4LFCQ

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 19
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4lfcQ00
2KCTA 4NXML 4Y7NH 2JA8H 3UE1A 1JJCB 4NXMQ 1ASZA 1PYBA 4IPGA 1KRTA 4JI1L 5C0XI 1HR0W 3H3VH 4QY7A 1YBYA 1X55A 3CPFA 4X62Q 5C0XG 1OXUA 2JA5G 3S1NH 3AEVA 4IFDI 1Z9FA 4UPAA 2UU9L 3EBEA 2JQOA 1WJJA 4BA1I 4L5RC 1VQNA 4B3ML 4DV3Q 1RIPA 2HHHL 5JEAJ 1W2BA 4KHZA 2UXBL 1VS0A 1L0WA 1N33Q 1NY4A 4JBWA 4BBSH 1E7ZA 1W3SA 4LF4Q 4A3DG 1VQKA 1UWVA 4LF4L 2N3SA 5C44H 1H95A 1PH2A 1E22A 1PHJA 2GVBA 5LMUL 4KLKA 3PIOA 4HJ9A 3AQQA 1AE2A 1G51A 3L0OA 4JI3L 3RNUA 3CCEA 5GADC 1V43A 1PYSB 2R7DA 3RR5A 4GOPA 1U5KA 4UP7A 4R4IA 3RLFA 4YY3L 1HNWL 4LF8Q 2YU9H 2OTJA 4LF8L 4YCVA 2L15A 2OQKA 2EIFA 4DV7L 1VQ4A 1XPRA 3KF8B 5M3MG 5FJ8G 4AQYL 4A93G 4A75A 1KD1C 2UUBQ 4GS3A 1XNRL 1VQCA 2K50A 4JYAL 1Q1EA 3DM3A 4JI0Q 3UDFA 3HOUG 5IYBH 2VS1A 3PCOB 3PO2G 4GKJQ 4J15A 3I7FA 1PH6A 4JI4L 2GN5A 1UE6A 2QA4A 1UE5A 1M1KC 5FLMH 2BH2A 4LFCL 1CSQA 3AFPA 2I5HA 3KOJA 4AIMA 3M85A 4K0KQ 1DGSA 5IYDH 3IRBA 3CCUA 2IHEA 5GROA 2KHJA 1ASYA 4GLVB 2UUCQ 4YCWA 4O0AA 1K9MC 1VQBA 1X65A 1YEZA 1YZ6A 1K0RA 5HY6A 3CCQA 4IPCA 4JCVE 4YHHL 2IX1A 4LF6Q 4JV5Q 2K75A 4DV5Q 4DR7Q 4A3FH 1KRSA 4X66Q 4L5SA 1K73C 4BY1H 3GTOH 4DV5L 2LSSA 1VQAA 2WP8J 2K4KA 4JI8L 1PH5A 2YTXA 1LYLA 4QGUA 4PZ7A 4BY7H 2R7ZG 4LF5L 1IYJB 5IWAL 3U4VA 4JI7L 4LNQA 3I4OA 3F2DA 3PGZA 4QIWE 4DR4L 3PSIA 5JJLA 1X6OA 2ES2A 4A3EG 2MO0A 2QGQA 4LFCQ 2D62A 2Q2TA 1BBUA 3RZOH 1NTGA 3KJPA 4DR5Q 2E5LQ 2K14A 2UU9Q 4P74A 3A74A 2NVXH 2JA6G 3U4ZA 4IJLA 2A19A 3UDIA 4LF7Q 2ZTEA 4DNIA 1XNRQ 4X6AH 2CQOA 2V1CC 1QZHA 3PIPA 1QVCA 4QQBX 1WYDA 4GKKQ 1Q12A 3OTOQ 4FDBA 2IY5B 1YJ9A 3L7ZC 2DUDA 4LFAL 5C4XG 1X56A 4R4CA 3SGIA 2Q2IA 2WAQG 4X65Q 3K7AH 1HNXL 2N78A 1KC8C 2Q2HA 2RHQB 3K0XA 3UE0A 1FGUA 4C3HH 3GTQH 2C35B 3BU2A 2BA1A 2DGYA 4BY7G 5IYCG 4LFBQ 2KHIA 3S2DH 2MO1A 1FJGL 1B7YB 1GO3E 4IJHA 4GOPC 2ZM6L 3M4PA 1K3RA 1A63A 1VQ5A 1TWCH 3E0EA 4XTCS 4TQUS 1NJIC 4DR6Q 1N36Q 2UUBL 1GVPA 4DV0L 2B29A 4JI5Q 3GO5A 4GKJL 1J5EQ 3E9IA 1YIJA 1XMQL 1KQSA 3TEHB 5GQOA 3PO3H 1E1TA 4DV4Q 1SMXA 4RG1A 4B3RL 1JT8A 2K52A 1XMQQ 1HZCA 4JI1Q 3W1BA 1M90C 2K5VA 1EUJA 4DR5L 3KDFB 3KF6B 3I2ZA 3KF6A 5C0XJ 5DLQE 5AJ3Q 1QVFA 3GD7A 3PF4A 2WFWA 1KAWA 1HZ9A 2PI2A 2RHSB 1IBLQ 1NMGA 1VQ6A 4X64Q 1K8GA 1HNZL 2KCMA 1VQHA 3FP9A 2AWNA 5M3MH 3S14H 4A3CG 5IY0A 4KHPL 4X64L 2A8VA 2B3GA 1CKNB 4HJ5A 1FL0A 4DR7L 1YHQA 4DV6Q 1Y1WH 3JAMc 3HOWH 3I4MG 2NVTH 4A3BG 2JJQA 4C3JH 4JI8Q 4A3MG 5LMUQ 4QJFA 1I94Q 4BY1G 4AH6A 3S1RH 1SR3A 3M3YH 4DUZL 1HNXQ 1IBMQ 2AHOB 1J5EL 5J3BA 4GN4B 3PUWA 1JMCA 4POFA 1QZGA 4NB3A 4A3MH 4IFDG 2PQAB 1HR0L 3K8AA 1UE7A 3NBHB 1VQJA 1IXRA 2FXQA 2HQLA 3U58A 4PMWA 1YJNA 4BXXG 4YY3Q 3TREA 4B3TQ 3M9BA 1MJCA 1EOVA 1HH2P 4GN5A 5JJKA 3LGJA 2E2IH 4OWWB 3PO3G 4DR6L 3RLOA 4AYBG 2AMCB 2F4VL 3OTOL 2VZAA 5C3EH 5IYCH 1MKHA 2RF4A 1VQEA 1V1QA 1X3FA 5IP7H 5FLMG 3J81c 3PUYA 2ATWA 1NE3A 4IOAA 1NMFA 1SLJA 1E1OA 3NENA 3CCVA 1QUQB 2IHFA 4QL5A 1A62A 4JI4Q 3PF5A 5IE8A 1LM0A 3AFQA 4YWKA 4LWCA 3RZDH 1WOCA 3HOUH 3HOYG 3ERSX 1WFQA 3KJOA 3T1HQ 4X62L 1C7YA 3CP0A 2ASBA 2NZHA 3A5ZB 4JBMA 1XNQL 1G6PA 1PH9A 1MJEA 1EIYB 1S72A 1KIXA 5BR8L 2JEBI 4DAMA 4AYBE 2YV5A 4EX5A 4KI0A 3FHWA 1HNZQ 2R92H 1C9OA 1TWHH 2I5MX 1Q86C 1HNWQ 4IOCA 3PO2H 3A5UA 3J80c 2ZM6Q 1N32L 1P8LA 1E24A 2R93G 3M7NA 2NN6I 2R7FA 2WAQE 3J80i 4DV2L 1YITA 3E9HA 4RMFA 3ULJA 5IYDG 1N36L 1IZ6A 5C4XH 2N49A 4OO1I 4JI6L 3OYYA 1EQQA 1P16A 1Q8KA 4DV1Q 1VQIA 1EQRA 1XPOA 2GVAA 2UXDL 3AYHB 4JI5L 3T1YL 1PH8A 4JOIA 3CD6A 4A3GH 3T1YQ 1IBKQ 4L5QA 4R4QA 1X3EA 3RLNA 5K36G 1LTLA 1SRUA 2Z6KA 3Q8DA 4JC0A 3TQYA 5IYBG 3JAMi 1B8AA 4DR2L 5FLXc 1FVIA 1L2FA 1B70B 1N34Q 4A3LG 4B3MQ 3DLLA 5AJ3L 1VCIA 3J81i 2VQEQ 4A3EH 2AKWB 1QUQA 4Y52H 5C4JH 3F2CA 3BZKA 2A1AA 4EQ5A 5IP9G 1X3GA 4DK6C 1PFSA 3S1MH 3KYHC 4P73A 1VQ8A 1VQLA 3CC4A 5IT9c 2CCZA 3CCMA 4IPDA 3S17H 2N8NA 1CKOA 1GKHA 3GTLH 1X9NA 4TVAB 3CPWA 1TWAH 5IP9H 4PZ8A 5EAYA 1Q1BA 1IBML 1Y14B 3GTKH 1OXSC 4DUZQ 1N8RC 3T1HL 1U0LA 1EIFA 2E2HH 4YWMA 1BBWA 2XGTA 1WCMH 3K80C 3NELA 2OCEA 4IO9A 5BR8Q 1G291 4L5TA 3RN5A 4ALPA 4XIGS 2CWPA 3HFZB 4IPHA 4BBRG 4A3JG 4A3KH 1WI5A 2YTVA 4DR2Q 2OWOA 3STBD 2JA6H 5LMNW 2F3IA 4X66L 1KL9A 2JK8A 1FJGQ 2YYZA 4JYAQ 4DV2Q 5GAHC 3H0GG 1K83H 2VQFQ 1MIUA 3U50C 2Z6KC 1EYGA 2LXJA 3CCLA 4LF5Q 4B3SL 1SROA 3G71A 2B63G 4JI6Q 1Q82C 3S2HH 2ID0A 2JA5H 3H3VI 4GLAC 2MQHA 3PUVA 1EWIA 3J81j 2JA7G 4B3RQ 2ZTDA 4ME3A 3WWVA 4DV4L 3UDXA 4DAYB 3JC66 5GAEC 3CMAA 3FKIG 1JB7A 3CCSA 3M4QA 3TRZA 1JE5A 4K0KL 1C0AA 3KLWA 5M5XH 4HIOA 3HKZG 4OWTB 1YI2A 3A0JA 2PQAA 2MFIA 4HJ7A 3PUXA 3HOVH 2UUAL 2VQEL 2H5XA 2Y0SG 4LUZA 5ELNA 5C44G 3G48A 3TS0A 1Q46A 1Y1VH 5LMNQ 1Q81C 5M3FH 3BJUA 1UE1A 1E3PA 3B6YA 4GN3B 1SFOH 4P75A 3CAMA 3CMEA 5IP7G 4OX9L 2CKZB 2HT1A 1L1OC 3D0FA 4GNXC 4PZ6A 2OTLA 4DR3Q 2PI2E 1SE8A 2AWOA 1OTCA 1A0IA 4DR4Q 4A4IA 4LW1A 1VQ9A 2PNHA 3GTMH 4DUYQ 2JA8G 3CCJA 4R4TA 3CF5A 4IFDJ 3MXNB 4H02A 2E5LL 3PUZA 2RCNA 4DV7Q 2IT1A 4GLXA 2UUCL 4JG2A 4JI2Q 3OW2A 4YCUA 1PH4A 1GM5A 3GDEA 1YJWA 4HJAA 1YVCA 2VQFL 5JEAG 3CC7A 1QVGA 4NXNQ 3G6EA 1YNXA 1N33L 2Z0SA 1D8LA 4P72A 4UP8A 4GOPB 2NVQH 3GTPH 2UXBQ 3HOXG 1PH1A 1TWGH 2YTYA 1IL2A 5FJ8H 4DR1Q 3J7A5 3KFUA 4A3CH 3CW2C 2EXDA 2NVYH 2R6GA 4BXXH 2K5NA 4X65L 4APVA 3CC2A 1A8VA 2I5LX 5JJIA 1BKBA 4JBKA 1PH7A 3F8TA 1PV4A 1HR0Q 2EQSA 1HZBA 1I5FA 2ZTCA 1HZAA 5M5YH 1I50H 3J7ZC 4DPGA 3CQZH 5M3FG 2Q2UA 1VQGA 5M5WH 5ELOA 1JJ2A 4LF7L 3ULPA 4DKAC 2F52A 1PH3A 4B3SQ 4JBJA 2VUMG 3CXCA 3ICEA 1OXTA 4DV0Q 4GKKL 1AE3A 1Y1VG 1Z47A 3PV0A 3UDGA 4R4OA 2UXDQ 1CKMA 1OXVA 2KBNA 2CFMA 4DV1L 1S3OA 2VUMH 3MEFA 1PA6A 2R92G 1XMOQ 2JA9A 3K7UC 3I4NG 1AH9A 1IBKL 1KHIA 2PMZE 3KDFA 4JOIC 3HOZG 2LXKA 3W1GA 2R93H 4A3BH 4B3TL 4A3GG 1JJGA 1Y1WG 5E7NA 4A3IH 3HOWG 3W5OA 3I4MH 5HGQA 2UUAQ 4NPSA 1XPUA 4PG3A 1IBLL 4JI2L 1L1OB 4GNXB 1X54A 1L1OA 4GNXA 4DV3L 1EFWA 1VQOA 4A76A 1Q7YC 1RL2A 3H15A 3M4OH 2NN6G 3RN2A 1OXXK 1KXLA 2QEXA 4LF6L 4JV5L 4YHHQ 2VL6A 3H0GH 1TWFH 3S24A 4LF9Q 1N32Q 2KENA 4OO1G 4A3IG 1YHBA 3D31A 3CCRA 1UEBA 3HKSA 3EIVA 3TS2A 2D0PA 4A3LH 2VNUD 3BZCA 3GTJH 3GTGH 1D7QA 4LUVA 3HKZE 1HJPA 1WCMG 2JE6I 1PVOA 4MTNA 4DR3L 1NBWA 1SN8A 2OQ0A 5GAGC 1VQDA 1VQPA 2VW9A 1CSPA 4DUYL 1GD7A 4O2DA 3G4SA 1K8AC 4LFBL 3I55A 2MNAA 4UY8C 3ULLA 2UXCL 2UXCQ 3VDYA 4WJ3M 3ZJYC 2WB1G 3L2PA 4A93H 2HIVA 2BA0A 1YHAA 4C3IH 1N34L 2JEAI 3F2BA 4AQYQ 3S1QH 4BBRH 4A3JH 4R1JA 4HJ8A 2F4VQ 4HIMA 2JA7H 4WJ4A 4JI0L 4NXNL 2Y0SE 3HOZH 4LF9L 2CWAA 4UP9A 2ZJQA 1XTDA 2NZOA 3ER0A 4C2MH 4LFAQ 2E8GA 2B63H 4OXPA 5H1SE 1I94L 4MNOA 4LUOA 1XMOL 4DR1L 3I56A 3F1ZA 1I3QH 2WB1E 2VY3A 5C3EG 4HIDA 1LUZA 1CKNA 4JI3Q 3S16H 2ZJRA 1R9TH 1V9PA 4BBSG 4A3DH 1XNQQ 1CUKA 4OONA 4A3KG 4POGA 3K81C 3S15H 1XJVA 3EN2A 1N9WA 2ALYB 1BVSA 2I0QA 2E2JH 1J6QA 2ZJPA 2HIXA 4KHPQ 3HOYH 4P71A 2BH8A 3I4NH 2HHHQ 4BA2I 3HOVG 4YWLA 5LMNL 4MZ9A 2R7ZH 1T9HA 1VQFA 4DV6L 1O7IA 2IX0A 4OWXB 4DK3C 1VQ7A 4OX9Q 1TXYA 2XTIA 2K5HA 3FKIH 3NEMA 3HOXH 1I6HH 4A3FG 3STBC 4JI7Q 5IWAQ 1VQMA 2D0OA 1S40A 4HIKA
chains in the Genus database with same CATH superfamily
2BE5C 1I4GA 1Y1VB 2K04A 1HR0W 5IOCA 5C0XG 1X55A 4IFDI 3AEVA 4IN3A 2UU9L 2L12A 2JQOA 1SE4A 1F9SA 3CHBD 1I4XA 3R2IA 3HRZC 3J7AV 1FGBD 5M5XB 1PTOC 2B39A 1B1ZA 5JEAJ 1W2BA 2UXBL 1L0WA 3RD4A 4BBSH 4CJ0B 1W3SA 3LWUA 2N3SA 1H95A 1E22A 1K83B 3VR3A 3AQQA 1BR9A 4JI3L 3RNUA 5CBAE 2EYJA 3PQIA 5JVG3 5IGDA 5KIXA 3RR5A 1U5KA 1PRTC 2N88A 4UP7A 3RLFA 4YY3L 1EQVA 1MI2A 2YU9H 2K5QA 3PIO3 2L15A 2OQKA 2EIFA 2B2UA 3KF8B 1A2TA 4A3DB 3S16B 1GHJA 3NP8A 3UDFA 2VS1A 3S17B 3PO2G 4GKJQ 3I7FA 1GJXA 1UE6A 1UE5A 4MN3A 2BH2A 1W6JA 5IYDH 3M85A 4AIMA 2KHSA 1F9QA 2L9HA 1RD9D 2ZXOA 4IURA 1ASYA 4KD3A 4YCWA 4O0AA 3PIP3 4RCOA 3CCQA 2IW3A 5IGCA 4O42A 4DR7Q 1ET6A 4L5SA 1SXTA 3GTOH 2CH4A 2RDGA 1MHWC 1Q3LA 1VQAA 2K4KA 1LLRD 4DR7L 1IKMA 2WAQB 3TSSA 4ZYSA 5IWAL 5JPNC 4F87A 4JI7L 1S5BD 1PTOH 4OELB 3PSIA 3PO2B 5C4HA 1TWHB 1A6XA 4A3EG 4KN4C 4LFCQ 3URYA 1NTGA 2SNSA 2DY8A 3N52A 4P74A 4IJLA 2F0MA 4LF7Q 4A3BB 1XNRQ 4RHSA 4X6AH 5A2QL 3PIPA 4QQBX 1HQMC 3DEOA 2Z9HA 5BN5A 3D4WA 1H9KA 5C4XG 3N6RA 5C3EB 4V190 2PZWA 2DNCA 4X65Q 3K7AH 2CW0D 2N78A 2RHQB 1JOOA 1KLGD 3K0XA 3UE0A 2O2LD 4M8AA 3MEHA 2Q8RE 4C3HH 5T1GA 5E3FA 5NUCA 5KYLA 4IJHA 1C48A 1JC7A 1VQ5A 3E0EA 3SHLA 1TIID 4TQUS 5JAVA 3QB3A 1N36Q 3MXGA 1K0SA 1RODA 3E9IA 1JE4A 4G7HC 2R7ZB 4PMCA 2K52A 1SYEA 1TS2A 3FPPA 1M90C 1IYUA 4ZQ3A 2SNMA 1QVFA 5C6AA 1HFGA 1ZEQX 2PI2A 3VYUA 1IBLQ 2EJMA 1VQ6A 4CGYB 4WJWA 5M3MH 3W2DA 3S14H 1B44D 1D1IA 1FL0A 1PRTF 3CU7A 1YHQA 1Y1WH 3I4MG 5F2DA 2NVTH 3EFXD 2A73B 3NTKA 1I94Q 4HMJA 4BY1G 1SR3A 2XNAC 1HNXQ 2M00A 1STYA 1BCPD 3I90A 3D4RA 4L8JA 1K8OA 1XYIA 3K8AA 3NBHB 3R3OA 1ENAA 3TREA 3BVGA 4F8MA 1KDBA 4GN5A 5L37A 1EU3A 1XTCD 1A3UA 4DR6L 3QO2A 5C3EH 5IYCH 2RKSA 1V1QA 4IOAA 3K7AB 5I6YA 5FLMG 3PUYA 1IHZA 1TT2A 1NMFA 1SLJA 3PMFA 4QL5A 3AFQA 5EPKA 3HOUH 2MHVA 4IQZA 3SK6A 5CV5A 3OMGA 1IL8A 3K5NA 3CP0A 3A5ZB 2K05A 1JWUD 4JBMA 1LO5D 1PH9A 1S72A 2JEBI 1E2VA 4AYBE 2YV5A 4EX5A 5FO7B 4DK1A 4LMQD 4A3KB 1HXYD 1Q86C 1G2TA 4RGTA 2R93G 3U9OA 1WCMB 2WAQE 3E9HA 3Q24A 3ULJA 1F9RA 2N49A 3NBHA 1B3AA 3OYYA 1EQQA 1Q8KA 2AQ3B 2K5WA 1XPOA 1V1PB 4JOIA 3CD6A 5I9PA 2Z6KA 5AFWA 3Q8DA 4R8IA 5KNBA 5FLXc 3VA7A 5C4ZA 1L2FA 2LMCB 4CKEA 1U4MA 1EU4A 3D4DA 3DLLA 4B3MQ 2QDBA 5C4JH 2A1AA 3NHHA 1X3GA 4DK6C 1TS4A 1CI3M 1WTQA 1X9NA 1BOSA 1B3QA 2KUMA 3NTIA 5EAYA 1Q1BA 2N55A 3GTKH 1OXSC 2X6LA 3CRLC 1LTRD 2F0UA 5CGKA 3NELA 2OCEA 5EQ0A 4L5TA 4QB4A 2DJGC 1AZPA 3STBD 3I91A 1KL9A 2YYZA 4JYAQ 5GAHC 3CCLA 1HA5A 4ZAIA 5FKAC 5IGEA 3ND9A 3S2HH 1EY7A 1HRJA 4GLAC 1KNAA 3JAML 1WTVA 3PUVA 3J81j 4B3RQ 3EA6A 4ME3A 3WWVA 4BBSB 4DAYA 3CMAA 2RQXA 3CCSA 3M4QA 3DEPA 1JE5A 3TRZA 4ZUIA 1CT1D 3K6OA 2CQAA 2VQEL 2G9DA 5C44G 3TS0A 5LMNQ 1BO0A 5A35A 1J8IA 4GN3B 3GV3A 1E3PA 1EL0A 3K0YA 2HT1A 2OTLA 1SE8A 1V1OA 1A0IA 4DR4Q 2PNHA 2JA8G 3CCJA 1DD2A 3HOWB 4HEDA 4JW0A 4H02A 1GUOA 4CDFC 2RCNA 2L1BA 1WD1A 4X3SA 1CFMA 1AP0A 1PH4A 1GM5A 3GDEA 4HJAA 1B2TA 2VQFL 3GTKB 2WKCA 1ML0D 1QVGA 4NXNQ 3G6EA 1YNXA 5KEEA 3PO3B 3DWAA 1SYBA 3MXPA 3J7A5 4DR1Q 1NNXA 3DXJC 4FXGC 1GUWA 2JA7B 4X65L 5G3LD 1A8VA 1BKBA 3SEBA 1HQRD 1PYWD 1O7YA 2EQSA 1NAPA 2ZTCA 1HZAA 3BZDB 5EKLA 2Q8IB 1PTOD 2Q2UA 5M5WH 1EY6A 4JBJA 1UAPA 1JQYD 1AE3A 1Y1VG 1Z47A 1ZYRD 2FMCA 2Z1CA 3UDGA 2Q8TA 1FNWA 2UXDQ 3GTJB 2CFMA 1FR3A 4I7AA 2OXPA 4K2KA 2VUMH 3K7UC 2IX3A 3VR5A 1KHIA 3W1GA 2R93H 4A3GG 1Y1WG 3I4MH 1XPUA 3MAQA 4PG3A 3I4MB 1TS3A 4IUTA 2HD3A 1NR4A 2NN6G 4UAIA 1OXXK 3HOUB 2K5DA 4MIUA 1TWFH 2F3WA 4LF9Q 3D31A 4PV1C 4DAPA 3GTJH 3GTGH 4LUVA 3HKZE 1QILA 1SN8A 4PQXA 5IT9E 2OQ0A 5FK9C 2VW9A 3A54A 5DM63 4O2DA 3I55A 2MNAA 3FRPB 3ULLA 2TMPA 4CDEC 2WB1G 2BA0A 2PZTA 3I72A 2J0TD 3GTPB 1TWGB 4C2MH 2E8GA 3HKZB 3NE5B 4MNOA 4LUOA 1K3BC 3I56A 4NDXA 1LUZA 1CKNA 3S16H 2EYLA 2B2WC 4A3DH 4A3KG 1FD7D 1XJVA 1A3TA 3S15H 4KJNA 2I0QA 1J6QA 1LTTD 5DM73 1S5CD 3I4NH 1KDCA 2A6EC 4OWXB 4XYQA 4DK3C 4N8FA 1KNEA 3FKIH 2L4NA 3STBC 1DOLA 3I4LA 4X3KA 4ULLA 4HIKA 3AB9A 4E6IA 1G6ZA 2KCTA 1Z6HA 4U68A 4C3JG 1B4OA 4NXMQ 3S2DB 4IUPA 1KRTA 4JI1L 5LL6S 3J81E 3H3VH 4X62Q 2JA5G 5M3FB 5LHY1 4KY6A 3V96A 4DF7A 3JAME 5EBCA 1CK1A 1TY0A 1U4RA 4KKSA 4UHVA 4MTKA 4L5RC 2Z8LA 1VQNA 1FNVA 4B3ML 1TKWB 2F0FA 4KHZA 1B9NA 4Y7NB 1N33Q 4JBWA 4A3DG 4LF4Q 1VQKA 5C44H 3OWEB 2F03A 1XX8A 5LMUL 2JA5B 2FMMA 3HOXB 1G51A 5G3LF 5GADC 3MZ5A 1V43A 1PYSB 4K6DA 2A69C 1GUSA 4RAUC 4F7XA 1HNWL 4RWSC 4LF8L 4N9TA 2L11A 3MFYA 5M3MG 1R9TB 1KD1C 2B2TA 1XNRL 4DXFA 2K50A 4V0BA 4JI0Q 3HOUG 5IYBH 3PCOB 1WTRA 1D6EC 4OEMB 2QA4A 3VYTA 1M1KC 3W3AA 4LFCL 3AFPA 2X69A 3KOJA 4K0KQ 1DGSA 2K1BA 5GROA 2KHJA 2NZ1D 2KOLA 4GLVB 2UUCQ 1VQBA 1K0RA 1JWSD 1JR0D 2ENBA 5HY6A 2EPBA 4A3EB 4G7ZC 4YHHL 4FXDA 1J9OA 4LF6Q 4JV5Q 5CBEE 4A3FH 1E0BA 1KRSA 1K73C 4DV5L 2LSSA 1PTOF 2WP8J 4JI8L 1TR5A 3MC0B 2R7ZG 3U4VA 2A6ED 4ZKCB 4LNQA 3PGZA 2V4DA 2M9VA 4DR4L 1D2BA 3KK7A 1TWFB 5JJLA 2QGQA 1ZYRC 1EY4A 4WFN3 1BBUA 4DR5Q 1EYDA 2F0PA 2R92B 2A68C 2NVXH 3U4ZA 1ILQA 1ONLA 2V1CC 4U673 1DXMA 2D2CC 1Q12A 4FDBA 2IY5B 1PRTB 3KBXA 4WRDA 4LFAL 4R4CA 3SGIA 3FEWX 3I73A 1QCBD 5EBDA 2PMZB 3K57A 1FGUA 3CQZB 1SNMA 3BU2A 3I3CA 3ZYYX 4LFBQ 2KHIA 4BWGB 2MO1A 4DFAA 1B7YB 4A3MB 1A63A 1TWCH 1DZ1A 3RMHA 1NJIC 3P20A 3WOFA 4S3SA 2PW5A 2B29A 4DV0L 3M3YB 2CHBD 1PLFA 2EYMA 3GO5A 3P7JA 3TEHB 3H6MA 3PO3H 1E1TA 1LT5D 1A3VA 1SMXA 2NVTB 1C4QA 1S5ED 3HOYB 3R2TA 3J7YW 2H4OA 3PF4A 3VA5A 5AJ3Q 5C0XJ 3GD7A 3S15B 2WFWA 2CH4W 4NP5A 4J1MA 3VR2A 1NMGA 4RFBA 1K8GA 1QE6A 1VQHA 2KCMA 4Z9CB 2A8VA 2PZUA 1HTPA 3H3VC 3IFTA 4DV6Q 4C2MB 3JAMc 3HOWH 1ESFA 2OEOA 4A3MG 3OOCA 4AH6A 3S1RH 3M3YH 2M2LA 2HUGA 3EROA 3PUWA 2KA7A 1B50A 4IFDG 4A3MH 3MHBA 2PQAB 3OIPA 1HR0L 4RKLA 1UE7A 4N9PA 4ZRZA 4C3HB 4DK0A 1EWHA 3U58A 1HTLD 2PW7A 4DAVA 4YY3Q 1Q90A 4KY7A 4HAEA 5JPMC 3LGJA 4IUQA 2MP1A 1BNZA 3PO3G 4FF2A 3RLOA 1CZGA 1F2YA 1BQQT 3OTOL 2PCFB 1MKHA 2RF4A 1R4PB 1VQEA 2ATWA 2L0CA 2WINB 1TY2A 2DNEA 5D65A 3NENA 1QUQB 1X3PA 5IT9L 5IE8A 3HOYG 3RZDH 1EWCA 4LWCA 2DN8A 1WFQA 5A2QE 1SYFA 3I70A 2ASBA 2NZHA 2VB3X 4J6HA 1EIYB 1KIXA 1EEID 5C3XA 1C9OA 1Q8IA 3BVZA 1HNWQ 3J80c 3Q6SA 5FLXL 1G91A 1E24A 3M7NA 4RA8A 1SNDA 5C4XH 5K36H 4JI6L 1HA6A 2A6HD 1P16A 3GTOB 3TN2A 2UXDL 4A3FB 3T1YL 1NCVA 1O7ZA 4A3GH 1IBKQ 2B2TC 1WD0A 2PPBC 5K36G 1ICWA 4JC0A 3VR4A 1STGA 5IYBG 1N34Q 4A3EH 1VCIA 1SE3A 2EJGC 1QUQA 1UEAB 3BZKA 4K6LA 1Y8OB 5M9OA 3S1MH 1VQLA 5IT9c 3CCMA 1CQFA 4IPDA 5JEAH 3FMCA 5IP9H 4PZ8A 1IBML 1Y14B 4DUZQ 2E2HH 2K6AA 1U0LA 1EIFA 3T1HL 4YWMA 1M8AA 2HQEA 4K14A 1G291 5IGBA 2JA6H 1NSNS 5LMNW 2Z6KC 2JSOA 1SROA 3SK5A 3RZDB 4JI6Q 2A68D 1I4RA 2ID0A 3H3VI 3AMUA 2JA7G 4DV4L 3UDXA 2EY5A 1S4ZA 2PQEA 1SDFA 4ZK9B 4IZ8A 4R9WA 2PQAA 5JJZA 4HJ7A 3PUXA 2NN6H 1L0YB 4XQQA 3EQLC 5ELNA 1Q46A 1Y1VH 1Q81C 2JYOA 5M3FH 1BF4A 1UE1A 1LV9A 3CMEA 3A8KE 3D0FA 4PZ6A 3FKIB 2FFKB 2EXZA 4RKBA 1BDOA 4NMZA 4LW1A 4DUYQ 1AN8A 4R4TA 4TRDA 4JK1C 3I4NB 3EVQA 5IGGA 1SJHD 2JN4A 5TSSA 3SDZA 1I4QA 2A5HA 2Z0SA 1D8LA 3K5OA 4P72A 2NVQH 5KRUA 4EVOA 2B2VA 4A3CH 2EXDA 3CW2C 3OPOA 1LTAD 1JORA 1CA5A 2Y0SB 5DNFA 5JJIA 4NW2A 3F8TA 4A93B 3LWEA 3J7ZC 4DPGA 3QJYA 3CQZH 4KKUA 1TU2B 5FOBB 1ENCA 1JJ2A 2F52A 3TP6A 3H94A 1PFNA 4FNFA 2C5CA 1OXTA 4DV0Q 2F0GA 1CKMA 1JICA 2KBNA 1AH9A 3I4NG 2KEEA 3VYRA 3E3XA 4A3BH 1JJGA 1KDAA 2NWGA 4A3IH 4C1NI 3ITPA 2UUAQ 4JI2L 1L1OB 4GNXB 1X54A 3R93A 1WVLA 1EFWA 3M4OH 1VQOA 4A3LG 1STNA 3H15A 2WACA 2SEBD 1N32Q 4A3IG 1YHBA 2VNUD 1D7QA 3HKSA 3TS2A 3SK4A 4ZKBB 2EOTA 1WCMG 2OT2A 4MTNA 3O13A 1NUCA 2ICIA 5I4DA 5M5YB 3G4SA 1SYDA 1SYGA 1GUNA 1EIHA 3VDYA 3TZDA 3ZJYC 4C3IH 1YHAA 1N34L 3L3OC 3F2BA 4AQYQ 3S1QH 4R1JA 4HJ8A 2F4VQ 1LT4D 2JA7H 1FNUA 4JI0L 1VF5C 1H9JA 3BDCA 1AFPA 2B2VC 4LF9L 4UP9A 1XTDA 2NZOA 3ER0A 4G4KA 1BUVT 1DJRD 1I94L 2JA8H 3DHQA 1XMOL 4HIDA 2XRQD 4BBSG 2H1EA 4OONA 5J39A 2ALYB 1Y8NB 2D9UA 2F0LA 2ZJPA 2HIXA 3NPPA 3C1FA 1SE2A 2HHHQ 5LMNL 4FO2A 4MZ9A 1MSHA 4H13C 5LL6X 4H0LC 4OX9Q 2XTIA 3NEMA 1CHPD 4EQPA 2RSOA 1CHQD 4N8X1 2QEJC 3BS1A 1F2LA 3UE1A 2QDLA 1ASZA 2L5TA 1PYBA 4IPGA 1YBYA 1Z9FA 4UPAA 3EBEA 3SE0A 4K2LA 3HGBA 1WJJA 1PRTD 2NTSA 1HUNA 5IIFA 1SNQA 1RIPA 1L0XB 2KCNA 4QMGA 1VS0A 1QB5D 4TSSA 2F0QA 4BS9A 1E7ZA 4CDCC 1UWVA 4KKTA 4LF4L 1PH2A 3J80E 3Q23A 3S2HB 3S9WA 3CCEA 3TP5A 1O78A 3RZOB 4R4IA 4OHJA 2OTJA 4DV7L 1XPRA 5FJ8G 4GZYC 2QW7A 4GS3A 3MWYW 1Q1EA 3DM3A 4JYAL 1DYQA 1S5FD 4J15A 2GN5A 5FLMH 1BCPF 1CSQA 1KABA 4IALA 2XN9C 3IRBA 3NQIA 3CCUA 2IHEA 5C4JB 4OIKA 1K9MC 1YZ6A 2G5DA 2RDHA 2Z4HA 4JCVE 4A3GB 2RDFA 1HUMA 1PZJD 2K75A 4X66Q 2EVBA 1VF7A 2RSNA 4H7BA 4BY7H 2YTXA 4QGUA 2EDGA 3D3RA 5COYA 5ELDA 3GTGB 1HPCA 4QIWE 4EQNA 2F0SA 1SNPA 1X6OA 2HCCA 1SSOA 3NK9A 2MO0A 2NB0A 2ES2A 2D62A 5EJWA 2FJ2A 3KJPA 3X3MA 2K14A 3P75A 1STAA 2UU9Q 3A74A 4ZUJA 1F9PA 3UDIA 2A19A 3MXUA 2CQOA 1QZHA 1SAPA 1SBBB 3BDLA 1YJ9A 3L7ZC 5D3IB 2A6HC 2RVLA 4DU9A 2WAQG 1HNXL 4FF3A 2Q2HA 5EGTA 2EY6A 3GTQH 2B2WA 4KN7C 1O80A 5J1ZA 2DGYA 1BBXC 4BY7G 1LTBD 5FO9B 1QOHA 1I6VC 4HR7B 1FJGL 1GO3E 4GOPC 2ZM6L 3M4PA 1K3RA 3ONAB 1MD2D 3NUCA 3S1RB 2BE5D 4M1UB 4DR6Q 2UUBL 1ZXTA 1GVPA 1JOKA 2BDNA 3OMCA 4JI5Q 1X32A 3AU7A 1YIJA 1J5EQ 1G2SA 4B9WA 5GQOA 3TP8A 4K8IA 4DV4Q 2NVQB 3MA2B 4RG1A 5T1IA 3W1BA 3ERQA 2K5VA 1YNNC 4DR5L 3KDFB 3KF6B 5DLQE 3DUZA 1CZWA 2D5DA 1KAWA 5HGTA 1II3A 4CJ2C 4X64Q 1HNZL 3FP9A 4KHPL 4X64L 2B3GA 1CKNB 1RDPD 4PNYA 2JJQA 3SK8A 1GOZA 4JI8Q 3QOLA 5LMUQ 1SNCA 3IKJA 4DUZL 1IBMQ 4BBRB 1J5EL 4GN4B 4KHVA 1JMCA 3J7AF 1ZKOA 4JPBW 1WTWA 1JWMD 2C9OA 1VQJA 1IXRA 4PMWA 4BXXG 3M9BA 1MJCA 3H91A 5DAUA 5JJKA 2E2IH 2J4XA 4OWWB 5KNCA 1LABA 4AYBG 1D5XC 3HG9A 2F4VL 2VZAA 4FXKC 5IP7H 5K5PA 1O7LA 2KQ3A 3CCVA 1TVXA 4QUCA 4YWKA 1WOCA 3ERSX 3KJOA 4X62L 1UUPA 1C7YA 1G6PA 1XNQL 2J7ZA 1MJEA 3HP3A 1A2UA 4AYBB 4KI0A 3GP7A 3E0JA 2NVXB 1RCVD 4I7ZC 3FVQA 1TWHH 4HTHA 4IOCA 3PO2H 1XWEA 2ZM6Q 1N32L 1P8LA 1PTOB 2R7FA 4DV2L 4DGZA 5IYDG 4FYDA 1IZ6A 1U9RA 3G7LA 2F0VA 1TWAB 2A74C 1Y69U 3ND8A 1RF2D 2GVAA 3AYHB 2EY2A 1AEXA 1PH8A 3QIAA 2MJ8A 3T1YQ 4L5QA 4R4QA 3RLNA 1EFID 1LTLA 1SRUA 3JAMi 2AUKA 1EYCA 1GUGA 5AJ3L 3J81i 1RTOA 2PYKA 1BXTA 4LJZC 3F2CA 4XYOA 5CC4A 4P73A 3CC4A 3T51B 2CCZA 4UDUC 4FF4A 5JVH3 3C3LA 1GKHA 3GTLH 3CPWA 1TWAH 2HDMA 1F2ZA 1FYCA 1BBWA 3K80C 4LK1C 1DCZA 3RN5A 4ALPA 4XIGS 2CWPA 3HFZB 4IPHA 4A3JG 4A3KH 1WI5A 2LFNA 2F3IA 4X66L 2JK8A 2IL8A 3QOJA 4KD4A 3GTMB 4DV2Q 3H0GG 2XWBB 1K83H 5CV7A 1MIUA 1EYGA 2LXJA 2JXMB 3G71A 1STBA 3NXWA 5C44B 4B3SL 2JA5H 3SXHA 1K8MA 2MQHA 3BYTB 3M4YA 2AQ1B 2K32A 2ZTDA 1D5ZC 3JC66 3NTHA 5GAEC 1JB7A 3FKIG 1QG7A 1EOTA 2B2YA 5BN3A 5M5XH 4HIOA 3HKZG 1YI2A 3UI2A 2MFIA 3HOVH 3S1NB 1M4VA 3DM1A 3T16A 1I4PA 2NTTA 4B08A 2HCIA 4L63B 1SFOH 3B6YA 4P75A 4OX9L 1L1OC 4GNXC 2XSCA 2PI2E 1LTGD 4A4IA 1VQ9A 2KEDA 4K5WA 4KK7A 3CF5A 2KECA 2E5LL 1X3QA 3NWSA 4MHEA 2F4IA 2B8GA 4GLXA 1W6KA 2UUCL 4X3TA 2ICEC 1YJWA 4J8QA 1LT6D 4OGQC 3KBGA 5JEAG 4OO1H 1I3QB 4XDXA 5D14A 1N33L 1VDZA 4UP8A 3GTPH 2AQ2B 1TWGH 2G9HD 2EYHA 3V2TA 3S1MB 1IKLA 2QCPX 2K5NA 4BXXH 1MSGA 2P5ZX 2R3ZA 2RA4A 2I5LX 4JBKA 1PH7A 1Z7TA 4ME5A 5M5YH 5M3FG 1H9RA 3MFGA 2RCFA 3GQBA 5ELOA 5C5LA 4B3SQ 1QWYA 2F1MA 3SVMA 2VUMG 3CXCA 1JOQA 4WORA 4G57A 1SYCA 1T5XD 4R4OA 2VB2X 1OXVA 5C3WA 4DV1L 1V8QA 4KJOA 2MPMA 2L55A 1XMOQ 5I9OA 1IBKL 5ELEA 3KDFA 4JOIC 2LXKA 3BG3A 4B3TL 5E7NA 3W5OA 1KTKA 3ICEA 2B2YC 1L1OA 4GNXA 4DV3L 4XQNA 4KTAA 1KXLA 2QEXA 4LF6L 4JV5L 2MGSA 2NYZD 2VL6A 1F77A 2F0DA 3BDOA 3CCRA 1HJPA 2JE6I 1PVOA 4DR3L 1YNND 4BY7B 4ILWA 1VQPA 1SMYC 1CSPA 4DUYL 4DXGA 1K8AC 2UXCL 3T13A 1I50B 3I8ZA 4WJ3M 1QNKA 1ILPA 2K01A 1H9MA 4BBRH 1HFNA 3T53B 2Y0SE 3A8JE 2B2UC 2CWAA 2ZJQA 4LFAQ 1CA6A 4H44C 2B63H 1E2WA 1E2ZA 1I3QH 1DM0B 2ZJRA 1R9TH 3P1HA 1XNQQ 1U4LA 1CUKA 1GUTA 5CORA 4KMUC 1N9WA 4IUVA 1BVSA 2YU9B 3HOYH 2BH8A 3CRKC 1DONA 2R61A 4BA2I 5I2XA 4YWLA 2WB1B 1T9HA 4DV6L 2A69D 4NKLA 1VQ7A 3LX0A 2K5HA 5E4WC 5CV4A 3HOXH 4FP5D 3C1EA 3FPUB 1ICFB 4NXML 4Y7NH 2NUCA 1JJCB 1EYAA 3D8GA 5C0XI 3DWPA 1MGSA 4QY7A 3CPFA 1OXUA 3S1NH 3HOVB 4OL7A 4BA1I 4B9XA 1PXUA 4DV3Q 2HHHL 1AW7A 2WKDA 3TZUA 1NY4A 4RCNA 3U9SA 1WTOA 1PHJA 2GVBA 3OIQA 4KLKA 4XQJA 3PIOA 3IAYA 4QCLA 1HCZA 4HJ9A 1AE2A 1PZKD 3A7LA 3L0OA 2F0JA 3NWTA 1UNSA 2R7DA 2CVRA 4GOPA 1STEA 1EQTA 4LF8Q 1R4QB 2AUJD 2LS01 5I2YA 4YCVA 2IJ0A 4C3HG 1VQ4A 4F88A 5C5MA 4AQYL 4RGOS 3MTSA 4A93G 3NQTA 4A75A 2UUBQ 5FLXE 1EIGA 3OHXC 1VQCA 2JA8B 1CM9A 1KLUD 2XRSD 1PH6A 4JI4L 3GTLB 2EYPA 3A55A 1K28A 1EY9A 2I5HA 3BYYB 3WDNA 4CDDC 3TBIB 1X65A 1YEZA 1YNJD 4IPCA 2PNRC 4C3IG 4K5VA 2IX1A 4DV5Q 4BY1H 3D6WA 1PH5A 2QILA 1LYLA 4PZ7A 1HHVA 4LF5L 1IYJB 1IW7D 1PFBA 4ID6A 2X6GA 2ZXRA 3I4OA 5JOBA 3CKIB 3F2DA 2O4XA 2Z6BA 2ZXPA 3K5MA 1Y8PB 1H9SA 2TSSA 5E4XA 2Q2TA 3RZOH 3M4OB 2E5LQ 4DA2A 4KY5A 2JA6G 1VMCA 1LACA 4A3IB 1U4PA 2DY7A 2EE1A 2ZTEA 4DNIA 2K28A 2VXWA 1RTNA 3J81L 1JCKB 1QVCA 1WYDA 4GKKQ 3OTOQ 1PZID 3C2PA 4O1NA 2F0WA 2DUDA 1X56A 2JP1A 4IUNA 1SEBD 2Q2IA 3SR1A 4RHRA 1ENFA 4ODGA 4QUFA 2F0EA 1KC8C 3QR8A 2QF7A 2E2IB 3X3NA 1D1KA 1RKNA 4RGMA 2C35B 2BA1A 3J80L 1EZ6A 5IYCG 3VYSA 5EPJA 3S2DH 4ZCKA 1LTSD 4XTCS 1H9SB 2EYOA 3NBIA 4C3JB 4KV6A 4XXEA 4GKJL 1XMQL 1KQSA 2WIIB 1KAAA 2KJXA 1RHPA 4C56C 4B3RL 1JT8A 1XMQQ 1HZCA 2PO4A 4JI1Q 2E74C 5CV8A 5CV9A 1WTHA 1EUJA 2K33A 1T5EA 5BN4A 3I2ZA 3KF6A 2E2JB 3M7GA 1SJED 2O5JC 2RHSB 1HZ9A 5J22A 2IPKD 2AWNA 4A3CG 5IY0A 2B63B 4HJ5A 2BOSA 2EJFC 4A3BG 5KGUA 4C3JH 4CHTB 2HDLA 3FDTA 3A7AB 4QJFA 3OWFA 4HN7A 1TWCB 5CMDA 1ET9A 2AHOB 4X3UA 4A3JB 5J3BA 1ESRA 5I6WA 4POFA 1QZGA 1EY8A 4NB3A 2LY7A 3GTQB 2HQLA 2FXQA 2WV6D 1YJNA 4B3TQ 2RBMA 4HSPA 4HSVA 3H09A 1EOVA 1HH2P 2SDFA 4IFDH 2AMCB 3E5SA 4P2CB 1X3FA 3J81c 2I46A 1NE3A 5IODA 4YIJA 3T4AC 1E1OA 5ELFA 1OO9B 3R8BA 4ZLTF 2IHFA 3H0GB 1A62A 1IW7C 3PF5A 4JI4Q 4LAAA 1LM0A 2B8FA 3T1HQ 2F0OA 5BR8L 4DAMA 5EKIA 3G6JB 3FHWA 1HNZQ 2R92H 2I5MX 2O5IC 3A5UA 2E75C 2F0HA 2NN6I 3A56A 3J80i 1YITA 1MBYA 3D6CA 4RMFA 1N36L 2E2HB 1PMRA 4OO1I 3WOEA 5CR3A 4DN4M 2EZVA 4DV1Q 1VQIA 1EQRA 4IUUA 3KUPA 5M5WB 1V1PA 4JI5L 1SNOA 5FO8B 5ISRA 4BY1B 4EGVA 1X3EA 1QNUA 3TQYA 5CV6A 3A8IE 1B8AA 4DR2L 5IGFA 1FVIA 1B70B 4HCEA 2K7VA 1XXGA 4Y52H 2VQEQ 2AKWB 2EY1A 4RGNA 4QIWB 4ABNA 4HCSA 3LNNA 5IP9G 4EQ5A 2NVYB 3DWQA 1PFSA 3KYHC 1VQ8A 4Q5VA 3IFDA 1GHKA 4K8JA 3S17H 2N8NA 1CKOA 2F0IA 4TVAB 2F3VA 2BDOA 5C4XB 1N8RC 2XGTA 1WCMH 4IO9A 5BR8Q 2MUYA 2EYFA 2ZT9C 4BBRG 2XWJB 2YTVA 4DR2Q 2OWOA 2IWHA 1PFMA 1FJGQ 3F2UA 3KF8A 3Q0AA 2VQFQ 3U50C 4CKBA 4LF5Q 1IYVA 3TDQA 2B63G 1Q82C 5C0XH 1EWIA 4TKOB 1DOMA 1BCPC 1SFOB 4DAYB 4JVZA 4K0KL 3DMUA 1C0AA 4G7OC 3KLWA 4OWTB 3A0JA 3TP7A 3EJIA 3IL8A 2UUAL 2H5XA 1WTXA 2Y0SG 4LUZA 1GXDC 3G48A 3BJUA 1C8CA 3CAMA 5IP7G 2CKZB 2LKVA 4HMIA 1EEFD 3V05A 1I6HB 4DR3Q 2AWOA 1OTCA 3GTMH 4C1NK 4EQOA 2E2DC 3VR6A 1Y1WB 1BCPB 4I65A 2DJFC 2CW0C 5ELBA 3NSWA 2KVMA 3KLSX 1DOKA 1CQVA 3MXNB 2JA6B 4IFDJ 5M3MB 3S14B 1RJTA 1STHA 3PUZA 4DV7Q 2IT1A 4JG2A 4JI2Q 3OW2A 4YCUA 4QF4A 4CBVA 1D5MC 1YVCA 2KCCA 3CC7A 3T56B 2Z4IA 2I07B 4GOPB 4CKCA 2UXBQ 3HOXG 1PH1A 1CTMA 2YTYA 3RUZA 5FJ8H 1IL2A 3KFUA 1JB3A 1TQOA 2NVYH 3HOZB 2R6GA 1G8ZD 4C3IB 4RH6A 4APVA 3CC2A 3S1QB 4FVMA 4CJ1B 1PV4A 1HR0Q 1HZBA 1I5FA 1I50H 1SMYD 3K59A 5CYUA 1VQGA 4LF7L 3TMEA 4DKAC 3ULPA 1PH3A 1LT3D 3QWNA 4GKKL 3PV0A 4PMBA 2QKIC 3E6ZX 2FHTA 1S3OA 3Q22A 3MEFA 1PA6A 2R92G 2JA9A 5EPLA 2PMZE 3HOZG 1VMPA 1S5DD 3HOWG 4DNRB 2R93B 5HGQA 4NPSA 1IBLL 1Q7YC 4A76A 1RL2A 2VUMB 3RN2A 4YHHQ 3OW7A 3H0GH 2FINB 3S24A 2F0KA 2KENA 4OO1G 1UEBA 3EIVA 2D0PA 4DNTB 4A3LH 3BZCA 1WTPA 1I4HA 3QG1A 2F0NA 2GA4B 1PDQA 1NBWA 3C46A 5GAGC 1VQDA 3K5LA 4FF1A 3L9AX 2NBFA 1GD7A 1TS5A 1A15A 4LFBL 4UY8C 2UXCQ 1YNJC 3BVMA 4R8NA 5D3DA 5DEHA 1B53A 5KYIA 3L2PA 2HIVA 4A93H 3K58A 2SOBA 2JEAI 1EY5A 1NR2A 4A3JH 1B9MA 4XT3B 4HIMA 2XVSA 5E1FA 4WJ4A 3GV6A 4NXNL 1LTID 3OSOA 3HOZH 4L6TB 5HURA 1EZ8A 2K03A 4OXPA 5H1SE 1EY0A 4DR1L 3F1ZA 2WB1E 1QJOA 2VY3A 5C3EG 4JI3Q 1AZQA 2F0TA 1V9PA 3HS0C 3MXNA 2XIWA 4POGA 3K81C 5EKKA 3EN2A 2OF1A 1F2MA 2E2JH 5KNDA 4K5XA 4KHPQ 4XT1B 4P71A 2E76C 3HOVG 4Q0FA 3KLRA 2R7ZH 1VQFA 1O7IA 2IX0A 3KLSA 3HEJA 1TXYA 4OIJA 4A3FG 1I6HH 4JI7Q 5ELCA 3MVVA 3HZXA 5IWAQ 2BCOA 1VQMA 2D0OA 1S40A
chains in the Genus database with same CATH topology
2KCTA 4NXML 4Y7NH 2JA8H 3UE1A 1JJCB 4NXMQ 1ASZA 1PYBA 4IPGA 1KRTA 4JI1L 5C0XI 1HR0W 3H3VH 4QY7A 1YBYA 1X55A 3CPFA 4X62Q 5C0XG 1OXUA 2JA5G 3S1NH 3AEVA 4IFDI 1Z9FA 4UPAA 2UU9L 3EBEA 2JQOA 1WJJA 4BA1I 4L5RC 1VQNA 4B3ML 4DV3Q 1RIPA 2HHHL 5JEAJ 1W2BA 4KHZA 2UXBL 1VS0A 1L0WA 1N33Q 1NY4A 4JBWA 4BBSH 1E7ZA 1W3SA 4LF4Q 4A3DG 1VQKA 1UWVA 4LF4L 2N3SA 5C44H 1H95A 1PH2A 1E22A 1PHJA 2GVBA 5LMUL 4KLKA 3PIOA 4HJ9A 3AQQA 1AE2A 1G51A 3L0OA 4JI3L 3RNUA 3CCEA 5GADC 1V43A 1PYSB 2R7DA 3RR5A 4GOPA 1U5KA 4UP7A 4R4IA 3RLFA 4YY3L 1HNWL 4LF8Q 2YU9H 2OTJA 4LF8L 4YCVA 2L15A 2OQKA 2EIFA 4DV7L 1VQ4A 1XPRA 3KF8B 5M3MG 5FJ8G 4AQYL 4A93G 4A75A 1KD1C 2UUBQ 4GS3A 1XNRL 1VQCA 2K50A 4JYAL 1Q1EA 3DM3A 4JI0Q 3UDFA 3HOUG 5IYBH 2VS1A 3PCOB 3PO2G 4GKJQ 4J15A 3I7FA 1PH6A 4JI4L 2GN5A 1UE6A 2QA4A 1UE5A 1M1KC 5FLMH 2BH2A 4LFCL 1CSQA 3AFPA 2I5HA 3KOJA 4AIMA 3M85A 4K0KQ 1DGSA 5IYDH 3IRBA 3CCUA 2IHEA 5GROA 2KHJA 1ASYA 4GLVB 2UUCQ 4YCWA 4O0AA 1K9MC 1VQBA 1X65A 1YEZA 1YZ6A 1K0RA 5HY6A 3CCQA 4IPCA 4JCVE 4YHHL 2IX1A 4LF6Q 4JV5Q 2K75A 4DV5Q 4DR7Q 4A3FH 1KRSA 4X66Q 4L5SA 1K73C 4BY1H 3GTOH 4DV5L 2LSSA 1VQAA 2WP8J 2K4KA 4JI8L 1PH5A 2YTXA 1LYLA 4QGUA 4PZ7A 4BY7H 2R7ZG 4LF5L 1IYJB 5IWAL 3U4VA 4JI7L 4LNQA 3I4OA 3F2DA 3PGZA 4QIWE 4DR4L 3PSIA 5JJLA 1X6OA 2ES2A 4A3EG 2MO0A 2QGQA 4LFCQ 2D62A 2Q2TA 1BBUA 3RZOH 1NTGA 3KJPA 4DR5Q 2E5LQ 2K14A 2UU9Q 4P74A 3A74A 2NVXH 2JA6G 3U4ZA 4IJLA 2A19A 3UDIA 4LF7Q 2ZTEA 4DNIA 1XNRQ 4X6AH 2CQOA 2V1CC 1QZHA 3PIPA 1QVCA 4QQBX 1WYDA 4GKKQ 1Q12A 3OTOQ 4FDBA 2IY5B 1YJ9A 3L7ZC 2DUDA 4LFAL 5C4XG 1X56A 4R4CA 3SGIA 2Q2IA 2WAQG 4X65Q 3K7AH 1HNXL 2N78A 1KC8C 2Q2HA 2RHQB 3K0XA 3UE0A 1FGUA 4C3HH 3GTQH 2C35B 3BU2A 2BA1A 2DGYA 4BY7G 5IYCG 4LFBQ 2KHIA 3S2DH 2MO1A 1FJGL 1B7YB 1GO3E 4IJHA 4GOPC 2ZM6L 3M4PA 1K3RA 1A63A 1VQ5A 1TWCH 3E0EA 4XTCS 4TQUS 1NJIC 4DR6Q 1N36Q 2UUBL 1GVPA 4DV0L 2B29A 4JI5Q 3GO5A 4GKJL 1J5EQ 3E9IA 1YIJA 1XMQL 1KQSA 3TEHB 5GQOA 3PO3H 1E1TA 4DV4Q 1SMXA 4RG1A 4B3RL 1JT8A 2K52A 1XMQQ 1HZCA 4JI1Q 3W1BA 1M90C 2K5VA 1EUJA 4DR5L 3KDFB 3KF6B 3I2ZA 3KF6A 5C0XJ 5DLQE 5AJ3Q 1QVFA 3GD7A 3PF4A 2WFWA 1KAWA 1HZ9A 2PI2A 2RHSB 1IBLQ 1NMGA 1VQ6A 4X64Q 1K8GA 1HNZL 2KCMA 1VQHA 3FP9A 2AWNA 5M3MH 3S14H 4A3CG 5IY0A 4KHPL 4X64L 2A8VA 2B3GA 1CKNB 4HJ5A 1FL0A 4DR7L 1YHQA 4DV6Q 1Y1WH 3JAMc 3HOWH 3I4MG 2NVTH 4A3BG 2JJQA 4C3JH 4JI8Q 4A3MG 5LMUQ 4QJFA 1I94Q 4BY1G 4AH6A 3S1RH 1SR3A 3M3YH 4DUZL 1HNXQ 1IBMQ 2AHOB 1J5EL 5J3BA 4GN4B 3PUWA 1JMCA 4POFA 1QZGA 4NB3A 4A3MH 4IFDG 2PQAB 1HR0L 3K8AA 1UE7A 3NBHB 1VQJA 1IXRA 2FXQA 2HQLA 3U58A 4PMWA 1YJNA 4BXXG 4YY3Q 3TREA 4B3TQ 3M9BA 1MJCA 1EOVA 1HH2P 4GN5A 5JJKA 3LGJA 2E2IH 4OWWB 3PO3G 4DR6L 3RLOA 4AYBG 2AMCB 2F4VL 3OTOL 2VZAA 5C3EH 5IYCH 1MKHA 2RF4A 1VQEA 1V1QA 1X3FA 5IP7H 5FLMG 3J81c 3PUYA 2ATWA 1NE3A 4IOAA 1NMFA 1SLJA 1E1OA 3NENA 3CCVA 1QUQB 2IHFA 4QL5A 1A62A 4JI4Q 3PF5A 5IE8A 1LM0A 3AFQA 4YWKA 4LWCA 3RZDH 1WOCA 3HOUH 3HOYG 3ERSX 1WFQA 3KJOA 3T1HQ 4X62L 1C7YA 3CP0A 2ASBA 2NZHA 3A5ZB 4JBMA 1XNQL 1G6PA 1PH9A 1MJEA 1EIYB 1S72A 1KIXA 5BR8L 2JEBI 4DAMA 4AYBE 2YV5A 4EX5A 4KI0A 3FHWA 1HNZQ 2R92H 1C9OA 1TWHH 2I5MX 1Q86C 1HNWQ 4IOCA 3PO2H 3A5UA 3J80c 2ZM6Q 1N32L 1P8LA 1E24A 2R93G 3M7NA 2NN6I 2R7FA 2WAQE 3J80i 4DV2L 1YITA 3E9HA 4RMFA 3ULJA 5IYDG 1N36L 1IZ6A 5C4XH 2N49A 4OO1I 4JI6L 3OYYA 1EQQA 1P16A 1Q8KA 4DV1Q 1VQIA 1EQRA 1XPOA 2GVAA 2UXDL 3AYHB 4JI5L 3T1YL 1PH8A 4JOIA 3CD6A 4A3GH 3T1YQ 1IBKQ 4L5QA 4R4QA 1X3EA 3RLNA 5K36G 1LTLA 1SRUA 2Z6KA 3Q8DA 4JC0A 3TQYA 5IYBG 3JAMi 1B8AA 4DR2L 5FLXc 1FVIA 1L2FA 1B70B 1N34Q 4A3LG 4B3MQ 3DLLA 5AJ3L 1VCIA 3J81i 2VQEQ 4A3EH 2AKWB 1QUQA 4Y52H 5C4JH 3F2CA 3BZKA 2A1AA 4EQ5A 5IP9G 1X3GA 4DK6C 1PFSA 3S1MH 3KYHC 4P73A 1VQ8A 1VQLA 3CC4A 5IT9c 2CCZA 3CCMA 4IPDA 3S17H 2N8NA 1CKOA 1GKHA 3GTLH 1X9NA 4TVAB 3CPWA 1TWAH 5IP9H 4PZ8A 5EAYA 1Q1BA 1IBML 1Y14B 3GTKH 1OXSC 4DUZQ 1N8RC 3T1HL 1U0LA 1EIFA 2E2HH 4YWMA 1BBWA 2XGTA 1WCMH 3K80C 3NELA 2OCEA 4IO9A 5BR8Q 1G291 4L5TA 3RN5A 4ALPA 4XIGS 2CWPA 3HFZB 4IPHA 4BBRG 4A3JG 4A3KH 1WI5A 2YTVA 4DR2Q 2OWOA 3STBD 2JA6H 5LMNW 2F3IA 4X66L 1KL9A 2JK8A 1FJGQ 2YYZA 4JYAQ 4DV2Q 5GAHC 3H0GG 1K83H 2VQFQ 1MIUA 3U50C 2Z6KC 1EYGA 2LXJA 3CCLA 4LF5Q 4B3SL 1SROA 3G71A 2B63G 4JI6Q 1Q82C 3S2HH 2ID0A 2JA5H 3H3VI 4GLAC 2MQHA 3PUVA 1EWIA 3J81j 2JA7G 4B3RQ 2ZTDA 4ME3A 3WWVA 4DV4L 3UDXA 4DAYB 3JC66 5GAEC 3CMAA 3FKIG 1JB7A 3CCSA 3M4QA 3TRZA 1JE5A 4K0KL 1C0AA 3KLWA 5M5XH 4HIOA 3HKZG 4OWTB 1YI2A 3A0JA 2PQAA 2MFIA 4HJ7A 3PUXA 3HOVH 2UUAL 2VQEL 2H5XA 2Y0SG 4LUZA 5ELNA 5C44G 3G48A 3TS0A 1Q46A 1Y1VH 5LMNQ 1Q81C 5M3FH 3BJUA 1UE1A 1E3PA 3B6YA 4GN3B 1SFOH 4P75A 3CAMA 3CMEA 5IP7G 4OX9L 2CKZB 2HT1A 1L1OC 3D0FA 4GNXC 4PZ6A 2OTLA 4DR3Q 2PI2E 1SE8A 2AWOA 1OTCA 1A0IA 4DR4Q 4A4IA 4LW1A 1VQ9A 2PNHA 3GTMH 4DUYQ 2JA8G 3CCJA 4R4TA 3CF5A 4IFDJ 3MXNB 4H02A 2E5LL 3PUZA 2RCNA 4DV7Q 2IT1A 4GLXA 2UUCL 4JG2A 4JI2Q 3OW2A 4YCUA 1PH4A 1GM5A 3GDEA 1YJWA 4HJAA 1YVCA 2VQFL 5JEAG 3CC7A 1QVGA 4NXNQ 3G6EA 1YNXA 1N33L 2Z0SA 1D8LA 4P72A 4UP8A 4GOPB 2NVQH 3GTPH 2UXBQ 3HOXG 1PH1A 1TWGH 2YTYA 1IL2A 5FJ8H 4DR1Q 3J7A5 3KFUA 4A3CH 3CW2C 2EXDA 2NVYH 2R6GA 4BXXH 2K5NA 4X65L 4APVA 3CC2A 1A8VA 2I5LX 5JJIA 1BKBA 4JBKA 1PH7A 3F8TA 1PV4A 1HR0Q 2EQSA 1HZBA 1I5FA 2ZTCA 1HZAA 5M5YH 1I50H 3J7ZC 4DPGA 3CQZH 5M3FG 2Q2UA 1VQGA 5M5WH 5ELOA 1JJ2A 4LF7L 3ULPA 4DKAC 2F52A 1PH3A 4B3SQ 4JBJA 2VUMG 3CXCA 3ICEA 1OXTA 4DV0Q 4GKKL 1AE3A 1Y1VG 1Z47A 3PV0A 3UDGA 4R4OA 2UXDQ 1CKMA 1OXVA 2KBNA 2CFMA 4DV1L 1S3OA 2VUMH 3MEFA 1PA6A 2R92G 1XMOQ 2JA9A 3K7UC 3I4NG 1AH9A 1IBKL 1KHIA 2PMZE 3KDFA 4JOIC 3HOZG 2LXKA 3W1GA 2R93H 4A3BH 4B3TL 4A3GG 1JJGA 1Y1WG 5E7NA 4A3IH 3HOWG 3W5OA 3I4MH 5HGQA 2UUAQ 4NPSA 1XPUA 4PG3A 1IBLL 4JI2L 1L1OB 4GNXB 1X54A 1L1OA 4GNXA 4DV3L 1EFWA 1VQOA 4A76A 1Q7YC 1RL2A 3H15A 3M4OH 2NN6G 3RN2A 1OXXK 1KXLA 2QEXA 4LF6L 4JV5L 4YHHQ 2VL6A 3H0GH 1TWFH 3S24A 4LF9Q 1N32Q 2KENA 4OO1G 4A3IG 1YHBA 3D31A 3CCRA 1UEBA 3HKSA 3EIVA 3TS2A 2D0PA 4A3LH 2VNUD 3BZCA 3GTJH 3GTGH 1D7QA 4LUVA 3HKZE 1HJPA 1WCMG 2JE6I 1PVOA 4MTNA 4DR3L 1NBWA 1SN8A 2OQ0A 5GAGC 1VQDA 1VQPA 2VW9A 1CSPA 4DUYL 1GD7A 4O2DA 3G4SA 1K8AC 4LFBL 3I55A 2MNAA 4UY8C 3ULLA 2UXCL 2UXCQ 3VDYA 4WJ3M 3ZJYC 2WB1G 3L2PA 4A93H 2HIVA 2BA0A 1YHAA 4C3IH 1N34L 2JEAI 3F2BA 4AQYQ 3S1QH 4BBRH 4A3JH 4R1JA 4HJ8A 2F4VQ 4HIMA 2JA7H 4WJ4A 4JI0L 4NXNL 2Y0SE 3HOZH 4LF9L 2CWAA 4UP9A 2ZJQA 1XTDA 2NZOA 3ER0A 4C2MH 4LFAQ 2E8GA 2B63H 4OXPA 5H1SE 1I94L 4MNOA 4LUOA 1XMOL 4DR1L 3I56A 3F1ZA 1I3QH 2WB1E 2VY3A 5C3EG 4HIDA 1LUZA 1CKNA 4JI3Q 3S16H 2ZJRA 1R9TH 1V9PA 4BBSG 4A3DH 1XNQQ 1CUKA 4OONA 4A3KG 4POGA 3K81C 3S15H 1XJVA 3EN2A 1N9WA 2ALYB 1BVSA 2I0QA 2E2JH 1J6QA 2ZJPA 2HIXA 4KHPQ 3HOYH 4P71A 2BH8A 3I4NH 2HHHQ 4BA2I 3HOVG 4YWLA 5LMNL 4MZ9A 2R7ZH 1T9HA 1VQFA 4DV6L 1O7IA 2IX0A 4OWXB 4DK3C 1VQ7A 4OX9Q 1TXYA 2XTIA 2K5HA 3FKIH 3NEMA 3HOXH 1I6HH 4A3FG 3STBC 4JI7Q 5IWAQ 1VQMA 2D0OA 1S40A 4HIKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KCT A;  4NXM L;  4Y7N H;  2JA8 H;  3UE1 A;  1JJC B;  4NXM Q;  1ASZ A;  1PYB A;  4IPG A;  1KRT A;  4JI1 L;  5C0X I;  1HR0 W;  3H3V H;  4QY7 A;  1YBY A;  1X55 A;  3CPF A;  4X62 Q;  5C0X G;  1OXU A;  2JA5 G;  3S1N H;  3AEV A;  4IFD I;  1Z9F A;  4UPA A;  2UU9 L;  3EBE A;  2JQO A;  1WJJ A;  4BA1 I;  4L5R C;  1VQN A;  4B3M L;  4DV3 Q;  1RIP A;  2HHH L;  5JEA J;  1W2B A;  4KHZ A;  2UXB L;  1VS0 A;  1L0W A;  1N33 Q;  1NY4 A;  4JBW A;  4BBS H;  1E7Z A;  1W3S A;  4LF4 Q;  4A3D G;  1VQK A;  1UWV A;  4LF4 L;  2N3S A;  5C44 H;  1H95 A;  1PH2 A;  1E22 A;  1PHJ A;  2GVB A;  5LMU L;  4KLK A;  3PIO A;  4HJ9 A;  3AQQ A;  1AE2 A;  1G51 A;  3L0O A;  4JI3 L;  3RNU A;  3CCE A;  5GAD C;  1V43 A;  1PYS B;  2R7D A;  3RR5 A;  4GOP A;  1U5K A;  4UP7 A;  4R4I A;  3RLF A;  4YY3 L;  1HNW L;  4LF8 Q;  2YU9 H;  2OTJ A;  4LF8 L;  4YCV A;  2L15 A;  2OQK A;  2EIF A;  4DV7 L;  1VQ4 A;  1XPR A;  3KF8 B;  5M3M G;  5FJ8 G;  4AQY L;  4A93 G;  4A75 A;  1KD1 C;  2UUB Q;  4GS3 A;  1XNR L;  1VQC A;  2K50 A;  4JYA L;  1Q1E A;  3DM3 A;  4JI0 Q;  3UDF A;  3HOU G;  5IYB H;  2VS1 A;  3PCO B;  3PO2 G;  4GKJ Q;  4J15 A;  3I7F A;  1PH6 A;  4JI4 L;  2GN5 A;  1UE6 A;  2QA4 A;  1UE5 A;  1M1K C;  5FLM H;  2BH2 A;  4LFC L;  1CSQ A;  3AFP A;  2I5H A;  3KOJ A;  4AIM A;  3M85 A;  4K0K Q;  1DGS A;  5IYD H;  3IRB A;  3CCU A;  2IHE A;  5GRO A;  2KHJ A;  1ASY A;  4GLV B;  2UUC Q;  4YCW A;  4O0A A;  1K9M C;  1VQB A;  1X65 A;  1YEZ A;  1YZ6 A;  1K0R A;  5HY6 A;  3CCQ A;  4IPC A;  4JCV E;  4YHH L;  2IX1 A;  4LF6 Q;  4JV5 Q;  2K75 A;  4DV5 Q;  4DR7 Q;  4A3F H;  1KRS A;  4X66 Q;  4L5S A;  1K73 C;  4BY1 H;  3GTO H;  4DV5 L;  2LSS A;  1VQA A;  2WP8 J;  2K4K A;  4JI8 L;  1PH5 A;  2YTX A;  1LYL A;  4QGU A;  4PZ7 A;  4BY7 H;  2R7Z G;  4LF5 L;  1IYJ B;  5IWA L;  3U4V A;  4JI7 L;  4LNQ A;  3I4O A;  3F2D A;  3PGZ A;  4QIW E;  4DR4 L;  3PSI A;  5JJL A;  1X6O A;  2ES2 A;  4A3E G;  2MO0 A;  2QGQ A;  4LFC Q;  2D62 A;  2Q2T A;  1BBU A;  3RZO H;  1NTG A;  3KJP A;  4DR5 Q;  2E5L Q;  2K14 A;  2UU9 Q;  4P74 A;  3A74 A;  2NVX H;  2JA6 G;  3U4Z A;  4IJL A;  2A19 A;  3UDI A;  4LF7 Q;  2ZTE A;  4DNI A;  1XNR Q;  4X6A H;  2CQO A;  2V1C C;  1QZH A;  3PIP A;  1QVC A;  4QQB X;  1WYD A;  4GKK Q;  1Q12 A;  3OTO Q;  4FDB A;  2IY5 B;  1YJ9 A;  3L7Z C;  2DUD A;  4LFA L;  5C4X G;  1X56 A;  4R4C A;  3SGI A;  2Q2I A;  2WAQ G;  4X65 Q;  3K7A H;  1HNX L;  2N78 A;  1KC8 C;  2Q2H A;  2RHQ B;  3K0X A;  3UE0 A;  1FGU A;  4C3H H;  3GTQ H;  2C35 B;  3BU2 A;  2BA1 A;  2DGY A;  4BY7 G;  5IYC G;  4LFB Q;  2KHI A;  3S2D H;  2MO1 A;  1FJG L;  1B7Y B;  1GO3 E;  4IJH A;  4GOP C;  2ZM6 L;  3M4P A;  1K3R A;  1A63 A;  1VQ5 A;  1TWC H;  3E0E A;  4XTC S;  4TQU S;  1NJI C;  4DR6 Q;  1N36 Q;  2UUB L;  1GVP A;  4DV0 L;  2B29 A;  4JI5 Q;  3GO5 A;  4GKJ L;  1J5E Q;  3E9I A;  1YIJ A;  1XMQ L;  1KQS A;  3TEH B;  5GQO A;  3PO3 H;  1E1T A;  4DV4 Q;  1SMX A;  4RG1 A;  4B3R L;  1JT8 A;  2K52 A;  1XMQ Q;  1HZC A;  4JI1 Q;  3W1B A;  1M90 C;  2K5V A;  1EUJ A;  4DR5 L;  3KDF B;  3KF6 B;  3I2Z A;  3KF6 A;  5C0X J;  5DLQ E;  5AJ3 Q;  1QVF A;  3GD7 A;  3PF4 A;  2WFW A;  1KAW A;  1HZ9 A;  2PI2 A;  2RHS B;  1IBL Q;  1NMG A;  1VQ6 A;  4X64 Q;  1K8G A;  1HNZ L;  2KCM A;  1VQH A;  3FP9 A;  2AWN A;  5M3M H;  3S14 H;  4A3C G;  5IY0 A;  4KHP L;  4X64 L;  2A8V A;  2B3G A;  1CKN B;  4HJ5 A;  1FL0 A;  4DR7 L;  1YHQ A;  4DV6 Q;  1Y1W H;  3JAM c;  3HOW H;  3I4M G;  2NVT H;  4A3B G;  2JJQ A;  4C3J H;  4JI8 Q;  4A3M G;  5LMU Q;  4QJF A;  1I94 Q;  4BY1 G;  4AH6 A;  3S1R H;  1SR3 A;  3M3Y H;  4DUZ L;  1HNX Q;  1IBM Q;  2AHO B;  1J5E L;  5J3B A;  4GN4 B;  3PUW A;  1JMC A;  4POF A;  1QZG A;  4NB3 A;  4A3M H;  4IFD G;  2PQA B;  1HR0 L;  3K8A A;  1UE7 A;  3NBH B;  1VQJ A;  1IXR A;  2FXQ A;  2HQL A;  3U58 A;  4PMW A;  1YJN A;  4BXX G;  4YY3 Q;  3TRE A;  4B3T Q;  3M9B A;  1MJC A;  1EOV A;  1HH2 P;  4GN5 A;  5JJK A;  3LGJ A;  2E2I H;  4OWW B;  3PO3 G;  4DR6 L;  3RLO A;  4AYB G;  2AMC B;  2F4V L;  3OTO L;  2VZA A;  5C3E H;  5IYC H;  1MKH A;  2RF4 A;  1VQE A;  1V1Q A;  1X3F A;  5IP7 H;  5FLM G;  3J81 c;  3PUY A;  2ATW A;  1NE3 A;  4IOA A;  1NMF A;  1SLJ A;  1E1O A;  3NEN A;  3CCV A;  1QUQ B;  2IHF A;  4QL5 A;  1A62 A;  4JI4 Q;  3PF5 A;  5IE8 A;  1LM0 A;  3AFQ A;  4YWK A;  4LWC A;  3RZD H;  1WOC A;  3HOU H;  3HOY G;  3ERS X;  1WFQ A;  3KJO A;  3T1H Q;  4X62 L;  1C7Y A;  3CP0 A;  2ASB A;  2NZH A;  3A5Z B;  4JBM A;  1XNQ L;  1G6P A;  1PH9 A;  1MJE A;  1EIY B;  1S72 A;  1KIX A;  5BR8 L;  2JEB I;  4DAM A;  4AYB E;  2YV5 A;  4EX5 A;  4KI0 A;  3FHW A;  1HNZ Q;  2R92 H;  1C9O A;  1TWH H;  2I5M X;  1Q86 C;  1HNW Q;  4IOC A;  3PO2 H;  3A5U A;  3J80 c;  2ZM6 Q;  1N32 L;  1P8L A;  1E24 A;  2R93 G;  3M7N A;  2NN6 I;  2R7F A;  2WAQ E;  3J80 i;  4DV2 L;  1YIT A;  3E9H A;  4RMF A;  3ULJ A;  5IYD G;  1N36 L;  1IZ6 A;  5C4X H;  2N49 A;  4OO1 I;  4JI6 L;  3OYY A;  1EQQ A;  1P16 A;  1Q8K A;  4DV1 Q;  1VQI A;  1EQR A;  1XPO A;  2GVA A;  2UXD L;  3AYH B;  4JI5 L;  3T1Y L;  1PH8 A;  4JOI A;  3CD6 A;  4A3G H;  3T1Y Q;  1IBK Q;  4L5Q A;  4R4Q A;  1X3E A;  3RLN A;  5K36 G;  1LTL A;  1SRU A;  2Z6K A;  3Q8D A;  4JC0 A;  3TQY A;  5IYB G;  3JAM i;  1B8A A;  4DR2 L;  5FLX c;  1FVI A;  1L2F A;  1B70 B;  1N34 Q;  4A3L G;  4B3M Q;  3DLL A;  5AJ3 L;  1VCI A;  3J81 i;  2VQE Q;  4A3E H;  2AKW B;  1QUQ A;  4Y52 H;  5C4J H;  3F2C A;  3BZK A;  2A1A A;  4EQ5 A;  5IP9 G;  1X3G A;  4DK6 C;  1PFS A;  3S1M H;  3KYH C;  4P73 A;  1VQ8 A;  1VQL A;  3CC4 A;  5IT9 c;  2CCZ A;  3CCM A;  4IPD A;  3S17 H;  2N8N A;  1CKO A;  1GKH A;  3GTL H;  1X9N A;  4TVA B;  3CPW A;  1TWA H;  5IP9 H;  4PZ8 A;  5EAY A;  1Q1B A;  1IBM L;  1Y14 B;  3GTK H;  1OXS C;  4DUZ Q;  1N8R C;  3T1H L;  1U0L A;  1EIF A;  2E2H H;  4YWM A;  1BBW A;  2XGT A;  1WCM H;  3K80 C;  3NEL A;  2OCE A;  4IO9 A;  5BR8 Q;  1G29 1;  4L5T A;  3RN5 A;  4ALP A;  4XIG S;  2CWP A;  3HFZ B;  4IPH A;  4BBR G;  4A3J G;  4A3K H;  1WI5 A;  2YTV A;  4DR2 Q;  2OWO A;  3STB D;  2JA6 H;  5LMN W;  2F3I A;  4X66 L;  1KL9 A;  2JK8 A;  1FJG Q;  2YYZ A;  4JYA Q;  4DV2 Q;  5GAH C;  3H0G G;  1K83 H;  2VQF Q;  1MIU A;  3U50 C;  2Z6K C;  1EYG A;  2LXJ A;  3CCL A;  4LF5 Q;  4B3S L;  1SRO A;  3G71 A;  2B63 G;  4JI6 Q;  1Q82 C;  3S2H H;  2ID0 A;  2JA5 H;  3H3V I;  4GLA C;  2MQH A;  3PUV A;  1EWI A;  3J81 j;  2JA7 G;  4B3R Q;  2ZTD A;  4ME3 A;  3WWV A;  4DV4 L;  3UDX A;  4DAY B;  3JC6 6;  5GAE C;  3CMA A;  3FKI G;  1JB7 A;  3CCS A;  3M4Q A;  3TRZ A;  1JE5 A;  4K0K L;  1C0A A;  3KLW A;  5M5X H;  4HIO A;  3HKZ G;  4OWT B;  1YI2 A;  3A0J A;  2PQA A;  2MFI A;  4HJ7 A;  3PUX A;  3HOV H;  2UUA L;  2VQE L;  2H5X A;  2Y0S G;  4LUZ A;  5ELN A;  5C44 G;  3G48 A;  3TS0 A;  1Q46 A;  1Y1V H;  5LMN Q;  1Q81 C;  5M3F H;  3BJU A;  1UE1 A;  1E3P A;  3B6Y A;  4GN3 B;  1SFO H;  4P75 A;  3CAM A;  3CME A;  5IP7 G;  4OX9 L;  2CKZ B;  2HT1 A;  1L1O C;  3D0F A;  4GNX C;  4PZ6 A;  2OTL A;  4DR3 Q;  2PI2 E;  1SE8 A;  2AWO A;  1OTC A;  1A0I A;  4DR4 Q;  4A4I A;  4LW1 A;  1VQ9 A;  2PNH A;  3GTM H;  4DUY Q;  2JA8 G;  3CCJ A;  4R4T A;  3CF5 A;  4IFD J;  3MXN B;  4H02 A;  2E5L L;  3PUZ A;  2RCN A;  4DV7 Q;  2IT1 A;  4GLX A;  2UUC L;  4JG2 A;  4JI2 Q;  3OW2 A;  4YCU A;  1PH4 A;  1GM5 A;  3GDE A;  1YJW A;  4HJA A;  1YVC A;  2VQF L;  5JEA G;  3CC7 A;  1QVG A;  4NXN Q;  3G6E A;  1YNX A;  1N33 L;  2Z0S A;  1D8L A;  4P72 A;  4UP8 A;  4GOP B;  2NVQ H;  3GTP H;  2UXB Q;  3HOX G;  1PH1 A;  1TWG H;  2YTY A;  1IL2 A;  5FJ8 H;  4DR1 Q;  3J7A 5;  3KFU A;  4A3C H;  3CW2 C;  2EXD A;  2NVY H;  2R6G A;  4BXX H;  2K5N A;  4X65 L;  4APV A;  3CC2 A;  1A8V A;  2I5L X;  5JJI A;  1BKB A;  4JBK A;  1PH7 A;  3F8T A;  1PV4 A;  1HR0 Q;  2EQS A;  1HZB A;  1I5F A;  2ZTC A;  1HZA A;  5M5Y H;  1I50 H;  3J7Z C;  4DPG A;  3CQZ H;  5M3F G;  2Q2U A;  1VQG A;  5M5W H;  5ELO A;  1JJ2 A;  4LF7 L;  3ULP A;  4DKA C;  2F52 A;  1PH3 A;  4B3S Q;  4JBJ A;  2VUM G;  3CXC A;  3ICE A;  1OXT A;  4DV0 Q;  4GKK L;  1AE3 A;  1Y1V G;  1Z47 A;  3PV0 A;  3UDG A;  4R4O A;  2UXD Q;  1CKM A;  1OXV A;  2KBN A;  2CFM A;  4DV1 L;  1S3O A;  2VUM H;  3MEF A;  1PA6 A;  2R92 G;  1XMO Q;  2JA9 A;  3K7U C;  3I4N G;  1AH9 A;  1IBK L;  1KHI A;  2PMZ E;  3KDF A;  4JOI C;  3HOZ G;  2LXK A;  3W1G A;  2R93 H;  4A3B H;  4B3T L;  4A3G G;  1JJG A;  1Y1W G;  5E7N A;  4A3I H;  3HOW G;  3W5O A;  3I4M H;  5HGQ A;  2UUA Q;  4NPS A;  1XPU A;  4PG3 A;  1IBL L;  4JI2 L;  1L1O B;  4GNX B;  1X54 A;  1L1O A;  4GNX A;  4DV3 L;  1EFW A;  1VQO A;  4A76 A;  1Q7Y C;  1RL2 A;  3H15 A;  3M4O H;  2NN6 G;  3RN2 A;  1OXX K;  1KXL A;  2QEX A;  4LF6 L;  4JV5 L;  4YHH Q;  2VL6 A;  3H0G H;  1TWF H;  3S24 A;  4LF9 Q;  1N32 Q;  2KEN A;  4OO1 G;  4A3I G;  1YHB A;  3D31 A;  3CCR A;  1UEB A;  3HKS A;  3EIV A;  3TS2 A;  2D0P A;  4A3L H;  2VNU D;  3BZC A;  3GTJ H;  3GTG H;  1D7Q A;  4LUV A;  3HKZ E;  1HJP A;  1WCM G;  2JE6 I;  1PVO A;  4MTN A;  4DR3 L;  1NBW A;  1SN8 A;  2OQ0 A;  5GAG C;  1VQD A;  1VQP A;  2VW9 A;  1CSP A;  4DUY L;  1GD7 A;  4O2D A;  3G4S A;  1K8A C;  4LFB L;  3I55 A;  2MNA A;  4UY8 C;  3ULL A;  2UXC L;  2UXC Q;  3VDY A;  4WJ3 M;  3ZJY C;  2WB1 G;  3L2P A;  4A93 H;  2HIV A;  2BA0 A;  1YHA A;  4C3I H;  1N34 L;  2JEA I;  3F2B A;  4AQY Q;  3S1Q H;  4BBR H;  4A3J H;  4R1J A;  4HJ8 A;  2F4V Q;  4HIM A;  2JA7 H;  4WJ4 A;  4JI0 L;  4NXN L;  2Y0S E;  3HOZ H;  4LF9 L;  2CWA A;  4UP9 A;  2ZJQ A;  1XTD A;  2NZO A;  3ER0 A;  4C2M H;  4LFA Q;  2E8G A;  2B63 H;  4OXP A;  5H1S E;  1I94 L;  4MNO A;  4LUO A;  1XMO L;  4DR1 L;  3I56 A;  3F1Z A;  1I3Q H;  2WB1 E;  2VY3 A;  5C3E G;  4HID A;  1LUZ A;  1CKN A;  4JI3 Q;  3S16 H;  2ZJR A;  1R9T H;  1V9P A;  4BBS G;  4A3D H;  1XNQ Q;  1CUK A;  4OON A;  4A3K G;  4POG A;  3K81 C;  3S15 H;  1XJV A;  3EN2 A;  1N9W A;  2ALY B;  1BVS A;  2I0Q A;  2E2J H;  1J6Q A;  2ZJP A;  2HIX A;  4KHP Q;  3HOY H;  4P71 A;  2BH8 A;  3I4N H;  2HHH Q;  4BA2 I;  3HOV G;  4YWL A;  5LMN L;  4MZ9 A;  2R7Z H;  1T9H A;  1VQF A;  4DV6 L;  1O7I A;  2IX0 A;  4OWX B;  4DK3 C;  1VQ7 A;  4OX9 Q;  1TXY A;  2XTI A;  2K5H A;  3FKI H;  3NEM A;  3HOX H;  1I6H H;  4A3F G;  3STB C;  4JI7 Q;  5IWA Q;  1VQM A;  2D0O A;  1S40 A;  4HIK A; 
#chains in the Genus database with same CATH topology
 2BE5 C;  1I4G A;  1Y1V B;  2K04 A;  1HR0 W;  5IOC A;  5C0X G;  1X55 A;  4IFD I;  3AEV A;  4IN3 A;  2UU9 L;  2L12 A;  2JQO A;  1SE4 A;  1F9S A;  3CHB D;  1I4X A;  3R2I A;  3HRZ C;  3J7A V;  1FGB D;  5M5X B;  1PTO C;  2B39 A;  1B1Z A;  5JEA J;  1W2B A;  2UXB L;  1L0W A;  3RD4 A;  4BBS H;  4CJ0 B;  1W3S A;  3LWU A;  2N3S A;  1H95 A;  1E22 A;  1K83 B;  3VR3 A;  3AQQ A;  1BR9 A;  4JI3 L;  3RNU A;  5CBA E;  2EYJ A;  3PQI A;  5JVG 3;  5IGD A;  5KIX A;  3RR5 A;  1U5K A;  1PRT C;  2N88 A;  4UP7 A;  3RLF A;  4YY3 L;  1EQV A;  1MI2 A;  2YU9 H;  2K5Q A;  3PIO 3;  2L15 A;  2OQK A;  2EIF A;  2B2U A;  3KF8 B;  1A2T A;  4A3D B;  3S16 B;  1GHJ A;  3NP8 A;  3UDF A;  2VS1 A;  3S17 B;  3PO2 G;  4GKJ Q;  3I7F A;  1GJX A;  1UE6 A;  1UE5 A;  4MN3 A;  2BH2 A;  1W6J A;  5IYD H;  3M85 A;  4AIM A;  2KHS A;  1F9Q A;  2L9H A;  1RD9 D;  2ZXO A;  4IUR A;  1ASY A;  4KD3 A;  4YCW A;  4O0A A;  3PIP 3;  4RCO A;  3CCQ A;  2IW3 A;  5IGC A;  4O42 A;  4DR7 Q;  1ET6 A;  4L5S A;  1SXT A;  3GTO H;  2CH4 A;  2RDG A;  1MHW C;  1Q3L A;  1VQA A;  2K4K A;  1LLR D;  4DR7 L;  1IKM A;  2WAQ B;  3TSS A;  4ZYS A;  5IWA L;  5JPN C;  4F87 A;  4JI7 L;  1S5B D;  1PTO H;  4OEL B;  3PSI A;  3PO2 B;  5C4H A;  1TWH B;  1A6X A;  4A3E G;  4KN4 C;  4LFC Q;  3URY A;  1NTG A;  2SNS A;  2DY8 A;  3N52 A;  4P74 A;  4IJL A;  2F0M A;  4LF7 Q;  4A3B B;  1XNR Q;  4RHS A;  4X6A H;  5A2Q L;  3PIP A;  4QQB X;  1HQM C;  3DEO A;  2Z9H A;  5BN5 A;  3D4W A;  1H9K A;  5C4X G;  3N6R A;  5C3E B;  4V19 0;  2PZW A;  2DNC A;  4X65 Q;  3K7A H;  2CW0 D;  2N78 A;  2RHQ B;  1JOO A;  1KLG D;  3K0X A;  3UE0 A;  2O2L D;  4M8A A;  3MEH A;  2Q8R E;  4C3H H;  5T1G A;  5E3F A;  5NUC A;  5KYL A;  4IJH A;  1C48 A;  1JC7 A;  1VQ5 A;  3E0E A;  3SHL A;  1TII D;  4TQU S;  5JAV A;  3QB3 A;  1N36 Q;  3MXG A;  1K0S A;  1ROD A;  3E9I A;  1JE4 A;  4G7H C;  2R7Z B;  4PMC A;  2K52 A;  1SYE A;  1TS2 A;  3FPP A;  1M90 C;  1IYU A;  4ZQ3 A;  2SNM A;  1QVF A;  5C6A A;  1HFG A;  1ZEQ X;  2PI2 A;  3VYU A;  1IBL Q;  2EJM A;  1VQ6 A;  4CGY B;  4WJW A;  5M3M H;  3W2D A;  3S14 H;  1B44 D;  1D1I A;  1FL0 A;  1PRT F;  3CU7 A;  1YHQ A;  1Y1W H;  3I4M G;  5F2D A;  2NVT H;  3EFX D;  2A73 B;  3NTK A;  1I94 Q;  4HMJ A;  4BY1 G;  1SR3 A;  2XNA C;  1HNX Q;  2M00 A;  1STY A;  1BCP D;  3I90 A;  3D4R A;  4L8J A;  1K8O A;  1XYI A;  3K8A A;  3NBH B;  3R3O A;  1ENA A;  3TRE A;  3BVG A;  4F8M A;  1KDB A;  4GN5 A;  5L37 A;  1EU3 A;  1XTC D;  1A3U A;  4DR6 L;  3QO2 A;  5C3E H;  5IYC H;  2RKS A;  1V1Q A;  4IOA A;  3K7A B;  5I6Y A;  5FLM G;  3PUY A;  1IHZ A;  1TT2 A;  1NMF A;  1SLJ A;  3PMF A;  4QL5 A;  3AFQ A;  5EPK A;  3HOU H;  2MHV A;  4IQZ A;  3SK6 A;  5CV5 A;  3OMG A;  1IL8 A;  3K5N A;  3CP0 A;  3A5Z B;  2K05 A;  1JWU D;  4JBM A;  1LO5 D;  1PH9 A;  1S72 A;  2JEB I;  1E2V A;  4AYB E;  2YV5 A;  4EX5 A;  5FO7 B;  4DK1 A;  4LMQ D;  4A3K B;  1HXY D;  1Q86 C;  1G2T A;  4RGT A;  2R93 G;  3U9O A;  1WCM B;  2WAQ E;  3E9H A;  3Q24 A;  3ULJ A;  1F9R A;  2N49 A;  3NBH A;  1B3A A;  3OYY A;  1EQQ A;  1Q8K A;  2AQ3 B;  2K5W A;  1XPO A;  1V1P B;  4JOI A;  3CD6 A;  5I9P A;  2Z6K A;  5AFW A;  3Q8D A;  4R8I A;  5KNB A;  5FLX c;  3VA7 A;  5C4Z A;  1L2F A;  2LMC B;  4CKE A;  1U4M A;  1EU4 A;  3D4D A;  3DLL A;  4B3M Q;  2QDB A;  5C4J H;  2A1A A;  3NHH A;  1X3G A;  4DK6 C;  1TS4 A;  1CI3 M;  1WTQ A;  1X9N A;  1BOS A;  1B3Q A;  2KUM A;  3NTI A;  5EAY A;  1Q1B A;  2N55 A;  3GTK H;  1OXS C;  2X6L A;  3CRL C;  1LTR D;  2F0U A;  5CGK A;  3NEL A;  2OCE A;  5EQ0 A;  4L5T A;  4QB4 A;  2DJG C;  1AZP A;  3STB D;  3I91 A;  1KL9 A;  2YYZ A;  4JYA Q;  5GAH C;  3CCL A;  1HA5 A;  4ZAI A;  5FKA C;  5IGE A;  3ND9 A;  3S2H H;  1EY7 A;  1HRJ A;  4GLA C;  1KNA A;  3JAM L;  1WTV A;  3PUV A;  3J81 j;  4B3R Q;  3EA6 A;  4ME3 A;  3WWV A;  4BBS B;  4DAY A;  3CMA A;  2RQX A;  3CCS A;  3M4Q A;  3DEP A;  1JE5 A;  3TRZ A;  4ZUI A;  1CT1 D;  3K6O A;  2CQA A;  2VQE L;  2G9D A;  5C44 G;  3TS0 A;  5LMN Q;  1BO0 A;  5A35 A;  1J8I A;  4GN3 B;  3GV3 A;  1E3P A;  1EL0 A;  3K0Y A;  2HT1 A;  2OTL A;  1SE8 A;  1V1O A;  1A0I A;  4DR4 Q;  2PNH A;  2JA8 G;  3CCJ A;  1DD2 A;  3HOW B;  4HED A;  4JW0 A;  4H02 A;  1GUO A;  4CDF C;  2RCN A;  2L1B A;  1WD1 A;  4X3S A;  1CFM A;  1AP0 A;  1PH4 A;  1GM5 A;  3GDE A;  4HJA A;  1B2T A;  2VQF L;  3GTK B;  2WKC A;  1ML0 D;  1QVG A;  4NXN Q;  3G6E A;  1YNX A;  5KEE A;  3PO3 B;  3DWA A;  1SYB A;  3MXP A;  3J7A 5;  4DR1 Q;  1NNX A;  3DXJ C;  4FXG C;  1GUW A;  2JA7 B;  4X65 L;  5G3L D;  1A8V A;  1BKB A;  3SEB A;  1HQR D;  1PYW D;  1O7Y A;  2EQS A;  1NAP A;  2ZTC A;  1HZA A;  3BZD B;  5EKL A;  2Q8I B;  1PTO D;  2Q2U A;  5M5W H;  1EY6 A;  4JBJ A;  1UAP A;  1JQY D;  1AE3 A;  1Y1V G;  1Z47 A;  1ZYR D;  2FMC A;  2Z1C A;  3UDG A;  2Q8T A;  1FNW A;  2UXD Q;  3GTJ B;  2CFM A;  1FR3 A;  4I7A A;  2OXP A;  4K2K A;  2VUM H;  3K7U C;  2IX3 A;  3VR5 A;  1KHI A;  3W1G A;  2R93 H;  4A3G G;  1Y1W G;  3I4M H;  1XPU A;  3MAQ A;  4PG3 A;  3I4M B;  1TS3 A;  4IUT A;  2HD3 A;  1NR4 A;  2NN6 G;  4UAI A;  1OXX K;  3HOU B;  2K5D A;  4MIU A;  1TWF H;  2F3W A;  4LF9 Q;  3D31 A;  4PV1 C;  4DAP A;  3GTJ H;  3GTG H;  4LUV A;  3HKZ E;  1QIL A;  1SN8 A;  4PQX A;  5IT9 E;  2OQ0 A;  5FK9 C;  2VW9 A;  3A54 A;  5DM6 3;  4O2D A;  3I55 A;  2MNA A;  3FRP B;  3ULL A;  2TMP A;  4CDE C;  2WB1 G;  2BA0 A;  2PZT A;  3I72 A;  2J0T D;  3GTP B;  1TWG B;  4C2M H;  2E8G A;  3HKZ B;  3NE5 B;  4MNO A;  4LUO A;  1K3B C;  3I56 A;  4NDX A;  1LUZ A;  1CKN A;  3S16 H;  2EYL A;  2B2W C;  4A3D H;  4A3K G;  1FD7 D;  1XJV A;  1A3T A;  3S15 H;  4KJN A;  2I0Q A;  1J6Q A;  1LTT D;  5DM7 3;  1S5C D;  3I4N H;  1KDC A;  2A6E C;  4OWX B;  4XYQ A;  4DK3 C;  4N8F A;  1KNE A;  3FKI H;  2L4N A;  3STB C;  1DOL A;  3I4L A;  4X3K A;  4ULL A;  4HIK A;  3AB9 A;  4E6I A;  1G6Z A;  2KCT A;  1Z6H A;  4U68 A;  4C3J G;  1B4O A;  4NXM Q;  3S2D B;  4IUP A;  1KRT A;  4JI1 L;  5LL6 S;  3J81 E;  3H3V H;  4X62 Q;  2JA5 G;  5M3F B;  5LHY 1;  4KY6 A;  3V96 A;  4DF7 A;  3JAM E;  5EBC A;  1CK1 A;  1TY0 A;  1U4R A;  4KKS A;  4UHV A;  4MTK A;  4L5R C;  2Z8L A;  1VQN A;  1FNV A;  4B3M L;  1TKW B;  2F0F A;  4KHZ A;  1B9N A;  4Y7N B;  1N33 Q;  4JBW A;  4A3D G;  4LF4 Q;  1VQK A;  5C44 H;  3OWE B;  2F03 A;  1XX8 A;  5LMU L;  2JA5 B;  2FMM A;  3HOX B;  1G51 A;  5G3L F;  5GAD C;  3MZ5 A;  1V43 A;  1PYS B;  4K6D A;  2A69 C;  1GUS A;  4RAU C;  4F7X A;  1HNW L;  4RWS C;  4LF8 L;  4N9T A;  2L11 A;  3MFY A;  5M3M G;  1R9T B;  1KD1 C;  2B2T A;  1XNR L;  4DXF A;  2K50 A;  4V0B A;  4JI0 Q;  3HOU G;  5IYB H;  3PCO B;  1WTR A;  1D6E C;  4OEM B;  2QA4 A;  3VYT A;  1M1K C;  3W3A A;  4LFC L;  3AFP A;  2X69 A;  3KOJ A;  4K0K Q;  1DGS A;  2K1B A;  5GRO A;  2KHJ A;  2NZ1 D;  2KOL A;  4GLV B;  2UUC Q;  1VQB A;  1K0R A;  1JWS D;  1JR0 D;  2ENB A;  5HY6 A;  2EPB A;  4A3E B;  4G7Z C;  4YHH L;  4FXD A;  1J9O A;  4LF6 Q;  4JV5 Q;  5CBE E;  4A3F H;  1E0B A;  1KRS A;  1K73 C;  4DV5 L;  2LSS A;  1PTO F;  2WP8 J;  4JI8 L;  1TR5 A;  3MC0 B;  2R7Z G;  3U4V A;  2A6E D;  4ZKC B;  4LNQ A;  3PGZ A;  2V4D A;  2M9V A;  4DR4 L;  1D2B A;  3KK7 A;  1TWF B;  5JJL A;  2QGQ A;  1ZYR C;  1EY4 A;  4WFN 3;  1BBU A;  4DR5 Q;  1EYD A;  2F0P A;  2R92 B;  2A68 C;  2NVX H;  3U4Z A;  1ILQ A;  1ONL A;  2V1C C;  4U67 3;  1DXM A;  2D2C C;  1Q12 A;  4FDB A;  2IY5 B;  1PRT B;  3KBX A;  4WRD A;  4LFA L;  4R4C A;  3SGI A;  3FEW X;  3I73 A;  1QCB D;  5EBD A;  2PMZ B;  3K57 A;  1FGU A;  3CQZ B;  1SNM A;  3BU2 A;  3I3C A;  3ZYY X;  4LFB Q;  2KHI A;  4BWG B;  2MO1 A;  4DFA A;  1B7Y B;  4A3M B;  1A63 A;  1TWC H;  1DZ1 A;  3RMH A;  1NJI C;  3P20 A;  3WOF A;  4S3S A;  2PW5 A;  2B29 A;  4DV0 L;  3M3Y B;  2CHB D;  1PLF A;  2EYM A;  3GO5 A;  3P7J A;  3TEH B;  3H6M A;  3PO3 H;  1E1T A;  1LT5 D;  1A3V A;  1SMX A;  2NVT B;  1C4Q A;  1S5E D;  3HOY B;  3R2T A;  3J7Y W;  2H4O A;  3PF4 A;  3VA5 A;  5AJ3 Q;  5C0X J;  3GD7 A;  3S15 B;  2WFW A;  2CH4 W;  4NP5 A;  4J1M A;  3VR2 A;  1NMG A;  4RFB A;  1K8G A;  1QE6 A;  1VQH A;  2KCM A;  4Z9C B;  2A8V A;  2PZU A;  1HTP A;  3H3V C;  3IFT A;  4DV6 Q;  4C2M B;  3JAM c;  3HOW H;  1ESF A;  2OEO A;  4A3M G;  3OOC A;  4AH6 A;  3S1R H;  3M3Y H;  2M2L A;  2HUG A;  3ERO A;  3PUW A;  2KA7 A;  1B50 A;  4IFD G;  4A3M H;  3MHB A;  2PQA B;  3OIP A;  1HR0 L;  4RKL A;  1UE7 A;  4N9P A;  4ZRZ A;  4C3H B;  4DK0 A;  1EWH A;  3U58 A;  1HTL D;  2PW7 A;  4DAV A;  4YY3 Q;  1Q90 A;  4KY7 A;  4HAE A;  5JPM C;  3LGJ A;  4IUQ A;  2MP1 A;  1BNZ A;  3PO3 G;  4FF2 A;  3RLO A;  1CZG A;  1F2Y A;  1BQQ T;  3OTO L;  2PCF B;  1MKH A;  2RF4 A;  1R4P B;  1VQE A;  2ATW A;  2L0C A;  2WIN B;  1TY2 A;  2DNE A;  5D65 A;  3NEN A;  1QUQ B;  1X3P A;  5IT9 L;  5IE8 A;  3HOY G;  3RZD H;  1EWC A;  4LWC A;  2DN8 A;  1WFQ A;  5A2Q E;  1SYF A;  3I70 A;  2ASB A;  2NZH A;  2VB3 X;  4J6H A;  1EIY B;  1KIX A;  1EEI D;  5C3X A;  1C9O A;  1Q8I A;  3BVZ A;  1HNW Q;  3J80 c;  3Q6S A;  5FLX L;  1G91 A;  1E24 A;  3M7N A;  4RA8 A;  1SND A;  5C4X H;  5K36 H;  4JI6 L;  1HA6 A;  2A6H D;  1P16 A;  3GTO B;  3TN2 A;  2UXD L;  4A3F B;  3T1Y L;  1NCV A;  1O7Z A;  4A3G H;  1IBK Q;  2B2T C;  1WD0 A;  2PPB C;  5K36 G;  1ICW A;  4JC0 A;  3VR4 A;  1STG A;  5IYB G;  1N34 Q;  4A3E H;  1VCI A;  1SE3 A;  2EJG C;  1QUQ A;  1UEA B;  3BZK A;  4K6L A;  1Y8O B;  5M9O A;  3S1M H;  1VQL A;  5IT9 c;  3CCM A;  1CQF A;  4IPD A;  5JEA H;  3FMC A;  5IP9 H;  4PZ8 A;  1IBM L;  1Y14 B;  4DUZ Q;  2E2H H;  2K6A A;  1U0L A;  1EIF A;  3T1H L;  4YWM A;  1M8A A;  2HQE A;  4K14 A;  1G29 1;  5IGB A;  2JA6 H;  1NSN S;  5LMN W;  2Z6K C;  2JSO A;  1SRO A;  3SK5 A;  3RZD B;  4JI6 Q;  2A68 D;  1I4R A;  2ID0 A;  3H3V I;  3AMU A;  2JA7 G;  4DV4 L;  3UDX A;  2EY5 A;  1S4Z A;  2PQE A;  1SDF A;  4ZK9 B;  4IZ8 A;  4R9W A;  2PQA A;  5JJZ A;  4HJ7 A;  3PUX A;  2NN6 H;  1L0Y B;  4XQQ A;  3EQL C;  5ELN A;  1Q46 A;  1Y1V H;  1Q81 C;  2JYO A;  5M3F H;  1BF4 A;  1UE1 A;  1LV9 A;  3CME A;  3A8K E;  3D0F A;  4PZ6 A;  3FKI B;  2FFK B;  2EXZ A;  4RKB A;  1BDO A;  4NMZ A;  4LW1 A;  4DUY Q;  1AN8 A;  4R4T A;  4TRD A;  4JK1 C;  3I4N B;  3EVQ A;  5IGG A;  1SJH D;  2JN4 A;  5TSS A;  3SDZ A;  1I4Q A;  2A5H A;  2Z0S A;  1D8L A;  3K5O A;  4P72 A;  2NVQ H;  5KRU A;  4EVO A;  2B2V A;  4A3C H;  2EXD A;  3CW2 C;  3OPO A;  1LTA D;  1JOR A;  1CA5 A;  2Y0S B;  5DNF A;  5JJI A;  4NW2 A;  3F8T A;  4A93 B;  3LWE A;  3J7Z C;  4DPG A;  3QJY A;  3CQZ H;  4KKU A;  1TU2 B;  5FOB B;  1ENC A;  1JJ2 A;  2F52 A;  3TP6 A;  3H94 A;  1PFN A;  4FNF A;  2C5C A;  1OXT A;  4DV0 Q;  2F0G A;  1CKM A;  1JIC A;  2KBN A;  1AH9 A;  3I4N G;  2KEE A;  3VYR A;  3E3X A;  4A3B H;  1JJG A;  1KDA A;  2NWG A;  4A3I H;  4C1N I;  3ITP A;  2UUA Q;  4JI2 L;  1L1O B;  4GNX B;  1X54 A;  3R93 A;  1WVL A;  1EFW A;  3M4O H;  1VQO A;  4A3L G;  1STN A;  3H15 A;  2WAC A;  2SEB D;  1N32 Q;  4A3I G;  1YHB A;  2VNU D;  1D7Q A;  3HKS A;  3TS2 A;  3SK4 A;  4ZKB B;  2EOT A;  1WCM G;  2OT2 A;  4MTN A;  3O13 A;  1NUC A;  2ICI A;  5I4D A;  5M5Y B;  3G4S A;  1SYD A;  1SYG A;  1GUN A;  1EIH A;  3VDY A;  3TZD A;  3ZJY C;  4C3I H;  1YHA A;  1N34 L;  3L3O C;  3F2B A;  4AQY Q;  3S1Q H;  4R1J A;  4HJ8 A;  2F4V Q;  1LT4 D;  2JA7 H;  1FNU A;  4JI0 L;  1VF5 C;  1H9J A;  3BDC A;  1AFP A;  2B2V C;  4LF9 L;  4UP9 A;  1XTD A;  2NZO A;  3ER0 A;  4G4K A;  1BUV T;  1DJR D;  1I94 L;  2JA8 H;  3DHQ A;  1XMO L;  4HID A;  2XRQ D;  4BBS G;  2H1E A;  4OON A;  5J39 A;  2ALY B;  1Y8N B;  2D9U A;  2F0L A;  2ZJP A;  2HIX A;  3NPP A;  3C1F A;  1SE2 A;  2HHH Q;  5LMN L;  4FO2 A;  4MZ9 A;  1MSH A;  4H13 C;  5LL6 X;  4H0L C;  4OX9 Q;  2XTI A;  3NEM A;  1CHP D;  4EQP A;  2RSO A;  1CHQ D;  4N8X 1;  2QEJ C;  3BS1 A;  1F2L A;  3UE1 A;  2QDL A;  1ASZ A;  2L5T A;  1PYB A;  4IPG A;  1YBY A;  1Z9F A;  4UPA A;  3EBE A;  3SE0 A;  4K2L A;  3HGB A;  1WJJ A;  1PRT D;  2NTS A;  1HUN A;  5IIF A;  1SNQ A;  1RIP A;  1L0X B;  2KCN A;  4QMG A;  1VS0 A;  1QB5 D;  4TSS A;  2F0Q A;  4BS9 A;  1E7Z A;  4CDC C;  1UWV A;  4KKT A;  4LF4 L;  1PH2 A;  3J80 E;  3Q23 A;  3S2H B;  3S9W A;  3CCE A;  3TP5 A;  1O78 A;  3RZO B;  4R4I A;  4OHJ A;  2OTJ A;  4DV7 L;  1XPR A;  5FJ8 G;  4GZY C;  2QW7 A;  4GS3 A;  3MWY W;  1Q1E A;  3DM3 A;  4JYA L;  1DYQ A;  1S5F D;  4J15 A;  2GN5 A;  5FLM H;  1BCP F;  1CSQ A;  1KAB A;  4IAL A;  2XN9 C;  3IRB A;  3NQI A;  3CCU A;  2IHE A;  5C4J B;  4OIK A;  1K9M C;  1YZ6 A;  2G5D A;  2RDH A;  2Z4H A;  4JCV E;  4A3G B;  2RDF A;  1HUM A;  1PZJ D;  2K75 A;  4X66 Q;  2EVB A;  1VF7 A;  2RSN A;  4H7B A;  4BY7 H;  2YTX A;  4QGU A;  2EDG A;  3D3R A;  5COY A;  5ELD A;  3GTG B;  1HPC A;  4QIW E;  4EQN A;  2F0S A;  1SNP A;  1X6O A;  2HCC A;  1SSO A;  3NK9 A;  2MO0 A;  2NB0 A;  2ES2 A;  2D62 A;  5EJW A;  2FJ2 A;  3KJP A;  3X3M A;  2K14 A;  3P75 A;  1STA A;  2UU9 Q;  3A74 A;  4ZUJ A;  1F9P A;  3UDI A;  2A19 A;  3MXU A;  2CQO A;  1QZH A;  1SAP A;  1SBB B;  3BDL A;  1YJ9 A;  3L7Z C;  5D3I B;  2A6H C;  2RVL A;  4DU9 A;  2WAQ G;  1HNX L;  4FF3 A;  2Q2H A;  5EGT A;  2EY6 A;  3GTQ H;  2B2W A;  4KN7 C;  1O80 A;  5J1Z A;  2DGY A;  1BBX C;  4BY7 G;  1LTB D;  5FO9 B;  1QOH A;  1I6V C;  4HR7 B;  1FJG L;  1GO3 E;  4GOP C;  2ZM6 L;  3M4P A;  1K3R A;  3ONA B;  1MD2 D;  3NUC A;  3S1R B;  2BE5 D;  4M1U B;  4DR6 Q;  2UUB L;  1ZXT A;  1GVP A;  1JOK A;  2BDN A;  3OMC A;  4JI5 Q;  1X32 A;  3AU7 A;  1YIJ A;  1J5E Q;  1G2S A;  4B9W A;  5GQO A;  3TP8 A;  4K8I A;  4DV4 Q;  2NVQ B;  3MA2 B;  4RG1 A;  5T1I A;  3W1B A;  3ERQ A;  2K5V A;  1YNN C;  4DR5 L;  3KDF B;  3KF6 B;  5DLQ E;  3DUZ A;  1CZW A;  2D5D A;  1KAW A;  5HGT A;  1II3 A;  4CJ2 C;  4X64 Q;  1HNZ L;  3FP9 A;  4KHP L;  4X64 L;  2B3G A;  1CKN B;  1RDP D;  4PNY A;  2JJQ A;  3SK8 A;  1GOZ A;  4JI8 Q;  3QOL A;  5LMU Q;  1SNC A;  3IKJ A;  4DUZ L;  1IBM Q;  4BBR B;  1J5E L;  4GN4 B;  4KHV A;  1JMC A;  3J7A F;  1ZKO A;  4JPB W;  1WTW A;  1JWM D;  2C9O A;  1VQJ A;  1IXR A;  4PMW A;  4BXX G;  3M9B A;  1MJC A;  3H91 A;  5DAU A;  5JJK A;  2E2I H;  2J4X A;  4OWW B;  5KNC A;  1LAB A;  4AYB G;  1D5X C;  3HG9 A;  2F4V L;  2VZA A;  4FXK C;  5IP7 H;  5K5P A;  1O7L A;  2KQ3 A;  3CCV A;  1TVX A;  4QUC A;  4YWK A;  1WOC A;  3ERS X;  3KJO A;  4X62 L;  1UUP A;  1C7Y A;  1G6P A;  1XNQ L;  2J7Z A;  1MJE A;  3HP3 A;  1A2U A;  4AYB B;  4KI0 A;  3GP7 A;  3E0J A;  2NVX B;  1RCV D;  4I7Z C;  3FVQ A;  1TWH H;  4HTH A;  4IOC A;  3PO2 H;  1XWE A;  2ZM6 Q;  1N32 L;  1P8L A;  1PTO B;  2R7F A;  4DV2 L;  4DGZ A;  5IYD G;  4FYD A;  1IZ6 A;  1U9R A;  3G7L A;  2F0V A;  1TWA B;  2A74 C;  1Y69 U;  3ND8 A;  1RF2 D;  2GVA A;  3AYH B;  2EY2 A;  1AEX A;  1PH8 A;  3QIA A;  2MJ8 A;  3T1Y Q;  4L5Q A;  4R4Q A;  3RLN A;  1EFI D;  1LTL A;  1SRU A;  3JAM i;  2AUK A;  1EYC A;  1GUG A;  5AJ3 L;  3J81 i;  1RTO A;  2PYK A;  1BXT A;  4LJZ C;  3F2C A;  4XYO A;  5CC4 A;  4P73 A;  3CC4 A;  3T51 B;  2CCZ A;  4UDU C;  4FF4 A;  5JVH 3;  3C3L A;  1GKH A;  3GTL H;  3CPW A;  1TWA H;  2HDM A;  1F2Z A;  1FYC A;  1BBW A;  3K80 C;  4LK1 C;  1DCZ A;  3RN5 A;  4ALP A;  4XIG S;  2CWP A;  3HFZ B;  4IPH A;  4A3J G;  4A3K H;  1WI5 A;  2LFN A;  2F3I A;  4X66 L;  2JK8 A;  2IL8 A;  3QOJ A;  4KD4 A;  3GTM B;  4DV2 Q;  3H0G G;  2XWB B;  1K83 H;  5CV7 A;  1MIU A;  1EYG A;  2LXJ A;  2JXM B;  3G71 A;  1STB A;  3NXW A;  5C44 B;  4B3S L;  2JA5 H;  3SXH A;  1K8M A;  2MQH A;  3BYT B;  3M4Y A;  2AQ1 B;  2K32 A;  2ZTD A;  1D5Z C;  3JC6 6;  3NTH A;  5GAE C;  1JB7 A;  3FKI G;  1QG7 A;  1EOT A;  2B2Y A;  5BN3 A;  5M5X H;  4HIO A;  3HKZ G;  1YI2 A;  3UI2 A;  2MFI A;  3HOV H;  3S1N B;  1M4V A;  3DM1 A;  3T16 A;  1I4P A;  2NTT A;  4B08 A;  2HCI A;  4L63 B;  1SFO H;  3B6Y A;  4P75 A;  4OX9 L;  1L1O C;  4GNX C;  2XSC A;  2PI2 E;  1LTG D;  4A4I A;  1VQ9 A;  2KED A;  4K5W A;  4KK7 A;  3CF5 A;  2KEC A;  2E5L L;  1X3Q A;  3NWS A;  4MHE A;  2F4I A;  2B8G A;  4GLX A;  1W6K A;  2UUC L;  4X3T A;  2ICE C;  1YJW A;  4J8Q A;  1LT6 D;  4OGQ C;  3KBG A;  5JEA G;  4OO1 H;  1I3Q B;  4XDX A;  5D14 A;  1N33 L;  1VDZ A;  4UP8 A;  3GTP H;  2AQ2 B;  1TWG H;  2G9H D;  2EYH A;  3V2T A;  3S1M B;  1IKL A;  2QCP X;  2K5N A;  4BXX H;  1MSG A;  2P5Z X;  2R3Z A;  2RA4 A;  2I5L X;  4JBK A;  1PH7 A;  1Z7T A;  4ME5 A;  5M5Y H;  5M3F G;  1H9R A;  3MFG A;  2RCF A;  3GQB A;  5ELO A;  5C5L A;  4B3S Q;  1QWY A;  2F1M A;  3SVM A;  2VUM G;  3CXC A;  1JOQ A;  4WOR A;  4G57 A;  1SYC A;  1T5X D;  4R4O A;  2VB2 X;  1OXV A;  5C3W A;  4DV1 L;  1V8Q A;  4KJO A;  2MPM A;  2L55 A;  1XMO Q;  5I9O A;  1IBK L;  5ELE A;  3KDF A;  4JOI C;  2LXK A;  3BG3 A;  4B3T L;  5E7N A;  3W5O A;  1KTK A;  3ICE A;  2B2Y C;  1L1O A;  4GNX A;  4DV3 L;  4XQN A;  4KTA A;  1KXL A;  2QEX A;  4LF6 L;  4JV5 L;  2MGS A;  2NYZ D;  2VL6 A;  1F77 A;  2F0D A;  3BDO A;  3CCR A;  1HJP A;  2JE6 I;  1PVO A;  4DR3 L;  1YNN D;  4BY7 B;  4ILW A;  1VQP A;  1SMY C;  1CSP A;  4DUY L;  4DXG A;  1K8A C;  2UXC L;  3T13 A;  1I50 B;  3I8Z A;  4WJ3 M;  1QNK A;  1ILP A;  2K01 A;  1H9M A;  4BBR H;  1HFN A;  3T53 B;  2Y0S E;  3A8J E;  2B2U C;  2CWA A;  2ZJQ A;  4LFA Q;  1CA6 A;  4H44 C;  2B63 H;  1E2W A;  1E2Z A;  1I3Q H;  1DM0 B;  2ZJR A;  1R9T H;  3P1H A;  1XNQ Q;  1U4L A;  1CUK A;  1GUT A;  5COR A;  4KMU C;  1N9W A;  4IUV A;  1BVS A;  2YU9 B;  3HOY H;  2BH8 A;  3CRK C;  1DON A;  2R61 A;  4BA2 I;  5I2X A;  4YWL A;  2WB1 B;  1T9H A;  4DV6 L;  2A69 D;  4NKL A;  1VQ7 A;  3LX0 A;  2K5H A;  5E4W C;  5CV4 A;  3HOX H;  4FP5 D;  3C1E A;  3FPU B;  1ICF B;  4NXM L;  4Y7N H;  2NUC A;  1JJC B;  1EYA A;  3D8G A;  5C0X I;  3DWP A;  1MGS A;  4QY7 A;  3CPF A;  1OXU A;  3S1N H;  3HOV B;  4OL7 A;  4BA1 I;  4B9X A;  1PXU A;  4DV3 Q;  2HHH L;  1AW7 A;  2WKD A;  3TZU A;  1NY4 A;  4RCN A;  3U9S A;  1WTO A;  1PHJ A;  2GVB A;  3OIQ A;  4KLK A;  4XQJ A;  3PIO A;  3IAY A;  4QCL A;  1HCZ A;  4HJ9 A;  1AE2 A;  1PZK D;  3A7L A;  3L0O A;  2F0J A;  3NWT A;  1UNS A;  2R7D A;  2CVR A;  4GOP A;  1STE A;  1EQT A;  4LF8 Q;  1R4Q B;  2AUJ D;  2LS0 1;  5I2Y A;  4YCV A;  2IJ0 A;  4C3H G;  1VQ4 A;  4F88 A;  5C5M A;  4AQY L;  4RGO S;  3MTS A;  4A93 G;  3NQT A;  4A75 A;  2UUB Q;  5FLX E;  1EIG A;  3OHX C;  1VQC A;  2JA8 B;  1CM9 A;  1KLU D;  2XRS D;  1PH6 A;  4JI4 L;  3GTL B;  2EYP A;  3A55 A;  1K28 A;  1EY9 A;  2I5H A;  3BYY B;  3WDN A;  4CDD C;  3TBI B;  1X65 A;  1YEZ A;  1YNJ D;  4IPC A;  2PNR C;  4C3I G;  4K5V A;  2IX1 A;  4DV5 Q;  4BY1 H;  3D6W A;  1PH5 A;  2QIL A;  1LYL A;  4PZ7 A;  1HHV A;  4LF5 L;  1IYJ B;  1IW7 D;  1PFB A;  4ID6 A;  2X6G A;  2ZXR A;  3I4O A;  5JOB A;  3CKI B;  3F2D A;  2O4X A;  2Z6B A;  2ZXP A;  3K5M A;  1Y8P B;  1H9S A;  2TSS A;  5E4X A;  2Q2T A;  3RZO H;  3M4O B;  2E5L Q;  4DA2 A;  4KY5 A;  2JA6 G;  1VMC A;  1LAC A;  4A3I B;  1U4P A;  2DY7 A;  2EE1 A;  2ZTE A;  4DNI A;  2K28 A;  2VXW A;  1RTN A;  3J81 L;  1JCK B;  1QVC A;  1WYD A;  4GKK Q;  3OTO Q;  1PZI D;  3C2P A;  4O1N A;  2F0W A;  2DUD A;  1X56 A;  2JP1 A;  4IUN A;  1SEB D;  2Q2I A;  3SR1 A;  4RHR A;  1ENF A;  4ODG A;  4QUF A;  2F0E A;  1KC8 C;  3QR8 A;  2QF7 A;  2E2I B;  3X3N A;  1D1K A;  1RKN A;  4RGM A;  2C35 B;  2BA1 A;  3J80 L;  1EZ6 A;  5IYC G;  3VYS A;  5EPJ A;  3S2D H;  4ZCK A;  1LTS D;  4XTC S;  1H9S B;  2EYO A;  3NBI A;  4C3J B;  4KV6 A;  4XXE A;  4GKJ L;  1XMQ L;  1KQS A;  2WII B;  1KAA A;  2KJX A;  1RHP A;  4C56 C;  4B3R L;  1JT8 A;  1XMQ Q;  1HZC A;  2PO4 A;  4JI1 Q;  2E74 C;  5CV8 A;  5CV9 A;  1WTH A;  1EUJ A;  2K33 A;  1T5E A;  5BN4 A;  3I2Z A;  3KF6 A;  2E2J B;  3M7G A;  1SJE D;  2O5J C;  2RHS B;  1HZ9 A;  5J22 A;  2IPK D;  2AWN A;  4A3C G;  5IY0 A;  2B63 B;  4HJ5 A;  2BOS A;  2EJF C;  4A3B G;  5KGU A;  4C3J H;  4CHT B;  2HDL A;  3FDT A;  3A7A B;  4QJF A;  3OWF A;  4HN7 A;  1TWC B;  5CMD A;  1ET9 A;  2AHO B;  4X3U A;  4A3J B;  5J3B A;  1ESR A;  5I6W A;  4POF A;  1QZG A;  1EY8 A;  4NB3 A;  2LY7 A;  3GTQ B;  2HQL A;  2FXQ A;  2WV6 D;  1YJN A;  4B3T Q;  2RBM A;  4HSP A;  4HSV A;  3H09 A;  1EOV A;  1HH2 P;  2SDF A;  4IFD H;  2AMC B;  3E5S A;  4P2C B;  1X3F A;  3J81 c;  2I46 A;  1NE3 A;  5IOD A;  4YIJ A;  3T4A C;  1E1O A;  5ELF A;  1OO9 B;  3R8B A;  4ZLT F;  2IHF A;  3H0G B;  1A62 A;  1IW7 C;  3PF5 A;  4JI4 Q;  4LAA A;  1LM0 A;  2B8F A;  3T1H Q;  2F0O A;  5BR8 L;  4DAM A;  5EKI A;  3G6J B;  3FHW A;  1HNZ Q;  2R92 H;  2I5M X;  2O5I C;  3A5U A;  2E75 C;  2F0H A;  2NN6 I;  3A56 A;  3J80 i;  1YIT A;  1MBY A;  3D6C A;  4RMF A;  1N36 L;  2E2H B;  1PMR A;  4OO1 I;  3WOE A;  5CR3 A;  4DN4 M;  2EZV A;  4DV1 Q;  1VQI A;  1EQR A;  4IUU A;  3KUP A;  5M5W B;  1V1P A;  4JI5 L;  1SNO A;  5FO8 B;  5ISR A;  4BY1 B;  4EGV A;  1X3E A;  1QNU A;  3TQY A;  5CV6 A;  3A8I E;  1B8A A;  4DR2 L;  5IGF A;  1FVI A;  1B70 B;  4HCE A;  2K7V A;  1XXG A;  4Y52 H;  2VQE Q;  2AKW B;  2EY1 A;  4RGN A;  4QIW B;  4ABN A;  4HCS A;  3LNN A;  5IP9 G;  4EQ5 A;  2NVY B;  3DWQ A;  1PFS A;  3KYH C;  1VQ8 A;  4Q5V A;  3IFD A;  1GHK A;  4K8J A;  3S17 H;  2N8N A;  1CKO A;  2F0I A;  4TVA B;  2F3V A;  2BDO A;  5C4X B;  1N8R C;  2XGT A;  1WCM H;  4IO9 A;  5BR8 Q;  2MUY A;  2EYF A;  2ZT9 C;  4BBR G;  2XWJ B;  2YTV A;  4DR2 Q;  2OWO A;  2IWH A;  1PFM A;  1FJG Q;  3F2U A;  3KF8 A;  3Q0A A;  2VQF Q;  3U50 C;  4CKB A;  4LF5 Q;  1IYV A;  3TDQ A;  2B63 G;  1Q82 C;  5C0X H;  1EWI A;  4TKO B;  1DOM A;  1BCP C;  1SFO B;  4DAY B;  4JVZ A;  4K0K L;  3DMU A;  1C0A A;  4G7O C;  3KLW A;  4OWT B;  3A0J A;  3TP7 A;  3EJI A;  3IL8 A;  2UUA L;  2H5X A;  1WTX A;  2Y0S G;  4LUZ A;  1GXD C;  3G48 A;  3BJU A;  1C8C A;  3CAM A;  5IP7 G;  2CKZ B;  2LKV A;  4HMI A;  1EEF D;  3V05 A;  1I6H B;  4DR3 Q;  2AWO A;  1OTC A;  3GTM H;  4C1N K;  4EQO A;  2E2D C;  3VR6 A;  1Y1W B;  1BCP B;  4I65 A;  2DJF C;  2CW0 C;  5ELB A;  3NSW A;  2KVM A;  3KLS X;  1DOK A;  1CQV A;  3MXN B;  2JA6 B;  4IFD J;  5M3M B;  3S14 B;  1RJT A;  1STH A;  3PUZ A;  4DV7 Q;  2IT1 A;  4JG2 A;  4JI2 Q;  3OW2 A;  4YCU A;  4QF4 A;  4CBV A;  1D5M C;  1YVC A;  2KCC A;  3CC7 A;  3T56 B;  2Z4I A;  2I07 B;  4GOP B;  4CKC A;  2UXB Q;  3HOX G;  1PH1 A;  1CTM A;  2YTY A;  3RUZ A;  5FJ8 H;  1IL2 A;  3KFU A;  1JB3 A;  1TQO A;  2NVY H;  3HOZ B;  2R6G A;  1G8Z D;  4C3I B;  4RH6 A;  4APV A;  3CC2 A;  3S1Q B;  4FVM A;  4CJ1 B;  1PV4 A;  1HR0 Q;  1HZB A;  1I5F A;  1I50 H;  1SMY D;  3K59 A;  5CYU A;  1VQG A;  4LF7 L;  3TME A;  4DKA C;  3ULP A;  1PH3 A;  1LT3 D;  3QWN A;  4GKK L;  3PV0 A;  4PMB A;  2QKI C;  3E6Z X;  2FHT A;  1S3O A;  3Q22 A;  3MEF A;  1PA6 A;  2R92 G;  2JA9 A;  5EPL A;  2PMZ E;  3HOZ G;  1VMP A;  1S5D D;  3HOW G;  4DNR B;  2R93 B;  5HGQ A;  4NPS A;  1IBL L;  1Q7Y C;  4A76 A;  1RL2 A;  2VUM B;  3RN2 A;  4YHH Q;  3OW7 A;  3H0G H;  2FIN B;  3S24 A;  2F0K A;  2KEN A;  4OO1 G;  1UEB A;  3EIV A;  2D0P A;  4DNT B;  4A3L H;  3BZC A;  1WTP A;  1I4H A;  3QG1 A;  2F0N A;  2GA4 B;  1PDQ A;  1NBW A;  3C46 A;  5GAG C;  1VQD A;  3K5L A;  4FF1 A;  3L9A X;  2NBF A;  1GD7 A;  1TS5 A;  1A15 A;  4LFB L;  4UY8 C;  2UXC Q;  1YNJ C;  3BVM A;  4R8N A;  5D3D A;  5DEH A;  1B53 A;  5KYI A;  3L2P A;  2HIV A;  4A93 H;  3K58 A;  2SOB A;  2JEA I;  1EY5 A;  1NR2 A;  4A3J H;  1B9M A;  4XT3 B;  4HIM A;  2XVS A;  5E1F A;  4WJ4 A;  3GV6 A;  4NXN L;  1LTI D;  3OSO A;  3HOZ H;  4L6T B;  5HUR A;  1EZ8 A;  2K03 A;  4OXP A;  5H1S E;  1EY0 A;  4DR1 L;  3F1Z A;  2WB1 E;  1QJO A;  2VY3 A;  5C3E G;  4JI3 Q;  1AZQ A;  2F0T A;  1V9P A;  3HS0 C;  3MXN A;  2XIW A;  4POG A;  3K81 C;  5EKK A;  3EN2 A;  2OF1 A;  1F2M A;  2E2J H;  5KND A;  4K5X A;  4KHP Q;  4XT1 B;  4P71 A;  2E76 C;  3HOV G;  4Q0F A;  3KLR A;  2R7Z H;  1VQF A;  1O7I A;  2IX0 A;  3KLS A;  3HEJ A;  1TXY A;  4OIJ A;  4A3F G;  1I6H H;  4JI7 Q;  5ELC A;  3MVV A;  3HZX A;  5IWA Q;  2BCO A;  1VQM A;  2D0O A;  1S40 A; 
#chains in the Genus database with same CATH homology
 2KCT A;  4NXM L;  4Y7N H;  2JA8 H;  3UE1 A;  1JJC B;  4NXM Q;  1ASZ A;  1PYB A;  4IPG A;  1KRT A;  4JI1 L;  5C0X I;  1HR0 W;  3H3V H;  4QY7 A;  1YBY A;  1X55 A;  3CPF A;  4X62 Q;  5C0X G;  1OXU A;  2JA5 G;  3S1N H;  3AEV A;  4IFD I;  1Z9F A;  4UPA A;  2UU9 L;  3EBE A;  2JQO A;  1WJJ A;  4BA1 I;  4L5R C;  1VQN A;  4B3M L;  4DV3 Q;  1RIP A;  2HHH L;  5JEA J;  1W2B A;  4KHZ A;  2UXB L;  1VS0 A;  1L0W A;  1N33 Q;  1NY4 A;  4JBW A;  4BBS H;  1E7Z A;  1W3S A;  4LF4 Q;  4A3D G;  1VQK A;  1UWV A;  4LF4 L;  2N3S A;  5C44 H;  1H95 A;  1PH2 A;  1E22 A;  1PHJ A;  2GVB A;  5LMU L;  4KLK A;  3PIO A;  4HJ9 A;  3AQQ A;  1AE2 A;  1G51 A;  3L0O A;  4JI3 L;  3RNU A;  3CCE A;  5GAD C;  1V43 A;  1PYS B;  2R7D A;  3RR5 A;  4GOP A;  1U5K A;  4UP7 A;  4R4I A;  3RLF A;  4YY3 L;  1HNW L;  4LF8 Q;  2YU9 H;  2OTJ A;  4LF8 L;  4YCV A;  2L15 A;  2OQK A;  2EIF A;  4DV7 L;  1VQ4 A;  1XPR A;  3KF8 B;  5M3M G;  5FJ8 G;  4AQY L;  4A93 G;  4A75 A;  1KD1 C;  2UUB Q;  4GS3 A;  1XNR L;  1VQC A;  2K50 A;  4JYA L;  1Q1E A;  3DM3 A;  4JI0 Q;  3UDF A;  3HOU G;  5IYB H;  2VS1 A;  3PCO B;  3PO2 G;  4GKJ Q;  4J15 A;  3I7F A;  1PH6 A;  4JI4 L;  2GN5 A;  1UE6 A;  2QA4 A;  1UE5 A;  1M1K C;  5FLM H;  2BH2 A;  4LFC L;  1CSQ A;  3AFP A;  2I5H A;  3KOJ A;  4AIM A;  3M85 A;  4K0K Q;  1DGS A;  5IYD H;  3IRB A;  3CCU A;  2IHE A;  5GRO A;  2KHJ A;  1ASY A;  4GLV B;  2UUC Q;  4YCW A;  4O0A A;  1K9M C;  1VQB A;  1X65 A;  1YEZ A;  1YZ6 A;  1K0R A;  5HY6 A;  3CCQ A;  4IPC A;  4JCV E;  4YHH L;  2IX1 A;  4LF6 Q;  4JV5 Q;  2K75 A;  4DV5 Q;  4DR7 Q;  4A3F H;  1KRS A;  4X66 Q;  4L5S A;  1K73 C;  4BY1 H;  3GTO H;  4DV5 L;  2LSS A;  1VQA A;  2WP8 J;  2K4K A;  4JI8 L;  1PH5 A;  2YTX A;  1LYL A;  4QGU A;  4PZ7 A;  4BY7 H;  2R7Z G;  4LF5 L;  1IYJ B;  5IWA L;  3U4V A;  4JI7 L;  4LNQ A;  3I4O A;  3F2D A;  3PGZ A;  4QIW E;  4DR4 L;  3PSI A;  5JJL A;  1X6O A;  2ES2 A;  4A3E G;  2MO0 A;  2QGQ A;  4LFC Q;  2D62 A;  2Q2T A;  1BBU A;  3RZO H;  1NTG A;  3KJP A;  4DR5 Q;  2E5L Q;  2K14 A;  2UU9 Q;  4P74 A;  3A74 A;  2NVX H;  2JA6 G;  3U4Z A;  4IJL A;  2A19 A;  3UDI A;  4LF7 Q;  2ZTE A;  4DNI A;  1XNR Q;  4X6A H;  2CQO A;  2V1C C;  1QZH A;  3PIP A;  1QVC A;  4QQB X;  1WYD A;  4GKK Q;  1Q12 A;  3OTO Q;  4FDB A;  2IY5 B;  1YJ9 A;  3L7Z C;  2DUD A;  4LFA L;  5C4X G;  1X56 A;  4R4C A;  3SGI A;  2Q2I A;  2WAQ G;  4X65 Q;  3K7A H;  1HNX L;  2N78 A;  1KC8 C;  2Q2H A;  2RHQ B;  3K0X A;  3UE0 A;  1FGU A;  4C3H H;  3GTQ H;  2C35 B;  3BU2 A;  2BA1 A;  2DGY A;  4BY7 G;  5IYC G;  4LFB Q;  2KHI A;  3S2D H;  2MO1 A;  1FJG L;  1B7Y B;  1GO3 E;  4IJH A;  4GOP C;  2ZM6 L;  3M4P A;  1K3R A;  1A63 A;  1VQ5 A;  1TWC H;  3E0E A;  4XTC S;  4TQU S;  1NJI C;  4DR6 Q;  1N36 Q;  2UUB L;  1GVP A;  4DV0 L;  2B29 A;  4JI5 Q;  3GO5 A;  4GKJ L;  1J5E Q;  3E9I A;  1YIJ A;  1XMQ L;  1KQS A;  3TEH B;  5GQO A;  3PO3 H;  1E1T A;  4DV4 Q;  1SMX A;  4RG1 A;  4B3R L;  1JT8 A;  2K52 A;  1XMQ Q;  1HZC A;  4JI1 Q;  3W1B A;  1M90 C;  2K5V A;  1EUJ A;  4DR5 L;  3KDF B;  3KF6 B;  3I2Z A;  3KF6 A;  5C0X J;  5DLQ E;  5AJ3 Q;  1QVF A;  3GD7 A;  3PF4 A;  2WFW A;  1KAW A;  1HZ9 A;  2PI2 A;  2RHS B;  1IBL Q;  1NMG A;  1VQ6 A;  4X64 Q;  1K8G A;  1HNZ L;  2KCM A;  1VQH A;  3FP9 A;  2AWN A;  5M3M H;  3S14 H;  4A3C G;  5IY0 A;  4KHP L;  4X64 L;  2A8V A;  2B3G A;  1CKN B;  4HJ5 A;  1FL0 A;  4DR7 L;  1YHQ A;  4DV6 Q;  1Y1W H;  3JAM c;  3HOW H;  3I4M G;  2NVT H;  4A3B G;  2JJQ A;  4C3J H;  4JI8 Q;  4A3M G;  5LMU Q;  4QJF A;  1I94 Q;  4BY1 G;  4AH6 A;  3S1R H;  1SR3 A;  3M3Y H;  4DUZ L;  1HNX Q;  1IBM Q;  2AHO B;  1J5E L;  5J3B A;  4GN4 B;  3PUW A;  1JMC A;  4POF A;  1QZG A;  4NB3 A;  4A3M H;  4IFD G;  2PQA B;  1HR0 L;  3K8A A;  1UE7 A;  3NBH B;  1VQJ A;  1IXR A;  2FXQ A;  2HQL A;  3U58 A;  4PMW A;  1YJN A;  4BXX G;  4YY3 Q;  3TRE A;  4B3T Q;  3M9B A;  1MJC A;  1EOV A;  1HH2 P;  4GN5 A;  5JJK A;  3LGJ A;  2E2I H;  4OWW B;  3PO3 G;  4DR6 L;  3RLO A;  4AYB G;  2AMC B;  2F4V L;  3OTO L;  2VZA A;  5C3E H;  5IYC H;  1MKH A;  2RF4 A;  1VQE A;  1V1Q A;  1X3F A;  5IP7 H;  5FLM G;  3J81 c;  3PUY A;  2ATW A;  1NE3 A;  4IOA A;  1NMF A;  1SLJ A;  1E1O A;  3NEN A;  3CCV A;  1QUQ B;  2IHF A;  4QL5 A;  1A62 A;  4JI4 Q;  3PF5 A;  5IE8 A;  1LM0 A;  3AFQ A;  4YWK A;  4LWC A;  3RZD H;  1WOC A;  3HOU H;  3HOY G;  3ERS X;  1WFQ A;  3KJO A;  3T1H Q;  4X62 L;  1C7Y A;  3CP0 A;  2ASB A;  2NZH A;  3A5Z B;  4JBM A;  1XNQ L;  1G6P A;  1PH9 A;  1MJE A;  1EIY B;  1S72 A;  1KIX A;  5BR8 L;  2JEB I;  4DAM A;  4AYB E;  2YV5 A;  4EX5 A;  4KI0 A;  3FHW A;  1HNZ Q;  2R92 H;  1C9O A;  1TWH H;  2I5M X;  1Q86 C;  1HNW Q;  4IOC A;  3PO2 H;  3A5U A;  3J80 c;  2ZM6 Q;  1N32 L;  1P8L A;  1E24 A;  2R93 G;  3M7N A;  2NN6 I;  2R7F A;  2WAQ E;  3J80 i;  4DV2 L;  1YIT A;  3E9H A;  4RMF A;  3ULJ A;  5IYD G;  1N36 L;  1IZ6 A;  5C4X H;  2N49 A;  4OO1 I;  4JI6 L;  3OYY A;  1EQQ A;  1P16 A;  1Q8K A;  4DV1 Q;  1VQI A;  1EQR A;  1XPO A;  2GVA A;  2UXD L;  3AYH B;  4JI5 L;  3T1Y L;  1PH8 A;  4JOI A;  3CD6 A;  4A3G H;  3T1Y Q;  1IBK Q;  4L5Q A;  4R4Q A;  1X3E A;  3RLN A;  5K36 G;  1LTL A;  1SRU A;  2Z6K A;  3Q8D A;  4JC0 A;  3TQY A;  5IYB G;  3JAM i;  1B8A A;  4DR2 L;  5FLX c;  1FVI A;  1L2F A;  1B70 B;  1N34 Q;  4A3L G;  4B3M Q;  3DLL A;  5AJ3 L;  1VCI A;  3J81 i;  2VQE Q;  4A3E H;  2AKW B;  1QUQ A;  4Y52 H;  5C4J H;  3F2C A;  3BZK A;  2A1A A;  4EQ5 A;  5IP9 G;  1X3G A;  4DK6 C;  1PFS A;  3S1M H;  3KYH C;  4P73 A;  1VQ8 A;  1VQL A;  3CC4 A;  5IT9 c;  2CCZ A;  3CCM A;  4IPD A;  3S17 H;  2N8N A;  1CKO A;  1GKH A;  3GTL H;  1X9N A;  4TVA B;  3CPW A;  1TWA H;  5IP9 H;  4PZ8 A;  5EAY A;  1Q1B A;  1IBM L;  1Y14 B;  3GTK H;  1OXS C;  4DUZ Q;  1N8R C;  3T1H L;  1U0L A;  1EIF A;  2E2H H;  4YWM A;  1BBW A;  2XGT A;  1WCM H;  3K80 C;  3NEL A;  2OCE A;  4IO9 A;  5BR8 Q;  1G29 1;  4L5T A;  3RN5 A;  4ALP A;  4XIG S;  2CWP A;  3HFZ B;  4IPH A;  4BBR G;  4A3J G;  4A3K H;  1WI5 A;  2YTV A;  4DR2 Q;  2OWO A;  3STB D;  2JA6 H;  5LMN W;  2F3I A;  4X66 L;  1KL9 A;  2JK8 A;  1FJG Q;  2YYZ A;  4JYA Q;  4DV2 Q;  5GAH C;  3H0G G;  1K83 H;  2VQF Q;  1MIU A;  3U50 C;  2Z6K C;  1EYG A;  2LXJ A;  3CCL A;  4LF5 Q;  4B3S L;  1SRO A;  3G71 A;  2B63 G;  4JI6 Q;  1Q82 C;  3S2H H;  2ID0 A;  2JA5 H;  3H3V I;  4GLA C;  2MQH A;  3PUV A;  1EWI A;  3J81 j;  2JA7 G;  4B3R Q;  2ZTD A;  4ME3 A;  3WWV A;  4DV4 L;  3UDX A;  4DAY B;  3JC6 6;  5GAE C;  3CMA A;  3FKI G;  1JB7 A;  3CCS A;  3M4Q A;  3TRZ A;  1JE5 A;  4K0K L;  1C0A A;  3KLW A;  5M5X H;  4HIO A;  3HKZ G;  4OWT B;  1YI2 A;  3A0J A;  2PQA A;  2MFI A;  4HJ7 A;  3PUX A;  3HOV H;  2UUA L;  2VQE L;  2H5X A;  2Y0S G;  4LUZ A;  5ELN A;  5C44 G;  3G48 A;  3TS0 A;  1Q46 A;  1Y1V H;  5LMN Q;  1Q81 C;  5M3F H;  3BJU A;  1UE1 A;  1E3P A;  3B6Y A;  4GN3 B;  1SFO H;  4P75 A;  3CAM A;  3CME A;  5IP7 G;  4OX9 L;  2CKZ B;  2HT1 A;  1L1O C;  3D0F A;  4GNX C;  4PZ6 A;  2OTL A;  4DR3 Q;  2PI2 E;  1SE8 A;  2AWO A;  1OTC A;  1A0I A;  4DR4 Q;  4A4I A;  4LW1 A;  1VQ9 A;  2PNH A;  3GTM H;  4DUY Q;  2JA8 G;  3CCJ A;  4R4T A;  3CF5 A;  4IFD J;  3MXN B;  4H02 A;  2E5L L;  3PUZ A;  2RCN A;  4DV7 Q;  2IT1 A;  4GLX A;  2UUC L;  4JG2 A;  4JI2 Q;  3OW2 A;  4YCU A;  1PH4 A;  1GM5 A;  3GDE A;  1YJW A;  4HJA A;  1YVC A;  2VQF L;  5JEA G;  3CC7 A;  1QVG A;  4NXN Q;  3G6E A;  1YNX A;  1N33 L;  2Z0S A;  1D8L A;  4P72 A;  4UP8 A;  4GOP B;  2NVQ H;  3GTP H;  2UXB Q;  3HOX G;  1PH1 A;  1TWG H;  2YTY A;  1IL2 A;  5FJ8 H;  4DR1 Q;  3J7A 5;  3KFU A;  4A3C H;  3CW2 C;  2EXD A;  2NVY H;  2R6G A;  4BXX H;  2K5N A;  4X65 L;  4APV A;  3CC2 A;  1A8V A;  2I5L X;  5JJI A;  1BKB A;  4JBK A;  1PH7 A;  3F8T A;  1PV4 A;  1HR0 Q;  2EQS A;  1HZB A;  1I5F A;  2ZTC A;  1HZA A;  5M5Y H;  1I50 H;  3J7Z C;  4DPG A;  3CQZ H;  5M3F G;  2Q2U A;  1VQG A;  5M5W H;  5ELO A;  1JJ2 A;  4LF7 L;  3ULP A;  4DKA C;  2F52 A;  1PH3 A;  4B3S Q;  4JBJ A;  2VUM G;  3CXC A;  3ICE A;  1OXT A;  4DV0 Q;  4GKK L;  1AE3 A;  1Y1V G;  1Z47 A;  3PV0 A;  3UDG A;  4R4O A;  2UXD Q;  1CKM A;  1OXV A;  2KBN A;  2CFM A;  4DV1 L;  1S3O A;  2VUM H;  3MEF A;  1PA6 A;  2R92 G;  1XMO Q;  2JA9 A;  3K7U C;  3I4N G;  1AH9 A;  1IBK L;  1KHI A;  2PMZ E;  3KDF A;  4JOI C;  3HOZ G;  2LXK A;  3W1G A;  2R93 H;  4A3B H;  4B3T L;  4A3G G;  1JJG A;  1Y1W G;  5E7N A;  4A3I H;  3HOW G;  3W5O A;  3I4M H;  5HGQ A;  2UUA Q;  4NPS A;  1XPU A;  4PG3 A;  1IBL L;  4JI2 L;  1L1O B;  4GNX B;  1X54 A;  1L1O A;  4GNX A;  4DV3 L;  1EFW A;  1VQO A;  4A76 A;  1Q7Y C;  1RL2 A;  3H15 A;  3M4O H;  2NN6 G;  3RN2 A;  1OXX K;  1KXL A;  2QEX A;  4LF6 L;  4JV5 L;  4YHH Q;  2VL6 A;  3H0G H;  1TWF H;  3S24 A;  4LF9 Q;  1N32 Q;  2KEN A;  4OO1 G;  4A3I G;  1YHB A;  3D31 A;  3CCR A;  1UEB A;  3HKS A;  3EIV A;  3TS2 A;  2D0P A;  4A3L H;  2VNU D;  3BZC A;  3GTJ H;  3GTG H;  1D7Q A;  4LUV A;  3HKZ E;  1HJP A;  1WCM G;  2JE6 I;  1PVO A;  4MTN A;  4DR3 L;  1NBW A;  1SN8 A;  2OQ0 A;  5GAG C;  1VQD A;  1VQP A;  2VW9 A;  1CSP A;  4DUY L;  1GD7 A;  4O2D A;  3G4S A;  1K8A C;  4LFB L;  3I55 A;  2MNA A;  4UY8 C;  3ULL A;  2UXC L;  2UXC Q;  3VDY A;  4WJ3 M;  3ZJY C;  2WB1 G;  3L2P A;  4A93 H;  2HIV A;  2BA0 A;  1YHA A;  4C3I H;  1N34 L;  2JEA I;  3F2B A;  4AQY Q;  3S1Q H;  4BBR H;  4A3J H;  4R1J A;  4HJ8 A;  2F4V Q;  4HIM A;  2JA7 H;  4WJ4 A;  4JI0 L;  4NXN L;  2Y0S E;  3HOZ H;  4LF9 L;  2CWA A;  4UP9 A;  2ZJQ A;  1XTD A;  2NZO A;  3ER0 A;  4C2M H;  4LFA Q;  2E8G A;  2B63 H;  4OXP A;  5H1S E;  1I94 L;  4MNO A;  4LUO A;  1XMO L;  4DR1 L;  3I56 A;  3F1Z A;  1I3Q H;  2WB1 E;  2VY3 A;  5C3E G;  4HID A;  1LUZ A;  1CKN A;  4JI3 Q;  3S16 H;  2ZJR A;  1R9T H;  1V9P A;  4BBS G;  4A3D H;  1XNQ Q;  1CUK A;  4OON A;  4A3K G;  4POG A;  3K81 C;  3S15 H;  1XJV A;  3EN2 A;  1N9W A;  2ALY B;  1BVS A;  2I0Q A;  2E2J H;  1J6Q A;  2ZJP A;  2HIX A;  4KHP Q;  3HOY H;  4P71 A;  2BH8 A;  3I4N H;  2HHH Q;  4BA2 I;  3HOV G;  4YWL A;  5LMN L;  4MZ9 A;  2R7Z H;  1T9H A;  1VQF A;  4DV6 L;  1O7I A;  2IX0 A;  4OWX B;  4DK3 C;  1VQ7 A;  4OX9 Q;  1TXY A;  2XTI A;  2K5H A;  3FKI H;  3NEM A;  3HOX H;  1I6H H;  4A3F G;  3STB C;  4JI7 Q;  5IWA Q;  1VQM A;  2D0O A;  1S40 A;  4HIK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...