4LFCQ

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 19
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4lfcQ00
3B6YA 4QL5A 3GTPH 2R92G 2E2IH 1BKBA 3HOWH 5GQOA 1UWVA 1T9HA 1SFOH 1TWHH 2OQ0A 3ULJA 5LMUQ 2VNUD 5LMUL 2Z0SA 1K73C 3M7NA 3TRZA 4A3CG 3FKIH 4BBRG 1XMQQ 2L15A 4YCVA 4HIKA 1GD7A 1OXTA 1CKNA 4HJAA 2PQAA 4XIGS 3KDFB 2IHFA 1VQ9A 2Q2TA 1CSPA 4JBKA 4R4OA 3H0GG 1XNQQ 2NZHA 3NELA 3I4NG 1EIFA 4NXML 3KFUA 2RF4A 2R92H 1D7QA 4X64L 1M1KC 3RZOH 1R9TH 4A3DG 4LF7L 2R6GA 5EAYA 5M5YH 4C3IH 3CAMA 3A5UA 1YIJA 4BY1G 3WWVA 4IPDA 3S24A 3CC7A 3T1YQ 1MKHA 1OTCA 4GKKQ 3J7ZC 1I3QH 1Y14B 4GKKL 1WFQA 1YI2A 2ZM6Q 3M9BA 2Q2UA 4KHPL 3GTLH 4LFCQ 4A3CH 4BBRH 4R4CA 3CCEA 1OXXK 2PQAB 1YHAA 2UUCQ 1SN8A 3L7ZC 1B7YB 3I4NH 4KI0A 2UUAL 4DUZQ 1VQAA 4A3LG 4LFBQ 2UXBQ 3ULPA 3CC4A 1YITA 2E2HH 4JBMA 1QVFA 4KLKA 4A3DH 4GNXA 1VQBA 3F8TA 4A76A 4BY1H 4LF5L 1YJ9A 1X65A 4P72A 4JC0A 3H3VH 3I7FA 2OWOA 2QGQA 4A3IG 1JJCB 5IYDH 2K14A 1YEZA 1L2FA 3RN2A 5IWAL 3CD6A 2EXDA 1KHIA 2XGTA 1J6QA 1TWCH 2ZTCA 3GD7A 4XTCS 4GOPC 3KF8B 4R4IA 4YHHL 4A3LH 2VQFL 2I5LX 4AQYQ 1S40A 4ALPA 1PH5A 2JA7G 1C0AA 5GAHC 1AE3A 1XTDA 4EQ5A 4DAMA 2QEXA 4GNXB 3AEVA 1X55A 3CCVA 5GADC 1JE5A 1VQDA 2E5LQ 1J5EL 4L5RC 1JT8A 2HQLA 4YWLA 3UDFA 1L1OA 3J80c 3BZKA 1QZHA 4J15A 1Q1EA 3STBC 3CCMA 4A3IH 3GTKH 1EQQA 4OWXB 1E7ZA 3J81c 5E7NA 3E9IA 1YZ6A 1N34L 1UE6A 2YTXA 3Q8DA 1N34Q 3HKZE 4DPGA 4WJ3M 1OXUA 4B3TL 1XJVA 4DV3L 4LF4Q 3A5ZB 5C4XG 4LF9Q 3CCJA 1NBWA 3M4OH 4YWKA 2PI2E 4DV7Q 2IHEA 1K9MC 5IT9c 1I94Q 4OX9L 2OTJA 1L1OB 3J81i 4OO1G 4ME3A 4JI5L 3PUXA 4DAYB 1DGSA 1V43A 1Q1BA 2IT1A 2BA0A 4TQUS 3L2PA 4C3JH 2JA5H 1KD1C 2UU9L 3S2DH 4AYBE 3PIOA 1VQGA 4BA1I 3PO2G 5J3BA 5C4XH 3W1GA 3S1QH 1PH3A 2D62A 4R1JA 4AH6A 3RLFA 4OXPA 5BR8L 1NJIC 4JI1Q 2OTLA 4K0KQ 1UE5A 4OWTB 5M5WH 1HNZQ 4HJ7A 2CWPA 1IBML 2NVQH 4IFDG 4BY7G 1KQSA 1VQHA 1A63A 2VL6A 4A3FG 4PMWA 2WFWA 4LUVA 3CMEA 4JI8Q 2F3IA 4YCUA 5IYBG 3A74A 1X3EA 4R4TA 4DV2Q 4DV2L 4JI7Q 5M3FG 1XPUA 1VQIA 1TWAH 1VQCA 5LMNL 1QZGA 4POGA 4UPAA 1Q8KA 5C0XI 1NMFA 1C7YA 2Y0SG 1VQOA 3CF5A 1YJNA 3TS2A 1N8RC 3ER0A 1E3PA 4JV5Q 3PIPA 4BY7H 4GKJL 1D8LA 1SE8A 1LTLA 3RR5A 4P73A 1MIUA 5GAEC 4A4IA 1YJWA 3HOVH 2GVBA 4LFAQ 4LFAL 4WJ4A 5M3FH 1G6PA 3M3YH 4IFDJ 1U5KA 3K0XA 2F4VL 5IYCG 1VQLA 2HHHL 1BVSA 2MFIA 3NBHB 2A19A 1EIYB 3K80C 4DK6C 1IYJB 3UE1A 1PYSB 3S1RH 2UXCL 2UUBQ 3EN2A 5IY0A 3G48A 2KBNA 1HR0W 2UUBL 2IX1A 1ASZA 3MEFA 1HH2P 2A1AA 3F2BA 1MJCA 3S2HH 3CMAA 3U4ZA 1Y1WG 3RNUA 3I4OA 4X65L 4NXMQ 1UE1A 1A0IA 1U0LA 4X64Q 5H1SE 5GAGC 4LW1A 3EBEA 1JJGA 2V1CC 4LF7Q 1HZCA 3TEHB 3KLWA 3GTOH 3BJUA 4DV6L 1IXRA 5M3MG 1SLJA 1TWGH 1K8GA 4P71A 3J7A5 4GLAC 4KHPQ 2A8VA 2K4KA 1B70B 4Y52H 3G4SA 3CW2C 2ID0A 4QY7A 4UP9A 1CKMA 5IE8A 1JMCA 4JI3L 2WAQE 2JA9A 1E22A 4DK3C 1RL2A 3H0GH 3K7AH 3MXNB 5ELNA 3I4MG 2UUAQ 3W1BA 3CC2A 4DV5Q 4A3KG 4DV5L 3CCLA 4JG2A 1VQ8A 3GTMH 1I50H 2YV5A 2D0OA 4LF5Q 2KHIA 2VUMG 1PYBA 1N36L 1AH9A 5M3MH 1WCMG 1PH1A 1MJEA 5FLXc 1HNWQ 1HNWL 2KCTA 1VQEA 1ASYA 3HOZG 1Q12A 4HJ5A 1X9NA 1HZBA 3FHWA 4NB3A 4DV1Q 4DV1L 2YYZA 5IWAQ 1N9WA 4QQBX 2BH8A 1PH2A 2NVTH 1EOVA 4P74A 1K8AC 3JC66 5M5XH 2VQEL 4LF8L 1SROA 2C35B 2CFMA 3D31A 4YHHQ 3G6EA 3RZDH 3K7UC 2VQFQ 3I4MH 2N3SA 2I5HA 2NZOA 2Z6KC 4JCVE 3CCSA 3KJOA 1Q86C 2D0PA 3H3VI 1WJJA 2E8GA 4DR1L 1IBKL 1HR0L 1J5EQ 2ES2A 2VUMH 1S3OA 3S15H 5IP9G 1XNRL 2ASBA 1HJPA 2BH2A 1WCMH 3L0OA 1LUZA 4L5TA 2GVAA 3TS0A 2H5XA 5JJIA 1CSQA 3HOZH 1PVOA 4GOPA 4B3MQ 3NENA 4B3ML 2NN6G 3PV0A 4IOAA 2KENA 3CCRA 1W3SA 1CKOA 4C2MH 4YWMA 4A93G 4B3TQ 3A0JA 4JI6L 3DLLA 2VZAA 4H02A 1FGUA 2JE6I 4DV3Q 1FJGQ 4LNQA 1FJGL 2DGYA 1PFSA 4A75A 1M90C 1E24A 2JA6G 3S16H 1WOCA 2R7FA 1GVPA 5C3EG 1XMOL 4LUZA 2JA7H 3PGZA 3U58A 1HNXL 4OX9Q 1VQNA 3HOYG 2HT1A 5IP9H 1EFWA 3HOXG 1NE3A 4JI5Q 4HJ9A 2EIFA 2R93G 1A8VA 2RCNA 1TXYA 1SR3A 4GOPB 2B63G 3F2DA 4DR5L 1SRUA 3PUVA 4DUYL 4PZ8A 1O7IA 1FL0A 3S17H 1YVCA 3S1NH 4Y7NH 2UU9Q 4A93H 1YBYA 2ZTDA 3PF4A 3OW2A 4GN3B 4YCWA 1V1QA 2OQKA 5IP7G 4PZ7A 4HIDA 3ICEA 2JEAI 1SMXA 1EYGA 1XPRA 5C3EH 4A3EG 4O0AA 5BR8Q 4A3JG 1LM0A 4MTNA 1JB7A 2R7DA 2CWAA 1X54A 2N49A 3STBD 2FXQA 1GO3E 3H15A 1IBMQ 3HOYH 4JOIC 4DR3Q 1HZAA 2N8NA 2RHQB 4DR3L 2ATWA 2ZJQA 4UP7A 4LUOA 3UDIA 4A3BG 4P75A 1GKHA 4UY8C 3I55A 1P8LA 3UDGA 1Z9FA 1KRTA 1PH7A 2I5MX 5LMNQ 1S72A 2K50A 3PUWA 3DM3A 1KAWA 1Q46A 3PO2H 1K83H 3CPWA 3K8AA 2IX0A 4L5QA 4A3EH 4A3JH 3T1HL 3W5OA 2B29A 1L0WA 2JA8G 4UP8A 3HKZG 3KJPA 2Q2HA 2EQSA 2LXKA 2DUDA 4GKJQ 4X66L 1OXSC 3PUZA 2IY5B 1PH8A 3U50C 4DV0L 2AWOA 4HJ8A 4DNIA 1XPOA 4NXNQ 4NXNL 4A3FH 1V9PA 3CP0A 5IYBH 2JEBI 4DR4L 1X3FA 2CKZB 2AMCB 2YTYA 4JI2Q 4JI2L 2F4VQ 2HHHQ 5C44G 1OXVA 4RG1A 3ZJYC 2Q2IA 3VDYA 3JAMc 3OTOL 1N33Q 2HIXA 4GN5A 1N33L 1KC8C 4HIMA 2JA8H 2UXCQ 4R4QA 3UE0A 4YY3L 4JI4L 1AE2A 2RHSB 4GS3A 4AYBG 4RMFA 4X65Q 1I6HH 3PUYA 3S14H 3E0EA 3GDEA 1KIXA 4BXXG 1WYDA 2VY3A 3M4PA 3CPFA 2WB1G 1G51A 2MO0A 2N78A 3JAMi 4DV6Q 3G71A 5IYCH 2HIVA 1CUKA 5C44H 3KF6A 1VQ7A 4A3GG 2XTIA 1YHQA 4HIOA 1Z47A 1G291 4DR6Q 4QGUA 4X6AH 3M85A 1VQMA 4PG3A 1VQFA 2K5NA 4DR6L 1NY4A 1LYLA 3I2ZA 1XMQL 4MNOA 3F2CA 4JI3Q 4BBSG 1TWFH 1Y1WH 4MZ9A 2R7ZG 2MNAA 1VQPA 1XNQL 2BA1A 5FLMG 4BXXH 1K3RA 4IPCA 1GM5A 2NVYH 5K36G 1N36Q 1NTGA 4IPGA 4PZ6A 3KF6B 1Q7YC 2VS1A 3T1YL 4A3GH 1EWIA 3RLOA 4GNXC 1FVIA 3PF5A 5JJKA 5IYDG 2ZM6L 1KL9A 1VQ4A 3SGIA 4LFCL 3KOJA 4B3RQ 4B3RL 1CKNB 1B8AA 3OYYA 2NVXH 4BBSH 1YHBA 4POFA 2VQEQ 4LF8Q 4O2DA 1Q82C 2UUCL 2R7ZH 3LGJA 3PSIA 2JJQA 3ULLA 3GTQH 4BA2I 3K81C 4EX5A 4DR7Q 4AIMA 5FLMH 4DR7L 1KXLA 4A3KH 4DUZL 4DR1Q 4LFBL 1IBKQ 2UXBL 4QJFA 1HR0Q 1QVGA 1KRSA 3PCOB 1XNRQ 1VQKA 1X3GA 1EQRA 5DLQE 3U4VA 5HY6A 2B3GA 3AYHB 4GN4B 1E1TA 1QVCA 3HFZB 1QUQA 2QA4A 2PI2A 2VW9A 1H95A 5FJ8G 2PMZE 1L1OC 1UEBA 1EUJA 2JQOA 4IOCA 5GROA 4JI6Q 2ZJPA 2Z6KA 4DKAC 1VQ6A 3BU2A 2YU9H 2PNHA 3M4QA 2AKWB 2JK8A 4A3MG 4L5SA 1IZ6A 1XMOQ 3PO3G 3IRBA 1BBWA 4AQYL 1HNXQ 1PH9A 2YTVA 4GLVB 4QIWE 4LWCA 5LMNW 2WAQG 2E5LL 4APVA 1IL2A 5HGQA 5JJLA 1P16A 3F1ZA 1QUQB 2K75A 2Y0SE 4DR5Q 4IJLA 5FJ8H 4DUYQ 1W2BA 3AFQA 1VQJA 1WI5A 1PHJA 1PH6A 4K0KL 2CQOA 4C3HH 2JA5G 4B3SQ 5C4JH 4B3SL 3D0FA 2ALYB 4IJHA 4A3MH 5JEAG 2ZJRA 4LF4L 2JA6H 1BBUA 1X56A 3PO3H 2MO1A 4LF9L 3J80i 5C0XG 4DV7L 4FDBA 1I94L 4DV4Q 4DV4L 3HOXH 2NN6I 2KHJA 3TREA 1PA6A 2R93H 2ZTEA 3CQZH 2B63H 1UE7A 1VCIA 2CCZA 1HZ9A 4JBJA 2LSSA 1RIPA 2OCEA 3HOUG 4JI0Q 4JI0L 1N32Q 1VQ5A 2E2JH 1N32L 5IP7H 1PH4A 5ELOA 1K0RA 4OWWB 3CCQA 3I56A 4JOIA 3T1HQ 2UXDQ 3E9HA 2UXDL 2K5HA 2WP8J 3AQQA 4OO1I 2LXJA 5AJ3Q 2AHOB 2MQHA 5AJ3L 2I0QA 4JI1L 4X66Q 3GO5A 3NEMA 4DV0Q 1HNZL 4OONA 2WB1E 3GTJH 3CXCA 3CCUA 4X62Q 4A3BH 1YNXA 3HKSA 1A62A 5JEAJ 1E1OA 2K52A 4X62L 4GLXA 3RN5A 4DR2Q 4DR2L 3S1MH 4DR4Q 1Y1VG 4NPSA 3BZCA 4JI8L 3HOUH 3RLNA 2K5VA 3HOVG 1X6OA 2GN5A 5C0XJ 3GTGH 1NMGA 2AWNA 3HOWG 4JI7L 3FP9A 1JJ2A 4LF6Q 3TQYA 4LF6L 3ERSX 3J81j 4KHZA 2KCMA 1PV4A 4IFDI 4TVAB 3OTOQ 1I5FA 1IBLQ 1C9OA 3AFPA 4JBWA 1IBLL 3UDXA 4IPHA 4YY3Q 4JYAQ 4JI4Q 4JYAL 3FKIG 3EIVA 1Q81C 4JV5L 1VS0A 4IO9A 3KYHC 2F52A 3KDFA 1Y1VH
chains in the Genus database with same CATH superfamily
1WTWA 2L5TA 3GTPH 5EGTA 1GXDC 4KJOA 4FXKC 3GTKB 2VNUD 4XQJA 5KGUA 5ELEA 4F87A 4HIKA 1GD7A 4HJAA 3AU7A 1J9OA 3H91A 5HURA 3NELA 4NXML 4RHSA 2HD3A 2R6GA 4C3IH 5BN3A 3A5UA 1YIJA 4BY1G 3WWVA 2QKIC 4IPDA 3CC7A 4GKKQ 1CZGA 1HTLD 4C3JB 1DJRD 1K8MA 4BBRH 2A5HA 3A7LA 1D2BA 2PQAB 1UNSA 1YHAA 3I4NH 1H9MA 2XRQD 4DUZQ 1QVFA 4GNXA 3J80L 4LF5L 1YJ9A 1LTGD 3H3VH 1J8IA 2QGQA 2EZVA 4ZQ3A 3NWSA 2F0WA 2XGTA 2ZTCA 1J6QA 2A68D 4R4IA 2I5LX 4OELB 2JA7G 5CYUA 1AE3A 3AEVA 2XRSD 5GADC 1VQDA 1J5EL 3J80c 2EJFC 1Q1EA 2HQEA 4A3IH 4ILWA 3MWYW 1EQQA 1SYBA 1T5EA 4DAYA 3HG9A 1V1PA 1S5FD 1XJVA 4LF4Q 5C4XG 1E2VA 3H09A 3PMFA 1LTTD 1NBWA 2OF1A 4LMQD 4YWKA 3M4OH 1K9MC 2IHEA 2K05A 2LFNA 2OTJA 4DXFA 3BVZA 4ME3A 3WOFA 4KKTA 1H9SB 2NZ1D 1TWGB 5JEAH 2EE1A 1VQGA 2KUMA 3PIOA 5J3BA 3W1GA 3S1QH 1FR3A 4R1JA 5I2YA 4OXPA 4K0KQ 1NAPA 1HNZQ 3OSOA 5M5WH 1SNMA 2CWPA 4XDXA 4IFDG 1BDOA 4G7OC 1KQSA 3RUZA 3VR4A 1F9RA 2SEBD 3L9AX 2PPBC 4DV2Q 4R4TA 4JI7Q 3MTSA 4JPBW 1KAAA 1Q8KA 5C0XI 2Y0SG 2RCFA 1YJNA 2ZXPA 1JOQA 1N8RC 3ER0A 2NVTB 1I4PA 4RGMA 2R61A 1TS3A 2D9UA 1EZ6A 1U4MA 1L0YB 5GAEC 3OPOA 4A4IA 1SE4A 4KV6A 1EWCA 2GVBA 4I7AA 4LFAQ 2VUMB 3S15B 3VYSA 1SYCA 2HHHL 2Q8RE 3KK7A 3HOZB 2A19A 1EWHA 4DK6C 1QJOA 1PYSB 2OEOA 2KBNA 2D5DA 1Q90A 1ASZA 1AEXA 1HH2P 1R4QB 3F2BA 3CMAA 3U4ZA 2F0LA 1Y8NB 1A0IA 4LW1A 3EBEA 1JJGA 2V1CC 4MIUA 4LF7Q 3M4YA 1H9RA 3KLWA 3BJUA 3UI2A 4F7XA 3MAQA 5M3MG 2XIWA 1SJED 1HUMA 4GLAC 4N9PA 2BDOA 1G8ZD 4Y52H 3EFXD 1CKMA 1E22A 4DK3C 4QB4A 2KOLA 3I4MG 3W1BA 2F0FA 4A3KG 5J22A 3CCLA 4JG2A 1JOKA 1I50H 2YV5A 2Z8LA 5EKKA 1N36L 3N6RA 1DYQA 1F2YA 1MJEA 1HNWQ 2OT2A 5CV5A 1VQEA 1ASYA 1EEFD 2EYHA 1IYVA 2F0GA 3IKJA 1HQRD 3M7GA 3BVGA 4HSPA 2E75C 2O5IC 4LF8L 3SHLA 1EY9A 3K0YA 4A3JB 3A8IE 5CBAE 3RZDH 3DHQA 2I5HA 2NZOA 3KJOA 1AFPA 2OXPA 2E8GA 1XNRL 4IN3A 1LUZA 2B2WC 1U4LA 1PFMA 1HPCA 2WACA 4GOPA 4IOAA 4B3ML 1SMYD 2NN6G 4K14A 3H94A 1W3SA 1CKOA 4C2MH 3CCRA 1H9SA 4B3TQ 4A93G 4JI6L 3DLLA 1F9PA 4DV3Q 1W6JA 2F0KA 1FJGL 5JVH3 1NNXA 2JA7H 3HKZB 1A2UA 4LUZA 4DNRB 4DA2A 4OX9Q 2IL8A 2HT1A 3P20A 3R3OA 5IP9H 4FXGC 3S14B 3HOXG 4JI5Q 2G9HD 4RGTA 1GJXA 1TXYA 3TN2A 2B63G 3F2DA 3GQBA 3PUVA 1O7IA 1HQMC 1B3AA 4L8JA 3OW2A 4GN3B 4YCWA 4HIDA 2F0VA 3G6JB 1SMXA 1EYGA 4LK1C 1KDCA 3EA6A 1F9QA 1I4GA 1IBMQ 3HOYH 1Y1WB 5EJWA 1HZAA 4ID6A 2VB2X 4UP7A 3SK6A 1WTHA 4N8FA 2NVYB 1VDZA 4UY8C 1PH7A 2I5MX 1H9KA 3PUWA 1KAWA 1GUOA 1Q46A 1LACA 1EY5A 1CFMA 3W5OA 4HAEA 2JA8G 1PTOB 4IFDH 1YNJC 2K04A 1PH8A 3FPUB 3C46A 2CW0C 2VXWA 1SYFA 2AMCB 2JYOA 2F4VQ 1EOTA 5JPNC 3P75A 1IW7C 1OXVA 1KNEA 4RG1A 4R9WA 3JAMc 3OTOL 4GN5A 1N33L 2A6HD 2A6EC 4R4QA 3UE0A 1YNNC 1AE2A 4AYBG 4WRDA 2F0DA 4RMFA 1G2SA 1I6HH 3PUYA 2VY3A 3U9OA 4K5XA 2WB1G 2MO0A 4DV6Q 3G71A 1CUKA 1I4HA 1VQ7A 1SDFA 4O1NA 1YHQA 4FF1A 1NY4A 1LYLA 3OOCA 2J4XA 1AP0A 5J1ZA 2Z6BA 2LS01 3NTIA 5FLMG 3I3CA 1GUSA 2SNMA 3I73A 1CI3M 2WAQB 3CQZB 3KF6B 4A3GH 1BR9A 4GNXC 1FVIA 1PYWD 5JJKA 1VQ4A 1UAPA 5C4ZA 4B3RL 1CKNB 2NVXH 4BBSH 3WOEA 2VQEQ 1LLRD 2R7ZH 3PSIA 1Y8OB 3GTQH 4BA2I 2ICIA 3K81C 4EX5A 4AIMA 4A3KH 1JE4A 4LFBL 3PCOB 1VQKA 1X3GA 4A3BB 4PQXA 3A8JE 5CV7A 5HY6A 3S1MB 1E1TA 1I4QA 1QVCA 2RKSA 1GOZA 5FJ8G 4H13C 4CJ2C 1QB5D 1EUJA 4J8QA 3M4QA 2AKWB 2RBMA 2E74C 4CBVA 1XMOQ 3C1FA 3PO3G 1HNXQ 1PTOH 3E5SA 4CDCC 5FO8B 2F3VA 3PIP3 1SJHD 3TP5A 3SE0A 3F1ZA 3A7AB 1O7YA 4PMCA 4DR5Q 2F0UA 4TSSA 4DUYQ 1FNVA 2E2IB 1ONLA 2KJXA 4L6TB 5NUCA 2JA5G 1RKNA 1CHQD 4B3SQ 4UDUC 4HMIA 3IAYA 4LF9L 1QNKA 1SYGA 4DV7L 4FDBA 4DV4L 3FRPB 3HOXH 2F0EA 4DF7A 2B63H 1UE7A 2LMCB 4JBJA 1TS2A 1PZKD 2OCEA 2Z1CA 1SEBD 1KABA 2ZXRA 1N32L 2ENBA 2I07B 3RD4A 3CCQA 4XT1B 3E9HA 4KTAA 3K6OA 3OIPA 2LXJA 1A3TA 5C0XH 2P5ZX 2NTSA 4DV0Q 4C56C 3NE5B 2X69A 3RN5A 2K52A 4GLXA 4DR2Q 3D3RA 1BOSA 4DR4Q 1Y1VG 1G6ZA 3ZYYX 3HOUH 3RLNA 2Q8TA 5C0XJ 1NMGA 4MHEA 4B08A 4BY1B 2RVLA 1SE2A 2WV6D 2BOSA 1WD0A 3R93A 4LF6Q 3J81j 1ZKOA 3J80E 1C9OA 1LTRD 1ZYRC 4YY3Q 4JYAL 3R2IA 1RHPA 1I4RA 1TWCB 1IHZA 1VS0A 3HGBA 3KYHC 2F52A 3L3OC 2FHTA 4G7ZC 4QL5A 1U4RA 1PDQA 2MGSA 1CQFA 1JOOA 3NHHA 3C3LA 2H1EA 5KRUA 4KK7A 4NMZA 4M1UB 4ODGA 1NR4A 3ULJA 5LMUL 2F0OA 3TRZA 3TMEA 4BBRG 1ESFA 4YCVA 4PMBA 1CKNA 1MSHA 1SBBB 1EY7A 3KDFB 2K5QA 2IHFA 2Q2TA 4JBKA 1XNQQ 2IJ0A 4R4OA 2D2CC 2NZHA 3I4NG 1EIFA 3KFUA 2RF4A 2R92H 2F0TA 1R9TH 5IGEA 2A73B 5EAYA 1RDPD 5M5YH 4Q5VA 2CH4A 3T1YQ 1H9JA 1Y14B 2ZM6Q 3M9BA 4KHPL 3GTLH 4LFCQ 3VR3A 3S2DB 4X3SA 3F2UA 3CCEA 2KEDA 5C4XB 1ENCA 3L7ZC 1ESRA 1IKLA 1EU4A 1M4VA 2EVBA 4A76A 3QR8A 1S5CD 1X65A 4HTHA 4P72A 4Q0FA 5E4WC 3J81L 3P7JA 2OWOA 4A3IG 4OL7A 1TWAB 1VMCA 1X32A 1XX8A 2BE5D 3ND9A 4RAUC 1NR2A 2EXDA 1KHIA 2PW5A 4GOPC 1C4QA 2IW3A 4YHHL 1I4XA 1KDAA 4A3LH 2VQFL 4AQYQ 4EQ5A 2Q8IB 2QEXA 4GNXB 1X55A 4L5RC 1JT8A 1JE5A 2E5LQ 2HQLA 5KIXA 1EY0A 3HOVB 3FVQA 1DXMA 3HOWB 3J81c 3E9IA 1N34L 3M3YB 1UE6A 1TWHB 4EGVA 4KJNA 1HA5A 1Q8IA 3FKIB 3CCJA 1U9RA 4FP5D 2J7ZA 1ENAA 2PI2E 1XXGA 4HSVA 1B44D 3VYRA 2WKDA 4DAYB 1V43A 1Q1BA 2IT1A 2K01A 3GTOB 2JA5H 1KD1C 4IUUA 3PO2G 1T5XD 1DOLA 5FO9B 1PH3A 4AH6A 5BR8L 1NJIC 4JI1Q 4ABNA 1UE5A 4OWTB 3H0GB 2L0CA 1BF4A 4OO1H 1R4PB 1UEAB 4A3FG 3GV6A 4XXEA 1B1ZA 1QG7A 2F3IA 3NUCA 3A74A 4LAAA 5JVG3 5LMNL 1QZGA 3I72A 1VQOA 4L63B 3NBHA 2MP1A 1PZJD 1E3PA 1CK1A 3CHBD 4BY7H 1D8LA 1SE8A 2KQ3A 3A8KE 3I4MB 3LNNA 4IUPA 4UHVA 1YJWA 1CA6A 4M8AA 5HGTA 2B8GA 2BCOA 1D6EC 5M3FH 1G6PA 2HCIA 1HCZA 2ICEC 2MFIA 3K80C 3S1RH 5IY0A 1EYDA 1X3PA 4H44C 3S2HH 2FINB 2KVMA 4N9TA 3T13A 3I4OA 5EBDA 1UE1A 4ZKCB 5J39A 2N55A 4X64Q 5IOCA 3SVMA 3CRKC 1C48A 2CHBD 1LTAD 4K6LA 4DGZA 5FLXL 1A2TA 1SLJA 4P71A 3S17B 2PZWA 1SNCA 1EZ8A 1TR5A 3CW2C 2ID0A 5C6AA 4QY7A 2NTTA 4UP9A 1WVLA 5I6YA 2JA9A 1RL2A 3K7AH 5FK9C 1Y69U 5ELNA 2UUAQ 3CC2A 4DV5L 1DOKA 1DOMA 3GTMH 2D0OA 2KHIA 3QG1A 1TY0A 5FLXc 5EPKA 1CA5A 1IKMA 5CV6A 1Q12A 3CRLC 4HJ5A 3FHWA 4NB3A 5IWAQ 2F0IA 1K83B 1PH2A 1HA6A 2X6GA 2PMZB 3D31A 4JCVE 1ET9A 3JAME 1TQOA 3W2DA 1IBKL 3CKIB 1HR0L 2ES2A 2NB0A 5IP9G 2B8FA 2KCNA 4FO2A 2QEJC 4L5TA 3TS0A 1PVOA 4B3MQ 2KENA 4U68A 2DNCA 2VZAA 4H02A 1FJGQ 4LNQA 2DGYA 3S16H 1D1IA 2JA8B 1CZWA 1WOCA 2R7FA 3MVVA 3U58A 2WKCA 3V96A 3HOYG 1MHWC 1NE3A 2EIFA 1X3QA 4RHRA 1A8VA 2RCNA 3K59A 4GOPB 4R8IA 1Y8PB 2XN9C 3S1NH 1DM0B 1K8OA 2UU9Q 3PF4A 1BCPD 3ERQA 5IP7G 4PZ7A 1XPRA 5C3EH 4O0AA 5EQ0A 3G7LA 4MTNA 4AYBB 2R7DA 3SDZA 3STBD 3H3VC 2FXQA 1GO3E 4IQZA 2ATWA 3TBIB 5A35A 2ZJQA 4K5VA 2A69C 4OIKA 3I55A 3UDGA 5LHY1 2WB1B 1F2MA 1TIID 2F0HA 3PO2H 1A6XA 2IX0A 4L5QA 4CDEC 3D4DA 4A3EH 2B29A 4ULLA 1BQQT 4CKEA 5FO7B 3KJPA 1RJTA 2EQSA 2B2YA 5M5XB 4GKJQ 4X66L 3U50C 1XPOA 4A3FH 1V9PA 1TS5A 5LL6S 1STNA 1KDBA 3T53B 5CC4A 2YTYA 1WCMB 1KLGD 3ZJYC 2PZUA 1N33Q 2UXCQ 4KKSA 1PFNA 1FD7D 2RHSB 4CDDC 4OGQC 4X65Q 1MSGA 1WYDA 1BXTA 3QIAA 3M4PA 4QCLA 4HN7A 1G51A 3JAMi 5C44H 2F3WA 2RDFA 4A3GG 4HIOA 4X6AH 3M85A 1VQMA 4PG3A 2K5NA 3I8ZA 3I2ZA 2KECA 4BBSG 1IYUA 3F2CA 4V0BA 4JI3Q 2JA6B 1TWFH 2R7ZG 4MZ9A 3PO3B 2MNAA 4C1NK 3W3AA 2BA1A 5I9PA 4IPCA 1GM5A 1IW7D 1K3BC 5K36G 2A68C 2R93B 4IPGA 4PZ6A 3MA2B 2PYKA 5ELDA 3PF5A 5IYDG 3SGIA 3KOJA 4B3RQ 4WJWA 1B8AA 3OYYA 2E2JB 1HXYD 1Q82C 1NSNS 3ULLA 3PIO3 4XQNA 4DR7L 3TDQA 4DUZL 4DR1Q 5I9OA 1QVGA 2NYZD 3HFZB 1QUQA 1MGSA 2PMZE 2K03A 4DKAC 1JR0D 2YU9H 1QWYA 2JK8A 1PMRA 4L5SA 1IZ6A 1O7LA 1O80A 3TP6A 4GLVB 5LMNW 5HGQA 2K75A 1LT6D 3GTPB 2QILA 3AFQA 1VQJA 1PHJA 4C3HH 1WTQA 4ZCKA 5C4JH 1EQVA 2IPKD 4JVZA 3HRZC 4LF4L 2NBFA 3KLRA 2DJGC 1PXUA 3D4WA 3KUPA 4BS9A 2PW7A 5C0XG 4CJ0B 4DV4Q 2Z9HA 2K7VA 2XSCA 1VCIA 1LTBD 3HOUG 1RIPA 4C3IB 5ELFA 4JI0L 1N32Q 5IP7H 3JAML 5ELOA 1ZEQX 3T1HQ 2O2LD 4OO1I 2L55A 2AHOB 5C4HA 2FJ2A 3BZDB 3GO5A 1HNZL 5K5PA 4OONA 1FYCA 2WB1E 3GTJH 4IUQA 4X62L 4IZ8A 1A62A 4WORA 4NPSA 1QE6A 1ILQA 2K5VA 4X3TA 1A3UA 3GTGH 4TRDA 2SNSA 4JI7L 1RTNA 5G3LD 3ERSX 1PV4A 1I5FA 1IBLL 4JYAQ 4JI4Q 3J81E 3EIVA 1Q81C 3LWUA 3I91A 3B6YA 1RF2D 1PTOD 2EOTA 2R92G 2EYOA 1RODA 3DEOA 3HOWH 4RCNA 5GQOA 1TWHH 2OQ0A 4A3IB 3Q22A 5LMUQ 4KY7A 4QMGA 5C5MA 3M7NA 3FKIH 1XMQQ 5CR3A 5FKAC 2L15A 5IGBA 1OXTA 4A3MB 2EDGA 4J1MA 1JWUD 4X3UA 5D3DA 1ICFB 4FF3A 1XYIA 5CV9A 1ZXTA 3M4OB 3K5MA 1Z7TA 2DJFC 1D7QA 1M1KC 3RZOH 3EQLC 4LF7L 3CAMA 2J0TD 1ZYRD 3S24A 5I2XA 1RD9D 1OTCA 1RCVD 1I3QH 1WFQA 2Q2UA 4A3CH 4R4CA 1OXXK 2UUCQ 1SN8A 1EY6A 3S1QB 4KI0A 4A3LG 1VQAA 2UXBQ 5M5WB 2KHSA 1PRTD 1B2TA 5K36H 4A3DH 1VQBA 1EU3A 1BBXC 4RFBA 3I7FA 3Q6SA 1JJCB 2L9HA 5IYDH 2K14A 4HMJA 3AMUA 1L2FA 3HP3A 3RN2A 4BWGB 2TMPA 4KY5A 3E6ZX 5FOBB 3SK8A 1S40A 2B2UA 3MEHA 1CTMA 1ML0D 4KHVA 4YWLA 1L1OA 3BZKA 3X3NA 4K6DA 1QZHA 3GTKH 1LABA 4OWXB 1E7ZA 1N34Q 5E7NA 2EY1A 1QOHA 2YTXA 1SFOB 3HKZE 1XTCD 2XVSA 4DPGA 4WJ3M 2A74C 1OXUA 4B3TL 4DV3L 3A5ZB 3TSSA 4IURA 1A15A 1EEID 4EVOA 3EROA 1EFID 5IT9c 1I94Q 4OX9L 2RSOA 3J81i 4RGNA 4OO1G 4K2LA 4JI5L 3PUXA 3E3XA 4TQUS 4C3JH 1BCPB 3RMHA 4BA1I 5A2QL 3SXHA 5FLXE 1JORA 3RLFA 1L0XB 2OTLA 1IBML 4BY7G 2DN8A 2A6HC 1VQHA 3KLSX 2IWHA 4PMWA 2WFWA 2E2HB 2B2YC 4JI8Q 3OHXC 1I50B 3K5OA 4YCUA 4ZUIA 2HUGA 3DUZA 5IYBG 1X3EA 3GP7A 5M3FG 1XPUA 1VQIA 1VQCA 2L4NA 4POGA 4HCEA 1C7YA 2CVRA 3CF5A 5EPJA 2LKVA 1WTVA 5JJZA 4JV5Q 2QDLA 3MXGA 3RZDB 4FYDA 3RR5A 2MHVA 1MIUA 2F0SA 3NP8A 4WJ4A 1U5KA 3K0XA 2F4VL 5IYCG 3D6WA 2E2DC 3NBHB 5KEEA 1IYJB 3UE1A 4C2MB 3MFGA 3EN2A 2UUBL 3G48A 2QCPX 3MEFA 4UAIA 1MJCA 3BDCA 4EQOA 1TKWB 1Y1WG 3RNUA 2JA7B 4NXMQ 3EJIA 1U0LA 5GAGC 3OIQA 1HZCA 2JN4A 3V2TA 4DV6L 1IXRA 2Z4IA 1TWGH 5T1GA 2K4KA 1B70B 1E2ZA 4V190 1LO5D 5IE8A 1JMCA 1HFGA 1JQYD 2WAQE 3MXNB 3ITPA 4DV5Q 2NVQB 4I7ZC 4LF5Q 1BCPF 1GUTA 4JW0A 5KYIA 2EY6A 1PZID 4N8X1 5I6WA 2K1BA 3ND8A 4DV1L 4FF4A 1N9WA 4QQBX 2NVTH 1EOVA 4P74A 1K8AC 5M5XH 2VQEL 3QJYA 1SROA 2C35B 4F88A 3G6EA 1B3QA 2N3SA 2D0PA 2K32A 1WJJA 2F0JA 3J7AF 1J5EQ 1STGA 2VUMH 3S15H 1HJPA 4ZRZA 2FMCA 1WCMH 2GVAA 3HOZH 1DD2A 3NENA 3IL8A 3PV0A 3V05A 4YWMA 3A0JA 1KLUD 2Y0SB 1PFSA 3T51B 1M90C 1Z6HA 1XMOL 1GVPA 5C3EG 1HNXL 2RDGA 1B50A 4EQNA 1HUNA 5DM63 1EFWA 1B53A 2V4DA 2K33A 4CHTB 4YIJA 4DR5L 1ENFA 1SRUA 4OEMB 4DUYL 1FL0A 1YVCA 2TSSA 1C8CA 3SR1A 4IUVA 1CT1D 3NTKA 3O13A 2OQKA 3ICEA 3R2TA 1MI2A 1S5ED 4A3EG 4ME5A 5KNDA 1DONA 2N49A 3H15A 4DR3L 2N8NA 2RHQB 4MN3A 3UDIA 4A3BG 4P75A 1GUNA 1GKHA 1P8LA 5T1IA 1KRTA 2JXMB 2AQ1B 1S72A 2K50A 5M3MB 3DM3A 4A3GB 3CPWA 2ZT9C 4A3JH 2EYPA 2NVXB 4BBSB 5COYA 2LXKA 2DUDA 2IY5B 1OXSC 2R7ZB 2QDBA 4DV0L 2LY7A 2AWOA 4HJ8A 3GTQB 4NXNL 4A3KB 1LTSD 3CP0A 4DNTB 2F0NA 2JEBI 5IYBH 4DR4L 2I46A 1GUWA 1FNWA 1EYAA 2B2VA 3ONAB 2DY8A 4JI2L 2HHHQ 3R8BA 5C44G 2Q2IA 2HIXA 2CQAA 4YY3L 2QF7A 3NQTA 3MXNA 3S14H 4FXDA 3E0EA 2B2TA 2K28A 4KD4A 1S5DD 4WFN3 4DK1A 1SSOA 2EJGC 2EY2A 2N78A 4G57A 5IYCH 2HIVA 3QOJA 1Z47A 1O78A 4QGUA 4Y7NB 4DR6L 4A93B 5BN5A 3BYYB 4F8MA 1VF7A 5BN4A 1EY4A 4MNOA 3TP7A 4CGYB 1IL8A 1Y1WH 1QNUA 1XNQL 2BE5C 4BXXH 1CQVA 2NVYH 5DM73 3HOXB 4KY6A 1TVXA 1HFNA 1N36Q 1NTGA 2B63B 2VS1A 2F1MA 3T1YL 4DAVA 3RLOA 5DNFA 1E0BA 2ZM6L 1KL9A 4KMUC 4LFCL 4LF8Q 4NW2A 4B9XA 2JJQA 5C3XA 4DR7Q 2FFKB 1PRTB 4K2KA 1STBA 4QJFA 2KA7A 4H7BA 1JWMD 1XNRQ 5DLQE 1EQRA 4IUTA 3U4VA 2B2UC 1SYEA 4FNFA 1GUGA 2QA4A 3HOUB 1H95A 1EYCA 1L1OC 2JQOA 3J7YW 4C3HG 5GROA 4JI6Q 4QUCA 2Z6KA 1VQ6A 1D5ZC 3BU2A 2M9VA 3IRBA 4AQYL 2C9OA 1PH9A 2YTVA 4LWCA 1EIGA 5G3LF 2E5LL 4APVA 4I65A 1II3A 1QUQB 5D3IB 2Y0SE 5L37A 1W2BA 2X6LA 2AUKA 1ILPA 2CQOA 1LT3D 3C1EA 2ALYB 4IJHA 4A3MH 2ZJRA 3QO2A 5IGDA 1PTOF 3HS0C 2MO1A 3A55A 4B9WA 4E6IA 1EY8A 5IIFA 2NN6I 2KHJA 1PA6A 2ZTEA 3CQZH 2R92B 3VR2A 1R9TB 5M5YB 4JI0Q 4DAPA 1PH4A 4OWWB 1K0RA 2BDNA 4JOIA 3H6MA 3GTLB 2UXDL 2WP8J 4LJZC 1F2LA 2MQHA 5AJ3L 1WTRA 2I0QA 2O5JC 4JI1L 2MJ8A 3NEMA 3MFYA 3D8GA 4DFAA 4GZYC 3CCUA 1UUPA 2O4XA 4X62Q 3HKSA 4S3SA 5JEAJ 4A3BH 3C2PA 1STEA 1Q3LA 3S1MH 3BZCA 3HOVG 1X6OA 2AWNA 3HOWG 3FP9A 3NTHA 2XWJB 3TQYA 3VR6A 4KHZA 2KCMA 2K5WA 4TVAB 3OTOQ 1IBLQ 1PRTF 1M8AA 3A56A 3FKIG 2XNAC 3SEBA 4IO9A 5E1FA 2DNEA 1NUCA 1JCKB 3BYTB 3VYUA 2E2IH 1BKBA 4RWSC 1UWVA 5IT9E 1T9HA 1SFOH 1LTID 1YNJD 5CMDA 1G2TA 3KBXA 2Z0SA 1WTOA 1K73C 4A3CG 3DXJC 5CORA 1SNOA 2PNRC 4MTKA 2CW0D 2PQAA 4XIGS 3URYA 1VQ9A 1CSPA 1EQTA 3H0GG 2PCFB 1B9NA 3X3MA 4X64L 1EL0A 4A3DG 3T56B 2MPMA 1EIHA 3GV3A 2A6ED 5CBEE 1MKHA 1YNND 3J7ZC 4GKKL 1LT5D 1YI2A 5F2DA 2JA5B 3Q23A 3MC0B 3NPPA 5AFWA 1JB3A 2PO4A 4CKBA 1SXTA 3I4LA 4RKBA 1B7YB 2UUAL 4KN4C 4LFBQ 2EYFA 3ULPA 1B9MA 3CC4A 1YITA 2E2HH 5A2QE 4JBMA 1SNQA 4KLKA 5C5LA 3VA5A 3Q24A 3BVMA 3F8TA 4BY1H 2K5DA 4OIJA 4JC0A 1D1KA 3HZXA 1YEZA 1JC7A 1GHKA 4DN4M 2HCCA 5IWAL 3CD6A 1SNPA 1TWCH 3GD7A 4RH6A 4XTCS 3KF8B 1HRJA 3NQIA 1C0AA 3DEPA 4ALPA 1PH5A 1BCPC 3BDOA 5GAHC 1XTDA 4BY7B 2QW7A 4DAMA 3CCVA 5M9OA 3UDFA 1Y1VB 5IGGA 4J15A 2R3ZA 4XYQA 3STBC 3CCMA 5M3FB 1YZ6A 3Q8DA 3OMCA 1U4PA 4C3JG 3HEJA 1V8QA 2SDFA 2Z4HA 4LF9Q 4PNYA 3S1RB 4DV7Q 2AQ3B 4XYOA 4K8JA 2WIIB 3S2HB 1L1OB 4EQPA 1DGSA 3D4RA 2BA0A 4ZAIA 3VYTA 1SNDA 3L2PA 4RGOS 2UU9L 2EYLA 3S2DH 4AYBE 3SK4A 3WDNA 3NBIA 5C4XH 4XQQA 2D62A 4BBRB 1STYA 1V1OA 2EYJA 1WD1A 5EPLA 4K0KL 2JP1A 4HJ7A 2NVQH 3K7AB 3I4NB 1OO9B 1A63A 2VL6A 2F0PA 4LUVA 3CMEA 1FGBD 1ET6A 3BG3A 3GTMB 1K0SA 4IUNA 3T16A 4KD3A 4DV2L 2F03A 1DZ1A 1HTPA 1QCBD 1TWAH 4ZK9B 4UPAA 1NMFA 3MXPA 3I70A 5TSSA 1SE3A 2B2VC 3TS2A 5DAUA 3PIPA 1B4OA 4GKJL 1LTLA 4P73A 4ZKBB 4QF4A 5JPMC 2FMMA 3OWFA 3FDTA 1AW7A 3HOVH 4LFAL 5LL6X 4HEDA 1SYDA 2SOBA 3M3YH 3SK5A 2B2TC 1SAPA 2KCCA 4IFDJ 3BDLA 1VQLA 4J6HA 1BVSA 3K5LA 2EPBA 4P2CB 1EIYB 5C3WA 1BUVT 1CM9A 1TU2B 1JICA 2UXCL 2UUBQ 1KNAA 1HR0W 2IX1A 3FMCA 3TP8A 3T4AC 2C5CA 2A1AA 3S16B 3CU7A 4X65L 2HDMA 5H1SE 1W6KA 3I90A 3TEHB 4DXGA 3GTOH 1K8GA 3J7A5 3S1NB 4KHPQ 2A8VA 3KBGA 2B39A 3G4SA 2F4IA 3NWTA 2F0MA 4JI3L 1SMYC 3H0GH 5C3EB 3VR5A 3KF8A 2ZXOA 5CV8A 2E76C 5JAVA 1VQ8A 4CDFC 2VUMG 1PYBA 1AH9A 3N52A 1F2ZA 5M3MH 5EKIA 1WCMG 1PH1A 1HNWL 2KCTA 3HOZG 2RSNA 5CV4A 1X9NA 1HZBA 5IODA 3MZ5A 4DV1Q 3OWEB 1A3VA 2YYZA 4O42A 4G7HC 3PO2B 2BH8A 3JC66 3P1HA 4A3EB 3I4MH 2CFMA 4RKLA 4YHHQ 1GHJA 3K7UC 2VQFQ 3CCSA 5IT9L 5KNBA 2Z6KC 1Q86C 3DWPA 2N88A 4DR1L 3H3VI 2CH4W 5IGFA 1S3OA 2K6AA 4A3FB 2ASBA 2BH2A 3L0OA 3DMUA 5E4XA 2H5XA 4QIWB 5DEHA 5JJIA 1CSQA 2G9DA 1FGUA 2JE6I 1O7ZA 1BNZA 4A75A 3NXWA 2PQEA 4CKCA 1E24A 2JA6G 2L1BA 3MHBA 4R8NA 1QILA 3QOLA 3PGZA 1VQNA 5ELCA 2EYMA 2IX3A 4HJ9A 2R93G 1SR3A 4JK1C 2RA4A 2NN6H 4PZ8A 3S17H 4K8IA 4Y7NH 5EBCA 1TY2A 1YBYA 5C44B 4A93H 2ZTDA 1BO0A 3D6CA 1V1QA 2KEEA 2JEAI 4A3JG 2EJMA 5BR8Q 1AN8A 2H4OA 3AB9A 1LM0A 1JB7A 2CWAA 1X54A 4XT3B 2EXZA 1TWFB 4JOIC 5I4DA 1XWEA 4DR3Q 1NCVA 2G5DA 4H0LC 4LUOA 4QUFA 4C1NI 1Z9FA 3VA7A 2VB3X 5LMNQ 1PFBA 3TZUA 1PTOC 2EY5A 1K83H 3K8AA 3T1HL 3FEWX 3QWNA 2HDLA 1L0WA 4UP8A 2M00A 3HKZG 2Q2HA 4OHJA 1VMPA 3PUZA 4DNIA 4NXNQ 4TKOB 1ICWA 3TZDA 1X3FA 2CKZB 3Q0AA 3BS1A 4JI2Q 3VDYA 3OMGA 4G4KA 4HIMA 1KC8C 2JA8H 2DY7A 5KYLA 2YU9B 4JI4L 5ISRA 4GS3A 5D14A 3S9WA 4DU9A 4PV1C 1MD2D 2AQ2B 3GDEA 1KIXA 4BXXG 1HHVA 3CPFA 2RDHA 4C3IG 4RCOA 1I6VC 3KF6A 1PRTC 3OW7A 2XTIA 4KKUA 4KN7C 4X3KA 1F77A 1G291 4DR6Q 4C3HB 1VQFA 1S5BD 5C4JB 1XMQL 1E2WA 3FPPA 1VQPA 1K3RA 3HOYB 3K57A 1D5MC 2WINB 2NWGA 4NP5A 5EKLA 1Q7YC 5KNCA 5JOBA 1EWIA 1LT4D 4HR7B 1MBYA 1FNUA 3E0JA 2JSOA 1YHBA 3LWEA 4POFA 1AZPA 4O2DA 3K58A 2UUCL 1STAA 3NK9A 1RTOA 3LGJA 3U9SA 1F9SA 2F0QA 5FLMH 1KXLA 1KTKA 1IBKQ 2UXBL 1HR0Q 1LV9A 1KRSA 3GTJB 5CGKA 3EVQA 4ZLTF 5IGCA 2B3GA 3AYHB 4GN4B 2PI2A 4CJ1B 2VW9A 3GTGB 3A54A 1UEBA 4HCSA 4IOCA 2ZJPA 2PNHA 1D5XC 4A3MG 1BBWA 2L12A 2B2WA 1JWSD 1WTPA 4QIWE 1I6HB 2WAQG 1IL2A 5JJLA 1P16A 2RQXA 4IJLA 5FJ8H 1TS4A 1WI5A 3DWQA 1PH6A 4B3SL 5D65A 3D0FA 5E3FA 5JEAG 2JA6H 1BBUA 1X56A 3PO3H 4ZYSA 3J80i 1I94L 3K5NA 2L11A 3TREA 2R93H 2CCZA 1HZ9A 4FVMA 3RZOB 2LSSA 1G91A 1V1PB 2MUYA 4K5WA 4ZUJA 2XWBB 4NKLA 4Z9CB 1VQ5A 2E2JH 1TT2A 1I3QB 3J7AV 3NSWA 3QB3A 3I56A 1S4ZA 3IFDA 2UXDQ 2K5HA 3AQQA 5AJ3Q 2PZTA 4U673 1K28A 1CHPD 3MXUA 4X66Q 3CXCA 1STHA 2NUCA 1YNXA 1E1OA 3IFTA 4DR2L 4NDXA 4A3DB 4JI8L 4IALA 3LX0A 2GN5A 3DM1A 2M2LA 1JJ2A 5ELBA 4LF6L 1VF5C 1PLFA 2GA4B 4DK0A 4IFDI 3KLSA 4RA8A 3AFPA 4JBWA 3UDXA 4IPHA 2AUJD 4FF2A 2A69D 1AZQA 4JV5L 3KDFA 3DWAA 1DCZA 3PQIA 1WTXA 1Y1VH
chains in the Genus database with same CATH topology
3B6YA 4QL5A 3GTPH 2R92G 2E2IH 1BKBA 3HOWH 5GQOA 1UWVA 1T9HA 1SFOH 1TWHH 2OQ0A 3ULJA 5LMUQ 2VNUD 5LMUL 2Z0SA 1K73C 3M7NA 3TRZA 4A3CG 3FKIH 4BBRG 1XMQQ 2L15A 4YCVA 4HIKA 1GD7A 1OXTA 1CKNA 4HJAA 2PQAA 4XIGS 3KDFB 2IHFA 1VQ9A 2Q2TA 1CSPA 4JBKA 4R4OA 3H0GG 1XNQQ 2NZHA 3NELA 3I4NG 1EIFA 4NXML 3KFUA 2RF4A 2R92H 1D7QA 4X64L 1M1KC 3RZOH 1R9TH 4A3DG 4LF7L 2R6GA 5EAYA 5M5YH 4C3IH 3CAMA 3A5UA 1YIJA 4BY1G 3WWVA 4IPDA 3S24A 3CC7A 3T1YQ 1MKHA 1OTCA 4GKKQ 3J7ZC 1I3QH 1Y14B 4GKKL 1WFQA 1YI2A 2ZM6Q 3M9BA 2Q2UA 4KHPL 3GTLH 4LFCQ 4A3CH 4BBRH 4R4CA 3CCEA 1OXXK 2PQAB 1YHAA 2UUCQ 1SN8A 3L7ZC 1B7YB 3I4NH 4KI0A 2UUAL 4DUZQ 1VQAA 4A3LG 4LFBQ 2UXBQ 3ULPA 3CC4A 1YITA 2E2HH 4JBMA 1QVFA 4KLKA 4A3DH 4GNXA 1VQBA 3F8TA 4A76A 4BY1H 4LF5L 1YJ9A 1X65A 4P72A 4JC0A 3H3VH 3I7FA 2OWOA 2QGQA 4A3IG 1JJCB 5IYDH 2K14A 1YEZA 1L2FA 3RN2A 5IWAL 3CD6A 2EXDA 1KHIA 2XGTA 1J6QA 1TWCH 2ZTCA 3GD7A 4XTCS 4GOPC 3KF8B 4R4IA 4YHHL 4A3LH 2VQFL 2I5LX 4AQYQ 1S40A 4ALPA 1PH5A 2JA7G 1C0AA 5GAHC 1AE3A 1XTDA 4EQ5A 4DAMA 2QEXA 4GNXB 3AEVA 1X55A 3CCVA 5GADC 1JE5A 1VQDA 2E5LQ 1J5EL 4L5RC 1JT8A 2HQLA 4YWLA 3UDFA 1L1OA 3J80c 3BZKA 1QZHA 4J15A 1Q1EA 3STBC 3CCMA 4A3IH 3GTKH 1EQQA 4OWXB 1E7ZA 3J81c 5E7NA 3E9IA 1YZ6A 1N34L 1UE6A 2YTXA 3Q8DA 1N34Q 3HKZE 4DPGA 4WJ3M 1OXUA 4B3TL 1XJVA 4DV3L 4LF4Q 3A5ZB 5C4XG 4LF9Q 3CCJA 1NBWA 3M4OH 4YWKA 2PI2E 4DV7Q 2IHEA 1K9MC 5IT9c 1I94Q 4OX9L 2OTJA 1L1OB 3J81i 4OO1G 4ME3A 4JI5L 3PUXA 4DAYB 1DGSA 1V43A 1Q1BA 2IT1A 2BA0A 4TQUS 3L2PA 4C3JH 2JA5H 1KD1C 2UU9L 3S2DH 4AYBE 3PIOA 1VQGA 4BA1I 3PO2G 5J3BA 5C4XH 3W1GA 3S1QH 1PH3A 2D62A 4R1JA 4AH6A 3RLFA 4OXPA 5BR8L 1NJIC 4JI1Q 2OTLA 4K0KQ 1UE5A 4OWTB 5M5WH 1HNZQ 4HJ7A 2CWPA 1IBML 2NVQH 4IFDG 4BY7G 1KQSA 1VQHA 1A63A 2VL6A 4A3FG 4PMWA 2WFWA 4LUVA 3CMEA 4JI8Q 2F3IA 4YCUA 5IYBG 3A74A 1X3EA 4R4TA 4DV2Q 4DV2L 4JI7Q 5M3FG 1XPUA 1VQIA 1TWAH 1VQCA 5LMNL 1QZGA 4POGA 4UPAA 1Q8KA 5C0XI 1NMFA 1C7YA 2Y0SG 1VQOA 3CF5A 1YJNA 3TS2A 1N8RC 3ER0A 1E3PA 4JV5Q 3PIPA 4BY7H 4GKJL 1D8LA 1SE8A 1LTLA 3RR5A 4P73A 1MIUA 5GAEC 4A4IA 1YJWA 3HOVH 2GVBA 4LFAQ 4LFAL 4WJ4A 5M3FH 1G6PA 3M3YH 4IFDJ 1U5KA 3K0XA 2F4VL 5IYCG 1VQLA 2HHHL 1BVSA 2MFIA 3NBHB 2A19A 1EIYB 3K80C 4DK6C 1IYJB 3UE1A 1PYSB 3S1RH 2UXCL 2UUBQ 3EN2A 5IY0A 3G48A 2KBNA 1HR0W 2UUBL 2IX1A 1ASZA 3MEFA 1HH2P 2A1AA 3F2BA 1MJCA 3S2HH 3CMAA 3U4ZA 1Y1WG 3RNUA 3I4OA 4X65L 4NXMQ 1UE1A 1A0IA 1U0LA 4X64Q 5H1SE 5GAGC 4LW1A 3EBEA 1JJGA 2V1CC 4LF7Q 1HZCA 3TEHB 3KLWA 3GTOH 3BJUA 4DV6L 1IXRA 5M3MG 1SLJA 1TWGH 1K8GA 4P71A 3J7A5 4GLAC 4KHPQ 2A8VA 2K4KA 1B70B 4Y52H 3G4SA 3CW2C 2ID0A 4QY7A 4UP9A 1CKMA 5IE8A 1JMCA 4JI3L 2WAQE 2JA9A 1E22A 4DK3C 1RL2A 3H0GH 3K7AH 3MXNB 5ELNA 3I4MG 2UUAQ 3W1BA 3CC2A 4DV5Q 4A3KG 4DV5L 3CCLA 4JG2A 1VQ8A 3GTMH 1I50H 2YV5A 2D0OA 4LF5Q 2KHIA 2VUMG 1PYBA 1N36L 1AH9A 5M3MH 1WCMG 1PH1A 1MJEA 5FLXc 1HNWQ 1HNWL 2KCTA 1VQEA 1ASYA 3HOZG 1Q12A 4HJ5A 1X9NA 1HZBA 3FHWA 4NB3A 4DV1Q 4DV1L 2YYZA 5IWAQ 1N9WA 4QQBX 2BH8A 1PH2A 2NVTH 1EOVA 4P74A 1K8AC 3JC66 5M5XH 2VQEL 4LF8L 1SROA 2C35B 2CFMA 3D31A 4YHHQ 3G6EA 3RZDH 3K7UC 2VQFQ 3I4MH 2N3SA 2I5HA 2NZOA 2Z6KC 4JCVE 3CCSA 3KJOA 1Q86C 2D0PA 3H3VI 1WJJA 2E8GA 4DR1L 1IBKL 1HR0L 1J5EQ 2ES2A 2VUMH 1S3OA 3S15H 5IP9G 1XNRL 2ASBA 1HJPA 2BH2A 1WCMH 3L0OA 1LUZA 4L5TA 2GVAA 3TS0A 2H5XA 5JJIA 1CSQA 3HOZH 1PVOA 4GOPA 4B3MQ 3NENA 4B3ML 2NN6G 3PV0A 4IOAA 2KENA 3CCRA 1W3SA 1CKOA 4C2MH 4YWMA 4A93G 4B3TQ 3A0JA 4JI6L 3DLLA 2VZAA 4H02A 1FGUA 2JE6I 4DV3Q 1FJGQ 4LNQA 1FJGL 2DGYA 1PFSA 4A75A 1M90C 1E24A 2JA6G 3S16H 1WOCA 2R7FA 1GVPA 5C3EG 1XMOL 4LUZA 2JA7H 3PGZA 3U58A 1HNXL 4OX9Q 1VQNA 3HOYG 2HT1A 5IP9H 1EFWA 3HOXG 1NE3A 4JI5Q 4HJ9A 2EIFA 2R93G 1A8VA 2RCNA 1TXYA 1SR3A 4GOPB 2B63G 3F2DA 4DR5L 1SRUA 3PUVA 4DUYL 4PZ8A 1O7IA 1FL0A 3S17H 1YVCA 3S1NH 4Y7NH 2UU9Q 4A93H 1YBYA 2ZTDA 3PF4A 3OW2A 4GN3B 4YCWA 1V1QA 2OQKA 5IP7G 4PZ7A 4HIDA 3ICEA 2JEAI 1SMXA 1EYGA 1XPRA 5C3EH 4A3EG 4O0AA 5BR8Q 4A3JG 1LM0A 4MTNA 1JB7A 2R7DA 2CWAA 1X54A 2N49A 3STBD 2FXQA 1GO3E 3H15A 1IBMQ 3HOYH 4JOIC 4DR3Q 1HZAA 2N8NA 2RHQB 4DR3L 2ATWA 2ZJQA 4UP7A 4LUOA 3UDIA 4A3BG 4P75A 1GKHA 4UY8C 3I55A 1P8LA 3UDGA 1Z9FA 1KRTA 1PH7A 2I5MX 5LMNQ 1S72A 2K50A 3PUWA 3DM3A 1KAWA 1Q46A 3PO2H 1K83H 3CPWA 3K8AA 2IX0A 4L5QA 4A3EH 4A3JH 3T1HL 3W5OA 2B29A 1L0WA 2JA8G 4UP8A 3HKZG 3KJPA 2Q2HA 2EQSA 2LXKA 2DUDA 4GKJQ 4X66L 1OXSC 3PUZA 2IY5B 1PH8A 3U50C 4DV0L 2AWOA 4HJ8A 4DNIA 1XPOA 4NXNQ 4NXNL 4A3FH 1V9PA 3CP0A 5IYBH 2JEBI 4DR4L 1X3FA 2CKZB 2AMCB 2YTYA 4JI2Q 4JI2L 2F4VQ 2HHHQ 5C44G 1OXVA 4RG1A 3ZJYC 2Q2IA 3VDYA 3JAMc 3OTOL 1N33Q 2HIXA 4GN5A 1N33L 1KC8C 4HIMA 2JA8H 2UXCQ 4R4QA 3UE0A 4YY3L 4JI4L 1AE2A 2RHSB 4GS3A 4AYBG 4RMFA 4X65Q 1I6HH 3PUYA 3S14H 3E0EA 3GDEA 1KIXA 4BXXG 1WYDA 2VY3A 3M4PA 3CPFA 2WB1G 1G51A 2MO0A 2N78A 3JAMi 4DV6Q 3G71A 5IYCH 2HIVA 1CUKA 5C44H 3KF6A 1VQ7A 4A3GG 2XTIA 1YHQA 4HIOA 1Z47A 1G291 4DR6Q 4QGUA 4X6AH 3M85A 1VQMA 4PG3A 1VQFA 2K5NA 4DR6L 1NY4A 1LYLA 3I2ZA 1XMQL 4MNOA 3F2CA 4JI3Q 4BBSG 1TWFH 1Y1WH 4MZ9A 2R7ZG 2MNAA 1VQPA 1XNQL 2BA1A 5FLMG 4BXXH 1K3RA 4IPCA 1GM5A 2NVYH 5K36G 1N36Q 1NTGA 4IPGA 4PZ6A 3KF6B 1Q7YC 2VS1A 3T1YL 4A3GH 1EWIA 3RLOA 4GNXC 1FVIA 3PF5A 5JJKA 5IYDG 2ZM6L 1KL9A 1VQ4A 3SGIA 4LFCL 3KOJA 4B3RQ 4B3RL 1CKNB 1B8AA 3OYYA 2NVXH 4BBSH 1YHBA 4POFA 2VQEQ 4LF8Q 4O2DA 1Q82C 2UUCL 2R7ZH 3LGJA 3PSIA 2JJQA 3ULLA 3GTQH 4BA2I 3K81C 4EX5A 4DR7Q 4AIMA 5FLMH 4DR7L 1KXLA 4A3KH 4DUZL 4DR1Q 4LFBL 1IBKQ 2UXBL 4QJFA 1HR0Q 1QVGA 1KRSA 3PCOB 1XNRQ 1VQKA 1X3GA 1EQRA 5DLQE 3U4VA 5HY6A 2B3GA 3AYHB 4GN4B 1E1TA 1QVCA 3HFZB 1QUQA 2QA4A 2PI2A 2VW9A 1H95A 5FJ8G 2PMZE 1L1OC 1UEBA 1EUJA 2JQOA 4IOCA 5GROA 4JI6Q 2ZJPA 2Z6KA 4DKAC 1VQ6A 3BU2A 2YU9H 2PNHA 3M4QA 2AKWB 2JK8A 4A3MG 4L5SA 1IZ6A 1XMOQ 3PO3G 3IRBA 1BBWA 4AQYL 1HNXQ 1PH9A 2YTVA 4GLVB 4QIWE 4LWCA 5LMNW 2WAQG 2E5LL 4APVA 1IL2A 5HGQA 5JJLA 1P16A 3F1ZA 1QUQB 2K75A 2Y0SE 4DR5Q 4IJLA 5FJ8H 4DUYQ 1W2BA 3AFQA 1VQJA 1WI5A 1PHJA 1PH6A 4K0KL 2CQOA 4C3HH 2JA5G 4B3SQ 5C4JH 4B3SL 3D0FA 2ALYB 4IJHA 4A3MH 5JEAG 2ZJRA 4LF4L 2JA6H 1BBUA 1X56A 3PO3H 2MO1A 4LF9L 3J80i 5C0XG 4DV7L 4FDBA 1I94L 4DV4Q 4DV4L 3HOXH 2NN6I 2KHJA 3TREA 1PA6A 2R93H 2ZTEA 3CQZH 2B63H 1UE7A 1VCIA 2CCZA 1HZ9A 4JBJA 2LSSA 1RIPA 2OCEA 3HOUG 4JI0Q 4JI0L 1N32Q 1VQ5A 2E2JH 1N32L 5IP7H 1PH4A 5ELOA 1K0RA 4OWWB 3CCQA 3I56A 4JOIA 3T1HQ 2UXDQ 3E9HA 2UXDL 2K5HA 2WP8J 3AQQA 4OO1I 2LXJA 5AJ3Q 2AHOB 2MQHA 5AJ3L 2I0QA 4JI1L 4X66Q 3GO5A 3NEMA 4DV0Q 1HNZL 4OONA 2WB1E 3GTJH 3CXCA 3CCUA 4X62Q 4A3BH 1YNXA 3HKSA 1A62A 5JEAJ 1E1OA 2K52A 4X62L 4GLXA 3RN5A 4DR2Q 4DR2L 3S1MH 4DR4Q 1Y1VG 4NPSA 3BZCA 4JI8L 3HOUH 3RLNA 2K5VA 3HOVG 1X6OA 2GN5A 5C0XJ 3GTGH 1NMGA 2AWNA 3HOWG 4JI7L 3FP9A 1JJ2A 4LF6Q 3TQYA 4LF6L 3ERSX 3J81j 4KHZA 2KCMA 1PV4A 4IFDI 4TVAB 3OTOQ 1I5FA 1IBLQ 1C9OA 3AFPA 4JBWA 1IBLL 3UDXA 4IPHA 4YY3Q 4JYAQ 4JI4Q 4JYAL 3FKIG 3EIVA 1Q81C 4JV5L 1VS0A 4IO9A 3KYHC 2F52A 3KDFA 1Y1VH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B6Y A;  4QL5 A;  3GTP H;  2R92 G;  2E2I H;  1BKB A;  3HOW H;  5GQO A;  1UWV A;  1T9H A;  1SFO H;  1TWH H;  2OQ0 A;  3ULJ A;  5LMU Q;  2VNU D;  5LMU L;  2Z0S A;  1K73 C;  3M7N A;  3TRZ A;  4A3C G;  3FKI H;  4BBR G;  1XMQ Q;  2L15 A;  4YCV A;  4HIK A;  1GD7 A;  1OXT A;  1CKN A;  4HJA A;  2PQA A;  4XIG S;  3KDF B;  2IHF A;  1VQ9 A;  2Q2T A;  1CSP A;  4JBK A;  4R4O A;  3H0G G;  1XNQ Q;  2NZH A;  3NEL A;  3I4N G;  1EIF A;  4NXM L;  3KFU A;  2RF4 A;  2R92 H;  1D7Q A;  4X64 L;  1M1K C;  3RZO H;  1R9T H;  4A3D G;  4LF7 L;  2R6G A;  5EAY A;  5M5Y H;  4C3I H;  3CAM A;  3A5U A;  1YIJ A;  4BY1 G;  3WWV A;  4IPD A;  3S24 A;  3CC7 A;  3T1Y Q;  1MKH A;  1OTC A;  4GKK Q;  3J7Z C;  1I3Q H;  1Y14 B;  4GKK L;  1WFQ A;  1YI2 A;  2ZM6 Q;  3M9B A;  2Q2U A;  4KHP L;  3GTL H;  4LFC Q;  4A3C H;  4BBR H;  4R4C A;  3CCE A;  1OXX K;  2PQA B;  1YHA A;  2UUC Q;  1SN8 A;  3L7Z C;  1B7Y B;  3I4N H;  4KI0 A;  2UUA L;  4DUZ Q;  1VQA A;  4A3L G;  4LFB Q;  2UXB Q;  3ULP A;  3CC4 A;  1YIT A;  2E2H H;  4JBM A;  1QVF A;  4KLK A;  4A3D H;  4GNX A;  1VQB A;  3F8T A;  4A76 A;  4BY1 H;  4LF5 L;  1YJ9 A;  1X65 A;  4P72 A;  4JC0 A;  3H3V H;  3I7F A;  2OWO A;  2QGQ A;  4A3I G;  1JJC B;  5IYD H;  2K14 A;  1YEZ A;  1L2F A;  3RN2 A;  5IWA L;  3CD6 A;  2EXD A;  1KHI A;  2XGT A;  1J6Q A;  1TWC H;  2ZTC A;  3GD7 A;  4XTC S;  4GOP C;  3KF8 B;  4R4I A;  4YHH L;  4A3L H;  2VQF L;  2I5L X;  4AQY Q;  1S40 A;  4ALP A;  1PH5 A;  2JA7 G;  1C0A A;  5GAH C;  1AE3 A;  1XTD A;  4EQ5 A;  4DAM A;  2QEX A;  4GNX B;  3AEV A;  1X55 A;  3CCV A;  5GAD C;  1JE5 A;  1VQD A;  2E5L Q;  1J5E L;  4L5R C;  1JT8 A;  2HQL A;  4YWL A;  3UDF A;  1L1O A;  3J80 c;  3BZK A;  1QZH A;  4J15 A;  1Q1E A;  3STB C;  3CCM A;  4A3I H;  3GTK H;  1EQQ A;  4OWX B;  1E7Z A;  3J81 c;  5E7N A;  3E9I A;  1YZ6 A;  1N34 L;  1UE6 A;  2YTX A;  3Q8D A;  1N34 Q;  3HKZ E;  4DPG A;  4WJ3 M;  1OXU A;  4B3T L;  1XJV A;  4DV3 L;  4LF4 Q;  3A5Z B;  5C4X G;  4LF9 Q;  3CCJ A;  1NBW A;  3M4O H;  4YWK A;  2PI2 E;  4DV7 Q;  2IHE A;  1K9M C;  5IT9 c;  1I94 Q;  4OX9 L;  2OTJ A;  1L1O B;  3J81 i;  4OO1 G;  4ME3 A;  4JI5 L;  3PUX A;  4DAY B;  1DGS A;  1V43 A;  1Q1B A;  2IT1 A;  2BA0 A;  4TQU S;  3L2P A;  4C3J H;  2JA5 H;  1KD1 C;  2UU9 L;  3S2D H;  4AYB E;  3PIO A;  1VQG A;  4BA1 I;  3PO2 G;  5J3B A;  5C4X H;  3W1G A;  3S1Q H;  1PH3 A;  2D62 A;  4R1J A;  4AH6 A;  3RLF A;  4OXP A;  5BR8 L;  1NJI C;  4JI1 Q;  2OTL A;  4K0K Q;  1UE5 A;  4OWT B;  5M5W H;  1HNZ Q;  4HJ7 A;  2CWP A;  1IBM L;  2NVQ H;  4IFD G;  4BY7 G;  1KQS A;  1VQH A;  1A63 A;  2VL6 A;  4A3F G;  4PMW A;  2WFW A;  4LUV A;  3CME A;  4JI8 Q;  2F3I A;  4YCU A;  5IYB G;  3A74 A;  1X3E A;  4R4T A;  4DV2 Q;  4DV2 L;  4JI7 Q;  5M3F G;  1XPU A;  1VQI A;  1TWA H;  1VQC A;  5LMN L;  1QZG A;  4POG A;  4UPA A;  1Q8K A;  5C0X I;  1NMF A;  1C7Y A;  2Y0S G;  1VQO A;  3CF5 A;  1YJN A;  3TS2 A;  1N8R C;  3ER0 A;  1E3P A;  4JV5 Q;  3PIP A;  4BY7 H;  4GKJ L;  1D8L A;  1SE8 A;  1LTL A;  3RR5 A;  4P73 A;  1MIU A;  5GAE C;  4A4I A;  1YJW A;  3HOV H;  2GVB A;  4LFA Q;  4LFA L;  4WJ4 A;  5M3F H;  1G6P A;  3M3Y H;  4IFD J;  1U5K A;  3K0X A;  2F4V L;  5IYC G;  1VQL A;  2HHH L;  1BVS A;  2MFI A;  3NBH B;  2A19 A;  1EIY B;  3K80 C;  4DK6 C;  1IYJ B;  3UE1 A;  1PYS B;  3S1R H;  2UXC L;  2UUB Q;  3EN2 A;  5IY0 A;  3G48 A;  2KBN A;  1HR0 W;  2UUB L;  2IX1 A;  1ASZ A;  3MEF A;  1HH2 P;  2A1A A;  3F2B A;  1MJC A;  3S2H H;  3CMA A;  3U4Z A;  1Y1W G;  3RNU A;  3I4O A;  4X65 L;  4NXM Q;  1UE1 A;  1A0I A;  1U0L A;  4X64 Q;  5H1S E;  5GAG C;  4LW1 A;  3EBE A;  1JJG A;  2V1C C;  4LF7 Q;  1HZC A;  3TEH B;  3KLW A;  3GTO H;  3BJU A;  4DV6 L;  1IXR A;  5M3M G;  1SLJ A;  1TWG H;  1K8G A;  4P71 A;  3J7A 5;  4GLA C;  4KHP Q;  2A8V A;  2K4K A;  1B70 B;  4Y52 H;  3G4S A;  3CW2 C;  2ID0 A;  4QY7 A;  4UP9 A;  1CKM A;  5IE8 A;  1JMC A;  4JI3 L;  2WAQ E;  2JA9 A;  1E22 A;  4DK3 C;  1RL2 A;  3H0G H;  3K7A H;  3MXN B;  5ELN A;  3I4M G;  2UUA Q;  3W1B A;  3CC2 A;  4DV5 Q;  4A3K G;  4DV5 L;  3CCL A;  4JG2 A;  1VQ8 A;  3GTM H;  1I50 H;  2YV5 A;  2D0O A;  4LF5 Q;  2KHI A;  2VUM G;  1PYB A;  1N36 L;  1AH9 A;  5M3M H;  1WCM G;  1PH1 A;  1MJE A;  5FLX c;  1HNW Q;  1HNW L;  2KCT A;  1VQE A;  1ASY A;  3HOZ G;  1Q12 A;  4HJ5 A;  1X9N A;  1HZB A;  3FHW A;  4NB3 A;  4DV1 Q;  4DV1 L;  2YYZ A;  5IWA Q;  1N9W A;  4QQB X;  2BH8 A;  1PH2 A;  2NVT H;  1EOV A;  4P74 A;  1K8A C;  3JC6 6;  5M5X H;  2VQE L;  4LF8 L;  1SRO A;  2C35 B;  2CFM A;  3D31 A;  4YHH Q;  3G6E A;  3RZD H;  3K7U C;  2VQF Q;  3I4M H;  2N3S A;  2I5H A;  2NZO A;  2Z6K C;  4JCV E;  3CCS A;  3KJO A;  1Q86 C;  2D0P A;  3H3V I;  1WJJ A;  2E8G A;  4DR1 L;  1IBK L;  1HR0 L;  1J5E Q;  2ES2 A;  2VUM H;  1S3O A;  3S15 H;  5IP9 G;  1XNR L;  2ASB A;  1HJP A;  2BH2 A;  1WCM H;  3L0O A;  1LUZ A;  4L5T A;  2GVA A;  3TS0 A;  2H5X A;  5JJI A;  1CSQ A;  3HOZ H;  1PVO A;  4GOP A;  4B3M Q;  3NEN A;  4B3M L;  2NN6 G;  3PV0 A;  4IOA A;  2KEN A;  3CCR A;  1W3S A;  1CKO A;  4C2M H;  4YWM A;  4A93 G;  4B3T Q;  3A0J A;  4JI6 L;  3DLL A;  2VZA A;  4H02 A;  1FGU A;  2JE6 I;  4DV3 Q;  1FJG Q;  4LNQ A;  1FJG L;  2DGY A;  1PFS A;  4A75 A;  1M90 C;  1E24 A;  2JA6 G;  3S16 H;  1WOC A;  2R7F A;  1GVP A;  5C3E G;  1XMO L;  4LUZ A;  2JA7 H;  3PGZ A;  3U58 A;  1HNX L;  4OX9 Q;  1VQN A;  3HOY G;  2HT1 A;  5IP9 H;  1EFW A;  3HOX G;  1NE3 A;  4JI5 Q;  4HJ9 A;  2EIF A;  2R93 G;  1A8V A;  2RCN A;  1TXY A;  1SR3 A;  4GOP B;  2B63 G;  3F2D A;  4DR5 L;  1SRU A;  3PUV A;  4DUY L;  4PZ8 A;  1O7I A;  1FL0 A;  3S17 H;  1YVC A;  3S1N H;  4Y7N H;  2UU9 Q;  4A93 H;  1YBY A;  2ZTD A;  3PF4 A;  3OW2 A;  4GN3 B;  4YCW A;  1V1Q A;  2OQK A;  5IP7 G;  4PZ7 A;  4HID A;  3ICE A;  2JEA I;  1SMX A;  1EYG A;  1XPR A;  5C3E H;  4A3E G;  4O0A A;  5BR8 Q;  4A3J G;  1LM0 A;  4MTN A;  1JB7 A;  2R7D A;  2CWA A;  1X54 A;  2N49 A;  3STB D;  2FXQ A;  1GO3 E;  3H15 A;  1IBM Q;  3HOY H;  4JOI C;  4DR3 Q;  1HZA A;  2N8N A;  2RHQ B;  4DR3 L;  2ATW A;  2ZJQ A;  4UP7 A;  4LUO A;  3UDI A;  4A3B G;  4P75 A;  1GKH A;  4UY8 C;  3I55 A;  1P8L A;  3UDG A;  1Z9F A;  1KRT A;  1PH7 A;  2I5M X;  5LMN Q;  1S72 A;  2K50 A;  3PUW A;  3DM3 A;  1KAW A;  1Q46 A;  3PO2 H;  1K83 H;  3CPW A;  3K8A A;  2IX0 A;  4L5Q A;  4A3E H;  4A3J H;  3T1H L;  3W5O A;  2B29 A;  1L0W A;  2JA8 G;  4UP8 A;  3HKZ G;  3KJP A;  2Q2H A;  2EQS A;  2LXK A;  2DUD A;  4GKJ Q;  4X66 L;  1OXS C;  3PUZ A;  2IY5 B;  1PH8 A;  3U50 C;  4DV0 L;  2AWO A;  4HJ8 A;  4DNI A;  1XPO A;  4NXN Q;  4NXN L;  4A3F H;  1V9P A;  3CP0 A;  5IYB H;  2JEB I;  4DR4 L;  1X3F A;  2CKZ B;  2AMC B;  2YTY A;  4JI2 Q;  4JI2 L;  2F4V Q;  2HHH Q;  5C44 G;  1OXV A;  4RG1 A;  3ZJY C;  2Q2I A;  3VDY A;  3JAM c;  3OTO L;  1N33 Q;  2HIX A;  4GN5 A;  1N33 L;  1KC8 C;  4HIM A;  2JA8 H;  2UXC Q;  4R4Q A;  3UE0 A;  4YY3 L;  4JI4 L;  1AE2 A;  2RHS B;  4GS3 A;  4AYB G;  4RMF A;  4X65 Q;  1I6H H;  3PUY A;  3S14 H;  3E0E A;  3GDE A;  1KIX A;  4BXX G;  1WYD A;  2VY3 A;  3M4P A;  3CPF A;  2WB1 G;  1G51 A;  2MO0 A;  2N78 A;  3JAM i;  4DV6 Q;  3G71 A;  5IYC H;  2HIV A;  1CUK A;  5C44 H;  3KF6 A;  1VQ7 A;  4A3G G;  2XTI A;  1YHQ A;  4HIO A;  1Z47 A;  1G29 1;  4DR6 Q;  4QGU A;  4X6A H;  3M85 A;  1VQM A;  4PG3 A;  1VQF A;  2K5N A;  4DR6 L;  1NY4 A;  1LYL A;  3I2Z A;  1XMQ L;  4MNO A;  3F2C A;  4JI3 Q;  4BBS G;  1TWF H;  1Y1W H;  4MZ9 A;  2R7Z G;  2MNA A;  1VQP A;  1XNQ L;  2BA1 A;  5FLM G;  4BXX H;  1K3R A;  4IPC A;  1GM5 A;  2NVY H;  5K36 G;  1N36 Q;  1NTG A;  4IPG A;  4PZ6 A;  3KF6 B;  1Q7Y C;  2VS1 A;  3T1Y L;  4A3G H;  1EWI A;  3RLO A;  4GNX C;  1FVI A;  3PF5 A;  5JJK A;  5IYD G;  2ZM6 L;  1KL9 A;  1VQ4 A;  3SGI A;  4LFC L;  3KOJ A;  4B3R Q;  4B3R L;  1CKN B;  1B8A A;  3OYY A;  2NVX H;  4BBS H;  1YHB A;  4POF A;  2VQE Q;  4LF8 Q;  4O2D A;  1Q82 C;  2UUC L;  2R7Z H;  3LGJ A;  3PSI A;  2JJQ A;  3ULL A;  3GTQ H;  4BA2 I;  3K81 C;  4EX5 A;  4DR7 Q;  4AIM A;  5FLM H;  4DR7 L;  1KXL A;  4A3K H;  4DUZ L;  4DR1 Q;  4LFB L;  1IBK Q;  2UXB L;  4QJF A;  1HR0 Q;  1QVG A;  1KRS A;  3PCO B;  1XNR Q;  1VQK A;  1X3G A;  1EQR A;  5DLQ E;  3U4V A;  5HY6 A;  2B3G A;  3AYH B;  4GN4 B;  1E1T A;  1QVC A;  3HFZ B;  1QUQ A;  2QA4 A;  2PI2 A;  2VW9 A;  1H95 A;  5FJ8 G;  2PMZ E;  1L1O C;  1UEB A;  1EUJ A;  2JQO A;  4IOC A;  5GRO A;  4JI6 Q;  2ZJP A;  2Z6K A;  4DKA C;  1VQ6 A;  3BU2 A;  2YU9 H;  2PNH A;  3M4Q A;  2AKW B;  2JK8 A;  4A3M G;  4L5S A;  1IZ6 A;  1XMO Q;  3PO3 G;  3IRB A;  1BBW A;  4AQY L;  1HNX Q;  1PH9 A;  2YTV A;  4GLV B;  4QIW E;  4LWC A;  5LMN W;  2WAQ G;  2E5L L;  4APV A;  1IL2 A;  5HGQ A;  5JJL A;  1P16 A;  3F1Z A;  1QUQ B;  2K75 A;  2Y0S E;  4DR5 Q;  4IJL A;  5FJ8 H;  4DUY Q;  1W2B A;  3AFQ A;  1VQJ A;  1WI5 A;  1PHJ A;  1PH6 A;  4K0K L;  2CQO A;  4C3H H;  2JA5 G;  4B3S Q;  5C4J H;  4B3S L;  3D0F A;  2ALY B;  4IJH A;  4A3M H;  5JEA G;  2ZJR A;  4LF4 L;  2JA6 H;  1BBU A;  1X56 A;  3PO3 H;  2MO1 A;  4LF9 L;  3J80 i;  5C0X G;  4DV7 L;  4FDB A;  1I94 L;  4DV4 Q;  4DV4 L;  3HOX H;  2NN6 I;  2KHJ A;  3TRE A;  1PA6 A;  2R93 H;  2ZTE A;  3CQZ H;  2B63 H;  1UE7 A;  1VCI A;  2CCZ A;  1HZ9 A;  4JBJ A;  2LSS A;  1RIP A;  2OCE A;  3HOU G;  4JI0 Q;  4JI0 L;  1N32 Q;  1VQ5 A;  2E2J H;  1N32 L;  5IP7 H;  1PH4 A;  5ELO A;  1K0R A;  4OWW B;  3CCQ A;  3I56 A;  4JOI A;  3T1H Q;  2UXD Q;  3E9H A;  2UXD L;  2K5H A;  2WP8 J;  3AQQ A;  4OO1 I;  2LXJ A;  5AJ3 Q;  2AHO B;  2MQH A;  5AJ3 L;  2I0Q A;  4JI1 L;  4X66 Q;  3GO5 A;  3NEM A;  4DV0 Q;  1HNZ L;  4OON A;  2WB1 E;  3GTJ H;  3CXC A;  3CCU A;  4X62 Q;  4A3B H;  1YNX A;  3HKS A;  1A62 A;  5JEA J;  1E1O A;  2K52 A;  4X62 L;  4GLX A;  3RN5 A;  4DR2 Q;  4DR2 L;  3S1M H;  4DR4 Q;  1Y1V G;  4NPS A;  3BZC A;  4JI8 L;  3HOU H;  3RLN A;  2K5V A;  3HOV G;  1X6O A;  2GN5 A;  5C0X J;  3GTG H;  1NMG A;  2AWN A;  3HOW G;  4JI7 L;  3FP9 A;  1JJ2 A;  4LF6 Q;  3TQY A;  4LF6 L;  3ERS X;  3J81 j;  4KHZ A;  2KCM A;  1PV4 A;  4IFD I;  4TVA B;  3OTO Q;  1I5F A;  1IBL Q;  1C9O A;  3AFP A;  4JBW A;  1IBL L;  3UDX A;  4IPH A;  4YY3 Q;  4JYA Q;  4JI4 Q;  4JYA L;  3FKI G;  3EIV A;  1Q81 C;  4JV5 L;  1VS0 A;  4IO9 A;  3KYH C;  2F52 A;  3KDF A;  1Y1V H; 
#chains in the Genus database with same CATH topology
 1WTW A;  2L5T A;  3GTP H;  5EGT A;  1GXD C;  4KJO A;  4FXK C;  3GTK B;  2VNU D;  4XQJ A;  5KGU A;  5ELE A;  4F87 A;  4HIK A;  1GD7 A;  4HJA A;  3AU7 A;  1J9O A;  3H91 A;  5HUR A;  3NEL A;  4NXM L;  4RHS A;  2HD3 A;  2R6G A;  4C3I H;  5BN3 A;  3A5U A;  1YIJ A;  4BY1 G;  3WWV A;  2QKI C;  4IPD A;  3CC7 A;  4GKK Q;  1CZG A;  1HTL D;  4C3J B;  1DJR D;  1K8M A;  4BBR H;  2A5H A;  3A7L A;  1D2B A;  2PQA B;  1UNS A;  1YHA A;  3I4N H;  1H9M A;  2XRQ D;  4DUZ Q;  1QVF A;  4GNX A;  3J80 L;  4LF5 L;  1YJ9 A;  1LTG D;  3H3V H;  1J8I A;  2QGQ A;  2EZV A;  4ZQ3 A;  3NWS A;  2F0W A;  2XGT A;  2ZTC A;  1J6Q A;  2A68 D;  4R4I A;  2I5L X;  4OEL B;  2JA7 G;  5CYU A;  1AE3 A;  3AEV A;  2XRS D;  5GAD C;  1VQD A;  1J5E L;  3J80 c;  2EJF C;  1Q1E A;  2HQE A;  4A3I H;  4ILW A;  3MWY W;  1EQQ A;  1SYB A;  1T5E A;  4DAY A;  3HG9 A;  1V1P A;  1S5F D;  1XJV A;  4LF4 Q;  5C4X G;  1E2V A;  3H09 A;  3PMF A;  1LTT D;  1NBW A;  2OF1 A;  4LMQ D;  4YWK A;  3M4O H;  1K9M C;  2IHE A;  2K05 A;  2LFN A;  2OTJ A;  4DXF A;  3BVZ A;  4ME3 A;  3WOF A;  4KKT A;  1H9S B;  2NZ1 D;  1TWG B;  5JEA H;  2EE1 A;  1VQG A;  2KUM A;  3PIO A;  5J3B A;  3W1G A;  3S1Q H;  1FR3 A;  4R1J A;  5I2Y A;  4OXP A;  4K0K Q;  1NAP A;  1HNZ Q;  3OSO A;  5M5W H;  1SNM A;  2CWP A;  4XDX A;  4IFD G;  1BDO A;  4G7O C;  1KQS A;  3RUZ A;  3VR4 A;  1F9R A;  2SEB D;  3L9A X;  2PPB C;  4DV2 Q;  4R4T A;  4JI7 Q;  3MTS A;  4JPB W;  1KAA A;  1Q8K A;  5C0X I;  2Y0S G;  2RCF A;  1YJN A;  2ZXP A;  1JOQ A;  1N8R C;  3ER0 A;  2NVT B;  1I4P A;  4RGM A;  2R61 A;  1TS3 A;  2D9U A;  1EZ6 A;  1U4M A;  1L0Y B;  5GAE C;  3OPO A;  4A4I A;  1SE4 A;  4KV6 A;  1EWC A;  2GVB A;  4I7A A;  4LFA Q;  2VUM B;  3S15 B;  3VYS A;  1SYC A;  2HHH L;  2Q8R E;  3KK7 A;  3HOZ B;  2A19 A;  1EWH A;  4DK6 C;  1QJO A;  1PYS B;  2OEO A;  2KBN A;  2D5D A;  1Q90 A;  1ASZ A;  1AEX A;  1HH2 P;  1R4Q B;  3F2B A;  3CMA A;  3U4Z A;  2F0L A;  1Y8N B;  1A0I A;  4LW1 A;  3EBE A;  1JJG A;  2V1C C;  4MIU A;  4LF7 Q;  3M4Y A;  1H9R A;  3KLW A;  3BJU A;  3UI2 A;  4F7X A;  3MAQ A;  5M3M G;  2XIW A;  1SJE D;  1HUM A;  4GLA C;  4N9P A;  2BDO A;  1G8Z D;  4Y52 H;  3EFX D;  1CKM A;  1E22 A;  4DK3 C;  4QB4 A;  2KOL A;  3I4M G;  3W1B A;  2F0F A;  4A3K G;  5J22 A;  3CCL A;  4JG2 A;  1JOK A;  1I50 H;  2YV5 A;  2Z8L A;  5EKK A;  1N36 L;  3N6R A;  1DYQ A;  1F2Y A;  1MJE A;  1HNW Q;  2OT2 A;  5CV5 A;  1VQE A;  1ASY A;  1EEF D;  2EYH A;  1IYV A;  2F0G A;  3IKJ A;  1HQR D;  3M7G A;  3BVG A;  4HSP A;  2E75 C;  2O5I C;  4LF8 L;  3SHL A;  1EY9 A;  3K0Y A;  4A3J B;  3A8I E;  5CBA E;  3RZD H;  3DHQ A;  2I5H A;  2NZO A;  3KJO A;  1AFP A;  2OXP A;  2E8G A;  1XNR L;  4IN3 A;  1LUZ A;  2B2W C;  1U4L A;  1PFM A;  1HPC A;  2WAC A;  4GOP A;  4IOA A;  4B3M L;  1SMY D;  2NN6 G;  4K14 A;  3H94 A;  1W3S A;  1CKO A;  4C2M H;  3CCR A;  1H9S A;  4B3T Q;  4A93 G;  4JI6 L;  3DLL A;  1F9P A;  4DV3 Q;  1W6J A;  2F0K A;  1FJG L;  5JVH 3;  1NNX A;  2JA7 H;  3HKZ B;  1A2U A;  4LUZ A;  4DNR B;  4DA2 A;  4OX9 Q;  2IL8 A;  2HT1 A;  3P20 A;  3R3O A;  5IP9 H;  4FXG C;  3S14 B;  3HOX G;  4JI5 Q;  2G9H D;  4RGT A;  1GJX A;  1TXY A;  3TN2 A;  2B63 G;  3F2D A;  3GQB A;  3PUV A;  1O7I A;  1HQM C;  1B3A A;  4L8J A;  3OW2 A;  4GN3 B;  4YCW A;  4HID A;  2F0V A;  3G6J B;  1SMX A;  1EYG A;  4LK1 C;  1KDC A;  3EA6 A;  1F9Q A;  1I4G A;  1IBM Q;  3HOY H;  1Y1W B;  5EJW A;  1HZA A;  4ID6 A;  2VB2 X;  4UP7 A;  3SK6 A;  1WTH A;  4N8F A;  2NVY B;  1VDZ A;  4UY8 C;  1PH7 A;  2I5M X;  1H9K A;  3PUW A;  1KAW A;  1GUO A;  1Q46 A;  1LAC A;  1EY5 A;  1CFM A;  3W5O A;  4HAE A;  2JA8 G;  1PTO B;  4IFD H;  1YNJ C;  2K04 A;  1PH8 A;  3FPU B;  3C46 A;  2CW0 C;  2VXW A;  1SYF A;  2AMC B;  2JYO A;  2F4V Q;  1EOT A;  5JPN C;  3P75 A;  1IW7 C;  1OXV A;  1KNE A;  4RG1 A;  4R9W A;  3JAM c;  3OTO L;  4GN5 A;  1N33 L;  2A6H D;  2A6E C;  4R4Q A;  3UE0 A;  1YNN C;  1AE2 A;  4AYB G;  4WRD A;  2F0D A;  4RMF A;  1G2S A;  1I6H H;  3PUY A;  2VY3 A;  3U9O A;  4K5X A;  2WB1 G;  2MO0 A;  4DV6 Q;  3G71 A;  1CUK A;  1I4H A;  1VQ7 A;  1SDF A;  4O1N A;  1YHQ A;  4FF1 A;  1NY4 A;  1LYL A;  3OOC A;  2J4X A;  1AP0 A;  5J1Z A;  2Z6B A;  2LS0 1;  3NTI A;  5FLM G;  3I3C A;  1GUS A;  2SNM A;  3I73 A;  1CI3 M;  2WAQ B;  3CQZ B;  3KF6 B;  4A3G H;  1BR9 A;  4GNX C;  1FVI A;  1PYW D;  5JJK A;  1VQ4 A;  1UAP A;  5C4Z A;  4B3R L;  1CKN B;  2NVX H;  4BBS H;  3WOE A;  2VQE Q;  1LLR D;  2R7Z H;  3PSI A;  1Y8O B;  3GTQ H;  4BA2 I;  2ICI A;  3K81 C;  4EX5 A;  4AIM A;  4A3K H;  1JE4 A;  4LFB L;  3PCO B;  1VQK A;  1X3G A;  4A3B B;  4PQX A;  3A8J E;  5CV7 A;  5HY6 A;  3S1M B;  1E1T A;  1I4Q A;  1QVC A;  2RKS A;  1GOZ A;  5FJ8 G;  4H13 C;  4CJ2 C;  1QB5 D;  1EUJ A;  4J8Q A;  3M4Q A;  2AKW B;  2RBM A;  2E74 C;  4CBV A;  1XMO Q;  3C1F A;  3PO3 G;  1HNX Q;  1PTO H;  3E5S A;  4CDC C;  5FO8 B;  2F3V A;  3PIP 3;  1SJH D;  3TP5 A;  3SE0 A;  3F1Z A;  3A7A B;  1O7Y A;  4PMC A;  4DR5 Q;  2F0U A;  4TSS A;  4DUY Q;  1FNV A;  2E2I B;  1ONL A;  2KJX A;  4L6T B;  5NUC A;  2JA5 G;  1RKN A;  1CHQ D;  4B3S Q;  4UDU C;  4HMI A;  3IAY A;  4LF9 L;  1QNK A;  1SYG A;  4DV7 L;  4FDB A;  4DV4 L;  3FRP B;  3HOX H;  2F0E A;  4DF7 A;  2B63 H;  1UE7 A;  2LMC B;  4JBJ A;  1TS2 A;  1PZK D;  2OCE A;  2Z1C A;  1SEB D;  1KAB A;  2ZXR A;  1N32 L;  2ENB A;  2I07 B;  3RD4 A;  3CCQ A;  4XT1 B;  3E9H A;  4KTA A;  3K6O A;  3OIP A;  2LXJ A;  1A3T A;  5C0X H;  2P5Z X;  2NTS A;  4DV0 Q;  4C56 C;  3NE5 B;  2X69 A;  3RN5 A;  2K52 A;  4GLX A;  4DR2 Q;  3D3R A;  1BOS A;  4DR4 Q;  1Y1V G;  1G6Z A;  3ZYY X;  3HOU H;  3RLN A;  2Q8T A;  5C0X J;  1NMG A;  4MHE A;  4B08 A;  4BY1 B;  2RVL A;  1SE2 A;  2WV6 D;  2BOS A;  1WD0 A;  3R93 A;  4LF6 Q;  3J81 j;  1ZKO A;  3J80 E;  1C9O A;  1LTR D;  1ZYR C;  4YY3 Q;  4JYA L;  3R2I A;  1RHP A;  1I4R A;  1TWC B;  1IHZ A;  1VS0 A;  3HGB A;  3KYH C;  2F52 A;  3L3O C;  2FHT A;  4G7Z C;  4QL5 A;  1U4R A;  1PDQ A;  2MGS A;  1CQF A;  1JOO A;  3NHH A;  3C3L A;  2H1E A;  5KRU A;  4KK7 A;  4NMZ A;  4M1U B;  4ODG A;  1NR4 A;  3ULJ A;  5LMU L;  2F0O A;  3TRZ A;  3TME A;  4BBR G;  1ESF A;  4YCV A;  4PMB A;  1CKN A;  1MSH A;  1SBB B;  1EY7 A;  3KDF B;  2K5Q A;  2IHF A;  2Q2T A;  4JBK A;  1XNQ Q;  2IJ0 A;  4R4O A;  2D2C C;  2NZH A;  3I4N G;  1EIF A;  3KFU A;  2RF4 A;  2R92 H;  2F0T A;  1R9T H;  5IGE A;  2A73 B;  5EAY A;  1RDP D;  5M5Y H;  4Q5V A;  2CH4 A;  3T1Y Q;  1H9J A;  1Y14 B;  2ZM6 Q;  3M9B A;  4KHP L;  3GTL H;  4LFC Q;  3VR3 A;  3S2D B;  4X3S A;  3F2U A;  3CCE A;  2KED A;  5C4X B;  1ENC A;  3L7Z C;  1ESR A;  1IKL A;  1EU4 A;  1M4V A;  2EVB A;  4A76 A;  3QR8 A;  1S5C D;  1X65 A;  4HTH A;  4P72 A;  4Q0F A;  5E4W C;  3J81 L;  3P7J A;  2OWO A;  4A3I G;  4OL7 A;  1TWA B;  1VMC A;  1X32 A;  1XX8 A;  2BE5 D;  3ND9 A;  4RAU C;  1NR2 A;  2EXD A;  1KHI A;  2PW5 A;  4GOP C;  1C4Q A;  2IW3 A;  4YHH L;  1I4X A;  1KDA A;  4A3L H;  2VQF L;  4AQY Q;  4EQ5 A;  2Q8I B;  2QEX A;  4GNX B;  1X55 A;  4L5R C;  1JT8 A;  1JE5 A;  2E5L Q;  2HQL A;  5KIX A;  1EY0 A;  3HOV B;  3FVQ A;  1DXM A;  3HOW B;  3J81 c;  3E9I A;  1N34 L;  3M3Y B;  1UE6 A;  1TWH B;  4EGV A;  4KJN A;  1HA5 A;  1Q8I A;  3FKI B;  3CCJ A;  1U9R A;  4FP5 D;  2J7Z A;  1ENA A;  2PI2 E;  1XXG A;  4HSV A;  1B44 D;  3VYR A;  2WKD A;  4DAY B;  1V43 A;  1Q1B A;  2IT1 A;  2K01 A;  3GTO B;  2JA5 H;  1KD1 C;  4IUU A;  3PO2 G;  1T5X D;  1DOL A;  5FO9 B;  1PH3 A;  4AH6 A;  5BR8 L;  1NJI C;  4JI1 Q;  4ABN A;  1UE5 A;  4OWT B;  3H0G B;  2L0C A;  1BF4 A;  4OO1 H;  1R4P B;  1UEA B;  4A3F G;  3GV6 A;  4XXE A;  1B1Z A;  1QG7 A;  2F3I A;  3NUC A;  3A74 A;  4LAA A;  5JVG 3;  5LMN L;  1QZG A;  3I72 A;  1VQO A;  4L63 B;  3NBH A;  2MP1 A;  1PZJ D;  1E3P A;  1CK1 A;  3CHB D;  4BY7 H;  1D8L A;  1SE8 A;  2KQ3 A;  3A8K E;  3I4M B;  3LNN A;  4IUP A;  4UHV A;  1YJW A;  1CA6 A;  4M8A A;  5HGT A;  2B8G A;  2BCO A;  1D6E C;  5M3F H;  1G6P A;  2HCI A;  1HCZ A;  2ICE C;  2MFI A;  3K80 C;  3S1R H;  5IY0 A;  1EYD A;  1X3P A;  4H44 C;  3S2H H;  2FIN B;  2KVM A;  4N9T A;  3T13 A;  3I4O A;  5EBD A;  1UE1 A;  4ZKC B;  5J39 A;  2N55 A;  4X64 Q;  5IOC A;  3SVM A;  3CRK C;  1C48 A;  2CHB D;  1LTA D;  4K6L A;  4DGZ A;  5FLX L;  1A2T A;  1SLJ A;  4P71 A;  3S17 B;  2PZW A;  1SNC A;  1EZ8 A;  1TR5 A;  3CW2 C;  2ID0 A;  5C6A A;  4QY7 A;  2NTT A;  4UP9 A;  1WVL A;  5I6Y A;  2JA9 A;  1RL2 A;  3K7A H;  5FK9 C;  1Y69 U;  5ELN A;  2UUA Q;  3CC2 A;  4DV5 L;  1DOK A;  1DOM A;  3GTM H;  2D0O A;  2KHI A;  3QG1 A;  1TY0 A;  5FLX c;  5EPK A;  1CA5 A;  1IKM A;  5CV6 A;  1Q12 A;  3CRL C;  4HJ5 A;  3FHW A;  4NB3 A;  5IWA Q;  2F0I A;  1K83 B;  1PH2 A;  1HA6 A;  2X6G A;  2PMZ B;  3D31 A;  4JCV E;  1ET9 A;  3JAM E;  1TQO A;  3W2D A;  1IBK L;  3CKI B;  1HR0 L;  2ES2 A;  2NB0 A;  5IP9 G;  2B8F A;  2KCN A;  4FO2 A;  2QEJ C;  4L5T A;  3TS0 A;  1PVO A;  4B3M Q;  2KEN A;  4U68 A;  2DNC A;  2VZA A;  4H02 A;  1FJG Q;  4LNQ A;  2DGY A;  3S16 H;  1D1I A;  2JA8 B;  1CZW A;  1WOC A;  2R7F A;  3MVV A;  3U58 A;  2WKC A;  3V96 A;  3HOY G;  1MHW C;  1NE3 A;  2EIF A;  1X3Q A;  4RHR A;  1A8V A;  2RCN A;  3K59 A;  4GOP B;  4R8I A;  1Y8P B;  2XN9 C;  3S1N H;  1DM0 B;  1K8O A;  2UU9 Q;  3PF4 A;  1BCP D;  3ERQ A;  5IP7 G;  4PZ7 A;  1XPR A;  5C3E H;  4O0A A;  5EQ0 A;  3G7L A;  4MTN A;  4AYB B;  2R7D A;  3SDZ A;  3STB D;  3H3V C;  2FXQ A;  1GO3 E;  4IQZ A;  2ATW A;  3TBI B;  5A35 A;  2ZJQ A;  4K5V A;  2A69 C;  4OIK A;  3I55 A;  3UDG A;  5LHY 1;  2WB1 B;  1F2M A;  1TII D;  2F0H A;  3PO2 H;  1A6X A;  2IX0 A;  4L5Q A;  4CDE C;  3D4D A;  4A3E H;  2B29 A;  4ULL A;  1BQQ T;  4CKE A;  5FO7 B;  3KJP A;  1RJT A;  2EQS A;  2B2Y A;  5M5X B;  4GKJ Q;  4X66 L;  3U50 C;  1XPO A;  4A3F H;  1V9P A;  1TS5 A;  5LL6 S;  1STN A;  1KDB A;  3T53 B;  5CC4 A;  2YTY A;  1WCM B;  1KLG D;  3ZJY C;  2PZU A;  1N33 Q;  2UXC Q;  4KKS A;  1PFN A;  1FD7 D;  2RHS B;  4CDD C;  4OGQ C;  4X65 Q;  1MSG A;  1WYD A;  1BXT A;  3QIA A;  3M4P A;  4QCL A;  4HN7 A;  1G51 A;  3JAM i;  5C44 H;  2F3W A;  2RDF A;  4A3G G;  4HIO A;  4X6A H;  3M85 A;  1VQM A;  4PG3 A;  2K5N A;  3I8Z A;  3I2Z A;  2KEC A;  4BBS G;  1IYU A;  3F2C A;  4V0B A;  4JI3 Q;  2JA6 B;  1TWF H;  2R7Z G;  4MZ9 A;  3PO3 B;  2MNA A;  4C1N K;  3W3A A;  2BA1 A;  5I9P A;  4IPC A;  1GM5 A;  1IW7 D;  1K3B C;  5K36 G;  2A68 C;  2R93 B;  4IPG A;  4PZ6 A;  3MA2 B;  2PYK A;  5ELD A;  3PF5 A;  5IYD G;  3SGI A;  3KOJ A;  4B3R Q;  4WJW A;  1B8A A;  3OYY A;  2E2J B;  1HXY D;  1Q82 C;  1NSN S;  3ULL A;  3PIO 3;  4XQN A;  4DR7 L;  3TDQ A;  4DUZ L;  4DR1 Q;  5I9O A;  1QVG A;  2NYZ D;  3HFZ B;  1QUQ A;  1MGS A;  2PMZ E;  2K03 A;  4DKA C;  1JR0 D;  2YU9 H;  1QWY A;  2JK8 A;  1PMR A;  4L5S A;  1IZ6 A;  1O7L A;  1O80 A;  3TP6 A;  4GLV B;  5LMN W;  5HGQ A;  2K75 A;  1LT6 D;  3GTP B;  2QIL A;  3AFQ A;  1VQJ A;  1PHJ A;  4C3H H;  1WTQ A;  4ZCK A;  5C4J H;  1EQV A;  2IPK D;  4JVZ A;  3HRZ C;  4LF4 L;  2NBF A;  3KLR A;  2DJG C;  1PXU A;  3D4W A;  3KUP A;  4BS9 A;  2PW7 A;  5C0X G;  4CJ0 B;  4DV4 Q;  2Z9H A;  2K7V A;  2XSC A;  1VCI A;  1LTB D;  3HOU G;  1RIP A;  4C3I B;  5ELF A;  4JI0 L;  1N32 Q;  5IP7 H;  3JAM L;  5ELO A;  1ZEQ X;  3T1H Q;  2O2L D;  4OO1 I;  2L55 A;  2AHO B;  5C4H A;  2FJ2 A;  3BZD B;  3GO5 A;  1HNZ L;  5K5P A;  4OON A;  1FYC A;  2WB1 E;  3GTJ H;  4IUQ A;  4X62 L;  4IZ8 A;  1A62 A;  4WOR A;  4NPS A;  1QE6 A;  1ILQ A;  2K5V A;  4X3T A;  1A3U A;  3GTG H;  4TRD A;  2SNS A;  4JI7 L;  1RTN A;  5G3L D;  3ERS X;  1PV4 A;  1I5F A;  1IBL L;  4JYA Q;  4JI4 Q;  3J81 E;  3EIV A;  1Q81 C;  3LWU A;  3I91 A;  3B6Y A;  1RF2 D;  1PTO D;  2EOT A;  2R92 G;  2EYO A;  1ROD A;  3DEO A;  3HOW H;  4RCN A;  5GQO A;  1TWH H;  2OQ0 A;  4A3I B;  3Q22 A;  5LMU Q;  4KY7 A;  4QMG A;  5C5M A;  3M7N A;  3FKI H;  1XMQ Q;  5CR3 A;  5FKA C;  2L15 A;  5IGB A;  1OXT A;  4A3M B;  2EDG A;  4J1M A;  1JWU D;  4X3U A;  5D3D A;  1ICF B;  4FF3 A;  1XYI A;  5CV9 A;  1ZXT A;  3M4O B;  3K5M A;  1Z7T A;  2DJF C;  1D7Q A;  1M1K C;  3RZO H;  3EQL C;  4LF7 L;  3CAM A;  2J0T D;  1ZYR D;  3S24 A;  5I2X A;  1RD9 D;  1OTC A;  1RCV D;  1I3Q H;  1WFQ A;  2Q2U A;  4A3C H;  4R4C A;  1OXX K;  2UUC Q;  1SN8 A;  1EY6 A;  3S1Q B;  4KI0 A;  4A3L G;  1VQA A;  2UXB Q;  5M5W B;  2KHS A;  1PRT D;  1B2T A;  5K36 H;  4A3D H;  1VQB A;  1EU3 A;  1BBX C;  4RFB A;  3I7F A;  3Q6S A;  1JJC B;  2L9H A;  5IYD H;  2K14 A;  4HMJ A;  3AMU A;  1L2F A;  3HP3 A;  3RN2 A;  4BWG B;  2TMP A;  4KY5 A;  3E6Z X;  5FOB B;  3SK8 A;  1S40 A;  2B2U A;  3MEH A;  1CTM A;  1ML0 D;  4KHV A;  4YWL A;  1L1O A;  3BZK A;  3X3N A;  4K6D A;  1QZH A;  3GTK H;  1LAB A;  4OWX B;  1E7Z A;  1N34 Q;  5E7N A;  2EY1 A;  1QOH A;  2YTX A;  1SFO B;  3HKZ E;  1XTC D;  2XVS A;  4DPG A;  4WJ3 M;  2A74 C;  1OXU A;  4B3T L;  4DV3 L;  3A5Z B;  3TSS A;  4IUR A;  1A15 A;  1EEI D;  4EVO A;  3ERO A;  1EFI D;  5IT9 c;  1I94 Q;  4OX9 L;  2RSO A;  3J81 i;  4RGN A;  4OO1 G;  4K2L A;  4JI5 L;  3PUX A;  3E3X A;  4TQU S;  4C3J H;  1BCP B;  3RMH A;  4BA1 I;  5A2Q L;  3SXH A;  5FLX E;  1JOR A;  3RLF A;  1L0X B;  2OTL A;  1IBM L;  4BY7 G;  2DN8 A;  2A6H C;  1VQH A;  3KLS X;  2IWH A;  4PMW A;  2WFW A;  2E2H B;  2B2Y C;  4JI8 Q;  3OHX C;  1I50 B;  3K5O A;  4YCU A;  4ZUI A;  2HUG A;  3DUZ A;  5IYB G;  1X3E A;  3GP7 A;  5M3F G;  1XPU A;  1VQI A;  1VQC A;  2L4N A;  4POG A;  4HCE A;  1C7Y A;  2CVR A;  3CF5 A;  5EPJ A;  2LKV A;  1WTV A;  5JJZ A;  4JV5 Q;  2QDL A;  3MXG A;  3RZD B;  4FYD A;  3RR5 A;  2MHV A;  1MIU A;  2F0S A;  3NP8 A;  4WJ4 A;  1U5K A;  3K0X A;  2F4V L;  5IYC G;  3D6W A;  2E2D C;  3NBH B;  5KEE A;  1IYJ B;  3UE1 A;  4C2M B;  3MFG A;  3EN2 A;  2UUB L;  3G48 A;  2QCP X;  3MEF A;  4UAI A;  1MJC A;  3BDC A;  4EQO A;  1TKW B;  1Y1W G;  3RNU A;  2JA7 B;  4NXM Q;  3EJI A;  1U0L A;  5GAG C;  3OIQ A;  1HZC A;  2JN4 A;  3V2T A;  4DV6 L;  1IXR A;  2Z4I A;  1TWG H;  5T1G A;  2K4K A;  1B70 B;  1E2Z A;  4V19 0;  1LO5 D;  5IE8 A;  1JMC A;  1HFG A;  1JQY D;  2WAQ E;  3MXN B;  3ITP A;  4DV5 Q;  2NVQ B;  4I7Z C;  4LF5 Q;  1BCP F;  1GUT A;  4JW0 A;  5KYI A;  2EY6 A;  1PZI D;  4N8X 1;  5I6W A;  2K1B A;  3ND8 A;  4DV1 L;  4FF4 A;  1N9W A;  4QQB X;  2NVT H;  1EOV A;  4P74 A;  1K8A C;  5M5X H;  2VQE L;  3QJY A;  1SRO A;  2C35 B;  4F88 A;  3G6E A;  1B3Q A;  2N3S A;  2D0P A;  2K32 A;  1WJJ A;  2F0J A;  3J7A F;  1J5E Q;  1STG A;  2VUM H;  3S15 H;  1HJP A;  4ZRZ A;  2FMC A;  1WCM H;  2GVA A;  3HOZ H;  1DD2 A;  3NEN A;  3IL8 A;  3PV0 A;  3V05 A;  4YWM A;  3A0J A;  1KLU D;  2Y0S B;  1PFS A;  3T51 B;  1M90 C;  1Z6H A;  1XMO L;  1GVP A;  5C3E G;  1HNX L;  2RDG A;  1B50 A;  4EQN A;  1HUN A;  5DM6 3;  1EFW A;  1B53 A;  2V4D A;  2K33 A;  4CHT B;  4YIJ A;  4DR5 L;  1ENF A;  1SRU A;  4OEM B;  4DUY L;  1FL0 A;  1YVC A;  2TSS A;  1C8C A;  3SR1 A;  4IUV A;  1CT1 D;  3NTK A;  3O13 A;  2OQK A;  3ICE A;  3R2T A;  1MI2 A;  1S5E D;  4A3E G;  4ME5 A;  5KND A;  1DON A;  2N49 A;  3H15 A;  4DR3 L;  2N8N A;  2RHQ B;  4MN3 A;  3UDI A;  4A3B G;  4P75 A;  1GUN A;  1GKH A;  1P8L A;  5T1I A;  1KRT A;  2JXM B;  2AQ1 B;  1S72 A;  2K50 A;  5M3M B;  3DM3 A;  4A3G B;  3CPW A;  2ZT9 C;  4A3J H;  2EYP A;  2NVX B;  4BBS B;  5COY A;  2LXK A;  2DUD A;  2IY5 B;  1OXS C;  2R7Z B;  2QDB A;  4DV0 L;  2LY7 A;  2AWO A;  4HJ8 A;  3GTQ B;  4NXN L;  4A3K B;  1LTS D;  3CP0 A;  4DNT B;  2F0N A;  2JEB I;  5IYB H;  4DR4 L;  2I46 A;  1GUW A;  1FNW A;  1EYA A;  2B2V A;  3ONA B;  2DY8 A;  4JI2 L;  2HHH Q;  3R8B A;  5C44 G;  2Q2I A;  2HIX A;  2CQA A;  4YY3 L;  2QF7 A;  3NQT A;  3MXN A;  3S14 H;  4FXD A;  3E0E A;  2B2T A;  2K28 A;  4KD4 A;  1S5D D;  4WFN 3;  4DK1 A;  1SSO A;  2EJG C;  2EY2 A;  2N78 A;  4G57 A;  5IYC H;  2HIV A;  3QOJ A;  1Z47 A;  1O78 A;  4QGU A;  4Y7N B;  4DR6 L;  4A93 B;  5BN5 A;  3BYY B;  4F8M A;  1VF7 A;  5BN4 A;  1EY4 A;  4MNO A;  3TP7 A;  4CGY B;  1IL8 A;  1Y1W H;  1QNU A;  1XNQ L;  2BE5 C;  4BXX H;  1CQV A;  2NVY H;  5DM7 3;  3HOX B;  4KY6 A;  1TVX A;  1HFN A;  1N36 Q;  1NTG A;  2B63 B;  2VS1 A;  2F1M A;  3T1Y L;  4DAV A;  3RLO A;  5DNF A;  1E0B A;  2ZM6 L;  1KL9 A;  4KMU C;  4LFC L;  4LF8 Q;  4NW2 A;  4B9X A;  2JJQ A;  5C3X A;  4DR7 Q;  2FFK B;  1PRT B;  4K2K A;  1STB A;  4QJF A;  2KA7 A;  4H7B A;  1JWM D;  1XNR Q;  5DLQ E;  1EQR A;  4IUT A;  3U4V A;  2B2U C;  1SYE A;  4FNF A;  1GUG A;  2QA4 A;  3HOU B;  1H95 A;  1EYC A;  1L1O C;  2JQO A;  3J7Y W;  4C3H G;  5GRO A;  4JI6 Q;  4QUC A;  2Z6K A;  1VQ6 A;  1D5Z C;  3BU2 A;  2M9V A;  3IRB A;  4AQY L;  2C9O A;  1PH9 A;  2YTV A;  4LWC A;  1EIG A;  5G3L F;  2E5L L;  4APV A;  4I65 A;  1II3 A;  1QUQ B;  5D3I B;  2Y0S E;  5L37 A;  1W2B A;  2X6L A;  2AUK A;  1ILP A;  2CQO A;  1LT3 D;  3C1E A;  2ALY B;  4IJH A;  4A3M H;  2ZJR A;  3QO2 A;  5IGD A;  1PTO F;  3HS0 C;  2MO1 A;  3A55 A;  4B9W A;  4E6I A;  1EY8 A;  5IIF A;  2NN6 I;  2KHJ A;  1PA6 A;  2ZTE A;  3CQZ H;  2R92 B;  3VR2 A;  1R9T B;  5M5Y B;  4JI0 Q;  4DAP A;  1PH4 A;  4OWW B;  1K0R A;  2BDN A;  4JOI A;  3H6M A;  3GTL B;  2UXD L;  2WP8 J;  4LJZ C;  1F2L A;  2MQH A;  5AJ3 L;  1WTR A;  2I0Q A;  2O5J C;  4JI1 L;  2MJ8 A;  3NEM A;  3MFY A;  3D8G A;  4DFA A;  4GZY C;  3CCU A;  1UUP A;  2O4X A;  4X62 Q;  3HKS A;  4S3S A;  5JEA J;  4A3B H;  3C2P A;  1STE A;  1Q3L A;  3S1M H;  3BZC A;  3HOV G;  1X6O A;  2AWN A;  3HOW G;  3FP9 A;  3NTH A;  2XWJ B;  3TQY A;  3VR6 A;  4KHZ A;  2KCM A;  2K5W A;  4TVA B;  3OTO Q;  1IBL Q;  1PRT F;  1M8A A;  3A56 A;  3FKI G;  2XNA C;  3SEB A;  4IO9 A;  5E1F A;  2DNE A;  1NUC A;  1JCK B;  3BYT B;  3VYU A;  2E2I H;  1BKB A;  4RWS C;  1UWV A;  5IT9 E;  1T9H A;  1SFO H;  1LTI D;  1YNJ D;  5CMD A;  1G2T A;  3KBX A;  2Z0S A;  1WTO A;  1K73 C;  4A3C G;  3DXJ C;  5COR A;  1SNO A;  2PNR C;  4MTK A;  2CW0 D;  2PQA A;  4XIG S;  3URY A;  1VQ9 A;  1CSP A;  1EQT A;  3H0G G;  2PCF B;  1B9N A;  3X3M A;  4X64 L;  1EL0 A;  4A3D G;  3T56 B;  2MPM A;  1EIH A;  3GV3 A;  2A6E D;  5CBE E;  1MKH A;  1YNN D;  3J7Z C;  4GKK L;  1LT5 D;  1YI2 A;  5F2D A;  2JA5 B;  3Q23 A;  3MC0 B;  3NPP A;  5AFW A;  1JB3 A;  2PO4 A;  4CKB A;  1SXT A;  3I4L A;  4RKB A;  1B7Y B;  2UUA L;  4KN4 C;  4LFB Q;  2EYF A;  3ULP A;  1B9M A;  3CC4 A;  1YIT A;  2E2H H;  5A2Q E;  4JBM A;  1SNQ A;  4KLK A;  5C5L A;  3VA5 A;  3Q24 A;  3BVM A;  3F8T A;  4BY1 H;  2K5D A;  4OIJ A;  4JC0 A;  1D1K A;  3HZX A;  1YEZ A;  1JC7 A;  1GHK A;  4DN4 M;  2HCC A;  5IWA L;  3CD6 A;  1SNP A;  1TWC H;  3GD7 A;  4RH6 A;  4XTC S;  3KF8 B;  1HRJ A;  3NQI A;  1C0A A;  3DEP A;  4ALP A;  1PH5 A;  1BCP C;  3BDO A;  5GAH C;  1XTD A;  4BY7 B;  2QW7 A;  4DAM A;  3CCV A;  5M9O A;  3UDF A;  1Y1V B;  5IGG A;  4J15 A;  2R3Z A;  4XYQ A;  3STB C;  3CCM A;  5M3F B;  1YZ6 A;  3Q8D A;  3OMC A;  1U4P A;  4C3J G;  3HEJ A;  1V8Q A;  2SDF A;  2Z4H A;  4LF9 Q;  4PNY A;  3S1R B;  4DV7 Q;  2AQ3 B;  4XYO A;  4K8J A;  2WII B;  3S2H B;  1L1O B;  4EQP A;  1DGS A;  3D4R A;  2BA0 A;  4ZAI A;  3VYT A;  1SND A;  3L2P A;  4RGO S;  2UU9 L;  2EYL A;  3S2D H;  4AYB E;  3SK4 A;  3WDN A;  3NBI A;  5C4X H;  4XQQ A;  2D62 A;  4BBR B;  1STY A;  1V1O A;  2EYJ A;  1WD1 A;  5EPL A;  4K0K L;  2JP1 A;  4HJ7 A;  2NVQ H;  3K7A B;  3I4N B;  1OO9 B;  1A63 A;  2VL6 A;  2F0P A;  4LUV A;  3CME A;  1FGB D;  1ET6 A;  3BG3 A;  3GTM B;  1K0S A;  4IUN A;  3T16 A;  4KD3 A;  4DV2 L;  2F03 A;  1DZ1 A;  1HTP A;  1QCB D;  1TWA H;  4ZK9 B;  4UPA A;  1NMF A;  3MXP A;  3I70 A;  5TSS A;  1SE3 A;  2B2V C;  3TS2 A;  5DAU A;  3PIP A;  1B4O A;  4GKJ L;  1LTL A;  4P73 A;  4ZKB B;  4QF4 A;  5JPM C;  2FMM A;  3OWF A;  3FDT A;  1AW7 A;  3HOV H;  4LFA L;  5LL6 X;  4HED A;  1SYD A;  2SOB A;  3M3Y H;  3SK5 A;  2B2T C;  1SAP A;  2KCC A;  4IFD J;  3BDL A;  1VQL A;  4J6H A;  1BVS A;  3K5L A;  2EPB A;  4P2C B;  1EIY B;  5C3W A;  1BUV T;  1CM9 A;  1TU2 B;  1JIC A;  2UXC L;  2UUB Q;  1KNA A;  1HR0 W;  2IX1 A;  3FMC A;  3TP8 A;  3T4A C;  2C5C A;  2A1A A;  3S16 B;  3CU7 A;  4X65 L;  2HDM A;  5H1S E;  1W6K A;  3I90 A;  3TEH B;  4DXG A;  3GTO H;  1K8G A;  3J7A 5;  3S1N B;  4KHP Q;  2A8V A;  3KBG A;  2B39 A;  3G4S A;  2F4I A;  3NWT A;  2F0M A;  4JI3 L;  1SMY C;  3H0G H;  5C3E B;  3VR5 A;  3KF8 A;  2ZXO A;  5CV8 A;  2E76 C;  5JAV A;  1VQ8 A;  4CDF C;  2VUM G;  1PYB A;  1AH9 A;  3N52 A;  1F2Z A;  5M3M H;  5EKI A;  1WCM G;  1PH1 A;  1HNW L;  2KCT A;  3HOZ G;  2RSN A;  5CV4 A;  1X9N A;  1HZB A;  5IOD A;  3MZ5 A;  4DV1 Q;  3OWE B;  1A3V A;  2YYZ A;  4O42 A;  4G7H C;  3PO2 B;  2BH8 A;  3JC6 6;  3P1H A;  4A3E B;  3I4M H;  2CFM A;  4RKL A;  4YHH Q;  1GHJ A;  3K7U C;  2VQF Q;  3CCS A;  5IT9 L;  5KNB A;  2Z6K C;  1Q86 C;  3DWP A;  2N88 A;  4DR1 L;  3H3V I;  2CH4 W;  5IGF A;  1S3O A;  2K6A A;  4A3F B;  2ASB A;  2BH2 A;  3L0O A;  3DMU A;  5E4X A;  2H5X A;  4QIW B;  5DEH A;  5JJI A;  1CSQ A;  2G9D A;  1FGU A;  2JE6 I;  1O7Z A;  1BNZ A;  4A75 A;  3NXW A;  2PQE A;  4CKC A;  1E24 A;  2JA6 G;  2L1B A;  3MHB A;  4R8N A;  1QIL A;  3QOL A;  3PGZ A;  1VQN A;  5ELC A;  2EYM A;  2IX3 A;  4HJ9 A;  2R93 G;  1SR3 A;  4JK1 C;  2RA4 A;  2NN6 H;  4PZ8 A;  3S17 H;  4K8I A;  4Y7N H;  5EBC A;  1TY2 A;  1YBY A;  5C44 B;  4A93 H;  2ZTD A;  1BO0 A;  3D6C A;  1V1Q A;  2KEE A;  2JEA I;  4A3J G;  2EJM A;  5BR8 Q;  1AN8 A;  2H4O A;  3AB9 A;  1LM0 A;  1JB7 A;  2CWA A;  1X54 A;  4XT3 B;  2EXZ A;  1TWF B;  4JOI C;  5I4D A;  1XWE A;  4DR3 Q;  1NCV A;  2G5D A;  4H0L C;  4LUO A;  4QUF A;  4C1N I;  1Z9F A;  3VA7 A;  2VB3 X;  5LMN Q;  1PFB A;  3TZU A;  1PTO C;  2EY5 A;  1K83 H;  3K8A A;  3T1H L;  3FEW X;  3QWN A;  2HDL A;  1L0W A;  4UP8 A;  2M00 A;  3HKZ G;  2Q2H A;  4OHJ A;  1VMP A;  3PUZ A;  4DNI A;  4NXN Q;  4TKO B;  1ICW A;  3TZD A;  1X3F A;  2CKZ B;  3Q0A A;  3BS1 A;  4JI2 Q;  3VDY A;  3OMG A;  4G4K A;  4HIM A;  1KC8 C;  2JA8 H;  2DY7 A;  5KYL A;  2YU9 B;  4JI4 L;  5ISR A;  4GS3 A;  5D14 A;  3S9W A;  4DU9 A;  4PV1 C;  1MD2 D;  2AQ2 B;  3GDE A;  1KIX A;  4BXX G;  1HHV A;  3CPF A;  2RDH A;  4C3I G;  4RCO A;  1I6V C;  3KF6 A;  1PRT C;  3OW7 A;  2XTI A;  4KKU A;  4KN7 C;  4X3K A;  1F77 A;  1G29 1;  4DR6 Q;  4C3H B;  1VQF A;  1S5B D;  5C4J B;  1XMQ L;  1E2W A;  3FPP A;  1VQP A;  1K3R A;  3HOY B;  3K57 A;  1D5M C;  2WIN B;  2NWG A;  4NP5 A;  5EKL A;  1Q7Y C;  5KNC A;  5JOB A;  1EWI A;  1LT4 D;  4HR7 B;  1MBY A;  1FNU A;  3E0J A;  2JSO A;  1YHB A;  3LWE A;  4POF A;  1AZP A;  4O2D A;  3K58 A;  2UUC L;  1STA A;  3NK9 A;  1RTO A;  3LGJ A;  3U9S A;  1F9S A;  2F0Q A;  5FLM H;  1KXL A;  1KTK A;  1IBK Q;  2UXB L;  1HR0 Q;  1LV9 A;  1KRS A;  3GTJ B;  5CGK A;  3EVQ A;  4ZLT F;  5IGC A;  2B3G A;  3AYH B;  4GN4 B;  2PI2 A;  4CJ1 B;  2VW9 A;  3GTG B;  3A54 A;  1UEB A;  4HCS A;  4IOC A;  2ZJP A;  2PNH A;  1D5X C;  4A3M G;  1BBW A;  2L12 A;  2B2W A;  1JWS D;  1WTP A;  4QIW E;  1I6H B;  2WAQ G;  1IL2 A;  5JJL A;  1P16 A;  2RQX A;  4IJL A;  5FJ8 H;  1TS4 A;  1WI5 A;  3DWQ A;  1PH6 A;  4B3S L;  5D65 A;  3D0F A;  5E3F A;  5JEA G;  2JA6 H;  1BBU A;  1X56 A;  3PO3 H;  4ZYS A;  3J80 i;  1I94 L;  3K5N A;  2L11 A;  3TRE A;  2R93 H;  2CCZ A;  1HZ9 A;  4FVM A;  3RZO B;  2LSS A;  1G91 A;  1V1P B;  2MUY A;  4K5W A;  4ZUJ A;  2XWB B;  4NKL A;  4Z9C B;  1VQ5 A;  2E2J H;  1TT2 A;  1I3Q B;  3J7A V;  3NSW A;  3QB3 A;  3I56 A;  1S4Z A;  3IFD A;  2UXD Q;  2K5H A;  3AQQ A;  5AJ3 Q;  2PZT A;  4U67 3;  1K28 A;  1CHP D;  3MXU A;  4X66 Q;  3CXC A;  1STH A;  2NUC A;  1YNX A;  1E1O A;  3IFT A;  4DR2 L;  4NDX A;  4A3D B;  4JI8 L;  4IAL A;  3LX0 A;  2GN5 A;  3DM1 A;  2M2L A;  1JJ2 A;  5ELB A;  4LF6 L;  1VF5 C;  1PLF A;  2GA4 B;  4DK0 A;  4IFD I;  3KLS A;  4RA8 A;  3AFP A;  4JBW A;  3UDX A;  4IPH A;  2AUJ D;  4FF2 A;  2A69 D;  1AZQ A;  4JV5 L;  3KDF A;  3DWA A;  1DCZ A;  3PQI A;  1WTX A;  1Y1V H; 
#chains in the Genus database with same CATH homology
 3B6Y A;  4QL5 A;  3GTP H;  2R92 G;  2E2I H;  1BKB A;  3HOW H;  5GQO A;  1UWV A;  1T9H A;  1SFO H;  1TWH H;  2OQ0 A;  3ULJ A;  5LMU Q;  2VNU D;  5LMU L;  2Z0S A;  1K73 C;  3M7N A;  3TRZ A;  4A3C G;  3FKI H;  4BBR G;  1XMQ Q;  2L15 A;  4YCV A;  4HIK A;  1GD7 A;  1OXT A;  1CKN A;  4HJA A;  2PQA A;  4XIG S;  3KDF B;  2IHF A;  1VQ9 A;  2Q2T A;  1CSP A;  4JBK A;  4R4O A;  3H0G G;  1XNQ Q;  2NZH A;  3NEL A;  3I4N G;  1EIF A;  4NXM L;  3KFU A;  2RF4 A;  2R92 H;  1D7Q A;  4X64 L;  1M1K C;  3RZO H;  1R9T H;  4A3D G;  4LF7 L;  2R6G A;  5EAY A;  5M5Y H;  4C3I H;  3CAM A;  3A5U A;  1YIJ A;  4BY1 G;  3WWV A;  4IPD A;  3S24 A;  3CC7 A;  3T1Y Q;  1MKH A;  1OTC A;  4GKK Q;  3J7Z C;  1I3Q H;  1Y14 B;  4GKK L;  1WFQ A;  1YI2 A;  2ZM6 Q;  3M9B A;  2Q2U A;  4KHP L;  3GTL H;  4LFC Q;  4A3C H;  4BBR H;  4R4C A;  3CCE A;  1OXX K;  2PQA B;  1YHA A;  2UUC Q;  1SN8 A;  3L7Z C;  1B7Y B;  3I4N H;  4KI0 A;  2UUA L;  4DUZ Q;  1VQA A;  4A3L G;  4LFB Q;  2UXB Q;  3ULP A;  3CC4 A;  1YIT A;  2E2H H;  4JBM A;  1QVF A;  4KLK A;  4A3D H;  4GNX A;  1VQB A;  3F8T A;  4A76 A;  4BY1 H;  4LF5 L;  1YJ9 A;  1X65 A;  4P72 A;  4JC0 A;  3H3V H;  3I7F A;  2OWO A;  2QGQ A;  4A3I G;  1JJC B;  5IYD H;  2K14 A;  1YEZ A;  1L2F A;  3RN2 A;  5IWA L;  3CD6 A;  2EXD A;  1KHI A;  2XGT A;  1J6Q A;  1TWC H;  2ZTC A;  3GD7 A;  4XTC S;  4GOP C;  3KF8 B;  4R4I A;  4YHH L;  4A3L H;  2VQF L;  2I5L X;  4AQY Q;  1S40 A;  4ALP A;  1PH5 A;  2JA7 G;  1C0A A;  5GAH C;  1AE3 A;  1XTD A;  4EQ5 A;  4DAM A;  2QEX A;  4GNX B;  3AEV A;  1X55 A;  3CCV A;  5GAD C;  1JE5 A;  1VQD A;  2E5L Q;  1J5E L;  4L5R C;  1JT8 A;  2HQL A;  4YWL A;  3UDF A;  1L1O A;  3J80 c;  3BZK A;  1QZH A;  4J15 A;  1Q1E A;  3STB C;  3CCM A;  4A3I H;  3GTK H;  1EQQ A;  4OWX B;  1E7Z A;  3J81 c;  5E7N A;  3E9I A;  1YZ6 A;  1N34 L;  1UE6 A;  2YTX A;  3Q8D A;  1N34 Q;  3HKZ E;  4DPG A;  4WJ3 M;  1OXU A;  4B3T L;  1XJV A;  4DV3 L;  4LF4 Q;  3A5Z B;  5C4X G;  4LF9 Q;  3CCJ A;  1NBW A;  3M4O H;  4YWK A;  2PI2 E;  4DV7 Q;  2IHE A;  1K9M C;  5IT9 c;  1I94 Q;  4OX9 L;  2OTJ A;  1L1O B;  3J81 i;  4OO1 G;  4ME3 A;  4JI5 L;  3PUX A;  4DAY B;  1DGS A;  1V43 A;  1Q1B A;  2IT1 A;  2BA0 A;  4TQU S;  3L2P A;  4C3J H;  2JA5 H;  1KD1 C;  2UU9 L;  3S2D H;  4AYB E;  3PIO A;  1VQG A;  4BA1 I;  3PO2 G;  5J3B A;  5C4X H;  3W1G A;  3S1Q H;  1PH3 A;  2D62 A;  4R1J A;  4AH6 A;  3RLF A;  4OXP A;  5BR8 L;  1NJI C;  4JI1 Q;  2OTL A;  4K0K Q;  1UE5 A;  4OWT B;  5M5W H;  1HNZ Q;  4HJ7 A;  2CWP A;  1IBM L;  2NVQ H;  4IFD G;  4BY7 G;  1KQS A;  1VQH A;  1A63 A;  2VL6 A;  4A3F G;  4PMW A;  2WFW A;  4LUV A;  3CME A;  4JI8 Q;  2F3I A;  4YCU A;  5IYB G;  3A74 A;  1X3E A;  4R4T A;  4DV2 Q;  4DV2 L;  4JI7 Q;  5M3F G;  1XPU A;  1VQI A;  1TWA H;  1VQC A;  5LMN L;  1QZG A;  4POG A;  4UPA A;  1Q8K A;  5C0X I;  1NMF A;  1C7Y A;  2Y0S G;  1VQO A;  3CF5 A;  1YJN A;  3TS2 A;  1N8R C;  3ER0 A;  1E3P A;  4JV5 Q;  3PIP A;  4BY7 H;  4GKJ L;  1D8L A;  1SE8 A;  1LTL A;  3RR5 A;  4P73 A;  1MIU A;  5GAE C;  4A4I A;  1YJW A;  3HOV H;  2GVB A;  4LFA Q;  4LFA L;  4WJ4 A;  5M3F H;  1G6P A;  3M3Y H;  4IFD J;  1U5K A;  3K0X A;  2F4V L;  5IYC G;  1VQL A;  2HHH L;  1BVS A;  2MFI A;  3NBH B;  2A19 A;  1EIY B;  3K80 C;  4DK6 C;  1IYJ B;  3UE1 A;  1PYS B;  3S1R H;  2UXC L;  2UUB Q;  3EN2 A;  5IY0 A;  3G48 A;  2KBN A;  1HR0 W;  2UUB L;  2IX1 A;  1ASZ A;  3MEF A;  1HH2 P;  2A1A A;  3F2B A;  1MJC A;  3S2H H;  3CMA A;  3U4Z A;  1Y1W G;  3RNU A;  3I4O A;  4X65 L;  4NXM Q;  1UE1 A;  1A0I A;  1U0L A;  4X64 Q;  5H1S E;  5GAG C;  4LW1 A;  3EBE A;  1JJG A;  2V1C C;  4LF7 Q;  1HZC A;  3TEH B;  3KLW A;  3GTO H;  3BJU A;  4DV6 L;  1IXR A;  5M3M G;  1SLJ A;  1TWG H;  1K8G A;  4P71 A;  3J7A 5;  4GLA C;  4KHP Q;  2A8V A;  2K4K A;  1B70 B;  4Y52 H;  3G4S A;  3CW2 C;  2ID0 A;  4QY7 A;  4UP9 A;  1CKM A;  5IE8 A;  1JMC A;  4JI3 L;  2WAQ E;  2JA9 A;  1E22 A;  4DK3 C;  1RL2 A;  3H0G H;  3K7A H;  3MXN B;  5ELN A;  3I4M G;  2UUA Q;  3W1B A;  3CC2 A;  4DV5 Q;  4A3K G;  4DV5 L;  3CCL A;  4JG2 A;  1VQ8 A;  3GTM H;  1I50 H;  2YV5 A;  2D0O A;  4LF5 Q;  2KHI A;  2VUM G;  1PYB A;  1N36 L;  1AH9 A;  5M3M H;  1WCM G;  1PH1 A;  1MJE A;  5FLX c;  1HNW Q;  1HNW L;  2KCT A;  1VQE A;  1ASY A;  3HOZ G;  1Q12 A;  4HJ5 A;  1X9N A;  1HZB A;  3FHW A;  4NB3 A;  4DV1 Q;  4DV1 L;  2YYZ A;  5IWA Q;  1N9W A;  4QQB X;  2BH8 A;  1PH2 A;  2NVT H;  1EOV A;  4P74 A;  1K8A C;  3JC6 6;  5M5X H;  2VQE L;  4LF8 L;  1SRO A;  2C35 B;  2CFM A;  3D31 A;  4YHH Q;  3G6E A;  3RZD H;  3K7U C;  2VQF Q;  3I4M H;  2N3S A;  2I5H A;  2NZO A;  2Z6K C;  4JCV E;  3CCS A;  3KJO A;  1Q86 C;  2D0P A;  3H3V I;  1WJJ A;  2E8G A;  4DR1 L;  1IBK L;  1HR0 L;  1J5E Q;  2ES2 A;  2VUM H;  1S3O A;  3S15 H;  5IP9 G;  1XNR L;  2ASB A;  1HJP A;  2BH2 A;  1WCM H;  3L0O A;  1LUZ A;  4L5T A;  2GVA A;  3TS0 A;  2H5X A;  5JJI A;  1CSQ A;  3HOZ H;  1PVO A;  4GOP A;  4B3M Q;  3NEN A;  4B3M L;  2NN6 G;  3PV0 A;  4IOA A;  2KEN A;  3CCR A;  1W3S A;  1CKO A;  4C2M H;  4YWM A;  4A93 G;  4B3T Q;  3A0J A;  4JI6 L;  3DLL A;  2VZA A;  4H02 A;  1FGU A;  2JE6 I;  4DV3 Q;  1FJG Q;  4LNQ A;  1FJG L;  2DGY A;  1PFS A;  4A75 A;  1M90 C;  1E24 A;  2JA6 G;  3S16 H;  1WOC A;  2R7F A;  1GVP A;  5C3E G;  1XMO L;  4LUZ A;  2JA7 H;  3PGZ A;  3U58 A;  1HNX L;  4OX9 Q;  1VQN A;  3HOY G;  2HT1 A;  5IP9 H;  1EFW A;  3HOX G;  1NE3 A;  4JI5 Q;  4HJ9 A;  2EIF A;  2R93 G;  1A8V A;  2RCN A;  1TXY A;  1SR3 A;  4GOP B;  2B63 G;  3F2D A;  4DR5 L;  1SRU A;  3PUV A;  4DUY L;  4PZ8 A;  1O7I A;  1FL0 A;  3S17 H;  1YVC A;  3S1N H;  4Y7N H;  2UU9 Q;  4A93 H;  1YBY A;  2ZTD A;  3PF4 A;  3OW2 A;  4GN3 B;  4YCW A;  1V1Q A;  2OQK A;  5IP7 G;  4PZ7 A;  4HID A;  3ICE A;  2JEA I;  1SMX A;  1EYG A;  1XPR A;  5C3E H;  4A3E G;  4O0A A;  5BR8 Q;  4A3J G;  1LM0 A;  4MTN A;  1JB7 A;  2R7D A;  2CWA A;  1X54 A;  2N49 A;  3STB D;  2FXQ A;  1GO3 E;  3H15 A;  1IBM Q;  3HOY H;  4JOI C;  4DR3 Q;  1HZA A;  2N8N A;  2RHQ B;  4DR3 L;  2ATW A;  2ZJQ A;  4UP7 A;  4LUO A;  3UDI A;  4A3B G;  4P75 A;  1GKH A;  4UY8 C;  3I55 A;  1P8L A;  3UDG A;  1Z9F A;  1KRT A;  1PH7 A;  2I5M X;  5LMN Q;  1S72 A;  2K50 A;  3PUW A;  3DM3 A;  1KAW A;  1Q46 A;  3PO2 H;  1K83 H;  3CPW A;  3K8A A;  2IX0 A;  4L5Q A;  4A3E H;  4A3J H;  3T1H L;  3W5O A;  2B29 A;  1L0W A;  2JA8 G;  4UP8 A;  3HKZ G;  3KJP A;  2Q2H A;  2EQS A;  2LXK A;  2DUD A;  4GKJ Q;  4X66 L;  1OXS C;  3PUZ A;  2IY5 B;  1PH8 A;  3U50 C;  4DV0 L;  2AWO A;  4HJ8 A;  4DNI A;  1XPO A;  4NXN Q;  4NXN L;  4A3F H;  1V9P A;  3CP0 A;  5IYB H;  2JEB I;  4DR4 L;  1X3F A;  2CKZ B;  2AMC B;  2YTY A;  4JI2 Q;  4JI2 L;  2F4V Q;  2HHH Q;  5C44 G;  1OXV A;  4RG1 A;  3ZJY C;  2Q2I A;  3VDY A;  3JAM c;  3OTO L;  1N33 Q;  2HIX A;  4GN5 A;  1N33 L;  1KC8 C;  4HIM A;  2JA8 H;  2UXC Q;  4R4Q A;  3UE0 A;  4YY3 L;  4JI4 L;  1AE2 A;  2RHS B;  4GS3 A;  4AYB G;  4RMF A;  4X65 Q;  1I6H H;  3PUY A;  3S14 H;  3E0E A;  3GDE A;  1KIX A;  4BXX G;  1WYD A;  2VY3 A;  3M4P A;  3CPF A;  2WB1 G;  1G51 A;  2MO0 A;  2N78 A;  3JAM i;  4DV6 Q;  3G71 A;  5IYC H;  2HIV A;  1CUK A;  5C44 H;  3KF6 A;  1VQ7 A;  4A3G G;  2XTI A;  1YHQ A;  4HIO A;  1Z47 A;  1G29 1;  4DR6 Q;  4QGU A;  4X6A H;  3M85 A;  1VQM A;  4PG3 A;  1VQF A;  2K5N A;  4DR6 L;  1NY4 A;  1LYL A;  3I2Z A;  1XMQ L;  4MNO A;  3F2C A;  4JI3 Q;  4BBS G;  1TWF H;  1Y1W H;  4MZ9 A;  2R7Z G;  2MNA A;  1VQP A;  1XNQ L;  2BA1 A;  5FLM G;  4BXX H;  1K3R A;  4IPC A;  1GM5 A;  2NVY H;  5K36 G;  1N36 Q;  1NTG A;  4IPG A;  4PZ6 A;  3KF6 B;  1Q7Y C;  2VS1 A;  3T1Y L;  4A3G H;  1EWI A;  3RLO A;  4GNX C;  1FVI A;  3PF5 A;  5JJK A;  5IYD G;  2ZM6 L;  1KL9 A;  1VQ4 A;  3SGI A;  4LFC L;  3KOJ A;  4B3R Q;  4B3R L;  1CKN B;  1B8A A;  3OYY A;  2NVX H;  4BBS H;  1YHB A;  4POF A;  2VQE Q;  4LF8 Q;  4O2D A;  1Q82 C;  2UUC L;  2R7Z H;  3LGJ A;  3PSI A;  2JJQ A;  3ULL A;  3GTQ H;  4BA2 I;  3K81 C;  4EX5 A;  4DR7 Q;  4AIM A;  5FLM H;  4DR7 L;  1KXL A;  4A3K H;  4DUZ L;  4DR1 Q;  4LFB L;  1IBK Q;  2UXB L;  4QJF A;  1HR0 Q;  1QVG A;  1KRS A;  3PCO B;  1XNR Q;  1VQK A;  1X3G A;  1EQR A;  5DLQ E;  3U4V A;  5HY6 A;  2B3G A;  3AYH B;  4GN4 B;  1E1T A;  1QVC A;  3HFZ B;  1QUQ A;  2QA4 A;  2PI2 A;  2VW9 A;  1H95 A;  5FJ8 G;  2PMZ E;  1L1O C;  1UEB A;  1EUJ A;  2JQO A;  4IOC A;  5GRO A;  4JI6 Q;  2ZJP A;  2Z6K A;  4DKA C;  1VQ6 A;  3BU2 A;  2YU9 H;  2PNH A;  3M4Q A;  2AKW B;  2JK8 A;  4A3M G;  4L5S A;  1IZ6 A;  1XMO Q;  3PO3 G;  3IRB A;  1BBW A;  4AQY L;  1HNX Q;  1PH9 A;  2YTV A;  4GLV B;  4QIW E;  4LWC A;  5LMN W;  2WAQ G;  2E5L L;  4APV A;  1IL2 A;  5HGQ A;  5JJL A;  1P16 A;  3F1Z A;  1QUQ B;  2K75 A;  2Y0S E;  4DR5 Q;  4IJL A;  5FJ8 H;  4DUY Q;  1W2B A;  3AFQ A;  1VQJ A;  1WI5 A;  1PHJ A;  1PH6 A;  4K0K L;  2CQO A;  4C3H H;  2JA5 G;  4B3S Q;  5C4J H;  4B3S L;  3D0F A;  2ALY B;  4IJH A;  4A3M H;  5JEA G;  2ZJR A;  4LF4 L;  2JA6 H;  1BBU A;  1X56 A;  3PO3 H;  2MO1 A;  4LF9 L;  3J80 i;  5C0X G;  4DV7 L;  4FDB A;  1I94 L;  4DV4 Q;  4DV4 L;  3HOX H;  2NN6 I;  2KHJ A;  3TRE A;  1PA6 A;  2R93 H;  2ZTE A;  3CQZ H;  2B63 H;  1UE7 A;  1VCI A;  2CCZ A;  1HZ9 A;  4JBJ A;  2LSS A;  1RIP A;  2OCE A;  3HOU G;  4JI0 Q;  4JI0 L;  1N32 Q;  1VQ5 A;  2E2J H;  1N32 L;  5IP7 H;  1PH4 A;  5ELO A;  1K0R A;  4OWW B;  3CCQ A;  3I56 A;  4JOI A;  3T1H Q;  2UXD Q;  3E9H A;  2UXD L;  2K5H A;  2WP8 J;  3AQQ A;  4OO1 I;  2LXJ A;  5AJ3 Q;  2AHO B;  2MQH A;  5AJ3 L;  2I0Q A;  4JI1 L;  4X66 Q;  3GO5 A;  3NEM A;  4DV0 Q;  1HNZ L;  4OON A;  2WB1 E;  3GTJ H;  3CXC A;  3CCU A;  4X62 Q;  4A3B H;  1YNX A;  3HKS A;  1A62 A;  5JEA J;  1E1O A;  2K52 A;  4X62 L;  4GLX A;  3RN5 A;  4DR2 Q;  4DR2 L;  3S1M H;  4DR4 Q;  1Y1V G;  4NPS A;  3BZC A;  4JI8 L;  3HOU H;  3RLN A;  2K5V A;  3HOV G;  1X6O A;  2GN5 A;  5C0X J;  3GTG H;  1NMG A;  2AWN A;  3HOW G;  4JI7 L;  3FP9 A;  1JJ2 A;  4LF6 Q;  3TQY A;  4LF6 L;  3ERS X;  3J81 j;  4KHZ A;  2KCM A;  1PV4 A;  4IFD I;  4TVA B;  3OTO Q;  1I5F A;  1IBL Q;  1C9O A;  3AFP A;  4JBW A;  1IBL L;  3UDX A;  4IPH A;  4YY3 Q;  4JYA Q;  4JI4 Q;  4JYA L;  3FKI G;  3EIV A;  1Q81 C;  4JV5 L;  1VS0 A;  4IO9 A;  3KYH C;  2F52 A;  3KDF A;  1Y1V H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...