3PUXA

Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
371
structure length
371
Chain Sequence
ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPGVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Maltose-binding periplasmic protein
publication title Snapshots of the maltose transporter during ATP hydrolysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/transport protein
total genus 104
structure length 371
sequence length 371
chains with identical sequence B
ec nomenclature ec 7.5.2.1: ABC-type maltose transporter.
pdb deposition date 2010-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3puxA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3puxA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3puxA01
1E9BA 4TQ9A 2K52A 2BKEA 1GOTA 1I4DD 2RHMA 4I81A 4M53A 4HAUA 2WJVA 1N6KA 2A6ED 3VR5A 3KJPA 3LD9A 1RVDA 4C0SA 1H8ED 4C7OB 2OAP1 2XB4A 3BJIC 5JS8A 3VX4A 4NTZA 4LJAA 1D5CA 4URXR 1NN0A 3LA6A 3EA5A 4BASA 4LF5L 4B3DA 1IOZA 2E87A 1JNYA 2WBLC 3DL0A 4LF9Q 1TWAH 2JK8A 1MOZA 1T3LA 3SI7A 3J81j 3HOVG 4JI4L 2L0XA 2XITA 2WWWA 4PV1C 2K32A 3AYHB 3IILA 1LNZA 4TSFA 2VL7A 1GJXA 3UMFA 4E5UA 5BWMA 5FPHA 2J9RA 2TMKA 4IO9A 5M5YH 1M2OB 2DFKB 4BLPA 4DCTA 5FTJA 1OW3B 4A2PA 5CB8A 2XZOA 2HYIC 3IIJA 1X65A 5C1BA 2YOGA 2RHQB 2GCPA 1E79A 2QTVB 4PC7A 1Y8PB 1YZ6A 3ADBA 3EAQA 1L0WA 3WWVA 2D5DA 3TR0A 5IP7H 1A7JA 1R5BA 1TKWB 3LVRE 1CKOA 1X8KA 3CZQA 2QT0A 5SZIA 3JVVA 2VEDA 4XH9B 5C46F 4TYPA 1TWFH 4LFAL 3A4MA 3ZS8A 4HUQB 2WZQA 4PQYA 2D06A 4RD6A 1SZPA 2A5GA 3PV0A 1D8TA 4L15A 3TVTA 4HLUA 3CCQA 2ZYWX 1SHZA 4DR7Q 1YQTA 4JOIA 4A3IH 3G71A 1VG9B 2CHQA 4IJHA 1H65A 1Z0KA 1P6XA 2VPPA 3KKNA 3ULLA 3TAUA 1XZPA 1GKIA 2IXGA 1W4CA 1RFLA 1PH2A 4UNSA 1K6MA 2OUKA 4Y0AA 1DAIA 5KDOA 2J41A 2GEVA 5ELOA 4A3CH 4MNOA 2P67A 4B2LA 4HIOA 1SN8A 1GAJA 2NO9A 4ZI2A 3U7EB 2O5JC 3EPJA 2R8RA 3LW8A 3UWKA 5HZHA 4POFA 1QHSA 3SDZA 1R0WA 1YJ5A 4TT3D 4RCYA 4RSGA 2R7ZH 4GMDA 2A6EC 2D2EA 4LYAA 3A5ZB 3T61A 1B70B 1YZLA 4A3FG 4HDQB 4M1KA 5HZKA 1GRRA 1EUJA 1X1SA 4KFSA 2B21A 4G1UC 3GLFE 1VQPA 1H8HD 3CH4B 4PHTA 1IBML 1X1RA 4V02A 4IFBA 1KNQA 2RGDA 1UDWA 2FSHA 4POAA 3OW7A 2UXDL 3JZMA 4B3XA 2XGTA 2F43A 4G5GA 2JEAI 5JEAG 5K8UA 5C44H 1KI3A 1FJGL 1NI3A 2REXB 5JCPA 4QC2A 4D81A 2PMDA 4A8JA 1EG7A 3LRPA 2NVTH 3I62A 1U8AA 2QP4A 1ZM4A 4CEIA 2HIXA 3A36A 1MO4A 2DFTA 4Q02A 1QRAA 1TEVA 4MRSA 4M9QA 2W0SA 1DD2A 3H3VI 4LHYA 1FOEB 1KSHA 1EWIA 4LFCQ 1LY1A 5FFMA 2A2ZA 4BFWA 4DLSA 1V8QA 4L5SA 2HT1A 1A63A 2OWOA 3AKDA 3LVQE 5IY0A 2VBCA 2ZANA 4OJKA 5FJ8H 2PEZA 3CCMA 3KB2A 3OAAD 1N36Q 1SLJA 2GILA 4FD2A 4GOXA 1WOCA 4Q9JA 4EJSA 5JBQA 3VR2A 1ZMXA 2FJUA 2IHEA 5H68A 4RFSB 4EKDA 3OE7D 1R0ZA 2QG6A 2HHHQ 1XTQA 2PCJA 1NMFA 2JA5H 1XMIA 5G3YA 4BFVA 1N6IA 3MMPA 3SYLA 1AE2A 3ULJA 1XMOQ 2C77A 2P65A 2QN6A 5CJ2A 1E2JA 3GLHB 4DCUA 4DC9A 5G40A 2WWXA 4TZ6A 1I94Q 4IHQA 4QNRA 2Z4SA 3GDEA 4I1OA 3WYGA 4E07A 1XFAA 4WAUA 1FPMA 1HH2P 4Q4LA 3HPQA 4JI5Q 4RFSA 2EWWA 4M0LA 1IBRA 3PJRA 3FHWA 2G83A 4N0EA 4RCNA 1DPFA 4QGHA 1U9IC 1FNMA 1AQUA 2OTJA 1W4RA 2A78A 4KLKA 4Q47A 4HR7B 1F5NA 4JC0A 4DR5L 2IHBA 3H0KA 4LK1C 2WIAA 4D2IA 3CC4A 1QVFA 2QORA 2J3EA 1G41A 4AKGA 5GJCA 1GKHA 4Q1DA 3FFAA 1Y3AA 1G7SA 5JWRA 4UJ5A 3VFDA 1L7VC 5JWOA 4DJTA 1G18A 2CLSA 2JLZA 1NVXQ 5BN5A 4CT5A 2ZVPX 1NG1A 1XCGB 4M21A 1HZAA 2PJZA 1HQCA 5DSZA 3CRVA 4DAMA 1VF7A 1ZNXA 3B1YA 1N5IA 3HYTA 2F1RA 5IYCH 4MRPA 4DR6Q 2PBRA 4KXFB 5GADl 4KBFA 3CP0A 4A3JH 1VHTA 1HEIA 1J99A 3QKSB 2UXBL 3SBEA 1E3MA 5FTLA 4B3RQ 4JYAL 4OX9L 2NMVA 3M4YA 1J8MF 1YZUA 1AE3A 3CPEA 1A82A 3IO5A 4TYWA 4OWXB 4FN5A 2Z5FA 2ZSBA 5H1SE 2GCNA 3PEVA 1E94E 4DWJA 5CB6A 3SGIA 1KI4A 1HNZQ 4QBIA 2JGNA 2IUUA 3MWLA 2JDID 3QKSA 1XD2A 1OFHA 3IRBA 3Q7QA 2F1JA 4DR3L 1L4UA 1Z0JA 1Z22A 1RIPA 1M90C 1YVDA 2ZE7A 3RLFA 1NVVR 2A5DA 4KU4A 4NKRA 3N6RA 3ERSX 3NVAA 2EIFA 1HQYE 3R7WA 4LJZC 5C0XH 5GROA 4DV6L 1Y1VG 1EX7A 2QU8A 3HOUH 3T56B 5GAHC 1KK3A 1Q86C 1LS1A 2YTXA 3BK7A 3HJNA 4IDPA 5FBQB 3CWZA 1ZVQA 4NDZA 5TB5A 2JJ2A 3RWOA 2WJYA 2IBMA 2OFXA 3D8BA 2EJFC 5GADC 2GN5A 4A3DG 3F3YA 2OBLA 4G7ZC 3S15H 3U50C 2GK6A 1KHIA 1KIMA 1KJWA 1ZP6A 2Q9CA 3B7GA 1RJ9B 3DM5A 3GMTA 3U61B 3THYA 1EXMA 3KXLA 2ZI5A 3DKPA 1KSFX 1P3JA 5AK0A 2XEXA 1IXZA 3AVUA 3HOYH 2MMCA 5BR8L 3KL4A 4DLRA 5IT9c 4JLVA 2WJJA 1P7CA 2BBTA 2D3WA 4BEBA 2WMNB 4NXML 5CM9C 4QJFA 2REOA 1R2QA 1ZC3A 2AK2A 3K7UC 1PH3A 4XVQA 4G5RA 4C30A 3F2BA 3T1QA 1KRTA 2UXCL 5HKKD 3LV8A 1U8ZA 1E2DA 3H94A 4A75A 1P2VA 3R9WA 1A62A 1W0KA 2OSBA 3IUYA 4DUYQ 1XNQQ 2V3CC 3GJ7A 4MH0R 4PHFA 3DM9B 4RCZA 521PA 5FPSA 4US2R 1T8TA 2X2EA 1Q21A 1A2KC 5C3EH 2JJ1A 2YHSA 5IYBH 1S9HA 3NEYA 4M1SA 1AH9A 5EAYA 1FR3A 3E70C 2OG2A 1X54A 2FMXA 3W3AA 1H9RA 1E1TA 4QBGB 3C14C 1DAGA 1DO0A 2LKCA 3L0OA 1LABA 2WKRA 3FFBA 1S3SA 1G4AE 4C4PA 2Z4RA 1KI1A 1AS0A 3ZVRA 2ZU6A 3C41J 3LDAA 3K0FB 2ZM5A 4DV3L 1SQ5A 4DT1A 3A4NA 1N2CE 3I8XA 4F38A 1JMCA 3AF0A 3A4LA 4EQ6B 2FZLA 2VYFA 1C4OA 2QMHA 2BA0A 3FPAA 3AM1A 4QL3A 1SVOA 221PA 2IYYA 2VF7A 2E9SA 1W49A 2ORVA 1GUOA 5G53C 3NE5B 4A3EH 4DKXA 3I32A 1R5NA 4CRWB 1Z47A 2EFDB 5F9FA 3DVLA 1VF5C 2IYSA 4BZQA 2AKWB 2PL3A 4EQ6A 3DXJC 1BMFD 1D8LA 3AKYA 4UNQA 4UNRA 1SR3A 2VQEL 2ZYVX 3FKIH 3QKRB 3A6PC 3FWYA 3PIOA 3LBHA 2Y0SE 3W5OA 4PPFA 2J7PD 2KCTA 1OH6A 4NBSA 4A3KG 4UXJA 4IOJA 3TSWA 2MSEB 1ANKA 1S4QA 2CKZB 2ZS7A 4J15A 1HT2E 3UK6A 1E32A 4U02A 4BFXA 1QHGA 4RD4A 3GTJH 5C18A 4GOPB 1WYDA 3HKZE 3QKRA 3C16C 3Q85A 2LXJA 1UBGA 3B8HA 4QHTA 1JJ7A 2YOFA 3BGWA 3JAMi 3BERA 1GZSA 3IFTA 1Z6HA 4DV0L 4Z54A 821PA 5HR5A 1OFUX 2N8NA 3J80i 1FNNA 1U81A 3ZQ6A 2VQFL 3ZVMA 1SVMA 2IW3A 1VQDA 3BB4A 1JXMA 1MH1A 2H1LA 4GOPA 1VQLA 3LAWA 1M7BA 1T3SA 3I4LA 4BY1H 3QF4B 3QXHA 4JBXA 4D25A 2WSSA 3I7FA 5EXSA 3CPFA 1N0UA 3QOFA 1EQRA 2IYVA 4IOLA 5IWAL 2X8AA 3B6EA 3CBQA 4MGYR 3EIVA 3Q7PA 3ZLJA 3DOEA 2IS2A 2W2TA 4IDQA 3TEHB 3RHFA 4P74A 3WY9A 2ZI9A 3NBHB 4B3SL 4BLTA 5EXPA 2W58A 3CNNA 4BZXA 4JL6A 3A1TA 4DK1A 1Z06A 1QG2A 1QG4A 2LXKA 1G8YA 4LWCA 4DR1Q 1G6PA 2ODWA 5JEEA 3GTQH 5KU1A 1W36B 1AK2A 4P71A 2N46A 1E4YA 2I5HA 1IBKQ 3RR5A 1GO3E 4M22A 4YHHQ 1KAOA 2EFEB 3OYYA 1YR6A 2BM1A 2WWIA 4YMTA 4W5JA 5FLXc 2GRJA 4G0NA 1VG1A 5FOXA 1NMXA 2X19A 1HYQA 4DNRB 1ZW6A 4NONA 2KENA 2V4ZA 4QM7A 3LBNA 1SGWA 3OW2A 2ZSDA 4OI1A 4C3IH 4KFRA 3K81C 4ZCMA 4KN4C 1XNRL 2AN9A 3N5CA 4P72A 2QM7A 2GVBA 2CFMA 2IHFA 2MO1A 4LF7L 2Y8EA 5JWHA 2ODEA 3TQFA 4OQFA 1IZ6A 3NHBA 3FHTA 1AZTA 1NF3A 2OILA 3MJHA 3NELA 3NENA 1T5EA 5M3MH 1DBSA 1K5DA 2MSDB 2XNSA 1NVUQ 2GVDC 3MLEA 2CLCX 3HGBA 2VIIA 3X1WA 5DIFA 1I4TD 2HT6A 4JI2Q 1TQ4A 1XEXB 4IDNA 4X6AH 5B64A 4A36A 3S17H 1OHHD 3T35A 2ZJ8A 2BJWA 3P27A 5B57C 3R9XA 5CK5A 3TMKA 4DV1Q 1C7YA 2QL6A 1VQ4A 4V0ME 2ZAOA 3S2HH 2V7QA 1XEXA 4L8GA 2NZOA 3AB3A 3LLUA 4AYTA 1E2NA 4BECA 4LWZA 3LNCA 3RS0A 1MJCA 2VTKA 4BWYA 2FE4A 1VQGA 2Q9BA 2JJ8A 5TVKA 1OYYA 4YMWA 1NY4A 1SXJE 4NCKA 3EZ7A 2EVBA 2WOOA 4ITRC 3KLRA 4OQMA 2OO7A 1PA6A 2O8CB 2E5LL 1E0AA 5K36G 3C15C 2CL0X 2PT5A 3AH8A 3H84A 3QE0A 4TMVA 1HNXL 2GJAA 1YNJC 4LHZA 1US8B 4DXAA 2ZRJA 2DYKA 3ZVLA 3QVUA 1Z6GA 5JS7A 3KYHC 1U5KA 4JI0L 4YONB 3BFKA 3RC8A 2OESA 4NMMA 4A3BG 3KKPA 5CDFE 3K70D 5CK4A 3GEIA 3RANA 1JR3E 3KDSE 2ZM6L 1S8FA 1O87A 4C2MH 2YV5A 4JI7L 1DVRA 2CCZA 1JXOA 4DNTB 1R5OA 5E7JA 4H9GA 1Z07A 1NJFA 3ZJYC 1US8A 3DM3A 4A3GH 2H57A 4Q9HA 1H9SA 2KI5A 4LBWA 3KQLA 4O2DA 2Q6TA 1NKSA 2VW9A 5CIWA 4AG5A 2D2CC 3PSIA 2CBZA 2H8KA 1X8JA 5JJIA 1GRQA 2FFAA 1P62B 3AKEA 4HI0E 4M9ZA 3MFYA 2WIBA 4MGZR 4KSCA 2HDNB 2X2FA 4WVFA 4GZYC 2FZ4A 2QTHA 1OH8A 4P75A 2V1UA 2MQHA 3W6OA 4V0OA 2ASEA 3VR6A 1G6OA 2H17A 1NLZA 3RRNA 3RVBA 2REBA 4BRWA 2ATWA 2W00A 3E2IA 2ZTCA 2HF8A 3QBVA 3KF6A 3L82B 1E1RD 3QEOA 2ZPTX 4LZZA 4JYBA 3UWOA 1GUNA 2JA8H 1M7GA 2N1BA 4B47A 4QRHA 2RGCA 1EESA 4S35A 3NKVA 3PUWA 2A1AA 4FCWA 4GRAA 5FL3A 1RPZA 2J46A 1QJOA 4Q1BA 4JLOA 1YJWA 2ZS8A 4L9WA 1Y69U 2IHYA 3B6YA 3VA7A 1C1YA 3QXSA 5AJZA 2OCEA 1TU4A 2XXAB 2KE5A 1O7LA 3CF2A 5GJVC 2V1CC 1JR3A 3I72A 1XTDA 3U4ZA 1PUJA 2F6RA 2OFOA 3GJ5A 3I8SA 3U44B 1GUGA 2EVWX 4P0TA 4A15A 1TTTA 1HR0Q 3AVVA 4X66Q 4B3TL 3GTLH 5JRJA 1Q12A 1E9RA 4UP8A 1M74A 4LJ4A 1XJVA 1CKMA 1NVWQ 2BJVA 4PO1A 3S1RH 2ZREA 3SC3A 1VQAA 3L43A 5A0FA 4LFBL 1ZUNB 3ICEA 2V55B 3K8AA 3A8KE 2BKUA 3EZ9A 4M9SA 2SHKA 3U44A 3A7LA 1G5RA 4NYIQ 1IBLQ 2AR7A 1KI7A 2VP9A 3VNUA 2VP0A 3K70C 3Q5DA 4JV5Q 2KSQA 4GNXC 5DHFA 1E0SA 2CMKA 2UVQA 4JL8A 1OXUA 2F55A 1VS0A 4MITA 1XPUA 2JE6I 4A3LH 3QKTA 3QXCA 1U98A 3VNVA 4Q48A 5B58C 3FKSD 4Q4HB 4WBSA 1BYUA 2RHSB 2UZIR 2JLWA 2WWHA 1KI2A 2LSSA 1VMAA 5M5WH 1E69A 3A58B 2R6GA 3CR8A 3RS3A 3SN6A 3K9NA 3RWMB 2H16A 4P4SB 3VMFA 4QL5A 2CE7A 2PZFA 2P6RA 1UFQA 3AP2A 3NC0C 4Q7MB 4Q4HA 1ZM2A 2ZETA 4AYBG 4R1JA 3J81c 1LM0A 3HOWH 2R93H 1G3MA 4JLNA 2ZVQX 1XU4A 2HCBA 4EPTA 3I3SR 4NXNL 2XTMA 2GJSA 2PX0A 4XTCS 2DB3A 2Q2UA 2V8OA 1B8AA 2F4VQ 3EIQA 4FMDB 2K14A 2BDTA 2ERYA 2IXFA 1RIFA 3GLGE 5F98A 3W8RA 4DV2L 3TSZA 3PUZA 1XJCA 5EP1A 1VQOA 1P61B 1Q44A 1WFQA 1A5TA 1VQBA 1UADA 3DLLA 1YIJA 2ZE8A 4IFEA 2OFWA 4X8MA 2ONKA 1BVSA 5M5XH 3W8NA 1WXQA 2D0OA 3K0AA 5CYOA 3FHOA 1MRSA 1W48A 3ZH9B 4R71A 1SMXA 5EQTA 3MUFA 4G5QA 5EZ6B 1CS4C 2GF9A 1PYSB 5IK2A 4FMCB 4TYYA 3O47A 2AK3A 3ZD6A 3WMEA 4BXXH 2VZAA 2R6DA 1LS6A 3BC1A 3THXA 4KYUA 2B63G 3F2DA 2UUBQ 4B3MQ 2VA8A 1PHJA 2G3YA 3GTMH 4URYR 4JBYA 4L8JA 3MRSA 2XAUA 3D6TB 4CEHB 4Y52H 3I4MH 2ASBA 1NMGA 4AD8A 2GBLC 2QSYA 3L7ZC 2QBYB 2Q3MA 1XTKA 4DLUA 4QG7A 1RYFA 3CX8A 3K80C 4LCBA 4AKEA 1K8MA 1UE1A 1UM8A 2K5HA 4DR4Q 4RG1A 1QUQB 4AWXA 4YY3Q 2K7VA 4M9XA 3IQXA 2GA8A 3RDPA 3W5JA 1T4GA 1VYTA 2OCBA 4IJLA 1G21E 4QHYA 3TR5A 1ETUA 2YVUA 4PTLA 1D9ZA 3GLGA 2QBYA 1XMVA 3CAMA 3AVTA 5SZHB 5UKDA 3MGCA 1KMQA 5IT5A 5FL7D 3H1TA 2RGNA 2CWPA 4ME3A 4BBRG 3AKCA 3CMAA 4KLZA 2CNWA 1QDEA 2F7SA 2VSXA 4A82A 5IP9H 1E2EA 1QUQA 3GJXC 5E4FA 3EPHA 2ZJBA 4TLEA 3S16H 3AVPA 3GLIB 1PH8A 2JLRA 4JI6L 4TL6A 1HCZA 1EWRA 2Z0MA 3T06B 3NBXX 1XPOA 3WRXC 4C0HA 2BEKA 1GL6A 4R4QA 2B3GA 5AJVB 4OHWA 1IYVA 2F3TA 3GLIA 3E9IA 1OV4A 3RZDH 1VQKA 3NG1A 3CD6A 3X1DA 3SFZA 5JEAJ 4BLQA 1KZGB 1MKYA 5L3SB 4X65L 1I2MA 3TS0A 3IBGA 4MUBA 4OQNA 1XWIA 4EFNA 2XTZA 4L5BA 3NIBA 3M3YH 2GJ9A 5BN4A 4C2UA 4FIDA 4F92B 2YTVA 4DLYA 5FLMG 4DUGD 4B44A 1MT0A 1G3QA 2CCKA 1S3OA 2KB0A 4JJZA 4KJZA 4WXPA 1A2BA 2ZTEA 1HNWQ 4M1WA 1N9WA 1G8GA 3T1HQ 1NRJB 2NO1A 3K53A 3QVVA 1E2PA 3U60B 4ZCLA 2LKDA 1FL0A 4HJ5A 4DR2Q 1U90A 1TU3A 2BOVA 3OEEA 3RS7A 2GTPA 4QFMA 1RW4A 4B6EA 1XXHB 2XJ4A 4EDHA 2NZHA 3CO5A 4D26A 3JZAA 1L4YA 3NDBB 3VKHA 1N32Q 3PF4A 5A35A 1KDRA 1SKYE 5B30A 3NEMA 4M1OA 1HH4A 3GFTA 3RS5A 5LBIA 2W6JA 4GLXA 3KLWA 2JA7H 3HOVH 1L8QA 3QPVA 4Q03A 4FDBA 2OZEA 3TRZA 3A8IE 3MJRA 4TWZA 4IVQA 4LUCA 5CJPA 2XOKD 4G5OA 4PSVA 3IHWA 3S1AB 2GCOA 1ELOA 1N5JA 1ZM3A 4TL8A 1CRQA 5DH9A 4B73A 1IONA 1N6RA 1K8GA 2CK3A 4LGMA 2C9CA 2IWHA 2FA9A 2R92G 4YWKA 2AWNA 3G82C 3IGFA 4GMXA 1S72A 4MKIA 4RVCA 4A0GA 1N33Q 2ZUDA 2FGJA 1T3HA 3NTUA 4R2IA 4LHWA 2GVAA 2QMOA 1SVIA 4TKOB 4A4IA 3DPUA 4POGA 2ZT9C 3OEHA 3QI2A 4IQZA 2IXEA 2W6IA 4OI4A 2Q8IB 1U0LA 2NO6A 1R8SA 2ZRPA 4IDOA 2R6FA 3U58A 2A30A 2XTIA 3CNOA 4IPHA 1VECA 2ORIA 2NO7A 4A0HA 1GIAA 1QHNA 1XZQA 2HUPA 3HU1A 5DO9A 4OXPA 1LW7A 3AFQA 3PEUA 5LMNL 4Q1FA 4DCVA 4DEYA 3KFXA 1NMZA 2IEYA 4TN1A 1X6OA 5FUWA 1G17A 3CR7A 2WAQG 2BCGY 3UXMA 3PEWA 1TX4B 1YEZA 4OGQC 1NBME 3Q8XB 5AUNB 4DV5L 1VQ8A 1P75A 5KDLA 1Y63A 2NZ8A 3IO3A 3ULPA 3S1NH 3H0GG 3ZYCA 4DV4Q 3U3JA 1EFCA 1RKBA 1WI5A 4PQRA 2E2JH 4TL7A 1XJQA 1CRPA 3M1IA 4Q00A 5GJBA 4RZ3A 2R7DA 2DGYA 1Q3HA 1VQEA 2N78A 4JI4Q 1UBFA 1ZM9A 1G16A 1E98A 2FWRA 1CIPA 4FCVA 4LF9L 4NCHA 4KODA 4JBKA 2P5TB 5FOTA 3RRYA 4HAVA 4Q7KA 1CBUA 1EYGA 4DDWA 3A1WA 3AP1A 5DNYB 4G7HC 2FXQA 1H9JA 5JJKA 1CR2A 1TWHH 5AJ3L 1YI2A 1U94A 2O0HA 3MAAC 4P31A 3TW8B 4YCVA 3GJ8A 1NTGA 1BKDR 5KHOC 4Y0VA 1D9XA 4H1VA 4XD7A 3C7KA 1TPZA 4LJ8A 1V9PA 1GUAA 1E0JA 1UE5A 3U9SA 2YC2C 3UATA 5KSZA 3D7MA 1WB9A 3UDIA 1J5EL 2N3SA 2BMFA 3OFND 3WNBA 2EJGC 4LFAQ 3CUEF 3ETLA 5LDDC 3PFIA 1FP7A 4AKIA 3PG5A 2EFGA 4OWWB 2RB4A 3CW2A 3DMDA 1NBMA 3EARA 5IYDG 1XTJA 3QF7A 3TE6A 2PMZE 2PJRA 4LF6L 4X64Q 4JBJA 1JQLB 4OO1G 2YU9H 3R20A 3SFVA 3ZIAA 5LMUQ 1M34E 2W2VA 4JVNA 1IQPA 1U0HC 2GEUA 3BH7A 1P2TA 1KYIA 5JI3E 4DR7L 5LD2C 2DUDA 1CSQA 4X8HA 1G64A 1VG0B 2VLIA 4HUTA 1Q8KA 2IEZA 2F43B 3BU2A 4OO1I 1CJVC 4JG2A 4AH6A 2NG1A 4EUNA 1SVSA 1GL9B 2OLKA 2WJHA 1OJLA 1HQMC 4A8JB 4HAZA 1N5LA 1EFUA 3HPRA 3SHFA 4X8OA 1E2FA 3P1JA 3TBKA 1M1KC 2J0UB 3ZQJA 4CEIB 2PI2E 4LW1A 1CFMA 1QZXA 1G1MA 4GPTA 3KJIA 1GUSA 4JVLA 3Q8DA 1GNPA 3H15A 1PV4A 1MO5A 3PQCA 1EIFA 3NEJA 3AQ4A 1D7QA 3AB9A 1J6QA 1NJGA 3ADDA 1DXMA 1OT3A 4NPSA 5ELXA 1P8LA 2QROA 5K8LA 3ZS9A 3U7FB 4Q1CA 3WMGA 2FSGA 2J0UA 2UXDQ 3ADKA 1XPRA 4EJSB 2JLVA 2WPDA 3RC3A 1FJGQ 4Z8XA 4Q7JB 3EWSA 4HAYA 4ACBA 5DYIA 4BEJA 3VR4A 4DCSA 4BLSA 2KCCA 1KRSA 4KHPL 2HLDD 2QRNA 3SJZA 4EPVA 1EQQA 5GVSA 1GRNA 3RRMA 3ZGXA 1A6XA 3K0SA 1L1OC 4O2RA 1XNJA 1Z8FA 3GTKH 1DG1G 3GLFB 2ODBA 2K50A 4MQBA 2XZPA 1KIXA 1JI0A 5IP7G 3O8DA 2FPKA 4DEXA 1LV7A 1W0JD 1JAIA 1W5SA 5C4MA 4PO8A 1N25A 4DPGA 2P3SA 3VQTA 1K8OA 1IAQA 2WB1E 3ZZUA 2QGNA 5FR2A 1N36L 1G51A 2EDGA 2JIZA 1GITA 3PXGA 5KSOA 1ESMA 4IXMA 5EE5B 3GLFA 1KO1A 1AM4D 2PI2A 2G1JA 4C0KA 3JC66 4PFSA 2AMCB 2FNAA 2HYDA 4GSYA 1BYIA 4KAXA 1E2HA 5KPJA 1KDOA 1S96A 3NWJA 2E74C 2ZITA 4WXRA 1GVNB 3GQBA 3B2EA 5EXTA 3NC1C 2YWEA 1I94L 4A3CG 4M1YA 1ASZA 1NN5A 4QQBX 4IFDH 2PPBC 3EC1A 2ECKA 3A1VA 4I1SA 4EFLA 5KTYA 3SNHA 2Q2HA 2EQSA 1WRBA 5DI9A 2AXNA 4HLDA 4B35A 1DAFA 2PNRC 1Z9FA 2Z6VA 4NYJQ 3U4VA 3TUIC 4R4OA 4AYBE 2BIFA 1P72A 1X86B 2A9KA 3B85A 1D2MA 4JSYA 2ZSAA 2AFHE 2QSZA 4GOKA 1VQFA 4QJ3A 4NB3A 1G9XA 1Q1QA 3KQUA 2ATXA 1LUZA 1XB2A 2ZYTX 1J8YF 1HZBA 3U7GA 4TSFD 1XD2B 2B8FA 5C44G 4D0GA 3OTOQ 1OFIA 1B9MA 3QQ5A 4AQYQ 2FEMA 3NBYC 1OIWA 1VCOA 1OF1A 2KA7A 4ILEA 3OPOA 3R7WB 2G9NA 2N42A 1Y1WG 2RGBA 2OXRA 4F4JA 4EIWA 4DLXA 2UUAL 4GNKA 2UXBQ 1IW7D 1AS2A 3CCRA 4UY8C 1R10A 1E79D 1N6NA 1UKZA 3RLNA 1WF3A 1VKJA 1ZU4A 3CF6R 3DMNA 5KO2A 3C4JA 4CEJB 1WE2A 4DK3C 4B3RL 4LF4Q 2O5IC 1WQ1R 1OKKA 3CF0A 1V43A 4ACAA 1TQ2A 3HDTA 5K8IA 3SQXA 2QEXA 4MYUA 2PH1A 5FJ8G 2K5UA 2RMKA 1LYLA 1HTWA 3T34A 5KPDA 3FMOB 3AF2A 4NCIA 3UPUA 3FMCA 2P0EA 2YTYA 1N3BA 2R6AA 1XMQL 4DR3Q 1ZBDA 1VDZA 1G5TA 4CEJA 4FWIB 4IPDA 1E1QA 2OCPA 2BDOA 1OB5A 2JA5G 2Z6KC 4DV6Q 3Q5EA 4RD1A 4HLQB 3W34A 3WNCA 1SHKA 1BBWA 5BN3A 2WP8J 4BFUA 5JZVA 1FYCA 1KDTA 2J45A 2PT7A 2H18A 3N70A 4K81B 2AKAB 2OAQ1 1X3FA 5HCNA 4GFDA 4EPYA 3LGJA 5DISB 2ZJAA 2QPOA 4KKTA 2J0VA 2K75A 3B9PA 5P21A 4EPRA 3GO5A 5BR8Q 3H86A 2IL1A 2VP6A 4M1TA 1NLFA 4OHYA 4PXAA 5E7NA 2ONJA 5CIQA 4BZPA 1V5WA 1CR4A 4WIAA 3SYNA 3PCOB 1XDBA 1Q90A 3HOZH 2NPIA 2QI9C 2VRWA 3KX2A 4KYIB 2QPAA 2C8VA 4DT1B 2RAPA 2Z43A 4LV5B 3L2PA 2Z83A 4N0DA 4Q1AA 2GZDA 1NNEA 2P6UA 1CULC 4JLBA 1GHJA 4OK6A 5GJWC 4IFDI 2PZEA 1P4SA 1GVPA 1FFHA 2ZJZA 2XGJA 3F8TA 4DUZQ 4QBHA 4AURA 2FFHA 1XNQL 2MO0A 4V0KA 4N1AA 2RGAA 121PA 2F3RA 4CVNA 1W7AA 2DR3A 3QXXA 1UBEA 4MRRA 4JJKA 2F9LA 1VQJA 1RL2A 2OBMA 2W2XA 2Q0HA 3BH6A 1B0UA 5AR1A 1WJJA 2QAGB 5AWFC 2FF7A 1IW7C 2XNDA 1N0WA 4DIEA 3RNLA 1IXSB 3ADCA 2C5LA 4Z8YA 3SBDA 1BO6A 1ZU5A 1X3SA 2IX0A 2JA6H 2C2HA 1YHBA 1LB1B 3HU2A 2QT1A 2WAXA 4DRZA 4QGAA 4KV9A 3T53B 5LPNA 3MCAA 1KNXA 2QAGA 4C0LA 2BH2A 2WJGA 4G3XA 4LV8B 1WCMH 2FH5B 5C0XG 621PA 1KO8A 3F5FA 5M3FH 5J4KA 5FPKA 4JI8Q 1N6HA 1DAKA 4HLUC 4URWR 3WHLA 4DLZA 2NN6H 2VQEQ 1Q0UA 3ND8A 4I7ZC 2ZAMA 4NCNA 3FDIA 1E2IA 3G6EA 3D31A 5C0XI 2C03A 5BYJA 3M7NA 4HB2A 3I56A 2IS6A 1ZIOA 1I3QH 2CL7X 4UNPA 2ZJQA 1JT8A 4XVRA 1NY6A 3SHWA 3THWB 3HOYG 3B82A 4D6PA 1JPNA 4ZIRA 1QF9A 3IHLA 1GD7A 4ZKDA 4KKSA 4JCVE 1P2SA 2CJWB 3V9PA 1PH6A 4DV7L 4JKYA 4YCWA 2KJQA 4TL9A 3CNLA 3KXKA 3THWA 2VQFQ 2D4HA 3D3QA 1PLLA 3IDQA 3ZIAD 3ZD7A 2C35B 4TLCA 2IYXA 1JJCB 1MRNA 4RD2A 5C3EG 4ZO4A 1AKEA 3K0XA 2CJWA 1Q3TA 3KKOA 1P5ZB 1TUIA 2I1QA 4RZUA 3SE0A 5IF9A 421PA 1ZNZA 3KJOA 1W2BA 4L5RC 1DO2A 4A8JC 3C5HA 2FPMA 2AD5A 4B3SQ 2ZRLA 2DPXA 2WAQE 4F93B 2HV8A 1I5FA 4B3CA 3WDNA 4K0KQ 1YR8A 5K36H 1HE1C 3CRRA 3OHMA 1PYBA 4KMUC 3CX7A 3LH5A 2XSZD 4MUAA 2NVQH 5TDHA 1TXYA 1FTSA 2PX3A 4NYMQ 1NLYA 4M1MA 2NQ2C 1YR9A 1N0VC 3W1BA 2J5XA 2Q3HA 1IBKL 4EJSC 4RMFA 1FMLA 2A7QA 3LY5A 4YHHL 4LX0A 3RNUA 4JKIA 4LJ7A 2KBFA 5GVRA 4B75A 2E2IH 1DTSA 2ZE6A 5J40A 1XJ0A 2P5SA 2ZROA 2A3RA 5TV2A 2CE2X 4TMZA 4C3HH 2ZRBA 2CXXA 5EUQB 3CXCA 3FKIG 4HJ9A 2UUCQ 1XNRQ 2I3BA 2JJ2D 4NYIR 4BBSG 3LQQA 3WP1B 1NL3A 2J87A 5HGQA 3P4XA 4LC0A 1UKEA 4ZPXA 3FPPA 5J3BA 3TSOA 3NXSA 2A5FA 2JA1A 2I1VB 1KY2A 2N49A 1X56A 1ZD1A 1EFTA 4RD3A 4XIGS 1PH7A 3VU9A 4CGZA 2FV8A 3PF5A 2E8GA 3D0FA 2B92A 1XX6A 1XMJA 1OXSC 4JI2L 1QVAA 3KXIA 2JASA 3OF5A 1W1WA 4IEEA 3U4QB 2B8GA 2H5EA 4B3BA 4R4TA 2ZXUA 2EYQA 3E0EA 1K8AC 1N34L 1EK0A 1W0KD 3RABA 3V00A 3TUZC 2V6IA 4DV1L 2KBEA 4BY1G 1ASYA 4XOIA 2IYZA 1IXRA 2JJ1D 4PZLA 2ZRCA 3BJUA 4YDSA 4GBMA 3AVWA 5JFGA 3HOXH 2NZJA 3U4QA 1H9SB 1U0JA 1KKLA 4M8NE 1QHXA 3RLOA 1TADA 2IUSA 4LNQA 3CPHA 2UU9L 5JLJA 2E5LQ 1S0UA 3SS8A 1KOFA 2HEIA 1SRUA 4XJXA 4DB2A 1HNXQ 4UP7A 4G5SA 4ESVA 1KZ7B 3FHCB 4R4IA 2ZRKA 1KK0A 4KITB 4LOAA 4A3MH 1FP6A 1TQDA 4JI0Q 5DN6A 4JLMA 2H7VA 3VKGA 1PVOA 1CTMA 2G0NA 1H9KA 4PSKA 3KF6B 3LXRA 3AF1A 1AS3A 2ZM6Q 1KMHA 4GKJL 3L0SA 3AVQA 2GXUA 1SXJB 4MRVA 1CXZA 4WZAE 4GKKQ 2BBSA 2QE7A 1LF5A 1VHLA 4UPAA 1HE8B 2QAJA 2XX3A 3BXZA 4V0MA 3TUJC 1F2TA 5J4YA 3ZDQA 4IOCA 1SKQA 1UEIA 4AIMA 3CONA 4UJ3A 2ERXA 4GDFA 1R7RA 1IN8A 2CW0C 3PR1A 3VHLB 4YLGA 4FW9A 4GLAC 1SXJA 1QHHA 4Q21A 4ZI3A 3L8YA 5EP2A 5LB4A 3J80c 3CM0A 1Z7TA 1G7CA 1N6LA 4GP6A 4D82A 1MR3F 2J59A 3HWSA 4O2LA 1AJEA 4HJAA 1ZNWA 1G7TA 2FN4A 2QQEA 1PJRA 4O25A 1K8RA 1PUIA 4Q5IA 4L9SA 3QIAA 3BBPA 5CDFA 2F9MA 1S1CA 3CCLA 1NY5A 1RYHA 1U8YA 4LJYA 2A68D 4LRWA 4B6FA 5HE8A 2OHFA 1OSNA 4A6PA 2DN8A 3MWKA 1KI9A 1R9TH 4ZCIA 5L3VA 4QOSA 4YWLA 2QTFA 3KDFA 4X62L 1I2DA 2WSSD 2YOHA 3CC2A 4BY7G 3HU3A 3A8TA 4IXNA 1D2NA 2ZTSA 3PCRB 4P73A 4ZV4A 1RC8A 2O0KA 5F9HA 1COWA 1XCPA 2WKQA 2F1IA 1Z5ZA 2EW1A 4B3TQ 1ZC4A 4URZR 2WB1G 1XTRA 5C2JB 4QY7A 2E2HH 2OQ0A 5AJYA 3TZUA 3KB1A 3UE0A 2Z0SA 1HR0L 2ZS9A 1K83H 4X66L 1E99A 1L2TA 1ZINA 3KJGA 3I61A 2VL6A 4LFBQ 3I4OA 4JLAA 3BZKA 2V54A 3MXUA 1FUUA 2C78A 2JATA 3T1VA 4C3JH 4TLDA 1WMSA 4UNNA 1E2LA 2GAAA 4ARZB 2I4IA 3U6BA 4OK5A 1P9NA 3CCUA 4Z51A 3KKQA 2J1LA 2RF4A 3SU8A 2VUMG 4A3GG 1EFRA 5DE3A 4LUZA 1TMKA 5DI3A 1W36D 2IYTA 2B8WA 4HB0A 4JS0A 2GK7A 3DO6A 4LBYA 5EE9A 4B3FX 1CLUA 3EZ2A 4ARZA 3CC7A 2GAOA 3GFPA 2GXSA 3PENA 3K1JA 1A8VA 2OEPA 3AP3A 3A5UA 1AGRA 1YRAA 1J70A 4D4JA 1YR7A 3K0AB 4JI1Q 3I1FA 4R98A 2QQ0A 4HAXA 5EP3A 3AEVA 3GTPH 4NXNQ 3VDYA 2MMGA 3GPLA 3LFUA 2IS1A 4PZ8A 1CJUC 1CI3M 1NP6A 4Q66C 1OXVA 2V1XA 1NMYA 1ZCBA 2FFBA 2GESA 2RGXA 3STBD 2OCAA 3B60A 3KQNA 3THXB 4ALPA 5GAEC 4DV2Q 4NCJA 4LHVA 4NH0A 4WZBE 1II9A 1UDXA 2A68C 1E96A 1W4BA 2V7QD 3A1UA 1BDOA 2JQOA 1JEEA 3W6NA 4Q19A 2ZU0C 3HYRA 4FI3C 4UXHA 1GP2A 4BUJA 4GOPC 1BIFA 1JR6A 4Q18A 1UJ2A 2ZUBA 1N8RC 5TY0A 2O52A 1G7RA 1PH9A 2AHOA 2BMJA 2VP4A 4LHXA 4LI0A 4NPHA 1KXLA 4KSBA 3SR0A 4U5XA 5EE3A 1H8EA 4PZ7A 3I4NG 3L0PA 3RAPR 5FLMH 4B34A 3GLGB 1KGDA 3BORA 2AWOA 1KAGA 2KWIA 1K9MC 3B1VA 3KZ1E 3K09C 2H5XA 1F2UA 3CIOA 3QNUA 4RY2A 1K5GA 3UDXA 1T0HB 4PC3A 2AKYA 3ZZTA 4BFTA 3EIHA 2EQBA 4AC9A 4RZXA 1BH2A 5FBLB 2QZ4A 3CH5A 2UUBL 2PNHA 4B3ML 2NVYH 1KQSA 2I0QA 4A93G 1GTVA 2FOLA 2WICA 2ZUCA 3RYTC 2L15A 1CJMA 2IX3A 1W47A 2DFNA 2IF2A 4GT1A 5EUMA 4GN3B 4A3LG 3GJ6A 4O0AA 4MRNA 1MKHA 1YITA 1K73C 1MJEA 3FVQA 4TZ0A 3BFXA 1E2MA 4OQXA 3REFA 4TTQA 3B1XA 1W36C 4DR4L 3QSYA 2QA5A 4WJ4A 1KSGA 5CITA 1SVWA 1L1OA 2O8DB 4C0JA 3FTQA 3L2OB 2VNUD 5D3MB 4DVGA 3V4RA 3GJ4A 1T91A 2JEBI 3HR7A 4ASUD 4MA4A 2VHTA 3HOWG 2R93G 4TMKA 1DELA 2CVHA 3KOJA 1F3OA 2IYLD 3A7AB 3M85A 3PO2G 2HJGA 2WVJA 4LK2A 2Q2TA 2PQAB 2ZRMA 1X9NA 1F6BA 1M6NA 4MGKR 2D0PA 3BWDD 3UMSA 1V1QA 1IYUA 1C9KA 5D3MA 5G41A 1Q7YC 1PLJA 1T8UA 3SJBA 4PSAA 2DFLA 4B76A 2LMCB 2OV2A 4H44C 1GKUB 3F2CA 4KFTA 4DIDA 1KO4A 1YJNA 1AQYA 3W1GA 3STBC 3MSXA 1XD8A 1S40A 2WWYA 4BFZA 3BDOA 4OI0A 3BZCA 4X65Q 1GILA 2PQAA 3S2DH 3CF5A 1R6BX 3CCSA 1U9IA 2RGGA 2YNMA 1JR3D 3T1YL 3B1ZA 3AGPA 2ANBA 1U2RA 3RSOA 4AYXA 2MSCB 4W7SA 2FU5C 2R7FA 4H13C 4XWKA 4KCGA 4KBGA 4A92A 5JEDA 2J0SA 4DDUA 1M1YE 1X8LA 3DKVA 4JLPA 2IX1A 4PG3A 4TT3A 1G8PA 1XF9A 3HKSA 1Z08A 2QMUA 5F2EA 3W3ZB 5IHPA 1Q81C 2GCOB 1HNWL 5BQ5A 1H8HA 1TWCH 2FSFA 5KUTA 5H8WA 4YQFA 3I5YA 5K8TA 3UG6A 2O8EA 1B7YB 3H0GH 1IY1A 2WTUA 1Z28A 3IPYA 4JLDA 4PHGA 3KUDA 3PVSA 3Q72A 2ZRIA 4LF8Q 4DSOA 4KVGA 3REGA 4MDEA 5LMNW 1N32L 1YHAA 1XRJA 2BM0A 3BOSA 1I6HH 4KVAA 3EA0A 2BHRA 1NN3A 2O8BB 4ZDWA 3QJYA 2VQSA 5KSPA 4P3YA 4MKFA 4LY6A 3AVOA 4PHHA 1NBWA 3F0TA 4HIMA 2ZRFA 1FTNA 2QA4A 2O8FA 1XCMA 4WZ6A 1KI6A 3P4YA 1OTCA 3B9QA 3IEUA 4YXWD 2D74A 1Z0IA 1GFIA 2VP2A 5IP9G 1TF7A 1SKYB 1Z29A 1II8B 2QP3A 3CRW1 3K0CC 2BWJA 3ER0A 3OAAA 4JI3L 4HZUA 2O8BA 2W0MA 4QIWE 2GDJA 4DSUA 1E2KA 3OE7A 1VQ9A 3CX6A 2K5NA 3T15A 4PZYA 5FUVA 1OH5A 2GEDA 1S1MA 2X1VA 2ZE5A 1QVRA 1II8A 3CPJB 5DHAA 2Z6KA 3T5DA 4S2EA 3TQYA 2ZIAA 3OIYA 1SROA 1UPTA 1QVCA 3RN5A 4NZYA 5A5GA 1II0A 4HJ7A 4WW0A 3PITA 2BBOA 2BC9A 4GL2A 2ZRGA 3LXXA 2Q9AA 1UE7A 4Q9LA 3K7AH 4FMBB 4CW7A 2EYUA 4OL0A 3GJ3A 1KHTA 3I92A 5IK2D 1VQ6A 1JEDA 2PMKA 4LF5Q 4DLTA 1FX0A 5IE8A 4DV5Q 1W2HA 1CJTC 2V9PA 5L3QA 4A3FH 1S2MA 4LPSA 1R0XA 5H1YA 2ALYB 2K4KA 2PCFB 4MYCA 2AD1A 4V0NA 5CM8B 4NU0A 3QY0A 1ZD8A 2JLUA 3HR8A 2IYUA 4EQ5A 2ZJOA 5HE9A 1P9RA 2JLQA 1DS6A 2PCLA 5KNBA 1E7ZA 4A2WA 4GI7A 4DV4L 3KF8B 3A74A 2WWGA 3FP9A 2BE5D 3M4QA 1LTQA 4MGIR 5JEAH 4GOJA 3NDPA 5G3ZA 1JBKA 2VF8A 4NYJR 1H9MA 3H3VH 5C4XG 3QPUA 2QGQA 2EFCB 1SVKA 2D2FA 1NJIC 2JA7G 4XVUA 1DAEA 3G5UA 1T9HA 2B7CA 4P4UA 1E2ZA 4DKAC 4RJLA 5AUPB 4DDVA 2FDCA 5FPYA 4C7OA 5DLQC 2KBNA 1ZM7A 1A0IA 5AJ3Q 2YC4C 4IRUB 3RRZA 3CRLC 1OXTA 2KHJA 4LDJA 2VP5A 1ONLA 1HZCA 4HB3A 1VQCA 2AXPA 2CNWD 4YDHB 2R44A 1KC8C 3EC2A 3TAHA 4L5TA 3PO3G 3LBIA 1DAMA 1A1VA 2FPLA 2JDIA 1W3SA 1J5EQ 3OIUA 5C4GB 3EQLC 1Z63A 1KAWA 4IFDJ 3LO5A 4LYHA 3CRKC 3IIMA 1CR1A 2QEQA 3W90A 1G19A 1YZQA 3OIVA 4F7WA 2D62A 2NVXH 3U5ZB 4A1FA 3F1ZA 2E1RA 3GD7A 3A1SA 1CSPA 1YHQA 3FMIA 3UIEA 5AUQA 4A6XA 4LF6Q 3MWJA 1K0RA 4OHZA 1Q1ZA 3I73A 2RKOA 1G3RA 2JJQA 1YBYA 4X64L 2C99A 1D2EA 1G8HA 4LC1A 5LMUL 4WJ3M 2CHVA 4JL5A 2ZRHA 2BV3A 1G5PA 4II7A 5FBWB 3GJ0A 4U7DA 3RZOH 3QBTA 5E95A 3WYFA 4C9BA 4DLVA 1XTSA 4HUQA 4AKHA 3TVDA 3ZVNA 2B29A 3WYAA 2AUKA 4HIDA 4Q01A 4US0R 3THOA 4GP7A 3M4OH 1KY3A 4BLOA 2YWFA 1IBMQ 3GTOH 2QPTA 4BRUA 4OBEA 4R7ZA 2GVZC 1YZTA 1TNDA 2IY5B 4OONA 1W4AA 2GF0A 2IYWA 3K9LA 3OEED 2JEOA 1PH4A 4PC2A 4QHSA 4CZ2A 1Z6YA 2CCGA 3TRFA 3D4RA 3LLMA 1LVGA 2WFWA 1G291 2F52A 5C0XJ 1JJVA 3CCVA 1ZNYA 2W6JD 2BE5C 4G01B 4JLKA 1E9DA 4TTPA 2ZRNA 1KD1C 2AL7A 1QHYA 4URUR 2V6JA 3FB4A 4DZZA 4APVA 4MZ9A 1NIJA 4KHPQ 4A4DA 2GWHA 2C95A 2QGZA 1WA5A 4OHVA 3KKMA 1TQ6A 3GLHE 4LFCL 4UXIA 3CPWA 4MYHA 2Q3FA 4BLRA 4B32A 1KSJA 1KJYA 1Y1WH 1E9FA 1FZQA 1Y8OB 2RGNC 3W9YA 1VIYA 1PFSA 2XB2A 1JJ2A 2CK3D 5BXQC 2GJ8A 2HJVA 1XEWY 4FXPA 1G3IA 2IK8A 2WAYA 1VQIA 2ZSFA 3DDCA 4DDTA 5JMTA 3LWNA 2ZEJA 3T51B 4A3IG 3QEJA 4C0QC 3TNFA 2HHHL 2YINC 3OESA 1P60A 3IEVA 3OEHD 1OPXA 4HSEA 2W6ID 1Y1VH 4A76A 2DY1A 1XMOL 1JB7A 4EFMA 2MNAA 1BMFA 1WDTA 5LB2A 4P4TA 5KNCA 4A0RA 3EWAA 2PLFA 2DHRA 1VQ7A 4TYNA 2VS1A 2CQOA 1KI8A 5GQOA 1PH1A 2GETA 4AYWA 4WOPA 4A3DH 2J7PA 2ZI3A 4QJ4A 4JI5L 1L2FA 5EXXA 4QGFA 4RKEA 1Z83A 5FBRB 4DR5Q 4U00A 3WRYC 2R7ZG 1DE0A 1C0AA 4Y7NH 3NHAA 5FOWA 1T0JB 5IRCD 2ZJ5A 3W6PA 1MV5A 4JVSB 3LX5A 3FKQA 1TEXA 2ZR0A 2YJTD 4TLAA 2F3IA 2VHCA 4A2QA 5A4JA 1UEJA 3B5JA 5JI2E 1FVIA 2RCNA 1GNRA 1U99A 1UKYA 1X3GA 1YZGA 3GLHA 3TGPA 1KL9A 1HPCA 4LJ9A 4QXAA 4V0LA 3UANA 1Y14B 3BRWD 5KDDA 4HDCA 3SQWA 3J81k 4DLWA 4W5WA 2OBNA 3FMPB 1W5TA 2X77A 4DR6L 3FMFA 5FPTA 3R8FA 4PC6A 1OLOA 1EFWA 2EFHB 4JYAQ 1O78A 4OX9Q 1ZCAA 3IBYA 3WHKA 4W9MC 1TU2B 3KUCA 3I2ZA 4XSHA 1GG2A 4BGDA 2UKDA 1Q46A 4BQSA 3OTOL 3QG1A 4LSGA 1E22A 4AQYL 2WKPA 3S1QH 2UUAQ 1EGAA 4EPXA 1XEFA 1QZGA 5B2ZA 5JHHB 2VHJA 4Q4JB 4IPGA 5JECA 2I5MX 3U2QA 3EBEA 1P16A 4XD7D 1HNZL 4AG6A 3UG7A 2ZI4A 1OE0A 5SZKB 1IJEA 3BB1A 3ZJYA 4LF4L 3U3OA 1CR0A 3BD9A 4JMPA 1ONBA 2XSZA 2OQKA 4HZIA 1XMQQ 4Q4JA 3BS4A 4B71A 1VCIA 1D6JA 1NBMD 4LBVA 1IHUA 5CLQA 1JECA 1OXXK 1ZKOA 1BKBA 3AF3A 4EAQA 4L5QA 1M8PA 2JXMB 4LV6A 2ZI7A 2P2LA 1E0KA 4URVR 4Z1MD 3WP0A 4Q7LA 2Q21A 4NYMR 1CKNB 2B7BA 1K3RA 3EG5A 3PUXA 4IVRA 4A3KH 3S14H 4OQLA 2DWPA 3AGQA 3EASA 3Q9LA 1G4UR 1I6VC 4NXMQ 1HT1E 2FGKA 3U6KA 4IFDG 4QGUA 4AIIA 4OYHA 5M04A 3A37A 2DWQA 3HFZB 3IIKA 2WHXA 5EJEA 1G20E 4DCNA 2UXCQ 4GZMA 1OHHA 3M6AA 3L8ZA 3RS4A 2XZLA 1CKNA 3MD0A 5FI1B 3T5GA 4GLVB 4QBFA 3U3KA 1R4AA 5IYCG 4DUYL 1XTIA 1NSFA 2K33A 4ZKEA 4I4LA 5TARA 5BYKA 2JA9A 1FUKA 3CRQA 3SZRA 1EWHA 4GN4B 1RJ9A 2ZRAA 4A3JG 4G7OC 3S24A 1PH5A 4XTRA 1Z0FA 2C98A 4C0AC 4PO9A 2V4DA 2WPDD 4J0QA 1Z6XA 4IOMA 3M4PA 2NIPA 4LBZA 4DNIA 5JRZA 4GNXB 4JYCA 3K70B 3LQRA 4DUZL 3EX7C 4DV3Q 3NH9A 4P32A 4A0FA 3KFVA 8OHMA 1E9CA 3M0EA 1ZUIA 1VTKA 1YZKA 5EZ5A 1HZ9A 4YWMA 1W46A 4FCTA 4H02A 4YMSA 5H70A 3C8UA 5JSZB 1E9SA 4GNXA 1P2UA 1XBTA 3GFOA 4JIMA 3K8YA 4BPBA 5F3WB 3HOUG 2BVNA 4QNMA 2NGRA 1A4RA 3OIWA 4D4LA 4UP9A 3KJHA 3B1WA 4IDHA 3UMRA 2JIZD 4ZIRB 3KQKA 4JOIC 4A9AA 3DHWC 4PQFA 5JSZA 4KLNA 1B23P 3CW2C 3BAFA 3BFVA 5FOVA 3WMFA 4C3ZA 2P6NA 4CIDA 4PZZA 5DYGA 1EX6A 4Z1MA 1E24A 3K0FA 4BFYA 1XEWX 5JCZA 1IYJB 1YKSA 4LJ5A 1FW6A 1KO5A 4JI8L 4IPCA 1HUQA 1T6NA 3PUVA 2BCJQ 2R9VA 4B74A 1VYUA 1E1RA 2A5JA 4BBSH 1FL9A 5SZJA 1LF0A 1HA3A 4DV0Q 3QUSA 3CCJA 2RHDA 5E7IA 2BMDA 5GAGC 4H1UA 1IY0A 4TMXA 4RFVA 3KJEA 2A19A 4EX5A 3HOZG 1ZJ6A 3PGZA 2D7CA 4IVPA 3L0IB 1VCNA 2VO1A 4DV7Q 1IJFA 2HIVA 2G88A 5IYBG 1GUTA 3K9HA 5HCIA 4B2IA 5HPYB 1T5LA 4I1VA 4HLCA 4B2PA 3O8BA 4PPGA 3QENA 3FOZA 5IWAQ 1NG9A 3B78A 1TF2A 1QVGA 3U3MA 5D3QA 3RN2A 3E5HA 1KTVA 1HURA 3VR1A 1VQHA 1OIVA 4RD0A 4KFUA 4P33A 1I50H 5EP4A 2BH8A 1KO7A 2LCFA 1SE8A 2A69D 2ZJPA 1ODFA 4OK3A 3T1OA 1PLKA 4UQOA 1X55A 1NVVQ 1X6VA 1KDPA 2H92A 1N6PA 1RRGA 2JLSA 3CB4A 5J4HA 3N2IA 4DR1L 4D4MA 4PAQA 4HJ8A 2GBLA 2VHUA 2K5VA 3J7ZC 3OOCA 4A3EG 1OKKD 1IN5A 4A3BH 4OJQA 1MO3A 3K09A 4MYTA 1S3GA 3QF4A 2JA6G 2JLXA 4XSGA 2YYZA 4K0KL 4TQAA 1YHNA 1TUEA 2ORWA 1IN6A 3JVUA 3DZDA 5FTKA 3VU9B 4E03A 1CF4A 2CLDX 1UF9A 3FKSA 4LF7Q 1WCMG 2A8VA 1E1QD 3TW4A 5M3FG 3GEHA 1E6CA 1VIAA 3K0EA 3M9BA 2A5YB 3VTKA 1W2GA 1UEBA 3I5XA 4ZDKA 1Q57A 2NN6G 3Q3JB 4PANA 2ZRDA 3EW9A 5EE1A 1IY2A 2CCJA 1VQ5A 2UUCL 5DGXA 4H0LC 3MG9A 2YWHA 2QUZA 4F4IA 4MKHA 3UDGA 3N2EA 2BEJA 2NN6I 2VY3A 1YZNA 3P32A 2ZJRA 5FOSA 2ZI6A 4PX9A 1VYVA 4CT4B 3TQCA 5JJLA 1R0YA 2ZSEA 2AFIE 5L3RA 3ZZ0A 4UKDA 2QNRA 4N3NA 6Q21A 1HJPA 1C9OA 1CKEA 1X3EA 3T12A 3GTGH 4ASUA 1CEEA 2ANCA 2GKSA 2NTYC 5AJWA 4E09A 4LYFA 2AUJD 3J81i 1DG3A 2QENA 3TJZA 1N34Q 1YNXA 2WSMA 1YRBA 1F48A 2RGEA 4PR0A 3WBJA 1UAAA 3HP1A 4PZ6A 4ZDJA 4X8LA 1N5KA 4BA1I 1H95A 1KMHB 2QMEA 5KSYA 1F60A 2C9OA 2GZAA 3E9HA 3AUXA 2QY9A 4Q9KA 2YZ2A 1VPLA 3BIFA 3MXNB 4IJMA 4IOKA 4JBMA 3BB3A 1R8QA 3CRMA 2A69C 1F2TB 3EPLA 4BY7H 1J7KA 1ZAKA 2UU9Q 2KCMA 5FI0B 3AF4A 3TREA 1DEKA 2IWRA 4CF7A 2ZR7A 4YCUA 2XNDD 2ZQ5A 1O3YA 4F4CA 4TMTA 4FWTA 4RKFA 4JI7Q 2OT3B 2PLRA 3WBKA 5FR1A 1Z6AA 1QZHA 2HXSA 3SYKA 1QHHB 4DHEA 2IS4A 4D0NA 2CHGA 1TL7C 2ZR9A 2F1HA 2ZYUX 2EXDA 3TS2A 2PEYA 4IOAA 2IA5A 2KHIA 1TWGH 1J2JA 2G6BA 4HB4A 2C04A 4GKJQ 1JB1A 3EN2A 3UE1A 3DZ8A 3G4SA 1IN4A 1Z0AA 1AIPA 2ODNA 2WM9B 3JAMc 1EWQA 3TIFA 2O8CA 2IT1A 5J5CA 1B9NA 5M3MG 2VUMH 2IF0A 4GKKL 4ABYA 5HKKA 3X1YA 4RZ2A 5CLLA 5FL7A 3G0HA 4HYYA 1YJ9A 1SFOH 3MEFA 3EPKA 1HR0W 3P26A 4E22A 1G6HA 3QXJA 3AVYA 2F1MA 1S9DA 3X1XA 2J0QA 1E4VA 1Q20A 3KDFB 2VSFA 1JQJC 2G77B 1RRCA 4MKGA 2WOJA 3K0CA 2ZJYA 4DSTA 2RH5A 3ICQB 2IUTA 3CKLA 4JT2A 1MIUA 3KFUA 1RZ3A 1XD9A 2CVFA 4JSTA 2ATVA 2LWIA 2JLYA 5E3HA 4KHZA 1GSIA 3CQZH 4QJ5A 3ND9A 3PUYA 3PIRA 3X2SA 4V03A 4O3MA 1VQNA 1WBDA 4AI6A 1AGPA 5DLQE 1ZUHA 2GZHA 1Q22A 4R4CA 2QF7A 4KN7C 2D7DA 5FTNA 3SEAA 1J90A 1M7HA 4C0BA 2DWOA 3BE4A 4KI0A 4X62Q 3H2YA 4NE2A 2DNCA 5KOYA 2ES2A 3DOFA 4DUGA 3UDFA 4PPQA 3HOXG 3PEYA 2G0TA 3EZFA 1GHKA 5AUOB 3IQWA 5DI3B 3THYB 3T1TA 3S1MH 1ESNA 1Z0DA 1IM2A 1EOVA 1Y8NB 5J47A 1CP2A 2B63H 3FYHA 1OH7A 3RS2A 2IC5A 1IBLL 2PZGA 4A3MG 1QHIA 1DCZA 3I4NH 2FEOA 2XXAA 2O0JA 4US1R 3CCEA 2GJKA 1E2WA 4JV5L 1NSTA 2WJIA 4NL4H 4QGGA 2HCJB 1NN1A 3LX8A 4O0MA 1Z6TA 3SJCA 4ESHA 3VX3A 5KNDA 2R6CA 3E1SA 3UKDA 4A93H 3AFPA 1LFDB 2CWAA 2B8TA 2G1KA 2GNOA 2QAGC 4C2TA 1Q82C 3ONWA 4TMWA 4QKQA 2XOKA 4TYQA 4PAMA 2DNEA 2OXCA 3SOPA 3GCGA 4BBRH 3RSLA 1E9AA 1E2QA 2JA8G 4LYJA 4W5HA 5FBVB 2FSIA 3A0JA 1XMSA 3WNDA 1VQMA 1JALA 1NIPA 2FX3A 3FGNA 4DB4A 1MO6A 5LD2B 3KQHA 1CUKA 2A6HD 2FFQA 4DK6C 3QKUA 4IKEA 4B48A 4ON9A 4YXWA 3QPWA 2OLJA 3AVXA 1KJZA 1ZIPA 2DBYA 3NBFA 3OZXA 3O8RA 2AHOB 2NOAA 1FMJA 3SJAA 2F4VL 4JI1L 1KK1A 1WBBA 5EE0A 3LNNA 2R62A 1JAHA 1IN7A 2EJMA 3EZ6A 3PO2H 2MFIA 1AN0A 3GEEA 4ZDIA 5C4JH 1F2UB 2FG5A 5J4VA 2YWGA 5HY6A 4P4SA 4K46A 1DGSA 4BE7B 3CLVA 1VCMA 2EWVA 1DARA 2O5VA 2IYQA 3IPXA 4TQUS 1Q1BA 2BBWA 4DBLC 1HY3A 5HTKA 1Z3IX 4DAYB 4BA2I 4PC1A 1YE8A 2R65A 3LW7A 4B33A 4YMUA 2IYRA 4NP6A 2GXAA 1W44A 3AEZA 1BOFA 2W83A 4LUVA 1O7IA 1FQJA 1SMYC 1YNNC 3LWUA 1N6OA 1HV8A 3R8CA 4IW3B 4DSNA 4I99A 3KTAB 5ANRB 1L1OB 2QRZA 5FH9A 3U7HB 2WMOB 3B13B 4JZKA 3A8JE 4M2LA 5DN6D 1LACA 4GN5A 1RE0A 4HDOB 4F91B 1PMRA 3GLIE 5TXGA 2YKGA 2QP9X 1GWNA 3U3RA 1ZYUA 2BMEA 4YY3L 1PZNA 4LJ6A 1P73A 1G8FA 1GDDA 1I4LD 2QE7D 3K9GA 3WXMA 4YMVA 1ZD9A 3KTAA 3VR3A 1GM5A 4M4SA 4KKUA 1XP8A 3VKWA 1UWVA 3I55A 4OI2A 5JHGB 4HAWA 3NH6A 1FQKA 4TTRA 4PMWA 2WWFA 4JLJA 4TVAB 4CEHA 1GNQA 1RRPA 2L5TA 4JI6Q 4R2HA 1BBUA 1E2VA 4JBWA 1SXJD 4L16A 1CTQA 1CU1A 1OIXA 2R2AA 3EXAA 2R92H 4Q9IA 3OFNA 4JK1C 1MABB 4IEIA 4FMDF 4HATA 4R9UC 2A6HC 4D80A 3AUYA 5TMPA 2CEAA 4DK0A 1QBKC 1LTLA 5FTMA 4NHOA 2B6HA 3IKJA 3FE2A 4GZLA 3PIPA 1Q1EA 1KKMA 4AK9A 3CWQA 3NBZC 3TLXA 1DAHA 1P9WA 1WP9A 2ID0A 2DCUA 4LUOA 1MABA 1UBCA 2E76C 1DADA 3MWYW 1XXHE 4XWAA 1ZRHA 4XWOA 3CZPA 2UZ3A 4FINA 1EFHA 5AJXA 2EU8A 2O8EB 3P20A 5FUXA 4B3GA 2HQLA 1G3UA 3T1YQ 4FMCF 2NO0A 1IL2A 4BXXG 2XTNA 3R9IA 1TF5A 5FOUA 721PA 2GXQA 1IXRC 4BFSA 5KYKA 1JJGA 2WV9A 1E9EA 3VAAA 4ERNA 4Q4AB 1COWD 3ASZA 1SULA 4Q1EA 1KK2A 3T1HL 1ZYRC 3I4MG 2VSOA 1AA9A 4KO8A 3TH5A 4DR2L 2C96A 3QG5A 4JT4A 5E7MA 2O8FB 1YVCA 2AX4A 3C5CA 1DOAA 1KI6B 2QM8A 4D0LB 2CL6X 1RRFA 4L4UA 5L3SA 3AV0B 2OM2A 3H4MA 4HZUB 2J7KA 4Q4AA 3BH0A 3ECCA 3AQQA 2I5LX 3G48A 4I1UA 4PPNA 1EIYB 3ASYA 1TAGA 1GL7A 2GHIA 2O8DA 1AZSC 5IDVA 1T5IA 1EFRD 3EIEA 3TKLA 1OFTA 2Y0SG 1GKYA 4HIKA 1HTPA 1VG8A 3BG3A 2HLDA 5CYPA 4LF8L 4B43A 4MDFA 5C4XH 3CMEA 2HF9A 4CDGA 4CYMA 4EPWA 4QM6A 3J7A5 1E3PA 4OWTB 2JAQA 1Z2AA 4JVMA 1UKVY 2CDNA 2HXYA 3W5IA 4OKSA 1XXHA 4MTNA 1BS1A 1WCV1 3HKZG 5BW8A 2VH5R 2XJ9A 1CJKC 2ZJ2A 1JE5A 3GP8A 1W0JA 1OB2A 1OYWA 1FGUA 1SXJC 4YC7A 1N33L 4JI3Q 1JPJA 4K8OA 1Z2CA 4D4KA 1SVLA 2E75C 2JCSA 1E2GA 4WA7A 2ZTDA 3PO3H 5L8VA 2BA1A 2Q2IA 5IYDH 3V4FA 5J4LA 2VHQA 1FX0B 1YU9A 4HEJA 4PAOA 3VHXA 5L3QB 2OE2A 4OO1H 5FUYA 3TK1A 3S1AA 4TLBA 1UE6A 5LMNQ 3O8CA 1E1OA 4LPKA 3DEFA 2OCYC 5ELNA 4OHXA 2NPFA 2OTLA 4AY2A 1AKYA 2C9YA 3X1ZA 1NE3A 1NKTA 4GS3A
chains in the Genus database with same CATH superfamily
4F2WA 2BKEA 4RUKA 2VT7A 1D4OA 1SCNE 3TR6A 4ZQEA 5CVTA 3DA8A 1HE3A 5FA5A 4DM4A 1JSZA 3H2GA 4LF9Q 1LLDA 3KSMA 4TSFA 2VL7A 3UMFA 4OXXA 3ZHOA 3ETEA 3V1LA 4UPEA 3W7BA 2QTTA 3DZBA 3FI9A 2ORED 3H9BA 1CKOA 5SZIA 3HA7A 2BMAA 3PPWA 1N2GA 1YQTA 1KH1A 3KAPA 2YZGA 3TQHA 3A0UA 4Y0AA 4UNSA 1K6MA 1F8UA 2L42A 1KH2A 1KQOA 2HNKA 4MNOA 3MOGA 2DHQA 4ZI2A 3LW8A 4POFA 5BMVA 4TXMA 2XMBA 4ZAZA 5ADHA 2QEJC 4O4JB 1IBML 1X1RA 2A73B 3TMAA 1BJKA 2OCLA 4XYQA 1EG7A 3QY9A 3VNAA 3EC7A 1LY1A 2OKCA 4L5SA 1QR6A 4H6XA 1OILA 3NHUA 3KQWA 3KB2A 2PEZA 3PFFA 4ARIA 1D6EC 1HEYA 3VR2A 4H4DA 4OIMA 1N6IA 5CJ2A 5JJ5A 3GNQA 1TKCA 2WWXA 1HWYA 1I94Q 4I1OA 1NU6A 3W4KA 5KX5A 4M83A 3BDAA 4B6GA 3GY0A 4O2AA 3VV3A 4D2IA 2QORA 1EM8B 1UMBA 1JHAA 4N01A 4DMHA 2CKMA 1HQCA 5KOJB 5ALTA 5CA1B 2Z58A 4FYMA 3E9QA 2FDRA 2RAUA 3SBEA 1F20A 3G9QA 2BTQA 1HNZQ 3HZRA 3ZIAD 2A5DA 4CLRA 2EIFA 1TR5A 1B2RA 1S4MA 1P5RA 2WJYA 5G2OA 3QMVA 3OQOA 3U61B 4HNSA 1TAHA 3HOYH 2P1ZA 2VVTA 4JLVA 5IW8A 1I10A 4TX1A 4IHKA 3D5EA 1O8BA 4XKJA 5FPSA 1X7WB 4I14A 3QI7A 4IV0A 1H9RA 5COAA 3ED1A 2IJGX 5F23A 2HWWA 2RJ3A 1TM5E 3ZWDA 1GKLA 3OQ6A 4RE6A 1Q1AA 3G0GA 1YUNA 1TUBB 2IYSA 2B4TO 2ZYVX 3GNTA 2Y0SE 3WC4A 2FPPB 1LPSA 3BA6A 4J90A 2WUVA 3D6CA 1XNGA 3KBGA 4G0XA 3K5IA 3B8HA 1FJ2A 3HP3A 2PZKA 2P2SA 4EYOA 2POQX 2VQFL 2XADA 1SVMA 2VI5A 4MVJM 4JBXA 2O2SA 2ARKA 2Z2XA 1CZLA 1EQRA 3LHSA 2W2TA 1UFKA 3WY9A 4OSOA 3SEQA 5JEEA 2R25B 3GUUA 5JYBA 4P71A 2JBAB 4ZOBA 3RZDB 2GRJA 4OX9Y 2VLBA 1WULS 2E4AA 2V4ZA 3TMYA 4WNAA 1Q7CA 1VL6A 5LU9A 3NHBA 5BYBA 1NF3A 1SOMA 2WR8A 2RHTA 5DHRA 1O4WA 1HNXB 1OHHD 4FGSA 4A26A 2E18A 5CK5A 4CGYB 4IHJF 4JEHA 2VTKA 2DQKA 4O5OA 4I65A 1TEZA 2AFIB 1E0AA 3AH8A 2XUZA 3HADA 4M3NA 2OMEA 4ZI5A 5E7JA 1GQYA 3H04A 2DH6A 1GRVA 4KN5A 3ZWMA 1F38A 1U5BA 2W2OA 4O4LF 1GRQA 3RC9A 3EF1A 3HMQA 4CM8A 3OZWA 2H4OA 1KS9A 3KF6A 3L82B 4CM1A 2A5LA 4MS3A 5K2OA 3UHAA 1NF2A 4FP9A 3SNKA 4IY1A 3HB7A 3NAZA 2HDLA 2W43A 2KE5A 2NTNA 3BMQB 1XTDA 1DJMA 1DUVG 1E9RA 5E2IA 5I3CA 4OELB 3ICEA 4NPAA 4IX1A 3USZA 2O1EA 5HKAA 4L95C 2YU9B 4BO1A 5K0FA 3Q5DA 3TGLA 5DHFA 4QYIA 1OXUA 5L4NA 2EHDA 2Y1FA 4P4SB 2CE7A 5BSGA 1LM0A 1PL0A 1G3MA 1KKUA 3I6YA 5ELDA 1T4CB 1VHJA 2C5CA 4RIHA 4EJ0A 4BE4A 3VYWA 1VQBA 5DP1A 3ZH9B 2RGYA 3TZKA 2WSLA 5IK2A 3ZD6A 2VZAA 4JJEA 2VA8A 2GM4A 4CEHB 5JPIA 4RTNA 2ZBVA 4AD8A 4DWWA 1BW9A 3LPNA 2K5HA 2G71A 5ALMA 3T9FA 1Y3HA 4JPBW 4PTLA 3JYPA 5FL7D 4TL6A 4CKZA 3GA5A 3PWSA 1M1NB 4JIGA 5FWYA 1WZEA 3JQAA 2PR7A 4EX7A 2JS7A 5HUHA 3MIIA 5DWQA 1SYGA 1SU4A 1VQKA 1RKUA 2O8DA 1MKYA 2R84A 2G82A 3TS0A 1TGVA 2GLXA 1MQSA 5I7FA 3TYXA 1GARA 1L7XA 2LXNA 2YWJA 2GKOA 4AB1A 3OEEA 2NZHA 5KTSA 4YRSA 3IMCA 1MX5A 1V1PB 3RS5A 3FVRA 3OT1B 3HOVH 3TRZA 1H4QA 5CJPA 2ZBUA 4J1TC 4WASA 1C9JA 1QVWA 1ENAA 3EIUA 2QYSA 2R00A 3FCYA 3DL7A 3LA8A 4LGMA 2C9CA 3U7QA 5C5IA 4LZOA 2GD1O 3MWEA 4FX5A 3ZPXA 4YXFA 1A5BB 2JFPA 2ZRPA 3CINA 1VECA 2A9JA 1HQDA 1ZK2A 4LKRA 1KDVA 3V55A 4Q1FA 4DEYA 3UXMA 2JA6B 1LZKA 1KRWA 3IELA 4AUNA 1UBFA 1AA6A 2WF7A 4LRYA 4Q7KA 4DDWA 5AJ3L 2ICAA 3OZCA 4PYQA 1D4ZA 3M9WA 1LPPA 4CMBA 5KYYA 1RZRD 4XQJA 4X00A 1K9SA 3ZIAA 2W2VA 2WSYB 4JVNA 2ZIZA 1VG0B 2IU6A 2F64A 4JG2A 4KTAA 4F88A 1SVSA 2J3DA 3R3XA 3VPCA 1JHDA 1WSBA 1LLFA 4RF3A 2WLSA 3Q8DA 4MQ4A 3HCAA 2E2IB 2BY4A 4YRPA 4DGSA 2GN0A 2DFPA 2KPOA 2WSBA 3MTQA 2KS6A 4HMOA 5REQB 1EG2A 3FOWA 3HB4X 2QTBA 1LRJA 4I5GA 1KO1A 3F96A 3ZY3A 2AMCB 1UMBB 1BYIA 5KPJA 1TZCA 3PQFA 3CBGA 4F1JA 1V41E 2DQ4A 4LSMA 1Z4NA 4IR7A 1VE9A 1ET9A 1FPQA 3ICOA 2RK4A 1YIDA 1LTRD 1L5QA 1TFUA 3QFSA 4BMSA 1EE2A 5C44G 3OTOQ 3QQ5A 2W7TA 4CLRB 3LYAA 1JMYA 2YIMA 3EZGA 2EKZA 1L5NA 2WHRA 3RLNA 1D8AA 4YAUA 3LK7A 2GNPA 4AJPA 2Y0DA 1FS6A 2BP7A 5BN3B 3PI6A 1XMQL 5DGTA 5K3AA 4L78A 4ID6A 4FT4A 4BX9A 1JMVA 1O94D 3NP9A 2V9CA 1I5EA 1ZGGA 1SUDA 4RJ2A 2F8MA 5DISB 2R8OA 4G8DA 2ZJAA 1A88A 4ZVKA 1TAUA 5CIQA 1CY7A 4UHEA 1V7PC 5BNFA 1SKUA 1RQ7A 5KHAA 2Z83A 4N0DA 1EYAA 4JLBA 2KOLA 4QQRA 4CR6A 1XNQL 3HEMA 1MQ9A 3I4CA 5ER9A 1EYCA 4QUJA 5AR1A 4GGOA 1U1EA 3ULKA 1F1JA 1LU9A 2CXUA 3U48A 2IX0A 3MJ4A 1K7EB 1TKAA 2QVBA 5COBA 5KNCD 4CDEC 1F3LA 2DY7A 1DAKA 1ZL2A 4URWR 1UQTA 1EUZA 1HTLD 1I13A 3D31A 2C03A 5FWXA 4ARBA 1T8PA 3KD2A 3Q9SA 2QLJA 1F17A 1Y34E 3WGGA 4D9EA 4H1WA 5T1GA 2NSLA 4K5VA 4ZIRA 1BN6A 2CJWB 1JAZA 1DTWB 4DV7L 2KJQA 4A16A 4KQXA 1ISPA 1ZNZA 2ISCA 5T3YA 2H2GA 2AD5A 3EIFA 1ADCA 3JY6A 2C00A 3CRRA 3LH5A 5E6SA 2XSZD 2NVQH 2Q4OA 4JI2B 2KLHA 1SA0A 2ZE6A 2P5SA 2LD4A 4BUZA 5I7VA 5D5PA 1JDTA 4UZSA 1Z5UA 1PH7A 1PN3A 4XPZA 3GI1A 1P2DA 3V7WA 3PRYA 3D3NA 2FF5A 1BH6A 4QELA 3K5OA 5GGXA 2B8JA 2HUGA 2FG7C 4H0FA 4XOIA 3CVUA 4KR0A 2NZJA 4ODIA 4ZQBA 1K89A 1SRUA 1U5BB 4KTVE 2G67A 2QRLA 4CM8B 5DN6A 1PVOA 3KF6B 1WZCA 5HIKA 2WIKA 4MS3B 3MJVA 3MXNA 3CZ4A 3F67A 2Z4TA 4UE6A 3S5JA 4LYDA 1R7RA 5DZSA 3D8HA 2HWUA 1YJ8A 1MGPA 1G7CA 4BQRA 1FLAA 4MCAA 2RI1A 2HDOA 4K9QA 2ZUTA 3S8EA 3Q3GE 1RQ2A 4QYIB 3H18A 4IXNA 2X9QA 4AJEA 2O0KA 3OPXA 4OREX 2Y0PA 4PR3A 4JY7A 3ZJ5A 4ZANA 1KORA 2J67A 4F4UA 3ZEAA 1FMCA 1JEJA 2FR1A 3P9PA 4LZLA 2Q2WA 4LBYA 4BGIA 1OLXA 1JHUA 5D3KA 4ZVQA 2Y0EA 3AP3A 1OX4A 3RFCA 5B1DA 2OXPA 4WK6A 4NS4A 3I1FA 2IS1A 1CJUC 5HEKA 4WZBE 2UUBB 1UDXA 4A0QA 3ZHQA 1BW9B 2ZULA 2VP4A 4NPHA 1MQAA 4IICA 4L63B 4XIYA 3A27A 2H5XA 5ALPA 3JAMA 2PBLA 2AKYA 2EQBA 1Q14A 2WICA 4Q21A 2I0QA 4LXYA 2IX3A 4A3DB 4R8RA 3KG2A 5IBCA 2N3ZA 5C5EA 3PP8A 2B3DA 1E3WB 4R8IA 1SVWA 2O8DB 2XRYA 3T1YB 1JP7A 4YCMA 3ED5A 1L9XA 5P8WA 1X9NA 4CG2A 1BDHA 4MGKR 4AICA 1MJNA 1T8UA 3OWXA 4F2PA 4PW0A 4OI0A 3DEOA 1MBZA 4MAAA 1G8PA 2PUBA 3GRFA 1PO7A 4P36A 4A3KB 3MWEB 4P3YA 1NBWA 4L5AA 1FXSA 4KXYA 5BNZA 2JG3A 3WWOA 3OF3A 3ZTTA 4V1CA 1BU5A 4IDDA 3A26A 4EI8A 3O95A 1Y8RA 5KREA 1DU4A 1AQNA 2MP1A 4K87A 1II0A 3JVDA 2I2BA 4XWGA 1CB0A 1WVIA 3PSHA 5EZYA 5HE9A 4R4JA 5FJJA 5JEAH 2FWBA 3REOA 5KYYB 4BQIA 5ALHA 4BEWA 1JHQA 4WBNA 3N1UA 3EC2A 5FTWA 3LBIA 3CRKC 3IDZA 1EINA 3TFQA 4BNIA 4BCBA 3CZAA 4A1FA 1I50B 2H00A 1PWHA 2L4NA 4IZ6A 1G3RA 2K6GA 1QH9A 1YAJA 3B12A 4U7DA 4FEAA 3O7MA 1J4AA 1KDCA 2HZBA 2Z09A 1T5HX 1XDWA 4BRUA 1YZTA 2IY5B 2IYWA 4PC2A 5IU6A 2O2EA 3MGBA 2IXDA 1R00A 5KJ1A 1E9DA 2AL7A 4Z0TA 3DLBA 4BC1A 1WD1A 1TQ6A 2TMYA 1C3JA 3GBSA 2EJCA 3GTGB 1W87A 2OXEA 2W8BB 2ZEJA 3TNFA 2HHHL 3DKKA 1IC6A 1JFSA 4EFMA 4YAGA 5LB2A 1XALA 5KNCA 4P4TA 1ZOIA 1OJ7A 2I5PO 4RW0A 5AVKA 4QPNA 2VYNA 5IRCD 1HA6A 2GNAA 3EUFA 3CXRA 5JI2E 3GEDA 4B7XA 4DLWA 2BP7B 3FMFA 1XZNA 3VVLA 2ATIA 3UMGA 4DR3B 5FEUA 1RXVA 5A2QL 2PGXA 1UP7A 4O2BA 5B2ZA 1NAHA 3O3NB 4DIOA 4XFJA 1CR0A 2XSZA 4OFWA 5E6RB 1EHCA 3D5TA 4TV9A 4CHTA 4IMPA 4MS1A 2QTLA 1IQ0A 1G4UR 3CZ9A 2XZLA 3VVCA 4ZYLA 1WB5A 3ID6C 2P9CA 5FI1B 3O3CA 4KQFA 3ETGA 4ZKEA 2K33A 5IBRA 4RIEA 1PH5A 2IIBA 3ZW9A 3SSNA 5D1HA 4ZO9A 4B9XA 3NWBA 1E9CA 3K5MA 4GVLA 2NP6A 2IRWA 1A27A 4WNCA 1PTJA 1ADYA 5JSZB 5LP6C 3PO2B 2KQUA 4K6MA 1RI2A 4OXKA 1QH0A 4ZIRB 3IOMA 4KLNA 3G1UA 4ZAXA 3WMFA 1OV6A 3PUIA 1AKUA 5HBGA 2YXEA 3CA8A 1XQ1A 4DV0Q 2RHDA 4BUCA 3PCTA 1D03A 1N5RA 1VCNA 1X9IA 1BUVT 4Y1FA 2B2WC 5E6SB 3O8BA 1NG9A 5TRTA 4NBLA 3WK9A 4C43A 1SA0B 4OJNA 4XASA 4R1NA 2O3UA 3KM0A 2H92A 2BI7A 3TLKA 4EUHA 4Y2PA 3J7ZC 5B37A 4KMMA 2EZVA 1KHHA 4GMHA 5CT4A 4D8WA 1MRZA 4H7JA 4JOSA 4PN7A 2GX6A 5HRCA 3OLWA 3DDWA 4N7MA 3IDFA 1XVUA 1YRYE 4PO3X 1A7KA 4GMGA 3VZRA 1DHRA 3GOQA 3CHYA 1F0PA 4ARCA 2ZT5A 3WRXA 2GERA 3DTNA 3VAZA 1R0YA 3ZZ0A 3QEAZ 2WFLB 4NZNA 4X90A 3PT9A 2QENA 5JXHA 1N34Q 3CUYA 3WBJA 5KJCA 2FRXA 4PZ6A 4CG1A 1NU8A 3AF5A 4BA1I 1NW3A 3E9HA 2QY9A 4Q9KA 4KXXA 3MXNB 4IOKA 1BSVA 3NIDB 3G9XA 2UU9Q 3AF4A 4YCUA 4AMVA 2V03A 3GBVA 1AH2A 4EJ6A 3OIFA 3R0QA 1FNDA 4L8WB 4ZOLF 4J1NA 1WB4A 4ZT4A 2JVIA 3L8MA 1FU8A 1I3KA 3IKLA 3MMSA 2FQYA 1UK9A 2GZSA 3RYHA 1U2EA 3ND9A 1QCBD 3DMPA 5DLQE 4X71A 4ZAYA 4FHEA 3C3JA 1ZN9A 1AK1A 2DWOA 4MA0A 3A9UA 3PEYA 3I12A 5AUOB 2PA3A 3IQWA 1YNND 2FJ2A 1ZN8A 1TWFB 5LQDA 3UB2A 2M1XA 2Z3ZA 1HQRD 3GJRA 2WJIA 5LL6P 2WKSA 4DG9A 5JH7A 2B8TA 4N8DA 4QXPA 3GG9A 4W5HA 1G0NA 1IVNA 1QB7A 1SNCA 4QU5A 2FX3A 2A6HD 3U17A 2F4VL 3QV1A 1WBBA 1E7QA 1PKXA 1RXEA 1PX0A 1FLDA 4DIBA 3EZ6A 3NUGA 4RAOA 2NVTB 3S1SA 5KVCA 1EBUA 4BE7B 2F3QA 5L6MB 1WVMA 1DLJA 1EFAA 2XVMA 2GXAA 3KTAB 5ANRB 2QRZA 2GPNA 3U7HB 4GN5A 2JGFA 5TQ0A 2ZUWA 2XVYA 3ZGVA 4UHDA 2BMEA 4MW4A 3UHPA 1R88A 1JDUA 1GDDA 2QE7D 1I3MA 3RODA 1UWVA 2CXQA 4TTRA 1UFOA 2WWFA 1GNQA 1RRPA 3RREA 2GF2A 1SXJD 4L16A 3T3HA 1FXWF 3LRXA 3W0LB 3OFNA 1H2YA 2RBGA 3LQKA 1VJRA 1LTLA 4C89A 3V7UA 3PIPA 4ZCKA 1OU0A 3O2JA 2NU8B 3R0ZA 4JU9A 1BC5A 4OQPA 4O4HA 1NJ1A 1A2QA 2OBYA 1AA9A 1A9OA 2C96A 1D07A 4AJJA 5AW1A 1NVDA 1O9BA 4MPRA 5C4XH 5FLEX 4QM6A 4ZI7A 3HDVA 2BSXA 4A7PA 1IY8A 5B4VA 3Q6IA 3S2FA 4JI3Q 1PT8A 3WS7A 1ECFA 4ZQHA 4DV5B 2P9JA 2OCYC 4OHXA 4AY2A 3GRRA 5HVNA 4GS3A 3HN7A 2WJ4A 1YHZA 3JWJA 3KJPA 2QLLA 1D5CA 4WBNB 4LF5L 1MOZA 3HOVG 1NE2A 5CCDA 2QNBA 5EINA 4U3JA 3A1EA 4MQ6A 4BP8A 4MDYA 3GTJB 3RRBA 1Y8PB 1V5GA 3EAQA 4R2LA 2C5AA 3C1FA 5I8ZA 1X8KA 3P71T 2CMDA 1NR1A 4B4OA 4N8EA 3FYCA 1IIBA 1APBA 4K6LA 3QEMA 4TT3D 4ZHQA 3OE1A 2D2EA 1TYAE 4J0EA 1XCJA 1ESFA 4EEKA 2B21A 1XIVA 3CH4B 2PZWA 4C3IB 2ZB2A 2FSHA 3JZMA 1CEQA 2BGGA 3FYSA 2JEAI 1CQXA 2R79A 3WTBA 3CEHA 1FRNA 5LC1A 3ABRB 4M9QA 5DIZA 1P1HA 3WQBA 3KZOA 2A2ZA 4Q6WA 4DHWA 3LVQE 3R5XA 5I7RA 3AWIA 4GOXA 5HRAA 4FD2A 4G0ZA 4DR5B 3FY4A 3P0IA 3HJTA 1PGPA 2MTBA 2JA5H 1PNRA 2QN6A 3IP9A 1E2JA 2ZIXB 4TZ6A 4RDCA 1C7ZA 4IHQA 2ISQA 4WAUA 2EYOA 4RFSA 3ZXUB 2W90A 1OWLA 4M0LA 3SJUA 5BN5B 1FNMA 1T36B 2RDGA 1W4RA 2IHBA 3S2SA 3E27A 2J3EA 5CJJA 4O2BB 4HNHA 3M5DA 5AVUA 4R1OA 3OJOA 3QMWA 4AY4A 2IPAB 3ZDZB 4JUIA 1OWMA 3FYTA 2VK4A 4PSCA 2VXCA 4CHTB 5DEOA 2RGWA 2ZE7A 4BNTA 3SK0A 3T56B 5GAHC 1VPWA 5AD1A 1PQYA 2OBLA 3V4ZA 4BOYA 3DKPA 1C9NA 5CW1A 4B85A 3FDJA 3LDUA 3ABSB 3T9DA 3SXUA 3LZCA 1P2VA 5C3UA 4PYLA 3B1JA 5M5WB 2FSVC 1A2KC 2JJ1A 1JQ5A 3B3GA 2NAFA 3BICA 3C14C 1DO0A 1F2VA 4J29A 3Q5GA 2R93B 2J9YB 3LDAA 1OR8A 5CIYA 1UFRA 1JMCA 2J3IA 1U02A 3FPAA 221PA 3CT6A 3BRSA 4TV8A 1M1XB 4UNQA 3ZXIA 1YR2A 1SR3A 3Q1KA 3LBHA 3QW2A 4WDQA 3SK5A 1JHXA 2CKZB 1ZCFA 3LNTA 2LXJA 2UUPA 3EGCA 4Z54A 3MXTA 5IARA 1LJ8A 4FLEA 1B8UA 3V05A 1A0OA 4BE9A 3TLGA 4CDNA 4MGYR 3ZYYX 1XU7A 3NBHB 1XZCA 4N5IX