1N36Q

Structure of the thermus thermophilus 30s ribosomal subunit in the presence of crystallographically disordered codon and near-cognate transfer rna anticodon stem-loop mismatched at the second codon position
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
molecule tags Ribosome
total genus 18
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1n36Q00
2UUCL 3STBD 5IYDH 2KBNA 1IBKL 1Q46A 2ZTEA 3H0GG 3ULJA 3CCEA 3NELA 4DV2L 1QZGA 1PH8A 1AH9A 5FLMH 4BBSG 1O7IA 3NBHB 4O2DA 1XTDA 1S72A 3L2PA 1OXUA 2OTLA 1FGUA 2K4KA 1PH4A 1I3QH 1TWGH 4R4OA 2JA8H 2R92H 4JI5L 3EBEA 1NBWA 5IYBG 4JCVE 4HJ9A 1X9NA 2KCMA 4JI0L 3W1BA 4A3MG 4OWWB 3CCJA 1EQRA 5C3EG 1YHAA 3UDXA 3HOWH 3S1RH 4A3FH 2NVQH 4WJ4A 5HY6A 3ICEA 2ASBA 2A19A 1YITA 1XMOQ 1K9MC 2ZM6Q 1Y1VG 1PH6A 1HNWL 3GTPH 4HJ5A 3PGZA 4NPSA 4A3KG 2CWPA 1TWAH 1GKHA 1VS0A 3PUYA 5E7NA 1A8VA 1IBLQ 3H15A 4ALPA 3HOZH 4X66L 1LM0A 1L1OB 4LFAQ 4YWLA 1CKMA 2AWOA 2ID0A 2NZHA 2JK8A 3E0EA 1Q1EA 5IP7G 4X65Q 1SFOH 2KHIA 3H0GH 1N34Q 4B3SQ 1UE6A 4HJ8A 1CSQA 1Q7YC 4LF5L 1XPUA 4WJ3M 2VZAA 4A75A 3I4MG 2H5XA 3VDYA 3AFQA 2K5HA 2Z6KC 4MTNA 1V43A 4A3DG 1XPRA 4KI0A 4GS3A 4LF9L 1VQOA 4K0KQ 2YYZA 5FJ8G 1CKOA 4DR3L 4DUZL 4LF6L 2AWNA 2N3SA 3MXNB 4IJLA 2K52A 1K73C 3K80C 4P71A 4A3MH 4DV6L 4DV5L 5C3EH 3PIPA 2UUCQ 3I4NG 3NENA 3BU2A 1IBKQ 1Q12A 2AHOB 2D0OA 4DV2Q 2UXDL 1M90C 4DK3C 3U4ZA 4A3GG 3GTQH 3KF6B 1Y1VH 4DR2L 4A3JG 5C4XG 1SMXA 4AH6A 4DR6L 3TEHB 5GROA 3RNUA 4KHPL 4A3KH 4A3BG 4LFCL 3UDGA 1A0IA 2JE6I 4OO1G 1Y1WG 4C3HH 5IY0A 2WB1G 4JI5Q 3UDIA 2E2JH 3CMEA 4JI0Q 1Y14B 2Z0SA 5IP7H 1GD7A 3CCVA 4A3CH 3HKZG 1KRTA 2HHHL 4IO9A 3HOUG 3I4MH 1VQBA 1VQEA 4L5QA 4EQ5A 1PYSB 4H02A 5M3MG 3KOJA 1LTLA 4YCUA 3TREA 4NB3A 4BA1I 4X64L 1HNWQ 3K0XA 3U50C 3S1QH 5FJ8H 1VQ4A 3CXCA 2IHEA 2NVYH 2D62A 5GQOA 5M3FG 4JBMA 1XJVA 1I94L 1VQ9A 1R9TH 1A63A 4HIKA 1HZ9A 3B6YA 1X3GA 1G6PA 1VQIA 4X66Q 3AEVA 3W5OA 3I4NH 3F2DA 2UXCL 2PQAA 4DV4L 1I5FA 3PF5A 1JJ2A 1ASYA 4GKKL 3J81j 4LF5Q 4FDBA 4Y52H 1K83H 1YJ9A 4A3GH 3JC66 4A3JH 1VQ5A 4QJFA 5C4XH 4GN4B 1OTCA 4P73A 4YCWA 4LF9Q 4LUOA 2JEAI 2IX1A 1Y1WH 2YTXA 1YNXA 1NMFA 1TWHH 4DR3Q 3S1NH 3PO2G 3CQZH 3K7AH 4DUZQ 2UU9L 4LF6Q 1CKNA 1YBYA 3K7UC 3L7ZC 2Q2HA 3TQYA 3I4OA 2IX0A 2MO1A 2CFMA 4DV6Q 1RL2A 4DV5Q 3CCLA 2JA9A 3S1MH 2YU9H 3TS0A 3GTLH 3HOUH 4A93G 5K36G 4DPGA 2HQLA 2XTIA 2JJQA 1NJIC 2UXDQ 4GKJL 5M5WH 3M4QA 5GADC 4DR2Q 4DR6Q 1WI5A 4IFDG 4KHPQ 1E1OA 2KCTA 5M3FH 4LFCQ 2UXBL 3SGIA 2D0PA 1K0RA 4YWMA 2C35B 1QZHA 1J5EL 4A3CG 5EAYA 3GO5A 1E24A 1UE5A 2DGYA 2F52A 1L0WA 3L0OA 3UE0A 4BBRG 3BZCA 1PYBA 2HHHQ 1S40A 1XNQL 3J7A5 1Z9FA 2JA6G 3M4PA 2PMZE 4IJHA 1I50H 1T9HA 4P74A 3HOXG 4IPDA 4A76A 1PH5A 1D7QA 5LMNL 1OXSC 4DUYL 5J3BA 2ZJRA 4AYBG 4X64Q 4DV1L 3CPWA 1EIFA 4B3ML 3TS2A 1WOCA 2R6GA 1I94Q 4JI4L 1X54A 3CCSA 1KXLA 3I2ZA 3FP9A 4DR4L 4BY7G 1EFWA 1W3SA 2PI2E 3DM3A 2UXCQ 4DNIA 4DV4Q 4GKKQ 3KDFA 5JJIA 1IXRA 2GVAA 2BA0A 2UUAL 4HIDA 1JB7A 3CCQA 1SE8A 4JI2L 4GLAC 4JI3Q 2Y0SG 2MQHA 4IPGA 1JJGA 1GVPA 3ZJYC 1WFQA 4P72A 2N49A 3KF8B 2MNAA 3A0JA 2NVXH 3M85A 2PI2A 2UU9Q 1AE3A 4BBSH 1FVIA 4LNQA 4X62L 1QVFA 2IT1A 4BBRH 4GOPA 3OW2A 2JA5G 3FKIG 4PZ7A 2PQAB 1VQAA 5IP9G 3S24A 2VL6A 2V1CC 2E8GA 2R7DA 3HOXH 1MJCA 4IOAA 2B29A 4IFDJ 1HNZL 3OYYA 5IYBH 4GKJQ 1E3PA 1K8AC 1TWFH 4OWXB 2QEXA 3S14H 1BBUA 1RIPA 1X55A 4DAYB 2GVBA 1WJJA 1B8AA 1VQ6A 3NEMA 2XGTA 4YWKA 2UXBQ 1SROA 1G291 1PH9A 4OONA 2MFIA 1V1QA 1J5EQ 4X6AH 1UE7A 4BY7H 4LF8L 1PVOA 1HNXL 1CKNB 4GNXC 4TVAB 4YY3L 3CC7A 2VUMG 3A74A 3PUVA 1MJEA 4QQBX 1XNQQ 3AYHB 4YCVA 2VQEL 1VQKA 5LMNQ 4POGA 2EQSA 3T1HL 4DUYQ 4O0AA 4JI1L 4JI8L 3RLNA 1C7YA 2CQOA 4DV1Q 2OTJA 1KAWA 1X6OA 1HR0L 1B70B 4JI4Q 3F1ZA 2DUDA 1YHQA 1HZAA 4A3DH 2L15A 4DR4Q 3S15H 4DV3L 3FKIH 3CD6A 1IYJB 4OXPA 3PSIA 5IP9H 1N33L 1Z47A 2NN6G 1EUJA 1PV4A 4B3RL 4BA2I 3A5ZB 4YHHL 4GOPC 4LW1A 2UUAQ 4QY7A 2YTYA 3RZDH 4JI2Q 4JG2A 2VQFL 4R4IA 4KLKA 5ELNA 4JYAL 5DLQE 2VS1A 2UUBL 2KHJA 4OO1I 5AJ3L 1VQ7A 5HGQA 4JBWA 2E5LL 1EIYB 1E1TA 5IWAL 4UP9A 4BXXG 2EXDA 1SR3A 1C0AA 2FXQA 2CWAA 1UE1A 1GM5A 1HZCA 2GN5A 3KLWA 4X62Q 3S2HH 1UEBA 1PH1A 3D0FA 1D8LA 2BH8A 3RLOA 4QIWE 1XMQL 1KHIA 1UWVA 3G48A 1WCMG 4LWCA 4AQYL 1E22A 3CF5A 4A3IG 4A3BH 3K81C 1NY4A 2VY3A 4UP8A 2LXJA 3GDEA 2ZJPA 2JQOA 4A3EG 3F2BA 3T1YL 1VQLA 2R7ZG 2ZTCA 3HOVG 3E9IA 3HKSA 3S16H 3PUXA 1VQCA 1MKHA 5FLMG 4OWTB 4XIGS 1QUQA 2RF4A 3OTOL 5C4JH 1JMCA 4UY8C 5JJKA 5IE8A 1J6QA 4LF7L 3M4OH 1YHBA 5M3MH 4LF8Q 4GLXA 1HNXQ 4LFBL 2F4VL 3A5UA 1VQGA 4JI7L 4YY3Q 4GOPB 2JA8G 3AFPA 1XNRL 4GN5A 1PA6A 2ZJQA 1N8RC 2ATWA 2AKWB 1YEZA 1NTGA 3UDFA 2VQEQ 4J15A 2OWOA 2LXKA 4JC0A 1KL9A 4JI6L 3T1HQ 4R4CA 4JI1Q 4JI8Q 1VQDA 3ULLA 1PHJA 4B3TL 2AMCB 3J7ZC 1OXVA 2NVTH 4IPHA 4Y7NH 4R4TA 3GTGH 3HOWG 5LMUL 4BXXH 3Q8DA 4DAMA 1YJNA 1HR0Q 4XTCS 2K75A 3U4VA 4PZ8A 3BJUA 4DR1L 4BY1G 4DV3Q 4PG3A 4A3IH 1WCMH 4PZ6A 3RN2A 3GTMH 4R4QA 5JEAG 1I6HH 3CP0A 3F8TA 4A4IA 2ALYB 4B3RQ 4OX9L 1YVCA 1YIJA 3PO2H 4YHHQ 4GNXA 4A3EH 2YTVA 1CUKA 4C2MH 3JAMc 3GD7A 2R7ZH 1L1OC 3MEFA 2VQFQ 4JBKA 3HOVH 4IFDI 4A93H 4DR7L 1K3RA 4JYAQ 2UUBQ 2HIVA 5AJ3Q 2N78A 5BR8L 2E5LQ 2B63G 1P16A 5IWAQ 2BA1A 2ES2A 1KRSA 1N32Q 2K14A 1MIUA 3RZOH 4NXNL 3CCUA 1OXXK 5GAHC 2HIXA 1VQJA 3CMAA 3KFUA 5C0XJ 1XMQQ 4POFA 1HZBA 2OCEA 4L5TA 3GTJH 1U5KA 4HIMA 1PFSA 4AQYQ 1ASZA 2WB1E 3BZKA 4KHZA 4APVA 4DR5L 3HKZE 3T1YQ 4PMWA 2CCZA 3HOYG 2I5LX 1NE3A 3I56A 1C9OA 2E2IH 3CC2A 3KYHC 3ULPA 2EIFA 1WYDA 2I5MX 3OTOQ 3J80c 4NXML 2JA6H 2JA7G 1HJPA 2F3IA 1QVGA 4LF7Q 4BY1H 3PF4A 4LFBQ 3M3YH 4GN3B 1KQSA 2F4VQ 2NZOA 1CSPA 4JI7Q 3J81c 1FJGL 1PH7A 1EYGA 4HJ7A 3LGJA 3S17H 5IYCG 1XNRQ 3M7NA 4DK6C 4LUVA 5GAEC 2IHFA 2JEBI 4R1JA 3D31A 3CC4A 1LYLA 4JI6Q 3JAMi 3G71A 1EOVA 3CPFA 4JOIC 2K5VA 1VQHA 4DKAC 1Q81C 4B3TQ 2CKZB 2Q2TA 1SLJA 1P8LA 3DLLA 4LF4L 1E7ZA 2B63H 3ER0A 5LMUQ 3EN2A 4MNOA 2A1AA 3GTKH 2R93G 2B3GA 5JEAJ 2IY5B 1QUQB 3E9HA 4P75A 2WAQE 2MO0A 1YZ6A 1YI2A 2N8NA 3I55A 1IBML 4DR1Q 1N32L 3S2DH 4IOCA 3K8AA 3PO3G 3KJPA 4B3MQ 4OX9Q 3G4SA 1G51A 4DV0L 1LUZA 1VCIA 4LUZA 1GO3E 2A8VA 3HOYH 4JV5L 1L2FA 1Q1BA 3RLFA 2JA5H 1HR0W 4DR7Q 2E2HH 1JT8A 1N36L 1PH2A 5BR8Q 2JA7H 2OQ0A 3J80i 4DV7L 2YV5A 1KC8C 1PH3A 3F2CA 1BKBA 2KENA 1Q82C 4NXNQ 2LSSA 3J81i 3G6EA 5IYCH 3PIOA 1FL0A 2BH2A 4RG1A 2I5HA 4MZ9A 1VQMA 3U58A 1SRUA 4TQUS 3CCMA 1EWIA 1EQQA 4GNXB 1U0LA 1X3EA 3PUZA 5C44G 4DR5Q 3W1GA 2HT1A 4A3LG 2RCNA 1KD1C 1AE2A 1TXYA 2VUMH 2QGQA 1W2BA 1H95A 5H1SE 2R93H 2WP8J 5IT9c 2PNHA 1L1OA 4NXMQ 2I0QA 1X56A 3ERSX 3KDFB 3AQQA 4QGUA 1QVCA 4AYBE 1HNZQ 2K50A 5C0XG 1A62A 3FHWA 3KJOA 1K8GA 3PCOB 2NN6I 2Q2IA 2RHQB 1FJGQ 3H3VI 4RMFA 3PO3H 3UE1A 5IYDG 3RR5A 3CCRA 4HJAA 2VNUD 5ELOA 2VW9A 4UP7A 1VQNA 5JJLA 3CW2C 4QL5A 4UPAA 1XMOL 1SN8A 2ZM6L 5GAGC 3PUWA 5FLXc 3EIVA 4JBJA 1IL2A 2OQKA 1VQFA 4ME3A 1YJWA 4IPCA 3WWVA 4JI3L 5M5XH 1IBLL 4LF4Q 2R92G 3H3VH 1X3FA 2WAQG 1Q8KA 4C3JH 5M5YH 3GTOH 2Y0SE 2K5NA 1VQ8A 4LFAL 4C3IH 3TRZA 1IBMQ 2ZTDA 1OXTA 2RHSB 4EX5A 4X65L 1XPOA 1N34L 4B3SL 1VQPA 1TWCH 4AIMA 1NMGA 1S3OA 3CAMA 2WFWA 1JJCB 1B7YB 1BBWA 3IRBA 3RN5A 4L5RC 5C0XI 3KF6A 3STBC 2R7FA 5C44H 4DV0Q 4A3FG 4A3LH 3HFZB 1BVSA 1N9WA 4JV5Q 4K0KL 4HIOA 1JE5A 2QA4A 1KIXA 2Q2UA 1V9PA 1N36Q 1M1KC 1N33Q 4L5SA 3PV0A 1DGSA 4DV7Q 3I7FA 4JOIA 1HH2P 1IZ6A 1X65A 5LMNW 1Q86C 3HOZG 4GLVB 3M9BA 2Z6KA
chains in the Genus database with same CATH superfamily
2UUCL 5IYDH 3MHBA 1G2TA 4RH6A 4BBSG 2SEBD 3NBHB 2RSOA 1IL8A 1XTDA 5IT9E 5I9OA 3L2PA 2OTLA 5CMDA 2K4KA 1I3QH 2R92B 3EBEA 2B2TA 3URYA 1KLGD 1O7ZA 2EPBA 2K05A 4A3MG 4HSVA 1SE4A 2NVQB 3QJYA 2ASBA 1Y1VG 3GTPH 4HJ5A 2WV6D 5KNBA 2CWPA 2E76C 1TWAH 5JEAH 3H15A 4RGMA 4LFAQ 4YWLA 2F0IA 4X65Q 1SFOH 1XPUA 1Q7YC 4BBSB 2H5XA 3VDYA 2K5HA 2Z6KC 1ENFA 2H4OA 4KI0A 3E3XA 3NPPA 4K0KQ 1HTPA 2YYZA 5FJ8G 4RKLA 4DUZL 2N3SA 4ID6A 3SK4A 1IYUA 5CV8A 4A3MB 3G6JB 3PIPA 2EYPA 5K5PA 3DWQA 2F0EA 3AU7A 1Q12A 3L3OC 4FXGC 1Y1VB 3R3OA 4KHVA 5C4XG 4DR6L 5GROA 3RNUA 4A3KH 3NTHA 4A3BG 1D2BA 2K28A 1QJOA 2ENBA 4OO1G 1Y8PB 5IY0A 4JI5Q 1FGBD 2XVSA 4RAUC 4UHVA 1XX8A 2KCCA 4JI0Q 2B2UA 2FMMA 1L0XB 2B8GA 1KRTA 2EYOA 1VQEA 4EQ5A 3DEOA 3S1QH 3CXCA 3AEVA 2D62A 4JBMA 3MAQA 1VQ9A 4TSSA 1R9TB 2M00A 3KUPA 4X66Q 1SBBB 2FJ2A 3PF5A 1JJ2A 2ZXPA 5J39A 4LF5Q 4FDBA 4IALA 3JC66 1KDAA 5C4XB 1EQTA 1MI2A 4DAYA 2SOBA 4YCWA 4A3BB 5IGFA 4LF9Q 1EY7A 1ZYRC 4ZUJA 2IX1A 5BN4A 1EEFD 1YNXA 1TWHB 3CQZB 4LF6Q 1CT1D 3L7ZC 2Q2HA 2CFMA 3S1MB 1RL2A 3OSOA 4DV5Q 2JA9A 2K6AA 5K36G 3P7JA 1EIGA 3NTKA 1HTLD 1NJIC 4XT1B 4GKJL 5M5WH 5GADC 2QDLA 2ICIA 4LFCQ 2D0PA 1TY2A 1SYGA 3AB9A 4L6TB 1UE5A 3L0OA 3UE0A 1ML0D 3BZCA 4P74A 1I50H 4A76A 4IPDA 1PH5A 1TY0A 1STHA 2ZJRA 2BCOA 1XYIA 2SDFA 1WOCA 5CORA 1I94Q 2HCIA 4BY7G 1II3A 3M7GA 3QB3A 3SK6A 3DM3A 4DV4Q 5I6YA 3FRPB 2UUAL 4KJOA 4CDFC 3CCQA 1T5XD 1JB7A 4JI2L 4KJNA 1JJGA 4P72A 1JICA 2Q8RE 3NSWA 4X62L 4OIJA 1WTXA 3OW2A 1NAPA 2J0TD 2E74C 1IKLA 2B2WA 4PZ7A 2XRQD 2PQAB 3S24A 2VL6A 2E8GA 2R7DA 4FP5D 3T4AC 4ZKBB 1JC7A 1TWFB 3S14B 4OWXB 3HZXA 1BCPF 4B08A 3QR8A 1RIPA 1X55A 4X3UA 1WJJA 1B8AA 3NEMA 1PTOH 1G291 2PPBC 2BE5C 2MFIA 4X6AH 4BY7B 1CKNB 1R4QB 3A74A 4HTHA 4CJ0B 2SNSA 4QQBX 1J9OA 4EGVA 4KKTA 3AYHB 5E1FA 4ZYSA 1VQKA 3T1HL 5CBAE 1D1IA 1SYEA 3RLNA 4JI1L 4JI8L 1B3AA 1D1KA 2XWBB 3F1ZA 1IW7C 1EFID 3FKIH 1SAPA 5C3WA 4OXPA 5C4HA 5IP9H 1N33L 1EUJA 4B9XA 1PV4A 1SMYD 4BA2I 4YHHL 2YTYA 3AMUA 2F0JA 4K2LA 5ELNA 2VS1A 1SSOA 5HGQA 1CZWA 1K28A 2FXQA 1GM5A 4XYOA 1UEBA 1PH1A 3RLOA 1D8LA 1ZEQX 1UWVA 2MGSA 3K0YA 2EJGC 2LXJA 5JJZA 4NKLA 1Y8NB 3NUCA 3F2BA 2CW0D 2ZTCA 4K5XA 3CRKC 4UAIA 3HOVG 4CKEA 1STGA 3I3CA 1J6QA 3M4OH 1EY9A 1YHBA 2JP1A 1DOLA 1Y8OB 4LFBL 1VQGA 2KOLA 4BS9A 5M5XB 2NN6H 4GOPB 3AFPA 3BZDB 4GN5A 3QWNA 2AKWB 4KKSA 4HR7B 3UDFA 4CDCC 4O42A 2IJ0A 4B3TL 3ULLA 4KKUA 1O7LA 2NVTH 2F1MA 4O1NA 4R4TA 3GTGB 1HHVA 1YJNA 4KK7A 4XTCS 1LACA 1EOTA 4MHEA 4PZ8A 4CKCA 4DR1L 2FHTA 4DV3Q 5JEAG 2KVMA 4A4IA 4B3RQ 1YIJA 2L0CA 3PO2H 1J8IA 4A3EH 1E2ZA 4F8MA 2R7ZH 1L1OC 1FNVA 3MEFA 2VQFQ 4JBKA 3HOVB 4IFDI 4JYAQ 1K3RA 5IIFA 5AJ3Q 2N78A 5BR8L 3ITPA 4EQNA 2E5LQ 2XWJB 3QOLA 1DXMA 2ES2A 5IWAQ 2B63G 1KRSA 2TMPA 1QG7A 1MIUA 3RZOB 3CCUA 1TU2B 3C1FA 3ZYYX 1QILA 3MXGA 3KFUA 1O7YA 2HIXA 1BQQT 1LABA 5C0XJ 1XMQQ 3GTJH 2EYMA 5IGCA 1ASZA 3BZKA 1I4RA 4F7XA 4DR5L 3T1YQ 4PMWA 4Q0FA 4MTKA 2CHBD 2E2IH 3KYHC 5A35A 4IUNA 2JA6H 2JA7G 3FVQA 1HJPA 1QVGA 4BY1H 5JVG3 2F4VQ 2NZOA 1FJGL 1PH7A 1JOQA 1EYGA 1X3QA 5IYCG 4DK6C 4LUVA 5LL6X 4DFAA 3A8JE 2F0HA 2JXMB 3CC4A 1LYLA 1EY6A 3CPFA 2CKZB 2B8FA 2B63B 1P8LA 1E7ZA 1O78A 3GTKH 2IY5B 3FDTA 2R3ZA 3E9HA 4K8IA 2O5JC 1YZ6A 2AQ1B 3W3AA 1IBML 1SMYC 3JAME 1KDBA 3PO3G 4RHRA 3NBHA 3G4SA 4S3SA 3SVMA 1ICWA 1LUZA 1VCIA 4X3KA 1GO3E 5C5MA 3HOYH 1UAPA 1HR0W 2JA7B 2IPKD 2EYJA 2YV5A 2OF1A 1BO0A 3LX0A 4NXNQ 2LSSA 2K01A 4RG1A 1KNEA 2F0GA 4B9WA 4G4KA 3OMGA 3A55A 3D6WA 4TQUS 1XTCD 3W1GA 4A3LG 1KD1C 5HURA 1W2BA 1H95A 5H1SE 3NTIA 3J81E 3R2IA 1T5EA 4G57A 3VR2A 2I0QA 1JWMD 3S1QB 3AQQA 2Z1CA 4X3TA 2K50A 2AQ3B 1A62A 3PO3B 2NN6I 2Q2IA 2RHQB 3T51B 2XNAC 4RMFA 3K59A 1HRJA 4K5VA 2F0SA 3RR5A 3SK5A 5ELOA 3C2PA 4HMJA 2EJMA 2A6HD 2F0OA 1SN8A 4K8JA 1YNND 2CQAA 3PUWA 4IQZA 3EIVA 4JBJA 4KY5A 5ISRA 1IL2A 1VQFA 1MSGA 1WTVA 3WWVA 3H3VH 2WAQG 4H13C 3VYTA 4C3JH 2AUKA 4C56C 2K5NA 4LFAL 4X65L 3EFXD 1TWCH 5F2DA 1S3OA 3RN5A 5IOCA 1CFMA 3VR4A 3QOJA 3HFZB 4XT3B 1N9WA 4JV5Q 3I73A 4K0KL 2Q2UA 1SNDA 1KLUD 1M1KC 1N33Q 1GHKA 2G5DA 3PV0A 1DGSA 5C0XH 4GLVB 1GUGA 4JPBW 1OO9B 3T56B 3QIAA 1Q46A 3CCEA 3H0GG 1PH8A 3KBXA 5FLMH 1RODA 2WAQB 4JI5L 1EU4A 4JI0L 5C3EG 1RKNA 4N8FA 1LTAD 1PZJD 1D5XC 1NR2A 3UDXA 4A3FH 3KLSX 2A19A 1PH6A 3LWUA 3UI2A 1EYCA 4LMQD 2L5TA 3OHXC 4ZRZA 1GKHA 4C3HG 1C4QA 3HOZH 4X66L 1LM0A 4DF7A 1L1OB 1E2WA 3SXHA 5IT9L 2ID0A 5IP7G 3E0EA 2JK8A 5CGKA 3H0GB 1CSQA 4LF5L 2VZAA 3I4MG 2KCNA 3AFQA 4WRDA 1V43A 2K32A 2K5WA 2A6ED 4LF9L 1GUTA 4QIWB 1VQOA 1RCVD 1EYAA 4LF6L 1SEBD 2AWNA 2JYOA 3MXNB 4OELB 4FF2A 1K73C 3K80C 5C3EB 4DV5L 4DU9A 1EWCA 3I4NG 1PTOB 3BU2A 4F88A 2AHOB 4DV2Q 4C1NI 1M90C 5DM63 3GTQB 4A3GG 1TT2A 1CA5A 1ESRA 4AH6A 3I8ZA 3SR1A 4LFCL 2QF7A 3UDGA 2KEDA 5KYIA 4C3HB 1Y1WG 1LTGD 2E2JH 2K04A 3CMEA 3H09A 3CCVA 1GD7A 4A3CH 1LTTD 3HRZC 4IO9A 3I4MB 3SEBA 1VQBA 4L5QA 2F0NA 2A6HC 2F0PA 4YCUA 2WACA 3TDQA 1HNWQ 3K0XA 3U50C 1G8ZD 2D2CC 2IHEA 2NVYH 5GQOA 4G7HC 4IZ8A 1I94L 1AP0A 5I6WA 4ZK9B 4R8IA 3B6YA 1CHPD 3HG9A 1G6PA 3W5OA 1CQFA 3I4NB 3G7LA 1HQMC 1BNZA 2PQAA 4DV4L 5DEHA 1WVLA 2LS01 2EE1A 4A3GB 1YJ9A 4A3JH 4K5WA 5E4WC 2QCPX 1OTCA 2H1EA 2VB3X 2JEAI 1Y1WB 5FO7B 2YTXA 1NMFA 4ODGA 4DR3Q 3S1NH 3K7AB 3PO2G 2NWGA 1CKNA 1YBYA 3TP5A 3C46A 3HGBA 2YU9H 3HOUH 3GTLB 3D4RA 4DPGA 2HQLA 2XTIA 3OOCA 2JJQA 2UXDQ 4HCEA 4DAPA 1ZYRD 3M4QA 1EQVA 4KHPQ 5M3FH 4J1MA 3V05A 3GV3A 5EAYA 5I2YA 3CHBD 3D3RA 1PYBA 4LK1C 1Z9FA 2JA6G 3M4PA 1D7QA 5J3BA 3A7LA 4AYBG 1AW7A 1LTID 1LLRD 4B3ML 3PO2B 5FKAC 3CCSA 3K57A 1CZGA 3FP9A 1B9MA 2MUYA 2XRSD 4GKKQ 3KDFA 1UNSA 3MA2B 2A6EC 1TS2A 1SE8A 1M4VA 2NZ1D 4GLAC 3O13A 4NW2A 3ZJYC 1WFQA 5JPNC 2N49A 2NVXB 3A0JA 4FO2A 3M85A 2PI2A 1QVFA 4LNQA 4XYQA 2IT1A 4BBRH 4GOPA 3VR5A 3FPUB 2JA6B 3KLSA 3HOXH 4IOAA 4IFDJ 1MJCA 3K5MA 3BVMA 1K8AC 4AYBB 4L63B 2QEXA 1BBUA 1JWSD 1GXDC 2GVBA 1TVXA 2B2YC 3CU7A 4OONA 1J5EQ 1UE7A 4GNXC 1I4GA 3CC7A 5I9PA 1F9SA 1JCKB 3VR6A 5E3FA 1XNQQ 4POGA 4DUYQ 1C7YA 5I4DA 4DV1Q 2BE5D 5J1ZA 1S5BD 3H6MA 1FD7D 4JI4Q 1YHQA 1CA6A 2DNCA 1SJED 2L15A 4A3DH 3NXWA 4DV3L 2BDOA 3PSIA 1Z47A 1ZKOA 5IGBA 4B3RL 3A5ZB 4GOPC 4IUQA 1Z7TA 4QY7A 2VQFL 1VF7A 4KLKA 2LY7A 2F0WA 1QNKA 4RCOA 5DLQE 2RCFA 4JYAL 5AJ3L 1IW7D 4QUCA 1JR0D 2E5LL 1EIYB 5IWAL 4UP9A 4BXXG 1EY8A 2EXDA 4UDUC 5IGDA 4HAEA 1HZCA 1QWYA 2PNRC 3D0FA 4KN4C 1XMQL 1KHIA 4A3IG 1WCMG 1E22A 2RBMA 2QEJC 2Z9HA 5KNCA 2CVRA 4UP8A 1K0SA 3GDEA 2JQOA 2B2VA 3BDLA 3P20A 3T1YL 1VQLA 3I72A 3HKSA 5ELFA 3S16B 1O80A 1TS4A 3FEWX 5FLMG 1JMCA 5C4JB 4QMGA 1JORA 4FVMA 5L37A 2WIIB 4RGOS 5M3MH 4LF8Q 1RHPA 4GLXA 2F4VL 3A7AB 4YY3Q 1PLFA 3EVQA 3IFTA 2XN9C 1PA6A 1G2SA 2BOSA 1YEZA 4JC0A 4DK0A 1YNJD 1PHJA 3M4YA 1OXVA 1HR0Q 2K75A 3D4WA 3BJUA 4PG3A 4A3IB 1WCMB 1I6HH 4PZ6A 4ZKCB 3RN2A 1RTOA 3GTMB 2QILA 2HD3A 1DOKA 3CP0A 2ALYB 4DN4M 3BYYB 4C2MB 1CUKA 2SNMA 5CR3A 1SNQA 4A93H 1U9RA 2UUBQ 3S9WA 4M8AA 1KABA 2B2VC 2BA1A 4NXNL 2F0MA 1EEID 5GAHC 3CMAA 1VQJA 1B9NA 4POFA 4IFDH 1HUNA 1HPCA 3QO2A 4KHZA 4FXDA 5KGUA 2PCFB 1B53A 3NBIA 1NE3A 1F9QA 1UUPA 1C9OA 2L12A 3ND8A 1UEAB 3OTOQ 4XQQA 3PF4A 3M3YB 4JI7Q 4IURA 1EU3A 1ESFA 4HJ7A 4QF4A 3LGJA 2R61A 1Y69U 3ERQA 1JOOA 3S17B 3M7NA 5GAEC 3IL8A 2F0FA 1SE3A 4JI6Q 1MBYA 1PTOD 2F0UA 3G71A 1EOVA 2K5VA 1VQHA 1Q81C 2ZXOA 1FYCA 2Q2TA 5LMUQ 2A1AA 2B3GA 1QUQB 3HP3A 4H7BA 4P75A 3SDZA 1YI2A 1ZXTA 2N8NA 3I55A 1BUVT 1I6VC 3S2DH 3Q22A 3EJIA 3KJPA 4B3MQ 4OX9Q 1S5FD 2N55A 2A8VA 4JV5L 1L2FA 2EDGA 3BDOA 3D8GA 2E2HB 1STAA 5T1GA 3TSSA 1ICFB 3PIO3 3RMHA 2J4XA 1Q82C 1PFMA 1CK1A 1VMPA 4TKOB 2OEOA 3MEHA 2E2JB 1FL0A 1DYQA 3U58A 1F9RA 4KD3A 4GNXB 1U0LA 3FMCA 5C44G 1HA6A 3K58A 4RGTA 2VUMH 2QGQA 1DD2A 3JAML 2R93H 3OWEB 4IUPA 2PMZB 1A3TA 5IT9c 2PNHA 4ZQ3A 1L1OA 4NXMQ 3ERSX 3KDFB 5ELCA 5C6AA 2CH4A 3I91A 1EY5A 3A8IE 5IYDG 4ME5A 2VNUD 2VW9A 5JJLA 3CW2C 1KNAA 1YNJC 3TP6A 5GAGC 1Z6HA 4CJ1B 4ME3A 3MXNA 1YJWA 1PRTB 4JI3L 4LF4Q 4WJWA 3GTOB 4HMIA 5M5YH 4C3IH 1NCVA 1XPOA 4EX5A 1N32Q 4AIMA 2WKCA 1NMGA 4ILWA 4L5RC 3J81L 3STBC 3WDNA 5C44B 2YU9B 1BVSA 1QCBD 4HIOA 1JE5A 2QA4A 1KIXA 1N36Q 3BYTB 4K2KA 3BVZA 3VYRA 4DV7Q 3I7FA 5C3XA 3X3MA 2KBNA 2HDLA 2ZTEA 4DV2L 3NELA 3W2DA 2DN8A 3ONAB 1EY0A 5EKKA 1I3QB 1V1OA 5EBCA 2JA8H 2R92H 2FMCA 2EY1A 2HUGA 4HJ9A 2KCMA 3W1BA 4OWWB 1EQRA 1SDFA 5FLXE 3HOWH 1PTOC 2NVQH 1VF5C 4WJ4A 1DM0B 3Q24A 4KN7C 1K9MC 1BR9A 4PV1C 1HNWL 4FF4A 3GTPB 3PGZA 4NPSA 1H9SB 3Q0AA 4A3KG 1TWAB 3PUYA 2I46A 4ALPA 5A2QE 4CDEC 1NNXA 3TP8A 1IHZA 1CKMA 2AWOA 4RCNA 1SFOB 3SHLA 1XWEA 1AN8A 1UE6A 2K5DA 4A75A 3NHHA 4MTNA 3TZDA 4A3DG 2NB0A 1XPRA 1SYDA 1K8MA 2Z6KA 1CKOA 4DR3L 1KDCA 4CKBA 2EZVA 4A3MH 1XXGA 2JSOA 3MXPA 4F87A 1HUMA 3I4LA 3NENA 2DJFC 1X32A 1IBKQ 1C48A 2UXDL 5KIXA 3U4ZA 1Y1VH 5C5LA 1SMXA 5EBDA 4KHPL 3TP7A 4A3KB 1A0IA 2JE6I 4YIJA 2WB1G 3UDIA 1C8CA 1F2YA 1Y14B 3HKZG 5E4XA 3DWAA 3J80E 2J7ZA 3EA6A 4A3DB 1PYSB 5M3MG 1DCZA 3KOJA 1LTLA 3TREA 3I90A 4NB3A 4BA1I 5FJ8H 1G6ZA 1JQYD 4TRDA 2X6LA 1A63A 3T13A 1XJVA 1AZPA 1R9TH 1X3GA 2GA4B 1ENCA 3R8BA 4GKKL 1I5FA 4MIUA 3J81j 1I4QA 1CM9A 1K83H 1B2TA 5C4XH 4P73A 3K5OA 4HN7A 3DWPA 1X3PA 2WB1B 1TWHH 3CQZH 1CTMA 2PO4A 4WFN3 5G3LD 3HKZB 3TQYA 4DXGA 4DV6Q 3S1MH 4A93G 3TS0A 5JAVA 1JE4A 5M3MB 5M5WB 3HEJA 4DR2Q 1GUSA 1WI5A 3A56A 4IFDG 1E1OA 1WTWA 3TBIB 5FO8B 3SGIA 3K6OA 4J6HA 1K0RA 2N88A 4YWMA 1QZHA 1J5EL 2A5HA 1JOKA 1E24A 1VDZA 2DGYA 3CKIB 5IODA 2HHHQ 4ABNA 1S40A 5EGTA 1XNQL 3J7A5 2L4NA 1V8QA 1I50B 2Z4IA 1OXSC 4DUYL 1I6HB 4X64Q 4DV1L 1R4PB 3TS2A 4DXFA 3SK8A 3WOFA 4JI4L 1PFNA 1KXLA 1B44D 4I65A 3I2ZA 5IGEA 2F03A 3CRLC 2F0QA 4A93B 1EFWA 4KV6A 2UXCQ 3BVGA 3ND9A 5JJIA 1IXRA 2BA0A 4HIDA 1B50A 4JI3Q 2Y0SG 2MQHA 1GVPA 1PZKD 3KF8B 2MNAA 3FPPA 3BS1A 2UU9Q 1AE3A 1L0YB 1FVIA 1TIID 2ZXRA 3FKIG 2RSNA 2A73B 5IP9G 3TMEA 2Q8TA 3V96A 2V1CC 1PFBA 5IYBH 1TWFH 3S14H 5KNDA 1D5MC 2XGTA 2UXBQ 1SROA 2HDMA 1V1QA 1HFGA 4BY7H 4LF8L 1PVOA 4ZLTF 1I4PA 4YY3L 2VUMG 3PUVA 1AEXA 1MJEA 1RD9D 1ET6A 2Y0SB 5LMNQ 2EQSA 3U9SA 4DNRB 4O0AA 2EVBA 5FK9C 1ILQA 1WTQA 1HR0L 1B70B 2O2LD 1D6EC 2DUDA 4RHSA 1AZQA 4DR4Q 4U673 5DNFA 3S15H 3FKIB 3CD6A 1I4HA 2NN6G 3H3VC 1U4LA 4LW1A 1QB5D 1F2ZA 4ZCKA 3RZDH 2P5ZX 5J22A 1SE2A 4R4IA 5EJWA 2RQXA 2UUBL 2KHJA 3I70A 1LTRD 4CGYB 3J7AV 4OO1I 4JBWA 1E1TA 1V1PB 4IUVA 1E2VA 4LAAA 1Q8IA 1SR3A 2CWAA 1UE1A 2VUMB 2GN5A 3KLWA 4N8X1 3KK7A 3S2HH 1PRTD 4QIWE 2AQ2B 3G48A 2DY8A 3H94A 1NY4A 1DOMA 3E5SA 4A3EG 5D14A 2R7ZG 1VQCA 4R9WA 4XIGS 1QUQA 4UY8C 3OTOL 5JJKA 3M4OB 4XDXA 1HNXQ 1S5CD 2LMCB 3A5UA 1PXUA 4JI7L 2L1BA 1WTOA 2JA8G 2MP1A 3DXJC 4IUTA 5M5YB 2ZJQA 1N8RC 2VQEQ 1SYFA 2F3WA 4J15A 2LXKA 1KL9A 1FNUA 2WKDA 5CV5A 4JI6L 1EIHA 1BOSA 1B4OA 1VQDA 2AMCB 3VA7A 2NVTB 4ULLA 1A15A 4Y7NH 3GTGH 3HOWG 5LMUL 3DHQA 3VR3A 3U4VA 4BY1G 5EPJA 4NP5A 2G9DA 1PTOF 4CJ2C 2B2YA 4ZAIA 2EY5A 3F8TA 1ILPA 4OX9L 1GUNA 4GNXA 4A3EB 5HGTA 2YTVA 2R7ZB 3JAMc 2RKSA 3HOVH 2EY2A 1STNA 2KA7A 3U9OA 1P16A 2K14A 5KRUA 3RZOH 4PQXA 1OXXK 2JA8B 1F77A 3GTJB 4V190 4AQYQ 4HIMA 1PFSA 1U4MA 4L8JA 1ENAA 2EY6A 3NWTA 4APVA 1AFPA 2L11A 4N9PA 2I5LX 3HOYG 3I56A 1KAAA 2KUMA 3CC2A 3HOWB 2E2IB 2EIFA 1DONA 1LT4D 2L55A 3J80c 3N52A 4NXML 2X6GA 5CC4A 1S5DD 2F3IA 4BY1B 4LF7Q 5CV7A 4GN3B 1CSPA 3J81c 1SYCA 1XNRQ 1TS5A 3PMFA 4R1JA 4JOIC 2PQEA 4DKAC 2A68C 2RDFA 1SLJA 2B63H 3MVVA 4LF4L 3GTKB 3EN2A 2OT2A 2F3VA 4FYDA 2MO0A 3BDCA 1N32L 3K8AA 2B2TC 5JVH3 3HOYB 1F2LA 1Q1BA 2JA5H 4DR7Q 1JT8A 1CQVA 1N36L 2JA7H 5EQ0A 1MHWC 2K1BA 4H0LC 4DV7L 2BDNA 1KC8C 1PH3A 1PRTC 4C3JG 5FO9B 2KENA 4DGZA 5NUCA 1NSNS 3G6EA 5IYCH 3A8KE 1VQMA 3Q23A 3CCMA 3OIQA 1EQQA 5KYLA 2PW5A 4RA8A 2RCNA 1H9SA 1AE2A 5EKIA 5CBEE 2PZWA 4EVOA 1X56A 4QGUA 4AYBE 3KJOA 5C0XG 3PO3H 4HCSA 1F2MA 2EOTA 3UE1A 3CCRA 2E2DC 1WTRA 2X69A 4UPAA 1F9PA 1BCPB 3EROA 1K8OA 2OQKA 1LT5D 1K83B 5CYUA 4KMUC 4C3JB 3MTSA 1LTBD 2M9VA 3OIPA 1RTNA 5AFWA 1TWCB 3CAMA 2WFWA 3VYSA 1RF2D 4Q5VA 4A3FG 4DV0Q 4A3LH 2NTSA 1SNPA 2B2UC 2O5IC 3LWEA 1JB3A 1V9PA 1KTKA 5LMNW 1X65A 1IZ6A 3SE0A 3HOZG 3M9BA 3P1HA 4HEDA 3STBD 1JWUD 2Z8LA 2KJXA 1IBKL 3ULJA 1QZGA 1AH9A 2TSSA 5CV9A 1O7IA 1MD2D 4O2DA 1S72A 4BWGB 1H9MA 2KHSA 3MXUA 2Z4HA 1OXUA 1WTPA 4K6DA 1FGUA 1PH4A 2F0TA 1TWGH 4R4OA 1NBWA 5IYBG 4JCVE 1X9NA 2JN4A 1STYA 4CDDC 4QB4A 5T1IA 3CCJA 2EYHA 1YHAA 2KQ3A 4A3FB 3S1RH 4ZUIA 4KY6A 1MSHA 5HY6A 3ICEA 1YITA 1XMOQ 2ZM6Q 1GHJA 2MPMA 1IBLQ 1VS0A 1FR3A 5E7NA 1A8VA 1SNMA 2B39A 1WD1A 4OHJA 2D5DA 3HOZB 2F0DA 5LHY1 5COYA 4A3CG 2NZHA 4KTAA 1N34Q 1Q1EA 4B3SQ 2KHIA 3H0GH 4HJ8A 3MFYA 4WJ3M 4JW0A 2K03A 4GS3A 2LKVA 5FLXL 1G91A 4IJLA 2K52A 4P71A 5DAUA 4DV6L 5C3EH 2UUCQ 2D9UA 4DA2A 1S5ED 3PQIA 2D0OA 1BDOA 4DK3C 5A2QL 1WTHA 3GTQH 3KF6B 4DR2L 4A3JG 5BN3A 5G3LF 2EYLA 3TEHB 3NP8A 3HS0C 4C3HH 1EZ6A 2RVLA 4JVZA 4NDXA 5IP7H 2Z0SA 2HHHL 3HOUG 3I4MH 4MN3A 3NQTA 4V0BA 4H02A 3S15B 3KF8A 4X64L 4P2CB 3MFGA 1QNUA 4G7OC 1VQ4A 2LFNA 2NVYB 5M3FG 3RZDB 2B2WC 1HXYD 3GV6A 4HIKA 1HZ9A 1VQIA 3I4NH 3F2DA 1RDPD 2UXCL 1ASYA 1EZ8A 1PZID 4Y52H 1A3UA 4A3GH 3S2HB 4A3JB 1VQ5A 4QJFA 4RGNA 4GN4B 3T53B 2ICEC 5LL6S 4LUOA 3P75A 2Q8IB 2Z6BA 1Y1WH 3J80L 2CH4W 3S1NB 3K7AH 4DUZQ 2UU9L 3K7UC 3CCLA 3I4OA 2IX0A 2MO1A 2PZTA 5BN5A 3HOUB 3GTLH 2QW7A 3QG1A 2EJFC 3NK9A 3F2UA 5DM73 5JOBA 2FFKB 3D6CA 3IAYA 2G9HD 2K5QA 1LT6D 1I4XA 1M8AA 1SXTA 4FF3A 4DR6Q 5M3FB 2KCTA 4K6LA 4J8QA 2UXBL 2F4IA 1GOZA 4NMZA 2C35B 1A6XA 3MWYW 4WORA 4EQPA 2IL8A 3GO5A 4OEMB 2F52A 4LJZC 1L0WA 2A74C 4Y7NB 4BBRG 1SYBA 2PMZE 4IJHA 1T9HA 3OPOA 3TN2A 3HOXG 5LMNL 3C3LA 1PDQA 2MJ8A 3CPWA 1EIFA 2RDHA 1V1PA 2R6GA 1QOHA 1X54A 2RA4A 1B1ZA 5C4ZA 4DR4L 1Q3LA 1W3SA 3N6RA 4CHTB 2PI2E 4DNIA 5KEEA 1LTSD 3T16A 2C9OA 2GVAA 4M1UB 4KD4A 4IPGA 3RD4A 2F0LA 3C1EA 1RJTA 2WINB 1A2UA 4K14A 2NVXH 1EL0A 4BBSH 2NUCA 3E6ZX 1SNCA 4BBRB 2JA5G 2KEEA 1PYWD 1STBA 1VQAA 2DY7A 3HOXB 4OIKA 5CV6A 2B29A 1W6JA 4EQOA 3OYYA 3PIP3 1HNZL 4GKJQ 2A69D 2E75C 1E3PA 1EYDA 1NUCA 3V2TA 4DAYB 2NTTA 1VQ6A 1PRTF 4YWKA 4C1NK 1IYVA 1PH9A 3GQBA 4FNFA 1HNXL 4R8NA 4TVAB 3IKJA 3DMUA 4DNTB 2MHVA 3J7AF 3DM1A 4YCVA 2VQEL 1HFNA 1LT3D 2CQOA 2OTJA 1KAWA 2QKIC 4X3SA 1X6OA 1W6KA 4XXEA 1HZAA 4I7AA 2HCCA 1TQOA 2JA5B 1SNOA 3TZUA 2VXWA 3K5NA 1IYJB 1S4ZA 1STEA 1ET9A 4DK1A 2UUAQ 4JI2Q 4JG2A 1LV9A 4U68A 1VQ7A 1BXTA 2CW0C 1C0AA 1BCPD 4X62Q 1DZ1A 5EPLA 4H44C 2BH8A 4AQYL 4LWCA 2F0VA 4A3BH 3CF5A 1E0BA 3K81C 2VY3A 4OO1H 2ZJPA 4E6IA 3E9IA 4XQJA 3S16H 3PUXA 1HCZA 1MKHA 4OWTB 2RF4A 5C4JH 5IE8A 4LF7L 1BF4A 1D5ZC 5ELEA 2ZT9C 1A3VA 1XNRL 2DNEA 2ATWA 3Q6SA 1DJRD 1NTGA 2OWOA 3EQLC 5I2XA 3T1HQ 4R4CA 4JI1Q 4JI8Q 4QCLA 2XSCA 3J7ZC 4IPHA 1U4RA 1EWHA 4BXXH 3Q8DA 2C5CA 4DAMA 4CBVA 2OXPA 5TSSA 4A3IH 1WCMH 3GTMH 4R4QA 2KECA 2PW7A 4KY7A 4OGQC 3D4DA 1YVCA 3IFDA 4YHHQ 3L9AX 4C2MH 2IW3A 3GD7A 4DR7L 1H9JA 5M9OA 2HIVA 5K36H 5IGGA 5CV4A 4HSPA 1TWGB 3RUZA 1HZBA 2OCEA 4L5TA 1U5KA 2V4DA 3MZ5A 4I7ZC 2A69C 2WB1E 2XIWA 2HQEA 1GUWA 3DEPA 1CI3M 3HKZE 4JK1C 2CCZA 1NR4A 1FNWA 1GUOA 1VMCA 2K7VA 2F0KA 4OL7A 3S1RB 4QUFA 3ULPA 1CHQD 4FF1A 1WYDA 2I5MX 4LFBQ 3M3YH 1KQSA 1MGSA 1U4PA 3S17H 5JPMC 2IHFA 3K5LA 2JEBI 3D31A 3MC0B 3WOEA 3JAMi 3VA5A 4PMBA 4B3TQ 3R93A 2IWHA 3DLLA 3ER0A 2R93G 4MNOA 5JEAJ 3GP7A 2WAQE 4RWSC 1TR5A 5D65A 4DR1Q 3H91A 3S2DB 4IOCA 4XQNA 4N9TA 2K33A 3A54A 3VYUA 1WD0A 1G51A 4DV0L 2A68D 4LUZA 5EPKA 3RLFA 2RDGA 3OWFA 5ELBA 2E2HH 1PH2A 1BCPC 5BR8Q 4Z9CB 2OQ0A 3J80i 1TKWB 3F2CA 1BKBA 4DAVA 4C3IG 1H9RA 3J81i 5FOBB 3PIOA 2O4XA 2BH2A 5EKLA 2I5HA 3LNNA 4MZ9A 2AUJD 2VB2X 3NQIA 2L9HA 1SRUA 3NWSA 1EWIA 2HT1A 1X3EA 3PUZA 4DR5Q 1LO5D 1TXYA 2NYZD 3DUZA 3KLRA 2R93B 1YNNC 2PYKA 3KBGA 2I07B 2WP8J 1A2TA 1PMRA 1EY4A 1TS3A 4IUUA 1QVCA 1HNZQ 1IKMA 1K8GA 3FHWA 3PCOB 1FJGQ 3H3VI 2EXZA 3NE5B 4HJAA 4PNYA 1VQNA 4UP7A 4QL5A 3R2TA 1XMOL 2ZM6L 1SJHD 4G7ZC 1GJXA 5FLXc 2M2LA 1IBLL 4IPCA 5M5XH 2R92G 1X3FA 2IX3A 2PZUA 1Q8KA 3E0JA 3GTOH 2Y0SE 5D3IB 1VQ8A 1H9KA 4C3IB 1HA5A 3TRZA 2EYFA 1IBMQ 2ZTDA 1OXTA 2RHSB 1N34L 4B3SL 4PMCA 1VQPA 1JJCB 1B7YB 1BBWA 3IRBA 4GZYC 1K3BC 2NBFA 5C0XI 3KF6A 4RKBA 5D3DA 2QDBA 2R7FA 5C44H 1BBXC 5ELDA 1HQRD 1B3QA 2FINB 3OW7A 3X3NA 1Q90A 1ONLA 3OMCA 2DJGC 3J7YW 4L5SA 1QE6A 4FXKC 4JOIA 4RFBA 1HH2P 4IN3A 1Q86C 3BG3A
chains in the Genus database with same CATH topology
2UUCL 3STBD 5IYDH 2KBNA 1IBKL 1Q46A 2ZTEA 3H0GG 3ULJA 3CCEA 3NELA 4DV2L 1QZGA 1PH8A 1AH9A 5FLMH 4BBSG 1O7IA 3NBHB 4O2DA 1XTDA 1S72A 3L2PA 1OXUA 2OTLA 1FGUA 2K4KA 1PH4A 1I3QH 1TWGH 4R4OA 2JA8H 2R92H 4JI5L 3EBEA 1NBWA 5IYBG 4JCVE 4HJ9A 1X9NA 2KCMA 4JI0L 3W1BA 4A3MG 4OWWB 3CCJA 1EQRA 5C3EG 1YHAA 3UDXA 3HOWH 3S1RH 4A3FH 2NVQH 4WJ4A 5HY6A 3ICEA 2ASBA 2A19A 1YITA 1XMOQ 1K9MC 2ZM6Q 1Y1VG 1PH6A 1HNWL 3GTPH 4HJ5A 3PGZA 4NPSA 4A3KG 2CWPA 1TWAH 1GKHA 1VS0A 3PUYA 5E7NA 1A8VA 1IBLQ 3H15A 4ALPA 3HOZH 4X66L 1LM0A 1L1OB 4LFAQ 4YWLA 1CKMA 2AWOA 2ID0A 2NZHA 2JK8A 3E0EA 1Q1EA 5IP7G 4X65Q 1SFOH 2KHIA 3H0GH 1N34Q 4B3SQ 1UE6A 4HJ8A 1CSQA 1Q7YC 4LF5L 1XPUA 4WJ3M 2VZAA 4A75A 3I4MG 2H5XA 3VDYA 3AFQA 2K5HA 2Z6KC 4MTNA 1V43A 4A3DG 1XPRA 4KI0A 4GS3A 4LF9L 1VQOA 4K0KQ 2YYZA 5FJ8G 1CKOA 4DR3L 4DUZL 4LF6L 2AWNA 2N3SA 3MXNB 4IJLA 2K52A 1K73C 3K80C 4P71A 4A3MH 4DV6L 4DV5L 5C3EH 3PIPA 2UUCQ 3I4NG 3NENA 3BU2A 1IBKQ 1Q12A 2AHOB 2D0OA 4DV2Q 2UXDL 1M90C 4DK3C 3U4ZA 4A3GG 3GTQH 3KF6B 1Y1VH 4DR2L 4A3JG 5C4XG 1SMXA 4AH6A 4DR6L 3TEHB 5GROA 3RNUA 4KHPL 4A3KH 4A3BG 4LFCL 3UDGA 1A0IA 2JE6I 4OO1G 1Y1WG 4C3HH 5IY0A 2WB1G 4JI5Q 3UDIA 2E2JH 3CMEA 4JI0Q 1Y14B 2Z0SA 5IP7H 1GD7A 3CCVA 4A3CH 3HKZG 1KRTA 2HHHL 4IO9A 3HOUG 3I4MH 1VQBA 1VQEA 4L5QA 4EQ5A 1PYSB 4H02A 5M3MG 3KOJA 1LTLA 4YCUA 3TREA 4NB3A 4BA1I 4X64L 1HNWQ 3K0XA 3U50C 3S1QH 5FJ8H 1VQ4A 3CXCA 2IHEA 2NVYH 2D62A 5GQOA 5M3FG 4JBMA 1XJVA 1I94L 1VQ9A 1R9TH 1A63A 4HIKA 1HZ9A 3B6YA 1X3GA 1G6PA 1VQIA 4X66Q 3AEVA 3W5OA 3I4NH 3F2DA 2UXCL 2PQAA 4DV4L 1I5FA 3PF5A 1JJ2A 1ASYA 4GKKL 3J81j 4LF5Q 4FDBA 4Y52H 1K83H 1YJ9A 4A3GH 3JC66 4A3JH 1VQ5A 4QJFA 5C4XH 4GN4B 1OTCA 4P73A 4YCWA 4LF9Q 4LUOA 2JEAI 2IX1A 1Y1WH 2YTXA 1YNXA 1NMFA 1TWHH 4DR3Q 3S1NH 3PO2G 3CQZH 3K7AH 4DUZQ 2UU9L 4LF6Q 1CKNA 1YBYA 3K7UC 3L7ZC 2Q2HA 3TQYA 3I4OA 2IX0A 2MO1A 2CFMA 4DV6Q 1RL2A 4DV5Q 3CCLA 2JA9A 3S1MH 2YU9H 3TS0A 3GTLH 3HOUH 4A93G 5K36G 4DPGA 2HQLA 2XTIA 2JJQA 1NJIC 2UXDQ 4GKJL 5M5WH 3M4QA 5GADC 4DR2Q 4DR6Q 1WI5A 4IFDG 4KHPQ 1E1OA 2KCTA 5M3FH 4LFCQ 2UXBL 3SGIA 2D0PA 1K0RA 4YWMA 2C35B 1QZHA 1J5EL 4A3CG 5EAYA 3GO5A 1E24A 1UE5A 2DGYA 2F52A 1L0WA 3L0OA 3UE0A 4BBRG 3BZCA 1PYBA 2HHHQ 1S40A 1XNQL 3J7A5 1Z9FA 2JA6G 3M4PA 2PMZE 4IJHA 1I50H 1T9HA 4P74A 3HOXG 4IPDA 4A76A 1PH5A 1D7QA 5LMNL 1OXSC 4DUYL 5J3BA 2ZJRA 4AYBG 4X64Q 4DV1L 3CPWA 1EIFA 4B3ML 3TS2A 1WOCA 2R6GA 1I94Q 4JI4L 1X54A 3CCSA 1KXLA 3I2ZA 3FP9A 4DR4L 4BY7G 1EFWA 1W3SA 2PI2E 3DM3A 2UXCQ 4DNIA 4DV4Q 4GKKQ 3KDFA 5JJIA 1IXRA 2GVAA 2BA0A 2UUAL 4HIDA 1JB7A 3CCQA 1SE8A 4JI2L 4GLAC 4JI3Q 2Y0SG 2MQHA 4IPGA 1JJGA 1GVPA 3ZJYC 1WFQA 4P72A 2N49A 3KF8B 2MNAA 3A0JA 2NVXH 3M85A 2PI2A 2UU9Q 1AE3A 4BBSH 1FVIA 4LNQA 4X62L 1QVFA 2IT1A 4BBRH 4GOPA 3OW2A 2JA5G 3FKIG 4PZ7A 2PQAB 1VQAA 5IP9G 3S24A 2VL6A 2V1CC 2E8GA 2R7DA 3HOXH 1MJCA 4IOAA 2B29A 4IFDJ 1HNZL 3OYYA 5IYBH 4GKJQ 1E3PA 1K8AC 1TWFH 4OWXB 2QEXA 3S14H 1BBUA 1RIPA 1X55A 4DAYB 2GVBA 1WJJA 1B8AA 1VQ6A 3NEMA 2XGTA 4YWKA 2UXBQ 1SROA 1G291 1PH9A 4OONA 2MFIA 1V1QA 1J5EQ 4X6AH 1UE7A 4BY7H 4LF8L 1PVOA 1HNXL 1CKNB 4GNXC 4TVAB 4YY3L 3CC7A 2VUMG 3A74A 3PUVA 1MJEA 4QQBX 1XNQQ 3AYHB 4YCVA 2VQEL 1VQKA 5LMNQ 4POGA 2EQSA 3T1HL 4DUYQ 4O0AA 4JI1L 4JI8L 3RLNA 1C7YA 2CQOA 4DV1Q 2OTJA 1KAWA 1X6OA 1HR0L 1B70B 4JI4Q 3F1ZA 2DUDA 1YHQA 1HZAA 4A3DH 2L15A 4DR4Q 3S15H 4DV3L 3FKIH 3CD6A 1IYJB 4OXPA 3PSIA 5IP9H 1N33L 1Z47A 2NN6G 1EUJA 1PV4A 4B3RL 4BA2I 3A5ZB 4YHHL 4GOPC 4LW1A 2UUAQ 4QY7A 2YTYA 3RZDH 4JI2Q 4JG2A 2VQFL 4R4IA 4KLKA 5ELNA 4JYAL 5DLQE 2VS1A 2UUBL 2KHJA 4OO1I 5AJ3L 1VQ7A 5HGQA 4JBWA 2E5LL 1EIYB 1E1TA 5IWAL 4UP9A 4BXXG 2EXDA 1SR3A 1C0AA 2FXQA 2CWAA 1UE1A 1GM5A 1HZCA 2GN5A 3KLWA 4X62Q 3S2HH 1UEBA 1PH1A 3D0FA 1D8LA 2BH8A 3RLOA 4QIWE 1XMQL 1KHIA 1UWVA 3G48A 1WCMG 4LWCA 4AQYL 1E22A 3CF5A 4A3IG 4A3BH 3K81C 1NY4A 2VY3A 4UP8A 2LXJA 3GDEA 2ZJPA 2JQOA 4A3EG 3F2BA 3T1YL 1VQLA 2R7ZG 2ZTCA 3HOVG 3E9IA 3HKSA 3S16H 3PUXA 1VQCA 1MKHA 5FLMG 4OWTB 4XIGS 1QUQA 2RF4A 3OTOL 5C4JH 1JMCA 4UY8C 5JJKA 5IE8A 1J6QA 4LF7L 3M4OH 1YHBA 5M3MH 4LF8Q 4GLXA 1HNXQ 4LFBL 2F4VL 3A5UA 1VQGA 4JI7L 4YY3Q 4GOPB 2JA8G 3AFPA 1XNRL 4GN5A 1PA6A 2ZJQA 1N8RC 2ATWA 2AKWB 1YEZA 1NTGA 3UDFA 2VQEQ 4J15A 2OWOA 2LXKA 4JC0A 1KL9A 4JI6L 3T1HQ 4R4CA 4JI1Q 4JI8Q 1VQDA 3ULLA 1PHJA 4B3TL 2AMCB 3J7ZC 1OXVA 2NVTH 4IPHA 4Y7NH 4R4TA 3GTGH 3HOWG 5LMUL 4BXXH 3Q8DA 4DAMA 1YJNA 1HR0Q 4XTCS 2K75A 3U4VA 4PZ8A 3BJUA 4DR1L 4BY1G 4DV3Q 4PG3A 4A3IH 1WCMH 4PZ6A 3RN2A 3GTMH 4R4QA 5JEAG 1I6HH 3CP0A 3F8TA 4A4IA 2ALYB 4B3RQ 4OX9L 1YVCA 1YIJA 3PO2H 4YHHQ 4GNXA 4A3EH 2YTVA 1CUKA 4C2MH 3JAMc 3GD7A 2R7ZH 1L1OC 3MEFA 2VQFQ 4JBKA 3HOVH 4IFDI 4A93H 4DR7L 1K3RA 4JYAQ 2UUBQ 2HIVA 5AJ3Q 2N78A 5BR8L 2E5LQ 2B63G 1P16A 5IWAQ 2BA1A 2ES2A 1KRSA 1N32Q 2K14A 1MIUA 3RZOH 4NXNL 3CCUA 1OXXK 5GAHC 2HIXA 1VQJA 3CMAA 3KFUA 5C0XJ 1XMQQ 4POFA 1HZBA 2OCEA 4L5TA 3GTJH 1U5KA 4HIMA 1PFSA 4AQYQ 1ASZA 2WB1E 3BZKA 4KHZA 4APVA 4DR5L 3HKZE 3T1YQ 4PMWA 2CCZA 3HOYG 2I5LX 1NE3A 3I56A 1C9OA 2E2IH 3CC2A 3KYHC 3ULPA 2EIFA 1WYDA 2I5MX 3OTOQ 3J80c 4NXML 2JA6H 2JA7G 1HJPA 2F3IA 1QVGA 4LF7Q 4BY1H 3PF4A 4LFBQ 3M3YH 4GN3B 1KQSA 2F4VQ 2NZOA 1CSPA 4JI7Q 3J81c 1FJGL 1PH7A 1EYGA 4HJ7A 3LGJA 3S17H 5IYCG 1XNRQ 3M7NA 4DK6C 4LUVA 5GAEC 2IHFA 2JEBI 4R1JA 3D31A 3CC4A 1LYLA 4JI6Q 3JAMi 3G71A 1EOVA 3CPFA 4JOIC 2K5VA 1VQHA 4DKAC 1Q81C 4B3TQ 2CKZB 2Q2TA 1SLJA 1P8LA 3DLLA 4LF4L 1E7ZA 2B63H 3ER0A 5LMUQ 3EN2A 4MNOA 2A1AA 3GTKH 2R93G 2B3GA 5JEAJ 2IY5B 1QUQB 3E9HA 4P75A 2WAQE 2MO0A 1YZ6A 1YI2A 2N8NA 3I55A 1IBML 4DR1Q 1N32L 3S2DH 4IOCA 3K8AA 3PO3G 3KJPA 4B3MQ 4OX9Q 3G4SA 1G51A 4DV0L 1LUZA 1VCIA 4LUZA 1GO3E 2A8VA 3HOYH 4JV5L 1L2FA 1Q1BA 3RLFA 2JA5H 1HR0W 4DR7Q 2E2HH 1JT8A 1N36L 1PH2A 5BR8Q 2JA7H 2OQ0A 3J80i 4DV7L 2YV5A 1KC8C 1PH3A 3F2CA 1BKBA 2KENA 1Q82C 4NXNQ 2LSSA 3J81i 3G6EA 5IYCH 3PIOA 1FL0A 2BH2A 4RG1A 2I5HA 4MZ9A 1VQMA 3U58A 1SRUA 4TQUS 3CCMA 1EWIA 1EQQA 4GNXB 1U0LA 1X3EA 3PUZA 5C44G 4DR5Q 3W1GA 2HT1A 4A3LG 2RCNA 1KD1C 1AE2A 1TXYA 2VUMH 2QGQA 1W2BA 1H95A 5H1SE 2R93H 2WP8J 5IT9c 2PNHA 1L1OA 4NXMQ 2I0QA 1X56A 3ERSX 3KDFB 3AQQA 4QGUA 1QVCA 4AYBE 1HNZQ 2K50A 5C0XG 1A62A 3FHWA 3KJOA 1K8GA 3PCOB 2NN6I 2Q2IA 2RHQB 1FJGQ 3H3VI 4RMFA 3PO3H 3UE1A 5IYDG 3RR5A 3CCRA 4HJAA 2VNUD 5ELOA 2VW9A 4UP7A 1VQNA 5JJLA 3CW2C 4QL5A 4UPAA 1XMOL 1SN8A 2ZM6L 5GAGC 3PUWA 5FLXc 3EIVA 4JBJA 1IL2A 2OQKA 1VQFA 4ME3A 1YJWA 4IPCA 3WWVA 4JI3L 5M5XH 1IBLL 4LF4Q 2R92G 3H3VH 1X3FA 2WAQG 1Q8KA 4C3JH 5M5YH 3GTOH 2Y0SE 2K5NA 1VQ8A 4LFAL 4C3IH 3TRZA 1IBMQ 2ZTDA 1OXTA 2RHSB 4EX5A 4X65L 1XPOA 1N34L 4B3SL 1VQPA 1TWCH 4AIMA 1NMGA 1S3OA 3CAMA 2WFWA 1JJCB 1B7YB 1BBWA 3IRBA 3RN5A 4L5RC 5C0XI 3KF6A 3STBC 2R7FA 5C44H 4DV0Q 4A3FG 4A3LH 3HFZB 1BVSA 1N9WA 4JV5Q 4K0KL 4HIOA 1JE5A 2QA4A 1KIXA 2Q2UA 1V9PA 1N36Q 1M1KC 1N33Q 4L5SA 3PV0A 1DGSA 4DV7Q 3I7FA 4JOIA 1HH2P 1IZ6A 1X65A 5LMNW 1Q86C 3HOZG 4GLVB 3M9BA 2Z6KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UUC L;  3STB D;  5IYD H;  2KBN A;  1IBK L;  1Q46 A;  2ZTE A;  3H0G G;  3ULJ A;  3CCE A;  3NEL A;  4DV2 L;  1QZG A;  1PH8 A;  1AH9 A;  5FLM H;  4BBS G;  1O7I A;  3NBH B;  4O2D A;  1XTD A;  1S72 A;  3L2P A;  1OXU A;  2OTL A;  1FGU A;  2K4K A;  1PH4 A;  1I3Q H;  1TWG H;  4R4O A;  2JA8 H;  2R92 H;  4JI5 L;  3EBE A;  1NBW A;  5IYB G;  4JCV E;  4HJ9 A;  1X9N A;  2KCM A;  4JI0 L;  3W1B A;  4A3M G;  4OWW B;  3CCJ A;  1EQR A;  5C3E G;  1YHA A;  3UDX A;  3HOW H;  3S1R H;  4A3F H;  2NVQ H;  4WJ4 A;  5HY6 A;  3ICE A;  2ASB A;  2A19 A;  1YIT A;  1XMO Q;  1K9M C;  2ZM6 Q;  1Y1V G;  1PH6 A;  1HNW L;  3GTP H;  4HJ5 A;  3PGZ A;  4NPS A;  4A3K G;  2CWP A;  1TWA H;  1GKH A;  1VS0 A;  3PUY A;  5E7N A;  1A8V A;  1IBL Q;  3H15 A;  4ALP A;  3HOZ H;  4X66 L;  1LM0 A;  1L1O B;  4LFA Q;  4YWL A;  1CKM A;  2AWO A;  2ID0 A;  2NZH A;  2JK8 A;  3E0E A;  1Q1E A;  5IP7 G;  4X65 Q;  1SFO H;  2KHI A;  3H0G H;  1N34 Q;  4B3S Q;  1UE6 A;  4HJ8 A;  1CSQ A;  1Q7Y C;  4LF5 L;  1XPU A;  4WJ3 M;  2VZA A;  4A75 A;  3I4M G;  2H5X A;  3VDY A;  3AFQ A;  2K5H A;  2Z6K C;  4MTN A;  1V43 A;  4A3D G;  1XPR A;  4KI0 A;  4GS3 A;  4LF9 L;  1VQO A;  4K0K Q;  2YYZ A;  5FJ8 G;  1CKO A;  4DR3 L;  4DUZ L;  4LF6 L;  2AWN A;  2N3S A;  3MXN B;  4IJL A;  2K52 A;  1K73 C;  3K80 C;  4P71 A;  4A3M H;  4DV6 L;  4DV5 L;  5C3E H;  3PIP A;  2UUC Q;  3I4N G;  3NEN A;  3BU2 A;  1IBK Q;  1Q12 A;  2AHO B;  2D0O A;  4DV2 Q;  2UXD L;  1M90 C;  4DK3 C;  3U4Z A;  4A3G G;  3GTQ H;  3KF6 B;  1Y1V H;  4DR2 L;  4A3J G;  5C4X G;  1SMX A;  4AH6 A;  4DR6 L;  3TEH B;  5GRO A;  3RNU A;  4KHP L;  4A3K H;  4A3B G;  4LFC L;  3UDG A;  1A0I A;  2JE6 I;  4OO1 G;  1Y1W G;  4C3H H;  5IY0 A;  2WB1 G;  4JI5 Q;  3UDI A;  2E2J H;  3CME A;  4JI0 Q;  1Y14 B;  2Z0S A;  5IP7 H;  1GD7 A;  3CCV A;  4A3C H;  3HKZ G;  1KRT A;  2HHH L;  4IO9 A;  3HOU G;  3I4M H;  1VQB A;  1VQE A;  4L5Q A;  4EQ5 A;  1PYS B;  4H02 A;  5M3M G;  3KOJ A;  1LTL A;  4YCU A;  3TRE A;  4NB3 A;  4BA1 I;  4X64 L;  1HNW Q;  3K0X A;  3U50 C;  3S1Q H;  5FJ8 H;  1VQ4 A;  3CXC A;  2IHE A;  2NVY H;  2D62 A;  5GQO A;  5M3F G;  4JBM A;  1XJV A;  1I94 L;  1VQ9 A;  1R9T H;  1A63 A;  4HIK A;  1HZ9 A;  3B6Y A;  1X3G A;  1G6P A;  1VQI A;  4X66 Q;  3AEV A;  3W5O A;  3I4N H;  3F2D A;  2UXC L;  2PQA A;  4DV4 L;  1I5F A;  3PF5 A;  1JJ2 A;  1ASY A;  4GKK L;  3J81 j;  4LF5 Q;  4FDB A;  4Y52 H;  1K83 H;  1YJ9 A;  4A3G H;  3JC6 6;  4A3J H;  1VQ5 A;  4QJF A;  5C4X H;  4GN4 B;  1OTC A;  4P73 A;  4YCW A;  4LF9 Q;  4LUO A;  2JEA I;  2IX1 A;  1Y1W H;  2YTX A;  1YNX A;  1NMF A;  1TWH H;  4DR3 Q;  3S1N H;  3PO2 G;  3CQZ H;  3K7A H;  4DUZ Q;  2UU9 L;  4LF6 Q;  1CKN A;  1YBY A;  3K7U C;  3L7Z C;  2Q2H A;  3TQY A;  3I4O A;  2IX0 A;  2MO1 A;  2CFM A;  4DV6 Q;  1RL2 A;  4DV5 Q;  3CCL A;  2JA9 A;  3S1M H;  2YU9 H;  3TS0 A;  3GTL H;  3HOU H;  4A93 G;  5K36 G;  4DPG A;  2HQL A;  2XTI A;  2JJQ A;  1NJI C;  2UXD Q;  4GKJ L;  5M5W H;  3M4Q A;  5GAD C;  4DR2 Q;  4DR6 Q;  1WI5 A;  4IFD G;  4KHP Q;  1E1O A;  2KCT A;  5M3F H;  4LFC Q;  2UXB L;  3SGI A;  2D0P A;  1K0R A;  4YWM A;  2C35 B;  1QZH A;  1J5E L;  4A3C G;  5EAY A;  3GO5 A;  1E24 A;  1UE5 A;  2DGY A;  2F52 A;  1L0W A;  3L0O A;  3UE0 A;  4BBR G;  3BZC A;  1PYB A;  2HHH Q;  1S40 A;  1XNQ L;  3J7A 5;  1Z9F A;  2JA6 G;  3M4P A;  2PMZ E;  4IJH A;  1I50 H;  1T9H A;  4P74 A;  3HOX G;  4IPD A;  4A76 A;  1PH5 A;  1D7Q A;  5LMN L;  1OXS C;  4DUY L;  5J3B A;  2ZJR A;  4AYB G;  4X64 Q;  4DV1 L;  3CPW A;  1EIF A;  4B3M L;  3TS2 A;  1WOC A;  2R6G A;  1I94 Q;  4JI4 L;  1X54 A;  3CCS A;  1KXL A;  3I2Z A;  3FP9 A;  4DR4 L;  4BY7 G;  1EFW A;  1W3S A;  2PI2 E;  3DM3 A;  2UXC Q;  4DNI A;  4DV4 Q;  4GKK Q;  3KDF A;  5JJI A;  1IXR A;  2GVA A;  2BA0 A;  2UUA L;  4HID A;  1JB7 A;  3CCQ A;  1SE8 A;  4JI2 L;  4GLA C;  4JI3 Q;  2Y0S G;  2MQH A;  4IPG A;  1JJG A;  1GVP A;  3ZJY C;  1WFQ A;  4P72 A;  2N49 A;  3KF8 B;  2MNA A;  3A0J A;  2NVX H;  3M85 A;  2PI2 A;  2UU9 Q;  1AE3 A;  4BBS H;  1FVI A;  4LNQ A;  4X62 L;  1QVF A;  2IT1 A;  4BBR H;  4GOP A;  3OW2 A;  2JA5 G;  3FKI G;  4PZ7 A;  2PQA B;  1VQA A;  5IP9 G;  3S24 A;  2VL6 A;  2V1C C;  2E8G A;  2R7D A;  3HOX H;  1MJC A;  4IOA A;  2B29 A;  4IFD J;  1HNZ L;  3OYY A;  5IYB H;  4GKJ Q;  1E3P A;  1K8A C;  1TWF H;  4OWX B;  2QEX A;  3S14 H;  1BBU A;  1RIP A;  1X55 A;  4DAY B;  2GVB A;  1WJJ A;  1B8A A;  1VQ6 A;  3NEM A;  2XGT A;  4YWK A;  2UXB Q;  1SRO A;  1G29 1;  1PH9 A;  4OON A;  2MFI A;  1V1Q A;  1J5E Q;  4X6A H;  1UE7 A;  4BY7 H;  4LF8 L;  1PVO A;  1HNX L;  1CKN B;  4GNX C;  4TVA B;  4YY3 L;  3CC7 A;  2VUM G;  3A74 A;  3PUV A;  1MJE A;  4QQB X;  1XNQ Q;  3AYH B;  4YCV A;  2VQE L;  1VQK A;  5LMN Q;  4POG A;  2EQS A;  3T1H L;  4DUY Q;  4O0A A;  4JI1 L;  4JI8 L;  3RLN A;  1C7Y A;  2CQO A;  4DV1 Q;  2OTJ A;  1KAW A;  1X6O A;  1HR0 L;  1B70 B;  4JI4 Q;  3F1Z A;  2DUD A;  1YHQ A;  1HZA A;  4A3D H;  2L15 A;  4DR4 Q;  3S15 H;  4DV3 L;  3FKI H;  3CD6 A;  1IYJ B;  4OXP A;  3PSI A;  5IP9 H;  1N33 L;  1Z47 A;  2NN6 G;  1EUJ A;  1PV4 A;  4B3R L;  4BA2 I;  3A5Z B;  4YHH L;  4GOP C;  4LW1 A;  2UUA Q;  4QY7 A;  2YTY A;  3RZD H;  4JI2 Q;  4JG2 A;  2VQF L;  4R4I A;  4KLK A;  5ELN A;  4JYA L;  5DLQ E;  2VS1 A;  2UUB L;  2KHJ A;  4OO1 I;  5AJ3 L;  1VQ7 A;  5HGQ A;  4JBW A;  2E5L L;  1EIY B;  1E1T A;  5IWA L;  4UP9 A;  4BXX G;  2EXD A;  1SR3 A;  1C0A A;  2FXQ A;  2CWA A;  1UE1 A;  1GM5 A;  1HZC A;  2GN5 A;  3KLW A;  4X62 Q;  3S2H H;  1UEB A;  1PH1 A;  3D0F A;  1D8L A;  2BH8 A;  3RLO A;  4QIW E;  1XMQ L;  1KHI A;  1UWV A;  3G48 A;  1WCM G;  4LWC A;  4AQY L;  1E22 A;  3CF5 A;  4A3I G;  4A3B H;  3K81 C;  1NY4 A;  2VY3 A;  4UP8 A;  2LXJ A;  3GDE A;  2ZJP A;  2JQO A;  4A3E G;  3F2B A;  3T1Y L;  1VQL A;  2R7Z G;  2ZTC A;  3HOV G;  3E9I A;  3HKS A;  3S16 H;  3PUX A;  1VQC A;  1MKH A;  5FLM G;  4OWT B;  4XIG S;  1QUQ A;  2RF4 A;  3OTO L;  5C4J H;  1JMC A;  4UY8 C;  5JJK A;  5IE8 A;  1J6Q A;  4LF7 L;  3M4O H;  1YHB A;  5M3M H;  4LF8 Q;  4GLX A;  1HNX Q;  4LFB L;  2F4V L;  3A5U A;  1VQG A;  4JI7 L;  4YY3 Q;  4GOP B;  2JA8 G;  3AFP A;  1XNR L;  4GN5 A;  1PA6 A;  2ZJQ A;  1N8R C;  2ATW A;  2AKW B;  1YEZ A;  1NTG A;  3UDF A;  2VQE Q;  4J15 A;  2OWO A;  2LXK A;  4JC0 A;  1KL9 A;  4JI6 L;  3T1H Q;  4R4C A;  4JI1 Q;  4JI8 Q;  1VQD A;  3ULL A;  1PHJ A;  4B3T L;  2AMC B;  3J7Z C;  1OXV A;  2NVT H;  4IPH A;  4Y7N H;  4R4T A;  3GTG H;  3HOW G;  5LMU L;  4BXX H;  3Q8D A;  4DAM A;  1YJN A;  1HR0 Q;  4XTC S;  2K75 A;  3U4V A;  4PZ8 A;  3BJU A;  4DR1 L;  4BY1 G;  4DV3 Q;  4PG3 A;  4A3I H;  1WCM H;  4PZ6 A;  3RN2 A;  3GTM H;  4R4Q A;  5JEA G;  1I6H H;  3CP0 A;  3F8T A;  4A4I A;  2ALY B;  4B3R Q;  4OX9 L;  1YVC A;  1YIJ A;  3PO2 H;  4YHH Q;  4GNX A;  4A3E H;  2YTV A;  1CUK A;  4C2M H;  3JAM c;  3GD7 A;  2R7Z H;  1L1O C;  3MEF A;  2VQF Q;  4JBK A;  3HOV H;  4IFD I;  4A93 H;  4DR7 L;  1K3R A;  4JYA Q;  2UUB Q;  2HIV A;  5AJ3 Q;  2N78 A;  5BR8 L;  2E5L Q;  2B63 G;  1P16 A;  5IWA Q;  2BA1 A;  2ES2 A;  1KRS A;  1N32 Q;  2K14 A;  1MIU A;  3RZO H;  4NXN L;  3CCU A;  1OXX K;  5GAH C;  2HIX A;  1VQJ A;  3CMA A;  3KFU A;  5C0X J;  1XMQ Q;  4POF A;  1HZB A;  2OCE A;  4L5T A;  3GTJ H;  1U5K A;  4HIM A;  1PFS A;  4AQY Q;  1ASZ A;  2WB1 E;  3BZK A;  4KHZ A;  4APV A;  4DR5 L;  3HKZ E;  3T1Y Q;  4PMW A;  2CCZ A;  3HOY G;  2I5L X;  1NE3 A;  3I56 A;  1C9O A;  2E2I H;  3CC2 A;  3KYH C;  3ULP A;  2EIF A;  1WYD A;  2I5M X;  3OTO Q;  3J80 c;  4NXM L;  2JA6 H;  2JA7 G;  1HJP A;  2F3I A;  1QVG A;  4LF7 Q;  4BY1 H;  3PF4 A;  4LFB Q;  3M3Y H;  4GN3 B;  1KQS A;  2F4V Q;  2NZO A;  1CSP A;  4JI7 Q;  3J81 c;  1FJG L;  1PH7 A;  1EYG A;  4HJ7 A;  3LGJ A;  3S17 H;  5IYC G;  1XNR Q;  3M7N A;  4DK6 C;  4LUV A;  5GAE C;  2IHF A;  2JEB I;  4R1J A;  3D31 A;  3CC4 A;  1LYL A;  4JI6 Q;  3JAM i;  3G71 A;  1EOV A;  3CPF A;  4JOI C;  2K5V A;  1VQH A;  4DKA C;  1Q81 C;  4B3T Q;  2CKZ B;  2Q2T A;  1SLJ A;  1P8L A;  3DLL A;  4LF4 L;  1E7Z A;  2B63 H;  3ER0 A;  5LMU Q;  3EN2 A;  4MNO A;  2A1A A;  3GTK H;  2R93 G;  2B3G A;  5JEA J;  2IY5 B;  1QUQ B;  3E9H A;  4P75 A;  2WAQ E;  2MO0 A;  1YZ6 A;  1YI2 A;  2N8N A;  3I55 A;  1IBM L;  4DR1 Q;  1N32 L;  3S2D H;  4IOC A;  3K8A A;  3PO3 G;  3KJP A;  4B3M Q;  4OX9 Q;  3G4S A;  1G51 A;  4DV0 L;  1LUZ A;  1VCI A;  4LUZ A;  1GO3 E;  2A8V A;  3HOY H;  4JV5 L;  1L2F A;  1Q1B A;  3RLF A;  2JA5 H;  1HR0 W;  4DR7 Q;  2E2H H;  1JT8 A;  1N36 L;  1PH2 A;  5BR8 Q;  2JA7 H;  2OQ0 A;  3J80 i;  4DV7 L;  2YV5 A;  1KC8 C;  1PH3 A;  3F2C A;  1BKB A;  2KEN A;  1Q82 C;  4NXN Q;  2LSS A;  3J81 i;  3G6E A;  5IYC H;  3PIO A;  1FL0 A;  2BH2 A;  4RG1 A;  2I5H A;  4MZ9 A;  1VQM A;  3U58 A;  1SRU A;  4TQU S;  3CCM A;  1EWI A;  1EQQ A;  4GNX B;  1U0L A;  1X3E A;  3PUZ A;  5C44 G;  4DR5 Q;  3W1G A;  2HT1 A;  4A3L G;  2RCN A;  1KD1 C;  1AE2 A;  1TXY A;  2VUM H;  2QGQ A;  1W2B A;  1H95 A;  5H1S E;  2R93 H;  2WP8 J;  5IT9 c;  2PNH A;  1L1O A;  4NXM Q;  2I0Q A;  1X56 A;  3ERS X;  3KDF B;  3AQQ A;  4QGU A;  1QVC A;  4AYB E;  1HNZ Q;  2K50 A;  5C0X G;  1A62 A;  3FHW A;  3KJO A;  1K8G A;  3PCO B;  2NN6 I;  2Q2I A;  2RHQ B;  1FJG Q;  3H3V I;  4RMF A;  3PO3 H;  3UE1 A;  5IYD G;  3RR5 A;  3CCR A;  4HJA A;  2VNU D;  5ELO A;  2VW9 A;  4UP7 A;  1VQN A;  5JJL A;  3CW2 C;  4QL5 A;  4UPA A;  1XMO L;  1SN8 A;  2ZM6 L;  5GAG C;  3PUW A;  5FLX c;  3EIV A;  4JBJ A;  1IL2 A;  2OQK A;  1VQF A;  4ME3 A;  1YJW A;  4IPC A;  3WWV A;  4JI3 L;  5M5X H;  1IBL L;  4LF4 Q;  2R92 G;  3H3V H;  1X3F A;  2WAQ G;  1Q8K A;  4C3J H;  5M5Y H;  3GTO H;  2Y0S E;  2K5N A;  1VQ8 A;  4LFA L;  4C3I H;  3TRZ A;  1IBM Q;  2ZTD A;  1OXT A;  2RHS B;  4EX5 A;  4X65 L;  1XPO A;  1N34 L;  4B3S L;  1VQP A;  1TWC H;  4AIM A;  1NMG A;  1S3O A;  3CAM A;  2WFW A;  1JJC B;  1B7Y B;  1BBW A;  3IRB A;  3RN5 A;  4L5R C;  5C0X I;  3KF6 A;  3STB C;  2R7F A;  5C44 H;  4DV0 Q;  4A3F G;  4A3L H;  3HFZ B;  1BVS A;  1N9W A;  4JV5 Q;  4K0K L;  4HIO A;  1JE5 A;  2QA4 A;  1KIX A;  2Q2U A;  1V9P A;  1N36 Q;  1M1K C;  1N33 Q;  4L5S A;  3PV0 A;  1DGS A;  4DV7 Q;  3I7F A;  4JOI A;  1HH2 P;  1IZ6 A;  1X65 A;  5LMN W;  1Q86 C;  3HOZ G;  4GLV B;  3M9B A;  2Z6K A; 
#chains in the Genus database with same CATH topology
 2UUC L;  5IYD H;  3MHB A;  1G2T A;  4RH6 A;  4BBS G;  2SEB D;  3NBH B;  2RSO A;  1IL8 A;  1XTD A;  5IT9 E;  5I9O A;  3L2P A;  2OTL A;  5CMD A;  2K4K A;  1I3Q H;  2R92 B;  3EBE A;  2B2T A;  3URY A;  1KLG D;  1O7Z A;  2EPB A;  2K05 A;  4A3M G;  4HSV A;  1SE4 A;  2NVQ B;  3QJY A;  2ASB A;  1Y1V G;  3GTP H;  4HJ5 A;  2WV6 D;  5KNB A;  2CWP A;  2E76 C;  1TWA H;  5JEA H;  3H15 A;  4RGM A;  4LFA Q;  4YWL A;  2F0I A;  4X65 Q;  1SFO H;  1XPU A;  1Q7Y C;  4BBS B;  2H5X A;  3VDY A;  2K5H A;  2Z6K C;  1ENF A;  2H4O A;  4KI0 A;  3E3X A;  3NPP A;  4K0K Q;  1HTP A;  2YYZ A;  5FJ8 G;  4RKL A;  4DUZ L;  2N3S A;  4ID6 A;  3SK4 A;  1IYU A;  5CV8 A;  4A3M B;  3G6J B;  3PIP A;  2EYP A;  5K5P A;  3DWQ A;  2F0E A;  3AU7 A;  1Q12 A;  3L3O C;  4FXG C;  1Y1V B;  3R3O A;  4KHV A;  5C4X G;  4DR6 L;  5GRO A;  3RNU A;  4A3K H;  3NTH A;  4A3B G;  1D2B A;  2K28 A;  1QJO A;  2ENB A;  4OO1 G;  1Y8P B;  5IY0 A;  4JI5 Q;  1FGB D;  2XVS A;  4RAU C;  4UHV A;  1XX8 A;  2KCC A;  4JI0 Q;  2B2U A;  2FMM A;  1L0X B;  2B8G A;  1KRT A;  2EYO A;  1VQE A;  4EQ5 A;  3DEO A;  3S1Q H;  3CXC A;  3AEV A;  2D62 A;  4JBM A;  3MAQ A;  1VQ9 A;  4TSS A;  1R9T B;  2M00 A;  3KUP A;  4X66 Q;  1SBB B;  2FJ2 A;  3PF5 A;  1JJ2 A;  2ZXP A;  5J39 A;  4LF5 Q;  4FDB A;  4IAL A;  3JC6 6;  1KDA A;  5C4X B;  1EQT A;  1MI2 A;  4DAY A;  2SOB A;  4YCW A;  4A3B B;  5IGF A;  4LF9 Q;  1EY7 A;  1ZYR C;  4ZUJ A;  2IX1 A;  5BN4 A;  1EEF D;  1YNX A;  1TWH B;  3CQZ B;  4LF6 Q;  1CT1 D;  3L7Z C;  2Q2H A;  2CFM A;  3S1M B;  1RL2 A;  3OSO A;  4DV5 Q;  2JA9 A;  2K6A A;  5K36 G;  3P7J A;  1EIG A;  3NTK A;  1HTL D;  1NJI C;  4XT1 B;  4GKJ L;  5M5W H;  5GAD C;  2QDL A;  2ICI A;  4LFC Q;  2D0P A;  1TY2 A;  1SYG A;  3AB9 A;  4L6T B;  1UE5 A;  3L0O A;  3UE0 A;  1ML0 D;  3BZC A;  4P74 A;  1I50 H;  4A76 A;  4IPD A;  1PH5 A;  1TY0 A;  1STH A;  2ZJR A;  2BCO A;  1XYI A;  2SDF A;  1WOC A;  5COR A;  1I94 Q;  2HCI A;  4BY7 G;  1II3 A;  3M7G A;  3QB3 A;  3SK6 A;  3DM3 A;  4DV4 Q;  5I6Y A;  3FRP B;  2UUA L;  4KJO A;  4CDF C;  3CCQ A;  1T5X D;  1JB7 A;  4JI2 L;  4KJN A;  1JJG A;  4P72 A;  1JIC A;  2Q8R E;  3NSW A;  4X62 L;  4OIJ A;  1WTX A;  3OW2 A;  1NAP A;  2J0T D;  2E74 C;  1IKL A;  2B2W A;  4PZ7 A;  2XRQ D;  2PQA B;  3S24 A;  2VL6 A;  2E8G A;  2R7D A;  4FP5 D;  3T4A C;  4ZKB B;  1JC7 A;  1TWF B;  3S14 B;  4OWX B;  3HZX A;  1BCP F;  4B08 A;  3QR8 A;  1RIP A;  1X55 A;  4X3U A;  1WJJ A;  1B8A A;  3NEM A;  1PTO H;  1G29 1;  2PPB C;  2BE5 C;  2MFI A;  4X6A H;  4BY7 B;  1CKN B;  1R4Q B;  3A74 A;  4HTH A;  4CJ0 B;  2SNS A;  4QQB X;  1J9O A;  4EGV A;  4KKT A;  3AYH B;  5E1F A;  4ZYS A;  1VQK A;  3T1H L;  5CBA E;  1D1I A;  1SYE A;  3RLN A;  4JI1 L;  4JI8 L;  1B3A A;  1D1K A;  2XWB B;  3F1Z A;  1IW7 C;  1EFI D;  3FKI H;  1SAP A;  5C3W A;  4OXP A;  5C4H A;  5IP9 H;  1N33 L;  1EUJ A;  4B9X A;  1PV4 A;  1SMY D;  4BA2 I;  4YHH L;  2YTY A;  3AMU A;  2F0J A;  4K2L A;  5ELN A;  2VS1 A;  1SSO A;  5HGQ A;  1CZW A;  1K28 A;  2FXQ A;  1GM5 A;  4XYO A;  1UEB A;  1PH1 A;  3RLO A;  1D8L A;  1ZEQ X;  1UWV A;  2MGS A;  3K0Y A;  2EJG C;  2LXJ A;  5JJZ A;  4NKL A;  1Y8N B;  3NUC A;  3F2B A;  2CW0 D;  2ZTC A;  4K5X A;  3CRK C;  4UAI A;  3HOV G;  4CKE A;  1STG A;  3I3C A;  1J6Q A;  3M4O H;  1EY9 A;  1YHB A;  2JP1 A;  1DOL A;  1Y8O B;  4LFB L;  1VQG A;  2KOL A;  4BS9 A;  5M5X B;  2NN6 H;  4GOP B;  3AFP A;  3BZD B;  4GN5 A;  3QWN A;  2AKW B;  4KKS A;  4HR7 B;  3UDF A;  4CDC C;  4O42 A;  2IJ0 A;  4B3T L;  3ULL A;  4KKU A;  1O7L A;  2NVT H;  2F1M A;  4O1N A;  4R4T A;  3GTG B;  1HHV A;  1YJN A;  4KK7 A;  4XTC S;  1LAC A;  1EOT A;  4MHE A;  4PZ8 A;  4CKC A;  4DR1 L;  2FHT A;  4DV3 Q;  5JEA G;  2KVM A;  4A4I A;  4B3R Q;  1YIJ A;  2L0C A;  3PO2 H;  1J8I A;  4A3E H;  1E2Z A;  4F8M A;  2R7Z H;  1L1O C;  1FNV A;  3MEF A;  2VQF Q;  4JBK A;  3HOV B;  4IFD I;  4JYA Q;  1K3R A;  5IIF A;  5AJ3 Q;  2N78 A;  5BR8 L;  3ITP A;  4EQN A;  2E5L Q;  2XWJ B;  3QOL A;  1DXM A;  2ES2 A;  5IWA Q;  2B63 G;  1KRS A;  2TMP A;  1QG7 A;  1MIU A;  3RZO B;  3CCU A;  1TU2 B;  3C1F A;  3ZYY X;  1QIL A;  3MXG A;  3KFU A;  1O7Y A;  2HIX A;  1BQQ T;  1LAB A;  5C0X J;  1XMQ Q;  3GTJ H;  2EYM A;  5IGC A;  1ASZ A;  3BZK A;  1I4R A;  4F7X A;  4DR5 L;  3T1Y Q;  4PMW A;  4Q0F A;  4MTK A;  2CHB D;  2E2I H;  3KYH C;  5A35 A;  4IUN A;  2JA6 H;  2JA7 G;  3FVQ A;  1HJP A;  1QVG A;  4BY1 H;  5JVG 3;  2F4V Q;  2NZO A;  1FJG L;  1PH7 A;  1JOQ A;  1EYG A;  1X3Q A;  5IYC G;  4DK6 C;  4LUV A;  5LL6 X;  4DFA A;  3A8J E;  2F0H A;  2JXM B;  3CC4 A;  1LYL A;  1EY6 A;  3CPF A;  2CKZ B;  2B8F A;  2B63 B;  1P8L A;  1E7Z A;  1O78 A;  3GTK H;  2IY5 B;  3FDT A;  2R3Z A;  3E9H A;  4K8I A;  2O5J C;  1YZ6 A;  2AQ1 B;  3W3A A;  1IBM L;  1SMY C;  3JAM E;  1KDB A;  3PO3 G;  4RHR A;  3NBH A;  3G4S A;  4S3S A;  3SVM A;  1ICW A;  1LUZ A;  1VCI A;  4X3K A;  1GO3 E;  5C5M A;  3HOY H;  1UAP A;  1HR0 W;  2JA7 B;  2IPK D;  2EYJ A;  2YV5 A;  2OF1 A;  1BO0 A;  3LX0 A;  4NXN Q;  2LSS A;  2K01 A;  4RG1 A;  1KNE A;  2F0G A;  4B9W A;  4G4K A;  3OMG A;  3A55 A;  3D6W A;  4TQU S;  1XTC D;  3W1G A;  4A3L G;  1KD1 C;  5HUR A;  1W2B A;  1H95 A;  5H1S E;  3NTI A;  3J81 E;  3R2I A;  1T5E A;  4G57 A;  3VR2 A;  2I0Q A;  1JWM D;  3S1Q B;  3AQQ A;  2Z1C A;  4X3T A;  2K50 A;  2AQ3 B;  1A62 A;  3PO3 B;  2NN6 I;  2Q2I A;  2RHQ B;  3T51 B;  2XNA C;  4RMF A;  3K59 A;  1HRJ A;  4K5V A;  2F0S A;  3RR5 A;  3SK5 A;  5ELO A;  3C2P A;  4HMJ A;  2EJM A;  2A6H D;  2F0O A;  1SN8 A;  4K8J A;  1YNN D;  2CQA A;  3PUW A;  4IQZ A;  3EIV A;  4JBJ A;  4KY5 A;  5ISR A;  1IL2 A;  1VQF A;  1MSG A;  1WTV A;  3WWV A;  3H3V H;  2WAQ G;  4H13 C;  3VYT A;  4C3J H;  2AUK A;  4C56 C;  2K5N A;  4LFA L;  4X65 L;  3EFX D;  1TWC H;  5F2D A;  1S3O A;  3RN5 A;  5IOC A;  1CFM A;  3VR4 A;  3QOJ A;  3HFZ B;  4XT3 B;  1N9W A;  4JV5 Q;  3I73 A;  4K0K L;  2Q2U A;  1SND A;  1KLU D;  1M1K C;  1N33 Q;  1GHK A;  2G5D A;  3PV0 A;  1DGS A;  5C0X H;  4GLV B;  1GUG A;  4JPB W;  1OO9 B;  3T56 B;  3QIA A;  1Q46 A;  3CCE A;  3H0G G;  1PH8 A;  3KBX A;  5FLM H;  1ROD A;  2WAQ B;  4JI5 L;  1EU4 A;  4JI0 L;  5C3E G;  1RKN A;  4N8F A;  1LTA D;  1PZJ D;  1D5X C;  1NR2 A;  3UDX A;  4A3F H;  3KLS X;  2A19 A;  1PH6 A;  3LWU A;  3UI2 A;  1EYC A;  4LMQ D;  2L5T A;  3OHX C;  4ZRZ A;  1GKH A;  4C3H G;  1C4Q A;  3HOZ H;  4X66 L;  1LM0 A;  4DF7 A;  1L1O B;  1E2W A;  3SXH A;  5IT9 L;  2ID0 A;  5IP7 G;  3E0E A;  2JK8 A;  5CGK A;  3H0G B;  1CSQ A;  4LF5 L;  2VZA A;  3I4M G;  2KCN A;  3AFQ A;  4WRD A;  1V43 A;  2K32 A;  2K5W A;  2A6E D;  4LF9 L;  1GUT A;  4QIW B;  1VQO A;  1RCV D;  1EYA A;  4LF6 L;  1SEB D;  2AWN A;  2JYO A;  3MXN B;  4OEL B;  4FF2 A;  1K73 C;  3K80 C;  5C3E B;  4DV5 L;  4DU9 A;  1EWC A;  3I4N G;  1PTO B;  3BU2 A;  4F88 A;  2AHO B;  4DV2 Q;  4C1N I;  1M90 C;  5DM6 3;  3GTQ B;  4A3G G;  1TT2 A;  1CA5 A;  1ESR A;  4AH6 A;  3I8Z A;  3SR1 A;  4LFC L;  2QF7 A;  3UDG A;  2KED A;  5KYI A;  4C3H B;  1Y1W G;  1LTG D;  2E2J H;  2K04 A;  3CME A;  3H09 A;  3CCV A;  1GD7 A;  4A3C H;  1LTT D;  3HRZ C;  4IO9 A;  3I4M B;  3SEB A;  1VQB A;  4L5Q A;  2F0N A;  2A6H C;  2F0P A;  4YCU A;  2WAC A;  3TDQ A;  1HNW Q;  3K0X A;  3U50 C;  1G8Z D;  2D2C C;  2IHE A;  2NVY H;  5GQO A;  4G7H C;  4IZ8 A;  1I94 L;  1AP0 A;  5I6W A;  4ZK9 B;  4R8I A;  3B6Y A;  1CHP D;  3HG9 A;  1G6P A;  3W5O A;  1CQF A;  3I4N B;  3G7L A;  1HQM C;  1BNZ A;  2PQA A;  4DV4 L;  5DEH A;  1WVL A;  2LS0 1;  2EE1 A;  4A3G B;  1YJ9 A;  4A3J H;  4K5W A;  5E4W C;  2QCP X;  1OTC A;  2H1E A;  2VB3 X;  2JEA I;  1Y1W B;  5FO7 B;  2YTX A;  1NMF A;  4ODG A;  4DR3 Q;  3S1N H;  3K7A B;  3PO2 G;  2NWG A;  1CKN A;  1YBY A;  3TP5 A;  3C46 A;  3HGB A;  2YU9 H;  3HOU H;  3GTL B;  3D4R A;  4DPG A;  2HQL A;  2XTI A;  3OOC A;  2JJQ A;  2UXD Q;  4HCE A;  4DAP A;  1ZYR D;  3M4Q A;  1EQV A;  4KHP Q;  5M3F H;  4J1M A;  3V05 A;  3GV3 A;  5EAY A;  5I2Y A;  3CHB D;  3D3R A;  1PYB A;  4LK1 C;  1Z9F A;  2JA6 G;  3M4P A;  1D7Q A;  5J3B A;  3A7L A;  4AYB G;  1AW7 A;  1LTI D;  1LLR D;  4B3M L;  3PO2 B;  5FKA C;  3CCS A;  3K57 A;  1CZG A;  3FP9 A;  1B9M A;  2MUY A;  2XRS D;  4GKK Q;  3KDF A;  1UNS A;  3MA2 B;  2A6E C;  1TS2 A;  1SE8 A;  1M4V A;  2NZ1 D;  4GLA C;  3O13 A;  4NW2 A;  3ZJY C;  1WFQ A;  5JPN C;  2N49 A;  2NVX B;  3A0J A;  4FO2 A;  3M85 A;  2PI2 A;  1QVF A;  4LNQ A;  4XYQ A;  2IT1 A;  4BBR H;  4GOP A;  3VR5 A;  3FPU B;  2JA6 B;  3KLS A;  3HOX H;  4IOA A;  4IFD J;  1MJC A;  3K5M A;  3BVM A;  1K8A C;  4AYB B;  4L63 B;  2QEX A;  1BBU A;  1JWS D;  1GXD C;  2GVB A;  1TVX A;  2B2Y C;  3CU7 A;  4OON A;  1J5E Q;  1UE7 A;  4GNX C;  1I4G A;  3CC7 A;  5I9P A;  1F9S A;  1JCK B;  3VR6 A;  5E3F A;  1XNQ Q;  4POG A;  4DUY Q;  1C7Y A;  5I4D A;  4DV1 Q;  2BE5 D;  5J1Z A;  1S5B D;  3H6M A;  1FD7 D;  4JI4 Q;  1YHQ A;  1CA6 A;  2DNC A;  1SJE D;  2L15 A;  4A3D H;  3NXW A;  4DV3 L;  2BDO A;  3PSI A;  1Z47 A;  1ZKO A;  5IGB A;  4B3R L;  3A5Z B;  4GOP C;  4IUQ A;  1Z7T A;  4QY7 A;  2VQF L;  1VF7 A;  4KLK A;  2LY7 A;  2F0W A;  1QNK A;  4RCO A;  5DLQ E;  2RCF A;  4JYA L;  5AJ3 L;  1IW7 D;  4QUC A;  1JR0 D;  2E5L L;  1EIY B;  5IWA L;  4UP9 A;  4BXX G;  1EY8 A;  2EXD A;  4UDU C;  5IGD A;  4HAE A;  1HZC A;  1QWY A;  2PNR C;  3D0F A;  4KN4 C;  1XMQ L;  1KHI A;  4A3I G;  1WCM G;  1E22 A;  2RBM A;  2QEJ C;  2Z9H A;  5KNC A;  2CVR A;  4UP8 A;  1K0S A;  3GDE A;  2JQO A;  2B2V A;  3BDL A;  3P20 A;  3T1Y L;  1VQL A;  3I72 A;  3HKS A;  5ELF A;  3S16 B;  1O80 A;  1TS4 A;  3FEW X;  5FLM G;  1JMC A;  5C4J B;  4QMG A;  1JOR A;  4FVM A;  5L37 A;  2WII B;  4RGO S;  5M3M H;  4LF8 Q;  1RHP A;  4GLX A;  2F4V L;  3A7A B;  4YY3 Q;  1PLF A;  3EVQ A;  3IFT A;  2XN9 C;  1PA6 A;  1G2S A;  2BOS A;  1YEZ A;  4JC0 A;  4DK0 A;  1YNJ D;  1PHJ A;  3M4Y A;  1OXV A;  1HR0 Q;  2K75 A;  3D4W A;  3BJU A;  4PG3 A;  4A3I B;  1WCM B;  1I6H H;  4PZ6 A;  4ZKC B;  3RN2 A;  1RTO A;  3GTM B;  2QIL A;  2HD3 A;  1DOK A;  3CP0 A;  2ALY B;  4DN4 M;  3BYY B;  4C2M B;  1CUK A;  2SNM A;  5CR3 A;  1SNQ A;  4A93 H;  1U9R A;  2UUB Q;  3S9W A;  4M8A A;  1KAB A;  2B2V C;  2BA1 A;  4NXN L;  2F0M A;  1EEI D;  5GAH C;  3CMA A;  1VQJ A;  1B9N A;  4POF A;  4IFD H;  1HUN A;  1HPC A;  3QO2 A;  4KHZ A;  4FXD A;  5KGU A;  2PCF B;  1B53 A;  3NBI A;  1NE3 A;  1F9Q A;  1UUP A;  1C9O A;  2L12 A;  3ND8 A;  1UEA B;  3OTO Q;  4XQQ A;  3PF4 A;  3M3Y B;  4JI7 Q;  4IUR A;  1EU3 A;  1ESF A;  4HJ7 A;  4QF4 A;  3LGJ A;  2R61 A;  1Y69 U;  3ERQ A;  1JOO A;  3S17 B;  3M7N A;  5GAE C;  3IL8 A;  2F0F A;  1SE3 A;  4JI6 Q;  1MBY A;  1PTO D;  2F0U A;  3G71 A;  1EOV A;  2K5V A;  1VQH A;  1Q81 C;  2ZXO A;  1FYC A;  2Q2T A;  5LMU Q;  2A1A A;  2B3G A;  1QUQ B;  3HP3 A;  4H7B A;  4P75 A;  3SDZ A;  1YI2 A;  1ZXT A;  2N8N A;  3I55 A;  1BUV T;  1I6V C;  3S2D H;  3Q22 A;  3EJI A;  3KJP A;  4B3M Q;  4OX9 Q;  1S5F D;  2N55 A;  2A8V A;  4JV5 L;  1L2F A;  2EDG A;  3BDO A;  3D8G A;  2E2H B;  1STA A;  5T1G A;  3TSS A;  1ICF B;  3PIO 3;  3RMH A;  2J4X A;  1Q82 C;  1PFM A;  1CK1 A;  1VMP A;  4TKO B;  2OEO A;  3MEH A;  2E2J B;  1FL0 A;  1DYQ A;  3U58 A;  1F9R A;  4KD3 A;  4GNX B;  1U0L A;  3FMC A;  5C44 G;  1HA6 A;  3K58 A;  4RGT A;  2VUM H;  2QGQ A;  1DD2 A;  3JAM L;  2R93 H;  3OWE B;  4IUP A;  2PMZ B;  1A3T A;  5IT9 c;  2PNH A;  4ZQ3 A;  1L1O A;  4NXM Q;  3ERS X;  3KDF B;  5ELC A;  5C6A A;  2CH4 A;  3I91 A;  1EY5 A;  3A8I E;  5IYD G;  4ME5 A;  2VNU D;  2VW9 A;  5JJL A;  3CW2 C;  1KNA A;  1YNJ C;  3TP6 A;  5GAG C;  1Z6H A;  4CJ1 B;  4ME3 A;  3MXN A;  1YJW A;  1PRT B;  4JI3 L;  4LF4 Q;  4WJW A;  3GTO B;  4HMI A;  5M5Y H;  4C3I H;  1NCV A;  1XPO A;  4EX5 A;  1N32 Q;  4AIM A;  2WKC A;  1NMG A;  4ILW A;  4L5R C;  3J81 L;  3STB C;  3WDN A;  5C44 B;  2YU9 B;  1BVS A;  1QCB D;  4HIO A;  1JE5 A;  2QA4 A;  1KIX A;  1N36 Q;  3BYT B;  4K2K A;  3BVZ A;  3VYR A;  4DV7 Q;  3I7F A;  5C3X A;  3X3M A;  2KBN A;  2HDL A;  2ZTE A;  4DV2 L;  3NEL A;  3W2D A;  2DN8 A;  3ONA B;  1EY0 A;  5EKK A;  1I3Q B;  1V1O A;  5EBC A;  2JA8 H;  2R92 H;  2FMC A;  2EY1 A;  2HUG A;  4HJ9 A;  2KCM A;  3W1B A;  4OWW B;  1EQR A;  1SDF A;  5FLX E;  3HOW H;  1PTO C;  2NVQ H;  1VF5 C;  4WJ4 A;  1DM0 B;  3Q24 A;  4KN7 C;  1K9M C;  1BR9 A;  4PV1 C;  1HNW L;  4FF4 A;  3GTP B;  3PGZ A;  4NPS A;  1H9S B;  3Q0A A;  4A3K G;  1TWA B;  3PUY A;  2I46 A;  4ALP A;  5A2Q E;  4CDE C;  1NNX A;  3TP8 A;  1IHZ A;  1CKM A;  2AWO A;  4RCN A;  1SFO B;  3SHL A;  1XWE A;  1AN8 A;  1UE6 A;  2K5D A;  4A75 A;  3NHH A;  4MTN A;  3TZD A;  4A3D G;  2NB0 A;  1XPR A;  1SYD A;  1K8M A;  2Z6K A;  1CKO A;  4DR3 L;  1KDC A;  4CKB A;  2EZV A;  4A3M H;  1XXG A;  2JSO A;  3MXP A;  4F87 A;  1HUM A;  3I4L A;  3NEN A;  2DJF C;  1X32 A;  1IBK Q;  1C48 A;  2UXD L;  5KIX A;  3U4Z A;  1Y1V H;  5C5L A;  1SMX A;  5EBD A;  4KHP L;  3TP7 A;  4A3K B;  1A0I A;  2JE6 I;  4YIJ A;  2WB1 G;  3UDI A;  1C8C A;  1F2Y A;  1Y14 B;  3HKZ G;  5E4X A;  3DWA A;  3J80 E;  2J7Z A;  3EA6 A;  4A3D B;  1PYS B;  5M3M G;  1DCZ A;  3KOJ A;  1LTL A;  3TRE A;  3I90 A;  4NB3 A;  4BA1 I;  5FJ8 H;  1G6Z A;  1JQY D;  4TRD A;  2X6L A;  1A63 A;  3T13 A;  1XJV A;  1AZP A;  1R9T H;  1X3G A;  2GA4 B;  1ENC A;  3R8B A;  4GKK L;  1I5F A;  4MIU A;  3J81 j;  1I4Q A;  1CM9 A;  1K83 H;  1B2T A;  5C4X H;  4P73 A;  3K5O A;  4HN7 A;  3DWP A;  1X3P A;  2WB1 B;  1TWH H;  3CQZ H;  1CTM A;  2PO4 A;  4WFN 3;  5G3L D;  3HKZ B;  3TQY A;  4DXG A;  4DV6 Q;  3S1M H;  4A93 G;  3TS0 A;  5JAV A;  1JE4 A;  5M3M B;  5M5W B;  3HEJ A;  4DR2 Q;  1GUS A;  1WI5 A;  3A56 A;  4IFD G;  1E1O A;  1WTW A;  3TBI B;  5FO8 B;  3SGI A;  3K6O A;  4J6H A;  1K0R A;  2N88 A;  4YWM A;  1QZH A;  1J5E L;  2A5H A;  1JOK A;  1E24 A;  1VDZ A;  2DGY A;  3CKI B;  5IOD A;  2HHH Q;  4ABN A;  1S40 A;  5EGT A;  1XNQ L;  3J7A 5;  2L4N A;  1V8Q A;  1I50 B;  2Z4I A;  1OXS C;  4DUY L;  1I6H B;  4X64 Q;  4DV1 L;  1R4P B;  3TS2 A;  4DXF A;  3SK8 A;  3WOF A;  4JI4 L;  1PFN A;  1KXL A;  1B44 D;  4I65 A;  3I2Z A;  5IGE A;  2F03 A;  3CRL C;  2F0Q A;  4A93 B;  1EFW A;  4KV6 A;  2UXC Q;  3BVG A;  3ND9 A;  5JJI A;  1IXR A;  2BA0 A;  4HID A;  1B50 A;  4JI3 Q;  2Y0S G;  2MQH A;  1GVP A;  1PZK D;  3KF8 B;  2MNA A;  3FPP A;  3BS1 A;  2UU9 Q;  1AE3 A;  1L0Y B;  1FVI A;  1TII D;  2ZXR A;  3FKI G;  2RSN A;  2A73 B;  5IP9 G;  3TME A;  2Q8T A;  3V96 A;  2V1C C;  1PFB A;  5IYB H;  1TWF H;  3S14 H;  5KND A;  1D5M C;  2XGT A;  2UXB Q;  1SRO A;  2HDM A;  1V1Q A;  1HFG A;  4BY7 H;  4LF8 L;  1PVO A;  4ZLT F;  1I4P A;  4YY3 L;  2VUM G;  3PUV A;  1AEX A;  1MJE A;  1RD9 D;  1ET6 A;  2Y0S B;  5LMN Q;  2EQS A;  3U9S A;  4DNR B;  4O0A A;  2EVB A;  5FK9 C;  1ILQ A;  1WTQ A;  1HR0 L;  1B70 B;  2O2L D;  1D6E C;  2DUD A;  4RHS A;  1AZQ A;  4DR4 Q;  4U67 3;  5DNF A;  3S15 H;  3FKI B;  3CD6 A;  1I4H A;  2NN6 G;  3H3V C;  1U4L A;  4LW1 A;  1QB5 D;  1F2Z A;  4ZCK A;  3RZD H;  2P5Z X;  5J22 A;  1SE2 A;  4R4I A;  5EJW A;  2RQX A;  2UUB L;  2KHJ A;  3I70 A;  1LTR D;  4CGY B;  3J7A V;  4OO1 I;  4JBW A;  1E1T A;  1V1P B;  4IUV A;  1E2V A;  4LAA A;  1Q8I A;  1SR3 A;  2CWA A;  1UE1 A;  2VUM B;  2GN5 A;  3KLW A;  4N8X 1;  3KK7 A;  3S2H H;  1PRT D;  4QIW E;  2AQ2 B;  3G48 A;  2DY8 A;  3H94 A;  1NY4 A;  1DOM A;  3E5S A;  4A3E G;  5D14 A;  2R7Z G;  1VQC A;  4R9W A;  4XIG S;  1QUQ A;  4UY8 C;  3OTO L;  5JJK A;  3M4O B;  4XDX A;  1HNX Q;  1S5C D;  2LMC B;  3A5U A;  1PXU A;  4JI7 L;  2L1B A;  1WTO A;  2JA8 G;  2MP1 A;  3DXJ C;  4IUT A;  5M5Y B;  2ZJQ A;  1N8R C;  2VQE Q;  1SYF A;  2F3W A;  4J15 A;  2LXK A;  1KL9 A;  1FNU A;  2WKD A;  5CV5 A;  4JI6 L;  1EIH A;  1BOS A;  1B4O A;  1VQD A;  2AMC B;  3VA7 A;  2NVT B;  4ULL A;  1A15 A;  4Y7N H;  3GTG H;  3HOW G;  5LMU L;  3DHQ A;  3VR3 A;  3U4V A;  4BY1 G;  5EPJ A;  4NP5 A;  2G9D A;  1PTO F;  4CJ2 C;  2B2Y A;  4ZAI A;  2EY5 A;  3F8T A;  1ILP A;  4OX9 L;  1GUN A;  4GNX A;  4A3E B;  5HGT A;  2YTV A;  2R7Z B;  3JAM c;  2RKS A;  3HOV H;  2EY2 A;  1STN A;  2KA7 A;  3U9O A;  1P16 A;  2K14 A;  5KRU A;  3RZO H;  4PQX A;  1OXX K;  2JA8 B;  1F77 A;  3GTJ B;  4V19 0;  4AQY Q;  4HIM A;  1PFS A;  1U4M A;  4L8J A;  1ENA A;  2EY6 A;  3NWT A;  4APV A;  1AFP A;  2L11 A;  4N9P A;  2I5L X;  3HOY G;  3I56 A;  1KAA A;  2KUM A;  3CC2 A;  3HOW B;  2E2I B;  2EIF A;  1DON A;  1LT4 D;  2L55 A;  3J80 c;  3N52 A;  4NXM L;  2X6G A;  5CC4 A;  1S5D D;  2F3I A;  4BY1 B;  4LF7 Q;  5CV7 A;  4GN3 B;  1CSP A;  3J81 c;  1SYC A;  1XNR Q;  1TS5 A;  3PMF A;  4R1J A;  4JOI C;  2PQE A;  4DKA C;  2A68 C;  2RDF A;  1SLJ A;  2B63 H;  3MVV A;  4LF4 L;  3GTK B;  3EN2 A;  2OT2 A;  2F3V A;  4FYD A;  2MO0 A;  3BDC A;  1N32 L;  3K8A A;  2B2T C;  5JVH 3;  3HOY B;  1F2L A;  1Q1B A;  2JA5 H;  4DR7 Q;  1JT8 A;  1CQV A;  1N36 L;  2JA7 H;  5EQ0 A;  1MHW C;  2K1B A;  4H0L C;  4DV7 L;  2BDN A;  1KC8 C;  1PH3 A;  1PRT C;  4C3J G;  5FO9 B;  2KEN A;  4DGZ A;  5NUC A;  1NSN S;  3G6E A;  5IYC H;  3A8K E;  1VQM A;  3Q23 A;  3CCM A;  3OIQ A;  1EQQ A;  5KYL A;  2PW5 A;  4RA8 A;  2RCN A;  1H9S A;  1AE2 A;  5EKI A;  5CBE E;  2PZW A;  4EVO A;  1X56 A;  4QGU A;  4AYB E;  3KJO A;  5C0X G;  3PO3 H;  4HCS A;  1F2M A;  2EOT A;  3UE1 A;  3CCR A;  2E2D C;  1WTR A;  2X69 A;  4UPA A;  1F9P A;  1BCP B;  3ERO A;  1K8O A;  2OQK A;  1LT5 D;  1K83 B;  5CYU A;  4KMU C;  4C3J B;  3MTS A;  1LTB D;  2M9V A;  3OIP A;  1RTN A;  5AFW A;  1TWC B;  3CAM A;  2WFW A;  3VYS A;  1RF2 D;  4Q5V A;  4A3F G;  4DV0 Q;  4A3L H;  2NTS A;  1SNP A;  2B2U C;  2O5I C;  3LWE A;  1JB3 A;  1V9P A;  1KTK A;  5LMN W;  1X65 A;  1IZ6 A;  3SE0 A;  3HOZ G;  3M9B A;  3P1H A;  4HED A;  3STB D;  1JWU D;  2Z8L A;  2KJX A;  1IBK L;  3ULJ A;  1QZG A;  1AH9 A;  2TSS A;  5CV9 A;  1O7I A;  1MD2 D;  4O2D A;  1S72 A;  4BWG B;  1H9M A;  2KHS A;  3MXU A;  2Z4H A;  1OXU A;  1WTP A;  4K6D A;  1FGU A;  1PH4 A;  2F0T A;  1TWG H;  4R4O A;  1NBW A;  5IYB G;  4JCV E;  1X9N A;  2JN4 A;  1STY A;  4CDD C;  4QB4 A;  5T1I A;  3CCJ A;  2EYH A;  1YHA A;  2KQ3 A;  4A3F B;  3S1R H;  4ZUI A;  4KY6 A;  1MSH A;  5HY6 A;  3ICE A;  1YIT A;  1XMO Q;  2ZM6 Q;  1GHJ A;  2MPM A;  1IBL Q;  1VS0 A;  1FR3 A;  5E7N A;  1A8V A;  1SNM A;  2B39 A;  1WD1 A;  4OHJ A;  2D5D A;  3HOZ B;  2F0D A;  5LHY 1;  5COY A;  4A3C G;  2NZH A;  4KTA A;  1N34 Q;  1Q1E A;  4B3S Q;  2KHI A;  3H0G H;  4HJ8 A;  3MFY A;  4WJ3 M;  4JW0 A;  2K03 A;  4GS3 A;  2LKV A;  5FLX L;  1G91 A;  4IJL A;  2K52 A;  4P71 A;  5DAU A;  4DV6 L;  5C3E H;  2UUC Q;  2D9U A;  4DA2 A;  1S5E D;  3PQI A;  2D0O A;  1BDO A;  4DK3 C;  5A2Q L;  1WTH A;  3GTQ H;  3KF6 B;  4DR2 L;  4A3J G;  5BN3 A;  5G3L F;  2EYL A;  3TEH B;  3NP8 A;  3HS0 C;  4C3H H;  1EZ6 A;  2RVL A;  4JVZ A;  4NDX A;  5IP7 H;  2Z0S A;  2HHH L;  3HOU G;  3I4M H;  4MN3 A;  3NQT A;  4V0B A;  4H02 A;  3S15 B;  3KF8 A;  4X64 L;  4P2C B;  3MFG A;  1QNU A;  4G7O C;  1VQ4 A;  2LFN A;  2NVY B;  5M3F G;  3RZD B;  2B2W C;  1HXY D;  3GV6 A;  4HIK A;  1HZ9 A;  1VQI A;  3I4N H;  3F2D A;  1RDP D;  2UXC L;  1ASY A;  1EZ8 A;  1PZI D;  4Y52 H;  1A3U A;  4A3G H;  3S2H B;  4A3J B;  1VQ5 A;  4QJF A;  4RGN A;  4GN4 B;  3T53 B;  2ICE C;  5LL6 S;  4LUO A;  3P75 A;  2Q8I B;  2Z6B A;  1Y1W H;  3J80 L;  2CH4 W;  3S1N B;  3K7A H;  4DUZ Q;  2UU9 L;  3K7U C;  3CCL A;  3I4O A;  2IX0 A;  2MO1 A;  2PZT A;  5BN5 A;  3HOU B;  3GTL H;  2QW7 A;  3QG1 A;  2EJF C;  3NK9 A;  3F2U A;  5DM7 3;  5JOB A;  2FFK B;  3D6C A;  3IAY A;  2G9H D;  2K5Q A;  1LT6 D;  1I4X A;  1M8A A;  1SXT A;  4FF3 A;  4DR6 Q;  5M3F B;  2KCT A;  4K6L A;  4J8Q A;  2UXB L;  2F4I A;  1GOZ A;  4NMZ A;  2C35 B;  1A6X A;  3MWY W;  4WOR A;  4EQP A;  2IL8 A;  3GO5 A;  4OEM B;  2F52 A;  4LJZ C;  1L0W A;  2A74 C;  4Y7N B;  4BBR G;  1SYB A;  2PMZ E;  4IJH A;  1T9H A;  3OPO A;  3TN2 A;  3HOX G;  5LMN L;  3C3L A;  1PDQ A;  2MJ8 A;  3CPW A;  1EIF A;  2RDH A;  1V1P A;  2R6G A;  1QOH A;  1X54 A;  2RA4 A;  1B1Z A;  5C4Z A;  4DR4 L;  1Q3L A;  1W3S A;  3N6R A;  4CHT B;  2PI2 E;  4DNI A;  5KEE A;  1LTS D;  3T16 A;  2C9O A;  2GVA A;  4M1U B;  4KD4 A;  4IPG A;  3RD4 A;  2F0L A;  3C1E A;  1RJT A;  2WIN B;  1A2U A;  4K14 A;  2NVX H;  1EL0 A;  4BBS H;  2NUC A;  3E6Z X;  1SNC A;  4BBR B;  2JA5 G;  2KEE A;  1PYW D;  1STB A;  1VQA A;  2DY7 A;  3HOX B;  4OIK A;  5CV6 A;  2B29 A;  1W6J A;  4EQO A;  3OYY A;  3PIP 3;  1HNZ L;  4GKJ Q;  2A69 D;  2E75 C;  1E3P A;  1EYD A;  1NUC A;  3V2T A;  4DAY B;  2NTT A;  1VQ6 A;  1PRT F;  4YWK A;  4C1N K;  1IYV A;  1PH9 A;  3GQB A;  4FNF A;  1HNX L;  4R8N A;  4TVA B;  3IKJ A;  3DMU A;  4DNT B;  2MHV A;  3J7A F;  3DM1 A;  4YCV A;  2VQE L;  1HFN A;  1LT3 D;  2CQO A;  2OTJ A;  1KAW A;  2QKI C;  4X3S A;  1X6O A;  1W6K A;  4XXE A;  1HZA A;  4I7A A;  2HCC A;  1TQO A;  2JA5 B;  1SNO A;  3TZU A;  2VXW A;  3K5N A;  1IYJ B;  1S4Z A;  1STE A;  1ET9 A;  4DK1 A;  2UUA Q;  4JI2 Q;  4JG2 A;  1LV9 A;  4U68 A;  1VQ7 A;  1BXT A;  2CW0 C;  1C0A A;  1BCP D;  4X62 Q;  1DZ1 A;  5EPL A;  4H44 C;  2BH8 A;  4AQY L;  4LWC A;  2F0V A;  4A3B H;  3CF5 A;  1E0B A;  3K81 C;  2VY3 A;  4OO1 H;  2ZJP A;  4E6I A;  3E9I A;  4XQJ A;  3S16 H;  3PUX A;  1HCZ A;  1MKH A;  4OWT B;  2RF4 A;  5C4J H;  5IE8 A;  4LF7 L;  1BF4 A;  1D5Z C;  5ELE A;  2ZT9 C;  1A3V A;  1XNR L;  2DNE A;  2ATW A;  3Q6S A;  1DJR D;  1NTG A;  2OWO A;  3EQL C;  5I2X A;  3T1H Q;  4R4C A;  4JI1 Q;  4JI8 Q;  4QCL A;  2XSC A;  3J7Z C;  4IPH A;  1U4R A;  1EWH A;  4BXX H;  3Q8D A;  2C5C A;  4DAM A;  4CBV A;  2OXP A;  5TSS A;  4A3I H;  1WCM H;  3GTM H;  4R4Q A;  2KEC A;  2PW7 A;  4KY7 A;  4OGQ C;  3D4D A;  1YVC A;  3IFD A;  4YHH Q;  3L9A X;  4C2M H;  2IW3 A;  3GD7 A;  4DR7 L;  1H9J A;  5M9O A;  2HIV A;  5K36 H;  5IGG A;  5CV4 A;  4HSP A;  1TWG B;  3RUZ A;  1HZB A;  2OCE A;  4L5T A;  1U5K A;  2V4D A;  3MZ5 A;  4I7Z C;  2A69 C;  2WB1 E;  2XIW A;  2HQE A;  1GUW A;  3DEP A;  1CI3 M;  3HKZ E;  4JK1 C;  2CCZ A;  1NR4 A;  1FNW A;  1GUO A;  1VMC A;  2K7V A;  2F0K A;  4OL7 A;  3S1R B;  4QUF A;  3ULP A;  1CHQ D;  4FF1 A;  1WYD A;  2I5M X;  4LFB Q;  3M3Y H;  1KQS A;  1MGS A;  1U4P A;  3S17 H;  5JPM C;  2IHF A;  3K5L A;  2JEB I;  3D31 A;  3MC0 B;  3WOE A;  3JAM i;  3VA5 A;  4PMB A;  4B3T Q;  3R93 A;  2IWH A;  3DLL A;  3ER0 A;  2R93 G;  4MNO A;  5JEA J;  3GP7 A;  2WAQ E;  4RWS C;  1TR5 A;  5D65 A;  4DR1 Q;  3H91 A;  3S2D B;  4IOC A;  4XQN A;  4N9T A;  2K33 A;  3A54 A;  3VYU A;  1WD0 A;  1G51 A;  4DV0 L;  2A68 D;  4LUZ A;  5EPK A;  3RLF A;  2RDG A;  3OWF A;  5ELB A;  2E2H H;  1PH2 A;  1BCP C;  5BR8 Q;  4Z9C B;  2OQ0 A;  3J80 i;  1TKW B;  3F2C A;  1BKB A;  4DAV A;  4C3I G;  1H9R A;  3J81 i;  5FOB B;  3PIO A;  2O4X A;  2BH2 A;  5EKL A;  2I5H A;  3LNN A;  4MZ9 A;  2AUJ D;  2VB2 X;  3NQI A;  2L9H A;  1SRU A;  3NWS A;  1EWI A;  2HT1 A;  1X3E A;  3PUZ A;  4DR5 Q;  1LO5 D;  1TXY A;  2NYZ D;  3DUZ A;  3KLR A;  2R93 B;  1YNN C;  2PYK A;  3KBG A;  2I07 B;  2WP8 J;  1A2T A;  1PMR A;  1EY4 A;  1TS3 A;  4IUU A;  1QVC A;  1HNZ Q;  1IKM A;  1K8G A;  3FHW A;  3PCO B;  1FJG Q;  3H3V I;  2EXZ A;  3NE5 B;  4HJA A;  4PNY A;  1VQN A;  4UP7 A;  4QL5 A;  3R2T A;  1XMO L;  2ZM6 L;  1SJH D;  4G7Z C;  1GJX A;  5FLX c;  2M2L A;  1IBL L;  4IPC A;  5M5X H;  2R92 G;  1X3F A;  2IX3 A;  2PZU A;  1Q8K A;  3E0J A;  3GTO H;  2Y0S E;  5D3I B;  1VQ8 A;  1H9K A;  4C3I B;  1HA5 A;  3TRZ A;  2EYF A;  1IBM Q;  2ZTD A;  1OXT A;  2RHS B;  1N34 L;  4B3S L;  4PMC A;  1VQP A;  1JJC B;  1B7Y B;  1BBW A;  3IRB A;  4GZY C;  1K3B C;  2NBF A;  5C0X I;  3KF6 A;  4RKB A;  5D3D A;  2QDB A;  2R7F A;  5C44 H;  1BBX C;  5ELD A;  1HQR D;  1B3Q A;  2FIN B;  3OW7 A;  3X3N A;  1Q90 A;  1ONL A;  3OMC A;  2DJG C;  3J7Y W;  4L5S A;  1QE6 A;  4FXK C;  4JOI A;  4RFB A;  1HH2 P;  4IN3 A;  1Q86 C;  3BG3 A; 
#chains in the Genus database with same CATH homology
 2UUC L;  3STB D;  5IYD H;  2KBN A;  1IBK L;  1Q46 A;  2ZTE A;  3H0G G;  3ULJ A;  3CCE A;  3NEL A;  4DV2 L;  1QZG A;  1PH8 A;  1AH9 A;  5FLM H;  4BBS G;  1O7I A;  3NBH B;  4O2D A;  1XTD A;  1S72 A;  3L2P A;  1OXU A;  2OTL A;  1FGU A;  2K4K A;  1PH4 A;  1I3Q H;  1TWG H;  4R4O A;  2JA8 H;  2R92 H;  4JI5 L;  3EBE A;  1NBW A;  5IYB G;  4JCV E;  4HJ9 A;  1X9N A;  2KCM A;  4JI0 L;  3W1B A;  4A3M G;  4OWW B;  3CCJ A;  1EQR A;  5C3E G;  1YHA A;  3UDX A;  3HOW H;  3S1R H;  4A3F H;  2NVQ H;  4WJ4 A;  5HY6 A;  3ICE A;  2ASB A;  2A19 A;  1YIT A;  1XMO Q;  1K9M C;  2ZM6 Q;  1Y1V G;  1PH6 A;  1HNW L;  3GTP H;  4HJ5 A;  3PGZ A;  4NPS A;  4A3K G;  2CWP A;  1TWA H;  1GKH A;  1VS0 A;  3PUY A;  5E7N A;  1A8V A;  1IBL Q;  3H15 A;  4ALP A;  3HOZ H;  4X66 L;  1LM0 A;  1L1O B;  4LFA Q;  4YWL A;  1CKM A;  2AWO A;  2ID0 A;  2NZH A;  2JK8 A;  3E0E A;  1Q1E A;  5IP7 G;  4X65 Q;  1SFO H;  2KHI A;  3H0G H;  1N34 Q;  4B3S Q;  1UE6 A;  4HJ8 A;  1CSQ A;  1Q7Y C;  4LF5 L;  1XPU A;  4WJ3 M;  2VZA A;  4A75 A;  3I4M G;  2H5X A;  3VDY A;  3AFQ A;  2K5H A;  2Z6K C;  4MTN A;  1V43 A;  4A3D G;  1XPR A;  4KI0 A;  4GS3 A;  4LF9 L;  1VQO A;  4K0K Q;  2YYZ A;  5FJ8 G;  1CKO A;  4DR3 L;  4DUZ L;  4LF6 L;  2AWN A;  2N3S A;  3MXN B;  4IJL A;  2K52 A;  1K73 C;  3K80 C;  4P71 A;  4A3M H;  4DV6 L;  4DV5 L;  5C3E H;  3PIP A;  2UUC Q;  3I4N G;  3NEN A;  3BU2 A;  1IBK Q;  1Q12 A;  2AHO B;  2D0O A;  4DV2 Q;  2UXD L;  1M90 C;  4DK3 C;  3U4Z A;  4A3G G;  3GTQ H;  3KF6 B;  1Y1V H;  4DR2 L;  4A3J G;  5C4X G;  1SMX A;  4AH6 A;  4DR6 L;  3TEH B;  5GRO A;  3RNU A;  4KHP L;  4A3K H;  4A3B G;  4LFC L;  3UDG A;  1A0I A;  2JE6 I;  4OO1 G;  1Y1W G;  4C3H H;  5IY0 A;  2WB1 G;  4JI5 Q;  3UDI A;  2E2J H;  3CME A;  4JI0 Q;  1Y14 B;  2Z0S A;  5IP7 H;  1GD7 A;  3CCV A;  4A3C H;  3HKZ G;  1KRT A;  2HHH L;  4IO9 A;  3HOU G;  3I4M H;  1VQB A;  1VQE A;  4L5Q A;  4EQ5 A;  1PYS B;  4H02 A;  5M3M G;  3KOJ A;  1LTL A;  4YCU A;  3TRE A;  4NB3 A;  4BA1 I;  4X64 L;  1HNW Q;  3K0X A;  3U50 C;  3S1Q H;  5FJ8 H;  1VQ4 A;  3CXC A;  2IHE A;  2NVY H;  2D62 A;  5GQO A;  5M3F G;  4JBM A;  1XJV A;  1I94 L;  1VQ9 A;  1R9T H;  1A63 A;  4HIK A;  1HZ9 A;  3B6Y A;  1X3G A;  1G6P A;  1VQI A;  4X66 Q;  3AEV A;  3W5O A;  3I4N H;  3F2D A;  2UXC L;  2PQA A;  4DV4 L;  1I5F A;  3PF5 A;  1JJ2 A;  1ASY A;  4GKK L;  3J81 j;  4LF5 Q;  4FDB A;  4Y52 H;  1K83 H;  1YJ9 A;  4A3G H;  3JC6 6;  4A3J H;  1VQ5 A;  4QJF A;  5C4X H;  4GN4 B;  1OTC A;  4P73 A;  4YCW A;  4LF9 Q;  4LUO A;  2JEA I;  2IX1 A;  1Y1W H;  2YTX A;  1YNX A;  1NMF A;  1TWH H;  4DR3 Q;  3S1N H;  3PO2 G;  3CQZ H;  3K7A H;  4DUZ Q;  2UU9 L;  4LF6 Q;  1CKN A;  1YBY A;  3K7U C;  3L7Z C;  2Q2H A;  3TQY A;  3I4O A;  2IX0 A;  2MO1 A;  2CFM A;  4DV6 Q;  1RL2 A;  4DV5 Q;  3CCL A;  2JA9 A;  3S1M H;  2YU9 H;  3TS0 A;  3GTL H;  3HOU H;  4A93 G;  5K36 G;  4DPG A;  2HQL A;  2XTI A;  2JJQ A;  1NJI C;  2UXD Q;  4GKJ L;  5M5W H;  3M4Q A;  5GAD C;  4DR2 Q;  4DR6 Q;  1WI5 A;  4IFD G;  4KHP Q;  1E1O A;  2KCT A;  5M3F H;  4LFC Q;  2UXB L;  3SGI A;  2D0P A;  1K0R A;  4YWM A;  2C35 B;  1QZH A;  1J5E L;  4A3C G;  5EAY A;  3GO5 A;  1E24 A;  1UE5 A;  2DGY A;  2F52 A;  1L0W A;  3L0O A;  3UE0 A;  4BBR G;  3BZC A;  1PYB A;  2HHH Q;  1S40 A;  1XNQ L;  3J7A 5;  1Z9F A;  2JA6 G;  3M4P A;  2PMZ E;  4IJH A;  1I50 H;  1T9H A;  4P74 A;  3HOX G;  4IPD A;  4A76 A;  1PH5 A;  1D7Q A;  5LMN L;  1OXS C;  4DUY L;  5J3B A;  2ZJR A;  4AYB G;  4X64 Q;  4DV1 L;  3CPW A;  1EIF A;  4B3M L;  3TS2 A;  1WOC A;  2R6G A;  1I94 Q;  4JI4 L;  1X54 A;  3CCS A;  1KXL A;  3I2Z A;  3FP9 A;  4DR4 L;  4BY7 G;  1EFW A;  1W3S A;  2PI2 E;  3DM3 A;  2UXC Q;  4DNI A;  4DV4 Q;  4GKK Q;  3KDF A;  5JJI A;  1IXR A;  2GVA A;  2BA0 A;  2UUA L;  4HID A;  1JB7 A;  3CCQ A;  1SE8 A;  4JI2 L;  4GLA C;  4JI3 Q;  2Y0S G;  2MQH A;  4IPG A;  1JJG A;  1GVP A;  3ZJY C;  1WFQ A;  4P72 A;  2N49 A;  3KF8 B;  2MNA A;  3A0J A;  2NVX H;  3M85 A;  2PI2 A;  2UU9 Q;  1AE3 A;  4BBS H;  1FVI A;  4LNQ A;  4X62 L;  1QVF A;  2IT1 A;  4BBR H;  4GOP A;  3OW2 A;  2JA5 G;  3FKI G;  4PZ7 A;  2PQA B;  1VQA A;  5IP9 G;  3S24 A;  2VL6 A;  2V1C C;  2E8G A;  2R7D A;  3HOX H;  1MJC A;  4IOA A;  2B29 A;  4IFD J;  1HNZ L;  3OYY A;  5IYB H;  4GKJ Q;  1E3P A;  1K8A C;  1TWF H;  4OWX B;  2QEX A;  3S14 H;  1BBU A;  1RIP A;  1X55 A;  4DAY B;  2GVB A;  1WJJ A;  1B8A A;  1VQ6 A;  3NEM A;  2XGT A;  4YWK A;  2UXB Q;  1SRO A;  1G29 1;  1PH9 A;  4OON A;  2MFI A;  1V1Q A;  1J5E Q;  4X6A H;  1UE7 A;  4BY7 H;  4LF8 L;  1PVO A;  1HNX L;  1CKN B;  4GNX C;  4TVA B;  4YY3 L;  3CC7 A;  2VUM G;  3A74 A;  3PUV A;  1MJE A;  4QQB X;  1XNQ Q;  3AYH B;  4YCV A;  2VQE L;  1VQK A;  5LMN Q;  4POG A;  2EQS A;  3T1H L;  4DUY Q;  4O0A A;  4JI1 L;  4JI8 L;  3RLN A;  1C7Y A;  2CQO A;  4DV1 Q;  2OTJ A;  1KAW A;  1X6O A;  1HR0 L;  1B70 B;  4JI4 Q;  3F1Z A;  2DUD A;  1YHQ A;  1HZA A;  4A3D H;  2L15 A;  4DR4 Q;  3S15 H;  4DV3 L;  3FKI H;  3CD6 A;  1IYJ B;  4OXP A;  3PSI A;  5IP9 H;  1N33 L;  1Z47 A;  2NN6 G;  1EUJ A;  1PV4 A;  4B3R L;  4BA2 I;  3A5Z B;  4YHH L;  4GOP C;  4LW1 A;  2UUA Q;  4QY7 A;  2YTY A;  3RZD H;  4JI2 Q;  4JG2 A;  2VQF L;  4R4I A;  4KLK A;  5ELN A;  4JYA L;  5DLQ E;  2VS1 A;  2UUB L;  2KHJ A;  4OO1 I;  5AJ3 L;  1VQ7 A;  5HGQ A;  4JBW A;  2E5L L;  1EIY B;  1E1T A;  5IWA L;  4UP9 A;  4BXX G;  2EXD A;  1SR3 A;  1C0A A;  2FXQ A;  2CWA A;  1UE1 A;  1GM5 A;  1HZC A;  2GN5 A;  3KLW A;  4X62 Q;  3S2H H;  1UEB A;  1PH1 A;  3D0F A;  1D8L A;  2BH8 A;  3RLO A;  4QIW E;  1XMQ L;  1KHI A;  1UWV A;  3G48 A;  1WCM G;  4LWC A;  4AQY L;  1E22 A;  3CF5 A;  4A3I G;  4A3B H;  3K81 C;  1NY4 A;  2VY3 A;  4UP8 A;  2LXJ A;  3GDE A;  2ZJP A;  2JQO A;  4A3E G;  3F2B A;  3T1Y L;  1VQL A;  2R7Z G;  2ZTC A;  3HOV G;  3E9I A;  3HKS A;  3S16 H;  3PUX A;  1VQC A;  1MKH A;  5FLM G;  4OWT B;  4XIG S;  1QUQ A;  2RF4 A;  3OTO L;  5C4J H;  1JMC A;  4UY8 C;  5JJK A;  5IE8 A;  1J6Q A;  4LF7 L;  3M4O H;  1YHB A;  5M3M H;  4LF8 Q;  4GLX A;  1HNX Q;  4LFB L;  2F4V L;  3A5U A;  1VQG A;  4JI7 L;  4YY3 Q;  4GOP B;  2JA8 G;  3AFP A;  1XNR L;  4GN5 A;  1PA6 A;  2ZJQ A;  1N8R C;  2ATW A;  2AKW B;  1YEZ A;  1NTG A;  3UDF A;  2VQE Q;  4J15 A;  2OWO A;  2LXK A;  4JC0 A;  1KL9 A;  4JI6 L;  3T1H Q;  4R4C A;  4JI1 Q;  4JI8 Q;  1VQD A;  3ULL A;  1PHJ A;  4B3T L;  2AMC B;  3J7Z C;  1OXV A;  2NVT H;  4IPH A;  4Y7N H;  4R4T A;  3GTG H;  3HOW G;  5LMU L;  4BXX H;  3Q8D A;  4DAM A;  1YJN A;  1HR0 Q;  4XTC S;  2K75 A;  3U4V A;  4PZ8 A;  3BJU A;  4DR1 L;  4BY1 G;  4DV3 Q;  4PG3 A;  4A3I H;  1WCM H;  4PZ6 A;  3RN2 A;  3GTM H;  4R4Q A;  5JEA G;  1I6H H;  3CP0 A;  3F8T A;  4A4I A;  2ALY B;  4B3R Q;  4OX9 L;  1YVC A;  1YIJ A;  3PO2 H;  4YHH Q;  4GNX A;  4A3E H;  2YTV A;  1CUK A;  4C2M H;  3JAM c;  3GD7 A;  2R7Z H;  1L1O C;  3MEF A;  2VQF Q;  4JBK A;  3HOV H;  4IFD I;  4A93 H;  4DR7 L;  1K3R A;  4JYA Q;  2UUB Q;  2HIV A;  5AJ3 Q;  2N78 A;  5BR8 L;  2E5L Q;  2B63 G;  1P16 A;  5IWA Q;  2BA1 A;  2ES2 A;  1KRS A;  1N32 Q;  2K14 A;  1MIU A;  3RZO H;  4NXN L;  3CCU A;  1OXX K;  5GAH C;  2HIX A;  1VQJ A;  3CMA A;  3KFU A;  5C0X J;  1XMQ Q;  4POF A;  1HZB A;  2OCE A;  4L5T A;  3GTJ H;  1U5K A;  4HIM A;  1PFS A;  4AQY Q;  1ASZ A;  2WB1 E;  3BZK A;  4KHZ A;  4APV A;  4DR5 L;  3HKZ E;  3T1Y Q;  4PMW A;  2CCZ A;  3HOY G;  2I5L X;  1NE3 A;  3I56 A;  1C9O A;  2E2I H;  3CC2 A;  3KYH C;  3ULP A;  2EIF A;  1WYD A;  2I5M X;  3OTO Q;  3J80 c;  4NXM L;  2JA6 H;  2JA7 G;  1HJP A;  2F3I A;  1QVG A;  4LF7 Q;  4BY1 H;  3PF4 A;  4LFB Q;  3M3Y H;  4GN3 B;  1KQS A;  2F4V Q;  2NZO A;  1CSP A;  4JI7 Q;  3J81 c;  1FJG L;  1PH7 A;  1EYG A;  4HJ7 A;  3LGJ A;  3S17 H;  5IYC G;  1XNR Q;  3M7N A;  4DK6 C;  4LUV A;  5GAE C;  2IHF A;  2JEB I;  4R1J A;  3D31 A;  3CC4 A;  1LYL A;  4JI6 Q;  3JAM i;  3G71 A;  1EOV A;  3CPF A;  4JOI C;  2K5V A;  1VQH A;  4DKA C;  1Q81 C;  4B3T Q;  2CKZ B;  2Q2T A;  1SLJ A;  1P8L A;  3DLL A;  4LF4 L;  1E7Z A;  2B63 H;  3ER0 A;  5LMU Q;  3EN2 A;  4MNO A;  2A1A A;  3GTK H;  2R93 G;  2B3G A;  5JEA J;  2IY5 B;  1QUQ B;  3E9H A;  4P75 A;  2WAQ E;  2MO0 A;  1YZ6 A;  1YI2 A;  2N8N A;  3I55 A;  1IBM L;  4DR1 Q;  1N32 L;  3S2D H;  4IOC A;  3K8A A;  3PO3 G;  3KJP A;  4B3M Q;  4OX9 Q;  3G4S A;  1G51 A;  4DV0 L;  1LUZ A;  1VCI A;  4LUZ A;  1GO3 E;  2A8V A;  3HOY H;  4JV5 L;  1L2F A;  1Q1B A;  3RLF A;  2JA5 H;  1HR0 W;  4DR7 Q;  2E2H H;  1JT8 A;  1N36 L;  1PH2 A;  5BR8 Q;  2JA7 H;  2OQ0 A;  3J80 i;  4DV7 L;  2YV5 A;  1KC8 C;  1PH3 A;  3F2C A;  1BKB A;  2KEN A;  1Q82 C;  4NXN Q;  2LSS A;  3J81 i;  3G6E A;  5IYC H;  3PIO A;  1FL0 A;  2BH2 A;  4RG1 A;  2I5H A;  4MZ9 A;  1VQM A;  3U58 A;  1SRU A;  4TQU S;  3CCM A;  1EWI A;  1EQQ A;  4GNX B;  1U0L A;  1X3E A;  3PUZ A;  5C44 G;  4DR5 Q;  3W1G A;  2HT1 A;  4A3L G;  2RCN A;  1KD1 C;  1AE2 A;  1TXY A;  2VUM H;  2QGQ A;  1W2B A;  1H95 A;  5H1S E;  2R93 H;  2WP8 J;  5IT9 c;  2PNH A;  1L1O A;  4NXM Q;  2I0Q A;  1X56 A;  3ERS X;  3KDF B;  3AQQ A;  4QGU A;  1QVC A;  4AYB E;  1HNZ Q;  2K50 A;  5C0X G;  1A62 A;  3FHW A;  3KJO A;  1K8G A;  3PCO B;  2NN6 I;  2Q2I A;  2RHQ B;  1FJG Q;  3H3V I;  4RMF A;  3PO3 H;  3UE1 A;  5IYD G;  3RR5 A;  3CCR A;  4HJA A;  2VNU D;  5ELO A;  2VW9 A;  4UP7 A;  1VQN A;  5JJL A;  3CW2 C;  4QL5 A;  4UPA A;  1XMO L;  1SN8 A;  2ZM6 L;  5GAG C;  3PUW A;  5FLX c;  3EIV A;  4JBJ A;  1IL2 A;  2OQK A;  1VQF A;  4ME3 A;  1YJW A;  4IPC A;  3WWV A;  4JI3 L;  5M5X H;  1IBL L;  4LF4 Q;  2R92 G;  3H3V H;  1X3F A;  2WAQ G;  1Q8K A;  4C3J H;  5M5Y H;  3GTO H;  2Y0S E;  2K5N A;  1VQ8 A;  4LFA L;  4C3I H;  3TRZ A;  1IBM Q;  2ZTD A;  1OXT A;  2RHS B;  4EX5 A;  4X65 L;  1XPO A;  1N34 L;  4B3S L;  1VQP A;  1TWC H;  4AIM A;  1NMG A;  1S3O A;  3CAM A;  2WFW A;  1JJC B;  1B7Y B;  1BBW A;  3IRB A;  3RN5 A;  4L5R C;  5C0X I;  3KF6 A;  3STB C;  2R7F A;  5C44 H;  4DV0 Q;  4A3F G;  4A3L H;  3HFZ B;  1BVS A;  1N9W A;  4JV5 Q;  4K0K L;  4HIO A;  1JE5 A;  2QA4 A;  1KIX A;  2Q2U A;  1V9P A;  1N36 Q;  1M1K C;  1N33 Q;  4L5S A;  3PV0 A;  1DGS A;  4DV7 Q;  3I7F A;  4JOI A;  1HH2 P;  1IZ6 A;  1X65 A;  5LMN W;  1Q86 C;  3HOZ G;  4GLV B;  3M9B A;  2Z6K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...