4OO1I

Structure of an rrp6-rna exosome complex bound to poly(a) rna
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
287
structure length
216
Chain Sequence
FQFPEIAYPGKLICPQYGTENKDGEDIIFNYVPGPGTKLIQYEHNGRTLEAITATLVGTVRCEEEKNILVSVLPGFANNLPKEGDIVLTRVTRLSLQRANVEILAVEDKPATFSVSQASSDLGETFRGIIRSQDVRSTDRDRVKVIECFKPGDIVRAQVLSLGDGTNYYLTTARNDLGVVFARAANGAGGLMYATDWQMMTSPVTGATEKRKCAKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of an Rrp6-RNA exosome complex bound to poly(A) RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/rna
molecule keywords Exosome complex component RRP45
total genus 33
structure length 216
sequence length 287
ec nomenclature
pdb deposition date 2014-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF10447 EXOSC1 Exosome component EXOSC1/CSL4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4oo1I02
2.40.50.880 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4oo1I01
3M7NA 1LYLA 4BBRH 4Y7NH 2BA0A 4JV5L 1L0WA 3ULJA 2UUCL 3ULLA 2ASBA 5IYBG 3S2HH 2OWOA 3PUVA 4R4OA 1FL0A 3M4QA 1LTLA 1YZ6A 5M3MG 4LFAQ 1I5FA 2JA6H 2HHHL 3FP9A 4P75A 1N32Q 1KRTA 4JOIA 2JA7H 1G6PA 1FVIA 1PH1A 3OYYA 1OXTA 1VQBA 3ER0A 1GVPA 3OTOL 4JI8L 5BR8Q 4DUYQ 4TVAB 1N34Q 3I4MG 3I56A 2F3IA 4O2DA 4IOCA 3I7FA 3A74A 3H0GG 4DV1L 4DR5L 4DV5L 4DR2Q 4A3FG 1X65A 1GM5A 3G48A 1XJVA 4IJHA 2MNAA 4A3EH 1JMCA 4LF7L 2UUBQ 1TWGH 2K75A 3A5UA 4DV2Q 1XMOL 1Y14B 4OXPA 1DGSA 4R4IA 2LXJA 4DV0Q 4HJ9A 4OX9L 5M5WH 3S1RH 1FGUA 3KF6B 4B3RQ 1L1OB 4L5QA 1Q86C 3JAMc 1N8RC 4JI7Q 2H5XA 3G71A 1GKHA 1VQLA 1XNRQ 4WJ4A 3M85A 2NZOA 1L2FA 5GQOA 1EIYB 1I3QH 5DLQE 3KJPA 3CCMA 3HOWG 2R7ZH 4YCVA 4PMWA 4AYBE 3I55A 1YIJA 1C7YA 4A3GH 1S3OA 5FLXc 5IT9c 1K8AC 4IPGA 1MIUA 3M9BA 1XTDA 2PNHA 4IPDA 4BY7G 3PO3G 3GTMH 4R4CA 2WFWA 1XMQL 1VQMA 3S1QH 1J5EQ 2JE6I 4KI0A 4ALPA 2R6GA 1YI2A 2R92G 1EOVA 1VQ4A 3BZCA 2UXDL 2DGYA 4DV4L 1VQFA 3KLWA 5ELOA 2EQSA 4X62Q 1XNQL 1BKBA 4IOAA 4LFBL 5M3MH 3T1YL 2XTIA 1IBML 3CC4A 1VQDA 2JEBI 1Y1WH 5LMNQ 2EIFA 1HNZQ 2CCZA 2ATWA 2AKWB 1JJGA 3S16H 3CCLA 4LF4L 1XPUA 2RF4A 4YY3Q 2KCTA 1HNWQ 1YJ9A 2MQHA 3FKIG 4GKJQ 1D7QA 2UUCQ 4YWLA 2F4VL 2CWPA 1IBLL 1VQKA 2ZJQA 3GD7A 3RN5A 4JI3Q 4LFAL 1SRUA 2V1CC 4FDBA 2GN5A 2OQ0A 4HJ7A 2E2IH 4DR7Q 2BA1A 1X55A 2AWNA 4DV3Q 1N36L 2K5HA 2CFMA 4X64L 2NVTH 2OCEA 1HZBA 1UE6A 4JG2A 4IO9A 2IT1A 1HR0W 2ZTDA 2VW9A 1VQHA 2VL6A 2UUBL 1V1QA 4DV2L 2Z6KA 5IP9H 4HIMA 4NB3A 2HQLA 5GAHC 3UE0A 1XPRA 3U58A 2Q2UA 4BXXH 4NXNQ 1TWHH 1UWVA 5H1SE 1Q7YC 1VQ6A 2JJQA 1C0AA 2WB1G 2Z6KC 4KLKA 3PO2G 2K50A 3CXCA 1XNRL 3FKIH 1YHBA 5LMNW 2ZTEA 4HIKA 3CCUA 2WAQG 4YCWA 4GNXB 2HIXA 1GD7A 4AIMA 5IY0A 3RZOH 2KHJA 2MO1A 3HOXG 4GN3B 1VQOA 1YHAA 3MEFA 3RLFA 2JA5H 4K0KQ 4DV7Q 1CSQA 4DPGA 1VQAA 2VY3A 4HJAA 1CKNA 4C2MH 4UP8A 2B29A 4IPHA 4X65Q 3GTJH 1VQ8A 1K8GA 2VQFL 4EX5A 4JBKA 4A3GG 4IFDI 1K9MC 1TWAH 1UE5A 3PV0A 2QA4A 2UXDQ 3EBEA 2BH8A 1I50H 4RMFA 4JI2L 1NJIC 3J80i 4C3HH 4X62L 1XNQQ 2AMCB 3M4OH 3PO3H 4LFBQ 3HOVH 1Q12A 1AH9A 3AYHB 4DNIA 1VQPA 1QZHA 2YU9H 3D31A 3Q8DA 4B3TQ 1E7ZA 1K83H 3I4OA 4A3BG 5LMNL 1YITA 2BH2A 4BXXG 3J80c 2JK8A 1Y1VH 4LUVA 1PH6A 4A3LH 4GKKL 5C4XG 2LXKA 3GTOH 3M3YH 2IY5B 1KD1C 5IYDH 3KDFB 3L7ZC 1X3GA 2F4VQ 4PZ6A 2E2JH 1L1OC 3NBHB 4DR6Q 1W3SA 4GNXA 1IBLQ 4JI3L 1Q1EA 3KFUA 2D0PA 4OWTB 1HNXL 1C9OA 2CQOA 3PGZA 4LF6L 5JJLA 1EWIA 4DK6C 4DUZL 4QY7A 2E2HH 5HGQA 3KJOA 4JI0Q 1KL9A 1SROA 1V43A 2Y0SE 4LFCQ 1CKMA 2JA8H 5JJKA 4HJ8A 5IYCH 3A5ZB 4DR1Q 4PG3A 5GADC 3K0XA 5JEAJ 4GOPC 1SMXA 4RG1A 1EYGA 1X54A 4DAMA 2MO0A 1ASYA 4A75A 4A3JH 1KQSA 3CC2A 1CKOA 5HY6A 1B8AA 2OQKA 3CCRA 4GOPA 4AYBG 3OTOQ 4JI8Q 5BR8L 4DUYL 1N34L 3H15A 2ID0A 1NMFA 3F1ZA 2B63G 3GTGH 4DR5Q 1VS0A 5AJ3L 3K8AA 4GLXA 4DV5Q 1WFQA 2B63H 3KDFA 2ZTCA 1QUQA 1X56A 3HOUH 1V9PA 1A62A 2JEAI 2OTJA 1A63A 1RIPA 5EAYA 2A8VA 4QQBX 1E24A 4POGA 1RL2A 4DV0L 4K0KL 4KHPQ 3CF5A 3J81j 4P71A 4YWKA 2UXCL 3S1NH 4H02A 4A3IG 2JA9A 1SLJA 1JE5A 1KRSA 1YEZA 3J7ZC 4B3SL 5IP7G 1PHJA 2D0OA 4A3DH 3E9HA 3LGJA 3OW2A 3PF5A 4DV6L 1E22A 3EIVA 3JAMi 1PH2A 4A3CG 1K73C 4UP9A 3JC66 4A93H 1N33Q 2AHOB 1HR0L 3CD6A 1Q1BA 1E1OA 2HT1A 3VDYA 2UUAL 4JYAQ 1KXLA 4GN5A 2JQOA 2VQEL 1R9TH 2R7FA 4JI4Q 1X3FA 4DV4Q 3G6EA 1B7YB 4B3RL 1QVFA 1PYSB 4LW1A 5J3BA 2ZJRA 1YBYA 2UU9Q 4OWWB 3UE1A 1H95A 4IJLA 4A3BH 4DR6L 4JCVE 4OO1I 1HNXQ 2NVXH 3U4ZA 4LUZA 4MTNA 1QVGA 3BZKA 3H3VH 2I5HA 1P8LA 2YTYA 2PI2A 4UPAA 5IP7H 3GTKH 4LF9L 4GNXC 1Z9FA 4LF4Q 4DR3Q 4YY3L 4A3IH 1HNWL 2IX1A 1Z47A 4GS3A 4DR1L 1JB7A 3KYHC 3NELA 1X3EA 1JJCB 1TWCH 1VQJA 3CW2C 5IYBH 2MFIA 1U0LA 4L5TA 1IL2A 3HOXH 3J7A5 5C0XI 1PH7A 4BA2I 2WAQE 3RZDH 3GO5A 4YHHQ 2JA5G 3DM3A 3S24A 1E1TA 3UDXA 4DAYB 3PF4A 1UEBA 4GLVB 5GROA 4BBRG 1VQEA 4DV3L 1YJNA 1Y1WG 4IFDJ 4BA1I 3E9IA 1PVOA 5LMUL 4AQYQ 1IBKL 3GTLH 1Q82C 2C35B 1VCIA 4QJFA 2NN6G 4JI5Q 4PZ8A 5IYCG 2E5LL 2R92H 1PH8A 5IP9G 1VQIA 3HOZG 1AE3A 2NN6I 4ME3A 1P16A 2F52A 4A3CH 4LF8L 2UXBQ 1CUKA 1EUJA 1WJJA 4OWXB 3T1HL 1IZ6A 4A3EG 4BY7H 4KHPL 1VQNA 1NBWA 1G51A 2Q2IA 3W1BA 3HFZB 3F2BA 2R7ZG 3S2DH 3STBD 3H3VI 4JI6L 3CQZH 4DV6Q 3W1GA 2AWOA 3L2PA 3HOZH 4AH6A 1KHIA 1M90C 1FJGL 2FXQA 3HOUG 4C3IH 4GOPB 1HR0Q 4QL5A 2A19A 1OXXK 4LF5Q 1OXVA 4X65L 5IYDG 3HOVG 3U4VA 5ELNA 3BU2A 2VQFQ 2ALYB 3KOJA 1XPOA 4HIOA 2UUAQ 4JYAL 5IWAL 4B3MQ 2N78A 2N8NA 3B6YA 3RNUA 1QUQB 3ICEA 1I6HH 2RHQB 4JI2Q 2DUDA 3PSIA 1VQCA 2L15A 1OXUA 1KC8C 4IFDG 4A3JG 1YNXA 3SGIA 3PUYA 4L5SA 3PUWA 4A3KH 2NVYH 1SR3A 2Q2HA 1PH5A 1PYBA 3K7AH 2JA7G 1S40A 4GKKQ 1JT8A 1IXRA 1EQRA 1TXYA 4JV5Q 1Q8KA 4DK3C 2PMZE 2Z0SA 3AFQA 2CKZB 1KIXA 2NVQH 1GO3E 3HOWH 3F2DA 3CCVA 2PI2E 3I2ZA 4P72A 3AQQA 2K5VA 4KHZA 1KAWA 2NZHA 5C0XG 2ZM6L 4POFA 2R93G 4MNOA 5C3EG 4R1JA 5C44H 2Y0SG 2YTXA 1BVSA 4XTCS 1CSPA 1MKHA 2QEXA 1YJWA 4LF6Q 1HH2P 2I5LX 4YHHL 1NTGA 1B70B 3TREA 3U50C 4JI1L 5IE8A 5M3FH 4LFCL 4DUZQ 4JI0L 1HZCA 4UY8C 4BBSH 4LNQA 3CMEA 1OXSC 1Y1VG 1BBWA 1SFOH 1JJ2A 1UE1A 4NXMQ 2R93H 2PQAA 3RN2A 4L5RC 4JI5L 2N49A 1PH9A 4PZ7A 2E5LQ 2ZJPA 3GTQH 1WI5A 1PA6A 1CKNB 1PFSA 1SN8A 4JBWA 5JEAG 5M3FG 3I4NG 2CWAA 4LF8Q 2UXBL 1Q46A 1VQ5A 3T1HQ 4OX9Q 3RLOA 4A3FH 1LM0A 1PH4A 5JJIA 1A8VA 3H0GH 3J81c 3S15H 3M4PA 4JI7L 5AJ3Q 3KF8B 2I5MX 2GVBA 1I94Q 4OO1G 4APVA 4A76A 3HKSA 2KHIA 1W2BA 2KCMA 3UDGA 4X66L 3AEVA 4A3KG 3MXNB 4X6AH 4EQ5A 2IHEA 2YV5A 3EN2A 4A3MG 3CPFA 1G291 2UXCQ 2B3GA 2XGTA 3HKZE 3FHWA 5E7NA 1J5EL 1EIFA 1IYJB 2VNUD 1BBUA 1K3RA 3STBC 4B3SQ 2VUMH 2QGQA 3D0FA 5C0XJ 2K4KA 2KBNA 3J81i 3CP0A 1N33L 2D62A 5FJ8G 1T9HA 1ASZA 3RR5A 3HOYG 1PH3A 3NENA 3W5OA 4XIGS 1Q81C 1NMGA 2K14A 2WP8J 5GAGC 3PUZA 1HNZL 3PIOA 3I4NH 1WOCA 4BY1G 3UDIA 1HJPA 2VQEQ 1O7IA 4DKAC 4OONA 2JA8G 4JI4L 3CAMA 1NY4A 4GN4B 2E8GA 3ERSX 3F2CA 3RLNA 2K5NA 2UU9L 4BY1H 4JBMA 4GKJL 4MZ9A 3CC7A 4J15A 5C4JH 3CMAA 2ZM6Q 4JC0A 3CPWA 1K0RA 4NPSA 1QZGA 5FLMH 4NXNL 4YWMA 3TS0A 4DR7L 5C4XH 4QGUA 3NEMA 4UP7A 4JI1Q 4LF9Q 4A3LG 3KF6A 1WCMG 1L1OA 1S72A 2IHFA 2IX0A 4DR3L 5FLMG 4X64Q 3ULPA 1N36Q 3S1MH 2R7DA 4HIDA 3K7UC 4JOIC 2N3SA 5C44G 1UE7A 1YHQA 1VQ9A 3DLLA 4NXML 3S14H 2HHHQ 2KENA 3AFPA 4BBSG 2A1AA 4LWCA 3UDFA 4C3JH 1N32L 3G4SA 2ES2A 5M5YH 1NE3A 1EFWA 1N9WA 4YCUA 3TRZA 4JBJA 5LMUQ 4AQYL 1IBKQ 2HIVA 1A0IA 4TQUS 2WB1E 3CCEA 4DV1Q 4DR2L 3TQYA 1MJEA 3A0JA 4WJ3M 4GLAC 1SE8A 1U5KA 1TWFH 4LF7Q 1I94L 2VUMG 1XMOQ 4DR4Q 1LUZA 1HZ9A 1YVCA 3E0EA 1WCMH 3TEHB 1HZAA 1QVCA 1AE2A 3PUXA 3K81C 4X66Q 5K36G 3PO2H 3GDEA 3K80C 4O0AA 4DV7L 4A3MH 3IRBA 4LUOA 3F8TA 1J6QA 3PIPA 1X9NA 3S17H 4P73A 2RCNA 3WWVA 2YYZA 4A93G 2PQAB 3TS2A 1EQQA 4HJ5A 4Y52H 4JI6Q 2EXDA 1X6OA 2K52A 4P74A 5M5XH 1OTCA 4A4IA 3GTPH 1FJGQ 4A3DG 2VZAA 5C3EH 2VS1A 3CCSA 3PCOB 3HKZG 4B3TL 4LF5L 1WYDA 1XMQQ 1M1KC 4DR4L 3CCJA 3I4MH 4IPCA 3L0OA 2Q2TA 5IWAQ 4B3ML 4QIWE 2OTLA 1E3PA 1VQGA 2RHSB 1PV4A 5GAEC 2I0QA 5FJ8H 2LSSA 2GVAA 3HOYH 1MJCA 4R4QA 1VQ7A 2JA6G 3T1YQ 1IBMQ 2YTVA 3CCQA 1D8LA 3ZJYC 3BJUA 4R4TA
chains in the Genus database with same CATH superfamily
2NUCA 2XSCA 4HTHA 4JV5L 1L0WA 3ULJA 5IYBG 2OWOA 1NR4A 2V4DA 2RDFA 1G2SA 1UUPA 1H9KA 4ID6A 4LFAQ 1F2ZA 3C1FA 1N32Q 4JOIA 3OYYA 5KYLA 4HCEA 3J7AV 3ER0A 1DOKA 1HCZA 1B1ZA 4TVAB 3I4MG 3MXPA 1ONLA 2F3IA 4DV1L 4DV5L 1GM5A 2K28A 3G48A 1LTAD 1XJVA 4KK7A 2K75A 2K5DA 1STEA 1U4LA 1EY4A 1DGSA 5I2YA 4DV0Q 4FF1A 3X3NA 4HJ9A 3KF6B 1L1OB 5KIXA 4HEDA 4L5QA 4V0BA 3JAMc 2PPBC 3VYSA 4FP5D 1SMYC 5CGKA 5GQOA 1EIYB 4MN3A 2B2VA 3KJPA 1EY5A 2R7ZH 4YCVA 4A3GH 1S3OA 5FLXc 3M9BA 1SAPA 3SR1A 3J81L 4A3BB 4R4CA 1D5ZC 1B50A 3EVQA 4KI0A 1WVLA 2R92G 1VQ4A 5CC4A 2DGYA 1A2UA 1VQFA 3KLWA 1SE2A 1IW7D 2RCFA 2YU9B 3CC4A 4CDDC 3K58A 2JEBI 5LMNQ 2CCZA 2ATWA 1I6HB 2AKWB 3V05A 4C56C 1XPUA 4YY3Q 2KCTA 3M7GA 3FKIG 1D7QA 2A6HC 2A5HA 4FXGC 3TP8A 1IBLL 1VQKA 2ZJQA 1FNVA 1OO9B 3GD7A 4FDBA 4DN4M 1IYUA 3CQZB 1X55A 3J81E 2AWNA 1N36L 3FRPB 1HZBA 4JG2A 2EZVA 2XRSD 3VA5A 3MC0B 4DV2L 2Z6KA 4R8NA 2EDGA 2LS01 3Q24A 5GAHC 2Q2UA 1GUOA 1T5EA 2NVXB 5H1SE 3PO2G 1XNRL 2N55A 2RSNA 2XWBB 1LTTD 2G9DA 3NPPA 2WAQG 4N9PA 3RZOH 3NTIA 2B39A 1YHAA 4GN3B 2RDGA 1X3PA 4HJAA 1CKNA 1DOMA 1II3A 2B29A 5CV7A 4C2MB 1PZKD 4X65Q 3GTJH 2A6EC 3KBXA 4A3GG 3S16B 2QA4A 3EBEA 2FINB 4IN3A 4JI2L 4C3HH 5JOBA 1S5DD 5FO9B 3OPOA 2Z1CA 3PO3H 4CDEC 1AH9A 1Q12A 4DNIA 2XNAC 4DR4Q 1TWHB 4C3HB 1YITA 4ZUJA 3J80c 2JK8A 1Y1VH 2IPKD 3L9AX 3VYTA 4GKKL 5C4XG 3GTOH 3M3YH 2IY5B 3BYYB 1SJED 2F4VQ 4PZ6A 1L1OC 4EVOA 1W3SA 3ND9A 1STAA 4GNXA 1IBLQ 3A7LA 4XT1B 3DUZA 4LF6L 1EWIA 1D6EC 1CM9A 4QY7A 4LFCQ 3RZDB 4HJ8A 2L55A 3VR6A 4DR1Q 1R4PB 4J1MA 5TSSA 2F0VA 3R2IA 4A3IB 1ET9A 5HY6A 2OQKA 1QB5D 1YNNC 4CJ2C 2G9HD 1TWGB 3A7AB 3CCRA 3OTOQ 5BR8L 4DUYL 3QR8A 1K8MA 2LMCB 3EA6A 3KDFA 1QUQA 3HOUH 1A62A 5T1IA 3GTOB 3M3YB 5EAYA 1IHZA 2F0KA 1RL2A 2AUJD 4DV0L 2QDLA 3O13A 4KJOA 2BE5C 2JA6B 3J81j 2UXCL 2K03A 4H02A 3S1NH 1FNUA 5EBDA 5IGGA 1PHJA 2D0OA 2JA8B 1GUSA 4DV6L 1E22A 5JPMC 4A3CG 4PQXA 1K73C 1RJTA 4A93H 4DAYA 1Q1BA 4FNFA 4KY6A 1H9JA 3VDYA 1AW7A 4JYAQ 2NTTA 2F0LA 4JI4Q 4DV4Q 1JJGA 3W2DA 2UU9Q 1JE4A 4OWWB 3MVVA 1H95A 3NXWA 4A3BH 4JCVE 5KYIA 5C0XH 1HNXQ 2NVXH 4MTNA 4LUZA 3H3VH 4C3HG 2PZWA 2PI2A 1A3VA 5IP7H 4LF9L 3TP5A 4YY3L 1HNWL 1SYFA 4TRDA 2IX1A 1Z47A 4DR1L 1O7LA 3KYHC 4PV1C 1JICA 1H9SA 2B2YC 1U0LA 1BOSA 4BA2I 4JK1C 2JA5G 4YHHQ 4RKLA 4DAYB 2Z8LA 5D3IB 4DV3L 1Y1WG 1YJNA 3NHHA 1O7ZA 1GUTA 3FPPA 5FLXE 3GTLH 5CBEE 2C35B 4CJ1B 1XX8A 5IGCA 5IYCG 2AQ1B 2R92H 1EEFD 1VQIA 5IP9G 2NN6I 3HOZG 1P16A 1DOLA 1NSNS 1Q3LA 1UAPA 5EKIA 1BDOA 1CUKA 1EUJA 3K5MA 1IZ6A 4A3EG 3ZYYX 4JVZA 3W1BA 5T1GA 2R7ZG 2Z4HA 2OT2A 2KJXA 1DONA 2AWOA 2KCNA 2FXQA 3HOUG 5BN4A 4GOPB 3MFGA 4QL5A 5CV5A 1OXXK 2EYHA 1CA5A 2VQFQ 3KOJA 1ZXTA 2UUAQ 1DXMA 4B3MQ 2N78A 3B6YA 2K5QA 3ICEA 2DUDA 1KC8C 1YNXA 5CV4A 1L0XB 4L5SA 2Q2HA 1PH5A 2L12A 1S40A 1D2BA 1Q8KA 3HOWH 1B2TA 2CKZB 2B2WA 1BCPB 3F2DA 3CCVA 3PMFA 3AQQA 2F0PA 3GTMB 1KAWA 3SK5A 4DF7A 2ZM6L 3SK4A 1EU4A 5C44H 4XTCS 5M5XB 2Y0SB 4LF6Q 3TREA 4JI1L 4P2CB 4BBSH 1QE6A 2DY7A 1HZCA 4K5XA 1QJOA 3CMEA 1BCPF 1BBWA 3BYTB 1UE1A 4I65A 2A69C 2EJFC 4L5RC 3H0GB 4CDCC 1NUCA 4NDXA 2K5WA 3T56B 3L3OC 1CKNB 1PA6A 1VQ5A 3RLOA 2KEEA 3D6WA 1GOZA 4FF2A 2KHSA 2EE1A 5M9OA 2HDMA 2GVBA 4IFDH 4ULLA 4OO1G 4RHRA 3HKSA 4J8QA 3UDGA 2CQAA 3AEVA 3MTSA 2SOBA 4X6AH 4EQ5A 2IHEA 2YV5A 1MGSA 2VB3X 2XGTA 2K05A 3FHWA 1J5EL 3N6RA 2VNUD 3DEPA 4ZKCB 1TY0A 5C0XJ 2K4KA 2PZUA 3CP0A 1YNJD 5CR3A 4G7OC 5EKLA 5K5PA 2D62A 4K2LA 2F4IA 1CZWA 3W5OA 1NMGA 2WP8J 5GAGC 3PUZA 4OIKA 1Y69U 4HSPA 1DYQA 2F0DA 1NY4A 4JBMA 2E8GA 2UU9L 4BY1H 4MZ9A 3CC7A 4J15A 1A6XA 1EFID 4NPSA 2PCFB 5FLMH 2L4NA 3J80L 1CHQD 4YWMA 3JAME 4DR7L 4QGUA 2F0HA 1L1OA 1S72A 3S1MH 1N36Q 5FLMG 1SBBB 4X64Q 3E6ZX 2R7DA 5C44G 2N3SA 3AMUA 2FMMA 3S15B 4GZYC 3CU7A 1IW7C 1TT2A 2A1AA 4LWCA 1WTWA 2ES2A 5M5YH 1NE3A 2RVLA 3DWPA 3K7AB 4QIWB 4RCOA 2EY5A 3RMHA 4JBJA 5LMUQ 3Q22A 4DXGA 4AQYL 1IBKQ 3C2PA 2A69D 3CCEA 1E2WA 4PMCA 1FD7D 3HG9A 4DK1A 4WJ3M 4H13C 4GLAC 1TWFH 3T51B 1HZ9A 1LUZA 2IWHA 4U673 3H3VI 1QVCA 1AE2A 4XQQA 3HS0C 3BVGA 4EQPA 3U9SA 2LKVA 4DV7L 3S14B 5BN5A 1LTRD 1HXYD 3VR4A 5E1FA 4ABNA 1J6QA 3PIPA 3HEJA 2RCNA 3IAYA 2YYZA 4A93G 2PQAB 5E4WC 3TZUA 1F9QA 3PIO3 1JQYD 2K52A 4P74A 5M5XH 4A4IA 1FJGQ 2HD3A 3NTKA 3LX0A 5KRUA 5D14A 2VS1A 3PCOB 1U4PA 4B3TL 1M1KC 2GA4B 3I4MH 4HN7A 4ODGA 3HOWB 1Z7TA 1RCVD 4MHEA 1HA6A 1QCBD 2DNCA 1IBMQ 3D4WA 4O42A 4R4TA 2KUMA 5M5YB 2QILA 2NZ1D 3T53B 3N52A 1C8CA 4RGTA 3MAQA 2WKCA 2ASBA 3IL8A 3S2HH 3OMGA 1FL0A 1TWCB 1UNSA 1YZ6A 2HHHL 3FP9A 5FK9C 4P75A 2JA7H 3WOEA 1PH1A 1OXTA 2F0QA 4ZK9B 3P1HA 5FKAC 1VQBA 5M3FB 3OIPA 4DUYQ 4O2DA 5EJWA 4RAUC 3H0GG 1PDQA 1JMCA 4LF7L 1XMOL 4NP5A 1Y14B 3MHBA 3KLSA 4OXPA 4ZLTF 4R4IA 2LXJA 4OX9L 4A3JB 5M5WH 3ONAB 4JI7Q 2H5XA 3G71A 1VQLA 3TMEA 3M85A 1PRTD 2PW7A 3HOWG 4NKLA 3A8IE 1YIJA 1C7YA 3C46A 1K8AC 3SVMA 4KKTA 1XTDA 2PNHA 4B9XA 4KV6A 2F0FA 4KKUA 1SYGA 1XMQL 4N9TA 1EEID 3A56A 5JAVA 5LHY1 4ALPA 2R6GA 1EOVA 1ENCA 4KY7A 5IGEA 4X62Q 4IOAA 4QF4A 3GTGB 2Q8IB 1IBML 1VQDA 1Y1WH 2EIFA 1WTOA 1TWAB 3CCLA 4LF4L 1JWSD 5D65A 4CKCA 4F87A 4LJZC 1E2ZA 5DNFA 1YJ9A 1BBXC 4C1NK 4JI3Q 1DZ1A 4LFAL 2BA1A 4BBSB 4FVMA 1EQTA 2CFMA 1MI2A 2NVTH 2BDNA 2OCEA 1HPCA 3BDLA 2A74C 3DXJC 2A6HD 1HR0W 1PTOF 2TMPA 2VL6A 2UUBL 1V1QA 4HIMA 1XYIA 4NB3A 1LO5D 3UE0A 3U58A 4FF4A 4KHVA 4LK1C 1EY8A 1C0AA 4HIKA 4HCSA 3CCUA 4YCWA 1BNZA 1GD7A 1I4XA 4AIMA 3HOXG 2E2IB 1H9RA 4Q0FA 1VQOA 2JA5H 3OIQA 4K0KQ 1CSQA 1RHPA 4DPGA 3GP7A 1TS4A 5JJZA 1K8GA 2VB2X 2VQFL 4JBKA 2WACA 3DEOA 2ENBA 2B2UC 3GTKB 2UXDQ 2BH8A 3J80i 4FXKC 4X62L 1K83B 3M4OH 4G57A 3HOVB 3AYHB 2BH2A 2E76C 4A3BG 1LT3D 4BXXG 5CMDA 2EY1A 2LXKA 1KLGD 1AP0A 2F0UA 2A6ED 1MSHA 2IW3A 1KLUD 1Y1VB 3KDFB 3L7ZC 1X3GA 2PMZB 4FF3A 1JWMD 2F0GA 1Q1EA 2CHBD 4JI3L 3BS1A 3KFUA 2D0PA 2F3VA 2N88A 2CQOA 3Q0AA 3GQBA 4DUZL 3KJOA 1KL9A 1V43A 2Y0SE 1WTPA 1KDAA 4DNRB 2XN9C 4K6DA 3K0XA 5JEAJ 1SMXA 1PYWD 1KNAA 4RG1A 4DAMA 2E2JB 1ML0D 3MA2B 2QCPX 2F0EA 3D6CA 3BZDB 1CKOA 3D4DA 1B8AA 1TY2A 4M1UB 4GOPA 1JOOA 3H15A 3F1ZA 2B63G 3GTGH 4DR5Q 5AJ3L 3K8AA 4GLXA 4DV5Q 3K5LA 3RD4A 1GHKA 2ZTCA 1I50B 5BN3A 1V9PA 1RIPA 3HP3A 5J39A 1FR3A 2FJ2A 4KHPQ 4LMQD 4YWKA 4Z9CB 2JA9A 1JE5A 1KRSA 3J7ZC 4B3SL 4A3DH 1J8IA 2MGSA 3LGJA 1S5CD 1RODA 1I4QA 3K5NA 1PH2A 1ILPA 1AN8A 1PFMA 1N33Q 1EY7A 2F0WA 3VYRA 2R7FA 4B3RL 1MSGA 1B7YB 3G6EA 5J3BA 1JB3A 3FKIB 4IJLA 2MPMA 1U4MA 4OO1I 3U4ZA 3CKIB 1XTCD 2R3ZA 4KD4A 2I5HA 1P8LA 2YTYA 4UPAA 3GTKH 4WFN3 1Z9FA 3K0YA 4LF4Q 4A3IH 5CBAE 1QNKA 1EZ6A 1V1OA 4GS3A 3VR2A 2L5TA 3NELA 1SEBD 1X3EA 1JB7A 1JJCB 1TWCH 4KMUC 1VQJA 1IL2A 3J7A5 5C0XI 1PH7A 2WAQE 3RZDH 3S24A 1E1TA 3PF4A 1WTHA 5GROA 5FLXL 4BA1I 3E9IA 1PRTF 1B4OA 2M9VA 4QJFA 2NN6G 1TS2A 5KNBA 1PH8A 1K3BC 4Q5VA 4ZUIA 3NQIA 4LF8L 2UXBQ 3E0JA 4F8MA 3T1HL 3S1QB 4KHPL 3QJYA 1G51A 3HFZB 2NVTB 5I2XA 1TVXA 2B8GA 3KF8A 4Y7NB 4E6IA 2KQ3A 5C4ZA 5DEHA 3W1GA 3HOZH 1H9SB 1M8AA 2KECA 1HR0Q 3WDNA 1OXVA 4X65L 3FVQA 2E2DC 3U4VA 1SNPA 3BU2A 2ALYB 4DK0A 1B44D 5IWAL 1WTXA 3RNUA 3IKJA 2EYPA 2R61A 1Y1WB 1VQCA 1OXUA 5I9OA 4A3JG 4KD3A 3OOCA 1STNA 4EGVA 2NVYH 2PZTA 1XWEA 1PYBA 3K7AH 1JT8A 2CW0C 2QEJC 1IXRA 4XYQA 1EQRA 1PRTB 2ZT9C 1W6JA 4DK3C 2PMZE 1KIXA 3MFYA 2O4XA 4KHZA 2K5VA 1K8OA 2PNRC 2KCCA 5C0XG 2WV6D 4IUQA 3MXNA 4NXNQ 4YHHL 4DUZQ 1B70B 1B53A 5IE8A 4UY8C 4M8AA 2CW0D 2SEBD 1C48A 3K57A 3MWYW 1JJ2A 1LV9A 4NXMQ 2R93H 5M5WB 3H91A 2N49A 3PO2B 3GV6A 1SNCA 5C5LA 1WI5A 1SN8A 4JBWA 3I4NG 3FEWX 3A54A 2O2LD 4A3FH 4OX9Q 1LM0A 1A8VA 2G5DA 4IUPA 4XQNA 5AJ3Q 3KF8B 1F9RA 2K7VA 2HCIA 3BVZA 1CQVA 5I4DA 1F2YA 4A76A 1VMPA 2SNMA 3MXNB 2D9UA 3EN2A 1G291 4IZ8A 4ZAIA 2C5CA 3HKZE 3TBIB 1SE4A 4K2KA 4B3SQ 2EJMA 5C4XB 4IUVA 1HUNA 4X3TA 4K8JA 1F9PA 2X69A 1EY0A 1PH3A 3PIOA 1F2LA 2VUMB 1HJPA 4JW0A 4K14A 2K5NA 5L37A 4BWGB 4X3KA 2JN4A 4LAAA 1EOTA 3CMAA 2RSOA 3CPWA 1K0RA 1QZGA 3SK6A 2IJ0A 3J80E 1E2VA 3NEMA 2EVBA 2Z6BA 3KF6A 1WCMG 4A3LG 2BDOA 1QNUA 2IHFA 4C3JB 2NN6H 4DR3L 2B2TA 4DU9A 1YHQA 3DLLA 4KN7C 4NXML 3S14H 4H7BA 4HAEA 3AFPA 4J6HA 4ILWA 1SSOA 1ZKOA 5DM63 1EFWA 1N9WA 4YCUA 3R8BA 5ELFA 3TRZA 4X3SA 2ICEC 2HUGA 4DR2L 5C4JB 4QUFA 4EQNA 2EXZA 3A0JA 1CHPD 1SE8A 2I46A 2WKDA 3DMUA 3SK8A 1BO0A 2VUMG 1YVCA 1W2BA 3GTQB 2XRQD 3QIAA 5E3FA 3PUXA 1BXTA 3K80C 4O0AA 3V96A 3IRBA 4LUOA 1DJRD 4KTAA 1SFOB 5ELDA 2K6AA 3A8KE 1X9NA 4P73A 3TS2A 1EQQA 3GTPH 1X3QA 4HMIA 2K01A 5F2DA 1HTLD 5EPKA 1HQRD 4BS9A 3WOFA 2L9HA 3QB3A 3CCJA 4CKBA 4FO2A 1AEXA 5FO7B 2PO4A 2Q2TA 3TP6A 1JOQA 1TIID 4KKSA 2LSSA 3HOYH 1MJCA 1VQ7A 2JA6G 2YTVA 3CCQA 1D8LA 3BDOA 1LYLA 2BA0A 1ICWA 4A3DB 4S3SA 2F0OA 3ULLA 4R4OA 3LWUA 4RKBA 3DHQA 3M4QA 2ZXOA 1X32A 3Q23A 4OEMB 1I5FA 1PLFA 1CI3M 4QB4A 1KRTA 1G8ZD 1FVIA 3TN2A 1GVPA 5BR8Q 1N34Q 2X6GA 3I56A 3AU7A 2L1BA 3I7FA 4DR5L 5IIFA 4DR2Q 1PTOC 4A3FG 1X65A 4IUTA 4NMZA 2Z4IA 1U9RA 1BCPD 2UUBQ 2XIWA 2NVQB 4DV2Q 1JC7A 3BVMA 1EZ8A 5C3XA 1EQVA 1I6VC 3D3RA 4TSSA 4RCNA 1Q86C 1N8RC 1GKHA 1XNRQ 4A93B 3KUPA 3KBGA 2QW7A 1CT1D 3URYA 5DLQE 3I55A 4PMWA 2J0TD 1EYDA 2B2UA 3HKZB 1AFPA 4BY7G 4UAIA 3GTMH 2WFWA 1WTVA 1B3AA 1SJHD 4DA2A 3S1QH 1J5EQ 2K04A 2KEDA 2F0IA 4F88A 4HMJA 2K33A 5LL6X 3R93A 3QWNA 2KOLA 3FDTA 2HDLA 1XNQL 1BKBA 2EYLA 3S2DB 2CH4W 5M3MH 1STBA 3NTHA 1EWCA 1HNZQ 2BE5D 3OHXC 3K59A 2RF4A 1UEAB 2MQHA 4GKJQ 2FFKB 4RGOS 5EKKA 2NB0A 2HQEA 3RN5A 1Q90A 2GN5A 4HJ7A 2E2IH 4DR7Q 3KK7A 1SYBA 3V2TA 1GHJA 4DV3Q 3HOXB 1UE6A 3P75A 1S5FD 2WIIB 2VW9A 1PFNA 1VQHA 3VA7A 1F77A 4CDFC 1CQFA 2HQLA 1XPRA 3TZDA 4BXXH 2AQ3B 1TWHH 1I4RA 2JJQA 2RKSA 3ERQA 4ZQ3A 2Z6KC 4KLKA 3CXCA 4DGZA 1YHBA 5LMNW 2ZTEA 3NBHA 4GNXB 1BUVT 5IY0A 3IFDA 1PFBA 2OF1A 3MEFA 5E4XA 3RLFA 3GTJB 1K0SA 1VQAA 1WTQA 4C2MH 4UP8A 3MXGA 1EYCA 4IUUA 1ICFB 2ZXRA 4EX5A 4IFDI 1K9MC 1TWAH 1UE5A 2A68D 3EROA 1I50H 4RMFA 4JPBW 1NJIC 4IALA 4LFBQ 3D31A 5LMNL 1IKMA 4LUVA 1PH6A 4A3LH 1LTID 4FYDA 1SYCA 1KD1C 5IYDH 1HFGA 2E2JH 3NBHB 4DR6Q 1LTSD 4OWTB 1C9OA 4OL7A 2E2HH 1PVOA 4JI0Q 5HGQA 1SROA 2JA8H 5JJKA 1CKMA 3D4RA 5IYCH 3A5ZB 3S1NB 4PG3A 4GOPC 1RKNA 1WTRA 1EYGA 3CRLC 1X54A 5ELEA 1ASYA 1O78A 4A75A 4A3JH 1KQSA 2EYFA 1EIGA 3X3MA 5DAUA 1EL0A 4AYBG 1EYAA 5CV8A 2ID0A 4MIUA 2EY6A 1VF5C 2RBMA 1X56A 1B9MA 2JSOA 3LWEA 2QKIC 4WRDA 1E24A 2H4OA 1Y8PB 4K0KL 1C4QA 4P71A 5A35A 4A3IG 1GUGA 1SLJA 1ILQA 3G7LA 4A3GB 3E9HA 2DJFC 3I90A 5AFWA 3FPUB 3EIVA 5ELCA 2LY7A 5FO8B 2RQXA 1MBYA 1TS5A 2CVRA 3VR3A 3CD6A 1RF2D 1V1PA 1IYVA 4K6LA 1E1OA 2HT1A 2IL8A 1XXGA 4HR7B 2AQ2B 2H1EA 4GN5A 1R9TH 3SEBA 1V8QA 1WD1A 3I4MB 3NQTA 1PYSB 4LW1A 2ZJRA 1QVFA 1YBYA 1SNMA 3NK9A 2B63B 5IT9L 3SXHA 1LT6D 1QVGA 2X6LA 4L8JA 4GNXC 3SHLA 2M00A 4XQJA 5IYBH 2MFIA 4L5TA 3HOXH 1B9NA 3GO5A 1EY6A 1UEBA 3E3XA 4BBRG 2Q8TA 4IFDJ 1TWFB 4CJ0B 4AQYQ 1IBKL 1Q82C 4DAVA 2KA7A 1ENFA 1A3TA 2E5LL 1AE3A 2F52A 2OXPA 3A8JE 4A3EB 1S5ED 4BY7H 2B8FA 1VQNA 1NBWA 2Q2IA 5C3EB 1JWUD 3S2DH 3T16A 1KAAA 3CQZH 1Z6HA 1SYDA 2MP1A 5EQ0A 1KHIA 1BF4A 3S17B 1FJGL 2A19A 3HOYB 4LF5Q 5IYDG 5ELNA 1XPOA 5HURA 2BOSA 2AUKA 1QUQB 1I6HH 4JI2Q 3RUZA 1FGBD 3HGBA 2Z9HA 1HTPA 3SGIA 3PUWA 5ISRA 4R9WA 5CORA 4A3KH 1SR3A 1HA5A 4GKKQ 3C3LA 1F2MA 1TXYA 4JV5Q 3AFQA 2Z0SA 2NVQH 1I4HA 1GO3E 1PXUA 3I2ZA 4P72A 1SXTA 2EOTA 4MNOA 4R1JA 2Q8RE 2Y0SG 1BVSA 2YTXA 1MKHA 3HRZC 2QEXA 1HH2P 3KLRA 5JEAH 1NTGA 3U50C 4LNQA 1OXSC 2JYOA 4G4KA 3EQLC 4H44C 2PQAA 3RN2A 1KTKA 4XXEA 4R8IA 4PZ7A 2E5LQ 2MUYA 1WCMB 1PFSA 5M3FG 4LF8Q 2UXBL 1AZQA 1Q46A 3H0GH 1A3UA 5C5MA 3M4PA 1L0YB 4JI7L 2EPBA 2I5MX 4ZKBB 1SNQA 2F0SA 4QUCA 3NE5B 1D1KA 2KHIA 2ZXPA 5DM73 2KCMA 1F9SA 4U68A 4A3MG 3NWTA 5IGFA 2RA4A 1IYJB 2A68C 1BBUA 1K3RA 1I3QB 4WJWA 3STBC 2VUMH 1ZYRD 1CK1A 3J81i 2HCCA 1BCPC 4OIJA 2IX3A 2DN8A 5A2QE 2OEOA 5IGBA 3HOYG 4ZYSA 3NENA 3VYUA 1Q81C 3I4NH 4BY1G 1QWYA 3UDIA 2JA8G 2VQEQ 1O7IA 4DKAC 4L6TB 4OONA 4B3RQ 3F2CA 3RLNA 3I4LA 5C4JH 3NWSA 4CKEA 2SNSA 1JCKB 3M4YA 2B2WC 1EIHA 2DJGC 4JI1Q 1W6KA 5D3DA 3ULPA 1MHWC 4JOIC 1EY9A 2F03A 1R4QB 2HHHQ 1LT5D 1STYA 3UDFA 4C3JH 2ICIA 1N32L 4BBRB 5KGUA 3Q6SA 4IQZA 1E0BA 3I73A 2DY8A 3QOLA 4PMBA 1A0IA 4TQUS 2WB1E 3QO2A 3GTLB 1U5KA 1VF7A 4DNTB 4LF7Q 1RD9D 2O5IC 1WCMH 5K36G 4OELB 1PZID 1LT4D 3U9OA 4A3MH 2B2VC 4F7XA 3F8TA 3T13A 3WWVA 4RHSA 5G3LD 5C3WA 1I4PA 2EXDA 1X6OA 2NVYB 1OTCA 1BR9A 5CV9A 1TS3A 2VZAA 1KDCA 3CCSA 4A3MB 4O1NA 4DR4L 1XMQQ 2I07B 3S9WA 4IPCA 2K32A 3OW7A 2OTLA 4X3UA 2J7ZA 5CYUA 2RHSB 5J1ZA 2I0QA 5FJ8H 4R4QA 3T1YQ 2J4XA 3ZJYC 1PZJD 3HOZB 2P5ZX 3M7NA 1LTBD 2QDBA 5LL6S 4BBRH 4Y7NH 2EJGC 2WAQB 2B2YA 2F1MA 5C44B 2UUCL 3P7JA 3LNNA 3PUVA 2F0NA 1I4GA 1LTLA 5M3MG 2JA6H 2JP1A 3CRKC 2B2TC 4RA8A 1G6PA 5HGTA 3FMCA 4ZCKA 4KN4C 3G6JB 3OTOL 4JI8L 3P20A 3HOUB 1G6ZA 3R3OA 3QOJA 2PW5A 4IOCA 3A74A 2MHVA 1GUWA 1A2TA 4IJHA 2MNAA 1IL8A 4A3EH 1TWGH 3OSOA 3A5UA 1GUNA 3SE0A 1NAPA 2O5JC 3S1RH 1FGUA 5ELBA 5NUCA 4CGYB 2D5DA 2MJ8A 4WJ4A 4I7ZC 2NZOA 1L2FA 1TKWB 1I3QH 3CCMA 1LTGD 4AYBE 5IT9c 1BQQT 4IPGA 1MIUA 3TDQA 4IPDA 3PO3G 1Y8NB 1VQMA 2JE6I 1NCVA 1YI2A 3BZCA 4K5VA 2UXDL 2FMCA 2R92B 3SDZA 4DV4L 5ELOA 2EQSA 4XDXA 4LFBL 5G3LF 3T1YL 2XTIA 3PO3B 4QCLA 2JXMB 2NBFA 3I70A 3S16H 3W3AA 1HNWQ 3MXUA 2UUCQ 4YWLA 2F4VL 2CWPA 1SNOA 2TSSA 3J7AF 1SRUA 2V1CC 3EFXD 2OQ0A 3RZOB 3F2UA 4L63B 2EYJA 4XT3B 2K5HA 4X64L 4IO9A 2IT1A 5I6YA 3AB9A 2ZTDA 4CHTB 1JR0D 5IP9H 3BG3A 1GJXA 1UWVA 1Q7YC 1VQ6A 1GXDC 1PTOD 2WB1G 2K50A 3ITPA 3FKIH 1KDBA 3PQIA 2HIXA 2KHJA 2MO1A 2PQEA 4DV7Q 2VY3A 4NW2A 3A55A 4N8FA 4IPHA 5FOBB 1VQ8A 4V190 4EQOA 3PV0A 4H0LC 1HQMC 1STHA 2AMCB 3MEHA 1XNQQ 3HOVH 4YIJA 1YNJC 1VQPA 1QZHA 2YU9H 4B3TQ 3Q8DA 4BY7B 1E7ZA 1K83H 3I4OA 1O7YA 4IURA 4CBVA 4RWSC 2EYMA 3PIP3 4TKOB 1SNDA 1FNWA 1VMCA 1HNXL 2JA5B 5C6AA 2NWGA 3PGZA 1RTNA 5JJLA 4DK6C 4G7ZC 4B08A 1K28A 1SMYD 4RFBA 5GADC 5EPLA 2MO0A 1QILA 2WB1B 1ZEQX 3CC2A 4RH6A 3H6MA 1ESRA 1V1PB 1SDFA 4AYBB 1ESFA 4QMGA 4JI8Q 3IFTA 1N34L 1NMFA 4RGNA 4KY5A 1QOHA 4OGQC 1VS0A 1WFQA 2B63H 2SDFA 1R9TB 2JEAI 2OTJA 1A63A 2A8VA 1NNXA 3DWAA 4HSVA 4POGA 4QQBX 3ND8A 5I6WA 5JVG3 3CF5A 1QG7A 1HRJA 3MZ5A 3M4OB 2BCOA 5IODA 1YEZA 5IP7G 3OW2A 3PF5A 3JAMi 1M4VA 1RDPD 4UP9A 1CZGA 3JC66 2AHOB 5J22A 1HR0L 1U4RA 3JAML 3S1RB 1CA6A 2UUAL 1HUMA 1KXLA 1JOKA 1TQOA 2JQOA 2VQEL 1X3FA 1EU3A 3UE1A 4DR6L 2D2CC 1KABA 4IUNA 4WORA 1AZPA 3BZKA 5K36H 2NTSA 5KNDA 4DR3Q 1TU2B 2F0JA 3R2TA 2K1BA 1WD0A 3TP7A 3CW2C 3EJIA 5EGTA 3BDCA 2EYOA 3DM3A 3UDXA 1B3QA 2E2HB 4GLVB 1VQEA 5LMUL 1ET6A 3I91A 2L11A 1VCIA 4JI5Q 4PZ8A 1NR2A 1HFNA 5JPNC 5C4HA 4ME3A 1SYEA 2JA7B 1YNND 3NSWA 4A3CH 1DD2A 4DFAA 4OWXB 1WJJA 3CHBD 1G91A 3H3VC 3DWQA 3S2HB 3J7YW 3F2BA 2R7ZB 3STBD 4JI6L 4DV6Q 3L2PA 4AH6A 1M90C 3C1EA 4C3IH 1DM0B 3VR5A 1G2TA 3HOVG 4MTKA 4HIOA 4JYAL 1O80A 2N8NA 3NBIA 1D5XC 2RHQB 3PSIA 3T4AC 2L15A 4IFDG 2F0MA 3PUYA 1D1IA 2PYKA 4ME5A 3UI2A 2JA7G 2DNEA 1KNEA 1CTMA 1SE3A 1FYCA 3QG1A 2PI2E 1T5XD 4UDUC 1STGA 2NZHA 2KVMA 4POFA 2R93G 5C3EG 5IGDA 4I7AA 3H09A 1CSPA 1YJWA 5M3FH 2I5LX 4Y52H 3GV3A 4JI0L 4LFCL 2LFNA 2NYZD 1Y1VG 1SFOH 4JI5L 2F0TA 1PH9A 2WINB 2ZJPA 1JORA 3GTQH 2VXWA 5JEAG 1J9OA 5KEEA 5COYA 2CWAA 2EY2A 3T1HQ 3I4NB 5JJIA 1PH4A 2RDHA 3J81c 5M3MB 4G7HC 3S15H 5EPJA 1LLRD 1ZYRC 3I72A 5I9PA 3S1MB 1ENAA 1I94Q 4OHJA 4APVA 3TSSA 4X66L 4A3KG 3CPFA 1D5MC 3K6OA 2UXCQ 2B3GA 5E7NA 1EIFA 2QGQA 3OWEB 3D0FA 5JVH3 2KBNA 1RTOA 2A73B 4DAPA 5IT9E 1N33L 5IOCA 5FJ8G 1T9HA 1LACA 1ASZA 1LABA 2CH4A 2FHTA 3OMCA 3RR5A 1HHVA 1PTOB 3OWFA 4XIGS 2K14A 1HNZL 1WOCA 4OO1H 5CV6A 4JI4L 3CAMA 4GN4B 3ERSX 4GKJL 3E5SA 2ZM6Q 4JC0A 4B9WA 4C3IB 4NXNL 1CFMA 3TS0A 5C4XH 4UP7A 4LF9Q 2IX0A 3DM1A 3D8GA 3K5OA 5EBCA 4HIDA 3K7UC 3I3CA 3NP8A 2F3WA 1UE7A 1VQ9A 1IKLA 1PMRA 2KENA 4N8X1 1VDZA 4BBSG 1A15A 3G4SA 5A2QL 2C9OA 2M2LA 1PTOH 4A3KB 4KJNA 1EWHA 2HIVA 4DV1Q 2L0CA 3TQYA 1MJEA 1S4ZA 4A3FB 4BY1B 2E74C 4K5WA 2XWJB 1I94L 1PRTC 1XMOQ 4DXFA 2E75C 3NUCA 4C3JG 3E0EA 3TEHB 1HZAA 4X66Q 3K81C 4UHVA 3PO2H 3GDEA 1TR5A 2R93B 4K8IA 4C3IG 4C1NI 4FXDA 3S17H 3GTPB 3H94A 4HJ5A 1DCZA 4JI6Q 1MD2D 4PNYA 3KLSX 4A3DG 3HZXA 3I8ZA 1Y8OB 5C3EH 3HKZG 4ZRZA 4LF5L 1WYDA 2XVSA 3L0OA 1H9MA 5IWAQ 4B3ML 4QIWE 2QF7A 4RGMA 1E3PA 1VQGA 1PV4A 5GAEC 5KNCA 1S5BD 1Q8IA 2GVAA 4XYOA 3BJUA
chains in the Genus database with same CATH topology
2NUCA 2XSCA 4HTHA 4JV5L 1L0WA 3ULJA 5IYBG 2OWOA 1NR4A 2V4DA 2RDFA 1G2SA 1UUPA 1H9KA 4LFAQ 4ID6A 1F2ZA 3C1FA 1N32Q 4JOIA 3OYYA 5KYLA 4HCEA 3J7AV 3ER0A 1DOKA 1HCZA 1B1ZA 4TVAB 3I4MG 3MXPA 2F3IA 1ONLA 4DV1L 4DV5L 1GM5A 2K28A 3G48A 1XJVA 1LTAD 4KK7A 2K75A 2K5DA 1STEA 1U4LA 1EY4A 1DGSA 5I2YA 4DV0Q 4FF1A 4HJ9A 3X3NA 3KF6B 1L1OB 5KIXA 4L5QA 4HEDA 4V0BA 3JAMc 2PPBC 3VYSA 4FP5D 1SMYC 5CGKA 5GQOA 1EIYB 4MN3A 2B2VA 3KJPA 1EY5A 2R7ZH 4YCVA 4A3GH 1S3OA 5FLXc 3M9BA 1SAPA 3SR1A 3J81L 4A3BB 4R4CA 1D5ZC 1B50A 3EVQA 4KI0A 1WVLA 2R92G 1VQ4A 5CC4A 2DGYA 1A2UA 1VQFA 3KLWA 1SE2A 1IW7D 2YU9B 3CC4A 3K58A 2JEBI 5LMNQ 2CCZA 2ATWA 1I6HB 2AKWB 3V05A 4C56C 1XPUA 4YY3Q 2KCTA 1D7QA 3FKIG 3M7GA 2A6HC 2A5HA 4FXGC 3TP8A 1IBLL 1VQKA 2ZJQA 1FNVA 3GD7A 1OO9B 4FDBA 4DN4M 1IYUA 3CQZB 1X55A 3J81E 2AWNA 1N36L 3FRPB 1HZBA 4JG2A 2EZVA 2XRSD 3VA5A 3MC0B 4DV2L 2Z6KA 4R8NA 2EDGA 2LS01 3Q24A 5GAHC 2Q2UA 1GUOA 1T5EA 2NVXB 5H1SE 3PO2G 1XNRL 2N55A 2RSNA 2XWBB 1LTTD 2G9DA 3NPPA 2WAQG 4N9PA 3RZOH 4GN3B 2B39A 1YHAA 3NTIA 2RDGA 1X3PA 4HJAA 1CKNA 1DOMA 2B29A 1II3A 5CV7A 4C2MB 4X65Q 1PZKD 3GTJH 2A6EC 3KBXA 4A3GG 3S16B 2QA4A 3EBEA 2FINB 4JI2L 4IN3A 4C3HH 5JOBA 1S5DD 5FO9B 3OPOA 3PO3H 2Z1CA 1AH9A 1Q12A 4DNIA 2XNAC 4DR4Q 1TWHB 4C3HB 1YITA 4ZUJA 3J80c 2JK8A 1Y1VH 2IPKD 3L9AX 3VYTA 4GKKL 5C4XG 3GTOH 3M3YH 2IY5B 3BYYB 1SJED 2F4VQ 4PZ6A 1L1OC 4EVOA 1W3SA 4GNXA 1IBLQ 1STAA 3ND9A 3A7LA 4XT1B 3DUZA 4LF6L 1EWIA 4QY7A 1CM9A 1D6EC 4LFCQ 3RZDB 4HJ8A 2L55A 3VR6A 4DR1Q 1R4PB 4J1MA 5TSSA 2F0VA 3R2IA 4A3IB 1ET9A 5HY6A 2OQKA 1QB5D 3CCRA 1YNNC 2G9HD 1TWGB 3A7AB 4CJ2C 3OTOQ 5BR8L 4DUYL 1K8MA 2LMCB 3EA6A 3KDFA 1QUQA 3HOUH 1A62A 5T1IA 3GTOB 3M3YB 5EAYA 1IHZA 2F0KA 1RL2A 2AUJD 4DV0L 3O13A 4KJOA 2BE5C 2JA6B 3J81j 2UXCL 3S1NH 4H02A 2K03A 1FNUA 5EBDA 5IGGA 1PHJA 2D0OA 2JA8B 1GUSA 4DV6L 1E22A 4A3CG 5JPMC 4PQXA 1K73C 1RJTA 4A93H 4DAYA 1Q1BA 4FNFA 4KY6A 1H9JA 3VDYA 1AW7A 4JYAQ 2NTTA 2F0LA 1JJGA 4JI4Q 4DV4Q 2UU9Q 4OWWB 1JE4A 3W2DA 3MVVA 1H95A 3NXWA 4A3BH 4JCVE 5KYIA 5C0XH 1HNXQ 2NVXH 4LUZA 4MTNA 3H3VH 4C3HG 2PZWA 2PI2A 5IP7H 1A3VA 4LF9L 3TP5A 4YY3L 1HNWL 1SYFA 4TRDA 2IX1A 1Z47A 4DR1L 1O7LA 3KYHC 4PV1C 1JICA 1H9SA 2B2YC 1U0LA 4BA2I 1BOSA 2JA5G 4JK1C 4YHHQ 4RKLA 4DAYB 2Z8LA 5D3IB 4DV3L 1Y1WG 1YJNA 3NHHA 1O7ZA 1GUTA 3FPPA 5FLXE 3GTLH 5CBEE 2C35B 4CJ1B 1XX8A 5IGCA 5IYCG 2AQ1B 2R92H 5IP9G 1VQIA 3HOZG 2NN6I 1EEFD 1P16A 1DOLA 1NSNS 1Q3LA 1UAPA 5EKIA 1BDOA 1CUKA 1EUJA 3K5MA 1IZ6A 4A3EG 3ZYYX 3W1BA 5T1GA 2R7ZG 2Z4HA 2OT2A 2KJXA 1DONA 2AWOA 2KCNA 2FXQA 3HOUG 5BN4A 4GOPB 3MFGA 4QL5A 5CV5A 1OXXK 2EYHA 1CA5A 2VQFQ 3KOJA 1ZXTA 2UUAQ 1DXMA 4B3MQ 2N78A 3B6YA 3ICEA 2K5QA 2DUDA 1KC8C 1YNXA 5CV4A 1L0XB 4L5SA 2Q2HA 1PH5A 2L12A 1S40A 1D2BA 1Q8KA 3HOWH 1B2TA 2CKZB 2B2WA 1BCPB 3F2DA 3CCVA 3PMFA 3AQQA 2F0PA 3GTMB 1KAWA 3SK5A 4DF7A 2ZM6L 3SK4A 1EU4A 5C44H 4XTCS 4LF6Q 2Y0SB 5M5XB 3TREA 4JI1L 4BBSH 4P2CB 1QE6A 2DY7A 1HZCA 4K5XA 1QJOA 3CMEA 1BCPF 1BBWA 3BYTB 1UE1A 4I65A 2A69C 2EJFC 4L5RC 3H0GB 1NUCA 4NDXA 2K5WA 3T56B 1PA6A 1CKNB 3L3OC 1VQ5A 3RLOA 2KEEA 3D6WA 1GOZA 4FF2A 2KHSA 2EE1A 5M9OA 2HDMA 2GVBA 4IFDH 4ULLA 4OO1G 4RHRA 3HKSA 4J8QA 3UDGA 2CQAA 3AEVA 3MTSA 2SOBA 4X6AH 4EQ5A 2IHEA 2YV5A 1MGSA 2VB3X 2XGTA 2K05A 3FHWA 1J5EL 2VNUD 3N6RA 3DEPA 4ZKCB 1TY0A 5C0XJ 2K4KA 2PZUA 3CP0A 1YNJD 5CR3A 4G7OC 5EKLA 5K5PA 2D62A 2F4IA 4K2LA 1CZWA 3W5OA 1NMGA 2WP8J 5GAGC 3PUZA 4OIKA 1Y69U 4HSPA 1DYQA 2F0DA 1NY4A 4JBMA 2E8GA 2UU9L 4BY1H 4MZ9A 3CC7A 4J15A 1A6XA 1EFID 4NPSA 5FLMH 2PCFB 2L4NA 3J80L 4YWMA 1CHQD 3JAME 4DR7L 4QGUA 2F0HA 1L1OA 1S72A 3S1MH 1N36Q 5FLMG 4X64Q 1SBBB 3E6ZX 2R7DA 5C44G 2N3SA 3AMUA 2FMMA 3S15B 4GZYC 3CU7A 1IW7C 2A1AA 4LWCA 1TT2A 1WTWA 2ES2A 5M5YH 1NE3A 2RVLA 3DWPA 3K7AB 4QIWB 4RCOA 2EY5A 3RMHA 4JBJA 5LMUQ 3Q22A 4AQYL 1IBKQ 4DXGA 3C2PA 3CCEA 2A69D 1E2WA 4PMCA 1FD7D 3HG9A 4DK1A 4WJ3M 4GLAC 4H13C 1TWFH 3T51B 3H3VI 1LUZA 1HZ9A 2IWHA 4U673 1QVCA 1AE2A 4XQQA 3HS0C 3BVGA 4EQPA 3U9SA 4DV7L 2LKVA 3S14B 5BN5A 1LTRD 1HXYD 3VR4A 5E1FA 4ABNA 1J6QA 3PIPA 3HEJA 2RCNA 4A93G 2YYZA 3IAYA 2PQAB 5E4WC 3TZUA 1F9QA 3PIO3 1JQYD 2K52A 4P74A 5M5XH 4A4IA 1FJGQ 3NTKA 3LX0A 5KRUA 5D14A 2VS1A 3PCOB 4B3TL 1U4PA 1M1KC 2GA4B 3I4MH 4HN7A 4ODGA 3HOWB 1Z7TA 1RCVD 4MHEA 1HA6A 1QCBD 2DNCA 1IBMQ 3D4WA 4O42A 4R4TA 2KUMA 5M5YB 2QILA 2NZ1D 3T53B 3N52A 1C8CA 4RGTA 3MAQA 2WKCA 2ASBA 3S2HH 3IL8A 3OMGA 1FL0A 1TWCB 1YZ6A 1UNSA 2HHHL 3FP9A 5FK9C 4P75A 2JA7H 3WOEA 1PH1A 1OXTA 2F0QA 4ZK9B 3P1HA 5FKAC 1VQBA 5M3FB 3OIPA 4DUYQ 4O2DA 5EJWA 4RAUC 3H0GG 1PDQA 1JMCA 4LF7L 1XMOL 4NP5A 1Y14B 3MHBA 3KLSA 4OXPA 4ZLTF 4R4IA 2LXJA 4OX9L 4A3JB 5M5WH 3ONAB 4JI7Q 2H5XA 3G71A 1VQLA 3TMEA 3M85A 1PRTD 2PW7A 3HOWG 4NKLA 3A8IE 1YIJA 1C7YA 3C46A 1K8AC 3SVMA 4KKTA 1XTDA 2PNHA 4B9XA 4KV6A 2F0FA 4KKUA 1SYGA 1XMQL 4N9TA 1EEID 3A56A 5JAVA 5LHY1 4ALPA 2R6GA 1EOVA 1ENCA 4KY7A 5IGEA 4X62Q 4IOAA 4QF4A 3GTGB 1IBML 2Q8IB 1VQDA 1Y1WH 2EIFA 1WTOA 1TWAB 3CCLA 4LF4L 1JWSD 5D65A 1YJ9A 4CKCA 4LJZC 1E2ZA 5DNFA 4F87A 1BBXC 4C1NK 4JI3Q 1DZ1A 4LFAL 2BA1A 4BBSB 4FVMA 1EQTA 2CFMA 1MI2A 2NVTH 2BDNA 2OCEA 1HPCA 3BDLA 2A74C 3DXJC 2A6HD 1HR0W 1PTOF 2TMPA 2VL6A 2UUBL 1V1QA 4HIMA 1XYIA 4NB3A 3UE0A 1LO5D 3U58A 4FF4A 4KHVA 4LK1C 1EY8A 1C0AA 4HIKA 4HCSA 3CCUA 4YCWA 1BNZA 1GD7A 1I4XA 4AIMA 3HOXG 2E2IB 1H9RA 4Q0FA 1VQOA 2JA5H 4K0KQ 3OIQA 1CSQA 4DPGA 1RHPA 3GP7A 1TS4A 5JJZA 1K8GA 2VQFL 2VB2X 4JBKA 2WACA 3DEOA 2ENBA 2B2UC 3GTKB 2UXDQ 2BH8A 3J80i 4X62L 4FXKC 1K83B 3M4OH 4G57A 3HOVB 3AYHB 2BH2A 2E76C 4A3BG 4BXXG 1LT3D 5CMDA 2LXKA 2EY1A 1KLGD 1AP0A 2F0UA 2A6ED 1MSHA 2IW3A 1KLUD 1Y1VB 3KDFB 3L7ZC 1X3GA 2PMZB 4FF3A 1JWMD 4JI3L 1Q1EA 2CHBD 3KFUA 2F0GA 3BS1A 2D0PA 2F3VA 2N88A 2CQOA 3Q0AA 3GQBA 4DUZL 3KJOA 1KL9A 1V43A 2Y0SE 1WTPA 1KDAA 4DNRB 2XN9C 4K6DA 3K0XA 5JEAJ 1SMXA 4RG1A 1KNAA 1PYWD 4DAMA 2E2JB 1ML0D 3MA2B 2QCPX 2F0EA 3D6CA 3BZDB 1CKOA 3D4DA 1B8AA 1TY2A 4M1UB 4GOPA 1JOOA 3H15A 3F1ZA 2B63G 3GTGH 4DR5Q 5AJ3L 3K8AA 4GLXA 4DV5Q 3K5LA 3RD4A 1GHKA 2ZTCA 1I50B 5BN3A 1V9PA 1RIPA 3HP3A 5J39A 1FR3A 2FJ2A 4KHPQ 4LMQD 4YWKA 4Z9CB 2JA9A 1JE5A 1KRSA 3J7ZC 4B3SL 4A3DH 1J8IA 3LGJA 2MGSA 1S5CD 1RODA 1PH2A 1I4QA 3K5NA 1ILPA 1AN8A 1PFMA 1N33Q 1EY7A 2F0WA 3VYRA 2R7FA 4B3RL 1MSGA 3G6EA 1B7YB 5J3BA 1JB3A 3FKIB 4IJLA 2MPMA 1U4MA 4OO1I 3U4ZA 3CKIB 1XTCD 2R3ZA 4KD4A 2I5HA 1P8LA 2YTYA 4UPAA 3GTKH 4WFN3 1Z9FA 4LF4Q 3K0YA 4A3IH 5CBAE 1QNKA 1EZ6A 1V1OA 4GS3A 1JB7A 2L5TA 3NELA 1X3EA 1SEBD 3VR2A 1JJCB 1TWCH 4KMUC 1VQJA 1IL2A 3J7A5 5C0XI 1PH7A 2WAQE 3RZDH 3S24A 1E1TA 3PF4A 5GROA 5FLXL 4BA1I 3E9IA 1PRTF 1B4OA 2M9VA 4QJFA 2NN6G 1TS2A 5KNBA 1PH8A 4Q5VA 4LF8L 2UXBQ 3NQIA 4ZUIA 3E0JA 3T1HL 4F8MA 3S1QB 4KHPL 3QJYA 1G51A 3HFZB 2NVTB 5I2XA 1TVXA 2B8GA 3KF8A 4Y7NB 4E6IA 2KQ3A 5C4ZA 3W1GA 5DEHA 3HOZH 1H9SB 1M8AA 2KECA 1HR0Q 3WDNA 1OXVA 4X65L 3FVQA 3U4VA 2E2DC 3BU2A 1SNPA 2ALYB 4DK0A 1B44D 5IWAL 1WTXA 3RNUA 3IKJA 2EYPA 2R61A 1Y1WB 1VQCA 1OXUA 5I9OA 4A3JG 4KD3A 3OOCA 1STNA 4EGVA 2NVYH 2PZTA 1XWEA 1PYBA 3K7AH 1JT8A 2CW0C 2QEJC 1IXRA 4XYQA 1EQRA 1PRTB 2ZT9C 4DK3C 1W6JA 2PMZE 1KIXA 2O4XA 3MFYA 4KHZA 2K5VA 1K8OA 2PNRC 2KCCA 5C0XG 2WV6D 3MXNA 4IUQA 4NXNQ 4YHHL 4DUZQ 1B70B 1B53A 5IE8A 4UY8C 4M8AA 2CW0D 2SEBD 1C48A 3K57A 3MWYW 1JJ2A 1LV9A 4NXMQ 2R93H 5M5WB 3H91A 2N49A 3PO2B 3GV6A 1SNCA 5C5LA 1WI5A 1SN8A 4JBWA 3I4NG 3FEWX 3A54A 4OX9Q 4A3FH 2O2LD 1LM0A 1A8VA 4IUPA 4XQNA 5AJ3Q 3KF8B 1F9RA 2K7VA 2HCIA 3BVZA 1CQVA 5I4DA 4A76A 1F2YA 1VMPA 2SNMA 3MXNB 2D9UA 3EN2A 1G291 4IZ8A 4ZAIA 2C5CA 3HKZE 3TBIB 1SE4A 4K2KA 4B3SQ 2EJMA 5C4XB 4IUVA 1HUNA 4X3TA 1F9PA 2X69A 4K8JA 1EY0A 1PH3A 3PIOA 1F2LA 2VUMB 1HJPA 4K14A 2K5NA 4BWGB 4X3KA 3CMAA 4LAAA 1EOTA 2RSOA 3CPWA 1K0RA 1QZGA 3SK6A 2IJ0A 3J80E 1E2VA 3NEMA 2EVBA 4A3LG 3KF6A 1WCMG 2IHFA 4DR3L 1QNUA 2BDOA 2NN6H 4C3JB 2B2TA 4DU9A 1YHQA 3DLLA 4NXML 3S14H 4KN7C 4H7BA 4HAEA 3AFPA 4J6HA 4ILWA 1SSOA 1ZKOA 5DM63 1EFWA 1N9WA 4YCUA 3R8BA 3TRZA 5ELFA 4X3SA 2ICEC 2HUGA 4DR2L 5C4JB 4QUFA 4EQNA 3A0JA 2EXZA 1CHPD 1SE8A 2I46A 2WKDA 3DMUA 3SK8A 1BO0A 2VUMG 1W2BA 1YVCA 3GTQB 2XRQD 3QIAA 5E3FA 3PUXA 1BXTA 3K80C 4O0AA 3V96A 3IRBA 4LUOA 1DJRD 4KTAA 1SFOB 5ELDA 2K6AA 1X9NA 3A8KE 4P73A 3TS2A 1EQQA 3GTPH 1X3QA 4HMIA 2K01A 5F2DA 1HTLD 5EPKA 1HQRD 4BS9A 3WOFA 2L9HA 3QB3A 3CCJA 4CKBA 4FO2A 1AEXA 5FO7B 2Q2TA 2PO4A 3TP6A 1JOQA 1TIID 4KKSA 2LSSA 3HOYH 1MJCA 1VQ7A 2JA6G 2YTVA 3CCQA 1D8LA 3BDOA 1LYLA 2BA0A 1ICWA 4A3DB 4S3SA 2F0OA 3ULLA 4R4OA 3LWUA 4RKBA 3DHQA 3M4QA 2ZXOA 1X32A 3Q23A 1I5FA 1PLFA 1CI3M 4QB4A 1KRTA 1G8ZD 1FVIA 3TN2A 1GVPA 5BR8Q 1N34Q 3I56A 2X6GA 3AU7A 2L1BA 3I7FA 4DR5L 5IIFA 4DR2Q 4A3FG 1PTOC 1X65A 4IUTA 4NMZA 2Z4IA 1U9RA 1BCPD 2UUBQ 2XIWA 2NVQB 4DV2Q 1JC7A 3BVMA 1EZ8A 5C3XA 1EQVA 1I6VC 3D3RA 4TSSA 4RCNA 1Q86C 1N8RC 1GKHA 1XNRQ 4A93B 3KUPA 3KBGA 1CT1D 3URYA 5DLQE 3I55A 4PMWA 2J0TD 1EYDA 2B2UA 3HKZB 1AFPA 4BY7G 4UAIA 3GTMH 2WFWA 1WTVA 1B3AA 1SJHD 3S1QH 4DA2A 1J5EQ 2K04A 2KEDA 2F0IA 4F88A 4HMJA 2K33A 5LL6X 3R93A 3QWNA 2KOLA 3FDTA 2HDLA 1XNQL 1BKBA 2EYLA 3S2DB 5M3MH 1STBA 3NTHA 1EWCA 1HNZQ 2BE5D 3OHXC 3K59A 2RF4A 1UEAB 2MQHA 4GKJQ 2FFKB 4RGOS 5EKKA 2NB0A 2HQEA 3RN5A 1Q90A 2GN5A 4HJ7A 2E2IH 4DR7Q 3KK7A 1SYBA 3V2TA 4DV3Q 1GHJA 3HOXB 1UE6A 3P75A 1S5FD 2WIIB 2VW9A 1VQHA 1PFNA 3VA7A 1F77A 2HQLA 1CQFA 1XPRA 4BXXH 3TZDA 2AQ3B 1TWHH 1I4RA 2JJQA 2RKSA 3ERQA 4ZQ3A 2Z6KC 4KLKA 3CXCA 4DGZA 1YHBA 5LMNW 2ZTEA 3NBHA 4GNXB 1BUVT 5IY0A 3IFDA 1PFBA 2OF1A 3MEFA 3RLFA 5E4XA 3GTJB 1VQAA 1WTQA 4C2MH 4UP8A 3MXGA 1EYCA 4IUUA 2ZXRA 4EX5A 4IFDI 1K9MC 1TWAH 1UE5A 2A68D 3EROA 1I50H 4RMFA 1NJIC 4IALA 4LFBQ 3D31A 5LMNL 1IKMA 4LUVA 1PH6A 4A3LH 1LTID 4FYDA 1SYCA 1KD1C 5IYDH 1HFGA 2E2JH 3NBHB 4DR6Q 1LTSD 4OWTB 1C9OA 4OL7A 2E2HH 1PVOA 4JI0Q 5HGQA 1SROA 2JA8H 5JJKA 1CKMA 3D4RA 5IYCH 3A5ZB 3S1NB 4PG3A 4GOPC 1RKNA 1WTRA 1EYGA 3CRLC 1X54A 5ELEA 1ASYA 1O78A 4A75A 4A3JH 1KQSA 2EYFA 1EIGA 3X3MA 5DAUA 1EL0A 4AYBG 1EYAA 5CV8A 2ID0A 4MIUA 2EY6A 1VF5C 2RBMA 1X56A 1B9MA 2JSOA 3LWEA 2QKIC 4WRDA 1E24A 2H4OA 1Y8PB 4K0KL 1C4QA 4P71A 5A35A 4A3IG 1GUGA 1SLJA 1ILQA 3G7LA 4A3GB 3E9HA 3I90A 5AFWA 3FPUB 3EIVA 5ELCA 2LY7A 5FO8B 2RQXA 1MBYA 1TS5A 3CD6A 2CVRA 3VR3A 1RF2D 1V1PA 1IYVA 4K6LA 1E1OA 2HT1A 2IL8A 1XXGA 4HR7B 2AQ2B 2H1EA 4GN5A 1R9TH 3SEBA 1V8QA 1WD1A 3I4MB 1QVFA 1PYSB 4LW1A 2ZJRA 3NQTA 1YBYA 1SNMA 3NK9A 2B63B 5IT9L 3SXHA 1LT6D 1QVGA 2X6LA 4L8JA 4GNXC 3SHLA 2M00A 4XQJA 5IYBH 2MFIA 4L5TA 3HOXH 1B9NA 3GO5A 1EY6A 1UEBA 4BBRG 2Q8TA 4IFDJ 1TWFB 4CJ0B 4AQYQ 1IBKL 1Q82C 4DAVA 2KA7A 1ENFA 1A3TA 2E5LL 1AE3A 2F52A 2OXPA 3A8JE 4A3EB 1S5ED 4BY7H 2B8FA 1VQNA 1NBWA 2Q2IA 5C3EB 1JWUD 3S2DH 3T16A 1KAAA 3CQZH 1Z6HA 1SYDA 2MP1A 5EQ0A 1KHIA 1BF4A 3S17B 1FJGL 2A19A 3HOYB 4LF5Q 5IYDG 5ELNA 1XPOA 5HURA 2BOSA 2AUKA 1QUQB 1I6HH 4JI2Q 3RUZA 1FGBD 3HGBA 3SGIA 1HTPA 3PUWA 5ISRA 4R9WA 4A3KH 5CORA 1SR3A 4GKKQ 1HA5A 3C3LA 1F2MA 1TXYA 4JV5Q 3AFQA 2Z0SA 2NVQH 1I4HA 1GO3E 1PXUA 3I2ZA 4P72A 1SXTA 2EOTA 4MNOA 4R1JA 2Y0SG 2YTXA 1BVSA 2Q8RE 1MKHA 2QEXA 3HRZC 1HH2P 3KLRA 5JEAH 1NTGA 3U50C 4LNQA 1OXSC 2JYOA 4G4KA 3EQLC 4H44C 2PQAA 3RN2A 1KTKA 4XXEA 4R8IA 4PZ7A 2E5LQ 2MUYA 1WCMB 1PFSA 5M3FG 4LF8Q 2UXBL 1AZQA 1Q46A 3H0GH 1A3UA 5C5MA 3M4PA 4JI7L 1L0YB 2EPBA 2I5MX 4ZKBB 1SNQA 2F0SA 4QUCA 3NE5B 1D1KA 2KHIA 2ZXPA 5DM73 2KCMA 1F9SA 4U68A 4A3MG 3NWTA 5IGFA 2RA4A 1IYJB 2A68C 1BBUA 1K3RA 3STBC 1I3QB 2VUMH 4WJWA 1ZYRD 1CK1A 3J81i 2HCCA 1BCPC 4OIJA 2IX3A 2DN8A 5A2QE 2OEOA 5IGBA 3HOYG 4ZYSA 3NENA 1Q81C 3VYUA 3I4NH 4BY1G 1QWYA 3UDIA 2JA8G 2VQEQ 1O7IA 4DKAC 4OONA 4L6TB 4B3RQ 3F2CA 3RLNA 3I4LA 5C4JH 3NWSA 4CKEA 2SNSA 1JCKB 3M4YA 2B2WC 1EIHA 4JI1Q 1W6KA 5D3DA 3ULPA 4JOIC 1EY9A 2F03A 1R4QB 2HHHQ 1LT5D 1STYA 3UDFA 4C3JH 1N32L 2ICIA 4BBRB 5KGUA 3Q6SA 4IQZA 1E0BA 3I73A 2DY8A 3QOLA 4PMBA 1A0IA 4TQUS 2WB1E 3QO2A 3GTLB 1U5KA 1VF7A 4LF7Q 4DNTB 1RD9D 2O5IC 1WCMH 5K36G 1PZID 1LT4D 3U9OA 4A3MH 2B2VC 4F7XA 3F8TA 3T13A 3WWVA 4RHSA 5G3LD 5C3WA 1I4PA 2EXDA 1X6OA 2NVYB 1OTCA 1BR9A 5CV9A 1TS3A 2VZAA 1KDCA 3CCSA 4A3MB 4O1NA 4DR4L 1XMQQ 2I07B 3S9WA 4IPCA 2K32A 3OW7A 2OTLA 4X3UA 2J7ZA 5CYUA 2RHSB 5J1ZA 2I0QA 5FJ8H 4R4QA 3T1YQ 2J4XA 3ZJYC 1PZJD 3HOZB 3M7NA 1LTBD 2QDBA 4BBRH 5LL6S 4Y7NH 2EJGC 2WAQB 2B2YA 2F1MA 5C44B 2UUCL 3P7JA 3LNNA 3PUVA 2F0NA 1I4GA 1LTLA 5M3MG 2JA6H 2JP1A 3CRKC 2B2TC 4RA8A 1G6PA 5HGTA 3FMCA 3OTOL 3G6JB 4KN4C 4JI8L 3P20A 3HOUB 1G6ZA 3R3OA 3QOJA 4IOCA 2PW5A 3A74A 2MHVA 1GUWA 1A2TA 4IJHA 2MNAA 4A3EH 1IL8A 1TWGH 3OSOA 3A5UA 1GUNA 3SE0A 1NAPA 2O5JC 3S1RH 1FGUA 5ELBA 5NUCA 4CGYB 2D5DA 2MJ8A 4WJ4A 4I7ZC 2NZOA 1L2FA 1TKWB 1I3QH 3CCMA 1LTGD 4AYBE 5IT9c 1BQQT 4IPGA 1MIUA 3TDQA 4IPDA 3PO3G 1Y8NB 1VQMA 2JE6I 1NCVA 1YI2A 3BZCA 2UXDL 4K5VA 2FMCA 2R92B 3SDZA 4DV4L 5ELOA 2EQSA 4XDXA 4LFBL 5G3LF 3T1YL 2XTIA 3PO3B 4QCLA 2JXMB 2NBFA 3I70A 3S16H 3W3AA 1HNWQ 3MXUA 2UUCQ 4YWLA 2F4VL 2CWPA 1SNOA 2TSSA 3J7AF 1SRUA 2V1CC 3EFXD 2OQ0A 3RZOB 3F2UA 4L63B 2EYJA 4XT3B 2K5HA 4X64L 4IO9A 2IT1A 5I6YA 3AB9A 2ZTDA 4CHTB 1JR0D 5IP9H 3BG3A 1GJXA 1UWVA 1Q7YC 1VQ6A 2WB1G 1PTOD 1GXDC 2K50A 3ITPA 3FKIH 1KDBA 2HIXA 2KHJA 2MO1A 2PQEA 4DV7Q 2VY3A 4NW2A 3A55A 4IPHA 5FOBB 1VQ8A 4V190 4EQOA 3PV0A 4H0LC 1XNQQ 2AMCB 1HQMC 1STHA 3MEHA 3HOVH 4YIJA 1YNJC 1VQPA 1QZHA 2YU9H 4B3TQ 3Q8DA 4BY7B 1E7ZA 1K83H 3I4OA 1O7YA 4IURA 4CBVA 4RWSC 2EYMA 3PIP3 4TKOB 1SNDA 1FNWA 1HNXL 1VMCA 2JA5B 5C6AA 2NWGA 3PGZA 5JJLA 1RTNA 4DK6C 4G7ZC 4B08A 1SMYD 4RFBA 5GADC 5EPLA 2MO0A 1QILA 2WB1B 1ZEQX 3CC2A 4RH6A 3H6MA 1ESRA 1V1PB 1SDFA 4AYBB 1ESFA 4QMGA 4JI8Q 1N34L 3IFTA 1NMFA 4RGNA 4KY5A 1QOHA 4OGQC 1VS0A 1WFQA 2B63H 2SDFA 1R9TB 2JEAI 2OTJA 1A63A 2A8VA 4QQBX 3DWAA 4HSVA 4POGA 3ND8A 5I6WA 5JVG3 3CF5A 1QG7A 1HRJA 3MZ5A 3M4OB 2BCOA 5IODA 1YEZA 5IP7G 3OW2A 3PF5A 3JAMi 1M4VA 1RDPD 4UP9A 1CZGA 3JC66 2AHOB 5J22A 1HR0L 1U4RA 3JAML 3S1RB 2UUAL 1CA6A 1HUMA 1KXLA 1JOKA 2JQOA 2VQEL 1TQOA 1X3FA 1EU3A 3UE1A 4DR6L 2D2CC 1KABA 4IUNA 4WORA 1AZPA 3BZKA 5K36H 2NTSA 5KNDA 4DR3Q 1TU2B 2F0JA 3R2TA 2K1BA 1WD0A 3TP7A 3CW2C 3EJIA 5EGTA 3BDCA 2EYOA 3DM3A 3UDXA 2E2HB 4GLVB 1VQEA 5LMUL 1ET6A 3I91A 2L11A 1VCIA 4JI5Q 4PZ8A 1NR2A 1HFNA 5JPNC 5C4HA 4ME3A 1SYEA 2JA7B 1YNND 4A3CH 3NSWA 1DD2A 4DFAA 4OWXB 1WJJA 3CHBD 1G91A 3H3VC 3DWQA 3S2HB 3J7YW 3F2BA 2R7ZB 3STBD 4JI6L 4DV6Q 3L2PA 4AH6A 1M90C 3C1EA 4C3IH 1DM0B 3VR5A 1G2TA 3HOVG 4HIOA 4JYAL 1O80A 2N8NA 3NBIA 1D5XC 2RHQB 3PSIA 3T4AC 2L15A 4IFDG 2F0MA 3PUYA 1D1IA 2PYKA 4ME5A 3UI2A 2JA7G 2DNEA 1KNEA 1CTMA 1SE3A 1FYCA 3QG1A 2PI2E 1T5XD 4UDUC 1STGA 2NZHA 4POFA 2KVMA 2R93G 5C3EG 1YJWA 5IGDA 3H09A 1CSPA 5M3FH 2I5LX 4Y52H 3GV3A 4JI0L 4LFCL 2LFNA 2NYZD 1Y1VG 1SFOH 4JI5L 1PH9A 2F0TA 2WINB 2ZJPA 1JORA 3GTQH 2VXWA 5JEAG 1J9OA 5KEEA 5COYA 2CWAA 3T1HQ 5JJIA 2EY2A 3I4NB 1PH4A 2RDHA 3J81c 5M3MB 3S15H 4G7HC 5EPJA 1LLRD 1ZYRC 3I72A 5I9PA 3S1MB 1ENAA 1I94Q 4APVA 4OHJA 3TSSA 4X66L 4A3KG 3CPFA 1D5MC 3K6OA 2UXCQ 2B3GA 5E7NA 1EIFA 2QGQA 3OWEB 3D0FA 5JVH3 2KBNA 1RTOA 2A73B 4DAPA 5IT9E 1N33L 5IOCA 5FJ8G 1T9HA 1LACA 1ASZA 1LABA 3RR5A 2FHTA 3OMCA 1HHVA 1PTOB 4XIGS 3OWFA 2K14A 1HNZL 1WOCA 4OO1H 5CV6A 4JI4L 3CAMA 4GN4B 3ERSX 4GKJL 3E5SA 2ZM6Q 4JC0A 4B9WA 4C3IB 4NXNL 1CFMA 3TS0A 5C4XH 4UP7A 4LF9Q 2IX0A 3DM1A 3D8GA 3K5OA 4HIDA 5EBCA 3K7UC 3I3CA 3NP8A 2F3WA 1UE7A 1VQ9A 1IKLA 1PMRA 2KENA 1VDZA 4BBSG 1A15A 3G4SA 5A2QL 2C9OA 2M2LA 1PTOH 4A3KB 4KJNA 1EWHA 2HIVA 4DV1Q 2L0CA 3TQYA 1MJEA 1S4ZA 4A3FB 4BY1B 2E74C 4K5WA 1I94L 2XWJB 1PRTC 1XMOQ 4DXFA 2E75C 3NUCA 4C3JG 3E0EA 3TEHB 1HZAA 4X66Q 3K81C 3PO2H 3GDEA 1TR5A 2R93B 4K8IA 4C3IG 4C1NI 4FXDA 3S17H 3GTPB 3H94A 4HJ5A 1DCZA 4JI6Q 1MD2D 4PNYA 3KLSX 4A3DG 3HZXA 3I8ZA 5C3EH 1Y8OB 3HKZG 4ZRZA 4LF5L 1WYDA 2XVSA 3L0OA 1H9MA 5IWAQ 4B3ML 4QIWE 2QF7A 4RGMA 1E3PA 1VQGA 1PV4A 5GAEC 5KNCA 1S5BD 2GVAA 1Q8IA 4XYOA 3BJUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M7N A;  1LYL A;  4BBR H;  4Y7N H;  2BA0 A;  4JV5 L;  1L0W A;  3ULJ A;  2UUC L;  3ULL A;  2ASB A;  5IYB G;  3S2H H;  2OWO A;  3PUV A;  4R4O A;  1FL0 A;  3M4Q A;  1LTL A;  1YZ6 A;  5M3M G;  4LFA Q;  1I5F A;  2JA6 H;  2HHH L;  3FP9 A;  4P75 A;  1N32 Q;  1KRT A;  4JOI A;  2JA7 H;  1G6P A;  1FVI A;  1PH1 A;  3OYY A;  1OXT A;  1VQB A;  3ER0 A;  1GVP A;  3OTO L;  4JI8 L;  5BR8 Q;  4DUY Q;  4TVA B;  1N34 Q;  3I4M G;  3I56 A;  2F3I A;  4O2D A;  4IOC A;  3I7F A;  3A74 A;  3H0G G;  4DV1 L;  4DR5 L;  4DV5 L;  4DR2 Q;  4A3F G;  1X65 A;  1GM5 A;  3G48 A;  1XJV A;  4IJH A;  2MNA A;  4A3E H;  1JMC A;  4LF7 L;  2UUB Q;  1TWG H;  2K75 A;  3A5U A;  4DV2 Q;  1XMO L;  1Y14 B;  4OXP A;  1DGS A;  4R4I A;  2LXJ A;  4DV0 Q;  4HJ9 A;  4OX9 L;  5M5W H;  3S1R H;  1FGU A;  3KF6 B;  4B3R Q;  1L1O B;  4L5Q A;  1Q86 C;  3JAM c;  1N8R C;  4JI7 Q;  2H5X A;  3G71 A;  1GKH A;  1VQL A;  1XNR Q;  4WJ4 A;  3M85 A;  2NZO A;  1L2F A;  5GQO A;  1EIY B;  1I3Q H;  5DLQ E;  3KJP A;  3CCM A;  3HOW G;  2R7Z H;  4YCV A;  4PMW A;  4AYB E;  3I55 A;  1YIJ A;  1C7Y A;  4A3G H;  1S3O A;  5FLX c;  5IT9 c;  1K8A C;  4IPG A;  1MIU A;  3M9B A;  1XTD A;  2PNH A;  4IPD A;  4BY7 G;  3PO3 G;  3GTM H;  4R4C A;  2WFW A;  1XMQ L;  1VQM A;  3S1Q H;  1J5E Q;  2JE6 I;  4KI0 A;  4ALP A;  2R6G A;  1YI2 A;  2R92 G;  1EOV A;  1VQ4 A;  3BZC A;  2UXD L;  2DGY A;  4DV4 L;  1VQF A;  3KLW A;  5ELO A;  2EQS A;  4X62 Q;  1XNQ L;  1BKB A;  4IOA A;  4LFB L;  5M3M H;  3T1Y L;  2XTI A;  1IBM L;  3CC4 A;  1VQD A;  2JEB I;  1Y1W H;  5LMN Q;  2EIF A;  1HNZ Q;  2CCZ A;  2ATW A;  2AKW B;  1JJG A;  3S16 H;  3CCL A;  4LF4 L;  1XPU A;  2RF4 A;  4YY3 Q;  2KCT A;  1HNW Q;  1YJ9 A;  2MQH A;  3FKI G;  4GKJ Q;  1D7Q A;  2UUC Q;  4YWL A;  2F4V L;  2CWP A;  1IBL L;  1VQK A;  2ZJQ A;  3GD7 A;  3RN5 A;  4JI3 Q;  4LFA L;  1SRU A;  2V1C C;  4FDB A;  2GN5 A;  2OQ0 A;  4HJ7 A;  2E2I H;  4DR7 Q;  2BA1 A;  1X55 A;  2AWN A;  4DV3 Q;  1N36 L;  2K5H A;  2CFM A;  4X64 L;  2NVT H;  2OCE A;  1HZB A;  1UE6 A;  4JG2 A;  4IO9 A;  2IT1 A;  1HR0 W;  2ZTD A;  2VW9 A;  1VQH A;  2VL6 A;  2UUB L;  1V1Q A;  4DV2 L;  2Z6K A;  5IP9 H;  4HIM A;  4NB3 A;  2HQL A;  5GAH C;  3UE0 A;  1XPR A;  3U58 A;  2Q2U A;  4BXX H;  4NXN Q;  1TWH H;  1UWV A;  5H1S E;  1Q7Y C;  1VQ6 A;  2JJQ A;  1C0A A;  2WB1 G;  2Z6K C;  4KLK A;  3PO2 G;  2K50 A;  3CXC A;  1XNR L;  3FKI H;  1YHB A;  5LMN W;  2ZTE A;  4HIK A;  3CCU A;  2WAQ G;  4YCW A;  4GNX B;  2HIX A;  1GD7 A;  4AIM A;  5IY0 A;  3RZO H;  2KHJ A;  2MO1 A;  3HOX G;  4GN3 B;  1VQO A;  1YHA A;  3MEF A;  3RLF A;  2JA5 H;  4K0K Q;  4DV7 Q;  1CSQ A;  4DPG A;  1VQA A;  2VY3 A;  4HJA A;  1CKN A;  4C2M H;  4UP8 A;  2B29 A;  4IPH A;  4X65 Q;  3GTJ H;  1VQ8 A;  1K8G A;  2VQF L;  4EX5 A;  4JBK A;  4A3G G;  4IFD I;  1K9M C;  1TWA H;  1UE5 A;  3PV0 A;  2QA4 A;  2UXD Q;  3EBE A;  2BH8 A;  1I50 H;  4RMF A;  4JI2 L;  1NJI C;  3J80 i;  4C3H H;  4X62 L;  1XNQ Q;  2AMC B;  3M4O H;  3PO3 H;  4LFB Q;  3HOV H;  1Q12 A;  1AH9 A;  3AYH B;  4DNI A;  1VQP A;  1QZH A;  2YU9 H;  3D31 A;  3Q8D A;  4B3T Q;  1E7Z A;  1K83 H;  3I4O A;  4A3B G;  5LMN L;  1YIT A;  2BH2 A;  4BXX G;  3J80 c;  2JK8 A;  1Y1V H;  4LUV A;  1PH6 A;  4A3L H;  4GKK L;  5C4X G;  2LXK A;  3GTO H;  3M3Y H;  2IY5 B;  1KD1 C;  5IYD H;  3KDF B;  3L7Z C;  1X3G A;  2F4V Q;  4PZ6 A;  2E2J H;  1L1O C;  3NBH B;  4DR6 Q;  1W3S A;  4GNX A;  1IBL Q;  4JI3 L;  1Q1E A;  3KFU A;  2D0P A;  4OWT B;  1HNX L;  1C9O A;  2CQO A;  3PGZ A;  4LF6 L;  5JJL A;  1EWI A;  4DK6 C;  4DUZ L;  4QY7 A;  2E2H H;  5HGQ A;  3KJO A;  4JI0 Q;  1KL9 A;  1SRO A;  1V43 A;  2Y0S E;  4LFC Q;  1CKM A;  2JA8 H;  5JJK A;  4HJ8 A;  5IYC H;  3A5Z B;  4DR1 Q;  4PG3 A;  5GAD C;  3K0X A;  5JEA J;  4GOP C;  1SMX A;  4RG1 A;  1EYG A;  1X54 A;  4DAM A;  2MO0 A;  1ASY A;  4A75 A;  4A3J H;  1KQS A;  3CC2 A;  1CKO A;  5HY6 A;  1B8A A;  2OQK A;  3CCR A;  4GOP A;  4AYB G;  3OTO Q;  4JI8 Q;  5BR8 L;  4DUY L;  1N34 L;  3H15 A;  2ID0 A;  1NMF A;  3F1Z A;  2B63 G;  3GTG H;  4DR5 Q;  1VS0 A;  5AJ3 L;  3K8A A;  4GLX A;  4DV5 Q;  1WFQ A;  2B63 H;  3KDF A;  2ZTC A;  1QUQ A;  1X56 A;  3HOU H;  1V9P A;  1A62 A;  2JEA I;  2OTJ A;  1A63 A;  1RIP A;  5EAY A;  2A8V A;  4QQB X;  1E24 A;  4POG A;  1RL2 A;  4DV0 L;  4K0K L;  4KHP Q;  3CF5 A;  3J81 j;  4P71 A;  4YWK A;  2UXC L;  3S1N H;  4H02 A;  4A3I G;  2JA9 A;  1SLJ A;  1JE5 A;  1KRS A;  1YEZ A;  3J7Z C;  4B3S L;  5IP7 G;  1PHJ A;  2D0O A;  4A3D H;  3E9H A;  3LGJ A;  3OW2 A;  3PF5 A;  4DV6 L;  1E22 A;  3EIV A;  3JAM i;  1PH2 A;  4A3C G;  1K73 C;  4UP9 A;  3JC6 6;  4A93 H;  1N33 Q;  2AHO B;  1HR0 L;  3CD6 A;  1Q1B A;  1E1O A;  2HT1 A;  3VDY A;  2UUA L;  4JYA Q;  1KXL A;  4GN5 A;  2JQO A;  2VQE L;  1R9T H;  2R7F A;  4JI4 Q;  1X3F A;  4DV4 Q;  3G6E A;  1B7Y B;  4B3R L;  1QVF A;  1PYS B;  4LW1 A;  5J3B A;  2ZJR A;  1YBY A;  2UU9 Q;  4OWW B;  3UE1 A;  1H95 A;  4IJL A;  4A3B H;  4DR6 L;  4JCV E;  4OO1 I;  1HNX Q;  2NVX H;  3U4Z A;  4LUZ A;  4MTN A;  1QVG A;  3BZK A;  3H3V H;  2I5H A;  1P8L A;  2YTY A;  2PI2 A;  4UPA A;  5IP7 H;  3GTK H;  4LF9 L;  4GNX C;  1Z9F A;  4LF4 Q;  4DR3 Q;  4YY3 L;  4A3I H;  1HNW L;  2IX1 A;  1Z47 A;  4GS3 A;  4DR1 L;  1JB7 A;  3KYH C;  3NEL A;  1X3E A;  1JJC B;  1TWC H;  1VQJ A;  3CW2 C;  5IYB H;  2MFI A;  1U0L A;  4L5T A;  1IL2 A;  3HOX H;  3J7A 5;  5C0X I;  1PH7 A;  4BA2 I;  2WAQ E;  3RZD H;  3GO5 A;  4YHH Q;  2JA5 G;  3DM3 A;  3S24 A;  1E1T A;  3UDX A;  4DAY B;  3PF4 A;  1UEB A;  4GLV B;  5GRO A;  4BBR G;  1VQE A;  4DV3 L;  1YJN A;  1Y1W G;  4IFD J;  4BA1 I;  3E9I A;  1PVO A;  5LMU L;  4AQY Q;  1IBK L;  3GTL H;  1Q82 C;  2C35 B;  1VCI A;  4QJF A;  2NN6 G;  4JI5 Q;  4PZ8 A;  5IYC G;  2E5L L;  2R92 H;  1PH8 A;  5IP9 G;  1VQI A;  3HOZ G;  1AE3 A;  2NN6 I;  4ME3 A;  1P16 A;  2F52 A;  4A3C H;  4LF8 L;  2UXB Q;  1CUK A;  1EUJ A;  1WJJ A;  4OWX B;  3T1H L;  1IZ6 A;  4A3E G;  4BY7 H;  4KHP L;  1VQN A;  1NBW A;  1G51 A;  2Q2I A;  3W1B A;  3HFZ B;  3F2B A;  2R7Z G;  3S2D H;  3STB D;  3H3V I;  4JI6 L;  3CQZ H;  4DV6 Q;  3W1G A;  2AWO A;  3L2P A;  3HOZ H;  4AH6 A;  1KHI A;  1M90 C;  1FJG L;  2FXQ A;  3HOU G;  4C3I H;  4GOP B;  1HR0 Q;  4QL5 A;  2A19 A;  1OXX K;  4LF5 Q;  1OXV A;  4X65 L;  5IYD G;  3HOV G;  3U4V A;  5ELN A;  3BU2 A;  2VQF Q;  2ALY B;  3KOJ A;  1XPO A;  4HIO A;  2UUA Q;  4JYA L;  5IWA L;  4B3M Q;  2N78 A;  2N8N A;  3B6Y A;  3RNU A;  1QUQ B;  3ICE A;  1I6H H;  2RHQ B;  4JI2 Q;  2DUD A;  3PSI A;  1VQC A;  2L15 A;  1OXU A;  1KC8 C;  4IFD G;  4A3J G;  1YNX A;  3SGI A;  3PUY A;  4L5S A;  3PUW A;  4A3K H;  2NVY H;  1SR3 A;  2Q2H A;  1PH5 A;  1PYB A;  3K7A H;  2JA7 G;  1S40 A;  4GKK Q;  1JT8 A;  1IXR A;  1EQR A;  1TXY A;  4JV5 Q;  1Q8K A;  4DK3 C;  2PMZ E;  2Z0S A;  3AFQ A;  2CKZ B;  1KIX A;  2NVQ H;  1GO3 E;  3HOW H;  3F2D A;  3CCV A;  2PI2 E;  3I2Z A;  4P72 A;  3AQQ A;  2K5V A;  4KHZ A;  1KAW A;  2NZH A;  5C0X G;  2ZM6 L;  4POF A;  2R93 G;  4MNO A;  5C3E G;  4R1J A;  5C44 H;  2Y0S G;  2YTX A;  1BVS A;  4XTC S;  1CSP A;  1MKH A;  2QEX A;  1YJW A;  4LF6 Q;  1HH2 P;  2I5L X;  4YHH L;  1NTG A;  1B70 B;  3TRE A;  3U50 C;  4JI1 L;  5IE8 A;  5M3F H;  4LFC L;  4DUZ Q;  4JI0 L;  1HZC A;  4UY8 C;  4BBS H;  4LNQ A;  3CME A;  1OXS C;  1Y1V G;  1BBW A;  1SFO H;  1JJ2 A;  1UE1 A;  4NXM Q;  2R93 H;  2PQA A;  3RN2 A;  4L5R C;  4JI5 L;  2N49 A;  1PH9 A;  4PZ7 A;  2E5L Q;  2ZJP A;  3GTQ H;  1WI5 A;  1PA6 A;  1CKN B;  1PFS A;  1SN8 A;  4JBW A;  5JEA G;  5M3F G;  3I4N G;  2CWA A;  4LF8 Q;  2UXB L;  1Q46 A;  1VQ5 A;  3T1H Q;  4OX9 Q;  3RLO A;  4A3F H;  1LM0 A;  1PH4 A;  5JJI A;  1A8V A;  3H0G H;  3J81 c;  3S15 H;  3M4P A;  4JI7 L;  5AJ3 Q;  3KF8 B;  2I5M X;  2GVB A;  1I94 Q;  4OO1 G;  4APV A;  4A76 A;  3HKS A;  2KHI A;  1W2B A;  2KCM A;  3UDG A;  4X66 L;  3AEV A;  4A3K G;  3MXN B;  4X6A H;  4EQ5 A;  2IHE A;  2YV5 A;  3EN2 A;  4A3M G;  3CPF A;  1G29 1;  2UXC Q;  2B3G A;  2XGT A;  3HKZ E;  3FHW A;  5E7N A;  1J5E L;  1EIF A;  1IYJ B;  2VNU D;  1BBU A;  1K3R A;  3STB C;  4B3S Q;  2VUM H;  2QGQ A;  3D0F A;  5C0X J;  2K4K A;  2KBN A;  3J81 i;  3CP0 A;  1N33 L;  2D62 A;  5FJ8 G;  1T9H A;  1ASZ A;  3RR5 A;  3HOY G;  1PH3 A;  3NEN A;  3W5O A;  4XIG S;  1Q81 C;  1NMG A;  2K14 A;  2WP8 J;  5GAG C;  3PUZ A;  1HNZ L;  3PIO A;  3I4N H;  1WOC A;  4BY1 G;  3UDI A;  1HJP A;  2VQE Q;  1O7I A;  4DKA C;  4OON A;  2JA8 G;  4JI4 L;  3CAM A;  1NY4 A;  4GN4 B;  2E8G A;  3ERS X;  3F2C A;  3RLN A;  2K5N A;  2UU9 L;  4BY1 H;  4JBM A;  4GKJ L;  4MZ9 A;  3CC7 A;  4J15 A;  5C4J H;  3CMA A;  2ZM6 Q;  4JC0 A;  3CPW A;  1K0R A;  4NPS A;  1QZG A;  5FLM H;  4NXN L;  4YWM A;  3TS0 A;  4DR7 L;  5C4X H;  4QGU A;  3NEM A;  4UP7 A;  4JI1 Q;  4LF9 Q;  4A3L G;  3KF6 A;  1WCM G;  1L1O A;  1S72 A;  2IHF A;  2IX0 A;  4DR3 L;  5FLM G;  4X64 Q;  3ULP A;  1N36 Q;  3S1M H;  2R7D A;  4HID A;  3K7U C;  4JOI C;  2N3S A;  5C44 G;  1UE7 A;  1YHQ A;  1VQ9 A;  3DLL A;  4NXM L;  3S14 H;  2HHH Q;  2KEN A;  3AFP A;  4BBS G;  2A1A A;  4LWC A;  3UDF A;  4C3J H;  1N32 L;  3G4S A;  2ES2 A;  5M5Y H;  1NE3 A;  1EFW A;  1N9W A;  4YCU A;  3TRZ A;  4JBJ A;  5LMU Q;  4AQY L;  1IBK Q;  2HIV A;  1A0I A;  4TQU S;  2WB1 E;  3CCE A;  4DV1 Q;  4DR2 L;  3TQY A;  1MJE A;  3A0J A;  4WJ3 M;  4GLA C;  1SE8 A;  1U5K A;  1TWF H;  4LF7 Q;  1I94 L;  2VUM G;  1XMO Q;  4DR4 Q;  1LUZ A;  1HZ9 A;  1YVC A;  3E0E A;  1WCM H;  3TEH B;  1HZA A;  1QVC A;  1AE2 A;  3PUX A;  3K81 C;  4X66 Q;  5K36 G;  3PO2 H;  3GDE A;  3K80 C;  4O0A A;  4DV7 L;  4A3M H;  3IRB A;  4LUO A;  3F8T A;  1J6Q A;  3PIP A;  1X9N A;  3S17 H;  4P73 A;  2RCN A;  3WWV A;  2YYZ A;  4A93 G;  2PQA B;  3TS2 A;  1EQQ A;  4HJ5 A;  4Y52 H;  4JI6 Q;  2EXD A;  1X6O A;  2K52 A;  4P74 A;  5M5X H;  1OTC A;  4A4I A;  3GTP H;  1FJG Q;  4A3D G;  2VZA A;  5C3E H;  2VS1 A;  3CCS A;  3PCO B;  3HKZ G;  4B3T L;  4LF5 L;  1WYD A;  1XMQ Q;  1M1K C;  4DR4 L;  3CCJ A;  3I4M H;  4IPC A;  3L0O A;  2Q2T A;  5IWA Q;  4B3M L;  4QIW E;  2OTL A;  1E3P A;  1VQG A;  2RHS B;  1PV4 A;  5GAE C;  2I0Q A;  5FJ8 H;  2LSS A;  2GVA A;  3HOY H;  1MJC A;  4R4Q A;  1VQ7 A;  2JA6 G;  3T1Y Q;  1IBM Q;  2YTV A;  3CCQ A;  1D8L A;  3ZJY C;  3BJU A;  4R4T A; 
#chains in the Genus database with same CATH topology
 2NUC A;  2XSC A;  4HTH A;  4JV5 L;  1L0W A;  3ULJ A;  5IYB G;  2OWO A;  1NR4 A;  2V4D A;  2RDF A;  1G2S A;  1UUP A;  1H9K A;  4ID6 A;  4LFA Q;  1F2Z A;  3C1F A;  1N32 Q;  4JOI A;  3OYY A;  5KYL A;  4HCE A;  3J7A V;  3ER0 A;  1DOK A;  1HCZ A;  1B1Z A;  4TVA B;  3I4M G;  3MXP A;  1ONL A;  2F3I A;  4DV1 L;  4DV5 L;  1GM5 A;  2K28 A;  3G48 A;  1LTA D;  1XJV A;  4KK7 A;  2K75 A;  2K5D A;  1STE A;  1U4L A;  1EY4 A;  1DGS A;  5I2Y A;  4DV0 Q;  4FF1 A;  3X3N A;  4HJ9 A;  3KF6 B;  1L1O B;  5KIX A;  4HED A;  4L5Q A;  4V0B A;  3JAM c;  2PPB C;  3VYS A;  4FP5 D;  1SMY C;  5CGK A;  5GQO A;  1EIY B;  4MN3 A;  2B2V A;  3KJP A;  1EY5 A;  2R7Z H;  4YCV A;  4A3G H;  1S3O A;  5FLX c;  3M9B A;  1SAP A;  3SR1 A;  3J81 L;  4A3B B;  4R4C A;  1D5Z C;  1B50 A;  3EVQ A;  4KI0 A;  1WVL A;  2R92 G;  1VQ4 A;  5CC4 A;  2DGY A;  1A2U A;  1VQF A;  3KLW A;  1SE2 A;  1IW7 D;  2RCF A;  2YU9 B;  3CC4 A;  4CDD C;  3K58 A;  2JEB I;  5LMN Q;  2CCZ A;  2ATW A;  1I6H B;  2AKW B;  3V05 A;  4C56 C;  1XPU A;  4YY3 Q;  2KCT A;  3M7G A;  3FKI G;  1D7Q A;  2A6H C;  2A5H A;  4FXG C;  3TP8 A;  1IBL L;  1VQK A;  2ZJQ A;  1FNV A;  1OO9 B;  3GD7 A;  4FDB A;  4DN4 M;  1IYU A;  3CQZ B;  1X55 A;  3J81 E;  2AWN A;  1N36 L;  3FRP B;  1HZB A;  4JG2 A;  2EZV A;  2XRS D;  3VA5 A;  3MC0 B;  4DV2 L;  2Z6K A;  4R8N A;  2EDG A;  2LS0 1;  3Q24 A;  5GAH C;  2Q2U A;  1GUO A;  1T5E A;  2NVX B;  5H1S E;  3PO2 G;  1XNR L;  2N55 A;  2RSN A;  2XWB B;  1LTT D;  2G9D A;  3NPP A;  2WAQ G;  4N9P A;  3RZO H;  3NTI A;  2B39 A;  1YHA A;  4GN3 B;  2RDG A;  1X3P A;  4HJA A;  1CKN A;  1DOM A;  1II3 A;  2B29 A;  5CV7 A;  4C2M B;  1PZK D;  4X65 Q;  3GTJ H;  2A6E C;  3KBX A;  4A3G G;  3S16 B;  2QA4 A;  3EBE A;  2FIN B;  4IN3 A;  4JI2 L;  4C3H H;  5JOB A;  1S5D D;  5FO9 B;  3OPO A;  2Z1C A;  3PO3 H;  4CDE C;  1AH9 A;  1Q12 A;  4DNI A;  2XNA C;  4DR4 Q;  1TWH B;  4C3H B;  1YIT A;  4ZUJ A;  3J80 c;  2JK8 A;  1Y1V H;  2IPK D;  3L9A X;  3VYT A;  4GKK L;  5C4X G;  3GTO H;  3M3Y H;  2IY5 B;  3BYY B;  1SJE D;  2F4V Q;  4PZ6 A;  1L1O C;  4EVO A;  1W3S A;  3ND9 A;  1STA A;  4GNX A;  1IBL Q;  3A7L A;  4XT1 B;  3DUZ A;  4LF6 L;  1EWI A;  1D6E C;  1CM9 A;  4QY7 A;  4LFC Q;  3RZD B;  4HJ8 A;  2L55 A;  3VR6 A;  4DR1 Q;  1R4P B;  4J1M A;  5TSS A;  2F0V A;  3R2I A;  4A3I B;  1ET9 A;  5HY6 A;  2OQK A;  1QB5 D;  1YNN C;  4CJ2 C;  2G9H D;  1TWG B;  3A7A B;  3CCR A;  3OTO Q;  5BR8 L;  4DUY L;  3QR8 A;  1K8M A;  2LMC B;  3EA6 A;  3KDF A;  1QUQ A;  3HOU H;  1A62 A;  5T1I A;  3GTO B;  3M3Y B;  5EAY A;  1IHZ A;  2F0K A;  1RL2 A;  2AUJ D;  4DV0 L;  2QDL A;  3O13 A;  4KJO A;  2BE5 C;  2JA6 B;  3J81 j;  2UXC L;  2K03 A;  4H02 A;  3S1N H;  1FNU A;  5EBD A;  5IGG A;  1PHJ A;  2D0O A;  2JA8 B;  1GUS A;  4DV6 L;  1E22 A;  5JPM C;  4A3C G;  4PQX A;  1K73 C;  1RJT A;  4A93 H;  4DAY A;  1Q1B A;  4FNF A;  4KY6 A;  1H9J A;  3VDY A;  1AW7 A;  4JYA Q;  2NTT A;  2F0L A;  4JI4 Q;  4DV4 Q;  1JJG A;  3W2D A;  2UU9 Q;  1JE4 A;  4OWW B;  3MVV A;  1H95 A;  3NXW A;  4A3B H;  4JCV E;  5KYI A;  5C0X H;  1HNX Q;  2NVX H;  4MTN A;  4LUZ A;  3H3V H;  4C3H G;  2PZW A;  2PI2 A;  1A3V A;  5IP7 H;  4LF9 L;  3TP5 A;  4YY3 L;  1HNW L;  1SYF A;  4TRD A;  2IX1 A;  1Z47 A;  4DR1 L;  1O7L A;  3KYH C;  4PV1 C;  1JIC A;  1H9S A;  2B2Y C;  1U0L A;  1BOS A;  4BA2 I;  4JK1 C;  2JA5 G;  4YHH Q;  4RKL A;  4DAY B;  2Z8L A;  5D3I B;  4DV3 L;  1Y1W G;  1YJN A;  3NHH A;  1O7Z A;  1GUT A;  3FPP A;  5FLX E;  3GTL H;  5CBE E;  2C35 B;  4CJ1 B;  1XX8 A;  5IGC A;  5IYC G;  2AQ1 B;  2R92 H;  1EEF D;  1VQI A;  5IP9 G;  2NN6 I;  3HOZ G;  1P16 A;  1DOL A;  1NSN S;  1Q3L A;  1UAP A;  5EKI A;  1BDO A;  1CUK A;  1EUJ A;  3K5M A;  1IZ6 A;  4A3E G;  3ZYY X;  4JVZ A;  3W1B A;  5T1G A;  2R7Z G;  2Z4H A;  2OT2 A;  2KJX A;  1DON A;  2AWO A;  2KCN A;  2FXQ A;  3HOU G;  5BN4 A;  4GOP B;  3MFG A;  4QL5 A;  5CV5 A;  1OXX K;  2EYH A;  1CA5 A;  2VQF Q;  3KOJ A;  1ZXT A;  2UUA Q;  1DXM A;  4B3M Q;  2N78 A;  3B6Y A;  2K5Q A;  3ICE A;  2DUD A;  1KC8 C;  1YNX A;  5CV4 A;  1L0X B;  4L5S A;  2Q2H A;  1PH5 A;  2L12 A;  1S40 A;  1D2B A;  1Q8K A;  3HOW H;  1B2T A;  2CKZ B;  2B2W A;  1BCP B;  3F2D A;  3CCV A;  3PMF A;  3AQQ A;  2F0P A;  3GTM B;  1KAW A;  3SK5 A;  4DF7 A;  2ZM6 L;  3SK4 A;  1EU4 A;  5C44 H;  4XTC S;  5M5X B;  2Y0S B;  4LF6 Q;  3TRE A;  4JI1 L;  4P2C B;  4BBS H;  1QE6 A;  2DY7 A;  1HZC A;  4K5X A;  1QJO A;  3CME A;  1BCP F;  1BBW A;  3BYT B;  1UE1 A;  4I65 A;  2A69 C;  2EJF C;  4L5R C;  3H0G B;  4CDC C;  1NUC A;  4NDX A;  2K5W A;  3T56 B;  3L3O C;  1CKN B;  1PA6 A;  1VQ5 A;  3RLO A;  2KEE A;  3D6W A;  1GOZ A;  4FF2 A;  2KHS A;  2EE1 A;  5M9O A;  2HDM A;  2GVB A;  4IFD H;  4ULL A;  4OO1 G;  4RHR A;  3HKS A;  4J8Q A;  3UDG A;  2CQA A;  3AEV A;  3MTS A;  2SOB A;  4X6A H;  4EQ5 A;  2IHE A;  2YV5 A;  1MGS A;  2VB3 X;  2XGT A;  2K05 A;  3FHW A;  1J5E L;  3N6R A;  2VNU D;  3DEP A;  4ZKC B;  1TY0 A;  5C0X J;  2K4K A;  2PZU A;  3CP0 A;  1YNJ D;  5CR3 A;  4G7O C;  5EKL A;  5K5P A;  2D62 A;  4K2L A;  2F4I A;  1CZW A;  3W5O A;  1NMG A;  2WP8 J;  5GAG C;  3PUZ A;  4OIK A;  1Y69 U;  4HSP A;  1DYQ A;  2F0D A;  1NY4 A;  4JBM A;  2E8G A;  2UU9 L;  4BY1 H;  4MZ9 A;  3CC7 A;  4J15 A;  1A6X A;  1EFI D;  4NPS A;  2PCF B;  5FLM H;  2L4N A;  3J80 L;  1CHQ D;  4YWM A;  3JAM E;  4DR7 L;  4QGU A;  2F0H A;  1L1O A;  1S72 A;  3S1M H;  1N36 Q;  5FLM G;  1SBB B;  4X64 Q;  3E6Z X;  2R7D A;  5C44 G;  2N3S A;  3AMU A;  2FMM A;  3S15 B;  4GZY C;  3CU7 A;  1IW7 C;  1TT2 A;  2A1A A;  4LWC A;  1WTW A;  2ES2 A;  5M5Y H;  1NE3 A;  2RVL A;  3DWP A;  3K7A B;  4QIW B;  4RCO A;  2EY5 A;  3RMH A;  4JBJ A;  5LMU Q;  3Q22 A;  4DXG A;  4AQY L;  1IBK Q;  3C2P A;  2A69 D;  3CCE A;  1E2W A;  4PMC A;  1FD7 D;  3HG9 A;  4DK1 A;  4WJ3 M;  4H13 C;  4GLA C;  1TWF H;  3T51 B;  1HZ9 A;  1LUZ A;  2IWH A;  4U67 3;  3H3V I;  1QVC A;  1AE2 A;  4XQQ A;  3HS0 C;  3BVG A;  4EQP A;  3U9S A;  2LKV A;  4DV7 L;  3S14 B;  5BN5 A;  1LTR D;  1HXY D;  3VR4 A;  5E1F A;  4ABN A;  1J6Q A;  3PIP A;  3HEJ A;  2RCN A;  3IAY A;  2YYZ A;  4A93 G;  2PQA B;  5E4W C;  3TZU A;  1F9Q A;  3PIO 3;  1JQY D;  2K52 A;  4P74 A;  5M5X H;  4A4I A;  1FJG Q;  2HD3 A;  3NTK A;  3LX0 A;  5KRU A;  5D14 A;  2VS1 A;  3PCO B;  1U4P A;  4B3T L;  1M1K C;  2GA4 B;  3I4M H;  4HN7 A;  4ODG A;  3HOW B;  1Z7T A;  1RCV D;  4MHE A;  1HA6 A;  1QCB D;  2DNC A;  1IBM Q;  3D4W A;  4O42 A;  4R4T A;  2KUM A;  5M5Y B;  2QIL A;  2NZ1 D;  3T53 B;  3N52 A;  1C8C A;  4RGT A;  3MAQ A;  2WKC A;  2ASB A;  3IL8 A;  3S2H H;  3OMG A;  1FL0 A;  1TWC B;  1UNS A;  1YZ6 A;  2HHH L;  3FP9 A;  5FK9 C;  4P75 A;  2JA7 H;  3WOE A;  1PH1 A;  1OXT A;  2F0Q A;  4ZK9 B;  3P1H A;  5FKA C;  1VQB A;  5M3F B;  3OIP A;  4DUY Q;  4O2D A;  5EJW A;  4RAU C;  3H0G G;  1PDQ A;  1JMC A;  4LF7 L;  1XMO L;  4NP5 A;  1Y14 B;  3MHB A;  3KLS A;  4OXP A;  4ZLT F;  4R4I A;  2LXJ A;  4OX9 L;  4A3J B;  5M5W H;  3ONA B;  4JI7 Q;  2H5X A;  3G71 A;  1VQL A;  3TME A;  3M85 A;  1PRT D;  2PW7 A;  3HOW G;  4NKL A;  3A8I E;  1YIJ A;  1C7Y A;  3C46 A;  1K8A C;  3SVM A;  4KKT A;  1XTD A;  2PNH A;  4B9X A;  4KV6 A;  2F0F A;  4KKU A;  1SYG A;  1XMQ L;  4N9T A;  1EEI D;  3A56 A;  5JAV A;  5LHY 1;  4ALP A;  2R6G A;  1EOV A;  1ENC A;  4KY7 A;  5IGE A;  4X62 Q;  4IOA A;  4QF4 A;  3GTG B;  2Q8I B;  1IBM L;  1VQD A;  1Y1W H;  2EIF A;  1WTO A;  1TWA B;  3CCL A;  4LF4 L;  1JWS D;  5D65 A;  4CKC A;  4F87 A;  4LJZ C;  1E2Z A;  5DNF A;  1YJ9 A;  1BBX C;  4C1N K;  4JI3 Q;  1DZ1 A;  4LFA L;  2BA1 A;  4BBS B;  4FVM A;  1EQT A;  2CFM A;  1MI2 A;  2NVT H;  2BDN A;  2OCE A;  1HPC A;  3BDL A;  2A74 C;  3DXJ C;  2A6H D;  1HR0 W;  1PTO F;  2TMP A;  2VL6 A;  2UUB L;  1V1Q A;  4HIM A;  1XYI A;  4NB3 A;  1LO5 D;  3UE0 A;  3U58 A;  4FF4 A;  4KHV A;  4LK1 C;  1EY8 A;  1C0A A;  4HIK A;  4HCS A;  3CCU A;  4YCW A;  1BNZ A;  1GD7 A;  1I4X A;  4AIM A;  3HOX G;  2E2I B;  1H9R A;  4Q0F A;  1VQO A;  2JA5 H;  3OIQ A;  4K0K Q;  1CSQ A;  1RHP A;  4DPG A;  3GP7 A;  1TS4 A;  5JJZ A;  1K8G A;  2VB2 X;  2VQF L;  4JBK A;  2WAC A;  3DEO A;  2ENB A;  2B2U C;  3GTK B;  2UXD Q;  2BH8 A;  3J80 i;  4FXK C;  4X62 L;  1K83 B;  3M4O H;  4G57 A;  3HOV B;  3AYH B;  2BH2 A;  2E76 C;  4A3B G;  1LT3 D;  4BXX G;  5CMD A;  2EY1 A;  2LXK A;  1KLG D;  1AP0 A;  2F0U A;  2A6E D;  1MSH A;  2IW3 A;  1KLU D;  1Y1V B;  3KDF B;  3L7Z C;  1X3G A;  2PMZ B;  4FF3 A;  1JWM D;  2F0G A;  1Q1E A;  2CHB D;  4JI3 L;  3BS1 A;  3KFU A;  2D0P A;  2F3V A;  2N88 A;  2CQO A;  3Q0A A;  3GQB A;  4DUZ L;  3KJO A;  1KL9 A;  1V43 A;  2Y0S E;  1WTP A;  1KDA A;  4DNR B;  2XN9 C;  4K6D A;  3K0X A;  5JEA J;  1SMX A;  1PYW D;  1KNA A;  4RG1 A;  4DAM A;  2E2J B;  1ML0 D;  3MA2 B;  2QCP X;  2F0E A;  3D6C A;  3BZD B;  1CKO A;  3D4D A;  1B8A A;  1TY2 A;  4M1U B;  4GOP A;  1JOO A;  3H15 A;  3F1Z A;  2B63 G;  3GTG H;  4DR5 Q;  5AJ3 L;  3K8A A;  4GLX A;  4DV5 Q;  3K5L A;  3RD4 A;  1GHK A;  2ZTC A;  1I50 B;  5BN3 A;  1V9P A;  1RIP A;  3HP3 A;  5J39 A;  1FR3 A;  2FJ2 A;  4KHP Q;  4LMQ D;  4YWK A;  4Z9C B;  2JA9 A;  1JE5 A;  1KRS A;  3J7Z C;  4B3S L;  4A3D H;  1J8I A;  2MGS A;  3LGJ A;  1S5C D;  1ROD A;  1I4Q A;  3K5N A;  1PH2 A;  1ILP A;  1AN8 A;  1PFM A;  1N33 Q;  1EY7 A;  2F0W A;  3VYR A;  2R7F A;  4B3R L;  1MSG A;  1B7Y B;  3G6E A;  5J3B A;  1JB3 A;  3FKI B;  4IJL A;  2MPM A;  1U4M A;  4OO1 I;  3U4Z A;  3CKI B;  1XTC D;  2R3Z A;  4KD4 A;  2I5H A;  1P8L A;  2YTY A;  4UPA A;  3GTK H;  4WFN 3;  1Z9F A;  3K0Y A;  4LF4 Q;  4A3I H;  5CBA E;  1QNK A;  1EZ6 A;  1V1O A;  4GS3 A;  3VR2 A;  2L5T A;  3NEL A;  1SEB D;  1X3E A;  1JB7 A;  1JJC B;  1TWC H;  4KMU C;  1VQJ A;  1IL2 A;  3J7A 5;  5C0X I;  1PH7 A;  2WAQ E;  3RZD H;  3S24 A;  1E1T A;  3PF4 A;  1WTH A;  5GRO A;  5FLX L;  4BA1 I;  3E9I A;  1PRT F;  1B4O A;  2M9V A;  4QJF A;  2NN6 G;  1TS2 A;  5KNB A;  1PH8 A;  1K3B C;  4Q5V A;  4ZUI A;  3NQI A;  4LF8 L;  2UXB Q;  3E0J A;  4F8M A;  3T1H L;  3S1Q B;  4KHP L;  3QJY A;  1G51 A;  3HFZ B;  2NVT B;  5I2X A;  1TVX A;  2B8G A;  3KF8 A;  4Y7N B;  4E6I A;  2KQ3 A;  5C4Z A;  5DEH A;  3W1G A;  3HOZ H;  1H9S B;  1M8A A;  2KEC A;  1HR0 Q;  3WDN A;  1OXV A;  4X65 L;  3FVQ A;  2E2D C;  3U4V A;  1SNP A;  3BU2 A;  2ALY B;  4DK0 A;  1B44 D;  5IWA L;  1WTX A;  3RNU A;  3IKJ A;  2EYP A;  2R61 A;  1Y1W B;  1VQC A;  1OXU A;  5I9O A;  4A3J G;  4KD3 A;  3OOC A;  1STN A;  4EGV A;  2NVY H;  2PZT A;  1XWE A;  1PYB A;  3K7A H;  1JT8 A;  2CW0 C;  2QEJ C;  1IXR A;  4XYQ A;  1EQR A;  1PRT B;  2ZT9 C;  1W6J A;  4DK3 C;  2PMZ E;  1KIX A;  3MFY A;  2O4X A;  4KHZ A;  2K5V A;  1K8O A;  2PNR C;  2KCC A;  5C0X G;  2WV6 D;  4IUQ A;  3MXN A;  4NXN Q;  4YHH L;  4DUZ Q;  1B70 B;  1B53 A;  5IE8 A;  4UY8 C;  4M8A A;  2CW0 D;  2SEB D;  1C48 A;  3K57 A;  3MWY W;  1JJ2 A;  1LV9 A;  4NXM Q;  2R93 H;  5M5W B;  3H91 A;  2N49 A;  3PO2 B;  3GV6 A;  1SNC A;  5C5L A;  1WI5 A;  1SN8 A;  4JBW A;  3I4N G;  3FEW X;  3A54 A;  2O2L D;  4A3F H;  4OX9 Q;  1LM0 A;  1A8V A;  2G5D A;  4IUP A;  4XQN A;  5AJ3 Q;  3KF8 B;  1F9R A;  2K7V A;  2HCI A;  3BVZ A;  1CQV A;  5I4D A;  1F2Y A;  4A76 A;  1VMP A;  2SNM A;  3MXN B;  2D9U A;  3EN2 A;  1G29 1;  4IZ8 A;  4ZAI A;  2C5C A;  3HKZ E;  3TBI B;  1SE4 A;  4K2K A;  4B3S Q;  2EJM A;  5C4X B;  4IUV A;  1HUN A;  4X3T A;  4K8J A;  1F9P A;  2X69 A;  1EY0 A;  1PH3 A;  3PIO A;  1F2L A;  2VUM B;  1HJP A;  4JW0 A;  4K14 A;  2K5N A;  5L37 A;  4BWG B;  4X3K A;  2JN4 A;  4LAA A;  1EOT A;  3CMA A;  2RSO A;  3CPW A;  1K0R A;  1QZG A;  3SK6 A;  2IJ0 A;  3J80 E;  1E2V A;  3NEM A;  2EVB A;  2Z6B A;  3KF6 A;  1WCM G;  4A3L G;  2BDO A;  1QNU A;  2IHF A;  4C3J B;  2NN6 H;  4DR3 L;  2B2T A;  4DU9 A;  1YHQ A;  3DLL A;  4KN7 C;  4NXM L;  3S14 H;  4H7B A;  4HAE A;  3AFP A;  4J6H A;  4ILW A;  1SSO A;  1ZKO A;  5DM6 3;  1EFW A;  1N9W A;  4YCU A;  3R8B A;  5ELF A;  3TRZ A;  4X3S A;  2ICE C;  2HUG A;  4DR2 L;  5C4J B;  4QUF A;  4EQN A;  2EXZ A;  3A0J A;  1CHP D;  1SE8 A;  2I46 A;  2WKD A;  3DMU A;  3SK8 A;  1BO0 A;  2VUM G;  1YVC A;  1W2B A;  3GTQ B;  2XRQ D;  3QIA A;  5E3F A;  3PUX A;  1BXT A;  3K80 C;  4O0A A;  3V96 A;  3IRB A;  4LUO A;  1DJR D;  4KTA A;  1SFO B;  5ELD A;  2K6A A;  3A8K E;  1X9N A;  4P73 A;  3TS2 A;  1EQQ A;  3GTP H;  1X3Q A;  4HMI A;  2K01 A;  5F2D A;  1HTL D;  5EPK A;  1HQR D;  4BS9 A;  3WOF A;  2L9H A;  3QB3 A;  3CCJ A;  4CKB A;  4FO2 A;  1AEX A;  5FO7 B;  2PO4 A;  2Q2T A;  3TP6 A;  1JOQ A;  1TII D;  4KKS A;  2LSS A;  3HOY H;  1MJC A;  1VQ7 A;  2JA6 G;  2YTV A;  3CCQ A;  1D8L A;  3BDO A;  1LYL A;  2BA0 A;  1ICW A;  4A3D B;  4S3S A;  2F0O A;  3ULL A;  4R4O A;  3LWU A;  4RKB A;  3DHQ A;  3M4Q A;  2ZXO A;  1X32 A;  3Q23 A;  4OEM B;  1I5F A;  1PLF A;  1CI3 M;  4QB4 A;  1KRT A;  1G8Z D;  1FVI A;  3TN2 A;  1GVP A;  5BR8 Q;  1N34 Q;  2X6G A;  3I56 A;  3AU7 A;  2L1B A;  3I7F A;  4DR5 L;  5IIF A;  4DR2 Q;  1PTO C;  4A3F G;  1X65 A;  4IUT A;  4NMZ A;  2Z4I A;  1U9R A;  1BCP D;  2UUB Q;  2XIW A;  2NVQ B;  4DV2 Q;  1JC7 A;  3BVM A;  1EZ8 A;  5C3X A;  1EQV A;  1I6V C;  3D3R A;  4TSS A;  4RCN A;  1Q86 C;  1N8R C;  1GKH A;  1XNR Q;  4A93 B;  3KUP A;  3KBG A;  2QW7 A;  1CT1 D;  3URY A;  5DLQ E;  3I55 A;  4PMW A;  2J0T D;  1EYD A;  2B2U A;  3HKZ B;  1AFP A;  4BY7 G;  4UAI A;  3GTM H;  2WFW A;  1WTV A;  1B3A A;  1SJH D;  4DA2 A;  3S1Q H;  1J5E Q;  2K04 A;  2KED A;  2F0I A;  4F88 A;  4HMJ A;  2K33 A;  5LL6 X;  3R93 A;  3QWN A;  2KOL A;  3FDT A;  2HDL A;  1XNQ L;  1BKB A;  2EYL A;  3S2D B;  2CH4 W;  5M3M H;  1STB A;  3NTH A;  1EWC A;  1HNZ Q;  2BE5 D;  3OHX C;  3K59 A;  2RF4 A;  1UEA B;  2MQH A;  4GKJ Q;  2FFK B;  4RGO S;  5EKK A;  2NB0 A;  2HQE A;  3RN5 A;  1Q90 A;  2GN5 A;  4HJ7 A;  2E2I H;  4DR7 Q;  3KK7 A;  1SYB A;  3V2T A;  1GHJ A;  4DV3 Q;  3HOX B;  1UE6 A;  3P75 A;  1S5F D;  2WII B;  2VW9 A;  1PFN A;  1VQH A;  3VA7 A;  1F77 A;  4CDF C;  1CQF A;  2HQL A;  1XPR A;  3TZD A;  4BXX H;  2AQ3 B;  1TWH H;  1I4R A;  2JJQ A;  2RKS A;  3ERQ A;  4ZQ3 A;  2Z6K C;  4KLK A;  3CXC A;  4DGZ A;  1YHB A;  5LMN W;  2ZTE A;  3NBH A;  4GNX B;  1BUV T;  5IY0 A;  3IFD A;  1PFB A;  2OF1 A;  3MEF A;  5E4X A;  3RLF A;  3GTJ B;  1K0S A;  1VQA A;  1WTQ A;  4C2M H;  4UP8 A;  3MXG A;  1EYC A;  4IUU A;  1ICF B;  2ZXR A;  4EX5 A;  4IFD I;  1K9M C;  1TWA H;  1UE5 A;  2A68 D;  3ERO A;  1I50 H;  4RMF A;  4JPB W;  1NJI C;  4IAL A;  4LFB Q;  3D31 A;  5LMN L;  1IKM A;  4LUV A;  1PH6 A;  4A3L H;  1LTI D;  4FYD A;  1SYC A;  1KD1 C;  5IYD H;  1HFG A;  2E2J H;  3NBH B;  4DR6 Q;  1LTS D;  4OWT B;  1C9O A;  4OL7 A;  2E2H H;  1PVO A;  4JI0 Q;  5HGQ A;  1SRO A;  2JA8 H;  5JJK A;  1CKM A;  3D4R A;  5IYC H;  3A5Z B;  3S1N B;  4PG3 A;  4GOP C;  1RKN A;  1WTR A;  1EYG A;  3CRL C;  1X54 A;  5ELE A;  1ASY A;  1O78 A;  4A75 A;  4A3J H;  1KQS A;  2EYF A;  1EIG A;  3X3M A;  5DAU A;  1EL0 A;  4AYB G;  1EYA A;  5CV8 A;  2ID0 A;  4MIU A;  2EY6 A;  1VF5 C;  2RBM A;  1X56 A;  1B9M A;  2JSO A;  3LWE A;  2QKI C;  4WRD A;  1E24 A;  2H4O A;  1Y8P B;  4K0K L;  1C4Q A;  4P71 A;  5A35 A;  4A3I G;  1GUG A;  1SLJ A;  1ILQ A;  3G7L A;  4A3G B;  3E9H A;  2DJF C;  3I90 A;  5AFW A;  3FPU B;  3EIV A;  5ELC A;  2LY7 A;  5FO8 B;  2RQX A;  1MBY A;  1TS5 A;  2CVR A;  3VR3 A;  3CD6 A;  1RF2 D;  1V1P A;  1IYV A;  4K6L A;  1E1O A;  2HT1 A;  2IL8 A;  1XXG A;  4HR7 B;  2AQ2 B;  2H1E A;  4GN5 A;  1R9T H;  3SEB A;  1V8Q A;  1WD1 A;  3I4M B;  3NQT A;  1PYS B;  4LW1 A;  2ZJR A;  1QVF A;  1YBY A;  1SNM A;  3NK9 A;  2B63 B;  5IT9 L;  3SXH A;  1LT6 D;  1QVG A;  2X6L A;  4L8J A;  4GNX C;  3SHL A;  2M00 A;  4XQJ A;  5IYB H;  2MFI A;  4L5T A;  3HOX H;  1B9N A;  3GO5 A;  1EY6 A;  1UEB A;  3E3X A;  4BBR G;  2Q8T A;  4IFD J;  1TWF B;  4CJ0 B;  4AQY Q;  1IBK L;  1Q82 C;  4DAV A;  2KA7 A;  1ENF A;  1A3T A;  2E5L L;  1AE3 A;  2F52 A;  2OXP A;  3A8J E;  4A3E B;  1S5E D;  4BY7 H;  2B8F A;  1VQN A;  1NBW A;  2Q2I A;  5C3E B;  1JWU D;  3S2D H;  3T16 A;  1KAA A;  3CQZ H;  1Z6H A;  1SYD A;  2MP1 A;  5EQ0 A;  1KHI A;  1BF4 A;  3S17 B;  1FJG L;  2A19 A;  3HOY B;  4LF5 Q;  5IYD G;  5ELN A;  1XPO A;  5HUR A;  2BOS A;  2AUK A;  1QUQ B;  1I6H H;  4JI2 Q;  3RUZ A;  1FGB D;  3HGB A;  2Z9H A;  1HTP A;  3SGI A;  3PUW A;  5ISR A;  4R9W A;  5COR A;  4A3K H;  1SR3 A;  1HA5 A;  4GKK Q;  3C3L A;  1F2M A;  1TXY A;  4JV5 Q;  3AFQ A;  2Z0S A;  2NVQ H;  1I4H A;  1GO3 E;  1PXU A;  3I2Z A;  4P72 A;  1SXT A;  2EOT A;  4MNO A;  4R1J A;  2Q8R E;  2Y0S G;  1BVS A;  2YTX A;  1MKH A;  3HRZ C;  2QEX A;  1HH2 P;  3KLR A;  5JEA H;  1NTG A;  3U50 C;  4LNQ A;  1OXS C;  2JYO A;  4G4K A;  3EQL C;  4H44 C;  2PQA A;  3RN2 A;  1KTK A;  4XXE A;  4R8I A;  4PZ7 A;  2E5L Q;  2MUY A;  1WCM B;  1PFS A;  5M3F G;  4LF8 Q;  2UXB L;  1AZQ A;  1Q46 A;  3H0G H;  1A3U A;  5C5M A;  3M4P A;  1L0Y B;  4JI7 L;  2EPB A;  2I5M X;  4ZKB B;  1SNQ A;  2F0S A;  4QUC A;  3NE5 B;  1D1K A;  2KHI A;  2ZXP A;  5DM7 3;  2KCM A;  1F9S A;  4U68 A;  4A3M G;  3NWT A;  5IGF A;  2RA4 A;  1IYJ B;  2A68 C;  1BBU A;  1K3R A;  1I3Q B;  4WJW A;  3STB C;  2VUM H;  1ZYR D;  1CK1 A;  3J81 i;  2HCC A;  1BCP C;  4OIJ A;  2IX3 A;  2DN8 A;  5A2Q E;  2OEO A;  5IGB A;  3HOY G;  4ZYS A;  3NEN A;  3VYU A;  1Q81 C;  3I4N H;  4BY1 G;  1QWY A;  3UDI A;  2JA8 G;  2VQE Q;  1O7I A;  4DKA C;  4L6T B;  4OON A;  4B3R Q;  3F2C A;  3RLN A;  3I4L A;  5C4J H;  3NWS A;  4CKE A;  2SNS A;  1JCK B;  3M4Y A;  2B2W C;  1EIH A;  2DJG C;  4JI1 Q;  1W6K A;  5D3D A;  3ULP A;  1MHW C;  4JOI C;  1EY9 A;  2F03 A;  1R4Q B;  2HHH Q;  1LT5 D;  1STY A;  3UDF A;  4C3J H;  2ICI A;  1N32 L;  4BBR B;  5KGU A;  3Q6S A;  4IQZ A;  1E0B A;  3I73 A;  2DY8 A;  3QOL A;  4PMB A;  1A0I A;  4TQU S;  2WB1 E;  3QO2 A;  3GTL B;  1U5K A;  1VF7 A;  4DNT B;  4LF7 Q;  1RD9 D;  2O5I C;  1WCM H;  5K36 G;  4OEL B;  1PZI D;  1LT4 D;  3U9O A;  4A3M H;  2B2V C;  4F7X A;  3F8T A;  3T13 A;  3WWV A;  4RHS A;  5G3L D;  5C3W A;  1I4P A;  2EXD A;  1X6O A;  2NVY B;  1OTC A;  1BR9 A;  5CV9 A;  1TS3 A;  2VZA A;  1KDC A;  3CCS A;  4A3M B;  4O1N A;  4DR4 L;  1XMQ Q;  2I07 B;  3S9W A;  4IPC A;  2K32 A;  3OW7 A;  2OTL A;  4X3U A;  2J7Z A;  5CYU A;  2RHS B;  5J1Z A;  2I0Q A;  5FJ8 H;  4R4Q A;  3T1Y Q;  2J4X A;  3ZJY C;  1PZJ D;  3HOZ B;  2P5Z X;  3M7N A;  1LTB D;  2QDB A;  5LL6 S;  4BBR H;  4Y7N H;  2EJG C;  2WAQ B;  2B2Y A;  2F1M A;  5C44 B;  2UUC L;  3P7J A;  3LNN A;  3PUV A;  2F0N A;  1I4G A;  1LTL A;  5M3M G;  2JA6 H;  2JP1 A;  3CRK C;  2B2T C;  4RA8 A;  1G6P A;  5HGT A;  3FMC A;  4ZCK A;  4KN4 C;  3G6J B;  3OTO L;  4JI8 L;  3P20 A;  3HOU B;  1G6Z A;  3R3O A;  3QOJ A;  2PW5 A;  4IOC A;  3A74 A;  2MHV A;  1GUW A;  1A2T A;  4IJH A;  2MNA A;  1IL8 A;  4A3E H;  1TWG H;  3OSO A;  3A5U A;  1GUN A;  3SE0 A;  1NAP A;  2O5J C;  3S1R H;  1FGU A;  5ELB A;  5NUC A;  4CGY B;  2D5D A;  2MJ8 A;  4WJ4 A;  4I7Z C;  2NZO A;  1L2F A;  1TKW B;  1I3Q H;  3CCM A;  1LTG D;  4AYB E;  5IT9 c;  1BQQ T;  4IPG A;  1MIU A;  3TDQ A;  4IPD A;  3PO3 G;  1Y8N B;  1VQM A;  2JE6 I;  1NCV A;  1YI2 A;  3BZC A;  4K5V A;  2UXD L;  2FMC A;  2R92 B;  3SDZ A;  4DV4 L;  5ELO A;  2EQS A;  4XDX A;  4LFB L;  5G3L F;  3T1Y L;  2XTI A;  3PO3 B;  4QCL A;  2JXM B;  2NBF A;  3I70 A;  3S16 H;  3W3A A;  1HNW Q;  3MXU A;  2UUC Q;  4YWL A;  2F4V L;  2CWP A;  1SNO A;  2TSS A;  3J7A F;  1SRU A;  2V1C C;  3EFX D;  2OQ0 A;  3RZO B;  3F2U A;  4L63 B;  2EYJ A;  4XT3 B;  2K5H A;  4X64 L;  4IO9 A;  2IT1 A;  5I6Y A;  3AB9 A;  2ZTD A;  4CHT B;  1JR0 D;  5IP9 H;  3BG3 A;  1GJX A;  1UWV A;  1Q7Y C;  1VQ6 A;  1GXD C;  1PTO D;  2WB1 G;  2K50 A;  3ITP A;  3FKI H;  1KDB A;  3PQI A;  2HIX A;  2KHJ A;  2MO1 A;  2PQE A;  4DV7 Q;  2VY3 A;  4NW2 A;  3A55 A;  4N8F A;  4IPH A;  5FOB B;  1VQ8 A;  4V19 0;  4EQO A;  3PV0 A;  4H0L C;  1HQM C;  1STH A;  2AMC B;  3MEH A;  1XNQ Q;  3HOV H;  4YIJ A;  1YNJ C;  1VQP A;  1QZH A;  2YU9 H;  4B3T Q;  3Q8D A;  4BY7 B;  1E7Z A;  1K83 H;  3I4O A;  1O7Y A;  4IUR A;  4CBV A;  4RWS C;  2EYM A;  3PIP 3;  4TKO B;  1SND A;  1FNW A;  1VMC A;  1HNX L;  2JA5 B;  5C6A A;  2NWG A;  3PGZ A;  1RTN A;  5JJL A;  4DK6 C;  4G7Z C;  4B08 A;  1K28 A;  1SMY D;  4RFB A;  5GAD C;  5EPL A;  2MO0 A;  1QIL A;  2WB1 B;  1ZEQ X;  3CC2 A;  4RH6 A;  3H6M A;  1ESR A;  1V1P B;  1SDF A;  4AYB B;  1ESF A;  4QMG A;  4JI8 Q;  3IFT A;  1N34 L;  1NMF A;  4RGN A;  4KY5 A;  1QOH A;  4OGQ C;  1VS0 A;  1WFQ A;  2B63 H;  2SDF A;  1R9T B;  2JEA I;  2OTJ A;  1A63 A;  2A8V A;  1NNX A;  3DWA A;  4HSV A;  4POG A;  4QQB X;  3ND8 A;  5I6W A;  5JVG 3;  3CF5 A;  1QG7 A;  1HRJ A;  3MZ5 A;  3M4O B;  2BCO A;  5IOD A;  1YEZ A;  5IP7 G;  3OW2 A;  3PF5 A;  3JAM i;  1M4V A;  1RDP D;  4UP9 A;  1CZG A;  3JC6 6;  2AHO B;  5J22 A;  1HR0 L;  1U4R A;  3JAM L;  3S1R B;  1CA6 A;  2UUA L;  1HUM A;  1KXL A;  1JOK A;  1TQO A;  2JQO A;  2VQE L;  1X3F A;  1EU3 A;  3UE1 A;  4DR6 L;  2D2C C;  1KAB A;  4IUN A;  4WOR A;  1AZP A;  3BZK A;  5K36 H;  2NTS A;  5KND A;  4DR3 Q;  1TU2 B;  2F0J A;  3R2T A;  2K1B A;  1WD0 A;  3TP7 A;  3CW2 C;  3EJI A;  5EGT A;  3BDC A;  2EYO A;  3DM3 A;  3UDX A;  1B3Q A;  2E2H B;  4GLV B;  1VQE A;  5LMU L;  1ET6 A;  3I91 A;  2L11 A;  1VCI A;  4JI5 Q;  4PZ8 A;  1NR2 A;  1HFN A;  5JPN C;  5C4H A;  4ME3 A;  1SYE A;  2JA7 B;  1YNN D;  3NSW A;  4A3C H;  1DD2 A;  4DFA A;  4OWX B;  1WJJ A;  3CHB D;  1G91 A;  3H3V C;  3DWQ A;  3S2H B;  3J7Y W;  3F2B A;  2R7Z B;  3STB D;  4JI6 L;  4DV6 Q;  3L2P A;  4AH6 A;  1M90 C;  3C1E A;  4C3I H;  1DM0 B;  3VR5 A;  1G2T A;  3HOV G;  4MTK A;  4HIO A;  4JYA L;  1O80 A;  2N8N A;  3NBI A;  1D5X C;  2RHQ B;  3PSI A;  3T4A C;  2L15 A;  4IFD G;  2F0M A;  3PUY A;  1D1I A;  2PYK A;  4ME5 A;  3UI2 A;  2JA7 G;  2DNE A;  1KNE A;  1CTM A;  1SE3 A;  1FYC A;  3QG1 A;  2PI2 E;  1T5X D;  4UDU C;  1STG A;  2NZH A;  2KVM A;  4POF A;  2R93 G;  5C3E G;  5IGD A;  4I7A A;  3H09 A;  1CSP A;  1YJW A;  5M3F H;  2I5L X;  4Y52 H;  3GV3 A;  4JI0 L;  4LFC L;  2LFN A;  2NYZ D;  1Y1V G;  1SFO H;  4JI5 L;  2F0T A;  1PH9 A;  2WIN B;  2ZJP A;  1JOR A;  3GTQ H;  2VXW A;  5JEA G;  1J9O A;  5KEE A;  5COY A;  2CWA A;  2EY2 A;  3T1H Q;  3I4N B;  5JJI A;  1PH4 A;  2RDH A;  3J81 c;  5M3M B;  4G7H C;  3S15 H;  5EPJ A;  1LLR D;  1ZYR C;  3I72 A;  5I9P A;  3S1M B;  1ENA A;  1I94 Q;  4OHJ A;  4APV A;  3TSS A;  4X66 L;  4A3K G;  3CPF A;  1D5M C;  3K6O A;  2UXC Q;  2B3G A;  5E7N A;  1EIF A;  2QGQ A;  3OWE B;  3D0F A;  5JVH 3;  2KBN A;  1RTO A;  2A73 B;  4DAP A;  5IT9 E;  1N33 L;  5IOC A;  5FJ8 G;  1T9H A;  1LAC A;  1ASZ A;  1LAB A;  2CH4 A;  2FHT A;  3OMC A;  3RR5 A;  1HHV A;  1PTO B;  3OWF A;  4XIG S;  2K14 A;  1HNZ L;  1WOC A;  4OO1 H;  5CV6 A;  4JI4 L;  3CAM A;  4GN4 B;  3ERS X;  4GKJ L;  3E5S A;  2ZM6 Q;  4JC0 A;  4B9W A;  4C3I B;  4NXN L;  1CFM A;  3TS0 A;  5C4X H;  4UP7 A;  4LF9 Q;  2IX0 A;  3DM1 A;  3D8G A;  3K5O A;  5EBC A;  4HID A;  3K7U C;  3I3C A;  3NP8 A;  2F3W A;  1UE7 A;  1VQ9 A;  1IKL A;  1PMR A;  2KEN A;  4N8X 1;  1VDZ A;  4BBS G;  1A15 A;  3G4S A;  5A2Q L;  2C9O A;  2M2L A;  1PTO H;  4A3K B;  4KJN A;  1EWH A;  2HIV A;  4DV1 Q;  2L0C A;  3TQY A;  1MJE A;  1S4Z A;  4A3F B;  4BY1 B;  2E74 C;  4K5W A;  2XWJ B;  1I94 L;  1PRT C;  1XMO Q;  4DXF A;  2E75 C;  3NUC A;  4C3J G;  3E0E A;  3TEH B;  1HZA A;  4X66 Q;  3K81 C;  4UHV A;  3PO2 H;  3GDE A;  1TR5 A;  2R93 B;  4K8I A;  4C3I G;  4C1N I;  4FXD A;  3S17 H;  3GTP B;  3H94 A;  4HJ5 A;  1DCZ A;  4JI6 Q;  1MD2 D;  4PNY A;  3KLS X;  4A3D G;  3HZX A;  3I8Z A;  1Y8O B;  5C3E H;  3HKZ G;  4ZRZ A;  4LF5 L;  1WYD A;  2XVS A;  3L0O A;  1H9M A;  5IWA Q;  4B3M L;  4QIW E;  2QF7 A;  4RGM A;  1E3P A;  1VQG A;  1PV4 A;  5GAE C;  5KNC A;  1S5B D;  1Q8I A;  2GVA A;  4XYO A;  3BJU A; 
#chains in the Genus database with same CATH homology
 2NUC A;  2XSC A;  4HTH A;  4JV5 L;  1L0W A;  3ULJ A;  5IYB G;  2OWO A;  1NR4 A;  2V4D A;  2RDF A;  1G2S A;  1UUP A;  1H9K A;  4LFA Q;  4ID6 A;  1F2Z A;  3C1F A;  1N32 Q;  4JOI A;  3OYY A;  5KYL A;  4HCE A;  3J7A V;  3ER0 A;  1DOK A;  1HCZ A;  1B1Z A;  4TVA B;  3I4M G;  3MXP A;  2F3I A;  1ONL A;  4DV1 L;  4DV5 L;  1GM5 A;  2K28 A;  3G48 A;  1XJV A;  1LTA D;  4KK7 A;  2K75 A;  2K5D A;  1STE A;  1U4L A;  1EY4 A;  1DGS A;  5I2Y A;  4DV0 Q;  4FF1 A;  4HJ9 A;  3X3N A;  3KF6 B;  1L1O B;  5KIX A;  4L5Q A;  4HED A;  4V0B A;  3JAM c;  2PPB C;  3VYS A;  4FP5 D;  1SMY C;  5CGK A;  5GQO A;  1EIY B;  4MN3 A;  2B2V A;  3KJP A;  1EY5 A;  2R7Z H;  4YCV A;  4A3G H;  1S3O A;  5FLX c;  3M9B A;  1SAP A;  3SR1 A;  3J81 L;  4A3B B;  4R4C A;  1D5Z C;  1B50 A;  3EVQ A;  4KI0 A;  1WVL A;  2R92 G;  1VQ4 A;  5CC4 A;  2DGY A;  1A2U A;  1VQF A;  3KLW A;  1SE2 A;  1IW7 D;  2YU9 B;  3CC4 A;  3K58 A;  2JEB I;  5LMN Q;  2CCZ A;  2ATW A;  1I6H B;  2AKW B;  3V05 A;  4C56 C;  1XPU A;  4YY3 Q;  2KCT A;  1D7Q A;  3FKI G;  3M7G A;  2A6H C;  2A5H A;  4FXG C;  3TP8 A;  1IBL L;  1VQK A;  2ZJQ A;  1FNV A;  3GD7 A;  1OO9 B;  4FDB A;  4DN4 M;  1IYU A;  3CQZ B;  1X55 A;  3J81 E;  2AWN A;  1N36 L;  3FRP B;  1HZB A;  4JG2 A;  2EZV A;  2XRS D;  3VA5 A;  3MC0 B;  4DV2 L;  2Z6K A;  4R8N A;  2EDG A;  2LS0 1;  3Q24 A;  5GAH C;  2Q2U A;  1GUO A;  1T5E A;  2NVX B;  5H1S E;  3PO2 G;  1XNR L;  2N55 A;  2RSN A;  2XWB B;  1LTT D;  2G9D A;  3NPP A;  2WAQ G;  4N9P A;  3RZO H;  4GN3 B;  2B39 A;  1YHA A;  3NTI A;  2RDG A;  1X3P A;  4HJA A;  1CKN A;  1DOM A;  2B29 A;  1II3 A;  5CV7 A;  4C2M B;  4X65 Q;  1PZK D;  3GTJ H;  2A6E C;  3KBX A;  4A3G G;  3S16 B;  2QA4 A;  3EBE A;  2FIN B;  4JI2 L;  4IN3 A;  4C3H H;  5JOB A;  1S5D D;  5FO9 B;  3OPO A;  3PO3 H;  2Z1C A;  1AH9 A;  1Q12 A;  4DNI A;  2XNA C;  4DR4 Q;  1TWH B;  4C3H B;  1YIT A;  4ZUJ A;  3J80 c;  2JK8 A;  1Y1V H;  2IPK D;  3L9A X;  3VYT A;  4GKK L;  5C4X G;  3GTO H;  3M3Y H;  2IY5 B;  3BYY B;  1SJE D;  2F4V Q;  4PZ6 A;  1L1O C;  4EVO A;  1W3S A;  4GNX A;  1IBL Q;  1STA A;  3ND9 A;  3A7L A;  4XT1 B;  3DUZ A;  4LF6 L;  1EWI A;  4QY7 A;  1CM9 A;  1D6E C;  4LFC Q;  3RZD B;  4HJ8 A;  2L55 A;  3VR6 A;  4DR1 Q;  1R4P B;  4J1M A;  5TSS A;  2F0V A;  3R2I A;  4A3I B;  1ET9 A;  5HY6 A;  2OQK A;  1QB5 D;  3CCR A;  1YNN C;  2G9H D;  1TWG B;  3A7A B;  4CJ2 C;  3OTO Q;  5BR8 L;  4DUY L;  1K8M A;  2LMC B;  3EA6 A;  3KDF A;  1QUQ A;  3HOU H;  1A62 A;  5T1I A;  3GTO B;  3M3Y B;  5EAY A;  1IHZ A;  2F0K A;  1RL2 A;  2AUJ D;  4DV0 L;  3O13 A;  4KJO A;  2BE5 C;  2JA6 B;  3J81 j;  2UXC L;  3S1N H;  4H02 A;  2K03 A;  1FNU A;  5EBD A;  5IGG A;  1PHJ A;  2D0O A;  2JA8 B;  1GUS A;  4DV6 L;  1E22 A;  4A3C G;  5JPM C;  4PQX A;  1K73 C;  1RJT A;  4A93 H;  4DAY A;  1Q1B A;  4FNF A;  4KY6 A;  1H9J A;  3VDY A;  1AW7 A;  4JYA Q;  2NTT A;  2F0L A;  1JJG A;  4JI4 Q;  4DV4 Q;  2UU9 Q;  4OWW B;  1JE4 A;  3W2D A;  3MVV A;  1H95 A;  3NXW A;  4A3B H;  4JCV E;  5KYI A;  5C0X H;  1HNX Q;  2NVX H;  4LUZ A;  4MTN A;  3H3V H;  4C3H G;  2PZW A;  2PI2 A;  5IP7 H;  1A3V A;  4LF9 L;  3TP5 A;  4YY3 L;  1HNW L;  1SYF A;  4TRD A;  2IX1 A;  1Z47 A;  4DR1 L;  1O7L A;  3KYH C;  4PV1 C;  1JIC A;  1H9S A;  2B2Y C;  1U0L A;  4BA2 I;  1BOS A;  2JA5 G;  4JK1 C;  4YHH Q;  4RKL A;  4DAY B;  2Z8L A;  5D3I B;  4DV3 L;  1Y1W G;  1YJN A;  3NHH A;  1O7Z A;  1GUT A;  3FPP A;  5FLX E;  3GTL H;  5CBE E;  2C35 B;  4CJ1 B;  1XX8 A;  5IGC A;  5IYC G;  2AQ1 B;  2R92 H;  5IP9 G;  1VQI A;  3HOZ G;  2NN6 I;  1EEF D;  1P16 A;  1DOL A;  1NSN S;  1Q3L A;  1UAP A;  5EKI A;  1BDO A;  1CUK A;  1EUJ A;  3K5M A;  1IZ6 A;  4A3E G;  3ZYY X;  3W1B A;  5T1G A;  2R7Z G;  2Z4H A;  2OT2 A;  2KJX A;  1DON A;  2AWO A;  2KCN A;  2FXQ A;  3HOU G;  5BN4 A;  4GOP B;  3MFG A;  4QL5 A;  5CV5 A;  1OXX K;  2EYH A;  1CA5 A;  2VQF Q;  3KOJ A;  1ZXT A;  2UUA Q;  1DXM A;  4B3M Q;  2N78 A;  3B6Y A;  3ICE A;  2K5Q A;  2DUD A;  1KC8 C;  1YNX A;  5CV4 A;  1L0X B;  4L5S A;  2Q2H A;  1PH5 A;  2L12 A;  1S40 A;  1D2B A;  1Q8K A;  3HOW H;  1B2T A;  2CKZ B;  2B2W A;  1BCP B;  3F2D A;  3CCV A;  3PMF A;  3AQQ A;  2F0P A;  3GTM B;  1KAW A;  3SK5 A;  4DF7 A;  2ZM6 L;  3SK4 A;  1EU4 A;  5C44 H;  4XTC S;  4LF6 Q;  2Y0S B;  5M5X B;  3TRE A;  4JI1 L;  4BBS H;  4P2C B;  1QE6 A;  2DY7 A;  1HZC A;  4K5X A;  1QJO A;  3CME A;  1BCP F;  1BBW A;  3BYT B;  1UE1 A;  4I65 A;  2A69 C;  2EJF C;  4L5R C;  3H0G B;  1NUC A;  4NDX A;  2K5W A;  3T56 B;  1PA6 A;  1CKN B;  3L3O C;  1VQ5 A;  3RLO A;  2KEE A;  3D6W A;  1GOZ A;  4FF2 A;  2KHS A;  2EE1 A;  5M9O A;  2HDM A;  2GVB A;  4IFD H;  4ULL A;  4OO1 G;  4RHR A;  3HKS A;  4J8Q A;  3UDG A;  2CQA A;  3AEV A;  3MTS A;  2SOB A;  4X6A H;  4EQ5 A;  2IHE A;  2YV5 A;  1MGS A;  2VB3 X;  2XGT A;  2K05 A;  3FHW A;  1J5E L;  2VNU D;  3N6R A;  3DEP A;  4ZKC B;  1TY0 A;  5C0X J;  2K4K A;  2PZU A;  3CP0 A;  1YNJ D;  5CR3 A;  4G7O C;  5EKL A;  5K5P A;  2D62 A;  2F4I A;  4K2L A;  1CZW A;  3W5O A;  1NMG A;  2WP8 J;  5GAG C;  3PUZ A;  4OIK A;  1Y69 U;  4HSP A;  1DYQ A;  2F0D A;  1NY4 A;  4JBM A;  2E8G A;  2UU9 L;  4BY1 H;  4MZ9 A;  3CC7 A;  4J15 A;  1A6X A;  1EFI D;  4NPS A;  5FLM H;  2PCF B;  2L4N A;  3J80 L;  4YWM A;  1CHQ D;  3JAM E;  4DR7 L;  4QGU A;  2F0H A;  1L1O A;  1S72 A;  3S1M H;  1N36 Q;  5FLM G;  4X64 Q;  1SBB B;  3E6Z X;  2R7D A;  5C44 G;  2N3S A;  3AMU A;  2FMM A;  3S15 B;  4GZY C;  3CU7 A;  1IW7 C;  2A1A A;  4LWC A;  1TT2 A;  1WTW A;  2ES2 A;  5M5Y H;  1NE3 A;  2RVL A;  3DWP A;  3K7A B;  4QIW B;  4RCO A;  2EY5 A;  3RMH A;  4JBJ A;  5LMU Q;  3Q22 A;  4AQY L;  1IBK Q;  4DXG A;  3C2P A;  3CCE A;  2A69 D;  1E2W A;  4PMC A;  1FD7 D;  3HG9 A;  4DK1 A;  4WJ3 M;  4GLA C;  4H13 C;  1TWF H;  3T51 B;  3H3V I;  1LUZ A;  1HZ9 A;  2IWH A;  4U67 3;  1QVC A;  1AE2 A;  4XQQ A;  3HS0 C;  3BVG A;  4EQP A;  3U9S A;  4DV7 L;  2LKV A;  3S14 B;  5BN5 A;  1LTR D;  1HXY D;  3VR4 A;  5E1F A;  4ABN A;  1J6Q A;  3PIP A;  3HEJ A;  2RCN A;  4A93 G;  2YYZ A;  3IAY A;  2PQA B;  5E4W C;  3TZU A;  1F9Q A;  3PIO 3;  1JQY D;  2K52 A;  4P74 A;  5M5X H;  4A4I A;  1FJG Q;  3NTK A;  3LX0 A;  5KRU A;  5D14 A;  2VS1 A;  3PCO B;  4B3T L;  1U4P A;  1M1K C;  2GA4 B;  3I4M H;  4HN7 A;  4ODG A;  3HOW B;  1Z7T A;  1RCV D;  4MHE A;  1HA6 A;  1QCB D;  2DNC A;  1IBM Q;  3D4W A;  4O42 A;  4R4T A;  2KUM A;  5M5Y B;  2QIL A;  2NZ1 D;  3T53 B;  3N52 A;  1C8C A;  4RGT A;  3MAQ A;  2WKC A;  2ASB A;  3S2H H;  3IL8 A;  3OMG A;  1FL0 A;  1TWC B;  1YZ6 A;  1UNS A;  2HHH L;  3FP9 A;  5FK9 C;  4P75 A;  2JA7 H;  3WOE A;  1PH1 A;  1OXT A;  2F0Q A;  4ZK9 B;  3P1H A;  5FKA C;  1VQB A;  5M3F B;  3OIP A;  4DUY Q;  4O2D A;  5EJW A;  4RAU C;  3H0G G;  1PDQ A;  1JMC A;  4LF7 L;  1XMO L;  4NP5 A;  1Y14 B;  3MHB A;  3KLS A;  4OXP A;  4ZLT F;  4R4I A;  2LXJ A;  4OX9 L;  4A3J B;  5M5W H;  3ONA B;  4JI7 Q;  2H5X A;  3G71 A;  1VQL A;  3TME A;  3M85 A;  1PRT D;  2PW7 A;  3HOW G;  4NKL A;  3A8I E;  1YIJ A;  1C7Y A;  3C46 A;  1K8A C;  3SVM A;  4KKT A;  1XTD A;  2PNH A;  4B9X A;  4KV6 A;  2F0F A;  4KKU A;  1SYG A;  1XMQ L;  4N9T A;  1EEI D;  3A56 A;  5JAV A;  5LHY 1;  4ALP A;  2R6G A;  1EOV A;  1ENC A;  4KY7 A;  5IGE A;  4X62 Q;  4IOA A;  4QF4 A;  3GTG B;  1IBM L;  2Q8I B;  1VQD A;  1Y1W H;  2EIF A;  1WTO A;  1TWA B;  3CCL A;  4LF4 L;  1JWS D;  5D65 A;  1YJ9 A;  4CKC A;  4LJZ C;  1E2Z A;  5DNF A;  4F87 A;  1BBX C;  4C1N K;  4JI3 Q;  1DZ1 A;  4LFA L;  2BA1 A;  4BBS B;  4FVM A;  1EQT A;  2CFM A;  1MI2 A;  2NVT H;  2BDN A;  2OCE A;  1HPC A;  3BDL A;  2A74 C;  3DXJ C;  2A6H D;  1HR0 W;  1PTO F;  2TMP A;  2VL6 A;  2UUB L;  1V1Q A;  4HIM A;  1XYI A;  4NB3 A;  3UE0 A;  1LO5 D;  3U58 A;  4FF4 A;  4KHV A;  4LK1 C;  1EY8 A;  1C0A A;  4HIK A;  4HCS A;  3CCU A;  4YCW A;  1BNZ A;  1GD7 A;  1I4X A;  4AIM A;  3HOX G;  2E2I B;  1H9R A;  4Q0F A;  1VQO A;  2JA5 H;  4K0K Q;  3OIQ A;  1CSQ A;  4DPG A;  1RHP A;  3GP7 A;  1TS4 A;  5JJZ A;  1K8G A;  2VQF L;  2VB2 X;  4JBK A;  2WAC A;  3DEO A;  2ENB A;  2B2U C;  3GTK B;  2UXD Q;  2BH8 A;  3J80 i;  4X62 L;  4FXK C;  1K83 B;  3M4O H;  4G57 A;  3HOV B;  3AYH B;  2BH2 A;  2E76 C;  4A3B G;  4BXX G;  1LT3 D;  5CMD A;  2LXK A;  2EY1 A;  1KLG D;  1AP0 A;  2F0U A;  2A6E D;  1MSH A;  2IW3 A;  1KLU D;  1Y1V B;  3KDF B;  3L7Z C;  1X3G A;  2PMZ B;  4FF3 A;  1JWM D;  4JI3 L;  1Q1E A;  2CHB D;  3KFU A;  2F0G A;  3BS1 A;  2D0P A;  2F3V A;  2N88 A;  2CQO A;  3Q0A A;  3GQB A;  4DUZ L;  3KJO A;  1KL9 A;  1V43 A;  2Y0S E;  1WTP A;  1KDA A;  4DNR B;  2XN9 C;  4K6D A;  3K0X A;  5JEA J;  1SMX A;  4RG1 A;  1KNA A;  1PYW D;  4DAM A;  2E2J B;  1ML0 D;  3MA2 B;  2QCP X;  2F0E A;  3D6C A;  3BZD B;  1CKO A;  3D4D A;  1B8A A;  1TY2 A;  4M1U B;  4GOP A;  1JOO A;  3H15 A;  3F1Z A;  2B63 G;  3GTG H;  4DR5 Q;  5AJ3 L;  3K8A A;  4GLX A;  4DV5 Q;  3K5L A;  3RD4 A;  1GHK A;  2ZTC A;  1I50 B;  5BN3 A;  1V9P A;  1RIP A;  3HP3 A;  5J39 A;  1FR3 A;  2FJ2 A;  4KHP Q;  4LMQ D;  4YWK A;  4Z9C B;  2JA9 A;  1JE5 A;  1KRS A;  3J7Z C;  4B3S L;  4A3D H;  1J8I A;  3LGJ A;  2MGS A;  1S5C D;  1ROD A;  1PH2 A;  1I4Q A;  3K5N A;  1ILP A;  1AN8 A;  1PFM A;  1N33 Q;  1EY7 A;  2F0W A;  3VYR A;  2R7F A;  4B3R L;  1MSG A;  3G6E A;  1B7Y B;  5J3B A;  1JB3 A;  3FKI B;  4IJL A;  2MPM A;  1U4M A;  4OO1 I;  3U4Z A;  3CKI B;  1XTC D;  2R3Z A;  4KD4 A;  2I5H A;  1P8L A;  2YTY A;  4UPA A;  3GTK H;  4WFN 3;  1Z9F A;  4LF4 Q;  3K0Y A;  4A3I H;  5CBA E;  1QNK A;  1EZ6 A;  1V1O A;  4GS3 A;  1JB7 A;  2L5T A;  3NEL A;  1X3E A;  1SEB D;  3VR2 A;  1JJC B;  1TWC H;  4KMU C;  1VQJ A;  1IL2 A;  3J7A 5;  5C0X I;  1PH7 A;  2WAQ E;  3RZD H;  3S24 A;  1E1T A;  3PF4 A;  5GRO A;  5FLX L;  4BA1 I;  3E9I A;  1PRT F;  1B4O A;  2M9V A;  4QJF A;  2NN6 G;  1TS2 A;  5KNB A;  1PH8 A;  4Q5V A;  4LF8 L;  2UXB Q;  3NQI A;  4ZUI A;  3E0J A;  3T1H L;  4F8M A;  3S1Q B;  4KHP L;  3QJY A;  1G51 A;  3HFZ B;  2NVT B;  5I2X A;  1TVX A;  2B8G A;  3KF8 A;  4Y7N B;  4E6I A;  2KQ3 A;  5C4Z A;  3W1G A;  5DEH A;  3HOZ H;  1H9S B;  1M8A A;  2KEC A;  1HR0 Q;  3WDN A;  1OXV A;  4X65 L;  3FVQ A;  3U4V A;  2E2D C;  3BU2 A;  1SNP A;  2ALY B;  4DK0 A;  1B44 D;  5IWA L;  1WTX A;  3RNU A;  3IKJ A;  2EYP A;  2R61 A;  1Y1W B;  1VQC A;  1OXU A;  5I9O A;  4A3J G;  4KD3 A;  3OOC A;  1STN A;  4EGV A;  2NVY H;  2PZT A;  1XWE A;  1PYB A;  3K7A H;  1JT8 A;  2CW0 C;  2QEJ C;  1IXR A;  4XYQ A;  1EQR A;  1PRT B;  2ZT9 C;  4DK3 C;  1W6J A;  2PMZ E;  1KIX A;  2O4X A;  3MFY A;  4KHZ A;  2K5V A;  1K8O A;  2PNR C;  2KCC A;  5C0X G;  2WV6 D;  3MXN A;  4IUQ A;  4NXN Q;  4YHH L;  4DUZ Q;  1B70 B;  1B53 A;  5IE8 A;  4UY8 C;  4M8A A;  2CW0 D;  2SEB D;  1C48 A;  3K57 A;  3MWY W;  1JJ2 A;  1LV9 A;  4NXM Q;  2R93 H;  5M5W B;  3H91 A;  2N49 A;  3PO2 B;  3GV6 A;  1SNC A;  5C5L A;  1WI5 A;  1SN8 A;  4JBW A;  3I4N G;  3FEW X;  3A54 A;  4OX9 Q;  4A3F H;  2O2L D;  1LM0 A;  1A8V A;  4IUP A;  4XQN A;  5AJ3 Q;  3KF8 B;  1F9R A;  2K7V A;  2HCI A;  3BVZ A;  1CQV A;  5I4D A;  4A76 A;  1F2Y A;  1VMP A;  2SNM A;  3MXN B;  2D9U A;  3EN2 A;  1G29 1;  4IZ8 A;  4ZAI A;  2C5C A;  3HKZ E;  3TBI B;  1SE4 A;  4K2K A;  4B3S Q;  2EJM A;  5C4X B;  4IUV A;  1HUN A;  4X3T A;  1F9P A;  2X69 A;  4K8J A;  1EY0 A;  1PH3 A;  3PIO A;  1F2L A;  2VUM B;  1HJP A;  4K14 A;  2K5N A;  4BWG B;  4X3K A;  3CMA A;  4LAA A;  1EOT A;  2RSO A;  3CPW A;  1K0R A;  1QZG A;  3SK6 A;  2IJ0 A;  3J80 E;  1E2V A;  3NEM A;  2EVB A;  4A3L G;  3KF6 A;  1WCM G;  2IHF A;  4DR3 L;  1QNU A;  2BDO A;  2NN6 H;  4C3J B;  2B2T A;  4DU9 A;  1YHQ A;  3DLL A;  4NXM L;  3S14 H;  4KN7 C;  4H7B A;  4HAE A;  3AFP A;  4J6H A;  4ILW A;  1SSO A;  1ZKO A;  5DM6 3;  1EFW A;  1N9W A;  4YCU A;  3R8B A;  3TRZ A;  5ELF A;  4X3S A;  2ICE C;  2HUG A;  4DR2 L;  5C4J B;  4QUF A;  4EQN A;  3A0J A;  2EXZ A;  1CHP D;  1SE8 A;  2I46 A;  2WKD A;  3DMU A;  3SK8 A;  1BO0 A;  2VUM G;  1W2B A;  1YVC A;  3GTQ B;  2XRQ D;  3QIA A;  5E3F A;  3PUX A;  1BXT A;  3K80 C;  4O0A A;  3V96 A;  3IRB A;  4LUO A;  1DJR D;  4KTA A;  1SFO B;  5ELD A;  2K6A A;  1X9N A;  3A8K E;  4P73 A;  3TS2 A;  1EQQ A;  3GTP H;  1X3Q A;  4HMI A;  2K01 A;  5F2D A;  1HTL D;  5EPK A;  1HQR D;  4BS9 A;  3WOF A;  2L9H A;  3QB3 A;  3CCJ A;  4CKB A;  4FO2 A;  1AEX A;  5FO7 B;  2Q2T A;  2PO4 A;  3TP6 A;  1JOQ A;  1TII D;  4KKS A;  2LSS A;  3HOY H;  1MJC A;  1VQ7 A;  2JA6 G;  2YTV A;  3CCQ A;  1D8L A;  3BDO A;  1LYL A;  2BA0 A;  1ICW A;  4A3D B;  4S3S A;  2F0O A;  3ULL A;  4R4O A;  3LWU A;  4RKB A;  3DHQ A;  3M4Q A;  2ZXO A;  1X32 A;  3Q23 A;  1I5F A;  1PLF A;  1CI3 M;  4QB4 A;  1KRT A;  1G8Z D;  1FVI A;  3TN2 A;  1GVP A;  5BR8 Q;  1N34 Q;  3I56 A;  2X6G A;  3AU7 A;  2L1B A;  3I7F A;  4DR5 L;  5IIF A;  4DR2 Q;  4A3F G;  1PTO C;  1X65 A;  4IUT A;  4NMZ A;  2Z4I A;  1U9R A;  1BCP D;  2UUB Q;  2XIW A;  2NVQ B;  4DV2 Q;  1JC7 A;  3BVM A;  1EZ8 A;  5C3X A;  1EQV A;  1I6V C;  3D3R A;  4TSS A;  4RCN A;  1Q86 C;  1N8R C;  1GKH A;  1XNR Q;  4A93 B;  3KUP A;  3KBG A;  1CT1 D;  3URY A;  5DLQ E;  3I55 A;  4PMW A;  2J0T D;  1EYD A;  2B2U A;  3HKZ B;  1AFP A;  4BY7 G;  4UAI A;  3GTM H;  2WFW A;  1WTV A;  1B3A A;  1SJH D;  3S1Q H;  4DA2 A;  1J5E Q;  2K04 A;  2KED A;  2F0I A;  4F88 A;  4HMJ A;  2K33 A;  5LL6 X;  3R93 A;  3QWN A;  2KOL A;  3FDT A;  2HDL A;  1XNQ L;  1BKB A;  2EYL A;  3S2D B;  5M3M H;  1STB A;  3NTH A;  1EWC A;  1HNZ Q;  2BE5 D;  3OHX C;  3K59 A;  2RF4 A;  1UEA B;  2MQH A;  4GKJ Q;  2FFK B;  4RGO S;  5EKK A;  2NB0 A;  2HQE A;  3RN5 A;  1Q90 A;  2GN5 A;  4HJ7 A;  2E2I H;  4DR7 Q;  3KK7 A;  1SYB A