3PUXA

Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
371
structure length
371
Chain Sequence
ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPGVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Snapshots of the maltose transporter during ATP hydrolysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/transport protein
molecule keywords Maltose-binding periplasmic protein
total genus 104
structure length 371
sequence length 371
chains with identical sequence B
ec nomenclature ec 7.5.2.1: ABC-type maltose transporter.
pdb deposition date 2010-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3puxA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3puxA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3puxA01
4M9QA 1CJVC 3LLUA 1JECA 3REGA 1YEZA 1OHHA 4MKIA 1RIPA 4UNPA 2IS6A 4L4UA 3VDYA 2WMOB 3PUZA 3FTQA 1M74A 2OCAA 3K70C 4A3DH 4XIGS 2H16A 821PA 1GSIA 3ERSX 3VTKA 3PENA 3ZLJA 2ZI6A 1ESNA 2IHYA 3K09A 3LX5A 2AHOB 3B1XA 4OBEA 4CEIB 1I4DD 1QZHA 1KI9A 4GLAC 2ZJRA 2V7QD 4DLSA 5CYOA 1JT8A 4S2EA 1NY5A 2XTNA 3A1UA 4ABYA 1PMRA 1VG8A 3K9GA 5DI3B 5M5YH 2IYRA 3RVBA 2E1RA 3SFZA 3NEYA 1TF2A 2ZJAA 2K52A 5IYDH 4D0GA 2R92H 2FFAA 4TLAA 1Y1VH 3L7ZC 1VQOA 2QZ4A 4DV4Q 1JJ2A 2K5UA 1KHTA 1B70B 1E7ZA 2Q3HA 2IS2A 2WBLC 4APVA 1TPZA 3NC0C 4HLCA 1L1OC 2AUKA 3FHCB 5GJVC 5L3RA 2H5XA 2KHJA 1G4AE 4P4TA 1CSQA 4KLKA 1R10A 3KF8B 2OM2A 3UANA 5ELNA 5D3MA 3BGWA 1LFDB 4B35A 4A93H 1XJ0A 3AP2A 1NY6A 1W5SA 3QF4B 1YNJC 1D2NA 5J5CA 1NJGA 1NN1A 2J0VA 5AJYA 3WP0A 3BJUA 4IFDH 4JBJA 1NVWQ 4Z51A 3O8DA 1ONLA 1HZAA 1CKMA 4BRUA 3I55A 4F4CA 1VQGA 4LHXA 2JLVA 2V4DA 1EFRD 2PT7A 1DXMA 3HDTA 3GTMH 4GBMA 3T5DA 2XTIA 4Q66C 3ZS8A 1SRUA 2CHQA 3K0FA 1KO4A 2HLDD 2GKSA 3MWKA 1FTSA 4QBHA 3VAAA 5FUWA 5E7NA 1MIUA 2P0EA 3PVSA 4R2HA 2ECKA 2EFEB 2JLRA 2ZRIA 3I8SA 1HPCA 1OH5A 4RG1A 3VU9B 2ALYB 1UBCA 2ZJZA 1E94E 4JVNA 4Q21A 5JHGB 1FMLA 1CXZA 2Z6KA 2GBLC 3AFQA 2ZI5A 1OIWA 2ZS8A 2EIFA 3L0IB 2EW1A 4BE7B 4D4JA 2BDTA 3B1ZA 4LFAL 4G3XA 2IYTA 1OH6A 1L1OB 1E0KA 1Q12A 1QHGA 2FNAA 1M7BA 5EJEA 1ZM4A 1RKBA 3KQUA 3KTAA 2L15A 1SVKA 2BA1A 2UXDL 2J87A 3CZPA 3WNBA 3Q9LA 4O2DA 3S16H 4A3KG 5GAGC 2YOFA 2AN9A 3BJIC 4YLGA 3R7WA 2GK7A 3U3RA 1ASZA 2ASBA 1II9A 4MYTA 3VQTA 1XTRA 1ZU4A 4DR7Q 4G0NA 4TYWA 4EPWA 2BCJQ 4AIIA 2VYFA 3CCSA 1R4AA 2PQAA 4A3IG 1DAKA 2YWFA 4LCBA 3TZUA 1ZM9A 4URWR 2EYUA 2A2ZA 4C2MH 3EW9A 3D3QA 3SC3A 1UKZA 3HOZH 2CXXA 4MITA 4A3FH 4P31A 4PQRA 4Q48A 3WNCA 3B78A 5JECA 2OO7A 2VUMH 4AYBG 1FW6A 2J7KA 4DR6L 2O5JC 1UWVA 1E2MA 3L0OA 3S14H 3AVQA 5P21A 1IYUA 2AWNA 2ZREA 2EJFC 1FP7A 2KSQA 3CPJB 4JVSB 2RHQB 4DB2A 4P4SA 4O2RA 3AV0B 5CLLA 4PX9A 1CBUA 4HJ7A 5EE1A 2OZEA 1HYQA 2HV8A 3EZ7A 3MXUA 3F2BA 5C3EG 1P2VA 1SKQA 2OUKA 2OFWA 1SE8A 3SQWA 1QVCA 4OHWA 1EWRA 2PI2A 1CU1A 3GJ0A 2UKDA 1D9XA 1ZP6A 1WB9A 3KQKA 4N0DA 3PIPA 2ZSEA 2V3CC 3FHOA 5FL3A 3KF6B 3EIVA 4L5TA 1KSHA 1GVPA 1VYTA 1XJQA 4AI6A 2X2FA 2HHHL 2IYYA 5D3QA 4AG5A 3LQRA 4B3ML 2K5NA 1H9SA 5JZVA 2JA9A 1OLOA 1W0JD 3LWUA 1MO5A 1X8LA 2W6JA 4HZUB 2N8NA 4NZYA 4DZZA 3O8RA 2CQOA 1G3QA 4A3JG 1JALA 4P73A 4UP7A 3EPKA 1NVXQ 2JA6H 1T91A 2IT1A 2RMKA 1HQYE 2DR3A 1TWCH 2GXUA 1NP6A 4QQBX 1OV4A 1W4BA 2G1KA 3IPXA 5GJCA 5LD2C 3OE7D 1ZM7A 3U6KA 4CEHA 4AKHA 3CLVA 2VQFL 3LY5A 4QG7A 3E5HA 3U3KA 2QAGA 1XMVA 4KVAA 4A3FG 2BMFA 2ZE8A 2ZRNA 4EJSB 4URXR 2JAQA 4JBXA 3PF5A 4U5XA 4JOIA 4HYYA 1HZCA 1P2SA 3T1QA 5IK2D 1HR0Q 1NN0A 2JIZA 2R44A 1YNNC 4EX5A 4Q4HB 1YU9A 1EESA 1GRNA 3ADDA 4AIMA 2ZRBA 2A6ED 4GKKL 4HAUA 5C4XH 1GL6A 3H0GG 1E0JA 4JYBA 1P9RA 4AURA 1KKMA 5LPNA 1DAHA 3U9SA 3DZDA 4F4JA 5CK4A 4NXNQ 1GKIA 4A3EH 1YJ5A 3M7NA 4LJYA 2ZVPX 4LYAA 1FR3A 1EQRA 4RMFA 2FE4A 3KKQA 2B8FA 3P26A 4KU4A 4HB4A 3SJCA 2IHFA 3RNUA 1E79D 1XPRA 3PCRB 1VKJA 2I4IA 3AQ4A 4HUTA 5CB8A 2C9YA 2R6FA 4M53A 1JE5A 1EX6A 1GAJA 5KO2A 3AVUA 2YTVA 2C96A 4DDWA 3EX7C 4B6EA 1X54A 1Z22A 4PHGA 1K3RA 4LJ7A 1Y1WH 4Q18A 2ZJOA 4OYHA 3UKDA 1MO6A 5JHHB 1JNYA 3G71A 2NVXH 4H9GA 4BFZA 4LUZA 3TNFA 2RGNC 4A8JB 2QEXA 1OJLA 1ZYRC 4MDFA 3LBIA 2VY3A 4YWMA 1KYIA 1G6PA 2HUPA 3T35A 3T1YQ 3HOZG 1KI8A 1KK1A 2IUTA 4LHVA 2D0PA 3GFTA 2ZUDA 2FJUA 3Q3JB 1XMJA 5IHPA 2YOGA 3GJ5A 1NMFA 2QAGB 4A4IA 1E3PA 2WAXA 3N6RA 2QMHA 3S1AA 4BZXA 4G5QA 2LSSA 1FFHA 2XZOA 2IK8A 1I3QH 1PH9A 1N6HA 1BDOA 2MFIA 1Z0IA 4DB4A 4DR4L 4TYYA 4HJ5A 4NHOA 5JCPA 3AVWA 2VQEL 3UG6A 4CVNA 2WOOA 1FQJA 2RH5A 3FKSD 1UKEA 2YKGA 2N3SA 2A5YB 3GTLH 5CLQA 2GXAA 5HE9A 2ZRHA 4TVAB 2DNEA 2QGNA 1XPOA 2WJJA 1JR3E 4TYNA 4IDQA 3K0CA 2JA5H 3CNOA 1N5JA 2ZYUX 3GLGE 3GJ7A 4ZV4A 5C2JB 3CRMA 2Q9BA 4BY1H 2R9VA 4HAYA 2HDNB 3IPYA 1PLJA 2XNDA 4ZKEA 3W5OA 1NTGA 4QGUA 4YONB 3RANA 2QTFA 4RD0A 1RJ9A 5EP2A 1MH1A 1Y3AA 5EXXA 5TVKA 3X2SA 1Q7YC 1F5NA 2JA8G 3JAMc 1Y1WG 1SROA 1LVGA 1N6IA 2G0NA 3LAWA 5CM8B 5DI3A 3TAHA 5KSZA 2BA0A 2DYKA 2KHIA 2J45A 2OE2A 4Q01A 5FFMA 2FWRA 3HOYG 4DUZQ 4DT1B 2PZEA 2QA4A 4OGQC 1N32Q 1VG0B 1EYGA 1ZNYA 3BBPA 4JBYA 1GDDA 4DSNA 5JMTA 3J7A5 5FI0B 3ER0A 3AF4A 2JA7G 1OT3A 1PA6A 3EASA 5M5XH 2Q2HA 3ZQJA 4ON9A 4C3JH 5AUPB 1CF4A 2G88A 3HOVH 3K8YA 3MMPA 4LBWA 3R8FA 2O8BB 2FXQA 1N6KA 3IHWA 3OPOA 1KZGB 2J1LA 3TQCA 5DO9A 4LF7Q 3ZJYA 3VNVA 4POFA 1HNZQ 1NNEA 1JJGA 5FBQB 2C77A 3G0HA 5IYBH 4GOPB 4P32A 1PH4A 3MRSA 4DK0A 1YNXA 3DLLA 2OAQ1 2QM7A 3EA0A 3G82C 1L4UA 2Z0SA 4BPBA 3B9PA 2A6EC 4A93G 1FUUA 4DBLC 2AD1A 3FOZA 1KI3A 1VCNA 1LNZA 3CNNA 1NJIC 3CKLA 4RZUA 4R7ZA 2PPBC 4ZCIA 1I4TD 3AP1A 4JV5Q 1GOTA 4IDHA 1KHIA 2YOHA 2W6ID 1U2RA 4KHZA 2K5HA 1M2OB 1AZTA 2JLUA 1RYHA 1H9JA 1L1OA 3BK7A 3CCEA 1N25A 4M1SA 3QVUA 3RAPR 4GSYA 4C3HH 4MGKR 4JI0L 2GZHA 1GFIA 3HOWG 2NG1A 3AM1A 1G291 1HNWQ 1UKVY 5IP7H 1YHBA 1ZC3A 3JC66 3D6TB 4D26A 2I3BA 2NPIA 4GMDA 5LBIA 2VIIA 2VQFQ 3CX6A 2XGTA 1YR8A 1LUZA 4DCSA 4KHPL 3FMPB 5FI1B 4BECA 4YCUA 1XMIA 1YR9A 4M4SA 5F3WB 2YWEA 4N1AA 1GHKA 3I4NG 1IL2A 4AYTA 5AUNB 1TWGH 4AD8A 1E2HA 4LSGA 1S3GA 2ZUBA 1CKEA 4DV3Q 3V00A 3K70D 2CCKA 2GETA 2ZJQA 1K5GA 3KJGA 1XBTA 2EWVA 2V9PA 1EFUA 4LPKA 3SHFA 2ANCA 4A2PA 2V6IA 1OXXK 1P72A 2ZRCA 4M9XA 4PZYA 2W83A 5ANRB 3U44A 5DYGA 1RL2A 1XMQQ 3CIOA 1CRQA 4M1KA 4IFDG 1A7JA 2ORWA 1G3IA 1YBYA 1LTQA 2Z6VA 3O8BA 1Q3HA 5DHFA 1VQ4A 1Z0KA 4PQYA 1W4RA 3S17H 3FMFA 1RPZA 4HAVA 4DSOA 4IPGA 4QM7A 1EFRA 2ZANA 1XEFA 1U0LA 2BWJA 4JS0A 4NYJQ 3GFPA 1BMFA 3CRRA 1P16A 4PZ6A 2WZQA 4WXPA 5EE5B 4D80A 4ZIRB 3U7FB 4O0MA 3CF0A 4DWJA 1W0JA 2VHQA 4YMTA 1FL9A 3C4JA 4MRSA 4OQXA 3F8TA 4TMVA 5FL7D 5J3BA 2PI2E 4YY3Q 2OEPA 2IYLD 1HNZL 4A3CH 2CBZA 3F3YA 1NL3A 4GP6A 3QPUA 4KCGA 5HKKA 2GBLA 2AWOA 2Q3FA 3J81c 3LDAA 1VQHA 1JR6A 2K75A 4C0BA 1UBFA 1KK0A 1UM8A 1S72A 4PC3A 2ZRGA 1G1MA 4EQ6A 3BH0A 2B8WA 5M5WH 1N6PA 3K0AA 4LJ9A 4TL8A 2JJ8A 3ULLA 1MOZA 1OPXA 4LF4Q 4FMBB 2RHSB 3SGIA 2DCUA 4PHFA 4RCYA 4FMDB 3UE0A 4A3LG 3OFNA 4KSBA 1GNPA 1T8TA 3N2EA 2XOKD 4LBVA 4GI7A 3KFXA 2GTPA 4B2IA 2CE2X 4R71A 1G17A 2GJKA 3AGQA 2P67A 5HY6A 3FMOB 4DK6C 1P60A 3CC2A 4NONA 1VMAA 3JVUA 4DR1L 5IT9c 5JWRA 3STBD 4KO8A 1X3SA 2PJZA 2EXDA 3BH6A 2W6JD 3A8KE 2BIFA 3DKPA 3BAFA 3PR1A 1W2GA 4A3JH 2R93H 1XX6A 4JCVE 1E1OA 2N78A 5J4KA 4DJTA 3OTOL 5H1SE 2X8AA 1CR2A 3PG5A 2IX0A 1NVVQ 3E9HA 4PPNA 1KO1A 2WPDA 2R6AA 3FVQA 4WJ3M 1FNNA 3HOWH 4MRVA 3KFUA 5C1BA 3AP3A 1TU2B 3EWSA 4DAYB 1UADA 4AH6A 1PH6A 2NO9A 4LUCA 3HOUG 4X8OA 1AGRA 4DUZL 4A0FA 1F60A 2XXAB 2F43B 1H8ED 4NL4H 2C2HA 2W2VA 4LBZA 2OFOA 2F3IA 4JBWA 2AXPA 3H0KA 4R4CA 4W5JA 4UP9A 3KKMA 4P0TA 1JPJA 1E1QA 3LVRE 4JL8A 4NE2A 2O8BA 1P2UA 3K09C 5AJVB 4PZ8A 3A8IE 1XFAA 1ZIOA 4YXWA 4V03A 2FPLA 4LWCA 5IDVA 4EFLA 4QNMA 1VTKA 3MGCA 2E87A 3NH6A 4RVCA 3J80c 5KNDA 2BJVA 3DM9B 3NTUA 4D82A 3H0GH 1N5IA 1FZQA 1GITA 2ZSBA 3THWA 1QG4A 4OWTB 4B3RL 4LHWA 2Z83A 3G4SA 3HU1A 4FMDF 1PYSB 3WHLA 4AY2A 3JZAA 1PH1A 4WOPA 3QXJA 1CKNB 3EG5A 4CYMA 2JA6G 1H9SB 1E69A 1RRPA 3S2HH 2QT0A 2MMGA 4GPTA 3Q5EA 4DLYA 4DPGA 3NXSA 3LD9A 1Z0FA 2C95A 1WE2A 3PEWA 1E9EA 1FNMA 3K81C 1HURA 4KYIB 1F2TA 3QG1A 1CJMA 4HSEA 4GKJL 1GILA 1UJ2A 3MEFA 3I3SR 4QBIA 2ERYA 3X1XA 3UXMA 5K36G 4LY6A 3RR5A 2P5TB 2R8RA 1AE3A 2AMCB 1XCMA 3CQZH 2FGJA 1TL7C 3OIWA 4K81B 4LK2A 2JLXA 5C4GB 1TF7A 5J4HA 5DHAA 3MJHA 2G6BA 3OAAD 2XAUA 2D62A 5GQOA 4TQUS 1LM0A 3CCUA 3RHFA 4NXML 3L2OB 4R4TA 1FUKA 5IF9A 2Z0MA 1TU3A 5H68A 4B3XA 3ZQ6A 2XZLA 4JYAQ 4GDFA 4K0KL 3I73A 4AYBE 1DD2A 3KL4A 2JA7H 3F1ZA 4U00A 1W0KA 4BFTA 1Z63A 3W8RA 3NDBB 1Q8KA 1QVFA 1MR3F 3CM0A 4LJ6A 2BM0A 2PNRC 2NO0A 1NLYA 3BWDD 3WY9A 1Q90A 3TUZC 3U7HB 3ZVNA 2ZI4A 1E9BA 2GEDA 4Q9HA 2PQAB 3KYHC 3KUDA 3N70A 5KNBA 4QBGB 4UKDA 1NVVR 4BLQA 2F9MA 5JS7A 4DV2Q 2F1RA 3IDQA 1XNQL 1US8B 4H13C 3GO5A 4IOAA 1BH2A 3KXIA 4AK9A 4KLZA 4LZZA 3FWYA 3MWJA 1TXYA 2JLZA 1FX0B 2B7CA 3A8JE 4Q02A 5FJ8H 4BFXA 1KTVA 4AKGA 4LFAQ 2JA8H 1XD8A 4XD7A 5SZJA 4TMXA 2OTJA 1KSJA 5FTNA 3BE4A 3GLIB 2YJTD 2GN5A 1XNRL 2QI9C 3H94A 3B85A 3SQXA 4TWZA 4NYMR 4L5RC 1N34Q 1P73A 4IOLA 3CP0A 4JC0A 1E2WA 3J81i 1W36D 2JDIA 2WWIA 3RYTC 5CIQA 4PC1A 4HZIA 2JLQA 1HH2P 1G8FA 3SJBA 4CEJA 1VPLA 5AK0A 2GESA 1E3MA 1KNQA 3T12A 2OQKA 4DR7L 3B2EA 3GPLA 2YZ2A 3CF5A 5FOXA 4C9BA 4RZXA 2PNHA 4PZ7A 1VQDA 4RD6A 4BUJA 4NKRA 2ONKA 4UPAA 4DR5Q 1W46A 3EBEA 1CS4C 2VHUA 5F2EA 3A1SA 4S35A 1Q82C 1YZ6A 1MJCA 1KC8C 2WKQA 3LQQA 1IBLQ 1UBEA 1ONBA 4H0LC 4QM6A 3C15C 3K0EA 4B32A 1HA3A 2VQSA 4Q1EA 3PEVA 3HKSA 4IOCA 4DR1Q 2E8GA 1ZJ6A 2CL0X 2VH5R 5GJWC 3K70B 2XJ4A 3CC7A 5CDFE 1EFHA 4NYMQ 3TMKA 5JSZB 1EK0A 2G1JA 2NGRA 5A5GA 4NXMQ 2QBYB 1HH4A 4DV5Q 2VP9A 2IWRA 3DOEA 2H5EA 4R9UC 5LDDC 1MRNA 2K33A 3W8NA 5C44H 3GD7A 4V0ME 1NLFA 4KAXA 1KY2A 5IT5A 4B3TL 2GXSA 4B48A 3ZGXA 4LJ4A 4MRPA 1VHLA 3GEEA 2K32A 1IXZA 1DOAA 4I7ZC 1BO6A 1RFLA 2W0SA 2IW3A 5SZHB 1CR1A 1ZNXA 2FPKA 5M3FG 4HAZA 1CSPA 1YHNA 4QGGA 1W2BA 4B3MQ 1P9WA 4TMKA 2FSFA 4KI0A 2ZJBA 4LFBL 1QVAA 4AQYL 4IQZA 2WVJA 2MO1A 1G3UA 2GCPA 2WWGA 4JLJA 3PUYA 3TW4A 2D7DA 1IQPA 4ME3A 3T56B 3AYHB 3D31A 3CXCA 4TTRA 5BWMA 1Z0AA 3NG1A 4CEIA 5GAHC 1N34L 4RFSB 5HTKA 3KQLA 3P27A 2EYQA 3PO2G 4FD2A 4HDOB 4LC0A 3KF6A 1WJJA 3P32A 2QPOA 4RD4A 4KFTA 3RNLA 5K8LA 1ZW6A 3K80C 4YHHL 1EQQA 2C35B 1B0UA 1DO2A 2OLJA 4NB3A 4GNXB 2OXCA 2V8OA 2ZITA 3AKEA 2JEBI 5EUQB 1W4AA 4Y0AA 1DAEA 1YVDA 3MFYA 1D5CA 4XOIA 3PEYA 2F4VQ 1S0UA 4M8NE 4OK3A 4ARZB 3H15A 1I2MA 3W3ZB 5FL7A 5KHOC 4HAXA 4P4SB 4UXIA 5FOTA 4GOXA 2XB4A 3GCGA 2XTZA 4DLRA 1G18A 5IP7G 2LXJA 3H3VH 2MSDB 3KQNA 1GKHA 5C0XH 4GKJQ 1A63A 1LY1A 2BBOA 1E2JA 2FN4A 1K6MA 2LCFA 4FINA 1WCMG 3LXXA 4KBGA 4OQLA 3TJZA 4A82A 4GZMA 3RLFA 4NPSA 4O0AA 1LS6A 1DE0A 1XEXA 2FEOA 1KSFX 2OLKA 2HLDA 2NZ8A 1HE1C 2QNRA 1II8A 2V1CC 3BFKA 1P4SA 4UQOA 4US0R 1N32L 4X8LA 3W1BA 1DGSA 3BB3A 3QKSA 2BH8A 5JEAJ 4KV9A 3RC3A 4AYWA 1I5FA 3QVVA 5B64A 3EPHA 4RCZA 3RS3A 3PIRA 3KTAB 3ADCA 4UNQA 3SNHA 5EP4A 3KZ1E 4JI8L 1SKYB 3SYNA 3B6EA 1F48A 1M7GA 1EFWA 4HIDA 1TQ6A 3CBQA 3CO5A 2PEYA 4QL5A 4HUQA 4JLKA 2JASA 4D4LA 2LKCA 2GF0A 4IW3B 1KI7A 3S1AB 5JSZA 5KYKA 1V5WA 2B21A 1AIPA 4L5SA 1Z6TA 2O0HA 1IN6A 3K9LA 3KXLA 2K7VA 1SGWA 1UDXA 3NBFA 3TE6A 4BEBA 4DNTB 1X8KA 4KBFA 1IAQA 1N36Q 2FV8A 1YJNA 3I61A 4BXXH 4JYCA 2O8FA 4Y0VA 3T34A 3RZDH 4PZLA 3UG7A 1FOEB 4PPQA 4BLTA 4G5OA 2R93G 2AR7A 3LNCA 1VQBA 1PYBA 4M1YA 2PZFA 5IY0A 2QMOA 5M04A 3LXRA 2VL7A 2GILA 3VKWA 1G7TA 1XTIA 4CIDA 4US2R 1DELA 1SXJC 3GJ3A 3IQWA 5FTKA 3SJAA 2J9RA 4DSUA 1R0XA 2IYXA 1C1YA 4BLSA 5L8VA 4LBYA 4YMWA 2HCBA 2FFBA 5LB4A 2YC2C 4B74A 2ZI7A 1NN3A 5B2ZA 5EUMA 1Z47A 4Y52H 5FUVA 3ADBA 3SYKA 4JG2A 1G16A 1NG1A 1NLZA 2QORA 5M3FH 4B71A 4AG6A 4P74A 4M1WA 3L43A 2E2IH 4NTZA 1MKYA 5LMNW 2P5SA 1JPNA 1DO0A 2E2JH 1S8FA 1T0JB 1TWFH 3DMNA 1WOCA 4XSGA 3AF0A 1GNRA 4DUYQ 1QHSA 1TQDA 1K83H 4GFDA 4HB3A 1IONA 3B9QA 4Q4LA 1FGUA 5C3EH 1IXRA 2OILA 4LJAA 4PAQA 3AVTA 1PLLA 2ZTDA 4CEHB 4A3KH 1Q21A 2D06A 2NN6H 1JBKA 2V4ZA 1R6BX 2C5LA 3TLXA 1Z28A 4OI2A 2KCTA 4C0AC 3VR6A 1VQFA 1T9HA 3OZXA 1SMYC 4ZPXA 2B8GA 5FR2A 3NIBA 1AJEA 4Q1BA 1R5BA 4HB2A 1CR4A 2ZI9A 2KENA 4GZLA 4X8HA 3RRYA 1IOZA 5E7IA 3VR1A 4YY3L 4A3IH 1MO3A 1OFIA 3BU2A 3CF2A 2GJ8A 3CAMA 4DV1L 4A76A 1WFQA 1WCMH 2W2XA 5CDFA 2CVHA 5C0XI 3E1SA 1KI2A 3PUVA 3I4LA 1E9CA 4PPGA 1DAMA 1S96A 5FPYA 2ONJA 3TUJC 3U3MA 1WI5A 4DLTA 2BC9A 4A8JC 1VQ9A 2C04A 4CT4B 1E9AA 4C3IH 5CJPA 3WYAA 5KOYA 5DNYB 1W3SA 3NE5B 3HOXH 4LPSA 1AA9A 4IDOA 1ZU5A 3VKHA 1PH3A 2XXAA 5TXGA 4JV5L 2VL6A 4M0LA 1XXHE 5FLXc 3EQLC 1HJPA 4RZ3A 4HJ8A 1G41A 1OYWA 4X64Q 6Q21A 2ATXA 2VHCA 4BRWA 1L7VC 4V0NA 5FR1A 5TB5A 3THXA 5ELOA 4TL9A 4Q00A 1AQYA 4IRUB 3DM5A 1NSTA 2ATWA 5EP3A 1XF9A 4Z54A 5KPDA 2NO6A 4IEIA 2H1LA 3G48A 4B44A 1X6OA 1SVOA 2F43A 5EE0A 4LNQA 1N6OA 3EC1A 3R9WA 4X65Q 1LF5A 2OSBA 1Z8FA 3GJXC 4DCVA 4A1FA 2AL7A 4DAMA 3ASZA 3AB9A 4XD7D 1FMJA 2VHJA 2ZSFA 3A74A 2REOA 2QF7A 1JR3D 2FPMA 4ZI2A 2WFWA 2VA8A 3WMGA 1BYUA 2QPTA 5HR5A 3THXB 1Z29A 2Z43A 2D0OA 1E2EA 2MSEB 3VR3A 1V9PA 1UE6A 1E1TA 1F3OA 5LD2B 1IYJB 4BFYA 1IHUA 4B43A 2E75C 3NBXX 5TARA 3THOA 1JMCA 4MUAA 3OEHD 3LRPA 3GTOH 1SKYE 3ZVRA 1D7QA 2IF0A 3HU2A 2Q0HA 4PFSA 3F0TA 4D6PA 3DHWC 5H1YA 3A5UA 3T1OA 3J7ZC 3IIMA 4L15A 421PA 3AVPA 4ACAA 5SZIA 1Y8OB 1VCMA 3FP9A 2G0TA 1D8LA 1BOFA 1NIPA 4K46A 4Q5IA 1R0YA 2Q2TA 2GNOA 2H8KA 2BEKA 2D74A 3KFVA 2BKEA 1VQCA 5TY0A 4DLUA 4MYCA 5EXSA 2XB2A 1KIMA 1NVUQ 4HJ9A 1H95A 2Q21A 3LW8A 1Y14B 1YZLA 3OHMA 3GDEA 4PHTA 4PZZA 4YDSA 2IUUA 3SOPA 3T61A 4Q03A 4PR0A 2GVBA 3RRMA 1HZBA 2FDCA 4DRZA 3M4PA 3CRVA 3VHLB 1KNXA 1W1WA 2DWOA 4BFSA 4F92B 5FOVA 2BEJA 4BY1G 2WSSD 2QMEA 2UUCL 4HLUC 3HGBA 4PSVA 1VF7A 3U50C 1KGDA 3UWOA 2A69C 1CULC 4X64L 1DVRA 5G3YA 4DR2L 3WBJA 3RABA 3ZS9A 3IEVA 4QJ3A 3PITA 2BE5D 4PC7A 4UNRA 5AJ3L 4BZQA 4RD3A 4K8OA 4LJ5A 3FMIA 1EOVA 1IM2A 2CL6X 1R7RA 2Q6TA 2WICA 2KA7A 1MKHA 1I2DA 3A8TA 4DXAA 3W6NA 3ZD7A 2QSYA 1XJCA 5FUYA 1PHJA 1E32A 1I6VC 1KO8A 1GVNB 1QF9A 1S9HA 4DLXA 4XWKA 2WAYA 1T5IA 3A7AB 2P65A 1Y63A 1L4YA 1JAHA 2V55B 3KJOA 1KJYA 3NBZC 3ZVLA 1DG1G 3W6PA 4ZIRA 2HIXA 4BQSA 1KDOA 3KKNA 1A1VA 3VU9A 4WXRA 4NU0A 3EIQA 4FCWA 1OIXA 1KDRA 2JJ1A 2PX0A 1RRGA 2YNMA 3AKYA 4UNNA 2IHEA 2VZAA 1WYDA 1Z07A 2Q2IA 4V0KA 4JI1Q 2BMDA 3U6BA 3R9XA 2EFGA 3W90A 3C5CA 4QHYA 2UXCQ 4XTRA 1Q1ZA 2BOVA 2X19A 2VHTA 3ZIAA 1ZD8A 3MD0A 3WP1B 3B6YA 2ZEJA 4A6XA 4NYIQ 1JR3A 3SJZA 3GLGA 3CH4B 2ZRJA 1T4GA 3UMSA 4HUQB 3T1TA 4C0JA 4OK6A 3MCAA 3KQHA 4TQAA 5F9HA 3GFOA 3U5ZB 1UE1A 2R62A 1T5EA 4LF5Q 3C14C 3M0EA 4V0MA 1W36B 1NIJA 1R0ZA 1NKTA 3EARA 1KK3A 4XVRA 4HIMA 2VP6A 5DN6A 2ZROA 1U99A 1TUEA 4N3NA 4B47A 4GOPA 3QIAA 4MGYR 1YI2A 1YZQA 2HT6A 4LHZA 4JI2L 4OL0A 5AR1A 1J70A 1AQUA 3I4NH 5FLMH 4A4DA 2A3RA 2H7VA 3DPUA 2VO1A 4DEYA 4PMWA 1HQMC 2NZHA 1IBLL 1E98A 3MUFA 4HB0A 4V0LA 1KOFA 1E2LA 1T3HA 3AVXA 5AJ3Q 2HJGA 2J41A 4G5RA 1E99A 4BXXG 2R7DA 1B8AA 2GWHA 4IVQA 1KDPA 4UXHA 3NBYC 1NE3A 2Z4SA 2CCZA 2J0UB 3BS4A 3EWAA 4QOSA 2JGNA 1OXSC 3E9IA 4A3EG 2QE7A 1E6CA 2CJWB 2BM1A 1KRTA 5J4LA 4TYQA 1N33Q 4M9ZA 1E9DA 3CRKC 1IY2A 3QXCA 1X65A 3UMRA 2PMZE 1QG2A 3LO5A 3T1HL 2QPAA 4EPTA 3I62A 2O8CA 1BYIA 1G8PA 5FPSA 4UY8C 3SZRA 3S2DH 3QI2A 4A3DG 1E0SA 3RC8A 3J80i 3CPFA 1CKOA 5EAYA 1P7CA 3RS7A 1SN8A 4A3GG 1YJ9A 4Q1AA 3TS2A 5LMNL 1AM4D 4MRNA 3WYGA 4F91B 2CW0C 2DUDA 1K0RA 1X3EA 3TEHB 2FSIA 2QU8A 4Q4JB 2DN8A 3U7EB 1QHXA 4A6PA 2UXCL 1QZGA 1G3RA 5B30A 4GL2A 4LF6Q 4LUOA 2W00A 4QIWE 3D7MA 2EJGC 1SXJE 1QUQB 4RCNA 2JXMB 1TKWB 1AS3A 1JB1A 3Q5DA 2E74C 4JL6A 2J0UA 2XOKA 1PH2A 4QKQA 3C5HA 2ERXA 2WB1G 4IFEA 2UXBL 2DBYA 2RGCA 1A2BA 4LF5L 5DLQC 4BA2I 1XRJA 3A7LA 1X56A 1NMZA 2ZUCA 3TS0A 2QL6A 4EJSC 4GN4B 1H9KA 4TN1A 2GVDC 3TR0A 3ZZUA 4D0LB 3FYHA 1WBBA 2X77A 3W3AA 1FQKA 4Q7KA 1J7KA 3EZ6A 2ZRLA 4DKXA 4IJHA 1DG3A 1XTJA 2GAAA 3HFZB 2FG5A 2NIPA 2F6RA 3UDGA 4IVRA 2ASEA 1M7HA 3RSLA 3TR5A 2P6UA 2ZPTX 2V7QA 4OI4A 5JRJA 2EVWX 1PVOA 3M85A 2NTYC 1VQAA 4KSCA 3B13B 3H2YA 4WJ4A 2B7BA 1CJUC 4DLZA 2KCCA 1YKSA 3THYB 2X2EA 1TAGA 3TVTA 5DN6D 1NMXA 3RLOA 2ZU0C 4DDVA 3M9BA 3B60A 4NDZA 4JI4L 3EIEA 5E4FA 1OB2A 4DV5L 1E2NA 3IFTA 3BFVA 3OTOQ 1MABB 4OO1I 5FLMG 1T8UA 2LKDA 3OESA 2WJYA 3NHBA 2KE5A 2ZSDA 4D2IA 3T51B 3H1TA 5KDLA 4Z1MD 2F9LA 1E9RA 1US8A 1AS2A 4JI7L 2GA8A 2OT3B 621PA 2YVUA 2HIVA 2YTXA 1B9MA 1RRFA 1H8HD 2KJQA 2A7QA 4NP6A 3THYA 4KKUA 2ZQ5A 4JLMA 1XMQL 2ZTSA 2A68D 1R0WA 3NELA 4BA1I 1IY1A 2VP2A 1GTVA 3GLIA 1Y8PB 4CF7A 4LF6L 1SR3A 1YIJA 4Q4HA 3BZKA 4E09A 3FDIA 3R20A 1KAWA 2QGQA 5C44G 1QRAA 4OJKA 4WIAA 1COWA 1GIAA 3H3VI 1XDBA 2E76C 2ZE6A 4URYR 1Z5ZA 4F38A 3KDSE 1HUQA 4A0RA 2G83A 2I5LX 2UXDQ 3G5UA 5DH9A 1N9WA 2O5VA 3WWVA 1A5TA 1P6XA 1XEXB 3TIFA 2WJVA 4OHZA 4DEXA 4YMUA 1XEWX 4BLPA 3GTPH 2ATVA 5EZ5A 4KVGA 4GRAA 2IS1A 4QJ5A 4MTNA 1BVSA 1NJFA 4DC9A 2HXSA 1G64A 5JFGA 4OKSA 2RGBA 4LF4L 1ZBDA 2PBRA 4JI2Q 3QENA 4BFVA 2NMVA 2ZYWX 3KJIA 3QXHA 2VF8A 4BLRA 3QUSA 4Q7MB 2MO0A 1M90C 1CKNA 4M2LA 1I50H 2ZRMA 2KB0A 3EXAA 5GROA 3PO3G 1XZQA 1NY4A 2AFIE 2RHMA 4JJZA 4IXNA 3TKLA 3ONWA 3U3JA 3GLHB 1F6BA 4L8JA 2ZE7A 1BS1A 4ZDWA 4LF9Q 2CWAA 1AGPA 2RHDA 2UZIR 3KJPA 2IA5A 4LX0A 2JJ1D 2N1BA 2O8DA 4NMMA 1OKKD 5EZ6B 2GJSA 3CWZA 1EX7A 2CHVA 4EPRA 1XWIA 3DL0A 3RSOA 2JE6I 4B2LA 1JXMA 4B6FA 4D4MA 1II0A 2BDOA 5J47A 1OH8A 3AVYA 5KDDA 2WJIA 2QEQA 3TK1A 3CH5A 1FL0A 1S3OA 2KWIA 4M21A 3SEAA 4P3YA 1X86B 4LFCL 1YZKA 4EPVA 4MKHA 3HOYH 3A58B 1P61B 4BFUA 5IP9G 2NZOA 3OEHA 1W36C 4LJ8A 3KJHA 4WBSA 2VSXA 3U4ZA 2IUSA 4YMVA 4KJZA 5LMNQ 1KI6A 1QHYA 1QHHA 1GUOA 2RKOA 3JVVA 3O47A 1J8MF 4GMXA 4PC2A 4QBFA 3SYLA 4C4PA 1KK2A 1R2QA 2JDID 3OAAA 4M1MA 1DBSA 4C2TA 2CKZB 1OB5A 3BIFA 1IW7C 4IHQA 5KSOA 5TMPA 4DV6Q 3QKUA 2R92G 3GJ4A 2UU9Q 3RS0A 2BMEA 1KMQA 3REFA 1YZUA 2F1MA 1XTDA 5IYBG 1KY3A 4JMPA 4B2PA 4E5UA 2RGGA 2J59A 3GP8A 1SHZA 3UPUA 2VTKA 4CZ2A 1PH8A 2N42A 4BASA 1ETUA 2QRZA 2QN6A 4U02A 1H8HA 2OESA 3OIUA 3IRBA 1G6OA 1XD9A 3HP1A 3A1TA 1NBWA 2E2HH 1PLKA 3CF6R 4FI3C 1OYYA 2GVZC 5L3QB 2HF9A 5G41A 2RCNA 2V6JA 1O7LA 1TU4A 4II7A 1SVSA 1HR0L 2J3EA 4DIEA 2MQHA 1DEKA 2QE7D 5L3VA 3BXZA 4RY2A 3NBHB 2FZ4A 3MXNB 3VX3A 1C4OA 1GUAA 5FOWA 4ALPA 2GDJA 1Q1EA 2I1VB 3H4MA 1T6NA 1L2TA 1S1MA 1WCV1 3EN2A 4N0EA 3K0FB 2OXRA 4A3CG 1FX0A 1LB1B 4ZO4A 4W7SA 4D4KA 3IIJA 2XGJA 2GCOA 4OQMA 3P4YA 1IW7D 2YV5A 1PV4A 3IO3A 2O8FB 3NKVA 1Z9FA 3A4MA 5D3MB 3PSIA 4TLBA 2H92A 2CK3A 3OFND 4JLBA 2XITA 4MKFA 4JI4Q 2A19A 1K9MC 2F52A 4IXMA 3U61B 1VECA 3FKIG 3SR0A 2IC5A 2IXFA 4JLNA 3WHKA 4H1UA 2ODEA 1IY0A 2NOAA 1V43A 2K50A 1W47A 1DCZA 1DADA 1EGAA 2JCSA 4US1R 4PV1C 3FE2A 5F9FA 3CD6A 1E9SA 2CL7X 4TLEA 3CPHA 1E4VA 3VMFA 3F2CA 1J5EL 3MJRA 1XEWY 2ZAMA 1IZ6A 5IWAQ 4XJXA 5JJKA 2IY5B 2YWGA 3LBHA 4PANA 1AH9A 3ZZ0A 1CFMA 3UDIA 2AXNA 1WP9A 4Q4AA 3FHWA 2QT1A 3I72A 3E2IA 1Z2CA 5FTLA 4LDJA 2IYWA 2O0JA 4QGHA 3GLIE 1RC8A 4TT3A 2CLDX 1N0WA 2AK2A 3NENA 2O8CB 1SFOH 3HYRA 4A0GA 1H8EA 2NO7A 3CX8A 3QY0A 1UPTA 2XSZA 3KKOA 5L3QA 1EG7A 3KOJA 4X65L 2WHXA 4LYJA 4NCKA 4JT4A 4Z8XA 4IFDI 4CW7A 1HE8B 1O7IA 2D4HA 2RB4A 5JWOA 1QBKC 5GAEC 4JVLA 4DV0Q 2YU9H 1RW4A 2R7ZH 4FCVA 1I4LD 3H84A 4JLAA 5CJ2A 3TGPA 1IBMQ 2FOLA 4M1TA 4WA7A 3FFAA 2OBMA 1E4YA 4PAOA 3KB2A 2B8TA 4BY7G 4Q9JA 2PH1A 3GJ6A 3FHTA 2QROA 1N5KA 2V1UA 2Y0SE 4BBSH 1U90A 3EAQA 3HYTA 4NCHA 4JI1L 4Z1MA 2OFXA 2A8VA 5HZKA 3U7GA 2CVFA 3QXXA 2CFMA 3S1NH 3CW2A 4EKDA 4OO1H 2I5HA 1M6NA 5KTYA 4JL5A 2XNDD 1SLJA 2Q8IB 1DAIA 5DIFA 3Q8DA 5BR8L 3Q7QA 3OW2A 4PO8A 4GN3B 2WWYA 4YCWA 1VHTA 4B3CA 3QKSB 1DTSA 5KNCA 3RRNA 4URUR 2VF7A 4DNIA 2WKRA 1Z6XA 3CR8A 5L3SB 5FH9A 1IN8A 1S9DA 2LMCB 4A9AA 4DHEA 2BE5C 3ASYA 1GO3E 1AE2A 3PGZA 4R98A 3FPAA 2F1IA 3GMTA 2AX4A 2QRNA 2L0XA 1J90A 3AKCA 4TKOB 4NYJR 3OOCA 3SI7A 1WF3A 1Z3IX 4POAA 1D6JA 1BKBA 3Q8XB 3PF4A 5M3MG 2D2EA 1G9XA 3CPEA 3MAAC 3RLNA 4KMUC 3PCOB 4RFSA 1C9OA 5C46F 3BDOA 2CK3D 1KI1A 3WYFA 3CC4A 1X6VA 1PH7A 1G7CA 4G5GA 4B3FX 1KAOA 3TREA 4I1UA 2MMCA 3IQXA 5JEAH 2BCGY 1YZTA 2FA9A 2ZRDA 4JLPA 4ESVA 2XEXA 3IO5A 1JJCB 2CEAA 4JI0Q 1XTQA 4B3DA 3CCLA 1XMSA 2RGEA 4OJQA 3CW2C 5TDHA 1AS0A 5J4YA 3C7KA 1SVIA 1UKYA 1S3SA 3LVQE 5JBQA 4EQ5A 3CCVA 1N33L 2OHFA 3QE0A 2TMKA 4M9SA 2QA5A 2PCFB 4C0KA 1CRPA 4ESHA 3NEJA 4RD2A 5E3HA 2A6HC 4C3ZA 1WBDA 1Z6GA 2ZJYA 5K36H 4LF8L 1NI3A 1Q20A 2FMXA 1NMGA 4OK5A 4RJLA 5EE9A 1LS1A 4URVR 3ECCA 2QSZA 1UAAA 1Q81C 3QXSA 5GVSA 1U94A 3ICQB 1X8JA 2WIAA 3A37A 4C30A 3JZMA 1Q3TA 2H17A 221PA 3FFBA 2ODWA 1EIYB 2DNCA 2C9CA 2RGNA 5KSYA 4OONA 1Y1VG 4DR6Q 1TNDA 2Q9AA 1IN4A 4TL6A 5JEEA 2QMUA 4YWLA 1ZVQA 2PX3A 1E96A 5IYCG 1IN5A 1U9IC 2C8VA 1K73C 5HE8A 2PMDA 3IBGA 4FXPA 4XVQA 5FBLB 4NBSA 1ZUIA 3RN2A 1Z06A 3R8CA 3CRQA 1O78A 1E0AA 2QG6A 3FKSA 2KI5A 1S2MA 5JEAG 2OBLA 1ZINA 4BY7H 2JJ2A 1C9KA 4PQFA 3EZ9A 4R2IA 5DISB 2OQ0A 3ZYCA 3BRWD 2F7SA 4JK1C 1FTNA 4KN4C 3CONA 3LW7A 1M34E 5CK5A 2QP3A 4JI5Q 3W34A 4QL3A 4R1JA 1KI4A 2GVAA 5GVRA 2WAQE 2YHSA 1S1CA 2ZJ5A 1HT1E 3GTQH 4OHXA 1G7SA 3PV0A 3CRW1 4PO9A 1HZ9A 3ZJYC 1MT0A 5HKKD 1W5TA 2EU8A 2WMNB 4ERNA 3LBNA 4XH9B 1VQMA 1OFUX 4KFUA 4MA4A 4JLVA 3OEED 1ASYA 5IYDG 2EFHB 1GUTA 4AYXA 2J0SA 1SVWA 2Z4RA 4A3MG 1PJRA 3ZD6A 1E22A 1W2HA 3U4QB 2HEIA 1GNQA 1C7YA 3VFDA 1TX4B 3CMAA 1OXVA 1YRBA 2ZR0A 4JBKA 5BXQC 1OTCA 2NQ2C 3EIHA 2LXKA 3D0FA 3AF2A 3QOFA 1E24A 2B3GA 2R7FA 2ZAOA 5SZKB 1V8QA 1SVLA 4L9SA 2GCNA 4AWXA 5C4JH 1GUSA 2R65A 3LGJA 2BH2A 2G3YA 4AC9A 2WP8J 2RGDA 2IYUA 3KKPA 4PG3A 4OQNA 2ID0A 1R8SA 1HT2E 4HDCA 2D2CC 4DR3Q 4NXNL 2JA5G 2CNWD 2ZETA 4MGZR 2A1AA 4B76A 1XXHA 2ES2A 1AN0A 5F98A 1KKLA 2WWWA 2CWPA 1ANKA 2O8DB 1CUKA 3DXJC 2KBEA 2ODBA 2D3WA 4Q9IA 3TRFA 4PPFA 3S1QH 3T15A 1UFQA 4X66L 2ZE5A 4O25A 1GKYA 4XVUA 5C4MA 1Z6HA 3B5JA 2XTMA 3DO6A 1TADA 5FUXA 4GS3A 1WXQA 1R5NA 1QDEA 2DPXA 3KUCA 1KAGA 5J40A 1RYFA 1FP6A 2JEOA 4TMTA 3T06B 2GZDA 1YE8A 3UWKA 5J4VA 1K8MA 3PEUA 3GLHA 3PUWA 4YMSA 1ZM3A 3I8XA 5G53C 4PO1A 1XCPA 3IGFA 5HZHA 1U98A 3SHWA 3AUXA 4GLXA 3L8YA 1NBMD 3TW8B 1OW3B 2GEUA 1WA5A 4TSFD 4ZCLA 1YR7A 1HNXL 2FEMA 4FCTA 2DFKB 3S24A 2UUCQ 3ADKA 4JKYA 1KMHA 1LW7A 3BOSA 3B82A 4ZCMA 4B34A 4JI6L 2QTHA 4MRRA 1TEVA 1ZNZA 1PFSA 3MWYW 5K8TA 3THWB 2ZT9C 3EZ2A 2WJHA 4DCTA 1OH7A 4TLDA 4DUGA 4BBRG 4EDHA 2A6HD 5JI3E 3AUYA 1IYVA 3CCJA 4O2LA 4WVFA 3AF1A 5EXPA 2QP4A 4KHPQ 2N46A 1AKYA 2NN6G 1JJ7A 1I94Q 1UEJA 2RGXA 4AKEA 1Z2AA 2PCLA 3R9IA 3AKDA 3M6AA 3TAUA 4QJFA 5FJ8G 4JI3L 1XJVA 1K8OA 2XX3A 4JYAL 4RD1A 4B3SQ 4AKIA 3ND9A 1VYVA 1EIFA 1ODFA 5H70A 3U4QA 4L16A 1CTMA 3QF7A 2N49A 1T0HB 2HCJB 4RSGA 3CCRA 1OFTA 3FB4A 1XTSA 2UUBL 2GCOB 4R4QA 1QHNA 1ELOA 4LV5B 4D0NA 1SULA 2HYIC 3S1MH 4GOJA 4NH0A 4LFBQ 1OE0A 1XD2A 1Q57A 4HLUA 3GEIA 1CEEA 3HR7A 4X66Q 5FOSA 3ZDQA 1DPFA 1ESMA 1J6QA 4FMCF 2NVYH 1W7AA 5CIWA 5UKDA 3N2IA 2A5FA 2ZXUA 5C4XG 1XB2A 4HI0E 3PO3H 3HPRA 4CEJB 2ZR9A 4IFBA 4OQFA 3RWMB 1DS6A 2RGAA 2ZSAA 2EJMA 4ITRC 4PSKA 3WBKA 4DCUA 2FH5B 3LLMA 2VEDA 4HIKA 2IX3A 1SVMA 4KKTA 3RRZA 4JI5L 1OHHD 2K14A 1E79A 2ZM6L 2IEZA 3NDPA 2F4VL 2WOJA 4GOPC 2ANBA 1KO5A 2FFHA 4H44C 3FMCA 4E07A 1U0JA 4ZDJA 3GLFA 721PA 4TTPA 4R4IA 1N6LA 2GJ9A 3TSOA 2AUJD 4DR2Q 2AKAB 4IO9A 1QHIA 4POGA 1PUJA 4EFNA 2BHRA 2G9NA 1AZSC 3B7GA 3VNUA 1AKEA 1G8HA 4P4UA 4A3GH 1VIAA 2QTVB 2W58A 1TQ2A 2AFHE 3HWSA 2F1JA 4Q4JA 1XMOQ 3HOUH 3WRXC 1VQ7A 1P8LA 1NBMA 2BBSA 1ZCBA 3O8CA 5HPYB 3WXMA 1I94L 2D2FA 3HOXG 4MKGA 4G7OC 2C98A 1Q46A 1GHJA 4J15A 1YITA 2K5VA 4Q1CA 4Q7JB 1G7RA 5E95A 1A0IA 4GLVB 1XP8A 4JI3Q 2ZRKA 3AVVA 3QBTA 4YQFA 4QGFA 4JSTA 4QXAA 1ZUHA 5IYCH 3ICEA 2QUZA 2VPPA 1IBKQ 2SHKA 2OCEA 5JLJA 3U44B 4YWKA 5A4JA 1QJOA 3K0CC 4NYIR 1N36L 4IPDA 4A0HA 1Q86C 1Z0DA 3DM3A 3W6OA 1FPMA 4DUGD 2J0QA 4A2WA 5GJBA 4DT1A 2VP4A 2C78A 2UUAL 5IWAL 1FJGL 1ZNWA 1CIPA 2IF2A 3GEHA 2UU9L 3JAMi 5JWHA 1Z83A 3UE1A 1G8GA 3NEMA 1N5LA 2FU5C 4QGAA 4IFDJ 1E2FA 2R2AA 1ZKOA 2OTLA 4F93B 2VNUD 1WMSA 2CLCX 1G5RA 3I1FA 4DNRB 3L2PA 3A1WA 4JOIC 5AJWA 2F55A 3I2ZA 1QHHB 4IPCA 4RFVA 4DSTA 1G5TA 4GNXC 1Q44A 2QAGC 3I4MH 2FFQA 2JLWA 1W4CA 3FKQA 4D25A 2A69D 5G40A 4ILEA 4KLNA 3HOVG 2EVBA 3CZQA 4WW0A 1KMHB 5H8WA 4QHSA 1JQLB 2F3RA 4X6AH 2F1HA 3NVAA 4Q19A 2IBMA 2B29A 3Q85A 4XWOA 4NCIA 3GLGB 1NKSA 4DDTA 1A8VA 1FVIA 3CCQA 3J81j 2VS1A 3UIEA 3BERA 3AB3A 2UZ3A 3T1VA 1YZNA 3RS5A 4OHYA 2QP9X 4LV6A 5EXTA 4JLOA 1UEIA 3A5ZB 5GADl 2O5IC 4OHVA 1EWHA 4YDHB 2ZTCA 1ZMXA 3IEUA 5K8IA 3IBYA 1SZPA 4MZ9A 2WSSA 5DI9A 2IXGA 1VQNA 5BW8A 1G3MA 4UJ5A 3QNUA 1E2IA 3TH5A 4UJ3A 2E5LQ 4JI8Q 4V02A 3K9HA 1FYCA 1KJZA 4GNKA 2ZVQX 1RJ9B 1COWD 4KN7C 5BQ5A 2RF4A 3GTJH 1NMYA 4W9MC 3I56A 1J8YF 4DV1Q 1F2UA 2B92A 2OAP1 4TTQA 3LX8A 1VQPA 3K7AH 3F2DA 5KSPA 4BEJA 2IWHA 2GHIA 4O3MA 3KLRA 4BLOA 2VUMG 3HJNA 4EQ6B 4WZAE 2NN6I 1A2KC 2L5TA 2BKUA 1G21E 4Q1FA 4TL7A 5BN5A 1ZAKA 2W2TA 3VR4A 1E9FA 1TQ4A 1QVRA 2NZJA 1NSFA 4DR4Q 5IK2A 1GUGA 1VF5C 1UF9A 4X62L 4I1OA 1E1RA 1EFTA 4IDPA 3FKIH 1J2JA 2A5JA 4KFSA 2KBNA 2EWWA 4OI1A 1L8QA 2R7ZG 2DFNA 4L9WA 4C0SA 4EFMA 4HLQB 4JZKA 4DV7L 1R9TH 2DGYA 1U8AA 1N8RC 1CTQA 2AKYA 3KDFA 5GADC 1JB7A 1A6XA 4G7HC 3T53B 1P9NA 4YC7A 1CR0A 3TQYA 3PXGA 3QG5A 3ZIAD 5LMUQ 4GN5A 4OO1G 1LYLA 1YJWA 1N0UA 5JJLA 5DLQE 3PFIA 1OKKA 3QKRA 4IOMA 1N6RA 2IYQA 3I5XA 3BG3A 1Z6AA 2DWPA 3M4YA 4LK1C 1M1KC 4DV4L 2OG2A 3K53A 2GZAA 2PL3A 4W5HA 4LUVA 4DV0L 2K4KA 1GZSA 2JJQA 4GKKQ 3CX7A 1H9RA 3EPJA 1LTLA 3DMDA 2ZJ2A 4TMZA 1IBML 3OEEA 5IRCD 4EIWA 1UE7A 2A5GA 2WJGA 2O0KA 2ZTEA 4NPHA 5FOUA 2CHGA 5JS8A 5IP9H 2ZI3A 4CDGA 1WRBA 4A3BH 3HKZE 2R6CA 3PUXA 2ZR7A 3P20A 1RZ3A 2OCBA 3FGNA 3KJEA 3GLFE 3CNLA 3MLEA 5E7MA 5JRZA 1D8TA 1YHAA 4A75A 1XNJA 2JIZD 2ZYTX 2ZM5A 1GL9B 1OXUA 3I4OA 2PLRA 3CUEF 3QEJA 5AUQA 1KO7A 3OIVA 4PAMA 1IJEA 1JI0A 1KDTA 5FPKA 3A36A 3X1WA 1IN7A 1X3GA 3C8UA 2YINC 2IYSA 4OXPA 4K0KQ 1N3BA 5EQTA 2JLYA 1H9MA 4B3TQ 2CNWA 1W49A 1RRCA 4P75A 1VQIA 4JI7Q 2ORVA 4CRWB 3CCMA 4OX9L 1IXRC 1A4RA 4Q47A 4TZ6A 1UDWA 4A15A 1KI6B 3NHAA 1AK2A 1E2GA 4I1VA 2KCMA 2GAOA 4IJMA 1VCOA 5LB2A 3RWOA 4KYUA 3Q72A 2MNAA 2UUAQ 2AK3A 3TQFA 1E2PA 2QQ0A 2ZYVX 2P6RA 4AQYQ 2Z6KC 3P4XA 2VQEQ 1P2TA 2HF8A 2RAPA 2REBA 4UP8A 1G19A 3CR7A 5FBWB 2FSGA 2ZJ8A 2NO1A 1IXSB 3L8ZA 1W48A 4C2UA 3TVDA 3RZOH 2PJRA 3B1YA 4HZUA 3B1WA 5AJZA 4DLWA 1TWAH 4OI0A 3AQQA 3V9PA 1VQ5A 2ZU6A 3QEOA 4BWYA 4LGMA 1VQ6A 5KU1A 1G4UR 1RIFA 2CCGA 1SHKA 4GZYC 4XSHA 3Q7PA 4GNXA 2PMKA 2ZIAA 1GKUB 1BBUA 5EE3A 3UMFA 4EPXA 4ZDKA 1VQLA 2I1QA 4B75A 4L5BA 3OW7A 1K8AC 4ARZA 4H02A 3HKZG 2PZGA 1E1RD 4RZ2A 5CB6A 1E2VA 4C0HA 4WZ6A 2VP0A 4DR5L 2Q2UA 1VG1A 3A1VA 1SMXA 4MGIR 1ZIPA 3BORA 4QY7A 2IEYA 1UEBA 2B63G 3A4LA 3L0PA 4IDNA 2VSFA 2JQOA 1EWIA 3K0XA 1XTKA 3MWLA 5ELXA 3TRZA 1E2ZA 1MV5A 4I99A 1XXHB 4URZR 2OV2A 2WIBA 4TYPA 3ULPA 4Q4AB 1L2FA 4C7OA 1R8QA 2FF7A 2DHRA 2HXYA 1U9IA 3GTKH 1O3YA 3D4RA 3I5YA 4FWTA 4XWAA 4QRHA 2I0QA 4P71A 1Q1QA 4I1SA 2BBWA 2DB3A 4Q9KA 2WWXA 3C16C 2V1XA 2NVQH 1VQ8A 2WV9A 3M4QA 4I4LA 3EC2A 4HR7B 3HU3A 4UXJA 3ND8A 4JT2A 5BN3A 2QBYA 1U0HC 3AVOA 4DLVA 2EQBA 4IKEA 4JKIA 4D81A 1BKDR 2J5XA 2HHHQ 4IOKA 3BFXA 3GJ8A 1JEDA 2DFTA 2XSZD 1ZYUA 2QQEA 3U2QA 1HNXQ 4LHYA 8OHMA 2O52A 1VYUA 1SQ5A 4L8GA 4C0QC 4MNOA 3CRLC 2WTUA 3DEFA 5C0XJ 3UK6A 5HGQA 4X62Q 1PH5A 2IHBA 1P3JA 2IYVA 1N6NA 1YZGA 1Q22A 4HATA 4U7DA 2DWQA 1L0WA 3A0JA 1VQJA 4L5QA 1HV8A 2PEZA 3AH8A 3EZFA 3NH9A 3QBVA 3PQCA 4JBMA 2LWIA 3LWNA 1U5KA 1HNWL 4B73A 3W1GA 1GUNA 1A82A 1B23P 4IJLA 2JK8A 1X1RA 4IPHA 4KITB 2Q3MA 4YHHQ 4XTCS 3SN6A 5LMUL 3CB4A 1HQCA 1Z0JA 1XD2B 2H57A 2W6IA 3M1IA 1PUIA 2GRJA 5DGXA 1MABA 4PSAA 1BMFD 1Z6YA 2A5DA 4GP7A 4ACBA 3RDPA 1HEIA 1TUIA 3AF3A 1GG2A 2YYZA 4LYFA 2FSHA 2GEVA 4B3GA 1HTPA 1GJXA 2IS4A 4HEJA 3KXKA 3VHXA 3SDZA 3QKRB 1NBME 1ZD1A 4TT3D 5AWFC 4E22A 1C0AA 3H86A 1OSNA 3B8HA 4NCJA 3SBDA 4ASUA 5JCZA 2P3SA 3E70C 5E7JA 3T5GA 3I4MG 2WAQG 3OYYA 1NG9A 4LI0A 1D2EA 1N2CE 2WWHA 1P62B 4GOKA 5TV2A 1VDZA 4HJAA 2WM9B 2HT1A 1S4QA 2JLSA 5JI2E 3E0EA 5M3MH 1B7YB 2CMKA 4OWWB 1W44A 5BR8Q 2OCYC 1Q1BA 1TF5A 3A4NA 2EFCB 3SU8A 521PA 3W5IA 3IKJA 2AKWB 1U8YA 2R6GA 1KD1C 2ZRAA 3N5CA 3QF4A 2QAJA 4HAWA 1YQTA 4TLCA 1TMKA 3HR8A 1CI3M 3BH7A 4PHHA 4C7OB 4DCNA 2EDGA 1G8YA 4Q7LA 2UXBQ 1P75A 3ZH9B 3SE0A 3TSWA 3IILA 1Y69U 4B3RQ 3UDXA 1JJVA 3T1YL 1S40A 4BBRH 3BB1A 4RKFA 3DVLA 1CP2A 1JQJC 1T3LA 1EFCA 3BB4A 4DDUA 1J5EQ 3LFUA 4FIDA 1MJEA 2Y0SG 2ZM6Q 1N0VC 2OWOA 4JSYA 3IUYA 1VQKA 1F2UB 2C9OA 2MSCB 3P1JA 3LV8A 1RE0A 1ZM2A 5C18A 2YWHA 4FMCB 1G6HA 3ETLA 4JI6Q 4G5SA 3MSXA 2WPDD 1X3FA 5BYJA 3VR5A 3BZCA 4DK1A 3KLWA 4GT1A 3TUIC 2CJWA 4B33A 2JATA 1MRSA 3RS4A 3I32A 2VSOA 4DIDA 1SXJD 2E9SA 1M8PA 5B57C 3RS2A 4JJKA 2QENA 1F2TB 2H18A 2VRWA 3W5JA 3CMEA 1NF3A 1VG9B 2V54A 2D7CA 2CCJA 3LA6A 3UDFA 4A3LH 1EWQA 4ZDIA 2ZRFA 1XCGB 1A62A 2HJVA 4LV8B 1E1QD 3SS8A 5KUTA 2J46A 4BFWA 3G6EA 1GL7A 1ZC4A 1ZRHA 4LF8Q 3L0SA 3DDCA 4DUYL 1NN5A 3X1ZA 3ZZTA 4TZ0A 1IBKL 2BBTA 1KJWA 4QFMA 1K8RA 4TMWA 4R4OA 2PLFA 4JIMA 2PCJA 2JEAI 3A6PC 3F5FA 4KKSA 1X1SA 3QJYA 2HQLA 4LC1A 4BZPA 4WZBE 3WMFA 4DV2L 1V1QA 5BN4A 3U4VA 1DAGA 1TEXA 2ODNA 2XNSA 2YC4C 3LNNA 3S1RH 1UE5A 1E2DA 3C41J 4EAQA 3WMEA 5DSZA 1R5OA 2IYZA 4P33A 3WDNA 2QM8A 3GLFB 1E2QA 3KB1A 3SFVA 4F4IA 2NVTH 5KPJA 3OF5A 4A8JA 1XNRQ 4C0LA 3PJRA 1WQ1R 1OF1A 3K9NA 1VIYA 1HCZA 1VQEA 1LABA 5BYKA 1H65A 3S15H 1ZUNB 5C0XG 3IIKA 5DE3A 4DK3C 5A0FA 3TBKA 3PIOA 2XZPA 2ORIA 1G51A 2IL1A 3DKVA 1GRRA 4QJ4A 2AD5A 5FBVB 1X9NA 4A3BG 2OBNA 2DFLA 4NCNA 2ZJPA 1YVCA 3OE7A 1Z08A 4KODA 4A3MH 1OFHA 1DAFA 1KSGA 5CYPA 1DARA 4FWIB 1BBWA 3MG9A 4QNRA 3U58A 2P6NA 1Q0UA 3EA5A 5G3ZA 4YXWD 2Q9CA 5KDOA 5FPTA 2GF9A 2A9KA 4IOJA 4MH0R 2VW9A 2C03A 2J7PD 1VCIA 3NWJA 3VX4A 4G01B 4CGZA 1K5DA 1YR6A 2JJ2D 4F7WA 2EQSA 1IBRA 4HIOA 1PZNA 2R6DA 3WRYC 4RKEA 1XU4A 3V4RA 2VP5A 3NC1C 4MUBA 3I92A 4FW9A 2B63H 3K0AB 4M1OA 1SXJB 5DYIA 2A78A 1XMOL 121PA 2A30A 2GK6A 3L82B 4BBSG 5FPHA 3VKGA 4EJSA 1UBGA 3U3OA 4PTLA 1CLUA 2ZRPA 2VLIA 4OWXB 4LRWA 3RN5A 5FTMA 4BGDA 5JJIA 4B3BA 4MDEA 3VR2A 1XPUA 4P72A 2XJ9A 4EUNA 2Z5FA 4ZKDA 4DV3L 4Q9LA 1JXOA 2QGZA 1GRQA 4HLDA 2D5DA 1GP2A 1YRAA 3IHLA 3DZ8A 5IE8A 5B58C 1KQSA 2G77B 1KRSA 3KDFB 1T3SA 2CDNA 3GTGH 4DR3L 1LF0A 2BJWA 3GQBA 5CM9C 3DOFA 1SXJA 2O8EA 4YCVA 2YTYA 1YHQA 1G5PA 1ZD9A 3KX2A 4KFRA 4M22A 4UNSA 3UATA 4MQBA 3V4FA 2QY9A 1XNQQ 4CT5A 4E03A 1FJGQ 1CJTC 3CPWA 4DV6L 2JA1A 2WKPA 1KXLA 3AEZA 1B9NA 2AHOA 2OCPA 4FN5A 1TWHH 2FZLA 4LW1A 3CWQA 5A35A 3K1JA 4LJZC 4LYHA 1P5ZB 2P2LA 4Y7NH 4LWZA 3X1DA 1W0KD 1HTWA 2KBFA 4X8MA 3QPVA 3QQ5A 4MYUA 1MO4A 3STBC 3M3YH 1GM5A 3D8BA 1BIFA 3K8AA 4DV7Q 2ZS7A 1G20E 3AFPA 1Z7TA 3ZVMA 2FGKA 4LF7L 4G1UC 3BD9A 1D9ZA 1EXMA 3HPQA 2BV3A 1CJKC 4PC6A 4TQ9A 4V0OA 4A92A 4A2QA 1KIXA 4PXAA 1LACA 1JAIA 1GWNA 1D2MA 4H1VA 4A36A 4J0QA 4G7ZC 5FTJA 1KZ7B 4ZI3A 4IEEA 5K8UA 2FX3A 2A68C 2BVNA 1HY3A 2NPFA 4DVGA 4EPYA 4IVPA 4FDBA 3ULJA 1ZCAA 1KL9A 2CLSA 4KXFB 2Y8EA 3WNDA 5AUOB 2IX1A 3QKTA 5AJXA 1QZXA 3X1YA 2IXEA 3U60B 2UVQA 1OIVA 2WSMA 3QSYA 1JEEA 3GLHE 1IJFA 1WDTA 1I6HH 2ZS9A 2W0MA 3I7FA 2X1VA 1XZPA 1QVGA 3FPPA 2DY1A 1Y8NB 4MYHA 4LF9L 4HDQB 3EPLA 2BMJA 1TTTA 5L3SA 2WB1E 1LV7A 3W9YA 3AGPA 5HCIA 4ASUD 4DKAC 2C99A 3VA7A 3K0SA 4WAUA 2I5MX 2O8EB 3B1VA 4I81A 4TSFA 1OXTA 2CE7A 1HR0W 1J99A 2GXQA 4LOAA 1X55A 2E5LL 3T1HQ 1U81A 1QUQA 1E2KA 1EUJA 1VS0A 4B3SL 2B6HA 3AEVA 3M4OH 2EFDB 2VBCA 1O87A 3SBEA 1II8B 3TSZA 4LFCQ 1GD7A 3K7UC 2J7PA 4JVMA 2PT5A 4Q1DA 4QC2A 4JLDA 2F3TA 5FBRB 4OX9Q 1RVDA 1T5LA 2HYDA 3PO2H 4W5WA 1K8GA 1NRJB 3LH5A 3OIYA 3R7WB 5JEDA 4Z8YA 2UUBQ 3QPWA 3J81k 4QHTA 2REXB 1M1YE 1U8ZA 3BC1A 2GJAA 2WWFA 5CITA 5EP1A 5HCNA
chains in the Genus database with same CATH superfamily
1NRWA 1OHHA 2JCBA 4B0PA 4PIVA 3VDYA 3LY9A 4KH1A 5I9MA 3FTQA 3OJFA 1KE2A 1M74A 4IUBS 1UZUA 3VPBA 4DE5A 2NN3C 3LX5A 2A59A 2B2YC 3EFBA 1SQFA 3FSEA 3B1XA 3OF2A 4I50B 4KQ1A 5KWJA 4CEIB 1IYZA 1QZHA 3HC7A 5IH7A 2DRIA 2ZJRA 1U8UA 1YNND 4MAAA 1V1OA 1XCOA 3FRJA 1IVYA 5LWQA 3RYCA 2WWVD 5DI3B 2IYRA 3SFZA 1A4XA 2F8TA 3RM3A 1TF2A 3I5UA 4LFBB 5IYDH 3LCVB 5DK6A 3WSTA 2ZATA 4TLAA 4ULLA 1W1IA 1WHSA 1Z4LA 3H17A 4FX2A 5CVEA 1JEQA 3RRXA 3UCEA 4AZ3B 1IE3A 3HG7A 3Q6MA 1CY4A 2K5UA 4HL6A 1YIDA 2Q3HA 3V7UA 1TPZA 5TPWA 2O14A 3ITPA 1ORTA 2RQXA 2H5XA 1THZA 1G4AE 2WYVA 1CSQA 3PPWA 1R10A 3KF8B 5DNDA 4BGVA 2L0CA 5ELNA 1FFSA 2XHZA 3R7FA 2V0NA 2XY4A 3B89A 3BGWA 3UO8B 3QLJA 4KIWA 4B35A 2N55A 4A93H 2EXZA 3AP2A 3MAQA 2CUKA 4R8KA 5D6OA 3QF4B 3E82A 5AESA 5SYAA 3K71B 5AJYA 4RC9A 1JHDA 2FEWB 2CC2A 5I7WA 3M8KA 4RO0A 3KEMA 4RSHA 4ITUA 1IZ9A 2W11A 4KNYA 1CKMA 4CIAA 3SK8A 3I55A 5DNEA 1VQGA 2VYCA 3C7CB 2PT7A 2JLVA 1TM2A 1OZGA 3HDTA 4GBMA 5BMVA 2XTIA 2EZ4A 1VRWA 2WLTA 4EHLA 4RQAA 5KJ6A 3PEFA 2QTLA 2WMYA 2OG1A 4ZPJA 3T9CA 4DY4A 1KO4A 3PJEA 4JB3A 4QBHA 3GGSA 3JD1A 2DQ4A 4K87A 4MPDA 5FUWA 1QNFA 3PVSA 1M2VB 1PFWA 2ECKA 1YWGO 2EFEB 2JLRA 2ZRIA 3OCJA 1WCIB 2I99A 4MYDA 3ERQA 2NO5A 3JQAA 3OOYA 4XYEA 1BVRA 2ID7A 4CLHA 2O5EA 4XEHA 1UBCA 1HRKA 2RHOA 1V7QA 2ZS8A 3L0IB 3Q1KA 2JVIA 1OIWA 4K5WA 2R60A 2VBIA 3H1PA 3V2TA 3LF2A 4J0CA 3B9RA 2BDTA 3B1ZA 4LFAL 4G3XA 4IQGA 4QPNA 1K28A 2IYTA 3NBHA 1V25A 1X80B 2XBUA 1QSGA 1UBNA 2FNAA 1M7BA 4KJNA 2P1RA 5LLDA 2BA1A 2UXDL 2H4JA 3CZPA 3Q9LA 1W9HA 4ZMSA 5GAGC 1ILPA 2PL5A 2VJCA 3BJIC 2XKKA 1ASZA 1SUPA 3FSJX 5ES3A 3COSA 2D0OB 3H6HA 3NBQA 3T4PA 1OGJA 3PGKA 1VKNA 3VHRA 3EVZA 3WJ7A 10MHA 5KGUA 4WH0A 5EIHA 1S4MA 1WOMA 4EPWA 1MNQA 4KWIA 4DCJA 4O2AB 4EKGA 1LSUA 1OD6A 3CCSA 2NU7B 5KYLA 1UKBA 4PONA 5E6SA 3VDXA 4ZICA 4WBNB 3MWGA 2ABWA 1UPUA 4A3IG 1USUA 2CUTA 4LXQA 2BE7A 3FPUB 2YWFA 3TZUA 2AVNA 4LQLA 1QV6A 3T7TA 5D14A 2A2ZA 1CUJA 3R3SA 3EZNA 3EW9A 3HA2A 4OJYA 4WV3A 3SC3A 4PQRA 4MITA 3WNCA 2VATA 1CV2A 1E58A 4PQXA 1FFDA 1T4CA 2Z3VA 3CNHA 1XU7A 3L7BA 2XWJB 4INOA 4K9DA 5HKBA 4DR6L 1NMSA 2X5NA 5JSYA 4DV5B 4NXMB 3I1YA 1UWVA 1JN0A 1A0OA 2Q1YA 2WD7B 3AVQA 4F1JA 3T5PA 4PGFA 1FP7A 2KSQA 4JVSB 1BOSA 2K5QA 2RHQB 4E3ZA 4AJ1A 4O2RA 5CLLA 3OQHA 5HUQA 4LY3A 1B6SA 5KIXA 4TGLA 5KHLB 1TM3E 1KR5A 2OFWA 2OUKA 2YIJA 3NIFB 1GD1O 2YBEA 3MPOA 4ZTUB 2B63B 4YCJA 1EWRA 4UHHA 3R0IA 2R8YA 4QFBA 3DC2A 5C5LA 1M1YA 2BHTA 1WB9A 2EKZA 2ZSEA 3PBKA 3OEYA 5FL3A 4ALNA 3KF6B 4G4SP 2X6GA 4Q05A 4BNNA 3DOCA 5CYFA 1GVPA 1CRZA 1VYTA 1H4QA 2HHHL 4OBBA 1XQ6A 2G1AA 4BUZA 4AG5A 3LQRA 1B15A 2J67A 3OKAA 3ZU5A 3ISVA 1K6JA 1KJ8A 2JA9A 4FDUA 3UOGA 5EJEA 1STOA 2B8NA 4NZYA 3O8RA 2CH4A 4WZBA 3VOTA 4A3JG 1JALA 4P73A 4UP7A 1KZ6A 2AGVA 2IUYA 3KELA 2EKBA 1DL5A 1V1MA 1T91A 2Q4RA 2YRXA 3OG9A 4I5DA 4RHFA 2R1UA 3ELYA 5CM2Z 1SG6A 5C8VA 1PNTA 1XZHA 2PGIA 2B5OA 1HQYE 2QQFA 2DR3A 1JIUA 1WPGA 2GXUA 4I5IA 1KEKA 5L3ZA 1HNZB 1T13A 3HOVB 3IPXA 4GXNA 1ZM7A 2H0RA 1Z73A 3RKSA 3C5WP 1MQ8B 3CLVA 3C1TA 4Y9SA 4KVAA 1E62A 1YAJA 1V5IA 5K4GA 4WBNF 4JOIA 4GR5A 4XR4A 3Q5GA 5B37A 4JYMA 3GARA 2JIZA 2BN4A 4EX5A 2QVYX 2PGDA 2WFAA 4YFVA 5HTOA 2EYHA 4AIMA 1SU7A 1YDGA 3G9UA 1AZPA 1Y98A 2DX7A 2DJIA 5CORA 3P9XA 3X43A 4GKKL 3ZGYA 4DUZB 4PLZA 4FILA 4KUGA 4ER5A 4EI8A 4OPMA 5AD1A 1E0JA 3A7DA 4FUTA 4OH7A 1DSSG 1KKMA 4BKUA 4DJEC 1D07A 1DAHA 1E1LA 2TSSA 4YAUA 5LPNA 1FSSA 1BD3A 2IY8A 2VUHB 4GOMD 4ECEA 2O3UA 1YJ5A 4A3MB 3F47A 4LJYA 2PW7A 4E1VA 2XVSA 2FE4A 3HSKA 3P26A 4ZOAA 2IDMA 2IHFA 2K05A 1E79D 2PN1A 4KMRA 3SJCA 4ZZ0A 4ED9A 2IU4A 4D8UA 3GRKA 5CB8A 3K2IA 1UK7A 3JAKB 1GAJA 2YTVA 2C96A 2IYEA 2YWJA 3DNMA 3VUEA 1X54A 2A9RA 1RAAA 4PHGA 4MUHA 4RMNA 4UZFA 2PW5A 4YIHA 5DHRA 4ARCA 2WABA 1MO6A 4BB9A 1PI3A 3OWXA 1P0FA 4LUZA 1ZUWA 3Q10A 1RLJA 4R68A 3ZX5A 2YR0A 4EJ0A 4TMFA 3GUVA 5JZMA 1EFLA 1OJLA 1T9GR 3AF5A 4MDFA 2HUPA 1G6PA 1UOQA 4MX8A 2IUTA 3NJRA 4Q6BA 2D0PA 3GFTA 2ZUDA 4Y1RB 5FPYA 5IHPA 5JH7B 3CUKA 1E3PA 4OHMA 1FFHA 1W25A 4HRVA 1V8FA 5J2TB 4RK6A 1N6HA 1CERA 2MFIA 1ACMA 4RELA 1A8HA 1J0XO 2Q62A 1AKMA 4PYIA 4HV4A 4LQCA 1ISHA 2X6RA 4CVNA 3SK4A 2WOOA 3F74A 2RH5A 3PK0A 1UKEA 4RKQA 2JP1A 5CLQA 5CV7A 3JTEA 1AUXA 2CXQA 4JXXA 1EUYA 3H3JA 3OZDA 4N40A 2VXBA 3KHTA 2QGNA 3L6OO 4TYNA 3WJ2A 3R0JA 5AK3A 1NFQA 2JD1A 3GJ7A 1MX1A 4NICA 2BDEA 1W6RA 3R5FA 2HRDA 2XYVA 2PQ2A 1URPA 3FWZA 4KRYA 3VOAA 2Q9BA 4RSMA 1RYYA 5K0BA 2N3ZA 3C39A 5IH3A 1X13A 1WUTA 4HAYA 4BU0A 3FTFA 3IPYA 1A9SA 9LDBA 2VTBA 1CSEE 1HFWA 3LUAA 3EEFA 2HM7A 1NTGA 2VXCA 2PUAA 4YONB 1J0CA 1MDBA 2QTFA 5TVKA 4NPAA 1MH1A 1Y3AA 5EP2A 2ZSHA 1Q7YC 1F5NA 2FMMA 2JA8G 4LOLA 4YAEA 2XYQA 1SROA 1LVGA 2IW1A 2IOYA 3LAWA 3OQ6A 3ECSA 5K0LA 2OE2A 5J43A 5FFMA 3HOYG 1SH7A 1EP2B 4RKBA 1ZL2A 2O48X 3BMQA 2GN8A 1B3BA 1QO7A 3HP7A 1DOKA 2C7PA 4X41A 4JBYA 1O95D 5IHXA 1GDDA 3J80A 1UEAB 3J7A5 3AF4A 1BXTA 1T36A 5A1JA 1R8YA 5EIEA 4DJAA 4YRDA 1NC1A 4YEDA 2IKQA 2G88A 3HOVH 1Q50A 2PRKA 3LRTA 3EK2A 5BV0A 2ATIA 4MS3A 3KSRA 1KZGB 1L7MA 1U0OC 3WB9A 3HABA 3I70A 1R6UA 5FBQB 2C77A 3DUWA 4GOPB 1A4UA 2ZIWB 3DDHA 5F2NA 5L40A 3DLLA 2OAQ1 3HFJA 3EA0A 3KYCA 4H7DA 3KYDB 3RI3A 1GN8A 3WWDA 1J8DA 2UUCB 2AD1A 1VCNA 1LNZA 3CNNA 3CKLA 4RZUA 5TQ2A 1BCPC 3N8GA 3PUKA 4PW0A 2PPBC 4B1FA 2F3PA 1HFJA 3AP1A 4JV5Q 2NUBA 3CJTA 2VI5A 4IDHA 4KRFA 2YOHA 2AJTA 2W6ID 3HJRA 2X14A 4DPMA 3TOSA 2V45A 3A1EA 1M2OB 2X8WA 4YRTA 3TIXB 3TVYA 4CLXA 1H9JA 1L1OA 3BK7A 3CCEA 2FW8A 3KWJA 4M1SA 2GPJA 4EYSA 3OZFA 4GSYA 1L7XA 4C3HH 5DTRA 4JI0L 3S99A 5DVZA 4DUYB 1Z8NA 3KCNA 1HNWQ 4NU5A 2VJMA 4KSYA 1NX6A 1KQNA 1OCEA 1KQ3A 2ZCJA 4BGUA 4LGYA 1RMTA 1TMGE 5C35A 2CLEB 1LTBD 1LUZA 5BSFA 4I2NA 4OUDB 5MFZA 3A54A 1RMYA 2BKAA 3IQZA 3T7RA 1ZXLA 1RBMA 1VMKA 4YLYA 1TWGH 1KZYC 4AD8A 4LSGA 4WZAA 1S3GA 1E5QA 2PZUA 1TZMA 2BPOA 2GPWA 3RAJA 2GETA 3C24A 4ZAFA 4XEUA 3K70D 1XBTA 2EWVA 1Q92A 2V9PA 2WF7A 4P80A 2KX7A 3G8DA 4LPKA 4DKXA 4FVTA 1QE3A 4UAGA 3OX2A 1CHQD 1MVNA 2E4XA 2WUDA 4U4AA 3TIIA 4CT4B 1CRQA 1A7JA 3ZHYA 1WDMA 3VYUA 4MGEA 5D85A 5DHFA 5LQNA 1NI4A 1SQ6A 1W4RA 2Q8NA 1RPZA 1XHLA 3JASB 3RUFA 5GM2A 2BDNA 1EFRA 2DSTA 2ZANA 3CJQA 3V1MA 4RZSA 2QX7A 1ZHHA 3QMPA 2WZCA 3OOWA 1U2TA 3PWKA 4NYJQ 4D80A 1P16A 4PZ6A 2PYZA 1HWYA 4GG1A 1P0CA 3ZLTA 4BQPA 1HNNA 3CF0A 1F6WA 4YDQA 3PEWA 4OQXA 3K6SA 4Q93A 4D9IA 3F8TA 3N0WA 1ABEA 5J3BA 4N5LA 3USES 1PTJC 4YY3Q 1T25A 3F3YA 3IL2A 4A3CH 2CBZA 2VT6A 2Y1GA 1WHSB 2EYPA 4KCGA 4LA4A 4MN3A 3OJ0A 4TRNA 5I9TA 3VYWA 4ZAXA 3TDMA 4M0CA 4UDNA 1Y4UA 1KK0A 1UM8A 1CY7A 3IXLA 3ZCUA 4DZRA 5B2EA 3BFJA 3E5RA 1SXPA 2CD7A 2B8WA 1H94A 3K0AA 5TQ0A 4LJ9A 2LZ0A 3D5QA 4DPKA 5HRUA 1Q7GA 2XVXA 3ULLA 1MOZA 4RJIA 1OPXA 5EJIA 3RSZA 5ICGA 2NU9B 1YF3A 1GLNA 2DCUA 4TPKA 1SUIA 3UE0A 2Q5CA 4TLMB 4WNCA 1NOIA 4LNUA 2ZUEA 4KSBA 4ID6A 4N49A 2PRZA 3JATB 3T54A 3KFXA 2OSVA 2HSEA 2VLBA 4KK4A 4MVJP 4YAFA 5B7NA 1MQ9A 2VHVA 4QQNA 2QD4A 1T2DA 4AM8A 3FOCA 3DFMA 3D54D 2E4VA 4TROA 1IUPA 3S7ZA 4NONA 3CC2A 1EDOA 1O97D 2IOQA 2C82A 5FKJA 2UYOA 4F9TA 3OZBA 4PO3X 1XROA 3MJ4A 2QG9A 1T9BA 5DM63 1X3SA 4MB6A 4ARAA 4CNQA 3LFTA 4CDRA 2W6JD 4GQBA 3DKPA 3GCZA 2GFIA 3WLJA 1LTGD 3PR1A 4GOND 2E5WA 4TWIA 4DR6B 2E6KA 4NNJA 4WECA 4JCVE 3PQ7A 3O8QB 3PR3A 4LX8A 5ENVA 3HVHA 4ZOCA 5H1SE 3VTFA 1H2XA 4D79A 5C5DA 2XQVA 2IX0A 3E9HA 5NUCA 4PPNA 5BSRA 4E08A 4OUDA 1GYQA 5DX1A 4C3VA 4DXGA 2R6AA 3MBOA 4HWPA 4C78A 4PLVA 3VC3A 1VZ2A 3NORA 1Z4KA 4RGYA 1CQJB 4DG9A 3LFHA 4RQUA 4CN8A 1SYCA 1ZVKA 1GL3A 3QW4B 4IXDA 1AGRA 1Q0ZA 4NV1A 1WDLA 2IY7A 5HOEA 3JWJA 4NL4H 1TYAE 3I64A 4K7JA 1DXQA 3N0VA 1XZLA 2ZAGA 3R0XA 4JBWA 1B8NA 2AXPA 4W5JA 4P0TA 2FOXA 2JAOA 3FLBA 3LVRE 3QLVC 3K09C 3HBNA 5M3FB 3O38A 3A8IE 2EZ8A 1ZIOA 2WF5A 1TQ8A 4LWCA 3GDHA 2MHVA 4RVCA 2E87A 5JPMC 2H2FA 4FEYA 2UXDB 1N5IA 2H2AA 4HBGA 2M6RA 1QG4A 3THWA 4IGAA 5AW4A 3OT4A 1EUQA 5A2QE 4OWTB 2V0CA 2YQZA 4HCSA 4MCIA 2Z83A 3G4SA 1W88B 4IUVA 4KQEA 2HZBA 1OWPA 5FHQA 4IDAA 3TOCA 3JZAA 3NNDA 1UT6A 1WWKA 2W22A 5KAPA 3REQA 2CMDA 1MXFA 2I4NA 2R5WA 2VKQA 3EG5A 2QT0A 3ISTA 3P9PA 3S2HH 2ZFUA 4WD3A 4C20A 4HMPA 3LBYA 4KV6A 1W5AA 2VHEA 1Z0FA 2C95A 1WDKA 4HGYA 3V7WA 3K81C 2QM3A 3C8MA 4QBIA 3QG1A 1CJMA 1H1TA 1U7UA 4GC5A 3I3SR 3K0KA 2OXTA 1QZZA 4FFLA 5AM5A 1MI2A 4CIBA 4ZJUA 4UUBA 3VZCA 3ZJ4A 2JRLA 1A2TA 1EHYA 2G5GX 1V2HE 3WDLA 2DGDA 3CQZH 4GI2A 5IAOA 1E6EA 4K81B 4LK2A 1J1UA 3OC0A 1TF7A 3WK9A 5J4HA 3OJCA 5ICSA 3A6ZA 2G6BA 3EQ9A 2PKYX 4N6GA 3LL7A 3VU0A 4CM8B 3OHSX 3CCUA 2KW5A 2W2MA 2FMCA 4NXML 2IP2A 4R4TA 1FUKA 1MBZA 2ODTX 4M0PA 3B7WA 5H68A 4B3XA 5IF9A 1VBMA 5JW6A 1OX6A 3U4IA 5K1ZA 4AYBE 1Q0LA 1PO7A 1T0IA 4ZRNA 1T4CB 4BO3A 3F1ZA 1L5RA 1P4AA 3HJCA 3NKLA 1DIBA 3OFKA 1L5YA 3EHDA 1Q8KA 4GZ6A 3Q0IA 2D1FA 5TEWA 2NO0A 1BMDA 3M6LA 4DAOA 1DJRD 2Y66A 1SBYA 3UI2A 2HKIA 5DAUA 3AG5A 1J9OA 2PQAB 1C3EA 2G76A 3H0EA 5KNBA 3GV3A 4M8LA 5D84A 3W5HA 4FF1A 2LW7A 2FCAA 5A9SA 4MO2A 3GEDA 2PKEA 2PT9A 1SBCA 2Z57A 3DTTA 3KXIA 4AK9A 4B09A 2HK7A 2JLZA 1FX0B 4Z99A 1A1SA 5HQ3B 1YE5A 1WUKS 4LFAQ 2JA8H 4Q39A 4WRRA 1BEUB 3FNGA 5SZJA 3LP6A 5HW0A 1R6XA 3GT4A 5MN5A 4BZWA 3WDMA 2OTJA 2BFWA 1USWA 3SQXA 3A6EA 4NYMR 4F87A 1N34Q 3JAML 4KXVA 2QX6A 1U4SA 3KWMA 3CP0A 4JB0A 3G5LA 1KYWA 6NULA 3O2NA 4ZOQI 4HF7A 4MWOA 2EX1A 2WWIA 3EVCA 3HEAA 2G6TA 1Q7TA 3GUZA 2JLQA 3LY7A 4HZIA 4PFQA 3RYTC 1JHPA 1HH2P 3HVUA 2F0IA 4C7JA 5IJ9A 4CEJA 2G63A 3EUFA 3QV1A 3WICA 1GA1A 2WVHA 5BNIA 4DR7L 1K63A 3B2EA 4KR6A 4I9GA 3CF5A 4C9BA 1HK7A 2P3QA 4C4XA 2O19A 2VDLB 4UPAA 3EBEA 2DFVA 2NADA 1QK4A 2V7VA 3DPIA 3A1SA 3JAME 1QDLB 2WU1A 2PMEA 2WKQA 3BL6A 3LHSA 1UXJA 1GAQA 4E12A 3H5RA 1CUIA 2HQOA 1YH3A 1LPAB 3K0EA 1U0RA 4KFCA 2B2VA 4GZ3A 1FPQA 1YGYA 4B32A 4PNYA 3ZQ4A 1U8TA 3PEVA 1PS0A 3BN3A 4XQCA 4IOCA 2JFNA 1V26A 2E8GA 1ZJ6A 1IMJA 2VH5R 4R0VA 5GJWC 1OXBB 4LIPD 4ZT3A 3CC7A 1T29A 2PQ0A 4NYMQ 3TMKA 4AN4A 1CE8B 1RLTA 2IZ1A 1HH4A 3G8CA 3NC4A 4R2JA 2VP9A 1RAFA 1MBYA 3DOEA 4J91A 3H4TA 5LDDC 3R76A 1HETA 3KLPX 4HDAA 3E9DA 1EP3B 1T2UA 3GH1A 1PSZA 4KAXA 3HCFA 1YTLA 4LJKA 5IT5A 3AETA 3HZRA 2DC1A 3HDJA 1KRXA 2ZYAA 1VHLA 4MRPA 3GEEA 6YASA 3CZRA 4QXOA 4QU9A 1BO6A 3B51X 3C3EA 4Q7EA 4TKUB 2J9FB 2IW3A 1ADGA 1CR1A 2W0SA 3JQDA 4UD6A 2FPKA 3HKEA 1CSPA 3BDIA 2UUAB 3HADA</