4H7BA

Crystal structure of staphylococcal nuclease mutant i72v/v99l
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKVEVEFDKGQRTDKYGRGLAYIYADGKMLNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Hydrophobic core mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
total genus 36
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2012-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4h7bA00
1F2YA 4MIUA 5EKLA 5CV9A 1JOKA 2F0OA 2OEOA 1EY8A 1EYCA 4K5WA 5E3FA 3SK6A 5C3WA 1NUCA 1EY6A 5CGKA 3SK8A 1KDAA 4F7XA 3D6CA 4R8NA 5CV8A 3TP6A 2RDFA 2OXPA 4WORA 3OMCA 1TR5A 4PMBA 3SHLA 5C6AA 4S3SA 2F3WA 3TMEA 2KQ3A 5IGCA 5JAVA 2F0EA 2HQEA 5E1FA 2EXZA 1EZ6A 1JOOA 1AEXA 4QF4A 1STGA 3TP7A 5EGTA 3D4WA 1A2TA 4ODGA 1SNPA 5IGBA 5F2DA 3QB3A 2EYPA 3T16A 3TP8A 5C4HA 1STAA 2F0GA 2M00A 1STBA 5KGUA 2OF1A 1EY9A 3MEHA 4N9TA 1KDCA 4YIJA 1NSNS 3OMGA 4OL7A 4EQNA 5KYLA 5IODA 3PMFA 1EY0A 2PQEA 4KY7A 3HZXA 3BDCA 3U9OA 1EZ8A 5I9PA 4KHVA 1JORA 2F0NA 1RKNA 5IIFA 4IALA 2F0LA 4K8JA 3NUCA 5KRUA 4H7BA 4PMCA 2NUCA 1F2ZA 1TT2A 2F0QA 2PW7A 2QDBA 5CV5A 4ME5A 4DFAA 5C5LA 4EQPA 5IGDA 2EYMA 3C1FA 3SK4A 4ZQ3A 3DHQA 3E5SA 3R3OA 1KABA 2F0IA 2EY1A 5IGFA 1SYGA 4B9WA 5HURA 1SYBA 5ISRA 4HTHA 2EYLA 3OSOA 4KY5A 2PZWA 5JOBA 1STHA 3V2TA 3D8GA 3QOLA 3NQTA 4KJOA 1A3VA 3ITPA 2F0PA 5HGTA 4DGZA 1STYA 3EROA 5C3XA 2F0TA 3QOJA 2F0FA 2ENBA 4K8IA 2SOBA 4WRDA 4B9XA 5CC4A 1SYCA 2F0VA 4TRDA 2LKVA 4LAAA 4QB4A 5C5MA 2F0MA 1SNOA 2EY5A 2F0HA 2F3VA 3OWFA 3NHHA 5J1ZA 3TP5A 3EVQA 1II3A 2PZTA 4ZUIA 4NKLA 2F0SA 2EYJA 2RBMA 2F0WA 1A3TA 4EVOA 4NMZA 3DMUA 2F0UA 4KY6A 1A3UA 5I6YA 5CV7A 5EKKA 3C1EA 5KEEA 5KIXA 1TQOA 4IZ8A 4HMJA 5CV4A 5KYIA 3ERQA 5M9OA 3S9WA 3P75A 1SYDA 1U9RA 3T13A 3D4DA 3P1HA 4EQOA 4KJNA 2EYFA 5I9OA 4K6DA 1SYFA 2PYKA 1KAAA 4J6HA 1KDBA 4ZUJA 1SNDA 2EY2A 3HEJA 4E6IA 5J39A 1EQVA 2F0DA 4K2LA 4RKLA 2PW5A 4ID6A 4PNYA 4KTAA 5J22A 2RKSA 1IHZA 4NP5A 3NXWA 4HMIA 4KD3A 1SNCA 5CR3A 5IOCA 1JOQA 3MVVA 4K2KA 1SNQA 5CV6A 2SNMA 3BDLA 3RUZA 1SNMA 2SNSA 4NDXA 4IUNA 5IGGA 1A2UA 5IGEA 4RKBA 1ENCA 4F8MA 4I65A 2EYHA 4N9PA 5I6WA 3H6MA 3MXPA 4G57A 5K5PA 3MZ5A 2F0JA 1EYDA 1EY5A 2KHSA 1SYEA 3EJIA 1STNA 2EY6A 3NK9A 4K5VA 5NUCA 4J1MA 4DU9A 2EYOA 2O4XA 1F2MA 4K14A 4KV6A 3SR1A 3VA5A 1EY7A 2PZUA 3NP8A 5DEHA 2F0KA 3SK5A 1EY4A 5C4ZA 4K5XA 1EYAA 3LX0A 4DF7A 5DAUA 4KD4A 3MHBA 4QMGA 3SXHA 2WACA 1ENAA
chains in the Genus database with same CATH superfamily
3QWNA 4RFBA 4B3TQ 2FMMA 2NVQH 2QILA 5C3WA 3J81c 1X3PA 1NUCA 1BF4A 1VQJA 3DXJC 2N8NA 1NMFA 3N52A 4IOCA 5H1SE 1ICWA 5C6AA 1HH2P 3TMEA 1QOHA 2F0EA 3I70A 1AEXA 2ZJPA 2HDMA 1F9SA 3KUPA 3S15H 1G6PA 5C4JH 5FO8B 4DUYL 1SE2A 3A56A 4DV7L 1LTSD 3V05A 1XTDA 2KBNA 1O80A 2L9HA 3U9OA 4NW2A 4KHVA 4IALA 4A75A 3LWUA 3A8KE 2HIXA 3VYSA 3IFDA 5I2YA 4LFAL 3S1RH 3PO3G 3SK4A 2NN6I 4RHRA 3MFGA 4R4QA 3ICEA 1OXXK 1WOCA 1TWHB 2RSNA 1BR9A 3HOWH 4AYBB 5C4JB 4XQJA 2H1EA 4EX5A 4DR5Q 3UDXA 1FJGQ 1N9WA 3H3VI 5DM73 1C48A 1GUOA 4FF3A 4KN7C 1D2BA 4MTNA 1SNOA 3HGBA 3KBGA 2E76C 5ELCA 2A69C 3HKZG 3VDYA 4ZUIA 2JA8B 2UUCL 3PUXA 4A93H 2F0WA 1PRTD 5I6YA 3ULJA 3ULPA 2BE5C 1I50B 5KIXA 2NZHA 4CDFC 4HMJA 2E2JB 4CKBA 3A8IE 1IYVA 3PIPA 4A3EB 3CC7A 1S5CD 4ID6A 1E24A 5J22A 2RKSA 1J5EQ 1TWCB 3BZCA 3NXWA 3CCEA 2K75A 3MVVA 4BBRG 3GTKH 3NWSA 5LMNW 1XNRQ 2V1CC 3K8AA 4Q0FA 1MJEA 1ENCA 1K28A 5T1GA 4I65A 4OXPA 3RN5A 1XXGA 5JVH3 1EEFD 2Z6KC 1EY5A 3K57A 1MJCA 5FLMH 4UP7A 2O4XA 3VYTA 1WJJA 1PZJD 1XPOA 2KEEA 3H15A 2MFIA 4OGQC 2NVYB 2FXQA 4G4KA 4KMUC 1YNJD 2R6GA 5GQOA 1XMOQ 1IBKL 3V96A 3RLFA 1N32L 1QUQA 2JN4A 3NSWA 5IT9L 1S5BD 4Y7NB 2UXBL 4JI8Q 2VS1A 1IW7C 1K3RA 3TQYA 4GKKL 2JA5B 2BDNA 4S3SA 4A3FG 3NPPA 3E9IA 1C4QA 1VMCA 4RG1A 3TZDA 2IX1A 4DR7Q 4OO1H 1RTOA 1STGA 2K5DA 2RF4A 5EGTA 3CC2A 5D65A 4UDUC 4ZK9B 3J7A5 3CKIB 3PF5A 1XMQL 4FP5D 3TSSA 1V1PA 2A68C 4GOPA 1H9JA 1QE6A 3F2UA 4BY7H 1BCPB 3M4OB 1G291 1M1KC 3T1YQ 1X9NA 5I4DA 5IY0A 2SEBD 3R2IA 4A3LH 3CXCA 1PTOC 1SSOA 2FHTA 1K0RA 1ZEQX 3UI2A 1I6HH 4C3IG 1IYUA 2LSSA 1P8LA 2E5LL 2C9OA 3MXNA 1PHJA 2ATWA 1K3BC 3K81C 2F0PA 1Y1VG 1IBML 4BA2I 2N3SA 1Y1WG 1FL0A 3HOXH 4BBSH 3ULLA 3PUYA 2LKVA 1L1OA 4JOIA 5J1ZA 1Y8OB 1KQSA 4L5SA 4UP9A 1LACA 2K33A 4UP8A 1II3A 2M2LA 2EYJA 3NELA 1JWMD 4NMZA 1A3UA 3KF8A 2F4IA 1I4QA 4L63B 3CRLC 4QGUA 4M1UB 3QR8A 3PO2H 3NENA 1CKNA 3NBIA 1TU2B 3OHXC 3J80i 3G4SA 1SNDA 4E6IA 3ERSX 5LHY1 2PNRC 3GTJH 4NP5A 5IT9c 3FKIB 2E2DC 5CV6A 4ILWA 3RUZA 1SNMA 5DLQE 4RKBA 3NTIA 1EYDA 2KHSA 3M85A 3NTKA 2IY5B 4DU9A 4K14A 4A3BH 1I4PA 2PMZE 2JA7B 4CJ1B 4AYBG 1HNXL 1QUQB 3GTOB 4CGYB 1R4QB 4BA1I 4DAYA 1X56A 2D2CC 1ICFB 3CCUA 1AH9A 1GUSA 4F7XA 2YTVA 2JA8G 1Q1EA 3E3XA 2O5IC 3SHLA 3H3VH 5ELNA 5C4XH 4GOPB 1KL9A 1ESFA 2BH8A 4P73A 4DV2Q 4A3KH 2EE1A 4A3EG 3EBEA 3TN2A 4CBVA 1EY9A 1W3SA 4B3TL 1S40A 3HZXA 3BDCA 4DV1L 4R1JA 2F0LA 2AMCB 5CV5A 3MXNB 4GN4B 1Q8KA 2K03A 1VQGA 2B8FA 2B2YC 5JEAH 3J7ZC 3OTOQ 1LTLA 3AEVA 5AJ3L 4FXGC 3GTQB 1H9RA 3QOLA 2XTIA 1L1OB 1PRTF 1VQLA 4J8QA 4B9XA 5IP7H 2F0VA 3VR3A 3KFUA 1FD7D 3BZKA 1JWSD 3EVQA 3JC66 5D3DA 1X3QA 4IPDA 1PZID 4NKLA 1CKNB 2JA5G 4A4IA 4KY6A 5GAHC 4OWWB 3MA2B 4R4CA 2UXCQ 4WJWA 3RZDB 1FNUA 1ASZA 2J7ZA 4EQ5A 1SYDA 3T13A 1X55A 1SROA 3HOYB 1OXSC 2R3ZA 2JJQA 4J15A 2LXJA 1VQPA 4LF9L 1G51A 5CR3A 4LW1A 4C3HB 4U673 1JJ2A 1SNQA 1G91A 4NDXA 1TS4A 4A3IH 1SFOH 5EPJA 2KENA 3H6MA 5I6WA 3Q8DA 2VUMB 1NJIC 1EQTA 1AN8A 1EEID 1IXRA 1TS2A 2E2IH 4IPCA 4NPSA 2I0QA 4RWSC 1KIXA 4DAYB 3AFQA 5DM63 1G2SA 4JPBW 4JV5L 1BCPC 1LTTD 5A2QL 3F2CA 5IYCG 2M9VA 1DOLA 1VQ9A 2JA6B 2PNHA 1Q86C 3GTLB 1Y8NB 3SEBA 4IJHA 2MPMA 5CV8A 3N6RA 3TP6A 2E2HB 2CWPA 1GO3E 2WAQB 3CRKC 2UUBL 1A0IA 1PYBA 2B29A 2LXKA 1GHJA 5IGBA 2Q8RE 1WCMH 3MEHA 1SDFA 1G6ZA 1RTNA 3STBD 3FKIG 4DUYQ 4GNXA 4DV7Q 3S1MH 4JI8L 3Q22A 3I73A 5KRUA 1X32A 4N8FA 3F2DA 4BY1H 4P2CB 2F0IA 4LFAQ 2JEBI 3HOUH 1EQRA 2JA7G 1QCBD 1M4VA 1WTWA 3ZYYX 3UDGA 1MBYA 2OCEA 1TWFB 4JBKA 1JJCB 2ZTCA 4DR2L 3JAME 1LTAD 1NCVA 3HOVB 2PZTA 5D3IB 4BY1B 1KD1C 2BH2A 1WTOA 2RQXA 2YU9H 2WINB 4Q5VA 2A1AA 2VZAA 1CZGA 1Y8PB 1I4XA 2KCTA 1RDPD 3FDTA 5KNDA 1S5ED 3K7AH 2NN6G 2NVXB 2JQOA 4FVMA 4ULLA 4IUNA 2B39A 4F8MA 1VQKA 3MXPA 4FO2A 3MZ5A 2LY7A 4GOPC 2JYOA 4K5VA 3PO3H 4KV6A 2K4KA 1YJ9A 3M4PA 1P16A 4JCVE 5E7NA 4QCLA 2G9DA 1I4HA 1E3PA 3J7AV 4FNFA 3PUZA 3T51B 1CSPA 2KA7A 3K7AB 1B8AA 1Q7YC 3BYYB 3K0YA 3S2DH 1GOZA 5TSSA 3A0JA 1IBKQ 1LUZA 1UE1A 4R8NA 2UXBQ 1DONA 1ESRA 4LFBL 3ZJYC 4GKKQ 2N49A 1NAPA 1L1OC 4JOIC 1V43A 1KHIA 1D6EC 3D4WA 3H09A 2NB0A 3G7LA 4GNXB 3HOYG 1L0WA 5C4HA 1LV9A 1STBA 1SMYC 1XMQQ 4FDBA 5IODA 2QA4A 1JT8A 5M5XB 4C3HG 1QWYA 3OIQA 1HA5A 1WYDA 4BBRH 5HY6A 1A63A 2QW7A 5I2XA 1X3FA 2DUDA 2VQFL 1TWAH 4AH6A 2VUMG 3WOEA 3I4LA 5BN5A 2EY1A 1PH4A 3S1QB 1DOKA 4HTHA 1YI2A 2K14A 3I55A 3GTGH 2WFWA 5FJ8G 1D8LA 4HJ9A 4YHHL 2CVRA 3OOCA 2E5LQ 2VL6A 2UXDL 1PMRA 1STYA 1PH3A 4O1NA 1IBMQ 4BWGB 2WKDA 4LAAA 1H9KA 3DEPA 5T1IA 2JA6G 3OWFA 1K73C 5LL6X 4EVOA 5KNBA 2A5HA 2WAQG 5KEEA 3S9WA 1I94Q 4A3FH 3GTPH 2K50A 1AP0A 3P1HA 4ZUJA 2AKWB 4YY3Q 1U4LA 3GQBA 1ET6A 2E75C 2KCNA 2F3IA 2R7ZB 4PV1C 1CT1D 2BCOA 1KC8C 1NNXA 1PLFA 1O7YA 3P7JA 3HKSA 1EWHA 3UE1A 2UXCL 2AQ1B 1EIGA 5NUCA 1UE7A 1I3QB 2WB1B 4KI0A 1CA5A 3VA5A 2KCMA 1LLRD 3HOZH 3T53B 2F0KA 2HDLA 4CKEA 5IWAL 5C4ZA 4FXKC 4C1NI 1Q46A 1Y1VH 3RNUA 1R9TB 1ENAA 2A8VA 4DV6L 1FVIA 1SEBD 1Y1WH 4MIUA 2FMCA 3CCMA 4ZYSA 4RH6A 3SK8A 1A8VA 4O42A 1CZWA 3HOVG 3D6CA 1VS0A 4BY1G 2EJGC 2Q2TA 2DJGC 1ZKOA 2OTJA 4CDCC 3HOZB 1D5ZC 3KOJA 2L1BA 1G8ZD 1EOVA 4Z9CB 5F2DA 4O2DA 1VQ7A 2EYPA 1XPRA 1YEZA 2XN9C 1OXTA 3VYUA 4YIJA 1KDCA 1BBUA 2PQEA 3CMAA 4LF5Q 2VNUD 5IIFA 3M7GA 4DV1Q 2K1BA 3DLLA 2WIIB 3MEFA 5C0XI 5FO7B 1VQ8A 4GZYC 2MP1A 2PW7A 4JI2L 1PRTB 1UE5A 3FPPA 2EYMA 1KRSA 1IW7D 2G9HD 2KHIA 1NR2A 1VQAA 5LMUL 2EYLA 3C46A 3J80L 1D7QA 1SXTA 5AJ3Q 1TWHH 3H91A 1CHQD 3TEHB 2K5HA 3LWEA 2K01A 3TREA 2MNAA 4JI0L 2F0FA 2ENBA 1BUVT 1YNND 1SE4A 4QB4A 1PYSB 2Q2HA 1SMXA 4DR3L 5JVG3 2H5XA 3A7LA 2EJMA 1GUGA 1TWGB 2JA8H 1PTOD 4CHTB 1BNZA 3ERQA 3A74A 1I50H 2K5VA 2CWAA 3K7UC 2E2JH 4LNQA 4DNRB 1GUNA 1EQVA 2F0DA 2PW5A 4A3EH 2YV5A 4DA2A 2UUAL 1TWCH 3NWTA 3BZDB 4K2KA 4LF6Q 4LF9Q 2SNMA 1JC7A 4JI4L 4XTCS 5JJZA 3S1NB 2A19A 5DNFA 1N33L 3WDNA 5K5PA 2RHQB 4LUOA 3W2DA 1B9NA 4IOAA 1U0LA 5IYDG 1ZYRC 1CKOA 2PZUA 4P75A 3NP8A 4GNXC 1QVFA 4FXDA 3G6EA 4POFA 4KLKA 2OT2A 1LO5D 2QGQA 3CCJA 4JV5Q 1MHWC 2NVYH 3CQZB 5E3FA 1EYCA 4XDXA 2I07B 5CGKA 1SBBB 2A6HC 4Y7NH 2A6EC 2JA5H 3RZOB 2O5JC 1L0YB 2HQEA 3J80c 1GD7A 4KKUA 2UUBQ 3L0OA 1Z47A 1CKMA 3HKZE 1CTMA 4QIWE 1QVGA 2EQSA 4TSSA 4QJFA 4R4OA 3LGJA 1B9MA 4DK1A 1HRJA 2F0NA 3M4OH 1HXYD 2R7ZG 5A2QE 5ELEA 5IP9G 4JI6L 4C56C 2ZTDA 2TMPA 2WB1G 4B9WA 1M8AA 3CCSA 2PZWA 1DXMA 5JOBA 2QF7A 2K05A 3E9HA 3D8GA 1EWIA 3V2TA 1VQIA 1Y69U 3NQTA 2KHJA 4KJOA 3UE0A 4R8IA 4H0LC 4DPGA 5GAGC 5IYCH 1EUJA 3T4AC 5CBAE 4DR2Q 2F3VA 4IQZA 4H02A 4G7HC 4IFDG 4X3SA 1N36L 1FNWA 2RBMA 1A3TA 1Q1BA 1TKWB 4CJ2C 4DXFA 5CV7A 1MIUA 3C3LA 4HJ8A 1VQ5A 4CKCA 4P74A 1E22A 3HOZG 5EKIA 3G48A 3PQIA 4O0AA 2EOTA 5ELOA 2PPBC 1V9PA 1O7LA 1BBXC 2R7FA 1HR0L 1U5KA 3GO5A 2F03A 3FKIH 1S5FD 3S24A 4B3SQ 1Q12A 4P71A 3KJOA 2Y0SB 2OWOA 2IX3A 2F0JA 2C35B 3EJIA 1I94L 2K04A 3NBHA 4AQYL 2B3GA 5CBEE 4DR6Q 4DN4M 4QUFA 1XPUA 3TZUA 1A6XA 4YY3L 5C0XH 1VDZA 2DNCA 1CQFA 4FYDA 4DF7A 2JA7H 2N88A 2KOLA 3GTOH 2VB3X 4JI7L 5CV9A 4YWLA 4K5WA 5ELFA 1J8IA 1PH1A 4JBMA 1HZ9A 1PRTC 3J81j 1BVSA 1X54A 2F3WA 5BR8L 2E8GA 3HRZC 5IGCA 5C3EB 4LFBQ 1JE4A 4DV3L 1T5XD 5M3MB 3VA7A 2NTSA 3JAMi 4MZ9A 3URYA 2ZM6L 1MKHA 4OWTB 4GKJL 2G5DA 4GN3B 2J4XA 3U58A 4OL7A 4A3JB 3CPWA 2ICIA 3D4RA 2NN6H 1A62A 4OIJA 1FR3A 2MO1A 1O7ZA 4L8JA 4KHPL 1IYJB 2ZXOA 4A3MB 1JJGA 3A5ZB 4H7BA 3EQLC 1TT2A 3CW2C 3C1FA 4JI1Q 5FK9C 5FOBB 3E5SA 2XGTA 3QJYA 2VQFQ 1Z9FA 4Y52H 1QNKA 1DJRD 3EA6A 3GTQH 1YNJC 2EXDA 1B3QA 3R93A 4YHHQ 1PTOF 1K83B 2UXDQ 4LF5L 5JEAJ 1MI2A 1VCIA 4IN3A 4NXML 3FVQA 4IO9A 4K0KL 4B3MQ 1PYWD 2KEDA 1C8CA 2K6AA 3C1EA 4DV5L 3H0GB 2JA9A 3PIP3 3RZDH 1IL8A 2R92B 2PYKA 4J6HA 1JCKB 3T1HL 4HN7A 1HFNA 1SAPA 3HOYH 4X3TA 3D3RA 1GUTA 3BDOA 3FHWA 4WJ3M 1K8GA 4C3HH 3NBHB 4XXEA 5IGEA 4RAUC 1AZPA 4IUTA 4N9PA 2EYHA 2K52A 4X3UA 4F87A 2HIVA 2PI2A 2VUMH 4U68A 1K8OA 4DNIA 2R7DA 3J81E 3S2HB 3SK5A 4P72A 3AQQA 5FJ8H 1V1QA 1UEBA 4MN3A 1Q90A 1UUPA 1ZXTA 4IUPA 4KD4A 5IWAQ 1NMGA 5GAEC 4TVAB 2QDLA 2Z9HA 4LF6L 3KLWA 3L3OC 4DV6Q 4ABNA 3OYYA 2JA6H 4X6AH 5LMNL 3GTLH 1TR5A 1YZ6A 2A74C 4ZLTF 2E2HH 1Q81C 3S14B 4PG3A 1PXUA 2A73B 3KLSX 4QL5A 5JAVA 5E1FA 4IUUA 2NWGA 1J6QA 1A2TA 5A35A 4A3DB 3VR6A 2N78A 4HJ7A 1QZGA 3R2TA 2OF1A 1HA6A 4XT1B 1MSGA 4RGMA 2AQ2B 1HZBA 4DAVA 4AIMA 3RR5A 3I2ZA 4RMFA 1CHPD 1F2ZA 1IZ6A 2Y0SG 3DUZA 1EIYB 3CCRA 1EYGA 1NE3A 4JI2Q 5IGFA 1STEA 5HURA 1N34Q 3KYHC 2NZ1D 3K5MA 1NY4A 1STHA 1OO9B 5LMUQ 5HGTA 3AMUA 4IFDI 3S17B 5JJKA 2F52A 2CKZB 5C44B 1X3EA 3B6YA 2UU9L 1TWFH 1SYCA 4TRDA 3TRZA 4JI0Q 3KF6A 1HHVA 2B2TA 3FRPB 1CA6A 1GHKA 4HJAA 2MJ8A 3I4NB 4DR3Q 3HOVH 1KLUD 3HG9A 3GV3A 4GS3A 5C3EG 5M3MG 4M8AA 4EQOA 2EYFA 5C0XG 3R8BA 2RCNA 4JC0A 1DM0B 2KUMA 1TS5A 3Q24A 1S4ZA 3Q0AA 1VQ6A 1TY2A 1UWVA 4A3JG 2NVXH 4DR4L 3IKJA 2CQOA 1ET9A 5IYBG 2UUAQ 5IGGA 1F2LA 1QB5D 2X6LA 4A3MG 2DJFC 4JI4Q 1CFMA 1JICA 2RCFA 3GDEA 5CMDA 2L0CA 1T9HA 1N33Q 1WTRA 5EJWA 3CC4A 3MC0B 1RIPA 1Z6HA 3KK7A 2F1MA 2RSOA 4UY8C 5EQ0A 3I4MB 2K32A 3NE5B 4GLAC 3K5NA 2IW3A 1UAPA 2EIFA 1RHPA 4B3SL 2L5TA 4HR7B 4FF4A 4JYAL 4KHZA 2NTTA 1TVXA 4HSVA 3AB9A 4HIOA 1VMPA 3AYHB 4DR6L 1CM9A 2AQ3B 4DAPA 4R4IA 1B4OA 3H0GG 4KKSA 2RDHA 2R92G 1VQBA 2KCCA 3T16A 1STAA 4N9TA 3U9SA 1LT6D 3MWYW 2O2LD 1PV4A 1EZ8A 2NVTB 4JI3L 5M5XH 1RKNA 3FEWX 4HSPA 3K80C 1PA6A 3NUCA 1BO0A 2K5QA 1CSQA 1IBLL 1LYLA 3L2PA 4ZQ3A 3DHQA 1KABA 4CJ0B 5K36G 3DWQA 4JI6Q 1SYBA 1VQDA 3RMHA 1D1IA 1RL2A 3F2BA 5IYDH 3S1QH 1TS3A 3KF6B 1MGSA 4NB3A 2GA4B 1HQMC 2JK8A 1PH6A 3A5UA 2XRSD 1MSHA 3E0EA 5M3FH 1HZCA 2F0HA 3I4OA 3VR5A 2EZVA 1BDOA 3D6WA 1JQYD 1W6KA 1BOSA 2F0SA 4QUCA 4NXNL 4JI1L 3M3YB 1N36Q 5IT9E 5KYIA 4JI5L 5CV4A 4HCSA 1KLGD 4LF8L 4A3DG 3STBC 4LJZC 3RD4A 1LTBD 3E0JA 2RVLA 5M3FB 1HR0Q 1LABA 1X65A 1TXYA 3K5OA 5J3BA 3PGZA 1DYQA 1PDQA 4QIWB 4B3ML 1GKHA 2R7ZH 2JEAI 5JJIA 1B50A 3OW2A 3K5LA 2ZT9C 5IP9H 4V190 2XRQD 4AQYQ 1I3QH 1C7YA 2CHBD 1MD2D 1RCVD 2WKCA 4F88A 4FF1A 4RCNA 1EYAA 2LMCB 1HUMA 2DNEA 4IUQA 4LMQD 2P5ZX 2GN5A 4C3JH 4LF4L 5L37A 5C44G 1F2YA 3D0FA 1R9TH 1W6JA 2JXMB 3WWVA 4JI7Q 1PFNA 2HT1A 1AE2A 2XIWA 3I4NG 1KAWA 4IFDH 4JK1C 2A69D 4DXGA 1JR0D 3U4VA 2CH4W 2BE5D 5BR8Q 4TKOB 1LT5D 4DV3Q 3TP8A 4C3JB 2B2UA 1QVCA 1E1OA 2XSCA 2F0GA 1VQFA 1GUWA 4PZ6A 2WAQE 2ZM6Q 3RLNA 4GKJQ 1EY0A 2YTXA 3L7ZC 1JORA 1QJOA 2ZXPA 4LFCL 1QZHA 1WFQA 4C2MH 3KLRA 5M5YB 4I7AA 1EOTA 4KHPQ 4X64L 2A6HD 4X66Q 2A6ED 4XIGS 1PTOB 3MTSA 4ZRZA 1PH7A 3GTMB 4BXXG 4KY5A 3KDFA 1UNSA 1XWEA 3WOFA 3PUWA 4A3GB 3I4MG 3I3CA 3EROA 5BN4A 1F77A 3I90A 4OWXB 3DEOA 1E1TA 2SOBA 3BG3A 1OXVA 4LUZA 5C5MA 4C2MB 2MQHA 5FLXL 4UHVA 5LL6S 1E7ZA 3PF4A 1GM5A 2FINB 4NXMQ 4K0KQ 1Y14B 5M9OA 3TS0A 3EN2A 1TWGH 1N34L 3I91A 3TS2A 1YHQA 1YVCA 4DV5Q 3FMCA 5I9OA 5EBDA 1UE6A 1XYIA 4K2LA 4HCEA 4CDDC 3T1HQ 3M9BA 4RCOA 4ALPA 4HAEA 4HMIA 4KD3A 2RHSB 5M5WB 2A68D 4X62L 4JW0A 5E4WC 2R93B 1B53A 2PMZB 2ID0A 3S1NH 1R4PB 1S3OA 4LUVA 2Q2IA 1Q3LA 4L5QA 1YITA 5D14A 3GD7A 3A55A 2VQEQ 2HCIA 4PQXA 5DEHA 3JAML 1EY4A 4ZCKA 2Q2UA 4QMGA 2HCCA 2NVQB 4QY7A 3SXHA 1FNVA 5EKLA 2B2WA 1EY8A 2ES2A 3CQZH 1WD1A 1T5EA 4L5RC 1EY6A 1VF7A 3BVZA 2RDFA 2OXPA 1PVOA 2CW0C 3QO2A 1HUNA 5LMNQ 2KQ3A 5EPKA 1VQHA 1EIFA 2EXZA 1EZ6A 3RZOH 1AFPA 2B2TC 3A7AB 3S15B 2PCFB 1VF5C 3FPUB 1U4PA 1YJWA 2SDFA 4X65Q 2OTLA 5KGUA 1FGBD 3PMFA 2HQLA 5FLXc 5M3FG 1YHAA 4DR1L 2I5MX 3S1RB 4DV4Q 5IE8A 4L5TA 4EGVA 3KDFB 4APVA 4DFAA 1TIID 3Q6SA 3R3OA 1XNQL 1PFBA 2EVBA 3HOWB 5EBCA 3BJUA 1V8QA 3DWAA 1JB7A 1W2BA 5JPNC 1HNWL 4WRDA 1PH5A 3CP0A 1VQMA 2UU9Q 3M4YA 3TP5A 4MNOA 4A93B 4CDEC 3J81i 3ONAB 1FGUA 4GLVB 3JAMc 1TQOA 2Z4IA 1RD9D 2Z4HA 4KJNA 1SJED 1KDBA 3HEJA 3VR4A 2C5CA 4B3RL 4C3JG 1H95A 2CCZA 3G6JB 1IHZA 2IWHA 1QILA 3GV6A 3T56B 5IOCA 3TBIB 3GTKB 2F4VL 4IJLA 2SNSA 2D62A 1A2UA 4DR4Q 2BA0A 2AHOB 4G7OC 4ME3A 4WFN3 4LF7L 1EU4A 4YCVA 1AE3A 2L15A 5G3LD 4J1MA 3SR1A 2D0PA 1PH2A 1IL2A 5CORA 1U4MA 2I46A 2JE6I 3OPOA 2IHEA 4K5XA 4A3GG 1H9MA 3QIAA 1YNNC 1HNZL 3S16H 2KJXA 1DD2A 3Q23A 2WB1E 1I4GA 2HD3A 3W1BA 1LTID 1E2WA 3ND9A 4OX9L 3CD6A 5C0XJ 1A15A 4JYAQ 4JBJA 4TQUS 1WI5A 2I5HA 5JJLA 4DV0L 1B7YB 1HPCA 3SVMA 4IPGA 1XX8A 1S5DD 5C3EH 3K58A 1SNPA 5M3MH 3KJPA 3QB3A 2DY8A 2VB2X 1BXTA 1LT4D 3S16B 3U4ZA 4BY7B 2QEJC 1O7IA 2L12A 3MXUA 2MHVA 3DWPA 4A3JH 2HHHL 1VQOA 2IL8A 2R93G 4JI3Q 5IYBH 2XWJB 4PMCA 2EDGA 4A3MH 4DK3C 1VQNA 1B70B 1LT3D 4ME5A 5IGDA 2BOSA 3CAMA 1F9RA 1I6HB 1EWCA 3OW7A 4I7ZC 3UDIA 1SYGA 1IBLQ 4FF2A 3CU7A 3HFZB 1PH8A 3HOXB 4BBSB 2R61A 1PFSA 4DGZA 4A3CG 4DK0A 3VR2A 5C3XA 1KNAA 2F0TA 4YWMA 4YWKA 4GN5A 4G7ZC 3X3MA 1DCZA 1BCPD 1X6OA 3CMEA 1K83H 4OELB 2Z0SA 1ASYA 3NHHA 3CCQA 4DUZL 5GADC 1BKBA 2ZXRA 4X66L 2CQAA 1VQEA 3IRBA 1WTQA 4DKAC 1CI3M 5JPMC 3IAYA 4NXNQ 3PO2B 5ELBA 1U9RA 3PCOB 3D4DA 4JI5Q 4QQBX 3H0GH 1KAAA 2RDGA 1OTCA 1SR3A 3GTJB 2R92H 1ENFA 4RKLA 4LF8Q 1WVLA 2CH4A 1JB3A 4HIMA 4XT3B 3O13A 4IPHA 4ZAIA 5GROA 1JOQA 2BA1A 3BDLA 2NYZD 4WJ4A 2B2VA 3SDZA 4KN4C 4AYBE 2Q8IB 1F9QA 2B2UC 4N8X1 4YCUA 4A3BB 2KVMA 1FYCA 1V1PB 2ASBA 4UAIA 5K36H 3HOWG 2AWNA 4PZ7A 3S2HH 1M90C 2VW9A 1SLJA 3MHBA 4RGNA 5COYA 1KTKA 4ZKBB 2E74C 4LF4Q 1JOKA 4H44C 5E4XA 1WTXA 2OEOA 1ML0D 3EFXD 1CUKA 3FP9A 5FKAC 5BN3A 4A93G 4WORA 2RA4A 5C4XB 1UEAB 1U4RA 3QG1A 1LM0A 1DZ1A 2VQEL 1HQRD 4LWCA 3S14H 1JOOA 3AFPA 3TP7A 4A3KB 1ILPA 3BVGA 1IKMA 3BS1A 4A3DH 4YCWA 1EFID 1D5XC 1XJVA 1VQCA 2MGSA 2YYZA 4EQNA 1B44D 4KY7A 1JMCA 4PZ8A 5FO9B 3KF8B 1V1OA 1O78A 4K8JA 1OXUA 1Q82C 4KK7A 3I8ZA 4LFCQ 2NUCA 2ZJRA 2F0QA 4JBWA 4RHSA 4EQPA 1L2FA 5J39A 1AW7A 1KRTA 5FLMG 3MAQA 1K9MC 1SE3A 3DM1A 4X64Q 2WV6D 3KLSA 2L4NA 3BVMA 4X65L 3F8TA 1L0XB 4DR5L 1A3VA 3ITPA 1FJGL 1HCZA 1WTVA 4OEMB 1CK1A 3A8JE 1LTGD 3GP7A 3A54A 3X3NA 5CC4A 1D5MC 2ALYB 3E6ZX 3S17H 2EJFC 1K0SA 5C44H 3SGIA 4IUVA 3MXGA 4DV4L 2OQKA 1X3GA 1NTGA 3K0XA 3I4NH 2K7VA 3PIOA 4OO1G 1KNEA 1D1KA 3P75A 1I5FA 2Q8TA 2B2WC 2AWOA 1CQVA 2B63H 4K6DA 2EY2A 4XYOA 1J5EL 2IPKD 2D0OA 4PNYA 4BY7G 5G3LF 4ZKCB 3EIVA 1SNCA 3ND8A 1XNRL 1EU3A 3LNNA 2D9UA 2FJ2A 3J7AF 4A3IB 1SMYD 1SFOB 3F1ZA 3TDQA 4PMWA 1NR4A 2Z8LA 4X62Q 4HEDA 4A3LG 4X3KA 1IKLA 2E2IB 3NK9A 5FLXE 2BDOA 3PV0A 2EYOA 2JP1A 1YHBA 2PO4A 3BU2A 2B63B 4V0BA 2YTYA 4BXXH 1WD0A 3PSIA 1J9OA 2Y0SE 3HOXG 3K6OA 5DAUA 1DGSA 3J7YW 4BBSG 4RGOS 1XMOL 3I4MH 4HIKA 2K28A 1VQ4A 2F0OA 3J80E 2AUKA 5CYUA 4HJ5A 4XYQA 2I5LX 2J0TD 1ILQA 2DN8A 4DR7L 4PMBA 2IX0A 4BS9A 3PO2G 1SJHD 4ODGA 2MO0A 1EFWA 1WCMB 4K6LA 2Z6KA 3AU7A 4UPAA 3RLOA 2QEXA 5KYLA 3SE0A 3T1YL 5EPLA 2GVAA 3S1MB 4RGTA 2NZOA 1B1ZA 2NVTH 4DR1Q 4DAMA 3U50C 2QDBA 2UUCQ 2PQAA 4A3BG 3I72A 1BCPF 3HOUB 1NBWA 3OSOA 1XNQQ 2ZJQA 4GLXA 1BBWA 2LFNA 3W1GA 1I4RA 1F9PA 1YIJA 3H94A 2GVBA 4MHEA 1JE5A 4A76A 1LTRD 4XQQA 1HNWQ 4H13C 1B3AA 4HIDA 4R9WA 2ICEC 3BYTB 3I56A 2IT1A 1QG7A 3PUVA 4JVZA 1YJNA 3IFTA 4RA8A 1E2ZA 2F0UA 3VYRA 5C4XG 2YU9B 3M3YH 4IZ8A 3HP3A 3NEMA 1DOMA 4A3KG 5HGQA 1SYFA 2XNAC 3K59A 1G2TA 4R4TA 2L55A 3DM3A 4KTAA 3L9AX 3I7FA 4B3RQ 1HTPA 4KKTA 1H9SA 2WP8J 1PFMA 2MUYA 1BQQT 1HFGA 3W5OA 2F4VQ 3H3VC 1N32Q 2HUGA 3ER0A 4G57A 5AFWA 2CFMA 1SYEA 3PO3B 4B08A 3HS0C 3CHBD 2EY6A 5JEAG 1PH9A 4LF7Q 2X6GA 3OIPA 2TSSA 1RJTA 3OWEB 3C2PA 1B2TA 3CPFA 2VY3A 2IJ0A 3P20A 1ONLA 2FFKB 2DY7A 2QKIC 3RN2A 1KXLA 5IP7G 2WACA 3S2DB 1HNZQ 1HJPA 1RODA 3SK6A 3G71A 1K8AC 1EQQA 2IHFA 1KDAA 2AUJD 1JWUD 2L11A 3HKZB 4OX9Q 3OMCA 4MTKA 4DV0Q 4QF4A 1SN8A 4DV2L 1EIHA 3MFYA 3W3AA 2Z6BA 4POGA 1C9OA 4LK1C 1YBYA 3KBXA 2B8GA 2DGYA 4IFDJ 2M00A 1NSNS 3OMGA 1WTPA 3M4QA 4XQNA 4BBRB 2ZTEA 5I9PA 4A3IG 2N55A 2PQAB 5KNCA 1E2VA 2Z1CA 1I6VC 1TWAB 2HHHQ 3J81L 3PIO3 2KECA 3D31A 2LS01 5M5YH 1S72A 5C5LA 2NBFA 3OTOL 1TY0A 2CW0D 3CCLA 5ISRA 3GTGB 1EL0A 1PTOH 2B63G 1SE8A 1ZYRD 3NQIA 3GTMH 1HR0W 2B2VC 1K8MA 4A3GH 3QOJA 1HZAA 4K8IA 1YNXA 2D5DA 2H4OA 4OO1I 2F0MA 1GVPA 2EY5A 1XTCD 2VXWA 4L6TB 1PZKD 2K5WA 1Z7TA 3IL8A 4OONA 4DUZQ 4DNTB 2QCPX 2OQ0A 4A3FB 2EPBA 3DMUA 3GTPB 3CCVA 5EKKA 2XWBB 4IURA 5EAYA 1E0BA 1HTLD 4C3IH 2V4DA 5ELDA 1Q8IA 1H9SB 1WCMG 3UDFA 3NTHA 2K5NA 1HNXQ 1GXDC 1QNUA 1SRUA 1C0AA 2XVSA 1GJXA 2B2YA 4OHJA 4JG2A 5M5WH 4OIKA 1AZQA 2R93H 3M7NA 1STNA 3HOUG 1F2MA 1EY7A 4C3IB 2PI2E 2X69A 1RF2D 4C1NK 1N8RC 1WTHA 1Y1VB 3LX0A 2JSOA 3CF5A 1Y1WB 4DK6C 4A3CH
chains in the Genus database with same CATH topology
3QWNA 4RFBA 2FMMA 2QILA 5C3WA 1X3PA 1NUCA 1BF4A 3DXJC 3N52A 1ICWA 5C6AA 3TMEA 1QOHA 2F0EA 3I70A 1AEXA 2HDMA 1F9SA 3KUPA 5FO8B 1SE2A 3A56A 1LTSD 3V05A 1O80A 2L9HA 3U9OA 4NW2A 4KHVA 4IALA 3LWUA 3A8KE 3VYSA 3IFDA 5I2YA 3SK4A 2NN6I 4RHRA 3MFGA 1OXXK 1TWHB 2RSNA 1BR9A 4AYBB 5C4JB 4XQJA 2H1EA 5DM73 1C48A 1GUOA 4FF3A 4KN7C 1D2BA 1SNOA 3HGBA 3KBGA 2E76C 5ELCA 2A69C 4ZUIA 2JA8B 3PUXA 2F0WA 1PRTD 5I6YA 2BE5C 1I50B 5KIXA 4HMJA 2E2JB 4CKBA 3A8IE 1IYVA 4A3EB 1S5CD 4ID6A 5J22A 2RKSA 1TWCB 3NXWA 3MVVA 3NWSA 4Q0FA 1ENCA 5T1GA 4I65A 1XXGA 5JVH3 1EEFD 1EY5A 3K57A 3VYTA 2O4XA 1PZJD 2KEEA 4OGQC 2NVYB 4G4KA 4KMUC 1YNJD 2R6GA 3V96A 3RLFA 3NSWA 5IT9L 1S5BD 4Y7NB 1IW7C 2JA5B 2BDNA 4S3SA 3NPPA 1C4QA 1VMCA 3TZDA 2IX1A 4OO1H 1RTOA 1STGA 2K5DA 5EGTA 5D65A 4UDUC 4ZK9B 3CKIB 4FP5D 3TSSA 1V1PA 2A68C 1H9JA 1QE6A 3F2UA 1BCPB 3M4OB 1G291 5I4DA 2SEBD 3R2IA 1PTOC 1SSOA 2FHTA 1ZEQX 3UI2A 4C3IG 1IYUA 2C9OA 3MXNA 2F0PA 4BA2I 3PUYA 2LKVA 5J1ZA 1Y8OB 1LACA 2K33A 1II3A 2M2LA 2EYJA 1JWMD 4NMZA 1A3UA 3KF8A 2F4IA 1I4QA 4L63B 3CRLC 4M1UB 3NBIA 1TU2B 3OHXC 1SNDA 4E6IA 5LHY1 2PNRC 4NP5A 3FKIB 2E2DC 5CV6A 4ILWA 3RUZA 1SNMA 4RKBA 3NTIA 1EYDA 2KHSA 3M85A 3NTKA 4DU9A 4K14A 1I4PA 2JA7B 4CJ1B 3GTOB 4CGYB 1R4QB 4BA1I 4DAYA 2D2CC 1GUSA 4F7XA 1Q1EA 2O5IC 3SHLA 1ESFA 2EE1A 3TN2A 4CBVA 1EY9A 3HZXA 3BDCA 2F0LA 5CV5A 2K03A 2B8FA 2B2YC 5JEAH 4FXGC 3GTQB 1H9RA 3QOLA 1PRTF 4J8QA 4B9XA 2F0VA 3VR3A 1FD7D 1JWSD 3EVQA 5D3DA 1X3QA 1PZID 4NKLA 4KY6A 3MA2B 4WJWA 3RZDB 1FNUA 2J7ZA 1SYDA 3T13A 3HOYB 1OXSC 2R3ZA 5CR3A 4C3HB 4U673 1SNQA 1G91A 4NDXA 1TS4A 5EPJA 5I6WA 3H6MA 2VUMB 1EQTA 1AN8A 1EEID 1TS2A 4RWSC 5DM63 1G2SA 1BCPC 1LTTD 5A2QL 2M9VA 1DOLA 2JA6B 3GTLB 1Y8NB 3SEBA 2MPMA 5CV8A 3N6RA 3TP6A 2E2HB 2WAQB 3CRKC 1GHJA 5IGBA 2Q8RE 3MEHA 1SDFA 1G6ZA 1RTNA 3Q22A 3I73A 5KRUA 1X32A 4P2CB 2F0IA 2JEBI 1QCBD 1M4VA 1WTWA 3ZYYX 1MBYA 1TWFB 3JAME 1LTAD 1NCVA 3HOVB 2PZTA 5D3IB 4BY1B 1WTOA 2RQXA 2WINB 4Q5VA 1CZGA 1Y8PB 1I4XA 1RDPD 3FDTA 5KNDA 1S5ED 2NN6G 2NVXB 4FVMA 4ULLA 4IUNA 2B39A 4F8MA 3MXPA 4FO2A 3MZ5A 2LY7A 2JYOA 4K5VA 4KV6A 4QCLA 2G9DA 1I4HA 3J7AV 4FNFA 3T51B 3PUZA 3K7AB 2KA7A 3BYYB 3K0YA 1GOZA 5TSSA 4R8NA 1DONA 1ESRA 1NAPA 1V43A 3D4WA 1D6EC 3H09A 2NB0A 3G7LA 5C4HA 1LV9A 1STBA 1SMYC 5IODA 5M5XB 4C3HG 1QWYA 3OIQA 1HA5A 5I2XA 3WOEA 3I4LA 5BN5A 2EY1A 3S1QB 1DOKA 4HTHA 2CVRA 3OOCA 1PMRA 1STYA 4O1NA 4BWGB 2WKDA 4LAAA 1H9KA 3DEPA 5T1IA 3OWFA 5LL6X 4EVOA 5KNBA 2A5HA 5KEEA 3S9WA 1AP0A 3P1HA 4ZUJA 1U4LA 3GQBA 1ET6A 2E75C 2KCNA 2R7ZB 4PV1C 1CT1D 2BCOA 1PLFA 1O7YA 3P7JA 1EWHA 2AQ1B 1EIGA 5NUCA 1I3QB 2WB1B 4KI0A 1CA5A 3VA5A 1LLRD 3T53B 2F0KA 2HDLA 4CKEA 5C4ZA 4FXKC 4C1NI 1R9TB 1ENAA 1SEBD 4MIUA 2FMCA 4ZYSA 4RH6A 3SK8A 4O42A 1CZWA 3D6CA 2EJGC 1ZKOA 3HOZB 1D5ZC 2L1BA 1G8ZD 4Z9CB 5F2DA 2EYPA 2XN9C 1OXTA 3VYUA 4YIJA 1KDCA 2PQEA 2VNUD 5IIFA 3M7GA 2K1BA 2WIIB 5C0XI 5FO7B 4GZYC 2MP1A 2PW7A 1PRTB 3FPPA 2EYMA 1IW7D 2G9HD 1NR2A 2EYLA 3C46A 3J80L 1SXTA 3H91A 1CHQD 3LWEA 2K01A 2F0FA 2ENBA 1BUVT 1YNND 1SE4A 4QB4A 5JVG3 3A7LA 2EJMA 1GUGA 1TWGB 1PTOD 4CHTB 1BNZA 3ERQA 4DNRB 1GUNA 1EQVA 2F0DA 2PW5A 4DA2A 3NWTA 4K2KA 3BZDB 2SNMA 1JC7A 4XTCS 5JJZA 3S1NB 5DNFA 3WDNA 5K5PA 3W2DA 1B9NA 1ZYRC 2PZUA 3NP8A 4FXDA 2OT2A 1LO5D 3CQZB 5E3FA 1EYCA 4XDXA 2I07B 5CGKA 1SBBB 2A6HC 2A6EC 3RZOB 2O5JC 1L0YB 2HQEA 4KKUA 1Z47A 1CTMA 4TSSA 1B9MA 4DK1A 1HRJA 2F0NA 1HXYD 5A2QE 5ELEA 4C56C 2TMPA 4B9WA 1M8AA 2PZWA 1DXMA 5JOBA 2K05A 2QF7A 3V2TA 3D8GA 1Y69U 3NQTA 4KJOA 4R8IA 4H0LC 3T4AC 5CBAE 2F3VA 4IQZA 4G7HC 4IFDG 4X3SA 1FNWA 2RBMA 1A3TA 1Q1BA 1TKWB 4CJ2C 4DXFA 5CV7A 3C3LA 4CKCA 5EKIA 2EOTA 2PPBC 1O7LA 1BBXC 3GO5A 2F03A 1S5FD 1Q12A 2Y0SB 2IX3A 2F0JA 3EJIA 2K04A 3NBHA 5CBEE 4DN4M 4QUFA 3TZUA 1A6XA 5C0XH 1VDZA 2DNCA 1CQFA 4FYDA 4DF7A 2N88A 2KOLA 2VB3X 5CV9A 4K5WA 5ELFA 1J8IA 1PRTC 2F3WA 5IGCA 3HRZC 5C3EB 1JE4A 1T5XD 5M3MB 3VA7A 2NTSA 3URYA 2J4XA 4OL7A 4A3JB 2ICIA 3D4RA 2NN6H 4OIJA 1FR3A 1O7ZA 4L8JA 2ZXOA 4A3MB 4H7BA 3EQLC 1TT2A 3C1FA 5FK9C 5FOBB 3E5SA 3QJYA 1QNKA 1DJRD 3EA6A 1YNJC 3R93A 1PTOF 1K83B 5JEAJ 1MI2A 1VCIA 4IN3A 3FVQA 1PYWD 2KEDA 1C8CA 2K6AA 3C1EA 3H0GB 3PIP3 1IL8A 2R92B 2PYKA 4J6HA 1JCKB 4HN7A 1HFNA 1SAPA 4X3TA 3D3RA 1GUTA 3BDOA 4XXEA 5IGEA 4RAUC 1AZPA 4IUTA 4N9PA 2EYHA 4X3UA 4F87A 4U68A 1K8OA 3J81E 3S2HB 3SK5A 4MN3A 1Q90A 1UUPA 1ZXTA 4IUPA 4KD4A 3L3OC 4ABNA 1TR5A 2A74C 4ZLTF 3S14B 1PXUA 2A73B 3KLSX 5JAVA 5E1FA 4IUUA 2NWGA 1A2TA 5A35A 4A3DB 3VR6A 3R2TA 2OF1A 1HA6A 4XT1B 1MSGA 4RGMA 2AQ2B 4DAVA 1CHPD 1F2ZA 3DUZA 5IGFA 1STEA 5HURA 2NZ1D 3K5MA 1STHA 1OO9B 5HGTA 3AMUA 4IFDI 3S17B 5C44B 1SYCA 4TRDA 1HHVA 2B2TA 3FRPB 1CA6A 1GHKA 2MJ8A 3I4NB 1KLUD 3HG9A 3GV3A 4M8AA 4EQOA 2EYFA 5C0XG 3R8BA 1DM0B 2KUMA 1TS5A 3Q24A 1S4ZA 3Q0AA 1TY2A 3IKJA 1ET9A 5IGGA 1F2LA 1QB5D 2X6LA 1CFMA 1JICA 5CMDA 2L0CA 1WTRA 5EJWA 3MC0B 1Z6HA 3KK7A 2F1MA 2RSOA 5EQ0A 3I4MB 2K32A 3NE5B 3K5NA 2IW3A 1UAPA 1RHPA 2L5TA 4HR7B 4FF4A 4KHZA 2NTTA 1TVXA 4HSVA 3AB9A 1VMPA 1CM9A 2AQ3B 4DAPA 1B4OA 4KKSA 2RDHA 2KCCA 3T16A 1STAA 4N9TA 3U9SA 1LT6D 3MWYW 2O2LD 1EZ8A 2NVTB 1RKNA 3FEWX 4HSPA 3NUCA 1BO0A 2K5QA 4ZQ3A 3DHQA 1KABA 4CJ0B 5K36G 3DWQA 1SYBA 3RMHA 1D1IA 1TS3A 1MGSA 2GA4B 1HQMC 2XRSD 1MSHA 2F0HA 3VR5A 2EZVA 1BDOA 1W6KA 1JQYD 2F0SA 1BOSA 4QUCA 3D6WA 3M3YB 5IT9E 5KYIA 5CV4A 4HCSA 1KLGD 4LJZC 3RD4A 1LTBD 3E0JA 2RVLA 5M3FB 1LABA 3K5OA 1DYQA 1PDQA 4QIWB 2JEAI 1B50A 3K5LA 2ZT9C 4V190 2XRQD 2CHBD 1MD2D 1RCVD 2WKCA 4F88A 4FF1A 4RCNA 1EYAA 2LMCB 1HUMA 2DNEA 4IUQA 4LMQD 1F2YA 1W6JA 2JXMB 1PFNA 2XIWA 4IFDH 4JK1C 2A69D 4DXGA 1JR0D 2BE5D 4TKOB 1LT5D 3TP8A 4C3JB 2B2UA 2XSCA 2F0GA 1GUWA 1EY0A 3L7ZC 1JORA 1QJOA 2ZXPA 3KLRA 5M5YB 1EOTA 2A6HD 2A6ED 4XIGS 1PTOB 3MTSA 4ZRZA 3GTMB 4KY5A 3WOFA 1UNSA 1XWEA 3PUWA 4A3GB 3I3CA 3EROA 5BN4A 1F77A 3I90A 3DEOA 2SOBA 3BG3A 1OXVA 5C5MA 4C2MB 5FLXL 5LL6S 2FINB 5M9OA 3I91A 3FMCA 5I9OA 5EBDA 1XYIA 4K2LA 4HCEA 4RCOA 4HAEA 4HMIA 4KD3A 5M5WB 2A68D 5E4WC 2R93B 1B53A 2PMZB 2ID0A 1R4PB 1Q3LA 5D14A 3GD7A 3A55A 2HCIA 4PQXA 5DEHA 3JAML 1EY4A 4QMGA 2HCCA 2NVQB 3SXHA 1FNVA 5EKLA 2B2WA 1EY8A 1WD1A 1T5EA 1EY6A 1VF7A 3BVZA 2RDFA 2OXPA 2CW0C 3QO2A 1HUNA 2KQ3A 5EPKA 2EXZA 1EZ6A 1AFPA 2B2TC 3A7AB 3S15B 2PCFB 1VF5C 3FPUB 1U4PA 2SDFA 5KGUA 1FGBD 3PMFA 3S1RB 4EGVA 4DFAA 1TIID 3Q6SA 3R3OA 1PFBA 2EVBA 3HOWB 5EBCA 1V8QA 3DWAA 5JPNC 4WRDA 3M4YA 3TP5A 4A93B 3ONAB 1TQOA 2Z4IA 1RD9D 2Z4HA 4KJNA 1SJED 1KDBA 3HEJA 3VR4A 2C5CA 4C3JG 3G6JB 1IHZA 2IWHA 1QILA 3GV6A 3T56B 5IOCA 3TBIB 3GTKB 2SNSA 2D62A 1A2UA 2BA0A 4G7OC 4WFN3 1EU4A 5G3LD 4J1MA 3SR1A 5CORA 1U4MA 2I46A 2JE6I 3OPOA 4K5XA 1H9MA 3QIAA 1YNNC 2KJXA 1DD2A 3Q23A 1I4GA 1LTID 1E2WA 3ND9A 5C0XJ 1A15A 4TQUS 1HPCA 3SVMA 1XX8A 1S5DD 3K58A 1SNPA 3QB3A 2DY8A 2VB2X 1BXTA 1LT4D 3S16B 4BY7B 2QEJC 2L12A 3MXUA 2MHVA 3DWPA 2IL8A 2XWJB 4PMCA 2EDGA 1LT3D 4ME5A 5IGDA 2BOSA 1F9RA 1I6HB 1EWCA 3OW7A 4I7ZC 1SYGA 4FF2A 3CU7A 3HOXB 4BBSB 2R61A 4DGZA 4DK0A 3VR2A 5C3XA 1KNAA 2F0TA 4G7ZC 3X3MA 1DCZA 1BCPD 3NHHA 2ZXRA 2CQAA 1WTQA 5JPMC 1CI3M 3IAYA 3PO2B 5ELBA 1U9RA 3D4DA 1KAAA 2RDGA 3GTJB 1ENFA 4RKLA 1WVLA 1JB3A 4XT3B 3O13A 4ZAIA 1JOQA 2BA1A 3BDLA 2NYZD 2B2VA 3SDZA 4KN4C 2Q8IB 1F9QA 2B2UC 4A3BB 2KVMA 1FYCA 1V1PB 4UAIA 5K36H 2AWNA 3MHBA 4RGNA 5COYA 1KTKA 4ZKBB 2E74C 1JOKA 4H44C 5E4XA 1WTXA 2OEOA 1ML0D 3EFXD 5FKAC 5BN3A 4WORA 2RA4A 5C4XB 1UEAB 1U4RA 3QG1A 1DZ1A 1HQRD 1JOOA 3TP7A 4A3KB 1ILPA 3BVGA 1IKMA 3BS1A 1EFID 1D5XC 4EQNA 2MGSA 2YYZA 1B44D 4KY7A 5FO9B 1V1OA 1O78A 4K8JA 1OXUA 4KK7A 3I8ZA 2NUCA 2F0QA 4JBWA 4RHSA 4EQPA 5J39A 1AW7A 3MAQA 1SE3A 3DM1A 2WV6D 3KLSA 2L4NA 3BVMA 1L0XB 1A3VA 3ITPA 1HCZA 1WTVA 1CK1A 3A8JE 1LTGD 3GP7A 3A54A 3X3NA 5CC4A 1D5MC 3E6ZX 2EJFC 4IUVA 3MXGA 2K7VA 4OO1G 1KNEA 1D1KA 3P75A 2Q8TA 2B2WC 2AWOA 1CQVA 4K6DA 2EY2A 4XYOA 2IPKD 4PNYA 5G3LF 4ZKCB 1SNCA 3ND8A 1EU3A 3LNNA 2D9UA 2FJ2A 3J7AF 4A3IB 1SMYD 1SFOB 3TDQA 4PMWA 1NR4A 2Z8LA 4HEDA 4X3KA 1IKLA 2E2IB 3NK9A 5FLXE 2BDOA 3PV0A 2EYOA 2JP1A 2PO4A 2B63B 4V0BA 1WD0A 1J9OA 3K6OA 5DAUA 3J7YW 4RGOS 2K28A 2F0OA 3J80E 2AUKA 5CYUA 4XYQA 2J0TD 1ILQA 2DN8A 4PMBA 2IX0A 4BS9A 1SJHD 4ODGA 1WCMB 4K6LA 3AU7A 5KYLA 3SE0A 5EPLA 3S1MB 4RGTA 1B1ZA 2QDBA 3I72A 1BCPF 3HOUB 3OSOA 2LFNA 1I4RA 1F9PA 3H94A 4MHEA 1LTRD 4XQQA 4H13C 1B3AA 4R9WA 2ICEC 3BYTB 2IT1A 1QG7A 3PUVA 3IFTA 4RA8A 1E2ZA 2F0UA 3VYRA 2YU9B 4IZ8A 3HP3A 1DOMA 1SYFA 2XNAC 3K59A 1G2TA 2L55A 4KTAA 3L9AX 1HTPA 4KKTA 1H9SA 2WP8J 1PFMA 2MUYA 1BQQT 1HFGA 3H3VC 2HUGA 4G57A 5AFWA 1SYEA 3PO3B 4B08A 3HS0C 3CHBD 2EY6A 5JEAG 2X6GA 3OIPA 2TSSA 1RJTA 3OWEB 3C2PA 1B2TA 2IJ0A 3P20A 1ONLA 2FFKB 2DY7A 2QKIC 2WACA 3S2DB 1RODA 3SK6A 1KDAA 2AUJD 1JWUD 2L11A 3HKZB 3OMCA 4QF4A 1EIHA 3MFYA 3W3AA 4LK1C 3KBXA 2B8GA 4IFDJ 2M00A 1NSNS 3OMGA 1WTPA 4XQNA 4BBRB 5I9PA 2N55A 5KNCA 1E2VA 2Z1CA 1I6VC 1TWAB 3J81L 3PIO3 2KECA 3D31A 2LS01 5C5LA 2NBFA 1TY0A 2CW0D 5ISRA 3GTGB 1EL0A 1PTOH 1ZYRD 3NQIA 2B2VC 1K8MA 3QOJA 4K8IA 2D5DA 2H4OA 4OO1I 2F0MA 2EY5A 1XTCD 2VXWA 4L6TB 1PZKD 2K5WA 1Z7TA 3IL8A 4DNTB 2QCPX 4A3FB 2EPBA 3DMUA 3GTPB 5EKKA 2XWBB 4IURA 1E0BA 1HTLD 2V4DA 5ELDA 1Q8IA 1H9SB 3NTHA 1GXDC 1QNUA 2XVSA 1GJXA 2B2YA 4OHJA 4OIKA 1AZQA 3M7NA 1STNA 1F2MA 1EY7A 4C3IB 2X69A 1RF2D 4C1NK 1Y1VB 3LX0A 2JSOA 1Y1WB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F2Y A;  4MIU A;  5EKL A;  5CV9 A;  1JOK A;  2F0O A;  2OEO A;  1EY8 A;  1EYC A;  4K5W A;  5E3F A;  3SK6 A;  5C3W A;  1NUC A;  1EY6 A;  5CGK A;  3SK8 A;  1KDA A;  4F7X A;  3D6C A;  4R8N A;  5CV8 A;  3TP6 A;  2RDF A;  2OXP A;  4WOR A;  3OMC A;  1TR5 A;  4PMB A;  3SHL A;  5C6A A;  4S3S A;  2F3W A;  3TME A;  2KQ3 A;  5IGC A;  5JAV A;  2F0E A;  2HQE A;  5E1F A;  2EXZ A;  1EZ6 A;  1JOO A;  1AEX A;  4QF4 A;  1STG A;  3TP7 A;  5EGT A;  3D4W A;  1A2T A;  4ODG A;  1SNP A;  5IGB A;  5F2D A;  3QB3 A;  2EYP A;  3T16 A;  3TP8 A;  5C4H A;  1STA A;  2F0G A;  2M00 A;  1STB A;  5KGU A;  2OF1 A;  1EY9 A;  3MEH A;  4N9T A;  1KDC A;  4YIJ A;  1NSN S;  3OMG A;  4OL7 A;  4EQN A;  5KYL A;  5IOD A;  3PMF A;  1EY0 A;  2PQE A;  4KY7 A;  3HZX A;  3BDC A;  3U9O A;  1EZ8 A;  5I9P A;  4KHV A;  1JOR A;  2F0N A;  1RKN A;  5IIF A;  4IAL A;  2F0L A;  4K8J A;  3NUC A;  5KRU A;  4H7B A;  4PMC A;  2NUC A;  1F2Z A;  1TT2 A;  2F0Q A;  2PW7 A;  2QDB A;  5CV5 A;  4ME5 A;  4DFA A;  5C5L A;  4EQP A;  5IGD A;  2EYM A;  3C1F A;  3SK4 A;  4ZQ3 A;  3DHQ A;  3E5S A;  3R3O A;  1KAB A;  2F0I A;  2EY1 A;  5IGF A;  1SYG A;  4B9W A;  5HUR A;  1SYB A;  5ISR A;  4HTH A;  2EYL A;  3OSO A;  4KY5 A;  2PZW A;  5JOB A;  1STH A;  3V2T A;  3D8G A;  3QOL A;  3NQT A;  4KJO A;  1A3V A;  3ITP A;  2F0P A;  5HGT A;  4DGZ A;  1STY A;  3ERO A;  5C3X A;  2F0T A;  3QOJ A;  2F0F A;  2ENB A;  4K8I A;  2SOB A;  4WRD A;  4B9X A;  5CC4 A;  1SYC A;  2F0V A;  4TRD A;  2LKV A;  4LAA A;  4QB4 A;  5C5M A;  2F0M A;  1SNO A;  2EY5 A;  2F0H A;  2F3V A;  3OWF A;  3NHH A;  5J1Z A;  3TP5 A;  3EVQ A;  1II3 A;  2PZT A;  4ZUI A;  4NKL A;  2F0S A;  2EYJ A;  2RBM A;  2F0W A;  1A3T A;  4EVO A;  4NMZ A;  3DMU A;  2F0U A;  4KY6 A;  1A3U A;  5I6Y A;  5CV7 A;  5EKK A;  3C1E A;  5KEE A;  5KIX A;  1TQO A;  4IZ8 A;  4HMJ A;  5CV4 A;  5KYI A;  3ERQ A;  5M9O A;  3S9W A;  3P75 A;  1SYD A;  1U9R A;  3T13 A;  3D4D A;  3P1H A;  4EQO A;  4KJN A;  2EYF A;  5I9O A;  4K6D A;  1SYF A;  2PYK A;  1KAA A;  4J6H A;  1KDB A;  4ZUJ A;  1SND A;  2EY2 A;  3HEJ A;  4E6I A;  5J39 A;  1EQV A;  2F0D A;  4K2L A;  4RKL A;  2PW5 A;  4ID6 A;  4PNY A;  4KTA A;  5J22 A;  2RKS A;  1IHZ A;  4NP5 A;  3NXW A;  4HMI A;  4KD3 A;  1SNC A;  5CR3 A;  5IOC A;  1JOQ A;  3MVV A;  4K2K A;  1SNQ A;  5CV6 A;  2SNM A;  3BDL A;  3RUZ A;  1SNM A;  2SNS A;  4NDX A;  4IUN A;  5IGG A;  1A2U A;  5IGE A;  4RKB A;  1ENC A;  4F8M A;  4I65 A;  2EYH A;  4N9P A;  5I6W A;  3H6M A;  3MXP A;  4G57 A;  5K5P A;  3MZ5 A;  2F0J A;  1EYD A;  1EY5 A;  2KHS A;  1SYE A;  3EJI A;  1STN A;  2EY6 A;  3NK9 A;  4K5V A;  5NUC A;  4J1M A;  4DU9 A;  2EYO A;  2O4X A;  1F2M A;  4K14 A;  4KV6 A;  3SR1 A;  3VA5 A;  1EY7 A;  2PZU A;  3NP8 A;  5DEH A;  2F0K A;  3SK5 A;  1EY4 A;  5C4Z A;  4K5X A;  1EYA A;  3LX0 A;  4DF7 A;  5DAU A;  4KD4 A;  3MHB A;  4QMG A;  3SXH A;  2WAC A;  1ENA A; 
#chains in the Genus database with same CATH topology
 3QWN A;  4RFB A;  4B3T Q;  2FMM A;  2NVQ H;  2QIL A;  5C3W A;  3J81 c;  1X3P A;  1NUC A;  1BF4 A;  1VQJ A;  3DXJ C;  2N8N A;  1NMF A;  3N52 A;  4IOC A;  5H1S E;  1ICW A;  5C6A A;  1HH2 P;  3TME A;  1QOH A;  2F0E A;  3I70 A;  1AEX A;  2ZJP A;  2HDM A;  1F9S A;  3KUP A;  3S15 H;  1G6P A;  5C4J H;  5FO8 B;  4DUY L;  1SE2 A;  3A56 A;  4DV7 L;  1LTS D;  3V05 A;  1XTD A;  2KBN A;  1O80 A;  2L9H A;  3U9O A;  4NW2 A;  4KHV A;  4IAL A;  4A75 A;  3LWU A;  3A8K E;  2HIX A;  3VYS A;  3IFD A;  5I2Y A;  4LFA L;  3S1R H;  3PO3 G;  3SK4 A;  2NN6 I;  4RHR A;  3MFG A;  4R4Q A;  3ICE A;  1OXX K;  1WOC A;  1TWH B;  2RSN A;  1BR9 A;  3HOW H;  4AYB B;  5C4J B;  4XQJ A;  2H1E A;  4EX5 A;  4DR5 Q;  3UDX A;  1FJG Q;  1N9W A;  3H3V I;  5DM7 3;  1C48 A;  1GUO A;  4FF3 A;  4KN7 C;  1D2B A;  4MTN A;  1SNO A;  3HGB A;  3KBG A;  2E76 C;  5ELC A;  2A69 C;  3HKZ G;  3VDY A;  4ZUI A;  2JA8 B;  2UUC L;  3PUX A;  4A93 H;  2F0W A;  1PRT D;  5I6Y A;  3ULJ A;  3ULP A;  2BE5 C;  1I50 B;  5KIX A;  2NZH A;  4CDF C;  4HMJ A;  2E2J B;  4CKB A;  3A8I E;  1IYV A;  3PIP A;  4A3E B;  3CC7 A;  1S5C D;  4ID6 A;  1E24 A;  5J22 A;  2RKS A;  1J5E Q;  1TWC B;  3BZC A;  3NXW A;  3CCE A;  2K75 A;  3MVV A;  4BBR G;  3GTK H;  3NWS A;  5LMN W;  1XNR Q;  2V1C C;  3K8A A;  4Q0F A;  1MJE A;  1ENC A;  1K28 A;  5T1G A;  4I65 A;  4OXP A;  3RN5 A;  1XXG A;  5JVH 3;  1EEF D;  2Z6K C;  1EY5 A;  3K57 A;  1MJC A;  5FLM H;  4UP7 A;  2O4X A;  3VYT A;  1WJJ A;  1PZJ D;  1XPO A;  2KEE A;  3H15 A;  2MFI A;  4OGQ C;  2NVY B;  2FXQ A;  4G4K A;  4KMU C;  1YNJ D;  2R6G A;  5GQO A;  1XMO Q;  1IBK L;  3V96 A;  3RLF A;  1N32 L;  1QUQ A;  2JN4 A;  3NSW A;  5IT9 L;  1S5B D;  4Y7N B;  2UXB L;  4JI8 Q;  2VS1 A;  1IW7 C;  1K3R A;  3TQY A;  4GKK L;  2JA5 B;  2BDN A;  4S3S A;  4A3F G;  3NPP A;  3E9I A;  1C4Q A;  1VMC A;  4RG1 A;  3TZD A;  2IX1 A;  4DR7 Q;  4OO1 H;  1RTO A;  1STG A;  2K5D A;  2RF4 A;  5EGT A;  3CC2 A;  5D65 A;  4UDU C;  4ZK9 B;  3J7A 5;  3CKI B;  3PF5 A;  1XMQ L;  4FP5 D;  3TSS A;  1V1P A;  2A68 C;  4GOP A;  1H9J A;  1QE6 A;  3F2U A;  4BY7 H;  1BCP B;  3M4O B;  1G29 1;  1M1K C;  3T1Y Q;  1X9N A;  5I4D A;  5IY0 A;  2SEB D;  3R2I A;  4A3L H;  3CXC A;  1PTO C;  1SSO A;  2FHT A;  1K0R A;  1ZEQ X;  3UI2 A;  1I6H H;  4C3I G;  1IYU A;  2LSS A;  1P8L A;  2E5L L;  2C9O A;  3MXN A;  1PHJ A;  2ATW A;  1K3B C;  3K81 C;  2F0P A;  1Y1V G;  1IBM L;  4BA2 I;  2N3S A;  1Y1W G;  1FL0 A;  3HOX H;  4BBS H;  3ULL A;  3PUY A;  2LKV A;  1L1O A;  4JOI A;  5J1Z A;  1Y8O B;  1KQS A;  4L5S A;  4UP9 A;  1LAC A;  2K33 A;  4UP8 A;  1II3 A;  2M2L A;  2EYJ A;  3NEL A;  1JWM D;  4NMZ A;  1A3U A;  3KF8 A;  2F4I A;  1I4Q A;  4L63 B;  3CRL C;  4QGU A;  4M1U B;  3QR8 A;  3PO2 H;  3NEN A;  1CKN A;  3NBI A;  1TU2 B;  3OHX C;  3J80 i;  3G4S A;  1SND A;  4E6I A;  3ERS X;  5LHY 1;  2PNR C;  3GTJ H;  4NP5 A;  5IT9 c;  3FKI B;  2E2D C;  5CV6 A;  4ILW A;  3RUZ A;  1SNM A;  5DLQ E;  4RKB A;  3NTI A;  1EYD A;  2KHS A;  3M85 A;  3NTK A;  2IY5 B;  4DU9 A;  4K14 A;  4A3B H;  1I4P A;  2PMZ E;  2JA7 B;  4CJ1 B;  4AYB G;  1HNX L;  1QUQ B;  3GTO B;  4CGY B;  1R4Q B;  4BA1 I;  4DAY A;  1X56 A;  2D2C C;  1ICF B;  3CCU A;  1AH9 A;  1GUS A;  4F7X A;  2YTV A;  2JA8 G;  1Q1E A;  3E3X A;  2O5I C;  3SHL A;  3H3V H;  5ELN A;  5C4X H;  4GOP B;  1KL9 A;  1ESF A;  2BH8 A;  4P73 A;  4DV2 Q;  4A3K H;  2EE1 A;  4A3E G;  3EBE A;  3TN2 A;  4CBV A;  1EY9 A;  1W3S A;  4B3T L;  1S40 A;  3HZX A;  3BDC A;  4DV1 L;  4R1J A;  2F0L A;  2AMC B;  5CV5 A;  3MXN B;  4GN4 B;  1Q8K A;  2K03 A;  1VQG A;  2B8F A;  2B2Y C;  5JEA H;  3J7Z C;  3OTO Q;  1LTL A;  3AEV A;  5AJ3 L;  4FXG C;  3GTQ B;  1H9R A;  3QOL A;  2XTI A;  1L1O B;  1PRT F;  1VQL A;  4J8Q A;  4B9X A;  5IP7 H;  2F0V A;  3VR3 A;  3KFU A;  1FD7 D;  3BZK A;  1JWS D;  3EVQ A;  3JC6 6;  5D3D A;  1X3Q A;  4IPD A;  1PZI D;  4NKL A;  1CKN B;  2JA5 G;  4A4I A;  4KY6 A;  5GAH C;  4OWW B;  3MA2 B;  4R4C A;  2UXC Q;  4WJW A;  3RZD B;  1FNU A;  1ASZ A;  2J7Z A;  4EQ5 A;  1SYD A;  3T13 A;  1X55 A;  1SRO A;  3HOY B;  1OXS C;  2R3Z A;  2JJQ A;  4J15 A;  2LXJ A;  1VQP A;  4LF9 L;  1G51 A;  5CR3 A;  4LW1 A;  4C3H B;  4U67 3;  1JJ2 A;  1SNQ A;  1G91 A;  4NDX A;  1TS4 A;  4A3I H;  1SFO H;  5EPJ A;  2KEN A;  3H6M A;  5I6W A;  3Q8D A;  2VUM B;  1NJI C;  1EQT A;  1AN8 A;  1EEI D;  1IXR A;  1TS2 A;  2E2I H;  4IPC A;  4NPS A;  2I0Q A;  4RWS C;  1KIX A;  4DAY B;  3AFQ A;  5DM6 3;  1G2S A;  4JPB W;  4JV5 L;  1BCP C;  1LTT D;  5A2Q L;  3F2C A;  5IYC G;  2M9V A;  1DOL A;  1VQ9 A;  2JA6 B;  2PNH A;  1Q86 C;  3GTL B;  1Y8N B;  3SEB A;  4IJH A;  2MPM A;  5CV8 A;  3N6R A;  3TP6 A;  2E2H B;  2CWP A;  1GO3 E;  2WAQ B;  3CRK C;  2UUB L;  1A0I A;  1PYB A;  2B29 A;  2LXK A;  1GHJ A;  5IGB A;  2Q8R E;  1WCM H;  3MEH A;  1SDF A;  1G6Z A;  1RTN A;  3STB D;  3FKI G;  4DUY Q;  4GNX A;  4DV7 Q;  3S1M H;  4JI8 L;  3Q22 A;  3I73 A;  5KRU A;  1X32 A;  4N8F A;  3F2D A;  4BY1 H;  4P2C B;  2F0I A;  4LFA Q;  2JEB I;  3HOU H;  1EQR A;  2JA7 G;  1QCB D;  1M4V A;  1WTW A;  3ZYY X;  3UDG A;  1MBY A;  2OCE A;  1TWF B;  4JBK A;  1JJC B;  2ZTC A;  4DR2 L;  3JAM E;  1LTA D;  1NCV A;  3HOV B;  2PZT A;  5D3I B;  4BY1 B;  1KD1 C;  2BH2 A;  1WTO A;  2RQX A;  2YU9 H;  2WIN B;  4Q5V A;  2A1A A;  2VZA A;  1CZG A;  1Y8P B;  1I4X A;  2KCT A;  1RDP D;  3FDT A;  5KND A;  1S5E D;  3K7A H;  2NN6 G;  2NVX B;  2JQO A;  4FVM A;  4ULL A;  4IUN A;  2B39 A;  4F8M A;  1VQK A;  3MXP A;  4FO2 A;  3MZ5 A;  2LY7 A;  4GOP C;  2JYO A;  4K5V A;  3PO3 H;  4KV6 A;  2K4K A;  1YJ9 A;  3M4P A;  1P16 A;  4JCV E;  5E7N A;  4QCL A;  2G9D A;  1I4H A;  1E3P A;  3J7A V;  4FNF A;  3PUZ A;  3T51 B;  1CSP A;  2KA7 A;  3K7A B;  1B8A A;  1Q7Y C;  3BYY B;  3K0Y A;  3S2D H;  1GOZ A;  5TSS A;  3A0J A;  1IBK Q;  1LUZ A;  1UE1 A;  4R8N A;  2UXB Q;  1DON A;  1ESR A;  4LFB L;  3ZJY C;  4GKK Q;  2N49 A;  1NAP A;  1L1O C;  4JOI C;  1V43 A;  1KHI A;  1D6E C;  3D4W A;  3H09 A;  2NB0 A;  3G7L A;  4GNX B;  3HOY G;  1L0W A;  5C4H A;  1LV9 A;  1STB A;  1SMY C;  1XMQ Q;  4FDB A;  5IOD A;  2QA4 A;  1JT8 A;  5M5X B;  4C3H G;  1QWY A;  3OIQ A;  1HA5 A;  1WYD A;  4BBR H;  5HY6 A;  1A63 A;  2QW7 A;  5I2X A;  1X3F A;  2DUD A;  2VQF L;  1TWA H;  4AH6 A;  2VUM G;  3WOE A;  3I4L A;  5BN5 A;  2EY1 A;  1PH4 A;  3S1Q B;  1DOK A;  4HTH A;  1YI2 A;  2K14 A;  3I55 A;  3GTG H;  2WFW A;  5FJ8 G;  1D8L A;  4HJ9 A;  4YHH L;  2CVR A;  3OOC A;  2E5L Q;  2VL6 A;  2UXD L;  1PMR A;  1STY A;  1PH3 A;  4O1N A;  1IBM Q;  4BWG B;  2WKD A;  4LAA A;  1H9K A;  3DEP A;  5T1I A;  2JA6 G;  3OWF A;  1K73 C;  5LL6 X;  4EVO A;  5KNB A;  2A5H A;  2WAQ G;  5KEE A;  3S9W A;  1I94 Q;  4A3F H;  3GTP H;  2K50 A;  1AP0 A;  3P1H A;  4ZUJ A;  2AKW B;  4YY3 Q;  1U4L A;  3GQB A;  1ET6 A;  2E75 C;  2KCN A;  2F3I A;  2R7Z B;  4PV1 C;  1CT1 D;  2BCO A;  1KC8 C;  1NNX A;  1PLF A;  1O7Y A;  3P7J A;  3HKS A;  1EWH A;  3UE1 A;  2UXC L;  2AQ1 B;  1EIG A;  5NUC A;  1UE7 A;  1I3Q B;  2WB1 B;  4KI0 A;  1CA5 A;  3VA5 A;  2KCM A;  1LLR D;  3HOZ H;  3T53 B;  2F0K A;  2HDL A;  4CKE A;  5IWA L;  5C4Z A;  4FXK C;  4C1N I;  1Q46 A;  1Y1V H;  3RNU A;  1R9T B;  1ENA A;  2A8V A;  4DV6 L;  1FVI A;  1SEB D;  1Y1W H;  4MIU A;  2FMC A;  3CCM A;  4ZYS A;  4RH6 A;  3SK8 A;  1A8V A;  4O42 A;  1CZW A;  3HOV G;  3D6C A;  1VS0 A;  4BY1 G;  2EJG C;  2Q2T A;  2DJG C;  1ZKO A;  2OTJ A;  4CDC C;  3HOZ B;  1D5Z C;  3KOJ A;  2L1B A;  1G8Z D;  1EOV A;  4Z9C B;  5F2D A;  4O2D A;  1VQ7 A;  2EYP A;  1XPR A;  1YEZ A;  2XN9 C;  1OXT A;  3VYU A;  4YIJ A;  1KDC A;  1BBU A;  2PQE A;  3CMA A;  4LF5 Q;  2VNU D;  5IIF A;  3M7G A;  4DV1 Q;  2K1B A;  3DLL A;  2WII B;  3MEF A;  5C0X I;  5FO7 B;  1VQ8 A;  4GZY C;  2MP1 A;  2PW7 A;  4JI2 L;  1PRT B;  1UE5 A;  3FPP A;  2EYM A;  1KRS A;  1IW7 D;  2G9H D;  2KHI A;  1NR2 A;  1VQA A;  5LMU L;  2EYL A;  3C46 A;  3J80 L;  1D7Q A;  1SXT A;  5AJ3 Q;  1TWH H;  3H91 A;  1CHQ D;  3TEH B;  2K5H A;  3LWE A;  2K01 A;  3TRE A;  2MNA A;  4JI0 L;  2F0F A;  2ENB A;  1BUV T;  1YNN D;  1SE4 A;  4QB4 A;  1PYS B;  2Q2H A;  1SMX A;  4DR3 L;  5JVG 3;  2H5X A;  3A7L A;  2EJM A;  1GUG A;  1TWG B;  2JA8 H;  1PTO D;  4CHT B;  1BNZ A;  3ERQ A;  3A74 A;  1I50 H;  2K5V A;  2CWA A;  3K7U C;  2E2J H;  4LNQ A;  4DNR B;  1GUN A;  1EQV A;  2F0D A;  2PW5 A;  4A3E H;  2YV5 A;  4DA2 A;  2UUA L;  1TWC H;  3NWT A;  3BZD B;  4K2K A;  4LF6 Q;  4LF9 Q;  2SNM A;  1JC7 A;  4JI4 L;  4XTC S;  5JJZ A;  3S1N B;  2A19 A;  5DNF A;  1N33 L;  3WDN A;  5K5P A;  2RHQ B;  4LUO A;  3W2D A;  1B9N A;  4IOA A;  1U0L A;  5IYD G;  1ZYR C;  1CKO A;  2PZU A;  4P75 A;  3NP8 A;  4GNX C;  1QVF A;  4FXD A;  3G6E A;  4POF A;  4KLK A;  2OT2 A;  1LO5 D;  2QGQ A;  3CCJ A;  4JV5 Q;  1MHW C;  2NVY H;  3CQZ B;  5E3F A;  1EYC A;  4XDX A;  2I07 B;  5CGK A;  1SBB B;  2A6H C;  4Y7N H;  2A6E C;  2JA5 H;  3RZO B;  2O5J C;  1L0Y B;  2HQE A;  3J80 c;  1GD7 A;  4KKU A;  2UUB Q;  3L0O A;  1Z47 A;  1CKM A;  3HKZ E;  1CTM A;  4QIW E;  1QVG A;  2EQS A;  4TSS A;  4QJF A;  4R4O A;  3LGJ A;  1B9M A;  4DK1 A;  1HRJ A;  2F0N A;  3M4O H;  1HXY D;  2R7Z G;  5A2Q E;  5ELE A;  5IP9 G;  4JI6 L;  4C56 C;  2ZTD A;  2TMP A;  2WB1 G;  4B9W A;  1M8A A;  3CCS A;  2PZW A;  1DXM A;  5JOB A;  2QF7 A;  2K05 A;  3E9H A;  3D8G A;  1EWI A;  3V2T A;  1VQI A;  1Y69 U;  3NQT A;  2KHJ A;  4KJO A;  3UE0 A;  4R8I A;  4H0L C;  4DPG A;  5GAG C;  5IYC H;  1EUJ A;  3T4A C;  5CBA E;  4DR2 Q;  2F3V A;  4IQZ A;  4H02 A;  4G7H C;  4IFD G;  4X3S A;  1N36 L;  1FNW A;  2RBM A;  1A3T A;  1Q1B A;  1TKW B;  4CJ2 C;  4DXF A;  5CV7 A;  1MIU A;  3C3L A;  4HJ8 A;  1VQ5 A;  4CKC A;  4P74 A;  1E22 A;  3HOZ G;  5EKI A;  3G48 A;  3PQI A;  4O0A A;  2EOT A;  5ELO A;  2PPB C;  1V9P A;  1O7L A;  1BBX C;  2R7F A;  1HR0 L;  1U5K A;  3GO5 A;  2F03 A;  3FKI H;  1S5F D;  3S24 A;  4B3S Q;  1Q12 A;  4P71 A;  3KJO A;  2Y0S B;  2OWO A;  2IX3 A;  2F0J A;  2C35 B;  3EJI A;  1I94 L;  2K04 A;  3NBH A;  4AQY L;  2B3G A;  5CBE E;  4DR6 Q;  4DN4 M;  4QUF A;  1XPU A;  3TZU A;  1A6X A;  4YY3 L;  5C0X H;  1VDZ A;  2DNC A;  1CQF A;  4FYD A;  4DF7 A;  2JA7 H;  2N88 A;  2KOL A;  3GTO H;  2VB3 X;  4JI7 L;  5CV9 A;  4YWL A;  4K5W A;  5ELF A;  1J8I A;  1PH1 A;  4JBM A;  1HZ9 A;  1PRT C;  3J81 j;  1BVS A;  1X54 A;  2F3W A;  5BR8 L;  2E8G A;  3HRZ C;  5IGC A;  5C3E B;  4LFB Q;  1JE4 A;  4DV3 L;  1T5X D;  5M3M B;  3VA7 A;  2NTS A;  3JAM i;  4MZ9 A;  3URY A;  2ZM6 L;  1MKH A;  4OWT B;  4GKJ L;  2G5D A;  4GN3 B;  2J4X A;  3U58 A;  4OL7 A;  4A3J B;  3CPW A;  2ICI A;  3D4R A;  2NN6 H;  1A62 A;  4OIJ A;  1FR3 A;  2MO1 A;  1O7Z A;  4L8J A;  4KHP L;  1IYJ B;  2ZXO A;  4A3M B;  1JJG A;  3A5Z B;  4H7B A;  3EQL C;  1TT2 A;  3CW2 C;  3C1F A;  4JI1 Q;  5FK9 C;  5FOB B;  3E5S A;  2XGT A;  3QJY A;  2VQF Q;  1Z9F A;  4Y52 H;  1QNK A;  1DJR D;  3EA6 A;  3GTQ H;  1YNJ C;  2EXD A;  1B3Q A;  3R93 A;  4YHH Q;  1PTO F;  1K83 B;  2UXD Q;  4LF5 L;  5JEA J;  1MI2 A;  1VCI A;  4IN3 A;  4NXM L;  3FVQ A;  4IO9 A;  4K0K L;  4B3M Q;  1PYW D;  2KED A;  1C8C A;  2K6A A;  3C1E A;  4DV5 L;  3H0G B;  2JA9 A;  3PIP 3;  3RZD H;  1IL8 A;  2R92 B;  2PYK A;  4J6H A;  1JCK B;  3T1H L;  4HN7 A;  1HFN A;  1SAP A;  3HOY H;  4X3T A;  3D3R A;  1GUT A;  3BDO A;  3FHW A;  4WJ3 M;  1K8G A;  4C3H H;  3NBH B;  4XXE A;  5IGE A;  4RAU C;  1AZP A;  4IUT A;  4N9P A;  2EYH A;  2K52 A;  4X3U A;  4F87 A;  2HIV A;  2PI2 A;  2VUM H;  4U68 A;  1K8O A;  4DNI A;  2R7D A;  3J81 E;  3S2H B;  3SK5 A;  4P72 A;  3AQQ A;  5FJ8 H;  1V1Q A;  1UEB A;  4MN3 A;  1Q90 A;  1UUP A;  1ZXT A;  4IUP A;  4KD4 A;  5IWA Q;  1NMG A;  5GAE C;  4TVA B;  2QDL A;  2Z9H A;  4LF6 L;  3KLW A;  3L3O C;  4DV6 Q;  4ABN A;  3OYY A;  2JA6 H;  4X6A H;  5LMN L;  3GTL H;  1TR5 A;  1YZ6 A;  2A74 C;  4ZLT F;  2E2H H;  1Q81 C;  3S14 B;  4PG3 A;  1PXU A;  2A73 B;  3KLS X;  4QL5 A;  5JAV A;  5E1F A;  4IUU A;  2NWG A;  1J6Q A;  1A2T A;  5A35 A;  4A3D B;  3VR6 A;  2N78 A;  4HJ7 A;  1QZG A;  3R2T A;  2OF1 A;  1HA6 A;  4XT1 B;  1MSG A;  4RGM A;  2AQ2 B;  1HZB A;  4DAV A;  4AIM A;  3RR5 A;  3I2Z A;  4RMF A;  1CHP D;  1F2Z A;  1IZ6 A;  2Y0S G;  3DUZ A;  1EIY B;  3CCR A;  1EYG A;  1NE3 A;  4JI2 Q;  5IGF A;  1STE A;  5HUR A;  1N34 Q;  3KYH C;  2NZ1 D;  3K5M A;  1NY4 A;  1STH A;  1OO9 B;  5LMU Q;  5HGT A;  3AMU A;  4IFD I;  3S17 B;  5JJK A;  2F52 A;  2CKZ B;  5C44 B;  1X3E A;  3B6Y A;  2UU9 L;  1TWF H;  1SYC A;  4TRD A;  3TRZ A;  4JI0 Q;  3KF6 A;  1HHV A;  2B2T A;  3FRP B;  1CA6 A;  1GHK A;  4HJA A;  2MJ8 A;  3I4N B;  4DR3 Q;  3HOV H;  1KLU D;  3HG9 A;  3GV3 A;  4GS3 A;  5C3E G;  5M3M G;  4M8A A;  4EQO A;  2EYF A;  5C0X G;  3R8B A;  2RCN A;  4JC0 A;  1DM0 B;  2KUM A;  1TS5 A;  3Q24 A;  1S4Z A;  3Q0A A;  1VQ6 A;  1TY2 A;  1UWV A;  4A3J G;  2NVX H;  4DR4 L;  3IKJ A;  2CQO A;  1ET9 A;  5IYB G;  2UUA Q;  5IGG A;  1F2L A;  1QB5 D;  2X6L A;  4A3M G;  2DJF C;  4JI4 Q;  1CFM A;  1JIC A;  2RCF A;  3GDE A;  5CMD A;  2L0C A;  1T9H A;  1N33 Q;  1WTR A;  5EJW A;  3CC4 A;  3MC0 B;  1RIP A;  1Z6H A;  3KK7 A;  2F1M A;  2RSO A;  4UY8 C;  5EQ0 A;  3I4M B;  2K32 A;  3NE5 B;  4GLA C;  3K5N A;  2IW3 A;  1UAP A;  2EIF A;  1RHP A;  4B3S L;  2L5T A;  4HR7 B;  4FF4 A;  4JYA L;  4KHZ A;  2NTT A;  1TVX A;  4HSV A;  3AB9 A;  4HIO A;  1VMP A;  3AYH B;  4DR6 L;  1CM9 A;  2AQ3 B;  4DAP A;  4R4I A;  1B4O A;  3H0G G;  4KKS A;  2RDH A;  2R92 G;  1VQB A;  2KCC A;  3T16 A;  1STA A;  4N9T A;  3U9S A;  1LT6 D;  3MWY W;  2O2L D;  1PV4 A;  1EZ8 A;  2NVT B;  4JI3 L;  5M5X H;  1RKN A;  3FEW X;  4HSP A;  3K80 C;  1PA6 A;  3NUC A;  1BO0 A;  2K5Q A;  1CSQ A;  1IBL L;  1LYL A;  3L2P A;  4ZQ3 A;  3DHQ A;  1KAB A;  4CJ0 B;  5K36 G;  3DWQ A;  4JI6 Q;  1SYB A;  1VQD A;  3RMH A;  1D1I A;  1RL2 A;  3F2B A;  5IYD H;  3S1Q H;  1TS3 A;  3KF6 B;  1MGS A;  4NB3 A;  2GA4 B;  1HQM C;  2JK8 A;  1PH6 A;  3A5U A;  2XRS D;  1MSH A;  3E0E A;  5M3F H;  1HZC A;  2F0H A;  3I4O A;  3VR5 A;  2EZV A;  1BDO A;  3D6W A;  1JQY D;  1W6K A;  1BOS A;  2F0S A;  4QUC A;  4NXN L;  4JI1 L;  3M3Y B;  1N36 Q;  5IT9 E;  5KYI A;  4JI5 L;  5CV4 A;  4HCS A;  1KLG D;  4LF8 L;  4A3D G;  3STB C;  4LJZ C;  3RD4 A;  1LTB D;  3E0J A;  2RVL A;  5M3F B;  1HR0 Q;  1LAB A;  1X65 A;  1TXY A;  3K5O A;  5J3B A;  3PGZ A;  1DYQ A;  1PDQ A;  4QIW B;  4B3M L;  1GKH A;  2R7Z H;  2JEA I;  5JJI A;  1B50 A;  3OW2 A;  3K5L A;  2ZT9 C;  5IP9 H;  4V19 0;  2XRQ D;  4AQY Q;  1I3Q H;  1C7Y A;  2CHB D;  1MD2 D;  1RCV D;  2WKC A;  4F88 A;  4FF1 A;  4RCN A;  1EYA A;  2LMC B;  1HUM A;  2DNE A;  4IUQ A;  4LMQ D;  2P5Z X;  2GN5 A;  4C3J H;  4LF4 L;  5L37 A;  5C44 G;  1F2Y A;  3D0F A;  1R9T H;  1W6J A;  2JXM B;  3WWV A;  4JI7 Q;  1PFN A;  2HT1 A;  1AE2 A;  2XIW A;  3I4N G;  1KAW A;  4IFD H;  4JK1 C;  2A69 D;  4DXG A;  1JR0 D;  3U4V A;  2CH4 W;  2BE5 D;  5BR8 Q;  4TKO B;  1LT5 D;  4DV3 Q;  3TP8 A;  4C3J B;  2B2U A;  1QVC A;  1E1O A;  2XSC A;  2F0G A;  1VQF A;  1GUW A;  4PZ6 A;  2WAQ E;  2ZM6 Q;  3RLN A;  4GKJ Q;  1EY0 A;  2YTX A;  3L7Z C;  1JOR A;  1QJO A;  2ZXP A;  4LFC L;  1QZH A;  1WFQ A;  4C2M H;  3KLR A;  5M5Y B;  4I7A A;  1EOT A;  4KHP Q;  4X64 L;  2A6H D;  4X66 Q;  2A6E D;  4XIG S;  1PTO B;  3MTS A;  4ZRZ A;  1PH7 A;  3GTM B;  4BXX G;  4KY5 A;  3KDF A;  1UNS A;  1XWE A;  3WOF A;  3PUW A;  4A3G B;  3I4M G;  3I3C A;  3ERO A;  5BN4 A;  1F77 A;  3I90 A;  4OWX B;  3DEO A;  1E1T A;  2SOB A;  3BG3 A;  1OXV A;  4LUZ A;  5C5M A;  4C2M B;  2MQH A;  5FLX L;  4UHV A;  5LL6 S;  1E7Z A;  3PF4 A;  1GM5 A;  2FIN B;  4NXM Q;  4K0K Q;  1Y14 B;  5M9O A;  3TS0 A;  3EN2 A;  1TWG H;  1N34 L;  3I91 A;  3TS2 A;  1YHQ A;  1YVC A;  4DV5 Q;  3FMC A;  5I9O A;  5EBD A;  1UE6 A;  1XYI A;  4K2L A;  4HCE A;  4CDD C;  3T1H Q;  3M9B A;  4RCO A;  4ALP A;  4HAE A;  4HMI A;  4KD3 A;  2RHS B;  5M5W B;  2A68 D;  4X62 L;  4JW0 A;  5E4W C;  2R93 B;  1B53 A;  2PMZ B;  2ID0 A;  3S1N H;  1R4P B;  1S3O A;  4LUV A;  2Q2I A;  1Q3L A;  4L5Q A;  1YIT A;  5D14 A;  3GD7 A;  3A55 A;  2VQE Q;  2HCI A;  4PQX A;  5DEH A;  3JAM L;  1EY4 A;  4ZCK A;  2Q2U A;  4QMG A;  2HCC A;  2NVQ B;  4QY7 A;  3SXH A;  1FNV A;  5EKL A;  2B2W A;  1EY8 A;  2ES2 A;  3CQZ H;  1WD1 A;  1T5E A;  4L5R C;  1EY6 A;  1VF7 A;  3BVZ A;  2RDF A;  2OXP A;  1PVO A;  2CW0 C;  3QO2 A;  1HUN A;  5LMN Q;  2KQ3 A;  5EPK A;  1VQH A;  1EIF A;  2EXZ A;  1EZ6 A;  3RZO H;  1AFP A;  2B2T C;  3A7A B;  3S15 B;  2PCF B;  1VF5 C;  3FPU B;  1U4P A;  1YJW A;  2SDF A;  4X65 Q;  2OTL A;  5KGU A;  1FGB D;  3PMF A;  2HQL A;  5FLX c;  5M3F G;  1YHA A;  4DR1 L;  2I5M X;  3S1R B;  4DV4 Q;  5IE8 A;  4L5T A;  4EGV A;  3KDF B;  4APV A;  4DFA A;  1TII D;  3Q6S A;  3R3O A;  1XNQ L;  1PFB A;  2EVB A;  3HOW B;  5EBC A;  3BJU A;  1V8Q A;  3DWA A;  1JB7 A;  1W2B A;  5JPN C;  1HNW L;  4WRD A;  1PH5 A;  3CP0 A;  1VQM A;  2UU9 Q;  3M4Y A;  3TP5 A;  4MNO A;  4A93 B;  4CDE C;  3J81 i;  3ONA B;  1FGU A;  4GLV B;  3JAM c;  1TQO A;  2Z4I A;  1RD9 D;  2Z4H A;  4KJN A;  1SJE D;  1KDB A;  3HEJ A;  3VR4 A;  2C5C A;  4B3R L;  4C3J G;  1H95 A;  2CCZ A;  3G6J B;  1IHZ A;  2IWH A;  1QIL A;  3GV6 A;  3T56 B;  5IOC A;  3TBI B;  3GTK B;  2F4V L;  4IJL A;  2SNS A;  2D62 A;  1A2U A;  4DR4 Q;  2BA0 A;  2AHO B;  4G7O C;  4ME3 A;  4WFN 3;  4LF7 L;  1EU4 A;  4YCV A;  1AE3 A;  2L15 A;  5G3L D;  4J1M A;  3SR1 A;  2D0P A;  1PH2 A;  1IL2 A;  5COR A;  1U4M A;  2I46 A;  2JE6 I;  3OPO A;  2IHE A;  4K5X A;  4A3G G;  1H9M A;  3QIA A;  1YNN C;  1HNZ L;  3S16 H;  2KJX A;  1DD2 A;  3Q23 A;  2WB1 E;  1I4G A;  2HD3 A;  3W1B A;  1LTI D;  1E2W A;  3ND9 A;  4OX9 L;  3CD6 A;  5C0X J;  1A15 A;  4JYA Q;  4JBJ A;  4TQU S;  1WI5 A;  2I5H A;  5JJL A;  4DV0 L;  1B7Y B;  1HPC A;  3SVM A;  4IPG A;  1XX8 A;  1S5D D;  5C3E H;  3K58 A;  1SNP A;  5M3M H;  3KJP A;  3QB3 A;  2DY8 A;  2VB2 X;  1BXT A;  1LT4 D;  3S16 B;  3U4Z A;  4BY7 B;  2QEJ C;  1O7I A;  2L12 A;  3MXU A;  2MHV A;  3DWP A;  4A3J H;  2HHH L;  1VQO A;  2IL8 A;  2R93 G;  4JI3 Q;  5IYB H;  2XWJ B;  4PMC A;  2EDG A;  4A3M H;  4DK3 C;  1VQN A;  1B70 B;  1LT3 D;  4ME5 A;  5IGD A;  2BOS A;  3CAM A;  1F9R A;  1I6H B;  1EWC A;  3OW7 A;  4I7Z C;  3UDI A;  1SYG A;  1IBL Q;  4FF2 A;  3CU7 A;  3HFZ B;  1PH8 A;  3HOX B;  4BBS B;  2R61 A;  1PFS A;  4DGZ A;  4A3C G;  4DK0 A;  3VR2 A;  5C3X A;  1KNA A;  2F0T A;  4YWM A;  4YWK A;  4GN5 A;  4G7Z C;  3X3M A;  1DCZ A;  1BCP D;  1X6O A;  3CME A;  1K83 H;  4OEL B;  2Z0S A;  1ASY A;  3NHH A;  3CCQ A;  4DUZ L;  5GAD C;  1BKB A;  2ZXR A;  4X66 L;  2CQA A;  1VQE A;  3IRB A;  1WTQ A;  4DKA C;  1CI3 M;  5JPM C;  3IAY A;  4NXN Q;  3PO2 B;  5ELB A;  1U9R A;  3PCO B;  3D4D A;  4JI5 Q;  4QQB X;  3H0G H;  1KAA A;  2RDG A;  1OTC A;  1SR3 A;  3GTJ B;  2R92 H;  1ENF A;  4RKL A;  4LF8 Q;  1WVL A;  2CH4 A;  1JB3 A;  4HIM A;  4XT3 B;  3O13 A;  4IPH A;  4ZAI A;  5GRO A;  1JOQ A;  2BA1 A;  3BDL A;  2NYZ D;  4WJ4 A;  2B2V A;  3SDZ A;  4KN4 C;  4AYB E;  2Q8I B;  1F9Q A;  2B2U C;  4N8X 1;  4YCU A;  4A3B B;  2KVM A;  1FYC A;  1V1P B;  2ASB A;  4UAI A;  5K36 H;  3HOW G;  2AWN A;  4PZ7 A;  3S2H H;  1M90 C;  2VW9 A;  1SLJ A;  3MHB A;  4RGN A;  5COY A;  1KTK A;  4ZKB B;  2E74 C;  4LF4 Q;  1JOK A;  4H44 C;  5E4X A;  1WTX A;  2OEO A;  1ML0 D;  3EFX D;  1CUK A;  3FP9 A;  5FKA C;  5BN3 A;  4A93 G;  4WOR A;  2RA4 A;  5C4X B;  1UEA B;  1U4R A;  3QG1 A;  1LM0 A;  1DZ1 A;  2VQE L;  1HQR D;  4LWC A;  3S14 H;  1JOO A;  3AFP A;  3TP7 A;  4A3K B;  1ILP A;  3BVG A;  1IKM A;  3BS1 A;  4A3D H;  4YCW A;  1EFI D;  1D5X C;  1XJV A;  1VQC A;  2MGS A;  2YYZ A;  4EQN A;  1B44 D;  4KY7 A;  1JMC A;  4PZ8 A;  5FO9 B;  3KF8 B;  1V1O A;  1O78 A;  4K8J A;  1OXU A;  1Q82 C;  4KK7 A;  3I8Z A;  4LFC Q;  2NUC A;  2ZJR A;  2F0Q A;  4JBW A;  4RHS A;  4EQP A;  1L2F A;  5J39 A;  1AW7 A;  1KRT A;  5FLM G;  3MAQ A;  1K9M C;  1SE3 A;  3DM1 A;  4X64 Q;  2WV6 D;  3KLS A;  2L4N A;  3BVM A;  4X65 L;  3F8T A;  1L0X B;  4DR5 L;  1A3V A;  3ITP A;  1FJG L;  1HCZ A;  1WTV A;  4OEM B;  1CK1 A;  3A8J E;  1LTG D;  3GP7 A;  3A54 A;  3X3N A;  5CC4 A;  1D5M C;  2ALY B;  3E6Z X;  3S17 H;  2EJF C;  1K0S A;  5C44 H;  3SGI A;  4IUV A;  3MXG A;  4DV4 L;  2OQK A;  1X3G A;  1NTG A;  3K0X A;  3I4N H;  2K7V A;  3PIO A;  4OO1 G;  1KNE A;  1D1K A;  3P75 A;  1I5F A;  2Q8T A;  2B2W C;  2AWO A;  1CQV A;  2B63 H;  4K6D A;  2EY2 A;  4XYO A;  1J5E L;  2IPK D;  2D0O A;  4PNY A;  4BY7 G;  5G3L F;  4ZKC B;  3EIV A;  1SNC A;  3ND8 A;  1XNR L;  1EU3 A;  3LNN A;  2D9U A;  2FJ2 A;  3J7A F;  4A3I B;  1SMY D;  1SFO B;  3F1Z A;  3TDQ A;  4PMW A;  1NR4 A;  2Z8L A;  4X62 Q;  4HED A;  4A3L G;  4X3K A;  1IKL A;  2E2I B;  3NK9 A;  5FLX E;  2BDO A;  3PV0 A;  2EYO A;  2JP1 A;  1YHB A;  2PO4 A;  3BU2 A;  2B63 B;  4V0B A;  2YTY A;  4BXX H;  1WD0 A;  3PSI A;  1J9O A;  2Y0S E;  3HOX G;  3K6O A;  5DAU A;  1DGS A;  3J7Y W;  4BBS G;  4RGO S;  1XMO L;  3I4M H;  4HIK A;  2K28 A;  1VQ4 A;  2F0O A;  3J80 E;  2AUK A;  5CYU A;  4HJ5 A;  4XYQ A;  2I5L X;  2J0T D;  1ILQ A;  2DN8 A;  4DR7 L;  4PMB A;  2IX0 A;  4BS9 A;  3PO2 G;  1SJH D;  4ODG A;  2MO0 A;  1EFW A;  1WCM B;  4K6L A;  2Z6K A;  3AU7 A;  4UPA A;  3RLO A;  2QEX A;  5KYL A;  3SE0 A;  3T1Y L;  5EPL A;  2GVA A;  3S1M B;  4RGT A;  2NZO A;  1B1Z A;  2NVT H;  4DR1 Q;  4DAM A;  3U50 C;  2QDB A;  2UUC Q;  2PQA A;  4A3B G;  3I72 A;  1BCP F;  3HOU B;  1NBW A;  3OSO A;  1XNQ Q;  2ZJQ A;  4GLX A;  1BBW A;  2LFN A;  3W1G A;  1I4R A;  1F9P A;  1YIJ A;  3H94 A;  2GVB A;  4MHE A;  1JE5 A;  4A76 A;  1LTR D;  4XQQ A;  1HNW Q;  4H13 C;  1B3A A;  4HID A;  4R9W A;  2ICE C;  3BYT B;  3I56 A;  2IT1 A;  1QG7 A;  3PUV A;  4JVZ A;  1YJN A;  3IFT A;  4RA8 A;  1E2Z A;  2F0U A;  3VYR A;  5C4X G;  2YU9 B;  3M3Y H;  4IZ8 A;  3HP3 A;  3NEM A;  1DOM A;  4A3K G;  5HGQ A;  1SYF A;  2XNA C;  3K59 A;  1G2T A;  4R4T A;  2L55 A;  3DM3 A;  4KTA A;  3L9A X;  3I7F A;  4B3R Q;  1HTP A;  4KKT A;  1H9S A;  2WP8 J;  1PFM A;  2MUY A;  1BQQ T;  1HFG A;  3W5O A;  2F4V Q;  3H3V C;  1N32 Q;  2HUG A;  3ER0 A;  4G57 A;  5AFW A;  2CFM A;  1SYE A;  3PO3 B;  4B08 A;  3HS0 C;  3CHB D;  2EY6 A;  5JEA G;  1PH9 A;  4LF7 Q;  2X6G A;  3OIP A;  2TSS A;  1RJT A;  3OWE B;  3C2P A;  1B2T A;  3CPF A;  2VY3 A;  2IJ0 A;  3P20 A;  1ONL A;  2FFK B;  2DY7 A;  2QKI C;  3RN2 A;  1KXL A;  5IP7 G;  2WAC A;  3S2D B;  1HNZ Q;  1HJP A;  1ROD A;  3SK6 A;  3G71 A;  1K8A C;  1EQQ A;  2IHF A;  1KDA A;  2AUJ D;  1JWU D;  2L11 A;  3HKZ B;  4OX9 Q;  3OMC A;  4MTK A;  4DV0 Q;  4QF4 A;  1SN8 A;  4DV2 L;  1EIH A;  3MFY A;  3W3A A;  2Z6B A;  4POG A;  1C9O A;  4LK1 C;  1YBY A;  3KBX A;  2B8G A;  2DGY A;  4IFD J;  2M00 A;  1NSN S;  3OMG A;  1WTP A;  3M4Q A;  4XQN A;  4BBR B;  2ZTE A;  5I9P A;  4A3I G;  2N55 A;  2PQA B;  5KNC A;  1E2V A;  2Z1C A;  1I6V C;  1TWA B;  2HHH Q;  3J81 L;  3PIO 3;  2KEC A;  3D31 A;  2LS0 1;  5M5Y H;  1S72 A;  5C5L A;  2NBF A;  3OTO L;  1TY0 A;  2CW0 D;  3CCL A;  5ISR A;  3GTG B;  1EL0 A;  1PTO H;  2B63 G;  1SE8 A;  1ZYR D;  3NQI A;  3GTM H;  1HR0 W;  2B2V C;  1K8M A;  4A3G H;  3QOJ A;  1HZA A;  4K8I A;  1YNX A;  2D5D A;  2H4O A;  4OO1 I;  2F0M A;  1GVP A;  2EY5 A;  1XTC D;  2VXW A;  4L6T B;  1PZK D;  2K5W A;  1Z7T A;  3IL8 A;  4OON A;  4DUZ Q;  4DNT B;  2QCP X;  2OQ0 A;  4A3F B;  2EPB A;  3DMU A;  3GTP B;  3CCV A;  5EKK A;  2XWB B;  4IUR A;  5EAY A;  1E0B A;  1HTL D;  4C3I H;  2V4D A;  5ELD A;  1Q8I A;  1H9S B;  1WCM G;  3UDF A;  3NTH A;  2K5N A;  1HNX Q;  1GXD C;  1QNU A;  1SRU A;  1C0A A;  2XVS A;  1GJX A;  2B2Y A;  4OHJ A;  4JG2 A;  5M5W H;  4OIK A;  1AZQ A;  2R93 H;  3M7N A;  1STN A;  3HOU G;  1F2M A;  1EY7 A;  4C3I B;  2PI2 E;  2X69 A;  1RF2 D;  4C1N K;  1N8R C;  1WTH A;  1Y1V B;  3LX0 A;  2JSO A;  3CF5 A;  1Y1W B;  4DK6 C;  4A3C H; 
#chains in the Genus database with same CATH homology
 3QWN A;  4RFB A;  2FMM A;  2QIL A;  5C3W A;  1X3P A;  1NUC A;  1BF4 A;  3DXJ C;  3N52 A;  1ICW A;  5C6A A;  3TME A;  1QOH A;  2F0E A;  3I70 A;  1AEX A;  2HDM A;  1F9S A;  3KUP A;  5FO8 B;  1SE2 A;  3A56 A;  1LTS D;  3V05 A;  1O80 A;  2L9H A;  3U9O A;  4NW2 A;  4KHV A;  4IAL A;  3LWU A;  3A8K E;  3VYS A;  3IFD A;  5I2Y A;  3SK4 A;  2NN6 I;  4RHR A;  3MFG A;  1OXX K;  1TWH B;  2RSN A;  1BR9 A;  4AYB B;  5C4J B;  4XQJ A;  2H1E A;  5DM7 3;  1C48 A;  1GUO A;  4FF3 A;  4KN7 C;  1D2B A;  1SNO A;  3HGB A;  3KBG A;  2E76 C;  5ELC A;  2A69 C;  4ZUI A;  2JA8 B;  3PUX A;  2F0W A;  1PRT D;  5I6Y A;  2BE5 C;  1I50 B;  5KIX A;  4HMJ A;  2E2J B;  4CKB A;  3A8I E;  1IYV A;  4A3E B;  1S5C D;  4ID6 A;  5J22 A;  2RKS A;  1TWC B;  3NXW A;  3MVV A;  3NWS A;  4Q0F A;  1ENC A;  5T1G A;  4I65 A;  1XXG A;  5JVH 3;  1EEF D;  1EY5 A;  3K57 A;  3VYT A;  2O4X A;  1PZJ D;  2KEE A;  4OGQ C;  2NVY B;  4G4K A;  4KMU C;  1YNJ D;  2R6G A;  3V96 A;  3RLF A;  3NSW A;  5IT9 L;  1S5B D;  4Y7N B;  1IW7 C;  2JA5 B;  2BDN A;  4S3S A;  3NPP A;  1C4Q A;  1VMC A;  3TZD A;  2IX1 A;  4OO1 H;  1RTO A;  1STG A;  2K5D A;  5EGT A;  5D65 A;  4UDU C;  4ZK9 B;  3CKI B;  4FP5 D;  3TSS A;  1V1P A;  2A68 C;  1H9J A;  1QE6 A;  3F2U A;  1BCP B;  3M4O B;  1G29 1;  5I4D A;  2SEB D;  3R2I A;  1PTO C;  1SSO A;  2FHT A;  1ZEQ X;  3UI2 A;  4C3I G;  1IYU A;  2C9O A;  3MXN A;  2F0P A;  4BA2 I;  3PUY A;  2LKV A;  5J1Z A;  1Y8O B;  1LAC A;  2K33 A;  1II3 A;  2M2L A;  2EYJ A;  1JWM D;  4NMZ A;  1A3U A;  3KF8 A;  2F4I A;  1I4Q A;  4L63 B;  3CRL C;  4M1U B;  3NBI A;  1TU2 B;  3OHX C;  1SND A;  4E6I A;  5LHY 1;  2PNR C;  4NP5 A;  3FKI B;  2E2D C;  5CV6 A;  4ILW A;  3RUZ A;  1SNM A;  4RKB A;  3NTI A;  1EYD A;  2KHS A;  3M85 A;  3NTK A;  4DU9 A;  4K14 A;  1I4P A;  2JA7 B;  4CJ1 B;  3GTO B;  4CGY B;  1R4Q B;  4BA1 I;  4DAY A;  2D2C C;  1GUS A;  4F7X A;  1Q1E A;  2O5I C;  3SHL A;  1ESF A;  2EE1 A;  3TN2 A;  4CBV A;  1EY9 A;  3HZX A;  3BDC A;  2F0L A;  5CV5 A;  2K03 A;  2B8F A;  2B2Y C;  5JEA H;  4FXG C;  3GTQ B;  1H9R A;  3QOL A;  1PRT F;  4J8Q A;  4B9X A;  2F0V A;  3VR3 A;  1FD7 D;  1JWS D;  3EVQ A;  5D3D A;  1X3Q A;  1PZI D;  4NKL A;  4KY6 A;  3MA2 B;  4WJW A;  3RZD B;  1FNU A;  2J7Z A;  1SYD A;  3T13 A;  3HOY B;  1OXS C;  2R3Z A;  5CR3 A;  4C3H B;  4U67 3;  1SNQ A;  1G91 A;  4NDX A;  1TS4 A;  5EPJ A;  5I6W A;  3H6M A;  2VUM B;  1EQT A;  1AN8 A;  1EEI D;  1TS2 A;  4RWS C;  5DM6 3;  1G2S A;  1BCP C;  1LTT D;  5A2Q L;  2M9V A;  1DOL A;  2JA6 B;  3GTL B;  1Y8N B;  3SEB A;  2MPM A;  5CV8 A;  3N6R A;  3TP6 A;  2E2H B;  2WAQ B;  3CRK C;  1GHJ A;  5IGB A;  2Q8R E;  3MEH A;  1SDF A;  1G6Z A;  1RTN A;  3Q22 A;  3I73 A;  5KRU A;  1X32 A;  4P2C B;  2F0I A;  2JEB I;  1QCB D;  1M4V A;  1WTW A;  3ZYY X;  1MBY A;  1TWF B;  3JAM E;  1LTA D;  1NCV A;  3HOV B;  2PZT A;  5D3I B;  4BY1 B;  1WTO A;  2RQX A;  2WIN B;  4Q5V A;  1CZG A;  1Y8P B;  1I4X A;  1RDP D;  3FDT A;  5KND A;  1S5E D;  2NN6 G;  2NVX B;  4FVM A;  4ULL A;  4IUN A;  2B39 A;  4F8M A;  3MXP A;  4FO2 A;  3MZ5 A;  2LY7 A;  2JYO A;  4K5V A;  4KV6 A;  4QCL A;  2G9D A;  1I4H A;  3J7A V;  4FNF A;  3T51 B;  3PUZ A;  3K7A B;  2KA7 A;  3BYY B;  3K0Y A;  1GOZ A;  5TSS A;  4R8N A;  1DON A;  1ESR A;  1NAP A;  1V43 A;  3D4W A;  1D6E C;  3H09 A;  2NB0 A;  3G7L A;  5C4H A;  1LV9 A;  1STB A;  1SMY C;  5IOD A;  5M5X B;  4C3H G;  1QWY A;  3OIQ A;  1HA5 A;  5I2X A;  3WOE A;  3I4L A;  5BN5 A;  2EY1 A;  3S1Q B;  1DOK A;  4HTH A;  2CVR A;  3OOC A;  1PMR A;  1STY A;  4O1N A;  4BWG B;  2WKD A;  4LAA A;  1H9K A;  3DEP A;  5T1I A;  3OWF A;  5LL6 X;  4EVO A;  5KNB A;  2A5H A;  5KEE A;  3S9W A;  1AP0 A;  3P1H A;  4ZUJ A;  1U4L A;  3GQB A;  1ET6 A;  2E75 C;  2KCN A;  2R7Z B;  4PV1 C;  1CT1 D;  2BCO A;  1PLF A;  1O7Y A;  3P7J A;  1EWH A;  2AQ1 B;  1EIG A;  5NUC A;  1I3Q B;  2WB1 B;  4KI0 A;  1CA5 A;  3VA5 A;  1LLR D;  3T53 B;  2F0K A;  2HDL A;  4CKE A;  5C4Z A;  4FXK C;  4C1N I;  1R9T B;  1ENA A;  1SEB D;  4MIU A;  2FMC A;  4ZYS A;  4RH6 A;  3SK8 A;  4O42 A;  1CZW A;  3D6C A;  2EJG C;  1ZKO A;  3HOZ B;  1D5Z C;  2L1B A;  1G8Z D;  4Z9C B;  5F2D A;  2EYP A;  2XN9 C;  1OXT A;  3VYU A;  4YIJ A;  1KDC A;  2PQE A;  2VNU D;  5IIF A;  3M7G A;  2K1B A;  2WII B;  5C0X I;  5FO7 B;  4GZY C;  2MP1 A;  2PW7 A;  1PRT B;  3FPP A;  2EYM A;  1IW7 D;  2G9H D;  1NR2 A;  2EYL A;  3C46 A;  3J80 L;  1SXT A;  3H91 A;  1CHQ D;  3LWE A;  2K01 A;  2F0F A;  2ENB A;  1BUV T;  1YNN D;  1SE4 A;  4QB4 A;  5JVG 3;  3A7L A;  2EJM A;  1GUG A;  1TWG B;  1PTO D;  4CHT B;  1BNZ A;  3ERQ A;  4DNR B;  1GUN A;  1EQV A;  2F0D A;  2PW5 A;  4DA2 A;  3NWT A;  4K2K A;  3BZD B;  2SNM A;  1JC7 A;  4XTC S;  5JJZ A;  3S1N B;  5DNF A;  3WDN A;  5K5P A;  3W2D A;  1B9N A;  1ZYR C;  2PZU A;  3NP8 A;  4FXD A;  2OT2 A;  1LO5 D;  3CQZ B;  5E3F A;  1EYC A;  4XDX A;  2I07 B;  5CGK A;  1SBB B;  2A6H C;  2A6E C;  3RZO B;  2O5J C;  1L0Y B;  2HQE A;  4KKU A;  1Z47 A;  1CTM A;  4TSS A;  1B9M A;  4DK1 A;  1HRJ A;  2F0N A;  1HXY D;  5A2Q E;  5ELE A;  4C56 C;  2TMP A;  4B9W A;  1M8A A;  2PZW A;  1DXM A;  5JOB A;  2K05 A;  2QF7 A;  3V2T A;  3D8G A;  1Y69 U;  3NQT A;  4KJO A;  4R8I A;  4H0L C;  3T4A C;  5CBA E;  2F3V A;  4IQZ A;  4G7H C;  4IFD G;  4X3S A;  1FNW A;  2RBM A;  1A3T A;  1Q1B A;  1TKW B;  4CJ2 C;  4DXF A;  5CV7 A;  3C3L A;  4CKC A;  5EKI A;  2EOT A;  2PPB C;  1O7L A;  1BBX C;  3GO5 A;  2F03 A;  1S5F D;  1Q12 A;  2Y0S B;  2IX3 A;  2F0J A;  3EJI A;  2K04 A;  3NBH A;  5CBE E;  4DN4 M;  4QUF A;  3TZU A;  1A6X A;  5C0X H;  1VDZ A;  2DNC A;  1CQF A;  4FYD A;  4DF7 A;  2N88 A;  2KOL A;  2VB3 X;  5CV9 A;  4K5W A;  5ELF A;  1J8I A;  1PRT C;  2F3W A;  5IGC A;  3HRZ C;  5C3E B;  1JE4 A;  1T5X D;  5M3M B;  3VA7 A;  2NTS A;  3URY A;  2J4X A;  4OL7 A;  4A3J B;  2ICI A;  3D4R A;  2NN6 H;  4OIJ A;  1FR3 A;  1O7Z A;  4L8J A;  2ZXO A;  4A3M B;  4H7B A;  3EQL C;  1TT2 A;  3C1F A;  5FK9 C;  5FOB B;  3E5S A;  3QJY A;  1QNK A;  1DJR D;  3EA6 A;  1YNJ C;  3R93 A;  1PTO F;  1K83 B;  5JEA J;  1MI2 A;  1VCI A;  4IN3 A;  3FVQ A;  1PYW D;  2KED A;  1C8C A;  2K6A A;  3C1E A;  3H0G B;  3PIP 3;  1IL8 A;  2R92 B;  2PYK A;  4J6H A;  1JCK B;  4HN7 A;  1HFN A;  1SAP A;  4X3T A;  3D3R A;  1GUT A;  3BDO A;  4XXE A;  5IGE A;  4RAU C;  1AZP A;  4IUT A;  4N9P A;  2EYH A;  4X3U A;  4F87 A;  4U68 A;  1K8O A;  3J81 E;  3S2H B;  3SK5 A;  4MN3 A;  1Q90 A;  1UUP A;  1ZXT A;  4IUP A;  4KD4 A;  3L3O C;  4ABN A;  1TR5 A;  2A74 C;  4ZLT F;  3S14 B;  1PXU A;  2A73 B;  3KLS X;  5JAV A;  5E1F A;  4IUU A;  2NWG A;  1A2T A;  5A35 A;  4A3D B;  3VR6 A;  3R2T A;  2OF1 A;  1HA6 A;  4XT1 B;  1MSG A;  4RGM A;  2AQ2 B;  4DAV A;  1CHP D;  1F2Z A;  3DUZ A;  5IGF A;  1STE A;  5HUR A;  2NZ1 D;  3K5M A;  1STH A;  1OO9 B;  5HGT A;  3AMU A;  4IFD I;  3S17 B;  5C44 B;  1SYC A;  4TRD A;  1HHV A;  2B2T A;  3FRP B;  1CA6 A;  1GHK A;  2MJ8 A;  3I4N B;  1KLU D;  3HG9 A;  3GV3 A;  4M8A A;  4EQO A;  2EYF A;  5C0X G;  3R8B A;  1DM0 B;  2KUM A;  1TS5 A;  3Q24 A;  1S4Z A;  3Q0A A;  1TY2 A;  3IKJ A;  1ET9 A;  5IGG A;  1F2L A;  1QB5 D;  2X6L A;  1CFM A;  1JIC A;  5CMD A;  2L0C A;  1WTR A;  5EJW A;  3MC0 B;  1Z6H A;  3KK7 A;  2F1M A;  2RSO A;  5EQ0 A;  3I4M B;  2K32 A;  3NE5 B;  3K5N A;  2IW3 A;  1UAP A;  1RHP A;  2L5T A;  4HR7 B;  4FF4 A;  4KHZ A;  2NTT A;  1TVX A;  4HSV A;  3AB9 A;  1VMP A;  1CM9 A;  2AQ3 B;  4DAP A;  1B4O A;  4KKS A;  2RDH A;  2KCC A;  3T16 A;  1STA A;  4N9T A;  3U9S A;  1LT6 D;  3MWY W;  2O2L D;  1EZ8 A;  2NVT B;  1RKN A;  3FEW X;  4HSP A;  3NUC A;  1BO0 A;  2K5Q A;  4ZQ3 A;  3DHQ A;  1KAB A;  4CJ0 B;  5K36 G;  3DWQ A;  1SYB A;  3RMH A;  1D1I A;  1TS3 A;  1MGS A;  2GA4 B;  1HQM C;  2XRS D;  1MSH A;  2F0H A;  3VR5 A;  2EZV A;  1BDO A;  1W6K A;  1JQY D;  2F0S A;  1BOS A;  4QUC A;  3D6W A;  3M3Y B;  5IT9 E;  5KYI A;  5CV4 A;  4HCS A;  1KLG D;  4LJZ C;  3RD4 A;  1LTB D;  3E0J A;  2RVL A;  5M3F B;  1LAB A;  3K5O A;  1DYQ A;  1PDQ A;  4QIW B;  2JEA I;  1B50 A;  3K5L A;  2ZT9 C;  4V19 0;  2XRQ D;  2CHB D;  1MD2 D;  1RCV D;  2WKC A;  4F88 A;  4FF1 A;  4RCN A;  1EYA A;  2LMC B;  1HUM A;  2DNE A;  4IUQ A;  4LMQ D;  1F2Y A;  1W6J A;  2JXM B;  1PFN A;  2XIW A;  4IFD H;  4JK1 C;  2A69 D;  4DXG A;  1JR0 D;  2BE5 D;  4TKO B;  1LT5 D;  3TP8 A;  4C3J B;  2B2U A;  2XSC A;  2F0G A;  1GUW A;  1EY0 A;  3L7Z C;  1JOR A;  1QJO A;  2ZXP A;  3KLR A;  5M5Y B;  1EOT A;  2A6H D;  2A6E D;  4XIG S;  1PTO B;  3MTS A;  4ZRZ A;  3GTM B;  4KY5 A;  3WOF A;  1UNS A;  1XWE A;  3PUW A;  4A3G B;  3I3C A;  3ERO A;  5BN4 A;  1F77 A;  3I90 A;  3DEO A;  2SOB A;  3BG3 A;  1OXV A;  5C5M A;  4C2M B;  5FLX L;  5LL6 S;  2FIN B;  5M9O A;  3I91 A;  3FMC A;  5I9O A;  5EBD A;  1XYI A;  4K2L A;  4HCE A;  4RCO A;  4HAE A;  4HMI A;  4KD3 A;  5M5W B;  2A68 D;  5E4W C;  2R93 B;  1B53 A;  2PMZ B;  2ID0 A;  1R4P B;  1Q3L A;  5D14 A;  3GD7 A;  3A55 A;  2HCI A;  4PQX A;  5DEH A;  3JAM L;  1EY4 A;  4QMG A;  2HCC A;  2NVQ B;  3SXH A;  1FNV A;  5EKL A;  2B2W A;  1EY8 A;  1WD1 A;  1T5E A;  1EY6 A;  1VF7 A;  3BVZ A;  2RDF A;  2OXP A;  2CW0 C;  3QO2 A;  1HUN A;  2KQ3 A;  5EPK A;  2EXZ A;  1EZ6 A;  1AFP A;  2B2T C;  3A7A B;  3S15 B;  2PCF B;  1VF5 C;  3FPU B;  1U4P A;  2SDF A;  5KGU A;  1FGB D;  3PMF A;  3S1R B;  4EGV A;  4DFA A;  1TII D;  3Q6S A;  3R3O A;  1PFB A;  2EVB A;  3HOW B;  5EBC A;  1V8Q A;  3DWA A;  5JPN C;  4WRD A;  3M4Y A;  3TP5 A;  4A93 B;  3ONA B;  1TQO A;  2Z4I A;  1RD9 D;  2Z4H A;  4KJN A;  1SJE D;  1KDB A;  3HEJ A;  3VR4 A;  2C5C A;  4C3J G;  3G6J B;  1IHZ A;  2IWH A;  1QIL A;  3GV6 A;  3T56 B;  5IOC A;  3TBI B;  3GTK B;  2SNS A;  2D62 A;  1A2U A;  2BA0 A;  4G7O C;  4WFN 3;  1EU4 A;  5G3L D;  4J1M A;  3SR1 A;  5COR A;  1U4M A;  2I46 A;  2JE6 I;  3OPO A;  4K5X A;  1H9M A;  3QIA A;  1YNN C;  2KJX A;  1DD2 A;  3Q23 A;  1I4G A;  1LTI D;  1E2W A;  3ND9 A;  5C0X J;  1A15 A;  4TQU S;  1HPC A;  3SVM A;  1XX8 A;  1S5D D;  3K58 A;  1SNP A;  3QB3 A;  2DY8 A;  2VB2 X;  1BXT A;  1LT4 D;  3S16 B;  4BY7 B;  2QEJ C;  2L12 A;  3MXU A;  2MHV A;  3DWP A;  2IL8 A;  2XWJ B;  4PMC A;  2EDG A;  1LT3 D;  4ME5 A;  5IGD A;  2BOS A;  1F9R A;  1I6H B;  1EWC A;  3OW7 A;  4I7Z C;  1SYG A;  4FF2 A;  3CU7 A;  3HOX B;  4BBS B;  2R61 A;  4DGZ A;  4DK0 A;  3VR2 A;  5C3X A;  1KNA A;  2F0T A;  4G7Z C;  3X3M A;  1DCZ A;  1BCP D;  3NHH A;  2ZXR A;  2CQA A;  1WTQ A;  5JPM C;  1CI3 M;  3IAY A;  3PO2 B;  5ELB A;  1U9R A;  3D4D A;  1KAA A;  2RDG A;  3GTJ B;  1ENF A;  4RKL A;  1WVL A;  1JB3 A;  4XT3 B;  3O13 A;  4ZAI A;  1JOQ A;  2BA1 A;  3BDL A;  2NYZ D;  2B2V A;  3SDZ A;  4KN4 C;  2Q8I B;  1F9Q A;  2B2U C;  4A3B B;  2KVM A;  1FYC A;  1V1P B;  4UAI A;  5K36 H;  2AWN A;  3MHB A;  4RGN A;  5COY A;  1KTK A;  4ZKB B;  2E74 C;  1JOK A;  4H44 C;  5E4X A;  1WTX A;  2OEO A;  1ML0 D;  3EFX D;  5FKA C;  5BN3 A;  4WOR A;  2RA4 A;  5C4X B;  1UEA B;  1U4R A;  3QG1 A;  1DZ1 A;  1HQR D;  1JOO A;  3TP7 A;  4A3K B;  1ILP A;  3BVG A;  1IKM A;  3BS1 A;  1EFI D;  1D5X C;  4EQN A;  2MGS A;  2YYZ A;  1B44 D;  4KY7 A;  5FO9 B;  1V1O A;  1O78 A;  4K8J A;  1OXU A;  4KK7 A;  3I8Z A;  2NUC A;  2F0Q A;  4JBW A;  4RHS A;  4EQP A;  5J39 A;  1AW7 A;  3MAQ A;  1SE3 A;  3DM1 A;  2WV6 D;  3KLS A;  2L4N A;  3BVM A;  1L0X B;  1A3V A;  3ITP A;  1HCZ A;  1WTV A;  1CK1 A;  3A8J E;  1LTG D;  3GP7 A;  3A54 A;  3X3N A;  5CC4 A;  1D5M C;  3E6Z X;  2EJF C;  4IUV A;  3MXG A;  2K7V A;  4OO1 G;  1KNE A;  1D1K A;  3P75 A;  2Q8T A;  2B2W C;  2AWO A;  1CQV A;  4K6D A;  2EY2 A;  4XYO A;  2IPK D;  4PNY A;  5G3L F;  4ZKC B;  1SNC A;  3ND8 A;  1EU3 A;  3LNN A;  2D9U A;  2FJ2 A;  3J7A F;  4A3I B;  1SMY D;  1SFO B;  3TDQ A;  4PMW A;  1NR4 A;  2Z8L A;  4HED A;  4X3K A;  1IKL A;  2E2I B;  3NK9 A;  5FLX E;  2BDO A;  3PV0 A;  2EYO A;  2JP1 A;  2PO4 A;  2B63 B;  4V0B A;  1WD0 A;  1J9O A;  3K6O A;  5DAU A;  3J7Y W;  4RGO S;  2K28 A;  2F0O A;  3J80 E;  2AUK A;  5CYU A;  4XYQ A;  2J0T D;  1ILQ A;  2DN8 A;  4PMB A;  2IX0 A;  4BS9 A;  1SJH D;  4ODG A;  1WCM B;  4K6L A;  3AU7 A;  5KYL A;  3SE0 A;  5EPL A;  3S1M B;  4RGT A;  1B1Z A;  2QDB A;  3I72 A;  1BCP F;  3HOU B;  3OSO A;  2LFN A;  1I4R A;  1F9P A;  3H94 A;  4MHE A;  1LTR D;  4XQQ A;  4H13 C;  1B3A A;  4R9W A;  2ICE C;  3BYT B;  2IT1 A;  1QG7 A;  3PUV A;  3IFT A;  4RA8 A;  1E2Z A;  2F0U A;  3VYR A;  2YU9 B;  4IZ8 A;  3HP3 A;  1DOM A;  1SYF A;  2XNA C;  3K59 A;  1G2T A;  2L55 A;  4KTA A;  3L9A X;  1HTP A;  4KKT A;  1H9S A;  2WP8 J;  1PFM A;  2MUY A;  1BQQ T;  1HFG A;  3H3V C;  2HUG A;  4G57 A;  5AFW A;  1SYE A;  3PO3 B;  4B08 A;  3HS0 C;  3CHB D;  2EY6 A;  5JEA G;  2X6G A;  3OIP A;  2TSS A;  1RJT A;  3OWE B;  3C2P A;  1B2T A;  2IJ0 A;  3P20 A;  1ONL A;  2FFK B;  2DY7 A;  2QKI C;  2WAC A;  3S2D B;  1ROD A;  3SK6 A;  1KDA A;  2AUJ D;  1JWU D;  2L11 A;  3HKZ B;  3OMC A;  4QF4 A;  1EIH A;  3MFY A;  3W3A A;  4LK1 C;  3KBX A;  2B8G A;  4IFD J;  2M00 A;  1NSN S;  3OMG A;  1WTP A;  4XQN A;  4BBR B;  5I9P A;  2N55 A;  5KNC A;  1E2V A;  2Z1C A;  1I6V C;  1TWA B;  3J81 L;  3PIO 3;  2KEC A;  3D31 A;  2LS0 1;  5C5L A;  2NBF A;  1TY0 A;  2CW0 D;  5ISR A;  3GTG B;  1EL0 A;  1PTO H;  1ZYR D;  3NQI A;  2B2V C;  1K8M A;  3QOJ A;  4K8I A;  2D5D A;  2H4O A;  4OO1 I;  2F0M A;  2EY5 A;  1XTC D;  2VXW A;  4L6T B;  1PZK D;  2K5W A;  1Z7T A;  3IL8 A;  4DNT B;  2QCP X;  4A3F B;  2EPB A;  3DMU A;  3GTP B;  5EKK A;  2XWB B;  4IUR A;  1E0B A;  1HTL D;  2V4D A;  5ELD A;  1Q8I A;  1H9S B;  3NTH A;  1GXD C;  1QNU A;  2XVS A;  1GJX A;  2B2Y A;  4OHJ A;  4OIK A;  1AZQ A;  3M7N A;  1STN A;  1F2M A;  1EY7 A;  4C3I B;  2X69 A;  1RF2 D;  4C1N K;  1Y1V B;  3LX0 A;  2JSO A;  1Y1W B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...