1XNQL

Structure of an inosine-adenine wobble base pair complex in the context of the decoding center
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
124
structure length
124
Chain Sequence
b'PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Structure of a purine-purine wobble base pair in the decoding center of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 15
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2004-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1xnqL00
4EX5A 2K5HA 1E7ZA 1FJGL 1SRUA 1YEZA 4X64Q 4DV7Q 1UEBA 3PF5A 1L1OA 4JI7Q 2CWPA 4IJHA 1LUZA 1KAWA 4A3CH 3IRBA 2VS1A 4A3LG 2JQOA 4IPDA 4KLKA 4A3FH 3CPWA 4DV4L 4IOCA 1N34Q 2NVXH 3AYHB 4JI1Q 4JI8Q 2ZJRA 4HJ7A 4JYAQ 1MKHA 1MIUA 1LYLA 1E3PA 1PFSA 4DUZL 1PA6A 4JBMA 4KHPQ 4IO9A 2GN5A 1KD1C 4UP8A 5AJ3Q 1IBLQ 2XTIA 4NPSA 5C0XJ 1PH5A 2A1AA 2D62A 3TQYA 4OX9L 1VQGA 1I5FA 4LFAQ 5M3MH 2CWAA 1HR0L 4A3KH 3PIPA 2B63H 4JBWA 3PUZA 3H15A 1VQMA 2PMZE 4DV6L 4OWWB 2OTJA 4Y52H 5IWAQ 3E9HA 5IYCG 1XMOL 1PH1A 3ICEA 3CAMA 3KF8B 1YJNA 1L1OB 1E1OA 1N36L 2C35B 2JA6H 4HIOA 2R93G 3F2CA 4LF6L 2VUMH 1I50H 1G291 2EQSA 1HJPA 3Q8DA 2K14A 5GAEC 3BZCA 3U58A 4NXML 4DR6L 2MNAA 1K8GA 1GKHA 1E24A 4QQBX 1UE6A 3EN2A 3ULLA 4X65L 1AH9A 2OCEA 4IFDJ 3K7AH 4JI3L 4HJ8A 2UXBQ 3PGZA 4HJAA 3CCQA 2UUAQ 1X56A 5M3FH 4R4CA 2HHHL 1PHJA 1VQ9A 2F4VL 2H5XA 1J6QA 1TWAH 2E8GA 5IE8A 3I4MG 1MJCA 1KRSA 2K4KA 1E22A 2AHOB 4KHZA 3KOJA 1L0WA 2WB1G 2YTVA 1IBML 4DV5Q 3CC2A 1M1KC 4BA2I 4BY7H 4RG1A 1XNRL 3I55A 4O0AA 3E9IA 4P71A 3UDIA 5GADC 4DV1Q 4JI6Q 4J15A 3OTOL 4K0KQ 1D7QA 1JJGA 2Y0SG 5M5YH 4O2DA 1PH9A 3CF5A 1I3QH 1D8LA 2Z6KC 4GKJQ 3CCSA 3K81C 4DR1Q 2A19A 4LFBQ 2R92H 2R7DA 2NZHA 4AYBG 1YHAA 4A3IH 4DK3C 5IP9H 2ID0A 1CUKA 1SR3A 3M4QA 4DV0L 4C3HH 4B3TQ 2JA8G 3AEVA 2MFIA 5E7NA 3STBC 1VQ4A 2OWOA 4ME3A 1WCMH 1Q82C 5IYBG 4IJLA 2E5LL 1Q1EA 1BBWA 2VL6A 3GTGH 2Q2UA 2VY3A 4YWKA 1XPUA 1CKMA 1GO3E 1IL2A 1KC8C 1PH7A 3T1HQ 4AQYL 3CQZH 2UXDQ 2JA7H 3HOWG 5C4XG 1X3EA 2JK8A 4LF9L 4AIMA 2NN6I 4UPAA 2NZOA 1VQFA 1QZHA 4PG3A 3A74A 3J80c 1YHBA 1EIYB 1TXYA 3GTQH 3T1YQ 1W2BA 4QIWE 1R9TH 1YIJA 3G4SA 3FKIG 2KBNA 1VQIA 1EIFA 4H02A 5GROA 2UXCL 1CKOA 5JJKA 4DAMA 5C4JH 4DR5L 4AH6A 2V1CC 3PUYA 2HIXA 1Y1VG 1Q8KA 1Q1BA 4MZ9A 1NY4A 3UDGA 1OXXK 2MO0A 3L0OA 1A8VA 3PO2H 2B3GA 3CW2C 2R7ZG 3TREA 1Y14B 4LF8Q 3PF4A 3HOUG 2E2JH 4B3ML 3UE0A 4BBRH 3RLOA 1N8RC 2N78A 2UU9Q 3S24A 4LF4Q 4HJ9A 3UDFA 1XPRA 2AWNA 4YWMA 2ZM6Q 3AQQA 3CCUA 1N33L 4JV5Q 5JJLA 1K3RA 3CC7A 3GTLH 2EIFA 1MJEA 4NXNQ 1A0IA 3MEFA 4JI0Q 4YCUA 4PZ8A 5LMNQ 4JI4L 2DUDA 3U4VA 4DKAC 1PH3A 3PO3G 5ELNA 4QL5A 1HNZL 2AWOA 2WB1E 2ES2A 5C3EH 4IFDI 2AMCB 3G71A 1S3OA 1HNWL 2UUCQ 4OO1I 1O7IA 1LTLA 2GVBA 4A3BG 2Q2IA 1TWHH 2KCTA 4DR4Q 3HOYH 5IYDG 2Y0SE 4BA1I 2IY5B 4A3GH 1P8LA 2YTXA 3JC66 1TWCH 5IP7H 5FLMH 1Q86C 2UUBL 1FJGQ 4AYBE 4DR3L 1UWVA 3RR5A 4EQ5A 4UP9A 2YTYA 1HH2P 2WFWA 2CCZA 1XMQL 4B3RL 1VQDA 3M4PA 1J5EL 1EWIA 3HFZB 2ALYB 3I4NH 1Y1WH 2K75A 4DV4Q 2KHJA 1H95A 1PH6A 1GD7A 4A3LH 2ASBA 4DUZQ 4GN4B 3S17H 3S14H 4L5RC 4JI2L 3I4OA 2I5HA 2R6GA 4R4IA 4X66L 3B6YA 5M5XH 1PH4A 4OX9Q 2FXQA 2OQKA 2E2IH 4DAYB 1YJ9A 1NJIC 1HR0Q 4A93H 1VQBA 4BXXH 2ZTDA 2VQFL 2PQAB 3J81j 4DV6Q 1OXTA 1TWFH 2RF4A 1EYGA 3GD7A 5EAYA 5HY6A 1XMOQ 1NE3A 3S16H 5M3MG 5BR8L 4A3KG 1N36Q 2B63G 5M5WH 4DR7L 3CMAA 5IYCH 3L7ZC 4QJFA 4DV3L 3L2PA 5IY0A 4LF6Q 3I7FA 4NXMQ 4DR6Q 3HKZG 2HQLA 3ULPA 3LGJA 3H0GG 1ASYA 1QUQB 1VQEA 2Z6KA 5FJ8H 4X65Q 2NN6G 2MQHA 4JI3Q 4PMWA 4LF5L 1X65A 3D0FA 3A0JA 3NEMA 1WJJA 3RNUA 3PV0A 4NB3A 1ASZA 2HHHQ 1SLJA 4YY3L 5GAHC 4IPCA 2F4VQ 4R1JA 3GTKH 2WAQG 3GTPH 1VQJA 1QVGA 2E2HH 3KDFB 4DNIA 4LF7L 1HZAA 2L15A 5M3FG 3TS0A 1IBMQ 3I4MH 1XNRQ 4JBJA 1EUJA 4MNOA 1B70B 1RIPA 1N32L 3F8TA 2N49A 3K80C 3OTOQ 1YITA 1NBWA 1SFOH 2A8VA 2HT1A 1X3FA 3D31A 1VQNA 2LXKA 4GKKL 1S40A 4GOPC 2IHFA 4A76A 4BY7G 3HOZG 3VDYA 4DV0Q 5C44H 4HJ5A 1XTDA 3HOVH 1G6PA 3MXNB 4LUZA 4POGA 3M3YH 1JJCB 4A3MH 2AKWB 4GOPB 3CMEA 4DR2L 2PNHA 3FHWA 3PUWA 1W3SA 2I5LX 5LMNW 1PH2A 1JE5A 2E5LQ 2R92G 3S1NH 3M4OH 4A3IG 1E1TA 5IP9G 3A5UA 1NTGA 1KQSA 1U0LA 2B29A 1G51A 4A3EH 5IYBH 4AQYQ 1K0RA 1WCMG 4BY1H 4OO1G 3HKSA 1C0AA 1PYSB 4LF9Q 3S2DH 2K5NA 3S1MH 2K50A 4XTCS 3GO5A 2Z0SA 3K0XA 1VQ8A 2OQ0A 5LMUL 5C4XH 3CCEA 3HOWH 1QVCA 1SE8A 2ATWA 2JA7G 3I56A 4JI5L 2D0OA 3G6EA 1CKNB 1FVIA 3BJUA 1XJVA 4GN3B 3E0EA 1X3GA 1WYDA 4GLXA 2UXCQ 1XPOA 1PH8A 5K36G 2DGYA 2JJQA 4GN5A 4DR5Q 4DUYL 4DV2L 1Q81C 3RN2A 4A3DH 1WFQA 2D0PA 4LW1A 4UP7A 2ZJPA 3KFUA 4A75A 3HKZE 3PSIA 4OONA 1UE7A 3WWVA 4GNXC 2NVQH 4B3SL 2NVTH 4R4QA 4B3MQ 3PIOA 4WJ4A 2ZTCA 1EOVA 4JG2A 4POFA 3UE1A 3EIVA 1N33Q 1VQPA 3PO2G 4KI0A 4WJ3M 3STBD 3NELA 1EFWA 3HOUH 1RL2A 4BBSG 1OXUA 1U5KA 4X62L 1VCIA 2PI2E 2WAQE 5H1SE 1Q7YC 3DM3A 4JI4Q 3JAMi 4JBKA 1DGSA 3KF6A 4OXPA 2VQEL 5JJIA 5J3BA 5C0XI 1IBKL 4C3JH 3PUVA 1IXRA 4QY7A 4A3JH 1HNZQ 2JA5H 4JCVE 1HNXL 3HOXH 1M90C 2PQAA 1HNWQ 3DLLA 1VQCA 3BZKA 2EXDA 3FP9A 4P74A 4YHHL 3PO3H 1AE3A 3TS2A 2BH8A 1I94L 3J81c 4A4IA 1GVPA 3J7A5 4TQUS 2F3IA 1GM5A 2UUBQ 4IOAA 2KENA 5C3EG 4A3BH 4DR3Q 1WOCA 4LFCL 4MTNA 1XMQQ 4B3RQ 3HOYG 1J5EQ 1KXLA 1P16A 3KYHC 1VS0A 1YVCA 5IP7G 3J81i 1PVOA 4A3CG 1QUQA 1YBYA 5HGQA 4QGUA 3GTOH 4YCVA 2JEBI 3CXCA 1YJWA 4YCWA 4ALPA 4A3FG 4X64L 4DV7L 1EQQA 3KF6B 3KJPA 4HIDA 2IT1A 1QZGA 1KIXA 1WI5A 4JOIA 2N3SA 1Y1WG 1X55A 4JI2Q 3I4NG 3TRZA 3I2ZA 4X66Q 5GAGC 1PV4A 4GLAC 3ZJYC 3K8AA 4IPHA 1UE5A 4LUVA 1N34L 4PZ7A 1JJ2A 4FDBA 4JI1L 4JI8L 1OXVA 2VQFQ 4JYAL 4XIGS 3KDFA 3S1RH 1VQKA 1SROA 3W1BA 4KHPL 3KLWA 1VQHA 2VNUD 1IBLL 5AJ3L 1YNXA 3G48A 3W1GA 1OXSC 3CCMA 1NMFA 4DPGA 4A93G 5BR8Q 4C3IH 4DR7Q 2RHSB 4BXXG 4LFAL 2KHIA 4DV3Q 2CKZB 1FL0A 3RZOH 4JOIC 4LUOA 5DLQE 4R4OA 2R93H 1L1OC 3ULJA 5IWAL 4OWTB 2JA6G 2I5MX 3CCRA 1T9HA 2VUMG 1KRTA 4LF5Q 4GOPA 4HIMA 3GTMH 1KHIA 3H0GH 3GDEA 5JEAG 2YYZA 3CC4A 3GTJH 1CSPA 4YY3Q 1YZ6A 1X9NA 1K73C 5FJ8G 1FGUA 1V1QA 3OYYA 1VQAA 4LF7Q 3W5OA 4P72A 1K9MC 2UXBL 4IPGA 1B8AA 4X6AH 1VQ7A 2UUAL 1N32Q 1PYBA 2OTLA 2CFMA 1YHQA 1AE2A 2QGQA 3ER0A 2ZTEA 1A62A 4Y7NH 3M85A 3TEHB 3NENA 3M7NA 1X6OA 4GLVB 5ELOA 1CKNA 2QEXA 1EQRA 4GKKQ 1KL9A 2HIVA 4APVA 2NVYH 1Q12A 4HIKA 4DV5L 2YU9H 4DV1L 4K0KL 5GQOA 4JI6L 1JMCA 3EBEA 2JA8H 1BKBA 3HOZH 1BVSA 2Q2HA 1SMXA 2K5VA 1QVFA 4DR2Q 2N8NA 4GKJL 3CP0A 1CSQA 4DR1L 4LFBL 2MO1A 4GS3A 5C0XG 4TVAB 5C44G 3HOVG 3S1QH 3H3VH 2K52A 1V43A 3AFQA 4B3TL 4A3MG 4P73A 3CCJA 1JT8A 2PI2A 3F1ZA 1BBUA 4GNXA 1YI2A 1VQ6A 3CD6A 5LMUQ 1S72A 4A3EG 4PZ6A 1LM0A 3UDXA 3S2HH 4BY1G 4JI5Q 3T1HL 2UXDL 3CPFA 1HZBA 1Z9FA 1UE1A 2CQOA 4L5QA 1NMGA 3FKIH 4LNQA 2RHQB 1XNQL 2I0QA 4DUYQ 4DV2Q 5IT9c 3RLFA 2BH2A 4P75A 3RN5A 2Q2TA 1XNQQ 1A63A 3K7UC 1K8AC 2JEAI 3CCLA 4RMFA 1Y1VH 3T1YL 4IFDG 1IZ6A 4YWLA 2LSSA 3JAMc 1I6HH 1C7YA 2JE6I 1HR0W 1C9OA 3NBHB 3U4ZA 1HZCA 2IX0A 3F2DA 1N9WA 2XGTA 4JC0A 4B3SQ 2LXJA 4UY8C 1K83H 4A3DG 2F52A 2R7ZH 2JA9A 1VQOA 3SGIA 3OW2A 3M9BA 4GNXB 2BA1A 3PUXA 3BU2A 4R4TA 1HZ9A 3J80i 1VQ5A 3CCVA 4L5TA 4BBRG 1Z47A 1VQLA 4JI7L 4X62Q 3RZDH 2VW9A 3A5ZB 2YV5A 2WP8J 3U50C 2VQEQ 2R7FA 4C2MH 5FLXc 4LF8L 2VZAA 1IBKQ 4LF4L 4BBSH 2IHEA 2UU9L 3S15H 1B7YB 1X54A 1HNXQ 2RCNA 3AFPA 3J7ZC 2ZM6L 4JV5L 2QA4A 3KJOA 2KCMA 4DK6C 4YHHQ 3PCOB 4NXNL 1I94Q 2GVAA 5JEAJ 4JI0L 5LMNL 5IYDH 1IYJB 1L2FA 1Q46A 1TWGH 2BA0A 4A3JG 3H3VI 4L5SA 1JB7A 2JA5G 2IX1A 3HOXG 3ERSX 4LFCQ 4A3GG 3F2BA 4OWXB 5FLMG 2UUCL 2ZJQA 4DR4L 1SN8A 3RLNA 1V9PA 1OTCA 4LWCA
chains in the Genus database with same CATH superfamily
3F2UA 1FJGL 2L55A 1YEZA 1D5XC 4JI7Q 4K14A 4IJHA 1LUZA 1Y8PB 4IQZA 3NK9A 1CQVA 2KJXA 3CQZB 4IOCA 3AYHB 1TU2B 3OWEB 4IUVA 4JI1Q 4JI8Q 2ZJRA 1KDAA 1HTPA 3BS1A 1IYVA 1E3PA 4KY5A 1EQTA 1KD1C 1EEFD 3JAML 1PH5A 3TQYA 1VQGA 4LFAQ 5M3MH 2B63H 3D4DA 3J81E 4OWWB 5IWAQ 3E9HA 2V4DA 1SNMA 5ELFA 3RZDB 3K5MA 2C35B 2NN6H 5CV6A 5FLXL 5CC4A 5I6WA 3F2CA 3Q8DA 5EKKA 4DR6L 1K8GA 2CH4A 1E24A 1B3AA 1UE6A 1STYA 1K8MA 4ZYSA 4JI3L 2UXBQ 4Z9CB 3CCQA 1TS4A 1TVXA 2HHHL 1VQ9A 1J6QA 1KTKA 1KRSA 3GQBA 1EU3A 2RDFA 2YTVA 1XNRL 3BG3A 1BCPD 4O0AA 1JJGA 1PH9A 1IW7D 2Z6KC 3K81C 2NVXB 4AYBG 3G7LA 4DK3C 5IP9H 3M4QA 4C3HH 3SDZA 3STBC 1VQ4A 3VYRA 1Q82C 1GUWA 2E5LL 4YWKA 1XPUA 4A3KB 1I4HA 2K6AA 1PH7A 2F0SA 4AQYL 2UXDQ 2JA7H 3RD4A 2XVSA 1D2BA 1KDCA 4PG3A 3A74A 4IN3A 2JA6B 4ID6A 1TXYA 3GTQH 1W2BA 1B53A 4N8X1 4QIWE 4RFBA 1GHJA 5GROA 2UXCL 1PRTF 5IGDA 2B2VC 4OGQC 4L8JA 4AH6A 4F8MA 2HIXA 3MXPA 1CT1D 1UUPA 3URYA 1B4OA 1VMPA 5M3FB 1B9MA 1NY4A 1NAPA 2WINB 3IFTA 4LAAA 3KUPA 4X3KA 1EY4A 1I4QA 2G5DA 3TREA 2A74C 3PF4A 2CHBD 3HOUG 4BBRH 1LLRD 3RLOA 3CCUA 5JJLA 1K3RA 4E6IA 3GTLH 2WIIB 1GUGA 1B50A 3GV6A 3NP8A 3QO2A 3D6WA 3TMEA 3I70A 1U4MA 1S3OA 1O7IA 1LTLA 3OWFA 2KCTA 4ABNA 4JK1C 3EQLC 5C44B 2IY5B 2JSOA 1WCMB 4RKBA 2XWJB 5IP7H 1Q86C 3O13A 1JB3A 2OT2A 2WFWA 1HA5A 4F7XA 3M4PA 1EWIA 5IGCA 1EFID 1SNPA 2F0HA 2K75A 2F0UA 1EIHA 4BY1B 5E3FA 4K6LA 3AU7A 3IKJA 1PH6A 4A3LH 3WOFA 1TS2A 1EIGA 4WJWA 5C5MA 1R4QB 3SE0A 1DYQA 3K5NA 4HEDA 1GHKA 2I5HA 1Q3LA 3WDNA 1I4XA 2FXQA 4CBVA 2JP1A 4DAYB 1YJ9A 2XRSD 1OXTA 4OEMB 4C3IG 2NTSA 4A3DB 5EAYA 1XMOQ 4LJZC 4A3KG 4MN3A 5CV4A 3CMAA 4DR7L 3I91A 4QJFA 3L2PA 4LF6Q 2QDBA 4NXMQ 1SYCA 5JEAH 4ZQ3A 3CU7A 3MWYW 1QUQB 4KJNA 4PMWA 3RNUA 1EY9A 1EZ6A 2EPBA 4IPCA 3KBXA 3HOYB 1VQJA 3QJYA 3KDFB 4DNIA 2B2UA 5M3FG 4FP5D 3I4MH 1EUJA 4FNFA 4L6TB 2EY5A 4UDUC 3U9SA 3I4NB 1Y1WB 4GKKL 4A76A 1VF7A 2O2LD 3A54A 1LT3D 1XTDA 5EPKA 3S17B 4FYDA 4LUZA 5E4WC 5M5XB 2BOSA 2EYFA 4DR2L 3S1NH 2E2IB 3A5UA 1HRJA 1G51A 4MTKA 4UHVA 2FFKB 1WCMG 1U4PA 3HKSA 1F77A 1ICFB 4G7OC 3GO5A 1TY0A 5LMUL 3HOWH 1PRTB 3BZDB 3OOCA 1A15A 2ATWA 1E0BA 4JI5L 3V2TA 2K33A 3E0EA 2R93B 1W6KA 2K1BA 4GLXA 1MGSA 4DR5Q 1Q81C 2CQAA 1ZXTA 3ZYYX 3KFUA 1PLFA 4A75A 3HKZE 3WWVA 4IALA 2PZTA 4GNXC 4B3SL 2DY8A 2E2HB 4POFA 1N33Q 1VQPA 3PO2G 1SYFA 1SFOB 4BBSG 2F0IA 2PI2E 2WB1B 2EOTA 2VQEL 5FOBB 1IBKL 4C3JH 3PUVA 1IXRA 1HNZQ 1DOKA 4KN4C 4JCVE 3HOXH 3H91A 3HOVB 2H1EA 1VQCA 4P74A 3AMUA 3M3YB 4A3MB 1I94L 1QJOA 4HMJA 4A3BH 2EYOA 3BYTB 2K04A 4LFCL 3EJIA 3X3NA 1J5EQ 3HOYG 1KXLA 1VS0A 2MHVA 3VR2A 3BVMA 4RAUC 1YJWA 1ZYRD 1ESFA 1EQQA 4IFDI 4DAVA 4JI7L 2ZXOA 1HHVA 3G6JB 3I4NG 1Y1WG 1X55A 4X66Q 1SBBB 3VYSA 1PV4A 1JJ2A 3ZJYC 2Q8RE 4JI1L 4JI8L 1LABA 2TSSA 1FYCA 1BCPC 2VNUD 3TP7A 3G48A 3CCMA 1NMFA 4A93G 5BR8Q 1STAA 3CRLC 2HDLA 1IW7C 2RHSB 4BXXG 2WACA 4LFAL 4CJ1B 4DV3Q 2DN8A 3RZOH 4IUQA 1BCPB 5IWAL 4JPBW 2B2WA 1QG7A 1T9HA 1KRTA 3MXNA 1LV9A 5C5LA 4HIMA 1KHIA 4R8IA 4A3JB 2YYZA 3GTJH 1S5CD 1K73C 5FJ8G 1FGUA 3PO3B 4H13C 1VQAA 2UXBL 1PYBA 3R93A 1WD1A 4Y7NH 2ZTEA 2C5CA 4K5WA 1X6OA 4CDCC 1STGA 1EQRA 4HIKA 2YU9H 1K8OA 3T53B 2NVQB 2KECA 1JMCA 4KV6A 2O5IC 2QILA 4K2KA 2K28A 4XT1B 4IZ8A 3HOVG 1LT5D 3NBHA 1V1OA 1V43A 2K52A 4CDDC 1BF4A 1RTOA 2X69A 4A3MG 4QIWB 1EY0A 1JT8A 5DNFA 1VQ6A 4HAEA 2QDLA 1RD9D 4EQOA 5KNBA 3NBIA 4HCSA 4CJ0B 2UXDL 1HZBA 1NMGA 4LNQA 2RHQB 1XNQL 4U673 3FPUB 4YIJA 3TP6A 3RLFA 2Q2TA 1LT6D 3H0GB 1K8AC 2A6HD 3NBHB 3NSWA 2IWHA 3OMCA 2F52A 3A7LA 3SGIA 3OW2A 4H0LC 3J80i 3BU2A 3FPPA 4BBRG 1Z47A 4X62Q 3RZDH 3A5ZB 2WP8J 1TWAB 1B1ZA 1SDFA 2RCNA 5CR3A 1M8AA 4N8FA 4YHHQ 3PCOB 4DNTB 3HOZB 4DA2A 4FXDA 4A3JG 3SR1A 3NPPA 3H3VI 5L37A 2JA5G 4IURA 3SVMA 4JW0A 2PW7A 4DXGA 5I4DA 5JVH3 1V9PA 1FNVA 3MFYA 2BE5D 4NP5A 4EX5A 1E7ZA 1SRUA 4DV7Q 1OO9B 1UEBA 1J8IA 2CWPA 1ENCA 3IRBA 4CKCA 1XWEA 3Q23A 4A3LG 1DXMA 4IPDA 4I65A 2NVXH 3NWSA 4HJ7A 1MKHA 2LFNA 2NBFA 4WFN3 2KCNA 4KHPQ 2F0VA 2GN5A 4TRDA 4EQPA 2F0NA 1CA6A 1IBLQ 5AJ3Q 2XTIA 2B8FA 2A1AA 2J7ZA 3DMUA 3L9AX 4HCEA 1A3UA 4WRDA 4A3KH 3PIPA 4JBWA 4Y52H 2PMZE 2OTJA 3A56A 3NTIA 5C4JB 3BVZA 5EBCA 1XMOL 1E1OA 2G9HD 2JA6H 5A2QE 4LF6L 4NXML 4DGZA 1S5DD 1SE3A 2MNAA 5C6AA 3TP8A 5DEHA 4IFDJ 1TWGB 4HJ8A 4HJAA 1X56A 5M3FH 1E2ZA 1G91A 3I4MG 1MJCA 1E22A 2F3VA 4XDXA 3MVVA 4KHZA 3KOJA 4RG1A 1JWSD 5J39A 3I55A 3GP7A 4DV1Q 1D7QA 2EY1A 1BDOA 1STBA 1D8LA 4GKJQ 1PFMA 1X3PA 4M8AA 5CV5A 4DR1Q 2R7DA 2LMCB 2ID0A 2N55A 2ICIA 5E7NA 3DEOA 1WCMH 1K0SA 4IJLA 1RHPA 3S14B 1SMYD 4X3UA 1KC8C 1F2MA 4J1MA 5IGGA 3HOWG 1MSGA 1X3EA 3J7AF 4AIMA 2NN6I 3J80c 1YHBA 1LACA 3S16B 2F3WA 4P2CB 1HXYD 2VUMB 1I50B 2KVMA 1CZGA 3G4SA 1CKOA 5JJKA 4DR5L 1QB5D 3PUYA 1Q1BA 1Q8KA 4MZ9A 3UDGA 1OXXK 1A8VA 3PO2H 2F0DA 2B3GA 1K3BC 3E0JA 5T1IA 4DXFA 2KOLA 3UE0A 1UAPA 3N52A 4QF4A 2JYOA 1N8RC 4LF4Q 4HJ9A 1XPRA 2AWNA 5CYUA 5D14A 4BY7B 1N33L 3NUCA 4NXNQ 3P7JA 5M5YB 4M1UB 4G4KA 2DUDA 3U4VA 5JAVA 4DKAC 5ELNA 1HNZL 2AWOA 2WB1E 3SK4A 2ES2A 3G71A 4A3BG 1PYWD 3HOYH 5IYDG 4BA1I 3JAME 1P8LA 5COYA 2EZVA 5FLMH 3GTGB 2HUGA 2IPKD 4EQ5A 4UP9A 5IGFA 1VQDA 1J5EL 2ALYB 3I4NH 1Y1WH 4WORA 3SEBA 3HRZC 2A5HA 3P1HA 4FO2A 1BNZA 3J80L 4X3SA 3MFGA 4DUZQ 3K0YA 5FLXE 3S17H 5FK9C 2E2DC 1R9TB 4F87A 3I4OA 4X66L 2R6GA 4R4IA 5M5XH 3B6YA 4F88A 3DWQA 3PMFA 2E2IH 4A93H 3NTKA 3DHQA 4BXXH 1STHA 2ZTDA 2PQAB 1TWFH 3TZUA 2RF4A 3HS0C 5HY6A 4PV1C 2EJMA 1SEBD 5BR8L 1N36Q 1QWYA 2MP1A 4DV3L 3I7FA 2L11A 1ICWA 2B8GA 3HKZG 1JWMD 2F0QA 2Z8LA 5FJ8H 2Z6KA 2OF1A 4X65Q 2O4XA 2MQHA 1RF2D 1X65A 3D0FA 4KKTA 2AQ2B 2NB0A 3PV0A 4NB3A 3GTKH 2F0FA 3FVQA 1HUMA 3C3LA 3AB9A 2E2HH 1JICA 4QCLA 1TWCB 1IBMQ 4KKUA 2F03A 1B70B 1V1PB 1SFOH 3OTOQ 1YITA 1NBWA 2A6HC 2HT1A 1BO0A 2Z4IA 5G3LD 1HFGA 4GOPC 4BY7G 3PQIA 5CV7A 3NXWA 3DXJC 4DV0Q 3HOVH 2FJ2A 4C56C 4K8IA 2ENBA 3M3YH 1JJCB 4A3MH 4GOPB 1GUSA 3T13A 3FHWA 2R92G 2I5LX 1JE5A 2B2VA 4J8QA 1NTGA 1KQSA 2B29A 2RA4A 5FO8B 5DM63 4IUTA 5IYBH 1RTNA 4OO1G 2EJFC 2K32A 4LF9Q 2K5NA 2E74C 1EY8A 2K50A 1FR3A 2Z0SA 1VQ8A 3CCEA 3TN2A 5I9OA 5KNCA 1QNKA 3G6EA 1XJVA 1CKNB 1CTMA 5IGBA 1X3GA 2PO4A 1XPOA 5K36G 4GN5A 1QNUA 2BE5C 3HGBA 1W6JA 4UP7A 2ZJPA 3P75A 3PSIA 1UE7A 3V05A 2E75C 1VMCA 4I7ZC 4ODGA 1GUTA 2Z9HA 3PIOA 4L63B 1EOVA 2RSNA 2JN4A 4JG2A 3UE1A 1MI2A 3MTSA 1QCBD 1SNDA 5CV9A 3NELA 1WTWA 4X62L 1VCIA 2WAQE 1Q7YC 5I2YA 5NUCA 5C0XI 4A3JH 4QY7A 4DAYA 2JA5H 2VB2X 3SXHA 1M90C 1KAAA 2GA4B 3DLLA 3FP9A 4YHHL 3PO3H 3TS2A 4A4IA 1GVPA 4K2LA 3H3VC 1GM5A 2KHSA 2F0KA 3J7YW 2KENA 4DR3Q 1WOCA 1XMQQ 4A3EB 4B3RQ 3D8GA 3KYHC 1SYBA 3S2DB 3S1MB 1YVCA 1I4PA 2EYMA 1QUQA 1YBYA 2SNMA 5HGQA 4QGUA 1BBXC 4YCVA 5C4XB 1E2VA 4DV7L 2NVQH 2PMZB 1WI5A 4JI2Q 3S2HB 5GAGC 1QE6A 1XXGA 1UE5A 4ZKBB 4O42A 1LTBD 1SE4A 1C4QA 3FKIB 2VQFQ 3KDFA 1SROA 2XWBB 4O1NA 4KHPL 3KLWA 4NW2A 1IBLL 5AJ3L 1YNXA 2KEEA 4QUCA 3W1GA 5BN3A 4DPGA 3A7AB 1H9RA 2RDGA 1PTOD 4BS9A 2SDFA 2KHIA 4K5VA 2CKZB 4LUOA 1JCKB 1L1OC 3ULJA 4OWTB 4KTAA 2JA6G 3OPOA 2SNSA 3CCRA 1BCPF 4G57A 3R8BA 4LF5Q 3CRKC 3LNNA 3H0GH 5IIFA 1SMYC 4ZRZA 1CSPA 4YY3Q 1YZ6A 1X9NA 2F0OA 3S15B 2P5ZX 4XXEA 1JC7A 1ENAA 4RWSC 5K5PA 4LF7Q 4P72A 1K9MC 4ZKCB 4HSPA 1CA5A 3HP3A 4EVOA 1N32Q 3CHBD 2OTLA 1KABA 2CFMA 1YHQA 2QGQA 3M85A 1A62A 3NENA 4B9WA 4GLVB 5ELCA 2K01A 3OW7A 2HIVA 3GTOB 2NVYH 2FMCA 1RCVD 3NE5B 4DV1L 1Z7TA 2F0TA 1BKBA 3HOZH 1SMXA 1QVFA 1IL8A 3K58A 1BOSA 3CP0A 1X32A 3SK6A 4GKJL 1YNJD 4DR1L 2MO1A 5C44G 2G9DA 3NTHA 1RJTA 3S1RB 3AFQA 3CCJA 4GNXA 1ML0D 3CD6A 2RVLA 1II3A 3LWEA 4A3EG 4PZ6A 3EVQA 3P20A 4ME5A 4BY1G 5M3MB 2B63B 1EY6A 4OELB 1Z9FA 1WTVA 1T5EA 4DV2Q 5IT9c 2B39A 4P75A 3GTMB 1ET6A 4KN7C 3CCLA 4RMFA 4DF7A 4YWLA 2LSSA 1AZQA 1C7YA 3U4ZA 1HZCA 3F2DA 4A3DG 3Q22A 2LXJA 5T1GA 5M9OA 4G7ZC 1F9SA 4GNXB 3PUXA 1S5BD 1HZ9A 1U4RA 4FF3A 2ZXPA 1JOQA 3VR4A 3QWNA 4LF4L 1LTAD 5JPNC 4HN7A 5KRUA 4DK6C 1KDBA 2JA8B 4NXNL 5JEAJ 4RA8A 1IYJB 1Q46A 1TWGH 2BA0A 3ONAB 5IYDH 4L5SA 1JB7A 1PZID 3NHHA 3VR6A 3F2BA 5FLMG 4C3HB 3FRPB 3KLRA 2LKVA 3ND8A 4DK1A 1XX8A 4LWCA 3KF8A 4X64Q 4LK1C 3A55A 3KK7A 4A3CH 1KAWA 3E5SA 3K5OA 2JQOA 1HQRD 3I72A 4KLKA 4NKLA 3CPWA 2JA7B 5IT9L 1AW7A 4KHVA 3VYTA 4JYAQ 1MIUA 1LYLA 2Z1CA 1PA6A 4DUZL 4JBMA 3J7AV 4IO9A 1H9MA 3FDTA 1Y1VB 4UP8A 3LX0A 1CZWA 4NPSA 5C0XJ 1WVLA 2D62A 1QOHA 1T5XD 2CWAA 1VQMA 5IGEA 5BN5A 1TIID 1A6XA 1LTID 1PH1A 3KF8B 5I2XA 4RGMA 1N36L 2XNAC 4HIOA 3BDCA 4XYOA 4C2MB 2R93G 1BQQT 2VUMH 1I50H 3U58A 2EQSA 1HJPA 1SAPA 1NNXA 2K14A 1G6ZA 1GKHA 3EN2A 1I6VC 3ULLA 4X65L 2OCEA 3PIP3 4ZCKA 1QILA 2CH4W 2H5XA 2MUYA 4UAIA 2N88A 4ZAIA 1IBML 4BA2I 2WB1G 4DV5Q 1O7LA 4BY7H 2OEOA 5GADC 1JOOA 3UDIA 4JI6Q 4K0KQ 3OTOL 2DNCA 5M5YH 4A3FB 1AFPA 2R92H 4J6HA 4C1NI 2EY6A 1SR3A 2OXPA 4DV0L 2JA8G 2QKIC 3AEVA 1EY5A 2OWOA 2A73B 4OO1H 4DFAA 5IYBG 1Q1EA 3GTGH 2Q2UA 2VY3A 5LL6S 4KMUC 4C1NK 1IL2A 1CK1A 3T1HQ 2HQEA 3CQZH 1B2TA 4DNRB 3E3XA 2JK8A 4LF9L 2LS01 4UPAA 5ISRA 5K36H 1EIYB 2MJ8A 3A8IE 1SNQA 3T1YQ 1R9TH 1YIJA 1EIFA 4JVZA 1O80A 2WAQB 3S9WA 3K7AB 1Y1VG 5C4HA 5JVG3 3TBIB 2F0EA 4MHEA 5D3IB 4IUNA 3W2DA 3OHXC 3CW2C 4LF8Q 1KNEA 1K28A 1H9SA 2UU9Q 4OIKA 4RH6A 4JV5Q 1S5ED 2IX3A 2EIFA 1MJEA 3MEFA 4JI0Q 4YCUA 1I3QB 5AFWA 2O5JC 1PTOC 3HEJA 5I9PA 3PO3G 1D5ZC 1JQYD 4A3IB 2AMCB 2GVBA 4DR4Q 2D2CC 1PTOB 2Y0SE 2L4NA 1TWCH 2EJGC 1UNSA 1WTHA 4CDFC 4DR3L 3KLSX 3RR5A 2MPMA 1ILQA 1HH2P 1PZJD 2CCZA 1XMQL 4B3RL 1DONA 1H9SB 3HFZB 1GUNA 3OIQA 4DV4Q 1GD7A 2BDNA 1EQVA 1NSNS 1H9KA 2XIWA 3KBGA 3TP5A 5KGUA 3NQTA 1F9PA 2QCPX 4JI2L 2I46A 1PH4A 4OX9Q 1HR0Q 1IKMA 4I7AA 1VQBA 2VQFL 4DV6Q 3J81j 4PMBA 1EYGA 3GD7A 1Q8IA 3NWTA 3RUZA 3D4RA 2K5QA 1YNJC 5IYCH 2HCIA 3L7ZC 2E2JB 2X6GA 5IY0A 2DNEA 1VF5C 5CBAE 2FMMA 3H0GG 1ASYA 2A69D 3R2TA 2AUJD 4LF5L 3A0JA 1WJJA 3R3OA 1ASZA 3QG1A 4BWGB 5C3EB 4YY3L 5GAHC 2F4VQ 4R1JA 2WAQG 3DEPA 1TWHB 1SSOA 4A3GB 4LF7L 2D5DA 2H4OA 3TS0A 4JBJA 4MNOA 1N32L 3K80C 5A35A 3D31A 1VQNA 2LXKA 4N9PA 1S40A 2IHFA 1O7ZA 3HOZG 4DAPA 1LTRD 2J4XA 5C44H 4HJ5A 1HUNA 3DUZA 4POGA 3I3CA 3KLSA 2AKWB 3X3MA 3CMEA 1O7YA 5LMNW 2Z6BA 3SK8A 4A3IG 1M4VA 5BN4A 2B2YA 3FMCA 4A3EH 2EE1A 1K0RA 4BY1H 3ERQA 1C0AA 3S2DH 1U4LA 1PMRA 2K7VA 2XN9C 3S1MH 4XQQA 2BDOA 3MAQA 1Q90A 2PCFB 3A8KE 3K0XA 2OQ0A 5CV8A 5M5WB 5C4XH 1G2TA 2CVRA 1QVCA 1SE8A 1TS5A 3VR3A 3I56A 1Y69U 2D0OA 4GN3B 3C2PA 3OIPA 2F0JA 5C3XA 1PH8A 2DGYA 2JJQA 4FVMA 2IL8A 2B2YC 4KD4A 4DV2L 1ZYRC 2SEBD 4A3DH 1WFQA 2D0PA 4RCNA 1EL0A 1MHWC 3GTPB 4CKBA 4HSVA 4R4QA 4B3MQ 1SJED 4WJ4A 1DM0B 4MIUA 3EIVA 3EROA 4WJ3M 3LWUA 1WTXA 1RL2A 1OXUA 1CQFA 1U5KA 4JI4Q 4JBKA 1DGSA 3IL8A 3KF6A 4OXPA 5JJIA 5J3BA 1ESRA 3J80E 1EWCA 1HNWQ 2NUCA 2PQAA 1PRTD 2EYPA 3QIAA 3J81c 1L0YB 2F0GA 3M4OB 2A68D 4TQUS 3PIO3 2UUBQ 3D3RA 4IOAA 4FXGC 1EZ8A 5C3EG 1MSHA 4FXKC 4MTNA 5DM73 5ELDA 1P16A 3CKIB 2PZUA 1PVOA 4A3CG 1DCZA 3GTOH 2AQ1B 1G8ZD 5EPLA 3CXCA 3BYYB 4ALPA 1QZGA 4X64L 1TR5A 4KD3A 3KF6B 3KJPA 3MHBA 2N3SA 3TRZA 4GLAC 3K8AA 3MC0B 4IPHA 4LUVA 1VDZA 5KYIA 1AZPA 1OXVA 4JYAL 4XIGS 3S1RH 1VQKA 4CDEC 1GJXA 1FD7D 1VQHA 4FF1A 1SE2A 1TS3A 4R9WA 1V1PA 1D1KA 2VB3X 5LHY1 2NVTB 2PQEA 3HZXA 1EU4A 5DLQE 2R93H 4NDXA 3TDQA 3HOUB 1WTQA 2VUMG 5CMDA 1EYCA 2KCCA 4GOPA 1AN8A 3GTMH 3GDEA 2KUMA 4KJOA 1WTPA 2WV6D 3NQIA 4GZYC 3OMGA 1FNUA 3OYYA 3J81L 3W5OA 1R4PB 4IPGA 4X6AH 2SOBA 1VQ7A 5KYLA 2EYHA 4CJ2C 2QEXA 1CKNA 1J9OA 1MBYA 1G2SA 1S4ZA 3L3OC 3WOEA 1CFMA 2KEDA 1Q12A 4DV5L 4K0KL 4JI6L 2JA8H 1BVSA 2Q2HA 2K5VA 1U9RA 2N8NA 4XT3B 5JPMC 4PNYA 1CSQA 2AQ3B 4GS3A 2FINB 1KLUD 1XYIA 1SYGA 4P73A 4RGOS 3I4LA 3F1ZA 1YI2A 2KQ3A 4C3IB 2HCCA 1FNWA 3TZDA 2EYJA 3T1HL 3Q0AA 3CPFA 4ILWA 2I07B 2I0QA 4DUYQ 1A3VA 2BH2A 3RN5A 4V190 1XNQQ 1DZ1A 1A63A 3K7UC 4IUPA 5EJWA 2JEAI 1UEAB 1Y1VH 3T1YL 5ELEA 4IFDG 3DWPA 1HR0W 3GV3A 1C9OA 1EOTA 2IX0A 2XGTA 2C9OA 4JC0A 4UY8C 4QMGA 2BA1A 5HURA 1VQ5A 3CCVA 1PFBA 1CI3M 1VQLA 3QB3A 5KIXA 2M9VA 2Y0SB 4LF8L 3U50C 2R7FA 4C2MH 2VZAA 2UU9L 1V8QA 1B7YB 1HNXQ 3J7ZC 4JV5L 2QF7A 1ONLA 3KJOA 5LL6X 4JI0L 1KNAA 4CKEA 1L2FA 3ERSX 3S1QB 2K05A 4OWXB 2WKDA 3IAYA 4CGYB 1ET9A 1WTOA 1JORA 4DR4L 2DJFC 1SN8A 3RLNA 2A69C 1EYDA 1PXUA 2K5HA 3PF5A 1L1OA 2VS1A 1RODA 5IODA 4A3FH 2F1MA 1SYDA 4DV4L 1N34Q 2RCFA 3OSOA 1PFSA 2PYKA 1YNND 4OIJA 1I6HB 1TY2A 4OX9L 1A2UA 1I5FA 5EGTA 5HGTA 4TKOB 1HR0L 1K83B 5E1FA 1AP0A 3PUZA 2R7ZB 1B3QA 3H15A 4DV6L 4B08A 1CHQD 5JJZA 5IYCG 3ICEA 3CAMA 1YJNA 1L1OB 3T56B 3PO2B 5G3LF 3QR8A 1FGBD 2NZ1D 4BBSB 1G291 5GAEC 2NYZD 3BZCA 3K57A 2IW3A 4QQBX 4RCOA 1AH9A 3K7AH 3PGZA 5FKAC 1EY7A 2UUAQ 2F0LA 4R4CA 3T16A 5F2DA 4ZK9B 1PHJA 2F4VL 3H09A 1TWAH 2E8GA 5IE8A 1CHPD 2K4KA 3M4YA 2AHOB 1D5MC 1L0WA 1NCVA 4ZLTF 3K5LA 3CC2A 1M1KC 1PDQA 3E9IA 4P71A 4J15A 2Y0SG 4O2DA 3CF5A 1I3QH 4XYQA 4H44C 3CCSA 2A19A 4LFBQ 1BR9A 2NZHA 1YHAA 4A3IH 2EXZA 1CUKA 4B3TQ 1I4GA 2MFIA 5C0XH 1PTOH 4ME3A 4KKSA 2VL6A 1BBWA 4B9XA 2B2UC 2F0MA 1CKMA 3HG9A 1GO3E 3A8JE 4A93B 2L12A 1BUVT 5C4XG 4KY6A 1PRTC 1TWFB 2DY7A 1TQOA 2NZOA 1VQFA 1DJRD 1QZHA 1RKNA 2F0PA 2RQXA 2A68C 5EKLA 1PFNA 2Q8TA 4CHTB 3FKIG 2KBNA 1VQIA 3DM1A 4H02A 4RHSA 4RKLA 4DAMA 4KY7A 5C4JH 2CW0D 2TMPA 2V1CC 3MZ5A 4N9TA 2MO0A 3L0OA 5J22A 2R7ZG 5JOBA 1Y14B 3GTKB 1RDPD 3UI2A 2E2JH 4B3ML 2N78A 3S24A 3UDFA 4YWMA 2ZM6Q 3AQQA 5EQ0A 3CC7A 2K5DA 1A0IA 2XSCA 3SK5A 4PZ8A 5LMNQ 4JI4L 2QEJC 3K6OA 1PH3A 4QL5A 5C3EH 5IT9E 4HMIA 1HNWL 2UUCQ 4OO1I 3EFXD 2Q2IA 1TWHH 4EGVA 4A3GH 2YTXA 2L9HA 3JC66 2UUBL 1FJGQ 4K5XA 4AYBE 1PTOF 1UWVA 1F2LA 4R8NA 1WTRA 3C46A 2YTYA 1ZKOA 3I90A 4RGTA 4DU9A 3VA5A 3U9OA 2KHJA 1DOLA 1H95A 1D1IA 4TSSA 1BXTA 1SJHD 2ASBA 4GN4B 4ZUIA 3GTQB 4EQNA 3S14H 4L5RC 1WD0A 1MD2D 2OQKA 3ITPA 1NJIC 1ENFA 3V96A 1NE3A 2K03A 2NTTA 4K6DA 1F9RA 3S16H 5M3MG 2B63G 1HA6A 5M5WH 3TSSA 4BBRB 3N6RA 4X3TA 2A6ED 4DR6Q 2HQLA 1NR2A 3LGJA 3ULPA 3I8ZA 3GTLB 1XTCD 1VQEA 4HR7B 2NN6G 2DJGC 3Q6SA 4JI3Q 1JWUD 3MA2B 3NEMA 1LT4D 2EDGA 2FHTA 2HHHQ 1L0XB 1SLJA 4IUUA 4S3SA 2BCOA 4KK7A 2JA5B 3GTPH 2PW5A 1QVGA 4HTHA 1HZAA 1Z6HA 2L15A 5EBDA 2D9UA 5CBEE 1XNRQ 5KNDA 1RIPA 3F8TA 2N49A 3SHLA 1TT2A 2A8VA 2J0TD 2B2WC 1X3FA 1F2YA 1AEXA 3QOLA 3VDYA 2EY2A 2R61A 3M7GA 2PPBC 1G6PA 3MXNB 4NMZA 1HCZA 2X6LA 2PNHA 3PUWA 3M4OH 1W3SA 5CORA 1PH2A 2E5LQ 1E1TA 2EYLA 3MEHA 5IP9G 5EKIA 4C3HG 1U0LA 2L1BA 4AQYQ 1NR4A 4FF2A 1H9JA 1STNA 1PYSB 4OL7A 4RHRA 4XTCS 1B9NA 5D65A 2L5TA 2JA7G 1GUOA 1FVIA 3BJUA 4IFDH 4QUFA 1WYDA 2UXCQ 4DUYL 4G7HC 3R2IA 3RN2A 4LW1A 1A3TA 3K59A 1HQMC 1KLGD 2HD3A 4OONA 4ULLA 2QW7A 2NVTH 4Q0FA 2ZTCA 1B44D 3QOJA 1GOZA 5C4ZA 3I4MB 1A2TA 4KI0A 3STBD 1YNNC 3DWAA 5FO9B 1EFWA 3HOUH 5H1SE 3DM3A 3JAMi 2K5WA 4U68A 5ELBA 1X3QA 4Q5VA 3C1EA 1HNXL 2Z4HA 2NVYB 3BZKA 2EXDA 1EEID 2F0WA 1AE3A 2BH8A 1LTGD 3J7A5 1TKWB 1CM9A 2F3IA 3S1NB 4ZUJA 1F2ZA 1JOKA 4DN4M 1ILPA 5IP7G 1SNCA 3J81i 2JEBI 2RKSA 4YCWA 3HOWB 1JE4A 3RMHA 4A3FG 1KIXA 4HIDA 2IT1A 1C48A 4JOIA 4LMQD 5E4XA 5C3WA 2KA7A 3W3AA 3I2ZA 2ZT9C 4PMCA 3Q24A 1ZEQX 1N34L 4PZ7A 3D6CA 4FDBA 1Y8OB 3VR5A 1DD2A 3W1BA 1EYAA 2NWGA 2B2TA 1OXSC 2XRQD 4PQXA 3E6ZX 4C3IH 4DR7Q 2L0CA 1FL0A 4JOIC 2RSOA 4R4OA 1SXTA 2HDMA 2I5MX 3C1FA 1E2WA 1JR0D 1SNOA 1NUCA 3EA6A 4C3JB 5JEAG 2B2TC 2RDHA 3CC4A 3ND9A 1F9QA 3HOXB 1HPCA 1V1QA 2ZXRA 4V0BA 4XQJA 2EVBA 4FF4A 5D3DA 1C8CA 5KEEA 1LO5D 3VYUA 1B8AA 4A3BB 2PZWA 2UUAL 3BDOA 1AE2A 3ER0A 2Q8IB 1DOMA 3TEHB 3M7NA 3MXUA 5ELOA 4GKKQ 5A2QL 4XQNA 1KL9A 5TSSA 4APVA 1I4RA 2CW0C 1SYEA 4H7BA 5GQOA 3EBEA 2WKCA 4DR2Q 3T51B 2M2LA 2PNRC 5J1ZA 5IOCA 5CGKA 4LFBL 2ICEC 4OHJA 5C0XG 4TVAB 3S1QH 3H3VH 4B3TL 1PZKD 4K8JA 2M00A 3BDLA 2AUKA 2PI2A 1BBUA 2RBMA 5LMUQ 1GXDC 1S72A 1LTTD 3BVGA 3UDXA 1LM0A 3RZOB 3S2HH 5I6YA 4JI5Q 2R3ZA 2VXWA 4DK0A 1UE1A 2CQOA 3FEWX 4L5QA 3FKIH 1IHZA 1Y8NB 3HKZB 3VA7A 1D6EC 3GTJB 1IZ6A 3JAMc 1I6HH 1STEA 2JE6I 3H6MA 2JXMB 4B3SQ 1N9WA 1K83H 3H94A 2R7ZH 2JA9A 1VQOA 1HFNA 3M9BA 4R4TA 1LTSD 1HTLD 3D4WA 3T4AC 2IJ0A 4L5TA 5FO7B 4Y7NB 2VW9A 4QB4A 2YV5A 4RGNA 2VQEQ 5FLXc 2LY7A 1IBKQ 2MGSA 4BBSH 2IHEA 3S15H 1IYUA 1X54A 4AYBB 2YU9B 3AFPA 2ZM6L 2QA4A 2KCMA 3I73A 1I94Q 2GVAA 2F4IA 5LMNL 4C3JG 3MXGA 2IX1A 2E76C 3HOXG 1EWHA 4LFCQ 4A3GG 2A6EC 2R92B 1S5FD 5DAUA 2UUCL 2ZJQA 5EPJA 1IKLA 1O78A 1OTCA 3IFDA
chains in the Genus database with same CATH topology
4EX5A 2K5HA 1E7ZA 1FJGL 1SRUA 1YEZA 4X64Q 4DV7Q 1UEBA 3PF5A 1L1OA 4JI7Q 2CWPA 4IJHA 1LUZA 1KAWA 4A3CH 3IRBA 2VS1A 4A3LG 2JQOA 4IPDA 4KLKA 4A3FH 3CPWA 4DV4L 4IOCA 1N34Q 2NVXH 3AYHB 4JI1Q 4JI8Q 2ZJRA 4HJ7A 4JYAQ 1MKHA 1MIUA 1LYLA 1E3PA 1PFSA 4DUZL 1PA6A 4JBMA 4KHPQ 4IO9A 2GN5A 1KD1C 4UP8A 5AJ3Q 1IBLQ 2XTIA 4NPSA 5C0XJ 1PH5A 2A1AA 2D62A 3TQYA 4OX9L 1VQGA 1I5FA 4LFAQ 5M3MH 2CWAA 1HR0L 4A3KH 3PIPA 2B63H 4JBWA 3PUZA 3H15A 1VQMA 2PMZE 4DV6L 4OWWB 2OTJA 4Y52H 5IWAQ 3E9HA 5IYCG 1XMOL 1PH1A 3ICEA 3CAMA 3KF8B 1YJNA 1L1OB 1E1OA 1N36L 2C35B 2JA6H 4HIOA 2R93G 3F2CA 4LF6L 2VUMH 1I50H 1G291 2EQSA 1HJPA 3Q8DA 2K14A 5GAEC 3BZCA 3U58A 4NXML 4DR6L 2MNAA 1K8GA 1GKHA 1E24A 4QQBX 1UE6A 3EN2A 3ULLA 4X65L 1AH9A 2OCEA 4IFDJ 3K7AH 4JI3L 4HJ8A 2UXBQ 3PGZA 4HJAA 3CCQA 2UUAQ 1X56A 5M3FH 4R4CA 2HHHL 1PHJA 1VQ9A 2F4VL 2H5XA 1J6QA 1TWAH 2E8GA 5IE8A 3I4MG 1MJCA 1KRSA 2K4KA 1E22A 2AHOB 4KHZA 3KOJA 1L0WA 2WB1G 2YTVA 1IBML 4DV5Q 3CC2A 1M1KC 4BA2I 4BY7H 4RG1A 1XNRL 3I55A 4O0AA 3E9IA 4P71A 3UDIA 5GADC 4DV1Q 4JI6Q 4J15A 3OTOL 4K0KQ 1D7QA 1JJGA 2Y0SG 5M5YH 4O2DA 1PH9A 3CF5A 1I3QH 1D8LA 2Z6KC 4GKJQ 3CCSA 3K81C 4DR1Q 2A19A 4LFBQ 2R92H 2R7DA 2NZHA 4AYBG 1YHAA 4A3IH 4DK3C 5IP9H 2ID0A 1CUKA 1SR3A 3M4QA 4DV0L 4C3HH 4B3TQ 2JA8G 3AEVA 2MFIA 5E7NA 3STBC 1VQ4A 2OWOA 4ME3A 1WCMH 1Q82C 5IYBG 4IJLA 2E5LL 1Q1EA 1BBWA 2VL6A 3GTGH 2Q2UA 2VY3A 4YWKA 1XPUA 1CKMA 1GO3E 1IL2A 1KC8C 1PH7A 3T1HQ 4AQYL 3CQZH 2UXDQ 2JA7H 3HOWG 5C4XG 1X3EA 2JK8A 4LF9L 4AIMA 2NN6I 4UPAA 2NZOA 1VQFA 1QZHA 4PG3A 3A74A 3J80c 1YHBA 1EIYB 1TXYA 3GTQH 3T1YQ 1W2BA 4QIWE 1R9TH 1YIJA 3G4SA 3FKIG 2KBNA 1VQIA 1EIFA 4H02A 5GROA 2UXCL 1CKOA 5JJKA 4DAMA 5C4JH 4DR5L 4AH6A 2V1CC 3PUYA 2HIXA 1Y1VG 1Q8KA 1Q1BA 4MZ9A 1NY4A 3UDGA 1OXXK 2MO0A 3L0OA 1A8VA 3PO2H 2B3GA 3CW2C 2R7ZG 3TREA 1Y14B 4LF8Q 3PF4A 3HOUG 2E2JH 4B3ML 3UE0A 4BBRH 3RLOA 1N8RC 2N78A 2UU9Q 3S24A 4LF4Q 4HJ9A 3UDFA 1XPRA 2AWNA 4YWMA 2ZM6Q 3AQQA 3CCUA 1N33L 4JV5Q 5JJLA 1K3RA 3CC7A 3GTLH 2EIFA 1MJEA 4NXNQ 1A0IA 3MEFA 4JI0Q 4YCUA 4PZ8A 5LMNQ 4JI4L 2DUDA 3U4VA 4DKAC 1PH3A 3PO3G 5ELNA 4QL5A 1HNZL 2AWOA 2WB1E 2ES2A 5C3EH 4IFDI 2AMCB 3G71A 1S3OA 1HNWL 2UUCQ 4OO1I 1O7IA 1LTLA 2GVBA 4A3BG 2Q2IA 1TWHH 2KCTA 4DR4Q 3HOYH 5IYDG 2Y0SE 4BA1I 2IY5B 4A3GH 1P8LA 2YTXA 3JC66 1TWCH 5IP7H 5FLMH 1Q86C 2UUBL 1FJGQ 4AYBE 4DR3L 1UWVA 3RR5A 4EQ5A 4UP9A 2YTYA 1HH2P 2WFWA 2CCZA 1XMQL 4B3RL 1VQDA 3M4PA 1J5EL 1EWIA 3HFZB 2ALYB 3I4NH 1Y1WH 2K75A 4DV4Q 2KHJA 1H95A 1PH6A 1GD7A 4A3LH 2ASBA 4DUZQ 4GN4B 3S17H 3S14H 4L5RC 4JI2L 3I4OA 2I5HA 2R6GA 4R4IA 4X66L 3B6YA 5M5XH 1PH4A 4OX9Q 2FXQA 2OQKA 2E2IH 4DAYB 1YJ9A 1NJIC 1HR0Q 4A93H 1VQBA 4BXXH 2ZTDA 2VQFL 2PQAB 3J81j 4DV6Q 1OXTA 1TWFH 2RF4A 1EYGA 3GD7A 5EAYA 5HY6A 1XMOQ 1NE3A 3S16H 5M3MG 5BR8L 4A3KG 1N36Q 2B63G 5M5WH 4DR7L 3CMAA 5IYCH 3L7ZC 4QJFA 4DV3L 3L2PA 5IY0A 4LF6Q 3I7FA 4NXMQ 4DR6Q 3HKZG 2HQLA 3ULPA 3LGJA 3H0GG 1ASYA 1QUQB 1VQEA 2Z6KA 5FJ8H 4X65Q 2NN6G 2MQHA 4JI3Q 4PMWA 4LF5L 1X65A 3D0FA 3A0JA 3NEMA 1WJJA 3RNUA 3PV0A 4NB3A 1ASZA 2HHHQ 1SLJA 4YY3L 5GAHC 4IPCA 2F4VQ 4R1JA 3GTKH 2WAQG 3GTPH 1VQJA 1QVGA 2E2HH 3KDFB 4DNIA 4LF7L 1HZAA 2L15A 5M3FG 3TS0A 1IBMQ 3I4MH 1XNRQ 4JBJA 1EUJA 4MNOA 1B70B 1RIPA 1N32L 3F8TA 2N49A 3K80C 3OTOQ 1YITA 1NBWA 1SFOH 2A8VA 2HT1A 1X3FA 3D31A 1VQNA 2LXKA 4GKKL 1S40A 4GOPC 2IHFA 4A76A 4BY7G 3HOZG 3VDYA 4DV0Q 5C44H 4HJ5A 1XTDA 3HOVH 1G6PA 3MXNB 4LUZA 4POGA 3M3YH 1JJCB 4A3MH 2AKWB 4GOPB 3CMEA 4DR2L 2PNHA 3FHWA 3PUWA 1W3SA 2I5LX 5LMNW 1PH2A 1JE5A 2E5LQ 2R92G 3S1NH 3M4OH 4A3IG 1E1TA 5IP9G 3A5UA 1NTGA 1KQSA 1U0LA 2B29A 1G51A 4A3EH 5IYBH 4AQYQ 1K0RA 1WCMG 4BY1H 4OO1G 3HKSA 1C0AA 1PYSB 4LF9Q 3S2DH 2K5NA 3S1MH 2K50A 4XTCS 3GO5A 2Z0SA 3K0XA 1VQ8A 2OQ0A 5LMUL 5C4XH 3CCEA 3HOWH 1QVCA 1SE8A 2ATWA 2JA7G 3I56A 4JI5L 2D0OA 3G6EA 1CKNB 1FVIA 3BJUA 1XJVA 4GN3B 3E0EA 1X3GA 1WYDA 4GLXA 2UXCQ 1XPOA 1PH8A 5K36G 2DGYA 2JJQA 4GN5A 4DR5Q 4DUYL 4DV2L 1Q81C 3RN2A 4A3DH 1WFQA 2D0PA 4LW1A 4UP7A 2ZJPA 3KFUA 4A75A 3HKZE 3PSIA 4OONA 1UE7A 3WWVA 4GNXC 2NVQH 4B3SL 2NVTH 4R4QA 4B3MQ 3PIOA 4WJ4A 2ZTCA 1EOVA 4JG2A 4POFA 3UE1A 3EIVA 1N33Q 1VQPA 3PO2G 4KI0A 4WJ3M 3STBD 3NELA 1EFWA 3HOUH 1RL2A 4BBSG 1OXUA 1U5KA 4X62L 1VCIA 2PI2E 2WAQE 5H1SE 1Q7YC 3DM3A 4JI4Q 3JAMi 4JBKA 1DGSA 3KF6A 4OXPA 2VQEL 5JJIA 5J3BA 5C0XI 1IBKL 4C3JH 3PUVA 1IXRA 4QY7A 4A3JH 1HNZQ 2JA5H 4JCVE 1HNXL 3HOXH 1M90C 2PQAA 1HNWQ 3DLLA 1VQCA 3BZKA 2EXDA 3FP9A 4P74A 4YHHL 3PO3H 1AE3A 3TS2A 2BH8A 1I94L 3J81c 4A4IA 1GVPA 3J7A5 4TQUS 2F3IA 1GM5A 2UUBQ 4IOAA 2KENA 5C3EG 4A3BH 4DR3Q 1WOCA 4LFCL 4MTNA 1XMQQ 4B3RQ 3HOYG 1J5EQ 1KXLA 1P16A 3KYHC 1VS0A 1YVCA 5IP7G 3J81i 1PVOA 4A3CG 1QUQA 1YBYA 5HGQA 4QGUA 3GTOH 4YCVA 2JEBI 3CXCA 1YJWA 4YCWA 4ALPA 4A3FG 4X64L 4DV7L 1EQQA 3KF6B 3KJPA 4HIDA 2IT1A 1QZGA 1KIXA 1WI5A 4JOIA 2N3SA 1Y1WG 1X55A 4JI2Q 3I4NG 3TRZA 3I2ZA 4X66Q 5GAGC 1PV4A 4GLAC 3ZJYC 3K8AA 4IPHA 1UE5A 4LUVA 1N34L 4PZ7A 1JJ2A 4FDBA 4JI1L 4JI8L 1OXVA 2VQFQ 4JYAL 4XIGS 3KDFA 3S1RH 1VQKA 1SROA 3W1BA 4KHPL 3KLWA 1VQHA 2VNUD 1IBLL 5AJ3L 1YNXA 3G48A 3W1GA 1OXSC 3CCMA 1NMFA 4DPGA 4A93G 5BR8Q 4C3IH 4DR7Q 2RHSB 4BXXG 4LFAL 2KHIA 4DV3Q 2CKZB 1FL0A 3RZOH 4JOIC 4LUOA 5DLQE 4R4OA 2R93H 1L1OC 3ULJA 5IWAL 4OWTB 2JA6G 2I5MX 3CCRA 1T9HA 2VUMG 1KRTA 4LF5Q 4GOPA 4HIMA 3GTMH 1KHIA 3H0GH 3GDEA 5JEAG 2YYZA 3CC4A 3GTJH 1CSPA 4YY3Q 1YZ6A 1X9NA 1K73C 5FJ8G 1FGUA 1V1QA 3OYYA 1VQAA 4LF7Q 3W5OA 4P72A 1K9MC 2UXBL 4IPGA 1B8AA 4X6AH 1VQ7A 2UUAL 1N32Q 1PYBA 2OTLA 2CFMA 1YHQA 1AE2A 2QGQA 3ER0A 2ZTEA 1A62A 4Y7NH 3M85A 3TEHB 3NENA 3M7NA 1X6OA 4GLVB 5ELOA 1CKNA 2QEXA 1EQRA 4GKKQ 1KL9A 2HIVA 4APVA 2NVYH 1Q12A 4HIKA 4DV5L 2YU9H 4DV1L 4K0KL 5GQOA 4JI6L 1JMCA 3EBEA 2JA8H 1BKBA 3HOZH 1BVSA 2Q2HA 1SMXA 2K5VA 1QVFA 4DR2Q 2N8NA 4GKJL 3CP0A 1CSQA 4DR1L 4LFBL 2MO1A 4GS3A 5C0XG 4TVAB 5C44G 3HOVG 3S1QH 3H3VH 2K52A 1V43A 3AFQA 4B3TL 4A3MG 4P73A 3CCJA 1JT8A 2PI2A 3F1ZA 1BBUA 4GNXA 1YI2A 1VQ6A 3CD6A 5LMUQ 1S72A 4A3EG 4PZ6A 1LM0A 3UDXA 3S2HH 4BY1G 4JI5Q 3T1HL 2UXDL 3CPFA 1HZBA 1Z9FA 1UE1A 2CQOA 4L5QA 1NMGA 3FKIH 4LNQA 2RHQB 1XNQL 2I0QA 4DUYQ 4DV2Q 5IT9c 3RLFA 2BH2A 4P75A 3RN5A 2Q2TA 1XNQQ 1A63A 3K7UC 1K8AC 2JEAI 3CCLA 4RMFA 1Y1VH 3T1YL 4IFDG 1IZ6A 4YWLA 2LSSA 3JAMc 1I6HH 1C7YA 2JE6I 1HR0W 1C9OA 3NBHB 3U4ZA 1HZCA 2IX0A 3F2DA 1N9WA 2XGTA 4JC0A 4B3SQ 2LXJA 4UY8C 1K83H 4A3DG 2F52A 2R7ZH 2JA9A 1VQOA 3SGIA 3OW2A 3M9BA 4GNXB 2BA1A 3PUXA 3BU2A 4R4TA 1HZ9A 3J80i 1VQ5A 3CCVA 4L5TA 4BBRG 1Z47A 1VQLA 4JI7L 4X62Q 3RZDH 2VW9A 3A5ZB 2YV5A 2WP8J 3U50C 2VQEQ 2R7FA 4C2MH 5FLXc 4LF8L 2VZAA 1IBKQ 4LF4L 4BBSH 2IHEA 2UU9L 3S15H 1B7YB 1X54A 1HNXQ 2RCNA 3AFPA 3J7ZC 2ZM6L 4JV5L 2QA4A 3KJOA 2KCMA 4DK6C 4YHHQ 3PCOB 4NXNL 1I94Q 2GVAA 5JEAJ 4JI0L 5LMNL 5IYDH 1IYJB 1L2FA 1Q46A 1TWGH 2BA0A 4A3JG 3H3VI 4L5SA 1JB7A 2JA5G 2IX1A 3HOXG 3ERSX 4LFCQ 4A3GG 3F2BA 4OWXB 5FLMG 2UUCL 2ZJQA 4DR4L 1SN8A 3RLNA 1V9PA 1OTCA 4LWCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EX5 A;  2K5H A;  1E7Z A;  1FJG L;  1SRU A;  1YEZ A;  4X64 Q;  4DV7 Q;  1UEB A;  3PF5 A;  1L1O A;  4JI7 Q;  2CWP A;  4IJH A;  1LUZ A;  1KAW A;  4A3C H;  3IRB A;  2VS1 A;  4A3L G;  2JQO A;  4IPD A;  4KLK A;  4A3F H;  3CPW A;  4DV4 L;  4IOC A;  1N34 Q;  2NVX H;  3AYH B;  4JI1 Q;  4JI8 Q;  2ZJR A;  4HJ7 A;  4JYA Q;  1MKH A;  1MIU A;  1LYL A;  1E3P A;  1PFS A;  4DUZ L;  1PA6 A;  4JBM A;  4KHP Q;  4IO9 A;  2GN5 A;  1KD1 C;  4UP8 A;  5AJ3 Q;  1IBL Q;  2XTI A;  4NPS A;  5C0X J;  1PH5 A;  2A1A A;  2D62 A;  3TQY A;  4OX9 L;  1VQG A;  1I5F A;  4LFA Q;  5M3M H;  2CWA A;  1HR0 L;  4A3K H;  3PIP A;  2B63 H;  4JBW A;  3PUZ A;  3H15 A;  1VQM A;  2PMZ E;  4DV6 L;  4OWW B;  2OTJ A;  4Y52 H;  5IWA Q;  3E9H A;  5IYC G;  1XMO L;  1PH1 A;  3ICE A;  3CAM A;  3KF8 B;  1YJN A;  1L1O B;  1E1O A;  1N36 L;  2C35 B;  2JA6 H;  4HIO A;  2R93 G;  3F2C A;  4LF6 L;  2VUM H;  1I50 H;  1G29 1;  2EQS A;  1HJP A;  3Q8D A;  2K14 A;  5GAE C;  3BZC A;  3U58 A;  4NXM L;  4DR6 L;  2MNA A;  1K8G A;  1GKH A;  1E24 A;  4QQB X;  1UE6 A;  3EN2 A;  3ULL A;  4X65 L;  1AH9 A;  2OCE A;  4IFD J;  3K7A H;  4JI3 L;  4HJ8 A;  2UXB Q;  3PGZ A;  4HJA A;  3CCQ A;  2UUA Q;  1X56 A;  5M3F H;  4R4C A;  2HHH L;  1PHJ A;  1VQ9 A;  2F4V L;  2H5X A;  1J6Q A;  1TWA H;  2E8G A;  5IE8 A;  3I4M G;  1MJC A;  1KRS A;  2K4K A;  1E22 A;  2AHO B;  4KHZ A;  3KOJ A;  1L0W A;  2WB1 G;  2YTV A;  1IBM L;  4DV5 Q;  3CC2 A;  1M1K C;  4BA2 I;  4BY7 H;  4RG1 A;  1XNR L;  3I55 A;  4O0A A;  3E9I A;  4P71 A;  3UDI A;  5GAD C;  4DV1 Q;  4JI6 Q;  4J15 A;  3OTO L;  4K0K Q;  1D7Q A;  1JJG A;  2Y0S G;  5M5Y H;  4O2D A;  1PH9 A;  3CF5 A;  1I3Q H;  1D8L A;  2Z6K C;  4GKJ Q;  3CCS A;  3K81 C;  4DR1 Q;  2A19 A;  4LFB Q;  2R92 H;  2R7D A;  2NZH A;  4AYB G;  1YHA A;  4A3I H;  4DK3 C;  5IP9 H;  2ID0 A;  1CUK A;  1SR3 A;  3M4Q A;  4DV0 L;  4C3H H;  4B3T Q;  2JA8 G;  3AEV A;  2MFI A;  5E7N A;  3STB C;  1VQ4 A;  2OWO A;  4ME3 A;  1WCM H;  1Q82 C;  5IYB G;  4IJL A;  2E5L L;  1Q1E A;  1BBW A;  2VL6 A;  3GTG H;  2Q2U A;  2VY3 A;  4YWK A;  1XPU A;  1CKM A;  1GO3 E;  1IL2 A;  1KC8 C;  1PH7 A;  3T1H Q;  4AQY L;  3CQZ H;  2UXD Q;  2JA7 H;  3HOW G;  5C4X G;  1X3E A;  2JK8 A;  4LF9 L;  4AIM A;  2NN6 I;  4UPA A;  2NZO A;  1VQF A;  1QZH A;  4PG3 A;  3A74 A;  3J80 c;  1YHB A;  1EIY B;  1TXY A;  3GTQ H;  3T1Y Q;  1W2B A;  4QIW E;  1R9T H;  1YIJ A;  3G4S A;  3FKI G;  2KBN A;  1VQI A;  1EIF A;  4H02 A;  5GRO A;  2UXC L;  1CKO A;  5JJK A;  4DAM A;  5C4J H;  4DR5 L;  4AH6 A;  2V1C C;  3PUY A;  2HIX A;  1Y1V G;  1Q8K A;  1Q1B A;  4MZ9 A;  1NY4 A;  3UDG A;  1OXX K;  2MO0 A;  3L0O A;  1A8V A;  3PO2 H;  2B3G A;  3CW2 C;  2R7Z G;  3TRE A;  1Y14 B;  4LF8 Q;  3PF4 A;  3HOU G;  2E2J H;  4B3M L;  3UE0 A;  4BBR H;  3RLO A;  1N8R C;  2N78 A;  2UU9 Q;  3S24 A;  4LF4 Q;  4HJ9 A;  3UDF A;  1XPR A;  2AWN A;  4YWM A;  2ZM6 Q;  3AQQ A;  3CCU A;  1N33 L;  4JV5 Q;  5JJL A;  1K3R A;  3CC7 A;  3GTL H;  2EIF A;  1MJE A;  4NXN Q;  1A0I A;  3MEF A;  4JI0 Q;  4YCU A;  4PZ8 A;  5LMN Q;  4JI4 L;  2DUD A;  3U4V A;  4DKA C;  1PH3 A;  3PO3 G;  5ELN A;  4QL5 A;  1HNZ L;  2AWO A;  2WB1 E;  2ES2 A;  5C3E H;  4IFD I;  2AMC B;  3G71 A;  1S3O A;  1HNW L;  2UUC Q;  4OO1 I;  1O7I A;  1LTL A;  2GVB A;  4A3B G;  2Q2I A;  1TWH H;  2KCT A;  4DR4 Q;  3HOY H;  5IYD G;  2Y0S E;  4BA1 I;  2IY5 B;  4A3G H;  1P8L A;  2YTX A;  3JC6 6;  1TWC H;  5IP7 H;  5FLM H;  1Q86 C;  2UUB L;  1FJG Q;  4AYB E;  4DR3 L;  1UWV A;  3RR5 A;  4EQ5 A;  4UP9 A;  2YTY A;  1HH2 P;  2WFW A;  2CCZ A;  1XMQ L;  4B3R L;  1VQD A;  3M4P A;  1J5E L;  1EWI A;  3HFZ B;  2ALY B;  3I4N H;  1Y1W H;  2K75 A;  4DV4 Q;  2KHJ A;  1H95 A;  1PH6 A;  1GD7 A;  4A3L H;  2ASB A;  4DUZ Q;  4GN4 B;  3S17 H;  3S14 H;  4L5R C;  4JI2 L;  3I4O A;  2I5H A;  2R6G A;  4R4I A;  4X66 L;  3B6Y A;  5M5X H;  1PH4 A;  4OX9 Q;  2FXQ A;  2OQK A;  2E2I H;  4DAY B;  1YJ9 A;  1NJI C;  1HR0 Q;  4A93 H;  1VQB A;  4BXX H;  2ZTD A;  2VQF L;  2PQA B;  3J81 j;  4DV6 Q;  1OXT A;  1TWF H;  2RF4 A;  1EYG A;  3GD7 A;  5EAY A;  5HY6 A;  1XMO Q;  1NE3 A;  3S16 H;  5M3M G;  5BR8 L;  4A3K G;  1N36 Q;  2B63 G;  5M5W H;  4DR7 L;  3CMA A;  5IYC H;  3L7Z C;  4QJF A;  4DV3 L;  3L2P A;  5IY0 A;  4LF6 Q;  3I7F A;  4NXM Q;  4DR6 Q;  3HKZ G;  2HQL A;  3ULP A;  3LGJ A;  3H0G G;  1ASY A;  1QUQ B;  1VQE A;  2Z6K A;  5FJ8 H;  4X65 Q;  2NN6 G;  2MQH A;  4JI3 Q;  4PMW A;  4LF5 L;  1X65 A;  3D0F A;  3A0J A;  3NEM A;  1WJJ A;  3RNU A;  3PV0 A;  4NB3 A;  1ASZ A;  2HHH Q;  1SLJ A;  4YY3 L;  5GAH C;  4IPC A;  2F4V Q;  4R1J A;  3GTK H;  2WAQ G;  3GTP H;  1VQJ A;  1QVG A;  2E2H H;  3KDF B;  4DNI A;  4LF7 L;  1HZA A;  2L15 A;  5M3F G;  3TS0 A;  1IBM Q;  3I4M H;  1XNR Q;  4JBJ A;  1EUJ A;  4MNO A;  1B70 B;  1RIP A;  1N32 L;  3F8T A;  2N49 A;  3K80 C;  3OTO Q;  1YIT A;  1NBW A;  1SFO H;  2A8V A;  2HT1 A;  1X3F A;  3D31 A;  1VQN A;  2LXK A;  4GKK L;  1S40 A;  4GOP C;  2IHF A;  4A76 A;  4BY7 G;  3HOZ G;  3VDY A;  4DV0 Q;  5C44 H;  4HJ5 A;  1XTD A;  3HOV H;  1G6P A;  3MXN B;  4LUZ A;  4POG A;  3M3Y H;  1JJC B;  4A3M H;  2AKW B;  4GOP B;  3CME A;  4DR2 L;  2PNH A;  3FHW A;  3PUW A;  1W3S A;  2I5L X;  5LMN W;  1PH2 A;  1JE5 A;  2E5L Q;  2R92 G;  3S1N H;  3M4O H;  4A3I G;  1E1T A;  5IP9 G;  3A5U A;  1NTG A;  1KQS A;  1U0L A;  2B29 A;  1G51 A;  4A3E H;  5IYB H;  4AQY Q;  1K0R A;  1WCM G;  4BY1 H;  4OO1 G;  3HKS A;  1C0A A;  1PYS B;  4LF9 Q;  3S2D H;  2K5N A;  3S1M H;  2K50 A;  4XTC S;  3GO5 A;  2Z0S A;  3K0X A;  1VQ8 A;  2OQ0 A;  5LMU L;  5C4X H;  3CCE A;  3HOW H;  1QVC A;  1SE8 A;  2ATW A;  2JA7 G;  3I56 A;  4JI5 L;  2D0O A;  3G6E A;  1CKN B;  1FVI A;  3BJU A;  1XJV A;  4GN3 B;  3E0E A;  1X3G A;  1WYD A;  4GLX A;  2UXC Q;  1XPO A;  1PH8 A;  5K36 G;  2DGY A;  2JJQ A;  4GN5 A;  4DR5 Q;  4DUY L;  4DV2 L;  1Q81 C;  3RN2 A;  4A3D H;  1WFQ A;  2D0P A;  4LW1 A;  4UP7 A;  2ZJP A;  3KFU A;  4A75 A;  3HKZ E;  3PSI A;  4OON A;  1UE7 A;  3WWV A;  4GNX C;  2NVQ H;  4B3S L;  2NVT H;  4R4Q A;  4B3M Q;  3PIO A;  4WJ4 A;  2ZTC A;  1EOV A;  4JG2 A;  4POF A;  3UE1 A;  3EIV A;  1N33 Q;  1VQP A;  3PO2 G;  4KI0 A;  4WJ3 M;  3STB D;  3NEL A;  1EFW A;  3HOU H;  1RL2 A;  4BBS G;  1OXU A;  1U5K A;  4X62 L;  1VCI A;  2PI2 E;  2WAQ E;  5H1S E;  1Q7Y C;  3DM3 A;  4JI4 Q;  3JAM i;  4JBK A;  1DGS A;  3KF6 A;  4OXP A;  2VQE L;  5JJI A;  5J3B A;  5C0X I;  1IBK L;  4C3J H;  3PUV A;  1IXR A;  4QY7 A;  4A3J H;  1HNZ Q;  2JA5 H;  4JCV E;  1HNX L;  3HOX H;  1M90 C;  2PQA A;  1HNW Q;  3DLL A;  1VQC A;  3BZK A;  2EXD A;  3FP9 A;  4P74 A;  4YHH L;  3PO3 H;  1AE3 A;  3TS2 A;  2BH8 A;  1I94 L;  3J81 c;  4A4I A;  1GVP A;  3J7A 5;  4TQU S;  2F3I A;  1GM5 A;  2UUB Q;  4IOA A;  2KEN A;  5C3E G;  4A3B H;  4DR3 Q;  1WOC A;  4LFC L;  4MTN A;  1XMQ Q;  4B3R Q;  3HOY G;  1J5E Q;  1KXL A;  1P16 A;  3KYH C;  1VS0 A;  1YVC A;  5IP7 G;  3J81 i;  1PVO A;  4A3C G;  1QUQ A;  1YBY A;  5HGQ A;  4QGU A;  3GTO H;  4YCV A;  2JEB I;  3CXC A;  1YJW A;  4YCW A;  4ALP A;  4A3F G;  4X64 L;  4DV7 L;  1EQQ A;  3KF6 B;  3KJP A;  4HID A;  2IT1 A;  1QZG A;  1KIX A;  1WI5 A;  4JOI A;  2N3S A;  1Y1W G;  1X55 A;  4JI2 Q;  3I4N G;  3TRZ A;  3I2Z A;  4X66 Q;  5GAG C;  1PV4 A;  4GLA C;  3ZJY C;  3K8A A;  4IPH A;  1UE5 A;  4LUV A;  1N34 L;  4PZ7 A;  1JJ2 A;  4FDB A;  4JI1 L;  4JI8 L;  1OXV A;  2VQF Q;  4JYA L;  4XIG S;  3KDF A;  3S1R H;  1VQK A;  1SRO A;  3W1B A;  4KHP L;  3KLW A;  1VQH A;  2VNU D;  1IBL L;  5AJ3 L;  1YNX A;  3G48 A;  3W1G A;  1OXS C;  3CCM A;  1NMF A;  4DPG A;  4A93 G;  5BR8 Q;  4C3I H;  4DR7 Q;  2RHS B;  4BXX G;  4LFA L;  2KHI A;  4DV3 Q;  2CKZ B;  1FL0 A;  3RZO H;  4JOI C;  4LUO A;  5DLQ E;  4R4O A;  2R93 H;  1L1O C;  3ULJ A;  5IWA L;  4OWT B;  2JA6 G;  2I5M X;  3CCR A;  1T9H A;  2VUM G;  1KRT A;  4LF5 Q;  4GOP A;  4HIM A;  3GTM H;  1KHI A;  3H0G H;  3GDE A;  5JEA G;  2YYZ A;  3CC4 A;  3GTJ H;  1CSP A;  4YY3 Q;  1YZ6 A;  1X9N A;  1K73 C;  5FJ8 G;  1FGU A;  1V1Q A;  3OYY A;  1VQA A;  4LF7 Q;  3W5O A;  4P72 A;  1K9M C;  2UXB L;  4IPG A;  1B8A A;  4X6A H;  1VQ7 A;  2UUA L;  1N32 Q;  1PYB A;  2OTL A;  2CFM A;  1YHQ A;  1AE2 A;  2QGQ A;  3ER0 A;  2ZTE A;  1A62 A;  4Y7N H;  3M85 A;  3TEH B;  3NEN A;  3M7N A;  1X6O A;  4GLV B;  5ELO A;  1CKN A;  2QEX A;  1EQR A;  4GKK Q;  1KL9 A;  2HIV A;  4APV A;  2NVY H;  1Q12 A;  4HIK A;  4DV5 L;  2YU9 H;  4DV1 L;  4K0K L;  5GQO A;  4JI6 L;  1JMC A;  3EBE A;  2JA8 H;  1BKB A;  3HOZ H;  1BVS A;  2Q2H A;  1SMX A;  2K5V A;  1QVF A;  4DR2 Q;  2N8N A;  4GKJ L;  3CP0 A;  1CSQ A;  4DR1 L;  4LFB L;  2MO1 A;  4GS3 A;  5C0X G;  4TVA B;  5C44 G;  3HOV G;  3S1Q H;  3H3V H;  2K52 A;  1V43 A;  3AFQ A;  4B3T L;  4A3M G;  4P73 A;  3CCJ A;  1JT8 A;  2PI2 A;  3F1Z A;  1BBU A;  4GNX A;  1YI2 A;  1VQ6 A;  3CD6 A;  5LMU Q;  1S72 A;  4A3E G;  4PZ6 A;  1LM0 A;  3UDX A;  3S2H H;  4BY1 G;  4JI5 Q;  3T1H L;  2UXD L;  3CPF A;  1HZB A;  1Z9F A;  1UE1 A;  2CQO A;  4L5Q A;  1NMG A;  3FKI H;  4LNQ A;  2RHQ B;  1XNQ L;  2I0Q A;  4DUY Q;  4DV2 Q;  5IT9 c;  3RLF A;  2BH2 A;  4P75 A;  3RN5 A;  2Q2T A;  1XNQ Q;  1A63 A;  3K7U C;  1K8A C;  2JEA I;  3CCL A;  4RMF A;  1Y1V H;  3T1Y L;  4IFD G;  1IZ6 A;  4YWL A;  2LSS A;  3JAM c;  1I6H H;  1C7Y A;  2JE6 I;  1HR0 W;  1C9O A;  3NBH B;  3U4Z A;  1HZC A;  2IX0 A;  3F2D A;  1N9W A;  2XGT A;  4JC0 A;  4B3S Q;  2LXJ A;  4UY8 C;  1K83 H;  4A3D G;  2F52 A;  2R7Z H;  2JA9 A;  1VQO A;  3SGI A;  3OW2 A;  3M9B A;  4GNX B;  2BA1 A;  3PUX A;  3BU2 A;  4R4T A;  1HZ9 A;  3J80 i;  1VQ5 A;  3CCV A;  4L5T A;  4BBR G;  1Z47 A;  1VQL A;  4JI7 L;  4X62 Q;  3RZD H;  2VW9 A;  3A5Z B;  2YV5 A;  2WP8 J;  3U50 C;  2VQE Q;  2R7F A;  4C2M H;  5FLX c;  4LF8 L;  2VZA A;  1IBK Q;  4LF4 L;  4BBS H;  2IHE A;  2UU9 L;  3S15 H;  1B7Y B;  1X54 A;  1HNX Q;  2RCN A;  3AFP A;  3J7Z C;  2ZM6 L;  4JV5 L;  2QA4 A;  3KJO A;  2KCM A;  4DK6 C;  4YHH Q;  3PCO B;  4NXN L;  1I94 Q;  2GVA A;  5JEA J;  4JI0 L;  5LMN L;  5IYD H;  1IYJ B;  1L2F A;  1Q46 A;  1TWG H;  2BA0 A;  4A3J G;  3H3V I;  4L5S A;  1JB7 A;  2JA5 G;  2IX1 A;  3HOX G;  3ERS X;  4LFC Q;  4A3G G;  3F2B A;  4OWX B;  5FLM G;  2UUC L;  2ZJQ A;  4DR4 L;  1SN8 A;  3RLN A;  1V9P A;  1OTC A;  4LWC A; 
#chains in the Genus database with same CATH topology
 3F2U A;  1FJG L;  2L55 A;  1YEZ A;  1D5X C;  4JI7 Q;  4K14 A;  4IJH A;  1LUZ A;  1Y8P B;  4IQZ A;  3NK9 A;  1CQV A;  2KJX A;  3CQZ B;  4IOC A;  3AYH B;  1TU2 B;  3OWE B;  4IUV A;  4JI1 Q;  4JI8 Q;  2ZJR A;  1KDA A;  1HTP A;  3BS1 A;  1IYV A;  1E3P A;  4KY5 A;  1EQT A;  1KD1 C;  1EEF D;  3JAM L;  1PH5 A;  3TQY A;  1VQG A;  4LFA Q;  5M3M H;  2B63 H;  3D4D A;  3J81 E;  4OWW B;  5IWA Q;  3E9H A;  2V4D A;  1SNM A;  5ELF A;  3RZD B;  3K5M A;  2C35 B;  2NN6 H;  5CV6 A;  5FLX L;  5CC4 A;  5I6W A;  3F2C A;  3Q8D A;  5EKK A;  4DR6 L;  1K8G A;  2CH4 A;  1E24 A;  1B3A A;  1UE6 A;  1STY A;  1K8M A;  4ZYS A;  4JI3 L;  2UXB Q;  4Z9C B;  3CCQ A;  1TS4 A;  1TVX A;  2HHH L;  1VQ9 A;  1J6Q A;  1KTK A;  1KRS A;  3GQB A;  1EU3 A;  2RDF A;  2YTV A;  1XNR L;  3BG3 A;  1BCP D;  4O0A A;  1JJG A;  1PH9 A;  1IW7 D;  2Z6K C;  3K81 C;  2NVX B;  4AYB G;  3G7L A;  4DK3 C;  5IP9 H;  3M4Q A;  4C3H H;  3SDZ A;  3STB C;  1VQ4 A;  3VYR A;  1Q82 C;  1GUW A;  2E5L L;  4YWK A;  1XPU A;  4A3K B;  1I4H A;  2K6A A;  1PH7 A;  2F0S A;  4AQY L;  2UXD Q;  2JA7 H;  3RD4 A;  2XVS A;  1D2B A;  1KDC A;  4PG3 A;  3A74 A;  4IN3 A;  2JA6 B;  4ID6 A;  1TXY A;  3GTQ H;  1W2B A;  1B53 A;  4N8X 1;  4QIW E;  4RFB A;  1GHJ A;  5GRO A;  2UXC L;  1PRT F;  5IGD A;  2B2V C;  4OGQ C;  4L8J A;  4AH6 A;  4F8M A;  2HIX A;  3MXP A;  1CT1 D;  1UUP A;  3URY A;  1B4O A;  1VMP A;  5M3F B;  1B9M A;  1NY4 A;  1NAP A;  2WIN B;  3IFT A;  4LAA A;  3KUP A;  4X3K A;  1EY4 A;  1I4Q A;  2G5D A;  3TRE A;  2A74 C;  3PF4 A;  2CHB D;  3HOU G;  4BBR H;  1LLR D;  3RLO A;  3CCU A;  5JJL A;  1K3R A;  4E6I A;  3GTL H;  2WII B;  1GUG A;  1B50 A;  3GV6 A;  3NP8 A;  3QO2 A;  3D6W A;  3TME A;  3I70 A;  1U4M A;  1S3O A;  1O7I A;  1LTL A;  3OWF A;  2KCT A;  4ABN A;  4JK1 C;  3EQL C;  5C44 B;  2IY5 B;  2JSO A;  1WCM B;  4RKB A;  2XWJ B;  5IP7 H;  1Q86 C;  3O13 A;  1JB3 A;  2OT2 A;  2WFW A;  1HA5 A;  4F7X A;  3M4P A;  1EWI A;  5IGC A;  1EFI D;  1SNP A;  2F0H A;  2K75 A;  2F0U A;  1EIH A;  4BY1 B;  5E3F A;  4K6L A;  3AU7 A;  3IKJ A;  1PH6 A;  4A3L H;  3WOF A;  1TS2 A;  1EIG A;  4WJW A;  5C5M A;  1R4Q B;  3SE0 A;  1DYQ A;  3K5N A;  4HED A;  1GHK A;  2I5H A;  1Q3L A;  3WDN A;  1I4X A;  2FXQ A;  4CBV A;  2JP1 A;  4DAY B;  1YJ9 A;  2XRS D;  1OXT A;  4OEM B;  4C3I G;  2NTS A;  4A3D B;  5EAY A;  1XMO Q;  4LJZ C;  4A3K G;  4MN3 A;  5CV4 A;  3CMA A;  4DR7 L;  3I91 A;  4QJF A;  3L2P A;  4LF6 Q;  2QDB A;  4NXM Q;  1SYC A;  5JEA H;  4ZQ3 A;  3CU7 A;  3MWY W;  1QUQ B;  4KJN A;  4PMW A;  3RNU A;  1EY9 A;  1EZ6 A;  2EPB A;  4IPC A;  3KBX A;  3HOY B;  1VQJ A;  3QJY A;  3KDF B;  4DNI A;  2B2U A;  5M3F G;  4FP5 D;  3I4M H;  1EUJ A;  4FNF A;  4L6T B;  2EY5 A;  4UDU C;  3U9S A;  3I4N B;  1Y1W B;  4GKK L;  4A76 A;  1VF7 A;  2O2L D;  3A54 A;  1LT3 D;  1XTD A;  5EPK A;  3S17 B;  4FYD A;  4LUZ A;  5E4W C;  5M5X B;  2BOS A;  2EYF A;  4DR2 L;  3S1N H;  2E2I B;  3A5U A;  1HRJ A;  1G51 A;  4MTK A;  4UHV A;  2FFK B;  1WCM G;  1U4P A;  3HKS A;  1F77 A;  1ICF B;  4G7O C;  3GO5 A;  1TY0 A;  5LMU L;  3HOW H;  1PRT B;  3BZD B;  3OOC A;  1A15 A;  2ATW A;  1E0B A;  4JI5 L;  3V2T A;  2K33 A;  3E0E A;  2R93 B;  1W6K A;  2K1B A;  4GLX A;  1MGS A;  4DR5 Q;  1Q81 C;  2CQA A;  1ZXT A;  3ZYY X;  3KFU A;  1PLF A;  4A75 A;  3HKZ E;  3WWV A;  4IAL A;  2PZT A;  4GNX C;  4B3S L;  2DY8 A;  2E2H B;  4POF A;  1N33 Q;  1VQP A;  3PO2 G;  1SYF A;  1SFO B;  4BBS G;  2F0I A;  2PI2 E;  2WB1 B;  2EOT A;  2VQE L;  5FOB B;  1IBK L;  4C3J H;  3PUV A;  1IXR A;  1HNZ Q;  1DOK A;  4KN4 C;  4JCV E;  3HOX H;  3H91 A;  3HOV B;  2H1E A;  1VQC A;  4P74 A;  3AMU A;  3M3Y B;  4A3M B;  1I94 L;  1QJO A;  4HMJ A;  4A3B H;  2EYO A;  3BYT B;  2K04 A;  4LFC L;  3EJI A;  3X3N A;  1J5E Q;  3HOY G;  1KXL A;  1VS0 A;  2MHV A;  3VR2 A;  3BVM A;  4RAU C;  1YJW A;  1ZYR D;  1ESF A;  1EQQ A;  4IFD I;  4DAV A;  4JI7 L;  2ZXO A;  1HHV A;  3G6J B;  3I4N G;  1Y1W G;  1X55 A;  4X66 Q;  1SBB B;  3VYS A;  1PV4 A;  1JJ2 A;  3ZJY C;  2Q8R E;  4JI1 L;  4JI8 L;  1LAB A;  2TSS A;  1FYC A;  1BCP C;  2VNU D;  3TP7 A;  3G48 A;  3CCM A;  1NMF A;  4A93 G;  5BR8 Q;  1STA A;  3CRL C;  2HDL A;  1IW7 C;  2RHS B;  4BXX G;  2WAC A;  4LFA L;  4CJ1 B;  4DV3 Q;  2DN8 A;  3RZO H;  4IUQ A;  1BCP B;  5IWA L;  4JPB W;  2B2W A;  1QG7 A;  1T9H A;  1KRT A;  3MXN A;  1LV9 A;  5C5L A;  4HIM A;  1KHI A;  4R8I A;  4A3J B;  2YYZ A;  3GTJ H;  1S5C D;  1K73 C;  5FJ8 G;  1FGU A;  3PO3 B;  4H13 C;  1VQA A;  2UXB L;  1PYB A;  3R93 A;  1WD1 A;  4Y7N H;  2ZTE A;  2C5C A;  4K5W A;  1X6O A;  4CDC C;  1STG A;  1EQR A;  4HIK A;  2YU9 H;  1K8O A;  3T53 B;  2NVQ B;  2KEC A;  1JMC A;  4KV6 A;  2O5I C;  2QIL A;  4K2K A;  2K28 A;  4XT1 B;  4IZ8 A;  3HOV G;  1LT5 D;  3NBH A;  1V1O A;  1V43 A;  2K52 A;  4CDD C;  1BF4 A;  1RTO A;  2X69 A;  4A3M G;  4QIW B;  1EY0 A;  1JT8 A;  5DNF A;  1VQ6 A;  4HAE A;  2QDL A;  1RD9 D;  4EQO A;  5KNB A;  3NBI A;  4HCS A;  4CJ0 B;  2UXD L;  1HZB A;  1NMG A;  4LNQ A;  2RHQ B;  1XNQ L;  4U67 3;  3FPU B;  4YIJ A;  3TP6 A;  3RLF A;  2Q2T A;  1LT6 D;  3H0G B;  1K8A C;  2A6H D;  3NBH B;  3NSW A;  2IWH A;  3OMC A;  2F52 A;  3A7L A;  3SGI A;  3OW2 A;  4H0L C;  3J80 i;  3BU2 A;  3FPP A;  4BBR G;  1Z47 A;  4X62 Q;  3RZD H;  3A5Z B;  2WP8 J;  1TWA B;  1B1Z A;  1SDF A;  2RCN A;  5CR3 A;  1M8A A;  4N8F A;  4YHH Q;  3PCO B;  4DNT B;  3HOZ B;  4DA2 A;  4FXD A;  4A3J G;  3SR1 A;  3NPP A;  3H3V I;  5L37 A;  2JA5 G;  4IUR A;  3SVM A;  4JW0 A;  2PW7 A;  4DXG A;  5I4D A;  5JVH 3;  1V9P A;  1FNV A;  3MFY A;  2BE5 D;  4NP5 A;  4EX5 A;  1E7Z A;  1SRU A;  4DV7 Q;  1OO9 B;  1UEB A;  1J8I A;  2CWP A;  1ENC A;  3IRB A;  4CKC A;  1XWE A;  3Q23 A;  4A3L G;  1DXM A;  4IPD A;  4I65 A;  2NVX H;  3NWS A;  4HJ7 A;  1MKH A;  2LFN A;  2NBF A;  4WFN 3;  2KCN A;  4KHP Q;  2F0V A;  2GN5 A;  4TRD A;  4EQP A;  2F0N A;  1CA6 A;  1IBL Q;  5AJ3 Q;  2XTI A;  2B8F A;  2A1A A;  2J7Z A;  3DMU A;  3L9A X;  4HCE A;  1A3U A;  4WRD A;  4A3K H;  3PIP A;  4JBW A;  4Y52 H;  2PMZ E;  2OTJ A;  3A56 A;  3NTI A;  5C4J B;  3BVZ A;  5EBC A;  1XMO L;  1E1O A;  2G9H D;  2JA6 H;  5A2Q E;  4LF6 L;  4NXM L;  4DGZ A;  1S5D D;  1SE3 A;  2MNA A;  5C6A A;  3TP8 A;  5DEH A;  4IFD J;  1TWG B;  4HJ8 A;  4HJA A;  1X56 A;  5M3F H;  1E2Z A;  1G91 A;  3I4M G;  1MJC A;  1E22 A;  2F3V A;  4XDX A;  3MVV A;  4KHZ A;  3KOJ A;  4RG1 A;  1JWS D;  5J39 A;  3I55 A;  3GP7 A;  4DV1 Q;  1D7Q A;  2EY1 A;  1BDO A;  1STB A;  1D8L A;  4GKJ Q;  1PFM A;  1X3P A;  4M8A A;  5CV5 A;  4DR1 Q;  2R7D A;  2LMC B;  2ID0 A;  2N55 A;  2ICI A;  5E7N A;  3DEO A;  1WCM H;  1K0S A;  4IJL A;  1RHP A;  3S14 B;  1SMY D;  4X3U A;  1KC8 C;  1F2M A;  4J1M A;  5IGG A;  3HOW G;  1MSG A;  1X3E A;  3J7A F;  4AIM A;  2NN6 I;  3J80 c;  1YHB A;  1LAC A;  3S16 B;  2F3W A;  4P2C B;  1HXY D;  2VUM B;  1I50 B;  2KVM A;  1CZG A;  3G4S A;  1CKO A;  5JJK A;  4DR5 L;  1QB5 D;  3PUY A;  1Q1B A;  1Q8K A;  4MZ9 A;  3UDG A;  1OXX K;  1A8V A;  3PO2 H;  2F0D A;  2B3G A;  1K3B C;  3E0J A;  5T1I A;  4DXF A;  2KOL A;  3UE0 A;  1UAP A;  3N52 A;  4QF4 A;  2JYO A;  1N8R C;  4LF4 Q;  4HJ9 A;  1XPR A;  2AWN A;  5CYU A;  5D14 A;  4BY7 B;  1N33 L;  3NUC A;  4NXN Q;  3P7J A;  5M5Y B;  4M1U B;  4G4K A;  2DUD A;  3U4V A;  5JAV A;  4DKA C;  5ELN A;  1HNZ L;  2AWO A;  2WB1 E;  3SK4 A;  2ES2 A;  3G71 A;  4A3B G;  1PYW D;  3HOY H;  5IYD G;  4BA1 I;  3JAM E;  1P8L A;  5COY A;  2EZV A;  5FLM H;  3GTG B;  2HUG A;  2IPK D;  4EQ5 A;  4UP9 A;  5IGF A;  1VQD A;  1J5E L;  2ALY B;  3I4N H;  1Y1W H;  4WOR A;  3SEB A;  3HRZ C;  2A5H A;  3P1H A;  4FO2 A;  1BNZ A;  3J80 L;  4X3S A;  3MFG A;  4DUZ Q;  3K0Y A;  5FLX E;  3S17 H;  5FK9 C;  2E2D C;  1R9T B;  4F87 A;  3I4O A;  4X66 L;  2R6G A;  4R4I A;  5M5X H;  3B6Y A;  4F88 A;  3DWQ A;  3PMF A;  2E2I H;  4A93 H;  3NTK A;  3DHQ A;  4BXX H;  1STH A;  2ZTD A;  2PQA B;  1TWF H;  3TZU A;  2RF4 A;  3HS0 C;  5HY6 A;  4PV1 C;  2EJM A;  1SEB D;  5BR8 L;  1N36 Q;  1QWY A;  2MP1 A;  4DV3 L;  3I7F A;  2L11 A;  1ICW A;  2B8G A;  3HKZ G;  1JWM D;  2F0Q A;  2Z8L A;  5FJ8 H;  2Z6K A;  2OF1 A;  4X65 Q;  2O4X A;  2MQH A;  1RF2 D;  1X65 A;  3D0F A;  4KKT A;  2AQ2 B;  2NB0 A;  3PV0 A;  4NB3 A;  3GTK H;  2F0F A;  3FVQ A;  1HUM A;  3C3L A;  3AB9 A;  2E2H H;  1JIC A;  4QCL A;  1TWC B;  1IBM Q;  4KKU A;  2F03 A;  1B70 B;  1V1P B;  1SFO H;  3OTO Q;  1YIT A;  1NBW A;  2A6H C;  2HT1 A;  1BO0 A;  2Z4I A;  5G3L D;  1HFG A;  4GOP C;  4BY7 G;  3PQI A;  5CV7 A;  3NXW A;  3DXJ C;  4DV0 Q;  3HOV H;  2FJ2 A;  4C56 C;  4K8I A;  2ENB A;  3M3Y H;  1JJC B;  4A3M H;  4GOP B;  1GUS A;  3T13 A;  3FHW A;  2R92 G;  2I5L X;  1JE5 A;  2B2V A;  4J8Q A;  1NTG A;  1KQS A;  2B29 A;  2RA4 A;  5FO8 B;  5DM6 3;  4IUT A;  5IYB H;  1RTN A;  4OO1 G;  2EJF C;  2K32 A;  4LF9 Q;  2K5N A;  2E74 C;  1EY8 A;  2K50 A;  1FR3 A;  2Z0S A;  1VQ8 A;  3CCE A;  3TN2 A;  5I9O A;  5KNC A;  1QNK A;  3G6E A;  1XJV A;  1CKN B;  1CTM A;  5IGB A;  1X3G A;  2PO4 A;  1XPO A;  5K36 G;  4GN5 A;  1QNU A;  2BE5 C;  3HGB A;  1W6J A;  4UP7 A;  2ZJP A;  3P75 A;  3PSI A;  1UE7 A;  3V05 A;  2E75 C;  1VMC A;  4I7Z C;  4ODG A;  1GUT A;  2Z9H A;  3PIO A;  4L63 B;  1EOV A;  2RSN A;  2JN4 A;  4JG2 A;  3UE1 A;  1MI2 A;  3MTS A;  1QCB D;  1SND A;  5CV9 A;  3NEL A;  1WTW A;  4X62 L;  1VCI A;  2WAQ E;  1Q7Y C;  5I2Y A;  5NUC A;  5C0X I;  4A3J H;  4QY7 A;  4DAY A;  2JA5 H;  2VB2 X;  3SXH A;  1M90 C;  1KAA A;  2GA4 B;  3DLL A;  3FP9 A;  4YHH L;  3PO3 H;  3TS2 A;  4A4I A;  1GVP A;  4K2L A;  3H3V C;  1GM5 A;  2KHS A;  2F0K A;  3J7Y W;  2KEN A;  4DR3 Q;  1WOC A;  1XMQ Q;  4A3E B;  4B3R Q;  3D8G A;  3KYH C;  1SYB A;  3S2D B;  3S1M B;  1YVC A;  1I4P A;  2EYM A;  1QUQ A;  1YBY A;  2SNM A;  5HGQ A;  4QGU A;  1BBX C;  4YCV A;  5C4X B;  1E2V A;  4DV7 L;  2NVQ H;  2PMZ B;  1WI5 A;  4JI2 Q;  3S2H B;  5GAG C;  1QE6 A;  1XXG A;  1UE5 A;  4ZKB B;  4O42 A;  1LTB D;  1SE4 A;  1C4Q A;  3FKI B;  2VQF Q;  3KDF A;  1SRO A;  2XWB B;  4O1N A;  4KHP L;  3KLW A;  4NW2 A;  1IBL L;  5AJ3 L;  1YNX A;  2KEE A;  4QUC A;  3W1G A;  5BN3 A;  4DPG A;  3A7A B;  1H9R A;  2RDG A;  1PTO D;  4BS9 A;  2SDF A;  2KHI A;  4K5V A;  2CKZ B;  4LUO A;  1JCK B;  1L1O C;  3ULJ A;  4OWT B;  4KTA A;  2JA6 G;  3OPO A;  2SNS A;  3CCR A;  1BCP F;  4G57 A;  3R8B A;  4LF5 Q;  3CRK C;  3LNN A;  3H0G H;  5IIF A;  1SMY C;  4ZRZ A;  1CSP A;  4YY3 Q;  1YZ6 A;  1X9N A;  2F0O A;  3S15 B;  2P5Z X;  4XXE A;  1JC7 A;  1ENA A;  4RWS C;  5K5P A;  4LF7 Q;  4P72 A;  1K9M C;  4ZKC B;  4HSP A;  1CA5 A;  3HP3 A;  4EVO A;  1N32 Q;  3CHB D;  2OTL A;  1KAB A;  2CFM A;  1YHQ A;  2QGQ A;  3M85 A;  1A62 A;  3NEN A;  4B9W A;  4GLV B;  5ELC A;  2K01 A;  3OW7 A;  2HIV A;  3GTO B;  2NVY H;  2FMC A;  1RCV D;  3NE5 B;  4DV1 L;  1Z7T A;  2F0T A;  1BKB A;  3HOZ H;  1SMX A;  1QVF A;  1IL8 A;  3K58 A;  1BOS A;  3CP0 A;  1X32 A;  3SK6 A;  4GKJ L;  1YNJ D;  4DR1 L;  2MO1 A;  5C44 G;  2G9D A;  3NTH A;  1RJT A;  3S1R B;  3AFQ A;  3CCJ A;  4GNX A;  1ML0 D;  3CD6 A;  2RVL A;  1II3 A;  3LWE A;  4A3E G;  4PZ6 A;  3EVQ A;  3P20 A;  4ME5 A;  4BY1 G;  5M3M B;  2B63 B;  1EY6 A;  4OEL B;  1Z9F A;  1WTV A;  1T5E A;  4DV2 Q;  5IT9 c;  2B39 A;  4P75 A;  3GTM B;  1ET6 A;  4KN7 C;  3CCL A;  4RMF A;  4DF7 A;  4YWL A;  2LSS A;  1AZQ A;  1C7Y A;  3U4Z A;  1HZC A;  3F2D A;  4A3D G;  3Q22 A;  2LXJ A;  5T1G A;  5M9O A;  4G7Z C;  1F9S A;  4GNX B;  3PUX A;  1S5B D;  1HZ9 A;  1U4R A;  4FF3 A;  2ZXP A;  1JOQ A;  3VR4 A;  3QWN A;  4LF4 L;  1LTA D;  5JPN C;  4HN7 A;  5KRU A;  4DK6 C;  1KDB A;  2JA8 B;  4NXN L;  5JEA J;  4RA8 A;  1IYJ B;  1Q46 A;  1TWG H;  2BA0 A;  3ONA B;  5IYD H;  4L5S A;  1JB7 A;  1PZI D;  3NHH A;  3VR6 A;  3F2B A;  5FLM G;  4C3H B;  3FRP B;  3KLR A;  2LKV A;  3ND8 A;  4DK1 A;  1XX8 A;  4LWC A;  3KF8 A;  4X64 Q;  4LK1 C;  3A55 A;  3KK7 A;  4A3C H;  1KAW A;  3E5S A;  3K5O A;  2JQO A;  1HQR D;  3I72 A;  4KLK A;  4NKL A;  3CPW A;  2JA7 B;  5IT9 L;  1AW7 A;  4KHV A;  3VYT A;  4JYA Q;  1MIU A;  1LYL A;  2Z1C A;  1PA6 A;  4DUZ L;  4JBM A;  3J7A V;  4IO9 A;  1H9M A;  3FDT A;  1Y1V B;  4UP8 A;  3LX0 A;  1CZW A;  4NPS A;  5C0X J;  1WVL A;  2D62 A;  1QOH A;  1T5X D;  2CWA A;  1VQM A;  5IGE A;  5BN5 A;  1TII D;  1A6X A;  1LTI D;  1PH1 A;  3KF8 B;  5I2X A;  4RGM A;  1N36 L;  2XNA C;  4HIO A;  3BDC A;  4XYO A;  4C2M B;  2R93 G;  1BQQ T;  2VUM H;  1I50 H;  3U58 A;  2EQS A;  1HJP A;  1SAP A;  1NNX A;  2K14 A;  1G6Z A;  1GKH A;  3EN2 A;  1I6V C;  3ULL A;  4X65 L;  2OCE A;  3PIP 3;  4ZCK A;  1QIL A;  2CH4 W;  2H5X A;  2MUY A;  4UAI A;  2N88 A;  4ZAI A;  1IBM L;  4BA2 I;  2WB1 G;  4DV5 Q;  1O7L A;  4BY7 H;  2OEO A;  5GAD C;  1JOO A;  3UDI A;  4JI6 Q;  4K0K Q;  3OTO L;  2DNC A;  5M5Y H;  4A3F B;  1AFP A;  2R92 H;  4J6H A;  4C1N I;  2EY6 A;  1SR3 A;  2OXP A;  4DV0 L;  2JA8 G;  2QKI C;  3AEV A;  1EY5 A;  2OWO A;  2A73 B;  4OO1 H;  4DFA A;  5IYB G;  1Q1E A;  3GTG H;  2Q2U A;  2VY3 A;  5LL6 S;  4KMU C;  4C1N K;  1IL2 A;  1CK1 A;  3T1H Q;  2HQE A;  3CQZ H;  1B2T A;  4DNR B;  3E3X A;  2JK8 A;  4LF9 L;  2LS0 1;  4UPA A;  5ISR A;  5K36 H;  1EIY B;  2MJ8 A;  3A8I E;  1SNQ A;  3T1Y Q;  1R9T H;  1YIJ A;  1EIF A;  4JVZ A;  1O80 A;  2WAQ B;  3S9W A;  3K7A B;  1Y1V G;  5C4H A;  5JVG 3;  3TBI B;  2F0E A;  4MHE A;  5D3I B;  4IUN A;  3W2D A;  3OHX C;  3CW2 C;  4LF8 Q;  1KNE A;  1K28 A;  1H9S A;  2UU9 Q;  4OIK A;  4RH6 A;  4JV5 Q;  1S5E D;  2IX3 A;  2EIF A;  1MJE A;  3MEF A;  4JI0 Q;  4YCU A;  1I3Q B;  5AFW A;  2O5J C;  1PTO C;  3HEJ A;  5I9P A;  3PO3 G;  1D5Z C;  1JQY D;  4A3I B;  2AMC B;  2GVB A;  4DR4 Q;  2D2C C;  1PTO B;  2Y0S E;  2L4N A;  1TWC H;  2EJG C;  1UNS A;  1WTH A;  4CDF C;  4DR3 L;  3KLS X;  3RR5 A;  2MPM A;  1ILQ A;  1HH2 P;  1PZJ D;  2CCZ A;  1XMQ L;  4B3R L;  1DON A;  1H9S B;  3HFZ B;  1GUN A;  3OIQ A;  4DV4 Q;  1GD7 A;  2BDN A;  1EQV A;  1NSN S;  1H9K A;  2XIW A;  3KBG A;  3TP5 A;  5KGU A;  3NQT A;  1F9P A;  2QCP X;  4JI2 L;  2I46 A;  1PH4 A;  4OX9 Q;  1HR0 Q;  1IKM A;  4I7A A;  1VQB A;  2VQF L;  4DV6 Q;  3J81 j;  4PMB A;  1EYG A;  3GD7 A;  1Q8I A;  3NWT A;  3RUZ A;  3D4R A;  2K5Q A;  1YNJ C;  5IYC H;  2HCI A;  3L7Z C;  2E2J B;  2X6G A;  5IY0 A;  2DNE A;  1VF5 C;  5CBA E;  2FMM A;  3H0G G;  1ASY A;  2A69 D;  3R2T A;  2AUJ D;  4LF5 L;  3A0J A;  1WJJ A;  3R3O A;  1ASZ A;  3QG1 A;  4BWG B;  5C3E B;  4YY3 L;  5GAH C;  2F4V Q;  4R1J A;  2WAQ G;  3DEP A;  1TWH B;  1SSO A;  4A3G B;  4LF7 L;  2D5D A;  2H4O A;  3TS0 A;  4JBJ A;  4MNO A;  1N32 L;  3K80 C;  5A35 A;  3D31 A;  1VQN A;  2LXK A;  4N9P A;  1S40 A;  2IHF A;  1O7Z A;  3HOZ G;  4DAP A;  1LTR D;  2J4X A;  5C44 H;  4HJ5 A;  1HUN A;  3DUZ A;  4POG A;  3I3C A;  3KLS A;  2AKW B;  3X3M A;  3CME A;  1O7Y A;  5LMN W;  2Z6B A;  3SK8 A;  4A3I G;  1M4V A;  5BN4 A;  2B2Y A;  3FMC A;  4A3E H;  2EE1 A;  1K0R A;  4BY1 H;  3ERQ A;  1C0A A;  3S2D H;  1U4L A;  1PMR A;  2K7V A;  2XN9 C;  3S1M H;  4XQQ A;  2BDO A;  3MAQ A;  1Q90 A;  2PCF B;  3A8K E;  3K0X A;  2OQ0 A;  5CV8 A;  5M5W B;  5C4X H;  1G2T A;  2CVR A;  1QVC A;  1SE8 A;  1TS5 A;  3VR3 A;  3I56 A;  1Y69 U;  2D0O A;  4GN3 B;  3C2P A;  3OIP A;  2F0J A;  5C3X A;  1PH8 A;  2DGY A;  2JJQ A;  4FVM A;  2IL8 A;  2B2Y C;  4KD4 A;  4DV2 L;  1ZYR C;  2SEB D;  4A3D H;  1WFQ A;  2D0P A;  4RCN A;  1EL0 A;  1MHW C;  3GTP B;  4CKB A;  4HSV A;  4R4Q A;  4B3M Q;  1SJE D;  4WJ4 A;  1DM0 B;  4MIU A;  3EIV A;  3ERO A;  4WJ3 M;  3LWU A;  1WTX A;  1RL2 A;  1OXU A;  1CQF A;  1U5K A;  4JI4 Q;  4JBK A;  1DGS A;  3IL8 A;  3KF6 A;  4OXP A;  5JJI A;  5J3B A;  1ESR A;  3J80 E;  1EWC A;  1HNW Q;  2NUC A;  2PQA A;  1PRT D;  2EYP A;  3QIA A;  3J81 c;  1L0Y B;  2F0G A;  3M4O B;  2A68 D;  4TQU S;  3PIO 3;  2UUB Q;  3D3R A;  4IOA A;  4FXG C;  1EZ8 A;  5C3E G;  1MSH A;  4FXK C;  4MTN A;  5DM7 3;  5ELD A;  1P16 A;  3CKI B;  2PZU A;  1PVO A;  4A3C G;  1DCZ A;  3GTO H;  2AQ1 B;  1G8Z D;  5EPL A;  3CXC A;  3BYY B;  4ALP A;  1QZG A;  4X64 L;  1TR5 A;  4KD3 A;  3KF6 B;  3KJP A;  3MHB A;  2N3S A;  3TRZ A;  4GLA C;  3K8A A;  3MC0 B;  4IPH A;  4LUV A;  1VDZ A;  5KYI A;  1AZP A;  1OXV A;  4JYA L;  4XIG S;  3S1R H;  1VQK A;  4CDE C;  1GJX A;  1FD7 D;  1VQH A;  4FF1 A;  1SE2 A;  1TS3 A;  4R9W A;  1V1P A;  1D1K A;  2VB3 X;  5LHY 1;  2NVT B;  2PQE A;  3HZX A;  1EU4 A;  5DLQ E;  2R93 H;  4NDX A;  3TDQ A;  3HOU B;  1WTQ A;  2VUM G;  5CMD A;  1EYC A;  2KCC A;  4GOP A;  1AN8 A;  3GTM H;  3GDE A;  2KUM A;  4KJO A;  1WTP A;  2WV6 D;  3NQI A;  4GZY C;  3OMG A;  1FNU A;  3OYY A;  3J81 L;  3W5O A;  1R4P B;  4IPG A;  4X6A H;  2SOB A;  1VQ7 A;  5KYL A;  2EYH A;  4CJ2 C;  2QEX A;  1CKN A;  1J9O A;  1MBY A;  1G2S A;  1S4Z A;  3L3O C;  3WOE A;  1CFM A;  2KED A;  1Q12 A;  4DV5 L;  4K0K L;  4JI6 L;  2JA8 H;  1BVS A;  2Q2H A;  2K5V A;  1U9R A;  2N8N A;  4XT3 B;  5JPM C;  4PNY A;  1CSQ A;  2AQ3 B;  4GS3 A;  2FIN B;  1KLU D;  1XYI A;  1SYG A;  4P73 A;  4RGO S;  3I4L A;  3F1Z A;  1YI2 A;  2KQ3 A;  4C3I B;  2HCC A;  1FNW A;  3TZD A;  2EYJ A;  3T1H L;  3Q0A A;  3CPF A;  4ILW A;  2I07 B;  2I0Q A;  4DUY Q;  1A3V A;  2BH2 A;  3RN5 A;  4V19 0;  1XNQ Q;  1DZ1 A;  1A63 A;  3K7U C;  4IUP A;  5EJW A;  2JEA I;  1UEA B;  1Y1V H;  3T1Y L;  5ELE A;  4IFD G;  3DWP A;  1HR0 W;  3GV3 A;  1C9O A;  1EOT A;  2IX0 A;  2XGT A;  2C9O A;  4JC0 A;  4UY8 C;  4QMG A;  2BA1 A;  5HUR A;  1VQ5 A;  3CCV A;  1PFB A;  1CI3 M;  1VQL A;  3QB3 A;  5KIX A;  2M9V A;  2Y0S B;  4LF8 L;  3U50 C;  2R7F A;  4C2M H;  2VZA A;  2UU9 L;  1V8Q A;  1B7Y B;  1HNX Q;  3J7Z C;  4JV5 L;  2QF7 A;  1ONL A;  3KJO A;  5LL6 X;  4JI0 L;  1KNA A;  4CKE A;  1L2F A;  3ERS X;  3S1Q B;  2K05 A;  4OWX B;  2WKD A;  3IAY A;  4CGY B;  1ET9 A;  1WTO A;  1JOR A;  4DR4 L;  2DJF C;  1SN8 A;  3RLN A;  2A69 C;  1EYD A;  1PXU A;  2K5H A;  3PF5 A;  1L1O A;  2VS1 A;  1ROD A;  5IOD A;  4A3F H;  2F1M A;  1SYD A;  4DV4 L;  1N34 Q;  2RCF A;  3OSO A;  1PFS A;  2PYK A;  1YNN D;  4OIJ A;  1I6H B;  1TY2 A;  4OX9 L;  1A2U A;  1I5F A;  5EGT A;  5HGT A;  4TKO B;  1HR0 L;  1K83 B;  5E1F A;  1AP0 A;  3PUZ A;  2R7Z B;  1B3Q A;  3H15 A;  4DV6 L;  4B08 A;  1CHQ D;  5JJZ A;  5IYC G;  3ICE A;  3CAM A;  1YJN A;  1L1O B;  3T56 B;  3PO2 B;  5G3L F;  3QR8 A;  1FGB D;  2NZ1 D;  4BBS B;  1G29 1;  5GAE C;  2NYZ D;  3BZC A;  3K57 A;  2IW3 A;  4QQB X;  4RCO A;  1AH9 A;  3K7A H;  3PGZ A;  5FKA C;  1EY7 A;  2UUA Q;  2F0L A;  4R4C A;  3T16 A;  5F2D A;  4ZK9 B;  1PHJ A;  2F4V L;  3H09 A;  1TWA H;  2E8G A;  5IE8 A;  1CHP D;  2K4K A;  3M4Y A;  2AHO B;  1D5M C;  1L0W A;  1NCV A;  4ZLT F;  3K5L A;  3CC2 A;  1M1K C;  1PDQ A;  3E9I A;  4P71 A;  4J15 A;  2Y0S G;  4O2D A;  3CF5 A;  1I3Q H;  4XYQ A;  4H44 C;  3CCS A;  2A19 A;  4LFB Q;  1BR9 A;  2NZH A;  1YHA A;  4A3I H;  2EXZ A;  1CUK A;  4B3T Q;  1I4G A;  2MFI A;  5C0X H;  1PTO H;  4ME3 A;  4KKS A;  2VL6 A;  1BBW A;  4B9X A;  2B2U C;  2F0M A;  1CKM A;  3HG9 A;  1GO3 E;  3A8J E;  4A93 B;  2L12 A;  1BUV T;  5C4X G;  4KY6 A;  1PRT C;  1TWF B;  2DY7 A;  1TQO A;  2NZO A;  1VQF A;  1DJR D;  1QZH A;  1RKN A;  2F0P A;  2RQX A;  2A68 C;  5EKL A;  1PFN A;  2Q8T A;  4CHT B;  3FKI G;  2KBN A;  1VQI A;  3DM1 A;  4H02 A;  4RHS A;  4RKL A;  4DAM A;  4KY7 A;  5C4J H;  2CW0 D;  2TMP A;  2V1C C;  3MZ5 A;  4N9T A;  2MO0 A;  3L0O A;  5J22 A;  2R7Z G;  5JOB A;  1Y14 B;  3GTK B;  1RDP D;  3UI2 A;  2E2J H;  4B3M L;  2N78 A;  3S24 A;  3UDF A;  4YWM A;  2ZM6 Q;  3AQQ A;  5EQ0 A;  3CC7 A;  2K5D A;  1A0I A;  2XSC A;  3SK5 A;  4PZ8 A;  5LMN Q;  4JI4 L;  2QEJ C;  3K6O A;  1PH3 A;  4QL5 A;  5C3E H;  5IT9 E;  4HMI A;  1HNW L;  2UUC Q;  4OO1 I;  3EFX D;  2Q2I A;  1TWH H;  4EGV A;  4A3G H;  2YTX A;  2L9H A;  3JC6 6;  2UUB L;  1FJG Q;  4K5X A;  4AYB E;  1PTO F;  1UWV A;  1F2L A;  4R8N A;  1WTR A;  3C46 A;  2YTY A;  1ZKO A;  3I90 A;  4RGT A;  4DU9 A;  3VA5 A;  3U9O A;  2KHJ A;  1DOL A;  1H95 A;  1D1I A;  4TSS A;  1BXT A;  1SJH D;  2ASB A;  4GN4 B;  4ZUI A;  3GTQ B;  4EQN A;  3S14 H;  4L5R C;  1WD0 A;  1MD2 D;  2OQK A;  3ITP A;  1NJI C;  1ENF A;  3V96 A;  1NE3 A;  2K03 A;  2NTT A;  4K6D A;  1F9R A;  3S16 H;  5M3M G;  2B63 G;  1HA6 A;  5M5W H;  3TSS A;  4BBR B;  3N6R A;  4X3T A;  2A6E D;  4DR6 Q;  2HQL A;  1NR2 A;  3LGJ A;  3ULP A;  3I8Z A;  3GTL B;  1XTC D;  1VQE A;  4HR7 B;  2NN6 G;  2DJG C;  3Q6S A;  4JI3 Q;  1JWU D;  3MA2 B;  3NEM A;  1LT4 D;  2EDG A;  2FHT A;  2HHH Q;  1L0X B;  1SLJ A;  4IUU A;  4S3S A;  2BCO A;  4KK7 A;  2JA5 B;  3GTP H;  2PW5 A;  1QVG A;  4HTH A;  1HZA A;  1Z6H A;  2L15 A;  5EBD A;  2D9U A;  5CBE E;  1XNR Q;  5KND A;  1RIP A;  3F8T A;  2N49 A;  3SHL A;  1TT2 A;  2A8V A;  2J0T D;  2B2W C;  1X3F A;  1F2Y A;  1AEX A;  3QOL A;  3VDY A;  2EY2 A;  2R61 A;  3M7G A;  2PPB C;  1G6P A;  3MXN B;  4NMZ A;  1HCZ A;  2X6L A;  2PNH A;  3PUW A;  3M4O H;  1W3S A;  5COR A;  1PH2 A;  2E5L Q;  1E1T A;  2EYL A;  3MEH A;  5IP9 G;  5EKI A;  4C3H G;  1U0L A;  2L1B A;  4AQY Q;  1NR4 A;  4FF2 A;  1H9J A;  1STN A;  1PYS B;  4OL7 A;  4RHR A;  4XTC S;  1B9N A;  5D65 A;  2L5T A;  2JA7 G;  1GUO A;  1FVI A;  3BJU A;  4IFD H;  4QUF A;  1WYD A;  2UXC Q;  4DUY L;  4G7H C;  3R2I A;  3RN2 A;  4LW1 A;  1A3T A;  3K59 A;  1HQM C;  1KLG D;  2HD3 A;  4OON A;  4ULL A;  2QW7 A;  2NVT H;  4Q0F A;  2ZTC A;  1B44 D;  3QOJ A;  1GOZ A;  5C4Z A;  3I4M B;  1A2T A;  4KI0 A;  3STB D;  1YNN C;  3DWA A;  5FO9 B;  1EFW A;  3HOU H;  5H1S E;  3DM3 A;  3JAM i;  2K5W A;  4U68 A;  5ELB A;  1X3Q A;  4Q5V A;  3C1E A;  1HNX L;  2Z4H A;  2NVY B;  3BZK A;  2EXD A;  1EEI D;  2F0W A;  1AE3 A;  2BH8 A;  1LTG D;  3J7A 5;  1TKW B;  1CM9 A;  2F3I A;  3S1N B;  4ZUJ A;  1F2Z A;  1JOK A;  4DN4 M;  1ILP A;  5IP7 G;  1SNC A;  3J81 i;  2JEB I;  2RKS A;  4YCW A;  3HOW B;  1JE4 A;  3RMH A;  4A3F G;  1KIX A;  4HID A;  2IT1 A;  1C48 A;  4JOI A;  4LMQ D;  5E4X A;  5C3W A;  2KA7 A;  3W3A A;  3I2Z A;  2ZT9 C;  4PMC A;  3Q24 A;  1ZEQ X;  1N34 L;  4PZ7 A;  3D6C A;  4FDB A;  1Y8O B;  3VR5 A;  1DD2 A;  3W1B A;  1EYA A;  2NWG A;  2B2T A;  1OXS C;  2XRQ D;  4PQX A;  3E6Z X;  4C3I H;  4DR7 Q;  2L0C A;  1FL0 A;  4JOI C;  2RSO A;  4R4O A;  1SXT A;  2HDM A;  2I5M X;  3C1F A;  1E2W A;  1JR0 D;  1SNO A;  1NUC A;  3EA6 A;  4C3J B;  5JEA G;  2B2T C;  2RDH A;  3CC4 A;  3ND9 A;  1F9Q A;  3HOX B;  1HPC A;  1V1Q A;  2ZXR A;  4V0B A;  4XQJ A;  2EVB A;  4FF4 A;  5D3D A;  1C8C A;  5KEE A;  1LO5 D;  3VYU A;  1B8A A;  4A3B B;  2PZW A;  2UUA L;  3BDO A;  1AE2 A;  3ER0 A;  2Q8I B;  1DOM A;  3TEH B;  3M7N A;  3MXU A;  5ELO A;  4GKK Q;  5A2Q L;  4XQN A;  1KL9 A;  5TSS A;  4APV A;  1I4R A;  2CW0 C;  1SYE A;  4H7B A;  5GQO A;  3EBE A;  2WKC A;  4DR2 Q;  3T51 B;  2M2L A;  2PNR C;  5J1Z A;  5IOC A;  5CGK A;  4LFB L;  2ICE C;  4OHJ A;  5C0X G;  4TVA B;  3S1Q H;  3H3V H;  4B3T L;  1PZK D;  4K8J A;  2M00 A;  3BDL A;  2AUK A;  2PI2 A;  1BBU A;  2RBM A;  5LMU Q;  1GXD C;  1S72 A;  1LTT D;  3BVG A;  3UDX A;  1LM0 A;  3RZO B;  3S2H H;  5I6Y A;  4JI5 Q;  2R3Z A;  2VXW A;  4DK0 A;  1UE1 A;  2CQO A;  3FEW X;  4L5Q A;  3FKI H;  1IHZ A;  1Y8N B;  3HKZ B;  3VA7 A;  1D6E C;  3GTJ B;  1IZ6 A;  3JAM c;  1I6H H;  1STE A;  2JE6 I;  3H6M A;  2JXM B;  4B3S Q;  1N9W A;  1K83 H;  3H94 A;  2R7Z H;  2JA9 A;  1VQO A;  1HFN A;  3M9B A;  4R4T A;  1LTS D;  1HTL D;  3D4W A;  3T4A C;  2IJ0 A;  4L5T A;  5FO7 B;  4Y7N B;  2VW9 A;  4QB4 A;  2YV5 A;  4RGN A;  2VQE Q;  5FLX c;  2LY7 A;  1IBK Q;  2MGS A;  4BBS H;  2IHE A;  3S15 H;  1IYU A;  1X54 A;  4AYB B;  2YU9 B;  3AFP A;  2ZM6 L;  2QA4 A;  2KCM A;  3I73 A;  1I94 Q;  2GVA A;  2F4I A;  5LMN L;  4C3J G;  3MXG A;  2IX1 A;  2E76 C;  3HOX G;  1EWH A;  4LFC Q;  4A3G G;  2A6E C;  2R92 B;  1S5F D;  5DAU A;  2UUC L;  2ZJQ A;  5EPJ A;  1IKL A;  1O78 A;  1OTC A;  3IFD A; 
#chains in the Genus database with same CATH homology
 4EX5 A;  2K5H A;  1E7Z A;  1FJG L;  1SRU A;  1YEZ A;  4X64 Q;  4DV7 Q;  1UEB A;  3PF5 A;  1L1O A;  4JI7 Q;  2CWP A;  4IJH A;  1LUZ A;  1KAW A;  4A3C H;  3IRB A;  2VS1 A;  4A3L G;  2JQO A;  4IPD A;  4KLK A;  4A3F H;  3CPW A;  4DV4 L;  4IOC A;  1N34 Q;  2NVX H;  3AYH B;  4JI1 Q;  4JI8 Q;  2ZJR A;  4HJ7 A;  4JYA Q;  1MKH A;  1MIU A;  1LYL A;  1E3P A;  1PFS A;  4DUZ L;  1PA6 A;  4JBM A;  4KHP Q;  4IO9 A;  2GN5 A;  1KD1 C;  4UP8 A;  5AJ3 Q;  1IBL Q;  2XTI A;  4NPS A;  5C0X J;  1PH5 A;  2A1A A;  2D62 A;  3TQY A;  4OX9 L;  1VQG A;  1I5F A;  4LFA Q;  5M3M H;  2CWA A;  1HR0 L;  4A3K H;  3PIP A;  2B63 H;  4JBW A;  3PUZ A;  3H15 A;  1VQM A;  2PMZ E;  4DV6 L;  4OWW B;  2OTJ A;  4Y52 H;  5IWA Q;  3E9H A;  5IYC G;  1XMO L;  1PH1 A;  3ICE A;  3CAM A;  3KF8 B;  1YJN A;  1L1O B;  1E1O A;  1N36 L;  2C35 B;  2JA6 H;  4HIO A;  2R93 G;  3F2C A;  4LF6 L;  2VUM H;  1I50 H;  1G29 1;  2EQS A;  1HJP A;  3Q8D A;  2K14 A;  5GAE C;  3BZC A;  3U58 A;  4NXM L;  4DR6 L;  2MNA A;  1K8G A;  1GKH A;  1E24 A;  4QQB X;  1UE6 A;  3EN2 A;  3ULL A;  4X65 L;  1AH9 A;  2OCE A;  4IFD J;  3K7A H;  4JI3 L;  4HJ8 A;  2UXB Q;  3PGZ A;  4HJA A;  3CCQ A;  2UUA Q;  1X56 A;  5M3F H;  4R4C A;  2HHH L;  1PHJ A;  1VQ9 A;  2F4V L;  2H5X A;  1J6Q A;  1TWA H;  2E8G A;  5IE8 A;  3I4M G;  1MJC A;  1KRS A;  2K4K A;  1E22 A;  2AHO B;  4KHZ A;  3KOJ A;  1L0W A;  2WB1 G;  2YTV A;  1IBM L;  4DV5 Q;  3CC2 A;  1M1K C;  4BA2 I;  4BY7 H;  4RG1 A;  1XNR L;  3I55 A;  4O0A A;  3E9I A;  4P71 A;  3UDI A;  5GAD C;  4DV1 Q;  4JI6 Q;  4J15 A;  3OTO L;  4K0K Q;  1D7Q A;  1JJG A;  2Y0S G;  5M5Y H;  4O2D A;  1PH9 A;  3CF5 A;  1I3Q H;  1D8L A;  2Z6K C;  4GKJ Q;  3CCS A;  3K81 C;  4DR1 Q;  2A19 A;  4LFB Q;  2R92 H;  2R7D A;  2NZH A;  4AYB G;  1YHA A;  4A3I H;  4DK3 C;  5IP9 H;  2ID0 A;  1CUK A;  1SR3 A;  3M4Q A;  4DV0 L;  4C3H H;  4B3T Q;  2JA8 G;  3AEV A;  2MFI A;  5E7N A;  3STB C;  1VQ4 A;  2OWO A;  4ME3 A;  1WCM H;  1Q82 C;  5IYB G;  4IJL A;  2E5L L;  1Q1E A;  1BBW A;  2VL6 A;  3GTG H;  2Q2U A;  2VY3 A;  4YWK A;  1XPU A;  1CKM A;  1GO3 E;  1IL2 A;  1KC8 C;  1PH7 A;  3T1H Q;  4AQY L;  3CQZ H;  2UXD Q;  2JA7 H;  3HOW G;  5C4X G;  1X3E A;  2JK8 A;  4LF9 L;  4AIM A;  2NN6 I;  4UPA A;  2NZO A;  1VQF A;  1QZH A;  4PG3 A;  3A74 A;  3J80 c;  1YHB A;  1EIY B;  1TXY A;  3GTQ H;  3T1Y Q;  1W2B A;  4QIW E;  1R9T H;  1YIJ A;  3G4S A;  3FKI G;  2KBN A;  1VQI A;  1EIF A;  4H02 A;  5GRO A;  2UXC L;  1CKO A;  5JJK A;  4DAM A;  5C4J H;  4DR5 L;  4AH6 A;  2V1C C;  3PUY A;  2HIX A;  1Y1V G;  1Q8K A;  1Q1B A;  4MZ9 A;  1NY4 A;  3UDG A;  1OXX K;  2MO0 A;  3L0O A;  1A8V A;  3PO2 H;  2B3G A;  3CW2 C;  2R7Z G;  3TRE A;  1Y14 B;  4LF8 Q;  3PF4 A;  3HOU G;  2E2J H;  4B3M L;  3UE0 A;  4BBR H;  3RLO A;  1N8R C;  2N78 A;  2UU9 Q;  3S24 A;  4LF4 Q;  4HJ9 A;  3UDF A;  1XPR A;  2AWN A;  4YWM A;  2ZM6 Q;  3AQQ A;  3CCU A;  1N33 L;  4JV5 Q;  5JJL A;  1K3R A;  3CC7 A;  3GTL H;  2EIF A;  1MJE A;  4NXN Q;  1A0I A;  3MEF A;  4JI0 Q;  4YCU A;  4PZ8 A;  5LMN Q;  4JI4 L;  2DUD A;  3U4V A;  4DKA C;  1PH3 A;  3PO3 G;  5ELN A;  4QL5 A;  1HNZ L;  2AWO A;  2WB1 E;  2ES2 A;  5C3E H;  4IFD I;  2AMC B;  3G71 A;  1S3O A;  1HNW L;  2UUC Q;  4OO1 I;  1O7I A;  1LTL A;  2GVB A;  4A3B G;  2Q2I A;  1TWH H;  2KCT A;  4DR4 Q;  3HOY H;  5IYD G;  2Y0S E;  4BA1 I;  2IY5 B;  4A3G H;  1P8L A;  2YTX A;  3JC6 6;  1TWC H;  5IP7 H;  5FLM H;  1Q86 C;  2UUB L;  1FJG Q;  4AYB E;  4DR3 L;  1UWV A;  3RR5 A;  4EQ5 A;  4UP9 A;  2YTY A;  1HH2 P;  2WFW A;  2CCZ A;  1XMQ L;  4B3R L;  1VQD A;  3M4P A;  1J5E L;  1EWI A;  3HFZ B;  2ALY B;  3I4N H;  1Y1W H;  2K75 A;  4DV4 Q;  2KHJ A;  1H95 A;  1PH6 A;  1GD7 A;  4A3L H;  2ASB A;  4DUZ Q;  4GN4 B;  3S17 H;  3S14 H;  4L5R C;  4JI2 L;  3I4O A;  2I5H A;  2R6G A;  4R4I A;  4X66 L;  3B6Y A;  5M5X H;  1PH4 A;  4OX9 Q;  2FXQ A;  2OQK A;  2E2I H;  4DAY B;  1YJ9 A;  1NJI C;  1HR0 Q;  4A93 H;  1VQB A;  4BXX H;  2ZTD A;  2VQF L;  2PQA B;  3J81 j;  4DV6 Q;  1OXT A;  1TWF H;  2RF4 A;  1EYG A;  3GD7 A;  5EAY A;  5HY6 A;  1XMO Q;  1NE3 A;  3S16 H;  5M3M G;  5BR8 L;  4A3K G;  1N36 Q;  2B63 G;  5M5W H;  4DR7 L;  3CMA A;  5IYC H;  3L7Z C;  4QJF A;  4DV3 L;  3L2P A;  5IY0 A;  4LF6 Q;  3I7F A;  4NXM Q;  4DR6 Q;  3HKZ G;  2HQL A;  3ULP A;  3LGJ A;  3H0G G;  1ASY A;  1QUQ B;  1VQE A;  2Z6K A;  5FJ8 H;  4X65 Q;  2NN6 G;  2MQH A;  4JI3 Q;  4PMW A;  4LF5 L;  1X65 A;  3D0F A;  3A0J A;  3NEM A;  1WJJ A;  3RNU A;  3PV0 A;  4NB3 A;  1ASZ A;  2HHH Q;  1SLJ A;  4YY3 L;  5GAH C;  4IPC A;  2F4V Q;  4R1J A;  3GTK H;  2WAQ G;  3GTP H;  1VQJ A;  1QVG A;  2E2H H;  3KDF B;  4DNI A;  4LF7 L;  1HZA A;  2L15 A;  5M3F G;  3TS0 A;  1IBM Q;  3I4M H;  1XNR Q;  4JBJ A;  1EUJ A;  4MNO A;  1B70 B;  1RIP A;  1N32 L;  3F8T A;  2N49 A;  3K80 C;  3OTO Q;  1YIT A;  1NBW A;  1SFO H;  2A8V A;  2HT1 A;  1X3F A;  3D31 A;  1VQN A;  2LXK A;  4GKK L;  1S40 A;  4GOP C;  2IHF A;  4A76 A;  4BY7 G;  3HOZ G;  3VDY A;  4DV0 Q;  5C44 H;  4HJ5 A;  1XTD A;  3HOV H;  1G6P A;  3MXN B;  4LUZ A;  4POG A;  3M3Y H;  1JJC B;  4A3M H;  2AKW B;  4GOP B;  3CME A;  4DR2 L;  2PNH A;  3FHW A;  3PUW A;  1W3S A;  2I5L X;  5LMN W;  1PH2 A;  1JE5 A;  2E5L Q;  2R92 G;  3S1N H;  3M4O H;  4A3I G;  1E1T A;  5IP9 G;  3A5U A;  1NTG A;  1KQS A;  1U0L A;  2B29 A;  1G51 A;  4A3E H;  5IYB H;  4AQY Q;  1K0R A;  1WCM G;  4BY1 H;  4OO1 G;  3HKS A;  1C0A A;  1PYS B;  4LF9 Q;  3S2D H;  2K5N A;  3S1M H;  2K50 A;  4XTC S;  3GO5 A;  2Z0S A;  3K0X A;  1VQ8 A;  2OQ0 A;  5LMU L;  5C4X H;  3CCE A;  3HOW H;  1QVC A;  1SE8 A;  2ATW A;  2JA7 G;  3I56 A;  4JI5 L;  2D0O A;  3G6E A;  1CKN B;  1FVI A;  3BJU A;  1XJV A;  4GN3 B;  3E0E A;  1X3G A;  1WYD A;  4GLX A;  2UXC Q;  1XPO A;  1PH8 A;  5K36 G;  2DGY A;  2JJQ A;  4GN5 A;  4DR5 Q;  4DUY L;  4DV2 L;  1Q81 C;  3RN2 A;  4A3D H;  1WFQ A;  2D0P A;  4LW1 A;  4UP7 A;  2ZJP A;  3KFU A;  4A75 A;  3HKZ E;  3PSI A;  4OON A;  1UE7 A;  3WWV A;  4GNX C;  2NVQ H;  4B3S L;  2NVT H;  4R4Q A;  4B3M Q;  3PIO A;  4WJ4 A;  2ZTC A;  1EOV A;  4JG2 A;  4POF A;  3UE1 A;  3EIV A;  1N33 Q;  1VQP A;  3PO2 G;  4KI0 A;  4WJ3 M;  3STB D;  3NEL A;  1EFW A;  3HOU H;  1RL2 A;  4BBS G;  1OXU A;  1U5K A;  4X62 L;  1VCI A;  2PI2 E;  2WAQ E;  5H1S E;  1Q7Y C;  3DM3 A;  4JI4 Q;  3JAM i;  4JBK A;  1DGS A;  3KF6 A;  4OXP A;  2VQE L;  5JJI A;  5J3B A;  5C0X I;  1IBK L;  4C3J H;  3PUV A;  1IXR A;  4QY7 A;  4A3J H;  1HNZ Q;  2JA5 H;  4JCV E;  1HNX L;  3HOX H;  1M90 C;  2PQA A;  1HNW Q;  3DLL A;  1VQC A;  3BZK A;  2EXD A;  3FP9 A;  4P74 A;  4YHH L;  3PO3 H;  1AE3 A;  3TS2 A;  2BH8 A;  1I94 L;  3J81 c;  4A4I A;  1GVP A;  3J7A 5;  4TQU S;  2F3I A;  1GM5 A;  2UUB Q;  4IOA A;  2KEN A;  5C3E G;  4A3B H;  4DR3 Q;  1WOC A;  4LFC L;  4MTN A;  1XMQ Q;  4B3R Q;  3HOY G;  1J5E Q;  1KXL A;  1P16 A;  3KYH C;  1VS0 A;  1YVC A;  5IP7 G;  3J81 i;  1PVO A;  4A3C G;  1QUQ A;  1YBY A;  5HGQ A;  4QGU A;  3GTO H;  4YCV A;  2JEB I;  3CXC A;  1YJW A;  4YCW A;  4ALP A;  4A3F G;  4X64 L;  4DV7 L;  1EQQ A;  3KF6 B;  3KJP A;  4HID A;  2IT1 A;  1QZG A;  1KIX A;  1WI5 A;  4JOI A;  2N3S A;  1Y1W G;  1X55 A;  4JI2 Q;  3I4N G;  3TRZ A;  3I2Z A;  4X66 Q;  5GAG C;  1PV4 A;  4GLA C;  3ZJY C;  3K8A A;  4IPH A;  1UE5 A;  4LUV A;  1N34 L;  4PZ7 A;  1JJ2 A;  4FDB A;  4JI1 L;  4JI8 L;  1OXV A;  2VQF Q;  4JYA L;  4XIG S;  3KDF A;  3S1R H;  1VQK A;  1SRO A;  3W1B A;  4KHP L;  3KLW A;  1VQH A;  2VNU D;  1IBL L;  5AJ3 L;  1YNX A;  3G48 A;  3W1G A;  1OXS C;  3CCM A;  1NMF A;  4DPG A;  4A93 G;  5BR8 Q;  4C3I H;  4DR7 Q;  2RHS B;  4BXX G;  4LFA L;  2KHI A;  4DV3 Q;  2CKZ B;  1FL0 A;  3RZO H;  4JOI C;  4LUO A;  5DLQ E;  4R4O A;  2R93 H;  1L1O C;  3ULJ A;  5IWA L;  4OWT B;  2JA6 G;  2I5M X;  3CCR A;  1T9H A;  2VUM G;  1KRT A;  4LF5 Q;  4GOP A;  4HIM A;  3GTM H;  1KHI A;  3H0G H;  3GDE A;  5JEA G;  2YYZ A;  3CC4 A;  3GTJ H;  1CSP A;  4YY3 Q;  1YZ6 A;  1X9N A;  1K73 C;  5FJ8 G;  1FGU A;  1V1Q A;  3OYY A;  1VQA A;  4LF7 Q;  3W5O A;  4P72 A;  1K9M C;  2UXB L;  4IPG A;  1B8A A;  4X6A H;  1VQ7 A;  2UUA L;  1N32 Q;  1PYB A;  2OTL A;  2CFM A;  1YHQ A;  1AE2 A;  2QGQ A;  3ER0 A;  2ZTE A;  1A62 A;  4Y7N H;  3M85 A;  3TEH B;  3NEN A;  3M7N A;  1X6O A;  4GLV B;  5ELO A;  1CKN A;  2QEX A;  1EQR A;  4GKK Q;  1KL9 A;  2HIV A;  4APV A;  2NVY H;  1Q12 A;  4HIK A;  4DV5 L;  2YU9 H;  4DV1 L;  4K0K L;  5GQO A;  4JI6 L;  1JMC A;  3EBE A;  2JA8 H;  1BKB A;  3HOZ H;  1BVS A;  2Q2H A;  1SMX A;  2K5V A;  1QVF A;  4DR2 Q;  2N8N A;  4GKJ L;  3CP0 A;  1CSQ A;  4DR1 L;  4LFB L;  2MO1 A;  4GS3 A;  5C0X G;  4TVA B;  5C44 G;  3HOV G;  3S1Q H;  3H3V H;  2K52 A;  1V43 A;  3AFQ A;  4B3T L;  4A3M G;  4P73 A;  3CCJ A;  1JT8 A;  2PI2 A;  3F1Z A;  1BBU A;  4GNX A;  1YI2 A;  1VQ6 A;  3CD6 A;  5LMU Q;  1S72 A;  4A3E G;  4PZ6 A;  1LM0 A;  3UDX A;  3S2H H;  4BY1 G;  4JI5 Q;  3T1H L;  2UXD L;  3CPF A;  1HZB A;  1Z9F A;  1UE1 A;  2CQO A;  4L5Q A;  1NMG A;  3FKI H;  4LNQ A;  2RHQ B;  1XNQ L;  2I0Q A;  4DUY Q;  4DV2 Q;  5IT9 c;  3RLF A;  2BH2 A;  4P75 A;  3RN5 A;  2Q2T A;  1XNQ Q;  1A63 A;  3K7U C;  1K8A C;  2JEA I;  3CCL A;  4RMF A;  1Y1V H;  3T1Y L;  4IFD G;  1IZ6 A;  4YWL A;  2LSS A;  3JAM c;  1I6H H;  1C7Y A;  2JE6 I;  1HR0 W;  1C9O A;  3NBH B;  3U4Z A;  1HZC A;  2IX0 A;  3F2D A;  1N9W A;  2XGT A;  4JC0 A;  4B3S Q;  2LXJ A;  4UY8 C;  1K83 H;  4A3D G;  2F52 A;  2R7Z H;  2JA9 A;  1VQO A;  3SGI A;  3OW2 A;  3M9B A;  4GNX B;  2BA1 A;  3PUX A;  3BU2 A;  4R4T A;  1HZ9 A;  3J80 i;  1VQ5 A;  3CCV A;  4L5T A;  4BBR G;  1Z47 A;  1VQL A;  4JI7 L;  4X62 Q;  3RZD H;  2VW9 A;  3A5Z B;  2YV5 A;  2WP8 J;  3U50 C;  2VQE Q;  2R7F A;  4C2M H;  5FLX c;  4LF8 L;  2VZA A;  1IBK Q;  4LF4 L;  4BBS H;  2IHE A;  2UU9 L;  3S15 H;  1B7Y B;  1X54 A;  1HNX Q;  2RCN A;  3AFP A;  3J7Z C;  2ZM6 L;  4JV5 L;  2QA4 A;  3KJO A;  2KCM A;  4DK6 C;  4YHH Q;  3PCO B;  4NXN L;  1I94 Q;  2GVA A;  5JEA J;  4JI0 L;  5LMN L;  5IYD H;  1IYJ B;  1L2F A;  1Q46 A;  1TWG H;  2BA0 A;  4A3J G;  3H3V I;  4L5S A;  1JB7 A;  2JA5 G;  2IX1 A;  3HOX G;  3ERS X;  4LFC Q;  4A3G G;  3F2B A;  4OWX B;  5FLM G;  2UUC L;  2ZJQ A;  4DR4 L;  1SN8 A;  3RLN A;  1V9P A;  1OTC A;  4LWC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...