1WTVA

Hyperthermophile chromosomal protein sac7d single mutant m29a in complex with dna gtaattac
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
64
structure length
64
Chain Sequence
VKVKFKYKGEEKEVDTSKIKKVWRVGKAVSFTYDDNGKTGRGAVSEKDAPKELLDMLARAEREK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/dna
molecule keywords 5'-D(*GP*TP*AP*AP*TP*TP*AP*C)-3'
publication title Probing the DNA kink structure induced by the hyperthermophilic chromosomal protein Sac7d
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
total genus 14
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2004-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02294 7kD_DNA_binding 7kD DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1wtvA00
1C8CA 4R8IA 1WTRA 3LWEA 3DEOA 3H91A 4CJ1B 3SVMA 2B2VC 1X32A 1ZXTA 2RA4A 1EQTA 4ZKBB 2FMMA 3MTSA 3DM1A 2M2LA 2H1EA 2K28A 4QUCA 4X3KA 4R9WA 1WTQA 4X3SA 4DN4M 1AP0A 2B2TA 1WTVA 2RVLA 1E0BA 1NR4A 1MSGA 3HP3A 3I3CA 3DEPA 4ZLTF 4MN3A 1F9SA 1JE4A 1SSOA 4HCSA 4IUTA 1HHVA 2Q8TA 3UI2A 2RSOA 1B50A 2K1BA 2B2VA 2L1BA 4X3UA 1PDQA 1HUNA 1NAPA 1KNAA 1WD0A 1G2TA 3KUPA 3N52A 3QO2A 3TZDA 1HA6A 1SAPA 2X6GA 1ILPA 2BDNA 2EOTA 2X6LA 2HDLA 2HUGA 5AFWA 4IURA 4ZKCB 1CA6A 1G91A 1MI2A 2NZ1D 1CA5A 2MPMA 2EPBA 4CJ0B 1CM9A 1QE6A 4QUFA 1GUWA 2L4NA 1HFGA 4XDXA 1BBXC 4UAIA 1HFNA 3KBXA 2MP1A 2K05A 2FJ2A 1WTPA 1HUMA 1A15A 2RSNA 1VMPA 4IUQA 5CBEE 1WVLA 1BF4A 1NR2A 3FPUB 1DZ1A 5CBAE 1XX8A 1KNEA 1O7YA 1ILQA 2EE1A 5EQ0A 5JJZA 1M8AA 1B3AA 3IL8A 4O42A 3TN2A 1PLFA 1AZQA 3F2UA 5D14A 2NYZD 1WD1A 2HCIA 1Q3LA 2DY7A 4RA8A 3GV6A 1G2SA 1U4LA 3IFDA 5COYA 1B2TA 1J9OA 2KECA 1EOTA 1DONA 2Q8RE 2R3ZA 1DOLA 2DY8A 4HEDA 2CVRA 1NCVA 1F9RA 1J8IA 5CORA 1X3PA 1DOMA 1QG7A 2J7ZA 2KUMA 2FINB 5E4XA 2K03A 2B2YC 2KOLA 1B53A 1PFNA 1RODA 2KVMA 2D9UA 2NWGA 3I8ZA 3Q6SA 5EKIA 1DOKA 2K01A 1S4ZA 1RJTA 2B2UC 4OIKA 1PFBA 1F2LA 1PFMA 5D65A 5CMDA 1EIHA 5T1IA 4ZK9B 1EIGA 1HRJA 2X69A 2JP1A 1IKMA 1RHPA 4U68A 2MGSA 1VMCA 1AZPA 1EL0A 1B4OA 1BO0A 5DNFA 2L11A 4ZAIA 2IL8A 4HAEA 2FHTA 1U4RA 4X3TA 1TVXA 4RWSC 2B2YA 1F9PA 5EPKA 4IUPA 1MGSA 2B2WC 2FFKB 2L12A 3FDTA 3P7JA 2B2UA 1SDFA 5E4WC 1U4PA 2SDFA 1QNKA 3MWYW 4OIJA 1ESRA 1ML0D 1U4MA 2HCCA 1BNZA 3I91A 5EPJA 3R93A 4HSVA 1XYIA 1F9QA 4RAUC 4IUVA 5EJWA 4LMQD 2K04A 4NW2A 4MHEA 3ONAB 1LV9A 2B2WA 5T1GA 1WTXA 1RTNA 1WTWA 1JICA 2HDMA 2L9HA 1IKLA 1ICWA 1RTOA 2KEEA 5EPLA 2KEDA 1G6ZA 2N55A 2MJ8A 3GV3A 1MSHA 4XT1B 1WTOA 2JYOA 1O7ZA 2N88A 1X3QA 3I90A 2XIWA 4XT3B 4CJ2C 1IL8A 2B2TC 3D6WA 3G7LA 2VXWA 4IUUA 1O80A
chains in the Genus database with same CATH superfamily
2PNRC 4FVMA 1NNXA 3J81j 1HH2P 3R8BA 1CK1A 3J80L 1QUQA 1OXTA 4QJFA 1WTQA 1WI5A 2A69D 2NVQB 1WTVA 4K8JA 3J80i 3W2DA 1KAAA 4DR2Q 3LNNA 1NUCA 5IT9L 3U58A 4C1NI 1EY8A 2EXZA 3ITPA 1F2ZA 3K81C 4B9XA 3DUZA 2F0FA 1H9SA 2NN6H 2X6LA 1KAWA 3PUXA 3TQYA 1SE8A 1FNUA 2VQFL 4A93H 1QE6A 3U9SA 1HFNA 3W3AA 4B3RQ 2K05A 3JAML 3RZOH 4LF6L 3OIQA 3A8IE 4R4IA 4A3KH 1K3BC 3X3MA 3JAMi 1PH3A 5JJZA 4NPSA 1I3QH 3TN2A 1SNPA 1XNRQ 1JB3A 2QEXA 2WAQG 1YHAA 2KCMA 1EQRA 3UE0A 2DUDA 4R4CA 3W1GA 1V8QA 1PRTF 2JA9A 4H7BA 2UUCQ 1KTKA 1Y1WH 2CQAA 5G3LD 5FLXc 4HEDA 1L1OA 5JEAG 1HNZL 1TR5A 2FINB 4LJZC 2A6HC 1SMXA 1B53A 3I8ZA 4DXFA 1DYQA 2I07B 2R6GA 5EKIA 5D3IB 4A3DB 4EQOA 2E2HH 4M8AA 1X3GA 2HT1A 3SK8A 2IHEA 3UE1A 1XMOQ 4HIDA 2MGSA 1AZPA 1SJHD 2EYHA 1BO0A 5DNFA 3T1YL 2XWBB 4OX9L 3PO3B 1N36Q 4DR6Q 4A75A 1B70B 1HXYD 2D62A 4A3EH 3MWYW 4OIJA 4LF8Q 4A93B 2PQAA 3OWFA 1K0RA 1HR0Q 1PH4A 1VF7A 1PRTB 1UEBA 3TP8A 4LMQD 3HOUB 4UDUC 1PYBA 1VQMA 2F4IA 4NXMQ 1KQSA 4J1MA 1VCIA 1RTNA 2AUKA 4C3JG 5IODA 3EFXD 3LGJA 1QZGA 2M9VA 4KY7A 1PYWD 1TWHH 2Q2HA 4OEMB 3CW2C 4GOPB 5IYDG 1W3SA 2N88A 3HOZG 3EQLC 2AWOA 4KN4C 2F0EA 2Y0SB 3BS1A 1VDZA 3SVMA 2RA4A 5CV9A 3T53B 1N33Q 1AEXA 2RDHA 3SK5A 2FMMA 1STGA 2JJQA 1AP0A 3RD4A 2OTJA 5HURA 3EROA 1LABA 1X54A 2CKZB 1B50A 5C5LA 4X3UA 4N8FA 2F0GA 1VQBA 1VQ9A 1U5KA 1H9RA 1VQJA 3K58A 4PZ7A 1VQEA 3V96A 2MUYA 1DJRD 5BN3A 1B9MA 4EQPA 1BF4A 1DCZA 4HR7B 4ODGA 5ELNA 2KA7A 4UP8A 4LFAL 2F0VA 4KKSA 1STHA 3MEFA 2R61A 1BBUA 3TSSA 2VQFQ 1CKOA 2QDLA 4G57A 2RHQB 4UHVA 3K8AA 1X3PA 1DOMA 1EZ8A 1QG7A 2RDFA 4LF6Q 1EWHA 5DEHA 1PFNA 3CCVA 2NTTA 4RHRA 4R8NA 4GNXC 3Q0AA 1YITA 1GKHA 2CFMA 3CC4A 2JP1A 3NBHA 4FF1A 3NSWA 3EA6A 3L2PA 4HAEA 4YHHL 3NPPA 4KKTA 1E1TA 1F9PA 5FJ8H 5EPKA 1HNZQ 4RG1A 2HIVA 5M5WB 1EIYB 1U4PA 1GUNA 2XVSA 1D1IA 3A74A 4JG2A 4EX5A 2YU9H 1EQQA 4GN5A 3CCEA 1XWEA 1BXTA 2OWOA 1LV9A 3T1YQ 4OX9Q 4GLXA 1JWUD 2R92H 2PYKA 1N32L 5M3MB 1S5ED 4IOAA 1WCMG 1VQFA 4A3DG 1B3QA 4CHTB 3U50C 3I7FA 3PV0A 1YZ6A 3C2PA 5KYIA 1EU4A 1S5BD 1S5FD 3PIOA 1LTGD 4QF4A 3GQBA 2BH8A 1JMCA 3F2CA 1X32A 2SEBD 5FLXE 3QWNA 2A19A 4K0KL 1SNQA 3CC2A 1PA6A 2RHSB 4QIWE 1B44D 5BR8Q 4TKOB 1C0AA 1FD7D 2E5LL 1IYJB 3KF8B 2VQEL 2B2VA 2PMZE 1PDQA 2JA5G 2JA8G 1Y14B 1JORA 5CC4A 2O5IC 4YCWA 3TZDA 3J81c 4DAPA 3C1EA 2WAQE 2ASBA 2J0TD 2O4XA 2EPBA 1GUWA 4DGZA 4B3ML 2K5NA 2VB2X 4RCNA 1RKNA 5K36H 3KFUA 1VMPA 1W6JA 3FVQA 4YCUA 2F0UA 4BBSB 5HGQA 1ENFA 4A3JB 4AIMA 2AQ1B 1CHQD 1K83B 2R93B 1Y1VB 2KCCA 2OQ0A 5C3EB 3ERQA 4K8IA 5CORA 4DF7A 3G6EA 1SMYC 2WIIB 3DLLA 4F88A 2JK8A 5C4XG 1LLRD 4C56C 3MAQA 4L8JA 2V4DA 4LFAQ 4ZK9B 3G71A 2A73B 2A5HA 4KV6A 5E7NA 4X66L 2Z1CA 4DV2L 1M1KC 2B2YA 5GROA 5IYBH 2RBMA 2K33A 1SNMA 2HQLA 1SDFA 1EYGA 5ELOA 4JOIA 3PUYA 3L3OC 1A0IA 4K5VA 4HJ8A 2XRQD 3S14B 4YWKA 1GUGA 1KDBA 3CF5A 3RZDH 3H0GB 4YHHQ 2JA6H 4GKKQ 2Q8IB 4L5RC 2KEEA 4ZCKA 2A68C 3GTKB 3BDOA 2KEDA 5C0XG 2ZJRA 1KIXA 1HR0W 3WOFA 4XT1B 3FKIG 3M4OB 2WP8J 3MXNB 1ASZA 3CRLC 1EWCA 3I4MH 2JXMB 1WTRA 4BY1G 2Z9HA 3DEOA 1B7YB 1R9TB 3I4NG 3NQTA 1SFOB 1EYAA 1N32Q 1IBLL 5E1FA 4E6IA 1CTMA 3H3VC 3GD7A 2ATWA 3DWQA 2JA7H 3K7AH 3MZ5A 4N9TA 4HCSA 1G8ZD 2RSOA 2BH2A 5M3FG 4HIOA 3UDXA 3CCMA 4IQZA 1VQAA 3ZJYC 3SHLA 2QILA 5EGTA 2HDLA 2ZXPA 4ME5A 1V9PA 4K0KQ 3HKSA 4JVZA 4UAIA 1ENCA 3FEWX 4ABNA 1X9NA 1JWMD 5CBEE 1PXUA 2E5LQ 3GTGH 2I46A 2VQEQ 2JEBI 3STBC 3I4OA 1B3AA 4IN3A 5CV5A 3U4ZA 2EYFA 2Q2TA 1BDOA 3E0JA 3NTKA 4L5SA 2ICIA 5M5XB 3EJIA 2Q8RE 4B3MQ 4BBRG 3BZDB 4JBKA 2TSSA 1OXUA 2MNAA 2Q2IA 1TY0A 1SNCA 2NVYH 5JPMC 3FMCA 3MA2B 1S4ZA 2VY3A 1NBWA 1D2BA 2M00A 5J39A 1LTSD 1PRTC 2X69A 3MEHA 1STYA 1AW7A 1NE3A 4P73A 3KJPA 1A63A 2N49A 1TVXA 1MGSA 5CYUA 4K2KA 3GTJB 4OL7A 1QVGA 1VQNA 2VB3X 3NENA 4JI3L 3BDLA 1FNVA 3VA7A 4IFDJ 1HJPA 1YNJC 2ENBA 4A3JG 4C3IB 2K04A 3J81E 4MHEA 1SRUA 4X66Q 2NUCA 4DV2Q 5C3EG 2XN9C 1ET6A 2K7VA 4CDFC 5IGBA 1G6ZA 4A3CG 1Y8OB 1MSHA 2BDOA 1SE3A 2JSOA 3AQQA 1N8RC 4DAVA 1HNWL 1Y8PB 1STNA 4JI8L 1VQLA 3CCLA 2E2JB 1EIFA 1KHIA 2F0DA 4GNXB 4PQXA 4ZKBB 5IGCA 1NR4A 2BA1A 4XXEA 1JE4A 1SSOA 2EY2A 3NHHA 4K6LA 4QIWB 2WV6D 1SYFA 2L1BA 1I6HH 4KY5A 3CC7A 1HQMC 4IJLA 2K32A 4JI5L 2PZUA 3SE0A 3KBGA 2O5JC 2A6EC 3W1BA 2IWHA 3C46A 4X6AH 3H0GG 5KYLA 3DMUA 2PMZB 3GTLB 4CKBA 5IP7H 1IBLQ 4IURA 3PCOB 1K8GA 5ELCA 1GUTA 2QW7A 3PQIA 2WAQB 1PH6A 4POGA 1PZID 3HOYH 4OWXB 2RSNA 1A15A 4IFDG 1C4QA 4NDXA 2C5CA 1XTCD 4B3SL 1F2MA 1GVPA 1TWFH 1X3EA 1EY9A 3E0EA 2LSSA 1BCPD 1EYCA 5IYDH 3S1QH 3S1MH 1H9MA 2BE5C 4G4KA 1PTOC 2KENA 3AU7A 5CGKA 1FJGQ 1J9OA 1JR0D 3CP0A 3HEJA 1VQ8A 1JT8A 1XNRL 2EY6A 3GTQB 1CKMA 1NCVA 1H9JA 1VQKA 4DPGA 1D7QA 2K03A 4QQBX 3ER0A 4LUVA 1ZEQX 3KK7A 3ULPA 1EIHA 1TWAB 4LW1A 1I50B 4DNRB 4A3BB 2KCNA 2FHTA 4MNOA 2EDGA 5KNCA 4IUPA 4IFDI 2YV5A 4C3JB 3R93A 5C3WA 1QVFA 1HPCA 4R1JA 2NVTB 3S15H 1JC7A 2XWJB 4P2CB 2F0KA 4OHJA 4GZYC 5I2YA 3HOZB 2IJ0A 1CSQA 1OXXK 4JI6Q 4A3GG 1SNDA 2IX0A 1PH7A 4LF9L 1RL2A 4PZ8A 1LT6D 1V1PB 4JI3Q 1JOKA 2NVQH 2QF7A 3HOWG 1YJ9A 3GTPB 2F0PA 3HGBA 3OTOL 1B8AA 1C8CA 2E75C 3K5LA 2IX3A 4RHSA 1J5EL 5L37A 4OWWB 3BDCA 2GVAA 3NWSA 2OTLA 3K6OA 3SK6A 2H1EA 3P1HA 3PIO3 4X3KA 1EY7A 3H3VH 3VYSA 1MSGA 4Y7NB 1JJ2A 3K5OA 3S1NB 3J7AF 1YNXA 4OELB 1X55A 2J4XA 3S2DB 2PI2A 1HNWQ 5FO8B 1HNXL 1QILA 5CV4A 4JI8Q 3CCJA 4C3IG 1KNAA 1G2TA 4FP5D 4LF4L 4FDBA 1ILPA 4DU9A 1VQIA 3E6ZX 3NUCA 2WB1G 4QUFA 3K5NA 3W5OA 1HZCA 4FXKC 1Q12A 1MHWC 4A3DH 4JI5Q 2P5ZX 3U4VA 2UXDL 4KD3A 4R4TA 1B2TA 4Z9CB 2KECA 1SN8A 4CBVA 3UDFA 1D6EC 1IYUA 4ME3A 3PO3H 1AFPA 1LT3D 1J8IA 5FO9B 2F4VL 2HHHQ 2J7ZA 5E4XA 4O0AA 1J6QA 4B3SQ 3HOXB 4X65L 4A3LG 1E2WA 2Z4HA 5CMDA 2ZM6L 3OMCA 2BA0A 3G48A 4RKLA 4GOPA 3HOUH 3I4LA 3TZUA 1QB5D 1LM0A 2AQ3B 4X3TA 1SEBD 1T5EA 4X64L 2IPKD 2B2UA 1FGUA 2R7FA 2MHVA 1IBKL 1EU3A 1JOQA 4BY7B 3I91A 4N9PA 1A8VA 2IX1A 2B63G 1WCMB 2F3IA 1R4QB 3E5SA 1TWCB 2R7ZB 2EJGC 3TS2A 2E74C 1WTHA 2K5QA 1MKHA 4MTNA 1H9KA 4BXXH 1S3OA 2R7DA 2RDGA 3S1RB 1K3RA 1T5XD 4XT3B 4DR3L 2Z6KA 4UP7A 1CKNB 2PZTA 3U9OA 1XTDA 4A3BG 1A62A 1AE3A 3GTOB 1HZBA 3H91A 3URYA 4PZ6A 3Q23A 4LF9Q 4HJ5A 1FGBD 2JA5B 5I2XA 3MTSA 3I55A 1CZWA 4IPDA 2CWPA 2JA8B 2C35B 1PH1A 2B2TA 3A56A 3L0OA 2AUJD 4C3HG 1VQOA 3A8KE 1F77A 4I7ZC 5C4JB 3OTOQ 3NBIA 5BR8L 1Z6HA 4L63B 1V1QA 4JCVE 5C5MA 2CH4W 1XPRA 1WD0A 5E3FA 1J5EQ 4POFA 3SDZA 2BDNA 2EOTA 4WJ4A 1CA6A 3JAMc 1CZGA 1P16A 1TY2A 5IGEA 4GKJL 4YY3Q 4IALA 5C0XH 1L0WA 3FPUB 1EZ6A 1HNXQ 4JPBW 4NMZA 1O78A 2EE1A 1AZQA 3FKIH 3Q8DA 4DV4L 2K50A 2CW0C 2NZHA 4KK7A 4LF4Q 5C4XB 4RA8A 1SBBB 2DY7A 4A76A 2CH4A 4LUZA 3IFDA 4O1NA 2BOSA 1PZKD 1DONA 3KF6B 3C1FA 2TMPA 4I7AA 3S9WA 1F9RA 1YVCA 3OW7A 2JN4A 2HD3A 5M5WH 1PTOF 1KL9A 3NEMA 4RGTA 4ZYSA 1LTID 4FF4A 2UXDQ 4PMWA 4OIKA 2O2LD 3R2TA 4RCOA 5T1IA 5A35A 5ELFA 1LUZA 2A69C 2UU9L 3K57A 4DAYB 4OO1H 2KHJA 3S24A 2F4VQ 5M3MH 4X65Q 5IYCG 5JJIA 1ET9A 1RIPA 4QY7A 4P72A 2ZM6Q 2JEAI 3A7LA 4EQNA 2DJGC 3D4DA 1P8LA 3FKIB 3KF8A 2F3VA 5IOCA 2D0OA 1VQ7A 4X64Q 2MO1A 4IPCA 2GA4B 5FLMG 3AYHB 1PTOB 4WORA 1T9HA 1IBKQ 4BY1B 3HOXG 3I4NB 2VUMB 4B08A 1SNOA 4K6DA 3T51B 2MJ8A 2B39A 4DV5L 4GKKL 3HG9A 4LNQA 3R3OA 4HTHA 1EFWA 4TQUS 4EGVA 2PNHA 4OWTB 1LT4D 3J81L 3A54A 3J7AV 1PVOA 3OW2A 5M3FB 3J81i 2A1AA 4JI7L 4I65A 4DK0A 4IPHA 1GJXA 1Q90A 2WB1E 1YHBA 5KIXA 2RVLA 1E0BA 2G9DA 4ZLTF 2RCFA 1HHVA 4BY7G 3SEBA 3QG1A 2I0QA 3GDEA 3M3YB 3EIVA 4DR3Q 1D1KA 1FVIA 1UNSA 1ASYA 2KHSA 2AWNA 4LF7Q 4BBSH 3PO2B 5GADC 1NAPA 2R7ZG 4A3JH 4XQQA 3CQZB 3QO2A 4KD4A 1F2YA 1K83H 1UE6A 4FO2A 2R93H 1NMGA 4KKUA 1PZJD 1Y1VH 1CM9A 3LX0A 1K8OA 5C3EH 2F0WA 1G51A 1WVLA 3J7A5 3FHWA 2FMCA 1Q8KA 4IPGA 4BBRB 4A3CH 1XX8A 4K2LA 5D14A 3PUZA 1Q46A 1GHKA 3GV6A 3OOCA 4IOCA 4LF5L 2DY8A 1I4PA 4GKJQ 2A74C 1E24A 1YJNA 2NN6G 3DXJC 5IGDA 5EQ0A 1IW7D 3M4PA 1ICFB 1DOKA 1YI2A 1HTLD 4KHPL 1A2TA 5D65A 4DV4Q 3TDQA 3J7YW 3PO2G 2PZWA 4DK6C 3CCSA 1RHPA 3S14H 1Q81C 2F0LA 3H0GH 3PUVA 4A3KG 3FP9A 5NUCA 5IT9E 3K0XA 1E2ZA 3PIPA 1JWSD 3GTKH 1BCPF 3M9BA 5C6AA 3UDIA 3CKIB 3PF4A 1BVSA 1O7LA 2N3SA 3RLNA 2VL6A 3ND9A 1RCVD 3M4OH 3SR1A 2UU9Q 3I2ZA 3S17B 2E2IB 1L0YB 4V0BA 1SJED 4YWLA 3JAME 1R9TH 2B8GA 4AQYL 1WFQA 1WTWA 1SFOH 2HDMA 2K4KA 5EPLA 2NN6I 5IGFA 5KEEA 1RF2D 1HCZA 2XNAC 1UWVA 3QOLA 4DA2A 5AJ3L 2K52A 4H13C 5GAEC 1IL8A 5CV8A 3AFQA 5J1ZA 4LAAA 1YEZA 4A3MB 1K0SA 1W6KA 1BOSA 1ZYRC 3EVQA 4A3EG 5EBDA 5FK9C 2EYMA 5LMUL 1BCPB 4QUCA 2OQKA 2E76C 4DV5Q 3ZYYX 4NP5A 2F0MA 3RN2A 5IWAL 4LFCL 1V43A 3HS0C 3HZXA 2N78A 4JW0A 3K5MA 5KRUA 1EOVA 3KUPA 4DR5L 4Y52H 1HA6A 3KDFB 4JI7Q 4UY8C 2QA4A 1HZAA 1MI2A 1GUSA 3N6RA 5M5XH 5DM73 1HFGA 2VUMG 3KBXA 3VR4A 3HRZC 4IUQA 3V2TA 2B29A 4KJOA 3RLOA 1QNUA 4CKEA 1TIID 3KJOA 2I5MX 4MTKA 1ONLA 3NTIA 2K5DA 1IL2A 1QJOA 5JOBA 4DV6L 1DOLA 4J8QA 1FJGL 2ZXOA 2I5LX 1CQFA 3GTJH 1UE5A 3VR3A 4APVA 2VS1A 2ZJPA 1Q8IA 4A3FB 3VR2A 2HIXA 4J15A 3WWVA 3GO5A 4C3IH 3VYRA 3G4SA 2L11A 4DR7L 4LF5Q 4KHZA 3Q22A 5J3BA 2B2WC 3P7JA 2RF4A 4FF3A 4GNXA 4XTCS 4A3GB 2EXDA 4KHPQ 2IT1A 2F0QA 2K14A 3CCQA 5C3XA 3HOWB 2E2JH 2ALYB 5JVG3 1KLGD 5T1GA 1BBWA 2EJMA 1TKWB 4C2MB 1HQRD 3MXPA 3H15A 2L9HA 3I72A 2IY5B 2ZT9C 3A5ZB 5DLQE 1MBYA 4JI6L 1VQ4A 2G9HD 2JYOA 4DAMA 1ZKOA 2XIWA 5FJ8G 1KRTA 3G6JB 3QJYA 4AQYQ 1KD1C 1SROA 1AH9A 2EVBA 1EEID 3GTLH 2F0NA 1SLJA 2BCOA 2K28A 5G3LF 4DN4M 4HJAA 1LT5D 3P75A 1Z47A 3OYYA 5AJ3Q 1C48A 2WB1B 3P20A 3S2HB 1EEFD 5JEAH 3RN5A 2X6GA 3CCRA 3IFTA 5LMUQ 1E1OA 4ZKCB 1JB7A 1CA5A 2NVXB 3OIPA 1YHQA 1BBXC 1U9RA 1EUJA 3GTQH 1JQYD 3HOVG 1VQCA 4ZUIA 3PMFA 4UP9A 1HZ9A 1L1OC 5IWAQ 4LFCQ 1ILQA 2Z6BA 2CHBD 4RKBA 3IL8A 4A3MG 1PLFA 4DR5Q 1TWAH 1NSNS 2QDBA 1Q3LA 2NZOA 1Z9FA 1G2SA 1I50H 4DXGA 2MFIA 3QB3A 4YCVA 4A3BH 1HA5A 3UDGA 3Q24A 1ESFA 2F1MA 4PMCA 4HSPA 4C3JH 2EYPA 4B3TL 1V1PA 1I5FA 1OXSC 2HHHL 4JBMA 2NVTH 1TQOA 1XPOA 3QIAA 4ILWA 2ZXRA 5K36G 4WJ3M 4MZ9A 1VQ5A 3V05A 3HOZH 4DV6Q 1X65A 2B63B 3H09A 3CAMA 3T16A 2DJFC 2L12A 4KJNA 2Y0SE 3RR5A 2RKSA 5EPJA 3GTPH 4HSVA 1A3TA 4JI0L 3KYHC 3K80C 4IUVA 5JJKA 4DR7Q 5GAHC 4EVOA 4RMFA 4V190 3K7UC 1UAPA 2K6AA 4H0LC 1ICWA 5BN5A 1C7YA 4LWCA 2N55A 4Y7NH 1WTOA 3NK9A 4ID6A 3S1NH 2XRSD 5I9OA 3M7GA 1QWYA 3QOJA 1K9MC 3D6WA 5C4ZA 3S2DH 3O13A 4A3FG 1FL0A 3BJUA 4CDEC 4R8IA 4C3HB 4KLKA 2A6HD 4ULLA 1ZXTA 2NTSA 2GN5A 5A2QE 1VF5C 5KNBA 1O7IA 2PQEA 1XPUA 2M2LA 4X3SA 4CDDC 2F0JA 4NXNL 5EAYA 1CT1D 4PV1C 5IGGA 1DD2A 4QMGA 3F1ZA 5C44B 2NZ1D 3T1HL 4JV5L 1X6OA 3D31A 1GM5A 3I4MG 1HUMA 3E9IA 2Z4IA 1KC8C 3HOXH 3A0JA 1GUOA 2E2DC 1Q1BA 2NBFA 4A3IB 4YY3L 1CQVA 2K5HA 1IYVA 1EY0A 4CDCC 2EQSA 3T56B 1K73C 3PGZA 5I6YA 1STEA 5M5YB 2QEJC 5FLXL 1TWGB 1PH9A 2KVMA 3GTMB 2PO4A 1N9WA 1RJTA 3DWAA 5JAVA 4BY7H 3ND8A 3A7AB 1WCMH 1VMCA 1EL0A 3MFGA 1B4OA 1TWCH 2R7ZH 1TXYA 2IL8A 5LMNW 1CKNA 1DGSA 4UPAA 3WOEA 5JEAJ 4P75A 3OSOA 1A3UA 1U0LA 2EZVA 3MXUA 4FXGC 4YIJA 1ML0D 1Q86C 2HCCA 2AHOB 4B3TQ 3S1RH 1TS3A 3PIP3 3AFPA 4H44C 4KTAA 5EJWA 4DK3C 2VZAA 4RGOS 4O2DA 4DUZL 3S16B 3L7ZC 1WTXA 3GTOH 5IP9G 4X62L 4YWMA 3MFYA 1BCPC 1K8MA 2F03A 1RTOA 1XXGA 3SK4A 2JA5H 2JA8H 3ICEA 2L55A 3D4WA 1LTRD 5M9OA 4HJ7A 4JI0Q 3KLSA 3I56A 3BZCA 2DGYA 3CU7A 2HQEA 5C4JH 2NB0A 5JPNC 4H02A 3PO2H 2B2VC 2L0CA 3EBEA 1S40A 3DM1A 1A6XA 4XYQA 3KLRA 2WKCA 3TP7A 1B9NA 1A3VA 2ZTEA 5IE8A 4IO9A 1Y8NB 4IUTA 1I4HA 3KF6A 2EIFA 3H94A 2MO0A 3MVVA 4ALPA 3VR5A 1QZHA 4JK1C 3WDNA 1HUNA 4HMIA 3NWTA 1OXVA 2WINB 4S3SA 3TP6A 5C4XH 3MC0B 1Y69U 4LF7L 4QL5A 2ICEC 3J80c 4NXNQ 2H4OA 1W2BA 3NTHA 4DR1L 1WTPA 4DAYA 2EYOA 4JC0A 4EQ5A 5IT9c 3RNUA 2I5HA 3BYYB 1DXMA 4GS3A 1QUQB 2SOBA 5DM63 1YNNC 1U4LA 1V1OA 1CUKA 3OWEB 3T1HQ 1LTAD 4JV5Q 2D5DA 1AE2A 1I6VC 1LO5D 4R4QA 1PH5A 3RZOB 1VQ6A 3IKJA 5D3DA 1K28A 2B2YC 4A3KB 3BZKA 1H9SB 2D9UA 3Q6SA 5IP7G 2WACA 4DV1L 1PHJA 1I3QB 3I73A 1F2LA 1KRSA 4DUYL 3HOYG 4OXPA 4JOIC 1LTBD 1Q7YC 5HGTA 1FYCA 4ZAIA 2F0IA 5CR3A 5C44G 1Y1WB 4GLAC 4IJHA 3HKZE 3FDTA 1PTOH 2SDFA 4BS9A 2CWAA 3F8TA 4BY1H 5CV6A 3A5UA 2VUMH 2QGQA 3I4NH 4DV0L 5ELEA 1BNZA 4AYBG 2L15A 4DV3L 4A3IG 2E2HB 1EY5A 3D6CA 3NXWA 2D2CC 4DV7L 1SR3A 1FNWA 1L1OB 1M90C 5H1SE 1E2VA 1XMQL 4HCEA 5M3FH 3CPWA 1KABA 1II3A 4A3EB 1H95A 3E3XA 4TVAB 3GV3A 1JE5A 1TS5A 1O7ZA 1X3QA 4K5WA 1FR3A 4HIKA 3M3YH 5I4DA 4DR4L 4JI1L 1SMYD 4DUZQ 3LWEA 2AKWB 1LTTD 4X62Q 3CQZH 5TSSA 1PMRA 2PQAB 1I94L 2B8FA 1TWHB 1VQGA 2ES2A 1L2FA 4C1NK 3HP3A 3DEPA 1GD7A 3AMUA 2EY1A 1NJIC 4BA1I 1D8LA 4BBRH 2LMCB 2Z0SA 3TBIB 3AEVA 1YBYA 2WKDA 4ZUJA 3RLFA 1ZYRD 5I6WA 3T13A 3TS0A 1G291 2E8GA 1TS2A 1LYLA 1S72A 4L6TB 2EJFC 1I4RA 3TP5A 4DFAA 3CMEA 2G5DA 1CFMA 1JCKB 2A68D 4JI4L 1EFID 2HCIA 5I9PA 4QB4A 2F52A 3NE5B 3M4YA 4KHVA 3KLSX 5COYA 5C4HA 5JJLA 3DM3A 4KI0A 4CKCA 4DR1Q 4RH6A 3D4RA 4WJWA 3BYTB 1EY6A 2NWGA 1RODA 5HY6A 1WOCA 4HIMA 1HRJA 5LMNL 2FXQA 3NP8A 3VDYA 2KJXA 3S17H 2E2IH 1U4RA 2EYLA 4L5QA 4PMBA 5E4WC 2FFKB 2F0HA 1IHZA 1VQPA 4F8MA 4DV1Q 1U4MA 3HOVH 2VNUD 1GXDC 3KOJA 1NY4A 1XYIA 2XTIA 4RAUC 4DUYQ 2ID0A 3PO3G 3H3VI 1S5CD 5K5PA 3VYUA 3ONAB 4A3MH 1SYGA 2ZTCA 4A93G 2YTXA 4DNTB 3J80E 3STBD 1IKLA 2OEOA 2OF1A 3EN2A 3KDFA 1CSPA 3MXNA 4DV0Q 3HOUG 3NBHB 2YU9B 4DV3Q 2YTVA 4JYAL 1KXLA 3I90A 4DV7Q 4ZQ3A 3R2IA 1ENAA 5F2DA 1PYSB 2VXWA 4K5XA 1M8AA 1X56A 2R92B 4IFDH 3BVMA 5EBCA 1XMQQ 5J22A 1Y1WG 5FOBB 3PUWA 4TSSA 1GO3E 1SYBA 3FRPB 1MJCA 2LS01 5C0XJ 2UUAL 1PRTD 1GOZA 5ELDA 2YYZA 3BG3A 2KCTA 1Q82C 4KMUC 2D0PA 4MN3A 2Y0SG 4DR4Q 2Q8TA 4JI1Q 3UI2A 1JJGA 2K1BA 2UUBL 1MIUA 3HOVB 4BXXG 3VA5A 3N52A 1TU2B 1SAPA 3BVZA 1I94Q 3A55A 5A2QL 5AFWA 1G91A 1IBML 2UXBL 1YNJD 2MPMA 3X3NA 4CJ0B 2L4NA 2C9OA 4XDXA 4B9WA 4P74A 1DM0B 1NR2A 4A4IA 3CMAA 1XJVA 4K14A 1QVCA 1RDPD 3LWUA 4QCLA 4LK1C 1M4VA 1L0XB 1G6PA 3TRZA 2RQXA 3TREA 3NELA 4A3FH 3PF5A 3SGIA 1TT2A 2CQOA 3CD6A 2OT2A 1E3PA 2Z8LA 4BA2I 1NMFA 3MHBA 3CCUA 2F0TA 3OMGA 3F2DA 2A8VA 2KOLA 4FF2A 3M85A 4A3GH 5CV7A 1IZ6A 1RD9D 2JQOA 4JI4Q 4AYBE 1EIGA 4FXDA 5EKKA 3BU2A 4U68A 3HOWH 3F2BA 1UUPA 1MJEA 1N34L 4Q0FA 1SYEA 4RWSC 5JVH3 4C2MH 5FO7B 3VR6A 2A6ED 1JOOA 1BKBA 3HKZB 2IW3A 1AN8A 2K5WA 4DNIA 5GAGC 1F9QA 1PFSA 5LMNQ 1D5MC 5LL6S 4FNFA 4JBWA 4WFN3 1OTCA 1VS0A 2EY5A 1Q1EA 4XQJA 1JICA 4HJ9A 1SXTA 3M4QA 2BE5D 2LY7A 1EY4A 2JE6I 1PTOD 2UXCL 3D3RA 2KBNA 4G7ZC 2F0OA 1UE1A 1B1ZA 5BN4A 4OO1G 3S2HH 2XGTA 1XNQL 2LFNA 3J7ZC 5C0XI 5M3MG 3RZDB 1WYDA 4CGYB 2JA6B 4CJ1B 1IW7C 3I70A 3AB9A 3DHQA 1EQTA 2B3GA 4JI2L 1EWIA 4HN7A 4N8X1 1SE4A 1LACA 3K0YA 2NVXH 4J6HA 4LUOA 4JYAQ 2OCEA 1F9SA 5KNDA 2LKVA 1HTPA 1STBA 3I4MB 2GVBA 1S5DD 2K5VA 4G7HC 1CHPD 3OPOA 1I4XA 4A3LH 4LFBL 4RFBA 2UUAQ 3C3LA 3HFZB 5IP9H 1SYCA 2AMCB 5FKAC 5IY0A 2DNCA 4F7XA 2JA7B 2FJ2A 3K7AB 4IZ8A 3T4AC 4GLVB 4OO1I 1K8AC 1JJCB 3GP7A 5CBAE 3L9AX 2UUBQ 4IUNA 1KNEA 1O7YA 3QR8A 4RGMA 1QOHA 4QGUA 2NYZD 2R92G 4XQNA 1KDCA 2PI2E 1IBMQ 2UXBQ 3K59A 3DWPA 2LXJA 2R3ZA 4GOPC 4GN4B 2B63H 2CVRA 4BBSG 4KY6A 3GTGB 4BWGB 1D5XC 1D5ZC 5GQOA 2R93G 2B2UC 5DAUA 3FPPA 1PFMA 1Y1VG 2SNSA 2F0SA 1IKMA 1EYDA 3RMHA 1YIJA 2NVYB 1QNKA 2ZJQA 1ESRA 2L5TA 3ULJA 1GHJA 1QCBD 4NW2A 4L5TA 1PV4A 4XIGS 1SE2A 1N34Q 4C3HH 3D0FA 2Z6KC 2V1CC 1Z7TA 1A2UA 1UE7A 1R4PB 1KDAA 4R4OA 4DR2L 5IIFA 4CJ2C 2B2TC 3G7LA 4NB3A 4IUUA 4NKLA 2QCPX 5KGUA 4P71A 4DK1A 2Q2UA 1PH2A 3JC66 1TS4A 2RCNA 2CCZA 5C44H 1I4GA 1I4QA 1BQQT 3E9HA 1BUVT 1C9OA 4R9WA 5ISRA 2UXCQ 3I3CA 4B3RL 3HKZG 4MIUA 2K75A 1XNQQ 3TMEA 2VW9A 4A3IH 1VQDA 4U673 3MXGA 3PSIA 3CPFA 1WJJA 5IYBG 4JI2Q 3CXCA 2HUGA 4TRDA 5LHY1 2UUCL 1YJWA 1CI3M 1EQVA 2MP1A 4WRDA 5M5YH 1IXRA 1TWGH 2PCFB 2QKIC 3SXHA 1DZ1A 1I6HB 3IAYA 3GTMH 1UEAB 4O42A 3F2UA 3CRKC 5IYCH 1WD1A 1OO9B 2JA6G 4LFBQ 1E22A 1XMOL 3M7NA 2WFWA 1EOTA 2DN8A 3B6YA 4KN7C 3HOYB 3KLWA 1N36L 2PW7A 4DR6L 2OXPA 2KUMA 4Q5VA 4ZRZA 2YTYA 1TWFB 3ERSX 4LF8L 2PW5A 1BR9A 2K01A 5FLMH 3S1QB 1PFBA 3S1MB 2EYJA 1HR0L 4M1UB 3H6MA 4PG3A 4RGNA 2KQ3A 2IHFA 3VYTA 4F87A 4AYBB 1SYDA 4JBJA 4FYDA 1YNND 4OGQC 4NXML 3S16H 3NQIA 3D8GA 2H5XA 3A8JE 2JA7G 1PH8A 2SNMA 1VQHA 1NTGA 1LTLA 3OHXC 4AH6A 2KHIA 4PNYA 3TEHB 2MQHA 3ULLA 4DKAC 2DNEA 2B2WA 1X3FA 2ZTDA 4G7OC 3IRBA 2XSCA 3RUZA 4HMJA 1STAA 1N33L 4GN3B 1MD2D 3CHBD 5EKLA 5LL6X 2CW0D 2AQ2B 4OONA 2N8NA 3BVGA 5ELBA 1E7ZA 2PPBC 3S15B 1KLUD 2LXKA 4XYOA 2F3WA 1O80A
chains in the Genus database with same CATH topology
2PNRC 4FVMA 3R8BA 1CK1A 3J80L 1OXTA 1WTQA 2NVQB 2A69D 1WTVA 4K8JA 3W2DA 1KAAA 3LNNA 1NUCA 5IT9L 4C1NI 1EY8A 2EXZA 3ITPA 1F2ZA 4B9XA 3DUZA 2F0FA 1H9SA 2NN6H 2X6LA 3PUXA 1FNUA 1QE6A 3U9SA 1HFNA 3W3AA 2K05A 3JAML 3OIQA 3A8IE 3X3MA 5JJZA 3TN2A 1SNPA 1JB3A 1V8QA 1PRTF 4H7BA 1KTKA 2CQAA 5G3LD 4HEDA 5JEAG 1TR5A 2FINB 4LJZC 2A6HC 3I8ZA 1B53A 4DXFA 1DYQA 2I07B 2R6GA 5EKIA 5D3IB 4A3DB 4EQOA 4M8AA 3SK8A 2MGSA 1AZPA 1SJHD 2EYHA 1BO0A 5DNFA 2XWBB 3PO3B 1HXYD 2D62A 4A93B 3MWYW 4OIJA 3OWFA 1VF7A 1PRTB 3TP8A 3HOUB 4LMQD 4UDUC 2F4IA 4J1MA 1VCIA 1RTNA 2AUKA 4C3JG 5IODA 3EFXD 2M9VA 4KY7A 1PYWD 2N88A 3EQLC 2AWOA 4KN4C 2F0EA 2Y0SB 3BS1A 1VDZA 3SVMA 2RA4A 5CV9A 3T53B 1AEXA 2RDHA 3SK5A 2FMMA 1STGA 1AP0A 3RD4A 5HURA 3EROA 1LABA 1B50A 5C5LA 4X3UA 2F0GA 1H9RA 3K58A 3V96A 2MUYA 1DJRD 5BN3A 1B9MA 4EQPA 1BF4A 1DCZA 4HR7B 4ODGA 2KA7A 2F0VA 4KKSA 1STHA 2R61A 3TSSA 4G57A 1X3PA 1DOMA 1EZ8A 1QG7A 2RDFA 1EWHA 5DEHA 1PFNA 2NTTA 4RHRA 4R8NA 3Q0AA 2JP1A 3NBHA 4FF1A 3NSWA 3EA6A 4HAEA 3NPPA 4KKTA 1F9PA 5EPKA 5M5WB 1U4PA 1GUNA 2XVSA 1D1IA 1XWEA 1BXTA 1LV9A 1JWUD 2PYKA 5M3MB 1S5ED 4CHTB 3PV0A 3C2PA 5KYIA 1EU4A 1S5BD 1S5FD 1LTGD 4QF4A 3GQBA 1X32A 2SEBD 5FLXE 3QWNA 1SNQA 1B44D 4TKOB 1FD7D 2B2VA 1PDQA 1JORA 5CC4A 2O5IC 3TZDA 4DAPA 3C1EA 2J0TD 2O4XA 2EPBA 1GUWA 4DGZA 2VB2X 4RCNA 1RKNA 5K36H 1VMPA 1W6JA 3FVQA 2F0UA 4BBSB 1ENFA 4A3JB 2AQ1B 1CHQD 1K83B 2R93B 1Y1VB 2KCCA 5C3EB 3ERQA 4K8IA 5CORA 4DF7A 1SMYC 2WIIB 4F88A 1LLRD 4C56C 3MAQA 4L8JA 2V4DA 4ZK9B 2A73B 2A5HA 4KV6A 2Z1CA 2B2YA 2RBMA 2K33A 1SNMA 1SDFA 3PUYA 3L3OC 4K5VA 2XRQD 3S14B 1GUGA 1KDBA 3H0GB 2Q8IB 2KEEA 2A68C 3GTKB 3BDOA 2KEDA 5C0XG 3WOFA 4XT1B 3M4OB 2WP8J 3CRLC 1EWCA 2JXMB 1WTRA 3DEOA 1R9TB 3NQTA 1SFOB 1EYAA 5E1FA 4E6IA 1CTMA 3H3VC 3GD7A 3DWQA 3MZ5A 4N9TA 4HCSA 1G8ZD 2RSOA 4IQZA 3SHLA 2QILA 5EGTA 2HDLA 2ZXPA 4ME5A 4UAIA 1ENCA 3FEWX 4ABNA 1JWMD 5CBEE 1PXUA 2I46A 2JEBI 1B3AA 4IN3A 5CV5A 2EYFA 1BDOA 3E0JA 3NTKA 2ICIA 5M5XB 3EJIA 2Q8RE 3BZDB 2TSSA 1OXUA 1TY0A 1SNCA 5JPMC 3FMCA 3MA2B 1S4ZA 1D2BA 2M00A 5J39A 1LTSD 1PRTC 2X69A 3MEHA 1STYA 1AW7A 1TVXA 1MGSA 5CYUA 4K2KA 3GTJB 4OL7A 2VB3X 3BDLA 1FNVA 3VA7A 4IFDJ 1YNJC 2ENBA 4C3IB 2K04A 3J81E 4MHEA 2NUCA 2XN9C 1ET6A 2K7VA 5IGBA 1G6ZA 1Y8OB 1MSHA 2BDOA 1SE3A 2JSOA 4DAVA 1Y8PB 1STNA 2E2JB 2F0DA 4PQXA 4ZKBB 5IGCA 1NR4A 2BA1A 4XXEA 1JE4A 1SSOA 2EY2A 3NHHA 4K6LA 4QIWB 2WV6D 1SYFA 2L1BA 4KY5A 1HQMC 2K32A 3SE0A 2PZUA 2O5JC 3KBGA 2A6EC 2IWHA 3C46A 5KYLA 3DMUA 2PMZB 3GTLB 4CKBA 4IURA 5ELCA 1GUTA 2WAQB 1PZID 2RSNA 1A15A 4IFDG 1C4QA 4NDXA 2C5CA 1XTCD 1F2MA 1EY9A 1BCPD 1EYCA 1H9MA 2BE5C 4G4KA 1PTOC 3AU7A 5CGKA 1J9OA 1JR0D 3HEJA 2EY6A 3GTQB 1NCVA 1H9JA 2K03A 1ZEQX 3KK7A 1EIHA 1TWAB 1I50B 4DNRB 4A3BB 2KCNA 2FHTA 2EDGA 5KNCA 4IUPA 4IFDI 4C3JB 3R93A 5C3WA 1HPCA 2NVTB 1JC7A 2XWJB 4P2CB 2F0KA 4OHJA 4GZYC 5I2YA 3HOZB 2IJ0A 1OXXK 1SNDA 2IX0A 1LT6D 1V1PB 1JOKA 2QF7A 3GTPB 2F0PA 3HGBA 1C8CA 2E75C 3K5LA 2IX3A 4RHSA 3BDCA 3NWSA 3K6OA 3SK6A 2H1EA 3P1HA 3PIO3 4X3KA 1EY7A 3VYSA 1MSGA 4Y7NB 3K5OA 3S1NB 3J7AF 2J4XA 3S2DB 5FO8B 1QILA 5CV4A 4C3IG 1KNAA 1G2TA 4FP5D 1ILPA 4DU9A 3E6ZX 3NUCA 4QUFA 3K5NA 4FXKC 1Q12A 4KD3A 1B2TA 4Z9CB 2KECA 4CBVA 1D6EC 1IYUA 1AFPA 1LT3D 1J8IA 5FO9B 5E4XA 2J7ZA 3HOXB 1E2WA 2Z4HA 5CMDA 3OMCA 2BA0A 4RKLA 3I4LA 3TZUA 1QB5D 2AQ3B 4X3TA 1SEBD 1T5EA 2IPKD 2B2UA 2MHVA 1EU3A 1JOQA 4BY7B 3I91A 4N9PA 2IX1A 1WCMB 1R4QB 3E5SA 1TWCB 2R7ZB 2EJGC 2E74C 2K5QA 1H9KA 2RDGA 3S1RB 1T5XD 4XT3B 2PZTA 3U9OA 3GTOB 3H91A 3URYA 3Q23A 1FGBD 2JA5B 5I2XA 3MTSA 2JA8B 1CZWA 2B2TA 3A56A 2AUJD 4C3HG 3A8KE 1F77A 4I7ZC 5C4JB 3NBIA 1Z6HA 4L63B 5C5MA 3PO2B 1WD0A 5E3FA 3SDZA 2BDNA 2EOTA 1CA6A 1CZGA 1TY2A 5IGEA 4IALA 5C0XH 3FPUB 1EZ6A 4NMZA 1O78A 2EE1A 1AZQA 4KK7A 2CW0C 5C4XB 4RA8A 1SBBB 2DY7A 4O1NA 3IFDA 2BOSA 1PZKD 1DONA 3C1FA 2TMPA 3S9WA 1F9RA 3OW7A 1PTOF 4RGTA 4ZYSA 1LTID 4FF4A 4PMWA 4OIKA 2O2LD 3R2TA 4RCOA 5T1IA 5A35A 5ELFA 2A69C 3K57A 4OO1H 1ET9A 2JEAI 3A7LA 4EQNA 3D4DA 5IOCA 3FKIB 3KF8A 2F3VA 2GA4B 1PTOB 4WORA 4BY1B 2VUMB 3I4NB 4B08A 1SNOA 4K6DA 3T51B 2MJ8A 2B39A 3HG9A 3R3OA 4HTHA 4TQUS 4EGVA 1LT4D 3J81L 3A54A 3J7AV 5M3FB 4I65A 4DK0A 1GJXA 1Q90A 5KIXA 2RVLA 1E0BA 2G9DA 4ZLTF 1HHVA 3SEBA 3QG1A 3M3YB 1D1KA 1UNSA 2KHSA 2AWNA 1NAPA 4XQQA 3CQZB 3QO2A 4KD4A 1F2YA 4FO2A 4KKUA 1PZJD 1CM9A 3LX0A 1K8OA 2F0WA 1WVLA 2FMCA 4BBRB 1XX8A 4K2LA 5D14A 3PUZA 1GHKA 3GV6A 3OOCA 2DY8A 1I4PA 2A74C 2NN6G 3DXJC 5IGDA 5EQ0A 1IW7D 1DOKA 1HTLD 1A2TA 5D65A 3TDQA 3J7YW 2PZWA 1RHPA 2F0LA 3PUVA 5NUCA 5IT9E 1E2ZA 1JWSD 1BCPF 5C6AA 3CKIB 1O7LA 3ND9A 1RCVD 3SR1A 3S17B 2E2IB 1L0YB 4V0BA 1SJED 3JAME 2B8GA 1WTWA 2HDMA 5EPLA 2NN6I 5IGFA 5KEEA 1RF2D 1HCZA 2XNAC 3QOLA 4DA2A 4H13C 1IL8A 5CV8A 5J1ZA 4LAAA 4A3MB 1W6KA 1BOSA 1ZYRC 3EVQA 5EBDA 5FK9C 2EYMA 1BCPB 4QUCA 2E76C 3ZYYX 4NP5A 2F0MA 1V43A 3HS0C 3HZXA 3K5MA 5KRUA 3KUPA 1HA6A 1MI2A 1GUSA 3N6RA 5DM73 1HFGA 3KBXA 3VR4A 3HRZC 4IUQA 3V2TA 4KJOA 1QNUA 4CKEA 1TIID 1ONLA 3NTIA 2K5DA 1QJOA 5JOBA 1DOLA 4J8QA 2ZXOA 1CQFA 3VR3A 1Q8IA 4A3FB 3VR2A 3GO5A 3VYRA 2L11A 4KHZA 3Q22A 2B2WC 3P7JA 4FF3A 4XTCS 4A3GB 2IT1A 2F0QA 5C3XA 3HOWB 5JVG3 1KLGD 5T1GA 2EJMA 1TKWB 4C2MB 1HQRD 3MXPA 2L9HA 3I72A 2ZT9C 1MBYA 2G9HD 2JYOA 1ZKOA 2XIWA 3G6JB 3QJYA 2EVBA 1EEID 2F0NA 2BCOA 2K28A 5G3LF 4DN4M 1LT5D 3P75A 1Z47A 1C48A 2WB1B 3P20A 3S2HB 1EEFD 5JEAH 2X6GA 3IFTA 4ZKCB 1CA5A 2NVXB 3OIPA 1BBXC 1U9RA 1JQYD 4ZUIA 3PMFA 1ILQA 2CHBD 4RKBA 3IL8A 1PLFA 1NSNS 2QDBA 1Q3LA 1G2SA 4DXGA 3QB3A 1HA5A 3Q24A 1ESFA 2F1MA 4PMCA 4HSPA 2EYPA 1V1PA 1OXSC 1TQOA 3QIAA 4ILWA 2ZXRA 5K36G 3V05A 2B63B 3H09A 3T16A 2L12A 4KJNA 2RKSA 5EPJA 4HSVA 1A3TA 4IUVA 4EVOA 4V190 1UAPA 2K6AA 4H0LC 1ICWA 5BN5A 2N55A 1WTOA 3NK9A 4ID6A 2XRSD 5I9OA 3M7GA 1QWYA 3QOJA 3D6WA 5C4ZA 3O13A 4R8IA 4C3HB 2A6HD 4ULLA 1ZXTA 2NTSA 5A2QE 5KNBA 1VF5C 2PQEA 2M2LA 4X3SA 2F0JA 1CT1D 4PV1C 5IGGA 1DD2A 4QMGA 5C44B 2NZ1D 3D31A 1HUMA 2Z4IA 1GUOA 2E2DC 1Q1BA 2NBFA 4A3IB 1CQVA 1IYVA 1EY0A 3T56B 5I6YA 1STEA 5M5YB 2QEJC 5FLXL 1TWGB 2KVMA 3GTMB 2PO4A 1RJTA 3DWAA 5JAVA 3ND8A 3A7AB 1VMCA 1EL0A 3MFGA 1B4OA 2IL8A 3WOEA 5JEAJ 3OSOA 1A3UA 2EZVA 3MXUA 4FXGC 4YIJA 1ML0D 2HCCA 1TS3A 3PIP3 4H44C 4KTAA 5EJWA 4RGOS 3S16B 3L7ZC 1WTXA 1BCPC 1K8MA 3MFYA 2F03A 1RTOA 1XXGA 3SK4A 2L55A 3D4WA 1LTRD 5M9OA 3KLSA 3CU7A 2HQEA 2NB0A 5JPNC 2B2VC 2L0CA 3DM1A 1A6XA 4XYQA 3KLRA 2WKCA 3TP7A 1B9NA 1A3VA 1Y8NB 4IUTA 1I4HA 3H94A 3MVVA 3VR5A 4JK1C 3WDNA 1HUNA 4HMIA 3NWTA 1OXVA 2WINB 4S3SA 3TP6A 3MC0B 1Y69U 2ICEC 2H4OA 3NTHA 1WTPA 4DAYA 2EYOA 3BYYB 1DXMA 2SOBA 5DM63 1YNNC 1U4LA 1V1OA 3OWEB 1LTAD 2D5DA 1I6VC 1LO5D 3RZOB 3IKJA 5D3DA 2B2YC 4A3KB 1H9SB 2D9UA 3Q6SA 2WACA 1I3QB 3I73A 1F2LA 1LTBD 5HGTA 1FYCA 4ZAIA 2F0IA 5CR3A 1Y1WB 3FDTA 1PTOH 2SDFA 4BS9A 5CV6A 5ELEA 1BNZA 2E2HB 1EY5A 3D6CA 3NXWA 2D2CC 1FNWA 1E2VA 4HCEA 1KABA 1II3A 4A3EB 3GV3A 1TS5A 1O7ZA 1X3QA 4K5WA 1FR3A 5I4DA 1SMYD 3LWEA 1LTTD 5TSSA 1PMRA 2B8FA 1TWHB 4C1NK 3HP3A 3DEPA 3AMUA 2EY1A 4BA1I 2LMCB 3TBIB 4ZUJA 2WKDA 3RLFA 1ZYRD 5I6WA 3T13A 1G291 1TS2A 4L6TB 2EJFC 1I4RA 3TP5A 4DFAA 1CFMA 1JCKB 2A68D 1EFID 2HCIA 5I9PA 4QB4A 3M4YA 3NE5B 5COYA 4KHVA 3KLSX 5C4HA 4KI0A 4CKCA 4RH6A 3D4RA 4WJWA 3BYTB 1EY6A 2NWGA 1RODA 1HRJA 3NP8A 2KJXA 1U4RA 2EYLA 4PMBA 5E4WC 2FFKB 2F0HA 1IHZA 4F8MA 1U4MA 2VNUD 1GXDC 1XYIA 4RAUC 2ID0A 1S5CD 5K5PA 3VYUA 3ONAB 1SYGA 4DNTB 3J80E 1IKLA 2OEOA 2OF1A 3MXNA 2YU9B 3I90A 4ZQ3A 3R2IA 1ENAA 5F2DA 2VXWA 4K5XA 1M8AA 2R92B 4IFDH 3BVMA 5EBCA 5J22A 5FOBB 3PUWA 4TSSA 1SYBA 3FRPB 2LS01 5C0XJ 1PRTD 1GOZA 5ELDA 2YYZA 3BG3A 4KMUC 4MN3A 2Q8TA 3UI2A 2K1BA 3HOVB 3VA5A 3N52A 1TU2B 1SAPA 3BVZA 3A55A 5A2QL 5AFWA 1G91A 1YNJD 2MPMA 3X3NA 4CJ0B 2L4NA 2C9OA 4XDXA 4B9WA 1DM0B 1NR2A 4K14A 1RDPD 3LWUA 4QCLA 4LK1C 1M4VA 1L0XB 2RQXA 1TT2A 2OT2A 2Z8LA 4BA2I 3MHBA 2F0TA 3OMGA 2KOLA 4FF2A 3M85A 5CV7A 1RD9D 1EIGA 4FXDA 5EKKA 4U68A 1UUPA 4Q0FA 1SYEA 4RWSC 5JVH3 5FO7B 3VR6A 2A6ED 1JOOA 3HKZB 2IW3A 1AN8A 2K5WA 1F9QA 1D5MC 5LL6S 4FNFA 4JBWA 4WFN3 2EY5A 1Q1EA 4XQJA 1JICA 1SXTA 2BE5D 2LY7A 1EY4A 2JE6I 1PTOD 3D3RA 4G7ZC 2F0OA 1B1ZA 5BN4A 4OO1G 2LFNA 5C0XI 3RZDB 4CGYB 2JA6B 4CJ1B 1IW7C 3I70A 3AB9A 3DHQA 1EQTA 4HN7A 1SE4A 1LACA 3K0YA 4J6HA 1F9SA 5KNDA 2LKVA 1HTPA 1STBA 3I4MB 1S5DD 4G7HC 1CHPD 3OPOA 1I4XA 4RFBA 3C3LA 1SYCA 5FKAC 2DNCA 4F7XA 2JA7B 2FJ2A 3K7AB 4IZ8A 3T4AC 4OO1I 3GP7A 5CBAE 3L9AX 4IUNA 1KNEA 1O7YA 4RGMA 1QOHA 2NYZD 4XQNA 1KDCA 3K59A 3DWPA 2R3ZA 2CVRA 4KY6A 3GTGB 4BWGB 1D5XC 1D5ZC 2B2UC 5DAUA 3FPPA 1PFMA 2SNSA 2F0SA 1IKMA 1EYDA 3RMHA 2NVYB 1QNKA 1ESRA 2L5TA 1GHJA 1QCBD 4NW2A 4XIGS 1SE2A 1Z7TA 1A2UA 1R4PB 1KDAA 5IIFA 4CJ2C 2B2TC 3G7LA 4IUUA 4NKLA 2QCPX 5KGUA 4DK1A 1TS4A 1I4GA 1I4QA 1BQQT 1BUVT 4R9WA 5ISRA 3I3CA 4MIUA 3TMEA 4U673 3MXGA 2HUGA 4TRDA 5LHY1 1CI3M 1EQVA 2MP1A 4WRDA 2PCFB 3SXHA 2QKIC 1DZ1A 1I6HB 3IAYA 1UEAB 4O42A 3F2UA 3CRKC 1WD1A 1OO9B 3M7NA 1EOTA 2DN8A 4KN7C 3HOYB 2PW7A 2OXPA 2KUMA 4Q5VA 4ZRZA 1TWFB 2PW5A 1BR9A 2K01A 3S1QB 1PFBA 3S1MB 2EYJA 4M1UB 3H6MA 4RGNA 2KQ3A 4F87A 3VYTA 4AYBB 1SYDA 4FYDA 1YNND 4OGQC 3NQIA 3D8GA 3A8JE 2SNMA 3OHXC 4PNYA 2DNEA 2B2WA 4G7OC 3RUZA 2XSCA 4HMJA 1STAA 1MD2D 3CHBD 5EKLA 5LL6X 2CW0D 2AQ2B 3BVGA 5ELBA 2PPBC 3S15B 1KLUD 4XYOA 2F3WA 1O80A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C8C A;  4R8I A;  1WTR A;  3LWE A;  3DEO A;  3H91 A;  4CJ1 B;  3SVM A;  2B2V C;  1X32 A;  1ZXT A;  2RA4 A;  1EQT A;  4ZKB B;  2FMM A;  3MTS A;  3DM1 A;  2M2L A;  2H1E A;  2K28 A;  4QUC A;  4X3K A;  4R9W A;  1WTQ A;  4X3S A;  4DN4 M;  1AP0 A;  2B2T A;  1WTV A;  2RVL A;  1E0B A;  1NR4 A;  1MSG A;  3HP3 A;  3I3C A;  3DEP A;  4ZLT F;  4MN3 A;  1F9S A;  1JE4 A;  1SSO A;  4HCS A;  4IUT A;  1HHV A;  2Q8T A;  3UI2 A;  2RSO A;  1B50 A;  2K1B A;  2B2V A;  2L1B A;  4X3U A;  1PDQ A;  1HUN A;  1NAP A;  1KNA A;  1WD0 A;  1G2T A;  3KUP A;  3N52 A;  3QO2 A;  3TZD A;  1HA6 A;  1SAP A;  2X6G A;  1ILP A;  2BDN A;  2EOT A;  2X6L A;  2HDL A;  2HUG A;  5AFW A;  4IUR A;  4ZKC B;  1CA6 A;  1G91 A;  1MI2 A;  2NZ1 D;  1CA5 A;  2MPM A;  2EPB A;  4CJ0 B;  1CM9 A;  1QE6 A;  4QUF A;  1GUW A;  2L4N A;  1HFG A;  4XDX A;  1BBX C;  4UAI A;  1HFN A;  3KBX A;  2MP1 A;  2K05 A;  2FJ2 A;  1WTP A;  1HUM A;  1A15 A;  2RSN A;  1VMP A;  4IUQ A;  5CBE E;  1WVL A;  1BF4 A;  1NR2 A;  3FPU B;  1DZ1 A;  5CBA E;  1XX8 A;  1KNE A;  1O7Y A;  1ILQ A;  2EE1 A;  5EQ0 A;  5JJZ A;  1M8A A;  1B3A A;  3IL8 A;  4O42 A;  3TN2 A;  1PLF A;  1AZQ A;  3F2U A;  5D14 A;  2NYZ D;  1WD1 A;  2HCI A;  1Q3L A;  2DY7 A;  4RA8 A;  3GV6 A;  1G2S A;  1U4L A;  3IFD A;  5COY A;  1B2T A;  1J9O A;  2KEC A;  1EOT A;  1DON A;  2Q8R E;  2R3Z A;  1DOL A;  2DY8 A;  4HED A;  2CVR A;  1NCV A;  1F9R A;  1J8I A;  5COR A;  1X3P A;  1DOM A;  1QG7 A;  2J7Z A;  2KUM A;  2FIN B;  5E4X A;  2K03 A;  2B2Y C;  2KOL A;  1B53 A;  1PFN A;  1ROD A;  2KVM A;  2D9U A;  2NWG A;  3I8Z A;  3Q6S A;  5EKI A;  1DOK A;  2K01 A;  1S4Z A;  1RJT A;  2B2U C;  4OIK A;  1PFB A;  1F2L A;  1PFM A;  5D65 A;  5CMD A;  1EIH A;  5T1I A;  4ZK9 B;  1EIG A;  1HRJ A;  2X69 A;  2JP1 A;  1IKM A;  1RHP A;  4U68 A;  2MGS A;  1VMC A;  1AZP A;  1EL0 A;  1B4O A;  1BO0 A;  5DNF A;  2L11 A;  4ZAI A;  2IL8 A;  4HAE A;  2FHT A;  1U4R A;  4X3T A;  1TVX A;  4RWS C;  2B2Y A;  1F9P A;  5EPK A;  4IUP A;  1MGS A;  2B2W C;  2FFK B;  2L12 A;  3FDT A;  3P7J A;  2B2U A;  1SDF A;  5E4W C;  1U4P A;  2SDF A;  1QNK A;  3MWY W;  4OIJ A;  1ESR A;  1ML0 D;  1U4M A;  2HCC A;  1BNZ A;  3I91 A;  5EPJ A;  3R93 A;  4HSV A;  1XYI A;  1F9Q A;  4RAU C;  4IUV A;  5EJW A;  4LMQ D;  2K04 A;  4NW2 A;  4MHE A;  3ONA B;  1LV9 A;  2B2W A;  5T1G A;  1WTX A;  1RTN A;  1WTW A;  1JIC A;  2HDM A;  2L9H A;  1IKL A;  1ICW A;  1RTO A;  2KEE A;  5EPL A;  2KED A;  1G6Z A;  2N55 A;  2MJ8 A;  3GV3 A;  1MSH A;  4XT1 B;  1WTO A;  2JYO A;  1O7Z A;  2N88 A;  1X3Q A;  3I90 A;  2XIW A;  4XT3 B;  4CJ2 C;  1IL8 A;  2B2T C;  3D6W A;  3G7L A;  2VXW A;  4IUU A;  1O80 A; 
#chains in the Genus database with same CATH topology
 2PNR C;  4FVM A;  1NNX A;  3J81 j;  1HH2 P;  3R8B A;  1CK1 A;  3J80 L;  1QUQ A;  1OXT A;  4QJF A;  1WTQ A;  1WI5 A;  2A69 D;  2NVQ B;  1WTV A;  4K8J A;  3J80 i;  3W2D A;  1KAA A;  4DR2 Q;  3LNN A;  1NUC A;  5IT9 L;  3U58 A;  4C1N I;  1EY8 A;  2EXZ A;  3ITP A;  1F2Z A;  3K81 C;  4B9X A;  3DUZ A;  2F0F A;  1H9S A;  2NN6 H;  2X6L A;  1KAW A;  3PUX A;  3TQY A;  1SE8 A;  1FNU A;  2VQF L;  4A93 H;  1QE6 A;  3U9S A;  1HFN A;  3W3A A;  4B3R Q;  2K05 A;  3JAM L;  3RZO H;  4LF6 L;  3OIQ A;  3A8I E;  4R4I A;  4A3K H;  1K3B C;  3X3M A;  3JAM i;  1PH3 A;  5JJZ A;  4NPS A;  1I3Q H;  3TN2 A;  1SNP A;  1XNR Q;  1JB3 A;  2QEX A;  2WAQ G;  1YHA A;  2KCM A;  1EQR A;  3UE0 A;  2DUD A;  4R4C A;  3W1G A;  1V8Q A;  1PRT F;  2JA9 A;  4H7B A;  2UUC Q;  1KTK A;  1Y1W H;  2CQA A;  5G3L D;  5FLX c;  4HED A;  1L1O A;  5JEA G;  1HNZ L;  1TR5 A;  2FIN B;  4LJZ C;  2A6H C;  1SMX A;  1B53 A;  3I8Z A;  4DXF A;  1DYQ A;  2I07 B;  2R6G A;  5EKI A;  5D3I B;  4A3D B;  4EQO A;  2E2H H;  4M8A A;  1X3G A;  2HT1 A;  3SK8 A;  2IHE A;  3UE1 A;  1XMO Q;  4HID A;  2MGS A;  1AZP A;  1SJH D;  2EYH A;  1BO0 A;  5DNF A;  3T1Y L;  2XWB B;  4OX9 L;  3PO3 B;  1N36 Q;  4DR6 Q;  4A75 A;  1B70 B;  1HXY D;  2D62 A;  4A3E H;  3MWY W;  4OIJ A;  4LF8 Q;  4A93 B;  2PQA A;  3OWF A;  1K0R A;  1HR0 Q;  1PH4 A;  1VF7 A;  1PRT B;  1UEB A;  3TP8 A;  4LMQ D;  3HOU B;  4UDU C;  1PYB A;  1VQM A;  2F4I A;  4NXM Q;  1KQS A;  4J1M A;  1VCI A;  1RTN A;  2AUK A;  4C3J G;  5IOD A;  3EFX D;  3LGJ A;  1QZG A;  2M9V A;  4KY7 A;  1PYW D;  1TWH H;  2Q2H A;  4OEM B;  3CW2 C;  4GOP B;  5IYD G;  1W3S A;  2N88 A;  3HOZ G;  3EQL C;  2AWO A;  4KN4 C;  2F0E A;  2Y0S B;  3BS1 A;  1VDZ A;  3SVM A;  2RA4 A;  5CV9 A;  3T53 B;  1N33 Q;  1AEX A;  2RDH A;  3SK5 A;  2FMM A;  1STG A;  2JJQ A;  1AP0 A;  3RD4 A;  2OTJ A;  5HUR A;  3ERO A;  1LAB A;  1X54 A;  2CKZ B;  1B50 A;  5C5L A;  4X3U A;  4N8F A;  2F0G A;  1VQB A;  1VQ9 A;  1U5K A;  1H9R A;  1VQJ A;  3K58 A;  4PZ7 A;  1VQE A;  3V96 A;  2MUY A;  1DJR D;  5BN3 A;  1B9M A;  4EQP A;  1BF4 A;  1DCZ A;  4HR7 B;  4ODG A;  5ELN A;  2KA7 A;  4UP8 A;  4LFA L;  2F0V A;  4KKS A;  1STH A;  3MEF A;  2R61 A;  1BBU A;  3TSS A;  2VQF Q;  1CKO A;  2QDL A;  4G57 A;  2RHQ B;  4UHV A;  3K8A A;  1X3P A;  1DOM A;  1EZ8 A;  1QG7 A;  2RDF A;  4LF6 Q;  1EWH A;  5DEH A;  1PFN A;  3CCV A;  2NTT A;  4RHR A;  4R8N A;  4GNX C;  3Q0A A;  1YIT A;  1GKH A;  2CFM A;  3CC4 A;  2JP1 A;  3NBH A;  4FF1 A;  3NSW A;  3EA6 A;  3L2P A;  4HAE A;  4YHH L;  3NPP A;  4KKT A;  1E1T A;  1F9P A;  5FJ8 H;  5EPK A;  1HNZ Q;  4RG1 A;  2HIV A;  5M5W B;  1EIY B;  1U4P A;  1GUN A;  2XVS A;  1D1I A;  3A74 A;  4JG2 A;  4EX5 A;  2YU9 H;  1EQQ A;  4GN5 A;  3CCE A;  1XWE A;  1BXT A;  2OWO A;  1LV9 A;  3T1Y Q;  4OX9 Q;  4GLX A;  1JWU D;  2R92 H;  2PYK A;  1N32 L;  5M3M B;  1S5E D;  4IOA A;  1WCM G;  1VQF A;  4A3D G;  1B3Q A;  4CHT B;  3U50 C;  3I7F A;  3PV0 A;  1YZ6 A;  3C2P A;  5KYI A;  1EU4 A;  1S5B D;  1S5F D;  3PIO A;  1LTG D;  4QF4 A;  3GQB A;  2BH8 A;  1JMC A;  3F2C A;  1X32 A;  2SEB D;  5FLX E;  3QWN A;  2A19 A;  4K0K L;  1SNQ A;  3CC2 A;  1PA6 A;  2RHS B;  4QIW E;  1B44 D;  5BR8 Q;  4TKO B;  1C0A A;  1FD7 D;  2E5L L;  1IYJ B;  3KF8 B;  2VQE L;  2B2V A;  2PMZ E;  1PDQ A;  2JA5 G;  2JA8 G;  1Y14 B;  1JOR A;  5CC4 A;  2O5I C;  4YCW A;  3TZD A;  3J81 c;  4DAP A;  3C1E A;  2WAQ E;  2ASB A;  2J0T D;  2O4X A;  2EPB A;  1GUW A;  4DGZ A;  4B3M L;  2K5N A;  2VB2 X;  4RCN A;  1RKN A;  5K36 H;  3KFU A;  1VMP A;  1W6J A;  3FVQ A;  4YCU A;  2F0U A;  4BBS B;  5HGQ A;  1ENF A;  4A3J B;  4AIM A;  2AQ1 B;  1CHQ D;  1K83 B;  2R93 B;  1Y1V B;  2KCC A;  2OQ0 A;  5C3E B;  3ERQ A;  4K8I A;  5COR A;  4DF7 A;  3G6E A;  1SMY C;  2WII B;  3DLL A;  4F88 A;  2JK8 A;  5C4X G;  1LLR D;  4C56 C;  3MAQ A;  4L8J A;  2V4D A;  4LFA Q;  4ZK9 B;  3G71 A;  2A73 B;  2A5H A;  4KV6 A;  5E7N A;  4X66 L;  2Z1C A;  4DV2 L;  1M1K C;  2B2Y A;  5GRO A;  5IYB H;  2RBM A;  2K33 A;  1SNM A;  2HQL A;  1SDF A;  1EYG A;  5ELO A;  4JOI A;  3PUY A;  3L3O C;  1A0I A;  4K5V A;  4HJ8 A;  2XRQ D;  3S14 B;  4YWK A;  1GUG A;  1KDB A;  3CF5 A;  3RZD H;  3H0G B;  4YHH Q;  2JA6 H;  4GKK Q;  2Q8I B;  4L5R C;  2KEE A;  4ZCK A;  2A68 C;  3GTK B;  3BDO A;  2KED A;  5C0X G;  2ZJR A;  1KIX A;  1HR0 W;  3WOF A;  4XT1 B;  3FKI G;  3M4O B;  2WP8 J;  3MXN B;  1ASZ A;  3CRL C;  1EWC A;  3I4M H;  2JXM B;  1WTR A;  4BY1 G;  2Z9H A;  3DEO A;  1B7Y B;  1R9T B;  3I4N G;  3NQT A;  1SFO B;  1EYA A;  1N32 Q;  1IBL L;  5E1F A;  4E6I A;  1CTM A;  3H3V C;  3GD7 A;  2ATW A;  3DWQ A;  2JA7 H;  3K7A H;  3MZ5 A;  4N9T A;  4HCS A;  1G8Z D;  2RSO A;  2BH2 A;  5M3F G;  4HIO A;  3UDX A;  3CCM A;  4IQZ A;  1VQA A;  3ZJY C;  3SHL A;  2QIL A;  5EGT A;  2HDL A;  2ZXP A;  4ME5 A;  1V9P A;  4K0K Q;  3HKS A;  4JVZ A;  4UAI A;  1ENC A;  3FEW X;  4ABN A;  1X9N A;  1JWM D;  5CBE E;  1PXU A;  2E5L Q;  3GTG H;  2I46 A;  2VQE Q;  2JEB I;  3STB C;  3I4O A;  1B3A A;  4IN3 A;  5CV5 A;  3U4Z A;  2EYF A;  2Q2T A;  1BDO A;  3E0J A;  3NTK A;  4L5S A;  2ICI A;  5M5X B;  3EJI A;  2Q8R E;  4B3M Q;  4BBR G;  3BZD B;  4JBK A;  2TSS A;  1OXU A;  2MNA A;  2Q2I A;  1TY0 A;  1SNC A;  2NVY H;  5JPM C;  3FMC A;  3MA2 B;  1S4Z A;  2VY3 A;  1NBW A;  1D2B A;  2M00 A;  5J39 A;  1LTS D;  1PRT C;  2X69 A;  3MEH A;  1STY A;  1AW7 A;  1NE3 A;  4P73 A;  3KJP A;  1A63 A;  2N49 A;  1TVX A;  1MGS A;  5CYU A;  4K2K A;  3GTJ B;  4OL7 A;  1QVG A;  1VQN A;  2VB3 X;  3NEN A;  4JI3 L;  3BDL A;  1FNV A;  3VA7 A;  4IFD J;  1HJP A;  1YNJ C;  2ENB A;  4A3J G;  4C3I B;  2K04 A;  3J81 E;  4MHE A;  1SRU A;  4X66 Q;  2NUC A;  4DV2 Q;  5C3E G;  2XN9 C;  1ET6 A;  2K7V A;  4CDF C;  5IGB A;  1G6Z A;  4A3C G;  1Y8O B;  1MSH A;  2BDO A;  1SE3 A;  2JSO A;  3AQQ A;  1N8R C;  4DAV A;  1HNW L;  1Y8P B;  1STN A;  4JI8 L;  1VQL A;  3CCL A;  2E2J B;  1EIF A;  1KHI A;  2F0D A;  4GNX B;  4PQX A;  4ZKB B;  5IGC A;  1NR4 A;  2BA1 A;  4XXE A;  1JE4 A;  1SSO A;  2EY2 A;  3NHH A;  4K6L A;  4QIW B;  2WV6 D;  1SYF A;  2L1B A;  1I6H H;  4KY5 A;  3CC7 A;  1HQM C;  4IJL A;  2K32 A;  4JI5 L;  2PZU A;  3SE0 A;  3KBG A;  2O5J C;  2A6E C;  3W1B A;  2IWH A;  3C46 A;  4X6A H;  3H0G G;  5KYL A;  3DMU A;  2PMZ B;  3GTL B;  4CKB A;  5IP7 H;  1IBL Q;  4IUR A;  3PCO B;  1K8G A;  5ELC A;  1GUT A;  2QW7 A;  3PQI A;  2WAQ B;  1PH6 A;  4POG A;  1PZI D;  3HOY H;  4OWX B;  2RSN A;  1A15 A;  4IFD G;  1C4Q A;  4NDX A;  2C5C A;  1XTC D;  4B3S L;  1F2M A;  1GVP A;  1TWF H;  1X3E A;  1EY9 A;  3E0E A;  2LSS A;  1BCP D;  1EYC A;  5IYD H;  3S1Q H;  3S1M H;  1H9M A;  2BE5 C;  4G4K A;  1PTO C;  2KEN A;  3AU7 A;  5CGK A;  1FJG Q;  1J9O A;  1JR0 D;  3CP0 A;  3HEJ A;  1VQ8 A;  1JT8 A;  1XNR L;  2EY6 A;  3GTQ B;  1CKM A;  1NCV A;  1H9J A;  1VQK A;  4DPG A;  1D7Q A;  2K03 A;  4QQB X;  3ER0 A;  4LUV A;  1ZEQ X;  3KK7 A;  3ULP A;  1EIH A;  1TWA B;  4LW1 A;  1I50 B;  4DNR B;  4A3B B;  2KCN A;  2FHT A;  4MNO A;  2EDG A;  5KNC A;  4IUP A;  4IFD I;  2YV5 A;  4C3J B;  3R93 A;  5C3W A;  1QVF A;  1HPC A;  4R1J A;  2NVT B;  3S15 H;  1JC7 A;  2XWJ B;  4P2C B;  2F0K A;  4OHJ A;  4GZY C;  5I2Y A;  3HOZ B;  2IJ0 A;  1CSQ A;  1OXX K;  4JI6 Q;  4A3G G;  1SND A;  2IX0 A;  1PH7 A;  4LF9 L;  1RL2 A;  4PZ8 A;  1LT6 D;  1V1P B;  4JI3 Q;  1JOK A;  2NVQ H;  2QF7 A;  3HOW G;  1YJ9 A;  3GTP B;  2F0P A;  3HGB A;  3OTO L;  1B8A A;  1C8C A;  2E75 C;  3K5L A;  2IX3 A;  4RHS A;  1J5E L;  5L37 A;  4OWW B;  3BDC A;  2GVA A;  3NWS A;  2OTL A;  3K6O A;  3SK6 A;  2H1E A;  3P1H A;  3PIO 3;  4X3K A;  1EY7 A;  3H3V H;  3VYS A;  1MSG A;  4Y7N B;  1JJ2 A;  3K5O A;  3S1N B;  3J7A F;  1YNX A;  4OEL B;  1X55 A;  2J4X A;  3S2D B;  2PI2 A;  1HNW Q;  5FO8 B;  1HNX L;  1QIL A;  5CV4 A;  4JI8 Q;  3CCJ A;  4C3I G;  1KNA A;  1G2T A;  4FP5 D;  4LF4 L;  4FDB A;  1ILP A;  4DU9 A;  1VQI A;  3E6Z X;  3NUC A;  2WB1 G;  4QUF A;  3K5N A;  3W5O A;  1HZC A;  4FXK C;  1Q12 A;  1MHW C;  4A3D H;  4JI5 Q;  2P5Z X;  3U4V A;  2UXD L;  4KD3 A;  4R4T A;  1B2T A;  4Z9C B;  2KEC A;  1SN8 A;  4CBV A;  3UDF A;  1D6E C;  1IYU A;  4ME3 A;  3PO3 H;  1AFP A;  1LT3 D;  1J8I A;  5FO9 B;  2F4V L;  2HHH Q;  2J7Z A;  5E4X A;  4O0A A;  1J6Q A;  4B3S Q;  3HOX B;  4X65 L;  4A3L G;  1E2W A;  2Z4H A;  5CMD A;  2ZM6 L;  3OMC A;  2BA0 A;  3G48 A;  4RKL A;  4GOP A;  3HOU H;  3I4L A;  3TZU A;  1QB5 D;  1LM0 A;  2AQ3 B;  4X3T A;  1SEB D;  1T5E A;  4X64 L;  2IPK D;  2B2U A;  1FGU A;  2R7F A;  2MHV A;  1IBK L;  1EU3 A;  1JOQ A;  4BY7 B;  3I91 A;  4N9P A;  1A8V A;  2IX1 A;  2B63 G;  1WCM B;  2F3I A;  1R4Q B;  3E5S A;  1TWC B;  2R7Z B;  2EJG C;  3TS2 A;  2E74 C;  1WTH A;  2K5Q A;  1MKH A;  4MTN A;  1H9K A;  4BXX H;  1S3O A;  2R7D A;  2RDG A;  3S1R B;  1K3R A;  1T5X D;  4XT3 B;  4DR3 L;  2Z6K A;  4UP7 A;  1CKN B;  2PZT A;  3U9O A;  1XTD A;  4A3B G;  1A62 A;  1AE3 A;  3GTO B;  1HZB A;  3H91 A;  3URY A;  4PZ6 A;  3Q23 A;  4LF9 Q;  4HJ5 A;  1FGB D;  2JA5 B;  5I2X A;  3MTS A;  3I55 A;  1CZW A;  4IPD A;  2CWP A;  2JA8 B;  2C35 B;  1PH1 A;  2B2T A;  3A56 A;  3L0O A;  2AUJ D;  4C3H G;  1VQO A;  3A8K E;  1F77 A;  4I7Z C;  5C4J B;  3OTO Q;  3NBI A;  5BR8 L;  1Z6H A;  4L63 B;  1V1Q A;  4JCV E;  5C5M A;  2CH4 W;  1XPR A;  1WD0 A;  5E3F A;  1J5E Q;  4POF A;  3SDZ A;  2BDN A;  2EOT A;  4WJ4 A;  1CA6 A;  3JAM c;  1CZG A;  1P16 A;  1TY2 A;  5IGE A;  4GKJ L;  4YY3 Q;  4IAL A;  5C0X H;  1L0W A;  3FPU B;  1EZ6 A;  1HNX Q;  4JPB W;  4NMZ A;  1O78 A;  2EE1 A;  1AZQ A;  3FKI H;  3Q8D A;  4DV4 L;  2K50 A;  2CW0 C;  2NZH A;  4KK7 A;  4LF4 Q;  5C4X B;  4RA8 A;  1SBB B;  2DY7 A;  4A76 A;  2CH4 A;  4LUZ A;  3IFD A;  4O1N A;  2BOS A;  1PZK D;  1DON A;  3KF6 B;  3C1F A;  2TMP A;  4I7A A;  3S9W A;  1F9R A;  1YVC A;  3OW7 A;  2JN4 A;  2HD3 A;  5M5W H;  1PTO F;  1KL9 A;  3NEM A;  4RGT A;  4ZYS A;  1LTI D;  4FF4 A;  2UXD Q;  4PMW A;  4OIK A;  2O2L D;  3R2T A;  4RCO A;  5T1I A;  5A35 A;  5ELF A;  1LUZ A;  2A69 C;  2UU9 L;  3K57 A;  4DAY B;  4OO1 H;  2KHJ A;  3S24 A;  2F4V Q;  5M3M H;  4X65 Q;  5IYC G;  5JJI A;  1ET9 A;  1RIP A;  4QY7 A;  4P72 A;  2ZM6 Q;  2JEA I;  3A7L A;  4EQN A;  2DJG C;  3D4D A;  1P8L A;  3FKI B;  3KF8 A;  2F3V A;  5IOC A;  2D0O A;  1VQ7 A;  4X64 Q;  2MO1 A;  4IPC A;  2GA4 B;  5FLM G;  3AYH B;  1PTO B;  4WOR A;  1T9H A;  1IBK Q;  4BY1 B;  3HOX G;  3I4N B;  2VUM B;  4B08 A;  1SNO A;  4K6D A;  3T51 B;  2MJ8 A;  2B39 A;  4DV5 L;  4GKK L;  3HG9 A;  4LNQ A;  3R3O A;  4HTH A;  1EFW A;  4TQU S;  4EGV A;  2PNH A;  4OWT B;  1LT4 D;  3J81 L;  3A54 A;  3J7A V;  1PVO A;  3OW2 A;  5M3F B;  3J81 i;  2A1A A;  4JI7 L;  4I65 A;  4DK0 A;  4IPH A;  1GJX A;  1Q90 A;  2WB1 E;  1YHB A;  5KIX A;  2RVL A;  1E0B A;  2G9D A;  4ZLT F;  2RCF A;  1HHV A;  4BY7 G;  3SEB A;  3QG1 A;  2I0Q A;  3GDE A;  3M3Y B;  3EIV A;  4DR3 Q;  1D1K A;  1FVI A;  1UNS A;  1ASY A;  2KHS A;  2AWN A;  4LF7 Q;  4BBS H;  3PO2 B;  5GAD C;  1NAP A;  2R7Z G;  4A3J H;  4XQQ A;  3CQZ B;  3QO2 A;  4KD4 A;  1F2Y A;  1K83 H;  1UE6 A;  4FO2 A;  2R93 H;  1NMG A;  4KKU A;  1PZJ D;  1Y1V H;  1CM9 A;  3LX0 A;  1K8O A;  5C3E H;  2F0W A;  1G51 A;  1WVL A;  3J7A 5;  3FHW A;  2FMC A;  1Q8K A;  4IPG A;  4BBR B;  4A3C H;  1XX8 A;  4K2L A;  5D14 A;  3PUZ A;  1Q46 A;  1GHK A;  3GV6 A;  3OOC A;  4IOC A;  4LF5 L;  2DY8 A;  1I4P A;  4GKJ Q;  2A74 C;  1E24 A;  1YJN A;  2NN6 G;  3DXJ C;  5IGD A;  5EQ0 A;  1IW7 D;  3M4P A;  1ICF B;  1DOK A;  1YI2 A;  1HTL D;  4KHP L;  1A2T A;  5D65 A;  4DV4 Q;  3TDQ A;  3J7Y W;  3PO2 G;  2PZW A;  4DK6 C;  3CCS A;  1RHP A;  3S14 H;  1Q81 C;  2F0L A;  3H0G H;  3PUV A;  4A3K G;  3FP9 A;  5NUC A;  5IT9 E;  3K0X A;  1E2Z A;  3PIP A;  1JWS D;  3GTK H;  1BCP F;  3M9B A;  5C6A A;  3UDI A;  3CKI B;  3PF4 A;  1BVS A;  1O7L A;  2N3S A;  3RLN A;  2VL6 A;  3ND9 A;  1RCV D;  3M4O H;  3SR1 A;  2UU9 Q;  3I2Z A;  3S17 B;  2E2I B;  1L0Y B;  4V0B A;  1SJE D;  4YWL A;  3JAM E;  1R9T H;  2B8G A;  4AQY L;  1WFQ A;  1WTW A;  1SFO H;  2HDM A;  2K4K A;  5EPL A;  2NN6 I;  5IGF A;  5KEE A;  1RF2 D;  1HCZ A;  2XNA C;  1UWV A;  3QOL A;  4DA2 A;  5AJ3 L;  2K52 A;  4H13 C;  5GAE C;  1IL8 A;  5CV8 A;  3AFQ A;  5J1Z A;  4LAA A;  1YEZ A;  4A3M B;  1K0S A;  1W6K A;  1BOS A;  1ZYR C;  3EVQ A;  4A3E G;  5EBD A;  5FK9 C;  2EYM A;  5LMU L;  1BCP B;  4QUC A;  2OQK A;  2E76 C;  4DV5 Q;  3ZYY X;  4NP5 A;  2F0M A;  3RN2 A;  5IWA L;  4LFC L;  1V43 A;  3HS0 C;  3HZX A;  2N78 A;  4JW0 A;  3K5M A;  5KRU A;  1EOV A;  3KUP A;  4DR5 L;  4Y52 H;  1HA6 A;  3KDF B;  4JI7 Q;  4UY8 C;  2QA4 A;  1HZA A;  1MI2 A;  1GUS A;  3N6R A;  5M5X H;  5DM7 3;  1HFG A;  2VUM G;  3KBX A;  3VR4 A;  3HRZ C;  4IUQ A;  3V2T A;  2B29 A;  4KJO A;  3RLO A;  1QNU A;  4CKE A;  1TII D;  3KJO A;  2I5M X;  4MTK A;  1ONL A;  3NTI A;  2K5D A;  1IL2 A;  1QJO A;  5JOB A;  4DV6 L;  1DOL A;  4J8Q A;  1FJG L;  2ZXO A;  2I5L X;  1CQF A;  3GTJ H;  1UE5 A;  3VR3 A;  4APV A;  2VS1 A;  2ZJP A;  1Q8I A;  4A3F B;  3VR2 A;  2HIX A;  4J15 A;  3WWV A;  3GO5 A;  4C3I H;  3VYR A;  3G4S A;  2L11 A;  4DR7 L;  4LF5 Q;  4KHZ A;  3Q22 A;  5J3B A;  2B2W C;  3P7J A;  2RF4 A;  4FF3 A;  4GNX A;  4XTC S;  4A3G B;  2EXD A;  4KHP Q;  2IT1 A;  2F0Q A;  2K14 A;  3CCQ A;  5C3X A;  3HOW B;  2E2J H;  2ALY B;  5JVG 3;  1KLG D;  5T1G A;  1BBW A;  2EJM A;  1TKW B;  4C2M B;  1HQR D;  3MXP A;  3H15 A;  2L9H A;  3I72 A;  2IY5 B;  2ZT9 C;  3A5Z B;  5DLQ E;  1MBY A;  4JI6 L;  1VQ4 A;  2G9H D;  2JYO A;  4DAM A;  1ZKO A;  2XIW A;  5FJ8 G;  1KRT A;  3G6J B;  3QJY A;  4AQY Q;  1KD1 C;  1SRO A;  1AH9 A;  2EVB A;  1EEI D;  3GTL H;  2F0N A;  1SLJ A;  2BCO A;  2K28 A;  5G3L F;  4DN4 M;  4HJA A;  1LT5 D;  3P75 A;  1Z47 A;  3OYY A;  5AJ3 Q;  1C48 A;  2WB1 B;  3P20 A;  3S2H B;  1EEF D;  5JEA H;  3RN5 A;  2X6G A;  3CCR A;  3IFT A;  5LMU Q;  1E1O A;  4ZKC B;  1JB7 A;  1CA5 A;  2NVX B;  3OIP A;  1YHQ A;  1BBX C;  1U9R A;  1EUJ A;  3GTQ H;  1JQY D;  3HOV G;  1VQC A;  4ZUI A;  3PMF A;  4UP9 A;  1HZ9 A;  1L1O C;  5IWA Q;  4LFC Q;  1ILQ A;  2Z6B A;  2CHB D;  4RKB A;  3IL8 A;  4A3M G;  1PLF A;  4DR5 Q;  1TWA H;  1NSN S;  2QDB A;  1Q3L A;  2NZO A;  1Z9F A;  1G2S A;  1I50 H;  4DXG A;  2MFI A;  3QB3 A;  4YCV A;  4A3B H;  1HA5 A;  3UDG A;  3Q24 A;  1ESF A;  2F1M A;  4PMC A;  4HSP A;  4C3J H;  2EYP A;  4B3T L;  1V1P A;  1I5F A;  1OXS C;  2HHH L;  4JBM A;  2NVT H;  1TQO A;  1XPO A;  3QIA A;  4ILW A;  2ZXR A;  5K36 G;  4WJ3 M;  4MZ9 A;  1VQ5 A;  3V05 A;  3HOZ H;  4DV6 Q;  1X65 A;  2B63 B;  3H09 A;  3CAM A;  3T16 A;  2DJF C;  2L12 A;  4KJN A;  2Y0S E;  3RR5 A;  2RKS A;  5EPJ A;  3GTP H;  4HSV A;  1A3T A;  4JI0 L;  3KYH C;  3K80 C;  4IUV A;  5JJK A;  4DR7 Q;  5GAH C;  4EVO A;  4RMF A;  4V19 0;  3K7U C;  1UAP A;  2K6A A;  4H0L C;  1ICW A;  5BN5 A;  1C7Y A;  4LWC A;  2N55 A;  4Y7N H;  1WTO A;  3NK9 A;  4ID6 A;  3S1N H;  2XRS D;  5I9O A;  3M7G A;  1QWY A;  3QOJ A;  1K9M C;  3D6W A;  5C4Z A;  3S2D H;  3O13 A;  4A3F G;  1FL0 A;  3BJU A;  4CDE C;  4R8I A;  4C3H B;  4KLK A;  2A6H D;  4ULL A;  1ZXT A;  2NTS A;  2GN5 A;  5A2Q E;  1VF5 C;  5KNB A;  1O7I A;  2PQE A;  1XPU A;  2M2L A;  4X3S A;  4CDD C;  2F0J A;  4NXN L;  5EAY A;  1CT1 D;  4PV1 C;  5IGG A;  1DD2 A;  4QMG A;  3F1Z A;  5C44 B;  2NZ1 D;  3T1H L;  4JV5 L;  1X6O A;  3D31 A;  1GM5 A;  3I4M G;  1HUM A;  3E9I A;  2Z4I A;  1KC8 C;  3HOX H;  3A0J A;  1GUO A;  2E2D C;  1Q1B A;  2NBF A;  4A3I B;  4YY3 L;  1CQV A;  2K5H A;  1IYV A;  1EY0 A;  4CDC C;  2EQS A;  3T56 B;  1K73 C;  3PGZ A;  5I6Y A;  1STE A;  5M5Y B;  2QEJ C;  5FLX L;  1TWG B;  1PH9 A;  2KVM A;  3GTM B;  2PO4 A;  1N9W A;  1RJT A;  3DWA A;  5JAV A;  4BY7 H;  3ND8 A;  3A7A B;  1WCM H;  1VMC A;  1EL0 A;  3MFG A;  1B4O A;  1TWC H;  2R7Z H;  1TXY A;  2IL8 A;  5LMN W;  1CKN A;  1DGS A;  4UPA A;  3WOE A;  5JEA J;  4P75 A;  3OSO A;  1A3U A;  1U0L A;  2EZV A;  3MXU A;  4FXG C;  4YIJ A;  1ML0 D;  1Q86 C;  2HCC A;  2AHO B;  4B3T Q;  3S1R H;  1TS3 A;  3PIP 3;  3AFP A;  4H44 C;  4KTA A;  5EJW A;  4DK3 C;  2VZA A;  4RGO S;  4O2D A;  4DUZ L;  3S16 B;  3L7Z C;  1WTX A;  3GTO H;  5IP9 G;  4X62 L;  4YWM A;  3MFY A;  1BCP C;  1K8M A;  2F03 A;  1RTO A;  1XXG A;  3SK4 A;  2JA5 H;  2JA8 H;  3ICE A;  2L55 A;  3D4W A;  1LTR D;  5M9O A;  4HJ7 A;  4JI0 Q;  3KLS A;  3I56 A;  3BZC A;  2DGY A;  3CU7 A;  2HQE A;  5C4J H;  2NB0 A;  5JPN C;  4H02 A;  3PO2 H;  2B2V C;  2L0C A;  3EBE A;  1S40 A;  3DM1 A;  1A6X A;  4XYQ A;  3KLR A;  2WKC A;  3TP7 A;  1B9N A;  1A3V A;  2ZTE A;  5IE8 A;  4IO9 A;  1Y8N B;  4IUT A;  1I4H A;  3KF6 A;  2EIF A;  3H94 A;  2MO0 A;  3MVV A;  4ALP A;  3VR5 A;  1QZH A;  4JK1 C;  3WDN A;  1HUN A;  4HMI A;  3NWT A;  1OXV A;  2WIN B;  4S3S A;  3TP6 A;  5C4X H;  3MC0 B;  1Y69 U;  4LF7 L;  4QL5 A;  2ICE C;  3J80 c;  4NXN Q;  2H4O A;  1W2B A;  3NTH A;  4DR1 L;  1WTP A;  4DAY A;  2EYO A;  4JC0 A;  4EQ5 A;  5IT9 c;  3RNU A;  2I5H A;  3BYY B;  1DXM A;  4GS3 A;  1QUQ B;  2SOB A;  5DM6 3;  1YNN C;  1U4L A;  1V1O A;  1CUK A;  3OWE B;  3T1H Q;  1LTA D;  4JV5 Q;  2D5D A;  1AE2 A;  1I6V C;  1LO5 D;  4R4Q A;  1PH5 A;  3RZO B;  1VQ6 A;  3IKJ A;  5D3D A;  1K28 A;  2B2Y C;  4A3K B;  3BZK A;  1H9S B;  2D9U A;  3Q6S A;  5IP7 G;  2WAC A;  4DV1 L;  1PHJ A;  1I3Q B;  3I73 A;  1F2L A;  1KRS A;  4DUY L;  3HOY G;  4OXP A;  4JOI C;  1LTB D;  1Q7Y C;  5HGT A;  1FYC A;  4ZAI A;  2F0I A;  5CR3 A;  5C44 G;  1Y1W B;  4GLA C;  4IJH A;  3HKZ E;  3FDT A;  1PTO H;  2SDF A;  4BS9 A;  2CWA A;  3F8T A;  4BY1 H;  5CV6 A;  3A5U A;  2VUM H;  2QGQ A;  3I4N H;  4DV0 L;  5ELE A;  1BNZ A;  4AYB G;  2L15 A;  4DV3 L;  4A3I G;  2E2H B;  1EY5 A;  3D6C A;  3NXW A;  2D2C C;  4DV7 L;  1SR3 A;  1FNW A;  1L1O B;  1M90 C;  5H1S E;  1E2V A;  1XMQ L;  4HCE A;  5M3F H;  3CPW A;  1KAB A;  1II3 A;  4A3E B;  1H95 A;  3E3X A;  4TVA B;  3GV3 A;  1JE5 A;  1TS5 A;  1O7Z A;  1X3Q A;  4K5W A;  1FR3 A;  4HIK A;  3M3Y H;  5I4D A;  4DR4 L;  4JI1 L;  1SMY D;  4DUZ Q;  3LWE A;  2AKW B;  1LTT D;  4X62 Q;  3CQZ H;  5TSS A;  1PMR A;  2PQA B;  1I94 L;  2B8F A;  1TWH B;  1VQG A;  2ES2 A;  1L2F A;  4C1N K;  3HP3 A;  3DEP A;  1GD7 A;  3AMU A;  2EY1 A;  1NJI C;  4BA1 I;  1D8L A;  4BBR H;  2LMC B;  2Z0S A;  3TBI B;  3AEV A;  1YBY A;  2WKD A;  4ZUJ A;  3RLF A;  1ZYR D;  5I6W A;  3T13 A;  3TS0 A;  1G29 1;  2E8G A;  1TS2 A;  1LYL A;  1S72 A;  4L6T B;  2EJF C;  1I4R A;  3TP5 A;  4DFA A;  3CME A;  2G5D A;  1CFM A;  1JCK B;  2A68 D;  4JI4 L;  1EFI D;  2HCI A;  5I9P A;  4QB4 A;  2F52 A;  3NE5 B;  3M4Y A;  4KHV A;  3KLS X;  5COY A;  5C4H A;  5JJL A;  3DM3 A;  4KI0 A;  4CKC A;  4DR1 Q;  4RH6 A;  3D4R A;  4WJW A;  3BYT B;  1EY6 A;  2NWG A;  1ROD A;  5HY6 A;  1WOC A;  4HIM A;  1HRJ A;  5LMN L;  2FXQ A;  3NP8 A;  3VDY A;  2KJX A;  3S17 H;  2E2I H;  1U4R A;  2EYL A;  4L5Q A;  4PMB A;  5E4W C;  2FFK B;  2F0H A;  1IHZ A;  1VQP A;  4F8M A;  4DV1 Q;  1U4M A;  3HOV H;  2VNU D;  1GXD C;  3KOJ A;  1NY4 A;  1XYI A;  2XTI A;  4RAU C;  4DUY Q;  2ID0 A;  3PO3 G;  3H3V I;  1S5C D;  5K5P A;  3VYU A;  3ONA B;  4A3M H;  1SYG A;  2ZTC A;  4A93 G;  2YTX A;  4DNT B;  3J80 E;  3STB D;  1IKL A;  2OEO A;  2OF1 A;  3EN2 A;  3KDF A;  1CSP A;  3MXN A;  4DV0 Q;  3HOU G;  3NBH B;  2YU9 B;  4DV3 Q;  2YTV A;  4JYA L;  1KXL A;  3I90 A;  4DV7 Q;  4ZQ3 A;  3R2I A;  1ENA A;  5F2D A;  1PYS B;  2VXW A;  4K5X A;  1M8A A;  1X56 A;  2R92 B;  4IFD H;  3BVM A;  5EBC A;  1XMQ Q;  5J22 A;  1Y1W G;  5FOB B;  3PUW A;  4TSS A;  1GO3 E;  1SYB A;  3FRP B;  1MJC A;  2LS0 1;  5C0X J;  2UUA L;  1PRT D;  1GOZ A;  5ELD A;  2YYZ A;  3BG3 A;  2KCT A;  1Q82 C;  4KMU C;  2D0P A;  4MN3 A;  2Y0S G;  4DR4 Q;  2Q8T A;  4JI1 Q;  3UI2 A;  1JJG A;  2K1B A;  2UUB L;  1MIU A;  3HOV B;  4BXX G;  3VA5 A;  3N52 A;  1TU2 B;  1SAP A;  3BVZ A;  1I94 Q;  3A55 A;  5A2Q L;  5AFW A;  1G91 A;  1IBM L;  2UXB L;  1YNJ D;  2MPM A;  3X3N A;  4CJ0 B;  2L4N A;  2C9O A;  4XDX A;  4B9W A;  4P74 A;  1DM0 B;  1NR2 A;  4A4I A;  3CMA A;  1XJV A;  4K14 A;  1QVC A;  1RDP D;  3LWU A;  4QCL A;  4LK1 C;  1M4V A;  1L0X B;  1G6P A;  3TRZ A;  2RQX A;  3TRE A;  3NEL A;  4A3F H;  3PF5 A;  3SGI A;  1TT2 A;  2CQO A;  3CD6 A;  2OT2 A;  1E3P A;  2Z8L A;  4BA2 I;  1NMF A;  3MHB A;  3CCU A;  2F0T A;  3OMG A;  3F2D A;  2A8V A;  2KOL A;  4FF2 A;  3M85 A;  4A3G H;  5CV7 A;  1IZ6 A;  1RD9 D;  2JQO A;  4JI4 Q;  4AYB E;  1EIG A;  4FXD A;  5EKK A;  3BU2 A;  4U68 A;  3HOW H;  3F2B A;  1UUP A;  1MJE A;  1N34 L;  4Q0F A;  1SYE A;  4RWS C;  5JVH 3;  4C2M H;  5FO7 B;  3VR6 A;  2A6E D;  1JOO A;  1BKB A;  3HKZ B;  2IW3 A;  1AN8 A;  2K5W A;  4DNI A;  5GAG C;  1F9Q A;  1PFS A;  5LMN Q;  1D5M C;  5LL6 S;  4FNF A;  4JBW A;  4WFN 3;  1OTC A;  1VS0 A;  2EY5 A;  1Q1E A;  4XQJ A;  1JIC A;  4HJ9 A;  1SXT A;  3M4Q A;  2BE5 D;  2LY7 A;  1EY4 A;  2JE6 I;  1PTO D;  2UXC L;  3D3R A;  2KBN A;  4G7Z C;  2F0O A;  1UE1 A;  1B1Z A;  5BN4 A;  4OO1 G;  3S2H H;  2XGT A;  1XNQ L;  2LFN A;  3J7Z C;  5C0X I;  5M3M G;  3RZD B;  1WYD A;  4CGY B;  2JA6 B;  4CJ1 B;  1IW7 C;  3I70 A;  3AB9 A;  3DHQ A;  1EQT A;  2B3G A;  4JI2 L;  1EWI A;  4HN7 A;  4N8X 1;  1SE4 A;  1LAC A;  3K0Y A;  2NVX H;  4J6H A;  4LUO A;  4JYA Q;  2OCE A;  1F9S A;  5KND A;  2LKV A;  1HTP A;  1STB A;  3I4M B;  2GVB A;  1S5D D;  2K5V A;  4G7H C;  1CHP D;  3OPO A;  1I4X A;  4A3L H;  4LFB L;  4RFB A;  2UUA Q;  3C3L A;  3HFZ B;  5IP9 H;  1SYC A;  2AMC B;  5FKA C;  5IY0 A;  2DNC A;  4F7X A;  2JA7 B;  2FJ2 A;  3K7A B;  4IZ8 A;  3T4A C;  4GLV B;  4OO1 I;  1K8A C;  1JJC B;  3GP7 A;  5CBA E;  3L9A X;  2UUB Q;  4IUN A;  1KNE A;  1O7Y A;  3QR8 A;  4RGM A;  1QOH A;  4QGU A;  2NYZ D;  2R92 G;  4XQN A;  1KDC A;  2PI2 E;  1IBM Q;  2UXB Q;  3K59 A;  3DWP A;  2LXJ A;  2R3Z A;  4GOP C;  4GN4 B;  2B63 H;  2CVR A;  4BBS G;  4KY6 A;  3GTG B;  4BWG B;  1D5X C;  1D5Z C;  5GQO A;  2R93 G;  2B2U C;  5DAU A;  3FPP A;  1PFM A;  1Y1V G;  2SNS A;  2F0S A;  1IKM A;  1EYD A;  3RMH A;  1YIJ A;  2NVY B;  1QNK A;  2ZJQ A;  1ESR A;  2L5T A;  3ULJ A;  1GHJ A;  1QCB D;  4NW2 A;  4L5T A;  1PV4 A;  4XIG S;  1SE2 A;  1N34 Q;  4C3H H;  3D0F A;  2Z6K C;  2V1C C;  1Z7T A;  1A2U A;  1UE7 A;  1R4P B;  1KDA A;  4R4O A;  4DR2 L;  5IIF A;  4CJ2 C;  2B2T C;  3G7L A;  4NB3 A;  4IUU A;  4NKL A;  2QCP X;  5KGU A;  4P71 A;  4DK1 A;  2Q2U A;  1PH2 A;  3JC6 6;  1TS4 A;  2RCN A;  2CCZ A;  5C44 H;  1I4G A;  1I4Q A;  1BQQ T;  3E9H A;  1BUV T;  1C9O A;  4R9W A;  5ISR A;  2UXC Q;  3I3C A;  4B3R L;  3HKZ G;  4MIU A;  2K75 A;  1XNQ Q;  3TME A;  2VW9 A;  4A3I H;  1VQD A;  4U67 3;  3MXG A;  3PSI A;  3CPF A;  1WJJ A;  5IYB G;  4JI2 Q;  3CXC A;  2HUG A;  4TRD A;  5LHY 1;  2UUC L;  1YJW A;  1CI3 M;  1EQV A;  2MP1 A;  4WRD A;  5M5Y H;  1IXR A;  1TWG H;  2PCF B;  2QKI C;  3SXH A;  1DZ1 A;  1I6H B;  3IAY A;  3GTM H;  1UEA B;  4O42 A;  3F2U A;  3CRK C;  5IYC H;  1WD1 A;  1OO9 B;  2JA6 G;  4LFB Q;  1E22 A;  1XMO L;  3M7N A;  2WFW A;  1EOT A;  2DN8 A;  3B6Y A;  4KN7 C;  3HOY B;  3KLW A;  1N36 L;  2PW7 A;  4DR6 L;  2OXP A;  2KUM A;  4Q5V A;  4ZRZ A;  2YTY A;  1TWF B;  3ERS X;  4LF8 L;  2PW5 A;  1BR9 A;  2K01 A;  5FLM H;  3S1Q B;  1PFB A;  3S1M B;  2EYJ A;  1HR0 L;  4M1U B;  3H6M A;  4PG3 A;  4RGN A;  2KQ3 A;  2IHF A;  3VYT A;  4F87 A;  4AYB B;  1SYD A;  4JBJ A;  4FYD A;  1YNN D;  4OGQ C;  4NXM L;  3S16 H;  3NQI A;  3D8G A;  2H5X A;  3A8J E;  2JA7 G;  1PH8 A;  2SNM A;  1VQH A;  1NTG A;  1LTL A;  3OHX C;  4AH6 A;  2KHI A;  4PNY A;  3TEH B;  2MQH A;  3ULL A;  4DKA C;  2DNE A;  2B2W A;  1X3F A;  2ZTD A;  4G7O C;  3IRB A;  2XSC A;  3RUZ A;  4HMJ A;  1STA A;  1N33 L;  4GN3 B;  1MD2 D;  3CHB D;  5EKL A;  5LL6 X;  2CW0 D;  2AQ2 B;  4OON A;  2N8N A;  3BVG A;  5ELB A;  1E7Z A;  2PPB C;  3S15 B;  1KLU D;  2LXK A;  4XYO A;  2F3W A;  1O80 A; 
#chains in the Genus database with same CATH homology
 2PNR C;  4FVM A;  3R8B A;  1CK1 A;  3J80 L;  1OXT A;  1WTQ A;  2NVQ B;  2A69 D;  1WTV A;  4K8J A;  3W2D A;  1KAA A;  3LNN A;  1NUC A;  5IT9 L;  4C1N I;  1EY8 A;  2EXZ A;  3ITP A;  1F2Z A;  4B9X A;  3DUZ A;  2F0F A;  1H9S A;  2NN6 H;  2X6L A;  3PUX A;  1FNU A;  1QE6 A;  3U9S A;  1HFN A;  3W3A A;  2K05 A;  3JAM L;  3OIQ A;  3A8I E;  3X3M A;  5JJZ A;  3TN2 A;  1SNP A;  1JB3 A;  1V8Q A;  1PRT F;  4H7B A;  1KTK A;  2CQA A;  5G3L D;  4HED A;  5JEA G;  1TR5 A;  2FIN B;  4LJZ C;  2A6H C;  3I8Z A;  1B53 A;  4DXF A;  1DYQ A;  2I07 B;  2R6G A;  5EKI A;  5D3I B;  4A3D B;  4EQO A;  4M8A A;  3SK8 A;  2MGS A;  1AZP A;  1SJH D;  2EYH A;  1BO0 A;  5DNF A;  2XWB B;  3PO3 B;  1HXY D;  2D62 A;  4A93 B;  3MWY W;  4OIJ A;  3OWF A;  1VF7 A;  1PRT B;  3TP8 A;  3HOU B;  4LMQ D;  4UDU C;  2F4I A;  4J1M A;  1VCI A;  1RTN A;  2AUK A;  4C3J G;  5IOD A;  3EFX D;  2M9V A;  4KY7 A;  1PYW D;  2N88 A;  3EQL C;  2AWO A;  4KN4 C;  2F0E A;  2Y0S B;  3BS1 A;  1VDZ A;  3SVM A;  2RA4 A;  5CV9 A;  3T53 B;  1AEX A;  2RDH A;  3SK5 A;  2FMM A;  1STG A;  1AP0 A;  3RD4 A;  5HUR A;  3ERO A;  1LAB A;  1B50 A;  5C5L A;  4X3U A;  2F0G A;  1H9R A;  3K58 A;  3V96 A;  2MUY A;  1DJR D;  5BN3 A;  1B9M A;  4EQP A;  1BF4 A;  1DCZ A;  4HR7 B;  4ODG A;  2KA7 A;  2F0V A;  4KKS A;  1STH A;  2R61 A;  3TSS A;  4G57 A;  1X3P A;  1DOM A;  1EZ8 A;  1QG7 A;  2RDF A;  1EWH A;  5DEH A;  1PFN A;  2NTT A;  4RHR A;  4R8N A;  3Q0A A;  2JP1 A;  3NBH A;  4FF1 A;  3NSW A;  3EA6 A;  4HAE A;  3NPP A;  4KKT A;  1F9P A;  5EPK A;  5M5W B;  1U4P A;  1GUN A;  2XVS A;  1D1I A;  1XWE A;  1BXT A;  1LV9 A;  1JWU D;  2PYK A;  5M3M B;  1S5E D;  4CHT B;  3PV0 A;  3C2P A;  5KYI A;  1EU4 A;  1S5B D;  1S5F D;  1LTG D;  4QF4 A;  3GQB A;  1X32 A;  2SEB D;  5FLX E;  3QWN A;  1SNQ A;  1B44 D;  4TKO B;  1FD7 D;  2B2V A;  1PDQ A;  1JOR A;  5CC4 A;  2O5I C;  3TZD A;  4DAP A;  3C1E A;  2J0T D;  2O4X A;  2EPB A;  1GUW A;  4DGZ A;  2VB2 X;  4RCN A;  1RKN A;  5K36 H;  1VMP A;  1W6J A;  3FVQ A;  2F0U A;  4BBS B;  1ENF A;  4A3J B;  2AQ1 B;  1CHQ D;  1K83 B;  2R93 B;  1Y1V B;  2KCC A;  5C3E B;  3ERQ A;  4K8I A;  5COR A;  4DF7 A;  1SMY C;  2WII B;  4F88 A;  1LLR D;  4C56 C;  3MAQ A;  4L8J A;  2V4D A;  4ZK9 B;  2A73 B;  2A5H A;  4KV6 A;  2Z1C A;  2B2Y A;  2RBM A;  2K33 A;  1SNM A;  1SDF A;  3PUY A;  3L3O C;  4K5V A;  2XRQ D;  3S14 B;  1GUG A;  1KDB A;  3H0G B;  2Q8I B;  2KEE A;  2A68 C;  3GTK B;  3BDO A;  2KED A;  5C0X G;  3WOF A;  4XT1 B;  3M4O B;  2WP8 J;  3CRL C;  1EWC A;  2JXM B;  1WTR A;  3DEO A;  1R9T B;  3NQT A;  1SFO B;  1EYA A;  5E1F A;  4E6I A;  1CTM A;  3H3V C;  3GD7 A;  3DWQ A;  3MZ5 A;  4N9T A;  4HCS A;  1G8Z D;  2RSO A;  4IQZ A;  3SHL A;  2QIL A;  5EGT A;  2HDL A;  2ZXP A;  4ME5 A;  4UAI A;  1ENC A;  3FEW X;  4ABN A;  1JWM D;  5CBE E;  1PXU A;  2I46 A;  2JEB I;  1B3A A;  4IN3 A;  5CV5 A;  2EYF A;  1BDO A;  3E0J A;  3NTK A;  2ICI A;  5M5X B;  3EJI A;  2Q8R E;  3BZD B;  2TSS A;  1OXU A;  1TY0 A;  1SNC A;  5JPM C;  3FMC A;  3MA2 B;  1S4Z A;  1D2B A;  2M00 A;  5J39 A;  1LTS D;  1PRT C;  2X69 A;  3MEH A;  1STY A;  1AW7 A;  1TVX A;  1MGS A;  5CYU A;  4K2K A;  3GTJ B;  4OL7 A;  2VB3 X;  3BDL A;  1FNV A;  3VA7 A;  4IFD J;  1YNJ C;  2ENB A;  4C3I B;  2K04 A;  3J81 E;  4MHE A;  2NUC A;  2XN9 C;  1ET6 A;  2K7V A;  5IGB A;  1G6Z A;  1Y8O B;  1MSH A;  2BDO A;  1SE3 A;  2JSO A;  4DAV A;  1Y8P B;  1STN A;  2E2J B;  2F0D A;  4PQX A;  4ZKB B;  5IGC A;  1NR4 A;  2BA1 A;  4XXE A;  1JE4 A;  1SSO A;  2EY2 A;  3NHH A;  4K6L A;  4QIW B;  2WV6 D;  1SYF A;  2L1B A;  4KY5 A;  1HQM C;  2K32 A;  3SE0 A;  2PZU A;  2O5J C;  3KBG A;  2A6E C;  2IWH A;  3C46 A;  5KYL A;  3DMU A;  2PMZ B;  3GTL B;  4CKB A;  4IUR A;  5ELC A;  1GUT A;  2WAQ B;  1PZI D;  2RSN A;  1A15 A;  4IFD G;  1C4Q A;  4NDX A;  2C5C A;  1XTC D;  1F2M A;  1EY9 A;  1BCP D;  1EYC A;  1H9M A;  2BE5 C;  4G4K A;  1PTO C;  3AU7 A;  5CGK A;  1J9O A;  1JR0 D;  3HEJ A;  2EY6 A;  3GTQ B;  1NCV A;  1H9J A;  2K03 A;  1ZEQ X;  3KK7 A;  1EIH A;  1TWA B;  1I50 B;  4DNR B;  4A3B B;  2KCN A;  2FHT A;  2EDG A;  5KNC A;  4IUP A;  4IFD I;  4C3J B;  3R93 A;  5C3W A;  1HPC A;  2NVT B;  1JC7 A;  2XWJ B;  4P2C B;  2F0K A;  4OHJ A;  4GZY C;  5I2Y A;  3HOZ B;  2IJ0 A;  1OXX K;  1SND A;  2IX0 A;  1LT6 D;  1V1P B;  1JOK A;  2QF7 A;  3GTP B;  2F0P A;  3HGB A;  1C8C A;  2E75 C;  3K5L A;  2IX3 A;  4RHS A;  3BDC A;  3NWS A;  3K6O A;  3SK6 A;  2H1E A;  3P1H A;  3PIO 3;  4X3K A;  1EY7 A;  3VYS A;  1MSG A;  4Y7N B;  3K5O A;  3S1N B;  3J7A F;  2J4X A;  3S2D B;  5FO8 B;  1QIL A;  5CV4 A;  4C3I G;  1KNA A;  1G2T A;  4FP5 D;  1ILP A;  4DU9 A;  3E6Z X;  3NUC A;  4QUF A;  3K5N A;  4FXK C;  1Q12 A;  4KD3 A;  1B2T A;  4Z9C B;  2KEC A;  4CBV A;  1D6E C;  1IYU A;  1AFP A;  1LT3 D;  1J8I A;  5FO9 B;  5E4X A;  2J7Z A;  3HOX B;  1E2W A;  2Z4H A;  5CMD A;  3OMC A;  2BA0 A;  4RKL A;  3I4L A;  3TZU A;  1QB5 D;  2AQ3 B;  4X3T A;  1SEB D;  1T5E A;  2IPK D;  2B2U A;  2MHV A;  1EU3 A;  1JOQ A;  4BY7 B;  3I91 A;  4N9P A;  2IX1 A;  1WCM B;  1R4Q B;  3E5S A;  1TWC B;  2R7Z B;  2EJG C;  2E74 C;  2K5Q A;  1H9K A;  2RDG A;  3S1R B;  1T5X D;  4XT3 B;  2PZT A;  3U9O A;  3GTO B;  3H91 A;  3URY A;  3Q23 A;  1FGB D;  2JA5 B;  5I2X A;  3MTS A;  2JA8 B;  1CZW A;  2B2T A;  3A56 A;  2AUJ D;  4C3H G;  3A8K E;  1F77 A;  4I7Z C;  5C4J B;  3NBI A;  1Z6H A;  4L63 B;  5C5M A;  3PO2 B;  1WD0 A;  5E3F A;  3SDZ A;  2BDN A;  2EOT A;  1CA6 A;  1CZG A;  1TY2 A;  5IGE A;  4IAL A;  5C0X H;  3FPU B;  1EZ6 A;  4NMZ A;  1O78 A;  2EE1 A;  1AZQ A;  4KK7 A;  2CW0 C;  5C4X B;  4RA8 A;  1SBB B;  2DY7 A;  4O1N A;  3IFD A;  2BOS A;  1PZK D;  1DON A;  3C1F A;  2TMP A;  3S9W A;  1F9R A;  3OW7 A;  1PTO F;  4RGT A;  4ZYS A;  1LTI D;  4FF4 A;  4PMW A;  4OIK A;  2O2L D;  3R2T A;  4RCO A;  5T1I A;  5A35 A;  5ELF A;  2A69 C;  3K57 A;  4OO1 H;  1ET9 A;  2JEA I;  3A7L A;  4EQN A;  3D4D A;  5IOC A;  3FKI B;  3KF8 A;  2F3V A;  2GA4 B;  1PTO B;  4WOR A;  4BY1 B;  2VUM B;  3I4N B;  4B08 A;  1SNO A;  4K6D A;  3T51 B;  2MJ8 A;  2B39 A;  3HG9 A;  3R3O A;  4HTH A;  4TQU S;  4EGV A;  1LT4 D;  3J81 L;  3A54 A;  3J7A V;  5M3F B;  4I65 A;  4DK0 A;  1GJX A;  1Q90 A;  5KIX A;  2RVL A;  1E0B A;  2G9D A;  4ZLT F;  1HHV A;  3SEB A;  3QG1 A;  3M3Y B;  1D1K A;  1UNS A;  2KHS A;  2AWN A;  1NAP A;  4XQQ A;  3CQZ B;  3QO2 A;  4KD4 A;  1F2Y A;  4FO2 A;  4KKU A;  1PZJ D;  1CM9 A;  3LX0 A;  1K8O A;  2F0W A;  1WVL A;  2FMC A;  4BBR B;  1XX8 A;  4K2L A;  5D14 A;  3PUZ A;  1GHK A;  3GV6 A;  3OOC A;  2DY8 A;  1I4P A;  2A74 C;  2NN6 G;  3DXJ C;  5IGD A;  5EQ0 A;  1IW7 D;  1DOK A;  1HTL D;  1A2T A;  5D65 A;  3TDQ A;  3J7Y W;  2PZW A;  1RHP A;  2F0L A;  3PUV A;  5NUC A;  5IT9 E;  1E2Z A;  1JWS D;  1BCP F;  5C6A A;  3CKI B;  1O7L A;  3ND9 A;  1RCV D;  3SR1 A;  3S17 B;  2E2I B;  1L0Y B;  4V0B A;  1SJE D;  3JAM E;  2B8G A;  1WTW A;  2HDM A;  5EPL A;  2NN6 I;  5IGF A;  5KEE A;  1RF2 D;  1HCZ A;  2XNA C;  3QOL A;  4DA2 A;  4H13 C;  1IL8 A;  5CV8 A;  5J1Z A;  4LAA A;  4A3M B;  1W6K A;  1BOS A;  1ZYR C;  3EVQ A;  5EBD A;  5FK9 C;  2EYM A;  1BCP B;  4QUC A;  2E76 C;  3ZYY X;  4NP5 A;  2F0M A;  1V43 A;  3HS0 C;  3HZX A;  3K5M A;  5KRU A;  3KUP A;  1HA6 A;  1MI2 A;  1GUS A;  3N6R A;  5DM7 3;  1HFG A;  3KBX A;  3VR4 A;  3HRZ C;  4IUQ A;  3V2T A;  4KJO A;  1QNU A;  4CKE A;  1TII D;  1ONL A;  3NTI A;  2K5D A;  1QJO A;  5JOB A;  1DOL A;  4J8Q A;  2ZXO A;  1CQF A;  3VR3 A;  1Q8I A;  4A3F B;  3VR2 A;  3GO5 A;  3VYR A;  2L11 A;  4KHZ A;  3Q22 A;  2B2W C;  3P7J A;  4FF3 A;  4XTC S;  4A3G B;  2IT1 A;  2F0Q A;  5C3X A;  3HOW B;  5JVG 3;  1KLG D;  5T1G A;  2EJM A;  1TKW B;  4C2M B;  1HQR D;  3MXP A;  2L9H A;  3I72 A;  2ZT9 C;  1MBY A;  2G9H D;  2JYO A;  1ZKO A;  2XIW A;  3G6J B;  3QJY A;  2EVB A;  1EEI D;  2F0N A;  2BCO A;  2K28 A;  5G3L F;  4DN4 M;  1LT5 D;  3P75 A;  1Z47 A;  1C48 A;  2WB1 B;  3P20 A;  3S2H B;  1EEF D;  5JEA H;  2X6G A;  3IFT A;  4ZKC B;  1CA5 A;  2NVX B;  3OIP A;  1BBX C;  1U9R A;  1JQY D;  4ZUI A;  3PMF A;  1ILQ A;  2CHB D;  4RKB A;  3IL8 A;  1PLF A;  1NSN S;  2QDB A;  1Q3L A;  1G2S A;  4DXG A;  3QB3 A;  1HA5 A;  3Q24 A;  1ESF A;  2F1M A;  4PMC A;  4HSP A;  2EYP A;  1V1P A;  1OXS C;  1TQO A;  3QIA A;  4ILW A;  2ZXR A;  5K36 G;  3V05 A;  2B63 B;  3H09 A;  3T16 A;  2L12 A;  4KJN A;  2RKS A;  5EPJ A;  4HSV A;  1A3T A;  4IUV A;  4EVO A;  4V19 0;  1UAP A;  2K6A A;  4H0L C;  1ICW A;  5BN5 A;  2N55 A;  1WTO A;  3NK9 A;  4ID6 A;  2XRS D;  5I9O A;  3M7G A;  1QWY A;  3QOJ A;  3D6W A;  5C4Z A;  3O13 A;  4R8I A;  4C3H B;  2A6H D;  4ULL A;  1ZXT A;  2NTS A;  5A2Q E;  5KNB A;  1VF5 C;  2PQE A;  2M2L A;  4X3S A;  2F0J A;  1CT1 D;  4PV1 C;  5IGG A;  1DD2 A;  4QMG A;  5C44 B;  2NZ1 D;  3D31 A;  1HUM A;  2Z4I A;  1GUO A;  2E2D C;  1Q1B A;  2NBF A;  4A3I B;  1CQV A;  1IYV A;  1EY0 A;  3T56 B;  5I6Y A;  1STE A;  5M5Y B;  2QEJ C;  5FLX L;  1TWG B;  2KVM A;  3GTM B;  2PO4 A;  1RJT A;  3DWA A;  5JAV A;  3ND8 A;  3A7A B;  1VMC A;  1EL0 A;  3MFG A;  1B4O A;  2IL8 A;  3WOE A;  5JEA J;  3OSO A;  1A3U A;  2EZV A;  3MXU A;  4FXG C;  4YIJ A;  1ML0 D;  2HCC A;  1TS3 A;  3PIP 3;  4H44 C;  4KTA A;  5EJW A;  4RGO S;  3S16 B;  3L7Z C;  1WTX A;  1BCP C;  1K8M A;  3MFY A;  2F03 A;  1RTO A;  1XXG A;  3SK4 A;  2L55 A;  3D4W A;  1LTR D;  5M9O A;  3KLS A;  3CU7 A;  2HQE A;  2NB0 A;  5JPN C;  2B2V C;  2L0C A;  3DM1 A;  1A6X A;  4XYQ A;  3KLR A;  2WKC A;  3TP7 A;  1B9N A;  1A3V A;  1Y8N B;  4IUT A;  1I4H A;  3H94 A;  3MVV A;  3VR5 A;  4JK1 C;  3WDN A;  1HUN A;  4HMI A;  3NWT A;  1OXV A;  2WIN B;  4S3S A;  3TP6 A;  3MC0 B;  1Y69 U;  2ICE C;  2H4O A;  3NTH A;  1WTP A;  4DAY A;  2EYO A;  3BYY B;  1DXM A;  2SOB A;  5DM6 3;  1YNN C;  1U4L A;  1V1O A;  3OWE B;  1LTA D;  2D5D A;  1I6V C;  1LO5 D;  3RZO B;  3IKJ A;  5D3D A;  2B2Y C;  4A3K B;  1H9S B;  2D9U A;  3Q6S A;  2WAC A;  1I3Q B;  3I73 A;  1F2L A;  1LTB D;  5HGT A;  1FYC A;  4ZAI A;  2F0I A;  5CR3 A;  1Y1W B;  3FDT A;  1PTO H;  2SDF A;  4BS9 A;  5CV6 A;  5ELE A;  1BNZ A;  2E2H B;  1EY5 A;  3D6C A;  3NXW A;  2D2C C;  1FNW A;  1E2V A;  4HCE A;  1KAB A;  1II3 A;  4A3E B;  3GV3 A;  1TS5 A;  1O7Z A;  1X3Q A;  4K5W A;  1FR3 A;  5I4D A;  1SMY D;  3LWE A;  1LTT D;  5TSS A;  1PMR A;  2B8F A;  1TWH B;  4C1N K;  3HP3 A;  3DEP A;  3AMU A;  2EY1 A;  4BA1 I;  2LMC B;  3TBI B;  4ZUJ A;  2WKD A;  3RLF A;  1ZYR D;  5I6W A;  3T13 A;  1G29 1;  1TS2 A;  4L6T B;  2EJF C;  1I4R A;  3TP5 A;  4DFA A;  1CFM A;  1JCK B;  2A68 D;  1EFI D;  2HCI A;  5I9P A;  4QB4 A;  3M4Y A;  3NE5 B;  5COY A;  4KHV A;  3KLS X;  5C4H A;  4KI0 A;  4CKC A;  4RH6 A;  3D4R A;  4WJW A;  3BYT B;  1EY6 A;  2NWG A;  1ROD A;  1HRJ A;  3NP8 A;  2KJX A;  1U4R A;  2EYL A;  4PMB A;  5E4W C;  2FFK B;  2F0H A;  1IHZ A;  4F8M A;  1U4M A;  2VNU D;  1GXD C;  1XYI A;  4RAU C;  2ID0 A;  1S5C D;  5K5P A;  3VYU A;  3ONA B;  1SYG A;  4DNT B;  3J80 E;  1IKL A;  2OEO A;  2OF1 A;  3MXN A;  2YU9 B;  3I90 A;  4ZQ3 A;  3R2I A;  1ENA A;  5F2D A;  2VXW A;  4K5X A;  1M8A A;  2R92 B;  4IFD H;  3BVM A;  5EBC A;  5J22 A;  5FOB B;  3PUW A;  4TSS A;  1SYB A;  3FRP B;  2LS0 1;  5C0X J;  1PRT D;  1GOZ A;  5ELD A;  2YYZ A;  3BG3 A;  4KMU C;  4MN3 A;  2Q8T A;  3UI2 A;  2K1B A;  3HOV B;  3VA5 A;  3N52 A;  1TU2 B;  1SAP A;  3BVZ A;  3A55 A;  5A2Q L;  5AFW A;  1G91 A;  1YNJ D;  2MPM A;  3X3N A;  4CJ0 B;  2L4N A;  2C9O A;  4XDX A;  4B9W A;  1DM0 B;  1NR2 A;  4K14 A;  1RDP D;  3LWU A;  4QCL A;  4LK1 C;  1M4V A;  1L0X B;  2RQX A;  1TT2 A;  2OT2 A;  2Z8L A;  4BA2 I;  3MHB A;  2F0T A;  3OMG A;  2KOL A;  4FF2 A;  3M85 A;  5CV7 A;  1RD9 D;  1EIG A;  4FXD A;  5EKK A;  4U68 A;  1UUP A;  4Q0F A;  1SYE A;  4RWS C;  5JVH 3;  5FO7 B;  3VR6 A;  2A6E D;  1JOO A;  3HKZ B;  2IW3 A;  1AN8 A;  2K5W A;  1F9Q A;  1D5M C;  5LL6 S;  4FNF A;  4JBW A;  4WFN 3;  2EY5 A;  1Q1E A;  4XQJ A;  1JIC A;  1SXT A;  2BE5 D;  2LY7 A;  1EY4 A;  2JE6 I;  1PTO D;  3D3R A;  4G7Z C;  2F0O A;  1B1Z A;  5BN4 A;  4OO1 G;  2LFN A;  5C0X I;  3RZD B;  4CGY B;  2JA6 B;  4CJ1 B;  1IW7 C;  3I70 A;  3AB9 A;  3DHQ A;  1EQT A;  4HN7 A;  1SE4 A;  1LAC A;  3K0Y A;  4J6H A;  1F9S A;  5KND A;  2LKV A;  1HTP A;  1STB A;  3I4M B;  1S5D D;  4G7H C;  1CHP D;  3OPO A;  1I4X A;  4RFB A;  3C3L A;  1SYC A;  5FKA C;  2DNC A;  4F7X A;  2JA7 B;  2FJ2 A;  3K7A B;  4IZ8 A;  3T4A C;  4OO1 I;  3GP7 A;  5CBA E;  3L9A X;  4IUN A;  1KNE A;  1O7Y A;  4RGM A;  1QOH A;  2NYZ D;  4XQN A;  1KDC A;  3K59 A;  3DWP A;  2R3Z A;  2CVR A;  4KY6 A;  3GTG B;  4BWG B;  1D5X C;  1D5Z C;  2B2U C;  5DAU A;  3FPP A;  1PFM A;  2SNS A;  2F0S A;  1IKM A;  1EYD A;  3RMH A;  2NVY B;  1QNK A;  1ESR A;  2L5T A;  1GHJ A;  1QCB D;  4NW2 A;  4XIG S;  1SE2 A;  1Z7T A;  1A2U A;  1R4P B;  1KDA A;  5IIF A;  4CJ2 C;  2B2T C;  3G7L A;  4IUU A;  4NKL A;  2QCP X;  5KGU A;  4DK1 A;  1TS4 A;  1I4G A;  1I4Q A;  1BQQ T;  1BUV T;  4R9W A;  5ISR A;  3I3C A;  4MIU A;  3TME A;  4U67 3;  3MXG A;  2HUG A;  4TRD A;  5LHY 1;  1CI3 M;  1EQV A;  2MP1 A;  4WRD A;  2PCF B;  3SXH A;  2QKI C;  1DZ1 A;  1I6H B;  3IAY A;  1UEA B;  4O42 A;  3F2U A;  3CRK C;  1WD1 A;  1OO9 B;  3M7N A;  1EOT A;  2DN8 A;  4KN7 C;  3HOY B;  2PW7 A;  2OXP A;  2KUM A;  4Q5V A;  4ZRZ A;  1TWF B;  2PW5 A;  1BR9 A;  2K01 A;  3S1Q B;  1PFB A;  3S1M B;  2EYJ A;  4M1U B;  3H6M A;  4RGN A;  2KQ3 A;  4F87 A;  3VYT A;  4AYB B;  1SYD A;  4FYD A;  1YNN D;  4OGQ C;  3NQI A;  3D8G A;  3A8J E;  2SNM A;  3OHX C;  4PNY A;  2DNE A;  2B2W A;  4G7O C;  3RUZ A;  2XSC A;  4HMJ A;  1STA A;  1MD2 D;  3CHB D;  5EKL A;  5LL6 X;  2CW0 D;  2AQ2 B;  3BVG A;  5ELB A;  2PPB C;  3S15 B;  1KLU D;  4XYO A;  2F3W A;  1O80 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...