1XNQL

Structure of an inosine-adenine wobble base pair complex in the context of the decoding center
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Structure of a purine-purine wobble base pair in the decoding center of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 15
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2004-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1xnqL00
4A3GH 3BZCA 1TWAH 3HKZG 4AYBG 3CCEA 3KFUA 3S1MH 4TVAB 4DV7L 3F2CA 3PO2H 1MIUA 1XMQQ 3PF5A 1P16A 1IL2A 3F2BA 4HJ9A 2DUDA 4R1JA 5JJLA 1IBML 2UXBL 3M4QA 5ELOA 2NN6I 3BJUA 3TREA 1HH2P 1VS0A 4JI7Q 5JJKA 2YV5A 4HJ5A 4QL5A 1N34Q 3WWVA 1L1OC 1MJCA 4UPAA 1Y1WG 3HOXH 1N36L 2I0QA 4LF9L 1GM5A 4OONA 1PH3A 1FGUA 3RR5A 4LFCQ 1PH1A 2VUMH 3BZKA 4UP8A 4YCUA 1YJWA 4OWTB 1EUJA 1YBYA 3U4ZA 4DUZL 4JI3Q 1XNRL 1XMOL 2JA6G 4JV5Q 4P72A 4LF7Q 4JI4Q 1XPRA 2AHOB 1HR0L 3OW2A 5C4XH 4J15A 1SROA 5C44H 1S40A 1I6HH 3TS2A 5HY6A 1L1OA 1VQDA 2K14A 3ICEA 5IT9c 1DGSA 4DV0Q 3I4OA 4ALPA 1PV4A 4DV2L 4PZ6A 3UDGA 1YIJA 5IYCH 3J80c 4B3RQ 4Y52H 1B8AA 3KYHC 1L1OB 5M5XH 4OWXB 3I4MG 3RNUA 1J5EQ 3PF4A 4LUVA 3CCJA 3D31A 4IPDA 1X6OA 1LM0A 3PO3G 4LFAQ 1EQQA 4IOAA 1XPUA 3G48A 3CCSA 2K5HA 2N3SA 3ULLA 2ES2A 5LMNL 3PV0A 2E2JH 1K8GA 1RL2A 2K52A 5JEAG 1BBUA 2B3GA 3EN2A 1NTGA 4LF6L 1N32Q 4DR5L 1JT8A 1X56A 2KHIA 3GO5A 1Q81C 1D7QA 1G6PA 4JI1Q 1SMXA 2WAQE 1RIPA 3ULJA 1LUZA 1JJCB 3AEVA 2HHHL 2R92G 1W3SA 1X3EA 3AYHB 4DR1Q 1HNZL 1HZ9A 1WCMG 1Y1WH 3HKZE 3ER0A 3E9IA 4LF4Q 1FJGL 4K0KQ 1SRUA 3EBEA 1B7YB 2Y0SG 4AQYL 1UE1A 3H3VH 2JA6H 2UUBQ 2HQLA 1WOCA 2MO0A 4JCVE 4B3TL 3J81i 4A3IG 4NXML 3ERSX 3CPWA 1X9NA 2JK8A 4DPGA 2QA4A 3A74A 2NN6G 4DR2Q 4HJ7A 1PH5A 3GTQH 2VNUD 4APVA 1Q7YC 1Z47A 1MKHA 1NMGA 2ATWA 4X66L 4OX9L 2Q2HA 1KQSA 2E5LL 4A93H 5AJ3Q 4GKJQ 2UXDQ 4DR6L 2OWOA 2B63G 2JA8G 5K36G 1E3PA 4C3IH 2D0OA 4A3FG 3AFPA 3L2PA 1I50H 2VL6A 1YJNA 3JAMi 1OXUA 2UU9L 3I4MH 1QZGA 4DR7L 4B3MQ 3GDEA 4DV1L 1JB7A 4P73A 1EOVA 3GTLH 3UDIA 1E1TA 5IYDG 4A4IA 1KIXA 3PO3H 4IFDG 2EXDA 4X65L 3PIOA 5EAYA 3UE1A 3CMAA 4HJAA 4KLKA 5M5YH 1PA6A 1YJ9A 4IO9A 1E24A 1VQGA 2ID0A 3PUZA 2Z6KA 3S14H 4OO1G 3A5ZB 3TRZA 3M7NA 3I2ZA 1WJJA 5BR8L 1TWGH 4C3JH 1C7YA 2AWNA 2B29A 3PUXA 4DKAC 2R92H 1C9OA 2K5NA 4QJFA 1A8VA 1S72A 3CCLA 1SLJA 5IYBG 4R4TA 3CP0A 2ZJPA 1HR0W 2BH2A 2GVBA 3OTOL 1TWHH 1V43A 5IP7G 1K0RA 4BBRG 2VY3A 3RLFA 2OQKA 2VQEQ 1XNQQ 2OQ0A 1YHAA 2DGYA 1SN8A 1Y14B 4NPSA 4OXPA 2BA0A 1PYSB 4L5RC 1GKHA 2HIVA 3H0GG 3W1BA 3D0FA 2VQFL 1JJ2A 2IX0A 2F4VL 1NJIC 4EQ5A 4X62L 1Q12A 2B63H 4A3MG 2AWOA 1J6QA 2AKWB 2IT1A 4A3FH 1IBLQ 3KDFA 3J7A5 1QUQA 1VQJA 3L7ZC 4H02A 5C4JH 2KBNA 2ASBA 5GADC 3T1YQ 4B3SQ 1VQFA 1JJGA 4JI2Q 3T1HL 2QGQA 4GOPC 4JI0L 3KF8B 2K75A 2Q2TA 3RLOA 2R7FA 2IHFA 2XTIA 4BBSG 3KDFB 5LMNW 1QUQB 1KAWA 4RG1A 4XTCS 3I56A 4DUYQ 2NVXH 4BY1H 2UXCL 2AMCB 3NBHB 5M3MG 2GVAA 1K8AC 3I7FA 3HOUH 3M4OH 1YITA 3CAMA 4NXNQ 2JE6I 1VQPA 1Q1EA 1Y1VG 4BY7G 1VCIA 3GTPH 4RMFA 2PI2A 3HOVG 4GOPA 1K73C 4GKKL 4KHPL 2QEXA 1UWVA 4GN5A 1E7ZA 5FJ8G 1PYBA 1I94L 1KC8C 1VQOA 1HJPA 1OTCA 1UE5A 2UUAQ 4DV3Q 4GOPB 2N78A 5IYBH 4GLXA 2JA5G 4JI6Q 5IP7H 5ELNA 3S1RH 4PG3A 5IY0A 2IX1A 2A19A 5C0XI 4JI8L 3TEHB 1YNXA 1HZBA 5C0XJ 4DR4L 3OYYA 4KI0A 1IXRA 2JA7G 2E2IH 3H0GH 4LFBL 1IBKQ 2C35B 4KHZA 1G51A 1YHBA 1HNXQ 2CWPA 3K80C 3RN5A 1Z9FA 1UEBA 5FLXc 1HNWQ 1TXYA 1VQHA 4JC0A 4AIMA 3U58A 2UUCL 3TS0A 4JI5L 2ZTDA 4EX5A 3K0XA 2JEBI 2JA9A 2Z0SA 3PCOB 1H95A 3GTOH 4YWLA 4DV4Q 1PH9A 4GN4B 2XGTA 4DV6Q 4BBSH 1R9TH 4LF5Q 1A0IA 3CQZH 4GLVB 4IJHA 4UP9A 2YYZA 4R4QA 1KHIA 5M3MH 2E2HH 1Q82C 1VQKA 2WB1G 4HJ8A 2A1AA 1SFOH 1TWCH 4R4IA 3M85A 2MQHA 4FDBA 1XMQL 4GNXC 1Y1VH 1CKMA 2H5XA 3RLNA 4BY7H 4MZ9A 2YTXA 3RZDH 4AYBE 3HOVH 3AQQA 1KL9A 2L15A 2R7DA 3K7UC 4JOIC 4A3BG 5FJ8H 1UE7A 2ZJRA 5GROA 4UP7A 4LF8Q 3HOWG 2F3IA 4JI7L 4QY7A 3PUYA 2NZOA 4YY3Q 1N34L 4YHHQ 4P75A 5IWAQ 4DR3Q 1X54A 2BH8A 4X64Q 1PH6A 3U50C 1K9MC 2JA5H 1SR3A 3STBC 4LFCL 1EIFA 3M3YH 3RZOH 1NY4A 4PMWA 1ASZA 1EWIA 1CKNA 4DV5Q 1K83H 4JI3L 4JV5L 3KLWA 3S2HH 4JOIA 2JA7H 4LF7L 2YTVA 4JI4L 2K4KA 3UDXA 4MTNA 1N9WA 5LMUQ 4NB3A 1VQ5A 1IZ6A 1LTLA 1E1OA 3G4SA 5IP9G 4IOCA 1PH2A 4UY8C 1CKNB 3F8TA 4Y7NH 1X55A 2ZM6Q 1CSQA 3KJOA 4WJ3M 4AH6A 2LXJA 2A8VA 4DV0L 2EQSA 1CKOA 2VS1A 4IJLA 3TQYA 3DLLA 1VQMA 2GN5A 4B3RL 4DV7Q 2R6GA 1N33Q 4BA2I 3S24A 1J5EL 2R93G 4L5QA 3CCMA 1PVOA 1EIYB 1VQLA 3B6YA 3GTGH 3FHWA 2OCEA 2RF4A 2F52A 2E8GA 1M90C 4LFAL 1IBMQ 2UXBQ 1PH4A 1AE3A 4DNIA 1QZHA 1WCMH 3J80i 3GTJH 3FKIG 1N36Q 4A3BH 3H3VI 4LF9Q 1N32L 2OTJA 4QIWE 5HGQA 3HOWH 1TWFH 2WP8J 4JBWA 4JI1L 4A3IH 4JBKA 4ME3A 3DM3A 4LUOA 4R4CA 1XNRQ 3H15A 4DR1L 1YVCA 3STBD 1XMOQ 1KRSA 4P74A 1CUKA 3W1GA 1HR0Q 4LF4L 3GD7A 1Q8KA 4MNOA 4HIKA 1PHJA 4LNQA 2V1CC 3CCQA 3HOXG 4K0KL 1XJVA 3PIPA 2PMZE 3Q8DA 5GQOA 2UUBL 2NVTH 1C0AA 2JA8H 1YEZA 4O2DA 2Y0SE 4DR2L 4GN3B 4DV2Q 3CCRA 2CCZA 2ZJQA 2LSSA 4IPHA 5IP9H 4HIDA 4A3LG 4JYAL 2UXDL 3A0JA 4GKJL 1VQ6A 5H1SE 5C44G 5AJ3L 5M3FG 1A62A 1PH7A 5IYDH 2RCNA 3NEMA 1EFWA 4PZ7A 2YTYA 2N49A 4HIOA 5DLQE 1U0LA 1VQAA 3CXCA 1V1QA 3J81j 2R7ZG 2I5MX 3S1NH 5C3EG 4A3CG 2ALYB 2NVYH 4GLAC 3K7AH 1VQIA 3U4VA 3RN2A 5LMNQ 1U5KA 5JEAJ 3UDFA 2R93H 3JC66 3AFQA 4B3ML 3MEFA 3PUVA 3GTKH 2WAQG 2PNHA 1YI2A 3S1QH 1CSPA 1VQ7A 4LF6Q 3G71A 4L5TA 4DR5Q 1VQBA 4TQUS 4IPGA 3J81c 4YWKA 2OTLA 4A3EG 3SGIA 1LYLA 4DK3C 1PH8A 1N33L 5E7NA 2HHHQ 3FKIH 1HNZQ 4BA1I 1VQNA 1FJGQ 3ZJYC 1XPOA 3S16H 4BBRH 3K81C 2MFIA 4AQYQ 3GTMH 5JJIA 2MNAA 4QQBX 2HIXA 4A3JG 1VQ4A 4B3TQ 3HOZG 4JBJA 4NXMQ 3EIVA 3IRBA 1AE2A 1W2BA 3JAMc 3CC4A 3PGZA 2MO1A 4X66Q 4OX9Q 4A3MH 3KJPA 1GVPA 2E5LQ 2VQEL 1XNQL 1QVFA 4DR6Q 2D0PA 2NZHA 1FL0A 4YCWA 2KCMA 5GAEC 4A3LH 3F1ZA 2CKZB 2WFWA 3UE0A 4DAYB 4XIGS 5M3FH 2UU9Q 4DR7Q 4IFDI 3PSIA 4A75A 4P71A 4IPCA 4C3HH 4DV1Q 4IFDJ 1IBLL 2Q2UA 2KCTA 1NE3A 2ZTEA 1VQCA 1EQRA 1AH9A 1QVCA 2R7ZH 3MXNB 4X65Q 5C3EH 3T1YL 4B3SL 4A3CH 1UE6A 3S17H 2KENA 4JI2L 3FP9A 5M5WH 1P8LA 5GAHC 3J7ZC 4OO1I 4A76A 5GAGC 4JG2A 2EIFA 1WFQA 1OXTA 1PFSA 2VW9A 4DUYL 1N8RC 4A3KG 5BR8Q 1BBWA 2Q2IA 4L5SA 4LW1A 4A3EH 1X65A 3KOJA 3E9HA 2KHJA 3CMEA 3CPFA 4NXNL 2I5LX 4R4OA 3CC7A 3NELA 3HKSA 3S2DH 4GNXA 2CWAA 3OTOQ 4A3JH 3HOZH 3F2DA 2JEAI 3W5OA 1KXLA 2CQOA 3CCVA 4LWCA 4POGA 2UUAL 1A63A 1L0WA 1OXSC 4DV3L 1VQ9A 1XTDA 1X3FA 1NBWA 1HZCA 5FLMG 2RHQB 2I5HA 4GNXB 2VQFQ 1YHQA 4JI6L 4LUZA 1JMCA 2N8NA 3I4NG 3M9BA 2F4VQ 4BXXG 4X62Q 1QVGA 1V9PA 3CF5A 3HFZB 1KRTA 5C0XG 1SE8A 5J3BA 2JQOA 3E0EA 1L2FA 3G6EA 3T1HQ 1IBKL 5IE8A 1HNXL 4JI0Q 1HZAA 3HOYG 4O0AA 4HIMA 1O7IA 4OWWB 1HNWL 1VQ8A 2UXCQ 1I5FA 4A3DG 2NVQH 2VZAA 3LGJA 4POFA 1JE5A 1K3RA 1YZ6A 1GO3E 2D62A 2K50A 2Z6KC 4DV4L 4A3GG 1I3QH 4DV6L 1BVSA 2JJQA 3K8AA 4LF5L 3PO2G 1GD7A 1EYGA 3S15H 1T9HA 4X6AH 4A3KH 2HT1A 2IHEA 2PQAA 4BY1G 4GKKQ 4KHPQ 1I94Q 3HOUG 4DUZQ 2PI2E 1WYDA 2WB1E 1G291 2PQAB 1FVIA 1S3OA 2CFMA 2ZTCA 2LXKA 2RHSB 3BU2A 4LF8L 4WJ4A 1ASYA 3I55A 1Q86C 2BA1A 4JI8Q 2YU9H 2VUMG 1X3GA 2K5VA 4A93G 2FXQA 4YY3L 4DR4Q 4QGUA 4PZ8A 5IWAL 4C2MH 4YHHL 4DR3L 5FLMH 4X64L 3CW2C 4JBMA 1BKBA 1OXXK 1E22A 4LFBQ 1KD1C 3M4PA 3I4NH 5C4XG 4YCVA 4BXXH 3NENA 4DV5L 1WI5A 3ULPA 2UUCQ 4JYAQ 1VQEA 1MJEA 1IYJB 3KF6A 4JI5Q 1D8LA 1Q46A 3CCUA 5LMUL 1Q1BA 1NMFA 4YWMA 4DK6C 3HOYH 5IYCG 2ZM6L 3L0OA 1B70B 3VDYA 4GS3A 3A5UA 3CD6A 3PUWA 3KF6B 3CC2A 4A3DH 4DAMA 1OXVA 1M1KC 2IY5B
chains in the Genus database with same CATH superfamily
2SEBD 3BZCA 3KFUA 2A6HD 1SNMA 4OEMB 4DV7L 3F2CA 1MIUA 5JJLA 3VYUA 1SSOA 1IBML 2UXBL 4LK1C 5ELOA 3I4MB 5F2DA 3V2TA 5EPLA 4HJ5A 1N34Q 4KY5A 1AEXA 3SEBA 3I70A 4J6HA 4IALA 4QIWB 1PH1A 2VUMH 3BZKA 4UP8A 2JA6G 1YBYA 4DUZL 4G4KA 1XMOL 4JI4Q 4R8NA 1H9MA 5C4XH 4RCNA 2B8GA 3FPPA 2F0UA 1VQDA 1L0YB 2K14A 5CV6A 1JOOA 1PV4A 4IUNA 4PZ6A 1QG7A 3D8GA 3J80c 4B3RQ 5CBEE 1B8AA 3I4MG 3RNUA 1X6OA 1LM0A 4IOAA 1EQQA 3MXPA 3G48A 5LMNL 3PV0A 1Y8PB 1BOSA 1K8GA 1RL2A 2K52A 1I6VC 2E2JH 1NTGA 1D1KA 2N55A 4KK7A 1EYDA 2KHIA 3GO5A 1HTPA 3ULJA 1LUZA 4C3JG 3AEVA 1X3EA 4F88A 1QOHA 1HNZL 1HZ9A 5T1GA 1AW7A 1UE1A 2BDNA 2JA6H 1XYIA 2MO0A 4JCVE 3VA5A 2K04A 2KOLA 3A74A 4DR2Q 3BS1A 2K1BA 3BYYB 2EYOA 1M4VA 1RDPD 2RA4A 1XX8A 1CFMA 1KQSA 2E5LL 2EYHA 4FF3A 2OWOA 4B9WA 1E3PA 2EXZA 5I6WA 4PQXA 1KTKA 3JAMi 3I4MH 1H9JA 4DV1L 2F0VA 5IYDG 5IIFA 4FF2A 4BWGB 4WORA 1A2TA 3UE1A 4HJAA 4KLKA 3I3CA 1PA6A 1VQGA 1GUSA 2ZXRA 2FHTA 1WJJA 5BR8L 4KMUC 4C3JH 3J81E 4B9XA 4BBSB 3PUXA 4H0LC 2K5NA 2HUGA 2B2VC 1EY0A 4R4TA 3CP0A 2ZJPA 5CV5A 1V43A 3DWAA 2VY3A 2EOTA 2OQKA 1XNQQ 4NPSA 3URYA 1Y1WB 1PYSB 2MUYA 3WOFA 4BS9A 3RZDB 2CHBD 2XWBB 3HOVB 2D9UA 2VQFL 4ZKBB 2EYPA 1X3PA 2PZWA 2BDOA 3EA6A 1NJIC 4A3MG 2IT1A 1J6QA 2B2VA 4RKLA 1QUQA 4K2KA 4RAUC 5C4JH 2KBNA 1A6XA 2QGQA 4JI0L 4BBSG 3KDFB 5LMNW 4RG1A 2UXCL 4DUYQ 4L63B 3NBHB 3P1HA 3T16A 2QILA 3DMUA 4KV6A 4NXNQ 1YNJC 5JAVA 3KLSA 3HOVG 3LX0A 1K73C 4K6DA 1DOLA 1B3AA 1U4MA 2WB1B 2N78A 2PW5A 2L9HA 4Q0FA 3BVMA 4UHVA 2A19A 1WCMB 2WV6D 1HZBA 3GTJB 5C0XJ 4KI0A 1VMCA 3R93A 2DJGC 1B4OA 5D65A 1IBKQ 2CWPA 5EGTA 4A3IB 1UEBA 1Z6HA 2F0EA 2Z0SA 3PCOB 1H95A 4DV4Q 1PH9A 2EJMA 2XGTA 4BBSH 4M8AA 5CV8A 2K03A 4RGMA 4GLVB 4R4QA 1KHIA 2WB1G 1YNJD 1QB5D 2CH4A 4I7AA 3OWEB 3M85A 4MZ9A 3KUPA 3RZDH 3HOVH 1KL9A 2L15A 3K7UC 4UP7A 2NVYB 3GTLB 4QY7A 3WOEA 5IODA 1N34L 4YHHQ 4P75A 4G7HC 1X54A 2BH8A 1PH6A 3U50C 1ENAA 3D4RA 4PMWA 3DHQA 1CKNA 1PZKD 1ZEQX 3KLWA 1EY6A 1TIID 5DAUA 5J39A 4JI4L 3K6OA 1VQ5A 1F2MA 1IZ6A 4IOCA 5IP9G 4RWSC 4UY8C 4Y7NH 1JWMD 2ZM6Q 1CSQA 1BDOA 2LS01 4G57A 4B3RL 1CQFA 5FK9C 4BA2I 3CCMA 3C2PA 4OL7A 3Q6SA 1DOMA 1AE3A 3PIO3 1G6ZA 1QZHA 1GUGA 1WCMH 3GTJH 5EJWA 1MGSA 4LF9Q 2V4DA 4JBWA 4A3IH 1F9RA 3DM3A 4OGQC 4CKBA 1XNRQ 4BY7B 1ENFA 5DNFA 4P74A 4H44C 4HIKA 4MNOA 2EVBA 3CCQA 4MHEA 1XJVA 3N52A 4FVMA 1GUTA 1QNKA 2Y0SE 4DR2L 2K32A 4DV2Q 1C8CA 3S2DB 2BCOA 4IPHA 5IP9H 1O80A 2F3WA 5DM73 5C44G 3AMUA 2EPBA 1PH7A 1LTTD 5M9OA 1EFWA 5IT9E 2E76C 3W2DA 5COYA 1JE4A 2F3VA 2WIIB 1PTOB 2ALYB 2NVYH 1H9KA 3GTLH 4DU9A 1EY5A 3H94A 4DAPA 2PNHA 1S5BD 3K5LA 4LF6Q 2PPBC 3VYSA 4K5WA 1VQBA 4TQUS 4QMGA 2HDMA 1L0XB 1LYLA 1N33L 5E7NA 2HHHQ 3BDLA 1PTOF 1FJGQ 1VQNA 1STEA 3Q23A 4IUPA 1SEBD 2MNAA 1WTQA 2A6EC 2HIXA 1VQ4A 3EJIA 4NXMQ 3S15B 1ONLA 2B2WA 1ZKOA 2KECA 5TSSA 4X66Q 3E5SA 3KJPA 2RDFA 1XNQL 1TR5A 1FYCA 5CR3A 1Y8NB 2R61A 4HAEA 1NUCA 2MP1A 4A75A 4IFDJ 2F0GA 2ZTEA 1X3QA 1AH9A 1D5XC 3MXNB 1UE6A 3I90A 1PDQA 5CBAE 3FDTA 1P8LA 3BVGA 4OO1I 5ISRA 3K59A 5GAGC 1WFQA 1OXTA 1PFSA 5A2QE 4DUYL 4A3KG 2RVLA 4LW1A 1X65A 5ELFA 3H6MA 4NXNL 1TS3A 4R4OA 2FFKB 2KUMA 2A6ED 1GUNA 3NELA 3HKSA 3S2DH 4A3GB 3LWEA 1M8AA 3F2DA 3W5OA 2JEAI 3CCVA 1K3BC 1W6JA 2FMMA 1BF4A 1OXSC 1EZ8A 2RHQB 3R3OA 1PTOH 3M9BA 5BN3A 1SJHD 3HFZB 1KRTA 3HOXB 1SE8A 5J3BA 2JQOA 1IBKL 1L2FA 3G6EA 4HIMA 4A93B 1O7IA 1PFMA 1I5FA 2NVQH 2WINB 4DV4L 4A3GG 1GO3E 2Z6KC 1EY4A 3PO2G 4K14A 1QILA 1EYGA 3S15H 2IX3A 4A3KH 2HT1A 4DXGA 4BY1G 4KHPQ 3NTHA 1I94Q 1K8MA 1WTXA 4DUZQ 1E2WA 2KQ3A 2LFNA 5JVH3 1G291 3MAQA 3E6ZX 1R4QB 1ZYRC 1HQMC 3BU2A 4WJ4A 4JI8Q 4A93G 2FXQA 4YHHL 3NE5B 4PZ8A 2K01A 3CW2C 4JBMA 1E22A 4ID6A 4JW0A 1FNWA 2UUCQ 1MJEA 4JI5Q 2ENBA 3HG9A 1Q1BA 1SNQA 4YWMA 3DEPA 2ZM6L 1B70B 3VDYA 1CA6A 3ZYYX 3KF6B 2EY1A 4GZYC 1OXVA 4A3GH 4ILWA 1GUOA 3D6CA 4TVAB 3PO2H 1XMQQ 1P16A 1IL2A 3F2BA 4C3IB 1S5DD 4HJ9A 2DUDA 4R1JA 1I3QB 1HPCA 1VS0A 4JI7Q 1EIHA 3GV6A 1ZYRD 1WVLA 3WWVA 1MJCA 3HOXH 2I0QA 4LF9L 1HHVA 4NP5A 4LJZC 2EYMA 1FGUA 4LFCQ 1IYVA 2SNMA 1BQQT 4YCUA 4XQJA 5FKAC 1YJWA 3U4ZA 1HUMA 1XNRL 4A93H 5KGUA 2Q8IB 3OW2A 4K8JA 1SROA 1TWGB 3TS2A 2YU9B 4FO2A 2Z4IA 4DV2L 1DJRD 3TDQA 1VDZA 4QF4A 1AP0A 4FF4A 1RHPA 1L1OB 4H7BA 1J5EQ 3PF4A 4LUVA 3CCJA 2OF1A 3CCSA 5G3LD 2B63B 3R2TA 2Z6BA 3D4WA 4ODGA 3VA7A 5KIXA 5JEAG 4A3FB 4LF6L 1JQYD 2KVMA 2WAQE 1JB3A 1RIPA 2F0NA 1STBA 2HHHL 1W3SA 1SNDA 1FJGL 4K0KQ 4QCLA 3EBEA 1TS5A 2HQLA 1WOCA 4NXML 2KJXA 1X9NA 2JK8A 1EIGA 3GTPB 3X3MA 4IQZA 4LAAA 1Z47A 4MTKA 2ATWA 4JYAQ 4X66L 2Q2HA 3OPOA 1STGA 2B63G 5K36G 4C3IH 4A3FG 2ZXOA 4RKBA 5C4XB 3L2PA 2VL6A 2ZT9C 5FO8B 2SNSA 3S1RB 3Q22A 4IUTA 2F0OA 4B3MQ 4P73A 1F9PA 1BCPB 3UDIA 4A4IA 3OIPA 1SMYC 3PIOA 2JN4A 5I9OA 1H9SA 3OMGA 1LACA 5JEAH 1E24A 2DNCA 1K0SA 3G6JB 4OO1G 4Z9CB 3A5ZB 3I2ZA 1R4PB 4J8QA 3NTIA 1TWGH 1BCPF 2AWNA 1R9TB 1C9OA 1A8VA 1CHQD 2M2LA 4E6IA 5IYBG 1BUVT 3SHLA 2GVBA 1SFOB 4BBRG 2CW0C 2Z4HA 2DN8A 3RLFA 2VQEQ 2I07B 1YHAA 2OQ0A 1SN8A 4OXPA 2BA0A 1I4HA 3GV3A 4RGTA 2HD3A 2IJ0A 2B63H 5K36H 4A3FH 2A5HA 4ZAIA 5HGTA 3J7A5 4UAIA 3L7ZC 2ASBA 2TSSA 5IOCA 4B3SQ 3EVQA 4DF7A 4GOPC 3KF8B 2K75A 2Q2TA 1KLUD 1EWCA 2IHFA 2R7FA 1SMYD 3RLOA 5CC4A 4WRDA 1JWSD 4DXFA 1K8AC 3X3NA 1YITA 3CAMA 2RQXA 2PZTA 4I65A 1F2YA 4OO1H 1VCIA 3GTPH 5IGFA 1LTID 4GOPA 4KHPL 1UWVA 1I94L 1HJPA 4HN7A 4JK1C 1UE5A 3T53B 5I4DA 2KA7A 4GLXA 2CW0D 2OEOA 5IYBH 2JA5G 4ULLA 2E2DC 5ELNA 4C3JB 3S1RH 1WTWA 5IY0A 1WTHA 5C0XI 1CHPD 4JI8L 2PMZB 2N88A 1X32A 4MN3A 1PYWD 1S5FD 1CTMA 4KHZA 1G51A 4ZYSA 3NP8A 1Z9FA 1HNWQ 1TXYA 4XQQA 2UUCL 3GQBA 4Q5VA 3U58A 3TS0A 4JI5L 2BE5C 4M1UB 2NVTB 1R9TH 4JPBW 2YYZA 3C1EA 5C4JB 1Q82C 1SFOH 4F87A 1S4ZA 4R4IA 1XMQL 1CKMA 1XXGA 4CKCA 1RCVD 1WTOA 1STNA 2R7DA 1KDAA 1UE7A 3S1NB 4LF8Q 2X6GA 3S1MB 4JI7L 3I91A 1DOKA 3OHXC 2NZOA 4K6LA 3S1QB 2JA5H 1U9RA 4X64Q 2F03A 3STBC 4LFCL 2Q8RE 3M4YA 4K5XA 1LT3D 2DY7A 1EEFD 2K4KA 1N9WA 3S16B 1LTLA 3T13A 1PH2A 1F9SA 3KBGA 3GTMB 3VR2A 1LT6D 2BE5D 2F0FA 3KJOA 1F2ZA 1CKOA 4LMQD 1PMRA 5EKLA 1VQMA 3J80L 3OIQA 4A3MB 1N33Q 1U4LA 2NYZD 1FNVA 3S24A 1J5EL 4L5QA 2E75C 2OCEA 2E8GA 4XDXA 1A15A 1PH4A 5M3FB 3J80i 4CHTB 3FKIG 1DONA 3H3VI 3NWSA 1B53A 2R7ZB 2OTJA 4QIWE 5HGQA 5C3EB 2I46A 1KABA 4JBKA 4LUOA 4R4CA 4FP5D 2DNEA 3STBD 1KRSA 3W1GA 2DY8A 4LNQA 1TS2A 1Q8KA 1SNPA 4K0KL 1PRTB 2V1CC 3OWFA 4A3EB 4MIUA 5CV9A 2PMZE 3Q8DA 2NVTH 1O78A 1HTLD 1TT2A 2CCZA 1GJXA 1E2VA 4HIDA 4JYAL 4A3JB 1VQ6A 5M3FG 3TBIB 1A62A 5IYDH 1PRTF 3NEMA 4DK0A 4KKUA 4N9PA 5DLQE 1U0LA 1MD2D 3C46A 1V1QA 2R7ZG 3S1NH 5KNCA 1OO9B 5C3EG 3RN2A 4Y7NB 3S1MH 3K7AH 1VQIA 2FINB 1U5KA 4KKTA 4B3ML 3MEFA 3PUVA 4IN3A 3GTKH 3S1QH 1CSPA 1VQ7A 1J9OA 4DR5Q 4KKSA 5EQ0A 4IPGA 2SOBA 4XT3B 1CI3M 3J81c 1NR2A 2OTLA 4A3EG 1PH8A 3FKIH 3ZJYC 4HCEA 1XPOA 3S16H 1MI2A 3K81C 2B2TC 3GTMH 5JJIA 1ESFA 2HDLA 2RSOA 4A3JG 4B3TQ 1FR3A 1V1OA 3IRBA 1AE2A 3IFTA 1EU3A 1CT1D 2QCPX 3CC4A 2K05A 2MO1A 3KLRA 3I8ZA 4DAYA 4A3MH 5EKKA 2VQEL 1QVFA 2D0PA 1FL0A 2B2TA 3F1ZA 2CKZB 1SNOA 5M3FH 4KY7A 2UU9Q 4IFDI 3PSIA 4P71A 4B08A 2LY7A 1NE3A 1LTRD 4C2MB 1QVCA 2R7ZH 2ICEC 4B3SL 5C3EH 1B9NA 3S17H 3FP9A 4A76A 2HQEA 2O5IC 2VW9A 2CH4W 2Q2IA 1A3UA 4A3EH 3QIAA 3CMEA 3CPFA 1PZID 4RGNA 2Z1CA 4A3DB 2F0TA 1BXTA 3NPPA 5E4WC 2CWAA 1XWEA 3J81L 4C1NK 4A3JH 5KYIA 1W6KA 3H91A 5FO7B 2JP1A 2EYLA 4LWCA 1NBWA 1HZCA 4GNXB 1SYEA 3I4NG 2F4VQ 4BXXG 1A3VA 1QVGA 4K5VA 5C0XG 2F0LA 4HMIA 5IE8A 1V1PA 4TKOB 2L1BA 1IW7C 2EYFA 4O0AA 5DM63 1HNWL 1VQ8A 1LV9A 1EFID 4A3DG 2IPKD 3FPUB 3LGJA 1K3RA 5FOBB 4FXGC 3LWUA 1PFBA 5C44B 1I6HB 2MJ8A 2JJQA 3K8AA 1JCKB 1D1IA 4X6AH 4CGYB 1CZGA 1RTOA 4KY6A 3HOUG 1WYDA 2WB1E 1CK1A 2EE1A 4ZLTF 1F9QA 4N8X1 1ZXTA 2PQAB 2J4XA 2CFMA 1SE2A 4AYBB 2LXKA 4LF8L 3I55A 2BA1A 3QG1A 1X3GA 1HA6A 4QGUA 4C2MH 4XQNA 4X64L 4LFBQ 3I4NH 4YCVA 4BXXH 2PQEA 3PIP3 1TY2A 3ULPA 3A8JE 4R9WA 3K5MA 5C0XH 1D8LA 1IW7D 2K5WA 2PYKA 4F8MA 5IYCG 3L0OA 1PLFA 3A5UA 3CD6A 5FLXE 3PUWA 4A3DH 1E2ZA 2H1EA 4X3SA 4IUQA 3GTQB 4AYBG 3CCEA 4HTHA 5KEEA 3DXJC 3PF5A 1G2TA 5BN4A 2MHVA 2NVQB 1I50B 1MSHA 3BJUA 3TREA 1HH2P 5JJKA 2ICIA 4A3KB 4UPAA 4FYDA 1GM5A 2FJ2A 1FGBD 5M5YB 4OWTB 4JI3Q 4JV5Q 4P72A 3HGBA 2AHOB 5C44H 1S40A 1I6HH 4XYQA 2R92B 2C5CA 5HY6A 3ICEA 5CYUA 3E3XA 5IT9c 4KD4A 4CDDC 3UDGA 5IYCH 4Y52H 4C1NI 5M5XH 4OWXB 3A7AB 3G7LA 3D31A 4IPDA 3TZUA 1XPUA 2B3GA 2MGSA 1F77A 3P7JA 1N32Q 4DR5L 1JT8A 1CQVA 1X56A 1Q81C 3NWTA 1G6PA 3PO2B 3MHBA 1JJCB 2R92G 3AYHB 2NVXB 4XT1B 4BY1B 2B8FA 3ER0A 3ND9A 1SRUA 1B9MA 5DEHA 1B7YB 5E3FA 2G5DA 3H3VH 1DZ1A 4NKLA 2UUBQ 4HEDA 4B3TL 5D3DA 4OHJA 3ERSX 5JOBA 3CPWA 1EY9A 3NQIA 2QA4A 2H4OA 2NN6G 5EPJA 1PH5A 3GTQH 1IYUA 4APVA 3L3OC 1Q7YC 1MKHA 2UXDQ 1VMPA 2EYJA 3NUCA 4QB4A 4CDCC 2JA8G 2M00A 2D0OA 4DN4M 4C56C 2J0TD 3AFPA 1I50H 4KHVA 5J22A 1YJNA 1TU2B 4N8FA 2D5DA 4HSPA 4P2CB 2UU9L 1QZGA 1K8OA 4KTAA 1JB7A 5IT9L 2C9OA 1EOVA 1E1TA 1D6EC 4IFDG 1KIXA 3K57A 5C6AA 5EAYA 2O4XA 5M5YH 1YJ9A 4IO9A 3TZDA 1SYCA 2ID0A 3PUZA 2Z6KA 1TQOA 4ZQ3A 3TRZA 3M7NA 4ZK9B 3GTOB 2Z8LA 1C7YA 2B29A 2R92H 1SYFA 1ET6A 3CQZB 5JJZA 1S72A 3CCLA 1LABA 1SLJA 2E2HB 3DWPA 1TWCB 1TWHH 2JXMB 1K0RA 2XRQD 4G7OC 1Y1VB 1LLRD 2DGYA 3PMFA 1SXTA 1Y14B 1SAPA 5EBDA 3MA2B 1AN8A 5LL6X 4L5RC 2HIVA 3W1BA 3D0FA 2L5TA 1ICFB 3MC0B 2F4VL 1KNAA 3QB3A 1Q12A 4EQ5A 3KDFA 1VQJA 1VF5C 3NBHA 2NZ1D 5GADC 3T1YQ 1JJGA 4JI2Q 3RZOB 2XVSA 2PNRC 1J8IA 3MZ5A 2F0DA 1I4RA 3CKIB 2NVXH 1QUQB 4IFDH 1QWYA 3D4DA 4BY1H 3S2HB 2JA7B 2L11A 2AMCB 1DYQA 3BDCA 2HCCA 3EQLC 2CQAA 1ESRA 1VQPA 3W3AA 1Y1VG 3RMHA 4WJWA 5FJ8G 3IFDA 1PYBA 1VQOA 1OTCA 4X3TA 1LT5D 4DV3Q 4ME5A 5J1ZA 2IX1A 4QUFA 2O5JC 3T51B 3TEHB 1YNXA 3SK5A 3OYYA 2JA7G 1D2BA 2E2IH 1EZ6A 4LFBL 5KYLA 1EQVA 3ERQA 3HOWB 1LTAD 1YHBA 3K80C 3M7GA 3MEHA 1Q8IA 2A73B 5CV7A 2QDBA 4I7ZC 3DUZA 2XSCA 3K0XA 2JA9A 4IZ8A 1EY8A 2K5QA 4YWLA 3GTOH 2SDFA 4KN4C 4DV6Q 3IKJA 3CQZH 4IJHA 4UP9A 4OIJA 3SXHA 3RUZA 2E2HH 1VQKA 4HJ8A 2A1AA 1HA5A 2RDHA 3CU7A 1TWCH 4ZUJA 1O7ZA 2MQHA 4FDBA 4GNXC 1Y1VH 3RLNA 2H5XA 1HQRD 3AQQA 2NBFA 1FNUA 4DA2A 4A3BG 5FJ8H 2TMPA 2ZJRA 2EY6A 3HOWG 2F3IA 4CJ2C 2R93B 1Z7TA 3PUYA 4YY3Q 3T56B 1B2TA 2KCCA 2KCNA 5EPKA 1WD1A 1K9MC 2KEEA 4FNFA 1S5CD 4ZKCB 3RZOH 1EIFA 2QKIC 1NY4A 1ASZA 4DV5Q 1K83H 2G9DA 4JI3L 4JV5L 3S2HH 2VB3X 2JA7H 2YTVA 2NTSA 4MTNA 1B1ZA 5LMUQ 3MFYA 4BBRB 3G4SA 4EQOA 1CKNB 1RTNA 3V96A 1HRJA 3OW7A 2JYOA 2A8VA 2OXPA 2VS1A 5IGEA 3MFGA 4IJLA 1IL8A 2IL8A 1EQTA 2R6GA 2O2LD 2R93G 1EIYB 1VQLA 4KJNA 2F52A 3NXWA 5IGCA 2B39A 3SE0A 4DNIA 4PNYA 4C3HB 1VF7A 5KRUA 3E0JA 1N36Q 4A3BH 1N32L 3A8KE 3TSSA 3HOWH 1DD2A 2WP8J 2K6AA 4ME3A 2EY5A 1NAPA 3H15A 1PTOC 1YVCA 1KDBA 4RHSA 1HR0Q 4RHRA 2NWGA 3GD7A 1PHJA 3PIPA 5GQOA 2UUBL 1C0AA 1YEZA 3I73A 3KLSX 2JA5B 3MXUA 3CCRA 3OMCA 4G7ZC 1UUPA 2UXDL 3A0JA 5H1SE 2RCNA 4C3HG 4HIOA 1G8ZD 4PMCA 4PV1C 1VQAA 3VYRA 3J81j 4A3CG 4GLAC 5D14A 2L4NA 3J80E 2R93H 3JC66 1YI2A 5L37A 3KBXA 1QE6A 3TP6A 3MTSA 4L5TA 3RD4A 5C4ZA 4YWKA 4IUVA 3CRLC 2K5DA 4DK3C 3H09A 1JC7A 2QW7A 3HZXA 3FVQA 1A3TA 1RODA 1SE3A 2L0CA 5LL6S 2L55A 3J7AV 4BBRH 1PTOD 1SE4A 2MFIA 4AQYQ 1RF2D 3HOZG 3BZDB 3HP3A 4JBJA 4N9TA 4ZCKA 1W2BA 3JAMc 1ET9A 5T1IA 4OX9Q 1ML0D 4HSVA 4DR6Q 1BBXC 2F0KA 2KCMA 5KNBA 1I4XA 3MXNA 2RSNA 5CORA 2WFWA 4L8JA 3UE0A 4ABNA 4XIGS 4DR7Q 1WD0A 3FRPB 3Q24A 4C3HH 3S9WA 1VQCA 1EQRA 5C3WA 4X65Q 3T1YL 4A3CH 3MVVA 4IURA 4JI2L 5GAHC 2XRSD 1HFGA 1ENCA 2NUCA 1N8RC 3QWNA 1BBWA 5E1FA 3K7AB 3KOJA 3HOYB 3GTKB 5C4HA 2I5LX 3CRKC 3TP8A 5D3IB 1SYDA 1T5XD 3U9OA 5CGKA 1I4GA 1TWAB 1NCVA 3OTOQ 4U68A 3HOZH 1LTGD 1JICA 5IGGA 4POGA 3FKIB 1MSGA 4DV3L 5CMDA 4LUZA 2N8NA 4X62Q 3R2IA 1ILPA 1V9PA 5C5LA 3DM1A 3CF5A 2E74C 2K7VA 3JAML 5EKIA 3ND8A 3T1HQ 3IL8A 1HZAA 3HOYG 1ICWA 2M9VA 4WFN3 3QOLA 1TKWB 2F0WA 2VZAA 4TRDA 1HCZA 3VR4A 4JVZA 4EQNA 1JWUD 4DV6L 1BVSA 4H13C 1B44D 1H9RA 1GD7A 2EJFC 3TP7A 1MBYA 1CM9A 2IHEA 4GKKQ 3S17B 1JORA 1GXDC 1QNUA 3ITPA 2PI2E 5A35A 3BYTB 2XIWA 3HKZB 2Z9HA 3BVZA 1JOQA 1KNEA 4KJOA 2K5VA 4YY3L 4DR4Q 4CKEA 4EGVA 2F0MA 3N6RA 3NENA 4DV5L 4ZRZA 3NTKA 3VYTA 1VQEA 4KN7C 3KF6A 3CCUA 5LMUL 1NMFA 2AUKA 2KEDA 3HOYH 4O1NA 4GS3A 3CC2A 1QJOA 1WTPA 3I72A 4DNTB 4DAVA 1HUNA 3NBIA 1TWAH 2F0SA 3HKZG 5IGBA 3DEOA 1PFNA 3TP5A 1EYAA 2KHSA 1I4QA 3M4QA 2NN6I 2AQ3B 2YV5A 4QL5A 1L1OC 3CHBD 1SNCA 1Y1WG 1N36L 3PO3B 4U673 3TN2A 4OONA 1PH3A 4XYOA 3RR5A 4X3UA 2QF7A 1EUJA 4HR7B 4LF7Q 1ILQA 1XPRA 1HR0L 3S14B 3K58A 2F0IA 4J15A 3AB9A 1L1OA 1DGSA 1BR9A 4DV0Q 3I4OA 2XWJB 4ALPA 2EDGA 3I4NB 1YIJA 2Y0SB 1V8QA 1SYGA 4ZUIA 3KYHC 1EWHA 1WTVA 1KDCA 5G3LF 1B3QA 2F0QA 3PO3G 4LFAQ 3SK4A 3VR6A 2K5HA 2N3SA 3ULLA 3Q0AA 2ES2A 4K8IA 1BBUA 3EN2A 3QR8A 4F7XA 2R3ZA 4CJ0B 1E0BA 4HMJA 1D7QA 3QO2A 1HXYD 2J7ZA 4JI1Q 1SMXA 4DR1Q 3O13A 1WCMG 1Y1WH 3HKZE 3E9IA 4LF4Q 1LTSD 1BCPC 3M4OB 3HOUB 2FMCA 2Y0SG 5NUCA 3J7YW 4AQYL 3J81i 4A3IG 2XNAC 4DPGA 5EBCA 1UEAB 4HJ7A 2VNUD 2OT2A 1NMGA 3NSWA 2RCFA 4OX9L 2EY2A 4GKJQ 5AJ3Q 4DR6L 3P20A 1EU4A 3VR3A 1K28A 2QEJC 1OXUA 4DR7L 4HCSA 3GDEA 4CBVA 3PO3H 2WACA 3H0GB 2EXDA 4X65L 1CZWA 3CMAA 2K28A 4TSSA 2AUJD 5M5XB 3FEWX 3BG3A 2Q8TA 4CJ1B 2L12A 3S14H 4S3SA 1H9SB 3DWQA 2JSOA 4DKAC 4QJFA 1BCPD 5IGDA 5M3MB 3F2UA 1HR0W 2BH2A 4RCOA 4RH6A 3OTOL 1EL0A 5IP7G 1S5ED 4RFBA 5I6YA 1GHKA 5I9PA 3A55A 1NNXA 1BNZA 3A54A 1GKHA 5ELBA 3H0GG 3IAYA 1GUWA 1JJ2A 2IX0A 3MWYW 2G9HD 3KF8A 4X62L 2AWOA 1I4PA 2AKWB 1IBLQ 3QOJA 2A69C 4H02A 1VQFA 5ELDA 3T1HL 2A68C 3M3YB 2XTIA 3I56A 1KAWA 4XTCS 3A56A 2X6LA 5M3MG 1EOTA 2GVAA 4FXDA 3I7FA 3HOUH 1WTRA 3M4OH 2NB0A 2JE6I 3LNNA 1Q1EA 4BY7G 4RMFA 2PI2A 4GKKL 2QEXA 2B2WC 4GN5A 1E7ZA 5I2YA 1KC8C 5I2XA 3U9SA 1IHZA 1PXUA 3QJYA 5C3XA 5LHY1 2UUAQ 4OIKA 4GOPB 3GTGB 1LT4D 3FMCA 4V190 2NTTA 4JI6Q 4OELB 5IP7H 2F0HA 5ELCA 4PG3A 1IKMA 5ELEA 2B2UC 1T5EA 4DR4L 1IXRA 3H0GH 2C35B 1TWHB 3K5NA 1LTBD 1HNXQ 1TWFB 4J1MA 3RN5A 4O42A 2A69D 5JPNC 3TMEA 5FLXc 1UNSA 1VQHA 4JC0A 4AIMA 2A68D 2ZTDA 4EX5A 4V0BA 2JEBI 4DFAA 1B50A 2B2UA 3HRZC 4GN4B 3NK9A 3K0YA 4LF5Q 2JA8B 1A0IA 3J7AF 3SVMA 4EQPA 3MXGA 5M3MH 4NMZA 4IUUA 4BY7H 4UDUC 2YTXA 5HURA 4AYBE 1STHA 4JOIC 2A74C 2RBMA 2LMCB 4NW2A 5GROA 2F1MA 3OSOA 1SYBA 2PZUA 5IWAQ 3VR5A 4DR3Q 2EZVA 1GOZA 1Y8OB 1SR3A 5CV4A 3M3YH 2AQ1B 1EWIA 1F2LA 5BN5A 1SDFA 4JOIA 4LF7L 3UDXA 4RA8A 1JR0D 4NB3A 3OOCA 1Q3LA 2DJFC 4PMBA 1E1OA 1GHJA 3F8TA 1X55A 4DK1A 3C3LA 4WJ3M 4AH6A 1JOKA 2LXJA 2BOSA 4DV0L 2EQSA 3D3RA 2E2IB 3TQYA 3DLLA 2GN5A 5FO9B 1TS4A 3A8IE 4DV7Q 1PRTC 2WKDA 5FLXL 2PW7A 1KLGD 1PVOA 3B6YA 3KK7A 4DGZA 3FHWA 1M90C 2RF4A 3GTGH 1AFPA 1STAA 4LFAL 1EYCA 5E4XA 1IBMQ 2UXBQ 3UI2A 4RGOS 1SJED 3PQIA 2D2CC 3C1FA 1AZQA 4R8IA 4DNRB 1Q90A 1TWFH 4JI1L 5M5WB 3D6WA 4X3KA 2WAQB 3P75A 2NN6H 4DR1L 1XMOQ 2EJGC 1CUKA 1DM0B 4LF4L 3AU7A 3BDOA 3HOXG 2LKVA 4FXKC 2B2YC 1U4RA 2JA8H 1HFNA 4L6TB 2K33A 4O2DA 4GN3B 3HEJA 1DXMA 1SBBB 1G91A 2ZJQA 2LSSA 4A3LG 3ONAB 1A2UA 4GKJL 1O7YA 4KD3A 1K83B 1RKNA 5AJ3L 4CDEC 3SDZA 5AFWA 4PZ7A 2YTYA 2N49A 1PRTD 1STYA 2RKSA 2B2YA 3CXCA 2IWHA 2I5MX 1TY0A 3U4VA 5LMNQ 5JEAJ 1BO0A 3UDFA 5A2QL 3AFQA 4K2LA 2WAQG 1XTCD 3G71A 3EROA 3SR1A 2P5ZX 3SGIA 2PCFB 1HNZQ 1LO5D 4BA1I 4QQBX 3EIVA 2ZXPA 3V05A 3NQTA 4A3BB 3PGZA 2E5LQ 1GVPA 3GP7A 1YNNC 2NZHA 1O7LA 1UAPA 4YCWA 5GAEC 1KAAA 1NSNS 4A3LH 1D5ZC 3SK6A 4DAYB 2MPMA 1IKLA 4IPCA 4DV1Q 3L9AX 1IBLL 2Q2UA 2RDGA 2KCTA 4C3IG 2KENA 5M5WH 3J7ZC 2AQ2B 4JG2A 1AZPA 2EIFA 1TVXA 4QUCA 1RD9D 2HCIA 5BR8Q 4L5SA 3E9HA 2KHJA 2CVRA 4EVOA 1U4PA 3CC7A 2QDLA 2GA4B 3K5OA 4GNXA 1KXLA 2CQOA 1RJTA 2UUAL 1A63A 2F0JA 4NDXA 1L0WA 1VQ9A 1XTDA 1X3FA 1CA5A 4YIJA 5FLMG 1YHQA 2I5HA 1YNND 2VQFQ 4JI6L 1JMCA 5JVG3 2PO4A 1Y69U 3HS0C 3E0EA 3WDNA 1HNXL 4JI0Q 1MHWC 2VUMB 3EFXD 1II3A 2IW3A 4OWWB 3SK8A 2XN9C 1EY7A 2UXCQ 5JPMC 4POFA 1JE5A 1YZ6A 2K50A 3I4LA 2D62A 1V1PB 1I3QH 4LF5L 1T9HA 1EEID 2A6HC 1C4QA 2PQAA 4CDFC 4FF1A 1C48A 2F4IA 3H3VC 5C5MA 1FVIA 1S3OA 2ZTCA 2RHSB 1ASYA 2X69A 1Q86C 2VUMG 2YU9H 2E2JB 4XXEA 3A7LA 5K5PA 5IWAL 4DR3L 5FLMH 1BKBA 1OXXK 2WKCA 1KD1C 3M4PA 5C4XG 3HOZB 1QCBD 5KNDA 1FD7D 1WI5A 2VXWA 1G2SA 1NR4A 1IYJB 1Q46A 3T4AC 3R8BA 3JAME 3NHHA 4DK6C 2VB2X 2JA6B 2F0PA 1PZJD 4DAMA 1D5MC 1DCZA 1M1KC 2IY5B
chains in the Genus database with same CATH topology
4A3GH 3BZCA 1TWAH 3HKZG 4AYBG 3CCEA 3KFUA 3S1MH 4TVAB 4DV7L 3F2CA 3PO2H 1MIUA 1XMQQ 3PF5A 1P16A 1IL2A 3F2BA 4HJ9A 2DUDA 4R1JA 5JJLA 1IBML 2UXBL 3M4QA 5ELOA 2NN6I 3BJUA 3TREA 1HH2P 1VS0A 4JI7Q 5JJKA 2YV5A 4HJ5A 4QL5A 1N34Q 3WWVA 1L1OC 1MJCA 4UPAA 1Y1WG 3HOXH 1N36L 2I0QA 4LF9L 1GM5A 4OONA 1PH3A 1FGUA 3RR5A 4LFCQ 1PH1A 2VUMH 3BZKA 4UP8A 4YCUA 1YJWA 4OWTB 1EUJA 1YBYA 3U4ZA 4DUZL 4JI3Q 1XNRL 1XMOL 2JA6G 4JV5Q 4P72A 4LF7Q 4JI4Q 1XPRA 2AHOB 1HR0L 3OW2A 5C4XH 4J15A 1SROA 5C44H 1S40A 1I6HH 3TS2A 5HY6A 1L1OA 1VQDA 2K14A 3ICEA 5IT9c 1DGSA 4DV0Q 3I4OA 4ALPA 1PV4A 4DV2L 4PZ6A 3UDGA 1YIJA 5IYCH 3J80c 4B3RQ 4Y52H 1B8AA 3KYHC 1L1OB 5M5XH 4OWXB 3I4MG 3RNUA 1J5EQ 3PF4A 4LUVA 3CCJA 3D31A 4IPDA 1X6OA 1LM0A 3PO3G 4LFAQ 1EQQA 4IOAA 1XPUA 3G48A 3CCSA 2K5HA 2N3SA 3ULLA 2ES2A 5LMNL 3PV0A 2E2JH 1K8GA 1RL2A 2K52A 5JEAG 1BBUA 2B3GA 3EN2A 1NTGA 4LF6L 1N32Q 4DR5L 1JT8A 1X56A 2KHIA 3GO5A 1Q81C 1D7QA 1G6PA 4JI1Q 1SMXA 2WAQE 1RIPA 3ULJA 1LUZA 1JJCB 3AEVA 2HHHL 2R92G 1W3SA 1X3EA 3AYHB 4DR1Q 1HNZL 1HZ9A 1WCMG 1Y1WH 3HKZE 3ER0A 3E9IA 4LF4Q 1FJGL 4K0KQ 1SRUA 3EBEA 1B7YB 2Y0SG 4AQYL 1UE1A 3H3VH 2JA6H 2UUBQ 2HQLA 1WOCA 2MO0A 4JCVE 4B3TL 3J81i 4A3IG 4NXML 3ERSX 3CPWA 1X9NA 2JK8A 4DPGA 2QA4A 3A74A 2NN6G 4DR2Q 4HJ7A 1PH5A 3GTQH 2VNUD 4APVA 1Q7YC 1Z47A 1MKHA 1NMGA 2ATWA 4X66L 4OX9L 2Q2HA 1KQSA 2E5LL 4A93H 5AJ3Q 4GKJQ 2UXDQ 4DR6L 2OWOA 2B63G 2JA8G 5K36G 1E3PA 4C3IH 2D0OA 4A3FG 3AFPA 3L2PA 1I50H 2VL6A 1YJNA 3JAMi 1OXUA 2UU9L 3I4MH 1QZGA 4DR7L 4B3MQ 3GDEA 4DV1L 1JB7A 4P73A 1EOVA 3GTLH 3UDIA 1E1TA 5IYDG 4A4IA 1KIXA 3PO3H 4IFDG 2EXDA 4X65L 3PIOA 5EAYA 3UE1A 3CMAA 4HJAA 4KLKA 5M5YH 1PA6A 1YJ9A 4IO9A 1E24A 1VQGA 2ID0A 3PUZA 2Z6KA 3S14H 4OO1G 3A5ZB 3TRZA 3M7NA 3I2ZA 1WJJA 5BR8L 1TWGH 4C3JH 1C7YA 2AWNA 2B29A 3PUXA 4DKAC 2R92H 1C9OA 2K5NA 4QJFA 1A8VA 1S72A 3CCLA 1SLJA 5IYBG 4R4TA 3CP0A 2ZJPA 1HR0W 2BH2A 2GVBA 3OTOL 1TWHH 1V43A 5IP7G 1K0RA 4BBRG 2VY3A 3RLFA 2OQKA 2VQEQ 1XNQQ 2OQ0A 1YHAA 2DGYA 1SN8A 1Y14B 4NPSA 4OXPA 2BA0A 1PYSB 4L5RC 1GKHA 2HIVA 3H0GG 3W1BA 3D0FA 2VQFL 1JJ2A 2IX0A 2F4VL 1NJIC 4EQ5A 4X62L 1Q12A 2B63H 4A3MG 2AWOA 1J6QA 2AKWB 2IT1A 4A3FH 1IBLQ 3KDFA 3J7A5 1QUQA 1VQJA 3L7ZC 4H02A 5C4JH 2KBNA 2ASBA 5GADC 3T1YQ 4B3SQ 1VQFA 1JJGA 4JI2Q 3T1HL 2QGQA 4GOPC 4JI0L 3KF8B 2K75A 2Q2TA 3RLOA 2R7FA 2IHFA 2XTIA 4BBSG 3KDFB 5LMNW 1QUQB 1KAWA 4RG1A 4XTCS 3I56A 4DUYQ 2NVXH 4BY1H 2UXCL 2AMCB 3NBHB 5M3MG 2GVAA 1K8AC 3I7FA 3HOUH 3M4OH 1YITA 3CAMA 4NXNQ 2JE6I 1VQPA 1Q1EA 1Y1VG 4BY7G 1VCIA 3GTPH 4RMFA 2PI2A 3HOVG 4GOPA 1K73C 4GKKL 4KHPL 2QEXA 1UWVA 4GN5A 1E7ZA 5FJ8G 1PYBA 1I94L 1KC8C 1VQOA 1HJPA 1OTCA 1UE5A 2UUAQ 4DV3Q 4GOPB 2N78A 5IYBH 4GLXA 2JA5G 4JI6Q 5IP7H 5ELNA 3S1RH 4PG3A 5IY0A 2IX1A 2A19A 5C0XI 4JI8L 3TEHB 1YNXA 1HZBA 5C0XJ 4DR4L 3OYYA 4KI0A 1IXRA 2JA7G 2E2IH 3H0GH 4LFBL 1IBKQ 2C35B 4KHZA 1G51A 1YHBA 1HNXQ 2CWPA 3K80C 3RN5A 1Z9FA 1UEBA 5FLXc 1HNWQ 1TXYA 1VQHA 4JC0A 4AIMA 3U58A 2UUCL 3TS0A 4JI5L 2ZTDA 4EX5A 3K0XA 2JEBI 2JA9A 2Z0SA 3PCOB 1H95A 3GTOH 4YWLA 4DV4Q 1PH9A 4GN4B 2XGTA 4DV6Q 4BBSH 1R9TH 4LF5Q 1A0IA 3CQZH 4GLVB 4IJHA 4UP9A 2YYZA 4R4QA 1KHIA 5M3MH 2E2HH 1Q82C 1VQKA 2WB1G 4HJ8A 2A1AA 1SFOH 1TWCH 4R4IA 3M85A 2MQHA 4FDBA 1XMQL 4GNXC 1Y1VH 1CKMA 2H5XA 3RLNA 4BY7H 4MZ9A 2YTXA 3RZDH 4AYBE 3HOVH 3AQQA 1KL9A 2L15A 2R7DA 3K7UC 4JOIC 4A3BG 5FJ8H 1UE7A 2ZJRA 5GROA 4UP7A 4LF8Q 3HOWG 2F3IA 4JI7L 4QY7A 3PUYA 2NZOA 4YY3Q 1N34L 4YHHQ 4P75A 5IWAQ 4DR3Q 1X54A 2BH8A 4X64Q 1PH6A 3U50C 1K9MC 2JA5H 1SR3A 3STBC 4LFCL 1EIFA 3M3YH 3RZOH 1NY4A 4PMWA 1ASZA 1EWIA 1CKNA 4DV5Q 1K83H 4JI3L 4JV5L 3KLWA 3S2HH 4JOIA 2JA7H 4LF7L 2YTVA 4JI4L 2K4KA 3UDXA 4MTNA 1N9WA 5LMUQ 4NB3A 1VQ5A 1IZ6A 1LTLA 1E1OA 3G4SA 5IP9G 4IOCA 1PH2A 4UY8C 1CKNB 3F8TA 4Y7NH 1X55A 2ZM6Q 1CSQA 3KJOA 4WJ3M 4AH6A 2LXJA 2A8VA 4DV0L 2EQSA 1CKOA 2VS1A 4IJLA 3TQYA 3DLLA 1VQMA 2GN5A 4B3RL 4DV7Q 2R6GA 1N33Q 4BA2I 3S24A 1J5EL 2R93G 4L5QA 3CCMA 1PVOA 1EIYB 1VQLA 3B6YA 3GTGH 3FHWA 2OCEA 2RF4A 2F52A 2E8GA 1M90C 4LFAL 1IBMQ 2UXBQ 1PH4A 1AE3A 4DNIA 1QZHA 1WCMH 3J80i 3GTJH 3FKIG 1N36Q 4A3BH 3H3VI 4LF9Q 1N32L 2OTJA 4QIWE 5HGQA 3HOWH 1TWFH 2WP8J 4JBWA 4JI1L 4A3IH 4JBKA 4ME3A 3DM3A 4LUOA 4R4CA 1XNRQ 3H15A 4DR1L 1YVCA 3STBD 1XMOQ 1KRSA 4P74A 1CUKA 3W1GA 1HR0Q 4LF4L 3GD7A 1Q8KA 4MNOA 4HIKA 1PHJA 4LNQA 2V1CC 3CCQA 3HOXG 4K0KL 1XJVA 3PIPA 2PMZE 3Q8DA 5GQOA 2UUBL 2NVTH 1C0AA 2JA8H 1YEZA 4O2DA 2Y0SE 4DR2L 4GN3B 4DV2Q 3CCRA 2CCZA 2ZJQA 2LSSA 4IPHA 5IP9H 4HIDA 4A3LG 4JYAL 2UXDL 3A0JA 4GKJL 1VQ6A 5H1SE 5C44G 5AJ3L 5M3FG 1A62A 1PH7A 5IYDH 2RCNA 3NEMA 1EFWA 4PZ7A 2YTYA 2N49A 4HIOA 5DLQE 1U0LA 1VQAA 3CXCA 1V1QA 3J81j 2R7ZG 2I5MX 3S1NH 5C3EG 4A3CG 2ALYB 2NVYH 4GLAC 3K7AH 1VQIA 3U4VA 3RN2A 5LMNQ 1U5KA 5JEAJ 3UDFA 2R93H 3JC66 3AFQA 4B3ML 3MEFA 3PUVA 3GTKH 2WAQG 2PNHA 1YI2A 3S1QH 1CSPA 1VQ7A 4LF6Q 3G71A 4L5TA 4DR5Q 1VQBA 4TQUS 4IPGA 3J81c 4YWKA 2OTLA 4A3EG 3SGIA 1LYLA 4DK3C 1PH8A 1N33L 5E7NA 2HHHQ 3FKIH 1HNZQ 4BA1I 1VQNA 1FJGQ 3ZJYC 1XPOA 3S16H 4BBRH 3K81C 2MFIA 4AQYQ 3GTMH 5JJIA 2MNAA 4QQBX 2HIXA 4A3JG 1VQ4A 4B3TQ 3HOZG 4JBJA 4NXMQ 3EIVA 3IRBA 1AE2A 1W2BA 3JAMc 3CC4A 3PGZA 2MO1A 4X66Q 4OX9Q 4A3MH 3KJPA 1GVPA 2E5LQ 2VQEL 1XNQL 1QVFA 4DR6Q 2D0PA 2NZHA 1FL0A 4YCWA 2KCMA 5GAEC 4A3LH 3F1ZA 2CKZB 2WFWA 3UE0A 4DAYB 4XIGS 5M3FH 2UU9Q 4DR7Q 4IFDI 3PSIA 4A75A 4P71A 4IPCA 4C3HH 4DV1Q 4IFDJ 1IBLL 2Q2UA 2KCTA 1NE3A 2ZTEA 1VQCA 1EQRA 1AH9A 1QVCA 2R7ZH 3MXNB 4X65Q 5C3EH 3T1YL 4B3SL 4A3CH 1UE6A 3S17H 2KENA 4JI2L 3FP9A 5M5WH 1P8LA 5GAHC 3J7ZC 4OO1I 4A76A 5GAGC 4JG2A 2EIFA 1WFQA 1OXTA 1PFSA 2VW9A 4DUYL 1N8RC 4A3KG 5BR8Q 1BBWA 2Q2IA 4L5SA 4LW1A 4A3EH 1X65A 3KOJA 3E9HA 2KHJA 3CMEA 3CPFA 4NXNL 2I5LX 4R4OA 3CC7A 3NELA 3HKSA 3S2DH 4GNXA 2CWAA 3OTOQ 4A3JH 3HOZH 3F2DA 2JEAI 3W5OA 1KXLA 2CQOA 3CCVA 4LWCA 4POGA 2UUAL 1A63A 1L0WA 1OXSC 4DV3L 1VQ9A 1XTDA 1X3FA 1NBWA 1HZCA 5FLMG 2RHQB 2I5HA 4GNXB 2VQFQ 1YHQA 4JI6L 4LUZA 1JMCA 2N8NA 3I4NG 3M9BA 2F4VQ 4BXXG 4X62Q 1QVGA 1V9PA 3CF5A 3HFZB 1KRTA 5C0XG 1SE8A 5J3BA 2JQOA 3E0EA 1L2FA 3G6EA 3T1HQ 1IBKL 5IE8A 1HNXL 4JI0Q 1HZAA 3HOYG 4O0AA 4HIMA 1O7IA 4OWWB 1HNWL 1VQ8A 2UXCQ 1I5FA 4A3DG 2NVQH 2VZAA 3LGJA 4POFA 1JE5A 1K3RA 1YZ6A 1GO3E 2D62A 2K50A 2Z6KC 4DV4L 4A3GG 1I3QH 4DV6L 1BVSA 2JJQA 3K8AA 4LF5L 3PO2G 1GD7A 1EYGA 3S15H 1T9HA 4X6AH 4A3KH 2HT1A 2IHEA 2PQAA 4BY1G 4GKKQ 4KHPQ 1I94Q 3HOUG 4DUZQ 2PI2E 1WYDA 2WB1E 1G291 2PQAB 1FVIA 1S3OA 2CFMA 2ZTCA 2LXKA 2RHSB 3BU2A 4LF8L 4WJ4A 1ASYA 3I55A 1Q86C 2BA1A 4JI8Q 2YU9H 2VUMG 1X3GA 2K5VA 4A93G 2FXQA 4YY3L 4DR4Q 4QGUA 4PZ8A 5IWAL 4C2MH 4YHHL 4DR3L 5FLMH 4X64L 3CW2C 4JBMA 1BKBA 1OXXK 1E22A 4LFBQ 1KD1C 3M4PA 3I4NH 5C4XG 4YCVA 4BXXH 3NENA 4DV5L 1WI5A 3ULPA 2UUCQ 4JYAQ 1VQEA 1MJEA 1IYJB 3KF6A 4JI5Q 1D8LA 1Q46A 3CCUA 5LMUL 1Q1BA 1NMFA 4YWMA 4DK6C 3HOYH 5IYCG 2ZM6L 3L0OA 1B70B 3VDYA 4GS3A 3A5UA 3CD6A 3PUWA 3KF6B 3CC2A 4A3DH 4DAMA 1OXVA 1M1KC 2IY5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3G H;  3BZC A;  1TWA H;  3HKZ G;  4AYB G;  3CCE A;  3KFU A;  3S1M H;  4TVA B;  4DV7 L;  3F2C A;  3PO2 H;  1MIU A;  1XMQ Q;  3PF5 A;  1P16 A;  1IL2 A;  3F2B A;  4HJ9 A;  2DUD A;  4R1J A;  5JJL A;  1IBM L;  2UXB L;  3M4Q A;  5ELO A;  2NN6 I;  3BJU A;  3TRE A;  1HH2 P;  1VS0 A;  4JI7 Q;  5JJK A;  2YV5 A;  4HJ5 A;  4QL5 A;  1N34 Q;  3WWV A;  1L1O C;  1MJC A;  4UPA A;  1Y1W G;  3HOX H;  1N36 L;  2I0Q A;  4LF9 L;  1GM5 A;  4OON A;  1PH3 A;  1FGU A;  3RR5 A;  4LFC Q;  1PH1 A;  2VUM H;  3BZK A;  4UP8 A;  4YCU A;  1YJW A;  4OWT B;  1EUJ A;  1YBY A;  3U4Z A;  4DUZ L;  4JI3 Q;  1XNR L;  1XMO L;  2JA6 G;  4JV5 Q;  4P72 A;  4LF7 Q;  4JI4 Q;  1XPR A;  2AHO B;  1HR0 L;  3OW2 A;  5C4X H;  4J15 A;  1SRO A;  5C44 H;  1S40 A;  1I6H H;  3TS2 A;  5HY6 A;  1L1O A;  1VQD A;  2K14 A;  3ICE A;  5IT9 c;  1DGS A;  4DV0 Q;  3I4O A;  4ALP A;  1PV4 A;  4DV2 L;  4PZ6 A;  3UDG A;  1YIJ A;  5IYC H;  3J80 c;  4B3R Q;  4Y52 H;  1B8A A;  3KYH C;  1L1O B;  5M5X H;  4OWX B;  3I4M G;  3RNU A;  1J5E Q;  3PF4 A;  4LUV A;  3CCJ A;  3D31 A;  4IPD A;  1X6O A;  1LM0 A;  3PO3 G;  4LFA Q;  1EQQ A;  4IOA A;  1XPU A;  3G48 A;  3CCS A;  2K5H A;  2N3S A;  3ULL A;  2ES2 A;  5LMN L;  3PV0 A;  2E2J H;  1K8G A;  1RL2 A;  2K52 A;  5JEA G;  1BBU A;  2B3G A;  3EN2 A;  1NTG A;  4LF6 L;  1N32 Q;  4DR5 L;  1JT8 A;  1X56 A;  2KHI A;  3GO5 A;  1Q81 C;  1D7Q A;  1G6P A;  4JI1 Q;  1SMX A;  2WAQ E;  1RIP A;  3ULJ A;  1LUZ A;  1JJC B;  3AEV A;  2HHH L;  2R92 G;  1W3S A;  1X3E A;  3AYH B;  4DR1 Q;  1HNZ L;  1HZ9 A;  1WCM G;  1Y1W H;  3HKZ E;  3ER0 A;  3E9I A;  4LF4 Q;  1FJG L;  4K0K Q;  1SRU A;  3EBE A;  1B7Y B;  2Y0S G;  4AQY L;  1UE1 A;  3H3V H;  2JA6 H;  2UUB Q;  2HQL A;  1WOC A;  2MO0 A;  4JCV E;  4B3T L;  3J81 i;  4A3I G;  4NXM L;  3ERS X;  3CPW A;  1X9N A;  2JK8 A;  4DPG A;  2QA4 A;  3A74 A;  2NN6 G;  4DR2 Q;  4HJ7 A;  1PH5 A;  3GTQ H;  2VNU D;  4APV A;  1Q7Y C;  1Z47 A;  1MKH A;  1NMG A;  2ATW A;  4X66 L;  4OX9 L;  2Q2H A;  1KQS A;  2E5L L;  4A93 H;  5AJ3 Q;  4GKJ Q;  2UXD Q;  4DR6 L;  2OWO A;  2B63 G;  2JA8 G;  5K36 G;  1E3P A;  4C3I H;  2D0O A;  4A3F G;  3AFP A;  3L2P A;  1I50 H;  2VL6 A;  1YJN A;  3JAM i;  1OXU A;  2UU9 L;  3I4M H;  1QZG A;  4DR7 L;  4B3M Q;  3GDE A;  4DV1 L;  1JB7 A;  4P73 A;  1EOV A;  3GTL H;  3UDI A;  1E1T A;  5IYD G;  4A4I A;  1KIX A;  3PO3 H;  4IFD G;  2EXD A;  4X65 L;  3PIO A;  5EAY A;  3UE1 A;  3CMA A;  4HJA A;  4KLK A;  5M5Y H;  1PA6 A;  1YJ9 A;  4IO9 A;  1E24 A;  1VQG A;  2ID0 A;  3PUZ A;  2Z6K A;  3S14 H;  4OO1 G;  3A5Z B;  3TRZ A;  3M7N A;  3I2Z A;  1WJJ A;  5BR8 L;  1TWG H;  4C3J H;  1C7Y A;  2AWN A;  2B29 A;  3PUX A;  4DKA C;  2R92 H;  1C9O A;  2K5N A;  4QJF A;  1A8V A;  1S72 A;  3CCL A;  1SLJ A;  5IYB G;  4R4T A;  3CP0 A;  2ZJP A;  1HR0 W;  2BH2 A;  2GVB A;  3OTO L;  1TWH H;  1V43 A;  5IP7 G;  1K0R A;  4BBR G;  2VY3 A;  3RLF A;  2OQK A;  2VQE Q;  1XNQ Q;  2OQ0 A;  1YHA A;  2DGY A;  1SN8 A;  1Y14 B;  4NPS A;  4OXP A;  2BA0 A;  1PYS B;  4L5R C;  1GKH A;  2HIV A;  3H0G G;  3W1B A;  3D0F A;  2VQF L;  1JJ2 A;  2IX0 A;  2F4V L;  1NJI C;  4EQ5 A;  4X62 L;  1Q12 A;  2B63 H;  4A3M G;  2AWO A;  1J6Q A;  2AKW B;  2IT1 A;  4A3F H;  1IBL Q;  3KDF A;  3J7A 5;  1QUQ A;  1VQJ A;  3L7Z C;  4H02 A;  5C4J H;  2KBN A;  2ASB A;  5GAD C;  3T1Y Q;  4B3S Q;  1VQF A;  1JJG A;  4JI2 Q;  3T1H L;  2QGQ A;  4GOP C;  4JI0 L;  3KF8 B;  2K75 A;  2Q2T A;  3RLO A;  2R7F A;  2IHF A;  2XTI A;  4BBS G;  3KDF B;  5LMN W;  1QUQ B;  1KAW A;  4RG1 A;  4XTC S;  3I56 A;  4DUY Q;  2NVX H;  4BY1 H;  2UXC L;  2AMC B;  3NBH B;  5M3M G;  2GVA A;  1K8A C;  3I7F A;  3HOU H;  3M4O H;  1YIT A;  3CAM A;  4NXN Q;  2JE6 I;  1VQP A;  1Q1E A;  1Y1V G;  4BY7 G;  1VCI A;  3GTP H;  4RMF A;  2PI2 A;  3HOV G;  4GOP A;  1K73 C;  4GKK L;  4KHP L;  2QEX A;  1UWV A;  4GN5 A;  1E7Z A;  5FJ8 G;  1PYB A;  1I94 L;  1KC8 C;  1VQO A;  1HJP A;  1OTC A;  1UE5 A;  2UUA Q;  4DV3 Q;  4GOP B;  2N78 A;  5IYB H;  4GLX A;  2JA5 G;  4JI6 Q;  5IP7 H;  5ELN A;  3S1R H;  4PG3 A;  5IY0 A;  2IX1 A;  2A19 A;  5C0X I;  4JI8 L;  3TEH B;  1YNX A;  1HZB A;  5C0X J;  4DR4 L;  3OYY A;  4KI0 A;  1IXR A;  2JA7 G;  2E2I H;  3H0G H;  4LFB L;  1IBK Q;  2C35 B;  4KHZ A;  1G51 A;  1YHB A;  1HNX Q;  2CWP A;  3K80 C;  3RN5 A;  1Z9F A;  1UEB A;  5FLX c;  1HNW Q;  1TXY A;  1VQH A;  4JC0 A;  4AIM A;  3U58 A;  2UUC L;  3TS0 A;  4JI5 L;  2ZTD A;  4EX5 A;  3K0X A;  2JEB I;  2JA9 A;  2Z0S A;  3PCO B;  1H95 A;  3GTO H;  4YWL A;  4DV4 Q;  1PH9 A;  4GN4 B;  2XGT A;  4DV6 Q;  4BBS H;  1R9T H;  4LF5 Q;  1A0I A;  3CQZ H;  4GLV B;  4IJH A;  4UP9 A;  2YYZ A;  4R4Q A;  1KHI A;  5M3M H;  2E2H H;  1Q82 C;  1VQK A;  2WB1 G;  4HJ8 A;  2A1A A;  1SFO H;  1TWC H;  4R4I A;  3M85 A;  2MQH A;  4FDB A;  1XMQ L;  4GNX C;  1Y1V H;  1CKM A;  2H5X A;  3RLN A;  4BY7 H;  4MZ9 A;  2YTX A;  3RZD H;  4AYB E;  3HOV H;  3AQQ A;  1KL9 A;  2L15 A;  2R7D A;  3K7U C;  4JOI C;  4A3B G;  5FJ8 H;  1UE7 A;  2ZJR A;  5GRO A;  4UP7 A;  4LF8 Q;  3HOW G;  2F3I A;  4JI7 L;  4QY7 A;  3PUY A;  2NZO A;  4YY3 Q;  1N34 L;  4YHH Q;  4P75 A;  5IWA Q;  4DR3 Q;  1X54 A;  2BH8 A;  4X64 Q;  1PH6 A;  3U50 C;  1K9M C;  2JA5 H;  1SR3 A;  3STB C;  4LFC L;  1EIF A;  3M3Y H;  3RZO H;  1NY4 A;  4PMW A;  1ASZ A;  1EWI A;  1CKN A;  4DV5 Q;  1K83 H;  4JI3 L;  4JV5 L;  3KLW A;  3S2H H;  4JOI A;  2JA7 H;  4LF7 L;  2YTV A;  4JI4 L;  2K4K A;  3UDX A;  4MTN A;  1N9W A;  5LMU Q;  4NB3 A;  1VQ5 A;  1IZ6 A;  1LTL A;  1E1O A;  3G4S A;  5IP9 G;  4IOC A;  1PH2 A;  4UY8 C;  1CKN B;  3F8T A;  4Y7N H;  1X55 A;  2ZM6 Q;  1CSQ A;  3KJO A;  4WJ3 M;  4AH6 A;  2LXJ A;  2A8V A;  4DV0 L;  2EQS A;  1CKO A;  2VS1 A;  4IJL A;  3TQY A;  3DLL A;  1VQM A;  2GN5 A;  4B3R L;  4DV7 Q;  2R6G A;  1N33 Q;  4BA2 I;  3S24 A;  1J5E L;  2R93 G;  4L5Q A;  3CCM A;  1PVO A;  1EIY B;  1VQL A;  3B6Y A;  3GTG H;  3FHW A;  2OCE A;  2RF4 A;  2F52 A;  2E8G A;  1M90 C;  4LFA L;  1IBM Q;  2UXB Q;  1PH4 A;  1AE3 A;  4DNI A;  1QZH A;  1WCM H;  3J80 i;  3GTJ H;  3FKI G;  1N36 Q;  4A3B H;  3H3V I;  4LF9 Q;  1N32 L;  2OTJ A;  4QIW E;  5HGQ A;  3HOW H;  1TWF H;  2WP8 J;  4JBW A;  4JI1 L;  4A3I H;  4JBK A;  4ME3 A;  3DM3 A;  4LUO A;  4R4C A;  1XNR Q;  3H15 A;  4DR1 L;  1YVC A;  3STB D;  1XMO Q;  1KRS A;  4P74 A;  1CUK A;  3W1G A;  1HR0 Q;  4LF4 L;  3GD7 A;  1Q8K A;  4MNO A;  4HIK A;  1PHJ A;  4LNQ A;  2V1C C;  3CCQ A;  3HOX G;  4K0K L;  1XJV A;  3PIP A;  2PMZ E;  3Q8D A;  5GQO A;  2UUB L;  2NVT H;  1C0A A;  2JA8 H;  1YEZ A;  4O2D A;  2Y0S E;  4DR2 L;  4GN3 B;  4DV2 Q;  3CCR A;  2CCZ A;  2ZJQ A;  2LSS A;  4IPH A;  5IP9 H;  4HID A;  4A3L G;  4JYA L;  2UXD L;  3A0J A;  4GKJ L;  1VQ6 A;  5H1S E;  5C44 G;  5AJ3 L;  5M3F G;  1A62 A;  1PH7 A;  5IYD H;  2RCN A;  3NEM A;  1EFW A;  4PZ7 A;  2YTY A;  2N49 A;  4HIO A;  5DLQ E;  1U0L A;  1VQA A;  3CXC A;  1V1Q A;  3J81 j;  2R7Z G;  2I5M X;  3S1N H;  5C3E G;  4A3C G;  2ALY B;  2NVY H;  4GLA C;  3K7A H;  1VQI A;  3U4V A;  3RN2 A;  5LMN Q;  1U5K A;  5JEA J;  3UDF A;  2R93 H;  3JC6 6;  3AFQ A;  4B3M L;  3MEF A;  3PUV A;  3GTK H;  2WAQ G;  2PNH A;  1YI2 A;  3S1Q H;  1CSP A;  1VQ7 A;  4LF6 Q;  3G71 A;  4L5T A;  4DR5 Q;  1VQB A;  4TQU S;  4IPG A;  3J81 c;  4YWK A;  2OTL A;  4A3E G;  3SGI A;  1LYL A;  4DK3 C;  1PH8 A;  1N33 L;  5E7N A;  2HHH Q;  3FKI H;  1HNZ Q;  4BA1 I;  1VQN A;  1FJG Q;  3ZJY C;  1XPO A;  3S16 H;  4BBR H;  3K81 C;  2MFI A;  4AQY Q;  3GTM H;  5JJI A;  2MNA A;  4QQB X;  2HIX A;  4A3J G;  1VQ4 A;  4B3T Q;  3HOZ G;  4JBJ A;  4NXM Q;  3EIV A;  3IRB A;  1AE2 A;  1W2B A;  3JAM c;  3CC4 A;  3PGZ A;  2MO1 A;  4X66 Q;  4OX9 Q;  4A3M H;  3KJP A;  1GVP A;  2E5L Q;  2VQE L;  1XNQ L;  1QVF A;  4DR6 Q;  2D0P A;  2NZH A;  1FL0 A;  4YCW A;  2KCM A;  5GAE C;  4A3L H;  3F1Z A;  2CKZ B;  2WFW A;  3UE0 A;  4DAY B;  4XIG S;  5M3F H;  2UU9 Q;  4DR7 Q;  4IFD I;  3PSI A;  4A75 A;  4P71 A;  4IPC A;  4C3H H;  4DV1 Q;  4IFD J;  1IBL L;  2Q2U A;  2KCT A;  1NE3 A;  2ZTE A;  1VQC A;  1EQR A;  1AH9 A;  1QVC A;  2R7Z H;  3MXN B;  4X65 Q;  5C3E H;  3T1Y L;  4B3S L;  4A3C H;  1UE6 A;  3S17 H;  2KEN A;  4JI2 L;  3FP9 A;  5M5W H;  1P8L A;  5GAH C;  3J7Z C;  4OO1 I;  4A76 A;  5GAG C;  4JG2 A;  2EIF A;  1WFQ A;  1OXT A;  1PFS A;  2VW9 A;  4DUY L;  1N8R C;  4A3K G;  5BR8 Q;  1BBW A;  2Q2I A;  4L5S A;  4LW1 A;  4A3E H;  1X65 A;  3KOJ A;  3E9H A;  2KHJ A;  3CME A;  3CPF A;  4NXN L;  2I5L X;  4R4O A;  3CC7 A;  3NEL A;  3HKS A;  3S2D H;  4GNX A;  2CWA A;  3OTO Q;  4A3J H;  3HOZ H;  3F2D A;  2JEA I;  3W5O A;  1KXL A;  2CQO A;  3CCV A;  4LWC A;  4POG A;  2UUA L;  1A63 A;  1L0W A;  1OXS C;  4DV3 L;  1VQ9 A;  1XTD A;  1X3F A;  1NBW A;  1HZC A;  5FLM G;  2RHQ B;  2I5H A;  4GNX B;  2VQF Q;  1YHQ A;  4JI6 L;  4LUZ A;  1JMC A;  2N8N A;  3I4N G;  3M9B A;  2F4V Q;  4BXX G;  4X62 Q;  1QVG A;  1V9P A;  3CF5 A;  3HFZ B;  1KRT A;  5C0X G;  1SE8 A;  5J3B A;  2JQO A;  3E0E A;  1L2F A;  3G6E A;  3T1H Q;  1IBK L;  5IE8 A;  1HNX L;  4JI0 Q;  1HZA A;  3HOY G;  4O0A A;  4HIM A;  1O7I A;  4OWW B;  1HNW L;  1VQ8 A;  2UXC Q;  1I5F A;  4A3D G;  2NVQ H;  2VZA A;  3LGJ A;  4POF A;  1JE5 A;  1K3R A;  1YZ6 A;  1GO3 E;  2D62 A;  2K50 A;  2Z6K C;  4DV4 L;  4A3G G;  1I3Q H;  4DV6 L;  1BVS A;  2JJQ A;  3K8A A;  4LF5 L;  3PO2 G;  1GD7 A;  1EYG A;  3S15 H;  1T9H A;  4X6A H;  4A3K H;  2HT1 A;  2IHE A;  2PQA A;  4BY1 G;  4GKK Q;  4KHP Q;  1I94 Q;  3HOU G;  4DUZ Q;  2PI2 E;  1WYD A;  2WB1 E;  1G29 1;  2PQA B;  1FVI A;  1S3O A;  2CFM A;  2ZTC A;  2LXK A;  2RHS B;  3BU2 A;  4LF8 L;  4WJ4 A;  1ASY A;  3I55 A;  1Q86 C;  2BA1 A;  4JI8 Q;  2YU9 H;  2VUM G;  1X3G A;  2K5V A;  4A93 G;  2FXQ A;  4YY3 L;  4DR4 Q;  4QGU A;  4PZ8 A;  5IWA L;  4C2M H;  4YHH L;  4DR3 L;  5FLM H;  4X64 L;  3CW2 C;  4JBM A;  1BKB A;  1OXX K;  1E22 A;  4LFB Q;  1KD1 C;  3M4P A;  3I4N H;  5C4X G;  4YCV A;  4BXX H;  3NEN A;  4DV5 L;  1WI5 A;  3ULP A;  2UUC Q;  4JYA Q;  1VQE A;  1MJE A;  1IYJ B;  3KF6 A;  4JI5 Q;  1D8L A;  1Q46 A;  3CCU A;  5LMU L;  1Q1B A;  1NMF A;  4YWM A;  4DK6 C;  3HOY H;  5IYC G;  2ZM6 L;  3L0O A;  1B70 B;  3VDY A;  4GS3 A;  3A5U A;  3CD6 A;  3PUW A;  3KF6 B;  3CC2 A;  4A3D H;  4DAM A;  1OXV A;  1M1K C;  2IY5 B; 
#chains in the Genus database with same CATH topology
 2SEB D;  3BZC A;  3KFU A;  2A6H D;  1SNM A;  4OEM B;  4DV7 L;  3F2C A;  1MIU A;  5JJL A;  3VYU A;  1SSO A;  1IBM L;  2UXB L;  4LK1 C;  5ELO A;  3I4M B;  5F2D A;  3V2T A;  5EPL A;  4HJ5 A;  1N34 Q;  4KY5 A;  1AEX A;  3SEB A;  3I70 A;  4J6H A;  4IAL A;  4QIW B;  1PH1 A;  2VUM H;  3BZK A;  4UP8 A;  2JA6 G;  1YBY A;  4DUZ L;  4G4K A;  1XMO L;  4JI4 Q;  4R8N A;  1H9M A;  5C4X H;  4RCN A;  2B8G A;  3FPP A;  2F0U A;  1VQD A;  1L0Y B;  2K14 A;  5CV6 A;  1JOO A;  1PV4 A;  4IUN A;  4PZ6 A;  1QG7 A;  3D8G A;  3J80 c;  4B3R Q;  5CBE E;  1B8A A;  3I4M G;  3RNU A;  1X6O A;  1LM0 A;  4IOA A;  1EQQ A;  3MXP A;  3G48 A;  5LMN L;  3PV0 A;  1Y8P B;  1BOS A;  1K8G A;  1RL2 A;  2K52 A;  1I6V C;  2E2J H;  1NTG A;  1D1K A;  2N55 A;  4KK7 A;  1EYD A;  2KHI A;  3GO5 A;  1HTP A;  3ULJ A;  1LUZ A;  4C3J G;  3AEV A;  1X3E A;  4F88 A;  1QOH A;  1HNZ L;  1HZ9 A;  5T1G A;  1AW7 A;  1UE1 A;  2BDN A;  2JA6 H;  1XYI A;  2MO0 A;  4JCV E;  3VA5 A;  2K04 A;  2KOL A;  3A74 A;  4DR2 Q;  3BS1 A;  2K1B A;  3BYY B;  2EYO A;  1M4V A;  1RDP D;  2RA4 A;  1XX8 A;  1CFM A;  1KQS A;  2E5L L;  2EYH A;  4FF3 A;  2OWO A;  4B9W A;  1E3P A;  2EXZ A;  5I6W A;  4PQX A;  1KTK A;  3JAM i;  3I4M H;  1H9J A;  4DV1 L;  2F0V A;  5IYD G;  5IIF A;  4FF2 A;  4BWG B;  4WOR A;  1A2T A;  3UE1 A;  4HJA A;  4KLK A;  3I3C A;  1PA6 A;  1VQG A;  1GUS A;  2ZXR A;  2FHT A;  1WJJ A;  5BR8 L;  4KMU C;  4C3J H;  3J81 E;  4B9X A;  4BBS B;  3PUX A;  4H0L C;  2K5N A;  2HUG A;  2B2V C;  1EY0 A;  4R4T A;  3CP0 A;  2ZJP A;  5CV5 A;  1V43 A;  3DWA A;  2VY3 A;  2EOT A;  2OQK A;  1XNQ Q;  4NPS A;  3URY A;  1Y1W B;  1PYS B;  2MUY A;  3WOF A;  4BS9 A;  3RZD B;  2CHB D;  2XWB B;  3HOV B;  2D9U A;  2VQF L;  4ZKB B;  2EYP A;  1X3P A;  2PZW A;  2BDO A;  3EA6 A;  1NJI C;  4A3M G;  2IT1 A;  1J6Q A;  2B2V A;  4RKL A;  1QUQ A;  4K2K A;  4RAU C;  5C4J H;  2KBN A;  1A6X A;  2QGQ A;  4JI0 L;  4BBS G;  3KDF B;  5LMN W;  4RG1 A;  2UXC L;  4DUY Q;  4L63 B;  3NBH B;  3P1H A;  3T16 A;  2QIL A;  3DMU A;  4KV6 A;  4NXN Q;  1YNJ C;  5JAV A;  3KLS A;  3HOV G;  3LX0 A;  1K73 C;  4K6D A;  1DOL A;  1B3A A;  1U4M A;  2WB1 B;  2N78 A;  2PW5 A;  2L9H A;  4Q0F A;  3BVM A;  4UHV A;  2A19 A;  1WCM B;  2WV6 D;  1HZB A;  3GTJ B;  5C0X J;  4KI0 A;  1VMC A;  3R93 A;  2DJG C;  1B4O A;  5D65 A;  1IBK Q;  2CWP A;  5EGT A;  4A3I B;  1UEB A;  1Z6H A;  2F0E A;  2Z0S A;  3PCO B;  1H95 A;  4DV4 Q;  1PH9 A;  2EJM A;  2XGT A;  4BBS H;  4M8A A;  5CV8 A;  2K03 A;  4RGM A;  4GLV B;  4R4Q A;  1KHI A;  2WB1 G;  1YNJ D;  1QB5 D;  2CH4 A;  4I7A A;  3OWE B;  3M85 A;  4MZ9 A;  3KUP A;  3RZD H;  3HOV H;  1KL9 A;  2L15 A;  3K7U C;  4UP7 A;  2NVY B;  3GTL B;  4QY7 A;  3WOE A;  5IOD A;  1N34 L;  4YHH Q;  4P75 A;  4G7H C;  1X54 A;  2BH8 A;  1PH6 A;  3U50 C;  1ENA A;  3D4R A;  4PMW A;  3DHQ A;  1CKN A;  1PZK D;  1ZEQ X;  3KLW A;  1EY6 A;  1TII D;  5DAU A;  5J39 A;  4JI4 L;  3K6O A;  1VQ5 A;  1F2M A;  1IZ6 A;  4IOC A;  5IP9 G;  4RWS C;  4UY8 C;  4Y7N H;  1JWM D;  2ZM6 Q;  1CSQ A;  1BDO A;  2LS0 1;  4G57 A;  4B3R L;  1CQF A;  5FK9 C;  4BA2 I;  3CCM A;  3C2P A;  4OL7 A;  3Q6S A;  1DOM A;  1AE3 A;  3PIO 3;  1G6Z A;  1QZH A;  1GUG A;  1WCM H;  3GTJ H;  5EJW A;  1MGS A;  4LF9 Q;  2V4D A;  4JBW A;  4A3I H;  1F9R A;  3DM3 A;  4OGQ C;  4CKB A;  1XNR Q;  4BY7 B;  1ENF A;  5DNF A;  4P74 A;  4H44 C;  4HIK A;  4MNO A;  2EVB A;  3CCQ A;  4MHE A;  1XJV A;  3N52 A;  4FVM A;  1GUT A;  1QNK A;  2Y0S E;  4DR2 L;  2K32 A;  4DV2 Q;  1C8C A;  3S2D B;  2BCO A;  4IPH A;  5IP9 H;  1O80 A;  2F3W A;  5DM7 3;  5C44 G;  3AMU A;  2EPB A;  1PH7 A;  1LTT D;  5M9O A;  1EFW A;  5IT9 E;  2E76 C;  3W2D A;  5COY A;  1JE4 A;  2F3V A;  2WII B;  1PTO B;  2ALY B;  2NVY H;  1H9K A;  3GTL H;  4DU9 A;  1EY5 A;  3H94 A;  4DAP A;  2PNH A;  1S5B D;  3K5L A;  4LF6 Q;  2PPB C;  3VYS A;  4K5W A;  1VQB A;  4TQU S;  4QMG A;  2HDM A;  1L0X B;  1LYL A;  1N33 L;  5E7N A;  2HHH Q;  3BDL A;  1PTO F;  1FJG Q;  1VQN A;  1STE A;  3Q23 A;  4IUP A;  1SEB D;  2MNA A;  1WTQ A;  2A6E C;  2HIX A;  1VQ4 A;  3EJI A;  4NXM Q;  3S15 B;  1ONL A;  2B2W A;  1ZKO A;  2KEC A;  5TSS A;  4X66 Q;  3E5S A;  3KJP A;  2RDF A;  1XNQ L;  1TR5 A;  1FYC A;  5CR3 A;  1Y8N B;  2R61 A;  4HAE A;  1NUC A;  2MP1 A;  4A75 A;  4IFD J;  2F0G A;  2ZTE A;  1X3Q A;  1AH9 A;  1D5X C;  3MXN B;  1UE6 A;  3I90 A;  1PDQ A;  5CBA E;  3FDT A;  1P8L A;  3BVG A;  4OO1 I;  5ISR A;  3K59 A;  5GAG C;  1WFQ A;  1OXT A;  1PFS A;  5A2Q E;  4DUY L;  4A3K G;  2RVL A;  4LW1 A;  1X65 A;  5ELF A;  3H6M A;  4NXN L;  1TS3 A;  4R4O A;  2FFK B;  2KUM A;  2A6E D;  1GUN A;  3NEL A;  3HKS A;  3S2D H;  4A3G B;  3LWE A;  1M8A A;  3F2D A;  3W5O A;  2JEA I;  3CCV A;  1K3B C;  1W6J A;  2FMM A;  1BF4 A;  1OXS C;  1EZ8 A;  2RHQ B;  3R3O A;  1PTO H;  3M9B A;  5BN3 A;  1SJH D;  3HFZ B;  1KRT A;  3HOX B;  1SE8 A;  5J3B A;  2JQO A;  1IBK L;  1L2F A;  3G6E A;  4HIM A;  4A93 B;  1O7I A;  1PFM A;  1I5F A;  2NVQ H;  2WIN B;  4DV4 L;  4A3G G;  1GO3 E;  2Z6K C;  1EY4 A;  3PO2 G;  4K14 A;  1QIL A;  1EYG A;  3S15 H;  2IX3 A;  4A3K H;  2HT1 A;  4DXG A;  4BY1 G;  4KHP Q;  3NTH A;  1I94 Q;  1K8M A;  1WTX A;  4DUZ Q;  1E2W A;  2KQ3 A;  2LFN A;  5JVH 3;  1G29 1;  3MAQ A;  3E6Z X;  1R4Q B;  1ZYR C;  1HQM C;  3BU2 A;  4WJ4 A;  4JI8 Q;  4A93 G;  2FXQ A;  4YHH L;  3NE5 B;  4PZ8 A;  2K01 A;  3CW2 C;  4JBM A;  1E22 A;  4ID6 A;  4JW0 A;  1FNW A;  2UUC Q;  1MJE A;  4JI5 Q;  2ENB A;  3HG9 A;  1Q1B A;  1SNQ A;  4YWM A;  3DEP A;  2ZM6 L;  1B70 B;  3VDY A;  1CA6 A;  3ZYY X;  3KF6 B;  2EY1 A;  4GZY C;  1OXV A;  4A3G H;  4ILW A;  1GUO A;  3D6C A;  4TVA B;  3PO2 H;  1XMQ Q;  1P16 A;  1IL2 A;  3F2B A;  4C3I B;  1S5D D;  4HJ9 A;  2DUD A;  4R1J A;  1I3Q B;  1HPC A;  1VS0 A;  4JI7 Q;  1EIH A;  3GV6 A;  1ZYR D;  1WVL A;  3WWV A;  1MJC A;  3HOX H;  2I0Q A;  4LF9 L;  1HHV A;  4NP5 A;  4LJZ C;  2EYM A;  1FGU A;  4LFC Q;  1IYV A;  2SNM A;  1BQQ T;  4YCU A;  4XQJ A;  5FKA C;  1YJW A;  3U4Z A;  1HUM A;  1XNR L;  4A93 H;  5KGU A;  2Q8I B;  3OW2 A;  4K8J A;  1SRO A;  1TWG B;  3TS2 A;  2YU9 B;  4FO2 A;  2Z4I A;  4DV2 L;  1DJR D;  3TDQ A;  1VDZ A;  4QF4 A;  1AP0 A;  4FF4 A;  1RHP A;  1L1O B;  4H7B A;  1J5E Q;  3PF4 A;  4LUV A;  3CCJ A;  2OF1 A;  3CCS A;  5G3L D;  2B63 B;  3R2T A;  2Z6B A;  3D4W A;  4ODG A;  3VA7 A;  5KIX A;  5JEA G;  4A3F B;  4LF6 L;  1JQY D;  2KVM A;  2WAQ E;  1JB3 A;  1RIP A;  2F0N A;  1STB A;  2HHH L;  1W3S A;  1SND A;  1FJG L;  4K0K Q;  4QCL A;  3EBE A;  1TS5 A;  2HQL A;  1WOC A;  4NXM L;  2KJX A;  1X9N A;  2JK8 A;  1EIG A;  3GTP B;  3X3M A;  4IQZ A;  4LAA A;  1Z47 A;  4MTK A;  2ATW A;  4JYA Q;  4X66 L;  2Q2H A;  3OPO A;  1STG A;  2B63 G;  5K36 G;  4C3I H;  4A3F G;  2ZXO A;  4RKB A;  5C4X B;  3L2P A;  2VL6 A;  2ZT9 C;  5FO8 B;  2SNS A;  3S1R B;  3Q22 A;  4IUT A;  2F0O A;  4B3M Q;  4P73 A;  1F9P A;  1BCP B;  3UDI A;  4A4I A;  3OIP A;  1SMY C;  3PIO A;  2JN4 A;  5I9O A;  1H9S A;  3OMG A;  1LAC A;  5JEA H;  1E24 A;  2DNC A;  1K0S A;  3G6J B;  4OO1 G;  4Z9C B;  3A5Z B;  3I2Z A;  1R4P B;  4J8Q A;  3NTI A;  1TWG H;  1BCP F;  2AWN A;  1R9T B;  1C9O A;  1A8V A;  1CHQ D;  2M2L A;  4E6I A;  5IYB G;  1BUV T;  3SHL A;  2GVB A;  1SFO B;  4BBR G;  2CW0 C;  2Z4H A;  2DN8 A;  3RLF A;  2VQE Q;  2I07 B;  1YHA A;  2OQ0 A;  1SN8 A;  4OXP A;  2BA0 A;  1I4H A;  3GV3 A;  4RGT A;  2HD3 A;  2IJ0 A;  2B63 H;  5K36 H;  4A3F H;  2A5H A;  4ZAI A;  5HGT A;  3J7A 5;  4UAI A;  3L7Z C;  2ASB A;  2TSS A;  5IOC A;  4B3S Q;  3EVQ A;  4DF7 A;  4GOP C;  3KF8 B;  2K75 A;  2Q2T A;  1KLU D;  1EWC A;  2IHF A;  2R7F A;  1SMY D;  3RLO A;  5CC4 A;  4WRD A;  1JWS D;  4DXF A;  1K8A C;  3X3N A;  1YIT A;  3CAM A;  2RQX A;  2PZT A;  4I65 A;  1F2Y A;  4OO1 H;  1VCI A;  3GTP H;  5IGF A;  1LTI D;  4GOP A;  4KHP L;  1UWV A;  1I94 L;  1HJP A;  4HN7 A;  4JK1 C;  1UE5 A;  3T53 B;  5I4D A;  2KA7 A;  4GLX A;  2CW0 D;  2OEO A;  5IYB H;  2JA5 G;  4ULL A;  2E2D C;  5ELN A;  4C3J B;  3S1R H;  1WTW A;  5IY0 A;  1WTH A;  5C0X I;  1CHP D;  4JI8 L;  2PMZ B;  2N88 A;  1X32 A;  4MN3 A;  1PYW D;  1S5F D;  1CTM A;  4KHZ A;  1G51 A;  4ZYS A;  3NP8 A;  1Z9F A;  1HNW Q;  1TXY A;  4XQQ A;  2UUC L;  3GQB A;  4Q5V A;  3U58 A;  3TS0 A;  4JI5 L;  2BE5 C;  4M1U B;  2NVT B;  1R9T H;  4JPB W;  2YYZ A;  3C1E A;  5C4J B;  1Q82 C;  1SFO H;  4F87 A;  1S4Z A;  4R4I A;  1XMQ L;  1CKM A;  1XXG A;  4CKC A;  1RCV D;  1WTO A;  1STN A;  2R7D A;  1KDA A;  1UE7 A;  3S1N B;  4LF8 Q;  2X6G A;  3S1M B;  4JI7 L;  3I91 A;  1DOK A;  3OHX C;  2NZO A;  4K6L A;  3S1Q B;  2JA5 H;  1U9R A;  4X64 Q;  2F03 A;  3STB C;  4LFC L;  2Q8R E;  3M4Y A;  4K5X A;  1LT3 D;  2DY7 A;  1EEF D;  2K4K A;  1N9W A;  3S16 B;  1LTL A;  3T13 A;  1PH2 A;  1F9S A;  3KBG A;  3GTM B;  3VR2 A;  1LT6 D;  2BE5 D;  2F0F A;  3KJO A;  1F2Z A;  1CKO A;  4LMQ D;  1PMR A;  5EKL A;  1VQM A;  3J80 L;  3OIQ A;  4A3M B;  1N33 Q;  1U4L A;  2NYZ D;  1FNV A;  3S24 A;  1J5E L;  4L5Q A;  2E75 C;  2OCE A;  2E8G A;  4XDX A;  1A15 A;  1PH4 A;  5M3F B;  3J80 i;  4CHT B;  3FKI G;  1DON A;  3H3V I;  3NWS A;  1B53 A;  2R7Z B;  2OTJ A;  4QIW E;  5HGQ A;  5C3E B;  2I46 A;  1KAB A;  4JBK A;  4LUO A;  4R4C A;  4FP5 D;  2DNE A;  3STB D;  1KRS A;  3W1G A;  2DY8 A;  4LNQ A;  1TS2 A;  1Q8K A;  1SNP A;  4K0K L;  1PRT B;  2V1C C;  3OWF A;  4A3E B;  4MIU A;  5CV9 A;  2PMZ E;  3Q8D A;  2NVT H;  1O78 A;  1HTL D;  1TT2 A;  2CCZ A;  1GJX A;  1E2V A;  4HID A;  4JYA L;  4A3J B;  1VQ6 A;  5M3F G;  3TBI B;  1A62 A;  5IYD H;  1PRT F;  3NEM A;  4DK0 A;  4KKU A;  4N9P A;  5DLQ E;  1U0L A;  1MD2 D;  3C46 A;  1V1Q A;  2R7Z G;  3S1N H;  5KNC A;  1OO9 B;  5C3E G;  3RN2 A;  4Y7N B;  3S1M H;  3K7A H;  1VQI A;  2FIN B;  1U5K A;  4KKT A;  4B3M L;  3MEF A;  3PUV A;  4IN3 A;  3GTK H;  3S1Q H;  1CSP A;  1VQ7 A;  1J9O A;  4DR5 Q;  4KKS A;  5EQ0 A;  4IPG A;  2SOB A;  4XT3 B;  1CI3 M;  3J81 c;  1NR2 A;  2OTL A;  4A3E G;  1PH8 A;  3FKI H;  3ZJY C;  4HCE A;  1XPO A;  3S16 H;  1MI2 A;  3K81 C;  2B2T C;  3GTM H;  5JJI A;  1ESF A;  2HDL A;  2RSO A;  4A3J G;  4B3T Q;  1FR3 A;  1V1O A;  3IRB A;  1AE2 A;  3IFT A;  1EU3 A;  1CT1 D;  2QCP X;  3CC4 A;  2K05 A;  2MO1 A;  3KLR A;  3I8Z A;  4DAY A;  4A3M H;  5EKK A;  2VQE L;  1QVF A;  2D0P A;  1FL0 A;  2B2T A;  3F1Z A;  2CKZ B;  1SNO A;  5M3F H;  4KY7 A;  2UU9 Q;  4IFD I;  3PSI A;  4P71 A;  4B08 A;  2LY7 A;  1NE3 A;  1LTR D;  4C2M B;  1QVC A;  2R7Z H;  2ICE C;  4B3S L;  5C3E H;  1B9N A;  3S17 H;  3FP9 A;  4A76 A;  2HQE A;  2O5I C;  2VW9 A;  2CH4 W;  2Q2I A;  1A3U A;  4A3E H;  3QIA A;  3CME A;  3CPF A;  1PZI D;  4RGN A;  2Z1C A;  4A3D B;  2F0T A;  1BXT A;  3NPP A;  5E4W C;  2CWA A;  1XWE A;  3J81 L;  4C1N K;  4A3J H;  5KYI A;  1W6K A;  3H91 A;  5FO7 B;  2JP1 A;  2EYL A;  4LWC A;  1NBW A;  1HZC A;  4GNX B;  1SYE A;  3I4N G;  2F4V Q;  4BXX G;  1A3V A;  1QVG A;  4K5V A;  5C0X G;  2F0L A;  4HMI A;  5IE8 A;  1V1P A;  4TKO B;  2L1B A;  1IW7 C;  2EYF A;  4O0A A;  5DM6 3;  1HNW L;  1VQ8 A;  1LV9 A;  1EFI D;  4A3D G;  2IPK D;  3FPU B;  3LGJ A;  1K3R A;  5FOB B;  4FXG C;  3LWU A;  1PFB A;  5C44 B;  1I6H B;  2MJ8 A;  2JJQ A;  3K8A A;  1JCK B;  1D1I A;  4X6A H;  4CGY B;  1CZG A;  1RTO A;  4KY6 A;  3HOU G;  1WYD A;  2WB1 E;  1CK1 A;  2EE1 A;  4ZLT F;  1F9Q A;  4N8X 1;  1ZXT A;  2PQA B;  2J4X A;  2CFM A;  1SE2 A;  4AYB B;  2LXK A;  4LF8 L;  3I55 A;  2BA1 A;  3QG1 A;  1X3G A;  1HA6 A;  4QGU A;  4C2M H;  4XQN A;  4X64 L;  4LFB Q;  3I4N H;  4YCV A;  4BXX H;  2PQE A;  3PIP 3;  1TY2 A;  3ULP A;  3A8J E;  4R9W A;  3K5M A;  5C0X H;  1D8L A;  1IW7 D;  2K5W A;  2PYK A;  4F8M A;  5IYC G;  3L0O A;  1PLF A;  3A5U A;  3CD6 A;  5FLX E;  3PUW A;  4A3D H;  1E2Z A;  2H1E A;  4X3S A;  4IUQ A;  3GTQ B;  4AYB G;  3CCE A;  4HTH A;  5KEE A;  3DXJ C;  3PF5 A;  1G2T A;  5BN4 A;  2MHV A;  2NVQ B;  1I50 B;  1MSH A;  3BJU A;  3TRE A;  1HH2 P;  5JJK A;  2ICI A;  4A3K B;  4UPA A;  4FYD A;  1GM5 A;  2FJ2 A;  1FGB D;  5M5Y B;  4OWT B;  4JI3 Q;  4JV5 Q;  4P72 A;  3HGB A;  2AHO B;  5C44 H;  1S40 A;  1I6H H;  4XYQ A;  2R92 B;  2C5C A;  5HY6 A;  3ICE A;  5CYU A;  3E3X A;  5IT9 c;  4KD4 A;  4CDD C;  3UDG A;  5IYC H;  4Y52 H;  4C1N I;  5M5X H;  4OWX B;  3A7A B;  3G7L A;  3D31 A;  4IPD A;  3TZU A;  1XPU A;  2B3G A;  2MGS A;  1F77 A;  3P7J A;  1N32 Q;  4DR5 L;  1JT8 A;  1CQV A;  1X56 A;  1Q81 C;  3NWT A;  1G6P A;  3PO2 B;  3MHB A;  1JJC B;  2R92 G;  3AYH B;  2NVX B;  4XT1 B;  4BY1 B;  2B8F A;  3ER0 A;  3ND9 A;  1SRU A;  1B9M A;  5DEH A;  1B7Y B;  5E3F A;  2G5D A;  3H3V H;  1DZ1 A;  4NKL A;  2UUB Q;  4HED A;  4B3T L;  5D3D A;  4OHJ A;  3ERS X;  5JOB A;  3CPW A;  1EY9 A;  3NQI A;  2QA4 A;  2H4O A;  2NN6 G;  5EPJ A;  1PH5 A;  3GTQ H;  1IYU A;  4APV A;  3L3O C;  1Q7Y C;  1MKH A;  2UXD Q;  1VMP A;  2EYJ A;  3NUC A;  4QB4 A;  4CDC C;  2JA8 G;  2M00 A;  2D0O A;  4DN4 M;  4C56 C;  2J0T D;  3AFP A;  1I50 H;  4KHV A;  5J22 A;  1YJN A;  1TU2 B;  4N8F A;  2D5D A;  4HSP A;  4P2C B;  2UU9 L;  1QZG A;  1K8O A;  4KTA A;  1JB7 A;  5IT9 L;  2C9O A;  1EOV A;  1E1T A;  1D6E C;  4IFD G;  1KIX A;  3K57 A;  5C6A A;  5EAY A;  2O4X A;  5M5Y H;  1YJ9 A;  4IO9 A;  3TZD A;  1SYC A;  2ID0 A;  3PUZ A;  2Z6K A;  1TQO A;  4ZQ3 A;  3TRZ A;  3M7N A;  4ZK9 B;  3GTO B;  2Z8L A;  1C7Y A;  2B29 A;  2R92 H;  1SYF A;  1ET6 A;  3CQZ B;  5JJZ A;  1S72 A;  3CCL A;  1LAB A;  1SLJ A;  2E2H B;  3DWP A;  1TWC B;  1TWH H;  2JXM B;  1K0R A;  2XRQ D;  4G7O C;  1Y1V B;  1LLR D;  2DGY A;  3PMF A;  1SXT A;  1Y14 B;  1SAP A;  5EBD A;  3MA2 B;  1AN8 A;  5LL6 X;  4L5R C;  2HIV A;  3W1B A;  3D0F A;  2L5T A;  1ICF B;  3MC0 B;  2F4V L;  1KNA A;  3QB3 A;  1Q12 A;  4EQ5 A;  3KDF A;  1VQJ A;  1VF5 C;  3NBH A;  2NZ1 D;  5GAD C;  3T1Y Q;  1JJG A;  4JI2 Q;  3RZO B;  2XVS A;  2PNR C;  1J8I A;  3MZ5 A;  2F0D A;  1I4R A;  3CKI B;  2NVX H;  1QUQ B;  4IFD H;  1QWY A;  3D4D A;  4BY1 H;  3S2H B;  2JA7 B;  2L11 A;  2AMC B;  1DYQ A;  3BDC A;  2HCC A;  3EQL C;  2CQA A;  1ESR A;  1VQP A;  3W3A A;  1Y1V G;  3RMH A;  4WJW A;  5FJ8 G;  3IFD A;  1PYB A;  1VQO A;  1OTC A;  4X3T A;  1LT5 D;  4DV3 Q;  4ME5 A;  5J1Z A;  2IX1 A;  4QUF A;  2O5J C;  3T51 B;  3TEH B;  1YNX A;  3SK5 A;  3OYY A;  2JA7 G;  1D2B A;  2E2I H;  1EZ6 A;  4LFB L;  5KYL A;  1EQV A;  3ERQ A;  3HOW B;  1LTA D;  1YHB A;  3K80 C;  3M7G A;  3MEH A;  1Q8I A;  2A73 B;  5CV7 A;  2QDB A;  4I7Z C;  3DUZ A;  2XSC A;  3K0X A;  2JA9 A;  4IZ8 A;  1EY8 A;  2K5Q A;  4YWL A;  3GTO H;  2SDF A;  4KN4 C;  4DV6 Q;  3IKJ A;  3CQZ H;  4IJH A;  4UP9 A;  4OIJ A;  3SXH A;  3RUZ A;  2E2H H;  1VQK A;  4HJ8 A;  2A1A A;  1HA5 A;  2RDH A;  3CU7 A;  1TWC H;  4ZUJ A;  1O7Z A;  2MQH A;  4FDB A;  4GNX C;  1Y1V H;  3RLN A;  2H5X A;  1HQR D;  3AQQ A;  2NBF A;  1FNU A;  4DA2 A;  4A3B G;  5FJ8 H;  2TMP A;  2ZJR A;  2EY6 A;  3HOW G;  2F3I A;  4CJ2 C;  2R93 B;  1Z7T A;  3PUY A;  4YY3 Q;  3T56 B;  1B2T A;  2KCC A;  2KCN A;  5EPK A;  1WD1 A;  1K9M C;  2KEE A;  4FNF A;  1S5C D;  4ZKC B;  3RZO H;  1EIF A;  2QKI C;  1NY4 A;  1ASZ A;  4DV5 Q;  1K83 H;  2G9D A;  4JI3 L;  4JV5 L;  3S2H H;  2VB3 X;  2JA7 H;  2YTV A;  2NTS A;  4MTN A;  1B1Z A;  5LMU Q;  3MFY A;  4BBR B;  3G4S A;  4EQO A;  1CKN B;  1RTN A;  3V96 A;  1HRJ A;  3OW7 A;  2JYO A;  2A8V A;  2OXP A;  2VS1 A;  5IGE A;  3MFG A;  4IJL A;  1IL8 A;  2IL8 A;  1EQT A;  2R6G A;  2O2L D;  2R93 G;  1EIY B;  1VQL A;  4KJN A;  2F52 A;  3NXW A;  5IGC A;  2B39 A;  3SE0 A;  4DNI A;  4PNY A;  4C3H B;  1VF7 A;  5KRU A;  3E0J A;  1N36 Q;  4A3B H;  1N32 L;  3A8K E;  3TSS A;  3HOW H;  1DD2 A;  2WP8 J;  2K6A A;  4ME3 A;  2EY5 A;  1NAP A;  3H15 A;  1PTO C;  1YVC A;  1KDB A;  4RHS A;  1HR0 Q;  4RHR A;  2NWG A;  3GD7 A;  1PHJ A;  3PIP A;  5GQO A;  2UUB L;  1C0A A;  1YEZ A;  3I73 A;  3KLS X;  2JA5 B;  3MXU A;  3CCR A;  3OMC A;  4G7Z C;  1UUP A;  2UXD L;  3A0J A;  5H1S E;  2RCN A;  4C3H G;  4HIO A;  1G8Z D;  4PMC A;  4PV1 C;  1VQA A;  3VYR A;  3J81 j;  4A3C G;  4GLA C;  5D14 A;  2L4N A;  3J80 E;  2R93 H;  3JC6 6;  1YI2 A;  5L37 A;  3KBX A;  1QE6 A;  3TP6 A;  3MTS A;  4L5T A;  3RD4 A;  5C4Z A;  4YWK A;  4IUV A;  3CRL C;  2K5D A;  4DK3 C;  3H09 A;  1JC7 A;  2QW7 A;  3HZX A;  3FVQ A;  1A3T A;  1ROD A;  1SE3 A;  2L0C A;  5LL6 S;  2L55 A;  3J7A V;  4BBR H;  1PTO D;  1SE4 A;  2MFI A;  4AQY Q;  1RF2 D;  3HOZ G;  3BZD B;  3HP3 A;  4JBJ A;  4N9T A;  4ZCK A;  1W2B A;  3JAM c;  1ET9 A;  5T1I A;  4OX9 Q;  1ML0 D;  4HSV A;  4DR6 Q;  1BBX C;  2F0K A;  2KCM A;  5KNB A;  1I4X A;  3MXN A;  2RSN A;  5COR A;  2WFW A;  4L8J A;  3UE0 A;  4ABN A;  4XIG S;  4DR7 Q;  1WD0 A;  3FRP B;  3Q24 A;  4C3H H;  3S9W A;  1VQC A;  1EQR A;  5C3W A;  4X65 Q;  3T1Y L;  4A3C H;  3MVV A;  4IUR A;  4JI2 L;  5GAH C;  2XRS D;  1HFG A;  1ENC A;  2NUC A;  1N8R C;  3QWN A;  1BBW A;  5E1F A;  3K7A B;  3KOJ A;  3HOY B;  3GTK B;  5C4H A;  2I5L X;  3CRK C;  3TP8 A;  5D3I B;  1SYD A;  1T5X D;  3U9O A;  5CGK A;  1I4G A;  1TWA B;  1NCV A;  3OTO Q;  4U68 A;  3HOZ H;  1LTG D;  1JIC A;  5IGG A;  4POG A;  3FKI B;  1MSG A;  4DV3 L;  5CMD A;  4LUZ A;  2N8N A;  4X62 Q;  3R2I A;  1ILP A;  1V9P A;  5C5L A;  3DM1 A;  3CF5 A;  2E74 C;  2K7V A;  3JAM L;  5EKI A;  3ND8 A;  3T1H Q;  3IL8 A;  1HZA A;  3HOY G;  1ICW A;  2M9V A;  4WFN 3;  3QOL A;  1TKW B;  2F0W A;  2VZA A;  4TRD A;  1HCZ A;  3VR4 A;  4JVZ A;  4EQN A;  1JWU D;  4DV6 L;  1BVS A;  4H13 C;  1B44 D;  1H9R A;  1GD7 A;  2EJF C;  3TP7 A;  1MBY A;  1CM9 A;  2IHE A;  4GKK Q;  3S17 B;  1JOR A;  1GXD C;  1QNU A;  3ITP A;  2PI2 E;  5A35 A;  3BYT B;  2XIW A;  3HKZ B;  2Z9H A;  3BVZ A;  1JOQ A;  1KNE A;  4KJO A;  2K5V A;  4YY3 L;  4DR4 Q;  4CKE A;  4EGV A;  2F0M A;  3N6R A;  3NEN A;  4DV5 L;  4ZRZ A;  3NTK A;  3VYT A;  1VQE A;  4KN7 C;  3KF6 A;  3CCU A;  5LMU L;  1NMF A;  2AUK A;  2KED A;  3HOY H;  4O1N A;  4GS3 A;  3CC2 A;  1QJO A;  1WTP A;  3I72 A;  4DNT B;  4DAV A;  1HUN A;  3NBI A;  1TWA H;  2F0S A;  3HKZ G;  5IGB A;  3DEO A;  1PFN A;  3TP5 A;  1EYA A;  2KHS A;  1I4Q A;  3M4Q A;  2NN6 I;  2AQ3 B;  2YV5 A;  4QL5 A;  1L1O C;  3CHB D;  1SNC A;  1Y1W G;  1N36 L;  3PO3 B;  4U67 3;  3TN2 A;  4OON A;  1PH3 A;  4XYO A;  3RR5 A;  4X3U A;  2QF7 A;  1EUJ A;  4HR7 B;  4LF7 Q;  1ILQ A;  1XPR A;  1HR0 L;  3S14 B;  3K58 A;  2F0I A;  4J15 A;  3AB9 A;  1L1O A;  1DGS A;  1BR9 A;  4DV0 Q;  3I4O A;  2XWJ B;  4ALP A;  2EDG A;  3I4N B;  1YIJ A;  2Y0S B;  1V8Q A;  1SYG A;  4ZUI A;  3KYH C;  1EWH A;  1WTV A;  1KDC A;  5G3L F;  1B3Q A;  2F0Q A;  3PO3 G;  4LFA Q;  3SK4 A;  3VR6 A;  2K5H A;  2N3S A;  3ULL A;  3Q0A A;  2ES2 A;  4K8I A;  1BBU A;  3EN2 A;  3QR8 A;  4F7X A;  2R3Z A;  4CJ0 B;  1E0B A;  4HMJ A;  1D7Q A;  3QO2 A;  1HXY D;  2J7Z A;  4JI1 Q;  1SMX A;  4DR1 Q;  3O13 A;  1WCM G;  1Y1W H;  3HKZ E;  3E9I A;  4LF4 Q;  1LTS D;  1BCP C;  3M4O B;  3HOU B;  2FMC A;  2Y0S G;  5NUC A;  3J7Y W;  4AQY L;  3J81 i;  4A3I G;  2XNA C;  4DPG A;  5EBC A;  1UEA B;  4HJ7 A;  2VNU D;  2OT2 A;  1NMG A;  3NSW A;  2RCF A;  4OX9 L;  2EY2 A;  4GKJ Q;  5AJ3 Q;  4DR6 L;  3P20 A;  1EU4 A;  3VR3 A;  1K28 A;  2QEJ C;  1OXU A;  4DR7 L;  4HCS A;  3GDE A;  4CBV A;  3PO3 H;  2WAC A;  3H0G B;  2EXD A;  4X65 L;  1CZW A;  3CMA A;  2K28 A;  4TSS A;  2AUJ D;  5M5X B;  3FEW X;  3BG3 A;  2Q8T A;  4CJ1 B;  2L12 A;  3S14 H;  4S3S A;  1H9S B;  3DWQ A;  2JSO A;  4DKA C;  4QJF A;  1BCP D;  5IGD A;  5M3M B;  3F2U A;  1HR0 W;  2BH2 A;  4RCO A;  4RH6 A;  3OTO L;  1EL0 A;  5IP7 G;  1S5E D;  4RFB A;  5I6Y A;  1GHK A;  5I9P A;  3A55 A;  1NNX A;  1BNZ A;  3A54 A;  1GKH A;  5ELB A;  3H0G G;  3IAY A;  1GUW A;  1JJ2 A;  2IX0 A;  3MWY W;  2G9H D;  3KF8 A;  4X62 L;  2AWO A;  1I4P A;  2AKW B;  1IBL Q;  3QOJ A;  2A69 C;  4H02 A;  1VQF A;  5ELD A;  3T1H L;  2A68 C;  3M3Y B;  2XTI A;  3I56 A;  1KAW A;  4XTC S;  3A56 A;  2X6L A;  5M3M G;  1EOT A;  2GVA A;  4FXD A;  3I7F A;  3HOU H;  1WTR A;  3M4O H;  2NB0 A;  2JE6 I;  3LNN A;  1Q1E A;  4BY7 G;  4RMF A;  2PI2 A;  4GKK L;  2QEX A;  2B2W C;  4GN5 A;  1E7Z A;  5I2Y A;  1KC8 C;  5I2X A;  3U9S A;  1IHZ A;  1PXU A;  3QJY A;  5C3X A;  5LHY 1;  2UUA Q;  4OIK A;  4GOP B;  3GTG B;  1LT4 D;  3FMC A;  4V19 0;  2NTT A;  4JI6 Q;  4OEL B;  5IP7 H;  2F0H A;  5ELC A;  4PG3 A;  1IKM A;  5ELE A;  2B2U C;  1T5E A;  4DR4 L;  1IXR A;  3H0G H;  2C35 B;  1TWH B;  3K5N A;  1LTB D;  1HNX Q;  1TWF B;  4J1M A;  3RN5 A;  4O42 A;  2A69 D;  5JPN C;  3TME A;  5FLX c;  1UNS A;  1VQH A;  4JC0 A;  4AIM A;  2A68 D;  2ZTD A;  4EX5 A;  4V0B A;  2JEB I;  4DFA A;  1B50 A;  2B2U A;  3HRZ C;  4GN4 B;  3NK9 A;  3K0Y A;  4LF5 Q;  2JA8 B;  1A0I A;  3J7A F;  3SVM A;  4EQP A;  3MXG A;  5M3M H;  4NMZ A;  4IUU A;  4BY7 H;  4UDU C;  2YTX A;  5HUR A;  4AYB E;  1STH A;  4JOI C;  2A74 C;  2RBM A;  2LMC B;  4NW2 A;  5GRO A;  2F1M A;  3OSO A;  1SYB A;  2PZU A;  5IWA Q;  3VR5 A;  4DR3 Q;  2EZV A;  1GOZ A;  1Y8O B;  1SR3 A;  5CV4 A;  3M3Y H;  2AQ1 B;  1EWI A;  1F2L A;  5BN5 A;  1SDF A;  4JOI A;  4LF7 L;  3UDX A;  4RA8 A;  1JR0 D;  4NB3 A;  3OOC A;  1Q3L A;  2DJF C;  4PMB A;  1E1O A;  1GHJ A;  3F8T A;  1X55 A;  4DK1 A;  3C3L A;  4WJ3 M;  4AH6 A;  1JOK A;  2LXJ A;  2BOS A;  4DV0 L;  2EQS A;  3D3R A;  2E2I B;  3TQY A;  3DLL A;  2GN5 A;  5FO9 B;  1TS4 A;  3A8I E;  4DV7 Q;  1PRT C;  2WKD A;  5FLX L;  2PW7 A;  1KLG D;  1PVO A;  3B6Y A;  3KK7 A;  4DGZ A;  3FHW A;  1M90 C;  2RF4 A;  3GTG H;  1AFP A;  1STA A;  4LFA L;  1EYC A;  5E4X A;  1IBM Q;  2UXB Q;  3UI2 A;  4RGO S;  1SJE D;  3PQI A;  2D2C C;  3C1F A;  1AZQ A;  4R8I A;  4DNR B;  1Q90 A;  1TWF H;  4JI1 L;  5M5W B;  3D6W A;  4X3K A;  2WAQ B;  3P75 A;  2NN6 H;  4DR1 L;  1XMO Q;  2EJG C;  1CUK A;  1DM0 B;  4LF4 L;  3AU7 A;  3BDO A;  3HOX G;  2LKV A;  4FXK C;  2B2Y C;  1U4R A;  2JA8 H;  1HFN A;  4L6T B;  2K33 A;  4O2D A;  4GN3 B;  3HEJ A;  1DXM A;  1SBB B;  1G91 A;  2ZJQ A;  2LSS A;  4A3L G;  3ONA B;  1A2U A;  4GKJ L;  1O7Y A;  4KD3 A;  1K83 B;  1RKN A;  5AJ3 L;  4CDE C;  3SDZ A;  5AFW A;  4PZ7 A;  2YTY A;  2N49 A;  1PRT D;  1STY A;  2RKS A;  2B2Y A;  3CXC A;  2IWH A;  2I5M X;  1TY0 A;  3U4V A;  5LMN Q;  5JEA J;  1BO0 A;  3UDF A;  5A2Q L;  3AFQ A;  4K2L A;  2WAQ G;  1XTC D;  3G71 A;  3ERO A;  3SR1 A;  2P5Z X;  3SGI A;  2PCF B;  1HNZ Q;  1LO5 D;  4BA1 I;  4QQB X;  3EIV A;  2ZXP A;  3V05 A;  3NQT A;  4A3B B;  3PGZ A;  2E5L Q;  1GVP A;  3GP7 A;  1YNN C;  2NZH A;  1O7L A;  1UAP A;  4YCW A;  5GAE C;  1KAA A;  1NSN S;  4A3L H;  1D5Z C;  3SK6 A;  4DAY B;  2MPM A;  1IKL A;  4IPC A;  4DV1 Q;  3L9A X;  1IBL L;  2Q2U A;  2RDG A;  2KCT A;  4C3I G;  2KEN A;  5M5W H;  3J7Z C;  2AQ2 B;  4JG2 A;  1AZP A;  2EIF A;  1TVX A;  4QUC A;  1RD9 D;  2HCI A;  5BR8 Q;  4L5S A;  3E9H A;  2KHJ A;  2CVR A;  4EVO A;  1U4P A;  3CC7 A;  2QDL A;  2GA4 B;  3K5O A;  4GNX A;  1KXL A;  2CQO A;  1RJT A;  2UUA L;  1A63 A;  2F0J A;  4NDX A;  1L0W A;  1VQ9 A;  1XTD A;  1X3F A;  1CA5 A;  4YIJ A;  5FLM G;  1YHQ A;  2I5H A;  1YNN D;  2VQF Q;  4JI6 L;  1JMC A;  5JVG 3;  2PO4 A;  1Y69 U;  3HS0 C;  3E0E A;  3WDN A;  1HNX L;  4JI0 Q;  1MHW C;  2VUM B;  3EFX D;  1II3 A;  2IW3 A;  4OWW B;  3SK8 A;  2XN9 C;  1EY7 A;  2UXC Q;  5JPM C;  4POF A;  1JE5 A;  1YZ6 A;  2K50 A;  3I4L A;  2D62 A;  1V1P B;  1I3Q H;  4LF5 L;  1T9H A;  1EEI D;  2A6H C;  1C4Q A;  2PQA A;  4CDF C;  4FF1 A;  1C48 A;  2F4I A;  3H3V C;  5C5M A;  1FVI A;  1S3O A;  2ZTC A;  2RHS B;  1ASY A;  2X69 A;  1Q86 C;  2VUM G;  2YU9 H;  2E2J B;  4XXE A;  3A7L A;  5K5P A;  5IWA L;  4DR3 L;  5FLM H;  1BKB A;  1OXX K;  2WKC A;  1KD1 C;  3M4P A;  5C4X G;  3HOZ B;  1QCB D;  5KND A;  1FD7 D;  1WI5 A;  2VXW A;  1G2S A;  1NR4 A;  1IYJ B;  1Q46 A;  3T4A C;  3R8B A;  3JAM E;  3NHH A;  4DK6 C;  2VB2 X;  2JA6 B;  2F0P A;  1PZJ D;  4DAM A;  1D5M C;  1DCZ A;  1M1K C;  2IY5 B; 
#chains in the Genus database with same CATH homology
 4A3G H;  3BZC A;  1TWA H;  3HKZ G;  4AYB G;  3CCE A;  3KFU A;  3S1M H;  4TVA B;  4DV7 L;  3F2C A;  3PO2 H;  1MIU A;  1XMQ Q;  3PF5 A;  1P16 A;  1IL2 A;  3F2B A;  4HJ9 A;  2DUD A;  4R1J A;  5JJL A;  1IBM L;  2UXB L;  3M4Q A;  5ELO A;  2NN6 I;  3BJU A;  3TRE A;  1HH2 P;  1VS0 A;  4JI7 Q;  5JJK A;  2YV5 A;  4HJ5 A;  4QL5 A;  1N34 Q;  3WWV A;  1L1O C;  1MJC A;  4UPA A;  1Y1W G;  3HOX H;  1N36 L;  2I0Q A;  4LF9 L;  1GM5 A;  4OON A;  1PH3 A;  1FGU A;  3RR5 A;  4LFC Q;  1PH1 A;  2VUM H;  3BZK A;  4UP8 A;  4YCU A;  1YJW A;  4OWT B;  1EUJ A;  1YBY A;  3U4Z A;  4DUZ L;  4JI3 Q;  1XNR L;  1XMO L;  2JA6 G;  4JV5 Q;  4P72 A;  4LF7 Q;  4JI4 Q;  1XPR A;  2AHO B;  1HR0 L;  3OW2 A;  5C4X H;  4J15 A;  1SRO A;  5C44 H;  1S40 A;  1I6H H;  3TS2 A;  5HY6 A;  1L1O A;  1VQD A;  2K14 A;  3ICE A;  5IT9 c;  1DGS A;  4DV0 Q;  3I4O A;  4ALP A;  1PV4 A;  4DV2 L;  4PZ6 A;  3UDG A;  1YIJ A;  5IYC H;  3J80 c;  4B3R Q;  4Y52 H;  1B8A A;  3KYH C;  1L1O B;  5M5X H;  4OWX B;  3I4M G;  3RNU A;  1J5E Q;  3PF4 A;  4LUV A;  3CCJ A;  3D31 A;  4IPD A;  1X6O A;  1LM0 A;  3PO3 G;  4LFA Q;  1EQQ A;  4IOA A;  1XPU A;  3G48 A;  3CCS A;  2K5H A;  2N3S A;  3ULL A;  2ES2 A;  5LMN L;  3PV0 A;  2E2J H;  1K8G A;  1RL2 A;  2K52 A;  5JEA G;  1BBU A;  2B3G A;  3EN2 A;  1NTG A;  4LF6 L;  1N32 Q;  4DR5 L;  1JT8 A;  1X56 A;  2KHI A;  3GO5 A;  1Q81 C;  1D7Q A;  1G6P A;  4JI1 Q;  1SMX A;  2WAQ E;  1RIP A;  3ULJ A;  1LUZ A;  1JJC B;  3AEV A;  2HHH L;  2R92 G;  1W3S A;  1X3E A;  3AYH B;  4DR1 Q;  1HNZ L;  1HZ9 A;  1WCM G;  1Y1W H;  3HKZ E;  3ER0 A;  3E9I A;  4LF4 Q;  1FJG L;  4K0K Q;  1SRU A;  3EBE A;  1B7Y B;  2Y0S G;  4AQY L;  1UE1 A;  3H3V H;  2JA6 H;  2UUB Q;  2HQL A;  1WOC A;  2MO0 A;  4JCV E;  4B3T L;  3J81 i;  4A3I G;  4NXM L;  3ERS X;  3CPW A;  1X9N A;  2JK8 A;  4DPG A;  2QA4 A;  3A74 A;  2NN6 G;  4DR2 Q;  4HJ7 A;  1PH5 A;  3GTQ H;  2VNU D;  4APV A;  1Q7Y C;  1Z47 A;  1MKH A;  1NMG A;  2ATW A;  4X66 L;  4OX9 L;  2Q2H A;  1KQS A;  2E5L L;  4A93 H;  5AJ3 Q;  4GKJ Q;  2UXD Q;  4DR6 L;  2OWO A;  2B63 G;  2JA8 G;  5K36 G;  1E3P A;  4C3I H;  2D0O A;  4A3F G;  3AFP A;  3L2P A;  1I50 H;  2VL6 A;  1YJN A;  3JAM i;  1OXU A;  2UU9 L;  3I4M H;  1QZG A;  4DR7 L;  4B3M Q;  3GDE A;  4DV1 L;  1JB7 A;  4P73 A;  1EOV A;  3GTL H;  3UDI A;  1E1T A;  5IYD G;  4A4I A;  1KIX A;  3PO3 H;  4IFD G;  2EXD A;  4X65 L;  3PIO A;  5EAY A;  3UE1 A;  3CMA A;  4HJA A;  4KLK A;  5M5Y H;  1PA6 A;  1YJ9 A;  4IO9 A;  1E24 A;  1VQG A;  2ID0 A;  3PUZ A;  2Z6K A;  3S14 H;  4OO1 G;  3A5Z B;  3TRZ A;  3M7N A;  3I2Z A;  1WJJ A;  5BR8 L;  1TWG H;  4C3J H;  1C7Y A;  2AWN A;  2B29 A;  3PUX A;  4DKA C;  2R92 H;  1C9O A;  2K5N A;  4QJF A;  1A8V A;  1S72 A;  3CCL A;  1SLJ A;  5IYB G;  4R4T A;  3CP0 A;  2ZJP A;  1HR0 W;  2BH2 A;  2GVB A;  3OTO L;  1TWH H;  1V43 A;  5IP7 G;  1K0R A;  4BBR G;  2VY3 A;  3RLF A;  2OQK A;  2VQE Q;  1XNQ Q;  2OQ0 A;  1YHA A;  2DGY A;  1SN8 A;  1Y14 B;  4NPS A;  4OXP A;  2BA0 A;  1PYS B;  4L5R C;  1GKH A;  2HIV A;  3H0G G;  3W1B A;  3D0F A;  2VQF L;  1JJ2 A;  2IX0 A;  2F4V L;  1NJI C;  4EQ5 A;  4X62 L;  1Q12 A;  2B63 H;  4A3M G;  2AWO A;  1J6Q A;  2AKW B;  2IT1 A;  4A3F H;  1IBL Q;  3KDF A;  3J7A 5;  1QUQ A;  1VQJ A;  3L7Z C;  4H02 A;  5C4J H;  2KBN A;  2ASB A;  5GAD C;  3T1Y Q;  4B3S Q;  1VQF A;  1JJG A;  4JI2 Q;  3T1H L;  2QGQ A;  4GOP C;  4JI0 L;  3KF8 B;  2K75 A;  2Q2T A;  3RLO A;  2R7F A;  2IHF A;  2XTI A;  4BBS G;  3KDF B;  5LMN W;  1QUQ B;  1KAW A;  4RG1 A;  4XTC S;  3I56 A;  4DUY Q;  2NVX H;  4BY1 H;  2UXC L;  2AMC B;  3NBH B;  5M3M G;  2GVA A;  1K8A C;  3I7F A;  3HOU H;  3M4O H;  1YIT A;  3CAM A;  4NXN Q;  2JE6 I;  1VQP A;  1Q1E A;  1Y1V G;  4BY7 G;  1VCI A;  3GTP H;  4RMF A;  2PI2 A;  3HOV G;  4GOP A;  1K73 C;  4GKK L;  4KHP L;  2QEX A;  1UWV A;  4GN5 A;  1E7Z A;  5FJ8 G;  1PYB A;  1I94 L;  1KC8 C;  1VQO A;  1HJP A;  1OTC A;  1UE5 A;  2UUA Q;  4DV3 Q;  4GOP B;  2N78 A;  5IYB H;  4GLX A;  2JA5 G;  4JI6 Q;  5IP7 H;  5ELN A;  3S1R H;  4PG3 A;  5IY0 A;  2IX1 A;  2A19 A;  5C0X I;  4JI8 L;  3TEH B;  1YNX A;  1HZB A;  5C0X J;  4DR4 L;  3OYY A;  4KI0 A;  1IXR A;  2JA7 G;  2E2I H;  3H0G H;  4LFB L;  1IBK Q;  2C35 B;  4KHZ A;  1G51 A;  1YHB A;  1HNX Q;  2CWP A;  3K80 C;  3RN5 A;  1Z9F A;  1UEB A;  5FLX c;  1HNW Q;  1TXY A;  1VQH A;  4JC0 A;  4AIM A;  3U58 A;  2UUC L;  3TS0 A;  4JI5 L;  2ZTD A;  4EX5 A;  3K0X A;  2JEB I;  2JA9 A;  2Z0S A;  3PCO B;  1H95 A;  3GTO H;  4YWL A;  4DV4 Q;  1PH9 A;  4GN4 B;  2XGT A;  4DV6 Q;  4BBS H;  1R9T H;  4LF5 Q;  1A0I A;  3CQZ H;  4GLV B;  4IJH A;  4UP9 A;  2YYZ A;  4R4Q A;  1KHI A;  5M3M H;  2E2H H;  1Q82 C;  1VQK A;  2WB1 G;  4HJ8 A;  2A1A A;  1SFO H;  1TWC H;  4R4I A;  3M85 A;  2MQH A;  4FDB A;  1XMQ L;  4GNX C;  1Y1V H;  1CKM A;  2H5X A;  3RLN A;  4BY7 H;  4MZ9 A;  2YTX A;  3RZD H;  4AYB E;  3HOV H;  3AQQ A;  1KL9 A;  2L15 A;  2R7D A;  3K7U C;  4JOI C;  4A3B G;  5FJ8 H;  1UE7 A;  2ZJR A;  5GRO A;  4UP7 A;  4LF8 Q;  3HOW G;  2F3I A;  4JI7 L;  4QY7 A;  3PUY A;  2NZO A;  4YY3 Q;  1N34 L;  4YHH Q;  4P75 A;  5IWA Q;  4DR3 Q;  1X54 A;  2BH8 A;  4X64 Q;  1PH6 A;  3U50 C;  1K9M C;  2JA5 H;  1SR3 A;  3STB C;  4LFC L;  1EIF A;  3M3Y H;  3RZO H;  1NY4 A;  4PMW A;  1ASZ A;  1EWI A;  1CKN A;  4DV5 Q;  1K83 H;  4JI3 L;  4JV5 L;  3KLW A;  3S2H H;  4JOI A;  2JA7 H;  4LF7 L;  2YTV A;  4JI4 L;  2K4K A;  3UDX A;  4MTN A;  1N9W A;  5LMU Q;  4NB3 A;  1VQ5 A;  1IZ6 A;  1LTL A;  1E1O A;  3G4S A;  5IP9 G;  4IOC A;  1PH2 A;  4UY8 C;  1CKN B;  3F8T A;  4Y7N H;  1X55 A;  2ZM6 Q;  1CSQ A;  3KJO A;  4WJ3 M;  4AH6 A;  2LXJ A;  2A8V A;  4DV0 L;  2EQS A;  1CKO A;  2VS1 A;  4IJL A;  3TQY A;  3DLL A;  1VQM A;  2GN5 A;  4B3R L;  4DV7 Q;  2R6G A;  1N33 Q;  4BA2 I;  3S24 A;  1J5E L;  2R93 G;  4L5Q A;  3CCM A;  1PVO A;  1EIY B;  1VQL A;  3B6Y A;  3GTG H;  3FHW A;  2OCE A;  2RF4 A;  2F52 A;  2E8G A;  1M90 C;  4LFA L;  1IBM Q;  2UXB Q;  1PH4 A;  1AE3 A;  4DNI A;  1QZH A;  1WCM H;  3J80 i;  3GTJ H;  3FKI G;  1N36 Q;  4A3B H;  3H3V I;  4LF9 Q;  1N32 L;  2OTJ A;  4QIW E;  5HGQ A;  3HOW H;  1TWF H;  2WP8 J;  4JBW A;  4JI1 L;  4A3I H;  4JBK A;  4ME3 A;  3DM3 A;  4LUO A;  4R4C A;  1XNR Q;  3H15 A;  4DR1 L;  1YVC A;  3STB D;  1XMO Q;  1KRS A;  4P74 A;  1CUK A;  3W1G A;  1HR0 Q;  4LF4 L;  3GD7 A;  1Q8K A;  4MNO A;  4HIK A;  1PHJ A;  4LNQ A;  2V1C C;  3CCQ A;  3HOX G;  4K0K L;  1XJV A;  3PIP A;  2PMZ E;  3Q8D A;  5GQO A;  2UUB L;  2NVT H;  1C0A A;  2JA8 H;  1YEZ A;  4O2D A;  2Y0S E;  4DR2 L;  4GN3 B;  4DV2 Q;  3CCR A;  2CCZ A;  2ZJQ A;  2LSS A;  4IPH A;  5IP9 H;  4HID A;  4A3L G;  4JYA L;  2UXD L;  3A0J A;  4GKJ L;  1VQ6 A;  5H1S E;  5C44 G;  5AJ3 L;  5M3F G;  1A62 A;  1PH7 A;  5IYD H;  2RCN A;  3NEM A;  1EFW A;  4PZ7 A;  2YTY A;  2N49 A;  4HIO A;  5DLQ E;  1U0L A;  1VQA A;  3CXC A;  1V1Q A;  3J81 j;  2R7Z G;  2I5M X;  3S1N H;  5C3E G;  4A3C G;  2ALY B;  2NVY H;  4GLA C;  3K7A H;  1VQI A;  3U4V A;  3RN2 A;  5LMN Q;  1U5K A;  5JEA J;  3UDF A;  2R93 H;  3JC6 6;  3AFQ A;  4B3M L;  3MEF A;  3PUV A;  3GTK H;  2WAQ G;  2PNH A;  1YI2 A;  3S1Q H;  1CSP A;  1VQ7 A;  4LF6 Q;  3G71 A;  4L5T A;  4DR5 Q;  1VQB A;  4TQU S;  4IPG A;  3J81 c;  4YWK A;  2OTL A;  4A3E G;  3SGI A;  1LYL A;  4DK3 C;  1PH8 A;  1N33 L;  5E7N A;  2HHH Q;  3FKI H;  1HNZ Q;  4BA1 I;  1VQN A;  1FJG Q;  3ZJY C;  1XPO A;  3S16 H;  4BBR H;  3K81 C;  2MFI A;  4AQY Q;  3GTM H;  5JJI A;  2MNA A;  4QQB X;  2HIX A;  4A3J G;  1VQ4 A;  4B3T Q;  3HOZ G;  4JBJ A;  4NXM Q;  3EIV A;  3IRB A;  1AE2 A;  1W2B A;  3JAM c;  3CC4 A;  3PGZ A;  2MO1 A;  4X66 Q;  4OX9 Q;  4A3M H;  3KJP A;  1GVP A;  2E5L Q;  2VQE L;  1XNQ L;  1QVF A;  4DR6 Q;  2D0P A;  2NZH A;  1FL0 A;  4YCW A;  2KCM A;  5GAE C;  4A3L H;  3F1Z A;  2CKZ B;  2WFW A;  3UE0 A;  4DAY B;  4XIG S;  5M3F H;  2UU9 Q;  4DR7 Q;  4IFD I;  3PSI A;  4A75 A;  4P71 A;  4IPC A;  4C3H H;  4DV1 Q;  4IFD J;  1IBL L;  2Q2U A;  2KCT A;  1NE3 A;  2ZTE A;  1VQC A;  1EQR A;  1AH9 A;  1QVC A;  2R7Z H;  3MXN B;  4X65 Q;  5C3E H;  3T1Y L;  4B3S L;  4A3C H;  1UE6 A;  3S17 H;  2KEN A;  4JI2 L;  3FP9 A;  5M5W H;  1P8L A;  5GAH C;  3J7Z C;  4OO1 I;  4A76 A;  5GAG C;  4JG2 A;  2EIF A;  1WFQ A;  1OXT A;  1PFS A;  2VW9 A;  4DUY L;  1N8R C;  4A3K G;  5BR8 Q;  1BBW A;  2Q2I A;  4L5S A;  4LW1 A;  4A3E H;  1X65 A;  3KOJ A;  3E9H A;  2KHJ A;  3CME A;  3CPF A;  4NXN L;  2I5L X;  4R4O A;  3CC7 A;  3NEL A;  3HKS A;  3S2D H;  4GNX A;  2CWA A;  3OTO Q;  4A3J H;  3HOZ H;  3F2D A;  2JEA I;  3W5O A;  1KXL A;  2CQO A;  3CCV A;  4LWC A;  4POG A;  2UUA L;  1A63 A;  1L0W A;  1OXS C;  4DV3 L;  1VQ9 A;  1XTD A;  1X3F A;  1NBW A;  1HZC A;  5FLM G;  2RHQ B;  2I5H A;  4GNX B;  2VQF Q;  1YHQ A;  4JI6 L;  4LUZ A;  1JMC A;  2N8N A;  3I4N G;  3M9B A;  2F4V Q;  4BXX G;  4X62 Q;  1QVG A;  1V9P A;  3CF5 A;  3HFZ B;  1KRT A;  5C0X G;  1SE8 A;  5J3B A;  2JQO A;  3E0E A;  1L2F A;  3G6E A;  3T1H Q;  1IBK L;  5IE8 A;  1HNX L;  4JI0 Q;  1HZA A;  3HOY G;  4O0A A;  4HIM A;  1O7I A;  4OWW B;  1HNW L;  1VQ8 A;  2UXC Q;  1I5F A;  4A3D G;  2NVQ H;  2VZA A;  3LGJ A;  4POF A;  1JE5 A;  1K3R A;  1YZ6 A;  1GO3 E;  2D62 A;  2K50 A;  2Z6K C;  4DV4 L;  4A3G G;  1I3Q H;  4DV6 L;  1BVS A;  2JJQ A;  3K8A A;  4LF5 L;  3PO2 G;  1GD7 A;  1EYG A;  3S15 H;  1T9H A;  4X6A H;  4A3K H;  2HT1 A;  2IHE A;  2PQA A;  4BY1 G;  4GKK Q;  4KHP Q;  1I94 Q;  3HOU G;  4DUZ Q;  2PI2 E;  1WYD A;  2WB1 E;  1G29 1;  2PQA B;  1FVI A;  1S3O A;  2CFM A;  2ZTC A;  2LXK A;  2RHS B;  3BU2 A;  4LF8 L;  4WJ4 A;  1ASY A;  3I55 A;  1Q86 C;  2BA1 A;  4JI8 Q;  2YU9 H;  2VUM G;  1X3G A;  2K5V A;  4A93 G;  2FXQ A;  4YY3 L;  4DR4 Q;  4QGU A;  4PZ8 A;  5IWA L;  4C2M H;  4YHH L;  4DR3 L;  5FLM H;  4X64 L;  3CW2 C;  4JBM A;  1BKB A;  1OXX K;  1E22 A;  4LFB Q;  1KD1 C;  3M4P A;  3I4N H;  5C4X G;  4YCV A;  4BXX H;  3NEN A;  4DV5 L;  1WI5 A;  3ULP A;  2UUC Q;  4JYA Q;  1VQE A;  1MJE A;  1IYJ B;  3KF6 A;  4JI5 Q;  1D8L A;  1Q46 A;  3CCU A;  5LMU L;  1Q1B A;  1NMF A;  4YWM A;  4DK6 C;  3HOY H;  5IYC G;  2ZM6 L;  3L0O A;  1B70 B;  3VDY A;  4GS3 A;  3A5U A;  3CD6 A;  3PUW A;  3KF6 B;  3CC2 A;  4A3D H;  4DAM A;  1OXV A;  1M1K C;  2IY5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...