4OO1I

Structure of an rrp6-rna exosome complex bound to poly(a) rna
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
287
structure length
216
Chain Sequence
FQFPEIAYPGKLICPQYGTENKDGEDIIFNYVPGPGTKLIQYEHNGRTLEAITATLVGTVRCEEEKNILVSVLPGFANNLPKEGDIVLTRVTRLSLQRANVEILAVEDKPATFSVSQASSDLGETFRGIIRSQDVRSTDRDRVKVIECFKPGDIVRAQVLSLGDGTNYYLTTARNDLGVVFARAANGAGGLMYATDWQMMTSPVTGATEKRKCAKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/rna
molecule keywords Exosome complex component RRP45
publication title Structure of an Rrp6-RNA exosome complex bound to poly(A) RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 33
structure length 216
sequence length 287
ec nomenclature
pdb deposition date 2014-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF10447 EXOSC1 Exosome component EXOSC1/CSL4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4oo1I02
2.40.50.880 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4oo1I01
3K7AH 4NXNQ 3S14H 1TWHH 1V9PA 1BBUA 2DGYA 4J15A 3M9BA 2WB1G 2D62A 1VQ6A 2JEAI 4WJ3M 4HJAA 1EFWA 1W3SA 1HNXL 1SFOH 3CF5A 2UXDL 2JK8A 4R4CA 2BA1A 4NXNL 2RHSB 5IT9c 1JMCA 4GOPC 1D7QA 2B63G 2YYZA 4DUYL 4DV5Q 1KAWA 1L0WA 4FDBA 3HOXG 2R7ZG 2K4KA 4GS3A 2HHHQ 3TS0A 1IXRA 4DV5L 1HZAA 3HOXH 2PQAA 1TWAH 2JA5G 1XNQQ 1DGSA 5IP9G 2R7ZH 3HFZB 2YV5A 1VQFA 1I94Q 2HHHL 3H3VI 4B3RQ 1PH5A 3GTJH 3BZKA 2JA5H 4DV6Q 5IP9H 4R4QA 1XNQL 4JYAL 3CC7A 2RF4A 1I94L 1OXVA 3GTGH 2KHJA 4B3RL 2AWOA 5DLQE 4DK3C 4YHHQ 5BR8Q 4LWCA 4DV6L 3CMEA 1HR0W 3AFQA 1RIPA 1UE7A 4LFBQ 1X56A 3RR5A 3GTKH 4DK6C 3RN5A 4OO1G 2E2JH 1Z9FA 4KI0A 4YHHL 4DR5L 3HOVG 1WI5A 5C0XJ 5ELOA 3GTPH 3GDEA 3RZDH 3J7A5 1G291 3I7FA 3OYYA 2K75A 3TREA 3TS2A 1OTCA 3HOVH 3KLWA 3EN2A 4BY1G 1TWFH 4GN4B 4RMFA 4LNQA 1VQBA 1WOCA 4DV1Q 4R4OA 4X66L 4OWXB 4LF6Q 2WAQG 4P75A 3I56A 1X9NA 1E3PA 2KCTA 2JA9A 1K0RA 3M4QA 1YBYA 4P71A 1VQ4A 4BY1H 2F52A 1HR0Q 4P73A 4DV1L 3CC2A 1HNWQ 4JI2Q 2VUMG 3MEFA 4KLKA 2JQOA 4DR1Q 4A3IG 3PF4A 1VQLA 1KXLA 1D8LA 1HR0L 4YY3Q 3M85A 1HNWL 5K36G 3CPFA 3TQYA 4UP8A 3J7ZC 4LF7Q 2VUMH 2NZOA 3UDXA 4DR1L 1CSPA 4A3IH 4DR4Q 1NMGA 4YY3L 1L1OB 1YVCA 4MZ9A 4OONA 2Q2UA 1UE5A 3NENA 1QVFA 1P8LA 4DR4L 2NVXH 4OXPA 4BBRG 3PUXA 4QY7A 1Q7YC 1VQDA 4O2DA 3ULLA 2NN6G 1YEZA 1I50H 3CD6A 2WB1E 4IPCA 3T1YL 4BBRH 2RHQB 5M3FG 1A8VA 1XPOA 1PH6A 4JI1Q 5JEAJ 1W2BA 2WFWA 3IRBA 5M5XH 1EOVA 3UE1A 4NXMQ 4GLAC 5IYBG 5M3FH 3A74A 4DR6Q 2Q2HA 2VW9A 1YHQA 2H5XA 2E2HH 4JC0A 1YNXA 1NJIC 4NXML 1EYGA 1AE2A 3E9IA 5IYBH 2N8NA 3I2ZA 4DR6L 3F2CA 3M7NA 1PH7A 4ME3A 1K83H 4R4IA 3CC4A 2ZTDA 3ULJA 1VQ8A 4OX9Q 2OWOA 1K8GA 4JI5Q 1U5KA 1WCMG 1TXYA 3GTOH 4GNXB 4YCWA 2UUAQ 4C3HH 4AQYQ 3KJPA 1VQAA 3PO2G 4P74A 3RLFA 2KCMA 2JA6G 4MTNA 3G4SA 4QL5A 1VQOA 4A3FG 4L5SA 2GVAA 4HIMA 1N34Q 3PO2H 4PG3A 2JA6H 1UWVA 3E9HA 1KIXA 1IBLQ 4YWKA 4XIGS 4A3FH 4IFDG 5J3BA 3L7ZC 3SGIA 1M90C 1Y14B 1N34L 4A3MG 1I5FA 4LF8Q 4JI6Q 4IJLA 2ZJPA 3HOUG 1EUJA 3KOJA 4JBKA 1VQMA 1V43A 4X65L 1VQGA 2RCNA 5IYCG 2JA7G 4A3MH 1X54A 1QZGA 1JJ2A 1AH9A 2K52A 1X3FA 4JI6L 1H95A 2K5HA 1ASYA 5FLMG 5FJ8G 3HOUH 1Q86C 3G71A 3M4PA 4P72A 4A3CH 4JI0Q 5IYCH 2IT1A 2JA7H 3CCSA 3AFPA 1HH2P 1CKOA 4YWMA 2GVBA 1LTLA 3DM3A 3PUZA 5FLMH 5FJ8H 2VZAA 1CKMA 1AE3A 1LYLA 4DUYQ 4A75A 2LSSA 4JI0L 5C0XI 2AKWB 3K8AA 5ELNA 1PH8A 1KC8C 2XTIA 2XGTA 4BXXG 4QQBX 1K9MC 3CP0A 3J80c 3J81c 4AYBG 5EAYA 4LFAQ 3OTOQ 2B63H 1YITA 4BXXH 3ICEA 2F4VL 2B3GA 3CXCA 2VNUD 1Q82C 4IJHA 1OXSC 3JAMi 4JYAQ 3A5UA 4HJ8A 1JE5A 3OTOL 4LFAL 1SROA 5LMUQ 5IP7G 3M4OH 4OWWB 1A0IA 3A0JA 1N33L 3F1ZA 2HIXA 1N32Q 1I3QH 1BVSA 5LMUL 5IP7H 4IPDA 2B29A 1QUQB 3RZOH 1B7YB 2E5LQ 4NB3A 1QVGA 4DR5Q 1A63A 1N32L 2CQOA 2ZTEA 3S1RH 1C7YA 3CCJA 1JT8A 1PVOA 2OTJA 3PUWA 4DAYB 3D0FA 5IYDG 2E5LL 1GKHA 3F2BA 4NPSA 4IO9A 3FKIG 3PUVA 2MQHA 4C3IH 4DV0Q 3KFUA 1LM0A 4H02A 2VQEQ 3PIOA 4JI7L 4Y52H 4X66Q 5C4JH 2V1CC 2WP8J 5IYDH 2Y0SE 4IPGA 4APVA 3FKIH 5E7NA 4JV5Q 2NN6I 4DV0L 5M5WH 2OTLA 2VQEL 3CCQA 4JBMA 4X6AH 3BJUA 4GLXA 4LW1A 3W1GA 1VQJA 3CMAA 2IX0A 3HOZG 4JV5L 1HJPA 1QZHA 2FXQA 1X65A 3GTQH 1I6HH 4GOPB 1YJWA 4DR3L 4HIOA 3HOZH 1CKNA 1SE8A 2OQ0A 3HKSA 4PMWA 4DAMA 4HIDA 2UXDQ 3NELA 2UUBQ 2A8VA 3H15A 3L2PA 2ID0A 1Q1BA 1X3GA 1FJGQ 2KENA 2PI2E 4EX5A 4GLVB 2UUBL 3F2DA 3STBC 3TRZA 1WYDA 4QGUA 4HIKA 1FJGL 3I55A 2ZJQA 5FLXc 2I5LX 4A93G 3T1YQ 1VS0A 3GO5A 3S1NH 4A76A 1SMXA 1XMQL 4YCVA 4IOCA 2YTVA 4A93H 2UXBQ 3H3VH 3L0OA 2ZM6L 4C3JH 2NVTH 4DV7Q 4BA2I 4IPHA 1CSQA 4DR7Q 1GD7A 1Y1VG 2QEXA 3D31A 4K0KQ 2EIFA 2UXBL 3U50C 4DV7L 3T1HQ 2CCZA 4DV3Q 1YHBA 1JJGA 5C44G 3CCVA 1Y1VH 4DR7L 1GM5A 3U58A 4K0KL 5JJKA 3EIVA 4JI4Q 3UE0A 1KD1C 3EBEA 1J5EQ 3T1HL 3KF6B 4A3EG 4DV3L 3ER0A 1J6QA 2UUCQ 4B3MQ 5C44H 1PH3A 4BBSG 1FL0A 3NBHB 3CCMA 1Q12A 2AHOB 1KL9A 3G6EA 4GKKL 4DPGA 4JI4L 4MNOA 1J5EL 4A3EH 3CPWA 2I5MX 2UUCL 4B3ML 3U4VA 4BBSH 4UPAA 1U0LA 2ASBA 4A4IA 1N9WA 1VQHA 4LUZA 1PV4A 1TWGH 2MO1A 1E1TA 1WCMH 1IYJB 5JJLA 2R93G 1C9OA 1K3RA 4DV4Q 1IBMQ 2Z6KA 4RG1A 1EWIA 1N36Q 1P16A 4PZ8A 4X64Q 4GKJQ 1VQ5A 4HJ5A 2R93H 1E7ZA 1T9HA 3TEHB 5IE8A 4DV4L 1IL2A 2A1AA 4X65Q 3VDYA 1SN8A 4A3KG 1QUQA 1IBML 1N36L 4IFDJ 1C0AA 3K80C 1HZ9A 4X64L 4GKJL 1VQIA 3AEVA 4PZ6A 1OXUA 1OXTA 1IZ6A 4A3JG 2CWPA 1TWCH 1Q81C 4A3KH 1ASZA 1PH9A 4IOAA 2R7DA 2WAQE 1VQ7A 5GAEC 4POFA 3ULPA 4BA1I 1NTGA 1YHAA 2VY3A 3H0GG 3STBD 4A3JH 4A3LG 2AMCB 3CAMA 2CFMA 2UU9Q 4DNIA 3HOWG 1NE3A 1O7IA 1NMFA 2VL6A 5GQOA 2MO0A 3H0GH 4JG2A 3KJOA 3NEMA 1R9TH 3CCRA 1S72A 4DR2Q 2I0QA 1SLJA 2UU9L 4A3LH 2YTXA 3HOWH 3GTMH 4OO1I 3CQZH 4L5QA 2MNAA 1MKHA 3W5OA 3BZCA 2F4VQ 4DV2Q 4DR2L 2C35B 5LMNW 4LF4L 2CKZB 1NY4A 2N3SA 3S15H 2UXCQ 3BU2A 2JEBI 5GAHC 4TQUS 4AH6A 4UP9A 3KF8B 4DV2L 1E24A 4LF5L 1SR3A 1N33Q 2UXCL 5C3EG 3S2DH 4YWLA 4PZ7A 3UDIA 1Z47A 3KDFB 1YIJA 1YZ6A 2CWAA 1L1OA 3PSIA 3S2HH 1SRUA 2YTYA 3OW2A 3I4NG 3HKZG 2NVYH 3PCOB 4X62L 5C3EH 1G6PA 5GROA 3JC66 1EIYB 4JCVE 3E0EA 3S1QH 4DUZQ 5M3MG 1PA6A 3I4NH 1E1OA 2VS1A 5LMNQ 4KHPQ 5M5YH 3HOYG 3I4MG 4A3DG 4DUZL 4KHZA 2GN5A 4GN5A 5M3MH 2N78A 4JI7Q 1UE1A 2ATWA 1PYBA 5GAGC 5LMNL 3FHWA 2IX1A 3S1MH 4KHPL 3LGJA 4L5RC 3HOYH 2Q2TA 2OCEA 3I4MH 4A3DH 3S17H 1L1OC 2NVQH 1XPRA 1S3OA 4QIWE 2D0PA 4DKAC 4A3CG 1OXXK 2OQKA 5GADC 2LXKA 3Q8DA 5C4XG 2D0OA 3FP9A 3KF6A 4DR3Q 3WWVA 1HNZQ 4OWTB 1K8AC 5H1SE 3PIPA 3K0XA 3I4OA 2K5VA 5IWAQ 4TVAB 5C4XH 1B70B 1WFQA 2N49A 4JOIA 4LUVA 3UDFA 3AQQA 2IHEA 3J81j 1HNZL 5C0XG 4GNXA 3CCLA 4LUOA 3RN2A 1KQSA 5IWAL 5BR8L 1XJVA 2ES2A 4JI8Q 1X3EA 2ZTCA 1NBWA 3G48A 4LFBL 1L2FA 2KHIA 3A5ZB 3RLNA 1JJCB 4JI8L 2IHFA 3JAMc 2HT1A 3K81C 1PH1A 4JI3Q 4POGA 3PUYA 3MXNB 1UEBA 1XMQQ 3CCEA 3CW2C 3UDGA 1YJ9A 1WJJA 1IBKQ 2PMZE 2DUDA 2ZM6Q 4JOIC 4JI3L 3S24A 1G51A 3PF5A 4GNXC 4LF6L 1B8AA 2ALYB 1IBKL 2R92G 1X6OA 1MIUA 4LF9Q 2EXDA 3KYHC 2YU9H 2K5NA 3W1BA 1RL2A 2K14A 1PH4A 4JI2L 2PQAB 4IFDI 2R92H 1YI2A 4LF9L 2I5HA 2JE6I 1FVIA 4BY7G 1XPUA 2R6GA 4AYBE 1EQRA 1VQKA 4LF7L 4GKKQ 2JA8G 1LUZA 2QA4A 2HQLA 2HIVA 4YCUA 1HZCA 4BY7H 4Y7NH 1VQCA 3PV0A 3B6YA 2KBNA 1VQ9A 3F8TA 2JA8H 1BBWA 1FGUA 1Q8KA 1X55A 4ALPA 2K50A 5JEAG 3HKZE 1XNRQ 4UY8C 2A19A 3RNUA 4L5TA 2PNHA 3PO3G 1EQQA 3GTLH 1KRSA 4A3GG 2Q2IA 4AIMA 4O0AA 2AWNA 2JJQA 1Y1WG 1XNRL 3KDFA 4A3BG 2Z0SA 1HZBA 4JI1L 3GD7A 3PO3H 4A3GH 1Q1EA 1GVPA 1QVCA 3AYHB 4UP7A 1JB7A 4A3BH 1Y1WH 1S40A 1Q46A 4HJ9A 4LFCQ 2ZJRA 4EQ5A 1MJCA 2EQSA 3J80i 1K73C 3J81i 1PHJA 3M3YH 2VQFQ 1MJEA 2IY5B 1PFSA 2MFIA 1CUKA 3CCUA 4LFCL 3PGZA 4JBWA 2Y0SG 1KRTA 1XTDA 1CKNB 4JBJA 5HGQA 5AJ3Q 2F3IA 2VQFL 3DLLA 4OX9L 4JI5L 2E2IH 2Z6KC 5JJIA 1V1QA 5AJ3L 5IY0A 2BH2A 4B3TQ 2UUAL 4AQYL 2E8GA 4GN3B 1VQPA 1E22A 4WJ4A 1PYSB 1UE6A 2BH8A 4HJ7A 3ERSX 4R4TA 1M1KC 1VQNA 1XMOQ 2QGQA 4LF4Q 1EIFA 4B3TL 4XTCS 2LXJA 4B3SQ 3RLOA 3S16H 1VCIA 4QJFA 1N8RC 2BA0A 4GOPA 1IBLL 1KHIA 1BKBA 2PI2A 1XMOL 4LF5Q 1YJNA 1VQEA 1GO3E 4B3SL 2L15A 4LF8L 5HY6A 1PH2A 2NZHA 3U4ZA 1A62A 3ZJYC 2R7FA 4R1JA 4X62Q 1HNXQ 4C2MH 3K7UC
chains in the Genus database with same CATH superfamily
3TBIB 4ZUJA 3M9BA 2D62A 3MXNA 3Q23A 1ENCA 4ZQ3A 1SFOH 4DN4M 2JK8A 2RHSB 5IT9E 5E3FA 1D7QA 2K05A 2F0NA 2YYZA 4O42A 2B63G 2EYFA 3AMUA 5CV9A 4FDBA 3HOXG 3OIQA 4QCLA 1YNND 4XQNA 4RCNA 2HHHQ 1RKNA 2RQXA 1HZAA 2R7ZH 2PQAA 1PLFA 1XNQQ 2B8FA 5IP9G 2YV5A 1VQFA 3H3VI 1PDQA 2B2TA 1BCPC 4R4QA 2F0UA 4JYAL 3CC7A 1I94L 2KHJA 4K2LA 4DV6L 5BR8Q 2EXZA 1EY6A 2FINB 4WJWA 1SNMA 1RIPA 3GTKH 4A3JB 4HR7B 4KI0A 3VA5A 3HOVG 1SE4A 1MHWC 4ME5A 3J7A5 1G291 3OYYA 3H94A 3G6JB 2F0WA 1XWEA 2B2WA 2L55A 3I56A 3MC0B 2F52A 1GJXA 5T1GA 5EPKA 2IX3A 4JI2Q 2VUMG 4KLKA 2JQOA 3PF4A 4NMZA 1HR0L 1GUTA 3M85A 1HNWL 2F0JA 1RJTA 3CPFA 3TQYA 3QIAA 5T1IA 3UDXA 1CSPA 1NMGA 1JOKA 1FYCA 3DUZA 1QILA 3W3AA 1CI3M 3PUXA 1FNUA 1WTWA 4O2DA 1YEZA 1QB5D 3CD6A 2BDOA 2K6AA 5I6YA 1LTTD 5KNDA 3S1MB 2D5DA 3HOXB 1A8VA 2M9VA 2TMPA 4JI1Q 1W2BA 2NN6H 1I4QA 4L6TB 1EYCA 3A74A 5CBEE 4DF7A 1AEXA 1AN8A 2PZUA 2VW9A 1KDCA 4JC0A 4NXML 2CH4A 1STNA 5IYBH 1LT3D 1PTOD 5C4XB 1EOTA 4DR6L 4ME3A 3VYRA 4DAPA 2ZTDA 2EYPA 5EBDA 3ULJA 1BBXC 3SK8A 1WCMG 5I6WA 3GTOH 4GNXB 2LMCB 2C9OA 2JA6G 3HOVB 3HGBA 4IUTA 4PMCA 1A3TA 3KLSX 2K04A 1N34Q 4HIMA 2F0LA 3T53B 1KIXA 1NR4A 1IBLQ 2M2LA 4IUVA 5ELEA 4IFDG 4A3FH 4A3MG 2ZJPA 1SYDA 3HOUG 1EUJA 1G2SA 3U9SA 4A3CG 4X65L 2HD3A 2J0TD 5IYCG 2O5JC 1AH9A 1X54A 4JI6L 1SDFA 1ASYA 5FJ8G 2JA7H 5CORA 2A6HD 1HH2P 3PUZA 5FLMH 4BWGB 1CKMA 1LTGD 4A75A 4BY7B 4Y7NB 3TZDA 1H9SA 1EYDA 3K8AA 2EVBA 2XTIA 1B2TA 4KY7A 1K9MC 3J80E 3J81E 4AYBG 3OTOQ 1YITA 4BXXH 2F4VL 4OHJA 2CW0C 4UHVA 2F0OA 3JAMi 1JE5A 4M1UB 1A15A 3A55A 4OIKA 5IGDA 4LFAL 5M9OA 5IP7G 3SDZA 4ULLA 1UAPA 1QOHA 3A0JA 3H91A 5I9PA 1N32Q 5CV8A 1BVSA 1D6EC 3QWNA 1QVGA 5CYUA 4DR5Q 3NWSA 2PO4A 2E5LL 3F2BA 4NPSA 3FKIG 2EYMA 4ZCKA 2KUMA 4KD3A 4X66Q 2V1CC 2Y0SE 3ND8A 2EPBA 1QNKA 1JQYD 2IX0A 3L9AX 3HOZG 1HJPA 3X3MA 4A3MB 2FXQA 1B3AA 3GTQH 1I6HH 1ZYRD 3DMUA 3K0YA 3HOUB 1CKNA 2OQ0A 4EQOA 4PMBA 2NUCA 3MWYW 3NELA 4C2MB 4ZKBB 1FJGQ 2PI2E 4EX5A 3QJYA 5FO7B 4IN3A 4OELB 2B2UA 1WYDA 3E6ZX 1PYWD 1Q8IA 2WB1B 1F9RA 1SYGA 3I55A 2HUGA 4A93G 3DWQA 5FLXE 3GO5A 4B9WA 4C3JG 4YCVA 2YTVA 2ZM6L 4IPHA 1CSQA 4CHTB 2QEXA 1SE3A 3A7LA 2EIFA 3GTJB 4K0KQ 4ZRZA 3T1HQ 5CV4A 2CCZA 1AFPA 3SXHA 3GTGB 5ISRA 4HTHA 1WD0A 3EIVA 3RZOB 5CMDA 3KF6B 4A3EG 4DV3L 2UUCQ 1J6QA 3DWAA 4B3MQ 1PH3A 1BF4A 1KL9A 3I3CA 4JI4L 4MNOA 1GHKA 1AZPA 4WRDA 3GTPB 4BBSH 3RZDB 2ASBA 4A4IA 2XVSA 1ICWA 3BS1A 1CTMA 1TWFB 5M5WB 1IYUA 5LL6X 3GQBA 1P16A 4X64Q 1STHA 4C1NK 1J9OA 3TEHB 1T9HA 4DV4L 1JOOA 3BDCA 4XT1B 1IBML 2CH4W 1QUQA 5C5MA 2HCIA 2SNSA 3HOZB 4V0BA 4GKJL 4IFDJ 1MGSA 2KVMA 1IZ6A 1TS2A 3HS0C 1KDAA 5GAEC 3ULPA 4BA1I 1YHAA 3H0GG 3TP6A 4A3JH 4A3LG 2CFMA 1O7IA 1WTXA 4IUQA 4KV6A 4XQQA 3CCRA 4DR2Q 2UU9L 3CQZH 4L5QA 1DOMA 4M8AA 2WACA 3HG9A 1AP0A 3W5OA 5LMNW 4LF4L 1JWMD 2N3SA 2UXCQ 1E2ZA 5M5XB 1EU3A 1O7YA 4RKBA 4AH6A 4UP9A 2LKVA 4DV2L 4G7HC 4DNTB 1S5BD 3PSIA 1ESRA 1SRUA 4ZLTF 3OW2A 5ELFA 3OIPA 5GROA 1EIYB 2EYLA 4KY5A 1H9RA 4DUZQ 2JXMB 1PA6A 4C3HB 1VF5C 3I4MG 5M3MH 1TWGB 3RMHA 3Q0AA 3S1MH 4X3KA 4ZYSA 3LGJA 4QIWE 1C48A 5I4DA 2LXKA 2EY5A 1HNZQ 1B9MA 3NBHA 3I4OA 1KABA 5C4XH 4KTAA 1Y8OB 4LUVA 4B08A 3UDFA 5C0XG 4QUFA 5BR8L 1IL8A 2ZTCA 3BZDB 5JPMC 4K5WA 3H0GB 4RHRA 3BDLA 1STAA 2Z4IA 1TY2A 2IHFA 2HT1A 1RF2D 5BN4A 3JAME 1XMQQ 2SDFA 1UNSA 1H9SB 1YJ9A 1IBKQ 2PMZE 2DUDA 4JOIC 4JI3L 2LFNA 3I8ZA 2MUYA 4GNXC 3TP5A 1DZ1A 2PPBC 1X6OA 4LF9Q 1KTKA 2VB2X 1MD2D 1RL2A 1PH4A 4JI2L 4IFDI 2B8GA 2RDFA 1YI2A 1VF7A 1ET6A 1LT4D 1TIID 1SNPA 3I72A 1HTPA 4BY7H 1HZCA 3FVQA 5IGBA 4Y7NH 4HCSA 1BDOA 2AQ3B 3B6YA 3LX0A 3F8TA 3WOEA 4C56C 1VQ9A 1BBWA 4TKOB 3OMGA 4C3IB 2A19A 3I4MB 3NUCA 2PNHA 3S17B 3PO3G 1CFMA 5JEAH 1Y1WG 1HZBA 1PFMA 4JI1L 3GD7A 3LWUA 1QVCA 4I7ZC 4Q5VA 2ZJRA 5I9OA 2VQFQ 2IY5B 1CUKA 4LJZC 2EJMA 2Y0SG 2L0CA 5CC4A 1CKNB 1ZEQX 5AJ3Q 2EYJA 2XRQD 1STEA 1Q3LA 1V1QA 1TS4A 5IY0A 1VQPA 1E22A 2ENBA 2BH8A 1ENFA 4B3TL 4XTCS 2E2DC 2HQEA 5A2QE 1VCIA 4QJFA 4GOPA 1IBLL 1KHIA 2YU9B 1GO3E 1U4LA 2L15A 3EROA 2R7FA 4R1JA 1DONA 2SOBA 4C2MH 3K7UC 2DNCA 3D6WA 4NXNQ 2DGYA 4J15A 4DK1A 1EFWA 2UXDL 3CF5A 1DOKA 4JVZA 4OL7A 5IIFA 1JMCA 1RTOA 3PQIA 4XXEA 4X3UA 4CJ2C 4DV5Q 2K4KA 1YNJC 4H13C 2IL8A 3A8KE 1IXRA 4K6DA 3I73A 5EKKA 5EGTA 1U4PA 4B3RQ 5EKLA 1Y1WB 1GUNA 4ZK9B 3GTJH 1QCBD 2JA5H 4ZKCB 2RF4A 3M3YB 3GTGH 1Y8PB 2AWOA 5DLQE 2F1MA 1SAPA 4LWCA 1X32A 3CMEA 4KKSA 1S5FD 1UE7A 2F0GA 3RN5A 1Z9FA 4YHHL 4DR5L 1RTNA 5C0XJ 3MFGA 5CR3A 3GTPH 2B2TC 3RZDH 2DJGC 5COYA 5KIXA 2KOLA 2IPKD 4FNFA 4IURA 1I6VC 3EN2A 4BY1G 1TWFH 4LNQA 1VQBA 1WOCA 2WIIB 4R4OA 4X66L 4OWXB 4P75A 1X9NA 3P7JA 2JA9A 1YBYA 1VQ4A 4E6IA 4DV1L 1BNZA 1WTOA 3MEFA 1B53A 4DR1Q 4A3IG 1VQLA 4GZYC 5C3XA 3K7AB 4YY3Q 1GUOA 3S14B 1TWHB 5K36G 4FF2A 4LF7Q 2RBMA 4RWSC 2NVYB 1PFNA 1SXTA 1TT2A 2Q2UA 1CA6A 2A6HC 3TP8A 1F9PA 1P8LA 4DR4L 4BBRG 2K7VA 2F0QA 5M5YB 4QY7A 1VQDA 1SE2A 4CKBA 1FNVA 2WB1E 1BR9A 2RHQB 5M3FG 2BCOA 1S5DD 1PH6A 3IRBA 5M5XH 5K5PA 3PMFA 1ILPA 2K32A 2Q2HA 4K5XA 1SMYC 5BN5A 1ET9A 2K5QA 2L9HA 3F2CA 4KMUC 4R4IA 2BE5C 3CC4A 1L0XB 3C1EA 2OWOA 1U5KA 1TXYA 4YCWA 1EY0A 1XX8A 4HEDA 4C3HH 4AQYQ 3KJPA 3VR3A 2MP1A 4QL5A 4DA2A 3PO2H 5J39A 3L7ZC 3SGIA 1Y14B 4LF8Q 4IJLA 1FNWA 4JBKA 1A2UA 1LTSD 1VQGA 4R8IA 3IFDA 2J7ZA 4A3IB 4K6LA 2ZXPA 1Q86C 1PMRA 3M4PA 4FVMA 3AFPA 2VZAA 1AE3A 1LYLA 4JI0L 5C0XI 2JA8B 3MA2B 1HUMA 1H9KA 2F0VA 1WD1A 1G2TA 5LL6S 4CKEA 5EAYA 4JK1C 3ICEA 2B3GA 4RKLA 3CXCA 4IJHA 4RH6A 4Q0FA 1SROA 4J6HA 3M4OH 4A3BB 2ZT9C 3NQIA 2F0IA 3HZXA 5I2YA 3C3LA 5LMUL 1EYAA 4IPDA 4NB3A 2A68D 2CQOA 2ZTEA 2AUJD 1IYVA 1JT8A 1PVOA 2QF7A 4HMIA 5IYDG 3BVMA 1GKHA 4IO9A 4C3IH 2MQHA 3TP7A 3KFUA 4FXKC 2VQEQ 1F9SA 3T13A 3PIOA 4OO1H 3A8IE 1HFNA 5EQ0A 2NN6I 4DV0L 3Q24A 3CCQA 2O2LD 4JBMA 1XYIA 2ZXOA 4JV5L 4CDDC 1X65A 4GOPB 2UUBQ 1QNUA 2MHVA 1XTCD 3H15A 2AQ1B 3L2PA 1X3GA 2KENA 1GUGA 3QB3A 2MJ8A 3TRZA 4QGUA 4HIKA 2J4XA 4Z9CB 3T16A 2I5LX 1O7ZA 2WKDA 3IL8A 1VMPA 4A76A 1XMQL 2B63B 2UXBQ 3H3VH 3L0OA 1TWAB 3A56A 4DV7Q 4BA2I 3K5OA 1GD7A 1Y1VG 3U50C 4CJ0B 4DU9A 2B2UC 1JJGA 1YHBA 1EIHA 4DR7L 1EQTA 1FR3A 3ZYYX 3H3VC 3UE0A 5EPJA 1J5EQ 1D1IA 1EY4A 5C44H 1FL0A 3CCMA 2AHOB 4JW0A 5IODA 4QMGA 4DPGA 2A6ED 5FO9B 3U4VA 4RGTA 1VQHA 2A69D 5C4JB 1LT6D 1E1TA 2L4NA 4S3SA 1IYJB 2R93G 2XWJB 1LLRD 1B3QA 1N36Q 4PZ8A 2F0MA 5IE8A 2FMMA 2A1AA 5JAVA 4A3KG 1SN8A 3VYSA 3SE0A 1B9NA 2K33A 3K80C 1VQIA 4PZ6A 1OXTA 2EY1A 1LTAD 1Q81C 2EY2A 1PH9A 2VUMB 2WAQE 4F7XA 3STBD 2VY3A 3VR4A 3CAMA 2OF1A 3DEPA 4DNIA 3HOWG 1LABA 3K57A 5GQOA 3KJOA 1S72A 3URYA 2I0QA 1SLJA 5KRUA 1I50B 2MNAA 2NTTA 5IGCA 3P20A 1MKHA 4I7AA 3K59A 2NVTB 4IZ8A 1PRTD 2CKZB 5G3LD 1JORA 3BU2A 2JEBI 1F2MA 1E24A 5CV7A 5JPNC 1N33Q 3NQTA 2E2HB 3UDIA 5IOCA 2CWAA 1L1OA 2YTYA 3I4NG 1HRJA 3HKZG 1Q90A 2NVYH 1K83B 3PCOB 5C3EH 4KKUA 4JCVE 1TS5A 5HURA 5M5YH 2XRSD 4A3DG 4KHZA 4GN5A 1UE1A 1WCMB 5GAGC 5LMNL 4KHPL 1QE6A 2IX1A 5C6AA 3HOYH 2OCEA 3MXUA 2JA6B 2R93B 1OXXK 4KJOA 2Z9HA 2A5HA 3FP9A 4DR3Q 5KEEA 2FHTA 2F0PA 2K5VA 4A3KB 1B70B 4ILWA 3S9WA 2N49A 3CCLA 2F0TA 1T5EA 1KQSA 2K01A 5IWAL 1XJVA 2ES2A 4JI8Q 3GP7A 1X3EA 3G48A 5DM73 3A5ZB 4N8X1 1RHPA 3HOWB 3MXNB 1UEBA 4P2CB 3CW2C 3UDGA 1K8OA 3S24A 1G51A 1LV9A 2CHBD 2R92G 1CT1D 1PTOB 1MIUA 1M8AA 1EIGA 2EXDA 4AYBB 1D5XC 1SYEA 1JWUD 1D5MC 2PQAB 2DY7A 1I3QB 3R3OA 1XPUA 3S1QB 1EQRA 1VQKA 4LF7L 1DJRD 2QA4A 3HKZB 4F87A 4H7BA 2KBNA 2JA8H 1Q8KA 4XDXA 4ALPA 2LY7A 4UY8C 4LK1C 4A3DB 4FO2A 2NVQB 4A3GG 2Q2IA 5F2DA 1BCPD 2JJQA 3FKIB 1XNRL 3KDFA 1JICA 1GVPA 4A3BH 4HJ9A 2EQSA 1KNEA 3EVQA 1MBYA 2MFIA 4QF4A 4LFCL 3PGZA 1NAPA 2K28A 2RVLA 4JBJA 4DAYA 3WOFA 3MFYA 3DLLA 2JSOA 2Z6KC 2NYZD 1BO0A 1F9QA 4AQYL 2E8GA 3OMCA 3S1NB 1IW7C 1XMOQ 1EIFA 2LXJA 3RLOA 4A93B 1WTPA 4LAAA 4C3JB 1BKBA 2PI2A 2E75C 4JPBW 1YJNA 5BN3A 1EEID 4DAVA 4B3SL 4FP5D 4LF8L 3BVGA 2R92B 4O1NA 1PH2A 1A62A 2L11A 3ZJYC 5DEHA 1V9PA 2G9DA 4HAEA 3SK5A 1CM9A 1VQ6A 4HJAA 1HNXL 2B2VA 5IT9c 2BA1A 3PIP3 4GOPC 1G91A 4A3EB 3OHXC 5HGTA 1A2TA 3KBXA 2R7ZG 1II3A 1DXMA 3K6OA 1K0SA 1LO5D 4DGZA 3HOXH 1TWAH 4A3GB 3MTSA 3HFZB 2O4XA 1I94Q 2HHHL 3D4WA 3Q22A 1PH5A 3BZKA 1XNQL 4DV6Q 5IP9H 4F88A 2B2YC 4CDEC 3GV6A 1EY8A 1TWCB 4DK3C 4LFBQ 1X56A 4OO1G 1SNCA 3IKJA 1EWCA 1PZKD 2E2IB 1WI5A 3GDEA 3QO2A 3I7FA 3VYUA 3E3XA 1X3QA 2K75A 4RA8A 3HOVH 3KLWA 4X3TA 3MVVA 4RMFA 1SYFA 3R2IA 3S16B 2PYKA 4LF6Q 2WAQG 1RODA 3QOLA 3M4QA 3S15B 1HR0Q 4MIUA 1X3PA 4P73A 3CC2A 1HNWQ 3K5LA 4PNYA 4UDUC 2VUMH 3S2HB 2F0SA 2NZOA 2K1BA 4G7ZC 1L1OB 3NENA 1C4QA 1QVFA 1L0YB 5E1FA 1E2VA 4OXPA 1HPCA 4FF4A 1S5ED 3ULLA 5FK9C 2NN6G 2H4OA 1I50H 1SYBA 4QUCA 1STGA 1D1KA 1EOVA 1YNNC 4NXMQ 2ICIA 4GLAC 3L3OC 5IYBG 4XYOA 4DR6Q 2BOSA 1YHQA 2H5XA 2E2HH 1EYGA 1AE2A 2N8NA 2IJ0A 2CQAA 1CQVA 3M7NA 1K83H 1WTQA 1VQ8A 4OX9Q 2EJFC 3NPPA 4NDXA 1K8GA 1JC7A 4V190 2H1EA 2JYOA 2Z6BA 1PTOF 2Q8TA 5A35A 2UUAQ 4ZAIA 4P74A 4MTNA 2GA4B 1VQOA 4A3FG 2F03A 4L5SA 2SEBD 2JA6H 2F0EA 3E9HA 4UAIA 4YWKA 5J3BA 1M90C 2ICEC 2I07B 5D65A 2QDLA 3RD4A 1I5FA 4ABNA 1N34L 4JI6Q 3FRPB 4G57A 3KOJA 4IFDH 5NUCA 1VQMA 1V43A 2JA7G 4A3MH 1QZGA 1H95A 3HOUH 5FLMG 4P72A 4A3CH 5EPLA 5IYCH 2IT1A 3CCSA 1CKOA 2GVBA 1LTLA 5FJ8H 5IGGA 1MSHA 4DUYQ 1K3BC 4NP5A 4IUNA 2AKWB 5ELNA 2PQEA 1KC8C 4BXXG 2MPMA 3DXJC 3CP0A 3SEBA 4KJNA 3NXWA 3J80c 3J81c 3GTLB 1MSGA 1ENAA 1IHZA 3KBGA 4LFAQ 3FDTA 3X3NA 2VNUD 2EE1A 1PTOH 3PO3B 1OXSC 3A5UA 4HJ8A 3OTOL 1PRTF 5G3LF 3NTKA 1TKWB 2F3WA 1N33L 2RDHA 2L1BA 3F1ZA 2HIXA 1I3QH 5IP7H 3A54A 1QUQB 3RZOH 1B7YB 2E5LQ 1PTOC 2KEEA 3GTOB 1N32L 1HQMC 5TSSA 1EEFD 3MZ5A 3G7LA 2Y0SB 3E5SA 3F2UA 3PUWA 4DAYB 3MXPA 1LM0A 3DWPA 4H02A 3ITPA 4Y52H 1U4MA 4IPGA 3LNNA 4APVA 4A3FB 3FKIH 5E7NA 5M5WH 3J7YW 1SEBD 4X6AH 1V1PA 4GLXA 1HXYD 4LW1A 3W1GA 1VQJA 3CMAA 1QZHA 2F0DA 3BYYB 3DM1A 3D3RA 5CBAE 2PW5A 1YJWA 4DR3L 4FF1A 1JCKB 3HOZH 3HKSA 1O80A 4U68A 5L37A 2Z8LA 3FPUB 1JR0D 2ID0A 2JN4A 3N52A 3KK7A 4GLVB 2B2WC 3STBC 1K28A 1FJGL 3T4AC 5FLXc 1D2BA 3T1YQ 1VS0A 2SNMA 3S1NH 2C5CA 1UEAB 1SMXA 5KNCA 4CGYB 4BS9A 4IOCA 4A93H 1V1OA 2KCNA 4C3JH 1B4OA 2DY8A 2IW3A 2MGSA 3D31A 2TSSA 2D9UA 1JOQA 4DV3Q 3DHQA 1KLGD 4EVOA 1GM5A 2OT2A 2XIWA 3U58A 2KQ3A 2DN8A 4K0KL 5JJKA 4JI4Q 1R4QB 3T1HL 3ER0A 4BBSG 2X69A 4WFN3 3NBHB 2QEJC 2E2JB 4A3EH 3CPWA 2I5MX 2UUCL 4B3ML 4UPAA 1U0LA 1I4RA 1Z6HA 3EQLC 4LUZA 1EL0A 1PV4A 1TWGH 1EZ8A 4DV4Q 1IBMQ 4IUUA 4F8MA 4RG1A 1EWIA 1VMCA 2M00A 4GKJQ 4BY1B 1VQ5A 1DD2A 1E7ZA 1SNQA 3GTQB 1BCPF 1C0AA 3VR5A 4X64L 2NB0A 3AEVA 1OXUA 3KUPA 4A3JG 1ESFA 1TWCH 2R7DA 1QJOA 1ZYRC 4POFA 5DM63 2Z4HA 2UU9Q 3CHBD 5JOBA 1NE3A 3VA7A 3EFXD 2NWGA 1NMFA 2NVXB 2MO0A 3H0GH 2XN9C 2E76C 3NEMA 4A3LH 2BDNA 4OO1I 4BBRB 4DV2Q 4DR2L 1NUCA 5C5LA 1O78A 1NY4A 1RD9D 4KHVA 3S15H 1WTVA 5GAHC 1RDPD 4TQUS 2EJGC 1ML0D 5M3FB 4L63B 1SR3A 2UXCL 4PZ7A 5DAUA 3K5MA 1YZ6A 4X3SA 3CKIB 3S2HH 1GUSA 1QG7A 5KYLA 3FPPA 3W2DA 3JC66 4J1MA 3TMEA 5M3MG 4BBSB 1EU4A 1EQVA 2VS1A 1KAAA 1W6KA 3NBIA 4RFBA 4DUZL 2GN5A 1HA6A 4QIWB 4JI7Q 2ATWA 3FHWA 4C1NI 3P75A 4L5RC 3I4MH 3S17H 1L1OC 1XPRA 1LTID 2F0FA 1DM0B 3TN2A 2OQKA 5GADC 3D6CA 5C4XG 2D0OA 3KF6A 1CHPD 5LHY1 1K8AC 4MHEA 5H1SE 3K0XA 3PIPA 3OWEB 4TVAB 3NK9A 1SNDA 1STBA 1HNZL 3AQQA 2IHEA 2KJXA 4LUOA 1EY7A 3RN2A 4H44C 1NBWA 1BXTA 4LFBL 5C0XH 1B44D 2XSCA 1L2FA 2KHIA 2PMZB 1XXGA 3RLNA 2B39A 1JJCB 3T56B 3JAMc 1SNOA 3K81C 5C3WA 3CQZB 1V8QA 4JI3Q 4POGA 4RGNA 3CCEA 1O7LA 1WJJA 2DNEA 4KN4C 5KYIA 1F2LA 3PF5A 4LF6L 1B8AA 1IBKL 2YU9H 2K03A 3W1BA 1GOZA 2K14A 3UI2A 1K8MA 2VB3X 4LF9L 2F0HA 1FVIA 2JE6I 4BY7G 2QILA 5CGKA 1H9MA 4GKKQ 1QWYA 3K5NA 1ZKOA 1YNJD 4ODGA 3S1RB 2XNAC 5M3MB 1LTRD 4K8JA 1FGUA 1X55A 5JEAG 3QR8A 4RGOS 3SHLA 2N88A 1EQQA 4IALA 3GTLH 4O0AA 2QKIC 1G6ZA 2AWNA 4N9PA 2Z0SA 3PO3H 2RSOA 1I4GA 3AYHB 4UP7A 1UUPA 3I70A 1Y1WH 1S40A 1Q46A 1V1PB 3QOJA 4EQ5A 1MJCA 1K73C 3TZUA 3M3YH 1MJEA 1IKLA 3CCUA 5JVG3 2HCCA 5HGQA 5AFWA 2F3IA 1M4VA 2VQFL 2Z1CA 1JE4A 4OX9L 5AJ3L 4B3TQ 2UUAL 1ZXTA 1I4HA 4GN3B 4K14A 2EZVA 4WJ4A 1PYSB 2PZTA 1EY5A 5IT9L 1N8RC 3A8JE 2EDGA 4LF5Q 2R61A 5HY6A 3NP8A 2NZHA 1PZID 1U9RA 4X62Q 2UXDQ 1Y1VB 3V2TA 3K7AH 3VR6A 3S14H 1TWHH 1J8IA 1BBUA 1EY9A 2WB1G 2JEAI 4WJ3M 1W3SA 4HSPA 4R4CA 4NXNL 4TRDA 4DUYL 1FD7D 1KAWA 1L0WA 1F2YA 5J22A 4GS3A 2O5IC 4XYQA 3OSOA 3TS0A 2G9HD 4DV5L 1TS3A 2N55A 2JA5G 1DGSA 1SMYD 3ONAB 3C46A 1HA5A 3IAYA 2AQ2B 2B2VC 4NKLA 2XWBB 2OEOA 2BE5D 4YIJA 1OXVA 4B3RL 3HP3A 3OWFA 3EA6A 2F4IA 3I4LA 3SK4A 4YHHQ 2L12A 3EJIA 1HR0W 1E0BA 3AFQA 3RR5A 4DK6C 2E2JH 4RCOA 2VXWA 5JVH3 5ELOA 4K8IA 1R4PB 1R9TB 1CZWA 3TREA 3TS2A 1OTCA 3GTMB 5ELCA 4GN4B 4DV1Q 3D4DA 1E3PA 2KCTA 1K0RA 2R3ZA 4P71A 4BY1H 2OXPA 1F2ZA 5CV5A 5D3IB 3V96A 2HDLA 4DXFA 3R93A 4WORA 1KXLA 1D8LA 3S2DB 3OW7A 4UP8A 3J7ZC 4DR1L 4A3IH 4DR4Q 4TSSA 4DNRB 1B50A 2RCFA 2FFKB 1YVCA 4MZ9A 4YY3L 2HDMA 4OONA 5K36H 1TVXA 1I4PA 1UE5A 4OIJA 2F0KA 4FXGC 4RGMA 3I4NB 2NVXH 1Q7YC 3TDQA 3VYTA 4QB4A 1A3VA 3NHHA 1D5ZC 4IPCA 1G8ZD 3T1YL 4BBRH 1XPOA 2F3VA 3KF8A 5JEAJ 2WFWA 3UE1A 3NSWA 4PV1C 1S5CD 5M3FH 2JA5B 3H6MA 1H9JA 1DYQA 5E4XA 1KDBA 1YNXA 1NJIC 3E9IA 4L8JA 3I2ZA 3OPOA 3NE5B 1PH7A 1SJHD 2RDGA 4C3HG 1U4RA 4FYDA 1ONLA 1PFBA 1S4ZA 4JI5Q 4ID6A 4H0LC 1AZQA 5IGEA 1VQAA 5IGFA 3PO2G 3RLFA 2KCMA 5EJWA 3G4SA 3T51B 1PRTB 3CRLC 2GVAA 4PG3A 1UWVA 1Y8NB 3MAQA 4XIGS 5JJZA 2X6GA 2NBFA 3J80L 2RCNA 3J81L 1JJ2A 1NSNS 1X3FA 2K52A 2K5HA 1PZJD 3KLSA 3G71A 4KK7A 1F77A 4JI0Q 1VDZA 2L5TA 1NNXA 4YWMA 2QDBA 3DM3A 2PCFB 2LSSA 2PZWA 3SR1A 1KLUD 1AW7A 1PH8A 1E2WA 2XGTA 4MTKA 3BG3A 2EOTA 4QQBX 1TU2B 3K58A 2B63H 3BVZA 1WVLA 1BQQT 2JP1A 3PIO3 1Q82C 1CHQD 4JYAQ 3HEJA 5LMUQ 1WTRA 5CV6A 4N9TA 4OWWB 1A0IA 2Q8IB 1KNAA 1NCVA 1HHVA 2B29A 4FF3A 2E74C 3NTIA 1A63A 1HCZA 3AU7A 3CU7A 4C3IG 3S1RH 1C7YA 3CCJA 2OTJA 1I4XA 1HQRD 3D0FA 2P5ZX 2PW7A 1T5XD 2KEDA 3PUVA 4DV0Q 1Y69U 1JB3A 3PO2B 4JI7L 3R2TA 1CZGA 5C4JH 2WP8J 5IYDH 3ERQA 2QW7A 4JV5Q 2OTLA 2VQEL 1WTHA 1LACA 2KA7A 3BJUA 4KY6A 3C2PA 5D3DA 3FEWX 5FLXL 3P1HA 4HN7A 5D14A 3N6RA 4G4KA 4IQZA 4HIOA 2FJ2A 1SE8A 4DAMA 4HIDA 4PMWA 2A8VA 1Q1BA 3GV3A 1TR5A 1ILQA 3SVMA 2WV6D 5ELBA 1SFOB 2UUBL 3F2DA 2DJFC 4K5VA 3BYTB 2ZJQA 1BCPB 3C1FA 1W6JA 3BDOA 3A7AB 4XT3B 2R7ZB 2CW0D 2NVTH 1HUNA 4DR7Q 1EWHA 3M4OB 5FO8B 2UXBL 4DV7L 4FXDA 4G7OC 5C44G 2EY6A 1Y1VH 3CCVA 4LMQD 3J7AF 1RCVD 3EBEA 3O13A 1KD1C 2A74C 3GTKB 1Q12A 3H09A 3G6EA 4GKKL 2KHSA 5FKAC 4KKTA 2RKSA 1J5EL 2K5WA 3R8BA 2A68C 3SK6A 1N9WA 3KLRA 4DXGA 2MO1A 4KD4A 1B1ZA 1WCMH 3J7AV 1BUVT 2EYHA 5JJLA 1SJED 1C9OA 1K3RA 2Z6KA 5J1ZA 2Q8RE 4HJ5A 2R93H 2EYOA 1IL2A 4X65Q 3VDYA 2CVRA 2WAQB 5FOBB 1N36L 1HZ9A 3U9OA 2CWPA 4A3KH 1ASZA 3NTHA 4IOAA 1VQ7A 4CDCC 1MI2A 1SYCA 3NWTA 1NTGA 4IUPA 2AMCB 3E0JA 1EZ6A 2RSNA 3I91A 1TQOA 2VL6A 4JG2A 2KCCA 1R9TH 4NW2A 2YTXA 1CQFA 3HOWH 1LTBD 3GTMH 4MN3A 3IFTA 3BZCA 2F4VQ 2C35B 4RHSA 1ICFB 1C8CA 3KF8B 2NZ1D 4N8FA 4LF5L 1GXDC 4XQJA 5C3EG 3S2DH 4YWLA 1Z47A 3KDFB 3MHBA 1YIJA 3D4RA 3CRKC 2WINB 3VR2A 3Q6SA 4X62L 5C44B 4HCEA 1G6PA 3MXGA 3S1QH 3E0EA 2I46A 2B2YA 1EFID 3I4NH 1E1OA 5LMNQ 4KHPQ 5EKIA 5C4ZA 3HOYG 2N78A 1HTLD 1PYBA 4KN7C 2A6EC 1STYA 4EGVA 3HRZC 4R8NA 2Q2TA 4A3DH 2NVQH 1S3OA 4OEMB 2A69C 2D0PA 4DKAC 3Q8DA 1Z7TA 3JAML 3MEHA 2IWHA 4U673 3QG1A 3WWVA 1SSOA 4OWTB 4K2KA 5C4HA 5IWAQ 1WFQA 4JOIA 3J81j 2AUKA 4GNXA 3FMCA 2JA7B 2WKCA 3I90A 2V4DA 2ZXRA 1IW7D 4JI8L 2A73B 1PH1A 3PUYA 2D2CC 2RA4A 2FMCA 2G5DA 4PQXA 2ZM6Q 4OGQC 1SBBB 5EBCA 2X6LA 4CKCA 2ALYB 4I65A 4DFAA 3KYHC 2K5NA 1PRTC 2R92H 2I5HA 5C3EB 4DK0A 2R6GA 4AYBE 1A3UA 2JA8G 1LUZA 1GUWA 2HQLA 2HIVA 4YCUA 1VQCA 3PV0A 1CA5A 4EQNA 1OO9B 1DOLA 1PXUA 1TY0A 3WDNA 2K50A 3HKZE 1XNRQ 3RNUA 3HOYB 4L5TA 1IKMA 3TSSA 1BOSA 1KRSA 3DEOA 4EQPA 4AIMA 1DCZA 4ZUIA 4CDFC 4A3BG 4HSVA 1GHJA 4A3GH 1Q1EA 1JB7A 5DNFA 5E4WC 4CBVA 4LFCQ 3RUZA 5I2XA 1I6HB 3J80i 1NR2A 3M4YA 3V05A 3J81i 2PNRC 1PHJA 5A2QL 1CK1A 1PFSA 4JBWA 3M7GA 1KRTA 1XTDA 4R9WA 2LS01 3LWEA 3ND9A 2QCPX 4JI5L 2E2IH 4HMJA 5JJIA 1A6XA 2BH2A 3D8GA 2NTSA 2KECA 5ELDA 1FGBD 1LT5D 4J8QA 1UE6A 4HJ7A 3ERSX 4R4TA 1M1KC 1VQNA 2QGQA 4LF4Q 2K5DA 4B3SQ 4B9XA 3S16H 1JWSD 2BA0A 4CJ1B 1XMOL 4RAUC 1VQEA 5KGUA 5KNBA 3U4ZA 3AB9A 1HNXQ 3OOCA 1HFGA
chains in the Genus database with same CATH topology
3TBIB 4ZUJA 3M9BA 2D62A 3MXNA 3Q23A 1ENCA 1SFOH 4ZQ3A 4DN4M 2JK8A 2RHSB 5IT9E 5E3FA 1D7QA 2B63G 2F0NA 2YYZA 2K05A 4O42A 2EYFA 3AMUA 5CV9A 4FDBA 3HOXG 3OIQA 4QCLA 1YNND 4XQNA 4RCNA 2HHHQ 1RKNA 2RQXA 1HZAA 2R7ZH 2PQAA 1PLFA 1XNQQ 2B8FA 5IP9G 2YV5A 1VQFA 3H3VI 1PDQA 2B2TA 1BCPC 4R4QA 4JYAL 2F0UA 3CC7A 1I94L 2KHJA 4K2LA 4DV6L 5BR8Q 2EXZA 1EY6A 2FINB 4WJWA 1SNMA 1RIPA 3GTKH 4A3JB 4KI0A 4HR7B 3VA5A 3HOVG 1SE4A 4ME5A 3J7A5 1G291 3OYYA 3H94A 3G6JB 2F0WA 1XWEA 2B2WA 2L55A 3I56A 3MC0B 2F52A 1GJXA 5T1GA 5EPKA 2IX3A 4JI2Q 2VUMG 4KLKA 2JQOA 3PF4A 4NMZA 1HR0L 1GUTA 3M85A 1HNWL 2F0JA 1RJTA 3CPFA 3TQYA 3QIAA 5T1IA 3UDXA 1CSPA 1NMGA 1JOKA 1FYCA 3DUZA 1QILA 3W3AA 1CI3M 3PUXA 1FNUA 1WTWA 4O2DA 1YEZA 3CD6A 1QB5D 2BDOA 2K6AA 5I6YA 1LTTD 5KNDA 3S1MB 2D5DA 3HOXB 1A8VA 2M9VA 2TMPA 4JI1Q 1W2BA 2NN6H 1I4QA 4L6TB 1EYCA 3A74A 5CBEE 4DF7A 1AEXA 1AN8A 2PZUA 2VW9A 1KDCA 4JC0A 4NXML 1STNA 5IYBH 1LT3D 1PTOD 5C4XB 1EOTA 4DR6L 4ME3A 3VYRA 4DAPA 2ZTDA 3ULJA 2EYPA 5EBDA 1BBXC 3SK8A 1WCMG 5I6WA 3GTOH 4GNXB 2LMCB 2JA6G 2C9OA 3HOVB 3HGBA 4IUTA 4PMCA 1A3TA 3KLSX 2K04A 1N34Q 4HIMA 2F0LA 3T53B 1KIXA 1NR4A 1IBLQ 2M2LA 4IUVA 5ELEA 4IFDG 4A3FH 4A3MG 2ZJPA 3HOUG 1SYDA 1EUJA 1G2SA 3U9SA 4A3CG 4X65L 1AH9A 2J0TD 5IYCG 2O5JC 1X54A 4JI6L 1SDFA 1ASYA 5FJ8G 2JA7H 5CORA 2A6HD 1HH2P 3PUZA 5FLMH 4BWGB 1CKMA 1LTGD 4A75A 4BY7B 4Y7NB 3TZDA 1H9SA 3K8AA 1EYDA 2EVBA 2XTIA 1B2TA 4KY7A 1K9MC 3J80E 3J81E 4AYBG 3OTOQ 1YITA 4BXXH 2F4VL 4OHJA 3JAMi 2CW0C 2F0OA 1JE5A 4LFAL 1A15A 3A55A 4M1UB 4OIKA 5IGDA 5IP7G 5M9OA 3SDZA 4ULLA 1UAPA 1QOHA 3A0JA 3H91A 5I9PA 1N32Q 5CV8A 1BVSA 1D6EC 3QWNA 1QVGA 4DR5Q 5CYUA 3NWSA 2PO4A 2E5LL 3F2BA 4NPSA 3FKIG 2EYMA 4X66Q 2KUMA 4KD3A 2V1CC 2Y0SE 3ND8A 2EPBA 1QNKA 1JQYD 2IX0A 3HOZG 3L9AX 1HJPA 3X3MA 4A3MB 2FXQA 3GTQH 1I6HH 1B3AA 1ZYRD 3DMUA 3K0YA 3HOUB 1CKNA 2OQ0A 4EQOA 4PMBA 3NELA 2NUCA 3MWYW 4C2MB 4ZKBB 1FJGQ 2PI2E 4EX5A 3QJYA 5FO7B 4IN3A 2B2UA 1WYDA 3E6ZX 1PYWD 1Q8IA 2WB1B 3I55A 1F9RA 1SYGA 2HUGA 4A93G 3DWQA 5FLXE 3GO5A 4B9WA 4C3JG 4YCVA 2YTVA 2ZM6L 4IPHA 1CSQA 4CHTB 2QEXA 1SE3A 4K0KQ 2EIFA 3A7LA 3GTJB 4ZRZA 3T1HQ 5CV4A 2CCZA 1AFPA 3SXHA 3GTGB 5ISRA 4HTHA 1WD0A 3EIVA 3RZOB 5CMDA 3KF6B 4A3EG 4DV3L 2UUCQ 1J6QA 4B3MQ 3DWAA 1PH3A 1BF4A 1KL9A 3I3CA 4JI4L 4MNOA 1GHKA 1AZPA 4WRDA 4BBSH 3GTPB 3RZDB 2ASBA 4A4IA 2XVSA 1ICWA 3BS1A 1CTMA 1TWFB 5M5WB 1IYUA 5LL6X 3GQBA 1P16A 4X64Q 1STHA 4C1NK 1J9OA 3TEHB 1T9HA 4DV4L 1JOOA 3BDCA 4XT1B 1IBML 1QUQA 5C5MA 2HCIA 4IFDJ 2SNSA 4V0BA 4GKJL 3HOZB 1MGSA 2KVMA 1IZ6A 1TS2A 3HS0C 1KDAA 5GAEC 3ULPA 4BA1I 1YHAA 3H0GG 4A3JH 3TP6A 4A3LG 2CFMA 1O7IA 1WTXA 4IUQA 4KV6A 4XQQA 3CCRA 4DR2Q 2UU9L 3CQZH 4L5QA 1DOMA 4M8AA 2WACA 3HG9A 1AP0A 3W5OA 5LMNW 4LF4L 2N3SA 2UXCQ 1JWMD 1E2ZA 5M5XB 1EU3A 1O7YA 4RKBA 4AH6A 4UP9A 4DV2L 2LKVA 4G7HC 4DNTB 1S5BD 3PSIA 1ESRA 1SRUA 4ZLTF 3OW2A 5ELFA 3OIPA 5GROA 1EIYB 2EYLA 4DUZQ 1H9RA 4KY5A 2JXMB 1PA6A 4C3HB 1VF5C 3I4MG 5M3MH 1TWGB 3RMHA 3Q0AA 3S1MH 4X3KA 4ZYSA 3LGJA 4QIWE 1C48A 5I4DA 2LXKA 2EY5A 1HNZQ 1B9MA 3NBHA 3I4OA 1KABA 5C4XH 4KTAA 1Y8OB 4LUVA 4B08A 3UDFA 5C0XG 4QUFA 5BR8L 1IL8A 2ZTCA 3BZDB 5JPMC 4K5WA 3H0GB 4RHRA 3BDLA 1STAA 2Z4IA 1TY2A 2IHFA 2HT1A 1RF2D 5BN4A 3JAME 1XMQQ 2SDFA 1YJ9A 1H9SB 1UNSA 1IBKQ 2PMZE 2DUDA 4JOIC 4JI3L 2LFNA 3I8ZA 4GNXC 2MUYA 3TP5A 1DZ1A 2PPBC 1X6OA 4LF9Q 1KTKA 2VB2X 1MD2D 1RL2A 1PH4A 4JI2L 4IFDI 2B8GA 1YI2A 2RDFA 1VF7A 1ET6A 1LT4D 1TIID 1SNPA 3I72A 1HTPA 4BY7H 1HZCA 3FVQA 5IGBA 4Y7NH 4HCSA 3B6YA 1BDOA 2AQ3B 1VQ9A 3F8TA 3LX0A 3WOEA 4C56C 1BBWA 4TKOB 3OMGA 4C3IB 2A19A 3I4MB 3NUCA 2PNHA 3S17B 3PO3G 1CFMA 5JEAH 1Y1WG 1HZBA 4JI1L 1PFMA 3GD7A 3LWUA 1QVCA 4I7ZC 4Q5VA 2ZJRA 5I9OA 2VQFQ 2IY5B 1CUKA 4LJZC 2EJMA 2Y0SG 2L0CA 5CC4A 1CKNB 1ZEQX 5AJ3Q 2EYJA 2XRQD 1STEA 1Q3LA 1V1QA 5IY0A 1TS4A 1VQPA 1E22A 2ENBA 2BH8A 1ENFA 4B3TL 4XTCS 2E2DC 2HQEA 5A2QE 1VCIA 4QJFA 4GOPA 1IBLL 1KHIA 2YU9B 1GO3E 1U4LA 2L15A 3EROA 2R7FA 4R1JA 1DONA 2SOBA 4C2MH 3K7UC 2DNCA 3D6WA 4NXNQ 2DGYA 4J15A 4DK1A 1EFWA 2UXDL 3CF5A 1DOKA 4OL7A 1JMCA 5IIFA 1RTOA 4XXEA 4X3UA 4DV5Q 4CJ2C 2K4KA 1YNJC 4H13C 2IL8A 3A8KE 1IXRA 4K6DA 3I73A 5EKKA 5EGTA 1U4PA 4B3RQ 5EKLA 1Y1WB 1GUNA 4ZK9B 3GTJH 1QCBD 2JA5H 4ZKCB 2RF4A 3M3YB 3GTGH 1Y8PB 2AWOA 5DLQE 2F1MA 1SAPA 4LWCA 1X32A 3CMEA 4KKSA 1S5FD 1UE7A 2F0GA 3RN5A 1Z9FA 4YHHL 4DR5L 1RTNA 5C0XJ 3MFGA 5CR3A 3GTPH 2B2TC 3RZDH 5COYA 5KIXA 2KOLA 2IPKD 4FNFA 4IURA 3EN2A 1I6VC 4BY1G 1TWFH 4LNQA 1VQBA 1WOCA 2WIIB 4R4OA 4X66L 4OWXB 4P75A 1X9NA 3P7JA 2JA9A 1YBYA 1VQ4A 4E6IA 4DV1L 1BNZA 1WTOA 3MEFA 1B53A 4DR1Q 4A3IG 1VQLA 4GZYC 5C3XA 4YY3Q 3K7AB 1GUOA 3S14B 5K36G 1TWHB 4FF2A 4LF7Q 2RBMA 4RWSC 2NVYB 1PFNA 1SXTA 1TT2A 2Q2UA 1CA6A 2A6HC 3TP8A 1F9PA 1P8LA 4DR4L 4BBRG 2K7VA 2F0QA 5M5YB 4QY7A 1VQDA 1SE2A 4CKBA 1FNVA 2WB1E 1BR9A 2RHQB 5M3FG 2BCOA 1S5DD 1PH6A 3IRBA 5M5XH 5K5PA 3PMFA 1ILPA 2K32A 2Q2HA 4K5XA 1SMYC 5BN5A 1ET9A 2K5QA 2L9HA 3F2CA 4KMUC 4R4IA 3CC4A 2BE5C 1L0XB 3C1EA 2OWOA 1U5KA 1TXYA 4YCWA 1EY0A 1XX8A 4HEDA 4C3HH 4AQYQ 3KJPA 3VR3A 2MP1A 4QL5A 4DA2A 3PO2H 5J39A 3L7ZC 3SGIA 1Y14B 4LF8Q 4IJLA 1FNWA 4JBKA 1A2UA 1LTSD 1VQGA 4R8IA 3IFDA 2J7ZA 4A3IB 4K6LA 2ZXPA 1Q86C 1PMRA 3M4PA 4FVMA 3AFPA 2VZAA 1AE3A 1LYLA 4JI0L 5C0XI 2JA8B 3MA2B 1HUMA 1H9KA 2F0VA 1WD1A 1G2TA 5LL6S 4CKEA 5EAYA 4JK1C 3ICEA 2B3GA 3CXCA 4RKLA 4IJHA 4RH6A 4Q0FA 1SROA 3M4OH 4J6HA 4A3BB 2ZT9C 3NQIA 2F0IA 3HZXA 5I2YA 3C3LA 5LMUL 1EYAA 4IPDA 4NB3A 2A68D 2CQOA 2ZTEA 2AUJD 1IYVA 1JT8A 1PVOA 2QF7A 4HMIA 5IYDG 3BVMA 1GKHA 4IO9A 4C3IH 2MQHA 3KFUA 3TP7A 2VQEQ 4FXKC 3PIOA 1F9SA 3T13A 4OO1H 3A8IE 1HFNA 5EQ0A 2NN6I 4DV0L 3CCQA 3Q24A 2O2LD 4JBMA 1XYIA 2ZXOA 4JV5L 1X65A 4GOPB 2UUBQ 1QNUA 2MHVA 1XTCD 3H15A 2AQ1B 3L2PA 1X3GA 2KENA 1GUGA 3QB3A 2MJ8A 3TRZA 4QGUA 4HIKA 2J4XA 4Z9CB 3T16A 2I5LX 1O7ZA 2WKDA 3IL8A 4A76A 1VMPA 1XMQL 2B63B 2UXBQ 3H3VH 3L0OA 1TWAB 3A56A 4DV7Q 4BA2I 3K5OA 1GD7A 1Y1VG 3U50C 4CJ0B 4DU9A 2B2UC 1JJGA 1YHBA 1EIHA 4DR7L 1EQTA 1FR3A 3ZYYX 3H3VC 3UE0A 5EPJA 1J5EQ 1D1IA 1EY4A 5C44H 1FL0A 3CCMA 2AHOB 5IODA 4DPGA 4QMGA 2A6ED 5FO9B 3U4VA 4RGTA 1VQHA 2A69D 5C4JB 1LT6D 1E1TA 2L4NA 4S3SA 1IYJB 2R93G 2XWJB 1LLRD 1N36Q 4PZ8A 2F0MA 5IE8A 2FMMA 2A1AA 5JAVA 4A3KG 1SN8A 3VYSA 3SE0A 1B9NA 2K33A 3K80C 1VQIA 4PZ6A 1OXTA 2EY1A 1Q81C 1LTAD 2EY2A 1PH9A 2VUMB 2WAQE 4F7XA 3STBD 2VY3A 3VR4A 3CAMA 2OF1A 4DNIA 3HOWG 3DEPA 1LABA 3K57A 5GQOA 3KJOA 1S72A 2I0QA 3URYA 1SLJA 5KRUA 1I50B 2MNAA 2NTTA 5IGCA 3P20A 1MKHA 3K59A 2NVTB 4IZ8A 1PRTD 2CKZB 5G3LD 1JORA 3BU2A 2JEBI 1F2MA 1E24A 5CV7A 5JPNC 1N33Q 3NQTA 2E2HB 3UDIA 5IOCA 2CWAA 1L1OA 2YTYA 3I4NG 1HRJA 3HKZG 2NVYH 3PCOB 5C3EH 1K83B 1Q90A 4KKUA 4JCVE 1TS5A 5M5YH 5HURA 2XRSD 4A3DG 4KHZA 4GN5A 1UE1A 1WCMB 5GAGC 5LMNL 4KHPL 2IX1A 1QE6A 5C6AA 3HOYH 2OCEA 3MXUA 2JA6B 2R93B 1OXXK 4KJOA 3FP9A 2A5HA 4DR3Q 5KEEA 2FHTA 2K5VA 2F0PA 4A3KB 1B70B 4ILWA 3S9WA 2N49A 3CCLA 2F0TA 1T5EA 1KQSA 5IWAL 2ES2A 1XJVA 2K01A 4JI8Q 3GP7A 1X3EA 3G48A 5DM73 3A5ZB 1RHPA 3HOWB 3MXNB 1UEBA 4P2CB 3CW2C 3UDGA 1K8OA 3S24A 1G51A 1LV9A 2CHBD 2R92G 1CT1D 1PTOB 1MIUA 1M8AA 1EIGA 2EXDA 4AYBB 1D5XC 1SYEA 1JWUD 1D5MC 2PQAB 1XPUA 1I3QB 2DY7A 3R3OA 3S1QB 1EQRA 1VQKA 4LF7L 1DJRD 2QA4A 3HKZB 4F87A 4H7BA 2KBNA 2JA8H 1Q8KA 4XDXA 4ALPA 2LY7A 4UY8C 4LK1C 4A3DB 4FO2A 2NVQB 4A3GG 2Q2IA 5F2DA 1BCPD 2JJQA 1XNRL 3FKIB 3KDFA 1JICA 1GVPA 4A3BH 4HJ9A 2EQSA 1KNEA 3EVQA 1MBYA 2MFIA 4QF4A 4LFCL 3PGZA 1NAPA 2K28A 2RVLA 4JBJA 4DAYA 3WOFA 3DLLA 3MFYA 2JSOA 2Z6KC 2NYZD 1BO0A 1F9QA 4AQYL 2E8GA 3OMCA 3S1NB 1IW7C 1XMOQ 1EIFA 2LXJA 3RLOA 4A93B 1WTPA 4LAAA 4C3JB 1BKBA 2PI2A 2E75C 1YJNA 5BN3A 1EEID 4B3SL 4DAVA 4LF8L 4FP5D 3BVGA 2R92B 1PH2A 4O1NA 1A62A 2L11A 3ZJYC 5DEHA 1V9PA 2G9DA 4HAEA 3SK5A 1CM9A 1VQ6A 4HJAA 1HNXL 2B2VA 5IT9c 2BA1A 3PIP3 4GOPC 1G91A 4A3EB 3OHXC 5HGTA 1A2TA 3KBXA 2R7ZG 1II3A 1DXMA 3K6OA 1LO5D 4DGZA 3HOXH 1TWAH 4A3GB 3MTSA 3HFZB 2HHHL 1I94Q 2O4XA 3D4WA 3Q22A 1PH5A 3BZKA 1XNQL 4DV6Q 5IP9H 4F88A 2B2YC 3GV6A 1EY8A 4DK3C 1TWCB 4LFBQ 1X56A 4OO1G 1SNCA 3IKJA 1EWCA 1PZKD 2E2IB 1WI5A 3GDEA 3QO2A 3I7FA 3VYUA 1X3QA 2K75A 3HOVH 4RA8A 3KLWA 4X3TA 3MVVA 4RMFA 1SYFA 3R2IA 3S16B 2PYKA 4LF6Q 2WAQG 1RODA 3QOLA 3M4QA 3S15B 1HR0Q 4MIUA 4P73A 3CC2A 1X3PA 1HNWQ 3K5LA 4PNYA 4UDUC 2VUMH 3S2HB 2F0SA 2NZOA 2K1BA 4G7ZC 1L1OB 3NENA 1QVFA 1C4QA 1L0YB 5E1FA 1E2VA 4OXPA 1HPCA 4FF4A 1S5ED 3ULLA 5FK9C 2NN6G 2H4OA 1I50H 1SYBA 4QUCA 1STGA 1D1KA 1EOVA 1YNNC 4NXMQ 4GLAC 2ICIA 3L3OC 5IYBG 4XYOA 4DR6Q 2BOSA 1YHQA 2H5XA 2E2HH 1EYGA 1AE2A 2N8NA 2IJ0A 3M7NA 1CQVA 2CQAA 1K83H 1WTQA 1VQ8A 4OX9Q 2EJFC 3NPPA 4NDXA 1K8GA 1JC7A 4V190 2H1EA 2JYOA 1PTOF 2Q8TA 5A35A 2UUAQ 4ZAIA 4P74A 4MTNA 2GA4B 1VQOA 4A3FG 2F03A 4L5SA 2SEBD 2JA6H 3E9HA 2F0EA 4UAIA 4YWKA 5J3BA 1M90C 2ICEC 2I07B 5D65A 1N34L 3RD4A 1I5FA 4ABNA 4JI6Q 3FRPB 4G57A 3KOJA 4IFDH 5NUCA 1VQMA 1V43A 2JA7G 4A3MH 1QZGA 1H95A 3HOUH 5FLMG 4P72A 4A3CH 5EPLA 5IYCH 2IT1A 3CCSA 1CKOA 2GVBA 1LTLA 5FJ8H 5IGGA 4DUYQ 1MSHA 4NP5A 4IUNA 2AKWB 5ELNA 2PQEA 1KC8C 4BXXG 2MPMA 3DXJC 3CP0A 3SEBA 3J80c 3NXWA 4KJNA 3J81c 3GTLB 1MSGA 1ENAA 1IHZA 4LFAQ 3KBGA 3FDTA 3X3NA 2VNUD 2EE1A 1PTOH 3PO3B 1OXSC 3A5UA 4HJ8A 3OTOL 1PRTF 5G3LF 3NTKA 1TKWB 2F3WA 1N33L 2RDHA 3F1ZA 2L1BA 2HIXA 1I3QH 5IP7H 3A54A 1QUQB 3RZOH 1B7YB 2E5LQ 1PTOC 2KEEA 1N32L 3GTOB 1HQMC 5TSSA 1EEFD 3MZ5A 3G7LA 3PUWA 4DAYB 2Y0SB 3E5SA 3F2UA 3MXPA 1LM0A 4H02A 3DWPA 3ITPA 4Y52H 1U4MA 4IPGA 4APVA 3LNNA 4A3FB 3FKIH 5E7NA 5M5WH 3J7YW 1SEBD 4X6AH 1V1PA 4GLXA 1HXYD 4LW1A 3W1GA 1VQJA 3CMAA 1QZHA 2F0DA 3BYYB 3DM1A 3D3RA 5CBAE 2PW5A 1YJWA 4DR3L 4FF1A 1JCKB 3HOZH 3HKSA 1O80A 4U68A 2Z8LA 3FPUB 1JR0D 2ID0A 3N52A 3KK7A 4GLVB 2B2WC 3STBC 1FJGL 3T4AC 5FLXc 1D2BA 3T1YQ 1VS0A 2SNMA 3S1NH 2C5CA 1UEAB 1SMXA 5KNCA 4CGYB 4IOCA 4BS9A 4A93H 1V1OA 2KCNA 4C3JH 1B4OA 2DY8A 2IW3A 2MGSA 3D31A 2TSSA 2D9UA 1JOQA 4DV3Q 3DHQA 1KLGD 4EVOA 1GM5A 3U58A 4K0KL 5JJKA 2KQ3A 2DN8A 2OT2A 2XIWA 4JI4Q 1R4QB 3T1HL 3ER0A 4BBSG 2X69A 4WFN3 3NBHB 2QEJC 2E2JB 4A3EH 3CPWA 2I5MX 2UUCL 4B3ML 4UPAA 1U0LA 1I4RA 1Z6HA 3EQLC 4LUZA 1EL0A 1PV4A 1TWGH 1EZ8A 4DV4Q 1IBMQ 4IUUA 4F8MA 4RG1A 1EWIA 1VMCA 2M00A 4GKJQ 4BY1B 1VQ5A 1DD2A 1E7ZA 1SNQA 3GTQB 1BCPF 1C0AA 3VR5A 4X64L 2NB0A 3AEVA 1OXUA 3KUPA 4A3JG 1ESFA 1TWCH 2R7DA 1QJOA 4POFA 1ZYRC 5DM63 2UU9Q 2Z4HA 3CHBD 5JOBA 1NE3A 3VA7A 3EFXD 2NWGA 1NMFA 2NVXB 2MO0A 3H0GH 3NEMA 4A3LH 2E76C 2XN9C 2BDNA 4OO1I 4BBRB 4DV2Q 4DR2L 1NUCA 5C5LA 1O78A 1NY4A 1RD9D 3S15H 4KHVA 1WTVA 5GAHC 1RDPD 4TQUS 2EJGC 1ML0D 5M3FB 4L63B 1SR3A 2UXCL 4PZ7A 5DAUA 3K5MA 1YZ6A 4X3SA 3CKIB 3S2HH 1GUSA 1QG7A 5KYLA 3FPPA 3W2DA 3JC66 4J1MA 3TMEA 5M3MG 4BBSB 1EU4A 2VS1A 1EQVA 1KAAA 1W6KA 3NBIA 4RFBA 4DUZL 2GN5A 1HA6A 4QIWB 4JI7Q 2ATWA 3FHWA 4C1NI 3P75A 4L5RC 3I4MH 3S17H 1L1OC 1XPRA 1LTID 2F0FA 1DM0B 3TN2A 2OQKA 5GADC 3D6CA 5C4XG 2D0OA 3KF6A 1CHPD 5LHY1 1K8AC 5H1SE 3PIPA 3K0XA 4MHEA 3OWEB 4TVAB 3NK9A 1SNDA 1STBA 1HNZL 3AQQA 2IHEA 2KJXA 4LUOA 3RN2A 1EY7A 4H44C 1NBWA 4LFBL 1BXTA 5C0XH 1B44D 2XSCA 1L2FA 2KHIA 2PMZB 3RLNA 1XXGA 2B39A 1JJCB 3T56B 3JAMc 1SNOA 3K81C 4JI3Q 4POGA 1V8QA 3CQZB 5C3WA 4RGNA 3CCEA 1O7LA 1WJJA 2DNEA 4KN4C 5KYIA 3PF5A 1F2LA 4LF6L 1B8AA 1IBKL 2YU9H 2K03A 3W1BA 1GOZA 2K14A 3UI2A 1K8MA 2VB3X 4LF9L 2JE6I 1FVIA 2F0HA 4BY7G 2QILA 5CGKA 1H9MA 4GKKQ 1QWYA 3K5NA 1ZKOA 1YNJD 4ODGA 3S1RB 2XNAC 5M3MB 1LTRD 4K8JA 1FGUA 1X55A 5JEAG 4RGOS 3SHLA 2N88A 1EQQA 3GTLH 4IALA 4O0AA 2QKIC 1G6ZA 2AWNA 4N9PA 2Z0SA 3PO3H 2RSOA 1I4GA 3AYHB 4UP7A 1UUPA 3I70A 1Y1WH 1S40A 1Q46A 1V1PB 3QOJA 4EQ5A 1MJCA 1K73C 3TZUA 3M3YH 1MJEA 1IKLA 3CCUA 5JVG3 2HCCA 5HGQA 5AFWA 2F3IA 1M4VA 2VQFL 2Z1CA 4OX9L 1JE4A 5AJ3L 4B3TQ 2UUAL 4GN3B 1I4HA 1ZXTA 4K14A 2EZVA 4WJ4A 1PYSB 2PZTA 1EY5A 5IT9L 1N8RC 3A8JE 2EDGA 4LF5Q 2R61A 5HY6A 3NP8A 2NZHA 1PZID 1U9RA 4X62Q 2UXDQ 1Y1VB 3V2TA 3K7AH 3VR6A 3S14H 1TWHH 1J8IA 1BBUA 2WB1G 1EY9A 2JEAI 4WJ3M 1W3SA 4HSPA 4R4CA 4NXNL 4TRDA 4DUYL 1FD7D 1KAWA 1L0WA 1F2YA 5J22A 4GS3A 2O5IC 4XYQA 3OSOA 3TS0A 2G9HD 4DV5L 1TS3A 2N55A 2JA5G 1DGSA 1SMYD 3ONAB 3C46A 1HA5A 3IAYA 2AQ2B 2B2VC 4NKLA 2XWBB 2OEOA 2BE5D 4YIJA 1OXVA 4B3RL 3HP3A 3OWFA 3EA6A 2F4IA 3I4LA 3SK4A 4YHHQ 2L12A 3EJIA 1HR0W 3AFQA 1E0BA 3RR5A 4DK6C 2E2JH 4RCOA 2VXWA 5JVH3 5ELOA 4K8IA 1R4PB 1R9TB 1CZWA 3TREA 3TS2A 1OTCA 3GTMB 5ELCA 4GN4B 4DV1Q 3D4DA 1E3PA 2KCTA 1K0RA 2R3ZA 4P71A 4BY1H 2OXPA 1F2ZA 5CV5A 5D3IB 3V96A 2HDLA 4DXFA 3R93A 4WORA 1KXLA 1D8LA 3S2DB 3OW7A 4UP8A 3J7ZC 4DR1L 4A3IH 4DR4Q 4TSSA 4DNRB 1B50A 4YY3L 1YVCA 4MZ9A 2FFKB 2HDMA 4OONA 5K36H 1UE5A 1I4PA 1TVXA 4OIJA 2F0KA 4FXGC 4RGMA 3I4NB 2NVXH 1Q7YC 3TDQA 3VYTA 4QB4A 1A3VA 3NHHA 1D5ZC 4IPCA 1G8ZD 3T1YL 4BBRH 1XPOA 2F3VA 5JEAJ 3KF8A 2WFWA 3UE1A 3NSWA 4PV1C 1S5CD 5M3FH 2JA5B 3H6MA 1H9JA 1DYQA 5E4XA 1KDBA 1YNXA 1NJIC 3E9IA 4L8JA 3I2ZA 3OPOA 3NE5B 1PH7A 1SJHD 2RDGA 4C3HG 1U4RA 4FYDA 1ONLA 1PFBA 1S4ZA 4JI5Q 4ID6A 4H0LC 1AZQA 5IGEA 1VQAA 5IGFA 3PO2G 3RLFA 2KCMA 5EJWA 3G4SA 3T51B 1PRTB 3CRLC 2GVAA 4PG3A 1UWVA 1Y8NB 3MAQA 4XIGS 5JJZA 2X6GA 2NBFA 3J80L 2RCNA 3J81L 1JJ2A 2K52A 1X3FA 1NSNS 2K5HA 1PZJD 3G71A 3KLSA 4KK7A 1F77A 4JI0Q 1VDZA 2L5TA 4YWMA 3DM3A 2QDBA 2PCFB 2LSSA 2PZWA 3SR1A 1KLUD 1AW7A 1PH8A 1E2WA 2XGTA 4QQBX 3BG3A 2EOTA 1TU2B 3K58A 2B63H 3BVZA 1WVLA 1BQQT 2JP1A 1Q82C 3PIO3 1CHQD 4JYAQ 3HEJA 5LMUQ 1WTRA 5CV6A 4N9TA 4OWWB 1A0IA 2Q8IB 1KNAA 1NCVA 1HHVA 2B29A 4FF3A 2E74C 1A63A 3NTIA 1HCZA 3AU7A 3CU7A 3S1RH 4C3IG 1C7YA 3CCJA 2OTJA 3D0FA 1I4XA 1HQRD 2PW7A 1T5XD 3PUVA 2KEDA 4DV0Q 1Y69U 1JB3A 3PO2B 4JI7L 3R2TA 5C4JH 1CZGA 2WP8J 5IYDH 3ERQA 4JV5Q 2OTLA 2VQEL 1LACA 2KA7A 3BJUA 4KY6A 3C2PA 5D3DA 3FEWX 5FLXL 3P1HA 4HN7A 5D14A 3N6RA 4G4KA 4IQZA 4HIOA 2FJ2A 1SE8A 4DAMA 4HIDA 4PMWA 2A8VA 1Q1BA 3GV3A 1TR5A 2UUBL 1ILQA 2WV6D 5ELBA 3SVMA 1SFOB 3F2DA 4K5VA 2ZJQA 3BYTB 1BCPB 3C1FA 1W6JA 3BDOA 3A7AB 4XT3B 2R7ZB 2CW0D 2NVTH 1HUNA 4DR7Q 1EWHA 3M4OB 5FO8B 2UXBL 4DV7L 4FXDA 4G7OC 5C44G 3CCVA 1Y1VH 2EY6A 4LMQD 3J7AF 1KD1C 3EBEA 1RCVD 3O13A 2A74C 3GTKB 1Q12A 3G6EA 4GKKL 3H09A 2KHSA 5FKAC 4KKTA 1J5EL 2RKSA 2K5WA 3R8BA 2A68C 3SK6A 1N9WA 3KLRA 4DXGA 2MO1A 4KD4A 1B1ZA 1WCMH 3J7AV 5JJLA 1BUVT 2EYHA 1SJED 1C9OA 1K3RA 2Z6KA 5J1ZA 2Q8RE 4HJ5A 2R93H 2EYOA 1IL2A 4X65Q 3VDYA 2CVRA 2WAQB 5FOBB 1N36L 1HZ9A 3U9OA 2CWPA 4A3KH 1ASZA 4IOAA 3NTHA 1VQ7A 1MI2A 1SYCA 3NWTA 1NTGA 4IUPA 2AMCB 3E0JA 1EZ6A 2RSNA 3I91A 1TQOA 2VL6A 4JG2A 1R9TH 2KCCA 4NW2A 2YTXA 3HOWH 1CQFA 3GTMH 1LTBD 4MN3A 3IFTA 3BZCA 2F4VQ 2C35B 4RHSA 1C8CA 3KF8B 2NZ1D 4LF5L 1GXDC 5C3EG 3S2DH 4XQJA 4YWLA 1Z47A 3KDFB 1YIJA 3MHBA 3D4RA 3CRKC 2WINB 3VR2A 4X62L 1G6PA 3Q6SA 4HCEA 5C44B 3MXGA 3S1QH 3E0EA 2I46A 2B2YA 1EFID 3I4NH 1E1OA 5LMNQ 4KHPQ 5EKIA 5C4ZA 3HOYG 2N78A 1HTLD 1PYBA 4KN7C 2A6EC 1STYA 4EGVA 3HRZC 4R8NA 2Q2TA 4A3DH 2NVQH 1S3OA 2A69C 2D0PA 4DKAC 3Q8DA 1Z7TA 3JAML 3MEHA 2IWHA 4U673 3QG1A 3WWVA 1SSOA 4OWTB 4K2KA 5C4HA 5IWAQ 1WFQA 4JOIA 3J81j 4GNXA 2AUKA 3FMCA 2JA7B 2WKCA 3I90A 2V4DA 2ZXRA 1IW7D 4JI8L 2A73B 1PH1A 3PUYA 2D2CC 2RA4A 2FMCA 2ZM6Q 4PQXA 4OGQC 1SBBB 5EBCA 2X6LA 4CKCA 2ALYB 4I65A 4DFAA 3KYHC 2K5NA 1PRTC 2R92H 2I5HA 5C3EB 4DK0A 2R6GA 4AYBE 1A3UA 2JA8G 1LUZA 1GUWA 2HQLA 2HIVA 4YCUA 1VQCA 3PV0A 1CA5A 4EQNA 1OO9B 1DOLA 1PXUA 1TY0A 3WDNA 2K50A 3HKZE 1XNRQ 3RNUA 3HOYB 4L5TA 1IKMA 3TSSA 1KRSA 1BOSA 3DEOA 4EQPA 4AIMA 1DCZA 4ZUIA 4A3BG 4HSVA 1GHJA 4A3GH 1Q1EA 1JB7A 5DNFA 5E4WC 4CBVA 4LFCQ 3RUZA 5I2XA 1I6HB 3J80i 1NR2A 3M4YA 3V05A 3J81i 2PNRC 1PHJA 5A2QL 1CK1A 1PFSA 4JBWA 1KRTA 3M7GA 1XTDA 4R9WA 2LS01 3LWEA 3ND9A 4JI5L 2QCPX 2E2IH 5JJIA 4HMJA 1A6XA 2BH2A 3D8GA 2NTSA 2KECA 5ELDA 1FGBD 1LT5D 4J8QA 1UE6A 4HJ7A 3ERSX 4R4TA 1M1KC 1VQNA 2QGQA 4LF4Q 2K5DA 4B3SQ 4B9XA 3S16H 2BA0A 1JWSD 4CJ1B 1XMOL 4RAUC 1VQEA 5KGUA 5KNBA 3U4ZA 3AB9A 1HNXQ 3OOCA 1HFGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K7A H;  4NXN Q;  3S14 H;  1TWH H;  1V9P A;  1BBU A;  2DGY A;  4J15 A;  3M9B A;  2WB1 G;  2D62 A;  1VQ6 A;  2JEA I;  4WJ3 M;  4HJA A;  1EFW A;  1W3S A;  1HNX L;  1SFO H;  3CF5 A;  2UXD L;  2JK8 A;  4R4C A;  2BA1 A;  4NXN L;  2RHS B;  5IT9 c;  1JMC A;  4GOP C;  1D7Q A;  2B63 G;  2YYZ A;  4DUY L;  4DV5 Q;  1KAW A;  1L0W A;  4FDB A;  3HOX G;  2R7Z G;  2K4K A;  4GS3 A;  2HHH Q;  3TS0 A;  1IXR A;  4DV5 L;  1HZA A;  3HOX H;  2PQA A;  1TWA H;  2JA5 G;  1XNQ Q;  1DGS A;  5IP9 G;  2R7Z H;  3HFZ B;  2YV5 A;  1VQF A;  1I94 Q;  2HHH L;  3H3V I;  4B3R Q;  1PH5 A;  3GTJ H;  3BZK A;  2JA5 H;  4DV6 Q;  5IP9 H;  4R4Q A;  1XNQ L;  4JYA L;  3CC7 A;  2RF4 A;  1I94 L;  1OXV A;  3GTG H;  2KHJ A;  4B3R L;  2AWO A;  5DLQ E;  4DK3 C;  4YHH Q;  5BR8 Q;  4LWC A;  4DV6 L;  3CME A;  1HR0 W;  3AFQ A;  1RIP A;  1UE7 A;  4LFB Q;  1X56 A;  3RR5 A;  3GTK H;  4DK6 C;  3RN5 A;  4OO1 G;  2E2J H;  1Z9F A;  4KI0 A;  4YHH L;  4DR5 L;  3HOV G;  1WI5 A;  5C0X J;  5ELO A;  3GTP H;  3GDE A;  3RZD H;  3J7A 5;  1G29 1;  3I7F A;  3OYY A;  2K75 A;  3TRE A;  3TS2 A;  1OTC A;  3HOV H;  3KLW A;  3EN2 A;  4BY1 G;  1TWF H;  4GN4 B;  4RMF A;  4LNQ A;  1VQB A;  1WOC A;  4DV1 Q;  4R4O A;  4X66 L;  4OWX B;  4LF6 Q;  2WAQ G;  4P75 A;  3I56 A;  1X9N A;  1E3P A;  2KCT A;  2JA9 A;  1K0R A;  3M4Q A;  1YBY A;  4P71 A;  1VQ4 A;  4BY1 H;  2F52 A;  1HR0 Q;  4P73 A;  4DV1 L;  3CC2 A;  1HNW Q;  4JI2 Q;  2VUM G;  3MEF A;  4KLK A;  2JQO A;  4DR1 Q;  4A3I G;  3PF4 A;  1VQL A;  1KXL A;  1D8L A;  1HR0 L;  4YY3 Q;  3M85 A;  1HNW L;  5K36 G;  3CPF A;  3TQY A;  4UP8 A;  3J7Z C;  4LF7 Q;  2VUM H;  2NZO A;  3UDX A;  4DR1 L;  1CSP A;  4A3I H;  4DR4 Q;  1NMG A;  4YY3 L;  1L1O B;  1YVC A;  4MZ9 A;  4OON A;  2Q2U A;  1UE5 A;  3NEN A;  1QVF A;  1P8L A;  4DR4 L;  2NVX H;  4OXP A;  4BBR G;  3PUX A;  4QY7 A;  1Q7Y C;  1VQD A;  4O2D A;  3ULL A;  2NN6 G;  1YEZ A;  1I50 H;  3CD6 A;  2WB1 E;  4IPC A;  3T1Y L;  4BBR H;  2RHQ B;  5M3F G;  1A8V A;  1XPO A;  1PH6 A;  4JI1 Q;  5JEA J;  1W2B A;  2WFW A;  3IRB A;  5M5X H;  1EOV A;  3UE1 A;  4NXM Q;  4GLA C;  5IYB G;  5M3F H;  3A74 A;  4DR6 Q;  2Q2H A;  2VW9 A;  1YHQ A;  2H5X A;  2E2H H;  4JC0 A;  1YNX A;  1NJI C;  4NXM L;  1EYG A;  1AE2 A;  3E9I A;  5IYB H;  2N8N A;  3I2Z A;  4DR6 L;  3F2C A;  3M7N A;  1PH7 A;  4ME3 A;  1K83 H;  4R4I A;  3CC4 A;  2ZTD A;  3ULJ A;  1VQ8 A;  4OX9 Q;  2OWO A;  1K8G A;  4JI5 Q;  1U5K A;  1WCM G;  1TXY A;  3GTO H;  4GNX B;  4YCW A;  2UUA Q;  4C3H H;  4AQY Q;  3KJP A;  1VQA A;  3PO2 G;  4P74 A;  3RLF A;  2KCM A;  2JA6 G;  4MTN A;  3G4S A;  4QL5 A;  1VQO A;  4A3F G;  4L5S A;  2GVA A;  4HIM A;  1N34 Q;  3PO2 H;  4PG3 A;  2JA6 H;  1UWV A;  3E9H A;  1KIX A;  1IBL Q;  4YWK A;  4XIG S;  4A3F H;  4IFD G;  5J3B A;  3L7Z C;  3SGI A;  1M90 C;  1Y14 B;  1N34 L;  4A3M G;  1I5F A;  4LF8 Q;  4JI6 Q;  4IJL A;  2ZJP A;  3HOU G;  1EUJ A;  3KOJ A;  4JBK A;  1VQM A;  1V43 A;  4X65 L;  1VQG A;  2RCN A;  5IYC G;  2JA7 G;  4A3M H;  1X54 A;  1QZG A;  1JJ2 A;  1AH9 A;  2K52 A;  1X3F A;  4JI6 L;  1H95 A;  2K5H A;  1ASY A;  5FLM G;  5FJ8 G;  3HOU H;  1Q86 C;  3G71 A;  3M4P A;  4P72 A;  4A3C H;  4JI0 Q;  5IYC H;  2IT1 A;  2JA7 H;  3CCS A;  3AFP A;  1HH2 P;  1CKO A;  4YWM A;  2GVB A;  1LTL A;  3DM3 A;  3PUZ A;  5FLM H;  5FJ8 H;  2VZA A;  1CKM A;  1AE3 A;  1LYL A;  4DUY Q;  4A75 A;  2LSS A;  4JI0 L;  5C0X I;  2AKW B;  3K8A A;  5ELN A;  1PH8 A;  1KC8 C;  2XTI A;  2XGT A;  4BXX G;  4QQB X;  1K9M C;  3CP0 A;  3J80 c;  3J81 c;  4AYB G;  5EAY A;  4LFA Q;  3OTO Q;  2B63 H;  1YIT A;  4BXX H;  3ICE A;  2F4V L;  2B3G A;  3CXC A;  2VNU D;  1Q82 C;  4IJH A;  1OXS C;  3JAM i;  4JYA Q;  3A5U A;  4HJ8 A;  1JE5 A;  3OTO L;  4LFA L;  1SRO A;  5LMU Q;  5IP7 G;  3M4O H;  4OWW B;  1A0I A;  3A0J A;  1N33 L;  3F1Z A;  2HIX A;  1N32 Q;  1I3Q H;  1BVS A;  5LMU L;  5IP7 H;  4IPD A;  2B29 A;  1QUQ B;  3RZO H;  1B7Y B;  2E5L Q;  4NB3 A;  1QVG A;  4DR5 Q;  1A63 A;  1N32 L;  2CQO A;  2ZTE A;  3S1R H;  1C7Y A;  3CCJ A;  1JT8 A;  1PVO A;  2OTJ A;  3PUW A;  4DAY B;  3D0F A;  5IYD G;  2E5L L;  1GKH A;  3F2B A;  4NPS A;  4IO9 A;  3FKI G;  3PUV A;  2MQH A;  4C3I H;  4DV0 Q;  3KFU A;  1LM0 A;  4H02 A;  2VQE Q;  3PIO A;  4JI7 L;  4Y52 H;  4X66 Q;  5C4J H;  2V1C C;  2WP8 J;  5IYD H;  2Y0S E;  4IPG A;  4APV A;  3FKI H;  5E7N A;  4JV5 Q;  2NN6 I;  4DV0 L;  5M5W H;  2OTL A;  2VQE L;  3CCQ A;  4JBM A;  4X6A H;  3BJU A;  4GLX A;  4LW1 A;  3W1G A;  1VQJ A;  3CMA A;  2IX0 A;  3HOZ G;  4JV5 L;  1HJP A;  1QZH A;  2FXQ A;  1X65 A;  3GTQ H;  1I6H H;  4GOP B;  1YJW A;  4DR3 L;  4HIO A;  3HOZ H;  1CKN A;  1SE8 A;  2OQ0 A;  3HKS A;  4PMW A;  4DAM A;  4HID A;  2UXD Q;  3NEL A;  2UUB Q;  2A8V A;  3H15 A;  3L2P A;  2ID0 A;  1Q1B A;  1X3G A;  1FJG Q;  2KEN A;  2PI2 E;  4EX5 A;  4GLV B;  2UUB L;  3F2D A;  3STB C;  3TRZ A;  1WYD A;  4QGU A;  4HIK A;  1FJG L;  3I55 A;  2ZJQ A;  5FLX c;  2I5L X;  4A93 G;  3T1Y Q;  1VS0 A;  3GO5 A;  3S1N H;  4A76 A;  1SMX A;  1XMQ L;  4YCV A;  4IOC A;  2YTV A;  4A93 H;  2UXB Q;  3H3V H;  3L0O A;  2ZM6 L;  4C3J H;  2NVT H;  4DV7 Q;  4BA2 I;  4IPH A;  1CSQ A;  4DR7 Q;  1GD7 A;  1Y1V G;  2QEX A;  3D31 A;  4K0K Q;  2EIF A;  2UXB L;  3U50 C;  4DV7 L;  3T1H Q;  2CCZ A;  4DV3 Q;  1YHB A;  1JJG A;  5C44 G;  3CCV A;  1Y1V H;  4DR7 L;  1GM5 A;  3U58 A;  4K0K L;  5JJK A;  3EIV A;  4JI4 Q;  3UE0 A;  1KD1 C;  3EBE A;  1J5E Q;  3T1H L;  3KF6 B;  4A3E G;  4DV3 L;  3ER0 A;  1J6Q A;  2UUC Q;  4B3M Q;  5C44 H;  1PH3 A;  4BBS G;  1FL0 A;  3NBH B;  3CCM A;  1Q12 A;  2AHO B;  1KL9 A;  3G6E A;  4GKK L;  4DPG A;  4JI4 L;  4MNO A;  1J5E L;  4A3E H;  3CPW A;  2I5M X;  2UUC L;  4B3M L;  3U4V A;  4BBS H;  4UPA A;  1U0L A;  2ASB A;  4A4I A;  1N9W A;  1VQH A;  4LUZ A;  1PV4 A;  1TWG H;  2MO1 A;  1E1T A;  1WCM H;  1IYJ B;  5JJL A;  2R93 G;  1C9O A;  1K3R A;  4DV4 Q;  1IBM Q;  2Z6K A;  4RG1 A;  1EWI A;  1N36 Q;  1P16 A;  4PZ8 A;  4X64 Q;  4GKJ Q;  1VQ5 A;  4HJ5 A;  2R93 H;  1E7Z A;  1T9H A;  3TEH B;  5IE8 A;  4DV4 L;  1IL2 A;  2A1A A;  4X65 Q;  3VDY A;  1SN8 A;  4A3K G;  1QUQ A;  1IBM L;  1N36 L;  4IFD J;  1C0A A;  3K80 C;  1HZ9 A;  4X64 L;  4GKJ L;  1VQI A;  3AEV A;  4PZ6 A;  1OXU A;  1OXT A;  1IZ6 A;  4A3J G;  2CWP A;  1TWC H;  1Q81 C;  4A3K H;  1ASZ A;  1PH9 A;  4IOA A;  2R7D A;  2WAQ E;  1VQ7 A;  5GAE C;  4POF A;  3ULP A;  4BA1 I;  1NTG A;  1YHA A;  2VY3 A;  3H0G G;  3STB D;  4A3J H;  4A3L G;  2AMC B;  3CAM A;  2CFM A;  2UU9 Q;  4DNI A;  3HOW G;  1NE3 A;  1O7I A;  1NMF A;  2VL6 A;  5GQO A;  2MO0 A;  3H0G H;  4JG2 A;  3KJO A;  3NEM A;  1R9T H;  3CCR A;  1S72 A;  4DR2 Q;  2I0Q A;  1SLJ A;  2UU9 L;  4A3L H;  2YTX A;  3HOW H;  3GTM H;  4OO1 I;  3CQZ H;  4L5Q A;  2MNA A;  1MKH A;  3W5O A;  3BZC A;  2F4V Q;  4DV2 Q;  4DR2 L;  2C35 B;  5LMN W;  4LF4 L;  2CKZ B;  1NY4 A;  2N3S A;  3S15 H;  2UXC Q;  3BU2 A;  2JEB I;  5GAH C;  4TQU S;  4AH6 A;  4UP9 A;  3KF8 B;  4DV2 L;  1E24 A;  4LF5 L;  1SR3 A;  1N33 Q;  2UXC L;  5C3E G;  3S2D H;  4YWL A;  4PZ7 A;  3UDI A;  1Z47 A;  3KDF B;  1YIJ A;  1YZ6 A;  2CWA A;  1L1O A;  3PSI A;  3S2H H;  1SRU A;  2YTY A;  3OW2 A;  3I4N G;  3HKZ G;  2NVY H;  3PCO B;  4X62 L;  5C3E H;  1G6P A;  5GRO A;  3JC6 6;  1EIY B;  4JCV E;  3E0E A;  3S1Q H;  4DUZ Q;  5M3M G;  1PA6 A;  3I4N H;  1E1O A;  2VS1 A;  5LMN Q;  4KHP Q;  5M5Y H;  3HOY G;  3I4M G;  4A3D G;  4DUZ L;  4KHZ A;  2GN5 A;  4GN5 A;  5M3M H;  2N78 A;  4JI7 Q;  1UE1 A;  2ATW A;  1PYB A;  5GAG C;  5LMN L;  3FHW A;  2IX1 A;  3S1M H;  4KHP L;  3LGJ A;  4L5R C;  3HOY H;  2Q2T A;  2OCE A;  3I4M H;  4A3D H;  3S17 H;  1L1O C;  2NVQ H;  1XPR A;  1S3O A;  4QIW E;  2D0P A;  4DKA C;  4A3C G;  1OXX K;  2OQK A;  5GAD C;  2LXK A;  3Q8D A;  5C4X G;  2D0O A;  3FP9 A;  3KF6 A;  4DR3 Q;  3WWV A;  1HNZ Q;  4OWT B;  1K8A C;  5H1S E;  3PIP A;  3K0X A;  3I4O A;  2K5V A;  5IWA Q;  4TVA B;  5C4X H;  1B70 B;  1WFQ A;  2N49 A;  4JOI A;  4LUV A;  3UDF A;  3AQQ A;  2IHE A;  3J81 j;  1HNZ L;  5C0X G;  4GNX A;  3CCL A;  4LUO A;  3RN2 A;  1KQS A;  5IWA L;  5BR8 L;  1XJV A;  2ES2 A;  4JI8 Q;  1X3E A;  2ZTC A;  1NBW A;  3G48 A;  4LFB L;  1L2F A;  2KHI A;  3A5Z B;  3RLN A;  1JJC B;  4JI8 L;  2IHF A;  3JAM c;  2HT1 A;  3K81 C;  1PH1 A;  4JI3 Q;  4POG A;  3PUY A;  3MXN B;  1UEB A;  1XMQ Q;  3CCE A;  3CW2 C;  3UDG A;  1YJ9 A;  1WJJ A;  1IBK Q;  2PMZ E;  2DUD A;  2ZM6 Q;  4JOI C;  4JI3 L;  3S24 A;  1G51 A;  3PF5 A;  4GNX C;  4LF6 L;  1B8A A;  2ALY B;  1IBK L;  2R92 G;  1X6O A;  1MIU A;  4LF9 Q;  2EXD A;  3KYH C;  2YU9 H;  2K5N A;  3W1B A;  1RL2 A;  2K14 A;  1PH4 A;  4JI2 L;  2PQA B;  4IFD I;  2R92 H;  1YI2 A;  4LF9 L;  2I5H A;  2JE6 I;  1FVI A;  4BY7 G;  1XPU A;  2R6G A;  4AYB E;  1EQR A;  1VQK A;  4LF7 L;  4GKK Q;  2JA8 G;  1LUZ A;  2QA4 A;  2HQL A;  2HIV A;  4YCU A;  1HZC A;  4BY7 H;  4Y7N H;  1VQC A;  3PV0 A;  3B6Y A;  2KBN A;  1VQ9 A;  3F8T A;  2JA8 H;  1BBW A;  1FGU A;  1Q8K A;  1X55 A;  4ALP A;  2K50 A;  5JEA G;  3HKZ E;  1XNR Q;  4UY8 C;  2A19 A;  3RNU A;  4L5T A;  2PNH A;  3PO3 G;  1EQQ A;  3GTL H;  1KRS A;  4A3G G;  2Q2I A;  4AIM A;  4O0A A;  2AWN A;  2JJQ A;  1Y1W G;  1XNR L;  3KDF A;  4A3B G;  2Z0S A;  1HZB A;  4JI1 L;  3GD7 A;  3PO3 H;  4A3G H;  1Q1E A;  1GVP A;  1QVC A;  3AYH B;  4UP7 A;  1JB7 A;  4A3B H;  1Y1W H;  1S40 A;  1Q46 A;  4HJ9 A;  4LFC Q;  2ZJR A;  4EQ5 A;  1MJC A;  2EQS A;  3J80 i;  1K73 C;  3J81 i;  1PHJ A;  3M3Y H;  2VQF Q;  1MJE A;  2IY5 B;  1PFS A;  2MFI A;  1CUK A;  3CCU A;  4LFC L;  3PGZ A;  4JBW A;  2Y0S G;  1KRT A;  1XTD A;  1CKN B;  4JBJ A;  5HGQ A;  5AJ3 Q;  2F3I A;  2VQF L;  3DLL A;  4OX9 L;  4JI5 L;  2E2I H;  2Z6K C;  5JJI A;  1V1Q A;  5AJ3 L;  5IY0 A;  2BH2 A;  4B3T Q;  2UUA L;  4AQY L;  2E8G A;  4GN3 B;  1VQP A;  1E22 A;  4WJ4 A;  1PYS B;  1UE6 A;  2BH8 A;  4HJ7 A;  3ERS X;  4R4T A;  1M1K C;  1VQN A;  1XMO Q;  2QGQ A;  4LF4 Q;  1EIF A;  4B3T L;  4XTC S;  2LXJ A;  4B3S Q;  3RLO A;  3S16 H;  1VCI A;  4QJF A;  1N8R C;  2BA0 A;  4GOP A;  1IBL L;  1KHI A;  1BKB A;  2PI2 A;  1XMO L;  4LF5 Q;  1YJN A;  1VQE A;  1GO3 E;  4B3S L;  2L15 A;  4LF8 L;  5HY6 A;  1PH2 A;  2NZH A;  3U4Z A;  1A62 A;  3ZJY C;  2R7F A;  4R1J A;  4X62 Q;  1HNX Q;  4C2M H;  3K7U C; 
#chains in the Genus database with same CATH topology
 3TBI B;  4ZUJ A;  3M9B A;  2D62 A;  3MXN A;  3Q23 A;  1ENC A;  4ZQ3 A;  1SFO H;  4DN4 M;  2JK8 A;  2RHS B;  5IT9 E;  5E3F A;  1D7Q A;  2K05 A;  2F0N A;  2YYZ A;  4O42 A;  2B63 G;  2EYF A;  3AMU A;  5CV9 A;  4FDB A;  3HOX G;  3OIQ A;  4QCL A;  1YNN D;  4XQN A;  4RCN A;  2HHH Q;  1RKN A;  2RQX A;  1HZA A;  2R7Z H;  2PQA A;  1PLF A;  1XNQ Q;  2B8F A;  5IP9 G;  2YV5 A;  1VQF A;  3H3V I;  1PDQ A;  2B2T A;  1BCP C;  4R4Q A;  2F0U A;  4JYA L;  3CC7 A;  1I94 L;  2KHJ A;  4K2L A;  4DV6 L;  5BR8 Q;  2EXZ A;  1EY6 A;  2FIN B;  4WJW A;  1SNM A;  1RIP A;  3GTK H;  4A3J B;  4HR7 B;  4KI0 A;  3VA5 A;  3HOV G;  1SE4 A;  1MHW C;  4ME5 A;  3J7A 5;  1G29 1;  3OYY A;  3H94 A;  3G6J B;  2F0W A;  1XWE A;  2B2W A;  2L55 A;  3I56 A;  3MC0 B;  2F52 A;  1GJX A;  5T1G A;  5EPK A;  2IX3 A;  4JI2 Q;  2VUM G;  4KLK A;  2JQO A;  3PF4 A;  4NMZ A;  1HR0 L;  1GUT A;  3M85 A;  1HNW L;  2F0J A;  1RJT A;  3CPF A;  3TQY A;  3QIA A;  5T1I A;  3UDX A;  1CSP A;  1NMG A;  1JOK A;  1FYC A;  3DUZ A;  1QIL A;  3W3A A;  1CI3 M;  3PUX A;  1FNU A;  1WTW A;  4O2D A;  1YEZ A;  1QB5 D;  3CD6 A;  2BDO A;  2K6A A;  5I6Y A;  1LTT D;  5KND A;  3S1M B;  2D5D A;  3HOX B;  1A8V A;  2M9V A;  2TMP A;  4JI1 Q;  1W2B A;  2NN6 H;  1I4Q A;  4L6T B;  1EYC A;  3A74 A;  5CBE E;  4DF7 A;  1AEX A;  1AN8 A;  2PZU A;  2VW9 A;  1KDC A;  4JC0 A;  4NXM L;  2CH4 A;  1STN A;  5IYB H;  1LT3 D;  1PTO D;  5C4X B;  1EOT A;  4DR6 L;  4ME3 A;  3VYR A;  4DAP A;  2ZTD A;  2EYP A;  5EBD A;  3ULJ A;  1BBX C;  3SK8 A;  1WCM G;  5I6W A;  3GTO H;  4GNX B;  2LMC B;  2C9O A;  2JA6 G;  3HOV B;  3HGB A;  4IUT A;  4PMC A;  1A3T A;  3KLS X;  2K04 A;  1N34 Q;  4HIM A;  2F0L A;  3T53 B;  1KIX A;  1NR4 A;  1IBL Q;  2M2L A;  4IUV A;  5ELE A;  4IFD G;  4A3F H;  4A3M G;  2ZJP A;  1SYD A;  3HOU G;  1EUJ A;  1G2S A;  3U9S A;  4A3C G;  4X65 L;  2HD3 A;  2J0T D;  5IYC G;  2O5J C;  1AH9 A;  1X54 A;  4JI6 L;  1SDF A;  1ASY A;  5FJ8 G;  2JA7 H;  5COR A;  2A6H D;  1HH2 P;  3PUZ A;  5FLM H;  4BWG B;  1CKM A;  1LTG D;  4A75 A;  4BY7 B;  4Y7N B;  3TZD A;  1H9S A;  1EYD A;  3K8A A;  2EVB A;  2XTI A;  1B2T A;  4KY7 A;  1K9M C;  3J80 E;  3J81 E;  4AYB G;  3OTO Q;  1YIT A;  4BXX H;  2F4V L;  4OHJ A;  2CW0 C;  4UHV A;  2F0O A;  3JAM i;  1JE5 A;  4M1U B;  1A15 A;  3A55 A;  4OIK A;  5IGD A;  4LFA L;  5M9O A;  5IP7 G;  3SDZ A;  4ULL A;  1UAP A;  1QOH A;  3A0J A;  3H91 A;  5I9P A;  1N32 Q;  5CV8 A;  1BVS A;  1D6E C;  3QWN A;  1QVG A;  5CYU A;  4DR5 Q;  3NWS A;  2PO4 A;  2E5L L;  3F2B A;  4NPS A;  3FKI G;  2EYM A;  4ZCK A;  2KUM A;  4KD3 A;  4X66 Q;  2V1C C;  2Y0S E;  3ND8 A;  2EPB A;  1QNK A;  1JQY D;  2IX0 A;  3L9A X;  3HOZ G;  1HJP A;  3X3M A;  4A3M B;  2FXQ A;  1B3A A;  3GTQ H;  1I6H H;  1ZYR D;  3DMU A;  3K0Y A;  3HOU B;  1CKN A;  2OQ0 A;  4EQO A;  4PMB A;  2NUC A;  3MWY W;  3NEL A;  4C2M B;  4ZKB B;  1FJG Q;  2PI2 E;  4EX5 A;  3QJY A;  5FO7 B;  4IN3 A;  4OEL B;  2B2U A;  1WYD A;  3E6Z X;  1PYW D;  1Q8I A;  2WB1 B;  1F9R A;  1SYG A;  3I55 A;  2HUG A;  4A93 G;  3DWQ A;  5FLX E;  3GO5 A;  4B9W A;  4C3J G;  4YCV A;  2YTV A;  2ZM6 L;  4IPH A;  1CSQ A;  4CHT B;  2QEX A;  1SE3 A;  3A7L A;  2EIF A;  3GTJ B;  4K0K Q;  4ZRZ A;  3T1H Q;  5CV4 A;  2CCZ A;  1AFP A;  3SXH A;  3GTG B;  5ISR A;  4HTH A;  1WD0 A;  3EIV A;  3RZO B;  5CMD A;  3KF6 B;  4A3E G;  4DV3 L;  2UUC Q;  1J6Q A;  3DWA A;  4B3M Q;  1PH3 A;  1BF4 A;  1KL9 A;  3I3C A;  4JI4 L;  4MNO A;  1GHK A;  1AZP A;  4WRD A;  3GTP B;  4BBS H;  3RZD B;  2ASB A;  4A4I A;  2XVS A;  1ICW A;  3BS1 A;  1CTM A;  1TWF B;  5M5W B;  1IYU A;  5LL6 X;  3GQB A;  1P16 A;  4X64 Q;  1STH A;  4C1N K;  1J9O A;  3TEH B;  1T9H A;  4DV4 L;  1JOO A;  3BDC A;  4XT1 B;  1IBM L;  2CH4 W;  1QUQ A;  5C5M A;  2HCI A;  2SNS A;  3HOZ B;  4V0B A;  4GKJ L;  4IFD J;  1MGS A;  2KVM A;  1IZ6 A;  1TS2 A;  3HS0 C;  1KDA A;  5GAE C;  3ULP A;  4BA1 I;  1YHA A;  3H0G G;  3TP6 A;  4A3J H;  4A3L G;  2CFM A;  1O7I A;  1WTX A;  4IUQ A;  4KV6 A;  4XQQ A;  3CCR A;  4DR2 Q;  2UU9 L;  3CQZ H;  4L5Q A;  1DOM A;  4M8A A;  2WAC A;  3HG9 A;  1AP0 A;  3W5O A;  5LMN W;  4LF4 L;  1JWM D;  2N3S A;  2UXC Q;  1E2Z A;  5M5X B;  1EU3 A;  1O7Y A;  4RKB A;  4AH6 A;  4UP9 A;  2LKV A;  4DV2 L;  4G7H C;  4DNT B;  1S5B D;  3PSI A;  1ESR A;  1SRU A;  4ZLT F;  3OW2 A;  5ELF A;  3OIP A;  5GRO A;  1EIY B;  2EYL A;  4KY5 A;  1H9R A;  4DUZ Q;  2JXM B;  1PA6 A;  4C3H B;  1VF5 C;  3I4M G;  5M3M H;  1TWG B;  3RMH A;  3Q0A A;  3S1M H;  4X3K A;  4ZYS A;  3LGJ A;  4QIW E;  1C48 A;  5I4D A;  2LXK A;  2EY5 A;  1HNZ Q;  1B9M A;  3NBH A;  3I4O A;  1KAB A;  5C4X H;  4KTA A;  1Y8O B;  4LUV A;  4B08 A;  3UDF A;  5C0X G;  4QUF A;  5BR8 L;  1IL8 A;  2ZTC A;  3BZD B;  5JPM C;  4K5W A;  3H0G B;  4RHR A;  3BDL A;  1STA A;  2Z4I A;  1TY2 A;  2IHF A;  2HT1 A;  1RF2 D;  5BN4 A;  3JAM E;  1XMQ Q;  2SDF A;  1UNS A;  1H9S B;  1YJ9 A;  1IBK Q;  2PMZ E;  2DUD A;  4JOI C;  4JI3 L;  2LFN A;  3I8Z A;  2MUY A;  4GNX C;  3TP5 A;  1DZ1 A;  2PPB C;  1X6O A;  4LF9 Q;  1KTK A;  2VB2 X;  1MD2 D;  1RL2 A;  1PH4 A;  4JI2 L;  4IFD I;  2B8G A;  2RDF A;  1YI2 A;  1VF7 A;  1ET6 A;  1LT4 D;  1TII D;  1SNP A;  3I72 A;  1HTP A;  4BY7 H;  1HZC A;  3FVQ A;  5IGB A;  4Y7N H;  4HCS A;  1BDO A;  2AQ3 B;  3B6Y A;  3LX0 A;  3F8T A;  3WOE A;  4C56 C;  1VQ9 A;  1BBW A;  4TKO B;  3OMG A;  4C3I B;  2A19 A;  3I4M B;  3NUC A;  2PNH A;  3S17 B;  3PO3 G;  1CFM A;  5JEA H;  1Y1W G;  1HZB A;  1PFM A;  4JI1 L;  3GD7 A;  3LWU A;  1QVC A;  4I7Z C;  4Q5V A;  2ZJR A;  5I9O A;  2VQF Q;  2IY5 B;  1CUK A;  4LJZ C;  2EJM A;  2Y0S G;  2L0C A;  5CC4 A;  1CKN B;  1ZEQ X;  5AJ3 Q;  2EYJ A;  2XRQ D;  1STE A;  1Q3L A;  1V1Q A;  1TS4 A;  5IY0 A;  1VQP A;  1E22 A;  2ENB A;  2BH8 A;  1ENF A;  4B3T L;  4XTC S;  2E2D C;  2HQE A;  5A2Q E;  1VCI A;  4QJF A;  4GOP A;  1IBL L;  1KHI A;  2YU9 B;  1GO3 E;  1U4L A;  2L15 A;  3ERO A;  2R7F A;  4R1J A;  1DON A;  2SOB A;  4C2M H;  3K7U C;  2DNC A;  3D6W A;  4NXN Q;  2DGY A;  4J15 A;  4DK1 A;  1EFW A;  2UXD L;  3CF5 A;  1DOK A;  4JVZ A;  4OL7 A;  5IIF A;  1JMC A;  1RTO A;  3PQI A;  4XXE A;  4X3U A;  4CJ2 C;  4DV5 Q;  2K4K A;  1YNJ C;  4H13 C;  2IL8 A;  3A8K E;  1IXR A;  4K6D A;  3I73 A;  5EKK A;  5EGT A;  1U4P A;  4B3R Q;  5EKL A;  1Y1W B;  1GUN A;  4ZK9 B;  3GTJ H;  1QCB D;  2JA5 H;  4ZKC B;  2RF4 A;  3M3Y B;  3GTG H;  1Y8P B;  2AWO A;  5DLQ E;  2F1M A;  1SAP A;  4LWC A;  1X32 A;  3CME A;  4KKS A;  1S5F D;  1UE7 A;  2F0G A;  3RN5 A;  1Z9F A;  4YHH L;  4DR5 L;  1RTN A;  5C0X J;  3MFG A;  5CR3 A;  3GTP H;  2B2T C;  3RZD H;  2DJG C;  5COY A;  5KIX A;  2KOL A;  2IPK D;  4FNF A;  4IUR A;  1I6V C;  3EN2 A;  4BY1 G;  1TWF H;  4LNQ A;  1VQB A;  1WOC A;  2WII B;  4R4O A;  4X66 L;  4OWX B;  4P75 A;  1X9N A;  3P7J A;  2JA9 A;  1YBY A;  1VQ4 A;  4E6I A;  4DV1 L;  1BNZ A;  1WTO A;  3MEF A;  1B53 A;  4DR1 Q;  4A3I G;  1VQL A;  4GZY C;  5C3X A;  3K7A B;  4YY3 Q;  1GUO A;  3S14 B;  1TWH B;  5K36 G;  4FF2 A;  4LF7 Q;  2RBM A;  4RWS C;  2NVY B;  1PFN A;  1SXT A;  1TT2 A;  2Q2U A;  1CA6 A;  2A6H C;  3TP8 A;  1F9P A;  1P8L A;  4DR4 L;  4BBR G;  2K7V A;  2F0Q A;  5M5Y B;  4QY7 A;  1VQD A;  1SE2 A;  4CKB A;  1FNV A;  2WB1 E;  1BR9 A;  2RHQ B;  5M3F G;  2BCO A;  1S5D D;  1PH6 A;  3IRB A;  5M5X H;  5K5P A;  3PMF A;  1ILP A;  2K32 A;  2Q2H A;  4K5X A;  1SMY C;  5BN5 A;  1ET9 A;  2K5Q A;  2L9H A;  3F2C A;  4KMU C;  4R4I A;  2BE5 C;  3CC4 A;  1L0X B;  3C1E A;  2OWO A;  1U5K A;  1TXY A;  4YCW A;  1EY0 A;  1XX8 A;  4HED A;  4C3H H;  4AQY Q;  3KJP A;  3VR3 A;  2MP1 A;  4QL5 A;  4DA2 A;  3PO2 H;  5J39 A;  3L7Z C;  3SGI A;  1Y14 B;  4LF8 Q;  4IJL A;  1FNW A;  4JBK A;  1A2U A;  1LTS D;  1VQG A;  4R8I A;  3IFD A;  2J7Z A;  4A3I B;  4K6L A;  2ZXP A;  1Q86 C;  1PMR A;  3M4P A;  4FVM A;  3AFP A;  2VZA A;  1AE3 A;  1LYL A;  4JI0 L;  5C0X I;  2JA8 B;  3MA2 B;  1HUM A;  1H9K A;  2F0V A;  1WD1 A;  1G2T A;  5LL6 S;  4CKE A;  5EAY A;  4JK1 C;  3ICE A;  2B3G A;  4RKL A;  3CXC A;  4IJH A;  4RH6 A;  4Q0F A;  1SRO A;  4J6H A;  3M4O H;  4A3B B;  2ZT9 C;  3NQI A;  2F0I A;  3HZX A;  5I2Y A;  3C3L A;  5LMU L;  1EYA A;  4IPD A;  4NB3 A;  2A68 D;  2CQO A;  2ZTE A;  2AUJ D;  1IYV A;  1JT8 A;  1PVO A;  2QF7 A;  4HMI A;  5IYD G;  3BVM A;  1GKH A;  4IO9 A;  4C3I H;  2MQH A;  3TP7 A;  3KFU A;  4FXK C;  2VQE Q;  1F9S A;  3T13 A;  3PIO A;  4OO1 H;  3A8I E;  1HFN A;  5EQ0 A;  2NN6 I;  4DV0 L;  3Q24 A;  3CCQ A;  2O2L D;  4JBM A;  1XYI A;  2ZXO A;  4JV5 L;  4CDD C;  1X65 A;  4GOP B;  2UUB Q;  1QNU A;  2MHV A;  1XTC D;  3H15 A;  2AQ1 B;  3L2P A;  1X3G A;  2KEN A;  1GUG A;  3QB3 A;  2MJ8 A;  3TRZ A;  4QGU A;  4HIK A;  2J4X A;  4Z9C B;  3T16 A;  2I5L X;  1O7Z A;  2WKD A;  3IL8 A;  1VMP A;  4A76 A;  1XMQ L;  2B63 B;  2UXB Q;  3H3V H;  3L0O A;  1TWA B;  3A56 A;  4DV7 Q;  4BA2 I;  3K5O A;  1GD7 A;  1Y1V G;  3U50 C;  4CJ0 B;  4DU9 A;  2B2U C;  1JJG A;  1YHB A;  1EIH A;  4DR7 L;  1EQT A;  1FR3 A;  3ZYY X;  3H3V C;  3UE0 A;  5EPJ A;  1J5E Q;  1D1I A;  1EY4 A;  5C44 H;  1FL0 A;  3CCM A;  2AHO B;  4JW0 A;  5IOD A;  4QMG A;  4DPG A;  2A6E D;  5FO9 B;  3U4V A;  4RGT A;  1VQH A;  2A69 D;  5C4J B;  1LT6 D;  1E1T A;  2L4N A;  4S3S A;  1IYJ B;  2R93 G;  2XWJ B;  1LLR D;  1B3Q A;  1N36 Q;  4PZ8 A;  2F0M A;  5IE8 A;  2FMM A;  2A1A A;  5JAV A;  4A3K G;  1SN8 A;  3VYS A;  3SE0 A;  1B9N A;  2K33 A;  3K80 C;  1VQI A;  4PZ6 A;  1OXT A;  2EY1 A;  1LTA D;  1Q81 C;  2EY2 A;  1PH9 A;  2VUM B;  2WAQ E;  4F7X A;  3STB D;  2VY3 A;  3VR4 A;  3CAM A;  2OF1 A;  3DEP A;  4DNI A;  3HOW G;  1LAB A;  3K57 A;  5GQO A;  3KJO A;  1S72 A;  3URY A;  2I0Q A;  1SLJ A;  5KRU A;  1I50 B;  2MNA A;  2NTT A;  5IGC A;  3P20 A;  1MKH A;  4I7A A;  3K59 A;  2NVT B;  4IZ8 A;  1PRT D;  2CKZ B;  5G3L D;  1JOR A;  3BU2 A;  2JEB I;  1F2M A;  1E24 A;  5CV7 A;  5JPN C;  1N33 Q;  3NQT A;  2E2H B;  3UDI A;  5IOC A;  2CWA A;  1L1O A;  2YTY A;  3I4N G;  1HRJ A;  3HKZ G;  1Q90 A;  2NVY H;  1K83 B;  3PCO B;  5C3E H;  4KKU A;  4JCV E;  1TS5 A;  5HUR A;  5M5Y H;  2XRS D;  4A3D G;  4KHZ A;  4GN5 A;  1UE1 A;  1WCM B;  5GAG C;  5LMN L;  4KHP L;  1QE6 A;  2IX1 A;  5C6A A;  3HOY H;  2OCE A;  3MXU A;  2JA6 B;  2R93 B;  1OXX K;  4KJO A;  2Z9H A;  2A5H A;  3FP9 A;  4DR3 Q;  5KEE A;  2FHT A;  2F0P A;  2K5V A;  4A3K B;  1B70 B;  4ILW A;  3S9W A;  2N49 A;  3CCL A;  2F0T A;  1T5E A;  1KQS A;  2K01 A;  5IWA L;  1XJV A;  2ES2 A;  4JI8 Q;  3GP7 A;  1X3E A;  3G48 A;  5DM7 3;  3A5Z B;  4N8X 1;  1RHP A;  3HOW B;  3MXN B;  1UEB A;  4P2C B;  3CW2 C;  3UDG A;  1K8O A;  3S24 A;  1G51 A;  1LV9 A;  2CHB D;  2R92 G;  1CT1 D;  1PTO B;  1MIU A;  1M8A A;  1EIG A;  2EXD A;  4AYB B;  1D5X C;  1SYE A;  1JWU D;  1D5M C;  2PQA B;  2DY7 A;  1I3Q B;  3R3O A;  1XPU A;  3S1Q B;  1EQR A;  1VQK A;  4LF7 L;  1DJR D;  2QA4 A;  3HKZ B;  4F87 A;  4H7B A;  2KBN A;  2JA8 H;  1Q8K A;  4XDX A;  4ALP A;  2LY7 A;  4UY8 C;  4LK1 C;  4A3D B;  4FO2 A;  2NVQ B;  4A3G G;  2Q2I A;  5F2D A;  1BCP D;  2JJQ A;  3FKI B;  1XNR L;  3KDF A;  1JIC A;  1GVP A;  4A3B H;  4HJ9 A;  2EQS A;  1KNE A;  3EVQ A;  1MBY A;  2MFI A;  4QF4 A;  4LFC L;  3PGZ A;  1NAP A;  2K28 A;  2RVL A;  4JBJ A;  4DAY A;  3WOF A;  3MFY A;  3DLL A;  2JSO A;  2Z6K C;  2NYZ D;  1BO0 A;  1F9Q A;  4AQY L;  2E8G A;  3OMC A;  3S1N B;  1IW7 C;  1XMO Q;  1EIF A;  2LXJ A;  3RLO A;  4A93 B;  1WTP A;  4LAA A;  4C3J B;  1BKB A;  2PI2 A;  2E75 C;  4JPB W;  1YJN A;  5BN3 A;  1EEI D;  4DAV A;  4B3S L;  4FP5 D;  4LF8 L;  3BVG A;  2R92 B;  4O1N A;  1PH2 A;  1A62 A;  2L11 A;  3ZJY C;  5DEH A;  1V9P A;  2G9D A;  4HAE A;  3SK5 A;  1CM9 A;  1VQ6 A;  4HJA A;  1HNX L;  2B2V A;  5IT9 c;  2BA1 A;  3PIP 3;  4GOP C;  1G91 A;  4A3E B;  3OHX C;  5HGT A;  1A2T A;  3KBX A;  2R7Z G;  1II3 A;  1DXM A;  3K6O A;  1K0S A;  1LO5 D;  4DGZ A;  3HOX H;  1TWA H;  4A3G B;  3MTS A;  3HFZ B;  2O4X A;  1I94 Q;  2HHH L;  3D4W A;  3Q22 A;  1PH5 A;  3BZK A;  1XNQ L;  4DV6 Q;  5IP9 H;  4F88 A;  2B2Y C;  4CDE C;  3GV6 A;  1EY8 A;  1TWC B;  4DK3 C;  4LFB Q;  1X56 A;  4OO1 G;  1SNC A;  3IKJ A;  1EWC A;  1PZK D;  2E2I B;  1WI5 A;  3GDE A;  3QO2 A;  3I7F A;  3VYU A;  3E3X A;  1X3Q A;  2K75 A;  4RA8 A;  3HOV H;  3KLW A;  4X3T A;  3MVV A;  4RMF A;  1SYF A;  3R2I A;  3S16 B;  2PYK A;  4LF6 Q;  2WAQ G;  1ROD A;  3QOL A;  3M4Q A;  3S15 B;  1HR0 Q;  4MIU A;  1X3P A;  4P73 A;  3CC2 A;  1HNW Q;  3K5L A;  4PNY A;  4UDU C;  2VUM H;  3S2H B;  2F0S A;  2NZO A;  2K1B A;  4G7Z C;  1L1O B;  3NEN A;  1C4Q A;  1QVF A;  1L0Y B;  5E1F A;  1E2V A;  4OXP A;  1HPC A;  4FF4 A;  1S5E D;  3ULL A;  5FK9 C;  2NN6 G;  2H4O A;  1I50 H;  1SYB A;  4QUC A;  1STG A;  1D1K A;  1EOV A;  1YNN C;  4NXM Q;  2ICI A;  4GLA C;  3L3O C;  5IYB G;  4XYO A;  4DR6 Q;  2BOS A;  1YHQ A;  2H5X A;  2E2H H;  1EYG A;  1AE2 A;  2N8N A;  2IJ0 A;  2CQA A;  1CQV A;  3M7N A;  1K83 H;  1WTQ A;  1VQ8 A;  4OX9 Q;  2EJF C;  3NPP A;  4NDX A;  1K8G A;  1JC7 A;  4V19 0;  2H1E A;  2JYO A;  2Z6B A;  1PTO F;  2Q8T A;  5A35 A;  2UUA Q;  4ZAI A;  4P74 A;  4MTN A;  2GA4 B;  1VQO A;  4A3F G;  2F03 A;  4L5S A;  2SEB D;  2JA6 H;  2F0E A;  3E9H A;  4UAI A;  4YWK A;  5J3B A;  1M90 C;  2ICE C;  2I07 B;  5D65 A;  2QDL A;  3RD4 A;  1I5F A;  4ABN A;  1N34 L;  4JI6 Q;  3FRP B;  4G57 A;  3KOJ A;  4IFD H;  5NUC A;  1VQM A;  1V43 A;  2JA7 G;  4A3M H;  1QZG A;  1H95 A;  3HOU H;  5FLM G;  4P72 A;  4A3C H;  5EPL A;  5IYC H;  2IT1 A;  3CCS A;  1CKO A;  2GVB A;  1LTL A;  5FJ8 H;  5IGG A;  1MSH A;  4DUY Q;  1K3B C;  4NP5 A;  4IUN A;  2AKW B;  5ELN A;  2PQE A;  1KC8 C;  4BXX G;  2MPM A;  3DXJ C;  3CP0 A;  3SEB A;  4KJN A;  3NXW A;  3J80 c;  3J81 c;  3GTL B;  1MSG A;  1ENA A;  1IHZ A;  3KBG A;  4LFA Q;  3FDT A;  3X3N A;  2VNU D;  2EE1 A;  1PTO H;  3PO3 B;  1OXS C;  3A5U A;  4HJ8 A;  3OTO L;  1PRT F;  5G3L F;  3NTK A;  1TKW B;  2F3W A;  1N33 L;  2RDH A;  2L1B A;  3F1Z A;  2HIX A;  1I3Q H;  5IP7 H;  3A54 A;  1QUQ B;  3RZO H;  1B7Y B;  2E5L Q;  1PTO C;  2KEE A;  3GTO B;  1N32 L;  1HQM C;  5TSS A;  1EEF D;  3MZ5 A;  3G7L A;  2Y0S B;  3E5S A;  3F2U A;  3PUW A;  4DAY B;  3MXP A;  1LM0 A;  3DWP A;  4H02 A;  3ITP A;  4Y52 H;  1U4M A;  4IPG A;  3LNN A;  4APV A;  4A3F B;  3FKI H;  5E7N A;  5M5W H;  3J7Y W;  1SEB D;  4X6A H;  1V1P A;  4GLX A;  1HXY D;  4LW1 A;  3W1G A;  1VQJ A;  3CMA A;  1QZH A;  2F0D A;  3BYY B;  3DM1 A;  3D3R A;  5CBA E;  2PW5 A;  1YJW A;  4DR3 L;  4FF1 A;  1JCK B;  3HOZ H;  3HKS A;  1O80 A;  4U68 A;  5L37 A;  2Z8L A;  3FPU B;  1JR0 D;  2ID0 A;  2JN4 A;  3N52 A;  3KK7 A;  4GLV B;  2B2W C;  3STB C;  1K28 A;  1FJG L;  3T4A C;  5FLX c;  1D2B A;  3T1Y Q;  1VS0 A;  2SNM A;  3S1N H;  2C5C A;  1UEA B;  1SMX A;  5KNC A;  4CGY B;  4BS9 A;  4IOC A;  4A93 H;  1V1O A;  2KCN A;  4C3J H;  1B4O A;  2DY8 A;  2IW3 A;  2MGS A;  3D31 A;  2TSS A;  2D9U A;  1JOQ A;  4DV3 Q;  3DHQ A;  1KLG D;  4EVO A;  1GM5 A;  2OT2 A;  2XIW A;  3U58 A;  2KQ3 A;  2DN8 A;  4K0K L;  5JJK A;  4JI4 Q;  1R4Q B;  3T1H L;  3ER0 A;  4BBS G;  2X69 A;  4WFN 3;  3NBH B;  2QEJ C;  2E2J B;  4A3E H;  3CPW A;  2I5M X;  2UUC L;  4B3M L;  4UPA A;  1U0L A;  1I4R A;  1Z6H A;  3EQL C;  4LUZ A;  1EL0 A;  1PV4 A;  1TWG H;  1EZ8 A;  4DV4 Q;  1IBM Q;  4IUU A;  4F8M A;  4RG1 A;  1EWI A;  1VMC A;  2M00 A;  4GKJ Q;  4BY1 B;  1VQ5 A;  1DD2 A;  1E7Z A;  1SNQ A;  3GTQ B;  1BCP F;  1C0A A;  3VR5 A;  4X64 L;  2NB0 A;  3AEV A;  1OXU A;  3KUP A;  4A3J G;  1ESF A;  1TWC H;  2R7D A;  1QJO A;  1ZYR C;  4POF A;  5DM6 3;  2Z4H A;  2UU9 Q;  3CHB D;  5JOB A;  1NE3 A;  3VA7 A;  3EFX D;  2NWG A;  1NMF A;  2NVX B;  2MO0 A;  3H0G H;  2XN9 C;  2E76 C;  3NEM A;  4A3L H;  2BDN A;  4OO1 I;  4BBR B;  4DV2 Q;  4DR2 L;  1NUC A;  5C5L A;  1O78 A;  1NY4 A;  1RD9 D;  4KHV A;  3S15 H;  1WTV A;  5GAH C;  1RDP D;  4TQU S;  2EJG C;  1ML0 D;  5M3F B;  4L63 B;  1SR3 A;  2UXC L;  4PZ7 A;  5DAU A;  3K5M A;  1YZ6 A;  4X3S A;  3CKI B;  3S2H H;  1GUS A;  1QG7 A;  5KYL A;  3FPP A;  3W2D A;  3JC6 6;  4J1M A;  3TME A;  5M3M G;  4BBS B;  1EU4 A;  1EQV A;  2VS1 A;  1KAA A;  1W6K A;  3NBI A;  4RFB A;  4DUZ L;  2GN5 A;  1HA6 A;  4QIW B;  4JI7 Q;  2ATW A;  3FHW A;  4C1N I;  3P75 A;  4L5R C;  3I4M H;  3S17 H;  1L1O C;  1XPR A;  1LTI D;  2F0F A;  1DM0 B;  3TN2 A;  2OQK A;  5GAD C;  3D6C A;  5C4X G;  2D0O A;  3KF6 A;  1CHP D;  5LHY 1;  1K8A C;  4MHE A;  5H1S E;  3K0X A;  3PIP A;  3OWE B;  4TVA B;  3NK9 A;  1SND A;  1STB A;  1HNZ L;  3AQQ A;  2IHE A;  2KJX A;  4LUO A;  1EY7 A;  3RN2 A;  4H44 C;  1NBW A;  1BXT A;  4LFB L;  5C0X H;  1B44 D;  2XSC A;  1L2F A;  2KHI A;  2PMZ B;  1XXG A;  3RLN A;  2B39 A;  1JJC B;  3T56 B;  3JAM c;  1SNO A;  3K81 C;  5C3W A;  3CQZ B;  1V8Q A;  4JI3 Q;  4POG A;  4RGN A;  3CCE A;  1O7L A;  1WJJ A;  2DNE A;  4KN4 C;  5KYI A;  1F2L A;  3PF5 A;  4LF6 L;  1B8A A;  1IBK L;  2YU9 H;  2K03 A;  3W1B A;  1GOZ A;  2K14 A;  3UI2 A;  1K8M A;  2VB3 X;  4LF9 L;  2F0H A;  1FVI A;  2JE6 I;  4BY7 G;  2QIL A;  5CGK A;  1H9M A;  4GKK Q;  1QWY A;  3K5N A;  1ZKO A;  1YNJ D;  4ODG A;  3S1R B;  2XNA C;  5M3M B;  1LTR D;  4K8J A;  1FGU A;  1X55 A;  5JEA G;  3QR8 A;  4RGO S;  3SHL A;  2N88 A;  1EQQ A;  4IAL A;  3GTL H;  4O0A A;  2QKI C;  1G6Z A;  2AWN A;  4N9P A;  2Z0S A;  3PO3 H;  2RSO A;  1I4G A;  3AYH B;  4UP7 A;  1UUP A;  3I70 A;  1Y1W H;  1S40 A;  1Q46 A;  1V1P B;  3QOJ A;  4EQ5 A;  1MJC A;  1K73 C;  3TZU A;  3M3Y H;  1MJE A;  1IKL A;  3CCU A;  5JVG 3;  2HCC A;  5HGQ A;  5AFW A;  2F3I A;  1M4V A;  2VQF L;  2Z1C A;  1JE4 A;  4OX9 L;  5AJ3 L;  4B3T Q;  2UUA L;  1ZXT A;  1I4H A;  4GN3 B;  4K14 A;  2EZV A;  4WJ4 A;  1PYS B;  2PZT A;  1EY5 A;  5IT9 L;  1N8R C;  3A8J E;  2EDG A;  4LF5 Q;  2R61 A;  5HY6 A;  3NP8 A;  2NZH A;  1PZI D;  1U9R A;  4X62 Q;  2UXD Q;  1Y1V B;  3V2T A;  3K7A H;  3VR6 A;  3S14 H;  1TWH H;  1J8I A;  1BBU A;  1EY9 A;  2WB1 G;  2JEA I;  4WJ3 M;  1W3S A;  4HSP A;  4R4C A;  4NXN L;  4TRD A;  4DUY L;  1FD7 D;  1KAW A;  1L0W A;  1F2Y A;  5J22 A;  4GS3 A;  2O5I C;  4XYQ A;  3OSO A;  3TS0 A;  2G9H D;  4DV5 L;  1TS3 A;  2N55 A;  2JA5 G;  1DGS A;  1SMY D;  3ONA B;  3C46 A;  1HA5 A;  3IAY A;  2AQ2 B;  2B2V C;  4NKL A;  2XWB B;  2OEO A;  2BE5 D;  4YIJ A;  1OXV A;  4B3R L;  3HP3 A;  3OWF A;  3EA6 A;  2F4I A;  3I4L A;  3SK4 A;  4YHH Q;  2L12 A;  3EJI A;  1HR0 W;  1E0B A;  3AFQ A;  3RR5 A;  4DK6 C;  2E2J H;  4RCO A;  2VXW A;  5JVH 3;  5ELO A;  4K8I A;  1R4P B;  1R9T B;  1CZW A;  3TRE A;  3TS2 A;  1OTC A;  3GTM B;  5ELC A;  4GN4 B;  4DV1 Q;  3D4D A;  1E3P A;  2KCT A;  1K0R A;  2R3Z A;  4P71 A;  4BY1 H;  2OXP A;  1F2Z A;  5CV5 A;  5D3I B;  3V96 A;  2HDL A;  4DXF A;  3R93 A;  4WOR A;  1KXL A;  1D8L A;  3S2D B;  3OW7 A;  4UP8 A;  3J7Z C;  4DR1 L;  4A3I H;  4DR4 Q;  4TSS A;  4DNR B;  1B50 A;  2RCF A;  2FFK B;  1YVC A;  4MZ9 A;  4YY3 L;  2HDM A;  4OON A;  5K36 H;  1TVX A;  1I4P A;  1UE5 A;  4OIJ A;  2F0K A;  4FXG C;  4RGM A;  3I4N B;  2NVX H;  1Q7Y C;  3TDQ A;  3VYT A;  4QB4 A;  1A3V A;  3NHH A;  1D5Z C;  4IPC A;  1G8Z D;  3T1Y L;  4BBR H;  1XPO A;  2F3V A;  3KF8 A;  5JEA J;  2WFW A;  3UE1 A;  3NSW A;  4PV1 C;  1S5C D;  5M3F H;  2JA5 B;  3H6M A;  1H9J A;  1DYQ A;  5E4X A;  1KDB A;  1YNX A;  1NJI C;  3E9I A;  4L8J A;  3I2Z A;  3OPO A;  3NE5 B;  1PH7 A;  1SJH D;  2RDG A;  4C3H G;  1U4R A;  4FYD A;  1ONL A;  1PFB A;  1S4Z A;  4JI5 Q;  4ID6 A;  4H0L C;  1AZQ A;  5IGE A;  1VQA A;  5IGF A;  3PO2 G;  3RLF A;  2KCM A;  5EJW A;  3G4S A;  3T51 B;  1PRT B;  3CRL C;  2GVA A;  4PG3 A;  1UWV A;  1Y8N B;  3MAQ A;  4XIG S;  5JJZ A;  2X6G A;  2NBF A;  3J80 L;  2RCN A;  3J81 L;  1JJ2 A;  1NSN S;  1X3F A;  2K52 A;  2K5H A;  1PZJ D;  3KLS A;  3G71 A;  4KK7 A;  1F77 A;  4JI0 Q;  1VDZ A;  2L5T A;  1NNX A;  4YWM A;  2QDB A;  3DM3 A;  2PCF B;  2LSS A;  2PZW A;  3SR1 A;  1KLU D;  1AW7 A;  1PH8 A;  1E2W A;  2XGT A;  4MTK A;  3BG3 A;  2EOT A;  4QQB X;  1TU2 B;  3K58 A;  2B63 H;  3BVZ A;  1WVL A;  1BQQ T;  2JP1 A;  3PIO 3;  1Q82 C;  1CHQ D;  4JYA Q;  3HEJ A;  5LMU Q;  1WTR A;  5CV6 A;  4N9T A;  4OWW B;  1A0I A;  2Q8I B;  1KNA A;  1NCV A;  1HHV A;  2B29 A;  4FF3 A;  2E74 C;  3NTI A;  1A63 A;  1HCZ A;  3AU7 A;  3CU7 A;  4C3I G;  3S1R H;  1C7Y A;  3CCJ A;  2OTJ A;  1I4X A;  1HQR D;  3D0F A;  2P5Z X;  2PW7 A;  1T5X D;  2KED A;  3PUV A;  4DV0 Q;  1Y69 U;  1JB3 A;  3PO2 B;  4JI7 L;  3R2T A;  1CZG A;  5C4J H;  2WP8 J;  5IYD H;  3ERQ A;  2QW7 A;  4JV5 Q;  2OTL A;  2VQE L;  1WTH A;  1LAC A;  2KA7 A;  3BJU A;  4KY6 A;  3C2P A;  5D3D A;  3FEW X;  5FLX L;  3P1H A;  4HN7 A;  5D14 A;  3N6R A;  4G4K A;  4IQZ A;  4HIO A;  2FJ2 A;  1SE8 A;  4DAM A;  4HID A;  4PMW A;  2A8V A;  1Q1B A;  3GV3 A;  1TR5 A;  1ILQ A;  3SVM A;  2WV6 D;  5ELB A;  1SFO B;  2UUB L;  3F2D A;  2DJF C;  4K5V A;  3BYT B;  2ZJQ A;  1BCP B;  3C1F A;  1W6J A;  3BDO A;  3A7A B;  4XT3 B;  2R7Z B;  2CW0 D;  2NVT H;  1HUN A;  4DR7 Q;  1EWH A;  3M4O B;  5FO8 B;  2UXB L;  4DV7 L;  4FXD A;  4G7O C;  5C44 G;  2EY6 A;  1Y1V H;  3CCV A;  4LMQ D;  3J7A F;  1RCV D;  3EBE A;  3O13 A;  1KD1 C;  2A74 C;  3GTK B;  1Q12 A;  3H09 A;  3G6E A;  4GKK L;  2KHS A;  5FKA C;  4KKT A;  2RKS A;  1J5E L;  2K5W A;  3R8B A;  2A68 C;  3SK6 A;  1N9W A;  3KLR A;  4DXG A;  2MO1 A;  4KD4 A;  1B1Z A;  1WCM H;  3J7A V;  1BUV T;  2EYH A;  5JJL A;  1SJE D;  1C9O A;  1K3R A;  2Z6K A;  5J1Z A;  2Q8R E;  4HJ5 A;  2R93 H;  2EYO A;  1IL2 A;  4X65 Q;  3VDY A;  2CVR A;  2WAQ B;  5FOB B;  1N36 L;  1HZ9 A;  3U9O A;  2CWP A;  4A3K H;  1ASZ A;  3NTH A;  4IOA A;  1VQ7 A;  4CDC C;  1MI2 A;  1SYC A;  3NWT A;  1NTG A;  4IUP A;  2AMC B;  3E0J A;  1EZ6 A;  2RSN A;  3I91 A;  1TQO A;  2VL6 A;  4JG2 A;  2KCC A;  1R9T H;  4NW2 A;  2YTX A;  1CQF A;  3HOW H;  1LTB D;  3GTM H;  4MN3 A;  3IFT A;  3BZC A;  2F4V Q;  2C35 B;  4RHS A;  1ICF B;  1C8C A;  3KF8 B;  2NZ1 D;  4N8F A;  4LF5 L;  1GXD C;  4XQJ A;  5C3E G;  3S2D H;  4YWL A;  1Z47 A;  3KDF B;  3MHB A;  1YIJ A;  3D4R A;  3CRK C;  2WIN B;  3VR2 A;  3Q6S A;  4X62 L;  5C44 B;  4HCE A;  1G6P A;  3MXG A;  3S1Q H;  3E0E A;  2I46 A;  2B2Y A;  1EFI D;  3I4N H;  1E1O A;  5LMN Q;  4KHP Q;  5EKI A;  5C4Z A;  3HOY G;  2N78 A;  1HTL D;  1PYB A;  4KN7 C;  2A6E C;  1STY A;  4EGV A;  3HRZ C;  4R8N A;  2Q2T A;  4A3D H;  2NVQ H;  1S3O A;  4OEM B;  2A69 C;  2D0P A;  4DKA C;  3Q8D A;  1Z7T A;  3JAM L;  3MEH A;  2IWH A;  4U67 3;  3QG1 A;  3WWV A;  1SSO A;  4OWT B;  4K2K A;  5C4H A;  5IWA Q;  1WFQ A;  4JOI A;  3J81 j;  2AUK A;  4GNX A;  3FMC A;  2JA7 B;  2WKC A;  3I90 A;  2V4D A;  2ZXR A;  1IW7 D;  4JI8 L;  2A73 B;  1PH1 A;  3PUY A;  2D2C C;  2RA4 A;  2FMC A;  2G5D A;  4PQX A;  2ZM6 Q;  4OGQ C;  1SBB B;  5EBC A;  2X6L A;  4CKC A;  2ALY B;  4I65 A;  4DFA A;  3KYH C;  2K5N A;  1PRT C;  2R92 H;  2I5H A;  5C3E B;  4DK0 A;  2R6G A;  4AYB E;  1A3U A;  2JA8 G;  1LUZ A;  1GUW A;  2HQL A;  2HIV A;  4YCU A;  1VQC A;  3PV0 A;  1CA5 A;  4EQN A;  1OO9 B;  1DOL A;  1PXU A;  1TY0 A;  3WDN A;  2K50 A;  3HKZ E;  1XNR Q;  3RNU A;  3HOY B;  4L5T A;  1IKM A;  3TSS A;  1BOS A;  1KRS A;  3DEO A;  4EQP A;  4AIM A;  1DCZ A;  4ZUI A;  4CDF C;  4A3B G;  4HSV A;  1GHJ A;  4A3G H;  1Q1E A;  1JB7 A;  5DNF A;  5E4W C;  4CBV A;  4LFC Q;  3RUZ A;  5I2X A;  1I6H B;  3J80 i;  1NR2 A;  3M4Y A;  3V05 A;  3J81 i;  2PNR C;  1PHJ A;  5A2Q L;  1CK1 A;  1PFS A;  4JBW A;  3M7G A;  1KRT A;  1XTD A;  4R9W A;  2LS0 1;  3LWE A;  3ND9 A;  2QCP X;  4JI5 L;  2E2I H;  4HMJ A;  5JJI A;  1A6X A;  2BH2 A;  3D8G A;  2NTS A;  2KEC A;  5ELD A;  1FGB D;  1LT5 D;  4J8Q A;  1UE6 A;  4HJ7 A;  3ERS X;  4R4T A;  1M1K C;  1VQN A;  2QGQ A;  4LF4 Q;  2K5D A;  4B3S Q;  4B9X A;  3S16 H;  1JWS D;  2BA0 A;  4CJ1 B;  1XMO L;  4RAU C;  1VQE A;  5KGU A;  5KNB A;  3U4Z A;  3AB9 A;  1HNX Q;  3OOC A;  1HFG A; 
#chains in the Genus database with same CATH homology
 3TBI B;  4ZUJ A;  3M9B A;  2D62 A;  3MXN A;  3Q23 A;  1ENC A;  1SFO H;  4ZQ3 A;  4DN4 M;  2JK8 A;  2RHS B;  5IT9 E;  5E3F A;  1D7Q A;  2B63 G;  2F0N A;  2YYZ A;  2K05 A;  4O42 A;  2EYF A;  3AMU A;  5CV9 A;  4FDB A;  3HOX G;  3OIQ A;  4QCL A;  1YNN D;  4XQN A;  4RCN A;  2HHH Q;  1RKN A;  2RQX A;  1HZA A;  2R7Z H;  2PQA A;  1PLF A;  1XNQ Q;  2B8F A;  5IP9 G;  2YV5 A;  1VQF A;  3H3V I;  1PDQ A;  2B2T A;  1BCP C;  4R4Q A;  4JYA L;  2F0U A;  3CC7 A;  1I94 L;  2KHJ A;  4K2L A;  4DV6 L;  5BR8 Q;  2EXZ A;  1EY6 A;  2FIN B;  4WJW A;  1SNM A;  1RIP A;  3GTK H;  4A3J B;  4KI0 A;  4HR7 B;  3VA5 A;  3HOV G;  1SE4 A;  4ME5 A;  3J7A 5;  1G29 1;  3OYY A;  3H94 A;  3G6J B;  2F0W A;  1XWE A;  2B2W A;  2L55 A;  3I56 A;  3MC0 B;  2F52 A;  1GJX A;  5T1G A;  5EPK A;  2IX3 A;  4JI2 Q;  2VUM G;  4KLK A;  2JQO A;  3PF4 A;  4NMZ A;  1HR0 L;  1GUT A;  3M85 A;  1HNW L;  2F0J A;  1RJT A;  3CPF A;  3TQY A;  3QIA A;  5T1I A;  3UDX A;  1CSP A;  1NMG A;  1JOK A;  1FYC A;  3DUZ A;  1QIL A;  3W3A A;  1CI3 M;  3PUX A;  1FNU A;  1WTW A;  4O2D A;  1YEZ A;  3CD6 A;  1QB5 D;  2BDO A;  2K6A A;  5I6Y A;  1LTT D;  5KND A;  3S1M B;  2D5D A;  3HOX B;  1A8V A;  2M9V A;  2TMP A;  4JI1 Q;  1W2B A;  2NN6 H;  1I4Q A;  4L6T B;  1EYC A;  3A74 A;  5CBE E;  4DF7 A;  1AEX A;  1AN8 A;  2PZU A;  2VW9 A;  1KDC A;  4JC0 A;  4NXM L;  1STN A;  5IYB H;  1LT3 D;  1PTO D;  5C4X B;  1EOT A;  4DR6 L;  4ME3 A;  3VYR A;  4DAP A;  2ZTD A;  3ULJ A;  2EYP A;  5EBD A;  1BBX C;  3SK8 A;  1WCM G;  5I6W A;  3GTO H;  4GNX B;  2LMC B;  2JA6 G;  2C9O A;  3HOV B;  3HGB A;  4IUT A;  4PMC A;  1A3T A;  3KLS X;  2K04 A;  1N34 Q;  4HIM A;  2F0L A;  3T53 B;  1KIX A;  1NR4 A;  1IBL Q;  2M2L A;  4IUV A;  5ELE A;  4IFD G;  4A3F H;  4A3M G;  2ZJP A;  3HOU G;  1SYD A;  1EUJ A;  1G2S A;  3U9S A;  4A3C G;  4X65 L;  1AH9 A;  2J0T D;  5IYC G;  2O5J C;  1X54 A;  4JI6 L;  1SDF A;  1ASY A;  5FJ8 G;  2JA7 H;  5COR A;  2A6H D;  1HH2 P;  3PUZ A;  5FLM H;  4BWG B;  1CKM A;  1LTG D;  4A75 A;  4BY7 B;  4Y7N B;  3TZD A;  1H9S A;  3K8A A;  1EYD A;  2EVB A;  2XTI A;  1B2T A;  4KY7 A;  1K9M C;  3J80 E;  3J81 E;  4AYB G;  3OTO Q;  1YIT A;  4BXX H;  2F4V L;  4OHJ A;  3JAM i;  2CW0 C;  2F0O A;  1JE5 A;  4LFA L;  1A15 A;  3A55 A;  4M1U B;  4OIK A;  5IGD A;  5IP7 G;  5M9O A;  3SDZ A;  4ULL A;  1UAP A;  1QOH A;  3A0J A;  3H91 A;  5I9P A;  1N32 Q;  5CV8 A;  1BVS A;  1D6E C;  3QWN A;  1QVG A;  4DR5 Q;  5CYU A;  3NWS A;  2PO4 A;  2E5L L;  3F2B A;  4NPS A;  3FKI G;  2EYM A;  4X66 Q;  2KUM A;  4KD3 A;  2V1C C;  2Y0S E;  3ND8 A;  2EPB A;  1QNK A;  1JQY D;  2IX0 A;  3HOZ G;  3L9A X;  1HJP A;  3X3M A;  4A3M B;  2FXQ A;  3GTQ H;  1I6H H;  1B3A A;  1ZYR D;  3DMU A;  3K0Y A;  3HOU B;  1CKN A;  2OQ0 A;  4EQO A;  4PMB A;  3NEL A;  2NUC A;  3MWY W;  4C2M B;  4ZKB B;  1FJG Q;  2PI2 E;  4EX5 A;  3QJY A;  5FO7 B;  4IN3 A;  2B2U A;  1WYD A;  3E6Z X;  1PYW D;  1Q8I A;  2WB1 B;  3I55 A;  1F9R A;  1SYG A;  2HUG A;  4A93 G;  3DWQ A;  5FLX E;  3GO5 A;  4B9W A;  4C3J G;  4YCV A;  2YTV A;  2ZM6 L;  4IPH A;  1CSQ A;  4CHT B;  2QEX A;  1SE3 A;  4K0K Q;  2EIF A;  3A7L A;  3GTJ B;  4ZRZ A;  3T1H Q;  5CV4 A;  2CCZ A;  1AFP A;  3SXH A;  3GTG B;  5ISR A;  4HTH A;  1WD0 A;  3EIV A;  3RZO B;  5CMD A;  3KF6 B;  4A3E G;  4DV3 L;  2UUC Q;  1J6Q A;  4B3M Q;  3DWA A;  1PH3 A;  1BF4 A;  1KL9 A;  3I3C A;  4JI4 L;  4MNO A;  1GHK A;  1AZP A;  4WRD A;  4BBS H;  3GTP B;  3RZD B;  2ASB A;  4A4I A;  2XVS A;  1ICW A;  3BS1 A;  1CTM A;  1TWF B;  5M5W B;  1IYU A;  5LL6 X;  3GQB A;  1P16 A;  4X64 Q;  1STH A;  4C1N K;  1J9O A;  3TEH B;  1T9H A;  4DV4 L;  1JOO A;  3BDC A;  4XT1 B;  1IBM L;  1QUQ A;  5C5M A;  2HCI A;  4IFD J;  2SNS A;  4V0B A;  4GKJ L;  3HOZ B;  1MGS A;  2KVM A;  1IZ6 A;  1TS2 A;  3HS0 C;  1KDA A;  5GAE C;  3ULP A;  4BA1 I;  1YHA A;  3H0G G;  4A3J H;  3TP6 A;  4A3L G;  2CFM A;  1O7I A;  1WTX A;  4IUQ A;  4KV6 A;  4XQQ A;  3CCR A;  4DR2 Q;  2UU9 L;  3CQZ H;  4L5Q A;  1DOM A;  4M8A A;  2WAC A;  3HG9 A;  1AP0 A;  3W5O A;  5LMN W;  4LF4 L;  2N3S A;  2UXC Q;  1JWM D;  1E2Z A;  5M5X B;  1EU3 A;  1O7Y A;  4RKB A;  4AH6 A;  4UP9 A;  4DV2 L;  2LKV A;  4G7H C;  4DNT B;  1S5B D;  3PSI A;  1ESR A;  1SRU A;  4ZLT F;  3OW2 A;  5ELF A;  3OIP A;  5GRO A;  1EIY B;  2EYL A;  4DUZ Q;  1H9R A;  4KY5 A;  2JXM B;  1PA6 A;  4C3H B;  1VF5 C;  3I4M G;  5M3M H;  1TWG B;  3RMH A;  3Q0A A;  3S1M H;  4X3K A;  4ZYS A;  3LGJ A;  4QIW E;  1C48 A;  5I4D A;  2LXK A;  2EY5 A;  1HNZ Q;  1B9M A;  3NBH A;  3I4O A;  1KAB A;  5C4X H;  4KTA A;  1Y8O B;  4LUV A;  4B08 A;  3UDF A;  5C0X G;  4QUF A;  5BR8 L;  1IL8 A;  2ZTC A;  3BZD B;  5JPM C;  4K5W A;  3H0G B;  4RHR A;  3BDL A;  1STA A;  2Z4I A;  1TY2 A;  2IHF A;  2HT1 A;  1RF2 D;  5BN4 A;  3JAM E;  1XMQ Q;  2SDF A;  1YJ9 A;  1H9S B;  1UNS A;  1IBK Q;  2PMZ E;  2DUD A;  4JOI C;  4JI3 L;  2LFN A;  3I8Z A;  4GNX C;  2MUY A;  3TP5 A;  1DZ1 A;  2PPB C;  1X6O A;  4LF9 Q;  1KTK A;  2VB2 X;  1MD2 D;  1RL2 A;  1PH4 A;  4JI2 L;  4IFD I;  2B8G A;  1YI2 A;  2RDF A;  1VF7 A;  1ET6 A;  1LT4 D;  1TII D;  1SNP A;  3I72 A;  1HTP A;  4BY7 H;  1HZC A;  3FVQ A;  5IGB A;  4Y7N H;  4HCS A;  3B6Y A;  1BDO A;  2AQ3 B;  1VQ9 A;  3F8T A;  3LX0 A;  3WOE A;  4C56 C;  1BBW A;  4TKO B;  3OMG A;  4C3I B;  2A19 A;  3I4M B;  3NUC A;  2PNH A;  3S17 B;  3PO3 G;  1CFM A;  5JEA H;  1Y1W G;  1HZB A;  4JI1 L;  1PFM A;  3GD7 A;  3LWU A;  1QVC A;  4I7Z C;  4Q5V A;  2ZJR A;  5I9O A;  2VQF Q;  2IY5 B;  1CUK A;  4LJZ C;  2EJM A;  2Y0S G;  2L0C A;  5CC4 A;  1CKN B;  1ZEQ X;  5AJ3 Q;  2EYJ A;  2XRQ D;  1STE A;  1Q3L A;  1V1Q A;  5IY0 A;  1TS4 A;  1VQP A;  1E22 A;  2ENB A;  2BH8 A;  1ENF A;  4B3T L;  4XTC S;  2E2D C;  2HQE A;  5A2Q E;  1VCI A;  4QJF A;  4GOP A;  1IBL L;  1KHI A;  2YU9 B;  1GO3 E;  1U4L A;  2L15 A;  3ERO A;  2R7F A;  4R1J A;  1DON A;  2SOB A;  4C2M H;  3K7U C;  2DNC A;  3D6W A;  4NXN Q;  2DGY A;  4J15 A;  4DK1 A;  1EFW A;  2UXD L;  3CF5 A;  1DOK A;  4OL7 A;  1JMC A;  5IIF A;  1RTO A;  4XXE A;  4X3U A;  4DV5 Q;  4CJ2 C;  2K4K A;  1YNJ C;  4H13 C;  2IL8 A;  3A8K E;  1IXR A;  4K6D A;  3I73 A;  5EKK A;  5EGT A;  1U4P A;  4B3R Q;  5EKL A;  1Y1W B;  1GUN A;  4ZK9 B;  3GTJ H;  1QCB D;  2JA5 H;  4ZKC B;  2RF4 A;  3M3Y B;  3GTG H;  1Y8P B;  2AWO A;  5DLQ E;  2F1M A;  1SAP A;  4LWC A;  1X32 A;  3CME A;  4KKS A;  1S5F D;  1UE7 A;  2F0G A;  3RN5 A;  1Z9F A;  4YHH L;  4DR5 L;  1RTN A;  5C0X J;  3MFG A;  5CR3 A;  3GTP H;  2B2T C;  3RZD H;  5COY A;  5KIX A;  2KOL A;  2IPK D;  4FNF A;  4IUR A;  3EN2 A;  1I6V C;  4BY1 G;  1TWF H;  4LNQ A;  1VQB A;  1WOC A;  2WII B;  4R4O A;  4X66 L;  4OWX B;  4P75 A;  1X9N A;  3P7J A;  2JA9 A;  1YBY A;  1VQ4 A;  4E6I A;  4DV1 L;  1BNZ A;  1WTO A;  3MEF A;  1B53 A;  4DR1 Q;  4A3I G;  1VQL A;  4GZY C;  5C3X A;  4YY3 Q;  3K7A B;  1GUO A;  3S14 B;  5K36 G;  1TWH B;  4FF2 A;  4LF7 Q;  2RBM A;  4RWS C;  2NVY B;  1PFN A;  1SXT A;  1TT2 A;  2Q2U A;  1CA6 A;  2A6H C;  3TP8 A;  1F9P A;  1P8L A;  4DR4 L;  4BBR G;  2K7V A;  2F0Q A;  5M5Y B;  4QY7 A;  1VQD A;  1SE2 A;  4CKB A;  1FNV A;  2WB1 E;  1BR9 A;  2RHQ B;  5M3F G;  2BCO A;  1S5D D;  1PH6 A;  3IRB A;  5M5X H;  5K5P A;  3PMF A;  1ILP A;  2K32 A;  2Q2H A;  4K5X A;  1SMY C;  5BN5 A;  1ET9 A;  2K5Q A;  2L9H A;  3F2C A;  4KMU C;  4R4I A;  3CC4 A;  2BE5 C;  1L0X B;  3C1E A;  2OWO A;  1U5K A;  1TXY A;  4YCW A;  1EY0 A;  1XX8 A;  4HED A;  4C3H H;  4AQY Q;  3KJP A;  3VR3 A;  2MP1 A;  4QL5 A;  4DA2 A;  3PO2 H;  5J39 A;  3L7Z C;  3SGI A;  1Y14 B;  4LF8 Q;  4IJL A;  1FNW A;  4JBK A;  1A2U A;  1LTS D;  1VQG A;  4R8I A;  3IFD A;  2J7Z A;  4A3I B;  4K6L A;  2ZXP A;  1Q86 C;  1PMR A;  3M4P A;  4FVM A;  3AFP A;  2VZA A;  1AE3 A;  1LYL A;  4JI0 L;  5C0X I;  2JA8 B;  3MA2 B;  1HUM A;  1H9K A;  2F0V A;  1WD1 A;  1G2T A;  5LL6 S;  4CKE A;  5EAY A;  4JK1 C;  3ICE A;  2B3G A;  3CXC A;  4RKL A;  4IJH A;  4RH6 A;  4Q0F A;  1SRO A;  3M4O H;  4J6H A;  4A3B B;  2ZT9 C;  3NQI A;  2F0I A;  3HZX A;  5I2Y A;  3C3L A;  5LMU L;  1EYA A;  4IPD A;  4NB3 A;  2A68 D;  2CQO A;  2ZTE A;  2AUJ D;  1IYV A;  1JT8 A;  1PVO A;  2QF7 A;  4HMI A;  5IYD G;  3BVM A;  1GKH A;  4IO9 A;  4C3I H;  2MQH A;  3KFU A;  3TP7 A;  2VQE Q;  4FXK C;  3PIO A;  1F9S A;  3T13 A;  4OO1 H;  3A8I E;  1HFN A;  5EQ0 A;  2NN6 I;  4DV0 L;  3CCQ A;  3Q24 A;  2O2L D;  4JBM A;  1XYI A;  2ZXO A;  4JV5 L;  1X65 A;  4GOP B;  2UUB Q;  1QNU A;  2MHV A;  1XTC D;  3H15 A;  2AQ1 B;  3L2P A;  1X3G A;  2KEN A;  1GUG A;  3QB3 A;  2MJ8 A;  3TRZ A;  4QGU A;  4HIK A;  2J4X A;  4Z9C B;  3T16 A;  2I5L X;  1O7Z A;  2WKD A;  3IL8 A;  4A76 A;  1VMP A;  1XMQ L;  2B63 B;  2UXB Q;  3H3V H;  3L0O A;  1TWA B;  3A56 A;  4DV7 Q;  4BA2 I;  3K5O A;  1GD7 A;  1Y1V G;  3U50 C;  4CJ0 B;  4DU9 A;  2B2U C;  1JJG A;  1YHB A;  1EIH A;  4DR7 L;  1EQT A;  1FR3 A;  3ZYY X;  3H3V C;  3UE0 A;  5EPJ A;  1J5E Q;  1D1I A;  1EY4 A;  5C44 H;  1FL0 A;  3CCM A;  2AHO B;  5IOD A;  4DPG A;  4QMG A;  2A6E D;  5FO9 B;  3U4V A;  4RGT A;  1VQH A;  2A69 D;  5C4J B;  1LT6 D;  1E1T A;  2L4N A;  4S3S A;  1IYJ B;  2R93 G;  2XWJ B;  1LLR D;  1N36 Q;  4PZ8 A;  2F0M A;  5IE8 A;  2FMM A;  2A1A A;  5JAV A;  4A3K G;  1SN8 A;  3VYS A;  3SE0 A;  1B9N A;  2K33 A;  3K80 C;  1VQI A;  4PZ6 A;  1OXT A;  2EY1 A;  1Q81 C;  1LTA D;  2EY2 A;  1PH9 A;  2VUM B;  2WAQ E;  4F7X A;  3STB D;  2VY3 A;  3VR4 A;  3CAM A;  2OF1 A;  4DNI A;  3HOW G;  3DEP A;  1LAB A;  3K57 A;  5GQO A;  3KJO A;  1S72 A;  2I0Q A;  3URY A;  1SLJ A;  5KRU A;  1I50 B;  2MNA A;  2NTT A;  5IGC A;  3P20 A;  1MKH A;  3K59 A;  2NVT B;  4IZ8 A;  1PRT D;  2CKZ B;  5G3L D;  1JOR A;  3BU2 A;  2JEB I;  1F2M A;  1E24 A;  5CV7 A;  5JPN C;  1N33 Q;  3NQT A;  2E2H B;  3UDI A;  5IOC A;  2CWA A;  1L1O A;  2YTY A;  3I4N G;  1HRJ A;  3HKZ G;  2NVY H;  3PCO B;  5C3E H;  1K83 B;  1Q90 A;  4KKU A;  4JCV E;  1TS5 A;  5M5Y H;  5HUR A;  2XRS D;  4A3D G;  4KHZ A;  4GN5 A;  1UE1 A;  1WCM B;  5GAG C;  5LMN L;  4KHP L;  2IX1 A;  1QE6 A;  5C6A A;  3HOY H;  2OCE A;  3MXU A;  2JA6 B;  2R93 B;  1OXX K;  4KJO A;  3FP9 A;  2A5H A;  4DR3 Q;  5KEE A;  2FHT A;  2K5V A;  2F0P A;  4A3K B;  1B70 B;  4ILW A;  3S9W A;  2N49 A;  3CCL A;  2F0T A;  1T5E A;  1KQS A;  5IWA L;  2ES2 A;  1XJV A;  2K01 A;  4JI8 Q;  3GP7 A;  1X3E A;  3G48 A;  5DM7 3;  3A5Z B;  1RHP A;  3HOW B;  3MXN B;  1UEB A;  4P2C B;  3CW2 C;  3UDG A;  1K8O A;  3S24 A;  1G51 A;  1LV9 A;  2CHB D;  2R92 G;  1CT1 D;  1PTO B;  1MIU A;  1M8A A;  1EIG A;  2EXD A;  4AYB B;  1D5X C;  1SYE A;  1JWU D;  1D5M C;  2PQA B;  1XPU A;  1I3Q B;  2DY7 A;  3R3O A;  3S1Q B;  1EQR A;  1VQK A;  4LF7 L;  1DJR D;  2QA4 A;  3HKZ B;  4F87 A;  4H7B A;  2KBN A;  2JA8 H;  1Q8K A;  4XDX A;  4ALP A;  2LY7 A;  4UY8 C;  4LK1 C;  4A3D B;  4FO2 A;  2NVQ B;  4A3G G;  2Q2I A;  5F2D A;  1BCP D;  2JJQ A;  1XNR L;  3FKI B;  3KDF A;  1JIC A;  1GVP A;  4A3B H;  4HJ9 A;  2EQS A;  1KNE A;  3EVQ A;  1MBY A;  2MFI A;  4QF4 A;  4LFC L;  3PGZ A;  1NAP A;  2K28 A;  2RVL A;  4JBJ A;  4DAY A;  3WOF A;  3DLL A;  3MFY A;  2JSO A;  2Z6K C;  2NYZ D;  1BO0 A;  1F9Q A;  4AQY L;  2E8G A;  3OMC A;  3S1N B;  1IW7 C;  1XMO Q;  1EIF A;  2LXJ A;  3RLO A;  4A93 B;  1WTP A;  4LAA A;  4C3J B;  1BKB A;  2PI2 A;  2E75 C;  1YJN A;  5BN3 A;  1EEI D;  4B3S L;  4DAV A;  4LF8 L;  4FP5 D;  3BVG A;  2R92 B;  1PH2 A;  4O1N A;  1A62 A;  2L11 A;  3ZJY C;  5DEH A;  1V9P A;  2G9D A;  4HAE A;  3SK5 A;  1CM9 A;  1VQ6 A;  4HJA A;  1HNX L;  2B2V A;  5IT9 c;  2BA1 A;  3PIP 3;  4GOP C;  1G91 A;  4A3E B;  3OHX C;  5HGT A;  1A2T A;  3KBX A;  2R7Z G;  1II3 A;  1DXM A;  3K6O A;  1LO5 D;  4DGZ A;  3HOX H;  1TWA H;  4A3G B;  3MTS A;  3HFZ B;  2HHH L;  1I94 Q;  2O4X A;  3D4W A;  3Q22 A;  1PH5 A;  3BZK A;  1XNQ L;  4DV6 Q;  5IP9 H;  4F88 A;  2B2Y C;  3GV6 A;  1EY8 A;  4DK3 C;  1TWC B;  4LFB Q;  1X56 A;  4OO1 G;  1SNC A;  3IKJ A;  1EWC A;  1PZK D;  2E2I B;  1WI5 A;  3GDE A;  3QO2 A;  3I7F A;  3VYU A;  1X3Q A;  2K75 A;  3HOV H;  4RA8 A;  3KLW A;  4X3T A;  3MVV A;  4RMF A;  1SYF A;  3R2I A;  3S16 B;  2PYK A;  4LF6 Q;  2WAQ G;  1ROD A;  3QOL A;  3M4Q A;  3S15 B;  1HR0 Q;  4MIU A;  4P73 A;  3CC2 A;  1X3P A;  1HNW Q;  3K5L A;  4PNY A;  4UDU C;  2VUM H;  3S2H B;  2F0S A;  2NZO A;  2K1B A;  4G7Z C;  1L1O B;  3NEN A;  1QVF A;  1C4Q A;  1L0Y B;  5E1F A;  1E2V A;  4OXP A;  1HPC A;  4FF4 A;  1S5E D;  3ULL A;  5FK9 C;  2NN6 G;  2H4O A;  1I50 H;  1SYB A;  4QUC A;  1STG A;  1D1K A;  1EOV A;  1YNN C;  4NXM Q;  4GLA C;  2ICI A;  3L3O C;  5IYB G;  4XYO A;  4DR6 Q;  2BOS A;  1YHQ A;  2H5X A;  2E2H H;  1EYG A;  1AE2 A;  2N8N A;  2IJ0 A;  3M7N A;  1CQV A;  2CQA A;  1K83 H;  1WTQ A;  1VQ8 A;  4OX9 Q;  2EJF C;  3NPP A;  4NDX A;  1K8G A;  1JC7 A;  4V19 0;  2H1E A;  2JYO A;  1PTO F;  2Q8T A;  5A35 A;  2UUA Q;  4ZAI A;  4P74 A;  4MTN A;  2GA4 B;  1VQO A;  4A3F G;  2F03 A;  4L5S A;  2SEB D;  2JA6 H;  3E9H A;  2F0E A;  4UAI A;  4YWK A;  5J3B A;  1M90 C;  2ICE C;  2I07 B;  5D65 A;  1N34 L;  3RD4 A;  1I5F A;  4ABN A;  4JI6 Q;  3FRP B;  4G57 A;  3KOJ A;  4IFD H;  5NUC A;  1VQM A;  1V43 A;  2JA7 G;  4A3M H;  1QZG A;  1H95 A;  3HOU H;  5FLM G;  4P72 A;  4A3C H;  5EPL A;  5IYC H;  2IT1 A;  3CCS A;  1CKO A;  2GVB A;  1LTL A;  5FJ8 H;  5IGG A;  4DUY Q;  1MSH A;  4NP5 A;  4IUN A;  2AKW B;  5ELN A;  2PQE A;  1KC8 C;  4BXX G;  2MPM A;  3DXJ C;  3CP0 A;  3SEB A;  3J80 c;  3NXW A;  4KJN A;  3J81 c;  3GTL B;  1MSG A;  1ENA A;  1IHZ A;  4LFA Q;  3KBG A;  3FDT A;  3X3N A;  2VNU D;  2EE1 A;  1PTO H;  3PO3 B;  1OXS C;  3A5