3PUXA

Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
371
structure length
371
Chain Sequence
ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPGVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Snapshots of the maltose transporter during ATP hydrolysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/transport protein
molecule keywords Maltose-binding periplasmic protein
total genus 104
structure length 371
sequence length 371
chains with identical sequence B
ec nomenclature ec 7.5.2.1: ABC-type maltose transporter.
pdb deposition date 2010-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3puxA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3puxA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3puxA01
5IY0A 4G7ZC 3NELA 4QY7A 4JBJA 3CCRA 2PI2E 1E2ZA 1CKNB 4GN3B 2OSBA 4OHZA 5FBRB 1Z6YA 3A6PC 4A3BH 1Z3IX 5IYBH 3WRYC 1VPLA 3I7FA 1PFSA 4DK3C 3ND9A 1M7HA 4K0KL 2R6CA 3QXCA 5IP7G 4OQFA 3I4NG 4LJ5A 1MIUA 3SQWA 2W58A 5GJBA 3C8UA 1KDPA 1CIPA 2YHSA 4FDBA 4MGZR 2W00A 4F38A 4LUCA 4B75A 4HIKA 2MNAA 1QJOA 5JMTA 2CJWA 4DR5L 5FOSA 4MITA 2CMKA 2Z6KA 3RLFA 3O47A 1SKYB 4YY3Q 2CNWA 5C2JB 4MDEA 1X1SA 2DN8A 5EE1A 2K50A 5CM8B 4R71A 3LA6A 1VMAA 4WBSA 2VHTA 2L5TA 1J6QA 1QHSA 5FR2A 4HR7B 1I3QH 4B2LA 1EX6A 3NDBB 3AP3A 2A1AA 3A36A 5C4XH 3BFVA 4HB2A 3TAHA 3BZCA 1FQKA 2K14A 3K7AH 3ZQ6A 4AKGA 1KK3A 3WYFA 3PJRA 4B3RL 4C30A 3B1XA 4O3MA 1T5EA 2GVZC 2HJVA 1G6PA 4BECA 2QL6A 3K9NA 2A69D 2UXBQ 2IHYA 1E2IA 2Q0HA 4KFTA 5L3RA 1LFDB 2GHIA 1RYFA 1UBEA 4JIMA 4DV4Q 4LJZC 2YU9H 1ZP6A 4LFAL 3PXGA 5BWMA 2RGBA 1M2OB 1JR3E 3IEVA 4U02A 3A1UA 2VP9A 4IXMA 1R8QA 4DV1Q 1OKKD 1WRBA 3CRMA 1FOEB 4KYIB 4II7A 2HCBA 3OIYA 4Q48A 1KC8C 1AZSC 1GUNA 3T06B 3Q5EA 3W90A 3NVAA 4OX9Q 5KSYA 4BA1I 3KDFB 2QQEA 3NH6A 3I62A 4IFDI 1IBML 2JIZD 2R7ZG 1KO5A 1W3SA 1WE2A 2VP0A 3SBEA 4GNXC 2H5EA 4A3JG 5CLLA 3T34A 1W47A 1TEVA 1IYVA 5IYDG 2OAP1 3EPJA 1OTCA 1TUIA 4QBHA 3CBQA 4ASUD 4B6EA 1NKTA 3TH5A 2ZR7A 2WP8J 4DDVA 3ZVMA 3NBYC 2AFHE 3I4LA 5IYDH 1YJNA 3I32A 2NVYH 4A3LG 3BK7A 4LV5B 1NMFA 4QOSA 1UM8A 3S1AA 4PO9A 3DPUA 4US2R 3AVWA 1XXHB 5JCPA 3T1HQ 2HF9A 1IZ6A 3GLIE 4C0SA 3M4YA 1TF2A 4DR4Q 2XNSA 4R4OA 2OFXA 1CTQA 5JHGB 3UDIA 3GFPA 5AWFC 1OXXK 4X62L 3AUXA 4LJYA 3MFYA 3HOZH 5FBLB 3CPFA 3I4NH 5A35A 1BIFA 1K0RA 4QGUA 1KJYA 1S9DA 1K5DA 1E9FA 3AVXA 4PPNA 2Q2IA 1XCPA 1AGRA 1WCMH 2BIFA 4M1YA 3RSOA 4A76A 4B32A 1KSFX 3RC8A 1OV4A 2DY1A 3QXJA 4PSKA 5FBVB 4JVNA 1JJCB 4A3LH 1Q20A 4NB3A 2JAQA 3BJIC 1GG2A 2ZIAA 2VUMG 2ZS8A 1C9KA 4TMXA 1OFHA 2ASEA 1QHIA 1Z29A 3A8KE 3SN6A 3ZZTA 2PBRA 4EKDA 4JLBA 2XSZD 3FVQA 1GKYA 2NN6H 4WA7A 3QVVA 2EFHB 2ERYA 2DFKB 1BYIA 1CSPA 4A0FA 3JAMi 3WRXC 4DUYQ 1V8QA 4IHQA 3QKSA 5CK5A 2FG5A 1KI1A 4K46A 4M9SA 1DOAA 4LYAA 4LF9L 5GJVC 3SNHA 1NG9A 2O8EB 5ANRB 2PZGA 1Z0AA 3HKZE 1N34L 2W83A 1TU3A 2BJWA 5G41A 1D8LA 1N0UA 4LHYA 3ZYCA 2VZAA 5IK2A 3RRYA 5BN5A 1RFLA 2PEYA 3F3YA 1SVIA 3OEEA 4RD1A 2C8VA 4F91B 1SHZA 4JK1C 2J9RA 4PHHA 1SHKA 1VG1A 1SXJE 2C9OA 1PH8A 1N36Q 1PH3A 1NN1A 1ONLA 1RZ3A 4DV3L 4O0AA 2G88A 1W0JA 1YE8A 4BLQA 4NCHA 2IS4A 1YNJC 3KJEA 4QJ4A 1BKBA 2PX0A 3TW4A 4HYYA 1W0JD 3UE0A 1VQJA 4Z8YA 3K8AA 3RR5A 4RG1A 4WZAE 3C7KA 1G8HA 1KSHA 5EP3A 4HJAA 5E7IA 2WJHA 3PG5A 4KLNA 4LF4Q 4DR1Q 3AVOA 1Y1WG 3AKDA 1ZUHA 3GEEA 4IFBA 4A3IG 4TZ6A 5K8IA 1OIXA 1H65A 1SKYE 1YZTA 1T4GA 2QORA 4ZIRB 5FJ8H 4YCVA 5HPYB 3QY0A 2ZYWX 3CH4B 3LW7A 2W0MA 4BBSG 4RD6A 5EXXA 6Q21A 4AH6A 2HHHL 5KYKA 3OEHD 4NPSA 4NCIA 2MMCA 3HWSA 4L5QA 1Z6XA 1FGUA 2XGTA 3VNUA 3RS5A 1NMXA 2ATVA 4OJKA 1XTRA 3QF4B 3D4RA 5C1BA 3VR5A 1C9OA 2ORIA 1HNZQ 3IIMA 4QG7A 3P26A 5E95A 3SFZA 1M6NA 5AJXA 3UXMA 3HOVH 5F9HA 4B3GA 3EBEA 3S14H 2Z43A 2C99A 3I92A 1DE0A 2NMVA 5DYGA 1NVVQ 3Q85A 2NVTH 3NIBA 4IJMA 1EFRA 3BAFA 1P61B 2YV5A 1NF3A 2EYQA 2MSEB 4NONA 4B3TQ 4Q4LA 3NH9A 3U4QA 4DUGA 4CEJA 4DV5Q 3EWSA 2Q2HA 2FGJA 3DVLA 3T61A 4KVGA 4O25A 3VFDA 1IY0A 1R0WA 2BA0A 4GN5A 1P75A 3PO3H 4QFMA 3A0JA 1H9SB 1HQMC 4DIDA 4EPXA 1YHAA 4AKEA 4C2MH 2AUJD 2J45A 1Q12A 2UUAQ 2ZJYA 4DC9A 1K5GA 3B60A 5IT9c 4DR3Q 2ZRJA 2IXEA 4GI7A 1AA9A 2WSSD 3OF5A 4NTZA 1GSIA 4D0GA 2W2TA 1N6PA 5KDOA 3ZLJA 4FMDF 4WVFA 3GLGB 1UKYA 3RVBA 4RD2A 4C0LA 3CF5A 4LUZA 2ONKA 4UP8A 5AUQA 2VHQA 5A5GA 2BH2A 1SFOH 4Q19A 2BMDA 2WWYA 1OYYA 2IYVA 4GP6A 2CWAA 4JT2A 1TUEA 1PH5A 2F4VL 1EFTA 1LS1A 4A3KG 3AEVA 4JL5A 3ZVLA 4Q9IA 1CP2A 3LWUA 2GK7A 4NMMA 3PO2G 4URUR 4OI0A 1PH4A 2GKSA 4Q02A 3K9HA 1H8HA 2IL1A 1XJQA 3TR0A 3EPHA 4JI3L 4KHPL 2C9CA 4RVCA 2O8FB 3B82A 3L0OA 1G3UA 2ZU0C 4M1OA 4ZV4A 1QHXA 3ULPA 1B0UA 1CU1A 1QHHA 2ATXA 2ZQ5A 4HDCA 1LTLA 3CZQA 1YRBA 4BY7H 3U7HB 1S3GA 4M1KA 3QKRA 3X1WA 8OHMA 3KLWA 3D7MA 4S2EA 3E70C 2YOHA 4HAZA 2RCNA 1IJFA 4JLKA 4C0JA 3F2CA 1MJEA 1G5TA 4L9WA 1YJ9A 1UAAA 1CR4A 1TF5A 1RVDA 2BMEA 4G5RA 2XSZA 2ZJ8A 3U3KA 2F1MA 1Z2CA 3GFOA 3LXXA 1WBDA 3STBC 1XMOQ 2D4HA 3RNUA 3GJ5A 1Q7YC 3KDSE 1JQJC 4R7ZA 4F4CA 4IPHA 4H02A 3S24A 1XPUA 1TQ6A 1XMQQ 1HR0Q 2WKQA 3BORA 5JLJA 3NTUA 1CULC 3NBZC 4KITB 4BFYA 2FSIA 5CM9C 4AIIA 1T8TA 1JPNA 5HE8A 2WFWA 5LB4A 2QAJA 5LMUL 1PUIA 1HNXL 2IYXA 2NO0A 4IOMA 5FPHA 1XZQA 2EVBA 2ZS9A 2IEYA 3EN2A 4KFSA 5FOXA 3SHWA 1N5KA 1R8SA 4H0LC 1HR0W 1G8PA 3ZS9A 2GNOA 1VIAA 2ZU6A 1PHJA 2IK8A 4ILEA 5DLQC 1W36D 3FMPB 4B3DA 1KDOA 1IBLQ 4PQFA 1N6IA 2WJJA 1YZKA 3HU1A 2VUMH 2GK6A 3QI2A 4JCVE 5LMNL 2EXDA 1ZNWA 5C44H 4GLXA 3O8BA 4MA4A 2JJ1D 3EIHA 2H1LA 2CL6X 4QL3A 5HY6A 4PPQA 3TW8B 5C4MA 3WHLA 2R62A 5JWOA 1DVRA 3IO3A 1KD1C 1ZM3A 2D2EA 5H8WA 3PCRB 2N1BA 1G3QA 4HUQB 4HAUA 2GVBA 2E2HH 5CDFA 1N0VC 3U6KA 4TQ9A 1GD7A 3U44A 2OILA 2DB3A 1XTJA 4TKOB 2IS2A 2MFIA 4KKTA 2D62A 3FMIA 5KDLA 4JBKA 2JIZA 2OO7A 4A36A 1NN0A 4PC6A 2C98A 1E2KA 4M1WA 3STBD 1FR3A 2WIBA 3CWQA 3A1WA 4AG5A 2VP5A 3CF6R 2VTKA 3CO5A 3EW9A 5CJPA 4OI1A 1E9BA 1HE8B 3U4QB 1SRUA 2CE7A 1PMRA 2AX4A 4PC2A 5JS8A 1EESA 1BYUA 2FSGA 2NGRA 4JS0A 1VQLA 3W8RA 1FJGL 4TYNA 4HJ9A 1E0AA 2A8VA 3MGCA 5TVKA 3I2ZA 4GBMA 1N33L 2KWIA 4A2PA 4OWXB 4LYFA 4QBGB 3LDAA 3B6YA 4GDFA 1BDOA 1CLUA 5KNBA 1FP6A 2NO9A 4BRUA 1Z83A 4UP9A 2WPDD 2BMJA 3IIKA 5LMUQ 4DV2Q 2XNDA 3HOWG 3AF0A 3AQ4A 3CH5A 5FLMH 1H8ED 1E96A 2J46A 2PZEA 1JJ2A 2V6JA 3DMNA 4POGA 4KLZA 3GLFB 1EK0A 2WPDA 4JVSB 3I61A 4PHGA 2Z5FA 4D0LB 2DNCA 2J0SA 1S72A 1E1RA 3U7EB 1X86B 1SXJC 3VR1A 4GFDA 3FKQA 1XMOL 1F2UA 4HB0A 5GADl 5JJLA 2YTXA 5G40A 4DUZL 5SZJA 3J7ZC 1KIMA 2ZE8A 1TADA 5M5XH 1DAIA 1O3YA 3DDCA 1MKHA 4HZIA 1E9CA 1E2FA 2VQFQ 1U99A 4ZDJA 3HKZG 1J90A 1XTSA 2QT0A 3U6BA 2A5FA 5JRJA 2RGDA 5GADC 4ITRC 2JLRA 3X1XA 4IFEA 3AFQA 2VO1A 1CRPA 1YNXA 1GP2A 1DCZA 4EIWA 2XTMA 5HKKD 1LS6A 4DR6Q 2WKPA 4P71A 3KLRA 4OKSA 2QAGB 3FWYA 4JJKA 1HNWQ 3QKRB 4Q1AA 4XSGA 2A9KA 2J0UA 3HU3A 4JJZA 4IJLA 1RJ9A 4Z54A 4YQFA 3C16C 4DCUA 3HFZB 3KFVA 4TL8A 1HT1E 3OAAD 1L1OB 1VS0A 4JV5Q 1IHUA 3UDXA 4M21A 3PQCA 4GS3A 2W6ID 2O8BB 4DR2L 2UUBL 2B21A 1BOFA 2J0VA 3B1VA 4TMVA 4BZQA 4PZLA 4MKIA 4WIAA 1G3IA 5L3VA 1ZUNB 4C3JH 1UJ2A 3GJXC 3KJGA 4J15A 1D2NA 2B7BA 3LLMA 2Y8EA 3MWJA 4P74A 1A62A 5BR8Q 1Q1BA 4DV7L 2UUCQ 1D2EA 1G4AE 1L4YA 3EIVA 3IPXA 4DK0A 1IL2A 4FIDA 2X2FA 2QTFA 1KDRA 2VS1A 1ONBA 5FTNA 1G7CA 4EJSC 5J4YA 1YJ5A 3LNCA 1YR7A 4A1FA 1GZSA 3N2IA 1E1QD 2XNDD 1L2FA 1M1KC 1BS1A 2E5LL 2IX0A 2OCYC 4PC1A 1H9JA 4QHSA 4EFNA 2K33A 3CRLC 4GZMA 4RMFA 2X1VA 2JA1A 3ZD6A 3CPEA 5GROA 4GNXA 2JA7H 3A5ZB 3AGPA 3NXSA 1BVSA 3WMEA 5SZKB 2KJQA 3MWLA 1I4TD 4LPKA 1QZGA 4OQNA 3CMAA 4D4MA 4GKKL 3TGPA 3GLIB 3E9HA 1KL9A 1W2HA 2A3RA 1VQEA 1XMSA 5CITA 1ZRHA 3EZ9A 2QUZA 4G01B 4JYBA 4QJFA 1ODFA 3K81C 3CAMA 5B2ZA 3KKQA 4A3CH 2YINC 2JQOA 3A8JE 3TZUA 1MKYA 1E6CA 3FMFA 2EWVA 1GWNA 1RRCA 3THWA 2PX3A 2R6DA 1SZPA 2G3YA 4QNRA 1YR6A 2F1JA 1VG9B 4PZ8A 1XPRA 2FFHA 3UMSA 2YC2C 4FMCF 1OH8A 4HIDA 4IOAA 2FFAA 1M8PA 4HLUC 4A6XA 1J2JA 2GJAA 1II8B 2KCMA 1E2DA 1GNQA 2AN9A 2RH5A 4TYQA 2Q9AA 2N3SA 4NCJA 2IWRA 2IYLD 3CMEA 3CX7A 4A6PA 4DCSA 3DM5A 1TXYA 2OCEA 1VQ7A 1GKIA 1J8YF 1FX0A 3PR1A 2ZJQA 2GCOA 4JZKA 4BWYA 2UU9L 1FZQA 1E2QA 1I6VC 2ZRMA 2A6ED 2R6GA 2ANCA 1Q1ZA 3RRZA 2GCOB 2K5HA 3GTLH 4Q4AA 5AJ3L 1E2MA 1ZNYA 4AYXA 1D8TA 2ZRDA 4YLGA 2B92A 5ELNA 3W5IA 4P4UA 2XXAB 4LSGA 1N36L 3SEAA 1UBGA 3HOZG 2ZRPA 4IVRA 4LOAA 2OAQ1 5FPTA 5J4HA 2AD5A 3UPUA 1XCGB 2CVHA 4X65L 1N6RA 2FXQA 2KE5A 1ZIPA 1G41A 1KI3A 1WDTA 3Q7QA 4Q1FA 1I94L 4ARZB 1I5FA 4MDFA 5CDFE 1E2NA 1Z07A 2GZHA 2QGNA 3LX5A 1FW6A 3WWVA 2VSOA 5JCZA 1N34Q 4HAYA 3A7AB 3RS2A 2QQ0A 4DSNA 1XTDA 4N3NA 1XNQQ 4BY1G 4JI7Q 3THOA 1XU4A 2GCNA 4PR0A 4PSAA 2BDTA 1KIXA 2UXDQ 3ZGXA 1Z0KA 3ER0A 2IW3A 2GZAA 4NBSA 4M4SA 3FYHA 5IF9A 3BG3A 1HZCA 1F2TB 1WCV1 1E9RA 2ES2A 4A93H 1VQ4A 4TMTA 2J0UB 3G4SA 3DKPA 4B6FA 4KKUA 2FJUA 4MGIR 1MO5A 1DAKA 1S9HA 1JNYA 3SR0A 2WAXA 4XH9B 3M0EA 4TLCA 1RPZA 2F52A 1NKSA 4TL7A 1U81A 3S17H 1W1WA 2NZOA 4U5XA 3WYAA 4URXR 4US1R 3DOFA 4HDOB 4JBXA 1KHIA 3BFKA 2Q9CA 4GNKA 4BUJA 3THXA 1S40A 4TTPA 1OE0A 4P32A 4I1UA 1E0JA 1X3EA 1SXJB 1JR3D 5CK4A 1VQIA 1G7RA 2VSXA 3MAAC 4Y0VA 2WWHA 4M9ZA 4M53A 3HPRA 4OL0A 1FX0B 4W5WA 3RDPA 1XRJA 4Q4JB 4B44A 5FPSA 2E87A 3QQ5A 2HXYA 4DDUA 2J5XA 3U4ZA 3T1YL 4TWZA 3EA5A 5C4JH 2K5UA 5AUPB 3I4MG 1AH9A 5C18A 1TKWB 2PLRA 1AQYA 2J59A 2FDCA 1VCMA 2ZJOA 4YMUA 4LF7Q 1CJVC 1JEDA 2WWWA 2ZSBA 4DLYA 2P6UA 3BZKA 4HLUA 1G21E 3TLXA 3L2PA 4DUGD 1XBTA 2QN6A 4RKEA 1N6OA 5JWRA 2JLVA 2HV8A 2CDNA 4W5JA 3Q9LA 5FFMA 5J4VA 3KX2A 5F2EA 1W2GA 2CVFA 5KHOC 1WP9A 4OWTB 1XJVA 1A8VA 3LAWA 4MYTA 2GTPA 4V02A 5EXPA 4L5TA 1GOTA 4WJ3M 5AUNB 5JRZA 3CW2A 4MUAA 1GNPA 4LYJA 3ICEA 1TWHH 3RN5A 2GEUA 2ZM6L 4R9UC 4JOIA 3KB2A 4RD0A 2ATWA 2HEIA 2B7CA 3M9BA 3C4JA 2RHQB 4L15A 1KMHB 3FB4A 4FWTA 2QA5A 4LNQA 3M3YH 1YVDA 4DV4L 1UDWA 1A1VA 4CEIA 4AQYL 1Z06A 3QF4A 3B1WA 3MCAA 4BLTA 2J1LA 3GQBA 1JR6A 3IQXA 4CEIB 1R9TH 1W5TA 2ZSAA 1HQYE 2GEVA 2R92H 4RSGA 1B9MA 4TT3D 3QEJA 3P20A 2KBNA 3W1BA 2YWHA 1X8JA 4JI0L 1OFTA 1SVLA 3W3AA 3K80C 2OCBA 1T3SA 2WICA 2E5LQ 4TT3A 4YXWD 4JI7L 2WZQA 3W1GA 4PZYA 4CEJB 1H9KA 1CSQA 2NOAA 4JLJA 2O8DB 2FNAA 1QG2A 3J80i 2AR7A 2LKDA 3N5CA 2B8TA 3AF4A 2BE5D 2IXFA 1IJEA 1KI9A 4OBEA 3V4RA 2CKZB 4RCZA 5BR8L 1JAIA 3T5DA 4P72A 3WDNA 1YIJA 2BOVA 2GJ9A 4LZZA 1HV8A 4DR5Q 1U8YA 3ONWA 3EQLC 3PUWA 1KAGA 2C78A 1WFQA 2GBLA 3CB4A 4C0QC 5K8TA 1E3MA 3H0KA 4RFSB 1G5RA 3S2DH 5G53C 4L5RC 2JXMB 3CCMA 3S1NH 2SHKA 2WHXA 4PX9A 3U44B 3CC4A 2IY5B 2UU9Q 3EXAA 4OHXA 1B70B 3EC1A 1U9IC 3BIFA 1ZCAA 521PA 4GKJL 3T5GA 2R7DA 1ZC4A 1OXUA 3FPAA 1KI2A 4OQLA 1HQCA 2ZR0A 4PO1A 5EXSA 2NO7A 4B3BA 1R0ZA 4DR6L 2V7QD 2PQAB 3UMFA 3WBKA 4QQBX 1IN6A 2ZTSA 4C7OB 3M1IA 1G16A 2DBYA 2ZM5A 2O8EA 3LH5A 1RRGA 3FKSD 1UEBA 3NHBA 4NYIR 4ZO4A 4URZR 2Q8IB 1IYUA 4FXPA 1DD2A 1EWHA 1Q46A 1QUQB 1J8MF 2OZEA 1NI3A 3CCUA 2VA8A 2Z6VA 4GOPA 3G5UA 5JHHB 1KNXA 2JLYA 4NH0A 1S3OA 3P4YA 3F1ZA 1E22A 2VBCA 1P2VA 5FOVA 3LRPA 1U8ZA 1ASYA 1E7ZA 1UKVY 1EQRA 4P75A 1DAMA 4B3MQ 4TLDA 3I56A 1IXZA 4DV6Q 2A5YB 3IQWA 1EQQA 1TU4A 4NU0A 2FN4A 2ZREA 4LJAA 3VHLB 1W44A 1K8AC 2ZRFA 1DTSA 4BBRG 3K70C 4AG6A 2ZRAA 1E3PA 4RY2A 3CCQA 1LABA 4JI0Q 3X1DA 5FL7A 3AM1A 1SMYC 2CCJA 1M34E 3KJPA 2OEPA 4MYHA 1G8FA 1OH7A 1YBYA 3NEJA 2BCGY 4PHTA 3VA7A 1QZXA 1KO7A 1PLJA 2EJGC 4AQYQ 4V0OA 4QJ3A 3MD0A 4DLWA 2CQOA 4IVPA 3AGQA 3B9QA 2QPTA 2ZI9A 4YONB 5M3FH 4DV7Q 4KLKA 2EJFC 2UUCL 1K8RA 2QU8A 3NEYA 3KTAB 1ZIOA 4GT1A 1VQGA 4FMDB 4M2LA 4DK6C 3T56B 1E2JA 2IS6A 3HR7A 4A93G 1UBCA 1F60A 3HOXH 2G1JA 4HSEA 5HE9A 3U60B 4NXMQ 1C1YA 1OW3B 1Z0JA 4LV8B 2LXJA 3GJ4A 3PSIA 1N5IA 1FQJA 5JI2E 2LMCB 4JI1L 1PUJA 1CFMA 4IDQA 4JYAQ 3CNOA 2G0TA 1GITA 4URWR 4KYUA 1NLZA 3SYLA 4JLAA 1V5WA 1BBWA 1VDZA 4I1VA 4K8OA 4LF8L 2I1QA 1J70A 1ZYRC 1XTKA 1YZNA 4NXNQ 1N6LA 2A5JA 3AEZA 3VQTA 1Q1QA 1MABB 5KUTA 1TAGA 2IF0A 3W34A 1OH5A 3IHWA 5FI0B 1YZ6A 1AGPA 5BYJA 1IBLL 4YMVA 1G3MA 3GP8A 2UZ3A 2WTUA 3S1AB 2XGJA 3M4OH 1NVUQ 2W2VA 4MRVA 3MLEA 4XWAA 5JEDA 2XZLA 2A6HD 1QDEA 1PA6A 4JBWA 1Z2AA 3KYHC 2ZI5A 3CX8A 2VQFL 4A2WA 2PCJA 3NENA 4BXXH 1NMZA 2NG1A 3BB3A 1T6NA 3F0TA 2JLXA 3BRWD 3GLFE 4YMTA 3H84A 3LY5A 1AS0A 3B1YA 4DEYA 4DUZQ 1MV5A 2CLCX 4HZUA 4DLRA 1OXSC 4NCNA 4WZBE 3KQHA 1AQUA 3KKOA 1XB2A 2QENA 4DKAC 1QHNA 2OXRA 4U00A 3TRFA 3GJ6A 1EWRA 3G48A 1CUKA 2K52A 5CIQA 3ADDA 2VHJA 3GEHA 4YCWA 3ASYA 4LHZA 1F2UB 2KHIA 2ZRKA 4B73A 2B8FA 2Q3HA 3IUYA 1QHGA 3PCOB 4D6PA 4GL2A 1MO4A 1YU9A 4BFWA 1R4AA 3EIQA 3SYKA 4KN4C 2AHOA 4IFDJ 1GAJA 2EIFA 3SZRA 1IW7C 1S2MA 4V0ME 1YR9A 4PAOA 5AJYA 5DHAA 1XNQL 2BEKA 2IUTA 3C5CA 3D8BA 3PUVA 3S15H 1E99A 3CPJB 1O7IA 1T3LA 3L82B 3CIOA 1FMJA 2ID0A 2D2FA 4KBFA 5L3QB 3FMOB 4FMCB 4HB3A 3QE0A 4NYMR 2IYQA 3SJBA 4YC7A 3V00A 5J4LA 1JB7A 2R7FA 1IY1A 3G6EA 5ELXA 2ORWA 4LK2A 4JVLA 2WOJA 3E2IA 5DN6D 2BHRA 3DMDA 1NBMA 2GBLC 1IQPA 2ZUCA 2FSHA 1OSNA 1T9HA 4NXML 1KTVA 1KNQA 1P9WA 3L43A 4A3EH 3FHOA 2EFCB 2GJ8A 4QL5A 2IYYA 1TNDA 2ZRLA 3ZZUA 2P67A 3OE7D 3SYNA 3X1YA 2G0NA 3TE6A 1IAQA 3VNVA 1BKDR 1ZYUA 1H9RA 4N1AA 4TMZA 4BFZA 1OJLA 4LRWA 2FWRA 3HYRA 1G64A 4QXAA 2BA1A 2LWIA 3J81c 1NBMD 3LLUA 4JYCA 3QG1A 1MT0A 4AY2A 2Y0SG 2ZRNA 1ZD8A 1IXRA 4DV0Q 4HZUB 3GTOH 3CF0A 4CT5A 1Y8OB 1X9NA 4CF7A 1NN3A 5DSZA 4P73A 3G71A 2GXUA 4GNXB 1OYWA 1HPCA 4L8JA 1NSFA 2D3WA 4G5OA 4G7HC 2NZHA 4AK9A 5IK2D 2EJMA 2JJ2D 4FCWA 5LD2C 2PZFA 4JLDA 1VHTA 2QTVB 4TN1A 1XP8A 3U61B 1J5EL 1Q0UA 3NG1A 2BEJA 1EIYB 2NIPA 3CD6A 2X2EA 3F2DA 3BD9A 3GLHB 4D25A 1ESNA 2ZTEA 3B6EA 3GCGA 4HUQA 4I7ZC 4OO1G 4OJQA 2JLZA 1JJGA 1K8GA 3K0CC 1OXVA 2HHHQ 1VQ6A 4P0TA 1UE5A 3AKEA 1U8AA 2EQBA 4IOCA 1EYGA 3LD9A 4B3FX 2CLDX 3MMPA 5C46F 4H1VA 2QMEA 1ZMXA 4C9BA 4A8JC 2GJKA 1HYQA 3KUCA 1XEWX 4Q66C 2JJ8A 4LF4L 4UXJA 1W46A 1E2LA 1U9IA 4Q00A 3D0FA 1W48A 1II8A 2F3TA 2GILA 3MUFA 2BVNA 1N3BA 3KL4A 2F43B 4N0DA 5KSOA 1JJVA 4HAXA 4RZUA 3VTKA 4DBLC 2RGNC 4C2UA 3A7LA 4BXXG 1XNRL 4Z1MA 3DXJC 1NBME 3O8DA 2QGQA 2XB4A 4DCNA 1X54A 5C3EG 1E69A 4JSTA 2XJ9A 4L9SA 2YWGA 2V6IA 3DM9B 1IW7D 4JV5L 3X1ZA 1XXHE 4MKFA 1N32L 1M74A 3PENA 3L2OB 2MSCB 1QBKC 2JLSA 4D4KA 2AWOA 1D5CA 1HZAA 4M9XA 5FL3A 2A68C 3NHAA 1E9SA 1Z63A 1VQ5A 2CCGA 1A6XA 2MO0A 1HNWL 1K6MA 5HZHA 1P5ZB 1RIPA 3GTGH 2DWOA 2RAPA 3T51B 1CJMA 1V9PA 2JK8A 4APVA 2CCZA 2GCPA 2R9VA 2W6JD 1IN5A 3P27A 4ERNA 1W7AA 1W36B 2KBFA 5F9FA 3A8IE 1EFHA 1NG1A 3THWB 4DB2A 4C3HH 1TWAH 4GLVB 1EGAA 1NRJB 3AP2A 3MWKA 4FI3C 3MWYW 5FL7D 5HCIA 3VU9A 4KJZA 1XFAA 2FPMA 3U9SA 2WAQG 2GRJA 3F5FA 4HLDA 2A78A 2Z83A 4O2RA 2OTLA 1VQKA 1QRAA 3EPKA 2DCUA 3U4VA 2GA8A 1R5NA 2IUUA 2WWIA 2ZUDA 3LW8A 2A19A 3UANA 821PA 5FUXA 2OXCA 1X3FA 3FFBA 1KGDA 5GAEC 1J5EQ 1AKYA 1P8LA 4DKXA 1NY4A 1P4SA 3S16H 4DNIA 4BA2I 2FEOA 3C5HA 1VCNA 3WMGA 1Z9FA 2B3GA 3CCJA 2V1UA 4LV6A 3KQNA 3LQRA 4DV0L 3BXZA 1R0XA 1UDXA 3REGA 1OIVA 2WWFA 2DHRA 3WP1B 5FH9A 4QHTA 1Q1EA 2QMOA 1E0SA 5E7JA 2CJWB 1NIPA 3B78A 3W6NA 2QEQA 2IT1A 4BFUA 3DZDA 1FJGQ 2C9YA 2XEXA 1S8FA 2CK3A 1L8QA 4M9QA 5IT5A 3EZ7A 1DS6A 1G4UR 3OFND 4LF7L 4M1TA 2O5JC 1ZCBA 4DPGA 2HDNB 2QY9A 4P33A 4DT1B 4LBWA 1VF7A 4JLOA 5C0XG 2ZSFA 3DEFA 1CKOA 3GEIA 4HJ5A 3L0PA 3RLNA 3MXUA 4A3DH 3FKSA 1NJGA 2CHVA 2H8KA 3UE1A 4IFDH 3R8CA 4DV3Q 621PA 5J47A 2CHGA 2K7VA 4UPAA 3JC66 2HIXA 2FFBA 4D4LA 1AJEA 1MR3F 2OCAA 1PLLA 4WJ4A 2H5XA 1XEXB 2JLUA 1E98A 4ZKEA 1WA5A 5IP7H 5HR5A 2R44A 1SE8A 2WWXA 2IBMA 4Q1EA 2HXSA 2OTJA 1FL9A 3BFXA 4YWMA 4X64L 1IN7A 4G7OC 1KO8A 1QHYA 3CNLA 5A0FA 3D31A 4CRWB 3HOXG 4DNRB 5LMNQ 1G9XA 3RS3A 5LBIA 4IOKA 2F9LA 5BYKA 3WHKA 1J7KA 3OIVA 5AUOB 4LFAQ 1AE3A 2K4KA 4LY6A 3JZAA 1O7LA 4Q03A 4AI6A 1Y63A 2J3EA 2WB1E 2ODEA 3GFTA 1UBFA 3CWZA 1WYDA 1VYVA 4DIEA 4A3JH 4EPTA 3VKGA 1CRQA 3HR8A 5C4XG 3WNCA 2OQ0A 2VW9A 2ASBA 3A1VA 1GO3E 3P1JA 4LBZA 4E03A 2EDGA 1E2WA 2UXDL 1FVIA 2O5VA 1EFRD 1KYIA 4JKYA 3NBFA 4UKDA 3KF6B 4Q4JA 1EWQA 2JJ1A 4GMXA 3K0SA 1AK2A 3KF6A 2R6AA 4HAVA 3ZQJA 1WB9A 2IYSA 2A69C 4I1SA 3QPVA 2RHSB 1N9WA 2FFQA 1GHJA 2BC9A 4IXNA 3G82C 1UE1A 1SVOA 3TSWA 3PGZA 3QF7A 4TTRA 5JEAJ 3K53A 2HJGA 3KFXA 3PUXA 3GTKH 3EG5A 4JKIA 4ZCMA 1MOZA 2ZROA 1L7VC 4ZCLA 4CT4B 2K32A 1KI4A 1UF9A 1B23P 2RKOA 5IDVA 2DPXA 2ZXUA 2G77B 4QHYA 2E2JH 1KSGA 5AJ3Q 3VR6A 2R6FA 3K09C 4XWOA 3PV0A 1WF3A 1GL6A 1W36C 2GZDA 3EARA 1OB2A 3TJZA 1TF7A 2R65A 3VHXA 1ZU4A 2WOOA 3U3MA 3O8CA 3GO5A 1W4AA 4QBIA 3CC2A 4BBSH 4JYAL 5C0XH 3V4FA 4BFTA 3CRKC 1E2HA 1MABA 2IYTA 1RJ9B 2Q6TA 4KMUC 1JR3A 3OZXA 1CKNA 2QBYA 2PNRC 2FZLA 1GM5A 4BPBA 4Q7KA 4R4CA 4DAYB 2IX1A 1LW7A 1XD8A 2WAYA 3HPQA 4ZKDA 5AK0A 4Y7NH 4HIOA 1QG4A 2BM1A 2O8DA 1E1QA 5G3YA 1II9A 1YZGA 1Z47A 2OUKA 1COWA 1KY2A 3CUEF 1UE6A 2Y0SE 3A1SA 4NZYA 1GIAA 3KKMA 4IKEA 4DV1L 1SXJA 3RZDH 4QM6A 1P60A 2F3IA 2FF7A 3Q7PA 4QNMA 1WCMG 2ZJ5A 2IYUA 3UKDA 4DLSA 1GFIA 4BZXA 1G5PA 4MKGA 2ZE7A 4Q5IA 3QEOA 4QJ5A 3CQZH 2MMGA 4DV5L 1VQMA 5FJ8G 4G1UC 3TREA 1FUUA 3LNNA 1EUJA 3R9WA 2YC4C 4BE7B 4MRPA 3SBDA 4UNSA 3U50C 4V0LA 3NDPA 3W8NA 2NO1A 3ZIAA 1G17A 1P62B 4CYMA 1P72A 1XD2B 2NZ8A 5JZVA 4WW0A 3B2EA 2QA4A 5EE9A 3TQYA 2B8WA 4XTCS 4HEJA 3NE5B 1VQCA 1WQ1R 3C14C 4OI4A 3V9PA 1KAWA 1P3JA 1ZUIA 721PA 1KJWA 1Z5ZA 3FHWA 2CE2X 2EU8A 2ZRGA 1LTQA 3T1QA 2D7DA 3IGFA 3A37A 2GAOA 4AC9A 2H92A 1ASZA 4X8OA 1TWGH 1KAOA 4Q18A 2ZITA 5D3QA 3TUZC 1KJZA 4YWKA 2RF4A 3DZ8A 2UUBQ 4GOJA 2ALYB 4OK6A 2VQEL 4LF6Q 3FP9A 4TLBA 2JLWA 4X8LA 1NVXQ 4IOLA 1QUQA 4LHWA 2ZRBA 5C3EH 3H15A 1GNRA 1JJ7A 4DLTA 3J81j 1P7CA 1KI7A 1KKLA 4MYUA 3K8YA 2DWQA 1K8OA 2YZ2A 3ULJA 2I5MX 2VHUA 4HDQB 2I0QA 4LFBL 3H2YA 3FMCA 1X1RA 5EQTA 1VQBA 4AYWA 2BE5C 1AKEA 2HF8A 1U5KA 1P73A 2VF7A 2I3BA 3RS4A 4DLVA 2AL7A 4V03A 3PIOA 3B8HA 1NBWA 4XOIA 4L5SA 4WZ6A 3TQFA 1TL7C 4ZCIA 3BBPA 3DKVA 1DG1G 1LVGA 1R10A 3EIEA 3GTMH 4QGAA 4A3MH 3Q8XB 4OXPA 4XD7A 5AJWA 2Z6KC 1XF9A 4O2LA 4O2DA 5CYPA 1H9SA 2GF0A 2OV2A 5EXTA 4KXFB 3R9IA 1W49A 4BLPA 2F1HA 3OYYA 2QEXA 2O0JA 3F8TA 2C96A 1WXQA 4K81B 1SULA 3BE4A 5LB2A 1U90A 2GEDA 2ZANA 3FKIH 1CEEA 2RGCA 3HGBA 4A15A 4J0QA 2OBMA 1MRNA 3GLGA 2EFGA 2LKCA 4LJ4A 1EWIA 4DT1A 4IDNA 3SJAA 1T5IA 1AE2A 1E2GA 3QJYA 2OFWA 3GLHA 4PXAA 1DAFA 4PC7A 1S4QA 2RMKA 1LY1A 4Z8XA 4OI2A 4BLRA 3TS0A 3I8XA 5B30A 2J41A 4EPYA 1UWVA 2HCJB 2OM2A 3I8SA 1KI8A 2IX3A 2AHOB 1GRQA 4M0LA 4YDSA 4DEXA 4TSFA 4JSYA 4GOKA 4DJTA 1AIPA 1QF9A 4UNPA 3OTOQ 4IRUB 4RCNA 2WSMA 4LJ8A 4P4TA 5KPJA 2BMFA 2FE4A 4QIWE 1Z22A 2IUSA 4Q21A 4H1UA 4RZ2A 3UG6A 2XB2A 1YEZA 4A3GH 4HLCA 1HY3A 2ZYUX 1XPOA 4HI0E 2AKWB 2FPLA 2TMKA 4X65Q 2AUKA 1US8A 4OO1I 1KY3A 1B9NA 5ELOA 2GXQA 4IO9A 2GXAA 2F7SA 1R0YA 3FPPA 3ADKA 3B7GA 4GOXA 5GJWC 1ZM2A 5L3SA 3PVSA 4KO8A 1Z6AA 3WYGA 1KK1A 4IPGA 2PH1A 1F5NA 3T1HL 2VP2A 1GL9B 5HZKA 3AVUA 1YZUA 1EFWA 5JEAH 2IWHA 2RHDA 3T1YQ 2VHCA 1PH1A 3R20A 4EPWA 2WJGA 3K9GA 4PFSA 5EE3A 5JEEA 4YDHB 1OHHD 2ORVA 3CPWA 2C95A 4Q4AB 1CJKC 5LD2B 5CJ2A 3PUZA 4A3FG 2V8OA 1DPFA 2ECKA 1I6HH 5FTKA 3TKLA 4IW3B 2H57A 3HJNA 4OK5A 2R7ZH 3OESA 2AKYA 2VIIA 4TVAB 2G83A 4JL6A 4Q7MB 3KFUA 4I81A 4RZ3A 3G0HA 2XTIA 2VL6A 3ULLA 2JA5G 3GTPH 2H16A 3RANA 3NC0C 4EX5A 1X3SA 2NZJA 4UNNA 4D81A 5KSZA 2JA5H 3RHFA 2H17A 3KB1A 1WJJA 1L1OA 3M7NA 1DELA 2CXXA 5DISB 2F6RA 2J7KA 5J5CA 3UWOA 3WNBA 3HKSA 1N6HA 2ZAOA 3K0FB 1CKMA 2B8GA 2HLDD 2WWGA 4PPGA 4CDGA 3IHLA 2OESA 1KOFA 3ZVNA 5LPNA 1E0KA 3WNDA 1R5OA 2JJ2A 4BLSA 1WMSA 4Q9JA 4ZI3A 1HT2E 4JLVA 1QVCA 2J0QA 4KHPQ 3KJOA 4JI3Q 2ODBA 2NVXH 2W2XA 3A4LA 3JZMA 1VF5C 3H94A 1NVVR 2QNRA 4GSYA 4I1OA 1NN5A 4Q4HB 3SC3A 1VG8A 1TWCH 2XAUA 4A0RA 2F4VQ 3BB1A 1P2TA 4GRAA 2E9SA 1C0AA 5KTYA 3H4MA 3RWMB 3N6RA 1YJWA 1GVPA 4K0KQ 5E7NA 4LJ7A 5DI3A 5JI3E 1XNRQ 1XEWY 1Z0IA 4Z51A 5FTJA 2D2CC 3KQUA 3WMFA 3AVQA 5KPDA 4RFSA 4LK1C 4G5GA 3S1QH 2QGZA 1F3OA 1GJXA 2XZPA 2DGYA 4IFDG 2WJVA 4TQAA 3ASZA 4B2IA 3KXIA 2UUAL 2PJRA 2OG2A 3R7WB 4TYPA 1A0IA 4MH0R 1TTTA 2JA8G 4X6AH 1DARA 1YKSA 3A4NA 4WOPA 4BFVA 2QSZA 4QBFA 5J3BA 1QVRA 4CZ2A 3CCLA 2IHBA 2NN6I 1Z6GA 2EWWA 2XTZA 4TSFD 4AD8A 4R98A 3CF2A 4ABYA 4B3TL 1T8UA 3GJ0A 1T0HB 3KTAA 1NIJA 4H13C 1MH1A 3IEUA 3BDOA 2P2LA 3QKSB 1VQAA 1Y69U 4LFCQ 5AJZA 5B64A 1ZNXA 3UMRA 3CLVA 3ERSX 1RRFA 4CIDA 4EUNA 2R2AA 3W6PA 2R93H 1DGSA 4R1JA 2EFDB 5J40A 3VKHA 4P31A 2VYFA 1X55A 1G18A 3GD7A 4YHHQ 4DWJA 4E5UA 1PH7A 1KMHA 1E4VA 1X6OA 3KJHA 2CEAA 1OLOA 3REFA 4URVR 2RB4A 2B29A 3GJ7A 4DLXA 1H9MA 2C35B 1JALA 4KAXA 3HOUG 1D6JA 2ZUBA 2ZE6A 1VYUA 4LBYA 3QOFA 2QT1A 1UE7A 2QE7A 5D3MB 3TMKA 2HT6A 4RD3A 4DDWA 4QM7A 3U7FB 3L8YA 1CF4A 1QZHA 2BV3A 2WV9A 1G7TA 3QXSA 2NPIA 4FWIB 1R2QA 4P3YA 4EJSA 5B58C 1NJFA 3FTQA 3AB9A 3VX3A 3SU8A 1NL3A 4LW1A 5KDDA 3Q8DA 4X66L 4PC3A 4W9MC 2HYIC 2JA6G 1FPMA 2J87A 3AVPA 2ZVQX 4GMDA 4ME3A 4JLPA 3T53B 3QKUA 2MQHA 4DR2Q 3LVRE 2O8CA 4A9AA 3AV0B 4G3XA 1X56A 1ZU5A 1KZGB 1J99A 2GXSA 2JJQA 2P3SA 5K36H 2X77A 4JMPA 1JBKA 3LBNA 2QBYB 5FR1A 1BO6A 1NJIC 3DHWC 2WKRA 4A0HA 5A4JA 4Q1DA 3JVUA 5K36G 4A3CG 3EWAA 4P4SB 2F3RA 3DM3A 4Q01A 3W5OA 3ADBA 2W6JA 1PLKA 1P6XA 2QPOA 2AWNA 1G51A 1GILA 2H18A 3CRRA 4D2IA 4F92B 5CIWA 4JI6Q 5IRCD 3K70B 5M5YH 5H1SE 1N2CE 3TK1A 5KNCA 4CVNA 2JA6H 1G291 1SGWA 2FMXA 3UDGA 4A3FH 4LPSA 1XCMA 3K70D 4B3SL 5JJKA 1E2VA 4Q4HA 3GTJH 5AR1A 3S2HH 1XTIA 2ODWA 2K75A 5FPKA 3FFAA 4DDTA 1L1OC 5KSPA 3B5JA 2KB0A 3E5HA 1GKHA 3SE0A 2ZJPA 1OXTA 1DADA 5IHPA 5P21A 5FOTA 2E2IH 3TEHB 1O78A 3ZH9B 4GZYC 5HGQA 2CHQA 2ERXA 2BKEA 3KUDA 4EFLA 1GKUB 4OK3A 4DSOA 2XZOA 3VR4A 1S1MA 2ZE5A 2YOFA 2ODNA 2OT3B 1ZC3A 3ZIAD 5HKKA 2PCFB 1YHNA 5D3MA 2AXPA 5EZ5A 3HOYH 4M22A 3DL0A 4FCTA 1GHKA 2AXNA 1W5SA 3EPLA 2IHEA 3W3ZB 4XJXA 3SHFA 3IIJA 2KA7A 1GVNB 3LXRA 3MEFA 1XNJA 2WMNB 4QRHA 1A63A 1W0KA 2GDJA 4B48A 1Y8NB 4XWKA 1BH2A 1OFIA 4V0KA 4YXWA 1Z6HA 2ZAMA 4AURA 1RC8A 1IYJB 1DBSA 3VU9B 2ZTDA 1P9NA 3E1SA 5CB6A 1FYCA 3S1MH 3SDZA 4YWLA 2BBOA 3PO3G 2ZSEA 3JAMc 4KSBA 4B2PA 3THYB 1QHHB 1KHTA 4R4QA 2VP4A 1S0UA 4JI1Q 1KSJA 1VYTA 3K1JA 4KVAA 2FU5C 3NBXX 4BEBA 4B33A 4EAQA 1K83H 1Q22A 1LF0A 1Y1VH 2IF2A 2KSQA 2V7QA 4LJ6A 1IBMQ 4POAA 1XWIA 3EZ6A 3MXNB 4L5BA 1G20E 1VQDA 3AVTA 1A5TA 1NE3A 2YWFA 1VTKA 1U98A 1V43A 2RGNA 1WOCA 5M3MG 2PMKA 1PYSB 3U58A 3WP0A 2AK3A 4C0BA 1FUKA 1PV4A 2A2ZA 1NTGA 221PA 4X8HA 2OHFA 3CCVA 1JPJA 3CC7A 1M1YE 1U0JA 3UATA 4DB4A 2NTYC 2O8BA 1WI5A 1GDDA 1JT8A 2GETA 2JCSA 4MYCA 4A0GA 1JEEA 3N2EA 1LF5A 3OW7A 1NP6A 4MGKR 1E94E 1HUQA 5JS7A 4A3MG 3C41J 3ZD7A 1GUAA 1RW4A 3CRVA 1D7QA 4IDPA 3UWKA 1SVMA 1GUTA 3HP1A 4EJSB 3LX8A 4PZ6A 4A75A 3CP0A 4B3RQ 3ADCA 4JG2A 2K5NA 1IXSB 1GUGA 2A5GA 2BWJA 1VCOA 3BGWA 4LHVA 3QKTA 3RS7A 2YVUA 4OQMA 4QC2A 4DAMA 1XMQL 1Q3HA 1W0KD 3AFPA 4DV6L 3AUYA 4EQ6A 3VKWA 1GUOA 3GLFA 1KKMA 4B3ML 3L7ZC 2B6HA 3WBJA 2CCKA 2UVQA 2DFNA 4G0NA 1ZKOA 4YMSA 2BCJQ 2OLJA 3U5ZB 4H44C 1I50H 1A7JA 2OBLA 5DE3A 1E79D 2FGKA 2ZI7A 3T1TA 4UXHA 1DAGA 1K73C 2O5IC 4ASUA 4OGQC 4A3IH 4BRWA 2EW1A 3OEHA 4AIMA 4JLNA 4P4SA 4JC0A 3OOCA 2QP3A 2ZR9A 3R7WA 2ZPTX 3IKJA 5IP9H 2WJYA 3RS0A 4G5QA 2JASA 2WJIA 4DSTA 5B57C 3I73A 2G9NA 1HZ9A 2BBSA 5EP4A 2XITA 2AD1A 2KENA 1AS2A 2Z4SA 4NYMQ 2IYWA 3MSXA 2UZIR 1GRNA 4FINA 4CEHB 5IYBG 4C3IH 1AS3A 2PEZA 1HZBA 1U2RA 3H3VI 3LGJA 1CKEA 5EE5B 4JBYA 2YTVA 2J7PD 4JI5L 3E0EA 3EZFA 2F43A 3IILA 1KZ7B 5TARA 2CK3D 2CL0X 1MO6A 2KCTA 2EQSA 2JA8H 4A3KH 3ETLA 5TB5A 3DOEA 4A92A 3SFVA 4C0HA 4C3ZA 5JEAG 1KQSA 3I1FA 4PHFA 3SJZA 4JI8L 4H9GA 2PI2A 3QPUA 5J4KA 2YKGA 2ANBA 4DR3L 1H8HD 4F7WA 1ZAKA 5GVSA 3I5YA 4W5HA 5SZHB 121PA 5E3HA 1F48A 4ZDKA 1LUZA 3F2BA 2AFIE 5FBQB 3TVDA 2XXAA 4LF9Q 2FH5B 3QVUA 3EX7C 2QROA 4JT4A 2E74C 2GJSA 4BASA 1E2PA 5IWAL 3PITA 2GAAA 3MJRA 4OHVA 5C4GB 2Q3FA 1YI2A 4EQ6B 4TYYA 1V1QA 4IPCA 3HYTA 5GJCA 3AKYA 1FL0A 3KF8B 4MKHA 1KXLA 3CX6A 1GRRA 3O8RA 5DIFA 4UJ3A 1OPXA 2OLKA 2FEMA 2N46A 3CCSA 2EFEB 1VQ9A 3JVVA 2NN6G 1BBUA 1U0HC 4PMWA 1Q81C 3TSZA 4JVMA 2Q2TA 2JEAI 1E4YA 5KU1A 2ZM6Q 2JLQA 5FLXc 1ZD1A 5CLQA 2PQAA 4TLAA 4C0AC 1KRSA 3PF5A 2EVWX 3K09A 4HB4A 2WM9B 4OHWA 1YRAA 1N5LA 4BLOA 3RLOA 3MJHA 3RC3A 3HOYG 1HJPA 3PIRA 5H1YA 4D4JA 1UPTA 1W4RA 2RGGA 2ZVPX 2W0SA 4QGHA 1T91A 5E7MA 5UKDA 1E79A 2NO6A 4Y52H 2FA9A 2V55B 4DR1L 1QVFA 2BBWA 5C0XI 2QF7A 5BQ5A 3SS8A 1U94A 3BJUA 2OQKA 3L0SA 3VMFA 5DYIA 5KO2A 2W6IA 2GN5A 2MO1A 3CNNA 5DHFA 4DHEA 3QIAA 3R9XA 1E9DA 3TR5A 2YNMA 5M3FG 1HEIA 1Z0FA 3CONA 4JI2Q 4Q7LA 1N0WA 2P0EA 2ZETA 4ON9A 3LWNA 4HLQB 4PSVA 2G1KA 3H1TA 3RZOH 3L8ZA 3P4XA 1IBKQ 4Q47A 4R2HA 2P6NA 1NNEA 3PEYA 4TYWA 5JFGA 1YVCA 1AM4D 3KKPA 4TZ0A 5FTLA 2N49A 2N78A 2Q3MA 1GTVA 4F4IA 1D9XA 3RWOA 4ZI2A 2F9MA 1DG3A 1RYHA 4TQUS 2I5LX 1TX4B 3QXHA 1EXMA 3GPLA 5JECA 1KRTA 4JI5Q 3I4MH 1I2DA 3TNFA 3B13B 1O87A 1Z8FA 5IE8A 1PJRA 3TQCA 1YZQA 2GVDC 5DI9A 4JI2L 2ZSDA 3QSYA 1N8RC 1VQ8A 1UADA 3BERA 2D06A 3RRMA 2P5TB 4I4LA 2RGEA 5L8VA 3GDEA 4DUYL 2E1RA 1X3GA 2VQEQ 4LF6L 2R8RA 3FOZA 1G3RA 1RIFA 3J7A5 5SZIA 2O52A 4HUTA 4BY7G 3SOPA 1KI6B 2QP4A 1S1CA 1SVSA 3AF3A 4V0NA 2GESA 3K0FA 4OHYA 1VQNA 1HE1C 1UKZA 1Y3AA 2QPAA 4MNOA 2ZI3A 5DGXA 1IONA 1JXOA 1HTPA 1ZW6A 4IDHA 5BXQC 3CRW1 5M04A 4DCTA 3KZ1E 5TV2A 1DO2A 1XMIA 2REBA 5EUMA 4B71A 2QP9X 3FDIA 1I94Q 4UY8C 1D9ZA 1XXHA 3SI7A 1I2MA 2PLFA 3GTQH 1II0A 2ZRHA 2CNWD 4HJ8A 2CLSA 4DK1A 3B9PA 1CI3M 1LB1B 5GQOA 4X62Q 2QZ4A 5IP9G 5DLQE 4BY1H 2LCFA 2RHMA 4MUBA 3A74A 2FV8A 4NL4H 4WXRA 4DR4L 1Z7TA 1PH6A 2Z0SA 3ICQB 4EDHA 1Q90A 1Y1VG 4A8JB 1T3HA 5DN6A 1SKQA 1Y14B 1Z28A 1VQHA 2K5VA 2REOA 3QNUA 1RKBA 2CL7X 3MG9A 4W7SA 1EX7A 1OB5A 3W9YA 4EPRA 4MQBA 5F3WB 4DXAA 3RSLA 5BN4A 2GVAA 2FSFA 4RZXA 3OE7A 2ONJA 2BH8A 2FPKA 2H7VA 4M1SA 4B43A 5BW8A 1YHBA 4AYTA 3QENA 1XEFA 2Z0MA 3BWDD 3NKVA 2DFTA 3TSOA 1R6BX 4AWXA 3VR2A 2E8GA 2NVQH 4NHOA 3RYTC 4Q9KA 5HCNA 3I55A 4KV9A 1VHLA 1OFUX 1K8MA 3TRZA 3UK6A 4LHXA 4ESVA 4L4UA 4URYR 2C04A 2YJTD 1ZD9A 3OPOA 1JI0A 1US8B 1IN4A 2QMHA 1Q86C 3TUIC 2A6EC 1IOZA 1Y8PB 4MRNA 4DVGA 1ETUA 4LWZA 3J81i 1N25A 1N5JA 2XTNA 4GKKQ 2X19A 3U2QA 2UXBL 1A82A 1C4OA 1ZM7A 2D7CA 3NC1C 3VDYA 4EQ5A 3R8FA 4A3EG 1FMLA 2IYZA 3A1TA 1B7YB 1PVOA 3CRQA 4NDZA 4BQSA 1L2TA 1Z08A 2ZJ2A 3KXLA 4IVQA 1YNNC 3RAPR 5M5WH 1R5BA 2QAGC 3AH8A 3C15C 3AB3A 1XX6A 4QKQA 1OT3A 2VRWA 3CCEA 2X8AA 1YZLA 1DAEA 2VP6A 2B63H 4UXIA 5FTMA 3LBIA 3RABA 1G6OA 3T1VA 4YY3L 3OW2A 1NY5A 1NVWQ 3K0XA 2ZYTX 3CM0A 3CW2C 4NYJR 1X8KA 1SXJD 5FPYA 2UXCL 2Q9BA 2KCCA 5KNDA 1EG7A 1P16A 4B3SQ 1G1MA 1Q44A 3FHTA 1TQDA 1ZVQA 4GZLA 1TU2B 1RE0A 4RCYA 3KKNA 2Z4RA 2O8FA 2BM0A 2MSDB 4IEEA 4LJ9A 3KOJA 3MRSA 1OIWA 3H0GH 4NKRA 4JI4Q 2HIVA 1OKKA 1VIYA 4UNRA 1K3RA 4D80A 1QVAA 2VSFA 4KFUA 5TDHA 4JI6L 4MTNA 4QGFA 1XTQA 4FMBB 4DZZA 1CR0A 1ZJ6A 1SR3A 5GVRA 2I5HA 2HQLA 5LDDC 1E32A 2VY3A 4IJHA 4X64Q 4V0MA 1G8YA 1IM2A 5FUVA 1HTWA 2A6HC 3BB4A 1E1OA 3A8TA 4TMWA 2OBNA 2QG6A 3CR8A 4A3DG 3OIWA 4A3BG 5M3MH 2ZYVX 2PT5A 2AMCB 2WVJA 2YTYA 1VQOA 1FNMA 2ZT9C 1PH2A 4NPHA 2JDIA 1VQPA 1IBKL 4ESHA 4LBVA 1YQTA 4A4DA 5KOYA 4RD4A 4LF5Q 1G19A 4B47A 4GN4B 1JECA 3ZDQA 1FNNA 2REXB 5EP1A 5K8UA 2WAQE 3HOUH 3HOWH 1JQLB 2F1IA 2IS1A 5EAYA 1MRSA 4WXPA 2LSSA 3H3VH 1KK2A 4BFSA 2AK2A 2VQSA 1X65A 4JL8A 1FP7A 4PANA 5GAHC 4DV2L 4GLAC 1HA3A 1TEXA 3PEWA 3I4OA 1ESMA 3BU2A 2HT1A 4DR7Q 1LNZA 4B3CA 5JBQA 1EIFA 4LC0A 4A2QA 1KK0A 2G6BA 3WXMA 1NLFA 1A2BA 4PAQA 3A4MA 4Q9HA 5G3ZA 3T15A 4LUVA 1N33Q 4A82A 1DXMA 2JA7G 2DWPA 2Q2UA 1N6NA 1PYBA 4KN7C 4L8GA 2RGAA 5HTKA 4KHZA 3PIPA 5C44G 2FX3A 2ZI4A 3M85A 2PNHA 5EP2A 3K0AA 1EFCA 2OCPA 3T12A 4BZPA 4CEHA 2D0OA 1G8GA 3SGIA 2PL3A 3VR3A 1E9EA 2DFLA 2FOLA 3PEUA 3VAAA 4X8MA 1HH2P 1SLJA 3Q3JB 1KO4A 1A2KC 4Q1BA 3IRBA 4C7OA 4FW9A 4LX0A 1KDTA 2BJVA 4POFA 3OHMA 1VCIA 2VL7A 4IOJA 5DNYB 4HJ7A 1LM0A 2RGXA 1CR2A 4MRSA 4WAUA 4FN5A 1W4BA 2YWEA 1Z6TA 4M8NE 3IO5A 1Z0DA 4PO8A 4TLEA 3AKCA 5EE0A 1COWD 5L3SB 4PG3A 1IN8A 5JSZB 3H0GG 3DLLA 3TIFA 3KDFA 5DH9A 3QBTA 4EPVA 1DO0A 1K9MC 2YOGA 4JI8Q 4R4IA 3ZJYC 1N32Q 1LV7A 2KI5A 1XZPA 2L0XA 3T35A 4AKIA 4F4JA 4C2TA 3QXXA 5FBWB 3UG7A 3OFNA 3U3OA 1NY6A 4KI0A 2KHJA 1TQ4A 5FUYA 1N6KA 3EAQA 3GJ8A 3K9LA 1UEIA 5TMPA 1HNXQ 1SVKA 2O0KA 2D74A 5LMNW 2UXCQ 1S96A 4MRRA 1Q57A 2C5LA 3GLHE 4QGGA 4ARZA 2PT7A 4B3XA 4BFXA 5K8LA 1XDBA 4UQOA 4PPFA 1T0JB 1G7SA 1ELOA 1AZTA 1HR0L 1TPZA 3OEED 2ZRCA 5TY0A 2QI9C 2P65A 4PZZA 4DSUA 1CTMA 1ZM4A 3KJIA 1ZNZA 4I99A 4U7DA 2HUPA 5EZ6B 1NSTA 3THYA 5BN3A 5DO9A 1FTNA 3A5UA 3K7UC 1SVWA 5IYCH 2IA5A 4B34A 1M7BA 2OWOA 2PJZA 4CGZA 3AQQA 4PAMA 3ZZ0A 4HIMA 1IXRC 2J7PA 3TUJC 3IBYA 2WBLC 3GJ3A 2Q21A 4N0EA 3J81k 2NQ2C 1JXMA 5CYOA 2A68D 2CWPA 1YITA 3D3QA 5CB8A 3L0IB 1QVGA 2B63G 4YMWA 4PTLA 3THXB 3AF1A 1ZBDA 3KXKA 2BBTA 4KBGA 3LFUA 2JDID 4GOPC 2XOKD 3BH7A 5L3QA 1MO3A 3VX4A 3SJCA 3W5JA 1W2BA 2DR3A 3ZS8A 2ZS7A 1XJCA 3PO2H 3GMTA 1NMYA 1SROA 1LACA 3PF4A 4DLZA 4GOPB 2V4DA 4JBMA 4FCVA 4ACAA 4DRZA 2JGNA 3CPHA 1CR1A 1HURA 2V1CC 2C77A 1XD2A 1Q8KA 2GF9A 1E1RD 2V4ZA 1S3SA 4KCGA 3AP1A 5EJEA 4KKSA 5EUQB 3AVYA 3LV8A 3RNLA 1H8EA 3HDTA 2VF8A 1LYLA 3NWJA 3TVTA 4E09A 3IFTA 3FHCB 5FI1B 2ZJAA 1GUSA 3I3SR 1JE5A 3QPWA 4LC1A 3B85A 2CBZA 1L0WA 2WMOB 2LXKA 2ZJBA 3BOSA 3X2SA 3UDFA 2ZRIA 2A7QA 4HATA 3K0AB 4DLUA 1E1TA 1XMJA 1FFHA 4ZDWA 5F98A 3AVVA 1JAHA 1UFQA 2V9PA 1HCZA 2JA9A 3D6TB 4MGYR 1W4CA 3ECCA 4XSHA 3WY9A 4PV1C 4RKFA 1Q3TA 3I72A 3H86A 1TWFH 1CJTC 4B76A 1C7YA 3I5XA 1HNZL 3M4QA 1R7RA 4O0MA 4D82A 2L15A 1Q21A 3TAUA 4AKHA 4FD2A 1RRPA 3CR7A 4BBRH 3OTOL 3J80c 3AF2A 3EC2A 4XD7D 4C0KA 4RJLA 3ZJYA 2ZJRA 2N8NA 4LWCA 1XD9A 2I1VB 2F1RA 1P9RA 1Q82C 2QE7D 3EZ2A 5H68A 3HU2A 1WBBA 3FE2A 4IEIA 5JSZA 4BEJA 2DNEA 3HOVG 4RFVA 3EASA 2KBEA 3IDQA 4MZ9A 3S1RH 3P32A 4LUOA 3M6AA 3QUSA 3KQKA 4NP6A 2JATA 2A5DA 4LGMA 1SN8A 2CFMA 4ZDIA 2VNUD 3U3JA 1TMKA 2QRZA 1A4RA 4XVRA 2P5SA 4B74A 2BKUA 4XVUA 2XOKA 4OONA 4UP7A 4NYJQ 1CBUA 2QM7A 4XVQA 4Q1CA 4PQRA 2E75C 1VQFA 4US0R 1DEKA 1FTSA 1YHQA 4LF5L 2JEOA 2OE2A 2QTHA 4EFMA 5IYCG 4BGDA 2QRNA 2ZTCA 1OF1A 1UKEA 2V3CC 1HH4A 5FOUA 2DUDA 2WIAA 4C4PA 1VKJA 3K0EA 3K0CA 3Q5DA 4OQXA 2DYKA 4ZPXA 4CW7A 3U7GA 2R92G 1X8LA 2IEZA 2IC5A 4IDOA 5FOWA 1I4LD 4KSCA 3CXCA 3OIUA 4Z1MD 2EYUA 2ZI6A 1ZM9A 2PCLA 1L4UA 1GL7A 2UKDA 2V54A 4G5SA 5H70A 4A8JA 3LBHA 2FZ4A 4M1MA 1CS4C 4GP7A 4TTQA 1RL2A 1CJUC 1TQ2A 3W6OA 2O8CB 5DI3B 5JWHA 2R93G 4TL9A 2PMDA 4OWWB 4L16A 4Q9LA 1JMCA 1SMXA 2WB1G 1IBRA 1XMVA 3CKLA 4NXNL 3IPYA 3PEVA 3BH0A 1F6BA 4PZ7A 2VH5R 4LF8Q 3U3RA 2IHFA 421PA 2O0HA 2VLIA 1XEXA 4D0NA 4ACBA 3SQXA 4UNQA 2ZJZA 4JI4L 2IXGA 4Y0AA 5FLMG 5FUWA 2VEDA 1T5LA 3Q72A 2JEBI 1B8AA 3UIEA 4E07A 2JE6I 1MJCA 1H95A 3OAAA 3DO6A 3ZVRA 4E22A 4TL6A 1IY2A 3LVQE 2HLDA 3AYHB 3PFIA 1M90C 3KQLA 2I4IA 2C03A 3QG5A 2P6RA 4X66Q 4NYIQ 1CXZA 1EOVA 1KI6A 2C2HA 3IBGA 4IPDA 4JLMA 4XTRA 4F93B 3RRNA 3E9IA 3NEMA 1VG0B 2ZEJA 1BMFD 4HAWA 5C0XJ 2GWHA 4Q7JB 1E24A 2XJ4A 1XJ0A 4UJ5A 1AN0A 1UEJA 4LCBA 4D26A 3EA0A 1DAHA 4YCUA 1PZNA 1YR8A 2V1XA 3PUYA 4IQZA 5GAGC 2XX3A 3FGNA 1VECA 2NPFA 2CW0C 4OO1H 2OFOA 3BH6A 4DR7L 3BS4A 3CZPA 2BDOA 3M4PA 5JJIA 3RN2A 4A4IA 1G6HA 2E76C 1PH9A 5TXGA 3TBKA 2PPBC 5IWAQ 2QMUA 3B1ZA 4LI0A 4R2IA 4A3GG 2F55A 2IYRA 4YHHL 1ZINA 4TMKA 4DNTB 2QM8A 4JOIC 3GLGE 2N42A 1U0LA 2QSYA 2WSSA 1D2MA 4ZIRA 5AJVB 3LO5A 4LYHA 4ALPA 1I4DD 4NE2A 4LFCL 4OYHA 1NMGA 1BMFA 1X6VA 1P2UA 4DCVA 3N70A 4GPTA 2VPPA 1E9AA 4R4TA 2HYDA 2AKAB 1M7GA 2PMZE 4XIGS 1Y1WH 1OH6A 3ND8A 5E4FA 3GLIA 2D5DA 4AYBE 1KMQA 1NLYA 2A30A 4NCKA 4S35A 1EFUA 3TS2A 1E2EA 2D0PA 2QAGA 4B35A 4OX9L 3LQQA 3QBVA 4PQYA 1JB1A 3T1OA 1ANKA 3A58B 4KU4A 4AYBG 3NBHB 1OHHA 1SQ5A 3BC1A 3FKIG 4LFBQ 4LDJA 1F2TA 1P2SA 4KODA 1KO1A 2YYZA 4KFRA 4GKJQ
chains in the Genus database with same CATH superfamily
5BXYA 4GUDA 4E2FA 2AMLA 3A9CA 2DT8A 4O4IB 2E1PA 2PI2E 3OQ1A 2V4UA 1FQOA 1G21A 1YONA 4H15A 4YJ3B 1Z6YA 3A6PC 4XPIA 3RYHB 3HQ4O 5EQ0A 1PFSA 2P1RA 2QVGA 4I14A 4TMYA 4CMAA 3I4NG 4IMRA 2X69A 1MIUA 1NJ5A 3DCJA 4PYKA 4I8XA 2W48A 3KOMA 1BCPD 1IZZA 3KYJB 2SOBA 1DQRA 4KAAA 1PJQA 1AQLA 1FYEA 3UAWA 4B75A 4F38A 1QJOA 2R6R1 4DR5L 1Z73A 1V7QA 3HDQA 5GONF 1SKYB 2QXYA 1T25A 5CYGA 1GHTA 4YUZA 1PG2A 1BKYA 1HUMA 3LRXA 3LA6A 1Z2NX 4NSNA 5EIFA 1AA6A 1HEUA 1GXSA 2VHTA 4CV2A 1FRNA 2B2TC 1I3QH 5FR2A 4A3SA 4DHWA 4MQFB 3BFVA 5C4XH 3PLRA 3KSAC 3BZCA 1FQKA 3SVZA 1BA3A 2GERA 4RMIA 2EX0A 1NFRA 4NMLA 3VOSA 2YTZA 4B3RL 2P62A 3B1XA 1QONA 4DIFA 4AVYA 3F7NA 3KQYA 4BECA 1NPYA 3UHFA 2HV9A 2IHYA 1L8AA 3VSAA 1S5BD 3D4BA 4LJLA 1KJ8A 4JIMA 3ETGA 5FUVA 4BZZA 3PXGA 2FW9A 4TKUB 4KIFA 3IEVA 4U02A 3A1UA 1PU2A 2X1MA 4DV1Q 1OKKD 4FXDA 1WRBA 3DGEC 1O08A 2FWBA 1FOEB 3LCVB 4KYIB 3S4YA 2AVNA 5BSKA 1AZSC 5CH8A 3ZGYA 3NVAA 2CLEB 3CXRA 2PX6A 4UPEA 4GX0A 1H2AS 2O9JA 3NB0A 4O1HA 4UTOA 3KDFB 4Q37A 4KE6A 1WXXA 4WZBA 2IU6A 3MTIA 3VO8A 4HEHA 4IO0A 1PZGA 1KO5A 1V3QE 1H0SA 4EG8A 5CA1B 4EVQA 3H0CA 4YO8A 4TLMB 1W47A 1TEVA 3IODA 5IYDG 2OAP1 4XI9A 3RJ9A 3EPJA 4QBHA 3CBQA 4DDVA 4J8QA 3LQ4A 3PC6A 3GPDG 3QYPA 4JD5A 5ER9A 3SDBA 3TH5A 2YFHA 1RS0A 1YJNA 4LV5B 5DHTA 2DBQA 4FFMA 4I4TA 3AVWA 1UPBA 3DPUA 1A88A 2OORC 1IZ6A 3AG5A 5AVQA 3GLIE 2UUOA 4CMEA 2R61A 2IHZA 1MSGA 1G20A 4RPHA 1TF2A 3FRPB 3FUUA 4CDCC 4QREA 5DNAA 1ITZA 3RG2A 2YJ3A 1XMOB 3LUPA 3IMFA 4X62L 3NT2A 3EVBA 4J91A 4G0UA 3HOZH 3CPFA 1NW3A 5H81A 5FBHA 1S9DA 2RI1A 1K5DA 1QO9A 1E9FA 2AHRA 4WSOA 1IHZA 1SD2A 2IGTA 3PXBA 3CQ9A 3RSOA 1UFKA 1BBXC 2QR5A 2QZZA 1XZFA 4GXQA 4EGQA 3VVBA 5FBVB 2AJDA 4ICIA 2JAQA 2ZIWB 2PGIA 3VDNB 1UODA 4W1PA 5KC9A 3QOWA 1M6VB 1OFHA 3ZX4A 4EUFA 1QHIA 1QF7A 3KB8A 4IZ6A 1ICWA 3BCHA 5KNDH 3OJ0A 3FVQA 1FDTA 2AVDA 5JYEA 2N9UA 4UBNA 4CQLB 1GG8A 1YR3A 1Z4OA 5KWEA 3QMPA 3QBJA 1ADGA 2ERYA 3TS1A 2DFKB 2PZAA 4BJ1A 4A0FA 2JAOA 3X43A 3JAMi 3QU7A 3K05A 3WRXC 1KVUA 3QKSA 3KSBC 4K46A 4M9SA 5CBPB 1DOAA 2HDWA 3NEAA 4QT4A 3RYCA 3SNHA 2F8MA 1NG9A 2NXWA 1SOWA 2PZGA 3O31A 5ANRB 3AG6A 3HKZE 1J8DA 2W83A 3GDHA 1TU3A 2BJWA 2JA7B 1N0UA 3VISA 2NZYA 3ZHQA 2D2XA 5IK2A 3GY0A 4AMGA 1PJTA 1LSOA 1R50A 5BN5A 4WLNA 4D74A 1OO9B 1BU8A 4WFN3 1VZ2A 3OEEA 1WVLA 4LNUB 3TTYA 3P52A 4YAJA 4B3RB 2O6LA 1YS6A 4MRAA 3QX8A 4EMTA 1G8ZD 1XCOA 1SIUA 5CXXA 3WHPA 4ZWNA 1LJLA 2XUPA 4BMNA 2Z3VA 4DXDA 1W0JA 1YE8A 3BDAA 4PY2A 3USCS 1DAPA 2IS4A 4I9UA 1BDMA 5G4LA 1W73A 4R4JA 3JQQA 4RCVA 5ILQA 4D3YA 3JZDA 1XWEA 3CW8X 3U7JA 5M5BA 1Y80A 1RLUA 1W85A 1RCTE 1JHUA 3C7KA 5E1BA 1AHPA 3GDGA 4RLFA 4HDSA 1G8AA 2LD4A 1MVLA 3WLEA 1X9GA 4KIJA 3W7BA 4TZ6A 1OFVA 3AINA 5ALYA 1XMXA 4NULA 1I3QB 4UHHA 1R9GA 4BBZA 2O2EA 2OXEA 3V9PA 4REOA 1RHQA 2AEFA 5LZ4A 4RPIA 2Y99A 3QY0A 5A5FA 2A9OA 5JNLA 5KTOA 3HOXB 5EXXA 4MQEB 2HHHL 4DCMA 3JYHA 1UC5B 3DBLA 2MMCA 3QNMA 4UMDA 3NJ4A 1TLLA 3TQQA 2XGTA 1JR2A 4IXWA 4JUIA 1U2DC 2R87A 2HCIA 1XTRA 4R1MA 2HU7A 3P9NA 1JRLA 3VI4B 3VR5A 3IIMA 4QG7A 1BXTA 1DMSA 5JVH3 1U04A 4QARA 5F9HA 2Z5GA 1JWLA 3EBEA 3S14H 2PBLA 2NMVA 1DE0A 5DYGA 4CF3A 3NUZA 2X4IA 3M1YA 5I9BA 4FYVA 3VR4H 5JUWA 2HHLA 2V9CA 1BVYF 1P61B 5EIEA 2EYQA 4IRMA 1W2WB 4NCAA 3R7DA 3RBVA 3T7EA 2FGJA 4C4SA 4DA9A 2HA3A 5FO9B 1KBQA 2KM1A 4EMSA 2OTCA 1R0WA 3Q4GA 3FVTA 4QYMA 1P75A 3PO3H 2RSLA 2J6BA 4QFMA 1HQMC 3EF1A 2X40A 4EPXA 1HF3A 3QX3A 3FPKA 1Q12A 5C7LO 4I65A 1BJRE 1ADCA 2RB5A 3TZEA 3T7IA 3P2YA 2Q0QA 2ZRJA 4QRIA 3SG0A 3FSGA 4QECA 1AA9A 4NTZA 4R2WA 2CMDA 5AM0A 1ULAA 3SYTA 3UMBA 5KDOA 2DUUA 4YJ3F 5IULC 1UKYA 4RD2A 4C0LA 3CF5A 4LUZA 1P81A 2GLXA 1TO1E 4KRYA 2H51A 4ND2A 1B8UA 5A5GA 1PQUA 5JS6A 1JDBC 3RR2A 2FWMX 1V45E 4G9BA 5LJLA 4YDQA 3L6OO 3LY8A 1LS1A 1EFTA 1CW2B 2XCLA 4OHMA 4E88A 5TIIA 5F52A 4Q9IA 1CP2A 3LWUA 1G9TA 2GK7A 4X3KA 3C3PA 3GOHA 3QU2A 1PH4A 4N49A 5I9PA 4EO9A 3EROA 3PJDA 3PNLA 1FU7A 2Q3EA 1H8HA 4PRLA 2ID7A 4BNMA 2XCTB 2SKCA 5HRAA 4G1BA 2A92A 1O94A 1P0IA 3B82A 2O8FB 1G3UA 3UUGA 4M83A 2AXQA 5K2MA 4XZ3A 3NCHA 3ULPA 4MR9B 3O75A 3QTLA 4NENA 1F7UA 2WM8A 1A8QA 3QVJA 1LC3A 1MEOA 1S3GA 1L7PA 4HCEA 3D0RA 4X3PA 1CYEA 2PL9A 3D7MA 3KU1A 4S2EA 3E70C 2VUSA 3FPSA 1V9CA 1IBLB 1BCRB 4PMBA 4CN9A 4L9WA 2H5IA 3K96A 5D3DA 1QH8B 1UAAA 2AOVA 3AYXB 1CR4A 1MUUA 3JQEA 4G5RA 2JFQA 3NFRA 1J5XA 1L7EA 1QYXA 1E3WB 4RAQA 1XMOQ 3QFFA 1CEXA 3RNUA 3GJ5A 1Q7YC 3ONDA 4F4CA 1ZA2A 4IPHA 4X6LA 1TQ6A 1RBQA 1Q0TA 1XWWA 1XMQQ 2XMPA 2JA6B 5JLJA 2APJA 3N2ZB 4FFOA 3LBFA 1F3LA 1MZVA 2IDKA 5C81A 1CRLA 2XCSB 2FSIA 3USES 4QWWA 1M34B 3OX1A 3R44A 1W6UA 4KZKA 3S2ZA 3OX4A 2QAJA 3PBKA 1PUIA 3T54A 4F9FA 4C6RA 1OVGA 1P1IA 4IOMA 2HPAA 2C31A 5FPHA 3R5XA 4FGJA 3ZDZB 2ZS9A 2C0CA 2JFHA 3AW9A 4G8CA 4H6PA 4KFSA 4Q6WA 3HKCB 3SHWA 4EHIA 1N5KA 2X5KO 3A0UA 4H0LC 4RGMA 1G8PA 1DJPA 3HNRA 4I3HA 1A76A 3WB0A 4AICA 3L7CA 1CRWG 4PLPA 3GGJA 4B3DA 4BNWA 1ZR4A 1W36D 4WFJA 1E5LA 1YZKA 1VJ5A 3DFIA 3QI2A 4FE4A 2IXAA 4CT4B 4BTEA 4FYDA 1ZNWA 2W70A 2JJ1D 4HQRA 4PZUA 2QL9A 2W8BA 4FFSA 3OMCA 3KT3A 4FHZA 4BDSA 3DUZA 9GPBA 3I4NB 4YRQA 2O8EB 4D9IA 2R62A 2B2UA 1DVRA 3SR1A 1KD1C 1E4EB 3MCUA 4JU9A 4MV5A 4MI9A 4OFBA 2N1BA 1Y6GA 2DB3A 1RP1A 1FBNA 1N0VC 1BF4A 4TQ9A 5CDFA 1RHPA 3HSSA 1XTJA 1ICEA 2MFIA 5IW8A 4A73A 1T4CA 1FS4A 5I9SA 1EY4A 4ULLA 4GP9A 2OO7A 4E12A 3CE9A 4PC6A 3OKPA 1CUUA 3GUYA 1E2KA 4FOSA 4M1WA 2WT8A 3K4QA 3SIXA 4AG5A 2VP5A 2VSYA 3FHJA 4TROA 1HTLD 4ZO7A 1N2BA 3DB1A 2P7IA 3EOZA 4EELA 1PMRA 2YCLA 5JS8A 4F1WA 3H11A 2FN9A 1IBMB 3EIOA 4M1ZA 1FJGL 3EZXA 3W8RA 3ZWCA 3VPSA 3T6KA 3ZHBA 1IQUA 4A2PA 5KEIA 1KZ4A 3SK0A 3EBOA 4UEWA 3B6YA 1YL6A 4NAVA 5ED0A 1YRQA 1CLUA 2WMDA 5SY4A 1U9YA 4UP9A 2E37A 1J2RA 2PT6A 5LMUQ 1C4WA 2PVPA 2WPDD 2XNDA 3IIKA 3NDIA 4YI3A 5FLMH 1U8UA 2B2NA 2B4RO 2J46A 2PZEA 3BTUA 3DMNA 3E35A 3H9BA 4UUAA 3GDFA 5JAMA 2M6KA 4DMLA 4DABA 3I61A 3T8YA 5E2IA 4MVJH 1S72A 5DP1A 1N92A 4C04A 4CF6A 5K6TA 4CV1A 3WMWA 1A3UA 1SBTA 3D1VA 3FKQA 3ILVA 4S0ZA 5KQGA 5JJLA 1K3TA 2Q3CA 4DUZL 1YBMA 4Q9NA 5I4IA 4DILA 3L6UA 5C4ZA 1O3YA 1F12A 4OREX 5ALSA 4MTCA 1RYZA 1E7YA 2PWBA 4IV8A 4R31A 1LTKA 4UU0A 1C0IA 4LNAA 1U9ZA 2WYWA 3VGJA 3ZHCA 4C2BA 3Q11A 2ISSD 2NB0A 3KBBA 1EP2B 1JHPA 1JVBA 3R41A 2JLRA 4B3HA 2GEKA 2AS0A 2VO1A 1VMEA 4NMXB 5IT9E 4TKVB 4R69A 1IZ7A 3IAFA 3ENQA 3PXEA 2BFEA 1BMQA 2EYPA 1XZEA 2IUYA 2AJBA 1LS6A 4LRTB 4PX2A 3T9FA 4EIWA 4GPIB 1B43A 3KHKA 4HGOA 3E3XA 2Q3LA 2QAGB 4GWLA 4OXNA 1SQSA 3UJDA 3V4PB 4XSGA 3MXNA 2A9KA 2BGMA 1NUCA 2P79A 3HVKA 4DLPA 2Y1CA 2EKPA 3IALA 4Z54A 4YQFA 1T10A 3E7WA 4JR0A 3KFVA 4TL8A 2B2WC 3BHIA 4HX9A 1N2CB 4X6YA 4W9RA 4X62B 2PG3A 1LZLA 4OIFA 1T8RA 5CHEA 1UZLA 1YVRA 2W6ID 3P97A 1Z2EA 2KW5A 4JCOA 5FLKA 5JAUA 5JR3A 5LQNA 4QX6A 2B21A 5BQFA 3Q3IA 1VL6A 3ZIUA 2C88A 2BGUA 1IZ0A 1KGSA 3ORQA 1PRTF 2H1RA 3AR4A 4PZLA 1T2FA 4GNRA 4TPKA 1VB3A 2BUBA 3OLVA 3RROA 1PUXA 5ES4B 2XXJA 5BR8Q 4H1TA 4DW8A 2UUCQ 1L4YA 4RKBA 1IJKA 4QDTA 2XUKA 5H83A 1ZAYA 3ITPA 2G1PA 1TAQA 2QTFA 1AN8A 2X2FA 2VS1A 1MCZA 1L1FA 1JBEA 4DYDA 1ZSVA 5B4VA 5TSDA 1XF1A 1YR7A 2HL6A 3QP9A 5JPMC 1LTHR 2RBGA 1X2BA 1M1NA 2XNDD 1L2FA 1QKIA 4G0YA 2IX0A 4N5LA 5IJXA 3NR2A 4PC1A 4QHSA 3SLKA 4CCSA 4EFNA 1T34A 3KPVA 4G67A 2AZTA 1M6VA 2DUJA 2JA7H 3CPEA 5E2AA 3I2FA 5SZKB 3U9TA 1I4TD 1WXEA 5KKNB 3CMAA 3OOYA 3TGPA 4I19A 3L92A 5M5YB 4BAUA 3WX0A 1EL0A 1KXZA 1WTPA 4JYBA 4QJFA 1KERA 5HOEA 1EUYA 5HGTA 4A3CH 3F97A 2JQOA 4MUIA 1PFUA 1ZXTA 2G7MC 1EQAA 1GWNA 3G2LA 3THWA 3QLVC 3KT8A 4NJMB 4O4JA 4XQGA 3V2TA 3GZJA 4QNRA 1X7ZA 3G0CA 4MUEA 3OZUA 2HEGA 4XIFA 4PZ8A 2FFHA 3RPEA 1KYWA 3UMSA 5FUMA 1OH8A 4HIDA 2WF6A 3ZGZA 2YFQA 3LUAA 1M8PA 2DH6A 5ALPA 2G25A 1QXSA 4HLUC 4A6XA 4DLBA 4ZI5A 3EYAA 3TSYA 2RH5A 4AY5A 3PJGA 2Q9AA 2IYLD 3CX7A 1DIHA 2Q0XA 4NQZA 1XHFA 2YWBA 4C3UA 2WFMA 4DIBA 1JHXA 4PGAA 1ZGZA 4BWYA 3WWCA 1Q1ZA 2C0QA 1YHYA 2I55A 2K5HA 5G1OA 4CIWA 5I7HA 3HM9A 1USUA 4W63A 5BRAA 3W5BA 1D8TA 4BKPA 4YLGA 2B92A 1GGVA 5ELNA 4GI2A 4DYVA 1Q0ZA 1YAJA 2XA1A 2Z1MA 3W5IA 2JK1A 3ZJVA 1QRRA 3TOXA 4AL4A 4CDNA 4EF4A 3GDOA 1UBGA 3HOZG 2ZRPA 3C4QA 4LOAA 2OAQ1 5G0UA 3ZXXA 1HM5A 5JAPA 1MNAA 4MVXA 5JRDS 2UV8A 1CE8B 4HK4A 4TVKA 3H6MA 4DOMA 1H85A 1EA5A 4MS3B 1OTXA 1JXAA 1P18A 5M9OA 4IDDA 4UUQA 1G41A 1G8MA 3OICA 4V24A 3SX4A 1RDPD 3S2DB 1E0DA 2YHAA 3CEAA 3JPWA 3BYYB 2QGNA 1QP8A 2VB2X 3WWVA 1LXCA 1M1NB 2VSOA 4GZ3A 2WTEA 4D0RA 3RS2A 2DPGA 5DBOA 3R8XA 1JA0A 1U2ZA 2Q27A 4DSNA 4G1FA 1ENOA 1KJNA 1CIJA 3OLQA 4JI7Q 2ACEA 1X7GA 2GCNA 2J4FA 1C3XA 5ED4A 4BUCA 2BDTA 1LLFA 2H3HA 3ZGXA 1Z0KA 2Y0PA 4F2WA 5IF9A 1HZCA 2M32A 4C3VA 1WCV1 1RM0A 2EYJA 1DX6A 3WR5A 4DLNA 4YBRA 4N5NA 1U1GA 1D5XC 1CUWA 1Z4PX 2B69A 1L8XA 2PBZA 3L6EA 3OFKA 4MJ7A 4C5AA 1NBAA 3SR0A 2ETXA 3TZQA 4XH9B 1KRWA 3E58A 3WHIA 2ONZA 1RPZA 2GASA 3FLMA 4YP6A 3S14B 4FM9A 1ZJ5A 3OPNA 1NBWB 2Y3IA 3Q8KA 2NZOA 4U5XA 4MB0A 2PA3A 5EZQA 1ZPDA 1EFPA 4X3UA 2SNMA 3FI0A 4GNKA 1S40A 1UXGA 4L0QA 5F9MA 2RAUA 3AUTA 3WS7A 5I2XA 2YY5A 1SNMA 2IW1A 1YCFA 1X3EA 3DOHA 1SXJB 4B4KA 2XDWA 3LCMA 2AFVA 4QUGA 3ZKWA 4S1TA 4XR9A 3A1CA 3EDYA 3QWFA 1AH2A 4AN4A 2YVKA 4M53A 4XQCA 3DFMA 3FDZB 5FORA 2D3TA 4DAVA 3ELYA 3PR3A 3RDPA 2UYHA 3WIDA 1DBQA 2E87A 3JR7A 3T1YL 4KXVA 3Q10A 4PCAA 1FC0A 2EJVA 2Q6LA 1IVYA 3AK4A 3I4MG 4QQ8A 5F2KA 2VBIA 2PLRA 2DJ5A 2J59A 5ENDA 1TWGB 1J21A 3R2IA 2ZJOA 4LF7Q 2ZSBA 2QD5A 3PGVA 4II3A 1DJNA 3M4XA 4DF3A 1HNXB 3TLXA 3OZCA 4RH6A 2O07A 1DXQA 1N6OA 2O20A 5JWRA 3AWIA 1SD5A 2NTVA 1DT3A 4E2XA 1AZQA 1H2YA 5FFMA 5J4VA 3KX2A 5F2EA 1W2GA 5LNK1 1E62A 2CVFA 4NNJA 3BEOA 4E94A 3NGLA 1TM1E 2NM0A 3NM5A 4B80A 3LAWA 2BHLA 2FWIA 2W37A 4JGIA 3WV5A 1QLWA 3UK0A 2P41A 5C5DA 5JRZA 4WRDA 5A4KA 4MUAA 1GNPA 1EVYA 1TWHH 2EY2A 3RN5A 1P91A 1VE9A 3BXFA 3GFRA 3V4OA 3V7UA 2PNJA 4WV3A 2A6PA 3KBGA 3E3AA 3GEGA 3M9BA 1TW2A 4L02A 4L15A 5DIZA 3FB4A 1AX9A 3LY9A 2B8EA 2QA5A 4FHDA 1RWVA 1YKGA 2W93A 4DV4L 4Q24A 4OIMA 4PONA 3STVA 4CEIA 1QYWA 3F5QA 3QF4A 3MCAA 4BLTA 3G13A 1UCFA 1R9TH 3H99A 1HQYE 4TT3D 2R92H 4KHVA 3J7AF 4RETA 3MIIA 5A7HA 2VK8A 4RD6A 3K57A 1X8JA 2GGSA 2IODA 2VDRB 1GCAA 2V7EA 4ZAWA 5EFOA 3NWPA 4YI5A 1T3SA 5IM4A 3OBIA 3EGXA 4YR9A 3W1GA 3BGVA 3K6KA 1A8PA 2FNAA 3GWGA 3V3TA 5ICSA 2Q8TA 2LKDA 4LGYA 3L7AA 2Y71A</