1N36Q

Structure of the thermus thermophilus 30s ribosomal subunit in the presence of crystallographically disordered codon and near-cognate transfer rna anticodon stem-loop mismatched at the second codon position
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
104
structure length
104
Chain Sequence
b'PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
molecule tags Ribosome
total genus 18
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1n36Q00
1TWFH 1G291 3PGZA 4P73A 2VQEL 3W1GA 1YJ9A 4JV5Q 3GO5A 1TWAH 3AFQA 1IBMQ 4GKKQ 2JA6H 2NVQH 4DV1L 4B3TL 1BBWA 1JJCB 4DAMA 1JMCA 3CCQA 3HOWG 4OX9L 4DR7L 4DV4L 1KL9A 1BBUA 5C4XH 2F3IA 1K8GA 3GTGH 1AE3A 3PCOB 3S2HH 5LMNW 2EQSA 4DV0L 4HJ7A 2PI2A 3OYYA 1PYBA 4DR1Q 5FJ8H 4BBSG 4HJ9A 2I5MX 2OQKA 1XJVA 4LUOA 2UUAL 3M4QA 1Y1VG 3GTQH 1PH3A 4POFA 3H3VH 4DR4Q 1YEZA 3PF4A 3L2PA 4AH6A 2VL6A 3HOUG 1SROA 5IYBG 3HOYH 4LF6Q 3J7ZC 3VDYA 4YCWA 2R7DA 3GTOH 4YHHQ 4GLAC 2IHEA 5DLQE 2C35B 1I94L 2EIFA 3U4VA 2OWOA 4JYAL 1HR0L 5M5WH 2A19A 2OTLA 3JAMc 5M5YH 1HH2P 4DR2L 1IBKL 4B3ML 3NELA 2A8VA 4LF5L 1BKBA 4A3CG 3UE1A 2YTVA 2Z6KA 1A62A 4DK6C 2JEAI 3I4OA 2JA9A 1YNXA 1TWHH 3MXNB 3U58A 4L5QA 2PQAA 1UE7A 3M7NA 1SE8A 2F4VQ 3PO2G 1SRUA 2ES2A 1E1TA 3CW2C 2R93G 2HHHQ 1Y1WH 2Q2HA 4X66L 1E24A 1YHBA 4C2MH 4DV5L 4DR5Q 3MEFA 3KJOA 1ASYA 1XNQL 2JA6G 2XTIA 2UUBL 4X65Q 2UXCQ 1J5EQ 2PI2E 1VQGA 2MQHA 1YITA 2K52A 1GO3E 3ZJYC 3I7FA 5HY6A 2CQOA 4JBWA 4UP7A 2IY5B 1B8AA 4B3SL 1GKHA 2VZAA 4DPGA 4IJHA 2QGQA 5GROA 2VQEQ 3FHWA 3PUXA 4J15A 4YWMA 4JI7Q 4DV1Q 4B3TQ 4A3JH 3D31A 1YHQA 1KQSA 3S14H 4OX9Q 1A63A 3M9BA 4UPAA 1YZ6A 4DV4Q 4DR7Q 1SLJA 3GTPH 1D8LA 4BY1H 2CWPA 3HOYG 2RCNA 4IFDG 4EQ5A 2R7ZG 4A3EH 2K5HA 2MFIA 4DV0Q 4DV2L 4QL5A 1VQPA 3E9IA 2NVYH 2WB1G 2R92H 4B3RL 4LFAL 1K3RA 3RZOH 4JOIC 1I3QH 4A3DH 3EIVA 4A3IH 2UUAQ 1EIYB 1TWCH 4OWXB 4A3LH 1UEBA 5JJIA 1PH2A 5LMNL 3HOZH 1CSPA 1N36L 2HQLA 1Q7YC 4JBMA 3UE0A 3NBHB 3S15H 2OTJA 4JI5L 2HT1A 2E2JH 1S40A 4LUZA 1WYDA 4A3FG 2D0PA 1PH1A 1CSQA 4KHZA 3I55A 3CP0A 1V1QA 1I94Q 2ZJQA 4JYAQ 1HR0Q 3H15A 2BH2A 1WCMH 1N8RC 4DR2Q 1L1OC 1X3FA 2DGYA 2PNHA 4IOCA 1IBKQ 1VQ7A 4UP8A 4B3MQ 4JI0L 5IYDG 4P75A 2MO0A 3KYHC 1YJNA 2IHFA 4BA1I 4LF5Q 3RNUA 3CCJA 4L5SA 5IWAL 2B63H 1NE3A 2AWNA 1HNWQ 4DR6L 1SR3A 1OXSC 3STBC 1C7YA 2I5HA 5C0XI 2JA8G 4OO1G 4X62L 2BA1A 1X65A 1FGUA 5C4JH 2ATWA 1K8AC 3HOVH 1L1OB 1WJJA 5IP9H 4X66Q 2N3SA 3I4MH 1N33L 4DV5Q 2CFMA 1XNQQ 1XNRL 4A3JG 1VQEA 1CUKA 2WFWA 2UUBQ 2E2IH 5C44H 2YTYA 2NN6I 1RIPA 1FVIA 5IT9c 4R4TA 4A3KH 5BR8L 1K73C 1VQ6A 1VS0A 4JCVE 1YJWA 4B3SQ 1VQMA 1GM5A 2R92G 1W2BA 1VQ5A 1KAWA 4A3IG 3M85A 1Q1EA 3RLFA 1HNXL 4A3LG 4DNIA 2HIXA 1S72A 4BY7H 1K9MC 1X9NA 1PH6A 5AJ3L 1Q12A 3HOZG 5M3FH 3RN5A 1MKHA 3CMEA 3RLNA 4C3IH 4UY8C 3AEVA 3I2ZA 5FLXc 1NMGA 5C3EG 3S16H 2KCMA 1SFOH 1E22A 2A1AA 1QZGA 4WJ4A 2I5LX 4DV2Q 3BU2A 2Z0SA 4B3RQ 4LFAQ 2NZHA 1EIFA 1HZAA 2JA5H 4DKAC 5LMNQ 2B63G 1Z9FA 4BBRG 3NENA 1N36Q 1NJIC 4NXNL 2UXBL 1VCIA 4AYBG 1XMQL 4PZ6A 4JI5Q 3CPFA 3BZCA 4KI0A 4A3MH 1LUZA 1HNZL 1G6PA 1BVSA 2F52A 4DR3L 2EXDA 5IP9G 4GKJL 1VQFA 1UWVA 4R4QA 1XMOL 2YTXA 2CKZB 1YHAA 2NZOA 3JAMi 4JI0Q 4LF7L 2MO1A 3HOXH 5LMUL 3K81C 3RR5A 5IWAQ 1UE6A 3G71A 2XGTA 4H02A 3F2CA 4A3KG 4LW1A 4AYBE 4DR6Q 1T9HA 3I4NH 4YCUA 4X62Q 4RMFA 1XPOA 1N32Q 4A93G 4LFCL 1U5KA 3CF5A 3M4OH 1R9TH 4BY7G 1QUQB 2E2HH 5IE8A 1N33Q 1LYLA 2E5LL 2VUMH 4A3GH 3T1YL 1JE5A 2UXDL 2KHIA 1XNRQ 4JI6L 2ID0A 4IPCA 5M3MH 3AQQA 3G4SA 1OXXK 1NY4A 3J81c 4DUZL 4GOPC 2JEBI 5BR8Q 4HIOA 3BZKA 3K7AH 3M4PA 1WOCA 3PIOA 1EQRA 3CC4A 4QQBX 3S2DH 3CCUA 1X3GA 3ER0A 3KJPA 2IX1A 1B7YB 1JT8A 2K14A 3S1QH 2JA5G 2JQOA 5C4XG 3ICEA 5JEAJ 4QGUA 2KBNA 5AJ3Q 4POGA 4GOPB 5FJ8G 4A4IA 4GN5A 4JI3L 4JI1L 4A3MG 4JOIA 3J81j 1KD1C 1FJGL 3HKZG 2VQFL 3PSIA 4JI2L 1C0AA 4HJ5A 1Q82C 4JI8L 2V1CC 3HOXG 1EOVA 4R1JA 3CD6A 1G51A 4NXNQ 3ULLA 2BH8A 3RN2A 1XMQQ 4L5RC 1HZCA 2UXBQ 2K4KA 2KCTA 5ELNA 3L0OA 3TS0A 4JBKA 1VQJA 2IX0A 1L1OA 3HKZE 1HNZQ 3TRZA 2E8GA 4DR3Q 1Q81C 4DV7L 2VUMG 4LF8L 4A3GG 4QJFA 4GKJQ 3UDGA 2Y0SG 1XMOQ 4LF7Q 3I56A 5LMUQ 1VQKA 3J7A5 4DV3L 1DGSA 1M90C 5E7NA 3ULJA 1YVCA 1Y1WG 1QVGA 1CKMA 1MJCA 1VQDA 5GAGC 3GDEA 4LF4L 5HGQA 1VQAA 1NTGA 4EX5A 3CCMA 5C0XJ 4LFCQ 3GTLH 1ASZA 3S17H 4GN3B 2JA7H 3DLLA 1AH9A 2E5LQ 4A3BH 1S3OA 2Y0SE 1XTDA 3E0EA 3T1YQ 2UXDQ 5H1SE 1MJEA 5EAYA 4JI6Q 2QEXA 2OCEA 2D0OA 5IYCH 1Q86C 5K36G 5IP7H 2N49A 5GQOA 1L0WA 4DUZQ 1EYGA 4IPGA 3Q8DA 2K50A 1WFQA 1K83H 3FP9A 4P71A 2ZTEA 4JC0A 1VQOA 3CC7A 4X64L 4OONA 4OWWB 1P16A 4ME3A 5IY0A 3PO3H 3U4ZA 1HR0W 4BY1G 2KENA 3CC2A 1YI2A 3PF5A 2AHOB 4A3EG 4L5TA 1O7IA 2OQ0A 1XPUA 4BBSH 1Q8KA 4LWCA 4JI3Q 4KHPL 1E7ZA 4JI1Q 3A5UA 4GLXA 1FJGQ 4A3DG 1EUJA 4IPDA 2CWAA 4LF9L 1FL0A 1X3EA 1EWIA 2VQFQ 4JI2Q 4NXML 1VQNA 1VQCA 2N78A 2K5NA 3NEMA 1JJ2A 1B70B 4JI8Q 3F1ZA 3U50C 1L2FA 4A76A 1QVFA 3HOUH 2GVAA 5IYBH 3T1HL 4MZ9A 4R4IA 5JEAG 4JI4L 3G6EA 1PH4A 3B6YA 4DUYL 1WCMG 2Q2TA 5JJLA 1EFWA 3J80c 1YIJA 1RL2A 4O0AA 1QUQA 1D7QA 3HFZB 2NVXH 3KDFB 3S1RH 2UXCL 4DV7Q 2Q2UA 3K80C 1UE5A 4LF8Q 4A3BG 3GTJH 1KRTA 2YV5A 1PFSA 2WP8J 3RLOA 4NPSA 3F2DA 1P8LA 1GVPA 4GNXC 3STBD 3KOJA 4AIMA 1CKNB 5IYCG 4DV3Q 1PV4A 1YBYA 5GAEC 1HJPA 4KLKA 4LNQA 3HOVG 3PO2H 3I4MG 4IFDI 2R93H 2ASBA 4O2DA 1C9OA 1VQ8A 4LF4Q 3PV0A 1PHJA 4C3HH 3K7UC 4JI7L 3PO3G 5C44G 4XTCS 4JBJA 3KF8B 2VS1A 4GNXB 1NMFA 4GOPA 3EBEA 2LXKA 2R7FA 2ZTDA 3TQYA 1PH8A 1SN8A 1Y14B 2ALYB 1IL2A 1H95A 2CCZA 2JE6I 4PZ7A 4MTNA 4PG3A 4BXXH 3S1MH 5JJKA 2GN5A 4UP9A 3J81i 4HIDA 4HJAA 1V9PA 2ZM6L 3LGJA 3TEHB 3S24A 4X64Q 5M3FG 1N34L 5IP7G 1I6HH 2H5XA 1EQQA 4Y52H 1JJGA 2YU9H 3KF6B 3PUVA 4YCVA 5C0XG 2ZTCA 3K0XA 3JC66 4IO9A 2HIVA 3GTMH 3FKIH 4OO1I 1IXRA 1KC8C 2R7ZH 3K8AA 1K0RA 1VQBA 4KHPQ 5J3BA 3A5ZB 1HNXQ 5ELOA 3KLWA 1E1OA 3OTOL 4LF9Q 2K75A 4A75A 4NXMQ 4K0KL 2NN6G 5FLMH 3OW2A 4X6AH 1HNWL 4R4OA 3CCRA 3H0GH 1LM0A 2I0QA 2UUCL 1SMXA 1HZ9A 4JG2A 4APVA 3T1HQ 2VY3A 3ULPA 2RF4A 1E3PA 4A3FH 2KHJA 4JI4Q 4YWLA 2LXJA 3W1BA 4DUYQ 4AQYL 1X6OA 1VQ4A 3GTKH 4WJ3M 2ZJPA 5M5XH 5GADC 5IYDH 4HJ8A 3HKSA 3CPWA 2Z6KC 2NVTH 4DV6L 3I4NG 4Y7NH 1IBLL 4NB3A 3F8TA 4R4CA 4YY3L 2UU9L 2JA8H 2JJQA 4BXXG 4MNOA 1QZHA 2BA0A 3CAMA 2LSSA 3EN2A 3GD7A 1XPRA 4DK3C 3A0JA 4BA2I 1KXLA 1A8VA 3AFPA 3RZDH 1MIUA 1AE2A 1Q46A 4GS3A 1HZBA 3UDIA 2DUDA 1M1KC 5M3MG 2WAQG 1U0LA 4OWTB 1PYSB 4TVAB 3D0FA 2D62A 4YWKA 4LFBL 3PUZA 3AYHB 1N32L 4ALPA 2PQAB 2RHQB 1KHIA 4P74A 4IPHA 3PIPA 1NBWA 4TQUS 3PUWA 1UE1A 3FKIG 2MNAA 1PH9A 4JV5L 1IBML 1X54A 2RHSB 4GKKL 4GN4B 2VNUD 2R6GA 1OXUA 4PZ8A 1LTLA 3BJUA 3CCLA 1OXTA 2ZM6Q 1PA6A 5FLMG 1N34Q 3G48A 4QIWE 2WAQE 3CCVA 4XIGS 4FDBA 2PMZE 1J6QA 1VQ9A 1VQLA 4DR1L 3H0GG 3TREA 2AWOA 2AMCB 5C3EH 4QY7A 3UDXA 4LUVA 2YYZA 3ERSX 4DR4L 1V43A 1KRSA 2WB1E 3HOWH 3OTOQ 3KDFA 2FXQA 2B3GA 3CXCA 4DAYB 3L7ZC 1X56A 4K0KQ 4LF6L 1QVCA 1Z47A 1N9WA 3S1NH 2B29A 4YHHL 2K5VA 4BBRH 2ZJRA 1OTCA 1CKNA 1W3SA 5GAHC 2UUCQ 3CQZH 4RG1A 1TXYA 3CMAA 1Q1BA 1TWGH 1VQHA 1A0IA 3W5OA 1Y1VH 2JK8A 1CKOA 1JB7A 3UDFA 4AQYQ 1PH7A 2N8NA 4P72A 3IRBA 3J80i 1IYJB 4GNXA 1KIXA 3WWVA 2F4VL 4IOAA 1VQIA 1GD7A 3PUYA 2QA4A 3CCEA 4DV6Q 2HHHL 1I50H 4HIKA 1IBLQ 3M3YH 4YY3Q 2IT1A 2GVBA 3SGIA 1PH5A 2UU9Q 1OXVA 2Q2IA 4DR5L 2VW9A 1X55A 1IZ6A 1PVOA 4A93H 4X65L 2JA7G 1J5EL 3H3VI 4A3CH 4OXPA 4IJLA 1WI5A 3DM3A 4PMWA 3F2BA 3E9HA 3CCSA 4HIMA 3TS2A 4IFDJ 3KFUA 3KF6A 4LFBQ 1I5FA 4GLVB 2AKWB 2L15A 3A74A 4C3JH
chains in the Genus database with same CATH superfamily
3PGZA 1YJ9A 1RTOA 3GO5A 1H9MA 3W3AA 4DU9A 1JJCB 2CH4A 2MUYA 4RA8A 4RFBA 4EVOA 2HD3A 2F03A 2F3IA 4DXFA 2G9HD 5LMNW 3J80E 3OYYA 1PYBA 3J7AV 5FLXL 4OIKA 2B2TC 2OQKA 1XJVA 3QOLA 2JP1A 1G8ZD 3ND8A 4POFA 2LFNA 3CQZB 5FKAC 1TR5A 4AH6A 1SROA 4LF6Q 1MD2D 3Q24A 3HG9A 4GLAC 4IN3A 1I94L 2OTLA 1PLFA 4FF4A 4OGQC 3NELA 3NPPA 1BKBA 2ZXRA 1GUOA 2EYMA 3UE1A 3K59A 2YTVA 2Z6KA 3NE5B 4ZRZA 1HPCA 2PQAA 1PYWD 2RDFA 1KTKA 1SE8A 3PO2G 2EJMA 1E1TA 2A74C 1CHQD 2NVQB 1Y1WH 4X66L 5C3WA 4C2MH 3BVZA 3MEFA 4DR5Q 5CBEE 3I7FA 3J81L 5CMDA 5C4XB 4CJ0B 4H7BA 4KN7C 4IJHA 2VQEQ 1EFID 1A6XA 1KAAA 3PUXA 4YWMA 2O5IC 1PZJD 2EY2A 4OX9Q 4DR7Q 1YZ6A 2Z1CA 2C5CA 3C46A 2RCNA 4DNTB 4JPBW 2Z9HA 4ZKCB 4R9WA 5I6WA 4DV0Q 3HOXB 3BYTB 1F77A 2UUAQ 4H13C 1PH2A 4JBMA 5C4ZA 1ENAA 3S15H 3UE0A 4FO2A 4V190 1PH1A 1LTID 1V1QA 4JYAQ 1HR0Q 4DR2Q 1L1OC 4IOCA 4B3MQ 2WKDA 3KYHC 1YJNA 2B63H 2A73B 1WTWA 3S1QB 1A15A 2EYLA 1FR3A 2IL8A 4JVZA 2ATWA 3I4MH 1JB3A 1ML0D 1XNQQ 4X3SA 2UUBQ 1EZ8A 4IUPA 3GP7A 1A3VA 4KY5A 2NN6I 5ISRA 1FVIA 5IT9c 4A3KH 1K73C 1EIGA 2RVLA 1VS0A 3GTPB 2N55A 4B3SQ 1GUGA 1ZKOA 3KK7A 1VQMA 1TIID 1VQ5A 3M85A 1Q1EA 3VYUA 2K01A 1S72A 1B53A 3RZOB 1JWUD 1PH6A 1EEFD 1PRTF 4G7HC 1TWCB 5M3FH 2O5JC 1MKHA 4C1NI 4E6IA 1D1IA 3KLSX 3RLNA 5CORA 5C0XH 3AEVA 3VR6A 3S16H 4KJNA 1E2VA 2I5LX 5ELCA 1LO5D 1TY0A 2E74C 3K5LA 1FGBD 1WCMB 4DKAC 4ZK9B 2B63G 4BBRG 4FF3A 3MXNA 2PW5A 4JI5Q 4PZ6A 4KI0A 4A3BB 4DR3L 1K8OA 3D4RA 4GKJL 3J80L 2CW0D 2CKZB 3HOVB 2NZOA 1HA6A 2LKVA 2XNAC 3K81C 3RR5A 2XGTA 4A3KG 2E2IB 4DR6Q 1T9HA 4YCUA 4X62Q 1XPOA 1RCVD 1LACA 2H1EA 4LFCL 5KRUA 2VUMH 1N33Q 2EPBA 2Z4IA 3A56A 1PZKD 4IPCA 3AQQA 1C4QA 1NY4A 1CA5A 2JN4A 2F0IA 2JEBI 4HIOA 3CC4A 3I72A 1BCPC 1HFGA 1MI2A 2IPKD 1B7YB 1PXUA 2JQOA 1AZPA 3T13A 4GOPB 5FJ8G 4A4IA 4I7AA 3S1RB 1HQRD 2B39A 2KQ3A 1SYEA 2F0KA 1O7LA 2PNRC 1X3PA 3PSIA 1Q82C 2Z4HA 2V1CC 4F87A 5IIFA 4L5RC 2BH8A 2UXBQ 2K4KA 5ELNA 3TS0A 3L0OA 4DK0A 1SE3A 1HNZQ 1Q81C 2VUMG 2K04A 4QJFA 1XMOQ 1D5ZC 1MBYA 5LMUQ 1YVCA 5M3MB 1Y8OB 1TVXA 1TS2A 1VQAA 3V2TA 1NTGA 3NSWA 2E5LQ 2UXDQ 3T1YQ 3R2IA 5DAUA 2QEXA 1WTPA 5K36G 2SNMA 1TS5A 1L0WA 1EYGA 4IPGA 3SDZA 3QOJA 2F0OA 3H0GB 3IKJA 2ZTEA 3ERQA 4OONA 3K5NA 4ME3A 1RTNA 3A7AB 3U4ZA 3QB3A 3SXHA 1YI2A 4L5TA 1GUNA 5KYLA 2XVSA 2KCCA 4BBSH 4JI3Q 1UAPA 2SEBD 4JI1Q 4XXEA 3A5UA 1FJGQ 4N9TA 1FL0A 4NXML 2EYHA 3NP8A 5JOBA 1B70B 4JI8Q 2PQEA 3U50C 4PQXA 3HOUH 1J9OA 5JEAG 1SNQA 1SYFA 1PH4A 3B6YA 4DUYL 2Q2TA 1CZGA 3TZDA 1EFWA 5JJLA 1QUQA 1EOTA 3HFZB 5IT9E 4I65A 3GTJH 1KRTA 3C3LA 2YV5A 3T56B 2JA7B 3KOJA 4DV3Q 1CKNB 1PV4A 5I9PA 2KUMA 4KLKA 2F0LA 2R93H 5JPMC 1FNWA 4LF4Q 1HTPA 5C3XA 2ZT9C 5EKLA 5C44G 2VS1A 4K8IA 1JR0D 2LXKA 3TQYA 4KY6A 4DAVA 1H95A 2HCCA 2NTTA 4HSVA 4PZ7A 4BXXH 1EYAA 2MHVA 5EPKA 3PQIA 4RGNA 1SMYC 4HJAA 2ZM6L 1K3BC 3S24A 5A2QE 5IP7G 3SVMA 2H5XA 3Q0AA 1B2TA 4YCVA 4C3IG 1WTXA 1STYA 4PMBA 5KYIA 4G57A 4CBVA 4FF2A 2HIVA 3GTMH 3FKIH 1KC8C 5AFWA 5J3BA 3A5ZB 1HNXQ 3E3XA 1JQYD 4LF9Q 4A75A 2NN6G 4R8NA 1M4VA 2F0GA 3P75A 3CCRA 4IQZA 1SMXA 1MSHA 1PTOD 5JPNC 1CM9A 4A3FH 2KHJA 2VXWA 2LXJA 1X6OA 3GTKH 1LTGD 1DONA 4ZUJA 1KABA 4C3HB 4HJ8A 3CPWA 2AQ2B 4DV6L 3I4NG 1IBLL 2JA8H 4BXXG 1JCKB 2JJQA 3I8ZA 1KDAA 2BA0A 3CAMA 2LSSA 4DGZA 1KXLA 1AE2A 1Q46A 1D5MC 3NTKA 1IHZA 4ME5A 4OWTB 1U0LA 4TVAB 4CDFC 4CHTB 1PFNA 2D62A 4KKTA 3S9WA 4ALPA 2PQAB 1I6HB 2F0TA 4G4KA 1UE1A 3FKIG 1VF7A 2BOSA 5DM73 1AFPA 3BYYB 1LTLA 4ZCKA 1OXTA 1PA6A 1QJOA 5M5YB 4FDBA 1VQ9A 4X3KA 2SNSA 5JVG3 1E2ZA 2YYZA 1TWHB 4DR4L 1KRSA 3HOWH 3KDFA 3MEHA 2RKSA 5A35A 1IL8A 3P1HA 1DOKA 5GAHC 2J0TD 3CQZH 3CMAA 2NVTB 4ULLA 1SDFA 1YNJD 2PO4A 1JB7A 3I91A 3N6RA 2N8NA 3IRBA 3KLSA 4GNXA 3RZDB 1J8IA 3BVMA 2F4VL 4IOAA 3PUYA 3CCEA 2HHHL 2GVBA 2UU9Q 2I07B 2M00A 1IZ6A 2A68D 1VMPA 4IJLA 1WI5A 3F2BA 3E9HA 3TS2A 3KFUA 1HHVA 3KF6A 4ILWA 2NVQH 3X3MA 1N32Q 1T5XD 5IT9L 1Y8PB 4P73A 1TT2A 2WACA 2BCOA 4OEMB 2F3VA 1LTTD 3QIAA 4JV5Q 3AFQA 4GKKQ 2JA6H 4B3TL 3CKIB 4DAMA 5C3EB 3J7YW 3HOWG 4CKEA 4FNFA 1A3UA 1KLUD 4DFAA 5C4XH 2O4XA 1K8GA 3PCOB 5C6AA 4HJ7A 3GV6A 1JC7A 4HJ9A 1EZ6A 3OOCA 3M4QA 4AYBB 2LS01 3H3VH 1MGSA 4HSPA 1DM0B 5C4JB 2A6HD 3T51B 1Y8NB 1O78A 3VDYA 3HGBA 2R7DA 3GTOH 4YHHQ 1Q3LA 2IHEA 4ZYSA 2C35B 5M5WH 1HH2P 1I50B 1IBKL 2P5ZX 4LF5L 3A8JE 2JSOA 3MXUA 1AP0A 2JEAI 2JA9A 1YNXA 3MXNB 3M7NA 2IWHA 3A55A 1CQVA 1EY7A 4NDXA 1BXTA 1YHBA 4DV5L 1ASYA 2JA6G 3QG1A 1SFOB 1ICFB 3H3VC 5HY6A 2KEDA 1EQTA 2CQOA 2ICEC 2IY5B 4UP7A 4TRDA 1GOZA 3TSSA 4QMGA 4J15A 3PIO3 4JI7Q 4DV1Q 2QEJC 4A3JH 1SE2A 2B2YA 5D14A 1YHQA 3S14H 1A63A 1JOQA 5JAVA 2Q8TA 4DAYA 4DV4Q 4K14A 3GTPH 3KLRA 3P20A 1D8LA 3MVVA 2R7ZG 3MC0B 2NUCA 3VYTA 4DV2L 4QL5A 1VQPA 2NVYH 4B3RL 2L11A 2NBFA 4G7OC 3RZOH 2KVMA 1I3QH 4JOIC 1TWCH 2A5HA 4OWXB 2KEEA 2EE1A 2CHBD 1CSPA 1PFBA 4F88A 1N36L 1R9TB 1SSOA 4K6LA 1H9SA 5ELFA 4LUZA 3I55A 3CP0A 2ZJQA 1ILPA 3H15A 1WCMH 3TMEA 3LWEA 1X3FA 2DGYA 4JI0L 1JOOA 1SYBA 3K7AB 4CJ2C 2A8VA 4P75A 3RNUA 5IWAL 1HNWQ 2AWNA 5C0XI 3URYA 3R93A 1B50A 1I4PA 3D6CA 3IFTA 4F8MA 3HOVH 1WJJA 4QCLA 3CHBD 4B08A 1XNRL 4A3JG 2WFWA 1F9SA 1ZYRD 3G7LA 2E2IH 1SYDA 1RIPA 4R4TA 4JCVE 4OL7A 2OEOA 4BY1B 1YJWA 1U4MA 1M8AA 4A3EB 4ZQ3A 3RUZA 3BG3A 1HNXL 4DNIA 4KJOA 1X9NA 4X3TA 5HURA 4A3DB 5AJ3L 4MHEA 3CMEA 3PMFA 3HOZB 3I2ZA 2AQ1B 2A6ED 2FJ2A 2RDGA 5JVH3 2E2JB 5E4XA 1XXGA 2A69D 4LFAQ 2NZHA 4DK1A 1EIFA 3VR2A 2JA5H 2ICIA 3E5SA 5LMNQ 3NENA 4NXNL 2B2UC 3SEBA 1XMQL 3BZCA 1LUZA 3QR8A 3BDCA 1SJED 1G6PA 3GV3A 1V1PA 1VQFA 1UWVA 4R4QA 2K32A 4C56C 3JAMi 4LF7L 2F0JA 5IGFA 1UE6A 1AZQA 4LW1A 4AYBE 3PO3B 5I2YA 2F0PA 3L3OC 4NMZA 2B2WC 3BDLA 3ONAB 4A93G 1QUQB 1L0XB 1I4QA 1LYLA 3H91A 4A3GH 2KHIA 3MXPA 4JI6L 4BY7B 2ID0A 5M3MH 4C3JG 1OXXK 5I2XA 4RGTA 4GOPC 5BR8Q 4HEDA 2L12A 3BZKA 3M4PA 3R3OA 5CV4A 1X3GA 2IX1A 1DD2A 2K14A 4FXKC 2B2VA 2JA5G 4IUNA 3ICEA 5JEAJ 2K5QA 3NBHA 1STAA 5J22A 4TSSA 2RDHA 3HKZG 2NZ1D 2QCPX 3NK9A 1HZCA 2G5DA 2VB3X 1VQJA 2IX0A 2PCFB 4RGMA 4DV7L 4A3GG 2Y0SG 3M4OB 2FINB 1C48A 1DGSA 5E7NA 1M90C 3ULJA 1A2TA 1Y1WG 1CKMA 1MJCA 4HMJA 2AQ3B 1ONLA 2ENBA 2M2LA 5HGQA 3CCMA 1BCPD 1ASZA 3S17H 1EY5A 2JA7H 3S2DB 5C5LA 4DN4M 1S3OA 1XTDA 3E0EA 5EAYA 4KHVA 2PZTA 5G3LF 5IYCH 4DUZQ 1WFQA 3PIP3 3NXWA 4JC0A 1JOKA 4X64L 1BR9A 5IY0A 1HR0W 1WTRA 3K0YA 2LY7A 1TS4A 3C1EA 4OELB 4KHPL 1E7ZA 1EUJA 4IPDA 1QNUA 2VQFQ 4JI2Q 1VQCA 2N78A 4DXGA 2K5NA 3ND9A 1JJ2A 4J1MA 1KNAA 1L2FA 1LTBD 4IALA 2GVAA 5IYBH 3T1HL 4R4IA 2RSNA 1L0YB 1XWEA 5K5PA 2QW7A 4CKBA 1D7QA 3KDFB 1TKWB 4LF8Q 4IURA 4Z9CB 2OXPA 3F2DA 4NPSA 3STBD 5IYCG 3OPOA 1LLRD 3EFXD 4LNQA 4IFDI 2K33A 5M9OA 3I4MG 3KBGA 4RAUC 4L6TB 3AB9A 4O2DA 4C3HH 1K83B 4JI7L 4XTCS 1Y69U 4GNXB 1NMFA 4CKCA 1PH8A 2ALYB 2DNEA 3O13A 5E1FA 4P2CB 4MTNA 3NTHA 2GN5A 5E4WC 3G6JB 3LGJA 1N34L 5M3FG 1NR4A 1I6HH 1EQQA 3KF6B 5C0XG 4IO9A 4HAEA 1PFMA 1IXRA 4RGOS 2VB2X 1K0RA 3CRLC 5ELOA 2K75A 3VYRA 1X3QA 4X6AH 5KEEA 1RJTA 2NVXB 1HNWL 1HCZA 1LM0A 4APVA 2DN8A 3QO2A 3DWPA 2RF4A 1E3PA 4JI4Q 4KMUC 2Q8IB 1LTAD 2EY1A 4K2LA 4K2KA 5J39A 3PO2B 4S3SA 1JICA 2C9OA 2ZJPA 4K5VA 5M5XH 1G6ZA 5IYDH 1AN8A 2Z6KC 1UUPA 2NVTH 2EYFA 3OWFA 4KD3A 4R4CA 3F8TA 4YY3L 5D3IB 5ELDA 4KV6A 4DK3C 1NUCA 3A0JA 3M7GA 1I6VC 4BA2I 3RZDH 2EOTA 2KCNA 2WAQG 4YWKA 1PYSB 2K5DA 4LFBL 2RHQB 1K8MA 1KHIA 1TY2A 1NBWA 3PUWA 4KD4A 4HR7B 5CV8A 1PDQA 1A2UA 4PZ8A 2Q8RE 5BN3A 3T16A 3Q6SA 1CZWA 4XIGS 1PRTD 4CJ1B 3X3NA 1Z7TA 2AWOA 2X6LA 3IL8A 5C3EH 4LUVA 4FP5D 1NCVA 2NB0A 3VA7A 3OTOQ 2FXQA 3MZ5A 2B3GA 3CXCA 1H9RA 3L7ZC 4DAYB 4K0KQ 4LF6L 1Z47A 1BNZA 3ITPA 3WOEA 2K5VA 2D9UA 4O42A 3HP3A 4KN4C 2UUCQ 1ZEQX 3VR5A 1Q1BA 3F2UA 2QDLA 3WDNA 1VQHA 1A0IA 1T5EA 1Y1VH 2JK8A 3W5OA 1R4PB 4AQYQ 1C8CA 2CW0C 1IYJB 4RHRA 2L5TA 1H9SB 1O7ZA 1I50H 4HIKA 1K0SA 4DR5L 1PVOA 1EY6A 2L55A 3H3VI 4CGYB 4A3CH 2QF7A 2BDOA 4WORA 3BZDB 2D5DA 4GLVB 2AKWB 1V1OA 3BDOA 4KK7A 3VYSA 2MJ8A 3SK5A 2VQEL 1QCBD 3DM1A 1IBMQ 3Q22A 2XRQD 2BE5C 1BBWA 4M8AA 1JMCA 3CCQA 2QKIC 2XN9C 4OX9L 4DR7L 1KL9A 2NYZD 4XT3B 1BBUA 1YNND 3GTGH 1AE3A 1QE6A 2EQSA 4DV0L 4DR1Q 2PI2A 4BBSG 3S1NB 2B63B 4BBRB 3A54A 2V4DA 4LUOA 3T4AC 3MHBA 1EEID 2UUAL 1D6EC 1Y1VG 4NW2A 1Z6HA 3GTQH 1YEZA 3PF4A 3L2PA 1STNA 2VL6A 3HOUG 3HOYH 3J7ZC 4IFDH 4YCWA 1HUNA 2EIFA 4JYAL 1HR0L 2A19A 3JAMc 4DR2L 4A3KB 3MWYW 4B3ML 2MP1A 1F2MA 4L63B 4A3CG 2X69A 4DK6C 5KNBA 3I4OA 2HCIA 2Z6BA 4XYOA 5LHY1 2R93G 2Q2HA 1E24A 1TWFB 4XT1B 1V1PB 3KJOA 1XNQL 1K28A 2UUBL 3S16B 3TP8A 4X65Q 1J5EQ 1S4ZA 2AUJD 1TWAB 1YITA 2MQHA 1GHJA 1GO3E 4JBWA 3OW7A 5IODA 4B3SL 4RH6A 1GKHA 3S2HB 4QUCA 1AW7A 2QGQA 4H0LC 4RCOA 2K1BA 3A7LA 4U673 1KQSA 3M9BA 4DNRB 1F9PA 1SLJA 2EYOA 4BY1H 3HOYG 3D6WA 4IFDG 4A3EH 2MFIA 3I73A 4FYDA 3E9IA 2WB1G 2R92H 5NUCA 4A3DH 4A3IH 4A3LH 1IW7C 4FXGC 4DF7A 3HOZH 1I4XA 1Q7YC 3NBHB 4JI5L 2OF1A 2VUMB 4FVMA 2E2JH 1S40A 1WYDA 4A3FG 2D0PA 1CSQA 4KHZA 1I94Q 4EQPA 4N8FA 5KIXA 3D8GA 3EROA 1N8RC 4IUQA 3MA2B 2NTSA 3CCJA 3OIPA 1NE3A 4DR6L 2JA8G 3EQLC 2RA4A 2I5HA 4X62L 3K5MA 2ZXPA 4NP5A 4PV1C 1FGUA 1I4RA 4X66Q 1N33L 2CFMA 1NNXA 1CUKA 2EVBA 5CC4A 4IUTA 2YTYA 2CH4W 1B44D 1F9QA 4H44C 4L8JA 1ENCA 1GM5A 2R92G 1W2BA 1S5CD 1MHWC 4CDEC 1GUWA 1KAWA 4A3IG 3RLFA 4BY7H 4A3LG 1EQVA 1B9NA 1Q12A 3HOZG 2KA7A 2XWJB 2B2TA 1NMGA 3C2PA 1PZID 2BDNA 2IJ0A 3BU2A 2Z0SA 2MGSA 3SR1A 1HZAA 2F0DA 1Z9FA 4QF4A 2K03A 2UXBL 1VCIA 2X6GA 2I46A 5D3DA 4BWGB 4JK1C 1HNZL 1ZXTA 3QJYA 1A3TA 1XMOL 2YTXA 1YHAA 3HOXH 5LMUL 3G71A 5A2QL 1QNKA 5EKIA 1NAPA 5C44B 1LTRD 1WTHA 1LT5D 1RDPD 3CF5A 3M4OH 4BY7G 2E5LL 3BVGA 2UXDL 1HXYD 3T1YL 1D2BA 4QB4A 1BF4A 3G4SA 4UDUC 4G7ZC 1WOCA 1U4RA 1EQRA 4C3IB 4QQBX 2F1MA 3S2DH 3CCUA 3ER0A 2TMPA 2K05A 3S1QH 5C4XG 1BO0A 2KHSA 2KBNA 3JAME 4GN5A 1IYUA 4JI3L 2IW3A 4JI1L 1FJGL 3J81j 4A3MB 4HJ5A 1JORA 4JI8L 1UEAB 3L9AX 3HOXG 1G91A 1G51A 4HCSA 3NWSA 5IOCA 1ESRA 4UAIA 4PMCA 4ZUIA 2KCTA 1S5ED 4JBKA 4K5WA 1LABA 4ZKBB 1YNJC 1L1OA 2E8GA 4DR3Q 1STEA 3I4NB 2MPMA 4GKJQ 1B3AA 2E2HB 3I56A 5I4DA 1E2WA 4DV3L 3IAYA 2E2DC 4QIWB 1QVGA 2K7VA 5GAGC 3GDEA 2XWBB 4LF4L 4EX5A 4LFCQ 5C0XJ 3FKIB 2F0HA 4A3BH 1MJEA 1V8QA 5KNDA 1SYGA 2D0OA 1FD7D 3I70A 1EIHA 5IP7H 2N49A 2L4NA 1GXDC 1EU3A 5CV6A 1K83H 5CYUA 3J7AF 3CC7A 2L0CA 4OWWB 1P16A 4R8IA 2F0EA 3CC2A 1G2TA 5FOBB 4V0BA 2AHOB 4Q5VA 1SNMA 3U9SA 1O7IA 2OQ0A 3PF5A 3K57A 1XPUA 3R8BA 1Q8KA 4LF9L 1X3EA 4M1UB 1D1KA 3MXGA 1SYCA 4HCEA 1W6KA 4A76A 2CVRA 3K5OA 1SNDA 5CV7A 1II3A 3G6EA 1WCMG 4O0AA 4DA2A 2NVXH 3S1RH 3QWNA 2Q2UA 3K80C 1UE5A 4A3BG 4LAAA 3GTLB 1PFSA 1NSNS 2WP8J 3RLOA 4GNXC 4AIMA 3NWTA 1YBYA 5GAEC 1HJPA 3HOVG 3PO2H 2K5WA 2ASBA 1KDCA 3PV0A 1JWMD 2PYKA 1PTOB 1RD9D 1QILA 1SBBB 4KKSA 1S5FD 3EBEA 2ZTDA 3NUCA 3HOWB 1Y14B 4J6HA 2CCZA 2JE6I 1QB5D 4PG3A 2JYOA 2HUGA 3NQIA 3J81i 1H9KA 4HIDA 1FNVA 1V9PA 1RHPA 1JWSD 1UNSA 1DOMA 3RMHA 1O80A 2EXZA 3PUVA 4Y52H 3TN2A 1JJGA 3K0XA 3JC66 2EDGA 2CQAA 3IFDA 4OO1I 1TU2B 3K8AA 2KJXA 5TSSA 5IGDA 1TS3A 5LL6S 1Q90A 3I90A 4IUVA 5CGKA 4NXMQ 5FLMH 4HN7A 1U4LA 3H0GH 3BS1A 2I0QA 1ET6A 1HQMC 1HZ9A 2PZWA 2VY3A 4XDXA 5KGUA 3W1BA 4DUYQ 1VQ4A 3JAML 2K28A 4CDCC 4WJ3M 4IZ8A 1SNOA 2JA6B 1S5DD 1SAPA 4NB3A 2UU9L 4FF1A 3FRPB 1G2SA 1QZHA 3EN2A 3GD7A 1XPRA 5LL6X 3S1MB 1A8VA 5JJZA 3E6ZX 1MIUA 3UDIA 3OHXC 1M1KC 1BBXC 5M3MG 1ZYRC 3D0FA 3R2TA 3PUZA 3AYHB 1N32L 3V96A 4P74A 3DEOA 3MTSA 3LNNA 4TQUS 2YU9B 4JV5L 3I4LA 2F0WA 1X54A 2RHSB 4GKKL 4GN4B 2F0NA 2R6GA 3GTOB 2R7ZB 1F2LA 4XQJA 3NTIA 5CR3A 3DUZA 1HFNA 2ZM6Q 5FLMG 5M5WB 3G48A 2RCFA 4QIWE 2B2YC 3DHQA 3H0GG 2A6EC 3TREA 5C4HA 4NKLA 1STGA 3UDXA 3ERSX 2D2CC 2E75C 2A69C 2TSSA 4C1NK 2WB1E 1BUVT 4UHVA 4IUUA 1X56A 1QVCA 4Q0FA 5D65A 3S1NH 4YHHL 2ZJRA 4BBRH 1OTCA 2EZVA 1W3SA 4ABNA 1S5BD 1TXYA 1D5XC 4Y7NB 3VR3A 5CV9A 1PH7A 2F0MA 4P72A 1DYQA 3J80i 4MTKA 3KF8A 2Z8LA 1LT6D 1KIXA 4LMQD 4A3JB 2DY8A 2QA4A 4DV6Q 3S14B 1IBLQ 1OXVA 2Q2IA 5T1IA 2JA7G 2OT2A 3W2DA 1TQOA 1DXMA 4IFDJ 2NVYB 3CCSA 2GA4B 4HIMA 4J8QA 1I3QB 1DCZA 1I5FA 4I7ZC 1SJHD 3A74A 2G9DA 1TWFH 1G291 4WJWA 1WD1A 3W1GA 1ILQA 1TWAH 4RCNA 2R3ZA 4DV1L 2DJFC 1WTOA 2B8GA 1RF2D 1VMCA 4DV4L 1EU4A 3TZUA 3MFYA 5BN5A 4JW0A 3S2HH 1BQQT 5FJ8H 2I5MX 1DJRD 4XQQA 1PH3A 4DR4Q 2PW7A 3TP5A 3D3RA 1TWGB 3T53B 1XTCD 5ELEA 1FNUA 5IYBG 1H9JA 3CRKC 4MN3A 1QWYA 5DLQE 3U4VA 1CI3M 2OWOA 1F9RA 1FYCA 1STBA 5M5YH 3FMCA 4EQOA 3M3YB 3OMCA 1CA6A 3H09A 2HDMA 1OO9B 4A93B 4K6DA 1A62A 5EJWA 2J4XA 5EQ0A 1TWHH 4ODGA 3U58A 1IKLA 4L5QA 1UE7A 4EGVA 2F4VQ 1SRUA 2ES2A 3CW2C 5FK9C 2M9VA 2HHHQ 4C3JB 1GUSA 4C3HG 3EVQA 3LWUA 2XTIA 2UXCQ 5DNFA 1KNEA 3RD4A 5L37A 2BE5D 2PI2E 1VQGA 2F0UA 3EA6A 2K52A 3ZJYC 4OO1H 2JA5B 1B8AA 5G3LD 5BN4A 5K36H 1CK1A 2VZAA 4DPGA 5GROA 3FHWA 1SE4A 1SMYD 4RHSA 4B3TQ 3D31A 3HKZB 4UPAA 1B3QA 2B2VC 4EQNA 2CWPA 4QUFA 3EJIA 4EQ5A 1LT4D 2EYPA 2K5HA 4RKBA 4LFAL 1K3RA 3DEPA 1B4OA 3EIVA 1EIYB 4DAPA 1UEBA 1CT1D 5JJIA 2IX3A 5LMNL 2HQLA 3DMUA 5DEHA 2OTJA 4LJZC 1PTOF 1DZ1A 2HT1A 4A3GB 2Y0SB 1STHA 5JEAH 3K6OA 2BH2A 1SNCA 3VA5A 1Y1WB 2PNHA 1IBKQ 1VQ7A 4UP8A 4C2MB 5IYDG 4LF5Q 2MO0A 2IHFA 4BA1I 4L5SA 1F2ZA 1HRJA 4BS9A 1W6JA 4OO1G 1SR3A 1OXSC 3STBC 1C7YA 5I6YA 2BA1A 4XYQA 5IGEA 1X65A 5C4JH 4X3UA 1HUMA 1K8AC 1L1OB 5IP9H 2N3SA 4DV5Q 1VQEA 2FHTA 2NWGA 1GUTA 3DWQA 5C44H 3FPPA 1XYIA 5BR8L 1VQ6A 3D4DA 1SXTA 2PZUA 1EWCA 2E76C 2EY5A 2HIXA 1K9MC 2RSOA 1IW7D 3RN5A 4C3IH 4UY8C 1VDZA 5FLXc 5C3EG 3S15B 2KCMA 1SFOH 1E22A 3HZXA 2A1AA 1QZGA 4WJ4A 4DV2Q 1U4PA 4B3RQ 1QG7A 1CHPD 3H6MA 2F3WA 1R4QB 4HMIA 2NN6H 1N36Q 1HTLD 1NJIC 4AYBG 3S17B 3CPFA 1WTQA 4A3MH 2QDBA 1BVSA 2F52A 2EXDA 5IP9G 2F0FA 2AUKA 4JI0Q 3I4MB 2MO1A 2HDLA 5IWAQ 3F2CA 4H02A 1EL0A 3TBIB 1PMRA 3I4NH 1KLGD 4RMFA 4YIJA 1F2YA 2L1BA 4LK1C 1U5KA 1R9TH 2E2HH 5IE8A 1SEBD 3OMGA 1JE5A 1XNRQ 2F4IA 2XIWA 1AEXA 3J81c 2WINB 4K5XA 4DUZL 5M3FB 3K7AH 3PIOA 3NQTA 2SOBA 3A8KE 3KJPA 1MSGA 1BOSA 2FFKB 1JT8A 2ZXOA 2KECA 3WOFA 3FDTA 2LMCB 4QGUA 4POGA 5AJ3Q 1PRTC 2WV6D 2EJFC 2O2LD 1BCPB 1EY0A 4A3MG 4JOIA 1KD1C 1RODA 2VQFL 1B9MA 4JI2L 3D4WA 3HRZC 4U68A 1C0AA 2F0VA 3U9OA 3TDQA 3FPUB 1HA5A 4TKOB 1EOVA 4R1JA 3CD6A 2PPBC 3CU7A 3UI2A 3ULLA 4NXNQ 3I3CA 3RN2A 1XMQQ 1JE4A 3ZYYX 3HKZE 1LT3D 3TRZA 5CV5A 4LF8L 3UDGA 3DWAA 4LF7Q 2B8FA 4MIUA 3N52A 1VQKA 3J7A5 5IGCA 1WTVA 1KDBA 2WAQB 4O1NA 2PMZB 1VQDA 5J1ZA 3SE0A 1X32A 2EYJA 3GTLH 3SHLA 2K6AA 4GN3B 3DLLA 5CBAE 1AH9A 2Y0SE 5H1SE 4JI6Q 1WVLA 4K8JA 2OCEA 1QOHA 1Q86C 5GQOA 3MAQA 4B9XA 3Q8DA 2K50A 3FP9A 3OWEB 4P71A 5IGBA 2WKCA 1PTOH 1VQOA 1B1ZA 5FO9B 1U9RA 3PO3H 1Q8IA 4BY1G 1NR2A 1YNNC 1ENFA 2KENA 3GQBA 4CDDC 4PNYA 3OIQA 4A3EG 5FO7B 3TP6A 5M5XB 3FVQA 4LWCA 4GLXA 4A3DG 2CWAA 3NHHA 1EWIA 3VR4A 1VQNA 1DOLA 3NEMA 5EBCA 2EJGC 2B2UA 3F1ZA 1IYVA 1QVFA 3Q23A 4MZ9A 2F0SA 5F2DA 4JI4L 3HS0C 3J80c 1YIJA 1RL2A 2UXCL 4DV7Q 2J7ZA 2RQXA 3E0JA 1PTOC 5KNCA 1P8LA 1GVPA 3H94A 1EWHA 2HQEA 2B2WA 4N9PA 3AMUA 4WFN3 1GJXA 3NBIA 4RKLA 5EGTA 1C9OA 2JXMB 1I4GA 1PHJA 3K7UC 5FO8B 5FLXE 3PO3G 4JBJA 3KF8B 3DXJC 1EYCA 4GOPA 5IGGA 4FXDA 2R7FA 1SN8A 1IL2A 3SK8A 2FMMA 1LTSD 3S1MH 5JJKA 4UP9A 4HTHA 2DNCA 4OIJA 4BBSB 4X64Q 3TEHB 2FMCA 2YU9H 1Y1VB 2H4OA 1EY4A 2ZTCA 1XX8A 1EY8A 2R7ZH 2WIIB 5T1GA 3HOUB 1VQBA 4KHPQ 3KLWA 1E1OA 3OTOL 1EYDA 2QILA 4K0KL 1I4HA 3MFGA 1CTMA 4KY7A 3OW2A 1WD0A 3A8IE 4R4OA 5ELBA 3KBXA 4ZAIA 2UUCL 3GTJB 4JG2A 3LX0A 3T1HQ 1LV9A 3ULPA 1GHKA 5HGTA 5EPLA 4YWLA 2XRSD 4AQYL 1PRTB 3J81E 2R93B 2KOLA 4RWSC 5GADC 3HKSA 2F0QA 4Y7NH 3FEWX 5COYA 4MNOA 2EY6A 3GTGB 3AFPA 1VQ8A 1IKMA 4GS3A 1HZBA 2DUDA 1ICWA 4KKUA 4WRDA 3GTQB 3PIPA 3KUPA 4IPHA 3HEJA 4KTAA 3SK4A 3TP7A 2MNAA 1PH9A 2A68C 1IBML 3HOYB 2VNUD 3M4YA 5I9OA 3GTMB 1OXUA 3C1FA 3BJUA 3CCLA 2WB1B 1N34Q 2WAQE 3CCVA 2PMZE 1VF5C 1J6QA 5EBDA 4ZLTF 1VQLA 4DR1L 1ET9A 3SK6A 1O7YA 4F7XA 2AMCB 2RBMA 4XQNA 4QY7A 1V43A 4A3FB 1EY9A 2N88A 3K58A 4GZYC 3GTKB 2R61A 4ID6A 1N9WA 2B29A 3P7JA 1CKNA 4RG1A 1ESFA 4B9WA 2XSCA 5EPJA 1TWGH 1SNPA 2JA8B 1CKOA 5EKKA 2L9HA 3UDFA 5DM63 2A6HC 3V05A 2DJGC 3WWVA 1CFMA 1VQIA 1GD7A 3AU7A 3M3YH 4YY3Q 2IT1A 3SGIA 1PH5A 5E3FA 1BDOA 4OHJA 2VW9A 2SDFA 1BCPF 1X55A 1E0BA 4X65L 4A93H 1J5EL 2DY7A 4OXPA 4PMWA 3DM3A 2R92B 3OSOA 4A3IB 4LFBQ 1RKNA 5C5MA 4N8X1 2L15A 4C3JH 1CQFA
chains in the Genus database with same CATH topology
1TWFH 1G291 3PGZA 4P73A 2VQEL 3W1GA 1YJ9A 4JV5Q 3GO5A 1TWAH 3AFQA 1IBMQ 4GKKQ 2JA6H 2NVQH 4DV1L 4B3TL 1BBWA 1JJCB 4DAMA 1JMCA 3CCQA 3HOWG 4OX9L 4DR7L 4DV4L 1KL9A 1BBUA 5C4XH 2F3IA 1K8GA 3GTGH 1AE3A 3PCOB 3S2HH 5LMNW 2EQSA 4DV0L 4HJ7A 2PI2A 3OYYA 1PYBA 4DR1Q 5FJ8H 4BBSG 4HJ9A 2I5MX 2OQKA 1XJVA 4LUOA 2UUAL 3M4QA 1Y1VG 3GTQH 1PH3A 4POFA 3H3VH 4DR4Q 1YEZA 3PF4A 3L2PA 4AH6A 2VL6A 3HOUG 1SROA 5IYBG 3HOYH 4LF6Q 3J7ZC 3VDYA 4YCWA 2R7DA 3GTOH 4YHHQ 4GLAC 2IHEA 5DLQE 2C35B 1I94L 2EIFA 3U4VA 2OWOA 4JYAL 1HR0L 5M5WH 2A19A 2OTLA 3JAMc 5M5YH 1HH2P 4DR2L 1IBKL 4B3ML 3NELA 2A8VA 4LF5L 1BKBA 4A3CG 3UE1A 2YTVA 2Z6KA 1A62A 4DK6C 2JEAI 3I4OA 2JA9A 1YNXA 1TWHH 3MXNB 3U58A 4L5QA 2PQAA 1UE7A 3M7NA 1SE8A 2F4VQ 3PO2G 1SRUA 2ES2A 1E1TA 3CW2C 2R93G 2HHHQ 1Y1WH 2Q2HA 4X66L 1E24A 1YHBA 4C2MH 4DV5L 4DR5Q 3MEFA 3KJOA 1ASYA 1XNQL 2JA6G 2XTIA 2UUBL 4X65Q 2UXCQ 1J5EQ 2PI2E 1VQGA 2MQHA 1YITA 2K52A 1GO3E 3ZJYC 3I7FA 5HY6A 2CQOA 4JBWA 4UP7A 2IY5B 1B8AA 4B3SL 1GKHA 2VZAA 4DPGA 4IJHA 2QGQA 5GROA 2VQEQ 3FHWA 3PUXA 4J15A 4YWMA 4JI7Q 4DV1Q 4B3TQ 4A3JH 3D31A 1YHQA 1KQSA 3S14H 4OX9Q 1A63A 3M9BA 4UPAA 1YZ6A 4DV4Q 4DR7Q 1SLJA 3GTPH 1D8LA 4BY1H 2CWPA 3HOYG 2RCNA 4IFDG 4EQ5A 2R7ZG 4A3EH 2K5HA 2MFIA 4DV0Q 4DV2L 4QL5A 1VQPA 3E9IA 2NVYH 2WB1G 2R92H 4B3RL 4LFAL 1K3RA 3RZOH 4JOIC 1I3QH 4A3DH 3EIVA 4A3IH 2UUAQ 1EIYB 1TWCH 4OWXB 4A3LH 1UEBA 5JJIA 1PH2A 5LMNL 3HOZH 1CSPA 1N36L 2HQLA 1Q7YC 4JBMA 3UE0A 3NBHB 3S15H 2OTJA 4JI5L 2HT1A 2E2JH 1S40A 4LUZA 1WYDA 4A3FG 2D0PA 1PH1A 1CSQA 4KHZA 3I55A 3CP0A 1V1QA 1I94Q 2ZJQA 4JYAQ 1HR0Q 3H15A 2BH2A 1WCMH 1N8RC 4DR2Q 1L1OC 1X3FA 2DGYA 2PNHA 4IOCA 1IBKQ 1VQ7A 4UP8A 4B3MQ 4JI0L 5IYDG 4P75A 2MO0A 3KYHC 1YJNA 2IHFA 4BA1I 4LF5Q 3RNUA 3CCJA 4L5SA 5IWAL 2B63H 1NE3A 2AWNA 1HNWQ 4DR6L 1SR3A 1OXSC 3STBC 1C7YA 2I5HA 5C0XI 2JA8G 4OO1G 4X62L 2BA1A 1X65A 1FGUA 5C4JH 2ATWA 1K8AC 3HOVH 1L1OB 1WJJA 5IP9H 4X66Q 2N3SA 3I4MH 1N33L 4DV5Q 2CFMA 1XNQQ 1XNRL 4A3JG 1VQEA 1CUKA 2WFWA 2UUBQ 2E2IH 5C44H 2YTYA 2NN6I 1RIPA 1FVIA 5IT9c 4R4TA 4A3KH 5BR8L 1K73C 1VQ6A 1VS0A 4JCVE 1YJWA 4B3SQ 1VQMA 1GM5A 2R92G 1W2BA 1VQ5A 1KAWA 4A3IG 3M85A 1Q1EA 3RLFA 1HNXL 4A3LG 4DNIA 2HIXA 1S72A 4BY7H 1K9MC 1X9NA 1PH6A 5AJ3L 1Q12A 3HOZG 5M3FH 3RN5A 1MKHA 3CMEA 3RLNA 4C3IH 4UY8C 3AEVA 3I2ZA 5FLXc 1NMGA 5C3EG 3S16H 2KCMA 1SFOH 1E22A 2A1AA 1QZGA 4WJ4A 2I5LX 4DV2Q 3BU2A 2Z0SA 4B3RQ 4LFAQ 2NZHA 1EIFA 1HZAA 2JA5H 4DKAC 5LMNQ 2B63G 1Z9FA 4BBRG 3NENA 1N36Q 1NJIC 4NXNL 2UXBL 1VCIA 4AYBG 1XMQL 4PZ6A 4JI5Q 3CPFA 3BZCA 4KI0A 4A3MH 1LUZA 1HNZL 1G6PA 1BVSA 2F52A 4DR3L 2EXDA 5IP9G 4GKJL 1VQFA 1UWVA 4R4QA 1XMOL 2YTXA 2CKZB 1YHAA 2NZOA 3JAMi 4JI0Q 4LF7L 2MO1A 3HOXH 5LMUL 3K81C 3RR5A 5IWAQ 1UE6A 3G71A 2XGTA 4H02A 3F2CA 4A3KG 4LW1A 4AYBE 4DR6Q 1T9HA 3I4NH 4YCUA 4X62Q 4RMFA 1XPOA 1N32Q 4A93G 4LFCL 1U5KA 3CF5A 3M4OH 1R9TH 4BY7G 1QUQB 2E2HH 5IE8A 1N33Q 1LYLA 2E5LL 2VUMH 4A3GH 3T1YL 1JE5A 2UXDL 2KHIA 1XNRQ 4JI6L 2ID0A 4IPCA 5M3MH 3AQQA 3G4SA 1OXXK 1NY4A 3J81c 4DUZL 4GOPC 2JEBI 5BR8Q 4HIOA 3BZKA 3K7AH 3M4PA 1WOCA 3PIOA 1EQRA 3CC4A 4QQBX 3S2DH 3CCUA 1X3GA 3ER0A 3KJPA 2IX1A 1B7YB 1JT8A 2K14A 3S1QH 2JA5G 2JQOA 5C4XG 3ICEA 5JEAJ 4QGUA 2KBNA 5AJ3Q 4POGA 4GOPB 5FJ8G 4A4IA 4GN5A 4JI3L 4JI1L 4A3MG 4JOIA 3J81j 1KD1C 1FJGL 3HKZG 2VQFL 3PSIA 4JI2L 1C0AA 4HJ5A 1Q82C 4JI8L 2V1CC 3HOXG 1EOVA 4R1JA 3CD6A 1G51A 4NXNQ 3ULLA 2BH8A 3RN2A 1XMQQ 4L5RC 1HZCA 2UXBQ 2K4KA 2KCTA 5ELNA 3L0OA 3TS0A 4JBKA 1VQJA 2IX0A 1L1OA 3HKZE 1HNZQ 3TRZA 2E8GA 4DR3Q 1Q81C 4DV7L 2VUMG 4LF8L 4A3GG 4QJFA 4GKJQ 3UDGA 2Y0SG 1XMOQ 4LF7Q 3I56A 5LMUQ 1VQKA 3J7A5 4DV3L 1DGSA 1M90C 5E7NA 3ULJA 1YVCA 1Y1WG 1QVGA 1CKMA 1MJCA 1VQDA 5GAGC 3GDEA 4LF4L 5HGQA 1VQAA 1NTGA 4EX5A 3CCMA 5C0XJ 4LFCQ 3GTLH 1ASZA 3S17H 4GN3B 2JA7H 3DLLA 1AH9A 2E5LQ 4A3BH 1S3OA 2Y0SE 1XTDA 3E0EA 3T1YQ 2UXDQ 5H1SE 1MJEA 5EAYA 4JI6Q 2QEXA 2OCEA 2D0OA 5IYCH 1Q86C 5K36G 5IP7H 2N49A 5GQOA 1L0WA 4DUZQ 1EYGA 4IPGA 3Q8DA 2K50A 1WFQA 1K83H 3FP9A 4P71A 2ZTEA 4JC0A 1VQOA 3CC7A 4X64L 4OONA 4OWWB 1P16A 4ME3A 5IY0A 3PO3H 3U4ZA 1HR0W 4BY1G 2KENA 3CC2A 1YI2A 3PF5A 2AHOB 4A3EG 4L5TA 1O7IA 2OQ0A 1XPUA 4BBSH 1Q8KA 4LWCA 4JI3Q 4KHPL 1E7ZA 4JI1Q 3A5UA 4GLXA 1FJGQ 4A3DG 1EUJA 4IPDA 2CWAA 4LF9L 1FL0A 1X3EA 1EWIA 2VQFQ 4JI2Q 4NXML 1VQNA 1VQCA 2N78A 2K5NA 3NEMA 1JJ2A 1B70B 4JI8Q 3F1ZA 3U50C 1L2FA 4A76A 1QVFA 3HOUH 2GVAA 5IYBH 3T1HL 4MZ9A 4R4IA 5JEAG 4JI4L 3G6EA 1PH4A 3B6YA 4DUYL 1WCMG 2Q2TA 5JJLA 1EFWA 3J80c 1YIJA 1RL2A 4O0AA 1QUQA 1D7QA 3HFZB 2NVXH 3KDFB 3S1RH 2UXCL 4DV7Q 2Q2UA 3K80C 1UE5A 4LF8Q 4A3BG 3GTJH 1KRTA 2YV5A 1PFSA 2WP8J 3RLOA 4NPSA 3F2DA 1P8LA 1GVPA 4GNXC 3STBD 3KOJA 4AIMA 1CKNB 5IYCG 4DV3Q 1PV4A 1YBYA 5GAEC 1HJPA 4KLKA 4LNQA 3HOVG 3PO2H 3I4MG 4IFDI 2R93H 2ASBA 4O2DA 1C9OA 1VQ8A 4LF4Q 3PV0A 1PHJA 4C3HH 3K7UC 4JI7L 3PO3G 5C44G 4XTCS 4JBJA 3KF8B 2VS1A 4GNXB 1NMFA 4GOPA 3EBEA 2LXKA 2R7FA 2ZTDA 3TQYA 1PH8A 1SN8A 1Y14B 2ALYB 1IL2A 1H95A 2CCZA 2JE6I 4PZ7A 4MTNA 4PG3A 4BXXH 3S1MH 5JJKA 2GN5A 4UP9A 3J81i 4HIDA 4HJAA 1V9PA 2ZM6L 3LGJA 3TEHB 3S24A 4X64Q 5M3FG 1N34L 5IP7G 1I6HH 2H5XA 1EQQA 4Y52H 1JJGA 2YU9H 3KF6B 3PUVA 4YCVA 5C0XG 2ZTCA 3K0XA 3JC66 4IO9A 2HIVA 3GTMH 3FKIH 4OO1I 1IXRA 1KC8C 2R7ZH 3K8AA 1K0RA 1VQBA 4KHPQ 5J3BA 3A5ZB 1HNXQ 5ELOA 3KLWA 1E1OA 3OTOL 4LF9Q 2K75A 4A75A 4NXMQ 4K0KL 2NN6G 5FLMH 3OW2A 4X6AH 1HNWL 4R4OA 3CCRA 3H0GH 1LM0A 2I0QA 2UUCL 1SMXA 1HZ9A 4JG2A 4APVA 3T1HQ 2VY3A 3ULPA 2RF4A 1E3PA 4A3FH 2KHJA 4JI4Q 4YWLA 2LXJA 3W1BA 4DUYQ 4AQYL 1X6OA 1VQ4A 3GTKH 4WJ3M 2ZJPA 5M5XH 5GADC 5IYDH 4HJ8A 3HKSA 3CPWA 2Z6KC 2NVTH 4DV6L 3I4NG 4Y7NH 1IBLL 4NB3A 3F8TA 4R4CA 4YY3L 2UU9L 2JA8H 2JJQA 4BXXG 4MNOA 1QZHA 2BA0A 3CAMA 2LSSA 3EN2A 3GD7A 1XPRA 4DK3C 3A0JA 4BA2I 1KXLA 1A8VA 3AFPA 3RZDH 1MIUA 1AE2A 1Q46A 4GS3A 1HZBA 3UDIA 2DUDA 1M1KC 5M3MG 2WAQG 1U0LA 4OWTB 1PYSB 4TVAB 3D0FA 2D62A 4YWKA 4LFBL 3PUZA 3AYHB 1N32L 4ALPA 2PQAB 2RHQB 1KHIA 4P74A 4IPHA 3PIPA 1NBWA 4TQUS 3PUWA 1UE1A 3FKIG 2MNAA 1PH9A 4JV5L 1IBML 1X54A 2RHSB 4GKKL 4GN4B 2VNUD 2R6GA 1OXUA 4PZ8A 1LTLA 3BJUA 3CCLA 1OXTA 2ZM6Q 1PA6A 5FLMG 1N34Q 3G48A 4QIWE 2WAQE 3CCVA 4XIGS 4FDBA 2PMZE 1J6QA 1VQ9A 1VQLA 4DR1L 3H0GG 3TREA 2AWOA 2AMCB 5C3EH 4QY7A 3UDXA 4LUVA 2YYZA 3ERSX 4DR4L 1V43A 1KRSA 2WB1E 3HOWH 3OTOQ 3KDFA 2FXQA 2B3GA 3CXCA 4DAYB 3L7ZC 1X56A 4K0KQ 4LF6L 1QVCA 1Z47A 1N9WA 3S1NH 2B29A 4YHHL 2K5VA 4BBRH 2ZJRA 1OTCA 1CKNA 1W3SA 5GAHC 2UUCQ 3CQZH 4RG1A 1TXYA 3CMAA 1Q1BA 1TWGH 1VQHA 1A0IA 3W5OA 1Y1VH 2JK8A 1CKOA 1JB7A 3UDFA 4AQYQ 1PH7A 2N8NA 4P72A 3IRBA 3J80i 1IYJB 4GNXA 1KIXA 3WWVA 2F4VL 4IOAA 1VQIA 1GD7A 3PUYA 2QA4A 3CCEA 4DV6Q 2HHHL 1I50H 4HIKA 1IBLQ 3M3YH 4YY3Q 2IT1A 2GVBA 3SGIA 1PH5A 2UU9Q 1OXVA 2Q2IA 4DR5L 2VW9A 1X55A 1IZ6A 1PVOA 4A93H 4X65L 2JA7G 1J5EL 3H3VI 4A3CH 4OXPA 4IJLA 1WI5A 3DM3A 4PMWA 3F2BA 3E9HA 3CCSA 4HIMA 3TS2A 4IFDJ 3KFUA 3KF6A 4LFBQ 1I5FA 4GLVB 2AKWB 2L15A 3A74A 4C3JH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TWF H;  1G29 1;  3PGZ A;  4P73 A;  2VQE L;  3W1G A;  1YJ9 A;  4JV5 Q;  3GO5 A;  1TWA H;  3AFQ A;  1IBM Q;  4GKK Q;  2JA6 H;  2NVQ H;  4DV1 L;  4B3T L;  1BBW A;  1JJC B;  4DAM A;  1JMC A;  3CCQ A;  3HOW G;  4OX9 L;  4DR7 L;  4DV4 L;  1KL9 A;  1BBU A;  5C4X H;  2F3I A;  1K8G A;  3GTG H;  1AE3 A;  3PCO B;  3S2H H;  5LMN W;  2EQS A;  4DV0 L;  4HJ7 A;  2PI2 A;  3OYY A;  1PYB A;  4DR1 Q;  5FJ8 H;  4BBS G;  4HJ9 A;  2I5M X;  2OQK A;  1XJV A;  4LUO A;  2UUA L;  3M4Q A;  1Y1V G;  3GTQ H;  1PH3 A;  4POF A;  3H3V H;  4DR4 Q;  1YEZ A;  3PF4 A;  3L2P A;  4AH6 A;  2VL6 A;  3HOU G;  1SRO A;  5IYB G;  3HOY H;  4LF6 Q;  3J7Z C;  3VDY A;  4YCW A;  2R7D A;  3GTO H;  4YHH Q;  4GLA C;  2IHE A;  5DLQ E;  2C35 B;  1I94 L;  2EIF A;  3U4V A;  2OWO A;  4JYA L;  1HR0 L;  5M5W H;  2A19 A;  2OTL A;  3JAM c;  5M5Y H;  1HH2 P;  4DR2 L;  1IBK L;  4B3M L;  3NEL A;  2A8V A;  4LF5 L;  1BKB A;  4A3C G;  3UE1 A;  2YTV A;  2Z6K A;  1A62 A;  4DK6 C;  2JEA I;  3I4O A;  2JA9 A;  1YNX A;  1TWH H;  3MXN B;  3U58 A;  4L5Q A;  2PQA A;  1UE7 A;  3M7N A;  1SE8 A;  2F4V Q;  3PO2 G;  1SRU A;  2ES2 A;  1E1T A;  3CW2 C;  2R93 G;  2HHH Q;  1Y1W H;  2Q2H A;  4X66 L;  1E24 A;  1YHB A;  4C2M H;  4DV5 L;  4DR5 Q;  3MEF A;  3KJO A;  1ASY A;  1XNQ L;  2JA6 G;  2XTI A;  2UUB L;  4X65 Q;  2UXC Q;  1J5E Q;  2PI2 E;  1VQG A;  2MQH A;  1YIT A;  2K52 A;  1GO3 E;  3ZJY C;  3I7F A;  5HY6 A;  2CQO A;  4JBW A;  4UP7 A;  2IY5 B;  1B8A A;  4B3S L;  1GKH A;  2VZA A;  4DPG A;  4IJH A;  2QGQ A;  5GRO A;  2VQE Q;  3FHW A;  3PUX A;  4J15 A;  4YWM A;  4JI7 Q;  4DV1 Q;  4B3T Q;  4A3J H;  3D31 A;  1YHQ A;  1KQS A;  3S14 H;  4OX9 Q;  1A63 A;  3M9B A;  4UPA A;  1YZ6 A;  4DV4 Q;  4DR7 Q;  1SLJ A;  3GTP H;  1D8L A;  4BY1 H;  2CWP A;  3HOY G;  2RCN A;  4IFD G;  4EQ5 A;  2R7Z G;  4A3E H;  2K5H A;  2MFI A;  4DV0 Q;  4DV2 L;  4QL5 A;  1VQP A;  3E9I A;  2NVY H;  2WB1 G;  2R92 H;  4B3R L;  4LFA L;  1K3R A;  3RZO H;  4JOI C;  1I3Q H;  4A3D H;  3EIV A;  4A3I H;  2UUA Q;  1EIY B;  1TWC H;  4OWX B;  4A3L H;  1UEB A;  5JJI A;  1PH2 A;  5LMN L;  3HOZ H;  1CSP A;  1N36 L;  2HQL A;  1Q7Y C;  4JBM A;  3UE0 A;  3NBH B;  3S15 H;  2OTJ A;  4JI5 L;  2HT1 A;  2E2J H;  1S40 A;  4LUZ A;  1WYD A;  4A3F G;  2D0P A;  1PH1 A;  1CSQ A;  4KHZ A;  3I55 A;  3CP0 A;  1V1Q A;  1I94 Q;  2ZJQ A;  4JYA Q;  1HR0 Q;  3H15 A;  2BH2 A;  1WCM H;  1N8R C;  4DR2 Q;  1L1O C;  1X3F A;  2DGY A;  2PNH A;  4IOC A;  1IBK Q;  1VQ7 A;  4UP8 A;  4B3M Q;  4JI0 L;  5IYD G;  4P75 A;  2MO0 A;  3KYH C;  1YJN A;  2IHF A;  4BA1 I;  4LF5 Q;  3RNU A;  3CCJ A;  4L5S A;  5IWA L;  2B63 H;  1NE3 A;  2AWN A;  1HNW Q;  4DR6 L;  1SR3 A;  1OXS C;  3STB C;  1C7Y A;  2I5H A;  5C0X I;  2JA8 G;  4OO1 G;  4X62 L;  2BA1 A;  1X65 A;  1FGU A;  5C4J H;  2ATW A;  1K8A C;  3HOV H;  1L1O B;  1WJJ A;  5IP9 H;  4X66 Q;  2N3S A;  3I4M H;  1N33 L;  4DV5 Q;  2CFM A;  1XNQ Q;  1XNR L;  4A3J G;  1VQE A;  1CUK A;  2WFW A;  2UUB Q;  2E2I H;  5C44 H;  2YTY A;  2NN6 I;  1RIP A;  1FVI A;  5IT9 c;  4R4T A;  4A3K H;  5BR8 L;  1K73 C;  1VQ6 A;  1VS0 A;  4JCV E;  1YJW A;  4B3S Q;  1VQM A;  1GM5 A;  2R92 G;  1W2B A;  1VQ5 A;  1KAW A;  4A3I G;  3M85 A;  1Q1E A;  3RLF A;  1HNX L;  4A3L G;  4DNI A;  2HIX A;  1S72 A;  4BY7 H;  1K9M C;  1X9N A;  1PH6 A;  5AJ3 L;  1Q12 A;  3HOZ G;  5M3F H;  3RN5 A;  1MKH A;  3CME A;  3RLN A;  4C3I H;  4UY8 C;  3AEV A;  3I2Z A;  5FLX c;  1NMG A;  5C3E G;  3S16 H;  2KCM A;  1SFO H;  1E22 A;  2A1A A;  1QZG A;  4WJ4 A;  2I5L X;  4DV2 Q;  3BU2 A;  2Z0S A;  4B3R Q;  4LFA Q;  2NZH A;  1EIF A;  1HZA A;  2JA5 H;  4DKA C;  5LMN Q;  2B63 G;  1Z9F A;  4BBR G;  3NEN A;  1N36 Q;  1NJI C;  4NXN L;  2UXB L;  1VCI A;  4AYB G;  1XMQ L;  4PZ6 A;  4JI5 Q;  3CPF A;  3BZC A;  4KI0 A;  4A3M H;  1LUZ A;  1HNZ L;  1G6P A;  1BVS A;  2F52 A;  4DR3 L;  2EXD A;  5IP9 G;  4GKJ L;  1VQF A;  1UWV A;  4R4Q A;  1XMO L;  2YTX A;  2CKZ B;  1YHA A;  2NZO A;  3JAM i;  4JI0 Q;  4LF7 L;  2MO1 A;  3HOX H;  5LMU L;  3K81 C;  3RR5 A;  5IWA Q;  1UE6 A;  3G71 A;  2XGT A;  4H02 A;  3F2C A;  4A3K G;  4LW1 A;  4AYB E;  4DR6 Q;  1T9H A;  3I4N H;  4YCU A;  4X62 Q;  4RMF A;  1XPO A;  1N32 Q;  4A93 G;  4LFC L;  1U5K A;  3CF5 A;  3M4O H;  1R9T H;  4BY7 G;  1QUQ B;  2E2H H;  5IE8 A;  1N33 Q;  1LYL A;  2E5L L;  2VUM H;  4A3G H;  3T1Y L;  1JE5 A;  2UXD L;  2KHI A;  1XNR Q;  4JI6 L;  2ID0 A;  4IPC A;  5M3M H;  3AQQ A;  3G4S A;  1OXX K;  1NY4 A;  3J81 c;  4DUZ L;  4GOP C;  2JEB I;  5BR8 Q;  4HIO A;  3BZK A;  3K7A H;  3M4P A;  1WOC A;  3PIO A;  1EQR A;  3CC4 A;  4QQB X;  3S2D H;  3CCU A;  1X3G A;  3ER0 A;  3KJP A;  2IX1 A;  1B7Y B;  1JT8 A;  2K14 A;  3S1Q H;  2JA5 G;  2JQO A;  5C4X G;  3ICE A;  5JEA J;  4QGU A;  2KBN A;  5AJ3 Q;  4POG A;  4GOP B;  5FJ8 G;  4A4I A;  4GN5 A;  4JI3 L;  4JI1 L;  4A3M G;  4JOI A;  3J81 j;  1KD1 C;  1FJG L;  3HKZ G;  2VQF L;  3PSI A;  4JI2 L;  1C0A A;  4HJ5 A;  1Q82 C;  4JI8 L;  2V1C C;  3HOX G;  1EOV A;  4R1J A;  3CD6 A;  1G51 A;  4NXN Q;  3ULL A;  2BH8 A;  3RN2 A;  1XMQ Q;  4L5R C;  1HZC A;  2UXB Q;  2K4K A;  2KCT A;  5ELN A;  3L0O A;  3TS0 A;  4JBK A;  1VQJ A;  2IX0 A;  1L1O A;  3HKZ E;  1HNZ Q;  3TRZ A;  2E8G A;  4DR3 Q;  1Q81 C;  4DV7 L;  2VUM G;  4LF8 L;  4A3G G;  4QJF A;  4GKJ Q;  3UDG A;  2Y0S G;  1XMO Q;  4LF7 Q;  3I56 A;  5LMU Q;  1VQK A;  3J7A 5;  4DV3 L;  1DGS A;  1M90 C;  5E7N A;  3ULJ A;  1YVC A;  1Y1W G;  1QVG A;  1CKM A;  1MJC A;  1VQD A;  5GAG C;  3GDE A;  4LF4 L;  5HGQ A;  1VQA A;  1NTG A;  4EX5 A;  3CCM A;  5C0X J;  4LFC Q;  3GTL H;  1ASZ A;  3S17 H;  4GN3 B;  2JA7 H;  3DLL A;  1AH9 A;  2E5L Q;  4A3B H;  1S3O A;  2Y0S E;  1XTD A;  3E0E A;  3T1Y Q;  2UXD Q;  5H1S E;  1MJE A;  5EAY A;  4JI6 Q;  2QEX A;  2OCE A;  2D0O A;  5IYC H;  1Q86 C;  5K36 G;  5IP7 H;  2N49 A;  5GQO A;  1L0W A;  4DUZ Q;  1EYG A;  4IPG A;  3Q8D A;  2K50 A;  1WFQ A;  1K83 H;  3FP9 A;  4P71 A;  2ZTE A;  4JC0 A;  1VQO A;  3CC7 A;  4X64 L;  4OON A;  4OWW B;  1P16 A;  4ME3 A;  5IY0 A;  3PO3 H;  3U4Z A;  1HR0 W;  4BY1 G;  2KEN A;  3CC2 A;  1YI2 A;  3PF5 A;  2AHO B;  4A3E G;  4L5T A;  1O7I A;  2OQ0 A;  1XPU A;  4BBS H;  1Q8K A;  4LWC A;  4JI3 Q;  4KHP L;  1E7Z A;  4JI1 Q;  3A5U A;  4GLX A;  1FJG Q;  4A3D G;  1EUJ A;  4IPD A;  2CWA A;  4LF9 L;  1FL0 A;  1X3E A;  1EWI A;  2VQF Q;  4JI2 Q;  4NXM L;  1VQN A;  1VQC A;  2N78 A;  2K5N A;  3NEM A;  1JJ2 A;  1B70 B;  4JI8 Q;  3F1Z A;  3U50 C;  1L2F A;  4A76 A;  1QVF A;  3HOU H;  2GVA A;  5IYB H;  3T1H L;  4MZ9 A;  4R4I A;  5JEA G;  4JI4 L;  3G6E A;  1PH4 A;  3B6Y A;  4DUY L;  1WCM G;  2Q2T A;  5JJL A;  1EFW A;  3J80 c;  1YIJ A;  1RL2 A;  4O0A A;  1QUQ A;  1D7Q A;  3HFZ B;  2NVX H;  3KDF B;  3S1R H;  2UXC L;  4DV7 Q;  2Q2U A;  3K80 C;  1UE5 A;  4LF8 Q;  4A3B G;  3GTJ H;  1KRT A;  2YV5 A;  1PFS A;  2WP8 J;  3RLO A;  4NPS A;  3F2D A;  1P8L A;  1GVP A;  4GNX C;  3STB D;  3KOJ A;  4AIM A;  1CKN B;  5IYC G;  4DV3 Q;  1PV4 A;  1YBY A;  5GAE C;  1HJP A;  4KLK A;  4LNQ A;  3HOV G;  3PO2 H;  3I4M G;  4IFD I;  2R93 H;  2ASB A;  4O2D A;  1C9O A;  1VQ8 A;  4LF4 Q;  3PV0 A;  1PHJ A;  4C3H H;  3K7U C;  4JI7 L;  3PO3 G;  5C44 G;  4XTC S;  4JBJ A;  3KF8 B;  2VS1 A;  4GNX B;  1NMF A;  4GOP A;  3EBE A;  2LXK A;  2R7F A;  2ZTD A;  3TQY A;  1PH8 A;  1SN8 A;  1Y14 B;  2ALY B;  1IL2 A;  1H95 A;  2CCZ A;  2JE6 I;  4PZ7 A;  4MTN A;  4PG3 A;  4BXX H;  3S1M H;  5JJK A;  2GN5 A;  4UP9 A;  3J81 i;  4HID A;  4HJA A;  1V9P A;  2ZM6 L;  3LGJ A;  3TEH B;  3S24 A;  4X64 Q;  5M3F G;  1N34 L;  5IP7 G;  1I6H H;  2H5X A;  1EQQ A;  4Y52 H;  1JJG A;  2YU9 H;  3KF6 B;  3PUV A;  4YCV A;  5C0X G;  2ZTC A;  3K0X A;  3JC6 6;  4IO9 A;  2HIV A;  3GTM H;  3FKI H;  4OO1 I;  1IXR A;  1KC8 C;  2R7Z H;  3K8A A;  1K0R A;  1VQB A;  4KHP Q;  5J3B A;  3A5Z B;  1HNX Q;  5ELO A;  3KLW A;  1E1O A;  3OTO L;  4LF9 Q;  2K75 A;  4A75 A;  4NXM Q;  4K0K L;  2NN6 G;  5FLM H;  3OW2 A;  4X6A H;  1HNW L;  4R4O A;  3CCR A;  3H0G H;  1LM0 A;  2I0Q A;  2UUC L;  1SMX A;  1HZ9 A;  4JG2 A;  4APV A;  3T1H Q;  2VY3 A;  3ULP A;  2RF4 A;  1E3P A;  4A3F H;  2KHJ A;  4JI4 Q;  4YWL A;  2LXJ A;  3W1B A;  4DUY Q;  4AQY L;  1X6O A;  1VQ4 A;  3GTK H;  4WJ3 M;  2ZJP A;  5M5X H;  5GAD C;  5IYD H;  4HJ8 A;  3HKS A;  3CPW A;  2Z6K C;  2NVT H;  4DV6 L;  3I4N G;  4Y7N H;  1IBL L;  4NB3 A;  3F8T A;  4R4C A;  4YY3 L;  2UU9 L;  2JA8 H;  2JJQ A;  4BXX G;  4MNO A;  1QZH A;  2BA0 A;  3CAM A;  2LSS A;  3EN2 A;  3GD7 A;  1XPR A;  4DK3 C;  3A0J A;  4BA2 I;  1KXL A;  1A8V A;  3AFP A;  3RZD H;  1MIU A;  1AE2 A;  1Q46 A;  4GS3 A;  1HZB A;  3UDI A;  2DUD A;  1M1K C;  5M3M G;  2WAQ G;  1U0L A;  4OWT B;  1PYS B;  4TVA B;  3D0F A;  2D62 A;  4YWK A;  4LFB L;  3PUZ A;  3AYH B;  1N32 L;  4ALP A;  2PQA B;  2RHQ B;  1KHI A;  4P74 A;  4IPH A;  3PIP A;  1NBW A;  4TQU S;  3PUW A;  1UE1 A;  3FKI G;  2MNA A;  1PH9 A;  4JV5 L;  1IBM L;  1X54 A;  2RHS B;  4GKK L;  4GN4 B;  2VNU D;  2R6G A;  1OXU A;  4PZ8 A;  1LTL A;  3BJU A;  3CCL A;  1OXT A;  2ZM6 Q;  1PA6 A;  5FLM G;  1N34 Q;  3G48 A;  4QIW E;  2WAQ E;  3CCV A;  4XIG S;  4FDB A;  2PMZ E;  1J6Q A;  1VQ9 A;  1VQL A;  4DR1 L;  3H0G G;  3TRE A;  2AWO A;  2AMC B;  5C3E H;  4QY7 A;  3UDX A;  4LUV A;  2YYZ A;  3ERS X;  4DR4 L;  1V43 A;  1KRS A;  2WB1 E;  3HOW H;  3OTO Q;  3KDF A;  2FXQ A;  2B3G A;  3CXC A;  4DAY B;  3L7Z C;  1X56 A;  4K0K Q;  4LF6 L;  1QVC A;  1Z47 A;  1N9W A;  3S1N H;  2B29 A;  4YHH L;  2K5V A;  4BBR H;  2ZJR A;  1OTC A;  1CKN A;  1W3S A;  5GAH C;  2UUC Q;  3CQZ H;  4RG1 A;  1TXY A;  3CMA A;  1Q1B A;  1TWG H;  1VQH A;  1A0I A;  3W5O A;  1Y1V H;  2JK8 A;  1CKO A;  1JB7 A;  3UDF A;  4AQY Q;  1PH7 A;  2N8N A;  4P72 A;  3IRB A;  3J80 i;  1IYJ B;  4GNX A;  1KIX A;  3WWV A;  2F4V L;  4IOA A;  1VQI A;  1GD7 A;  3PUY A;  2QA4 A;  3CCE A;  4DV6 Q;  2HHH L;  1I50 H;  4HIK A;  1IBL Q;  3M3Y H;  4YY3 Q;  2IT1 A;  2GVB A;  3SGI A;  1PH5 A;  2UU9 Q;  1OXV A;  2Q2I A;  4DR5 L;  2VW9 A;  1X55 A;  1IZ6 A;  1PVO A;  4A93 H;  4X65 L;  2JA7 G;  1J5E L;  3H3V I;  4A3C H;  4OXP A;  4IJL A;  1WI5 A;  3DM3 A;  4PMW A;  3F2B A;  3E9H A;  3CCS A;  4HIM A;  3TS2 A;  4IFD J;  3KFU A;  3KF6 A;  4LFB Q;  1I5F A;  4GLV B;  2AKW B;  2L15 A;  3A74 A;  4C3J H; 
#chains in the Genus database with same CATH topology
 3PGZ A;  1YJ9 A;  1RTO A;  3GO5 A;  1H9M A;  3W3A A;  4DU9 A;  1JJC B;  2CH4 A;  2MUY A;  4RA8 A;  4RFB A;  4EVO A;  2HD3 A;  2F03 A;  2F3I A;  4DXF A;  2G9H D;  5LMN W;  3J80 E;  3OYY A;  1PYB A;  3J7A V;  5FLX L;  4OIK A;  2B2T C;  2OQK A;  1XJV A;  3QOL A;  2JP1 A;  1G8Z D;  3ND8 A;  4POF A;  2LFN A;  3CQZ B;  5FKA C;  1TR5 A;  4AH6 A;  1SRO A;  4LF6 Q;  1MD2 D;  3Q24 A;  3HG9 A;  4GLA C;  4IN3 A;  1I94 L;  2OTL A;  1PLF A;  4FF4 A;  4OGQ C;  3NEL A;  3NPP A;  1BKB A;  2ZXR A;  1GUO A;  2EYM A;  3UE1 A;  3K59 A;  2YTV A;  2Z6K A;  3NE5 B;  4ZRZ A;  1HPC A;  2PQA A;  1PYW D;  2RDF A;  1KTK A;  1SE8 A;  3PO2 G;  2EJM A;  1E1T A;  2A74 C;  1CHQ D;  2NVQ B;  1Y1W H;  4X66 L;  5C3W A;  4C2M H;  3BVZ A;  3MEF A;  4DR5 Q;  5CBE E;  3I7F A;  3J81 L;  5CMD A;  5C4X B;  4CJ0 B;  4H7B A;  4KN7 C;  4IJH A;  2VQE Q;  1EFI D;  1A6X A;  1KAA A;  3PUX A;  4YWM A;  2O5I C;  1PZJ D;  2EY2 A;  4OX9 Q;  4DR7 Q;  1YZ6 A;  2Z1C A;  2C5C A;  3C46 A;  2RCN A;  4DNT B;  4JPB W;  2Z9H A;  4ZKC B;  4R9W A;  5I6W A;  4DV0 Q;  3HOX B;  3BYT B;  1F77 A;  2UUA Q;  4H13 C;  1PH2 A;  4JBM A;  5C4Z A;  1ENA A;  3S15 H;  3UE0 A;  4FO2 A;  4V19 0;  1PH1 A;  1LTI D;  1V1Q A;  4JYA Q;  1HR0 Q;  4DR2 Q;  1L1O C;  4IOC A;  4B3M Q;  2WKD A;  3KYH C;  1YJN A;  2B63 H;  2A73 B;  1WTW A;  3S1Q B;  1A15 A;  2EYL A;  1FR3 A;  2IL8 A;  4JVZ A;  2ATW A;  3I4M H;  1JB3 A;  1ML0 D;  1XNQ Q;  4X3S A;  2UUB Q;  1EZ8 A;  4IUP A;  3GP7 A;  1A3V A;  4KY5 A;  2NN6 I;  5ISR A;  1FVI A;  5IT9 c;  4A3K H;  1K73 C;  1EIG A;  2RVL A;  1VS0 A;  3GTP B;  2N55 A;  4B3S Q;  1GUG A;  1ZKO A;  3KK7 A;  1VQM A;  1TII D;  1VQ5 A;  3M85 A;  1Q1E A;  3VYU A;  2K01 A;  1S72 A;  1B53 A;  3RZO B;  1JWU D;  1PH6 A;  1EEF D;  1PRT F;  4G7H C;  1TWC B;  5M3F H;  2O5J C;  1MKH A;  4C1N I;  4E6I A;  1D1I A;  3KLS X;  3RLN A;  5COR A;  5C0X H;  3AEV A;  3VR6 A;  3S16 H;  4KJN A;  1E2V A;  2I5L X;  5ELC A;  1LO5 D;  1TY0 A;  2E74 C;  3K5L A;  1FGB D;  1WCM B;  4DKA C;  4ZK9 B;  2B63 G;  4BBR G;  4FF3 A;  3MXN A;  2PW5 A;  4JI5 Q;  4PZ6 A;  4KI0 A;  4A3B B;  4DR3 L;  1K8O A;  3D4R A;  4GKJ L;  3J80 L;  2CW0 D;  2CKZ B;  3HOV B;  2NZO A;  1HA6 A;  2LKV A;  2XNA C;  3K81 C;  3RR5 A;  2XGT A;  4A3K G;  2E2I B;  4DR6 Q;  1T9H A;  4YCU A;  4X62 Q;  1XPO A;  1RCV D;  1LAC A;  2H1E A;  4LFC L;  5KRU A;  2VUM H;  1N33 Q;  2EPB A;  2Z4I A;  3A56 A;  1PZK D;  4IPC A;  3AQQ A;  1C4Q A;  1NY4 A;  1CA5 A;  2JN4 A;  2F0I A;  2JEB I;  4HIO A;  3CC4 A;  3I72 A;  1BCP C;  1HFG A;  1MI2 A;  2IPK D;  1B7Y B;  1PXU A;  2JQO A;  1AZP A;  3T13 A;  4GOP B;  5FJ8 G;  4A4I A;  4I7A A;  3S1R B;  1HQR D;  2B39 A;  2KQ3 A;  1SYE A;  2F0K A;  1O7L A;  2PNR C;  1X3P A;  3PSI A;  1Q82 C;  2Z4H A;  2V1C C;  4F87 A;  5IIF A;  4L5R C;  2BH8 A;  2UXB Q;  2K4K A;  5ELN A;  3TS0 A;  3L0O A;  4DK0 A;  1SE3 A;  1HNZ Q;  1Q81 C;  2VUM G;  2K04 A;  4QJF A;  1XMO Q;  1D5Z C;  1MBY A;  5LMU Q;  1YVC A;  5M3M B;  1Y8O B;  1TVX A;  1TS2 A;  1VQA A;  3V2T A;  1NTG A;  3NSW A;  2E5L Q;  2UXD Q;  3T1Y Q;  3R2I A;  5DAU A;  2QEX A;  1WTP A;  5K36 G;  2SNM A;  1TS5 A;  1L0W A;  1EYG A;  4IPG A;  3SDZ A;  3QOJ A;  2F0O A;  3H0G B;  3IKJ A;  2ZTE A;  3ERQ A;  4OON A;  3K5N A;  4ME3 A;  1RTN A;  3A7A B;  3U4Z A;  3QB3 A;  3SXH A;  1YI2 A;  4L5T A;  1GUN A;  5KYL A;  2XVS A;  2KCC A;  4BBS H;  4JI3 Q;  1UAP A;  2SEB D;  4JI1 Q;  4XXE A;  3A5U A;  1FJG Q;  4N9T A;  1FL0 A;  4NXM L;  2EYH A;  3NP8 A;  5JOB A;  1B70 B;  4JI8 Q;  2PQE A;  3U50 C;  4PQX A;  3HOU H;  1J9O A;  5JEA G;  1SNQ A;  1SYF A;  1PH4 A;  3B6Y A;  4DUY L;  2Q2T A;  1CZG A;  3TZD A;  1EFW A;  5JJL A;  1QUQ A;  1EOT A;  3HFZ B;  5IT9 E;  4I65 A;  3GTJ H;  1KRT A;  3C3L A;  2YV5 A;  3T56 B;  2JA7 B;  3KOJ A;  4DV3 Q;  1CKN B;  1PV4 A;  5I9P A;  2KUM A;  4KLK A;  2F0L A;  2R93 H;  5JPM C;  1FNW A;  4LF4 Q;  1HTP A;  5C3X A;  2ZT9 C;  5EKL A;  5C44 G;  2VS1 A;  4K8I A;  1JR0 D;  2LXK A;  3TQY A;  4KY6 A;  4DAV A;  1H95 A;  2HCC A;  2NTT A;  4HSV A;  4PZ7 A;  4BXX H;  1EYA A;  2MHV A;  5EPK A;  3PQI A;  4RGN A;  1SMY C;  4HJA A;  2ZM6 L;  1K3B C;  3S24 A;  5A2Q E;  5IP7 G;  3SVM A;  2H5X A;  3Q0A A;  1B2T A;  4YCV A;  4C3I G;  1WTX A;  1STY A;  4PMB A;  5KYI A;  4G57 A;  4CBV A;  4FF2 A;  2HIV A;  3GTM H;  3FKI H;  1KC8 C;  5AFW A;  5J3B A;  3A5Z B;  1HNX Q;  3E3X A;  1JQY D;  4LF9 Q;  4A75 A;  2NN6 G;  4R8N A;  1M4V A;  2F0G A;  3P75 A;  3CCR A;  4IQZ A;  1SMX A;  1MSH A;  1PTO D;  5JPN C;  1CM9 A;  4A3F H;  2KHJ A;  2VXW A;  2LXJ A;  1X6O A;  3GTK H;  1LTG D;  1DON A;  4ZUJ A;  1KAB A;  4C3H B;  4HJ8 A;  3CPW A;  2AQ2 B;  4DV6 L;  3I4N G;  1IBL L;  2JA8 H;  4BXX G;  1JCK B;  2JJQ A;  3I8Z A;  1KDA A;  2BA0 A;  3CAM A;  2LSS A;  4DGZ A;  1KXL A;  1AE2 A;  1Q46 A;  1D5M C;  3NTK A;  1IHZ A;  4ME5 A;  4OWT B;  1U0L A;  4TVA B;  4CDF C;  4CHT B;  1PFN A;  2D62 A;  4KKT A;  3S9W A;  4ALP A;  2PQA B;  1I6H B;  2F0T A;  4G4K A;  1UE1 A;  3FKI G;  1VF7 A;  2BOS A;  5DM7 3;  1AFP A;  3BYY B;  1LTL A;  4ZCK A;  1OXT A;  1PA6 A;  1QJO A;  5M5Y B;  4FDB A;  1VQ9 A;  4X3K A;  2SNS A;  5JVG 3;  1E2Z A;  2YYZ A;  1TWH B;  4DR4 L;  1KRS A;  3HOW H;  3KDF A;  3MEH A;  2RKS A;  5A35 A;  1IL8 A;  3P1H A;  1DOK A;  5GAH C;  2J0T D;  3CQZ H;  3CMA A;  2NVT B;  4ULL A;  1SDF A;  1YNJ D;  2PO4 A;  1JB7 A;  3I91 A;  3N6R A;  2N8N A;  3IRB A;  3KLS A;  4GNX A;  3RZD B;  1J8I A;  3BVM A;  2F4V L;  4IOA A;  3PUY A;  3CCE A;  2HHH L;  2GVB A;  2UU9 Q;  2I07 B;  2M00 A;  1IZ6 A;  2A68 D;  1VMP A;  4IJL A;  1WI5 A;  3F2B A;  3E9H A;  3TS2 A;  3KFU A;  1HHV A;  3KF6 A;  4ILW A;  2NVQ H;  3X3M A;  1N32 Q;  1T5X D;  5IT9 L;  1Y8P B;  4P73 A;  1TT2 A;  2WAC A;  2BCO A;  4OEM B;  2F3V A;  1LTT D;  3QIA A;  4JV5 Q;  3AFQ A;  4GKK Q;  2JA6 H;  4B3T L;  3CKI B;  4DAM A;  5C3E B;  3J7Y W;  3HOW G;  4CKE A;  4FNF A;  1A3U A;  1KLU D;  4DFA A;  5C4X H;  2O4X A;  1K8G A;  3PCO B;  5C6A A;  4HJ7 A;  3GV6 A;  1JC7 A;  4HJ9 A;  1EZ6 A;  3OOC A;  3M4Q A;  4AYB B;  2LS0 1;  3H3V H;  1MGS A;  4HSP A;  1DM0 B;  5C4J B;  2A6H D;  3T51 B;  1Y8N B;  1O78 A;  3VDY A;  3HGB A;  2R7D A;  3GTO H;  4YHH Q;  1Q3L A;  2IHE A;  4ZYS A;  2C35 B;  5M5W H;  1HH2 P;  1I50 B;  1IBK L;  2P5Z X;  4LF5 L;  3A8J E;  2JSO A;  3MXU A;  1AP0 A;  2JEA I;  2JA9 A;  1YNX A;  3MXN B;  3M7N A;  2IWH A;  3A55 A;  1CQV A;  1EY7 A;  4NDX A;  1BXT A;  1YHB A;  4DV5 L;  1ASY A;  2JA6 G;  3QG1 A;  1SFO B;  1ICF B;  3H3V C;  5HY6 A;  2KED A;  1EQT A;  2CQO A;  2ICE C;  2IY5 B;  4UP7 A;  4TRD A;  1GOZ A;  3TSS A;  4QMG A;  4J15 A;  3PIO 3;  4JI7 Q;  4DV1 Q;  2QEJ C;  4A3J H;  1SE2 A;  2B2Y A;  5D14 A;  1YHQ A;  3S14 H;  1A63 A;  1JOQ A;  5JAV A;  2Q8T A;  4DAY A;  4DV4 Q;  4K14 A;  3GTP H;  3KLR A;  3P20 A;  1D8L A;  3MVV A;  2R7Z G;  3MC0 B;  2NUC A;  3VYT A;  4DV2 L;  4QL5 A;  1VQP A;  2NVY H;  4B3R L;  2L11 A;  2NBF A;  4G7O C;  3RZO H;  2KVM A;  1I3Q H;  4JOI C;  1TWC H;  2A5H A;  4OWX B;  2KEE A;  2EE1 A;  2CHB D;  1CSP A;  1PFB A;  4F88 A;  1N36 L;  1R9T B;  1SSO A;  4K6L A;  1H9S A;  5ELF A;  4LUZ A;  3I55 A;  3CP0 A;  2ZJQ A;  1ILP A;  3H15 A;  1WCM H;  3TME A;  3LWE A;  1X3F A;  2DGY A;  4JI0 L;  1JOO A;  1SYB A;  3K7A B;  4CJ2 C;  2A8V A;  4P75 A;  3RNU A;  5IWA L;  1HNW Q;  2AWN A;  5C0X I;  3URY A;  3R93 A;  1B50 A;  1I4P A;  3D6C A;  3IFT A;  4F8M A;  3HOV H;  1WJJ A;  4QCL A;  3CHB D;  4B08 A;  1XNR L;  4A3J G;  2WFW A;  1F9S A;  1ZYR D;  3G7L A;  2E2I H;  1SYD A;  1RIP A;  4R4T A;  4JCV E;  4OL7 A;  2OEO A;  4BY1 B;  1YJW A;  1U4M A;  1M8A A;  4A3E B;  4ZQ3 A;  3RUZ A;  3BG3 A;  1HNX L;  4DNI A;  4KJO A;  1X9N A;  4X3T A;  5HUR A;  4A3D B;  5AJ3 L;  4MHE A;  3CME A;  3PMF A;  3HOZ B;  3I2Z A;  2AQ1 B;  2A6E D;  2FJ2 A;  2RDG A;  5JVH 3;  2E2J B;  5E4X A;  1XXG A;  2A69 D;  4LFA Q;  2NZH A;  4DK1 A;  1EIF A;  3VR2 A;  2JA5 H;  2ICI A;  3E5S A;  5LMN Q;  3NEN A;  4NXN L;  2B2U C;  3SEB A;  1XMQ L;  3BZC A;  1LUZ A;  3QR8 A;  3BDC A;  1SJE D;  1G6P A;  3GV3 A;  1V1P A;  1VQF A;  1UWV A;  4R4Q A;  2K32 A;  4C56 C;  3JAM i;  4LF7 L;  2F0J A;  5IGF A;  1UE6 A;  1AZQ A;  4LW1 A;  4AYB E;  3PO3 B;  5I2Y A;  2F0P A;  3L3O C;  4NMZ A;  2B2W C;  3BDL A;  3ONA B;  4A93 G;  1QUQ B;  1L0X B;  1I4Q A;  1LYL A;  3H91 A;  4A3G H;  2KHI A;  3MXP A;  4JI6 L;  4BY7 B;  2ID0 A;  5M3M H;  4C3J G;  1OXX K;  5I2X A;  4RGT A;  4GOP C;  5BR8 Q;  4HED A;  2L12 A;  3BZK A;  3M4P A;  3R3O A;  5CV4 A;  1X3G A;  2IX1 A;  1DD2 A;  2K14 A;  4FXK C;  2B2V A;  2JA5 G;  4IUN A;  3ICE A;  5JEA J;  2K5Q A;  3NBH A;  1STA A;  5J22 A;  4TSS A;  2RDH A;  3HKZ G;  2NZ1 D;  2QCP X;  3NK9 A;  1HZC A;  2G5D A;  2VB3 X;  1VQJ A;  2IX0 A;  2PCF B;  4RGM A;  4DV7 L;  4A3G G;  2Y0S G;  3M4O B;  2FIN B;  1C48 A;  1DGS A;  5E7N A;  1M90 C;  3ULJ A;  1A2T A;  1Y1W G;  1CKM A;  1MJC A;  4HMJ A;  2AQ3 B;  1ONL A;  2ENB A;  2M2L A;  5HGQ A;  3CCM A;  1BCP D;  1ASZ A;  3S17 H;  1EY5 A;  2JA7 H;  3S2D B;  5C5L A;  4DN4 M;  1S3O A;  1XTD A;  3E0E A;  5EAY A;  4KHV A;  2PZT A;  5G3L F;  5IYC H;  4DUZ Q;  1WFQ A;  3PIP 3;  3NXW A;  4JC0 A;  1JOK A;  4X64 L;  1BR9 A;  5IY0 A;  1HR0 W;  1WTR A;  3K0Y A;  2LY7 A;  1TS4 A;  3C1E A;  4OEL B;  4KHP L;  1E7Z A;  1EUJ A;  4IPD A;  1QNU A;  2VQF Q;  4JI2 Q;  1VQC A;  2N78 A;  4DXG A;  2K5N A;  3ND9 A;  1JJ2 A;  4J1M A;  1KNA A;  1L2F A;  1LTB D;  4IAL A;  2GVA A;  5IYB H;  3T1H L;  4R4I A;  2RSN A;  1L0Y B;  1XWE A;  5K5P A;  2QW7 A;  4CKB A;  1D7Q A;  3KDF B;  1TKW B;  4LF8 Q;  4IUR A;  4Z9C B;  2OXP A;  3F2D A;  4NPS A;  3STB D;  5IYC G;  3OPO A;  1LLR D;  3EFX D;  4LNQ A;  4IFD I;  2K33 A;  5M9O A;  3I4M G;  3KBG A;  4RAU C;  4L6T B;  3AB9 A;  4O2D A;  4C3H H;  1K83 B;  4JI7 L;  4XTC S;  1Y69 U;  4GNX B;  1NMF A;  4CKC A;  1PH8 A;  2ALY B;  2DNE A;  3O13 A;  5E1F A;  4P2C B;  4MTN A;  3NTH A;  2GN5 A;  5E4W C;  3G6J B;  3LGJ A;  1N34 L;  5M3F G;  1NR4 A;  1I6H H;  1EQQ A;  3KF6 B;  5C0X G;  4IO9 A;  4HAE A;  1PFM A;  1IXR A;  4RGO S;  2VB2 X;  1K0R A;  3CRL C;  5ELO A;  2K75 A;  3VYR A;  1X3Q A;  4X6A H;  5KEE A;  1RJT A;  2NVX B;  1HNW L;  1HCZ A;  1LM0 A;  4APV A;  2DN8 A;  3QO2 A;  3DWP A;  2RF4 A;  1E3P A;  4JI4 Q;  4KMU C;  2Q8I B;  1LTA D;  2EY1 A;  4K2L A;  4K2K A;  5J39 A;  3PO2 B;  4S3S A;  1JIC A;  2C9O A;  2ZJP A;  4K5V A;  5M5X H;  1G6Z A;  5IYD H;  1AN8 A;  2Z6K C;  1UUP A;  2NVT H;  2EYF A;  3OWF A;  4KD3 A;  4R4C A;  3F8T A;  4YY3 L;  5D3I B;  5ELD A;  4KV6 A;  4DK3 C;  1NUC A;  3A0J A;  3M7G A;  1I6V C;  4BA2 I;  3RZD H;  2EOT A;  2KCN A;  2WAQ G;  4YWK A;  1PYS B;  2K5D A;  4LFB L;  2RHQ B;  1K8M A;  1KHI A;  1TY2 A;  1NBW A;  3PUW A;  4KD4 A;  4HR7 B;  5CV8 A;  1PDQ A;  1A2U A;  4PZ8 A;  2Q8R E;  5BN3 A;  3T16 A;  3Q6S A;  1CZW A;  4XIG S;  1PRT D;  4CJ1 B;  3X3N A;  1Z7T A;  2AWO A;  2X6L A;  3IL8 A;  5C3E H;  4LUV A;  4FP5 D;  1NCV A;  2NB0 A;  3VA7 A;  3OTO Q;  2FXQ A;  3MZ5 A;  2B3G A;  3CXC A;  1H9R A;  3L7Z C;  4DAY B;  4K0K Q;  4LF6 L;  1Z47 A;  1BNZ A;  3ITP A;  3WOE A;  2K5V A;  2D9U A;  4O42 A;  3HP3 A;  4KN4 C;  2UUC Q;  1ZEQ X;  3VR5 A;  1Q1B A;  3F2U A;  2QDL A;  3WDN A;  1VQH A;  1A0I A;  1T5E A;  1Y1V H;  2JK8 A;  3W5O A;  1R4P B;  4AQY Q;  1C8C A;  2CW0 C;  1IYJ B;  4RHR A;  2L5T A;  1H9S B;  1O7Z A;  1I50 H;  4HIK A;  1K0S A;  4DR5 L;  1PVO A;  1EY6 A;  2L55 A;  3H3V I;  4CGY B;  4A3C H;  2QF7 A;  2BDO A;  4WOR A;  3BZD B;  2D5D A;  4GLV B;  2AKW B;  1V1O A;  3BDO A;  4KK7 A;  3VYS A;  2MJ8 A;  3SK5 A;  2VQE L;  1QCB D;  3DM1 A;  1IBM Q;  3Q22 A;  2XRQ D;  2BE5 C;  1BBW A;  4M8A A;  1JMC A;  3CCQ A;  2QKI C;  2XN9 C;  4OX9 L;  4DR7 L;  1KL9 A;  2NYZ D;  4XT3 B;  1BBU A;  1YNN D;  3GTG H;  1AE3 A;  1QE6 A;  2EQS A;  4DV0 L;  4DR1 Q;  2PI2 A;  4BBS G;  3S1N B;  2B63 B;  4BBR B;  3A54 A;  2V4D A;  4LUO A;  3T4A C;  3MHB A;  1EEI D;  2UUA L;  1D6E C;  1Y1V G;  4NW2 A;  1Z6H A;  3GTQ H;  1YEZ A;  3PF4 A;  3L2P A;  1STN A;  2VL6 A;  3HOU G;  3HOY H;  3J7Z C;  4IFD H;  4YCW A;  1HUN A;  2EIF A;  4JYA L;  1HR0 L;  2A19 A;  3JAM c;  4DR2 L;  4A3K B;  3MWY W;  4B3M L;  2MP1 A;  1F2M A;  4L63 B;  4A3C G;  2X69 A;  4DK6 C;  5KNB A;  3I4O A;  2HCI A;  2Z6B A;  4XYO A;  5LHY 1;  2R93 G;  2Q2H A;  1E24 A;  1TWF B;  4XT1 B;  1V1P B;  3KJO A;  1XNQ L;  1K28 A;  2UUB L;  3S16 B;  3TP8 A;  4X65 Q;  1J5E Q;  1S4Z A;  2AUJ D;  1TWA B;  1YIT A;  2MQH A;  1GHJ A;  1GO3 E;  4JBW A;  3OW7 A;  5IOD A;  4B3S L;  4RH6 A;  1GKH A;  3S2H B;  4QUC A;  1AW7 A;  2QGQ A;  4H0L C;  4RCO A;  2K1B A;  3A7L A;  4U67 3;  1KQS A;  3M9B A;  4DNR B;  1F9P A;  1SLJ A;  2EYO A;  4BY1 H;  3HOY G;  3D6W A;  4IFD G;  4A3E H;  2MFI A;  3I73 A;  4FYD A;  3E9I A;  2WB1 G;  2R92 H;  5NUC A;  4A3D H;  4A3I H;  4A3L H;  1IW7 C;  4FXG C;  4DF7 A;  3HOZ H;  1I4X A;  1Q7Y C;  3NBH B;  4JI5 L;  2OF1 A;  2VUM B;  4FVM A;  2E2J H;  1S40 A;  1WYD A;  4A3F G;  2D0P A;  1CSQ A;  4KHZ A;  1I94 Q;  4EQP A;  4N8F A;  5KIX A;  3D8G A;  3ERO A;  1N8R C;  4IUQ A;  3MA2 B;  2NTS A;  3CCJ A;  3OIP A;  1NE3 A;  4DR6 L;  2JA8 G;  3EQL C;  2RA4 A;  2I5H A;  4X62 L;  3K5M A;  2ZXP A;  4NP5 A;  4PV1 C;  1FGU A;  1I4R A;  4X66 Q;  1N33 L;  2CFM A;  1NNX A;  1CUK A;  2EVB A;  5CC4 A;  4IUT A;  2YTY A;  2CH4 W;  1B44 D;  1F9Q A;  4H44 C;  4L8J A;  1ENC A;  1GM5 A;  2R92 G;  1W2B A;  1S5C D;  1MHW C;  4CDE C;  1GUW A;  1KAW A;  4A3I G;  3RLF A;  4BY7 H;  4A3L G;  1EQV A;  1B9N A;  1Q12 A;  3HOZ G;  2KA7 A;  2XWJ B;  2B2T A;  1NMG A;  3C2P A;  1PZI D;  2BDN A;  2IJ0 A;  3BU2 A;  2Z0S A;  2MGS A;  3SR1 A;  1HZA A;  2F0D A;  1Z9F A;  4QF4 A;  2K03 A;  2UXB L;  1VCI A;  2X6G A;  2I46 A;  5D3D A;  4BWG B;  4JK1 C;  1HNZ L;  1ZXT A;  3QJY A;  1A3T A;  1XMO L;  2YTX A;  1YHA A;  3HOX H;  5LMU L;  3G71 A;  5A2Q L;  1QNK A;  5EKI A;  1NAP A;  5C44 B;  1LTR D;  1WTH A;  1LT5 D;  1RDP D;  3CF5 A;  3M4O H;  4BY7 G;  2E5L L;  3BVG A;  2UXD L;  1HXY D;  3T1Y L;  1D2B A;  4QB4 A;  1BF4 A;  3G4S A;  4UDU C;  4G7Z C;  1WOC A;  1U4R A;  1EQR A;  4C3I B;  4QQB X;  2F1M A;  3S2D H;  3CCU A;  3ER0 A;  2TMP A;  2K05 A;  3S1Q H;  5C4X G;  1BO0 A;  2KHS A;  2KBN A;  3JAM E;  4GN5 A;  1IYU A;  4JI3 L;  2IW3 A;  4JI1 L;  1FJG L;  3J81 j;  4A3M B;  4HJ5 A;  1JOR A;  4JI8 L;  1UEA B;  3L9A X;  3HOX G;  1G91 A;  1G51 A;  4HCS A;  3NWS A;  5IOC A;  1ESR A;  4UAI A;  4PMC A;  4ZUI A;  2KCT A;  1S5E D;  4JBK A;  4K5W A;  1LAB A;  4ZKB B;  1YNJ C;  1L1O A;  2E8G A;  4DR3 Q;  1STE A;  3I4N B;  2MPM A;  4GKJ Q;  1B3A A;  2E2H B;  3I56 A;  5I4D A;  1E2W A;  4DV3 L;  3IAY A;  2E2D C;  4QIW B;  1QVG A;  2K7V A;  5GAG C;  3GDE A;  2XWB B;  4LF4 L;  4EX5 A;  4LFC Q;  5C0X J;  3FKI B;  2F0H A;  4A3B H;  1MJE A;  1V8Q A;  5KND A;  1SYG A;  2D0O A;  1FD7 D;  3I70 A;  1EIH A;  5IP7 H;  2N49 A;  2L4N A;  1GXD C;  1EU3 A;  5CV6 A;  1K83 H;  5CYU A;  3J7A F;  3CC7 A;  2L0C A;  4OWW B;  1P16 A;  4R8I A;  2F0E A;  3CC2 A;  1G2T A;  5FOB B;  4V0B A;  2AHO B;  4Q5V A;  1SNM A;  3U9S A;  1O7I A;  2OQ0 A;  3PF5 A;  3K57 A;  1XPU A;  3R8B A;  1Q8K A;  4LF9 L;  1X3E A;  4M1U B;  1D1K A;  3MXG A;  1SYC A;  4HCE A;  1W6K A;  4A76 A;  2CVR A;  3K5O A;  1SND A;  5CV7 A;  1II3 A;  3G6E A;  1WCM G;  4O0A A;  4DA2 A;  2NVX H;  3S1R H;  3QWN A;  2Q2U A;  3K80 C;  1UE5 A;  4A3B G;  4LAA A;  3GTL B;  1PFS A;  1NSN S;  2WP8 J;  3RLO A;  4GNX C;  4AIM A;  3NWT A;  1YBY A;  5GAE C;  1HJP A;  3HOV G;  3PO2 H;  2K5W A;  2ASB A;  1KDC A;  3PV0 A;  1JWM D;  2PYK A;  1PTO B;  1RD9 D;  1QIL A;  1SBB B;  4KKS A;  1S5F D;  3EBE A;  2ZTD A;  3NUC A;  3HOW B;  1Y14 B;  4J6H A;  2CCZ A;  2JE6 I;  1QB5 D;  4PG3 A;  2JYO A;  2HUG A;  3NQI A;  3J81 i;  1H9K A;  4HID A;  1FNV A;  1V9P A;  1RHP A;  1JWS D;  1UNS A;  1DOM A;  3RMH A;  1O80 A;  2EXZ A;  3PUV A;  4Y52 H;  3TN2 A;  1JJG A;  3K0X A;  3JC6 6;  2EDG A;  2CQA A;  3IFD A;  4OO1 I;  1TU2 B;  3K8A A;  2KJX A;  5TSS A;  5IGD A;  1TS3 A;  5LL6 S;  1Q90 A;  3I90 A;  4IUV A;  5CGK A;  4NXM Q;  5FLM H;  4HN7 A;  1U4L A;  3H0G H;  3BS1 A;  2I0Q A;  1ET6 A;  1HQM C;  1HZ9 A;  2PZW A;  2VY3 A;  4XDX A;  5KGU A;  3W1B A;  4DUY Q;  1VQ4 A;  3JAM L;  2K28 A;  4CDC C;  4WJ3 M;  4IZ8 A;  1SNO A;  2JA6 B;  1S5D D;  1SAP A;  4NB3 A;  2UU9 L;  4FF1 A;  3FRP B;  1G2S A;  1QZH A;  3EN2 A;  3GD7 A;  1XPR A;  5LL6 X;  3S1M B;  1A8V A;  5JJZ A;  3E6Z X;  1MIU A;  3UDI A;  3OHX C;  1M1K C;  1BBX C;  5M3M G;  1ZYR C;  3D0F A;  3R2T A;  3PUZ A;  3AYH B;  1N32 L;  3V96 A;  4P74 A;  3DEO A;  3MTS A;  3LNN A;  4TQU S;  2YU9 B;  4JV5 L;  3I4L A;  2F0W A;  1X54 A;  2RHS B;  4GKK L;  4GN4 B;  2F0N A;  2R6G A;  3GTO B;  2R7Z B;  1F2L A;  4XQJ A;  3NTI A;  5CR3 A;  3DUZ A;  1HFN A;  2ZM6 Q;  5FLM G;  5M5W B;  3G48 A;  2RCF A;  4QIW E;  2B2Y C;  3DHQ A;  3H0G G;  2A6E C;  3TRE A;  5C4H A;  4NKL A;  1STG A;  3UDX A;  3ERS X;  2D2C C;  2E75 C;  2A69 C;  2TSS A;  4C1N K;  2WB1 E;  1BUV T;  4UHV A;  4IUU A;  1X56 A;  1QVC A;  4Q0F A;  5D65 A;  3S1N H;  4YHH L;  2ZJR A;  4BBR H;  1OTC A;  2EZV A;  1W3S A;  4ABN A;  1S5B D;  1TXY A;  1D5X C;  4Y7N B;  3VR3 A;  5CV9 A;  1PH7 A;  2F0M A;  4P72 A;  1DYQ A;  3J80 i;  4MTK A;  3KF8 A;  2Z8L A;  1LT6 D;  1KIX A;  4LMQ D;  4A3J B;  2DY8 A;  2QA4 A;  4DV6 Q;  3S14 B;  1IBL Q;  1OXV A;  2Q2I A;  5T1I A;  2JA7 G;  2OT2 A;  3W2D A;  1TQO A;  1DXM A;  4IFD J;  2NVY B;  3CCS A;  2GA4 B;  4HIM A;  4J8Q A;  1I3Q B;  1DCZ A;  1I5F A;  4I7Z C;  1SJH D;  3A74 A;  2G9D A;  1TWF H;  1G29 1;  4WJW A;  1WD1 A;  3W1G A;  1ILQ A;  1TWA H;  4RCN A;  2R3Z A;  4DV1 L;  2DJF C;  1WTO A;  2B8G A;  1RF2 D;  1VMC A;  4DV4 L;  1EU4 A;  3TZU A;  3MFY A;  5BN5 A;  4JW0 A;  3S2H H;  1BQQ T;  5FJ8 H;  2I5M X;  1DJR D;  4XQQ A;  1PH3 A;  4DR4 Q;  2PW7 A;  3TP5 A;  3D3R A;  1TWG B;  3T53 B;  1XTC D;  5ELE A;  1FNU A;  5IYB G;  1H9J A;  3CRK C;  4MN3 A;  1QWY A;  5DLQ E;  3U4V A;  1CI3 M;  2OWO A;  1F9R A;  1FYC A;  1STB A;  5M5Y H;  3FMC A;  4EQO A;  3M3Y B;  3OMC A;  1CA6 A;  3H09 A;  2HDM A;  1OO9 B;  4A93 B;  4K6D A;  1A62 A;  5EJW A;  2J4X A;  5EQ0 A;  1TWH H;  4ODG A;  3U58 A;  1IKL A;  4L5Q A;  1UE7 A;  4EGV A;  2F4V Q;  1SRU A;  2ES2 A;  3CW2 C;  5FK9 C;  2M9V A;  2HHH Q;  4C3J B;  1GUS A;  4C3H G;  3EVQ A;  3LWU A;  2XTI A;  2UXC Q;  5DNF A;  1KNE A;  3RD4 A;  5L37 A;  2BE5 D;  2PI2 E;  1VQG A;  2F0U A;  3EA6 A;  2K52 A;  3ZJY C;  4OO1 H;  2JA5 B;  1B8A A;  5G3L D;  5BN4 A;  5K36 H;  1CK1 A;  2VZA A;  4DPG A;  5GRO A;  3FHW A;  1SE4 A;  1SMY D;  4RHS A;  4B3T Q;  3D31 A;  3HKZ B;  4UPA A;  1B3Q A;  2B2V C;  4EQN A;  2CWP A;  4QUF A;  3EJI A;  4EQ5 A;  1LT4 D;  2EYP A;  2K5H A;  4RKB A;  4LFA L;  1K3R A;  3DEP A;  1B4O A;  3EIV A;  1EIY B;  4DAP A;  1UEB A;  1CT1 D;  5JJI A;  2IX3 A;  5LMN L;  2HQL A;  3DMU A;  5DEH A;  2OTJ A;  4LJZ C;  1PTO F;  1DZ1 A;  2HT1 A;  4A3G B;  2Y0S B;  1STH A;  5JEA H;  3K6O A;  2BH2 A;  1SNC A;  3VA5 A;  1Y1W B;  2PNH A;  1IBK Q;  1VQ7 A;  4UP8 A;  4C2M B;  5IYD G;  4LF5 Q;  2MO0 A;  2IHF A;  4BA1 I;  4L5S A;  1F2Z A;  1HRJ A;  4BS9 A;  1W6J A;  4OO1 G;  1SR3 A;  1OXS C;  3STB C;  1C7Y A;  5I6Y A;  2BA1 A;  4XYQ A;  5IGE A;  1X65 A;  5C4J H;  4X3U A;  1HUM A;  1K8A C;  1L1O B;  5IP9 H;  2N3S A;  4DV5 Q;  1VQE A;  2FHT A;  2NWG A;  1GUT A;  3DWQ A;  5C44 H;  3FPP A;  1XYI A;  5BR8 L;  1VQ6 A;  3D4D A;  1SXT A;  2PZU A;  1EWC A;  2E76 C;  2EY5 A;  2HIX A;  1K9M C;  2RSO A;  1IW7 D;  3RN5 A;  4C3I H;  4UY8 C;  1VDZ A;  5FLX c;  5C3E G;  3S15 B;  2KCM A;  1SFO H;  1E22 A;  3HZX A;  2A1A A;  1QZG A;  4WJ4 A;  4DV2 Q;  1U4P A;  4B3R Q;  1QG7 A;  1CHP D;  3H6M A;  2F3W A;  1R4Q B;  4HMI A;  2NN6 H;  1N36 Q;  1HTL D;  1NJI C;  4AYB G;  3S17 B;  3CPF A;  1WTQ A;  4A3M H;  2QDB A;  1BVS A;  2F52 A;  2EXD A;  5IP9 G;  2F0F A;  2AUK A;  4JI0 Q;  3I4M B;  2MO1 A;  2HDL A;  5IWA Q;  3F2C A;  4H02 A;  1EL0 A;  3TBI B;  1PMR A;  3I4N H;  1KLG D;  4RMF A;  4YIJ A;  1F2Y A;  2L1B A;  4LK1 C;  1U5K A;  1R9T H;  2E2H H;  5IE8 A;  1SEB D;  3OMG A;  1JE5 A;  1XNR Q;  2F4I A;  2XIW A;  1AEX A;  3J81 c;  2WIN B;  4K5X A;  4DUZ L;  5M3F B;  3K7A H;  3PIO A;  3NQT A;  2SOB A;  3A8K E;  3KJP A;  1MSG A;  1BOS A;  2FFK B;  1JT8 A;  2ZXO A;  2KEC A;  3WOF A;  3FDT A;  2LMC B;  4QGU A;  4POG A;  5AJ3 Q;  1PRT C;  2WV6 D;  2EJF C;  2O2L D;  1BCP B;  1EY0 A;  4A3M G;  4JOI A;  1KD1 C;  1ROD A;  2VQF L;  1B9M A;  4JI2 L;  3D4W A;  3HRZ C;  4U68 A;  1C0A A;  2F0V A;  3U9O A;  3TDQ A;  3FPU B;  1HA5 A;  4TKO B;  1EOV A;  4R1J A;  3CD6 A;  2PPB C;  3CU7 A;  3UI2 A;  3ULL A;  4NXN Q;  3I3C A;  3RN2 A;  1XMQ Q;  1JE4 A;  3ZYY X;  3HKZ E;  1LT3 D;  3TRZ A;  5CV5 A;  4LF8 L;  3UDG A;  3DWA A;  4LF7 Q;  2B8F A;  4MIU A;  3N52 A;  1VQK A;  3J7A 5;  5IGC A;  1WTV A;  1KDB A;  2WAQ B;  4O1N A;  2PMZ B;  1VQD A;  5J1Z A;  3SE0 A;  1X32 A;  2EYJ A;  3GTL H;  3SHL A;  2K6A A;  4GN3 B;  3DLL A;  5CBA E;  1AH9 A;  2Y0S E;  5H1S E;  4JI6 Q;  1WVL A;  4K8J A;  2OCE A;  1QOH A;  1Q86 C;  5GQO A;  3MAQ A;  4B9X A;  3Q8D A;  2K50 A;  3FP9 A;  3OWE B;  4P71 A;  5IGB A;  2WKC A;  1PTO H;  1VQO A;  1B1Z A;  5FO9 B;  1U9R A;  3PO3 H;  1Q8I A;  4BY1 G;  1NR2 A;  1YNN C;  1ENF A;  2KEN A;  3GQB A;  4CDD C;  4PNY A;  3OIQ A;  4A3E G;  5FO7 B;  3TP6 A;  5M5X B;  3FVQ A;  4LWC A;  4GLX A;  4A3D G;  2CWA A;  3NHH A;  1EWI A;  3VR4 A;  1VQN A;  1DOL A;  3NEM A;  5EBC A;  2EJG C;  2B2U A;  3F1Z A;  1IYV A;  1QVF A;  3Q23 A;  4MZ9 A;  2F0S A;  5F2D A;  4JI4 L;  3HS0 C;  3J80 c;  1YIJ A;  1RL2 A;  2UXC L;  4DV7 Q;  2J7Z A;  2RQX A;  3E0J A;  1PTO C;  5KNC A;  1P8L A;  1GVP A;  3H94 A;  1EWH A;  2HQE A;  2B2W A;  4N9P A;  3AMU A;  4WFN 3;  1GJX A;  3NBI A;  4RKL A;  5EGT A;  1C9O A;  2JXM B;  1I4G A;  1PHJ A;  3K7U C;  5FO8 B;  5FLX E;  3PO3 G;  4JBJ A;  3KF8 B;  3DXJ C;  1EYC A;  4GOP A;  5IGG A;  4FXD A;  2R7F A;  1SN8 A;  1IL2 A;  3SK8 A;  2FMM A;  1LTS D;  3S1M H;  5JJK A;  4UP9 A;  4HTH A;  2DNC A;  4OIJ A;  4BBS B;  4X64 Q;  3TEH B;  2FMC A;  2YU9 H;  1Y1V B;  2H4O A;  1EY4 A;  2ZTC A;  1XX8 A;  1EY8 A;  2R7Z H;  2WII B;  5T1G A;  3HOU B;  1VQB A;  4KHP Q;  3KLW A;  1E1O A;  3OTO L;  1EYD A;  2QIL A;  4K0K L;  1I4H A;  3MFG A;  1CTM A;  4KY7 A;  3OW2 A;  1WD0 A;  3A8I E;  4R4O A;  5ELB A;  3KBX A;  4ZAI A;  2UUC L;  3GTJ B;  4JG2 A;  3LX0 A;  3T1H Q;  1LV9 A;  3ULP A;  1GHK A;  5HGT A;  5EPL A;  4YWL A;  2XRS D;  4AQY L;  1PRT B;  3J81 E;  2R93 B;  2KOL A;  4RWS C;  5GAD C;  3HKS A;  2F0Q A;  4Y7N H;  3FEW X;  5COY A;  4MNO A;  2EY6 A;  3GTG B;  3AFP A;  1VQ8 A;  1IKM A;  4GS3 A;  1HZB A;  2DUD A;  1ICW A;  4KKU A;  4WRD A;  3GTQ B;  3PIP A;  3KUP A;  4IPH A;  3HEJ A;  4KTA A;  3SK4 A;  3TP7 A;  2MNA A;  1PH9 A;  2A68 C;  1IBM L;  3HOY B;  2VNU D;  3M4Y A;  5I9O A;  3GTM B;  1OXU A;  3C1F A;  3BJU A;  3CCL A;  2WB1 B;  1N34 Q;  2WAQ E;  3CCV A;  2PMZ E;  1VF5 C;  1J6Q A;  5EBD A;  4ZLT F;  1VQL A;  4DR1 L;  1ET9 A;  3SK6 A;  1O7Y A;  4F7X A;  2AMC B;  2RBM A;  4XQN A;  4QY7 A;  1V43 A;  4A3F B;  1EY9 A;  2N88 A;  3K58 A;  4GZY C;  3GTK B;  2R61 A;  4ID6 A;  1N9W A;  2B29 A;  3P7J A;  1CKN A;  4RG1 A;  1ESF A;  4B9W A;  2XSC A;  5EPJ A;  1TWG H;  1SNP A;  2JA8 B;  1CKO A;  5EKK A;  2L9H A;  3UDF A;  5DM6 3;  2A6H C;  3V05 A;  2DJG C;  3WWV A;  1CFM A;  1VQI A;  1GD7 A;  3AU7 A;  3M3Y H;  4YY3 Q;  2IT1 A;  3SGI A;  1PH5 A;  5E3F A;  1BDO A;  4OHJ A;  2VW9 A;  2SDF A;  1BCP F;  1X55 A;  1E0B A;  4X65 L;  4A93 H;  1J5E L;  2DY7 A;  4OXP A;  4PMW A;  3DM3 A;  2R92 B;  3OSO A;  4A3I B;  4LFB Q;  1RKN A;  5C5M A;  4N8X 1;  2L15 A;  4C3J H;  1CQF A; 
#chains in the Genus database with same CATH homology
 1TWF H;  1G29 1;  3PGZ A;  4P73 A;  2VQE L;  3W1G A;  1YJ9 A;  4JV5 Q;  3GO5 A;  1TWA H;  3AFQ A;  1IBM Q;  4GKK Q;  2JA6 H;  2NVQ H;  4DV1 L;  4B3T L;  1BBW A;  1JJC B;  4DAM A;  1JMC A;  3CCQ A;  3HOW G;  4OX9 L;  4DR7 L;  4DV4 L;  1KL9 A;  1BBU A;  5C4X H;  2F3I A;  1K8G A;  3GTG H;  1AE3 A;  3PCO B;  3S2H H;  5LMN W;  2EQS A;  4DV0 L;  4HJ7 A;  2PI2 A;  3OYY A;  1PYB A;  4DR1 Q;  5FJ8 H;  4BBS G;  4HJ9 A;  2I5M X;  2OQK A;  1XJV A;  4LUO A;  2UUA L;  3M4Q A;  1Y1V G;  3GTQ H;  1PH3 A;  4POF A;  3H3V H;  4DR4 Q;  1YEZ A;  3PF4 A;  3L2P A;  4AH6 A;  2VL6 A;  3HOU G;  1SRO A;  5IYB G;  3HOY H;  4LF6 Q;  3J7Z C;  3VDY A;  4YCW A;  2R7D A;  3GTO H;  4YHH Q;  4GLA C;  2IHE A;  5DLQ E;  2C35 B;  1I94 L;  2EIF A;  3U4V A;  2OWO A;  4JYA L;  1HR0 L;  5M5W H;  2A19 A;  2OTL A;  3JAM c;  5M5Y H;  1HH2 P;  4DR2 L;  1IBK L;  4B3M L;  3NEL A;  2A8V A;  4LF5 L;  1BKB A;  4A3C G;  3UE1 A;  2YTV A;  2Z6K A;  1A62 A;  4DK6 C;  2JEA I;  3I4O A;  2JA9 A;  1YNX A;  1TWH H;  3MXN B;  3U58 A;  4L5Q A;  2PQA A;  1UE7 A;  3M7N A;  1SE8 A;  2F4V Q;  3PO2 G;  1SRU A;  2ES2 A;  1E1T A;  3CW2 C;  2R93 G;  2HHH Q;  1Y1W H;  2Q2H A;  4X66 L;  1E24 A;  1YHB A;  4C2M H;  4DV5 L;  4DR5 Q;  3MEF A;  3KJO A;  1ASY A;  1XNQ L;  2JA6 G;  2XTI A;  2UUB L;  4X65 Q;  2UXC Q;  1J5E Q;  2PI2 E;  1VQG A;  2MQH A;  1YIT A;  2K52 A;  1GO3 E;  3ZJY C;  3I7F A;  5HY6 A;  2CQO A;  4JBW A;  4UP7 A;  2IY5 B;  1B8A A;  4B3S L;  1GKH A;  2VZA A;  4DPG A;  4IJH A;  2QGQ A;  5GRO A;  2VQE Q;  3FHW A;  3PUX A;  4J15 A;  4YWM A;  4JI7 Q;  4DV1 Q;  4B3T Q;  4A3J H;  3D31 A;  1YHQ A;  1KQS A;  3S14 H;  4OX9 Q;  1A63 A;  3M9B A;  4UPA A;  1YZ6 A;  4DV4 Q;  4DR7 Q;  1SLJ A;  3GTP H;  1D8L A;  4BY1 H;  2CWP A;  3HOY G;  2RCN A;  4IFD G;  4EQ5 A;  2R7Z G;  4A3E H;  2K5H A;  2MFI A;  4DV0 Q;  4DV2 L;  4QL5 A;  1VQP A;  3E9I A;  2NVY H;  2WB1 G;  2R92 H;  4B3R L;  4LFA L;  1K3R A;  3RZO H;  4JOI C;  1I3Q H;  4A3D H;  3EIV A;  4A3I H;  2UUA Q;  1EIY B;  1TWC H;  4OWX B;  4A3L H;  1UEB A;  5JJI A;  1PH2 A;  5LMN L;  3HOZ H;  1CSP A;  1N36 L;  2HQL A;  1Q7Y C;  4JBM A;  3UE0 A;  3NBH B;  3S15 H;  2OTJ A;  4JI5 L;  2HT1 A;  2E2J H;  1S40 A;  4LUZ A;  1WYD A;  4A3F G;  2D0P A;  1PH1 A;  1CSQ A;  4KHZ A;  3I55 A;  3CP0 A;  1V1Q A;  1I94 Q;  2ZJQ A;  4JYA Q;  1HR0 Q;  3H15 A;  2BH2 A;  1WCM H;  1N8R C;  4DR2 Q;  1L1O C;  1X3F A;  2DGY A;  2PNH A;  4IOC A;  1IBK Q;  1VQ7 A;  4UP8 A;  4B3M Q;  4JI0 L;  5IYD G;  4P75 A;  2MO0 A;  3KYH C;  1YJN A;  2IHF A;  4BA1 I;  4LF5 Q;  3RNU A;  3CCJ A;  4L5S A;  5IWA L;  2B63 H;  1NE3 A;  2AWN A;  1HNW Q;  4DR6 L;  1SR3 A;  1OXS C;  3STB C;  1C7Y A;  2I5H A;  5C0X I;  2JA8 G;  4OO1 G;  4X62 L;  2BA1 A;  1X65 A;  1FGU A;  5C4J H;  2ATW A;  1K8A C;  3HOV H;  1L1O B;  1WJJ A;  5IP9 H;  4X66 Q;  2N3S A;  3I4M H;  1N33 L;  4DV5 Q;  2CFM A;  1XNQ Q;  1XNR L;  4A3J G;  1VQE A;  1CUK A;  2WFW A;  2UUB Q;  2E2I H;  5C44 H;  2YTY A;  2NN6 I;  1RIP A;  1FVI A;  5IT9 c;  4R4T A;  4A3K H;  5BR8 L;  1K73 C;  1VQ6 A;  1VS0 A;  4JCV E;  1YJW A;  4B3S Q;  1VQM A;  1GM5 A;  2R92 G;  1W2B A;  1VQ5 A;  1KAW A;  4A3I G;  3M85 A;  1Q1E A;  3RLF A;  1HNX L;  4A3L G;  4DNI A;  2HIX A;  1S72 A;  4BY7 H;  1K9M C;  1X9N A;  1PH6 A;  5AJ3 L;  1Q12 A;  3HOZ G;  5M3F H;  3RN5 A;  1MKH A;  3CME A;  3RLN A;  4C3I H;  4UY8 C;  3AEV A;  3I2Z A;  5FLX c;  1NMG A;  5C3E G;  3S16 H;  2KCM A;  1SFO H;  1E22 A;  2A1A A;  1QZG A;  4WJ4 A;  2I5L X;  4DV2 Q;  3BU2 A;  2Z0S A;  4B3R Q;  4LFA Q;  2NZH A;  1EIF A;  1HZA A;  2JA5 H;  4DKA C;  5LMN Q;  2B63 G;  1Z9F A;  4BBR G;  3NEN A;  1N36 Q;  1NJI C;  4NXN L;  2UXB L;  1VCI A;  4AYB G;  1XMQ L;  4PZ6 A;  4JI5 Q;  3CPF A;  3BZC A;  4KI0 A;  4A3M H;  1LUZ A;  1HNZ L;  1G6P A;  1BVS A;  2F52 A;  4DR3 L;  2EXD A;  5IP9 G;  4GKJ L;  1VQF A;  1UWV A;  4R4Q A;  1XMO L;  2YTX A;  2CKZ B;  1YHA A;  2NZO A;  3JAM i;  4JI0 Q;  4LF7 L;  2MO1 A;  3HOX H;  5LMU L;  3K81 C;  3RR5 A;  5IWA Q;  1UE6 A;  3G71 A;  2XGT A;  4H02 A;  3F2C A;  4A3K G;  4LW1 A;  4AYB E;  4DR6 Q;  1T9H A;  3I4N H;  4YCU A;  4X62 Q;  4RMF A;  1XPO A;  1N32 Q;  4A93 G;  4LFC L;  1U5K A;  3CF5 A;  3M4O H;  1R9T H;  4BY7 G;  1QUQ B;  2E2H H;  5IE8 A;  1N33 Q;  1LYL A;  2E5L L;  2VUM H;  4A3G H;  3T1Y L;  1JE5 A;  2UXD L;  2KHI A;  1XNR Q;  4JI6 L;  2ID0 A;  4IPC A;  5M3M H;  3AQQ A;  3G4S A;  1OXX K;  1NY4 A;  3J81 c;  4DUZ L;  4GOP C;  2JEB I;  5BR8 Q;  4HIO A;  3BZK A;  3K7A H;  3M4P A;  1WOC A;  3PIO A;  1EQR A;  3CC4 A;  4QQB X;  3S2D H;  3CCU A;  1X3G A;  3ER0 A;  3KJP A;  2IX1 A;  1B7Y B;  1JT8 A;  2K14 A;  3S1Q H;  2JA5 G;  2JQO A;  5C4X G;  3ICE A;  5JEA J;  4QGU A;  2KBN A;  5AJ3 Q;  4POG A;  4GOP B;  5FJ8 G;  4A4I A;  4GN5 A;  4JI3 L;  4JI1 L;  4A3M G;  4JOI A;  3J81 j;  1KD1 C;  1FJG L;  3HKZ G;  2VQF L;  3PSI A;  4JI2 L;  1C0A A;  4HJ5 A;  1Q82 C;  4JI8 L;  2V1C C;  3HOX G;  1EOV A;  4R1J A;  3CD6 A;  1G51 A;  4NXN Q;  3ULL A;  2BH8 A;  3RN2 A;  1XMQ Q;  4L5R C;  1HZC A;  2UXB Q;  2K4K A;  2KCT A;  5ELN A;  3L0O A;  3TS0 A;  4JBK A;  1VQJ A;  2IX0 A;  1L1O A;  3HKZ E;  1HNZ Q;  3TRZ A;  2E8G A;  4DR3 Q;  1Q81 C;  4DV7 L;  2VUM G;  4LF8 L;  4A3G G;  4QJF A;  4GKJ Q;  3UDG A;  2Y0S G;  1XMO Q;  4LF7 Q;  3I56 A;  5LMU Q;  1VQK A;  3J7A 5;  4DV3 L;  1DGS A;  1M90 C;  5E7N A;  3ULJ A;  1YVC A;  1Y1W G;  1QVG A;  1CKM A;  1MJC A;  1VQD A;  5GAG C;  3GDE A;  4LF4 L;  5HGQ A;  1VQA A;  1NTG A;  4EX5 A;  3CCM A;  5C0X J;  4LFC Q;  3GTL H;  1ASZ A;  3S17 H;  4GN3 B;  2JA7 H;  3DLL A;  1AH9 A;  2E5L Q;  4A3B H;  1S3O A;  2Y0S E;  1XTD A;  3E0E A;  3T1Y Q;  2UXD Q;  5H1S E;  1MJE A;  5EAY A;  4JI6 Q;  2QEX A;  2OCE A;  2D0O A;  5IYC H;  1Q86 C;  5K36 G;  5IP7 H;  2N49 A;  5GQO A;  1L0W A;  4DUZ Q;  1EYG A;  4IPG A;  3Q8D A;  2K50 A;  1WFQ A;  1K83 H;  3FP9 A;  4P71 A;  2ZTE A;  4JC0 A;  1VQO A;  3CC7 A;  4X64 L;  4OON A;  4OWW B;  1P16 A;  4ME3 A;  5IY0 A;  3PO3 H;  3U4Z A;  1HR0 W;  4BY1 G;  2KEN A;  3CC2 A;  1YI2 A;  3PF5 A;  2AHO B;  4A3E G;  4L5T A;  1O7I A;  2OQ0 A;  1XPU A;  4BBS H;  1Q8K A;  4LWC A;  4JI3 Q;  4KHP L;  1E7Z A;  4JI1 Q;  3A5U A;  4GLX A;  1FJG Q;  4A3D G;  1EUJ A;  4IPD A;  2CWA A;  4LF9 L;  1FL0 A;  1X3E A;  1EWI A;  2VQF Q;  4JI2 Q;  4NXM L;  1VQN A;  1VQC A;  2N78 A;  2K5N A;  3NEM A;  1JJ2 A;  1B70 B;  4JI8 Q;  3F1Z A;  3U50 C;  1L2F A;  4A76 A;  1QVF A;  3HOU H;  2GVA A;  5IYB H;  3T1H L;  4MZ9 A;  4R4I A;  5JEA G;  4JI4 L;  3G6E A;  1PH4 A;  3B6Y A;  4DUY L;  1WCM G;  2Q2T A;  5JJL A;  1EFW A;  3J80 c;  1YIJ A;  1RL2 A;  4O0A A;  1QUQ A;  1D7Q A;  3HFZ B;  2NVX H;  3KDF B;  3S1R H;  2UXC L;  4DV7 Q;  2Q2U A;  3K80 C;  1UE5 A;  4LF8 Q;  4A3B G;  3GTJ H;  1KRT A;  2YV5 A;  1PFS A;  2WP8 J;  3RLO A;  4NPS A;  3F2D A;  1P8L A;  1GVP A;  4GNX C;  3STB D;  3KOJ A;  4AIM A;  1CKN B;  5IYC G;  4DV3 Q;  1PV4 A;  1YBY A;  5GAE C;  1HJP A;  4KLK A;  4LNQ A;  3HOV G;  3PO2 H;  3I4M G;  4IFD I;  2R93 H;  2ASB A;  4O2D A;  1C9O A;  1VQ8 A;  4LF4 Q;  3PV0 A;  1PHJ A;  4C3H H;  3K7U C;  4JI7 L;  3PO3 G;  5C44 G;  4XTC S;  4JBJ A;  3KF8 B;  2VS1 A;  4GNX B;  1NMF A;  4GOP A;  3EBE A;  2LXK A;  2R7F A;  2ZTD A;  3TQY A;  1PH8 A;  1SN8 A;  1Y14 B;  2ALY B;  1IL2 A;  1H95 A;  2CCZ A;  2JE6 I;  4PZ7 A;  4MTN A;  4PG3 A;  4BXX H;  3S1M H;  5JJK A;  2GN5 A;  4UP9 A;  3J81 i;  4HID A;  4HJA A;  1V9P A;  2ZM6 L;  3LGJ A;  3TEH B;  3S24 A;  4X64 Q;  5M3F G;  1N34 L;  5IP7 G;  1I6H H;  2H5X A;  1EQQ A;  4Y52 H;  1JJG A;  2YU9 H;  3KF6 B;  3PUV A;  4YCV A;  5C0X G;  2ZTC A;  3K0X A;  3JC6 6;  4IO9 A;  2HIV A;  3GTM H;  3FKI H;  4OO1 I;  1IXR A;  1KC8 C;  2R7Z H;  3K8A A;  1K0R A;  1VQB A;  4KHP Q;  5J3B A;  3A5Z B;  1HNX Q;  5ELO A;  3KLW A;  1E1O A;  3OTO L;  4LF9 Q;  2K75 A;  4A75 A;  4NXM Q;  4K0K L;  2NN6 G;  5FLM H;  3OW2 A;  4X6A H;  1HNW L;  4R4O A;  3CCR A;  3H0G H;  1LM0 A;  2I0Q A;  2UUC L;  1SMX A;  1HZ9 A;  4JG2 A;  4APV A;  3T1H Q;  2VY3 A;  3ULP A;  2RF4 A;  1E3P A;  4A3F H;  2KHJ A;  4JI4 Q;  4YWL A;  2LXJ A;  3W1B A;  4DUY Q;  4AQY L;  1X6O A;  1VQ4 A;  3GTK H;  4WJ3 M;  2ZJP A;  5M5X H;  5GAD C;  5IYD H;  4HJ8 A;  3HKS A;  3CPW A;  2Z6K C;  2NVT H;  4DV6 L;  3I4N G;  4Y7N H;  1IBL L;  4NB3 A;  3F8T A;  4R4C A;  4YY3 L;  2UU9 L;  2JA8 H;  2JJQ A;  4BXX G;  4MNO A;  1QZH A;  2BA0 A;  3CAM A;  2LSS A;  3EN2 A;  3GD7 A;  1XPR A;  4DK3 C;  3A0J A;  4BA2 I;  1KXL A;  1A8V A;  3AFP A;  3RZD H;  1MIU A;  1AE2 A;  1Q46 A;  4GS3 A;  1HZB A;  3UDI A;  2DUD A;  1M1K C;  5M3M G;  2WAQ G;  1U0L A;  4OWT B;  1PYS B;  4TVA B;  3D0F A;  2D62 A;  4YWK A;  4LFB L;  3PUZ A;  3AYH B;  1N32 L;  4ALP A;  2PQA B;  2RHQ B;  1KHI A;  4P74 A;  4IPH A;  3PIP A;  1NBW A;  4TQU S;  3PUW A;  1UE1 A;  3FKI G;  2MNA A;  1PH9 A;  4JV5 L;  1IBM L;  1X54 A;  2RHS B;  4GKK L;  4GN4 B;  2VNU D;  2R6G A;  1OXU A;  4PZ8 A;  1LTL A;  3BJU A;  3CCL A;  1OXT A;  2ZM6 Q;  1PA6 A;  5FLM G;  1N34 Q;  3G48 A;  4QIW E;  2WAQ E;  3CCV A;  4XIG S;  4FDB A;  2PMZ E;  1J6Q A;  1VQ9 A;  1VQL A;  4DR1 L;  3H0G G;  3TRE A;  2AWO A;  2AMC B;  5C3E H;  4QY7 A;  3UDX A;  4LUV A;  2YYZ A;  3ERS X;  4DR4 L;  1V43 A;  1KRS A;  2WB1 E;  3HOW H;  3OTO Q;  3KDF A;  2FXQ A;  2B3G A;  3CXC A;  4DAY B;  3L7Z C;  1X56 A;  4K0K Q;  4LF6 L;  1QVC A;  1Z47 A;  1N9W A;  3S1N H;  2B29 A;  4YHH L;  2K5V A;  4BBR H;  2ZJR A;  1OTC A;  1CKN A;  1W3S A;  5GAH C;  2UUC Q;  3CQZ H;  4RG1 A;  1TXY A;  3CMA A;  1Q1B A;  1TWG H;  1VQH A;  1A0I A;  3W5O A;  1Y1V H;  2JK8 A;  1CKO A;  1JB7 A;  3UDF A;  4AQY Q;  1PH7 A;  2N8N A;  4P72 A;  3IRB A;  3J80 i;  1IYJ B;  4GNX A;  1KIX A;  3WWV A;  2F4V L;  4IOA A;  1VQI A;  1GD7 A;  3PUY A;  2QA4 A;  3CCE A;  4DV6 Q;  2HHH L;  1I50 H;  4HIK A;  1IBL Q;  3M3Y H;  4YY3 Q;  2IT1 A;  2GVB A;  3SGI A;  1PH5 A;  2UU9 Q;  1OXV A;  2Q2I A;  4DR5 L;  2VW9 A;  1X55 A;  1IZ6 A;  1PVO A;  4A93 H;  4X65 L;  2JA7 G;  1J5E L;  3H3V I;  4A3C H;  4OXP A;  4IJL A;  1WI5 A;  3DM3 A;  4PMW A;  3F2B A;  3E9H A;  3CCS A;  4HIM A;  3TS2 A;  4IFD J;  3KFU A;  3KF6 A;  4LFB Q;  1I5F A;  4GLV B;  2AKW B;  2L15 A;  3A74 A;  4C3J H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...