4LFCQ

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
molecule tags Ribosome
total genus 19
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4lfcQ00
4B3TQ 4X66L 4R4IA 4JCVE 2GVAA 1H95A 1UE7A 2B63H 5BR8Q 2R92H 1L2FA 2D0OA 1KAWA 4DR5L 4JI2L 1YJ9A 1FL0A 3ER0A 3KJPA 2RHSB 2ZTCA 3OTOL 2N8NA 4A3IH 4B3MQ 3CP0A 1CKNB 1FGUA 3U4VA 3CMEA 3ULPA 4JG2A 1PH1A 3HOVH 3S14H 4B3SL 5IP9G 2UXBL 1D7QA 4LF5Q 1OXSC 4A75A 2VQEQ 4A3MH 1IBMQ 2YTVA 5IY0A 3CQZH 1WI5A 5IYCH 4A3FG 2MNAA 1Q86C 5LMUQ 3AFPA 2IT1A 4DR2L 3OW2A 4YY3L 1YJNA 2KBNA 2NVXH 3TS2A 3H0GG 1N9WA 4DAYB 3M85A 3KDFB 4JYAQ 3W1BA 1IBLQ 1J5EL 4BY1H 3A74A 1TWHH 2AWOA 3UDFA 3J80c 2UU9Q 3K0XA 4X62L 4DUZL 4A3KH 1V1QA 5DLQE 1GM5A 3KDFA 4C2MH 1I94L 1D8LA 3PCOB 1YI2A 5GAHC 3CCLA 1CSPA 5C44G 2CKZB 4HIOA 4LUZA 1HNXL 2FXQA 4GN5A 1VQ8A 2VNUD 4B3RL 1JJGA 1IZ6A 5IWAL 3KOJA 2WP8J 4R4TA 4DV0L 4LUVA 1Z9FA 4DAMA 4HJ9A 1S72A 1KD1C 1K0RA 2ID0A 4H02A 3UE1A 4JBWA 3I4MH 3TRZA 3BZKA 2KHIA 1OXUA 4MTNA 4JI4L 1G6PA 1L1OC 1MIUA 1OTCA 4JI5Q 3UE0A 2ASBA 1EOVA 1YHBA 3L0OA 5M3MG 3CPWA 2K75A 5M3FG 1L0WA 4DV4L 2R7ZH 2AWNA 3J7A5 3TQYA 1E22A 1IBKQ 2HHHQ 4DR1L 4DV1Q 1XJVA 3HOZH 3J80i 3I2ZA 1JJCB 1PH5A 3NELA 1J6QA 2VUMH 5JEAG 1X3FA 2DUDA 2Y0SE 1N36L 1SR3A 2XGTA 2UUCQ 3HOWH 3H3VH 3PUYA 1KHIA 5GROA 3KLWA 4LUOA 3NEMA 2QEXA 2ZJRA 5M5YH 2NVQH 3UDIA 4IPCA 1M1KC 5EAYA 3AYHB 2UXDL 1NTGA 1HH2P 2BH2A 3GTLH 3PUWA 4X64L 1MJCA 2IHFA 4JI8L 4X66Q 3I4NH 2VY3A 3HOXG 1W2BA 1X56A 2OQ0A 3KJOA 4P75A 4JI3L 5IYBH 3CPFA 3STBD 4A3BH 1WCMG 3A5UA 4IOCA 5IYDG 3J7ZC 4DR5Q 4A3DG 2WAQG 4R4QA 1UE1A 4JI2Q 1R9TH 2I5MX 3LGJA 4GLVB 4IPGA 3TEHB 4LF6L 2PMZE 3AEVA 1SRUA 4YWLA 2C35B 4JOIA 1HR0W 4OO1G 2JK8A 3OTOQ 1PH7A 4A3CG 1SN8A 1PH6A 4A76A 4J15A 2VQFL 4LWCA 2MO1A 3T1YL 4BBSH 4DR7L 4B3SQ 3RR5A 3HOYG 2OQKA 3PF4A 4L5SA 4Y7NH 4POGA 2UXBQ 1N33L 2ZTDA 3GTQH 3I7FA 1Q46A 4OONA 3DM3A 3TREA 4JV5L 3CD6A 2IX0A 2KCMA 3D0FA 4KLKA 4QL5A 2A19A 4DV5L 1XPUA 1GVPA 4BXXH 1T9HA 4C3HH 2K14A 4AH6A 2ES2A 1XTDA 5M5XH 2UXCL 2R6GA 4LFAL 1PH4A 4DR2Q 1FJGL 3KF6B 4YY3Q 4P74A 3GDEA 2NVYH 4R4CA 4L5TA 2A8VA 3W5OA 4R4OA 5AJ3L 4OX9L 3IRBA 4C3IH 2YU9H 1Q12A 2GVBA 3F2DA 4HJAA 5C0XJ 1J5EQ 1IL2A 2RF4A 2Z0SA 3KF6A 3PUVA 4GOPA 3PIOA 1BKBA 3GTPH 3FHWA 4DUZQ 1I94Q 3G48A 3F8TA 5H1SE 4GN3B 2OTLA 1HNXQ 4EQ5A 2LXJA 3PO2H 2YV5A 4B3RQ 2WFWA 5IWAQ 5M3MH 4DV0Q 4OO1I 2N3SA 1I5FA 3EIVA 1CSQA 4A93G 4LFCL 2XTIA 2ZJPA 4JC0A 2I0QA 4JI4Q 1VCIA 4JI7L 1VQBA 1I50H 4P72A 4JBKA 4GNXA 3PO3H 4A3JG 1EIYB 4DV4Q 1MJEA 1TWFH 1DGSA 4UP8A 1GO3E 1XPRA 4BY7G 2LSSA 4UP9A 4DR1Q 1PH3A 1S3OA 3OYYA 2HQLA 3FP9A 3CCEA 3KYHC 2Z6KA 2RCNA 1Q1EA 4LW1A 1N36Q 5FJ8G 3H15A 2JA6G 2CWAA 2R93H 2AMCB 1VQNA 1KRSA 3GTKH 2CQOA 5GQOA 2ZJQA 2JA8G 3HKSA 1YJWA 1NJIC 1K8GA 1HZAA 1VQGA 1WCMH 4DV6L 4JBMA 1PH2A 3FKIH 2A1AA 1VQPA 1ASYA 3L2PA 2UXDQ 4IPHA 1KC8C 4GS3A 2QGQA 4JI8Q 4X64Q 4OWTB 1PVOA 2WAQE 1LYLA 4IFDJ 2JE6I 1VQLA 2ZTEA 4JI3Q 2ATWA 1VQ4A 4JI6L 3HOYH 1YZ6A 3I55A 2F52A 4LF6Q 2KCTA 1Q82C 2Q2UA 3K8AA 4HJ5A 1XNRL 2JEBI 3RN5A 5C3EH 1WYDA 3T1YQ 2VQFQ 4XIGS 1UEBA 2N49A 4DR7Q 1VQ6A 4BBRG 1U0LA 2V1CC 1VQ5A 2N78A 2QA4A 3PF5A 1B8AA 5IT9c 1N33Q 3M3YH 1LUZA 1O7IA 4JV5Q 2R7FA 1AE3A 4AIMA 2I5HA 2JA5G 4UY8C 3CAMA 3A0JA 3Q8DA 3A5ZB 3CCVA 4DV5Q 1V43A 1HR0L 4DR4L 4A4IA 1Y1VG 4KHZA 1GD7A 1PHJA 4P71A 4P73A 5C4XG 1B70B 2UXCQ 1EQQA 1ASZA 3ULJA 4LFAQ 1QZGA 3K80C 4OXPA 1NMGA 1FJGQ 2K52A 2Q2TA 4JI0L 4DV2L 3DLLA 3E0EA 3MXNB 4OX9Q 3HOUG 5AJ3Q 5GADC 1HNWL 4A3GG 1NY4A 4DUYL 1HZ9A 3S2DH 2UUAL 3RLFA 2BA1A 1KIXA 4PZ7A 4NXML 5J3BA 4A93H 1TWAH 1M90C 5IP7G 3UDXA 1SLJA 2GN5A 1V9PA 1VQDA 1QUQA 1QZHA 4OWWB 2JA7G 2K5NA 1HNZL 1VQAA 1B7YB 4IO9A 4OWXB 1TWCH 3RLOA 4AQYL 1Y1WG 4BA2I 5FLMG 1C9OA 5HGQA 1X3EA 3CCJA 1L1OA 5HY6A 4BY7H 1XPOA 4LFCQ 4DV3L 3CC2A 1I6HH 5ELNA 1N34L 4JI7Q 5IP9H 4JOIC 2B63G 4EX5A 2R92G 1WJJA 1BBUA 1RL2A 5C4JH 3J81c 2JA8H 3PV0A 3G71A 3KF8B 4X65L 1Q8KA 4A3IG 3M4PA 4A3FH 2OWOA 4GLXA 2F4VL 3JAMc 3S16H 1Q1BA 3HOVG 2JJQA 3HKZE 3U58A 1G51A 4RG1A 4R1JA 3H0GH 1A63A 4GKJL 1JT8A 3D31A 3I4OA 3BU2A 2BH8A 3M9BA 4PG3A 4NPSA 4A3MG 4X6AH 3K7UC 4DV6Q 1BVSA 4DR3L 2YYZA 5JEAJ 1LM0A 2JQOA 5K36G 1G291 3HFZB 5IYCG 4A3LG 4L5QA 1E1OA 4IJLA 3T1HL 4GOPB 1YHQA 4GKKL 3G6EA 5C44H 1KQSA 2HT1A 3S24A 1XMOL 4AYBE 1A8VA 5LMNW 3J81i 4JI6Q 2AHOB 1HZBA 2OCEA 1YNXA 4BY1G 1VQ9A 1EYGA 1QVGA 1TXYA 3F2CA 1SFOH 4IPDA 1X54A 1WFQA 3JAMi 1XNRQ 4HIKA 4LF8L 1X65A 4A3KG 4LFBL 2EXDA 5E7NA 4TVAB 1SE8A 2NVTH 2DGYA 3WWVA 1U5KA 1IYJB 1HZCA 1CKOA 3STBC 1YEZA 4O2DA 4UPAA 1P8LA 4YHHL 5M3FH 1VQKA 1QVFA 4TQUS 4GNXB 4LF7L 3F2BA 4POFA 1TWGH 5JJLA 4WJ4A 3PGZA 3L7ZC 1HR0Q 2I5LX 1I3QH 1WOCA 3U50C 5C0XI 3M4OH 4DR4Q 3U4ZA 3BZCA 5JJKA 2YTYA 1JB7A 1Q7YC 4JI0Q 1K8AC 4DV2Q 1JE5A 4PZ8A 4PMWA 2R7ZG 3ZJYC 4MNOA 1CUKA 4QQBX 2UUBL 4IFDG 1HNWQ 3HOZG 2IY5B 3PSIA 1X3GA 1YIJA 1Y1WH 4DUYQ 1KRTA 1IXRA 2JEAI 2VUMG 2UUAQ 4HIDA 4NXMQ 1Q81C 1E24A 1KL9A 4YCUA 3HKZG 1PYBA 3SGIA 3PIPA 3HOXH 2H5XA 4KHPL 2HIXA 1VQ7A 4LF4L 1K3RA 1NE3A 2ZM6L 4HJ8A 3HOWG 1FVIA 5FLXc 5IYDH 1UE6A 1HNZQ 4A3DH 3GTMH 2LXKA 1EWIA 4NXNL 2BA0A 4AQYQ 4DNIA 5LMNQ 4JI1L 1VS0A 4K0KL 1Z47A 4Y52H 2K5HA 1JMCA 4DV3Q 4L5RC 4A3CH 1N32L 3I4NG 2CWPA 1KXLA 1JJ2A 2CCZA 1YITA 5IYBG 4YCWA 1SROA 2RHQB 1N34Q 2E5LL 4A3BG 1BBWA 2OTJA 2KENA 1EUJA 2YTXA 4AYBG 3S17H 1VQFA 2PI2E 4LNQA 1LTLA 3JC66 1VQJA 1CKNA 4QJFA 4A3EG 1X6OA 4C3JH 4IOAA 3M4QA 4X65Q 1YHAA 3CC4A 1XNQL 3ICEA 2AKWB 1AH9A 2F4VQ 4APVA 4RMFA 4BBSG 3S1RH 4A3LH 3UDGA 2D62A 3CC7A 4UP7A 4DR6Q 3M7NA 4IFDI 1YBYA 4GKJQ 3J81j 1S40A 1OXVA 3BJUA 1YVCA 2WB1E 4YWKA 2D0PA 4BXXG 4DR3Q 1RIPA 4LF9L 3F1ZA 2VS1A 2VZAA 1E7ZA 3GTOH 3H3VI 3T1HQ 5IE8A 3S1QH 4GKKQ 1C7YA 1XMOQ 2CFMA 2EQSA 2KHJA 5GAGC 4DV7L 1QUQB 3CCRA 1XMQQ 4ME3A 5GAEC 3CCMA 3MEFA 3NENA 3EN2A 4DK3C 4B3TL 1PYSB 1K9MC 3G4SA 4LF8Q 1L1OB 4LFBQ 3AQQA 4QY7A 5BR8L 1C0AA 4A3JH 3PO2G 2F3IA 5LMNL 2K5VA 4YHHQ 1VQEA 4PZ6A 1PH8A 4LF7Q 1A62A 1MKHA 4B3ML 1PV4A 1AE2A 3B6YA 2MFIA 3K7AH 3RZOH 4GLAC 4HJ7A 1K73C 1PH9A 4YCVA 3NBHB 1VQHA 5FJ8H 2JA6H 1VQOA 4QGUA 4GN4B 3VDYA 3S1NH 1PA6A 4BA1I 4LF5L 3PO3G 2NZHA 2L15A 1PFSA 2NN6G 4QIWE 1CKMA 2VQEL 1IBML 1EFWA 3CCQA 1E1TA 4JBJA 2UUBQ 1X55A 4IJHA 5C0XG 5LMUL 2K50A 1UE5A 2HIVA 3CCUA 3S1MH 1VQMA 2VL6A 4KHPQ 4DR6L 3K81C 2R93G 3I56A 4LF4Q 2ZM6Q 2EIFA 4YWMA 2NZOA 4JYAL 4XTCS 3CMAA 2K4KA 1E3PA 4O0AA 1IBLL 1NMFA 3CCSA 4NXNQ 2ALYB 3FKIG 3W1GA 2PQAB 2WB1G 1OXTA 5ELOA 2R7DA 4JI1Q 4DPGA 2VW9A 4HIMA 2UU9L 4K0KQ 3CW2C 3EBEA 4A3EH 1N32Q 2MO0A 3GO5A 4GOPC 3ULLA 1EIFA 1K83H 2PQAA 3S2HH 4BBRH 1XMQL 3TS0A 3RN2A 1N8RC 2E5LQ 2Q2HA 4FDBA 3KFUA 4NB3A 3S15H 1X9NA 1W3SA 2JA5H 1VQIA 4WJ3M 1Y1VH 1VQCA 1XNQQ 3CF5A 5M5WH 4ALPA 2IHEA 4DKAC 5C4XH 3RZDH 5C3EG 3E9HA 3GTGH 4JI5L 1SMXA 2E8GA 2E2HH 2NN6I 1Y14B 4KI0A 1NBWA 1P16A 3AFQA 1EQRA 3RLNA 1IBKL 2HHHL 3HOUH 3I4MG 3GTJH 4GNXC 4DV1L 2E2JH 4A3GH 3RNUA 4LF9Q 2UUCL 3CXCA 2Q2IA 3ERSX 4DK6C 5IP7H 2E2IH 2JA9A 2B3GA 1A0IA 4X62Q 2B29A 2Y0SG 2Z6KC 2JA7H 5JJIA 3PUZA 3PUXA 2IX1A 1OXXK 1UWVA 4DV7Q 1GKHA 1QVCA 2PI2A 3E9IA 5FLMH 2MQHA 1HJPA 2PNHA 3GD7A 4MZ9A
chains in the Genus database with same CATH superfamily
2K1BA 3MTSA 4JCVE 2ZT9C 2R92H 4JVZA 1KAWA 4EQNA 3KJPA 2B2YA 2WV6D 2ZTCA 1S5CD 3OTOL 2N8NA 3L9AX 1TS5A 5E3FA 4A3IH 1SNOA 1CKNB 1FGUA 3CMEA 3S14H 2WINB 4JG2A 4KD3A 4B3SL 5M9OA 4C2MB 1SNMA 2O5IC 4A75A 3PIP3 2F0QA 2F1MA 1WD0A 4IUVA 3SK8A 1BR9A 5IYCH 1JC7A 1BCPB 2A6HC 4Q0FA 1PTOB 4DR2L 2GA4B 3Q23A 1IKLA 3KDFB 3M85A 3DHQA 3W1BA 1IBLQ 1LO5D 4X3UA 2R7ZB 2EJMA 1AZPA 2UU9Q 2K5QA 4X62L 4DUZL 4C2MH 2V4DA 5GAHC 2VUMB 3K5NA 2FXQA 2VNUD 4XDXA 1JJGA 3UI2A 2PO4A 3FEWX 3KOJA 4R4TA 1Z9FA 4DAMA 1K0RA 1RJTA 5IGCA 2JN4A 3K6OA 2NVQB 2Z9HA 3VA7A 1B3QA 2RVLA 1QE6A 4JI4L 1WTQA 2E75C 4C1NK 3GTLB 4IURA 3MEHA 4DV4L 3J7YW 2R7ZH 1V1OA 3J7A5 3TQYA 3VYTA 1IBKQ 2BDOA 5KEEA 2VUMH 3J7AF 1X3FA 2Y0SE 4A3EB 4FF1A 4EQPA 3A55A 4FXKC 3K5OA 1AP0A 4O1NA 3HOWH 1IKMA 1K83B 3VR6A 4X3SA 1KHIA 5GROA 2QEXA 4QCLA 4MHEA 2NVQH 3NUCA 4RHRA 4U673 2BH2A 3GTLH 2NBFA 3TP6A 1KNEA 3IFDA 3KUPA 4IOCA 1R9TH 4ODGA 2I5MX 2NVYB 4XYOA 4YWLA 2SDFA 3OTOQ 2YU9B 2L5TA 2SEBD 4A3CG 1SN8A 1AW7A 1PH6A 4A76A 4J15A 1STEA 4B3SQ 1S5BD 2E2DC 2OQKA 4L5SA 3PF4A 1X3QA 4KLKA 2F0VA 4MN3A 3TP5A 1KTKA 2R6GA 4DR2Q 3GDEA 2NVYH 3V96A 4L5TA 5IODA 2A8VA 3IRBA 2YU9H 2GVBA 4HJAA 4F87A 5C0XJ 3GV3A 2F0LA 1IL8A 3FHWA 4PNYA 4DUZQ 3HOVB 2EYLA 2G5DA 1QCBD 3F8TA 4GN3B 3U9OA 2JP1A 4G57A 2L12A 4K2LA 3R2TA 2WFWA 2FFKB 4A3MB 2OXPA 5EBCA 1TU2B 3A56A 1D6EC 1ILPA 4JI4Q 1H9KA 1VQBA 3IAYA 4JBKA 2NN6H 3M4YA 4DV4Q 3H09A 1GO3E 4N9PA 1XPRA 4BY7G 1J8IA 2B8GA 1R4PB 3OYYA 3CCEA 1TS3A 2RSOA 2JA6G 2CWAA 3GTKH 5GQOA 1CTMA 3HKSA 1A6XA 3A54A 4IQZA 3OIQA 1F9PA 1PVOA 2VB2X 4IFDJ 2JE6I 1SYFA 2ATWA 5C5MA 1VQ4A 1YZ6A 3T16A 3LWUA 4UHVA 4QIWB 3P7JA 3K8AA 2JEBI 1PTOF 3URYA 3HKZB 3MFYA 1UEBA 1L0YB 1U0LA 4K8JA 1VQ5A 2N78A 2QA4A 3PF5A 5IT9c 2R7FA 4AIMA 1LT6D 5M5YB 1CT1D 1Y1VG 4KN4C 1PHJA 1B70B 3CRLC 1B9NA 3ULJA 1LT5D 3E6ZX 2K52A 2QW7A 5GADC 3S2DH 2UUAL 3RLFA 2BA1A 1GJXA 4A93H 3RUZA 3UDXA 1LTGD 4BBSB 1V9PA 1QUQA 2K5NA 3C3LA 1VQAA 4Y7NB 2IPKD 4IO9A 4AQYL 4BA2I 5FLMG 2EXZA 4R8NA 5HY6A 5C5LA 1XPOA 3MFGA 4C3HB 1EQVA 5JPMC 1EY7A 4JOIC 2B63G 4EX5A 1RL2A 2JA8H 2R61A 3I72A 1D2BA 1LT4D 2OWOA 4GLXA 1BDOA 1Y8PB 3T13A 2JJQA 5I4DA 5IT9E 3NK9A 1BOSA 2Z8LA 4K5WA 4R1JA 4CBVA 1A63A 1F2ZA 3GP7A 3QOLA 2OEOA 1G291 2EY5A 4IJLA 4ZQ3A 3G6EA 3J81L 1KQSA 1I50B 4AYBE 3MC0B 1B9MA 3MXPA 4HN7A 1ENCA 4HIKA 4A3KG 1SE8A 5E4XA 3BS1A 2KOLA 4CDEC 2DGYA 1IYJB 4RKLA 4CDCC 1P8LA 1VQKA 1CZGA 4TQUS 1SYCA 1TWGH 3FKIB 3A8KE 4WJ4A 1XYIA 3PGZA 3BVGA 2I5LX 1I3QH 1WOCA 5C0XI 5JJKA 4KKTA 1JB7A 1Q7YC 1HRJA 2EDGA 1EY9A 1HTLD 5I6YA 1S5FD 2L11A 4NDXA 1YIJA 1PXUA 1RCVD 3BG3A 1DOLA 2UUAQ 2F0SA 2L55A 1PYBA 3Q6SA 3SGIA 3PQIA 5FLXc 1C4QA 3D4WA 2Z4IA 3GTMH 2XVSA 4BS9A 4AQYQ 5LMNQ 4K0KL 1MSHA 2K5HA 3V2TA 1SNPA 4MTKA 4A3CH 2ZXOA 3I4NG 1C48A 1TVXA 1KXLA 1VMPA 2CCZA 5IYBG 3GTOB 2XSCA 2Y0SB 1EUJA 4AYBG 2PI2E 2FMMA 1WTRA 2NB0A 2PYKA 1SE3A 3OSOA 3X3MA 2KVMA 3LX0A 2BDNA 4RMFA 1A3UA 3S1RH 3P20A 1I4PA 4WORA 4IFDI 3J81j 1S40A 1OXVA 1JWSD 5L37A 2D0PA 4I7AA 4LF9L 2X69A 2VS1A 4BY7B 2EY1A 3GTOH 3H3VI 1AEXA 1EY0A 1ENAA 4DAYA 3S1QH 3Q0AA 1TY2A 1T5XD 2R3ZA 4C3IG 5DNFA 3CCMA 1CZWA 1K9MC 2G9DA 1E2WA 1L1OB 2IWHA 4DK0A 3AQQA 5IGGA 2QCPX 3EJIA 1K28A 3PO2G 3VR5A 4PZ6A 1LTAD 1CA5A 3RZOH 1SNQA 4YCVA 4MIUA 2JA6H 1VQOA 4QGUA 1DONA 3VDYA 3PO3G 5ISRA 4G7OC 1CKMA 3H94A 4IUPA 3CCQA 1PMRA 3TZUA 5LMUL 1UE5A 1H9MA 1HQMC 3AU7A 5EKIA 3K81C 5M5WB 1WTHA 5BN3A 3SVMA 4O0AA 1E3PA 1NMFA 1RF2D 1OXTA 1H9SB 2R7DA 4K0KQ 3MHBA 3W2DA 2MO0A 2K05A 3SK6A 3GO5A 4GOPC 3ULLA 2PQAA 1EIHA 1XMQL 2Z6BA 3TS0A 2E2IB 3NSWA 1U4PA 2B8FA 3LWEA 5I2YA 3S9WA 1Y1VH 5M5WH 5C3EG 3VR4A 3GTGH 5AFWA 4ULLA 1JQYD 2B63B 1ESRA 3QWNA 3RNUA 4LF9Q 2HDLA 2TMPA 2E2IH 4KY6A 2N55A 2B29A 4IN3A 2K03A 5ELBA 3PUXA 1K3BC 2IX1A 3KK7A 3E9IA 5FLMH 1HHVA 3I90A 1HJPA 1B44D 2GVAA 1H95A 2B63H 3OIPA 1EYDA 1L2FA 1AFPA 2NVXB 3ER0A 2F0DA 1GUSA 3CP0A 4J1MA 2F0PA 3U4VA 1EYCA 3ULPA 2PCFB 4DAVA 4A3KB 2UXBL 2CH4A 2PNRC 4HR7B 1EWCA 4KKSA 1WI5A 5LMUQ 5CBEE 4XQJA 1A2UA 3OW2A 4YY3L 2NTTA 2NVXH 3H0GG 1N9WA 2WKDA 4OIKA 1X3PA 1GUGA 3UDFA 3J80c 2MHVA 5A35A 2F0OA 4A3KH 1V1QA 4K8IA 1YI2A 4HIOA 1VQ8A 4CDFC 3G7LA 1A15A 1IZ6A 3HS0C 4HJ9A 4B9WA 5KGUA 1Y8OB 1I4HA 3K59A 3UE1A 3I4MH 1JWUD 2L4NA 2D2CC 2X6LA 1II3A 2ASBA 1EOVA 1YHBA 3CPWA 2K75A 2PZTA 2VXWA 2EYJA 1C8CA 4AYBB 1XJVA 3J80i 5COYA 1PH5A 3NELA 1J6QA 5BN4A 2C9OA 1LTRD 5JEAG 2DUDA 2O5JC 4LJZC 4TRDA 3S2HB 4BBRB 4ZCKA 4ABNA 1LTTD 1B4OA 3KLWA 4LUOA 3TSSA 3DWQA 1SE2A 3I4LA 5EAYA 2UXDL 1NTGA 1F9QA 4IUQA 5EBDA 3PUWA 4X64L 3I4NH 3RZDB 5C4XB 3HOXG 1W2BA 5IYBH 2E2HB 3CPFA 4RA8A 3J80E 1QB5D 3J7ZC 4CHTB 4A3DG 1UE1A 3HOUB 2PMZE 1HR0W 4OO1G 3WOFA 1PH7A 1K8OA 4LWCA 1G91A 1QG7A 1QNUA 4POGA 2UXBQ 1N33L 2ZTDA 3GTQH 3I7FA 4JV5L 3KF8A 2KCMA 2XWBB 4RFBA 4DV5L 2A19A 1GVPA 1TT2A 4FNFA 1XTDA 1SYDA 4YY3Q 1GUWA 4CGYB 1CHQD 3PO3B 5C3WA 4C3IH 1Q12A 3F2DA 1MI2A 2Z0SA 1BCPD 5K5PA 4A3IB 4GOPA 1PTOD 1G6ZA 1JOOA 1M4VA 4WJWA 3PO2H 2I07B 2YV5A 2F4IA 3EIVA 4A93G 4J8QA 3PO3H 1TR5A 3NTKA 1DGSA 3BZDB 5CV4A 4UP9A 1PDQA 3FP9A 3C46A 2EE1A 5FJ8G 3H15A 2AMCB 1VQNA 3E5SA 5C3EB 2Z4HA 2JA8G 3NWSA 1PFMA 1U4MA 1HZAA 4JBMA 2A1AA 2OT2A 1VQPA 1RTNA 1ASYA 3L2PA 2UXDQ 1IW7D 4IPHA 1KC8C 1BCPC 4NKLA 4X64Q 4OWTB 3M7GA 1EZ6A 1PTOC 4JI6L 1DZ1A 4N8FA 4GZYC 1Q82C 4FP5D 2F0HA 3D4DA 5C3EH 4H0LC 2N49A 1TWAB 4ME5A 3HOWB 1N33Q 2M9VA 4JV5Q 2I5HA 1JE4A 4UY8C 3CAMA 3A0JA 3HEJA 4IALA 3SK4A 4DV5Q 1HR0L 4KHZA 2NUCA 2J0TD 4P71A 4P73A 2AUJD 1EQQA 1QZGA 5KNCA 4DV2L 5EQ0A 3E0EA 1R9TB 4A3GG 3BDCA 1NY4A 4DUYL 1HZ9A 3SR1A 4NXML 1TWAH 1M90C 4L63B 3MXNA 5IT9L 5EGTA 1STGA 3VYRA 2O4XA 2JA7G 4OWXB 2F0GA 1RDPD 1U9RA 1PYWD 3CCJA 1O7LA 4DV3L 2JSOA 1J9OA 3CC2A 4RCNA 5ELNA 4ILWA 1N34L 1JWMD 3MAQA 2KCNA 2EJGC 3PV0A 1Q8KA 3NBHA 2F4VL 3I73A 3MVVA 2K33A 1Q1BA 1VMCA 1G51A 1S4ZA 1TKWB 4TKOB 3R2IA 3H0GH 1JT8A 3MXGA 3BU2A 3M9BA 5CR3A 3BYYB 4DR3L 2YYZA 5JEAJ 5K36G 3V05A 1WTPA 2CW0D 3IKJA 4C56C 4XQQA 3T1HL 1YHQA 1ENFA 2HT1A 1XMOL 1NUCA 3SK5A 5LMNW 4JI6Q 2K7VA 4BY1G 4JK1C 1TXYA 1SFOH 1X32A 4HCSA 5KRUA 2ZXPA 1X54A 1WFQA 4K6DA 4KTAA 4LF8L 1X65A 4FXDA 5E7NA 4FYDA 4TVAB 4IUUA 3WWVA 1U5KA 5KYLA 1HZCA 1YEZA 4UPAA 3GTKB 1QVFA 4GNXB 5JJLA 3DWAA 1HR0Q 3L7ZC 3U50C 3M4OH 5JEAH 3U4ZA 1EU3A 1EWHA 2YTYA 3A7AB 3BDOA 4DNRB 4DV2Q 4PMWA 1NNXA 2A5HA 1CUKA 1STBA 3HOZG 2KJXA 2IY5B 3HRZC 3PSIA 2DN8A 2HCCA 4DUYQ 4HIDA 4NXMQ 3TMEA 1E24A 1KL9A 3HOXH 4HEDA 2ICIA 2HIXA 2B2UA 4FF2A 4A3DH 1AZQA 1EWIA 2BA0A 4DNIA 4JI1L 1VS0A 1F9SA 2F0NA 4OO1H 4Y52H 1JR0D 1JMCA 4DV3Q 4L5RC 1LLRD 3QR8A 1YITA 1N34Q 4A3BG 2OTJA 1BBWA 2YTXA 4LNQA 1G8ZD 2QDLA 2MPMA 1KDCA 1CKNA 1VQJA 1X6OA 3M4QA 4ZK9B 1XNQL 3S2DB 2F4VQ 3NP8A 2AQ2B 4A93B 3RD4A 3J7AV 3UDGA 4S3SA 2KEEA 3FVQA 3H3VC 4DR6Q 3MZ5A 4ZRZA 3C1EA 3BJUA 1BNZA 2WB1E 4YWKA 4BXXG 2QKIC 4DR3Q 2PMZB 1PFBA 3T1HQ 2LMCB 1XMOQ 5J39A 1Z7TA 2KHJA 1G2SA 4DV7L 4ZKBB 1FYCA 3CCRA 2JA8B 3AB9A 3W3AA 2F0EA 4HMIA 5TSSA 4LF8Q 1E2VA 5DEHA 3E0JA 5FOBB 3QJYA 4QY7A 1BF4A 1C0AA 1U4RA 5CORA 5LMNL 1HUNA 1PH8A 1A62A 2FMCA 1PV4A 1AE2A 5J1ZA 1YNJD 3K7AH 4GLAC 1SE4A 2B39A 5FJ8H 5CYUA 1TS2A 4GN4B 3S1NH 1SSOA 4BA1I 2VQEL 4TSSA 1CM9A 2DNCA 1IBML 1EFWA 4G7HC 2L1BA 4JBJA 3SEBA 1X55A 1ICFB 1SMYD 2BE5D 1B3AA 4FF4A 2R93G 2QDBA 3I56A 5D3IB 2EIFA 4YWMA 4XTCS 2K4KA 3CCSA 1W6KA 2P5ZX 1TWGB 2PQAB 2WB1G 4DPGA 4JI1Q 1KDBA 5D65A 1BUVT 1I3QB 4A3GB 2E2JB 5D14A 4HSPA 1N8RC 3RN2A 2JA7B 1A2TA 1ZYRD 1X9NA 4H13C 5ELEA 1MSGA 2WKCA 1UUPA 1I4XA 1XNQQ 4ALPA 1HFGA 4K14A 1YNJC 3DMUA 3E9HA 4JI5L 1SMXA 2NN6I 1CFMA 1DOKA 3D4RA 1NBWA 1P16A 5JOBA 3GTMB 3I4MG 3GTJH 2E2JH 4A3GH 3KBXA 3R8BA 1GUOA 2UUCL 4XT1B 3CXCA 2F3VA 1PFNA 1VDZA 4Z9CB 2XNAC 2Z6KC 1SMYC 2BE5C 2JA7H 3PUZA 5EKLA 1OXXK 4DV7Q 1DD2A 1UEAB 5G3LF 2Q8IB 1BO0A 1CQFA 4MZ9A 5CBAE 3CQZB 2MGSA 2PZUA 1LV9A 2NYZD 3FDTA 4R4IA 3ND9A 1BXTA 3S1RB 2D0OA 4DR5L 1Z6HA 4DA2A 3A8IE 1FL0A 5ELDA 1ZYRC 1DM0B 1PLFA 2B2WC 3S1QB 1D7QA 1OXSC 2VQEQ 1HA6A 2O2LD 3KLRA 1IBMQ 2YTVA 5IY0A 1O7ZA 3CQZH 5K36H 1LTSD 4A3FG 3AFPA 4RGOS 2IT1A 1HQRD 4N9TA 1F77A 3NWTA 4OL7A 4CKBA 1G2TA 1YNND 1YJNA 2KBNA 5C6AA 3SDZA 3R3OA 5A2QE 1J5EL 4BY1H 1FGBD 2OF1A 1D5MC 1KAAA 3OHXC 3RZOB 1FD7D 2XRQD 2G9HD 1DYQA 2HQEA 2JA6B 1CSPA 1Q3LA 1V1PB 5C44G 1HNXL 4LUZA 1MBYA 3H6MA 1HFNA 2WP8J 2F0WA 1NR4A 4LUVA 1KD1C 1I6HH 3QOJA 5FLXE 4H02A 1FNVA 2I46A 2LKVA 2RDFA 1ICWA 5C4ZA 1OXUA 3FPPA 1G6PA 1L1OC 1MIUA 2WIIB 4JI5Q 3L0OA 3T4AC 5M3FG 1L0WA 3J80L 1E22A 4DR1L 4OELB 3HOZH 3I2ZA 2UUCQ 1SR3A 2XGTA 3I3CA 1QWYA 2EJFC 1YNNC 3NEMA 2ZJRA 1EY6A 2CH4W 4IPCA 1M1KC 1D5ZC 3AYHB 1HH2P 1HTPA 1Y1VB 4HSVA 1MJCA 2A73B 2CHBD 2F0IA 4L8JA 2EYMA 2VY3A 2PPBC 1EL0A 3GTGB 1X56A 2OQ0A 3MXUA 4P75A 4JI3L 3KJOA 3STBD 3K5LA 4A3BH 3A5UA 4DR5Q 5IYDG 2WAQG 3ERQA 4DAPA 4IPGA 3AEVA 3NXWA 1IYUA 4JOIA 4IUTA 4XT3B 2JK8A 1B2TA 4CKCA 2MO1A 4DR7L 3I91A 1MD2D 1Q46A 3DM3A 3CD6A 2IX0A 4QL5A 2B2TC 2PW5A 4BXXH 4CDDC 1F2MA 4C3JG 4DK1A 4HTHA 4LMQD 4KY7A 3NTIA 5IGEA 3WDNA 4IZ8A 1I4QA 5NUCA 2ES2A 2UXCL 5M5XH 4KHVA 1FJGL 3E3XA 1PRTB 3NPPA 4QUFA 3W5OA 4R4OA 5AJ3L 1J5EQ 4OIJA 3GQBA 2EZVA 3KF6A 4RCOA 1A3TA 3PUVA 3PIOA 4KN7C 4EQOA 3G48A 4PQXA 3BVMA 1HNXQ 1MGSA 1SYEA 4EQ5A 3RMHA 1EFID 2R93B 2B2VC 4RGNA 5M3MH 2N3SA 5CV8A 1VF5C 1QILA 1CSQA 4LFCL 4QUCA 2XTIA 2ZJPA 2WB1B 2I0QA 4JI7L 2DNEA 5EPJA 4P72A 1SNDA 4A3JG 1EIYB 2K5WA 3ITPA 4ZKCB 1MJEA 4J6HA 5JAVA 4ZUIA 1QOHA 4UP8A 4DR1Q 2Z6KA 2Z1CA 2R93H 4H44C 1KRSA 3CHBD 4V190 2CQOA 2ZJQA 4H7BA 4KD4A 1NJIC 1K8GA 4EVOA 1WCMH 1EYAA 4DV6L 1PH2A 4K5XA 3M3YB 2RBMA 3I4MB 1STNA 2XRSD 3P75A 4GS3A 5IGBA 4KMUC 2EY6A 4JI3Q 2F0KA 3HOYH 1JORA 3KLSX 1B53A 3I55A 1FNWA 2Q2UA 4DNTB 4HJ5A 2B2WA 4HCEA 1LTID 3D6CA 3QB3A 4DR7Q 4RHSA 5EJWA 3ND8A 3DM1A 1VQ6A 2V1CC 3M3YH 1LUZA 5LL6X 2EYHA 3I8ZA 3Q8DA 1V43A 3T53B 2KUMA 4A4IA 1GD7A 1JOKA 5EPLA 4QF4A 1WTVA 1GUTA 1TIID 1JB3A 3I4NB 2UXCQ 2Q8RE 1FJGQ 3K80C 4JI0L 5LL6S 3DLLA 3MXNB 2AQ1B 1A3VA 5AJ3Q 3A7LA 1V8QA 2GN5A 1I4GA 1VQDA 4RGMA 3S16B 1QZHA 1H9RA 1KDAA 1MHWC 4K6LA 3GTQB 4XXEA 4B08A 3AMUA 3RLOA 2KCCA 4EGVA 5HGQA 4CJ0B 1L1OA 3IL8A 4LFCQ 4YIJA 4JI7Q 2CQAA 1STHA 5FO7B 1WJJA 1BBUA 1PZJD 3LNNA 5C4JH 4M8AA 4C3IB 4CJ2C 1HCZA 4X65L 1UAPA 3M4PA 4A3FH 5ELCA 3JAMc 3S16H 3NBIA 3HKZE 3HOVG 3U58A 1KLUD 4RG1A 2J7ZA 3PO2B 4GKJL 3D31A 3I4OA 4X6AH 2BH8A 4A3MG 1O7YA 3K7UC 4DV6Q 1BVSA 5M3FB 1LM0A 2JQOA 1S5ED 4NW2A 5CGKA 4GKKL 3VA5A 2D5DA 5C44H 1Y69U 1F2LA 2AHOB 1HZBA 1VQ9A 1YNXA 1EYGA 1QVGA 3F2CA 4IPDA 3TBIB 2L0CA 4Q5VA 3JAMi 2EXDA 2NVTH 1PRTF 1SAPA 3C1FA 2CVRA 1CKOA 4O2DA 5I2XA 4YHHL 5M3FH 1FR3A 3N52A 3I70A 1KLGD 2ENBA 3DEOA 4ZYSA 2MJ8A 5CV7A 1IYVA 3TDQA 3BZCA 5F2DA 3PIO3 4JI0Q 4RWSC 3JAME 4IFDG 3S17B 1Y1WH 2ZXRA 1KRTA 1STYA 1Q81C 3EVQA 4KKUA 4YCUA 3HKZG 4KHPL 1VQ7A 2B2VA 1K3RA 2ZM6L 4HJ8A 1FVIA 3D6WA 1UE6A 5IYDH 4I65A 3TP8A 4OGQC 4RGTA 1Z47A 2KECA 2PW7A 1ET9A 1S5DD 1O78A 1SROA 1OO9B 2RHQB 1RHPA 3S17H 1VQFA 1LTBD 1KABA 5I9PA 2FINB 3JC66 4QJFA 4IOAA 4C3JH 4X65Q 4BBSG 4A3LH 3CC7A 3HP3A 4GKJQ 4A3JB 4G4KA 2VZAA 4C3HG 2EYFA 1I6VC 5IE8A 3Q24A 2IL8A 4GKKQ 1C7YA 2DY7A 2IJ0A 2CFMA 2EQSA 5GAGC 1QUQB 3OWFA 3NENA 3KLSA 1UNSA 4B3TL 1PYSB 1IW7C 1PTOH 1DCZA 2FHTA 1NCVA 2RDGA 5BR8L 1R4QB 3S1MB 1W6JA 5JVH3 3CU7A 4A3JH 5ELFA 3H0GB 1EEID 4YHHQ 5EPKA 3K58A 1EQTA 4B3ML 3HG9A 2MFIA 4OEMB 5I9OA 4NMZA 3T56B 1K73C 1PH9A 1JOQA 3D3RA 1SEBD 1PA6A 4LF5L 2L15A 1PFSA 2K04A 5G3LD 2C5CA 2F0UA 1SFOB 3S15B 2K6AA 1QJOA 3D8GA 2K50A 4QB4A 3CCUA 3S1MH 1K8MA 5CC4A 2VL6A 2NWGA 1VQMA 4DR6L 4KHPQ 2ZM6Q 2JYOA 3K5MA 2NZOA 4JYAL 2ALYB 1EEFD 3FKIG 3OMGA 5JJZA 4HIMA 3CW2C 2ICEC 3M4OB 4A3EH 1SXTA 1JCKB 4E6IA 1K83H 2RKSA 2Q2HA 4FDBA 3KFUA 3S15H 1VQIA 4WJ3M 5KYIA 1IHZA 4DKAC 1ZKOA 1HPCA 3OPOA 5CV6A 2E8GA 4F8MA 3HOXB 2SOBA 3TP7A 1Y14B 4KI0A 3P1HA 4A3DB 3RLNA 4R8IA 2HHHL 4GNXC 4DV1L 4LK1C 2LFNA 3G6JB 2A68D 1SJED 2Q2IA 2NZ1D 2B3GA 1A0IA 4X62Q 2Y0SG 5FKAC 2IW3A 2EPBA 2KEDA 4P2CB 1D5XC 1QVCA 2PI2A 2MQHA 2PNHA 5CV5A 3GD7A 4B3TQ 1VF7A 4X66L 2CW0C 1ZEQX 4DXGA 1UE7A 4O42A 3NTHA 5BR8Q 1NSNS 4DF7A 4DXFA 4DGZA 4JI2L 1L0XB 3FPUB 1YJ9A 4KJOA 4KY5A 2RHSB 5A2QL 3HZXA 4B3MQ 1LT3D 3ZYYX 1TWHB 1PH1A 3HOVH 5C0XH 2K01A 5IP9G 4LF5Q 5HURA 1CHPD 2FJ2A 4A3MH 2D9UA 5FLXL 1ML0D 3EFXD 2MNAA 1WTOA 2SNSA 1Q86C 2A68C 1SYBA 4FXGC 3EROA 5IGFA 5IOCA 3TS2A 1M8AA 3VYSA 4DAYB 4JYAQ 4F88A 3A74A 1TWHH 1EU4A 1ONLA 2AWOA 1H9JA 3K0XA 3K7AB 1BCPF 1GM5A 5DLQE 1I94L 3KDFA 3CCLA 1D8LA 3PCOB 2EYOA 2CKZB 3S1NB 4GN5A 3WOEA 4B3RL 3TZDA 5IWAL 4DV0L 4K5VA 1S72A 2VB3X 2X6GA 1SBBB 4IUNA 2ID0A 1WD1A 1RD9D 4JBWA 1CA6A 3HGBA 3TRZA 2HDMA 3BZKA 2KHIA 4MTNA 2HCIA 1OTCA 3UE0A 5M3MG 4PMCA 2K5DA 3SE0A 2AWNA 1AN8A 2HHHQ 4FF3A 4IFDH 4DV1Q 1JJCB 1ZXTA 3ONAB 3TN2A 1N36L 1WTXA 1STAA 1DXMA 3H3VH 2F03A 3PUYA 1EY8A 4UAIA 5M5YH 4PMBA 3UDIA 1HXYD 3QG1A 2IHFA 4JI8L 4X66Q 3QO2A 2Q8TA 1TS4A 5KNDA 2RQXA 1WCMG 2QF7A 4R4QA 4JI2Q 3TEHB 3LGJA 4GLVB 4LF6L 3GTJB 1E2ZA 1SRUA 2C35B 1WTWA 2EOTA 2RA4A 4B9XA 3T51B 3T1YL 2VQFL 4BBSH 3GTPB 5T1IA 3RR5A 4C1NI 3HOYG 1RTOA 4Y7NH 4X3KA 5KIXA 4OONA 3TREA 1ESFA 3D0FA 1XPUA 1TY0A 4KV6A 2KQ3A 4DN4M 1T9HA 4C3HH 2K14A 4NP5A 4AH6A 2M00A 4LFAL 1PH4A 2A74C 3KF6B 4P74A 2QILA 4R4CA 4OX9L 1EOTA 1IL2A 2RF4A 1TWFB 3N6RA 3GTPH 1BKBA 3C2PA 1I94Q 5H1SE 2OTLA 4R9WA 1ILQA 2KA7A 2LXJA 4B3RQ 5IWAQ 4DV0Q 1U4LA 2AQ3B 3BVZA 4OO1I 1I5FA 4ZUJA 1DJRD 3FRPB 2JXMB 4CKEA 1XWEA 4JC0A 1VCIA 2TSSA 3BYTB 1I50H 4GNXA 3OWEB 1B1ZA 1TWFH 1NR2A 4BY1B 2LSSA 1PH3A 1S3OA 5IIFA 2HQLA 3KYHC 4KK7A 2RCNA 1Q1EA 4LW1A 1N36Q 3DXJC 3QIAA 2AUKA 3MA2B 1I4RA 1YJWA 3U9SA 1I6HB 1VQGA 3FKIH 3NQTA 1SNCA 3A8JE 2QGQA 4JI8Q 1D1KA 1GHJA 1LYLA 2EVBA 2RDHA 2WAQE 1VQLA 2ZTEA 2LY7A 4HMJA 2K28A 4CJ1B 3VYUA 3SHLA 2F52A 4LF6Q 2KCTA 3HOZB 1XNRL 5E1FA 2RCFA 3OMCA 3RN5A 1WYDA 3T1YQ 2VQFQ 4XIGS 1CI3M 4BBRG 1D1IA 1GUNA 1B8AA 2IX3A 1O7IA 2M2LA 1AE3A 4M1UB 5I6WA 2A69D 3CCVA 2JA5G 3A5ZB 1TWCB 4DR4L 1JICA 4PV1C 5C4XG 5CMDA 1ASZA 1SDFA 4LFAQ 4OXPA 1NMGA 2Q2TA 4A3BB 1CQVA 4OX9Q 3HOUG 1HNWL 4F7XA 4UDUC 3R93A 1KIXA 2NTSA 4PZ7A 5J3BA 5IP7G 4DU9A 1SLJA 1PRTD 4X3TA 4OWWB 5IGDA 3NE5B 4BWGB 1HNZL 1Y8NB 1B7YB 2L9HA 1TWCH 2F3WA 3MWYW 1Y1WG 1C9OA 1X3EA 4N8X1 1BBXC 4BY7H 1RKNA 5DM63 1GOZA 5M5XB 1XX8A 3Q22A 5IP9H 1HA5A 2R92G 5HGTA 1NAPA 1RODA 4ID6A 3J81c 3G71A 2BOSA 2HUGA 3KF8B 1PZKD 4A3IG 1WVLA 2A69C 2N88A 3VR2A 4PG3A 4NPSA 5M3MB 1LACA 3H91A 2XN9C 4RKBA 3HFZB 5IYCG 4A3LG 4L5QA 1E1OA 4GOPB 1FNUA 3S24A 2H1EA 1PRTC 1A8VA 2XWJB 3J81i 1QNKA 2OCEA 3JAML 4XQNA 2E74C 3NQIA 3L3OC 1XNRQ 2DY8A 4LFBL 4OHJA 5J22A 3CKIB 5CV9A 1XTCD 2F0FA 3DUZA 1T5EA 3STBC 3GV6A 4LF7L 4FO2A 4WRDA 1LABA 3F2BA 1WCMB 4POFA 5FO9B 4DR4Q 2RSNA 2B2YC 3J81E 4HAEA 2E76C 5KNBA 4DFAA 1EZ8A 1K8AC 1JE5A 4PZ8A 2R7ZG 3HOYB 3ZJYC 4MNOA 4QQBX 2UUBL 4ZLTF 1HNWQ 5C4HA 3VR3A 1X3GA 2JEAI 1IXRA 2VUMG 2SNMA 1Q8IA 4FVMA 3EQLC 3PIPA 2H5XA 2DJGC 5FO8B 4LF4L 1NE3A 3HOWG 2PQEA 1HNZQ 2LXKA 4NXNL 3K57A 3FMCA 1EIGA 1SYGA 5T1GA 1N32L 3PMFA 2CWPA 1JJ2A 4YCWA 2EY2A 2F0JA 2E5LL 5JJIA 2K32A 2KENA 5DM73 5C3XA 1B50A 1LTLA 4A3EG 1AH9A 3CC4A 1YHAA 3ICEA 5LHY1 2AKWB 1KNAA 3KBGA 4APVA 3NHHA 3O13A 2D62A 3X3NA 5BN5A 5DAUA 2MP1A 4UP7A 3M7NA 1YBYA 2QEJC 1Q90A 1YVCA 5JPNC 1RIPA 3OW7A 3F1ZA 1E7ZA 2LS01 1F9RA 1SJHD 4QMGA 4I7ZC 4U68A 5C4JB 1GXDC 1TQOA 4ME3A 1XMQQ 3DWPA 1CK1A 3MEFA 5GAEC 3EN2A 4DK3C 3F2UA 4G7ZC 4ZAIA 3BDLA 4L6TB 4A3FB 3G4SA 1V1PA 4LFBQ 1PZID 4JPBW 3OOCA 2F3IA 5EKKA 2K5VA 1VQEA 4LF7Q 1MKHA 2A6ED 3B6YA 1GHKA 4HJ7A 3NBHB 2H4OA 1VQHA 3IFTA 5C44B 2NZHA 4QIWE 2NN6G 1BQQT 2KHSA 1O80A 1E1TA 5E4WC 2UUBQ 1EY4A 4IJHA 4LAAA 3SXHA 4WFN3 1HUMA 5C0XG 2HIVA 2JA5B 3CRKC 5FK9C 2NVTB 3K0YA 2XIWA 4LF4Q 4V0BA 3DEPA 3CMAA 1IBLL 4NXNQ 3W1GA 5ELOA 2UU9L 2HD3A 2VW9A 3EBEA 1N32Q 1EIFA 3S2HH 1ET6A 1H9SA 4BBRH 2E5LQ 2PZWA 4NB3A 2F0MA 1W3SA 2JA5H 1K0SA 1Y1WB 1EY5A 1VQCA 3CF5A 4RH6A 2IHEA 4K2KA 5C4XH 2A6EC 3RZDH 2J4XA 2B2TA 5D3DA 2E2HH 4KJNA 2EYPA 3AFQA 1EQRA 2WAQB 1IBKL 3HOUH 2R92B 5JVG3 2A6HD 2WACA 2MUYA 4XYQA 1E0BA 1DOMA 2BCOA 4RAUC 3ERSX 4DK6C 5IP7H 1XXGA 2JA9A 3EA6A 3S14B 1F2YA 1UWVA 2F0TA 1GKHA 4JW0A 2B2UC 4C3JB 2DJFC
chains in the Genus database with same CATH topology
4B3TQ 4X66L 4R4IA 4JCVE 2GVAA 1H95A 1UE7A 2B63H 5BR8Q 2R92H 1L2FA 2D0OA 1KAWA 4DR5L 4JI2L 1YJ9A 1FL0A 3ER0A 3KJPA 2RHSB 2ZTCA 3OTOL 2N8NA 4A3IH 4B3MQ 3CP0A 1CKNB 1FGUA 3U4VA 3CMEA 3ULPA 4JG2A 1PH1A 3HOVH 3S14H 4B3SL 5IP9G 2UXBL 1D7QA 4LF5Q 1OXSC 4A75A 2VQEQ 4A3MH 1IBMQ 2YTVA 5IY0A 3CQZH 1WI5A 5IYCH 4A3FG 2MNAA 1Q86C 5LMUQ 3AFPA 2IT1A 4DR2L 3OW2A 4YY3L 1YJNA 2KBNA 2NVXH 3TS2A 3H0GG 1N9WA 4DAYB 3M85A 3KDFB 4JYAQ 3W1BA 1IBLQ 1J5EL 4BY1H 3A74A 1TWHH 2AWOA 3UDFA 3J80c 2UU9Q 3K0XA 4X62L 4DUZL 4A3KH 1V1QA 5DLQE 1GM5A 3KDFA 4C2MH 1I94L 1D8LA 3PCOB 1YI2A 5GAHC 3CCLA 1CSPA 5C44G 2CKZB 4HIOA 4LUZA 1HNXL 2FXQA 4GN5A 1VQ8A 2VNUD 4B3RL 1JJGA 1IZ6A 5IWAL 3KOJA 2WP8J 4R4TA 4DV0L 4LUVA 1Z9FA 4DAMA 4HJ9A 1S72A 1KD1C 1K0RA 2ID0A 4H02A 3UE1A 4JBWA 3I4MH 3TRZA 3BZKA 2KHIA 1OXUA 4MTNA 4JI4L 1G6PA 1L1OC 1MIUA 1OTCA 4JI5Q 3UE0A 2ASBA 1EOVA 1YHBA 3L0OA 5M3MG 3CPWA 2K75A 5M3FG 1L0WA 4DV4L 2R7ZH 2AWNA 3J7A5 3TQYA 1E22A 1IBKQ 2HHHQ 4DR1L 4DV1Q 1XJVA 3HOZH 3J80i 3I2ZA 1JJCB 1PH5A 3NELA 1J6QA 2VUMH 5JEAG 1X3FA 2DUDA 2Y0SE 1N36L 1SR3A 2XGTA 2UUCQ 3HOWH 3H3VH 3PUYA 1KHIA 5GROA 3KLWA 4LUOA 3NEMA 2QEXA 2ZJRA 5M5YH 2NVQH 3UDIA 4IPCA 1M1KC 5EAYA 3AYHB 2UXDL 1NTGA 1HH2P 2BH2A 3GTLH 3PUWA 4X64L 1MJCA 2IHFA 4JI8L 4X66Q 3I4NH 2VY3A 3HOXG 1W2BA 1X56A 2OQ0A 3KJOA 4P75A 4JI3L 5IYBH 3CPFA 3STBD 4A3BH 1WCMG 3A5UA 4IOCA 5IYDG 3J7ZC 4DR5Q 4A3DG 2WAQG 4R4QA 1UE1A 4JI2Q 1R9TH 2I5MX 3LGJA 4GLVB 4IPGA 3TEHB 4LF6L 2PMZE 3AEVA 1SRUA 4YWLA 2C35B 4JOIA 1HR0W 4OO1G 2JK8A 3OTOQ 1PH7A 4A3CG 1SN8A 1PH6A 4A76A 4J15A 2VQFL 4LWCA 2MO1A 3T1YL 4BBSH 4DR7L 4B3SQ 3RR5A 3HOYG 2OQKA 3PF4A 4L5SA 4Y7NH 4POGA 2UXBQ 1N33L 2ZTDA 3GTQH 3I7FA 1Q46A 4OONA 3DM3A 3TREA 4JV5L 3CD6A 2IX0A 2KCMA 3D0FA 4KLKA 4QL5A 2A19A 4DV5L 1XPUA 1GVPA 4BXXH 1T9HA 4C3HH 2K14A 4AH6A 2ES2A 1XTDA 5M5XH 2UXCL 2R6GA 4LFAL 1PH4A 4DR2Q 1FJGL 3KF6B 4YY3Q 4P74A 3GDEA 2NVYH 4R4CA 4L5TA 2A8VA 3W5OA 4R4OA 5AJ3L 4OX9L 3IRBA 4C3IH 2YU9H 1Q12A 2GVBA 3F2DA 4HJAA 5C0XJ 1J5EQ 1IL2A 2RF4A 2Z0SA 3KF6A 3PUVA 4GOPA 3PIOA 1BKBA 3GTPH 3FHWA 4DUZQ 1I94Q 3G48A 3F8TA 5H1SE 4GN3B 2OTLA 1HNXQ 4EQ5A 2LXJA 3PO2H 2YV5A 4B3RQ 2WFWA 5IWAQ 5M3MH 4DV0Q 4OO1I 2N3SA 1I5FA 3EIVA 1CSQA 4A93G 4LFCL 2XTIA 2ZJPA 4JC0A 2I0QA 4JI4Q 1VCIA 4JI7L 1VQBA 1I50H 4P72A 4JBKA 4GNXA 3PO3H 4A3JG 1EIYB 4DV4Q 1MJEA 1TWFH 1DGSA 4UP8A 1GO3E 1XPRA 4BY7G 2LSSA 4UP9A 4DR1Q 1PH3A 1S3OA 3OYYA 2HQLA 3FP9A 3CCEA 3KYHC 2Z6KA 2RCNA 1Q1EA 4LW1A 1N36Q 5FJ8G 3H15A 2JA6G 2CWAA 2R93H 2AMCB 1VQNA 1KRSA 3GTKH 2CQOA 5GQOA 2ZJQA 2JA8G 3HKSA 1YJWA 1NJIC 1K8GA 1HZAA 1VQGA 1WCMH 4DV6L 4JBMA 1PH2A 3FKIH 2A1AA 1VQPA 1ASYA 3L2PA 2UXDQ 4IPHA 1KC8C 4GS3A 2QGQA 4JI8Q 4X64Q 4OWTB 1PVOA 2WAQE 1LYLA 4IFDJ 2JE6I 1VQLA 2ZTEA 4JI3Q 2ATWA 1VQ4A 4JI6L 3HOYH 1YZ6A 3I55A 2F52A 4LF6Q 2KCTA 1Q82C 2Q2UA 3K8AA 4HJ5A 1XNRL 2JEBI 3RN5A 5C3EH 1WYDA 3T1YQ 2VQFQ 4XIGS 1UEBA 2N49A 4DR7Q 1VQ6A 4BBRG 1U0LA 2V1CC 1VQ5A 2N78A 2QA4A 3PF5A 1B8AA 5IT9c 1N33Q 3M3YH 1LUZA 1O7IA 4JV5Q 2R7FA 1AE3A 4AIMA 2I5HA 2JA5G 4UY8C 3CAMA 3A0JA 3Q8DA 3A5ZB 3CCVA 4DV5Q 1V43A 1HR0L 4DR4L 4A4IA 1Y1VG 4KHZA 1GD7A 1PHJA 4P71A 4P73A 5C4XG 1B70B 2UXCQ 1EQQA 1ASZA 3ULJA 4LFAQ 1QZGA 3K80C 4OXPA 1NMGA 1FJGQ 2K52A 2Q2TA 4JI0L 4DV2L 3DLLA 3E0EA 3MXNB 4OX9Q 3HOUG 5AJ3Q 5GADC 1HNWL 4A3GG 1NY4A 4DUYL 1HZ9A 3S2DH 2UUAL 3RLFA 2BA1A 1KIXA 4PZ7A 4NXML 5J3BA 4A93H 1TWAH 1M90C 5IP7G 3UDXA 1SLJA 2GN5A 1V9PA 1VQDA 1QUQA 1QZHA 4OWWB 2JA7G 2K5NA 1HNZL 1VQAA 1B7YB 4IO9A 4OWXB 1TWCH 3RLOA 4AQYL 1Y1WG 4BA2I 5FLMG 1C9OA 5HGQA 1X3EA 3CCJA 1L1OA 5HY6A 4BY7H 1XPOA 4LFCQ 4DV3L 3CC2A 1I6HH 5ELNA 1N34L 4JI7Q 5IP9H 4JOIC 2B63G 4EX5A 2R92G 1WJJA 1BBUA 1RL2A 5C4JH 3J81c 2JA8H 3PV0A 3G71A 3KF8B 4X65L 1Q8KA 4A3IG 3M4PA 4A3FH 2OWOA 4GLXA 2F4VL 3JAMc 3S16H 1Q1BA 3HOVG 2JJQA 3HKZE 3U58A 1G51A 4RG1A 4R1JA 3H0GH 1A63A 4GKJL 1JT8A 3D31A 3I4OA 3BU2A 2BH8A 3M9BA 4PG3A 4NPSA 4A3MG 4X6AH 3K7UC 4DV6Q 1BVSA 4DR3L 2YYZA 5JEAJ 1LM0A 2JQOA 5K36G 1G291 3HFZB 5IYCG 4A3LG 4L5QA 1E1OA 4IJLA 3T1HL 4GOPB 1YHQA 4GKKL 3G6EA 5C44H 1KQSA 2HT1A 3S24A 1XMOL 4AYBE 1A8VA 5LMNW 3J81i 4JI6Q 2AHOB 1HZBA 2OCEA 1YNXA 4BY1G 1VQ9A 1EYGA 1QVGA 1TXYA 3F2CA 1SFOH 4IPDA 1X54A 1WFQA 3JAMi 1XNRQ 4HIKA 4LF8L 1X65A 4A3KG 4LFBL 2EXDA 5E7NA 4TVAB 1SE8A 2NVTH 2DGYA 3WWVA 1U5KA 1IYJB 1HZCA 1CKOA 3STBC 1YEZA 4O2DA 4UPAA 1P8LA 4YHHL 5M3FH 1VQKA 1QVFA 4TQUS 4GNXB 4LF7L 3F2BA 4POFA 1TWGH 5JJLA 4WJ4A 3PGZA 3L7ZC 1HR0Q 2I5LX 1I3QH 1WOCA 3U50C 5C0XI 3M4OH 4DR4Q 3U4ZA 3BZCA 5JJKA 2YTYA 1JB7A 1Q7YC 4JI0Q 1K8AC 4DV2Q 1JE5A 4PZ8A 4PMWA 2R7ZG 3ZJYC 4MNOA 1CUKA 4QQBX 2UUBL 4IFDG 1HNWQ 3HOZG 2IY5B 3PSIA 1X3GA 1YIJA 1Y1WH 4DUYQ 1KRTA 1IXRA 2JEAI 2VUMG 2UUAQ 4HIDA 4NXMQ 1Q81C 1E24A 1KL9A 4YCUA 3HKZG 1PYBA 3SGIA 3PIPA 3HOXH 2H5XA 4KHPL 2HIXA 1VQ7A 4LF4L 1K3RA 1NE3A 2ZM6L 4HJ8A 3HOWG 1FVIA 5FLXc 5IYDH 1UE6A 1HNZQ 4A3DH 3GTMH 2LXKA 1EWIA 4NXNL 2BA0A 4AQYQ 4DNIA 5LMNQ 4JI1L 1VS0A 4K0KL 1Z47A 4Y52H 2K5HA 1JMCA 4DV3Q 4L5RC 4A3CH 1N32L 3I4NG 2CWPA 1KXLA 1JJ2A 2CCZA 1YITA 5IYBG 4YCWA 1SROA 2RHQB 1N34Q 2E5LL 4A3BG 1BBWA 2OTJA 2KENA 1EUJA 2YTXA 4AYBG 3S17H 1VQFA 2PI2E 4LNQA 1LTLA 3JC66 1VQJA 1CKNA 4QJFA 4A3EG 1X6OA 4C3JH 4IOAA 3M4QA 4X65Q 1YHAA 3CC4A 1XNQL 3ICEA 2AKWB 1AH9A 2F4VQ 4APVA 4RMFA 4BBSG 3S1RH 4A3LH 3UDGA 2D62A 3CC7A 4UP7A 4DR6Q 3M7NA 4IFDI 1YBYA 4GKJQ 3J81j 1S40A 1OXVA 3BJUA 1YVCA 2WB1E 4YWKA 2D0PA 4BXXG 4DR3Q 1RIPA 4LF9L 3F1ZA 2VS1A 2VZAA 1E7ZA 3GTOH 3H3VI 3T1HQ 5IE8A 3S1QH 4GKKQ 1C7YA 1XMOQ 2CFMA 2EQSA 2KHJA 5GAGC 4DV7L 1QUQB 3CCRA 1XMQQ 4ME3A 5GAEC 3CCMA 3MEFA 3NENA 3EN2A 4DK3C 4B3TL 1PYSB 1K9MC 3G4SA 4LF8Q 1L1OB 4LFBQ 3AQQA 4QY7A 5BR8L 1C0AA 4A3JH 3PO2G 2F3IA 5LMNL 2K5VA 4YHHQ 1VQEA 4PZ6A 1PH8A 4LF7Q 1A62A 1MKHA 4B3ML 1PV4A 1AE2A 3B6YA 2MFIA 3K7AH 3RZOH 4GLAC 4HJ7A 1K73C 1PH9A 4YCVA 3NBHB 1VQHA 5FJ8H 2JA6H 1VQOA 4QGUA 4GN4B 3VDYA 3S1NH 1PA6A 4BA1I 4LF5L 3PO3G 2NZHA 2L15A 1PFSA 2NN6G 4QIWE 1CKMA 2VQEL 1IBML 1EFWA 3CCQA 1E1TA 4JBJA 2UUBQ 1X55A 4IJHA 5C0XG 5LMUL 2K50A 1UE5A 2HIVA 3CCUA 3S1MH 1VQMA 2VL6A 4KHPQ 4DR6L 3K81C 2R93G 3I56A 4LF4Q 2ZM6Q 2EIFA 4YWMA 2NZOA 4JYAL 4XTCS 3CMAA 2K4KA 1E3PA 4O0AA 1IBLL 1NMFA 3CCSA 4NXNQ 2ALYB 3FKIG 3W1GA 2PQAB 2WB1G 1OXTA 5ELOA 2R7DA 4JI1Q 4DPGA 2VW9A 4HIMA 2UU9L 4K0KQ 3CW2C 3EBEA 4A3EH 1N32Q 2MO0A 3GO5A 4GOPC 3ULLA 1EIFA 1K83H 2PQAA 3S2HH 4BBRH 1XMQL 3TS0A 3RN2A 1N8RC 2E5LQ 2Q2HA 4FDBA 3KFUA 4NB3A 3S15H 1X9NA 1W3SA 2JA5H 1VQIA 4WJ3M 1Y1VH 1VQCA 1XNQQ 3CF5A 5M5WH 4ALPA 2IHEA 4DKAC 5C4XH 3RZDH 5C3EG 3E9HA 3GTGH 4JI5L 1SMXA 2E8GA 2E2HH 2NN6I 1Y14B 4KI0A 1NBWA 1P16A 3AFQA 1EQRA 3RLNA 1IBKL 2HHHL 3HOUH 3I4MG 3GTJH 4GNXC 4DV1L 2E2JH 4A3GH 3RNUA 4LF9Q 2UUCL 3CXCA 2Q2IA 3ERSX 4DK6C 5IP7H 2E2IH 2JA9A 2B3GA 1A0IA 4X62Q 2B29A 2Y0SG 2Z6KC 2JA7H 5JJIA 3PUZA 3PUXA 2IX1A 1OXXK 1UWVA 4DV7Q 1GKHA 1QVCA 2PI2A 3E9IA 5FLMH 2MQHA 1HJPA 2PNHA 3GD7A 4MZ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3T Q;  4X66 L;  4R4I A;  4JCV E;  2GVA A;  1H95 A;  1UE7 A;  2B63 H;  5BR8 Q;  2R92 H;  1L2F A;  2D0O A;  1KAW A;  4DR5 L;  4JI2 L;  1YJ9 A;  1FL0 A;  3ER0 A;  3KJP A;  2RHS B;  2ZTC A;  3OTO L;  2N8N A;  4A3I H;  4B3M Q;  3CP0 A;  1CKN B;  1FGU A;  3U4V A;  3CME A;  3ULP A;  4JG2 A;  1PH1 A;  3HOV H;  3S14 H;  4B3S L;  5IP9 G;  2UXB L;  1D7Q A;  4LF5 Q;  1OXS C;  4A75 A;  2VQE Q;  4A3M H;  1IBM Q;  2YTV A;  5IY0 A;  3CQZ H;  1WI5 A;  5IYC H;  4A3F G;  2MNA A;  1Q86 C;  5LMU Q;  3AFP A;  2IT1 A;  4DR2 L;  3OW2 A;  4YY3 L;  1YJN A;  2KBN A;  2NVX H;  3TS2 A;  3H0G G;  1N9W A;  4DAY B;  3M85 A;  3KDF B;  4JYA Q;  3W1B A;  1IBL Q;  1J5E L;  4BY1 H;  3A74 A;  1TWH H;  2AWO A;  3UDF A;  3J80 c;  2UU9 Q;  3K0X A;  4X62 L;  4DUZ L;  4A3K H;  1V1Q A;  5DLQ E;  1GM5 A;  3KDF A;  4C2M H;  1I94 L;  1D8L A;  3PCO B;  1YI2 A;  5GAH C;  3CCL A;  1CSP A;  5C44 G;  2CKZ B;  4HIO A;  4LUZ A;  1HNX L;  2FXQ A;  4GN5 A;  1VQ8 A;  2VNU D;  4B3R L;  1JJG A;  1IZ6 A;  5IWA L;  3KOJ A;  2WP8 J;  4R4T A;  4DV0 L;  4LUV A;  1Z9F A;  4DAM A;  4HJ9 A;  1S72 A;  1KD1 C;  1K0R A;  2ID0 A;  4H02 A;  3UE1 A;  4JBW A;  3I4M H;  3TRZ A;  3BZK A;  2KHI A;  1OXU A;  4MTN A;  4JI4 L;  1G6P A;  1L1O C;  1MIU A;  1OTC A;  4JI5 Q;  3UE0 A;  2ASB A;  1EOV A;  1YHB A;  3L0O A;  5M3M G;  3CPW A;  2K75 A;  5M3F G;  1L0W A;  4DV4 L;  2R7Z H;  2AWN A;  3J7A 5;  3TQY A;  1E22 A;  1IBK Q;  2HHH Q;  4DR1 L;  4DV1 Q;  1XJV A;  3HOZ H;  3J80 i;  3I2Z A;  1JJC B;  1PH5 A;  3NEL A;  1J6Q A;  2VUM H;  5JEA G;  1X3F A;  2DUD A;  2Y0S E;  1N36 L;  1SR3 A;  2XGT A;  2UUC Q;  3HOW H;  3H3V H;  3PUY A;  1KHI A;  5GRO A;  3KLW A;  4LUO A;  3NEM A;  2QEX A;  2ZJR A;  5M5Y H;  2NVQ H;  3UDI A;  4IPC A;  1M1K C;  5EAY A;  3AYH B;  2UXD L;  1NTG A;  1HH2 P;  2BH2 A;  3GTL H;  3PUW A;  4X64 L;  1MJC A;  2IHF A;  4JI8 L;  4X66 Q;  3I4N H;  2VY3 A;  3HOX G;  1W2B A;  1X56 A;  2OQ0 A;  3KJO A;  4P75 A;  4JI3 L;  5IYB H;  3CPF A;  3STB D;  4A3B H;  1WCM G;  3A5U A;  4IOC A;  5IYD G;  3J7Z C;  4DR5 Q;  4A3D G;  2WAQ G;  4R4Q A;  1UE1 A;  4JI2 Q;  1R9T H;  2I5M X;  3LGJ A;  4GLV B;  4IPG A;  3TEH B;  4LF6 L;  2PMZ E;  3AEV A;  1SRU A;  4YWL A;  2C35 B;  4JOI A;  1HR0 W;  4OO1 G;  2JK8 A;  3OTO Q;  1PH7 A;  4A3C G;  1SN8 A;  1PH6 A;  4A76 A;  4J15 A;  2VQF L;  4LWC A;  2MO1 A;  3T1Y L;  4BBS H;  4DR7 L;  4B3S Q;  3RR5 A;  3HOY G;  2OQK A;  3PF4 A;  4L5S A;  4Y7N H;  4POG A;  2UXB Q;  1N33 L;  2ZTD A;  3GTQ H;  3I7F A;  1Q46 A;  4OON A;  3DM3 A;  3TRE A;  4JV5 L;  3CD6 A;  2IX0 A;  2KCM A;  3D0F A;  4KLK A;  4QL5 A;  2A19 A;  4DV5 L;  1XPU A;  1GVP A;  4BXX H;  1T9H A;  4C3H H;  2K14 A;  4AH6 A;  2ES2 A;  1XTD A;  5M5X H;  2UXC L;  2R6G A;  4LFA L;  1PH4 A;  4DR2 Q;  1FJG L;  3KF6 B;  4YY3 Q;  4P74 A;  3GDE A;  2NVY H;  4R4C A;  4L5T A;  2A8V A;  3W5O A;  4R4O A;  5AJ3 L;  4OX9 L;  3IRB A;  4C3I H;  2YU9 H;  1Q12 A;  2GVB A;  3F2D A;  4HJA A;  5C0X J;  1J5E Q;  1IL2 A;  2RF4 A;  2Z0S A;  3KF6 A;  3PUV A;  4GOP A;  3PIO A;  1BKB A;  3GTP H;  3FHW A;  4DUZ Q;  1I94 Q;  3G48 A;  3F8T A;  5H1S E;  4GN3 B;  2OTL A;  1HNX Q;  4EQ5 A;  2LXJ A;  3PO2 H;  2YV5 A;  4B3R Q;  2WFW A;  5IWA Q;  5M3M H;  4DV0 Q;  4OO1 I;  2N3S A;  1I5F A;  3EIV A;  1CSQ A;  4A93 G;  4LFC L;  2XTI A;  2ZJP A;  4JC0 A;  2I0Q A;  4JI4 Q;  1VCI A;  4JI7 L;  1VQB A;  1I50 H;  4P72 A;  4JBK A;  4GNX A;  3PO3 H;  4A3J G;  1EIY B;  4DV4 Q;  1MJE A;  1TWF H;  1DGS A;  4UP8 A;  1GO3 E;  1XPR A;  4BY7 G;  2LSS A;  4UP9 A;  4DR1 Q;  1PH3 A;  1S3O A;  3OYY A;  2HQL A;  3FP9 A;  3CCE A;  3KYH C;  2Z6K A;  2RCN A;  1Q1E A;  4LW1 A;  1N36 Q;  5FJ8 G;  3H15 A;  2JA6 G;  2CWA A;  2R93 H;  2AMC B;  1VQN A;  1KRS A;  3GTK H;  2CQO A;  5GQO A;  2ZJQ A;  2JA8 G;  3HKS A;  1YJW A;  1NJI C;  1K8G A;  1HZA A;  1VQG A;  1WCM H;  4DV6 L;  4JBM A;  1PH2 A;  3FKI H;  2A1A A;  1VQP A;  1ASY A;  3L2P A;  2UXD Q;  4IPH A;  1KC8 C;  4GS3 A;  2QGQ A;  4JI8 Q;  4X64 Q;  4OWT B;  1PVO A;  2WAQ E;  1LYL A;  4IFD J;  2JE6 I;  1VQL A;  2ZTE A;  4JI3 Q;  2ATW A;  1VQ4 A;  4JI6 L;  3HOY H;  1YZ6 A;  3I55 A;  2F52 A;  4LF6 Q;  2KCT A;  1Q82 C;  2Q2U A;  3K8A A;  4HJ5 A;  1XNR L;  2JEB I;  3RN5 A;  5C3E H;  1WYD A;  3T1Y Q;  2VQF Q;  4XIG S;  1UEB A;  2N49 A;  4DR7 Q;  1VQ6 A;  4BBR G;  1U0L A;  2V1C C;  1VQ5 A;  2N78 A;  2QA4 A;  3PF5 A;  1B8A A;  5IT9 c;  1N33 Q;  3M3Y H;  1LUZ A;  1O7I A;  4JV5 Q;  2R7F A;  1AE3 A;  4AIM A;  2I5H A;  2JA5 G;  4UY8 C;  3CAM A;  3A0J A;  3Q8D A;  3A5Z B;  3CCV A;  4DV5 Q;  1V43 A;  1HR0 L;  4DR4 L;  4A4I A;  1Y1V G;  4KHZ A;  1GD7 A;  1PHJ A;  4P71 A;  4P73 A;  5C4X G;  1B70 B;  2UXC Q;  1EQQ A;  1ASZ A;  3ULJ A;  4LFA Q;  1QZG A;  3K80 C;  4OXP A;  1NMG A;  1FJG Q;  2K52 A;  2Q2T A;  4JI0 L;  4DV2 L;  3DLL A;  3E0E A;  3MXN B;  4OX9 Q;  3HOU G;  5AJ3 Q;  5GAD C;  1HNW L;  4A3G G;  1NY4 A;  4DUY L;  1HZ9 A;  3S2D H;  2UUA L;  3RLF A;  2BA1 A;  1KIX A;  4PZ7 A;  4NXM L;  5J3B A;  4A93 H;  1TWA H;  1M90 C;  5IP7 G;  3UDX A;  1SLJ A;  2GN5 A;  1V9P A;  1VQD A;  1QUQ A;  1QZH A;  4OWW B;  2JA7 G;  2K5N A;  1HNZ L;  1VQA A;  1B7Y B;  4IO9 A;  4OWX B;  1TWC H;  3RLO A;  4AQY L;  1Y1W G;  4BA2 I;  5FLM G;  1C9O A;  5HGQ A;  1X3E A;  3CCJ A;  1L1O A;  5HY6 A;  4BY7 H;  1XPO A;  4LFC Q;  4DV3 L;  3CC2 A;  1I6H H;  5ELN A;  1N34 L;  4JI7 Q;  5IP9 H;  4JOI C;  2B63 G;  4EX5 A;  2R92 G;  1WJJ A;  1BBU A;  1RL2 A;  5C4J H;  3J81 c;  2JA8 H;  3PV0 A;  3G71 A;  3KF8 B;  4X65 L;  1Q8K A;  4A3I G;  3M4P A;  4A3F H;  2OWO A;  4GLX A;  2F4V L;  3JAM c;  3S16 H;  1Q1B A;  3HOV G;  2JJQ A;  3HKZ E;  3U58 A;  1G51 A;  4RG1 A;  4R1J A;  3H0G H;  1A63 A;  4GKJ L;  1JT8 A;  3D31 A;  3I4O A;  3BU2 A;  2BH8 A;  3M9B A;  4PG3 A;  4NPS A;  4A3M G;  4X6A H;  3K7U C;  4DV6 Q;  1BVS A;  4DR3 L;  2YYZ A;  5JEA J;  1LM0 A;  2JQO A;  5K36 G;  1G29 1;  3HFZ B;  5IYC G;  4A3L G;  4L5Q A;  1E1O A;  4IJL A;  3T1H L;  4GOP B;  1YHQ A;  4GKK L;  3G6E A;  5C44 H;  1KQS A;  2HT1 A;  3S24 A;  1XMO L;  4AYB E;  1A8V A;  5LMN W;  3J81 i;  4JI6 Q;  2AHO B;  1HZB A;  2OCE A;  1YNX A;  4BY1 G;  1VQ9 A;  1EYG A;  1QVG A;  1TXY A;  3F2C A;  1SFO H;  4IPD A;  1X54 A;  1WFQ A;  3JAM i;  1XNR Q;  4HIK A;  4LF8 L;  1X65 A;  4A3K G;  4LFB L;  2EXD A;  5E7N A;  4TVA B;  1SE8 A;  2NVT H;  2DGY A;  3WWV A;  1U5K A;  1IYJ B;  1HZC A;  1CKO A;  3STB C;  1YEZ A;  4O2D A;  4UPA A;  1P8L A;  4YHH L;  5M3F H;  1VQK A;  1QVF A;  4TQU S;  4GNX B;  4LF7 L;  3F2B A;  4POF A;  1TWG H;  5JJL A;  4WJ4 A;  3PGZ A;  3L7Z C;  1HR0 Q;  2I5L X;  1I3Q H;  1WOC A;  3U50 C;  5C0X I;  3M4O H;  4DR4 Q;  3U4Z A;  3BZC A;  5JJK A;  2YTY A;  1JB7 A;  1Q7Y C;  4JI0 Q;  1K8A C;  4DV2 Q;  1JE5 A;  4PZ8 A;  4PMW A;  2R7Z G;  3ZJY C;  4MNO A;  1CUK A;  4QQB X;  2UUB L;  4IFD G;  1HNW Q;  3HOZ G;  2IY5 B;  3PSI A;  1X3G A;  1YIJ A;  1Y1W H;  4DUY Q;  1KRT A;  1IXR A;  2JEA I;  2VUM G;  2UUA Q;  4HID A;  4NXM Q;  1Q81 C;  1E24 A;  1KL9 A;  4YCU A;  3HKZ G;  1PYB A;  3SGI A;  3PIP A;  3HOX H;  2H5X A;  4KHP L;  2HIX A;  1VQ7 A;  4LF4 L;  1K3R A;  1NE3 A;  2ZM6 L;  4HJ8 A;  3HOW G;  1FVI A;  5FLX c;  5IYD H;  1UE6 A;  1HNZ Q;  4A3D H;  3GTM H;  2LXK A;  1EWI A;  4NXN L;  2BA0 A;  4AQY Q;  4DNI A;  5LMN Q;  4JI1 L;  1VS0 A;  4K0K L;  1Z47 A;  4Y52 H;  2K5H A;  1JMC A;  4DV3 Q;  4L5R C;  4A3C H;  1N32 L;  3I4N G;  2CWP A;  1KXL A;  1JJ2 A;  2CCZ A;  1YIT A;  5IYB G;  4YCW A;  1SRO A;  2RHQ B;  1N34 Q;  2E5L L;  4A3B G;  1BBW A;  2OTJ A;  2KEN A;  1EUJ A;  2YTX A;  4AYB G;  3S17 H;  1VQF A;  2PI2 E;  4LNQ A;  1LTL A;  3JC6 6;  1VQJ A;  1CKN A;  4QJF A;  4A3E G;  1X6O A;  4C3J H;  4IOA A;  3M4Q A;  4X65 Q;  1YHA A;  3CC4 A;  1XNQ L;  3ICE A;  2AKW B;  1AH9 A;  2F4V Q;  4APV A;  4RMF A;  4BBS G;  3S1R H;  4A3L H;  3UDG A;  2D62 A;  3CC7 A;  4UP7 A;  4DR6 Q;  3M7N A;  4IFD I;  1YBY A;  4GKJ Q;  3J81 j;  1S40 A;  1OXV A;  3BJU A;  1YVC A;  2WB1 E;  4YWK A;  2D0P A;  4BXX G;  4DR3 Q;  1RIP A;  4LF9 L;  3F1Z A;  2VS1 A;  2VZA A;  1E7Z A;  3GTO H;  3H3V I;  3T1H Q;  5IE8 A;  3S1Q H;  4GKK Q;  1C7Y A;  1XMO Q;  2CFM A;  2EQS A;  2KHJ A;  5GAG C;  4DV7 L;  1QUQ B;  3CCR A;  1XMQ Q;  4ME3 A;  5GAE C;  3CCM A;  3MEF A;  3NEN A;  3EN2 A;  4DK3 C;  4B3T L;  1PYS B;  1K9M C;  3G4S A;  4LF8 Q;  1L1O B;  4LFB Q;  3AQQ A;  4QY7 A;  5BR8 L;  1C0A A;  4A3J H;  3PO2 G;  2F3I A;  5LMN L;  2K5V A;  4YHH Q;  1VQE A;  4PZ6 A;  1PH8 A;  4LF7 Q;  1A62 A;  1MKH A;  4B3M L;  1PV4 A;  1AE2 A;  3B6Y A;  2MFI A;  3K7A H;  3RZO H;  4GLA C;  4HJ7 A;  1K73 C;  1PH9 A;  4YCV A;  3NBH B;  1VQH A;  5FJ8 H;  2JA6 H;  1VQO A;  4QGU A;  4GN4 B;  3VDY A;  3S1N H;  1PA6 A;  4BA1 I;  4LF5 L;  3PO3 G;  2NZH A;  2L15 A;  1PFS A;  2NN6 G;  4QIW E;  1CKM A;  2VQE L;  1IBM L;  1EFW A;  3CCQ A;  1E1T A;  4JBJ A;  2UUB Q;  1X55 A;  4IJH A;  5C0X G;  5LMU L;  2K50 A;  1UE5 A;  2HIV A;  3CCU A;  3S1M H;  1VQM A;  2VL6 A;  4KHP Q;  4DR6 L;  3K81 C;  2R93 G;  3I56 A;  4LF4 Q;  2ZM6 Q;  2EIF A;  4YWM A;  2NZO A;  4JYA L;  4XTC S;  3CMA A;  2K4K A;  1E3P A;  4O0A A;  1IBL L;  1NMF A;  3CCS A;  4NXN Q;  2ALY B;  3FKI G;  3W1G A;  2PQA B;  2WB1 G;  1OXT A;  5ELO A;  2R7D A;  4JI1 Q;  4DPG A;  2VW9 A;  4HIM A;  2UU9 L;  4K0K Q;  3CW2 C;  3EBE A;  4A3E H;  1N32 Q;  2MO0 A;  3GO5 A;  4GOP C;  3ULL A;  1EIF A;  1K83 H;  2PQA A;  3S2H H;  4BBR H;  1XMQ L;  3TS0 A;  3RN2 A;  1N8R C;  2E5L Q;  2Q2H A;  4FDB A;  3KFU A;  4NB3 A;  3S15 H;  1X9N A;  1W3S A;  2JA5 H;  1VQI A;  4WJ3 M;  1Y1V H;  1VQC A;  1XNQ Q;  3CF5 A;  5M5W H;  4ALP A;  2IHE A;  4DKA C;  5C4X H;  3RZD H;  5C3E G;  3E9H A;  3GTG H;  4JI5 L;  1SMX A;  2E8G A;  2E2H H;  2NN6 I;  1Y14 B;  4KI0 A;  1NBW A;  1P16 A;  3AFQ A;  1EQR A;  3RLN A;  1IBK L;  2HHH L;  3HOU H;  3I4M G;  3GTJ H;  4GNX C;  4DV1 L;  2E2J H;  4A3G H;  3RNU A;  4LF9 Q;  2UUC L;  3CXC A;  2Q2I A;  3ERS X;  4DK6 C;  5IP7 H;  2E2I H;  2JA9 A;  2B3G A;  1A0I A;  4X62 Q;  2B29 A;  2Y0S G;  2Z6K C;  2JA7 H;  5JJI A;  3PUZ A;  3PUX A;  2IX1 A;  1OXX K;  1UWV A;  4DV7 Q;  1GKH A;  1QVC A;  2PI2 A;  3E9I A;  5FLM H;  2MQH A;  1HJP A;  2PNH A;  3GD7 A;  4MZ9 A; 
#chains in the Genus database with same CATH topology
 2K1B A;  3MTS A;  4JCV E;  2ZT9 C;  2R92 H;  4JVZ A;  1KAW A;  4EQN A;  3KJP A;  2B2Y A;  2WV6 D;  2ZTC A;  1S5C D;  3OTO L;  2N8N A;  3L9A X;  1TS5 A;  5E3F A;  4A3I H;  1SNO A;  1CKN B;  1FGU A;  3CME A;  3S14 H;  2WIN B;  4JG2 A;  4KD3 A;  4B3S L;  5M9O A;  4C2M B;  1SNM A;  2O5I C;  4A75 A;  3PIP 3;  2F0Q A;  2F1M A;  1WD0 A;  4IUV A;  3SK8 A;  1BR9 A;  5IYC H;  1JC7 A;  1BCP B;  2A6H C;  4Q0F A;  1PTO B;  4DR2 L;  2GA4 B;  3Q23 A;  1IKL A;  3KDF B;  3M85 A;  3DHQ A;  3W1B A;  1IBL Q;  1LO5 D;  4X3U A;  2R7Z B;  2EJM A;  1AZP A;  2UU9 Q;  2K5Q A;  4X62 L;  4DUZ L;  4C2M H;  2V4D A;  5GAH C;  2VUM B;  3K5N A;  2FXQ A;  2VNU D;  4XDX A;  1JJG A;  3UI2 A;  2PO4 A;  3FEW X;  3KOJ A;  4R4T A;  1Z9F A;  4DAM A;  1K0R A;  1RJT A;  5IGC A;  2JN4 A;  3K6O A;  2NVQ B;  2Z9H A;  3VA7 A;  1B3Q A;  2RVL A;  1QE6 A;  4JI4 L;  1WTQ A;  2E75 C;  4C1N K;  3GTL B;  4IUR A;  3MEH A;  4DV4 L;  3J7Y W;  2R7Z H;  1V1O A;  3J7A 5;  3TQY A;  3VYT A;  1IBK Q;  2BDO A;  5KEE A;  2VUM H;  3J7A F;  1X3F A;  2Y0S E;  4A3E B;  4FF1 A;  4EQP A;  3A55 A;  4FXK C;  3K5O A;  1AP0 A;  4O1N A;  3HOW H;  1IKM A;  1K83 B;  3VR6 A;  4X3S A;  1KHI A;  5GRO A;  2QEX A;  4QCL A;  4MHE A;  2NVQ H;  3NUC A;  4RHR A;  4U67 3;  2BH2 A;  3GTL H;  2NBF A;  3TP6 A;  1KNE A;  3IFD A;  3KUP A;  4IOC A;  1R9T H;  4ODG A;  2I5M X;  2NVY B;  4XYO A;  4YWL A;  2SDF A;  3OTO Q;  2YU9 B;  2L5T A;  2SEB D;  4A3C G;  1SN8 A;  1AW7 A;  1PH6 A;  4A76 A;  4J15 A;  1STE A;  4B3S Q;  1S5B D;  2E2D C;  2OQK A;  4L5S A;  3PF4 A;  1X3Q A;  4KLK A;  2F0V A;  4MN3 A;  3TP5 A;  1KTK A;  2R6G A;  4DR2 Q;  3GDE A;  2NVY H;  3V96 A;  4L5T A;  5IOD A;  2A8V A;  3IRB A;  2YU9 H;  2GVB A;  4HJA A;  4F87 A;  5C0X J;  3GV3 A;  2F0L A;  1IL8 A;  3FHW A;  4PNY A;  4DUZ Q;  3HOV B;  2EYL A;  2G5D A;  1QCB D;  3F8T A;  4GN3 B;  3U9O A;  2JP1 A;  4G57 A;  2L12 A;  4K2L A;  3R2T A;  2WFW A;  2FFK B;  4A3M B;  2OXP A;  5EBC A;  1TU2 B;  3A56 A;  1D6E C;  1ILP A;  4JI4 Q;  1H9K A;  1VQB A;  3IAY A;  4JBK A;  2NN6 H;  3M4Y A;  4DV4 Q;  3H09 A;  1GO3 E;  4N9P A;  1XPR A;  4BY7 G;  1J8I A;  2B8G A;  1R4P B;  3OYY A;  3CCE A;  1TS3 A;  2RSO A;  2JA6 G;  2CWA A;  3GTK H;  5GQO A;  1CTM A;  3HKS A;  1A6X A;  3A54 A;  4IQZ A;  3OIQ A;  1F9P A;  1PVO A;  2VB2 X;  4IFD J;  2JE6 I;  1SYF A;  2ATW A;  5C5M A;  1VQ4 A;  1YZ6 A;  3T16 A;  3LWU A;  4UHV A;  4QIW B;  3P7J A;  3K8A A;  2JEB I;  1PTO F;  3URY A;  3HKZ B;  3MFY A;  1UEB A;  1L0Y B;  1U0L A;  4K8J A;  1VQ5 A;  2N78 A;  2QA4 A;  3PF5 A;  5IT9 c;  2R7F A;  4AIM A;  1LT6 D;  5M5Y B;  1CT1 D;  1Y1V G;  4KN4 C;  1PHJ A;  1B70 B;  3CRL C;  1B9N A;  3ULJ A;  1LT5 D;  3E6Z X;  2K52 A;  2QW7 A;  5GAD C;  3S2D H;  2UUA L;  3RLF A;  2BA1 A;  1GJX A;  4A93 H;  3RUZ A;  3UDX A;  1LTG D;  4BBS B;  1V9P A;  1QUQ A;  2K5N A;  3C3L A;  1VQA A;  4Y7N B;  2IPK D;  4IO9 A;  4AQY L;  4BA2 I;  5FLM G;  2EXZ A;  4R8N A;  5HY6 A;  5C5L A;  1XPO A;  3MFG A;  4C3H B;  1EQV A;  5JPM C;  1EY7 A;  4JOI C;  2B63 G;  4EX5 A;  1RL2 A;  2JA8 H;  2R61 A;  3I72 A;  1D2B A;  1LT4 D;  2OWO A;  4GLX A;  1BDO A;  1Y8P B;  3T13 A;  2JJQ A;  5I4D A;  5IT9 E;  3NK9 A;  1BOS A;  2Z8L A;  4K5W A;  4R1J A;  4CBV A;  1A63 A;  1F2Z A;  3GP7 A;  3QOL A;  2OEO A;  1G29 1;  2EY5 A;  4IJL A;  4ZQ3 A;  3G6E A;  3J81 L;  1KQS A;  1I50 B;  4AYB E;  3MC0 B;  1B9M A;  3MXP A;  4HN7 A;  1ENC A;  4HIK A;  4A3K G;  1SE8 A;  5E4X A;  3BS1 A;  2KOL A;  4CDE C;  2DGY A;  1IYJ B;  4RKL A;  4CDC C;  1P8L A;  1VQK A;  1CZG A;  4TQU S;  1SYC A;  1TWG H;  3FKI B;  3A8K E;  4WJ4 A;  1XYI A;  3PGZ A;  3BVG A;  2I5L X;  1I3Q H;  1WOC A;  5C0X I;  5JJK A;  4KKT A;  1JB7 A;  1Q7Y C;  1HRJ A;  2EDG A;  1EY9 A;  1HTL D;  5I6Y A;  1S5F D;  2L11 A;  4NDX A;  1YIJ A;  1PXU A;  1RCV D;  3BG3 A;  1DOL A;  2UUA Q;  2F0S A;  2L55 A;  1PYB A;  3Q6S A;  3SGI A;  3PQI A;  5FLX c;  1C4Q A;  3D4W A;  2Z4I A;  3GTM H;  2XVS A;  4BS9 A;  4AQY Q;  5LMN Q;  4K0K L;  1MSH A;  2K5H A;  3V2T A;  1SNP A;  4MTK A;  4A3C H;  2ZXO A;  3I4N G;  1C48 A;  1TVX A;  1KXL A;  1VMP A;  2CCZ A;  5IYB G;  3GTO B;  2XSC A;  2Y0S B;  1EUJ A;  4AYB G;  2PI2 E;  2FMM A;  1WTR A;  2NB0 A;  2PYK A;  1SE3 A;  3OSO A;  3X3M A;  2KVM A;  3LX0 A;  2BDN A;  4RMF A;  1A3U A;  3S1R H;  3P20 A;  1I4P A;  4WOR A;  4IFD I;  3J81 j;  1S40 A;  1OXV A;  1JWS D;  5L37 A;  2D0P A;  4I7A A;  4LF9 L;  2X69 A;  2VS1 A;  4BY7 B;  2EY1 A;  3GTO H;  3H3V I;  1AEX A;  1EY0 A;  1ENA A;  4DAY A;  3S1Q H;  3Q0A A;  1TY2 A;  1T5X D;  2R3Z A;  4C3I G;  5DNF A;  3CCM A;  1CZW A;  1K9M C;  2G9D A;  1E2W A;  1L1O B;  2IWH A;  4DK0 A;  3AQQ A;  5IGG A;  2QCP X;  3EJI A;  1K28 A;  3PO2 G;  3VR5 A;  4PZ6 A;  1LTA D;  1CA5 A;  3RZO H;  1SNQ A;  4YCV A;  4MIU A;  2JA6 H;  1VQO A;  4QGU A;  1DON A;  3VDY A;  3PO3 G;  5ISR A;  4G7O C;  1CKM A;  3H94 A;  4IUP A;  3CCQ A;  1PMR A;  3TZU A;  5LMU L;  1UE5 A;  1H9M A;  1HQM C;  3AU7 A;  5EKI A;  3K81 C;  5M5W B;  1WTH A;  5BN3 A;  3SVM A;  4O0A A;  1E3P A;  1NMF A;  1RF2 D;  1OXT A;  1H9S B;  2R7D A;  4K0K Q;  3MHB A;  3W2D A;  2MO0 A;  2K05 A;  3SK6 A;  3GO5 A;  4GOP C;  3ULL A;  2PQA A;  1EIH A;  1XMQ L;  2Z6B A;  3TS0 A;  2E2I B;  3NSW A;  1U4P A;  2B8F A;  3LWE A;  5I2Y A;  3S9W A;  1Y1V H;  5M5W H;  5C3E G;  3VR4 A;  3GTG H;  5AFW A;  4ULL A;  1JQY D;  2B63 B;  1ESR A;  3QWN A;  3RNU A;  4LF9 Q;  2HDL A;  2TMP A;  2E2I H;  4KY6 A;  2N55 A;  2B29 A;  4IN3 A;  2K03 A;  5ELB A;  3PUX A;  1K3B C;  2IX1 A;  3KK7 A;  3E9I A;  5FLM H;  1HHV A;  3I90 A;  1HJP A;  1B44 D;  2GVA A;  1H95 A;  2B63 H;  3OIP A;  1EYD A;  1L2F A;  1AFP A;  2NVX B;  3ER0 A;  2F0D A;  1GUS A;  3CP0 A;  4J1M A;  2F0P A;  3U4V A;  1EYC A;  3ULP A;  2PCF B;  4DAV A;  4A3K B;  2UXB L;  2CH4 A;  2PNR C;  4HR7 B;  1EWC A;  4KKS A;  1WI5 A;  5LMU Q;  5CBE E;  4XQJ A;  1A2U A;  3OW2 A;  4YY3 L;  2NTT A;  2NVX H;  3H0G G;  1N9W A;  2WKD A;  4OIK A;  1X3P A;  1GUG A;  3UDF A;  3J80 c;  2MHV A;  5A35 A;  2F0O A;  4A3K H;  1V1Q A;  4K8I A;  1YI2 A;  4HIO A;  1VQ8 A;  4CDF C;  3G7L A;  1A15 A;  1IZ6 A;  3HS0 C;  4HJ9 A;  4B9W A;  5KGU A;  1Y8O B;  1I4H A;  3K59 A;  3UE1 A;  3I4M H;  1JWU D;  2L4N A;  2D2C C;  2X6L A;  1II3 A;  2ASB A;  1EOV A;  1YHB A;  3CPW A;  2K75 A;  2PZT A;  2VXW A;  2EYJ A;  1C8C A;  4AYB B;  1XJV A;  3J80 i;  5COY A;  1PH5 A;  3NEL A;  1J6Q A;  5BN4 A;  2C9O A;  1LTR D;  5JEA G;  2DUD A;  2O5J C;  4LJZ C;  4TRD A;  3S2H B;  4BBR B;  4ZCK A;  4ABN A;  1LTT D;  1B4O A;  3KLW A;  4LUO A;  3TSS A;  3DWQ A;  1SE2 A;  3I4L A;  5EAY A;  2UXD L;  1NTG A;  1F9Q A;  4IUQ A;  5EBD A;  3PUW A;  4X64 L;  3I4N H;  3RZD B;  5C4X B;  3HOX G;  1W2B A;  5IYB H;  2E2H B;  3CPF A;  4RA8 A;  3J80 E;  1QB5 D;  3J7Z C;  4CHT B;  4A3D G;  1UE1 A;  3HOU B;  2PMZ E;  1HR0 W;  4OO1 G;  3WOF A;  1PH7 A;  1K8O A;  4LWC A;  1G91 A;  1QG7 A;  1QNU A;  4POG A;  2UXB Q;  1N33 L;  2ZTD A;  3GTQ H;  3I7F A;  4JV5 L;  3KF8 A;  2KCM A;  2XWB B;  4RFB A;  4DV5 L;  2A19 A;  1GVP A;  1TT2 A;  4FNF A;  1XTD A;  1SYD A;  4YY3 Q;  1GUW A;  4CGY B;  1CHQ D;  3PO3 B;  5C3W A;  4C3I H;  1Q12 A;  3F2D A;  1MI2 A;  2Z0S A;  1BCP D;  5K5P A;  4A3I B;  4GOP A;  1PTO D;  1G6Z A;  1JOO A;  1M4V A;  4WJW A;  3PO2 H;  2I07 B;  2YV5 A;  2F4I A;  3EIV A;  4A93 G;  4J8Q A;  3PO3 H;  1TR5 A;  3NTK A;  1DGS A;  3BZD B;  5CV4 A;  4UP9 A;  1PDQ A;  3FP9 A;  3C46 A;  2EE1 A;  5FJ8 G;  3H15 A;  2AMC B;  1VQN A;  3E5S A;  5C3E B;  2Z4H A;  2JA8 G;  3NWS A;  1PFM A;  1U4M A;  1HZA A;  4JBM A;  2A1A A;  2OT2 A;  1VQP A;  1RTN A;  1ASY A;  3L2P A;  2UXD Q;  1IW7 D;  4IPH A;  1KC8 C;  1BCP C;  4NKL A;  4X64 Q;  4OWT B;  3M7G A;  1EZ6 A;  1PTO C;  4JI6 L;  1DZ1 A;  4N8F A;  4GZY C;  1Q82 C;  4FP5 D;  2F0H A;  3D4D A;  5C3E H;  4H0L C;  2N49 A;  1TWA B;  4ME5 A;  3HOW B;  1N33 Q;  2M9V A;  4JV5 Q;  2I5H A;  1JE4 A;  4UY8 C;  3CAM A;  3A0J A;  3HEJ A;  4IAL A;  3SK4 A;  4DV5 Q;  1HR0 L;  4KHZ A;  2NUC A;  2J0T D;  4P71 A;  4P73 A;  2AUJ D;  1EQQ A;  1QZG A;  5KNC A;  4DV2 L;  5EQ0 A;  3E0E A;  1R9T B;  4A3G G;  3BDC A;  1NY4 A;  4DUY L;  1HZ9 A;  3SR1 A;  4NXM L;  1TWA H;  1M90 C;  4L63 B;  3MXN A;  5IT9 L;  5EGT A;  1STG A;  3VYR A;  2O4X A;  2JA7 G;  4OWX B;  2F0G A;  1RDP D;  1U9R A;  1PYW D;  3CCJ A;  1O7L A;  4DV3 L;  2JSO A;  1J9O A;  3CC2 A;  4RCN A;  5ELN A;  4ILW A;  1N34 L;  1JWM D;  3MAQ A;  2KCN A;  2EJG C;  3PV0 A;  1Q8K A;  3NBH A;  2F4V L;  3I73 A;  3MVV A;  2K33 A;  1Q1B A;  1VMC A;  1G51 A;  1S4Z A;  1TKW B;  4TKO B;  3R2I A;  3H0G H;  1JT8 A;  3MXG A;  3BU2 A;  3M9B A;  5CR3 A;  3BYY B;  4DR3 L;  2YYZ A;  5JEA J;  5K36 G;  3V05 A;  1WTP A;  2CW0 D;  3IKJ A;  4C56 C;  4XQQ A;  3T1H L;  1YHQ A;  1ENF A;  2HT1 A;  1XMO L;  1NUC A;  3SK5 A;  5LMN W;  4JI6 Q;  2K7V A;  4BY1 G;  4JK1 C;  1TXY A;  1SFO H;  1X32 A;  4HCS A;  5KRU A;  2ZXP A;  1X54 A;  1WFQ A;  4K6D A;  4KTA A;  4LF8 L;  1X65 A;  4FXD A;  5E7N A;  4FYD A;  4TVA B;  4IUU A;  3WWV A;  1U5K A;  5KYL A;  1HZC A;  1YEZ A;  4UPA A;  3GTK B;  1QVF A;  4GNX B;  5JJL A;  3DWA A;  1HR0 Q;  3L7Z C;  3U50 C;  3M4O H;  5JEA H;  3U4Z A;  1EU3 A;  1EWH A;  2YTY A;  3A7A B;  3BDO A;  4DNR B;  4DV2 Q;  4PMW A;  1NNX A;  2A5H A;  1CUK A;  1STB A;  3HOZ G;  2KJX A;  2IY5 B;  3HRZ C;  3PSI A;  2DN8 A;  2HCC A;  4DUY Q;  4HID A;  4NXM Q;  3TME A;  1E24 A;  1KL9 A;  3HOX H;  4HED A;  2ICI A;  2HIX A;  2B2U A;  4FF2 A;  4A3D H;  1AZQ A;  1EWI A;  2BA0 A;  4DNI A;  4JI1 L;  1VS0 A;  1F9S A;  2F0N A;  4OO1 H;  4Y52 H;  1JR0 D;  1JMC A;  4DV3 Q;  4L5R C;  1LLR D;  3QR8 A;  1YIT A;  1N34 Q;  4A3B G;  2OTJ A;  1BBW A;  2YTX A;  4LNQ A;  1G8Z D;  2QDL A;  2MPM A;  1KDC A;  1CKN A;  1VQJ A;  1X6O A;  3M4Q A;  4ZK9 B;  1XNQ L;  3S2D B;  2F4V Q;  3NP8 A;  2AQ2 B;  4A93 B;  3RD4 A;  3J7A V;  3UDG A;  4S3S A;  2KEE A;  3FVQ A;  3H3V C;  4DR6 Q;  3MZ5 A;  4ZRZ A;  3C1E A;  3BJU A;  1BNZ A;  2WB1 E;  4YWK A;  4BXX G;  2QKI C;  4DR3 Q;  2PMZ B;  1PFB A;  3T1H Q;  2LMC B;  1XMO Q;  5J39 A;  1Z7T A;  2KHJ A;  1G2S A;  4DV7 L;  4ZKB B;  1FYC A;  3CCR A;  2JA8 B;  3AB9 A;  3W3A A;  2F0E A;  4HMI A;  5TSS A;  4LF8 Q;  1E2V A;  5DEH A;  3E0J A;  5FOB B;  3QJY A;  4QY7 A;  1BF4 A;  1C0A A;  1U4R A;  5COR A;  5LMN L;  1HUN A;  1PH8 A;  1A62 A;  2FMC A;  1PV4 A;  1AE2 A;  5J1Z A;  1YNJ D;  3K7A H;  4GLA C;  1SE4 A;  2B39 A;  5FJ8 H;  5CYU A;  1TS2 A;  4GN4 B;  3S1N H;  1SSO A;  4BA1 I;  2VQE L;  4TSS A;  1CM9 A;  2DNC A;  1IBM L;  1EFW A;  4G7H C;  2L1B A;  4JBJ A;  3SEB A;  1X55 A;  1ICF B;  1SMY D;  2BE5 D;  1B3A A;  4FF4 A;  2R93 G;  2QDB A;  3I56 A;  5D3I B;  2EIF A;  4YWM A;  4XTC S;  2K4K A;  3CCS A;  1W6K A;  2P5Z X;  1TWG B;  2PQA B;  2WB1 G;  4DPG A;  4JI1 Q;  1KDB A;  5D65 A;  1BUV T;  1I3Q B;  4A3G B;  2E2J B;  5D14 A;  4HSP A;  1N8R C;  3RN2 A;  2JA7 B;  1A2T A;  1ZYR D;  1X9N A;  4H13 C;  5ELE A;  1MSG A;  2WKC A;  1UUP A;  1I4X A;  1XNQ Q;  4ALP A;  1HFG A;  4K14 A;  1YNJ C;  3DMU A;  3E9H A;  4JI5 L;  1SMX A;  2NN6 I;  1CFM A;  1DOK A;  3D4R A;  1NBW A;  1P16 A;  5JOB A;  3GTM B;  3I4M G;  3GTJ H;  2E2J H;  4A3G H;  3KBX A;  3R8B A;  1GUO A;  2UUC L;  4XT1 B;  3CXC A;  2F3V A;  1PFN A;  1VDZ A;  4Z9C B;  2XNA C;  2Z6K C;  1SMY C;  2BE5 C;  2JA7 H;  3PUZ A;  5EKL A;  1OXX K;  4DV7 Q;  1DD2 A;  1UEA B;  5G3L F;  2Q8I B;  1BO0 A;  1CQF A;  4MZ9 A;  5CBA E;  3CQZ B;  2MGS A;  2PZU A;  1LV9 A;  2NYZ D;  3FDT A;  4R4I A;  3ND9 A;  1BXT A;  3S1R B;  2D0O A;  4DR5 L;  1Z6H A;  4DA2 A;  3A8I E;  1FL0 A;  5ELD A;  1ZYR C;  1DM0 B;  1PLF A;  2B2W C;  3S1Q B;  1D7Q A;  1OXS C;  2VQE Q;  1HA6 A;  2O2L D;  3KLR A;  1IBM Q;  2YTV A;  5IY0 A;  1O7Z A;  3CQZ H;  5K36 H;  1LTS D;  4A3F G;  3AFP A;  4RGO S;  2IT1 A;  1HQR D;  4N9T A;  1F77 A;  3NWT A;  4OL7 A;  4CKB A;  1G2T A;  1YNN D;  1YJN A;  2KBN A;  5C6A A;  3SDZ A;  3R3O A;  5A2Q E;  1J5E L;  4BY1 H;  1FGB D;  2OF1 A;  1D5M C;  1KAA A;  3OHX C;  3RZO B;  1FD7 D;  2XRQ D;  2G9H D;  1DYQ A;  2HQE A;  2JA6 B;  1CSP A;  1Q3L A;  1V1P B;  5C44 G;  1HNX L;  4LUZ A;  1MBY A;  3H6M A;  1HFN A;  2WP8 J;  2F0W A;  1NR4 A;  4LUV A;  1KD1 C;  1I6H H;  3QOJ A;  5FLX E;  4H02 A;  1FNV A;  2I46 A;  2LKV A;  2RDF A;  1ICW A;  5C4Z A;  1OXU A;  3FPP A;  1G6P A;  1L1O C;  1MIU A;  2WII B;  4JI5 Q;  3L0O A;  3T4A C;  5M3F G;  1L0W A;  3J80 L;  1E22 A;  4DR1 L;  4OEL B;  3HOZ H;  3I2Z A;  2UUC Q;  1SR3 A;  2XGT A;  3I3C A;  1QWY A;  2EJF C;  1YNN C;  3NEM A;  2ZJR A;  1EY6 A;  2CH4 W;  4IPC A;  1M1K C;  1D5Z C;  3AYH B;  1HH2 P;  1HTP A;  1Y1V B;  4HSV A;  1MJC A;  2A73 B;  2CHB D;  2F0I A;  4L8J A;  2EYM A;  2VY3 A;  2PPB C;  1EL0 A;  3GTG B;  1X56 A;  2OQ0 A;  3MXU A;  4P75 A;  4JI3 L;  3KJO A;  3STB D;  3K5L A;  4A3B H;  3A5U A;  4DR5 Q;  5IYD G;  2WAQ G;  3ERQ A;  4DAP A;  4IPG A;  3AEV A;  3NXW A;  1IYU A;  4JOI A;  4IUT A;  4XT3 B;  2JK8 A;  1B2T A;  4CKC A;  2MO1 A;  4DR7 L;  3I91 A;  1MD2 D;  1Q46 A;  3DM3 A;  3CD6 A;  2IX0 A;  4QL5 A;  2B2T C;  2PW5 A;  4BXX H;  4CDD C;  1F2M A;  4C3J G;  4DK1 A;  4HTH A;  4LMQ D;  4KY7 A;  3NTI A;  5IGE A;  3WDN A;  4IZ8 A;  1I4Q A;  5NUC A;  2ES2 A;  2UXC L;  5M5X H;  4KHV A;  1FJG L;  3E3X A;  1PRT B;  3NPP A;  4QUF A;  3W5O A;  4R4O A;  5AJ3 L;  1J5E Q;  4OIJ A;  3GQB A;  2EZV A;  3KF6 A;  4RCO A;  1A3T A;  3PUV A;  3PIO A;  4KN7 C;  4EQO A;  3G48 A;  4PQX A;  3BVM A;  1HNX Q;  1MGS A;  1SYE A;  4EQ5 A;  3RMH A;  1EFI D;  2R93 B;  2B2V C;  4RGN A;  5M3M H;  2N3S A;  5CV8 A;  1VF5 C;  1QIL A;  1CSQ A;  4LFC L;  4QUC A;  2XTI A;  2ZJP A;  2WB1 B;  2I0Q A;  4JI7 L;  2DNE A;  5EPJ A;  4P72 A;  1SND A;  4A3J G;  1EIY B;  2K5W A;  3ITP A;  4ZKC B;  1MJE A;  4J6H A;  5JAV A;  4ZUI A;  1QOH A;  4UP8 A;  4DR1 Q;  2Z6K A;  2Z1C A;  2R93 H;  4H44 C;  1KRS A;  3CHB D;  4V19 0;  2CQO A;  2ZJQ A;  4H7B A;  4KD4 A;  1NJI C;  1K8G A;  4EVO A;  1WCM H;  1EYA A;  4DV6 L;  1PH2 A;  4K5X A;  3M3Y B;  2RBM A;  3I4M B;  1STN A;  2XRS D;  3P75 A;  4GS3 A;  5IGB A;  4KMU C;  2EY6 A;  4JI3 Q;  2F0K A;  3HOY H;  1JOR A;  3KLS X;  1B53 A;  3I55 A;  1FNW A;  2Q2U A;  4DNT B;  4HJ5 A;  2B2W A;  4HCE A;  1LTI D;  3D6C A;  3QB3 A;  4DR7 Q;  4RHS A;  5EJW A;  3ND8 A;  3DM1 A;  1VQ6 A;  2V1C C;  3M3Y H;  1LUZ A;  5LL6 X;  2EYH A;  3I8Z A;  3Q8D A;  1V43 A;  3T53 B;  2KUM A;  4A4I A;  1GD7 A;  1JOK A;  5EPL A;  4QF4 A;  1WTV A;  1GUT A;  1TII D;  1JB3 A;  3I4N B;  2UXC Q;  2Q8R E;  1FJG Q;  3K80 C;  4JI0 L;  5LL6 S;  3DLL A;  3MXN B;  2AQ1 B;  1A3V A;  5AJ3 Q;  3A7L A;  1V8Q A;  2GN5 A;  1I4G A;  1VQD A;  4RGM A;  3S16 B;  1QZH A;  1H9R A;  1KDA A;  1MHW C;  4K6L A;  3GTQ B;  4XXE A;  4B08 A;  3AMU A;  3RLO A;  2KCC A;  4EGV A;  5HGQ A;  4CJ0 B;  1L1O A;  3IL8 A;  4LFC Q;  4YIJ A;  4JI7 Q;  2CQA A;  1STH A;  5FO7 B;  1WJJ A;  1BBU A;  1PZJ D;  3LNN A;  5C4J H;  4M8A A;  4C3I B;  4CJ2 C;  1HCZ A;  4X65 L;  1UAP A;  3M4P A;  4A3F H;  5ELC A;  3JAM c;  3S16 H;  3NBI A;  3HKZ E;  3HOV G;  3U58 A;  1KLU D;  4RG1 A;  2J7Z A;  3PO2 B;  4GKJ L;  3D31 A;  3I4O A;  4X6A H;  2BH8 A;  4A3M G;  1O7Y A;  3K7U C;  4DV6 Q;  1BVS A;  5M3F B;  1LM0 A;  2JQO A;  1S5E D;  4NW2 A;  5CGK A;  4GKK L;  3VA5 A;  2D5D A;  5C44 H;  1Y69 U;  1F2L A;  2AHO B;  1HZB A;  1VQ9 A;  1YNX A;  1EYG A;  1QVG A;  3F2C A;  4IPD A;  3TBI B;  2L0C A;  4Q5V A;  3JAM i;  2EXD A;  2NVT H;  1PRT F;  1SAP A;  3C1F A;  2CVR A;  1CKO A;  4O2D A;  5I2X A;  4YHH L;  5M3F H;  1FR3 A;  3N52 A;  3I70 A;  1KLG D;  2ENB A;  3DEO A;  4ZYS A;  2MJ8 A;  5CV7 A;  1IYV A;  3TDQ A;  3BZC A;  5F2D A;  3PIO 3;  4JI0 Q;  4RWS C;  3JAM E;  4IFD G;  3S17 B;  1Y1W H;  2ZXR A;  1KRT A;  1STY A;  1Q81 C;  3EVQ A;  4KKU A;  4YCU A;  3HKZ G;  4KHP L;  1VQ7 A;  2B2V A;  1K3R A;  2ZM6 L;  4HJ8 A;  1FVI A;  3D6W A;  1UE6 A;  5IYD H;  4I65 A;  3TP8 A;  4OGQ C;  4RGT A;  1Z47 A;  2KEC A;  2PW7 A;  1ET9 A;  1S5D D;  1O78 A;  1SRO A;  1OO9 B;  2RHQ B;  1RHP A;  3S17 H;  1VQF A;  1LTB D;  1KAB A;  5I9P A;  2FIN B;  3JC6 6;  4QJF A;  4IOA A;  4C3J H;  4X65 Q;  4BBS G;  4A3L H;  3CC7 A;  3HP3 A;  4GKJ Q;  4A3J B;  4G4K A;  2VZA A;  4C3H G;  2EYF A;  1I6V C;  5IE8 A;  3Q24 A;  2IL8 A;  4GKK Q;  1C7Y A;  2DY7 A;  2IJ0 A;  2CFM A;  2EQS A;  5GAG C;  1QUQ B;  3OWF A;  3NEN A;  3KLS A;  1UNS A;  4B3T L;  1PYS B;  1IW7 C;  1PTO H;  1DCZ A;  2FHT A;  1NCV A;  2RDG A;  5BR8 L;  1R4Q B;  3S1M B;  1W6J A;  5JVH 3;  3CU7 A;  4A3J H;  5ELF A;  3H0G B;  1EEI D;  4YHH Q;  5EPK A;  3K58 A;  1EQT A;  4B3M L;  3HG9 A;  2MFI A;  4OEM B;  5I9O A;  4NMZ A;  3T56 B;  1K73 C;  1PH9 A;  1JOQ A;  3D3R A;  1SEB D;  1PA6 A;  4LF5 L;  2L15 A;  1PFS A;  2K04 A;  5G3L D;  2C5C A;  2F0U A;  1SFO B;  3S15 B;  2K6A A;  1QJO A;  3D8G A;  2K50 A;  4QB4 A;  3CCU A;  3S1M H;  1K8M A;  5CC4 A;  2VL6 A;  2NWG A;  1VQM A;  4DR6 L;  4KHP Q;  2ZM6 Q;  2JYO A;  3K5M A;  2NZO A;  4JYA L;  2ALY B;  1EEF D;  3FKI G;  3OMG A;  5JJZ A;  4HIM A;  3CW2 C;  2ICE C;  3M4O B;  4A3E H;  1SXT A;  1JCK B;  4E6I A;  1K83 H;  2RKS A;  2Q2H A;  4FDB A;  3KFU A;  3S15 H;  1VQI A;  4WJ3 M;  5KYI A;  1IHZ A;  4DKA C;  1ZKO A;  1HPC A;  3OPO A;  5CV6 A;  2E8G A;  4F8M A;  3HOX B;  2SOB A;  3TP7 A;  1Y14 B;  4KI0 A;  3P1H A;  4A3D B;  3RLN A;  4R8I A;  2HHH L;  4GNX C;  4DV1 L;  4LK1 C;  2LFN A;  3G6J B;  2A68 D;  1SJE D;  2Q2I A;  2NZ1 D;  2B3G A;  1A0I A;  4X62 Q;  2Y0S G;  5FKA C;  2IW3 A;  2EPB A;  2KED A;  4P2C B;  1D5X C;  1QVC A;  2PI2 A;  2MQH A;  2PNH A;  5CV5 A;  3GD7 A;  4B3T Q;  1VF7 A;  4X66 L;  2CW0 C;  1ZEQ X;  4DXG A;  1UE7 A;  4O42 A;  3NTH A;  5BR8 Q;  1NSN S;  4DF7 A;  4DXF A;  4DGZ A;  4JI2 L;  1L0X B;  3FPU B;  1YJ9 A;  4KJO A;  4KY5 A;  2RHS B;  5A2Q L;  3HZX A;  4B3M Q;  1LT3 D;  3ZYY X;  1TWH B;  1PH1 A;  3HOV H;  5C0X H;  2K01 A;  5IP9 G;  4LF5 Q;  5HUR A;  1CHP D;  2FJ2 A;  4A3M H;  2D9U A;  5FLX L;  1ML0 D;  3EFX D;  2MNA A;  1WTO A;  2SNS A;  1Q86 C;  2A68 C;  1SYB A;  4FXG C;  3ERO A;  5IGF A;  5IOC A;  3TS2 A;  1M8A A;  3VYS A;  4DAY B;  4JYA Q;  4F88 A;  3A74 A;  1TWH H;  1EU4 A;  1ONL A;  2AWO A;  1H9J A;  3K0X A;  3K7A B;  1BCP F;  1GM5 A;  5DLQ E;  1I94 L;  3KDF A;  3CCL A;  1D8L A;  3PCO B;  2EYO A;  2CKZ B;  3S1N B;  4GN5 A;  3WOE A;  4B3R L;  3TZD A;  5IWA L;  4DV0 L;  4K5V A;  1S72 A;  2VB3 X;  2X6G A;  1SBB B;  4IUN A;  2ID0 A;  1WD1 A;  1RD9 D;  4JBW A;  1CA6 A;  3HGB A;  3TRZ A;  2HDM A;  3BZK A;  2KHI A;  4MTN A;  2HCI A;  1OTC A;  3UE0 A;  5M3M G;  4PMC A;  2K5D A;  3SE0 A;  2AWN A;  1AN8 A;  2HHH Q;  4FF3 A;  4IFD H;  4DV1 Q;  1JJC B;  1ZXT A;  3ONA B;  3TN2 A;  1N36 L;  1WTX A;  1STA A;  1DXM A;  3H3V H;  2F03 A;  3PUY A;  1EY8 A;  4UAI A;  5M5Y H;  4PMB A;  3UDI A;  1HXY D;  3QG1 A;  2IHF A;  4JI8 L;  4X66 Q;  3QO2 A;  2Q8T A;  1TS4 A;  5KND A;  2RQX A;  1WCM G;  2QF7 A;  4R4Q A;  4JI2 Q;  3TEH B;  3LGJ A;  4GLV B;  4LF6 L;  3GTJ B;  1E2Z A;  1SRU A;  2C35 B;  1WTW A;  2EOT A;  2RA4 A;  4B9X A;  3T51 B;  3T1Y L;  2VQF L;  4BBS H;  3GTP B;  5T1I A;  3RR5 A;  4C1N I;  3HOY G;  1RTO A;  4Y7N H;  4X3K A;  5KIX A;  4OON A;  3TRE A;  1ESF A;  3D0F A;  1XPU A;  1TY0 A;  4KV6 A;  2KQ3 A;  4DN4 M;  1T9H A;  4C3H H;  2K14 A;  4NP5 A;  4AH6 A;  2M00 A;  4LFA L;  1PH4 A;  2A74 C;  3KF6 B;  4P74 A;  2QIL A;  4R4C A;  4OX9 L;  1EOT A;  1IL2 A;  2RF4 A;  1TWF B;  3N6R A;  3GTP H;  1BKB A;  3C2P A;  1I94 Q;  5H1S E;  2OTL A;  4R9W A;  1ILQ A;  2KA7 A;  2LXJ A;  4B3R Q;  5IWA Q;  4DV0 Q;  1U4L A;  2AQ3 B;  3BVZ A;  4OO1 I;  1I5F A;  4ZUJ A;  1DJR D;  3FRP B;  2JXM B;  4CKE A;  1XWE A;  4JC0 A;  1VCI A;  2TSS A;  3BYT B;  1I50 H;  4GNX A;  3OWE B;  1B1Z A;  1TWF H;  1NR2 A;  4BY1 B;  2LSS A;  1PH3 A;  1S3O A;  5IIF A;  2HQL A;  3KYH C;  4KK7 A;  2RCN A;  1Q1E A;  4LW1 A;  1N36 Q;  3DXJ C;  3QIA A;  2AUK A;  3MA2 B;  1I4R A;  1YJW A;  3U9S A;  1I6H B;  1VQG A;  3FKI H;  3NQT A;  1SNC A;  3A8J E;  2QGQ A;  4JI8 Q;  1D1K A;  1GHJ A;  1LYL A;  2EVB A;  2RDH A;  2WAQ E;  1VQL A;  2ZTE A;  2LY7 A;  4HMJ A;  2K28 A;  4CJ1 B;  3VYU A;  3SHL A;  2F52 A;  4LF6 Q;  2KCT A;  3HOZ B;  1XNR L;  5E1F A;  2RCF A;  3OMC A;  3RN5 A;  1WYD A;  3T1Y Q;  2VQF Q;  4XIG S;  1CI3 M;  4BBR G;  1D1I A;  1GUN A;  1B8A A;  2IX3 A;  1O7I A;  2M2L A;  1AE3 A;  4M1U B;  5I6W A;  2A69 D;  3CCV A;  2JA5 G;  3A5Z B;  1TWC B;  4DR4 L;  1JIC A;  4PV1 C;  5C4X G;  5CMD A;  1ASZ A;  1SDF A;  4LFA Q;  4OXP A;  1NMG A;  2Q2T A;  4A3B B;  1CQV A;  4OX9 Q;  3HOU G;  1HNW L;  4F7X A;  4UDU C;  3R93 A;  1KIX A;  2NTS A;  4PZ7 A;  5J3B A;  5IP7 G;  4DU9 A;  1SLJ A;  1PRT D;  4X3T A;  4OWW B;  5IGD A;  3NE5 B;  4BWG B;  1HNZ L;  1Y8N B;  1B7Y B;  2L9H A;  1TWC H;  2F3W A;  3MWY W;  1Y1W G;  1C9O A;  1X3E A;  4N8X 1;  1BBX C;  4BY7 H;  1RKN A;  5DM6 3;  1GOZ A;  5M5X B;  1XX8 A;  3Q22 A;  5IP9 H;  1HA5 A;  2R92 G;  5HGT A;  1NAP A;  1ROD A;  4ID6 A;  3J81 c;  3G71 A;  2BOS A;  2HUG A;  3KF8 B;  1PZK D;  4A3I G;  1WVL A;  2A69 C;  2N88 A;  3VR2 A;  4PG3 A;  4NPS A;  5M3M B;  1LAC A;  3H91 A;  2XN9 C;  4RKB A;  3HFZ B;  5IYC G;  4A3L G;  4L5Q A;  1E1O A;  4GOP B;  1FNU A;  3S24 A;  2H1E A;  1PRT C;  1A8V A;  2XWJ B;  3J81 i;  1QNK A;  2OCE A;  3JAM L;  4XQN A;  2E74 C;  3NQI A;  3L3O C;  1XNR Q;  2DY8 A;  4LFB L;  4OHJ A;  5J22 A;  3CKI B;  5CV9 A;  1XTC D;  2F0F A;  3DUZ A;  1T5E A;  3STB C;  3GV6 A;  4LF7 L;  4FO2 A;  4WRD A;  1LAB A;  3F2B A;  1WCM B;  4POF A;  5FO9 B;  4DR4 Q;  2RSN A;  2B2Y C;  3J81 E;  4HAE A;  2E76 C;  5KNB A;  4DFA A;  1EZ8 A;  1K8A C;  1JE5 A;  4PZ8 A;  2R7Z G;  3HOY B;  3ZJY C;  4MNO A;  4QQB X;  2UUB L;  4ZLT F;  1HNW Q;  5C4H A;  3VR3 A;  1X3G A;  2JEA I;  1IXR A;  2VUM G;  2SNM A;  1Q8I A;  4FVM A;  3EQL C;  3PIP A;  2H5X A;  2DJG C;  5FO8 B;  4LF4 L;  1NE3 A;  3HOW G;  2PQE A;  1HNZ Q;  2LXK A;  4NXN L;  3K57 A;  3FMC A;  1EIG A;  1SYG A;  5T1G A;  1N32 L;  3PMF A;  2CWP A;  1JJ2 A;  4YCW A;  2EY2 A;  2F0J A;  2E5L L;  5JJI A;  2K32 A;  2KEN A;  5DM7 3;  5C3X A;  1B50 A;  1LTL A;  4A3E G;  1AH9 A;  3CC4 A;  1YHA A;  3ICE A;  5LHY 1;  2AKW B;  1KNA A;  3KBG A;  4APV A;  3NHH A;  3O13 A;  2D62 A;  3X3N A;  5BN5 A;  5DAU A;  2MP1 A;  4UP7 A;  3M7N A;  1YBY A;  2QEJ C;  1Q90 A;  1YVC A;  5JPN C;  1RIP A;  3OW7 A;  3F1Z A;  1E7Z A;  2LS0 1;  1F9R A;  1SJH D;  4QMG A;  4I7Z C;  4U68 A;  5C4J B;  1GXD C;  1TQO A;  4ME3 A;  1XMQ Q;  3DWP A;  1CK1 A;  3MEF A;  5GAE C;  3EN2 A;  4DK3 C;  3F2U A;  4G7Z C;  4ZAI A;  3BDL A;  4L6T B;  4A3F B;  3G4S A;  1V1P A;  4LFB Q;  1PZI D;  4JPB W;  3OOC A;  2F3I A;  5EKK A;  2K5V A;  1VQE A;  4LF7 Q;  1MKH A;  2A6E D;  3B6Y A;  1GHK A;  4HJ7 A;  3NBH B;  2H4O A;  1VQH A;  3IFT A;  5C44 B;  2NZH A;  4QIW E;  2NN6 G;  1BQQ T;  2KHS A;  1O80 A;  1E1T A;  5E4W C;  2UUB Q;  1EY4 A;  4IJH A;  4LAA A;  3SXH A;  4WFN 3;  1HUM A;  5C0X G;  2HIV A;  2JA5 B;  3CRK C;  5FK9 C;  2NVT B;  3K0Y A;  2XIW A;  4LF4 Q;  4V0B A;  3DEP A;  3CMA A;  1IBL L;  4NXN Q;  3W1G A;  5ELO A;  2UU9 L;  2HD3 A;  2VW9 A;  3EBE A;  1N32 Q;  1EIF A;  3S2H H;  1ET6 A;  1H9S A;  4BBR H;  2E5L Q;  2PZW A;  4NB3 A;  2F0M A;  1W3S A;  2JA5 H;  1K0S A;  1Y1W B;  1EY5 A;  1VQC A;  3CF5 A;  4RH6 A;  2IHE A;  4K2K A;  5C4X H;  2A6E C;  3RZD H;  2J4X A;  2B2T A;  5D3D A;  2E2H H;  4KJN A;  2EYP A;  3AFQ A;  1EQR A;  2WAQ B;  1IBK L;  3HOU H;  2R92 B;  5JVG 3;  2A6H D;  2WAC A;  2MUY A;  4XYQ A;  1E0B A;  1DOM A;  2BCO A;  4RAU C;  3ERS X;  4DK6 C;  5IP7 H;  1XXG A;  2JA9 A;  3EA6 A;  3S14 B;  1F2Y A;  1UWV A;  2F0T A;  1GKH A;  4JW0 A;  2B2U C;  4C3J B;  2DJF C; 
#chains in the Genus database with same CATH homology
 4B3T Q;  4X66 L;  4R4I A;  4JCV E;  2GVA A;  1H95 A;  1UE7 A;  2B63 H;  5BR8 Q;  2R92 H;  1L2F A;  2D0O A;  1KAW A;  4DR5 L;  4JI2 L;  1YJ9 A;  1FL0 A;  3ER0 A;  3KJP A;  2RHS B;  2ZTC A;  3OTO L;  2N8N A;  4A3I H;  4B3M Q;  3CP0 A;  1CKN B;  1FGU A;  3U4V A;  3CME A;  3ULP A;  4JG2 A;  1PH1 A;  3HOV H;  3S14 H;  4B3S L;  5IP9 G;  2UXB L;  1D7Q A;  4LF5 Q;  1OXS C;  4A75 A;  2VQE Q;  4A3M H;  1IBM Q;  2YTV A;  5IY0 A;  3CQZ H;  1WI5 A;  5IYC H;  4A3F G;  2MNA A;  1Q86 C;  5LMU Q;  3AFP A;  2IT1 A;  4DR2 L;  3OW2 A;  4YY3 L;  1YJN A;  2KBN A;  2NVX H;  3TS2 A;  3H0G G;  1N9W A;  4DAY B;  3M85 A;  3KDF B;  4JYA Q;  3W1B A;  1IBL Q;  1J5E L;  4BY1 H;  3A74 A;  1TWH H;  2AWO A;  3UDF A;  3J80 c;  2UU9 Q;  3K0X A;  4X62 L;  4DUZ L;  4A3K H;  1V1Q A;  5DLQ E;  1GM5 A;  3KDF A;  4C2M H;  1I94 L;  1D8L A;  3PCO B;  1YI2 A;  5GAH C;  3CCL A;  1CSP A;  5C44 G;  2CKZ B;  4HIO A;  4LUZ A;  1HNX L;  2FXQ A;  4GN5 A;  1VQ8 A;  2VNU D;  4B3R L;  1JJG A;  1IZ6 A;  5IWA L;  3KOJ A;  2WP8 J;  4R4T A;  4DV0 L;  4LUV A;  1Z9F A;  4DAM A;  4HJ9 A;  1S72 A;  1KD1 C;  1K0R A;  2ID0 A;  4H02 A;  3UE1 A;  4JBW A;  3I4M H;  3TRZ A;  3BZK A;  2KHI A;  1OXU A;  4MTN A;  4JI4 L;  1G6P A;  1L1O C;  1MIU A;  1OTC A;  4JI5 Q;  3UE0 A;  2ASB A;  1EOV A;  1YHB A;  3L0O A;  5M3M G;  3CPW A;  2K75 A;  5M3F G;  1L0W A;  4DV4 L;  2R7Z H;  2AWN A;  3J7A 5;  3TQY A;  1E22 A;  1IBK Q;  2HHH Q;  4DR1 L;  4DV1 Q;  1XJV A;  3HOZ H;  3J80 i;  3I2Z A;  1JJC B;  1PH5 A;  3NEL A;  1J6Q A;  2VUM H;  5JEA G;  1X3F A;  2DUD A;  2Y0S E;  1N36 L;  1SR3 A;  2XGT A;  2UUC Q;  3HOW H;  3H3V H;  3PUY A;  1KHI A;  5GRO A;  3KLW A;  4LUO A;  3NEM A;  2QEX A;  2ZJR A;  5M5Y H;  2NVQ H;  3UDI A;  4IPC A;  1M1K C;  5EAY A;  3AYH B;  2UXD L;  1NTG A;  1HH2 P;  2BH2 A;  3GTL H;  3PUW A;  4X64 L;  1MJC A;  2IHF A;  4JI8 L;  4X66 Q;  3I4N H;  2VY3 A;  3HOX G;  1W2B A;  1X56 A;  2OQ0 A;  3KJO A;  4P75 A;  4JI3 L;  5IYB H;  3CPF A;  3STB D;  4A3B H;  1WCM G;  3A5U A;  4IOC A;  5IYD G;  3J7Z C;  4DR5 Q;  4A3D G;  2WAQ G;  4R4Q A;  1UE1 A;  4JI2 Q;  1R9T H;  2I5M X;  3LGJ A;  4GLV B;  4IPG A;  3TEH B;  4LF6 L;  2PMZ E;  3AEV A;  1SRU A;  4YWL A;  2C35 B;  4JOI A;  1HR0 W;  4OO1 G;  2JK8 A;  3OTO Q;  1PH7 A;  4A3C G;  1SN8 A;  1PH6 A;  4A76 A;  4J15 A;  2VQF L;  4LWC A;  2MO1 A;  3T1Y L;  4BBS H;  4DR7 L;  4B3S Q;  3RR5 A;  3HOY G;  2OQK A;  3PF4 A;  4L5S A;  4Y7N H;  4POG A;  2UXB Q;  1N33 L;  2ZTD A;  3GTQ H;  3I7F A;  1Q46 A;  4OON A;  3DM3 A;  3TRE A;  4JV5 L;  3CD6 A;  2IX0 A;  2KCM A;  3D0F A;  4KLK A;  4QL5 A;  2A19 A;  4DV5 L;  1XPU A;  1GVP A;  4BXX H;  1T9H A;  4C3H H;  2K14 A;  4AH6 A;  2ES2 A;  1XTD A;  5M5X H;  2UXC L;  2R6G A;  4LFA L;  1PH4 A;  4DR2 Q;  1FJG L;  3KF6 B;  4YY3 Q;  4P74 A;  3GDE A;  2NVY H;  4R4C A;  4L5T A;  2A8V A;  3W5O A;  4R4O A;  5AJ3 L;  4OX9 L;  3IRB A;  4C3I H;  2YU9 H;  1Q12 A;  2GVB A;  3F2D A;  4HJA A;  5C0X J;  1J5E Q;  1IL2 A;  2RF4 A;  2Z0S A;  3KF6 A;  3PUV A;  4GOP A;  3PIO A;  1BKB A;  3GTP H;  3FHW A;  4DUZ Q;  1I94 Q;  3G48 A;  3F8T A;  5H1S E;  4GN3 B;  2OTL A;  1HNX Q;  4EQ5 A;  2LXJ A;  3PO2 H;  2YV5 A;  4B3R Q;  2WFW A;  5IWA Q;  5M3M H;  4DV0 Q;  4OO1 I;  2N3S A;  1I5F A;  3EIV A;  1CSQ A;  4A93 G;  4LFC L;  2XTI A;  2ZJP A;  4JC0 A;  2I0Q A;  4JI4 Q;  1VCI A;  4JI7 L;  1VQB A;  1I50 H;  4P72 A;  4JBK A;  4GNX A;  3PO3 H;  4A3J G;  1EIY B;  4DV4 Q;  1MJE A;  1TWF H;  1DGS A;  4UP8 A;  1GO3 E;  1XPR A;  4BY7 G;  2LSS A;  4UP9 A;  4DR1 Q;  1PH3 A;  1S3O A;  3OYY A;  2HQL A;  3FP9 A;  3CCE A;  3KYH C;  2Z6K A;  2RCN A;  1Q1E A;  4LW1 A;  1N36 Q;  5FJ8 G;  3H15 A;  2JA6 G;  2CWA A;  2R93 H;  2AMC B;  1VQN A;  1KRS A;  3GTK H;  2CQO A;  5GQO A;  2ZJQ A;  2JA8 G;  3HKS A;  1YJW A;  1NJI C;  1K8G A;  1HZA A;  1VQG A;  1WCM H;  4DV6 L;  4JBM A;  1PH2 A;  3FKI H;  2A1A A;  1VQP A;  1ASY A;  3L2P A;  2UXD Q;  4IPH A;  1KC8 C;  4GS3 A;  2QGQ A;  4JI8 Q;  4X64 Q;  4OWT B;  1PVO A;  2WAQ E;  1LYL A;  4IFD J;  2JE6 I;  1VQL A;  2ZTE A;  4JI3 Q;  2ATW A;  1VQ4 A;  4JI6 L;  3HOY H;  1YZ6 A;  3I55 A;  2F52 A;  4LF6 Q;  2KCT A;  1Q82 C;  2Q2U A;  3K8A A;  4HJ5 A;  1XNR L;  2JEB I;  3RN5 A;  5C3E H;  1WYD A;  3T1Y Q;  2VQF Q;  4XIG S;  1UEB A;  2N49 A;  4DR7 Q;  1VQ6 A;  4BBR G;  1U0L A;  2V1C C;  1VQ5 A;  2N78 A;  2QA4 A;  3PF5 A;  1B8A A;  5IT9 c;  1N33 Q;  3M3Y H;  1LUZ A;  1O7I A;  4JV5 Q;  2R7F A;  1AE3 A;  4AIM A;  2I5H A;  2JA5 G;  4UY8 C;  3CAM A;  3A0J A;  3Q8D A;  3A5Z B;  3CCV A;  4DV5 Q;  1V43 A;  1HR0 L;  4DR4 L;  4A4I A;  1Y1V G;  4KHZ A;  1GD7 A;  1PHJ A;  4P71 A;  4P73 A;  5C4X G;  1B70 B;  2UXC Q;  1EQQ A;  1ASZ A;  3ULJ A;  4LFA Q;  1QZG A;  3K80 C;  4OXP A;  1NMG A;  1FJG Q;  2K52 A;  2Q2T A;  4JI0 L;  4DV2 L;  3DLL A;  3E0E A;  3MXN B;  4OX9 Q;  3HOU G;  5AJ3 Q;  5GAD C;  1HNW L;  4A3G G;  1NY4 A;  4DUY L;  1HZ9 A;  3S2D H;  2UUA L;  3RLF A;  2BA1 A;  1KIX A;  4PZ7 A;  4NXM L;  5J3B A;  4A93 H;  1TWA H;  1M90 C;  5IP7 G;  3UDX A;  1SLJ A;  2GN5 A;  1V9P A;  1VQD A;  1QUQ A;  1QZH A;  4OWW B;  2JA7 G;  2K5N A;  1HNZ L;  1VQA A;  1B7Y B;  4IO9 A;  4OWX B;  1TWC H;  3RLO A;  4AQY L;  1Y1W G;  4BA2 I;  5FLM G;  1C9O A;  5HGQ A;  1X3E A;  3CCJ A;  1L1O A;  5HY6 A;  4BY7 H;  1XPO A;  4LFC Q;  4DV3 L;  3CC2 A;  1I6H H;  5ELN A;  1N34 L;  4JI7 Q;  5IP9 H;  4JOI C;  2B63 G;  4EX5 A;  2R92 G;  1WJJ A;  1BBU A;  1RL2 A;  5C4J H;  3J81 c;  2JA8 H;  3PV0 A;  3G71 A;  3KF8 B;  4X65 L;  1Q8K A;  4A3I G;  3M4P A;  4A3F H;  2OWO A;  4GLX A;  2F4V L;  3JAM c;  3S16 H;  1Q1B A;  3HOV G;  2JJQ A;  3HKZ E;  3U58 A;  1G51 A;  4RG1 A;  4R1J A;  3H0G H;  1A63 A;  4GKJ L;  1JT8 A;  3D31 A;  3I4O A;  3BU2 A;  2BH8 A;  3M9B A;  4PG3 A;  4NPS A;  4A3M G;  4X6A H;  3K7U C;  4DV6 Q;  1BVS A;  4DR3 L;  2YYZ A;  5JEA J;  1LM0 A;  2JQO A;  5K36 G;  1G29 1;  3HFZ B;  5IYC G;  4A3L G;  4L5Q A;  1E1O A;  4IJL A;  3T1H L;  4GOP B;  1YHQ A;  4GKK L;  3G6E A;  5C44 H;  1KQS A;  2HT1 A;  3S24 A;  1XMO L;  4AYB E;  1A8V A;  5LMN W;  3J81 i;  4JI6 Q;  2AHO B;  1HZB A;  2OCE A;  1YNX A;  4BY1 G;  1VQ9 A;  1EYG A;  1QVG A;  1TXY A;  3F2C A;  1SFO H;  4IPD A;  1X54 A;  1WFQ A;  3JAM i;  1XNR Q;  4HIK A;  4LF8 L;  1X65 A;  4A3K G;  4LFB L;  2EXD A;  5E7N A;  4TVA B;  1SE8 A;  2NVT H;  2DGY A;  3WWV A;  1U5K A;  1IYJ B;  1HZC A;  1CKO A;  3STB C;  1YEZ A;  4O2D A;  4UPA A;  1P8L A;  4YHH L;  5M3F H;  1VQK A;  1QVF A;  4TQU S;  4GNX B;  4LF7 L;  3F2B A;  4POF A;  1TWG H;  5JJL A;  4WJ4 A;  3PGZ A;  3L7Z C;  1HR0 Q;  2I5L X;  1I3Q H;  1WOC A;  3U50 C;  5C0X I;  3M4O H;  4DR4 Q;  3U4Z A;  3BZC A;  5JJK A;  2YTY A;  1JB7 A;  1Q7Y C;  4JI0 Q;  1K8A C;  4DV2 Q;  1JE5 A;  4PZ8 A;  4PMW A;  2R7Z G;  3ZJY C;  4MNO A;  1CUK A;  4QQB X;  2UUB L;  4IFD G;  1HNW Q;  3HOZ G;  2IY5 B;  3PSI A;  1X3G A;  1YIJ A;  1Y1W H;  4DUY Q;  1KRT A;  1IXR A;  2JEA I;  2VUM G;  2UUA Q;  4HID A;  4NXM Q;  1Q81 C;  1E24 A;  1KL9 A;  4YCU A;  3HKZ G;  1PYB A;  3SGI A;  3PIP A;  3HOX H;  2H5X A;  4KHP L;  2HIX A;  1VQ7 A;  4LF4 L;  1K3R A;  1NE3 A;  2ZM6 L;  4HJ8 A;  3HOW G;  1FVI A;  5FLX c;  5IYD H;  1UE6 A;  1HNZ Q;  4A3D H;  3GTM H;  2LXK A;  1EWI A;  4NXN L;  2BA0 A;  4AQY Q;  4DNI A;  5LMN Q;  4JI1 L;  1VS0 A;  4K0K L;  1Z47 A;  4Y52 H;  2K5H A;  1JMC A;  4DV3 Q;  4L5R C;  4A3C H;  1N32 L;  3I4N G;  2CWP A;  1KXL A;  1JJ2 A;  2CCZ A;  1YIT A;  5IYB G;  4YCW A;  1SRO A;  2RHQ B;  1N34 Q;  2E5L L;  4A3B G;  1BBW A;  2OTJ A;  2KEN A;  1EUJ A;  2YTX A;  4AYB G;  3S17 H;  1VQF A;  2PI2 E;  4LNQ A;  1LTL A;  3JC6 6;  1VQJ A;  1CKN A;  4QJF A;  4A3E G;  1X6O A;  4C3J H;  4IOA A;  3M4Q A;  4X65 Q;  1YHA A;  3CC4 A;  1XNQ L;  3ICE A;  2AKW B;  1AH9 A;  2F4V Q;  4APV A;  4RMF A;  4BBS G;  3S1R H;  4A3L H;  3UDG A;  2D62 A;  3CC7 A;  4UP7 A;  4DR6 Q;  3M7N A;  4IFD I;  1YBY A;  4GKJ Q;  3J81 j;  1S40 A;  1OXV A;  3BJU A;  1YVC A;  2WB1 E;  4YWK A;  2D0P A;  4BXX G;  4DR3 Q;  1RIP A;  4LF9 L;  3F1Z A;  2VS1 A;  2VZA A;  1E7Z A;  3GTO H;  3H3V I;  3T1H Q;  5IE8 A;  3S1Q H;  4GKK Q;  1C7Y A;  1XMO Q;  2CFM A;  2EQS A;  2KHJ A;  5GAG C;  4DV7 L;  1QUQ B;  3CCR A;  1XMQ Q;  4ME3 A;  5GAE C;  3CCM A;  3MEF A;  3NEN A;  3EN2 A;  4DK3 C;  4B3T L;  1PYS B;  1K9M C;  3G4S A;  4LF8 Q;  1L1O B;  4LFB Q;  3AQQ A;  4QY7 A;  5BR8 L;  1C0A A;  4A3J H;  3PO2 G;  2F3I A;  5LMN L;  2K5V A;  4YHH Q;  1VQE A;  4PZ6 A;  1PH8 A;  4LF7 Q;  1A62 A;  1MKH A;  4B3M L;  1PV4 A;  1AE2 A;  3B6Y A;  2MFI A;  3K7A H;  3RZO H;  4GLA C;  4HJ7 A;  1K73 C;  1PH9 A;  4YCV A;  3NBH B;  1VQH A;  5FJ8 H;  2JA6 H;  1VQO A;  4QGU A;  4GN4 B;  3VDY A;  3S1N H;  1PA6 A;  4BA1 I;  4LF5 L;  3PO3 G;  2NZH A;  2L15 A;  1PFS A;  2NN6 G;  4QIW E;  1CKM A;  2VQE L;  1IBM L;  1EFW A;  3CCQ A;  1E1T A;  4JBJ A;  2UUB Q;  1X55 A;  4IJH A;  5C0X G;  5LMU L;  2K50 A;  1UE5 A;  2HIV A;  3CCU A;  3S1M H;  1VQM A;  2VL6 A;  4KHP Q;  4DR6 L;  3K81 C;  2R93 G;  3I56 A;  4LF4 Q;  2ZM6 Q;  2EIF A;  4YWM A;  2NZO A;  4JYA L;  4XTC S;  3CMA A;  2K4K A;  1E3P A;  4O0A A;  1IBL L;  1NMF A;  3CCS A;  4NXN Q;  2ALY B;  3FKI G;  3W1G A;  2PQA B;  2WB1 G;  1OXT A;  5ELO A;  2R7D A;  4JI1 Q;  4DPG A;  2VW9 A;  4HIM A;  2UU9 L;  4K0K Q;  3CW2 C;  3EBE A;  4A3E H;  1N32 Q;  2MO0 A;  3GO5 A;  4GOP C;  3ULL A;  1EIF A;  1K83 H;  2PQA A;  3S2H H;  4BBR H;  1XMQ L;  3TS0 A;  3RN2 A;  1N8R C;  2E5L Q;  2Q2H A;  4FDB A;  3KFU A;  4NB3 A;  3S15 H;  1X9N A;  1W3S A;  2JA5 H;  1VQI A;  4WJ3 M;  1Y1V H;  1VQC A;  1XNQ Q;  3CF5 A;  5M5W H;  4ALP A;  2IHE A;  4DKA C;  5C4X H;  3RZD H;  5C3E G;  3E9H A;  3GTG H;  4JI5 L;  1SMX A;  2E8G A;  2E2H H;  2NN6 I;  1Y14 B;  4KI0 A;  1NBW A;  1P16 A;  3AFQ A;  1EQR A;  3RLN A;  1IBK L;  2HHH L;  3HOU H;  3I4M G;  3GTJ H;  4GNX C;  4DV1 L;  2E2J H;  4A3G H;  3RNU A;  4LF9 Q;  2UUC L;  3CXC A;  2Q2I A;  3ERS X;  4DK6 C;  5IP7 H;  2E2I H;  2JA9 A;  2B3G A;  1A0I A;  4X62 Q;  2B29 A;  2Y0S G;  2Z6K C;  2JA7 H;  5JJI A;  3PUZ A;  3PUX A;  2IX1 A;  1OXX K;  1UWV A;  4DV7 Q;  1GKH A;  1QVC A;  2PI2 A;  3E9I A;  5FLM H;  2MQH A;  1HJP A;  2PNH A;  3GD7 A;  4MZ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...