3PUXA

Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
371
structure length
371
Chain Sequence
ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPGVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Snapshots of the maltose transporter during ATP hydrolysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/transport protein
molecule keywords Maltose-binding periplasmic protein
total genus 104
structure length 371
sequence length 371
chains with identical sequence B
ec nomenclature ec 7.5.2.1: ABC-type maltose transporter.
pdb deposition date 2010-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3puxA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3puxA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3puxA01
4KLZA 3GLFB 1P75A 1KI8A 2IYYA 4BEBA 1ZC3A 1N6OA 5AJVB 3PEWA 3ZZ0A 1SXJA 2CE2X 2JJ2A 2XXAB 2UU9Q 1X6OA 1U8AA 5C1BA 3MLEA 1KNXA 3MEFA 3LFUA 3CF5A 2ZM5A 2AUKA 3KOJA 1OKKD 3UDXA 2ZJOA 2F1HA 3LY5A 4YDHB 2AWOA 4JI1Q 2MO1A 4KLKA 2NO6A 1YJNA 2PI2E 2REBA 2YYZA 1TADA 3ASYA 1N32Q 1RE0A 1N6NA 1U9IC 3B9QA 4OQFA 4TMKA 1GUTA 1S96A 4BBSH 3OFNA 2OE2A 2JA8H 1C9OA 3CCUA 4DLYA 1Z06A 3CF0A 4RZXA 1V1QA 1QRAA 2GA8A 2N1BA 3CD6A 4JYBA 4DDWA 1XNRQ 3KF6A 1WA5A 4X64L 2AKWB 1XTJA 2KCCA 4CYMA 4PAOA 1A0IA 1CKMA 1L7VC 3TR5A 3AKDA 3CCSA 3M6AA 3G6EA 4PHFA 4TMVA 1X65A 1X3GA 1TU4A 2QGQA 2GVAA 4B3ML 4H9GA 3I4OA 5CM8B 1WCV1 2JLUA 3LNNA 4DR2Q 5HCIA 4NCIA 4TL9A 4GNXC 5BQ5A 3PR1A 1Q1BA 3K70C 2NIPA 1KIXA 1VQFA 1UDXA 2OAP1 4B44A 3D0FA 4B3RQ 1N5IA 1N5JA 4EPXA 1O87A 3W9YA 5JHGB 5K8TA 2PH1A 5IYCH 3F2CA 1E98A 2IYVA 5IK2A 1T4GA 4BE7B 1NTGA 2BVNA 5BWMA 1G7SA 4PHHA 2EWWA 3A1TA 5HGQA 1BO6A 1KYIA 3C14C 1Y1WG 1Z6GA 4GNXB 3THXA 1ZU4A 5CJPA 2A6HD 1TL7C 2QRNA 4JL5A 1T3LA 4QBHA 1KRSA 1G8PA 1I4LD 3IEVA 3EPLA 3LRPA 1J90A 5HR5A 1UBCA 1T9HA 4ESVA 2LKDA 2R7DA 1I2DA 1E0JA 1M90C 1VQNA 2OSBA 2QMHA 4AKIA 1XTQA 5J3BA 4CGZA 1OB2A 2OBLA 4NYJR 4MDFA 4LHYA 2IWHA 1AQYA 4C0KA 4B47A 1HEIA 1ZM2A 3ZVLA 4BLSA 2NN6G 1BKDR 3AVVA 1NN0A 5L3QA 1J70A 2PEZA 2WB1G 3FB4A 4MA4A 2WP8J 3PUXA 4HJ9A 3BJUA 1G8HA 1N6RA 1WQ1R 1XD2A 4IDNA 2IK8A 4DR3Q 3CRRA 4OWXB 2OCEA 1ELOA 1VIAA 3OIVA 1BMFA 4MGYR 3CPFA 5DISB 3B82A 3WNDA 1Z3IX 1GNQA 2B63H 2JA6H 3L8ZA 4JJZA 1RL2A 4GDFA 1XEWX 3I56A 4JLMA 4CEIA 1EYGA 2KENA 1H9MA 4YDSA 2FSHA 2X2EA 2YWGA 4I7ZC 2XNDA 3GMTA 1N6KA 2WM9B 5H8WA 5FOSA 2BEKA 3SJAA 1Q1QA 3BOSA 3CX6A 1YRAA 1CUKA 1CJVC 4EFNA 3GJ3A 2BIFA 4JSTA 1VQ6A 4GP7A 3TE6A 4W5WA 4DR1Q 1XTDA 4WXRA 4PFSA 4PQYA 2ID0A 4Q1FA 3BK7A 3U4QB 4A3FG 2CJWA 3O8CA 1BVSA 2J41A 3ULLA 2OO7A 1S1MA 4LBWA 2GCOA 5K36G 4RKEA 2Q9BA 2GEUA 5J40A 1F2TB 2AR7A 5FPKA 4W9MC 2OCYC 4GPTA 1JR6A 3RNUA 4RD1A 5TXGA 2N3SA 3CCLA 5ELOA 2HLDA 1VG0B 2WWGA 2PT5A 4BBSG 4MKHA 4OHYA 1VQKA 4D2IA 1OTCA 4M8NE 2GAOA 1UF9A 2J46A 3A58B 3NIBA 5EXPA 3W6OA 1KJZA 3KQNA 5JWOA 3S15H 1KTVA 2AFIE 3S1AB 3U61B 2R8RA 2MFIA 3SC3A 4LGMA 3A8IE 2QT1A 2H1LA 3PO2G 3GJ0A 1QVAA 3OEHD 5EQTA 1F2UB 1HV8A 1Z0AA 3CRW1 3NBXX 4LX0A 4NP6A 1G1MA 3NEJA 4A3MH 1Y8NB 2J0UA 2IL1A 4FCVA 4AD8A 3TUZC 4AG6A 4S2EA 1HNZL 4DLWA 1JBKA 2FSGA 4OI4A 4IOKA 3AVXA 3A4LA 3B7GA 4LHXA 4HJ7A 2HYDA 3CZQA 3PIPA 1IZ6A 3ZYCA 2AD5A 1XPOA 2WFWA 2UU9L 1UPTA 4LUCA 2QG6A 4OL0A 4V03A 1T5LA 3FHTA 1OFIA 4B3SL 1KO8A 1Q22A 1XJQA 2LWIA 2SHKA 4CEHA 1G41A 2NO7A 2OBNA 2V4DA 3H86A 3T06B 1N32L 1YHQA 4N0EA 4TMWA 4LF6Q 4DCUA 2D2CC 4PMWA 5FL3A 1RZ3A 2GCNA 3M3YH 1XTRA 1MKHA 5C4JH 4MTNA 1YR8A 4C0SA 4QOSA 1OIWA 2EFCB 1EFCA 1AZTA 4C7OB 3JAMc 3SJCA 4IFDJ 1VQMA 1IQPA 2QM8A 4JYCA 3J80i 5IYCG 2BMFA 4N0DA 4X65L 1JT8A 1DE0A 1GKIA 1VF5C 2XB4A 1C4OA 1Z63A 3LVQE 4HI0E 2Z0SA 4FCWA 4JLNA 1RRCA 3CWQA 4RZ3A 2ZUDA 5KNCA 1G4AE 2Z6KC 2ZJBA 2HF8A 1KOFA 2CNWD 2ZRFA 3GLHA 4KMUC 4HAXA 4A3EG 2VSXA 1RYHA 4BXXG 4O2LA 4RD0A 1IONA 1E7ZA 2V4ZA 4PAQA 3QXJA 3U60B 3MG9A 4ZI2A 1X3FA 1P61B 2N78A 1R0YA 2IS2A 4LUOA 2DUDA 2B63G 2JA6G 1S2MA 3B85A 3D8BA 1UKZA 5EZ5A 3Q5EA 1G8GA 2FFQA 3HOXH 4DV7Q 1P2TA 4IXMA 5LMNW 3J7A5 1AE3A 4EAQA 2EWVA 2BE5C 3FGNA 4M1WA 5KHOC 2UXDQ 4QHSA 1E2PA 5BN5A 3GTQH 2CHGA 1K8AC 4AIMA 3EZ2A 1CS4C 1YNNC 121PA 4OXPA 2VP2A 4PPFA 4R7ZA 3UPUA 1W36C 1QVGA 3GCGA 4DDTA 4OGQC 1ZW6A 5AUOB 4DCVA 3QOFA 3SU8A 1W4RA 1VQGA 3QXHA 1JQLB 3BFXA 4JI8Q 2KWIA 3LBIA 4K8OA 2CL7X 5BR8L 1X55A 5KYKA 3W8NA 1KD1C 1U99A 2BBWA 4S35A 3Q5DA 5KDLA 4ZV4A 3QE0A 5SZJA 2EFEB 3CP0A 2O8EB 4Q48A 1Z2AA 4OK6A 5E7JA 1YZUA 1VYTA 3A36A 4JJKA 1U5KA 1OXVA 5EP1A 4AKGA 4PO8A 1FYCA 3K0FA 1FTSA 5CITA 3CH4B 1VQJA 4BFXA 1W7AA 1OIXA 4RCZA 1GWNA 2XNDD 4UY8C 2WAYA 1JEDA 1A7JA 1VQ9A 2P2LA 4BUJA 3S2HH 1NSTA 2A7QA 2GVZC 4MYHA 4NCHA 3RRMA 4JI8L 4LFAQ 4BRWA 3OZXA 1S9DA 2XZOA 1QVFA 3CXCA 2VP0A 1TX4B 1K3RA 3TVDA 4R9UC 4QJ5A 1L8QA 4WXPA 4X62Q 1ESMA 5J47A 1VQAA 1NBWA 1FQKA 3DHWC 4O25A 5JSZA 1PHJA 1HZAA 2VQSA 4A8JB 1LS6A 4KFSA 1U81A 2F1RA 5JJKA 3TW4A 1J2JA 1DAIA 4YHHQ 1LACA 3LO5A 4LCBA 4TL8A 1TU3A 4P0TA 1WBBA 3WP1B 3AF4A 4BLQA 1XJ0A 4AYBG 3LNCA 5EXXA 3UG6A 2JLWA 1Q12A 1K73C 2KB0A 2LXKA 4YWMA 1KNQA 3RZDH 1LNZA 1W4CA 2XTIA 4DV4Q 4LFBL 1AH9A 1Q7YC 1QHHB 2ZE7A 1HNWL 1DAHA 1C7YA 1US8A 2BBSA 4ON9A 5AK0A 3X1ZA 1GG2A 3U7EB 1LM0A 1Z0JA 2ZRAA 5EE0A 1JPNA 3CCQA 1MRSA 2UUCL 4DUYQ 1EIFA 4OI2A 3C16C 5TB5A 4JI0Q 2XTMA 4CT5A 4EPTA 3GTJH 3J81i 1U98A 4EPVA 3H0GG 5C44G 2WJGA 4BGDA 1GOTA 1XMIA 1G7RA 3MAAC 4Q4HA 4DT1A 1GUAA 1R7RA 5FLXc 2DFTA 2V7QA 4ZCMA 2P67A 3QI2A 5B57C 3EX7C 4DSNA 2R7ZG 4E09A 4OQMA 2A3RA 4TYNA 5E7IA 1SQ5A 2ZRNA 1TTTA 3HYTA 4Q9LA 4LFBQ 1XXHB 2QY9A 5IP7G 3CPWA 4URWR 3T1OA 3UKDA 3UDFA 1NLFA 1VIYA 1ZAKA 2HIXA 2P6UA 2K14A 1W0JA 4JI7Q 4OQNA 1JR3A 1G20E 2IEYA 2RGGA 5LBIA 5H68A 4BFUA 1G6OA 3PQCA 1RPZA 2KCTA 1ZIPA 1CLUA 4DR5Q 5HE8A 4ZDWA 2D4HA 2NO9A 4HIDA 2VHJA 4AKEA 1SROA 4PAMA 4LYHA 4UNNA 3W6PA 1GHJA 1GP2A 5BN3A 4L5RC 1NF3A 1XJCA 1FFHA 4FD2A 1A2BA 2D3WA 4AK9A 1E0KA 1TWAH 3R8CA 1QHYA 1PZNA 5DN6D 3ZS9A 2ZVPX 4EDHA 4LY6A 5IDVA 4D4JA 4O0AA 4JI5L 4DDUA 2IYSA 1HE1C 1G8FA 1IW7C 4KHZA 1YZLA 3BB3A 3AGQA 4LJ5A 3LDAA 3LQQA 4DSUA 1IN4A 4RG1A 621PA 1EWQA 3L0OA 1HTWA 2ZSDA 4B43A 1WOCA 3TH5A 2QMOA 5KNDA 3KQHA 1Q8KA 1EX6A 4G0NA 3T15A 1ZNWA 3PO2H 3BBPA 3T61A 5HPYB 3ZQ6A 2ZR0A 4Q1DA 5FTNA 4WJ4A 3QIAA 1SGWA 4UXHA 3PJRA 4JOIC 2FPLA 4B3MQ 4HSEA 2QSZA 1Z83A 3DDCA 3U44A 1IBLQ 3HU2A 5FTMA 1CBUA 3IDQA 3RABA 1MO3A 3Q8XB 2RGEA 3BAFA 3AF3A 1N6PA 1WBDA 2ODWA 4NXNQ 3AUYA 1R0XA 4OQLA 1JJGA 1HPCA 3RLOA 2ZYUX 1TPZA 3NVAA 3QF4B 2ZRBA 1GRNA 1B0UA 2BH2A 2IW3A 4RCYA 5M5WH 2W6IA 2Z83A 1II9A 2QAGC 2J45A 4OI1A 2O52A 2NVYH 3K70B 3NXSA 3GJ5A 2QGNA 3B1VA 5BYJA 2CK3D 1KHTA 1XPRA 3GEIA 3M0EA 4QGHA 2FV8A 3B78A 4B35A 1L1OB 2KHIA 3PEVA 4L8GA 2IYRA 4PZYA 1KI4A 2JASA 4MUAA 5IYBG 2J0SA 2ZRKA 3K81C 1DGSA 1B7YB 3NC1C 3U9SA 2RGDA 3Q9LA 4EJSB 3T56B 1N8RC 2V6IA 1FZQA 2PNRC 3MFYA 2P5SA 4JLAA 4BFYA 1O7LA 3AVWA 3CCMA 1CKNB 2OFWA 2IYTA 4GLAC 4UP7A 1TEVA 1VG8A 4BY7H 3GEEA 5CDFA 4AQYL 3E0EA 2O0KA 3WY9A 4Q9KA 1KC8C 1G5TA 1Z0IA 2XAUA 3OIWA 4IPHA 4FMDB 4V0NA 4Q9IA 2Q3HA 2O8CA 2WJJA 1YVDA 1Z0FA 1N36Q 3QBVA 3VTKA 1JB7A 2A5GA 4GOPC 4PR0A 2RGNA 3U3OA 4DR3L 2UVQA 2QE7D 2IYLD 4DCNA 2ALYB 4AWXA 2QEXA 1YJ9A 4A93H 2IS6A 3WBKA 5DYIA 5IK2D 1UE5A 2Q6TA 2YKGA 4I81A 3HOYG 3PFIA 1FUKA 1T6NA 2C96A 1UEIA 1QUQB 3T1YL 1XZQA 3A1SA 2FFAA 4AQYQ 1E1QD 2YHSA 1OH8A 4YWLA 1SULA 3R9XA 2CNWA 3PENA 2F9MA 1VQOA 4ARZA 1EFHA 2HCBA 4TL7A 1ZD9A 3P32A 3MJHA 2YC2C 3BB1A 3MJRA 4RD6A 2OCAA 4Q7KA 1NY5A 4BY7G 2WHXA 5UKDA 4Q7MB 3FHCB 3U50C 1S9HA 5JECA 4LV5B 3LLUA 3H0KA 4PV1C 4W7SA 4US2R 5EZ6B 3BDOA 4TQUS 3PVSA 1W1WA 4KCGA 2YNMA 4DV4L 2C04A 2EXDA 2V9PA 4C7OA 2R6DA 1F6BA 2RCNA 4TLDA 2NZJA 1Z6XA 3Q3JB 2BKEA 4TTPA 4P72A 2FEMA 2CL6X 1Q90A 1HZ9A 2P6NA 1FOEB 3RHFA 5BW8A 4HIOA 2VPPA 2FGJA 3BJIC 1GUNA 4CEJA 2CWAA 2YWEA 3LD9A 1Q44A 1BS1A 2B6HA 4I99A 2FFHA 3IKJA 1EK0A 4BFTA 2H16A 3AFPA 3AQQA 1NMXA 1WYDA 2QSYA 2RAPA 3FPAA 1TU2B 5ANRB 4ZDKA 1SZPA 1XJVA 1T91A 3EC1A 2VA8A 4RD2A 2HYIC 5F9FA 2YWHA 4ABYA 4EPRA 5KPJA 1N0UA 4NYMR 1R8QA 1ZU5A 4L4UA 5EUQB 4IJLA 1MH1A 1WE2A 3OEEA 4KSBA 4BFWA 1GUGA 4R98A 3THWB 1NG9A 3HOYH 1BYIA 2Z4SA 1HT1E 5GJCA 2E9SA 1DG3A 3X2SA 3C5HA 5FJ8H 4QM6A 2X2FA 4LBYA 3KL4A 4PZ8A 1IYUA 3S24A 3PF5A 1QHXA 5J5CA 4NCJA 4CRWB 1EESA 5DSZA 3RRNA 4ME3A 4OHWA 1L4YA 3GJ4A 1IL2A 3RS2A 4DCSA 2WAQG 5CYOA 4PG3A 1W3SA 1IN5A 4YMTA 1IN6A 2QM7A 4UP8A 1TUEA 1YZQA 3QKUA 2DNCA 2GN5A 3K0CA 2LXJA 3I4MG 3DZ8A 1JAHA 3FDIA 3WMEA 4BFZA 3CC7A 3IRBA 4DV3Q 4URUR 3TSOA 1WMSA 1WXQA 1XTKA 2MSDB 1XCGB 1JALA 4LJYA 1IYJB 4Q4JA 3R9IA 2HT1A 4DZZA 4DUZL 5JWHA 3UMSA 1ZVQA 5IYBH 2FOLA 4HLQB 4NBSA 3ZJYC 3ZLJA 4PQRA 5CM9C 4DXAA 1G6PA 2HJVA 1XEWY 2E2HH 3A7LA 2GCOB 4BBRG 2J87A 2CJWB 4PPGA 4DLVA 2KCMA 2BDOA 2GK6A 2Z6VA 2ZETA 2O8BA 1GNRA 2IHEA 2QF7A 5KSZA 1Q3TA 4HDOB 1DAMA 2NGRA 3I61A 3H3VI 4B2LA 1II0A 1VS0A 1V43A 1U2RA 1Z28A 1V5WA 2RHQB 2C9OA 2CHQA 2ZAMA 2JIZD 2Z5FA 4Q01A 821PA 4UQOA 1CXZA 4OO1H 1BBWA 4M9ZA 4KV9A 4B33A 1CRPA 1Q0UA 3SBDA 2IF0A 4QL5A 2QTFA 2W6ID 2ZVQX 3SHFA 1GZSA 4B3XA 2LMCB 4HATA 1VG9B 4Q47A 3PITA 4NMMA 2QMUA 5JZVA 1G18A 2D2EA 4JLJA 4AI6A 4DKAC 1JEEA 2DFKB 4D0LB 4CEJB 4A76A 4OJKA 1VCOA 4YLGA 3OPOA 1W4BA 1XTSA 4DV5Q 2R7FA 1WP9A 4GBMA 3RNLA 5JSZB 2BM1A 2MMGA 4M9SA 4KXFB 1ODFA 1S3SA 1ZRHA 5JBQA 1Z8FA 1DAFA 3FMPB 1G3RA 1Z07A 2Y0SG 2KHJA 2Y8EA 4OWWB 1RJ9B 3CO5A 5LB2A 4IOJA 1SKYE 1X54A 4KN7C 1T8TA 5JFGA 4PPNA 3QF4A 3WMGA 4JL6A 2A68D 5HKKD 2FA9A 4A3CH 3B6EA 1W4AA 4HDCA 3BD9A 1G3MA 5FPTA 2JDIA 4LK1C 2WPDD 4JYAL 2YTYA 1P6XA 2GCPA 4NPHA 4Z54A 5F2EA 4GOXA 1E0SA 5CK5A 4EPYA 2GZDA 4A3JG 3AVQA 3R20A 4FWTA 1MR3F 4KYIB 1E2LA 1LABA 2K5VA 4Q9HA 4CDGA 3K9NA 4HAYA 1HNZQ 4KI0A 2WIAA 3Q7PA 4PTLA 2ZYWX 421PA 4MH0R 1CJTC 2OZEA 4GOPB 3EIEA 2ZE6A 4L5BA 1IW7D 3NBFA 2C98A 4IW3B 1KQSA 5G41A 5EXSA 1XCMA 5D3MA 4A36A 4II7A 5DO9A 4M2LA 2BA1A 3EIHA 4GS3A 2YC4C 3RS0A 1W36D 4LC1A 4OJQA 5JEAJ 1AS2A 1P60A 1YE8A 5C2JB 1EWIA 2PBRA 2QPAA 1UKVY 1IXSB 1GVNB 4LF5L 1CKNA 4A4IA 1TMKA 1QHIA 3IIKA 3T12A 4GOPA 1YHNA 1DCZA 2W2VA 5EP3A 4DK1A 4WZ6A 3VHLB 4H44C 2AWNA 2E2IH 4A3GH 4DWJA 3ADKA 3T35A 1B9NA 3VHXA 4R4QA 2I4IA 2WKPA 3CW2C 1G16A 3CIOA 3IHLA 3VQTA 4D81A 1OH6A 3B9PA 4A92A 3GFPA 2QZ4A 3LBHA 3GPLA 4NDZA 1YVCA 2OILA 1XMSA 4DR7L 2Q2IA 2QUZA 1ZINA 2X77A 1QZXA 3VKWA 3U6KA 3QEOA 3SYNA 4RFSB 3M85A 4X8MA 4YMVA 2K5UA 3DMNA 3ZVRA 1P9NA 1EUJA 2VZAA 1Q82C 4HYYA 3CC4A 2ZI3A 4UP9A 4LF8Q 4QGGA 3QPUA 3ZD6A 4P4SA 4AY2A 4IPDA 4LF5Q 2Q2HA 4BY1G 1DOAA 2KSQA 4DB2A 2HCJB 1IHUA 1OHHA 2HQLA 3PF4A 3IPYA 4DNIA 1GIAA 1KO7A 3VMFA 2XZLA 3GJ8A 3L43A 1XMQL 1YHAA 1G21E 3WYAA 5FI0B 3UXMA 2UXCQ 4JI3L 5DE3A 5GAGC 1QDEA 2Q3FA 2ZT9C 3CC2A 4Q9JA 5JI3E 2WWIA 3KDFB 1OIVA 3Q85A 1HYQA 1PH8A 2OG2A 3GFTA 3RN2A 4RSGA 2RHSB 2O8FB 1U8ZA 4IDHA 4TMZA 3S1NH 1BIFA 1XEXB 5FOVA 1IN8A 5JCZA 2VP6A 4Q18A 5FBVB 4JLPA 2EJMA 1VQBA 1G7TA 4U00A 3GTGH 4AC9A 4O2DA 1XNQL 3VU9B 1ZYUA 5FOUA 2VUMG 2WSMA 1ZKOA 1KK0A 4PANA 4V0MA 2KBFA 2J0UB 3EWAA 1KJYA 1E9SA 5JI2E 5JS7A 5DYGA 4LF7Q 3EBEA 1FX0B 3RRZA 4F92B 2WWYA 2QP3A 1DEKA 3S1RH 2WOJA 4Q1EA 3TAUA 2XGJA 2MO0A 4RCNA 2HHHQ 3Q8DA 5HZHA 4HZIA 1SRUA 3PUYA 3PSIA 1WB9A 3VR2A 4GFDA 1E1RD 4TLBA 2JDID 4BXXH 1OXTA 1QBKC 4AURA 1CFMA 2RHDA 5JEAG 4Q4JB 3SS8A 4LJAA 1KSHA 4M53A 3ULPA 1ETUA 1G6HA 1N0WA 2BH8A 4WW0A 4DCTA 4DPGA 3T5DA 3U7FB 2RB4A 4GKKL 1FJGQ 3CRLC 1KAWA 1RKBA 3NDPA 2E1RA 5L3RA 1Z29A 2XOKA 2ZYTX 1E2DA 4BLPA 3U7HB 1A2KC 2JLXA 3P4YA 2E5LQ 2JEBI 3LQRA 2D62A 5H1SE 5G40A 1YZ6A 2XNSA 3O8DA 3KJEA 2ZM6Q 1Z0DA 2UUCQ 4GZLA 1UE6A 2PT7A 2GJAA 4OHZA 3KKQA 1HUQA 2R6GA 2NPIA 2WOOA 3SZRA 4C2UA 2WWHA 5DLQC 4A3CG 3GD7A 3IHWA 2QBYB 3PEYA 4DLXA 2H92A 4JI2Q 2IYWA 3B1XA 4IJHA 4A3FH 3IQXA 3CF6R 3TMKA 3EA0A 3L0IB 4DLTA 3AKYA 4ZCIA 1I94L 1JXMA 2BM0A 3IPXA 5CK4A 1Y1WH 1QG4A 1S1CA 1FMLA 2EYUA 4MYTA 3U3MA 1L1OA 5GAHC 1CIPA 2OT3B 2PZEA 2ZRPA 4BWYA 1N25A 1KXLA 4B6EA 2G88A 4M1MA 5K8IA 4QNMA 2QPTA 1G3UA 4B3RL 3KF8B 1NSFA 3T1HQ 2ZJYA 3K8YA 3PGZA 1AS3A 2GXUA 3QPVA 2RMKA 4NYIR 4Q1AA 2YZ2A 1NRJB 2FXQA 5HY6A 2BC9A 3AP3A 1TWFH 3FMCA 2FF7A 5KO2A 3ND9A 1M7BA 1Z47A 4OHXA 4ZDIA 3SGIA 5GQOA 3KJPA 3HKZG 2DN8A 4C3IH 3F2BA 4LF4L 1P2SA 4RD4A 2IT1A 1LTQA 1EQRA 2F1MA 2B7CA 2GVBA 2RGCA 1P72A 2K50A 3E70C 3RAPR 4R4OA 5DN6A 4JBXA 3SYKA 3RR5A 4DC9A 1NMZA 3MSXA 1QG2A 4JBYA 1QUQA 4C4PA 1ONLA 5C3EG 2QMEA 1UKYA 4JVNA 4XVQA 4C3ZA 1G5RA 2F52A 3S1QH 3KTAB 4Q19A 2FSFA 2QGZA 3ONWA 3PG5A 5G53C 4TLEA 1OXSC 4JI5Q 1ZD1A 1Z22A 2DCUA 4JZKA 1G5PA 2ZQ5A 4NXML 4K0KQ 2A5DA 3CRQA 3IUYA 3K9HA 4MRVA 3TJZA 4TL6A 1XTIA 5LMUQ 3HDTA 1G17A 1VQ7A 5DHFA 1HH4A 3BIFA 2XJ9A 4XSHA 4N1AA 1DPFA 2W58A 5IYDG 4X6AH 3BS4A 2C77A 1Q86C 2VP4A 2AUJD 2O0JA 4ALPA 2WJYA 3JVUA 3PO3G 1IXRC 1HT2E 1NVUQ 3I32A 3ZQJA 4JKYA 1O78A 2OTLA 3BH7A 1L2TA 2UXCL 2ZR7A 3UANA 1E1TA 1FGUA 4B3TL 2OWOA 2ZRHA 2UZ3A 4TZ0A 5EUMA 4IDOA 4G7OC 1DAGA 5SZHB 4P4SB 2VF8A 1CTQA 2GILA 3PCOB 1QHSA 2VQFQ 2A8VA 1E9RA 1KDPA 2VLIA 4GNKA 3AF2A 3HOZG 1S3GA 1SMXA 3EW9A 4KLNA 2IHBA 4PO1A 4A9AA 4RMFA 1E2VA 3KFVA 3REFA 3ADCA 4DR6L 4QJ4A 1Q3HA 1OFTA 1NJGA 5AJYA 4JL8A 1RYFA 3TSZA 1LFDB 1AGPA 1FUUA 5TVKA 3AVUA 1NVVQ 1KIMA 4B32A 4DEXA 3QXCA 4TYQA 5FTJA 1NI3A 3BERA 2HHHL 1IM2A 4EFMA 1G291 2PCJA 2ATVA 3AH8A 5FTKA 2Q0HA 3CPHA 4G7HC 4RZ2A 4JV5L 3ZJYA 3OIUA 4LPSA 4QM7A 1AK2A 1US8B 4U5XA 2A69C 3T34A 2JCSA 1P8LA 1NY6A 4WZBE 1ZNYA 4L5TA 5C4XG 1CR0A 2D7CA 1DO2A 1G3IA 2W83A 4N3NA 3V4RA 5H1YA 1E2MA 4GSYA 4IFEA 3ND8A 1CULC 1HNXQ 2QT0A 4IQZA 1Q57A 2JIZA 3K7UC 2CDNA 2V1UA 4BASA 2YVUA 5IYDH 3EASA 1E1QA 3O8BA 1JJVA 2QP4A 2EVBA 1S8FA 5GAEC 2R6AA 3BC1A 3LGJA 4UNQA 1E9FA 4D80A 2ERXA 1DAKA 3KTAA 3VFDA 4B34A 4LUZA 1ZMXA 4HJAA 2F6RA 4IO9A 1Q21A 5IT5A 2XB2A 4B3FX 3W1GA 1JJ7A 4YCVA 2V8OA 2GDJA 3QEJA 4JBKA 1VG1A 2IXFA 4MRSA 1VQPA 1OE0A 1P16A 2G6BA 5KDDA 1UAAA 3DLLA 5JHHB 4DEYA 3A6PC 1SHZA 3I55A 2QN6A 4XVRA 3HP1A 5DIFA 1E0AA 4JKIA 2CW0C 2W6JA 4M1SA 3U2QA 2EW1A 1OV4A 4QNRA 4X62L 3DKPA 3HOVH 3L82B 4K46A 1E9CA 3PIRA 2MQHA 3AVPA 3U58A 2AKAB 1VQ4A 4CW7A 5KSOA 1TQ6A 1W0KA 1XXHA 2B92A 1FQJA 5FR1A 4AIIA 5AR1A 3Q72A 4UJ3A 3G71A 2GJKA 2O8EA 3KKPA 2YV5A 5E7MA 3KJOA 1XMOL 2OXRA 5CYPA 2JA9A 4OHVA 4Q21A 3EPHA 5DLQE 1SXJE 1GDDA 1MO4A 3RZOH 2BEJA 2D74A 2ZROA 3N6RA 1F2TA 3QNUA 5J4KA 3SOPA 4EKDA 4GOKA 1KO5A 4YMSA 2JA8G 3ZS8A 2B8WA 4C0LA 1I94Q 2CCJA 2ZI6A 3EN2A 2XSZD 1TWHH 2WBLC 4X8LA 4QXAA 2F7SA 2Q3MA 3IGFA 4B3SQ 5M5YH 3KB1A 3G82C 3F1ZA 1W0JD 2BKUA 1N9WA 3T51B 1KL9A 2BE5D 4R1JA 1H65A 4TTQA 5CIQA 4CZ2A 2GK7A 3SQXA 2CQOA 4DV6Q 1TF5A 5C4XH 2EQSA 3UMFA 4Q5IA 1LS1A 4JBWA 1VQ5A 2DPXA 4FN5A 3AUXA 5FLMG 4E22A 4TYYA 4BPBA 1XRJA 4QRHA 1CRQA 2N8NA 3VR6A 5FBWB 4F91B 4ACBA 5M3MG 2B8FA 1KGDA 1DADA 2I1VB 5F3WB 3CF2A 2AHOB 4MRNA 1KK1A 3LW8A 5FR2A 4ERNA 1IBMQ 3KKNA 2CHVA 4ZCLA 2ZAOA 2AKYA 4HLUA 3ZD7A 1ASYA 4I1VA 3HGBA 2VQEQ 5BXQC 1D5CA 1CR4A 2EJGC 2J1LA 3HPQA 3OHMA 4TVAB 3EZ6A 4B74A 4X8OA 2VP5A 2W0MA 1SVOA 4US0R 1AQUA 3ZIAA 3TEHB 2IX1A 1KK2A 4G5SA 4C0QC 2E87A 3A8KE 3PO3H 3R9WA 3N2IA 1YU9A 4LYJA 5BYKA 3BE4A 1TF2A 2XXAA 2OESA 3E9IA 3C4JA 4HIMA 4DR2L 4C0BA 3CUEF 3AVTA 4DV7L 1Q81C 1EX7A 4LOAA 3UE0A 1FX0A 4URZR 1AM4D 1TEXA 3MMPA 2AMCB 1R8SA 4DLZA 4RJLA 1DXMA 3STBC 2RF4A 3P4XA 4HDQB 4A1FA 3RN5A 2GJSA 5LMNQ 2HT6A 2BMEA 4LJ6A 2VIIA 2JA1A 2ZTSA 1IJFA 1JJCB 1Z2CA 4KFTA 3X1YA 2J9RA 1YJWA 1ZCBA 4IFDI 2VHUA 4A0GA 3BH6A 3A7AB 2CLSA 2UZIR 1K9MC 2O5VA 2P3SA 2GNOA 1PH1A 2CCZA 2QTHA 3JC66 1NL3A 3A37A 3FVQA 5TV2A 3GTMH 2LKCA 2JEAI 5CJ2A 1W2HA 2J7KA 4Q66C 5IY0A 5G3YA 1BOFA 4LK2A 4LFCL 4O0MA 2PCFB 1E3PA 5J4VA 5C0XI 1H9SB 1TXYA 3W5IA 5LPNA 2UUAL 2RGBA 4G01B 4CF7A 1IJEA 3V9PA 3WNBA 1TUIA 4LBVA 4E03A 1IXRA 1HZBA 4JT2A 3ZDQA 2IYQA 2B3GA 2IHFA 2A19A 1J6QA 2XTZA 4HLDA 1K8GA 2WPDA 4KODA 1BYUA 1KI7A 2ZI7A 4BFVA 2ZXUA 3FKIG 2XEXA 2ZJAA 1A63A 1LUZA 4P75A 2QE7A 4KFRA 4TYWA 3K0EA 3FP9A 1P4SA 4QBFA 1F60A 4KKSA 3WRYC 1M1KC 3PIOA 1SE8A 4XH9B 1VCNA 2G83A 1OSNA 4DV0L 1LY1A 1ZUHA 1HE8B 2F3IA 5EP4A 5KSYA 1XEFA 1I50H 4KVAA 4LWCA 1XCPA 3O47A 2BA0A 1UADA 4KYUA 3KX2A 4JI1L 2UUAQ 3WXMA 2ZREA 3A8JE 1YR9A 4LYAA 5KPDA 3B6YA 4HJ8A 3HYRA 3RRYA 3F2DA 3GLFA 3SYLA 3LA6A 3P26A 5M5XH 1E9BA 4CVNA 4HB0A 4Z8XA 4RD3A 3AP2A 2D7DA 4DUZQ 1ZJ6A 2WSSA 2ZEJA 3BRWD 3RYTC 3VR5A 1COWD 3A0JA 1QHHA 4MNOA 2IYXA 2IWRA 5ELNA 1JNYA 3AF1A 4DR5L 2VHTA 1HQCA 1P7CA 4PHTA 3ASZA 1E2ZA 2WKRA 2ZJPA 2VHQA 4M1OA 1TNDA 1YJ5A 4KO8A 4IJMA 5GVSA 3DO6A 3A1VA 3UDIA 1FW6A 1WCMG 1S0UA 3KDFA 4KN4C 5C44H 1JJ2A 2UXBQ 1U94A 4JLVA 5B64A 3T1TA 2NZHA 5F9HA 2E74C 2OTJA 2E5LL 4JI7L 5FBLB 1E99A 3QXXA 1E22A 4Z8YA 1D2NA 1N6LA 3V4FA 1NBME 4JBMA 4MKIA 1C9KA 1E9DA 4L15A 4QC2A 3TAHA 1SMYC 3TQYA 3OE7D 5L3QB 1TQDA 3GLIE 2VHCA 3U4VA 3G5UA 1TF7A 1NNEA 1JR3E 1UM8A 4YONB 1Y8OB 4JOIA 2JE6I 4A75A 1YITA 2FGKA 3CPEA 2PCLA 3LAWA 3QKRB 4L16A 5EAYA 2L15A 4LF9Q 1J5EQ 1WF3A 4MDEA 2NO0A 3K9LA 2OAQ1 4TYPA 4DK0A 4POFA 1J99A 4OI0A 4IPGA 5C46F 4WIAA 4ARZB 2CWPA 3H84A 3QJYA 2DHRA 2OHFA 3A4MA 4GMDA 4B3CA 3I5XA 3CWZA 3ERSX 1T8UA 2JLZA 3C7KA 1KAGA 2G0NA 3AEZA 4LF6L 4JI3Q 3QXSA 5IF9A 1M7GA 3KQUA 1IBML 1EIYB 1ANKA 4OYHA 2IX3A 3UWOA 3NH6A 4GKJL 4B76A 4OO1I 2AFHE 3FOZA 2K5NA 2ZRLA 3RC3A 4DK3C 1L0WA 2R93G 1KZ7B 3OEED 2N49A 2Z4RA 1CJMA 2DWQA 1SVMA 2QQEA 3QBTA 1YNJC 1IY2A 2ZSBA 4A2PA 3GQBA 5A4JA 2ODNA 1F3OA 4M1TA 2CLCX 1M74A 1NKTA 2ATWA 1I6VC 1O3YA 5JRJA 5ELXA 4UKDA 3J81j 1EFUA 5JEDA 4LF7L 1E94E 1PH4A 2A9KA 3IQWA 2IUUA 3VR3A 3DZDA 3UE1A 1L2FA 1KJWA 1D8LA 2FFBA 1GL9B 3I72A 2QPOA 1GL7A 4P74A 2TMKA 4QG7A 1K8MA 4H13C 1FMJA 1F5NA 3OAAA 4MGKR 1PH7A 2ZU0C 1NN3A 2E8GA 1AE2A 4PX9A 2QTVB 2C35B 3NE5B 1TWGH 2PNHA 4KBFA 2F1JA 4PPQA 3IO5A 2Y0SE 3H15A 4HIKA 2ZRGA 5A0FA 5JS8A 4D4MA 2FDCA 2E76C 1KSGA 2JXMB 2QENA 4LNQA 1T5EA 1Q1ZA 1KO4A 3AP1A 2XGTA 1MABB 2A30A 3HU1A 3KUDA 4U7DA 4BLRA 2BHRA 4DHEA 1PMRA 1GUSA 3EAQA 1VQIA 2WWXA 2QEQA 3I8XA 4GMXA 3C15C 4UNRA 4LJ4A 3ADDA 4JT4A 4XWOA 4GNXA 1COWA 2ODEA 4PQFA 2P5TB 2J7PA 4HUQB 5AJZA 2CLDX 5EE5B 5HE9A 2YU9H 1OYYA 4ZKEA 1A5TA 2JLYA 2KJQA 3KFUA 1GILA 2FMXA 1W2BA 3F0TA 4V02A 5TDHA 1AKEA 1U0LA 2A6EC 5AUNB 4DUGA 2C99A 3VKHA 1N36L 3RLNA 1R10A 3DVLA 2ZE8A 3ZZUA 4DV6L 2R6CA 2NZOA 2WWFA 1H8HA 1KSJA 1XEXA 3AYHB 1ZYRC 1E1OA 1CKEA 4PHGA 1P2VA 1N33Q 1GTVA 1ZNZA 3KQKA 2O8FA 4KFUA 1CJKC 4LWZA 2KA7A 4DAMA 1HR0W 2R93H 1KAOA 2OCBA 2OM2A 2WJVA 2BMJA 4NCKA 2V1XA 4PC1A 1XZPA 2FJUA 4HJ5A 4OX9Q 1H9JA 4A8JA 3HOUG 5IHPA 1W5TA 1LV7A 4CT4B 2DFNA 1S40A 1QVCA 3E9HA 1VHTA 2X8AA 5FOTA 3AB9A 2HXSA 3FKSA 3CAMA 4HZUA 1X3SA 2RKOA 2W2XA 2DGYA 4G3XA 4KHPQ 5M04A 2CCKA 2ODBA 4I1UA 4HAWA 1IXZA 1GRQA 1G51A 2DNEA 3A4NA 3C41J 4JCVE 4LW1A 3CMAA 3FFBA 3K09C 3VKGA 2R62A 2VH5R 1FVIA 4FWIB 1G4UR 4J15A 4HB2A 1AN0A 2HV8A 3S1AA 3CPJB 2JLSA 3CMEA 5G3ZA 4LJ9A 2VSFA 3CRVA 2HLDD 4Q4HB 2G9NA 3HOXG 4BZQA 3JAMi 4DT1B 4IXNA 5LDDC 3P1JA 4XOIA 1PLJA 1OXXK 1ZM3A 3B8HA 3TREA 1I2MA 3NBZC 4QJ3A 1OH7A 2WIBA 4IRUB 3UK6A 3THOA 2CL0X 4R4TA 1W48A 1N6IA 4IKEA 4A15A 2A6HC 5HZKA 4POAA 1X56A 2K52A 2QL6A 1M34E 2CE7A 3NBYC 4M9XA 3GEHA 4MRPA 3NHBA 4A6XA 2ZPTX 2ZU6A 4F7WA 5LMUL 3M4PA 4OWTB 1DAEA 1SVWA 1XP8A 2YOHA 3TS0A 1CJUC 1K5GA 4UNSA 4L9SA 3SR0A 3EPKA 4KKTA 1HJPA 2EFHB 3ER0A 5FI1B 1JQJC 3CCRA 1ZCAA 2I5HA 4EPWA 3QUSA 3LXXA 3JVVA 2BV3A 4ASUD 3TZUA 4D4KA 2NTYC 1YZNA 4G5OA 2A6ED 521PA 2YTXA 1MOZA 4DUGD 1JXOA 2WAXA 1JAIA 4QL3A 5FPSA 4ESHA 1GO3E 4OK3A 1F48A 2VSOA 4YY3L 4LJZC 2QU8A 3S1MH 3I4MH 5GADC 1KI6B 2X1VA 3FFAA 1DS6A 4QGFA 3EQLC 1E32A 1XD2B 1ZM4A 1Z08A 2C9YA 4BLOA 3HOUH 1MT0A 2QA4A 4I4LA 4L9WA 1Z6TA 2ZRCA 2O0HA 4NONA 1EFRD 1G7CA 1M1YE 4HLUC 4QQBX 4Q00A 5C0XJ 2FE4A 4ACAA 2G1JA 4C2MH 1FNNA 4R4IA 2GEVA 4MGZR 1R0WA 5C0XG 2ASEA 4P4UA 4BY1H 5C4GB 4MZ9A 2VL7A 2GRJA 4IOLA 4ZPXA 4MUBA 4BQSA 4XWKA 2IS4A 1VYUA 4OQXA 1VTKA 2CVHA 2EFGA 4GZYC 4DR4Q 2IXEA 3T1QA 2AN9A 1XF9A 1X8JA 2IA5A 4A3MG 3HJNA 3B5JA 4R2HA 2NPFA 1T3HA 1RJ9A 5IWAL 3KQLA 4DV1L 3BFVA 3F8TA 2WSSD 4RZUA 4AYXA 2JA5H 3CNOA 3W6NA 4IVPA 4QFMA 1RVDA 1YI2A 4LC0A 1GAJA 2LSSA 2ZM6L 5KTYA 2GF0A 3H1TA 3QPWA 3QKTA 3TNFA 4OBEA 5J4HA 4P73A 1GKYA 1KI9A 3QG5A 2NN6H 1XMVA 4US1R 2D0PA 3SI7A 2G0TA 2LCFA 4XVUA 5DH9A 1OF1A 1E2GA 2ANBA 2GF9A 2KI5A 3A1UA 1V9PA 3ICEA 4UXIA 3LBNA 3X1XA 2IF2A 2N42A 4NB3A 1U9IA 1XNRL 5FL7D 4A3KG 2JLRA 1Z6AA 1E6CA 5FUVA 3PCRB 3K7AH 1HY3A 1NBMD 1XBTA 2G77B 2ERYA 4JSYA 2VL6A 4TWZA 4CIDA 1Y8PB 3NBHB 5L3SA 3EIQA 3FMIA 3OTOQ 2JJQA 1MIUA 2Z6KA 2FSIA 2F43A 2BBOA 1WJJA 1VQHA 1X86B 1VCMA 3P20A 2ZS9A 3FKIH 4P31A 1I5FA 1H9RA 2ZUCA 1SXJC 4LJ8A 3HU3A 3TUIC 2IBMA 1N33L 4P33A 3RSOA 1MJCA 1HZCA 3SDZA 4LF4Q 2NQ2C 1NE3A 1T3SA 3AV0B 3LX8A 4FMDF 3DPUA 4JI0L 4C3JH 3VNUA 3KLWA 2UKDA 4JYAQ 4Y0AA 1IAQA 4A93G 1G8YA 1A62A 4XD7A 4KAXA 4XD7D 2F4VL 2F1IA 4LYFA 5M3FG 1VKJA 5DI9A 3KXLA 3LWUA 2L0XA 3AM1A 1H8ED 5IP7H 4LHWA 1AGRA 3CLVA 4TN1A 1VPLA 4DNTB 2FEOA 1P2UA 2IHYA 4LHVA 2IXGA 4MYUA 2O8BB 1T5IA 2K5HA 3TBKA 1EFRA 3WDNA 4DSOA 2FPKA 2ZSFA 4FCTA 2FX3A 4POGA 4D82A 2PPBC 3RS7A 2K75A 1PLLA 1CR1A 1U0JA 2ZS7A 3DOFA 2D0OA 4M9QA 4JI2L 4IFDH 1E2QA 3W90A 2EJFC 2K32A 2ZJ5A 5FPHA 2YINC 4QHYA 3OOCA 4APVA 1NN5A 4HAZA 1VQCA 2F43B 3MUFA 2V3CC 4BA1I 4IDPA 1P73A 3VAAA 1OFHA 4BZPA 2V55B 2ZYVX 1R5BA 2IUSA 1Z7TA 4UPAA 2GKSA 1NN1A 1Y14B 3CW2A 4A0HA 1XD8A 1N5KA 4A3LG 4YXWA 4WVFA 3QKSA 3GLIB 4H0LC 2CKZB 1J7KA 1NLZA 1Y63A 2C03A 2ZI9A 3RWMB 1B9MA 3RVBA 1ASZA 1MJEA 5JJIA 2I3BA 4PSAA 2VYFA 2EVWX 1SN8A 1N2CE 1NG1A 4KSCA 2KBNA 4IHQA 4QGUA 5H70A 3IO3A 1PJRA 3KZ1E 1Y1VG 3QVVA 2ATXA 4A8JC 1HQYE 2KBEA 2AD1A 1VQEA 2XOKD 2ANCA 2OEPA 3TKLA 3AVYA 3VNVA 2YOFA 4TQ9A 1R0ZA 3NEMA 3M9BA 3SE0A 3W5OA 1KK3A 3AEVA 3M4OH 3AGPA 1R4AA 4J0QA 3BFKA 1GNPA 5K8LA 1PFSA 4RFSA 2DFLA 5FUWA 3QSYA 4TZ6A 2O8DA 1X1RA 4HUTA 5IT9c 2G3YA 2ZRIA 5FTLA 1SXJD 4NXNL 3IBGA 1NLYA 1XMQQ 3NHAA 1ZUNB 1XU4A 2D06A 2QROA 4A3LH 1X1SA 4Q02A 3BU2A 2OFOA 4G1UC 4M4SA 3ZVMA 1UBEA 2VBCA 1YQTA 3EARA 3LXRA 1GKHA 1SVKA 2NG1A 2WJHA 1FTNA 1IBKL 5B2ZA 4DKXA 1A1VA 4PC2A 1ONBA 2UXDL 2CEAA 1AJEA 2C5LA 3FYHA 5DHAA 3EZFA 1XMOQ 3CR7A 1UKEA 1NP6A 3BZCA 4IFBA 1N34L 4EQ5A 2C9CA 4EIWA 1K8RA 4PC6A 1GRRA 1WRBA 4L5SA 4YWKA 1XNQQ 1RW4A 1ZC4A 3A5ZB 2C8VA 2GWHA 2IUTA 1TKWB 2JA7G 3REGA 4DJTA 1GD7A 4OX9L 3AQ4A 3SFZA 3VA7A 5IE8A 4TSFD 1W36B 1KI3A 2DWOA 5D3MB 2O5IC 4FMBB 5E95A 3UIEA 4TSFA 3ZVNA 2VQFL 2Q9CA 2XX3A 3RWOA 4MGIR 4PZ7A 2ZTEA 2E75C 3HKZE 1PA6A 3MXUA 2OFXA 3X1WA 2JJ2D 1TQ2A 3FMFA 3QY0A 2HUPA 5KUTA 4WJ3M 1Q46A 4QKQA 3FHOA 5JCPA 5FOWA 4JMPA 3CRKC 1QHNA 3BORA 4W5HA 4EJSC 4R71A 1E2HA 3F3YA 1SKYB 1P9RA 2JLQA 4JVSB 3DOEA 2MMCA 4NCNA 3PUVA 1HR0Q 4D25A 2ORWA 5DI3B 1L1OC 1LW7A 1DELA 5TMPA 4GN4B 4I1SA 4M1KA 4TTRA 2PQAB 1GM5A 2C2HA 3CNNA 3EXAA 2JA7H 4HB3A 3RS4A 5EE1A 4GKKQ 3VDYA 3N70A 3O8RA 1KDOA 2DWPA 2RGAA 3JZAA 4DBLC 1KY3A 4A3IG 2GAAA 3S16H 1AA9A 1KZGB 1WDTA 4G5RA 3GTLH 4KJZA 1DG1G 3AKEA 1P5ZB 2ZTCA 4V0OA 3U44B 3DMDA 1D8TA 1EXMA 2W00A 4XWAA 1PVOA 1PH5A 4GI7A 3RC8A 2H57A 4BLTA 3IIJA 1I6HH 2UXBL 4XSGA 5JMTA 1PYBA 3I4NH 1VCIA 1CU1A 5EP2A 1XPUA 2GHIA 1Y69U 1KMQA 4Q4AA 2BWJA 4NTZA 1YZGA 2EIFA 2HF9A 4DAYB 1E79A 4NH0A 2NO1A 3SNHA 5M3MH 2PX0A 1P62B 1OKKA 3EC2A 3GLGE 1OPXA 1HURA 1QF9A 1H8HD 1KDTA 5TY0A 4C30A 1XWIA 3MCAA 4E07A 1AS0A 3K0SA 3DM9B 2VY3A 5FUYA 5CB8A 3R7WA 4YCWA 2ZANA 4TMTA 2WZQA 2BMDA 2O5JC 5C3EH 3CKLA 4NYJQ 4TT3A 3PXGA 3EIVA 2QAGA 3OEHA 4URYR 3ZZTA 3HR7A 1BDOA 1DTSA 3QG1A 3LVRE 2ZR9A 1G9XA 3K0AA 2JA5G 3CR8A 4Y7NH 1E24A 1OYWA 3CBQA 5A35A 4WZAE 1OHHD 1E9EA 5L3VA 4TQAA 4H1VA 1ZBDA 3K53A 2NZ8A 4HAUA 3QVUA 3W8RA 4O2RA 3VX4A 1XMJA 4DR4L 5BR8Q 2R44A 4YMWA 3UATA 4HR7B 4B3TQ 3J80c 4AH6A 1KKMA 1EG7A 1NVXQ 4NXMQ 4K0KL 1RIFA 2H8KA 3GLHB 4FW9A 1E2WA 2OLKA 4MKFA 2J59A 3F5FA 2JGNA 3MWJA 4JVLA 2ZI5A 4LRWA 4P4TA 2EYQA 3THYB 1CSPA 1LYLA 4A3KH 3N2EA 4NZYA 2HJGA 2N46A 5FPYA 3FMOB 3NWJA 4FMCF 1KDRA 1M7HA 3HOVG 3A74A 1MO6A 3U4QA 4RY2A 3H94A 1E2FA 2JAQA 2BCGY 3B1YA 2P6RA 4JI6Q 1TQ4A 2EFDB 3TK1A 3S17H 2NN6I 4DNRB 4EQ6A 1X8KA 5DNYB 3U5ZB 1W46A 3TIFA 4IVRA 2CCGA 4MQBA 4BZXA 1Z0KA 3THWA 2GJ9A 1RRFA 3KJIA 2ZS8A 4PO9A 3UMRA 1XB2A 1EFTA 5IP9G 4CEHB 3A1WA 1KMHB 5KSPA 5AJWA 1HA3A 3W34A 1AZSC 2FWRA 2V6JA 4B3BA 4NPSA 3W1BA 1SKQA 2QP9X 3OW7A 2IS1A 4B3DA 4LV8B 5CB6A 1QHGA 2JLVA 5CIWA 4LFAL 3W3AA 4DR6Q 3WYGA 3CRMA 2L5TA 2RHMA 4O3MA 4JLKA 3K0XA 4LF8L 2IY5B 2F3RA 1B23P 3IIMA 4V0KA 1E79D 1KHIA 1CKOA 1R5OA 2OBMA 4IEEA 4Q03A 3E2IA 2XZPA 3OF5A 2EQBA 4BFSA 5P21A 2ZJZA 3G4SA 1PH2A 1T0JB 1JMCA 4JIMA 1HNWQ 3OFND 4BA2I 4A3EH 4YHHL 1K8OA 1Z6YA 3SJZA 1E2IA 3UDGA 3WHKA 1NJFA 1AKYA 2NOAA 5JLJA 1N34Q 2GEDA 1R9TH 1GHKA 2YJTD 3L0PA 4IDQA 4LSGA 4XJXA 1UJ2A 4M21A 3BB4A 4GZMA 5GJBA 2B7BA 3GO5A 4NL4H 1J8MF 4ITRC 4QHTA 1A82A 4PZ6A 1Z5ZA 3VR4A 4I1OA 1OLOA 3QQ5A 3AFQA 4MRRA 3EA5A 2V1CC 3KB2A 2PQAA 5SZIA 2F55A 2DY1A 5GJWC 5KOYA 3X1DA 5LD2B 5DI3A 3D7MA 3TRZA 1FP7A 2QNRA 4GLVB 1W2GA 1PH6A 4P3YA 5EJEA 1DBSA 5HTKA 4B2IA 2VW9A 5E7NA 5EE9A 3LW7A 3WBJA 4TLAA 1PYSB 1IN7A 2VEDA 2ZRMA 4KU4A 3TSWA 5JEEA 3GTOH 1OB5A 4PC3A 4HEJA 3EZ7A 4GT1A 1YZKA 4ILEA 4DSTA 1PH9A 1E2EA 2QRZA 2O8CB 3S2DH 2R7ZH 1XDBA 4PSKA 4L8JA 4D26A 2R92G 3I3SR 4DV1Q 3NTUA 2GJ8A 4MYCA 4PZZA 4ZO4A 4BEJA 1D9ZA 4A3DH 5E4FA 4JI4L 1L4UA 1QZGA 4ASUA 1C0AA 2CXXA 1KSFX 2VRWA 1YR6A 1FL9A 1U0HC 1SVSA 2W6JD 3K0CC 3W3ZB 4B73A 5GADl 3HR8A 4G7ZC 4EJSA 4DV0Q 3NC0C 4KKUA 1OXUA 2VS1A 3KF6B 2B21A 4P71A 3PUWA 1R5NA 2R65A 4FIDA 3DM5A 5GJVC 2WICA 2ZSEA 5A5GA 1XXHE 1NMYA 2PZGA 2GXAA 2DR3A 1B8AA 1S4QA 1TAGA 3FKQA 4F38A 5K8UA 5JRZA 2ZIAA 2A5FA 4LPKA 1UBFA 5D3QA 4H02A 4LJ7A 1BH2A 2JK8A 3L2PA 5AJXA 1NIJA 4M1YA 3G48A 1YEZA 1EWRA 3THYA 1M6NA 2JEOA 3ZIAD 2GXSA 1RRPA 4GN3B 3D6TB 3J81k 2J3EA 3HOWH 2H18A 2YWFA 2RGXA 3B2EA 3BWDD 2AXPA 3DEFA 4Y0VA 3RANA 4DDVA 3GP8A 3ETLA 1N6HA 4GKJQ 3IFTA 3CNLA 4B6FA 1Q1EA 3EZ9A 3L7ZC 4X8HA 2GTPA 4BECA 1VF7A 3AVOA 4HB4A 1SFOH 2RGNC 4F4CA 4FDBA 1QZHA 4GN5A 3K0AB 3MD0A 4PXAA 2XTNA 2Q9AA 4YMUA 3CX7A 3STBD 3RLFA 1XX6A 4B48A 3M7NA 4IVQA 3IEUA 3WNCA 2YTVA 5E3HA 6Q21A 2FNAA 2ORVA 3EPJA 3L2OB 3T1HL 4KVGA 3I5YA 2BJWA 4JK1C 1G3QA 2BJVA 1JECA 3I8SA 3HOWG 2IYUA 4K81B 2PEYA 2B29A 1EGAA 1S3OA 2KE5A 3H3VH 1YRBA 4LDJA 5TARA 4YXWD 2YOGA 2ZUBA 3K70D 2BDTA 2XSZA 2W2TA 2ZRJA 3OE7A 1J5EL 5CDFE 1UEJA 5KU1A 3ECCA 4IEIA 4X65Q 3GTPH 1NKSA 3LWNA 2E2JH 3TLXA 1F2UA 4A82A 5EXTA 1I4DD 2W0SA 4JG2A 1MRNA 4M0LA 3TQFA 2VTKA 2MSCB 1VQ8A 1E96A 1RRGA 4A2QA 4D6PA 3LV8A 1DVRA 1ZNXA 5LMNL 3PEUA 3IBYA 4Q1BA 1IOZA 3KJGA 4GOJA 2J5XA 1W0KD 1X8LA 3I4LA 2JJ8A 2D5DA 3K8AA 1W44A 2PL3A 5L8VA 4KHPL 2A69D 2Q2UA 1EFWA 2WMNB 1H8EA 4WOPA 3IILA 4DR1L 1Q20A 5HKKA 3H0GH 5HCNA 2XITA 3TRFA 4DUYL 4QGAA 3V00A 3ICQB 4DIDA 2A2ZA 3N5CA 4B2PA 4C9BA 4FINA 1WFQA 1D2MA 4DLSA 4ZIRA 1YIJA 1I4TD 4JVMA 4RFVA 2GBLC 4NKRA 2REXB 2JJ1D 4ZKDA 1A8VA 3J81c 2FPMA 3I73A 2ZJRA 4FI3C 2PJRA 3WMFA 2OV2A 2CVFA 1K0RA 3FWYA 4FMCB 5JWRA 3PV0A 3CZPA 4A3BH 3U3JA 2AHOA 4YQFA 4DR7Q 2QAGB 4QJFA 1HTPA 4BBRH 1ZP6A 1VHLA 3C5CA 4IOMA 3WRXC 2HEIA 3CH5A 3R7WB 1V8QA 1GITA 1O7IA 2PMZE 1GFIA 2FZLA 3OW2A 4OO1G 1JE5A 5J4YA 1E4YA 1LVGA 3D31A 1MV5A 2GESA 2IEZA 4CEIB 3TVTA 1W49A 2K4KA 5AJ3Q 1ZD8A 2QORA 2ZITA 1A6XA 1YNXA 4M22A 4TLCA 1TWCH 2AL7A 1DO0A 2I5MX 3T1YQ 3SJBA 1K6MA 1E2KA 1BMFD 3K80C 8OHMA 1K5DA 2ZRDA 3QENA 5LD2C 3OESA 1II8B 3SQWA 1JPJA 1MO5A 1KRTA 1B70B 2UUBQ 1XNJA 2CBZA 3D3QA 1CI3M 1ZIOA 4JLOA 1CSQA 1SLJA 4Y52H 1H95A 2JATA 2WB1E 2WV9A 1R6BX 4TKOB 2BCJQ 1W47A 3LX5A 4DLUA 5DGXA 2A5JA 1ZM9A 4D0GA 4TT3D 3WP0A 3MWKA 2PJZA 5SZKB 1KI1A 1EQQA 3TUJC 2FN4A 5EE3A 3PUZA 4AYTA 1IYVA 5FJ8G 1Y3AA 3RDPA 1RC8A 3K0FB 2R92H 4KBGA 1EWHA 4OK5A 5GROA 1R2QA 3CX8A 4UJ5A 4JC0A 1Z9FA 2HIVA 1P9WA 5C18A 1FR3A 3BH0A 4JI4Q 3EG5A 4G5GA 2CFMA 4R4CA 4UXJA 2PMDA 4F4JA 2WVJA 3THXB 3BZKA 4HLCA 4Z1MD 1E3MA 4A4DA 1IBLL 1YR7A 4EUNA 721PA 3T1VA 3KKOA 5FH9A 4Q7JB 2OQ0A 3B1ZA 4PZLA 5B58C 3DKVA 4A3JH 1WI5A 1E69A 2NMVA 1FPMA 3GJ7A 1FP6A 3NG1A 4AKHA 3GDEA 2WKQA 5AWFC 3RS3A 4OONA 3TS2A 2WWWA 4D4LA 5J4LA 4YCUA 1UWVA 4F93B 4XTRA 4TMXA 3U3RA 3I62A 4LBZA 2A5YB 2X19A 1GJXA 2JQOA 4BRUA 1IY1A 3TGPA 3A8TA 3DL0A 4XIGS 3QKSB 4V0ME 4L5QA 3E1SA 2ZJQA 1IBRA 2ZJ8A 3K9GA 1KMHA 1YZTA 1NBMA 1JI0A 3B13B 3M4QA 2WMOB 3WWVA 4DIEA 3GLIA 1U8YA 3KXKA 1CR2A 2REOA 4A3IH 5CLLA 2FG5A 1VDZA 2C78A 3FHWA 3VR1A 2FU5C 2GETA 4A3GG 2OQKA 1FJGL 3I4NG 3MGCA 3BXZA 5KNBA 3S14H 4MITA 1VECA 3CCJA 4DV3L 1KY2A 4NYIQ 3KXIA 5FFMA 4IOCA 2P0EA 4Z1MA 3NEYA 3RS5A 4C2TA 4ZIRB 4RKFA 2OXCA 4U02A 2PLRA 3CQZH 5FBRB 1M8PA 1CF4A 2WJIA 1BBUA 3AB3A 2I1QA 4P32A 1HCZA 4C0JA 2B8TA 2D2FA 3Q7QA 4LV6A 2O8DB 4V0LA 3G0HA 1SXJB 1BKBA 1IY0A 2VO1A 5M3FH 4Q1CA 2PLFA 2V54A 4RVCA 4Q4AB 4Q7LA 4X66Q 2ORIA 3FE2A 3SEAA 1NJIC 3VX3A 4HAVA 4D0NA 3CB4A 2IC5A 4XTCS 1UBGA 1KKLA 2GVDC 1SVIA 1GVPA 2ONKA 4B71A 4JS0A 2WAQE 2H7VA 2K33A 2AXNA 4C0HA 4IOAA 1X3EA 2F9LA 3C8UA 3GLHE 221PA 2J7PD 4ZDJA 1CEEA 5FLMH 4QBIA 3NELA 3MWLA 1GKUB 4PSVA 4FXPA 1H9SA 3E5HA 2R2AA 4IPCA 4JV5Q 3FTQA 3SBEA 3T5GA 3U4ZA 2OUKA 1QVRA 1VYVA 1QJOA 3ZH9B 1HH2P 2ECKA 3GFOA 2NVQH 2J0VA 4W5JA 1OH5A 4JBJA 4AYBE 4JI6L 1LF0A 3HPRA 2NVXH 4X66L 1P3JA 4LZZA 2H5EA 1PLKA 2EDGA 1FL0A 3OYYA 2V7QD 2IYZA 1ZM7A 2H17A 2P65A 5BN4A 3MWYW 2IX0A 4DLRA 4B75A 5JJLA 1NMFA 3TW8B 4QIWE 3J7ZC 3B60A 2JJ1A 3I1FA 2AK3A 3B1WA 4G5QA 1ESNA 3NH9A 4LUVA 1WCMH 1X6VA 2FZ4A 3D4RA 4PC7A 2XJ4A 2GXQA 4QY7A 4HUQA 4LHZA 4WBSA 2BBTA 2PX3A 3HKSA 4AYWA 5FOXA 1J8YF 2A68C 4C3HH 4URVR 1SHKA 2VNUD 2Q8IB 4X64Q 4NE2A 1NIPA 2WTUA 4LI0A 3DXJC 3BGWA 3QKRA 5KDOA 3ULJA 1GUOA 1E1RA 1JB1A 1T0HB 1UDWA 4DV2Q 5K36H 1MABA 2AK2A 2G1KA 2J0QA 2FH5B 3GJ6A 1GL6A 2MNAA 3BG3A 4LF9L 5AJ3L 1UE1A 3NENA 1N3BA 5AUQA 1E9AA 1LB1B 2I5LX 5C0XH 1EOVA 3I2ZA 2QA5A 1KI2A 1OT3A 4WA7A 3KYHC 2B8GA 4A0FA 5CLQA 4YC7A 3ADBA 3P27A 1X9NA 2DBYA 2BOVA 2Z0MA 2ZE5A 2UUBL 1C1YA 3LH5A 1NVWQ 3OTOL 2C95A 3NKVA 4A6PA 3GTKH 1K83H 5FUXA 1OW3B 2ZSAA 5LB4A 2A1AA 2GBLA 3TQCA 1KI6A 4NHOA 4EFLA 4A3DG 4MKGA 1PUJA 2NVTH 1UE7A 1E2NA 1JR3D 1RIPA 4A0RA 1XFAA 5L3SB 3GLFE 2QBYA 1AIPA 4DV2L 1E4VA 4H1UA 2A78A 1CTMA 4GP6A 3RSLA 1CP2A 4JLDA 1D6JA 3LLMA 3K09A 1W5SA 4ZI3A 1PUIA 2ONJA 3K1JA 4QBGB 3W5JA 5C4MA 1GSIA 3A5UA 3NDBB 3UG7A 2ZJ2A 2ES2A 3CM0A 3WHLA 1D9XA 2F4VQ 3T53B 3HWSA 2VQEL 4EQ6B 3HOZH 2GZAA 2HDNB 3QF7A 1A4RA 2MSEB 4KITB 1ZUIA 5F98A 4B3GA 2VP9A 4URXR 3CONA 3GLGA 1N0VC 1RFLA 1NMGA 2OLJA 2PZFA 3H4MA 4NU0A 1E2JA 4A3BG 1YKSA 1M2OB 2ZI4A 1YHBA 2F3TA 1LTLA 3KDSE 3UWKA 4E5UA 1U90A 2DB3A 2CK3A 1D7QA 3TR0A 2K7VA 1I3QH 3SFVA 3SN6A 1HNXL 2HXYA 2Z43A 1Z6HA 3I92A 2DYKA 3M1IA 3KUCA 3HFZB 1DD2A 1VMAA 1OJLA 5GVRA 3WYFA 1IBKQ 4GRAA 1G64A 1KO1A 1PV4A 1YBYA 3U3KA 4A2WA 1HQMC 2Q2TA 4Q4LA 4DRZA 3U6BA 4DV5L 1SR3A 2QI9C 5JEAH 1VQDA 2VF7A 4WAUA 3R8FA 1DARA 3H2YA 2ZTDA 3MXNB 3KFXA 1G19A 2R9VA 3KKMA 2R6FA 1H9KA 4GLXA 3GJXC 4DK6C 3MRSA 4JLBA 4Z51A 4YY3Q 3OIYA 1NVVR 1MKYA 3KJHA 3SHWA 4IFDG 5AUPB 5IRCD 4C0AC 4HZUB 1XD9A 3KLRA 2GZHA 3CCEA 3JZMA 1II8A 4R2IA 3VU9A 3ZGXA 3AF0A 5B30A 3L0SA 2VUMH 4EX5A 5IP9H 2I0QA 1D2EA 3AKCA 4UNPA 2RH5A 1NY4A 1N5LA 2CMKA 4LFCQ 2EU8A 2H5XA 2Q21A 3EWSA 2QAJA 3L8YA 3DM3A 5FL7A 1OFUX 2ASBA 4DB4A 3I7FA 3FPPA 4OKSA 3CCVA 1S72A 3U7GA 1HR0L 4AG5A 5IWAQ 1UFQA 4NYMQ 1UEBA 1LF5A 5FBQB 1Y1VH 4DVGA 3GLGB 4GL2A 1FNMA 2AX4A 1SVLA 3OAAD 1VQLA 4F4IA 2OCPA 2PMKA 3FKSD 2PI2A 3M4YA 2QQ0A 1PH3A
chains in the Genus database with same CATH superfamily
5COBA 4KLZA 5K6RA 1WD5A 1Q3KA 2BR3A 3EF0A 3PEWA 2PTGA 4L73A 5ILQA 2A0UA 2P62A 3DXZA 4XFKA 4CMHA 2XXAB 3AFGA 1U8AA 2O14A 2WLTA 4COKA 1KNXA 3T52A 3LFUA 2P9CA 1GJRA 2ZM5A 3KOJA 4I50B 2FWBA 3QOWA 3ILXA 1BRTA 1I0ZA 3C48A 5JG7A 3K71B 2KOLA 2NO6A 1Z18A 3KSMA 1TADA 2BEVB 4FDUA 3B9QA 3N75A 4TMKA 2J3LA 1ST3A 2B2VC 1WMAA 1F5SA 1K5PA 1RVV1 2AMYA 2YFHA 3FUXA 4A7PA 1X38A 2FUCA 3KJNA 3PFFA 3L3OC 4WADA 2ZLBA 5EMHA 3GTJB 2P90A 4HXGA 5KOHA 3K9QO 3EOZA 2KQ3A 1L3IA 3EA6A 1QRAA 1GNLA 1EU3A 3CD6A 1AXGA 1R4ZA 1YDFA 3KF6A 2R48A 3LUFA 4G84A 4HDSA 3UT0A 3IDFA 1JG7A 2KCCA 3S27A 1QYDA 3U49A 4DLLA 3ESRA 3M82A 3TR5A 3DF9A 3AKDA 3J7TA 3OQMA 2AQ2B 4OFBA 3CEAA 4Q3DA 3D6NB 2D5BA 1X3GA 4IUPA 4NBWA 4H9GA 5FI5A 3EEQA 4UVGA 3ULKA 3L8GA 1PQ4A 2KX7A 2LIPA 1FRVA 2ISCA 1JICA 1D0IA 1H1DA 1NYLA 2AQ8A 2GZ2A 5D5HA 3EIFA 5J59A 3SCZA 2PS1A 3BYZA 4GR5A 4B2YA 4XVCA 1YVPA 1GPNA 1Q1BA 3RVPA 2NIPA 3GFVA 4QYIB 5JTTA 2W2PA 4C5CA 1KAMA 1YH3A 1T8YA 1UDXA 3R3OA 1U6IA 4KC0A 4B3RQ 3FNBA 1IPFA 1OLUB 2R96A 3I1IA 4B44A 3W9YA 3KEFA 4EGAA 1D03A 1OILA 2BAGA 1EI9A 3EVDA 5EEGA 4EY6A 2OBYA 2PH1A 3VTFA 4ZMBA 4U6SA 5CBPA 5IK2A 1COZA 5BV7A 1BFKA 2EWWA 2FPGB 5HGQA 3A0UA 3KZXA 1BA3A 3TSCA 4C1NK 2GEFA 3C14C 4QPPA 1M5UA 1WMDA 4HXEB 3IAUA 1VP9A 3LVBA 5JALA 2A5LA 1UBCA 3GIDA 1LX7A 2QZSA 5LUAA 4AKIA 1XTQA 2QL7A 1OB2A 4I50F 3CISA 5FHQA 1AQYA 2EXZA 3EXEB 4X7PA 1Q7GA 1J9ZA 4C0KA 4RLQA 4KRFA 1ONSA 1VL6A 2WYWA 4BLSA 3JQPA 4N8DA 1FY2A 2VHWA 3K2QA 3LDHA 1U63A 3AZQA 3PUXA 4IDNA 3S2GA 1XZAA 1SDFA 3FYSA 3HOUB 1ZNQO 2IK8A 3A2LA 3OM1A 1CA5A 3P2JA 1YIDA 4ZXPA 4MGYR 4ZD6A 3B82A 2HU5A 1L7QA 1Z3IX 4D4GA 2B63H 3FNIA 3BJZA 4F5DA 1RL2A 1DKNA 1XEWX 3LX6A 3UXYA 3QY9A 5BR7A 3I56A 3NGXA 5EWMA 1E3JA 1YUNA 4M83A 4W5TA 1H9MA 1R4MA 1YXMA 4AN4A 2FSHA 5EZSA 3JQCA 3E9NA 1RLOA 3Q7SA 4FEEA 2JHAA 3GQBB 4GPAA 4MVJD 3D43A 4PS0A 4W7HA 5FOSA 1NNLA 3NJRA 3K92A 1LQTA 5HRCA 3CZAA 5CNKA 3SLKA 1ZQ9A 1CJVC 4EFNA 4KIFA 4EI8A 4JSTA 1VQ6A 2PX6A 4TUYA 4DR1Q 4WXRA 4HMPA 4XW2A 4PQYA 4RHSA 4A26A 4LXXA 3E8XA 5CX1A 1P3DA 1P0FA 3KJXA 4Q1FA 3DH0A 2PFSA 3BK7A 1XNGA 3FI9A 4A3FG 2CJWA 2GBPA 2WTMA 2J41A 5ALMA 3ZCVA 5AKIA 5K36G 2NU8B 1L1FA 1HDXA 1F2TB 2AR7A 2GPWA 3UV7A 3BK1A 3QELB 1NVEA 1R6VA 1L7AA 5TXGA 1IN1A 2B2WC 2XCUA 1VG0B 5GQSA 1TRKA 2PT5A 3MXOA 4BBSG 2FVXA 2WUDA 1PJZA 3RASA 3HJAA 4C7KA 1VQKA 4OHYA 4D2IA 1OTCA 1KH3A 4N48A 1UF9A 3D5EA 1ECLA 3S15H 1KTVA 4KIGA 4DJAA 3EQ6A 1TZCA 3JVDA 1KZ4A 3BM5A 1FX1A 4B6JA 1TE2A 2EEZA 4A3EB 1C14A 3QMVA 4IIJA 4MV5A 4CN8A 3EEOA 5JAVA 1BZYA 2M32A 2V6FA 1SBNE 3PBKA 3VJMA 1WCYA 2VDKB 3LT0A 3LPLA 3D6WA 1F2UB 3P9PA 1WOMA 1T9DA 1GZDA 3WWPA 1HA5A 3EMKA 1PDQA 4YQEA 4ND2A 4UHCA 1JFVA 4L57A 4O1HA 4FTWA 4AG6A 4DILA 1HNZL 2FSGA 3A4IA 1OC4A 4IOKA 4WKNA 4GI2A 3A4LA 3AVXA 1U1DA 1T4BA 1GNTA 1Q95A 3ZYCA 3AYZB 1XPOA 4AW9A 1SRRA 1THTA 1O57A 1OFIA 1GGNA 1ZITA 2DRIA 4ZGWA 4ID9A 2CD9A 4P8RA 2SHKA 2LWIA 1IIRA 1P18A 3T06B 4U0JA 2F0DA 2Z2YA 3EGWA 3WTBA 4MS1B 5CBEE 4TMWA 3OC0A 3OJFA 2RH4A 1CUUA 3RIHA 4KQJA 1QYRA 3M3YH 2YQZA 4QDUA 4CI9A 4UOEA 4H4DA 2LXNA 1Y1PA 3WFZA 1OIWA 2EFCB 2MDTA 2JAOA 5EI5A 5K20A 2HCFA 5IYCG 1OZAA 2IYFA 3KLNA 4X65L 3GBPA 3MW8A 4PGMA 3OKPA 4WPGA 5C5MA 2XB4A 1F0YA 3AFIA 4X1OA 4XDYA 4HI0E 5AFSA 4JLNA 3V96A 1Z63A 3CWQA 4JI2B 2ZUDA 2JG3A 3K6OA 2OUIA 1RQXA 4KVZA 1EXNA 1KOFA 2CNWD 3L93A 3FSGD 1OJ7A 1PBTA 4KZKA 5F5LA 1YONA 1W73A 2VSXA 2O3QA 2V4ZA 2V97A 3QXJA 2J6BA 4FQ7A 1GGJA 1MC1A 1NR5A 3PC7A 1X3FA 3DOJA 3ROGA 2IS2A 2XQVA 1MHPA 5A4KA 2DUDA 2JA6G 1M6WA 2JK0A 3UICA 4A3GB 2I3DA 3F67A 5HF8A 1TVKA 5EMNA 1JRLA 5LMNW 4DMKA 2HQEA 1XSEA 2BE5C 3FGNA 4H7PA 3VZBA 3NVKI 4NZOA 5H4GA 3HB1A 2UXDQ 2EOAA 2JFZA 4Z0TA 1E2PA 1ID1A 3SXUA 3BMQB 1SCUB 5JVDA 1RM4A 3GI1A 1JKFA 1JLRA 4K26A 1GG8A 1QB7A 4LHEA 1XPJA 1E3DA 3P94A 2O8NA 3TCNA 1KTIA 3O03A 4DYDA 1CA6A 1EL0A 2ZR8A 3UPUA 1B8PA 1M1XB 1XJWA 4DDTA 4N5IX 1F4VA 1PFGA 1P1IA 3RADC 4HNQA 3OCCA 4LXTA 4AN1A 3SHLA 3ML1A 1VL8A 5LQMA 1JQLB 1P39A 4TXMA 3MCTA 4H7BA 4JI8Q 2KWIA 4ARCA 3RD5A 2I0FA 3GP5A 3O84A 3W8NA 1NDQA 1LPMA 2PRIA 3F71A 4S3SA 2B1JA 4JASB 4GXNA 4YV0A 1JE1A 1J1UA 2DWUA 4REMA 3QE0A 4RM3A 1V2HE 3BTSA 1STYA 2O3RA 5EKXA 5DNYB 1NJ6A 4JJKA 3BHJA 3QVTA 1JWUD 3S16B 4TXLA 3A6ZA 3OQ6A 3RUDA 5FFNA 3CH4B 1VQJA 1LBSA 1MX9A 4BFXA 4RCZA 2GN0A 1AG9A 3ABSB 4UY8C 3I04A 4RBNA 5HUJA 1NSTA 1VJCA 2A7QA 4MYHA 1R15A 4NCHA 3R3YA 2I8CA 4WY8A 5CNMA 3UKJA 3RTGA 6PFKA 1I4QA 5THXA 2V4MA 3WMRA 3Q0EA 5JY1A 2HMTA 1CK4A 1ZJWA 4Z6KA 4AS3A 4QJ5A 3SF8B 1T15A 1ESMA 3NDJA 1VQAA 4LY3A 1A4UA 2VJOA 4NCBA 1T1RA 4K6GA 4TV9F 2G8LA 1K7EB 1FP1D 2I33A 3JX9A 3NCHA 2R61A 2G6TA 1N57A 4LQ4A 5JJKA 1B2RA 4OKIA 4Q82A 2EGUA 1HXHA 1N8NA 1C9MA 1GARA 2DLNA 1GFSA 2IHVA 1F0NA 1U2GC 4BLQA 1M83A 2QGFA 3LNCA 3SJUA 3UG6A 2E2WA 1Q12A 1A5BB 3E7XA 2KB0A 3IUBA 4UBJA 3RZDH 2H51A 2H7YA 4G1MB 4FNGA 1Q7YC 4LFBL 3GFQA 2OMEA 1GZ4A 4YWJA 5TMDA 1DAHA 1C3EA 5DM73 1X1TA 2H1RA 2H1WA 2X3FA 3DOHA 3L4EA 4MR7B 1JQAA 3WNZA 1EK6A 4R9SA 3TTSA 4XDXA 1KRXA 5EE0A 5EHIA 4CKXA 5IW8A 1MRSA 4OI2A 1QO0A 2D2XA 1DHTA 2XADA 2XTMA 3C16C 3L1KA 3S5UA 4CT5A 3SSMA 2W93A 2WSBA 3HK2A 1U98A 4H4EA 3H0GG 5C44G 1N2IA 1VPTA 2WJGA 3OPXA 5E9WA 2UYOA 2ZZMA 5KIAA 1DFGA 3MSCA 1E5TA 1UQUA 1WUHS 4KR0A 4Q4HA 5FLXc 2B3DA 2YZGA 1VE9A 4Z3DA 4ZT4A 3U7JA 4ZCMA 1QJ4A 4IXDA 4DSNA 3E1KA 2Q62A 3FZGA 5AXDA 1ODTC 1VP3A 2H0RA 2O2LD 1CS0B 2L11A 5F2DA 1KJ8A 2FLKA 2ZRNA 3NOQA 4KUHA 5E7IA 3C5EA 4URWR 3CPWA 1UAPA 3B9RA 1NLFA 1VIYA 1ZAKA 2GDZA 2HIXA 2D8AA 2P6UA 3EIWA 4OQNA 4ZAXA 4BFUA 5LBIA 5H68A 1QRTA 1G6OA 3C43A 1NT4A 1RPZA 5T1GA 3LCVB 2AIRA 2D4HA 5BNIA 5K4GA 1Z73A 1P7ZA 2NO9A 3JQAA 3U4DA 2ZYRA 2B2VA 4JX9A 3WYEA 1Y6JA 4BNUA 4LYHA 5EIFA 5JPIA 4EHIA 4IILA 2W5UA 4L4SA 3W6PA 4D9MA 1XFDA 1NF3A 1FFHA 4HJRA 1A2BA 2ICIA 1W30A 2IU6A 2HKIA 1XZMA 4MR7A 1DEAA 1E0KA 3LUAA 3BKWA 1F9SA 1BJKA 1W93A 2R11A 3N8DA 3P2KA 5M34A 1ZIYA 3HCRA 2ZVPX 2WUWE 1Y9EA 3L7CA 5IDVA 3ZS9A 4O0AA 2XT9A 4E2FA 4EDHA 2J31A 4HGOA 4UDNA 1AC5A 3BB3A 2W8BA 4KAJA 1BAPA 3AEQA 1TT5A 3TIGA 3L0OA 4MV3A 3R2JA 3UJAA 3DE4X 1WOCA 2FP4B 4MUNA 1AFPA 2CVRA 3SEQA 4BU1A 1T9AA 2GBCA 2IPNA 1VSQA 3A4VA 3ZQ6A 5FTNA 1JU9A 4UXHA 3QIAA 1SGWA 3R74A 3UK1A 3ZV4A 1YHZA 3B70A 3HEMA 5ALQA 1N9ZA 1JDJA 4B3MQ 1XLUA 2FPLA 1Z83A 2QSZA 1WPQA 3DP7A 4IUDS 5EZQA 3ROXA 2QRGA 3RVOA 4UMDA 1OMOA 3HU2A 5HKBA 3I90A 2BTOA 2YNMD 1WBDA 2P79A 5IEBA 4EB8A 5C52B 2ICAA 2WU3A 4OQLA 5IM4F 4G36A 3T7AA 2EDAA 2YXBA 4MS3A 2QCPX 3AR4A 1PHRA 2ZRBA 5IVKA 3D0KA 5M5WH 1II9A 2QAGC 2V7XA 3SVLA 4RWZA 1EAMA 4WZAA 3MOGA 5CAEA 4YGYA 5BR4A 1K06A 1Q19A 2B4TO 4EFDA 1CLEA 1XTUA 3EQZA 4GLOA 1GO2A 2WVGA 4Y3UA 1M5RA 3F2UA 2AVDA 2Q1SA 5LHY1 4ME6A 2JGLA 4XGRA 2J0SA 1UK8A 4HEHA 1T8WA 1L1OB 2K5QA 4PYQA 5IASA 1P9OA 2XR1A 1DC6A 4MYSA 1XYYA 5C8YA 4Z9XA 1AVTA 1LRJA 4V0RA 3K81C 2HX1A 1B7YB 3FKIB 2JBHA 3Q9LA 3T56B 2P5SA 3IXQA 4BFYA 3GFBA 3AVWA 3WLQA 3RG8A 3VPDA 3B8EA 4H7IA 1L5LA 3SX0A 2P9GA 2MSKA 4BO0A 5K9ZA 1XTBA 2NNLD 4PRKA 4DYHA 1CQWA 4Q9KA 5T64A 1ITZA 1J23A 1Z0IA 4FE3A 5BQFA 1HMPA 1V8BA 4LXGA 4UAIA 1NRXA 3QBVA 4AUEA 1AEXA 2A5GA 3ES9A 1Q1NA 1WDWB 2RGNA 2ECOA 5BSMA 5JC1A 5JZBA 3EH1A 1YJCA 1JG3A 1NUSA 4E6IA 1NATA 1TTHA 4UPDA 1EB8A 4R4JA 1GKLA 3MPUA 2RKSA 2ZAGA 4ER0A 2C7QA 2CLMB 1QIIA 4ZOLF 4BKUA 5IK2D 2P6PA 3R44A 4I81A 3HL4A 3PFIA 2JD2A 4EKEA 4XT1B 4NSNA 3RV4A 1XZQA 2LNDA 1YC2A 4XJVA 3IAEA 1XROA 5A9TA 3GVXA 4BBSB 1OH8A 1T2UA 1TA9A 3GJSA 1YJXA 2F9MA 3OWHA 4K9PA 1ZSVA 1EFHA 2HCBA 3NUGA 4H7HA 3SZOA 3DFIA 3P32A 3VH2A 2YC2C 3MJRA 3EOAI 3OZEA 2OCAA 3N5KA 4Q7KA 2SCUA 1C1HA 4MCJA 4BY7G 3DO5A 4Z9BA 1H4TA 2QZPA 2R3ZA 3WIUA 5JECA 3FGOA 2B1GA 4R41A 3RAJA 3SSNA 3MM4A 3ISJA 3UQYS 2WB2A 3TL2A 1EZZA 4JQZA 4K0KB 1E58A 2C04A 4O42A 2AFIB 1I51A 3H1GA 3PO3B 1EB9A 1ZOOA 1J24A 4GGPA 3WWDA 5DKFA 2JA7B 2RSOA 2FEMA 3H42B 5HG0A 1BG6A 3THSA 1A9ZA 1FOEB 3D3EA 2JFOA 5SYAA 3DEAA 4AJ2A 5HA5A 1YIAA 1KRHA 4BFTA 2FFHA 3G85A 2H16A 2H6EA 3AFPA 1WYDA 4IUBS 3T7TA 1SZPA 1XJVA 1T91A 4GUDA 2VA8A 1KS2A 4RD2A 5DTIA 5EWJB 4ABYA 5EUQB 4HQLA 4BFWA 4RJIA 3OEEA 1EWYA 2J09A 2CFTA 1GUGA 3FROA 3MEHA 3K3PA 3HOYH 1WOYA 2Z4SA 1HT1E 1RYMA 3OPNA 3JARA 4N3GA 4QFBA 3X2SA 1QYIA 2D5CA 3O4IA 4YJHB 3U0BA 2FX2A 1MEJA 1G9SA 4LBYA 5EQFA 1DXQA 1JZQA 3M4YA 4NCJA 1Y8QA 1TA0A 1DNPA 2P9JA 2OPHA 3AUUA 4DRYA 4HCEA 4OHWA 3TP5A 1IL2A 2IPLA 4AF6A 4DCSA 2B4YA 5CYOA 3OA0A 1W3SA 3BS1A 2VN8A 2JH9A 1IN6A 2Y4NA 3HVKA 4UP8A 4HWGA 4L9RA 4UDXX 2PU5A 2O1WA 1MAHA 3WJ7A 3TECE 1CQJB 3I4MG 1K28A 2L2QA 3CC7A 1N2GA 3PCXA 3TSOA 3VGJA 4OLAA 2EYOA 3A70A 4Q4JA 2WTXA 2JN4A 1O5OA 5K5EA 4FC6A 4KHPB 2FW9A 1MHTA 3QTBA 3I39X 4XRRA 5IYBH 2IZ7A 2E5WA 4FS8A 1NW3A 4HLQB 1QGZA 4PS1A 4PQRA 5LJLA 2LTAA 4YRJA 2WTEA 3ZI0A 3UHFA 5C5DA 2N88A 5MN5A 3RD4A 1Y0BA 2LDXA 1VL0A 2CJWB 2OBBA 3LPMA 5IVDA 1QPZA 3D6FA 2IHEA 2HWUA 2JAWA 3O91A 4KX5A 3GTPB 1L5ZA 2NGRA 3A10A 3I61A 4PLPA 1OI7A 2AOUA 1V43A 2AMLA 3OQ1A 1V5WA 3NIWA 5WRFA 3BJMA 1ESCA 1L5WA 1BBWA 5KRUA 3P2IA 4KV9A 1BO0A 3FX2A 4M9ZA 2QTZA 1FYVA 2FG7C 3WBBA 3KHTA 5HJ5A 1EGQA 2WZDA 4HYEA 2IF0A 2ZBRA 2W6ID 4MCIA 4YAJA 1NCVA 2VT3A 1PNRA 5IGEA 1C9NA 2QMUA 4J16C 4MOWA 4M8AA 2V59A 5D6NA 4AI6A 2FWIA 4REQA 4CG2A 4X94A 4A76A 1Z33A 2J9ZB 2K04A 1EE9A 5AVJA 4OJKA 4F8EA 5K0SA 4YLGA 5LL6S 2R7FA 5EY5B 4S1TA 2MJLA 1RQRA 2BM1A 4YRFA 4AU1A 1ODFA 1VLJA 3ADCA 1GDHA 3FMPB 1G3RA 3S3TA 2Y0SG 2Y8EA 4OWWB 5LB2A 2HA6A 2LPMA 2P3OA 4IOJA 4YRLA 1F0KA 1SKYE 4NHEA 1L0BA 1U0SY 3EFHA 2AC4A 1WHTB 2CLHB 3E0QA 3FNHA 1T8TA 3QPBA 4LMAA 4X24A 5KKCA 3QF4A 4J75A 4FP5D 3EGDB 4JL6A 2QUBA 5AJHA 4CFYA 1O94C 3M6XA 2JIRA 4R3NA 1SUDA 4N6GA 3B6EA 1RDFA 3OM0A 3ICWA 2GCPA 2YTYA 1B42A 1P6XA 3G0OA 3H99A 4L9AA 5EPLA 4FOLA 3EROA 3AU8A 1Q74A 3KDPA 5CDYA 2BI7A 2VRCA 3V4OA 3KT8A 3N6VA 3NHPA 1Z35A 1QZTA 1MGPA 3MQFA 3BDLA 4Q9HA 5CHEA 5HDQA 1RKVA 4F86A 4KI0A 2AN1A 3Q7PA 4PTLA 2Y67A 2ZYWX 1N32B 4CLOA 3EFXD 3REQB 4L5BA 3EDCA 1UBMS 2C98A 4WNIA 1KQSA 3I6ZA 1J7JA 2FWPA 5HTOA 3H8VA 2X3UA 5LQAA 3FWZA 1KFCB 3NYWA 4IWNA 3ZLUA 4ZOCA 1U2PA 4G0QA 2FCAA 4M2LA 4N9WA 2BA1A 3O75A 2QTRA 4DOMA 2XBMA 2YC4C 3MB5A 1BVHA 1BE8A 4R1TA 4V2UA 4NBNA 5E4JA 4D9IA 3VR5D 1LTAD 5HKOA 1S5ED 1P60A 4K5QA 4ALNA 2NUBA 2PBRA 2X4IA</