1N36Q

Structure of the thermus thermophilus 30s ribosomal subunit in the presence of crystallographically disordered codon and near-cognate transfer rna anticodon stem-loop mismatched at the second codon position
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
molecule tags Ribosome
total genus 18
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1n36Q00
2AWNA 1EOVA 5DLQE 1G6PA 5ELNA 4DKAC 2QA4A 5M5YH 1B8AA 3ULLA 3J80c 3AFPA 4DR5L 1KC8C 3TREA 4DNIA 1NBWA 2LXJA 3T1HL 1HR0L 4JYAL 3G6EA 5M3FH 3CCMA 1PH6A 1VQNA 1KQSA 2R92H 2OTJA 4FDBA 4LF8Q 2VUMH 3S14H 3HKSA 1LM0A 2I0QA 2ZTDA 4DR3Q 2HIVA 3FP9A 4DR4Q 1AH9A 1XJVA 1UE5A 4HJ5A 4KHPL 3K0XA 4A3LG 2YTXA 3K80C 2ZM6L 4UP8A 1YZ6A 4JI2Q 1I3QH 1AE2A 2K75A 1HR0W 1GKHA 4A3EG 1TWAH 3PIOA 4QQBX 2KCTA 2CQOA 1VQBA 1V9PA 2WAQG 5GQOA 4LNQA 1L1OB 3PF4A 4AQYL 5M3MG 3I4NG 1O7IA 2UXBQ 4BY7G 1I6HH 1X6OA 2OWOA 4A93H 5IWAL 3GTOH 1K9MC 1VQGA 4ALPA 2XGTA 1YNXA 1I5FA 1WYDA 1SRUA 1YVCA 2K5NA 2N3SA 1HZBA 1T9HA 2IX0A 1IBKQ 3U58A 2NVTH 1KRTA 1PH8A 2Z6KA 3M7NA 1QUQB 3L7ZC 4JI3Q 4DV4L 3T1YL 3I4MG 2N78A 3S1QH 2HT1A 2OCEA 3M4PA 4GNXA 4IFDI 1VQIA 3PIPA 1UE6A 2HHHQ 4UP7A 4NB3A 2D0OA 2YTYA 1VQ7A 2VQFL 1WCMG 1H95A 1HNXQ 2DGYA 3PUWA 4YHHL 2ZJPA 5M3FG 1Y1VH 4KI0A 1SMXA 2JA8G 4WJ3M 5IYBG 1G291 1AE3A 2ID0A 4LUVA 3CCVA 2IX1A 3CPFA 1QVFA 2PQAB 4P71A 3CCJA 2VS1A 4XTCS 4GKJL 2F3IA 4DAMA 3UDFA 4Y7NH 5LMNL 4DV7L 3GTQH 4LF6Q 4LFAQ 1B70B 3I56A 1PH4A 1HZCA 4P72A 1HNZL 1FJGQ 4QGUA 4B3TL 3WWVA 3J80i 2HIXA 2MFIA 1X56A 3ICEA 5LMUQ 4A3JG 1OXXK 5HY6A 4PMWA 3G71A 1JJGA 3K8AA 4X64Q 4DV6Q 4PG3A 2RF4A 1MJCA 4A3FH 2NVXH 1KRSA 1NMGA 1UE7A 3JAMi 1YI2A 4LF7Q 1TWHH 4GOPB 4GLAC 4AYBE 4HJAA 2B63H 5M5WH 4Y52H 1FL0A 1G51A 1IBLQ 3I4OA 4DV2Q 4YCVA 4GLVB 2WFWA 4DUZQ 1JB7A 1HJPA 1MKHA 4R4CA 4RG1A 3A0JA 3J81i 1NE3A 5IP9G 2R93H 3CMAA 2E5LQ 4DV0Q 4XIGS 3GTPH 3AYHB 4DAYB 2D62A 1VQFA 4A4IA 5C4JH 1MJEA 1N36Q 2VL6A 1VQLA 3PUVA 5IP7G 3PUYA 5JJIA 1VQAA 2C35B 1UEBA 3KF8B 3K7AH 4JI6Q 1NJIC 4L5SA 5JJLA 3PO3G 3A74A 2UUBQ 5E7NA 4DPGA 1XMQQ 3TS0A 2GVBA 2I5HA 4R4OA 3GD7A 4LF9L 2V1CC 4IPDA 4HIKA 3GTGH 1IZ6A 2VW9A 4OX9L 3ULJA 2JA9A 1S40A 1EIYB 1E22A 4DR1L 4JI5L 3FKIH 4DV1L 4DR2L 1CSQA 5C0XG 4JV5Q 4BY1G 5BR8L 4A3LH 3PUXA 4JBMA 1PA6A 4UY8C 1YHBA 2Y0SG 3W1GA 4IPCA 1J5EL 1PHJA 1Q86C 1X3GA 3IRBA 3S17H 4A3EH 4A3FG 3AFQA 5C44G 5M3MH 3I4NH 4B3MQ 4JI7L 4BY7H 3DLLA 4HJ9A 4A3IG 3GDEA 1YITA 3HOYG 3B6YA 4EX5A 2ASBA 4IOAA 4APVA 1N32L 2E2HH 4IOCA 3KJPA 3KLWA 1XMOQ 4QL5A 3CCSA 5ELOA 1XNRL 4DV5L 4JYAQ 3L2PA 4GKKQ 3G4SA 3H0GH 4X62Q 4LUZA 2F4VL 4LF4Q 2ES2A 1Q12A 4NXNQ 3I4MH 1VQKA 3G48A 4K0KQ 3HKZG 3STBC 4X6AH 4TQUS 1WFQA 4OONA 4B3SQ 2MNAA 4JOIA 3KJOA 3GO5A 2Z0SA 2N8NA 1WCMH 2ZM6Q 2K5VA 3CXCA 1YHQA 4LF5L 4BXXG 2YU9H 2JA8H 1U0LA 2L15A 5IYBH 1RIPA 1L1OC 1K8AC 3AEVA 3FKIG 2KENA 4JI1Q 2UU9L 2UXCQ 3GTMH 4B3RQ 1RL2A 3LGJA 4LFCL 1M1KC 3OYYA 1A0IA 2BA1A 4KHZA 2R7ZG 2VQEQ 3TS2A 4DR6L 3RLNA 1OXSC 1XNQQ 2UUCL 4R1JA 1PVOA 3MXNB 3RZDH 3S1NH 4A3JH 2AMCB 3UE0A 2IT1A 1QZHA 3PCOB 1VQOA 3HOUG 3D31A 3HOXG 3K81C 4O2DA 1X9NA 1FGUA 2NZOA 4MTNA 3CCEA 2JA6G 2E8GA 3HOWH 3HOVG 3OTOL 1PH5A 1Q82C 4HIOA 3HOZH 1GVPA 1WI5A 3EN2A 3ERSX 4R4IA 3H0GG 1TWFH 4JI8L 3DM3A 3CF5A 1PH7A 3NELA 5K36G 1OXTA 2WB1G 3CAMA 1LYLA 3J7ZC 5IP9H 4DUYL 1CKNA 4OO1G 5JJKA 1YJWA 3M3YH 4DR4L 1SROA 4EQ5A 3CC4A 1C7YA 1E1TA 1Z47A 3S2HH 1GO3E 1VQEA 1BBUA 4DK6C 4GKJQ 5IP7H 3CMEA 3RLOA 4GN4B 4JI2L 1EYGA 1VQ9A 1XPOA 4WJ4A 2R6GA 1N34L 3PO3H 1IBMQ 2KHJA 3NENA 1EWIA 2YV5A 2AHOB 2UXBL 2H5XA 4X65Q 1EQRA 3KDFA 1NY4A 1KD1C 3BU2A 4BA1I 2Q2UA 4NXML 1B7YB 2K4KA 4GOPC 2EIFA 2WAQE 2YYZA 1GM5A 2UUAQ 4BY1H 1V43A 4JI0Q 3F1ZA 3RZOH 5C0XJ 4YY3Q 2K52A 4PZ8A 1VS0A 3PV0A 4MZ9A 3W5OA 4X66L 3S16H 2CWAA 5H1SE 5C0XI 3F2DA 5C44H 5IE8A 2NN6G 2RHSB 3KF6A 2OTLA 3HOZG 2HHHL 2IHFA 1X3FA 1N33L 1YBYA 4L5TA 3SGIA 4POFA 4A3IH 3HOYH 2PNHA 3I55A 4BA2I 4DR7L 1YEZA 1WJJA 2ZJQA 5GROA 3ER0A 1HNXL 2B29A 2HQLA 2YTVA 1V1QA 1PH9A 3E0EA 2KHIA 1EFWA 5C4XG 3RR5A 2JA5G 4OXPA 1XPRA 1PYBA 1Q8KA 4DV3Q 2E2IH 3PUZA 4QIWE 1IL2A 1XPUA 2AKWB 1QZGA 2CKZB 4LF6L 5C3EH 5IYCG 4LFAL 4DV1Q 4DR2Q 1KIXA 3HFZB 4QY7A 4YWLA 1JE5A 3I7FA 5FLXc 4C3HH 3NBHB 1U5KA 1KHIA 1Y1WG 4BXXH 3S15H 2VZAA 5GAHC 1J5EQ 4A3DG 4X64L 4DV6L 1JJ2A 2IHEA 5FJ8G 2JEAI 2NZHA 4PZ6A 4A3MG 1YJNA 3I2ZA 3U50C 4LF7L 3J7A5 4IPGA 4KLKA 4LW1A 2OQKA 1L1OA 4O0AA 1IBLL 3UDIA 4LFBQ 3BZKA 3M9BA 4DV2L 4JI7Q 4L5RC 4TVAB 2I5MX 2R7ZH 3EBEA 3PF5A 1I94Q 1HNWQ 1CSPA 4R4QA 4DUZL 3PGZA 2GN5A 1BBWA 4L5QA 2BH2A 4C3JH 4JI4L 4GNXB 1XNRQ 1NTGA 3KFUA 4DV0L 4GLXA 2LSSA 1TWCH 4C2MH 3VDYA 1N9WA 1D8LA 1QUQA 1N36L 3HOUH 3HOXH 4OWWB 3HOVH 2JA6H 4DR5Q 1IYJB 1HR0Q 3T1HQ 3BJUA 4YWMA 5AJ3L 1PYSB 4A3CG 2KBNA 4PZ7A 4BBRG 1K73C 1PFSA 1LTLA 1Q1EA 4JBKA 1XMQL 2JQOA 1X54A 2Q2HA 3CC2A 4A75A 1VQJA 1R9TH 3TEHB 3CQZH 1E7ZA 3K7UC 1SN8A 4GN5A 3UDXA 5FLMG 5C3EG 4C3IH 1E24A 1WOCA 1Y14B 1JJCB 4KHPQ 3RLFA 3J81j 1VQPA 4OO1I 1IXRA 5GADC 3RN5A 1ASZA 2CWPA 1MIUA 2UUCQ 2A8VA 2MO1A 1L2FA 2D0PA 3KF6B 4DK3C 2Y0SE 3EIVA 3S1MH 1TWGH 1LUZA 3W1BA 4AQYQ 4B3ML 1P16A 1W2BA 2ALYB 4GS3A 1CKOA 4ME3A 1M90C 2JA7G 3STBD 5IWAQ 1SR3A 2PI2E 3KYHC 2VY3A 3FHWA 5IYDG 1X3EA 1XMOL 4A3GG 3RNUA 1OXVA 1SLJA 1CUKA 3OTOQ 4GOPA 4IO9A 4GKKL 2K5HA 4X62L 4A3BG 1UWVA 3JAMc 1VQ6A 1C9OA 4LF4L 3D0FA 4JI8Q 4NXNL 2F52A 1Q81C 1VQCA 2VNUD 4DV4Q 4MNOA 3T1YQ 4K0KL 4UPAA 4DUYQ 1PH2A 4BBSG 4OWTB 1TXYA 4B3SL 2JK8A 2N49A 2LXKA 3J81c 1HH2P 4AH6A 3MEFA 4LF8L 2VQFQ 1K0RA 3HKZE 1QVGA 1YIJA 2MO0A 3A5UA 3PO2G 2NN6I 4YHHQ 4POGA 4R4TA 1L0WA 4DR3L 3S2DH 1JT8A 5C4XH 4JI1L 1N34Q 2ZTCA 3ULPA 2JA5H 4P74A 2UXCL 3RN2A 4B3RL 1VCIA 5J3BA 2I5LX 3KOJA 3S1RH 4NXMQ 3CD6A 2OQ0A 2VQEL 1S72A 2A1AA 5LMNQ 4DV7Q 1XNQL 3M4QA 5IYCH 1PV4A 5EAYA 1HNZQ 1EUJA 4B3TQ 1Y1WH 4IFDJ 4AYBG 2JEBI 4RMFA 2UXDQ 1GD7A 2E2JH 2AWOA 4A3DH 2IY5B 4IPHA 2PI2A 5FJ8H 4X66Q 2QEXA 4A3MH 1X55A 1N8RC 4YWKA 2E5LL 4A3KH 5IT9c 1HZ9A 2EQSA 4JOIC 5HGQA 1IBKL 4IJHA 4OWXB 1Q46A 4QJFA 1UE1A 3Q8DA 2QGQA 3NEMA 2EXDA 4LWCA 4YCUA 3S24A 2Q2TA 1N33Q 2R92G 5M5XH 4A76A 4DR7Q 4JI3L 1K83H 2VUMG 4P73A 1A62A 3H15A 3PSIA 3F2CA 4H02A 3GTJH 1PH1A 3H3VH 3HOWG 1BVSA 3E9IA 5IY0A 1EIFA 1NMFA 2K14A 4HJ8A 1X65A 2WB1E 3A5ZB 4JC0A 1OTCA 3CP0A 2ZJRA 2NVQH 2CCZA 1QVCA 3CC7A 3H3VI 3GTLH 2PMZE 3CPWA 4A3CH 2BH8A 4BBRH 3CCQA 4IJLA 1K3RA 1IBML 1W3SA 1VQMA 1DGSA 4LF9Q 2CFMA 4X65L 2KCMA 3GTKH 2RCNA 4JBJA 3TRZA 4P75A 1EQQA 4A93G 4OX9Q 3OW2A 3E9HA 4DR1Q 2UUAL 4JI5Q 5FLMH 2RHQB 1A63A 2NVYH 2FXQA 2JE6I 1VQ4A 5BR8Q 1SFOH 2Z6KC 4JI0L 1A8VA 2DUDA 1FJGL 4YY3L 4IFDG 5LMUL 1K8GA 4GNXC 3U4ZA 1S3OA 3F2BA 3ZJYC 4JI4Q 3CW2C 5LMNW 5JEAJ 4A3KG 4HIMA 1ASYA 2R7DA 1VQDA 3JC66 1CKMA 1OXUA 2BA0A 4UP9A 2JA7H 1N32Q 1FVIA 3CCLA 5GAEC 4A3GH 5IYDH 1CKNB 5AJ3Q 2R7FA 1Q7YC 4DV5Q 1VQ5A 1Y1VG 3M85A 4A3BH 1KAWA 1SE8A 4DV3L 2F4VQ 3BZCA 1E3PA 1YHAA 1XTDA 2K50A 3L0OA 1P8LA 1PH3A 2ZTEA 2B3GA 4BBSH 4JI6L 3UDGA 4LUOA 1VQ8A 3AQQA 3UE1A 2UUBL 1Q1BA 4JCVE 4LF5Q 2WP8J 4AIMA 4JBWA 1VQHA 3KDFB 4HIDA 3PO2H 5GAGC 2GVAA 1D7QA 2MQHA 4YCWA 3CCUA 4HJ7A 1Z9FA 1KXLA 2UU9Q 2UXDL 1JMCA 4J15A 2B63G 4JV5L 1E1OA 2JJQA 4LFBL 4GN3B 2PQAA 4LFCQ 2A19A 1J6QA 1I94L 1HNWL 1YJ9A 4DR6Q 2XTIA 3M4OH 4JG2A 1KL9A 1BKBA 2ATWA 4NPSA 3TQYA 1I50H 2Q2IA 5JEAG 1HZAA 3F8TA 3CCRA 2R93G 3U4VA 1C0AA
chains in the Genus database with same CATH superfamily
2JA7B 1EOVA 1C4QA 5M5YH 4S3SA 5JJKA 1ET9A 3AFPA 4DR5L 1HUNA 3CCMA 1EZ8A 2R92H 4FDBA 3S14H 2I0QA 2ZTDA 2EJMA 4ODGA 5FOBB 3FP9A 2BDNA 2QDBA 1JWUD 3VR5A 4UP8A 1TVXA 2NYZD 4JI2Q 1AE2A 2K75A 1GOZA 4U673 4A3EG 3PIOA 1EQTA 4QQBX 2CQOA 1VQBA 1V9PA 2WAQG 1L1OB 3M4OB 4A93H 1PRTB 4G4KA 1EU3A 4ALPA 4OGQC 1I5FA 2E5LQ 1SRUA 1U4MA 3C1FA 2E74C 1UAPA 1PH8A 2Z6KA 5EKKA 5IT9E 1GXDC 2N78A 2HT1A 2OCEA 2PYKA 3M4PA 4IFDI 1BCPB 3PIPA 1DOLA 1STBA 4KD4A 5D14A 3JAML 1I4RA 3NSWA 4NB3A 2YTYA 4HTHA 2IWHA 4KN4C 1H95A 2DGYA 4DXFA 2ZJPA 2Z4HA 1SMXA 5IYBG 1G291 2IX1A 4IUTA 3CPFA 1QVFA 1JB3A 3CCJA 4XTCS 4KTAA 1GHKA 4ZKCB 2F3IA 1PXUA 1EY7A 1F77A 4DAMA 1QILA 2B39A 1PH4A 3RZDB 3S1NB 1W6KA 4QGUA 2MFIA 3GTOB 2SOBA 4FXGC 5JVH3 1WD0A 1IL8A 4PG3A 1MJCA 5FLXE 4A3FH 2NVXH 2PNRC 3JAMi 3HOWG 2JXMB 1GJXA 2B63H 4AYBE 4HJAA 3D4WA 2L0CA 3I4OA 4HR7B 2HCIA 2WFWA 4X3SA 4DUZQ 1JB7A 4ME5A 3E6ZX 4R4CA 1NE3A 3VYUA 5KYIA 4XIGS 3GTPH 3AYHB 2D62A 4IURA 4FXDA 4EVOA 3PUVA 4ZK9B 3PUYA 1VQAA 4JI6Q 5JJLA 4I7ZC 4ZLTF 5E7NA 1XMQQ 2AQ3B 4LF9L 3W2DA 3WOEA 1IZ6A 2X69A 2VW9A 1E22A 2DY8A 3FKIH 2EY1A 4JV5Q 2Y0SB 5BR8L 1CK1A 2F0KA 2F4IA 1SYCA 1QNUA 3S17H 5M5WB 5C44G 1TR5A 2DJGC 1U9RA 4JI7L 3BZDB 1LTRD 3K5NA 2A69C 2ASBA 2R93B 4IOCA 4QL5A 3CCSA 5ELOA 1XNRL 1SYDA 4JYAQ 5ISRA 4GKKQ 3G4SA 1AP0A 3NBIA 3K7AB 3HKZG 3MZ5A 4X6AH 3BDLA 2ICEC 4OONA 4ULLA 4JOIA 3GTGB 2Z0SA 4BXXG 1JC7A 1STAA 3J81E 3TDQA 1RIPA 2KENA 2Q8TA 3LGJA 5LHY1 4QF4A 1DD2A 2BA1A 4KHZA 2R7ZG 1X3PA 2GA4B 3GV3A 1OXSC 1SYGA 4XXEA 5M3MB 3S9WA 3PQIA 4ZCKA 3I4NB 1MGSA 2A68D 4BY7B 1V1PA 2XVSA 4A3JH 5KNCA 2O4XA 1VQOA 3QIAA 4O2DA 3HOVG 1FGUA 1CI3M 4OEMB 3CCEA 1VMCA 2E8GA 1PH5A 3H0GB 3HOZH 1W6JA 3EN2A 2KECA 4XQJA 2Z8LA 2PO4A 3KBGA 3J7ZC 3EROA 1B3AA 5IP9H 4DUYL 1LTSD 1EEID 3HEJA 4RGOS 1WCMB 3CC4A 1E1TA 1PTOD 3A54A 2JA8B 2EY2A 4GKJQ 1UEAB 5IP7H 1RTNA 3RLOA 4GN4B 4JI2L 1EYGA 1VQ9A 1IBMQ 2OEOA 2SNMA 2PPBC 4K2LA 1EFID 3KDFA 1Y69U 4BA1I 2Q2UA 2Z1CA 2WAQE 1GM5A 2UUAQ 4JI0Q 1TS3A 3RZOH 1R4QB 4YY3Q 3K5MA 3PV0A 4MZ9A 3W5OA 1G2SA 4EQPA 2CWAA 5H1SE 5C0XI 3F2DA 3MVVA 2NN6G 5EBCA 2IHFA 4BA2I 1YBYA 3TZDA 3SGIA 3HOYH 3I55A 3A8KE 3OMCA 3PIO3 2ZJQA 3MTSA 4DU9A 3ER0A 2O5IC 3M3YB 2HQLA 4RHRA 1FYCA 1KNEA 2MP1A 1PH9A 3IFTA 3E0EA 3NE5B 1EIGA 1GUTA 2JA5G 1PYBA 1EOTA 1BXTA 2EZVA 5ELCA 1JOKA 3PO3B 2ICIA 3ND9A 5C3EH 4DV1Q 4DR2Q 1KIXA 5FK9C 2E2JB 2WKDA 2VXWA 4C3HH 3PIP3 4A3MB 2J7ZA 5FJ8G 4BY1B 3HG9A 1JOQA 3I2ZA 3J7A5 1LTID 4F7XA 4R9WA 3UDIA 1K83B 4TVAB 1HNWQ 4CDEC 1CSPA 4R4QA 4DUZL 2ZT9C 2EYJA 4RGMA 3KFUA 1TWCH 4V190 1Q3LA 4C2MH 3T51B 2B2WA 1QUQA 3HOXH 2M9VA 1AN8A 1HR0Q 4DN4M 1H9JA 2LKVA 1PZID 3BVGA 3ONAB 1XMQL 1T5XD 1X54A 4KKSA 1PFBA 2RDFA 3ND8A 1R9TH 3WOFA 3FEWX 3CQZH 2B2YA 3K7UC 1CA5A 2K5QA 1E24A 3TP8A 1B9NA 1VQPA 4C56C 4OO1I 4J1MA 3RN5A 2K1BA 2HCCA 1L2FA 3EIVA 1LUZA 3BDOA 3W1BA 1X32A 5FO7B 1SNCA 3STBD 1WD1A 3KYHC 4A3GG 1X3EA 4GOPA 4GKKL 2K5HA 4ZQ3A 5I2XA 3JAMc 1C8CA 1VQ6A 5IOCA 1IKMA 4BBSB 3T1YQ 4KV6A 1E2ZA 1K8MA 1LT6D 3L9AX 1ZYRD 2H4OA 2JK8A 3R2TA 2N49A 2LXKA 1HH2P 4DAYA 2WINB 3P7JA 4XT1B 1R4PB 3HKZE 1QVGA 3A7AB 2AQ2B 3A5UA 4POGA 4R4TA 4DR3L 3D6WA 4UAIA 1JT8A 2ZTCA 4K8IA 3SK4A 1H9MA 4P74A 4C3IG 4G7HC 4KY7A 2F0EA 2F0MA 2I5LX 3EA6A 4NXMQ 3I3CA 1ZEQX 2P5ZX 1E2WA 1S72A 4DV7Q 4I7AA 4K6DA 2F0UA 4B3TQ 1Y1WH 4IFDJ 1MI2A 2JEBI 3P20A 4X66Q 2I07B 1N8RC 4YWKA 3CRLC 1EIHA 2EQSA 2QDLA 3DM1A 2VUMB 3V2TA 1O7LA 2EXDA 2R92G 4JI3L 4P73A 4H02A 1PH1A 3H3VH 3E9IA 1EIFA 3T13A 2F3VA 2K14A 4XT3B 4DGZA 1X65A 4JC0A 1OTCA 3CP0A 3I90A 1ENFA 2EPBA 3SK5A 3CPWA 2BH8A 2AQ1B 4IJLA 1IBML 1VQMA 2F0TA 2Q8RE 1NNXA 4A93G 5CV5A 5J22A 1JWMD 3EFXD 2UUAL 2QILA 5FLMH 5COYA 2NVYH 2KHSA 4JI0L 1A8VA 1V1PB 3FRPB 3M7GA 4QMGA 4YY3L 2NZ1D 3IFDA 4CJ2C 3G7LA 5IGFA 5LMNW 1JCKB 4A3KG 2DN8A 4G7ZC 3OWFA 5M5XB 2CHBD 2R7DA 4IUQA 1CKMA 3FDTA 2JA7H 4UP9A 3GTJB 5IYDH 4WORA 3EVQA 4BWGB 1Q7YC 3FMCA 2CVRA 3E0JA 2L11A 5KYLA 4A3BH 3ERQA 1E3PA 1XTDA 1PH3A 1IHZA 4BBRB 1DYQA 2L5TA 2B3GA 1JICA 3MXPA 1NR2A 4XQNA 5FKAC 3R3OA 2A74C 1EYCA 4LUOA 3AQQA 1Q1BA 5D3IB 4QUFA 4LF5Q 4AIMA 4JBWA 3KDFB 4HIDA 5IGBA 1H9KA 3CCUA 1KXLA 2Z9HA 1CHPD 2B63G 4KY6A 2JJQA 3KK7A 5E4XA 4RHSA 4LFCQ 2A19A 2J0TD 3VYSA 2K7VA 1B2TA 1HNWL 1YJ9A 4H0LC 4DR6Q 3M4OH 2IJ0A 2Q2IA 3SXHA 3F8TA 3Q0AA 2FHTA 3IL8A 2EOTA 2AWNA 1G6PA 5DLQE 5ELNA 4DKAC 3J80c 3TREA 1HR0L 3DWAA 3LX0A 1PTOH 3WDNA 1EY6A 1VQNA 1KQSA 1U4PA 1RD9D 4LF8Q 2A73B 1PFMA 1TY0A 4PNYA 1EWCA 1FD7D 3Q23A 3J7AV 5CBEE 3K80C 3PO2B 5G3LD 2KOLA 2WAQB 4DNRB 1HR0W 1GKHA 4KKTA 2KCTA 1JORA 4LNQA 3PF4A 2VB2X 1KDCA 3P75A 1X6OA 2OWOA 3GTOH 5KNBA 1VQGA 2XGTA 2K5NA 5E1FA 2N3SA 1IBKQ 4FYDA 1QUQB 1D6EC 2QW7A 3T1YL 1VQIA 4FXKC 1UE6A 5C4HA 2HHHQ 2D0OA 2L55A 1NAPA 1B3QA 3PUWA 1AFPA 4WJ3M 4KI0A 3CU7A 3GTMB 4LUVA 4DFAA 4P71A 2F0QA 1K8OA 4RKLA 4DV7L 4XDXA 1EY8A 3I56A 4P72A 1WTRA 4B3TL 3WWVA 1HQRD 5LMUQ 4A3JG 1AZQA 4X64Q 1KRSA 1UE7A 1YI2A 4GOPB 4GLAC 5M5WH 1H9SA 2F0PA 2DNEA 1YNND 1A3UA 1ZKOA 4HMIA 4YCVA 3S1QB 4HAEA 1GUSA 5JEAH 4O42A 3TMEA 5IP9G 2R93H 2DY7A 3CMAA 4DV0Q 1RDPD 1GUWA 4DAYB 2EJFC 4A4IA 1N36Q 2RBMA 5IP7G 1XX8A 3TBIB 2C35B 1ESRA 3K7AH 2I5HA 3GTQB 5JAVA 3GTGH 2JA9A 1S40A 1U4LA 5C3WA 2PZWA 1SSOA 1HXYD 3PUXA 4JBMA 1PA6A 4UY8C 5JOBA 1J5EL 3UI2A 2TMPA 1BOSA 1BF4A 2C9OA 5M3MH 3I4NH 4BY7H 4XYQA 1YITA 5CYUA 3HOYG 3B6YA 4EX5A 1STYA 1XMOQ 2KVMA 4N8X1 2AUJD 3K59A 3L2PA 1QNKA 5C4JB 3H0GH 4X62Q 3J80E 3H94A 3I4MH 1JOOA 1O7ZA 3STBC 2NBFA 1I4HA 1HTLD 4TQUS 2MNAA 5E3FA 1C48A 1S5FD 3S15B 1PLFA 4C3HG 4LF5L 1WCMH 2ZM6Q 1RKNA 1SDFA 2JA8H 5FO8B 2L15A 1SMYD 1K8AC 1ZXTA 2UXCQ 1ZYRC 4LFCL 1B4OA 1M1KC 5DAUA 4DR6L 2VQEQ 4N9TA 2XN9C 2UUCL 2EXZA 1MBYA 3QR8A 1LLRD 3UE0A 4R8NA 3HOXG 4PMCA 3K81C 1X9NA 2NZOA 1CA6A 3OTOL 4HIOA 1WI5A 3ERSX 3A8JE 1S5DD 4JI8L 1WVLA 1OXTA 3CAMA 5LL6X 4NW2A 4X3TA 3M3YH 2XWJB 1SROA 4EQ5A 2G9DA 2LMCB 4K5XA 3S2HH 4LMQD 1BBUA 5CV8A 2MHVA 3SHLA 3CMEA 3V96A 2Z6BA 1XPOA 2R6GA 4FNFA 3PO3H 4TRDA 4WJWA 2YV5A 2AHOB 2FINB 1KTKA 2NB0A 3BU2A 1TIID 3H91A 1B7YB 2V4DA 2EIFA 4M8AA 2KCNA 4BY1H 4RH6A 4PV1C 1VS0A 3S16H 1LTGD 1ILQA 1MSHA 1TWFB 2HHHL 1X3FA 4A3IH 4DR7L 1WTHA 1WJJA 4MN3A 2YTVA 3NWTA 2JA5B 1V1QA 5I6WA 2MPMA 3R93A 3RR5A 2HQEA 2L12A 1XPRA 4DV3Q 3J7AF 2E2IH 1XPUA 4QIWE 1QZGA 4KMUC 2CKZB 1BDOA 2PZTA 4FP5D 4QY7A 4YWLA 1DOKA 2EYLA 1Y1WG 3K58A 4X64L 1JJ2A 2F0GA 4Z9CB 1YJNA 4IUVA 2F0FA 4KLKA 2OQKA 2K32A 4O0AA 4LFBQ 4L5RC 2I5MX 3EBEA 2OT2A 2RDGA 1ENAA 5K5PA 4DF7A 4L5QA 4HSPA 3EQLC 4JI4L 1SEBD 1NTGA 4DV0L 3U9OA 3SVMA 1HRJA 2WV6D 1N36L 4CHTB 1JQYD 2JA6H 1IYJB 4YWMA 3TP5A 5HGTA 5CR3A 1K73C 3GTKB 4JBKA 2Q2HA 3PMFA 2EE1A 2KCCA 3TEHB 1SN8A 4GN5A 2F0OA 5FLMG 1WOCA 1Y14B 1JJCB 1SYBA 4KHPQ 3BYTB 1Q8IA 1RTOA 4IUUA 3C46A 1QG7A 5A2QE 2LFNA 5EGTA 5JPMC 3I73A 2D0PA 4J6HA 1AEXA 4AQYQ 1H9SB 3T16A 2ALYB 5CMDA 4GZYC 1CKOA 4ME3A 2JA7G 4C3JB 5IWAQ 2LS01 1PFNA 1TY2A 5IYDG 1XMOL 4LK1C 4E6IA 4KHVA 3HOUB 4X62L 4A3BG 1C9OA 1RHPA 1WTOA 1CQFA 1Q81C 1B53A 5C6AA 1CZGA 2VNUD 1E0BA 4MNOA 2B2UC 4OWTB 1PRTD 1LTBD 4JVZA 1UNSA 1NR4A 4AH6A 3MEFA 3SEBA 1LABA 1J8IA 2K03A 1PZJD 2NN6I 3SR1A 4C3IB 1HFNA 3OWEB 1RF2D 1N34Q 2UXCL 1FNUA 3RN2A 1XXGA 1CQVA 3TN2A 1A2TA 1BCPD 3CD6A 2VQEL 3ITPA 1QWYA 5LMNQ 5IYCH 1PV4A 3S1MB 1TWGB 5EAYA 1HNZQ 1O80A 4KY5A 3NK9A 5M5YB 3T53B 1DM0B 2F0LA 4IPHA 2G5DA 1HTPA 1K28A 1SBBB 1X55A 4QUCA 2E5LL 2R92B 1HZ9A 4JOIC 5TSSA 5HGQA 4DK6C 4OWXB 1Q46A 4LWCA 1N33Q 2QGQA 2K05A 3NEMA 4YCUA 2Q2TA 5M5XH 3GV6A 3H15A 3QOLA 3GTJH 3OIPA 5I6YA 1PTOF 1KAAA 3LNNA 4OHJA 2HDLA 3VR4A 3S2DB 1YNNC 5C4XB 1STHA 1F2MA 4BBRH 3S1RB 1B44D 1L0YB 3TRZA 4P75A 1HQMC 2PZUA 5T1IA 1SYFA 4DR1Q 4JI5Q 3RUZA 2CQAA 1II3A 3FVQA 5I4DA 2BOSA 1QJOA 4A3DB 1K8GA 1J9OA 2QCPX 4GNXC 3U4ZA 4NMZA 4A3KB 1ML0D 5IT9L 1A2UA 4DAVA 1VQDA 1OXUA 3VA5A 1N32Q 5BN4A 3H09A 1S5ED 5GAEC 2NUCA 3A56A 5AJ3Q 3M85A 1KAWA 1SE8A 4DV3L 3RMHA 5FO9B 2ZXOA 3GTLB 2WACA 1P8LA 2ZTEA 4JI6L 5DEHA 1VQ8A 3G6JB 3E3XA 3UE1A 5KGUA 4X3UA 1VQHA 1S5CD 3EJIA 3PO2H 2NVXB 2MQHA 2B63B 4HJ7A 1Z9FA 1SFOB 2RA4A 5FLXL 4JV5L 4J15A 4MHEA 5IIFA 4LFBL 4Q0FA 1STGA 3TQYA 5JEAG 3T56B 2R93G 3U4VA 1C0AA 4XYOA 1D2BA 3TP7A 2QA4A 3MC0B 3ULLA 3MFYA 2JYOA 4DNIA 2KEEA 2LXJA 1I4QA 3G6EA 4JYAL 3IKJA 1PH6A 1RCVD 5CORA 1LM0A 4G57A 2F0JA 2DJFC 2I46A 3ZYYX 2HIVA 3NTHA 1UE5A 4HJ5A 4KHPL 2YTXA 4TSSA 4LAAA 1YZ6A 3VA7A 3BDCA 4X3KA 1CZWA 1O7YA 2B2TC 5BN5A 5EJWA 1O78A 4B9XA 3HZXA 1JWSD 4AQYL 5M3MG 3I4NG 2UXBQ 4BY7G 1SNOA 1I6HH 1HHVA 1IW7D 5IWAL 1STNA 4N9PA 2PQEA 1YNXA 1YVCA 2OF1A 4AYBB 4IFDH 1T9HA 2IX0A 1G91A 1KRTA 3M7NA 3L7ZC 3QO2A 3I4MG 1QOHA 3S1QH 5M3FB 3NP8A 3BVMA 4ILWA 4UP7A 1A3TA 4FF3A 1Y8OB 3MA2B 1WCMG 4QIWB 1HNXQ 5I9PA 2JA8G 1EU4A 3FPUB 1EY5A 1AE3A 2ID0A 4DXGA 3J81L 2EVBA 4HCSA 5DM73 1B9MA 4CJ0B 2PQAB 5C5LA 2B2VC 2F0DA 2VS1A 4GKJL 1I3QB 5I2YA 1TWAB 3UDFA 4Y7NH 5LMNL 3GTQH 1EL0A 4LF6Q 3NXWA 1B70B 5ELBA 1HZCA 1HNZL 1FJGQ 2RSNA 3DEPA 1OXXK 5HY6A 4PMWA 1JJGA 3K8AA 3CHBD 1SYEA 4DV6Q 1SNDA 1NMGA 2E2DC 3SE0A 4LF7Q 1TWHH 2NVTB 4Y52H 1FL0A 1G51A 4DV2Q 4GLVB 3H3VC 1LACA 2R3ZA 4RG1A 3J81i 5EPJA 3DMUA 4KJOA 5C4JH 3L3OC 2VL6A 1Y1VB 4ZAIA 1UEBA 5D65A 1NJIC 2WKCA 4L5SA 3PO3G 1ENCA 3A74A 2F0SA 4QCLA 2UUBQ 2XIWA 3TS0A 3GD7A 1SNMA 3OMGA 2F03A 4ZRZA 3ULJA 4DR1L 4UDUC 4JI5L 4DV1L 4DR2L 1CSQA 3DWPA 3DHQA 1MHWC 1I4GA 4BY1G 4A3LH 1LT3D 1WTXA 3W1GA 4IPCA 4WFN3 3K57A 1X3GA 3IRBA 1EZ6A 4A3FG 3AFQA 4TKOB 3HOYB 1SXTA 1EY4A 4HJ9A 4A3IG 4IOAA 1N32L 4APVA 3AMUA 1F2ZA 1ONLA 4LUZA 2ES2A 1VQKA 3G48A 1D1KA 4NDXA 4K0KQ 3JAME 3OSOA 4ZUJA 1U4RA 1WFQA 5HURA 1BUVT 2A68C 3GO5A 2EYPA 3TSSA 4RGTA 2E76C 1L1OC 3FKIG 1I4PA 1PRTC 1MD2D 3OYYA 2F1MA 2JSOA 3K0YA 2B8GA 1K0SA 4A3EB 2BE5D 3RLNA 4G7OC 1XNQQ 2K28A 1TWCB 3N6RA 4R1JA 5ELDA 1PVOA 1D5ZC 4C2MB 1JR0D 3MXUA 3RZDH 3S1NH 2E2HB 1QZHA 1PTOC 3PCOB 4NP5A 1SJED 1BCPC 2JA6G 4MTNA 5KEEA 2HUGA 2NN6H 1Q82C 2QF7A 3HP3A 4R4IA 1TWFH 1F2LA 3DM3A 1PH7A 4U68A 3CQZB 1F9RA 1KNAA 2WB1G 1LYLA 1HA6A 1CKNA 1SE4A 3DUZA 5DM63 4HCEA 1DZ1A 2PCFB 1C7YA 1LT5D 1Z47A 4DAPA 1VQEA 4B08A 2YU9B 5G3LF 3URYA 3OHXC 1OO9B 4WJ4A 4L8JA 1FGBD 4N8FA 1T5EA 3NENA 1EWIA 3MEHA 2RVLA 2UXBL 1EQRA 4NXML 1F9SA 2FMMA 2YYZA 3BYYB 5C0XH 3F1ZA 4RWSC 1VMPA 3KLSX 5C0XJ 2K52A 3IAYA 1PYWD 3HOWB 4X66L 1WTQA 5D3DA 2RDHA 5IE8A 2RHSB 2OTLA 3HOZG 4POFA 2PNHA 1YEZA 3O13A 1HNXL 1GUNA 2B29A 1Y8NB 2OXPA 1F9QA 2KHIA 4HEDA 3QB3A 4OXPA 1A3VA 1Q90A 1Q8KA 1YNJD 2NTTA 5C5MA 1IL2A 3K5LA 4JK1C 2AKWB 1TS5A 1LO5D 4LF6L 5T1GA 5IYCG 1NUCA 3HFZB 1JE5A 3I7FA 5E4WC 5FLXc 1SE3A 4ID6A 5GAHC 4DV6L 2JEAI 2IHEA 4JW0A 2NZHA 4LF7L 1KLUD 4IPGA 4LW1A 5ELFA 4DV2L 4JI7Q 3PF5A 3NTKA 2XRSD 5C44B 2GN5A 1FNVA 4C3JH 1XNRQ 4GLXA 4JPBW 1D1IA 1VF5C 4O1NA 1JE4A 1D8LA 4FF1A 3HOUH 4EQOA 4V0BA 3C1EA 4CKEA 3T1HQ 1PYSB 3TZUA 4K14A 4BBRG 1XWEA 3HKZB 4CKBA 3CC2A 5K36H 5EKLA 3OW7A 1B1ZA 1VQJA 4OO1H 1VDZA 3AU7A 1ICFB 3UDXA 5C3EG 4C3IH 3RLFA 2EY6A 3BS1A 4ZYSA 4B9WA 5F2DA 2CWPA 1MIUA 2A8VA 3KF6B 3S1MH 2R7ZB 1TWGH 4RA8A 1P16A 4NKLA 4GS3A 3MXGA 3P1HA 2G9HD 4WRDA 1CFMA 2F0NA 2K5WA 3T4AC 4R8IA 3RNUA 4A3BB 3D8GA 4FVMA 1UWVA 1V8QA 3HOVB 3D0FA 2F52A 1VQCA 2PW7A 4DV4Q 4K0KL 2EYOA 1QE6A 2HD3A 1IW7C 4DUYQ 1FR3A 1PH2A 4ABNA 1TXYA 3A8IE 5CBAE 3J81c 4F87A 4LF8L 1BBXC 2VQFQ 3PO2G 3X3NA 4PMBA 4YHHQ 3S2DH 5AFWA 3KF8A 3OIQA 5C4XH 3ULPA 4DK1A 3KOJA 3S1RH 2OQ0A 2A1AA 4Q5VA 1XNQL 2WIIB 3HRZC 1KDBA 2UXDQ 3A55A 2IY5B 4RMFA 2E2JH 4A3DH 4A3MH 2JP1A 1PTOB 3VYTA 1AZPA 4A3KH 2C5CA 2FMCA 3FPPA 1IBKL 1UE1A 1EY0A 2O2LD 3S24A 1RJTA 2BCOA 4IALA 4A76A 1K83H 3TP6A 4CDFC 1CTMA 2VB3X 2NTSA 3F2CA 2H1EA 5J1ZA 3VR6A 2WB1E 2ZJRA 1EY9A 3DEOA 2CCZA 1QVCA 3CC7A 4OL7A 3H3VI 3GTLH 2PMZE 2ZXRA 4HMJA 4A3CH 3CCQA 1PZKD 1DGSA 1LTTD 2CFMA 1K3BC 2MGSA 5EBDA 3K6OA 1EQQA 1SE2A 4OX9Q 1DONA 3OW2A 3E9HA 2RHQB 1A63A 2FXQA 2JE6I 1VQ4A 4IFDG 1SFOH 2Z6KC 5LMUL 2PW5A 1S3OA 4RGNA 3F2BA 3ZJYC 2NWGA 2N88A 4L63B 3MXNA 1HPCA 4XQQA 1FVIA 2F0WA 1NCVA 2K5DA 1CKNB 2A6ED 1VQ5A 4DV5Q 1XTCD 2NVQB 5J39A 2F4VQ 3E5SA 3SK6A 1YHAA 4HN7A 2K50A 3L0OA 4BBSH 2B2UA 5L37A 3N52A 2A6HD 3DXJC 2WP8J 5GAGC 2K04A 2SEBD 1DXMA 3NPPA 2UU9Q 3KLRA 1KLGD 3NQIA 4GN3B 1TU2B 2PQAA 1J6QA 4L6TB 3VR2A 1KL9A 2CH4A 1HFGA 5IGEA 2XNAC 1RODA 4ZKBB 4A3GB 1B8AA 1KC8C 1TT2A 1NBWA 3T1HL 2BE5C 2MUYA 2LY7A 5M3FH 2OTJA 2VUMH 3GP7A 1AW7A 3HKSA 5JVG3 4F88A 1Y8PB 4FF2A 4DR3Q 1G8ZD 2RCFA 4QB4A 4DR4Q 4CKCA 4RCOA 1XJVA 1LTAD 1AH9A 3K0XA 4A3LG 2SNSA 2ZM6L 4H44C 4KK7A 1I3QH 1TWAH 1KABA 5GQOA 3C3LA 4FF4A 5EPLA 3NBHA 1O7IA 4C1NI 2D9UA 1I50B 1PDQA 1NSNS 5M9OA 3J7YW 1K9MC 2F3WA 4CJ1B 1WYDA 1HZBA 3U58A 1STEA 2NVTH 3I4MB 2L1BA 5IGCA 3J80L 4JI3Q 4RFBA 4DV4L 3BG3A 1PRTF 4GNXA 3S14B 1VQ7A 1E2VA 2A5HA 2EYFA 4BS9A 2VQFL 1VF7A 4YHHL 1Y1VH 3CCVA 4MTKA 1BCPF 3I72A 2QKIC 1B50A 4LFAQ 3LWUA 4A93B 3J80i 2HIXA 3ICEA 1X56A 3SDZA 2UXDL 3G71A 1YNJC 2RF4A 1Z7TA 1IBLQ 3CKIB 3NWSA 1HCZA 1HJPA 1MKHA 3A0JA 3S2HB 4K8JA 3R8BA 1QCBD 1VQFA 3AB9A 1WTWA 1MJEA 1VQLA 2XWBB 2K6AA 5JJIA 1EWHA 3KF8B 2CW0D 4DPGA 5BN3A 2GVBA 4R4OA 1L0XB 5NUCA 1I4XA 2V1CC 3LWEA 4IPDA 4HIKA 3MFGA 4OX9L 1EIYB 3QG1A 5C0XG 3R2IA 4H7BA 5ELEA 1YHBA 2Y0SG 3S16B 4A3FB 1PHJA 1Q86C 5DNFA 4A3EH 2B2TA 4A3IB 1IYUA 5KIXA 4B3MQ 3DLLA 3GDEA 3HGBA 1EYDA 2E2HH 3KJPA 3KLWA 3RD4A 3GTPB 1EEFD 4DV5L 1SMYC 2E2IB 4RKBA 2F4VL 3D3RA 4LF4Q 1Q12A 4EGVA 4NXNQ 1BR9A 2O5JC 1D5MC 1UUPA 2D5DA 2L4NA 4B3SQ 3KJOA 2N8NA 2F0IA 1CT1D 2K5VA 3CXCA 3I8ZA 1YHQA 2YU9H 3FKIB 1U0LA 3OOCA 5IYBH 3AEVA 4JI1Q 2UU9L 1BNZA 3GTMH 1HUMA 1RL2A 4B3RQ 4DK0A 2FFKB 1A0IA 3TS2A 3S17B 3QOJA 2KJXA 2B2VA 1ESFA 3HS0C 1GUGA 4C3JG 2AUKA 1X3QA 2QEJC 2B2WC 3MXNB 2RKSA 2AMCB 2JA6B 3I70A 2IT1A 3HOUG 2F0HA 3D31A 4HSVA 1G6ZA 2RSOA 2SDFA 3CRKC 3HOWH 5CV9A 1GVPA 4M1UB 2CH4W 3H0GG 2WB1B 3CF5A 5CC4A 3NELA 5K36G 2B2YC 2XRQD 3QJYA 2PMZB 3NTIA 2MJ8A 4OO1G 1YJWA 4DR4L 1GO3E 2M00A 4CGYB 3D4DA 1WTPA 4K5WA 1N34L 5A2QL 2KHJA 5IGGA 2H5XA 4X65Q 1KD1C 1NY4A 1IKLA 2K4KA 4GOPC 3SK8A 5I9OA 2KA7A 4A3JB 1V43A 3D6CA 4PZ8A 4P2CB 2K01A 3MAQA 3HOZB 3I91A 3C2PA 5C44H 4FO2A 1ET6A 4H13C 3KF6A 5KRUA 1N33L 4L5TA 4DA2A 3D4RA 5EKIA 1IYVA 4IZ8A 5GROA 1D5XC 1PMRA 5A35A 5EPKA 1CM9A 2L9HA 1EFWA 5C4XG 4J8QA 4F8MA 3PUZA 4DNTB 4K2KA 1DOMA 4CDCC 4LFAL 2A6EC 5C3XA 4OELB 3NBHB 1U5KA 1KHIA 4BXXH 3S15H 2VZAA 1J5EQ 4OIKA 4A3DG 4A3MG 4PZ6A 3U50C 3RZOB 1L1OA 5CV7A 1IBLL 3BZKA 3M9BA 3M4YA 2R7ZH 1I94Q 2A6HC 3PGZA 1BBWA 2DNCA 2BH2A 4GNXB 1ICWA 2LSSA 4UHVA 2X6GA 1DCZA 3K5OA 4CDDC 1N9WA 3VDYA 4OWWB 3HOVH 4DR5Q 3BJUA 4K6LA 5AJ3L 4A3CG 1XYIA 2KBNA 4PZ7A 4K5VA 1PFSA 1LTLA 1SJHD 2D2CC 1Q1EA 5EQ0A 1HA5A 2JQOA 4RCNA 2BDOA 3KLSA 4A75A 5C3EB 1SAPA 3V05A 1E7ZA 2R61A 3KUPA 4C3HB 1GUOA 5LL6S 2A69D 3J81j 4KJNA 4KN7C 1IXRA 5GADC 1S5BD 3VR3A 1ASZA 2UUCQ 3NUCA 2MO1A 4DK3C 2Y0SE 2B8FA 4B3ML 1W2BA 4KKUA 3W3AA 1M90C 2Z4IA 4IQZA 1SR3A 2PI2E 2VY3A 3FHWA 4ZUIA 2Q8IB 1ILPA 1OXVA 1SLJA 1CUKA 2IL8A 3OTOQ 4IO9A 3U9SA 1SNQA 2IPKD 4LJZC 1FNWA 1WTVA 3HOXB 4LF4L 4JI8Q 4IUNA 4PQXA 4NXNL 1A6XA 1SNPA 4C1NK 4UPAA 1M4VA 4BBSG 2N55A 3A7LA 4B3SL 3BVZA 2JN4A 1TS4A 3Q6SA 1MSGA 1Z6HA 5CV4A 1BO0A 3Q24A 1K0RA 1R9TB 1YIJA 2FJ2A 2MO0A 2IX3A 2X6LA 5CV6A 1L0WA 5IGDA 4JI1L 2JA5H 2M2LA 1TKWB 4B3RL 1VCIA 3F2UA 5J3BA 1EYAA 3M4QA 1QB5D 1BQQT 2K33A 1EUJA 3MHBA 4AYBG 1GD7A 2AWOA 4OIJA 2PI2A 5FJ8H 3VYRA 2QEXA 1V1OA 2KQ3A 5IT9c 3Q22A 4IJHA 5M3FG 4QJFA 3Q8DA 4DR7Q 1I6VC 2KEDA 3H6MA 2VUMG 4EQNA 1A62A 3PSIA 3X3MA 1TS2A 4RAUC 1BVSA 1EQVA 1H9RA 4IUPA 2EJGC 4KD3A 5IY0A 1NMFA 4HJ8A 1LV9A 2EY5A 2F0VA 4CBVA 3A5ZB 5KNDA 2NVQH 3DWQA 2EYMA 3GQBA 1S4ZA 1DJRD 5CGKA 1K3RA 3NQTA 1W3SA 1A15A 1I6HB 4LF9Q 3GTKH 4X65L 2KCMA 1GHJA 2RCNA 4JBJA 2J4XA 2XSCA 1F9PA 2HDMA 1M8AA 1Y1WB 5BR8Q 1FJGL 2DUDA 1LT4D 1CHQD 1F2YA 2CW0C 4YIJA 3OPOA 4JI4Q 3CW2C 5JEAJ 2EYHA 4HIMA 1ASYA 3JC66 2RQXA 2BA0A 3CCLA 4A3GH 1TQOA 4I65A 2R7FA 4MIUA 1Y1VG 3NHHA 2E75C 3BZCA 2KUMA 4Y7NB 2ENBA 3UDGA 5C4ZA 2UUBL 3I4LA 2ZXPA 3KBXA 4JCVE 5JJZA 2TSSA 1KDAA 3QWNA 2GVAA 1D7QA 2IW3A 1TWHB 2NVYB 4YCWA 5IODA 3MWYW 1JMCA 1E1OA 5JPNC 1I94L 1G2TA 2XTIA 4JG2A 1BKBA 4IN3A 4NPSA 2ATWA 1I50H 2EDGA 1HZAA 3CCRA
chains in the Genus database with same CATH topology
2AWNA 1EOVA 5DLQE 1G6PA 5ELNA 4DKAC 2QA4A 5M5YH 1B8AA 3ULLA 3J80c 3AFPA 4DR5L 1KC8C 3TREA 4DNIA 1NBWA 2LXJA 3T1HL 1HR0L 4JYAL 3G6EA 5M3FH 3CCMA 1PH6A 1VQNA 1KQSA 2R92H 2OTJA 4FDBA 4LF8Q 2VUMH 3S14H 3HKSA 1LM0A 2I0QA 2ZTDA 4DR3Q 2HIVA 3FP9A 4DR4Q 1AH9A 1XJVA 1UE5A 4HJ5A 4KHPL 3K0XA 4A3LG 2YTXA 3K80C 2ZM6L 4UP8A 1YZ6A 4JI2Q 1I3QH 1AE2A 2K75A 1HR0W 1GKHA 4A3EG 1TWAH 3PIOA 4QQBX 2KCTA 2CQOA 1VQBA 1V9PA 2WAQG 5GQOA 4LNQA 1L1OB 3PF4A 4AQYL 5M3MG 3I4NG 1O7IA 2UXBQ 4BY7G 1I6HH 1X6OA 2OWOA 4A93H 5IWAL 3GTOH 1K9MC 1VQGA 4ALPA 2XGTA 1YNXA 1I5FA 1WYDA 1SRUA 1YVCA 2K5NA 2N3SA 1HZBA 1T9HA 2IX0A 1IBKQ 3U58A 2NVTH 1KRTA 1PH8A 2Z6KA 3M7NA 1QUQB 3L7ZC 4JI3Q 4DV4L 3T1YL 3I4MG 2N78A 3S1QH 2HT1A 2OCEA 3M4PA 4GNXA 4IFDI 1VQIA 3PIPA 1UE6A 2HHHQ 4UP7A 4NB3A 2D0OA 2YTYA 1VQ7A 2VQFL 1WCMG 1H95A 1HNXQ 2DGYA 3PUWA 4YHHL 2ZJPA 5M3FG 1Y1VH 4KI0A 1SMXA 2JA8G 4WJ3M 5IYBG 1G291 1AE3A 2ID0A 4LUVA 3CCVA 2IX1A 3CPFA 1QVFA 2PQAB 4P71A 3CCJA 2VS1A 4XTCS 4GKJL 2F3IA 4DAMA 3UDFA 4Y7NH 5LMNL 4DV7L 3GTQH 4LF6Q 4LFAQ 1B70B 3I56A 1PH4A 1HZCA 4P72A 1HNZL 1FJGQ 4QGUA 4B3TL 3WWVA 3J80i 2HIXA 2MFIA 1X56A 3ICEA 5LMUQ 4A3JG 1OXXK 5HY6A 4PMWA 3G71A 1JJGA 3K8AA 4X64Q 4DV6Q 4PG3A 2RF4A 1MJCA 4A3FH 2NVXH 1KRSA 1NMGA 1UE7A 3JAMi 1YI2A 4LF7Q 1TWHH 4GOPB 4GLAC 4AYBE 4HJAA 2B63H 5M5WH 4Y52H 1FL0A 1G51A 1IBLQ 3I4OA 4DV2Q 4YCVA 4GLVB 2WFWA 4DUZQ 1JB7A 1HJPA 1MKHA 4R4CA 4RG1A 3A0JA 3J81i 1NE3A 5IP9G 2R93H 3CMAA 2E5LQ 4DV0Q 4XIGS 3GTPH 3AYHB 4DAYB 2D62A 1VQFA 4A4IA 5C4JH 1MJEA 1N36Q 2VL6A 1VQLA 3PUVA 5IP7G 3PUYA 5JJIA 1VQAA 2C35B 1UEBA 3KF8B 3K7AH 4JI6Q 1NJIC 4L5SA 5JJLA 3PO3G 3A74A 2UUBQ 5E7NA 4DPGA 1XMQQ 3TS0A 2GVBA 2I5HA 4R4OA 3GD7A 4LF9L 2V1CC 4IPDA 4HIKA 3GTGH 1IZ6A 2VW9A 4OX9L 3ULJA 2JA9A 1S40A 1EIYB 1E22A 4DR1L 4JI5L 3FKIH 4DV1L 4DR2L 1CSQA 5C0XG 4JV5Q 4BY1G 5BR8L 4A3LH 3PUXA 4JBMA 1PA6A 4UY8C 1YHBA 2Y0SG 3W1GA 4IPCA 1J5EL 1PHJA 1Q86C 1X3GA 3IRBA 3S17H 4A3EH 4A3FG 3AFQA 5C44G 5M3MH 3I4NH 4B3MQ 4JI7L 4BY7H 3DLLA 4HJ9A 4A3IG 3GDEA 1YITA 3HOYG 3B6YA 4EX5A 2ASBA 4IOAA 4APVA 1N32L 2E2HH 4IOCA 3KJPA 3KLWA 1XMOQ 4QL5A 3CCSA 5ELOA 1XNRL 4DV5L 4JYAQ 3L2PA 4GKKQ 3G4SA 3H0GH 4X62Q 4LUZA 2F4VL 4LF4Q 2ES2A 1Q12A 4NXNQ 3I4MH 1VQKA 3G48A 4K0KQ 3HKZG 3STBC 4X6AH 4TQUS 1WFQA 4OONA 4B3SQ 2MNAA 4JOIA 3KJOA 3GO5A 2Z0SA 2N8NA 1WCMH 2ZM6Q 2K5VA 3CXCA 1YHQA 4LF5L 4BXXG 2YU9H 2JA8H 1U0LA 2L15A 5IYBH 1RIPA 1L1OC 1K8AC 3AEVA 3FKIG 2KENA 4JI1Q 2UU9L 2UXCQ 3GTMH 4B3RQ 1RL2A 3LGJA 4LFCL 1M1KC 3OYYA 1A0IA 2BA1A 4KHZA 2R7ZG 2VQEQ 3TS2A 4DR6L 3RLNA 1OXSC 1XNQQ 2UUCL 4R1JA 1PVOA 3MXNB 3RZDH 3S1NH 4A3JH 2AMCB 3UE0A 2IT1A 1QZHA 3PCOB 1VQOA 3HOUG 3D31A 3HOXG 3K81C 4O2DA 1X9NA 1FGUA 2NZOA 4MTNA 3CCEA 2JA6G 2E8GA 3HOWH 3HOVG 3OTOL 1PH5A 1Q82C 4HIOA 3HOZH 1GVPA 1WI5A 3EN2A 3ERSX 4R4IA 3H0GG 1TWFH 4JI8L 3DM3A 3CF5A 1PH7A 3NELA 5K36G 1OXTA 2WB1G 3CAMA 1LYLA 3J7ZC 5IP9H 4DUYL 1CKNA 4OO1G 5JJKA 1YJWA 3M3YH 4DR4L 1SROA 4EQ5A 3CC4A 1C7YA 1E1TA 1Z47A 3S2HH 1GO3E 1VQEA 1BBUA 4DK6C 4GKJQ 5IP7H 3CMEA 3RLOA 4GN4B 4JI2L 1EYGA 1VQ9A 1XPOA 4WJ4A 2R6GA 1N34L 3PO3H 1IBMQ 2KHJA 3NENA 1EWIA 2YV5A 2AHOB 2UXBL 2H5XA 4X65Q 1EQRA 3KDFA 1NY4A 1KD1C 3BU2A 4BA1I 2Q2UA 4NXML 1B7YB 2K4KA 4GOPC 2EIFA 2WAQE 2YYZA 1GM5A 2UUAQ 4BY1H 1V43A 4JI0Q 3F1ZA 3RZOH 5C0XJ 4YY3Q 2K52A 4PZ8A 1VS0A 3PV0A 4MZ9A 3W5OA 4X66L 3S16H 2CWAA 5H1SE 5C0XI 3F2DA 5C44H 5IE8A 2NN6G 2RHSB 3KF6A 2OTLA 3HOZG 2HHHL 2IHFA 1X3FA 1N33L 1YBYA 4L5TA 3SGIA 4POFA 4A3IH 3HOYH 2PNHA 3I55A 4BA2I 4DR7L 1YEZA 1WJJA 2ZJQA 5GROA 3ER0A 1HNXL 2B29A 2HQLA 2YTVA 1V1QA 1PH9A 3E0EA 2KHIA 1EFWA 5C4XG 3RR5A 2JA5G 4OXPA 1XPRA 1PYBA 1Q8KA 4DV3Q 2E2IH 3PUZA 4QIWE 1IL2A 1XPUA 2AKWB 1QZGA 2CKZB 4LF6L 5C3EH 5IYCG 4LFAL 4DV1Q 4DR2Q 1KIXA 3HFZB 4QY7A 4YWLA 1JE5A 3I7FA 5FLXc 4C3HH 3NBHB 1U5KA 1KHIA 1Y1WG 4BXXH 3S15H 2VZAA 5GAHC 1J5EQ 4A3DG 4X64L 4DV6L 1JJ2A 2IHEA 5FJ8G 2JEAI 2NZHA 4PZ6A 4A3MG 1YJNA 3I2ZA 3U50C 4LF7L 3J7A5 4IPGA 4KLKA 4LW1A 2OQKA 1L1OA 4O0AA 1IBLL 3UDIA 4LFBQ 3BZKA 3M9BA 4DV2L 4JI7Q 4L5RC 4TVAB 2I5MX 2R7ZH 3EBEA 3PF5A 1I94Q 1HNWQ 1CSPA 4R4QA 4DUZL 3PGZA 2GN5A 1BBWA 4L5QA 2BH2A 4C3JH 4JI4L 4GNXB 1XNRQ 1NTGA 3KFUA 4DV0L 4GLXA 2LSSA 1TWCH 4C2MH 3VDYA 1N9WA 1D8LA 1QUQA 1N36L 3HOUH 3HOXH 4OWWB 3HOVH 2JA6H 4DR5Q 1IYJB 1HR0Q 3T1HQ 3BJUA 4YWMA 5AJ3L 1PYSB 4A3CG 2KBNA 4PZ7A 4BBRG 1K73C 1PFSA 1LTLA 1Q1EA 4JBKA 1XMQL 2JQOA 1X54A 2Q2HA 3CC2A 4A75A 1VQJA 1R9TH 3TEHB 3CQZH 1E7ZA 3K7UC 1SN8A 4GN5A 3UDXA 5FLMG 5C3EG 4C3IH 1E24A 1WOCA 1Y14B 1JJCB 4KHPQ 3RLFA 3J81j 1VQPA 4OO1I 1IXRA 5GADC 3RN5A 1ASZA 2CWPA 1MIUA 2UUCQ 2A8VA 2MO1A 1L2FA 2D0PA 3KF6B 4DK3C 2Y0SE 3EIVA 3S1MH 1TWGH 1LUZA 3W1BA 4AQYQ 4B3ML 1P16A 1W2BA 2ALYB 4GS3A 1CKOA 4ME3A 1M90C 2JA7G 3STBD 5IWAQ 1SR3A 2PI2E 3KYHC 2VY3A 3FHWA 5IYDG 1X3EA 1XMOL 4A3GG 3RNUA 1OXVA 1SLJA 1CUKA 3OTOQ 4GOPA 4IO9A 4GKKL 2K5HA 4X62L 4A3BG 1UWVA 3JAMc 1VQ6A 1C9OA 4LF4L 3D0FA 4JI8Q 4NXNL 2F52A 1Q81C 1VQCA 2VNUD 4DV4Q 4MNOA 3T1YQ 4K0KL 4UPAA 4DUYQ 1PH2A 4BBSG 4OWTB 1TXYA 4B3SL 2JK8A 2N49A 2LXKA 3J81c 1HH2P 4AH6A 3MEFA 4LF8L 2VQFQ 1K0RA 3HKZE 1QVGA 1YIJA 2MO0A 3A5UA 3PO2G 2NN6I 4YHHQ 4POGA 4R4TA 1L0WA 4DR3L 3S2DH 1JT8A 5C4XH 4JI1L 1N34Q 2ZTCA 3ULPA 2JA5H 4P74A 2UXCL 3RN2A 4B3RL 1VCIA 5J3BA 2I5LX 3KOJA 3S1RH 4NXMQ 3CD6A 2OQ0A 2VQEL 1S72A 2A1AA 5LMNQ 4DV7Q 1XNQL 3M4QA 5IYCH 1PV4A 5EAYA 1HNZQ 1EUJA 4B3TQ 1Y1WH 4IFDJ 4AYBG 2JEBI 4RMFA 2UXDQ 1GD7A 2E2JH 2AWOA 4A3DH 2IY5B 4IPHA 2PI2A 5FJ8H 4X66Q 2QEXA 4A3MH 1X55A 1N8RC 4YWKA 2E5LL 4A3KH 5IT9c 1HZ9A 2EQSA 4JOIC 5HGQA 1IBKL 4IJHA 4OWXB 1Q46A 4QJFA 1UE1A 3Q8DA 2QGQA 3NEMA 2EXDA 4LWCA 4YCUA 3S24A 2Q2TA 1N33Q 2R92G 5M5XH 4A76A 4DR7Q 4JI3L 1K83H 2VUMG 4P73A 1A62A 3H15A 3PSIA 3F2CA 4H02A 3GTJH 1PH1A 3H3VH 3HOWG 1BVSA 3E9IA 5IY0A 1EIFA 1NMFA 2K14A 4HJ8A 1X65A 2WB1E 3A5ZB 4JC0A 1OTCA 3CP0A 2ZJRA 2NVQH 2CCZA 1QVCA 3CC7A 3H3VI 3GTLH 2PMZE 3CPWA 4A3CH 2BH8A 4BBRH 3CCQA 4IJLA 1K3RA 1IBML 1W3SA 1VQMA 1DGSA 4LF9Q 2CFMA 4X65L 2KCMA 3GTKH 2RCNA 4JBJA 3TRZA 4P75A 1EQQA 4A93G 4OX9Q 3OW2A 3E9HA 4DR1Q 2UUAL 4JI5Q 5FLMH 2RHQB 1A63A 2NVYH 2FXQA 2JE6I 1VQ4A 5BR8Q 1SFOH 2Z6KC 4JI0L 1A8VA 2DUDA 1FJGL 4YY3L 4IFDG 5LMUL 1K8GA 4GNXC 3U4ZA 1S3OA 3F2BA 3ZJYC 4JI4Q 3CW2C 5LMNW 5JEAJ 4A3KG 4HIMA 1ASYA 2R7DA 1VQDA 3JC66 1CKMA 1OXUA 2BA0A 4UP9A 2JA7H 1N32Q 1FVIA 3CCLA 5GAEC 4A3GH 5IYDH 1CKNB 5AJ3Q 2R7FA 1Q7YC 4DV5Q 1VQ5A 1Y1VG 3M85A 4A3BH 1KAWA 1SE8A 4DV3L 2F4VQ 3BZCA 1E3PA 1YHAA 1XTDA 2K50A 3L0OA 1P8LA 1PH3A 2ZTEA 2B3GA 4BBSH 4JI6L 3UDGA 4LUOA 1VQ8A 3AQQA 3UE1A 2UUBL 1Q1BA 4JCVE 4LF5Q 2WP8J 4AIMA 4JBWA 1VQHA 3KDFB 4HIDA 3PO2H 5GAGC 2GVAA 1D7QA 2MQHA 4YCWA 3CCUA 4HJ7A 1Z9FA 1KXLA 2UU9Q 2UXDL 1JMCA 4J15A 2B63G 4JV5L 1E1OA 2JJQA 4LFBL 4GN3B 2PQAA 4LFCQ 2A19A 1J6QA 1I94L 1HNWL 1YJ9A 4DR6Q 2XTIA 3M4OH 4JG2A 1KL9A 1BKBA 2ATWA 4NPSA 3TQYA 1I50H 2Q2IA 5JEAG 1HZAA 3F8TA 3CCRA 2R93G 3U4VA 1C0AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AWN A;  1EOV A;  5DLQ E;  1G6P A;  5ELN A;  4DKA C;  2QA4 A;  5M5Y H;  1B8A A;  3ULL A;  3J80 c;  3AFP A;  4DR5 L;  1KC8 C;  3TRE A;  4DNI A;  1NBW A;  2LXJ A;  3T1H L;  1HR0 L;  4JYA L;  3G6E A;  5M3F H;  3CCM A;  1PH6 A;  1VQN A;  1KQS A;  2R92 H;  2OTJ A;  4FDB A;  4LF8 Q;  2VUM H;  3S14 H;  3HKS A;  1LM0 A;  2I0Q A;  2ZTD A;  4DR3 Q;  2HIV A;  3FP9 A;  4DR4 Q;  1AH9 A;  1XJV A;  1UE5 A;  4HJ5 A;  4KHP L;  3K0X A;  4A3L G;  2YTX A;  3K80 C;  2ZM6 L;  4UP8 A;  1YZ6 A;  4JI2 Q;  1I3Q H;  1AE2 A;  2K75 A;  1HR0 W;  1GKH A;  4A3E G;  1TWA H;  3PIO A;  4QQB X;  2KCT A;  2CQO A;  1VQB A;  1V9P A;  2WAQ G;  5GQO A;  4LNQ A;  1L1O B;  3PF4 A;  4AQY L;  5M3M G;  3I4N G;  1O7I A;  2UXB Q;  4BY7 G;  1I6H H;  1X6O A;  2OWO A;  4A93 H;  5IWA L;  3GTO H;  1K9M C;  1VQG A;  4ALP A;  2XGT A;  1YNX A;  1I5F A;  1WYD A;  1SRU A;  1YVC A;  2K5N A;  2N3S A;  1HZB A;  1T9H A;  2IX0 A;  1IBK Q;  3U58 A;  2NVT H;  1KRT A;  1PH8 A;  2Z6K A;  3M7N A;  1QUQ B;  3L7Z C;  4JI3 Q;  4DV4 L;  3T1Y L;  3I4M G;  2N78 A;  3S1Q H;  2HT1 A;  2OCE A;  3M4P A;  4GNX A;  4IFD I;  1VQI A;  3PIP A;  1UE6 A;  2HHH Q;  4UP7 A;  4NB3 A;  2D0O A;  2YTY A;  1VQ7 A;  2VQF L;  1WCM G;  1H95 A;  1HNX Q;  2DGY A;  3PUW A;  4YHH L;  2ZJP A;  5M3F G;  1Y1V H;  4KI0 A;  1SMX A;  2JA8 G;  4WJ3 M;  5IYB G;  1G29 1;  1AE3 A;  2ID0 A;  4LUV A;  3CCV A;  2IX1 A;  3CPF A;  1QVF A;  2PQA B;  4P71 A;  3CCJ A;  2VS1 A;  4XTC S;  4GKJ L;  2F3I A;  4DAM A;  3UDF A;  4Y7N H;  5LMN L;  4DV7 L;  3GTQ H;  4LF6 Q;  4LFA Q;  1B70 B;  3I56 A;  1PH4 A;  1HZC A;  4P72 A;  1HNZ L;  1FJG Q;  4QGU A;  4B3T L;  3WWV A;  3J80 i;  2HIX A;  2MFI A;  1X56 A;  3ICE A;  5LMU Q;  4A3J G;  1OXX K;  5HY6 A;  4PMW A;  3G71 A;  1JJG A;  3K8A A;  4X64 Q;  4DV6 Q;  4PG3 A;  2RF4 A;  1MJC A;  4A3F H;  2NVX H;  1KRS A;  1NMG A;  1UE7 A;  3JAM i;  1YI2 A;  4LF7 Q;  1TWH H;  4GOP B;  4GLA C;  4AYB E;  4HJA A;  2B63 H;  5M5W H;  4Y52 H;  1FL0 A;  1G51 A;  1IBL Q;  3I4O A;  4DV2 Q;  4YCV A;  4GLV B;  2WFW A;  4DUZ Q;  1JB7 A;  1HJP A;  1MKH A;  4R4C A;  4RG1 A;  3A0J A;  3J81 i;  1NE3 A;  5IP9 G;  2R93 H;  3CMA A;  2E5L Q;  4DV0 Q;  4XIG S;  3GTP H;  3AYH B;  4DAY B;  2D62 A;  1VQF A;  4A4I A;  5C4J H;  1MJE A;  1N36 Q;  2VL6 A;  1VQL A;  3PUV A;  5IP7 G;  3PUY A;  5JJI A;  1VQA A;  2C35 B;  1UEB A;  3KF8 B;  3K7A H;  4JI6 Q;  1NJI C;  4L5S A;  5JJL A;  3PO3 G;  3A74 A;  2UUB Q;  5E7N A;  4DPG A;  1XMQ Q;  3TS0 A;  2GVB A;  2I5H A;  4R4O A;  3GD7 A;  4LF9 L;  2V1C C;  4IPD A;  4HIK A;  3GTG H;  1IZ6 A;  2VW9 A;  4OX9 L;  3ULJ A;  2JA9 A;  1S40 A;  1EIY B;  1E22 A;  4DR1 L;  4JI5 L;  3FKI H;  4DV1 L;  4DR2 L;  1CSQ A;  5C0X G;  4JV5 Q;  4BY1 G;  5BR8 L;  4A3L H;  3PUX A;  4JBM A;  1PA6 A;  4UY8 C;  1YHB A;  2Y0S G;  3W1G A;  4IPC A;  1J5E L;  1PHJ A;  1Q86 C;  1X3G A;  3IRB A;  3S17 H;  4A3E H;  4A3F G;  3AFQ A;  5C44 G;  5M3M H;  3I4N H;  4B3M Q;  4JI7 L;  4BY7 H;  3DLL A;  4HJ9 A;  4A3I G;  3GDE A;  1YIT A;  3HOY G;  3B6Y A;  4EX5 A;  2ASB A;  4IOA A;  4APV A;  1N32 L;  2E2H H;  4IOC A;  3KJP A;  3KLW A;  1XMO Q;  4QL5 A;  3CCS A;  5ELO A;  1XNR L;  4DV5 L;  4JYA Q;  3L2P A;  4GKK Q;  3G4S A;  3H0G H;  4X62 Q;  4LUZ A;  2F4V L;  4LF4 Q;  2ES2 A;  1Q12 A;  4NXN Q;  3I4M H;  1VQK A;  3G48 A;  4K0K Q;  3HKZ G;  3STB C;  4X6A H;  4TQU S;  1WFQ A;  4OON A;  4B3S Q;  2MNA A;  4JOI A;  3KJO A;  3GO5 A;  2Z0S A;  2N8N A;  1WCM H;  2ZM6 Q;  2K5V A;  3CXC A;  1YHQ A;  4LF5 L;  4BXX G;  2YU9 H;  2JA8 H;  1U0L A;  2L15 A;  5IYB H;  1RIP A;  1L1O C;  1K8A C;  3AEV A;  3FKI G;  2KEN A;  4JI1 Q;  2UU9 L;  2UXC Q;  3GTM H;  4B3R Q;  1RL2 A;  3LGJ A;  4LFC L;  1M1K C;  3OYY A;  1A0I A;  2BA1 A;  4KHZ A;  2R7Z G;  2VQE Q;  3TS2 A;  4DR6 L;  3RLN A;  1OXS C;  1XNQ Q;  2UUC L;  4R1J A;  1PVO A;  3MXN B;  3RZD H;  3S1N H;  4A3J H;  2AMC B;  3UE0 A;  2IT1 A;  1QZH A;  3PCO B;  1VQO A;  3HOU G;  3D31 A;  3HOX G;  3K81 C;  4O2D A;  1X9N A;  1FGU A;  2NZO A;  4MTN A;  3CCE A;  2JA6 G;  2E8G A;  3HOW H;  3HOV G;  3OTO L;  1PH5 A;  1Q82 C;  4HIO A;  3HOZ H;  1GVP A;  1WI5 A;  3EN2 A;  3ERS X;  4R4I A;  3H0G G;  1TWF H;  4JI8 L;  3DM3 A;  3CF5 A;  1PH7 A;  3NEL A;  5K36 G;  1OXT A;  2WB1 G;  3CAM A;  1LYL A;  3J7Z C;  5IP9 H;  4DUY L;  1CKN A;  4OO1 G;  5JJK A;  1YJW A;  3M3Y H;  4DR4 L;  1SRO A;  4EQ5 A;  3CC4 A;  1C7Y A;  1E1T A;  1Z47 A;  3S2H H;  1GO3 E;  1VQE A;  1BBU A;  4DK6 C;  4GKJ Q;  5IP7 H;  3CME A;  3RLO A;  4GN4 B;  4JI2 L;  1EYG A;  1VQ9 A;  1XPO A;  4WJ4 A;  2R6G A;  1N34 L;  3PO3 H;  1IBM Q;  2KHJ A;  3NEN A;  1EWI A;  2YV5 A;  2AHO B;  2UXB L;  2H5X A;  4X65 Q;  1EQR A;  3KDF A;  1NY4 A;  1KD1 C;  3BU2 A;  4BA1 I;  2Q2U A;  4NXM L;  1B7Y B;  2K4K A;  4GOP C;  2EIF A;  2WAQ E;  2YYZ A;  1GM5 A;  2UUA Q;  4BY1 H;  1V43 A;  4JI0 Q;  3F1Z A;  3RZO H;  5C0X J;  4YY3 Q;  2K52 A;  4PZ8 A;  1VS0 A;  3PV0 A;  4MZ9 A;  3W5O A;  4X66 L;  3S16 H;  2CWA A;  5H1S E;  5C0X I;  3F2D A;  5C44 H;  5IE8 A;  2NN6 G;  2RHS B;  3KF6 A;  2OTL A;  3HOZ G;  2HHH L;  2IHF A;  1X3F A;  1N33 L;  1YBY A;  4L5T A;  3SGI A;  4POF A;  4A3I H;  3HOY H;  2PNH A;  3I55 A;  4BA2 I;  4DR7 L;  1YEZ A;  1WJJ A;  2ZJQ A;  5GRO A;  3ER0 A;  1HNX L;  2B29 A;  2HQL A;  2YTV A;  1V1Q A;  1PH9 A;  3E0E A;  2KHI A;  1EFW A;  5C4X G;  3RR5 A;  2JA5 G;  4OXP A;  1XPR A;  1PYB A;  1Q8K A;  4DV3 Q;  2E2I H;  3PUZ A;  4QIW E;  1IL2 A;  1XPU A;  2AKW B;  1QZG A;  2CKZ B;  4LF6 L;  5C3E H;  5IYC G;  4LFA L;  4DV1 Q;  4DR2 Q;  1KIX A;  3HFZ B;  4QY7 A;  4YWL A;  1JE5 A;  3I7F A;  5FLX c;  4C3H H;  3NBH B;  1U5K A;  1KHI A;  1Y1W G;  4BXX H;  3S15 H;  2VZA A;  5GAH C;  1J5E Q;  4A3D G;  4X64 L;  4DV6 L;  1JJ2 A;  2IHE A;  5FJ8 G;  2JEA I;  2NZH A;  4PZ6 A;  4A3M G;  1YJN A;  3I2Z A;  3U50 C;  4LF7 L;  3J7A 5;  4IPG A;  4KLK A;  4LW1 A;  2OQK A;  1L1O A;  4O0A A;  1IBL L;  3UDI A;  4LFB Q;  3BZK A;  3M9B A;  4DV2 L;  4JI7 Q;  4L5R C;  4TVA B;  2I5M X;  2R7Z H;  3EBE A;  3PF5 A;  1I94 Q;  1HNW Q;  1CSP A;  4R4Q A;  4DUZ L;  3PGZ A;  2GN5 A;  1BBW A;  4L5Q A;  2BH2 A;  4C3J H;  4JI4 L;  4GNX B;  1XNR Q;  1NTG A;  3KFU A;  4DV0 L;  4GLX A;  2LSS A;  1TWC H;  4C2M H;  3VDY A;  1N9W A;  1D8L A;  1QUQ A;  1N36 L;  3HOU H;  3HOX H;  4OWW B;  3HOV H;  2JA6 H;  4DR5 Q;  1IYJ B;  1HR0 Q;  3T1H Q;  3BJU A;  4YWM A;  5AJ3 L;  1PYS B;  4A3C G;  2KBN A;  4PZ7 A;  4BBR G;  1K73 C;  1PFS A;  1LTL A;  1Q1E A;  4JBK A;  1XMQ L;  2JQO A;  1X54 A;  2Q2H A;  3CC2 A;  4A75 A;  1VQJ A;  1R9T H;  3TEH B;  3CQZ H;  1E7Z A;  3K7U C;  1SN8 A;  4GN5 A;  3UDX A;  5FLM G;  5C3E G;  4C3I H;  1E24 A;  1WOC A;  1Y14 B;  1JJC B;  4KHP Q;  3RLF A;  3J81 j;  1VQP A;  4OO1 I;  1IXR A;  5GAD C;  3RN5 A;  1ASZ A;  2CWP A;  1MIU A;  2UUC Q;  2A8V A;  2MO1 A;  1L2F A;  2D0P A;  3KF6 B;  4DK3 C;  2Y0S E;  3EIV A;  3S1M H;  1TWG H;  1LUZ A;  3W1B A;  4AQY Q;  4B3M L;  1P16 A;  1W2B A;  2ALY B;  4GS3 A;  1CKO A;  4ME3 A;  1M90 C;  2JA7 G;  3STB D;  5IWA Q;  1SR3 A;  2PI2 E;  3KYH C;  2VY3 A;  3FHW A;  5IYD G;  1X3E A;  1XMO L;  4A3G G;  3RNU A;  1OXV A;  1SLJ A;  1CUK A;  3OTO Q;  4GOP A;  4IO9 A;  4GKK L;  2K5H A;  4X62 L;  4A3B G;  1UWV A;  3JAM c;  1VQ6 A;  1C9O A;  4LF4 L;  3D0F A;  4JI8 Q;  4NXN L;  2F52 A;  1Q81 C;  1VQC A;  2VNU D;  4DV4 Q;  4MNO A;  3T1Y Q;  4K0K L;  4UPA A;  4DUY Q;  1PH2 A;  4BBS G;  4OWT B;  1TXY A;  4B3S L;  2JK8 A;  2N49 A;  2LXK A;  3J81 c;  1HH2 P;  4AH6 A;  3MEF A;  4LF8 L;  2VQF Q;  1K0R A;  3HKZ E;  1QVG A;  1YIJ A;  2MO0 A;  3A5U A;  3PO2 G;  2NN6 I;  4YHH Q;  4POG A;  4R4T A;  1L0W A;  4DR3 L;  3S2D H;  1JT8 A;  5C4X H;  4JI1 L;  1N34 Q;  2ZTC A;  3ULP A;  2JA5 H;  4P74 A;  2UXC L;  3RN2 A;  4B3R L;  1VCI A;  5J3B A;  2I5L X;  3KOJ A;  3S1R H;  4NXM Q;  3CD6 A;  2OQ0 A;  2VQE L;  1S72 A;  2A1A A;  5LMN Q;  4DV7 Q;  1XNQ L;  3M4Q A;  5IYC H;  1PV4 A;  5EAY A;  1HNZ Q;  1EUJ A;  4B3T Q;  1Y1W H;  4IFD J;  4AYB G;  2JEB I;  4RMF A;  2UXD Q;  1GD7 A;  2E2J H;  2AWO A;  4A3D H;  2IY5 B;  4IPH A;  2PI2 A;  5FJ8 H;  4X66 Q;  2QEX A;  4A3M H;  1X55 A;  1N8R C;  4YWK A;  2E5L L;  4A3K H;  5IT9 c;  1HZ9 A;  2EQS A;  4JOI C;  5HGQ A;  1IBK L;  4IJH A;  4OWX B;  1Q46 A;  4QJF A;  1UE1 A;  3Q8D A;  2QGQ A;  3NEM A;  2EXD A;  4LWC A;  4YCU A;  3S24 A;  2Q2T A;  1N33 Q;  2R92 G;  5M5X H;  4A76 A;  4DR7 Q;  4JI3 L;  1K83 H;  2VUM G;  4P73 A;  1A62 A;  3H15 A;  3PSI A;  3F2C A;  4H02 A;  3GTJ H;  1PH1 A;  3H3V H;  3HOW G;  1BVS A;  3E9I A;  5IY0 A;  1EIF A;  1NMF A;  2K14 A;  4HJ8 A;  1X65 A;  2WB1 E;  3A5Z B;  4JC0 A;  1OTC A;  3CP0 A;  2ZJR A;  2NVQ H;  2CCZ A;  1QVC A;  3CC7 A;  3H3V I;  3GTL H;  2PMZ E;  3CPW A;  4A3C H;  2BH8 A;  4BBR H;  3CCQ A;  4IJL A;  1K3R A;  1IBM L;  1W3S A;  1VQM A;  1DGS A;  4LF9 Q;  2CFM A;  4X65 L;  2KCM A;  3GTK H;  2RCN A;  4JBJ A;  3TRZ A;  4P75 A;  1EQQ A;  4A93 G;  4OX9 Q;  3OW2 A;  3E9H A;  4DR1 Q;  2UUA L;  4JI5 Q;  5FLM H;  2RHQ B;  1A63 A;  2NVY H;  2FXQ A;  2JE6 I;  1VQ4 A;  5BR8 Q;  1SFO H;  2Z6K C;  4JI0 L;  1A8V A;  2DUD A;  1FJG L;  4YY3 L;  4IFD G;  5LMU L;  1K8G A;  4GNX C;  3U4Z A;  1S3O A;  3F2B A;  3ZJY C;  4JI4 Q;  3CW2 C;  5LMN W;  5JEA J;  4A3K G;  4HIM A;  1ASY A;  2R7D A;  1VQD A;  3JC6 6;  1CKM A;  1OXU A;  2BA0 A;  4UP9 A;  2JA7 H;  1N32 Q;  1FVI A;  3CCL A;  5GAE C;  4A3G H;  5IYD H;  1CKN B;  5AJ3 Q;  2R7F A;  1Q7Y C;  4DV5 Q;  1VQ5 A;  1Y1V G;  3M85 A;  4A3B H;  1KAW A;  1SE8 A;  4DV3 L;  2F4V Q;  3BZC A;  1E3P A;  1YHA A;  1XTD A;  2K50 A;  3L0O A;  1P8L A;  1PH3 A;  2ZTE A;  2B3G A;  4BBS H;  4JI6 L;  3UDG A;  4LUO A;  1VQ8 A;  3AQQ A;  3UE1 A;  2UUB L;  1Q1B A;  4JCV E;  4LF5 Q;  2WP8 J;  4AIM A;  4JBW A;  1VQH A;  3KDF B;  4HID A;  3PO2 H;  5GAG C;  2GVA A;  1D7Q A;  2MQH A;  4YCW A;  3CCU A;  4HJ7 A;  1Z9F A;  1KXL A;  2UU9 Q;  2UXD L;  1JMC A;  4J15 A;  2B63 G;  4JV5 L;  1E1O A;  2JJQ A;  4LFB L;  4GN3 B;  2PQA A;  4LFC Q;  2A19 A;  1J6Q A;  1I94 L;  1HNW L;  1YJ9 A;  4DR6 Q;  2XTI A;  3M4O H;  4JG2 A;  1KL9 A;  1BKB A;  2ATW A;  4NPS A;  3TQY A;  1I50 H;  2Q2I A;  5JEA G;  1HZA A;  3F8T A;  3CCR A;  2R93 G;  3U4V A;  1C0A A; 
#chains in the Genus database with same CATH topology
 2JA7 B;  1EOV A;  1C4Q A;  5M5Y H;  4S3S A;  5JJK A;  1ET9 A;  3AFP A;  4DR5 L;  1HUN A;  3CCM A;  1EZ8 A;  2R92 H;  4FDB A;  3S14 H;  2I0Q A;  2ZTD A;  2EJM A;  4ODG A;  5FOB B;  3FP9 A;  2BDN A;  2QDB A;  1JWU D;  3VR5 A;  4UP8 A;  1TVX A;  2NYZ D;  4JI2 Q;  1AE2 A;  2K75 A;  1GOZ A;  4U67 3;  4A3E G;  3PIO A;  1EQT A;  4QQB X;  2CQO A;  1VQB A;  1V9P A;  2WAQ G;  1L1O B;  3M4O B;  4A93 H;  1PRT B;  4G4K A;  1EU3 A;  4ALP A;  4OGQ C;  1I5F A;  2E5L Q;  1SRU A;  1U4M A;  3C1F A;  2E74 C;  1UAP A;  1PH8 A;  2Z6K A;  5EKK A;  5IT9 E;  1GXD C;  2N78 A;  2HT1 A;  2OCE A;  2PYK A;  3M4P A;  4IFD I;  1BCP B;  3PIP A;  1DOL A;  1STB A;  4KD4 A;  5D14 A;  3JAM L;  1I4R A;  3NSW A;  4NB3 A;  2YTY A;  4HTH A;  2IWH A;  4KN4 C;  1H95 A;  2DGY A;  4DXF A;  2ZJP A;  2Z4H A;  1SMX A;  5IYB G;  1G29 1;  2IX1 A;  4IUT A;  3CPF A;  1QVF A;  1JB3 A;  3CCJ A;  4XTC S;  4KTA A;  1GHK A;  4ZKC B;  2F3I A;  1PXU A;  1EY7 A;  1F77 A;  4DAM A;  1QIL A;  2B39 A;  1PH4 A;  3RZD B;  3S1N B;  1W6K A;  4QGU A;  2MFI A;  3GTO B;  2SOB A;  4FXG C;  5JVH 3;  1WD0 A;  1IL8 A;  4PG3 A;  1MJC A;  5FLX E;  4A3F H;  2NVX H;  2PNR C;  3JAM i;  3HOW G;  2JXM B;  1GJX A;  2B63 H;  4AYB E;  4HJA A;  3D4W A;  2L0C A;  3I4O A;  4HR7 B;  2HCI A;  2WFW A;  4X3S A;  4DUZ Q;  1JB7 A;  4ME5 A;  3E6Z X;  4R4C A;  1NE3 A;  3VYU A;  5KYI A;  4XIG S;  3GTP H;  3AYH B;  2D62 A;  4IUR A;  4FXD A;  4EVO A;  3PUV A;  4ZK9 B;  3PUY A;  1VQA A;  4JI6 Q;  5JJL A;  4I7Z C;  4ZLT F;  5E7N A;  1XMQ Q;  2AQ3 B;  4LF9 L;  3W2D A;  3WOE A;  1IZ6 A;  2X69 A;  2VW9 A;  1E22 A;  2DY8 A;  3FKI H;  2EY1 A;  4JV5 Q;  2Y0S B;  5BR8 L;  1CK1 A;  2F0K A;  2F4I A;  1SYC A;  1QNU A;  3S17 H;  5M5W B;  5C44 G;  1TR5 A;  2DJG C;  1U9R A;  4JI7 L;  3BZD B;  1LTR D;  3K5N A;  2A69 C;  2ASB A;  2R93 B;  4IOC A;  4QL5 A;  3CCS A;  5ELO A;  1XNR L;  1SYD A;  4JYA Q;  5ISR A;  4GKK Q;  3G4S A;  1AP0 A;  3NBI A;  3K7A B;  3HKZ G;  3MZ5 A;  4X6A H;  3BDL A;  2ICE C;  4OON A;  4ULL A;  4JOI A;  3GTG B;  2Z0S A;  4BXX G;  1JC7 A;  1STA A;  3J81 E;  3TDQ A;  1RIP A;  2KEN A;  2Q8T A;  3LGJ A;  5LHY 1;  4QF4 A;  1DD2 A;  2BA1 A;  4KHZ A;  2R7Z G;  1X3P A;  2GA4 B;  3GV3 A;  1OXS C;  1SYG A;  4XXE A;  5M3M B;  3S9W A;  3PQI A;  4ZCK A;  3I4N B;  1MGS A;  2A68 D;  4BY7 B;  1V1P A;  2XVS A;  4A3J H;  5KNC A;  2O4X A;  1VQO A;  3QIA A;  4O2D A;  3HOV G;  1FGU A;  1CI3 M;  4OEM B;  3CCE A;  1VMC A;  2E8G A;  1PH5 A;  3H0G B;  3HOZ H;  1W6J A;  3EN2 A;  2KEC A;  4XQJ A;  2Z8L A;  2PO4 A;  3KBG A;  3J7Z C;  3ERO A;  1B3A A;  5IP9 H;  4DUY L;  1LTS D;  1EEI D;  3HEJ A;  4RGO S;  1WCM B;  3CC4 A;  1E1T A;  1PTO D;  3A54 A;  2JA8 B;  2EY2 A;  4GKJ Q;  1UEA B;  5IP7 H;  1RTN A;  3RLO A;  4GN4 B;  4JI2 L;  1EYG A;  1VQ9 A;  1IBM Q;  2OEO A;  2SNM A;  2PPB C;  4K2L A;  1EFI D;  3KDF A;  1Y69 U;  4BA1 I;  2Q2U A;  2Z1C A;  2WAQ E;  1GM5 A;  2UUA Q;  4JI0 Q;  1TS3 A;  3RZO H;  1R4Q B;  4YY3 Q;  3K5M A;  3PV0 A;  4MZ9 A;  3W5O A;  1G2S A;  4EQP A;  2CWA A;  5H1S E;  5C0X I;  3F2D A;  3MVV A;  2NN6 G;  5EBC A;  2IHF A;  4BA2 I;  1YBY A;  3TZD A;  3SGI A;  3HOY H;  3I55 A;  3A8K E;  3OMC A;  3PIO 3;  2ZJQ A;  3MTS A;  4DU9 A;  3ER0 A;  2O5I C;  3M3Y B;  2HQL A;  4RHR A;  1FYC A;  1KNE A;  2MP1 A;  1PH9 A;  3IFT A;  3E0E A;  3NE5 B;  1EIG A;  1GUT A;  2JA5 G;  1PYB A;  1EOT A;  1BXT A;  2EZV A;  5ELC A;  1JOK A;  3PO3 B;  2ICI A;  3ND9 A;  5C3E H;  4DV1 Q;  4DR2 Q;  1KIX A;  5FK9 C;  2E2J B;  2WKD A;  2VXW A;  4C3H H;  3PIP 3;  4A3M B;  2J7Z A;  5FJ8 G;  4BY1 B;  3HG9 A;  1JOQ A;  3I2Z A;  3J7A 5;  1LTI D;  4F7X A;  4R9W A;  3UDI A;  1K83 B;  4TVA B;  1HNW Q;  4CDE C;  1CSP A;  4R4Q A;  4DUZ L;  2ZT9 C;  2EYJ A;  4RGM A;  3KFU A;  1TWC H;  4V19 0;  1Q3L A;  4C2M H;  3T51 B;  2B2W A;  1QUQ A;  3HOX H;  2M9V A;  1AN8 A;  1HR0 Q;  4DN4 M;  1H9J A;  2LKV A;  1PZI D;  3BVG A;  3ONA B;  1XMQ L;  1T5X D;  1X54 A;  4KKS A;  1PFB A;  2RDF A;  3ND8 A;  1R9T H;  3WOF A;  3FEW X;  3CQZ H;  2B2Y A;  3K7U C;  1CA5 A;  2K5Q A;  1E24 A;  3TP8 A;  1B9N A;  1VQP A;  4C56 C;  4OO1 I;  4J1M A;  3RN5 A;  2K1B A;  2HCC A;  1L2F A;  3EIV A;  1LUZ A;  3BDO A;  3W1B A;  1X32 A;  5FO7 B;  1SNC A;  3STB D;  1WD1 A;  3KYH C;  4A3G G;  1X3E A;  4GOP A;  4GKK L;  2K5H A;  4ZQ3 A;  5I2X A;  3JAM c;  1C8C A;  1VQ6 A;  5IOC A;  1IKM A;  4BBS B;  3T1Y Q;  4KV6 A;  1E2Z A;  1K8M A;  1LT6 D;  3L9A X;  1ZYR D;  2H4O A;  2JK8 A;  3R2T A;  2N49 A;  2LXK A;  1HH2 P;  4DAY A;  2WIN B;  3P7J A;  4XT1 B;  1R4P B;  3HKZ E;  1QVG A;  3A7A B;  2AQ2 B;  3A5U A;  4POG A;  4R4T A;  4DR3 L;  3D6W A;  4UAI A;  1JT8 A;  2ZTC A;  4K8I A;  3SK4 A;  1H9M A;  4P74 A;  4C3I G;  4G7H C;  4KY7 A;  2F0E A;  2F0M A;  2I5L X;  3EA6 A;  4NXM Q;  3I3C A;  1ZEQ X;  2P5Z X;  1E2W A;  1S72 A;  4DV7 Q;  4I7A A;  4K6D A;  2F0U A;  4B3T Q;  1Y1W H;  4IFD J;  1MI2 A;  2JEB I;  3P20 A;  4X66 Q;  2I07 B;  1N8R C;  4YWK A;  3CRL C;  1EIH A;  2EQS A;  2QDL A;  3DM1 A;  2VUM B;  3V2T A;  1O7L A;  2EXD A;  2R92 G;  4JI3 L;  4P73 A;  4H02 A;  1PH1 A;  3H3V H;  3E9I A;  1EIF A;  3T13 A;  2F3V A;  2K14 A;  4XT3 B;  4DGZ A;  1X65 A;  4JC0 A;  1OTC A;  3CP0 A;  3I90 A;  1ENF A;  2EPB A;  3SK5 A;  3CPW A;  2BH8 A;  2AQ1 B;  4IJL A;  1IBM L;  1VQM A;  2F0T A;  2Q8R E;  1NNX A;  4A93 G;  5CV5 A;  5J22 A;  1JWM D;  3EFX D;  2UUA L;  2QIL A;  5FLM H;  5COY A;  2NVY H;  2KHS A;  4JI0 L;  1A8V A;  1V1P B;  3FRP B;  3M7G A;  4QMG A;  4YY3 L;  2NZ1 D;  3IFD A;  4CJ2 C;  3G7L A;  5IGF A;  5LMN W;  1JCK B;  4A3K G;  2DN8 A;  4G7Z C;  3OWF A;  5M5X B;  2CHB D;  2R7D A;  4IUQ A;  1CKM A;  3FDT A;  2JA7 H;  4UP9 A;  3GTJ B;  5IYD H;  4WOR A;  3EVQ A;  4BWG B;  1Q7Y C;  3FMC A;  2CVR A;  3E0J A;  2L11 A;  5KYL A;  4A3B H;  3ERQ A;  1E3P A;  1XTD A;  1PH3 A;  1IHZ A;  4BBR B;  1DYQ A;  2L5T A;  2B3G A;  1JIC A;  3MXP A;  1NR2 A;  4XQN A;  5FKA C;  3R3O A;  2A74 C;  1EYC A;  4LUO A;  3AQQ A;  1Q1B A;  5D3I B;  4QUF A;  4LF5 Q;  4AIM A;  4JBW A;  3KDF B;  4HID A;  5IGB A;  1H9K A;  3CCU A;  1KXL A;  2Z9H A;  1CHP D;  2B63 G;  4KY6 A;  2JJQ A;  3KK7 A;  5E4X A;  4RHS A;  4LFC Q;  2A19 A;  2J0T D;  3VYS A;  2K7V A;  1B2T A;  1HNW L;  1YJ9 A;  4H0L C;  4DR6 Q;  3M4O H;  2IJ0 A;  2Q2I A;  3SXH A;  3F8T A;  3Q0A A;  2FHT A;  3IL8 A;  2EOT A;  2AWN A;  1G6P A;  5DLQ E;  5ELN A;  4DKA C;  3J80 c;  3TRE A;  1HR0 L;  3DWA A;  3LX0 A;  1PTO H;  3WDN A;  1EY6 A;  1VQN A;  1KQS A;  1U4P A;  1RD9 D;  4LF8 Q;  2A73 B;  1PFM A;  1TY0 A;  4PNY A;  1EWC A;  1FD7 D;  3Q23 A;  3J7A V;  5CBE E;  3K80 C;  3PO2 B;  5G3L D;  2KOL A;  2WAQ B;  4DNR B;  1HR0 W;  1GKH A;  4KKT A;  2KCT A;  1JOR A;  4LNQ A;  3PF4 A;  2VB2 X;  1KDC A;  3P75 A;  1X6O A;  2OWO A;  3GTO H;  5KNB A;  1VQG A;  2XGT A;  2K5N A;  5E1F A;  2N3S A;  1IBK Q;  4FYD A;  1QUQ B;  1D6E C;  2QW7 A;  3T1Y L;  1VQI A;  4FXK C;  1UE6 A;  5C4H A;  2HHH Q;  2D0O A;  2L55 A;  1NAP A;  1B3Q A;  3PUW A;  1AFP A;  4WJ3 M;  4KI0 A;  3CU7 A;  3GTM B;  4LUV A;  4DFA A;  4P71 A;  2F0Q A;  1K8O A;  4RKL A;  4DV7 L;  4XDX A;  1EY8 A;  3I56 A;  4P72 A;  1WTR A;  4B3T L;  3WWV A;  1HQR D;  5LMU Q;  4A3J G;  1AZQ A;  4X64 Q;  1KRS A;  1UE7 A;  1YI2 A;  4GOP B;  4GLA C;  5M5W H;  1H9S A;  2F0P A;  2DNE A;  1YNN D;  1A3U A;  1ZKO A;  4HMI A;  4YCV A;  3S1Q B;  4HAE A;  1GUS A;  5JEA H;  4O42 A;  3TME A;  5IP9 G;  2R93 H;  2DY7 A;  3CMA A;  4DV0 Q;  1RDP D;  1GUW A;  4DAY B;  2EJF C;  4A4I A;  1N36 Q;  2RBM A;  5IP7 G;  1XX8 A;  3TBI B;  2C35 B;  1ESR A;  3K7A H;  2I5H A;  3GTQ B;  5JAV A;  3GTG H;  2JA9 A;  1S40 A;  1U4L A;  5C3W A;  2PZW A;  1SSO A;  1HXY D;  3PUX A;  4JBM A;  1PA6 A;  4UY8 C;  5JOB A;  1J5E L;  3UI2 A;  2TMP A;  1BOS A;  1BF4 A;  2C9O A;  5M3M H;  3I4N H;  4BY7 H;  4XYQ A;  1YIT A;  5CYU A;  3HOY G;  3B6Y A;  4EX5 A;  1STY A;  1XMO Q;  2KVM A;  4N8X 1;  2AUJ D;  3K59 A;  3L2P A;  1QNK A;  5C4J B;  3H0G H;  4X62 Q;  3J80 E;  3H94 A;  3I4M H;  1JOO A;  1O7Z A;  3STB C;  2NBF A;  1I4H A;  1HTL D;  4TQU S;  2MNA A;  5E3F A;  1C48 A;  1S5F D;  3S15 B;  1PLF A;  4C3H G;  4LF5 L;  1WCM H;  2ZM6 Q;  1RKN A;  1SDF A;  2JA8 H;  5FO8 B;  2L15 A;  1SMY D;  1K8A C;  1ZXT A;  2UXC Q;  1ZYR C;  4LFC L;  1B4O A;  1M1K C;  5DAU A;  4DR6 L;  2VQE Q;  4N9T A;  2XN9 C;  2UUC L;  2EXZ A;  1MBY A;  3QR8 A;  1LLR D;  3UE0 A;  4R8N A;  3HOX G;  4PMC A;  3K81 C;  1X9N A;  2NZO A;  1CA6 A;  3OTO L;  4HIO A;  1WI5 A;  3ERS X;  3A8J E;  1S5D D;  4JI8 L;  1WVL A;  1OXT A;  3CAM A;  5LL6 X;  4NW2 A;  4X3T A;  3M3Y H;  2XWJ B;  1SRO A;  4EQ5 A;  2G9D A;  2LMC B;  4K5X A;  3S2H H;  4LMQ D;  1BBU A;  5CV8 A;  2MHV A;  3SHL A;  3CME A;  3V96 A;  2Z6B A;  1XPO A;  2R6G A;  4FNF A;  3PO3 H;  4TRD A;  4WJW A;  2YV5 A;  2AHO B;  2FIN B;  1KTK A;  2NB0 A;  3BU2 A;  1TII D;  3H91 A;  1B7Y B;  2V4D A;  2EIF A;  4M8A A;  2KCN A;  4BY1 H;  4RH6 A;  4PV1 C;  1VS0 A;  3S16 H;  1LTG D;  1ILQ A;  1MSH A;  1TWF B;  2HHH L;  1X3F A;  4A3I H;  4DR7 L;  1WTH A;  1WJJ A;  4MN3 A;  2YTV A;  3NWT A;  2JA5 B;  1V1Q A;  5I6W A;  2MPM A;  3R93 A;  3RR5 A;  2HQE A;  2L12 A;  1XPR A;  4DV3 Q;  3J7A F;  2E2I H;  1XPU A;  4QIW E;  1QZG A;  4KMU C;  2CKZ B;  1BDO A;  2PZT A;  4FP5 D;  4QY7 A;  4YWL A;  1DOK A;  2EYL A;  1Y1W G;  3K58 A;  4X64 L;  1JJ2 A;  2F0G A;  4Z9C B;  1YJN A;  4IUV A;  2F0F A;  4KLK A;  2OQK A;  2K32 A;  4O0A A;  4LFB Q;  4L5R C;  2I5M X;  3EBE A;  2OT2 A;  2RDG A;  1ENA A;  5K5P A;  4DF7 A;  4L5Q A;  4HSP A;  3EQL C;  4JI4 L;  1SEB D;  1NTG A;  4DV0 L;  3U9O A;  3SVM A;  1HRJ A;  2WV6 D;  1N36 L;  4CHT B;  1JQY D;  2JA6 H;  1IYJ B;  4YWM A;  3TP5 A;  5HGT A;  5CR3 A;  1K73 C;  3GTK B;  4JBK A;  2Q2H A;  3PMF A;  2EE1 A;  2KCC A;  3TEH B;  1SN8 A;  4GN5 A;  2F0O A;  5FLM G;  1WOC A;  1Y14 B;  1JJC B;  1SYB A;  4KHP Q;  3BYT B;  1Q8I A;  1RTO A;  4IUU A;  3C46 A;  1QG7 A;  5A2Q E;  2LFN A;  5EGT A;  5JPM C;  3I73 A;  2D0P A;  4J6H A;  1AEX A;  4AQY Q;  1H9S B;  3T16 A;  2ALY B;  5CMD A;  4GZY C;  1CKO A;  4ME3 A;  2JA7 G;  4C3J B;  5IWA Q;  2LS0 1;  1PFN A;  1TY2 A;  5IYD G;  1XMO L;  4LK1 C;  4E6I A;  4KHV A;  3HOU B;  4X62 L;  4A3B G;  1C9O A;  1RHP A;  1WTO A;  1CQF A;  1Q81 C;  1B53 A;  5C6A A;  1CZG A;  2VNU D;  1E0B A;  4MNO A;  2B2U C;  4OWT B;  1PRT D;  1LTB D;  4JVZ A;  1UNS A;  1NR4 A;  4AH6 A;  3MEF A;  3SEB A;  1LAB A;  1J8I A;  2K03 A;  1PZJ D;  2NN6 I;  3SR1 A;  4C3I B;  1HFN A;  3OWE B;  1RF2 D;  1N34 Q;  2UXC L;  1FNU A;  3RN2 A;  1XXG A;  1CQV A;  3TN2 A;  1A2T A;  1BCP D;  3CD6 A;  2VQE L;  3ITP A;  1QWY A;  5LMN Q;  5IYC H;  1PV4 A;  3S1M B;  1TWG B;  5EAY A;  1HNZ Q;  1O80 A;  4KY5 A;  3NK9 A;  5M5Y B;  3T53 B;  1DM0 B;  2F0L A;  4IPH A;  2G5D A;  1HTP A;  1K28 A;  1SBB B;  1X55 A;  4QUC A;  2E5L L;  2R92 B;  1HZ9 A;  4JOI C;  5TSS A;  5HGQ A;  4DK6 C;  4OWX B;  1Q46 A;  4LWC A;  1N33 Q;  2QGQ A;  2K05 A;  3NEM A;  4YCU A;  2Q2T A;  5M5X H;  3GV6 A;  3H15 A;  3QOL A;  3GTJ H;  3OIP A;  5I6Y A;  1PTO F;  1KAA A;  3LNN A;  4OHJ A;  2HDL A;  3VR4 A;  3S2D B;  1YNN C;  5C4X B;  1STH A;  1F2M A;  4BBR H;  3S1R B;  1B44 D;  1L0Y B;  3TRZ A;  4P75 A;  1HQM C;  2PZU A;  5T1I A;  1SYF A;  4DR1 Q;  4JI5 Q;  3RUZ A;  2CQA A;  1II3 A;  3FVQ A;  5I4D A;  2BOS A;  1QJO A;  4A3D B;  1K8G A;  1J9O A;  2QCP X;  4GNX C;  3U4Z A;  4NMZ A;  4A3K B;  1ML0 D;  5IT9 L;  1A2U A;  4DAV A;  1VQD A;  1OXU A;  3VA5 A;  1N32 Q;  5BN4 A;  3H09 A;  1S5E D;  5GAE C;  2NUC A;  3A56 A;  5AJ3 Q;  3M85 A;  1KAW A;  1SE8 A;  4DV3 L;  3RMH A;  5FO9 B;  2ZXO A;  3GTL B;  2WAC A;  1P8L A;  2ZTE A;  4JI6 L;  5DEH A;  1VQ8 A;  3G6J B;  3E3X A;  3UE1 A;  5KGU A;  4X3U A;  1VQH A;  1S5C D;  3EJI A;  3PO2 H;  2NVX B;  2MQH A;  2B63 B;  4HJ7 A;  1Z9F A;  1SFO B;  2RA4 A;  5FLX L;  4JV5 L;  4J15 A;  4MHE A;  5IIF A;  4LFB L;  4Q0F A;  1STG A;  3TQY A;  5JEA G;  3T56 B;  2R93 G;  3U4V A;  1C0A A;  4XYO A;  1D2B A;  3TP7 A;  2QA4 A;  3MC0 B;  3ULL A;  3MFY A;  2JYO A;  4DNI A;  2KEE A;  2LXJ A;  1I4Q A;  3G6E A;  4JYA L;  3IKJ A;  1PH6 A;  1RCV D;  5COR A;  1LM0 A;  4G57 A;  2F0J A;  2DJF C;  2I46 A;  3ZYY X;  2HIV A;  3NTH A;  1UE5 A;  4HJ5 A;  4KHP L;  2YTX A;  4TSS A;  4LAA A;  1YZ6 A;  3VA7 A;  3BDC A;  4X3K A;  1CZW A;  1O7Y A;  2B2T C;  5BN5 A;  5EJW A;  1O78 A;  4B9X A;  3HZX A;  1JWS D;  4AQY L;  5M3M G;  3I4N G;  2UXB Q;  4BY7 G;  1SNO A;  1I6H H;  1HHV A;  1IW7 D;  5IWA L;  1STN A;  4N9P A;  2PQE A;  1YNX A;  1YVC A;  2OF1 A;  4AYB B;  4IFD H;  1T9H A;  2IX0 A;  1G91 A;  1KRT A;  3M7N A;  3L7Z C;  3QO2 A;  3I4M G;  1QOH A;  3S1Q H;  5M3F B;  3NP8 A;  3BVM A;  4ILW A;  4UP7 A;  1A3T A;  4FF3 A;  1Y8O B;  3MA2 B;  1WCM G;  4QIW B;  1HNX Q;  5I9P A;  2JA8 G;  1EU4 A;  3FPU B;  1EY5 A;  1AE3 A;  2ID0 A;  4DXG A;  3J81 L;  2EVB A;  4HCS A;  5DM7 3;  1B9M A;  4CJ0 B;  2PQA B;  5C5L A;  2B2V C;  2F0D A;  2VS1 A;  4GKJ L;  1I3Q B;  5I2Y A;  1TWA B;  3UDF A;  4Y7N H;  5LMN L;  3GTQ H;  1EL0 A;  4LF6 Q;  3NXW A;  1B70 B;  5ELB A;  1HZC A;  1HNZ L;  1FJG Q;  2RSN A;  3DEP A;  1OXX K;  5HY6 A;  4PMW A;  1JJG A;  3K8A A;  3CHB D;  1SYE A;  4DV6 Q;  1SND A;  1NMG A;  2E2D C;  3SE0 A;  4LF7 Q;  1TWH H;  2NVT B;  4Y52 H;  1FL0 A;  1G51 A;  4DV2 Q;  4GLV B;  3H3V C;  1LAC A;  2R3Z A;  4RG1 A;  3J81 i;  5EPJ A;  3DMU A;  4KJO A;  5C4J H;  3L3O C;  2VL6 A;  1Y1V B;  4ZAI A;  1UEB A;  5D65 A;  1NJI C;  2WKC A;  4L5S A;  3PO3 G;  1ENC A;  3A74 A;  2F0S A;  4QCL A;  2UUB Q;  2XIW A;  3TS0 A;  3GD7 A;  1SNM A;  3OMG A;  2F03 A;  4ZRZ A;  3ULJ A;  4DR1 L;  4UDU C;  4JI5 L;  4DV1 L;  4DR2 L;  1CSQ A;  3DWP A;  3DHQ A;  1MHW C;  1I4G A;  4BY1 G;  4A3L H;  1LT3 D;  1WTX A;  3W1G A;  4IPC A;  4WFN 3;  3K57 A;  1X3G A;  3IRB A;  1EZ6 A;  4A3F G;  3AFQ A;  4TKO B;  3HOY B;  1SXT A;  1EY4 A;  4HJ9 A;  4A3I G;  4IOA A;  1N32 L;  4APV A;  3AMU A;  1F2Z A;  1ONL A;  4LUZ A;  2ES2 A;  1VQK A;  3G48 A;  1D1K A;  4NDX A;  4K0K Q;  3JAM E;  3OSO A;  4ZUJ A;  1U4R A;  1WFQ A;  5HUR A;  1BUV T;  2A68 C;  3GO5 A;  2EYP A;  3TSS A;  4RGT A;  2E76 C;  1L1O C;  3FKI G;  1I4P A;  1PRT C;  1MD2 D;  3OYY A;  2F1M A;  2JSO A;  3K0Y A;  2B8G A;  1K0S A;  4A3E B;  2BE5 D;  3RLN A;  4G7O C;  1XNQ Q;  2K28 A;  1TWC B;  3N6R A;  4R1J A;  5ELD A;  1PVO A;  1D5Z C;  4C2M B;  1JR0 D;  3MXU A;  3RZD H;  3S1N H;  2E2H B;  1QZH A;  1PTO C;  3PCO B;  4NP5 A;  1SJE D;  1BCP C;  2JA6 G;  4MTN A;  5KEE A;  2HUG A;  2NN6 H;  1Q82 C;  2QF7 A;  3HP3 A;  4R4I A;  1TWF H;  1F2L A;  3DM3 A;  1PH7 A;  4U68 A;  3CQZ B;  1F9R A;  1KNA A;  2WB1 G;  1LYL A;  1HA6 A;  1CKN A;  1SE4 A;  3DUZ A;  5DM6 3;  4HCE A;  1DZ1 A;  2PCF B;  1C7Y A;  1LT5 D;  1Z47 A;  4DAP A;  1VQE A;  4B08 A;  2YU9 B;  5G3L F;  3URY A;  3OHX C;  1OO9 B;  4WJ4 A;  4L8J A;  1FGB D;  4N8F A;  1T5E A;  3NEN A;  1EWI A;  3MEH A;  2RVL A;  2UXB L;  1EQR A;  4NXM L;  1F9S A;  2FMM A;  2YYZ A;  3BYY B;  5C0X H;  3F1Z A;  4RWS C;  1VMP A;  3KLS X;  5C0X J;  2K52 A;  3IAY A;  1PYW D;  3HOW B;  4X66 L;  1WTQ A;  5D3D A;  2RDH A;  5IE8 A;  2RHS B;  2OTL A;  3HOZ G;  4POF A;  2PNH A;  1YEZ A;  3O13 A;  1HNX L;  1GUN A;  2B29 A;  1Y8N B;  2OXP A;  1F9Q A;  2KHI A;  4HED A;  3QB3 A;  4OXP A;  1A3V A;  1Q90 A;  1Q8K A;  1YNJ D;  2NTT A;  5C5M A;  1IL2 A;  3K5L A;  4JK1 C;  2AKW B;  1TS5 A;  1LO5 D;  4LF6 L;  5T1G A;  5IYC G;  1NUC A;  3HFZ B;  1JE5 A;  3I7F A;  5E4W C;  5FLX c;  1SE3 A;  4ID6 A;  5GAH C;  4DV6 L;  2JEA I;  2IHE A;  4JW0 A;  2NZH A;  4LF7 L;  1KLU D;  4IPG A;  4LW1 A;  5ELF A;  4DV2 L;  4JI7 Q;  3PF5 A;  3NTK A;  2XRS D;  5C44 B;  2GN5 A;  1FNV A;  4C3J H;  1XNR Q;  4GLX A;  4JPB W;  1D1I A;  1VF5 C;  4O1N A;  1JE4 A;  1D8L A;  4FF1 A;  3HOU H;  4EQO A;  4V0B A;  3C1E A;  4CKE A;  3T1H Q;  1PYS B;  3TZU A;  4K14 A;  4BBR G;  1XWE A;  3HKZ B;  4CKB A;  3CC2 A;  5K36 H;  5EKL A;  3OW7 A;  1B1Z A;  1VQJ A;  4OO1 H;  1VDZ A;  3AU7 A;  1ICF B;  3UDX A;  5C3E G;  4C3I H;  3RLF A;  2EY6 A;  3BS1 A;  4ZYS A;  4B9W A;  5F2D A;  2CWP A;  1MIU A;  2A8V A;  3KF6 B;  3S1M H;  2R7Z B;  1TWG H;  4RA8 A;  1P16 A;  4NKL A;  4GS3 A;  3MXG A;  3P1H A;  2G9H D;  4WRD A;  1CFM A;  2F0N A;  2K5W A;  3T4A C;  4R8I A;  3RNU A;  4A3B B;  3D8G A;  4FVM A;  1UWV A;  1V8Q A;  3HOV B;  3D0F A;  2F52 A;  1VQC A;  2PW7 A;  4DV4 Q;  4K0K L;  2EYO A;  1QE6 A;  2HD3 A;  1IW7 C;  4DUY Q;  1FR3 A;  1PH2 A;  4ABN A;  1TXY A;  3A8I E;  5CBA E;  3J81 c;  4F87 A;  4LF8 L;  1BBX C;  2VQF Q;  3PO2 G;  3X3N A;  4PMB A;  4YHH Q;  3S2D H;  5AFW A;  3KF8 A;  3OIQ A;  5C4X H;  3ULP A;  4DK1 A;  3KOJ A;  3S1R H;  2OQ0 A;  2A1A A;  4Q5V A;  1XNQ L;  2WII B;  3HRZ C;  1KDB A;  2UXD Q;  3A55 A;  2IY5 B;  4RMF A;  2E2J H;  4A3D H;  4A3M H;  2JP1 A;  1PTO B;  3VYT A;  1AZP A;  4A3K H;  2C5C A;  2FMC A;  3FPP A;  1IBK L;  1UE1 A;  1EY0 A;  2O2L D;  3S24 A;  1RJT A;  2BCO A;  4IAL A;  4A76 A;  1K83 H;  3TP6 A;  4CDF C;  1CTM A;  2VB3 X;  2NTS A;  3F2C A;  2H1E A;  5J1Z A;  3VR6 A;  2WB1 E;  2ZJR A;  1EY9 A;  3DEO A;  2CCZ A;  1QVC A;  3CC7 A;  4OL7 A;  3H3V I;  3GTL H;  2PMZ E;  2ZXR A;  4HMJ A;  4A3C H;  3CCQ A;  1PZK D;  1DGS A;  1LTT D;  2CFM A;  1K3B C;  2MGS A;  5EBD A;  3K6O A;  1EQQ A;  1SE2 A;  4OX9 Q;  1DON A;  3OW2 A;  3E9H A;  2RHQ B;  1A63 A;  2FXQ A;  2JE6 I;  1VQ4 A;  4IFD G;  1SFO H;  2Z6K C;  5LMU L;  2PW5 A;  1S3O A;  4RGN A;  3F2B A;  3ZJY C;  2NWG A;  2N88 A;  4L63 B;  3MXN A;  1HPC A;  4XQQ A;  1FVI A;  2F0W A;  1NCV A;  2K5D A;  1CKN B;  2A6E D;  1VQ5 A;  4DV5 Q;  1XTC D;  2NVQ B;  5J39 A;  2F4V Q;  3E5S A;  3SK6 A;  1YHA A;  4HN7 A;  2K50 A;  3L0O A;  4BBS H;  2B2U A;  5L37 A;  3N52 A;  2A6H D;  3DXJ C;  2WP8 J;  5GAG C;  2K04 A;  2SEB D;  1DXM A;  3NPP A;  2UU9 Q;  3KLR A;  1KLG D;  3NQI A;  4GN3 B;  1TU2 B;  2PQA A;  1J6Q A;  4L6T B;  3VR2 A;  1KL9 A;  2CH4 A;  1HFG A;  5IGE A;  2XNA C;  1ROD A;  4ZKB B;  4A3G B;  1B8A A;  1KC8 C;  1TT2 A;  1NBW A;  3T1H L;  2BE5 C;  2MUY A;  2LY7 A;  5M3F H;  2OTJ A;  2VUM H;  3GP7 A;  1AW7 A;  3HKS A;  5JVG 3;  4F88 A;  1Y8P B;  4FF2 A;  4DR3 Q;  1G8Z D;  2RCF A;  4QB4 A;  4DR4 Q;  4CKC A;  4RCO A;  1XJV A;  1LTA D;  1AH9 A;  3K0X A;  4A3L G;  2SNS A;  2ZM6 L;  4H44 C;  4KK7 A;  1I3Q H;  1TWA H;  1KAB A;  5GQO A;  3C3L A;  4FF4 A;  5EPL A;  3NBH A;  1O7I A;  4C1N I;  2D9U A;  1I50 B;  1PDQ A;  1NSN S;  5M9O A;  3J7Y W;  1K9M C;  2F3W A;  4CJ1 B;  1WYD A;  1HZB A;  3U58 A;  1STE A;  2NVT H;  3I4M B;  2L1B A;  5IGC A;  3J80 L;  4JI3 Q;  4RFB A;  4DV4 L;  3BG3 A;  1PRT F;  4GNX A;  3S14 B;  1VQ7 A;  1E2V A;  2A5H A;  2EYF A;  4BS9 A;  2VQF L;  1VF7 A;  4YHH L;  1Y1V H;  3CCV A;  4MTK A;  1BCP F;  3I72 A;  2QKI C;  1B50 A;  4LFA Q;  3LWU A;  4A93 B;  3J80 i;  2HIX A;  3ICE A;  1X56 A;  3SDZ A;  2UXD L;  3G71 A;  1YNJ C;  2RF4 A;  1Z7T A;  1IBL Q;  3CKI B;  3NWS A;  1HCZ A;  1HJP A;  1MKH A;  3A0J A;  3S2H B;  4K8J A;  3R8B A;  1QCB D;  1VQF A;  3AB9 A;  1WTW A;  1MJE A;  1VQL A;  2XWB B;  2K6A A;  5JJI A;  1EWH A;  3KF8 B;  2CW0 D;  4DPG A;  5BN3 A;  2GVB A;  4R4O A;  1L0X B;  5NUC A;  1I4X A;  2V1C C;  3LWE A;  4IPD A;  4HIK A;  3MFG A;  4OX9 L;  1EIY B;  3QG1 A;  5C0X G;  3R2I A;  4H7B A;  5ELE A;  1YHB A;  2Y0S G;  3S16 B;  4A3F B;  1PHJ A;  1Q86 C;  5DNF A;  4A3E H;  2B2T A;  4A3I B;  1IYU A;  5KIX A;  4B3M Q;  3DLL A;  3GDE A;  3HGB A;  1EYD A;  2E2H H;  3KJP A;  3KLW A;  3RD4 A;  3GTP B;  1EEF D;  4DV5 L;  1SMY C;  2E2I B;  4RKB A;  2F4V L;  3D3R A;  4LF4 Q;  1Q12 A;  4EGV A;  4NXN Q;  1BR9 A;  2O5J C;  1D5M C;  1UUP A;  2D5D A;  2L4N A;  4B3S Q;  3KJO A;  2N8N A;  2F0I A;  1CT1 D;  2K5V A;  3CXC A;  3I8Z A;  1YHQ A;  2YU9 H;  3FKI B;  1U0L A;  3OOC A;  5IYB H;  3AEV A;  4JI1 Q;  2UU9 L;  1BNZ A;  3GTM H;  1HUM A;  1RL2 A;  4B3R Q;  4DK0 A;  2FFK B;  1A0I A;  3TS2 A;  3S17 B;  3QOJ A;  2KJX A;  2B2V A;  1ESF A;  3HS0 C;  1GUG A;  4C3J G;  2AUK A;  1X3Q A;  2QEJ C;  2B2W C;  3MXN B;  2RKS A;  2AMC B;  2JA6 B;  3I70 A;  2IT1 A;  3HOU G;  2F0H A;  3D31 A;  4HSV A;  1G6Z A;  2RSO A;  2SDF A;  3CRK C;  3HOW H;  5CV9 A;  1GVP A;  4M1U B;  2CH4 W;  3H0G G;  2WB1 B;  3CF5 A;  5CC4 A;  3NEL A;  5K36 G;  2B2Y C;  2XRQ D;  3QJY A;  2PMZ B;  3NTI A;  2MJ8 A;  4OO1 G;  1YJW A;  4DR4 L;  1GO3 E;  2M00 A;  4CGY B;  3D4D A;  1WTP A;  4K5W A;  1N34 L;  5A2Q L;  2KHJ A;  5IGG A;  2H5X A;  4X65 Q;  1KD1 C;  1NY4 A;  1IKL A;  2K4K A;  4GOP C;  3SK8 A;  5I9O A;  2KA7 A;  4A3J B;  1V43 A;  3D6C A;  4PZ8 A;  4P2C B;  2K01 A;  3MAQ A;  3HOZ B;  3I91 A;  3C2P A;  5C44 H;  4FO2 A;  1ET6 A;  4H13 C;  3KF6 A;  5KRU A;  1N33 L;  4L5T A;  4DA2 A;  3D4R A;  5EKI A;  1IYV A;  4IZ8 A;  5GRO A;  1D5X C;  1PMR A;  5A35 A;  5EPK A;  1CM9 A;  2L9H A;  1EFW A;  5C4X G;  4J8Q A;  4F8M A;  3PUZ A;  4DNT B;  4K2K A;  1DOM A;  4CDC C;  4LFA L;  2A6E C;  5C3X A;  4OEL B;  3NBH B;  1U5K A;  1KHI A;  4BXX H;  3S15 H;  2VZA A;  1J5E Q;  4OIK A;  4A3D G;  4A3M G;  4PZ6 A;  3U50 C;  3RZO B;  1L1O A;  5CV7 A;  1IBL L;  3BZK A;  3M9B A;  3M4Y A;  2R7Z H;  1I94 Q;  2A6H C;  3PGZ A;  1BBW A;  2DNC A;  2BH2 A;  4GNX B;  1ICW A;  2LSS A;  4UHV A;  2X6G A;  1DCZ A;  3K5O A;  4CDD C;  1N9W A;  3VDY A;  4OWW B;  3HOV H;  4DR5 Q;  3BJU A;  4K6L A;  5AJ3 L;  4A3C G;  1XYI A;  2KBN A;  4PZ7 A;  4K5V A;  1PFS A;  1LTL A;  1SJH D;  2D2C C;  1Q1E A;  5EQ0 A;  1HA5 A;  2JQO A;  4RCN A;  2BDO A;  3KLS A;  4A75 A;  5C3E B;  1SAP A;  3V05 A;  1E7Z A;  2R61 A;  3KUP A;  4C3H B;  1GUO A;  5LL6 S;  2A69 D;  3J81 j;  4KJN A;  4KN7 C;  1IXR A;  5GAD C;  1S5B D;  3VR3 A;  1ASZ A;  2UUC Q;  3NUC A;  2MO1 A;  4DK3 C;  2Y0S E;  2B8F A;  4B3M L;  1W2B A;  4KKU A;  3W3A A;  1M90 C;  2Z4I A;  4IQZ A;  1SR3 A;  2PI2 E;  2VY3 A;  3FHW A;  4ZUI A;  2Q8I B;  1ILP A;  1OXV A;  1SLJ A;  1CUK A;  2IL8 A;  3OTO Q;  4IO9 A;  3U9S A;  1SNQ A;  2IPK D;  4LJZ C;  1FNW A;  1WTV A;  3HOX B;  4LF4 L;  4JI8 Q;  4IUN A;  4PQX A;  4NXN L;  1A6X A;  1SNP A;  4C1N K;  4UPA A;  1M4V A;  4BBS G;  2N55 A;  3A7L A;  4B3S L;  3BVZ A;  2JN4 A;  1TS4 A;  3Q6S A;  1MSG A;  1Z6H A;  5CV4 A;  1BO0 A;  3Q24 A;  1K0R A;  1R9T B;  1YIJ A;  2FJ2 A;  2MO0 A;  2IX3 A;  2X6L A;  5CV6 A;  1L0W A;  5IGD A;  4JI1 L;  2JA5 H;  2M2L A;  1TKW B;  4B3R L;  1VCI A;  3F2U A;  5J3B A;  1EYA A;  3M4Q A;  1QB5 D;  1BQQ T;  2K33 A;  1EUJ A;  3MHB A;  4AYB G;  1GD7 A;  2AWO A;  4OIJ A;  2PI2 A;  5FJ8 H;  3VYR A;  2QEX A;  1V1O A;  2KQ3 A;  5IT9 c;  3Q22 A;  4IJH A;  5M3F G;  4QJF A;  3Q8D A;  4DR7 Q;  1I6V C;  2KED A;  3H6M A;  2VUM G;  4EQN A;  1A62 A;  3PSI A;  3X3M A;  1TS2 A;  4RAU C;  1BVS A;  1EQV A;  1H9R A;  4IUP A;  2EJG C;  4KD3 A;  5IY0 A;  1NMF A;  4HJ8 A;  1LV9 A;  2EY5 A;  2F0V A;  4CBV A;  3A5Z B;  5KND A;  2NVQ H;  3DWQ A;  2EYM A;  3GQB A;  1S4Z A;  1DJR D;  5CGK A;  1K3R A;  3NQT A;  1W3S A;  1A15 A;  1I6H B;  4LF9 Q;  3GTK H;  4X65 L;  2KCM A;  1GHJ A;  2RCN A;  4JBJ A;  2J4X A;  2XSC A;  1F9P A;  2HDM A;  1M8A A;  1Y1W B;  5BR8 Q;  1FJG L;  2DUD A;  1LT4 D;  1CHQ D;  1F2Y A;  2CW0 C;  4YIJ A;  3OPO A;  4JI4 Q;  3CW2 C;  5JEA J;  2EYH A;  4HIM A;  1ASY A;  3JC6 6;  2RQX A;  2BA0 A;  3CCL A;  4A3G H;  1TQO A;  4I65 A;  2R7F A;  4MIU A;  1Y1V G;  3NHH A;  2E75 C;  3BZC A;  2KUM A;  4Y7N B;  2ENB A;  3UDG A;  5C4Z A;  2UUB L;  3I4L A;  2ZXP A;  3KBX A;  4JCV E;  5JJZ A;  2TSS A;  1KDA A;  3QWN A;  2GVA A;  1D7Q A;  2IW3 A;  1TWH B;  2NVY B;  4YCW A;  5IOD A;  3MWY W;  1JMC A;  1E1O A;  5JPN C;  1I94 L;  1G2T A;  2XTI A;  4JG2 A;  1BKB A;  4IN3 A;  4NPS A;  2ATW A;  1I50 H;  2EDG A;  1HZA A;  3CCR A; 
#chains in the Genus database with same CATH homology
 2AWN A;  1EOV A;  5DLQ E;  1G6P A;  5ELN A;  4DKA C;  2QA4 A;  5M5Y H;  1B8A A;  3ULL A;  3J80 c;  3AFP A;  4DR5 L;  1KC8 C;  3TRE A;  4DNI A;  1NBW A;  2LXJ A;  3T1H L;  1HR0 L;  4JYA L;  3G6E A;  5M3F H;  3CCM A;  1PH6 A;  1VQN A;  1KQS A;  2R92 H;  2OTJ A;  4FDB A;  4LF8 Q;  2VUM H;  3S14 H;  3HKS A;  1LM0 A;  2I0Q A;  2ZTD A;  4DR3 Q;  2HIV A;  3FP9 A;  4DR4 Q;  1AH9 A;  1XJV A;  1UE5 A;  4HJ5 A;  4KHP L;  3K0X A;  4A3L G;  2YTX A;  3K80 C;  2ZM6 L;  4UP8 A;  1YZ6 A;  4JI2 Q;  1I3Q H;  1AE2 A;  2K75 A;  1HR0 W;  1GKH A;  4A3E G;  1TWA H;  3PIO A;  4QQB X;  2KCT A;  2CQO A;  1VQB A;  1V9P A;  2WAQ G;  5GQO A;  4LNQ A;  1L1O B;  3PF4 A;  4AQY L;  5M3M G;  3I4N G;  1O7I A;  2UXB Q;  4BY7 G;  1I6H H;  1X6O A;  2OWO A;  4A93 H;  5IWA L;  3GTO H;  1K9M C;  1VQG A;  4ALP A;  2XGT A;  1YNX A;  1I5F A;  1WYD A;  1SRU A;  1YVC A;  2K5N A;  2N3S A;  1HZB A;  1T9H A;  2IX0 A;  1IBK Q;  3U58 A;  2NVT H;  1KRT A;  1PH8 A;  2Z6K A;  3M7N A;  1QUQ B;  3L7Z C;  4JI3 Q;  4DV4 L;  3T1Y L;  3I4M G;  2N78 A;  3S1Q H;  2HT1 A;  2OCE A;  3M4P A;  4GNX A;  4IFD I;  1VQI A;  3PIP A;  1UE6 A;  2HHH Q;  4UP7 A;  4NB3 A;  2D0O A;  2YTY A;  1VQ7 A;  2VQF L;  1WCM G;  1H95 A;  1HNX Q;  2DGY A;  3PUW A;  4YHH L;  2ZJP A;  5M3F G;  1Y1V H;  4KI0 A;  1SMX A;  2JA8 G;  4WJ3 M;  5IYB G;  1G29 1;  1AE3 A;  2ID0 A;  4LUV A;  3CCV A;  2IX1 A;  3CPF A;  1QVF A;  2PQA B;  4P71 A;  3CCJ A;  2VS1 A;  4XTC S;  4GKJ L;  2F3I A;  4DAM A;  3UDF A;  4Y7N H;  5LMN L;  4DV7 L;  3GTQ H;  4LF6 Q;  4LFA Q;  1B70 B;  3I56 A;  1PH4 A;  1HZC A;  4P72 A;  1HNZ L;  1FJG Q;  4QGU A;  4B3T L;  3WWV A;  3J80 i;  2HIX A;  2MFI A;  1X56 A;  3ICE A;  5LMU Q;  4A3J G;  1OXX K;  5HY6 A;  4PMW A;  3G71 A;  1JJG A;  3K8A A;  4X64 Q;  4DV6 Q;  4PG3 A;  2RF4 A;  1MJC A;  4A3F H;  2NVX H;  1KRS A;  1NMG A;  1UE7 A;  3JAM i;  1YI2 A;  4LF7 Q;  1TWH H;  4GOP B;  4GLA C;  4AYB E;  4HJA A;  2B63 H;  5M5W H;  4Y52 H;  1FL0 A;  1G51 A;  1IBL Q;  3I4O A;  4DV2 Q;  4YCV A;  4GLV B;  2WFW A;  4DUZ Q;  1JB7 A;  1HJP A;  1MKH A;  4R4C A;  4RG1 A;  3A0J A;  3J81 i;  1NE3 A;  5IP9 G;  2R93 H;  3CMA A;  2E5L Q;  4DV0 Q;  4XIG S;  3GTP H;  3AYH B;  4DAY B;  2D62 A;  1VQF A;  4A4I A;  5C4J H;  1MJE A;  1N36 Q;  2VL6 A;  1VQL A;  3PUV A;  5IP7 G;  3PUY A;  5JJI A;  1VQA A;  2C35 B;  1UEB A;  3KF8 B;  3K7A H;  4JI6 Q;  1NJI C;  4L5S A;  5JJL A;  3PO3 G;  3A74 A;  2UUB Q;  5E7N A;  4DPG A;  1XMQ Q;  3TS0 A;  2GVB A;  2I5H A;  4R4O A;  3GD7 A;  4LF9 L;  2V1C C;  4IPD A;  4HIK A;  3GTG H;  1IZ6 A;  2VW9 A;  4OX9 L;  3ULJ A;  2JA9 A;  1S40 A;  1EIY B;  1E22 A;  4DR1 L;  4JI5 L;  3FKI H;  4DV1 L;  4DR2 L;  1CSQ A;  5C0X G;  4JV5 Q;  4BY1 G;  5BR8 L;  4A3L H;  3PUX A;  4JBM A;  1PA6 A;  4UY8 C;  1YHB A;  2Y0S G;  3W1G A;  4IPC A;  1J5E L;  1PHJ A;  1Q86 C;  1X3G A;  3IRB A;  3S17 H;  4A3E H;  4A3F G;  3AFQ A;  5C44 G;  5M3M H;  3I4N H;  4B3M Q;  4JI7 L;  4BY7 H;  3DLL A;  4HJ9 A;  4A3I G;  3GDE A;  1YIT A;  3HOY G;  3B6Y A;  4EX5 A;  2ASB A;  4IOA A;  4APV A;  1N32 L;  2E2H H;  4IOC A;  3KJP A;  3KLW A;  1XMO Q;  4QL5 A;  3CCS A;  5ELO A;  1XNR L;  4DV5 L;  4JYA Q;  3L2P A;  4GKK Q;  3G4S A;  3H0G H;  4X62 Q;  4LUZ A;  2F4V L;  4LF4 Q;  2ES2 A;  1Q12 A;  4NXN Q;  3I4M H;  1VQK A;  3G48 A;  4K0K Q;  3HKZ G;  3STB C;  4X6A H;  4TQU S;  1WFQ A;  4OON A;  4B3S Q;  2MNA A;  4JOI A;  3KJO A;  3GO5 A;  2Z0S A;  2N8N A;  1WCM H;  2ZM6 Q;  2K5V A;  3CXC A;  1YHQ A;  4LF5 L;  4BXX G;  2YU9 H;  2JA8 H;  1U0L A;  2L15 A;  5IYB H;  1RIP A;  1L1O C;  1K8A C;  3AEV A;  3FKI G;  2KEN A;  4JI1 Q;  2UU9 L;  2UXC Q;  3GTM H;  4B3R Q;  1RL2 A;  3LGJ A;  4LFC L;  1M1K C;  3OYY A;  1A0I A;  2BA1 A;  4KHZ A;  2R7Z G;  2VQE Q;  3TS2 A;  4DR6 L;  3RLN A;  1OXS C;  1XNQ Q;  2UUC L;  4R1J A;  1PVO A;  3MXN B;  3RZD H;  3S1N H;  4A3J H;  2AMC B;  3UE0 A;  2IT1 A;  1QZH A;  3PCO B;  1VQO A;  3HOU G;  3D31 A;  3HOX G;  3K81 C;  4O2D A;  1X9N A;  1FGU A;  2NZO A;  4MTN A;  3CCE A;  2JA6 G;  2E8G A;  3HOW H;  3HOV G;  3OTO L;  1PH5 A;  1Q82 C;  4HIO A;  3HOZ H;  1GVP A;  1WI5 A;  3EN2 A;  3ERS X;  4R4I A;  3H0G G;  1TWF H;  4JI8 L;  3DM3 A;  3CF5 A;  1PH7 A;  3NEL A;  5K36 G;  1OXT A;  2WB1 G;  3CAM A;  1LYL A;  3J7Z C;  5IP9 H;  4DUY L;  1CKN A;  4OO1 G;  5JJK A;  1YJW A;  3M3Y H;  4DR4 L;  1SRO A;  4EQ5 A;  3CC4 A;  1C7Y A;  1E1T A;  1Z47 A;  3S2H H;  1GO3 E;  1VQE A;  1BBU A;  4DK6 C;  4GKJ Q;  5IP7 H;  3CME A;  3RLO A;  4GN4 B;  4JI2 L;  1EYG A;  1VQ9 A;  1XPO A;  4WJ4 A;  2R6G A;  1N34 L;  3PO3 H;  1IBM Q;  2KHJ A;  3NEN A;  1EWI A;  2YV5 A;  2AHO B;  2UXB L;  2H5X A;  4X65 Q;  1EQR A;  3KDF A;  1NY4 A;  1KD1 C;  3BU2 A;  4BA1 I;  2Q2U A;  4NXM L;  1B7Y B;  2K4K A;  4GOP C;  2EIF A;  2WAQ E;  2YYZ A;  1GM5 A;  2UUA Q;  4BY1 H;  1V43 A;  4JI0 Q;  3F1Z A;  3RZO H;  5C0X J;  4YY3 Q;  2K52 A;  4PZ8 A;  1VS0 A;  3PV0 A;  4MZ9 A;  3W5O A;  4X66 L;  3S16 H;  2CWA A;  5H1S E;  5C0X I;  3F2D A;  5C44 H;  5IE8 A;  2NN6 G;  2RHS B;  3KF6 A;  2OTL A;  3HOZ G;  2HHH L;  2IHF A;  1X3F A;  1N33 L;  1YBY A;  4L5T A;  3SGI A;  4POF A;  4A3I H;  3HOY H;  2PNH A;  3I55 A;  4BA2 I;  4DR7 L;  1YEZ A;  1WJJ A;  2ZJQ A;  5GRO A;  3ER0 A;  1HNX L;  2B29 A;  2HQL A;  2YTV A;  1V1Q A;  1PH9 A;  3E0E A;  2KHI A;  1EFW A;  5C4X G;  3RR5 A;  2JA5 G;  4OXP A;  1XPR A;  1PYB A;  1Q8K A;  4DV3 Q;  2E2I H;  3PUZ A;  4QIW E;  1IL2 A;  1XPU A;  2AKW B;  1QZG A;  2CKZ B;  4LF6 L;  5C3E H;  5IYC G;  4LFA L;  4DV1 Q;  4DR2 Q;  1KIX A;  3HFZ B;  4QY7 A;  4YWL A;  1JE5 A;  3I7F A;  5FLX c;  4C3H H;  3NBH B;  1U5K A;  1KHI A;  1Y1W G;  4BXX H;  3S15 H;  2VZA A;  5GAH C;  1J5E Q;  4A3D G;  4X64 L;  4DV6 L;  1JJ2 A;  2IHE A;  5FJ8 G;  2JEA I;  2NZH A;  4PZ6 A;  4A3M G;  1YJN A;  3I2Z A;  3U50 C;  4LF7 L;  3J7A 5;  4IPG A;  4KLK A;  4LW1 A;  2OQK A;  1L1O A;  4O0A A;  1IBL L;  3UDI A;  4LFB Q;  3BZK A;  3M9B A;  4DV2 L;  4JI7 Q;  4L5R C;  4TVA B;  2I5M X;  2R7Z H;  3EBE A;  3PF5 A;  1I94 Q;  1HNW Q;  1CSP A;  4R4Q A;  4DUZ L;  3PGZ A;  2GN5 A;  1BBW A;  4L5Q A;  2BH2 A;  4C3J H;  4JI4 L;  4GNX B;  1XNR Q;  1NTG A;  3KFU A;  4DV0 L;  4GLX A;  2LSS A;  1TWC H;  4C2M H;  3VDY A;  1N9W A;  1D8L A;  1QUQ A;  1N36 L;  3HOU H;  3HOX H;  4OWW B;  3HOV H;  2JA6 H;  4DR5 Q;  1IYJ B;  1HR0 Q;  3T1H Q;  3BJU A;  4YWM A;  5AJ3 L;  1PYS B;  4A3C G;  2KBN A;  4PZ7 A;  4BBR G;  1K73 C;  1PFS A;  1LTL A;  1Q1E A;  4JBK A;  1XMQ L;  2JQO A;  1X54 A;  2Q2H A;  3CC2 A;  4A75 A;  1VQJ A;  1R9T H;  3TEH B;  3CQZ H;  1E7Z A;  3K7U C;  1SN8 A;  4GN5 A;  3UDX A;  5FLM G;  5C3E G;  4C3I H;  1E24 A;  1WOC A;  1Y14 B;  1JJC B;  4KHP Q;  3RLF A;  3J81 j;  1VQP A;  4OO1 I;  1IXR A;  5GAD C;  3RN5 A;  1ASZ A;  2CWP A;  1MIU A;  2UUC Q;  2A8V A;  2MO1 A;  1L2F A;  2D0P A;  3KF6 B;  4DK3 C;  2Y0S E;  3EIV A;  3S1M H;  1TWG H;  1LUZ A;  3W1B A;  4AQY Q;  4B3M L;  1P16 A;  1W2B A;  2ALY B;  4GS3 A;  1CKO A;  4ME3 A;  1M90 C;  2JA7 G;  3STB D;  5IWA Q;  1SR3 A;  2PI2 E;  3KYH C;  2VY3 A;  3FHW A;  5IYD G;  1X3E A;  1XMO L;  4A3G G;  3RNU A;  1OXV A;  1SLJ A;  1CUK A;  3OTO Q;  4GOP A;  4IO9 A;  4GKK L;  2K5H A;  4X62 L;  4A3B G;  1UWV A;  3JAM c;  1VQ6 A;  1C9O A;  4LF4 L;  3D0F A;  4JI8 Q;  4NXN L;  2F52 A;  1Q81 C;  1VQC A;  2VNU D;  4DV4 Q;  4MNO A;  3T1Y Q;  4K0K L;  4UPA A;  4DUY Q;  1PH2 A;  4BBS G;  4OWT B;  1TXY A;  4B3S L;  2JK8 A;  2N49 A;  2LXK A;  3J81 c;  1HH2 P;  4AH6 A;  3MEF A;  4LF8 L;  2VQF Q;  1K0R A;  3HKZ E;  1QVG A;  1YIJ A;  2MO0 A;  3A5U A;  3PO2 G;  2NN6 I;  4YHH Q;  4POG A;  4R4T A;  1L0W A;  4DR3 L;  3S2D H;  1JT8 A;  5C4X H;  4JI1 L;  1N34 Q;  2ZTC A;  3ULP A;  2JA5 H;  4P74 A;  2UXC L;  3RN2 A;  4B3R L;  1VCI A;  5J3B A;  2I5L X;  3KOJ A;  3S1R H;  4NXM Q;  3CD6 A;  2OQ0 A;  2VQE L;  1S72 A;  2A1A A;  5LMN Q;  4DV7 Q;  1XNQ L;  3M4Q A;  5IYC H;  1PV4 A;  5EAY A;  1HNZ Q;  1EUJ A;  4B3T Q;  1Y1W H;  4IFD J;  4AYB G;  2JEB I;  4RMF A;  2UXD Q;  1GD7 A;  2E2J H;  2AWO A;  4A3D H;  2IY5 B;  4IPH A;  2PI2 A;  5FJ8 H;  4X66 Q;  2QEX A;  4A3M H;  1X55 A;  1N8R C;  4YWK A;  2E5L L;  4A3K H;  5IT9 c;  1HZ9 A;  2EQS A;  4JOI C;  5HGQ A;  1IBK L;  4IJH A;  4OWX B;  1Q46 A;  4QJF A;  1UE1 A;  3Q8D A;  2QGQ A;  3NEM A;  2EXD A;  4LWC A;  4YCU A;  3S24 A;  2Q2T A;  1N33 Q;  2R92 G;  5M5X H;  4A76 A;  4DR7 Q;  4JI3 L;  1K83 H;  2VUM G;  4P73 A;  1A62 A;  3H15 A;  3PSI A;  3F2C A;  4H02 A;  3GTJ H;  1PH1 A;  3H3V H;  3HOW G;  1BVS A;  3E9I A;  5IY0 A;  1EIF A;  1NMF A;  2K14 A;  4HJ8 A;  1X65 A;  2WB1 E;  3A5Z B;  4JC0 A;  1OTC A;  3CP0 A;  2ZJR A;  2NVQ H;  2CCZ A;  1QVC A;  3CC7 A;  3H3V I;  3GTL H;  2PMZ E;  3CPW A;  4A3C H;  2BH8 A;  4BBR H;  3CCQ A;  4IJL A;  1K3R A;  1IBM L;  1W3S A;  1VQM A;  1DGS A;  4LF9 Q;  2CFM A;  4X65 L;  2KCM A;  3GTK H;  2RCN A;  4JBJ A;  3TRZ A;  4P75 A;  1EQQ A;  4A93 G;  4OX9 Q;  3OW2 A;  3E9H A;  4DR1 Q;  2UUA L;  4JI5 Q;  5FLM H;  2RHQ B;  1A63 A;  2NVY H;  2FXQ A;  2JE6 I;  1VQ4 A;  5BR8 Q;  1SFO H;  2Z6K C;  4JI0 L;  1A8V A;  2DUD A;  1FJG L;  4YY3 L;  4IFD G;  5LMU L;  1K8G A;  4GNX C;  3U4Z A;  1S3O A;  3F2B A;  3ZJY C;  4JI4 Q;  3CW2 C;  5LMN W;  5JEA J;  4A3K G;  4HIM A;  1ASY A;  2R7D A;  1VQD A;  3JC6 6;  1CKM A;  1OXU A;  2BA0 A;  4UP9 A;  2JA7 H;  1N32 Q;  1FVI A;  3CCL A;  5GAE C;  4A3G H;  5IYD H;  1CKN B;  5AJ3 Q;  2R7F A;  1Q7Y C;  4DV5 Q;  1VQ5 A;  1Y1V G;  3M85 A;  4A3B H;  1KAW A;  1SE8 A;  4DV3 L;  2F4V Q;  3BZC A;  1E3P A;  1YHA A;  1XTD A;  2K50 A;  3L0O A;  1P8L A;  1PH3 A;  2ZTE A;  2B3G A;  4BBS H;  4JI6 L;  3UDG A;  4LUO A;  1VQ8 A;  3AQQ A;  3UE1 A;  2UUB L;  1Q1B A;  4JCV E;  4LF5 Q;  2WP8 J;  4AIM A;  4JBW A;  1VQH A;  3KDF B;  4HID A;  3PO2 H;  5GAG C;  2GVA A;  1D7Q A;  2MQH A;  4YCW A;  3CCU A;  4HJ7 A;  1Z9F A;  1KXL A;  2UU9 Q;  2UXD L;  1JMC A;  4J15 A;  2B63 G;  4JV5 L;  1E1O A;  2JJQ A;  4LFB L;  4GN3 B;  2PQA A;  4LFC Q;  2A19 A;  1J6Q A;  1I94 L;  1HNW L;  1YJ9 A;  4DR6 Q;  2XTI A;  3M4O H;  4JG2 A;  1KL9 A;  1BKB A;  2ATW A;  4NPS A;  3TQY A;  1I50 H;  2Q2I A;  5JEA G;  1HZA A;  3F8T A;  3CCR A;  2R93 G;  3U4V A;  1C0A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...