMZ B;  1B9N A;  3BVM A;  5C4Z A;  2WKD A;  4JBW A;  4HCS A;  1BVS A;  4NB3 A;  5IWA L;  1DGS A;  4ULL A;  3A8J E;  1SRU A;  4JI5 Q;  2NVQ H;  3FVQ A;  2B2W C;  3A56 A;  4KN4 C;  1AH9 A;  3C1F A;  3D8G A;  3FMC A;  1MJC A;  2LS0 1;  2UUB Q;  5IYC H;  1YHB A;  1U5K A;  3NEL A;  4LF9 L;  1UEB A;  2X69 A;  3FKI G;  1MGS A;  3R2I A;  2FMM A;  4JI6 Q;  4ME5 A;  4X66 Q;  3PIO 3;  2QEX A;  4J1M A;  2UXD Q;  5CMD A;  3EN2 A;  2Z6K C;  1VQK A;  1IL8 A;  2L5T A;  4DR3 L;  4JI8 L;  2VUM G;  2CWA A;  3E9I A;  4DV6 L;  1PA6 A;  4G7O C;  1A8V A;  1ENC A;  5LL6 S;  3EBE A;  3E6Z X;  3KLS X;  3QO2 A;  1J9O A;  3OWF A;  4K6D A;  2K50 A;  3A8I E;  5G3L D;  3SVM A;  4LJZ C;  4A3I B;  1LT5 D;  4DV1 L;  1PTO F;  3K5L A;  3HKS A;  3CCL A;  3CRL C;  4LFC L;  1N9W A;  4JV5 L;  1I50 H;  1VQF A;  2B2T A;  3NWT A;  4N8X 1;  3SHL A;  1X54 A;  4TSS A;  4UP8 A;  1KNE A;  1SYF A;  5EKK A;  4X65 L;  1BCP B;  1K9M C;  3FPP A;  1YNN D;  1Y8P B;  1VQ8 A;  1J5E Q;  2OQK A;  1E1O A;  2A68 D;  1PRT D;  2LSS A;  1CSQ A;  5JJZ A;  4GKK Q;  1X56 A;  3RZD B;  5C4X H;  2CCZ A;  4IOC A;  5DM7 3;  1FNW A;  1N34 Q;  3PUV A;  4JI0 Q;  1RF2 D;  5DM6 3;  4A3F H;  1SXT A;  3K5N A;  3UE1 A;  2EZV A;  1PXU A;  3UE0 A;  1H9M A;  3PO2 G;  2ICE C;  4KTA A;  2E2I B;  2WAC A;  5LMU L;  1ZYR C;  1S40 A;  4CBV A;  4O1N A;  1BBX C;  2RSO A;  2MO1 A;  5JEA G;  3D6W A;  3C1E A;  2K04 A;  2E2I H;  4JI3 Q;  1JB3 A;  1R4Q B;  1EYC A;  1BXT A;  2KBN A;  2VQF L;  4BBS H;  1G2T A;  1UE1 A;  3A54 A;  4ZQ3 A;  5ELC A;  1KL9 A;  2K1B A;  1JJC B;  5KNB A;  5M5X B;  1IW7 C;  3D4W A;  4FF3 A;  2HIX A;  2HT1 A;  1OTC A;  2R92 G;  2A69 D;  1DOM A;  3UDF A;  3PCO B;  5FKA C;  3CCE A;  5HGQ A;  1CA6 A;  2RCN A;  2Z6B A;  3S15 B;  1CI3 M;  3S1R B;  1X3E A;  1VQ4 A;  3AQQ A;  5C0X J;  3KDF A;  2Y0S E;  1RTN A;  3A5Z B;  2EE1 A;  5M3F G;  4A3D B;  3UDG A;  3PIP 3;  3H6M A;  4K2K A;  2Q2T A;  1N33 Q;  4DK6 C;  2PCF B;  3GTJ H;  1STN A;  1ESF A;  1ET6 A;  3T53 B;  4HIM A;  2L15 A;  3ER0 A;  5JAV A;  2I5H A;  2L9H A;  1SNQ A;  2F0P A;  4EGV A;  2DNC A;  4KV6 A;  2B63 B;  4CKE A;  4V0B A;  3RZO B;  2E2H B;  4N8F A;  4X64 L;  2NTS A;  2EQS A;  3OMC A;  1G2S A;  1BCP C;  3MFY A;  2CHB D;  4JI2 L;  2IW3 A;  4BY1 B;  1TWG H;  1U0L A;  3VR3 A;  1VQO A;  1JMC A;  1LTA D;  3I4M B;  4IFD J;  2E2H H;  2WII B;  3VA5 A;  4RKL A;  3D4D A;  4JG2 A;  4QIW B;  4GN3 B;  3DLL A;  1I4X A;  3HOZ G;  2N3S A;  4O0A A;  2E74 C;  4QJF A;  3DMU A;  4C56 C;  2K32 A;  2YYZ A;  5K5P A;  3AMU A;  5FOB B;  1YJ9 A;  1LYL A;  1GOZ A;  3RNU A;  1KDC A;  2EJG C;  5M3M H;  3MXP A;  3AFQ A;  3U9S A;  5CGK A;  3G7L A;  4A3E H;  2RQX A;  1L1O B;  1ENA A;  1D5X C;  3S1Q B;  1CSP A;  3PMF A;  1BF4 A;  4JPB W;  3PIO A;  3A74 A;  1VF7 A;  5KIX A;  4J15 A;  3S1N H;  4YCW A;  3FKI B;  1OXT A;  1YBY A;  5C0X I;  4QQB X;  4DV6 Q;  1M90 C;  4YWM A;  2F0E A;  4NMZ A;  4JBM A;  2DGY A;  2B2Y C;  4DK0 A;  2VUM B;  3NEM A;  4CKB A;  2Z4H A;  2F3I A;  4KHP Q;  2X6G A;  2JA8 H;  4I65 A;  1RDP D;  1PFM A;  3CPW A;  1WYD A;  1EQV A;  1JJ2 A;  5IGC A;  1L0X B;  2K5N A;  4B3S Q;  4R4O A;  2QW7 A;  5I2Y A;  1UEA B;  1KXL A;  2MJ8 A;  1MI2 A;  1PTO B;  3MVV A;  4MTK A;  4C3H G;  4IFD I;  4ZUJ A;  3RMH A;  3HOW B;  4DK3 C;  2Q8R E;  1TWF H;  3H3V I;  1K3B C;  3G71 A;  1PFS A;  4NPS A;  3BS1 A;  1E24 A;  2YTY A;  4JBJ A;  5AFW A;  4PMC A;  1DON A;  5J1Z A;  3OW2 A;  4GLV B;  2H1E A;  1YIT A;  4V19 0;  2NWG A;  1GUT A;  1VMC A;  1TII D;  4WJW A;  4DAY A;  3H91 A;  3NUC A;  1GHJ A;  1QZH A;  1BUV T;  1H9R A;  5ISR A;  1V1P A;  1D1K A;  1HNZ Q;  2OCE A;  5IGB A;  1ENF A;  4DR5 Q;  4H13 C;  3RLO A;  4DV5 L;  2HIV A;  1R4P B;  3S16 H;  2MPM A;  3PO2 B;  3KF6 A;  2BE5 C;  3OTO Q;  4LUZ A;  2RF4 A;  4A3M H;  1EU4 A;  4HJ7 A;  2VQF Q;  1XMO L;  3CD6 A;  2R6G A;  2EYH A;  2EYF A;  3KLR A;  5TSS A;  3LGJ A;  1SMX A;  5FLX L;  4NXM L;  3FRP B;  1DD2 A;  1XTD A;  3M85 A;  1RL2 A;  1ZYR D;  5JEA H;  3BZC A;  4UP7 A;  1D6E C;  3A7A B;  4JC0 A;  4HJA A;  5IE8 A;  3GD7 A;  2R92 B;  1JIC A;  3VR5 A;  3ND9 A;  3NEN A;  1O7Z A;  4RFB A;  4LF6 Q;  4K2L A;  1IYU A;  5E4X A;  1VF5 C;  1TWH B;  1IW7 D;  5IP9 G;  3J80 c;  4DAV A;  2NVY B;  3T51 B;  1K83 H;  3T1H L;  1HUM A;  3K81 C;  5IYD G;  1TWH H;  4LF4 L;  3PIP A;  4R8I A;  5D3I B;  3VR2 A;  4LMQ D;  2F0O A;  1A3U A;  1PV4 A;  5M3F B;  4FF2 A;  4TRD A;  2XRQ D;  1IBM L;  4DN4 M;  4O42 A;  1WTV A;  2WV6 D;  2WAQ G;  1STY A;  1U4L A;  3HOY G;  4RWS C;  4EQN A;  4DR2 Q;  1YZ6 A;  3HOX H;  3E0J A;  1BBU A;  1SNC A;  4AYB E;  4JI2 Q;  2MGS A;  1UUP A;  1PTO C;  4DFA A;  1XMQ L;  4B9W A;  2A73 B;  3GTM H;  1Z6H A;  3T1Y L;  4AIM A;  3TRE A;  1ZKO A;  1H9S A;  3G4S A;  1JT8 A;  3JAM c;  5M5Y B;  3HOZ B;  2B8G A;  4P75 A;  3KLS A;  2ZXO A;  2VW9 A;  1O7I A;  2ALY B;  2ZTE A;  1BCP D;  3B6Y A;  1CK1 A;  3NHH A;  4QMG A;  3J80 E;  1AZQ A;  1XXG A;  1K0S A;  2F0G A;  3DWP A;  1FNU A;  3K0Y A;  3P20 A;  3BYY B;  4LWC A;  3KDF B;  4C1N I;  2A1A A;  2PQE A;  4FNF A;  1C7Y A;  3P1H A;  5L37 A;  3GTQ B;  2Q2H A;  1C0A A;  3J7A V;  2FHT A;  2A74 C;  3NBH A;  2HHH L;  4MIU A;  1IZ6 A;  1FGU A;  1IKL A;  1PH2 A;  1ONL A;  3PQI A;  1QZG A;  3GTL H;  1RJT A;  3IFT A;  3P7J A;  1EWC A;  5IYC G;  1CZG A;  1A3V A;  4ZLT F;  3KUP A;  1DM0 B;  2B2T C;  3QB3 A;  2NTT A;  1EY5 A;  4JI5 L;  2OQ0 A;  3K7U C;  1S72 A;  2UUB L;  4ZRZ A;  1EY0 A;  1SN8 A;  4QL5 A;  3M4O B;  1B8A A;  4A76 A;  4IN3 A;  3ONA B;  1LLR D;  2Z1C A;  3VR4 A;  4A3J H;  4JI6 L;  4X66 L;  3JAM E;  4MHE A;  4GNX A;  3U9O A;  1CFM A;  4QB4 A;  2K33 A;  2ZJR A;  2UXD L;  2BA1 A;  3I4L A;  1Q8I A;  3EFX D;  4RHS A;  5AJ3 Q;  1EIH A;  5JVG 3;  2K6A A;  1CKN A;  2F03 A;  4FF4 A;  5GAG C;  3TBI B;  4LF5 L;  3OYY A;  3ERO A;  4U68 A;  4C3H B;  4KKU A;  1D5Z C;  3NSW A;  1FR3 A;  4IUR A;  4C3J H;  5COR A;  3U4V A;  2Z4I A;  4ME3 A;  2JP1 A;  5C3X A;  5C4X G;  2K03 A;  1Q1E A;  2K75 A;  3KYH C;  3RR5 A;  4I7Z C;  2F4V Q;  1J5E L;  1G29 1;  5I6W A;  2Z8L A;  2VZA A;  1EOT A;  5HUR A;  3HG9 A;  2BDO A;  3DM3 A;  1TT2 A;  4UHV A;  1DYQ A;  1XNR Q;  1S4Z A;  3J7A F;  1WFQ A;  1HR0 L;  1MJE A;  2NVX H;  1N34 L;  5GAH C;  1E0B A;  3A8K E;  1DZ1 A;  1WTH A;  2C35 B;  4BBS G;  1HJP A;  2WFW A;  4LAA A;  4A93 B;  2A6E C;  1Q81 C;  2Q8I B;  3H15 A;  3CF5 A;  2UU9 Q;  1S5D D;  1IBK Q;  2BE5 D;  3V96 A;  3DHQ A;  1X6O A;  4R4I A;  2KEC A;  1KAB A;  1Y8O B;  1TWA H;  1F9Q A;  1HZA A;  3RUZ A;  2H5X A;  3TSS A;  2ATW A;  1G91 A;  3HOU H;  1QG7 A;  4H7B A;  4JI3 L;  2A5H A;  2NYZ D;  2OTL A;  2HD3 A;  1VQP A;  3R2T A;  3SR1 A;  1HNW L;  2NVT B;  1ML0 D;  3M3Y B;  3BYT B;  4RGN A;  5JPN C;  3U58 A;  3MXN A;  3L9A X;  3T56 B;  3UI2 A;  1R9T H;  2VS1 A;  3FHW A;  1HNX Q;  1TXY A;  1EY7 A;  5EBC A;  2V1C C;  3QOJ A;  4ZUI A;  4OO1 H;  4BS9 A;  1S5B D;  1BO0 A;  1S5F D;  1IBM Q;  4FDB A;  1V1P B;  4P2C B;  3S2D B;  2D5D A;  2ES2 A;  2OF1 A;  1UE5 A;  1F2L A;  2NN6 I;  4QUC A;  3KJP A;  4R8N A;  1KLU D;  3WOE A;  4ABN A;  4P74 A;  1OO9 B;  3DWQ A;  1XNQ Q;  5EPK A;  3KF6 B;  4Q0F A;  1Y1W B;  1I4H A;  1SMY C;  4QY7 A;  1PYS B;  2KEN A;  4YWK A;  1CUK A;  1W6K A;  2WAQ B;  3HOY B;  1N33 L;  2ZXP A;  3MC0 B;  3PUW A;  4AYB G;  3HOY H;  1RHP A;  2L4N A;  1Q12 A;  4N9T A;  4CJ2 C;  1FNV A;  1VQ5 A;  2AKW B;  3DM1 A;  4L6T B;  4IJH A;  3S2H B;  1X32 A;  1MKH A;  3S1M H;  2KHS A;  4OEM B;  1XX8 A;  3CHB D;  1RIP A;  4KKS A;  1B50 A;  1EOV A;  3U50 C;  1X3G A;  3BZK A;  4KY6 A;  5M3M G;  1V1O A;  3OW7 A;  1HRJ A;  1CQF A;  2RDF A;  1C48 A;  4BA1 I;  5BN3 A;  1WJJ A;  3D4R A;  3GP7 A;  3E9H A;  4XQQ A;  1I6H H;  1ILQ A;  4A3E G;  1YJW A;  3TZD A;  1ZEQ X;  1GVP A;  2NVQ B;  1EZ8 A;  4XQN A;  4IPH A;  4DNI A;  1Q7Y C;  1HZB A;  4LUV A;  4RG1 A;  1UAP A;  4XDX A;  3GQB A;  1OXU A;  1SYD A;  5IY0 A;  4B3R Q;  1SSO A;  4XT3 B;  1NR2 A;  1NE3 A;  1IYJ B;  3VYS A;  2NUC A;  4A3B H;  4NKL A;  3L0O A;  4HSP A;  1IL2 A;  3R8B A;  3M7N A;  1LTS D;  4K0K Q;  1H9S B;  3Q0A A;  2M9V A;  3BDC A;  2B29 A;  1D7Q A;  1T5E A;  2JA8 G;  1L2F A;  2JA5 H;  3FDT A;  5EBD A;  2XVS A;  4YIJ A;  1NUC A;  2NZ1 D;  1JWS D;  1OXV A;  5LMN L;  1IHZ A;  3GV6 A;  4CJ1 B;  4LF5 Q;  4KHP L;  2B2U A;  1GUN A;  1Y1V H;  1I50 B;  4JOI A;  1EL0 A;  1EFI D;  3TP7 A;  4JI7 Q;  2P5Z X;  2V4D A;  3TP5 A;  2N78 A;  4OL7 A;  4B3S L;  4FYD A;  4ZK9 B;  3T13 A;  4LFA L;  5GRO A;  2HDM A;  2RHS B;  4E6I A;  2GVB A;  4DV0 L;  1S5C D;  1HTP A;  4OON A;  4X3U A;  3S9W A;  4BXX G;  2KVM A;  3MXG A;  4UAI A;  2RBM A;  3NWS A;  4YWL A;  5IT9 E;  4CDF C;  4P72 A;  1SJE D;  1PH9 A;  5C4X B;  2F0W A;  3QIA A;  2DJG C;  4KN7 C;  4WFN 3;  1PZI D;  4K14 A;  1SR3 A;  1LTB D;  2Z9H A;  3DEO A;  4H02 A;  4A3F B;  3STB C;  1KLG D;  2LXK A;  2I0Q A;  4IJL A;  1TKW B;  3C2P A;  1HR0 Q;  1LTR D;  3QJY A;  2B3G A;  3PGZ A;  4B9X A;  4GNX B;  1FJG Q;  5CV7 A;  4A3M G;  1GO3 E;  4YCV A;  5CBE E;  3A7L A;  4XYQ A;  1EQT A;  2JXM B;  3UDX A;  4KJN A;  1HNZ L;  4BBS B;  4DR5 L;  1CKN B;  2K5V A;  4AH6 A;  4LF7 L;  3CXC A;  5KRU A;  2UXB Q;  3K57 A;  1O78 A;  4JYA Q;  5FO8 B;  3OTO L;  1BNZ A;  5EJW A;  5A2Q E;  1PH1 A;  2O5J C;  3EQL C;  1HNW Q;  2BH2 A;  3RLF A;  1A63 A;  1VQL A;  1I4R A;  2A8V A;  4NP5 A;  2A6E D;  5FJ8 H;  4X3S A;  4LFB Q;  2EYJ A;  1EEI D;  1UE6 A;  2KEE A;  4RGO S;  2MQH A;  3E3X A;  2LKV A;  4KD4 A;  2LY7 A;  4G57 A;  1TS5 A;  2WB1 E;  2IX3 A;  4LF6 L;  4L63 B;  1OXS C;  2AWO A;  1HTL D;  3NK9 A;  1DOK A;  2NB0 A;  4JBK A;  4PNY A;  2J0T D;  2RA4 A;  3GTJ B;  1PH7 A;  3L3O C;  1K8M A;  1O7L A;  1TR5 A;  1KNA A;  5E7N A;  2N88 A;  3M4Y A;  2LXJ A;  5CBA E;  3HOX G;  2K5D A;  2C9O A;  2LMC B;  3ERS X;  4R9W A;  2QIL A;  5C0X G;  2I5L X;  2KCM A;  4B3M L;  1C8C A;  1QVG A;  3GO5 A;  1LM0 A;  3MA2 B;  1BKB A;  1JOR A;  1B70 B;  1SMY D;  3H0G H;  1TWG B;  4AYB B;  3TP8 A;  3J81 j;  1E2W A;  2Q8T A;  5KND A;  4DR2 L;  3Q8D A;  1P16 A;  4PV1 C;  1PRT F;  3V05 A;  1VQE A;  2XN9 C;  1K3R A;  2KCN A;  4MTN A;  5E3F A;  1JE4 A;  2JJQ A;  3HKZ E;  2K01 A;  3Q6S A;  2IHE A;  2JEB I;  2X6L A;  1V1Q A;  5C3E H;  4RCO A;  1Q3L A;  3A55 A;  5M3M B;  3IAY A;  1CA5 A;  4GNX C;  1YNX A;  4PMB A;  2EY1 A;  4A3E B;  4CKC A;  1SJH D;  4LNQ A;  3S17 H;  1PFB A;  3ZJY C;  1Q82 C;  3L7Z C;  5BR8 L;  3S1N B;  1EFW A;  1VQ7 A;  3SGI A;  1F2Y A;  2F4I A;  3G48 A;  1E2Z A;  4JVZ A;  2F52 A;  5KNC A;  1WD0 A;  3EIV A;  3I55 A;  1B44 D;  1E22 A;  4GZY C;  1D2B A;  2ID0 A;  4DR6 L;  4A3J G;  1Y8N B;  5EPJ A;  1W3S A;  4KJO A;  2JA8 B;  2DJF C;  5LMN Q;  4QCL A;  2GVA A;  3NPP A;  1JCK B;  2SEB D;  4ZKB B;  2QEJ C;  3O13 A;  4R4Q A;  3PV0 A;  1BR9 A;  3AB9 A;  1CM9 A;  4B3T Q;  5JVH 3;  1FL0 A;  2EJM A;  3ULJ A;  3CC4 A;  2JA6 H;  1EU3 A;  5AJ3 L;  4LFA Q;  1A15 A;  4KD3 A;  1B1Z A;  1TS2 A;  1TWF B;  2CFM A;  2KHI A;  3KBX A;  4PG3 A;  4DV0 Q;  4KHV A;  4C3J G;  4K5V A;  2N8N A;  5ELO A;  1FVI A;  4YHH Q;  1TY2 A;  5I4D A;  1NAP A;  1SRO A;  5JJK A;  3CME A;  1I3Q H; 
#chains in the Genus database with same CATH homology
 1F9R A;  4WRD A;  3P75 A;  1C4Q A;  4K6L A;  3NTH A;  4KKT A;  1U4M A;  1Q1B A;  3S16 B;  4EVO A;  1QE6 A;  4RA8 A;  2TSS A;  4A3M B;  5ELF A;  1S5E D;  1F77 A;  5NUC A;  2XWJ B;  5IIF A;  3BVZ A;  2IX0 A;  3MHB A;  1QCB D;  3MEH A;  3OWE B;  2MP1 A;  5C3W A;  1MSH A;  5JOB A;  1MD2 D;  5E1F A;  1STG A;  3Q24 A;  3ITP A;  1V43 A;  2JYO A;  3QG1 A;  1EYD A;  4WOR A;  2QF7 A;  1U4P A;  1TS4 A;  1K83 B;  1TY0 A;  3K5M A;  4OO1 G;  1ESR A;  2FJ2 A;  1JOK A;  3OIQ A;  2C5C A;  2OEO A;  3H09 A;  5D3D A;  2B39 A;  1J8I A;  3HOX B;  2EYP A;  2QKI C;  3BDO A;  2PPB C;  1AP0 A;  2PW7 A;  3OIP A;  3MWY W;  1MSG A;  4IAL A;  2B2V A;  3GTM B;  2SNS A;  1PZK D;  2PZT A;  5C0X H;  1KAA A;  2F0N A;  3GV3 A;  1B2T A;  4FXD A;  3GTO B;  4RCN A;  4HMI A;  5ELB A;  2IWH A;  2EYL A;  5JPM C;  1K8O A;  4NDX A;  4J8Q A;  5IGD A;  2KJX A;  2E2J B;  3TP6 A;  3GTL B;  4IFD H;  2DNE A;  4UDU C;  1SBB B;  5LHY 1;  2B2U C;  3LX0 A;  4TQU S;  1U4R A;  3GTP B;  1HQR D;  2K05 A;  3NXW A;  4DNT B;  1BDO A;  2SDF A;  3K59 A;  1FD7 D;  1SNM A;  3I73 A;  4FXG C;  4ZYS A;  3MXU A;  2ENB A;  2XWB B;  3D6C A;  4A3J B;  4OIK A;  1G8Z D;  1GXD C;  4IUQ A;  2RKS A;  1QIL A;  1BQQ T;  1Z7T A;  3KF8 A;  1JQY D;  2HCI A;  2BCO A;  1A6X A;  5E4W C;  4B08 A;  4IUU A;  3IKJ A;  1VDZ A;  5A2Q L;  2I07 B;  4KY5 A;  3T16 A;  5DNF A;  1D1I A;  5CC4 A;  4C3J B;  2XSC A;  1CQV A;  2J4X A;  2PNR C;  3KBG A;  2EJF C;  3NQT A;  5D14 A;  4K8I A;  4IUT A;  5IGF A;  2B8F A;  3BDL A;  5DAU A;  4JK1 C;  5LL6 X;  1SNO A;  1AFP A;  4XYO A;  3Q22 A;  1B3A A;  4IUV A;  3NP8 A;  3J81 E;  2AWN A;  2NVX B;  2F0K A;  5HGT A;  1I4P A;  2EPB A;  3R93 A;  4DGZ A;  2EOT A;  2H4O A;  1IYV A;  5I9P A;  2QDB A;  4J6H A;  5DEH A;  1ILP A;  1TWA B;  4RH6 A;  2LFN A;  3PUZ A;  3HOU B;  5ELE A;  4G7H C;  2BDN A;  4XT1 B;  4H44 C;  1O7Y A;  1PLF A;  4IUP A;  3IL8 A;  1QB5 D;  2F0D A;  1R9T B;  5EQ0 A;  1I4G A;  5C5M A;  3SK5 A;  2KCC A;  5CV6 A;  1GUG A;  2IJ0 A;  5CV4 A;  2WB1 B;  1EZ6 A;  2XNA C;  3LNN A;  2WP8 J;  2Y0S B;  3LWE A;  1KTK A;  4Z9C B;  2K5Q A;  3ZYY X;  2R61 A;  1KDB A;  1D5M C;  2J7Z A;  1XWE A;  4HR7 B;  1EY6 A;  2F0J A;  2ZT9 C;  5FK9 C;  4HAE A;  2IX1 A;  3URY A;  3S1M B;  3BG3 A;  1H9J A;  3VYT A;  3MZ5 A;  5J22 A;  1PTO D;  2OXP A;  1STE A;  1GUO A;  4ILW A;  3MFG A;  2HDL A;  2ICI A;  5J39 A;  3TZU A;  3CRK C;  4ZKC B;  5BN4 A;  1I6H B;  1HPC A;  4RGM A;  3SK8 A;  1WD1 A;  3TN2 A;  2IPK D;  1SYB A;  1QNK A;  4Q5V A;  1DOL A;  5FO7 B;  1LO5 D;  1TVX A;  1JWU D;  4X3K A;  4ZAI A;  1LT4 D;  3I90 A;  4A3B B;  2K28 A;  2I46 A;  3NE5 B;  1M4V A;  4XXE A;  2DY7 A;  4DAP A;  2O2L D;  2WKC A;  3PUY A;  4DXG A;  2FMC A;  5IOC A;  2JA5 B;  1JOQ A;  2AUJ D;  2TMP A;  4L8J A;  3G6J B;  3RD4 A;  1JWM D;  1HFN A;  1Y1V B;  3I72 A;  3VYU A;  5T1G A;  3NQI A;  2F0I A;  1YNJ C;  3KK7 A;  5I9O A;  4F7X A;  3DUZ A;  4OIJ A;  2EY2 A;  2L12 A;  1WTR A;  1A2T A;  4BA2 I;  3X3N A;  1F9S A;  3OHX C;  3SK6 A;  4PQX A;  3I91 A;  2R3Z A;  1CHP D;  3M7G A;  2F0S A;  1ICW A;  2NN6 H;  2MHV A;  3DWA A;  3W2D A;  1RKN A;  2HCC A;  2GA4 B;  4DA2 A;  2RDG A;  1H9K A;  1WTQ A;  1EIG A;  3FPU B;  1RCV D;  1SDF A;  2EDG A;  4FVM A;  5CV8 A;  2EXZ A;  5C5L A;  4M8A A;  1OXX K;  1X3Q A;  5JEA J;  1HFG A;  3BVG A;  2XRS D;  3WOF A;  1II3 A;  4F87 A;  2WIN B;  4KMU C;  2B2V C;  3K58 A;  1PMR A;  1LT3 D;  1SYC A;  3J80 L;  2CVR A;  1WTX A;  5I6Y A;  1ROD A;  4S3S A;  1GHK A;  3IFD A;  2AQ2 B;  3HS0 C;  3R3O A;  1EY4 A;  5G3L F;  3BZD B;  1M8A A;  1LTT D;  2KED A;  5CYU A;  2EVB A;  3LWU A;  4Y7N B;  4CJ0 B;  4K5W A;  1MBY A;  3H0G B;  4ODG A;  1NSN S;  1F2M A;  5EGT A;  5CR3 A;  3QOL A;  2F0M A;  3VR6 A;  2BOS A;  2PO4 A;  1FGB D;  3J7Y W;  3JAM L;  1Z47 A;  5C3E B;  2IL8 A;  5KGU A;  4IZ8 A;  2L1B A;  1PFN A;  3D31 A;  1KDA A;  1QWY A;  4CGY B;  4IFD G;  3C46 A;  3ND8 A;  1IKM A;  3S17 B;  1STB A;  3N6R A;  1WTP A;  1DCZ A;  4DXF A;  3E5S A;  3I70 A;  2F0U A;  2KQ3 A;  4FF1 A;  2K7V A;  1T5X D;  4K8J A;  3SEB A;  1HHV A;  5M9O A;  1HXY D;  3I3C A;  1SE4 A;  5K36 H;  3J81 L;  4HTH A;  2PZW A;  2FFK B;  3CKI B;  1WTW A;  2D62 A;  1NCV A;  1QNU A;  1I4Q A;  2JA6 B;  1Q90 A;  2O4X A;  1LTI D;  5IGE A;  5C4H A;  2F0F A;  3NTK A;  4HMJ A;  3SXH A;  5CV9 A;  3PO3 B;  2HQE A;  1SE2 A;  1YNJ D;  4G4K A;  3DXJ C;  1HQM C;  1I3Q B;  1F9P A;  4H0L C;  1SAP A;  3H94 A;  4EQP A;  4DK1 A;  4G7Z C;  3PUX A;  1V8Q A;  2L0C A;  2B2W A;  1LAB A;  3AU7 A;  1AEX A;  1GUS A;  5C6A A;  1LV9 A;  5KYI A;  5C4J B;  1SE3 A;  1SEB D;  4RAU C;  1PTO H;  1B4O A;  4RKB A;  2KA7 A;  1HA6 A;  1SYE A;  1F2Z A;  4C2M B;  3SE0 A;  2R93 B;  3K7A B;  4A3K B;  1RD9 D;  3CU7 A;  1JOO A;  4C1N K;  4RGT A;  4QUF A;  5BN5 A;  1SFO B;  3TDQ A;  4TKO B;  1STH A;  1B9M A;  5KEE A;  2F0L A;  4LK1 C;  4C3I G;  2F3W A;  2F0H A;  1TQO A;  4F8M A;  2K5W A;  4A3G B;  1PYW D;  2A6H C;  3GTG B;  2PZU A;  2F1M A;  3C3L A;  3HOV B;  3OSO A;  2DN8 A;  3TME A;  3HGB A;  4RHR A;  3OOC A;  3X3M A;  1A2U A;  1A3T A;  1SND A;  1CTM A;  1CT1 D;  4MN3 A;  4IUN A;  1EWH A;  2AUK A;  1X3P A;  2FIN B;  5ELD A;  1W6J A;  2YU9 B;  2EY6 A;  4CHT B;  1PRT B;  2L11 A;  3FEW X;  2VB2 X;  1WTO A;  4HCE A;  4FO2 A;  4KI0 A;  4X3T A;  2D9U A;  3HRZ C;  2EYM A;  1AN8 A;  1SYG A;  3OMG A;  3D3R A;  5T1I A;  2L55 A;  2HUG A;  4U67 3;  2CW0 C;  4HSV A;  1Y69 U;  2RVL A;  5C44 B;  2KUM A;  2F0Q A;  1DJR D;  2JA7 B;  5IT9 L;  2BA0 A;  1EY8 A;  3T4A C;  1JC7 A;  1QJO A;  2ZXR A;  2SOB A;  1EEF D;  1TWC B;  1EY9 A;  3SK4 A;  4OO1 I;  2G9D A;  1UNS A;  5IGG A;  1O80 A;  5F2D A;  1LT6 D;  1HA5 A;  3VYR A;  2N55 A;  2M00 A;  1VCI A;  1QOH A;  2M2L A;  4KY7 A;  1WVL A;  3MTS A;  2E76 C;  1JR0 D;  1DXM A;  5CV5 A;  3ERQ A;  2E2D C;  4XIG S;  2RSN A;  4DU9 A;  3HP3 A;  3SDZ A;  2JSO A;  4DNR B;  1EYA A;  1VMP A;  1LAC A;  5COY A;  1U9R A;  1SNP A;  1L0Y B;  2AQ1 B;  5I2X A;  5A35 A;  2SNM A;  4KK7 A;  4EQO A;  3HEJ A;  1CZW A;  2NN6 G;  2VXW A;  1XYI A;  3S14 B;  5M5W B;  1I6V C;  2JEA I;  2F0T A;  1YNN C;  4FP5 D;  3WDN A;  1BCP F;  2PW5 A;  2A68 C;  4PMW A;  1PRT C;  4OGQ C;  2PYK A;  1HCZ A;  3CQZ B;  1PZJ D;  1B53 A;  3Q23 A;  2E75 C;  4HN7 A;  1XTC D;  2B2Y A;  3HZX A;  3K5O A;  2OT2 A;  4F88 A;  5D65 A;  3H3V C;  3GTK B;  1E2V A;  2JE6 I;  4OHJ A;  4FXK C;  2VNU D;  1AZP A;  1HUN A;  1BOS A;  4N9P A;  2O5I C;  3W3A A;  4QF4 A;  4C3I B;  2IT1 A;  2A69 C;  5FO9 B;  1NR4 A;  5IOD A;  1ZXT A;  5KYL A;  2AQ3 B;  3I4N B;  2F3V A;  2RDH A;  3EVQ A;  2KOL A;  3QWN A;  2A6H D;  4XTC S;  2CQA A;  3OPO A;  1TU2 B;  3F2U A;  4NW2 A;  1LTG D;  3I8Z A;  3NTI A;  2MUY A;  2F0V A;  3VA7 A;  1G6Z A;  2QCP X;  1GJX A;  1ET9 A;  4ID6 A;  1FYC A;  2DY8 A;  1WCM B;  2EYO A;  5EKI A;  5EKL A;  3EJI A;  2EY5 A;  4BBR B;  2VB3 X;  3K6O A;  3V2T A;  3EA6 A;  1RTO A;  3HKZ B;  4BWG B;  4XQJ A;  4K5X A;  1GUW A;  5FLX E;  4KHZ A;  2G9H D;  3MAQ A;  2D2C C;  4IQZ A;  1PDQ A;  4M1U B;  2R7Z B;  1STA A;  3DEP A;  3N52 A;  1AW7 A;  4DF7 A;  2NBF A;  4BY7 B;  1TS3 A;  1CHQ D;  4HED A;  5EPL A;  2XIW A;  5K36 G;  2CW0 D;  3NBI A;  2PMZ B;  1B9N A;  3BVM A;  5C4Z A;  2WKD A;  4JBW A;  4HCS A;  4ULL A;  3A8J E;  3FVQ A;  2B2W C;  3A56 A;  4KN4 C;  3C1F A;  3D8G A;  3FMC A;  2LS0 1;  2X69 A;  1MGS A;  3R2I A;  2FMM A;  4ME5 A;  3PIO 3;  4J1M A;  5CMD A;  1IL8 A;  2L5T A;  4G7O C;  1ENC A;  5LL6 S;  3E6Z X;  3KLS X;  3QO2 A;  1J9O A;  3OWF A;  4K6D A;  3A8I E;  5G3L D;  3SVM A;  4LJZ C;  4A3I B;  1LT5 D;  1PTO F;  3K5L A;  3CRL C;  2B2T A;  3NWT A;  3SHL A;  4TSS A;  1KNE A;  1SYF A;  5EKK A;  1BCP B;  3FPP A;  1YNN D;  1Y8P B;  2A68 D;  1PRT D;  5JJZ A;  3RZD B;  5DM7 3;  1FNW A;  3PUV A;  1RF2 D;  5DM6 3;  1SXT A;  3K5N A;  2EZV A;  1PXU A;  1H9M A;  2ICE C;  4KTA A;  2E2I B;  2WAC A;  1ZYR C;  4CBV A;  4O1N A;  1BBX C;  2RSO A;  5JEA G;  3D6W A;  3C1E A;  2K04 A;  1JB3 A;  1R4Q B;  1EYC A;  1BXT A;  1G2T A;  3A54 A;  4ZQ3 A;  5ELC A;  2K1B A;  5KNB A;  5M5X B;  1IW7 C;  3D4W A;  4FF3 A;  2A69 D;  1DOM A;  5FKA C;  1CA6 A;  3S15 B;  1CI3 M;  3S1R B;  5C0X J;  1RTN A;  2EE1 A;  4A3D B;  3PIP 3;  3H6M A;  4K2K A;  2PCF B;  1STN A;  1ESF A;  1ET6 A;  3T53 B;  5JAV A;  2L9H A;  1SNQ A;  2F0P A;  4EGV A;  2DNC A;  4KV6 A;  2B63 B;  4CKE A;  4V0B A;  3RZO B;  2E2H B;  2NTS A;  3OMC A;  1G2S A;  1BCP C;  3MFY A;  2CHB D;  4BY1 B;  2IW3 A;  3VR3 A;  3I4M B;  4IFD J;  1LTA D;  2WII B;  3VA5 A;  4RKL A;  3D4D A;  4QIW B;  1I4X A;  2E74 C;  3DMU A;  4C56 C;  2K32 A;  2YYZ A;  5K5P A;  3AMU A;  5FOB B;  1GOZ A;  1KDC A;  2EJG C;  3MXP A;  3U9S A;  5CGK A;  3G7L A;  2RQX A;  1ENA A;  1D5X C;  3S1Q B;  3PMF A;  1BF4 A;  1VF7 A;  5KIX A;  3FKI B;  1OXT A;  5C0X I;  2F0E A;  4NMZ A;  2B2Y C;  4DK0 A;  2VUM B;  4CKB A;  2Z4H A;  2X6G A;  4I65 A;  1RDP D;  1PFM A;  1EQV A;  5IGC A;  1L0X B;  5I2Y A;  1UEA B;  2MJ8 A;  1MI2 A;  1PTO B;  3MVV A;  4C3H G;  4IFD I;  4ZUJ A;  3RMH A;  3HOW B;  2Q8R E;  3BS1 A;  5AFW A;  4PMC A;  1DON A;  5J1Z A;  2H1E A;  4V19 0;  2NWG A;  1GUT A;  1VMC A;  1TII D;  4WJW A;  4DAY A;  3H91 A;  3NUC A;  1GHJ A;  1BUV T;  1H9R A;  5ISR A;  1V1P A;  1D1K A;  5IGB A;  1ENF A;  4H13 C;  1R4P B;  2MPM A;  3PO2 B;  2BE5 C;  1EU4 A;  2R6G A;  2EYH A;  2EYF A;  3KLR A;  5TSS A;  5FLX L;  3FRP B;  1DD2 A;  3M85 A;  1ZYR D;  5JEA H;  1D6E C;  3A7A B;  3GD7 A;  2R92 B;  1JIC A;  3VR5 A;  3ND9 A;  1O7Z A;  4RFB A;  4K2L A;  1IYU A;  5E4X A;  1VF5 C;  1TWH B;  1IW7 D;  4DAV A;  2NVY B;  3T51 B;  1HUM A;  4R8I A;  5D3I B;  3VR2 A;  4LMQ D;  2F0O A;  1A3U A;  5M3F B;  4FF2 A;  4TRD A;  2XRQ D;  4DN4 M;  4O42 A;  1WTV A;  2WV6 D;  1STY A;  1U4L A;  4RWS C;  4EQN A;  3E0J A;  1SNC A;  2MGS A;  1UUP A;  1PTO C;  4DFA A;  4B9W A;  2A73 B;  1Z6H A;  1ZKO A;  1H9S A;  5M5Y B;  3HOZ B;  2B8G A;  3KLS A;  2ZXO A;  1BCP D;  1CK1 A;  3NHH A;  4QMG A;  3J80 E;  1AZQ A;  1XXG A;  2F0G A;  3DWP A;  1FNU A;  3K0Y A;  3P20 A;  3BYY B;  4C1N I;  2PQE A;  4FNF A;  3P1H A;  3GTQ B;  3J7A V;  2FHT A;  2A74 C;  3NBH A;  4MIU A;  1IKL A;  1ONL A;  1RJT A;  3IFT A;  3P7J A;  1EWC A;  1CZG A;  1A3V A;  4ZLT F;  3KUP A;  1DM0 B;  2B2T C;  3QB3 A;  2NTT A;  1EY5 A;  4ZRZ A;  1EY0 A;  3M4O B;  4IN3 A;  3ONA B;  1LLR D;  2Z1C A;  3VR4 A;  3JAM E;  4MHE A;  3U9O A;  1CFM A;  4QB4 A;  2K33 A;  2BA1 A;  3I4L A;  1Q8I A;  3EFX D;  4RHS A;  1EIH A;  5JVG 3;  2K6A A;  2F03 A;  4FF4 A;  3TBI B;  3ERO A;  4U68 A;  4C3H B;  4KKU A;  1D5Z C;  3NSW A;  1FR3 A;  4IUR A;  5COR A;  2Z4I A;  2JP1 A;  5C3X A;  2K03 A;  1Q1E A;  4I7Z C;  1G29 1;  5I6W A;  2Z8L A;  1EOT A;  5HUR A;  3HG9 A;  2BDO A;  1TT2 A;  1DYQ A;  1S4Z A;  3J7A F;  1E0B A;  3A8K E;  1DZ1 A;  4LAA A;  4A93 B;  2A6E C;  2Q8I B;  1S5D D;  2BE5 D;  3V96 A;  3DHQ A;  2KEC A;  1KAB A;  1Y8O B;  1F9Q A;  3RUZ A;  3TSS A;  1G91 A;  1QG7 A;  4H7B A;  2A5H A;  2NYZ D;  3R2T A;  3SR1 A;  2NVT B;  1ML0 D;  3M3Y B;  3BYT B;  4RGN A;  5JPN C;  3MXN A;  3L9A X;  3T56 B;  3UI2 A;  1EY7 A;  5EBC A;  3QOJ A;  4ZUI A;  4OO1 H;  4BS9 A;  1S5B D;  1BO0 A;  1S5F D;  1V1P B;  4P2C B;  3S2D B;  2D5D A;  2OF1 A;  4QUC A;  1F2L A;  2NN6 I;  4R8N A;  1KLU D;  3WOE A;  4ABN A;  1OO9 B;  3DWQ A;  5EPK A;  1Y1W B;  4Q0F A;  1I4H A;  1SMY C;  1W6K A;  2WAQ B;  3HOY B;  2ZXP A;  3MC0 B;  3PUW A;  1RHP A;  2L4N A;  1Q12 A;  4N9T A;  4CJ2 C;  1FNV A;  3DM1 A;  4L6T B;  3S2H B;  1X32 A;  2KHS A;  1XX8 A;  3CHB D;  4KKS A;  1B50 A;  4KY6 A;  1V1O A;  3OW7 A;  1HRJ A;  1CQF A;  2RDF A;  1C48 A;  4BA1 I;  5BN3 A;  3D4R A;  3GP7 A;  4XQQ A;  1ILQ A;  3TZD A;  1ZEQ X;  2NVQ B;  1EZ8 A;  4XQN A;  1UAP A;  4XDX A;  3GQB A;  1OXU A;  1SYD A;  1SSO A;  4XT3 B;  1NR2 A;  3VYS A;  2NUC A;  4NKL A;  4HSP A;  3R8B A;  3M7N A;  1LTS D;  1H9S B;  3Q0A A;  2M9V A;  3BDC A;  1T5E A;  3FDT A;  5EBD A;  2XVS A;  4YIJ A;  1NUC A;  2NZ1 D;  1JWS D;  1OXV A;  1IHZ A;  3GV6 A;  4CJ1 B;  2B2U A;  1GUN A;  1I50 B;  1EL0 A;  1EFI D;  3TP7 A;  2V4D A;  3TP5 A;  4OL7 A;  4FYD A;  4ZK9 B;  3T13 A;  2HDM A;  4E6I A;  1S5C D;  1HTP A;  4X3U A;  3S9W A;  2KVM A;  3MXG A;  4UAI A;  2RBM A;  3NWS A;  5IT9 E;  1SJE D;  5C4X B;  2F0W A;  3QIA A;  4KN7 C;  4WFN 3;  1PZI D;  4K14 A;  1LTB D;  3DEO A;  4A3F B;  1KLG D;  1TKW B;  3C2P A;  1LTR D;  3QJY A;  4B9X A;  5CV7 A;  5CBE E;  3A7L A;  4XYQ A;  1EQT A;  2JXM B;  4KJN A;  4BBS B;  5KRU A;  3K57 A;  1O78 A;  5FO8 B;  1BNZ A;  5EJW A;  5A2Q E;  2O5J C;  3EQL C;  3RLF A;  1I4R A;  4NP5 A;  2A6E D;  4X3S A;  2EYJ A;  1EEI D;  2KEE A;  4RGO S;  2LKV A;  4KD4 A;  2LY7 A;  4G57 A;  1TS5 A;  2IX3 A;  4L63 B;  1OXS C;  2AWO A;  1HTL D;  3NK9 A;  1DOK A;  2NB0 A;  4PNY A;  2J0T D;  2RA4 A;  3GTJ B;  3L3O C;  1K8M A;  1O7L A;  1TR5 A;  1KNA A;  2N88 A;  3M4Y A;  5CBA E;  2K5D A;  2C9O A;  2LMC B;  4R9W A;  2QIL A;  5C0X G;  1C8C A;  3GO5 A;  3MA2 B;  1JOR A;  1SMY D;  1TWG B;  4AYB B;  3TP8 A;  1E2W A;  2Q8T A;  5KND A;  4PV1 C;  1PRT F;  3V05 A;  2XN9 C;  2KCN A;  5E3F A;  1JE4 A;  2K01 A;  3Q6S A;  2JEB I;  2X6L A;  4RCO A;  1Q3L A;  3A55 A;  5M3M B;  3IAY A;  1CA5 A;  4PMB A;  2EY1 A;  4A3E B;  4CKC A;  1SJH D;  1PFB A;  3L7Z C;  3S1N B;  1F2Y A;  2F4I A;  1E2Z A;  5KNC A;  1WD0 A;  1B44 D;  4GZY C;  1D2B A;  2ID0 A;  1Y8N B;  5EPJ A;  4KJO A;  2JA8 B;  4QCL A;  3NPP A;  1JCK B;  2SEB D;  4ZKB B;  2QEJ C;  3O13 A;  3PV0 A;  1BR9 A;  3AB9 A;  1CM9 A;  5JVH 3;  2EJM A;  1EU3 A;  1A15 A;  4KD3 A;  1B1Z A;  1TS2 A;  1TWF B;  3KBX A;  4KHV A;  4C3J G;  4K5V A;  1TY2 A;  5I4D A;  1NAP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...