1N36Q

Structure of the thermus thermophilus 30s ribosomal subunit in the presence of crystallographically disordered codon and near-cognate transfer rna anticodon stem-loop mismatched at the second codon position
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 18
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1n36Q00
4GN3B 4PG3A 4C3IH 4BY7H 3ULLA 2QA4A 2R7ZG 4A3LG 1VQLA 2JE6I 2EQSA 4GNXB 3HOVH 1UE6A 4DKAC 2IX1A 4BA1I 4X62Q 1VQ5A 2HIVA 3HOVG 1HNWQ 5BR8Q 1PYBA 4QIWE 2R7ZH 3H3VI 1XPUA 1FJGQ 4HIDA 4POGA 1H95A 4BXXG 3HOYG 4GN4B 4X64Q 2BH8A 3IRBA 1JMCA 2PI2A 3U50C 3KJOA 4GOPA 4GLVB 1GO3E 1GM5A 3ICEA 1YJ9A 4J15A 2VUMH 5ELNA 4A3IH 2Q2IA 2PMZE 3I7FA 3LGJA 1GKHA 1PH1A 2AKWB 4JI1L 4JI3Q 2ZJQA 3E9IA 4DV3Q 4OX9Q 4A93H 2MO1A 1X3GA 3L7ZC 3UE1A 5M5XH 4IOCA 4AQYL 4JI8L 3RR5A 5GAHC 2ATWA 1X55A 4NXMQ 3CAMA 5JJKA 2YU9H 1N9WA 2H5XA 4GNXC 4L5RC 1VQKA 4IFDJ 2IHEA 3F2CA 2HIXA 2CQOA 3H3VH 1Z9FA 4O2DA 5HGQA 3W1GA 1FVIA 2QGQA 5IYDH 1XPRA 3I2ZA 1YHAA 5LMNW 5JEAJ 4LFCQ 5DLQE 4P74A 4B3SL 4DR5Q 3ZJYC 5IP9H 4BA2I 1W3SA 4JOIC 3F2BA 1X3EA 4DR3L 5IWAL 4LF8Q 4YHHL 2JA6H 3PSIA 2DUDA 1EQRA 4IJLA 4ALPA 3T1YL 1PH6A 4IPHA 4A3JG 1C9OA 5E7NA 1YEZA 1XTDA 3HOXH 2R92H 4B3ML 2VQEQ 2RHQB 4LF6Q 4JBKA 1YBYA 4PZ8A 3I4MG 2ASBA 1E22A 1AE2A 3FKIG 1X3FA 4DUZQ 2OTLA 1A62A 4JI7Q 1KAWA 4P73A 4JI0L 3J80c 3KOJA 3TEHB 1WOCA 4JI5Q 4GKJL 3FHWA 1N36L 1QZHA 2MQHA 4JYAL 2UUCL 3I4MH 3I55A 1X65A 3CCRA 1VQMA 3I4OA 4LFCL 3PV0A 2VQFL 1G291 3CCVA 3UDFA 2Y0SG 2JK8A 1K83H 2F3IA 1HNXQ 2OWOA 4NB3A 2CCZA 4LFBL 4A3KG 5H1SE 3G6EA 1KRSA 1QUQB 2C35B 3CW2C 2I5LX 5FLMH 5C4JH 5IY0A 3S1RH 3KDFA 4B3TQ 2GVAA 1AH9A 1IBKL 4LFAQ 1S40A 3A5UA 1VS0A 2MNAA 1VQGA 4LF6L 5IE8A 4L5TA 3VDYA 4LF4L 1UWVA 2BH2A 1VQ8A 4NXNQ 2V1CC 4RG1A 4JI7L 2D62A 5IWAQ 1TWHH 4H02A 1L0WA 4DAYB 2B63G 1YJNA 3M4OH 1HZCA 2BA1A 2WB1G 1YI2A 2WP8J 3OYYA 2FXQA 4HJ9A 4A3JH 1XMOL 1VQ6A 1C0AA 3OTOQ 4BBRH 2MFIA 3PIPA 3KJPA 3T1HQ 4DK6C 1Q81C 1NJIC 2NN6I 1B70B 1N32L 1WFQA 1LUZA 4NPSA 3JC66 1PV4A 2UUBL 2CWAA 2LXJA 5M5YH 3UDIA 3BZKA 1XNQQ 1VQ4A 2BA0A 2Q2HA 4B3SQ 4QQBX 1HH2P 4A3LH 3HKZG 2IHFA 5GAGC 1Q82C 1NMGA 1K0RA 3CF5A 4YCVA 2JA5G 4DR2Q 3CC4A 1BBWA 1Z47A 3D31A 3RN5A 4UY8C 4ME3A 5JEAG 1VQEA 1YHBA 4A3EG 4BXXH 1CKNB 3FKIH 4JV5L 4DV6L 2OTJA 2R93H 2GVBA 2K50A 2ALYB 2UUCQ 1HNZQ 2JEAI 4AH6A 1WYDA 4DUYQ 1VQPA 1IBLQ 2ZTEA 3ULJA 4B3MQ 4IPDA 1Y1VH 2EXDA 3CQZH 1E7ZA 3M9BA 4DR1Q 5GAEC 3F2DA 2Z0SA 3CCJA 3G71A 1VQ7A 4JI2Q 4OWXB 3UE0A 3EBEA 4IPGA 1K73C 5M5WH 3HOWH 3AFQA 4DR7Q 4LW1A 2K5NA 4A3MH 1K3RA 1PFSA 1BKBA 3BU2A 2NVQH 3A5ZB 3HOZG 5C3EH 1A8VA 2R7FA 3L0OA 1FJGL 2XGTA 2HHHL 3RZOH 1GVPA 2KCMA 4IPCA 1YVCA 4DV5L 4AIMA 3RNUA 1PH8A 1KXLA 3TS0A 3K81C 3GTKH 1PYSB 1OXVA 4PZ7A 4KHZA 4A3CG 1CSQA 1I6HH 1U5KA 1QUQA 4MNOA 2Q2UA 4LF9Q 3S16H 4DR4Q 3S15H 3T1HL 1L2FA 1N32Q 2OCEA 1CKNA 1N8RC 4JI1Q 4JI3L 4JI4Q 5C0XG 4IO9A 2JJQA 2JA7H 3PF5A 2I5MX 1Q1BA 3CCSA 4IFDI 5JJLA 3S1NH 4OX9L 1PHJA 1E1OA 4KLKA 4DV0Q 1IXRA 2ES2A 1UE7A 4LUZA 3A0JA 3CCEA 3GD7A 1WJJA 3CCMA 4DV1Q 4A3EH 1QZGA 1SLJA 5C0XJ 5M3FH 4IOAA 4R4IA 1X9NA 2E8GA 1OXUA 3TQYA 2B3GA 4A3IG 4YWKA 1N34Q 4X6AH 2JQOA 3PIOA 1A63A 2E5LL 1IZ6A 1LM0A 1QVCA 4Y52H 3W5OA 1CSPA 3FP9A 5FLXc 2UXDQ 3CXCA 3RN2A 3GTMH 2ZM6Q 4P75A 1Q12A 3HOYH 4DR1L 5IYBG 2UUAL 1WCMG 3PUZA 1VQDA 4X62L 3HOUH 3S14H 4JBMA 1PH3A 1SN8A 4XTCS 4R4QA 1W2BA 2N3SA 3CPFA 1VQAA 1EYGA 2NZHA 1PH2A 2UU9Q 5M3MH 4JBJA 2Y0SE 4QJFA 4DR2L 2VZAA 2GN5A 4UP7A 3SGIA 4KHPL 4KI0A 5C4XH 5HY6A 1XNRQ 3S17H 4OWWB 3KF6B 4XIGS 2VQEL 3K0XA 4DV5Q 4UPAA 3PUWA 2CKZB 2E5LQ 1R9TH 4JI6L 1XMQL 2N49A 1YZ6A 1AE3A 2R7DA 1MJEA 3PF4A 4BY7G 1NTGA 1SFOH 2KENA 3H0GH 3W1BA 2AWNA 1J5EQ 2XTIA 1EIYB 2NVYH 1JE5A 3CC7A 1X56A 3NELA 4OONA 1FL0A 1N33Q 4OWTB 5JJIA 4R4OA 4DV0L 5AJ3Q 4P72A 3KYHC 4R4TA 4BBSH 2K5HA 1IBML 4B3RQ 4DV4L 2KCTA 3PO2G 5C44G 4DR4L 1EIFA 4DV2Q 4BY1H 4A3FH 4QY7A 1HR0W 1SR3A 2R6GA 3NEMA 2ZTCA 1M90C 4YWMA 3PUXA 1CKOA 3D0FA 4B3TL 3STBC 4L5SA 3PO3H 4AQYQ 2IY5B 4GNXA 5C44H 2UU9L 3M4PA 2RCNA 2ZM6L 4A93G 4HJAA 3BJUA 5LMNQ 3S2DH 4DAMA 1X6OA 1KL9A 4RMFA 1CUKA 3B6YA 4YCUA 5FJ8H 1HZ9A 1ASZA 4GKKQ 4YWLA 3S2HH 1NY4A 4UP8A 1X54A 4C3JH 3J81i 4GLXA 2KBNA 4WJ4A 1A0IA 4K0KQ 3J7ZC 1BBUA 1V1QA 4DV7L 4DR7L 2VNUD 3JAMc 1K8GA 4A3BH 4AYBE 2K75A 2RHSB 4HIMA 1Q46A 4DV1L 1EOVA 1N34L 2K4KA 2PQAA 3J81j 2ZTDA 4OXPA 1NE3A 2B29A 3OTOL 4GOPC 1XMQQ 2IT1A 5LMUL 4DPGA 4DK3C 5BR8L 4A3BG 1VCIA 2N78A 1MIUA 2N8NA 4UP9A 1XNRL 2OQ0A 4HJ5A 4KHPQ 1I3QH 3RLFA 1KC8C 4JOIA 3GTOH 1XPOA 4TQUS 1M1KC 4A3GG 1IYJB 3NENA 2K5VA 1J6QA 1GD7A 3KLWA 2K14A 2VY3A 2AMCB 2YTXA 4IJHA 3K7UC 4C3HH 4DR5L 3MEFA 3CMAA 4LF9L 3JAMi 4JI4L 1VQIA 3F1ZA 1PVOA 4YCWA 1CKMA 2VL6A 3CD6A 2NZOA 4MZ9A 5GROA 1XNQL 4BY1G 4X66Q 5GQOA 1VQFA 1IL2A 4OO1I 3AEVA 1VQJA 1OXSC 1RIPA 4LUOA 2JA6G 2YYZA 1JT8A 2JA7G 1QVGA 3ERSX 2KHJA 1S3OA 4GOPB 2D0OA 4LF7L 1Q1EA 3H15A 2JA8H 3TREA 1KRTA 4JI2L 1OXTA 3GTPH 4JI8Q 5IYCH 2JA8G 4HJ7A 3S1MH 1KQSA 4WJ3M 5FJ8G 1HJPA 2NVXH 5M3FG 4DR6Q 1KIXA 3S1QH 1S72A 1KD1C 3KF6A 3M4QA 4A3DH 1B7YB 2D0PA 3PO3G 4LF4Q 1VQHA 3I56A 3CMEA 1NBWA 3ULPA 4LF5Q 1YNXA 1WCMH 1I94Q 1U0LA 4DV6Q 3HOUG 3WWVA 2F4VL 4DUYL 4JV5Q 2I5HA 1JB7A 2L15A 5C3EG 4FDBA 5IYBH 3DLLA 5K36G 3S24A 1IBLL 3K8AA 1TWGH 1HNZL 1HZAA 2DGYA 2PQAB 2A8VA 1UEBA 3KF8B 1PH4A 4K0KL 5EAYA 2UXBQ 4A76A 3TS2A 1YJWA 2HHHQ 4P71A 4LF7Q 1QVFA 3CPWA 2UXBL 4A4IA 2OQKA 1LYLA 1UE1A 1VQBA 4GS3A 1FGUA 1VQNA 4X66L 2Z6KC 2CFMA 2EIFA 1L1OC 4HJ8A 4X65Q 3F8TA 3RZDH 2UUBQ 2B63H 3PGZA 3UDXA 1P8LA 3CCQA 1I94L 3TRZA 2MO0A 4DUZL 1JJCB 2F4VQ 3U58A 2JA5H 1YIJA 4Y7NH 2F52A 5IYCG 5LMUQ 4R1JA 4QGUA 1C7YA 4X65L 1DGSA 1OTCA 1V9PA 1K8AC 4NXNL 1E3PA 4A3FG 1HNXL 4LFAL 3K7AH 4DV7Q 3U4ZA 4GN5A 1EQQA 3PO2H 1T9HA 1OXXK 3AYHB 3K80C 1VQOA 5LMNL 3EIVA 3G48A 3RLNA 2JEBI 3G4SA 4PMWA 2AHOB 2VQFQ 4JI6Q 3HFZB 4EQ5A 3GTGH 1EUJA 4GKKL 4IFDG 1VQCA 2VUMG 3HOWG 4A3DG 1SMXA 4JYAQ 1L1OB 5FLMG 4JI0Q 3NBHB 4JG2A 4GKJQ 2LSSA 1D7QA 4A3KH 3PUVA 2WAQG 1NMFA 3A74A 3M85A 1P16A 1XMOQ 3OW2A 2NVTH 1I5FA 1E1TA 1SRUA 4LF5L 3CC2A 1V43A 2VS1A 4DV4Q 4JCVE 3J81c 5C4XG 2ID0A 3UDGA 1PA6A 4JI5L 1LTLA 1SROA 3AQQA 4YHHQ 4DV2L 2I0QA 2UUAQ 4LNQA 3KFUA 3M7NA 4A3MG 4DR6L 2K52A 4YY3L 1TWAH 1YHQA 3GTQH 1B8AA 1PH5A 5IP9G 1PH9A 4A3GH 3EN2A 1KHIA 4C2MH 2ZJPA 1N33L 1IBKQ 2LXKA 1J5EL 3HKZE 1VQ9A 3T1YQ 1D8LA 4LUVA 2PI2E 4LFBQ 4DR3Q 1Y14B 1G51A 2IX0A 2Q2TA 5C0XI 3J80i 4YY3Q 3U4VA 1JJGA 2R93G 4BBRG 2Z6KA 3M3YH 2JA9A 1Q86C 1K9MC 2HT1A 1YITA 4NXML 1TWCH 2WFWA 3DM3A 3MXNB 2WB1E 3Q8DA 1WI5A 3HOXG 2E2JH 3PUYA 5J3BA 1E24A 4DNIA 1N36Q 1TWFH 2CWPA 3STBD 1HR0L 2A1AA 1G6PA 2HQLA 1UE5A 2KHIA 3GDEA 1Y1VG 3PCOB 3RLOA 1SE8A 1ASYA 2E2IH 4BBSG 4OO1G 3E0EA 1Q7YC 2NN6G 3I4NG 3GTLH 2RF4A 2YV5A 4QL5A 5AJ3L 2UXDL 2YTYA 1TXYA 4MTNA 4O0AA 1XJVA 1IBMQ 4B3RL 2A19A 3ER0A 5GADC 5IP7H 4HIOA 1Y1WH 3I4NH 2UXCQ 1HZBA 4GLAC 4TVAB 4LF8L 4LWCA 5IP7G 1Y1WG 1EWIA 4EX5A 4POFA 5ELOA 4APVA 4AYBG 5IT9c 4HIKA 4X64L 3L2PA 1EFWA 3E9HA 2VW9A 3KDFB 4L5QA 1MKHA 3J7A5 1HNWL 2QEXA 4A75A 3CCUA 3CCLA 1Q8KA 5IYDG 2UXCL 1MJCA 3GO5A 4JBWA 4JC0A 1JJ2A 2PNHA 4R4CA 3H0GG 5M3MG 1PH7A 1BVSA 1L1OA 4A3CH 1RL2A 3HOZH 3GTJH 4PZ6A 1I50H 2ZJRA 2E2HH 1O7IA 2R92G 3BZCA 2AWOA 3AFPA 1HR0Q 4DV3L 2YTVA 3HKSA 2WAQE 3CP0A
chains in the Genus database with same CATH superfamily
4C3JB 2D5DA 4I7ZC 3ULLA 2R7ZG 2V4DA 1B9MA 1PFNA 4JW0A 4GNXB 4X62Q 3C3LA 4MHEA 4QIWE 4EQNA 1XPUA 1H95A 2C9OA 3ERQA 3KBXA 3U50C 2IL8A 3I7FA 3K5LA 4C3JG 2PMZB 1LV9A 3S17B 2FINB 1PMRA 4JI1L 2O5IC 4OX9Q 3L7ZC 2ATWA 3GV3A 4MTKA 2H5XA 4GNXC 2K04A 2IHEA 3F2CA 1KTKA 2HIXA 3H3VH 1ILQA 4O2DA 1B3AA 5HGQA 2FMMA 4A3DB 4LAAA 5T1GA 1FVIA 1YHAA 3OOCA 5DLQE 4DR5Q 1CHQD 2XIWA 1I3QB 1D5ZC 1DXMA 4IJLA 4PMBA 4A3JG 2MJ8A 3BVGA 1MD2D 5E7NA 5ISRA 4ZYSA 3OIQA 2QW7A 2VQEQ 4LF6Q 1SSOA 1YBYA 4JPBW 2ASBA 4H0LC 4KN7C 2F4IA 4JI5Q 4GKJL 4NW2A 2MQHA 1KNEA 5M3FB 3I4MH 1X65A 2IX3A 1PRTF 4X3UA 4QB4A 1RDPD 2F0PA 3GTKB 1K83H 1KDAA 3C46A 5H1SE 1HQRD 2C35B 3IKJA 3MAQA 4B3TQ 1H9RA 1BUVT 2JXMB 2GVAA 3KDFA 3K0YA 3A5UA 1VS0A 3HOWB 4HR7B 4L5TA 3VDYA 1KLGD 2BH2A 2K32A 4RAUC 1VQ8A 5CC4A 2V1CC 4RG1A 3T13A 3HZXA 2D62A 1X3QA 1FNUA 5IWAQ 2Z9HA 2X69A 3D4RA 3H0GB 4DAYB 1CK1A 1GUWA 5CV5A 1PRTD 5LL6S 3OTOQ 3KJPA 1N32L 5IGEA 4G7HC 2NN6I 3O13A 5C6AA 5FOBB 1PLFA 3BDLA 4B3SQ 4QQBX 4QUFA 3T4AC 3HKZG 4YCVA 1M8AA 1BBWA 3D31A 3C1EA 3VR4A 3RN5A 3NTHA 1VQEA 1YHBA 3FKIH 1TKWB 4ODGA 2K50A 2UUCQ 1RKNA 1A2UA 1ZEQX 4IN3A 1EYDA 4DUYQ 5DEHA 5C3XA 2EYLA 4DR1Q 1CM9A 4QCLA 2C5CA 3G71A 1F9RA 4CDDC 3QB3A 4IPGA 3HOWH 3AFQA 1SNDA 1K3RA 2Q8TA 1PFSA 1BKBA 5E4WC 2NVQH 3A5ZB 3QOLA 5C3EH 3P75A 2JN4A 2R7FA 3L3OC 2L9HA 3GP7A 1GVPA 5JOBA 1YVCA 2B2VA 4R9WA 1KXLA 1BCPF 4XQNA 1I6HB 1VDZA 1BDOA 3GTKH 4KHZA 3A56A 1CSQA 1U5KA 1QUQA 2F0MA 4MNOA 2Q2UA 3RZOB 1M4VA 3ND9A 1N8RC 4JI1Q 2KCCA 3S1NH 1CA6A 3JAME 1E1OA 1IXRA 2ES2A 1UE7A 1HFNA 3D6CA 1WJJA 4A3EH 3C2PA 5E3FA 2XSCA 1X9NA 3TQYA 2B3GA 1RODA 4YWKA 1N34Q 3N6RA 1LM0A 1JOOA 3DM1A 2UXDQ 3CXCA 3RN2A 2G9HD 4H7BA 2UUAL 1VQDA 3OWFA 2B2TA 1PH3A 3AU7A 1K28A 1VQAA 5EPKA 3VYUA 1EYGA 2NZHA 5A2QE 5D65A 4JBJA 4RA8A 1LT6D 4DR2L 2VZAA 3UI2A 3SGIA 3T53B 3S17H 4XIGS 4DV5Q 2MHVA 1TQOA 1SAPA 1AE3A 4HMIA 1SFOH 2KENA 5KYLA 4DNTB 2AWNA 2XTIA 1A3UA 2NVYH 1B4OA 4A93B 3CC7A 1AZPA 5EPJA 4OONA 2FHTA 2RBMA 2DNCA 4XXEA 1N33Q 5JJIA 2VUMB 4DV0L 4JVZA 2F3WA 1IBML 1CQFA 1AW7A 3MEHA 5C44G 2A68C 3U9SA 3KBGA 3NEMA 4YWMA 3PUXA 3GTMB 3J81E 2ZM6L 3M4OB 4A93G 5I9OA 2HQEA 1GOZA 2A68D 3Q6SA 4YCUA 2FFKB 5ELCA 3S2HH 4OL7A 2KBNA 1A0IA 1B1ZA 4K0KQ 5LL6X 4DR7L 2VNUD 3JAMc 1K8GA 1Y8PB 2K75A 4HIMA 1N34L 1Q46A 3J81j 1BOSA 4DXGA 4IALA 2OT2A 2N78A 3WOEA 4UP9A 1XNRL 4KHPQ 1KC8C 3NQIA 1DONA 1XPOA 1M1KC 1X3PA 4JK1C 2VY3A 1B44D 2YTXA 3K7UC 1D1KA 3MEFA 1TR5A 3JAMi 4KJOA 1SNOA 3CD6A 2B63B 1TWCB 5GROA 4X66Q 1IL2A 4OO1I 3DWPA 4LUOA 2R92B 3E3XA 4RHRA 1LABA 1JT8A 1QVGA 1S3OA 2D0OA 5EKIA 1T5XD 3SK6A 3RUZA 3GTPH 4HJ7A 5FJ8G 2NVXH 3TZUA 1GUTA 2D0PA 2X6LA 1VQHA 3HOUG 4DV6Q 1TU2B 5DM63 2I5HA 4JV5Q 1B9NA 3AB9A 5IYBH 2X6GA 1PZJD 4WJWA 5IT9L 1TWGH 1HNZL 1EY9A 5FLXE 4KJNA 1EL0A 2SNMA 3TS2A 4A4IA 2NTTA 1NSNS 1UUPA 4FYDA 2NB0A 1F2YA 1SE3A 2EY5A 3P1HA 3UDXA 3CCQA 5J39A 4K6DA 5ELDA 2QCPX 2L4NA 1Y8OB 3U58A 4KD3A 1OTCA 1K8AC 4NXNL 1HA6A 1O7ZA 1O7YA 4RGTA 3PO2H 2JEBI 2QDBA 2AHOB 2VQFQ 4EQ5A 4IFDG 4GKKL 3OIPA 1U4PA 4OHJA 3CKIB 4A3DG 4XQJA 5C3WA 4GKJQ 4JG2A 4L63B 3K5MA 2AQ1B 3MZ5A 2K5DA 4G7OC 5C4XG 5DM73 3UDGA 1STHA 2B2YA 1SROA 4DV2L 4LNQA 3R8BA 2B2UA 1H9MA 4PMCA 1YHQA 1O7LA 2HDLA 3GTQH 1PH5A 1PH9A 4C2MH 2ZJPA 1BR9A 3HKZE 1D8LA 4LUVA 1JICA 2P5ZX 4DR3Q 2Q2TA 1D2BA 4BBRG 3TP8A 2HT1A 2DY8A 4B9WA 2NVXB 4A3KB 2F0LA 3PUYA 5J3BA 1E24A 1N36Q 1TWFH 1HR0L 2A1AA 3U9OA 3GTPB 1ASYA 3GDEA 1Y1VG 4K5VA 2E2IH 2E2JB 3LWUA 4A3IB 4F8MA 1Q7YC 1L0XB 5AJ3L 1TXYA 2OXPA 1E2WA 3HGBA 4O0AA 3I70A 4HIOA 1WCMB 5IP7H 1Y1WH 4TVAB 3HOUB 4POFA 1OO9B 4APVA 3L2PA 1EFWA 3J7A5 2QKIC 1JR0D 5L37A 1TWAB 1Q8KA 5IYDG 2L1BA 4JBWA 5K36H 1PRTC 5IIFA 1PH7A 5C5LA 4F7XA 3MFGA 5IGBA 3MWYW 5CORA 1O7IA 1JB3A 2AWOA 2JA7B 1SYFA 1HR0Q 3HKSA 1DM0B 1B53A 3CP0A 4PG3A 1EOTA 3S2HB 4L8JA 1STBA 2JE6I 2K6AA 1UE6A 2A69D 1AN8A 2PO4A 5IGDA 3HOVG 5BR8Q 2K33A 2PPBC 2AUJD 3H3VI 2CH4A 2OF1A 3HOYG 2BH8A 1PRTB 3A8JE 5KYIA 1I4XA 3P7JA 3SK5A 3PF4A 2PI2A 1GO3E 1PZKD 1YJ9A 3NE5B 2VUMH 4A3IH 2EY6A 2Z8LA 1F2ZA 1TWFB 2AKWB 2G9DA 1RHPA 4DV3Q 4A93H 5KIXA 1SDFA 5GAHC 5JJKA 1F2MA 2A73B 3QG1A 4L5RC 4IFDJ 1PTOB 1RCVD 5E4XA 2CQOA 1Z9FA 3W3AA 3KLSX 3I73A 5G3LD 5IYDH 1IL8A 3I2ZA 5JEAJ 2F0DA 4B3SL 1D1IA 2AUKA 3TP7A 5IP9H 1W3SA 3S1MB 1X3EA 5IWAL 4DU9A 1S5DD 1FD7D 1ESRA 1C9OA 1TS2A 2RSNA 4FXGC 1MHWC 3SDZA 5CMDA 4GZYC 2XRSD 1E22A 3K5OA 4RFBA 1H9SA 4DUZQ 1A62A 4P73A 3KOJA 1N36L 4JYAL 1VQMA 3I4OA 1LLRD 1EY8A 2VQFL 1G291 3PO2B 4C1NK 2Y0SG 2JK8A 2B2WC 3S1NB 1HNXQ 2OWOA 4NB3A 5DNFA 4A3FB 3G6EA 1KRSA 2VXWA 3CW2C 2I5LX 3URYA 5IY0A 3VA7A 5C4JH 3S1RH 5EGTA 1STNA 2F0JA 1S40A 1VQGA 5IE8A 3FPUB 3HP3A 4LF4L 4JI7L 3QR8A 3I3CA 4CDCC 5HURA 1YJNA 1HZCA 2DJFC 2WB1G 4C3HG 1XMOL 1VQ6A 1HA5A 4O42A 3NTKA 1NJIC 4N9PA 3SE0A 4NPSA 1V1PB 2LXJA 3UDIA 5M5YH 2K03A 4QF4A 3BZKA 2A74C 4RHSA 3S16B 2LS01 1HH2P 4A3LH 4OO1H 1K0RA 5E1FA 4ZCKA 4UY8C 4ME3A 2CHBD 2WB1B 5JEAG 4WFN3 1STGA 4BXXH 4JV5L 2IWHA 2ZT9C 1NR4A 2GVBA 4BBRB 2L0CA 1PTOD 1HNZQ 2JEAI 1EY4A 1I4QA 3EVQA 1GUSA 1IKMA 4UHVA 2PQEA 2MPMA 1F9SA 1VQ7A 5I4DA 3UE0A 1K73C 2EVBA 2K5NA 4NKLA 4HCSA 2EYMA 3HOZG 2L5TA 2EY2A 2XGTA 3D8GA 4DFAA 2KCMA 4ME5A 4AYBB 1E2VA 1PH8A 3VA5A 1OXVA 4PZ7A 5KRUA 2EYJA 4LF9Q 3S16H 3S15H 2OCEA 1K8OA 3F2UA 5IGCA 4JI4Q 5C0XG 3TDQA 4IFDI 3PF5A 2EY1A 1Q1BA 5FK9C 3D4WA 1KABA 4OX9L 1IYUA 1FNWA 3PMFA 5M3FH 3I4MB 4XYOA 5IOCA 4IOAA 2E8GA 1OXUA 1QILA 4X6AH 1WTVA 3DEOA 5I9PA 4ID6A 1A63A 1BCPB 1IZ6A 1QVCA 4Y52H 3W5OA 3FP9A 5FLXc 3GTMH 4V190 2WKDA 1SYEA 4FXDA 1W6KA 1YNNC 3IFTA 2HCIA 3JAML 1W2BA 4A3MB 2UU9Q 5I6YA 3GTLB 2E74C 2Y0SE 1YNND 2XN9C 1HCZA 2NVYB 4OWWB 2VQEL 2K05A 4KK7A 4FF1A 1SFOB 1R9TH 4JI6L 2F0UA 5EPLA 1YZ6A 2F1MA 2R7DA 1MJEA 1BF4A 1EQTA 1JE5A 4DAPA 1S5ED 3MXNA 1EWHA 1FL0A 3DWAA 1KDBA 3CQZB 2RVLA 1JOQA 1EZ6A 4R4OA 3V05A 2EXZA 3DWQA 1H9JA 1RF2D 4BY7B 1PFMA 4A3FH 1CZWA 4K8JA 1EQVA 1CKOA 1U9RA 3L9AX 3FPPA 4L5SA 2B8FA 4AQYQ 2IY5B 4GNXA 4KMUC 2UU9L 2RCNA 1WTQA 1EY0A 3IL8A 1JOKA 2UXCQ 4RMFA 3B6YA 1FNVA 2KEEA 5FJ8H 2K5WA 4UP8A 1X54A 3X3MA 4C3JH 3I72A 3OW7A 3T51B 3J7ZC 1BBUA 1V1QA 3K59A 4A3BH 2AQ3B 4AYBE 1XYIA 2K4KA 4HMJA 4GOPC 2B29A 1WD0A 2IT1A 3K7AB 4DK3C 5BR8L 1HRJA 1VCIA 2KECA 1MIUA 2OQ0A 3RLFA 4IUTA 3GTOH 4IZ8A 4TQUS 4A3GG 3H91A 3BDCA 3CRLC 3QJYA 1GD7A 2N55A 4CGYB 5KGUA 2KHSA 4C3HH 4Z9CB 4LF9L 3G7LA 3F1ZA 4HSPA 1PVOA 1CKMA 1LT3D 1PTOH 4MZ9A 1LT5D 2PZTA 1DOLA 4BY1G 1RIPA 2JSOA 4J8QA 4XQQA 1VF5C 4QMGA 4Q5VA 4GOPB 4LF7L 2H1EA 3TREA 4JI2L 2HDMA 2JA8G 1NCVA 5FLXL 1STEA 4N9TA 1KIXA 5LHY1 1DOMA 3KF6A 3M4QA 4XDXA 2Y0SB 3I56A 1WCMH 1Y1WB 3WWVA 5K5PA 1EY5A 1JB7A 3W2DA 2PQAB 1DD2A 2EOTA 1UEBA 1PH4A 1KAAA 2CW0D 2UXBQ 4K14A 1YJWA 3NP8A 4P71A 2OQKA 4DGZA 1G2TA 1LYLA 1UE1A 2BDOA 3CHBD 4B9XA 1VQNA 2Z6KC 2EIFA 4HJ8A 1PZID 1L0YB 4MN3A 1JJCB 1TS3A 2ZXRA 3OMCA 2M9VA 1UEAB 4XT3B 4E6IA 2F4VQ 1JC7A 2JA5H 3HOVB 2N88A 1J8IA 1C7YA 2EYPA 4X65L 2B2YC 2EYHA 1Q8IA 1QG7A 3K7AH 2EYFA 1EQQA 4GN5A 1T9HA 1OXXK 3QOJA 3M3YH 1VQOA 2RDFA 3RLNA 1JWSD 1PDQA 1MBYA 2VUMG 4R8NA 1SMXA 4HCEA 4C3IB 1XX8A 3E6ZX 1D7QA 4A3KH 1SYCA 2E2HB 3PUVA 5CYUA 1NMFA 3M85A 2KEDA 1P16A 1XMOQ 3OW2A 1SRUA 4DAYA 2PW5A 2PW7A 3S1QB 2KOLA 3T16A 3M7NA 2A6ED 4K2KA 1UNSA 1SYBA 3DMUA 1PYWD 1IBKQ 1VQ9A 3T1YQ 4ZUIA 1ZXTA 5JVH3 1STYA 1Y14B 1G51A 2IX0A 5C0XI 4NP5A 3A54A 4YY3Q 1JJGA 4S3SA 2LY7A 5T1IA 4RH6A 4NXML 1K3BC 3X3NA 3MVVA 5C0XH 2WFWA 4N8X1 3QO2A 3NPPA 3HOXG 4DNIA 4L6TB 4CJ1B 3PCOB 4BBSG 3A7LA 1NR2A 1O78A 1S4ZA 3GTLH 2YTYA 2A19A 5BN4A 3ER0A 5GADC 3I4NH 4DF7A 1A2TA 2EJGC 1Q3LA 1QWYA 3S1QH 5IT9c 1TIID 1EIHA 3E9HA 4L5QA 1MKHA 3CU7A 5D3IB 4X3SA 1EFID 4C56C 3BYTB 3I4LA 1MJCA 5JPMC 3BS1A 2PNHA 1S5FD 2J4XA 3H0GG 1BVSA 1RL2A 2F0QA 1AFPA 1B50A 5ELBA 1FR3A 3BZCA 4RGNA 4PQXA 2WAQE 3EFXD 4GN3B 5EKKA 3C1FA 1KLUD 5CR3A 1VQLA 3HOVH 2JA5B 2PCFB 4DK0A 1HNWQ 3J7AV 3I8ZA 1BO0A 1BNZA 2R7ZH 3PO3B 4R8IA 5JEAH 4BXXG 2D2CC 1JMCA 4GLVB 3ICEA 4IQZA 3N52A 4DNRB 2Q2IA 3LGJA 1GKHA 3VYSA 2ZJQA 3UE1A 1X3GA 4IOCA 5EBCA 3RR5A 1X55A 4NXMQ 2YU9H 1N9WA 1ICFB 4IUPA 1VQKA 1GUGA 4F88A 4B08A 5C4XB 3WDNA 4IUNA 2QGQA 1XPRA 1WTHA 4A3GB 4LFCQ 5LMNW 4KKUA 4TKOB 4P74A 4HSVA 3ZJYC 4BA2I 2DN8A 3SR1A 1BCPD 3F2BA 4DA2A 4DR3L 4YHHL 3PSIA 3T1YL 4ALPA 3S14B 1ET6A 4IPHA 2K1BA 4I7AA 1YEZA 1XTDA 4CJ0B 3HOXH 1VMCA 4B3ML 1WTXA 1YNJC 4PZ8A 1DCZA 3I4MG 4U68A 1AE2A 2OTLA 4JI0L 3J80c 3FHWA 4CKEA 1QE6A 2UUCL 1D5XC 4HTHA 3PV0A 1K0SA 3LWEA 4UAIA 4RCOA 2XWJB 1HHVA 1MI2A 1JQYD 1K8MA 2F0OA 2E76C 3RMHA 4LFAQ 3D3RA 3WOFA 4LF6L 2M00A 1ENAA 1UWVA 3NXWA 4M8AA 1C4QA 1U4LA 4NXNQ 1PFBA 1PXUA 3VYRA 2WAQB 1TWHH 4H02A 2B63G 3EJIA 3MFYA 5J22A 1YI2A 5DAUA 1ML0D 2WP8J 3OYYA 2FXQA 1C0AA 3SK4A 2SNSA 3T1HQ 2MFIA 3HG9A 1WFQA 2F3VA 2K7VA 1LUZA 3JC66 2G5DA 1PV4A 2CWAA 2UUBL 1EWCA 1YNJD 1XNQQ 5EQ0A 1Y1VB 2BA0A 1AEXA 1E0BA 3I90A 2A6HC 2JYOA 5JJZA 1MSHA 2QF7A 4DR2Q 3CC4A 1Z47A 2B2VC 2LFNA 2R93H 4A3EG 3VYTA 1CKNB 5EJWA 4BS9A 4ZLTF 2ALYB 1C48A 2NVQB 1VQPA 1IBLQ 1B2TA 1ILPA 3ULJA 4B3MQ 2IPKD 2NBFA 1E7ZA 3BVZA 3HEJA 5I6WA 3NWTA 5GAEC 3F2DA 2Z0SA 1QNKA 1CI3M 4JI2Q 2SOBA 4OWXB 3EBEA 3MHBA 4EVOA 4A3EB 2XRQD 5M5WH 4LW1A 1BQQT 4CKBA 1EY7A 4RGOS 1TS4A 4A3MH 3BU2A 1VF7A 1A8VA 4N8FA 3L0OA 1RD9D 2HHHL 3RZOH 4IPCA 2EPBA 2F0SA 4AIMA 3TS0A 3K81C 5BN3A 1PYSB 1I6HH 3LNNA 1SNPA 1STAA 1N32Q 1CKNA 4KN4C 2H4OA 3NBHA 1EZ8A 4IO9A 2JA7H 5JJLA 2I5MX 5IGGA 2L11A 1SEBD 2ENBA 4KLKA 4DV0Q 3A0JA 4XYQA 3GD7A 2KVMA 4G4KA 3J7YW 3CCMA 4DV1Q 1WTWA 3HOXB 3J80L 4R4IA 2F0IA 3MXUA 1LTBD 3S15B 2E5LL 1CZGA 2ZM6Q 4P75A 4DR1L 1GJXA 3K5NA 3PUZA 3HOUH 2RKSA 1I4PA 4XTCS 4R4QA 2B2WA 1K83B 1PH2A 4OIKA 4LK1C 5FO8B 1XWEA 4UP7A 1S5BD 4KI0A 1XNRQ 2F0NA 5HY6A 3KF6B 2CKZB 2A6EC 1GUOA 4BY7G 2TMPA 1NTGA 2F0KA 3H0GH 3W1BA 5M5WB 5M5XB 1QOHA 1Y8NB 2Q8IB 3NELA 4RWSC 2R7ZB 2VB2X 3FMCA 1HPCA 4P72A 1EYCA 3BYYB 4DV4L 4LMQD 5M5YB 4DR4L 2EDGA 1EIFA 4BY1H 4QY7A 1HR0W 1I6VC 1SR3A 2R6GA 1M90C 5CV7A 5C44H 2BOSA 4HJAA 5LMNQ 1XTCD 4U673 4DAMA 2XVSA 1HZ9A 4YWLA 3AMUA 4GLXA 2WACA 1SNQA 3J7AF 1D5MC 2F0WA 2EJMA 3KF8A 1EOVA 4DV1L 2PQAA 2ZTDA 2O4XA 1NE3A 1XMQQ 3Q23A 5LMUL 1TWHB 3NHHA 2RQXA 1ENFA 4HJ5A 1I3QH 2CW0C 2JP1A 1ONLA 4JOIA 1IYJB 3NENA 2K5VA 5CV4A 2K14A 4IJHA 4K6LA 4XT1B 4JI4L 5ELEA 1IHZA 5IGFA 1U4MA 1XNQL 3IAYA 1R4PB 3AEVA 1HFGA 1OXSC 1JORA 3TN2A 4QIWB 3ERSX 2A69C 1Q1EA 2JA8H 1OXTA 3S1MH 3PIP3 1HJPA 4DR6Q 5M3FG 5ELFA 3VR5A 1TWGB 3K58A 1S72A 1KD1C 3BG3A 4IUVA 3SHLA 3FEWX 1B7YB 3ULPA 1NBWA 4NMZA 3VR3A 1I94Q 4DUYL 4K2LA 3H3VC 3A55A 4QUCA 2CH4W 5C3EG 2SEBD 1SNCA 1JWMD 2PZWA 3DLLA 2MGSA 4OIJA 1HZAA 2DGYA 3CRKC 4H44C 1SMYC 2KA7A 5EAYA 1KNAA 1IKLA 1CTMA 4BWGB 4A76A 2HHHQ 1H9KA 4CHTB 1WTOA 2NUCA 3V2TA 4A3JB 3EA6A 1WVLA 3KLRA 1VQBA 4GS3A 2YU9B 1FGUA 3M3YB 2CFMA 1EYAA 4X65Q 3F8TA 3SXHA 4RKLA 4K5WA 2UUBQ 2B63H 3PGZA 1P8LA 1IYVA 2I46A 4TRDA 2MO0A 4DUZL 1ZYRD 4PNYA 3R2IA 4IUQA 1TT2A 1HUMA 5IYCG 5LMUQ 1LTAD 4QGUA 5J1ZA 3GQBA 1DGSA 3H09A 3R2TA 1V9PA 1E3PA 1V1PA 5TSSA 4LFAL 1HNXL 5KNBA 4DV7Q 3U4ZA 4V0BA 3EIVA 4PMWA 4JI6Q 2NVTB 2B39A 1VQCA 4JYAQ 1QB5D 2O5JC 5FLMG 5FKAC 4JI0Q 2LSSA 2WAQG 2WKCA 3GTGB 3BDOA 2DJGC 5F2DA 4LF5L 3NWSA 3PIO3 3QWNA 2VS1A 4M1UB 2ID0A 2JA6B 3P20A 1LTLA 3AQQA 2F0TA 2HD3A 4DXFA 3E0JA 1BCPC 4I65A 2I0QA 4A3MG 4DR6L 4YY3L 3VR6A 5IP9G 3EN2A 1N33L 5JAVA 2E2IB 1F2LA 4LFBQ 2Z1CA 1ICWA 3J80i 3U4VA 1ESFA 3RZDB 1LTTD 1A15A 2Z6KA 4ZKCB 1SBBB 2JA9A 2F0GA 3Q8DA 2RDHA 3STBD 1G6PA 4YIJA 2HQLA 2KHIA 3RLOA 1A3TA 4OO1G 3E0EA 4HAEA 2NN6G 2WINB 3A7AB 2SDFA 2YV5A 2HUGA 3Q0AA 4MTNA 1XJVA 4B3RL 2PYKA 3MTSA 4C1NI 1HZBA 4LF8L 1EWIA 4AYBG 4HIKA 1HTPA 4X3KA 4Y7NB 3KDFB 1MSGA 2QEXA 4A75A 3CCUA 2RCFA 2UXCL 3BVMA 1JJ2A 2XWBB 3SEBA 4R4CA 2R61A 4A3CH 4FXKC 3HOZH 5KNDA 5I2YA 3R3OA 4PZ6A 2CQAA 1I4RA 3HOZB 1I50H 2ZJRA 2E2HH 2R92G 3ITPA 4DV3L 4C3IH 4BY7H 4IURA 2QA4A 2PNRC 3E5SA 4A3LG 1D6EC 2EQSA 2EJFC 4DKAC 2IX1A 4BA1I 1VQ5A 2HIVA 5C44B 2NYZD 5BN5A 1PYBA 1LTRD 1FJGQ 4HIDA 4POGA 4GN4B 4X64Q 4BY1B 2RDGA 3ND8A 3IRBA 2LKVA 4GOPA 2L55A 3KJOA 3ONAB 1C8CA 1GM5A 4J15A 1R9TB 5ELNA 4ZKBB 2PMZE 1NUCA 4IFDH 1PTOF 1GHJA 1PH1A 4KKSA 4JI3Q 3KK7A 2MUYA 2E75C 3E9IA 2MO1A 4AQYL 4G57A 5M5XH 3GV6A 1F9QA 2B8GA 3FRPB 4KD4A 4JI8L 3S2DB 3CAMA 2WV6D 3Q22A 1LACA 4OEMB 1ENCA 2RSOA 4ZRZA 3LX0A 4CBVA 3FKIB 3W1GA 5KNCA 2J7ZA 4BBSB 2OEOA 2Z4HA 1BBXC 4JOIC 1RTOA 4LF8Q 2BCOA 1S5CD 2JA6H 2DUDA 1EQRA 3FDTA 1PH6A 1I4GA 5CV6A 2XNAC 3HS0C 1LT4D 4EQOA 5FO7B 2R92H 2RHQB 4K8IA 4JBKA 1F9PA 1UAPA 4IUUA 3MC0B 2A6HD 1Q90A 3FKIG 1X3FA 3M7GA 4JI7Q 1A6XA 1KAWA 3VR2A 3TEHB 1WOCA 4RGMA 1IW7D 2A5HA 1QZHA 2J0TD 3I55A 3CCRA 4LFCL 5M3MB 3DHQA 3CCVA 3UDFA 3MXPA 2F3IA 4TSSA 5JPNC 2CCZA 2B2TC 3S9WA 4LFBL 4A3KG 2ZXOA 1QUQB 5FLMH 4C3HB 4DAVA 1AH9A 1IBKL 2MNAA 4FP5D 4HN7A 3T56B 2MP1A 1AP0A 1EU4A 5A2QL 3NTIA 4P2CB 2EYOA 1KDCA 3SK8A 1L0WA 1FYCA 1Z6HA 3M4OH 2BA1A 2L12A 1I4HA 4HJ9A 4A3JH 4FVMA 1QCBD 4A3BB 1Y69U 4BBRH 3PIPA 1Q81C 4DK6C 1B70B 1H9SB 1SJED 1AZQA 1BXTA 3NBIA 2Q2HA 1VQ4A 2IW3A 2DY7A 1W6JA 2IHFA 5GAGC 1Q82C 1NMGA 3RD4A 3TBIB 3CF5A 4ILWA 2JA5G 1WTRA 3TMEA 2OTJA 1SYDA 4DV6L 2Z4IA 2FJ2A 2R93B 4HEDA 4LJZC 3HOYB 3NUCA 4AH6A 1LO5D 1WYDA 2IJ0A 2ZTEA 1NAPA 2F0FA 4IPDA 1Y1VH 2EXDA 3CQZH 3M9BA 3CCJA 2JA8B 3K57A 5CBEE 1B3QA 3OSOA 3TP5A 4DR7Q 1HQMC 4F87A 4KY6A 1II3A 5C4JB 3S1RB 4FO2A 5D14A 3KLSA 1SXTA 2EE1A 1FJGL 1SMYD 4DV5L 3RNUA 5CV9A 1Z7TA 4OELB 1TVXA 4A3CG 3K6OA 5C4ZA 5COYA 4KY5A 2EZVA 2NWGA 4FF4A 4DR4Q 3T1HL 1L2FA 3QIAA 2KQ3A 4JI3L 2JJQA 3CCSA 2KUMA 4FF2A 1PHJA 4LUZA 3GTJB 3CCEA 3TZDA 1QZGA 1SLJA 5C0XJ 1RJTA 4A3IG 5NUCA 2JQOA 3PIOA 1SNMA 1CSPA 5D3DA 1Q12A 3HOYH 5IYBG 1IW7C 1WD1A 1WCMG 4X62L 4Q0FA 3S14H 5M9OA 4JBMA 5C3EB 1SN8A 2N3SA 3CPFA 2ICIA 1EEID 2AQ2B 3BZDB 2CVRA 1E2ZA 1LTID 5M3MH 4QJFA 2BDNA 5I2XA 1T5EA 4ZAIA 2GN5A 4ZQ3A 4KHPL 5C4XH 3I91A 3K0XA 4UPAA 3PUWA 2E5LQ 4KY7A 1EIGA 1XMQL 1GHKA 1ZYRC 2N49A 4G7ZC 5G3LF 2KJXA 2KCNA 2TSSA 1SE4A 1J5EQ 2LMCB 1EIYB 1CHPD 1EEFD 1X56A 1G6ZA 1V8QA 3OHXC 4OWTB 5AJ3Q 3KYHC 4R4TA 1CFMA 2K5HA 4BBSH 4B3RQ 4C3IG 2KCTA 3PO2G 4DV2Q 1TS5A 2ZTCA 2GA4B 4B3TL 5A35A 3PO3H 3D0FA 3STBC 3KUPA 3IFDA 3M4PA 2F0VA 3BJUA 1GUNA 3S2DH 1X6OA 1KL9A 1CUKA 1SYGA 1ASZA 4GKKQ 1F77A 4KV6A 1NY4A 3J81i 4WJ4A 4DV7L 3R93A 2RHSB 1HUNA 3HRZC 2K5QA 4OXPA 3OTOL 2VB3X 1JE4A 4DPGA 4A3BG 4FF3A 2N8NA 5HGTA 3D6WA 3M4YA 1WTPA 3OWEB 1DOKA 1A3VA 4X3TA 3MA2B 1J6QA 3NQTA 3KLWA 2AMCB 4DR5L 4J6HA 3CMAA 3TP6A 1VQIA 3FVQA 5CV8A 4H13C 5C4HA 3I4NB 3DEPA 2VL6A 4YCWA 2NZOA 5JVG3 5GQOA 1VQFA 5CBAE 1I50B 3G6JB 1TY2A 1VQJA 1CT1D 2JA6G 2YYZA 2JA7G 2QILA 4DK1A 2KHJA 1HXYD 2ICEC 4WRDA 3H15A 1PTOC 1KRTA 1R4QB 4JI8Q 5IYCH 2PZUA 1KQSA 4WJ3M 3DXJC 1G91A 1U4RA 1CQVA 4KHVA 3GTQB 4A3DH 3PO3G 4LF4Q 3CMEA 2D9UA 2R3ZA 1YNXA 4LF5Q 4PV1C 4CDFC 1U0LA 2F4VL 2L15A 2Q8RE 4FDBA 4ZUJA 5K36G 3S24A 1IBLL 3K8AA 1JCKB 2A8VA 3KF8B 5IODA 4K0KL 3EQLC 1SJHD 4LF7Q 1QNUA 1QVFA 3CPWA 2UXBL 3J80E 4NDXA 2F03A 4X66L 4MIUA 1L1OC 3RZDH 4KTAA 4EQPA 3TRZA 1I94L 5CGKA 1G2SA 4RCNA 1RTNA 1J9OA 3NSWA 1YIJA 2I07B 4Y7NH 2F52A 2BE5C 1XXGA 3D4DA 4R1JA 4CKCA 2B2UC 3H6MA 1DYQA 2NZ1D 4A3FG 2BE5D 3AYHB 4J1MA 3K80C 5LMNL 3G48A 1CA5A 3G4SA 3HFZB 3GTGH 1EUJA 3PQIA 3HOWG 4ZK9B 5EBDA 2M2LA 2NN6H 1TY0A 1L1OB 3OMGA 3H94A 3NBHB 2Z6BA 4CDEC 4KKTA 1SE2A 3A74A 5KEEA 2NVTH 2K01A 1I5FA 1E1TA 1DJRD 2RA4A 4WORA 4O1NA 3CC2A 4EGVA 1V43A 1ET9A 4JCVE 3J81c 4DV4Q 1PA6A 4JI5L 3KFUA 4YHHQ 2UUAQ 1V1OA 4FNFA 2K52A 1VMPA 1TWAH 3DUZA 1B8AA 4A3GH 1KHIA 2NTSA 2LXKA 3HKZB 1J5EL 1LTSD 3ZYYX 2DNEA 2F0HA 2PI2E 5FO9B 3V96A 1QJOA 2R93G 1EY6A 1HTLD 1FGBD 1Q86C 3OPOA 1K9MC 1DZ1A 1YITA 3Q24A 1TWCH 3SVMA 3DM3A 1X32A 2WB1E 3MXNB 1WI5A 2FMCA 2E2JH 1MGSA 3TSSA 2CWPA 1G8ZD 1UE5A 1ZKOA 1SE8A 3I4NG 1JWUD 2RF4A 2WIIB 4QL5A 2UXDL 3MXGA 2QEJC 4ABNA 2HCCA 1GXDC 3A8KE 1IBMQ 4UDUC 5EKLA 3EROA 2QDLA 4GLAC 4LWCA 5IP7G 2ZXPA 1Y1WG 4EX5A 5ELOA 1O80A 4X64L 4C2MB 2O2LD 2VW9A 1HNWL 4K5XA 3NK9A 2F0EA 3CCLA 1EU3A 1NNXA 3GTOB 5IT9E 3GO5A 4JC0A 3J81L 5C5MA 4OGQC 5M3MG 1L1OA 4DN4M 3A8IE 3GTJH 5AFWA 4CJ2C 1LTGD 2K28A 4RKBA 4ULLA 2E2DC 3AFPA 2YTVA
chains in the Genus database with same CATH topology
4GN3B 4PG3A 4C3IH 4BY7H 3ULLA 2QA4A 2R7ZG 4A3LG 1VQLA 2JE6I 2EQSA 4GNXB 3HOVH 1UE6A 4DKAC 2IX1A 4BA1I 4X62Q 1VQ5A 2HIVA 3HOVG 1HNWQ 5BR8Q 1PYBA 4QIWE 2R7ZH 3H3VI 1XPUA 1FJGQ 4HIDA 4POGA 1H95A 4BXXG 3HOYG 4GN4B 4X64Q 2BH8A 3IRBA 1JMCA 2PI2A 3U50C 3KJOA 4GOPA 4GLVB 1GO3E 1GM5A 3ICEA 1YJ9A 4J15A 2VUMH 5ELNA 4A3IH 2Q2IA 2PMZE 3I7FA 3LGJA 1GKHA 1PH1A 2AKWB 4JI1L 4JI3Q 2ZJQA 3E9IA 4DV3Q 4OX9Q 4A93H 2MO1A 1X3GA 3L7ZC 3UE1A 5M5XH 4IOCA 4AQYL 4JI8L 3RR5A 5GAHC 2ATWA 1X55A 4NXMQ 3CAMA 5JJKA 2YU9H 1N9WA 2H5XA 4GNXC 4L5RC 1VQKA 4IFDJ 2IHEA 3F2CA 2HIXA 2CQOA 3H3VH 1Z9FA 4O2DA 5HGQA 3W1GA 1FVIA 2QGQA 5IYDH 1XPRA 3I2ZA 1YHAA 5LMNW 5JEAJ 4LFCQ 5DLQE 4P74A 4B3SL 4DR5Q 3ZJYC 5IP9H 4BA2I 1W3SA 4JOIC 3F2BA 1X3EA 4DR3L 5IWAL 4LF8Q 4YHHL 2JA6H 3PSIA 2DUDA 1EQRA 4IJLA 4ALPA 3T1YL 1PH6A 4IPHA 4A3JG 1C9OA 5E7NA 1YEZA 1XTDA 3HOXH 2R92H 4B3ML 2VQEQ 2RHQB 4LF6Q 4JBKA 1YBYA 4PZ8A 3I4MG 2ASBA 1E22A 1AE2A 3FKIG 1X3FA 4DUZQ 2OTLA 1A62A 4JI7Q 1KAWA 4P73A 4JI0L 3J80c 3KOJA 3TEHB 1WOCA 4JI5Q 4GKJL 3FHWA 1N36L 1QZHA 2MQHA 4JYAL 2UUCL 3I4MH 3I55A 1X65A 3CCRA 1VQMA 3I4OA 4LFCL 3PV0A 2VQFL 1G291 3CCVA 3UDFA 2Y0SG 2JK8A 1K83H 2F3IA 1HNXQ 2OWOA 4NB3A 2CCZA 4LFBL 4A3KG 5H1SE 3G6EA 1KRSA 1QUQB 2C35B 3CW2C 2I5LX 5FLMH 5C4JH 5IY0A 3S1RH 3KDFA 4B3TQ 2GVAA 1AH9A 1IBKL 4LFAQ 1S40A 3A5UA 1VS0A 2MNAA 1VQGA 4LF6L 5IE8A 4L5TA 3VDYA 4LF4L 1UWVA 2BH2A 1VQ8A 4NXNQ 2V1CC 4RG1A 4JI7L 2D62A 5IWAQ 1TWHH 4H02A 1L0WA 4DAYB 2B63G 1YJNA 3M4OH 1HZCA 2BA1A 2WB1G 1YI2A 2WP8J 3OYYA 2FXQA 4HJ9A 4A3JH 1XMOL 1VQ6A 1C0AA 3OTOQ 4BBRH 2MFIA 3PIPA 3KJPA 3T1HQ 4DK6C 1Q81C 1NJIC 2NN6I 1B70B 1N32L 1WFQA 1LUZA 4NPSA 3JC66 1PV4A 2UUBL 2CWAA 2LXJA 5M5YH 3UDIA 3BZKA 1XNQQ 1VQ4A 2BA0A 2Q2HA 4B3SQ 4QQBX 1HH2P 4A3LH 3HKZG 2IHFA 5GAGC 1Q82C 1NMGA 1K0RA 3CF5A 4YCVA 2JA5G 4DR2Q 3CC4A 1BBWA 1Z47A 3D31A 3RN5A 4UY8C 4ME3A 5JEAG 1VQEA 1YHBA 4A3EG 4BXXH 1CKNB 3FKIH 4JV5L 4DV6L 2OTJA 2R93H 2GVBA 2K50A 2ALYB 2UUCQ 1HNZQ 2JEAI 4AH6A 1WYDA 4DUYQ 1VQPA 1IBLQ 2ZTEA 3ULJA 4B3MQ 4IPDA 1Y1VH 2EXDA 3CQZH 1E7ZA 3M9BA 4DR1Q 5GAEC 3F2DA 2Z0SA 3CCJA 3G71A 1VQ7A 4JI2Q 4OWXB 3UE0A 3EBEA 4IPGA 1K73C 5M5WH 3HOWH 3AFQA 4DR7Q 4LW1A 2K5NA 4A3MH 1K3RA 1PFSA 1BKBA 3BU2A 2NVQH 3A5ZB 3HOZG 5C3EH 1A8VA 2R7FA 3L0OA 1FJGL 2XGTA 2HHHL 3RZOH 1GVPA 2KCMA 4IPCA 1YVCA 4DV5L 4AIMA 3RNUA 1PH8A 1KXLA 3TS0A 3K81C 3GTKH 1PYSB 1OXVA 4PZ7A 4KHZA 4A3CG 1CSQA 1I6HH 1U5KA 1QUQA 4MNOA 2Q2UA 4LF9Q 3S16H 4DR4Q 3S15H 3T1HL 1L2FA 1N32Q 2OCEA 1CKNA 1N8RC 4JI1Q 4JI3L 4JI4Q 5C0XG 4IO9A 2JJQA 2JA7H 3PF5A 2I5MX 1Q1BA 3CCSA 4IFDI 5JJLA 3S1NH 4OX9L 1PHJA 1E1OA 4KLKA 4DV0Q 1IXRA 2ES2A 1UE7A 4LUZA 3A0JA 3CCEA 3GD7A 1WJJA 3CCMA 4DV1Q 4A3EH 1QZGA 1SLJA 5C0XJ 5M3FH 4IOAA 4R4IA 1X9NA 2E8GA 1OXUA 3TQYA 2B3GA 4A3IG 4YWKA 1N34Q 4X6AH 2JQOA 3PIOA 1A63A 2E5LL 1IZ6A 1LM0A 1QVCA 4Y52H 3W5OA 1CSPA 3FP9A 5FLXc 2UXDQ 3CXCA 3RN2A 3GTMH 2ZM6Q 4P75A 1Q12A 3HOYH 4DR1L 5IYBG 2UUAL 1WCMG 3PUZA 1VQDA 4X62L 3HOUH 3S14H 4JBMA 1PH3A 1SN8A 4XTCS 4R4QA 1W2BA 2N3SA 3CPFA 1VQAA 1EYGA 2NZHA 1PH2A 2UU9Q 5M3MH 4JBJA 2Y0SE 4QJFA 4DR2L 2VZAA 2GN5A 4UP7A 3SGIA 4KHPL 4KI0A 5C4XH 5HY6A 1XNRQ 3S17H 4OWWB 3KF6B 4XIGS 2VQEL 3K0XA 4DV5Q 4UPAA 3PUWA 2CKZB 2E5LQ 1R9TH 4JI6L 1XMQL 2N49A 1YZ6A 1AE3A 2R7DA 1MJEA 3PF4A 4BY7G 1NTGA 1SFOH 2KENA 3H0GH 3W1BA 2AWNA 1J5EQ 2XTIA 1EIYB 2NVYH 1JE5A 3CC7A 1X56A 3NELA 4OONA 1FL0A 1N33Q 4OWTB 5JJIA 4R4OA 4DV0L 5AJ3Q 4P72A 3KYHC 4R4TA 4BBSH 2K5HA 1IBML 4B3RQ 4DV4L 2KCTA 3PO2G 5C44G 4DR4L 1EIFA 4DV2Q 4BY1H 4A3FH 4QY7A 1HR0W 1SR3A 2R6GA 3NEMA 2ZTCA 1M90C 4YWMA 3PUXA 1CKOA 3D0FA 4B3TL 3STBC 4L5SA 3PO3H 4AQYQ 2IY5B 4GNXA 5C44H 2UU9L 3M4PA 2RCNA 2ZM6L 4A93G 4HJAA 3BJUA 5LMNQ 3S2DH 4DAMA 1X6OA 1KL9A 4RMFA 1CUKA 3B6YA 4YCUA 5FJ8H 1HZ9A 1ASZA 4GKKQ 4YWLA 3S2HH 1NY4A 4UP8A 1X54A 4C3JH 3J81i 4GLXA 2KBNA 4WJ4A 1A0IA 4K0KQ 3J7ZC 1BBUA 1V1QA 4DV7L 4DR7L 2VNUD 3JAMc 1K8GA 4A3BH 4AYBE 2K75A 2RHSB 4HIMA 1Q46A 4DV1L 1EOVA 1N34L 2K4KA 2PQAA 3J81j 2ZTDA 4OXPA 1NE3A 2B29A 3OTOL 4GOPC 1XMQQ 2IT1A 5LMUL 4DPGA 4DK3C 5BR8L 4A3BG 1VCIA 2N78A 1MIUA 2N8NA 4UP9A 1XNRL 2OQ0A 4HJ5A 4KHPQ 1I3QH 3RLFA 1KC8C 4JOIA 3GTOH 1XPOA 4TQUS 1M1KC 4A3GG 1IYJB 3NENA 2K5VA 1J6QA 1GD7A 3KLWA 2K14A 2VY3A 2AMCB 2YTXA 4IJHA 3K7UC 4C3HH 4DR5L 3MEFA 3CMAA 4LF9L 3JAMi 4JI4L 1VQIA 3F1ZA 1PVOA 4YCWA 1CKMA 2VL6A 3CD6A 2NZOA 4MZ9A 5GROA 1XNQL 4BY1G 4X66Q 5GQOA 1VQFA 1IL2A 4OO1I 3AEVA 1VQJA 1OXSC 1RIPA 4LUOA 2JA6G 2YYZA 1JT8A 2JA7G 1QVGA 3ERSX 2KHJA 1S3OA 4GOPB 2D0OA 4LF7L 1Q1EA 3H15A 2JA8H 3TREA 1KRTA 4JI2L 1OXTA 3GTPH 4JI8Q 5IYCH 2JA8G 4HJ7A 3S1MH 1KQSA 4WJ3M 5FJ8G 1HJPA 2NVXH 5M3FG 4DR6Q 1KIXA 3S1QH 1S72A 1KD1C 3KF6A 3M4QA 4A3DH 1B7YB 2D0PA 3PO3G 4LF4Q 1VQHA 3I56A 3CMEA 1NBWA 3ULPA 4LF5Q 1YNXA 1WCMH 1I94Q 1U0LA 4DV6Q 3HOUG 3WWVA 2F4VL 4DUYL 4JV5Q 2I5HA 1JB7A 2L15A 5C3EG 4FDBA 5IYBH 3DLLA 5K36G 3S24A 1IBLL 3K8AA 1TWGH 1HNZL 1HZAA 2DGYA 2PQAB 2A8VA 1UEBA 3KF8B 1PH4A 4K0KL 5EAYA 2UXBQ 4A76A 3TS2A 1YJWA 2HHHQ 4P71A 4LF7Q 1QVFA 3CPWA 2UXBL 4A4IA 2OQKA 1LYLA 1UE1A 1VQBA 4GS3A 1FGUA 1VQNA 4X66L 2Z6KC 2CFMA 2EIFA 1L1OC 4HJ8A 4X65Q 3F8TA 3RZDH 2UUBQ 2B63H 3PGZA 3UDXA 1P8LA 3CCQA 1I94L 3TRZA 2MO0A 4DUZL 1JJCB 2F4VQ 3U58A 2JA5H 1YIJA 4Y7NH 2F52A 5IYCG 5LMUQ 4R1JA 4QGUA 1C7YA 4X65L 1DGSA 1OTCA 1V9PA 1K8AC 4NXNL 1E3PA 4A3FG 1HNXL 4LFAL 3K7AH 4DV7Q 3U4ZA 4GN5A 1EQQA 3PO2H 1T9HA 1OXXK 3AYHB 3K80C 1VQOA 5LMNL 3EIVA 3G48A 3RLNA 2JEBI 3G4SA 4PMWA 2AHOB 2VQFQ 4JI6Q 3HFZB 4EQ5A 3GTGH 1EUJA 4GKKL 4IFDG 1VQCA 2VUMG 3HOWG 4A3DG 1SMXA 4JYAQ 1L1OB 5FLMG 4JI0Q 3NBHB 4JG2A 4GKJQ 2LSSA 1D7QA 4A3KH 3PUVA 2WAQG 1NMFA 3A74A 3M85A 1P16A 1XMOQ 3OW2A 2NVTH 1I5FA 1E1TA 1SRUA 4LF5L 3CC2A 1V43A 2VS1A 4DV4Q 4JCVE 3J81c 5C4XG 2ID0A 3UDGA 1PA6A 4JI5L 1LTLA 1SROA 3AQQA 4YHHQ 4DV2L 2I0QA 2UUAQ 4LNQA 3KFUA 3M7NA 4A3MG 4DR6L 2K52A 4YY3L 1TWAH 1YHQA 3GTQH 1B8AA 1PH5A 5IP9G 1PH9A 4A3GH 3EN2A 1KHIA 4C2MH 2ZJPA 1N33L 1IBKQ 2LXKA 1J5EL 3HKZE 1VQ9A 3T1YQ 1D8LA 4LUVA 2PI2E 4LFBQ 4DR3Q 1Y14B 1G51A 2IX0A 2Q2TA 5C0XI 3J80i 4YY3Q 3U4VA 1JJGA 2R93G 4BBRG 2Z6KA 3M3YH 2JA9A 1Q86C 1K9MC 2HT1A 1YITA 4NXML 1TWCH 2WFWA 3DM3A 3MXNB 2WB1E 3Q8DA 1WI5A 3HOXG 2E2JH 3PUYA 5J3BA 1E24A 4DNIA 1N36Q 1TWFH 2CWPA 3STBD 1HR0L 2A1AA 1G6PA 2HQLA 1UE5A 2KHIA 3GDEA 1Y1VG 3PCOB 3RLOA 1SE8A 1ASYA 2E2IH 4BBSG 4OO1G 3E0EA 1Q7YC 2NN6G 3I4NG 3GTLH 2RF4A 2YV5A 4QL5A 5AJ3L 2UXDL 2YTYA 1TXYA 4MTNA 4O0AA 1XJVA 1IBMQ 4B3RL 2A19A 3ER0A 5GADC 5IP7H 4HIOA 1Y1WH 3I4NH 2UXCQ 1HZBA 4GLAC 4TVAB 4LF8L 4LWCA 5IP7G 1Y1WG 1EWIA 4EX5A 4POFA 5ELOA 4APVA 4AYBG 5IT9c 4HIKA 4X64L 3L2PA 1EFWA 3E9HA 2VW9A 3KDFB 4L5QA 1MKHA 3J7A5 1HNWL 2QEXA 4A75A 3CCUA 3CCLA 1Q8KA 5IYDG 2UXCL 1MJCA 3GO5A 4JBWA 4JC0A 1JJ2A 2PNHA 4R4CA 3H0GG 5M3MG 1PH7A 1BVSA 1L1OA 4A3CH 1RL2A 3HOZH 3GTJH 4PZ6A 1I50H 2ZJRA 2E2HH 1O7IA 2R92G 3BZCA 2AWOA 3AFPA 1HR0Q 4DV3L 2YTVA 3HKSA 2WAQE 3CP0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GN3 B;  4PG3 A;  4C3I H;  4BY7 H;  3ULL A;  2QA4 A;  2R7Z G;  4A3L G;  1VQL A;  2JE6 I;  2EQS A;  4GNX B;  3HOV H;  1UE6 A;  4DKA C;  2IX1 A;  4BA1 I;  4X62 Q;  1VQ5 A;  2HIV A;  3HOV G;  1HNW Q;  5BR8 Q;  1PYB A;  4QIW E;  2R7Z H;  3H3V I;  1XPU A;  1FJG Q;  4HID A;  4POG A;  1H95 A;  4BXX G;  3HOY G;  4GN4 B;  4X64 Q;  2BH8 A;  3IRB A;  1JMC A;  2PI2 A;  3U50 C;  3KJO A;  4GOP A;  4GLV B;  1GO3 E;  1GM5 A;  3ICE A;  1YJ9 A;  4J15 A;  2VUM H;  5ELN A;  4A3I H;  2Q2I A;  2PMZ E;  3I7F A;  3LGJ A;  1GKH A;  1PH1 A;  2AKW B;  4JI1 L;  4JI3 Q;  2ZJQ A;  3E9I A;  4DV3 Q;  4OX9 Q;  4A93 H;  2MO1 A;  1X3G A;  3L7Z C;  3UE1 A;  5M5X H;  4IOC A;  4AQY L;  4JI8 L;  3RR5 A;  5GAH C;  2ATW A;  1X55 A;  4NXM Q;  3CAM A;  5JJK A;  2YU9 H;  1N9W A;  2H5X A;  4GNX C;  4L5R C;  1VQK A;  4IFD J;  2IHE A;  3F2C A;  2HIX A;  2CQO A;  3H3V H;  1Z9F A;  4O2D A;  5HGQ A;  3W1G A;  1FVI A;  2QGQ A;  5IYD H;  1XPR A;  3I2Z A;  1YHA A;  5LMN W;  5JEA J;  4LFC Q;  5DLQ E;  4P74 A;  4B3S L;  4DR5 Q;  3ZJY C;  5IP9 H;  4BA2 I;  1W3S A;  4JOI C;  3F2B A;  1X3E A;  4DR3 L;  5IWA L;  4LF8 Q;  4YHH L;  2JA6 H;  3PSI A;  2DUD A;  1EQR A;  4IJL A;  4ALP A;  3T1Y L;  1PH6 A;  4IPH A;  4A3J G;  1C9O A;  5E7N A;  1YEZ A;  1XTD A;  3HOX H;  2R92 H;  4B3M L;  2VQE Q;  2RHQ B;  4LF6 Q;  4JBK A;  1YBY A;  4PZ8 A;  3I4M G;  2ASB A;  1E22 A;  1AE2 A;  3FKI G;  1X3F A;  4DUZ Q;  2OTL A;  1A62 A;  4JI7 Q;  1KAW A;  4P73 A;  4JI0 L;  3J80 c;  3KOJ A;  3TEH B;  1WOC A;  4JI5 Q;  4GKJ L;  3FHW A;  1N36 L;  1QZH A;  2MQH A;  4JYA L;  2UUC L;  3I4M H;  3I55 A;  1X65 A;  3CCR A;  1VQM A;  3I4O A;  4LFC L;  3PV0 A;  2VQF L;  1G29 1;  3CCV A;  3UDF A;  2Y0S G;  2JK8 A;  1K83 H;  2F3I A;  1HNX Q;  2OWO A;  4NB3 A;  2CCZ A;  4LFB L;  4A3K G;  5H1S E;  3G6E A;  1KRS A;  1QUQ B;  2C35 B;  3CW2 C;  2I5L X;  5FLM H;  5C4J H;  5IY0 A;  3S1R H;  3KDF A;  4B3T Q;  2GVA A;  1AH9 A;  1IBK L;  4LFA Q;  1S40 A;  3A5U A;  1VS0 A;  2MNA A;  1VQG A;  4LF6 L;  5IE8 A;  4L5T A;  3VDY A;  4LF4 L;  1UWV A;  2BH2 A;  1VQ8 A;  4NXN Q;  2V1C C;  4RG1 A;  4JI7 L;  2D62 A;  5IWA Q;  1TWH H;  4H02 A;  1L0W A;  4DAY B;  2B63 G;  1YJN A;  3M4O H;  1HZC A;  2BA1 A;  2WB1 G;  1YI2 A;  2WP8 J;  3OYY A;  2FXQ A;  4HJ9 A;  4A3J H;  1XMO L;  1VQ6 A;  1C0A A;  3OTO Q;  4BBR H;  2MFI A;  3PIP A;  3KJP A;  3T1H Q;  4DK6 C;  1Q81 C;  1NJI C;  2NN6 I;  1B70 B;  1N32 L;  1WFQ A;  1LUZ A;  4NPS A;  3JC6 6;  1PV4 A;  2UUB L;  2CWA A;  2LXJ A;  5M5Y H;  3UDI A;  3BZK A;  1XNQ Q;  1VQ4 A;  2BA0 A;  2Q2H A;  4B3S Q;  4QQB X;  1HH2 P;  4A3L H;  3HKZ G;  2IHF A;  5GAG C;  1Q82 C;  1NMG A;  1K0R A;  3CF5 A;  4YCV A;  2JA5 G;  4DR2 Q;  3CC4 A;  1BBW A;  1Z47 A;  3D31 A;  3RN5 A;  4UY8 C;  4ME3 A;  5JEA G;  1VQE A;  1YHB A;  4A3E G;  4BXX H;  1CKN B;  3FKI H;  4JV5 L;  4DV6 L;  2OTJ A;  2R93 H;  2GVB A;  2K50 A;  2ALY B;  2UUC Q;  1HNZ Q;  2JEA I;  4AH6 A;  1WYD A;  4DUY Q;  1VQP A;  1IBL Q;  2ZTE A;  3ULJ A;  4B3M Q;  4IPD A;  1Y1V H;  2EXD A;  3CQZ H;  1E7Z A;  3M9B A;  4DR1 Q;  5GAE C;  3F2D A;  2Z0S A;  3CCJ A;  3G71 A;  1VQ7 A;  4JI2 Q;  4OWX B;  3UE0 A;  3EBE A;  4IPG A;  1K73 C;  5M5W H;  3HOW H;  3AFQ A;  4DR7 Q;  4LW1 A;  2K5N A;  4A3M H;  1K3R A;  1PFS A;  1BKB A;  3BU2 A;  2NVQ H;  3A5Z B;  3HOZ G;  5C3E H;  1A8V A;  2R7F A;  3L0O A;  1FJG L;  2XGT A;  2HHH L;  3RZO H;  1GVP A;  2KCM A;  4IPC A;  1YVC A;  4DV5 L;  4AIM A;  3RNU A;  1PH8 A;  1KXL A;  3TS0 A;  3K81 C;  3GTK H;  1PYS B;  1OXV A;  4PZ7 A;  4KHZ A;  4A3C G;  1CSQ A;  1I6H H;  1U5K A;  1QUQ A;  4MNO A;  2Q2U A;  4LF9 Q;  3S16 H;  4DR4 Q;  3S15 H;  3T1H L;  1L2F A;  1N32 Q;  2OCE A;  1CKN A;  1N8R C;  4JI1 Q;  4JI3 L;  4JI4 Q;  5C0X G;  4IO9 A;  2JJQ A;  2JA7 H;  3PF5 A;  2I5M X;  1Q1B A;  3CCS A;  4IFD I;  5JJL A;  3S1N H;  4OX9 L;  1PHJ A;  1E1O A;  4KLK A;  4DV0 Q;  1IXR A;  2ES2 A;  1UE7 A;  4LUZ A;  3A0J A;  3CCE A;  3GD7 A;  1WJJ A;  3CCM A;  4DV1 Q;  4A3E H;  1QZG A;  1SLJ A;  5C0X J;  5M3F H;  4IOA A;  4R4I A;  1X9N A;  2E8G A;  1OXU A;  3TQY A;  2B3G A;  4A3I G;  4YWK A;  1N34 Q;  4X6A H;  2JQO A;  3PIO A;  1A63 A;  2E5L L;  1IZ6 A;  1LM0 A;  1QVC A;  4Y52 H;  3W5O A;  1CSP A;  3FP9 A;  5FLX c;  2UXD Q;  3CXC A;  3RN2 A;  3GTM H;  2ZM6 Q;  4P75 A;  1Q12 A;  3HOY H;  4DR1 L;  5IYB G;  2UUA L;  1WCM G;  3PUZ A;  1VQD A;  4X62 L;  3HOU H;  3S14 H;  4JBM A;  1PH3 A;  1SN8 A;  4XTC S;  4R4Q A;  1W2B A;  2N3S A;  3CPF A;  1VQA A;  1EYG A;  2NZH A;  1PH2 A;  2UU9 Q;  5M3M H;  4JBJ A;  2Y0S E;  4QJF A;  4DR2 L;  2VZA A;  2GN5 A;  4UP7 A;  3SGI A;  4KHP L;  4KI0 A;  5C4X H;  5HY6 A;  1XNR Q;  3S17 H;  4OWW B;  3KF6 B;  4XIG S;  2VQE L;  3K0X A;  4DV5 Q;  4UPA A;  3PUW A;  2CKZ B;  2E5L Q;  1R9T H;  4JI6 L;  1XMQ L;  2N49 A;  1YZ6 A;  1AE3 A;  2R7D A;  1MJE A;  3PF4 A;  4BY7 G;  1NTG A;  1SFO H;  2KEN A;  3H0G H;  3W1B A;  2AWN A;  1J5E Q;  2XTI A;  1EIY B;  2NVY H;  1JE5 A;  3CC7 A;  1X56 A;  3NEL A;  4OON A;  1FL0 A;  1N33 Q;  4OWT B;  5JJI A;  4R4O A;  4DV0 L;  5AJ3 Q;  4P72 A;  3KYH C;  4R4T A;  4BBS H;  2K5H A;  1IBM L;  4B3R Q;  4DV4 L;  2KCT A;  3PO2 G;  5C44 G;  4DR4 L;  1EIF A;  4DV2 Q;  4BY1 H;  4A3F H;  4QY7 A;  1HR0 W;  1SR3 A;  2R6G A;  3NEM A;  2ZTC A;  1M90 C;  4YWM A;  3PUX A;  1CKO A;  3D0F A;  4B3T L;  3STB C;  4L5S A;  3PO3 H;  4AQY Q;  2IY5 B;  4GNX A;  5C44 H;  2UU9 L;  3M4P A;  2RCN A;  2ZM6 L;  4A93 G;  4HJA A;  3BJU A;  5LMN Q;  3S2D H;  4DAM A;  1X6O A;  1KL9 A;  4RMF A;  1CUK A;  3B6Y A;  4YCU A;  5FJ8 H;  1HZ9 A;  1ASZ A;  4GKK Q;  4YWL A;  3S2H H;  1NY4 A;  4UP8 A;  1X54 A;  4C3J H;  3J81 i;  4GLX A;  2KBN A;  4WJ4 A;  1A0I A;  4K0K Q;  3J7Z C;  1BBU A;  1V1Q A;  4DV7 L;  4DR7 L;  2VNU D;  3JAM c;  1K8G A;  4A3B H;  4AYB E;  2K75 A;  2RHS B;  4HIM A;  1Q46 A;  4DV1 L;  1EOV A;  1N34 L;  2K4K A;  2PQA A;  3J81 j;  2ZTD A;  4OXP A;  1NE3 A;  2B29 A;  3OTO L;  4GOP C;  1XMQ Q;  2IT1 A;  5LMU L;  4DPG A;  4DK3 C;  5BR8 L;  4A3B G;  1VCI A;  2N78 A;  1MIU A;  2N8N A;  4UP9 A;  1XNR L;  2OQ0 A;  4HJ5 A;  4KHP Q;  1I3Q H;  3RLF A;  1KC8 C;  4JOI A;  3GTO H;  1XPO A;  4TQU S;  1M1K C;  4A3G G;  1IYJ B;  3NEN A;  2K5V A;  1J6Q A;  1GD7 A;  3KLW A;  2K14 A;  2VY3 A;  2AMC B;  2YTX A;  4IJH A;  3K7U C;  4C3H H;  4DR5 L;  3MEF A;  3CMA A;  4LF9 L;  3JAM i;  4JI4 L;  1VQI A;  3F1Z A;  1PVO A;  4YCW A;  1CKM A;  2VL6 A;  3CD6 A;  2NZO A;  4MZ9 A;  5GRO A;  1XNQ L;  4BY1 G;  4X66 Q;  5GQO A;  1VQF A;  1IL2 A;  4OO1 I;  3AEV A;  1VQJ A;  1OXS C;  1RIP A;  4LUO A;  2JA6 G;  2YYZ A;  1JT8 A;  2JA7 G;  1QVG A;  3ERS X;  2KHJ A;  1S3O A;  4GOP B;  2D0O A;  4LF7 L;  1Q1E A;  3H15 A;  2JA8 H;  3TRE A;  1KRT A;  4JI2 L;  1OXT A;  3GTP H;  4JI8 Q;  5IYC H;  2JA8 G;  4HJ7 A;  3S1M H;  1KQS A;  4WJ3 M;  5FJ8 G;  1HJP A;  2NVX H;  5M3F G;  4DR6 Q;  1KIX A;  3S1Q H;  1S72 A;  1KD1 C;  3KF6 A;  3M4Q A;  4A3D H;  1B7Y B;  2D0P A;  3PO3 G;  4LF4 Q;  1VQH A;  3I56 A;  3CME A;  1NBW A;  3ULP A;  4LF5 Q;  1YNX A;  1WCM H;  1I94 Q;  1U0L A;  4DV6 Q;  3HOU G;  3WWV A;  2F4V L;  4DUY L;  4JV5 Q;  2I5H A;  1JB7 A;  2L15 A;  5C3E G;  4FDB A;  5IYB H;  3DLL A;  5K36 G;  3S24 A;  1IBL L;  3K8A A;  1TWG H;  1HNZ L;  1HZA A;  2DGY A;  2PQA B;  2A8V A;  1UEB A;  3KF8 B;  1PH4 A;  4K0K L;  5EAY A;  2UXB Q;  4A76 A;  3TS2 A;  1YJW A;  2HHH Q;  4P71 A;  4LF7 Q;  1QVF A;  3CPW A;  2UXB L;  4A4I A;  2OQK A;  1LYL A;  1UE1 A;  1VQB A;  4GS3 A;  1FGU A;  1VQN A;  4X66 L;  2Z6K C;  2CFM A;  2EIF A;  1L1O C;  4HJ8 A;  4X65 Q;  3F8T A;  3RZD H;  2UUB Q;  2B63 H;  3PGZ A;  3UDX A;  1P8L A;  3CCQ A;  1I94 L;  3TRZ A;  2MO0 A;  4DUZ L;  1JJC B;  2F4V Q;  3U58 A;  2JA5 H;  1YIJ A;  4Y7N H;  2F52 A;  5IYC G;  5LMU Q;  4R1J A;  4QGU A;  1C7Y A;  4X65 L;  1DGS A;  1OTC A;  1V9P A;  1K8A C;  4NXN L;  1E3P A;  4A3F G;  1HNX L;  4LFA L;  3K7A H;  4DV7 Q;  3U4Z A;  4GN5 A;  1EQQ A;  3PO2 H;  1T9H A;  1OXX K;  3AYH B;  3K80 C;  1VQO A;  5LMN L;  3EIV A;  3G48 A;  3RLN A;  2JEB I;  3G4S A;  4PMW A;  2AHO B;  2VQF Q;  4JI6 Q;  3HFZ B;  4EQ5 A;  3GTG H;  1EUJ A;  4GKK L;  4IFD G;  1VQC A;  2VUM G;  3HOW G;  4A3D G;  1SMX A;  4JYA Q;  1L1O B;  5FLM G;  4JI0 Q;  3NBH B;  4JG2 A;  4GKJ Q;  2LSS A;  1D7Q A;  4A3K H;  3PUV A;  2WAQ G;  1NMF A;  3A74 A;  3M85 A;  1P16 A;  1XMO Q;  3OW2 A;  2NVT H;  1I5F A;  1E1T A;  1SRU A;  4LF5 L;  3CC2 A;  1V43 A;  2VS1 A;  4DV4 Q;  4JCV E;  3J81 c;  5C4X G;  2ID0 A;  3UDG A;  1PA6 A;  4JI5 L;  1LTL A;  1SRO A;  3AQQ A;  4YHH Q;  4DV2 L;  2I0Q A;  2UUA Q;  4LNQ A;  3KFU A;  3M7N A;  4A3M G;  4DR6 L;  2K52 A;  4YY3 L;  1TWA H;  1YHQ A;  3GTQ H;  1B8A A;  1PH5 A;  5IP9 G;  1PH9 A;  4A3G H;  3EN2 A;  1KHI A;  4C2M H;  2ZJP A;  1N33 L;  1IBK Q;  2LXK A;  1J5E L;  3HKZ E;  1VQ9 A;  3T1Y Q;  1D8L A;  4LUV A;  2PI2 E;  4LFB Q;  4DR3 Q;  1Y14 B;  1G51 A;  2IX0 A;  2Q2T A;  5C0X I;  3J80 i;  4YY3 Q;  3U4V A;  1JJG A;  2R93 G;  4BBR G;  2Z6K A;  3M3Y H;  2JA9 A;  1Q86 C;  1K9M C;  2HT1 A;  1YIT A;  4NXM L;  1TWC H;  2WFW A;  3DM3 A;  3MXN B;  2WB1 E;  3Q8D A;  1WI5 A;  3HOX G;  2E2J H;  3PUY A;  5J3B A;  1E24 A;  4DNI A;  1N36 Q;  1TWF H;  2CWP A;  3STB D;  1HR0 L;  2A1A A;  1G6P A;  2HQL A;  1UE5 A;  2KHI A;  3GDE A;  1Y1V G;  3PCO B;  3RLO A;  1SE8 A;  1ASY A;  2E2I H;  4BBS G;  4OO1 G;  3E0E A;  1Q7Y C;  2NN6 G;  3I4N G;  3GTL H;  2RF4 A;  2YV5 A;  4QL5 A;  5AJ3 L;  2UXD L;  2YTY A;  1TXY A;  4MTN A;  4O0A A;  1XJV A;  1IBM Q;  4B3R L;  2A19 A;  3ER0 A;  5GAD C;  5IP7 H;  4HIO A;  1Y1W H;  3I4N H;  2UXC Q;  1HZB A;  4GLA C;  4TVA B;  4LF8 L;  4LWC A;  5IP7 G;  1Y1W G;  1EWI A;  4EX5 A;  4POF A;  5ELO A;  4APV A;  4AYB G;  5IT9 c;  4HIK A;  4X64 L;  3L2P A;  1EFW A;  3E9H A;  2VW9 A;  3KDF B;  4L5Q A;  1MKH A;  3J7A 5;  1HNW L;  2QEX A;  4A75 A;  3CCU A;  3CCL A;  1Q8K A;  5IYD G;  2UXC L;  1MJC A;  3GO5 A;  4JBW A;  4JC0 A;  1JJ2 A;  2PNH A;  4R4C A;  3H0G G;  5M3M G;  1PH7 A;  1BVS A;  1L1O A;  4A3C H;  1RL2 A;  3HOZ H;  3GTJ H;  4PZ6 A;  1I50 H;  2ZJR A;  2E2H H;  1O7I A;  2R92 G;  3BZC A;  2AWO A;  3AFP A;  1HR0 Q;  4DV3 L;  2YTV A;  3HKS A;  2WAQ E;  3CP0 A; 
#chains in the Genus database with same CATH topology
 4C3J B;  2D5D A;  4I7Z C;  3ULL A;  2R7Z G;  2V4D A;  1B9M A;  1PFN A;  4JW0 A;  4GNX B;  4X62 Q;  3C3L A;  4MHE A;  4QIW E;  4EQN A;  1XPU A;  1H95 A;  2C9O A;  3ERQ A;  3KBX A;  3U50 C;  2IL8 A;  3I7F A;  3K5L A;  4C3J G;  2PMZ B;  1LV9 A;  3S17 B;  2FIN B;  1PMR A;  4JI1 L;  2O5I C;  4OX9 Q;  3L7Z C;  2ATW A;  3GV3 A;  4MTK A;  2H5X A;  4GNX C;  2K04 A;  2IHE A;  3F2C A;  1KTK A;  2HIX A;  3H3V H;  1ILQ A;  4O2D A;  1B3A A;  5HGQ A;  2FMM A;  4A3D B;  4LAA A;  5T1G A;  1FVI A;  1YHA A;  3OOC A;  5DLQ E;  4DR5 Q;  1CHQ D;  2XIW A;  1I3Q B;  1D5Z C;  1DXM A;  4IJL A;  4PMB A;  4A3J G;  2MJ8 A;  3BVG A;  1MD2 D;  5E7N A;  5ISR A;  4ZYS A;  3OIQ A;  2QW7 A;  2VQE Q;  4LF6 Q;  1SSO A;  1YBY A;  4JPB W;  2ASB A;  4H0L C;  4KN7 C;  2F4I A;  4JI5 Q;  4GKJ L;  4NW2 A;  2MQH A;  1KNE A;  5M3F B;  3I4M H;  1X65 A;  2IX3 A;  1PRT F;  4X3U A;  4QB4 A;  1RDP D;  2F0P A;  3GTK B;  1K83 H;  1KDA A;  3C46 A;  5H1S E;  1HQR D;  2C35 B;  3IKJ A;  3MAQ A;  4B3T Q;  1H9R A;  1BUV T;  2JXM B;  2GVA A;  3KDF A;  3K0Y A;  3A5U A;  1VS0 A;  3HOW B;  4HR7 B;  4L5T A;  3VDY A;  1KLG D;  2BH2 A;  2K32 A;  4RAU C;  1VQ8 A;  5CC4 A;  2V1C C;  4RG1 A;  3T13 A;  3HZX A;  2D62 A;  1X3Q A;  1FNU A;  5IWA Q;  2Z9H A;  2X69 A;  3D4R A;  3H0G B;  4DAY B;  1CK1 A;  1GUW A;  5CV5 A;  1PRT D;  5LL6 S;  3OTO Q;  3KJP A;  1N32 L;  5IGE A;  4G7H C;  2NN6 I;  3O13 A;  5C6A A;  5FOB B;  1PLF A;  3BDL A;  4B3S Q;  4QQB X;  4QUF A;  3T4A C;  3HKZ G;  4YCV A;  1M8A A;  1BBW A;  3D31 A;  3C1E A;  3VR4 A;  3RN5 A;  3NTH A;  1VQE A;  1YHB A;  3FKI H;  1TKW B;  4ODG A;  2K50 A;  2UUC Q;  1RKN A;  1A2U A;  1ZEQ X;  4IN3 A;  1EYD A;  4DUY Q;  5DEH A;  5C3X A;  2EYL A;  4DR1 Q;  1CM9 A;  4QCL A;  2C5C A;  3G71 A;  1F9R A;  4CDD C;  3QB3 A;  4IPG A;  3HOW H;  3AFQ A;  1SND A;  1K3R A;  2Q8T A;  1PFS A;  1BKB A;  5E4W C;  2NVQ H;  3A5Z B;  3QOL A;  5C3E H;  3P75 A;  2JN4 A;  2R7F A;  3L3O C;  2L9H A;  3GP7 A;  1GVP A;  5JOB A;  1YVC A;  2B2V A;  4R9W A;  1KXL A;  1BCP F;  4XQN A;  1I6H B;  1VDZ A;  1BDO A;  3GTK H;  4KHZ A;  3A56 A;  1CSQ A;  1U5K A;  1QUQ A;  2F0M A;  4MNO A;  2Q2U A;  3RZO B;  1M4V A;  3ND9 A;  1N8R C;  4JI1 Q;  2KCC A;  3S1N H;  1CA6 A;  3JAM E;  1E1O A;  1IXR A;  2ES2 A;  1UE7 A;  1HFN A;  3D6C A;  1WJJ A;  4A3E H;  3C2P A;  5E3F A;  2XSC A;  1X9N A;  3TQY A;  2B3G A;  1ROD A;  4YWK A;  1N34 Q;  3N6R A;  1LM0 A;  1JOO A;  3DM1 A;  2UXD Q;  3CXC A;  3RN2 A;  2G9H D;  4H7B A;  2UUA L;  1VQD A;  3OWF A;  2B2T A;  1PH3 A;  3AU7 A;  1K28 A;  1VQA A;  5EPK A;  3VYU A;  1EYG A;  2NZH A;  5A2Q E;  5D65 A;  4JBJ A;  4RA8 A;  1LT6 D;  4DR2 L;  2VZA A;  3UI2 A;  3SGI A;  3T53 B;  3S17 H;  4XIG S;  4DV5 Q;  2MHV A;  1TQO A;  1SAP A;  1AE3 A;  4HMI A;  1SFO H;  2KEN A;  5KYL A;  4DNT B;  2AWN A;  2XTI A;  1A3U A;  2NVY H;  1B4O A;  4A93 B;  3CC7 A;  1AZP A;  5EPJ A;  4OON A;  2FHT A;  2RBM A;  2DNC A;  4XXE A;  1N33 Q;  5JJI A;  2VUM B;  4DV0 L;  4JVZ A;  2F3W A;  1IBM L;  1CQF A;  1AW7 A;  3MEH A;  5C44 G;  2A68 C;  3U9S A;  3KBG A;  3NEM A;  4YWM A;  3PUX A;  3GTM B;  3J81 E;  2ZM6 L;  3M4O B;  4A93 G;  5I9O A;  2HQE A;  1GOZ A;  2A68 D;  3Q6S A;  4YCU A;  2FFK B;  5ELC A;  3S2H H;  4OL7 A;  2KBN A;  1A0I A;  1B1Z A;  4K0K Q;  5LL6 X;  4DR7 L;  2VNU D;  3JAM c;  1K8G A;  1Y8P B;  2K75 A;  4HIM A;  1N34 L;  1Q46 A;  3J81 j;  1BOS A;  4DXG A;  4IAL A;  2OT2 A;  2N78 A;  3WOE A;  4UP9 A;  1XNR L;  4KHP Q;  1KC8 C;  3NQI A;  1DON A;  1XPO A;  1M1K C;  1X3P A;  4JK1 C;  2VY3 A;  1B44 D;  2YTX A;  3K7U C;  1D1K A;  3MEF A;  1TR5 A;  3JAM i;  4KJO A;  1SNO A;  3CD6 A;  2B63 B;  1TWC B;  5GRO A;  4X66 Q;  1IL2 A;  4OO1 I;  3DWP A;  4LUO A;  2R92 B;  3E3X A;  4RHR A;  1LAB A;  1JT8 A;  1QVG A;  1S3O A;  2D0O A;  5EKI A;  1T5X D;  3SK6 A;  3RUZ A;  3GTP H;  4HJ7 A;  5FJ8 G;  2NVX H;  3TZU A;  1GUT A;  2D0P A;  2X6L A;  1VQH A;  3HOU G;  4DV6 Q;  1TU2 B;  5DM6 3;  2I5H A;  4JV5 Q;  1B9N A;  3AB9 A;  5IYB H;  2X6G A;  1PZJ D;  4WJW A;  5IT9 L;  1TWG H;  1HNZ L;  1EY9 A;  5FLX E;  4KJN A;  1EL0 A;  2SNM A;  3TS2 A;  4A4I A;  2NTT A;  1NSN S;  1UUP A;  4FYD A;  2NB0 A;  1F2Y A;  1SE3 A;  2EY5 A;  3P1H A;  3UDX A;  3CCQ A;  5J39 A;  4K6D A;  5ELD A;  2QCP X;  2L4N A;  1Y8O B;  3U58 A;  4KD3 A;  1OTC A;  1K8A C;  4NXN L;  1HA6 A;  1O7Z A;  1O7Y A;  4RGT A;  3PO2 H;  2JEB I;  2QDB A;  2AHO B;  2VQF Q;  4EQ5 A;  4IFD G;  4GKK L;  3OIP A;  1U4P A;  4OHJ A;  3CKI B;  4A3D G;  4XQJ A;  5C3W A;  4GKJ Q;  4JG2 A;  4L63 B;  3K5M A;  2AQ1 B;  3MZ5 A;  2K5D A;  4G7O C;  5C4X G;  5DM7 3;  3UDG A;  1STH A;  2B2Y A;  1SRO A;  4DV2 L;  4LNQ A;  3R8B A;  2B2U A;  1H9M A;  4PMC A;  1YHQ A;  1O7L A;  2HDL A;  3GTQ H;  1PH5 A;  1PH9 A;  4C2M H;  2ZJP A;  1BR9 A;  3HKZ E;  1D8L A;  4LUV A;  1JIC A;  2P5Z X;  4DR3 Q;  2Q2T A;  1D2B A;  4BBR G;  3TP8 A;  2HT1 A;  2DY8 A;  4B9W A;  2NVX B;  4A3K B;  2F0L A;  3PUY A;  5J3B A;  1E24 A;  1N36 Q;  1TWF H;  1HR0 L;  2A1A A;  3U9O A;  3GTP B;  1ASY A;  3GDE A;  1Y1V G;  4K5V A;  2E2I H;  2E2J B;  3LWU A;  4A3I B;  4F8M A;  1Q7Y C;  1L0X B;  5AJ3 L;  1TXY A;  2OXP A;  1E2W A;  3HGB A;  4O0A A;  3I70 A;  4HIO A;  1WCM B;  5IP7 H;  1Y1W H;  4TVA B;  3HOU B;  4POF A;  1OO9 B;  4APV A;  3L2P A;  1EFW A;  3J7A 5;  2QKI C;  1JR0 D;  5L37 A;  1TWA B;  1Q8K A;  5IYD G;  2L1B A;  4JBW A;  5K36 H;  1PRT C;  5IIF A;  1PH7 A;  5C5L A;  4F7X A;  3MFG A;  5IGB A;  3MWY W;  5COR A;  1O7I A;  1JB3 A;  2AWO A;  2JA7 B;  1SYF A;  1HR0 Q;  3HKS A;  1DM0 B;  1B53 A;  3CP0 A;  4PG3 A;  1EOT A;  3S2H B;  4L8J A;  1STB A;  2JE6 I;  2K6A A;  1UE6 A;  2A69 D;  1AN8 A;  2PO4 A;  5IGD A;  3HOV G;  5BR8 Q;  2K33 A;  2PPB C;  2AUJ D;  3H3V I;  2CH4 A;  2OF1 A;  3HOY G;  2BH8 A;  1PRT B;  3A8J E;  5KYI A;  1I4X A;  3P7J A;  3SK5 A;  3PF4 A;  2PI2 A;  1GO3 E;  1PZK D;  1YJ9 A;  3NE5 B;  2VUM H;  4A3I H;  2EY6 A;  2Z8L A;  1F2Z A;  1TWF B;  2AKW B;  2G9D A;  1RHP A;  4DV3 Q;  4A93 H;  5KIX A;  1SDF A;  5GAH C;  5JJK A;  1F2M A;  2A73 B;  3QG1 A;  4L5R C;  4IFD J;  1PTO B;  1RCV D;  5E4X A;  2CQO A;  1Z9F A;  3W3A A;  3KLS X;  3I73 A;  5G3L D;  5IYD H;  1IL8 A;  3I2Z A;  5JEA J;  2F0D A;  4B3S L;  1D1I A;  2AUK A;  3TP7 A;  5IP9 H;  1W3S A;  3S1M B;  1X3E A;  5IWA L;  4DU9 A;  1S5D D;  1FD7 D;  1ESR A;  1C9O A;  1TS2 A;  2RSN A;  4FXG C;  1MHW C;  3SDZ A;  5CMD A;  4GZY C;  2XRS D;  1E22 A;  3K5O A;  4RFB A;  1H9S A;  4DUZ Q;  1A62 A;  4P73 A;  3KOJ A;  1N36 L;  4JYA L;  1VQM A;  3I4O A;  1LLR D;  1EY8 A;  2VQF L;  1G29 1;  3PO2 B;  4C1N K;  2Y0S G;  2JK8 A;  2B2W C;  3S1N B;  1HNX Q;  2OWO A;  4NB3 A;  5DNF A;  4A3F B;  3G6E A;  1KRS A;  2VXW A;  3CW2 C;  2I5L X;  3URY A;  5IY0 A;  3VA7 A;  5C4J H;  3S1R H;  5EGT A;  1STN A;  2F0J A;  1S40 A;  1VQG A;  5IE8 A;  3FPU B;  3HP3 A;  4LF4 L;  4JI7 L;  3QR8 A;  3I3C A;  4CDC C;  5HUR A;  1YJN A;  1HZC A;  2DJF C;  2WB1 G;  4C3H G;  1XMO L;  1VQ6 A;  1HA5 A;  4O42 A;  3NTK A;  1NJI C;  4N9P A;  3SE0 A;  4NPS A;  1V1P B;  2LXJ A;  3UDI A;  5M5Y H;  2K03 A;  4QF4 A;  3BZK A;  2A74 C;  4RHS A;  3S16 B;  2LS0 1;  1HH2 P;  4A3L H;  4OO1 H;  1K0R A;  5E1F A;  4ZCK A;  4UY8 C;  4ME3 A;  2CHB D;  2WB1 B;  5JEA G;  4WFN 3;  1STG A;  4BXX H;  4JV5 L;  2IWH A;  2ZT9 C;  1NR4 A;  2GVB A;  4BBR B;  2L0C A;  1PTO D;  1HNZ Q;  2JEA I;  1EY4 A;  1I4Q A;  3EVQ A;  1GUS A;  1IKM A;  4UHV A;  2PQE A;  2MPM A;  1F9S A;  1VQ7 A;  5I4D A;  3UE0 A;  1K73 C;  2EVB A;  2K5N A;  4NKL A;  4HCS A;  2EYM A;  3HOZ G;  2L5T A;  2EY2 A;  2XGT A;  3D8G A;  4DFA A;  2KCM A;  4ME5 A;  4AYB B;  1E2V A;  1PH8 A;  3VA5 A;  1OXV A;  4PZ7 A;  5KRU A;  2EYJ A;  4LF9 Q;  3S16 H;  3S15 H;  2OCE A;  1K8O A;  3F2U A;  5IGC A;  4JI4 Q;  5C0X G;  3TDQ A;  4IFD I;  3PF5 A;  2EY1 A;  1Q1B A;  5FK9 C;  3D4W A;  1KAB A;  4OX9 L;  1IYU A;  1FNW A;  3PMF A;  5M3F H;  3I4M B;  4XYO A;  5IOC A;  4IOA A;  2E8G A;  1OXU A;  1QIL A;  4X6A H;  1WTV A;  3DEO A;  5I9P A;  4ID6 A;  1A63 A;  1BCP B;  1IZ6 A;  1QVC A;  4Y52 H;  3W5O A;  3FP9 A;  5FLX c;  3GTM H;  4V19 0;  2WKD A;  1SYE A;  4FXD A;  1W6K A;  1YNN C;  3IFT A;  2HCI A;  3JAM L;  1W2B A;  4A3M B;  2UU9 Q;  5I6Y A;  3GTL B;  2E74 C;  2Y0S E;  1YNN D;  2XN9 C;  1HCZ A;  2NVY B;  4OWW B;  2VQE L;  2K05 A;  4KK7 A;  4FF1 A;  1SFO B;  1R9T H;  4JI6 L;  2F0U A;  5EPL A;  1YZ6 A;  2F1M A;  2R7D A;  1MJE A;  1BF4 A;  1EQT A;  1JE5 A;  4DAP A;  1S5E D;  3MXN A;  1EWH A;  1FL0 A;  3DWA A;  1KDB A;  3CQZ B;  2RVL A;  1JOQ A;  1EZ6 A;  4R4O A;  3V05 A;  2EXZ A;  3DWQ A;  1H9J A;  1RF2 D;  4BY7 B;  1PFM A;  4A3F H;  1CZW A;  4K8J A;  1EQV A;  1CKO A;  1U9R A;  3L9A X;  3FPP A;  4L5S A;  2B8F A;  4AQY Q;  2IY5 B;  4GNX A;  4KMU C;  2UU9 L;  2RCN A;  1WTQ A;  1EY0 A;  3IL8 A;  1JOK A;  2UXC Q;  4RMF A;  3B6Y A;  1FNV A;  2KEE A;  5FJ8 H;  2K5W A;  4UP8 A;  1X54 A;  3X3M A;  4C3J H;  3I72 A;  3OW7 A;  3T51 B;  3J7Z C;  1BBU A;  1V1Q A;  3K59 A;  4A3B H;  2AQ3 B;  4AYB E;  1XYI A;  2K4K A;  4HMJ A;  4GOP C;  2B29 A;  1WD0 A;  2IT1 A;  3K7A B;  4DK3 C;  5BR8 L;  1HRJ A;  1VCI A;  2KEC A;  1MIU A;  2OQ0 A;  3RLF A;  4IUT A;  3GTO H;  4IZ8 A;  4TQU S;  4A3G G;  3H91 A;  3BDC A;  3CRL C;  3QJY A;  1GD7 A;  2N55 A;  4CGY B;  5KGU A;  2KHS A;  4C3H H;  4Z9C B;  4LF9 L;  3G7L A;  3F1Z A;  4HSP A;  1PVO A;  1CKM A;  1LT3 D;  1PTO H;  4MZ9 A;  1LT5 D;  2PZT A;  1DOL A;  4BY1 G;  1RIP A;  2JSO A;  4J8Q A;  4XQQ A;  1VF5 C;  4QMG A;  4Q5V A;  4GOP B;  4LF7 L;  2H1E A;  3TRE A;  4JI2 L;  2HDM A;  2JA8 G;  1NCV A;  5FLX L;  1STE A;  4N9T A;  1KIX A;  5LHY 1;  1DOM A;  3KF6 A;  3M4Q A;  4XDX A;  2Y0S B;  3I56 A;  1WCM H;  1Y1W B;  3WWV A;  5K5P A;  1EY5 A;  1JB7 A;  3W2D A;  2PQA B;  1DD2 A;  2EOT A;  1UEB A;  1PH4 A;  1KAA A;  2CW0 D;  2UXB Q;  4K14 A;  1YJW A;  3NP8 A;  4P71 A;  2OQK A;  4DGZ A;  1G2T A;  1LYL A;  1UE1 A;  2BDO A;  3CHB D;  4B9X A;  1VQN A;  2Z6K C;  2EIF A;  4HJ8 A;  1PZI D;  1L0Y B;  4MN3 A;  1JJC B;  1TS3 A;  2ZXR A;  3OMC A;  2M9V A;  1UEA B;  4XT3 B;  4E6I A;  2F4V Q;  1JC7 A;  2JA5 H;  3HOV B;  2N88 A;  1J8I A;  1C7Y A;  2EYP A;  4X65 L;  2B2Y C;  2EYH A;  1Q8I A;  1QG7 A;  3K7A H;  2EYF A;  1EQQ A;  4GN5 A;  1T9H A;  1OXX K;  3QOJ A;  3M3Y H;  1VQO A;  2RDF A;  3RLN A;  1JWS D;  1PDQ A;  1MBY A;  2VUM G;  4R8N A;  1SMX A;  4HCE A;  4C3I B;  1XX8 A;  3E6Z X;  1D7Q A;  4A3K H;  1SYC A;  2E2H B;  3PUV A;  5CYU A;  1NMF A;  3M85 A;  2KED A;  1P16 A;  1XMO Q;  3OW2 A;  1SRU A;  4DAY A;  2PW5 A;  2PW7 A;  3S1Q B;  2KOL A;  3T16 A;  3M7N A;  2A6E D;  4K2K A;  1UNS A;  1SYB A;  3DMU A;  1PYW D;  1IBK Q;  1VQ9 A;  3T1Y Q;  4ZUI A;  1ZXT A;  5JVH 3;  1STY A;  1Y14 B;  1G51 A;  2IX0 A;  5C0X I;  4NP5 A;  3A54 A;  4YY3 Q;  1JJG A;  4S3S A;  2LY7 A;  5T1I A;  4RH6 A;  4NXM L;  1K3B C;  3X3N A;  3MVV A;  5C0X H;  2WFW A;  4N8X 1;  3QO2 A;  3NPP A;  3HOX G;  4DNI A;  4L6T B;  4CJ1 B;  3PCO B;  4BBS G;  3A7L A;  1NR2 A;  1O78 A;  1S4Z A;  3GTL H;  2YTY A;  2A19 A;  5BN4 A;  3ER0 A;  5GAD C;  3I4N H;  4DF7 A;  1A2T A;  2EJG C;  1Q3L A;  1QWY A;  3S1Q H;  5IT9 c;  1TII D;  1EIH A;  3E9H A;  4L5Q A;  1MKH A;  3CU7 A;  5D3I B;  4X3S A;  1EFI D;  4C56 C;  3BYT B;  3I4L A;  1MJC A;  5JPM C;  3BS1 A;  2PNH A;  1S5F D;  2J4X A;  3H0G G;  1BVS A;  1RL2 A;  2F0Q A;  1AFP A;  1B50 A;  5ELB A;  1FR3 A;  3BZC A;  4RGN A;  4PQX A;  2WAQ E;  3EFX D;  4GN3 B;  5EKK A;  3C1F A;  1KLU D;  5CR3 A;  1VQL A;  3HOV H;  2JA5 B;  2PCF B;  4DK0 A;  1HNW Q;  3J7A V;  3I8Z A;  1BO0 A;  1BNZ A;  2R7Z H;  3PO3 B;  4R8I A;  5JEA H;  4BXX G;  2D2C C;  1JMC A;  4GLV B;  3ICE A;  4IQZ A;  3N52 A;  4DNR B;  2Q2I A;  3LGJ A;  1GKH A;  3VYS A;  2ZJQ A;  3UE1 A;  1X3G A;  4IOC A;  5EBC A;  3RR5 A;  1X55 A;  4NXM Q;  2YU9 H;  1N9W A;  1ICF B;  4IUP A;  1VQK A;  1GUG A;  4F88 A;  4B08 A;  5C4X B;  3WDN A;  4IUN A;  2QGQ A;  1XPR A;  1WTH A;  4A3G B;  4LFC Q;  5LMN W;  4KKU A;  4TKO B;  4P74 A;  4HSV A;  3ZJY C;  4BA2 I;  2DN8 A;  3SR1 A;  1BCP D;  3F2B A;  4DA2 A;  4DR3 L;  4YHH L;  3PSI A;  3T1Y L;  4ALP A;  3S14 B;  1ET6 A;  4IPH A;  2K1B A;  4I7A A;  1YEZ A;  1XTD A;  4CJ0 B;  3HOX H;  1VMC A;  4B3M L;  1WTX A;  1YNJ C;  4PZ8 A;  1DCZ A;  3I4M G;  4U68 A;  1AE2 A;  2OTL A;  4JI0 L;  3J80 c;  3FHW A;  4CKE A;  1QE6 A;  2UUC L;  1D5X C;  4HTH A;  3PV0 A;  1K0S A;  3LWE A;  4UAI A;  4RCO A;  2XWJ B;  1HHV A;  1MI2 A;  1JQY D;  1K8M A;  2F0O A;  2E76 C;  3RMH A;  4LFA Q;  3D3R A;  3WOF A;  4LF6 L;  2M00 A;  1ENA A;  1UWV A;  3NXW A;  4M8A A;  1C4Q A;  1U4L A;  4NXN Q;  1PFB A;  1PXU A;  3VYR A;  2WAQ B;  1TWH H;  4H02 A;  2B63 G;  3EJI A;  3MFY A;  5J22 A;  1YI2 A;  5DAU A;  1ML0 D;  2WP8 J;  3OYY A;  2FXQ A;  1C0A A;  3SK4 A;  2SNS A;  3T1H Q;  2MFI A;  3HG9 A;  1WFQ A;  2F3V A;  2K7V A;  1LUZ A;  3JC6 6;  2G5D A;  1PV4 A;  2CWA A;  2UUB L;  1EWC A;  1YNJ D;  1XNQ Q;  5EQ0 A;  1Y1V B;  2BA0 A;  1AEX A;  1E0B A;  3I90 A;  2A6H C;  2JYO A;  5JJZ A;  1MSH A;  2QF7 A;  4DR2 Q;  3CC4 A;  1Z47 A;  2B2V C;  2LFN A;  2R93 H;  4A3E G;  3VYT A;  1CKN B;  5EJW A;  4BS9 A;  4ZLT F;  2ALY B;  1C48 A;  2NVQ B;  1VQP A;  1IBL Q;  1B2T A;  1ILP A;  3ULJ A;  4B3M Q;  2IPK D;  2NBF A;  1E7Z A;  3BVZ A;  3HEJ A;  5I6W A;  3NWT A;  5GAE C;  3F2D A;  2Z0S A;  1QNK A;  1CI3 M;  4JI2 Q;  2SOB A;  4OWX B;  3EBE A;  3MHB A;  4EVO A;  4A3E B;  2XRQ D;  5M5W H;  4LW1 A;  1BQQ T;  4CKB A;  1EY7 A;  4RGO S;  1TS4 A;  4A3M H;  3BU2 A;  1VF7 A;  1A8V A;  4N8F A;  3L0O A;  1RD9 D;  2HHH L;  3RZO H;  4IPC A;  2EPB A;  2F0S A;  4AIM A;  3TS0 A;  3K81 C;  5BN3 A;  1PYS B;  1I6H H;  3LNN A;  1SNP A;  1STA A;  1N32 Q;  1CKN A;  4KN4 C;  2H4O A;  3NBH A;  1EZ8 A;  4IO9 A;  2JA7 H;  5JJL A;  2I5M X;  5IGG A;  2L11 A;  1SEB D;  2ENB A;  4KLK A;  4DV0 Q;  3A0J A;  4XYQ A;  3GD7 A;  2KVM A;  4G4K A;  3J7Y W;  3CCM A;  4DV1 Q;  1WTW A;  3HOX B;  3J80 L;  4R4I A;  2F0I A;  3MXU A;  1LTB D;  3S15 B;  2E5L L;  1CZG A;  2ZM6 Q;  4P75 A;  4DR1 L;  1GJX A;  3K5N A;  3PUZ A;  3HOU H;  2RKS A;  1I4P A;  4XTC S;  4R4Q A;  2B2W A;  1K83 B;  1PH2 A;  4OIK A;  4LK1 C;  5FO8 B;  1XWE A;  4UP7 A;  1S5B D;  4KI0 A;  1XNR Q;  2F0N A;  5HY6 A;  3KF6 B;  2CKZ B;  2A6E C;  1GUO A;  4BY7 G;  2TMP A;  1NTG A;  2F0K A;  3H0G H;  3W1B A;  5M5W B;  5M5X B;  1QOH A;  1Y8N B;  2Q8I B;  3NEL A;  4RWS C;  2R7Z B;  2VB2 X;  3FMC A;  1HPC A;  4P72 A;  1EYC A;  3BYY B;  4DV4 L;  4LMQ D;  5M5Y B;  4DR4 L;  2EDG A;  1EIF A;  4BY1 H;  4QY7 A;  1HR0 W;  1I6V C;  1SR3 A;  2R6G A;  1M90 C;  5CV7 A;  5C44 H;  2BOS A;  4HJA A;  5LMN Q;  1XTC D;  4U67 3;  4DAM A;  2XVS A;  1HZ9 A;  4YWL A;  3AMU A;  4GLX A;  2WAC A;  1SNQ A;  3J7A F;  1D5M C;  2F0W A;  2EJM A;  3KF8 A;  1EOV A;  4DV1 L;  2PQA A;  2ZTD A;  2O4X A;  1NE3 A;  1XMQ Q;  3Q23 A;  5LMU L;  1TWH B;  3NHH A;  2RQX A;  1ENF A;  4HJ5 A;  1I3Q H;  2CW0 C;  2JP1 A;  1ONL A;  4JOI A;  1IYJ B;  3NEN A;  2K5V A;  5CV4 A;  2K14 A;  4IJH A;  4K6L A;  4XT1 B;  4JI4 L;  5ELE A;  1IHZ A;  5IGF A;  1U4M A;  1XNQ L;  3IAY A;  1R4P B;  3AEV A;  1HFG A;  1OXS C;  1JOR A;  3TN2 A;  4QIW B;  3ERS X;  2A69 C;  1Q1E A;  2JA8 H;  1OXT A;  3S1M H;  3PIP 3;  1HJP A;  4DR6 Q;  5M3F G;  5ELF A;  3VR5 A;  1TWG B;  3K58 A;  1S72 A;  1KD1 C;  3BG3 A;  4IUV A;  3SHL A;  3FEW X;  1B7Y B;  3ULP A;  1NBW A;  4NMZ A;  3VR3 A;  1I94 Q;  4DUY L;  4K2L A;  3H3V C;  3A55 A;  4QUC A;  2CH4 W;  5C3E G;  2SEB D;  1SNC A;  1JWM D;  2PZW A;  3DLL A;  2MGS A;  4OIJ A;  1HZA A;  2DGY A;  3CRK C;  4H44 C;  1SMY C;  2KA7 A;  5EAY A;  1KNA A;  1IKL A;  1CTM A;  4BWG B;  4A76 A;  2HHH Q;  1H9K A;  4CHT B;  1WTO A;  2NUC A;  3V2T A;  4A3J B;  3EA6 A;  1WVL A;  3KLR A;  1VQB A;  4GS3 A;  2YU9 B;  1FGU A;  3M3Y B;  2CFM A;  1EYA A;  4X65 Q;  3F8T A;  3SXH A;  4RKL A;  4K5W A;  2UUB Q;  2B63 H;  3PGZ A;  1P8L A;  1IYV A;  2I46 A;  4TRD A;  2MO0 A;  4DUZ L;  1ZYR D;  4PNY A;  3R2I A;  4IUQ A;  1TT2 A;  1HUM A;  5IYC G;  5LMU Q;  1LTA D;  4QGU A;  5J1Z A;  3GQB A;  1DGS A;  3H09 A;  3R2T A;  1V9P A;  1E3P A;  1V1P A;  5TSS A;  4LFA L;  1HNX L;  5KNB A;  4DV7 Q;  3U4Z A;  4V0B A;  3EIV A;  4PMW A;  4JI6 Q;  2NVT B;  2B39 A;  1VQC A;  4JYA Q;  1QB5 D;  2O5J C;  5FLM G;  5FKA C;  4JI0 Q;  2LSS A;  2WAQ G;  2WKC A;  3GTG B;  3BDO A;  2DJG C;  5F2D A;  4LF5 L;  3NWS A;  3PIO 3;  3QWN A;  2VS1 A;  4M1U B;  2ID0 A;  2JA6 B;  3P20 A;  1LTL A;  3AQQ A;  2F0T A;  2HD3 A;  4DXF A;  3E0J A;  1BCP C;  4I65 A;  2I0Q A;  4A3M G;  4DR6 L;  4YY3 L;  3VR6 A;  5IP9 G;  3EN2 A;  1N33 L;  5JAV A;  2E2I B;  1F2L A;  4LFB Q;  2Z1C A;  1ICW A;  3J80 i;  3U4V A;  1ESF A;  3RZD B;  1LTT D;  1A15 A;  2Z6K A;  4ZKC B;  1SBB B;  2JA9 A;  2F0G A;  3Q8D A;  2RDH A;  3STB D;  1G6P A;  4YIJ A;  2HQL A;  2KHI A;  3RLO A;  1A3T A;  4OO1 G;  3E0E A;  4HAE A;  2NN6 G;  2WIN B;  3A7A B;  2SDF A;  2YV5 A;  2HUG A;  3Q0A A;  4MTN A;  1XJV A;  4B3R L;  2PYK A;  3MTS A;  4C1N I;  1HZB A;  4LF8 L;  1EWI A;  4AYB G;  4HIK A;  1HTP A;  4X3K A;  4Y7N B;  3KDF B;  1MSG A;  2QEX A;  4A75 A;  3CCU A;  2RCF A;  2UXC L;  3BVM A;  1JJ2 A;  2XWB B;  3SEB A;  4R4C A;  2R61 A;  4A3C H;  4FXK C;  3HOZ H;  5KND A;  5I2Y A;  3R3O A;  4PZ6 A;  2CQA A;  1I4R A;  3HOZ B;  1I50 H;  2ZJR A;  2E2H H;  2R92 G;  3ITP A;  4DV3 L;  4C3I H;  4BY7 H;  4IUR A;  2QA4 A;  2PNR C;  3E5S A;  4A3L G;  1D6E C;  2EQS A;  2EJF C;  4DKA C;  2IX1 A;  4BA1 I;  1VQ5 A;  2HIV A;  5C44 B;  2NYZ D;  5BN5 A;  1PYB A;  1LTR D;  1FJG Q;  4HID A;  4POG A;  4GN4 B;  4X64 Q;  4BY1 B;  2RDG A;  3ND8 A;  3IRB A;  2LKV A;  4GOP A;  2L55 A;  3KJO A;  3ONA B;  1C8C A;  1GM5 A;  4J15 A;  1R9T B;  5ELN A;  4ZKB B;  2PMZ E;  1NUC A;  4IFD H;  1PTO F;  1GHJ A;  1PH1 A;  4KKS A;  4JI3 Q;  3KK7 A;  2MUY A;  2E75 C;  3E9I A;  2MO1 A;  4AQY L;  4G57 A;  5M5X H;  3GV6 A;  1F9Q A;  2B8G A;  3FRP B;  4KD4 A;  4JI8 L;  3S2D B;  3CAM A;  2WV6 D;  3Q22 A;  1LAC A;  4OEM B;  1ENC A;  2RSO A;  4ZRZ A;  3LX0 A;  4CBV A;  3FKI B;  3W1G A;  5KNC A;  2J7Z A;  4BBS B;  2OEO A;  2Z4H A;  1BBX C;  4JOI C;  1RTO A;  4LF8 Q;  2BCO A;  1S5C D;  2JA6 H;  2DUD A;  1EQR A;  3FDT A;  1PH6 A;  1I4G A;  5CV6 A;  2XNA C;  3HS0 C;  1LT4 D;  4EQO A;  5FO7 B;  2R92 H;  2RHQ B;  4K8I A;  4JBK A;  1F9P A;  1UAP A;  4IUU A;  3MC0 B;  2A6H D;  1Q90 A;  3FKI G;  1X3F A;  3M7G A;  4JI7 Q;  1A6X A;  1KAW A;  3VR2 A;  3TEH B;  1WOC A;  4RGM A;  1IW7 D;  2A5H A;  1QZH A;  2J0T D;  3I55 A;  3CCR A;  4LFC L;  5M3M B;  3DHQ A;  3CCV A;  3UDF A;  3MXP A;  2F3I A;  4TSS A;  5JPN C;  2CCZ A;  2B2T C;  3S9W A;  4LFB L;  4A3K G;  2ZXO A;  1QUQ B;  5FLM H;  4C3H B;  4DAV A;  1AH9 A;  1IBK L;  2MNA A;  4FP5 D;  4HN7 A;  3T56 B;  2MP1 A;  1AP0 A;  1EU4 A;  5A2Q L;  3NTI A;  4P2C B;  2EYO A;  1KDC A;  3SK8 A;  1L0W A;  1FYC A;  1Z6H A;  3M4O H;  2BA1 A;  2L12 A;  1I4H A;  4HJ9 A;  4A3J H;  4FVM A;  1QCB D;  4A3B B;  1Y69 U;  4BBR H;  3PIP A;  1Q81 C;  4DK6 C;  1B70 B;  1H9S B;  1SJE D;  1AZQ A;  1BXT A;  3NBI A;  2Q2H A;  1VQ4 A;  2IW3 A;  2DY7 A;  1W6J A;  2IHF A;  5GAG C;  1Q82 C;  1NMG A;  3RD4 A;  3TBI B;  3CF5 A;  4ILW A;  2JA5 G;  1WTR A;  3TME A;  2OTJ A;  1SYD A;  4DV6 L;  2Z4I A;  2FJ2 A;  2R93 B;  4HED A;  4LJZ C;  3HOY B;  3NUC A;  4AH6 A;  1LO5 D;  1WYD A;  2IJ0 A;  2ZTE A;  1NAP A;  2F0F A;  4IPD A;  1Y1V H;  2EXD A;  3CQZ H;  3M9B A;  3CCJ A;  2JA8 B;  3K57 A;  5CBE E;  1B3Q A;  3OSO A;  3TP5 A;  4DR7 Q;  1HQM C;  4F87 A;  4KY6 A;  1II3 A;  5C4J B;  3S1R B;  4FO2 A;  5D14 A;  3KLS A;  1SXT A;  2EE1 A;  1FJG L;  1SMY D;  4DV5 L;  3RNU A;  5CV9 A;  1Z7T A;  4OEL B;  1TVX A;  4A3C G;  3K6O A;  5C4Z A;  5COY A;  4KY5 A;  2EZV A;  2NWG A;  4FF4 A;  4DR4 Q;  3T1H L;  1L2F A;  3QIA A;  2KQ3 A;  4JI3 L;  2JJQ A;  3CCS A;  2KUM A;  4FF2 A;  1PHJ A;  4LUZ A;  3GTJ B;  3CCE A;  3TZD A;  1QZG A;  1SLJ A;  5C0X J;  1RJT A;  4A3I G;  5NUC A;  2JQO A;  3PIO A;  1SNM A;  1CSP A;  5D3D A;  1Q12 A;  3HOY H;  5IYB G;  1IW7 C;  1WD1 A;  1WCM G;  4X62 L;  4Q0F A;  3S14 H;  5M9O A;  4JBM A;  5C3E B;  1SN8 A;  2N3S A;  3CPF A;  2ICI A;  1EEI D;  2AQ2 B;  3BZD B;  2CVR A;  1E2Z A;  1LTI D;  5M3M H;  4QJF A;  2BDN A;  5I2X A;  1T5E A;  4ZAI A;  2GN5 A;  4ZQ3 A;  4KHP L;  5C4X H;  3I91 A;  3K0X A;  4UPA A;  3PUW A;  2E5L Q;  4KY7 A;  1EIG A;  1XMQ L;  1GHK A;  1ZYR C;  2N49 A;  4G7Z C;  5G3L F;  2KJX A;  2KCN A;  2TSS A;  1SE4 A;  1J5E Q;  2LMC B;  1EIY B;  1CHP D;  1EEF D;  1X56 A;  1G6Z A;  1V8Q A;  3OHX C;  4OWT B;  5AJ3 Q;  3KYH C;  4R4T A;  1CFM A;  2K5H A;  4BBS H;  4B3R Q;  4C3I G;  2KCT A;  3PO2 G;  4DV2 Q;  1TS5 A;  2ZTC A;  2GA4 B;  4B3T L;  5A35 A;  3PO3 H;  3D0F A;  3STB C;  3KUP A;  3IFD A;  3M4P A;  2F0V A;  3BJU A;  1GUN A;  3S2D H;  1X6O A;  1KL9 A;  1CUK A;  1SYG A;  1ASZ A;  4GKK Q;  1F77 A;  4KV6 A;  1NY4 A;  3J81 i;  4WJ4 A;  4DV7 L;  3R93 A;  2RHS B;  1HUN A;  3HRZ C;  2K5Q A;  4OXP A;  3OTO L;  2VB3 X;  1JE4 A;  4DPG A;  4A3B G;  4FF3 A;  2N8N A;  5HGT A;  3D6W A;  3M4Y A;  1WTP A;  3OWE B;  1DOK A;  1A3V A;  4X3T A;  3MA2 B;  1J6Q A;  3NQT A;  3KLW A;  2AMC B;  4DR5 L;  4J6H A;  3CMA A;  3TP6 A;  1VQI A;  3FVQ A;  5CV8 A;  4H13 C;  5C4H A;  3I4N B;  3DEP A;  2VL6 A;  4YCW A;  2NZO A;  5JVG 3;  5GQO A;  1VQF A;  5CBA E;  1I50 B;  3G6J B;  1TY2 A;  1VQJ A;  1CT1 D;  2JA6 G;  2YYZ A;  2JA7 G;  2QIL A;  4DK1 A;  2KHJ A;  1HXY D;  2ICE C;  4WRD A;  3H15 A;  1PTO C;  1KRT A;  1R4Q B;  4JI8 Q;  5IYC H;  2PZU A;  1KQS A;  4WJ3 M;  3DXJ C;  1G91 A;  1U4R A;  1CQV A;  4KHV A;  3GTQ B;  4A3D H;  3PO3 G;  4LF4 Q;  3CME A;  2D9U A;  2R3Z A;  1YNX A;  4LF5 Q;  4PV1 C;  4CDF C;  1U0L A;  2F4V L;  2L15 A;  2Q8R E;  4FDB A;  4ZUJ A;  5K36 G;  3S24 A;  1IBL L;  3K8A A;  1JCK B;  2A8V A;  3KF8 B;  5IOD A;  4K0K L;  3EQL C;  1SJH D;  4LF7 Q;  1QNU A;  1QVF A;  3CPW A;  2UXB L;  3J80 E;  4NDX A;  2F03 A;  4X66 L;  4MIU A;  1L1O C;  3RZD H;  4KTA A;  4EQP A;  3TRZ A;  1I94 L;  5CGK A;  1G2S A;  4RCN A;  1RTN A;  1J9O A;  3NSW A;  1YIJ A;  2I07 B;  4Y7N H;  2F52 A;  2BE5 C;  1XXG A;  3D4D A;  4R1J A;  4CKC A;  2B2U C;  3H6M A;  1DYQ A;  2NZ1 D;  4A3F G;  2BE5 D;  3AYH B;  4J1M A;  3K80 C;  5LMN L;  3G48 A;  1CA5 A;  3G4S A;  3HFZ B;  3GTG H;  1EUJ A;  3PQI A;  3HOW G;  4ZK9 B;  5EBD A;  2M2L A;  2NN6 H;  1TY0 A;  1L1O B;  3OMG A;  3H94 A;  3NBH B;  2Z6B A;  4CDE C;  4KKT A;  1SE2 A;  3A74 A;  5KEE A;  2NVT H;  2K01 A;  1I5F A;  1E1T A;  1DJR D;  2RA4 A;  4WOR A;  4O1N A;  3CC2 A;  4EGV A;  1V43 A;  1ET9 A;  4JCV E;  3J81 c;  4DV4 Q;  1PA6 A;  4JI5 L;  3KFU A;  4YHH Q;  2UUA Q;  1V1O A;  4FNF A;  2K52 A;  1VMP A;  1TWA H;  3DUZ A;  1B8A A;  4A3G H;  1KHI A;  2NTS A;  2LXK A;  3HKZ B;  1J5E L;  1LTS D;  3ZYY X;  2DNE A;  2F0H A;  2PI2 E;  5FO9 B;  3V96 A;  1QJO A;  2R93 G;  1EY6 A;  1HTL D;  1FGB D;  1Q86 C;  3OPO A;  1K9M C;  1DZ1 A;  1YIT A;  3Q24 A;  1TWC H;  3SVM A;  3DM3 A;  1X32 A;  2WB1 E;  3MXN B;  1WI5 A;  2FMC A;  2E2J H;  1MGS A;  3TSS A;  2CWP A;  1G8Z D;  1UE5 A;  1ZKO A;  1SE8 A;  3I4N G;  1JWU D;  2RF4 A;  2WII B;  4QL5 A;  2UXD L;  3MXG A;  2QEJ C;  4ABN A;  2HCC A;  1GXD C;  3A8K E;  1IBM Q;  4UDU C;  5EKL A;  3ERO A;  2QDL A;  4GLA C;  4LWC A;  5IP7 G;  2ZXP A;  1Y1W G;  4EX5 A;  5ELO A;  1O80 A;  4X64 L;  4C2M B;  2O2L D;  2VW9 A;  1HNW L;  4K5X A;  3NK9 A;  2F0E A;  3CCL A;  1EU3 A;  1NNX A;  3GTO B;  5IT9 E;  3GO5 A;  4JC0 A;  3J81 L;  5C5M A;  4OGQ C;  5M3M G;  1L1O A;  4DN4 M;  3A8I E;  3GTJ H;  5AFW A;  4CJ2 C;  1LTG D;  2K28 A;  4RKB A;  4ULL A;  2E2D C;  3AFP A;  2YTV A; 
#chains in the Genus database with same CATH homology
 4GN3 B;  4PG3 A;  4C3I H;  4BY7 H;  3ULL A;  2QA4 A;  2R7Z G;  4A3L G;  1VQL A;  2JE6 I;  2EQS A;  4GNX B;  3HOV H;  1UE6 A;  4DKA C;  2IX1 A;  4BA1 I;  4X62 Q;  1VQ5 A;  2HIV A;  3HOV G;  1HNW Q;  5BR8 Q;  1PYB A;  4QIW E;  2R7Z H;  3H3V I;  1XPU A;  1FJG Q;  4HID A;  4POG A;  1H95 A;  4BXX G;  3HOY G;  4GN4 B;  4X64 Q;  2BH8 A;  3IRB A;  1JMC A;  2PI2 A;  3U50 C;  3KJO A;  4GOP A;  4GLV B;  1GO3 E;  1GM5 A;  3ICE A;  1YJ9 A;  4J15 A;  2VUM H;  5ELN A;  4A3I H;  2Q2I A;  2PMZ E;  3I7F A;  3LGJ A;  1GKH A;  1PH1 A;  2AKW B;  4JI1 L;  4JI3 Q;  2ZJQ A;  3E9I A;  4DV3 Q;  4OX9 Q;  4A93 H;  2MO1 A;  1X3G A;  3L7Z C;  3UE1 A;  5M5X H;  4IOC A;  4AQY L;  4JI8 L;  3RR5 A;  5GAH C;  2ATW A;  1X55 A;  4NXM Q;  3CAM A;  5JJK A;  2YU9 H;  1N9W A;  2H5X A;  4GNX C;  4L5R C;  1VQK A;  4IFD J;  2IHE A;  3F2C A;  2HIX A;  2CQO A;  3H3V H;  1Z9F A;  4O2D A;  5HGQ A;  3W1G A;  1FVI A;  2QGQ A;  5IYD H;  1XPR A;  3I2Z A;  1YHA A;  5LMN W;  5JEA J;  4LFC Q;  5DLQ E;  4P74 A;  4B3S L;  4DR5 Q;  3ZJY C;  5IP9 H;  4BA2 I;  1W3S A;  4JOI C;  3F2B A;  1X3E A;  4DR3 L;  5IWA L;  4LF8 Q;  4YHH L;  2JA6 H;  3PSI A;  2DUD A;  1EQR A;  4IJL A;  4ALP A;  3T1Y L;  1PH6 A;  4IPH A;  4A3J G;  1C9O A;  5E7N A;  1YEZ A;  1XTD A;  3HOX H;  2R92 H;  4B3M L;  2VQE Q;  2RHQ B;  4LF6 Q;  4JBK A;  1YBY A;  4PZ8 A;  3I4M G;  2ASB A;  1E22 A;  1AE2 A;  3FKI G;  1X3F A;  4DUZ Q;  2OTL A;  1A62 A;  4JI7 Q;  1KAW A;  4P73 A;  4JI0 L;  3J80 c;  3KOJ A;  3TEH B;  1WOC A;  4JI5 Q;  4GKJ L;  3FHW A;  1N36 L;  1QZH A;  2MQH A;  4JYA L;  2UUC L;  3I4M H;  3I55 A;  1X65 A;  3CCR A;  1VQM A;  3I4O A;  4LFC L;  3PV0 A;  2VQF L;  1G29 1;  3CCV A;  3UDF A;  2Y0S G;  2JK8 A;  1K83 H;  2F3I A;  1HNX Q;  2OWO A;  4NB3 A;  2CCZ A;  4LFB L;  4A3K G;  5H1S E;  3G6E A;  1KRS A;  1QUQ B;  2C35 B;  3CW2 C;  2I5L X;  5FLM H;  5C4J H;  5IY0 A;  3S1R H;  3KDF A;  4B3T Q;  2GVA A;  1AH9 A;  1IBK L;  4LFA Q;  1S40 A;  3A5U A;  1VS0 A;  2MNA A;  1VQG A;  4LF6 L;  5IE8 A;  4L5T A;  3VDY A;  4LF4 L;  1UWV A;  2BH2 A;  1VQ8 A;  4NXN Q;  2V1C C;  4RG1 A;  4JI7 L;  2D62 A;  5IWA Q;  1TWH H;  4H02 A;  1L0W A;  4DAY B;  2B63 G;  1YJN A;  3M4O H;  1HZC A;  2BA1 A;  2WB1 G;  1YI2 A;  2WP8 J;  3OYY A;  2FXQ A;  4HJ9 A;  4A3J H;  1XMO L;  1VQ6 A;  1C0A A;  3OTO Q;  4BBR H;  2MFI A;  3PIP A;  3KJP A;  3T1H Q;  4DK6 C;  1Q81 C;  1NJI C;  2NN6 I;  1B70 B;  1N32 L;  1WFQ A;  1LUZ A;  4NPS A;  3JC6 6;  1PV4 A;  2UUB L;  2CWA A;  2LXJ A;  5M5Y H;  3UDI A;  3BZK A;  1XNQ Q;  1VQ4 A;  2BA0 A;  2Q2H A;  4B3S Q;  4QQB X;  1HH2 P;  4A3L H;  3HKZ G;  2IHF A;  5GAG C;  1Q82 C;  1NMG A;  1K0R A;  3CF5 A;  4YCV A;  2JA5 G;  4DR2 Q;  3CC4 A;  1BBW A;  1Z47 A;  3D31 A;  3RN5 A;  4UY8 C;  4ME3 A;  5JEA G;  1VQE A;  1YHB A;  4A3E G;  4BXX H;  1CKN B;  3FKI H;  4JV5 L;  4DV6 L;  2OTJ A;  2R93 H;  2GVB A;  2K50 A;  2ALY B;  2UUC Q;  1HNZ Q;  2JEA I;  4AH6 A;  1WYD A;  4DUY Q;  1VQP A;  1IBL Q;  2ZTE A;  3ULJ A;  4B3M Q;  4IPD A;  1Y1V H;  2EXD A;  3CQZ H;  1E7Z A;  3M9B A;  4DR1 Q;  5GAE C;  3F2D A;  2Z0S A;  3CCJ A;  3G71 A;  1VQ7 A;  4JI2 Q;  4OWX B;  3UE0 A;  3EBE A;  4IPG A;  1K73 C;  5M5W H;  3HOW H;  3AFQ A;  4DR7 Q;  4LW1 A;  2K5N A;  4A3M H;  1K3R A;  1PFS A;  1BKB A;  3BU2 A;  2NVQ H;  3A5Z B;  3HOZ G;  5C3E H;  1A8V A;  2R7F A;  3L0O A;  1FJG L;  2XGT A;  2HHH L;  3RZO H;  1GVP A;  2KCM A;  4IPC A;  1YVC A;  4DV5 L;  4AIM A;  3RNU A;  1PH8 A;  1KXL A;  3TS0 A;  3K81 C;  3GTK H;  1PYS B;  1OXV A;  4PZ7 A;  4KHZ A;  4A3C G;  1CSQ A;  1I6H H;  1U5K A;  1QUQ A;  4MNO A;  2Q2U A;  4LF9 Q;  3S16 H;  4DR4 Q;  3S15 H;  3T1H L;  1L2F A;  1N32 Q;  2OCE A;  1CKN A;  1N8R C;  4JI1 Q;  4JI3 L;  4JI4 Q;  5C0X G;  4IO9 A;  2JJQ A;  2JA7 H;  3PF5 A;  2I5M X;  1Q1B A;  3CCS A;  4IFD I;  5JJL A;  3S1N H;  4OX9 L;  1PHJ A;  1E1O A;  4KLK A;  4DV0 Q;  1IXR A;  2ES2 A;  1UE7 A;  4LUZ A;  3A0J A;  3CCE A;  3GD7 A;  1WJJ A;  3CCM A;  4DV1 Q;  4A3E H;  1QZG A;  1SLJ A;  5C0X J;  5M3F H;  4IOA A;  4R4I A;  1X9N A;  2E8G A;  1OXU A;  3TQY A;  2B3G A;  4A3I G;  4YWK A;  1N34 Q;  4X6A H;  2JQO A;  3PIO A;  1A63 A;  2E5L L;  1IZ6 A;  1LM0 A;  1QVC A;  4Y52 H;  3W5O A;  1CSP A;  3FP9 A;  5FLX c;  2UXD Q;  3CXC A;  3RN2 A;  3GTM H;  2ZM6 Q;  4P75 A;  1Q12 A;  3HOY H;  4DR1 L;  5IYB G;  2UUA L;  1WCM G;  3PUZ A;  1VQD A;  4X62 L;  3HOU H;  3S14 H;  4JBM A;  1PH3 A;  1SN8 A;  4XTC S;  4R4Q A;  1W2B A;  2N3S A;  3CPF A;  1VQA A;  1EYG A;  2NZH A;  1PH2 A;  2UU9 Q;  5M3M H;  4JBJ A;  2Y0S E;  4QJF A;  4DR2 L;  2VZA A;  2GN5 A;  4UP7 A;  3SGI A;  4KHP L;  4KI0 A;  5C4X H;  5HY6 A;  1XNR Q;  3S17 H;  4OWW B;  3KF6 B;  4XIG S;  2VQE L;  3K0X A;  4DV5 Q;  4UPA A;  3PUW A;  2CKZ B;  2E5L Q;  1R9T H;  4JI6 L;  1XMQ L;  2N49 A;  1YZ6 A;  1AE3 A;  2R7D A;  1MJE A;  3PF4 A;  4BY7 G;  1NTG A;  1SFO H;  2KEN A;  3H0G H;  3W1B A;  2AWN A;  1J5E Q;  2XTI A;  1EIY B;  2NVY H;  1JE5 A;  3CC7 A;  1X56 A;  3NEL A;  4OON A;  1FL0 A;  1N33 Q;  4OWT B;  5JJI A;  4R4O A;  4DV0 L;  5AJ3 Q;  4P72 A;  3KYH C;  4R4T A;  4BBS H;  2K5H A;  1IBM L;  4B3R Q;  4DV4 L;  2KCT A;  3PO2 G;  5C44 G;  4DR4 L;  1EIF A;  4DV2 Q;  4BY1 H;  4A3F H;  4QY7 A;  1HR0 W;  1SR3 A;  2R6G A;  3NEM A;  2ZTC A;  1M90 C;  4YWM A;  3PUX A;  1CKO A;  3D0F A;  4B3T L;  3STB C;  4L5S A;  3PO3 H;  4AQY Q;  2IY5 B;  4GNX A;  5C44 H;  2UU9 L;  3M4P A;  2RCN A;  2ZM6 L;  4A93 G;  4HJA A;  3BJU A;  5LMN Q;  3S2D H;  4DAM A;  1X6O A;  1KL9 A;  4RMF A;  1CUK A;  3B6Y A;  4YCU A;  5FJ8 H;  1HZ9 A;  1ASZ A;  4GKK Q;  4YWL A;  3S2H H;  1NY4 A;  4UP8 A;  1X54 A;  4C3J H;  3J81 i;  4GLX A;  2KBN A;  4WJ4 A;  1A0I A;  4K0K Q;  3J7Z C;  1BBU A;  1V1Q A;  4DV7 L;  4DR7 L;  2VNU D;  3JAM c;  1K8G A;  4A3B H;  4AYB E;  2K75 A;  2RHS B;  4HIM A;  1Q46 A;  4DV1 L;  1EOV A;  1N34 L;  2K4K A;  2PQA A;  3J81 j;  2ZTD A;  4OXP A;  1NE3 A;  2B29 A;  3OTO L;  4GOP C;  1XMQ Q;  2IT1 A;  5LMU L;  4DPG A;  4DK3 C;  5BR8 L;  4A3B G;  1VCI A;  2N78 A;  1MIU A;  2N8N A;  4UP9 A;  1XNR L;  2OQ0 A;  4HJ5 A;  4KHP Q;  1I3Q H;  3RLF A;  1KC8 C;  4JOI A;  3GTO H;  1XPO A;  4TQU S;  1M1K C;  4A3G G;  1IYJ B;  3NEN A;  2K5V A;  1J6Q A;  1GD7 A;  3KLW A;  2K14 A;  2VY3 A;  2AMC B;  2YTX A;  4IJH A;  3K7U C;  4C3H H;  4DR5 L;  3MEF A;  3CMA A;  4LF9 L;  3JAM i;  4JI4 L;  1VQI A;  3F1Z A;  1PVO A;  4YCW A;  1CKM A;  2VL6 A;  3CD6 A;  2NZO A;  4MZ9 A;  5GRO A;  1XNQ L;  4BY1 G;  4X66 Q;  5GQO A;  1VQF A;  1IL2 A;  4OO1 I;  3AEV A;  1VQJ A;  1OXS C;  1RIP A;  4LUO A;  2JA6 G;  2YYZ A;  1JT8 A;  2JA7 G;  1QVG A;  3ERS X;  2KHJ A;  1S3O A;  4GOP B;  2D0O A;  4LF7 L;  1Q1E A;  3H15 A;  2JA8 H;  3TRE A;  1KRT A;  4JI2 L;  1OXT A;  3GTP H;  4JI8 Q;  5IYC H;  2JA8 G;  4HJ7 A;  3S1M H;  1KQS A;  4WJ3 M;  5FJ8 G;  1HJP A;  2NVX H;  5M3F G;  4DR6 Q;  1KIX A;  3S1Q H;  1S72 A;  1KD1 C;  3KF6 A;  3M4Q A;  4A3D H;  1B7Y B;  2D0P A;  3PO3 G;  4LF4 Q;  1VQH A;  3I56 A;  3CME A;  1NBW A;  3ULP A;  4LF5 Q;  1YNX A;  1WCM H;  1I94 Q;  1U0L A;  4DV6 Q;  3HOU G;  3WWV A;  2F4V L;  4DUY L;  4JV5 Q;  2I5H A;  1JB7 A;  2L15 A;  5C3E G;  4FDB A;  5IYB H;  3DLL A;  5K36 G;  3S24 A;  1IBL L;  3K8A A;  1TWG H;  1HNZ L;  1HZA A;  2DGY A;  2PQA B;  2A8V A;  1UEB A;  3KF8 B;  1PH4 A;  4K0K L;  5EAY A;  2UXB Q;  4A76 A;  3TS2 A;  1YJW A;  2HHH Q;  4P71 A;  4LF7 Q;  1QVF A;  3CPW A;  2UXB L;  4A4I A;  2OQK A;  1LYL A;  1UE1 A;  1VQB A;  4GS3 A;  1FGU A;  1VQN A;  4X66 L;  2Z6K C;  2CFM A;  2EIF A;  1L1O C;  4HJ8 A;  4X65 Q;  3F8T A;  3RZD H;  2UUB Q;  2B63 H;  3PGZ A;  3UDX A;  1P8L A;  3CCQ A;  1I94 L;  3TRZ A;  2MO0 A;  4DUZ L;  1JJC B;  2F4V Q;  3U58 A;  2JA5 H;  1YIJ A;  4Y7N H;  2F52 A;  5IYC G;  5LMU Q;  4R1J A;  4QGU A;  1C7Y A;  4X65 L;  1DGS A;  1OTC A;  1V9P A;  1K8A C;  4NXN L;  1E3P A;  4A3F G;  1HNX L;  4LFA L;  3K7A H;  4DV7 Q;  3U4Z A;  4GN5 A;  1EQQ A;  3PO2 H;  1T9H A;  1OXX K;  3AYH B;  3K80 C;  1VQO A;  5LMN L;  3EIV A;  3G48 A;  3RLN A;  2JEB I;  3G4S A;  4PMW A;  2AHO B;  2VQF Q;  4JI6 Q;  3HFZ B;  4EQ5 A;  3GTG H;  1EUJ A;  4GKK L;  4IFD G;  1VQC A;  2VUM G;  3HOW G;  4A3D G;  1SMX A;  4JYA Q;  1L1O B;  5FLM G;  4JI0 Q;  3NBH B;  4JG2 A;  4GKJ Q;  2LSS A;  1D7Q A;  4A3K H;  3PUV A;  2WAQ G;  1NMF A;  3A74 A;  3M85 A;  1P16 A;  1XMO Q;  3OW2 A;  2NVT H;  1I5F A;  1E1T A;  1SRU A;  4LF5 L;  3CC2 A;  1V43 A;  2VS1 A;  4DV4 Q;  4JCV E;  3J81 c;  5C4X G;  2ID0 A;  3UDG A;  1PA6 A;  4JI5 L;  1LTL A;  1SRO A;  3AQQ A;  4YHH Q;  4DV2 L;  2I0Q A;  2UUA Q;  4LNQ A;  3KFU A;  3M7N A;  4A3M G;  4DR6 L;  2K52 A;  4YY3 L;  1TWA H;  1YHQ A;  3GTQ H;  1B8A A;  1PH5 A;  5IP9 G;  1PH9 A;  4A3G H;  3EN2 A;  1KHI A;  4C2M H;  2ZJP A;  1N33 L;  1IBK Q;  2LXK A;  1J5E L;  3HKZ E;  1VQ9 A;  3T1Y Q;  1D8L A;  4LUV A;  2PI2 E;  4LFB Q;  4DR3 Q;  1Y14 B;  1G51 A;  2IX0 A;  2Q2T A;  5C0X I;  3J80 i;  4YY3 Q;  3U4V A;  1JJG A;  2R93 G;  4BBR G;  2Z6K A;  3M3Y H;  2JA9 A;  1Q86 C;  1K9M C;  2HT1 A;  1YIT A;  4NXM L;  1TWC H;  2WFW A;  3DM3 A;  3MXN B;  2WB1 E;  3Q8D A;  1WI5 A;  3HOX G;  2E2J H;  3PUY A;  5J3B A;  1E24 A;  4DNI A;  1N36 Q;  1TWF H;  2CWP A;  3STB D;  1HR0 L;  2A1A A;  1G6P A;  2HQL A;  1UE5 A;  2KHI A;  3GDE A;  1Y1V G;  3PCO B;  3RLO A;  1SE8 A;  1ASY A;  2E2I H;  4BBS G;  4OO1 G;  3E0E A;  1Q7Y C;  2NN6 G;  3I4N G;  3GTL H;  2RF4 A;  2YV5 A;  4QL5 A;  5AJ3 L;  2UXD L;  2YTY A;  1TXY A;  4MTN A;  4O0A A;  1XJV A;  1IBM Q;  4B3R L;  2A19 A;  3ER0 A;  5GAD C;  5IP7 H;  4HIO A;  1Y1W H;  3I4N H;  2UXC Q;  1HZB A;  4GLA C;  4TVA B;  4LF8 L;  4LWC A;  5IP7 G;  1Y1W G;  1EWI A;  4EX5 A;  4POF A;  5ELO A;  4APV A;  4AYB G;  5IT9 c;  4HIK A;  4X64 L;  3L2P A;  1EFW A;  3E9H A;  2VW9 A;  3KDF B;  4L5Q A;  1MKH A;  3J7A 5;  1HNW L;  2QEX A;  4A75 A;  3CCU A;  3CCL A;  1Q8K A;  5IYD G;  2UXC L;  1MJC A;  3GO5 A;  4JBW A;  4JC0 A;  1JJ2 A;  2PNH A;  4R4C A;  3H0G G;  5M3M G;  1PH7 A;  1BVS A;  1L1O A;  4A3C H;  1RL2 A;  3HOZ H;  3GTJ H;  4PZ6 A;  1I50 H;  2ZJR A;  2E2H H;  1O7I A;  2R92 G;  3BZC A;  2AWO A;  3AFP A;  1HR0 Q;  4DV3 L;  2YTV A;  3HKS A;  2WAQ E;  3CP0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...