1XNQL

Structure of an inosine-adenine wobble base pair complex in the context of the decoding center
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
publication title Structure of a purine-purine wobble base pair in the decoding center of the ribosome.
pubmed doi rcsb
total genus 15
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2004-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1xnqL00
3AQQA 1VQAA 2N8NA 1L0WA 4YHHL 3PIOA 3S16H 1CKNA 5C0XJ 4LNQA 1IZ6A 4J15A 4BBSH 3EN2A 1VQPA 1NY4A 4MZ9A 4WJ3M 3WWVA 1EIYB 4B3ML 4R4QA 4X6AH 4AIMA 4O2DA 3GTKH 4Y52H 1DGSA 1PFSA 3Q8DA 4NXML 1HR0Q 4K0KQ 1TXYA 4AQYQ 4A3GG 3CCRA 4DV0L 1X3EA 2Z6KC 4GNXC 3PGZA 1KRSA 4RG1A 3J7A5 4LFCQ 4IOAA 1VS0A 1A8VA 2D0OA 1PVOA 4KI0A 3ULLA 4A3EG 1E24A 2OQKA 3HOYG 4JI5Q 1R9TH 1XPUA 2OCEA 5M5YH 3HOUH 4B3RL 3H3VH 2MQHA 2DGYA 4LWCA 5GQOA 3AFQA 1LTLA 1EQQA 1SRUA 4YCVA 1PH9A 1J5EL 2GVAA 1IBKQ 2RHQB 3ER0A 4H02A 3KFUA 1HNXQ 1V1QA 3PUVA 1K8AC 1ASZA 3KF6B 1L1OA 3GTOH 4BBSG 4AH6A 2N49A 2JE6I 4X64L 2UUAL 4LF4Q 1N33L 2HT1A 1EQRA 1KD1C 1G291 2AWNA 2JQOA 2NZHA 1YBYA 3A5ZB 3CPFA 3MEFA 4ME3A 4JI8L 3UE1A 4YY3L 4DUZL 4NXNQ 1N36Q 2JA6H 4X65L 2HIXA 5AJ3L 4IPGA 2WP8J 4OWTB 1MIUA 2VQEL 5LMNW 4IPCA 4UY8C 2I5HA 4GLAC 1GKHA 4DNIA 4LF5L 2UXCL 2ZTEA 3CMAA 4IOCA 1YVCA 1S3OA 2VNUD 4ALPA 3CAMA 4UP8A 4GNXB 3HOUG 1X54A 4HJ8A 3F1ZA 4JCVE 4A3JH 2GN5A 4JI2L 2VY3A 4DV3L 4JI6L 3G4SA 4JBWA 1U0LA 4IFDG 1SLJA 1B70B 3L2PA 1PH4A 3U50C 1J6QA 1O7IA 4DK3C 1UE1A 1W3SA 1BKBA 2K5NA 2RF4A 2XTIA 3D31A 4QGUA 4HIOA 1HZBA 2IT1A 2BH8A 1VQ9A 3CCUA 3TRZA 4QL5A 4JI0L 4OONA 4LF6Q 2R6GA 1SR3A 3KJOA 3CCSA 1AE2A 4DAYB 2JA6G 4GOPC 3PUYA 3AYHB 4GKJQ 2VQFQ 1SN8A 5JEAG 3CC4A 5E7NA 3TS2A 5FJ8H 2UUBQ 5JJLA 5M3FH 3EBEA 3PF4A 4C3JH 4YWLA 3F2BA 1K9MC 1N32L 1XPOA 4LFAL 2KHIA 2LSSA 1NE3A 1Q86C 3S1QH 4DR7Q 4A3JG 4HIKA 1X3GA 5IYCH 3GTPH 5GAHC 2I5LX 5FLXc 1IBKL 2JA7G 1N34Q 2JA8H 3AEVA 4A3DH 4DR4Q 1VQGA 2A19A 4DK6C 3CC2A 2AWOA 3CCVA 4DR5L 1PV4A 1PHJA 1K8GA 2VUMH 3S24A 1XNQQ 1TWCH 4JBKA 2VS1A 1Y14B 4C2MH 3E0EA 1VQDA 3D0FA 1VQ8A 5C4XH 1IXRA 3EIVA 3W1BA 3L0OA 1IBMQ 2K14A 3NEMA 3DLLA 2Q2UA 4DUYL 3BZCA 1N36L 1YJ9A 4LF9Q 3ICEA 3ZJYC 1A63A 1KL9A 1HZAA 1UEBA 1JT8A 3OTOQ 3OYYA 4HJAA 2HHHL 1SFOH 4BY1H 2LXJA 3HKSA 2OWOA 1V43A 1GO3E 5M3FG 3UDIA 1YHQA 3L7ZC 1PH1A 2UXDL 2I0QA 3I7FA 5IT9c 1PA6A 1Y1VG 1CKMA 4AYBG 2E5LL 4OXPA 5IYCG 4GOPB 2Z6KA 2NVQH 4A3DG 4GNXA 4BY7H 4NPSA 2B29A 1WI5A 4YCWA 3CPWA 1JB7A 3T1YQ 2WB1E 4P74A 2KBNA 4AYBE 5GADC 4DR3L 2IHFA 1VQOA 4QQBX 2UXBQ 5K36G 1KXLA 2B63H 2PI2E 1YEZA 2D62A 1IL2A 1JJGA 1G6PA 2CQOA 2QA4A 1YJWA 3U58A 4DV7Q 1K73C 4B3TQ 4A3BG 1D8LA 2F4VQ 1WCMH 2E2HH 3GD7A 4BY1G 2CWAA 1I5FA 3PCOB 1UE6A 1VQJA 4DV4Q 4LF7Q 2Y0SG 1Q7YC 4OX9Q 3NENA 3KF8B 3I4MH 1Z47A 1E7ZA 2PQAB 1VQ4A 2HQLA 1C7YA 2Y0SE 3RZOH 4R4OA 1PYBA 4PMWA 4Y7NH 3M9BA 5DLQE 1KQSA 2CKZB 2CWPA 4BY7G 4APVA 4JI3L 2MO0A 3G71A 4B3SQ 4LFBQ 1AE3A 4A3FH 2EXDA 1VCIA 4QY7A 2Q2HA 2ZM6Q 1OXXK 2B63G 2YTXA 5C4JH 1VQ6A 3JAMi 3I55A 5LMNQ 4KHPL 2RCNA 4HIDA 4PG3A 2JJQA 4DR1L 2MFIA 2ATWA 5LMUL 1M1KC 1YZ6A 3KDFA 3S1NH 1HH2P 4LF9L 3I2ZA 3PO3H 2VZAA 3TEHB 2JA9A 1JMCA 4A3LH 1PYSB 4YWKA 1UE7A 3GTMH 1WCMG 3RR5A 4GLVB 4QIWE 2A1AA 2K5VA 3GDEA 3RN2A 4L5QA 1WFQA 3U4ZA 3GTLH 1HNWQ 2F52A 4UP7A 3CCEA 1N8RC 5IE8A 1GD7A 1S72A 3I4MG 3SGIA 1Y1WH 4A3MH 4DV2Q 1XNRQ 2IX1A 1HZCA 1FJGQ 3S2HH 5HY6A 1HNZQ 2AMCB 4GOPA 4YCUA 1RIPA 3J81j 4A3FG 1X55A 5C44H 1VQEA 4JG2A 1FGUA 5M3MH 5BR8Q 4DKAC 1XMQQ 1NJIC 5GROA 4L5RC 2UU9Q 1VQNA 5IYDH 4JI7L 1L2FA 2JA7H 4DV7L 1OXSC 2RHSB 2E8GA 1XJVA 4MNOA 1Q1BA 3RLOA 4KLKA 1A0IA 1QUQB 3PO3G 3K7UC 1KHIA 4A3LG 4HJ5A 1Q8KA 1VQFA 5M5WH 3F2CA 4OX9L 2LXKA 2QGQA 1I3QH 2KCMA 3UE0A 1VQHA 2Z0SA 2PMZE 4DV1Q 2D0PA 4AQYL 1YJNA 1HR0L 1G51A 1I6HH 3FP9A 3RN5A 4GN3B 2EQSA 1LUZA 2A8VA 1I50H 4LFCL 2V1CC 1Q1EA 3RLNA 4QJFA 1UE5A 2QEXA 4O0AA 4A3MG 3FKIH 3PSIA 1Y1WG 1MJEA 4K0KL 3CF5A 1AH9A 4YWMA 2IX0A 1SMXA 3CCQA 4B3SL 4JI5L 3BZKA 4IFDJ 4EX5A 1N9WA 1Z9FA 3CW2C 5C44G 1Y1VH 5M3MG 4JI4Q 1K0RA 4JV5Q 2UUCQ 2K52A 4IPHA 5IYDG 1UWVA 4DPGA 4DR6Q 1EWIA 2R7ZH 1HNXL 3PIPA 3TREA 1CKNB 1T9HA 2AHOB 1NMGA 2H5XA 4JOIC 3K80C 3JAMc 1IBLQ 4GKKQ 2C35B 2CFMA 2AKWB 1Q12A 1QVFA 4LF4L 4YHHQ 1XPRA 2MO1A 3KF6A 1S40A 3HOVH 4DAMA 3TQYA 4R4TA 1HZ9A 4GS3A 2F3IA 3J81i 4B3MQ 1IYJB 2YV5A 4NXNL 3CMEA 1ASYA 2JEBI 5JEAJ 3M3YH 2VL6A 5GAGC 1H95A 3TS0A 4A3BH 2NVYH 4DV2L 2ZJRA 4IO9A 2HIVA 5IP7H 3FKIG 1YIJA 5JJIA 3CQZH 3CP0A 1BVSA 4L5TA 4GLXA 4A3IG 1HNZL 3CD6A 4P75A 4DV5Q 1YITA 3A5UA 3W5OA 3K8AA 1FL0A 4KHZA 1LYLA 1OXUA 4B3RQ 4TQUS 1LM0A 1GVPA 1PH2A 4EQ5A 2R7DA 3A74A 3K0XA 2IY5B 2R7ZG 1J5EQ 1TWAH 3HOXH 1OXVA 1P16A 3PO2G 1L1OB 4MTNA 2R7FA 3STBC 4A3KH 3ERSX 3I4OA 5HGQA 4BXXH 4A3CH 3CXCA 2ES2A 4IPDA 1VQLA 2PI2A 4LF7L 3HOVG 3E9HA 2UUAQ 1N33Q 2NN6I 1WYDA 4LF6L 4DR2Q 4UPAA 1CUKA 1WJJA 2VW9A 4DV6Q 4P73A 4R4CA 1E3PA 1PH3A 3AFPA 4YY3Q 4JI8Q 2VQFL 4DUZQ 1E22A 2ID0A 3HKZG 5IP7G 3CCMA 2CCZA 3E9IA 4X65Q 3H0GG 5AJ3Q 1QZGA 1VQIA 2UUBL 2VQEQ 1VQKA 1BBWA 1X56A 2ZTDA 3IRBA 1MJCA 2R92H 1V9PA 5ELNA 3RNUA 4LF5Q 4DR7L 4GN5A 3RLFA 4JI4L 4R4IA 3G48A 2N3SA 1N34L 4DR4L 2ZTCA 4BBRH 3I56A 2IHEA 1IBLL 4JI2Q 5FLMH 4P71A 3HOXG 4JI6Q 1XNQL 1SE8A 4RMFA 5M5XH 4LUOA 2MNAA 2Q2TA 1X65A 2PNHA 4PZ8A 3H15A 1SROA 3A0JA 4OWXB 1RL2A 4POGA 1X6OA 1XTDA 3PV0A 4A3KG 1IBML 4BXXG 4A3CG 4JYAQ 2YYZA 4HJ7A 1JE5A 4LW1A 1YI2A 3F2DA 2N78A 4PZ7A 4A93H 3T1HQ 1EUJA 1VQBA 3OTOL 3J81c 4OWWB 3BJUA 1VQMA 1EIFA 4JI0Q 1YHAA 2WAQG 1KRTA 5H1SE 4DV5L 1NBWA 1TWFH 2BA1A 4JBMA 2R92G 3S2DH 4A4IA 2JEAI 2WAQE 3I4NH 1N32Q 2JK8A 1EOVA 4NB3A 4LFAQ 3PUWA 1EYGA 2R93H 1OXTA 4BBRG 2K5HA 1YHBA 3T1YL 1OTCA 4L5SA 5FLMG 1CSQA 2UXBL 1PH8A 4OO1I 1NTGA 4HIMA 1HR0W 4JI1Q 4C3HH 2ALYB 4DR5Q 3M4QA 3ULPA 3K7AH 1TWHH 1WOCA 2FXQA 4FDBA 4B3TL 5C0XI 3FHWA 5C3EH 1M90C 4DR2L 3KYHC 4C3IH 4DV6L 1NMFA 4UP9A 3B6YA 1A62A 2K4KA 3PF5A 4A93G 2YU9H 2F4VL 1E1OA 4X62Q 4DUYQ 1P8LA 3W1GA 4A75A 4JOIA 1QZHA 4XTCS 4DV4L 4XIGS 5IY0A 3S15H 3ULJA 1XMOQ 2HHHQ 4POFA 2WFWA 2BH2A 3J80i 1BBUA 3KOJA 1HJPA 4X66Q 3CC7A 2NN6G 2ASBA 3I4NG 3OW2A 3HOWH 2UXDQ 3NELA 4IJLA 1KC8C 1K83H 2EIFA 5J3BA 1X9NA 1KIXA 4A3IH 3NBHB 2E5LQ 2PQAA 2R93G 4WJ4A 4LFBL 1D7QA 1L1OC 1PH5A 2ZM6L 1QVCA 3S17H 1VQCA 1FVIA 2K75A 5LMNL 4DR3Q 2JA5H 3GO5A 4JYAL 3S1RH 1I94Q 2OTLA 2E2JH 5IWAQ 1PH6A 4TVAB 1K3RA 5IYBH 5IP9H 3J7ZC 1PH7A 3M4OH 5C3EG 3T1HL 3PO2H 1C0AA 1B8AA 2DUDA 5JJKA 4LF8Q 1TWGH 4HJ9A 3MXNB 1HNWL 2B3GA 2OQ0A 2XGTA 4BA2I 1JJ2A 2Q2IA 3LGJA 4LUVA 4NXMQ 1YNXA 3DM3A 3K81C 4GKJL 1XNRL 2KHJA 5EAYA 4DV0Q 3UDFA 3HOWG 1Q81C 2L15A 3CCJA 3H0GH 1FJGL 4IJHA 1W2BA 3RZDH 2NZOA 3UDGA 3BU2A 4A76A 4JI1L 1B7YB 1U5KA 5BR8L 2GVBA 3GTJH 1XMQL 4JI3Q 2UU9L 2JA5G 4JC0A 1MKHA 3UDXA 2ZJQA 3PUZA 3HOZH 3M85A 3KDFB 1GM5A 3S14H 3CCLA 2YTVA 2NVXH 4KHPQ 5IYBG 5IP9G 4DR1Q 4GN4B 5LMUQ 3GTQH 4X62L 2E2IH 4OO1G 3VDYA 1Q82C 3STBD 1QUQA 4DV1L 2KCTA 1KAWA 4P72A 4BA1I 1XMOL 2YTYA 4X64Q 3KLWA 3GTGH 5ELOA 3S1MH 1C9OA 3F8TA 4X66L 5FJ8G 2I5MX 5C0XG 2OTJA 4A3GH 3PUXA 3H3VI 3M7NA 3M4PA 1CKOA 3G6EA 2WB1G 3JC66 3U4VA 5GAEC 1VQ5A 2ZJPA 1VQ7A 1CSPA 3J80c 2JA8G 4IFDI 3KJPA 2K50A 4A3EH 2UXCQ 4JBJA 2KENA 3HKZE 4R1JA 3HOYH 2VUMG 1I94L 2UUCL 1E1TA 4JV5L 4PZ6A 1X3FA 5IWAL 3HOZG 4DR6L 2NVTH 1Q46A 3HFZB 1EFWA 5C4XG 2BA0A 4JI7Q 1QVGA 4GKKL 4DV3Q 1JJCB 4LUZA 4LF8L
chains in the Genus database with same CATH superfamily
3AQQA 1VQAA 1IZ6A 4BBSH 3EN2A 1EIYB 4RGNA 4X6AH 4C3HB 4O2DA 3MXNA 1DGSA 4LK1C 4RFBA 3CCRA 4XXEA 1X3EA 3G7LA 1TWHB 4RG1A 1PLFA 1U4LA 1VS0A 4C3IB 3QO2A 1PVOA 2PQEA 1E24A 1TS5A 1TVXA 2OQKA 5M5WB 3HOYG 1PZJD 2PCFB 4EQOA 5GQOA 4LWCA 3S15B 3AFQA 1LTLA 1EQQA 3NXWA 3EROA 4YCVA 2GVAA 1IBKQ 2RHQB 3HOWB 1HNXQ 3OMCA 3PUVA 1ET9A 1XYIA 2NWGA 4QMGA 1IYVA 2UUAL 2JE6I 2O4XA 1KD1C 1G291 2JQOA 3A5ZB 1YBYA 3CPFA 2E2JB 4YY3L 2JA6H 1A3UA 3PO2B 5JEAH 4UY8C 3CMAA 3C46A 2VNUD 1NNXA 3URYA 3HOUG 4A3JH 4JI2L 2VY3A 3DM1A 1WTVA 4OELB 1SLJA 4BWGB 1J6QA 1ZKOA 1O7IA 1PZID 2NZ1D 3RZDB 2K5NA 2RF4A 2XTIA 4JW0A 1BR9A 4RGOS 5D14A 4HIOA 1SYCA 4QL5A 4LF6Q 1F2YA 3BDOA 1SR3A 3PIO3 3KJOA 3Q23A 1EY9A 4GOPC 4C1NI 4QCLA 1XWEA 1C48A 5JJLA 1SJED 5M3FH 5T1GA 4DFAA 1PRTD 1PRTC 1K9MC 1PRTF 1Q86C 4DR7Q 1DYQA 2RA4A 2JA7G 3QOJA 4DR4Q 4DK0A 1VQGA 4DK6C 3CC2A 3G6JB 5K36H 1PHJA 3T53B 1HCZA 3MWYW 4HSPA 1TWCH 2B2UA 1KTKA 4RGTA 1UNSA 4A3EB 1VQ8A 1VQDA 1BCPD 1BCPF 3W1BA 3NEMA 2Q2UA 4KJNA 1A63A 3ZJYC 1JT8A 2HHHL 1A2TA 3S16B 1V43A 1GO3E 3UDIA 1ICFB 1PH1A 5C5LA 4IUVA 1RCVD 2Q8IB 4BY7H 1WI5A 1JB7A 1HA6A 3BYTB 4AYBE 1LV9A 3BZDB 2PI2E 4K6LA 4Q5VA 1IL2A 5BN4A 1G6PA 1K73C 4B3TQ 4UAIA 2HCIA 2SDFA 4ZUJA 1CHPD 3GD7A 3PCOB 1I5FA 1O7ZA 2PMZB 2K32A 2RDFA 2K03A 5JAVA 3I4MH 1SYEA 3ND8A 1Z47A 2PQAB 1VQ4A 1C7YA 1PYBA 4PMWA 3M9BA 2F0MA 5DLQE 1KQSA 2CWPA 3BVMA 2MO0A 3D4DA 4LFBQ 3R93A 1VCIA 2ZM6Q 3MZ5A 1SNMA 1MSHA 4K14A 3JAMi 2RCNA 3LX0A 1HA5A 4CDEC 5LMUL 1YZ6A 2M00A 3S1NH 1I6VC 3MA2B 2JXMB 4L6TB 3PO3H 2ZT9C 3T56B 5L37A 2JA9A 4FXGC 1NR2A 3GTMH 2RSOA 3GDEA 2BOSA 4B9WA 1N8RC 2EE1A 1S72A 4XQNA 4IQZA 3P7JA 2SOBA 1LT5D 3SGIA 4QB4A 1XNRQ 3SHLA 5I4DA 1B2TA 1FJGQ 3S2HH 5I9OA 1RIPA 4CDDC 2KA7A 2JSOA 5C44H 1FGUA 4DKAC 2UU9Q 3D3RA 5IYDH 1L2FA 4DV7L 2RHSB 3MTSA 1XJVA 4I7AA 1QUQB 2JA8B 5M5WH 2RCFA 3F2CA 4V0BA 1YJNA 2VUMB 2PMZE 1STYA 4GN3B 1ML0D 1SAPA 2V1CC 3A8IE 2A69D 3ND9A 4LFCL 3NP8A 4O0AA 4A3MG 3PSIA 1RD9D 3OHXC 2QF7A 3AB9A 1FGBD 2IX0A 3L3OC 4YIJA 2EYMA 1EZ8A 3BZKA 2KVMA 3NHHA 1SFOB 5M3MG 1TQOA 1DM0B 1E0BA 2K5WA 4ZUIA 2E74C 3JAMc 2NVQB 2AKWB 1Q12A 4UHVA 3KF6A 1BXTA 4N9TA 3HOYB 1I4RA 4R4TA 3J81i 1EY4A 4B3MQ 1WTXA 2JEBI 4MTKA 2VL6A 3TS0A 5JPNC 4A3BH 2NVYH 1GJXA 2L12A 3CQZH 1U4MA 1HNZL 1BVSA 3I73A 4HCEA 4P75A 3E6ZX 1RF2D 1YITA 1WCMB 2E2HB 1VF7A 1LYLA 1OXUA 2BE5C 1LM0A 2NTTA 4X3SA 1FD7D 3A74A 2R7ZG 2K05A 1TWAH 1OXVA 1P16A 4J1MA 2B8FA 1LTTD 2LKVA 3NUCA 2K1BA 5IIFA 4IPDA 2J4XA 2WV6D 4A3FB 3W2DA 1V8QA 3CRLC 2VW9A 1PH3A 1E3PA 5FO9B 3NTIA 3HKZG 5IP7G 1VQIA 1B1ZA 2VQEQ 1BBWA 1X56A 2ZTDA 3BG3A 3IRBA 4LF5Q 2P5ZX 3TP5A 2N3SA 1N34L 3VR4A 2AUJD 1D5ZC 1NSNS 1IKLA 2IHEA 1AEXA 1IBLL 4P71A 3J80E 3HOXG 5J39A 1XNQL 1J9OA 4LUOA 3NSWA 4OWXB 4POGA 4ZRZA 1RL2A 5LHY1 1XTDA 4A3KG 4OGQC 4A3CG 4HJ7A 3J81L 1BCPB 1YI2A 2KCNA 2N78A 1ENFA 1PFMA 4PZ7A 1VMCA 3T1HQ 1VQBA 2JA7B 3EFXD 3J81c 4OWWB 1JOKA 4KY6A 4ZK9B 2WAQG 2F0TA 2B2VC 4G7OC 2NN6H 2JEAI 2VB2X 1I3QB 1WTWA 4K8JA 2JK8A 1EYGA 1I6HB 5A2QL 5FK9C 3UI2A 5FLMG 1I50B 4DAPA 5I6WA 3FKIB 4JI1Q 4MIUA 4DR5Q 3M4QA 2ZXOA 5DEHA 1CQVA 4FDBA 5D65A 5C0XI 3IFTA 1STGA 4DV6L 4RHSA 2F4VL 4DV4L 3F2UA 3QIAA 1B9NA 3R2IA 1O7LA 5HURA 1HJPA 5C3WA 3ONAB 1PMRA 3U9OA 4XT3B 5E4WC 3OW2A 1KDBA 5BN3A 1K83H 1LTAD 4A3IH 2RQXA 4P2CB 3KLSA 1LT4D 1QVCA 3K6OA 4WORA 3SK8A 4DN4M 5KEEA 4XDXA 3GO5A 3Q22A 3S1RH 2OTLA 2A6ED 5IWAQ 4XYQA 5IP9H 3M4OH 5JOBA 4C3IG 4R8IA 4HJ9A 3A8KE 1JJ2A 3LGJA 4LUVA 3DM3A 5ELFA 2K04A 2F0PA 3HOWG 4KD3A 2ICEC 2SEBD 2L4NA 1TY0A 4ZYSA 1H9MA 1ET6A 2CW0C 2CW0D 3GTJH 2JA5G 1H9KA 3HOZH 3M85A 3S14H 3CCLA 1X3QA 5IYBG 1I4HA 3TZUA 4GN4B 3VA5A 4BBRB 3VDYA 4KKUA 3JAME 4DV1L 1KAWA 4P72A 4X64Q 1DCZA 1NUCA 5C0XG 5C4JB 1HQMC 4KY5A 3H3VI 2F03A 3N52A 1WTOA 1CKOA 5GAEC 3OPOA 3DXJC 4IFDI 3VR6A 2FINB 4JK1C 3KJPA 2B2UC 1EY6A 2E2DC 2KENA 3HOYH 2B2WA 2E76C 1YNJC 1YNJD 1X3FA 4U68A 3HFZB 5C4XG 1QVGA 5TSSA 4GKKL 4DV3Q 4YHHL 1H9SA 2WINB 3PIOA 1CKNA 4J15A 1VQPA 1I4PA 1D6EC 4R8NA 3X3MA 4HMJA 2A5HA 4AIMA 3R8BA 3OWFA 1PFSA 4K0KQ 3EVQA 4CKCA 4DV0L 2JN4A 4DK1A 3Q24A 5D3DA 3ERQA 3J7A5 2K5DA 5E1FA 2D0OA 2NB0A 1HXYD 3ULLA 4A3EG 1R9TH 1XPUA 3HOUH 4B3RL 2L0CA 1PH9A 1J5EL 1QNKA 3VYSA 4H02A 3KFUA 1I4GA 1ASZA 2KEEA 1L1OA 3GTOH 1JQYD 1CZGA 1QOHA 1N33L 2HT1A 2EYLA 1EQRA 2NZHA 4ME3A 3MEFA 3UE1A 4OEMB 1N36Q 1JORA 4X65L 2HIXA 4IPGA 2WP8J 1PFNA 1WTPA 3J81E 4DNIA 4IOCA 2EYJA 1YVCA 2HD3A 4ALPA 4JVZA 2RBMA 3F1ZA 2I46A 4JI6L 2AQ1B 1U0LA 4IFDG 3HKZB 1B53A 2K6AA 2F0GA 2PZUA 3C1FA 3U50C 1UE1A 1M8AA 3SDZA 3QG1A 3D31A 5A2QE 2M9VA 1QJOA 4OO1H 1HHVA 1CQFA 1XX8A 4JI0L 4OONA 2NVXB 4CDFC 4DAYB 5CMDA 2VQFQ 3GTQB 2J0TD 4IZ8A 3CC4A 3TS2A 5FJ8H 2LFNA 4YWLA 1XPOA 1PZKD 4LFAL 1NE3A 3I72A 3GTGB 1H9JA 3FVQA 3S1MB 3GTPH 1SXTA 2I5LX 1IBKL 4PV1C 1TKWB 2XIWA 5CR3A 1Y8NB 4CGYB 1K8GA 4ABNA 3S24A 3IKJA 3K5LA 3MXUA 3I8ZA 2VS1A 3A7AB 4C2MH 3DWQA 1IW7C 3E0EA 2DNCA 1QWYA 1IXRA 3EIVA 1IBMQ 1K8OA 2K14A 3DLLA 1S5DD 5FO8B 4DUYL 4LF9Q 3ICEA 3H09A 4X3TA 1KL9A 2B39A 1PTOH 2EY5A 5EQ0A 3KBXA 3BDLA 1STHA 4HJAA 2JP1A 4F7XA 3HKSA 4K6DA 1GOZA 1O78A 2UXDL 5IGCA 1PDQA 1Y1VG 4OXPA 4CHTB 5DM73 2J7ZA 2Z6KA 5E3FA 3CPWA 1SNDA 4DR3L 3NBHA 1VQOA 2IHFA 1AW7A 1U4PA 3TP7A 2F0IA 1WD1A 2UXBQ 2B2VA 2D62A 3S2DB 3MHBA 4UDUC 2CQOA 3U58A 3D4RA 1GHJA 1SNOA 5KRUA 5FKAC 5FOBB 5KYLA 2F0OA 4BY1G 2M2LA 1VQJA 1Q7YC 3OMGA 2Q8TA 3NPPA 5CGKA 2HQLA 5KNCA 2Y0SE 4Y7NH 4OIKA 2LS01 5JPMC 2CKZB 4PMCA 4APVA 1SSOA 4B3SQ 1AE3A 2EXDA 2PZWA 4QY7A 5IOCA 1OXXK 1SE4A 2YTXA 5C4JH 3I55A 4G4KA 1K0SA 4KHPL 2F0WA 1D5XC 2ATWA 3KDFA 3TZDA 2VB3X 2VZAA 3TEHB 3P20A 1E2ZA 4NP5A 1WCMG 3RR5A 4GLVB 4QIWE 3GTLH 4L5QA 1Y8PB 2JA5B 3CCEA 1X3PA 1GD7A 1C8CA 1FNVA 3BDCA 1JWMD 4A3MH 4DV2Q 4Z9CB 2IX1A 3BVGA 1RTNA 4A3FG 1X55A 5M3MH 2IL8A 1XMQQ 5CV6A 5BR8Q 4L5RC 1VQNA 2DJGC 2MUYA 1ILPA 4C3JB 3WOFA 4RHRA 4MNOA 4AYBB 4KLKA 4A3LG 4O42A 2KCMA 3UE0A 1VQHA 2Z0SA 1HR0L 4AQYL 1F2MA 2DY7A 2EQSA 1BBXC 3NQIA 3RLNA 2MHVA 4MN3A 3HG9A 5C4XB 4QJFA 1LACA 1MJEA 3CF5A 3SK4A 4ZQ3A 4YWMA 2E2IB 4DXGA 1SMXA 3CCQA 4JI5L 2IX3A 4FXKC 4JI4Q 4JV5Q 2K52A 3MXPA 1LT3D 4DPGA 1DJRD 2R7ZH 1S4ZA 2HDMA 1SE2A 1QVFA 3T4AC 4LF4L 2MO1A 4FF1A 4DAMA 1DD2A 2GA4B 3K5MA 1IYJB 2YV5A 4NXNL 1ASYA 5JEAJ 3M3YH 4J8QA 1H95A 2FJ2A 4CJ2C 2HIVA 5IP7H 3FKIG 1YIJA 5A35A 4ILWA 4L5TA 3OSOA 3A54A 5IGBA 3W5OA 3K8AA 1FL0A 3T51B 4TQUS 4XQQA 5IGEA 3HOXH 4MTNA 3C3LA 3RZOB 1B50A 1W6JA 4A3KH 3I4OA 1WD0A 4NKLA 2F0VA 4A3CH 2PI2A 3HOVG 1HTPA 5M5YB 2UUAQ 1KNEA 4DR2Q 1CUKA 3AFPA 4YY3Q 4GKJL 5K5PA 2CCZA 5KIXA 4C1NK 3E9IA 1QZGA 3H0GG 2UUBL 2DNEA 5DM63 1V9PA 3RNUA 4GN5A 2F0EA 3FPPA 4N8FA 1CHQD 3G48A 2RKSA 3I56A 4JI2Q 5FLMH 2BDOA 1Y1WB 1ZEQX 2Q2TA 1X65A 2PNHA 2MJ8A 3H15A 1SROA 5EPJA 5F2DA 1D2BA 1WTQA 4BXXG 1M4VA 4LW1A 1EWCA 1G8ZD 2HQEA 1Z6HA 3OTOL 1VQMA 1YHAA 2B2WC 1PTOD 1PTOC 4JBMA 3S2DH 1PTOF 2OF1A 5ELCA 1EOVA 3IL8A 3PUWA 2K01A 4BBRG 1SDFA 3T1YL 1HR0W 4C3HH 1IHZA 3I91A 4FO2A 1TWHH 4DA2A 4H0LC 3S1QB 1SBBB 1Y1VB 4C3IH 5CV5A 1TY2A 4UP9A 1D1IA 1GUNA 1A62A 2K4KA 2X6LA 4TSSA 4A93G 1E1OA 1UEAB 4X62Q 3TSSA 1QZHA 4XTCS 2EOTA 3S15H 1U4RA 1XMOQ 2HHHQ 4F88A 4B08A 2QW7A 2X6GA 3VA7A 3HOWH 3NELA 2EIFA 2R93G 3J7AF 2PQAA 2EJFC 1L1OC 2Q8RE 4BY1B 4Q0FA 5LMNL 2JA5H 1F2ZA 4KMUC 2E2JH 1EY0A 5IYBH 3J7ZC 3T1HL 3PO2H 1B8AA 3DEPA 4RH6A 5JJKA 4LF8Q 3SK6A 2HCCA 1W6KA 3MFYA 4TRDA 1HNWL 3T16A 1JC7A 1FNWA 4BA2I 5C0XH 3FDTA 3K58A 4NXMQ 1YNXA 4LMQD 2KHJA 3CU7A 3UDFA 2L15A 3CCJA 1DXMA 5T1IA 4IJHA 3RZDH 4H13C 2NZOA 3UDGA 3BU2A 4JI1L 1B7YB 5C3XA 4FF4A 1FR3A 4JC0A 2PYKA 1A3TA 1B3QA 2BE5D 3P75A 2R92B 3HEJA 1Y8OB 5LMUQ 3KBGA 4DAVA 2E2IH 1KAAA 3GV6A 1Q82C 1CA5A 1QUQA 2EXZA 2A68C 2A68D 2KCTA 3DEOA 2I5MX 4CBVA 2H4OA 1PFBA 3T13A 1HPCA 4G57A 2K50A 4A3EH 2UXCQ 4JBJA 2B2YA 2UUCL 1PRTB 2KQ3A 1GUOA 5IWAL 4DR6L 2FFKB 1EQTA 1VQ9A 3I4NB 2XWJB 3WDNA 2F0DA 3S16H 2RDGA 5C0XJ 1EIGA 1NY4A 4MZ9A 1JCKB 4WJ3M 1VDZA 1E2WA 4R4QA 1JOQA 4Y52H 3EQLC 3O13A 3K7AB 3C2PA 2Z6KC 1R4PB 1MD2D 1MSGA 5C3EB 4LFCQ 4IOAA 1A8VA 2YU9B 4KI0A 2SNSA 5M5YH 3H3VH 4R9WA 4J6HA 5ELEA 1F9RA 1A3VA 2JYOA 1AZQA 3FEWX 3ER0A 1LT6D 3CKIB 1V1QA 1K8AC 3FPUB 1I4XA 3DMUA 3MC0B 3HS0C 2N49A 1SE3A 4X64L 5CC4A 5ELBA 1KXLA 4ZCKA 1EYAA 4JI8L 2PW5A 1RODA 4DUZL 2WKDA 5AJ3L 4OWTB 1HQRD 1MIUA 1CFMA 5LMNW 4IPCA 2I5HA 1GKHA 2ZTEA 1O80A 1TWGB 1S3OA 2R61A 4EGVA 3HOVB 4UP8A 4GNXB 1X54A 3H91A 4PNYA 4DV3L 2B8GA 3MAQA 2F1MA 2KUMA 4EVOA 1PH4A 1EY5A 3H0GB 3RD4A 1F77A 4XT1B 2A73B 1S5FD 2B2TA 1W3SA 1BKBA 4QGUA 1EU4A 1FYCA 2IT1A 2BH8A 3MVVA 4H44C 3CCUA 2L1BA 3LWUA 3CCSA 1AE2A 2VXWA 2L55A 3AYHB 1SYGA 1SN8A 4ZKBB 5IGGA 5FLXL 4IUTA 3Q0AA 1N32L 1J8IA 2KHIA 2ENBA 1EYDA 1I4QA 1DOKA 4HIKA 3S1QH 3ZYYX 5GAHC 5FLXc 2JA8H 3P1HA 1T5EA 1N34Q 2A19A 2XRQD 5IGFA 2VUMH 1XNQQ 1GUSA 3D4WA 1Y14B 1EOTA 1SEBD 1EL0A 3NE5B 1N36L 1YJ9A 1HZAA 3GV3A 1UEBA 5IT9L 1SFOH 4BY1H 2EVBA 2WKCA 3N6RA 4BBSB 3L7ZC 3SK5A 4C3JG 5IT9c 1PA6A 3HP3A 1CKMA 4AYBG 2E5LL 1HFNA 5IYCG 2NVQH 3I90A 2I07B 4A3DG 4RCOA 4GNXA 4A93B 2C5CA 4NPSA 4YCWA 5EJWA 4P74A 2KBNA 5GADC 4QQBX 1G6ZA 5IGDA 3SEBA 1X32A 1TWFB 4G7ZC 3QOLA 2QA4A 1GXDC 2PPBC 1ESFA 4RCNA 1GUTA 4KKTA 2R93B 4A3BG 2F4VQ 4LAAA 4F8MA 1WCMH 2E2HH 1Q8IA 2CWAA 4DV4Q 4OX9Q 4LF7Q 3OOCA 2G9HD 4PQXA 3NENA 3KF8B 2F3VA 5IODA 2F0HA 1E7ZA 1AFPA 2CH4W 1C4QA 1EEFD 1SMYC 3C1EA 4JI3L 4I65A 2JA6B 1V1OA 4A3FH 2Q2HA 5KNBA 2X69A 2B63G 1EIHA 1VMPA 1BUVT 1K8MA 4L63B 4DR1L 1M1KC 2MGSA 1HH2P 3NTHA 4A3JB 4LF9L 3MFGA 2K28A 4A3LH 4YWKA 2EY6A 3S17B 2A1AA 2K5VA 3RN2A 3U4ZA 1WFQA 2F52A 2MP1A 4UP7A 2EDGA 2ZXRA 1DOLA 1BDOA 3KUPA 3NWSA 4RAUC 5HY6A 2AMCB 4K2KA 1GUGA 3J81j 3LWEA 1XTCD 1KLUD 5EBCA 1MBYA 1NJIC 3K0YA 5M3FB 4JI7L 2JA7H 2E8GA 5EKKA 3RLOA 1A0IA 4X3UA 1LTBD 3K7UC 1KHIA 2H1EA 5CBAE 1Q8KA 4HJ5A 1LTGD 4NW2A 2LXKA 4IUPA 2QGQA 1I3QH 4DV1Q 4QF4A 5DNFA 1TWCB 1I6HH 3RN5A 2A8VA 1LUZA 1AN8A 1JICA 1I50H 3ITPA 1Q1EA 4HCSA 1UE5A 1Y1WG 3FKIH 1AH9A 2A6HC 2A6HD 3IAYA 4OIJA 2Z8LA 2EJGC 4B3SL 2F0SA 1S5CD 3VR3A 3A7LA 4HSVA 4EX5A 1Z9FA 2MPMA 1II3A 3CW2C 5JVG3 2Y0SB 5E4XA 5C4ZA 4K5VA 1UWVA 5G3LD 1EWIA 5G3LF 5C5MA 1HNXL 3H3VC 4L8JA 2AHOB 3HGBA 3K80C 4GKKQ 2C35B 2CFMA 4ZLTF 3OW7A 2PO4A 4CDCC 4BY7B 4YHHQ 1SNCA 1XPRA 1IW7D 3HOVH 2Z1CA 3TQYA 1HZ9A 3CMEA 1QG7A 1EWHA 5GAGC 3IFDA 4DV2L 4RGMA 4IO9A 4ULLA 4QIWB 5JJIA 3U9SA 4A3IG 4DV5Q 2Z4HA 3A5UA 1EY7A 4H7BA 3GTKB 4CJ0B 3E5SA 5LL6S 4B3RQ 4K8IA 4EQ5A 2R7DA 1BO0A 5I6YA 2QEJC 1J5EQ 3I4MB 5FLXE 4ME5A 2R7FA 3STBC 2OEOA 3ERSX 5HGQA 4BXXH 3V2TA 1VQLA 2HDLA 2XWBB 1N33Q 1WYDA 4LF6L 4UPAA 4R4CA 2KHSA 1E22A 2RVLA 1BQQT 4X65Q 4FYDA 4DAYA 1VQKA 1O7YA 4HAEA 4DR7L 1D5MC 1RJTA 3GTMB 3RLFA 4JI4L 4R4IA 2XN9C 2A74C 3K5OA 2TSSA 4DR4L 2ZTCA 4K2LA 4BBRH 5IT9E 3A55A 1RDPD 4JI6Q 2QDBA 1SE8A 4RMFA 3A0JA 3S2HB 1X6OA 2ZXPA 1B44D 3PV0A 4JYAQ 3FRPB 4NDXA 1JE5A 5C44B 3F2DA 4X3KA 3PIP3 4A93H 1EUJA 4FNFA 2DY8A 2FHTA 3J7YW 1EIFA 4JI0Q 2OXPA 1F9PA 2B2YC 4KK7A 1KRTA 3VR5A 4K5WA 4XQJA 1NBWA 1TWFH 2R92G 1MI2A 2CVRA 4A4IA 2WAQE 4NB3A 4LFAQ 2F0JA 2R93H 2K5HA 1YHBA 5CV9A 3R2TA 1EZ6A 1OTCA 1CSQA 5KNDA 4L5SA 2NTSA 1KNAA 1PH8A 3V05A 1K28A 4WFN3 4OO1I 1PYWD 1VF5C 1SJHD 4B3TL 1SNPA 3FHWA 4DR2L 3KYHC 1NMFA 2L9HA 3L9AX 4A3DB 3CHBD 4DUYQ 3VYRA 1P8LA 4JOIA 3Q6SA 4E6IA 5IY0A 2K33A 1EU3A 3J80i 1BBUA 2ICIA 4X66Q 1CK1A 5CORA 2ASBA 3I4NG 2UXDQ 4FXDA 2Z6BA 1TS2A 3I4LA 4A3BB 4LFBL 5J1ZA 2NVYB 1GHKA 1PH5A 2ZM6L 3S17H 1VQCA 2D5DA 1FVIA 2K75A 3CQZB 4DR3Q 5DAUA 1JE4A 3R3OA 1I94Q 5J22A 2F0KA 1CTMA 2XRSD 4TVAB 1K3RA 1ZYRC 1ZYRD 1PH7A 5C3EG 5EBDA 1LLRD 4IALA 1C0AA 2DUDA 5CYUA 3TP8A 1NR4A 1STBA 1TWAB 2B3GA 2OQ0A 2B63B 3W3AA 2Q2IA 1TT2A 1JR0D 3A8JE 3BYYB 3K81C 1XNRL 1FNUA 1FJGL 4FF3A 4B9XA 3E3XA 1IYUA 1LTRD 2B2TC 2L5TA 4A76A 1ILQA 2GVBA 1HTLD 2UU9L 1S5BD 3S9WA 3D8GA 1BCPC 2YTVA 1AZPA 2NVXH 4KHPQ 3GTQH 4X62L 4OO1G 3QR8A 3QJYA 4FP5D 1XMOL 2YTYA 3KLWA 3GTGH 3S1MH 1C9OA 5FJ8G 2O5IC 3J80L 1A15A 4K5XA 3M7NA 1RTOA 3G6EA 3JC66 1VQ7A 1CSPA 1ENAA 1RHPA 1D1KA 3NBIA 1LTID 2N55A 3AU7A 3J80c 3K5NA 1V1PB 2PW7A 4NMZA 5JVH3 2F0LA 1QILA 1Q46A 1EFWA 4DNRB 2BA0A 1JJCB 4LUZA 1A2UA 2F0QA 4LF8L 2N8NA 1L0WA 4LNQA 3WWVA 4IUUA 4B3ML 3GTKH 4RA8A 3Q8DA 2N88A 4NXML 1HR0Q 1TXYA 4AQYQ 4A3GG 4GNXC 2CHBD 2EY1A 3PGZA 1KRSA 5CV4A 2LY7A 1SYDA 2F0FA 1WTRA 3SE0A 4JI5Q 2OCEA 1CI3M 2MQHA 2DGYA 3V96A 5C6AA 5ISRA 1SRUA 2QILA 4BS9A 3KF6B 1K83B 4A3IB 4JPBW 4BBSG 4AH6A 4LF4Q 1EFID 1EY8A 1WTHA 3HRZC 2FMMA 3S1RB 2AWNA 4LJZC 2DJFC 4NXNQ 3NTKA 5BN5A 3M4OB 1KABA 5HGTA 2VQEL 1EEID 4GLAC 2EZVA 4LF5L 2UXCL 3J7AV 5D3IB 1V1PA 1OO9B 3CAMA 2FMCA 4HJ8A 4JCVE 2GN5A 3X3NA 2RDHA 4DNTB 3G4SA 4JBWA 1JWUD 1BNZA 1B70B 2WB1B 3L2PA 3SXHA 1AP0A 4DK3C 1SYFA 5KGUA 4RKBA 1HZBA 3GTJB 2F0NA 3HOZB 2NYZD 3TRZA 3S14B 1ESRA 2R6GA 4C56C 2A69C 2JA6G 3PUYA 2D2CC 4GKJQ 1G2SA 1Y69U 5JEAG 5E7NA 1JB3A 2UUBQ 3EBEA 3PF4A 1KDCA 4C3JH 3F2BA 1HRJA 2LSSA 4A3JG 1X3GA 3JAML 5IYCH 1MHWC 4A3DH 3DHQA 3AEVA 1F9SA 5COYA 4KJOA 1JOOA 2AWOA 3CCVA 5CBEE 4DR5L 1PV4A 1Z7TA 2XSCA 3GP7A 4JBKA 1LTSD 1NCVA 3D0FA 5C4XH 4KHVA 3L0OA 3KK7A 3BZCA 4KKSA 4DF7A 1IL8A 3OTOQ 1L0YB 3OYYA 5M5XB 2LXJA 2OWOA 1HFGA 5M3FG 1YHQA 3WOEA 3KLSX 4RKLA 2I0QA 3I7FA 4S3SA 3E0JA 1NAPA 4V190 4GOPB 1XXGA 4HEDA 1G91A 4PMBA 1HUMA 2B29A 2AQ2B 3T1YQ 3K59A 2WB1E 4WRDA 5K36G 2B63H 1RKNA 1YEZA 4ZKCB 1JJGA 4IUQA 1R9TB 1YJWA 3HOUB 4DV7Q 4IURA 2IJ0A 4N9PA 2KEDA 1D8LA 5C4HA 2NUCA 5FO7B 4KN7C 1A6XA 2RSNA 1UE6A 1TU2B 2Y0SG 4TKOB 3MEHA 4QUFA 3GTOB 5KYIA 2QDLA 3SR1A 4IUNA 3RZOH 4R4OA 1ICWA 4BY7G 4WJWA 3G71A 1PXUA 3TN2A 5ELDA 1WVLA 1B3AA 1VQ6A 5LMNQ 4HIDA 4PG3A 2JJQA 2MFIA 5EPKA 4IFDH 3I2ZA 2IW3A 2F0UA 1JMCA 1PYSB 1UE7A 4HR7B 1HNWQ 1LABA 5LL6X 1STAA 3D6CA 5IE8A 2F3WA 1UUPA 3I4MG 4IN3A 1Y1WH 4DU9A 4HMIA 1KDAA 4XYOA 1HZCA 3M4YA 1HNZQ 1F2LA 4GOPA 4YCUA 5CV7A 3RMHA 3M7GA 1VQEA 4JG2A 1LO5D 5GROA 4G7HC 3CRKC 4KD4A 1OXSC 2NBFA 4KN4C 2SNMA 1Q1BA 1U9RA 3FMCA 3GTPB 3PO3G 1VQFA 5I2XA 4OX9L 4HTHA 4K0KL 4LF7L 4M8AA 2D0PA 1G51A 4KTAA 3FP9A 4I7ZC 4C2MB 4M1UB 2QEXA 3I3CA 3PMFA 3NWTA 2G5DA 3TBIB 1K3BC 1PTOB 1L0XB 4IFDJ 1N9WA 2EYOA 4C3HG 5C44G 1Y1VH 3DWAA 1K0RA 2AQ3B 3BVZA 2UUCQ 2AUKA 2A6EC 3OWEB 4IPHA 5IYDG 4A3GB 4DR6Q 2O2LD 5EKLA 3PIPA 2WACA 1H9SB 3TREA 1CKNB 1T9HA 2H5XA 1NMGA 4JOIC 1IBLQ 1UAPA 4OL7A 2EYHA 5EPLA 3BS1A 1S40A 4GS3A 2F3IA 2PZTA 2NVTB 4KY7A 2ZJRA 2HUGA 1F9QA 3QB3A 3CP0A 2XNAC 4GLXA 3CD6A 2TMPA 2BCOA 4KHZA 4EQPA 3DUZA 2L11A 1SYBA 3MXGA 1SNQA 1GVPA 3VYTA 1PH2A 3K0XA 2IY5B 2E75C 3PO2G 1L1OB 3AMUA 3EA6A 4Y7NB 1CM9A 3CXCA 1CA6A 2ES2A 4ODGA 3E9HA 3H6MA 4CKEA 2NN6I 4DV6Q 1WJJA 4ZAIA 4P73A 3EJIA 3TP6A 4DGZA 2Z9HA 4JI8Q 2VQFL 4DUZQ 2ID0A 3CCMA 1HUNA 5AJ3Q 3SVMA 1T5XD 1MJCA 2R92H 1QNUA 3LNNA 5ELNA 1TR5A 3GTLB 2Z4IA 4O1NA 1SMYD 4EQNA 1EYCA 4A3MB 5M5XH 2MNAA 3TDQA 4PZ8A 1R4QB 1STEA 1IBML 2KOLA 2YYZA 1S5ED 3A56A 3PQIA 5M3MB 1TS3A 3KLRA 3K57A 5AFWA 2EPBA 3BJUA 1DONA 2PNRC 5EKIA 2R3ZA 2K7VA 5H1SE 4DV5L 1B9MA 5EGTA 2BA1A 3OIPA 3NK9A 2EJMA 3I4NH 1N32Q 2QCPX 1OXTA 2UXBL 1NTGA 4HIMA 1DOMA 1Q90A 1TIID 3TMEA 2LMCB 2ALYB 1YNNC 1YNND 2V4DA 1MGSA 3ULPA 2IPKD 3K7AH 1CT1D 1WOCA 1KLGD 2FXQA 1DZ1A 5C3EH 2EY2A 1M90C 2C9OA 3B6YA 3PF5A 3D6WA 2YU9H 4A75A 3W1GA 2R7ZB 2KCCA 4XIGS 4U673 4GZYC 3ULJA 4POFA 1B4OA 2WFWA 2BH2A 4N8X1 3KOJA 3DWPA 3CC7A 4DXFA 2NN6G 5CV8A 1BF4A 1TS4A 4IJLA 2CH4A 1KC8C 3NQTA 3KF8A 5J3BA 1X9NA 1KIXA 2E5LQ 3M3YB 3NBHB 5M9OA 4WJ4A 1D7QA 1BOSA 4HN7A 4JYAL 2EYPA 1PH6A 5I9PA 3VR2A 2BDNA 1CZWA 2QKIC 4QUCA 2IWHA 1TWGH 3MXNB 3HOXB 3VYUA 1QE6A 3OIQA 2XGTA 4MHEA 2EYFA 4A3KB 4RWSC 1GUWA 4DV0Q 5EAYA 1Q81C 1STNA 5I2YA 1ENCA 1E2VA 1IKMA 3H0GH 2WIIB 2KECA 1W2BA 3I70A 1QB5D 1U5KA 3RUZA 5BR8L 5JJZA 1XMQL 5NUCA 2WAQB 4JI3Q 2ZJQA 1MKHA 3UDXA 3PUZA 4CKBA 3KDFB 1EQVA 1GM5A 2XVSA 2K5QA 3HZXA 5IP9G 4DR1Q 2OT2A 1QCBD 4FF2A 3STBD 4CJ1B 4F87A 3GQBA 4OHJA 1JWSD 4BA1I 1H9RA 2F4IA 5ELOA 3F8TA 4X66L 4ID6A 4A3GH 2OTJA 3PUXA 3M4PA 2WB1G 3U4VA 1VQ5A 3S1NB 2ZJPA 1ONLA 3QWNA 2JA8G 3PO3B 3H94A 4FVMA 2DN8A 1G2TA 3HKZE 4R1JA 1ZXTA 2VUMG 2D9UA 1I94L 1E1TA 4JV5L 4PZ6A 4KV6A 2O5JC 3HOZG 2CQAA 2NVTH 2G9DA 1Q3LA 4JI7Q 2KJXA
chains in the Genus database with same CATH topology
3AQQA 1VQAA 2N8NA 1L0WA 4YHHL 3PIOA 3S16H 1CKNA 5C0XJ 4LNQA 1IZ6A 4J15A 4BBSH 3EN2A 1VQPA 1NY4A 4MZ9A 4WJ3M 3WWVA 1EIYB 4B3ML 4R4QA 4X6AH 4AIMA 4O2DA 3GTKH 4Y52H 1DGSA 1PFSA 3Q8DA 4NXML 1HR0Q 4K0KQ 1TXYA 4AQYQ 4A3GG 3CCRA 4DV0L 1X3EA 2Z6KC 4GNXC 3PGZA 1KRSA 4RG1A 3J7A5 4LFCQ 4IOAA 1VS0A 1A8VA 2D0OA 1PVOA 4KI0A 3ULLA 4A3EG 1E24A 2OQKA 3HOYG 4JI5Q 1R9TH 1XPUA 2OCEA 5M5YH 3HOUH 4B3RL 3H3VH 2MQHA 2DGYA 4LWCA 5GQOA 3AFQA 1LTLA 1EQQA 1SRUA 4YCVA 1PH9A 1J5EL 2GVAA 1IBKQ 2RHQB 3ER0A 4H02A 3KFUA 1HNXQ 1V1QA 3PUVA 1K8AC 1ASZA 3KF6B 1L1OA 3GTOH 4BBSG 4AH6A 2N49A 2JE6I 4X64L 2UUAL 4LF4Q 1N33L 2HT1A 1EQRA 1KD1C 1G291 2AWNA 2JQOA 2NZHA 1YBYA 3A5ZB 3CPFA 3MEFA 4ME3A 4JI8L 3UE1A 4YY3L 4DUZL 4NXNQ 1N36Q 2JA6H 4X65L 2HIXA 5AJ3L 4IPGA 2WP8J 4OWTB 1MIUA 2VQEL 5LMNW 4IPCA 4UY8C 2I5HA 4GLAC 1GKHA 4DNIA 4LF5L 2UXCL 2ZTEA 3CMAA 4IOCA 1YVCA 1S3OA 2VNUD 4ALPA 3CAMA 4UP8A 4GNXB 3HOUG 1X54A 4HJ8A 3F1ZA 4JCVE 4A3JH 2GN5A 4JI2L 2VY3A 4DV3L 4JI6L 3G4SA 4JBWA 1U0LA 4IFDG 1SLJA 1B70B 3L2PA 1PH4A 3U50C 1J6QA 1O7IA 4DK3C 1UE1A 1W3SA 1BKBA 2K5NA 2RF4A 2XTIA 3D31A 4QGUA 4HIOA 1HZBA 2IT1A 2BH8A 1VQ9A 3CCUA 3TRZA 4QL5A 4JI0L 4OONA 4LF6Q 2R6GA 1SR3A 3KJOA 3CCSA 1AE2A 4DAYB 2JA6G 4GOPC 3PUYA 3AYHB 4GKJQ 2VQFQ 1SN8A 5JEAG 3CC4A 5E7NA 3TS2A 5FJ8H 2UUBQ 5JJLA 5M3FH 3EBEA 3PF4A 4C3JH 4YWLA 3F2BA 1K9MC 1N32L 1XPOA 4LFAL 2KHIA 2LSSA 1NE3A 1Q86C 3S1QH 4DR7Q 4A3JG 4HIKA 1X3GA 5IYCH 3GTPH 5GAHC 2I5LX 5FLXc 1IBKL 2JA7G 1N34Q 2JA8H 3AEVA 4A3DH 4DR4Q 1VQGA 2A19A 4DK6C 3CC2A 2AWOA 3CCVA 4DR5L 1PV4A 1PHJA 1K8GA 2VUMH 3S24A 1XNQQ 1TWCH 4JBKA 2VS1A 1Y14B 4C2MH 3E0EA 1VQDA 3D0FA 1VQ8A 5C4XH 1IXRA 3EIVA 3W1BA 3L0OA 1IBMQ 2K14A 3NEMA 3DLLA 2Q2UA 4DUYL 3BZCA 1N36L 1YJ9A 4LF9Q 3ICEA 3ZJYC 1A63A 1KL9A 1HZAA 1UEBA 1JT8A 3OTOQ 3OYYA 4HJAA 2HHHL 1SFOH 4BY1H 2LXJA 3HKSA 2OWOA 1V43A 1GO3E 5M3FG 3UDIA 1YHQA 3L7ZC 1PH1A 2UXDL 2I0QA 3I7FA 5IT9c 1PA6A 1Y1VG 1CKMA 4AYBG 2E5LL 4OXPA 5IYCG 4GOPB 2Z6KA 2NVQH 4A3DG 4GNXA 4BY7H 4NPSA 2B29A 1WI5A 4YCWA 3CPWA 1JB7A 3T1YQ 2WB1E 4P74A 2KBNA 4AYBE 5GADC 4DR3L 2IHFA 1VQOA 4QQBX 2UXBQ 5K36G 1KXLA 2B63H 2PI2E 1YEZA 2D62A 1IL2A 1JJGA 1G6PA 2CQOA 2QA4A 1YJWA 3U58A 4DV7Q 1K73C 4B3TQ 4A3BG 1D8LA 2F4VQ 1WCMH 2E2HH 3GD7A 4BY1G 2CWAA 1I5FA 3PCOB 1UE6A 1VQJA 4DV4Q 4LF7Q 2Y0SG 1Q7YC 4OX9Q 3NENA 3KF8B 3I4MH 1Z47A 1E7ZA 2PQAB 1VQ4A 2HQLA 1C7YA 2Y0SE 3RZOH 4R4OA 1PYBA 4PMWA 4Y7NH 3M9BA 5DLQE 1KQSA 2CKZB 2CWPA 4BY7G 4APVA 4JI3L 2MO0A 3G71A 4B3SQ 4LFBQ 1AE3A 4A3FH 2EXDA 1VCIA 4QY7A 2Q2HA 2ZM6Q 1OXXK 2B63G 2YTXA 5C4JH 1VQ6A 3JAMi 3I55A 5LMNQ 4KHPL 2RCNA 4HIDA 4PG3A 2JJQA 4DR1L 2MFIA 2ATWA 5LMUL 1M1KC 1YZ6A 3KDFA 3S1NH 1HH2P 4LF9L 3I2ZA 3PO3H 2VZAA 3TEHB 2JA9A 1JMCA 4A3LH 1PYSB 4YWKA 1UE7A 3GTMH 1WCMG 3RR5A 4GLVB 4QIWE 2A1AA 2K5VA 3GDEA 3RN2A 4L5QA 1WFQA 3U4ZA 3GTLH 1HNWQ 2F52A 4UP7A 3CCEA 1N8RC 5IE8A 1GD7A 1S72A 3I4MG 3SGIA 1Y1WH 4A3MH 4DV2Q 1XNRQ 2IX1A 1HZCA 1FJGQ 3S2HH 5HY6A 1HNZQ 2AMCB 4GOPA 4YCUA 1RIPA 3J81j 4A3FG 1X55A 5C44H 1VQEA 4JG2A 1FGUA 5M3MH 5BR8Q 4DKAC 1XMQQ 1NJIC 5GROA 4L5RC 2UU9Q 1VQNA 5IYDH 4JI7L 1L2FA 2JA7H 4DV7L 1OXSC 2RHSB 2E8GA 1XJVA 4MNOA 1Q1BA 3RLOA 4KLKA 1A0IA 1QUQB 3PO3G 3K7UC 1KHIA 4A3LG 4HJ5A 1Q8KA 1VQFA 5M5WH 3F2CA 4OX9L 2LXKA 2QGQA 1I3QH 2KCMA 3UE0A 1VQHA 2Z0SA 2PMZE 4DV1Q 2D0PA 4AQYL 1YJNA 1HR0L 1G51A 1I6HH 3FP9A 3RN5A 4GN3B 2EQSA 1LUZA 2A8VA 1I50H 4LFCL 2V1CC 1Q1EA 3RLNA 4QJFA 1UE5A 2QEXA 4O0AA 4A3MG 3FKIH 3PSIA 1Y1WG 1MJEA 4K0KL 3CF5A 1AH9A 4YWMA 2IX0A 1SMXA 3CCQA 4B3SL 4JI5L 3BZKA 4IFDJ 4EX5A 1N9WA 1Z9FA 3CW2C 5C44G 1Y1VH 5M3MG 4JI4Q 1K0RA 4JV5Q 2UUCQ 2K52A 4IPHA 5IYDG 1UWVA 4DPGA 4DR6Q 1EWIA 2R7ZH 1HNXL 3PIPA 3TREA 1CKNB 1T9HA 2AHOB 1NMGA 2H5XA 4JOIC 3K80C 3JAMc 1IBLQ 4GKKQ 2C35B 2CFMA 2AKWB 1Q12A 1QVFA 4LF4L 4YHHQ 1XPRA 2MO1A 3KF6A 1S40A 3HOVH 4DAMA 3TQYA 4R4TA 1HZ9A 4GS3A 2F3IA 3J81i 4B3MQ 1IYJB 2YV5A 4NXNL 3CMEA 1ASYA 2JEBI 5JEAJ 3M3YH 2VL6A 5GAGC 1H95A 3TS0A 4A3BH 2NVYH 4DV2L 2ZJRA 4IO9A 2HIVA 5IP7H 3FKIG 1YIJA 5JJIA 3CQZH 3CP0A 1BVSA 4L5TA 4GLXA 4A3IG 1HNZL 3CD6A 4P75A 4DV5Q 1YITA 3A5UA 3W5OA 3K8AA 1FL0A 4KHZA 1LYLA 1OXUA 4B3RQ 4TQUS 1LM0A 1GVPA 1PH2A 4EQ5A 2R7DA 3A74A 3K0XA 2IY5B 2R7ZG 1J5EQ 1TWAH 3HOXH 1OXVA 1P16A 3PO2G 1L1OB 4MTNA 2R7FA 3STBC 4A3KH 3ERSX 3I4OA 5HGQA 4BXXH 4A3CH 3CXCA 2ES2A 4IPDA 1VQLA 2PI2A 4LF7L 3HOVG 3E9HA 2UUAQ 1N33Q 2NN6I 1WYDA 4LF6L 4DR2Q 4UPAA 1CUKA 1WJJA 2VW9A 4DV6Q 4P73A 4R4CA 1E3PA 1PH3A 3AFPA 4YY3Q 4JI8Q 2VQFL 4DUZQ 1E22A 2ID0A 3HKZG 5IP7G 3CCMA 2CCZA 3E9IA 4X65Q 3H0GG 5AJ3Q 1QZGA 1VQIA 2UUBL 2VQEQ 1VQKA 1BBWA 1X56A 2ZTDA 3IRBA 1MJCA 2R92H 1V9PA 5ELNA 3RNUA 4LF5Q 4DR7L 4GN5A 3RLFA 4JI4L 4R4IA 3G48A 2N3SA 1N34L 4DR4L 2ZTCA 4BBRH 3I56A 2IHEA 1IBLL 4JI2Q 5FLMH 4P71A 3HOXG 4JI6Q 1XNQL 1SE8A 4RMFA 5M5XH 4LUOA 2MNAA 2Q2TA 1X65A 2PNHA 4PZ8A 3H15A 1SROA 3A0JA 4OWXB 1RL2A 4POGA 1X6OA 1XTDA 3PV0A 4A3KG 1IBML 4BXXG 4A3CG 4JYAQ 2YYZA 4HJ7A 1JE5A 4LW1A 1YI2A 3F2DA 2N78A 4PZ7A 4A93H 3T1HQ 1EUJA 1VQBA 3OTOL 3J81c 4OWWB 3BJUA 1VQMA 1EIFA 4JI0Q 1YHAA 2WAQG 1KRTA 5H1SE 4DV5L 1NBWA 1TWFH 2BA1A 4JBMA 2R92G 3S2DH 4A4IA 2JEAI 2WAQE 3I4NH 1N32Q 2JK8A 1EOVA 4NB3A 4LFAQ 3PUWA 1EYGA 2R93H 1OXTA 4BBRG 2K5HA 1YHBA 3T1YL 1OTCA 4L5SA 5FLMG 1CSQA 2UXBL 1PH8A 4OO1I 1NTGA 4HIMA 1HR0W 4JI1Q 4C3HH 2ALYB 4DR5Q 3M4QA 3ULPA 3K7AH 1TWHH 1WOCA 2FXQA 4FDBA 4B3TL 5C0XI 3FHWA 5C3EH 1M90C 4DR2L 3KYHC 4C3IH 4DV6L 1NMFA 4UP9A 3B6YA 1A62A 2K4KA 3PF5A 4A93G 2YU9H 2F4VL 1E1OA 4X62Q 4DUYQ 1P8LA 3W1GA 4A75A 4JOIA 1QZHA 4XTCS 4DV4L 4XIGS 5IY0A 3S15H 3ULJA 1XMOQ 2HHHQ 4POFA 2WFWA 2BH2A 3J80i 1BBUA 3KOJA 1HJPA 4X66Q 3CC7A 2NN6G 2ASBA 3I4NG 3OW2A 3HOWH 2UXDQ 3NELA 4IJLA 1KC8C 1K83H 2EIFA 5J3BA 1X9NA 1KIXA 4A3IH 3NBHB 2E5LQ 2PQAA 2R93G 4WJ4A 4LFBL 1D7QA 1L1OC 1PH5A 2ZM6L 1QVCA 3S17H 1VQCA 1FVIA 2K75A 5LMNL 4DR3Q 2JA5H 3GO5A 4JYAL 3S1RH 1I94Q 2OTLA 2E2JH 5IWAQ 1PH6A 4TVAB 1K3RA 5IYBH 5IP9H 3J7ZC 1PH7A 3M4OH 5C3EG 3T1HL 3PO2H 1C0AA 1B8AA 2DUDA 5JJKA 4LF8Q 1TWGH 4HJ9A 3MXNB 1HNWL 2B3GA 2OQ0A 2XGTA 4BA2I 1JJ2A 2Q2IA 3LGJA 4LUVA 4NXMQ 1YNXA 3DM3A 3K81C 4GKJL 1XNRL 2KHJA 5EAYA 4DV0Q 3UDFA 3HOWG 1Q81C 2L15A 3CCJA 3H0GH 1FJGL 4IJHA 1W2BA 3RZDH 2NZOA 3UDGA 3BU2A 4A76A 4JI1L 1B7YB 1U5KA 5BR8L 2GVBA 3GTJH 1XMQL 4JI3Q 2UU9L 2JA5G 4JC0A 1MKHA 3UDXA 2ZJQA 3PUZA 3HOZH 3M85A 3KDFB 1GM5A 3S14H 3CCLA 2YTVA 2NVXH 4KHPQ 5IYBG 5IP9G 4DR1Q 4GN4B 5LMUQ 3GTQH 4X62L 2E2IH 4OO1G 3VDYA 1Q82C 3STBD 1QUQA 4DV1L 2KCTA 1KAWA 4P72A 4BA1I 1XMOL 2YTYA 4X64Q 3KLWA 3GTGH 5ELOA 3S1MH 1C9OA 3F8TA 4X66L 5FJ8G 2I5MX 5C0XG 2OTJA 4A3GH 3PUXA 3H3VI 3M7NA 3M4PA 1CKOA 3G6EA 2WB1G 3JC66 3U4VA 5GAEC 1VQ5A 2ZJPA 1VQ7A 1CSPA 3J80c 2JA8G 4IFDI 3KJPA 2K50A 4A3EH 2UXCQ 4JBJA 2KENA 3HKZE 4R1JA 3HOYH 2VUMG 1I94L 2UUCL 1E1TA 4JV5L 4PZ6A 1X3FA 5IWAL 3HOZG 4DR6L 2NVTH 1Q46A 3HFZB 1EFWA 5C4XG 2BA0A 4JI7Q 1QVGA 4GKKL 4DV3Q 1JJCB 4LUZA 4LF8L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AQQ A;  1VQA A;  2N8N A;  1L0W A;  4YHH L;  3PIO A;  3S16 H;  1CKN A;  5C0X J;  4LNQ A;  1IZ6 A;  4J15 A;  4BBS H;  3EN2 A;  1VQP A;  1NY4 A;  4MZ9 A;  4WJ3 M;  3WWV A;  1EIY B;  4B3M L;  4R4Q A;  4X6A H;  4AIM A;  4O2D A;  3GTK H;  4Y52 H;  1DGS A;  1PFS A;  3Q8D A;  4NXM L;  1HR0 Q;  4K0K Q;  1TXY A;  4AQY Q;  4A3G G;  3CCR A;  4DV0 L;  1X3E A;  2Z6K C;  4GNX C;  3PGZ A;  1KRS A;  4RG1 A;  3J7A 5;  4LFC Q;  4IOA A;  1VS0 A;  1A8V A;  2D0O A;  1PVO A;  4KI0 A;  3ULL A;  4A3E G;  1E24 A;  2OQK A;  3HOY G;  4JI5 Q;  1R9T H;  1XPU A;  2OCE A;  5M5Y H;  3HOU H;  4B3R L;  3H3V H;  2MQH A;  2DGY A;  4LWC A;  5GQO A;  3AFQ A;  1LTL A;  1EQQ A;  1SRU A;  4YCV A;  1PH9 A;  1J5E L;  2GVA A;  1IBK Q;  2RHQ B;  3ER0 A;  4H02 A;  3KFU A;  1HNX Q;  1V1Q A;  3PUV A;  1K8A C;  1ASZ A;  3KF6 B;  1L1O A;  3GTO H;  4BBS G;  4AH6 A;  2N49 A;  2JE6 I;  4X64 L;  2UUA L;  4LF4 Q;  1N33 L;  2HT1 A;  1EQR A;  1KD1 C;  1G29 1;  2AWN A;  2JQO A;  2NZH A;  1YBY A;  3A5Z B;  3CPF A;  3MEF A;  4ME3 A;  4JI8 L;  3UE1 A;  4YY3 L;  4DUZ L;  4NXN Q;  1N36 Q;  2JA6 H;  4X65 L;  2HIX A;  5AJ3 L;  4IPG A;  2WP8 J;  4OWT B;  1MIU A;  2VQE L;  5LMN W;  4IPC A;  4UY8 C;  2I5H A;  4GLA C;  1GKH A;  4DNI A;  4LF5 L;  2UXC L;  2ZTE A;  3CMA A;  4IOC A;  1YVC A;  1S3O A;  2VNU D;  4ALP A;  3CAM A;  4UP8 A;  4GNX B;  3HOU G;  1X54 A;  4HJ8 A;  3F1Z A;  4JCV E;  4A3J H;  2GN5 A;  4JI2 L;  2VY3 A;  4DV3 L;  4JI6 L;  3G4S A;  4JBW A;  1U0L A;  4IFD G;  1SLJ A;  1B70 B;  3L2P A;  1PH4 A;  3U50 C;  1J6Q A;  1O7I A;  4DK3 C;  1UE1 A;  1W3S A;  1BKB A;  2K5N A;  2RF4 A;  2XTI A;  3D31 A;  4QGU A;  4HIO A;  1HZB A;  2IT1 A;  2BH8 A;  1VQ9 A;  3CCU A;  3TRZ A;  4QL5 A;  4JI0 L;  4OON A;  4LF6 Q;  2R6G A;  1SR3 A;  3KJO A;  3CCS A;  1AE2 A;  4DAY B;  2JA6 G;  4GOP C;  3PUY A;  3AYH B;  4GKJ Q;  2VQF Q;  1SN8 A;  5JEA G;  3CC4 A;  5E7N A;  3TS2 A;  5FJ8 H;  2UUB Q;  5JJL A;  5M3F H;  3EBE A;  3PF4 A;  4C3J H;  4YWL A;  3F2B A;  1K9M C;  1N32 L;  1XPO A;  4LFA L;  2KHI A;  2LSS A;  1NE3 A;  1Q86 C;  3S1Q H;  4DR7 Q;  4A3J G;  4HIK A;  1X3G A;  5IYC H;  3GTP H;  5GAH C;  2I5L X;  5FLX c;  1IBK L;  2JA7 G;  1N34 Q;  2JA8 H;  3AEV A;  4A3D H;  4DR4 Q;  1VQG A;  2A19 A;  4DK6 C;  3CC2 A;  2AWO A;  3CCV A;  4DR5 L;  1PV4 A;  1PHJ A;  1K8G A;  2VUM H;  3S24 A;  1XNQ Q;  1TWC H;  4JBK A;  2VS1 A;  1Y14 B;  4C2M H;  3E0E A;  1VQD A;  3D0F A;  1VQ8 A;  5C4X H;  1IXR A;  3EIV A;  3W1B A;  3L0O A;  1IBM Q;  2K14 A;  3NEM A;  3DLL A;  2Q2U A;  4DUY L;  3BZC A;  1N36 L;  1YJ9 A;  4LF9 Q;  3ICE A;  3ZJY C;  1A63 A;  1KL9 A;  1HZA A;  1UEB A;  1JT8 A;  3OTO Q;  3OYY A;  4HJA A;  2HHH L;  1SFO H;  4BY1 H;  2LXJ A;  3HKS A;  2OWO A;  1V43 A;  1GO3 E;  5M3F G;  3UDI A;  1YHQ A;  3L7Z C;  1PH1 A;  2UXD L;  2I0Q A;  3I7F A;  5IT9 c;  1PA6 A;  1Y1V G;  1CKM A;  4AYB G;  2E5L L;  4OXP A;  5IYC G;  4GOP B;  2Z6K A;  2NVQ H;  4A3D G;  4GNX A;  4BY7 H;  4NPS A;  2B29 A;  1WI5 A;  4YCW A;  3CPW A;  1JB7 A;  3T1Y Q;  2WB1 E;  4P74 A;  2KBN A;  4AYB E;  5GAD C;  4DR3 L;  2IHF A;  1VQO A;  4QQB X;  2UXB Q;  5K36 G;  1KXL A;  2B63 H;  2PI2 E;  1YEZ A;  2D62 A;  1IL2 A;  1JJG A;  1G6P A;  2CQO A;  2QA4 A;  1YJW A;  3U58 A;  4DV7 Q;  1K73 C;  4B3T Q;  4A3B G;  1D8L A;  2F4V Q;  1WCM H;  2E2H H;  3GD7 A;  4BY1 G;  2CWA A;  1I5F A;  3PCO B;  1UE6 A;  1VQJ A;  4DV4 Q;  4LF7 Q;  2Y0S G;  1Q7Y C;  4OX9 Q;  3NEN A;  3KF8 B;  3I4M H;  1Z47 A;  1E7Z A;  2PQA B;  1VQ4 A;  2HQL A;  1C7Y A;  2Y0S E;  3RZO H;  4R4O A;  1PYB A;  4PMW A;  4Y7N H;  3M9B A;  5DLQ E;  1KQS A;  2CKZ B;  2CWP A;  4BY7 G;  4APV A;  4JI3 L;  2MO0 A;  3G71 A;  4B3S Q;  4LFB Q;  1AE3 A;  4A3F H;  2EXD A;  1VCI A;  4QY7 A;  2Q2H A;  2ZM6 Q;  1OXX K;  2B63 G;  2YTX A;  5C4J H;  1VQ6 A;  3JAM i;  3I55 A;  5LMN Q;  4KHP L;  2RCN A;  4HID A;  4PG3 A;  2JJQ A;  4DR1 L;  2MFI A;  2ATW A;  5LMU L;  1M1K C;  1YZ6 A;  3KDF A;  3S1N H;  1HH2 P;  4LF9 L;  3I2Z A;  3PO3 H;  2VZA A;  3TEH B;  2JA9 A;  1JMC A;  4A3L H;  1PYS B;  4YWK A;  1UE7 A;  3GTM H;  1WCM G;  3RR5 A;  4GLV B;  4QIW E;  2A1A A;  2K5V A;  3GDE A;  3RN2 A;  4L5Q A;  1WFQ A;  3U4Z A;  3GTL H;  1HNW Q;  2F52 A;  4UP7 A;  3CCE A;  1N8R C;  5IE8 A;  1GD7 A;  1S72 A;  3I4M G;  3SGI A;  1Y1W H;  4A3M H;  4DV2 Q;  1XNR Q;  2IX1 A;  1HZC A;  1FJG Q;  3S2H H;  5HY6 A;  1HNZ Q;  2AMC B;  4GOP A;  4YCU A;  1RIP A;  3J81 j;  4A3F G;  1X55 A;  5C44 H;  1VQE A;  4JG2 A;  1FGU A;  5M3M H;  5BR8 Q;  4DKA C;  1XMQ Q;  1NJI C;  5GRO A;  4L5R C;  2UU9 Q;  1VQN A;  5IYD H;  4JI7 L;  1L2F A;  2JA7 H;  4DV7 L;  1OXS C;  2RHS B;  2E8G A;  1XJV A;  4MNO A;  1Q1B A;  3RLO A;  4KLK A;  1A0I A;  1QUQ B;  3PO3 G;  3K7U C;  1KHI A;  4A3L G;  4HJ5 A;  1Q8K A;  1VQF A;  5M5W H;  3F2C A;  4OX9 L;  2LXK A;  2QGQ A;  1I3Q H;  2KCM A;  3UE0 A;  1VQH A;  2Z0S A;  2PMZ E;  4DV1 Q;  2D0P A;  4AQY L;  1YJN A;  1HR0 L;  1G51 A;  1I6H H;  3FP9 A;  3RN5 A;  4GN3 B;  2EQS A;  1LUZ A;  2A8V A;  1I50 H;  4LFC L;  2V1C C;  1Q1E A;  3RLN A;  4QJF A;  1UE5 A;  2QEX A;  4O0A A;  4A3M G;  3FKI H;  3PSI A;  1Y1W G;  1MJE A;  4K0K L;  3CF5 A;  1AH9 A;  4YWM A;  2IX0 A;  1SMX A;  3CCQ A;  4B3S L;  4JI5 L;  3BZK A;  4IFD J;  4EX5 A;  1N9W A;  1Z9F A;  3CW2 C;  5C44 G;  1Y1V H;  5M3M G;  4JI4 Q;  1K0R A;  4JV5 Q;  2UUC Q;  2K52 A;  4IPH A;  5IYD G;  1UWV A;  4DPG A;  4DR6 Q;  1EWI A;  2R7Z H;  1HNX L;  3PIP A;  3TRE A;  1CKN B;  1T9H A;  2AHO B;  1NMG A;  2H5X A;  4JOI C;  3K80 C;  3JAM c;  1IBL Q;  4GKK Q;  2C35 B;  2CFM A;  2AKW B;  1Q12 A;  1QVF A;  4LF4 L;  4YHH Q;  1XPR A;  2MO1 A;  3KF6 A;  1S40 A;  3HOV H;  4DAM A;  3TQY A;  4R4T A;  1HZ9 A;  4GS3 A;  2F3I A;  3J81 i;  4B3M Q;  1IYJ B;  2YV5 A;  4NXN L;  3CME A;  1ASY A;  2JEB I;  5JEA J;  3M3Y H;  2VL6 A;  5GAG C;  1H95 A;  3TS0 A;  4A3B H;  2NVY H;  4DV2 L;  2ZJR A;  4IO9 A;  2HIV A;  5IP7 H;  3FKI G;  1YIJ A;  5JJI A;  3CQZ H;  3CP0 A;  1BVS A;  4L5T A;  4GLX A;  4A3I G;  1HNZ L;  3CD6 A;  4P75 A;  4DV5 Q;  1YIT A;  3A5U A;  3W5O A;  3K8A A;  1FL0 A;  4KHZ A;  1LYL A;  1OXU A;  4B3R Q;  4TQU S;  1LM0 A;  1GVP A;  1PH2 A;  4EQ5 A;  2R7D A;  3A74 A;  3K0X A;  2IY5 B;  2R7Z G;  1J5E Q;  1TWA H;  3HOX H;  1OXV A;  1P16 A;  3PO2 G;  1L1O B;  4MTN A;  2R7F A;  3STB C;  4A3K H;  3ERS X;  3I4O A;  5HGQ A;  4BXX H;  4A3C H;  3CXC A;  2ES2 A;  4IPD A;  1VQL A;  2PI2 A;  4LF7 L;  3HOV G;  3E9H A;  2UUA Q;  1N33 Q;  2NN6 I;  1WYD A;  4LF6 L;  4DR2 Q;  4UPA A;  1CUK A;  1WJJ A;  2VW9 A;  4DV6 Q;  4P73 A;  4R4C A;  1E3P A;  1PH3 A;  3AFP A;  4YY3 Q;  4JI8 Q;  2VQF L;  4DUZ Q;  1E22 A;  2ID0 A;  3HKZ G;  5IP7 G;  3CCM A;  2CCZ A;  3E9I A;  4X65 Q;  3H0G G;  5AJ3 Q;  1QZG A;  1VQI A;  2UUB L;  2VQE Q;  1VQK A;  1BBW A;  1X56 A;  2ZTD A;  3IRB A;  1MJC A;  2R92 H;  1V9P A;  5ELN A;  3RNU A;  4LF5 Q;  4DR7 L;  4GN5 A;  3RLF A;  4JI4 L;  4R4I A;  3G48 A;  2N3S A;  1N34 L;  4DR4 L;  2ZTC A;  4BBR H;  3I56 A;  2IHE A;  1IBL L;  4JI2 Q;  5FLM H;  4P71 A;  3HOX G;  4JI6 Q;  1XNQ L;  1SE8 A;  4RMF A;  5M5X H;  4LUO A;  2MNA A;  2Q2T A;  1X65 A;  2PNH A;  4PZ8 A;  3H15 A;  1SRO A;  3A0J A;  4OWX B;  1RL2 A;  4POG A;  1X6O A;  1XTD A;  3PV0 A;  4A3K G;  1IBM L;  4BXX G;  4A3C G;  4JYA Q;  2YYZ A;  4HJ7 A;  1JE5 A;  4LW1 A;  1YI2 A;  3F2D A;  2N78 A;  4PZ7 A;  4A93 H;  3T1H Q;  1EUJ A;  1VQB A;  3OTO L;  3J81 c;  4OWW B;  3BJU A;  1VQM A;  1EIF A;  4JI0 Q;  1YHA A;  2WAQ G;  1KRT A;  5H1S E;  4DV5 L;  1NBW A;  1TWF H;  2BA1 A;  4JBM A;  2R92 G;  3S2D H;  4A4I A;  2JEA I;  2WAQ E;  3I4N H;  1N32 Q;  2JK8 A;  1EOV A;  4NB3 A;  4LFA Q;  3PUW A;  1EYG A;  2R93 H;  1OXT A;  4BBR G;  2K5H A;  1YHB A;  3T1Y L;  1OTC A;  4L5S A;  5FLM G;  1CSQ A;  2UXB L;  1PH8 A;  4OO1 I;  1NTG A;  4HIM A;  1HR0 W;  4JI1 Q;  4C3H H;  2ALY B;  4DR5 Q;  3M4Q A;  3ULP A;  3K7A H;  1TWH H;  1WOC A;  2FXQ A;  4FDB A;  4B3T L;  5C0X I;  3FHW A;  5C3E H;  1M90 C;  4DR2 L;  3KYH C;  4C3I H;  4DV6 L;  1NMF A;  4UP9 A;  3B6Y A;  1A62 A;  2K4K A;  3PF5 A;  4A93 G;  2YU9 H;  2F4V L;  1E1O A;  4X62 Q;  4DUY Q;  1P8L A;  3W1G A;  4A75 A;  4JOI A;  1QZH A;  4XTC S;  4DV4 L;  4XIG S;  5IY0 A;  3S15 H;  3ULJ A;  1XMO Q;  2HHH Q;  4POF A;  2WFW A;  2BH2 A;  3J80 i;  1BBU A;  3KOJ A;  1HJP A;  4X66 Q;  3CC7 A;  2NN6 G;  2ASB A;  3I4N G;  3OW2 A;  3HOW H;  2UXD Q;  3NEL A;  4IJL A;  1KC8 C;  1K83 H;  2EIF A;  5J3B A;  1X9N A;  1KIX A;  4A3I H;  3NBH B;  2E5L Q;  2PQA A;  2R93 G;  4WJ4 A;  4LFB L;  1D7Q A;  1L1O C;  1PH5 A;  2ZM6 L;  1QVC A;  3S17 H;  1VQC A;  1FVI A;  2K75 A;  5LMN L;  4DR3 Q;  2JA5 H;  3GO5 A;  4JYA L;  3S1R H;  1I94 Q;  2OTL A;  2E2J H;  5IWA Q;  1PH6 A;  4TVA B;  1K3R A;  5IYB H;  5IP9 H;  3J7Z C;  1PH7 A;  3M4O H;  5C3E G;  3T1H L;  3PO2 H;  1C0A A;  1B8A A;  2DUD A;  5JJK A;  4LF8 Q;  1TWG H;  4HJ9 A;  3MXN B;  1HNW L;  2B3G A;  2OQ0 A;  2XGT A;  4BA2 I;  1JJ2 A;  2Q2I A;  3LGJ A;  4LUV A;  4NXM Q;  1YNX A;  3DM3 A;  3K81 C;  4GKJ L;  1XNR L;  2KHJ A;  5EAY A;  4DV0 Q;  3UDF A;  3HOW G;  1Q81 C;  2L15 A;  3CCJ A;  3H0G H;  1FJG L;  4IJH A;  1W2B A;  3RZD H;  2NZO A;  3UDG A;  3BU2 A;  4A76 A;  4JI1 L;  1B7Y B;  1U5K A;  5BR8 L;  2GVB A;  3GTJ H;  1XMQ L;  4JI3 Q;  2UU9 L;  2JA5 G;  4JC0 A;  1MKH A;  3UDX A;  2ZJQ A;  3PUZ A;  3HOZ H;  3M85 A;  3KDF B;  1GM5 A;  3S14 H;  3CCL A;  2YTV A;  2NVX H;  4KHP Q;  5IYB G;  5IP9 G;  4DR1 Q;  4GN4 B;  5LMU Q;  3GTQ H;  4X62 L;  2E2I H;  4OO1 G;  3VDY A;  1Q82 C;  3STB D;  1QUQ A;  4DV1 L;  2KCT A;  1KAW A;  4P72 A;  4BA1 I;  1XMO L;  2YTY A;  4X64 Q;  3KLW A;  3GTG H;  5ELO A;  3S1M H;  1C9O A;  3F8T A;  4X66 L;  5FJ8 G;  2I5M X;  5C0X G;  2OTJ A;  4A3G H;  3PUX A;  3H3V I;  3M7N A;  3M4P A;  1CKO A;  3G6E A;  2WB1 G;  3JC6 6;  3U4V A;  5GAE C;  1VQ5 A;  2ZJP A;  1VQ7 A;  1CSP A;  3J80 c;  2JA8 G;  4IFD I;  3KJP A;  2K50 A;  4A3E H;  2UXC Q;  4JBJ A;  2KEN A;  3HKZ E;  4R1J A;  3HOY H;  2VUM G;  1I94 L;  2UUC L;  1E1T A;  4JV5 L;  4PZ6 A;  1X3F A;  5IWA L;  3HOZ G;  4DR6 L;  2NVT H;  1Q46 A;  3HFZ B;  1EFW A;  5C4X G;  2BA0 A;  4JI7 Q;  1QVG A;  4GKK L;  4DV3 Q;  1JJC B;  4LUZ A;  4LF8 L; 
#chains in the Genus database with same CATH topology
 3AQQ A;  1VQA A;  1IZ6 A;  4BBS H;  3EN2 A;  1EIY B;  4RGN A;  4X6A H;  4C3H B;  4O2D A;  3MXN A;  1DGS A;  4LK1 C;  4RFB A;  3CCR A;  4XXE A;  1X3E A;  3G7L A;  1TWH B;  4RG1 A;  1PLF A;  1U4L A;  1VS0 A;  4C3I B;  3QO2 A;  1PVO A;  2PQE A;  1E24 A;  1TS5 A;  1TVX A;  2OQK A;  5M5W B;  3HOY G;  1PZJ D;  2PCF B;  4EQO A;  5GQO A;  4LWC A;  3S15 B;  3AFQ A;  1LTL A;  1EQQ A;  3NXW A;  3ERO A;  4YCV A;  2GVA A;  1IBK Q;  2RHQ B;  3HOW B;  1HNX Q;  3OMC A;  3PUV A;  1ET9 A;  1XYI A;  2NWG A;  4QMG A;  1IYV A;  2UUA L;  2JE6 I;  2O4X A;  1KD1 C;  1G29 1;  2JQO A;  3A5Z B;  1YBY A;  3CPF A;  2E2J B;  4YY3 L;  2JA6 H;  1A3U A;  3PO2 B;  5JEA H;  4UY8 C;  3CMA A;  3C46 A;  2VNU D;  1NNX A;  3URY A;  3HOU G;  4A3J H;  4JI2 L;  2VY3 A;  3DM1 A;  1WTV A;  4OEL B;  1SLJ A;  4BWG B;  1J6Q A;  1ZKO A;  1O7I A;  1PZI D;  2NZ1 D;  3RZD B;  2K5N A;  2RF4 A;  2XTI A;  4JW0 A;  1BR9 A;  4RGO S;  5D14 A;  4HIO A;  1SYC A;  4QL5 A;  4LF6 Q;  1F2Y A;  3BDO A;  1SR3 A;  3PIO 3;  3KJO A;  3Q23 A;  1EY9 A;  4GOP C;  4C1N I;  4QCL A;  1XWE A;  1C48 A;  5JJL A;  1SJE D;  5M3F H;  5T1G A;  4DFA A;  1PRT D;  1PRT C;  1K9M C;  1PRT F;  1Q86 C;  4DR7 Q;  1DYQ A;  2RA4 A;  2JA7 G;  3QOJ A;  4DR4 Q;  4DK0 A;  1VQG A;  4DK6 C;  3CC2 A;  3G6J B;  5K36 H;  1PHJ A;  3T53 B;  1HCZ A;  3MWY W;  4HSP A;  1TWC H;  2B2U A;  1KTK A;  4RGT A;  1UNS A;  4A3E B;  1VQ8 A;  1VQD A;  1BCP D;  1BCP F;  3W1B A;  3NEM A;  2Q2U A;  4KJN A;  1A63 A;  3ZJY C;  1JT8 A;  2HHH L;  1A2T A;  3S16 B;  1V43 A;  1GO3 E;  3UDI A;  1ICF B;  1PH1 A;  5C5L A;  4IUV A;  1RCV D;  2Q8I B;  4BY7 H;  1WI5 A;  1JB7 A;  1HA6 A;  3BYT B;  4AYB E;  1LV9 A;  3BZD B;  2PI2 E;  4K6L A;  4Q5V A;  1IL2 A;  5BN4 A;  1G6P A;  1K73 C;  4B3T Q;  4UAI A;  2HCI A;  2SDF A;  4ZUJ A;  1CHP D;  3GD7 A;  3PCO B;  1I5F A;  1O7Z A;  2PMZ B;  2K32 A;  2RDF A;  2K03 A;  5JAV A;  3I4M H;  1SYE A;  3ND8 A;  1Z47 A;  2PQA B;  1VQ4 A;  1C7Y A;  1PYB A;  4PMW A;  3M9B A;  2F0M A;  5DLQ E;  1KQS A;  2CWP A;  3BVM A;  2MO0 A;  3D4D A;  4LFB Q;  3R93 A;  1VCI A;  2ZM6 Q;  3MZ5 A;  1SNM A;  1MSH A;  4K14 A;  3JAM i;  2RCN A;  3LX0 A;  1HA5 A;  4CDE C;  5LMU L;  1YZ6 A;  2M00 A;  3S1N H;  1I6V C;  3MA2 B;  2JXM B;  4L6T B;  3PO3 H;  2ZT9 C;  3T56 B;  5L37 A;  2JA9 A;  4FXG C;  1NR2 A;  3GTM H;  2RSO A;  3GDE A;  2BOS A;  4B9W A;  1N8R C;  2EE1 A;  1S72 A;  4XQN A;  4IQZ A;  3P7J A;  2SOB A;  1LT5 D;  3SGI A;  4QB4 A;  1XNR Q;  3SHL A;  5I4D A;  1B2T A;  1FJG Q;  3S2H H;  5I9O A;  1RIP A;  4CDD C;  2KA7 A;  2JSO A;  5C44 H;  1FGU A;  4DKA C;  2UU9 Q;  3D3R A;  5IYD H;  1L2F A;  4DV7 L;  2RHS B;  3MTS A;  1XJV A;  4I7A A;  1QUQ B;  2JA8 B;  5M5W H;  2RCF A;  3F2C A;  4V0B A;  1YJN A;  2VUM B;  2PMZ E;  1STY A;  4GN3 B;  1ML0 D;  1SAP A;  2V1C C;  3A8I E;  2A69 D;  3ND9 A;  4LFC L;  3NP8 A;  4O0A A;  4A3M G;  3PSI A;  1RD9 D;  3OHX C;  2QF7 A;  3AB9 A;  1FGB D;  2IX0 A;  3L3O C;  4YIJ A;  2EYM A;  1EZ8 A;  3BZK A;  2KVM A;  3NHH A;  1SFO B;  5M3M G;  1TQO A;  1DM0 B;  1E0B A;  2K5W A;  4ZUI A;  2E74 C;  3JAM c;  2NVQ B;  2AKW B;  1Q12 A;  4UHV A;  3KF6 A;  1BXT A;  4N9T A;  3HOY B;  1I4R A;  4R4T A;  3J81 i;  1EY4 A;  4B3M Q;  1WTX A;  2JEB I;  4MTK A;  2VL6 A;  3TS0 A;  5JPN C;  4A3B H;  2NVY H;  1GJX A;  2L12 A;  3CQZ H;  1U4M A;  1HNZ L;  1BVS A;  3I73 A;  4HCE A;  4P75 A;  3E6Z X;  1RF2 D;  1YIT A;  1WCM B;  2E2H B;  1VF7 A;  1LYL A;  1OXU A;  2BE5 C;  1LM0 A;  2NTT A;  4X3S A;  1FD7 D;  3A74 A;  2R7Z G;  2K05 A;  1TWA H;  1OXV A;  1P16 A;  4J1M A;  2B8F A;  1LTT D;  2LKV A;  3NUC A;  2K1B A;  5IIF A;  4IPD A;  2J4X A;  2WV6 D;  4A3F B;  3W2D A;  1V8Q A;  3CRL C;  2VW9 A;  1PH3 A;  1E3P A;  5FO9 B;  3NTI A;  3HKZ G;  5IP7 G;  1VQI A;  1B1Z A;  2VQE Q;  1BBW A;  1X56 A;  2ZTD A;  3BG3 A;  3IRB A;  4LF5 Q;  2P5Z X;  3TP5 A;  2N3S A;  1N34 L;  3VR4 A;  2AUJ D;  1D5Z C;  1NSN S;  1IKL A;  2IHE A;  1AEX A;  1IBL L;  4P71 A;  3J80 E;  3HOX G;  5J39 A;  1XNQ L;  1J9O A;  4LUO A;  3NSW A;  4OWX B;  4POG A;  4ZRZ A;  1RL2 A;  5LHY 1;  1XTD A;  4A3K G;  4OGQ C;  4A3C G;  4HJ7 A;  3J81 L;  1BCP B;  1YI2 A;  2KCN A;  2N78 A;  1ENF A;  1PFM A;  4PZ7 A;  1VMC A;  3T1H Q;  1VQB A;  2JA7 B;  3EFX D;  3J81 c;  4OWW B;  1JOK A;  4KY6 A;  4ZK9 B;  2WAQ G;  2F0T A;  2B2V C;  4G7O C;  2NN6 H;  2JEA I;  2VB2 X;  1I3Q B;  1WTW A;  4K8J A;  2JK8 A;  1EYG A;  1I6H B;  5A2Q L;  5FK9 C;  3UI2 A;  5FLM G;  1I50 B;  4DAP A;  5I6W A;  3FKI B;  4JI1 Q;  4MIU A;  4DR5 Q;  3M4Q A;  2ZXO A;  5DEH A;  1CQV A;  4FDB A;  5D65 A;  5C0X I;  3IFT A;  1STG A;  4DV6 L;  4RHS A;  2F4V L;  4DV4 L;  3F2U A;  3QIA A;  1B9N A;  3R2I A;  1O7L A;  5HUR A;  1HJP A;  5C3W A;  3ONA B;  1PMR A;  3U9O A;  4XT3 B;  5E4W C;  3OW2 A;  1KDB A;  5BN3 A;  1K83 H;  1LTA D;  4A3I H;  2RQX A;  4P2C B;  3KLS A;  1LT4 D;  1QVC A;  3K6O A;  4WOR A;  3SK8 A;  4DN4 M;  5KEE A;  4XDX A;  3GO5 A;  3Q22 A;  3S1R H;  2OTL A;  2A6E D;  5IWA Q;  4XYQ A;  5IP9 H;  3M4O H;  5JOB A;  4C3I G;  4R8I A;  4HJ9 A;  3A8K E;  1JJ2 A;  3LGJ A;  4LUV A;  3DM3 A;  5ELF A;  2K04 A;  2F0P A;  3HOW G;  4KD3 A;  2ICE C;  2SEB D;  2L4N A;  1TY0 A;  4ZYS A;  1H9M A;  1ET6 A;  2CW0 C;  2CW0 D;  3GTJ H;  2JA5 G;  1H9K A;  3HOZ H;  3M85 A;  3S14 H;  3CCL A;  1X3Q A;  5IYB G;  1I4H A;  3TZU A;  4GN4 B;  3VA5 A;  4BBR B;  3VDY A;  4KKU A;  3JAM E;  4DV1 L;  1KAW A;  4P72 A;  4X64 Q;  1DCZ A;  1NUC A;  5C0X G;  5C4J B;  1HQM C;  4KY5 A;  3H3V I;  2F03 A;  3N52 A;  1WTO A;  1CKO A;  5GAE C;  3OPO A;  3DXJ C;  4IFD I;  3VR6 A;  2FIN B;  4JK1 C;  3KJP A;  2B2U C;  1EY6 A;  2E2D C;  2KEN A;  3HOY H;  2B2W A;  2E76 C;  1YNJ C;  1YNJ D;  1X3F A;  4U68 A;  3HFZ B;  5C4X G;  1QVG A;  5TSS A;  4GKK L;  4DV3 Q;  4YHH L;  1H9S A;  2WIN B;  3PIO A;  1CKN A;  4J15 A;  1VQP A;  1I4P A;  1D6E C;  4R8N A;  3X3M A;  4HMJ A;  2A5H A;  4AIM A;  3R8B A;  3OWF A;  1PFS A;  4K0K Q;  3EVQ A;  4CKC A;  4DV0 L;  2JN4 A;  4DK1 A;  3Q24 A;  5D3D A;  3ERQ A;  3J7A 5;  2K5D A;  5E1F A;  2D0O A;  2NB0 A;  1HXY D;  3ULL A;  4A3E G;  1R9T H;  1XPU A;  3HOU H;  4B3R L;  2L0C A;  1PH9 A;  1J5E L;  1QNK A;  3VYS A;  4H02 A;  3KFU A;  1I4G A;  1ASZ A;  2KEE A;  1L1O A;  3GTO H;  1JQY D;  1CZG A;  1QOH A;  1N33 L;  2HT1 A;  2EYL A;  1EQR A;  2NZH A;  4ME3 A;  3MEF A;  3UE1 A;  4OEM B;  1N36 Q;  1JOR A;  4X65 L;  2HIX A;  4IPG A;  2WP8 J;  1PFN A;  1WTP A;  3J81 E;  4DNI A;  4IOC A;  2EYJ A;  1YVC A;  2HD3 A;  4ALP A;  4JVZ A;  2RBM A;  3F1Z A;  2I46 A;  4JI6 L;  2AQ1 B;  1U0L A;  4IFD G;  3HKZ B;  1B53 A;  2K6A A;  2F0G A;  2PZU A;  3C1F A;  3U50 C;  1UE1 A;  1M8A A;  3SDZ A;  3QG1 A;  3D31 A;  5A2Q E;  2M9V A;  1QJO A;  4OO1 H;  1HHV A;  1CQF A;  1XX8 A;  4JI0 L;  4OON A;  2NVX B;  4CDF C;  4DAY B;  5CMD A;  2VQF Q;  3GTQ B;  2J0T D;  4IZ8 A;  3CC4 A;  3TS2 A;  5FJ8 H;  2LFN A;  4YWL A;  1XPO A;  1PZK D;  4LFA L;  1NE3 A;  3I72 A;  3GTG B;  1H9J A;  3FVQ A;  3S1M B;  3GTP H;  1SXT A;  2I5L X;  1IBK L;  4PV1 C;  1TKW B;  2XIW A;  5CR3 A;  1Y8N B;  4CGY B;  1K8G A;  4ABN A;  3S24 A;  3IKJ A;  3K5L A;  3MXU A;  3I8Z A;  2VS1 A;  3A7A B;  4C2M H;  3DWQ A;  1IW7 C;  3E0E A;  2DNC A;  1QWY A;  1IXR A;  3EIV A;  1IBM Q;  1K8O A;  2K14 A;  3DLL A;  1S5D D;  5FO8 B;  4DUY L;  4LF9 Q;  3ICE A;  3H09 A;  4X3T A;  1KL9 A;  2B39 A;  1PTO H;  2EY5 A;  5EQ0 A;  3KBX A;  3BDL A;  1STH A;  4HJA A;  2JP1 A;  4F7X A;  3HKS A;  4K6D A;  1GOZ A;  1O78 A;  2UXD L;  5IGC A;  1PDQ A;  1Y1V G;  4OXP A;  4CHT B;  5DM7 3;  2J7Z A;  2Z6K A;  5E3F A;  3CPW A;  1SND A;  4DR3 L;  3NBH A;  1VQO A;  2IHF A;  1AW7 A;  1U4P A;  3TP7 A;  2F0I A;  1WD1 A;  2UXB Q;  2B2V A;  2D62 A;  3S2D B;  3MHB A;  4UDU C;  2CQO A;  3U58 A;  3D4R A;  1GHJ A;  1SNO A;  5KRU A;  5FKA C;  5FOB B;  5KYL A;  2F0O A;  4BY1 G;  2M2L A;  1VQJ A;  1Q7Y C;  3OMG A;  2Q8T A;  3NPP A;  5CGK A;  2HQL A;  5KNC A;  2Y0S E;  4Y7N H;  4OIK A;  2LS0 1;  5JPM C;  2CKZ B;  4PMC A;  4APV A;  1SSO A;  4B3S Q;  1AE3 A;  2EXD A;  2PZW A;  4QY7 A;  5IOC A;  1OXX K;  1SE4 A;  2YTX A;  5C4J H;  3I55 A;  4G4K A;  1K0S A;  4KHP L;  2F0W A;  1D5X C;  2ATW A;  3KDF A;  3TZD A;  2VB3 X;  2VZA A;  3TEH B;  3P20 A;  1E2Z A;  4NP5 A;  1WCM G;  3RR5 A;  4GLV B;  4QIW E;  3GTL H;  4L5Q A;  1Y8P B;  2JA5 B;  3CCE A;  1X3P A;  1GD7 A;  1C8C A;  1FNV A;  3BDC A;  1JWM D;  4A3M H;  4DV2 Q;  4Z9C B;  2IX1 A;  3BVG A;  1RTN A;  4A3F G;  1X55 A;  5M3M H;  2IL8 A;  1XMQ Q;  5CV6 A;  5BR8 Q;  4L5R C;  1VQN A;  2DJG C;  2MUY A;  1ILP A;  4C3J B;  3WOF A;  4RHR A;  4MNO A;  4AYB B;  4KLK A;  4A3L G;  4O42 A;  2KCM A;  3UE0 A;  1VQH A;  2Z0S A;  1HR0 L;  4AQY L;  1F2M A;  2DY7 A;  2EQS A;  1BBX C;  3NQI A;  3RLN A;  2MHV A;  4MN3 A;  3HG9 A;  5C4X B;  4QJF A;  1LAC A;  1MJE A;  3CF5 A;  3SK4 A;  4ZQ3 A;  4YWM A;  2E2I B;  4DXG A;  1SMX A;  3CCQ A;  4JI5 L;  2IX3 A;  4FXK C;  4JI4 Q;  4JV5 Q;  2K52 A;  3MXP A;  1LT3 D;  4DPG A;  1DJR D;  2R7Z H;  1S4Z A;  2HDM A;  1SE2 A;  1QVF A;  3T4A C;  4LF4 L;  2MO1 A;  4FF1 A;  4DAM A;  1DD2 A;  2GA4 B;  3K5M A;  1IYJ B;  2YV5 A;  4NXN L;  1ASY A;  5JEA J;  3M3Y H;  4J8Q A;  1H95 A;  2FJ2 A;  4CJ2 C;  2HIV A;  5IP7 H;  3FKI G;  1YIJ A;  5A35 A;  4ILW A;  4L5T A;  3OSO A;  3A54 A;  5IGB A;  3W5O A;  3K8A A;  1FL0 A;  3T51 B;  4TQU S;  4XQQ A;  5IGE A;  3HOX H;  4MTN A;  3C3L A;  3RZO B;  1B50 A;  1W6J A;  4A3K H;  3I4O A;  1WD0 A;  4NKL A;  2F0V A;  4A3C H;  2PI2 A;  3HOV G;  1HTP A;  5M5Y B;  2UUA Q;  1KNE A;  4DR2 Q;  1CUK A;  3AFP A;  4YY3 Q;  4GKJ L;  5K5P A;  2CCZ A;  5KIX A;  4C1N K;  3E9I A;  1QZG A;  3H0G G;  2UUB L;  2DNE A;  5DM6 3;  1V9P A;  3RNU A;  4GN5 A;  2F0E A;  3FPP A;  4N8F A;  1CHQ D;  3G48 A;  2RKS A;  3I56 A;  4JI2 Q;  5FLM H;  2BDO A;  1Y1W B;  1ZEQ X;  2Q2T A;  1X65 A;  2PNH A;  2MJ8 A;  3H15 A;  1SRO A;  5EPJ A;  5F2D A;  1D2B A;  1WTQ A;  4BXX G;  1M4V A;  4LW1 A;  1EWC A;  1G8Z D;  2HQE A;  1Z6H A;  3OTO L;  1VQM A;  1YHA A;  2B2W C;  1PTO D;  1PTO C;  4JBM A;  3S2D H;  1PTO F;  2OF1 A;  5ELC A;  1EOV A;  3IL8 A;  3PUW A;  2K01 A;  4BBR G;  1SDF A;  3T1Y L;  1HR0 W;  4C3H H;  1IHZ A;  3I91 A;  4FO2 A;  1TWH H;  4DA2 A;  4H0L C;  3S1Q B;  1SBB B;  1Y1V B;  4C3I H;  5CV5 A;  1TY2 A;  4UP9 A;  1D1I A;  1GUN A;  1A62 A;  2K4K A;  2X6L A;  4TSS A;  4A93 G;  1E1O A;  1UEA B;  4X62 Q;  3TSS A;  1QZH A;  4XTC S;  2EOT A;  3S15 H;  1U4R A;  1XMO Q;  2HHH Q;  4F88 A;  4B08 A;  2QW7 A;  2X6G A;  3VA7 A;  3HOW H;  3NEL A;  2EIF A;  2R93 G;  3J7A F;  2PQA A;  2EJF C;  1L1O C;  2Q8R E;  4BY1 B;  4Q0F A;  5LMN L;  2JA5 H;  1F2Z A;  4KMU C;  2E2J H;  1EY0 A;  5IYB H;  3J7Z C;  3T1H L;  3PO2 H;  1B8A A;  3DEP A;  4RH6 A;  5JJK A;  4LF8 Q;  3SK6 A;  2HCC A;  1W6K A;  3MFY A;  4TRD A;  1HNW L;  3T16 A;  1JC7 A;  1FNW A;  4BA2 I;  5C0X H;  3FDT A;  3K58 A;  4NXM Q;  1YNX A;  4LMQ D;  2KHJ A;  3CU7 A;  3UDF A;  2L15 A;  3CCJ A;  1DXM A;  5T1I A;  4IJH A;  3RZD H;  4H13 C;  2NZO A;  3UDG A;  3BU2 A;  4JI1 L;  1B7Y B;  5C3X A;  4FF4 A;  1FR3 A;  4JC0 A;  2PYK A;  1A3T A;  1B3Q A;  2BE5 D;  3P75 A;  2R92 B;  3HEJ A;  1Y8O B;  5LMU Q;  3KBG A;  4DAV A;  2E2I H;  1KAA A;  3GV6 A;  1Q82 C;  1CA5 A;  1QUQ A;  2EXZ A;  2A68 C;  2A68 D;  2KCT A;  3DEO A;  2I5M X;  4CBV A;  2H4O A;  1PFB A;  3T13 A;  1HPC A;  4G57 A;  2K50 A;  4A3E H;  2UXC Q;  4JBJ A;  2B2Y A;  2UUC L;  1PRT B;  2KQ3 A;  1GUO A;  5IWA L;  4DR6 L;  2FFK B;  1EQT A;  1VQ9 A;  3I4N B;  2XWJ B;  3WDN A;  2F0D A;  3S16 H;  2RDG A;  5C0X J;  1EIG A;  1NY4 A;  4MZ9 A;  1JCK B;  4WJ3 M;  1VDZ A;  1E2W A;  4R4Q A;  1JOQ A;  4Y52 H;  3EQL C;  3O13 A;  3K7A B;  3C2P A;  2Z6K C;  1R4P B;  1MD2 D;  1MSG A;  5C3E B;  4LFC Q;  4IOA A;  1A8V A;  2YU9 B;  4KI0 A;  2SNS A;  5M5Y H;  3H3V H;  4R9W A;  4J6H A;  5ELE A;  1F9R A;  1A3V A;  2JYO A;  1AZQ A;  3FEW X;  3ER0 A;  1LT6 D;  3CKI B;  1V1Q A;  1K8A C;  3FPU B;  1I4X A;  3DMU A;  3MC0 B;  3HS0 C;  2N49 A;  1SE3 A;  4X64 L;  5CC4 A;  5ELB A;  1KXL A;  4ZCK A;  1EYA A;  4JI8 L;  2PW5 A;  1ROD A;  4DUZ L;  2WKD A;  5AJ3 L;  4OWT B;  1HQR D;  1MIU A;  1CFM A;  5LMN W;  4IPC A;  2I5H A;  1GKH A;  2ZTE A;  1O80 A;  1TWG B;  1S3O A;  2R61 A;  4EGV A;  3HOV B;  4UP8 A;  4GNX B;  1X54 A;  3H91 A;  4PNY A;  4DV3 L;  2B8G A;  3MAQ A;  2F1M A;  2KUM A;  4EVO A;  1PH4 A;  1EY5 A;  3H0G B;  3RD4 A;  1F77 A;  4XT1 B;  2A73 B;  1S5F D;  2B2T A;  1W3S A;  1BKB A;  4QGU A;  1EU4 A;  1FYC A;  2IT1 A;  2BH8 A;  3MVV A;  4H44 C;  3CCU A;  2L1B A;  3LWU A;  3CCS A;  1AE2 A;  2VXW A;  2L55 A;  3AYH B;  1SYG A;  1SN8 A;  4ZKB B;  5IGG A;  5FLX L;  4IUT A;  3Q0A A;  1N32 L;  1J8I A;  2KHI A;  2ENB A;  1EYD A;  1I4Q A;  1DOK A;  4HIK A;  3S1Q H;  3ZYY X;  5GAH C;  5FLX c;  2JA8 H;  3P1H A;  1T5E A;  1N34 Q;  2A19 A;  2XRQ D;  5IGF A;  2VUM H;  1XNQ Q;  1GUS A;  3D4W A;  1Y14 B;  1EOT A;  1SEB D;  1EL0 A;  3NE5 B;  1N36 L;  1YJ9 A;  1HZA A;  3GV3 A;  1UEB A;  5IT9 L;  1SFO H;  4BY1 H;  2EVB A;  2WKC A;  3N6R A;  4BBS B;  3L7Z C;  3SK5 A;  4C3J G;  5IT9 c;  1PA6 A;  3HP3 A;  1CKM A;  4AYB G;  2E5L L;  1HFN A;  5IYC G;  2NVQ H;  3I90 A;  2I07 B;  4A3D G;  4RCO A;  4GNX A;  4A93 B;  2C5C A;  4NPS A;  4YCW A;  5EJW A;  4P74 A;  2KBN A;  5GAD C;  4QQB X;  1G6Z A;  5IGD A;  3SEB A;  1X32 A;  1TWF B;  4G7Z C;  3QOL A;  2QA4 A;  1GXD C;  2PPB C;  1ESF A;  4RCN A;  1GUT A;  4KKT A;  2R93 B;  4A3B G;  2F4V Q;  4LAA A;  4F8M A;  1WCM H;  2E2H H;  1Q8I A;  2CWA A;  4DV4 Q;  4OX9 Q;  4LF7 Q;  3OOC A;  2G9H D;  4PQX A;  3NEN A;  3KF8 B;  2F3V A;  5IOD A;  2F0H A;  1E7Z A;  1AFP A;  2CH4 W;  1C4Q A;  1EEF D;  1SMY C;  3C1E A;  4JI3 L;  4I65 A;  2JA6 B;  1V1O A;  4A3F H;  2Q2H A;  5KNB A;  2X69 A;  2B63 G;  1EIH A;  1VMP A;  1BUV T;  1K8M A;  4L63 B;  4DR1 L;  1M1K C;  2MGS A;  1HH2 P;  3NTH A;  4A3J B;  4LF9 L;  3MFG A;  2K28 A;  4A3L H;  4YWK A;  2EY6 A;  3S17 B;  2A1A A;  2K5V A;  3RN2 A;  3U4Z A;  1WFQ A;  2F52 A;  2MP1 A;  4UP7 A;  2EDG A;  2ZXR A;  1DOL A;  1BDO A;  3KUP A;  3NWS A;  4RAU C;  5HY6 A;  2AMC B;  4K2K A;  1GUG A;  3J81 j;  3LWE A;  1XTC D;  1KLU D;  5EBC A;  1MBY A;  1NJI C;  3K0Y A;  5M3F B;  4JI7 L;  2JA7 H;  2E8G A;  5EKK A;  3RLO A;  1A0I A;  4X3U A;  1LTB D;  3K7U C;  1KHI A;  2H1E A;  5CBA E;  1Q8K A;  4HJ5 A;  1LTG D;  4NW2 A;  2LXK A;  4IUP A;  2QGQ A;  1I3Q H;  4DV1 Q;  4QF4 A;  5DNF A;  1TWC B;  1I6H H;  3RN5 A;  2A8V A;  1LUZ A;  1AN8 A;  1JIC A;  1I50 H;  3ITP A;  1Q1E A;  4HCS A;  1UE5 A;  1Y1W G;  3FKI H;  1AH9 A;  2A6H C;  2A6H D;  3IAY A;  4OIJ A;  2Z8L A;  2EJG C;  4B3S L;  2F0S A;  1S5C D;  3VR3 A;  3A7L A;  4HSV A;  4EX5 A;  1Z9F A;  2MPM A;  1II3 A;  3CW2 C;  5JVG 3;  2Y0S B;  5E4X A;  5C4Z A;  4K5V A;  1UWV A;  5G3L D;  1EWI A;  5G3L F;  5C5M A;  1HNX L;  3H3V C;  4L8J A;  2AHO B;  3HGB A;  3K80 C;  4GKK Q;  2C35 B;  2CFM A;  4ZLT F;  3OW7 A;  2PO4 A;  4CDC C;  4BY7 B;  4YHH Q;  1SNC A;  1XPR A;  1IW7 D;  3HOV H;  2Z1C A;  3TQY A;  1HZ9 A;  3CME A;  1QG7 A;  1EWH A;  5GAG C;  3IFD A;  4DV2 L;  4RGM A;  4IO9 A;  4ULL A;  4QIW B;  5JJI A;  3U9S A;  4A3I G;  4DV5 Q;  2Z4H A;  3A5U A;  1EY7 A;  4H7B A;  3GTK B;  4CJ0 B;  3E5S A;  5LL6 S;  4B3R Q;  4K8I A;  4EQ5 A;  2R7D A;  1BO0 A;  5I6Y A;  2QEJ C;  1J5E Q;  3I4M B;  5FLX E;  4ME5 A;  2R7F A;  3STB C;  2OEO A;  3ERS X;  5HGQ A;  4BXX H;  3V2T A;  1VQL A;  2HDL A;  2XWB B;  1N33 Q;  1WYD A;  4LF6 L;  4UPA A;  4R4C A;  2KHS A;  1E22 A;  2RVL A;  1BQQ T;  4X65 Q;  4FYD A;  4DAY A;  1VQK A;  1O7Y A;  4HAE A;  4DR7 L;  1D5M C;  1RJT A;  3GTM B;  3RLF A;  4JI4 L;  4R4I A;  2XN9 C;  2A74 C;  3K5O A;  2TSS A;  4DR4 L;  2ZTC A;  4K2L A;  4BBR H;  5IT9 E;  3A55 A;  1RDP D;  4JI6 Q;  2QDB A;  1SE8 A;  4RMF A;  3A0J A;  3S2H B;  1X6O A;  2ZXP A;  1B44 D;  3PV0 A;  4JYA Q;  3FRP B;  4NDX A;  1JE5 A;  5C44 B;  3F2D A;  4X3K A;  3PIP 3;  4A93 H;  1EUJ A;  4FNF A;  2DY8 A;  2FHT A;  3J7Y W;  1EIF A;  4JI0 Q;  2OXP A;  1F9P A;  2B2Y C;  4KK7 A;  1KRT A;  3VR5 A;  4K5W A;  4XQJ A;  1NBW A;  1TWF H;  2R92 G;  1MI2 A;  2CVR A;  4A4I A;  2WAQ E;  4NB3 A;  4LFA Q;  2F0J A;  2R93 H;  2K5H A;  1YHB A;  5CV9 A;  3R2T A;  1EZ6 A;  1OTC A;  1CSQ A;  5KND A;  4L5S A;  2NTS A;  1KNA A;  1PH8 A;  3V05 A;  1K28 A;  4WFN 3;  4OO1 I;  1PYW D;  1VF5 C;  1SJH D;  4B3T L;  1SNP A;  3FHW A;  4DR2 L;  3KYH C;  1NMF A;  2L9H A;  3L9A X;  4A3D B;  3CHB D;  4DUY Q;  3VYR A;  1P8L A;  4JOI A;  3Q6S A;  4E6I A;  5IY0 A;  2K33 A;  1EU3 A;  3J80 i;  1BBU A;  2ICI A;  4X66 Q;  1CK1 A;  5COR A;  2ASB A;  3I4N G;  2UXD Q;  4FXD A;  2Z6B A;  1TS2 A;  3I4L A;  4A3B B;  4LFB L;  5J1Z A;  2NVY B;  1GHK A;  1PH5 A;  2ZM6 L;  3S17 H;  1VQC A;  2D5D A;  1FVI A;  2K75 A;  3CQZ B;  4DR3 Q;  5DAU A;  1JE4 A;  3R3O A;  1I94 Q;  5J22 A;  2F0K A;  1CTM A;  2XRS D;  4TVA B;  1K3R A;  1ZYR C;  1ZYR D;  1PH7 A;  5C3E G;  5EBD A;  1LLR D;  4IAL A;  1C0A A;  2DUD A;  5CYU A;  3TP8 A;  1NR4 A;  1STB A;  1TWA B;  2B3G A;  2OQ0 A;  2B63 B;  3W3A A;  2Q2I A;  1TT2 A;  1JR0 D;  3A8J E;  3BYY B;  3K81 C;  1XNR L;  1FNU A;  1FJG L;  4FF3 A;  4B9X A;  3E3X A;  1IYU A;  1LTR D;  2B2T C;  2L5T A;  4A76 A;  1ILQ A;  2GVB A;  1HTL D;  2UU9 L;  1S5B D;  3S9W A;  3D8G A;  1BCP C;  2YTV A;  1AZP A;  2NVX H;  4KHP Q;  3GTQ H;  4X62 L;  4OO1 G;  3QR8 A;  3QJY A;  4FP5 D;  1XMO L;  2YTY A;  3KLW A;  3GTG H;  3S1M H;  1C9O A;  5FJ8 G;  2O5I C;  3J80 L;  1A15 A;  4K5X A;  3M7N A;  1RTO A;  3G6E A;  3JC6 6;  1VQ7 A;  1CSP A;  1ENA A;  1RHP A;  1D1K A;  3NBI A;  1LTI D;  2N55 A;  3AU7 A;  3J80 c;  3K5N A;  1V1P B;  2PW7 A;  4NMZ A;  5JVH 3;  2F0L A;  1QIL A;  1Q46 A;  1EFW A;  4DNR B;  2BA0 A;  1JJC B;  4LUZ A;  1A2U A;  2F0Q A;  4LF8 L;  2N8N A;  1L0W A;  4LNQ A;  3WWV A;  4IUU A;  4B3M L;  3GTK H;  4RA8 A;  3Q8D A;  2N88 A;  4NXM L;  1HR0 Q;  1TXY A;  4AQY Q;  4A3G G;  4GNX C;  2CHB D;  2EY1 A;  3PGZ A;  1KRS A;  5CV4 A;  2LY7 A;  1SYD A;  2F0F A;  1WTR A;  3SE0 A;  4JI5 Q;  2OCE A;  1CI3 M;  2MQH A;  2DGY A;  3V96 A;  5C6A A;  5ISR A;  1SRU A;  2QIL A;  4BS9 A;  3KF6 B;  1K83 B;  4A3I B;  4JPB W;  4BBS G;  4AH6 A;  4LF4 Q;  1EFI D;  1EY8 A;  1WTH A;  3HRZ C;  2FMM A;  3S1R B;  2AWN A;  4LJZ C;  2DJF C;  4NXN Q;  3NTK A;  5BN5 A;  3M4O B;  1KAB A;  5HGT A;  2VQE L;  1EEI D;  4GLA C;  2EZV A;  4LF5 L;  2UXC L;  3J7A V;  5D3I B;  1V1P A;  1OO9 B;  3CAM A;  2FMC A;  4HJ8 A;  4JCV E;  2GN5 A;  3X3N A;  2RDH A;  4DNT B;  3G4S A;  4JBW A;  1JWU D;  1BNZ A;  1B70 B;  2WB1 B;  3L2P A;  3SXH A;  1AP0 A;  4DK3 C;  1SYF A;  5KGU A;  4RKB A;  1HZB A;  3GTJ B;  2F0N A;  3HOZ B;  2NYZ D;  3TRZ A;  3S14 B;  1ESR A;  2R6G A;  4C56 C;  2A69 C;  2JA6 G;  3PUY A;  2D2C C;  4GKJ Q;  1G2S A;  1Y69 U;  5JEA G;  5E7N A;  1JB3 A;  2UUB Q;  3EBE A;  3PF4 A;  1KDC A;  4C3J H;  3F2B A;  1HRJ A;  2LSS A;  4A3J G;  1X3G A;  3JAM L;  5IYC H;  1MHW C;  4A3D H;  3DHQ A;  3AEV A;  1F9S A;  5COY A;  4KJO A;  1JOO A;  2AWO A;  3CCV A;  5CBE E;  4DR5 L;  1PV4 A;  1Z7T A;  2XSC A;  3GP7 A;  4JBK A;  1LTS D;  1NCV A;  3D0F A;  5C4X H;  4KHV A;  3L0O A;  3KK7 A;  3BZC A;  4KKS A;  4DF7 A;  1IL8 A;  3OTO Q;  1L0Y B;  3OYY A;  5M5X B;  2LXJ A;  2OWO A;  1HFG A;  5M3F G;  1YHQ A;  3WOE A;  3KLS X;  4RKL A;  2I0Q A;  3I7F A;  4S3S A;  3E0J A;  1NAP A;  4V19 0;  4GOP B;  1XXG A;  4HED A;  1G91 A;  4PMB A;  1HUM A;  2B29 A;  2AQ2 B;  3T1Y Q;  3K59 A;  2WB1 E;  4WRD A;  5K36 G;  2B63 H;  1RKN A;  1YEZ A;  4ZKC B;  1JJG A;  4IUQ A;  1R9T B;  1YJW A;  3HOU B;  4DV7 Q;  4IUR A;  2IJ0 A;  4N9P A;  2KED A;  1D8L A;  5C4H A;  2NUC A;  5FO7 B;  4KN7 C;  1A6X A;  2RSN A;  1UE6 A;  1TU2 B;  2Y0S G;  4TKO B;  3MEH A;  4QUF A;  3GTO B;  5KYI A;  2QDL A;  3SR1 A;  4IUN A;  3RZO H;  4R4O A;  1ICW A;  4BY7 G;  4WJW A;  3G71 A;  1PXU A;  3TN2 A;  5ELD A;  1WVL A;  1B3A A;  1VQ6 A;  5LMN Q;  4HID A;  4PG3 A;  2JJQ A;  2MFI A;  5EPK A;  4IFD H;  3I2Z A;  2IW3 A;  2F0U A;  1JMC A;  1PYS B;  1UE7 A;  4HR7 B;  1HNW Q;  1LAB A;  5LL6 X;  1STA A;  3D6C A;  5IE8 A;  2F3W A;  1UUP A;  3I4M G;  4IN3 A;  1Y1W H;  4DU9 A;  4HMI A;  1KDA A;  4XYO A;  1HZC A;  3M4Y A;  1HNZ Q;  1F2L A;  4GOP A;  4YCU A;  5CV7 A;  3RMH A;  3M7G A;  1VQE A;  4JG2 A;  1LO5 D;  5GRO A;  4G7H C;  3CRK C;  4KD4 A;  1OXS C;  2NBF A;  4KN4 C;  2SNM A;  1Q1B A;  1U9R A;  3FMC A;  3GTP B;  3PO3 G;  1VQF A;  5I2X A;  4OX9 L;  4HTH A;  4K0K L;  4LF7 L;  4M8A A;  2D0P A;  1G51 A;  4KTA A;  3FP9 A;  4I7Z C;  4C2M B;  4M1U B;  2QEX A;  3I3C A;  3PMF A;  3NWT A;  2G5D A;  3TBI B;  1K3B C;  1PTO B;  1L0X B;  4IFD J;  1N9W A;  2EYO A;  4C3H G;  5C44 G;  1Y1V H;  3DWA A;  1K0R A;  2AQ3 B;  3BVZ A;  2UUC Q;  2AUK A;  2A6E C;  3OWE B;  4IPH A;  5IYD G;  4A3G B;  4DR6 Q;  2O2L D;  5EKL A;  3PIP A;  2WAC A;  1H9S B;  3TRE A;  1CKN B;  1T9H A;  2H5X A;  1NMG A;  4JOI C;  1IBL Q;  1UAP A;  4OL7 A;  2EYH A;  5EPL A;  3BS1 A;  1S40 A;  4GS3 A;  2F3I A;  2PZT A;  2NVT B;  4KY7 A;  2ZJR A;  2HUG A;  1F9Q A;  3QB3 A;  3CP0 A;  2XNA C;  4GLX A;  3CD6 A;  2TMP A;  2BCO A;  4KHZ A;  4EQP A;  3DUZ A;  2L11 A;  1SYB A;  3MXG A;  1SNQ A;  1GVP A;  3VYT A;  1PH2 A;  3K0X A;  2IY5 B;  2E75 C;  3PO2 G;  1L1O B;  3AMU A;  3EA6 A;  4Y7N B;  1CM9 A;  3CXC A;  1CA6 A;  2ES2 A;  4ODG A;  3E9H A;  3H6M A;  4CKE A;  2NN6 I;  4DV6 Q;  1WJJ A;  4ZAI A;  4P73 A;  3EJI A;  3TP6 A;  4DGZ A;  2Z9H A;  4JI8 Q;  2VQF L;  4DUZ Q;  2ID0 A;  3CCM A;  1HUN A;  5AJ3 Q;  3SVM A;  1T5X D;  1MJC A;  2R92 H;  1QNU A;  3LNN A;  5ELN A;  1TR5 A;  3GTL B;  2Z4I A;  4O1N A;  1SMY D;  4EQN A;  1EYC A;  4A3M B;  5M5X H;  2MNA A;  3TDQ A;  4PZ8 A;  1R4Q B;  1STE A;  1IBM L;  2KOL A;  2YYZ A;  1S5E D;  3A56 A;  3PQI A;  5M3M B;  1TS3 A;  3KLR A;  3K57 A;  5AFW A;  2EPB A;  3BJU A;  1DON A;  2PNR C;  5EKI A;  2R3Z A;  2K7V A;  5H1S E;  4DV5 L;  1B9M A;  5EGT A;  2BA1 A;  3OIP A;  3NK9 A;  2EJM A;  3I4N H;  1N32 Q;  2QCP X;  1OXT A;  2UXB L;  1NTG A;  4HIM A;  1DOM A;  1Q90 A;  1TII D;  3TME A;  2LMC B;  2ALY B;  1YNN C;  1YNN D;  2V4D A;  1MGS A;  3ULP A;  2IPK D;  3K7A H;  1CT1 D;  1WOC A;  1KLG D;  2FXQ A;  1DZ1 A;  5C3E H;  2EY2 A;  1M90 C;  2C9O A;  3B6Y A;  3PF5 A;  3D6W A;  2YU9 H;  4A75 A;  3W1G A;  2R7Z B;  2KCC A;  4XIG S;  4U67 3;  4GZY C;  3ULJ A;  4POF A;  1B4O A;  2WFW A;  2BH2 A;  4N8X 1;  3KOJ A;  3DWP A;  3CC7 A;  4DXF A;  2NN6 G;  5CV8 A;  1BF4 A;  1TS4 A;  4IJL A;  2CH4 A;  1KC8 C;  3NQT A;  3KF8 A;  5J3B A;  1X9N A;  1KIX A;  2E5L Q;  3M3Y B;  3NBH B;  5M9O A;  4WJ4 A;  1D7Q A;  1BOS A;  4HN7 A;  4JYA L;  2EYP A;  1PH6 A;  5I9P A;  3VR2 A;  2BDN A;  1CZW A;  2QKI C;  4QUC A;  2IWH A;  1TWG H;  3MXN B;  3HOX B;  3VYU A;  1QE6 A;  3OIQ A;  2XGT A;  4MHE A;  2EYF A;  4A3K B;  4RWS C;  1GUW A;  4DV0 Q;  5EAY A;  1Q81 C;  1STN A;  5I2Y A;  1ENC A;  1E2V A;  1IKM A;  3H0G H;  2WII B;  2KEC A;  1W2B A;  3I70 A;  1QB5 D;  1U5K A;  3RUZ A;  5BR8 L;  5JJZ A;  1XMQ L;  5NUC A;  2WAQ B;  4JI3 Q;  2ZJQ A;  1MKH A;  3UDX A;  3PUZ A;  4CKB A;  3KDF B;  1EQV A;  1GM5 A;  2XVS A;  2K5Q A;  3HZX A;  5IP9 G;  4DR1 Q;  2OT2 A;  1QCB D;  4FF2 A;  3STB D;  4CJ1 B;  4F87 A;  3GQB A;  4OHJ A;  1JWS D;  4BA1 I;  1H9R A;  2F4I A;  5ELO A;  3F8T A;  4X66 L;  4ID6 A;  4A3G H;  2OTJ A;  3PUX A;  3M4P A;  2WB1 G;  3U4V A;  1VQ5 A;  3S1N B;  2ZJP A;  1ONL A;  3QWN A;  2JA8 G;  3PO3 B;  3H94 A;  4FVM A;  2DN8 A;  1G2T A;  3HKZ E;  4R1J A;  1ZXT A;  2VUM G;  2D9U A;  1I94 L;  1E1T A;  4JV5 L;  4PZ6 A;  4KV6 A;  2O5J C;  3HOZ G;  2CQA A;  2NVT H;  2G9D A;  1Q3L A;  4JI7 Q;  2KJX A; 
#chains in the Genus database with same CATH homology
 3AQQ A;  1VQA A;  2N8N A;  1L0W A;  4YHH L;  3PIO A;  3S16 H;  1CKN A;  5C0X J;  4LNQ A;  1IZ6 A;  4J15 A;  4BBS H;  3EN2 A;  1VQP A;  1NY4 A;  4MZ9 A;  4WJ3 M;  3WWV A;  1EIY B;  4B3M L;  4R4Q A;  4X6A H;  4AIM A;  4O2D A;  3GTK H;  4Y52 H;  1DGS A;  1PFS A;  3Q8D A;  4NXM L;  1HR0 Q;  4K0K Q;  1TXY A;  4AQY Q;  4A3G G;  3CCR A;  4DV0 L;  1X3E A;  2Z6K C;  4GNX C;  3PGZ A;  1KRS A;  4RG1 A;  3J7A 5;  4LFC Q;  4IOA A;  1VS0 A;  1A8V A;  2D0O A;  1PVO A;  4KI0 A;  3ULL A;  4A3E G;  1E24 A;  2OQK A;  3HOY G;  4JI5 Q;  1R9T H;  1XPU A;  2OCE A;  5M5Y H;  3HOU H;  4B3R L;  3H3V H;  2MQH A;  2DGY A;  4LWC A;  5GQO A;  3AFQ A;  1LTL A;  1EQQ A;  1SRU A;  4YCV A;  1PH9 A;  1J5E L;  2GVA A;  1IBK Q;  2RHQ B;  3ER0 A;  4H02 A;  3KFU A;  1HNX Q;  1V1Q A;  3PUV A;  1K8A C;  1ASZ A;  3KF6 B;  1L1O A;  3GTO H;  4BBS G;  4AH6 A;  2N49 A;  2JE6 I;  4X64 L;  2UUA L;  4LF4 Q;  1N33 L;  2HT1 A;  1EQR A;  1KD1 C;  1G29 1;  2AWN A;  2JQO A;  2NZH A;  1YBY A;  3A5Z B;  3CPF A;  3MEF A;  4ME3 A;  4JI8 L;  3UE1 A;  4YY3 L;  4DUZ L;  4NXN Q;  1N36 Q;  2JA6 H;  4X65 L;  2HIX A;  5AJ3 L;  4IPG A;  2WP8 J;  4OWT B;  1MIU A;  2VQE L;  5LMN W;  4IPC A;  4UY8 C;  2I5H A;  4GLA C;  1GKH A;  4DNI A;  4LF5 L;  2UXC L;  2ZTE A;  3CMA A;  4IOC A;  1YVC A;  1S3O A;  2VNU D;  4ALP A;  3CAM A;  4UP8 A;  4GNX B;  3HOU G;  1X54 A;  4HJ8 A;  3F1Z A;  4JCV E;  4A3J H;  2GN5 A;  4JI2 L;  2VY3 A;  4DV3 L;  4JI6 L;  3G4S A;  4JBW A;  1U0L A;  4IFD G;  1SLJ A;  1B70 B;  3L2P A;  1PH4 A;  3U50 C;  1J6Q A;  1O7I A;  4DK3 C;  1UE1 A;  1W3S A;  1BKB A;  2K5N A;  2RF4 A;  2XTI A;  3D31 A;  4QGU A;  4HIO A;  1HZB A;  2IT1 A;  2BH8 A;  1VQ9 A;  3CCU A;  3TRZ A;  4QL5 A;  4JI0 L;  4OON A;  4LF6 Q;  2R6G A;  1SR3 A;  3KJO A;  3CCS A;  1AE2 A;  4DAY B;  2JA6 G;  4GOP C;  3PUY A;  3AYH B;  4GKJ Q;  2VQF Q;  1SN8 A;  5JEA G;  3CC4 A;  5E7N A;  3TS2 A;  5FJ8 H;  2UUB Q;  5JJL A;  5M3F H;  3EBE A;  3PF4 A;  4C3J H;  4YWL A;  3F2B A;  1K9M C;  1N32 L;  1XPO A;  4LFA L;  2KHI A;  2LSS A;  1NE3 A;  1Q86 C;  3S1Q H;  4DR7 Q;  4A3J G;  4HIK A;  1X3G A;  5IYC H;  3GTP H;  5GAH C;  2I5L X;  5FLX c;  1IBK L;  2JA7 G;  1N34 Q;  2JA8 H;  3AEV A;  4A3D H;  4DR4 Q;  1VQG A;  2A19 A;  4DK6 C;  3CC2 A;  2AWO A;  3CCV A;  4DR5 L;  1PV4 A;  1PHJ A;  1K8G A;  2VUM H;  3S24 A;  1XNQ Q;  1TWC H;  4JBK A;  2VS1 A;  1Y14 B;  4C2M H;  3E0E A;  1VQD A;  3D0F A;  1VQ8 A;  5C4X H;  1IXR A;  3EIV A;  3W1B A;  3L0O A;  1IBM Q;  2K14 A;  3NEM A;  3DLL A;  2Q2U A;  4DUY L;  3BZC A;  1N36 L;  1YJ9 A;  4LF9 Q;  3ICE A;  3ZJY C;  1A63 A;  1KL9 A;  1HZA A;  1UEB A;  1JT8 A;  3OTO Q;  3OYY A;  4HJA A;  2HHH L;  1SFO H;  4BY1 H;  2LXJ A;  3HKS A;  2OWO A;  1V43 A;  1GO3 E;  5M3F G;  3UDI A;  1YHQ A;  3L7Z C;  1PH1 A;  2UXD L;  2I0Q A;  3I7F A;  5IT9 c;  1PA6 A;  1Y1V G;  1CKM A;  4AYB G;  2E5L L;  4OXP A;  5IYC G;  4GOP B;  2Z6K A;  2NVQ H;  4A3D G;  4GNX A;  4BY7 H;  4NPS A;  2B29 A;  1WI5 A;  4YCW A;  3CPW A;  1JB7 A;  3T1Y Q;  2WB1 E;  4P74 A;  2KBN A;  4AYB E;  5GAD C;  4DR3 L;  2IHF A;  1VQO A;  4QQB X;  2UXB Q;  5K36 G;  1KXL A;  2B63 H;  2PI2 E;  1YEZ A;  2D62 A;  1IL2 A;  1JJG A;  1G6P A;  2CQO A;  2QA4 A;  1YJW A;  3U58 A;  4DV7 Q;  1K73 C;  4B3T Q;  4A3B G;  1D8L A;  2F4V Q;  1WCM H;  2E2H H;  3GD7 A;  4BY1 G;  2CWA A;  1I5F A;  3PCO B;  1UE6 A;  1VQJ A;  4DV4 Q;  4LF7 Q;  2Y0S G;  1Q7Y C;  4OX9 Q;  3NEN A;  3KF8 B;  3I4M H;  1Z47 A;  1E7Z A;  2PQA B;  1VQ4 A;  2HQL A;  1C7Y A;  2Y0S E;  3RZO H;  4R4O A;  1PYB A;  4PMW A;  4Y7N H;  3M9B A;  5DLQ E;  1KQS A;  2CKZ B;  2CWP A;  4BY7 G;  4APV A;  4JI3 L;  2MO0 A;  3G71 A;  4B3S Q;  4LFB Q;  1AE3 A;  4A3F H;  2EXD A;  1VCI A;  4QY7 A;  2Q2H A;  2ZM6 Q;  1OXX K;  2B63 G;  2YTX A;  5C4J H;  1VQ6 A;  3JAM i;  3I55 A;  5LMN Q;  4KHP L;  2RCN A;  4HID A;  4PG3 A;  2JJQ A;  4DR1 L;  2MFI A;  2ATW A;  5LMU L;  1M1K C;  1YZ6 A;  3KDF A;  3S1N H;  1HH2 P;  4LF9 L;  3I2Z A;  3PO3 H;  2VZA A;  3TEH B;  2JA9 A;  1JMC A;  4A3L H;  1PYS B;  4YWK A;  1UE7 A;  3GTM H;  1WCM G;  3RR5 A;  4GLV B;  4QIW E;  2A1A A;  2K5V A;  3GDE A;  3RN2 A;  4L5Q A;  1WFQ A;  3U4Z A;  3GTL H;  1HNW Q;  2F52 A;  4UP7 A;  3CCE A;  1N8R C;  5IE8 A;  1GD7 A;  1S72 A;  3I4M G;  3SGI A;  1Y1W H;  4A3M H;  4DV2 Q;  1XNR Q;  2IX1 A;  1HZC A;  1FJG Q;  3S2H H;  5HY6 A;  1HNZ Q;  2AMC B;  4GOP A;  4YCU A;  1RIP A;  3J81 j;  4A3F G;  1X55 A;  5C44 H;  1VQE A;  4JG2 A;  1FGU A;  5M3M H;  5BR8 Q;  4DKA C;  1XMQ Q;  1NJI C;  5GRO A;  4L5R C;  2UU9 Q;  1VQN A;  5IYD H;  4JI7 L;  1L2F A;  2JA7 H;  4DV7 L;  1OXS C;  2RHS B;  2E8G A;  1XJV A;  4MNO A;  1Q1B A;  3RLO A;  4KLK A;  1A0I A;  1QUQ B;  3PO3 G;  3K7U C;  1KHI A;  4A3L G;  4HJ5 A;  1Q8K A;  1VQF A;  5M5W H;  3F2C A;  4OX9 L;  2LXK A;  2QGQ A;  1I3Q H;  2KCM A;  3UE0 A;  1VQH A;  2Z0S A;  2PMZ E;  4DV1 Q;  2D0P A;  4AQY L;  1YJN A;  1HR0 L;  1G51 A;  1I6H H;  3FP9 A;  3RN5 A;  4GN3 B;  2EQS A;  1LUZ A;  2A8V A;  1I50 H;  4LFC L;  2V1C C;  1Q1E A;  3RLN A;  4QJF A;  1UE5 A;  2QEX A;  4O0A A;  4A3M G;  3FKI H;  3PSI A;  1Y1W G;  1MJE A;  4K0K L;  3CF5 A;  1AH9 A;  4YWM A;  2IX0 A;  1SMX A;  3CCQ A;  4B3S L;  4JI5 L;  3BZK A;  4IFD J;  4EX5 A;  1N9W A;  1Z9F A;  3CW2 C;  5C44 G;  1Y1V H;  5M3M G;  4JI4 Q;  1K0R A;  4JV5 Q;  2UUC Q;  2K52 A;  4IPH A;  5IYD G;  1UWV A;  4DPG A;  4DR6 Q;  1EWI A;  2R7Z H;  1HNX L;  3PIP A;  3TRE A;  1CKN B;  1T9H A;  2AHO B;  1NMG A;  2H5X A;  4JOI C;  3K80 C;  3JAM c;  1IBL Q;  4GKK Q;  2C35 B;  2CFM A;  2AKW B;  1Q12 A;  1QVF A;  4LF4 L;  4YHH Q;  1XPR A;  2MO1 A;  3KF6 A;  1S40 A;  3HOV H;  4DAM A;  3TQY A;  4R4T A;  1HZ9 A;  4GS3 A;  2F3I A;  3J81 i;  4B3M Q;  1IYJ B;  2YV5 A;  4NXN L;  3CME A;  1ASY A;  2JEB I;  5JEA J;  3M3Y H;  2VL6 A;  5GAG C;  1H95 A;  3TS0 A;  4A3B H;  2NVY H;  4DV2 L;  2ZJR A;  4IO9 A;  2HIV A;  5IP7 H;  3FKI G;  1YIJ A;  5JJI A;  3CQZ H;  3CP0 A;  1BVS A;  4L5T A;  4GLX A;  4A3I G;  1HNZ L;  3CD6 A;  4P75 A;  4DV5 Q;  1YIT A;  3A5U A;  3W5O A;  3K8A A;  1FL0 A;  4KHZ A;  1LYL A;  1OXU A;  4B3R Q;  4TQU S;  1LM0 A;  1GVP A;  1PH2 A;  4EQ5 A;  2R7D A;  3A74 A;  3K0X A;  2IY5 B;  2R7Z G;  1J5E Q;  1TWA H;  3HOX H;  1OXV A;  1P16 A;  3PO2 G;  1L1O B;  4MTN A;  2R7F A;  3STB C;  4A3K H;  3ERS X;  3I4O A;  5HGQ A;  4BXX H;  4A3C H;  3CXC A;  2ES2 A;  4IPD A;  1VQL A;  2PI2 A;  4LF7 L;  3HOV G;  3E9H A;  2UUA Q;  1N33 Q;  2NN6 I;  1WYD A;  4LF6 L;  4DR2 Q;  4UPA A;  1CUK A;  1WJJ A;  2VW9 A;  4DV6 Q;  4P73 A;  4R4C A;  1E3P A;  1PH3 A;  3AFP A;  4YY3 Q;  4JI8 Q;  2VQF L;  4DUZ Q;  1E22 A;  2ID0 A;  3HKZ G;  5IP7 G;  3CCM A;  2CCZ A;  3E9I A;  4X65 Q;  3H0G G;  5AJ3 Q;  1QZG A;  1VQI A;  2UUB L;  2VQE Q;  1VQK A;  1BBW A;  1X56 A;  2ZTD A;  3IRB A;  1MJC A;  2R92 H;  1V9P A;  5ELN A;  3RNU A;  4LF5 Q;  4DR7 L;  4GN5 A;  3RLF A;  4JI4 L;  4R4I A;  3G48 A;  2N3S A;  1N34 L;  4DR4 L;  2ZTC A;  4BBR H;  3I56 A;  2IHE A;  1IBL L;  4JI2 Q;  5FLM H;  4P71 A;  3HOX G;  4JI6 Q;  1XNQ L;  1SE8 A;  4RMF A;  5M5X H;  4LUO A;  2MNA A;  2Q2T A;  1X65 A;  2PNH A;  4PZ8 A;  3H15 A;  1SRO A;  3A0J A;  4OWX B;  1RL2 A;  4POG A;  1X6O A;  1XTD A;  3PV0 A;  4A3K G;  1IBM L;  4BXX G;  4A3C G;  4JYA Q;  2YYZ A;  4HJ7 A;  1JE5 A;  4LW1 A;  1YI2 A;  3F2D A;  2N78 A;  4PZ7 A;  4A93 H;  3T1H Q;  1EUJ A;  1VQB A;  3OTO L;  3J81 c;  4OWW B;  3BJU A;  1VQM A;  1EIF A;  4JI0 Q;  1YHA A;  2WAQ G;  1KRT A;  5H1S E;  4DV5 L;  1NBW A;  1TWF H;  2BA1 A;  4JBM A;  2R92 G;  3S2D H;  4A4I A;  2JEA I;  2WAQ E;  3I4N H;  1N32 Q;  2JK8 A;  1EOV A;  4NB3 A;  4LFA Q;  3PUW A;  1EYG A;  2R93 H;  1OXT A;  4BBR G;  2K5H A;  1YHB A;  3T1Y L;  1OTC A;  4L5S A;  5FLM G;  1CSQ A;  2UXB L;  1PH8 A;  4OO1 I;  1NTG A;  4HIM A;  1HR0 W;  4JI1 Q;  4C3H H;  2ALY B;  4DR5 Q;  3M4Q A;  3ULP A;  3K7A H;  1TWH H;  1WOC A;  2FXQ A;  4FDB A;  4B3T L;  5C0X I;  3FHW A;  5C3E H;  1M90 C;  4DR2 L;  3KYH C;  4C3I H;  4DV6 L;  1NMF A;  4UP9 A;  3B6Y A;  1A62 A;  2K4K A;  3PF5 A;  4A93 G;  2YU9 H;  2F4V L;  1E1O A;  4X62 Q;  4DUY Q;  1P8L A;  3W1G A;  4A75 A;  4JOI A;  1QZH A;  4XTC S;  4DV4 L;  4XIG S;  5IY0 A;  3S15 H;  3ULJ A;  1XMO Q;  2HHH Q;  4POF A;  2WFW A;  2BH2 A;  3J80 i;  1BBU A;  3KOJ A;  1HJP A;  4X66 Q;  3CC7 A;  2NN6 G;  2ASB A;  3I4N G;  3OW2 A;  3HOW H;  2UXD Q;  3NEL A;  4IJL A;  1KC8 C;  1K83 H;  2EIF A;  5J3B A;  1X9N A;  1KIX A;  4A3I H;  3NBH B;  2E5L Q;  2PQA A;  2R93 G;  4WJ4 A;  4LFB L;  1D7Q A;  1L1O C;  1PH5 A;  2ZM6 L;  1QVC A;  3S17 H;  1VQC A;  1FVI A;  2K75 A;  5LMN L;  4DR3 Q;  2JA5 H;  3GO5 A;  4JYA L;  3S1R H;  1I94 Q;  2OTL A;  2E2J H;  5IWA Q;  1PH6 A;  4TVA B;  1K3R A;  5IYB H;  5IP9 H;  3J7Z C;  1PH7 A;  3M4O H;  5C3E G;  3T1H L;  3PO2 H;  1C0A A;  1B8A A;  2DUD A;  5JJK A;  4LF8 Q;  1TWG H;  4HJ9 A;  3MXN B;  1HNW L;  2B3G A;  2OQ0 A;  2XGT A;  4BA2 I;  1JJ2 A;  2Q2I A;  3LGJ A;  4LUV A;  4NXM Q;  1YNX A;  3DM3 A;  3K81 C;  4GKJ L;  1XNR L;  2KHJ A;  5EAY A;  4DV0 Q;  3UDF A;  3HOW G;  1Q81 C;  2L15 A;  3CCJ A;  3H0G H;  1FJG L;  4IJH A;  1W2B A;  3RZD H;  2NZO A;  3UDG A;  3BU2 A;  4A76 A;  4JI1 L;  1B7Y B;  1U5K A;  5BR8 L;  2GVB A;  3GTJ H;  1XMQ L;  4JI3 Q;  2UU9 L;  2JA5 G;  4JC0 A;  1MKH A;  3UDX A;  2ZJQ A;  3PUZ A;  3HOZ H;  3M85 A;  3KDF B;  1GM5 A;  3S14 H;  3CCL A;  2YTV A;  2NVX H;  4KHP Q;  5IYB G;  5IP9 G;  4DR1 Q;  4GN4 B;  5LMU Q;  3GTQ H;  4X62 L;  2E2I H;  4OO1 G;  3VDY A;  1Q82 C;  3STB D;  1QUQ A;  4DV1 L;  2KCT A;  1KAW A;  4P72 A;  4BA1 I;  1XMO L;  2YTY A;  4X64 Q;  3KLW A;  3GTG H;  5ELO A;  3S1M H;  1C9O A;  3F8T A;  4X66 L;  5FJ8 G;  2I5M X;  5C0X G;  2OTJ A;  4A3G H;  3PUX A;  3H3V I;  3M7N A;  3M4P A;  1CKO A;  3G6E A;  2WB1 G;  3JC6 6;  3U4V A;  5GAE C;  1VQ5 A;  2ZJP A;  1VQ7 A;  1CSP A;  3J80 c;  2JA8 G;  4IFD I;  3KJP A;  2K50 A;  4A3E H;  2UXC Q;  4JBJ A;  2KEN A;  3HKZ E;  4R1J A;  3HOY H;  2VUM G;  1I94 L;  2UUC L;  1E1T A;  4JV5 L;  4PZ6 A;  1X3F A;  5IWA L;  3HOZ G;  4DR6 L;  2NVT H;  1Q46 A;  3HFZ B;  1EFW A;  5C4X G;  2BA0 A;  4JI7 Q;  1QVG A;  4GKK L;  4DV3 Q;  1JJC B;  4LUZ A;  4LF8 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...