1N36Q

Structure of the thermus thermophilus 30s ribosomal subunit in the presence of crystallographically disordered codon and near-cognate transfer rna anticodon stem-loop mismatched at the second codon position
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 18
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1n36Q00
1A0IA 2BA1A 1KC8C 2QA4A 4JI2L 1XNQL 1PA6A 3KYHC 1W3SA 3PCOB 1X55A 5M3MG 4LFAL 4DR4Q 3K80C 1PH6A 2UXBQ 1J6QA 1LYLA 4ME3A 3AQQA 5AJ3L 1Z47A 2VL6A 4QQBX 3F1ZA 5C4JH 3M85A 4BY1G 5M5XH 1C7YA 4B3RL 2ZTEA 4YWMA 1PVOA 4O2DA 2VW9A 4DV1Q 2VQEL 2R92G 3TS2A 5IYDH 5IY0A 3T1YQ 4PG3A 4POFA 2ZM6Q 2JA5G 4JCVE 2K14A 3KLWA 1OXUA 4LFAQ 3A5UA 4DR4L 4DV6L 4H02A 2RHSB 4PZ8A 3TRZA 2R7ZG 3ULLA 4DR7Q 3HOVG 1PYSB 3FKIG 1PYBA 2B3GA 2EXDA 2UUAQ 4AQYQ 3NBHB 5DLQE 4DV5Q 3D0FA 1L1OC 4PZ6A 2BH2A 1TWFH 4O0AA 1FJGL 1FJGQ 4NXML 2MNAA 3B6YA 4DV4Q 2B63H 1I6HH 1N36L 3S24A 4HIOA 3GTOH 1DGSA 3PF5A 4JI4Q 1HNWL 4DUYL 1IBML 1I5FA 2VQFQ 1IYJB 2OTLA 1SROA 2RF4A 3SGIA 3F8TA 1EUJA 4YWKA 4LFCQ 4WJ3M 1QVFA 1ASYA 2ATWA 4LF4Q 1HR0W 3UDFA 4NXMQ 1WCMH 2R7DA 1J5EQ 1VQIA 3HOXG 2KENA 4MTNA 5IWAL 3GDEA 2CKZB 3M7NA 4IJHA 1KIXA 2E8GA 4JI3Q 4KHPL 4LF8L 2AWNA 3CW2C 2K52A 1K83H 2KHIA 2E5LL 2WB1E 5HGQA 4XIGS 4GOPA 4A93H 1V43A 1KXLA 4DV2L 4K0KL 3AYHB 4JOIC 1UE7A 1LTLA 4DV7Q 2PNHA 4A3JG 1SFOH 4OONA 4A3CH 4A3GH 2E5LQ 3KF8B 4OWTB 2UU9Q 4LF5Q 3EIVA 1R9TH 1XPOA 1D7QA 4L5SA 3STBC 1GD7A 2XGTA 3KJPA 2JA8H 2F4VL 3CCSA 1C9OA 1S40A 1NTGA 3ZJYC 3BJUA 1JJCB 1YHAA 2ID0A 3GD7A 5IP9H 3KF6A 4DV0Q 5GADC 2UXBL 4R4CA 4TVAB 1GKHA 1Y1VG 1VQJA 1Y1VH 3S1MH 4APVA 2ZTCA 5BR8L 3A74A 4YY3Q 1N9WA 1BBUA 2IX0A 2YTYA 1HZAA 2Q2UA 5IYDG 4LF6Q 4IFDJ 5JJKA 1E24A 2HHHL 2HIXA 1HNWQ 3GTKH 3CCLA 3PF4A 5IYCG 1EIFA 3FKIH 4X66L 1PH5A 2I0QA 1T9HA 2JK8A 4ALPA 1A62A 3J7A5 3G4SA 4UY8C 1PH8A 2NVQH 1VQOA 4DR5Q 5M3FH 1PH7A 4KHZA 1UWVA 1VQFA 1Y14B 3KDFB 4AQYL 1YITA 2E2JH 3UDXA 1X3EA 4EQ5A 1P8LA 3GTQH 3ICEA 3H15A 1K0RA 2Q2TA 2I5MX 3CCUA 5HY6A 2UXDQ 2KHJA 2H5XA 1Q1BA 1OXXK 4JI7Q 2ASBA 2IX1A 4GOPC 3PO3H 4DUZQ 5LMNQ 4A75A 3STBD 4DR1Q 4BBSH 4GKKL 4YCWA 4JOIA 1Q12A 3RLFA 1W2BA 1PH9A 1E1TA 4B3TQ 5LMNL 4GKKQ 2F52A 1KL9A 4JYAQ 4LFBL 4GN5A 1ASZA 4TQUS 1GO3E 4YHHL 2KCMA 3D31A 1VCIA 5FLMG 3NENA 1E3PA 2F4VQ 1IZ6A 1PV4A 1N33L 3F2DA 3CCJA 3OYYA 1EOVA 2MO0A 3PO3G 1EIYB 4LF8Q 4LUZA 5EAYA 1HNZQ 3UDIA 3RNUA 5JJLA 3KFUA 3HOZH 4JV5L 5JEAG 1QZHA 3M3YH 1U0LA 4K0KQ 1X54A 1Q81C 4JBMA 2OQKA 1I50H 3EN2A 1X9NA 3I4NH 4NPSA 4JI8Q 4HIKA 4LF4L 2XTIA 4DPGA 1FGUA 3E9HA 1HNXQ 3W1GA 4A3DG 1A8VA 3A0JA 3J7ZC 4QJFA 3PIOA 2Z6KC 4HJAA 3S1RH 1JMCA 1JB7A 3FP9A 5FJ8G 1YJ9A 3CC2A 3KOJA 2RCNA 3TQYA 3CCRA 1P16A 2N3SA 4DKAC 4HJ5A 2YU9H 1IXRA 4OO1I 1XTDA 2NN6I 3K81C 3CXCA 1XMQL 4BY1H 1B7YB 1WCMG 2K5VA 4GOPB 5J3BA 1VQ7A 4X62L 4X6AH 4R4TA 1EWIA 4LUVA 2IHEA 5LMUL 2GVAA 4JI5L 1S3OA 2AKWB 1CSQA 3TREA 3HFZB 3CPWA 4GNXC 1HZBA 2KCTA 1IBKQ 4A3FG 4A3FH 3JC66 1VQNA 4X66Q 3CC4A 4YCVA 4X64Q 3UDGA 1VQBA 2NZOA 4P73A 1WYDA 1YJWA 2JA6G 2OWOA 3W5OA 1VQ6A 1X65A 4QL5A 3H3VH 5ELNA 3I56A 2VY3A 2RHQB 1Q82C 2R7ZH 1JE5A 1KRTA 1V1QA 4JBKA 4IFDI 3I2ZA 2AMCB 4JI1Q 4JBJA 4AYBG 4FDBA 4GLXA 4BBRH 5JEAJ 3K0XA 3KJOA 4LFCL 4JI1L 1WOCA 4BBSG 3G48A 1Z9FA 5C4XG 5IYBH 4DK3C 2HIVA 1X3GA 2CFMA 4OO1G 4LNQA 3LGJA 1TWHH 2N78A 3GTJH 2NVTH 2JA6H 5IT9c 2DGYA 1XPUA 1TWCH 4R4IA 3HOVH 4JI7L 1BKBA 1OXVA 1VQPA 2B63G 3L7ZC 1UE1A 2WFWA 3CC7A 1PH1A 4LF9L 2Y0SG 4PZ7A 3HOYH 5GROA 2GN5A 2MFIA 1MIUA 4GN3B 2HT1A 4UPAA 2JA7G 2VQFL 3BU2A 3S2DH 3MEFA 4GN4B 3J80c 4J15A 2JEBI 3J81i 3HKSA 3OW2A 2L15A 4X64L 1MKHA 2QGQA 4C3IH 1FL0A 3HOUG 2MO1A 4YCUA 3PUXA 1J5EL 3H0GH 4IJLA 1OXTA 5IP7G 3K7AH 4DV6Q 1VQ9A 2HHHQ 4OXPA 4A3IH 4IPDA 3CMAA 3H3VI 1G291 3PO2H 5IYCH 3OTOQ 2EIFA 2VZAA 1G6PA 3T1HQ 1GM5A 3JAMc 1LUZA 4DAMA 2YV5A 2KBNA 2R7FA 4JC0A 4OWXB 4YY3L 5GAHC 5C3EH 1YJNA 1K8GA 1EYGA 4B3RQ 1VQLA 1Q1EA 1XMQQ 2VUMH 4KI0A 4Y52H 2Y0SE 3VDYA 1I94L 3W1BA 4JI8L 4EX5A 1A63A 4A3DH 5C44G 5H1SE 1NBWA 4DAYB 2VQEQ 3FHWA 4L5QA 1NMFA 2NVXH 3HOWH 4IFDG 5M3MH 3G6EA 5K36G 1HNXL 3NELA 3PGZA 4GLVB 3KDFA 1RIPA 4DR3Q 3CP0A 4X65Q 4GLAC 4DV7L 5IE8A 4DV2Q 2YTXA 3RLOA 3HOUH 3U4VA 2R92H 4DR3L 1CKNB 2BH8A 2PQAA 5E7NA 3EBEA 4R4QA 4C2MH 4A3LG 2YTVA 4A3LH 1CUKA 3HOXH 4DNIA 2CCZA 2YYZA 3CD6A 2AWOA 3I7FA 1K73C 4JI5Q 3JAMi 1VQGA 4P71A 1VQ4A 1V9PA 1WFQA 2C35B 2OQ0A 1EFWA 4LF7L 4DUZL 3S14H 2UXCL 1CKNA 3J81j 4YWLA 2OTJA 2F3IA 2VUMG 4B3TL 2K50A 3KF6B 2UUCQ 1E22A 2JQOA 1NY4A 1OXSC 1YBYA 3BZCA 2HQLA 4MZ9A 3UE1A 1U5KA 2K4KA 1SLJA 2Z0SA 3PSIA 1SN8A 1YZ6A 1IBMQ 2UUCL 1VS0A 5C0XI 2VNUD 1XMOL 2GVBA 2I5HA 2Z6KA 3CAMA 1AE2A 4LWCA 4AYBE 2K75A 4C3JH 4Y7NH 2VS1A 4DV4L 4R1JA 4P74A 1Y1WH 1YHQA 1Q86C 4DK6C 5M5YH 2UXCQ 3MXNB 2UUBQ 5C3EG 4NXNQ 5M5WH 3I4MG 1JT8A 2BA0A 3S1NH 1HNZL 2NZHA 2PI2E 3CCEA 3UE0A 1Q7YC 1VQAA 3IRBA 1N33Q 4BXXH 3GTPH 4GNXA 2IHFA 1HR0L 1OTCA 3HOYG 5FLMH 5GAEC 3HOWG 4NB3A 1HZ9A 1K9MC 4IOAA 3CQZH 1NJIC 1E7ZA 4QGUA 2K5NA 1EQQA 4C3HH 1X56A 3ER0A 2DUDA 5IP9G 1PH3A 4JI6L 1UE6A 1KRSA 3PV0A 3GTMH 3PO2G 1PH2A 4BY7G 4A93G 5LMNW 4A3KG 4GNXB 5BR8Q 5IWAQ 1YHBA 3I55A 2IT1A 1I94Q 2CQOA 3ULJA 4DV3L 4L5RC 1KQSA 1TWAH 2JJQA 1G51A 2ZJPA 1QVGA 4IOCA 3K8AA 2ES2A 1X6OA 4JI2Q 3HKZE 1XNQQ 1BVSA 1L0WA 1QUQB 4RMFA 1VQCA 3OTOL 1MJEA 2I5LX 3K7UC 4AIMA 4P72A 4BBRG 1H95A 3GTLH 1IBLL 1GVPA 3J81c 4OX9Q 1YEZA 3U4ZA 3S16H 4IPCA 2LXJA 1IBKL 3M9BA 3A5ZB 5C44H 3S2HH 1UE5A 1N34L 1LM0A 1I3QH 3Q8DA 1XNRQ 2JA5H 4IPHA 1XMOQ 4QIWE 2CWAA 2FXQA 2UUAL 3F2BA 1N32L 1KAWA 2NVYH 4UP9A 3HOZG 3T1HL 4JG2A 1N32Q 4DR2Q 1EQRA 2ALYB 2WB1G 2JE6I 1IL2A 2LXKA 2QEXA 1FVIA 1YVCA 1QVCA 2Q2HA 2R6GA 1PH4A 1WI5A 1X3FA 3CCMA 3TEHB 4LF6L 2WP8J 4DV1L 1CKMA 4LF7Q 3RR5A 3PUZA 4B3ML 4R4OA 5IP7H 2E2HH 4DUYQ 1VQDA 1KHIA 1D8LA 3U50C 4OWWB 3RN5A 4DV0L 2PI2A 4RG1A 5JJIA 4A3EG 1AH9A 2NN6G 3CPFA 1CKOA 1KD1C 4JV5Q 4OX9L 5M3FG 3M4PA 2JEAI 3CCVA 4A3CG 4B3SL 3NEMA 3M4QA 4LW1A 1N8RC 2UU9L 1HJPA 4LF5L 1VQHA 4JI3L 1Y1WG 3DM3A 4JI0Q 4DR7L 1SMXA 4JI6Q 2A19A 4A3IG 2JA7H 4BXXG 1B8AA 1Q46A 2N49A 4BY7H 5C4XH 2AHOB 4HIDA 2D0OA 4IPGA 4X62Q 2B29A 3RZOH 3M4OH 3PUYA 3PIPA 1K3RA 1TXYA 2ZJRA 2OCEA 1SRUA 5FJ8H 3AEVA 4HIMA 3I4MH 4QY7A 5GQOA 1HZCA 2ZJQA 3RLNA 1IBLQ 4A3GG 3S17H 2R93H 1AE3A 4UP8A 4DR5L 3HKZG 1N34Q 2JA9A 1E1OA 4IO9A 3RN2A 1M1KC 3I4NG 1VQ5A 4BA1I 5GAGC 1NE3A 3S15H 3PUVA 4A3BG 4P75A 1VQKA 1VQEA 1Q8KA 1HH2P 1L1OB 3AFQA 5FLXc 5C0XG 4LF9Q 4GKJQ 3ULPA 4DV5L 3E9IA 3S1QH 1O7IA 3J80i 2PQAB 4DR2L 1JJ2A 4A3KH 2WAQE 1QUQA 3PUWA 2D0PA 4LFBQ 4A4IA 2K5HA 2ZM6L 2WAQG 1YI2A 4L5TA 1M90C 1RL2A 3T1YL 2A1AA 3BZKA 3F2CA 4A3BH 3AFPA 2PMZE 3L2PA 1CSPA 4JI0L 3WWVA 3ERSX 4DR1L 1N36Q 5ELOA 5AJ3Q 2V1CC 3GTGH 4A3EH 3E0EA 3G71A 2UXDL 4GS3A 3TS0A 2UUBL 3CMEA 4YHHQ 4UP7A 4AH6A 4HJ7A 1VQ8A 4KLKA 4XTCS 4DV3Q 3U58A 4JYAL 4KHPQ 1SR3A 4A3MG 4B3MQ 3CF5A 4BA2I 4NXNL 2ZTDA 4HJ8A 1K8AC 1MJCA 3RZDH 4JBWA 5C0XJ 2EQSA 1WJJA 1BBWA 4WJ4A 2D62A 4A76A 2Q2IA 4DR6L 4LUOA 1VQMA 5IYBG 2A8VA 2N8NA 1NMGA 1TWGH 1L2FA 1S72A 1HR0Q 1L1OA 3GO5A 2IY5B 3H0GG 4PMWA 2E2IH 4JI4L 1JJGA 2CWPA 4A3MH 1XNRL 2JA8G 4GKJL 4DR6Q 3DLLA 1B70B 3CCQA 1YNXA 5LMUQ 1XJVA 2R93G 1PFSA 1UEBA 4X65L 1QZGA 2MQHA 4A3JH 1C0AA 4POGA 3I4OA 2LSSA 1YIJA 4B3SQ 4HJ9A 1XPRA 3L0OA 1PHJA 4MNOA 1SE8A
chains in the Genus database with same CATH superfamily
1SNMA 4KY5A 1A0IA 1KC8C 2KEDA 1Q8IA 1B44D 2OEOA 1X55A 2ICEC 1WTOA 3AQQA 1SEBD 2VL6A 2JA5B 2RSNA 2HCIA 3M85A 4BY1G 1C7YA 4O2DA 4DN4M 2VQEL 5IYDH 3T1YQ 2JA5G 4NDXA 1MI2A 1D5MC 4DR4L 2RHSB 1PTOD 1JICA 3ULLA 3EFXD 3V05A 3Q23A 4DV5Q 3CRKC 3MEHA 3KBGA 3VR5A 4O0AA 3P7JA 1FJGL 5CV9A 2Q8TA 4DV4Q 1I6HH 1SE4A 2G9DA 4JI4Q 2JXMB 2GA4B 3NTKA 1IYJB 1SROA 1TWCB 4X3KA 3I72A 1LT3D 2MJ8A 1K0SA 1JWSD 4NXMQ 1J9OA 1VQIA 3HOXG 5IWAL 3M7NA 1HTLD 5CYUA 5EPJA 4JI3Q 1I4HA 2L4NA 2VXWA 4LF8L 4ZUIA 2AWNA 2K52A 3MFYA 1NSNS 2KHIA 4RH6A 4GOPA 5JVH3 1KXLA 4K0KL 3EA6A 4DV7Q 3FDTA 3KF8B 3J7YW 2H1EA 2SEBD 4RCNA 2SNMA 3EIVA 2D2CC 2WV6D 4RGNA 2AQ3B 2A6HC 3F2UA 3CCSA 1S40A 5L37A 3QB3A 3TP6A 5IP9H 4BBSB 1VQJA 4APVA 2ZTCA 1F2YA 5JJKA 2X6GA 3GTKH 3CCLA 5I6WA 5IYCG 2I0QA 2M2LA 1SJED 1T9HA 1XWEA 1PH7A 1U9RA 4KHZA 4AQYL 3SDZA 4C3IG 1W6KA 3D3RA 3S1MB 2LKVA 2F0WA 2A68D 4TSSA 4PNYA 1OXXK 2ZXPA 5KNBA 2IX1A 1H9SA 4A75A 1BF4A 3NQIA 1GOZA 4BBSH 1F9SA 3KLRA 4GKKL 4JOIA 4H0LC 4B08A 5LMNL 3N52A 4YHHL 3FRPB 2KCMA 3SR1A 1IZ6A 4IUNA 1PV4A 1WTWA 3KLSA 1EOVA 4HEDA 1EIYB 4LF8Q 5EAYA 1HNZQ 3NTIA 5C4JB 3UDIA 1LABA 1HHVA 2NTTA 1U0LA 3EN2A 3I4NH 4NPSA 2B2YA 3W1GA 1A8VA 4QJFA 5KEEA 2Z6KC 1EU3A 1XX8A 3FKIB 3PIOA 4HJAA 1ICWA 1P16A 2N3SA 4DKAC 1IXRA 3I70A 5IT9L 1B7YB 1RCVD 1XXGA 3IFTA 1VQ7A 5ELBA 4LJZC 4CGYB 2CH4A 3VR6A 1EY5A 1V8QA 3MA2B 2KCTA 5NUCA 3HZXA 2LY7A 3JC66 1FGBD 1TWAB 4ZYSA 1HCZA 3T53B 1D6EC 2NZOA 1SDFA 1WYDA 1YJWA 3M7GA 2JA6G 3WDNA 3K57A 3H6MA 1Y8PB 1Q82C 5CC4A 1JE5A 1V1QA 3I2ZA 2X69A 4JBJA 3TN2A 3K5OA 1V1OA 5CBEE 3K0XA 4LFCL 4V0BA 4JI1L 1Z9FA 3AMUA 4C3JB 3LGJA 1TWHH 4A3JB 4R4IA 2IL8A 1UE1A 1PH1A 2EJFC 4GN3B 3G7LA 3BU2A 2VQFL 4GN4B 2AQ2B 3OW2A 2L15A 4X64L 4K5VA 2VB2X 4ULLA 3C46A 2MO1A 4YCUA 1J5EL 1EQTA 4IJLA 1XTCD 3K7AH 4DV6Q 1ONLA 4IPDA 3VR2A 3OTOQ 4C3HG 2DN8A 2Z4HA 1G6PA 3HOZH 2CW0C 5C3EH 2YV5A 1YJNA 4OWXB 1K8GA 3E6ZX 4ZLTF 4CBVA 2Y0SE 1I94L 3W1BA 3LWEA 4EX5A 1H9KA 5H1SE 1F2MA 3FHWA 1BO0A 3S1NB 5K36G 5C4XB 2O5JC 3PGZA 4DR3Q 2I46A 2JYOA 3CP0A 4X65Q 3D6CA 3RZOB 1YNNC 2M9VA 4ZUJA 2WAQB 1SJHD 3U4VA 2R92H 5E7NA 2PQAA 2PQEA 2B2UC 4R4QA 3BG3A 4A3MB 4EQOA 5IGGA 1CK1A 4A3KB 3PMFA 3CD6A 2K05A 4JI5Q 1BUVT 4LF7L 1V9PA 2OQ0A 5LL6S 5KYIA 4YWLA 1RD9D 5FO9B 3MXUA 4QF4A 4B3TL 4MTKA 1OXSC 1STBA 1B3AA 1AN8A 3OOCA 2Z0SA 1SLJA 5G3LF 5C0XI 2I5HA 3CAMA 4LWCA 4AYBE 4DXFA 4R1JA 4P74A 1F9PA 5M5YH 3HG9A 1STEA 2PCFB 2XIWA 3SK5A 4EQNA 5G3LD 1ZEQX 3GTPH 2IHFA 3HOYG 3HOWG 3WOFA 1K9MC 1LTRD 2IWHA 1NJIC 2AQ1B 1EQQA 1DYQA 2LFNA 2N55A 1KRSA 4DXGA 4JI6L 1I3QB 1PH2A 1JB3A 4GNXB 1K8OA 2EDGA 2IT1A 3NHHA 1JCKB 3DM1A 1TWAH 1G51A 4O42A 4IOCA 1X6OA 5DNFA 2ZT9C 1XNQQ 1L0WA 4RMFA 1PFNA 3GTLH 2RSOA 3J81c 1YEZA 3OMGA 5CV6A 1UE5A 3GTPB 1LM0A 3M4OB 2JA5H 3CHBD 4EVOA 2FHTA 2FXQA 3RUZA 3F2BA 5ELDA 1KAWA 1N32Q 4DR2Q 2ALYB 2JE6I 2R6GA 2Q2HA 2WP8J 4X3UA 4LAAA 2HDLA 4BY7B 4RHRA 5IP7H 3VA7A 1PMRA 3BYYB 2PI2A 3SK6A 5JJIA 1JE4A 1HUMA 2N88A 3W2DA 1ENCA 5ISRA 1KD1C 4OX9L 1ENFA 3M4PA 4JV5Q 2D5DA 4B3SL 2FINB 1HJPA 4X3SA 4DR7L 5BN4A 4IUUA 2K5DA 2A19A 1D1IA 3MXGA 2N49A 2PW5A 2E76C 2FJ2A 4K5XA 3R2IA 1EY4A 1B2TA 2IJ0A 3C1FA 5M9OA 3RZOH 1WCMB 3NWSA 1KLGD 1K3RA 1Q3LA 3HKZB 1EYAA 2KJXA 1WTQA 1SYEA 3I4MH 5A35A 2L12A 4DR5L 3HKZG 3I91A 3I4NG 1YNJC 3PUVA 1BCPB 1NUCA 2F0MA 4P75A 1VQKA 1RODA 1VQEA 1R9TB 4IUQA 1L1OB 3AFQA 3E0JA 1GUNA 5EKKA 5FLXc 1FNVA 3HEJA 4JPBW 3C1EA 4DV5L 1QWYA 2PQAB 1QUQA 5D14A 1SSOA 2PYKA 2A5HA 4A4IA 1NAPA 2K5HA 2WAQG 1HA6A 5DM73 3T1YL 2A1AA 4A3BH 2BOSA 2R93B 4R9WA 3OWEB 2A6ED 1ILQA 1SYBA 4G57A 5ELOA 1G2SA 2WIIB 1PXUA 1SNDA 3E0EA 2UXDL 3I3CA 2NVYB 2UUBL 2XN9C 3BDLA 3A7LA 5C3WA 4UP7A 4IUVA 3TP7A 3E5SA 4JYAL 2ICIA 1VF7A 4A3MG 1TWFB 1QNKA 4JBWA 2EQSA 3JAML 2EY2A 4F8MA 4A76A 4DR6L 2QW7A 2N8NA 1L2FA 2Z8LA 1S72A 1HR0Q 1EY8A 4C3IB 1U4RA 4K6LA 2IY5B 3H0GG 2E2IH 2CWPA 2JA8G 2FMMA 3R93A 3HOYB 2WB1B 3K5LA 3CCQA 5D3IB 1UEBA 2DY7A 5JAVA 4A3JH 3OIPA 5DEHA 2EYFA 4DK0A 4MNOA 5I2YA 4L6TB 2BA1A 2QA4A 3J80E 1XNQL 2A6HD 3KYHC 1EY9A 1W3SA 5M3MG 2L9HA 4LFAL 2UXBQ 4C3JG 1PH6A 1PTOB 4ME3A 1CHPD 1Z47A 3F1ZA 5C4JH 3QOLA 3W3AA 4B3RL 2ZTEA 4DV1Q 3TS2A 5IY0A 2VUMB 2B2WA 4X3TA 4ZK9B 4RFBA 1II3A 3J81L 4DR7Q 2O2LD 3FKIG 1CM9A 1PYBA 5DLQE 4ODGA 1TIID 1L1OC 2HDMA 2BH2A 4KK7A 3G6JB 4DF7A 2B63H 3MC0B 1HA5A 3GTOH 3NPPA 1DGSA 3PF5A 1HNWL 3FMCA 3NBIA 2MGSA 2VQFQ 1BQQT 4BS9A 2OTLA 1QJOA 2NVTB 2V4DA 2ATWA 1C48A 1WCMH 2NUCA 1TS5A 2B8GA 2XRQD 2NWGA 1WTXA 4FXKC 1DM0B 2E5LL 2B2TC 3D6WA 1V43A 4XQQA 1UE7A 1ZYRD 5HURA 2PNHA 5C44B 1CA5A 4OO1H 2E5LQ 4OWTB 4LF5Q 3HS0C 1R9TH 1XPOA 4L5SA 4IALA 2F3VA 5I6YA 5EJWA 3KF6A 4DV0Q 2F0IA 1A3TA 3MVVA 4TVAB 1Y1VG 1Y1VH 2B39A 5IODA 3A74A 2WKCA 3HGBA 4K8JA 1ESFA 2IX3A 2IX0A 1ET6A 1MSHA 1TS4A 2HHHL 2EYJA 1HNWQ 2BDOA 4RHSA 4KMUC 3V96A 4X66L 1PH5A 2JK8A 1D5XC 2Z9HA 1CTMA 4KHVA 4KN7C 1EYDA 1VQOA 5M3FH 5KGUA 1UWVA 1VQFA 1Y14B 4UDUC 5ELFA 1RKNA 1JQYD 4XDXA 1P8LA 1K0RA 4FXGC 1Y69U 4FXDA 2UXDQ 2H5XA 1Q1BA 4GOPC 4N8X1 4J1MA 4YCWA 3RLFA 1W2BA 1A3VA 1PH9A 4B3TQ 3IKJA 5CBAE 3NBHA 1STNA 2FFKB 4GN5A 2K5QA 2DNCA 4NMZA 1PLFA 3PO3G 2F0JA 2RQXA 4MN3A 4L8JA 4LUZA 1QZHA 4JBMA 2OQKA 3A54A 1X9NA 4HIKA 1QCBD 2XTIA 4IQZA 4A3DG 3A0JA 3J7ZC 5FJ8G 1YJ9A 3CC2A 3KOJA 4RCOA 2RKSA 2F0VA 4ZKCB 4A3DB 1ZYRC 4O1NA 3CXCA 2OT2A 4X6AH 1B50A 4R4TA 5LMUL 3TSSA 2GVAA 3HOZB 4KN4C 3SK8A 3QR8A 3CPWA 4QIWB 1K8MA 3KUPA 1EWCA 2A69D 2VB3X 2JA8B 1STAA 1VQNA 4X66Q 1K83B 3VYSA 4X64Q 1O7YA 3UDGA 1VQBA 4HCEA 1B3QA 4QL5A 3H3VH 4KD4A 2C5CA 2VY3A 2RHQB 3QG1A 3I56A 1KRTA 2AMCB 5J1ZA 1G8ZD 4FDBA 2BE5D 5JEAJ 1ENAA 4KJNA 2K01A 1WOCA 3GTGB 2HIVA 5C3XA 2CFMA 4B9WA 3GTJH 2DGYA 1XPUA 1BKBA 1LTGD 2B63G 3L7ZC 2WFWA 4AYBB 2Y0SG 3CRLC 2GN5A 2MFIA 1MIUA 2HT1A 4BXXH 3J81i 3BDCA 3DWPA 4C3IH 1TWGB 2KVMA 1OXTA 3HRZC 1FYCA 4OXPA 3CMAA 3H3VI 3PO2H 5IYCH 2VZAA 3JAMc 4IZ8A 2HCCA 5I4DA 3I4LA 1GHKA 4JI8L 1A63A 1EEFD 5C44G 3P20A 2VQEQ 4WFN3 4IFDG 2O5IC 1PTOH 3QJYA 1KABA 1O7LA 3G6EA 1NNXA 3GTKB 3KDFA 2J4XA 3FPUB 2RDFA 4GLAC 4DV7L 4DV2Q 5FOBB 4L63B 1LACA 3VR4A 1K28A 1Y1VB 4A3LG 4A3LH 1U4PA 2YYZA 1K73C 2A74C 1VQ4A 3HOVH 1WFQA 2C35B 4DUZL 1CKNA 2BDNA 3H0GB 2F0OA 2F3IA 3Q22A 3S2DB 3HOVB 2EYPA 3QIAA 3BZCA 4RGOS 1YBYA 2K4KA 4G7HC 1IBMQ 2K5WA 1SN8A 1YZ6A 4YIJA 1IYVA 3MZ5A 3EROA 1AE2A 2K75A 3MXNB 2EPBA 4KTAA 2NVQB 5M5WH 1STGA 2EYMA 1JT8A 2BA0A 5M3MB 2E74C 1Q7YC 1VQAA 1IW7D 1DXMA 4OIKA 1HR0L 2RBMA 1TQOA 3CQZH 5E3FA 3SK4A 1GUSA 4C3HH 2PZWA 3ER0A 1PH3A 1UE6A 4FNFA 4N9TA 4A93G 4KKSA 1YHBA 4IUPA 1I94Q 2CQOA 3ULJA 1KQSA 5BN3A 1LTID 1E0BA 3OMCA 1QVGA 1PRTC 4JI2Q 2JN4A 3HKZE 3X3NA 1WVLA 3S14B 2KHSA 1QUQB 2DJGC 3OTOL 1MJEA 4IUTA 4CDFC 1H95A 3PO3B 2F4IA 1UAPA 4OX9Q 3S16H 2LXJA 2R92B 1WTVA 3Q8DA 1XNRQ 4HR7B 4IPHA 3ZYYX 1B1ZA 2CWAA 1NR2A 3HOZG 1EQRA 2WB1G 1B53A 3OHXC 2Q8RE 1PH4A 1FVIA 1D5ZC 1IKMA 1WI5A 3D4DA 3DHQA 4ZQ3A 4R8NA 4WRDA 4DV1L 1CKMA 4LF7Q 5EGTA 2EJMA 4B3ML 1CHQD 1VQDA 1KHIA 4PMCA 3RN5A 1BBXC 4RG1A 1DD2A 2NN6H 2NN6G 1CKOA 2ZXOA 1PDQA 5M3FG 3CCVA 4KKUA 1O78A 4LW1A 1N8RC 2UU9L 5CGKA 1Y1WG 3DM3A 4C2MB 1EEID 4KV6A 1EWHA 1SMXA 4A3IG 4BXXG 2K6AA 1B8AA 1GHJA 4HIDA 3U9OA 2BCOA 3K59A 5IGCA 3SEBA 3I4NB 3L3OC 5J39A 1TXYA 4DAVA 5EBCA 1DZ1A 3I90A 2ZJQA 4A3BB 1BOSA 2R93H 3S17H 1AP0A 2QDBA 1N34Q 3O13A 4XXEA 1M1KC 1EY7A 4A3BG 3H3VC 1Q8KA 4HTHA 5COYA 3J80L 3S1QH 3E9IA 1SFOB 4DR2L 3OPOA 4XT1B 3DWAA 1EL0A 4BY1B 1X3PA 2ZM6L 3HOXB 5CMDA 4L5TA 4NW2A 1M90C 3BZKA 3L2PA 1HQRD 2TSSA 1RDPD 4G4KA 2OXPA 2KEEA 2V1CC 4LK1C 3GTGH 3G71A 4BBRB 1E2ZA 4GS3A 3TS0A 3CMEA 4HJ7A 4XTCS 1SR3A 4B3MQ 4EQPA 4BA2I 4NXNL 2ZTDA 1MJCA 1JC7A 1WJJA 4WJ4A 1PRTB 2Q2IA 2QCPX 5LHY1 3S1QB 1TWGH 4QMGA 2G5DA 3GO5A 4XT3B 5KIXA 1EQVA 1EY6A 1XNRL 1V1PA 1HTPA 4KJOA 4OEMB 3S9WA 2E2HB 3DLLA 1F77A 1YNXA 4TKOB 2MQHA 4E6IA 3I4OA 1SBBB 1YIJA 4B3SQ 1PHJA 1G6ZA 2F0LA 1PZKD 1I4QA 4JI2L 1PA6A 4C1NI 3E3XA 3U9SA 3HP3A 3K5MA 5K36H 3K80C 1J6QA 1QOHA 5AJ3L 4A3EB 2MUYA 3VYTA 1LT5D 3BVMA 4ZRZA 1FNWA 2XWJB 1A2UA 2L5TA 3A5UA 1OXUA 4LFAQ 3OSOA 4H02A 1PFMA 2PMZB 4PZ8A 3TRZA 2K32A 1PYSB 1GUGA 2B3GA 2EXDA 4AQYQ 3NBHB 3D0FA 2F0DA 3UI2A 3BDOA 5IIFA 4PZ6A 1TWFH 1SYDA 1C8CA 1FJGQ 3B6YA 5EQ0A 1EYCA 4DUYL 1IBML 4FO2A 1TY2A 1I5FA 4CKCA 1H9MA 1LT6D 2RF4A 3F8TA 4WJ3M 1PTOC 1QVFA 1ASYA 4LF4Q 5JOBA 1I4XA 3UDFA 2R7DA 1J5EQ 3A7AB 4DFAA 4MTNA 1Q90A 5I9PA 4IJHA 1I4PA 1KIXA 1GUTA 2E8GA 5CV7A 1FR3A 1Y1WB 1K83H 4HCSA 4UAIA 4CJ2C 3GTLB 3GTOB 4QCLA 2WB1E 1SYCA 3A56A 1AEXA 4DV2L 5IT9E 5KYLA 5C5LA 3AYHB 4JOIC 4A3JG 1LTLA 1SFOH 4OONA 4K14A 1EIHA 1D7QA 3STBC 1UNSA 1C9OA 1VDZA 3ZJYC 5BN5A 2KQ3A 2B2VC 3GD7A 2UXBL 3GTMB 2EJGC 4QB4A 5C5MA 5IOCA 5BR8L 1N9WA 5E1FA 4Q5VA 2YTYA 2XRSD 5IYDG 4LF6Q 4IFDJ 1E24A 2HIXA 4C3HB 4N9PA 1EIGA 3FKIH 1I4RA 3TZDA 3M3YB 4I7AA 4UY8C 1PH8A 4DR5Q 4C56C 5IGFA 3KLSX 1I50B 3KDFB 1S5BD 1KDAA 2F3WA 1X3EA 3UDXA 3GTQH 3H15A 2CW0D 3CCUA 1A15A 2KHJA 4PV1C 4JI7Q 2ASBA 3PO3H 1ILPA 1RHPA 4DUZQ 3STBD 1HRJA 4K2LA 1EZ8A 3CU7A 5AFWA 1Q12A 1E1TA 4QUCA 4JYAQ 4OL7A 4LFBL 1GO3E 2NYZD 3D31A 1VCIA 5FLMG 3NENA 1JR0D 1L0YB 1E3PA 1S4ZA 2EY5A 3Q0AA 2EVBA 5EKLA 3CCJA 2NZ1D 2MO0A 3OYYA 4ME5A 5JJLA 2JP1A 4JV5L 5JEAG 5FKAC 3M3YH 4K0KQ 1X54A 1Q81C 4JI8Q 4LF4L 1S5ED 1SAPA 1LLRD 3S1RH 1JMCA 4DAPA 4G7OC 3A8JE 2Q8IB 3DUZA 2YU9H 2NN6I 3K81C 1YNND 1XMQL 1TY0A 1SNPA 2F0UA 1WCMG 2K5VA 1BXTA 5J3BA 4X62L 3EVQA 4CHTB 1EWIA 2A73B 4JI5L 4A3FB 1ZKOA 1LO5D 2Z1CA 1CSQA 3TREA 3HFZB 4DNRB 1HZBA 5EBDA 1EFID 4A3FG 4A3FH 2K33A 4KY7A 2B8FA 3KBXA 4TRDA 1CQVA 3TP8A 4I65A 4P73A 2I07B 1J8IA 3W5OA 1VQ6A 4FF3A 2R7ZH 2DNEA 4IFDI 4PQXA 2F0HA 4AYBG 4BBRH 2JSOA 5KNCA 3T56B 3D4WA 4BBSG 3G48A 1LTAD 4OGQC 1X3GA 4N8FA 4OO1G 4LNQA 4DGZA 2EOTA 3BYTB 3R3OA 5IT9c 2NVTH 1VQPA 4LF9L 1Y8NB 2KUMA 3HOYH 2F0PA 5GROA 5HGTA 3S2DH 3GQBA 1LTBD 3J80c 2JEBI 1SYGA 3OW7A 3V2TA 2LMCB 4WORA 3MHBA 1SE3A 1FL0A 2TMPA 3HOUG 1MBYA 5ELEA 1TT2A 4FF4A 2F0QA 4CKEA 3PQIA 1QB5D 2HHHQ 2EYOA 2WKDA 4A3IH 1JORA 2R3ZA 1LUZA 4BWGB 4JC0A 1W6JA 4YY3L 3RZDB 4B3RQ 4FF2A 2VUMH 4KI0A 4Y52H 5FO8B 2E2JB 1U4LA 3VDYA 1F2LA 1SMYC 4L5QA 1U4MA 1NMFA 1TU2B 2NVXH 3HOWH 1GUOA 4RKBA 1HNXL 3Q6SA 3NELA 3RD4A 1LTTD 1RIPA 1TS2A 3RLOA 3HOUH 2L0CA 5IGBA 4EGVA 4DR3L 4C2MH 5JPMC 3HOXH 4DNIA 3MAQA 1VQGA 1TS3A 4P71A 1WD1A 1EFWA 4V190 4KD3A 3J81j 2PZUA 2X6LA 2MPMA 2VUMG 5FLXL 3S15B 2EZVA 1IKLA 2NTSA 2K50A 1DCZA 2B2YC 2UUCQ 4F7XA 4MZ9A 2HQLA 2VNUD 1U5KA 3PSIA 2F0TA 1GXDC 1VS0A 1IHZA 1MGSA 2Z6KA 1PFBA 3SXHA 4Y7NH 4C3JH 1N36Q 2VS1A 2UXCQ 2UUBQ 5C3EG 2HQEA 3C2PA 4DAYA 3S1NH 1HNZL 2K1BA 2PI2E 3CCEA 3UE0A 4GZYC 3IRBA 2F03A 2XNAC 4GNXA 5FLMH 1HZ9A 3SVMA 3K5NA 3S16B 2K5NA 4BY7G 4A3KG 3IAYA 1SE2A 1LT4D 5IWAQ 2F1MA 4ILWA 1KLUD 1PRTD 3K8AA 1Z6HA 2ES2A 1BVSA 1UEAB 1VQCA 3URYA 1TKWB 3K7UC 4P72A 3A55A 4IPCA 4H44C 4JW0A 1O80A 2PO4A 1OO9B 4G7ZC 3GTQB 1TWHB 1XMOQ 4QIWE 1WD0A 3MTSA 1AZQA 1STYA 2NVYH 4UP9A 3NSWA 3GV6A 5ELCA 5I9OA 1IL2A 4ABNA 1QVCA 3CCMA 1T5EA 4LF6L 1CZWA 3T4AC 2NBFA 3T13A 2CHBD 3D8GA 1JWUD 3PUZA 4R4OA 4XYQA 5JJZA 2E2HH 3NE5B 1D8LA 1F9RA 2XWBB 4S3SA 4U68A 1WTPA 1VF5C 1IL8A 4A3EG 1AH9A 3CPFA 1BCPC 4RGMA 4Z9CB 1D2BA 3C3LA 2KCCA 2PNRC 3M4YA 3NEMA 3M4QA 5D65A 1VQHA 4JI3L 4JI0Q 3NK9A 2IPKD 4HMJA 4P2CB 4HMIA 4CJ1B 4RWSC 1A2TA 1WTHA 5C4XH 1SNQA 2D0OA 1DOMA 4WJWA 1O7ZA 2B29A 5EPKA 3M4OH 3PUYA 1M8AA 2F0NA 3TZUA 3K0YA 1Z7TA 5FJ8H 2F0SA 3ND8A 4XQNA 4HIMA 3NUCA 4QY7A 3RLNA 2K04A 1F2ZA 2KA7A 1BDOA 4UP8A 4LMQD 1GUWA 1H9JA 1L0XB 5CV5A 1E1OA 4IO9A 1BCPF 4BA1I 5GAGC 1NE3A 3S15H 2SNSA 1DJRD 3P1HA 1HH2P 2D9UA 4GKJQ 4JK1C 2MP1A 4A3GB 1AFPA 1O7IA 4HSVA 1AW7A 1Y8OB 3TP5A 4CDDC 3S17B 1HUNA 3F2CA 2PMZE 4JI0L 4DR1L 5AJ3Q 3MFGA 3HOWB 2NVXB 4NKLA 5I2XA 4ZKBB 3EQLC 1FNUA 1SNOA 3I8ZA 4YHHQ 3JAME 4AH6A 3NQTA 1HFNA 5C4HA 2HUGA 4DV3Q 3U58A 2PZTA 5C0XJ 2D62A 1I6HB 1S5DD 2E2DC 4CKBA 1B9MA 1RF2D 3K7AB 2EYLA 2K7VA 2MHVA 4PMWA 3NP8A 4JI4L 4GKJL 3FEWX 1B70B 2R93G 1PFSA 4XYOA 5JEAH 1HPCA 4X65L 1HQMC 3FVQA 1XPRA 3L0OA 4PMBA 3TBIB 1SE8A 4QUFA 2F0GA 5T1IA 3AU7A 3PCOB 4DR4Q 2L11A 1LYLA 1G2TA 4QQBX 3DXJC 5M5XH 4YWMA 4FYDA 1PVOA 3ITPA 2VW9A 3S2HB 2R92G 1DOKA 5F2DA 3EJIA 4DNTB 1CZGA 4PG3A 4POFA 2ZM6Q 4JCVE 2K14A 3KLWA 1E2VA 4DV6L 3ONAB 1PZJD 2R7ZG 3HOVG 2KOLA 2UUAQ 2IW3A 5JVG3 1RJTA 1BR9A 1LV9A 1TVXA 4F88A 1KDCA 3VYUA 1K3BC 4NXML 2MNAA 1N36L 3S24A 4HIOA 5A2QL 5E4WC 2PPBC 1ML0D 1YNJD 2QKIC 3SGIA 3ND9A 4YWKA 1EUJA 4LFCQ 1EY0A 2WINB 4RAUC 1HR0W 2KENA 3GDEA 2CKZB 2RVLA 3A8IE 2KECA 1JOOA 4KHPL 2G9HD 2KCNA 3CW2C 5DM63 3CKIB 5HGQA 4XIGS 4A93H 5E4XA 1ZXTA 4A3GH 4A3CH 2UU9Q 2BE5C 2Y0SB 5CR3A 2QILA 1GD7A 2XGTA 3KJPA 4J8QA 2F4VL 2JA8H 1NTGA 2XVSA 3BJUA 1JJCB 1YHAA 4KY6A 1MSGA 2ID0A 1JOKA 5IGDA 5GADC 4R4CA 1GKHA 3S1MH 2AUJD 3IL8A 4YY3Q 2RA4A 3H09A 3HOUB 1BBUA 2Q2UA 1HZAA 3GV3A 3BZDB 3QO2A 3PF4A 1EIFA 1DONA 4HAEA 3BS1A 4ALPA 3J7A5 1A62A 3ERQA 5JPNC 3G4SA 3IFDA 4ID6A 2NVQH 2C9OA 2JA7B 2EYHA 1YITA 2E2JH 4EQ5A 3ICEA 4OELB 2Q2TA 2I5MX 2A68C 5HY6A 1A3UA 2L55A 1QNUA 1RTNA 1GJXA 3NWTA 1NCVA 4Y7NB 1X32A 1D1KA 2B2TA 5LMNQ 4DR1Q 1M4VA 1BCPD 3VYRA 3BVZA 3DWQA 4GKKQ 2F52A 4R8IA 1KL9A 3D4RA 1ASZA 4TQUS 4Q0FA 3I73A 1EZ6A 3R8BA 2F4VQ 3NTHA 1N33L 3F2DA 5DAUA 2RDHA 1I4GA 3RNUA 4C1NK 3KFUA 4JVZA 5KRUA 2B2WC 1I50H 5M5XB 1VMPA 4DPGA 1FGUA 1KDBA 3E9HA 1HNXQ 1CFMA 4HN7A 1JB7A 3FP9A 2RCNA 3TQYA 1ICFB 5C3EB 3CCRA 4MHEA 4OO1I 4HJ5A 5TSSA 1XTDA 4BY1H 1MHWC 1LTSD 4GOPB 2QDLA 3DEOA 2E2IB 4LUVA 2IHEA 1S3OA 2AKWB 5T1GA 4UHVA 4GNXC 5CV4A 4MIUA 5C6AA 1IBKQ 3CC4A 1HXYD 2EXZA 3T51B 4YCVA 2F0EA 2CQAA 2OWOA 1X65A 5ELNA 3OWFA 4JBKA 4ZCKA 4JI1Q 3X3MA 1CI3M 3S1RB 4GLXA 3KJOA 5C4XG 5IYBH 4DK3C 3PIP3 1NR4A 2N78A 3WOEA 2JA6H 1TWCH 4JI7L 1OXVA 3CC7A 4DK1A 3J7AV 4PZ7A 5J22A 2EY6A 4UPAA 2JA7G 1PRTF 1B4OA 1DOLA 3MEFA 4J15A 2R7ZB 3HKSA 3KF8A 1MKHA 1QILA 2QGQA 4RKLA 3PUXA 3H0GH 5IP7G 5IGEA 1VQ9A 3K58A 1G291 3DMUA 4RGTA 2EIFA 4XQJA 3T1HQ 1GM5A 4DAMA 2KBNA 2R7FA 1EYGA 5GAHC 1PZID 5EPLA 3SE0A 1JWMD 1VQLA 1Q1EA 1XMQQ 4RA8A 2Z6BA 5CORA 4FP5D 4A3DH 3RMHA 1NBWA 1SMYD 4DAYB 5C0XH 1E2WA 5M3MH 1KNEA 4GLVB 4H7BA 2K03A 5IE8A 2YTXA 1CKNB 2BH8A 3EBEA 4U673 2YTVA 1CUKA 4K8IA 1EU4A 1MD2D 2CCZA 1H9SB 3MXPA 2DJFC 3PIO3 2AWOA 3I7FA 1F9QA 5FO7B 3JAMi 3S14H 4A3IB 1IW7C 1T5XD 2UXCL 4CDEC 3P75A 2OTJA 3R2TA 3NXWA 5CV8A 3KF6B 1E22A 2ZXRA 2JQOA 1NY4A 1V1PB 3UE1A 5LMUQ 2UUCL 2RDGA 3LNNA 3OIQA 1XMOL 4K5WA 3I4MB 2FMCA 2GVBA 1VMCA 4DV4L 1Y1WH 1YHQA 4J6HA 1Q86C 4DK6C 5K5PA 3K6OA 4NXNQ 3I4MG 1ESRA 2H4OA 2NZHA 2QF7A 1HFGA 1QG7A 4FVMA 1N33Q 1OTCA 3H94A 5GAEC 4NB3A 2XSCA 4IOAA 1FD7D 1E7ZA 4QGUA 4F87A 1X56A 4M1UB 2DUDA 5IP9G 1SNCA 3GTMH 3PO2G 3PV0A 5LMNW 5BR8Q 2DY8A 3I55A 4DV3L 4L5RC 1JOQA 2J7ZA 2JJQA 2PW7A 4ZAIA 3GP7A 2ZJPA 2CVRA 1CA6A 4K2KA 4OIJA 2I5LX 2RCFA 4AIMA 4BBRG 1IBLL 1GVPA 2SDFA 3U4ZA 1X3QA 1IBKL 2K28A 3M9BA 3A5ZB 5C44H 2QEJC 3S2HH 1IYUA 2EE1A 4FF1A 1N34L 1I3QH 4IFDH 4CJ0B 3FPPA 2UUAL 1N32L 1KNAA 3T1HL 4JG2A 1SXTA 5M5WB 2F0FA 1ET9A 2LXKA 2QEXA 1YVCA 1X3FA 3TEHB 4I7ZC 3RR5A 3QWNA 3AB9A 3SHLA 1G91A 1H9RA 4DUYQ 3U50C 4OWWB 4DV0L 1QE6A 2JEAI 1WTRA 4A3CG 4LF5L 1PYWD 5A2QE 2Z4IA 1CQFA 4JI6Q 4DA2A 1XYIA 3A8KE 2JA7H 2YU9B 3LX0A 1Q46A 4BY7H 2F0KA 2AHOB 3CQZB 3MWYW 1SYFA 2B2UA 4IPGA 2A69C 4X62Q 4CDCC 2NB0A 2P5ZX 5C4ZA 3J81E 1KTKA 1STHA 3L9AX 3PIPA 2R61A 2LS01 1TR5A 2ZJRA 2OCEA 1SRUA 1I6VC 5D3DA 3AEVA 1R4PB 4KKTA 5GQOA 1HZCA 1PTOF 1B9NA 3H91A 1IBLQ 4A3GG 1AE3A 3VR3A 5M5YB 2ENBA 2JA9A 3RN2A 1RTOA 1UUPA 4H13C 1VQ5A 2OF1A 3QOJA 4IN3A 5C0XG 4LF9Q 3PO2B 3ULPA 4K6DA 3J80i 5LL6X 1JJ2A 4NP5A 4A3KH 4A93B 2WAQE 3PUWA 2D0PA 4LFBQ 3LWUA 1YI2A 1RL2A 3KK7A 3TDQA 3T16A 3AFPA 2A6EC 1CSPA 3WWVA 1KAAA 2EY1A 3ERSX 1AZPA 5M3FB 4M8AA 4A3EH 1BNZA 2B2VA 1A6XA 5EKIA 3VA5A 2J0TD 5FLXE 3GTJB 2M00A 1VQ8A 4KLKA 2L1BA 4KHPQ 2SOBA 4DU9A 3CF5A 4IURA 4HSPA 2WACA 2AUKA 1R4QB 4HJ8A 5FK9C 1K8AC 3DEPA 1EOTA 3RZDH 1BBWA 2B63B 4LUOA 1VQMA 2HD3A 1C4QA 5IYBG 2A8VA 1NMGA 4B9XA 1L1OA 2CH4W 4OHJA 5KNDA 3BVGA 2O4XA 1JJGA 4A3MH 1S5FD 2E75C 3J7AF 4DR6Q 3Q24A 1CT1D 1XJVA 1QZGA 2JA6B 1C0AA 4POGA 3MXNA 2LSSA 3N6RA 4HJ9A 1S5CD 3TMEA
chains in the Genus database with same CATH topology
1A0IA 2BA1A 1KC8C 2QA4A 4JI2L 1XNQL 1PA6A 3KYHC 1W3SA 3PCOB 1X55A 5M3MG 4LFAL 4DR4Q 3K80C 1PH6A 2UXBQ 1J6QA 1LYLA 4ME3A 3AQQA 5AJ3L 1Z47A 2VL6A 4QQBX 3F1ZA 5C4JH 3M85A 4BY1G 5M5XH 1C7YA 4B3RL 2ZTEA 4YWMA 1PVOA 4O2DA 2VW9A 4DV1Q 2VQEL 2R92G 3TS2A 5IYDH 5IY0A 3T1YQ 4PG3A 4POFA 2ZM6Q 2JA5G 4JCVE 2K14A 3KLWA 1OXUA 4LFAQ 3A5UA 4DR4L 4DV6L 4H02A 2RHSB 4PZ8A 3TRZA 2R7ZG 3ULLA 4DR7Q 3HOVG 1PYSB 3FKIG 1PYBA 2B3GA 2EXDA 2UUAQ 4AQYQ 3NBHB 5DLQE 4DV5Q 3D0FA 1L1OC 4PZ6A 2BH2A 1TWFH 4O0AA 1FJGL 1FJGQ 4NXML 2MNAA 3B6YA 4DV4Q 2B63H 1I6HH 1N36L 3S24A 4HIOA 3GTOH 1DGSA 3PF5A 4JI4Q 1HNWL 4DUYL 1IBML 1I5FA 2VQFQ 1IYJB 2OTLA 1SROA 2RF4A 3SGIA 3F8TA 1EUJA 4YWKA 4LFCQ 4WJ3M 1QVFA 1ASYA 2ATWA 4LF4Q 1HR0W 3UDFA 4NXMQ 1WCMH 2R7DA 1J5EQ 1VQIA 3HOXG 2KENA 4MTNA 5IWAL 3GDEA 2CKZB 3M7NA 4IJHA 1KIXA 2E8GA 4JI3Q 4KHPL 4LF8L 2AWNA 3CW2C 2K52A 1K83H 2KHIA 2E5LL 2WB1E 5HGQA 4XIGS 4GOPA 4A93H 1V43A 1KXLA 4DV2L 4K0KL 3AYHB 4JOIC 1UE7A 1LTLA 4DV7Q 2PNHA 4A3JG 1SFOH 4OONA 4A3CH 4A3GH 2E5LQ 3KF8B 4OWTB 2UU9Q 4LF5Q 3EIVA 1R9TH 1XPOA 1D7QA 4L5SA 3STBC 1GD7A 2XGTA 3KJPA 2JA8H 2F4VL 3CCSA 1C9OA 1S40A 1NTGA 3ZJYC 3BJUA 1JJCB 1YHAA 2ID0A 3GD7A 5IP9H 3KF6A 4DV0Q 5GADC 2UXBL 4R4CA 4TVAB 1GKHA 1Y1VG 1VQJA 1Y1VH 3S1MH 4APVA 2ZTCA 5BR8L 3A74A 4YY3Q 1N9WA 1BBUA 2IX0A 2YTYA 1HZAA 2Q2UA 5IYDG 4LF6Q 4IFDJ 5JJKA 1E24A 2HHHL 2HIXA 1HNWQ 3GTKH 3CCLA 3PF4A 5IYCG 1EIFA 3FKIH 4X66L 1PH5A 2I0QA 1T9HA 2JK8A 4ALPA 1A62A 3J7A5 3G4SA 4UY8C 1PH8A 2NVQH 1VQOA 4DR5Q 5M3FH 1PH7A 4KHZA 1UWVA 1VQFA 1Y14B 3KDFB 4AQYL 1YITA 2E2JH 3UDXA 1X3EA 4EQ5A 1P8LA 3GTQH 3ICEA 3H15A 1K0RA 2Q2TA 2I5MX 3CCUA 5HY6A 2UXDQ 2KHJA 2H5XA 1Q1BA 1OXXK 4JI7Q 2ASBA 2IX1A 4GOPC 3PO3H 4DUZQ 5LMNQ 4A75A 3STBD 4DR1Q 4BBSH 4GKKL 4YCWA 4JOIA 1Q12A 3RLFA 1W2BA 1PH9A 1E1TA 4B3TQ 5LMNL 4GKKQ 2F52A 1KL9A 4JYAQ 4LFBL 4GN5A 1ASZA 4TQUS 1GO3E 4YHHL 2KCMA 3D31A 1VCIA 5FLMG 3NENA 1E3PA 2F4VQ 1IZ6A 1PV4A 1N33L 3F2DA 3CCJA 3OYYA 1EOVA 2MO0A 3PO3G 1EIYB 4LF8Q 4LUZA 5EAYA 1HNZQ 3UDIA 3RNUA 5JJLA 3KFUA 3HOZH 4JV5L 5JEAG 1QZHA 3M3YH 1U0LA 4K0KQ 1X54A 1Q81C 4JBMA 2OQKA 1I50H 3EN2A 1X9NA 3I4NH 4NPSA 4JI8Q 4HIKA 4LF4L 2XTIA 4DPGA 1FGUA 3E9HA 1HNXQ 3W1GA 4A3DG 1A8VA 3A0JA 3J7ZC 4QJFA 3PIOA 2Z6KC 4HJAA 3S1RH 1JMCA 1JB7A 3FP9A 5FJ8G 1YJ9A 3CC2A 3KOJA 2RCNA 3TQYA 3CCRA 1P16A 2N3SA 4DKAC 4HJ5A 2YU9H 1IXRA 4OO1I 1XTDA 2NN6I 3K81C 3CXCA 1XMQL 4BY1H 1B7YB 1WCMG 2K5VA 4GOPB 5J3BA 1VQ7A 4X62L 4X6AH 4R4TA 1EWIA 4LUVA 2IHEA 5LMUL 2GVAA 4JI5L 1S3OA 2AKWB 1CSQA 3TREA 3HFZB 3CPWA 4GNXC 1HZBA 2KCTA 1IBKQ 4A3FG 4A3FH 3JC66 1VQNA 4X66Q 3CC4A 4YCVA 4X64Q 3UDGA 1VQBA 2NZOA 4P73A 1WYDA 1YJWA 2JA6G 2OWOA 3W5OA 1VQ6A 1X65A 4QL5A 3H3VH 5ELNA 3I56A 2VY3A 2RHQB 1Q82C 2R7ZH 1JE5A 1KRTA 1V1QA 4JBKA 4IFDI 3I2ZA 2AMCB 4JI1Q 4JBJA 4AYBG 4FDBA 4GLXA 4BBRH 5JEAJ 3K0XA 3KJOA 4LFCL 4JI1L 1WOCA 4BBSG 3G48A 1Z9FA 5C4XG 5IYBH 4DK3C 2HIVA 1X3GA 2CFMA 4OO1G 4LNQA 3LGJA 1TWHH 2N78A 3GTJH 2NVTH 2JA6H 5IT9c 2DGYA 1XPUA 1TWCH 4R4IA 3HOVH 4JI7L 1BKBA 1OXVA 1VQPA 2B63G 3L7ZC 1UE1A 2WFWA 3CC7A 1PH1A 4LF9L 2Y0SG 4PZ7A 3HOYH 5GROA 2GN5A 2MFIA 1MIUA 4GN3B 2HT1A 4UPAA 2JA7G 2VQFL 3BU2A 3S2DH 3MEFA 4GN4B 3J80c 4J15A 2JEBI 3J81i 3HKSA 3OW2A 2L15A 4X64L 1MKHA 2QGQA 4C3IH 1FL0A 3HOUG 2MO1A 4YCUA 3PUXA 1J5EL 3H0GH 4IJLA 1OXTA 5IP7G 3K7AH 4DV6Q 1VQ9A 2HHHQ 4OXPA 4A3IH 4IPDA 3CMAA 3H3VI 1G291 3PO2H 5IYCH 3OTOQ 2EIFA 2VZAA 1G6PA 3T1HQ 1GM5A 3JAMc 1LUZA 4DAMA 2YV5A 2KBNA 2R7FA 4JC0A 4OWXB 4YY3L 5GAHC 5C3EH 1YJNA 1K8GA 1EYGA 4B3RQ 1VQLA 1Q1EA 1XMQQ 2VUMH 4KI0A 4Y52H 2Y0SE 3VDYA 1I94L 3W1BA 4JI8L 4EX5A 1A63A 4A3DH 5C44G 5H1SE 1NBWA 4DAYB 2VQEQ 3FHWA 4L5QA 1NMFA 2NVXH 3HOWH 4IFDG 5M3MH 3G6EA 5K36G 1HNXL 3NELA 3PGZA 4GLVB 3KDFA 1RIPA 4DR3Q 3CP0A 4X65Q 4GLAC 4DV7L 5IE8A 4DV2Q 2YTXA 3RLOA 3HOUH 3U4VA 2R92H 4DR3L 1CKNB 2BH8A 2PQAA 5E7NA 3EBEA 4R4QA 4C2MH 4A3LG 2YTVA 4A3LH 1CUKA 3HOXH 4DNIA 2CCZA 2YYZA 3CD6A 2AWOA 3I7FA 1K73C 4JI5Q 3JAMi 1VQGA 4P71A 1VQ4A 1V9PA 1WFQA 2C35B 2OQ0A 1EFWA 4LF7L 4DUZL 3S14H 2UXCL 1CKNA 3J81j 4YWLA 2OTJA 2F3IA 2VUMG 4B3TL 2K50A 3KF6B 2UUCQ 1E22A 2JQOA 1NY4A 1OXSC 1YBYA 3BZCA 2HQLA 4MZ9A 3UE1A 1U5KA 2K4KA 1SLJA 2Z0SA 3PSIA 1SN8A 1YZ6A 1IBMQ 2UUCL 1VS0A 5C0XI 2VNUD 1XMOL 2GVBA 2I5HA 2Z6KA 3CAMA 1AE2A 4LWCA 4AYBE 2K75A 4C3JH 4Y7NH 2VS1A 4DV4L 4R1JA 4P74A 1Y1WH 1YHQA 1Q86C 4DK6C 5M5YH 2UXCQ 3MXNB 2UUBQ 5C3EG 4NXNQ 5M5WH 3I4MG 1JT8A 2BA0A 3S1NH 1HNZL 2NZHA 2PI2E 3CCEA 3UE0A 1Q7YC 1VQAA 3IRBA 1N33Q 4BXXH 3GTPH 4GNXA 2IHFA 1HR0L 1OTCA 3HOYG 5FLMH 5GAEC 3HOWG 4NB3A 1HZ9A 1K9MC 4IOAA 3CQZH 1NJIC 1E7ZA 4QGUA 2K5NA 1EQQA 4C3HH 1X56A 3ER0A 2DUDA 5IP9G 1PH3A 4JI6L 1UE6A 1KRSA 3PV0A 3GTMH 3PO2G 1PH2A 4BY7G 4A93G 5LMNW 4A3KG 4GNXB 5BR8Q 5IWAQ 1YHBA 3I55A 2IT1A 1I94Q 2CQOA 3ULJA 4DV3L 4L5RC 1KQSA 1TWAH 2JJQA 1G51A 2ZJPA 1QVGA 4IOCA 3K8AA 2ES2A 1X6OA 4JI2Q 3HKZE 1XNQQ 1BVSA 1L0WA 1QUQB 4RMFA 1VQCA 3OTOL 1MJEA 2I5LX 3K7UC 4AIMA 4P72A 4BBRG 1H95A 3GTLH 1IBLL 1GVPA 3J81c 4OX9Q 1YEZA 3U4ZA 3S16H 4IPCA 2LXJA 1IBKL 3M9BA 3A5ZB 5C44H 3S2HH 1UE5A 1N34L 1LM0A 1I3QH 3Q8DA 1XNRQ 2JA5H 4IPHA 1XMOQ 4QIWE 2CWAA 2FXQA 2UUAL 3F2BA 1N32L 1KAWA 2NVYH 4UP9A 3HOZG 3T1HL 4JG2A 1N32Q 4DR2Q 1EQRA 2ALYB 2WB1G 2JE6I 1IL2A 2LXKA 2QEXA 1FVIA 1YVCA 1QVCA 2Q2HA 2R6GA 1PH4A 1WI5A 1X3FA 3CCMA 3TEHB 4LF6L 2WP8J 4DV1L 1CKMA 4LF7Q 3RR5A 3PUZA 4B3ML 4R4OA 5IP7H 2E2HH 4DUYQ 1VQDA 1KHIA 1D8LA 3U50C 4OWWB 3RN5A 4DV0L 2PI2A 4RG1A 5JJIA 4A3EG 1AH9A 2NN6G 3CPFA 1CKOA 1KD1C 4JV5Q 4OX9L 5M3FG 3M4PA 2JEAI 3CCVA 4A3CG 4B3SL 3NEMA 3M4QA 4LW1A 1N8RC 2UU9L 1HJPA 4LF5L 1VQHA 4JI3L 1Y1WG 3DM3A 4JI0Q 4DR7L 1SMXA 4JI6Q 2A19A 4A3IG 2JA7H 4BXXG 1B8AA 1Q46A 2N49A 4BY7H 5C4XH 2AHOB 4HIDA 2D0OA 4IPGA 4X62Q 2B29A 3RZOH 3M4OH 3PUYA 3PIPA 1K3RA 1TXYA 2ZJRA 2OCEA 1SRUA 5FJ8H 3AEVA 4HIMA 3I4MH 4QY7A 5GQOA 1HZCA 2ZJQA 3RLNA 1IBLQ 4A3GG 3S17H 2R93H 1AE3A 4UP8A 4DR5L 3HKZG 1N34Q 2JA9A 1E1OA 4IO9A 3RN2A 1M1KC 3I4NG 1VQ5A 4BA1I 5GAGC 1NE3A 3S15H 3PUVA 4A3BG 4P75A 1VQKA 1VQEA 1Q8KA 1HH2P 1L1OB 3AFQA 5FLXc 5C0XG 4LF9Q 4GKJQ 3ULPA 4DV5L 3E9IA 3S1QH 1O7IA 3J80i 2PQAB 4DR2L 1JJ2A 4A3KH 2WAQE 1QUQA 3PUWA 2D0PA 4LFBQ 4A4IA 2K5HA 2ZM6L 2WAQG 1YI2A 4L5TA 1M90C 1RL2A 3T1YL 2A1AA 3BZKA 3F2CA 4A3BH 3AFPA 2PMZE 3L2PA 1CSPA 4JI0L 3WWVA 3ERSX 4DR1L 1N36Q 5ELOA 5AJ3Q 2V1CC 3GTGH 4A3EH 3E0EA 3G71A 2UXDL 4GS3A 3TS0A 2UUBL 3CMEA 4YHHQ 4UP7A 4AH6A 4HJ7A 1VQ8A 4KLKA 4XTCS 4DV3Q 3U58A 4JYAL 4KHPQ 1SR3A 4A3MG 4B3MQ 3CF5A 4BA2I 4NXNL 2ZTDA 4HJ8A 1K8AC 1MJCA 3RZDH 4JBWA 5C0XJ 2EQSA 1WJJA 1BBWA 4WJ4A 2D62A 4A76A 2Q2IA 4DR6L 4LUOA 1VQMA 5IYBG 2A8VA 2N8NA 1NMGA 1TWGH 1L2FA 1S72A 1HR0Q 1L1OA 3GO5A 2IY5B 3H0GG 4PMWA 2E2IH 4JI4L 1JJGA 2CWPA 4A3MH 1XNRL 2JA8G 4GKJL 4DR6Q 3DLLA 1B70B 3CCQA 1YNXA 5LMUQ 1XJVA 2R93G 1PFSA 1UEBA 4X65L 1QZGA 2MQHA 4A3JH 1C0AA 4POGA 3I4OA 2LSSA 1YIJA 4B3SQ 4HJ9A 1XPRA 3L0OA 1PHJA 4MNOA 1SE8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A0I A;  2BA1 A;  1KC8 C;  2QA4 A;  4JI2 L;  1XNQ L;  1PA6 A;  3KYH C;  1W3S A;  3PCO B;  1X55 A;  5M3M G;  4LFA L;  4DR4 Q;  3K80 C;  1PH6 A;  2UXB Q;  1J6Q A;  1LYL A;  4ME3 A;  3AQQ A;  5AJ3 L;  1Z47 A;  2VL6 A;  4QQB X;  3F1Z A;  5C4J H;  3M85 A;  4BY1 G;  5M5X H;  1C7Y A;  4B3R L;  2ZTE A;  4YWM A;  1PVO A;  4O2D A;  2VW9 A;  4DV1 Q;  2VQE L;  2R92 G;  3TS2 A;  5IYD H;  5IY0 A;  3T1Y Q;  4PG3 A;  4POF A;  2ZM6 Q;  2JA5 G;  4JCV E;  2K14 A;  3KLW A;  1OXU A;  4LFA Q;  3A5U A;  4DR4 L;  4DV6 L;  4H02 A;  2RHS B;  4PZ8 A;  3TRZ A;  2R7Z G;  3ULL A;  4DR7 Q;  3HOV G;  1PYS B;  3FKI G;  1PYB A;  2B3G A;  2EXD A;  2UUA Q;  4AQY Q;  3NBH B;  5DLQ E;  4DV5 Q;  3D0F A;  1L1O C;  4PZ6 A;  2BH2 A;  1TWF H;  4O0A A;  1FJG L;  1FJG Q;  4NXM L;  2MNA A;  3B6Y A;  4DV4 Q;  2B63 H;  1I6H H;  1N36 L;  3S24 A;  4HIO A;  3GTO H;  1DGS A;  3PF5 A;  4JI4 Q;  1HNW L;  4DUY L;  1IBM L;  1I5F A;  2VQF Q;  1IYJ B;  2OTL A;  1SRO A;  2RF4 A;  3SGI A;  3F8T A;  1EUJ A;  4YWK A;  4LFC Q;  4WJ3 M;  1QVF A;  1ASY A;  2ATW A;  4LF4 Q;  1HR0 W;  3UDF A;  4NXM Q;  1WCM H;  2R7D A;  1J5E Q;  1VQI A;  3HOX G;  2KEN A;  4MTN A;  5IWA L;  3GDE A;  2CKZ B;  3M7N A;  4IJH A;  1KIX A;  2E8G A;  4JI3 Q;  4KHP L;  4LF8 L;  2AWN A;  3CW2 C;  2K52 A;  1K83 H;  2KHI A;  2E5L L;  2WB1 E;  5HGQ A;  4XIG S;  4GOP A;  4A93 H;  1V43 A;  1KXL A;  4DV2 L;  4K0K L;  3AYH B;  4JOI C;  1UE7 A;  1LTL A;  4DV7 Q;  2PNH A;  4A3J G;  1SFO H;  4OON A;  4A3C H;  4A3G H;  2E5L Q;  3KF8 B;  4OWT B;  2UU9 Q;  4LF5 Q;  3EIV A;  1R9T H;  1XPO A;  1D7Q A;  4L5S A;  3STB C;  1GD7 A;  2XGT A;  3KJP A;  2JA8 H;  2F4V L;  3CCS A;  1C9O A;  1S40 A;  1NTG A;  3ZJY C;  3BJU A;  1JJC B;  1YHA A;  2ID0 A;  3GD7 A;  5IP9 H;  3KF6 A;  4DV0 Q;  5GAD C;  2UXB L;  4R4C A;  4TVA B;  1GKH A;  1Y1V G;  1VQJ A;  1Y1V H;  3S1M H;  4APV A;  2ZTC A;  5BR8 L;  3A74 A;  4YY3 Q;  1N9W A;  1BBU A;  2IX0 A;  2YTY A;  1HZA A;  2Q2U A;  5IYD G;  4LF6 Q;  4IFD J;  5JJK A;  1E24 A;  2HHH L;  2HIX A;  1HNW Q;  3GTK H;  3CCL A;  3PF4 A;  5IYC G;  1EIF A;  3FKI H;  4X66 L;  1PH5 A;  2I0Q A;  1T9H A;  2JK8 A;  4ALP A;  1A62 A;  3J7A 5;  3G4S A;  4UY8 C;  1PH8 A;  2NVQ H;  1VQO A;  4DR5 Q;  5M3F H;  1PH7 A;  4KHZ A;  1UWV A;  1VQF A;  1Y14 B;  3KDF B;  4AQY L;  1YIT A;  2E2J H;  3UDX A;  1X3E A;  4EQ5 A;  1P8L A;  3GTQ H;  3ICE A;  3H15 A;  1K0R A;  2Q2T A;  2I5M X;  3CCU A;  5HY6 A;  2UXD Q;  2KHJ A;  2H5X A;  1Q1B A;  1OXX K;  4JI7 Q;  2ASB A;  2IX1 A;  4GOP C;  3PO3 H;  4DUZ Q;  5LMN Q;  4A75 A;  3STB D;  4DR1 Q;  4BBS H;  4GKK L;  4YCW A;  4JOI A;  1Q12 A;  3RLF A;  1W2B A;  1PH9 A;  1E1T A;  4B3T Q;  5LMN L;  4GKK Q;  2F52 A;  1KL9 A;  4JYA Q;  4LFB L;  4GN5 A;  1ASZ A;  4TQU S;  1GO3 E;  4YHH L;  2KCM A;  3D31 A;  1VCI A;  5FLM G;  3NEN A;  1E3P A;  2F4V Q;  1IZ6 A;  1PV4 A;  1N33 L;  3F2D A;  3CCJ A;  3OYY A;  1EOV A;  2MO0 A;  3PO3 G;  1EIY B;  4LF8 Q;  4LUZ A;  5EAY A;  1HNZ Q;  3UDI A;  3RNU A;  5JJL A;  3KFU A;  3HOZ H;  4JV5 L;  5JEA G;  1QZH A;  3M3Y H;  1U0L A;  4K0K Q;  1X54 A;  1Q81 C;  4JBM A;  2OQK A;  1I50 H;  3EN2 A;  1X9N A;  3I4N H;  4NPS A;  4JI8 Q;  4HIK A;  4LF4 L;  2XTI A;  4DPG A;  1FGU A;  3E9H A;  1HNX Q;  3W1G A;  4A3D G;  1A8V A;  3A0J A;  3J7Z C;  4QJF A;  3PIO A;  2Z6K C;  4HJA A;  3S1R H;  1JMC A;  1JB7 A;  3FP9 A;  5FJ8 G;  1YJ9 A;  3CC2 A;  3KOJ A;  2RCN A;  3TQY A;  3CCR A;  1P16 A;  2N3S A;  4DKA C;  4HJ5 A;  2YU9 H;  1IXR A;  4OO1 I;  1XTD A;  2NN6 I;  3K81 C;  3CXC A;  1XMQ L;  4BY1 H;  1B7Y B;  1WCM G;  2K5V A;  4GOP B;  5J3B A;  1VQ7 A;  4X62 L;  4X6A H;  4R4T A;  1EWI A;  4LUV A;  2IHE A;  5LMU L;  2GVA A;  4JI5 L;  1S3O A;  2AKW B;  1CSQ A;  3TRE A;  3HFZ B;  3CPW A;  4GNX C;  1HZB A;  2KCT A;  1IBK Q;  4A3F G;  4A3F H;  3JC6 6;  1VQN A;  4X66 Q;  3CC4 A;  4YCV A;  4X64 Q;  3UDG A;  1VQB A;  2NZO A;  4P73 A;  1WYD A;  1YJW A;  2JA6 G;  2OWO A;  3W5O A;  1VQ6 A;  1X65 A;  4QL5 A;  3H3V H;  5ELN A;  3I56 A;  2VY3 A;  2RHQ B;  1Q82 C;  2R7Z H;  1JE5 A;  1KRT A;  1V1Q A;  4JBK A;  4IFD I;  3I2Z A;  2AMC B;  4JI1 Q;  4JBJ A;  4AYB G;  4FDB A;  4GLX A;  4BBR H;  5JEA J;  3K0X A;  3KJO A;  4LFC L;  4JI1 L;  1WOC A;  4BBS G;  3G48 A;  1Z9F A;  5C4X G;  5IYB H;  4DK3 C;  2HIV A;  1X3G A;  2CFM A;  4OO1 G;  4LNQ A;  3LGJ A;  1TWH H;  2N78 A;  3GTJ H;  2NVT H;  2JA6 H;  5IT9 c;  2DGY A;  1XPU A;  1TWC H;  4R4I A;  3HOV H;  4JI7 L;  1BKB A;  1OXV A;  1VQP A;  2B63 G;  3L7Z C;  1UE1 A;  2WFW A;  3CC7 A;  1PH1 A;  4LF9 L;  2Y0S G;  4PZ7 A;  3HOY H;  5GRO A;  2GN5 A;  2MFI A;  1MIU A;  4GN3 B;  2HT1 A;  4UPA A;  2JA7 G;  2VQF L;  3BU2 A;  3S2D H;  3MEF A;  4GN4 B;  3J80 c;  4J15 A;  2JEB I;  3J81 i;  3HKS A;  3OW2 A;  2L15 A;  4X64 L;  1MKH A;  2QGQ A;  4C3I H;  1FL0 A;  3HOU G;  2MO1 A;  4YCU A;  3PUX A;  1J5E L;  3H0G H;  4IJL A;  1OXT A;  5IP7 G;  3K7A H;  4DV6 Q;  1VQ9 A;  2HHH Q;  4OXP A;  4A3I H;  4IPD A;  3CMA A;  3H3V I;  1G29 1;  3PO2 H;  5IYC H;  3OTO Q;  2EIF A;  2VZA A;  1G6P A;  3T1H Q;  1GM5 A;  3JAM c;  1LUZ A;  4DAM A;  2YV5 A;  2KBN A;  2R7F A;  4JC0 A;  4OWX B;  4YY3 L;  5GAH C;  5C3E H;  1YJN A;  1K8G A;  1EYG A;  4B3R Q;  1VQL A;  1Q1E A;  1XMQ Q;  2VUM H;  4KI0 A;  4Y52 H;  2Y0S E;  3VDY A;  1I94 L;  3W1B A;  4JI8 L;  4EX5 A;  1A63 A;  4A3D H;  5C44 G;  5H1S E;  1NBW A;  4DAY B;  2VQE Q;  3FHW A;  4L5Q A;  1NMF A;  2NVX H;  3HOW H;  4IFD G;  5M3M H;  3G6E A;  5K36 G;  1HNX L;  3NEL A;  3PGZ A;  4GLV B;  3KDF A;  1RIP A;  4DR3 Q;  3CP0 A;  4X65 Q;  4GLA C;  4DV7 L;  5IE8 A;  4DV2 Q;  2YTX A;  3RLO A;  3HOU H;  3U4V A;  2R92 H;  4DR3 L;  1CKN B;  2BH8 A;  2PQA A;  5E7N A;  3EBE A;  4R4Q A;  4C2M H;  4A3L G;  2YTV A;  4A3L H;  1CUK A;  3HOX H;  4DNI A;  2CCZ A;  2YYZ A;  3CD6 A;  2AWO A;  3I7F A;  1K73 C;  4JI5 Q;  3JAM i;  1VQG A;  4P71 A;  1VQ4 A;  1V9P A;  1WFQ A;  2C35 B;  2OQ0 A;  1EFW A;  4LF7 L;  4DUZ L;  3S14 H;  2UXC L;  1CKN A;  3J81 j;  4YWL A;  2OTJ A;  2F3I A;  2VUM G;  4B3T L;  2K50 A;  3KF6 B;  2UUC Q;  1E22 A;  2JQO A;  1NY4 A;  1OXS C;  1YBY A;  3BZC A;  2HQL A;  4MZ9 A;  3UE1 A;  1U5K A;  2K4K A;  1SLJ A;  2Z0S A;  3PSI A;  1SN8 A;  1YZ6 A;  1IBM Q;  2UUC L;  1VS0 A;  5C0X I;  2VNU D;  1XMO L;  2GVB A;  2I5H A;  2Z6K A;  3CAM A;  1AE2 A;  4LWC A;  4AYB E;  2K75 A;  4C3J H;  4Y7N H;  2VS1 A;  4DV4 L;  4R1J A;  4P74 A;  1Y1W H;  1YHQ A;  1Q86 C;  4DK6 C;  5M5Y H;  2UXC Q;  3MXN B;  2UUB Q;  5C3E G;  4NXN Q;  5M5W H;  3I4M G;  1JT8 A;  2BA0 A;  3S1N H;  1HNZ L;  2NZH A;  2PI2 E;  3CCE A;  3UE0 A;  1Q7Y C;  1VQA A;  3IRB A;  1N33 Q;  4BXX H;  3GTP H;  4GNX A;  2IHF A;  1HR0 L;  1OTC A;  3HOY G;  5FLM H;  5GAE C;  3HOW G;  4NB3 A;  1HZ9 A;  1K9M C;  4IOA A;  3CQZ H;  1NJI C;  1E7Z A;  4QGU A;  2K5N A;  1EQQ A;  4C3H H;  1X56 A;  3ER0 A;  2DUD A;  5IP9 G;  1PH3 A;  4JI6 L;  1UE6 A;  1KRS A;  3PV0 A;  3GTM H;  3PO2 G;  1PH2 A;  4BY7 G;  4A93 G;  5LMN W;  4A3K G;  4GNX B;  5BR8 Q;  5IWA Q;  1YHB A;  3I55 A;  2IT1 A;  1I94 Q;  2CQO A;  3ULJ A;  4DV3 L;  4L5R C;  1KQS A;  1TWA H;  2JJQ A;  1G51 A;  2ZJP A;  1QVG A;  4IOC A;  3K8A A;  2ES2 A;  1X6O A;  4JI2 Q;  3HKZ E;  1XNQ Q;  1BVS A;  1L0W A;  1QUQ B;  4RMF A;  1VQC A;  3OTO L;  1MJE A;  2I5L X;  3K7U C;  4AIM A;  4P72 A;  4BBR G;  1H95 A;  3GTL H;  1IBL L;  1GVP A;  3J81 c;  4OX9 Q;  1YEZ A;  3U4Z A;  3S16 H;  4IPC A;  2LXJ A;  1IBK L;  3M9B A;  3A5Z B;  5C44 H;  3S2H H;  1UE5 A;  1N34 L;  1LM0 A;  1I3Q H;  3Q8D A;  1XNR Q;  2JA5 H;  4IPH A;  1XMO Q;  4QIW E;  2CWA A;  2FXQ A;  2UUA L;  3F2B A;  1N32 L;  1KAW A;  2NVY H;  4UP9 A;  3HOZ G;  3T1H L;  4JG2 A;  1N32 Q;  4DR2 Q;  1EQR A;  2ALY B;  2WB1 G;  2JE6 I;  1IL2 A;  2LXK A;  2QEX A;  1FVI A;  1YVC A;  1QVC A;  2Q2H A;  2R6G A;  1PH4 A;  1WI5 A;  1X3F A;  3CCM A;  3TEH B;  4LF6 L;  2WP8 J;  4DV1 L;  1CKM A;  4LF7 Q;  3RR5 A;  3PUZ A;  4B3M L;  4R4O A;  5IP7 H;  2E2H H;  4DUY Q;  1VQD A;  1KHI A;  1D8L A;  3U50 C;  4OWW B;  3RN5 A;  4DV0 L;  2PI2 A;  4RG1 A;  5JJI A;  4A3E G;  1AH9 A;  2NN6 G;  3CPF A;  1CKO A;  1KD1 C;  4JV5 Q;  4OX9 L;  5M3F G;  3M4P A;  2JEA I;  3CCV A;  4A3C G;  4B3S L;  3NEM A;  3M4Q A;  4LW1 A;  1N8R C;  2UU9 L;  1HJP A;  4LF5 L;  1VQH A;  4JI3 L;  1Y1W G;  3DM3 A;  4JI0 Q;  4DR7 L;  1SMX A;  4JI6 Q;  2A19 A;  4A3I G;  2JA7 H;  4BXX G;  1B8A A;  1Q46 A;  2N49 A;  4BY7 H;  5C4X H;  2AHO B;  4HID A;  2D0O A;  4IPG A;  4X62 Q;  2B29 A;  3RZO H;  3M4O H;  3PUY A;  3PIP A;  1K3R A;  1TXY A;  2ZJR A;  2OCE A;  1SRU A;  5FJ8 H;  3AEV A;  4HIM A;  3I4M H;  4QY7 A;  5GQO A;  1HZC A;  2ZJQ A;  3RLN A;  1IBL Q;  4A3G G;  3S17 H;  2R93 H;  1AE3 A;  4UP8 A;  4DR5 L;  3HKZ G;  1N34 Q;  2JA9 A;  1E1O A;  4IO9 A;  3RN2 A;  1M1K C;  3I4N G;  1VQ5 A;  4BA1 I;  5GAG C;  1NE3 A;  3S15 H;  3PUV A;  4A3B G;  4P75 A;  1VQK A;  1VQE A;  1Q8K A;  1HH2 P;  1L1O B;  3AFQ A;  5FLX c;  5C0X G;  4LF9 Q;  4GKJ Q;  3ULP A;  4DV5 L;  3E9I A;  3S1Q H;  1O7I A;  3J80 i;  2PQA B;  4DR2 L;  1JJ2 A;  4A3K H;  2WAQ E;  1QUQ A;  3PUW A;  2D0P A;  4LFB Q;  4A4I A;  2K5H A;  2ZM6 L;  2WAQ G;  1YI2 A;  4L5T A;  1M90 C;  1RL2 A;  3T1Y L;  2A1A A;  3BZK A;  3F2C A;  4A3B H;  3AFP A;  2PMZ E;  3L2P A;  1CSP A;  4JI0 L;  3WWV A;  3ERS X;  4DR1 L;  1N36 Q;  5ELO A;  5AJ3 Q;  2V1C C;  3GTG H;  4A3E H;  3E0E A;  3G71 A;  2UXD L;  4GS3 A;  3TS0 A;  2UUB L;  3CME A;  4YHH Q;  4UP7 A;  4AH6 A;  4HJ7 A;  1VQ8 A;  4KLK A;  4XTC S;  4DV3 Q;  3U58 A;  4JYA L;  4KHP Q;  1SR3 A;  4A3M G;  4B3M Q;  3CF5 A;  4BA2 I;  4NXN L;  2ZTD A;  4HJ8 A;  1K8A C;  1MJC A;  3RZD H;  4JBW A;  5C0X J;  2EQS A;  1WJJ A;  1BBW A;  4WJ4 A;  2D62 A;  4A76 A;  2Q2I A;  4DR6 L;  4LUO A;  1VQM A;  5IYB G;  2A8V A;  2N8N A;  1NMG A;  1TWG H;  1L2F A;  1S72 A;  1HR0 Q;  1L1O A;  3GO5 A;  2IY5 B;  3H0G G;  4PMW A;  2E2I H;  4JI4 L;  1JJG A;  2CWP A;  4A3M H;  1XNR L;  2JA8 G;  4GKJ L;  4DR6 Q;  3DLL A;  1B70 B;  3CCQ A;  1YNX A;  5LMU Q;  1XJV A;  2R93 G;  1PFS A;  1UEB A;  4X65 L;  1QZG A;  2MQH A;  4A3J H;  1C0A A;  4POG A;  3I4O A;  2LSS A;  1YIJ A;  4B3S Q;  4HJ9 A;  1XPR A;  3L0O A;  1PHJ A;  4MNO A;  1SE8 A; 
#chains in the Genus database with same CATH topology
 1SNM A;  4KY5 A;  1A0I A;  1KC8 C;  2KED A;  1Q8I A;  1B44 D;  2OEO A;  1X55 A;  2ICE C;  1WTO A;  3AQQ A;  1SEB D;  2VL6 A;  2JA5 B;  2RSN A;  2HCI A;  3M85 A;  4BY1 G;  1C7Y A;  4O2D A;  4DN4 M;  2VQE L;  5IYD H;  3T1Y Q;  2JA5 G;  4NDX A;  1MI2 A;  1D5M C;  4DR4 L;  2RHS B;  1PTO D;  1JIC A;  3ULL A;  3EFX D;  3V05 A;  3Q23 A;  4DV5 Q;  3CRK C;  3MEH A;  3KBG A;  3VR5 A;  4O0A A;  3P7J A;  1FJG L;  5CV9 A;  2Q8T A;  4DV4 Q;  1I6H H;  1SE4 A;  2G9D A;  4JI4 Q;  2JXM B;  2GA4 B;  3NTK A;  1IYJ B;  1SRO A;  1TWC B;  4X3K A;  3I72 A;  1LT3 D;  2MJ8 A;  1K0S A;  1JWS D;  4NXM Q;  1J9O A;  1VQI A;  3HOX G;  5IWA L;  3M7N A;  1HTL D;  5CYU A;  5EPJ A;  4JI3 Q;  1I4H A;  2L4N A;  2VXW A;  4LF8 L;  4ZUI A;  2AWN A;  2K52 A;  3MFY A;  1NSN S;  2KHI A;  4RH6 A;  4GOP A;  5JVH 3;  1KXL A;  4K0K L;  3EA6 A;  4DV7 Q;  3FDT A;  3KF8 B;  3J7Y W;  2H1E A;  2SEB D;  4RCN A;  2SNM A;  3EIV A;  2D2C C;  2WV6 D;  4RGN A;  2AQ3 B;  2A6H C;  3F2U A;  3CCS A;  1S40 A;  5L37 A;  3QB3 A;  3TP6 A;  5IP9 H;  4BBS B;  1VQJ A;  4APV A;  2ZTC A;  1F2Y A;  5JJK A;  2X6G A;  3GTK H;  3CCL A;  5I6W A;  5IYC G;  2I0Q A;  2M2L A;  1SJE D;  1T9H A;  1XWE A;  1PH7 A;  1U9R A;  4KHZ A;  4AQY L;  3SDZ A;  4C3I G;  1W6K A;  3D3R A;  3S1M B;  2LKV A;  2F0W A;  2A68 D;  4TSS A;  4PNY A;  1OXX K;  2ZXP A;  5KNB A;  2IX1 A;  1H9S A;  4A75 A;  1BF4 A;  3NQI A;  1GOZ A;  4BBS H;  1F9S A;  3KLR A;  4GKK L;  4JOI A;  4H0L C;  4B08 A;  5LMN L;  3N52 A;  4YHH L;  3FRP B;  2KCM A;  3SR1 A;  1IZ6 A;  4IUN A;  1PV4 A;  1WTW A;  3KLS A;  1EOV A;  4HED A;  1EIY B;  4LF8 Q;  5EAY A;  1HNZ Q;  3NTI A;  5C4J B;  3UDI A;  1LAB A;  1HHV A;  2NTT A;  1U0L A;  3EN2 A;  3I4N H;  4NPS A;  2B2Y A;  3W1G A;  1A8V A;  4QJF A;  5KEE A;  2Z6K C;  1EU3 A;  1XX8 A;  3FKI B;  3PIO A;  4HJA A;  1ICW A;  1P16 A;  2N3S A;  4DKA C;  1IXR A;  3I70 A;  5IT9 L;  1B7Y B;  1RCV D;  1XXG A;  3IFT A;  1VQ7 A;  5ELB A;  4LJZ C;  4CGY B;  2CH4 A;  3VR6 A;  1EY5 A;  1V8Q A;  3MA2 B;  2KCT A;  5NUC A;  3HZX A;  2LY7 A;  3JC6 6;  1FGB D;  1TWA B;  4ZYS A;  1HCZ A;  3T53 B;  1D6E C;  2NZO A;  1SDF A;  1WYD A;  1YJW A;  3M7G A;  2JA6 G;  3WDN A;  3K57 A;  3H6M A;  1Y8P B;  1Q82 C;  5CC4 A;  1JE5 A;  1V1Q A;  3I2Z A;  2X69 A;  4JBJ A;  3TN2 A;  3K5O A;  1V1O A;  5CBE E;  3K0X A;  4LFC L;  4V0B A;  4JI1 L;  1Z9F A;  3AMU A;  4C3J B;  3LGJ A;  1TWH H;  4A3J B;  4R4I A;  2IL8 A;  1UE1 A;  1PH1 A;  2EJF C;  4GN3 B;  3G7L A;  3BU2 A;  2VQF L;  4GN4 B;  2AQ2 B;  3OW2 A;  2L15 A;  4X64 L;  4K5V A;  2VB2 X;  4ULL A;  3C46 A;  2MO1 A;  4YCU A;  1J5E L;  1EQT A;  4IJL A;  1XTC D;  3K7A H;  4DV6 Q;  1ONL A;  4IPD A;  3VR2 A;  3OTO Q;  4C3H G;  2DN8 A;  2Z4H A;  1G6P A;  3HOZ H;  2CW0 C;  5C3E H;  2YV5 A;  1YJN A;  4OWX B;  1K8G A;  3E6Z X;  4ZLT F;  4CBV A;  2Y0S E;  1I94 L;  3W1B A;  3LWE A;  4EX5 A;  1H9K A;  5H1S E;  1F2M A;  3FHW A;  1BO0 A;  3S1N B;  5K36 G;  5C4X B;  2O5J C;  3PGZ A;  4DR3 Q;  2I46 A;  2JYO A;  3CP0 A;  4X65 Q;  3D6C A;  3RZO B;  1YNN C;  2M9V A;  4ZUJ A;  2WAQ B;  1SJH D;  3U4V A;  2R92 H;  5E7N A;  2PQA A;  2PQE A;  2B2U C;  4R4Q A;  3BG3 A;  4A3M B;  4EQO A;  5IGG A;  1CK1 A;  4A3K B;  3PMF A;  3CD6 A;  2K05 A;  4JI5 Q;  1BUV T;  4LF7 L;  1V9P A;  2OQ0 A;  5LL6 S;  5KYI A;  4YWL A;  1RD9 D;  5FO9 B;  3MXU A;  4QF4 A;  4B3T L;  4MTK A;  1OXS C;  1STB A;  1B3A A;  1AN8 A;  3OOC A;  2Z0S A;  1SLJ A;  5G3L F;  5C0X I;  2I5H A;  3CAM A;  4LWC A;  4AYB E;  4DXF A;  4R1J A;  4P74 A;  1F9P A;  5M5Y H;  3HG9 A;  1STE A;  2PCF B;  2XIW A;  3SK5 A;  4EQN A;  5G3L D;  1ZEQ X;  3GTP H;  2IHF A;  3HOY G;  3HOW G;  3WOF A;  1K9M C;  1LTR D;  2IWH A;  1NJI C;  2AQ1 B;  1EQQ A;  1DYQ A;  2LFN A;  2N55 A;  1KRS A;  4DXG A;  4JI6 L;  1I3Q B;  1PH2 A;  1JB3 A;  4GNX B;  1K8O A;  2EDG A;  2IT1 A;  3NHH A;  1JCK B;  3DM1 A;  1TWA H;  1G51 A;  4O42 A;  4IOC A;  1X6O A;  5DNF A;  2ZT9 C;  1XNQ Q;  1L0W A;  4RMF A;  1PFN A;  3GTL H;  2RSO A;  3J81 c;  1YEZ A;  3OMG A;  5CV6 A;  1UE5 A;  3GTP B;  1LM0 A;  3M4O B;  2JA5 H;  3CHB D;  4EVO A;  2FHT A;  2FXQ A;  3RUZ A;  3F2B A;  5ELD A;  1KAW A;  1N32 Q;  4DR2 Q;  2ALY B;  2JE6 I;  2R6G A;  2Q2H A;  2WP8 J;  4X3U A;  4LAA A;  2HDL A;  4BY7 B;  4RHR A;  5IP7 H;  3VA7 A;  1PMR A;  3BYY B;  2PI2 A;  3SK6 A;  5JJI A;  1JE4 A;  1HUM A;  2N88 A;  3W2D A;  1ENC A;  5ISR A;  1KD1 C;  4OX9 L;  1ENF A;  3M4P A;  4JV5 Q;  2D5D A;  4B3S L;  2FIN B;  1HJP A;  4X3S A;  4DR7 L;  5BN4 A;  4IUU A;  2K5D A;  2A19 A;  1D1I A;  3MXG A;  2N49 A;  2PW5 A;  2E76 C;  2FJ2 A;  4K5X A;  3R2I A;  1EY4 A;  1B2T A;  2IJ0 A;  3C1F A;  5M9O A;  3RZO H;  1WCM B;  3NWS A;  1KLG D;  1K3R A;  1Q3L A;  3HKZ B;  1EYA A;  2KJX A;  1WTQ A;  1SYE A;  3I4M H;  5A35 A;  2L12 A;  4DR5 L;  3HKZ G;  3I91 A;  3I4N G;  1YNJ C;  3PUV A;  1BCP B;  1NUC A;  2F0M A;  4P75 A;  1VQK A;  1ROD A;  1VQE A;  1R9T B;  4IUQ A;  1L1O B;  3AFQ A;  3E0J A;  1GUN A;  5EKK A;  5FLX c;  1FNV A;  3HEJ A;  4JPB W;  3C1E A;  4DV5 L;  1QWY A;  2PQA B;  1QUQ A;  5D14 A;  1SSO A;  2PYK A;  2A5H A;  4A4I A;  1NAP A;  2K5H A;  2WAQ G;  1HA6 A;  5DM7 3;  3T1Y L;  2A1A A;  4A3B H;  2BOS A;  2R93 B;  4R9W A;  3OWE B;  2A6E D;  1ILQ A;  1SYB A;  4G57 A;  5ELO A;  1G2S A;  2WII B;  1PXU A;  1SND A;  3E0E A;  2UXD L;  3I3C A;  2NVY B;  2UUB L;  2XN9 C;  3BDL A;  3A7L A;  5C3W A;  4UP7 A;  4IUV A;  3TP7 A;  3E5S A;  4JYA L;  2ICI A;  1VF7 A;  4A3M G;  1TWF B;  1QNK A;  4JBW A;  2EQS A;  3JAM L;  2EY2 A;  4F8M A;  4A76 A;  4DR6 L;  2QW7 A;  2N8N A;  1L2F A;  2Z8L A;  1S72 A;  1HR0 Q;  1EY8 A;  4C3I B;  1U4R A;  4K6L A;  2IY5 B;  3H0G G;  2E2I H;  2CWP A;  2JA8 G;  2FMM A;  3R93 A;  3HOY B;  2WB1 B;  3K5L A;  3CCQ A;  5D3I B;  1UEB A;  2DY7 A;  5JAV A;  4A3J H;  3OIP A;  5DEH A;  2EYF A;  4DK0 A;  4MNO A;  5I2Y A;  4L6T B;  2BA1 A;  2QA4 A;  3J80 E;  1XNQ L;  2A6H D;  3KYH C;  1EY9 A;  1W3S A;  5M3M G;  2L9H A;  4LFA L;  2UXB Q;  4C3J G;  1PH6 A;  1PTO B;  4ME3 A;  1CHP D;  1Z47 A;  3F1Z A;  5C4J H;  3QOL A;  3W3A A;  4B3R L;  2ZTE A;  4DV1 Q;  3TS2 A;  5IY0 A;  2VUM B;  2B2W A;  4X3T A;  4ZK9 B;  4RFB A;  1II3 A;  3J81 L;  4DR7 Q;  2O2L D;  3FKI G;  1CM9 A;  1PYB A;  5DLQ E;  4ODG A;  1TII D;  1L1O C;  2HDM A;  2BH2 A;  4KK7 A;  3G6J B;  4DF7 A;  2B63 H;  3MC0 B;  1HA5 A;  3GTO H;  3NPP A;  1DGS A;  3PF5 A;  1HNW L;  3FMC A;  3NBI A;  2MGS A;  2VQF Q;  1BQQ T;  4BS9 A;  2OTL A;  1QJO A;  2NVT B;  2V4D A;  2ATW A;  1C48 A;  1WCM H;  2NUC A;  1TS5 A;  2B8G A;  2XRQ D;  2NWG A;  1WTX A;  4FXK C;  1DM0 B;  2E5L L;  2B2T C;  3D6W A;  1V43 A;  4XQQ A;  1UE7 A;  1ZYR D;  5HUR A;  2PNH A;  5C44 B;  1CA5 A;  4OO1 H;  2E5L Q;  4OWT B;  4LF5 Q;  3HS0 C;  1R9T H;  1XPO A;  4L5S A;  4IAL A;  2F3V A;  5I6Y A;  5EJW A;  3KF6 A;  4DV0 Q;  2F0I A;  1A3T A;  3MVV A;  4TVA B;  1Y1V G;  1Y1V H;  2B39 A;  5IOD A;  3A74 A;  2WKC A;  3HGB A;  4K8J A;  1ESF A;  2IX3 A;  2IX0 A;  1ET6 A;  1MSH A;  1TS4 A;  2HHH L;  2EYJ A;  1HNW Q;  2BDO A;  4RHS A;  4KMU C;  3V96 A;  4X66 L;  1PH5 A;  2JK8 A;  1D5X C;  2Z9H A;  1CTM A;  4KHV A;  4KN7 C;  1EYD A;  1VQO A;  5M3F H;  5KGU A;  1UWV A;  1VQF A;  1Y14 B;  4UDU C;  5ELF A;  1RKN A;  1JQY D;  4XDX A;  1P8L A;  1K0R A;  4FXG C;  1Y69 U;  4FXD A;  2UXD Q;  2H5X A;  1Q1B A;  4GOP C;  4N8X 1;  4J1M A;  4YCW A;  3RLF A;  1W2B A;  1A3V A;  1PH9 A;  4B3T Q;  3IKJ A;  5CBA E;  3NBH A;  1STN A;  2FFK B;  4GN5 A;  2K5Q A;  2DNC A;  4NMZ A;  1PLF A;  3PO3 G;  2F0J A;  2RQX A;  4MN3 A;  4L8J A;  4LUZ A;  1QZH A;  4JBM A;  2OQK A;  3A54 A;  1X9N A;  4HIK A;  1QCB D;  2XTI A;  4IQZ A;  4A3D G;  3A0J A;  3J7Z C;  5FJ8 G;  1YJ9 A;  3CC2 A;  3KOJ A;  4RCO A;  2RKS A;  2F0V A;  4ZKC B;  4A3D B;  1ZYR C;  4O1N A;  3CXC A;  2OT2 A;  4X6A H;  1B50 A;  4R4T A;  5LMU L;  3TSS A;  2GVA A;  3HOZ B;  4KN4 C;  3SK8 A;  3QR8 A;  3CPW A;  4QIW B;  1K8M A;  3KUP A;  1EWC A;  2A69 D;  2VB3 X;  2JA8 B;  1STA A;  1VQN A;  4X66 Q;  1K83 B;  3VYS A;  4X64 Q;  1O7Y A;  3UDG A;  1VQB A;  4HCE A;  1B3Q A;  4QL5 A;  3H3V H;  4KD4 A;  2C5C A;  2VY3 A;  2RHQ B;  3QG1 A;  3I56 A;  1KRT A;  2AMC B;  5J1Z A;  1G8Z D;  4FDB A;  2BE5 D;  5JEA J;  1ENA A;  4KJN A;  2K01 A;  1WOC A;  3GTG B;  2HIV A;  5C3X A;  2CFM A;  4B9W A;  3GTJ H;  2DGY A;  1XPU A;  1BKB A;  1LTG D;  2B63 G;  3L7Z C;  2WFW A;  4AYB B;  2Y0S G;  3CRL C;  2GN5 A;  2MFI A;  1MIU A;  2HT1 A;  4BXX H;  3J81 i;  3BDC A;  3DWP A;  4C3I H;  1TWG B;  2KVM A;  1OXT A;  3HRZ C;  1FYC A;  4OXP A;  3CMA A;  3H3V I;  3PO2 H;  5IYC H;  2VZA A;  3JAM c;  4IZ8 A;  2HCC A;  5I4D A;  3I4L A;  1GHK A;  4JI8 L;  1A63 A;  1EEF D;  5C44 G;  3P20 A;  2VQE Q;  4WFN 3;  4IFD G;  2O5I C;  1PTO H;  3QJY A;  1KAB A;  1O7L A;  3G6E A;  1NNX A;  3GTK B;  3KDF A;  2J4X A;  3FPU B;  2RDF A;  4GLA C;  4DV7 L;  4DV2 Q;  5FOB B;  4L63 B;  1LAC A;  3VR4 A;  1K28 A;  1Y1V B;  4A3L G;  4A3L H;  1U4P A;  2YYZ A;  1K73 C;  2A74 C;  1VQ4 A;  3HOV H;  1WFQ A;  2C35 B;  4DUZ L;  1CKN A;  2BDN A;  3H0G B;  2F0O A;  2F3I A;  3Q22 A;  3S2D B;  3HOV B;  2EYP A;  3QIA A;  3BZC A;  4RGO S;  1YBY A;  2K4K A;  4G7H C;  1IBM Q;  2K5W A;  1SN8 A;  1YZ6 A;  4YIJ A;  1IYV A;  3MZ5 A;  3ERO A;  1AE2 A;  2K75 A;  3MXN B;  2EPB A;  4KTA A;  2NVQ B;  5M5W H;  1STG A;  2EYM A;  1JT8 A;  2BA0 A;  5M3M B;  2E74 C;  1Q7Y C;  1VQA A;  1IW7 D;  1DXM A;  4OIK A;  1HR0 L;  2RBM A;  1TQO A;  3CQZ H;  5E3F A;  3SK4 A;  1GUS A;  4C3H H;  2PZW A;  3ER0 A;  1PH3 A;  1UE6 A;  4FNF A;  4N9T A;  4A93 G;  4KKS A;  1YHB A;  4IUP A;  1I94 Q;  2CQO A;  3ULJ A;  1KQS A;  5BN3 A;  1LTI D;  1E0B A;  3OMC A;  1QVG A;  1PRT C;  4JI2 Q;  2JN4 A;  3HKZ E;  3X3N A;  1WVL A;  3S14 B;  2KHS A;  1QUQ B;  2DJG C;  3OTO L;  1MJE A;  4IUT A;  4CDF C;  1H95 A;  3PO3 B;  2F4I A;  1UAP A;  4OX9 Q;  3S16 H;  2LXJ A;  2R92 B;  1WTV A;  3Q8D A;  1XNR Q;  4HR7 B;  4IPH A;  3ZYY X;  1B1Z A;  2CWA A;  1NR2 A;  3HOZ G;  1EQR A;  2WB1 G;  1B53 A;  3OHX C;  2Q8R E;  1PH4 A;  1FVI A;  1D5Z C;  1IKM A;  1WI5 A;  3D4D A;  3DHQ A;  4ZQ3 A;  4R8N A;  4WRD A;  4DV1 L;  1CKM A;  4LF7 Q;  5EGT A;  2EJM A;  4B3M L;  1CHQ D;  1VQD A;  1KHI A;  4PMC A;  3RN5 A;  1BBX C;  4RG1 A;  1DD2 A;  2NN6 H;  2NN6 G;  1CKO A;  2ZXO A;  1PDQ A;  5M3F G;  3CCV A;  4KKU A;  1O78 A;  4LW1 A;  1N8R C;  2UU9 L;  5CGK A;  1Y1W G;  3DM3 A;  4C2M B;  1EEI D;  4KV6 A;  1EWH A;  1SMX A;  4A3I G;  4BXX G;  2K6A A;  1B8A A;  1GHJ A;  4HID A;  3U9O A;  2BCO A;  3K59 A;  5IGC A;  3SEB A;  3I4N B;  3L3O C;  5J39 A;  1TXY A;  4DAV A;  5EBC A;  1DZ1 A;  3I90 A;  2ZJQ A;  4A3B B;  1BOS A;  2R93 H;  3S17 H;  1AP0 A;  2QDB A;  1N34 Q;  3O13 A;  4XXE A;  1M1K C;  1EY7 A;  4A3B G;  3H3V C;  1Q8K A;  4HTH A;  5COY A;  3J80 L;  3S1Q H;  3E9I A;  1SFO B;  4DR2 L;  3OPO A;  4XT1 B;  3DWA A;  1EL0 A;  4BY1 B;  1X3P A;  2ZM6 L;  3HOX B;  5CMD A;  4L5T A;  4NW2 A;  1M90 C;  3BZK A;  3L2P A;  1HQR D;  2TSS A;  1RDP D;  4G4K A;  2OXP A;  2KEE A;  2V1C C;  4LK1 C;  3GTG H;  3G71 A;  4BBR B;  1E2Z A;  4GS3 A;  3TS0 A;  3CME A;  4HJ7 A;  4XTC S;  1SR3 A;  4B3M Q;  4EQP A;  4BA2 I;  4NXN L;  2ZTD A;  1MJC A;  1JC7 A;  1WJJ A;  4WJ4 A;  1PRT B;  2Q2I A;  2QCP X;  5LHY 1;  3S1Q B;  1TWG H;  4QMG A;  2G5D A;  3GO5 A;  4XT3 B;  5KIX A;  1EQV A;  1EY6 A;  1XNR L;  1V1P A;  1HTP A;  4KJO A;  4OEM B;  3S9W A;  2E2H B;  3DLL A;  1F77 A;  1YNX A;  4TKO B;  2MQH A;  4E6I A;  3I4O A;  1SBB B;  1YIJ A;  4B3S Q;  1PHJ A;  1G6Z A;  2F0L A;  1PZK D;  1I4Q A;  4JI2 L;  1PA6 A;  4C1N I;  3E3X A;  3U9S A;  3HP3 A;  3K5M A;  5K36 H;  3K80 C;  1J6Q A;  1QOH A;  5AJ3 L;  4A3E B;  2MUY A;  3VYT A;  1LT5 D;  3BVM A;  4ZRZ A;  1FNW A;  2XWJ B;  1A2U A;  2L5T A;  3A5U A;  1OXU A;  4LFA Q;  3OSO A;  4H02 A;  1PFM A;  2PMZ B;  4PZ8 A;  3TRZ A;  2K32 A;  1PYS B;  1GUG A;  2B3G A;  2EXD A;  4AQY Q;  3NBH B;  3D0F A;  2F0D A;  3UI2 A;  3BDO A;  5IIF A;  4PZ6 A;  1TWF H;  1SYD A;  1C8C A;  1FJG Q;  3B6Y A;  5EQ0 A;  1EYC A;  4DUY L;  1IBM L;  4FO2 A;  1TY2 A;  1I5F A;  4CKC A;  1H9M A;  1LT6 D;  2RF4 A;  3F8T A;  4WJ3 M;  1PTO C;  1QVF A;  1ASY A;  4LF4 Q;  5JOB A;  1I4X A;  3UDF A;  2R7D A;  1J5E Q;  3A7A B;  4DFA A;  4MTN A;  1Q90 A;  5I9P A;  4IJH A;  1I4P A;  1KIX A;  1GUT A;  2E8G A;  5CV7 A;  1FR3 A;  1Y1W B;  1K83 H;  4HCS A;  4UAI A;  4CJ2 C;  3GTL B;  3GTO B;  4QCL A;  2WB1 E;  1SYC A;  3A56 A;  1AEX A;  4DV2 L;  5IT9 E;  5KYL A;  5C5L A;  3AYH B;  4JOI C;  4A3J G;  1LTL A;  1SFO H;  4OON A;  4K14 A;  1EIH A;  1D7Q A;  3STB C;  1UNS A;  1C9O A;  1VDZ A;  3ZJY C;  5BN5 A;  2KQ3 A;  2B2V C;  3GD7 A;  2UXB L;  3GTM B;  2EJG C;  4QB4 A;  5C5M A;  5IOC A;  5BR8 L;  1N9W A;  5E1F A;  4Q5V A;  2YTY A;  2XRS D;  5IYD G;  4LF6 Q;  4IFD J;  1E24 A;  2HIX A;  4C3H B;  4N9P A;  1EIG A;  3FKI H;  1I4R A;  3TZD A;  3M3Y B;  4I7A A;  4UY8 C;  1PH8 A;  4DR5 Q;  4C56 C;  5IGF A;  3KLS X;  1I50 B;  3KDF B;  1S5B D;  1KDA A;  2F3W A;  1X3E A;  3UDX A;  3GTQ H;  3H15 A;  2CW0 D;  3CCU A;  1A15 A;  2KHJ A;  4PV1 C;  4JI7 Q;  2ASB A;  3PO3 H;  1ILP A;  1RHP A;  4DUZ Q;  3STB D;  1HRJ A;  4K2L A;  1EZ8 A;  3CU7 A;  5AFW A;  1Q12 A;  1E1T A;  4QUC A;  4JYA Q;  4OL7 A;  4LFB L;  1GO3 E;  2NYZ D;  3D31 A;  1VCI A;  5FLM G;  3NEN A;  1JR0 D;  1L0Y B;  1E3P A;  1S4Z A;  2EY5 A;  3Q0A A;  2EVB A;  5EKL A;  3CCJ A;  2NZ1 D;  2MO0 A;  3OYY A;  4ME5 A;  5JJL A;  2JP1 A;  4JV5 L;  5JEA G;  5FKA C;  3M3Y H;  4K0K Q;  1X54 A;  1Q81 C;  4JI8 Q;  4LF4 L;  1S5E D;  1SAP A;  1LLR D;  3S1R H;  1JMC A;  4DAP A;  4G7O C;  3A8J E;  2Q8I B;  3DUZ A;  2YU9 H;  2NN6 I;  3K81 C;  1YNN D;  1XMQ L;  1TY0 A;  1SNP A;  2F0U A;  1WCM G;  2K5V A;  1BXT A;  5J3B A;  4X62 L;  3EVQ A;  4CHT B;  1EWI A;  2A73 B;  4JI5 L;  4A3F B;  1ZKO A;  1LO5 D;  2Z1C A;  1CSQ A;  3TRE A;  3HFZ B;  4DNR B;  1HZB A;  5EBD A;  1EFI D;  4A3F G;  4A3F H;  2K33 A;  4KY7 A;  2B8F A;  3KBX A;  4TRD A;  1CQV A;  3TP8 A;  4I65 A;  4P73 A;  2I07 B;  1J8I A;  3W5O A;  1VQ6 A;  4FF3 A;  2R7Z H;  2DNE A;  4IFD I;  4PQX A;  2F0H A;  4AYB G;  4BBR H;  2JSO A;  5KNC A;  3T56 B;  3D4W A;  4BBS G;  3G48 A;  1LTA D;  4OGQ C;  1X3G A;  4N8F A;  4OO1 G;  4LNQ A;  4DGZ A;  2EOT A;  3BYT B;  3R3O A;  5IT9 c;  2NVT H;  1VQP A;  4LF9 L;  1Y8N B;  2KUM A;  3HOY H;  2F0P A;  5GRO A;  5HGT A;  3S2D H;  3GQB A;  1LTB D;  3J80 c;  2JEB I;  1SYG A;  3OW7 A;  3V2T A;  2LMC B;  4WOR A;  3MHB A;  1SE3 A;  1FL0 A;  2TMP A;  3HOU G;  1MBY A;  5ELE A;  1TT2 A;  4FF4 A;  2F0Q A;  4CKE A;  3PQI A;  1QB5 D;  2HHH Q;  2EYO A;  2WKD A;  4A3I H;  1JOR A;  2R3Z A;  1LUZ A;  4BWG B;  4JC0 A;  1W6J A;  4YY3 L;  3RZD B;  4B3R Q;  4FF2 A;  2VUM H;  4KI0 A;  4Y52 H;  5FO8 B;  2E2J B;  1U4L A;  3VDY A;  1F2L A;  1SMY C;  4L5Q A;  1U4M A;  1NMF A;  1TU2 B;  2NVX H;  3HOW H;  1GUO A;  4RKB A;  1HNX L;  3Q6S A;  3NEL A;  3RD4 A;  1LTT D;  1RIP A;  1TS2 A;  3RLO A;  3HOU H;  2L0C A;  5IGB A;  4EGV A;  4DR3 L;  4C2M H;  5JPM C;  3HOX H;  4DNI A;  3MAQ A;  1VQG A;  1TS3 A;  4P71 A;  1WD1 A;  1EFW A;  4V19 0;  4KD3 A;  3J81 j;  2PZU A;  2X6L A;  2MPM A;  2VUM G;  5FLX L;  3S15 B;  2EZV A;  1IKL A;  2NTS A;  2K50 A;  1DCZ A;  2B2Y C;  2UUC Q;  4F7X A;  4MZ9 A;  2HQL A;  2VNU D;  1U5K A;  3PSI A;  2F0T A;  1GXD C;  1VS0 A;  1IHZ A;  1MGS A;  2Z6K A;  1PFB A;  3SXH A;  4Y7N H;  4C3J H;  1N36 Q;  2VS1 A;  2UXC Q;  2UUB Q;  5C3E G;  2HQE A;  3C2P A;  4DAY A;  3S1N H;  1HNZ L;  2K1B A;  2PI2 E;  3CCE A;  3UE0 A;  4GZY C;  3IRB A;  2F03 A;  2XNA C;  4GNX A;  5FLM H;  1HZ9 A;  3SVM A;  3K5N A;  3S16 B;  2K5N A;  4BY7 G;  4A3K G;  3IAY A;  1SE2 A;  1LT4 D;  5IWA Q;  2F1M A;  4ILW A;  1KLU D;  1PRT D;  3K8A A;  1Z6H A;  2ES2 A;  1BVS A;  1UEA B;  1VQC A;  3URY A;  1TKW B;  3K7U C;  4P72 A;  3A55 A;  4IPC A;  4H44 C;  4JW0 A;  1O80 A;  2PO4 A;  1OO9 B;  4G7Z C;  3GTQ B;  1TWH B;  1XMO Q;  4QIW E;  1WD0 A;  3MTS A;  1AZQ A;  1STY A;  2NVY H;  4UP9 A;  3NSW A;  3GV6 A;  5ELC A;  5I9O A;  1IL2 A;  4ABN A;  1QVC A;  3CCM A;  1T5E A;  4LF6 L;  1CZW A;  3T4A C;  2NBF A;  3T13 A;  2CHB D;  3D8G A;  1JWU D;  3PUZ A;  4R4O A;  4XYQ A;  5JJZ A;  2E2H H;  3NE5 B;  1D8L A;  1F9R A;  2XWB B;  4S3S A;  4U68 A;  1WTP A;  1VF5 C;  1IL8 A;  4A3E G;  1AH9 A;  3CPF A;  1BCP C;  4RGM A;  4Z9C B;  1D2B A;  3C3L A;  2KCC A;  2PNR C;  3M4Y A;  3NEM A;  3M4Q A;  5D65 A;  1VQH A;  4JI3 L;  4JI0 Q;  3NK9 A;  2IPK D;  4HMJ A;  4P2C B;  4HMI A;  4CJ1 B;  4RWS C;  1A2T A;  1WTH A;  5C4X H;  1SNQ A;  2D0O A;  1DOM A;  4WJW A;  1O7Z A;  2B29 A;  5EPK A;  3M4O H;  3PUY A;  1M8A A;  2F0N A;  3TZU A;  3K0Y A;  1Z7T A;  5FJ8 H;  2F0S A;  3ND8 A;  4XQN A;  4HIM A;  3NUC A;  4QY7 A;  3RLN A;  2K04 A;  1F2Z A;  2KA7 A;  1BDO A;  4UP8 A;  4LMQ D;  1GUW A;  1H9J A;  1L0X B;  5CV5 A;  1E1O A;  4IO9 A;  1BCP F;  4BA1 I;  5GAG C;  1NE3 A;  3S15 H;  2SNS A;  1DJR D;  3P1H A;  1HH2 P;  2D9U A;  4GKJ Q;  4JK1 C;  2MP1 A;  4A3G B;  1AFP A;  1O7I A;  4HSV A;  1AW7 A;  1Y8O B;  3TP5 A;  4CDD C;  3S17 B;  1HUN A;  3F2C A;  2PMZ E;  4JI0 L;  4DR1 L;  5AJ3 Q;  3MFG A;  3HOW B;  2NVX B;  4NKL A;  5I2X A;  4ZKB B;  3EQL C;  1FNU A;  1SNO A;  3I8Z A;  4YHH Q;  3JAM E;  4AH6 A;  3NQT A;  1HFN A;  5C4H A;  2HUG A;  4DV3 Q;  3U58 A;  2PZT A;  5C0X J;  2D62 A;  1I6H B;  1S5D D;  2E2D C;  4CKB A;  1B9M A;  1RF2 D;  3K7A B;  2EYL A;  2K7V A;  2MHV A;  4PMW A;  3NP8 A;  4JI4 L;  4GKJ L;  3FEW X;  1B70 B;  2R93 G;  1PFS A;  4XYO A;  5JEA H;  1HPC A;  4X65 L;  1HQM C;  3FVQ A;  1XPR A;  3L0O A;  4PMB A;  3TBI B;  1SE8 A;  4QUF A;  2F0G A;  5T1I A;  3AU7 A;  3PCO B;  4DR4 Q;  2L11 A;  1LYL A;  1G2T A;  4QQB X;  3DXJ C;  5M5X H;  4YWM A;  4FYD A;  1PVO A;  3ITP A;  2VW9 A;  3S2H B;  2R92 G;  1DOK A;  5F2D A;  3EJI A;  4DNT B;  1CZG A;  4PG3 A;  4POF A;  2ZM6 Q;  4JCV E;  2K14 A;  3KLW A;  1E2V A;  4DV6 L;  3ONA B;  1PZJ D;  2R7Z G;  3HOV G;  2KOL A;  2UUA Q;  2IW3 A;  5JVG 3;  1RJT A;  1BR9 A;  1LV9 A;  1TVX A;  4F88 A;  1KDC A;  3VYU A;  1K3B C;  4NXM L;  2MNA A;  1N36 L;  3S24 A;  4HIO A;  5A2Q L;  5E4W C;  2PPB C;  1ML0 D;  1YNJ D;  2QKI C;  3SGI A;  3ND9 A;  4YWK A;  1EUJ A;  4LFC Q;  1EY0 A;  2WIN B;  4RAU C;  1HR0 W;  2KEN A;  3GDE A;  2CKZ B;  2RVL A;  3A8I E;  2KEC A;  1JOO A;  4KHP L;  2G9H D;  2KCN A;  3CW2 C;  5DM6 3;  3CKI B;  5HGQ A;  4XIG S;  4A93 H;  5E4X A;  1ZXT A;  4A3G H;  4A3C H;  2UU9 Q;  2BE5 C;  2Y0S B;  5CR3 A;  2QIL A;  1GD7 A;  2XGT A;  3KJP A;  4J8Q A;  2F4V L;  2JA8 H;  1NTG A;  2XVS A;  3BJU A;  1JJC B;  1YHA A;  4KY6 A;  1MSG A;  2ID0 A;  1JOK A;  5IGD A;  5GAD C;  4R4C A;  1GKH A;  3S1M H;  2AUJ D;  3IL8 A;  4YY3 Q;  2RA4 A;  3H09 A;  3HOU B;  1BBU A;  2Q2U A;  1HZA A;  3GV3 A;  3BZD B;  3QO2 A;  3PF4 A;  1EIF A;  1DON A;  4HAE A;  3BS1 A;  4ALP A;  3J7A 5;  1A62 A;  3ERQ A;  5JPN C;  3G4S A;  3IFD A;  4ID6 A;  2NVQ H;  2C9O A;  2JA7 B;  2EYH A;  1YIT A;  2E2J H;  4EQ5 A;  3ICE A;  4OEL B;  2Q2T A;  2I5M X;  2A68 C;  5HY6 A;  1A3U A;  2L55 A;  1QNU A;  1RTN A;  1GJX A;  3NWT A;  1NCV A;  4Y7N B;  1X32 A;  1D1K A;  2B2T A;  5LMN Q;  4DR1 Q;  1M4V A;  1BCP D;  3VYR A;  3BVZ A;  3DWQ A;  4GKK Q;  2F52 A;  4R8I A;  1KL9 A;  3D4R A;  1ASZ A;  4TQU S;  4Q0F A;  3I73 A;  1EZ6 A;  3R8B A;  2F4V Q;  3NTH A;  1N33 L;  3F2D A;  5DAU A;  2RDH A;  1I4G A;  3RNU A;  4C1N K;  3KFU A;  4JVZ A;  5KRU A;  2B2W C;  1I50 H;  5M5X B;  1VMP A;  4DPG A;  1FGU A;  1KDB A;  3E9H A;  1HNX Q;  1CFM A;  4HN7 A;  1JB7 A;  3FP9 A;  2RCN A;  3TQY A;  1ICF B;  5C3E B;  3CCR A;  4MHE A;  4OO1 I;  4HJ5 A;  5TSS A;  1XTD A;  4BY1 H;  1MHW C;  1LTS D;  4GOP B;  2QDL A;  3DEO A;  2E2I B;  4LUV A;  2IHE A;  1S3O A;  2AKW B;  5T1G A;  4UHV A;  4GNX C;  5CV4 A;  4MIU A;  5C6A A;  1IBK Q;  3CC4 A;  1HXY D;  2EXZ A;  3T51 B;  4YCV A;  2F0E A;  2CQA A;  2OWO A;  1X65 A;  5ELN A;  3OWF A;  4JBK A;  4ZCK A;  4JI1 Q;  3X3M A;  1CI3 M;  3S1R B;  4GLX A;  3KJO A;  5C4X G;  5IYB H;  4DK3 C;  3PIP 3;  1NR4 A;  2N78 A;  3WOE A;  2JA6 H;  1TWC H;  4JI7 L;  1OXV A;  3CC7 A;  4DK1 A;  3J7A V;  4PZ7 A;  5J22 A;  2EY6 A;  4UPA A;  2JA7 G;  1PRT F;  1B4O A;  1DOL A;  3MEF A;  4J15 A;  2R7Z B;  3HKS A;  3KF8 A;  1MKH A;  1QIL A;  2QGQ A;  4RKL A;  3PUX A;  3H0G H;  5IP7 G;  5IGE A;  1VQ9 A;  3K58 A;  1G29 1;  3DMU A;  4RGT A;  2EIF A;  4XQJ A;  3T1H Q;  1GM5 A;  4DAM A;  2KBN A;  2R7F A;  1EYG A;  5GAH C;  1PZI D;  5EPL A;  3SE0 A;  1JWM D;  1VQL A;  1Q1E A;  1XMQ Q;  4RA8 A;  2Z6B A;  5COR A;  4FP5 D;  4A3D H;  3RMH A;  1NBW A;  1SMY D;  4DAY B;  5C0X H;  1E2W A;  5M3M H;  1KNE A;  4GLV B;  4H7B A;  2K03 A;  5IE8 A;  2YTX A;  1CKN B;  2BH8 A;  3EBE A;  4U67 3;  2YTV A;  1CUK A;  4K8I A;  1EU4 A;  1MD2 D;  2CCZ A;  1H9S B;  3MXP A;  2DJF C;  3PIO 3;  2AWO A;  3I7F A;  1F9Q A;  5FO7 B;  3JAM i;  3S14 H;  4A3I B;  1IW7 C;  1T5X D;  2UXC L;  4CDE C;  3P75 A;  2OTJ A;  3R2T A;  3NXW A;  5CV8 A;  3KF6 B;  1E22 A;  2ZXR A;  2JQO A;  1NY4 A;  1V1P B;  3UE1 A;  5LMU Q;  2UUC L;  2RDG A;  3LNN A;  3OIQ A;  1XMO L;  4K5W A;  3I4M B;  2FMC A;  2GVB A;  1VMC A;  4DV4 L;  1Y1W H;  1YHQ A;  4J6H A;  1Q86 C;  4DK6 C;  5K5P A;  3K6O A;  4NXN Q;  3I4M G;  1ESR A;  2H4O A;  2NZH A;  2QF7 A;  1HFG A;  1QG7 A;  4FVM A;  1N33 Q;  1OTC A;  3H94 A;  5GAE C;  4NB3 A;  2XSC A;  4IOA A;  1FD7 D;  1E7Z A;  4QGU A;  4F87 A;  1X56 A;  4M1U B;  2DUD A;  5IP9 G;  1SNC A;  3GTM H;  3PO2 G;  3PV0 A;  5LMN W;  5BR8 Q;  2DY8 A;  3I55 A;  4DV3 L;  4L5R C;  1JOQ A;  2J7Z A;  2JJQ A;  2PW7 A;  4ZAI A;  3GP7 A;  2ZJP A;  2CVR A;  1CA6 A;  4K2K A;  4OIJ A;  2I5L X;  2RCF A;  4AIM A;  4BBR G;  1IBL L;  1GVP A;  2SDF A;  3U4Z A;  1X3Q A;  1IBK L;  2K28 A;  3M9B A;  3A5Z B;  5C44 H;  2QEJ C;  3S2H H;  1IYU A;  2EE1 A;  4FF1 A;  1N34 L;  1I3Q H;  4IFD H;  4CJ0 B;  3FPP A;  2UUA L;  1N32 L;  1KNA A;  3T1H L;  4JG2 A;  1SXT A;  5M5W B;  2F0F A;  1ET9 A;  2LXK A;  2QEX A;  1YVC A;  1X3F A;  3TEH B;  4I7Z C;  3RR5 A;  3QWN A;  3AB9 A;  3SHL A;  1G91 A;  1H9R A;  4DUY Q;  3U50 C;  4OWW B;  4DV0 L;  1QE6 A;  2JEA I;  1WTR A;  4A3C G;  4LF5 L;  1PYW D;  5A2Q E;  2Z4I A;  1CQF A;  4JI6 Q;  4DA2 A;  1XYI A;  3A8K E;  2JA7 H;  2YU9 B;  3LX0 A;  1Q46 A;  4BY7 H;  2F0K A;  2AHO B;  3CQZ B;  3MWY W;  1SYF A;  2B2U A;  4IPG A;  2A69 C;  4X62 Q;  4CDC C;  2NB0 A;  2P5Z X;  5C4Z A;  3J81 E;  1KTK A;  1STH A;  3L9A X;  3PIP A;  2R61 A;  2LS0 1;  1TR5 A;  2ZJR A;  2OCE A;  1SRU A;  1I6V C;  5D3D A;  3AEV A;  1R4P B;  4KKT A;  5GQO A;  1HZC A;  1PTO F;  1B9N A;  3H91 A;  1IBL Q;  4A3G G;  1AE3 A;  3VR3 A;  5M5Y B;  2ENB A;  2JA9 A;  3RN2 A;  1RTO A;  1UUP A;  4H13 C;  1VQ5 A;  2OF1 A;  3QOJ A;  4IN3 A;  5C0X G;  4LF9 Q;  3PO2 B;  3ULP A;  4K6D A;  3J80 i;  5LL6 X;  1JJ2 A;  4NP5 A;  4A3K H;  4A93 B;  2WAQ E;  3PUW A;  2D0P A;  4LFB Q;  3LWU A;  1YI2 A;  1RL2 A;  3KK7 A;  3TDQ A;  3T16 A;  3AFP A;  2A6E C;  1CSP A;  3WWV A;  1KAA A;  2EY1 A;  3ERS X;  1AZP A;  5M3F B;  4M8A A;  4A3E H;  1BNZ A;  2B2V A;  1A6X A;  5EKI A;  3VA5 A;  2J0T D;  5FLX E;  3GTJ B;  2M00 A;  1VQ8 A;  4KLK A;  2L1B A;  4KHP Q;  2SOB A;  4DU9 A;  3CF5 A;  4IUR A;  4HSP A;  2WAC A;  2AUK A;  1R4Q B;  4HJ8 A;  5FK9 C;  1K8A C;  3DEP A;  1EOT A;  3RZD H;  1BBW A;  2B63 B;  4LUO A;  1VQM A;  2HD3 A;  1C4Q A;  5IYB G;  2A8V A;  1NMG A;  4B9X A;  1L1O A;  2CH4 W;  4OHJ A;  5KND A;  3BVG A;  2O4X A;  1JJG A;  4A3M H;  1S5F D;  2E75 C;  3J7A F;  4DR6 Q;  3Q24 A;  1CT1 D;  1XJV A;  1QZG A;  2JA6 B;  1C0A A;  4POG A;  3MXN A;  2LSS A;  3N6R A;  4HJ9 A;  1S5C D;  3TME A; 
#chains in the Genus database with same CATH homology
 1A0I A;  2BA1 A;  1KC8 C;  2QA4 A;  4JI2 L;  1XNQ L;  1PA6 A;  3KYH C;  1W3S A;  3PCO B;  1X55 A;  5M3M G;  4LFA L;  4DR4 Q;  3K80 C;  1PH6 A;  2UXB Q;  1J6Q A;  1LYL A;  4ME3 A;  3AQQ A;  5AJ3 L;  1Z47 A;  2VL6 A;  4QQB X;  3F1Z A;  5C4J H;  3M85 A;  4BY1 G;  5M5X H;  1C7Y A;  4B3R L;  2ZTE A;  4YWM A;  1PVO A;  4O2D A;  2VW9 A;  4DV1 Q;  2VQE L;  2R92 G;  3TS2 A;  5IYD H;  5IY0 A;  3T1Y Q;  4PG3 A;  4POF A;  2ZM6 Q;  2JA5 G;  4JCV E;  2K14 A;  3KLW A;  1OXU A;  4LFA Q;  3A5U A;  4DR4 L;  4DV6 L;  4H02 A;  2RHS B;  4PZ8 A;  3TRZ A;  2R7Z G;  3ULL A;  4DR7 Q;  3HOV G;  1PYS B;  3FKI G;  1PYB A;  2B3G A;  2EXD A;  2UUA Q;  4AQY Q;  3NBH B;  5DLQ E;  4DV5 Q;  3D0F A;  1L1O C;  4PZ6 A;  2BH2 A;  1TWF H;  4O0A A;  1FJG L;  1FJG Q;  4NXM L;  2MNA A;  3B6Y A;  4DV4 Q;  2B63 H;  1I6H H;  1N36 L;  3S24 A;  4HIO A;  3GTO H;  1DGS A;  3PF5 A;  4JI4 Q;  1HNW L;  4DUY L;  1IBM L;  1I5F A;  2VQF Q;  1IYJ B;  2OTL A;  1SRO A;  2RF4 A;  3SGI A;  3F8T A;  1EUJ A;  4YWK A;  4LFC Q;  4WJ3 M;  1QVF A;  1ASY A;  2ATW A;  4LF4 Q;  1HR0 W;  3UDF A;  4NXM Q;  1WCM H;  2R7D A;  1J5E Q;  1VQI A;  3HOX G;  2KEN A;  4MTN A;  5IWA L;  3GDE A;  2CKZ B;  3M7N A;  4IJH A;  1KIX A;  2E8G A;  4JI3 Q;  4KHP L;  4LF8 L;  2AWN A;  3CW2 C;  2K52 A;  1K83 H;  2KHI A;  2E5L L;  2WB1 E;  5HGQ A;  4XIG S;  4GOP A;  4A93 H;  1V43 A;  1KXL A;  4DV2 L;  4K0K L;  3AYH B;  4JOI C;  1UE7 A;  1LTL A;  4DV7 Q;  2PNH A;  4A3J G;  1SFO H;  4OON A;  4A3C H;  4A3G H;  2E5L Q;  3KF8 B;  4OWT B;  2UU9 Q;  4LF5 Q;  3EIV A;  1R9T H;  1XPO A;  1D7Q A;  4L5S A;  3STB C;  1GD7 A;  2XGT A;  3KJP A;  2JA8 H;  2F4V L;  3CCS A;  1C9O A;  1S40 A;  1NTG A;  3ZJY C;  3BJU A;  1JJC B;  1YHA A;  2ID0 A;  3GD7 A;  5IP9 H;  3KF6 A;  4DV0 Q;  5GAD C;  2UXB L;  4R4C A;  4TVA B;  1GKH A;  1Y1V G;  1VQJ A;  1Y1V H;  3S1M H;  4APV A;  2ZTC A;  5BR8 L;  3A74 A;  4YY3 Q;  1N9W A;  1BBU A;  2IX0 A;  2YTY A;  1HZA A;  2Q2U A;  5IYD G;  4LF6 Q;  4IFD J;  5JJK A;  1E24 A;  2HHH L;  2HIX A;  1HNW Q;  3GTK H;  3CCL A;  3PF4 A;  5IYC G;  1EIF A;  3FKI H;  4X66 L;  1PH5 A;  2I0Q A;  1T9H A;  2JK8 A;  4ALP A;  1A62 A;  3J7A 5;  3G4S A;  4UY8 C;  1PH8 A;  2NVQ H;  1VQO A;  4DR5 Q;  5M3F H;  1PH7 A;  4KHZ A;  1UWV A;  1VQF A;  1Y14 B;  3KDF B;  4AQY L;  1YIT A;  2E2J H;  3UDX A;  1X3E A;  4EQ5 A;  1P8L A;  3GTQ H;  3ICE A;  3H15 A;  1K0R A;  2Q2T A;  2I5M X;  3CCU A;  5HY6 A;  2UXD Q;  2KHJ A;  2H5X A;  1Q1B A;  1OXX K;  4JI7 Q;  2ASB A;  2IX1 A;  4GOP C;  3PO3 H;  4DUZ Q;  5LMN Q;  4A75 A;  3STB D;  4DR1 Q;  4BBS H;  4GKK L;  4YCW A;  4JOI A;  1Q12 A;  3RLF A;  1W2B A;  1PH9 A;  1E1T A;  4B3T Q;  5LMN L;  4GKK Q;  2F52 A;  1KL9 A;  4JYA Q;  4LFB L;  4GN5 A;  1ASZ A;  4TQU S;  1GO3 E;  4YHH L;  2KCM A;  3D31 A;  1VCI A;  5FLM G;  3NEN A;  1E3P A;  2F4V Q;  1IZ6 A;  1PV4 A;  1N33 L;  3F2D A;  3CCJ A;  3OYY A;  1EOV A;  2MO0 A;  3PO3 G;  1EIY B;  4LF8 Q;  4LUZ A;  5EAY A;  1HNZ Q;  3UDI A;  3RNU A;  5JJL A;  3KFU A;  3HOZ H;  4JV5 L;  5JEA G;  1QZH A;  3M3Y H;  1U0L A;  4K0K Q;  1X54 A;  1Q81 C;  4JBM A;  2OQK A;  1I50 H;  3EN2 A;  1X9N A;  3I4N H;  4NPS A;  4JI8 Q;  4HIK A;  4LF4 L;  2XTI A;  4DPG A;  1FGU A;  3E9H A;  1HNX Q;  3W1G A;  4A3D G;  1A8V A;  3A0J A;  3J7Z C;  4QJF A;  3PIO A;  2Z6K C;  4HJA A;  3S1R H;  1JMC A;  1JB7 A;  3FP9 A;  5FJ8 G;  1YJ9 A;  3CC2 A;  3KOJ A;  2RCN A;  3TQY A;  3CCR A;  1P16 A;  2N3S A;  4DKA C;  4HJ5 A;  2YU9 H;  1IXR A;  4OO1 I;  1XTD A;  2NN6 I;  3K81 C;  3CXC A;  1XMQ L;  4BY1 H;  1B7Y B;  1WCM G;  2K5V A;  4GOP B;  5J3B A;  1VQ7 A;  4X62 L;  4X6A H;  4R4T A;  1EWI A;  4LUV A;  2IHE A;  5LMU L;  2GVA A;  4JI5 L;  1S3O A;  2AKW B;  1CSQ A;  3TRE A;  3HFZ B;  3CPW A;  4GNX C;  1HZB A;  2KCT A;  1IBK Q;  4A3F G;  4A3F H;  3JC6 6;  1VQN A;  4X66 Q;  3CC4 A;  4YCV A;  4X64 Q;  3UDG A;  1VQB A;  2NZO A;  4P73 A;  1WYD A;  1YJW A;  2JA6 G;  2OWO A;  3W5O A;  1VQ6 A;  1X65 A;  4QL5 A;  3H3V H;  5ELN A;  3I56 A;  2VY3 A;  2RHQ B;  1Q82 C;  2R7Z H;  1JE5 A;  1KRT A;  1V1Q A;  4JBK A;  4IFD I;  3I2Z A;  2AMC B;  4JI1 Q;  4JBJ A;  4AYB G;  4FDB A;  4GLX A;  4BBR H;  5JEA J;  3K0X A;  3KJO A;  4LFC L;  4JI1 L;  1WOC A;  4BBS G;  3G48 A;  1Z9F A;  5C4X G;  5IYB H;  4DK3 C;  2HIV A;  1X3G A;  2CFM A;  4OO1 G;  4LNQ A;  3LGJ A;  1TWH H;  2N78 A;  3GTJ H;  2NVT H;  2JA6 H;  5IT9 c;  2DGY A;  1XPU A;  1TWC H;  4R4I A;  3HOV H;  4JI7 L;  1BKB A;  1OXV A;  1VQP A;  2B63 G;  3L7Z C;  1UE1 A;  2WFW A;  3CC7 A;  1PH1 A;  4LF9 L;  2Y0S G;  4PZ7 A;  3HOY H;  5GRO A;  2GN5 A;  2MFI A;  1MIU A;  4GN3 B;  2HT1 A;  4UPA A;  2JA7 G;  2VQF L;  3BU2 A;  3S2D H;  3MEF A;  4GN4 B;  3J80 c;  4J15 A;  2JEB I;  3J81 i;  3HKS A;  3OW2 A;  2L15 A;  4X64 L;  1MKH A;  2QGQ A;  4C3I H;  1FL0 A;  3HOU G;  2MO1 A;  4YCU A;  3PUX A;  1J5E L;  3H0G H;  4IJL A;  1OXT A;  5IP7 G;  3K7A H;  4DV6 Q;  1VQ9 A;  2HHH Q;  4OXP A;  4A3I H;  4IPD A;  3CMA A;  3H3V I;  1G29 1;  3PO2 H;  5IYC H;  3OTO Q;  2EIF A;  2VZA A;  1G6P A;  3T1H Q;  1GM5 A;  3JAM c;  1LUZ A;  4DAM A;  2YV5 A;  2KBN A;  2R7F A;  4JC0 A;  4OWX B;  4YY3 L;  5GAH C;  5C3E H;  1YJN A;  1K8G A;  1EYG A;  4B3R Q;  1VQL A;  1Q1E A;  1XMQ Q;  2VUM H;  4KI0 A;  4Y52 H;  2Y0S E;  3VDY A;  1I94 L;  3W1B A;  4JI8 L;  4EX5 A;  1A63 A;  4A3D H;  5C44 G;  5H1S E;  1NBW A;  4DAY B;  2VQE Q;  3FHW A;  4L5Q A;  1NMF A;  2NVX H;  3HOW H;  4IFD G;  5M3M H;  3G6E A;  5K36 G;  1HNX L;  3NEL A;  3PGZ A;  4GLV B;  3KDF A;  1RIP A;  4DR3 Q;  3CP0 A;  4X65 Q;  4GLA C;  4DV7 L;  5IE8 A;  4DV2 Q;  2YTX A;  3RLO A;  3HOU H;  3U4V A;  2R92 H;  4DR3 L;  1CKN B;  2BH8 A;  2PQA A;  5E7N A;  3EBE A;  4R4Q A;  4C2M H;  4A3L G;  2YTV A;  4A3L H;  1CUK A;  3HOX H;  4DNI A;  2CCZ A;  2YYZ A;  3CD6 A;  2AWO A;  3I7F A;  1K73 C;  4JI5 Q;  3JAM i;  1VQG A;  4P71 A;  1VQ4 A;  1V9P A;  1WFQ A;  2C35 B;  2OQ0 A;  1EFW A;  4LF7 L;  4DUZ L;  3S14 H;  2UXC L;  1CKN A;  3J81 j;  4YWL A;  2OTJ A;  2F3I A;  2VUM G;  4B3T L;  2K50 A;  3KF6 B;  2UUC Q;  1E22 A;  2JQO A;  1NY4 A;  1OXS C;  1YBY A;  3BZC A;  2HQL A;  4MZ9 A;  3UE1 A;  1U5K A;  2K4K A;  1SLJ A;  2Z0S A;  3PSI A;  1SN8 A;  1YZ6 A;  1IBM Q;  2UUC L;  1VS0 A;  5C0X I;  2VNU D;  1XMO L;  2GVB A;  2I5H A;  2Z6K A;  3CAM A;  1AE2 A;  4LWC A;  4AYB E;  2K75 A;  4C3J H;  4Y7N H;  2VS1 A;  4DV4 L;  4R1J A;  4P74 A;  1Y1W H;  1YHQ A;  1Q86 C;  4DK6 C;  5M5Y H;  2UXC Q;  3MXN B;  2UUB Q;  5C3E G;  4NXN Q;  5M5W H;  3I4M G;  1JT8 A;  2BA0 A;  3S1N H;  1HNZ L;  2NZH A;  2PI2 E;  3CCE A;  3UE0 A;  1Q7Y C;  1VQA A;  3IRB A;  1N33 Q;  4BXX H;  3GTP H;  4GNX A;  2IHF A;  1HR0 L;  1OTC A;  3HOY G;  5FLM H;  5GAE C;  3HOW G;  4NB3 A;  1HZ9 A;  1K9M C;  4IOA A;  3CQZ H;  1NJI C;  1E7Z A;  4QGU A;  2K5N A;  1EQQ A;  4C3H H;  1X56 A;  3ER0 A;  2DUD A;  5IP9 G;  1PH3 A;  4JI6 L;  1UE6 A;  1KRS A;  3PV0 A;  3GTM H;  3PO2 G;  1PH2 A;  4BY7 G;  4A93 G;  5LMN W;  4A3K G;  4GNX B;  5BR8 Q;  5IWA Q;  1YHB A;  3I55 A;  2IT1 A;  1I94 Q;  2CQO A;  3ULJ A;  4DV3 L;  4L5R C;  1KQS A;  1TWA H;  2JJQ A;  1G51 A;  2ZJP A;  1QVG A;  4IOC A;  3K8A A;  2ES2 A;  1X6O A;  4JI2 Q;  3HKZ E;  1XNQ Q;  1BVS A;  1L0W A;  1QUQ B;  4RMF A;  1VQC A;  3OTO L;  1MJE A;  2I5L X;  3K7U C;  4AIM A;  4P72 A;  4BBR G;  1H95 A;  3GTL H;  1IBL L;  1GVP A;  3J81 c;  4OX9 Q;  1YEZ A;  3U4Z A;  3S16 H;  4IPC A;  2LXJ A;  1IBK L;  3M9B A;  3A5Z B;  5C44 H;  3S2H H;  1UE5 A;  1N34 L;  1LM0 A;  1I3Q H;  3Q8D A;  1XNR Q;  2JA5 H;  4IPH A;  1XMO Q;  4QIW E;  2CWA A;  2FXQ A;  2UUA L;  3F2B A;  1N32 L;  1KAW A;  2NVY H;  4UP9 A;  3HOZ G;  3T1H L;  4JG2 A;  1N32 Q;  4DR2 Q;  1EQR A;  2ALY B;  2WB1 G;  2JE6 I;  1IL2 A;  2LXK A;  2QEX A;  1FVI A;  1YVC A;  1QVC A;  2Q2H A;  2R6G A;  1PH4 A;  1WI5 A;  1X3F A;  3CCM A;  3TEH B;  4LF6 L;  2WP8 J;  4DV1 L;  1CKM A;  4LF7 Q;  3RR5 A;  3PUZ A;  4B3M L;  4R4O A;  5IP7 H;  2E2H H;  4DUY Q;  1VQD A;  1KHI A;  1D8L A;  3U50 C;  4OWW B;  3RN5 A;  4DV0 L;  2PI2 A;  4RG1 A;  5JJI A;  4A3E G;  1AH9 A;  2NN6 G;  3CPF A;  1CKO A;  1KD1 C;  4JV5 Q;  4OX9 L;  5M3F G;  3M4P A;  2JEA I;  3CCV A;  4A3C G;  4B3S L;  3NEM A;  3M4Q A;  4LW1 A;  1N8R C;  2UU9 L;  1HJP A;  4LF5 L;  1VQH A;  4JI3 L;  1Y1W G;  3DM3 A;  4JI0 Q;  4DR7 L;  1SMX A;  4JI6 Q;  2A19 A;  4A3I G;  2JA7 H;  4BXX G;  1B8A A;  1Q46 A;  2N49 A;  4BY7 H;  5C4X H;  2AHO B;  4HID A;  2D0O A;  4IPG A;  4X62 Q;  2B29 A;  3RZO H;  3M4O H;  3PUY A;  3PIP A;  1K3R A;  1TXY A;  2ZJR A;  2OCE A;  1SRU A;  5FJ8 H;  3AEV A;  4HIM A;  3I4M H;  4QY7 A;  5GQO A;  1HZC A;  2ZJQ A;  3RLN A;  1IBL Q;  4A3G G;  3S17 H;  2R93 H;  1AE3 A;  4UP8 A;  4DR5 L;  3HKZ G;  1N34 Q;  2JA9 A;  1E1O A;  4IO9 A;  3RN2 A;  1M1K C;  3I4N G;  1VQ5 A;  4BA1 I;  5GAG C;  1NE3 A;  3S15 H;  3PUV A;  4A3B G;  4P75 A;  1VQK A;  1VQE A;  1Q8K A;  1HH2 P;  1L1O B;  3AFQ A;  5FLX c;  5C0X G;  4LF9 Q;  4GKJ Q;  3ULP A;  4DV5 L;  3E9I A;  3S1Q H;  1O7I A;  3J80 i;  2PQA B;  4DR2 L;  1JJ2 A;  4A3K H;  2WAQ E;  1QUQ A;  3PUW A;  2D0P A;  4LFB Q;  4A4I A;  2K5H A;  2ZM6 L;  2WAQ G;  1YI2 A;  4L5T A;  1M90 C;  1RL2 A;  3T1Y L;  2A1A A;  3BZK A;  3F2C A;  4A3B H;  3AFP A;  2PMZ E;  3L2P A;  1CSP A;  4JI0 L;  3WWV A;  3ERS X;  4DR1 L;  1N36 Q;  5ELO A;  5AJ3 Q;  2V1C C;  3GTG H;  4A3E H;  3E0E A;  3G71 A;  2UXD L;  4GS3 A;  3TS0 A;  2UUB L;  3CME A;  4YHH Q;  4UP7 A;  4AH6 A;  4HJ7 A;  1VQ8 A;  4KLK A;  4XTC S;  4DV3 Q;  3U58 A;  4JYA L;  4KHP Q;  1SR3 A;  4A3M G;  4B3M Q;  3CF5 A;  4BA2 I;  4NXN L;  2ZTD A;  4HJ8 A;  1K8A C;  1MJC A;  3RZD H;  4JBW A;  5C0X J;  2EQS A;  1WJJ A;  1BBW A;  4WJ4 A;  2D62 A;  4A76 A;  2Q2I A;  4DR6 L;  4LUO A;  1VQM A;  5IYB G;  2A8V A;  2N8N A;  1NMG A;  1TWG H;  1L2F A;  1S72 A;  1HR0 Q;  1L1O A;  3GO5 A;  2IY5 B;  3H0G G;  4PMW A;  2E2I H;  4JI4 L;  1JJG A;  2CWP A;  4A3M H;  1XNR L;  2JA8 G;  4GKJ L;  4DR6 Q;  3DLL A;  1B70 B;  3CCQ A;  1YNX A;  5LMU Q;  1XJV A;  2R93 G;  1PFS A;  1UEB A;  4X65 L;  1QZG A;  2MQH A;  4A3J H;  1C0A A;  4POG A;  3I4O A;  2LSS A;  1YIJ A;  4B3S Q;  4HJ9 A;  1XPR A;  3L0O A;  1PHJ A;  4MNO A;  1SE8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...