4LFCQ

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 19
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4lfcQ00
3W1GA 1XJVA 1HNWL 3H3VI 2UU9Q 2CWPA 1N32Q 2RHSB 1G291 4X64Q 2ZM6Q 3KYHC 2KCTA 2UXDL 3HKSA 3CCUA 4IO9A 2WAQE 1FJGQ 5IYCH 1NMFA 5JEAG 1WJJA 2WB1G 4RMFA 4JOIA 1TWHH 2L15A 3CC2A 5C4XH 2NVYH 2KBNA 4BXXG 1SR3A 1W2BA 4UPAA 1G51A 3S1RH 1VS0A 1I6HH 2HIXA 1NBWA 5C4XG 5IWAQ 4DR2Q 1JB7A 2BH8A 4IPHA 1MJCA 2LXKA 2NN6I 3T1YQ 4QY7A 1JE5A 1J6QA 2B3GA 3A5ZB 4GNXA 4IPDA 1FGUA 1EWIA 4C3HH 5IWAL 1CKNB 4ALPA 2YV5A 4DR2L 1BKBA 1RL2A 2K50A 3GTQH 1K8GA 4P72A 4DR3L 3A74A 5LMNL 4DR1L 1E3PA 2NN6G 4GKJQ 1WCMH 2ZTDA 1GVPA 1VQDA 2VQFL 4JBKA 1Y1WG 3CC4A 4OO1G 1VQ4A 1Q7YC 3I4OA 5JJKA 4DUZL 4AH6A 1JJ2A 1HR0Q 4JI8Q 3CCMA 4BY1G 4LFAQ 2ID0A 3U4VA 3ULJA 4UP9A 2XTIA 4LFBL 4R4IA 1VQFA 2VUMH 5C0XG 3J81i 3GTMH 3CMAA 4P73A 1OXXK 3KDFA 2ZJPA 4YCUA 4JI3Q 2NVTH 1XNQL 1IL2A 3DM3A 1N33L 4XTCS 2F52A 1QVFA 3A0JA 4DV7Q 1U0LA 3M85A 4POGA 2QA4A 2UU9L 1Q8KA 3PO3G 4JI5L 4J15A 3JC66 3DLLA 1YHQA 3HOVH 1EOVA 1E1OA 5LMNW 5HY6A 2VNUD 5BR8L 3UE0A 2MQHA 2VL6A 1FJGL 1X6OA 5IT9c 4IPCA 5C0XI 3HOXG 3H3VH 3G6EA 1FL0A 1NY4A 2JEBI 4C2MH 1PV4A 2R93H 3S24A 3I56A 2HT1A 4AYBE 5GROA 1SMXA 1N32L 3NELA 1AE3A 5FJ8H 1VQAA 2K5VA 1EQRA 4JCVE 5LMNQ 4KLKA 1PH6A 2VQEQ 3FKIG 1CKMA 3HOZH 3CP0A 2YU9H 4OONA 4JI2Q 4A4IA 2HIVA 1CUKA 1LUZA 3PV0A 5FLXc 2Q2TA 2IHEA 1KC8C 1JT8A 5M3FH 1YI2A 1VQ8A 5IP7G 1X56A 2VS1A 4DUZQ 2ASBA 2LXJA 1P16A 4YY3Q 4DV1Q 4DV5Q 1TWCH 4PZ6A 1VQLA 4WJ4A 2MNAA 1XPOA 3F1ZA 5IP7H 4K0KQ 2BH2A 2CFMA 3AYHB 4LUVA 3PO2G 2PI2E 4DUYL 4GKKQ 4LFBQ 4JI5Q 1YJWA 1SFOH 1AE2A 1N9WA 4A93G 1M90C 3JAMi 4H02A 3NEMA 5IYBG 3I7FA 4LNQA 4HIKA 1W3SA 3HKZG 4NXNL 3UDXA 5C44H 1XPRA 5IP9H 3HOYH 1VQPA 4UY8C 2Z6KC 1VQBA 4JI6Q 1Q86C 1VQOA 2AWNA 3PUZA 4LUZA 4LF5L 2Q2UA 3S15H 1XNRQ 3U50C 3CCVA 1VCIA 2C35B 4NB3A 4DV2L 1PH7A 4BY7H 1IBLQ 1Q81C 5IYDH 4IFDI 2KCMA 3W5OA 1HR0L 4JC0A 1I50H 2OTLA 1TWFH 4JI8L 1SLJA 4LF7Q 4NXMQ 2B63H 2GVBA 3KJOA 2V1CC 3T1YL 1XMOL 2R92H 4IOAA 1Q1BA 2PNHA 4DK6C 4JBWA 3ZJYC 4K0KL 3ERSX 2RF4A 1SE8A 4EQ5A 1XPUA 3J7A5 1B70B 5ELOA 2QEXA 4LF6Q 2JA6H 4JI0L 2I0QA 4DR5Q 4JI2L 4DR1Q 2K5HA 4GOPC 2K14A 1NE3A 2NVXH 2PQAA 1IBKL 3PGZA 4A3GG 2N78A 3ICEA 2K52A 1E22A 3STBC 4A3BH 3KFUA 3M3YH 2UUCQ 1XMQQ 1ASYA 5C3EH 2UXCQ 3HOUH 1QVCA 1IYJB 4A3BG 4DR6Q 2I5MX 2LSSA 1I94Q 5C3EG 1M1KC 1HNXQ 2YTYA 1IBLL 4P75A 1Q46A 2WB1E 1SN8A 4IJHA 4X66Q 4GOPA 1XMQL 1X3FA 4LWCA 4OXPA 2CKZB 3GDEA 2VW9A 1KQSA 5JJIA 4AIMA 1YVCA 4GLAC 4YWMA 4LFCL 4JI6L 1KRSA 4OWWB 2A8VA 4DNIA 2IX1A 3RN2A 4C3JH 3TS0A 4A3IH 2XGTA 4HIOA 1HNZQ 1X65A 3K7UC 2MO1A 1V9PA 4A3IG 2NZOA 4YCWA 3K81C 4A75A 1EUJA 4WJ3M 2Z0SA 1Z9FA 4DUYQ 1HZ9A 3B6YA 4R4OA 3TEHB 1EIFA 2DUDA 1KRTA 4HJAA 4RG1A 2UXBQ 1EIYB 2BA0A 1PH9A 4NXNQ 2GVAA 2R93G 2GN5A 1TXYA 3K8AA 3G4SA 3RZOH 1CKNA 1T9HA 1HNXL 5J3BA 2VQEL 2UXBL 3GTJH 3J80i 3RR5A 3G48A 4GN4B 5C4JH 1XNRL 3HOZG 3GTKH 2EXDA 4YHHL 2WAQG 2ZM6L 2CCZA 4LFCQ 4LF4Q 3S16H 2UXDQ 4YY3L 3M7NA 2PMZE 2F4VQ 4BBRH 3S14H 4YWKA 3WWVA 1WI5A 4GN5A 4GNXC 4PZ8A 2B29A 3S1QH 1UEBA 4BBSG 5M5WH 2QGQA 3E0EA 1YJ9A 4JBMA 2CWAA 3PO2H 1Y1VG 4BBSH 4MTNA 4JBJA 3OTOQ 4X6AH 3H0GG 1JMCA 5M3FG 1X9NA 2OWOA 1UWVA 4A3MH 4YCVA 4QIWE 4L5RC 1OXVA 2D62A 1PH8A 4IFDG 4PZ7A 4BA2I 5JJLA 2R7FA 4A3FG 1D7QA 3KLWA 3KF8B 4R4TA 2VZAA 1YNXA 2Q2IA 1KXLA 3M4PA 1KIXA 3GTOH 4B3TQ 1HZAA 1S72A 4DAYB 3UDGA 3GTGH 1QUQA 4B3RL 3HOWG 1L1OC 4HJ9A 1U5KA 2UXCL 4IPGA 3RLOA 5C44G 1IBMQ 2E2IH 2R7DA 4P71A 1VQ7A 1PH4A 4B3MQ 4DR6L 4A3DH 4Y7NH 2NVQH 3T1HQ 1NJIC 3ER0A 4B3RQ 5LMUL 1VQJA 1C9OA 4QGUA 1XMOQ 4POFA 3CCSA 3OW2A 3FP9A 2JA8G 4R4CA 1A62A 4Y52H 1QZHA 4PMWA 4HJ8A 5GAEC 1O7IA 1WFQA 4JI0Q 4DV3L 1VQNA 4DR5L 3MEFA 2DGYA 1OTCA 1IZ6A 5H1SE 1K3RA 5ELNA 2D0OA 4GNXB 2B63G 2AKWB 3CF5A 1XNQQ 2HQLA 1X55A 4PG3A 1HZBA 4OX9L 2R92G 4LW1A 4DPGA 1N36Q 4A3GH 4OWTB 2MFIA 1OXTA 4IOCA 4QQBX 4BA1I 2UUCL 1GD7A 5AJ3Q 3AQQA 4JYAL 1Q12A 4C3IH 3RZDH 3G71A 4NPSA 3L7ZC 3F2DA 4A3KH 1N36L 3J81c 2E8GA 3CCLA 1A0IA 2A19A 3FHWA 1B8AA 3W1BA 3L0OA 2RCNA 1JJGA 4LF5Q 4JYAQ 3BZCA 5LMUQ 1RIPA 5C0XJ 1PYSB 4DV0L 1FVIA 1WCMG 3F8TA 4DAMA 3PUXA 1Y1WH 3GO5A 4GLXA 3M9BA 1GKHA 1VQIA 2NZHA 2YTXA 4A3JG 4YHHQ 1R9TH 1X3GA 2A1AA 3CQZH 2UUBQ 2K4KA 1WYDA 3AEVA 2VUMG 4QJFA 3NENA 1N8RC 3I55A 3GTPH 4TQUS 4HIMA 2UUBL 1UE6A 2ZJRA 4QL5A 4BY1H 4DR7Q 3VDYA 3GTLH 4A3EH 4B3TL 4DV1L 4DV5L 4JOIC 3L2PA 4GN3B 3UE1A 1L1OA 4GOPB 3I2ZA 3KDFB 1K8AC 5M3MG 1IBKQ 3D31A 3CD6A 1LM0A 3HOVG 3HFZB 2WP8J 2IX0A 2KENA 3OYYA 2E2JH 2FXQA 3T1HL 3S2DH 2OTJA 2IY5B 2Y0SE 4O2DA 1K9MC 3D0FA 2UUAL 1YEZA 3PO3H 1MKHA 4AYBG 1GM5A 4A3LG 3PCOB 1WOCA 3E9HA 1KD1C 3MXNB 2PQAB 4DV0Q 3KF6A 4LF4L 1IBML 1PH3A 1ASZA 2JA7G 1VQ9A 3TQYA 3A5UA 3HOXH 1I3QH 4BBRG 3PUWA 2JEAI 4JG2A 4DV2Q 4YWLA 1C0AA 2EQSA 4FDBA 4O0AA 1VQ5A 4LF9L 4LFAL 1MIUA 5DLQE 1NMGA 4AQYQ 1L1OB 1Q1EA 3U4ZA 4DR4L 1UE7A 3S17H 5AJ3L 3FKIH 4IJLA 3NBHB 4A3MG 1Q82C 5GAGC 3PIOA 2E2HH 1Z47A 4A3FH 1N33Q 2E5LQ 4APVA 3RNUA 1K0RA 1E1TA 4JI4Q 4GLVB 3BU2A 1VQ6A 1YIJA 1A8VA 2H5XA 1JJCB 4TVAB 1VQGA 2UUAQ 1KL9A 5IP9G 1YHAA 2F4VL 1QUQB 2AWOA 5FLMH 1HR0W 4HJ5A 3K0XA 2YYZA 3PIPA 3IRBA 4HJ7A 5IYBH 1VQMA 3M4QA 5FLMG 1AH9A 3ULLA 2JJQA 1BBUA 1EYGA 1SRUA 1QZGA 1SROA 4JV5Q 1A63A 2K75A 4BY7G 4DR7L 3HKZE 2JA8H 4L5TA 4EX5A 1D8LA 4DV4Q 4DV6Q 1K73C 4JI1Q 2HHHL 4L5SA 4LF8L 4A3DG 1HNWQ 5HGQA 4B3SL 4KHPQ 1KHIA 3CC7A 4HIDA 2RHQB 4OX9Q 1CKOA 2Q2HA 1GO3E 5IYDG 1J5EL 2JA9A 1PFSA 3LGJA 3PF4A 5E7NA 2D0PA 4ME3A 5IYCG 1YITA 4JI7Q 1E24A 2PI2A 3E9IA 1EQQA 3U58A 2EIFA 5JEAJ 4OWXB 3ULPA 3PF5A 4B3SQ 4BXXH 1I5FA 2YTVA 1BVSA 3CAMA 1N34L 3BZKA 3S2HH 1V1QA 2R6GA 1L2FA 2Z6KA 5GAHC 4AQYL 5M5YH 2JA5H 4A3KG 1QVGA 2I5HA 3GD7A 2IT1A 3EN2A 2ZJQA 2ATWA 2JA6G 4OO1I 3RLNA 4DV7L 1C7YA 1N34Q 1K83H 4UP8A 2JA5G 4LUOA 3S1MH 3HOUG 1IXRA 1E7ZA 4A76A 2JE6I 5IE8A 4B3ML 5GQOA 5GADC 3EIVA 2BA1A 3F2BA 3EBEA 3KF6B 3I4MG 3KOJA 4DV4L 2VY3A 4DV6L 1PH2A 2KHIA 3K7AH 4LF8Q 2F3IA 5K36G 2KHJA 1XTDA 1YJNA 3I4MH 4IFDJ 1PVOA 4KHZA 1Y14B 5M5XH 4R1JA 3PUVA 1L0WA 1CSPA 3CCRA 3S1NH 3F2CA 3I4NH 4A3JH 3PUYA 4A3EG 2OQ0A 1MJEA 4KI0A 2N8NA 4R4QA 1HH2P 2WFWA 1YZ6A 1OXUA 1YHBA 3I4NG 1V43A 2ZTCA 5M3MH 2Y0SG 3CXCA 3TRZA 5IY0A 3OTOL 1CSQA 4X65Q 1PHJA 2HHHQ 4P74A 1PH5A 2E5LL 1HZCA 1BBWA 2N3SA 3AFPA 3CCEA 2ZTEA 3CPFA 4JI4L 1VQEA 2OQKA 3K80C 2ES2A 1UE1A 1VQCA 2I5LX 4MNOA 1KAWA 1X3EA 4A3LH 3RLFA 2OCEA 4X62Q 3RN5A 3BJUA 5EAYA 1DGSA 4JI1L 3J81j 1HJPA 4L5QA 2JA7H 2CQOA 3UDFA 4GKJL 3JAMc 2VQFQ 3CCQA 4DKAC 1PYBA 4LF9Q 1VQHA 3CW2C 3J7ZC 2AMCB 2JQOA 3STBD 1I94L 2K5NA 4MZ9A 4JV5L 4DR4Q 4JI7L 4X66L 3AFQA 4A3CH 1YBYA 4DR3Q 3CMEA 1UE5A 4X64L 4UP7A 1H95A 4A3CG 4KHPL 5FJ8G 1EFWA 4XIGS 1Y1VH 1VQKA 1PA6A 1TWAH 3H0GH 3CCJA 2AHOB 1J5EQ 3H15A 4DV3Q 4LF7L 4X65L 4NXML 1X54A 1HNZL 3KJPA 2R7ZG 2ALYB 1TWGH 3TREA 4DK3C 3M4OH 1LYLA 3J80c 1P8LA 2IHFA 2R7ZH 3UDIA 1G6PA 1NTGA 1LTLA 2MO0A 1S3OA 2N49A 4GS3A 4LF6L 3CPWA 4X62L 3HOWH 3Q8DA 3HOYG 4JI3L 3SGIA 4A93H 1B7YB 5BR8Q 1PH1A 4GKKL 3TS2A 1S40A 2JK8A 1OXSC 3PSIA
chains in the Genus database with same CATH superfamily
3S1RB 1XJVA 1JR0D 2CWPA 4IUVA 1A3VA 3KYHC 2KCTA 3HKSA 2NYZD 4IO9A 4R8NA 1WJJA 1LABA 3CC2A 5EPJA 5C4XH 1W2BA 1G51A 1LTAD 2HIXA 1NBWA 4C3HB 1A6XA 1BQQT 1MI2A 5JAVA 3T1YQ 1ZEQX 2B3GA 4GNXA 2F0SA 4C3HH 1FGUA 2F4VQ 4DR2L 2YV5A 2K50A 2F03A 1DOMA 3DHQA 4P72A 4DR1L 5IGCA 3OSOA 4ILWA 1WTVA 1IW7C 1GVPA 4DA2A 2E2JB 4KKUA 1V8QA 5IOCA 1VQ4A 1Q7YC 3I4OA 1HPCA 3TBIB 3GTLB 1LT6D 3ULJA 2A6HD 2XTIA 4UP9A 4DAYA 4R4IA 1F77A 3EQLC 1STEA 4I65A 4ZKCB 4JI3Q 1XNQL 2JA7B 3MC0B 3Q22A 2D9UA 1N33L 5EKLA 3M4OB 4RKLA 1KTKA 1EY4A 4JI5L 5EBDA 3DLLA 5HY6A 1O7ZA 5BR8L 3UE0A 1X6OA 4IPCA 5C0XI 3HOXG 1LT5D 4C2MH 2FINB 2KJXA 4CKCA 3S24A 4JCVE 3TP8A 4KLKA 5LMNQ 4BS9A 3CP0A 3EA6A 2F0HA 4OONA 1XYIA 2YU9H 4JI2Q 2HIVA 1LUZA 5FLXc 3OHXC 1FYCA 2E74C 1X56A 4DUZQ 1VQLA 1TWCH 3AYHB 2B2VA 1SFOH 1M90C 2J0TD 3MFGA 3JAMi 2JXMB 4HIKA 3S2HB 1XPRA 5C44H 4LJZC 1BNZA 1VQBA 3ND9A 2AWNA 3PUZA 2Q2UA 3CCVA 1VCIA 2C35B 4NB3A 1Q81C 2ZXRA 3MAQA 1I50H 4V190 1ESRA 1CTMA 2B63H 3KJOA 2V1CC 2R92H 2AQ3B 1I4QA 3SXHA 2XVSA 3S1MB 1EIGA 2BDOA 3ZJYC 2RF4A 1SE8A 4EQ5A 3J7A5 1B70B 2QEXA 4JI0L 4KY7A 4HAEA 1VMPA 2PQAA 5JPNC 3PGZA 3LX0A 2LFNA 4A3BH 1XMQQ 3QO2A 2Z4IA 2I5MX 2LSSA 4H0LC 1JICA 5CR3A 1IBLL 1Y8NB 1X3FA 4LWCA 4OXPA 4RGTA 1S5BD 2VW9A 3R2IA 5T1GA 4OWWB 4H7BA 4A3IH 2XGTA 1RHPA 1HNZQ 1X65A 2QEJC 4F88A 2NZOA 4QCLA 4YCWA 4A75A 3D8GA 3N52A 3B6YA 3K59A 1EIFA 2B2TC 1QCBD 2DY8A 2UXBQ 1EIYB 2BA0A 3EROA 4CKBA 4I7ZC 1PH9A 2GN5A 2QKIC 4QUCA 4F87A 2VQEL 1H9SB 3VR6A 4IUQA 3J80i 3RR5A 1BOSA 3OW7A 2EXDA 1M4VA 3VR2A 4G4KA 2CCZA 3S16H 2Z8LA 2GA4B 3S1QH 4PZ8A 2B29A 1GJXA 5M5WH 2EXZA 2K04A 2B63B 1GHKA 5CBEE 4BBSH 4MTNA 3W3AA 4JBJA 1X9NA 2MPMA 3NQIA 1ENCA 4YCVA 3M4YA 4IFDG 4BA2I 1PRTB 2HUGA 3QOJA 1D7QA 1SMYD 3OMCA 4XYQA 5A2QL 1KIXA 3GTOH 4B3TQ 3GTKB 1S72A 4DAYB 4QIWB 1U5KA 2IW3A 4DAPA 1XTCD 1EL0A 2R7DA 3CQZB 4P71A 4DF7A 4Y7NH 3T1HQ 5EKKA 3ER0A 3MVVA 4FF2A 1O7YA 1XMOQ 1K8MA 3CCSA 4WORA 2JA8G 1EFID 1Y8OB 1E2WA 4XQNA 5GAEC 3H91A 2EYMA 2F0PA 4G7OC 4DR5L 2E2IB 2IPKD 3MEFA 1OTCA 5H1SE 1K3RA 3FVQA 4J8QA 3CF5A 2DJGC 1HZBA 4LW1A 2MFIA 1OXTA 2B8FA 4QQBX 4BA1I 3KUPA 3FRPB 1Q12A 3A8IE 4A3KH 3DM1A 3J81c 3CCLA 3SK4A 4ID6A 5CMDA 3HOVB 1GUSA 4XQQA 1NSNS 2CW0C 2RCNA 3L0OA 1JJGA 4JYAQ 1EQVA 3P20A 2NWGA 1WCMG 1STNA 2EYHA 1PFNA 3PUXA 3J81L 3AEVA 2PO4A 3CQZH 2A1AA 4FNFA 3NENA 1HHVA 2ZJRA 4QL5A 1JWSD 4DR7Q 3C3LA 3GTLH 4A3EH 3NE5B 4DV5L 2K5QA 2C9OA 4GOPB 3I2ZA 3BVGA 3D31A 5C5LA 3HFZB 3K5LA 3F2UA 1EY9A 2Y0SE 2IWHA 2C5CA 5EKIA 1GM5A 3BG3A 3PCOB 2Q8TA 1YNJD 3TDQA 1ESFA 4DV0Q 4LF4L 4C3JB 5KNCA 2B2WA 4CJ2C 4ZCKA 1IHZA 2KA7A 4KKSA 2JEAI 4JG2A 5D3DA 5J1ZA 4YWLA 1HTLD 4O42A 1GUWA 1VQ5A 3I8ZA 3QOLA 2IJ0A 1L1OB 3U4ZA 1UE7A 2CVRA 2K03A 2X6GA 5AJ3L 1GOZA 1JOKA 4A3MG 1WD0A 3PIOA 2E2HH 1Z47A 3K0YA 1N33Q 2KOLA 2E5LQ 1GUGA 1RKNA 4JI4Q 1E1TA 2N88A 5CYUA 5IGEA 3EFXD 1ENFA 2H5XA 1JJCB 3QWNA 5C3XA 2UUAQ 1YHAA 5FLMH 5FK9C 1AH9A 1BBUA 2J7ZA 5M9OA 3T53B 1QZGA 1ILPA 1TS4A 3MXUA 2JA8H 1SE2A 2EYPA 1WTHA 4EX5A 1D8LA 1KNAA 1TWGB 4DV4Q 4L5SA 4A3DG 3A8KE 3HGBA 5HGQA 4B3SL 3VR3A 1SNPA 3RUZA 1CKOA 4KD4A 3LGJA 3WOEA 2A6EC 3E9IA 4OWXB 5ELCA 3OWFA 3CAMA 5LL6X 2K5WA 1H9JA 5GAHC 5FO9B 2JA5H 1QVGA 2ATWA 5E1FA 4OO1I 5CV4A 5EPLA 4LUOA 3HOUG 4A76A 2RKSA 5GQOA 4RCOA 1EWCA 3UI2A 2QDBA 1B4OA 4ZRZA 4DV6L 2VY3A 4LF8Q 3K7AH 1DYQA 3NTHA 1STGA 3X3MA 3TZUA 3PUVA 2WIIB 4A3EG 1ZXTA 2OQ0A 1MJEA 2N8NA 4R4QA 1OXUA 3I4NB 3L9AX 3NTKA 1ET6A 1QNKA 5IY0A 4X65Q 4P74A 5D3IB 3PIO3 2E5LL 1BBWA 2ZTEA 4JI4L 2K01A 1TS3A 1MHWC 4PNYA 2ES2A 2I5LX 2MGSA 1KAWA 1LTBD 3RLFA 2O5IC 1AZQA 1K3BC 1H9MA 2OCEA 4X62Q 3RN5A 1EY5A 5EAYA 4L5QA 1PZKD 3WDNA 1PYBA 4LF9Q 1VQHA 3J7ZC 4JI7L 3DUZA 1TY2A 3AFQA 4A3CH 2LS01 3VR4A 3SDZA 4DR3Q 1UE5A 1VF5C 1H95A 1LTSD 3MWYW 5C5MA 3H0GH 1VF7A 4DV3Q 1X54A 1HNZL 4IUNA 4ZUJA 4JVZA 1TR5A 2IHFA 2N49A 2MO0A 2WINB 4JK1C 1G2SA 1X32A 1YNNC 4EQOA 4IUPA 4IFDH 1EU3A 3HOYG 1SMYC 1RCVD 3SGIA 1PH1A 4RHSA 1OXSC 3W1GA 2F0LA 1LV9A 1N32Q 3AU7A 2I46A 1G291 4X64Q 2K33A 2XIWA 3CCUA 2FJ2A 1FJGQ 5IYCH 1NMFA 5JEAG 2WB1G 1TWHH 1PRTD 1SR3A 4UPAA 3ND8A 2Z4HA 5IWAQ 1JB7A 2BH8A 1MJCA 2OT2A 3NTIA 2J4XA 1J6QA 1WTOA 4OGQC 4IPDA 5JPMC 4ALPA 2ZXPA 1BKBA 1U9RA 1ICFB 3IFTA 4RCNA 1J8IA 2CH4W 1E3PA 3S9WA 2A73B 4DAVA 3QG1A 1Y1WG 3MXNA 3CC4A 4OO1G 5C3WA 2NVQB 3SE0A 4Q0FA 5JJKA 4K2KA 4OEMB 4FF1A 4LFAQ 1RJTA 1B50A 4BY1B 2JA5B 3GTOB 3GTMH 3CMAA 4P73A 1OXXK 4G7HC 1PTOB 2NVTH 4XTCS 2F52A 5FO8B 2TMPA 3A0JA 3DWPA 3K6OA 3CRKC 1U0LA 2UU9L 1WCMB 1Q8KA 3ZYYX 1B1ZA 1I4GA 3DEOA 4J15A 2VNUD 1D1KA 3QIAA 4HR7B 1SYBA 2LMCB 1C4QA 3G6EA 1FL0A 2JEBI 1QB5D 2AUKA 4KD3A 4TRDA 4AYBE 2HT1A 1N32L 1VQAA 4K5XA 1S5DD 3EVQA 1LLRD 3FKIG 3EJIA 1JT8A 3PV0A 5M3FH 2VS1A 1HXYD 2N55A 2LXJA 4DV5Q 1UUPA 5IP7H 1KDAA 4K0KQ 2BH2A 1QILA 3MXPA 4LUVA 2PI2E 1SE3A 4JI5Q 4A3DB 2O2LD 2HCCA 3TP5A 1N9WA 1SYGA 3I72A 3K5OA 5IYBG 4LNQA 1W3SA 3U9OA 3UDXA 2K1BA 5IP9H 4UHVA 4PQXA 3I91A 3JAML 4JI6Q 3S1NB 5M5XB 1JOQA 4LF5L 4CJ0B 1HUMA 2F0KA 5JEAH 3Q24A 1TWHB 1HA5A 4K6DA 5D14A 2L5TA 3S2DB 2KCMA 4JC0A 1TWAB 3NBHA 2M00A 2GVBA 3T1YL 2XWBB 4X3TA 4DK6C 4JBWA 1XPUA 4JW0A 4K5WA 2XNAC 1SDFA 2B2UA 1KLGD 4DK1A 4JI2L 4DR1Q 2K5HA 1NUCA 1PTOD 2K14A 3SK6A 1NE3A 1I4HA 3ICEA 3M3YH 5C3EH 5KYIA 3HOUH 1QVCA 2K6AA 2YTYA 2EZVA 1SN8A 4FXKC 1KABA 3URYA 2QCPX 4RA8A 4P2CB 5JJIA 1YVCA 4GLAC 4YWMA 1STHA 4C3JH 3TS0A 2LKVA 3K7UC 1V9PA 2NVYB 1ILQA 2A68C 4B9WA 2XN9C 4KJNA 1EYAA 5IIFA 1CQVA 4M8AA 2K7VA 5DM73 4L6TB 4HJAA 1K28A 1TXYA 2XRSD 4A3EB 3A7LA 2AQ1B 3RZOH 4K14A 5HGTA 3HOZG 2F0EA 3HOWB 5A35A 1EU4A 2WAQG 1KLUD 4J1MA 4YIJA 3CKIB 3M7NA 4BBRH 3S14H 3J80L 3A56A 1JCKB 3WWVA 4GN5A 4IURA 4GNXC 4BBSG 1CK1A 4X3UA 2MP1A 3E0EA 5E4XA 1AW7A 3H0GB 1PTOF 1UWVA 4A3MH 4QIWE 1OXVA 1PH8A 1FNUA 1JQYD 1QJOA 2R7FA 4ABNA 3KLWA 4R4TA 3S14B 1SE4A 1EEID 3GQBA 4B3RL 5DEHA 1EY7A 4CDFC 5F2DA 2PW7A 1EY8A 1QWYA 3H09A 4IPGA 2E2IH 1MGSA 1PH4A 1CQFA 2PMZB 1NJIC 1BCPB 5LMUL 2D5DA 3U9SA 4N9TA 3FP9A 2A6HC 1Y8PB 1PRTC 4N9PA 2R61A 5IT9E 1BR9A 1WFQA 4JI0Q 1VQNA 1I4XA 4DV3L 2L1BA 1BCPD 1GUNA 5ELNA 2B63G 2D0OA 3AMUA 1II3A 2HQLA 2G5DA 5ELFA 2DN8A 1GD7A 1V1PA 3AQQA 2EYLA 3PMFA 4C3IH 3RZDH 1EYCA 2QILA 3L7ZC 4C1NK 1N36L 4B9XA 1W6KA 3FHWA 1BF4A 2ICIA 1J9OA 5I2YA 4LF5Q 3SR1A 5BN5A 1CFMA 1EZ6A 2H4OA 1Y1WH 4GLXA 1R9TH 1GKHA 2NZHA 4A3JG 2VUMG 2K4KA 1QE6A 2KCNA 4PMBA 1FGBD 4C3JG 5M5YB 3GV6A 3I55A 3GTPH 4HIMA 3HOXB 4RHRA 2UUBL 1UE6A 1A2TA 1G2TA 1B9NA 3L2PA 4DNRB 1L1OA 4ME5A 1K8AC 2R92B 5CV5A 1O80A 3DXJC 2IX0A 2KENA 2FXQA 1F9RA 3S2DH 4O2DA 3Q6SA 4KK7A 3D0FA 1YEZA 4E6IA 4AYBG 4NW2A 1JE4A 3KF6A 3GTQB 1PH3A 3BVMA 3A5UA 2JSOA 3HOXH 4BBRG 4DV2Q 4FDBA 3FMCA 4O0AA 5CV6A 4LFAL 1STAA 1MIUA 5DLQE 4AQYQ 3S17H 3FKIH 2E2HB 1Q82C 3VYSA 4HN7A 4K6LA 1F2YA 5GAGC 4A3FH 2F0QA 1EOTA 3RNUA 3SEBA 1VQ6A 3BU2A 5FLXL 1YIJA 1A8VA 4WFN3 4FXDA 4TVAB 5M3MB 3OPOA 3GTGB 5J22A 3NBIA 2L55A 3IRBA 1B3AA 2B2UC 1EYGA 2JJQA 5KRUA 1SRUA 2SNMA 3P1HA 3K5MA 3H3VC 5KGUA 3HKZE 5CV9A 4L5TA 5FKAC 4LK1C 3BDLA 2HHHL 4JI1Q 3PO2B 1HNWQ 4R9WA 1X3PA 3MA2B 2F3WA 3R8BA 1J5EL 5ELDA 3PF4A 5E7NA 2D0PA 5IYCG 1AN8A 3CHBD 1YNND 1SYEA 4IQZA 5E3FA 3ULPA 2YTVA 1N34L 1BVSA 5C44B 2CH4A 1TT2A 1V1QA 2B2YA 3Q23A 1L2FA 3S2HH 5M5YH 2JA6B 1RF2D 2IT1A 2PNRC 2ZJQA 1SXTA 3WOFA 1C7YA 1R9TB 4KTAA 1HFGA 5L37A 2V4DA 1EQTA 3NQTA 1AZPA 2PZTA 5GADC 3MTSA 4BWGB 3EIVA 3F2BA 2FHTA 3I4MG 4ZK9B 4DV4L 1PH2A 2DJFC 2F0WA 2KHJA 5LL6S 2F0DA 2F3VA 3OIQA 4C3IB 4KHZA 4R1JA 2L11A 3CCRA 3HG9A 3TP6A 1KDBA 1U4PA 1DOLA 1YHBA 3I4NG 1O7LA 4CJ1B 2ZXOA 5A2QE 1PHJA 1PH5A 4KJOA 2EJGC 1HZCA 3HRZC 2N3SA 3CCEA 5C4XB 1HRJA 2OQKA 1VQCA 3Q0AA 1X3EA 1LT4D 1TQOA 2A69C 4N8X1 1DGSA 4ZLTF 2F0UA 2JA7H 1PTOH 2NVTB 2VQFQ 3E0JA 3ERQA 2RSNA 1F2MA 2AMCB 2JQOA 3GTMB 2K5NA 1B3QA 4MZ9A 4DXFA 5HURA 2G9DA 1BXTA 1YBYA 1BCPC 4UP7A 4EQNA 4WJWA 1V1PB 3HKZB 4XIGS 5IT9L 1Y1VH 1VQKA 4K8JA 3RMHA 1J5EQ 3C2PA 4LF7L 4AYBB 4X65L 1VMCA 3BYYB 1G8ZD 3J80c 2R7ZH 2QW7A 1NTGA 1LTLA 4GS3A 1K0SA 2JN4A 4X62L 3LWEA 2CW0D 3HOYB 3HOWH 1R4PB 4JI3L 1CT1D 4GKKL 2VUMB 3TS2A 1PLFA 4XT3B 3RZOB 3D4RA 2B2WC 4A3FB 2SNSA 2WAQE 2FMCA 2B2YC 4RMFA 1PTOC 2L15A 3OOCA 3FKIB 3N6RA 2NVYH 3G7LA 4BXXG 3V96A 3S1RH 1VS0A 2IL8A 1I6HH 3V05A 3G6JB 4DR2Q 4R8IA 2LXKA 4C3HG 2RDFA 4C56C 1JE5A 3A5ZB 3GTQH 1RL2A 4H13C 1K8GA 4FVMA 1Q3LA 2NN6G 3VYUA 5KIXA 1H9SA 2VQFL 4L63B 2WB1B 2K5DA 4K8IA 4AH6A 1JJ2A 5ELBA 3NWTA 4XDXA 1HR0Q 1LTGD 1SJED 3CCMA 1PYWD 2OXPA 4BY1G 4LFBL 2BE5D 1VQFA 2VUMH 2SOBA 3IFDA 3KLSX 3KDFA 4O1NA 4OL7A 2DNCA 1HFNA 3OIPA 3DM3A 3MZ5A 1PZID 1QVFA 5NUCA 3C1FA 1H9KA 2EVBA 3PO3G 2E75C 1D6EC 4RH6A 1YHQA 3K57A 1E1OA 1CHQD 2F0TA 2VL6A 1MD2D 5IT9c 4ZAIA 3RZDB 1MSHA 1NY4A 1PV4A 4MTKA 5GROA 1SMXA 1AE3A 2RCFA 5FJ8H 2K5VA 3NUCA 1ONLA 1I6HB 3T13A 1CKMA 3HOZH 4A4IA 1U4RA 1KC8C 2AUJD 1YI2A 1VQ8A 4CGYB 3C46A 4YY3Q 4DNTB 1L0YB 4WJ4A 1IKMA 2MNAA 3F1ZA 2KCCA 4DUYL 2RSOA 1AE2A 4G57A 4FXGC 1Z7TA 4H02A 3NEMA 1SNOA 3I7FA 3SK8A 3HKZG 4NXNL 2EY5A 4UY8C 3NSWA 1VQOA 4LUZA 3S15H 1XNRQ 3U50C 1SAPA 2DNEA 4DV2L 1IW7D 5IYDH 2L4NA 4IFDI 1HR0L 3VYRA 4FP5D 2OTLA 1TWFH 5FO7B 1SLJA 2WAQB 3MXGA 4LF7Q 1PZJD 4IOAA 1Q1BA 2PNHA 4BBRB 4K0KL 4ODGA 3SHLA 5ELOA 2JA6H 1FR3A 2WV6D 4EQPA 3T16A 1TIID 5C4JB 2E76C 1IBKL 1KDCA 2FFKB 5T1IA 1E22A 3STBC 3T4AC 1PMRA 3KFUA 2UUCQ 1HQRD 4WRDA 1IYJB 4DR6Q 2NUCA 3K5NA 1I94Q 2F0FA 2Z1CA 1HNXQ 4IJHA 4X66Q 1XMQL 2QF7A 4A3KB 1G6ZA 4FO2A 1E2VA 3NK9A 1CHPD 1M8AA 4LFCL 4JI6L 2A8VA 2IX1A 3DWAA 5DM63 3VA7A 3W2DA 1NCVA 2EYOA 3J81E 4HIOA 5C6AA 4A3IG 1CZGA 4C1NI 3K81C 1EUJA 4WJ3M 1B9MA 4DUYQ 4R4OA 5BN3A 2DUDA 1KRTA 1EWHA 3FEWX 4RG1A 1DD2A 3M3YB 4KY6A 2A69D 4NXNQ 4Y7NB 2EE1A 1CKNA 1T9HA 5J3BA 2UXBL 3GTJH 5C4JH 1XNRL 3GTKH 2ZM6L 4Q5VA 2B2VC 2UXDQ 3I4MB 1GXDC 1UEBA 1NR4A 3GV3A 2QGQA 3PO2H 1Y1VG 4X6AH 1EEFD 3H0GG 1JMCA 3NWSA 2OWOA 1FNWA 1XX8A 4L5RC 4KN7C 5K5PA 3JAME 5JJLA 2EJFC 4A3FG 3KF8B 2Q2IA 1KXLA 2EDGA 4OHJA 4V0BA 1SEBD 1UAPA 1HZAA 1RD9D 3UDGA 3GTGH 3HOWG 2EY1A 3RLOA 5C44G 1CZWA 1T5XD 4DR6L 1VQ7A 2PZWA 1L0XB 4J6HA 4POFA 1X3QA 1S4ZA 3BDCA 3HZXA 3KLSA 4R4CA 4RKBA 5LHY1 3OWEB 4HMJA 4Y52H 1DOKA 1ET9A 1O7IA 2DGYA 4MHEA 1ICWA 2XWJB 4GNXB 2VB3X 2AKWB 5I9PA 2R92G 1X55A 4PG3A 4K5VA 5KNBA 4LMQD 3RD4A 2B8GA 4OX9L 4A3GH 2XRQD 4IOCA 1WTPA 3TN2A 3CU7A 5AJ3Q 2A5HA 4JYAL 4NPSA 3F2DA 2E8GA 1B8AA 3W1BA 1HQMC 3FPUB 3OMGA 3BZCA 3BZDB 4X3KA 5LMUQ 1RIPA 3LWUA 5CBAE 1PYSB 3KBXA 3S1QB 2YTXA 4RAUC 1WYDA 2MUYA 1OO9B 1N8RC 4EVOA 4TQUS 3A7AB 4BY1H 1DZ1A 1E2ZA 4KHVA 4B3TL 1BDOA 4DV1L 1GUTA 1Y1WB 2ICEC 4GN3B 1SNDA 3UE1A 1IBKQ 3HOVG 2EYJA 3T1HL 5ELEA 1WTQA 1WOCA 3MXNB 1WVLA 3J80E 4RGMA 4DGZA 3MFYA 2JA7G 5KEEA 2BCOA 2RVLA 1VQ9A 1PFMA 3TQYA 4ZKBB 1I3QH 2WACA 3GTJB 3A54A 4CHTB 1C0AA 1WTRA 1JWUD 1NMGA 1SFOB 1Q1EA 4DR4L 2A68D 4U673 2DY7A 3BYTB 1UEAB 1TY0A 1PRTF 1Q8IA 4XT1B 1K0RA 4GLVB 3BS1A 2OEOA 1Q90A 1S40A 2YU9B 2CHBD 2F0NA 1KL9A 1RTOA 4HCEA 1QUQB 1HR0W 4NP5A 4HJ5A 2YYZA 4HJ7A 5IYBH 5FLMG 3ULLA 1F9SA 2TSSA 3I70A 4Z9CB 1SROA 1A63A 4BY7G 4DR7L 2L9HA 4HEDA 1I50B 4KHPQ 1SNQA 1KHIA 1B44D 2RHQB 2Q2HA 1GO3E 2EYFA 2JA9A 4IUUA 4JI7Q 1E24A 2PI2A 4LAAA 1EQQA 4B3SQ 2EIFA 4HMIA 1F9PA 4BXXH 5E4WC 5I6YA 2R6GA 5C4HA 4AQYL 2I5HA 3GD7A 3FPPA 3RLNA 4DV7L 1STYA 4UP8A 5JVH3 5IE8A 1AEXA 1EIHA 2FMMA 3EBEA 3KF6B 4BBSB 4ZQ3A 2F4IA 2NN6H 5KNDA 4NMZA 4DK0A 5M5WB 4HTHA 1YJNA 4IFDJ 1PVOA 1Y14B 3NHHA 3S1NH 1UNSA 5CV7A 3E3XA 3QJYA 3C1EA 4A3JH 4RGNA 1VDZA 2NTSA 4RGOS 4KI0A 2R93B 2WFWA 4C2MB 5DAUA 1YZ6A 3PQIA 1V43A 2ZTCA 2HDLA 5C0XH 3CXCA 3TRZA 1WD1A 3OTOL 1CSQA 2HHHQ 1XXGA 1I6VC 1TVXA 5JVG3 3A55A 3AFPA 1VQEA 3K80C 1UE1A 4MNOA 1TKWB 5I6WA 3MEHA 3J81j 1F9QA 1HJPA 4F7XA 2CQOA 3UDFA 4GKJL 3JAMc 3CW2C 1I94L 3STBD 2NB0A 4TKOB 4A3IB 4X66L 3TZDA 4A93B 4MN3A 4HSPA 2M2LA 3M7GA 4KHPL 5FJ8G 1EFWA 3X3NA 3E6ZX 3R3OA 2AHOB 4NXML 2RQXA 2R7ZG 1DXMA 4QMGA 1TWGH 3TREA 4DK3C 1LYLA 2NZ1D 3S15B 1P8LA 3UDIA 4LF6L 1S3OA 4ZUIA 3S16B 2Q8IB 2NVXB 3Q8DA 2PW5A 1PDQA 1D1IA 3R2TA 3GTPB 1IYUA 3D6WA 3V2TA 4A93H 2KUMA 2F0JA 1SBBB 2JK8A 1CA6A 3PSIA 3T51B 1EY6A 2PQEA 1HNWL 3KF8A 3H3VI 2UU9Q 2RHSB 2PYKA 3QR8A 4KKTA 1XWEA 2ZM6Q 2UXDL 2RDGA 4KMUC 2CQAA 4JOIA 4XXEA 5CC4A 2KBNA 5I9OA 3HOZB 1C8CA 1SYDA 2LY7A 4CDDC 5C4XG 3NP8A 2KVMA 4IPHA 2NN6I 3PIP3 4QY7A 3NPPA 2PPBC 1U4MA 1ZKOA 2MHVA 4A3JB 2RA4A 1EWIA 5IWAL 1CKNB 1DJRD 2HQEA 1YNJC 3IL8A 5J39A 3K58A 4DR3L 2RDHA 4QF4A 5JJZA 3A74A 2Z6BA 5LMNL 3ITPA 3D4WA 4GKJQ 1WCMH 2ZTDA 4JBKA 1VQDA 5K36H 1LTID 2F0IA 4IALA 4OIJA 2ZT9C 4DUZL 3BVZA 4OO1H 4JI8Q 1V1OA 2A6ED 2ID0A 3U4VA 4K2LA 1CM9A 3MHBA 5C0XG 3J81i 2ZJPA 1HTPA 4YCUA 1IL2A 2F0VA 1IKLA 2R3ZA 2Q8RE 4DV7Q 3CRLC 2BDNA 3M85A 4POGA 2QA4A 1BUVT 4BY7B 4QB4A 3JC66 3HOVH 1EOVA 5LMNW 3I90A 1T5EA 2MQHA 1NNXA 1Y1VB 1FJGL 1SYCA 3H3VH 1G91A 1K8OA 4KY5A 2RBMA 2R93H 3I56A 2I07B 3A8JE 3NELA 4IUTA 1EQRA 1CI3M 1FD7D 2F1MA 2VQEQ 1PH6A 1CUKA 2F0MA 2Q2TA 2IHEA 1JC7A 4F8MA 5IP7G 1TS5A 1LTRD 2ASBA 4DV1Q 1P16A 2KEDA 2NTTA 4PZ6A 1XPOA 1BCPF 5D65A 2MJ8A 5G3LD 1GUOA 2XSCA 2CFMA 3PO2G 4FF4A 4GKKQ 4LFBQ 1YJWA 4A93G 3QB3A 3HOYH 1VQPA 2Z6KC 1Q86C 5EBCA 2X6LA 1SYFA 5CGKA 2R7ZB 2K28A 2WKDA 1U4LA 5IGBA 1PH7A 4BY7H 1IBLQ 5TSSA 3HOUB 1SNCA 2VB2X 3W5OA 1S5CD 4JI8L 3O13A 4XYOA 4NXMQ 4H44C 1XMOL 5EPKA 4S3SA 1SSOA 3ERSX 5JOBA 3LNNA 4LF6Q 2I0QA 4DR5Q 4C3IG 3HS0C 4GOPC 4A3GG 2NVXH 3J7AV 2N78A 2K52A 3TMEA 1PFBA 1TWFB 4IN3A 5C4ZA 1ASYA 2UXCQ 1IL8A 1DM0B 2OF1A 4I7AA 1Y69U 4A3BG 5C3EG 1M1KC 1CA5A 5G3LF 1W6JA 4P75A 1Q46A 2WB1E 4GOPA 5I4DA 2EY2A 2CKZB 3GDEA 1KQSA 3TP7A 3NXWA 4AIMA 1KRSA 4DNIA 3RN2A 1HCZA 4TSSA 4ULLA 2MO1A 4DXGA 1GHJA 3K7AB 2L0CA 4M1UB 4IZ8A 1JORA 2Z0SA 1Z9FA 1HZ9A 3TEHB 5M3FB 1B2TA 5C3EB 2ENBA 1LO5D 2GVAA 3TSSA 3J7AF 2R93G 3K8AA 3G4SA 4DFAA 1HNXL 4DN4M 1D5XC 1Z6HA 1SNMA 1LT3D 3G48A 4GN4B 1QNUA 2B2TA 4YHHL 1FNVA 4LFCQ 4LF4Q 4YY3L 2PMZE 1F2ZA 3D4DA 4YWKA 1WI5A 1O78A 2KQ3A 1D5ZC 1YJ9A 4JBMA 2CWAA 3H6MA 2SDFA 5ISRA 3OTOQ 5M3FG 3VYTA 2D62A 5AFWA 1DCZA 2F0GA 4PZ7A 5EJWA 2PZUA 1PXUA 2VZAA 2WKCA 1YNXA 3M4PA 3I4LA 1RODA 1TS2A 5BN4A 1QUQA 1L1OC 4HJ9A 5FLXE 2UXCL 1DONA 4FYDA 1IBMQ 4B3MQ 4A3DH 4ZYSA 1ZYRD 2NVQH 4HCSA 4B3RQ 1VQJA 1C9OA 4QGUA 3OW2A 2SEBD 3I3CA 1TWCB 2BE5C 1A62A 1A15A 3P7JA 3S17B 1QZHA 2PCFB 4PMWA 4HJ8A 3J7YW 3DMUA 1S5FD 1KAAA 1MSGA 5CV8A 1JOOA 1IZ6A 1S5ED 2JP1A 1AP0A 3SVMA 1XNQQ 1NR2A 4DPGA 1N36Q 4OWTB 1BBXC 5CORA 5EGTA 2UUCL 2HCIA 1EZ8A 2EJMA 1D5MC 4G7ZC 3P75A 4CBVA 3G71A 3KBGA 4X3SA 3IAYA 1A0IA 2A19A 1LTTD 2EPBA 5C0XJ 3T56B 1IYVA 4DV0L 1FVIA 1R4QB 3BDOA 3F8TA 4DAMA 1K83B 3GO5A 3M9BA 1VQIA 5IODA 2UUBQ 4YHHQ 3H94A 1X3GA 4QJFA 5COYA 3VA5A 4NKLA 4PMCA 2Z9HA 3VDYA 1RDPD 4JOIC 2H1EA 2L12A 3L3OC 1STBA 3KDFB 2M9VA 5M3MG 1JWMD 4HSVA 3CD6A 1LM0A 2KECA 1C48A 4A3MB 2BOSA 2WP8J 3OYYA 2E2JH 2OTJA 2IY5B 3SK5A 4FF3A 4CDEC 5IGDA 1K9MC 5IGFA 2UUAL 3PO3H 1MKHA 4A3LG 3VR5A 4KV6A 3E9HA 1KD1C 3KK7A 2PQAB 3ONAB 4OELB 1IBML 1ASZA 3PUWA 2EQSA 4LF9L 1I4PA 4L8JA 2EOTA 4IJLA 3NBHB 4EGVA 1EY0A 5IGGA 4APVA 2Y0SB 3I73A 4GZYC 1MBYA 1D2BA 1VQGA 5IP9G 1HUNA 1I3QB 2F4VL 2AWOA 3K0XA 3PIPA 3HEJA 4B08A 2HDMA 3M4QA 1VQMA 2O5JC 3DWQA 4JV5Q 1ML0D 2K75A 3PO3B 2F0OA 4PV1C 4DV6Q 4LF8L 1K73C 3D6CA 2B39A 2NBFA 3CC7A 3R93A 4HIDA 4OX9Q 5IYDG 3D3RA 3FDTA 2HD3A 1PFSA 1TU2B 4XQJA 2X69A 4ME3A 4A3BB 1YITA 3U58A 5JEAJ 2IX3A 3PF5A 1AFPA 4RWSC 2P5ZX 1I5FA 3GP7A 3BZKA 1I4RA 2Z6KA 4A3KG 3EN2A 5KYLA 3HP3A 2JA6G 1A3UA 1N34Q 1K83H 4OIKA 2JA5G 3S1MH 1IXRA 1E7ZA 2JYOA 2JE6I 4MIUA 5DNFA 1ZYRC 4B3ML 2BA1A 4CDCC 3KOJA 2KHIA 2F3IA 4KN4C 5K36G 1XTDA 3I4MH 5M5XH 1L0WA 1CSPA 1RTNA 4QUFA 2A74C 1WTWA 3F2CA 2O4XA 1E0BA 3I4NH 3PUYA 4A3GB 2E2DC 1HH2P 1BO0A 3E5SA 1JB3A 5M3MH 2Y0SG 1F2LA 4UAIA 1EYDA 4UDUC 3CPFA 1H9RA 2G9HD 2EY6A 2QDLA 2VXWA 5EQ0A 1NAPA 2K32A 4A3LH 3BJUA 4JI1L 1QG7A 4U68A 4JPBW 3CCQA 1WTXA 4DKAC 2KHSA 4JV5L 4DR4Q 5I2XA 1HA6A 1KNEA 3CMEA 1B53A 3KLRA 4NDXA 4X64L 4A3CG 1LACA 2KEEA 4DU9A 1PA6A 1TWAH 3CCJA 2D2CC 3H15A 3KJPA 1SJHD 2ALYB 2K05A 5FOBB 4N8FA 3M4OH 1G6PA 2AQ2B 2JA8B 3DEPA 4RFBA 3AB9A 3CPWA 3IKJA 1QOHA 4CKEA 1B7YB 5BR8Q 1A3TA 1ENAA 1A2UA
chains in the Genus database with same CATH topology
3W1GA 1XJVA 1HNWL 3H3VI 2UU9Q 2CWPA 1N32Q 2RHSB 1G291 4X64Q 2ZM6Q 3KYHC 2KCTA 2UXDL 3HKSA 3CCUA 4IO9A 2WAQE 1FJGQ 5IYCH 1NMFA 5JEAG 1WJJA 2WB1G 4RMFA 4JOIA 1TWHH 2L15A 3CC2A 5C4XH 2NVYH 2KBNA 4BXXG 1SR3A 1W2BA 4UPAA 1G51A 3S1RH 1VS0A 1I6HH 2HIXA 1NBWA 5C4XG 5IWAQ 4DR2Q 1JB7A 2BH8A 4IPHA 1MJCA 2LXKA 2NN6I 3T1YQ 4QY7A 1JE5A 1J6QA 2B3GA 3A5ZB 4GNXA 4IPDA 1FGUA 1EWIA 4C3HH 5IWAL 1CKNB 4ALPA 2YV5A 4DR2L 1BKBA 1RL2A 2K50A 3GTQH 1K8GA 4P72A 4DR3L 3A74A 5LMNL 4DR1L 1E3PA 2NN6G 4GKJQ 1WCMH 2ZTDA 1GVPA 1VQDA 2VQFL 4JBKA 1Y1WG 3CC4A 4OO1G 1VQ4A 1Q7YC 3I4OA 5JJKA 4DUZL 4AH6A 1JJ2A 1HR0Q 4JI8Q 3CCMA 4BY1G 4LFAQ 2ID0A 3U4VA 3ULJA 4UP9A 2XTIA 4LFBL 4R4IA 1VQFA 2VUMH 5C0XG 3J81i 3GTMH 3CMAA 4P73A 1OXXK 3KDFA 2ZJPA 4YCUA 4JI3Q 2NVTH 1XNQL 1IL2A 3DM3A 1N33L 4XTCS 2F52A 1QVFA 3A0JA 4DV7Q 1U0LA 3M85A 4POGA 2QA4A 2UU9L 1Q8KA 3PO3G 4JI5L 4J15A 3JC66 3DLLA 1YHQA 3HOVH 1EOVA 1E1OA 5LMNW 5HY6A 2VNUD 5BR8L 3UE0A 2MQHA 2VL6A 1FJGL 1X6OA 5IT9c 4IPCA 5C0XI 3HOXG 3H3VH 3G6EA 1FL0A 1NY4A 2JEBI 4C2MH 1PV4A 2R93H 3S24A 3I56A 2HT1A 4AYBE 5GROA 1SMXA 1N32L 3NELA 1AE3A 5FJ8H 1VQAA 2K5VA 1EQRA 4JCVE 5LMNQ 4KLKA 1PH6A 2VQEQ 3FKIG 1CKMA 3HOZH 3CP0A 2YU9H 4OONA 4JI2Q 4A4IA 2HIVA 1CUKA 1LUZA 3PV0A 5FLXc 2Q2TA 2IHEA 1KC8C 1JT8A 5M3FH 1YI2A 1VQ8A 5IP7G 1X56A 2VS1A 4DUZQ 2ASBA 2LXJA 1P16A 4YY3Q 4DV1Q 4DV5Q 1TWCH 4PZ6A 1VQLA 4WJ4A 2MNAA 1XPOA 3F1ZA 5IP7H 4K0KQ 2BH2A 2CFMA 3AYHB 4LUVA 3PO2G 2PI2E 4DUYL 4GKKQ 4LFBQ 4JI5Q 1YJWA 1SFOH 1AE2A 1N9WA 4A93G 1M90C 3JAMi 4H02A 3NEMA 5IYBG 3I7FA 4LNQA 4HIKA 1W3SA 3HKZG 4NXNL 3UDXA 5C44H 1XPRA 5IP9H 3HOYH 1VQPA 4UY8C 2Z6KC 1VQBA 4JI6Q 1Q86C 1VQOA 2AWNA 3PUZA 4LUZA 4LF5L 2Q2UA 3S15H 1XNRQ 3U50C 3CCVA 1VCIA 2C35B 4NB3A 4DV2L 1PH7A 4BY7H 1IBLQ 1Q81C 5IYDH 4IFDI 2KCMA 3W5OA 1HR0L 4JC0A 1I50H 2OTLA 1TWFH 4JI8L 1SLJA 4LF7Q 4NXMQ 2B63H 2GVBA 3KJOA 2V1CC 3T1YL 1XMOL 2R92H 4IOAA 1Q1BA 2PNHA 4DK6C 4JBWA 3ZJYC 4K0KL 3ERSX 2RF4A 1SE8A 4EQ5A 1XPUA 3J7A5 1B70B 5ELOA 2QEXA 4LF6Q 2JA6H 4JI0L 2I0QA 4DR5Q 4JI2L 4DR1Q 2K5HA 4GOPC 2K14A 1NE3A 2NVXH 2PQAA 1IBKL 3PGZA 4A3GG 2N78A 3ICEA 2K52A 1E22A 3STBC 4A3BH 3KFUA 3M3YH 2UUCQ 1XMQQ 1ASYA 5C3EH 2UXCQ 3HOUH 1QVCA 1IYJB 4A3BG 4DR6Q 2I5MX 2LSSA 1I94Q 5C3EG 1M1KC 1HNXQ 2YTYA 1IBLL 4P75A 1Q46A 2WB1E 1SN8A 4IJHA 4X66Q 4GOPA 1XMQL 1X3FA 4LWCA 4OXPA 2CKZB 3GDEA 2VW9A 1KQSA 5JJIA 4AIMA 1YVCA 4GLAC 4YWMA 4LFCL 4JI6L 1KRSA 4OWWB 2A8VA 4DNIA 2IX1A 3RN2A 4C3JH 3TS0A 4A3IH 2XGTA 4HIOA 1HNZQ 1X65A 3K7UC 2MO1A 1V9PA 4A3IG 2NZOA 4YCWA 3K81C 4A75A 1EUJA 4WJ3M 2Z0SA 1Z9FA 4DUYQ 1HZ9A 3B6YA 4R4OA 3TEHB 1EIFA 2DUDA 1KRTA 4HJAA 4RG1A 2UXBQ 1EIYB 2BA0A 1PH9A 4NXNQ 2GVAA 2R93G 2GN5A 1TXYA 3K8AA 3G4SA 3RZOH 1CKNA 1T9HA 1HNXL 5J3BA 2VQEL 2UXBL 3GTJH 3J80i 3RR5A 3G48A 4GN4B 5C4JH 1XNRL 3HOZG 3GTKH 2EXDA 4YHHL 2WAQG 2ZM6L 2CCZA 4LFCQ 4LF4Q 3S16H 2UXDQ 4YY3L 3M7NA 2PMZE 2F4VQ 4BBRH 3S14H 4YWKA 3WWVA 1WI5A 4GN5A 4GNXC 4PZ8A 2B29A 3S1QH 1UEBA 4BBSG 5M5WH 2QGQA 3E0EA 1YJ9A 4JBMA 2CWAA 3PO2H 1Y1VG 4BBSH 4MTNA 4JBJA 3OTOQ 4X6AH 3H0GG 1JMCA 5M3FG 1X9NA 2OWOA 1UWVA 4A3MH 4YCVA 4QIWE 4L5RC 1OXVA 2D62A 1PH8A 4IFDG 4PZ7A 4BA2I 5JJLA 2R7FA 4A3FG 1D7QA 3KLWA 3KF8B 4R4TA 2VZAA 1YNXA 2Q2IA 1KXLA 3M4PA 1KIXA 3GTOH 4B3TQ 1HZAA 1S72A 4DAYB 3UDGA 3GTGH 1QUQA 4B3RL 3HOWG 1L1OC 4HJ9A 1U5KA 2UXCL 4IPGA 3RLOA 5C44G 1IBMQ 2E2IH 2R7DA 4P71A 1VQ7A 1PH4A 4B3MQ 4DR6L 4A3DH 4Y7NH 2NVQH 3T1HQ 1NJIC 3ER0A 4B3RQ 5LMUL 1VQJA 1C9OA 4QGUA 1XMOQ 4POFA 3CCSA 3OW2A 3FP9A 2JA8G 4R4CA 1A62A 4Y52H 1QZHA 4PMWA 4HJ8A 5GAEC 1O7IA 1WFQA 4JI0Q 4DV3L 1VQNA 4DR5L 3MEFA 2DGYA 1OTCA 1IZ6A 5H1SE 1K3RA 5ELNA 2D0OA 4GNXB 2B63G 2AKWB 3CF5A 1XNQQ 2HQLA 1X55A 4PG3A 1HZBA 4OX9L 2R92G 4LW1A 4DPGA 1N36Q 4A3GH 4OWTB 2MFIA 1OXTA 4IOCA 4QQBX 4BA1I 2UUCL 1GD7A 5AJ3Q 3AQQA 4JYAL 1Q12A 4C3IH 3RZDH 3G71A 4NPSA 3L7ZC 3F2DA 4A3KH 1N36L 3J81c 2E8GA 3CCLA 1A0IA 2A19A 3FHWA 1B8AA 3W1BA 3L0OA 2RCNA 1JJGA 4LF5Q 4JYAQ 3BZCA 5LMUQ 1RIPA 5C0XJ 1PYSB 4DV0L 1FVIA 1WCMG 3F8TA 4DAMA 3PUXA 1Y1WH 3GO5A 4GLXA 3M9BA 1GKHA 1VQIA 2NZHA 2YTXA 4A3JG 4YHHQ 1R9TH 1X3GA 2A1AA 3CQZH 2UUBQ 2K4KA 1WYDA 3AEVA 2VUMG 4QJFA 3NENA 1N8RC 3I55A 3GTPH 4TQUS 4HIMA 2UUBL 1UE6A 2ZJRA 4QL5A 4BY1H 4DR7Q 3VDYA 3GTLH 4A3EH 4B3TL 4DV1L 4DV5L 4JOIC 3L2PA 4GN3B 3UE1A 1L1OA 4GOPB 3I2ZA 3KDFB 1K8AC 5M3MG 1IBKQ 3D31A 3CD6A 1LM0A 3HOVG 3HFZB 2WP8J 2IX0A 2KENA 3OYYA 2E2JH 2FXQA 3T1HL 3S2DH 2OTJA 2IY5B 2Y0SE 4O2DA 1K9MC 3D0FA 2UUAL 1YEZA 3PO3H 1MKHA 4AYBG 1GM5A 4A3LG 3PCOB 1WOCA 3E9HA 1KD1C 3MXNB 2PQAB 4DV0Q 3KF6A 4LF4L 1IBML 1PH3A 1ASZA 2JA7G 1VQ9A 3TQYA 3A5UA 3HOXH 1I3QH 4BBRG 3PUWA 2JEAI 4JG2A 4DV2Q 4YWLA 1C0AA 2EQSA 4FDBA 4O0AA 1VQ5A 4LF9L 4LFAL 1MIUA 5DLQE 1NMGA 4AQYQ 1L1OB 1Q1EA 3U4ZA 4DR4L 1UE7A 3S17H 5AJ3L 3FKIH 4IJLA 3NBHB 4A3MG 1Q82C 5GAGC 3PIOA 2E2HH 1Z47A 4A3FH 1N33Q 2E5LQ 4APVA 3RNUA 1K0RA 1E1TA 4JI4Q 4GLVB 3BU2A 1VQ6A 1YIJA 1A8VA 2H5XA 1JJCB 4TVAB 1VQGA 2UUAQ 1KL9A 5IP9G 1YHAA 2F4VL 1QUQB 2AWOA 5FLMH 1HR0W 4HJ5A 3K0XA 2YYZA 3PIPA 3IRBA 4HJ7A 5IYBH 1VQMA 3M4QA 5FLMG 1AH9A 3ULLA 2JJQA 1BBUA 1EYGA 1SRUA 1QZGA 1SROA 4JV5Q 1A63A 2K75A 4BY7G 4DR7L 3HKZE 2JA8H 4L5TA 4EX5A 1D8LA 4DV4Q 4DV6Q 1K73C 4JI1Q 2HHHL 4L5SA 4LF8L 4A3DG 1HNWQ 5HGQA 4B3SL 4KHPQ 1KHIA 3CC7A 4HIDA 2RHQB 4OX9Q 1CKOA 2Q2HA 1GO3E 5IYDG 1J5EL 2JA9A 1PFSA 3LGJA 3PF4A 5E7NA 2D0PA 4ME3A 5IYCG 1YITA 4JI7Q 1E24A 2PI2A 3E9IA 1EQQA 3U58A 2EIFA 5JEAJ 4OWXB 3ULPA 3PF5A 4B3SQ 4BXXH 1I5FA 2YTVA 1BVSA 3CAMA 1N34L 3BZKA 3S2HH 1V1QA 2R6GA 1L2FA 2Z6KA 5GAHC 4AQYL 5M5YH 2JA5H 4A3KG 1QVGA 2I5HA 3GD7A 2IT1A 3EN2A 2ZJQA 2ATWA 2JA6G 4OO1I 3RLNA 4DV7L 1C7YA 1N34Q 1K83H 4UP8A 2JA5G 4LUOA 3S1MH 3HOUG 1IXRA 1E7ZA 4A76A 2JE6I 5IE8A 4B3ML 5GQOA 5GADC 3EIVA 2BA1A 3F2BA 3EBEA 3KF6B 3I4MG 3KOJA 4DV4L 2VY3A 4DV6L 1PH2A 2KHIA 3K7AH 4LF8Q 2F3IA 5K36G 2KHJA 1XTDA 1YJNA 3I4MH 4IFDJ 1PVOA 4KHZA 1Y14B 5M5XH 4R1JA 3PUVA 1L0WA 1CSPA 3CCRA 3S1NH 3F2CA 3I4NH 4A3JH 3PUYA 4A3EG 2OQ0A 1MJEA 4KI0A 2N8NA 4R4QA 1HH2P 2WFWA 1YZ6A 1OXUA 1YHBA 3I4NG 1V43A 2ZTCA 5M3MH 2Y0SG 3CXCA 3TRZA 5IY0A 3OTOL 1CSQA 4X65Q 1PHJA 2HHHQ 4P74A 1PH5A 2E5LL 1HZCA 1BBWA 2N3SA 3AFPA 3CCEA 2ZTEA 3CPFA 4JI4L 1VQEA 2OQKA 3K80C 2ES2A 1UE1A 1VQCA 2I5LX 4MNOA 1KAWA 1X3EA 4A3LH 3RLFA 2OCEA 4X62Q 3RN5A 3BJUA 5EAYA 1DGSA 4JI1L 3J81j 1HJPA 4L5QA 2JA7H 2CQOA 3UDFA 4GKJL 3JAMc 2VQFQ 3CCQA 4DKAC 1PYBA 4LF9Q 1VQHA 3CW2C 3J7ZC 2AMCB 2JQOA 3STBD 1I94L 2K5NA 4MZ9A 4JV5L 4DR4Q 4JI7L 4X66L 3AFQA 4A3CH 1YBYA 4DR3Q 3CMEA 1UE5A 4X64L 4UP7A 1H95A 4A3CG 4KHPL 5FJ8G 1EFWA 4XIGS 1Y1VH 1VQKA 1PA6A 1TWAH 3H0GH 3CCJA 2AHOB 1J5EQ 3H15A 4DV3Q 4LF7L 4X65L 4NXML 1X54A 1HNZL 3KJPA 2R7ZG 2ALYB 1TWGH 3TREA 4DK3C 3M4OH 1LYLA 3J80c 1P8LA 2IHFA 2R7ZH 3UDIA 1G6PA 1NTGA 1LTLA 2MO0A 1S3OA 2N49A 4GS3A 4LF6L 3CPWA 4X62L 3HOWH 3Q8DA 3HOYG 4JI3L 3SGIA 4A93H 1B7YB 5BR8Q 1PH1A 4GKKL 3TS2A 1S40A 2JK8A 1OXSC 3PSIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W1G A;  1XJV A;  1HNW L;  3H3V I;  2UU9 Q;  2CWP A;  1N32 Q;  2RHS B;  1G29 1;  4X64 Q;  2ZM6 Q;  3KYH C;  2KCT A;  2UXD L;  3HKS A;  3CCU A;  4IO9 A;  2WAQ E;  1FJG Q;  5IYC H;  1NMF A;  5JEA G;  1WJJ A;  2WB1 G;  4RMF A;  4JOI A;  1TWH H;  2L15 A;  3CC2 A;  5C4X H;  2NVY H;  2KBN A;  4BXX G;  1SR3 A;  1W2B A;  4UPA A;  1G51 A;  3S1R H;  1VS0 A;  1I6H H;  2HIX A;  1NBW A;  5C4X G;  5IWA Q;  4DR2 Q;  1JB7 A;  2BH8 A;  4IPH A;  1MJC A;  2LXK A;  2NN6 I;  3T1Y Q;  4QY7 A;  1JE5 A;  1J6Q A;  2B3G A;  3A5Z B;  4GNX A;  4IPD A;  1FGU A;  1EWI A;  4C3H H;  5IWA L;  1CKN B;  4ALP A;  2YV5 A;  4DR2 L;  1BKB A;  1RL2 A;  2K50 A;  3GTQ H;  1K8G A;  4P72 A;  4DR3 L;  3A74 A;  5LMN L;  4DR1 L;  1E3P A;  2NN6 G;  4GKJ Q;  1WCM H;  2ZTD A;  1GVP A;  1VQD A;  2VQF L;  4JBK A;  1Y1W G;  3CC4 A;  4OO1 G;  1VQ4 A;  1Q7Y C;  3I4O A;  5JJK A;  4DUZ L;  4AH6 A;  1JJ2 A;  1HR0 Q;  4JI8 Q;  3CCM A;  4BY1 G;  4LFA Q;  2ID0 A;  3U4V A;  3ULJ A;  4UP9 A;  2XTI A;  4LFB L;  4R4I A;  1VQF A;  2VUM H;  5C0X G;  3J81 i;  3GTM H;  3CMA A;  4P73 A;  1OXX K;  3KDF A;  2ZJP A;  4YCU A;  4JI3 Q;  2NVT H;  1XNQ L;  1IL2 A;  3DM3 A;  1N33 L;  4XTC S;  2F52 A;  1QVF A;  3A0J A;  4DV7 Q;  1U0L A;  3M85 A;  4POG A;  2QA4 A;  2UU9 L;  1Q8K A;  3PO3 G;  4JI5 L;  4J15 A;  3JC6 6;  3DLL A;  1YHQ A;  3HOV H;  1EOV A;  1E1O A;  5LMN W;  5HY6 A;  2VNU D;  5BR8 L;  3UE0 A;  2MQH A;  2VL6 A;  1FJG L;  1X6O A;  5IT9 c;  4IPC A;  5C0X I;  3HOX G;  3H3V H;  3G6E A;  1FL0 A;  1NY4 A;  2JEB I;  4C2M H;  1PV4 A;  2R93 H;  3S24 A;  3I56 A;  2HT1 A;  4AYB E;  5GRO A;  1SMX A;  1N32 L;  3NEL A;  1AE3 A;  5FJ8 H;  1VQA A;  2K5V A;  1EQR A;  4JCV E;  5LMN Q;  4KLK A;  1PH6 A;  2VQE Q;  3FKI G;  1CKM A;  3HOZ H;  3CP0 A;  2YU9 H;  4OON A;  4JI2 Q;  4A4I A;  2HIV A;  1CUK A;  1LUZ A;  3PV0 A;  5FLX c;  2Q2T A;  2IHE A;  1KC8 C;  1JT8 A;  5M3F H;  1YI2 A;  1VQ8 A;  5IP7 G;  1X56 A;  2VS1 A;  4DUZ Q;  2ASB A;  2LXJ A;  1P16 A;  4YY3 Q;  4DV1 Q;  4DV5 Q;  1TWC H;  4PZ6 A;  1VQL A;  4WJ4 A;  2MNA A;  1XPO A;  3F1Z A;  5IP7 H;  4K0K Q;  2BH2 A;  2CFM A;  3AYH B;  4LUV A;  3PO2 G;  2PI2 E;  4DUY L;  4GKK Q;  4LFB Q;  4JI5 Q;  1YJW A;  1SFO H;  1AE2 A;  1N9W A;  4A93 G;  1M90 C;  3JAM i;  4H02 A;  3NEM A;  5IYB G;  3I7F A;  4LNQ A;  4HIK A;  1W3S A;  3HKZ G;  4NXN L;  3UDX A;  5C44 H;  1XPR A;  5IP9 H;  3HOY H;  1VQP A;  4UY8 C;  2Z6K C;  1VQB A;  4JI6 Q;  1Q86 C;  1VQO A;  2AWN A;  3PUZ A;  4LUZ A;  4LF5 L;  2Q2U A;  3S15 H;  1XNR Q;  3U50 C;  3CCV A;  1VCI A;  2C35 B;  4NB3 A;  4DV2 L;  1PH7 A;  4BY7 H;  1IBL Q;  1Q81 C;  5IYD H;  4IFD I;  2KCM A;  3W5O A;  1HR0 L;  4JC0 A;  1I50 H;  2OTL A;  1TWF H;  4JI8 L;  1SLJ A;  4LF7 Q;  4NXM Q;  2B63 H;  2GVB A;  3KJO A;  2V1C C;  3T1Y L;  1XMO L;  2R92 H;  4IOA A;  1Q1B A;  2PNH A;  4DK6 C;  4JBW A;  3ZJY C;  4K0K L;  3ERS X;  2RF4 A;  1SE8 A;  4EQ5 A;  1XPU A;  3J7A 5;  1B70 B;  5ELO A;  2QEX A;  4LF6 Q;  2JA6 H;  4JI0 L;  2I0Q A;  4DR5 Q;  4JI2 L;  4DR1 Q;  2K5H A;  4GOP C;  2K14 A;  1NE3 A;  2NVX H;  2PQA A;  1IBK L;  3PGZ A;  4A3G G;  2N78 A;  3ICE A;  2K52 A;  1E22 A;  3STB C;  4A3B H;  3KFU A;  3M3Y H;  2UUC Q;  1XMQ Q;  1ASY A;  5C3E H;  2UXC Q;  3HOU H;  1QVC A;  1IYJ B;  4A3B G;  4DR6 Q;  2I5M X;  2LSS A;  1I94 Q;  5C3E G;  1M1K C;  1HNX Q;  2YTY A;  1IBL L;  4P75 A;  1Q46 A;  2WB1 E;  1SN8 A;  4IJH A;  4X66 Q;  4GOP A;  1XMQ L;  1X3F A;  4LWC A;  4OXP A;  2CKZ B;  3GDE A;  2VW9 A;  1KQS A;  5JJI A;  4AIM A;  1YVC A;  4GLA C;  4YWM A;  4LFC L;  4JI6 L;  1KRS A;  4OWW B;  2A8V A;  4DNI A;  2IX1 A;  3RN2 A;  4C3J H;  3TS0 A;  4A3I H;  2XGT A;  4HIO A;  1HNZ Q;  1X65 A;  3K7U C;  2MO1 A;  1V9P A;  4A3I G;  2NZO A;  4YCW A;  3K81 C;  4A75 A;  1EUJ A;  4WJ3 M;  2Z0S A;  1Z9F A;  4DUY Q;  1HZ9 A;  3B6Y A;  4R4O A;  3TEH B;  1EIF A;  2DUD A;  1KRT A;  4HJA A;  4RG1 A;  2UXB Q;  1EIY B;  2BA0 A;  1PH9 A;  4NXN Q;  2GVA A;  2R93 G;  2GN5 A;  1TXY A;  3K8A A;  3G4S A;  3RZO H;  1CKN A;  1T9H A;  1HNX L;  5J3B A;  2VQE L;  2UXB L;  3GTJ H;  3J80 i;  3RR5 A;  3G48 A;  4GN4 B;  5C4J H;  1XNR L;  3HOZ G;  3GTK H;  2EXD A;  4YHH L;  2WAQ G;  2ZM6 L;  2CCZ A;  4LFC Q;  4LF4 Q;  3S16 H;  2UXD Q;  4YY3 L;  3M7N A;  2PMZ E;  2F4V Q;  4BBR H;  3S14 H;  4YWK A;  3WWV A;  1WI5 A;  4GN5 A;  4GNX C;  4PZ8 A;  2B29 A;  3S1Q H;  1UEB A;  4BBS G;  5M5W H;  2QGQ A;  3E0E A;  1YJ9 A;  4JBM A;  2CWA A;  3PO2 H;  1Y1V G;  4BBS H;  4MTN A;  4JBJ A;  3OTO Q;  4X6A H;  3H0G G;  1JMC A;  5M3F G;  1X9N A;  2OWO A;  1UWV A;  4A3M H;  4YCV A;  4QIW E;  4L5R C;  1OXV A;  2D62 A;  1PH8 A;  4IFD G;  4PZ7 A;  4BA2 I;  5JJL A;  2R7F A;  4A3F G;  1D7Q A;  3KLW A;  3KF8 B;  4R4T A;  2VZA A;  1YNX A;  2Q2I A;  1KXL A;  3M4P A;  1KIX A;  3GTO H;  4B3T Q;  1HZA A;  1S72 A;  4DAY B;  3UDG A;  3GTG H;  1QUQ A;  4B3R L;  3HOW G;  1L1O C;  4HJ9 A;  1U5K A;  2UXC L;  4IPG A;  3RLO A;  5C44 G;  1IBM Q;  2E2I H;  2R7D A;  4P71 A;  1VQ7 A;  1PH4 A;  4B3M Q;  4DR6 L;  4A3D H;  4Y7N H;  2NVQ H;  3T1H Q;  1NJI C;  3ER0 A;  4B3R Q;  5LMU L;  1VQJ A;  1C9O A;  4QGU A;  1XMO Q;  4POF A;  3CCS A;  3OW2 A;  3FP9 A;  2JA8 G;  4R4C A;  1A62 A;  4Y52 H;  1QZH A;  4PMW A;  4HJ8 A;  5GAE C;  1O7I A;  1WFQ A;  4JI0 Q;  4DV3 L;  1VQN A;  4DR5 L;  3MEF A;  2DGY A;  1OTC A;  1IZ6 A;  5H1S E;  1K3R A;  5ELN A;  2D0O A;  4GNX B;  2B63 G;  2AKW B;  3CF5 A;  1XNQ Q;  2HQL A;  1X55 A;  4PG3 A;  1HZB A;  4OX9 L;  2R92 G;  4LW1 A;  4DPG A;  1N36 Q;  4A3G H;  4OWT B;  2MFI A;  1OXT A;  4IOC A;  4QQB X;  4BA1 I;  2UUC L;  1GD7 A;  5AJ3 Q;  3AQQ A;  4JYA L;  1Q12 A;  4C3I H;  3RZD H;  3G71 A;  4NPS A;  3L7Z C;  3F2D A;  4A3K H;  1N36 L;  3J81 c;  2E8G A;  3CCL A;  1A0I A;  2A19 A;  3FHW A;  1B8A A;  3W1B A;  3L0O A;  2RCN A;  1JJG A;  4LF5 Q;  4JYA Q;  3BZC A;  5LMU Q;  1RIP A;  5C0X J;  1PYS B;  4DV0 L;  1FVI A;  1WCM G;  3F8T A;  4DAM A;  3PUX A;  1Y1W H;  3GO5 A;  4GLX A;  3M9B A;  1GKH A;  1VQI A;  2NZH A;  2YTX A;  4A3J G;  4YHH Q;  1R9T H;  1X3G A;  2A1A A;  3CQZ H;  2UUB Q;  2K4K A;  1WYD A;  3AEV A;  2VUM G;  4QJF A;  3NEN A;  1N8R C;  3I55 A;  3GTP H;  4TQU S;  4HIM A;  2UUB L;  1UE6 A;  2ZJR A;  4QL5 A;  4BY1 H;  4DR7 Q;  3VDY A;  3GTL H;  4A3E H;  4B3T L;  4DV1 L;  4DV5 L;  4JOI C;  3L2P A;  4GN3 B;  3UE1 A;  1L1O A;  4GOP B;  3I2Z A;  3KDF B;  1K8A C;  5M3M G;  1IBK Q;  3D31 A;  3CD6 A;  1LM0 A;  3HOV G;  3HFZ B;  2WP8 J;  2IX0 A;  2KEN A;  3OYY A;  2E2J H;  2FXQ A;  3T1H L;  3S2D H;  2OTJ A;  2IY5 B;  2Y0S E;  4O2D A;  1K9M C;  3D0F A;  2UUA L;  1YEZ A;  3PO3 H;  1MKH A;  4AYB G;  1GM5 A;  4A3L G;  3PCO B;  1WOC A;  3E9H A;  1KD1 C;  3MXN B;  2PQA B;  4DV0 Q;  3KF6 A;  4LF4 L;  1IBM L;  1PH3 A;  1ASZ A;  2JA7 G;  1VQ9 A;  3TQY A;  3A5U A;  3HOX H;  1I3Q H;  4BBR G;  3PUW A;  2JEA I;  4JG2 A;  4DV2 Q;  4YWL A;  1C0A A;  2EQS A;  4FDB A;  4O0A A;  1VQ5 A;  4LF9 L;  4LFA L;  1MIU A;  5DLQ E;  1NMG A;  4AQY Q;  1L1O B;  1Q1E A;  3U4Z A;  4DR4 L;  1UE7 A;  3S17 H;  5AJ3 L;  3FKI H;  4IJL A;  3NBH B;  4A3M G;  1Q82 C;  5GAG C;  3PIO A;  2E2H H;  1Z47 A;  4A3F H;  1N33 Q;  2E5L Q;  4APV A;  3RNU A;  1K0R A;  1E1T A;  4JI4 Q;  4GLV B;  3BU2 A;  1VQ6 A;  1YIJ A;  1A8V A;  2H5X A;  1JJC B;  4TVA B;  1VQG A;  2UUA Q;  1KL9 A;  5IP9 G;  1YHA A;  2F4V L;  1QUQ B;  2AWO A;  5FLM H;  1HR0 W;  4HJ5 A;  3K0X A;  2YYZ A;  3PIP A;  3IRB A;  4HJ7 A;  5IYB H;  1VQM A;  3M4Q A;  5FLM G;  1AH9 A;  3ULL A;  2JJQ A;  1BBU A;  1EYG A;  1SRU A;  1QZG A;  1SRO A;  4JV5 Q;  1A63 A;  2K75 A;  4BY7 G;  4DR7 L;  3HKZ E;  2JA8 H;  4L5T A;  4EX5 A;  1D8L A;  4DV4 Q;  4DV6 Q;  1K73 C;  4JI1 Q;  2HHH L;  4L5S A;  4LF8 L;  4A3D G;  1HNW Q;  5HGQ A;  4B3S L;  4KHP Q;  1KHI A;  3CC7 A;  4HID A;  2RHQ B;  4OX9 Q;  1CKO A;  2Q2H A;  1GO3 E;  5IYD G;  1J5E L;  2JA9 A;  1PFS A;  3LGJ A;  3PF4 A;  5E7N A;  2D0P A;  4ME3 A;  5IYC G;  1YIT A;  4JI7 Q;  1E24 A;  2PI2 A;  3E9I A;  1EQQ A;  3U58 A;  2EIF A;  5JEA J;  4OWX B;  3ULP A;  3PF5 A;  4B3S Q;  4BXX H;  1I5F A;  2YTV A;  1BVS A;  3CAM A;  1N34 L;  3BZK A;  3S2H H;  1V1Q A;  2R6G A;  1L2F A;  2Z6K A;  5GAH C;  4AQY L;  5M5Y H;  2JA5 H;  4A3K G;  1QVG A;  2I5H A;  3GD7 A;  2IT1 A;  3EN2 A;  2ZJQ A;  2ATW A;  2JA6 G;  4OO1 I;  3RLN A;  4DV7 L;  1C7Y A;  1N34 Q;  1K83 H;  4UP8 A;  2JA5 G;  4LUO A;  3S1M H;  3HOU G;  1IXR A;  1E7Z A;  4A76 A;  2JE6 I;  5IE8 A;  4B3M L;  5GQO A;  5GAD C;  3EIV A;  2BA1 A;  3F2B A;  3EBE A;  3KF6 B;  3I4M G;  3KOJ A;  4DV4 L;  2VY3 A;  4DV6 L;  1PH2 A;  2KHI A;  3K7A H;  4LF8 Q;  2F3I A;  5K36 G;  2KHJ A;  1XTD A;  1YJN A;  3I4M H;  4IFD J;  1PVO A;  4KHZ A;  1Y14 B;  5M5X H;  4R1J A;  3PUV A;  1L0W A;  1CSP A;  3CCR A;  3S1N H;  3F2C A;  3I4N H;  4A3J H;  3PUY A;  4A3E G;  2OQ0 A;  1MJE A;  4KI0 A;  2N8N A;  4R4Q A;  1HH2 P;  2WFW A;  1YZ6 A;  1OXU A;  1YHB A;  3I4N G;  1V43 A;  2ZTC A;  5M3M H;  2Y0S G;  3CXC A;  3TRZ A;  5IY0 A;  3OTO L;  1CSQ A;  4X65 Q;  1PHJ A;  2HHH Q;  4P74 A;  1PH5 A;  2E5L L;  1HZC A;  1BBW A;  2N3S A;  3AFP A;  3CCE A;  2ZTE A;  3CPF A;  4JI4 L;  1VQE A;  2OQK A;  3K80 C;  2ES2 A;  1UE1 A;  1VQC A;  2I5L X;  4MNO A;  1KAW A;  1X3E A;  4A3L H;  3RLF A;  2OCE A;  4X62 Q;  3RN5 A;  3BJU A;  5EAY A;  1DGS A;  4JI1 L;  3J81 j;  1HJP A;  4L5Q A;  2JA7 H;  2CQO A;  3UDF A;  4GKJ L;  3JAM c;  2VQF Q;  3CCQ A;  4DKA C;  1PYB A;  4LF9 Q;  1VQH A;  3CW2 C;  3J7Z C;  2AMC B;  2JQO A;  3STB D;  1I94 L;  2K5N A;  4MZ9 A;  4JV5 L;  4DR4 Q;  4JI7 L;  4X66 L;  3AFQ A;  4A3C H;  1YBY A;  4DR3 Q;  3CME A;  1UE5 A;  4X64 L;  4UP7 A;  1H95 A;  4A3C G;  4KHP L;  5FJ8 G;  1EFW A;  4XIG S;  1Y1V H;  1VQK A;  1PA6 A;  1TWA H;  3H0G H;  3CCJ A;  2AHO B;  1J5E Q;  3H15 A;  4DV3 Q;  4LF7 L;  4X65 L;  4NXM L;  1X54 A;  1HNZ L;  3KJP A;  2R7Z G;  2ALY B;  1TWG H;  3TRE A;  4DK3 C;  3M4O H;  1LYL A;  3J80 c;  1P8L A;  2IHF A;  2R7Z H;  3UDI A;  1G6P A;  1NTG A;  1LTL A;  2MO0 A;  1S3O A;  2N49 A;  4GS3 A;  4LF6 L;  3CPW A;  4X62 L;  3HOW H;  3Q8D A;  3HOY G;  4JI3 L;  3SGI A;  4A93 H;  1B7Y B;  5BR8 Q;  1PH1 A;  4GKK L;  3TS2 A;  1S40 A;  2JK8 A;  1OXS C;  3PSI A; 
#chains in the Genus database with same CATH topology
 3S1R B;  1XJV A;  1JR0 D;  2CWP A;  4IUV A;  1A3V A;  3KYH C;  2KCT A;  3HKS A;  2NYZ D;  4IO9 A;  4R8N A;  1WJJ A;  1LAB A;  3CC2 A;  5EPJ A;  5C4X H;  1W2B A;  1G51 A;  1LTA D;  2HIX A;  1NBW A;  4C3H B;  1A6X A;  1BQQ T;  1MI2 A;  5JAV A;  3T1Y Q;  1ZEQ X;  2B3G A;  4GNX A;  2F0S A;  4C3H H;  1FGU A;  2F4V Q;  4DR2 L;  2YV5 A;  2K50 A;  2F03 A;  1DOM A;  3DHQ A;  4P72 A;  4DR1 L;  5IGC A;  3OSO A;  4ILW A;  1WTV A;  1IW7 C;  1GVP A;  4DA2 A;  2E2J B;  4KKU A;  1V8Q A;  5IOC A;  1VQ4 A;  1Q7Y C;  3I4O A;  1HPC A;  3TBI B;  3GTL B;  1LT6 D;  3ULJ A;  2A6H D;  2XTI A;  4UP9 A;  4DAY A;  4R4I A;  1F77 A;  3EQL C;  1STE A;  4I65 A;  4ZKC B;  4JI3 Q;  1XNQ L;  2JA7 B;  3MC0 B;  3Q22 A;  2D9U A;  1N33 L;  5EKL A;  3M4O B;  4RKL A;  1KTK A;  1EY4 A;  4JI5 L;  5EBD A;  3DLL A;  5HY6 A;  1O7Z A;  5BR8 L;  3UE0 A;  1X6O A;  4IPC A;  5C0X I;  3HOX G;  1LT5 D;  4C2M H;  2FIN B;  2KJX A;  4CKC A;  3S24 A;  4JCV E;  3TP8 A;  4KLK A;  5LMN Q;  4BS9 A;  3CP0 A;  3EA6 A;  2F0H A;  4OON A;  1XYI A;  2YU9 H;  4JI2 Q;  2HIV A;  1LUZ A;  5FLX c;  3OHX C;  1FYC A;  2E74 C;  1X56 A;  4DUZ Q;  1VQL A;  1TWC H;  3AYH B;  2B2V A;  1SFO H;  1M90 C;  2J0T D;  3MFG A;  3JAM i;  2JXM B;  4HIK A;  3S2H B;  1XPR A;  5C44 H;  4LJZ C;  1BNZ A;  1VQB A;  3ND9 A;  2AWN A;  3PUZ A;  2Q2U A;  3CCV A;  1VCI A;  2C35 B;  4NB3 A;  1Q81 C;  2ZXR A;  3MAQ A;  1I50 H;  4V19 0;  1ESR A;  1CTM A;  2B63 H;  3KJO A;  2V1C C;  2R92 H;  2AQ3 B;  1I4Q A;  3SXH A;  2XVS A;  3S1M B;  1EIG A;  2BDO A;  3ZJY C;  2RF4 A;  1SE8 A;  4EQ5 A;  3J7A 5;  1B70 B;  2QEX A;  4JI0 L;  4KY7 A;  4HAE A;  1VMP A;  2PQA A;  5JPN C;  3PGZ A;  3LX0 A;  2LFN A;  4A3B H;  1XMQ Q;  3QO2 A;  2Z4I A;  2I5M X;  2LSS A;  4H0L C;  1JIC A;  5CR3 A;  1IBL L;  1Y8N B;  1X3F A;  4LWC A;  4OXP A;  4RGT A;  1S5B D;  2VW9 A;  3R2I A;  5T1G A;  4OWW B;  4H7B A;  4A3I H;  2XGT A;  1RHP A;  1HNZ Q;  1X65 A;  2QEJ C;  4F88 A;  2NZO A;  4QCL A;  4YCW A;  4A75 A;  3D8G A;  3N52 A;  3B6Y A;  3K59 A;  1EIF A;  2B2T C;  1QCB D;  2DY8 A;  2UXB Q;  1EIY B;  2BA0 A;  3ERO A;  4CKB A;  4I7Z C;  1PH9 A;  2GN5 A;  2QKI C;  4QUC A;  4F87 A;  2VQE L;  1H9S B;  3VR6 A;  4IUQ A;  3J80 i;  3RR5 A;  1BOS A;  3OW7 A;  2EXD A;  1M4V A;  3VR2 A;  4G4K A;  2CCZ A;  3S16 H;  2Z8L A;  2GA4 B;  3S1Q H;  4PZ8 A;  2B29 A;  1GJX A;  5M5W H;  2EXZ A;  2K04 A;  2B63 B;  1GHK A;  5CBE E;  4BBS H;  4MTN A;  3W3A A;  4JBJ A;  1X9N A;  2MPM A;  3NQI A;  1ENC A;  4YCV A;  3M4Y A;  4IFD G;  4BA2 I;  1PRT B;  2HUG A;  3QOJ A;  1D7Q A;  1SMY D;  3OMC A;  4XYQ A;  5A2Q L;  1KIX A;  3GTO H;  4B3T Q;  3GTK B;  1S72 A;  4DAY B;  4QIW B;  1U5K A;  2IW3 A;  4DAP A;  1XTC D;  1EL0 A;  2R7D A;  3CQZ B;  4P71 A;  4DF7 A;  4Y7N H;  3T1H Q;  5EKK A;  3ER0 A;  3MVV A;  4FF2 A;  1O7Y A;  1XMO Q;  1K8M A;  3CCS A;  4WOR A;  2JA8 G;  1EFI D;  1Y8O B;  1E2W A;  4XQN A;  5GAE C;  3H91 A;  2EYM A;  2F0P A;  4G7O C;  4DR5 L;  2E2I B;  2IPK D;  3MEF A;  1OTC A;  5H1S E;  1K3R A;  3FVQ A;  4J8Q A;  3CF5 A;  2DJG C;  1HZB A;  4LW1 A;  2MFI A;  1OXT A;  2B8F A;  4QQB X;  4BA1 I;  3KUP A;  3FRP B;  1Q12 A;  3A8I E;  4A3K H;  3DM1 A;  3J81 c;  3CCL A;  3SK4 A;  4ID6 A;  5CMD A;  3HOV B;  1GUS A;  4XQQ A;  1NSN S;  2CW0 C;  2RCN A;  3L0O A;  1JJG A;  4JYA Q;  1EQV A;  3P20 A;  2NWG A;  1WCM G;  1STN A;  2EYH A;  1PFN A;  3PUX A;  3J81 L;  3AEV A;  2PO4 A;  3CQZ H;  2A1A A;  4FNF A;  3NEN A;  1HHV A;  2ZJR A;  4QL5 A;  1JWS D;  4DR7 Q;  3C3L A;  3GTL H;  4A3E H;  3NE5 B;  4DV5 L;  2K5Q A;  2C9O A;  4GOP B;  3I2Z A;  3BVG A;  3D31 A;  5C5L A;  3HFZ B;  3K5L A;  3F2U A;  1EY9 A;  2Y0S E;  2IWH A;  2C5C A;  5EKI A;  1GM5 A;  3BG3 A;  3PCO B;  2Q8T A;  1YNJ D;  3TDQ A;  1ESF A;  4DV0 Q;  4LF4 L;  4C3J B;  5KNC A;  2B2W A;  4CJ2 C;  4ZCK A;  1IHZ A;  2KA7 A;  4KKS A;  2JEA I;  4JG2 A;  5D3D A;  5J1Z A;  4YWL A;  1HTL D;  4O42 A;  1GUW A;  1VQ5 A;  3I8Z A;  3QOL A;  2IJ0 A;  1L1O B;  3U4Z A;  1UE7 A;  2CVR A;  2K03 A;  2X6G A;  5AJ3 L;  1GOZ A;  1JOK A;  4A3M G;  1WD0 A;  3PIO A;  2E2H H;  1Z47 A;  3K0Y A;  1N33 Q;  2KOL A;  2E5L Q;  1GUG A;  1RKN A;  4JI4 Q;  1E1T A;  2N88 A;  5CYU A;  5IGE A;  3EFX D;  1ENF A;  2H5X A;  1JJC B;  3QWN A;  5C3X A;  2UUA Q;  1YHA A;  5FLM H;  5FK9 C;  1AH9 A;  1BBU A;  2J7Z A;  5M9O A;  3T53 B;  1QZG A;  1ILP A;  1TS4 A;  3MXU A;  2JA8 H;  1SE2 A;  2EYP A;  1WTH A;  4EX5 A;  1D8L A;  1KNA A;  1TWG B;  4DV4 Q;  4L5S A;  4A3D G;  3A8K E;  3HGB A;  5HGQ A;  4B3S L;  3VR3 A;  1SNP A;  3RUZ A;  1CKO A;  4KD4 A;  3LGJ A;  3WOE A;  2A6E C;  3E9I A;  4OWX B;  5ELC A;  3OWF A;  3CAM A;  5LL6 X;  2K5W A;  1H9J A;  5GAH C;  5FO9 B;  2JA5 H;  1QVG A;  2ATW A;  5E1F A;  4OO1 I;  5CV4 A;  5EPL A;  4LUO A;  3HOU G;  4A76 A;  2RKS A;  5GQO A;  4RCO A;  1EWC A;  3UI2 A;  2QDB A;  1B4O A;  4ZRZ A;  4DV6 L;  2VY3 A;  4LF8 Q;  3K7A H;  1DYQ A;  3NTH A;  1STG A;  3X3M A;  3TZU A;  3PUV A;  2WII B;  4A3E G;  1ZXT A;  2OQ0 A;  1MJE A;  2N8N A;  4R4Q A;  1OXU A;  3I4N B;  3L9A X;  3NTK A;  1ET6 A;  1QNK A;  5IY0 A;  4X65 Q;  4P74 A;  5D3I B;  3PIO 3;  2E5L L;  1BBW A;  2ZTE A;  4JI4 L;  2K01 A;  1TS3 A;  1MHW C;  4PNY A;  2ES2 A;  2I5L X;  2MGS A;  1KAW A;  1LTB D;  3RLF A;  2O5I C;  1AZQ A;  1K3B C;  1H9M A;  2OCE A;  4X62 Q;  3RN5 A;  1EY5 A;  5EAY A;  4L5Q A;  1PZK D;  3WDN A;  1PYB A;  4LF9 Q;  1VQH A;  3J7Z C;  4JI7 L;  3DUZ A;  1TY2 A;  3AFQ A;  4A3C H;  2LS0 1;  3VR4 A;  3SDZ A;  4DR3 Q;  1UE5 A;  1VF5 C;  1H95 A;  1LTS D;  3MWY W;  5C5M A;  3H0G H;  1VF7 A;  4DV3 Q;  1X54 A;  1HNZ L;  4IUN A;  4ZUJ A;  4JVZ A;  1TR5 A;  2IHF A;  2N49 A;  2MO0 A;  2WIN B;  4JK1 C;  1G2S A;  1X32 A;  1YNN C;  4EQO A;  4IUP A;  4IFD H;  1EU3 A;  3HOY G;  1SMY C;  1RCV D;  3SGI A;  1PH1 A;  4RHS A;  1OXS C;  3W1G A;  2F0L A;  1LV9 A;  1N32 Q;  3AU7 A;  2I46 A;  1G29 1;  4X64 Q;  2K33 A;  2XIW A;  3CCU A;  2FJ2 A;  1FJG Q;  5IYC H;  1NMF A;  5JEA G;  2WB1 G;  1TWH H;  1PRT D;  1SR3 A;  4UPA A;  3ND8 A;  2Z4H A;  5IWA Q;  1JB7 A;  2BH8 A;  1MJC A;  2OT2 A;  3NTI A;  2J4X A;  1J6Q A;  1WTO A;  4OGQ C;  4IPD A;  5JPM C;  4ALP A;  2ZXP A;  1BKB A;  1U9R A;  1ICF B;  3IFT A;  4RCN A;  1J8I A;  2CH4 W;  1E3P A;  3S9W A;  2A73 B;  4DAV A;  3QG1 A;  1Y1W G;  3MXN A;  3CC4 A;  4OO1 G;  5C3W A;  2NVQ B;  3SE0 A;  4Q0F A;  5JJK A;  4K2K A;  4OEM B;  4FF1 A;  4LFA Q;  1RJT A;  1B50 A;  4BY1 B;  2JA5 B;  3GTO B;  3GTM H;  3CMA A;  4P73 A;  1OXX K;  4G7H C;  1PTO B;  2NVT H;  4XTC S;  2F52 A;  5FO8 B;  2TMP A;  3A0J A;  3DWP A;  3K6O A;  3CRK C;  1U0L A;  2UU9 L;  1WCM B;  1Q8K A;  3ZYY X;  1B1Z A;  1I4G A;  3DEO A;  4J15 A;  2VNU D;  1D1K A;  3QIA A;  4HR7 B;  1SYB A;  2LMC B;  1C4Q A;  3G6E A;  1FL0 A;  2JEB I;  1QB5 D;  2AUK A;  4KD3 A;  4TRD A;  4AYB E;  2HT1 A;  1N32 L;  1VQA A;  4K5X A;  1S5D D;  3EVQ A;  1LLR D;  3FKI G;  3EJI A;  1JT8 A;  3PV0 A;  5M3F H;  2VS1 A;  1HXY D;  2N55 A;  2LXJ A;  4DV5 Q;  1UUP A;  5IP7 H;  1KDA A;  4K0K Q;  2BH2 A;  1QIL A;  3MXP A;  4LUV A;  2PI2 E;  1SE3 A;  4JI5 Q;  4A3D B;  2O2L D;  2HCC A;  3TP5 A;  1N9W A;  1SYG A;  3I72 A;  3K5O A;  5IYB G;  4LNQ A;  1W3S A;  3U9O A;  3UDX A;  2K1B A;  5IP9 H;  4UHV A;  4PQX A;  3I91 A;  3JAM L;  4JI6 Q;  3S1N B;  5M5X B;  1JOQ A;  4LF5 L;  4CJ0 B;  1HUM A;  2F0K A;  5JEA H;  3Q24 A;  1TWH B;  1HA5 A;  4K6D A;  5D14 A;  2L5T A;  3S2D B;  2KCM A;  4JC0 A;  1TWA B;  3NBH A;  2M00 A;  2GVB A;  3T1Y L;  2XWB B;  4X3T A;  4DK6 C;  4JBW A;  1XPU A;  4JW0 A;  4K5W A;  2XNA C;  1SDF A;  2B2U A;  1KLG D;  4DK1 A;  4JI2 L;  4DR1 Q;  2K5H A;  1NUC A;  1PTO D;  2K14 A;  3SK6 A;  1NE3 A;  1I4H A;  3ICE A;  3M3Y H;  5C3E H;  5KYI A;  3HOU H;  1QVC A;  2K6A A;  2YTY A;  2EZV A;  1SN8 A;  4FXK C;  1KAB A;  3URY A;  2QCP X;  4RA8 A;  4P2C B;  5JJI A;  1YVC A;  4GLA C;  4YWM A;  1STH A;  4C3J H;  3TS0 A;  2LKV A;  3K7U C;  1V9P A;  2NVY B;  1ILQ A;  2A68 C;  4B9W A;  2XN9 C;  4KJN A;  1EYA A;  5IIF A;  1CQV A;  4M8A A;  2K7V A;  5DM7 3;  4L6T B;  4HJA A;  1K28 A;  1TXY A;  2XRS D;  4A3E B;  3A7L A;  2AQ1 B;  3RZO H;  4K14 A;  5HGT A;  3HOZ G;  2F0E A;  3HOW B;  5A35 A;  1EU4 A;  2WAQ G;  1KLU D;  4J1M A;  4YIJ A;  3CKI B;  3M7N A;  4BBR H;  3S14 H;  3J80 L;  3A56 A;  1JCK B;  3WWV A;  4GN5 A;  4IUR A;  4GNX C;  4BBS G;  1CK1 A;  4X3U A;  2MP1 A;  3E0E A;  5E4X A;  1AW7 A;  3H0G B;  1PTO F;  1UWV A;  4A3M H;  4QIW E;  1OXV A;  1PH8 A;  1FNU A;  1JQY D;  1QJO A;  2R7F A;  4ABN A;  3KLW A;  4R4T A;  3S14 B;  1SE4 A;  1EEI D;  3GQB A;  4B3R L;  5DEH A;  1EY7 A;  4CDF C;  5F2D A;  2PW7 A;  1EY8 A;  1QWY A;  3H09 A;  4IPG A;  2E2I H;  1MGS A;  1PH4 A;  1CQF A;  2PMZ B;  1NJI C;  1BCP B;  5LMU L;  2D5D A;  3U9S A;  4N9T A;  3FP9 A;  2A6H C;  1Y8P B;  1PRT C;  4N9P A;  2R61 A;  5IT9 E;  1BR9 A;  1WFQ A;  4JI0 Q;  1VQN A;  1I4X A;  4DV3 L;  2L1B A;  1BCP D;  1GUN A;  5ELN A;  2B63 G;  2D0O A;  3AMU A;  1II3 A;  2HQL A;  2G5D A;  5ELF A;  2DN8 A;  1GD7 A;  1V1P A;  3AQQ A;  2EYL A;  3PMF A;  4C3I H;  3RZD H;  1EYC A;  2QIL A;  3L7Z C;  4C1N K;  1N36 L;  4B9X A;  1W6K A;  3FHW A;  1BF4 A;  2ICI A;  1J9O A;  5I2Y A;  4LF5 Q;  3SR1 A;  5BN5 A;  1CFM A;  1EZ6 A;  2H4O A;  1Y1W H;  4GLX A;  1R9T H;  1GKH A;  2NZH A;  4A3J G;  2VUM G;  2K4K A;  1QE6 A;  2KCN A;  4PMB A;  1FGB D;  4C3J G;  5M5Y B;  3GV6 A;  3I55 A;  3GTP H;  4HIM A;  3HOX B;  4RHR A;  2UUB L;  1UE6 A;  1A2T A;  1G2T A;  1B9N A;  3L2P A;  4DNR B;  1L1O A;  4ME5 A;  1K8A C;  2R92 B;  5CV5 A;  1O80 A;  3DXJ C;  2IX0 A;  2KEN A;  2FXQ A;  1F9R A;  3S2D H;  4O2D A;  3Q6S A;  4KK7 A;  3D0F A;  1YEZ A;  4E6I A;  4AYB G;  4NW2 A;  1JE4 A;  3KF6 A;  3GTQ B;  1PH3 A;  3BVM A;  3A5U A;  2JSO A;  3HOX H;  4BBR G;  4DV2 Q;  4FDB A;  3FMC A;  4O0A A;  5CV6 A;  4LFA L;  1STA A;  1MIU A;  5DLQ E;  4AQY Q;  3S17 H;  3FKI H;  2E2H B;  1Q82 C;  3VYS A;  4HN7 A;  4K6L A;  1F2Y A;  5GAG C;  4A3F H;  2F0Q A;  1EOT A;  3RNU A;  3SEB A;  1VQ6 A;  3BU2 A;  5FLX L;  1YIJ A;  1A8V A;  4WFN 3;  4FXD A;  4TVA B;  5M3M B;  3OPO A;  3GTG B;  5J22 A;  3NBI A;  2L55 A;  3IRB A;  1B3A A;  2B2U C;  1EYG A;  2JJQ A;  5KRU A;  1SRU A;  2SNM A;  3P1H A;  3K5M A;  3H3V C;  5KGU A;  3HKZ E;  5CV9 A;  4L5T A;  5FKA C;  4LK1 C;  3BDL A;  2HHH L;  4JI1 Q;  3PO2 B;  1HNW Q;  4R9W A;  1X3P A;  3MA2 B;  2F3W A;  3R8B A;  1J5E L;  5ELD A;  3PF4 A;  5E7N A;  2D0P A;  5IYC G;  1AN8 A;  3CHB D;  1YNN D;  1SYE A;  4IQZ A;  5E3F A;  3ULP A;  2YTV A;  1N34 L;  1BVS A;  5C44 B;  2CH4 A;  1TT2 A;  1V1Q A;  2B2Y A;  3Q23 A;  1L2F A;  3S2H H;  5M5Y H;  2JA6 B;  1RF2 D;  2IT1 A;  2PNR C;  2ZJQ A;  1SXT A;  3WOF A;  1C7Y A;  1R9T B;  4KTA A;  1HFG A;  5L37 A;  2V4D A;  1EQT A;  3NQT A;  1AZP A;  2PZT A;  5GAD C;  3MTS A;  4BWG B;  3EIV A;  3F2B A;  2FHT A;  3I4M G;  4ZK9 B;  4DV4 L;  1PH2 A;  2DJF C;  2F0W A;  2KHJ A;  5LL6 S;  2F0D A;  2F3V A;  3OIQ A;  4C3I B;  4KHZ A;  4R1J A;  2L11 A;  3CCR A;  3HG9 A;  3TP6 A;  1KDB A;  1U4P A;  1DOL A;  1YHB A;  3I4N G;  1O7L A;  4CJ1 B;  2ZXO A;  5A2Q E;  1PHJ A;  1PH5 A;  4KJO A;  2EJG C;  1HZC A;  3HRZ C;  2N3S A;  3CCE A;  5C4X B;  1HRJ A;  2OQK A;  1VQC A;  3Q0A A;  1X3E A;  1LT4 D;  1TQO A;  2A69 C;  4N8X 1;  1DGS A;  4ZLT F;  2F0U A;  2JA7 H;  1PTO H;  2NVT B;  2VQF Q;  3E0J A;  3ERQ A;  2RSN A;  1F2M A;  2AMC B;  2JQO A;  3GTM B;  2K5N A;  1B3Q A;  4MZ9 A;  4DXF A;  5HUR A;  2G9D A;  1BXT A;  1YBY A;  1BCP C;  4UP7 A;  4EQN A;  4WJW A;  1V1P B;  3HKZ B;  4XIG S;  5IT9 L;  1Y1V H;  1VQK A;  4K8J A;  3RMH A;  1J5E Q;  3C2P A;  4LF7 L;  4AYB B;  4X65 L;  1VMC A;  3BYY B;  1G8Z D;  3J80 c;  2R7Z H;  2QW7 A;  1NTG A;  1LTL A;  4GS3 A;  1K0S A;  2JN4 A;  4X62 L;  3LWE A;  2CW0 D;  3HOY B;  3HOW H;  1R4P B;  4JI3 L;  1CT1 D;  4GKK L;  2VUM B;  3TS2 A;  1PLF A;  4XT3 B;  3RZO B;  3D4R A;  2B2W C;  4A3F B;  2SNS A;  2WAQ E;  2FMC A;  2B2Y C;  4RMF A;  1PTO C;  2L15 A;  3OOC A;  3FKI B;  3N6R A;  2NVY H;  3G7L A;  4BXX G;  3V96 A;  3S1R H;  1VS0 A;  2IL8 A;  1I6H H;  3V05 A;  3G6J B;  4DR2 Q;  4R8I A;  2LXK A;  4C3H G;  2RDF A;  4C56 C;  1JE5 A;  3A5Z B;  3GTQ H;  1RL2 A;  4H13 C;  1K8G A;  4FVM A;  1Q3L A;  2NN6 G;  3VYU A;  5KIX A;  1H9S A;  2VQF L;  4L63 B;  2WB1 B;  2K5D A;  4K8I A;  4AH6 A;  1JJ2 A;  5ELB A;  3NWT A;  4XDX A;  1HR0 Q;  1LTG D;  1SJE D;  3CCM A;  1PYW D;  2OXP A;  4BY1 G;  4LFB L;  2BE5 D;  1VQF A;  2VUM H;  2SOB A;  3IFD A;  3KLS X;  3KDF A;  4O1N A;  4OL7 A;  2DNC A;  1HFN A;  3OIP A;  3DM3 A;  3MZ5 A;  1PZI D;  1QVF A;  5NUC A;  3C1F A;  1H9K A;  2EVB A;  3PO3 G;  2E75 C;  1D6E C;  4RH6 A;  1YHQ A;  3K57 A;  1E1O A;  1CHQ D;  2F0T A;  2VL6 A;  1MD2 D;  5IT9 c;  4ZAI A;  3RZD B;  1MSH A;  1NY4 A;  1PV4 A;  4MTK A;  5GRO A;  1SMX A;  1AE3 A;  2RCF A;  5FJ8 H;  2K5V A;  3NUC A;  1ONL A;  1I6H B;  3T13 A;  1CKM A;  3HOZ H;  4A4I A;  1U4R A;  1KC8 C;  2AUJ D;  1YI2 A;  1VQ8 A;  4CGY B;  3C46 A;  4YY3 Q;  4DNT B;  1L0Y B;  4WJ4 A;  1IKM A;  2MNA A;  3F1Z A;  2KCC A;  4DUY L;  2RSO A;  1AE2 A;  4G57 A;  4FXG C;  1Z7T A;  4H02 A;  3NEM A;  1SNO A;  3I7F A;  3SK8 A;  3HKZ G;  4NXN L;  2EY5 A;  4UY8 C;  3NSW A;  1VQO A;  4LUZ A;  3S15 H;  1XNR Q;  3U50 C;  1SAP A;  2DNE A;  4DV2 L;  1IW7 D;  5IYD H;  2L4N A;  4IFD I;  1HR0 L;  3VYR A;  4FP5 D;  2OTL A;  1TWF H;  5FO7 B;  1SLJ A;  2WAQ B;  3MXG A;  4LF7 Q;  1PZJ D;  4IOA A;  1Q1B A;  2PNH A;  4BBR B;  4K0K L;  4ODG A;  3SHL A;  5ELO A;  2JA6 H;  1FR3 A;  2WV6 D;  4EQP A;  3T16 A;  1TII D;  5C4J B;  2E76 C;  1IBK L;  1KDC A;  2FFK B;  5T1I A;  1E22 A;  3STB C;  3T4A C;  1PMR A;  3KFU A;  2UUC Q;  1HQR D;  4WRD A;  1IYJ B;  4DR6 Q;  2NUC A;  3K5N A;  1I94 Q;  2F0F A;  2Z1C A;  1HNX Q;  4IJH A;  4X66 Q;  1XMQ L;  2QF7 A;  4A3K B;  1G6Z A;  4FO2 A;  1E2V A;  3NK9 A;  1CHP D;  1M8A A;  4LFC L;  4JI6 L;  2A8V A;  2IX1 A;  3DWA A;  5DM6 3;  3VA7 A;  3W2D A;  1NCV A;  2EYO A;  3J81 E;  4HIO A;  5C6A A;  4A3I G;  1CZG A;  4C1N I;  3K81 C;  1EUJ A;  4WJ3 M;  1B9M A;  4DUY Q;  4R4O A;  5BN3 A;  2DUD A;  1KRT A;  1EWH A;  3FEW X;  4RG1 A;  1DD2 A;  3M3Y B;  4KY6 A;  2A69 D;  4NXN Q;  4Y7N B;  2EE1 A;  1CKN A;  1T9H A;  5J3B A;  2UXB L;  3GTJ H;  5C4J H;  1XNR L;  3GTK H;  2ZM6 L;  4Q5V A;  2B2V C;  2UXD Q;  3I4M B;  1GXD C;  1UEB A;  1NR4 A;  3GV3 A;  2QGQ A;  3PO2 H;  1Y1V G;  4X6A H;  1EEF D;  3H0G G;  1JMC A;  3NWS A;  2OWO A;  1FNW A;  1XX8 A;  4L5R C;  4KN7 C;  5K5P A;  3JAM E;  5JJL A;  2EJF C;  4A3F G;  3KF8 B;  2Q2I A;  1KXL A;  2EDG A;  4OHJ A;  4V0B A;  1SEB D;  1UAP A;  1HZA A;  1RD9 D;  3UDG A;  3GTG H;  3HOW G;  2EY1 A;  3RLO A;  5C44 G;  1CZW A;  1T5X D;  4DR6 L;  1VQ7 A;  2PZW A;  1L0X B;  4J6H A;  4POF A;  1X3Q A;  1S4Z A;  3BDC A;  3HZX A;  3KLS A;  4R4C A;  4RKB A;  5LHY 1;  3OWE B;  4HMJ A;  4Y52 H;  1DOK A;  1ET9 A;  1O7I A;  2DGY A;  4MHE A;  1ICW A;  2XWJ B;  4GNX B;  2VB3 X;  2AKW B;  5I9P A;  2R92 G;  1X55 A;  4PG3 A;  4K5V A;  5KNB A;  4LMQ D;  3RD4 A;  2B8G A;  4OX9 L;  4A3G H;  2XRQ D;  4IOC A;  1WTP A;  3TN2 A;  3CU7 A;  5AJ3 Q;  2A5H A;  4JYA L;  4NPS A;  3F2D A;  2E8G A;  1B8A A;  3W1B A;  1HQM C;  3FPU B;  3OMG A;  3BZC A;  3BZD B;  4X3K A;  5LMU Q;  1RIP A;  3LWU A;  5CBA E;  1PYS B;  3KBX A;  3S1Q B;  2YTX A;  4RAU C;  1WYD A;  2MUY A;  1OO9 B;  1N8R C;  4EVO A;  4TQU S;  3A7A B;  4BY1 H;  1DZ1 A;  1E2Z A;  4KHV A;  4B3T L;  1BDO A;  4DV1 L;  1GUT A;  1Y1W B;  2ICE C;  4GN3 B;  1SND A;  3UE1 A;  1IBK Q;  3HOV G;  2EYJ A;  3T1H L;  5ELE A;  1WTQ A;  1WOC A;  3MXN B;  1WVL A;  3J80 E;  4RGM A;  4DGZ A;  3MFY A;  2JA7 G;  5KEE A;  2BCO A;  2RVL A;  1VQ9 A;  1PFM A;  3TQY A;  4ZKB B;  1I3Q H;  2WAC A;  3GTJ B;  3A54 A;  4CHT B;  1C0A A;  1WTR A;  1JWU D;  1NMG A;  1SFO B;  1Q1E A;  4DR4 L;  2A68 D;  4U67 3;  2DY7 A;  3BYT B;  1UEA B;  1TY0 A;  1PRT F;  1Q8I A;  4XT1 B;  1K0R A;  4GLV B;  3BS1 A;  2OEO A;  1Q90 A;  1S40 A;  2YU9 B;  2CHB D;  2F0N A;  1KL9 A;  1RTO A;  4HCE A;  1QUQ B;  1HR0 W;  4NP5 A;  4HJ5 A;  2YYZ A;  4HJ7 A;  5IYB H;  5FLM G;  3ULL A;  1F9S A;  2TSS A;  3I70 A;  4Z9C B;  1SRO A;  1A63 A;  4BY7 G;  4DR7 L;  2L9H A;  4HED A;  1I50 B;  4KHP Q;  1SNQ A;  1KHI A;  1B44 D;  2RHQ B;  2Q2H A;  1GO3 E;  2EYF A;  2JA9 A;  4IUU A;  4JI7 Q;  1E24 A;  2PI2 A;  4LAA A;  1EQQ A;  4B3S Q;  2EIF A;  4HMI A;  1F9P A;  4BXX H;  5E4W C;  5I6Y A;  2R6G A;  5C4H A;  4AQY L;  2I5H A;  3GD7 A;  3FPP A;  3RLN A;  4DV7 L;  1STY A;  4UP8 A;  5JVH 3;  5IE8 A;  1AEX A;  1EIH A;  2FMM A;  3EBE A;  3KF6 B;  4BBS B;  4ZQ3 A;  2F4I A;  2NN6 H;  5KND A;  4NMZ A;  4DK0 A;  5M5W B;  4HTH A;  1YJN A;  4IFD J;  1PVO A;  1Y14 B;  3NHH A;  3S1N H;  1UNS A;  5CV7 A;  3E3X A;  3QJY A;  3C1E A;  4A3J H;  4RGN A;  1VDZ A;  2NTS A;  4RGO S;  4KI0 A;  2R93 B;  2WFW A;  4C2M B;  5DAU A;  1YZ6 A;  3PQI A;  1V43 A;  2ZTC A;  2HDL A;  5C0X H;  3CXC A;  3TRZ A;  1WD1 A;  3OTO L;  1CSQ A;  2HHH Q;  1XXG A;  1I6V C;  1TVX A;  5JVG 3;  3A55 A;  3AFP A;  1VQE A;  3K80 C;  1UE1 A;  4MNO A;  1TKW B;  5I6W A;  3MEH A;  3J81 j;  1F9Q A;  1HJP A;  4F7X A;  2CQO A;  3UDF A;  4GKJ L;  3JAM c;  3CW2 C;  1I94 L;  3STB D;  2NB0 A;  4TKO B;  4A3I B;  4X66 L;  3TZD A;  4A93 B;  4MN3 A;  4HSP A;  2M2L A;  3M7G A;  4KHP L;  5FJ8 G;  1EFW A;  3X3N A;  3E6Z X;  3R3O A;  2AHO B;  4NXM L;  2RQX A;  2R7Z G;  1DXM A;  4QMG A;  1TWG H;  3TRE A;  4DK3 C;  1LYL A;  2NZ1 D;  3S15 B;  1P8L A;  3UDI A;  4LF6 L;  1S3O A;  4ZUI A;  3S16 B;  2Q8I B;  2NVX B;  3Q8D A;  2PW5 A;  1PDQ A;  1D1I A;  3R2T A;  3GTP B;  1IYU A;  3D6W A;  3V2T A;  4A93 H;  2KUM A;  2F0J A;  1SBB B;  2JK8 A;  1CA6 A;  3PSI A;  3T51 B;  1EY6 A;  2PQE A;  1HNW L;  3KF8 A;  3H3V I;  2UU9 Q;  2RHS B;  2PYK A;  3QR8 A;  4KKT A;  1XWE A;  2ZM6 Q;  2UXD L;  2RDG A;  4KMU C;  2CQA A;  4JOI A;  4XXE A;  5CC4 A;  2KBN A;  5I9O A;  3HOZ B;  1C8C A;  1SYD A;  2LY7 A;  4CDD C;  5C4X G;  3NP8 A;  2KVM A;  4IPH A;  2NN6 I;  3PIP 3;  4QY7 A;  3NPP A;  2PPB C;  1U4M A;  1ZKO A;  2MHV A;  4A3J B;  2RA4 A;  1EWI A;  5IWA L;  1CKN B;  1DJR D;  2HQE A;  1YNJ C;  3IL8 A;  5J39 A;  3K58 A;  4DR3 L;  2RDH A;  4QF4 A;  5JJZ A;  3A74 A;  2Z6B A;  5LMN L;  3ITP A;  3D4W A;  4GKJ Q;  1WCM H;  2ZTD A;  4JBK A;  1VQD A;  5K36 H;  1LTI D;  2F0I A;  4IAL A;  4OIJ A;  2ZT9 C;  4DUZ L;  3BVZ A;  4OO1 H;  4JI8 Q;  1V1O A;  2A6E D;  2ID0 A;  3U4V A;  4K2L A;  1CM9 A;  3MHB A;  5C0X G;  3J81 i;  2ZJP A;  1HTP A;  4YCU A;  1IL2 A;  2F0V A;  1IKL A;  2R3Z A;  2Q8R E;  4DV7 Q;  3CRL C;  2BDN A;  3M85 A;  4POG A;  2QA4 A;  1BUV T;  4BY7 B;  4QB4 A;  3JC6 6;  3HOV H;  1EOV A;  5LMN W;  3I90 A;  1T5E A;  2MQH A;  1NNX A;  1Y1V B;  1FJG L;  1SYC A;  3H3V H;  1G91 A;  1K8O A;  4KY5 A;  2RBM A;  2R93 H;  3I56 A;  2I07 B;  3A8J E;  3NEL A;  4IUT A;  1EQR A;  1CI3 M;  1FD7 D;  2F1M A;  2VQE Q;  1PH6 A;  1CUK A;  2F0M A;  2Q2T A;  2IHE A;  1JC7 A;  4F8M A;  5IP7 G;  1TS5 A;  1LTR D;  2ASB A;  4DV1 Q;  1P16 A;  2KED A;  2NTT A;  4PZ6 A;  1XPO A;  1BCP F;  5D65 A;  2MJ8 A;  5G3L D;  1GUO A;  2XSC A;  2CFM A;  3PO2 G;  4FF4 A;  4GKK Q;  4LFB Q;  1YJW A;  4A93 G;  3QB3 A;  3HOY H;  1VQP A;  2Z6K C;  1Q86 C;  5EBC A;  2X6L A;  1SYF A;  5CGK A;  2R7Z B;  2K28 A;  2WKD A;  1U4L A;  5IGB A;  1PH7 A;  4BY7 H;  1IBL Q;  5TSS A;  3HOU B;  1SNC A;  2VB2 X;  3W5O A;  1S5C D;  4JI8 L;  3O13 A;  4XYO A;  4NXM Q;  4H44 C;  1XMO L;  5EPK A;  4S3S A;  1SSO A;  3ERS X;  5JOB A;  3LNN A;  4LF6 Q;  2I0Q A;  4DR5 Q;  4C3I G;  3HS0 C;  4GOP C;  4A3G G;  2NVX H;  3J7A V;  2N78 A;  2K52 A;  3TME A;  1PFB A;  1TWF B;  4IN3 A;  5C4Z A;  1ASY A;  2UXC Q;  1IL8 A;  1DM0 B;  2OF1 A;  4I7A A;  1Y69 U;  4A3B G;  5C3E G;  1M1K C;  1CA5 A;  5G3L F;  1W6J A;  4P75 A;  1Q46 A;  2WB1 E;  4GOP A;  5I4D A;  2EY2 A;  2CKZ B;  3GDE A;  1KQS A;  3TP7 A;  3NXW A;  4AIM A;  1KRS A;  4DNI A;  3RN2 A;  1HCZ A;  4TSS A;  4ULL A;  2MO1 A;  4DXG A;  1GHJ A;  3K7A B;  2L0C A;  4M1U B;  4IZ8 A;  1JOR A;  2Z0S A;  1Z9F A;  1HZ9 A;  3TEH B;  5M3F B;  1B2T A;  5C3E B;  2ENB A;  1LO5 D;  2GVA A;  3TSS A;  3J7A F;  2R93 G;  3K8A A;  3G4S A;  4DFA A;  1HNX L;  4DN4 M;  1D5X C;  1Z6H A;  1SNM A;  1LT3 D;  3G48 A;  4GN4 B;  1QNU A;  2B2T A;  4YHH L;  1FNV A;  4LFC Q;  4LF4 Q;  4YY3 L;  2PMZ E;  1F2Z A;  3D4D A;  4YWK A;  1WI5 A;  1O78 A;  2KQ3 A;  1D5Z C;  1YJ9 A;  4JBM A;  2CWA A;  3H6M A;  2SDF A;  5ISR A;  3OTO Q;  5M3F G;  3VYT A;  2D62 A;  5AFW A;  1DCZ A;  2F0G A;  4PZ7 A;  5EJW A;  2PZU A;  1PXU A;  2VZA A;  2WKC A;  1YNX A;  3M4P A;  3I4L A;  1ROD A;  1TS2 A;  5BN4 A;  1QUQ A;  1L1O C;  4HJ9 A;  5FLX E;  2UXC L;  1DON A;  4FYD A;  1IBM Q;  4B3M Q;  4A3D H;  4ZYS A;  1ZYR D;  2NVQ H;  4HCS A;  4B3R Q;  1VQJ A;  1C9O A;  4QGU A;  3OW2 A;  2SEB D;  3I3C A;  1TWC B;  2BE5 C;  1A62 A;  1A15 A;  3P7J A;  3S17 B;  1QZH A;  2PCF B;  4PMW A;  4HJ8 A;  3J7Y W;  3DMU A;  1S5F D;  1KAA A;  1MSG A;  5CV8 A;  1JOO A;  1IZ6 A;  1S5E D;  2JP1 A;  1AP0 A;  3SVM A;  1XNQ Q;  1NR2 A;  4DPG A;  1N36 Q;  4OWT B;  1BBX C;  5COR A;  5EGT A;  2UUC L;  2HCI A;  1EZ8 A;  2EJM A;  1D5M C;  4G7Z C;  3P75 A;  4CBV A;  3G71 A;  3KBG A;  4X3S A;  3IAY A;  1A0I A;  2A19 A;  1LTT D;  2EPB A;  5C0X J;  3T56 B;  1IYV A;  4DV0 L;  1FVI A;  1R4Q B;  3BDO A;  3F8T A;  4DAM A;  1K83 B;  3GO5 A;  3M9B A;  1VQI A;  5IOD A;  2UUB Q;  4YHH Q;  3H94 A;  1X3G A;  4QJF A;  5COY A;  3VA5 A;  4NKL A;  4PMC A;  2Z9H A;  3VDY A;  1RDP D;  4JOI C;  2H1E A;  2L12 A;  3L3O C;  1STB A;  3KDF B;  2M9V A;  5M3M G;  1JWM D;  4HSV A;  3CD6 A;  1LM0 A;  2KEC A;  1C48 A;  4A3M B;  2BOS A;  2WP8 J;  3OYY A;  2E2J H;  2OTJ A;  2IY5 B;  3SK5 A;  4FF3 A;  4CDE C;  5IGD A;  1K9M C;  5IGF A;  2UUA L;  3PO3 H;  1MKH A;  4A3L G;  3VR5 A;  4KV6 A;  3E9H A;  1KD1 C;  3KK7 A;  2PQA B;  3ONA B;  4OEL B;  1IBM L;  1ASZ A;  3PUW A;  2EQS A;  4LF9 L;  1I4P A;  4L8J A;  2EOT A;  4IJL A;  3NBH B;  4EGV A;  1EY0 A;  5IGG A;  4APV A;  2Y0S B;  3I73 A;  4GZY C;  1MBY A;  1D2B A;  1VQG A;  5IP9 G;  1HUN A;  1I3Q B;  2F4V L;  2AWO A;  3K0X A;  3PIP A;  3HEJ A;  4B08 A;  2HDM A;  3M4Q A;  1VQM A;  2O5J C;  3DWQ A;  4JV5 Q;  1ML0 D;  2K75 A;  3PO3 B;  2F0O A;  4PV1 C;  4DV6 Q;  4LF8 L;  1K73 C;  3D6C A;  2B39 A;  2NBF A;  3CC7 A;  3R93 A;  4HID A;  4OX9 Q;  5IYD G;  3D3R A;  3FDT A;  2HD3 A;  1PFS A;  1TU2 B;  4XQJ A;  2X69 A;  4ME3 A;  4A3B B;  1YIT A;  3U58 A;  5JEA J;  2IX3 A;  3PF5 A;  1AFP A;  4RWS C;  2P5Z X;  1I5F A;  3GP7 A;  3BZK A;  1I4R A;  2Z6K A;  4A3K G;  3EN2 A;  5KYL A;  3HP3 A;  2JA6 G;  1A3U A;  1N34 Q;  1K83 H;  4OIK A;  2JA5 G;  3S1M H;  1IXR A;  1E7Z A;  2JYO A;  2JE6 I;  4MIU A;  5DNF A;  1ZYR C;  4B3M L;  2BA1 A;  4CDC C;  3KOJ A;  2KHI A;  2F3I A;  4KN4 C;  5K36 G;  1XTD A;  3I4M H;  5M5X H;  1L0W A;  1CSP A;  1RTN A;  4QUF A;  2A74 C;  1WTW A;  3F2C A;  2O4X A;  1E0B A;  3I4N H;  3PUY A;  4A3G B;  2E2D C;  1HH2 P;  1BO0 A;  3E5S A;  1JB3 A;  5M3M H;  2Y0S G;  1F2L A;  4UAI A;  1EYD A;  4UDU C;  3CPF A;  1H9R A;  2G9H D;  2EY6 A;  2QDL A;  2VXW A;  5EQ0 A;  1NAP A;  2K32 A;  4A3L H;  3BJU A;  4JI1 L;  1QG7 A;  4U68 A;  4JPB W;  3CCQ A;  1WTX A;  4DKA C;  2KHS A;  4JV5 L;  4DR4 Q;  5I2X A;  1HA6 A;  1KNE A;  3CME A;  1B53 A;  3KLR A;  4NDX A;  4X64 L;  4A3C G;  1LAC A;  2KEE A;  4DU9 A;  1PA6 A;  1TWA H;  3CCJ A;  2D2C C;  3H15 A;  3KJP A;  1SJH D;  2ALY B;  2K05 A;  5FOB B;  4N8F A;  3M4O H;  1G6P A;  2AQ2 B;  2JA8 B;  3DEP A;  4RFB A;  3AB9 A;  3CPW A;  3IKJ A;  1QOH A;  4CKE A;  1B7Y B;  5BR8 Q;  1A3T A;  1ENA A;  1A2U A; 
#chains in the Genus database with same CATH homology
 3W1G A;  1XJV A;  1HNW L;  3H3V I;  2UU9 Q;  2CWP A;  1N32 Q;  2RHS B;  1G29 1;  4X64 Q;  2ZM6 Q;  3KYH C;  2KCT A;  2UXD L;  3HKS A;  3CCU A;  4IO9 A;  2WAQ E;  1FJG Q;  5IYC H;  1NMF A;  5JEA G;  1WJJ A;  2WB1 G;  4RMF A;  4JOI A;  1TWH H;  2L15 A;  3CC2 A;  5C4X H;  2NVY H;  2KBN A;  4BXX G;  1SR3 A;  1W2B A;  4UPA A;  1G51 A;  3S1R H;  1VS0 A;  1I6H H;  2HIX A;  1NBW A;  5C4X G;  5IWA Q;  4DR2 Q;  1JB7 A;  2BH8 A;  4IPH A;  1MJC A;  2LXK A;  2NN6 I;  3T1Y Q;  4QY7 A;  1JE5 A;  1J6Q A;  2B3G A;  3A5Z B;  4GNX A;  4IPD A;  1FGU A;  1EWI A;  4C3H H;  5IWA L;  1CKN B;  4ALP A;  2YV5 A;  4DR2 L;  1BKB A;  1RL2 A;  2K50 A;  3GTQ H;  1K8G A;  4P72 A;  4DR3 L;  3A74 A;  5LMN L;  4DR1 L;  1E3P A;  2NN6 G;  4GKJ Q;  1WCM H;  2ZTD A;  1GVP A;  1VQD A;  2VQF L;  4JBK A;  1Y1W G;  3CC4 A;  4OO1 G;  1VQ4 A;  1Q7Y C;  3I4O A;  5JJK A;  4DUZ L;  4AH6 A;  1JJ2 A;  1HR0 Q;  4JI8 Q;  3CCM A;  4BY1 G;  4LFA Q;  2ID0 A;  3U4V A;  3ULJ A;  4UP9 A;  2XTI A;  4LFB L;  4R4I A;  1VQF A;  2VUM H;  5C0X G;  3J81 i;  3GTM H;  3CMA A;  4P73 A;  1OXX K;  3KDF A;  2ZJP A;  4YCU A;  4JI3 Q;  2NVT H;  1XNQ L;  1IL2 A;  3DM3 A;  1N33 L;  4XTC S;  2F52 A;  1QVF A;  3A0J A;  4DV7 Q;  1U0L A;  3M85 A;  4POG A;  2QA4 A;  2UU9 L;  1Q8K A;  3PO3 G;  4JI5 L;  4J15 A;  3JC6 6;  3DLL A;  1YHQ A;  3HOV H;  1EOV A;  1E1O A;  5LMN W;  5HY6 A;  2VNU D;  5BR8 L;  3UE0 A;  2MQH A;  2VL6 A;  1FJG L;  1X6O A;  5IT9 c;  4IPC A;  5C0X I;  3HOX G;  3H3V H;  3G6E A;  1FL0 A;  1NY4 A;  2JEB I;  4C2M H;  1PV4 A;  2R93 H;  3S24 A;  3I56 A;  2HT1 A;  4AYB E;  5GRO A;  1SMX A;  1N32 L;  3NEL A;  1AE3 A;  5FJ8 H;  1VQA A;  2K5V A;  1EQR A;  4JCV E;  5LMN Q;  4KLK A;  1PH6 A;  2VQE Q;  3FKI G;  1CKM A;  3HOZ H;  3CP0 A;  2YU9 H;  4OON A;  4JI2 Q;  4A4I A;  2HIV A;  1CUK A;  1LUZ A;  3PV0 A;  5FLX c;  2Q2T A;  2IHE A;  1KC8 C;  1JT8 A;  5M3F H;  1YI2 A;  1VQ8 A;  5IP7 G;  1X56 A;  2VS1 A;  4DUZ Q;  2ASB A;  2LXJ A;  1P16 A;  4YY3 Q;  4DV1 Q;  4DV5 Q;  1TWC H;  4PZ6 A;  1VQL A;  4WJ4 A;  2MNA A;  1XPO A;  3F1Z A;  5IP7 H;  4K0K Q;  2BH2 A;  2CFM A;  3AYH B;  4LUV A;  3PO2 G;  2PI2 E;  4DUY L;  4GKK Q;  4LFB Q;  4JI5 Q;  1YJW A;  1SFO H;  1AE2 A;  1N9W A;  4A93 G;  1M90 C;  3JAM i;  4H02 A;  3NEM A;  5IYB G;  3I7F A;  4LNQ A;  4HIK A;  1W3S A;  3HKZ G;  4NXN L;  3UDX A;  5C44 H;  1XPR A;  5IP9 H;  3HOY H;  1VQP A;  4UY8 C;  2Z6K C;  1VQB A;  4JI6 Q;  1Q86 C;  1VQO A;  2AWN A;  3PUZ A;  4LUZ A;  4LF5 L;  2Q2U A;  3S15 H;  1XNR Q;  3U50 C;  3CCV A;  1VCI A;  2C35 B;  4NB3 A;  4DV2 L;  1PH7 A;  4BY7 H;  1IBL Q;  1Q81 C;  5IYD H;  4IFD I;  2KCM A;  3W5O A;  1HR0 L;  4JC0 A;  1I50 H;  2OTL A;  1TWF H;  4JI8 L;  1SLJ A;  4LF7 Q;  4NXM Q;  2B63 H;  2GVB A;  3KJO A;  2V1C C;  3T1Y L;  1XMO L;  2R92 H;  4IOA A;  1Q1B A;  2PNH A;  4DK6 C;  4JBW A;  3ZJY C;  4K0K L;  3ERS X;  2RF4 A;  1SE8 A;  4EQ5 A;  1XPU A;  3J7A 5;  1B70 B;  5ELO A;  2QEX A;  4LF6 Q;  2JA6 H;  4JI0 L;  2I0Q A;  4DR5 Q;  4JI2 L;  4DR1 Q;  2K5H A;  4GOP C;  2K14 A;  1NE3 A;  2NVX H;  2PQA A;  1IBK L;  3PGZ A;  4A3G G;  2N78 A;  3ICE A;  2K52 A;  1E22 A;  3STB C;  4A3B H;  3KFU A;  3M3Y H;  2UUC Q;  1XMQ Q;  1ASY A;  5C3E H;  2UXC Q;  3HOU H;  1QVC A;  1IYJ B;  4A3B G;  4DR6 Q;  2I5M X;  2LSS A;  1I94 Q;  5C3E G;  1M1K C;  1HNX Q;  2YTY A;  1IBL L;  4P75 A;  1Q46 A;  2WB1 E;  1SN8 A;  4IJH A;  4X66 Q;  4GOP A;  1XMQ L;  1X3F A;  4LWC A;  4OXP A;  2CKZ B;  3GDE A;  2VW9 A;  1KQS A;  5JJI A;  4AIM A;  1YVC A;  4GLA C;  4YWM A;  4LFC L;  4JI6 L;  1KRS A;  4OWW B;  2A8V A;  4DNI A;  2IX1 A;  3RN2 A;  4C3J H;  3TS0 A;  4A3I H;  2XGT A;  4HIO A;  1HNZ Q;  1X65 A;  3K7U C;  2MO1 A;  1V9P A;  4A3I G;  2NZO A;  4YCW A;  3K81 C;  4A75 A;  1EUJ A;  4WJ3 M;  2Z0S A;  1Z9F A;  4DUY Q;  1HZ9 A;  3B6Y A;  4R4O A;  3TEH B;  1EIF A;  2DUD A;  1KRT A;  4HJA A;  4RG1 A;  2UXB Q;  1EIY B;  2BA0 A;  1PH9 A;  4NXN Q;  2GVA A;  2R93 G;  2GN5 A;  1TXY A;  3K8A A;  3G4S A;  3RZO H;  1CKN A;  1T9H A;  1HNX L;  5J3B A;  2VQE L;  2UXB L;  3GTJ H;  3J80 i;  3RR5 A;  3G48 A;  4GN4 B;  5C4J H;  1XNR L;  3HOZ G;  3GTK H;  2EXD A;  4YHH L;  2WAQ G;  2ZM6 L;  2CCZ A;  4LFC Q;  4LF4 Q;  3S16 H;  2UXD Q;  4YY3 L;  3M7N A;  2PMZ E;  2F4V Q;  4BBR H;  3S14 H;  4YWK A;  3WWV A;  1WI5 A;  4GN5 A;  4GNX C;  4PZ8 A;  2B29 A;  3S1Q H;  1UEB A;  4BBS G;  5M5W H;  2QGQ A;  3E0E A;  1YJ9 A;  4JBM A;  2CWA A;  3PO2 H;  1Y1V G;  4BBS H;  4MTN A;  4JBJ A;  3OTO Q;  4X6A H;  3H0G G;  1JMC A;  5M3F G;  1X9N A;  2OWO A;  1UWV A;  4A3M H;  4YCV A;  4QIW E;  4L5R C;  1OXV A;  2D62 A;  1PH8 A;  4IFD G;  4PZ7 A;  4BA2 I;  5JJL A;  2R7F A;  4A3F G;  1D7Q A;  3KLW A;  3KF8 B;  4R4T A;  2VZA A;  1YNX A;  2Q2I A;  1KXL A;  3M4P A;  1KIX A;  3GTO H;  4B3T Q;  1HZA A;  1S72 A;  4DAY B;  3UDG A;  3GTG H;  1QUQ A;  4B3R L;  3HOW G;  1L1O C;  4HJ9 A;  1U5K A;  2UXC L;  4IPG A;  3RLO A;  5C44 G;  1IBM Q;  2E2I H;  2R7D A;  4P71 A;  1VQ7 A;  1PH4 A;  4B3M Q;  4DR6 L;  4A3D H;  4Y7N H;  2NVQ H;  3T1H Q;  1NJI C;  3ER0 A;  4B3R Q;  5LMU L;  1VQJ A;  1C9O A;  4QGU A;  1XMO Q;  4POF A;  3CCS A;  3OW2 A;  3FP9 A;  2JA8 G;  4R4C A;  1A62 A;  4Y52 H;  1QZH A;  4PMW A;  4HJ8 A;  5GAE C;  1O7I A;  1WFQ A;  4JI0 Q;  4DV3 L;  1VQN A;  4DR5 L;  3MEF A;  2DGY A;  1OTC A;  1IZ6 A;  5H1S E;  1K3R A;  5ELN A;  2D0O A;  4GNX B;  2B63 G;  2AKW B;  3CF5 A;  1XNQ Q;  2HQL A;  1X55 A;  4PG3 A;  1HZB A;  4OX9 L;  2R92 G;  4LW1 A;  4DPG A;  1N36 Q;  4A3G H;  4OWT B;  2MFI A;  1OXT A;  4IOC A;  4QQB X;  4BA1 I;  2UUC L;  1GD7 A;  5AJ3 Q;  3AQQ A;  4JYA L;  1Q12 A;  4C3I H;  3RZD H;  3G71 A;  4NPS A;  3L7Z C;  3F2D A;  4A3K H;  1N36 L;  3J81 c;  2E8G A;  3CCL A;  1A0I A;  2A19 A;  3FHW A;  1B8A A;  3W1B A;  3L0O A;  2RCN A;  1JJG A;  4LF5 Q;  4JYA Q;  3BZC A;  5LMU Q;  1RIP A;  5C0X J;  1PYS B;  4DV0 L;  1FVI A;  1WCM G;  3F8T A;  4DAM A;  3PUX A;  1Y1W H;  3GO5 A;  4GLX A;  3M9B A;  1GKH A;  1VQI A;  2NZH A;  2YTX A;  4A3J G;  4YHH Q;  1R9T H;  1X3G A;  2A1A A;  3CQZ H;  2UUB Q;  2K4K A;  1WYD A;  3AEV A;  2VUM G;  4QJF A;  3NEN A;  1N8R C;  3I55 A;  3GTP H;  4TQU S;  4HIM A;  2UUB L;  1UE6 A;  2ZJR A;  4QL5 A;  4BY1 H;  4DR7 Q;  3VDY A;  3GTL H;  4A3E H;  4B3T L;  4DV1 L;  4DV5 L;  4JOI C;  3L2P A;  4GN3 B;  3UE1 A;  1L1O A;  4GOP B;  3I2Z A;  3KDF B;  1K8A C;  5M3M G;  1IBK Q;  3D31 A;  3CD6 A;  1LM0 A;  3HOV G;  3HFZ B;  2WP8 J;  2IX0 A;  2KEN A;  3OYY A;  2E2J H;  2FXQ A;  3T1H L;  3S2D H;  2OTJ A;  2IY5 B;  2Y0S E;  4O2D A;  1K9M C;  3D0F A;  2UUA L;  1YEZ A;  3PO3 H;  1MKH A;  4AYB G;  1GM5 A;  4A3L G;  3PCO B;  1WOC A;  3E9H A;  1KD1 C;  3MXN B;  2PQA B;  4DV0 Q;  3KF6 A;  4LF4 L;  1IBM L;  1PH3 A;  1ASZ A;  2JA7 G;  1VQ9 A;  3TQY A;  3A5U A;  3HOX H;  1I3Q H;  4BBR G;  3PUW A;  2JEA I;  4JG2 A;  4DV2 Q;  4YWL A;  1C0A A;  2EQS A;  4FDB A;  4O0A A;  1VQ5 A;  4LF9 L;  4LFA L;  1MIU A;  5DLQ E;  1NMG A;  4AQY Q;  1L1O B;  1Q1E A;  3U4Z A;  4DR4 L;  1UE7 A;  3S17 H;  5AJ3 L;  3FKI H;  4IJL A;  3NBH B;  4A3M G;  1Q82 C;  5GAG C;  3PIO A;  2E2H H;  1Z47 A;  4A3F H;  1N33 Q;  2E5L Q;  4APV A;  3RNU A;  1K0R A;  1E1T A;  4JI4 Q;  4GLV B;  3BU2 A;  1VQ6 A;  1YIJ A;  1A8V A;  2H5X A;  1JJC B;  4TVA B;  1VQG A;  2UUA Q;  1KL9 A;  5IP9 G;  1YHA A;  2F4V L;  1QUQ B;  2AWO A;  5FLM H;  1HR0 W;  4HJ5 A;  3K0X A;  2YYZ A;  3PIP A;  3IRB A;  4HJ7 A;  5IYB H;  1VQM A;  3M4Q A;  5FLM G;  1AH9 A;  3ULL A;  2JJQ A;  1BBU A;  1EYG A;  1SRU A;  1QZG A;  1SRO A;  4JV5 Q;  1A63 A;  2K75 A;  4BY7 G;  4DR7 L;  3HKZ E;  2JA8 H;  4L5T A;  4EX5 A;  1D8L A;  4DV4 Q;  4DV6 Q;  1K73 C;  4JI1 Q;  2HHH L;  4L5S A;  4LF8 L;  4A3D G;  1HNW Q;  5HGQ A;  4B3S L;  4KHP Q;  1KHI A;  3CC7 A;  4HID A;  2RHQ B;  4OX9 Q;  1CKO A;  2Q2H A;  1GO3 E;  5IYD G;  1J5E L;  2JA9 A;  1PFS A;  3LGJ A;  3PF4 A;  5E7N A;  2D0P A;  4ME3 A;  5IYC G;  1YIT A;  4JI7 Q;  1E24 A;  2PI2 A;  3E9I A;  1EQQ A;  3U58 A;  2EIF A;  5JEA J;  4OWX B;  3ULP A;  3PF5 A;  4B3S Q;  4BXX H;  1I5F A;  2YTV A;  1BVS A;  3CAM A;  1N34 L;  3BZK A;  3S2H H;  1V1Q A;  2R6G A;  1L2F A;  2Z6K A;  5GAH C;  4AQY L;  5M5Y H;  2JA5 H;  4A3K G;  1QVG A;  2I5H A;  3GD7 A;  2IT1 A;  3EN2 A;  2ZJQ A;  2ATW A;  2JA6 G;  4OO1 I;  3RLN A;  4DV7 L;  1C7Y A;  1N34 Q;  1K83 H;  4UP8 A;  2JA5 G;  4LUO A;  3S1M H;  3HOU G;  1IXR A;  1E7Z A;  4A76 A;  2JE6 I;  5IE8 A;  4B3M L;  5GQO A;  5GAD C;  3EIV A;  2BA1 A;  3F2B A;  3EBE A;  3KF6 B;  3I4M G;  3KOJ A;  4DV4 L;  2VY3 A;  4DV6 L;  1PH2 A;  2KHI A;  3K7A H;  4LF8 Q;  2F3I A;  5K36 G;  2KHJ A;  1XTD A;  1YJN A;  3I4M H;  4IFD J;  1PVO A;  4KHZ A;  1Y14 B;  5M5X H;  4R1J A;  3PUV A;  1L0W A;  1CSP A;  3CCR A;  3S1N H;  3F2C A;  3I4N H;  4A3J H;  3PUY A;  4A3E G;  2OQ0 A;  1MJE A;  4KI0 A;  2N8N A;  4R4Q A;  1HH2 P;  2WFW A;  1YZ6 A;  1OXU A;  1YHB A;  3I4N G;  1V43 A;  2ZTC A;  5M3M H;  2Y0S G;  3CXC A;  3TRZ A;  5IY0 A;  3OTO L;  1CSQ A;  4X65 Q;  1PHJ A;  2HHH Q;  4P74 A;  1PH5 A;  2E5L L;  1HZC A;  1BBW A;  2N3S A;  3AFP A;  3CCE A;  2ZTE A;  3CPF A;  4JI4 L;  1VQE A;  2OQK A;  3K80 C;  2ES2 A;  1UE1 A;  1VQC A;  2I5L X;  4MNO A;  1KAW A;  1X3E A;  4A3L H;  3RLF A;  2OCE A;  4X62 Q;  3RN5 A;  3BJU A;  5EAY A;  1DGS A;  4JI1 L;  3J81 j;  1HJP A;  4L5Q A;  2JA7 H;  2CQO A;  3UDF A;  4GKJ L;  3JAM c;  2VQF Q;  3CCQ A;  4DKA C;  1PYB A;  4LF9 Q;  1VQH A;  3CW2 C;  3J7Z C;  2AMC B;  2JQO A;  3STB D;  1I94 L;  2K5N A;  4MZ9 A;  4JV5 L;  4DR4 Q;  4JI7 L;  4X66 L;  3AFQ A;  4A3C H;  1YBY A;  4DR3 Q;  3CME A;  1UE5 A;  4X64 L;  4UP7 A;  1H95 A;  4A3C G;  4KHP L;  5FJ8 G;  1EFW A;  4XIG S;  1Y1V H;  1VQK A;  1PA6 A;  1TWA H;  3H0G H;  3CCJ A;  2AHO B;  1J5E Q;  3H15 A;  4DV3 Q;  4LF7 L;  4X65 L;  4NXM L;  1X54 A;  1HNZ L;  3KJP A;  2R7Z G;  2ALY B;  1TWG H;  3TRE A;  4DK3 C;  3M4O H;  1LYL A;  3J80 c;  1P8L A;  2IHF A;  2R7Z H;  3UDI A;  1G6P A;  1NTG A;  1LTL A;  2MO0 A;  1S3O A;  2N49 A;  4GS3 A;  4LF6 L;  3CPW A;  4X62 L;  3HOW H;  3Q8D A;  3HOY G;  4JI3 L;  3SGI A;  4A93 H;  1B7Y B;  5BR8 Q;  1PH1 A;  4GKK L;  3TS2 A;  1S40 A;  2JK8 A;  1OXS C;  3PSI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...