4LFCQ

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 19
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4lfcQ00
2UUAQ 4GOPC 4BXXG 1D8LA 5M5XH 1HR0L 4DV1Q 1L1OC 3I4MH 1KC8C 5JEAJ 4L5TA 1PHJA 1EUJA 3PSIA 1YEZA 4PZ6A 4DV7L 3AQQA 1LYLA 1KRTA 5FJ8G 3RNUA 4J15A 2ZJQA 3S2HH 1Q1EA 2BH2A 3ICEA 1Y1WH 2A8VA 1N34Q 1FVIA 1N36L 3TREA 2E2JH 2JA5G 1VQPA 1TXYA 4RG1A 4DR6L 3CCQA 4GKKQ 4A75A 3GD7A 2NVXH 1CKNB 1EQRA 4MNOA 2CWPA 4GKKL 3M4OH 4LFAL 5AJ3Q 2QA4A 3VDYA 1YHBA 5C4JH 4IOAA 2JE6I 4A3FH 5JJLA 1R9TH 2HQLA 2VS1A 4YWMA 1L1OA 5IT9c 2DUDA 4AH6A 4AIMA 1JE5A 2MQHA 1L0WA 1A0IA 4LWCA 1Z9FA 2ID0A 2N3SA 2RHSB 2WP8J 1N32L 2Q2UA 1QVGA 4IPCA 4X6AH 4A76A 4DUZQ 4XTCS 2I5HA 1FL0A 4B3SL 1VQIA 2WB1E 1CKMA 4O0AA 4JI3Q 4LF8L 1KL9A 1A8VA 2KCTA 4GN4B 2AMCB 4GOPB 1WCMG 1VQ6A 1PYSB 1X54A 2PQAA 5GQOA 4A4IA 4DV4Q 1HNWQ 4DR4Q 1I3QH 1HJPA 5IYDG 4JI5L 4DV2Q 1VQDA 5DLQE 1J5EQ 4DV5Q 1PH8A 2YV5A 3I4NG 3I4MG 1MKHA 2Z6KC 4HJ5A 4HJ8A 3D0FA 4DR7L 4JBMA 1VQCA 2JJQA 3BU2A 3K81C 1B8AA 2CFMA 2MO0A 1KAWA 2AWOA 5IWAQ 2HIVA 4DR5L 2KHIA 5ELOA 3STBD 1SFOH 1Q81C 4HJ9A 2UU9Q 4B3RL 4AQYL 1BBUA 2UU9L 1WJJA 2K5NA 3PUVA 1JT8A 5LMUQ 2JA8H 2NZHA 2MO1A 4R1JA 4KI0A 3HOYH 3RN5A 4R4IA 4DV7Q 5M3FG 1WFQA 1IBLQ 3KOJA 1PH1A 3CD6A 3GTPH 5J3BA 3CCLA 1I94Q 4X62L 1Q7YC 2I5LX 1PH6A 1HR0Q 2QGQA 1E1OA 4ME3A 4YWKA 1SRUA 1XMOL 4A3KG 4LNQA 3CCMA 4OWTB 3J7ZC 4DV6L 2ZM6Q 4IJHA 2R7DA 1BVSA 3L7ZC 1YJWA 2GVBA 2IY5B 5IYCG 4QY7A 5E7NA 4JV5Q 2HIXA 1J6QA 4GLXA 1NMGA 1Q46A 4JYAL 2KCMA 2YU9H 3UDFA 3CMEA 4K0KQ 1KRSA 2L15A 3ULJA 1MIUA 4JI6L 3PUZA 4DUYL 4BBSG 2D0OA 2C35B 3U4ZA 2PI2A 2OTLA 2UUCL 1PH5A 1NMFA 5C44H 2B3GA 3CC2A 4JI4Q 3S14H 2K4KA 1Q86C 3K0XA 1NTGA 2Z6KA 4JC0A 4NB3A 4JI4L 4NXML 4OX9Q 2IHEA 3CQZH 1BKBA 3OW2A 1C9OA 5LMNQ 4A3DH 4JI7Q 4DR4L 4R4QA 3H15A 1I6HH 5C44G 2F52A 4JI6Q 1PV4A 3S1QH 3ULLA 4K0KL 2UXBQ 2Q2TA 4BBSH 2XTIA 1L1OB 2IX1A 2VUMG 4JOIA 3M7NA 4JI3L 2FXQA 3I4OA 2K75A 4DR1L 2VQFQ 5M3MG 3TQYA 4HIDA 4LUZA 4A3EG 3G71A 3PUXA 1TWFH 3HKSA 3WWVA 1YHQA 1IBLL 3KF8B 1HNXQ 3PV0A 5ELNA 4UP7A 1D7QA 4A3BH 3HOZH 5FLXc 1GM5A 4MZ9A 1Q82C 3UDXA 4GKJQ 1PH4A 3HOVG 1PH3A 1VQMA 4LFCL 4B3RQ 1E1TA 4OXPA 1RL2A 3HKZG 4HIKA 3BZCA 4DNIA 3HOXH 4DV0Q 2AHOB 3M4PA 3U58A 1X3GA 2UXBL 2R93G 5IYDH 4UP8A 4DR7Q 3PCOB 2H5XA 2KHJA 3UE0A 2R92H 4A3JG 3PF4A 3J81i 5IP7G 4IJLA 3CXCA 1VQHA 3PUYA 2Y0SG 4DV1L 1HZ9A 3ERSX 2E5LQ 3E9HA 5LMUL 3KF6A 2UXDL 2YTYA 1WOCA 2WB1G 2OWOA 2EXDA 4JI1Q 5IY0A 3PO2G 2K5VA 5C4XH 1UE5A 4Y7NH 2VW9A 1XNRQ 1XNQQ 1CSPA 4LFBL 4QGUA 4PZ8A 1G51A 3J7A5 1VQKA 1QVFA 2D62A 1YJ9A 5IE8A 3AFPA 4JBWA 4WJ3M 2ZM6L 4PMWA 5H1SE 1LUZA 1EQQA 4A3EH 4A3IG 3F2DA 1IYJB 4C3IH 4H02A 3RZDH 2RHQB 5M3MH 2VQFL 3PO2H 1FJGQ 3KF6B 4JI1L 2A19A 2YTXA 4DK3C 3S2DH 2D0PA 1X55A 3NELA 2PI2E 1UEBA 4PG3A 3HOWG 4YWLA 3K80C 1A63A 1X65A 1GVPA 5GAEC 1XPUA 1IXRA 1GKHA 4A3MH 4LF6Q 1X56A 1VQ8A 1VCIA 2AWNA 4OWWB 1ASYA 2JA9A 4XIGS 4BXXH 4DKAC 4GNXB 4NXMQ 3A0JA 1VQ9A 4OX9L 2WFWA 4OWXB 4LF9Q 2JA7H 4MTNA 4BA2I 4A3LG 4GLAC 1Q8KA 1J5EL 4YY3Q 2VZAA 3HOWH 1YIJA 4QIWE 1HZCA 4IFDI 4HJ7A 5IWAL 1YVCA 4EQ5A 1CUKA 1QUQA 3UDIA 3T1HQ 2NVYH 2OQ0A 2VL6A 2UXCL 3S1RH 2R7FA 2IHFA 4AYBE 3D31A 1S3OA 4LUVA 3E0EA 3F8TA 4RMFA 1U0LA 4A3BG 1B7YB 1L2FA 4YHHQ 3CP0A 3HFZB 3W5OA 1VQAA 3M3YH 3A74A 3KLWA 3FP9A 3G6EA 1HH2P 1I94L 2B63H 4P75A 4BBRH 4X64Q 4AYBG 2NN6I 4ALPA 5EAYA 1M1KC 4JI0L 2OQKA 1S72A 3T1HL 2ATWA 2JA8G 3GTGH 4B3TL 1B70B 2E5LL 1W3SA 3RLNA 4DV0L 1N32Q 1XMQQ 3HOUG 1Y1VG 3MEFA 1N33Q 2VNUD 4R4TA 3TS0A 1YNXA 4HIMA 3GTJH 3U4VA 5JJIA 5IP9G 2A1AA 2Z0SA 2N49A 1OXVA 3L2PA 2ZJRA 1Q1BA 1FJGL 2R7ZH 3JC66 3S24A 4A3JH 3H0GH 3GTQH 1KXLA 4A3GG 4TVAB 1YJNA 2UUBQ 1OTCA 4P72A 4LFAQ 3AFQA 2R93H 2LXKA 3GTMH 1YHAA 2NVTH 4UPAA 5C0XI 3K7UC 4JBJA 4IOCA 3ULPA 2CWAA 3A5UA 2MFIA 2BA1A 3T1YL 1N34L 4POGA 1JJ2A 5IP9H 3EN2A 5GAHC 3CMAA 4UY8C 1EIYB 1Y1VH 4KHPL 1LM0A 1CKOA 3ER0A 4KHPQ 4A3IH 4DV6Q 4Y52H 2B29A 4X66Q 3OTOQ 1IZ6A 3S1MH 3CCVA 1V1QA 1VQEA 2WAQE 2F4VQ 1V9PA 3RLFA 4DAYB 3EIVA 2KBNA 2RCNA 5M3FH 4BY7H 3S17H 1NY4A 1SROA 2YYZA 4P71A 1XNQL 5JEAG 1GO3E 3KJPA 1YITA 1Q12A 1XNRL 2VUMH 1YI2A 2VY3A 1VS0A 4LF4Q 1V43A 4GOPA 3HOYG 2ZTCA 2LSSA 4POFA 2IT1A 3GDEA 4DR5Q 2GN5A 4LUOA 1NBWA 4A3DG 1WI5A 1NE3A 1XPOA 5FJ8H 3RLOA 4IO9A 4DPGA 4L5SA 4JYAQ 4LF9L 4BY1H 3J80c 1G291 1UE6A 3F2CA 3EBEA 2E2IH 5IYBG 1ASZA 3JAMc 4A3LH 1QUQB 3J80i 3S1NH 1TWAH 4DK6C 4IPDA 4DR3Q 4LF6L 2JA7G 3S16H 2KENA 4BY1G 3HOVH 5HGQA 1HZAA 4X62Q 4IFDJ 2NZOA 1OXTA 1DGSA 1VQGA 1OXXK 1K73C 4OO1G 5FLMH 1C7YA 4JBKA 5BR8L 2V1CC 1K0RA 1EWIA 2I5MX 3M4QA 1SR3A 1KD1C 3LGJA 1SLJA 3HOXG 3CAMA 4EX5A 1T9HA 4LF5L 2IX0A 5C3EH 2ZJPA 4TQUS 1TWHH 2MNAA 3T1YQ 4A3CG 2R6GA 1HNXL 1G6PA 1OXSC 1P8LA 1U5KA 1A62A 1JB7A 1K8AC 1HNZQ 3CCUA 2LXJA 3I55A 1NJIC 2UUBL 5C0XG 2CKZB 4JI2Q 4DR1Q 2ASBA 1HZBA 1W2BA 2UUCQ 1H95A 4DV2L 4JI5Q 2ALYB 3RZOH 1N33L 3CPWA 3B6YA 4DV4L 3K7AH 3PUWA 2JA5H 1I5FA 1VQ4A 1X3FA 2Q2IA 4YCUA 4LF7Q 1AE3A 1M90C 3GTKH 2BH8A 2HT1A 4JI0Q 3BJUA 4GNXA 1X6OA 4DV3Q 1IBKL 1VQFA 4B3SQ 3CF5A 1QZHA 3I4NH 1QVCA 1XMOQ 3NEMA 4QL5A 4QJFA 4UP9A 3I56A 1AE2A 4LW1A 3CCRA 3H0GG 1PH7A 1JJGA 2R92G 2VQEQ 3FKIG 3UDGA 3S15H 1N8RC 2K52A 2JEAI 3W1GA 4A3MG 1UWVA 2K50A 4GNXC 1EYGA 1YZ6A 3KDFB 3F2BA 2K14A 4JI8L 1MJEA 1PH9A 1X3EA 5AJ3L 4C3JH 4HJAA 3CC4A 1UE7A 4A3KH 4HIOA 2AKWB 2DGYA 4FDBA 4BY7G 3TS2A 4OONA 3CCSA 2JEBI 1KIXA 3BZKA 4R4OA 3OYYA 5IYCH 3KFUA 1LTLA 4X65Q 3DM3A 4IPHA 3GTLH 1E3PA 3MXNB 4JOIC 4LF7L 1PA6A 5C4XG 3OTOL 1CSQA 3ZJYC 4L5QA 1X9NA 4GN3B 1VQ7A 5K36G 2GVAA 4LFCQ 1VQBA 5BR8Q 1C0AA 4WJ4A 2JA6H 4DUZL 2EIFA 4X65L 4JI8Q 1BBWA 4JCVE 3CPFA 4P73A 3JAMi 3SGIA 3J81c 4DV5L 4R4CA 4DR3L 2WAQG 2UUAL 2XGTA 1VQJA 1HNZL 4DR2Q 1SN8A 3U50C 1E22A 2QEXA 3F1ZA 4B3MQ 4LFBQ 4BA1I 4GLVB 4GS3A 5IYBH 3KJOA 2BA0A 2EQSA 2JA6G 1S40A 5M5WH 2NN6G 4YCVA 1XPRA 4IPGA 2UXDQ 1WCMH 4YY3L 1XJVA 1KQSA 1XMQL 3IRBA 4BBRG 1RIPA 4L5RC 1IBMQ 4QQBX 1P16A 3M9BA 5LMNW 5JJKA 3Q8DA 3H3VI 5GROA 2PQAB 4KLKA 4X64L 1PH2A 2NVQH 1AH9A 3CW2C 3DLLA 1YBYA 4JG2A 3W1BA 3RN2A 2F4VL 5M5YH 3AYHB 4NPSA 2K5HA 3CC7A 2OCEA 3CCJA 1EFWA 1PFSA 2RF4A 3RR5A 3TRZA 5GADC 3L0OA 4IFDG 1N9WA 1K9MC 4APVA 4A3FG 4PZ7A 1SMXA 1HR0W 1JMCA 4P74A 4DR6Q 1QZGA 1VQOA 1N36Q 2HHHQ 1VQLA 1E24A 2N78A 2CCZA 3AEVA 4LF4L 3KYHC 4C2MH 3G4SA 1SE8A 4JI2L 2ES2A 3G48A 1FGUA 5IP7H 3A5ZB 3E9IA 2YTVA 1O7IA 3UE1A 3PF5A 5GAGC 2VQEL 2R7ZG 1K83H 2PMZE 3H3VH 1CKNA 1HNWL 2E8GA 3NBHB 3M85A 2CQOA 2JK8A 1GD7A 5C0XJ 4LF5Q 3HOUH 4GN5A 2E2HH 1TWGH 1UE1A 3GO5A 2HHHL 4A3GH 4DV3L 1IBKQ 4LF8Q 4A93G 2Q2HA 3HKZE 4NXNL 3PO3H 4DAMA 1JJCB 1EIFA 1EOVA 2ZTDA 4B3TQ 3STBC 4NXNQ 1XTDA 3HOZG 4JI7L 4AQYQ 5LMNL 1KHIA 3FHWA 2JQOA 1PYBA 3I2ZA 2N8NA 3GTOH 3TEHB 3CCEA 2PNHA 3NENA 1K3RA 1OXUA 3K8AA 3PGZA 2B63G 1IL2A 4YHHL 1IBML 4B3ML 1K8GA 1I50H 3J81j 4YCWA 4DUYQ 1Y14B 3PO3G 3KDFA 2OTJA 2F3IA 1VQ5A 2I0QA 4A93H 4GKJL 2UXCQ 2Y0SE 5C3EG 1PVOA 1VQNA 2ZTEA 3I7FA 4O2DA 4X66L 4C3HH 3PIOA 4A3CH 5HY6A 1E7ZA 4OO1I 1WYDA 1Z47A 1MJCA 1TWCH 4JV5L 4KHZA 3PIPA 1Y1WG 5FLMG 4DR2L 3FKIH
chains in the Genus database with same CATH superfamily
4GOPC 4CDFC 2PCFB 4DV1Q 1PRTB 3I4MH 5JEAJ 1UAPA 2OF1A 4JVZA 4IUUA 4Z9CB 1LYLA 4XT3B 5FJ8G 3MXNA 2DNCA 2RCFA 1Y1WH 2CW0C 5FO7B 3CCQA 4G7OC 5DM73 3K0YA 1EQRA 1SJED 2CWPA 1C4QA 3TZUA 4LFAL 5AJ3Q 1TS4A 3QG1A 3MTSA 3VDYA 1SE4A 4IOAA 1Q8IA 4K14A 4ABNA 4B08A 1L0WA 2MQHA 4LWCA 3HKZB 4R9WA 1SYFA 2ID0A 1BR9A 2PO4A 4J8QA 3QB3A 4C56C 1QVGA 2B2YA 2KUMA 4IPCA 4DU9A 4X6AH 4F8MA 3BDLA 1CT1D 4B3SL 4O0AA 4JI3Q 1HFGA 1MBYA 1KL9A 3ONAB 1A8VA 4DA2A 2AMCB 4GOPB 4A4IA 2PQAA 5EGTA 4DR4Q 1HJPA 4DV2Q 1VQDA 4TSSA 4DV5Q 2QDLA 1PH8A 3I4MG 3UI2A 3D0FA 1G8ZD 3K81C 1B8AA 2AWOA 1Q81C 2KHIA 3STBD 1STBA 1BBUA 4QF4A 5KEEA 1JT8A 4R8NA 2NZHA 1ONLA 4CGYB 3E0JA 4DV7Q 1WFQA 3TP6A 2PMZB 2B2UA 1PH1A 3OIPA 2I5LX 1E1OA 1GXDC 3SR1A 4YWKA 1TIID 3J7ZC 2ZM6Q 2R7DA 3VYTA 1YJWA 2JYOA 2IY5B 5IYCG 4QY7A 5E7NA 1J6QA 1Q46A 4JYAL 2KCMA 1ML0D 4N8X1 1EZ8A 1SBBB 4LMQD 4JI6L 1S5BD 4DUYL 1BO0A 2C35B 2K5DA 1SJHD 1ZYRC 2B3GA 2A68C 3S14H 1Q86C 1NTGA 2Z6KA 1FD7D 4NB3A 4BBRB 1SYDA 4OX9Q 3OW2A 1PYWD 1BKBA 4GZYC 3QR8A 5LMNQ 4A3DH 1I6HH 1NR4A 5C44G 1I50B 2F52A 2SNMA 3QWNA 3S1QH 5CGKA 1L1OB 3Q23A 4NDXA 3OSOA 4JOIA 1PTOH 2FXQA 2KCNA 4WFN3 4HIDA 4A3EG 3K58A 4BS9A 1LLRD 4ILWA 4KTAA 5M5XB 3HOVB 5I9OA 1STAA 3KF8B 5ELNA 4UP7A 4Q0FA 4A3GB 2K33A 4MZ9A 3UDXA 1CTMA 4ID6A 1D1KA 3HOVG 1VQMA 5IT9E 4B3RQ 1RL2A 1V1PA 3HOXH 2AHOB 5I6WA 2R93G 2KA7A 1PTOF 5LHY1 4IZ8A 3K5LA 4ODGA 3PCOB 2H5XA 1H9JA 3UE0A 5DNFA 3H94A 1X3QA 1VQHA 5HURA 3ERSX 1HTPA 1L0YB 3E9HA 2K5QA 1IYVA 3IFTA 3NTHA 4PV1C 3K7AB 4KN7C 2YTYA 1ENAA 1EY9A 3I4LA 4C3HB 4JI1Q 5BN4A 3PO2G 5JPNC 4Y7NH 4PZ8A 1G51A 3J7A5 1VQKA 3C1FA 2D62A 2ZM6L 5H1SE 2EOTA 2FFKB 1WTVA 3V2TA 4KHVA 4A3EH 4FP5D 4H02A 3MA2B 1TU2B 5M3MH 2SNSA 4H0LC 3NELA 2K04A 1JR0D 1RKNA 4PNYA 2O5JC 1X65A 4C3JG 1XPUA 1O78A 1UNSA 4A3MH 1VCIA 1LTTD 3A0JA 2WFWA 4OWXB 4LF9Q 1FNUA 2F0LA 1YIJA 4QIWE 1HZCA 4HJ7A 3HRZC 3T1HQ 2NVYH 2PZTA 1A3UA 4RMFA 3NHHA 1TKWB 3A74A 3KLWA 3G6EA 4DN4M 5G3LD 1MD2D 1S72A 2ATWA 1PFMA 1QWYA 1B70B 2F3WA 2AUKA 1N32Q 1Y1VG 3NTKA 4R4TA 1YNXA 3TS0A 2N49A 1EWHA 3ERQA 4RCOA 1Q1BA 2F0QA 4K2LA 3NK9A 4ZUIA 1LTGD 2AQ3B 4TVAB 1YJNA 1IW7C 1OTCA 2N55A 2XSCA 4DAPA 1JWUD 2LXKA 4UPAA 4JBJA 2BA1A 5D3DA 1SEBD 4POGA 1HA5A 5IP9H 2H1EA 4A3BB 1SSOA 3ER0A 4C3IG 1F2LA 3MWYW 1I6VC 4HCSA 2J4XA 1V1QA 4DAYB 3AB9A 1B2TA 2WAQB 1AFPA 1ICFB 2RCNA 4XDXA 3HOUB 4BY7H 4P71A 1XNRL 1Q12A 2VUMH 2VY3A 4LF4Q 3MVVA 2LSSA 2FMMA 3NE5B 4POFA 1PFBA 2GN5A 1NE3A 2B2TA 5FJ8H 4LF9L 3BVMA 1SYGA 1UE6A 3EBEA 3BYTB 3J80i 3S1NH 1TWAH 1I4GA 5HGQA 1K73C 1VQGA 2IX3A 4OO1G 1OXXK 2F0TA 1EWIA 3M4QA 2QF7A 1F2YA 1HHVA 1T9HA 2E75C 5IT9L 4A3CG 2L55A 2PYKA 3FKIB 2BOSA 1K83B 1PMRA 1HNXL 1JB7A 1HNZQ 4JK1C 2LXJA 3CCUA 1EYAA 3I55A 1F9QA 4DR1Q 2QEJC 2ALYB 4MTKA 1L0XB 3CPWA 3B6YA 4DV4L 2OT2A 1VQ4A 2Q2IA 1AE3A 4N9TA 3GTKH 2BH8A 2HT1A 2EYLA 4JI0Q 4GNXA 1X6OA 5CV9A 4DV3Q 5KNBA 1LTID 5CR3A 1XMOQ 5FLXE 3H0GG 3CCRA 4TKOB 5D3IB 2R92G 3K5OA 3UDGA 4RKLA 3W1GA 1UWVA 2K50A 1YZ6A 3KDFB 3F2BA 1BCPB 1EOTA 4A3KH 4HIOA 1JORA 3TS2A 3D3RA 1GUGA 1LTAD 2JEBI 3BZKA 4R4OA 1KIXA 4HTHA 3KBGA 4IPHA 5CBAE 3H0GB 3MC0B 1E3PA 3V96A 5IODA 4JOIC 1PZKD 1SFOB 4ZCKA 2NVTB 3LNNA 2RSOA 1VQ7A 3URYA 5A2QE 1C8CA 1C0AA 3S1RB 4X65L 1CZWA 1BBWA 3CPFA 3SGIA 3J81c 3SK6A 2XGTA 3U50C 4RGOS 2PW7A 3C3LA 3MHBA 5T1IA 3KJOA 2NN6G 3GTGB 4YCVA 1XPRA 2ZXOA 1WCMH 4YY3L 3NP8A 5EKKA 5A2QL 3VR2A 1IKLA 2CW0D 1OO9B 1JCKB 1RCVD 3Q8DA 5GROA 3H3VI 3VA5A 2BCOA 1AH9A 3MXGA 2FJ2A 3MFGA 3DLLA 1YBYA 3RN2A 2A5HA 3L9AX 1SNMA 3W3AA 5LL6S 2BE5C 4U673 3RR5A 3Q0AA 3H3VC 4CKBA 4IFDG 4APVA 4KMUC 3ZYYX 1Q90A 1QZGA 3IFDA 1N36Q 2HHHQ 3KYHC 5CC4A 3RMHA 3G4SA 4KK7A 2ES2A 4DGZA 3G48A 2RBMA 3D4RA 2YTVA 1O7IA 3S1MB 3LWUA 2PMZE 1SNCA 3F2UA 2E8GA 1S5ED 5IGEA 4KN4C 3M85A 2CQOA 5KRUA 3GO5A 4DFAA 4LF8Q 1ESFA 4KKSA 2O5IC 4J1MA 1DYQA 4DAMA 1JJCB 1EIFA 1EOVA 4B3TQ 4JI7L 4AQYQ 1SNOA 1JICA 5LMNL 3I2ZA 1CHPD 3TEHB 4CJ1B 2PNHA 4OIJA 1OXUA 2E2IB 5EBCA 2X69A 1IBML 4B3ML 1I50H 4DUYQ 1ZXTA 5T1GA 2OTJA 1VQ5A 5FO8B 2B8FA 5C3EG 1HUNA 4X66L 4A3CH 1PTOB 1MSHA 5HY6A 3J81L 4KV6A 1LO5D 2I07B 3PIPA 2HDMA 1CM9A 2UUAQ 2ICIA 5M5XH 3M7GA 2TSSA 2A6HD 4C3IB 3PSIA 1YEZA 4PZ6A 4DV7L 1KRTA 3RNUA 3GTLB 3S2DB 2B2YC 3S9WA 2BH2A 1H9KA 3D4DA 4HR7B 1N34Q 2JA5G 2E2JH 3TREA 1VQPA 2F3VA 3GD7A 3KLRA 2NVXH 1CKNB 1EEFD 1EFID 3M4OH 1JE4A 3HP3A 4IURA 5I2YA 2QA4A 1BF4A 5C4JH 4A3FH 5JJLA 4UDUC 1KNEA 1L1OA 1JE5A 1H9MA 1SE2A 3GP7A 1A0IA 1Z9FA 3IKJA 4A76A 4XTCS 2I5HA 4AYBB 2JSOA 1QG7A 4C3JB 4GN4B 2B2WC 2F0IA 1BXTA 2PW5A 1VQ6A 2CH4W 3J80L 1RD9D 1HCZA 3FRPB 5C3WA 2N88A 3I4NG 1MKHA 4HJ5A 1ENFA 2NB0A 3BU2A 5CV4A 3SE0A 4EGVA 2MO0A 1KAWA 4DR5L 2KVMA 2O4XA 4AQYL 1A6XA 1WJJA 5LMUQ 2JA8H 4DK1A 4KI0A 4J6HA 3RN5A 5JEAH 1HA6A 1IBLQ 2JA6B 3NQIA 4C2MB 3CD6A 3GTPH 2R61A 2Q8TA 3DEOA 3QO2A 2WKDA 3J7AV 1PH6A 1O80A 3BG3A 1SRUA 2EY2A 4LNQA 3KK7A 3EQLC 4X3SA 2GVBA 1F2MA 5EJWA 4EQPA 4ZKBB 3CMEA 2EJMA 2HD3A 2L15A 4K0KQ 1MIUA 5KNCA 3PUZA 2D0OA 3U4ZA 2OTLA 2CVRA 4JI4Q 4JI4L 4NXML 2RDFA 3VA7A 1PRTD 4JI7Q 3NTIA 1V8QA 3ULLA 5E4XA 2UXBQ 2EYFA 2Q2TA 1PRTC 2IX1A 4A93B 3SK8A 2EVBA 3R93A 2K6AA 4U68A 4JI3L 3M7NA 2FMCA 1RTOA 5M3MG 3GTMB 1ZKOA 3G71A 1YNJC 3MEHA 4QUFA 1KTKA 3FMCA 3S16B 1RODA 1U4LA 3HKSA 1TQOA 3PV0A 2XVSA 2EYMA 1D7QA 4A3BH 3P1HA 3HOZH 5FLXc 3TN2A 3X3NA 2C9OA 3T13A 4OXPA 2KHSA 3HKZG 4HIKA 3BZCA 4DNIA 4DV0Q 2K5WA 2UXBL 1E2VA 2CHBD 4UP8A 1X32A 2KHJA 1R9TB 1CHQD 5KNDA 3QOLA 3CXCA 3PUYA 4RWSC 1AZQA 2E5LQ 5LMUL 2UXDL 4M8AA 3H6MA 4L8JA 3J7YW 1EY6A 1G2SA 2WB1B 1J9OA 5G3LF 2M00A 1EL0A 2VW9A 1XNRQ 1TWAB 2KEEA 4WJ3M 4JBWA 4PMWA 1J8IA 2DNEA 3I4MB 4UHVA 1SNPA 1DD2A 2MJ8A 1GHJA 1YNND 1ET6A 2VQFL 3KF6B 4JI1L 2A19A 4DK3C 5C3EB 2ZXPA 3HOWG 1PDQA 1BOSA 4YWLA 3K80C 3W2DA 1GKHA 1WD0A 4LF6Q 1X56A 5FOBB 2JP1A 1VQ8A 1EY4A 4PMBA 4OWWB 3HOYB 2QDBA 1S5CD 2AQ1B 3NWTA 3DMUA 4MTNA 3T56B 1WTWA 1LT3D 3P20A 4GLAC 4A3LG 2EYHA 1J5EL 2EJFC 4EQ5A 4K5VA 3EA6A 2L4NA 4LK1C 3J7AF 3EVQA 3SK4A 3D31A 2B2WA 1U0LA 1L2FA 5F2DA 3CP0A 4YHHQ 1HPCA 3OMGA 3M3YH 3FP9A 4P75A 1M1KC 2NN6I 5EAYA 1BQQT 3T1HL 4RCNA 4DV0L 2WKCA 3U4VA 1OXVA 3L2PA 2ZJRA 2F03A 4FF1A 3JC66 5I2XA 4MN3A 4A3JH 1K28A 5KYIA 3K6OA 3GTQH 1KXLA 4ZLTF 5EPJA 3AFQA 4KJOA 1RF2D 3A5UA 1TWFB 2EY6A 1JJ2A 3TDQA 2IWHA 5GAHC 2ENBA 4KHPL 1LM0A 4KHPQ 2YU9B 4DV6Q 3KUPA 3CKIB 5EKLA 2G5DA 1IZ6A 1VQEA 1BCPF 2WAQE 4FO2A 1V9PA 1SMYC 1SE3A 3A8IE 5C4HA 2QILA 2AQ2B 5M3FH 3CHBD 2R92B 1GO3E 1V43A 4GOPA 1XTCD 4FF2A 3GDEA 4V0BA 1DCZA 1SXTA 4BWGB 4DPGA 4JYAQ 4BY1H 3GTOB 3J80c 3T4AC 1G291 5CV5A 4A3LH 1R4PB 1CQFA 4ZK9B 2O2LD 4IPDA 4DR3Q 1AN8A 4BY1G 4N8FA 1HZAA 4X62Q 2NZOA 1OXTA 5TSSA 1FNVA 5IGBA 4A3BG 1SR3A 2HDLA 4C3HG 4EX5A 3T1YQ 1G6PA 1UEAB 1A2UA 1STHA 1AP0A 3OHXC 1WTPA 1U5KA 2NZ1D 2LMCB 1T5XD 3I70A 1K8AC 1D5XC 1K3BC 3SXHA 2ASBA 1HZBA 1W2BA 2JA7B 2UUCQ 1H95A 4JI5Q 3R3OA 2XRQD 2B2UC 4IALA 4LF7Q 1RJTA 2QW7A 4Y7NB 3BJUA 1G91A 3TMEA 1VQFA 3CF5A 2K01A 5L37A 1S5FD 2F0FA 1G2TA 1E0BA 4QL5A 4QJFA 4UP9A 3Q24A 3S15H 3FKIG 3RZDB 2K52A 3NUCA 4A3MG 4X3TA 3M4YA 4G7HC 1PH9A 5AJ3L 3CC4A 2IL8A 3G6JB 5K36H 1EIGA 3PQIA 4H7BA 1I4HA 1F77A 4BY7G 4A3MB 1Y8OB 3CCSA 4UAIA 1GHKA 1H9SB 1PA6A 1CSQA 3GV3A 2EYOA 2F4IA 4DK0A 4PMCA 4GN3B 2NVYB 3ND9A 4DXGA 1Y1VB 5D14A 4WJ4A 4QIWB 5CV6A 4DR3L 1JWSD 2WV6D 2WAQG 3OWEB 2VXWA 3GV6A 2K03A 2QEXA 1E22A 2XIWA 3F1ZA 4LFBQ 4BA1I 2L1BA 3CRKC 1D6EC 1QCBD 4GLVB 3G7LA 2CQAA 4DNTB 1RIPA 3BDCA 5DAUA 3GTJB 3M9BA 3NBHA 5LMNW 3HEJA 2PQAB 4KLKA 1PH2A 2B8GA 3CW2C 1EYCA 3DWAA 3NPPA 3CQZB 1EY5A 3W1BA 2F4VL 2R93B 1X3PA 3CC7A 3CCJA 2OCEA 1PFSA 3BDOA 3L0OA 1FNWA 2JA8B 1SMXA 4I65A 4P74A 1VQOA 2J7ZA 4IQZA 3AEVA 1SYCA 1SMYD 4O1NA 4JI2L 2C5CA 3MXUA 4PQXA 3D6WA 3UE1A 2RA4A 2R7ZG 1RHPA 3H3VH 1CKNA 5CMDA 3NBHB 4RHSA 2JK8A 3J81E 1TS5A 2E2HH 4ULLA 1TWGH 2JN4A 3DHQA 4KJNA 2HHHL 5E3FA 5CORA 2Q2HA 3WOEA 5DEHA 3HOZG 1D5ZC 4LAAA 1KHIA 1KDCA 1PYBA 1DONA 2F0DA 3A7LA 1B4OA 3PGZA 1IL2A 4A3DB 1I6HB 3EJIA 2F0MA 2F0NA 1Y14B 4ZRZA 1EU4A 4N9PA 2HQEA 1PVOA 3PIOA 5CV7A 2LY7A 1DXMA 1Z47A 5I4DA 3EFXD 5FLMG 5I9PA 4WORA 4BXXG 1D8LA 4CKEA 3DWQA 2BE5D 4RFBA 4L5TA 5AFWA 3X3MA 1PHJA 3PO2B 3AQQA 3SHLA 2EY1A 1STNA 5JAVA 2ZJQA 1Q1EA 4HAEA 3ICEA 3S2HH 1FVIA 1N36L 3HOXB 4MNOA 4ZKCB 3E3XA 2V4DA 4FF4A 4IN3A 1R9TH 1LT6D 1MSGA 4YWMA 3R8BA 5IT9c 3I90A 4DAVA 3DEPA 4L63B 1NAPA 3R2TA 2WP8J 2Q8RE 2QCPX 3HS0C 4RKBA 1BNZA 1Z7TA 2K1BA 1CKMA 5J22A 4LF8L 3A55A 1PZID 5EPLA 4QUCA 1X54A 4DV4Q 1LACA 2F0GA 4A3EB 1I3QH 1ZYRD 2YV5A 2Z6KC 4HJ8A 4KY5A 1K8OA 2CFMA 2HIVA 4K6DA 5ELOA 4HJ9A 5FK9C 2EJGC 4OIKA 1DZ1A 1QJOA 2MO1A 4R1JA 3HOYH 3C1EA 4R4IA 4IFDH 5M3FG 4QB4A 3KOJA 1HFNA 2QKIC 3CCLA 1I94Q 1Q7YC 1HR0Q 2QGQA 4ME3A 4WRDA 3IAYA 1XMOL 4A3KG 3AMUA 1K0SA 4OWTB 4IJHA 3L7ZC 1BVSA 1H9SA 4FXDA 4GLXA 4H44C 1KLGD 5ELDA 4A3IB 3UDFA 1TY0A 1WCMB 1KRSA 3VYSA 3PO3B 1JOOA 5ISRA 2RKSA 1KDBA 1CFMA 2XN9C 4G4KA 3M3YB 1NMFA 5C44H 2F0EA 3CC2A 2NVQB 3K0XA 4JC0A 4OGQC 2F0HA 3MXPA 1IYUA 1F2ZA 3RD4A 5M5YB 4DR4L 1PV4A 2L11A 4K0KL 1E2ZA 2XTIA 2AUJD 5ELFA 2K75A 4HMIA 3FPPA 3H91A 3TQYA 4LUZA 4K8IA 1D1IA 3WWVA 4Q5VA 1HNXQ 2MUYA 1FR3A 1EWCA 1E2WA 3A8JE 1PH4A 5CYUA 1I4XA 3BVZA 4IUVA 3Q6SA 3M4PA 4RAUC 1ESRA 1X3GA 4H13C 5IYDH 4F88A 1KDAA 2R92H 1LTRD 4A3JG 2VUMB 3J81i 5IP7G 4IJLA 2Y0SG 4DV1L 4MHEA 3SK5A 5IGFA 1U4MA 1XX8A 2JA5B 1WOCA 2D5DA 3SVMA 2K5VA 5C4XH 1UE5A 1XNQQ 3S1NB 4F87A 2Z9HA 1PTOC 5IE8A 1B1ZA 4B9XA 1IYJB 4C3IH 1JOQA 1CK1A 3TP8A 4R8IA 2KQ3A 2D0PA 4F7XA 4PG3A 1UEBA 2PI2E 2Z4IA 1TS3A 3C2PA 4XT1B 1TS2A 4HSVA 3DXJC 1I4QA 4DNRB 1ASYA 2JA9A 4A3FB 4DKAC 4OX9L 1VQ9A 4BA2I 4V190 2EDGA 1JQYD 2Z8LA 4RGNA 1Q8KA 3VR6A 2F0UA 2VZAA 3HOWH 4IFDI 4FF3A 1YVCA 3UDIA 2OQ0A 2F0WA 1A3VA 2VL6A 3VR3A 2UXCL 2IHFA 4AYBE 2EYJA 5HGTA 4KD3A 4LUVA 3E0EA 3KBXA 3I91A 1B7YB 4LJZC 3W5OA 1HH2P 2B63H 1C48A 4X3UA 1NCVA 4BBRH 3CRLC 1F9PA 4ALPA 2OQKA 2K05A 2F0VA 2E5LL 3RLNA 2IPKD 1XMQQ 3HOUG 4QCLA 5IIFA 5EBDA 4HIMA 5IP9G 2Z0SA 1FJGL 3E5SA 2HCIA 3H0GH 3BZDB 2DJFC 3MFYA 4P72A 4LFAQ 1HXYD 2NVTH 1Y8NB 2CWAA 3EN2A 3CMAA 4UY8C 1EIYB 1Y1VH 4FNFA 1CKOA 3I72A 2HUGA 4Y52H 3HGBA 4RGTA 3S1MH 1JC7A 3RLFA 4RHRA 2E74C 1EQVA 3S14B 4WJWA 3S17H 1SROA 2YYZA 3P7JA 1YITA 1CA5A 1LT5D 1VS0A 3HOYG 1GJXA 4EQOA 5E4WC 2HCCA 1H9RA 2KOLA 4DR5Q 5I6YA 3DM1A 2L0CA 1JOKA 4G7ZC 4OO1H 3RLOA 3CU7A 4IO9A 5IGDA 1U4RA 3OPOA 3F2CA 2E2IH 5IYBG 1ASZA 3K57A 1QUQB 4KY7A 4LF6L 3S16H 3HOVH 3I3CA 4QMGA 4IFDJ 1DGSA 1GUTA 4JBKA 1TY2A 1K0RA 5BR8L 2I5MX 1KD1C 5FO9B 1SLJA 2EY5A 3P75A 2VB2X 2E2DC 4TQUS 1TWHH 2MNAA 2R6GA 3ITPA 2XRSD 2NTTA 5COYA 1NJIC 1FGBD 3A54A 2UUBL 2J0TD 2OXPA 1F9SA 2CKZB 4JI2Q 3NXWA 4M1UB 4DV2L 3RZOH 1VMCA 1Y1WB 1DOKA 2B2VA 3K7AH 3PUWA 2OEOA 4FXKC 1X3FA 1EY8A 4YCUA 1M90C 2A6HC 5EKIA 4XYOA 3FPUB 3I4NH 1U4PA 1QZHA 1A3TA 1EY0A 1QVCA 3LWEA 2B2VC 4DF7A 3I56A 1JJGA 4CHTB 3R2IA 5KGUA 3AU7A 1QNUA 1TT2A 5M3MB 2D9UA 4JI8L 1KNAA 2KJXA 1X3EA 4JW0A 1MJEA 3V05A 2FHTA 1I4RA 3EROA 1B9NA 2DGYA 2X6LA 4FDBA 4OONA 1HUMA 4RH6A 2FINB 2IJ0A 3OYYA 3VYRA 1VF5C 2R7ZB 4IUNA 3GTLH 1B50A 5JOBA 4LF7L 3OTOL 3ZJYC 3OIQA 4OHJA 1X9NA 1VQBA 3HZXA 3IL8A 1AW7A 1S4ZA 2JA6H 4DUZL 2EIFA 4JI8Q 2A69C 3FEWX 1QILA 1LTSD 2UUAL 1VQJA 4JPBW 1CZGA 3FVQA 4DR2Q 4HMJA 5JVH3 4C1NI 3K59A 1YNJD 4KY6A 4GS3A 2I46A 4CJ2C 2JA6G 1M8AA 1S40A 5KYLA 2UXDQ 1XJVA 1KQSA 1XMQL 3IRBA 4L5RC 1DOMA 3TP7A 1IBMQ 1P16A 2Y0SB 4OL7A 5JJKA 3TP5A 1K8MA 5J39A 5C5LA 4JG2A 4OELB 2RF4A 4K5XA 5GADC 4A3FG 4C1NK 2X6GA 1E24A 5CBEE 2CCZA 4LF4L 4C2MH 3GTPB 2A6ED 1NSNS 3NBIA 2NWGA 5IP7H 2F1MA 2A74C 5GAGC 2A69D 1K83H 4G57A 3PIO3 1HNWL 3HOUH 1EZ6A 4GN5A 4BY7B 1DM0B 1UE1A 4A3GH 4FYDA 1IBKQ 1W6KA 3L3OC 3HKZE 4NXNL 1SNDA 4NXNQ 4CDEC 3STBC 1XTDA 2RVLA 1IKMA 5C44B 1ZEQX 2JQOA 1B3AA 1AZPA 3GTKB 5CV8A 3OWFA 3T16A 1UUPA 3CCEA 2BDNA 3I8ZA 4YHHL 3J81j 4YCWA 3PO3G 1XXGA 4XQQA 3KDFA 3SDZA 2EZVA 2I0QA 4A93H 4GKJL 4ZQ3A 4CDDC 4C3HH 4YIJA 2F0PA 3QJYA 1MJCA 1TWCH 5ELBA 3FDTA 4JV5L 1KAAA 5JPMC 1Y1WG 2PNRC 4DR2L 1Q3LA 4A3KB 3FKIH 5K5PA 3KLSA 2MHVA 1HR0L 1L1OC 2WIIB 1KC8C 1KABA 1MI2A 1EUJA 4NKLA 1HTLD 1RDPD 1STEA 2XNAC 4J15A 2A8VA 4K6LA 1TXYA 4RG1A 4DR6L 4GKKQ 4A75A 2RDHA 4GKKL 1Y8PB 4CJ0B 1YHBA 3T53B 2JE6I 2MGSA 1GUWA 3OMCA 2HQLA 2VS1A 2DUDA 4AH6A 4AIMA 3HG9A 2SOBA 1NNXA 2N3SA 2RHSB 4ZUJA 1N32L 2Q2UA 4DUZQ 2DY7A 1FL0A 3BYYB 1VQIA 2WB1E 1WTOA 5LL6X 1EU3A 2PZWA 3WDNA 3JAML 5M5WB 2KCTA 1WCMG 1PYSB 5GQOA 1BCPD 2GA4B 1HNWQ 2NN6H 1IL8A 5IYDG 4JI5L 2XWJB 2K7VA 5DLQE 1J5EQ 2DY8A 2NYZD 2P5ZX 4DR7L 5IGGA 3RUZA 4JBMA 1VQCA 2JJQA 3TZDA 4TRDA 5IWAQ 2SDFA 4EVOA 2UU9Q 1SFOH 4B3RL 2UU9L 3Q22A 2K5NA 3PUVA 1Y69U 3DWPA 3VR4A 2EYPA 1R4QB 3D8GA 2MP1A 4KKTA 5J3BA 4X62L 1A15A 1EEID 5J1ZA 1SAPA 2TMPA 3CCMA 4DV6L 2RQXA 4JV5Q 2HIXA 1NMGA 1XYIA 4B9WA 2YU9H 3TBIB 5C6AA 4X3KA 1SYBA 3ULJA 1IW7D 4BBSG 3NWSA 2PI2A 4EQNA 1PXUA 2UUCL 1PLFA 1PH5A 2K4KA 2B63B 3K5MA 3I73A 1LT4D 2IHEA 3CQZH 2H4OA 1C9OA 3NQTA 4R4QA 4CDCC 3H15A 1GOZA 1SYEA 4JI6Q 4BBSH 1WD1A 2VUMG 5EQ0A 3BVGA 5C0XH 2F0KA 3I4OA 5M9OA 4BY1B 2SEBD 1QNKA 5NUCA 4DR1L 2VQFQ 3A7AB 4RA8A 1B9MA 1QB5D 2L9HA 3QOJA 1SDFA 5A35A 2EE1A 3PUXA 4DAYA 1TWFH 1YHQA 1IBLL 1WTHA 1PFNA 1GM5A 1V1PB 1Q82C 1KLUD 1NR2A 1O7LA 5BN5A 1O7ZA 4GKJQ 1PH3A 1CI3M 4LFCL 1E1TA 4HCEA 1I4PA 5KIXA 4HN7A 1RTNA 3U58A 2L5TA 1B3QA 4DR7Q 5C3XA 3O13A 3S17B 3J80E 3PF4A 1U9RA 4KKUA 1HZ9A 4K2KA 1YNNC 3KF6A 2NTSA 4DXFA 2OWOA 2WB1G 2EXDA 5IY0A 1T5EA 2NUCA 1EY7A 2ZXRA 4NW2A 1CA6A 1CSPA 1GUSA 4LFBL 4ZAIA 4QGUA 1QVFA 1YJ9A 3AFPA 1BCPC 1LUZA 1EQQA 5IOCA 4A3IG 3F2DA 3S15B 4O42A 3RZDH 2MPMA 2RHQB 3PO2H 2RDGA 1FJGQ 3OOCA 2YTXA 5JVG3 3S2DH 1ILQA 1X55A 3OW7A 2E2JB 1F9RA 1A63A 1GVPA 5GAEC 2NVXB 1IXRA 3N6RA 4I7ZC 3BS1A 2M9VA 2AWNA 3M4OB 3C46A 5C4JB 4XIGS 3ND8A 4BXXH 1TR5A 4GNXB 4NXMQ 2JA7H 3LX0A 3VYUA 2ZT9C 3RZOB 4FVMA 5FLXL 4YY3Q 1NUCA 2XWBB 3PMFA 4XQNA 1ENCA 1PRTF 5IWAL 1CUKA 1QUQA 5IGCA 1XWEA 3DUZA 4ME5A 1VF7A 3T51B 3I4NB 3S1RH 2R7FA 5C4ZA 1S3OA 3F8TA 3HFZB 1STGA 1VQAA 4FXGC 4I7AA 1I94L 5BN3A 4X64Q 4AYBG 1STYA 2IW3A 4P2CB 4JI0L 3GTGH 2JA8G 4B3TL 2PQEA 1W3SA 3SEBA 3S1QB 2VNUD 3MEFA 1N33Q 1CQVA 5JJIA 3GTJH 2A1AA 2F0JA 2JXMB 2R7ZH 3S24A 4A3GG 2UUBQ 1HQRD 2R93H 3GTMH 1YHAA 1DOLA 1VMPA 4ZYSA 5C0XI 3K7UC 4IOCA 3ULPA 3T1YL 2MFIA 1N34L 4K8JA 3H09A 4K5WA 2E76C 1W6JA 4XQJA 4A3IH 2L12A 1EIHA 2B29A 1LABA 4X66Q 3WOFA 3OTOQ 3CCVA 2F4VQ 3EIVA 2KBNA 4CBVA 2E2HB 1NY4A 1XNQL 5JEAG 3KJPA 3K5NA 1YI2A 3E6ZX 2ZTCA 2IT1A 4LUOA 1NBWA 4A3DG 1WI5A 1XPOA 2CH4A 4L5SA 2Q8IB 2LFNA 3GQBA 4E6IA 3JAMc 1LTBD 2WACA 4DK6C 1AEXA 5D65A 2JA7G 2KENA 1B53A 2DJGC 5FLMH 1C7YA 2V1CC 5DM63 3LGJA 3HOXG 3CAMA 3D6CA 4LF5L 2IX0A 5C3EH 2ZJPA 2B2TC 1WTXA 3U9SA 1OXSC 1P8LA 1A62A 3NSWA 1TWGB 1IHZA 1EYDA 3QIAA 2DN8A 5C0XG 2D2CC 2G9DA 5JJZA 1N33L 2M2LA 1WTQA 2LS01 3U9OA 2JA5H 1DJRD 1I5FA 1VDZA 1V1OA 1D5MC 2RSNA 3KLSX 5C4XB 1MHWC 3MAQA 1IBKL 4B3SQ 1G6ZA 3NEMA 1AE2A 4LW1A 2A73B 1PH7A 4IUTA 1GUOA 2VB3X 2VQEQ 1N8RC 2JEAI 1PTOD 1WTRA 3MZ5A 4GNXC 2LKVA 1EYGA 4XYQA 1S5DD 3A8KE 1TWCB 2K14A 4C3JH 4HJAA 1HRJA 2NBFA 1UE7A 1PZJD 4NP5A 2AKWB 5C5MA 4IUQA 1EQTA 1I3QB 5IYCH 1JWMD 3KFUA 1LTLA 4X65Q 4IUPA 3DM3A 2Z4HA 3GTQB 5EPKA 1WVLA 3S2HB 2B39A 3MXNB 5ELCA 2PPBC 3TSSA 1A2TA 5C4XG 1QOHA 3HOWB 4L5QA 1D2BA 1O7YA 2Z1CA 1TVXA 4L6TB 5K36G 2GVAA 4LFCQ 5BR8Q 5FKAC 1GUNA 1BDOA 2F0OA 4JCVE 4P73A 3JAMi 4DV5L 4R4CA 2PZUA 1HNZL 1SN8A 2R3ZA 4B3MQ 3JAME 4KD4A 5IYBH 5M3FB 2BA0A 2BDOA 2EQSA 3PIP3 5M5WH 4IPGA 1Z6HA 4BBRG 4HEDA 4QQBX 2K32A 2KECA 1FYCA 4X64L 1ET9A 4A3JB 4CKCA 2NVQH 4XXEA 2G9HD 2ICEC 3KF8A 5M5YH 4NPSA 3AYHB 2K5HA 1EFWA 2Z6BA 2A68D 3TRZA 3D4WA 1QE6A 1N9WA 1K9MC 1HR0W 4PZ7A 1JMCA 4DR6Q 4S3SA 1II3A 1VQLA 2KCCA 2N78A 4HSPA 1SE8A 1FGUA 3A5ZB 3E9IA 3PF5A 1LV9A 2VQEL 2K28A 3N52A 4MIUA 5E1FA 1GD7A 5C0XJ 4LF5Q 1BUVT 3HOZB 2WINB 4DV3L 1JB3A 4A93G 3VR5A 3PO3H 3A56A 4NMZA 4OEMB 2ZTDA 2EPBA 1MGSA 3FHWA 1ILPA 2N8NA 3GTOH 1ICWA 2EXZA 2KEDA 3NENA 1K3RA 3K8AA 1M4VA 1B44D 2B63G 1K8GA 5ELEA 2F3IA 4BBSB 1HQMC 2UXCQ 2Y0SE 1VQNA 2ZTEA 3I7FA 4O2DA 4OO1I 1E7ZA 4RGMA 1WYDA 2A6EC 1BBXC 2F0SA 4KHZA 1TWHB 1SNQA
chains in the Genus database with same CATH topology
2UUAQ 4GOPC 4BXXG 1D8LA 5M5XH 1HR0L 4DV1Q 1L1OC 3I4MH 1KC8C 5JEAJ 4L5TA 1PHJA 1EUJA 3PSIA 1YEZA 4PZ6A 4DV7L 3AQQA 1LYLA 1KRTA 5FJ8G 3RNUA 4J15A 2ZJQA 3S2HH 1Q1EA 2BH2A 3ICEA 1Y1WH 2A8VA 1N34Q 1FVIA 1N36L 3TREA 2E2JH 2JA5G 1VQPA 1TXYA 4RG1A 4DR6L 3CCQA 4GKKQ 4A75A 3GD7A 2NVXH 1CKNB 1EQRA 4MNOA 2CWPA 4GKKL 3M4OH 4LFAL 5AJ3Q 2QA4A 3VDYA 1YHBA 5C4JH 4IOAA 2JE6I 4A3FH 5JJLA 1R9TH 2HQLA 2VS1A 4YWMA 1L1OA 5IT9c 2DUDA 4AH6A 4AIMA 1JE5A 2MQHA 1L0WA 1A0IA 4LWCA 1Z9FA 2ID0A 2N3SA 2RHSB 2WP8J 1N32L 2Q2UA 1QVGA 4IPCA 4X6AH 4A76A 4DUZQ 4XTCS 2I5HA 1FL0A 4B3SL 1VQIA 2WB1E 1CKMA 4O0AA 4JI3Q 4LF8L 1KL9A 1A8VA 2KCTA 4GN4B 2AMCB 4GOPB 1WCMG 1VQ6A 1PYSB 1X54A 2PQAA 5GQOA 4A4IA 4DV4Q 1HNWQ 4DR4Q 1I3QH 1HJPA 5IYDG 4JI5L 4DV2Q 1VQDA 5DLQE 1J5EQ 4DV5Q 1PH8A 2YV5A 3I4NG 3I4MG 1MKHA 2Z6KC 4HJ5A 4HJ8A 3D0FA 4DR7L 4JBMA 1VQCA 2JJQA 3BU2A 3K81C 1B8AA 2CFMA 2MO0A 1KAWA 2AWOA 5IWAQ 2HIVA 4DR5L 2KHIA 5ELOA 3STBD 1SFOH 1Q81C 4HJ9A 2UU9Q 4B3RL 4AQYL 1BBUA 2UU9L 1WJJA 2K5NA 3PUVA 1JT8A 5LMUQ 2JA8H 2NZHA 2MO1A 4R1JA 4KI0A 3HOYH 3RN5A 4R4IA 4DV7Q 5M3FG 1WFQA 1IBLQ 3KOJA 1PH1A 3CD6A 3GTPH 5J3BA 3CCLA 1I94Q 4X62L 1Q7YC 2I5LX 1PH6A 1HR0Q 2QGQA 1E1OA 4ME3A 4YWKA 1SRUA 1XMOL 4A3KG 4LNQA 3CCMA 4OWTB 3J7ZC 4DV6L 2ZM6Q 4IJHA 2R7DA 1BVSA 3L7ZC 1YJWA 2GVBA 2IY5B 5IYCG 4QY7A 5E7NA 4JV5Q 2HIXA 1J6QA 4GLXA 1NMGA 1Q46A 4JYAL 2KCMA 2YU9H 3UDFA 3CMEA 4K0KQ 1KRSA 2L15A 3ULJA 1MIUA 4JI6L 3PUZA 4DUYL 4BBSG 2D0OA 2C35B 3U4ZA 2PI2A 2OTLA 2UUCL 1PH5A 1NMFA 5C44H 2B3GA 3CC2A 4JI4Q 3S14H 2K4KA 1Q86C 3K0XA 1NTGA 2Z6KA 4JC0A 4NB3A 4JI4L 4NXML 4OX9Q 2IHEA 3CQZH 1BKBA 3OW2A 1C9OA 5LMNQ 4A3DH 4JI7Q 4DR4L 4R4QA 3H15A 1I6HH 5C44G 2F52A 4JI6Q 1PV4A 3S1QH 3ULLA 4K0KL 2UXBQ 2Q2TA 4BBSH 2XTIA 1L1OB 2IX1A 2VUMG 4JOIA 3M7NA 4JI3L 2FXQA 3I4OA 2K75A 4DR1L 2VQFQ 5M3MG 3TQYA 4HIDA 4LUZA 4A3EG 3G71A 3PUXA 1TWFH 3HKSA 3WWVA 1YHQA 1IBLL 3KF8B 1HNXQ 3PV0A 5ELNA 4UP7A 1D7QA 4A3BH 3HOZH 5FLXc 1GM5A 4MZ9A 1Q82C 3UDXA 4GKJQ 1PH4A 3HOVG 1PH3A 1VQMA 4LFCL 4B3RQ 1E1TA 4OXPA 1RL2A 3HKZG 4HIKA 3BZCA 4DNIA 3HOXH 4DV0Q 2AHOB 3M4PA 3U58A 1X3GA 2UXBL 2R93G 5IYDH 4UP8A 4DR7Q 3PCOB 2H5XA 2KHJA 3UE0A 2R92H 4A3JG 3PF4A 3J81i 5IP7G 4IJLA 3CXCA 1VQHA 3PUYA 2Y0SG 4DV1L 1HZ9A 3ERSX 2E5LQ 3E9HA 5LMUL 3KF6A 2UXDL 2YTYA 1WOCA 2WB1G 2OWOA 2EXDA 4JI1Q 5IY0A 3PO2G 2K5VA 5C4XH 1UE5A 4Y7NH 2VW9A 1XNRQ 1XNQQ 1CSPA 4LFBL 4QGUA 4PZ8A 1G51A 3J7A5 1VQKA 1QVFA 2D62A 1YJ9A 5IE8A 3AFPA 4JBWA 4WJ3M 2ZM6L 4PMWA 5H1SE 1LUZA 1EQQA 4A3EH 4A3IG 3F2DA 1IYJB 4C3IH 4H02A 3RZDH 2RHQB 5M3MH 2VQFL 3PO2H 1FJGQ 3KF6B 4JI1L 2A19A 2YTXA 4DK3C 3S2DH 2D0PA 1X55A 3NELA 2PI2E 1UEBA 4PG3A 3HOWG 4YWLA 3K80C 1A63A 1X65A 1GVPA 5GAEC 1XPUA 1IXRA 1GKHA 4A3MH 4LF6Q 1X56A 1VQ8A 1VCIA 2AWNA 4OWWB 1ASYA 2JA9A 4XIGS 4BXXH 4DKAC 4GNXB 4NXMQ 3A0JA 1VQ9A 4OX9L 2WFWA 4OWXB 4LF9Q 2JA7H 4MTNA 4BA2I 4A3LG 4GLAC 1Q8KA 1J5EL 4YY3Q 2VZAA 3HOWH 1YIJA 4QIWE 1HZCA 4IFDI 4HJ7A 5IWAL 1YVCA 4EQ5A 1CUKA 1QUQA 3UDIA 3T1HQ 2NVYH 2OQ0A 2VL6A 2UXCL 3S1RH 2R7FA 2IHFA 4AYBE 3D31A 1S3OA 4LUVA 3E0EA 3F8TA 4RMFA 1U0LA 4A3BG 1B7YB 1L2FA 4YHHQ 3CP0A 3HFZB 3W5OA 1VQAA 3M3YH 3A74A 3KLWA 3FP9A 3G6EA 1HH2P 1I94L 2B63H 4P75A 4BBRH 4X64Q 4AYBG 2NN6I 4ALPA 5EAYA 1M1KC 4JI0L 2OQKA 1S72A 3T1HL 2ATWA 2JA8G 3GTGH 4B3TL 1B70B 2E5LL 1W3SA 3RLNA 4DV0L 1N32Q 1XMQQ 3HOUG 1Y1VG 3MEFA 1N33Q 2VNUD 4R4TA 3TS0A 1YNXA 4HIMA 3GTJH 3U4VA 5JJIA 5IP9G 2A1AA 2Z0SA 2N49A 1OXVA 3L2PA 2ZJRA 1Q1BA 1FJGL 2R7ZH 3JC66 3S24A 4A3JH 3H0GH 3GTQH 1KXLA 4A3GG 4TVAB 1YJNA 2UUBQ 1OTCA 4P72A 4LFAQ 3AFQA 2R93H 2LXKA 3GTMH 1YHAA 2NVTH 4UPAA 5C0XI 3K7UC 4JBJA 4IOCA 3ULPA 2CWAA 3A5UA 2MFIA 2BA1A 3T1YL 1N34L 4POGA 1JJ2A 5IP9H 3EN2A 5GAHC 3CMAA 4UY8C 1EIYB 1Y1VH 4KHPL 1LM0A 1CKOA 3ER0A 4KHPQ 4A3IH 4DV6Q 4Y52H 2B29A 4X66Q 3OTOQ 1IZ6A 3S1MH 3CCVA 1V1QA 1VQEA 2WAQE 2F4VQ 1V9PA 3RLFA 4DAYB 3EIVA 2KBNA 2RCNA 5M3FH 4BY7H 3S17H 1NY4A 1SROA 2YYZA 4P71A 1XNQL 5JEAG 1GO3E 3KJPA 1YITA 1Q12A 1XNRL 2VUMH 1YI2A 2VY3A 1VS0A 4LF4Q 1V43A 4GOPA 3HOYG 2ZTCA 2LSSA 4POFA 2IT1A 3GDEA 4DR5Q 2GN5A 4LUOA 1NBWA 4A3DG 1WI5A 1NE3A 1XPOA 5FJ8H 3RLOA 4IO9A 4DPGA 4L5SA 4JYAQ 4LF9L 4BY1H 3J80c 1G291 1UE6A 3F2CA 3EBEA 2E2IH 5IYBG 1ASZA 3JAMc 4A3LH 1QUQB 3J80i 3S1NH 1TWAH 4DK6C 4IPDA 4DR3Q 4LF6L 2JA7G 3S16H 2KENA 4BY1G 3HOVH 5HGQA 1HZAA 4X62Q 4IFDJ 2NZOA 1OXTA 1DGSA 1VQGA 1OXXK 1K73C 4OO1G 5FLMH 1C7YA 4JBKA 5BR8L 2V1CC 1K0RA 1EWIA 2I5MX 3M4QA 1SR3A 1KD1C 3LGJA 1SLJA 3HOXG 3CAMA 4EX5A 1T9HA 4LF5L 2IX0A 5C3EH 2ZJPA 4TQUS 1TWHH 2MNAA 3T1YQ 4A3CG 2R6GA 1HNXL 1G6PA 1OXSC 1P8LA 1U5KA 1A62A 1JB7A 1K8AC 1HNZQ 3CCUA 2LXJA 3I55A 1NJIC 2UUBL 5C0XG 2CKZB 4JI2Q 4DR1Q 2ASBA 1HZBA 1W2BA 2UUCQ 1H95A 4DV2L 4JI5Q 2ALYB 3RZOH 1N33L 3CPWA 3B6YA 4DV4L 3K7AH 3PUWA 2JA5H 1I5FA 1VQ4A 1X3FA 2Q2IA 4YCUA 4LF7Q 1AE3A 1M90C 3GTKH 2BH8A 2HT1A 4JI0Q 3BJUA 4GNXA 1X6OA 4DV3Q 1IBKL 1VQFA 4B3SQ 3CF5A 1QZHA 3I4NH 1QVCA 1XMOQ 3NEMA 4QL5A 4QJFA 4UP9A 3I56A 1AE2A 4LW1A 3CCRA 3H0GG 1PH7A 1JJGA 2R92G 2VQEQ 3FKIG 3UDGA 3S15H 1N8RC 2K52A 2JEAI 3W1GA 4A3MG 1UWVA 2K50A 4GNXC 1EYGA 1YZ6A 3KDFB 3F2BA 2K14A 4JI8L 1MJEA 1PH9A 1X3EA 5AJ3L 4C3JH 4HJAA 3CC4A 1UE7A 4A3KH 4HIOA 2AKWB 2DGYA 4FDBA 4BY7G 3TS2A 4OONA 3CCSA 2JEBI 1KIXA 3BZKA 4R4OA 3OYYA 5IYCH 3KFUA 1LTLA 4X65Q 3DM3A 4IPHA 3GTLH 1E3PA 3MXNB 4JOIC 4LF7L 1PA6A 5C4XG 3OTOL 1CSQA 3ZJYC 4L5QA 1X9NA 4GN3B 1VQ7A 5K36G 2GVAA 4LFCQ 1VQBA 5BR8Q 1C0AA 4WJ4A 2JA6H 4DUZL 2EIFA 4X65L 4JI8Q 1BBWA 4JCVE 3CPFA 4P73A 3JAMi 3SGIA 3J81c 4DV5L 4R4CA 4DR3L 2WAQG 2UUAL 2XGTA 1VQJA 1HNZL 4DR2Q 1SN8A 3U50C 1E22A 2QEXA 3F1ZA 4B3MQ 4LFBQ 4BA1I 4GLVB 4GS3A 5IYBH 3KJOA 2BA0A 2EQSA 2JA6G 1S40A 5M5WH 2NN6G 4YCVA 1XPRA 4IPGA 2UXDQ 1WCMH 4YY3L 1XJVA 1KQSA 1XMQL 3IRBA 4BBRG 1RIPA 4L5RC 1IBMQ 4QQBX 1P16A 3M9BA 5LMNW 5JJKA 3Q8DA 3H3VI 5GROA 2PQAB 4KLKA 4X64L 1PH2A 2NVQH 1AH9A 3CW2C 3DLLA 1YBYA 4JG2A 3W1BA 3RN2A 2F4VL 5M5YH 3AYHB 4NPSA 2K5HA 3CC7A 2OCEA 3CCJA 1EFWA 1PFSA 2RF4A 3RR5A 3TRZA 5GADC 3L0OA 4IFDG 1N9WA 1K9MC 4APVA 4A3FG 4PZ7A 1SMXA 1HR0W 1JMCA 4P74A 4DR6Q 1QZGA 1VQOA 1N36Q 2HHHQ 1VQLA 1E24A 2N78A 2CCZA 3AEVA 4LF4L 3KYHC 4C2MH 3G4SA 1SE8A 4JI2L 2ES2A 3G48A 1FGUA 5IP7H 3A5ZB 3E9IA 2YTVA 1O7IA 3UE1A 3PF5A 5GAGC 2VQEL 2R7ZG 1K83H 2PMZE 3H3VH 1CKNA 1HNWL 2E8GA 3NBHB 3M85A 2CQOA 2JK8A 1GD7A 5C0XJ 4LF5Q 3HOUH 4GN5A 2E2HH 1TWGH 1UE1A 3GO5A 2HHHL 4A3GH 4DV3L 1IBKQ 4LF8Q 4A93G 2Q2HA 3HKZE 4NXNL 3PO3H 4DAMA 1JJCB 1EIFA 1EOVA 2ZTDA 4B3TQ 3STBC 4NXNQ 1XTDA 3HOZG 4JI7L 4AQYQ 5LMNL 1KHIA 3FHWA 2JQOA 1PYBA 3I2ZA 2N8NA 3GTOH 3TEHB 3CCEA 2PNHA 3NENA 1K3RA 1OXUA 3K8AA 3PGZA 2B63G 1IL2A 4YHHL 1IBML 4B3ML 1K8GA 1I50H 3J81j 4YCWA 4DUYQ 1Y14B 3PO3G 3KDFA 2OTJA 2F3IA 1VQ5A 2I0QA 4A93H 4GKJL 2UXCQ 2Y0SE 5C3EG 1PVOA 1VQNA 2ZTEA 3I7FA 4O2DA 4X66L 4C3HH 3PIOA 4A3CH 5HY6A 1E7ZA 4OO1I 1WYDA 1Z47A 1MJCA 1TWCH 4JV5L 4KHZA 3PIPA 1Y1WG 5FLMG 4DR2L 3FKIH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UUA Q;  4GOP C;  4BXX G;  1D8L A;  5M5X H;  1HR0 L;  4DV1 Q;  1L1O C;  3I4M H;  1KC8 C;  5JEA J;  4L5T A;  1PHJ A;  1EUJ A;  3PSI A;  1YEZ A;  4PZ6 A;  4DV7 L;  3AQQ A;  1LYL A;  1KRT A;  5FJ8 G;  3RNU A;  4J15 A;  2ZJQ A;  3S2H H;  1Q1E A;  2BH2 A;  3ICE A;  1Y1W H;  2A8V A;  1N34 Q;  1FVI A;  1N36 L;  3TRE A;  2E2J H;  2JA5 G;  1VQP A;  1TXY A;  4RG1 A;  4DR6 L;  3CCQ A;  4GKK Q;  4A75 A;  3GD7 A;  2NVX H;  1CKN B;  1EQR A;  4MNO A;  2CWP A;  4GKK L;  3M4O H;  4LFA L;  5AJ3 Q;  2QA4 A;  3VDY A;  1YHB A;  5C4J H;  4IOA A;  2JE6 I;  4A3F H;  5JJL A;  1R9T H;  2HQL A;  2VS1 A;  4YWM A;  1L1O A;  5IT9 c;  2DUD A;  4AH6 A;  4AIM A;  1JE5 A;  2MQH A;  1L0W A;  1A0I A;  4LWC A;  1Z9F A;  2ID0 A;  2N3S A;  2RHS B;  2WP8 J;  1N32 L;  2Q2U A;  1QVG A;  4IPC A;  4X6A H;  4A76 A;  4DUZ Q;  4XTC S;  2I5H A;  1FL0 A;  4B3S L;  1VQI A;  2WB1 E;  1CKM A;  4O0A A;  4JI3 Q;  4LF8 L;  1KL9 A;  1A8V A;  2KCT A;  4GN4 B;  2AMC B;  4GOP B;  1WCM G;  1VQ6 A;  1PYS B;  1X54 A;  2PQA A;  5GQO A;  4A4I A;  4DV4 Q;  1HNW Q;  4DR4 Q;  1I3Q H;  1HJP A;  5IYD G;  4JI5 L;  4DV2 Q;  1VQD A;  5DLQ E;  1J5E Q;  4DV5 Q;  1PH8 A;  2YV5 A;  3I4N G;  3I4M G;  1MKH A;  2Z6K C;  4HJ5 A;  4HJ8 A;  3D0F A;  4DR7 L;  4JBM A;  1VQC A;  2JJQ A;  3BU2 A;  3K81 C;  1B8A A;  2CFM A;  2MO0 A;  1KAW A;  2AWO A;  5IWA Q;  2HIV A;  4DR5 L;  2KHI A;  5ELO A;  3STB D;  1SFO H;  1Q81 C;  4HJ9 A;  2UU9 Q;  4B3R L;  4AQY L;  1BBU A;  2UU9 L;  1WJJ A;  2K5N A;  3PUV A;  1JT8 A;  5LMU Q;  2JA8 H;  2NZH A;  2MO1 A;  4R1J A;  4KI0 A;  3HOY H;  3RN5 A;  4R4I A;  4DV7 Q;  5M3F G;  1WFQ A;  1IBL Q;  3KOJ A;  1PH1 A;  3CD6 A;  3GTP H;  5J3B A;  3CCL A;  1I94 Q;  4X62 L;  1Q7Y C;  2I5L X;  1PH6 A;  1HR0 Q;  2QGQ A;  1E1O A;  4ME3 A;  4YWK A;  1SRU A;  1XMO L;  4A3K G;  4LNQ A;  3CCM A;  4OWT B;  3J7Z C;  4DV6 L;  2ZM6 Q;  4IJH A;  2R7D A;  1BVS A;  3L7Z C;  1YJW A;  2GVB A;  2IY5 B;  5IYC G;  4QY7 A;  5E7N A;  4JV5 Q;  2HIX A;  1J6Q A;  4GLX A;  1NMG A;  1Q46 A;  4JYA L;  2KCM A;  2YU9 H;  3UDF A;  3CME A;  4K0K Q;  1KRS A;  2L15 A;  3ULJ A;  1MIU A;  4JI6 L;  3PUZ A;  4DUY L;  4BBS G;  2D0O A;  2C35 B;  3U4Z A;  2PI2 A;  2OTL A;  2UUC L;  1PH5 A;  1NMF A;  5C44 H;  2B3G A;  3CC2 A;  4JI4 Q;  3S14 H;  2K4K A;  1Q86 C;  3K0X A;  1NTG A;  2Z6K A;  4JC0 A;  4NB3 A;  4JI4 L;  4NXM L;  4OX9 Q;  2IHE A;  3CQZ H;  1BKB A;  3OW2 A;  1C9O A;  5LMN Q;  4A3D H;  4JI7 Q;  4DR4 L;  4R4Q A;  3H15 A;  1I6H H;  5C44 G;  2F52 A;  4JI6 Q;  1PV4 A;  3S1Q H;  3ULL A;  4K0K L;  2UXB Q;  2Q2T A;  4BBS H;  2XTI A;  1L1O B;  2IX1 A;  2VUM G;  4JOI A;  3M7N A;  4JI3 L;  2FXQ A;  3I4O A;  2K75 A;  4DR1 L;  2VQF Q;  5M3M G;  3TQY A;  4HID A;  4LUZ A;  4A3E G;  3G71 A;  3PUX A;  1TWF H;  3HKS A;  3WWV A;  1YHQ A;  1IBL L;  3KF8 B;  1HNX Q;  3PV0 A;  5ELN A;  4UP7 A;  1D7Q A;  4A3B H;  3HOZ H;  5FLX c;  1GM5 A;  4MZ9 A;  1Q82 C;  3UDX A;  4GKJ Q;  1PH4 A;  3HOV G;  1PH3 A;  1VQM A;  4LFC L;  4B3R Q;  1E1T A;  4OXP A;  1RL2 A;  3HKZ G;  4HIK A;  3BZC A;  4DNI A;  3HOX H;  4DV0 Q;  2AHO B;  3M4P A;  3U58 A;  1X3G A;  2UXB L;  2R93 G;  5IYD H;  4UP8 A;  4DR7 Q;  3PCO B;  2H5X A;  2KHJ A;  3UE0 A;  2R92 H;  4A3J G;  3PF4 A;  3J81 i;  5IP7 G;  4IJL A;  3CXC A;  1VQH A;  3PUY A;  2Y0S G;  4DV1 L;  1HZ9 A;  3ERS X;  2E5L Q;  3E9H A;  5LMU L;  3KF6 A;  2UXD L;  2YTY A;  1WOC A;  2WB1 G;  2OWO A;  2EXD A;  4JI1 Q;  5IY0 A;  3PO2 G;  2K5V A;  5C4X H;  1UE5 A;  4Y7N H;  2VW9 A;  1XNR Q;  1XNQ Q;  1CSP A;  4LFB L;  4QGU A;  4PZ8 A;  1G51 A;  3J7A 5;  1VQK A;  1QVF A;  2D62 A;  1YJ9 A;  5IE8 A;  3AFP A;  4JBW A;  4WJ3 M;  2ZM6 L;  4PMW A;  5H1S E;  1LUZ A;  1EQQ A;  4A3E H;  4A3I G;  3F2D A;  1IYJ B;  4C3I H;  4H02 A;  3RZD H;  2RHQ B;  5M3M H;  2VQF L;  3PO2 H;  1FJG Q;  3KF6 B;  4JI1 L;  2A19 A;  2YTX A;  4DK3 C;  3S2D H;  2D0P A;  1X55 A;  3NEL A;  2PI2 E;  1UEB A;  4PG3 A;  3HOW G;  4YWL A;  3K80 C;  1A63 A;  1X65 A;  1GVP A;  5GAE C;  1XPU A;  1IXR A;  1GKH A;  4A3M H;  4LF6 Q;  1X56 A;  1VQ8 A;  1VCI A;  2AWN A;  4OWW B;  1ASY A;  2JA9 A;  4XIG S;  4BXX H;  4DKA C;  4GNX B;  4NXM Q;  3A0J A;  1VQ9 A;  4OX9 L;  2WFW A;  4OWX B;  4LF9 Q;  2JA7 H;  4MTN A;  4BA2 I;  4A3L G;  4GLA C;  1Q8K A;  1J5E L;  4YY3 Q;  2VZA A;  3HOW H;  1YIJ A;  4QIW E;  1HZC A;  4IFD I;  4HJ7 A;  5IWA L;  1YVC A;  4EQ5 A;  1CUK A;  1QUQ A;  3UDI A;  3T1H Q;  2NVY H;  2OQ0 A;  2VL6 A;  2UXC L;  3S1R H;  2R7F A;  2IHF A;  4AYB E;  3D31 A;  1S3O A;  4LUV A;  3E0E A;  3F8T A;  4RMF A;  1U0L A;  4A3B G;  1B7Y B;  1L2F A;  4YHH Q;  3CP0 A;  3HFZ B;  3W5O A;  1VQA A;  3M3Y H;  3A74 A;  3KLW A;  3FP9 A;  3G6E A;  1HH2 P;  1I94 L;  2B63 H;  4P75 A;  4BBR H;  4X64 Q;  4AYB G;  2NN6 I;  4ALP A;  5EAY A;  1M1K C;  4JI0 L;  2OQK A;  1S72 A;  3T1H L;  2ATW A;  2JA8 G;  3GTG H;  4B3T L;  1B70 B;  2E5L L;  1W3S A;  3RLN A;  4DV0 L;  1N32 Q;  1XMQ Q;  3HOU G;  1Y1V G;  3MEF A;  1N33 Q;  2VNU D;  4R4T A;  3TS0 A;  1YNX A;  4HIM A;  3GTJ H;  3U4V A;  5JJI A;  5IP9 G;  2A1A A;  2Z0S A;  2N49 A;  1OXV A;  3L2P A;  2ZJR A;  1Q1B A;  1FJG L;  2R7Z H;  3JC6 6;  3S24 A;  4A3J H;  3H0G H;  3GTQ H;  1KXL A;  4A3G G;  4TVA B;  1YJN A;  2UUB Q;  1OTC A;  4P72 A;  4LFA Q;  3AFQ A;  2R93 H;  2LXK A;  3GTM H;  1YHA A;  2NVT H;  4UPA A;  5C0X I;  3K7U C;  4JBJ A;  4IOC A;  3ULP A;  2CWA A;  3A5U A;  2MFI A;  2BA1 A;  3T1Y L;  1N34 L;  4POG A;  1JJ2 A;  5IP9 H;  3EN2 A;  5GAH C;  3CMA A;  4UY8 C;  1EIY B;  1Y1V H;  4KHP L;  1LM0 A;  1CKO A;  3ER0 A;  4KHP Q;  4A3I H;  4DV6 Q;  4Y52 H;  2B29 A;  4X66 Q;  3OTO Q;  1IZ6 A;  3S1M H;  3CCV A;  1V1Q A;  1VQE A;  2WAQ E;  2F4V Q;  1V9P A;  3RLF A;  4DAY B;  3EIV A;  2KBN A;  2RCN A;  5M3F H;  4BY7 H;  3S17 H;  1NY4 A;  1SRO A;  2YYZ A;  4P71 A;  1XNQ L;  5JEA G;  1GO3 E;  3KJP A;  1YIT A;  1Q12 A;  1XNR L;  2VUM H;  1YI2 A;  2VY3 A;  1VS0 A;  4LF4 Q;  1V43 A;  4GOP A;  3HOY G;  2ZTC A;  2LSS A;  4POF A;  2IT1 A;  3GDE A;  4DR5 Q;  2GN5 A;  4LUO A;  1NBW A;  4A3D G;  1WI5 A;  1NE3 A;  1XPO A;  5FJ8 H;  3RLO A;  4IO9 A;  4DPG A;  4L5S A;  4JYA Q;  4LF9 L;  4BY1 H;  3J80 c;  1G29 1;  1UE6 A;  3F2C A;  3EBE A;  2E2I H;  5IYB G;  1ASZ A;  3JAM c;  4A3L H;  1QUQ B;  3J80 i;  3S1N H;  1TWA H;  4DK6 C;  4IPD A;  4DR3 Q;  4LF6 L;  2JA7 G;  3S16 H;  2KEN A;  4BY1 G;  3HOV H;  5HGQ A;  1HZA A;  4X62 Q;  4IFD J;  2NZO A;  1OXT A;  1DGS A;  1VQG A;  1OXX K;  1K73 C;  4OO1 G;  5FLM H;  1C7Y A;  4JBK A;  5BR8 L;  2V1C C;  1K0R A;  1EWI A;  2I5M X;  3M4Q A;  1SR3 A;  1KD1 C;  3LGJ A;  1SLJ A;  3HOX G;  3CAM A;  4EX5 A;  1T9H A;  4LF5 L;  2IX0 A;  5C3E H;  2ZJP A;  4TQU S;  1TWH H;  2MNA A;  3T1Y Q;  4A3C G;  2R6G A;  1HNX L;  1G6P A;  1OXS C;  1P8L A;  1U5K A;  1A62 A;  1JB7 A;  1K8A C;  1HNZ Q;  3CCU A;  2LXJ A;  3I55 A;  1NJI C;  2UUB L;  5C0X G;  2CKZ B;  4JI2 Q;  4DR1 Q;  2ASB A;  1HZB A;  1W2B A;  2UUC Q;  1H95 A;  4DV2 L;  4JI5 Q;  2ALY B;  3RZO H;  1N33 L;  3CPW A;  3B6Y A;  4DV4 L;  3K7A H;  3PUW A;  2JA5 H;  1I5F A;  1VQ4 A;  1X3F A;  2Q2I A;  4YCU A;  4LF7 Q;  1AE3 A;  1M90 C;  3GTK H;  2BH8 A;  2HT1 A;  4JI0 Q;  3BJU A;  4GNX A;  1X6O A;  4DV3 Q;  1IBK L;  1VQF A;  4B3S Q;  3CF5 A;  1QZH A;  3I4N H;  1QVC A;  1XMO Q;  3NEM A;  4QL5 A;  4QJF A;  4UP9 A;  3I56 A;  1AE2 A;  4LW1 A;  3CCR A;  3H0G G;  1PH7 A;  1JJG A;  2R92 G;  2VQE Q;  3FKI G;  3UDG A;  3S15 H;  1N8R C;  2K52 A;  2JEA I;  3W1G A;  4A3M G;  1UWV A;  2K50 A;  4GNX C;  1EYG A;  1YZ6 A;  3KDF B;  3F2B A;  2K14 A;  4JI8 L;  1MJE A;  1PH9 A;  1X3E A;  5AJ3 L;  4C3J H;  4HJA A;  3CC4 A;  1UE7 A;  4A3K H;  4HIO A;  2AKW B;  2DGY A;  4FDB A;  4BY7 G;  3TS2 A;  4OON A;  3CCS A;  2JEB I;  1KIX A;  3BZK A;  4R4O A;  3OYY A;  5IYC H;  3KFU A;  1LTL A;  4X65 Q;  3DM3 A;  4IPH A;  3GTL H;  1E3P A;  3MXN B;  4JOI C;  4LF7 L;  1PA6 A;  5C4X G;  3OTO L;  1CSQ A;  3ZJY C;  4L5Q A;  1X9N A;  4GN3 B;  1VQ7 A;  5K36 G;  2GVA A;  4LFC Q;  1VQB A;  5BR8 Q;  1C0A A;  4WJ4 A;  2JA6 H;  4DUZ L;  2EIF A;  4X65 L;  4JI8 Q;  1BBW A;  4JCV E;  3CPF A;  4P73 A;  3JAM i;  3SGI A;  3J81 c;  4DV5 L;  4R4C A;  4DR3 L;  2WAQ G;  2UUA L;  2XGT A;  1VQJ A;  1HNZ L;  4DR2 Q;  1SN8 A;  3U50 C;  1E22 A;  2QEX A;  3F1Z A;  4B3M Q;  4LFB Q;  4BA1 I;  4GLV B;  4GS3 A;  5IYB H;  3KJO A;  2BA0 A;  2EQS A;  2JA6 G;  1S40 A;  5M5W H;  2NN6 G;  4YCV A;  1XPR A;  4IPG A;  2UXD Q;  1WCM H;  4YY3 L;  1XJV A;  1KQS A;  1XMQ L;  3IRB A;  4BBR G;  1RIP A;  4L5R C;  1IBM Q;  4QQB X;  1P16 A;  3M9B A;  5LMN W;  5JJK A;  3Q8D A;  3H3V I;  5GRO A;  2PQA B;  4KLK A;  4X64 L;  1PH2 A;  2NVQ H;  1AH9 A;  3CW2 C;  3DLL A;  1YBY A;  4JG2 A;  3W1B A;  3RN2 A;  2F4V L;  5M5Y H;  3AYH B;  4NPS A;  2K5H A;  3CC7 A;  2OCE A;  3CCJ A;  1EFW A;  1PFS A;  2RF4 A;  3RR5 A;  3TRZ A;  5GAD C;  3L0O A;  4IFD G;  1N9W A;  1K9M C;  4APV A;  4A3F G;  4PZ7 A;  1SMX A;  1HR0 W;  1JMC A;  4P74 A;  4DR6 Q;  1QZG A;  1VQO A;  1N36 Q;  2HHH Q;  1VQL A;  1E24 A;  2N78 A;  2CCZ A;  3AEV A;  4LF4 L;  3KYH C;  4C2M H;  3G4S A;  1SE8 A;  4JI2 L;  2ES2 A;  3G48 A;  1FGU A;  5IP7 H;  3A5Z B;  3E9I A;  2YTV A;  1O7I A;  3UE1 A;  3PF5 A;  5GAG C;  2VQE L;  2R7Z G;  1K83 H;  2PMZ E;  3H3V H;  1CKN A;  1HNW L;  2E8G A;  3NBH B;  3M85 A;  2CQO A;  2JK8 A;  1GD7 A;  5C0X J;  4LF5 Q;  3HOU H;  4GN5 A;  2E2H H;  1TWG H;  1UE1 A;  3GO5 A;  2HHH L;  4A3G H;  4DV3 L;  1IBK Q;  4LF8 Q;  4A93 G;  2Q2H A;  3HKZ E;  4NXN L;  3PO3 H;  4DAM A;  1JJC B;  1EIF A;  1EOV A;  2ZTD A;  4B3T Q;  3STB C;  4NXN Q;  1XTD A;  3HOZ G;  4JI7 L;  4AQY Q;  5LMN L;  1KHI A;  3FHW A;  2JQO A;  1PYB A;  3I2Z A;  2N8N A;  3GTO H;  3TEH B;  3CCE A;  2PNH A;  3NEN A;  1K3R A;  1OXU A;  3K8A A;  3PGZ A;  2B63 G;  1IL2 A;  4YHH L;  1IBM L;  4B3M L;  1K8G A;  1I50 H;  3J81 j;  4YCW A;  4DUY Q;  1Y14 B;  3PO3 G;  3KDF A;  2OTJ A;  2F3I A;  1VQ5 A;  2I0Q A;  4A93 H;  4GKJ L;  2UXC Q;  2Y0S E;  5C3E G;  1PVO A;  1VQN A;  2ZTE A;  3I7F A;  4O2D A;  4X66 L;  4C3H H;  3PIO A;  4A3C H;  5HY6 A;  1E7Z A;  4OO1 I;  1WYD A;  1Z47 A;  1MJC A;  1TWC H;  4JV5 L;  4KHZ A;  3PIP A;  1Y1W G;  5FLM G;  4DR2 L;  3FKI H; 
#chains in the Genus database with same CATH topology
 4GOP C;  4CDF C;  2PCF B;  4DV1 Q;  1PRT B;  3I4M H;  5JEA J;  1UAP A;  2OF1 A;  4JVZ A;  4IUU A;  4Z9C B;  1LYL A;  4XT3 B;  5FJ8 G;  3MXN A;  2DNC A;  2RCF A;  1Y1W H;  2CW0 C;  5FO7 B;  3CCQ A;  4G7O C;  5DM7 3;  3K0Y A;  1EQR A;  1SJE D;  2CWP A;  1C4Q A;  3TZU A;  4LFA L;  5AJ3 Q;  1TS4 A;  3QG1 A;  3MTS A;  3VDY A;  1SE4 A;  4IOA A;  1Q8I A;  4K14 A;  4ABN A;  4B08 A;  1L0W A;  2MQH A;  4LWC A;  3HKZ B;  4R9W A;  1SYF A;  2ID0 A;  1BR9 A;  2PO4 A;  4J8Q A;  3QB3 A;  4C56 C;  1QVG A;  2B2Y A;  2KUM A;  4IPC A;  4DU9 A;  4X6A H;  4F8M A;  3BDL A;  1CT1 D;  4B3S L;  4O0A A;  4JI3 Q;  1HFG A;  1MBY A;  1KL9 A;  3ONA B;  1A8V A;  4DA2 A;  2AMC B;  4GOP B;  4A4I A;  2PQA A;  5EGT A;  4DR4 Q;  1HJP A;  4DV2 Q;  1VQD A;  4TSS A;  4DV5 Q;  2QDL A;  1PH8 A;  3I4M G;  3UI2 A;  3D0F A;  1G8Z D;  3K81 C;  1B8A A;  2AWO A;  1Q81 C;  2KHI A;  3STB D;  1STB A;  1BBU A;  4QF4 A;  5KEE A;  1JT8 A;  4R8N A;  2NZH A;  1ONL A;  4CGY B;  3E0J A;  4DV7 Q;  1WFQ A;  3TP6 A;  2PMZ B;  2B2U A;  1PH1 A;  3OIP A;  2I5L X;  1E1O A;  1GXD C;  3SR1 A;  4YWK A;  1TII D;  3J7Z C;  2ZM6 Q;  2R7D A;  3VYT A;  1YJW A;  2JYO A;  2IY5 B;  5IYC G;  4QY7 A;  5E7N A;  1J6Q A;  1Q46 A;  4JYA L;  2KCM A;  1ML0 D;  4N8X 1;  1EZ8 A;  1SBB B;  4LMQ D;  4JI6 L;  1S5B D;  4DUY L;  1BO0 A;  2C35 B;  2K5D A;  1SJH D;  1ZYR C;  2B3G A;  2A68 C;  3S14 H;  1Q86 C;  1NTG A;  2Z6K A;  1FD7 D;  4NB3 A;  4BBR B;  1SYD A;  4OX9 Q;  3OW2 A;  1PYW D;  1BKB A;  4GZY C;  3QR8 A;  5LMN Q;  4A3D H;  1I6H H;  1NR4 A;  5C44 G;  1I50 B;  2F52 A;  2SNM A;  3QWN A;  3S1Q H;  5CGK A;  1L1O B;  3Q23 A;  4NDX A;  3OSO A;  4JOI A;  1PTO H;  2FXQ A;  2KCN A;  4WFN 3;  4HID A;  4A3E G;  3K58 A;  4BS9 A;  1LLR D;  4ILW A;  4KTA A;  5M5X B;  3HOV B;  5I9O A;  1STA A;  3KF8 B;  5ELN A;  4UP7 A;  4Q0F A;  4A3G B;  2K33 A;  4MZ9 A;  3UDX A;  1CTM A;  4ID6 A;  1D1K A;  3HOV G;  1VQM A;  5IT9 E;  4B3R Q;  1RL2 A;  1V1P A;  3HOX H;  2AHO B;  5I6W A;  2R93 G;  2KA7 A;  1PTO F;  5LHY 1;  4IZ8 A;  3K5L A;  4ODG A;  3PCO B;  2H5X A;  1H9J A;  3UE0 A;  5DNF A;  3H94 A;  1X3Q A;  1VQH A;  5HUR A;  3ERS X;  1HTP A;  1L0Y B;  3E9H A;  2K5Q A;  1IYV A;  3IFT A;  3NTH A;  4PV1 C;  3K7A B;  4KN7 C;  2YTY A;  1ENA A;  1EY9 A;  3I4L A;  4C3H B;  4JI1 Q;  5BN4 A;  3PO2 G;  5JPN C;  4Y7N H;  4PZ8 A;  1G51 A;  3J7A 5;  1VQK A;  3C1F A;  2D62 A;  2ZM6 L;  5H1S E;  2EOT A;  2FFK B;  1WTV A;  3V2T A;  4KHV A;  4A3E H;  4FP5 D;  4H02 A;  3MA2 B;  1TU2 B;  5M3M H;  2SNS A;  4H0L C;  3NEL A;  2K04 A;  1JR0 D;  1RKN A;  4PNY A;  2O5J C;  1X65 A;  4C3J G;  1XPU A;  1O78 A;  1UNS A;  4A3M H;  1VCI A;  1LTT D;  3A0J A;  2WFW A;  4OWX B;  4LF9 Q;  1FNU A;  2F0L A;  1YIJ A;  4QIW E;  1HZC A;  4HJ7 A;  3HRZ C;  3T1H Q;  2NVY H;  2PZT A;  1A3U A;  4RMF A;  3NHH A;  1TKW B;  3A74 A;  3KLW A;  3G6E A;  4DN4 M;  5G3L D;  1MD2 D;  1S72 A;  2ATW A;  1PFM A;  1QWY A;  1B70 B;  2F3W A;  2AUK A;  1N32 Q;  1Y1V G;  3NTK A;  4R4T A;  1YNX A;  3TS0 A;  2N49 A;  1EWH A;  3ERQ A;  4RCO A;  1Q1B A;  2F0Q A;  4K2L A;  3NK9 A;  4ZUI A;  1LTG D;  2AQ3 B;  4TVA B;  1YJN A;  1IW7 C;  1OTC A;  2N55 A;  2XSC A;  4DAP A;  1JWU D;  2LXK A;  4UPA A;  4JBJ A;  2BA1 A;  5D3D A;  1SEB D;  4POG A;  1HA5 A;  5IP9 H;  2H1E A;  4A3B B;  1SSO A;  3ER0 A;  4C3I G;  1F2L A;  3MWY W;  1I6V C;  4HCS A;  2J4X A;  1V1Q A;  4DAY B;  3AB9 A;  1B2T A;  2WAQ B;  1AFP A;  1ICF B;  2RCN A;  4XDX A;  3HOU B;  4BY7 H;  4P71 A;  1XNR L;  1Q12 A;  2VUM H;  2VY3 A;  4LF4 Q;  3MVV A;  2LSS A;  2FMM A;  3NE5 B;  4POF A;  1PFB A;  2GN5 A;  1NE3 A;  2B2T A;  5FJ8 H;  4LF9 L;  3BVM A;  1SYG A;  1UE6 A;  3EBE A;  3BYT B;  3J80 i;  3S1N H;  1TWA H;  1I4G A;  5HGQ A;  1K73 C;  1VQG A;  2IX3 A;  4OO1 G;  1OXX K;  2F0T A;  1EWI A;  3M4Q A;  2QF7 A;  1F2Y A;  1HHV A;  1T9H A;  2E75 C;  5IT9 L;  4A3C G;  2L55 A;  2PYK A;  3FKI B;  2BOS A;  1K83 B;  1PMR A;  1HNX L;  1JB7 A;  1HNZ Q;  4JK1 C;  2LXJ A;  3CCU A;  1EYA A;  3I55 A;  1F9Q A;  4DR1 Q;  2QEJ C;  2ALY B;  4MTK A;  1L0X B;  3CPW A;  3B6Y A;  4DV4 L;  2OT2 A;  1VQ4 A;  2Q2I A;  1AE3 A;  4N9T A;  3GTK H;  2BH8 A;  2HT1 A;  2EYL A;  4JI0 Q;  4GNX A;  1X6O A;  5CV9 A;  4DV3 Q;  5KNB A;  1LTI D;  5CR3 A;  1XMO Q;  5FLX E;  3H0G G;  3CCR A;  4TKO B;  5D3I B;  2R92 G;  3K5O A;  3UDG A;  4RKL A;  3W1G A;  1UWV A;  2K50 A;  1YZ6 A;  3KDF B;  3F2B A;  1BCP B;  1EOT A;  4A3K H;  4HIO A;  1JOR A;  3TS2 A;  3D3R A;  1GUG A;  1LTA D;  2JEB I;  3BZK A;  4R4O A;  1KIX A;  4HTH A;  3KBG A;  4IPH A;  5CBA E;  3H0G B;  3MC0 B;  1E3P A;  3V96 A;  5IOD A;  4JOI C;  1PZK D;  1SFO B;  4ZCK A;  2NVT B;  3LNN A;  2RSO A;  1VQ7 A;  3URY A;  5A2Q E;  1C8C A;  1C0A A;  3S1R B;  4X65 L;  1CZW A;  1BBW A;  3CPF A;  3SGI A;  3J81 c;  3SK6 A;  2XGT A;  3U50 C;  4RGO S;  2PW7 A;  3C3L A;  3MHB A;  5T1I A;  3KJO A;  2NN6 G;  3GTG B;  4YCV A;  1XPR A;  2ZXO A;  1WCM H;  4YY3 L;  3NP8 A;  5EKK A;  5A2Q L;  3VR2 A;  1IKL A;  2CW0 D;  1OO9 B;  1JCK B;  1RCV D;  3Q8D A;  5GRO A;  3H3V I;  3VA5 A;  2BCO A;  1AH9 A;  3MXG A;  2FJ2 A;  3MFG A;  3DLL A;  1YBY A;  3RN2 A;  2A5H A;  3L9A X;  1SNM A;  3W3A A;  5LL6 S;  2BE5 C;  4U67 3;  3RR5 A;  3Q0A A;  3H3V C;  4CKB A;  4IFD G;  4APV A;  4KMU C;  3ZYY X;  1Q90 A;  1QZG A;  3IFD A;  1N36 Q;  2HHH Q;  3KYH C;  5CC4 A;  3RMH A;  3G4S A;  4KK7 A;  2ES2 A;  4DGZ A;  3G48 A;  2RBM A;  3D4R A;  2YTV A;  1O7I A;  3S1M B;  3LWU A;  2PMZ E;  1SNC A;  3F2U A;  2E8G A;  1S5E D;  5IGE A;  4KN4 C;  3M85 A;  2CQO A;  5KRU A;  3GO5 A;  4DFA A;  4LF8 Q;  1ESF A;  4KKS A;  2O5I C;  4J1M A;  1DYQ A;  4DAM A;  1JJC B;  1EIF A;  1EOV A;  4B3T Q;  4JI7 L;  4AQY Q;  1SNO A;  1JIC A;  5LMN L;  3I2Z A;  1CHP D;  3TEH B;  4CJ1 B;  2PNH A;  4OIJ A;  1OXU A;  2E2I B;  5EBC A;  2X69 A;  1IBM L;  4B3M L;  1I50 H;  4DUY Q;  1ZXT A;  5T1G A;  2OTJ A;  1VQ5 A;  5FO8 B;  2B8F A;  5C3E G;  1HUN A;  4X66 L;  4A3C H;  1PTO B;  1MSH A;  5HY6 A;  3J81 L;  4KV6 A;  1LO5 D;  2I07 B;  3PIP A;  2HDM A;  1CM9 A;  2UUA Q;  2ICI A;  5M5X H;  3M7G A;  2TSS A;  2A6H D;  4C3I B;  3PSI A;  1YEZ A;  4PZ6 A;  4DV7 L;  1KRT A;  3RNU A;  3GTL B;  3S2D B;  2B2Y C;  3S9W A;  2BH2 A;  1H9K A;  3D4D A;  4HR7 B;  1N34 Q;  2JA5 G;  2E2J H;  3TRE A;  1VQP A;  2F3V A;  3GD7 A;  3KLR A;  2NVX H;  1CKN B;  1EEF D;  1EFI D;  3M4O H;  1JE4 A;  3HP3 A;  4IUR A;  5I2Y A;  2QA4 A;  1BF4 A;  5C4J H;  4A3F H;  5JJL A;  4UDU C;  1KNE A;  1L1O A;  1JE5 A;  1H9M A;  1SE2 A;  3GP7 A;  1A0I A;  1Z9F A;  3IKJ A;  4A76 A;  4XTC S;  2I5H A;  4AYB B;  2JSO A;  1QG7 A;  4C3J B;  4GN4 B;  2B2W C;  2F0I A;  1BXT A;  2PW5 A;  1VQ6 A;  2CH4 W;  3J80 L;  1RD9 D;  1HCZ A;  3FRP B;  5C3W A;  2N88 A;  3I4N G;  1MKH A;  4HJ5 A;  1ENF A;  2NB0 A;  3BU2 A;  5CV4 A;  3SE0 A;  4EGV A;  2MO0 A;  1KAW A;  4DR5 L;  2KVM A;  2O4X A;  4AQY L;  1A6X A;  1WJJ A;  5LMU Q;  2JA8 H;  4DK1 A;  4KI0 A;  4J6H A;  3RN5 A;  5JEA H;  1HA6 A;  1IBL Q;  2JA6 B;  3NQI A;  4C2M B;  3CD6 A;  3GTP H;  2R61 A;  2Q8T A;  3DEO A;  3QO2 A;  2WKD A;  3J7A V;  1PH6 A;  1O80 A;  3BG3 A;  1SRU A;  2EY2 A;  4LNQ A;  3KK7 A;  3EQL C;  4X3S A;  2GVB A;  1F2M A;  5EJW A;  4EQP A;  4ZKB B;  3CME A;  2EJM A;  2HD3 A;  2L15 A;  4K0K Q;  1MIU A;  5KNC A;  3PUZ A;  2D0O A;  3U4Z A;  2OTL A;  2CVR A;  4JI4 Q;  4JI4 L;  4NXM L;  2RDF A;  3VA7 A;  1PRT D;  4JI7 Q;  3NTI A;  1V8Q A;  3ULL A;  5E4X A;  2UXB Q;  2EYF A;  2Q2T A;  1PRT C;  2IX1 A;  4A93 B;  3SK8 A;  2EVB A;  3R93 A;  2K6A A;  4U68 A;  4JI3 L;  3M7N A;  2FMC A;  1RTO A;  5M3M G;  3GTM B;  1ZKO A;  3G71 A;  1YNJ C;  3MEH A;  4QUF A;  1KTK A;  3FMC A;  3S16 B;  1ROD A;  1U4L A;  3HKS A;  1TQO A;  3PV0 A;  2XVS A;  2EYM A;  1D7Q A;  4A3B H;  3P1H A;  3HOZ H;  5FLX c;  3TN2 A;  3X3N A;  2C9O A;  3T13 A;  4OXP A;  2KHS A;  3HKZ G;  4HIK A;  3BZC A;  4DNI A;  4DV0 Q;  2K5W A;  2UXB L;  1E2V A;  2CHB D;  4UP8 A;  1X32 A;  2KHJ A;  1R9T B;  1CHQ D;  5KND A;  3QOL A;  3CXC A;  3PUY A;  4RWS C;  1AZQ A;  2E5L Q;  5LMU L;  2UXD L;  4M8A A;  3H6M A;  4L8J A;  3J7Y W;  1EY6 A;  1G2S A;  2WB1 B;  1J9O A;  5G3L F;  2M00 A;  1EL0 A;  2VW9 A;  1XNR Q;  1TWA B;  2KEE A;  4WJ3 M;  4JBW A;  4PMW A;  1J8I A;  2DNE A;  3I4M B;  4UHV A;  1SNP A;  1DD2 A;  2MJ8 A;  1GHJ A;  1YNN D;  1ET6 A;  2VQF L;  3KF6 B;  4JI1 L;  2A19 A;  4DK3 C;  5C3E B;  2ZXP A;  3HOW G;  1PDQ A;  1BOS A;  4YWL A;  3K80 C;  3W2D A;  1GKH A;  1WD0 A;  4LF6 Q;  1X56 A;  5FOB B;  2JP1 A;  1VQ8 A;  1EY4 A;  4PMB A;  4OWW B;  3HOY B;  2QDB A;  1S5C D;  2AQ1 B;  3NWT A;  3DMU A;  4MTN A;  3T56 B;  1WTW A;  1LT3 D;  3P20 A;  4GLA C;  4A3L G;  2EYH A;  1J5E L;  2EJF C;  4EQ5 A;  4K5V A;  3EA6 A;  2L4N A;  4LK1 C;  3J7A F;  3EVQ A;  3SK4 A;  3D31 A;  2B2W A;  1U0L A;  1L2F A;  5F2D A;  3CP0 A;  4YHH Q;  1HPC A;  3OMG A;  3M3Y H;  3FP9 A;  4P75 A;  1M1K C;  2NN6 I;  5EAY A;  1BQQ T;  3T1H L;  4RCN A;  4DV0 L;  2WKC A;  3U4V A;  1OXV A;  3L2P A;  2ZJR A;  2F03 A;  4FF1 A;  3JC6 6;  5I2X A;  4MN3 A;  4A3J H;  1K28 A;  5KYI A;  3K6O A;  3GTQ H;  1KXL A;  4ZLT F;  5EPJ A;  3AFQ A;  4KJO A;  1RF2 D;  3A5U A;  1TWF B;  2EY6 A;  1JJ2 A;  3TDQ A;  2IWH A;  5GAH C;  2ENB A;  4KHP L;  1LM0 A;  4KHP Q;  2YU9 B;  4DV6 Q;  3KUP A;  3CKI B;  5EKL A;  2G5D A;  1IZ6 A;  1VQE A;  1BCP F;  2WAQ E;  4FO2 A;  1V9P A;  1SMY C;  1SE3 A;  3A8I E;  5C4H A;  2QIL A;  2AQ2 B;  5M3F H;  3CHB D;  2R92 B;  1GO3 E;  1V43 A;  4GOP A;  1XTC D;  4FF2 A;  3GDE A;  4V0B A;  1DCZ A;  1SXT A;  4BWG B;  4DPG A;  4JYA Q;  4BY1 H;  3GTO B;  3J80 c;  3T4A C;  1G29 1;  5CV5 A;  4A3L H;  1R4P B;  1CQF A;  4ZK9 B;  2O2L D;  4IPD A;  4DR3 Q;  1AN8 A;  4BY1 G;  4N8F A;  1HZA A;  4X62 Q;  2NZO A;  1OXT A;  5TSS A;  1FNV A;  5IGB A;  4A3B G;  1SR3 A;  2HDL A;  4C3H G;  4EX5 A;  3T1Y Q;  1G6P A;  1UEA B;  1A2U A;  1STH A;  1AP0 A;  3OHX C;  1WTP A;  1U5K A;  2NZ1 D;  2LMC B;  1T5X D;  3I70 A;  1K8A C;  1D5X C;  1K3B C;  3SXH A;  2ASB A;  1HZB A;  1W2B A;  2JA7 B;  2UUC Q;  1H95 A;  4JI5 Q;  3R3O A;  2XRQ D;  2B2U C;  4IAL A;  4LF7 Q;  1RJT A;  2QW7 A;  4Y7N B;  3BJU A;  1G91 A;  3TME A;  1VQF A;  3CF5 A;  2K01 A;  5L37 A;  1S5F D;  2F0F A;  1G2T A;  1E0B A;  4QL5 A;  4QJF A;  4UP9 A;  3Q24 A;  3S15 H;  3FKI G;  3RZD B;  2K52 A;  3NUC A;  4A3M G;  4X3T A;  3M4Y A;  4G7H C;  1PH9 A;  5AJ3 L;  3CC4 A;  2IL8 A;  3G6J B;  5K36 H;  1EIG A;  3PQI A;  4H7B A;  1I4H A;  1F77 A;  4BY7 G;  4A3M B;  1Y8O B;  3CCS A;  4UAI A;  1GHK A;  1H9S B;  1PA6 A;  1CSQ A;  3GV3 A;  2EYO A;  2F4I A;  4DK0 A;  4PMC A;  4GN3 B;  2NVY B;  3ND9 A;  4DXG A;  1Y1V B;  5D14 A;  4WJ4 A;  4QIW B;  5CV6 A;  4DR3 L;  1JWS D;  2WV6 D;  2WAQ G;  3OWE B;  2VXW A;  3GV6 A;  2K03 A;  2QEX A;  1E22 A;  2XIW A;  3F1Z A;  4LFB Q;  4BA1 I;  2L1B A;  3CRK C;  1D6E C;  1QCB D;  4GLV B;  3G7L A;  2CQA A;  4DNT B;  1RIP A;  3BDC A;  5DAU A;  3GTJ B;  3M9B A;  3NBH A;  5LMN W;  3HEJ A;  2PQA B;  4KLK A;  1PH2 A;  2B8G A;  3CW2 C;  1EYC A;  3DWA A;  3NPP A;  3CQZ B;  1EY5 A;  3W1B A;  2F4V L;  2R93 B;  1X3P A;  3CC7 A;  3CCJ A;  2OCE A;  1PFS A;  3BDO A;  3L0O A;  1FNW A;  2JA8 B;  1SMX A;  4I65 A;  4P74 A;  1VQO A;  2J7Z A;  4IQZ A;  3AEV A;  1SYC A;  1SMY D;  4O1N A;  4JI2 L;  2C5C A;  3MXU A;  4PQX A;  3D6W A;  3UE1 A;  2RA4 A;  2R7Z G;  1RHP A;  3H3V H;  1CKN A;  5CMD A;  3NBH B;  4RHS A;  2JK8 A;  3J81 E;  1TS5 A;  2E2H H;  4ULL A;  1TWG H;  2JN4 A;  3DHQ A;  4KJN A;  2HHH L;  5E3F A;  5COR A;  2Q2H A;  3WOE A;  5DEH A;  3HOZ G;  1D5Z C;  4LAA A;  1KHI A;  1KDC A;  1PYB A;  1DON A;  2F0D A;  3A7L A;  1B4O A;  3PGZ A;  1IL2 A;  4A3D B;  1I6H B;  3EJI A;  2F0M A;  2F0N A;  1Y14 B;  4ZRZ A;  1EU4 A;  4N9P A;  2HQE A;  1PVO A;  3PIO A;  5CV7 A;  2LY7 A;  1DXM A;  1Z47 A;  5I4D A;  3EFX D;  5FLM G;  5I9P A;  4WOR A;  4BXX G;  1D8L A;  4CKE A;  3DWQ A;  2BE5 D;  4RFB A;  4L5T A;  5AFW A;  3X3M A;  1PHJ A;  3PO2 B;  3AQQ A;  3SHL A;  2EY1 A;  1STN A;  5JAV A;  2ZJQ A;  1Q1E A;  4HAE A;  3ICE A;  3S2H H;  1FVI A;  1N36 L;  3HOX B;  4MNO A;  4ZKC B;  3E3X A;  2V4D A;  4FF4 A;  4IN3 A;  1R9T H;  1LT6 D;  1MSG A;  4YWM A;  3R8B A;  5IT9 c;  3I90 A;  4DAV A;  3DEP A;  4L63 B;  1NAP A;  3R2T A;  2WP8 J;  2Q8R E;  2QCP X;  3HS0 C;  4RKB A;  1BNZ A;  1Z7T A;  2K1B A;  1CKM A;  5J22 A;  4LF8 L;  3A55 A;  1PZI D;  5EPL A;  4QUC A;  1X54 A;  4DV4 Q;  1LAC A;  2F0G A;  4A3E B;  1I3Q H;  1ZYR D;  2YV5 A;  2Z6K C;  4HJ8 A;  4KY5 A;  1K8O A;  2CFM A;  2HIV A;  4K6D A;  5ELO A;  4HJ9 A;  5FK9 C;  2EJG C;  4OIK A;  1DZ1 A;  1QJO A;  2MO1 A;  4R1J A;  3HOY H;  3C1E A;  4R4I A;  4IFD H;  5M3F G;  4QB4 A;  3KOJ A;  1HFN A;  2QKI C;  3CCL A;  1I94 Q;  1Q7Y C;  1HR0 Q;  2QGQ A;  4ME3 A;  4WRD A;  3IAY A;  1XMO L;  4A3K G;  3AMU A;  1K0S A;  4OWT B;  4IJH A;  3L7Z C;  1BVS A;  1H9S A;  4FXD A;  4GLX A;  4H44 C;  1KLG D;  5ELD A;  4A3I B;  3UDF A;  1TY0 A;  1WCM B;  1KRS A;  3VYS A;  3PO3 B;  1JOO A;  5ISR A;  2RKS A;  1KDB A;  1CFM A;  2XN9 C;  4G4K A;  3M3Y B;  1NMF A;  5C44 H;  2F0E A;  3CC2 A;  2NVQ B;  3K0X A;  4JC0 A;  4OGQ C;  2F0H A;  3MXP A;  1IYU A;  1F2Z A;  3RD4 A;  5M5Y B;  4DR4 L;  1PV4 A;  2L11 A;  4K0K L;  1E2Z A;  2XTI A;  2AUJ D;  5ELF A;  2K75 A;  4HMI A;  3FPP A;  3H91 A;  3TQY A;  4LUZ A;  4K8I A;  1D1I A;  3WWV A;  4Q5V A;  1HNX Q;  2MUY A;  1FR3 A;  1EWC A;  1E2W A;  3A8J E;  1PH4 A;  5CYU A;  1I4X A;  3BVZ A;  4IUV A;  3Q6S A;  3M4P A;  4RAU C;  1ESR A;  1X3G A;  4H13 C;  5IYD H;  4F88 A;  1KDA A;  2R92 H;  1LTR D;  4A3J G;  2VUM B;  3J81 i;  5IP7 G;  4IJL A;  2Y0S G;  4DV1 L;  4MHE A;  3SK5 A;  5IGF A;  1U4M A;  1XX8 A;  2JA5 B;  1WOC A;  2D5D A;  3SVM A;  2K5V A;  5C4X H;  1UE5 A;  1XNQ Q;  3S1N B;  4F87 A;  2Z9H A;  1PTO C;  5IE8 A;  1B1Z A;  4B9X A;  1IYJ B;  4C3I H;  1JOQ A;  1CK1 A;  3TP8 A;  4R8I A;  2KQ3 A;  2D0P A;  4F7X A;  4PG3 A;  1UEB A;  2PI2 E;  2Z4I A;  1TS3 A;  3C2P A;  4XT1 B;  1TS2 A;  4HSV A;  3DXJ C;  1I4Q A;  4DNR B;  1ASY A;  2JA9 A;  4A3F B;  4DKA C;  4OX9 L;  1VQ9 A;  4BA2 I;  4V19 0;  2EDG A;  1JQY D;  2Z8L A;  4RGN A;  1Q8K A;  3VR6 A;  2F0U A;  2VZA A;  3HOW H;  4IFD I;  4FF3 A;  1YVC A;  3UDI A;  2OQ0 A;  2F0W A;  1A3V A;  2VL6 A;  3VR3 A;  2UXC L;  2IHF A;  4AYB E;  2EYJ A;  5HGT A;  4KD3 A;  4LUV A;  3E0E A;  3KBX A;  3I91 A;  1B7Y B;  4LJZ C;  3W5O A;  1HH2 P;  2B63 H;  1C48 A;  4X3U A;  1NCV A;  4BBR H;  3CRL C;  1F9P A;  4ALP A;  2OQK A;  2K05 A;  2F0V A;  2E5L L;  3RLN A;  2IPK D;  1XMQ Q;  3HOU G;  4QCL A;  5IIF A;  5EBD A;  4HIM A;  5IP9 G;  2Z0S A;  1FJG L;  3E5S A;  2HCI A;  3H0G H;  3BZD B;  2DJF C;  3MFY A;  4P72 A;  4LFA Q;  1HXY D;  2NVT H;  1Y8N B;  2CWA A;  3EN2 A;  3CMA A;  4UY8 C;  1EIY B;  1Y1V H;  4FNF A;  1CKO A;  3I72 A;  2HUG A;  4Y52 H;  3HGB A;  4RGT A;  3S1M H;  1JC7 A;  3RLF A;  4RHR A;  2E74 C;  1EQV A;  3S14 B;  4WJW A;  3S17 H;  1SRO A;  2YYZ A;  3P7J A;  1YIT A;  1CA5 A;  1LT5 D;  1VS0 A;  3HOY G;  1GJX A;  4EQO A;  5E4W C;  2HCC A;  1H9R A;  2KOL A;  4DR5 Q;  5I6Y A;  3DM1 A;  2L0C A;  1JOK A;  4G7Z C;  4OO1 H;  3RLO A;  3CU7 A;  4IO9 A;  5IGD A;  1U4R A;  3OPO A;  3F2C A;  2E2I H;  5IYB G;  1ASZ A;  3K57 A;  1QUQ B;  4KY7 A;  4LF6 L;  3S16 H;  3HOV H;  3I3C A;  4QMG A;  4IFD J;  1DGS A;  1GUT A;  4JBK A;  1TY2 A;  1K0R A;  5BR8 L;  2I5M X;  1KD1 C;  5FO9 B;  1SLJ A;  2EY5 A;  3P75 A;  2VB2 X;  2E2D C;  4TQU S;  1TWH H;  2MNA A;  2R6G A;  3ITP A;  2XRS D;  2NTT A;  5COY A;  1NJI C;  1FGB D;  3A54 A;  2UUB L;  2J0T D;  2OXP A;  1F9S A;  2CKZ B;  4JI2 Q;  3NXW A;  4M1U B;  4DV2 L;  3RZO H;  1VMC A;  1Y1W B;  1DOK A;  2B2V A;  3K7A H;  3PUW A;  2OEO A;  4FXK C;  1X3F A;  1EY8 A;  4YCU A;  1M90 C;  2A6H C;  5EKI A;  4XYO A;  3FPU B;  3I4N H;  1U4P A;  1QZH A;  1A3T A;  1EY0 A;  1QVC A;  3LWE A;  2B2V C;  4DF7 A;  3I56 A;  1JJG A;  4CHT B;  3R2I A;  5KGU A;  3AU7 A;  1QNU A;  1TT2 A;  5M3M B;  2D9U A;  4JI8 L;  1KNA A;  2KJX A;  1X3E A;  4JW0 A;  1MJE A;  3V05 A;  2FHT A;  1I4R A;  3ERO A;  1B9N A;  2DGY A;  2X6L A;  4FDB A;  4OON A;  1HUM A;  4RH6 A;  2FIN B;  2IJ0 A;  3OYY A;  3VYR A;  1VF5 C;  2R7Z B;  4IUN A;  3GTL H;  1B50 A;  5JOB A;  4LF7 L;  3OTO L;  3ZJY C;  3OIQ A;  4OHJ A;  1X9N A;  1VQB A;  3HZX A;  3IL8 A;  1AW7 A;  1S4Z A;  2JA6 H;  4DUZ L;  2EIF A;  4JI8 Q;  2A69 C;  3FEW X;  1QIL A;  1LTS D;  2UUA L;  1VQJ A;  4JPB W;  1CZG A;  3FVQ A;  4DR2 Q;  4HMJ A;  5JVH 3;  4C1N I;  3K59 A;  1YNJ D;  4KY6 A;  4GS3 A;  2I46 A;  4CJ2 C;  2JA6 G;  1M8A A;  1S40 A;  5KYL A;  2UXD Q;  1XJV A;  1KQS A;  1XMQ L;  3IRB A;  4L5R C;  1DOM A;  3TP7 A;  1IBM Q;  1P16 A;  2Y0S B;  4OL7 A;  5JJK A;  3TP5 A;  1K8M A;  5J39 A;  5C5L A;  4JG2 A;  4OEL B;  2RF4 A;  4K5X A;  5GAD C;  4A3F G;  4C1N K;  2X6G A;  1E24 A;  5CBE E;  2CCZ A;  4LF4 L;  4C2M H;  3GTP B;  2A6E D;  1NSN S;  3NBI A;  2NWG A;  5IP7 H;  2F1M A;  2A74 C;  5GAG C;  2A69 D;  1K83 H;  4G57 A;  3PIO 3;  1HNW L;  3HOU H;  1EZ6 A;  4GN5 A;  4BY7 B;  1DM0 B;  1UE1 A;  4A3G H;  4FYD A;  1IBK Q;  1W6K A;  3L3O C;  3HKZ E;  4NXN L;  1SND A;  4NXN Q;  4CDE C;  3STB C;  1XTD A;  2RVL A;  1IKM A;  5C44 B;  1ZEQ X;  2JQO A;  1B3A A;  1AZP A;  3GTK B;  5CV8 A;  3OWF A;  3T16 A;  1UUP A;  3CCE A;  2BDN A;  3I8Z A;  4YHH L;  3J81 j;  4YCW A;  3PO3 G;  1XXG A;  4XQQ A;  3KDF A;  3SDZ A;  2EZV A;  2I0Q A;  4A93 H;  4GKJ L;  4ZQ3 A;  4CDD C;  4C3H H;  4YIJ A;  2F0P A;  3QJY A;  1MJC A;  1TWC H;  5ELB A;  3FDT A;  4JV5 L;  1KAA A;  5JPM C;  1Y1W G;  2PNR C;  4DR2 L;  1Q3L A;  4A3K B;  3FKI H;  5K5P A;  3KLS A;  2MHV A;  1HR0 L;  1L1O C;  2WII B;  1KC8 C;  1KAB A;  1MI2 A;  1EUJ A;  4NKL A;  1HTL D;  1RDP D;  1STE A;  2XNA C;  4J15 A;  2A8V A;  4K6L A;  1TXY A;  4RG1 A;  4DR6 L;  4GKK Q;  4A75 A;  2RDH A;  4GKK L;  1Y8P B;  4CJ0 B;  1YHB A;  3T53 B;  2JE6 I;  2MGS A;  1GUW A;  3OMC A;  2HQL A;  2VS1 A;  2DUD A;  4AH6 A;  4AIM A;  3HG9 A;  2SOB A;  1NNX A;  2N3S A;  2RHS B;  4ZUJ A;  1N32 L;  2Q2U A;  4DUZ Q;  2DY7 A;  1FL0 A;  3BYY B;  1VQI A;  2WB1 E;  1WTO A;  5LL6 X;  1EU3 A;  2PZW A;  3WDN A;  3JAM L;  5M5W B;  2KCT A;  1WCM G;  1PYS B;  5GQO A;  1BCP D;  2GA4 B;  1HNW Q;  2NN6 H;  1IL8 A;  5IYD G;  4JI5 L;  2XWJ B;  2K7V A;  5DLQ E;  1J5E Q;  2DY8 A;  2NYZ D;  2P5Z X;  4DR7 L;  5IGG A;  3RUZ A;  4JBM A;  1VQC A;  2JJQ A;  3TZD A;  4TRD A;  5IWA Q;  2SDF A;  4EVO A;  2UU9 Q;  1SFO H;  4B3R L;  2UU9 L;  3Q22 A;  2K5N A;  3PUV A;  1Y69 U;  3DWP A;  3VR4 A;  2EYP A;  1R4Q B;  3D8G A;  2MP1 A;  4KKT A;  5J3B A;  4X62 L;  1A15 A;  1EEI D;  5J1Z A;  1SAP A;  2TMP A;  3CCM A;  4DV6 L;  2RQX A;  4JV5 Q;  2HIX A;  1NMG A;  1XYI A;  4B9W A;  2YU9 H;  3TBI B;  5C6A A;  4X3K A;  1SYB A;  3ULJ A;  1IW7 D;  4BBS G;  3NWS A;  2PI2 A;  4EQN A;  1PXU A;  2UUC L;  1PLF A;  1PH5 A;  2K4K A;  2B63 B;  3K5M A;  3I73 A;  1LT4 D;  2IHE A;  3CQZ H;  2H4O A;  1C9O A;  3NQT A;  4R4Q A;  4CDC C;  3H15 A;  1GOZ A;  1SYE A;  4JI6 Q;  4BBS H;  1WD1 A;  2VUM G;  5EQ0 A;  3BVG A;  5C0X H;  2F0K A;  3I4O A;  5M9O A;  4BY1 B;  2SEB D;  1QNK A;  5NUC A;  4DR1 L;  2VQF Q;  3A7A B;  4RA8 A;  1B9M A;  1QB5 D;  2L9H A;  3QOJ A;  1SDF A;  5A35 A;  2EE1 A;  3PUX A;  4DAY A;  1TWF H;  1YHQ A;  1IBL L;  1WTH A;  1PFN A;  1GM5 A;  1V1P B;  1Q82 C;  1KLU D;  1NR2 A;  1O7L A;  5BN5 A;  1O7Z A;  4GKJ Q;  1PH3 A;  1CI3 M;  4LFC L;  1E1T A;  4HCE A;  1I4P A;  5KIX A;  4HN7 A;  1RTN A;  3U58 A;  2L5T A;  1B3Q A;  4DR7 Q;  5C3X A;  3O13 A;  3S17 B;  3J80 E;  3PF4 A;  1U9R A;  4KKU A;  1HZ9 A;  4K2K A;  1YNN C;  3KF6 A;  2NTS A;  4DXF A;  2OWO A;  2WB1 G;  2EXD A;  5IY0 A;  1T5E A;  2NUC A;  1EY7 A;  2ZXR A;  4NW2 A;  1CA6 A;  1CSP A;  1GUS A;  4LFB L;  4ZAI A;  4QGU A;  1QVF A;  1YJ9 A;  3AFP A;  1BCP C;  1LUZ A;  1EQQ A;  5IOC A;  4A3I G;  3F2D A;  3S15 B;  4O42 A;  3RZD H;  2MPM A;  2RHQ B;  3PO2 H;  2RDG A;  1FJG Q;  3OOC A;  2YTX A;  5JVG 3;  3S2D H;  1ILQ A;  1X55 A;  3OW7 A;  2E2J B;  1F9R A;  1A63 A;  1GVP A;  5GAE C;  2NVX B;  1IXR A;  3N6R A;  4I7Z C;  3BS1 A;  2M9V A;  2AWN A;  3M4O B;  3C46 A;  5C4J B;  4XIG S;  3ND8 A;  4BXX H;  1TR5 A;  4GNX B;  4NXM Q;  2JA7 H;  3LX0 A;  3VYU A;  2ZT9 C;  3RZO B;  4FVM A;  5FLX L;  4YY3 Q;  1NUC A;  2XWB B;  3PMF A;  4XQN A;  1ENC A;  1PRT F;  5IWA L;  1CUK A;  1QUQ A;  5IGC A;  1XWE A;  3DUZ A;  4ME5 A;  1VF7 A;  3T51 B;  3I4N B;  3S1R H;  2R7F A;  5C4Z A;  1S3O A;  3F8T A;  3HFZ B;  1STG A;  1VQA A;  4FXG C;  4I7A A;  1I94 L;  5BN3 A;  4X64 Q;  4AYB G;  1STY A;  2IW3 A;  4P2C B;  4JI0 L;  3GTG H;  2JA8 G;  4B3T L;  2PQE A;  1W3S A;  3SEB A;  3S1Q B;  2VNU D;  3MEF A;  1N33 Q;  1CQV A;  5JJI A;  3GTJ H;  2A1A A;  2F0J A;  2JXM B;  2R7Z H;  3S24 A;  4A3G G;  2UUB Q;  1HQR D;  2R93 H;  3GTM H;  1YHA A;  1DOL A;  1VMP A;  4ZYS A;  5C0X I;  3K7U C;  4IOC A;  3ULP A;  3T1Y L;  2MFI A;  1N34 L;  4K8J A;  3H09 A;  4K5W A;  2E76 C;  1W6J A;  4XQJ A;  4A3I H;  2L12 A;  1EIH A;  2B29 A;  1LAB A;  4X66 Q;  3WOF A;  3OTO Q;  3CCV A;  2F4V Q;  3EIV A;  2KBN A;  4CBV A;  2E2H B;  1NY4 A;  1XNQ L;  5JEA G;  3KJP A;  3K5N A;  1YI2 A;  3E6Z X;  2ZTC A;  2IT1 A;  4LUO A;  1NBW A;  4A3D G;  1WI5 A;  1XPO A;  2CH4 A;  4L5S A;  2Q8I B;  2LFN A;  3GQB A;  4E6I A;  3JAM c;  1LTB D;  2WAC A;  4DK6 C;  1AEX A;  5D65 A;  2JA7 G;  2KEN A;  1B53 A;  2DJG C;  5FLM H;  1C7Y A;  2V1C C;  5DM6 3;  3LGJ A;  3HOX G;  3CAM A;  3D6C A;  4LF5 L;  2IX0 A;  5C3E H;  2ZJP A;  2B2T C;  1WTX A;  3U9S A;  1OXS C;  1P8L A;  1A62 A;  3NSW A;  1TWG B;  1IHZ A;  1EYD A;  3QIA A;  2DN8 A;  5C0X G;  2D2C C;  2G9D A;  5JJZ A;  1N33 L;  2M2L A;  1WTQ A;  2LS0 1;  3U9O A;  2JA5 H;  1DJR D;  1I5F A;  1VDZ A;  1V1O A;  1D5M C;  2RSN A;  3KLS X;  5C4X B;  1MHW C;  3MAQ A;  1IBK L;  4B3S Q;  1G6Z A;  3NEM A;  1AE2 A;  4LW1 A;  2A73 B;  1PH7 A;  4IUT A;  1GUO A;  2VB3 X;  2VQE Q;  1N8R C;  2JEA I;  1PTO D;  1WTR A;  3MZ5 A;  4GNX C;  2LKV A;  1EYG A;  4XYQ A;  1S5D D;  3A8K E;  1TWC B;  2K14 A;  4C3J H;  4HJA A;  1HRJ A;  2NBF A;  1UE7 A;  1PZJ D;  4NP5 A;  2AKW B;  5C5M A;  4IUQ A;  1EQT A;  1I3Q B;  5IYC H;  1JWM D;  3KFU A;  1LTL A;  4X65 Q;  4IUP A;  3DM3 A;  2Z4H A;  3GTQ B;  5EPK A;  1WVL A;  3S2H B;  2B39 A;  3MXN B;  5ELC A;  2PPB C;  3TSS A;  1A2T A;  5C4X G;  1QOH A;  3HOW B;  4L5Q A;  1D2B A;  1O7Y A;  2Z1C A;  1TVX A;  4L6T B;  5K36 G;  2GVA A;  4LFC Q;  5BR8 Q;  5FKA C;  1GUN A;  1BDO A;  2F0O A;  4JCV E;  4P73 A;  3JAM i;  4DV5 L;  4R4C A;  2PZU A;  1HNZ L;  1SN8 A;  2R3Z A;  4B3M Q;  3JAM E;  4KD4 A;  5IYB H;  5M3F B;  2BA0 A;  2BDO A;  2EQS A;  3PIP 3;  5M5W H;  4IPG A;  1Z6H A;  4BBR G;  4HED A;  4QQB X;  2K32 A;  2KEC A;  1FYC A;  4X64 L;  1ET9 A;  4A3J B;  4CKC A;  2NVQ H;  4XXE A;  2G9H D;  2ICE C;  3KF8 A;  5M5Y H;  4NPS A;  3AYH B;  2K5H A;  1EFW A;  2Z6B A;  2A68 D;  3TRZ A;  3D4W A;  1QE6 A;  1N9W A;  1K9M C;  1HR0 W;  4PZ7 A;  1JMC A;  4DR6 Q;  4S3S A;  1II3 A;  1VQL A;  2KCC A;  2N78 A;  4HSP A;  1SE8 A;  1FGU A;  3A5Z B;  3E9I A;  3PF5 A;  1LV9 A;  2VQE L;  2K28 A;  3N52 A;  4MIU A;  5E1F A;  1GD7 A;  5C0X J;  4LF5 Q;  1BUV T;  3HOZ B;  2WIN B;  4DV3 L;  1JB3 A;  4A93 G;  3VR5 A;  3PO3 H;  3A56 A;  4NMZ A;  4OEM B;  2ZTD A;  2EPB A;  1MGS A;  3FHW A;  1ILP A;  2N8N A;  3GTO H;  1ICW A;  2EXZ A;  2KED A;  3NEN A;  1K3R A;  3K8A A;  1M4V A;  1B44 D;  2B63 G;  1K8G A;  5ELE A;  2F3I A;  4BBS B;  1HQM C;  2UXC Q;  2Y0S E;  1VQN A;  2ZTE A;  3I7F A;  4O2D A;  4OO1 I;  1E7Z A;  4RGM A;  1WYD A;  2A6E C;  1BBX C;  2F0S A;  4KHZ A;  1TWH B;  1SNQ A; 
#chains in the Genus database with same CATH homology
 2UUA Q;  4GOP C;  4BXX G;  1D8L A;  5M5X H;  1HR0 L;  4DV1 Q;  1L1O C;  3I4M H;  1KC8 C;  5JEA J;  4L5T A;  1PHJ A;  1EUJ A;  3PSI A;  1YEZ A;  4PZ6 A;  4DV7 L;  3AQQ A;  1LYL A;  1KRT A;  5FJ8 G;  3RNU A;  4J15 A;  2ZJQ A;  3S2H H;  1Q1E A;  2BH2 A;  3ICE A;  1Y1W H;  2A8V A;  1N34 Q;  1FVI A;  1N36 L;  3TRE A;  2E2J H;  2JA5 G;  1VQP A;  1TXY A;  4RG1 A;  4DR6 L;  3CCQ A;  4GKK Q;  4A75 A;  3GD7 A;  2NVX H;  1CKN B;  1EQR A;  4MNO A;  2CWP A;  4GKK L;  3M4O H;  4LFA L;  5AJ3 Q;  2QA4 A;  3VDY A;  1YHB A;  5C4J H;  4IOA A;  2JE6 I;  4A3F H;  5JJL A;  1R9T H;  2HQL A;  2VS1 A;  4YWM A;  1L1O A;  5IT9 c;  2DUD A;  4AH6 A;  4AIM A;  1JE5 A;  2MQH A;  1L0W A;  1A0I A;  4LWC A;  1Z9F A;  2ID0 A;  2N3S A;  2RHS B;  2WP8 J;  1N32 L;  2Q2U A;  1QVG A;  4IPC A;  4X6A H;  4A76 A;  4DUZ Q;  4XTC S;  2I5H A;  1FL0 A;  4B3S L;  1VQI A;  2WB1 E;  1CKM A;  4O0A A;  4JI3 Q;  4LF8 L;  1KL9 A;  1A8V A;  2KCT A;  4GN4 B;  2AMC B;  4GOP B;  1WCM G;  1VQ6 A;  1PYS B;  1X54 A;  2PQA A;  5GQO A;  4A4I A;  4DV4 Q;  1HNW Q;  4DR4 Q;  1I3Q H;  1HJP A;  5IYD G;  4JI5 L;  4DV2 Q;  1VQD A;  5DLQ E;  1J5E Q;  4DV5 Q;  1PH8 A;  2YV5 A;  3I4N G;  3I4M G;  1MKH A;  2Z6K C;  4HJ5 A;  4HJ8 A;  3D0F A;  4DR7 L;  4JBM A;  1VQC A;  2JJQ A;  3BU2 A;  3K81 C;  1B8A A;  2CFM A;  2MO0 A;  1KAW A;  2AWO A;  5IWA Q;  2HIV A;  4DR5 L;  2KHI A;  5ELO A;  3STB D;  1SFO H;  1Q81 C;  4HJ9 A;  2UU9 Q;  4B3R L;  4AQY L;  1BBU A;  2UU9 L;  1WJJ A;  2K5N A;  3PUV A;  1JT8 A;  5LMU Q;  2JA8 H;  2NZH A;  2MO1 A;  4R1J A;  4KI0 A;  3HOY H;  3RN5 A;  4R4I A;  4DV7 Q;  5M3F G;  1WFQ A;  1IBL Q;  3KOJ A;  1PH1 A;  3CD6 A;  3GTP H;  5J3B A;  3CCL A;  1I94 Q;  4X62 L;  1Q7Y C;  2I5L X;  1PH6 A;  1HR0 Q;  2QGQ A;  1E1O A;  4ME3 A;  4YWK A;  1SRU A;  1XMO L;  4A3K G;  4LNQ A;  3CCM A;  4OWT B;  3J7Z C;  4DV6 L;  2ZM6 Q;  4IJH A;  2R7D A;  1BVS A;  3L7Z C;  1YJW A;  2GVB A;  2IY5 B;  5IYC G;  4QY7 A;  5E7N A;  4JV5 Q;  2HIX A;  1J6Q A;  4GLX A;  1NMG A;  1Q46 A;  4JYA L;  2KCM A;  2YU9 H;  3UDF A;  3CME A;  4K0K Q;  1KRS A;  2L15 A;  3ULJ A;  1MIU A;  4JI6 L;  3PUZ A;  4DUY L;  4BBS G;  2D0O A;  2C35 B;  3U4Z A;  2PI2 A;  2OTL A;  2UUC L;  1PH5 A;  1NMF A;  5C44 H;  2B3G A;  3CC2 A;  4JI4 Q;  3S14 H;  2K4K A;  1Q86 C;  3K0X A;  1NTG A;  2Z6K A;  4JC0 A;  4NB3 A;  4JI4 L;  4NXM L;  4OX9 Q;  2IHE A;  3CQZ H;  1BKB A;  3OW2 A;  1C9O A;  5LMN Q;  4A3D H;  4JI7 Q;  4DR4 L;  4R4Q A;  3H15 A;  1I6H H;  5C44 G;  2F52 A;  4JI6 Q;  1PV4 A;  3S1Q H;  3ULL A;  4K0K L;  2UXB Q;  2Q2T A;  4BBS H;  2XTI A;  1L1O B;  2IX1 A;  2VUM G;  4JOI A;  3M7N A;  4JI3 L;  2FXQ A;  3I4O A;  2K75 A;  4DR1 L;  2VQF Q;  5M3M G;  3TQY A;  4HID A;  4LUZ A;  4A3E G;  3G71 A;  3PUX A;  1TWF H;  3HKS A;  3WWV A;  1YHQ A;  1IBL L;  3KF8 B;  1HNX Q;  3PV0 A;  5ELN A;  4UP7 A;  1D7Q A;  4A3B H;  3HOZ H;  5FLX c;  1GM5 A;  4MZ9 A;  1Q82 C;  3UDX A;  4GKJ Q;  1PH4 A;  3HOV G;  1PH3 A;  1VQM A;  4LFC L;  4B3R Q;  1E1T A;  4OXP A;  1RL2 A;  3HKZ G;  4HIK A;  3BZC A;  4DNI A;  3HOX H;  4DV0 Q;  2AHO B;  3M4P A;  3U58 A;  1X3G A;  2UXB L;  2R93 G;  5IYD H;  4UP8 A;  4DR7 Q;  3PCO B;  2H5X A;  2KHJ A;  3UE0 A;  2R92 H;  4A3J G;  3PF4 A;  3J81 i;  5IP7 G;  4IJL A;  3CXC A;  1VQH A;  3PUY A;  2Y0S G;  4DV1 L;  1HZ9 A;  3ERS X;  2E5L Q;  3E9H A;  5LMU L;  3KF6 A;  2UXD L;  2YTY A;  1WOC A;  2WB1 G;  2OWO A;  2EXD A;  4JI1 Q;  5IY0 A;  3PO2 G;  2K5V A;  5C4X H;  1UE5 A;  4Y7N H;  2VW9 A;  1XNR Q;  1XNQ Q;  1CSP A;  4LFB L;  4QGU A;  4PZ8 A;  1G51 A;  3J7A 5;  1VQK A;  1QVF A;  2D62 A;  1YJ9 A;  5IE8 A;  3AFP A;  4JBW A;  4WJ3 M;  2ZM6 L;  4PMW A;  5H1S E;  1LUZ A;  1EQQ A;  4A3E H;  4A3I G;  3F2D A;  1IYJ B;  4C3I H;  4H02 A;  3RZD H;  2RHQ B;  5M3M H;  2VQF L;  3PO2 H;  1FJG Q;  3KF6 B;  4JI1 L;  2A19 A;  2YTX A;  4DK3 C;  3S2D H;  2D0P A;  1X55 A;  3NEL A;  2PI2 E;  1UEB A;  4PG3 A;  3HOW G;  4YWL A;  3K80 C;  1A63 A;  1X65 A;  1GVP A;  5GAE C;  1XPU A;  1IXR A;  1GKH A;  4A3M H;  4LF6 Q;  1X56 A;  1VQ8 A;  1VCI A;  2AWN A;  4OWW B;  1ASY A;  2JA9 A;  4XIG S;  4BXX H;  4DKA C;  4GNX B;  4NXM Q;  3A0J A;  1VQ9 A;  4OX9 L;  2WFW A;  4OWX B;  4LF9 Q;  2JA7 H;  4MTN A;  4BA2 I;  4A3L G;  4GLA C;  1Q8K A;  1J5E L;  4YY3 Q;  2VZA A;  3HOW H;  1YIJ A;  4QIW E;  1HZC A;  4IFD I;  4HJ7 A;  5IWA L;  1YVC A;  4EQ5 A;  1CUK A;  1QUQ A;  3UDI A;  3T1H Q;  2NVY H;  2OQ0 A;  2VL6 A;  2UXC L;  3S1R H;  2R7F A;  2IHF A;  4AYB E;  3D31 A;  1S3O A;  4LUV A;  3E0E A;  3F8T A;  4RMF A;  1U0L A;  4A3B G;  1B7Y B;  1L2F A;  4YHH Q;  3CP0 A;  3HFZ B;  3W5O A;  1VQA A;  3M3Y H;  3A74 A;  3KLW A;  3FP9 A;  3G6E A;  1HH2 P;  1I94 L;  2B63 H;  4P75 A;  4BBR H;  4X64 Q;  4AYB G;  2NN6 I;  4ALP A;  5EAY A;  1M1K C;  4JI0 L;  2OQK A;  1S72 A;  3T1H L;  2ATW A;  2JA8 G;  3GTG H;  4B3T L;  1B70 B;  2E5L L;  1W3S A;  3RLN A;  4DV0 L;  1N32 Q;  1XMQ Q;  3HOU G;  1Y1V G;  3MEF A;  1N33 Q;  2VNU D;  4R4T A;  3TS0 A;  1YNX A;  4HIM A;  3GTJ H;  3U4V A;  5JJI A;  5IP9 G;  2A1A A;  2Z0S A;  2N49 A;  1OXV A;  3L2P A;  2ZJR A;  1Q1B A;  1FJG L;  2R7Z H;  3JC6 6;  3S24 A;  4A3J H;  3H0G H;  3GTQ H;  1KXL A;  4A3G G;  4TVA B;  1YJN A;  2UUB Q;  1OTC A;  4P72 A;  4LFA Q;  3AFQ A;  2R93 H;  2LXK A;  3GTM H;  1YHA A;  2NVT H;  4UPA A;  5C0X I;  3K7U C;  4JBJ A;  4IOC A;  3ULP A;  2CWA A;  3A5U A;  2MFI A;  2BA1 A;  3T1Y L;  1N34 L;  4POG A;  1JJ2 A;  5IP9 H;  3EN2 A;  5GAH C;  3CMA A;  4UY8 C;  1EIY B;  1Y1V H;  4KHP L;  1LM0 A;  1CKO A;  3ER0 A;  4KHP Q;  4A3I H;  4DV6 Q;  4Y52 H;  2B29 A;  4X66 Q;  3OTO Q;  1IZ6 A;  3S1M H;  3CCV A;  1V1Q A;  1VQE A;  2WAQ E;  2F4V Q;  1V9P A;  3RLF A;  4DAY B;  3EIV A;  2KBN A;  2RCN A;  5M3F H;  4BY7 H;  3S17 H;  1NY4 A;  1SRO A;  2YYZ A;  4P71 A;  1XNQ L;  5JEA G;  1GO3 E;  3KJP A;  1YIT A;  1Q12 A;  1XNR L;  2VUM H;  1YI2 A;  2VY3 A;  1VS0 A;  4LF4 Q;  1V43 A;  4GOP A;  3HOY G;  2ZTC A;  2LSS A;  4POF A;  2IT1 A;  3GDE A;  4DR5 Q;  2GN5 A;  4LUO A;  1NBW A;  4A3D G;  1WI5 A;  1NE3 A;  1XPO A;  5FJ8 H;  3RLO A;  4IO9 A;  4DPG A;  4L5S A;  4JYA Q;  4LF9 L;  4BY1 H;  3J80 c;  1G29 1;  1UE6 A;  3F2C A;  3EBE A;  2E2I H;  5IYB G;  1ASZ A;  3JAM c;  4A3L H;  1QUQ B;  3J80 i;  3S1N H;  1TWA H;  4DK6 C;  4IPD A;  4DR3 Q;  4LF6 L;  2JA7 G;  3S16 H;  2KEN A;  4BY1 G;  3HOV H;  5HGQ A;  1HZA A;  4X62 Q;  4IFD J;  2NZO A;  1OXT A;  1DGS A;  1VQG A;  1OXX K;  1K73 C;  4OO1 G;  5FLM H;  1C7Y A;  4JBK A;  5BR8 L;  2V1C C;  1K0R A;  1EWI A;  2I5M X;  3M4Q A;  1SR3 A;  1KD1 C;  3LGJ A;  1SLJ A;  3HOX G;  3CAM A;  4EX5 A;  1T9H A;  4LF5 L;  2IX0 A;  5C3E H;  2ZJP A;  4TQU S;  1TWH H;  2MNA A;  3T1Y Q;  4A3C G;  2R6G A;  1HNX L;  1G6P A;  1OXS C;  1P8L A;  1U5K A;  1A62 A;  1JB7 A;  1K8A C;  1HNZ Q;  3CCU A;  2LXJ A;  3I55 A;  1NJI C;  2UUB L;  5C0X G;  2CKZ B;  4JI2 Q;  4DR1 Q;  2ASB A;  1HZB A;  1W2B A;  2UUC Q;  1H95 A;  4DV2 L;  4JI5 Q;  2ALY B;  3RZO H;  1N33 L;  3CPW A;  3B6Y A;  4DV4 L;  3K7A H;  3PUW A;  2JA5 H;  1I5F A;  1VQ4 A;  1X3F A;  2Q2I A;  4YCU A;  4LF7 Q;  1AE3 A;  1M90 C;  3GTK H;  2BH8 A;  2HT1 A;  4JI0 Q;  3BJU A;  4GNX A;  1X6O A;  4DV3 Q;  1IBK L;  1VQF A;  4B3S Q;  3CF5 A;  1QZH A;  3I4N H;  1QVC A;  1XMO Q;  3NEM A;  4QL5 A;  4QJF A;  4UP9 A;  3I56 A;  1AE2 A;  4LW1 A;  3CCR A;  3H0G G;  1PH7 A;  1JJG A;  2R92 G;  2VQE Q;  3FKI G;  3UDG A;  3S15 H;  1N8R C;  2K52 A;  2JEA I;  3W1G A;  4A3M G;  1UWV A;  2K50 A;  4GNX C;  1EYG A;  1YZ6 A;  3KDF B;  3F2B A;  2K14 A;  4JI8 L;  1MJE A;  1PH9 A;  1X3E A;  5AJ3 L;  4C3J H;  4HJA A;  3CC4 A;  1UE7 A;  4A3K H;  4HIO A;  2AKW B;  2DGY A;  4FDB A;  4BY7 G;  3TS2 A;  4OON A;  3CCS A;  2JEB I;  1KIX A;  3BZK A;  4R4O A;  3OYY A;  5IYC H;  3KFU A;  1LTL A;  4X65 Q;  3DM3 A;  4IPH A;  3GTL H;  1E3P A;  3MXN B;  4JOI C;  4LF7 L;  1PA6 A;  5C4X G;  3OTO L;  1CSQ A;  3ZJY C;  4L5Q A;  1X9N A;  4GN3 B;  1VQ7 A;  5K36 G;  2GVA A;  4LFC Q;  1VQB A;  5BR8 Q;  1C0A A;  4WJ4 A;  2JA6 H;  4DUZ L;  2EIF A;  4X65 L;  4JI8 Q;  1BBW A;  4JCV E;  3CPF A;  4P73 A;  3JAM i;  3SGI A;  3J81 c;  4DV5 L;  4R4C A;  4DR3 L;  2WAQ G;  2UUA L;  2XGT A;  1VQJ A;  1HNZ L;  4DR2 Q;  1SN8 A;  3U50 C;  1E22 A;  2QEX A;  3F1Z A;  4B3M Q;  4LFB Q;  4BA1 I;  4GLV B;  4GS3 A;  5IYB H;  3KJO A;  2BA0 A;  2EQS A;  2JA6 G;  1S40 A;  5M5W H;  2NN6 G;  4YCV A;  1XPR A;  4IPG A;  2UXD Q;  1WCM H;  4YY3 L;  1XJV A;  1KQS A;  1XMQ L;  3IRB A;  4BBR G;  1RIP A;  4L5R C;  1IBM Q;  4QQB X;  1P16 A;  3M9B A;  5LMN W;  5JJK A;  3Q8D A;  3H3V I;  5GRO A;  2PQA B;  4KLK A;  4X64 L;  1PH2 A;  2NVQ H;  1AH9 A;  3CW2 C;  3DLL A;  1YBY A;  4JG2 A;  3W1B A;  3RN2 A;  2F4V L;  5M5Y H;  3AYH B;  4NPS A;  2K5H A;  3CC7 A;  2OCE A;  3CCJ A;  1EFW A;  1PFS A;  2RF4 A;  3RR5 A;  3TRZ A;  5GAD C;  3L0O A;  4IFD G;  1N9W A;  1K9M C;  4APV A;  4A3F G;  4PZ7 A;  1SMX A;  1HR0 W;  1JMC A;  4P74 A;  4DR6 Q;  1QZG A;  1VQO A;  1N36 Q;  2HHH Q;  1VQL A;  1E24 A;  2N78 A;  2CCZ A;  3AEV A;  4LF4 L;  3KYH C;  4C2M H;  3G4S A;  1SE8 A;  4JI2 L;  2ES2 A;  3G48 A;  1FGU A;  5IP7 H;  3A5Z B;  3E9I A;  2YTV A;  1O7I A;  3UE1 A;  3PF5 A;  5GAG C;  2VQE L;  2R7Z G;  1K83 H;  2PMZ E;  3H3V H;  1CKN A;  1HNW L;  2E8G A;  3NBH B;  3M85 A;  2CQO A;  2JK8 A;  1GD7 A;  5C0X J;  4LF5 Q;  3HOU H;  4GN5 A;  2E2H H;  1TWG H;  1UE1 A;  3GO5 A;  2HHH L;  4A3G H;  4DV3 L;  1IBK Q;  4LF8 Q;  4A93 G;  2Q2H A;  3HKZ E;  4NXN L;  3PO3 H;  4DAM A;  1JJC B;  1EIF A;  1EOV A;  2ZTD A;  4B3T Q;  3STB C;  4NXN Q;  1XTD A;  3HOZ G;  4JI7 L;  4AQY Q;  5LMN L;  1KHI A;  3FHW A;  2JQO A;  1PYB A;  3I2Z A;  2N8N A;  3GTO H;  3TEH B;  3CCE A;  2PNH A;  3NEN A;  1K3R A;  1OXU A;  3K8A A;  3PGZ A;  2B63 G;  1IL2 A;  4YHH L;  1IBM L;  4B3M L;  1K8G A;  1I50 H;  3J81 j;  4YCW A;  4DUY Q;  1Y14 B;  3PO3 G;  3KDF A;  2OTJ A;  2F3I A;  1VQ5 A;  2I0Q A;  4A93 H;  4GKJ L;  2UXC Q;  2Y0S E;  5C3E G;  1PVO A;  1VQN A;  2ZTE A;  3I7F A;  4O2D A;  4X66 L;  4C3H H;  3PIO A;  4A3C H;  5HY6 A;  1E7Z A;  4OO1 I;  1WYD A;  1Z47 A;  1MJC A;  1TWC H;  4JV5 L;  4KHZ A;  3PIP A;  1Y1W G;  5FLM G;  4DR2 L;  3FKI H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...