3PUXA

Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
371
structure length
371
Chain Sequence
ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPGVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/transport protein
molecule keywords Maltose-binding periplasmic protein
publication title Snapshots of the maltose transporter during ATP hydrolysis.
pubmed doi rcsb
source organism Escherichia coli
total genus 104
structure length 371
sequence length 371
chains with identical sequence B
ec nomenclature ec 7.5.2.1: ABC-type maltose transporter.
pdb deposition date 2010-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3puxA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3puxA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3puxA01
1JI0A 4HATA 3P20A 1U8YA 2LKCA 1N5JA 3E5HA 2GXAA 2O0JA 2ODBA 5FLMH 3I61A 1Q86C 3QG1A 2AWNA 1EFWA 1E2KA 2ZRLA 1EWIA 3M1IA 5DN6A 2RGCA 4HB4A 4EPYA 5HR5A 4IPHA 4A75A 3S1QH 5EP1A 1E79D 3SQXA 3HOXG 1DD2A 4APVA 1S3OA 3QKRB 2BKEA 3GJ5A 2BIFA 3QKTA 3ZYCA 3TR5A 5AJ3L 4OO1I 4DB4A 4URVR 1DPFA 2N46A 2LWIA 4LF4Q 5IDVA 3OOCA 2C04A 2IBMA 4JI4L 3H4MA 3EIEA 4X65Q 3T1HL 3U3JA 1SROA 5C4XG 4DLUA 4DR3Q 1IN8A 2B6HA 1G16A 2DY1A 2ZS7A 4V0NA 3SJBA 4DK3C 3CCEA 4RZUA 2HIVA 4BBSH 1Z5ZA 4GOKA 1GHJA 2WJYA 2QSZA 5CK5A 1KI1A 4BLPA 2AD5A 2F7SA 1WXQA 4QL3A 3SS8A 1TTTA 4BPBA 4IFDH 3N70A 1X3GA 1CKMA 2WIBA 1ZKOA 2WOOA 3BJIC 4G5OA 4M9QA 4I4LA 4BFZA 5JWRA 4A3CH 1YJNA 4FW9A 3RSOA 1ANKA 2UXBQ 2DNCA 4KFUA 3VDYA 4U00A 5IHPA 1L1OC 1L7VC 1ASYA 4I81A 3UWOA 4TYWA 2RGDA 1VQ7A 2IWRA 2SHKA 3KLRA 1KAGA 1SULA 4PSKA 4A3GH 1VS0A 1CBUA 5CJ2A 2P65A 4D4JA 4R2HA 5K8LA 5EAYA 4Z1MA 1QHHB 3HOVH 1ZUIA 2WWFA 4GLVB 3BXZA 4IOCA 2AR7A 4TL7A 4XH9B 1Y8NB 1MIUA 1DAFA 3GD7A 1E1RD 4KBFA 3SC3A 2WWWA 5BWMA 4LSGA 4MZ9A 4JI8L 4X62L 3PEWA 1NSTA 2VLIA 3R9IA 1GM5A 3J7A5 4M53A 1YBYA 3S15H 1X8JA 3GTJH 2ZUDA 2WKPA 5JI3E 1G64A 4NE2A 2IYVA 4IOAA 4JI3Q 2NN6G 5IK2A 2AUJD 3J80c 3LNNA 1ZW6A 3QPWA 4WAUA 1P8LA 1VQAA 4XD7A 5GVSA 3TNFA 1V9PA 1VQ9A 2BE5D 1ASZA 4OQLA 4IPCA 4DLRA 1OIXA 1NBMA 2OM2A 1LYLA 2VSFA 3PV0A 421PA 3D4RA 3CMEA 5DHAA 5C3EH 1EG7A 4DXAA 4A3LG 1WA5A 2WIAA 1CR0A 2OQKA 1HE8B 1K8AC 1WP9A 4LW1A 2BMFA 2QY9A 3CWQA 4LNQA 1BMFA 1JAIA 4HLQB 3TVDA 3MEFA 1E2JA 3A0JA 1G51A 3AKDA 3K0FB 4M8NE 2O8CA 2GRJA 2REXB 4UJ3A 2OBNA 3EA0A 4IJMA 5JFGA 1XTIA 4ARZA 1GKHA 1EIYB 2H1LA 4H9GA 4DUYQ 4Q21A 4P4SB 3TRZA 4C3JH 3ULJA 2QT0A 4LFCL 4NXMQ 2JEBI 5C0XG 1DAEA 2IX1A 2IUUA 2ZM5A 2QBYA 2Q2HA 2J46A 3UG7A 3RNLA 2PX0A 3PR1A 2MSDB 3LVQE 2ZTCA 4OQMA 3CRKC 4DV7Q 5DGXA 5CB6A 3A74A 3D6TB 4JCVE 4JBYA 1YZTA 1HUQA 4NONA 3KDSE 5KNCA 2FFHA 3KFXA 2NO7A 3L0SA 3O8DA 1KI6A 1QHXA 2QORA 2K50A 1S96A 1EFRA 2G0TA 2GZHA 5H68A 2JA6G 1HH4A 3R8FA 4J15A 4RD1A 1VQ4A 1F2UB 1Z47A 3CRVA 3KZ1E 4A2QA 2W2XA 2IS4A 4EPRA 3S14H 3TBKA 3J81k 4QQBX 2F43B 2G9NA 2R8RA 1N8RC 1HA3A 1CI3M 3UK6A 3T5GA 1KK1A 2GKSA 4TYYA 4A3EG 1SVKA 3CRW1 4YMWA 4XJXA 3VU9B 3LNCA 3N2EA 3CMAA 3BORA 4UNNA 4YC7A 4F4IA 2Z0SA 1IBMQ 3GMTA 4HZUA 1N0VC 4NP6A 2CFMA 1U2RA 3TLXA 4DNTB 2D7DA 5IP7G 2IXFA 3PF5A 1KNXA 5FL7D 4GKJQ 2BMDA 1K5GA 4GMDA 1XRJA 1MV5A 2BEKA 1PV4A 1YI2A 4IFEA 5E3HA 5EQTA 1A4RA 2AFHE 3PEYA 3P1JA 4BY1H 2QMUA 1FX0B 2QTHA 2H92A 2C98A 4AKIA 1GKUB 1AE2A 1E1QA 1JNYA 1UEJA 3SYLA 2CL7X 4H44C 3CR7A 5BYJA 4YMVA 3CCLA 4EPWA 3W1GA 1G291 3PO2H 4A3DG 4MNOA 4E22A 4BLSA 1GTVA 4DLZA 4YWMA 2GNOA 4OK6A 4LBWA 4HIOA 1MR3F 3OEEA 5DIFA 1AJEA 5DISB 4IOJA 4JLDA 3X1YA 3KL4A 5FPTA 4B32A 4LJZC 5JSZA 3NEMA 5AUQA 2K75A 5GAHC 1SRUA 1GO3E 3E0EA 1KJYA 1TWFH 2C2HA 3MWLA 5JEEA 1HZBA 1BVSA 1KOFA 2A5FA 3RS0A 3KQKA 2QAGA 3K9HA 1IJFA 4GN5A 3A4LA 4DV0Q 3LFUA 4KFRA 2QRZA 1IYVA 2V7QA 2ZRJA 2BWJA 1IAQA 1N6PA 3FFAA 2K33A 2HHHL 2VP6A 2RGEA 2P6RA 5LMUL 1E2PA 1TWAH 5E7JA 1U9IC 4X8LA 1K3RA 3C14C 1C7YA 2GZDA 5TV2A 3K09A 3RRMA 3R9WA 3AVTA 1OF1A 3KJIA 2AL7A 4KHPL 4LJ7A 2ZRGA 5C18A 5J47A 1VG8A 3IHWA 4Z51A 2PEZA 4DLVA 4NYIQ 5HE8A 3WWVA 3W6OA 3EPHA 4B44A 3EQLC 4A82A 2PLFA 1TXYA 2XTIA 1RIPA 1SZPA 4TL8A 1K6MA 2N49A 2J7KA 4PC2A 5GADC 2L0XA 4WZBE 2FEOA 3LW8A 1K0RA 1GKIA 2QM8A 5SZIA 3IIJA 1ODFA 3PUVA 2J7PD 1KGDA 4JBXA 4JI5L 3WP0A 1DELA 2B8FA 1WCMH 3THXB 1XMQQ 4BXXG 4QNRA 3NBFA 1A2KC 1JQJC 4KKTA 2R6DA 4MKFA 5DLQC 2XEXA 4YCUA 4Q5IA 4DV4Q 2BA1A 2PI2A 4EX5A 1PHJA 4MA4A 4XSGA 5KDOA 3S24A 4UY8C 2LXJA 1AGPA 4A0GA 2B7CA 1G6OA 2PCFB 2ZSFA 1HZ9A 3KTAB 5EP3A 3VR1A 4C0HA 1W36C 2CE7A 3KKPA 4DAYB 1PZNA 2IYTA 3A37A 3C15C 4F4CA 2CK3D 4BA2I 4A3BH 1TX4B 2DR3A 2XGTA 3NEJA 4Q9HA 2JA8H 3KFUA 1HH2P 5CITA 2OFXA 1MKHA 3HFZB 1Z3IX 4YWKA 1XCPA 1IJEA 4IDOA 2F4VQ 2VTKA 4D6PA 3LWUA 1G9XA 2QAJA 3CR8A 4OL0A 2PJRA 2I3BA 2BBOA 2A78A 4DR7L 1DARA 3QXHA 2JLWA 1CIPA 3S1AB 3KFVA 5L3VA 3ADDA 3KDFA 1OIWA 5CM9C 4HB0A 4H0LC 4Q1FA 5JI2E 3BFVA 2RHQB 3BGWA 4A3FG 5E4FA 5KYKA 2R92H 4A36A 1KY2A 4JS0A 4Q02A 2B7BA 4JI6Q 1S3SA 4URZR 3AQ4A 2HYDA 4LX0A 2ZJOA 2NPIA 3K0XA 1GDDA 1M8PA 2ZJZA 1X8KA 1J5EL 4JVMA 1OSNA 2AHOB 4GKKQ 5FJ8G 3HKZG 3CXCA 1Q21A 3VHXA 4C0AC 4CEIB 5JRZA 2OESA 3ND8A 3QIAA 3IIKA 2JA5H 1KI8A 3CWZA 5IP9G 4G01B 3A4MA 3UIEA 5DYIA 3WHLA 1FMJA 1XMIA 1ZC4A 2OCBA 5JWHA 3SJCA 3BRWD 2IHEA 3T06B 3ZZUA 5F9FA 4BWYA 2EFDB 5KDDA 5ELNA 1DEKA 3UPUA 2PMZE 2GTPA 3FMCA 1P16A 2QM7A 4QM6A 4Q7MB 4M1KA 2Q8IB 1C1YA 4M4SA 2JIZD 3M0EA 3BAFA 4GNKA 4A2PA 5LPNA 3HPRA 4Y0VA 1O3YA 1I94L 4EQ5A 4JT4A 2JLYA 1PYSB 3HOWG 2HYIC 4IPGA 2NVTH 2GCNA 3HOXH 821PA 2D2EA 5E95A 2VBCA 3OFND 5JCZA 1P2VA 5BXQC 2BBWA 2F6RA 4FIDA 1WE2A 4G7HC 4LFAQ 1W0JA 1KJZA 4ZDJA 4LF5Q 1LS1A 3DMDA 4JJKA 4RZ2A 1E2QA 3K09C 4KBGA 4Q4AA 3K81C 3ZVLA 2V8OA 2WWYA 2ZI6A 4QL5A 1KSFX 3RLOA 1EIFA 3BB1A 1XMVA 3FE2A 1CJTC 3LBIA 4DSTA 4R4CA 1DO0A 2ZS9A 2PCLA 3W90A 1GP2A 2ZPTX 3CX6A 2XTMA 3S16H 2JJ2A 3TW4A 4C4PA 1WJJA 1IY0A 2OCPA 1VQHA 2A30A 1P2SA 1OJLA 1BKDR 5HY6A 1GVNB 4BY7G 2QTVB 4URXR 4R71A 1NJIC 1R0WA 5FL7A 1Q20A 1VKJA 1ZIPA 4D4KA 1GUOA 2EVWX 4E09A 5JBQA 1YNXA 1HNXQ 1JECA 2B8WA 3SHWA 1SN8A 4V0KA 1F5NA 2D74A 1N3BA 4B3SL 4V0OA 5M04A 3MFYA 1NF3A 4IPDA 1HZAA 1CTQA 1SQ5A 4DV2Q 3THOA 4DIEA 4ALPA 4POFA 1ZM9A 2XNDA 1H8ED 2WSSD 1E4YA 1FJGL 1W2BA 2W00A 4RY2A 1JEDA 1YKSA 2ZE8A 2WJVA 4TTQA 4FWTA 2VY3A 1C9KA 1F3OA 2JLXA 1T5LA 3ZZ0A 4DLXA 3BWDD 3EXAA 5A35A 4LPKA 1OIVA 3GLFB 3HOYG 5K8TA 1TU2B 1A1VA 4KKUA 1KO1A 2RGXA 3WYAA 4KJZA 1EQRA 2K14A 5CYOA 2FZLA 3T1TA 4DV5L 2O8DB 1VPLA 1C9OA 4EQ6A 1NY4A 2Q9AA 2O8EA 4V02A 2IA5A 5CDFE 1XXHB 1E3PA 3SBDA 2QSYA 1DGSA 4A3LH 2A6ED 3AH8A 2KHJA 1Z0AA 1GFIA 3FMIA 5AJ3Q 3K9LA 4PC3A 4IXMA 2CWPA 2RHDA 5F3WB 3SOPA 3W6PA 3GLHE 2NZOA 4JI4Q 4BBSG 1NE3A 2AFIE 2FZ4A 4GI7A 4ESHA 3RWMB 3CCJA 3T1HQ 2C9OA 1HPCA 4HJ5A 1QDEA 2VHTA 4FINA 1PH3A 4R1JA 1Z08A 3NH6A 1OFUX 4MGZR 4BRWA 1K73C 4JI1L 3IILA 3QEJA 3U7FB 1Q3HA 5HZHA 3A7LA 5C0XH 4RCNA 2QROA 3W5JA 4ESVA 1XZPA 1HT1E 2DFNA 3HU2A 1NMXA 2J7PA 2WVJA 4KVAA 1U8ZA 4R2IA 4HLDA 5B58C 1ZBDA 2P6NA 2A7QA 3U9SA 3R7WA 2PZGA 2DFKB 2QGNA 3EC2A 3GJ3A 2L15A 3GLIE 4KLZA 1FL0A 2K5HA 4A4IA 3A5ZB 2YOFA 4EIWA 2JA6H 3VX4A 4L5SA 5EZ5A 2AD1A 1FGUA 3AVOA 2ZRNA 2JDIA 4R4QA 3ULPA 3EWAA 3RNUA 2E8GA 2V1CC 4HB2A 4JVSB 4IVRA 5FPKA 2XX3A 4B34A 5L3QA 1G3MA 3J81i 4K0KL 1VYVA 4POAA 2QE7D 1G8PA 4LWCA 4NZYA 3M4OH 4A3EH 1NI3A 1NY6A 1JALA 4FD2A 4A3MG 5F98A 4JI8Q 4X62Q 4BLQA 1FTSA 4PSVA 1CJKC 2QT1A 3ZH9B 2WWHA 4EFLA 5FOSA 2OWOA 4OYHA 4GNXA 2BKUA 3DO6A 1MRSA 3FHTA 2DWPA 1YHBA 4DKAC 1HE1C 3EZFA 2JK8A 1KO8A 1TUEA 1G5PA 3WP1B 4AKEA 4DNIA 4W5HA 4PZ6A 2J0SA 3CH4B 3N2IA 2FE4A 4HAWA 3I8SA 1KAWA 1E2EA 4B71A 3FYHA 2ZJ8A 3I5YA 3IKJA 4P4SA 5L8VA 5DSZA 3ADBA 1OW3B 3G48A 1XX6A 4UXHA 1U90A 3EW9A 2BMEA 3WYGA 4TYNA 2MMGA 1UM8A 2JLUA 4PANA 2XTZA 1T5IA 4A3DH 2CBZA 2ODEA 2ZRIA 1W5TA 3PCRB 3MAAC 4OI1A 1HURA 3W3AA 5H1SE 1PVOA 1PLJA 3CNOA 4XWKA 4PXAA 1T5EA 3AUYA 2E87A 4JLJA 2OLJA 2FXQA 4C0BA 1PH6A 4LFCQ 3T1YL 1HNWL 4Q19A 3A58B 4EUNA 1VDZA 1N36L 2ZRAA 4AKHA 4KN7C 2G1KA 4ME3A 3VU9A 3BBPA 3NEYA 2HXSA 1KDPA 1Z22A 2GJSA 4JLPA 1T3LA 2XB2A 3CPWA 2Q0HA 4DCUA 3DPUA 3IEVA 3HU1A 4Q4HA 4YCWA 4EPVA 2V1UA 4AG5A 1R9TH 2JIZA 4FCTA 4UP9A 2TMKA 4DDTA 2XXAB 4X64L 1TADA 4Q01A 3TUZC 2HQLA 2CDNA 2CHVA 2XOKD 3OFNA 4NYIR 5B57C 1NMYA 2RGNC 2CKZB 4JKIA 4P4UA 4D0NA 3SU8A 2ZYTX 1B23P 1GD7A 4X66L 2FPLA 4RD3A 2D0OA 3HP1A 5JHGB 3FKIG 4C3IH 1NMZA 2BA0A 3CCMA 2HT1A 4QKQA 1KNQA 3LV8A 3VAAA 1E3MA 1GUAA 4OXPA 4TMXA 1EK0A 4FN5A 4C0KA 2WAQG 4GLXA 4C2MH 4EJSA 1IY2A 3U3KA 4A76A 4JBJA 2FFAA 5UKDA 1Q1QA 4B76A 4BXXH 2VEDA 3DOEA 1LTQA 2QRNA 1TMKA 1SXJE 1YJ5A 2O8BB 3P26A 4B33A 4NL4H 4OX9L 1YJ9A 2GJ9A 3BFXA 3PO2G 1QG2A 1GHKA 4LYHA 5C1BA 1PH8A 3LXRA 2J0QA 2R7ZG 3DXJC 3GTKH 1N6RA 4DCVA 1XJQA 5BQ5A 4G3XA 3T1QA 4LV6A 2O0KA 2VHQA 3PUZA 3PF4A 3MSXA 1J70A 1IYJB 3L2OB 4MYHA 3ERSX 1XJCA 2OFWA 5FUYA 4Q1EA 1N32L 4B43A 1S9DA 3A1WA 1IW7C 2ZVPX 3B6YA 4IDHA 1CUKA 1Y1VG 1KDOA 3AVQA 1ZD1A 4ZO4A 2ZT9C 1A8VA 3GLGB 1M34E 2D3WA 3AVXA 2RGAA 3NC0C 2WZQA 1H8EA 1E2HA 2QAGC 2EW1A 4ABYA 1IZ6A 4G7ZC 3NENA 1XEFA 2CCKA 4MGIR 4TSFD 3U2QA 2UZ3A 2KBNA 3SYKA 2UUAQ 2H7VA 2NGRA 1G1MA 4CVNA 2NN6I 3NKVA 1OPXA 2G6BA 1GUTA 4O0AA 1E69A 1VG0B 3AB9A 4DUZL 4DR5L 4LF8L 1OFIA 1X1RA 1ZVQA 1SMYC 4GOPA 3B1XA 4C0JA 2HHHQ 2NQ2C 4A3FH 1PH9A 1GJXA 3B1ZA 5LMUQ 4GDFA 5HPYB 1MABA 1H65A 2ZVQX 4DRZA 1A6XA 4DEYA 3FP9A 3CD6A 5JJKA 2AK2A 2ZE6A 1GRRA 1OXVA 4KHPQ 3CLVA 4WVFA 4BQSA 5HKKD 4TLEA 4JLKA 2B21A 1SMXA 4ZCMA 2Z6KA 1QHIA 3LWNA 4TMZA 1SXJD 3LXXA 3MG9A 3CH5A 3HGBA 1E2VA 1NIPA 5EUQB 1YR6A 2A69C 5FJ8H 4AYWA 4KODA 3AYHB 4TWZA 3K8AA 3TZUA 4JL6A 2ZSDA 1UPTA 4LJ8A 4O25A 3SFVA 1KK2A 3RABA 4L8JA 3E9IA 5IP9H 2YZ2A 2OG2A 3FOZA 3NH9A 2YYZA 3NWJA 3QE0A 4UNPA 2WMOB 5C0XI 1G7RA 1WB9A 4JI5Q 3H2YA 1OFHA 4BFUA 2V6IA 3A7AB 2Q2TA 1U81A 2A5YB 2GBLA 1E2MA 4X8OA 5EXTA 2A5JA 3VR6A 2F1HA 2FFQA 3LW7A 4LCBA 3HKZE 4K8OA 1RRFA 3AF0A 4QGHA 1A7JA 3CCQA 1XTRA 1YZKA 3HOWH 2GDJA 3B9PA 1B70B 3CCUA 1X54A 2H5XA 5FL3A 3X1DA 2P2LA 3AKYA 3VQTA 4GBMA 3KLWA 1YITA 3S1AA 3KJOA 4DWJA 1NVVQ 5M3MH 1AH9A 1II8B 5FBLB 4QG7A 5E7MA 1P62B 4D4MA 5LB2A 4JL5A 3ZJYA 5A4JA 2GJAA 1OH7A 3NBZC 3JC66 3QNUA 1QHYA 3B2EA 3Q3JB 3TS2A 4A1FA 2A3RA 5FI1B 3U6KA 2MMCA 2QE7A 3AV0B 3BC1A 3U7EB 3VFDA 3K70B 3QENA 2MNAA 3BE4A 1VF7A 4GN3B 2XSZA 3F5FA 4KYUA 4IJHA 4O2DA 1J2JA 2IYXA 3BH7A 3RYTC 3UMSA 4DR7Q 4DLWA 4IXNA 1FZQA 3J81c 2JA7G 2ES2A 1Z0DA 4Q1DA 3VX3A 2BE5C 2EFEB 2RAPA 2ZRBA 3ADCA 5DNYB 3GLHA 4BY7H 1JJVA 3AGQA 2YWHA 1R0XA 5EUMA 3KJPA 1Z83A 1YHNA 1YE8A 2Q3HA 3RS7A 4A8JA 2OAQ1 2UZIR 3H15A 1G8FA 2DYKA 2VQEL 3TS0A 1AKEA 2PI2E 1U99A 1ZD8A 3PVSA 1T0JB 3Q72A 2CL6X 4A3IG 1J6QA 1EOVA 2ZJBA 3X1XA 4L5QA 3GTQH 1W2HA 2JA5G 4KXFB 2QPAA 4DEXA 4ZIRA 3THWB 1J5EQ 3KJEA 4JMPA 2IXEA 4OJKA 1JR3D 2ZTEA 3LX5A 1W3SA 4G0NA 2CCZA 4BEBA 5FTMA 1CSQA 1T3HA 3KUDA 3U4ZA 1Q57A 5TVKA 3GLIA 3FMOB 2NMVA 4PR0A 2GXUA 4MKGA 1LB1B 2ZR0A 1TF2A 3HOYH 3L0OA 1Q82C 2BDOA 4GFDA 3QXSA 3CC2A 1TU3A 4LWZA 4H02A 4JYAL 2D5DA 3QF4B 4ON9A 3I72A 4B2IA 3NG1A 2F1MA 4AD8A 1XZQA 4OWTB 2C77A 2QA5A 4P0TA 3IEUA 3LDAA 1I94Q 4RG1A 1KK0A 2JXMB 4A15A 3KKMA 2Q3FA 4NKRA 3B1VA 1P9RA 3W34A 3A8TA 1T3SA 2OFOA 3D3QA 1P61B 4HDCA 2N3SA 3DDCA 2W6ID 2JE6I 4ACAA 2KHIA 4DLSA 1XB2A 1KZGB 1Z2AA 1VQ5A 4PSAA 1E0JA 1CLUA 4YXWD 4GOJA 2ATVA 2DPXA 4AC9A 2QN6A 3K8YA 2EU8A 1Y69U 4P71A 3T53B 4FDBA 4YY3L 1OT3A 2GILA 4D2IA 1VQGA 1TNDA 3RS4A 4DCNA 2ANCA 4MDEA 1AQUA 4PTLA 1R8QA 4L5BA 2IYZA 4GPTA 2NIPA 5D3QA 1RPZA 1S9HA 1CKNA 1HR0W 2E9SA 2FGJA 3ADKA 3MJRA 2YTYA 4Q03A 4US2R 2AMCB 4LK1C 1SGWA 1EWQA 4L8GA 2BCJQ 2C95A 4V0ME 5B30A 6Q21A 4BGDA 1K8RA 2P0EA 2Z43A 2Z4SA 1KIXA 4L15A 1KAOA 4JI7L 3LD9A 4G5SA 1IN4A 3HWSA 1X3SA 4BASA 3THYA 3KKOA 4B48A 3OYYA 1JJCB 3SNHA 4OGQC 3CF5A 5GVRA 3H84A 1YZGA 4PZZA 2ZUBA 4YDHB 1KO7A 1I5FA 1ZNYA 2E5LL 2W6JD 4BZPA 3SZRA 3REGA 4A0FA 2RMKA 3F2DA 4B3SQ 2UKDA 4JZKA 2PT7A 3MRSA 3PJRA 3M9BA 3K0AA 1RRGA 1U8AA 3P4YA 3RWOA 2R44A 4LF7L 4HIKA 2PQAA 1KTVA 2ID0A 4A3MH 1ONBA 3S2HH 3EBEA 1S1MA 2UU9Q 5GJCA 1FJGQ 1YVDA 5J4YA 2YC4C 4W5JA 2XITA 5FUVA 2B8GA 2PH1A 3H86A 2F3IA 1GNRA 4JYBA 1X3FA 3K9NA 3CIOA 4OK3A 3UG6A 1SHZA 2BV3A 1D6JA 4M9XA 4JK1C 2FFBA 4B2PA 4EPXA 1V1QA 4AQYL 1LS6A 1G5TA 3N5CA 3EARA 2ATWA 2V1XA 3PEUA 5G41A 4DV5Q 3ICQB 4UXJA 5KPJA 5SZKB 1MT0A 1AE3A 2A1AA 1VG1A 2QP9X 3QKUA 4H1UA 3UDIA 2IHFA 3W6NA 4M1WA 4DBLC 1ZM7A 2WAYA 1XCMA 3B1WA 3A6PC 3A1VA 3PCOB 1VQDA 1VQBA 2WV9A 3ZIAD 1OTCA 2Q2UA 4UP8A 4JI0L 1E2ZA 2PZEA 4RVCA 4Q66C 4TQUS 1H8HD 2YWGA 4B75A 3M4YA 4LJ4A 5AJXA 1Y1WG 5J4VA 1S2MA 4HUQB 2OILA 1SXJA 2AXNA 2J0UB 2GWHA 4MKHA 5DI3A 1Z6TA 1KKLA 3ECCA 4DLYA 2JLZA 1ZCAA 2HJVA 3OEHD 4JI1Q 1PH1A 2QZ4A 1PH5A 2DFLA 3MCAA 1VHLA 3MJHA 1RYFA 1JT8A 3OE7D 1E1TA 1X3EA 3OTOL 2BMJA 2WJIA 1SHKA 1JJ2A 2J1LA 4CEHB 2WFWA 3DVLA 3K9GA 2ZU6A 4LF9L 4AYXA 1L0WA 3AEVA 1TL7C 1TU4A 2C96A 4BFWA 4DCTA 1Z29A 2QP3A 1UE6A 1OHHA 3LO5A 4JLNA 3FMPB 4TQAA 1EQQA 3EPKA 4IQZA 2XAUA 5HTKA 3JZAA 1MO3A 4URWR 1F60A 2QG6A 5D3MB 4UPAA 5JCPA 1AK2A 4UXIA 3BDOA 3AF4A 4LUCA 3M4PA 2GHIA 1X8LA 2CW0C 2IT1A 1E2DA 2VYFA 2WWGA 3A36A 4G5QA 1M1KC 2JLRA 2RHSB 1AA9A 1YR9A 4JBKA 4K0KQ 4M22A 4GNXC 2ZRPA 3RZOH 1EFCA 3PENA 5CIQA 3VNVA 1GUGA 1L4UA 3GJ0A 4QGAA 1ESMA 3U44B 3FKIH 1DBSA 2P6UA 4NPHA 1VQEA 1UADA 4UKDA 5CK4A 4DZZA 3HYTA 1CR1A 1J99A 1IHUA 1I2DA 3RZDH 3KF6B 4M1SA 5ANRB 4I1UA 4DKXA 2E2IH 1Z06A 3AEZA 1RKBA 1UKYA 4A3JG 2BBTA 2RGGA 3IUYA 1PH2A 2HLDD 4QGUA 2ZAOA 4KFSA 2FNAA 4PC7A 4RD2A 1W5SA 4WZ6A 4YDSA 5IF9A 3DM5A 4A3KG 3LQRA 3EWSA 3T15A 1OB5A 1T4GA 4XTCS 3VKHA 4MRNA 3DM3A 5BW8A 4QFMA 1COWA 3IHLA 1Z6HA 1XTKA 1BH2A 1OE0A 4D82A 2PT5A 3KQNA 2R7ZH 1UEIA 1CR2A 2WAQE 1TWHH 2CNWD 1P9WA 3A1UA 1HCZA 3TAHA 3I2ZA 3I4LA 1SR3A 1KYIA 1RIFA 1TQ4A 2OZEA 2XJ9A 3TIFA 2CMKA 3W5IA 2VNUD 1M2OB 2Y0SG 3C16C 3QBVA 1HTPA 1Y1VH 1NBWA 1WOCA 1QJOA 2H57A 4LUZA 1G7TA 2JA9A 5EXSA 2AK3A 3HPQA 3KQHA 3JAMi 1Q81C 1G3UA 2ZI7A 1TAGA 4QHSA 5J4HA 4GMXA 3TREA 3GJXC 3VR4A 3I3SR 2WM9B 4QHYA 3X1WA 3ZDQA 1O7IA 3KYHC 3T1YQ 1HNWQ 2OXCA 1K8GA 1YEZA 1N36Q 1I4DD 1TEXA 1UFQA 2V9PA 5HCNA 3UWKA 4LFBL 4AURA 3I7FA 1N34L 1XWIA 2WTUA 1XEXA 4D26A 1SKQA 1E79A 5M3FG 2I4IA 3DOFA 2O8FB 1R2QA 2EYUA 4B2LA 4MRPA 4TZ0A 2ZSAA 4Q9IA 4IDNA 2ZTDA 4F4JA 1NL3A 5TY0A 2FSHA 1NVWQ 4X64Q 1KMHA 3RC3A 4KKSA 3U4QB 1G21E 4CT4B 3ZVNA 4TLBA 4DR6L 5DE3A 1W36B 4LYFA 4E03A 3QVUA 4DB2A 2UXDL 2W6IA 5FPYA 4GN4B 2DBYA 3ZLJA 5LD2C 1M1YE 1R0YA 1BO6A 4ILEA 4KLNA 4HJ7A 4X66Q 4B3DA 4EJSC 4Z8YA 2E1RA 1S72A 2YNMA 5KSPA 4IFDI 4TZ6A 4WJ4A 1OKKD 2NO0A 5CLQA 3U3RA 1XTDA 1JPNA 4FCWA 5LDDC 2F1RA 4EAQA 2ZR9A 1GL7A 2IHYA 2IHBA 4DNRB 3K0SA 4D0LB 2IYLD 4MUBA 1H9KA 3MXNB 5HGQA 5SZJA 3MWYW 2ZRDA 2ZRCA 2W0SA 4OX9Q 3K0CA 5EE9A 5F9HA 3OESA 3H3VH 4IFBA 1K8MA 4IKEA 4DT1B 1UAAA 2VHUA 2E76C 1HYQA 2QMHA 3ZS8A 1A5TA 3QPUA 1TWGH 1NVVR 4Q7JB 4OBEA 2BHRA 3ETLA 1E1RA 4I7ZC 3A8JE 4LI0A 5BN5A 2G0NA 2W6JA 5CB8A 3IQWA 5BN4A 2DWQA 1N32Q 2EDGA 3EPLA 4RJLA 4MRVA 1A62A 2HIXA 5CLLA 3OW2A 1UEBA 2NOAA 1ZUNB 3U7GA 5HCIA 3DEFA 2ZTSA 3W8RA 4LBYA 1VQJA 4DV3L 1FFHA 5M5YH 1US8A 2YC2C 4RFSA 4GOPC 3ZQ6A 2J5XA 4R7ZA 1QUQB 1PH4A 3H0KA 2JA7H 1SKYB 1A2BA 2G77B 3QJYA 1GSIA 5FTKA 4LF8Q 4DUZQ 4DR5Q 4XD7D 5JHHB 3MUFA 5H1YA 5IWAL 4FMCB 3QKSA 2Z6KC 3QBTA 2ZI5A 4IHQA 4J0QA 4MRSA 4DV1L 3ONWA 5AUOB 3NTUA 2QU8A 2QGZA 1BBWA 3GTPH 1ZM3A 3IO3A 1M74A 1NKTA 4A3IH 1G8HA 1UF9A 1HZCA 1T9HA 1ZUHA 1XPOA 1CR4A 2ZI3A 5FBQB 4LYJA 4P33A 4V0MA 4C3ZA 2ZR7A 1F2TA 3ZIAA 5FOXA 1LVGA 2VO1A 1JJGA 2IY5B 3I8XA 2YTXA 3SI7A 3AF2A 3U7HB 1YRBA 5FTLA 5KUTA 1K8OA 2GBLC 5DI9A 1SE8A 3O8BA 1JQLB 2JJ8A 5C4JH 4JLMA 4ZDIA 2E2HH 3S17H 2UVQA 4H1VA 1J8YF 3OEHA 4MYCA 2X8AA 2WP8J 2YOGA 4B35A 5KOYA 4HIMA 5FPHA 3IBYA 1XD2B 4BUJA 1JAHA 4DUGD 3DHWC 4RD4A 4R4TA 1NN3A 3LGJA 4JSTA 3D0FA 2GESA 5M3MG 1T91A 2I5MX 2VHJA 3C4JA 1L8QA 4IVPA 1U0LA 1BIFA 3VR2A 3ZJYC 1G3QA 4G5GA 4NYJQ 2R6GA 4BA1I 3L43A 1E2GA 4HDQB 3EX7C 2GCOA 4BLRA 2E2JH 4MRRA 3AVYA 4C0SA 5F2EA 1KI4A 2R62A 3QUSA 4II7A 1ZP6A 4M9ZA 2B3GA 3I4MG 1ZC3A 2WOJA 5M5XH 3UDXA 1VQFA 4Q4JB 1H9SA 3TE6A 2O8DA 1FL9A 3FFBA 2BDTA 3A8KE 4C7OB 3F2BA 1YIJA 3BH6A 4DDWA 1T0HB 3THWA 3TR0A 2UUBL 1NRJB 4ASUD 3GP8A 1CSPA 5FOVA 1E9FA 2PMKA 1M6NA 2GVAA 3BD9A 2OHFA 1ZM4A 3CM0A 5E7IA 4A8JC 2CL0X 4BZXA 4BZQA 3CZPA 2OBMA 2HLDA 2A68C 3CPJB 3JVUA 1XPUA 4RCYA 4LBVA 4R98A 3J7ZC 4QRHA 3CC4A 1U5KA 2VQEQ 2W2TA 1D8LA 3G0HA 1K9MC 1P73A 3QKRA 4GSYA 3SN6A 1CKOA 5FH9A 2CNWA 5TARA 2PBRA 3L0IB 3MWKA 4JJZA 5C4MA 3OIYA 3T5DA 2IS2A 1NLYA 4UP7A 3VHLB 1H9JA 2N1BA 3AP3A 2W0MA 4ERNA 3F8TA 1OFTA 1LF0A 2AN9A 4L16A 3VMFA 1W36D 3I73A 3TRFA 4FMDB 2GF9A 3B7GA 2GXQA 2OT3B 3I1FA 4NYMQ 1L4YA 1D8TA 4S35A 4TT3D 4CRWB 4WOPA 4OONA 1P3JA 4TMVA 5C4GB 5JEAJ 1AS3A 2VQSA 4FCVA 4JYAQ 1OV4A 2KCTA 4OWXB 1HQYE 1RW4A 1TEVA 3CAMA 1XFAA 4URUR 3WBJA 1SVWA 1DS6A 3GEEA 3A8IE 4O0MA 3RANA 2GEUA 1W48A 1EESA 3ZZTA 1YZQA 3JAMc 1PH7A 1WBBA 4M0LA 1E22A 4CGZA 1YR7A 4QGGA 2NZ8A 3OAAD 2MO0A 3I32A 3F2CA 3OW7A 4HDOB 4IOKA 4PQFA 4YQFA 4N0EA 1FP7A 3CKLA 4R4OA 1XNQL 4LHYA 4DDUA 1KK3A 2VL6A 1DCZA 5IYBH 5IYCG 1GOTA 2FX3A 4TMTA 5AJVB 1Y1WH 1QHHA 4XTRA 4AK9A 1D5CA 4YY3Q 2GVZC 2AWOA 3IFTA 1FUKA 2F55A 1IBKL 1Q22A 1R5OA 3LY5A 3KQLA 2ZJQA 1UWVA 2HXYA 3TQFA 3QY0A 4ZV4A 2G1JA 1OKKA 3AQQA 2GJ8A 4MH0R 5L3SA 1G5RA 3JVVA 3LH5A 3P4XA 4IEEA 1N2CE 4Y52H 2YTVA 4HAZA 5D3MA 2V54A 3QEOA 3M6AA 3X1ZA 2IS1A 4JI7Q 3B1YA 2WSMA 4IEIA 1A82A 4DK6C 1KI7A 4RFVA 3V00A 5FTJA 1QVCA 3IO5A 2C99A 3A5UA 1IM2A 1Q90A 5TB5A 4A6PA 2GN5A 1ELOA 4KV9A 621PA 3VKGA 3CCSA 2D7CA 3M3YH 1EWHA 2IUTA 2E5LQ 1Q0UA 2CK3A 2WHXA 2ZU0C 3KB1A 3KOJA 3NBHB 1Z9FA 4GP7A 1CJVC 2O8CB 1Q1EA 1EFTA 2JCSA 3CNLA 1AS0A 2NO1A 3FB4A 4B47A 4DSUA 3BU2A 4ARZB 4V0LA 4OI0A 4LF7Q 4JIMA 4BLTA 2ZXUA 3RS2A 3GJ6A 4CW7A 3K0FA 5J4LA 2HUPA 4WBSA 3AVUA 3I4NH 3U61B 2QBYB 4GOXA 2CLCX 2BCGY 3QVVA 4NCIA 5M5WH 1RYHA 2PCJA 4PZ8A 4C9BA 2R2AA 2ZRFA 4A3JH 2FMXA 2X77A 1SVOA 1VIYA 2ZRKA 4EFMA 4AQYQ 3LX8A 1DAIA 4P31A 4A3KH 1HY3A 4IW3B 3AFQA 2P3SA 4P4TA 4U02A 3VTKA 1VIAA 1KI6B 2RCNA 4HR7B 2WB1G 1Y63A 1ZU4A 5GJVC 5EZ6B 1PLKA 3B5JA 4JLOA 2YV5A 2ZAMA 4CEHA 1CRQA 1LY1A 1GUSA 5IRCD 3GJ4A 4W9MC 1E9EA 3W3ZB 5LMNW 4IRUB 1CULC 1G8YA 1NN5A 4LHZA 2V4DA 1G4UR 1SXJC 3ND9A 2AKAB 1F2UA 2DWOA 5IY0A 2IC5A 2WPDD 2XZPA 4PPQA 4M1MA 2Z4RA 3LVRE 1OH5A 4PMWA 1FYCA 2Q6TA 1Y14B 2MO1A 1WRBA 2F43A 1T8UA 4XWAA 1VQOA 1E4VA 5JRJA 1FQJA 1V8QA 3D8BA 4HZUB 4NMMA 3FPPA 5KNDA 1DG1G 4Q48A 2G83A 2KWIA 2D2CC 2R9VA 4LUOA 4JLAA 3I5XA 1UDWA 4Q9KA 3OTOQ 2AUKA 2N8NA 1IONA 2Z0MA 4HLUA 2VZAA 1KI9A 5J4KA 4LF9Q 1W0KD 1AQYA 5KNBA 2RGBA 2Y0SE 3EZ9A 3ICEA 1OXXK 1KD1C 3AVPA 1HNZL 2JA1A 2JJ1D 3K0EA 3QF7A 4PO8A 5M3FH 4BBRH 4HUTA 2QI9C 4DUGA 1WBDA 4Q4LA 3L0PA 2XJ4A 2CXXA 4PC6A 1MO5A 2NZHA 1UJ2A 4D25A 1FX0A 1PFSA 3IRBA 2PEYA 1ONLA 3UATA 1GRQA 4Q00A 1M7HA 2A5DA 2VA8A 4W7SA 3DKPA 2LSSA 1LNZA 1J7KA 4LJ5A 4Q18A 3KF8B 3U60B 4OO1H 2C78A 1V43A 2OO7A 1RE0A 5JSZB 2OAP1 5AWFC 4CF7A 1VECA 2ZJAA 4AY2A 1BDOA 4JI2L 1TPZA 3M4QA 2R6AA 2C35B 5AJWA 1D7QA 1DG3A 2QAGB 4PO1A 5CYPA 1SLJA 2ZSBA 1MO6A 2N42A 4OHVA 3UKDA 1UKZA 4MQBA 4GRAA 2VL7A 3UE0A 4ASUA 2OCEA 3PITA 2X2EA 5GQOA 5JEAG 2DNEA 4RMFA 4KYIB 1GITA 3T12A 1OLOA 3G71A 1VQCA 4D4LA 3N6RA 5FBRB 5JWOA 3GCGA 2JLVA 1IXRA 4KAXA 1DVRA 1WMSA 4OKSA 1NN1A 1AZSC 2VP4A 4NDZA 4AG6A 3ZGXA 2JLSA 1NP6A 2WSSA 4Z1MD 2O8FA 4HJ8A 2JLQA 5G53C 2YU9H 2J87A 2WKRA 2JEAI 1IOZA 2XZLA 1NJGA 3KKNA 3Q8XB 2ERYA 2ASBA 1Q46A 1Q8KA 4ZCLA 2FPKA 5IE8A 3TSOA 4PPFA 2MSCB 1KO5A 2GAAA 1RL2A 4R4IA 1X6VA 4HYYA 4TT3A 3VKWA 4B3FX 4LFBQ 4DLTA 5IYDG 4WA7A 1N34Q 3H94A 4RKFA 3THXA 1TKWB 4KI0A 2VQFL 1VG9B 2VHCA 2ZANA 3EZ7A 1LW7A 4GZMA 4I99A 4TQ9A 4KFTA 5CJPA 4D80A 4QJFA 4KLKA 1FP6A 3Q7QA 2NO6A 4YMUA 5GROA 4I1VA 2PX3A 4A93H 4BFSA 1W1WA 2O5VA 3QPVA 2QGQA 4DK0A 1LF5A 3CONA 3WRYC 1WI5A 4TYPA 4OI2A 4KMUC 4DR6Q 3KTAA 2ERXA 1R8SA 1N25A 3GFOA 3OAAA 1SVMA 4FWIB 3RS5A 3DKVA 2C5LA 1WF3A 2UXDQ 5JZVA 1PMRA 4PG3A 1N0WA 1R0ZA 1XU4A 1HJPA 1KKMA 2ANBA 3QOFA 4NCNA 4DC9A 2H8KA 2QPOA 4NHOA 1B7YB 4PHGA 1YZNA 3X2SA 3L82B 4C2UA 1GWNA 3FHCB 4QC2A 3KXIA 1UE1A 1UBEA 1JR3E 1L2FA 4POGA 1C0AA 1E2FA 3K0CC 1Q12A 2PJZA 4QNMA 5FBWB 4C0QC 1I4TD 4MUAA 2EXDA 4RZ3A 5L3RA 3TAUA 3PUXA 3VA7A 2A8VA 1W2GA 3D7MA 4AIIA 3ASYA 3RVBA 3UANA 3DZ8A 3GFTA 1ZMXA 4NYJR 1LFDB 2J45A 2JASA 3LBHA 5JJIA 221PA 3IPXA 1D2NA 4AWXA 1ZYRC 1YHQA 3NVAA 1U0HC 3K53A 1N33L 1W47A 2RB4A 4US1R 3TW8B 4YCVA 2ZUCA 3I4MH 4C3HH 1FNMA 3KKQA 1WFQA 3WMGA 2W2VA 2UXCL 4TKOB 1SVIA 1NY5A 2AHOA 2IWHA 1NVUQ 2KBFA 4TTPA 4LF5L 2QQEA 4CEIA 2Z5FA 4DR4L 4NCHA 4V03A 3WYFA 3FVQA 4DV3Q 3GO5A 3VR3A 2ZJ5A 4LJAA 2FWRA 1G7SA 1IQPA 3OIVA 3EIQA 3HJNA 4Z8XA 1R5BA 1Y3AA 2CE2X 2GF0A 2IEYA 1NKSA 4JBMA 1U98A 1EGAA 2XNSA 4E5UA 1W4CA 1RZ3A 2I5HA 1SVLA 1F48A 1NMGA 4B3ML 1AN0A 1VQPA 2WJJA 5KSZA 1KHIA 4XVQA 5IWAQ 4O2RA 3T35A 2MQHA 3KQUA 1VQIA 2I1QA 3CCVA 4DV1Q 5HZKA 2R7FA 4HJ9A 2FG5A 2YWFA 3EASA 3CPHA 1OB2A 3SJZA 2QMOA 1I6HH 3BK7A 3K7AH 3RRYA 4OWWB 1JBKA 2ATXA 1N6KA 4PQRA 2WPDA 2MSEB 2WMNB 4WW0A 3B60A 1GZSA 3T1VA 4RD0A 3BB4A 4QBFA 1I3QH 1LTLA 2F3TA 4LGMA 5SZHB 4NYMR 2BM1A 4ITRC 2KE5A 2OTLA 3K1JA 1IW7D 1QHSA 2ZM6L 4N3NA 4DJTA 4DCSA 1UKVY 2QEXA 5EP4A 4WZAE 2JGNA 2IYRA 2EVBA 1YU9A 1Z6XA 4YLGA 4DPGA 1L1OB 2QMEA 4Q4JA 4NU0A 4F92B 5JLJA 3EIHA 4US0R 2B63G 2IS6A 4LYAA 1W0KA 1ZYUA 2V7QD 2IUSA 3CBQA 1L2TA 1E2NA 2JJ1A 1R5NA 1P7CA 3ASZA 4OQXA 4JLVA 4PPGA 5KHOC 1Q3TA 2XOKA 1Z63A 2RF4A 3GDEA 2V55B 4JLBA 4F91B 4NH0A 1E0AA 2ODNA 3B9QA 2PZFA 5IYCH 4DR1L 4H13C 1N9WA 1TF5A 2VH5R 3J81j 3NC1C 4GP6A 2ZE5A 4HAVA 5K8IA 4JC0A 1XNJA 4HAUA 2BC9A 2FF7A 1B8AA 2RKOA 4UNSA 4URYR 521PA 2D4HA 1R4AA 2KJQA 4W5WA 2A6HD 5FPSA 4OK5A 4QJ3A 2A69D 2UUBQ 1K83H 3KXLA 2D62A 5J3BA 2ZI4A 4EQ6B 3GLFA 4JSYA 2B92A 2O8EB 3B82A 4PHHA 1Z6GA 1N6NA 1CU1A 2J3EA 1QZXA 1IN7A 4Q9LA 1R6BX 4JOIA 4WJ3M 2DN8A 5H8WA 2KB0A 4IOLA 3TQCA 3PIOA 3GTGH 2QUZA 3LA6A 1MKYA 2FEMA 3HOUG 1XXHA 2ZQ5A 4L4UA 5FLXc 1TQ2A 1VCNA 3FGNA 3IIMA 3EPJA 3WMEA 2HF8A 2H17A 3BH0A 1IXZA 3H0GG 3QXCA 5AUNB 4JV5L 3SBEA 3RAPR 5EP2A 5LMNL 3STBD 2F1IA 3E2IA 1E32A 3LLUA 1VQ8A 2BM0A 2VF8A 2ZEJA 1P72A 1ZRHA 4NCJA 4PX9A 5B2ZA 3OIUA 1HEIA 3P27A 4TSFA 3FHOA 1NIJA 3I56A 1XPRA 5KSYA 1II0A 3TUIC 1MJCA 3G4SA 1E99A 1ZNZA 3L8YA 3DZDA 2Q9BA 3CW2A 1X1SA 3L2PA 3AGPA 2HDNB 3FWYA 1P75A 4Q9JA 3DLLA 5LB4A 5KSOA 4N0DA 1P60A 4JKYA 1QRAA 2Z83A 4DVGA 3BZKA 3E9HA 2VP5A 1Z0JA 3MXUA 3RLNA 1M7GA 2QENA 1DTSA 2BVNA 1JB1A 2YVUA 4YWLA 3HOZG 5IYBG 1OYYA 2CLDX 1AKYA 1GIAA 1KDRA 5L3QB 1Z7TA 2D06A 2N78A 1KSHA 3ZVMA 3ULLA 1ESNA 1W4BA 4HLCA 5G3ZA 4DV6L 1E96A 4BFXA 4YMSA 1AGRA 3AB3A 1XNQQ 2OCYC 4QJ4A 4KITB 4EKDA 4DR2L 1GILA 3AM1A 5GJWC 4LPSA 4B3RL 2KCCA 5FOWA 2WB1E 2Y8EA 4NXNL 3AP2A 4GNXB 2IXGA 3IGFA 3K70D 2EJGC 1N5KA 2QEQA 1OXUA 1QVRA 3RDPA 2PNHA 3WY9A 1IBKQ 1N6HA 2R93G 5G3YA 3DM9B 3A1SA 3TH5A 1QHGA 2LXKA 5GJBA 3SDZA 2AKYA 4G1UC 3V4FA 3WDNA 1DAMA 2F9LA 2H5EA 4PZLA 1C4OA 1O87A 4JVLA 4L9WA 4LC1A 1G18A 2KA7A 2O5IC 1I6VC 3EZ6A 1I2MA 2YINC 3FKQA 2WWXA 2Q21A 1UE7A 3KUCA 2LKDA 2IL1A 5IT5A 2HV8A 3H1TA 4ZI2A 1E98A 2BOVA 3R7WB 2I5LX 4PAQA 1JJ7A 1M90C 121PA 1EFHA 2J59A 3I4NG 2DHRA 4HB3A 3T51B 4LHWA 4MITA 3W8NA 4O2LA 1W0JD 1G6PA 3W5OA 5AJYA 4HI0E 4A0RA 4CZ2A 3BZCA 1XMSA 1QZGA 1E9DA 4LF6L 4ZDWA 3RN2A 2ZSEA 1RVDA 2HCBA 3Q8DA 4LUVA 1IY1A 1E2WA 2C03A 2Q9CA 3CZQA 4MKIA 2ONJA 2ZITA 2PLRA 1U0JA 5J5CA 1NJFA 4GS3A 1E1OA 1XJ0A 3T34A 3W9YA 2RGNA 3SJAA 5CIWA 5K36G 3S2DH 2JJ2D 3LBNA 2L5TA 4QOSA 4Q4HB 1W7AA 3S1NH 2NG1A 4CT5A 3RSLA 2BJWA 4NCKA 1O7LA 2BEJA 2AX4A 4YHHL 5JEAH 1AZTA 4AKGA 3NIBA 1KMQA 1NSFA 3EIVA 1DE0A 1QVGA 4FMBB 5EE3A 3GTLH 2GJKA 2CJWB 2REBA 1YZLA 3UE1A 3FPAA 4KVGA 4U7DA 1EUJA 3CF0A 2XXAA 3GEIA 1JR3A 2K5UA 3PO3G 2FGKA 4PHFA 1S40A 1TWCH 1RJ9B 2IF0A 2IYYA 1VTKA 2P5TB 2XNDD 1AIPA 3U50C 1VCMA 3A1TA 1G3RA 4HLUC 5LD2B 4EJSB 4QM7A 5BR8L 1E9SA 3SEAA 3PSIA 4F38A 3C41J 4JL8A 3WNCA 3TKLA 3PUYA 2CCGA 2FN4A 5EXPA 1UDXA 1FPMA 1E6CA 2FOLA 4IO9A 4BBRG 1B9MA 1G7CA 2WBLC 1IYUA 1NN0A 4XVUA 4XWOA 5B64A 4AYTA 2ZREA 4XSHA 3CRLC 5IYDH 3GJ8A 1MO4A 2KBEA 1FUUA 3RR5A 2K5VA 1HNZQ 1P2UA 2UUAL 1Q7YC 1IBLL 3CC7A 1FNNA 4XIGS 1X65A 2O8BA 2Q2IA 1E24A 2EFHB 3UMFA 1SFOH 1VQLA 2ZJ2A 1UBFA 4OO1G 4YXWA 1LABA 3M85A 1WQ1R 2CHQA 4E07A 1DAHA 4KO8A 2CQOA 2K5NA 3AVWA 3R8CA 2EQBA 2V3CC 3TQYA 4LY6A 3SE0A 2YWEA 721PA 2VPPA 1PUIA 4UQOA 3PQCA 3B8HA 1B9NA 4I1SA 3T1OA 4P3YA 4LK2A 1MRNA 4QHTA 2VS1A 4JI2Q 1KRTA 1ZCBA 2A9KA 2OLKA 4Z54A 1ZAKA 3GLGA 2I0QA 3CF6R 1S8FA 3EAQA 1E0SA 1XMOL 3KX2A 2OUKA 5L3SB 3L8ZA 1VF5C 4GOPB 1N6OA 3CRMA 4A0HA 2MFIA 2C8VA 1MABB 1IXRC 1QF9A 4L5TA 1E9CA 1F6BA 2OE2A 4LJYA 4RKEA 4B6FA 1QBKC 2OV2A 2ORIA 2HCJB 4OJQA 1ZU5A 4BFYA 3MD0A 1YR8A 2ZRHA 2ZYUX 1KO4A 1W4RA 3TEHB 2OEPA 2G88A 2ZROA 3CPEA 3AKEA 2EJFC 4PC1A 2QP4A 3CRQA 4RSGA 1OH6A 2JDID 1FR3A 2JJQA 1YZUA 5FR2A 2ZJPA 1VQNA 1E7ZA 3BJUA 1RFLA 1NTGA 1DOAA 2VSOA 3QI2A 3BIFA 4K46A 1CS4C 1KI2A 2D2FA 4WXPA 2VSXA 2GK6A 2VRWA 2NVYH 4QY7A 2GEVA 4IFDJ 4OQFA 3BS4A 1NG1A 4DAMA 5J40A 3TGPA 4DHEA 4B3TL 1LACA 1TUIA 3NDBB 4FMCF 5FR1A 1P5ZB 3FDIA 2A6EC 3FKSD 4TL6A 4BECA 3PIPA 4N1AA 4S2EA 1PUJA 4A93G 2GAOA 2VQFQ 4RZXA 1XNRL 1HT2E 2W83A 4OHXA 1E0KA 3U3OA 1GL6A 1UBGA 3NHBA 1N6IA 4LV8B 3QQ5A 4PHTA 3AVVA 2NVQH 1A63A 1EXMA 1TQDA 3OZXA 3SYNA 4GL2A 3OIWA 1H8HA 4RCZA 3TVTA 3UMRA 1AS2A 3SQWA 3PGZA 2JEOA 3L7ZC 1VMAA 1II8A 1Z07A 1VYTA 1LV7A 1ZD9A 5AJZA 1VYUA 2F3RA 2UUCL 2GEDA 1WCV1 2I1VB 2EWVA 3M7NA 4DK1A 2REOA 2EFGA 2YOHA 4BFTA 5DLQE 3OE7A 2KENA 1FMLA 5FOUA 1HR0L 3HR8A 2KCMA 3B6EA 3PG5A 5JS8A 1UBCA 4LV5B 1HV8A 3ER0A 3GLHB 4LJ6A 3R20A 3IDQA 1CKEA 3GTMH 4DSOA 3BOSA 3A4NA 2B63H 1XEWY 1E94E 3P32A 4PAOA 2QA4A 4A8JB 2H16A 3R9XA 2FJUA 2EYQA 4P73A 3B78A 5EXXA 1OH8A 3AKCA 2V4ZA 3UDGA 1TQ6A 5FOTA 1X9NA 1EFUA 2FSIA 3RS3A 4ZIRB 4Q47A 3KJHA 2BBSA 3LRPA 4LF4L 5AK0A 2R6FA 1N33Q 4KCGA 4KSCA 1T6NA 3I92A 4X65L 1YZ6A 1H95A 4Q1AA 2B8TA 4AYBG 2JATA 3GLIB 4DR3L 2UXCQ 1G3IA 1YNJC 3RLFA 1DAKA 1CRPA 3U3MA 2VW9A 2VF7A 4ZKEA 3AFPA 4NB3A 2EJMA 4QXAA 1KHTA 4TYQA 4DR4Q 4B74A 2FA9A 3ZS9A 5EE1A 5C4XH 1Z8FA 1K5DA 2QTFA 1CEEA 3CO5A 3O8CA 1X55A 1XD9A 5GADl 1NNEA 2WJGA 4TLDA 2GVBA 3CRRA 2K52A 5C44G 1KI3A 3Q85A 1E2IA 1WYDA 2P5SA 3MWJA 4IDPA 4M9SA 3T61A 3U4QA 2FPMA 2UXBL 1CP2A 1T8TA 2IYSA 3E70C 3QF4A 4OHYA 4B3MQ 4NPSA 1GKYA 3EN2A 4GLAC 4FI3C 2NVXH 4GT1A 2YJTD 3PFIA 5CM8B 3EZ2A 1VQKA 1JPJA 3HOUH 5FBVB 4CIDA 4Y0AA 1Q1ZA 1L1OA 2E74C 4KSBA 3UXMA 3QSYA 2FV8A 1GNQA 4FMDF 3MMPA 4K81B 2ORVA 4O3MA 2PMDA 4X8MA 4IJLA 3H0GH 4NBSA 3GQBA 3I4OA 1SKYE 2GA8A 3D31A 2H18A 3PIRA 1KRSA 2ZJRA 3WNDA 3WBKA 4B6EA 3MLEA 1CKNB 4F7WA 2OTJA 1UE5A 5P21A 3ZD7A 2VUMG 4DIDA 5TDHA 1H9RA 4TMKA 1U94A 2UU9L 3GJ7A 1FW6A 4MGYR 1FVIA 2ZM6Q 3EC1A 5A0FA 4JI3L 1ZNXA 2FDCA 1OYWA 4Q1BA 3I55A 2R65A 3THYB 3CPFA 5JECA 3UDFA 2ZS8A 5AR1A 5FLMG 3C5HA 1XBTA 2ONKA 4Y7NH 2WKQA 2ZYWX 2DB3A 2NN6H 1P9NA 3OHMA 4ZCIA 4LJ9A 2ZJYA 1EWRA 3HOZH 1G4AE 2ODWA 1SVSA 3BB3A 3CB4A 1P2TA 5JMTA 2CHGA 1IN5A 4G5RA 1PA6A 3PUWA 1XTSA 1G17A 1XCGB 2V6JA 3K0AB 2Q3MA 3F0TA 1I4LD 1OXTA 1N5IA 3GTOH 3HYRA 2PQAB 4OHWA 1LUZA 2RHMA 1EX6A 4DR1Q 4A9AA 4L5RC 2GZAA 4UNQA 3S1MH 2YKGA 4PAMA 2CCJA 1P6XA 2VP2A 4U5XA 1GG2A 4DUYL 4TN1A 3ZQJA 5BN3A 4YMTA 2R93H 4Q1CA 2IX3A 4NXML 4HAXA 5KTYA 4PZ7A 1S0UA 1TF7A 4HAYA 1CXZA 3RN5A 4LDJA 1RC8A 4IFDG 3K80C 4JOIC 3KB2A 3H3VI 2EQSA 4DV7L 4A3CG 1O78A 2HEIA 3T56B 3OF5A 1DAGA 4A92A 3B85A 3GFPA 3PEVA 4BRUA 1ZM2A 4TLAA 1GUNA 1FOEB 2EFCB 4WXRA 4A3GG 1MJEA 2Z6VA 3CF2A 1J90A 1X86B 1JMCA 2ZYVX 4LHVA 4BFVA 3I62A 2WAXA 1MOZA 3HOVG 1RRCA 1SXJB 2ZI9A 1XMJA 4OI4A 3CX7A 1DXMA 1A0IA 4JV5Q 5DI3B 5EJEA 5LMNQ 5DYGA 2AKWB 4QIWE 1XEWX 4LBZA 2XZOA 2K7VA 4TMWA 2QL6A 4JYCA 4HUQA 4EDHA 3CW2C 1IBML 2LCFA 2J0UA 4X8HA 3SHFA 3AP1A 1YJWA 3IQXA 3TUJC 2OBLA 1LM0A 2XSZD 1W49A 2PL3A 1VQMA 2IX0A 1Z0FA 1YHAA 3CCRA 4GKJL 5K36H 1NVXQ 4CYMA 2NTYC 1Q1BA 2X1VA 3RRNA 3FKSA 5IP7H 2EIFA 3DL0A 3RC8A 3HU3A 3GLFE 4OHZA 4JI0Q 1BBUA 3NELA 5C3EG 2CWAA 4JVNA 3FMFA 1HQCA 5JJLA 5HKKA 4MTNA 4F93B 3QXJA 2A68D 3GPLA 2DGYA 1ZJ6A 4DV6Q 2OCAA 3KXKA 1P4SA 3QG5A 2O0HA 3HKSA 4M1YA 4GZLA 3PO3H 4D0GA 5GAGC 4DR2Q 2OXRA 1W44A 1XXHE 3U4VA 2G3YA 3G82C 1JR6A 4QJ5A 4B3RQ 5FUXA 2WWIA 4LRWA 4M21A 4NXNQ 1G6HA 2NZJA 3EA5A 5DHFA 2HT6A 4B3XA 4HIDA 3REFA 2X19A 1S4QA 2OSBA 8OHMA 3CX8A 5DH9A 3SFZA 1Z28A 3U44A 2C9YA 1CTMA 3TSZA 1D2EA 2VP9A 2QPTA 2IW3A 4AI6A 3KF6A 1XJVA 3C7KA 4QBIA 3NDPA 4M2LA 3U5ZB 5DN6D 4DV0L 1V5WA 4QBHA 2PPBC 5ELOA 1E9RA 4XOIA 3RHFA 1QG4A 1VHTA 5DO9A 5TXGA 3WHKA 4L9SA 3TMKA 2B29A 3B13B 1XF9A 3AF3A 2CVHA 4A4DA 4B3CA 1E9AA 1Q44A 3LQQA 1II9A 1U9IA 3O47A 1G8GA 4FXPA 5KO2A 3Q5DA 5TMPA 1J8MF 3SR0A 2R7DA 2VIIA 4P74A 3C8UA 3NHAA 1NG9A 2BH2A 1OXSC 1NBME 2GVDC 3V9PA 4MDFA 4LHXA 2CJWA 5FI0B 2JAQA 4LF6Q 4C2TA 3VR5A 1N6LA 1JE5A 2GXSA 1JXOA 2XTNA 4C0LA 3ZD6A 1X6OA 1XTQA 1QHNA 1BOFA 1KJWA 3U58A 3TK1A 3TJZA 1XMQL 1XEXB 2W58A 3GEHA 1RJ9A 3O8RA 2KI5A 4Q7KA 2F52A 3VNUA 1W46A 3HDTA 1MH1A 1KIMA 4DV4L 1M7BA 1HQMC 4BY1G 2OQ0A 1KZ7B 2QF7A 4YHHQ 4NTZA 5FTNA 4A6XA 1KMHB 2O5JC 3OPOA 1Y8OB 2ZRMA 2IYUA 4CEJB 4BEJA 1FQKA 2IK8A 4HSEA 4B73A 1E2LA 3E1SA 1UKEA 2CVFA 2NO9A 3SGIA 3QXXA 3BFKA 2BH8A 4WIAA 5JEDA 1IBRA 3J80i 2J9RA 3G5UA 5G40A 1BYIA 4UJ5A 1N5LA 1CJMA 3Q7PA 4C30A 1AM4D 5E7NA 3LLMA 4CEJA 2A19A 2ORWA 5C2JB 4OQNA 5C46F 4PFSA 2F4VL 5BR8Q 2ZIAA 3K7UC 1BS1A 3PXGA 2WICA 2QQ0A 4BE7B 4HEJA 1KXLA 3WXMA 2PNRC 1QVFA 5IK2D 1DADA 1I50H 1XD8A 1YQTA 2VP0A 2GCPA 4PZYA 1D2MA 1R10A 1VCOA 4MGKR 2IYWA 1NBMD 4MYUA 5GAEC 1Z2CA 2IYQA 1R7RA 1VCIA 2IF2A 3KJGA 4JT2A 2XB4A 3EG5A 1X56A 2LMCB 1IBLQ 4UNRA 4ZDKA 4AH6A 1Z6AA 4XVRA 1RRPA 3FTQA 4JI6L 1BMFD 1GVPA 3NBYC 4DT1A 3V4RA 1KC8C 4P32A 1D9XA 2RH5A 5KPDA 4LOAA 4D81A 2K32A 3NE5B 1CJUC 2AXPA 1CF4A 3S1RH 1XDBA 4HZIA 3WNBA 1YVCA 4GKKL 4EFNA 4I1OA 2KSQA 3F1ZA 5AUPB 5HE9A 2ZETA 3CUEF 3KDFB 1IXSB 1KDTA 1JEEA 5JS7A 3F3YA 1US8B 1Z0KA 4RFSB 2A6HC 1XTJA 2A2ZA 2BJVA 3IPYA 4QBGB 5EE0A 3AUXA 1BKBA 2IEZA 4LZZA 4PPNA 1IN6A 1KQSA 4ZI3A 1ZIOA 1G41A 1CFMA 4GZYC 1XMOQ 3IBGA 5LBIA 5A5GA 1WCMG 4P75A 5ELXA 1GL9B 1GRNA 2HF9A 4ACBA 4JBWA 1QUQA 3CQZH 1DO2A 3Q9LA 1KL9A 3RRZA 2JQOA 1EFRD 1G20E 3QKSB 4IVQA 4LC0A 2E75C 1KSJA 1S1CA 1OHHD 2FH5B 4M1OA 4X6AH 5H70A 1KSGA 2D0PA 2DFTA 3JZMA 1D9ZA 3W1BA 3NBXX 3WRXC 3CNNA 1JB7A 2CLSA 4QGFA 3NXSA 1ETUA 4RD6A 1F2TB 4M1TA 2J0VA 4LFAL 3ZVRA 3G6EA 2K4KA 1ZNWA 2J41A 5EE5B 3BERA 3STBC 4KHZA 4A3BG 4Q7LA 4DDVA 2A5GA 1Z0IA 4KU4A 1Z6YA 4B3GA 2JA8G 2FU5C 4A2WA 5KU1A 2EWWA 5C0XJ 4PV1C 4TTRA 4PO9A 1ZINA 2CEAA 4DSNA 1YRAA 1JXMA 1W4AA 2F9MA 1H9MA 3BG3A 4P72A 3AF1A 5K8UA 1NMFA 2XGJA 4B3TQ 1PYBA 1VQ6A 1GNPA 1HTWA 5FFMA 1NLFA 4G7OC 2FSGA 2C9CA 5CDFA 2ALYB 2R6CA 5BYKA 1IL2A 4PQYA 5KDLA 3WMFA 3GLGE 5C44H 5IT9c 3Q5EA 4EPTA 3CP0A 1PJRA 2YHSA 4AYBE 2ZE7A 4TVAB 4IOMA 1E1QD 4ZKDA 1XD2A 1FTNA 2F1JA 1BYUA 4B3BA 3HR7A 2ASEA 4IDQA 1YNNC 1XNRQ 1HNXL 2R92G 2O52A 3MGCA 2FSFA 2HJGA 3DMNA 4Q4AB 2GCOB 2QNRA 1XP8A 1COWD 5FUWA 2NPFA 2ECKA 2DUDA 1WDTA 2DCUA 2X2FA 1G19A 4TL9A 4TLCA 4AIMA 1Y8PB 1B0UA 2WJHA 4JG2A 4HJAA 1E9BA 3LAWA 3OEED 4DV2L 1N0UA 2GK7A 4R9UC 1EYGA 3K70C 2UUCQ 1H9SB 1QVAA 1QZHA 3U6BA 1KY3A 1EX7A 1NLZA 2P67A 4ZPXA 3TSWA 4KN4C 4YONB 2VUMH 1PLLA 3C5CA 4BLOA 1HR0Q 1S3GA 1GAJA 2GETA 4MYTA 3FHWA 4CDGA 4C7OA
chains in the Genus database with same CATH superfamily
2LKCA 2AWNA 4IPHA 3GB9A 5A0VA 3NIWA 2XNJA 1XXLA 4HVAA 5CK5A 4MQFA 2FSUA 4FFSA 1K4YA 5JWRA 2YYYA 4Y1FA 2I4LA 5IW8A 2F0FA 2FZ5A 4A3GH 4IOCA 1MIUA 5BWMA 1KAHA 4JI8L 1SYCA 3W78A 4EARA 4IRXA 1R9MA 1CZKA 3LPMA 1E59A 4ZT7A 4IG9A 1QQAA 2JHGA 3H2BA 1E5XA 4LFBB 3PRJA 1N34B 1TS4A 3N76A 3TIGA 1P31A 5C3EH 3MWEA 4A3LG 1VMDA 2A9FA 4DQXA 1FRNA 3ZBUA 4DR6B 5I51A 1E2JA 4M8NE 1Q3LA 4JXJA 1QUFA 5KYYB 5K3EA 5C0XG 4Q3CA 2QBYA 4TXMA 1WKCA 3A74A 2R4TA 1RF2D 3GPCA 3OZCA 2OENG 3KZ1E 5IBPA 4D4IA 2REQB 2K4MA 2QILA 3LUGA 3KR1A 1U2RA 5K5PA 2PWYA 2D7DA 2HY7A 4Z9AA 2CL5A 1KMIY 1M1ZA 4EG1A 5IWAB 2H92A 4AKIA 3EGXA 3UMBA 4TRMA 4AJNA 1J9ZA 3SAJA 3K2BA 3L1JA 4G0OA 4JLDA 2P3QA 5GAHC 1RLMA 4R7GA 1EHYA 1LDMA 3E1GA 4R01A 4DDKA 2OXTA 1U02A 4J94A 4DN4M 2RHCA 2C4HA 1YQ9A 2ZRJA 5KMGA 2WU4A 1TWAH 2EZTA 3G2PA 1O58A 5TV2A 3R9WA 1Y5NA 1OF1A 2ZRGA 2PEZA 5M34A 1TJ4A 3L5OA 5ICGA 2PR2A 1GKIA 4HFJA 3CNQS 4BQPA 4Y9UA 3WP0A 5T3UA 1PHJA 4U2KA 4C0HA 3HXQA 4MVJG 3ROMA 4BMPB 4MVJP 1R6VA 2PRYA 3ENKA 2WIJA 2ZIUB 3HFZB 4YWKA 5EG5A 4EG8A 1NF8A 3CR8A 4OL0A 2JLWA 5M9OA 1STEA 5CM9C 1ATIA 3LP5A 1N8NA 3BWEA 4A36A 1PW7A 4MKXA 2ZJOA 4OFWA 5DGTA 1ICEA 1AKWA 5DRYA 2HF2A 3TW8A 4G01B 3CWZA 3WHLA 1Z25A 1WXEA 4GNKA 3LIPA 4CUZA 2OD7A 4IPGA 3JQAD 2MYTA 3VPSA 4MPPA 3PNYA 1WE2A 4O2AF 1H2YA 1VZ3A 2Y67A 1PK9A 1YONA 4ZDJA 1UMBA 5IJ9A 1CUHA 2ZI6A 1EDZA 1D4OA 4RENA 5K99A 3G02A 2VXWA 3QMWA 1SVNA 1BKDR 1B93A 4LXQA 3X1JA 4AULA 1N3BA 4PYQA 1XTTA 4I2NA 1PGOA 4QGSA 2HD3A 1USVA 1JEDA 3KOMA 1RS0A 1ARZA 4IIEA 1R66A 2H29A 5KQLA 2X14A 3M9LA 3FI0A 1ZY2A 2FETA 1I14A 2IL8A 3BEDA 3LT4A 3SP1A 3SQDA 5DCUA 1XZIA 2I46A 2YWXA 4MGZR 2EXZA 4BRWA 1P6UA 2CNOA 1HT1E 4Y9RA 3EHEA 1IH8A 5B58C 2ENWA 3HFJA 1ZCFA 3O1HB 3SSAA 3GJ3A 2POQX 3D8GA 4NW2A 4JJAA 4ZQIA 5FWDA 1GT91 1E63A 4A3MG 2R79A 1CJKC 5A7FA 4BNKA 1ZISA 2C8LA 3LDUA 3ND5A 2J0SA 1FJHA 3BM5A 4B71A 4GR9A 1PZMA 1B0AA 4TYNA 3LTEA 5IUNC 1SFRA 1A5BB 5F1OA 4GL4A 3JSAA 4IDGA 3IRUA 3QVKA 1NI5A 2VHZA 4KN7C 3NS7A 3DPUA 4BBAA 4DDTA 2Z58A 3ESAA 2XIWA 1XRQA 3LUHA 2PGXA 1LPNA 1JE0A 2W71A 2FSVA 3F8WA 4KWIA 1DPGA 2M6RA 2VK4A 1LT4D 2GB4A 4PF1A 2R751 1YJ5A 5GONF 3P26A 4BO6A 1YJ9A 2AA3A 2DOKA 2EQ5A 4DCVA 3SHQA 4PSDA 2O0KA 3PUZA 1J39A 3QTTA 2ZVPX 1DNPA 4ZO4A 2G9UA 4AO6A 2VSNA 2WZQA 3NGLA 4JJIA 4HYEA 1EVZA 4FEEA 3D2BA 5JBIA 3OZFA 1E69A 3KOXA 4N5LA 4NDNE 3OSZA 4OH1A 3M6IA 2F0PA 2LXNA 3GOHA 4J75A 4UTZA 3ELYA 1KK2A 3IS3A 3B6JA 1U3VA 3A7AB 4X8OA 3V2UA 1EX1A 1N5MA 2B35A 4R8KA 2A6PA 3STHA 1A7JA 1TRKA 5JNSA 4OMFG 4RLFA 2H5XA 4KIUA 1YITA 1EP9A 3KJOA 2EL9A 1NVVQ 3SQMA 2Y76A 4C01A 4PIPA 3VUEA 1FZQA 1WS6A 1H3NA 2PM8A 3IH5A 4OMCA 3TS0A 1K2WA 2ZJBA 1VJ5A 4L5QA 3H1PA 4R69A 1J5EQ 5ELLA 4RF3A 2FPXA 1GZDA 4MVWA 1Q57A 4MI9A 2R1VB 4WNAB 5CA1B 3QF4B 2CFCA 2YYAA 2YIVX 3D3QA 4ZVNA 2PT9A 3ASVA 3CPSA 4ODGA 2R6JA 1FNWA 5I6DA 2GILA 4O1NA 1U0OC 4WECA 3REQA 1C50A 4US2R 3ZNOA 1CIVA 3LXMA 2BCJQ 1A3UA 4AY3A 4HJRA 2Z4SA 2RAFA 2WI8A 1VL2A 1JJCB 2OL4A 3CQ9A 1M10A 2IPKD 1PSDA 2VNIA 2ZDQA 1QFXA 4JYBA 2IITA 1X3FA 4OSPA 1ZITA 1V1QA 3S1NB 4K5WA 4NU6A 4HXGA 2DBVO 3EARA 1P5RA 5G41A 6NULA 1AE3A 5DOVA 1G2IA 4BWFB 3B1WA 1JHYA 4FFBB 4TKUA 2FW9A 2WV9A 1W9HA 3IR5A 1Y3BE 4RHFA 2KHZA 2XBMA 1S89A 1KKLA 3PF8A 1ZLXA 1R9GA 4IRMA 1E1TA 4ZVSA 4LF9L 4BFWA 4W5NA 1S5FD 1EUZA 1T5HX 1M8GA 1FP4A 5DM63 3K59A 4NEGA 1TJYA 3R3YA 4IHAA 3HLYA 3NX4A 3L8DA 1DUIA 2FDRA 2XDQB 2BRUA 3THRA 5LL6S 5KCMA 4QGBA 1XNRB 5IJZA 3FZEA 3LTNC 5J2UF 4PG8A 4RA9A 2DJ5A 1PR1A 1D4FA 3EDRA 4AECA 3B70A 1C3OA 1SXQA 1N36Q 1UFQA 1G8JA 4AY6A 1JG7A 4INAA 1TEZA 3JCZA 3VGJA 5ALXA 1JXQA 4L27A 2VK1A 4MRPA 4LOLA 1SR8A 4KKSA 1QNFA 3ZVNA 1KVTA 4E5SA 3G89A 4GN4B 1TC2A 4X66Q 1V1RA 4CKBA 1YCGA 3L7DA 1DBWA 2NO0A 2HA3A 4LOIA 3GGDA 1SD5A 2FPIA 4GPD1 2FEWB 5JOQA 1PNTA 2F0LA 4DT1B 2VHUA 2P2DA 2HFKA 3QUQA 1H3FA 4F5DA 1BW9A 2P41A 2ZTSA 2PO7A 1FFHA 1P3DA 2YC2C 4RULA 3GARA 1CVRA 2WACA 3KL2A 2PTHA 1X1TA 3PXUA 1MB2A 3DKKA 1HZCA 1CR4A 4P33A 2ZR7A 1YZHA 5B7GA 2J5KA 3WRWA 2FP3A 5DI9A 3ZDDA 2XHZA 2DUWA 1Q8IA 4UW9A 3N3BC 1NN3A 1T9AA 2V7EA 1YOVB 1Z16A 3EX7C 3KPJA 1NUPA 3LCUA 1XRPA 2WOJA 1L8XA 2R93B 2R8ZA 3F2BA 3DUFB 3HXOA 4FUTA 3THWA 2Y99A 4GQIA 1E0BA 2MYPA 3EZNA 3CLUD 4QYXA 3P9KA 2GEFA 2QTAA 2N1BA 3BMXA 1QCZA 1WB5A 2AQ3B 2MINB 1TCCA 1Y1LA 5JAQA 3STYA 2PMCA 4L4SA 1E4OA 3ZZTA 1WBBA 1PH7A 5DWDA 3SK5A 1MX3A 4GYKA 4IHJB 2QSUA 4D02A 5IYCG 1OA1A 4YV0A 3LJKA 1UWVA 2AW5A 1G5RA 2D7JA 4Z3KA 1LI4A 4NDAA 2WHQA 2RSNA 3F46A 3L7JA 2FR8C 2D7CA 2CK3A 3KB1A 3HZRA 2J8ZA 4D9GA 3FB4A 2HK8A 3GJ6A 5A5VA 3GDWA 5F2KA 3FGZA 4QDOA 1DAIA 1HY3A 4J1TA 5EBDA 1KI6B 1M1YA 4RQTA 5K45A 2DLCX 1B41A 3EGVA 5HF6A 3LVRE 2VHYA 1OFVA 4H0CA 4R8RA 5KNDA 3FRHA 2KWIA 3DW1X 2H4OA 1EP1B 1I50B 2GBGA 1KI9A 3TZ6A 1USGA 3WLKX 1LA2A 1U3WA 4CV3A 1U3FA 2C2KA 1LTID 3A70A 5ALSA 2NZHA 4MJ3A 1K8QA 3GLUA 4W7SA 4NR0A 1LNZA 4I9UA 5LZ7A 1RE0A 5JSZB 3DL4A 4PQEA 4MLDA 3W77A 5JAUA 2LFNA 5ECGC 1V39A 1EH5A 1FFWA 4RV5A 1H2RS 1A9XB 1X3PA 4KTAA 1U3UA 2DNEA 1W8DA 3BGVA 4D4LA 3BGDA 1V1PB 1WMSA 2IOQA 2IZ1A 3E9YA 3FNQA 2BZ0A 2X7JA 2WSSA 1RADA 1Q0LA 3BK2A 1IOZA 1KETA 4UTPA 1B2RA 4FW8A 4UVDA 5DXJA 1KO5A 3PX7A 2VT2A 2BE7A 4R4IA 4TX1A 3NUGA 3VPHA 3GNTA 3WGYA 3C6KA 4I1VA 1M6YA 1W1WA 2O5VA 1WSAA 1OLSA 4OI2A 4IYRA 1N25A 2QQ5A 1HJPA 4NY1A 3BEOA 3KTFA 1MGSA 1GPAA 5CGZA 1QH8B 3X2SA 1RYNA 4AG3A 4NQRA 4F9GA 4MOWA 1KABA 3TAUA 3KT0A 3ET4A 3BVGA 2J45A 1ENOA 4JV5B 4AWXA 1RAFA 3FJ1A 1NY5A 2KBFA 4LF5L 3KZVA 1JJIA 4DR4L 2WUGA 3K20A 4K8RB 1IQPA 3HJNA 1Y3AA 5JMPA 4UEQA 2XNSA 3KHUA 5B4VA 2XUPA 1VQPA 2GHQA 1JDUA 1UDCA 2A59A 3FMGA 2EY6A 1IOVA 3SJZA 4MROA 4OWWB 1EA5A 2OSVA 4QYIA 3C6QA 1YU9A 1DKNA 4CG3A 1P1IA 3I53A 1P7CA 1V8ZA 2WY2D 4KY6A 2DPLA 5IAOA 4OJMX 3DCIA 2EG9A 1B8AA 1VC2A 1XJ5A 2HA7A 2ZIWB 1TYBE 3FBWA 5AH0A 1X7ZB 3HOUG 2WW8A 2D5LA 3HWWA 3A14A 4NNPA 1Y8ZA 3WMEA 1KVUA 1HL3A 3OZAA 3OIUA 2HJWA 5T7BA 3FWYA 3L2PA 2HDNB 1P75A 1W85B 3VC7A 3V3KA 3LBFA 1KF0A 2GBIA 2IHVA 2H2IA 1V11A 1YOBA 4MSUA 3ZZNA 4HLCA 4DV6L 2SEBD 1AGRA 2C8JA 1ECFA 4RKRA 4Q7QA 1OXUA 2PNHA 3LG2A 3FR7A 3V4FA 1QIKA 4G1UC 3HJFA 4J91A 4R05A 3USCS 3BIOA 1UE7A 4RL4A 2WYOA 4O4JF 1QR2A 4LHWA 2X1HA 4MPJA 4ZHQF 1KR5A 4Y6RA 3FBTA 4RCVA 2HCBA 1K7FB 5EPOA 1U0JA 2GO7A 2R1TB 2NZWA 2PU7A 5CIWA 1W96A 4QOSA 2BEVA 5I6YA 1P5HA 3FPAA 4XIIA 3LPAA 2FGKA 3N87A 1KP3A 4OL9A 4Y2QA 4V1CA 3NWPA 1NR5A 4JL8A 4IIGA 1E6CA 2WHPB 4WESA 2WBLC 1K0FA 4LXGA 3NJRA 4KD3A 3ACDA 4ENVA 3UWSA 1Q7YC 2QTLA 1QO0A 2QTGA 3CUWA 9MHTA 3LQFA 1MOPA 1KMNA 1R3DA 1P7YA 1LLFA 4LK2A 2DT5A 1ZAKA 4EHLA 3MB5A 3L8ZA 4OIMA 5K0FA 5D65A 3HRHA 2J6HA 2ORIA 1ZU5A 4YCMA 2ZYUX 2E3JA 1LSJA 3JYOA 5BW4A 4YA6A 4CQMA 2IH5A 1NTGA 1DOAA 3BJZA 2W4MA 5E1DA 2VRWA 4YV7A 4B3TL 3FTNA 4ZYZA 2VF5X 3C8HA 1PUJA 4A93G 4RZXA 2B2WA 1GL6A 5C1DA 1I5RA 4O02B 1ZD9A 1EJ0A 1Z07A 1LV7A 5B37A 1WCV1 2I6GA 1PZJD 4I50B 3VYRA 3HHEA 2Z56A 3VJMA 3G8CA 5G0TA 1X9NA 1EFUA 2DR2A 4N49A 3FOWA 3PXAA 2H2GA 4GYWA 4G9BA 3ZS9A 1L9XA 1I01A 4QICA 2DP4E 3OMCA 3NHFA 4CDNA 2ETVA 3PFIA 2HO4A 1AK9A 1X7XB 5ICCA 2E74C 3M4OB 3BMOB 2I8LA 3GQBA 3I3CA 2AEEA 4UDNA 3R41A 1EWYA 2UU9L 5LJLA 4F45A 1LK5A 4XZ3A 3CPFA 3GAAA 1G42A 3F90A 2X15A 3UFXB 1PR6A 5CCDA 3EXHB 3OURA 3EODA 5DJ5A 3NTIA 2Z9DA 3DZJA 3EGCA 1PYDA 3W4KA 1C9NA 2EQSA 3W2EA 4ONEA 1R9TB 4P5DA 1VKRA 3W5BA 4TLAA 2XQIA 2X5JO 4YGXB 1NC3A 4BFVA 4KLCA 3HOVG 3QX7A 1LW6E 1DXMA 4QFDA 1NI4A 2BGLA 1CNEA 4NS4A 5LZ8A 1VKNA 2B4YA 4PBTA 1HFWA 5HFAA 2A94A 3FKSA 2YXLA 4UHJA 1P4SA 2G3YA 4QJ5A 4ID3A 2WWIA 4YALA 2ZB2A 3QW2A 3RHZA 2PZAA 1V5WA 2PPBC 1Y1TA 3FSEA 4OAQA 1FS4A 4HBZA 5F64A 4L8VA 2SOBA 4G0PA 4NMXB 1A8SA 2JF0A 1HBJA 2OBBA 2GVDC 2V7VA 2ZKIA 2A1UB 2Q8QA 3ETJA 1N3LA 4KQKA 1KJWA 1BOFA 3Q12A 5TRTA 3GEHA 2I8CA 1W46A 4BMZA 4ZO6A 4GO1A 1RCFA 2BGKA 4YRMA 2CVFA 2NO9A 3QXXA 1ZVJA 5TGDA 2F0GA 5E7NA 4I7EA 2XT6A 4F8JA 4JROA 4E11A 3E8XA 5IDQA 2VP0A 4MGKR 1Z2CA 3CHBD 3KJGA 4MARA 1JZSA 3LY7A 5LKRA 3NBYC 5E9WA 1N8KA 1JH8A 4M87A 1A9YA 4Q3AA 1WHSB 3S1RH 4X3PA 3TZLA 3DQPA 5KCZA 2WZBA 3R7FA 4D8WA 4OYYA 1BQQT 2OAGA 3IDOA 3WDMA 2HF9A 4ACBA 1G6ZA 1G8ZD 2E6KA 1HKHA 5FBKA 1HE3A 3OIFA 4RTRA 1LRKA 5EERA 1B1CA 3G6EA 3STBC 3RBAA 1RJEA 2TMYA 2F0SA 1B42A 4PV1C 1VBMA 1NUTA 3GJSA 5HP4A 1PYBA 1UZLA 4PQYA 2B2VA 1E1QD 2NO4A 1ND5A 2H5IA 4ND5A 3TAXA 1YB6A 4BO1A 3FHLA 3HV2A 3IE2A 4XRRA 5CT6A 3UJBA 3TLCA 2BGNA 2BEUA 2V6BA 4O4IA 4BNJA 2PQ2A 1QFJA 2Q2QA 3Q3HA 1U8YA 3U16A 3KT3A 1N5DA 3H18A 2BKEA 2N46A 2LWIA 5IDVA 3HZXA 3H4MA 3UUWA 4ZAGA 4DLUA 5IVKA 2NYRA 4NP5A 3RMHA 4HWGA 1AT1A 4P3PA 1BE0A 2SHKA 4IQ4A 2D5AA 4CMGA 3UB3A 3KAKA 3SHWA 4AKTA 2YJ3A 2I87A 4A8PA 4OUDA 4CGYA 1WAMA 1GM5A 3CN7A 3ZE2B 3ZDXB 4CDFC 2NN6G 4ZCKA 2CDRA 2AUJD 4O4HA 4P4NA 4LK3A 1K5HA 421PA 5E4XA 4RF5A 4B0PA 1CG6A 4TXLA 3DXFA 3HXTA 2QY9A 4FGLA 3FOFC 3TVDA 1Y1VB 4K9KA 4O4LA 3IFSA 3Q87B 1EIYB 4BNUA 3JQEA 1ORRA 4ER3A 2I22A 2PX0A 3I28A 2YFYA 4ZCPA 3D8TA 4KQ2A 4QPCA 1QHXA 2QORA 2X4IA 5H68A 1VQ4A 1F2UB 2NTJA 1TZ2A 1K08A 3BHMA 3PVZA 2HGSA 3P9CA 4YMWA 5KOJA 2A92A 4EHIA 2R8XA 3L93A 4K8IA 1S2DA 5TMBA 2AOUB 4BTEA 5PNTA 1UM9B 2AFHE 1WG8A 5EAIA 2XVYA 4BBJA 1FCJA 3CR7A 1G291 4TKVA 2Q7DA 3AL3A 2CH4W 4C05A 1MR3F 4LQ4A 4PLGA 3X1YA 2JGDB 4GGMX 3JWHA 3DFMA 1BVSA 3RYIB 5JAHA 1T4DA 3ZE8A 2QRZA 2K33A 2VP6A 1F0PA 1MAVA 2P6RA 1E2PA 1U9IC 5CFOA 2OZVA 2GZDA 3N2KA 3JD3A 3W6OA 4TWAA 3E9RA 3E2PA 5COBA 3QX8A 1FDRA 2KM1A 3PC7A 2LIPA 4GIBA 1ISPA 1I0LA 3JPYA 3N2YA 1BBXC 3SG0A 1W9MA 4BXXG 4QNRA 1A2KC 1MF7A 3S2FA 2XEXA 3ZW9A 4I4CA 4DV4Q 4HGRA 4LY0A 1SUPA 3UJDA 4EB6A 5EP3A 2GGSA 3C15C 4F4CA 5CITA 1SHLA 5FLEX 3MWDA 3MPUA 1IJEA 2XYVA 3LWUA 2EKLA 3RIYA 3Q7SA 1V71A 1DARA 1C2TA 4TS9A 3ZWYA 1IC6A 4NBVA 4HB0A 5A5FA 2VTBB 3TLAA 4A0SA 1Q7GA 1WPQA 5IPFA 2HYDA 4L72A 1K7SN 1J5EL 4MMZB 2NV6A 1AB6A 4FNGA 2YV4A 2OESA 3A0RB 2FHPA 4B79A 1QP8A 3KTDA 2EFDB 3E82A 1N9KA 3KQVA 4HNGA 5ALEA 1OI2A 1KYTA 1PYSB 4JU9A 5HEKA 2NVTH 3BCRA 3P45A 1O57A 4DJEC 5LMZA 2PBFA 1DEAA 3R40A 3DE3X 5L45A 4AY5A 5EPJA 4JJKA 3P2YA 4MB6A 1X2BA 2YL2A 1LD3A 3VC3A 2PUAA 4WK2B 3CX6A 1WJJA 1IY0A 2A30A 2NSHA 5HKBA 2GBPA 3E05A 2D74A 5M04A 5EMJA 1CTQA 3THOA 1ZM9A 1E4YA 1C9KA 1Q3KA 3OPMA 4DLXA 1KO1A 1YI1A 4N82A