4LFCQ

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
104
structure length
104
Chain Sequence
b'PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSKRGGKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
molecule tags Ribosome
total genus 19
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4lfcQ00
4IPGA 3BZCA 4B3RQ 4YY3Q 3J80c 2PQAA 2A8VA 5C4XG 1QUQB 2A19A 2MNAA 3GDEA 3RNUA 1YI2A 3HOUG 2UXCQ 2VZAA 1OXUA 3JC66 5GROA 3HOVG 5C44G 2R7ZH 4A3BG 1FGUA 5E7NA 1RIPA 5IWAL 4DK3C 2Y0SG 5J3BA 4R4QA 1N32L 4APVA 1VQIA 2NZOA 4QQBX 1VQNA 4A3MH 4PZ6A 3PF5A 3CC4A 1YNXA 4DR3Q 4OWTB 1X55A 1PV4A 1SLJA 4DV6Q 1FVIA 3KFUA 1L1OA 4LF5Q 5M3FG 4LW1A 2B3GA 3M4OH 2ATWA 3PF4A 4A3JG 1D8LA 4FDBA 3HKSA 2NVQH 1V43A 4LWCA 4BBRH 1A63A 1E3PA 1R9TH 4A3IH 1N8RC 4DR4L 3EIVA 5IYBG 4A3DH 2YTYA 1VQGA 4QY7A 3GO5A 1N36Q 4A3CH 1EWIA 1M90C 4LF7Q 4JI6L 3HOZH 1VQ9A 2JA6H 1TXYA 5C3EH 3HFZB 3ZJYC 2K5NA 3NENA 4UP8A 1Q82C 4IJLA 1EOVA 1OXXK 1PH3A 4DKAC 2KCMA 3OW2A 1QVGA 4XIGS 4LUZA 2UXBL 5LMNQ 3J81i 2NN6I 4PMWA 4Y52H 4L5QA 4Y7NH 1OXVA 2B63G 1CKNB 3MEFA 3PGZA 3A5UA 4DV2Q 4IFDI 1E7ZA 1B8AA 1I5FA 3PUZA 3KF8B 4R4TA 5ELNA 1KL9A 3BU2A 4UP9A 4KHZA 4BA2I 1CKMA 3A5ZB 2KHIA 1VQAA 2F3IA 4L5RC 1PFSA 2AWOA 1SR3A 1IBKQ 1JB7A 2JA5G 2E2JH 2VUMH 4JI2Q 3CPWA 1C9OA 1HJPA 4O0AA 1LUZA 3CMAA 1KXLA 2PMZE 4BA1I 4DUYL 4DNIA 2JEAI 1AE3A 1X3EA 4BBSH 4KHPQ 1J5EQ 3PO2H 2F52A 2VQEL 2UUAQ 3H0GG 2JA7G 1N9WA 1JE5A 5GADC 4JI5Q 1N33L 2PQAB 3VDYA 1HR0Q 4JYAQ 1NE3A 4HIDA 5FLXc 3K0XA 4X64L 3ICEA 1SRUA 1EYGA 4LF9Q 1Q1EA 3FP9A 4BY7H 2K75A 5IE8A 3HOWG 4JG2A 5EAYA 4LFAQ 1KC8C 5IY0A 4DK6C 2AMCB 1XTDA 1KQSA 3F2BA 2ZJPA 4DV0L 1PH7A 4LF4L 3PO3G 2MFIA 4X65Q 4BXXG 5C4XH 1K8GA 5GAEC 1L1OB 3HOUH 2CFMA 4JI8Q 1OTCA 3HOVH 4A3BH 1N34Q 4X66L 5C44H 3KF6A 2PI2E 2WP8J 1GO3E 2HIXA 2LXJA 3FKIG 2GN5A 4QIWE 3CCQA 2FXQA 4NXML 1WI5A 4GLXA 4IPCA 4HJ5A 3S16H 5GAHC 2N3SA 4A3FG 2B29A 3KYHC 1NMFA 3NBHB 1YZ6A 4DAMA 3L2PA 3CMEA 5JEAG 1PH2A 1VQHA 2H5XA 1RL2A 4C3IH 5M3FH 2OTJA 4JBMA 1PYBA 5AJ3L 4A76A 1VCIA 2NVXH 3E9IA 1SMXA 4A3JH 2RHSB 1Y1VH 3GTQH 2WAQE 3OYYA 4DV4Q 2R7DA 4QGUA 1I50H 5LMUL 4JC0A 5K36G 4DV3Q 5IYBH 5IYDG 2I5HA 2JJQA 2CQOA 2EQSA 3RLFA 1W2BA 2K5HA 1XMQQ 2MQHA 3TQYA 1E1TA 1VQLA 1JJGA 3CCRA 3CCLA 2ES2A 1N36L 4P75A 5BR8L 3PIOA 2UUCL 4LF7L 4DR5L 4DR7Q 4QJFA 1EIYB 3IRBA 1L2FA 1YHBA 4DV7L 4MTNA 4B3TQ 4GKJL 4LF8Q 4A3GG 2IX1A 4OWWB 4OO1G 3CF5A 2N49A 2UUBQ 2OWOA 2HIVA 4KI0A 1FJGQ 2IHFA 1V1QA 2KCTA 2BH8A 3T1YQ 3RR5A 4JCVE 2B63H 5LMNW 3GTJH 1U5KA 4X62L 4A3LG 3I4NG 4LF6L 2BA1A 4JV5Q 1MJEA 4K0KQ 1XMOL 3H15A 1J6QA 1E1OA 4RG1A 3CCSA 4OX9L 3CQZH 5FJ8G 3TS2A 1VQFA 1X3GA 2HHHL 1YJNA 1X56A 2MO0A 3RLNA 2JA5H 1I94Q 3ULJA 1VQOA 4DR6L 3J7ZC 1Q8KA 1XNQQ 4GNXA 1L1OC 1VQ4A 4AQYQ 1BKBA 3K81C 3JAMi 1QZHA 5C0XI 4JI2L 1HNWL 2VQFQ 3RN2A 1QVCA 2Z0SA 1KD1C 1IBMQ 1H95A 3ULLA 4DAYB 4NPSA 3MXNB 3U58A 2UXDQ 5M3MG 1TWCH 4YHHQ 3M9BA 4IPHA 3H0GH 4B3SL 2JA7H 3RZOH 1QVFA 1B7YB 2E2HH 3AEVA 1CSQA 4DR1Q 4NXNL 4LUOA 4DV1Q 2ZM6Q 2KENA 2KBNA 1VS0A 3STBD 4JI4L 1NMGA 3KF6B 1HR0W 3GTMH 1VQMA 3M4QA 3S1NH 4JYAL 1NBWA 4RMFA 4DUZQ 3K7AH 1VQJA 3CPFA 1JMCA 2HQLA 1M1KC 2IT1A 3E9HA 2JK8A 4LFBQ 2BH2A 1YEZA 3HKZE 2F4VL 2XGTA 3TS0A 3PO3H 1X65A 1PH6A 2HT1A 3G48A 4TQUS 3OTOQ 3CXCA 1Q46A 1Q1BA 4BXXH 1PVOA 2NN6G 1IZ6A 1VQCA 4DV5Q 1XPOA 2JEBI 2YTXA 3S1RH 2ID0A 3G71A 4LNQA 3GTKH 5JJIA 4HJ9A 1HNXQ 4IFDG 3FKIH 1JT8A 2ZTDA 1PH8A 1IBLQ 2JA8G 4GOPA 3G6EA 3M3YH 1PH1A 1N34L 2L15A 3PUYA 1HNZQ 3F8TA 4JI3L 2KHJA 3I55A 2K52A 3UDGA 3T1HL 1XJVA 4JOIA 4GKKL 1D7QA 4IO9A 3CCVA 2WAQG 4A3FH 1Y1WG 2R93G 3BZKA 4L5TA 1PHJA 1KIXA 1Z47A 1CSPA 5JJKA 3D0FA 3E0EA 1AH9A 1HZAA 2RF4A 2VY3A 5IP9G 1FL0A 4WJ4A 2QGQA 1A8VA 3KJOA 1KAWA 2RCNA 4BY1G 1GD7A 2I0QA 1VQ8A 5IYDH 4JI0L 4DV3L 2QEXA 1YHAA 3KOJA 3GTLH 3F2CA 1IYJB 3PIPA 1XMQL 2UU9Q 1Q7YC 1G6PA 3S2HH 4A3GH 4MZ9A 3CCUA 2E5LL 3GD7A 2E8GA 3CC7A 4OWXB 3A0JA 4OXPA 1WJJA 4JI7L 2ZJQA 1QUQA 1TWFH 4DR2Q 4POGA 4HIOA 3HOXG 3H3VH 2N78A 4DR4Q 1VQDA 3U50C 4EQ5A 4A3LH 4LFCL 4GLVB 2LXKA 4R1JA 1EIFA 1SFOH 4JI6Q 4B3RL 4YY3L 5H1SE 3K8AA 1XNRQ 4A3CG 1A0IA 3M4PA 2ALYB 3G4SA 4HIKA 1EQRA 1TWGH 5FJ8H 2UXCL 2CWPA 1G291 5JEAJ 2D0OA 3PCOB 1Y14B 2OCEA 4HIMA 2E2IH 3W5OA 1TWHH 3BJUA 2AKWB 2Q2IA 3PSIA 4A3EG 4YCVA 1E22A 2UXBQ 1VQKA 1K3RA 2NZHA 1NJIC 4PZ8A 2OQ0A 1L0WA 3UDXA 3NELA 3UDFA 2EIFA 4YWKA 2Z6KA 4DR3L 1K0RA 1X3FA 4DV6L 1UE1A 1S3OA 3DM3A 3EBEA 4R4OA 5M3MH 1QZGA 2VW9A 4LF5L 1BBWA 4ALPA 1A62A 2MO1A 2R92G 3I4NH 4C2MH 1UEBA 2OQKA 2YTVA 1K83H 1PH9A 3M7NA 3ER0A 2PI2A 1CKOA 4C3HH 1XPRA 3KDFA 3HKZG 3RN5A 4IPDA 1BBUA 4DUYQ 4GOPB 1UE7A 2I5LX 2AWNA 1PH4A 1VQEA 4NB3A 4X6AH 4EX5A 5GAGC 3PUXA 4A75A 2VQEQ 3U4ZA 1WOCA 1MJCA 4GLAC 3UE1A 1Q81C 1P8LA 2CWAA 3CCMA 5LMNL 1N33Q 1KRSA 1K73C 3PO2G 4KLKA 4JI1Q 4YCUA 1OXTA 3LGJA 2GVAA 4DV2L 1JJ2A 3J80i 2JA8H 1LM0A 4GNXC 4A93G 4POFA 1PYSB 4UPAA 4YCWA 3CCJA 1IBKL 2IY5B 3KLWA 2RHQB 4DV0Q 1UWVA 1Y1WH 4LF4Q 1X9NA 1NTGA 1IL2A 1WYDA 1XPUA 3I4MG 3TREA 4DPGA 5C0XG 4X66Q 5IP9H 3PUVA 4C3JH 4AYBE 2ZJRA 4BY1H 4NXMQ 3SGIA 4KHPL 1J5EL 1MIUA 3DLLA 1VQPA 1EUJA 5IYCG 2UUAL 2GVBA 4JI5L 3TEHB 3JAMc 4P73A 4PZ7A 1HR0L 4XTCS 4B3SQ 3GTGH 1PA6A 1YVCA 5FLMG 4PG3A 3HOWH 5AJ3Q 1WCMG 3K80C 1YJWA 1SN8A 4JBKA 2UU9L 4IJHA 4HJAA 4LF9L 1HH2P 3HOXH 5LMUQ 4B3MQ 3F1ZA 4IFDJ 2D62A 1P16A 4AIMA 2Q2TA 4LFAL 3UDIA 4DR2L 4A3KG 1Y1VG 2K5VA 5JJLA 3PV0A 2JQOA 3EN2A 1ASZA 3HOYG 4GOPC 1W3SA 3J7A5 4X65L 3L7ZC 2UUCQ 1Q12A 5BR8Q 2YU9H 4HJ7A 3S15H 4JOIC 4IOCA 4JI8L 4DR5Q 4DV7Q 2AHOB 4IOAA 1XNRL 4UP7A 1YBYA 4GKJQ 3CC2A 5HGQA 5C4JH 4YWLA 3J81c 4A3EH 4GS3A 3L0OA 1NY4A 2K14A 1TWAH 4GN3B 1S72A 1B70B 4OONA 3KDFB 1X6OA 4X62Q 4P71A 4O2DA 4BY7G 1BVSA 2CCZA 5IP7G 4LF6Q 4R4CA 4HJ8A 2YV5A 1XMOQ 1HZBA 1K8AC 3UE0A 1LYLA 2XTIA 3U4VA 4OX9Q 2NVYH 5IWAQ 3I56A 1N32Q 2R92H 2HHHQ 2N8NA 2R6GA 2R7ZG 4DV4L 2ZTCA 4DR6Q 2Q2HA 1V9PA 2VNUD 1ASYA 2D0PA 2WB1G 2PNHA 2IHEA 1AE2A 2LSSA 4GN4B 4YWMA 3S24A 5M5XH 3F2DA 1HNWQ 3S2DH 4A3MG 4L5SA 3GTOH 1U0LA 1YITA 1UE5A 4DR7L 2Y0SE 4B3TL 3J81j 4LF8L 1OXSC 2C35B 2R7FA 3K7UC 3WWVA 4GNXB 5DLQE 5M5WH 3FHWA 3D31A 4LUVA 2UUBL 1MKHA 2V1CC 4BBRG 5M5YH 1EFWA 4NXNQ 3T1YL 4A3IG 4MNOA 1FJGL 1VQ5A 3RLOA 4P74A 3W1BA 3CCEA 2QA4A 4GN5A 1S40A 2K50A 3PUWA 4JI4Q 4A3DG 5ELOA 4JI1L 4JV5L 3HOZG 2JA6G 3AFQA 4JBJA 4K0KL 2JE6I 5C3EG 4A93H 2I5MX 1T9HA 1HZ9A 3CP0A 1WFQA 2A1AA 3KJPA 2DUDA 2JA9A 3M85A 1HZCA 4QL5A 1YHQA 1C7YA 1Z9FA 2F4VQ 1X54A 2Z6KC 4AYBG 3A74A 1I94L 3CD6A 1KHIA 1EQQA 1GM5A 3NEMA 1XNQL 2Q2UA 2NVTH 1E24A 3I4MH 4AQYL 3ULPA 1SE8A 1VQ7A 4WJ3M 2VQFL 4ME3A 1IBML 1IXRA 3I4OA 4A4IA 3AQQA 2UXDL 4J15A 3W1GA 4JI3Q 2OTLA 3S1QH 4YHHL 1G51A 3Q8DA 5IYCH 1LTLA 3T1HQ 4GKKQ 2BA0A 2WFWA 5GQOA 3ERSX 5HY6A 4P72A 1PH5A 1CUKA 4H02A 1YJ9A 4DR1L 3S14H 1O7IA 2VS1A 1KRTA 4DV1L 2ZM6L 2VUMG 4TVAB 5FLMH 2YYZA 1WCMH 1GKHA 3I2ZA 1CKNA 2EXDA 2ASBA 1Q86C 2WB1E 4JBWA 3S17H 1DGSA 4DUZL 1K9MC 3B6YA 1C0AA 1UE6A 4BBSG 2K4KA 4A3KH 4AH6A 3AYHB 4JI0Q 3GTPH 4B3ML 1JJCB 3HOYH 4LFBL 3CW2C 3OTOL 4UY8C 3TRZA 3AFPA 4X64Q 1SROA 3I7FA 4DV5L 3RZDH 2ZTEA 2DGYA 1I3QH 1HNXL 2E5LQ 1YIJA 1IBLL 4JI7Q 4OO1I 3CAMA 1VQBA 5C0XJ 1HNZL 1VQ6A 3STBC 5IT9c 3H3VI 3S1MH 1I6HH 2R93H 4R4IA 2VL6A 1GVPA 2CKZB 4LFCQ 2IX0A 5IP7H
chains in the Genus database with same CATH superfamily
4B3RQ 4YY3Q 1PZID 2O2LD 2VB2X 3GV6A 2MNAA 3RNUA 2CH4A 1OXUA 3HP3A 3HOVG 4A3BG 2R7ZH 5E7NA 5C5MA 4L6TB 1RIPA 4DK3C 4R4QA 1N32L 4APVA 4WORA 2BCOA 5KGUA 2NZOA 4PZ6A 3PF5A 1YNXA 2F0MA 4OWTB 4XQJA 1PV4A 4QUFA 2EE1A 1J9OA 1L1OA 4LF5Q 5M3FG 3VR5A 2HCCA 2QKIC 3M4OH 1I4HA 1FGBD 4FDBA 4H0LC 2KUMA 4BBRH 3S1QB 1JOKA 1E3PA 1A63A 4FF3A 2OXPA 2ZXOA 5IYBG 2EYPA 1EWIA 2X6LA 3HOZH 4CKEA 1TXYA 5KYIA 5C3EH 1Q82C 4RWSC 4IUTA 1EOVA 3MWYW 2KCMA 4LUZA 4UDUC 2CVRA 3J81i 1BDOA 4TSSA 5JVH3 4PMWA 4Y52H 3J7AV 1CKNB 1GHJA 3KF8B 2JA8B 2M00A 4R4TA 4BA2I 3IFTA 4F88A 1EQTA 3SE0A 1G6ZA 1CA6A 1CI3M 2P5ZX 1IBKQ 1I6HB 1EL0A 2R93B 3CPWA 2DY8A 5KEEA 3RUZA 3PIO3 1JICA 3CMAA 5FOBB 1EWHA 5CMDA 4KHPQ 1J5EQ 3FPPA 1C8CA 3FDTA 2UUAQ 2JA7G 3N6RA 3TP7A 2CW0D 3NPPA 3GTGB 5AFWA 2KCCA 3K0XA 3ICEA 1AN8A 1CHPD 3FP9A 1WTOA 5IE8A 4CJ1B 3KBGA 1STBA 4JG2A 3MXNA 1BCPC 1M8AA 1XTDA 1KQSA 1ILPA 5ISRA 3PO3G 5C4XH 1K8GA 4LK1C 1HA5A 3DWQA 3HOUH 2JA6B 1G8ZD 5FK9C 2PI2E 2RA4A 1F9PA 4NXML 2ENBA 1AW7A 1TWAB 1K3BC 4DK0A 5IGBA 4RGTA 5DAUA 2N3SA 1K8MA 4Y7NB 3NTHA 4PMBA 3QO2A 1YZ6A 4HMIA 1VQHA 1FYCA 4JBMA 5AJ3L 2NVXH 3WOFA 3GTQH 5DNFA 2R7DA 4ZRZA 3R2IA 3TP6A 2CQOA 2EYHA 1W2BA 3MXPA 4P2CB 2RDGA 3P7JA 3S2DB 4LF7L 2F0KA 3IRBA 4DV7L 5D3DA 1K0SA 2DJGC 1TY2A 3A8IE 2HIVA 3L3OC 2G5DA 2B63H 4JCVE 4A3LG 1B50A 3NTKA 1STEA 2BA1A 4LF6L 1STNA 5KNCA 5D3IB 5FJ8G 1NUCA 1CA5A 1X56A 2MO0A 3EJIA 3RLNA 2JA5H 3ULJA 1VQOA 3H6MA 1BO0A 3J7ZC 1L1OC 4TRDA 3HRZC 3H94A 3PIP3 1WTHA 1KAAA 1H95A 1QVCA 2Z0SA 1T5EA 1ZYRC 2OEOA 3U58A 2B2UA 4YHHQ 3X3MA 4FF4A 4I7ZC 3AEVA 4DR1Q 4NXNL 2ZM6Q 1VS0A 4C3HG 1NMGA 3KF6B 5IGCA 3QIAA 3GTMH 4JYAL 1SNCA 3LNNA 4DUZQ 1VQJA 4CDDC 2JK8A 1I50B 2E76C 2DNEA 2XN9C 3TS0A 1GUWA 2HT1A 1PVOA 5CV8A 4TQUS 1Q46A 1Q1BA 1IZ6A 4DV5Q 2JEBI 4K5VA 1PXUA 1SE4A 5ELCA 5M9OA 4HJ9A 3FKIH 2ZTDA 2EXZA 4K5WA 2JA8G 4GOPA 3G6EA 3M3YH 1HNZQ 1N34L 2L15A 3I55A 3ITPA 2ZT9C 3CCVA 1IYVA 2EYJA 2WAQG 2K32A 1GUGA 3BDOA 1NAPA 3EA6A 1Y1WG 2R93G 1TS4A 3SEBA 1PHJA 5JEAH 1CSPA 5JJKA 1MD2D 1NNXA 2B8FA 3A7AB 3CQZB 5K36H 5IGDA 3I70A 1IKLA 4N8X1 2F1MA 1AZPA 2MGSA 3UI2A 4DV3L 2QEXA 3KOJA 3GTLH 1DXMA 1IYJB 1XMQL 2UU9Q 2FMMA 1CFMA 1EZ8A 2WV6D 1HUMA 3S2HH 4A3GH 4MN3A 4GZYC 4JI7L 4DR2Q 1SNDA 4POGA 1TWCB 4FNFA 2R61A 4HIOA 4BBRB 3H3VH 3H0GB 3D4WA 2LXKA 4JI6Q 1EIFA 5E1FA 4EQOA 1XNRQ 3K8AA 4K8JA 4A3CG 1HTPA 1PTOH 4BWGB 1ZEQX 2ALYB 3G4SA 2CWPA 2D0OA 1Y14B 2E2IH 4DA2A 4A3EG 2UXBQ 2EYOA 4X3SA 1VQKA 1WTPA 3UDXA 1EFID 2OQ0A 1L0WA 2RQXA 2B2YC 3NELA 1O7ZA 2EIFA 4DAPA 4IURA 4OEMB 2L12A 4B9WA 1X32A 1EOTA 2R92G 2AQ1B 1HA6A 4C2MH 1F9RA 2YTVA 3ER0A 5EQ0A 3KDFA 3CRLC 1SXTA 3RN5A 5JPNC 3Q24A 4V0BA 3SXHA 1PH4A 5GAGC 1I4GA 4A75A 1I4PA 1MJCA 4GLAC 3UE1A 1Q81C 1P8LA 5ELDA 3E5SA 3I72A 1QG7A 2F0HA 5KNDA 4YIJA 4E6IA 3HZXA 2BDNA 3V2TA 1LTAD 3VA5A 4YCWA 1TWFB 2ZXPA 1BF4A 3KLWA 4LF4Q 1NTGA 1IL2A 3VA7A 1U9RA 1PFMA 1FNUA 2RDFA 2PW7A 4X66Q 1QB5D 2K33A 1SNOA 1SE2A 1TWGB 4AYBE 5COYA 2Y0SB 2FFKB 5C6AA 2ZJRA 2PMZB 3A7LA 2NTTA 1EU3A 2Q8RE 3D3RA 2GVBA 3TEHB 4HSVA 1QCBD 1M4VA 2HUGA 1STGA 4B3SQ 5JPMC 5FLMG 1JCKB 1F77A 2F0WA 2Q8TA 2NVXB 3K80C 1SN8A 1I4RA 5E3FA 4IJHA 4HJAA 5M3MB 3HOXH 3NBIA 4AIMA 3BG3A 3OPOA 4LFAL 1QNKA 1ASZA 1R4PB 5D14A 4GOPC 4X65L 1Q12A 5BR8Q 4HJ7A 2XRSD 4JI8L 1HFGA 1ICFB 1DOLA 3L0OA 1NY4A 1KNEA 4QIWB 1DZ1A 3WDNA 4CDEC 4P71A 1BVSA 2EVBA 5L37A 1MSGA 4QB4A 1TR5A 5TSSA 1HHVA 1WTXA 4G7OC 4F8MA 3I73A 1FNVA 2N8NA 2RSNA 2R7ZG 4DR6Q 4JK1C 3MA2B 1V9PA 2SDFA 2PNHA 1MI2A 3F2DA 2TSSA 1HNWQ 1NCVA 4KY6A 1LT5D 5CBAE 2K5DA 3ZYYX 2JYOA 1NSNS 3OOCA 4B3TL 1OXSC 3K7UC 4Q0FA 3WOEA 1A3TA 4C3JB 5DLQE 3P75A 4LUVA 4K6DA 4BBRG 1RF2D 5EBCA 3R2TA 4GN5A 3GQBA 1F2YA 3HEJA 4JV5L 3HOZG 2DN8A 5C3EG 4A93H 1HZ9A 3CP0A 4HTHA 4K14A 2DUDA 2JA9A 2RCFA 3J80E 1HZCA 2PQEA 4QL5A 3CD6A 4N9TA 1H9SA 2SNMA 4X3UA 2M2LA 3A54A 1RDPD 4RHRA 5C0XH 1VQ7A 2YU9B 3FKIB 1ML0D 4A4IA 3S15B 3W1GA 4JI3Q 1W6KA 3S1QH 4KTAA 1ENFA 1G51A 2B2TA 3Q8DA 3T1HQ 1S5BD 4FYDA 1VDZA 3ND8A 5T1GA 1YJ9A 3U9OA 1BCPD 2YYZA 2K5QA 3OSOA 4CKCA 1ICWA 4JBWA 1LABA 2B39A 1KDCA 2NVYB 1C0AA 3VYSA 4JI0Q 4B3ML 3HOYH 1F2MA 1EU4A 2FINB 3GTLB 4UY8C 3RD4A 1L0YB 3I7FA 2RDHA 2J7ZA 4A3GB 3S2HB 3GTOB 1HNXL 3T53B 3BZDB 1I6HH 1PRTD 5IT9c 3H3VI 4QUCA 2R93H 2F0OA 2F03A 1BXTA 4LFCQ 2IX0A 4WJWA 2QW7A 5IP7H 5M5YB 4IPGA 3G6JB 4ULLA 3MXUA 1PTOB 1R4QB 4ZYSA 5C4XG 3HOUG 2VZAA 1JWSD 2E75C 2E2IB 3OW7A 2Y0SG 1VQIA 3IAYA 2FHTA 2L5TA 2LMCB 3O13A 4A3MH 2HDLA 3CC4A 2H4OA 1DYQA 2MPMA 4NP5A 4DV6Q 1FVIA 4KN7C 1SYFA 4IALA 1D8LA 4H7BA 5FLXE 2D5DA 2PCFB 2EOTA 4A3CH 4A3DH 4QY7A 1VQGA 2JA6H 3ND9A 3NENA 1WCMB 1OXXK 4XQNA 1QVGA 3S17B 4KD4A 1ZYRD 5LMNQ 1IHZA 3GTPB 4Y7NH 3R93A 4XYOA 2B63G 1Q90A 4S3SA 1PLFA 1Y8NB 1I5FA 2GA4B 3PUZA 5ELNA 1KL9A 3BU2A 1CKMA 3A5ZB 2KHIA 2AWOA 3C2PA 3MEHA 1EY0A 2JA5G 4JI2Q 1Y69U 4O0AA 1JWUD 1LTGD 2EJMA 5C4ZA 1KXLA 1STHA 4BBSH 1AE3A 1X3EA 4JVZA 1EWCA 1X3PA 1GHKA 3TN2A 1N9WA 5GADC 2QDBA 3W2DA 4JI5Q 1N33L 2PQAB 1HR0Q 2XNAC 1SJED 4X64L 1SYGA 1IL8A 1EYGA 3HOXB 1Z6HA 1ZXTA 5EAYA 1KC8C 5IY0A 5HGTA 2LS01 3M7GA 3F2BA 2X6GA 4RKLA 2MFIA 2KA7A 2B2TC 5A2QL 5DM63 3K5MA 1K8OA 4ABNA 2WP8J 4RH6A 3FKIG 1NR4A 5JJZA 4Z9CB 3SK8A 4GLXA 4HJ5A 3SVMA 4CBVA 1U4LA 2B29A 5JEAG 4ILWA 1PYBA 4A76A 4KN4C 3E9IA 4K2KA 4A3JH 2WAQE 2AUKA 4XT3B 4QGUA 1I50H 4JC0A 5K36G 1EIGA 2JJQA 1BOSA 3RLFA 3HKZB 3TQYA 2EJGC 4ZUJA 2QEJC 3CCLA 4P75A 2UUCL 4DR5L 1L2FA 4A3GG 4K2LA 3CF5A 4L8JA 3MVVA 5LL6X 2OT2A 4KI0A 1A15A 2IHFA 3PO2B 2X69A 1AEXA 2KOLA 1ZKOA 4KY7A 1JOQA 4X62L 1GXDC 2XRQD 1MJEA 4A93B 3H15A 1E1OA 4OX9L 4EQNA 3CQZH 2HHHL 1YJNA 3TBIB 1Q8KA 1II3A 1XNQQ 2XWBB 2A69C 1BKBA 3K81C 3JAMi 5C0XI 2QCPX 1IBMQ 4DAYB 4QF4A 1TWCH 3NQTA 3M9BA 3RZOH 3H0GH 1B7YB 1CSQA 3S16B 2AUJD 1GUOA 1KDAA 1LT4D 4JI4L 3STBD 3M4QA 5KNBA 1EY9A 1Q8IA 4C3IB 4RMFA 3VR3A 2ICIA 2HQLA 1M1KC 3E9HA 4OELB 1Y1VB 3DMUA 1SJHD 4LFBQ 3HOYB 2F4VL 2XGTA 1X65A 3G48A 3OTOQ 5J22A 1VQCA 1CHQD 3I8ZA 3J81L 1TIID 1IBLQ 2Q8IB 1D7QA 4IO9A 2F0IA 3A56A 5BN3A 4XT1B 3K5OA 1Z47A 3H09A 3TMEA 2L0CA 1AH9A 3E0EA 1BQQT 4DXGA 3DEPA 3KJOA 1KAWA 1LTID 3HGBA 1GD7A 5IYDH 4M8AA 1KDBA 1V1PA 1Z7TA 3P20A 1YHAA 4A3MB 3F2CA 3I90A 3V96A 1V1OA 1G91A 4FXKC 5C5LA 4MZ9A 2E5LL 1GUNA 2E8GA 3GD7A 4OXPA 2KEDA 2NZ1D 2ZJQA 1SNQA 1TWFH 3HOXG 4EQ5A 2E2HB 4A3DB 4R1JA 5EKIA 1RTOA 5IT9E 2EZVA 1TWGH 2UXCL 5JEAJ 1TWHH 2RBMA 2AKWB 4DNRB 5T1IA 1CQVA 1K3RA 4PZ8A 1B4OA 1TKWB 1PRTC 4YWKA 3QOJA 5EBDA 4DR3L 3S1RB 1DOKA 1DD2A 1UE1A 2B2YA 5M3MH 1QZGA 4HR7B 3H91A 4JPBW 5BN5A 2MHVA 1TS3A 3M7NA 5C3XA 2KQ3A 3OHXC 1XX8A 4A3FB 4RGOS 3HKZG 4IPDA 1BBUA 1EQVA 2AWNA 4NB3A 4BBSB 3PUXA 3C46A 1WOCA 3PO2G 4DV2L 4IFDH 3J80i 2D9UA 1O7YA 4A93G 4OHJA 3BS1A 5IOCA 5CV9A 3CCJA 2MP1A 3CU7A 4J1MA 4HCEA 3NXWA 2NWGA 4N8FA 3MAQA 2CHBD 2L4NA 1SFOB 5C0XG 1TY0A 2PZTA 5IP9H 4C3JH 2EY5A 4KJNA 4NXMQ 3SGIA 5EKLA 4IUPA 4B9XA 1EUJA 1HFNA 3D4RA 2RKSA 1S5FD 2HDMA 4PG3A 5AJ3Q 4JBKA 2UU9L 2HCIA 4LF9L 4A3JB 1EYDA 4RCOA 4DR2L 1Y1VG 2JQOA 3EN2A 2B2WA 3DUZA 3HOYG 4CJ2C 1W3SA 2YU9H 3S15H 3D6WA 4IOCA 5IGGA 4DV7Q 3MFYA 1XNRL 1YBYA 1XYIA 1PMRA 4OONA 4K6LA 5CV7A 4F87A 2CCZA 5KRUA 5IP7G 4LF6Q 4R4CA 3A8KE 2YV5A 4KV6A 4TKOB 1HZBA 1K8AC 3UE0A 1HQRD 2F3WA 2NVYH 4O1NA 3SK5A 5IWAQ 1RD9D 3H3VC 1LTSD 1LTTD 2R6GA 4DV4L 4KMUC 2F0DA 2Q2HA 4QMGA 5EGTA 1DJRD 1DONA 1J8IA 1SYBA 1PTOC 2K04A 3BDCA 4A3MG 4L5SA 2EPBA 1YNNC 3GTOH 5DM73 1UE5A 4DR7L 2Y0SE 4LF8L 2R7FA 3RZOB 1VMCA 2XWJB 3D31A 2UUBL 1FJGL 5M5YH 4NXNQ 4X3KA 3T1YL 1B9NA 2E2DC 2QA4A 3CCEA 1S40A 4A3DG 1DM0B 4RKBA 2JA6G 4K0KL 2JE6I 1CTMA 1T9HA 2PZWA 3M85A 1I94L 4B08A 2K28A 5G3LD 2Q2UA 3LWEA 4AQYL 3KBXA 5ELEA 1A2UA 2Z8LA 4ME3A 2VQFL 3I4OA 3KK7A 3K6OA 2SNSA 4J15A 2UXDL 2OTLA 4WRDA 1EYAA 1LTLA 2WFWA 1PH5A 3K0YA 1O7IA 3SK6A 4DV1L 1UAPA 3D8GA 4IQZA 2V4DA 5ELFA 1WCMH 3I2ZA 1VF7A 1CKNA 1Q86C 4H44C 1SBBB 2WB1E 5J1ZA 4CDFC 3S17H 1DGSA 1F9QA 3KF8A 1K9MC 1A6XA 1GOZA 4BBSG 2K4KA 4A3KH 3GTPH 3CW2C 3D4DA 1DOMA 3TRZA 1SROA 3RZDH 2QILA 5FKAC 2F0VA 4JI7Q 1Y8OB 5C0XJ 3STBC 1C4QA 2RVLA 3MXGA 3I4NB 3BZCA 4EVOA 1VF5C 1QUQB 2A19A 2A6EC 3GDEA 1FGUA 4XQQA 2A68C 1TWHB 4R8IA 4J8QA 4RAUC 5J3BA 2NBFA 3NP8A 3FRPB 1EEID 4IUQA 1VQNA 2IL8A 3EQLC 3I4MB 1MSHA 1SLJA 3KFUA 4LW1A 2B2WC 1BCPF 2B3GA 5C3WA 3F2UA 3NWSA 4A3JG 3PF4A 1V43A 4LWCA 1RCVD 4DR4L 1Q3LA 2YTYA 1N36Q 3QG1A 1M90C 1VQ9A 1U4PA 3HFZB 3ZJYC 2K5NA 4NKLA 2A69D 1SNPA 1QOHA 4DKAC 3J7YW 4WFN3 1KABA 1EIHA 1TU2B 2EY6A 1WD0A 2IPKD 3A5UA 4IFDI 4RGNA 1E7ZA 5IGFA 1PZJD 3KUPA 2F0EA 4UP9A 1I3QB 4XXEA 1SYEA 5I9PA 2F3IA 4L5RC 4NMZA 1SR3A 3S1MB 1RHPA 4FXGC 5K5PA 4BY7B 5CV4A 1WTVA 1C9OA 1LUZA 4DUYL 4BA1I 2WACA 3P1HA 2F0TA 2LFNA 4FP5D 2JEAI 1H9KA 3PO2H 2VQEL 2EYMA 3H0GG 1JE5A 2Z1CA 3VDYA 3TDQA 1E2ZA 1NE3A 3T56B 4ZQ3A 1JQYD 3FPUB 1Q1EA 3K57A 2A73B 4KJOA 1FD7D 2J0TD 4LFAQ 1F2LA 2NVQB 4DK6C 2AMCB 4CJ0B 4JW0A 4DV0L 1PH7A 5EPJA 1R9TB 4X65Q 4ME5A 5GAEC 1L1OB 3NE5B 2CFMA 4JI8Q 1OTCA 3QR8A 1YNJC 3URYA 3KF6A 5C44H 1AZQA 1D1IA 1GO3E 2HIXA 2LXJA 2GN5A 3OMCA 1JR0D 4ZCKA 3S16H 4AYBB 5GAHC 2QDLA 2F0GA 3NBHB 4DAMA 3CMEA 2H5XA 4FXDA 1RL2A 4C3IH 2OTJA 1SMXA 2RHSB 1Y1VH 3CHBD 1RKNA 3OWEB 3OYYA 5LMUL 5IYDG 2G9DA 2I5HA 3IL8A 1JJGA 2E2JB 1E1TA 2VXWA 3Q6SA 1I6VC 5E4XA 1SYDA 1EIYB 2K01A 2K7VA 4MTNA 4B3TQ 4GKJL 1D5MC 1XXGA 2IX1A 2OWOA 1V1QA 2KCTA 3U9SA 3RR5A 1U5KA 1HTLD 3I4NG 3QWNA 4JV5Q 1XMOL 1J6QA 1MGSA 5LL6S 2K1BA 1VQFA 1X3GA 2Z4IA 5IGEA 3I91A 2O4XA 1QZHA 4JI2L 3RN2A 1KD1C 3ULLA 4NPSA 3MXNB 3HOVB 4A3BB 5M3MG 1H9RA 1EY7A 4ZLTF 1WTRA 2HQEA 2E2HH 1IKMA 1CT1D 1KTKA 1XWEA 1EEFD 1SMYD 3AU7A 3Q23A 5EKKA 3N52A 3KLSA 2EJFC 1D6EC 1SE3A 1HQMC 1NBWA 5M3FB 1IYUA 3CPFA 1JMCA 4A3KB 3LX0A 4G4KA 4OIKA 2BH2A 3HKZE 3IFDA 1PH6A 4BXXH 2CH4W 2A6HC 5JVG3 3RZDB 2YTXA 3S1RH 1XPOA 5E4WC 3GTKH 4BS9A 3Q0AA 4FO2A 5JOBA 1HNXQ 1OO9B 4IFDG 2I46A 3QJYA 4RGMA 1ESFA 1B1ZA 3X3NA 1PH1A 3PUYA 1H9JA 3F8TA 1QWYA 2KHJA 2HD3A 2K52A 3UDGA 4JOIA 4GKKL 1JE4A 4A3FH 3BZKA 3GTJB 4J6HA 1JOOA 1BR9A 5CC4A 5IP9G 4C3JG 4WJ4A 1LO5D 2QGQA 1A8VA 2RCNA 1VQ8A 2SEBD 3T13A 1CZGA 3VYRA 1Q7YC 5JAVA 1EY6A 3ONAB 2BE5C 3NQIA 3AB9A 4OO1H 3A0JA 1WJJA 1QUQA 1IW7C 2EYFA 2JA7B 2EDGA 1CQFA 1SFOH 4B3RL 4YY3L 5H1SE 3OIQA 1A0IA 3M4PA 3S1NB 1PTOD 3PCOB 1YNND 1MHWC 4HIMA 1E2VA 3PSIA 2F0FA 4DFAA 1E22A 2L55A 1KLUD 1GUSA 2NZHA 1NJIC 2MUYA 4PV1C 3UDFA 1LT6D 4U673 1S5CD 2B2VA 3DM3A 3EBEA 4LF5L 3HG9A 4G7ZC 4ALPA 2MO1A 2A74C 5KYLA 1UEBA 3KLSX 1PH9A 1K83H 2Z6BA 1CKOA 1LLRD 3SHLA 1XPRA 1B3QA 2F0LA 4GOPB 3QB3A 2I5LX 3SR1A 3HS0C 4X3TA 1VQEA 4X6AH 4EX5A 1FR3A 4DGZA 4MTKA 2EY1A 1O7LA 2CWAA 3CCMA 1N33Q 2NN6H 1K73C 4JI1Q 4YCUA 1OXTA 1CM9A 4EGVA 4EQPA 1E2WA 1JJ2A 2C5CA 3I4LA 1D1KA 1PFBA 1PYSB 2H1EA 1EZ6A 2AQ2B 3OMGA 1IBKL 2RHQB 1UWVA 3FMCA 1QE6A 1STAA 1WYDA 1EY4A 1ESRA 1HXYD 1VMPA 3TREA 3L9AX 2WINB 5C44B 3JAML 1ILQA 1JWMD 5D65A 1RTNA 4BY1H 4KHPL 3NTIA 1J5EL 1MIUA 2A5HA 2UUAL 1QILA 4RFBA 3JAMc 4P73A 4F7XA 1EY8A 5FO8B 4XTCS 1LACA 2F0SA 2WKCA 5KIXA 1WCMG 3D6CA 4IFDJ 1QNUA 2A6ED 3F1ZA 1P16A 2Q2TA 3UDIA 4A3KG 2K5VA 2N88A 5JJLA 2A68D 2EYLA 3J7AF 2NYZD 3DWAA 4C3HB 2UUCQ 4DAVA 4JOIC 4DR5Q 4UP7A 2F3VA 3CC2A 5C4JH 3EROA 4YWLA 3NBHA 3J81c 4GS3A 3NUCA 4KKTA 2KVMA 1S72A 2ZXRA 3KDFB 1X6OA 4X62Q 4HJ8A 2F4IA 1L0XB 1SYCA 3CKIB 4Q5VA 1LYLA 2XTIA 4OX9Q 1B9MA 5CBEE 5CV5A 3I56A 1N32Q 3LWUA 2HHHQ 1ENAA 1LTBD 2ZTCA 3C1FA 2VNUD 4ZUIA 2WAQB 4PNYA 1Y1WB 3S24A 1AE2A 2LSSA 5I9OA 5M5XH 4HSPA 2BOSA 3E0JA 1WTWA 1X3QA 4GNXB 3WWVA 5M5WH 1HUNA 1MKHA 2F0JA 2V1CC 4ZKCB 3I4NH 4P74A 2XVSA 4JI4Q 2K50A 3PUWA 3OIPA 4JBJA 4ZK9B 2I5MX 3HOWB 1B53A 3KJPA 1AP0A 3VR4A 2JXMB 1C7YA 1UNSA 1Z9FA 3RMHA 1X54A 2F4VQ 2B2VC 1KHIA 1S4ZA 2NB0A 3NEMA 2NVTH 5I4DA 1E24A 3I4MH 3E6ZX 3ULPA 3GTKB 3ERQA 3AQQA 4HN7A 4K5XA 1GJXA 4YHHL 1CZWA 5IYCH 4A3EB 2BA0A 4C56C 2PNRC 2KHSA 2F0QA 4DR1L 1KRTA 2L9HA 2VS1A 2ZM6L 3DEOA 4TVAB 1WVLA 4U68A 1GKHA 5J39A 4DUZL 3B6YA 1UE6A 1YNJD 2R92B 2JSOA 4HMJA 4XDXA 4DK1A 1I4QA 3VR2A 3AFPA 4HCSA 1A2TA 3BVZA 4DV5L 3G7LA 1I3QH 2E5LQ 4DXFA 4OO1I 2DY7A 1SMYC 1VQBA 5NUCA 3J80L 1HNZL 3S1MH 4LAAA 5CV6A 2VL6A 4FVMA 2CKZB 4BY7H 5ELBA 3J80c 1G2SA 2PQAA 2A8VA 3EVQA 4KKUA 1YI2A 2UXCQ 1BUVT 3JC66 4I7AA 5G3LF 5GROA 5IIFA 5C44G 5IWAL 1HCZA 5HURA 1RJTA 2K6AA 4QQBX 4OGQC 3A8JE 3GP7A 4DR3Q 3AMUA 1X55A 2IWHA 4OL7A 4C3IG 3V05A 1D5ZC 2ATWA 2NVQH 1H9SB 3HKSA 1R9TH 4A3IH 4O42A 1N8RC 1K83B 3EIVA 2PZUA 4CDCC 2CQAA 5CYUA 3GO5A 4LF7Q 4JI6L 3S14B 4KK7A 2M9VA 4UP8A 1D2BA 4IJLA 1JC7A 4DF7A 1ET9A 3CRKC 3NHHA 1PH3A 5DEHA 3OW2A 2FJ2A 4RA8A 2PYKA 3TP5A 4XIGS 2UXBL 2ICEC 2TMPA 4H13C 2NN6I 1JB3A 1KNAA 1OXVA 4L5QA 2Z9HA 4LJZC 1Y8PB 3MEFA 3PGZA 3FEWX 4DV2Q 3BYTB 1B8AA 5CGKA 5A2QE 1SAPA 4CGYB 4KHVA 2KCNA 4KHZA 3PQIA 3R3OA 1VQAA 1G2TA 1PFSA 1JB7A 3NSWA 4KKSA 2E2JH 2VUMH 3BVMA 1AFPA 1HJPA 2B8GA 1SDFA 2A6HD 2PMZE 3K59A 4DNIA 4BY1B 2R7ZB 2F52A 5FLXL 5I6WA 3Q22A 4JYAQ 4XYQA 4HIDA 5FLXc 1SRUA 4DN4M 4LF9Q 4DAYA 2K75A 3HOWG 3M4OB 3DWPA 2ZJPA 1FNWA 3S9WA 4LF4L 4PMCA 4BXXG 3NK9A 3HOZB 3A55A 5C3EB 4IZ8A 1HPCA 4G57A 4X66L 1N34Q 3HOVH 5C4JB 4QIWE 3CCQA 2FXQA 1WI5A 2L1BA 4IPCA 2BE5D 3MTSA 3T4AC 2VB3X 4RCNA 2IW3A 2IJ0A 1IW7D 1JORA 4A3FG 3KYHC 1NMFA 1RODA 3L2PA 1LT3D 1PH2A 4B3SL 1PDQA 5M3FH 3TZDA 2JN4A 1VCIA 1U4MA 3JAME 4DV4Q 4M1UB 4DV3Q 2F0UA 5IYBH 2XIWA 1E0BA 2EQSA 2K5HA 5M5XB 2MQHA 5LHY1 1XMQQ 1VQLA 3CCRA 4ID6A 2ES2A 1N36L 5BR8L 4DU9A 2G9HD 1F9SA 3PIOA 4DR7Q 4QJFA 1YHBA 4LF8Q 4OWWB 4FF2A 4OO1G 5M5WB 2N49A 3MC0B 2UUBQ 1NR2A 3R8BA 1FJGQ 4CKBA 3BVGA 2D2CC 2BH8A 3T1YQ 5LMNW 3GTJH 3J81E 4K0KQ 5EPKA 5FO7B 3CCSA 1W6JA 4RG1A 1GUTA 1EY5A 3TS2A 3VYTA 3TP8A 4DR6L 1I94Q 4GNXA 2NVTB 1VQ4A 4AQYQ 2E74C 1ET6A 1HNWL 2VQFQ 2B2UC 5C4XB 3HOUB 3TSSA 2UXDQ 3PMFA 1QJOA 4IPHA 2JA7H 1QVFA 1BCPB 4PQXA 3NWTA 4LUOA 4DV1Q 2KENA 4UAIA 2KBNA 2NUCA 1H9MA 1HR0W 3K58A 1VQMA 2SOBA 3S1NH 1K28A 4MIUA 3K7AH 2IT1A 3GTQB 2O5JC 1YEZA 3PO3H 3CXCA 1PRTF 2RSOA 2Z4HA 2NN6G 2R3ZA 2ID0A 1PZKD 3G71A 4LNQA 5JJIA 1JT8A 2LY7A 1PH8A 1PRTB 2FMCA 2XSCA 4OIJA 4JI3L 2CW0C 3T1HL 1XJVA 3C1EA 4L5TA 2B63B 2J4XA 1KIXA 4CHTB 4C1NK 2PW5A 1B3AA 2F0PA 3D0FA 1CK1A 1HZAA 1C48A 2RF4A 4R8NA 1ONLA 2VY3A 3OWFA 1FL0A 1U4RA 5IODA 4BY1G 2I0QA 2WB1B 5I2XA 4JI0L 1DCZA 1V8QA 4RHSA 2JA5B 2WKDA 1A3VA 3PIPA 1G6PA 3CCUA 2F0NA 3CC7A 2BDOA 5EPLA 4OWXB 3BYYB 1UUPA 2N78A 4DR4Q 5CR3A 4A3IB 1VQDA 3U50C 4A3LH 4LFCL 4GLVB 2AQ3B 1BBXC 4HIKA 1EQRA 1PYWD 5FJ8H 3GTMB 2QF7A 1G291 3E3XA 2OCEA 4NW2A 3BDLA 3SK4A 4G7HC 1LTRD 3W5OA 3BJUA 2Q2IA 4YCVA 3T16A 1T5XD 3GV3A 2Z6KA 1K0RA 1X3FA 4DV6L 1S3OA 4R4OA 2VW9A 1TVXA 1BBWA 1A62A 3M3YB 2IX3A 2OQKA 2VUMB 2PI2A 5F2DA 4C3HH 5I6YA 5A35A 4DUYQ 3TZUA 4QCLA 1UE7A 1BNZA 4ZAIA 2VQEQ 2DJFC 3U4ZA 4MHEA 1B2TA 5LMNL 1KRSA 2LKVA 1O80A 4KLKA 2I07B 2NTSA 3LGJA 3KLRA 2GVAA 4HEDA 5IT9L 2JA8H 4NDXA 1ENCA 1LM0A 4GNXC 4POFA 1V1PB 4UPAA 2L11A 4L63B 2IY5B 1WD1A 4DV0Q 1Y1WH 1PTOF 1TT2A 1X9NA 2N55A 1SEBD 1XPUA 3I4MG 2OF1A 4DPGA 3PUVA 1F2ZA 2MJ8A 3DM1A 2DNCA 3MZ5A 5EJWA 3DLLA 1VQPA 5IYCG 4JI5L 1O78A 1SNMA 4PZ7A 3I3CA 1HR0L 3GTGH 1PA6A 1UEAB 1YVCA 4C1NI 3HOWH 3IKJA 3DHQA 1YJWA 1A3UA 1HH2P 5LMUQ 4B3MQ 2D62A 3K5NA 3K5LA 3PV0A 4HAEA 4C2MB 1S5DD 3J7A5 3L7ZC 1PFNA 4IOAA 2AHOB 4GKJQ 4DNTB 4KY5A 5HGQA 4K8IA 1TS5A 4A3EH 2K14A 1TWAH 4GN3B 1B70B 2O5IC 4O2DA 4IUUA 4BY7G 3QOLA 2K03A 1XMOQ 3SDZA 2KEEA 3U4VA 3DXJC 1SSOA 2R92H 1ASYA 2D0PA 2WB1G 2IHEA 4GN4B 4YWMA 1LV9A 2K05A 3S2DH 1U0LA 2KJXA 1YITA 1EYCA 5BN4A 3J81j 4N9PA 2C35B 1KLGD 3FHWA 4IUNA 1STYA 5CORA 1EFWA 4A3IG 4MNOA 1VQ5A 3RLOA 1I4XA 4R9WA 3W1BA 4IUVA 2K5WA 5ELOA 4JI1L 3C3LA 3AFQA 4KD3A 1WFQA 2A1AA 2WIIB 3K7AB 1S5ED 1YHQA 1MBYA 2Z6KC 4AYBG 3A74A 3T51B 3PO3B 3FVQA 1B44D 1EQQA 2KECA 1GM5A 1XNQL 1SE8A 4WJ3M 3W3AA 1IBML 1IXRA 4I65A 1TS2A 3EFXD 4FF1A 4GKKQ 5GQOA 5HY6A 3ERSX 3M4YA 3MHBA 4ODGA 4P72A 1CUKA 4H02A 4ZKBB 1TQOA 3S14H 2VUMG 1XTCD 5FO9B 5FLMH 4IN3A 2ASBA 2EXDA 2PO4A 2JP1A 2EY2A 1WTQA 5C4HA 4AH6A 3VR6A 3AYHB 4LFBL 1JJCB 4UHVA 1HRJA 3VYUA 3OTOL 4X64Q 4LMQD 2ZTEA 1D5XC 2DGYA 2PPBC 1YIJA 1IBLL 2C9OA 4A3BH 3CAMA 1VQ6A 4V190 3MFGA 4R4IA 1GVPA 5I2YA
chains in the Genus database with same CATH topology
4IPGA 3BZCA 4B3RQ 4YY3Q 3J80c 2PQAA 2A8VA 5C4XG 1QUQB 2A19A 2MNAA 3GDEA 3RNUA 1YI2A 3HOUG 2UXCQ 2VZAA 1OXUA 3JC66 5GROA 3HOVG 5C44G 2R7ZH 4A3BG 1FGUA 5E7NA 1RIPA 5IWAL 4DK3C 2Y0SG 5J3BA 4R4QA 1N32L 4APVA 1VQIA 2NZOA 4QQBX 1VQNA 4A3MH 4PZ6A 3PF5A 3CC4A 1YNXA 4DR3Q 4OWTB 1X55A 1PV4A 1SLJA 4DV6Q 1FVIA 3KFUA 1L1OA 4LF5Q 5M3FG 4LW1A 2B3GA 3M4OH 2ATWA 3PF4A 4A3JG 1D8LA 4FDBA 3HKSA 2NVQH 1V43A 4LWCA 4BBRH 1A63A 1E3PA 1R9TH 4A3IH 1N8RC 4DR4L 3EIVA 5IYBG 4A3DH 2YTYA 1VQGA 4QY7A 3GO5A 1N36Q 4A3CH 1EWIA 1M90C 4LF7Q 4JI6L 3HOZH 1VQ9A 2JA6H 1TXYA 5C3EH 3HFZB 3ZJYC 2K5NA 3NENA 4UP8A 1Q82C 4IJLA 1EOVA 1OXXK 1PH3A 4DKAC 2KCMA 3OW2A 1QVGA 4XIGS 4LUZA 2UXBL 5LMNQ 3J81i 2NN6I 4PMWA 4Y52H 4L5QA 4Y7NH 1OXVA 2B63G 1CKNB 3MEFA 3PGZA 3A5UA 4DV2Q 4IFDI 1E7ZA 1B8AA 1I5FA 3PUZA 3KF8B 4R4TA 5ELNA 1KL9A 3BU2A 4UP9A 4KHZA 4BA2I 1CKMA 3A5ZB 2KHIA 1VQAA 2F3IA 4L5RC 1PFSA 2AWOA 1SR3A 1IBKQ 1JB7A 2JA5G 2E2JH 2VUMH 4JI2Q 3CPWA 1C9OA 1HJPA 4O0AA 1LUZA 3CMAA 1KXLA 2PMZE 4BA1I 4DUYL 4DNIA 2JEAI 1AE3A 1X3EA 4BBSH 4KHPQ 1J5EQ 3PO2H 2F52A 2VQEL 2UUAQ 3H0GG 2JA7G 1N9WA 1JE5A 5GADC 4JI5Q 1N33L 2PQAB 3VDYA 1HR0Q 4JYAQ 1NE3A 4HIDA 5FLXc 3K0XA 4X64L 3ICEA 1SRUA 1EYGA 4LF9Q 1Q1EA 3FP9A 4BY7H 2K75A 5IE8A 3HOWG 4JG2A 5EAYA 4LFAQ 1KC8C 5IY0A 4DK6C 2AMCB 1XTDA 1KQSA 3F2BA 2ZJPA 4DV0L 1PH7A 4LF4L 3PO3G 2MFIA 4X65Q 4BXXG 5C4XH 1K8GA 5GAEC 1L1OB 3HOUH 2CFMA 4JI8Q 1OTCA 3HOVH 4A3BH 1N34Q 4X66L 5C44H 3KF6A 2PI2E 2WP8J 1GO3E 2HIXA 2LXJA 3FKIG 2GN5A 4QIWE 3CCQA 2FXQA 4NXML 1WI5A 4GLXA 4IPCA 4HJ5A 3S16H 5GAHC 2N3SA 4A3FG 2B29A 3KYHC 1NMFA 3NBHB 1YZ6A 4DAMA 3L2PA 3CMEA 5JEAG 1PH2A 1VQHA 2H5XA 1RL2A 4C3IH 5M3FH 2OTJA 4JBMA 1PYBA 5AJ3L 4A76A 1VCIA 2NVXH 3E9IA 1SMXA 4A3JH 2RHSB 1Y1VH 3GTQH 2WAQE 3OYYA 4DV4Q 2R7DA 4QGUA 1I50H 5LMUL 4JC0A 5K36G 4DV3Q 5IYBH 5IYDG 2I5HA 2JJQA 2CQOA 2EQSA 3RLFA 1W2BA 2K5HA 1XMQQ 2MQHA 3TQYA 1E1TA 1VQLA 1JJGA 3CCRA 3CCLA 2ES2A 1N36L 4P75A 5BR8L 3PIOA 2UUCL 4LF7L 4DR5L 4DR7Q 4QJFA 1EIYB 3IRBA 1L2FA 1YHBA 4DV7L 4MTNA 4B3TQ 4GKJL 4LF8Q 4A3GG 2IX1A 4OWWB 4OO1G 3CF5A 2N49A 2UUBQ 2OWOA 2HIVA 4KI0A 1FJGQ 2IHFA 1V1QA 2KCTA 2BH8A 3T1YQ 3RR5A 4JCVE 2B63H 5LMNW 3GTJH 1U5KA 4X62L 4A3LG 3I4NG 4LF6L 2BA1A 4JV5Q 1MJEA 4K0KQ 1XMOL 3H15A 1J6QA 1E1OA 4RG1A 3CCSA 4OX9L 3CQZH 5FJ8G 3TS2A 1VQFA 1X3GA 2HHHL 1YJNA 1X56A 2MO0A 3RLNA 2JA5H 1I94Q 3ULJA 1VQOA 4DR6L 3J7ZC 1Q8KA 1XNQQ 4GNXA 1L1OC 1VQ4A 4AQYQ 1BKBA 3K81C 3JAMi 1QZHA 5C0XI 4JI2L 1HNWL 2VQFQ 3RN2A 1QVCA 2Z0SA 1KD1C 1IBMQ 1H95A 3ULLA 4DAYB 4NPSA 3MXNB 3U58A 2UXDQ 5M3MG 1TWCH 4YHHQ 3M9BA 4IPHA 3H0GH 4B3SL 2JA7H 3RZOH 1QVFA 1B7YB 2E2HH 3AEVA 1CSQA 4DR1Q 4NXNL 4LUOA 4DV1Q 2ZM6Q 2KENA 2KBNA 1VS0A 3STBD 4JI4L 1NMGA 3KF6B 1HR0W 3GTMH 1VQMA 3M4QA 3S1NH 4JYAL 1NBWA 4RMFA 4DUZQ 3K7AH 1VQJA 3CPFA 1JMCA 2HQLA 1M1KC 2IT1A 3E9HA 2JK8A 4LFBQ 2BH2A 1YEZA 3HKZE 2F4VL 2XGTA 3TS0A 3PO3H 1X65A 1PH6A 2HT1A 3G48A 4TQUS 3OTOQ 3CXCA 1Q46A 1Q1BA 4BXXH 1PVOA 2NN6G 1IZ6A 1VQCA 4DV5Q 1XPOA 2JEBI 2YTXA 3S1RH 2ID0A 3G71A 4LNQA 3GTKH 5JJIA 4HJ9A 1HNXQ 4IFDG 3FKIH 1JT8A 2ZTDA 1PH8A 1IBLQ 2JA8G 4GOPA 3G6EA 3M3YH 1PH1A 1N34L 2L15A 3PUYA 1HNZQ 3F8TA 4JI3L 2KHJA 3I55A 2K52A 3UDGA 3T1HL 1XJVA 4JOIA 4GKKL 1D7QA 4IO9A 3CCVA 2WAQG 4A3FH 1Y1WG 2R93G 3BZKA 4L5TA 1PHJA 1KIXA 1Z47A 1CSPA 5JJKA 3D0FA 3E0EA 1AH9A 1HZAA 2RF4A 2VY3A 5IP9G 1FL0A 4WJ4A 2QGQA 1A8VA 3KJOA 1KAWA 2RCNA 4BY1G 1GD7A 2I0QA 1VQ8A 5IYDH 4JI0L 4DV3L 2QEXA 1YHAA 3KOJA 3GTLH 3F2CA 1IYJB 3PIPA 1XMQL 2UU9Q 1Q7YC 1G6PA 3S2HH 4A3GH 4MZ9A 3CCUA 2E5LL 3GD7A 2E8GA 3CC7A 4OWXB 3A0JA 4OXPA 1WJJA 4JI7L 2ZJQA 1QUQA 1TWFH 4DR2Q 4POGA 4HIOA 3HOXG 3H3VH 2N78A 4DR4Q 1VQDA 3U50C 4EQ5A 4A3LH 4LFCL 4GLVB 2LXKA 4R1JA 1EIFA 1SFOH 4JI6Q 4B3RL 4YY3L 5H1SE 3K8AA 1XNRQ 4A3CG 1A0IA 3M4PA 2ALYB 3G4SA 4HIKA 1EQRA 1TWGH 5FJ8H 2UXCL 2CWPA 1G291 5JEAJ 2D0OA 3PCOB 1Y14B 2OCEA 4HIMA 2E2IH 3W5OA 1TWHH 3BJUA 2AKWB 2Q2IA 3PSIA 4A3EG 4YCVA 1E22A 2UXBQ 1VQKA 1K3RA 2NZHA 1NJIC 4PZ8A 2OQ0A 1L0WA 3UDXA 3NELA 3UDFA 2EIFA 4YWKA 2Z6KA 4DR3L 1K0RA 1X3FA 4DV6L 1UE1A 1S3OA 3DM3A 3EBEA 4R4OA 5M3MH 1QZGA 2VW9A 4LF5L 1BBWA 4ALPA 1A62A 2MO1A 2R92G 3I4NH 4C2MH 1UEBA 2OQKA 2YTVA 1K83H 1PH9A 3M7NA 3ER0A 2PI2A 1CKOA 4C3HH 1XPRA 3KDFA 3HKZG 3RN5A 4IPDA 1BBUA 4DUYQ 4GOPB 1UE7A 2I5LX 2AWNA 1PH4A 1VQEA 4NB3A 4X6AH 4EX5A 5GAGC 3PUXA 4A75A 2VQEQ 3U4ZA 1WOCA 1MJCA 4GLAC 3UE1A 1Q81C 1P8LA 2CWAA 3CCMA 5LMNL 1N33Q 1KRSA 1K73C 3PO2G 4KLKA 4JI1Q 4YCUA 1OXTA 3LGJA 2GVAA 4DV2L 1JJ2A 3J80i 2JA8H 1LM0A 4GNXC 4A93G 4POFA 1PYSB 4UPAA 4YCWA 3CCJA 1IBKL 2IY5B 3KLWA 2RHQB 4DV0Q 1UWVA 1Y1WH 4LF4Q 1X9NA 1NTGA 1IL2A 1WYDA 1XPUA 3I4MG 3TREA 4DPGA 5C0XG 4X66Q 5IP9H 3PUVA 4C3JH 4AYBE 2ZJRA 4BY1H 4NXMQ 3SGIA 4KHPL 1J5EL 1MIUA 3DLLA 1VQPA 1EUJA 5IYCG 2UUAL 2GVBA 4JI5L 3TEHB 3JAMc 4P73A 4PZ7A 1HR0L 4XTCS 4B3SQ 3GTGH 1PA6A 1YVCA 5FLMG 4PG3A 3HOWH 5AJ3Q 1WCMG 3K80C 1YJWA 1SN8A 4JBKA 2UU9L 4IJHA 4HJAA 4LF9L 1HH2P 3HOXH 5LMUQ 4B3MQ 3F1ZA 4IFDJ 2D62A 1P16A 4AIMA 2Q2TA 4LFAL 3UDIA 4DR2L 4A3KG 1Y1VG 2K5VA 5JJLA 3PV0A 2JQOA 3EN2A 1ASZA 3HOYG 4GOPC 1W3SA 3J7A5 4X65L 3L7ZC 2UUCQ 1Q12A 5BR8Q 2YU9H 4HJ7A 3S15H 4JOIC 4IOCA 4JI8L 4DR5Q 4DV7Q 2AHOB 4IOAA 1XNRL 4UP7A 1YBYA 4GKJQ 3CC2A 5HGQA 5C4JH 4YWLA 3J81c 4A3EH 4GS3A 3L0OA 1NY4A 2K14A 1TWAH 4GN3B 1S72A 1B70B 4OONA 3KDFB 1X6OA 4X62Q 4P71A 4O2DA 4BY7G 1BVSA 2CCZA 5IP7G 4LF6Q 4R4CA 4HJ8A 2YV5A 1XMOQ 1HZBA 1K8AC 3UE0A 1LYLA 2XTIA 3U4VA 4OX9Q 2NVYH 5IWAQ 3I56A 1N32Q 2R92H 2HHHQ 2N8NA 2R6GA 2R7ZG 4DV4L 2ZTCA 4DR6Q 2Q2HA 1V9PA 2VNUD 1ASYA 2D0PA 2WB1G 2PNHA 2IHEA 1AE2A 2LSSA 4GN4B 4YWMA 3S24A 5M5XH 3F2DA 1HNWQ 3S2DH 4A3MG 4L5SA 3GTOH 1U0LA 1YITA 1UE5A 4DR7L 2Y0SE 4B3TL 3J81j 4LF8L 1OXSC 2C35B 2R7FA 3K7UC 3WWVA 4GNXB 5DLQE 5M5WH 3FHWA 3D31A 4LUVA 2UUBL 1MKHA 2V1CC 4BBRG 5M5YH 1EFWA 4NXNQ 3T1YL 4A3IG 4MNOA 1FJGL 1VQ5A 3RLOA 4P74A 3W1BA 3CCEA 2QA4A 4GN5A 1S40A 2K50A 3PUWA 4JI4Q 4A3DG 5ELOA 4JI1L 4JV5L 3HOZG 2JA6G 3AFQA 4JBJA 4K0KL 2JE6I 5C3EG 4A93H 2I5MX 1T9HA 1HZ9A 3CP0A 1WFQA 2A1AA 3KJPA 2DUDA 2JA9A 3M85A 1HZCA 4QL5A 1YHQA 1C7YA 1Z9FA 2F4VQ 1X54A 2Z6KC 4AYBG 3A74A 1I94L 3CD6A 1KHIA 1EQQA 1GM5A 3NEMA 1XNQL 2Q2UA 2NVTH 1E24A 3I4MH 4AQYL 3ULPA 1SE8A 1VQ7A 4WJ3M 2VQFL 4ME3A 1IBML 1IXRA 3I4OA 4A4IA 3AQQA 2UXDL 4J15A 3W1GA 4JI3Q 2OTLA 3S1QH 4YHHL 1G51A 3Q8DA 5IYCH 1LTLA 3T1HQ 4GKKQ 2BA0A 2WFWA 5GQOA 3ERSX 5HY6A 4P72A 1PH5A 1CUKA 4H02A 1YJ9A 4DR1L 3S14H 1O7IA 2VS1A 1KRTA 4DV1L 2ZM6L 2VUMG 4TVAB 5FLMH 2YYZA 1WCMH 1GKHA 3I2ZA 1CKNA 2EXDA 2ASBA 1Q86C 2WB1E 4JBWA 3S17H 1DGSA 4DUZL 1K9MC 3B6YA 1C0AA 1UE6A 4BBSG 2K4KA 4A3KH 4AH6A 3AYHB 4JI0Q 3GTPH 4B3ML 1JJCB 3HOYH 4LFBL 3CW2C 3OTOL 4UY8C 3TRZA 3AFPA 4X64Q 1SROA 3I7FA 4DV5L 3RZDH 2ZTEA 2DGYA 1I3QH 1HNXL 2E5LQ 1YIJA 1IBLL 4JI7Q 4OO1I 3CAMA 1VQBA 5C0XJ 1HNZL 1VQ6A 3STBC 5IT9c 3H3VI 3S1MH 1I6HH 2R93H 4R4IA 2VL6A 1GVPA 2CKZB 4LFCQ 2IX0A 5IP7H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IPG A;  3BZC A;  4B3R Q;  4YY3 Q;  3J80 c;  2PQA A;  2A8V A;  5C4X G;  1QUQ B;  2A19 A;  2MNA A;  3GDE A;  3RNU A;  1YI2 A;  3HOU G;  2UXC Q;  2VZA A;  1OXU A;  3JC6 6;  5GRO A;  3HOV G;  5C44 G;  2R7Z H;  4A3B G;  1FGU A;  5E7N A;  1RIP A;  5IWA L;  4DK3 C;  2Y0S G;  5J3B A;  4R4Q A;  1N32 L;  4APV A;  1VQI A;  2NZO A;  4QQB X;  1VQN A;  4A3M H;  4PZ6 A;  3PF5 A;  3CC4 A;  1YNX A;  4DR3 Q;  4OWT B;  1X55 A;  1PV4 A;  1SLJ A;  4DV6 Q;  1FVI A;  3KFU A;  1L1O A;  4LF5 Q;  5M3F G;  4LW1 A;  2B3G A;  3M4O H;  2ATW A;  3PF4 A;  4A3J G;  1D8L A;  4FDB A;  3HKS A;  2NVQ H;  1V43 A;  4LWC A;  4BBR H;  1A63 A;  1E3P A;  1R9T H;  4A3I H;  1N8R C;  4DR4 L;  3EIV A;  5IYB G;  4A3D H;  2YTY A;  1VQG A;  4QY7 A;  3GO5 A;  1N36 Q;  4A3C H;  1EWI A;  1M90 C;  4LF7 Q;  4JI6 L;  3HOZ H;  1VQ9 A;  2JA6 H;  1TXY A;  5C3E H;  3HFZ B;  3ZJY C;  2K5N A;  3NEN A;  4UP8 A;  1Q82 C;  4IJL A;  1EOV A;  1OXX K;  1PH3 A;  4DKA C;  2KCM A;  3OW2 A;  1QVG A;  4XIG S;  4LUZ A;  2UXB L;  5LMN Q;  3J81 i;  2NN6 I;  4PMW A;  4Y52 H;  4L5Q A;  4Y7N H;  1OXV A;  2B63 G;  1CKN B;  3MEF A;  3PGZ A;  3A5U A;  4DV2 Q;  4IFD I;  1E7Z A;  1B8A A;  1I5F A;  3PUZ A;  3KF8 B;  4R4T A;  5ELN A;  1KL9 A;  3BU2 A;  4UP9 A;  4KHZ A;  4BA2 I;  1CKM A;  3A5Z B;  2KHI A;  1VQA A;  2F3I A;  4L5R C;  1PFS A;  2AWO A;  1SR3 A;  1IBK Q;  1JB7 A;  2JA5 G;  2E2J H;  2VUM H;  4JI2 Q;  3CPW A;  1C9O A;  1HJP A;  4O0A A;  1LUZ A;  3CMA A;  1KXL A;  2PMZ E;  4BA1 I;  4DUY L;  4DNI A;  2JEA I;  1AE3 A;  1X3E A;  4BBS H;  4KHP Q;  1J5E Q;  3PO2 H;  2F52 A;  2VQE L;  2UUA Q;  3H0G G;  2JA7 G;  1N9W A;  1JE5 A;  5GAD C;  4JI5 Q;  1N33 L;  2PQA B;  3VDY A;  1HR0 Q;  4JYA Q;  1NE3 A;  4HID A;  5FLX c;  3K0X A;  4X64 L;  3ICE A;  1SRU A;  1EYG A;  4LF9 Q;  1Q1E A;  3FP9 A;  4BY7 H;  2K75 A;  5IE8 A;  3HOW G;  4JG2 A;  5EAY A;  4LFA Q;  1KC8 C;  5IY0 A;  4DK6 C;  2AMC B;  1XTD A;  1KQS A;  3F2B A;  2ZJP A;  4DV0 L;  1PH7 A;  4LF4 L;  3PO3 G;  2MFI A;  4X65 Q;  4BXX G;  5C4X H;  1K8G A;  5GAE C;  1L1O B;  3HOU H;  2CFM A;  4JI8 Q;  1OTC A;  3HOV H;  4A3B H;  1N34 Q;  4X66 L;  5C44 H;  3KF6 A;  2PI2 E;  2WP8 J;  1GO3 E;  2HIX A;  2LXJ A;  3FKI G;  2GN5 A;  4QIW E;  3CCQ A;  2FXQ A;  4NXM L;  1WI5 A;  4GLX A;  4IPC A;  4HJ5 A;  3S16 H;  5GAH C;  2N3S A;  4A3F G;  2B29 A;  3KYH C;  1NMF A;  3NBH B;  1YZ6 A;  4DAM A;  3L2P A;  3CME A;  5JEA G;  1PH2 A;  1VQH A;  2H5X A;  1RL2 A;  4C3I H;  5M3F H;  2OTJ A;  4JBM A;  1PYB A;  5AJ3 L;  4A76 A;  1VCI A;  2NVX H;  3E9I A;  1SMX A;  4A3J H;  2RHS B;  1Y1V H;  3GTQ H;  2WAQ E;  3OYY A;  4DV4 Q;  2R7D A;  4QGU A;  1I50 H;  5LMU L;  4JC0 A;  5K36 G;  4DV3 Q;  5IYB H;  5IYD G;  2I5H A;  2JJQ A;  2CQO A;  2EQS A;  3RLF A;  1W2B A;  2K5H A;  1XMQ Q;  2MQH A;  3TQY A;  1E1T A;  1VQL A;  1JJG A;  3CCR A;  3CCL A;  2ES2 A;  1N36 L;  4P75 A;  5BR8 L;  3PIO A;  2UUC L;  4LF7 L;  4DR5 L;  4DR7 Q;  4QJF A;  1EIY B;  3IRB A;  1L2F A;  1YHB A;  4DV7 L;  4MTN A;  4B3T Q;  4GKJ L;  4LF8 Q;  4A3G G;  2IX1 A;  4OWW B;  4OO1 G;  3CF5 A;  2N49 A;  2UUB Q;  2OWO A;  2HIV A;  4KI0 A;  1FJG Q;  2IHF A;  1V1Q A;  2KCT A;  2BH8 A;  3T1Y Q;  3RR5 A;  4JCV E;  2B63 H;  5LMN W;  3GTJ H;  1U5K A;  4X62 L;  4A3L G;  3I4N G;  4LF6 L;  2BA1 A;  4JV5 Q;  1MJE A;  4K0K Q;  1XMO L;  3H15 A;  1J6Q A;  1E1O A;  4RG1 A;  3CCS A;  4OX9 L;  3CQZ H;  5FJ8 G;  3TS2 A;  1VQF A;  1X3G A;  2HHH L;  1YJN A;  1X56 A;  2MO0 A;  3RLN A;  2JA5 H;  1I94 Q;  3ULJ A;  1VQO A;  4DR6 L;  3J7Z C;  1Q8K A;  1XNQ Q;  4GNX A;  1L1O C;  1VQ4 A;  4AQY Q;  1BKB A;  3K81 C;  3JAM i;  1QZH A;  5C0X I;  4JI2 L;  1HNW L;  2VQF Q;  3RN2 A;  1QVC A;  2Z0S A;  1KD1 C;  1IBM Q;  1H95 A;  3ULL A;  4DAY B;  4NPS A;  3MXN B;  3U58 A;  2UXD Q;  5M3M G;  1TWC H;  4YHH Q;  3M9B A;  4IPH A;  3H0G H;  4B3S L;  2JA7 H;  3RZO H;  1QVF A;  1B7Y B;  2E2H H;  3AEV A;  1CSQ A;  4DR1 Q;  4NXN L;  4LUO A;  4DV1 Q;  2ZM6 Q;  2KEN A;  2KBN A;  1VS0 A;  3STB D;  4JI4 L;  1NMG A;  3KF6 B;  1HR0 W;  3GTM H;  1VQM A;  3M4Q A;  3S1N H;  4JYA L;  1NBW A;  4RMF A;  4DUZ Q;  3K7A H;  1VQJ A;  3CPF A;  1JMC A;  2HQL A;  1M1K C;  2IT1 A;  3E9H A;  2JK8 A;  4LFB Q;  2BH2 A;  1YEZ A;  3HKZ E;  2F4V L;  2XGT A;  3TS0 A;  3PO3 H;  1X65 A;  1PH6 A;  2HT1 A;  3G48 A;  4TQU S;  3OTO Q;  3CXC A;  1Q46 A;  1Q1B A;  4BXX H;  1PVO A;  2NN6 G;  1IZ6 A;  1VQC A;  4DV5 Q;  1XPO A;  2JEB I;  2YTX A;  3S1R H;  2ID0 A;  3G71 A;  4LNQ A;  3GTK H;  5JJI A;  4HJ9 A;  1HNX Q;  4IFD G;  3FKI H;  1JT8 A;  2ZTD A;  1PH8 A;  1IBL Q;  2JA8 G;  4GOP A;  3G6E A;  3M3Y H;  1PH1 A;  1N34 L;  2L15 A;  3PUY A;  1HNZ Q;  3F8T A;  4JI3 L;  2KHJ A;  3I55 A;  2K52 A;  3UDG A;  3T1H L;  1XJV A;  4JOI A;  4GKK L;  1D7Q A;  4IO9 A;  3CCV A;  2WAQ G;  4A3F H;  1Y1W G;  2R93 G;  3BZK A;  4L5T A;  1PHJ A;  1KIX A;  1Z47 A;  1CSP A;  5JJK A;  3D0F A;  3E0E A;  1AH9 A;  1HZA A;  2RF4 A;  2VY3 A;  5IP9 G;  1FL0 A;  4WJ4 A;  2QGQ A;  1A8V A;  3KJO A;  1KAW A;  2RCN A;  4BY1 G;  1GD7 A;  2I0Q A;  1VQ8 A;  5IYD H;  4JI0 L;  4DV3 L;  2QEX A;  1YHA A;  3KOJ A;  3GTL H;  3F2C A;  1IYJ B;  3PIP A;  1XMQ L;  2UU9 Q;  1Q7Y C;  1G6P A;  3S2H H;  4A3G H;  4MZ9 A;  3CCU A;  2E5L L;  3GD7 A;  2E8G A;  3CC7 A;  4OWX B;  3A0J A;  4OXP A;  1WJJ A;  4JI7 L;  2ZJQ A;  1QUQ A;  1TWF H;  4DR2 Q;  4POG A;  4HIO A;  3HOX G;  3H3V H;  2N78 A;  4DR4 Q;  1VQD A;  3U50 C;  4EQ5 A;  4A3L H;  4LFC L;  4GLV B;  2LXK A;  4R1J A;  1EIF A;  1SFO H;  4JI6 Q;  4B3R L;  4YY3 L;  5H1S E;  3K8A A;  1XNR Q;  4A3C G;  1A0I A;  3M4P A;  2ALY B;  3G4S A;  4HIK A;  1EQR A;  1TWG H;  5FJ8 H;  2UXC L;  2CWP A;  1G29 1;  5JEA J;  2D0O A;  3PCO B;  1Y14 B;  2OCE A;  4HIM A;  2E2I H;  3W5O A;  1TWH H;  3BJU A;  2AKW B;  2Q2I A;  3PSI A;  4A3E G;  4YCV A;  1E22 A;  2UXB Q;  1VQK A;  1K3R A;  2NZH A;  1NJI C;  4PZ8 A;  2OQ0 A;  1L0W A;  3UDX A;  3NEL A;  3UDF A;  2EIF A;  4YWK A;  2Z6K A;  4DR3 L;  1K0R A;  1X3F A;  4DV6 L;  1UE1 A;  1S3O A;  3DM3 A;  3EBE A;  4R4O A;  5M3M H;  1QZG A;  2VW9 A;  4LF5 L;  1BBW A;  4ALP A;  1A62 A;  2MO1 A;  2R92 G;  3I4N H;  4C2M H;  1UEB A;  2OQK A;  2YTV A;  1K83 H;  1PH9 A;  3M7N A;  3ER0 A;  2PI2 A;  1CKO A;  4C3H H;  1XPR A;  3KDF A;  3HKZ G;  3RN5 A;  4IPD A;  1BBU A;  4DUY Q;  4GOP B;  1UE7 A;  2I5L X;  2AWN A;  1PH4 A;  1VQE A;  4NB3 A;  4X6A H;  4EX5 A;  5GAG C;  3PUX A;  4A75 A;  2VQE Q;  3U4Z A;  1WOC A;  1MJC A;  4GLA C;  3UE1 A;  1Q81 C;  1P8L A;  2CWA A;  3CCM A;  5LMN L;  1N33 Q;  1KRS A;  1K73 C;  3PO2 G;  4KLK A;  4JI1 Q;  4YCU A;  1OXT A;  3LGJ A;  2GVA A;  4DV2 L;  1JJ2 A;  3J80 i;  2JA8 H;  1LM0 A;  4GNX C;  4A93 G;  4POF A;  1PYS B;  4UPA A;  4YCW A;  3CCJ A;  1IBK L;  2IY5 B;  3KLW A;  2RHQ B;  4DV0 Q;  1UWV A;  1Y1W H;  4LF4 Q;  1X9N A;  1NTG A;  1IL2 A;  1WYD A;  1XPU A;  3I4M G;  3TRE A;  4DPG A;  5C0X G;  4X66 Q;  5IP9 H;  3PUV A;  4C3J H;  4AYB E;  2ZJR A;  4BY1 H;  4NXM Q;  3SGI A;  4KHP L;  1J5E L;  1MIU A;  3DLL A;  1VQP A;  1EUJ A;  5IYC G;  2UUA L;  2GVB A;  4JI5 L;  3TEH B;  3JAM c;  4P73 A;  4PZ7 A;  1HR0 L;  4XTC S;  4B3S Q;  3GTG H;  1PA6 A;  1YVC A;  5FLM G;  4PG3 A;  3HOW H;  5AJ3 Q;  1WCM G;  3K80 C;  1YJW A;  1SN8 A;  4JBK A;  2UU9 L;  4IJH A;  4HJA A;  4LF9 L;  1HH2 P;  3HOX H;  5LMU Q;  4B3M Q;  3F1Z A;  4IFD J;  2D62 A;  1P16 A;  4AIM A;  2Q2T A;  4LFA L;  3UDI A;  4DR2 L;  4A3K G;  1Y1V G;  2K5V A;  5JJL A;  3PV0 A;  2JQO A;  3EN2 A;  1ASZ A;  3HOY G;  4GOP C;  1W3S A;  3J7A 5;  4X65 L;  3L7Z C;  2UUC Q;  1Q12 A;  5BR8 Q;  2YU9 H;  4HJ7 A;  3S15 H;  4JOI C;  4IOC A;  4JI8 L;  4DR5 Q;  4DV7 Q;  2AHO B;  4IOA A;  1XNR L;  4UP7 A;  1YBY A;  4GKJ Q;  3CC2 A;  5HGQ A;  5C4J H;  4YWL A;  3J81 c;  4A3E H;  4GS3 A;  3L0O A;  1NY4 A;  2K14 A;  1TWA H;  4GN3 B;  1S72 A;  1B70 B;  4OON A;  3KDF B;  1X6O A;  4X62 Q;  4P71 A;  4O2D A;  4BY7 G;  1BVS A;  2CCZ A;  5IP7 G;  4LF6 Q;  4R4C A;  4HJ8 A;  2YV5 A;  1XMO Q;  1HZB A;  1K8A C;  3UE0 A;  1LYL A;  2XTI A;  3U4V A;  4OX9 Q;  2NVY H;  5IWA Q;  3I56 A;  1N32 Q;  2R92 H;  2HHH Q;  2N8N A;  2R6G A;  2R7Z G;  4DV4 L;  2ZTC A;  4DR6 Q;  2Q2H A;  1V9P A;  2VNU D;  1ASY A;  2D0P A;  2WB1 G;  2PNH A;  2IHE A;  1AE2 A;  2LSS A;  4GN4 B;  4YWM A;  3S24 A;  5M5X H;  3F2D A;  1HNW Q;  3S2D H;  4A3M G;  4L5S A;  3GTO H;  1U0L A;  1YIT A;  1UE5 A;  4DR7 L;  2Y0S E;  4B3T L;  3J81 j;  4LF8 L;  1OXS C;  2C35 B;  2R7F A;  3K7U C;  3WWV A;  4GNX B;  5DLQ E;  5M5W H;  3FHW A;  3D31 A;  4LUV A;  2UUB L;  1MKH A;  2V1C C;  4BBR G;  5M5Y H;  1EFW A;  4NXN Q;  3T1Y L;  4A3I G;  4MNO A;  1FJG L;  1VQ5 A;  3RLO A;  4P74 A;  3W1B A;  3CCE A;  2QA4 A;  4GN5 A;  1S40 A;  2K50 A;  3PUW A;  4JI4 Q;  4A3D G;  5ELO A;  4JI1 L;  4JV5 L;  3HOZ G;  2JA6 G;  3AFQ A;  4JBJ A;  4K0K L;  2JE6 I;  5C3E G;  4A93 H;  2I5M X;  1T9H A;  1HZ9 A;  3CP0 A;  1WFQ A;  2A1A A;  3KJP A;  2DUD A;  2JA9 A;  3M85 A;  1HZC A;  4QL5 A;  1YHQ A;  1C7Y A;  1Z9F A;  2F4V Q;  1X54 A;  2Z6K C;  4AYB G;  3A74 A;  1I94 L;  3CD6 A;  1KHI A;  1EQQ A;  1GM5 A;  3NEM A;  1XNQ L;  2Q2U A;  2NVT H;  1E24 A;  3I4M H;  4AQY L;  3ULP A;  1SE8 A;  1VQ7 A;  4WJ3 M;  2VQF L;  4ME3 A;  1IBM L;  1IXR A;  3I4O A;  4A4I A;  3AQQ A;  2UXD L;  4J15 A;  3W1G A;  4JI3 Q;  2OTL A;  3S1Q H;  4YHH L;  1G51 A;  3Q8D A;  5IYC H;  1LTL A;  3T1H Q;  4GKK Q;  2BA0 A;  2WFW A;  5GQO A;  3ERS X;  5HY6 A;  4P72 A;  1PH5 A;  1CUK A;  4H02 A;  1YJ9 A;  4DR1 L;  3S14 H;  1O7I A;  2VS1 A;  1KRT A;  4DV1 L;  2ZM6 L;  2VUM G;  4TVA B;  5FLM H;  2YYZ A;  1WCM H;  1GKH A;  3I2Z A;  1CKN A;  2EXD A;  2ASB A;  1Q86 C;  2WB1 E;  4JBW A;  3S17 H;  1DGS A;  4DUZ L;  1K9M C;  3B6Y A;  1C0A A;  1UE6 A;  4BBS G;  2K4K A;  4A3K H;  4AH6 A;  3AYH B;  4JI0 Q;  3GTP H;  4B3M L;  1JJC B;  3HOY H;  4LFB L;  3CW2 C;  3OTO L;  4UY8 C;  3TRZ A;  3AFP A;  4X64 Q;  1SRO A;  3I7F A;  4DV5 L;  3RZD H;  2ZTE A;  2DGY A;  1I3Q H;  1HNX L;  2E5L Q;  1YIJ A;  1IBL L;  4JI7 Q;  4OO1 I;  3CAM A;  1VQB A;  5C0X J;  1HNZ L;  1VQ6 A;  3STB C;  5IT9 c;  3H3V I;  3S1M H;  1I6H H;  2R93 H;  4R4I A;  2VL6 A;  1GVP A;  2CKZ B;  4LFC Q;  2IX0 A;  5IP7 H; 
#chains in the Genus database with same CATH topology
 4B3R Q;  4YY3 Q;  1PZI D;  2O2L D;  2VB2 X;  3GV6 A;  2MNA A;  3RNU A;  2CH4 A;  1OXU A;  3HP3 A;  3HOV G;  4A3B G;  2R7Z H;  5E7N A;  5C5M A;  4L6T B;  1RIP A;  4DK3 C;  4R4Q A;  1N32 L;  4APV A;  4WOR A;  2BCO A;  5KGU A;  2NZO A;  4PZ6 A;  3PF5 A;  1YNX A;  2F0M A;  4OWT B;  4XQJ A;  1PV4 A;  4QUF A;  2EE1 A;  1J9O A;  1L1O A;  4LF5 Q;  5M3F G;  3VR5 A;  2HCC A;  2QKI C;  3M4O H;  1I4H A;  1FGB D;  4FDB A;  4H0L C;  2KUM A;  4BBR H;  3S1Q B;  1JOK A;  1E3P A;  1A63 A;  4FF3 A;  2OXP A;  2ZXO A;  5IYB G;  2EYP A;  1EWI A;  2X6L A;  3HOZ H;  4CKE A;  1TXY A;  5KYI A;  5C3E H;  1Q82 C;  4RWS C;  4IUT A;  1EOV A;  3MWY W;  2KCM A;  4LUZ A;  4UDU C;  2CVR A;  3J81 i;  1BDO A;  4TSS A;  5JVH 3;  4PMW A;  4Y52 H;  3J7A V;  1CKN B;  1GHJ A;  3KF8 B;  2JA8 B;  2M00 A;  4R4T A;  4BA2 I;  3IFT A;  4F88 A;  1EQT A;  3SE0 A;  1G6Z A;  1CA6 A;  1CI3 M;  2P5Z X;  1IBK Q;  1I6H B;  1EL0 A;  2R93 B;  3CPW A;  2DY8 A;  5KEE A;  3RUZ A;  3PIO 3;  1JIC A;  3CMA A;  5FOB B;  1EWH A;  5CMD A;  4KHP Q;  1J5E Q;  3FPP A;  1C8C A;  3FDT A;  2UUA Q;  2JA7 G;  3N6R A;  3TP7 A;  2CW0 D;  3NPP A;  3GTG B;  5AFW A;  2KCC A;  3K0X A;  3ICE A;  1AN8 A;  1CHP D;  3FP9 A;  1WTO A;  5IE8 A;  4CJ1 B;  3KBG A;  1STB A;  4JG2 A;  3MXN A;  1BCP C;  1M8A A;  1XTD A;  1KQS A;  1ILP A;  5ISR A;  3PO3 G;  5C4X H;  1K8G A;  4LK1 C;  1HA5 A;  3DWQ A;  3HOU H;  2JA6 B;  1G8Z D;  5FK9 C;  2PI2 E;  2RA4 A;  1F9P A;  4NXM L;  2ENB A;  1AW7 A;  1TWA B;  1K3B C;  4DK0 A;  5IGB A;  4RGT A;  5DAU A;  2N3S A;  1K8M A;  4Y7N B;  3NTH A;  4PMB A;  3QO2 A;  1YZ6 A;  4HMI A;  1VQH A;  1FYC A;  4JBM A;  5AJ3 L;  2NVX H;  3WOF A;  3GTQ H;  5DNF A;  2R7D A;  4ZRZ A;  3R2I A;  3TP6 A;  2CQO A;  2EYH A;  1W2B A;  3MXP A;  4P2C B;  2RDG A;  3P7J A;  3S2D B;  4LF7 L;  2F0K A;  3IRB A;  4DV7 L;  5D3D A;  1K0S A;  2DJG C;  1TY2 A;  3A8I E;  2HIV A;  3L3O C;  2G5D A;  2B63 H;  4JCV E;  4A3L G;  1B50 A;  3NTK A;  1STE A;  2BA1 A;  4LF6 L;  1STN A;  5KNC A;  5D3I B;  5FJ8 G;  1NUC A;  1CA5 A;  1X56 A;  2MO0 A;  3EJI A;  3RLN A;  2JA5 H;  3ULJ A;  1VQO A;  3H6M A;  1BO0 A;  3J7Z C;  1L1O C;  4TRD A;  3HRZ C;  3H94 A;  3PIP 3;  1WTH A;  1KAA A;  1H95 A;  1QVC A;  2Z0S A;  1T5E A;  1ZYR C;  2OEO A;  3U58 A;  2B2U A;  4YHH Q;  3X3M A;  4FF4 A;  4I7Z C;  3AEV A;  4DR1 Q;  4NXN L;  2ZM6 Q;  1VS0 A;  4C3H G;  1NMG A;  3KF6 B;  5IGC A;  3QIA A;  3GTM H;  4JYA L;  1SNC A;  3LNN A;  4DUZ Q;  1VQJ A;  4CDD C;  2JK8 A;  1I50 B;  2E76 C;  2DNE A;  2XN9 C;  3TS0 A;  1GUW A;  2HT1 A;  1PVO A;  5CV8 A;  4TQU S;  1Q46 A;  1Q1B A;  1IZ6 A;  4DV5 Q;  2JEB I;  4K5V A;  1PXU A;  1SE4 A;  5ELC A;  5M9O A;  4HJ9 A;  3FKI H;  2ZTD A;  2EXZ A;  4K5W A;  2JA8 G;  4GOP A;  3G6E A;  3M3Y H;  1HNZ Q;  1N34 L;  2L15 A;  3I55 A;  3ITP A;  2ZT9 C;  3CCV A;  1IYV A;  2EYJ A;  2WAQ G;  2K32 A;  1GUG A;  3BDO A;  1NAP A;  3EA6 A;  1Y1W G;  2R93 G;  1TS4 A;  3SEB A;  1PHJ A;  5JEA H;  1CSP A;  5JJK A;  1MD2 D;  1NNX A;  2B8F A;  3A7A B;  3CQZ B;  5K36 H;  5IGD A;  3I70 A;  1IKL A;  4N8X 1;  2F1M A;  1AZP A;  2MGS A;  3UI2 A;  4DV3 L;  2QEX A;  3KOJ A;  3GTL H;  1DXM A;  1IYJ B;  1XMQ L;  2UU9 Q;  2FMM A;  1CFM A;  1EZ8 A;  2WV6 D;  1HUM A;  3S2H H;  4A3G H;  4MN3 A;  4GZY C;  4JI7 L;  4DR2 Q;  1SND A;  4POG A;  1TWC B;  4FNF A;  2R61 A;  4HIO A;  4BBR B;  3H3V H;  3H0G B;  3D4W A;  2LXK A;  4JI6 Q;  1EIF A;  5E1F A;  4EQO A;  1XNR Q;  3K8A A;  4K8J A;  4A3C G;  1HTP A;  1PTO H;  4BWG B;  1ZEQ X;  2ALY B;  3G4S A;  2CWP A;  2D0O A;  1Y14 B;  2E2I H;  4DA2 A;  4A3E G;  2UXB Q;  2EYO A;  4X3S A;  1VQK A;  1WTP A;  3UDX A;  1EFI D;  2OQ0 A;  1L0W A;  2RQX A;  2B2Y C;  3NEL A;  1O7Z A;  2EIF A;  4DAP A;  4IUR A;  4OEM B;  2L12 A;  4B9W A;  1X32 A;  1EOT A;  2R92 G;  2AQ1 B;  1HA6 A;  4C2M H;  1F9R A;  2YTV A;  3ER0 A;  5EQ0 A;  3KDF A;  3CRL C;  1SXT A;  3RN5 A;  5JPN C;  3Q24 A;  4V0B A;  3SXH A;  1PH4 A;  5GAG C;  1I4G A;  4A75 A;  1I4P A;  1MJC A;  4GLA C;  3UE1 A;  1Q81 C;  1P8L A;  5ELD A;  3E5S A;  3I72 A;  1QG7 A;  2F0H A;  5KND A;  4YIJ A;  4E6I A;  3HZX A;  2BDN A;  3V2T A;  1LTA D;  3VA5 A;  4YCW A;  1TWF B;  2ZXP A;  1BF4 A;  3KLW A;  4LF4 Q;  1NTG A;  1IL2 A;  3VA7 A;  1U9R A;  1PFM A;  1FNU A;  2RDF A;  2PW7 A;  4X66 Q;  1QB5 D;  2K33 A;  1SNO A;  1SE2 A;  1TWG B;  4AYB E;  5COY A;  2Y0S B;  2FFK B;  5C6A A;  2ZJR A;  2PMZ B;  3A7L A;  2NTT A;  1EU3 A;  2Q8R E;  3D3R A;  2GVB A;  3TEH B;  4HSV A;  1QCB D;  1M4V A;  2HUG A;  1STG A;  4B3S Q;  5JPM C;  5FLM G;  1JCK B;  1F77 A;  2F0W A;  2Q8T A;  2NVX B;  3K80 C;  1SN8 A;  1I4R A;  5E3F A;  4IJH A;  4HJA A;  5M3M B;  3HOX H;  3NBI A;  4AIM A;  3BG3 A;  3OPO A;  4LFA L;  1QNK A;  1ASZ A;  1R4P B;  5D14 A;  4GOP C;  4X65 L;  1Q12 A;  5BR8 Q;  4HJ7 A;  2XRS D;  4JI8 L;  1HFG A;  1ICF B;  1DOL A;  3L0O A;  1NY4 A;  1KNE A;  4QIW B;  1DZ1 A;  3WDN A;  4CDE C;  4P71 A;  1BVS A;  2EVB A;  5L37 A;  1MSG A;  4QB4 A;  1TR5 A;  5TSS A;  1HHV A;  1WTX A;  4G7O C;  4F8M A;  3I73 A;  1FNV A;  2N8N A;  2RSN A;  2R7Z G;  4DR6 Q;  4JK1 C;  3MA2 B;  1V9P A;  2SDF A;  2PNH A;  1MI2 A;  3F2D A;  2TSS A;  1HNW Q;  1NCV A;  4KY6 A;  1LT5 D;  5CBA E;  2K5D A;  3ZYY X;  2JYO A;  1NSN S;  3OOC A;  4B3T L;  1OXS C;  3K7U C;  4Q0F A;  3WOE A;  1A3T A;  4C3J B;  5DLQ E;  3P75 A;  4LUV A;  4K6D A;  4BBR G;  1RF2 D;  5EBC A;  3R2T A;  4GN5 A;  3GQB A;  1F2Y A;  3HEJ A;  4JV5 L;  3HOZ G;  2DN8 A;  5C3E G;  4A93 H;  1HZ9 A;  3CP0 A;  4HTH A;  4K14 A;  2DUD A;  2JA9 A;  2RCF A;  3J80 E;  1HZC A;  2PQE A;  4QL5 A;  3CD6 A;  4N9T A;  1H9S A;  2SNM A;  4X3U A;  2M2L A;  3A54 A;  1RDP D;  4RHR A;  5C0X H;  1VQ7 A;  2YU9 B;  3FKI B;  1ML0 D;  4A4I A;  3S15 B;  3W1G A;  4JI3 Q;  1W6K A;  3S1Q H;  4KTA A;  1ENF A;  1G51 A;  2B2T A;  3Q8D A;  3T1H Q;  1S5B D;  4FYD A;  1VDZ A;  3ND8 A;  5T1G A;  1YJ9 A;  3U9O A;  1BCP D;  2YYZ A;  2K5Q A;  3OSO A;  4CKC A;  1ICW A;  4JBW A;  1LAB A;  2B39 A;  1KDC A;  2NVY B;  1C0A A;  3VYS A;  4JI0 Q;  4B3M L;  3HOY H;  1F2M A;  1EU4 A;  2FIN B;  3GTL B;  4UY8 C;  3RD4 A;  1L0Y B;  3I7F A;  2RDH A;  2J7Z A;  4A3G B;  3S2H B;  3GTO B;  1HNX L;  3T53 B;  3BZD B;  1I6H H;  1PRT D;  5IT9 c;  3H3V I;  4QUC A;  2R93 H;  2F0O A;  2F03 A;  1BXT A;  4LFC Q;  2IX0 A;  4WJW A;  2QW7 A;  5IP7 H;  5M5Y B;  4IPG A;  3G6J B;  4ULL A;  3MXU A;  1PTO B;  1R4Q B;  4ZYS A;  5C4X G;  3HOU G;  2VZA A;  1JWS D;  2E75 C;  2E2I B;  3OW7 A;  2Y0S G;  1VQI A;  3IAY A;  2FHT A;  2L5T A;  2LMC B;  3O13 A;  4A3M H;  2HDL A;  3CC4 A;  2H4O A;  1DYQ A;  2MPM A;  4NP5 A;  4DV6 Q;  1FVI A;  4KN7 C;  1SYF A;  4IAL A;  1D8L A;  4H7B A;  5FLX E;  2D5D A;  2PCF B;  2EOT A;  4A3C H;  4A3D H;  4QY7 A;  1VQG A;  2JA6 H;  3ND9 A;  3NEN A;  1WCM B;  1OXX K;  4XQN A;  1QVG A;  3S17 B;  4KD4 A;  1ZYR D;  5LMN Q;  1IHZ A;  3GTP B;  4Y7N H;  3R93 A;  4XYO A;  2B63 G;  1Q90 A;  4S3S A;  1PLF A;  1Y8N B;  1I5F A;  2GA4 B;  3PUZ A;  5ELN A;  1KL9 A;  3BU2 A;  1CKM A;  3A5Z B;  2KHI A;  2AWO A;  3C2P A;  3MEH A;  1EY0 A;  2JA5 G;  4JI2 Q;  1Y69 U;  4O0A A;  1JWU D;  1LTG D;  2EJM A;  5C4Z A;  1KXL A;  1STH A;  4BBS H;  1AE3 A;  1X3E A;  4JVZ A;  1EWC A;  1X3P A;  1GHK A;  3TN2 A;  1N9W A;  5GAD C;  2QDB A;  3W2D A;  4JI5 Q;  1N33 L;  2PQA B;  1HR0 Q;  2XNA C;  1SJE D;  4X64 L;  1SYG A;  1IL8 A;  1EYG A;  3HOX B;  1Z6H A;  1ZXT A;  5EAY A;  1KC8 C;  5IY0 A;  5HGT A;  2LS0 1;  3M7G A;  3F2B A;  2X6G A;  4RKL A;  2MFI A;  2KA7 A;  2B2T C;  5A2Q L;  5DM6 3;  3K5M A;  1K8O A;  4ABN A;  2WP8 J;  4RH6 A;  3FKI G;  1NR4 A;  5JJZ A;  4Z9C B;  3SK8 A;  4GLX A;  4HJ5 A;  3SVM A;  4CBV A;  1U4L A;  2B29 A;  5JEA G;  4ILW A;  1PYB A;  4A76 A;  4KN4 C;  3E9I A;  4K2K A;  4A3J H;  2WAQ E;  2AUK A;  4XT3 B;  4QGU A;  1I50 H;  4JC0 A;  5K36 G;  1EIG A;  2JJQ A;  1BOS A;  3RLF A;  3HKZ B;  3TQY A;  2EJG C;  4ZUJ A;  2QEJ C;  3CCL A;  4P75 A;  2UUC L;  4DR5 L;  1L2F A;  4A3G G;  4K2L A;  3CF5 A;  4L8J A;  3MVV A;  5LL6 X;  2OT2 A;  4KI0 A;  1A15 A;  2IHF A;  3PO2 B;  2X69 A;  1AEX A;  2KOL A;  1ZKO A;  4KY7 A;  1JOQ A;  4X62 L;  1GXD C;  2XRQ D;  1MJE A;  4A93 B;  3H15 A;  1E1O A;  4OX9 L;  4EQN A;  3CQZ H;  2HHH L;  1YJN A;  3TBI B;  1Q8K A;  1II3 A;  1XNQ Q;  2XWB B;  2A69 C;  1BKB A;  3K81 C;  3JAM i;  5C0X I;  2QCP X;  1IBM Q;  4DAY B;  4QF4 A;  1TWC H;  3NQT A;  3M9B A;  3RZO H;  3H0G H;  1B7Y B;  1CSQ A;  3S16 B;  2AUJ D;  1GUO A;  1KDA A;  1LT4 D;  4JI4 L;  3STB D;  3M4Q A;  5KNB A;  1EY9 A;  1Q8I A;  4C3I B;  4RMF A;  3VR3 A;  2ICI A;  2HQL A;  1M1K C;  3E9H A;  4OEL B;  1Y1V B;  3DMU A;  1SJH D;  4LFB Q;  3HOY B;  2F4V L;  2XGT A;  1X65 A;  3G48 A;  3OTO Q;  5J22 A;  1VQC A;  1CHQ D;  3I8Z A;  3J81 L;  1TII D;  1IBL Q;  2Q8I B;  1D7Q A;  4IO9 A;  2F0I A;  3A56 A;  5BN3 A;  4XT1 B;  3K5O A;  1Z47 A;  3H09 A;  3TME A;  2L0C A;  1AH9 A;  3E0E A;  1BQQ T;  4DXG A;  3DEP A;  3KJO A;  1KAW A;  1LTI D;  3HGB A;  1GD7 A;  5IYD H;  4M8A A;  1KDB A;  1V1P A;  1Z7T A;  3P20 A;  1YHA A;  4A3M B;  3F2C A;  3I90 A;  3V96 A;  1V1O A;  1G91 A;  4FXK C;  5C5L A;  4MZ9 A;  2E5L L;  1GUN A;  2E8G A;  3GD7 A;  4OXP A;  2KED A;  2NZ1 D;  2ZJQ A;  1SNQ A;  1TWF H;  3HOX G;  4EQ5 A;  2E2H B;  4A3D B;  4R1J A;  5EKI A;  1RTO A;  5IT9 E;  2EZV A;  1TWG H;  2UXC L;  5JEA J;  1TWH H;  2RBM A;  2AKW B;  4DNR B;  5T1I A;  1CQV A;  1K3R A;  4PZ8 A;  1B4O A;  1TKW B;  1PRT C;  4YWK A;  3QOJ A;  5EBD A;  4DR3 L;  3S1R B;  1DOK A;  1DD2 A;  1UE1 A;  2B2Y A;  5M3M H;  1QZG A;  4HR7 B;  3H91 A;  4JPB W;  5BN5 A;  2MHV A;  1TS3 A;  3M7N A;  5C3X A;  2KQ3 A;  3OHX C;  1XX8 A;  4A3F B;  4RGO S;  3HKZ G;  4IPD A;  1BBU A;  1EQV A;  2AWN A;  4NB3 A;  4BBS B;  3PUX A;  3C46 A;  1WOC A;  3PO2 G;  4DV2 L;  4IFD H;  3J80 i;  2D9U A;  1O7Y A;  4A93 G;  4OHJ A;  3BS1 A;  5IOC A;  5CV9 A;  3CCJ A;  2MP1 A;  3CU7 A;  4J1M A;  4HCE A;  3NXW A;  2NWG A;  4N8F A;  3MAQ A;  2CHB D;  2L4N A;  1SFO B;  5C0X G;  1TY0 A;  2PZT A;  5IP9 H;  4C3J H;  2EY5 A;  4KJN A;  4NXM Q;  3SGI A;  5EKL A;  4IUP A;  4B9X A;  1EUJ A;  1HFN A;  3D4R A;  2RKS A;  1S5F D;  2HDM A;  4PG3 A;  5AJ3 Q;  4JBK A;  2UU9 L;  2HCI A;  4LF9 L;  4A3J B;  1EYD A;  4RCO A;  4DR2 L;  1Y1V G;  2JQO A;  3EN2 A;  2B2W A;  3DUZ A;  3HOY G;  4CJ2 C;  1W3S A;  2YU9 H;  3S15 H;  3D6W A;  4IOC A;  5IGG A;  4DV7 Q;  3MFY A;  1XNR L;  1YBY A;  1XYI A;  1PMR A;  4OON A;  4K6L A;  5CV7 A;  4F87 A;  2CCZ A;  5KRU A;  5IP7 G;  4LF6 Q;  4R4C A;  3A8K E;  2YV5 A;  4KV6 A;  4TKO B;  1HZB A;  1K8A C;  3UE0 A;  1HQR D;  2F3W A;  2NVY H;  4O1N A;  3SK5 A;  5IWA Q;  1RD9 D;  3H3V C;  1LTS D;  1LTT D;  2R6G A;  4DV4 L;  4KMU C;  2F0D A;  2Q2H A;  4QMG A;  5EGT A;  1DJR D;  1DON A;  1J8I A;  1SYB A;  1PTO C;  2K04 A;  3BDC A;  4A3M G;  4L5S A;  2EPB A;  1YNN C;  3GTO H;  5DM7 3;  1UE5 A;  4DR7 L;  2Y0S E;  4LF8 L;  2R7F A;  3RZO B;  1VMC A;  2XWJ B;  3D31 A;  2UUB L;  1FJG L;  5M5Y H;  4NXN Q;  4X3K A;  3T1Y L;  1B9N A;  2E2D C;  2QA4 A;  3CCE A;  1S40 A;  4A3D G;  1DM0 B;  4RKB A;  2JA6 G;  4K0K L;  2JE6 I;  1CTM A;  1T9H A;  2PZW A;  3M85 A;  1I94 L;  4B08 A;  2K28 A;  5G3L D;  2Q2U A;  3LWE A;  4AQY L;  3KBX A;  5ELE A;  1A2U A;  2Z8L A;  4ME3 A;  2VQF L;  3I4O A;  3KK7 A;  3K6O A;  2SNS A;  4J15 A;  2UXD L;  2OTL A;  4WRD A;  1EYA A;  1LTL A;  2WFW A;  1PH5 A;  3K0Y A;  1O7I A;  3SK6 A;  4DV1 L;  1UAP A;  3D8G A;  4IQZ A;  2V4D A;  5ELF A;  1WCM H;  3I2Z A;  1VF7 A;  1CKN A;  1Q86 C;  4H44 C;  1SBB B;  2WB1 E;  5J1Z A;  4CDF C;  3S17 H;  1DGS A;  1F9Q A;  3KF8 A;  1K9M C;  1A6X A;  1GOZ A;  4BBS G;  2K4K A;  4A3K H;  3GTP H;  3CW2 C;  3D4D A;  1DOM A;  3TRZ A;  1SRO A;  3RZD H;  2QIL A;  5FKA C;  2F0V A;  4JI7 Q;  1Y8O B;  5C0X J;  3STB C;  1C4Q A;  2RVL A;  3MXG A;  3I4N B;  3BZC A;  4EVO A;  1VF5 C;  1QUQ B;  2A19 A;  2A6E C;  3GDE A;  1FGU A;  4XQQ A;  2A68 C;  1TWH B;  4R8I A;  4J8Q A;  4RAU C;  5J3B A;  2NBF A;  3NP8 A;  3FRP B;  1EEI D;  4IUQ A;  1VQN A;  2IL8 A;  3EQL C;  3I4M B;  1MSH A;  1SLJ A;  3KFU A;  4LW1 A;  2B2W C;  1BCP F;  2B3G A;  5C3W A;  3F2U A;  3NWS A;  4A3J G;  3PF4 A;  1V43 A;  4LWC A;  1RCV D;  4DR4 L;  1Q3L A;  2YTY A;  1N36 Q;  3QG1 A;  1M90 C;  1VQ9 A;  1U4P A;  3HFZ B;  3ZJY C;  2K5N A;  4NKL A;  2A69 D;  1SNP A;  1QOH A;  4DKA C;  3J7Y W;  4WFN 3;  1KAB A;  1EIH A;  1TU2 B;  2EY6 A;  1WD0 A;  2IPK D;  3A5U A;  4IFD I;  4RGN A;  1E7Z A;  5IGF A;  1PZJ D;  3KUP A;  2F0E A;  4UP9 A;  1I3Q B;  4XXE A;  1SYE A;  5I9P A;  2F3I A;  4L5R C;  4NMZ A;  1SR3 A;  3S1M B;  1RHP A;  4FXG C;  5K5P A;  4BY7 B;  5CV4 A;  1WTV A;  1C9O A;  1LUZ A;  4DUY L;  4BA1 I;  2WAC A;  3P1H A;  2F0T A;  2LFN A;  4FP5 D;  2JEA I;  1H9K A;  3PO2 H;  2VQE L;  2EYM A;  3H0G G;  1JE5 A;  2Z1C A;  3VDY A;  3TDQ A;  1E2Z A;  1NE3 A;  3T56 B;  4ZQ3 A;  1JQY D;  3FPU B;  1Q1E A;  3K57 A;  2A73 B;  4KJO A;  1FD7 D;  2J0T D;  4LFA Q;  1F2L A;  2NVQ B;  4DK6 C;  2AMC B;  4CJ0 B;  4JW0 A;  4DV0 L;  1PH7 A;  5EPJ A;  1R9T B;  4X65 Q;  4ME5 A;  5GAE C;  1L1O B;  3NE5 B;  2CFM A;  4JI8 Q;  1OTC A;  3QR8 A;  1YNJ C;  3URY A;  3KF6 A;  5C44 H;  1AZQ A;  1D1I A;  1GO3 E;  2HIX A;  2LXJ A;  2GN5 A;  3OMC A;  1JR0 D;  4ZCK A;  3S16 H;  4AYB B;  5GAH C;  2QDL A;  2F0G A;  3NBH B;  4DAM A;  3CME A;  2H5X A;  4FXD A;  1RL2 A;  4C3I H;  2OTJ A;  1SMX A;  2RHS B;  1Y1V H;  3CHB D;  1RKN A;  3OWE B;  3OYY A;  5LMU L;  5IYD G;  2G9D A;  2I5H A;  3IL8 A;  1JJG A;  2E2J B;  1E1T A;  2VXW A;  3Q6S A;  1I6V C;  5E4X A;  1SYD A;  1EIY B;  2K01 A;  2K7V A;  4MTN A;  4B3T Q;  4GKJ L;  1D5M C;  1XXG A;  2IX1 A;  2OWO A;  1V1Q A;  2KCT A;  3U9S A;  3RR5 A;  1U5K A;  1HTL D;  3I4N G;  3QWN A;  4JV5 Q;  1XMO L;  1J6Q A;  1MGS A;  5LL6 S;  2K1B A;  1VQF A;  1X3G A;  2Z4I A;  5IGE A;  3I91 A;  2O4X A;  1QZH A;  4JI2 L;  3RN2 A;  1KD1 C;  3ULL A;  4NPS A;  3MXN B;  3HOV B;  4A3B B;  5M3M G;  1H9R A;  1EY7 A;  4ZLT F;  1WTR A;  2HQE A;  2E2H H;  1IKM A;  1CT1 D;  1KTK A;  1XWE A;  1EEF D;  1SMY D;  3AU7 A;  3Q23 A;  5EKK A;  3N52 A;  3KLS A;  2EJF C;  1D6E C;  1SE3 A;  1HQM C;  1NBW A;  5M3F B;  1IYU A;  3CPF A;  1JMC A;  4A3K B;  3LX0 A;  4G4K A;  4OIK A;  2BH2 A;  3HKZ E;  3IFD A;  1PH6 A;  4BXX H;  2CH4 W;  2A6H C;  5JVG 3;  3RZD B;  2YTX A;  3S1R H;  1XPO A;  5E4W C;  3GTK H;  4BS9 A;  3Q0A A;  4FO2 A;  5JOB A;  1HNX Q;  1OO9 B;  4IFD G;  2I46 A;  3QJY A;  4RGM A;  1ESF A;  1B1Z A;  3X3N A;  1PH1 A;  3PUY A;  1H9J A;  3F8T A;  1QWY A;  2KHJ A;  2HD3 A;  2K52 A;  3UDG A;  4JOI A;  4GKK L;  1JE4 A;  4A3F H;  3BZK A;  3GTJ B;  4J6H A;  1JOO A;  1BR9 A;  5CC4 A;  5IP9 G;  4C3J G;  4WJ4 A;  1LO5 D;  2QGQ A;  1A8V A;  2RCN A;  1VQ8 A;  2SEB D;  3T13 A;  1CZG A;  3VYR A;  1Q7Y C;  5JAV A;  1EY6 A;  3ONA B;  2BE5 C;  3NQI A;  3AB9 A;  4OO1 H;  3A0J A;  1WJJ A;  1QUQ A;  1IW7 C;  2EYF A;  2JA7 B;  2EDG A;  1CQF A;  1SFO H;  4B3R L;  4YY3 L;  5H1S E;  3OIQ A;  1A0I A;  3M4P A;  3S1N B;  1PTO D;  3PCO B;  1YNN D;  1MHW C;  4HIM A;  1E2V A;  3PSI A;  2F0F A;  4DFA A;  1E22 A;  2L55 A;  1KLU D;  1GUS A;  2NZH A;  1NJI C;  2MUY A;  4PV1 C;  3UDF A;  1LT6 D;  4U67 3;  1S5C D;  2B2V A;  3DM3 A;  3EBE A;  4LF5 L;  3HG9 A;  4G7Z C;  4ALP A;  2MO1 A;  2A74 C;  5KYL A;  1UEB A;  3KLS X;  1PH9 A;  1K83 H;  2Z6B A;  1CKO A;  1LLR D;  3SHL A;  1XPR A;  1B3Q A;  2F0L A;  4GOP B;  3QB3 A;  2I5L X;  3SR1 A;  3HS0 C;  4X3T A;  1VQE A;  4X6A H;  4EX5 A;  1FR3 A;  4DGZ A;  4MTK A;  2EY1 A;  1O7L A;  2CWA A;  3CCM A;  1N33 Q;  2NN6 H;  1K73 C;  4JI1 Q;  4YCU A;  1OXT A;  1CM9 A;  4EGV A;  4EQP A;  1E2W A;  1JJ2 A;  2C5C A;  3I4L A;  1D1K A;  1PFB A;  1PYS B;  2H1E A;  1EZ6 A;  2AQ2 B;  3OMG A;  1IBK L;  2RHQ B;  1UWV A;  3FMC A;  1QE6 A;  1STA A;  1WYD A;  1EY4 A;  1ESR A;  1HXY D;  1VMP A;  3TRE A;  3L9A X;  2WIN B;  5C44 B;  3JAM L;  1ILQ A;  1JWM D;  5D65 A;  1RTN A;  4BY1 H;  4KHP L;  3NTI A;  1J5E L;  1MIU A;  2A5H A;  2UUA L;  1QIL A;  4RFB A;  3JAM c;  4P73 A;  4F7X A;  1EY8 A;  5FO8 B;  4XTC S;  1LAC A;  2F0S A;  2WKC A;  5KIX A;  1WCM G;  3D6C A;  4IFD J;  1QNU A;  2A6E D;  3F1Z A;  1P16 A;  2Q2T A;  3UDI A;  4A3K G;  2K5V A;  2N88 A;  5JJL A;  2A68 D;  2EYL A;  3J7A F;  2NYZ D;  3DWA A;  4C3H B;  2UUC Q;  4DAV A;  4JOI C;  4DR5 Q;  4UP7 A;  2F3V A;  3CC2 A;  5C4J H;  3ERO A;  4YWL A;  3NBH A;  3J81 c;  4GS3 A;  3NUC A;  4KKT A;  2KVM A;  1S72 A;  2ZXR A;  3KDF B;  1X6O A;  4X62 Q;  4HJ8 A;  2F4I A;  1L0X B;  1SYC A;  3CKI B;  4Q5V A;  1LYL A;  2XTI A;  4OX9 Q;  1B9M A;  5CBE E;  5CV5 A;  3I56 A;  1N32 Q;  3LWU A;  2HHH Q;  1ENA A;  1LTB D;  2ZTC A;  3C1F A;  2VNU D;  4ZUI A;  2WAQ B;  4PNY A;  1Y1W B;  3S24 A;  1AE2 A;  2LSS A;  5I9O A;  5M5X H;  4HSP A;  2BOS A;  3E0J A;  1WTW A;  1X3Q A;  4GNX B;  3WWV A;  5M5W H;  1HUN A;  1MKH A;  2F0J A;  2V1C C;  4ZKC B;  3I4N H;  4P74 A;  2XVS A;  4JI4 Q;  2K50 A;  3PUW A;  3OIP A;  4JBJ A;  4ZK9 B;  2I5M X;  3HOW B;  1B53 A;  3KJP A;  1AP0 A;  3VR4 A;  2JXM B;  1C7Y A;  1UNS A;  1Z9F A;  3RMH A;  1X54 A;  2F4V Q;  2B2V C;  1KHI A;  1S4Z A;  2NB0 A;  3NEM A;  2NVT H;  5I4D A;  1E24 A;  3I4M H;  3E6Z X;  3ULP A;  3GTK B;  3ERQ A;  3AQQ A;  4HN7 A;  4K5X A;  1GJX A;  4YHH L;  1CZW A;  5IYC H;  4A3E B;  2BA0 A;  4C56 C;  2PNR C;  2KHS A;  2F0Q A;  4DR1 L;  1KRT A;  2L9H A;  2VS1 A;  2ZM6 L;  3DEO A;  4TVA B;  1WVL A;  4U68 A;  1GKH A;  5J39 A;  4DUZ L;  3B6Y A;  1UE6 A;  1YNJ D;  2R92 B;  2JSO A;  4HMJ A;  4XDX A;  4DK1 A;  1I4Q A;  3VR2 A;  3AFP A;  4HCS A;  1A2T A;  3BVZ A;  4DV5 L;  3G7L A;  1I3Q H;  2E5L Q;  4DXF A;  4OO1 I;  2DY7 A;  1SMY C;  1VQB A;  5NUC A;  3J80 L;  1HNZ L;  3S1M H;  4LAA A;  5CV6 A;  2VL6 A;  4FVM A;  2CKZ B;  4BY7 H;  5ELB A;  3J80 c;  1G2S A;  2PQA A;  2A8V A;  3EVQ A;  4KKU A;  1YI2 A;  2UXC Q;  1BUV T;  3JC6 6;  4I7A A;  5G3L F;  5GRO A;  5IIF A;  5C44 G;  5IWA L;  1HCZ A;  5HUR A;  1RJT A;  2K6A A;  4QQB X;  4OGQ C;  3A8J E;  3GP7 A;  4DR3 Q;  3AMU A;  1X55 A;  2IWH A;  4OL7 A;  4C3I G;  3V05 A;  1D5Z C;  2ATW A;  2NVQ H;  1H9S B;  3HKS A;  1R9T H;  4A3I H;  4O42 A;  1N8R C;  1K83 B;  3EIV A;  2PZU A;  4CDC C;  2CQA A;  5CYU A;  3GO5 A;  4LF7 Q;  4JI6 L;  3S14 B;  4KK7 A;  2M9V A;  4UP8 A;  1D2B A;  4IJL A;  1JC7 A;  4DF7 A;  1ET9 A;  3CRK C;  3NHH A;  1PH3 A;  5DEH A;  3OW2 A;  2FJ2 A;  4RA8 A;  2PYK A;  3TP5 A;  4XIG S;  2UXB L;  2ICE C;  2TMP A;  4H13 C;  2NN6 I;  1JB3 A;  1KNA A;  1OXV A;  4L5Q A;  2Z9H A;  4LJZ C;  1Y8P B;  3MEF A;  3PGZ A;  3FEW X;  4DV2 Q;  3BYT B;  1B8A A;  5CGK A;  5A2Q E;  1SAP A;  4CGY B;  4KHV A;  2KCN A;  4KHZ A;  3PQI A;  3R3O A;  1VQA A;  1G2T A;  1PFS A;  1JB7 A;  3NSW A;  4KKS A;  2E2J H;  2VUM H;  3BVM A;  1AFP A;  1HJP A;  2B8G A;  1SDF A;  2A6H D;  2PMZ E;  3K59 A;  4DNI A;  4BY1 B;  2R7Z B;  2F52 A;  5FLX L;  5I6W A;  3Q22 A;  4JYA Q;  4XYQ A;  4HID A;  5FLX c;  1SRU A;  4DN4 M;  4LF9 Q;  4DAY A;  2K75 A;  3HOW G;  3M4O B;  3DWP A;  2ZJP A;  1FNW A;  3S9W A;  4LF4 L;  4PMC A;  4BXX G;  3NK9 A;  3HOZ B;  3A55 A;  5C3E B;  4IZ8 A;  1HPC A;  4G57 A;  4X66 L;  1N34 Q;  3HOV H;  5C4J B;  4QIW E;  3CCQ A;  2FXQ A;  1WI5 A;  2L1B A;  4IPC A;  2BE5 D;  3MTS A;  3T4A C;  2VB3 X;  4RCN A;  2IW3 A;  2IJ0 A;  1IW7 D;  1JOR A;  4A3F G;  3KYH C;  1NMF A;  1ROD A;  3L2P A;  1LT3 D;  1PH2 A;  4B3S L;  1PDQ A;  5M3F H;  3TZD A;  2JN4 A;  1VCI A;  1U4M A;  3JAM E;  4DV4 Q;  4M1U B;  4DV3 Q;  2F0U A;  5IYB H;  2XIW A;  1E0B A;  2EQS A;  2K5H A;  5M5X B;  2MQH A;  5LHY 1;  1XMQ Q;  1VQL A;  3CCR A;  4ID6 A;  2ES2 A;  1N36 L;  5BR8 L;  4DU9 A;  2G9H D;  1F9S A;  3PIO A;  4DR7 Q;  4QJF A;  1YHB A;  4LF8 Q;  4OWW B;  4FF2 A;  4OO1 G;  5M5W B;  2N49 A;  3MC0 B;  2UUB Q;  1NR2 A;  3R8B A;  1FJG Q;  4CKB A;  3BVG A;  2D2C C;  2BH8 A;  3T1Y Q;  5LMN W;  3GTJ H;  3J81 E;  4K0K Q;  5EPK A;  5FO7 B;  3CCS A;  1W6J A;  4RG1 A;  1GUT A;  1EY5 A;  3TS2 A;  3VYT A;  3TP8 A;  4DR6 L;  1I94 Q;  4GNX A;  2NVT B;  1VQ4 A;  4AQY Q;  2E74 C;  1ET6 A;  1HNW L;  2VQF Q;  2B2U C;  5C4X B;  3HOU B;  3TSS A;  2UXD Q;  3PMF A;  1QJO A;  4IPH A;  2JA7 H;  1QVF A;  1BCP B;  4PQX A;  3NWT A;  4LUO A;  4DV1 Q;  2KEN A;  4UAI A;  2KBN A;  2NUC A;  1H9M A;  1HR0 W;  3K58 A;  1VQM A;  2SOB A;  3S1N H;  1K28 A;  4MIU A;  3K7A H;  2IT1 A;  3GTQ B;  2O5J C;  1YEZ A;  3PO3 H;  3CXC A;  1PRT F;  2RSO A;  2Z4H A;  2NN6 G;  2R3Z A;  2ID0 A;  1PZK D;  3G71 A;  4LNQ A;  5JJI A;  1JT8 A;  2LY7 A;  1PH8 A;  1PRT B;  2FMC A;  2XSC A;  4OIJ A;  4JI3 L;  2CW0 C;  3T1H L;  1XJV A;  3C1E A;  4L5T A;  2B63 B;  2J4X A;  1KIX A;  4CHT B;  4C1N K;  2PW5 A;  1B3A A;  2F0P A;  3D0F A;  1CK1 A;  1HZA A;  1C48 A;  2RF4 A;  4R8N A;  1ONL A;  2VY3 A;  3OWF A;  1FL0 A;  1U4R A;  5IOD A;  4BY1 G;  2I0Q A;  2WB1 B;  5I2X A;  4JI0 L;  1DCZ A;  1V8Q A;  4RHS A;  2JA5 B;  2WKD A;  1A3V A;  3PIP A;  1G6P A;  3CCU A;  2F0N A;  3CC7 A;  2BDO A;  5EPL A;  4OWX B;  3BYY B;  1UUP A;  2N78 A;  4DR4 Q;  5CR3 A;  4A3I B;  1VQD A;  3U50 C;  4A3L H;  4LFC L;  4GLV B;  2AQ3 B;  1BBX C;  4HIK A;  1EQR A;  1PYW D;  5FJ8 H;  3GTM B;  2QF7 A;  1G29 1;  3E3X A;  2OCE A;  4NW2 A;  3BDL A;  3SK4 A;  4G7H C;  1LTR D;  3W5O A;  3BJU A;  2Q2I A;  4YCV A;  3T16 A;  1T5X D;  3GV3 A;  2Z6K A;  1K0R A;  1X3F A;  4DV6 L;  1S3O A;  4R4O A;  2VW9 A;  1TVX A;  1BBW A;  1A62 A;  3M3Y B;  2IX3 A;  2OQK A;  2VUM B;  2PI2 A;  5F2D A;  4C3H H;  5I6Y A;  5A35 A;  4DUY Q;  3TZU A;  4QCL A;  1UE7 A;  1BNZ A;  4ZAI A;  2VQE Q;  2DJF C;  3U4Z A;  4MHE A;  1B2T A;  5LMN L;  1KRS A;  2LKV A;  1O80 A;  4KLK A;  2I07 B;  2NTS A;  3LGJ A;  3KLR A;  2GVA A;  4HED A;  5IT9 L;  2JA8 H;  4NDX A;  1ENC A;  1LM0 A;  4GNX C;  4POF A;  1V1P B;  4UPA A;  2L11 A;  4L63 B;  2IY5 B;  1WD1 A;  4DV0 Q;  1Y1W H;  1PTO F;  1TT2 A;  1X9N A;  2N55 A;  1SEB D;  1XPU A;  3I4M G;  2OF1 A;  4DPG A;  3PUV A;  1F2Z A;  2MJ8 A;  3DM1 A;  2DNC A;  3MZ5 A;  5EJW A;  3DLL A;  1VQP A;  5IYC G;  4JI5 L;  1O78 A;  1SNM A;  4PZ7 A;  3I3C A;  1HR0 L;  3GTG H;  1PA6 A;  1UEA B;  1YVC A;  4C1N I;  3HOW H;  3IKJ A;  3DHQ A;  1YJW A;  1A3U A;  1HH2 P;  5LMU Q;  4B3M Q;  2D62 A;  3K5N A;  3K5L A;  3PV0 A;  4HAE A;  4C2M B;  1S5D D;  3J7A 5;  3L7Z C;  1PFN A;  4IOA A;  2AHO B;  4GKJ Q;  4DNT B;  4KY5 A;  5HGQ A;  4K8I A;  1TS5 A;  4A3E H;  2K14 A;  1TWA H;  4GN3 B;  1B70 B;  2O5I C;  4O2D A;  4IUU A;  4BY7 G;  3QOL A;  2K03 A;  1XMO Q;  3SDZ A;  2KEE A;  3U4V A;  3DXJ C;  1SSO A;  2R92 H;  1ASY A;  2D0P A;  2WB1 G;  2IHE A;  4GN4 B;  4YWM A;  1LV9 A;  2K05 A;  3S2D H;  1U0L A;  2KJX A;  1YIT A;  1EYC A;  5BN4 A;  3J81 j;  4N9P A;  2C35 B;  1KLG D;  3FHW A;  4IUN A;  1STY A;  5COR A;  1EFW A;  4A3I G;  4MNO A;  1VQ5 A;  3RLO A;  1I4X A;  4R9W A;  3W1B A;  4IUV A;  2K5W A;  5ELO A;  4JI1 L;  3C3L A;  3AFQ A;  4KD3 A;  1WFQ A;  2A1A A;  2WII B;  3K7A B;  1S5E D;  1YHQ A;  1MBY A;  2Z6K C;  4AYB G;  3A74 A;  3T51 B;  3PO3 B;  3FVQ A;  1B44 D;  1EQQ A;  2KEC A;  1GM5 A;  1XNQ L;  1SE8 A;  4WJ3 M;  3W3A A;  1IBM L;  1IXR A;  4I65 A;  1TS2 A;  3EFX D;  4FF1 A;  4GKK Q;  5GQO A;  5HY6 A;  3ERS X;  3M4Y A;  3MHB A;  4ODG A;  4P72 A;  1CUK A;  4H02 A;  4ZKB B;  1TQO A;  3S14 H;  2VUM G;  1XTC D;  5FO9 B;  5FLM H;  4IN3 A;  2ASB A;  2EXD A;  2PO4 A;  2JP1 A;  2EY2 A;  1WTQ A;  5C4H A;  4AH6 A;  3VR6 A;  3AYH B;  4LFB L;  1JJC B;  4UHV A;  1HRJ A;  3VYU A;  3OTO L;  4X64 Q;  4LMQ D;  2ZTE A;  1D5X C;  2DGY A;  2PPB C;  1YIJ A;  1IBL L;  2C9O A;  4A3B H;  3CAM A;  1VQ6 A;  4V19 0;  3MFG A;  4R4I A;  1GVP A;  5I2Y A; 
#chains in the Genus database with same CATH homology
 4IPG A;  3BZC A;  4B3R Q;  4YY3 Q;  3J80 c;  2PQA A;  2A8V A;  5C4X G;  1QUQ B;  2A19 A;  2MNA A;  3GDE A;  3RNU A;  1YI2 A;  3HOU G;  2UXC Q;  2VZA A;  1OXU A;  3JC6 6;  5GRO A;  3HOV G;  5C44 G;  2R7Z H;  4A3B G;  1FGU A;  5E7N A;  1RIP A;  5IWA L;  4DK3 C;  2Y0S G;  5J3B A;  4R4Q A;  1N32 L;  4APV A;  1VQI A;  2NZO A;  4QQB X;  1VQN A;  4A3M H;  4PZ6 A;  3PF5 A;  3CC4 A;  1YNX A;  4DR3 Q;  4OWT B;  1X55 A;  1PV4 A;  1SLJ A;  4DV6 Q;  1FVI A;  3KFU A;  1L1O A;  4LF5 Q;  5M3F G;  4LW1 A;  2B3G A;  3M4O H;  2ATW A;  3PF4 A;  4A3J G;  1D8L A;  4FDB A;  3HKS A;  2NVQ H;  1V43 A;  4LWC A;  4BBR H;  1A63 A;  1E3P A;  1R9T H;  4A3I H;  1N8R C;  4DR4 L;  3EIV A;  5IYB G;  4A3D H;  2YTY A;  1VQG A;  4QY7 A;  3GO5 A;  1N36 Q;  4A3C H;  1EWI A;  1M90 C;  4LF7 Q;  4JI6 L;  3HOZ H;  1VQ9 A;  2JA6 H;  1TXY A;  5C3E H;  3HFZ B;  3ZJY C;  2K5N A;  3NEN A;  4UP8 A;  1Q82 C;  4IJL A;  1EOV A;  1OXX K;  1PH3 A;  4DKA C;  2KCM A;  3OW2 A;  1QVG A;  4XIG S;  4LUZ A;  2UXB L;  5LMN Q;  3J81 i;  2NN6 I;  4PMW A;  4Y52 H;  4L5Q A;  4Y7N H;  1OXV A;  2B63 G;  1CKN B;  3MEF A;  3PGZ A;  3A5U A;  4DV2 Q;  4IFD I;  1E7Z A;  1B8A A;  1I5F A;  3PUZ A;  3KF8 B;  4R4T A;  5ELN A;  1KL9 A;  3BU2 A;  4UP9 A;  4KHZ A;  4BA2 I;  1CKM A;  3A5Z B;  2KHI A;  1VQA A;  2F3I A;  4L5R C;  1PFS A;  2AWO A;  1SR3 A;  1IBK Q;  1JB7 A;  2JA5 G;  2E2J H;  2VUM H;  4JI2 Q;  3CPW A;  1C9O A;  1HJP A;  4O0A A;  1LUZ A;  3CMA A;  1KXL A;  2PMZ E;  4BA1 I;  4DUY L;  4DNI A;  2JEA I;  1AE3 A;  1X3E A;  4BBS H;  4KHP Q;  1J5E Q;  3PO2 H;  2F52 A;  2VQE L;  2UUA Q;  3H0G G;  2JA7 G;  1N9W A;  1JE5 A;  5GAD C;  4JI5 Q;  1N33 L;  2PQA B;  3VDY A;  1HR0 Q;  4JYA Q;  1NE3 A;  4HID A;  5FLX c;  3K0X A;  4X64 L;  3ICE A;  1SRU A;  1EYG A;  4LF9 Q;  1Q1E A;  3FP9 A;  4BY7 H;  2K75 A;  5IE8 A;  3HOW G;  4JG2 A;  5EAY A;  4LFA Q;  1KC8 C;  5IY0 A;  4DK6 C;  2AMC B;  1XTD A;  1KQS A;  3F2B A;  2ZJP A;  4DV0 L;  1PH7 A;  4LF4 L;  3PO3 G;  2MFI A;  4X65 Q;  4BXX G;  5C4X H;  1K8G A;  5GAE C;  1L1O B;  3HOU H;  2CFM A;  4JI8 Q;  1OTC A;  3HOV H;  4A3B H;  1N34 Q;  4X66 L;  5C44 H;  3KF6 A;  2PI2 E;  2WP8 J;  1GO3 E;  2HIX A;  2LXJ A;  3FKI G;  2GN5 A;  4QIW E;  3CCQ A;  2FXQ A;  4NXM L;  1WI5 A;  4GLX A;  4IPC A;  4HJ5 A;  3S16 H;  5GAH C;  2N3S A;  4A3F G;  2B29 A;  3KYH C;  1NMF A;  3NBH B;  1YZ6 A;  4DAM A;  3L2P A;  3CME A;  5JEA G;  1PH2 A;  1VQH A;  2H5X A;  1RL2 A;  4C3I H;  5M3F H;  2OTJ A;  4JBM A;  1PYB A;  5AJ3 L;  4A76 A;  1VCI A;  2NVX H;  3E9I A;  1SMX A;  4A3J H;  2RHS B;  1Y1V H;  3GTQ H;  2WAQ E;  3OYY A;  4DV4 Q;  2R7D A;  4QGU A;  1I50 H;  5LMU L;  4JC0 A;  5K36 G;  4DV3 Q;  5IYB H;  5IYD G;  2I5H A;  2JJQ A;  2CQO A;  2EQS A;  3RLF A;  1W2B A;  2K5H A;  1XMQ Q;  2MQH A;  3TQY A;  1E1T A;  1VQL A;  1JJG A;  3CCR A;  3CCL A;  2ES2 A;  1N36 L;  4P75 A;  5BR8 L;  3PIO A;  2UUC L;  4LF7 L;  4DR5 L;  4DR7 Q;  4QJF A;  1EIY B;  3IRB A;  1L2F A;  1YHB A;  4DV7 L;  4MTN A;  4B3T Q;  4GKJ L;  4LF8 Q;  4A3G G;  2IX1 A;  4OWW B;  4OO1 G;  3CF5 A;  2N49 A;  2UUB Q;  2OWO A;  2HIV A;  4KI0 A;  1FJG Q;  2IHF A;  1V1Q A;  2KCT A;  2BH8 A;  3T1Y Q;  3RR5 A;  4JCV E;  2B63 H;  5LMN W;  3GTJ H;  1U5K A;  4X62 L;  4A3L G;  3I4N G;  4LF6 L;  2BA1 A;  4JV5 Q;  1MJE A;  4K0K Q;  1XMO L;  3H15 A;  1J6Q A;  1E1O A;  4RG1 A;  3CCS A;  4OX9 L;  3CQZ H;  5FJ8 G;  3TS2 A;  1VQF A;  1X3G A;  2HHH L;  1YJN A;  1X56 A;  2MO0 A;  3RLN A;  2JA5 H;  1I94 Q;  3ULJ A;  1VQO A;  4DR6 L;  3J7Z C;  1Q8K A;  1XNQ Q;  4GNX A;  1L1O C;  1VQ4 A;  4AQY Q;  1BKB A;  3K81 C;  3JAM i;  1QZH A;  5C0X I;  4JI2 L;  1HNW L;  2VQF Q;  3RN2 A;  1QVC A;  2Z0S A;  1KD1 C;  1IBM Q;  1H95 A;  3ULL A;  4DAY B;  4NPS A;  3MXN B;  3U58 A;  2UXD Q;  5M3M G;  1TWC H;  4YHH Q;  3M9B A;  4IPH A;  3H0G H;  4B3S L;  2JA7 H;  3RZO H;  1QVF A;  1B7Y B;  2E2H H;  3AEV A;  1CSQ A;  4DR1 Q;  4NXN L;  4LUO A;  4DV1 Q;  2ZM6 Q;  2KEN A;  2KBN A;  1VS0 A;  3STB D;  4JI4 L;  1NMG A;  3KF6 B;  1HR0 W;  3GTM H;  1VQM A;  3M4Q A;  3S1N H;  4JYA L;  1NBW A;  4RMF A;  4DUZ Q;  3K7A H;  1VQJ A;  3CPF A;  1JMC A;  2HQL A;  1M1K C;  2IT1 A;  3E9H A;  2JK8 A;  4LFB Q;  2BH2 A;  1YEZ A;  3HKZ E;  2F4V L;  2XGT A;  3TS0 A;  3PO3 H;  1X65 A;  1PH6 A;  2HT1 A;  3G48 A;  4TQU S;  3OTO Q;  3CXC A;  1Q46 A;  1Q1B A;  4BXX H;  1PVO A;  2NN6 G;  1IZ6 A;  1VQC A;  4DV5 Q;  1XPO A;  2JEB I;  2YTX A;  3S1R H;  2ID0 A;  3G71 A;  4LNQ A;  3GTK H;  5JJI A;  4HJ9 A;  1HNX Q;  4IFD G;  3FKI H;  1JT8 A;  2ZTD A;  1PH8 A;  1IBL Q;  2JA8 G;  4GOP A;  3G6E A;  3M3Y H;  1PH1 A;  1N34 L;  2L15 A;  3PUY A;  1HNZ Q;  3F8T A;  4JI3 L;  2KHJ A;  3I55 A;  2K52 A;  3UDG A;  3T1H L;  1XJV A;  4JOI A;  4GKK L;  1D7Q A;  4IO9 A;  3CCV A;  2WAQ G;  4A3F H;  1Y1W G;  2R93 G;  3BZK A;  4L5T A;  1PHJ A;  1KIX A;  1Z47 A;  1CSP A;  5JJK A;  3D0F A;  3E0E A;  1AH9 A;  1HZA A;  2RF4 A;  2VY3 A;  5IP9 G;  1FL0 A;  4WJ4 A;  2QGQ A;  1A8V A;  3KJO A;  1KAW A;  2RCN A;  4BY1 G;  1GD7 A;  2I0Q A;  1VQ8 A;  5IYD H;  4JI0 L;  4DV3 L;  2QEX A;  1YHA A;  3KOJ A;  3GTL H;  3F2C A;  1IYJ B;  3PIP A;  1XMQ L;  2UU9 Q;  1Q7Y C;  1G6P A;  3S2H H;  4A3G H;  4MZ9 A;  3CCU A;  2E5L L;  3GD7 A;  2E8G A;  3CC7 A;  4OWX B;  3A0J A;  4OXP A;  1WJJ A;  4JI7 L;  2ZJQ A;  1QUQ A;  1TWF H;  4DR2 Q;  4POG A;  4HIO A;  3HOX G;  3H3V H;  2N78 A;  4DR4 Q;  1VQD A;  3U50 C;  4EQ5 A;  4A3L H;  4LFC L;  4GLV B;  2LXK A;  4R1J A;  1EIF A;  1SFO H;  4JI6 Q;  4B3R L;  4YY3 L;  5H1S E;  3K8A A;  1XNR Q;  4A3C G;  1A0I A;  3M4P A;  2ALY B;  3G4S A;  4HIK A;  1EQR A;  1TWG H;  5FJ8 H;  2UXC L;  2CWP A;  1G29 1;  5JEA J;  2D0O A;  3PCO B;  1Y14 B;  2OCE A;  4HIM A;  2E2I H;  3W5O A;  1TWH H;  3BJU A;  2AKW B;  2Q2I A;  3PSI A;  4A3E G;  4YCV A;  1E22 A;  2UXB Q;  1VQK A;  1K3R A;  2NZH A;  1NJI C;  4PZ8 A;  2OQ0 A;  1L0W A;  3UDX A;  3NEL A;  3UDF A;  2EIF A;  4YWK A;  2Z6K A;  4DR3 L;  1K0R A;  1X3F A;  4DV6 L;  1UE1 A;  1S3O A;  3DM3 A;  3EBE A;  4R4O A;  5M3M H;  1QZG A;  2VW9 A;  4LF5 L;  1BBW A;  4ALP A;  1A62 A;  2MO1 A;  2R92 G;  3I4N H;  4C2M H;  1UEB A;  2OQK A;  2YTV A;  1K83 H;  1PH9 A;  3M7N A;  3ER0 A;  2PI2 A;  1CKO A;  4C3H H;  1XPR A;  3KDF A;  3HKZ G;  3RN5 A;  4IPD A;  1BBU A;  4DUY Q;  4GOP B;  1UE7 A;  2I5L X;  2AWN A;  1PH4 A;  1VQE A;  4NB3 A;  4X6A H;  4EX5 A;  5GAG C;  3PUX A;  4A75 A;  2VQE Q;  3U4Z A;  1WOC A;  1MJC A;  4GLA C;  3UE1 A;  1Q81 C;  1P8L A;  2CWA A;  3CCM A;  5LMN L;  1N33 Q;  1KRS A;  1K73 C;  3PO2 G;  4KLK A;  4JI1 Q;  4YCU A;  1OXT A;  3LGJ A;  2GVA A;  4DV2 L;  1JJ2 A;  3J80 i;  2JA8 H;  1LM0 A;  4GNX C;  4A93 G;  4POF A;  1PYS B;  4UPA A;  4YCW A;  3CCJ A;  1IBK L;  2IY5 B;  3KLW A;  2RHQ B;  4DV0 Q;  1UWV A;  1Y1W H;  4LF4 Q;  1X9N A;  1NTG A;  1IL2 A;  1WYD A;  1XPU A;  3I4M G;  3TRE A;  4DPG A;  5C0X G;  4X66 Q;  5IP9 H;  3PUV A;  4C3J H;  4AYB E;  2ZJR A;  4BY1 H;  4NXM Q;  3SGI A;  4KHP L;  1J5E L;  1MIU A;  3DLL A;  1VQP A;  1EUJ A;  5IYC G;  2UUA L;  2GVB A;  4JI5 L;  3TEH B;  3JAM c;  4P73 A;  4PZ7 A;  1HR0 L;  4XTC S;  4B3S Q;  3GTG H;  1PA6 A;  1YVC A;  5FLM G;  4PG3 A;  3HOW H;  5AJ3 Q;  1WCM G;  3K80 C;  1YJW A;  1SN8 A;  4JBK A;  2UU9 L;  4IJH A;  4HJA A;  4LF9 L;  1HH2 P;  3HOX H;  5LMU Q;  4B3M Q;  3F1Z A;  4IFD J;  2D62 A;  1P16 A;  4AIM A;  2Q2T A;  4LFA L;  3UDI A;  4DR2 L;  4A3K G;  1Y1V G;  2K5V A;  5JJL A;  3PV0 A;  2JQO A;  3EN2 A;  1ASZ A;  3HOY G;  4GOP C;  1W3S A;  3J7A 5;  4X65 L;  3L7Z C;  2UUC Q;  1Q12 A;  5BR8 Q;  2YU9 H;  4HJ7 A;  3S15 H;  4JOI C;  4IOC A;  4JI8 L;  4DR5 Q;  4DV7 Q;  2AHO B;  4IOA A;  1XNR L;  4UP7 A;  1YBY A;  4GKJ Q;  3CC2 A;  5HGQ A;  5C4J H;  4YWL A;  3J81 c;  4A3E H;  4GS3 A;  3L0O A;  1NY4 A;  2K14 A;  1TWA H;  4GN3 B;  1S72 A;  1B70 B;  4OON A;  3KDF B;  1X6O A;  4X62 Q;  4P71 A;  4O2D A;  4BY7 G;  1BVS A;  2CCZ A;  5IP7 G;  4LF6 Q;  4R4C A;  4HJ8 A;  2YV5 A;  1XMO Q;  1HZB A;  1K8A C;  3UE0 A;  1LYL A;  2XTI A;  3U4V A;  4OX9 Q;  2NVY H;  5IWA Q;  3I56 A;  1N32 Q;  2R92 H;  2HHH Q;  2N8N A;  2R6G A;  2R7Z G;  4DV4 L;  2ZTC A;  4DR6 Q;  2Q2H A;  1V9P A;  2VNU D;  1ASY A;  2D0P A;  2WB1 G;  2PNH A;  2IHE A;  1AE2 A;  2LSS A;  4GN4 B;  4YWM A;  3S24 A;  5M5X H;  3F2D A;  1HNW Q;  3S2D H;  4A3M G;  4L5S A;  3GTO H;  1U0L A;  1YIT A;  1UE5 A;  4DR7 L;  2Y0S E;  4B3T L;  3J81 j;  4LF8 L;  1OXS C;  2C35 B;  2R7F A;  3K7U C;  3WWV A;  4GNX B;  5DLQ E;  5M5W H;  3FHW A;  3D31 A;  4LUV A;  2UUB L;  1MKH A;  2V1C C;  4BBR G;  5M5Y H;  1EFW A;  4NXN Q;  3T1Y L;  4A3I G;  4MNO A;  1FJG L;  1VQ5 A;  3RLO A;  4P74 A;  3W1B A;  3CCE A;  2QA4 A;  4GN5 A;  1S40 A;  2K50 A;  3PUW A;  4JI4 Q;  4A3D G;  5ELO A;  4JI1 L;  4JV5 L;  3HOZ G;  2JA6 G;  3AFQ A;  4JBJ A;  4K0K L;  2JE6 I;  5C3E G;  4A93 H;  2I5M X;  1T9H A;  1HZ9 A;  3CP0 A;  1WFQ A;  2A1A A;  3KJP A;  2DUD A;  2JA9 A;  3M85 A;  1HZC A;  4QL5 A;  1YHQ A;  1C7Y A;  1Z9F A;  2F4V Q;  1X54 A;  2Z6K C;  4AYB G;  3A74 A;  1I94 L;  3CD6 A;  1KHI A;  1EQQ A;  1GM5 A;  3NEM A;  1XNQ L;  2Q2U A;  2NVT H;  1E24 A;  3I4M H;  4AQY L;  3ULP A;  1SE8 A;  1VQ7 A;  4WJ3 M;  2VQF L;  4ME3 A;  1IBM L;  1IXR A;  3I4O A;  4A4I A;  3AQQ A;  2UXD L;  4J15 A;  3W1G A;  4JI3 Q;  2OTL A;  3S1Q H;  4YHH L;  1G51 A;  3Q8D A;  5IYC H;  1LTL A;  3T1H Q;  4GKK Q;  2BA0 A;  2WFW A;  5GQO A;  3ERS X;  5HY6 A;  4P72 A;  1PH5 A;  1CUK A;  4H02 A;  1YJ9 A;  4DR1 L;  3S14 H;  1O7I A;  2VS1 A;  1KRT A;  4DV1 L;  2ZM6 L;  2VUM G;  4TVA B;  5FLM H;  2YYZ A;  1WCM H;  1GKH A;  3I2Z A;  1CKN A;  2EXD A;  2ASB A;  1Q86 C;  2WB1 E;  4JBW A;  3S17 H;  1DGS A;  4DUZ L;  1K9M C;  3B6Y A;  1C0A A;  1UE6 A;  4BBS G;  2K4K A;  4A3K H;  4AH6 A;  3AYH B;  4JI0 Q;  3GTP H;  4B3M L;  1JJC B;  3HOY H;  4LFB L;  3CW2 C;  3OTO L;  4UY8 C;  3TRZ A;  3AFP A;  4X64 Q;  1SRO A;  3I7F A;  4DV5 L;  3RZD H;  2ZTE A;  2DGY A;  1I3Q H;  1HNX L;  2E5L Q;  1YIJ A;  1IBL L;  4JI7 Q;  4OO1 I;  3CAM A;  1VQB A;  5C0X J;  1HNZ L;  1VQ6 A;  3STB C;  5IT9 c;  3H3V I;  3S1M H;  1I6H H;  2R93 H;  4R4I A;  2VL6 A;  1GVP A;  2CKZ B;  4LFC Q;  2IX0 A;  5IP7 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...