1N36Q

Structure of the thermus thermophilus 30s ribosomal subunit in the presence of crystallographically disordered codon and near-cognate transfer rna anticodon stem-loop mismatched at the second codon position
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
total genus 18
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1n36Q00
4HIMA 4LF9Q 1G291 3E9IA 2VQFQ 4TVAB 4GOPA 2R7DA 4A3IG 4K0KL 2OQ0A 4B3SL 3RN2A 1TWAH 5FJ8G 1UE7A 5FJ8H 4R4QA 5DLQE 2Y0SE 1WYDA 5M5XH 2OWOA 4DR3L 3HKZE 1X9NA 1C7YA 4B3ML 5IYDG 4GNXA 4A3LH 1KL9A 3BZCA 1KQSA 2UXDL 2ZTEA 3B6YA 1NY4A 3F1ZA 4KLKA 4YY3Q 1J5EL 3CCLA 3K8AA 3GO5A 3KDFA 4IOAA 3TQYA 3GTPH 1YVCA 3CCRA 2CQOA 2KCTA 2E2JH 4JCVE 4POGA 4DKAC 1V9PA 1Q7YC 3PF5A 1KRSA 1JB7A 1WI5A 1HZAA 3K81C 4DUZQ 4JOIC 3JAMi 1WCMG 1WCMH 2ZM6Q 4JC0A 2VUMH 2NVXH 4JI7Q 2VQEL 4PZ7A 2QA4A 1HR0Q 3KOJA 2HHHQ 3UDFA 1UE6A 4UPAA 1C0AA 4DAMA 5HY6A 4BBRG 4BBRH 2IX0A 3VDYA 4K0KQ 1N32L 4GS3A 4LF5L 4DPGA 1CKMA 1G51A 1FVIA 4DR3Q 2WB1E 3H3VI 5EAYA 4IOCA 4B3MQ 1P8LA 2K5HA 4LUVA 4DV6L 1VQOA 1CSQA 4LFCL 1J5EQ 4HJ9A 1IYJB 3OW2A 3HOYH 3HOYG 1CKOA 1W2BA 4LF6Q 1VQJA 2D0PA 1X3FA 4JBJA 1MKHA 4J15A 4P72A 3A74A 1S3OA 1AE2A 3D0FA 1NMFA 1EQRA 4NXNL 1VQ7A 1VQ9A 2R7ZH 2K5VA 2YTXA 4GN3B 3GTQH 2R7ZG 3CCMA 5LMNW 1VQ5A 3M7NA 2CKZB 1XNQL 3CCVA 2A8VA 2VQEQ 5C4XG 1L1OA 5C4XH 1E7ZA 3CP0A 3S24A 4ALPA 2IX1A 1LYLA 1YNXA 4DR5L 1NTGA 2PQAB 1PA6A 1VQNA 2GN5A 4R4CA 3RNUA 4H02A 3H15A 1VQPA 5J3BA 2NZHA 4PMWA 2Z6KC 4YHHQ 1N9WA 4OWTB 2R7FA 1EIYB 2KBNA 4LFCQ 2AMCB 1VQGA 1MIUA 1W3SA 1Y1WH 4OXPA 1EQQA 4X65L 4LFAL 2JEAI 1T9HA 1MJCA 4JI2Q 3EBEA 4DR2Q 1XMOQ 4GKKL 4HIDA 3G6EA 4O2DA 3HFZB 3NBHB 2Z0SA 3T1HL 2QEXA 2LSSA 4EX5A 1GKHA 5JEAG 1B7YB 3W1BA 4A3KH 1X54A 3FHWA 1XMQL 5C44G 2Q2UA 5FLMG 5FLMH 2JJQA 2BH8A 3PUWA 4GN5A 1JT8A 1BBUA 2I5MX 2E5LL 1CSPA 1BVSA 3BJUA 4DV2L 3TRZA 3I7FA 3J7A5 3E9HA 2JA7G 3TEHB 2JA7H 5K36G 4A76A 4JI3L 1J6QA 3ULPA 3HOUG 2CFMA 5E7NA 2WFWA 4IFDI 2XGTA 2HT1A 1HR0W 3E0EA 5AJ3L 3OTOL 4OO1G 1C9OA 3PCOB 2JA5G 3T1YQ 1Q8KA 4KHZA 4X6AH 2PNHA 1WOCA 1YHAA 2FXQA 3L7ZC 3GTGH 4LFAQ 4X65Q 5IWAL 1GD7A 1EWIA 4LWCA 4UP7A 4AIMA 4GKKQ 3CPFA 1OXUA 3PUYA 3CCSA 2UXCL 4R1JA 1BBWA 2ALYB 1I94L 5H1SE 4A4IA 1QZGA 2PI2A 1L2FA 2A1AA 4DK6C 1SN8A 1HNZQ 3CCQA 1QZHA 2ZJRA 2ZTCA 2JA8G 2I5HA 4JI4L 2F52A 2F3IA 1PFSA 3HOXH 4A3GG 3A5UA 4A3GH 4X62L 2MO1A 1PH6A 4DR7L 3W1GA 3U4ZA 1PH1A 4IFDG 5IYBG 5IYBH 3F2CA 4GOPC 3RR5A 4JI3Q 2MO0A 4A3IH 5GAGC 2KCMA 3JC66 1KRTA 3S2DH 2OCEA 5AJ3Q 3EIVA 1X3EA 3OTOQ 1OTCA 3CC7A 1X56A 4HJ7A 1KHIA 1YHQA 3I4NG 4HJAA 5IYDH 4GNXC 4P73A 2C35B 4LF7L 1U5KA 2L15A 1E3PA 3G71A 4LF4Q 3S17H 5GQOA 4P71A 4IFDJ 2NVYH 4DK3C 2UXCQ 3J81j 2VZAA 1Y1VG 4EQ5A 4JI1L 4JI8L 4A3BG 1CKNA 4A3BH 2B63G 2B63H 4JBKA 4R4TA 1SRUA 3CC4A 1FJGL 3CPWA 4DV4L 1OXSC 4QL5A 4C3IH 3J7ZC 1VQCA 1VQ4A 4GOPB 2YYZA 4X62Q 1QUQA 3M4QA 3RLFA 3CCJA 1XNRL 1P16A 4DR7Q 1QVCA 4IPHA 4B3RL 1TWFH 2DUDA 2VL6A 4L5TA 2H5XA 2CWPA 3FKIH 3FKIG 2WAQG 4BY1G 4B3SQ 4BY1H 2HIXA 4A75A 1PH2A 3TS2A 1A8VA 3KLWA 2RHQB 3U4VA 4GNXB 3S14H 3M9BA 4YWKA 4AQYL 1S40A 1S72A 2IT1A 5IP9G 1UE5A 5IP7H 5IP9H 5IP7G 5C3EG 5C3EH 3J80c 3I55A 1YJNA 1Q81C 2YTYA 1A62A 1E1OA 3KDFB 4LF7Q 4P75A 3GTLH 2UXDQ 4PG3A 3RZOH 4JOIA 2EIFA 2N49A 4NB3A 4XIGS 3BU2A 1D8LA 1BKBA 1IL2A 4A3MG 3HOWG 3HOWH 5M3MG 3U50C 1H95A 3L0OA 3AYHB 4JI1Q 2UU9L 4GLVB 4QY7A 3K0XA 2EXDA 4OWXB 3K7AH 1RL2A 4IJLA 5ELOA 1TWHH 3CQZH 4LUZA 3CF5A 4IO9A 1FJGQ 1TWGH 3F2DA 2KENA 4C3HH 2A19A 3ER0A 3GDEA 1VQFA 3UE0A 3ULLA 5M5YH 4HIKA 4JYAL 1VQKA 1K8AC 2E2IH 3CD6A 1V1QA 4L5QA 2XTIA 1N32Q 2N8NA 1HNXL 4LF5Q 3H3VH 2UXBL 3NELA 2IHEA 4AQYQ 1Q12A 4DR4L 1UWVA 1X65A 3M85A 1Z9FA 2YTVA 1VQBA 1RIPA 4DV6Q 4L5SA 2F4VL 1JJCB 3OYYA 4DV1L 2UUBL 3CCUA 2JE6I 1PH7A 3CMEA 4AYBG 3S15H 1NE3A 1GM5A 1PYBA 3Q8DA 3NENA 4DV7L 2UUAL 1SROA 2UU9Q 4KI0A 2WAQE 1G6PA 2BA1A 1HNWL 1NMGA 4NXNQ 3ERSX 3GTOH 5JJLA 1YIJA 2K4KA 4P74A 1L1OB 2MFIA 1IBKL 5C44H 2OTLA 5C0XI 3TS0A 1FL0A 3CXCA 1PHJA 1XNQQ 1CUKA 3GTJH 4X66L 1XJVA 2LXKA 4DV3L 1YITA 2UUCL 3CC2A 3NEMA 4RG1A 1VQMA 2E2HH 1K83H 2K52A 2Q2HA 4DR5Q 2IHFA 3KJOA 4YCUA 5IY0A 1HH2P 1IBLL 4NXML 1GO3E 3KF6A 4YCVA 1E1TA 5ELNA 3PIPA 3DLLA 3AQQA 1HNXQ 3HOUH 4LF8L 3CCEA 1LUZA 1WFQA 4C3JH 3DM3A 4R4OA 2JA5H 1EYGA 1SFOH 5BR8L 1EUJA 1HZ9A 1UE1A 1XPUA 1VQDA 2F4VQ 5GROA 4DV1Q 2Y0SG 3IRBA 2I5LX 3UDGA 3HKZG 4JBWA 1N34L 2HIVA 3RLNA 4Y7NH 4POFA 2GVBA 4YCWA 3T1HQ 2UUAQ 4BBSG 5C0XG 4IPCA 1XMQQ 2ID0A 1IBKQ 3WWVA 3CAMA 4UP9A 2JA8H 2AWNA 4X66Q 4JG2A 1VQHA 3H0GG 3H0GH 4JBMA 1XPRA 2ATWA 2E5LQ 2UUCQ 1JJGA 2K75A 1E24A 4DV2Q 4HIOA 1YJ9A 4X64L 4A3DG 4A3DH 3TREA 4DR6L 3BZKA 2HQLA 1IBML 4LUOA 1Q86C 3D31A 4MTNA 5C0XJ 1IBLQ 1ASZA 4UY8C 2BA0A 3K80C 1B70B 3J80i 4QQBX 3PO2G 4JI5L 3PO2H 3HOVG 3HOVH 3S16H 4LFBL 4A3JG 1YHBA 1SR3A 3I4NH 2JEBI 4YWMA 3I4MG 3I4MH 1JMCA 1PYSB 2PMZE 4PZ8A 5GAHC 4DNIA 1M90C 1N33L 1Y14B 4DUZL 4WJ4A 5IWAQ 2ZM6L 2WB1G 2RF4A 3ICEA 2KHJA 3STBC 5GADC 1I94Q 1Y1VH 1HR0L 1XPOA 2HHHL 4XTCS 3AFPA 4RMFA 1YBYA 1K0RA 2CWAA 3AFQA 4A3FG 4A3FH 2ZTDA 4IJHA 1KC8C 2OTJA 1Q82C 4JI4Q 2NN6I 3UDIA 4BA2I 1XTDA 3AEVA 1TWCH 4L5RC 1JJ2A 4QJFA 4X64Q 1PH3A 1MJEA 3HOZG 2DGYA 3HOZH 4A3CG 4DR6Q 4A3CH 2RCNA 1IBMQ 4A3LG 1VS0A 1Q1BA 2AWOA 1EIFA 1Q46A 1VQ6A 3M3YH 3M4OH 4GKJL 3GTKH 2NVQH 4JI5Q 4LFBQ 2VY3A 1O7IA 2D0OA 4QGUA 4LF6L 3S1QH 1VQEA 3A0JA 1VQ8A 1AE3A 3CW2C 1KAWA 2B29A 3L2PA 5HGQA 1I6HH 4A3EG 4A3EH 4QIWE 1N33Q 1SE8A 4A93G 4A93H 3RLOA 4DV5L 3J81i 2ZJPA 4GLXA 4LNQA 3HKSA 2VUMG 3S1RH 1CKNB 1AH9A 3PUVA 4A3MH 5M3MH 1UEBA 1OXTA 4JI8Q 2OQKA 1QVFA 1OXVA 4C2MH 1IXRA 2NN6G 3G4SA 5IE8A 1PH4A 1M1KC 4GLAC 2I0QA 2K50A 1KD1C 1K9MC 3UDXA 4TQUS 3KYHC 1QUQB 3MEFA 4AH6A 1R9TH 4DV4Q 2CCZA 1EOVA 2N78A 1L0WA 2PQAA 3I56A 1L1OC 1KIXA 2R6GA 2JA6G 1X3GA 4JI0L 1PH5A 2JA6H 4YHHL 3F8TA 4DV0L 1XNRQ 1D7QA 3PIOA 1VQLA 3GTMH 4B3RQ 2ZJQA 2N3SA 2BH2A 4GKJQ 1HJPA 5JJKA 4JI6L 3LGJA 4YWLA 4DR2L 1XMOL 4JI2L 2QGQA 4B3TL 1VQIA 1K73C 1I3QH 4ME3A 1NBWA 3STBD 4PZ6A 4WJ3M 4GN4B 2B3GA 2YV5A 4DR1L 1LTLA 4DV5Q 1VCIA 1OXXK 2JQOA 4UP8A 1X55A 3I2ZA 2E8GA 1I50H 2GVAA 4NPSA 2Q2TA 3KF8B 3JAMc 3J81c 4IPDA 4DAYB 1FGUA 3MXNB 1Z47A 1WJJA 4OX9L 2JA9A 2ASBA 4MNOA 3CMAA 1PH8A 1YI2A 1HZCA 4O0AA 1V43A 3SGIA 1JE5A 4R4IA 4JI0Q 4JYAQ 4KHPL 4DV0Q 2Z6KA 1YZ6A 2AHOB 3T1YL 3U58A 4APVA 4OWWB 1Y1WG 4OO1I 1QVGA 2YU9H 3UE1A 4JI6Q 4Y52H 5JJIA 1B8AA 2ES2A 3PV0A 2UXBQ 5LMNL 2NZOA 1SLJA 2K5NA 4B3TQ 1U0LA 4BY7G 4BY7H 4DR4Q 2R92G 2R92H 2AKWB 4HJ8A 3PO3G 3KFUA 1DGSA 2MQHA 4A3KG 2KHIA 1Q1EA 5LMUL 3PO3H 1SMXA 1HNZL 1ASYA 4DR1Q 4DUYL 2UUBQ 2RHSB 4JV5L 4BA1I 1N36L 3S2HH 4MZ9A 1LM0A 3PUXA 1EFWA 2IY5B 2K14A 2D62A 3A5ZB 4DV7Q 4FDBA 4BBSH 1GVPA 3RN5A 1HNWQ 4OX9Q 4LF9L 5C4JH 2VQFL 1PV4A 3S1NH 2NVTH 3FP9A 5JEAJ 2Q2IA 3M4PA 3PSIA 3ZJYC 1N8RC 4DV3Q 1PH9A 1PVOA 4KHPQ 3F2BA 4OONA 4AYBE 3PF4A 3KF6B 4BXXG 4BXXH 1YEZA 1K3RA 2VW9A 3PUZA 5IYCG 3PGZA 5IYCH 3GD7A 5GAEC 1KXLA 3KJPA 4NXMQ 4LF4L 1X6OA 4YY3L 5IT9c 2WP8J 5LMNQ 2VS1A 5FLXc 2MNAA 1YJWA 4LF8Q 2VNUD 1A63A 4A3JH 1I5FA 1K8GA 1A0IA 5M3FG 5M3FH 2JK8A 5BR8Q 2LXJA 2V1CC 5LMUQ 1IZ6A 1TXYA 1VQAA 2PI2E 3EN2A 3I4OA 3ULJA 4LW1A 3W5OA 4DUYQ 3K7UC 4HJ5A 1E22A 1NJIC 1N36Q 4JV5Q 1HZBA 2R93G 1N34Q 2R93H 5M5WH 4JI7L 3G48A 3HOXG 3RZDH 4IPGA 3S1MH 2EQSA
chains in the Genus database with same CATH superfamily
1T5XD 2Z1CA 2F0MA 2R7DA 3VYSA 1UE7A 2Y0SE 5CBEE 2SNSA 1X9NA 3GP7A 1JCKB 2F0LA 1PTOF 2EJFC 2UXDL 2ZTEA 5D14A 2WIIB 2F0KA 3MXUA 4IOAA 3TQYA 1NAPA 1YVCA 5DNFA 2CQOA 3TP8A 2KCTA 4JK1C 4POGA 2A68D 1V9PA 1KRSA 3K81C 1IW7C 4JOIC 1BXTA 4PZ7A 4F88A 1HR0Q 3KOJA 3SE0A 1S5CD 2KEDA 5CORA 4CDEC 2Z8LA 1TS2A 1C0AA 1ESRA 2K05A 2E74C 4BBRG 3D4RA 4K0KQ 4GS3A 4LF5L 3A7AB 2RQXA 2ENBA 5E4WC 1CKMA 4DR3Q 2FFKB 5I9OA 2MUYA 4B3MQ 1P8LA 1VQOA 4DV6L 1PTOH 1J5EQ 1MSGA 2DY8A 4QIWB 3HOYG 4A3GB 1B53A 2L11A 4P72A 1VQ9A 3D0FA 3BS1A 1BCPB 4XQJA 4A3IB 3GTQH 2K5VA 3KLSA 4GN3B 5NUCA 3EVQA 3TSSA 1VQ5A 3M7NA 2A8VA 2KHSA 3K0YA 5C4XH 4KHVA 5DM63 3BYTB 1EZ8A 1YNXA 2LMCB 3RNUA 4H02A 1PTOC 3OWFA 2K6AA 4OWTB 2B63B 2KBNA 4LFCQ 5C5LA 2JEAI 4DR2Q 1XMOQ 3D6CA 1IW7D 1GOZA 1BCPD 5IGDA 5JEAH 3W1BA 3MC0B 5FLMH 4I7AA 2AQ2B 3PMFA 4ZUJA 3J80E 3Q6SA 4GN5A 4K2LA 3K5NA 4EVOA 4DV2L 3I7FA 3TEHB 1LTRD 3RZOB 1J6QA 4FNFA 1PXUA 4L6TB 2HT1A 1KTKA 4L8JA 4OO1H 4M8AA 3VA7A 4WRDA 3IFDA 2PNHA 1TY0A 1WOCA 4FYDA 2XVSA 4TSSA 3GTGH 4LFAQ 4H13C 4AIMA 3CPFA 5C4XB 2E2IB 3MAQA 1L2FA 2XRQD 1HNZQ 3CCQA 1CQFA 5E4XA 1SSOA 2ZTCA 2F52A 2DJFC 1WTWA 1XTCD 4A3GG 1QWYA 5IYBH 1U9RA 3RR5A 2MO0A 2KCMA 5E1FA 2A5HA 1KRTA 3CU7A 3WDNA 1RHPA 3CC7A 2K28A 1Q90A 4HJ7A 5CV6A 4HJAA 4RWSC 2EJGC 2XIWA 5IYDH 5C44B 3G71A 1FNUA 2NVYH 4PQXA 3MWYW 5EBCA 4JI8L 1SNDA 2B63G 1LTGD 1SRUA 4WORA 4MIUA 4C3JB 1MHWC 4X62Q 1QUQA 3RLFA 1ONLA 4F7XA 1TWFH 5COYA 1DOLA 1X32A 3FKIH 4BY1H 5FO9B 4B3SQ 1MGSA 1HHVA 1A8VA 2RCFA 2RHQB 4AQYL 3NTIA 1S40A 2IT1A 5IP9G 1EYAA 1UE5A 5IP7H 1Q81C 2XSCA 3E5SA 3MEHA 3A54A 2EYPA 4P75A 1M8AA 4JOIA 2N49A 3BU2A 4WJWA 3NSWA 1H95A 1S5FD 2PQEA 4GLVB 4ODGA 1FD7D 2QILA 3K0XA 1TWHH 4ILWA 2EOTA 4C3HH 2KJXA 2ICEC 3ER0A 3GDEA 3I4MB 1VQFA 3ULLA 1IKMA 5CV7A 5JVH3 5IGGA 1ESFA 1V1PA 3CD6A 1V1QA 1V8QA 3H3VH 5F2DA 3NELA 2NUCA 1ICFB 2IHEA 1Q12A 5I9PA 3SVMA 1LO5D 4A3FB 4KKTA 2F4VL 5JPMC 3CCUA 3CMEA 3S15H 1NE3A 2G9HD 1GM5A 1BBXC 5G3LD 1W6JA 3NENA 1SROA 2VB2X 4KI0A 2WAQE 1G6PA 1H9SA 1NMGA 4NXNQ 3ERSX 3X3NA 1G91A 4P74A 4IALA 3TP6A 3M3YB 2OTLA 4DU9A 5C0XI 3TS0A 1XNQQ 2OF1A 4X66L 5BN5A 2LXKA 1ZXTA 1NCVA 2UUCL 4N9TA 1I6HB 3NEMA 3I8ZA 1KLGD 2Q2HA 4A93B 2HUGA 1RD9D 1S4ZA 4CJ0B 5IY0A 5I2YA 2B2UA 3S1RB 3M7GA 4LF8L 4C3JG 3X3MA 1SYBA 1SFOH 2QDLA 1W6KA 5GROA 4DV1Q 3DWPA 3IRBA 1RKNA 3I73A 4RAUC 4NP5A 3GV3A 1B2TA 1D1IA 4Y7NH 4TKOB 3T1HQ 4BBSG 1ZKOA 1AN8A 1S5ED 4EQPA 2F0SA 1VQHA 3H0GH 4JBMA 2XN9C 1WTOA 2FMCA 1JJGA 2EY1A 2K75A 1E24A 3TREA 1I4PA 4IUQA 3BZKA 1IL8A 1TS4A 3SK8A 1Y8PB 1ASZA 4UY8C 1I50B 4QQBX 4JI5L 3PO2H 4LFBL 4QCLA 2G5DA 3TBIB 5D3IB 3I4NH 2JEBI 3I4MG 2PMZE 1WTHA 3IFTA 4PZ8A 4WJ4A 2KEEA 2F0JA 2WB1G 2QF7A 3ICEA 2KHJA 1BOSA 3STBC 1I94Q 1HR0L 1EU4A 2K03A 3VYRA 4XTCS 1B1ZA 1K0RA 3AFQA 3NWSA 4A3FG 2ZTDA 1EY4A 1Q82C 4JI4Q 4ID6A 3UDIA 5EKIA 4L5RC 2F0HA 1JJ2A 3HOZH 5FK9C 2DGYA 2K7VA 4A3CG 2G9DA 2RCNA 1IBMQ 1GUGA 4A3LG 2AWOA 3M4OH 1Q46A 4KY7A 4J8QA 1H9RA 1H9MA 2D0OA 1DXMA 3GQBA 1KAWA 1E2VA 2B29A 5C4JB 4A3EH 1N33Q 5I6YA 4HAEA 4A93G 3RLOA 2VUMG 1CKNB 4A3MH 5M3MH 4C2MH 5IE8A 4GLAC 1KD1C 4RGTA 4NMZA 2PZUA 4TQUS 4XT1B 2CCZA 4DV4Q 2N78A 1SE4A 1KIXA 3ND8A 5M3FB 1PH5A 5D3DA 1XNRQ 5KIXA 1F77A 5FO8B 1D7QA 3PIOA 1SEBD 2N3SA 5JJKA 4GKJQ 1HJPA 3VR6A 1B44D 5EKLA 2RSNA 3VR3A 1VMPA 4DR2L 1XMOL 4B3TL 4QB4A 4OELB 1K73C 1NBWA 3STBD 4PZ6A 1IKLA 4WJ3M 1L0YB 1ENFA 2D5DA 4DR1L 4DV5Q 1VCIA 4CDCC 1OXXK 3OMGA 4JVZA 1X55A 2E8GA 1DM0B 5M5XB 2GVAA 2LFNA 1SYDA 1EQTA 2ZXRA 2M00A 1GUNA 4K8JA 3MXNB 2ASBA 3WOEA 1HZCA 4QUCA 1JE5A 1JICA 1GUOA 3IKJA 4JYAQ 2B8GA 2K5WA 4APVA 3K5LA 4OO1I 3K57A 1STEA 1WCMB 2IPKD 3UE1A 4JI6Q 3PV0A 4K6LA 5DM73 2K5NA 2FINB 1S5DD 2R92G 2TSSA 4HJ8A 3PO3H 3CRKC 4A3KG 1GHKA 3NE5B 1SMXA 1HNZL 4ZAIA 4UHVA 3DEPA 3BVGA 4BA1I 3S2HH 4MZ9A 1LM0A 2K01A 1FGBD 2K14A 2D62A 3A5ZB 4DV7Q 4FDBA 1D5ZC 1NSNS 3I91A 2VQFL 3KBGA 3FP9A 4H7BA 3ZJYC 1XWEA 2Q2IA 1N8RC 1A15A 3KF6B 4BXXG 1RF2D 1YEZA 3PUZA 2B2YC 3PGZA 5IYCH 5KNCA 4GZYC 5EPJA 4YY3L 2WP8J 1A63A 2VS1A 2VNUD 3OW7A 2RSOA 4A3JH 1A0IA 4H44C 5M3FG 1FR3A 1IZ6A 4HJ5A 1DD2A 1E22A 1NJIC 4JV5Q 3A8KE 5M5WH 4JI7L 3T51B 3G48A 3HOXG 4J6HA 4R1JA 4ALPA 1LTBD 4DNTB 4LF9Q 3E9IA 4GOPA 3Q0AA 4ZKCB 4B3SL 1SJED 5FJ8G 3I4LA 4R4QA 1WYDA 2EYHA 2OWOA 4G7OC 3HKZE 5LHY1 1STNA 2J0TD 4GNXA 1KL9A 2F0VA 1KQSA 1A2UA 3CCLA 3K6OA 1LLRD 5K5PA 3CCRA 5DEHA 3A8JE 2B2WC 5JOBA 2JN4A 1JB7A 5EJWA 1WI5A 2N88A 3A8IE 2BE5C 1D1KA 3HRZC 1WCMG 3BDCA 4JC0A 3J7AF 2VQEL 1JE4A 1HFNA 5BN3A 1UE6A 1EY9A 4BBRH 5JAVA 4DPGA 1QG7A 2BDNA 4K6DA 3W3AA 3H3VI 4IOCA 1BR9A 4LUVA 1CSQA 3UI2A 2K32A 5M5WB 1IYJB 2KCCA 4G7HC 3HOYH 1CKOA 1VQJA 4JBJA 1X3FA 1MKHA 4J15A 1S3OA 1AE2A 1NMFA 1EQRA 1VMCA 4NXNL 1F2YA 2B2VC 2NTSA 3S2DB 4WFN3 1TVXA 1XNQL 3F2UA 1D5XC 1SDFA 2PPBC 1B50A 3S17B 3NTHA 1L0XB 4R4CA 5M9OA 5J3BA 2Z6KC 2OEOA 5C4HA 1N9WA 1EIYB 4CDDC 2AMCB 1Y1WH 1W3SA 1BDOA 2O4XA 1PDQA 3J80L 2OT2A 1EQQA 4X65L 1STYA 4GKKL 1T9HA 1MJCA 4RGMA 4JI2Q 4C3IB 4HMIA 1K8MA 2BE5D 3T13A 2LS01 1GUTA 3HFZB 2Z0SA 3T1HL 2QEXA 2LSSA 2O5IC 1B7YB 4KKSA 2JJQA 2BH8A 3QG1A 3S14B 2L4NA 3K58A 2A68C 2H1EA 5C3EB 5ELEA 3TRZA 3J7A5 3E9HA 1BCPF 3GTLB 2AQ1B 4A76A 5K36G 3KK7A 3MXPA 1LABA 1FNVA 2GA4B 3HOUG 5E7NA 1TS5A 3EFXD 2LY7A 1LTSD 3E0EA 5I2XA 5AJ3L 3OTOL 3PCOB 2JA5G 1TQOA 3T1YQ 4KHZA 3CQZB 3L7ZC 1TWGB 1G2TA 1EWIA 4UP7A 3PUYA 3CCSA 1AP0A 5M5YB 4KKUA 4F8MA 4FF3A 1I94L 1PMRA 2V4DA 2A1AA 1SN8A 2PCFB 1DONA 1QZHA 4ZYSA 2JA8G 2I5HA 4JI4L 2F3IA 4A3GH 3DXJC 4DR7L 3U4ZA 1PH1A 4JI3Q 4A3IH 3S9WA 1JORA 2IWHA 3V05A 4HEDA 2KECA 1YHQA 3TZUA 5C3XA 1EWHA 1U5KA 4LF4Q 1I4GA 1TS3A 4P71A 4IFDJ 2UXCQ 1Y1VG 2NYZD 2E2HB 1K83B 4MHEA 1STGA 1MBYA 4A3BG 2B63H 1RODA 4R4TA 3CC4A 1BCPC 3O13A 4QL5A 3T56B 4DV4L 1VF7A 4C3IG 3J7ZC 4FXDA 2YYZA 1XNRL 1P16A 2QEJC 1IYUA 2WKCA 2WV6D 2DUDA 3NXWA 3P1HA 2H5XA 2CWPA 1SXTA 1F2LA 1SBBB 4KTAA 3U4VA 3PIP3 1CQVA 1MD2D 4YWKA 3SK5A 1S72A 1W2BA 5IP9H 1YJNA 2B2WA 5C3EG 1XYIA 3J80c 2YTYA 1A62A 3KDFB 4LF7Q 2MJ8A 2AUKA 1AZPA 3RZOH 4NB3A 4XIGS 1EWCA 3AYHB 4JI1Q 2UU9L 4QY7A 4XQNA 4OWXB 3MA2B 4PMCA 1EYCA 5ELOA 3CF5A 4IO9A 1FJGQ 3S16B 2Z4HA 2KENA 2SNMA 4ZLTF 4JYAL 4HIKA 3D6WA 1VQKA 3A7LA 4CJ2C 2E2IH 3N52A 2NZ1D 2FMMA 1STHA 2N8NA 1HNXL 5LL6X 3D4WA 1UWVA 1F2ZA 1VQBA 1RIPA 3I72A 2RDFA 2Q8TA 1JWSD 3SK4A 4L5SA 4MN3A 1PH7A 4CKBA 2WACA 1TWCB 1PYBA 3Q8DA 4DV7L 5FO7B 1K8OA 3EQLC 4X3SA 5JJLA 3BG3A 1HPCA 3MHBA 4DK0A 1L1OB 5C44H 1FL0A 2F0QA 3CXCA 1PHJA 1CUKA 3S1QB 3NPPA 5G3LF 1O7ZA 2IHFA 3KJOA 1EY0A 4NKLA 1GO3E 2B2TA 5ELNA 2NB0A 2EXZA 2HQEA 1TIID 1LUZA 1WFQA 4C3JH 3CCEA 1EYGA 2MHVA 4DXFA 1UNSA 2Y0SG 1R9TB 5J39A 2I5LX 3UDGA 4JBWA 2JA6B 2HIVA 2UUAQ 5C0XG 1B3AA 2F03A 1IBKQ 1BF4A 4J1MA 4UP9A 1U4MA 2C9OA 1I3QB 2E5LQ 1I4HA 1CFMA 4HIOA 2Z4IA 1KNEA 4X64L 4IFDH 4DR6L 4QF4A 4PMBA 3NHHA 1SAPA 3HZXA 4LUOA 1IBLQ 3JAME 2BA0A 3E6ZX 3J80i 4CHTB 3J81E 3PQIA 3HOVG 3QJYA 5EGTA 4HSVA 1SR3A 3I4MH 4G4KA 1JMCA 5GAHC 4DNIA 1M90C 3VA5A 5IWAQ 3NQTA 2A6HC 2RF4A 1Q3LA 1XXGA 2MPMA 1SYCA 4RMFA 4A3FH 1KLUD 2OTJA 4LAAA 3D8GA 1A3TA 4N8X1 1AFPA 3EJIA 2HDMA 4QJFA 4A3CH 1GUWA 1Q1BA 2X69A 3M3YH 1WTRA 1I4RA 5ELCA 4BBSB 5J1ZA 4QGUA 5IT9L 1VQEA 2A73B 5FLXL 2M9VA 3TN2A 3CW2C 1I6HH 3L2PA 1JOKA 1SE8A 4A93H 3H09A 3J81i 2ZJPA 4LNQA 3S1RH 3M4YA 3PUVA 5D65A 1EY6A 2R3ZA 3OOCA 1QVFA 3G4SA 1IXRA 2EYMA 1PH4A 4FXKC 2I0QA 3LX0A 3UDXA 3KF8A 4QUFA 3MEFA 4DAYA 1LT4D 2JA6G 4DV0L 3ERQA 1ZYRC 1BNZA 1VQLA 4RHSA 4B3RQ 2KQ3A 2WB1B 3J7AV 2R93B 4YWLA 4JI2L 2WINB 2IX3A 5IGCA 2A6HD 2NWGA 4DF7A 4KN7C 3KLSX 1HFGA 1TWAB 2JQOA 2SEBD 2K33A 2F0PA 5HURA 1I50H 2MGSA 1HUNA 3E0JA 5I4DA 4IPDA 1FGUA 1Z47A 2JA9A 4K2KA 5IIFA 4BWGB 1PH8A 2SOBA 2EVBA 3GTPB 1O7YA 3SGIA 2E2JB 1EL0A 4JI0Q 3SK6A 4KHPL 1PRTC 3T1YL 1SMYC 4OIKA 1QVGA 2VUMB 4EGVA 4CBVA 2NVXB 4DAVA 2UXBQ 5LMNL 1LTTD 2BDOA 5CMDA 1U0LA 4DR4Q 4RA8A 3RMHA 2R92H 1E0BA 1RDPD 4HCEA 1DGSA 1Q1EA 5LMUL 1E2ZA 2RHSB 3W2DA 1N36L 2IY5B 1B3QA 2A6EC 1CTMA 2L55A 5CR3A 3NTKA 4OX9Q 1PLFA 3D3RA 4FP5D 4FO2A 5C4JH 1ZYRD 1PRTB 1PVOA 3SR1A 4AYBE 2R7ZB 4BXXH 1KXLA 3KJPA 4NXMQ 1QE6A 4LF4L 3C3LA 5IT9c 4ZK9B 2HCCA 3RD4A 1YJWA 5FLXc 1ILQA 2PW5A 1I5FA 3DMUA 2X6LA 4NDXA 3AMUA 2DNCA 5M3FH 3ULJA 3I4OA 3W5OA 4DUYQ 5FOBB 1G6ZA 4RGOS 2R93G 4IQZA 1JOQA 5TSSA 2L0CA 2EQSA 1MSHA 4HIMA 1PRTD 2F0IA 4TVAB 4X3UA 1SMYD 4LJZC 4K0KL 2OQ0A 1DOMA 5FJ8H 2R92B 5M5XH 2L5TA 4DR3L 4A3KB 4B3ML 5IYDG 1STAA 4HCSA 5DAUA 2EY2A 1J5EL 4I7ZC 3C46A 3MXGA 4C1NK 2JA7B 2A6ED 4X3TA 1U4RA 1Q7YC 3KLRA 4DUZQ 4RHRA 4KY5A 1ET6A 1G2SA 1WCMH 2ZM6Q 2KCNA 2QA4A 4KN4C 1WVLA 1QNKA 2HHHQ 3UDFA 5EQ0A 3G7LA 4UPAA 5I6WA 2NN6H 3ITPA 2IX0A 2R61A 1A6XA 3T53B 1FVIA 2EDGA 2CH4W 1EY8A 1YNNC 1HA5A 2K5HA 2QKIC 4LFCL 3C2PA 1CK1A 1Y1WB 5EPKA 3OW2A 3HOXB 4XXEA 1O80A 2D0PA 3BVZA 3A74A 1HTPA 1RCVD 2R7ZG 3CKIB 1EEFD 2I46A 3CCMA 3NBHA 2MP1A 1HA6A 5LMNW 3AU7A 2L12A 2VB3X 2CKZB 3NP8A 3ND9A 2IX1A 1LYLA 2PQAB 4XQQA 1PA6A 1VQNA 2E76C 2GN5A 4O1NA 1VQPA 2P5ZX 4PMWA 4YHHQ 1VQGA 4H0LC 4F87A 4OXPA 4LFAL 3EBEA 4HIDA 4JW0A 3G6EA 4O2DA 5CC4A 4RCNA 5FKAC 2RDHA 2Q2UA 3FEWX 3AB9A 4IURA 4FF4A 3PUWA 1VDZA 4U673 3SEBA 3QOLA 1JT8A 3H91A 2E5LL 1CSPA 1BVSA 2F0FA 2JA7G 5K36H 1YNND 2JSOA 2CFMA 2WFWA 4IFDI 2XGTA 3HOWB 1HR0W 3QO2A 1Z7TA 1TR5A 4R8NA 3K7AB 4X6AH 1YHAA 2FXQA 1Z6HA 5IWAL 5JPNC 1D6EC 3R2TA 3A56A 1QZGA 2IJ0A 1K28A 4HMJA 4DK6C 2FJ2A 2ZJRA 1HRJA 1IHZA 3Q23A 1PFSA 2B39A 4N8FA 4X62L 1PH6A 2F4IA 3W1GA 5GAGC 3S2DH 4XYQA 3EIVA 1X3EA 4KJOA 5ELBA 3SHLA 1X56A 2HCIA 3I4NG 3GTOB 4P73A 2C35B 3DWAA 3S17H 3GTJB 3DHQA 3MFGA 2RBMA 3J81j 2VZAA 1F2MA 2K1BA 1CKNA 4A3BH 1C48A 2F0GA 4JBKA 3HOUB 5E3FA 1TU2B 1B9MA 4C3IH 1X3PA 1VQCA 2DJGC 1VQ4A 2JA5B 1K3BC 1QOHA 4IUPA 3FPUB 2F3VA 4B3RL 2EYFA 4L5TA 3OMCA 2HIXA 4A75A 1PH2A 1SNMA 3KLWA 3S14H 3M9BA 2XNAC 5C3EH 3VYUA 1KDBA 3GTLH 2JA8B 4PG3A 1D8LA 1IL2A 4A3MG 3HOWG 5M3MG 4UAIA 4I65A 4KY6A 4A3DB 2NTTA 2EXDA 3CQZH 3K5OA 4PNYA 4N9PA 2DY7A 1TWGH 3MXNA 2A19A 2FHTA 5M5YH 3VR5A 4MTKA 1K8AC 4L5QA 1N32Q 2UXBL 2N55A 1Y1VB 4AQYQ 4DR4L 1X65A 3M85A 1SYEA 3TMEA 4A3BB 1Z9FA 2IL8A 2H4OA 2C5CA 2I07B 1EIGA 1KABA 1QJOA 3C1FA 4DV1L 1KNAA 2ZT9C 5LL6S 5IGEA 4EQNA 1YIJA 5KRUA 5EPLA 3T16A 5KNBA 3GTKB 2NVQB 3G6JB 1BO0A 1AW7A 1SYGA 3CC2A 2E2HH 1DZ1A 1K83H 2LKVA 4DR5Q 2TMPA 1SE2A 3L3OC 4NXML 3KF6A 1E1TA 3DLLA 3BDLA 4LMQD 1K0SA 3D4DA 3DWQA 3OHXC 3T4AC 1LTID 2ZXPA 1EUJA 1VQDA 2F4VQ 3HS0C 3HKZG 1HCZA 4POFA 3I90A 1X3QA 4IPCA 1BQQT 4X3KA 1XMQQ 1STBA 3JAML 3WWVA 3J81L 1U4LA 2AWNA 4X66Q 4JG2A 2PYKA 1XPRA 4C56C 2UUCQ 1YJ9A 4RGNA 4A3DG 2B2YA 2HQLA 1IBML 2RDGA 3D31A 1TT2A 3MVVA 3PIO3 3K80C 1B70B 3S16H 3HOVH 1DJRD 4A3JG 5ELFA 2KOLA 2ZXOA 4YWMA 1PYSB 5KNDA 1SNCA 2PZWA 2NBFA 1C8CA 1EYDA 1N33L 1Y14B 4DUZL 2ZM6L 1A3VA 3H6MA 1SJHD 3LNNA 4L63B 4M1UB 3OPOA 5GADC 2EPBA 2HHHL 3AFPA 2YU9B 2CWAA 4IJHA 5A2QE 1KC8C 1FNWA 2NN6I 4BA2I 4BY7B 1TWCH 2EYJA 4P2CB 1MJEA 2Y0SB 2A74C 1VS0A 1VQ6A 4GKJL 1EIFA 2QW7A 4DNRB 4JI5Q 2CQAA 4LFBQ 2VY3A 3S1QH 3A0JA 1VQ8A 3S1NB 1VF5C 4QIWE 2NVTB 4DV5L 4U68A 4GLXA 3TP7A 3HKSA 2SDFA 4B08A 1GUSA 1OXTA 1NUCA 1OXVA 1M1KC 2K50A 3CHBD 1QUQB 3I3CA 1R9TH 2KUMA 3HOVB 1L0WA 5IGFA 1L1OC 5CBAE 2JA6H 1X3GA 4YHHL 3GTMH 3QR8A 4JI6L 1O7LA 2BOSA 2QGQA 3RZDB 1A2TA 3RUZA 1I3QH 5L37A 1EZ6A 2F1MA 3QB3A 3QIAA 4GN4B 2B3GA 2B2VA 1LTLA 4UP8A 3I2ZA 5KEEA 4R9WA 2L9HA 3R3OA 3L9AX 4RFBA 2Q2TA 1PZJD 2EE1A 3KF8B 3JAMc 2F0TA 3J81c 4DAYB 1WJJA 1SNOA 1RTOA 3CMAA 3GV6A 1YI2A 1PFNA 1V43A 1V1PB 5CV8A 2Z6KA 2AHOB 3U58A 4OWWB 1Y1WG 2B2UC 1B8AA 3LWEA 4ZRZA 2ES2A 2NZOA 4B3TQ 4BY7G 2AKWB 3KFUA 2MQHA 2KHIA 1ASYA 4DR1Q 2UUBQ 4JV5L 1H9SB 2J4XA 3PUXA 4BBSH 2EYOA 3RN5A 3GTMB 1HNWQ 1PTOB 4LF9L 2F3WA 2XRSD 3MFYA 3PSIA 4DV3Q 3FPPA 3R2IA 3F2BA 3GTQB 2E2DC 1NNXA 3GD7A 1CHQD 3MTSA 4KD3A 3Q24A 4V0BA 5A35A 1CA5A 1K8GA 2XWBB 2JK8A 4OHJA 5BR8Q 2LXJA 2V1CC 1TKWB 4E6IA 1TXYA 1VQAA 2L1BA 2PI2E 4LW1A 4RCOA 1HZBA 1N34Q 2R93H 1PTOD 3ZYYX 3BVMA 1B9NA 4ZQ3A 3S1MH 1G291 2B8FA 3TZDA 2VQFQ 4A3IG 1GJXA 1KDAA 3BYYB 1LT3D 4G57A 3RN2A 1TWAH 5DLQE 3HP3A 1C7YA 4A3LH 3BZCA 3B6YA 3F1ZA 1NY4A 4KLKA 5T1GA 4YY3Q 3K8AA 3GO5A 1PRTF 3KDFA 3GTPH 3OIQA 2E2JH 4JCVE 4K5WA 2K04A 4FVMA 1JC7A 4DKAC 3P7JA 3EROA 3PF5A 1HZAA 3JAMi 2VUMH 2NVXH 4C1NI 4JI7Q 1H9KA 2D9UA 4IUVA 1XX8A 4K14A 3EA6A 4DAMA 5HY6A 3GTGB 3Q22A 1ILPA 3CRLC 4DXGA 3VDYA 1N32L 1GXDC 1G51A 2DNEA 2WB1E 5EAYA 1AZQA 2EY6A 4CJ1B 4HJ9A 3P75A 1D5MC 4K8IA 4IUTA 4LF6Q 4FF2A 3S1MB 1VQ7A 2R7ZH 2YTXA 4RH6A 5C4ZA 3CCVA 2VQEQ 5C4XG 1L1OA 1E7ZA 3CP0A 1EEID 3S24A 4DR5L 1NTGA 3OIPA 1R4QB 2NVYB 4DA2A 3H15A 4R8IA 4LK1C 2PO4A 2NZHA 3I70A 5IOCA 4RKLA 2R7FA 4QMGA 1QILA 1MIUA 2KA7A 4FXGC 1WD0A 5BN4A 4OEMB 1JOOA 1NR2A 2O2LD 3FDTA 3NBHB 1PZKD 4EX5A 1GKHA 1TWFB 5JEAG 4A3KH 1X54A 3FHWA 1XMQL 3FKIB 4NW2A 5C44G 2AUJD 2WAQB 5FLMG 4Q5VA 4BY1B 4HN7A 1T5EA 1BBUA 3V96A 1IYVA 2I5MX 3H3VC 2BCOA 4HR7B 3BJUA 3A55A 1G8ZD 2OXPA 2JA7H 4JI3L 3ULPA 1MI2A 1EOTA 4HSPA 1WTVA 1YNJC 4OO1G 1C9OA 1WTXA 5EBDA 2EZVA 1Q8KA 4OL7A 1TWHB 1ZEQX 2K5QA 4X65Q 3NQIA 4GKKQ 1GD7A 2A69C 4LWCA 4C3HB 1EU3A 5KGUA 1OXUA 1I4QA 3SXHA 2UXCL 1BBWA 2ALYB 2HDLA 5H1SE 4A4IA 5AFWA 4Q0FA 2PI2A 1UUPA 1SE3A 1CHPD 1KAAA 3HOXH 3A5UA 2MO1A 1QB5D 2QDBA 4IFDG 3E3XA 5IYBG 2PZTA 3F2CA 4GOPC 4YIJA 1LT6D 2JXMB 4AYBB 3JC66 3S15B 2KVMA 1ICWA 2OCEA 2PNRC 5AJ3Q 3OTOQ 1OTCA 1KHIA 3IL8A 3K5MA 1HQRD 4GNXC 4LF7L 2L15A 1E3PA 4KMUC 1LACA 5GQOA 1HQMC 2PMZB 5KYIA 1CA6A 2VXWA 4DK3C 1F9SA 3HGBA 2WKDA 4EQ5A 1PYWD 4JI1L 1WD1A 3URYA 5C5MA 3IAYA 1LTAD 1FJGL 3CPWA 4DK1A 1OXSC 1JB3A 3SDZA 2X6GA 4GOPB 1SFOB 3M4QA 2F0WA 3CCJA 1YNJD 4DR7Q 1QVCA 4IPHA 5J22A 2VL6A 3FKIG 4BY1G 1WTPA 2WAQG 4Y7NB 3TS2A 3VR4A 2A69D 4GNXB 5IP7G 4XDXA 1I4XA 1U4PA 3I55A 1E1OA 2F0EA 2UXDQ 1V1OA 2EIFA 3H0GB 2EJMA 1BKBA 2DN8A 3HOWH 3U50C 3L0OA 2AQ3B 5IT9E 5FLXE 2JP1A 1CT1D 3K7AH 1RL2A 4IJLA 3DM1A 4LUZA 1S5BD 3PO2B 1CZWA 3F2DA 4C3HG 3I4NB 3UE0A 4CGYB 1II3A 2XTIA 4LF5Q 1CI3M 4XT3B 1EFID 5CV4A 3OWEB 2K5DA 2YTVA 4B9XA 4DV6Q 1JWMD 3BZDB 1JJCB 3OYYA 2UUBL 2JE6I 1EQVA 4AYBG 1SNPA 1D2BA 1GHJA 2Z9HA 2UUAL 3HOZB 2UU9Q 2BA1A 5HGTA 1HNWL 3GTOH 4DFAA 3M4OB 2K4KA 1CM9A 2MFIA 4JPBW 1IBKL 1EIHA 1E2WA 5ISRA 3VYTA 3GTJH 1XJVA 2D2CC 4DV3L 1YITA 1QCBD 1VQMA 4RG1A 4A3EB 2K52A 5CYUA 4YCUA 3HG9A 1HH2P 1IBLL 4S3SA 4YCVA 4B9WA 3PIPA 1HNXQ 3HOUH 3R93A 3AQQA 2CW0C 3NUCA 4A3MB 5M3MB 1SNQA 3DM3A 4C2MB 4R4OA 3QOJA 3TP5A 2JA5H 5BR8L 1XPUA 1HZ9A 1UE1A 4ABNA 3QWNA 1JR0D 2F0NA 1DOKA 2RKSA 3BDOA 4ULLA 3ONAB 1HTLD 3HEJA 3RLNA 1N34L 2GVBA 4YCWA 1F9QA 3VR2A 1QNUA 4RKBA 2F0DA 2ID0A 3CAMA 2JA8H 1JWUD 1OO9B 4CKCA 3H0GG 4HTHA 4FF1A 5JVG3 2ATWA 1RTNA 4DV2Q 2ICIA 3U9OA 4A3DH 4O42A 3WOFA 4DGZA 3NK9A 1Q86C 5C0XJ 4MTNA 1Q8IA 5CGKA 3U9SA 3PO2G 1Y8NB 1M4VA 4IN3A 5CV5A 1YHBA 2Q8IB 5A2QL 1FYCA 4G7ZC 1PZID 2CVRA 1ENCA 1Y1VH 1F9RA 1J9OA 1XPOA 4CKEA 1YBYA 1SYFA 4IUUA 2J7ZA 1BUVT 1XTDA 3AEVA 3TDQA 3MZ5A 1EY7A 1ML0D 3N6RA 2CW0D 5C3WA 2QCPX 3PO3B 3HOZG 4X64Q 1PH3A 1TY2A 3H94A 4K5VA 4DR6Q 3HKZB 4Z9CB 3S2HB 3NBIA 5JJZA 3GTKH 2NVQH 1O7IA 4LF6L 5C6AA 2F0UA 1AE3A 1NR4A 2EY5A 2RA4A 5HGQA 5CV9A 3P20A 5IGBA 4A3EG 1C4QA 2Q8RE 3C1EA 3LWUA 1UEAB 1AH9A 4DN4M 4PV1C 1UEBA 5T1IA 4JI8Q 2OQKA 1HXYD 2IW3A 2NN6G 3FRPB 1R4PB 5IODA 1K9MC 3KYHC 2O5JC 4AH6A 1DYQA 1WTQA 1EOVA 1KDCA 4A3JB 2PQAA 3I56A 3V2TA 2R6GA 2PW7A 4JI0L 3F8TA 1EY5A 1CZGA 2ZJQA 2BH2A 3LGJA 2RVLA 2Z6BA 1O78A 1VQIA 2E75C 4ME3A 4OIJA 1HUMA 2YV5A 1LT5D 4KK7A 4V190 4TRDA 4XYOA 4KV6A 2HD3A 4BS9A 1JQYD 4NPSA 1UAPA 4OX9L 4CDFC 3J7YW 4MNOA 4ZCKA 5KYLA 4O0AA 4R4IA 1I6VC 4DV0Q 1H9JA 1YZ6A 2F0OA 4ZUIA 2CH4A 4EQOA 3NWTA 2YU9H 4Y52H 5JJIA 2B2TC 1F9PA 1SLJA 3R8BA 3K59A 4OGQC 4ME5A 4BY7H 4K5XA 4BBRB 3PO3G 4ZKBB 4DUYL 4UDUC 1LV9A 5ELDA 1PFMA 1EFWA 1B4OA 5C0XH 1GVPA 1PFBA 1ET9A 5EKKA 1PV4A 3S1NH 1J8IA 2NVTH 3HOYB 5JEAJ 3M4PA 2JYOA 4KD4A 1PH9A 3OSOA 4KHPQ 1AEXA 4OONA 3PF4A 2CHBD 1ENAA 1K3RA 2M2LA 2VW9A 5GAEC 5IYCG 3KUPA 3DEOA 1X6OA 1Y69U 5LMNQ 2MNAA 1DCZA 4LF8Q 4IUNA 1RJTA 4IZ8A 3DUZA 2XWJB 1Y8OB 5LMUQ 3KBXA 4DAPA 3EN2A 4KJNA 3FVQA 3K7UC 1N36Q 1A3UA 3FMCA 3RZDH 2EYLA 4IPGA
chains in the Genus database with same CATH topology
4HIMA 4LF9Q 1G291 3E9IA 2VQFQ 4TVAB 4GOPA 2R7DA 4A3IG 4K0KL 2OQ0A 4B3SL 3RN2A 1TWAH 5FJ8G 1UE7A 5FJ8H 4R4QA 5DLQE 2Y0SE 1WYDA 5M5XH 2OWOA 4DR3L 3HKZE 1X9NA 1C7YA 4B3ML 5IYDG 4GNXA 4A3LH 1KL9A 3BZCA 1KQSA 2UXDL 2ZTEA 3B6YA 1NY4A 3F1ZA 4KLKA 4YY3Q 1J5EL 3CCLA 3K8AA 3GO5A 3KDFA 4IOAA 3TQYA 3GTPH 1YVCA 3CCRA 2CQOA 2KCTA 2E2JH 4JCVE 4POGA 4DKAC 1V9PA 1Q7YC 3PF5A 1KRSA 1JB7A 1WI5A 1HZAA 3K81C 4DUZQ 4JOIC 3JAMi 1WCMG 1WCMH 2ZM6Q 4JC0A 2VUMH 2NVXH 4JI7Q 2VQEL 4PZ7A 2QA4A 1HR0Q 3KOJA 2HHHQ 3UDFA 1UE6A 4UPAA 1C0AA 4DAMA 5HY6A 4BBRG 4BBRH 2IX0A 3VDYA 4K0KQ 1N32L 4GS3A 4LF5L 4DPGA 1CKMA 1G51A 1FVIA 4DR3Q 2WB1E 3H3VI 5EAYA 4IOCA 4B3MQ 1P8LA 2K5HA 4LUVA 4DV6L 1VQOA 1CSQA 4LFCL 1J5EQ 4HJ9A 1IYJB 3OW2A 3HOYH 3HOYG 1CKOA 1W2BA 4LF6Q 1VQJA 2D0PA 1X3FA 4JBJA 1MKHA 4J15A 4P72A 3A74A 1S3OA 1AE2A 3D0FA 1NMFA 1EQRA 4NXNL 1VQ7A 1VQ9A 2R7ZH 2K5VA 2YTXA 4GN3B 3GTQH 2R7ZG 3CCMA 5LMNW 1VQ5A 3M7NA 2CKZB 1XNQL 3CCVA 2A8VA 2VQEQ 5C4XG 1L1OA 5C4XH 1E7ZA 3CP0A 3S24A 4ALPA 2IX1A 1LYLA 1YNXA 4DR5L 1NTGA 2PQAB 1PA6A 1VQNA 2GN5A 4R4CA 3RNUA 4H02A 3H15A 1VQPA 5J3BA 2NZHA 4PMWA 2Z6KC 4YHHQ 1N9WA 4OWTB 2R7FA 1EIYB 2KBNA 4LFCQ 2AMCB 1VQGA 1MIUA 1W3SA 1Y1WH 4OXPA 1EQQA 4X65L 4LFAL 2JEAI 1T9HA 1MJCA 4JI2Q 3EBEA 4DR2Q 1XMOQ 4GKKL 4HIDA 3G6EA 4O2DA 3HFZB 3NBHB 2Z0SA 3T1HL 2QEXA 2LSSA 4EX5A 1GKHA 5JEAG 1B7YB 3W1BA 4A3KH 1X54A 3FHWA 1XMQL 5C44G 2Q2UA 5FLMG 5FLMH 2JJQA 2BH8A 3PUWA 4GN5A 1JT8A 1BBUA 2I5MX 2E5LL 1CSPA 1BVSA 3BJUA 4DV2L 3TRZA 3I7FA 3J7A5 3E9HA 2JA7G 3TEHB 2JA7H 5K36G 4A76A 4JI3L 1J6QA 3ULPA 3HOUG 2CFMA 5E7NA 2WFWA 4IFDI 2XGTA 2HT1A 1HR0W 3E0EA 5AJ3L 3OTOL 4OO1G 1C9OA 3PCOB 2JA5G 3T1YQ 1Q8KA 4KHZA 4X6AH 2PNHA 1WOCA 1YHAA 2FXQA 3L7ZC 3GTGH 4LFAQ 4X65Q 5IWAL 1GD7A 1EWIA 4LWCA 4UP7A 4AIMA 4GKKQ 3CPFA 1OXUA 3PUYA 3CCSA 2UXCL 4R1JA 1BBWA 2ALYB 1I94L 5H1SE 4A4IA 1QZGA 2PI2A 1L2FA 2A1AA 4DK6C 1SN8A 1HNZQ 3CCQA 1QZHA 2ZJRA 2ZTCA 2JA8G 2I5HA 4JI4L 2F52A 2F3IA 1PFSA 3HOXH 4A3GG 3A5UA 4A3GH 4X62L 2MO1A 1PH6A 4DR7L 3W1GA 3U4ZA 1PH1A 4IFDG 5IYBG 5IYBH 3F2CA 4GOPC 3RR5A 4JI3Q 2MO0A 4A3IH 5GAGC 2KCMA 3JC66 1KRTA 3S2DH 2OCEA 5AJ3Q 3EIVA 1X3EA 3OTOQ 1OTCA 3CC7A 1X56A 4HJ7A 1KHIA 1YHQA 3I4NG 4HJAA 5IYDH 4GNXC 4P73A 2C35B 4LF7L 1U5KA 2L15A 1E3PA 3G71A 4LF4Q 3S17H 5GQOA 4P71A 4IFDJ 2NVYH 4DK3C 2UXCQ 3J81j 2VZAA 1Y1VG 4EQ5A 4JI1L 4JI8L 4A3BG 1CKNA 4A3BH 2B63G 2B63H 4JBKA 4R4TA 1SRUA 3CC4A 1FJGL 3CPWA 4DV4L 1OXSC 4QL5A 4C3IH 3J7ZC 1VQCA 1VQ4A 4GOPB 2YYZA 4X62Q 1QUQA 3M4QA 3RLFA 3CCJA 1XNRL 1P16A 4DR7Q 1QVCA 4IPHA 4B3RL 1TWFH 2DUDA 2VL6A 4L5TA 2H5XA 2CWPA 3FKIH 3FKIG 2WAQG 4BY1G 4B3SQ 4BY1H 2HIXA 4A75A 1PH2A 3TS2A 1A8VA 3KLWA 2RHQB 3U4VA 4GNXB 3S14H 3M9BA 4YWKA 4AQYL 1S40A 1S72A 2IT1A 5IP9G 1UE5A 5IP7H 5IP9H 5IP7G 5C3EG 5C3EH 3J80c 3I55A 1YJNA 1Q81C 2YTYA 1A62A 1E1OA 3KDFB 4LF7Q 4P75A 3GTLH 2UXDQ 4PG3A 3RZOH 4JOIA 2EIFA 2N49A 4NB3A 4XIGS 3BU2A 1D8LA 1BKBA 1IL2A 4A3MG 3HOWG 3HOWH 5M3MG 3U50C 1H95A 3L0OA 3AYHB 4JI1Q 2UU9L 4GLVB 4QY7A 3K0XA 2EXDA 4OWXB 3K7AH 1RL2A 4IJLA 5ELOA 1TWHH 3CQZH 4LUZA 3CF5A 4IO9A 1FJGQ 1TWGH 3F2DA 2KENA 4C3HH 2A19A 3ER0A 3GDEA 1VQFA 3UE0A 3ULLA 5M5YH 4HIKA 4JYAL 1VQKA 1K8AC 2E2IH 3CD6A 1V1QA 4L5QA 2XTIA 1N32Q 2N8NA 1HNXL 4LF5Q 3H3VH 2UXBL 3NELA 2IHEA 4AQYQ 1Q12A 4DR4L 1UWVA 1X65A 3M85A 1Z9FA 2YTVA 1VQBA 1RIPA 4DV6Q 4L5SA 2F4VL 1JJCB 3OYYA 4DV1L 2UUBL 3CCUA 2JE6I 1PH7A 3CMEA 4AYBG 3S15H 1NE3A 1GM5A 1PYBA 3Q8DA 3NENA 4DV7L 2UUAL 1SROA 2UU9Q 4KI0A 2WAQE 1G6PA 2BA1A 1HNWL 1NMGA 4NXNQ 3ERSX 3GTOH 5JJLA 1YIJA 2K4KA 4P74A 1L1OB 2MFIA 1IBKL 5C44H 2OTLA 5C0XI 3TS0A 1FL0A 3CXCA 1PHJA 1XNQQ 1CUKA 3GTJH 4X66L 1XJVA 2LXKA 4DV3L 1YITA 2UUCL 3CC2A 3NEMA 4RG1A 1VQMA 2E2HH 1K83H 2K52A 2Q2HA 4DR5Q 2IHFA 3KJOA 4YCUA 5IY0A 1HH2P 1IBLL 4NXML 1GO3E 3KF6A 4YCVA 1E1TA 5ELNA 3PIPA 3DLLA 3AQQA 1HNXQ 3HOUH 4LF8L 3CCEA 1LUZA 1WFQA 4C3JH 3DM3A 4R4OA 2JA5H 1EYGA 1SFOH 5BR8L 1EUJA 1HZ9A 1UE1A 1XPUA 1VQDA 2F4VQ 5GROA 4DV1Q 2Y0SG 3IRBA 2I5LX 3UDGA 3HKZG 4JBWA 1N34L 2HIVA 3RLNA 4Y7NH 4POFA 2GVBA 4YCWA 3T1HQ 2UUAQ 4BBSG 5C0XG 4IPCA 1XMQQ 2ID0A 1IBKQ 3WWVA 3CAMA 4UP9A 2JA8H 2AWNA 4X66Q 4JG2A 1VQHA 3H0GG 3H0GH 4JBMA 1XPRA 2ATWA 2E5LQ 2UUCQ 1JJGA 2K75A 1E24A 4DV2Q 4HIOA 1YJ9A 4X64L 4A3DG 4A3DH 3TREA 4DR6L 3BZKA 2HQLA 1IBML 4LUOA 1Q86C 3D31A 4MTNA 5C0XJ 1IBLQ 1ASZA 4UY8C 2BA0A 3K80C 1B70B 3J80i 4QQBX 3PO2G 4JI5L 3PO2H 3HOVG 3HOVH 3S16H 4LFBL 4A3JG 1YHBA 1SR3A 3I4NH 2JEBI 4YWMA 3I4MG 3I4MH 1JMCA 1PYSB 2PMZE 4PZ8A 5GAHC 4DNIA 1M90C 1N33L 1Y14B 4DUZL 4WJ4A 5IWAQ 2ZM6L 2WB1G 2RF4A 3ICEA 2KHJA 3STBC 5GADC 1I94Q 1Y1VH 1HR0L 1XPOA 2HHHL 4XTCS 3AFPA 4RMFA 1YBYA 1K0RA 2CWAA 3AFQA 4A3FG 4A3FH 2ZTDA 4IJHA 1KC8C 2OTJA 1Q82C 4JI4Q 2NN6I 3UDIA 4BA2I 1XTDA 3AEVA 1TWCH 4L5RC 1JJ2A 4QJFA 4X64Q 1PH3A 1MJEA 3HOZG 2DGYA 3HOZH 4A3CG 4DR6Q 4A3CH 2RCNA 1IBMQ 4A3LG 1VS0A 1Q1BA 2AWOA 1EIFA 1Q46A 1VQ6A 3M3YH 3M4OH 4GKJL 3GTKH 2NVQH 4JI5Q 4LFBQ 2VY3A 1O7IA 2D0OA 4QGUA 4LF6L 3S1QH 1VQEA 3A0JA 1VQ8A 1AE3A 3CW2C 1KAWA 2B29A 3L2PA 5HGQA 1I6HH 4A3EG 4A3EH 4QIWE 1N33Q 1SE8A 4A93G 4A93H 3RLOA 4DV5L 3J81i 2ZJPA 4GLXA 4LNQA 3HKSA 2VUMG 3S1RH 1CKNB 1AH9A 3PUVA 4A3MH 5M3MH 1UEBA 1OXTA 4JI8Q 2OQKA 1QVFA 1OXVA 4C2MH 1IXRA 2NN6G 3G4SA 5IE8A 1PH4A 1M1KC 4GLAC 2I0QA 2K50A 1KD1C 1K9MC 3UDXA 4TQUS 3KYHC 1QUQB 3MEFA 4AH6A 1R9TH 4DV4Q 2CCZA 1EOVA 2N78A 1L0WA 2PQAA 3I56A 1L1OC 1KIXA 2R6GA 2JA6G 1X3GA 4JI0L 1PH5A 2JA6H 4YHHL 3F8TA 4DV0L 1XNRQ 1D7QA 3PIOA 1VQLA 3GTMH 4B3RQ 2ZJQA 2N3SA 2BH2A 4GKJQ 1HJPA 5JJKA 4JI6L 3LGJA 4YWLA 4DR2L 1XMOL 4JI2L 2QGQA 4B3TL 1VQIA 1K73C 1I3QH 4ME3A 1NBWA 3STBD 4PZ6A 4WJ3M 4GN4B 2B3GA 2YV5A 4DR1L 1LTLA 4DV5Q 1VCIA 1OXXK 2JQOA 4UP8A 1X55A 3I2ZA 2E8GA 1I50H 2GVAA 4NPSA 2Q2TA 3KF8B 3JAMc 3J81c 4IPDA 4DAYB 1FGUA 3MXNB 1Z47A 1WJJA 4OX9L 2JA9A 2ASBA 4MNOA 3CMAA 1PH8A 1YI2A 1HZCA 4O0AA 1V43A 3SGIA 1JE5A 4R4IA 4JI0Q 4JYAQ 4KHPL 4DV0Q 2Z6KA 1YZ6A 2AHOB 3T1YL 3U58A 4APVA 4OWWB 1Y1WG 4OO1I 1QVGA 2YU9H 3UE1A 4JI6Q 4Y52H 5JJIA 1B8AA 2ES2A 3PV0A 2UXBQ 5LMNL 2NZOA 1SLJA 2K5NA 4B3TQ 1U0LA 4BY7G 4BY7H 4DR4Q 2R92G 2R92H 2AKWB 4HJ8A 3PO3G 3KFUA 1DGSA 2MQHA 4A3KG 2KHIA 1Q1EA 5LMUL 3PO3H 1SMXA 1HNZL 1ASYA 4DR1Q 4DUYL 2UUBQ 2RHSB 4JV5L 4BA1I 1N36L 3S2HH 4MZ9A 1LM0A 3PUXA 1EFWA 2IY5B 2K14A 2D62A 3A5ZB 4DV7Q 4FDBA 4BBSH 1GVPA 3RN5A 1HNWQ 4OX9Q 4LF9L 5C4JH 2VQFL 1PV4A 3S1NH 2NVTH 3FP9A 5JEAJ 2Q2IA 3M4PA 3PSIA 3ZJYC 1N8RC 4DV3Q 1PH9A 1PVOA 4KHPQ 3F2BA 4OONA 4AYBE 3PF4A 3KF6B 4BXXG 4BXXH 1YEZA 1K3RA 2VW9A 3PUZA 5IYCG 3PGZA 5IYCH 3GD7A 5GAEC 1KXLA 3KJPA 4NXMQ 4LF4L 1X6OA 4YY3L 5IT9c 2WP8J 5LMNQ 2VS1A 5FLXc 2MNAA 1YJWA 4LF8Q 2VNUD 1A63A 4A3JH 1I5FA 1K8GA 1A0IA 5M3FG 5M3FH 2JK8A 5BR8Q 2LXJA 2V1CC 5LMUQ 1IZ6A 1TXYA 1VQAA 2PI2E 3EN2A 3I4OA 3ULJA 4LW1A 3W5OA 4DUYQ 3K7UC 4HJ5A 1E22A 1NJIC 1N36Q 4JV5Q 1HZBA 2R93G 1N34Q 2R93H 5M5WH 4JI7L 3G48A 3HOXG 3RZDH 4IPGA 3S1MH 2EQSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HIM A;  4LF9 Q;  1G29 1;  3E9I A;  2VQF Q;  4TVA B;  4GOP A;  2R7D A;  4A3I G;  4K0K L;  2OQ0 A;  4B3S L;  3RN2 A;  1TWA H;  5FJ8 G;  1UE7 A;  5FJ8 H;  4R4Q A;  5DLQ E;  2Y0S E;  1WYD A;  5M5X H;  2OWO A;  4DR3 L;  3HKZ E;  1X9N A;  1C7Y A;  4B3M L;  5IYD G;  4GNX A;  4A3L H;  1KL9 A;  3BZC A;  1KQS A;  2UXD L;  2ZTE A;  3B6Y A;  1NY4 A;  3F1Z A;  4KLK A;  4YY3 Q;  1J5E L;  3CCL A;  3K8A A;  3GO5 A;  3KDF A;  4IOA A;  3TQY A;  3GTP H;  1YVC A;  3CCR A;  2CQO A;  2KCT A;  2E2J H;  4JCV E;  4POG A;  4DKA C;  1V9P A;  1Q7Y C;  3PF5 A;  1KRS A;  1JB7 A;  1WI5 A;  1HZA A;  3K81 C;  4DUZ Q;  4JOI C;  3JAM i;  1WCM G;  1WCM H;  2ZM6 Q;  4JC0 A;  2VUM H;  2NVX H;  4JI7 Q;  2VQE L;  4PZ7 A;  2QA4 A;  1HR0 Q;  3KOJ A;  2HHH Q;  3UDF A;  1UE6 A;  4UPA A;  1C0A A;  4DAM A;  5HY6 A;  4BBR G;  4BBR H;  2IX0 A;  3VDY A;  4K0K Q;  1N32 L;  4GS3 A;  4LF5 L;  4DPG A;  1CKM A;  1G51 A;  1FVI A;  4DR3 Q;  2WB1 E;  3H3V I;  5EAY A;  4IOC A;  4B3M Q;  1P8L A;  2K5H A;  4LUV A;  4DV6 L;  1VQO A;  1CSQ A;  4LFC L;  1J5E Q;  4HJ9 A;  1IYJ B;  3OW2 A;  3HOY H;  3HOY G;  1CKO A;  1W2B A;  4LF6 Q;  1VQJ A;  2D0P A;  1X3F A;  4JBJ A;  1MKH A;  4J15 A;  4P72 A;  3A74 A;  1S3O A;  1AE2 A;  3D0F A;  1NMF A;  1EQR A;  4NXN L;  1VQ7 A;  1VQ9 A;  2R7Z H;  2K5V A;  2YTX A;  4GN3 B;  3GTQ H;  2R7Z G;  3CCM A;  5LMN W;  1VQ5 A;  3M7N A;  2CKZ B;  1XNQ L;  3CCV A;  2A8V A;  2VQE Q;  5C4X G;  1L1O A;  5C4X H;  1E7Z A;  3CP0 A;  3S24 A;  4ALP A;  2IX1 A;  1LYL A;  1YNX A;  4DR5 L;  1NTG A;  2PQA B;  1PA6 A;  1VQN A;  2GN5 A;  4R4C A;  3RNU A;  4H02 A;  3H15 A;  1VQP A;  5J3B A;  2NZH A;  4PMW A;  2Z6K C;  4YHH Q;  1N9W A;  4OWT B;  2R7F A;  1EIY B;  2KBN A;  4LFC Q;  2AMC B;  1VQG A;  1MIU A;  1W3S A;  1Y1W H;  4OXP A;  1EQQ A;  4X65 L;  4LFA L;  2JEA I;  1T9H A;  1MJC A;  4JI2 Q;  3EBE A;  4DR2 Q;  1XMO Q;  4GKK L;  4HID A;  3G6E A;  4O2D A;  3HFZ B;  3NBH B;  2Z0S A;  3T1H L;  2QEX A;  2LSS A;  4EX5 A;  1GKH A;  5JEA G;  1B7Y B;  3W1B A;  4A3K H;  1X54 A;  3FHW A;  1XMQ L;  5C44 G;  2Q2U A;  5FLM G;  5FLM H;  2JJQ A;  2BH8 A;  3PUW A;  4GN5 A;  1JT8 A;  1BBU A;  2I5M X;  2E5L L;  1CSP A;  1BVS A;  3BJU A;  4DV2 L;  3TRZ A;  3I7F A;  3J7A 5;  3E9H A;  2JA7 G;  3TEH B;  2JA7 H;  5K36 G;  4A76 A;  4JI3 L;  1J6Q A;  3ULP A;  3HOU G;  2CFM A;  5E7N A;  2WFW A;  4IFD I;  2XGT A;  2HT1 A;  1HR0 W;  3E0E A;  5AJ3 L;  3OTO L;  4OO1 G;  1C9O A;  3PCO B;  2JA5 G;  3T1Y Q;  1Q8K A;  4KHZ A;  4X6A H;  2PNH A;  1WOC A;  1YHA A;  2FXQ A;  3L7Z C;  3GTG H;  4LFA Q;  4X65 Q;  5IWA L;  1GD7 A;  1EWI A;  4LWC A;  4UP7 A;  4AIM A;  4GKK Q;  3CPF A;  1OXU A;  3PUY A;  3CCS A;  2UXC L;  4R1J A;  1BBW A;  2ALY B;  1I94 L;  5H1S E;  4A4I A;  1QZG A;  2PI2 A;  1L2F A;  2A1A A;  4DK6 C;  1SN8 A;  1HNZ Q;  3CCQ A;  1QZH A;  2ZJR A;  2ZTC A;  2JA8 G;  2I5H A;  4JI4 L;  2F52 A;  2F3I A;  1PFS A;  3HOX H;  4A3G G;  3A5U A;  4A3G H;  4X62 L;  2MO1 A;  1PH6 A;  4DR7 L;  3W1G A;  3U4Z A;  1PH1 A;  4IFD G;  5IYB G;  5IYB H;  3F2C A;  4GOP C;  3RR5 A;  4JI3 Q;  2MO0 A;  4A3I H;  5GAG C;  2KCM A;  3JC6 6;  1KRT A;  3S2D H;  2OCE A;  5AJ3 Q;  3EIV A;  1X3E A;  3OTO Q;  1OTC A;  3CC7 A;  1X56 A;  4HJ7 A;  1KHI A;  1YHQ A;  3I4N G;  4HJA A;  5IYD H;  4GNX C;  4P73 A;  2C35 B;  4LF7 L;  1U5K A;  2L15 A;  1E3P A;  3G71 A;  4LF4 Q;  3S17 H;  5GQO A;  4P71 A;  4IFD J;  2NVY H;  4DK3 C;  2UXC Q;  3J81 j;  2VZA A;  1Y1V G;  4EQ5 A;  4JI1 L;  4JI8 L;  4A3B G;  1CKN A;  4A3B H;  2B63 G;  2B63 H;  4JBK A;  4R4T A;  1SRU A;  3CC4 A;  1FJG L;  3CPW A;  4DV4 L;  1OXS C;  4QL5 A;  4C3I H;  3J7Z C;  1VQC A;  1VQ4 A;  4GOP B;  2YYZ A;  4X62 Q;  1QUQ A;  3M4Q A;  3RLF A;  3CCJ A;  1XNR L;  1P16 A;  4DR7 Q;  1QVC A;  4IPH A;  4B3R L;  1TWF H;  2DUD A;  2VL6 A;  4L5T A;  2H5X A;  2CWP A;  3FKI H;  3FKI G;  2WAQ G;  4BY1 G;  4B3S Q;  4BY1 H;  2HIX A;  4A75 A;  1PH2 A;  3TS2 A;  1A8V A;  3KLW A;  2RHQ B;  3U4V A;  4GNX B;  3S14 H;  3M9B A;  4YWK A;  4AQY L;  1S40 A;  1S72 A;  2IT1 A;  5IP9 G;  1UE5 A;  5IP7 H;  5IP9 H;  5IP7 G;  5C3E G;  5C3E H;  3J80 c;  3I55 A;  1YJN A;  1Q81 C;  2YTY A;  1A62 A;  1E1O A;  3KDF B;  4LF7 Q;  4P75 A;  3GTL H;  2UXD Q;  4PG3 A;  3RZO H;  4JOI A;  2EIF A;  2N49 A;  4NB3 A;  4XIG S;  3BU2 A;  1D8L A;  1BKB A;  1IL2 A;  4A3M G;  3HOW G;  3HOW H;  5M3M G;  3U50 C;  1H95 A;  3L0O A;  3AYH B;  4JI1 Q;  2UU9 L;  4GLV B;  4QY7 A;  3K0X A;  2EXD A;  4OWX B;  3K7A H;  1RL2 A;  4IJL A;  5ELO A;  1TWH H;  3CQZ H;  4LUZ A;  3CF5 A;  4IO9 A;  1FJG Q;  1TWG H;  3F2D A;  2KEN A;  4C3H H;  2A19 A;  3ER0 A;  3GDE A;  1VQF A;  3UE0 A;  3ULL A;  5M5Y H;  4HIK A;  4JYA L;  1VQK A;  1K8A C;  2E2I H;  3CD6 A;  1V1Q A;  4L5Q A;  2XTI A;  1N32 Q;  2N8N A;  1HNX L;  4LF5 Q;  3H3V H;  2UXB L;  3NEL A;  2IHE A;  4AQY Q;  1Q12 A;  4DR4 L;  1UWV A;  1X65 A;  3M85 A;  1Z9F A;  2YTV A;  1VQB A;  1RIP A;  4DV6 Q;  4L5S A;  2F4V L;  1JJC B;  3OYY A;  4DV1 L;  2UUB L;  3CCU A;  2JE6 I;  1PH7 A;  3CME A;  4AYB G;  3S15 H;  1NE3 A;  1GM5 A;  1PYB A;  3Q8D A;  3NEN A;  4DV7 L;  2UUA L;  1SRO A;  2UU9 Q;  4KI0 A;  2WAQ E;  1G6P A;  2BA1 A;  1HNW L;  1NMG A;  4NXN Q;  3ERS X;  3GTO H;  5JJL A;  1YIJ A;  2K4K A;  4P74 A;  1L1O B;  2MFI A;  1IBK L;  5C44 H;  2OTL A;  5C0X I;  3TS0 A;  1FL0 A;  3CXC A;  1PHJ A;  1XNQ Q;  1CUK A;  3GTJ H;  4X66 L;  1XJV A;  2LXK A;  4DV3 L;  1YIT A;  2UUC L;  3CC2 A;  3NEM A;  4RG1 A;  1VQM A;  2E2H H;  1K83 H;  2K52 A;  2Q2H A;  4DR5 Q;  2IHF A;  3KJO A;  4YCU A;  5IY0 A;  1HH2 P;  1IBL L;  4NXM L;  1GO3 E;  3KF6 A;  4YCV A;  1E1T A;  5ELN A;  3PIP A;  3DLL A;  3AQQ A;  1HNX Q;  3HOU H;  4LF8 L;  3CCE A;  1LUZ A;  1WFQ A;  4C3J H;  3DM3 A;  4R4O A;  2JA5 H;  1EYG A;  1SFO H;  5BR8 L;  1EUJ A;  1HZ9 A;  1UE1 A;  1XPU A;  1VQD A;  2F4V Q;  5GRO A;  4DV1 Q;  2Y0S G;  3IRB A;  2I5L X;  3UDG A;  3HKZ G;  4JBW A;  1N34 L;  2HIV A;  3RLN A;  4Y7N H;  4POF A;  2GVB A;  4YCW A;  3T1H Q;  2UUA Q;  4BBS G;  5C0X G;  4IPC A;  1XMQ Q;  2ID0 A;  1IBK Q;  3WWV A;  3CAM A;  4UP9 A;  2JA8 H;  2AWN A;  4X66 Q;  4JG2 A;  1VQH A;  3H0G G;  3H0G H;  4JBM A;  1XPR A;  2ATW A;  2E5L Q;  2UUC Q;  1JJG A;  2K75 A;  1E24 A;  4DV2 Q;  4HIO A;  1YJ9 A;  4X64 L;  4A3D G;  4A3D H;  3TRE A;  4DR6 L;  3BZK A;  2HQL A;  1IBM L;  4LUO A;  1Q86 C;  3D31 A;  4MTN A;  5C0X J;  1IBL Q;  1ASZ A;  4UY8 C;  2BA0 A;  3K80 C;  1B70 B;  3J80 i;  4QQB X;  3PO2 G;  4JI5 L;  3PO2 H;  3HOV G;  3HOV H;  3S16 H;  4LFB L;  4A3J G;  1YHB A;  1SR3 A;  3I4N H;  2JEB I;  4YWM A;  3I4M G;  3I4M H;  1JMC A;  1PYS B;  2PMZ E;  4PZ8 A;  5GAH C;  4DNI A;  1M90 C;  1N33 L;  1Y14 B;  4DUZ L;  4WJ4 A;  5IWA Q;  2ZM6 L;  2WB1 G;  2RF4 A;  3ICE A;  2KHJ A;  3STB C;  5GAD C;  1I94 Q;  1Y1V H;  1HR0 L;  1XPO A;  2HHH L;  4XTC S;  3AFP A;  4RMF A;  1YBY A;  1K0R A;  2CWA A;  3AFQ A;  4A3F G;  4A3F H;  2ZTD A;  4IJH A;  1KC8 C;  2OTJ A;  1Q82 C;  4JI4 Q;  2NN6 I;  3UDI A;  4BA2 I;  1XTD A;  3AEV A;  1TWC H;  4L5R C;  1JJ2 A;  4QJF A;  4X64 Q;  1PH3 A;  1MJE A;  3HOZ G;  2DGY A;  3HOZ H;  4A3C G;  4DR6 Q;  4A3C H;  2RCN A;  1IBM Q;  4A3L G;  1VS0 A;  1Q1B A;  2AWO A;  1EIF A;  1Q46 A;  1VQ6 A;  3M3Y H;  3M4O H;  4GKJ L;  3GTK H;  2NVQ H;  4JI5 Q;  4LFB Q;  2VY3 A;  1O7I A;  2D0O A;  4QGU A;  4LF6 L;  3S1Q H;  1VQE A;  3A0J A;  1VQ8 A;  1AE3 A;  3CW2 C;  1KAW A;  2B29 A;  3L2P A;  5HGQ A;  1I6H H;  4A3E G;  4A3E H;  4QIW E;  1N33 Q;  1SE8 A;  4A93 G;  4A93 H;  3RLO A;  4DV5 L;  3J81 i;  2ZJP A;  4GLX A;  4LNQ A;  3HKS A;  2VUM G;  3S1R H;  1CKN B;  1AH9 A;  3PUV A;  4A3M H;  5M3M H;  1UEB A;  1OXT A;  4JI8 Q;  2OQK A;  1QVF A;  1OXV A;  4C2M H;  1IXR A;  2NN6 G;  3G4S A;  5IE8 A;  1PH4 A;  1M1K C;  4GLA C;  2I0Q A;  2K50 A;  1KD1 C;  1K9M C;  3UDX A;  4TQU S;  3KYH C;  1QUQ B;  3MEF A;  4AH6 A;  1R9T H;  4DV4 Q;  2CCZ A;  1EOV A;  2N78 A;  1L0W A;  2PQA A;  3I56 A;  1L1O C;  1KIX A;  2R6G A;  2JA6 G;  1X3G A;  4JI0 L;  1PH5 A;  2JA6 H;  4YHH L;  3F8T A;  4DV0 L;  1XNR Q;  1D7Q A;  3PIO A;  1VQL A;  3GTM H;  4B3R Q;  2ZJQ A;  2N3S A;  2BH2 A;  4GKJ Q;  1HJP A;  5JJK A;  4JI6 L;  3LGJ A;  4YWL A;  4DR2 L;  1XMO L;  4JI2 L;  2QGQ A;  4B3T L;  1VQI A;  1K73 C;  1I3Q H;  4ME3 A;  1NBW A;  3STB D;  4PZ6 A;  4WJ3 M;  4GN4 B;  2B3G A;  2YV5 A;  4DR1 L;  1LTL A;  4DV5 Q;  1VCI A;  1OXX K;  2JQO A;  4UP8 A;  1X55 A;  3I2Z A;  2E8G A;  1I50 H;  2GVA A;  4NPS A;  2Q2T A;  3KF8 B;  3JAM c;  3J81 c;  4IPD A;  4DAY B;  1FGU A;  3MXN B;  1Z47 A;  1WJJ A;  4OX9 L;  2JA9 A;  2ASB A;  4MNO A;  3CMA A;  1PH8 A;  1YI2 A;  1HZC A;  4O0A A;  1V43 A;  3SGI A;  1JE5 A;  4R4I A;  4JI0 Q;  4JYA Q;  4KHP L;  4DV0 Q;  2Z6K A;  1YZ6 A;  2AHO B;  3T1Y L;  3U58 A;  4APV A;  4OWW B;  1Y1W G;  4OO1 I;  1QVG A;  2YU9 H;  3UE1 A;  4JI6 Q;  4Y52 H;  5JJI A;  1B8A A;  2ES2 A;  3PV0 A;  2UXB Q;  5LMN L;  2NZO A;  1SLJ A;  2K5N A;  4B3T Q;  1U0L A;  4BY7 G;  4BY7 H;  4DR4 Q;  2R92 G;  2R92 H;  2AKW B;  4HJ8 A;  3PO3 G;  3KFU A;  1DGS A;  2MQH A;  4A3K G;  2KHI A;  1Q1E A;  5LMU L;  3PO3 H;  1SMX A;  1HNZ L;  1ASY A;  4DR1 Q;  4DUY L;  2UUB Q;  2RHS B;  4JV5 L;  4BA1 I;  1N36 L;  3S2H H;  4MZ9 A;  1LM0 A;  3PUX A;  1EFW A;  2IY5 B;  2K14 A;  2D62 A;  3A5Z B;  4DV7 Q;  4FDB A;  4BBS H;  1GVP A;  3RN5 A;  1HNW Q;  4OX9 Q;  4LF9 L;  5C4J H;  2VQF L;  1PV4 A;  3S1N H;  2NVT H;  3FP9 A;  5JEA J;  2Q2I A;  3M4P A;  3PSI A;  3ZJY C;  1N8R C;  4DV3 Q;  1PH9 A;  1PVO A;  4KHP Q;  3F2B A;  4OON A;  4AYB E;  3PF4 A;  3KF6 B;  4BXX G;  4BXX H;  1YEZ A;  1K3R A;  2VW9 A;  3PUZ A;  5IYC G;  3PGZ A;  5IYC H;  3GD7 A;  5GAE C;  1KXL A;  3KJP A;  4NXM Q;  4LF4 L;  1X6O A;  4YY3 L;  5IT9 c;  2WP8 J;  5LMN Q;  2VS1 A;  5FLX c;  2MNA A;  1YJW A;  4LF8 Q;  2VNU D;  1A63 A;  4A3J H;  1I5F A;  1K8G A;  1A0I A;  5M3F G;  5M3F H;  2JK8 A;  5BR8 Q;  2LXJ A;  2V1C C;  5LMU Q;  1IZ6 A;  1TXY A;  1VQA A;  2PI2 E;  3EN2 A;  3I4O A;  3ULJ A;  4LW1 A;  3W5O A;  4DUY Q;  3K7U C;  4HJ5 A;  1E22 A;  1NJI C;  1N36 Q;  4JV5 Q;  1HZB A;  2R93 G;  1N34 Q;  2R93 H;  5M5W H;  4JI7 L;  3G48 A;  3HOX G;  3RZD H;  4IPG A;  3S1M H;  2EQS A; 
#chains in the Genus database with same CATH topology
 1T5X D;  2Z1C A;  2F0M A;  2R7D A;  3VYS A;  1UE7 A;  2Y0S E;  5CBE E;  2SNS A;  1X9N A;  3GP7 A;  1JCK B;  2F0L A;  1PTO F;  2EJF C;  2UXD L;  2ZTE A;  5D14 A;  2WII B;  2F0K A;  3MXU A;  4IOA A;  3TQY A;  1NAP A;  1YVC A;  5DNF A;  2CQO A;  3TP8 A;  2KCT A;  4JK1 C;  4POG A;  2A68 D;  1V9P A;  1KRS A;  3K81 C;  1IW7 C;  4JOI C;  1BXT A;  4PZ7 A;  4F88 A;  1HR0 Q;  3KOJ A;  3SE0 A;  1S5C D;  2KED A;  5COR A;  4CDE C;  2Z8L A;  1TS2 A;  1C0A A;  1ESR A;  2K05 A;  2E74 C;  4BBR G;  3D4R A;  4K0K Q;  4GS3 A;  4LF5 L;  3A7A B;  2RQX A;  2ENB A;  5E4W C;  1CKM A;  4DR3 Q;  2FFK B;  5I9O A;  2MUY A;  4B3M Q;  1P8L A;  1VQO A;  4DV6 L;  1PTO H;  1J5E Q;  1MSG A;  2DY8 A;  4QIW B;  3HOY G;  4A3G B;  1B53 A;  2L11 A;  4P72 A;  1VQ9 A;  3D0F A;  3BS1 A;  1BCP B;  4XQJ A;  4A3I B;  3GTQ H;  2K5V A;  3KLS A;  4GN3 B;  5NUC A;  3EVQ A;  3TSS A;  1VQ5 A;  3M7N A;  2A8V A;  2KHS A;  3K0Y A;  5C4X H;  4KHV A;  5DM6 3;  3BYT B;  1EZ8 A;  1YNX A;  2LMC B;  3RNU A;  4H02 A;  1PTO C;  3OWF A;  2K6A A;  4OWT B;  2B63 B;  2KBN A;  4LFC Q;  5C5L A;  2JEA I;  4DR2 Q;  1XMO Q;  3D6C A;  1IW7 D;  1GOZ A;  1BCP D;  5IGD A;  5JEA H;  3W1B A;  3MC0 B;  5FLM H;  4I7A A;  2AQ2 B;  3PMF A;  4ZUJ A;  3J80 E;  3Q6S A;  4GN5 A;  4K2L A;  3K5N A;  4EVO A;  4DV2 L;  3I7F A;  3TEH B;  1LTR D;  3RZO B;  1J6Q A;  4FNF A;  1PXU A;  4L6T B;  2HT1 A;  1KTK A;  4L8J A;  4OO1 H;  4M8A A;  3VA7 A;  4WRD A;  3IFD A;  2PNH A;  1TY0 A;  1WOC A;  4FYD A;  2XVS A;  4TSS A;  3GTG H;  4LFA Q;  4H13 C;  4AIM A;  3CPF A;  5C4X B;  2E2I B;  3MAQ A;  1L2F A;  2XRQ D;  1HNZ Q;  3CCQ A;  1CQF A;  5E4X A;  1SSO A;  2ZTC A;  2F52 A;  2DJF C;  1WTW A;  1XTC D;  4A3G G;  1QWY A;  5IYB H;  1U9R A;  3RR5 A;  2MO0 A;  2KCM A;  5E1F A;  2A5H A;  1KRT A;  3CU7 A;  3WDN A;  1RHP A;  3CC7 A;  2K28 A;  1Q90 A;  4HJ7 A;  5CV6 A;  4HJA A;  4RWS C;  2EJG C;  2XIW A;  5IYD H;  5C44 B;  3G71 A;  1FNU A;  2NVY H;  4PQX A;  3MWY W;  5EBC A;  4JI8 L;  1SND A;  2B63 G;  1LTG D;  1SRU A;  4WOR A;  4MIU A;  4C3J B;  1MHW C;  4X62 Q;  1QUQ A;  3RLF A;  1ONL A;  4F7X A;  1TWF H;  5COY A;  1DOL A;  1X32 A;  3FKI H;  4BY1 H;  5FO9 B;  4B3S Q;  1MGS A;  1HHV A;  1A8V A;  2RCF A;  2RHQ B;  4AQY L;  3NTI A;  1S40 A;  2IT1 A;  5IP9 G;  1EYA A;  1UE5 A;  5IP7 H;  1Q81 C;  2XSC A;  3E5S A;  3MEH A;  3A54 A;  2EYP A;  4P75 A;  1M8A A;  4JOI A;  2N49 A;  3BU2 A;  4WJW A;  3NSW A;  1H95 A;  1S5F D;  2PQE A;  4GLV B;  4ODG A;  1FD7 D;  2QIL A;  3K0X A;  1TWH H;  4ILW A;  2EOT A;  4C3H H;  2KJX A;  2ICE C;  3ER0 A;  3GDE A;  3I4M B;  1VQF A;  3ULL A;  1IKM A;  5CV7 A;  5JVH 3;  5IGG A;  1ESF A;  1V1P A;  3CD6 A;  1V1Q A;  1V8Q A;  3H3V H;  5F2D A;  3NEL A;  2NUC A;  1ICF B;  2IHE A;  1Q12 A;  5I9P A;  3SVM A;  1LO5 D;  4A3F B;  4KKT A;  2F4V L;  5JPM C;  3CCU A;  3CME A;  3S15 H;  1NE3 A;  2G9H D;  1GM5 A;  1BBX C;  5G3L D;  1W6J A;  3NEN A;  1SRO A;  2VB2 X;  4KI0 A;  2WAQ E;  1G6P A;  1H9S A;  1NMG A;  4NXN Q;  3ERS X;  3X3N A;  1G91 A;  4P74 A;  4IAL A;  3TP6 A;  3M3Y B;  2OTL A;  4DU9 A;  5C0X I;  3TS0 A;  1XNQ Q;  2OF1 A;  4X66 L;  5BN5 A;  2LXK A;  1ZXT A;  1NCV A;  2UUC L;  4N9T A;  1I6H B;  3NEM A;  3I8Z A;  1KLG D;  2Q2H A;  4A93 B;  2HUG A;  1RD9 D;  1S4Z A;  4CJ0 B;  5IY0 A;  5I2Y A;  2B2U A;  3S1R B;  3M7G A;  4LF8 L;  4C3J G;  3X3M A;  1SYB A;  1SFO H;  2QDL A;  1W6K A;  5GRO A;  4DV1 Q;  3DWP A;  3IRB A;  1RKN A;  3I73 A;  4RAU C;  4NP5 A;  3GV3 A;  1B2T A;  1D1I A;  4Y7N H;  4TKO B;  3T1H Q;  4BBS G;  1ZKO A;  1AN8 A;  1S5E D;  4EQP A;  2F0S A;  1VQH A;  3H0G H;  4JBM A;  2XN9 C;  1WTO A;  2FMC A;  1JJG A;  2EY1 A;  2K75 A;  1E24 A;  3TRE A;  1I4P A;  4IUQ A;  3BZK A;  1IL8 A;  1TS4 A;  3SK8 A;  1Y8P B;  1ASZ A;  4UY8 C;  1I50 B;  4QQB X;  4JI5 L;  3PO2 H;  4LFB L;  4QCL A;  2G5D A;  3TBI B;  5D3I B;  3I4N H;  2JEB I;  3I4M G;  2PMZ E;  1WTH A;  3IFT A;  4PZ8 A;  4WJ4 A;  2KEE A;  2F0J A;  2WB1 G;  2QF7 A;  3ICE A;  2KHJ A;  1BOS A;  3STB C;  1I94 Q;  1HR0 L;  1EU4 A;  2K03 A;  3VYR A;  4XTC S;  1B1Z A;  1K0R A;  3AFQ A;  3NWS A;  4A3F G;  2ZTD A;  1EY4 A;  1Q82 C;  4JI4 Q;  4ID6 A;  3UDI A;  5EKI A;  4L5R C;  2F0H A;  1JJ2 A;  3HOZ H;  5FK9 C;  2DGY A;  2K7V A;  4A3C G;  2G9D A;  2RCN A;  1IBM Q;  1GUG A;  4A3L G;  2AWO A;  3M4O H;  1Q46 A;  4KY7 A;  4J8Q A;  1H9R A;  1H9M A;  2D0O A;  1DXM A;  3GQB A;  1KAW A;  1E2V A;  2B29 A;  5C4J B;  4A3E H;  1N33 Q;  5I6Y A;  4HAE A;  4A93 G;  3RLO A;  2VUM G;  1CKN B;  4A3M H;  5M3M H;  4C2M H;  5IE8 A;  4GLA C;  1KD1 C;  4RGT A;  4NMZ A;  2PZU A;  4TQU S;  4XT1 B;  2CCZ A;  4DV4 Q;  2N78 A;  1SE4 A;  1KIX A;  3ND8 A;  5M3F B;  1PH5 A;  5D3D A;  1XNR Q;  5KIX A;  1F77 A;  5FO8 B;  1D7Q A;  3PIO A;  1SEB D;  2N3S A;  5JJK A;  4GKJ Q;  1HJP A;  3VR6 A;  1B44 D;  5EKL A;  2RSN A;  3VR3 A;  1VMP A;  4DR2 L;  1XMO L;  4B3T L;  4QB4 A;  4OEL B;  1K73 C;  1NBW A;  3STB D;  4PZ6 A;  1IKL A;  4WJ3 M;  1L0Y B;  1ENF A;  2D5D A;  4DR1 L;  4DV5 Q;  1VCI A;  4CDC C;  1OXX K;  3OMG A;  4JVZ A;  1X55 A;  2E8G A;  1DM0 B;  5M5X B;  2GVA A;  2LFN A;  1SYD A;  1EQT A;  2ZXR A;  2M00 A;  1GUN A;  4K8J A;  3MXN B;  2ASB A;  3WOE A;  1HZC A;  4QUC A;  1JE5 A;  1JIC A;  1GUO A;  3IKJ A;  4JYA Q;  2B8G A;  2K5W A;  4APV A;  3K5L A;  4OO1 I;  3K57 A;  1STE A;  1WCM B;  2IPK D;  3UE1 A;  4JI6 Q;  3PV0 A;  4K6L A;  5DM7 3;  2K5N A;  2FIN B;  1S5D D;  2R92 G;  2TSS A;  4HJ8 A;  3PO3 H;  3CRK C;  4A3K G;  1GHK A;  3NE5 B;  1SMX A;  1HNZ L;  4ZAI A;  4UHV A;  3DEP A;  3BVG A;  4BA1 I;  3S2H H;  4MZ9 A;  1LM0 A;  2K01 A;  1FGB D;  2K14 A;  2D62 A;  3A5Z B;  4DV7 Q;  4FDB A;  1D5Z C;  1NSN S;  3I91 A;  2VQF L;  3KBG A;  3FP9 A;  4H7B A;  3ZJY C;  1XWE A;  2Q2I A;  1N8R C;  1A15 A;  3KF6 B;  4BXX G;  1RF2 D;  1YEZ A;  3PUZ A;  2B2Y C;  3PGZ A;  5IYC H;  5KNC A;  4GZY C;  5EPJ A;  4YY3 L;  2WP8 J;  1A63 A;  2VS1 A;  2VNU D;  3OW7 A;  2RSO A;  4A3J H;  1A0I A;  4H44 C;  5M3F G;  1FR3 A;  1IZ6 A;  4HJ5 A;  1DD2 A;  1E22 A;  1NJI C;  4JV5 Q;  3A8K E;  5M5W H;  4JI7 L;  3T51 B;  3G48 A;  3HOX G;  4J6H A;  4R1J A;  4ALP A;  1LTB D;  4DNT B;  4LF9 Q;  3E9I A;  4GOP A;  3Q0A A;  4ZKC B;  4B3S L;  1SJE D;  5FJ8 G;  3I4L A;  4R4Q A;  1WYD A;  2EYH A;  2OWO A;  4G7O C;  3HKZ E;  5LHY 1;  1STN A;  2J0T D;  4GNX A;  1KL9 A;  2F0V A;  1KQS A;  1A2U A;  3CCL A;  3K6O A;  1LLR D;  5K5P A;  3CCR A;  5DEH A;  3A8J E;  2B2W C;  5JOB A;  2JN4 A;  1JB7 A;  5EJW A;  1WI5 A;  2N88 A;  3A8I E;  2BE5 C;  1D1K A;  3HRZ C;  1WCM G;  3BDC A;  4JC0 A;  3J7A F;  2VQE L;  1JE4 A;  1HFN A;  5BN3 A;  1UE6 A;  1EY9 A;  4BBR H;  5JAV A;  4DPG A;  1QG7 A;  2BDN A;  4K6D A;  3W3A A;  3H3V I;  4IOC A;  1BR9 A;  4LUV A;  1CSQ A;  3UI2 A;  2K32 A;  5M5W B;  1IYJ B;  2KCC A;  4G7H C;  3HOY H;  1CKO A;  1VQJ A;  4JBJ A;  1X3F A;  1MKH A;  4J15 A;  1S3O A;  1AE2 A;  1NMF A;  1EQR A;  1VMC A;  4NXN L;  1F2Y A;  2B2V C;  2NTS A;  3S2D B;  4WFN 3;  1TVX A;  1XNQ L;  3F2U A;  1D5X C;  1SDF A;  2PPB C;  1B50 A;  3S17 B;  3NTH A;  1L0X B;  4R4C A;  5M9O A;  5J3B A;  2Z6K C;  2OEO A;  5C4H A;  1N9W A;  1EIY B;  4CDD C;  2AMC B;  1Y1W H;  1W3S A;  1BDO A;  2O4X A;  1PDQ A;  3J80 L;  2OT2 A;  1EQQ A;  4X65 L;  1STY A;  4GKK L;  1T9H A;  1MJC A;  4RGM A;  4JI2 Q;  4C3I B;  4HMI A;  1K8M A;  2BE5 D;  3T13 A;  2LS0 1;  1GUT A;  3HFZ B;  2Z0S A;  3T1H L;  2QEX A;  2LSS A;  2O5I C;  1B7Y B;  4KKS A;  2JJQ A;  2BH8 A;  3QG1 A;  3S14 B;  2L4N A;  3K58 A;  2A68 C;  2H1E A;  5C3E B;  5ELE A;  3TRZ A;  3J7A 5;  3E9H A;  1BCP F;  3GTL B;  2AQ1 B;  4A76 A;  5K36 G;  3KK7 A;  3MXP A;  1LAB A;  1FNV A;  2GA4 B;  3HOU G;  5E7N A;  1TS5 A;  3EFX D;  2LY7 A;  1LTS D;  3E0E A;  5I2X A;  5AJ3 L;  3OTO L;  3PCO B;  2JA5 G;  1TQO A;  3T1Y Q;  4KHZ A;  3CQZ B;  3L7Z C;  1TWG B;  1G2T A;  1EWI A;  4UP7 A;  3PUY A;  3CCS A;  1AP0 A;  5M5Y B;  4KKU A;  4F8M A;  4FF3 A;  1I94 L;  1PMR A;  2V4D A;  2A1A A;  1SN8 A;  2PCF B;  1DON A;  1QZH A;  4ZYS A;  2JA8 G;  2I5H A;  4JI4 L;  2F3I A;  4A3G H;  3DXJ C;  4DR7 L;  3U4Z A;  1PH1 A;  4JI3 Q;  4A3I H;  3S9W A;  1JOR A;  2IWH A;  3V05 A;  4HED A;  2KEC A;  1YHQ A;  3TZU A;  5C3X A;  1EWH A;  1U5K A;  4LF4 Q;  1I4G A;  1TS3 A;  4P71 A;  4IFD J;  2UXC Q;  1Y1V G;  2NYZ D;  2E2H B;  1K83 B;  4MHE A;  1STG A;  1MBY A;  4A3B G;  2B63 H;  1ROD A;  4R4T A;  3CC4 A;  1BCP C;  3O13 A;  4QL5 A;  3T56 B;  4DV4 L;  1VF7 A;  4C3I G;  3J7Z C;  4FXD A;  2YYZ A;  1XNR L;  1P16 A;  2QEJ C;  1IYU A;  2WKC A;  2WV6 D;  2DUD A;  3NXW A;  3P1H A;  2H5X A;  2CWP A;  1SXT A;  1F2L A;  1SBB B;  4KTA A;  3U4V A;  3PIP 3;  1CQV A;  1MD2 D;  4YWK A;  3SK5 A;  1S72 A;  1W2B A;  5IP9 H;  1YJN A;  2B2W A;  5C3E G;  1XYI A;  3J80 c;  2YTY A;  1A62 A;  3KDF B;  4LF7 Q;  2MJ8 A;  2AUK A;  1AZP A;  3RZO H;  4NB3 A;  4XIG S;  1EWC A;  3AYH B;  4JI1 Q;  2UU9 L;  4QY7 A;  4XQN A;  4OWX B;  3MA2 B;  4PMC A;  1EYC A;  5ELO A;  3CF5 A;  4IO9 A;  1FJG Q;  3S16 B;  2Z4H A;  2KEN A;  2SNM A;  4ZLT F;  4JYA L;  4HIK A;  3D6W A;  1VQK A;  3A7L A;  4CJ2 C;  2E2I H;  3N52 A;  2NZ1 D;  2FMM A;  1STH A;  2N8N A;  1HNX L;  5LL6 X;  3D4W A;  1UWV A;  1F2Z A;  1VQB A;  1RIP A;  3I72 A;  2RDF A;  2Q8T A;  1JWS D;  3SK4 A;  4L5S A;  4MN3 A;  1PH7 A;  4CKB A;  2WAC A;  1TWC B;  1PYB A;  3Q8D A;  4DV7 L;  5FO7 B;  1K8O A;  3EQL C;  4X3S A;  5JJL A;  3BG3 A;  1HPC A;  3MHB A;  4DK0 A;  1L1O B;  5C44 H;  1FL0 A;  2F0Q A;  3CXC A;  1PHJ A;  1CUK A;  3S1Q B;  3NPP A;  5G3L F;  1O7Z A;  2IHF A;  3KJO A;  1EY0 A;  4NKL A;  1GO3 E;  2B2T A;  5ELN A;  2NB0 A;  2EXZ A;  2HQE A;  1TII D;  1LUZ A;  1WFQ A;  4C3J H;  3CCE A;  1EYG A;  2MHV A;  4DXF A;  1UNS A;  2Y0S G;  1R9T B;  5J39 A;  2I5L X;  3UDG A;  4JBW A;  2JA6 B;  2HIV A;  2UUA Q;  5C0X G;  1B3A A;  2F03 A;  1IBK Q;  1BF4 A;  4J1M A;  4UP9 A;  1U4M A;  2C9O A;  1I3Q B;  2E5L Q;  1I4H A;  1CFM A;  4HIO A;  2Z4I A;  1KNE A;  4X64 L;  4IFD H;  4DR6 L;  4QF4 A;  4PMB A;  3NHH A;  1SAP A;  3HZX A;  4LUO A;  1IBL Q;  3JAM E;  2BA0 A;  3E6Z X;  3J80 i;  4CHT B;  3J81 E;  3PQI A;  3HOV G;  3QJY A;  5EGT A;  4HSV A;  1SR3 A;  3I4M H;  4G4K A;  1JMC A;  5GAH C;  4DNI A;  1M90 C;  3VA5 A;  5IWA Q;  3NQT A;  2A6H C;  2RF4 A;  1Q3L A;  1XXG A;  2MPM A;  1SYC A;  4RMF A;  4A3F H;  1KLU D;  2OTJ A;  4LAA A;  3D8G A;  1A3T A;  4N8X 1;  1AFP A;  3EJI A;  2HDM A;  4QJF A;  4A3C H;  1GUW A;  1Q1B A;  2X69 A;  3M3Y H;  1WTR A;  1I4R A;  5ELC A;  4BBS B;  5J1Z A;  4QGU A;  5IT9 L;  1VQE A;  2A73 B;  5FLX L;  2M9V A;  3TN2 A;  3CW2 C;  1I6H H;  3L2P A;  1JOK A;  1SE8 A;  4A93 H;  3H09 A;  3J81 i;  2ZJP A;  4LNQ A;  3S1R H;  3M4Y A;  3PUV A;  5D65 A;  1EY6 A;  2R3Z A;  3OOC A;  1QVF A;  3G4S A;  1IXR A;  2EYM A;  1PH4 A;  4FXK C;  2I0Q A;  3LX0 A;  3UDX A;  3KF8 A;  4QUF A;  3MEF A;  4DAY A;  1LT4 D;  2JA6 G;  4DV0 L;  3ERQ A;  1ZYR C;  1BNZ A;  1VQL A;  4RHS A;  4B3R Q;  2KQ3 A;  2WB1 B;  3J7A V;  2R93 B;  4YWL A;  4JI2 L;  2WIN B;  2IX3 A;  5IGC A;  2A6H D;  2NWG A;  4DF7 A;  4KN7 C;  3KLS X;  1HFG A;  1TWA B;  2JQO A;  2SEB D;  2K33 A;  2F0P A;  5HUR A;  1I50 H;  2MGS A;  1HUN A;  3E0J A;  5I4D A;  4IPD A;  1FGU A;  1Z47 A;  2JA9 A;  4K2K A;  5IIF A;  4BWG B;  1PH8 A;  2SOB A;  2EVB A;  3GTP B;  1O7Y A;  3SGI A;  2E2J B;  1EL0 A;  4JI0 Q;  3SK6 A;  4KHP L;  1PRT C;  3T1Y L;  1SMY C;  4OIK A;  1QVG A;  2VUM B;  4EGV A;  4CBV A;  2NVX B;  4DAV A;  2UXB Q;  5LMN L;  1LTT D;  2BDO A;  5CMD A;  1U0L A;  4DR4 Q;  4RA8 A;  3RMH A;  2R92 H;  1E0B A;  1RDP D;  4HCE A;  1DGS A;  1Q1E A;  5LMU L;  1E2Z A;  2RHS B;  3W2D A;  1N36 L;  2IY5 B;  1B3Q A;  2A6E C;  1CTM A;  2L55 A;  5CR3 A;  3NTK A;  4OX9 Q;  1PLF A;  3D3R A;  4FP5 D;  4FO2 A;  5C4J H;  1ZYR D;  1PRT B;  1PVO A;  3SR1 A;  4AYB E;  2R7Z B;  4BXX H;  1KXL A;  3KJP A;  4NXM Q;  1QE6 A;  4LF4 L;  3C3L A;  5IT9 c;  4ZK9 B;  2HCC A;  3RD4 A;  1YJW A;  5FLX c;  1ILQ A;  2PW5 A;  1I5F A;  3DMU A;  2X6L A;  4NDX A;  3AMU A;  2DNC A;  5M3F H;  3ULJ A;  3I4O A;  3W5O A;  4DUY Q;  5FOB B;  1G6Z A;  4RGO S;  2R93 G;  4IQZ A;  1JOQ A;  5TSS A;  2L0C A;  2EQS A;  1MSH A;  4HIM A;  1PRT D;  2F0I A;  4TVA B;  4X3U A;  1SMY D;  4LJZ C;  4K0K L;  2OQ0 A;  1DOM A;  5FJ8 H;  2R92 B;  5M5X H;  2L5T A;  4DR3 L;  4A3K B;  4B3M L;  5IYD G;  1STA A;  4HCS A;  5DAU A;  2EY2 A;  1J5E L;  4I7Z C;  3C46 A;  3MXG A;  4C1N K;  2JA7 B;  2A6E D;  4X3T A;  1U4R A;  1Q7Y C;  3KLR A;  4DUZ Q;  4RHR A;  4KY5 A;  1ET6 A;  1G2S A;  1WCM H;  2ZM6 Q;  2KCN A;  2QA4 A;  4KN4 C;  1WVL A;  1QNK A;  2HHH Q;  3UDF A;  5EQ0 A;  3G7L A;  4UPA A;  5I6W A;  2NN6 H;  3ITP A;  2IX0 A;  2R61 A;  1A6X A;  3T53 B;  1FVI A;  2EDG A;  2CH4 W;  1EY8 A;  1YNN C;  1HA5 A;  2K5H A;  2QKI C;  4LFC L;  3C2P A;  1CK1 A;  1Y1W B;  5EPK A;  3OW2 A;  3HOX B;  4XXE A;  1O80 A;  2D0P A;  3BVZ A;  3A74 A;  1HTP A;  1RCV D;  2R7Z G;  3CKI B;  1EEF D;  2I46 A;  3CCM A;  3NBH A;  2MP1 A;  1HA6 A;  5LMN W;  3AU7 A;  2L12 A;  2VB3 X;  2CKZ B;  3NP8 A;  3ND9 A;  2IX1 A;  1LYL A;  2PQA B;  4XQQ A;  1PA6 A;  1VQN A;  2E76 C;  2GN5 A;  4O1N A;  1VQP A;  2P5Z X;  4PMW A;  4YHH Q;  1VQG A;  4H0L C;  4F87 A;  4OXP A;  4LFA L;  3EBE A;  4HID A;  4JW0 A;  3G6E A;  4O2D A;  5CC4 A;  4RCN A;  5FKA C;  2RDH A;  2Q2U A;  3FEW X;  3AB9 A;  4IUR A;  4FF4 A;  3PUW A;  1VDZ A;  4U67 3;  3SEB A;  3QOL A;  1JT8 A;  3H91 A;  2E5L L;  1CSP A;  1BVS A;  2F0F A;  2JA7 G;  5K36 H;  1YNN D;  2JSO A;  2CFM A;  2WFW A;  4IFD I;  2XGT A;  3HOW B;  1HR0 W;  3QO2 A;  1Z7T A;  1TR5 A;  4R8N A;  3K7A B;  4X6A H;  1YHA A;  2FXQ A;  1Z6H A;  5IWA L;  5JPN C;  1D6E C;  3R2T A;  3A56 A;  1QZG A;  2IJ0 A;  1K28 A;  4HMJ A;  4DK6 C;  2FJ2 A;  2ZJR A;  1HRJ A;  1IHZ A;  3Q23 A;  1PFS A;  2B39 A;  4N8F A;  4X62 L;  1PH6 A;  2F4I A;  3W1G A;  5GAG C;  3S2D H;  4XYQ A;  3EIV A;  1X3E A;  4KJO A;  5ELB A;  3SHL A;  1X56 A;  2HCI A;  3I4N G;  3GTO B;  4P73 A;  2C35 B;  3DWA A;  3S17 H;  3GTJ B;  3DHQ A;  3MFG A;  2RBM A;  3J81 j;  2VZA A;  1F2M A;  2K1B A;  1CKN A;  4A3B H;  1C48 A;  2F0G A;  4JBK A;  3HOU B;  5E3F A;  1TU2 B;  1B9M A;  4C3I H;  1X3P A;  1VQC A;  2DJG C;  1VQ4 A;  2JA5 B;  1K3B C;  1QOH A;  4IUP A;  3FPU B;  2F3V A;  4B3R L;  2EYF A;  4L5T A;  3OMC A;  2HIX A;  4A75 A;  1PH2 A;  1SNM A;  3KLW A;  3S14 H;  3M9B A;  2XNA C;  5C3E H;  3VYU A;  1KDB A;  3GTL H;  2JA8 B;  4PG3 A;  1D8L A;  1IL2 A;  4A3M G;  3HOW G;  5M3M G;  4UAI A;  4I65 A;  4KY6 A;  4A3D B;  2NTT A;  2EXD A;  3CQZ H;  3K5O A;  4PNY A;  4N9P A;  2DY7 A;  1TWG H;  3MXN A;  2A19 A;  2FHT A;  5M5Y H;  3VR5 A;  4MTK A;  1K8A C;  4L5Q A;  1N32 Q;  2UXB L;  2N55 A;  1Y1V B;  4AQY Q;  4DR4 L;  1X65 A;  3M85 A;  1SYE A;  3TME A;  4A3B B;  1Z9F A;  2IL8 A;  2H4O A;  2C5C A;  2I07 B;  1EIG A;  1KAB A;  1QJO A;  3C1F A;  4DV1 L;  1KNA A;  2ZT9 C;  5LL6 S;  5IGE A;  4EQN A;  1YIJ A;  5KRU A;  5EPL A;  3T16 A;  5KNB A;  3GTK B;  2NVQ B;  3G6J B;  1BO0 A;  1AW7 A;  1SYG A;  3CC2 A;  2E2H H;  1DZ1 A;  1K83 H;  2LKV A;  4DR5 Q;  2TMP A;  1SE2 A;  3L3O C;  4NXM L;  3KF6 A;  1E1T A;  3DLL A;  3BDL A;  4LMQ D;  1K0S A;  3D4D A;  3DWQ A;  3OHX C;  3T4A C;  1LTI D;  2ZXP A;  1EUJ A;  1VQD A;  2F4V Q;  3HS0 C;  3HKZ G;  1HCZ A;  4POF A;  3I90 A;  1X3Q A;  4IPC A;  1BQQ T;  4X3K A;  1XMQ Q;  1STB A;  3JAM L;  3WWV A;  3J81 L;  1U4L A;  2AWN A;  4X66 Q;  4JG2 A;  2PYK A;  1XPR A;  4C56 C;  2UUC Q;  1YJ9 A;  4RGN A;  4A3D G;  2B2Y A;  2HQL A;  1IBM L;  2RDG A;  3D31 A;  1TT2 A;  3MVV A;  3PIO 3;  3K80 C;  1B70 B;  3S16 H;  3HOV H;  1DJR D;  4A3J G;  5ELF A;  2KOL A;  2ZXO A;  4YWM A;  1PYS B;  5KND A;  1SNC A;  2PZW A;  2NBF A;  1C8C A;  1EYD A;  1N33 L;  1Y14 B;  4DUZ L;  2ZM6 L;  1A3V A;  3H6M A;  1SJH D;  3LNN A;  4L63 B;  4M1U B;  3OPO A;  5GAD C;  2EPB A;  2HHH L;  3AFP A;  2YU9 B;  2CWA A;  4IJH A;  5A2Q E;  1KC8 C;  1FNW A;  2NN6 I;  4BA2 I;  4BY7 B;  1TWC H;  2EYJ A;  4P2C B;  1MJE A;  2Y0S B;  2A74 C;  1VS0 A;  1VQ6 A;  4GKJ L;  1EIF A;  2QW7 A;  4DNR B;  4JI5 Q;  2CQA A;  4LFB Q;  2VY3 A;  3S1Q H;  3A0J A;  1VQ8 A;  3S1N B;  1VF5 C;  4QIW E;  2NVT B;  4DV5 L;  4U68 A;  4GLX A;  3TP7 A;  3HKS A;  2SDF A;  4B08 A;  1GUS A;  1OXT A;  1NUC A;  1OXV A;  1M1K C;  2K50 A;  3CHB D;  1QUQ B;  3I3C A;  1R9T H;  2KUM A;  3HOV B;  1L0W A;  5IGF A;  1L1O C;  5CBA E;  2JA6 H;  1X3G A;  4YHH L;  3GTM H;  3QR8 A;  4JI6 L;  1O7L A;  2BOS A;  2QGQ A;  3RZD B;  1A2T A;  3RUZ A;  1I3Q H;  5L37 A;  1EZ6 A;  2F1M A;  3QB3 A;  3QIA A;  4GN4 B;  2B3G A;  2B2V A;  1LTL A;  4UP8 A;  3I2Z A;  5KEE A;  4R9W A;  2L9H A;  3R3O A;  3L9A X;  4RFB A;  2Q2T A;  1PZJ D;  2EE1 A;  3KF8 B;  3JAM c;  2F0T A;  3J81 c;  4DAY B;  1WJJ A;  1SNO A;  1RTO A;  3CMA A;  3GV6 A;  1YI2 A;  1PFN A;  1V43 A;  1V1P B;  5CV8 A;  2Z6K A;  2AHO B;  3U58 A;  4OWW B;  1Y1W G;  2B2U C;  1B8A A;  3LWE A;  4ZRZ A;  2ES2 A;  2NZO A;  4B3T Q;  4BY7 G;  2AKW B;  3KFU A;  2MQH A;  2KHI A;  1ASY A;  4DR1 Q;  2UUB Q;  4JV5 L;  1H9S B;  2J4X A;  3PUX A;  4BBS H;  2EYO A;  3RN5 A;  3GTM B;  1HNW Q;  1PTO B;  4LF9 L;  2F3W A;  2XRS D;  3MFY A;  3PSI A;  4DV3 Q;  3FPP A;  3R2I A;  3F2B A;  3GTQ B;  2E2D C;  1NNX A;  3GD7 A;  1CHQ D;  3MTS A;  4KD3 A;  3Q24 A;  4V0B A;  5A35 A;  1CA5 A;  1K8G A;  2XWB B;  2JK8 A;  4OHJ A;  5BR8 Q;  2LXJ A;  2V1C C;  1TKW B;  4E6I A;  1TXY A;  1VQA A;  2L1B A;  2PI2 E;  4LW1 A;  4RCO A;  1HZB A;  1N34 Q;  2R93 H;  1PTO D;  3ZYY X;  3BVM A;  1B9N A;  4ZQ3 A;  3S1M H;  1G29 1;  2B8F A;  3TZD A;  2VQF Q;  4A3I G;  1GJX A;  1KDA A;  3BYY B;  1LT3 D;  4G57 A;  3RN2 A;  1TWA H;  5DLQ E;  3HP3 A;  1C7Y A;  4A3L H;  3BZC A;  3B6Y A;  3F1Z A;  1NY4 A;  4KLK A;  5T1G A;  4YY3 Q;  3K8A A;  3GO5 A;  1PRT F;  3KDF A;  3GTP H;  3OIQ A;  2E2J H;  4JCV E;  4K5W A;  2K04 A;  4FVM A;  1JC7 A;  4DKA C;  3P7J A;  3ERO A;  3PF5 A;  1HZA A;  3JAM i;  2VUM H;  2NVX H;  4C1N I;  4JI7 Q;  1H9K A;  2D9U A;  4IUV A;  1XX8 A;  4K14 A;  3EA6 A;  4DAM A;  5HY6 A;  3GTG B;  3Q22 A;  1ILP A;  3CRL C;  4DXG A;  3VDY A;  1N32 L;  1GXD C;  1G51 A;  2DNE A;  2WB1 E;  5EAY A;  1AZQ A;  2EY6 A;  4CJ1 B;  4HJ9 A;  3P75 A;  1D5M C;  4K8I A;  4IUT A;  4LF6 Q;  4FF2 A;  3S1M B;  1VQ7 A;  2R7Z H;  2YTX A;  4RH6 A;  5C4Z A;  3CCV A;  2VQE Q;  5C4X G;  1L1O A;  1E7Z A;  3CP0 A;  1EEI D;  3S24 A;  4DR5 L;  1NTG A;  3OIP A;  1R4Q B;  2NVY B;  4DA2 A;  3H15 A;  4R8I A;  4LK1 C;  2PO4 A;  2NZH A;  3I70 A;  5IOC A;  4RKL A;  2R7F A;  4QMG A;  1QIL A;  1MIU A;  2KA7 A;  4FXG C;  1WD0 A;  5BN4 A;  4OEM B;  1JOO A;  1NR2 A;  2O2L D;  3FDT A;  3NBH B;  1PZK D;  4EX5 A;  1GKH A;  1TWF B;  5JEA G;  4A3K H;  1X54 A;  3FHW A;  1XMQ L;  3FKI B;  4NW2 A;  5C44 G;  2AUJ D;  2WAQ B;  5FLM G;  4Q5V A;  4BY1 B;  4HN7 A;  1T5E A;  1BBU A;  3V96 A;  1IYV A;  2I5M X;  3H3V C;  2BCO A;  4HR7 B;  3BJU A;  3A55 A;  1G8Z D;  2OXP A;  2JA7 H;  4JI3 L;  3ULP A;  1MI2 A;  1EOT A;  4HSP A;  1WTV A;  1YNJ C;  4OO1 G;  1C9O A;  1WTX A;  5EBD A;  2EZV A;  1Q8K A;  4OL7 A;  1TWH B;  1ZEQ X;  2K5Q A;  4X65 Q;  3NQI A;  4GKK Q;  1GD7 A;  2A69 C;  4LWC A;  4C3H B;  1EU3 A;  5KGU A;  1OXU A;  1I4Q A;  3SXH A;  2UXC L;  1BBW A;  2ALY B;  2HDL A;  5H1S E;  4A4I A;  5AFW A;  4Q0F A;  2PI2 A;  1UUP A;  1SE3 A;  1CHP D;  1KAA A;  3HOX H;  3A5U A;  2MO1 A;  1QB5 D;  2QDB A;  4IFD G;  3E3X A;  5IYB G;  2PZT A;  3F2C A;  4GOP C;  4YIJ A;  1LT6 D;  2JXM B;  4AYB B;  3JC6 6;  3S15 B;  2KVM A;  1ICW A;  2OCE A;  2PNR C;  5AJ3 Q;  3OTO Q;  1OTC A;  1KHI A;  3IL8 A;  3K5M A;  1HQR D;  4GNX C;  4LF7 L;  2L15 A;  1E3P A;  4KMU C;  1LAC A;  5GQO A;  1HQM C;  2PMZ B;  5KYI A;  1CA6 A;  2VXW A;  4DK3 C;  1F9S A;  3HGB A;  2WKD A;  4EQ5 A;  1PYW D;  4JI1 L;  1WD1 A;  3URY A;  5C5M A;  3IAY A;  1LTA D;  1FJG L;  3CPW A;  4DK1 A;  1OXS C;  1JB3 A;  3SDZ A;  2X6G A;  4GOP B;  1SFO B;  3M4Q A;  2F0W A;  3CCJ A;  1YNJ D;  4DR7 Q;  1QVC A;  4IPH A;  5J22 A;  2VL6 A;  3FKI G;  4BY1 G;  1WTP A;  2WAQ G;  4Y7N B;  3TS2 A;  3VR4 A;  2A69 D;  4GNX B;  5IP7 G;  4XDX A;  1I4X A;  1U4P A;  3I55 A;  1E1O A;  2F0E A;  2UXD Q;  1V1O A;  2EIF A;  3H0G B;  2EJM A;  1BKB A;  2DN8 A;  3HOW H;  3U50 C;  3L0O A;  2AQ3 B;  5IT9 E;  5FLX E;  2JP1 A;  1CT1 D;  3K7A H;  1RL2 A;  4IJL A;  3DM1 A;  4LUZ A;  1S5B D;  3PO2 B;  1CZW A;  3F2D A;  4C3H G;  3I4N B;  3UE0 A;  4CGY B;  1II3 A;  2XTI A;  4LF5 Q;  1CI3 M;  4XT3 B;  1EFI D;  5CV4 A;  3OWE B;  2K5D A;  2YTV A;  4B9X A;  4DV6 Q;  1JWM D;  3BZD B;  1JJC B;  3OYY A;  2UUB L;  2JE6 I;  1EQV A;  4AYB G;  1SNP A;  1D2B A;  1GHJ A;  2Z9H A;  2UUA L;  3HOZ B;  2UU9 Q;  2BA1 A;  5HGT A;  1HNW L;  3GTO H;  4DFA A;  3M4O B;  2K4K A;  1CM9 A;  2MFI A;  4JPB W;  1IBK L;  1EIH A;  1E2W A;  5ISR A;  3VYT A;  3GTJ H;  1XJV A;  2D2C C;  4DV3 L;  1YIT A;  1QCB D;  1VQM A;  4RG1 A;  4A3E B;  2K52 A;  5CYU A;  4YCU A;  3HG9 A;  1HH2 P;  1IBL L;  4S3S A;  4YCV A;  4B9W A;  3PIP A;  1HNX Q;  3HOU H;  3R93 A;  3AQQ A;  2CW0 C;  3NUC A;  4A3M B;  5M3M B;  1SNQ A;  3DM3 A;  4C2M B;  4R4O A;  3QOJ A;  3TP5 A;  2JA5 H;  5BR8 L;  1XPU A;  1HZ9 A;  1UE1 A;  4ABN A;  3QWN A;  1JR0 D;  2F0N A;  1DOK A;  2RKS A;  3BDO A;  4ULL A;  3ONA B;  1HTL D;  3HEJ A;  3RLN A;  1N34 L;  2GVB A;  4YCW A;  1F9Q A;  3VR2 A;  1QNU A;  4RKB A;  2F0D A;  2ID0 A;  3CAM A;  2JA8 H;  1JWU D;  1OO9 B;  4CKC A;  3H0G G;  4HTH A;  4FF1 A;  5JVG 3;  2ATW A;  1RTN A;  4DV2 Q;  2ICI A;  3U9O A;  4A3D H;  4O42 A;  3WOF A;  4DGZ A;  3NK9 A;  1Q86 C;  5C0X J;  4MTN A;  1Q8I A;  5CGK A;  3U9S A;  3PO2 G;  1Y8N B;  1M4V A;  4IN3 A;  5CV5 A;  1YHB A;  2Q8I B;  5A2Q L;  1FYC A;  4G7Z C;  1PZI D;  2CVR A;  1ENC A;  1Y1V H;  1F9R A;  1J9O A;  1XPO A;  4CKE A;  1YBY A;  1SYF A;  4IUU A;  2J7Z A;  1BUV T;  1XTD A;  3AEV A;  3TDQ A;  3MZ5 A;  1EY7 A;  1ML0 D;  3N6R A;  2CW0 D;  5C3W A;  2QCP X;  3PO3 B;  3HOZ G;  4X64 Q;  1PH3 A;  1TY2 A;  3H94 A;  4K5V A;  4DR6 Q;  3HKZ B;  4Z9C B;  3S2H B;  3NBI A;  5JJZ A;  3GTK H;  2NVQ H;  1O7I A;  4LF6 L;  5C6A A;  2F0U A;  1AE3 A;  1NR4 A;  2EY5 A;  2RA4 A;  5HGQ A;  5CV9 A;  3P20 A;  5IGB A;  4A3E G;  1C4Q A;  2Q8R E;  3C1E A;  3LWU A;  1UEA B;  1AH9 A;  4DN4 M;  4PV1 C;  1UEB A;  5T1I A;  4JI8 Q;  2OQK A;  1HXY D;  2IW3 A;  2NN6 G;  3FRP B;  1R4P B;  5IOD A;  1K9M C;  3KYH C;  2O5J C;  4AH6 A;  1DYQ A;  1WTQ A;  1EOV A;  1KDC A;  4A3J B;  2PQA A;  3I56 A;  3V2T A;  2R6G A;  2PW7 A;  4JI0 L;  3F8T A;  1EY5 A;  1CZG A;  2ZJQ A;  2BH2 A;  3LGJ A;  2RVL A;  2Z6B A;  1O78 A;  1VQI A;  2E75 C;  4ME3 A;  4OIJ A;  1HUM A;  2YV5 A;  1LT5 D;  4KK7 A;  4V19 0;  4TRD A;  4XYO A;  4KV6 A;  2HD3 A;  4BS9 A;  1JQY D;  4NPS A;  1UAP A;  4OX9 L;  4CDF C;  3J7Y W;  4MNO A;  4ZCK A;  5KYL A;  4O0A A;  4R4I A;  1I6V C;  4DV0 Q;  1H9J A;  1YZ6 A;  2F0O A;  4ZUI A;  2CH4 A;  4EQO A;  3NWT A;  2YU9 H;  4Y52 H;  5JJI A;  2B2T C;  1F9P A;  1SLJ A;  3R8B A;  3K59 A;  4OGQ C;  4ME5 A;  4BY7 H;  4K5X A;  4BBR B;  3PO3 G;  4ZKB B;  4DUY L;  4UDU C;  1LV9 A;  5ELD A;  1PFM A;  1EFW A;  1B4O A;  5C0X H;  1GVP A;  1PFB A;  1ET9 A;  5EKK A;  1PV4 A;  3S1N H;  1J8I A;  2NVT H;  3HOY B;  5JEA J;  3M4P A;  2JYO A;  4KD4 A;  1PH9 A;  3OSO A;  4KHP Q;  1AEX A;  4OON A;  3PF4 A;  2CHB D;  1ENA A;  1K3R A;  2M2L A;  2VW9 A;  5GAE C;  5IYC G;  3KUP A;  3DEO A;  1X6O A;  1Y69 U;  5LMN Q;  2MNA A;  1DCZ A;  4LF8 Q;  4IUN A;  1RJT A;  4IZ8 A;  3DUZ A;  2XWJ B;  1Y8O B;  5LMU Q;  3KBX A;  4DAP A;  3EN2 A;  4KJN A;  3FVQ A;  3K7U C;  1N36 Q;  1A3U A;  3FMC A;  3RZD H;  2EYL A;  4IPG A; 
#chains in the Genus database with same CATH homology
 4HIM A;  4LF9 Q;  1G29 1;  3E9I A;  2VQF Q;  4TVA B;  4GOP A;  2R7D A;  4A3I G;  4K0K L;  2OQ0 A;  4B3S L;  3RN2 A;  1TWA H;  5FJ8 G;  1UE7 A;  5FJ8 H;  4R4Q A;  5DLQ E;  2Y0S E;  1WYD A;  5M5X H;  2OWO A;  4DR3 L;  3HKZ E;  1X9N A;  1C7Y A;  4B3M L;  5IYD G;  4GNX A;  4A3L H;  1KL9 A;  3BZC A;  1KQS A;  2UXD L;  2ZTE A;  3B6Y A;  1NY4 A;  3F1Z A;  4KLK A;  4YY3 Q;  1J5E L;  3CCL A;  3K8A A;  3GO5 A;  3KDF A;  4IOA A;  3TQY A;  3GTP H;  1YVC A;  3CCR A;  2CQO A;  2KCT A;  2E2J H;  4JCV E;  4POG A;  4DKA C;  1V9P A;  1Q7Y C;  3PF5 A;  1KRS A;  1JB7 A;  1WI5 A;  1HZA A;  3K81 C;  4DUZ Q;  4JOI C;  3JAM i;  1WCM G;  1WCM H;  2ZM6 Q;  4JC0 A;  2VUM H;  2NVX H;  4JI7 Q;  2VQE L;  4PZ7 A;  2QA4 A;  1HR0 Q;  3KOJ A;  2HHH Q;  3UDF A;  1UE6 A;  4UPA A;  1C0A A;  4DAM A;  5HY6 A;  4BBR G;  4BBR H;  2IX0 A;  3VDY A;  4K0K Q;  1N32 L;  4GS3 A;  4LF5 L;  4DPG A;  1CKM A;  1G51 A;  1FVI A;  4DR3 Q;  2WB1 E;  3H3V I;  5EAY A;  4IOC A;  4B3M Q;  1P8L A;  2K5H A;  4LUV A;  4DV6 L;  1VQO A;  1CSQ A;  4LFC L;  1J5E Q;  4HJ9 A;  1IYJ B;  3OW2 A;  3HOY H;  3HOY G;  1CKO A;  1W2B A;  4LF6 Q;  1VQJ A;  2D0P A;  1X3F A;  4JBJ A;  1MKH A;  4J15 A;  4P72 A;  3A74 A;  1S3O A;  1AE2 A;  3D0F A;  1NMF A;  1EQR A;  4NXN L;  1VQ7 A;  1VQ9 A;  2R7Z H;  2K5V A;  2YTX A;  4GN3 B;  3GTQ H;  2R7Z G;  3CCM A;  5LMN W;  1VQ5 A;  3M7N A;  2CKZ B;  1XNQ L;  3CCV A;  2A8V A;  2VQE Q;  5C4X G;  1L1O A;  5C4X H;  1E7Z A;  3CP0 A;  3S24 A;  4ALP A;  2IX1 A;  1LYL A;  1YNX A;  4DR5 L;  1NTG A;  2PQA B;  1PA6 A;  1VQN A;  2GN5 A;  4R4C A;  3RNU A;  4H02 A;  3H15 A;  1VQP A;  5J3B A;  2NZH A;  4PMW A;  2Z6K C;  4YHH Q;  1N9W A;  4OWT B;  2R7F A;  1EIY B;  2KBN A;  4LFC Q;  2AMC B;  1VQG A;  1MIU A;  1W3S A;  1Y1W H;  4OXP A;  1EQQ A;  4X65 L;  4LFA L;  2JEA I;  1T9H A;  1MJC A;  4JI2 Q;  3EBE A;  4DR2 Q;  1XMO Q;  4GKK L;  4HID A;  3G6E A;  4O2D A;  3HFZ B;  3NBH B;  2Z0S A;  3T1H L;  2QEX A;  2LSS A;  4EX5 A;  1GKH A;  5JEA G;  1B7Y B;  3W1B A;  4A3K H;  1X54 A;  3FHW A;  1XMQ L;  5C44 G;  2Q2U A;  5FLM G;  5FLM H;  2JJQ A;  2BH8 A;  3PUW A;  4GN5 A;  1JT8 A;  1BBU A;  2I5M X;  2E5L L;  1CSP A;  1BVS A;  3BJU A;  4DV2 L;  3TRZ A;  3I7F A;  3J7A 5;  3E9H A;  2JA7 G;  3TEH B;  2JA7 H;  5K36 G;  4A76 A;  4JI3 L;  1J6Q A;  3ULP A;  3HOU G;  2CFM A;  5E7N A;  2WFW A;  4IFD I;  2XGT A;  2HT1 A;  1HR0 W;  3E0E A;  5AJ3 L;  3OTO L;  4OO1 G;  1C9O A;  3PCO B;  2JA5 G;  3T1Y Q;  1Q8K A;  4KHZ A;  4X6A H;  2PNH A;  1WOC A;  1YHA A;  2FXQ A;  3L7Z C;  3GTG H;  4LFA Q;  4X65 Q;  5IWA L;  1GD7 A;  1EWI A;  4LWC A;  4UP7 A;  4AIM A;  4GKK Q;  3CPF A;  1OXU A;  3PUY A;  3CCS A;  2UXC L;  4R1J A;  1BBW A;  2ALY B;  1I94 L;  5H1S E;  4A4I A;  1QZG A;  2PI2 A;  1L2F A;  2A1A A;  4DK6 C;  1SN8 A;  1HNZ Q;  3CCQ A;  1QZH A;  2ZJR A;  2ZTC A;  2JA8 G;  2I5H A;  4JI4 L;  2F52 A;  2F3I A;  1PFS A;  3HOX H;  4A3G G;  3A5U A;  4A3G H;  4X62 L;  2MO1 A;  1PH6 A;  4DR7 L;  3W1G A;  3U4Z A;  1PH1 A;  4IFD G;  5IYB G;  5IYB H;  3F2C A;  4GOP C;  3RR5 A;  4JI3 Q;  2MO0 A;  4A3I H;  5GAG C;  2KCM A;  3JC6 6;  1KRT A;  3S2D H;  2OCE A;  5AJ3 Q;  3EIV A;  1X3E A;  3OTO Q;  1OTC A;  3CC7 A;  1X56 A;  4HJ7 A;  1KHI A;  1YHQ A;  3I4N G;  4HJA A;  5IYD H;  4GNX C;  4P73 A;  2C35 B;  4LF7 L;  1U5K A;  2L15 A;  1E3P A;  3G71 A;  4LF4 Q;  3S17 H;  5GQO A;  4P71 A;  4IFD J;  2NVY H;  4DK3 C;  2UXC Q;  3J81 j;  2VZA A;  1Y1V G;  4EQ5 A;  4JI1 L;  4JI8 L;  4A3B G;  1CKN A;  4A3B H;  2B63 G;  2B63 H;  4JBK A;  4R4T A;  1SRU A;  3CC4 A;  1FJG L;  3CPW A;  4DV4 L;  1OXS C;  4QL5 A;  4C3I H;  3J7Z C;  1VQC A;  1VQ4 A;  4GOP B;  2YYZ A;  4X62 Q;  1QUQ A;  3M4Q A;  3RLF A;  3CCJ A;  1XNR L;  1P16 A;  4DR7 Q;  1QVC A;  4IPH A;  4B3R L;  1TWF H;  2DUD A;  2VL6 A;  4L5T A;  2H5X A;  2CWP A;  3FKI H;  3FKI G;  2WAQ G;  4BY1 G;  4B3S Q;  4BY1 H;  2HIX A;  4A75 A;  1PH2 A;  3TS2 A;  1A8V A;  3KLW A;  2RHQ B;  3U4V A;  4GNX B;  3S14 H;  3M9B A;  4YWK A;  4AQY L;  1S40 A;  1S72 A;  2IT1 A;  5IP9 G;  1UE5 A;  5IP7 H;  5IP9 H;  5IP7 G;  5C3E G;  5C3E H;  3J80 c;  3I55 A;  1YJN A;  1Q81 C;  2YTY A;  1A62 A;  1E1O A;  3KDF B;  4LF7 Q;  4P75 A;  3GTL H;  2UXD Q;  4PG3 A;  3RZO H;  4JOI A;  2EIF A;  2N49 A;  4NB3 A;  4XIG S;  3BU2 A;  1D8L A;  1BKB A;  1IL2 A;  4A3M G;  3HOW G;  3HOW H;  5M3M G;  3U50 C;  1H95 A;  3L0O A;  3AYH B;  4JI1 Q;  2UU9 L;  4GLV B;  4QY7 A;  3K0X A;  2EXD A;  4OWX B;  3K7A H;  1RL2 A;  4IJL A;  5ELO A;  1TWH H;  3CQZ H;  4LUZ A;  3CF5 A;  4IO9 A;  1FJG Q;  1TWG H;  3F2D A;  2KEN A;  4C3H H;  2A19 A;  3ER0 A;  3GDE A;  1VQF A;  3UE0 A;  3ULL A;  5M5Y H;  4HIK A;  4JYA L;  1VQK A;  1K8A C;  2E2I H;  3CD6 A;  1V1Q A;  4L5Q A;  2XTI A;  1N32 Q;  2N8N A;  1HNX L;  4LF5 Q;  3H3V H;  2UXB L;  3NEL A;  2IHE A;  4AQY Q;  1Q12 A;  4DR4 L;  1UWV A;  1X65 A;  3M85 A;  1Z9F A;  2YTV A;  1VQB A;  1RIP A;  4DV6 Q;  4L5S A;  2F4V L;  1JJC B;  3OYY A;  4DV1 L;  2UUB L;  3CCU A;  2JE6 I;  1PH7 A;  3CME A;  4AYB G;  3S15 H;  1NE3 A;  1GM5 A;  1PYB A;  3Q8D A;  3NEN A;  4DV7 L;  2UUA L;  1SRO A;  2UU9 Q;  4KI0 A;  2WAQ E;  1G6P A;  2BA1 A;  1HNW L;  1NMG A;  4NXN Q;  3ERS X;  3GTO H;  5JJL A;  1YIJ A;  2K4K A;  4P74 A;  1L1O B;  2MFI A;  1IBK L;  5C44 H;  2OTL A;  5C0X I;  3TS0 A;  1FL0 A;  3CXC A;  1PHJ A;  1XNQ Q;  1CUK A;  3GTJ H;  4X66 L;  1XJV A;  2LXK A;  4DV3 L;  1YIT A;  2UUC L;  3CC2 A;  3NEM A;  4RG1 A;  1VQM A;  2E2H H;  1K83 H;  2K52 A;  2Q2H A;  4DR5 Q;  2IHF A;  3KJO A;  4YCU A;  5IY0 A;  1HH2 P;  1IBL L;  4NXM L;  1GO3 E;  3KF6 A;  4YCV A;  1E1T A;  5ELN A;  3PIP A;  3DLL A;  3AQQ A;  1HNX Q;  3HOU H;  4LF8 L;  3CCE A;  1LUZ A;  1WFQ A;  4C3J H;  3DM3 A;  4R4O A;  2JA5 H;  1EYG A;  1SFO H;  5BR8 L;  1EUJ A;  1HZ9 A;  1UE1 A;  1XPU A;  1VQD A;  2F4V Q;  5GRO A;  4DV1 Q;  2Y0S G;  3IRB A;  2I5L X;  3UDG A;  3HKZ G;  4JBW A;  1N34 L;  2HIV A;  3RLN A;  4Y7N H;  4POF A;  2GVB A;  4YCW A;  3T1H Q;  2UUA Q;  4BBS G;  5C0X G;  4IPC A;  1XMQ Q;  2ID0 A;  1IBK Q;  3WWV A;  3CAM A;  4UP9 A;  2JA8 H;  2AWN A;  4X66 Q;  4JG2 A;  1VQH A;  3H0G G;  3H0G H;  4JBM A;  1XPR A;  2ATW A;  2E5L Q;  2UUC Q;  1JJG A;  2K75 A;  1E24 A;  4DV2 Q;  4HIO A;  1YJ9 A;  4X64 L;  4A3D G;  4A3D H;  3TRE A;  4DR6 L;  3BZK A;  2HQL A;  1IBM L;  4LUO A;  1Q86 C;  3D31 A;  4MTN A;  5C0X J;  1IBL Q;  1ASZ A;  4UY8 C;  2BA0 A;  3K80 C;  1B70 B;  3J80 i;  4QQB X;  3PO2 G;  4JI5 L;  3PO2 H;  3HOV G;  3HOV H;  3S16 H;  4LFB L;  4A3J G;  1YHB A;  1SR3 A;  3I4N H;  2JEB I;  4YWM A;  3I4M G;  3I4M H;  1JMC A;  1PYS B;  2PMZ E;  4PZ8 A;  5GAH C;  4DNI A;  1M90 C;  1N33 L;  1Y14 B;  4DUZ L;  4WJ4 A;  5IWA Q;  2ZM6 L;  2WB1 G;  2RF4 A;  3ICE A;  2KHJ A;  3STB C;  5GAD C;  1I94 Q;  1Y1V H;  1HR0 L;  1XPO A;  2HHH L;  4XTC S;  3AFP A;  4RMF A;  1YBY A;  1K0R A;  2CWA A;  3AFQ A;  4A3F G;  4A3F H;  2ZTD A;  4IJH A;  1KC8 C;  2OTJ A;  1Q82 C;  4JI4 Q;  2NN6 I;  3UDI A;  4BA2 I;  1XTD A;  3AEV A;  1TWC H;  4L5R C;  1JJ2 A;  4QJF A;  4X64 Q;  1PH3 A;  1MJE A;  3HOZ G;  2DGY A;  3HOZ H;  4A3C G;  4DR6 Q;  4A3C H;  2RCN A;  1IBM Q;  4A3L G;  1VS0 A;  1Q1B A;  2AWO A;  1EIF A;  1Q46 A;  1VQ6 A;  3M3Y H;  3M4O H;  4GKJ L;  3GTK H;  2NVQ H;  4JI5 Q;  4LFB Q;  2VY3 A;  1O7I A;  2D0O A;  4QGU A;  4LF6 L;  3S1Q H;  1VQE A;  3A0J A;  1VQ8 A;  1AE3 A;  3CW2 C;  1KAW A;  2B29 A;  3L2P A;  5HGQ A;  1I6H H;  4A3E G;  4A3E H;  4QIW E;  1N33 Q;  1SE8 A;  4A93 G;  4A93 H;  3RLO A;  4DV5 L;  3J81 i;  2ZJP A;  4GLX A;  4LNQ A;  3HKS A;  2VUM G;  3S1R H;  1CKN B;  1AH9 A;  3PUV A;  4A3M H;  5M3M H;  1UEB A;  1OXT A;  4JI8 Q;  2OQK A;  1QVF A;  1OXV A;  4C2M H;  1IXR A;  2NN6 G;  3G4S A;  5IE8 A;  1PH4 A;  1M1K C;  4GLA C;  2I0Q A;  2K50 A;  1KD1 C;  1K9M C;  3UDX A;  4TQU S;  3KYH C;  1QUQ B;  3MEF A;  4AH6 A;  1R9T H;  4DV4 Q;  2CCZ A;  1EOV A;  2N78 A;  1L0W A;  2PQA A;  3I56 A;  1L1O C;  1KIX A;  2R6G A;  2JA6 G;  1X3G A;  4JI0 L;  1PH5 A;  2JA6 H;  4YHH L;  3F8T A;  4DV0 L;  1XNR Q;  1D7Q A;  3PIO A;  1VQL A;  3GTM H;  4B3R Q;  2ZJQ A;  2N3S A;  2BH2 A;  4GKJ Q;  1HJP A;  5JJK A;  4JI6 L;  3LGJ A;  4YWL A;  4DR2 L;  1XMO L;  4JI2 L;  2QGQ A;  4B3T L;  1VQI A;  1K73 C;  1I3Q H;  4ME3 A;  1NBW A;  3STB D;  4PZ6 A;  4WJ3 M;  4GN4 B;  2B3G A;  2YV5 A;  4DR1 L;  1LTL A;  4DV5 Q;  1VCI A;  1OXX K;  2JQO A;  4UP8 A;  1X55 A;  3I2Z A;  2E8G A;  1I50 H;  2GVA A;  4NPS A;  2Q2T A;  3KF8 B;  3JAM c;  3J81 c;  4IPD A;  4DAY B;  1FGU A;  3MXN B;  1Z47 A;  1WJJ A;  4OX9 L;  2JA9 A;  2ASB A;  4MNO A;  3CMA A;  1PH8 A;  1YI2 A;  1HZC A;  4O0A A;  1V43 A;  3SGI A;  1JE5 A;  4R4I A;  4JI0 Q;  4JYA Q;  4KHP L;  4DV0 Q;  2Z6K A;  1YZ6 A;  2AHO B;  3T1Y L;  3U58 A;  4APV A;  4OWW B;  1Y1W G;  4OO1 I;  1QVG A;  2YU9 H;  3UE1 A;  4JI6 Q;  4Y52 H;  5JJI A;  1B8A A;  2ES2 A;  3PV0 A;  2UXB Q;  5LMN L;  2NZO A;  1SLJ A;  2K5N A;  4B3T Q;  1U0L A;  4BY7 G;  4BY7 H;  4DR4 Q;  2R92 G;  2R92 H;  2AKW B;  4HJ8 A;  3PO3 G;  3KFU A;  1DGS A;  2MQH A;  4A3K G;  2KHI A;  1Q1E A;  5LMU L;  3PO3 H;  1SMX A;  1HNZ L;  1ASY A;  4DR1 Q;  4DUY L;  2UUB Q;  2RHS B;  4JV5 L;  4BA1 I;  1N36 L;  3S2H H;  4MZ9 A;  1LM0 A;  3PUX A;  1EFW A;  2IY5 B;  2K14 A;  2D62 A;  3A5Z B;  4DV7 Q;  4FDB A;  4BBS H;  1GVP A;  3RN5 A;  1HNW Q;  4OX9 Q;  4LF9 L;  5C4J H;  2VQF L;  1PV4 A;  3S1N H;  2NVT H;  3FP9 A;  5JEA J;  2Q2I A;  3M4P A;  3PSI A;  3ZJY C;  1N8R C;  4DV3 Q;  1PH9 A;  1PVO A;  4KHP Q;  3F2B A;  4OON A;  4AYB E;  3PF4 A;  3KF6 B;  4BXX G;  4BXX H;  1YEZ A;  1K3R A;  2VW9 A;  3PUZ A;  5IYC G;  3PGZ A;  5IYC H;  3GD7 A;  5GAE C;  1KXL A;  3KJP A;  4NXM Q;  4LF4 L;  1X6O A;  4YY3 L;  5IT9 c;  2WP8 J;  5LMN Q;  2VS1 A;  5FLX c;  2MNA A;  1YJW A;  4LF8 Q;  2VNU D;  1A63 A;  4A3J H;  1I5F A;  1K8G A;  1A0I A;  5M3F G;  5M3F H;  2JK8 A;  5BR8 Q;  2LXJ A;  2V1C C;  5LMU Q;  1IZ6 A;  1TXY A;  1VQA A;  2PI2 E;  3EN2 A;  3I4O A;  3ULJ A;  4LW1 A;  3W5O A;  4DUY Q;  3K7U C;  4HJ5 A;  1E22 A;  1NJI C;  1N36 Q;  4JV5 Q;  1HZB A;  2R93 G;  1N34 Q;  2R93 H;  5M5W H;  4JI7 L;  3G48 A;  3HOX G;  3RZD H;  4IPG A;  3S1M H;  2EQS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...