4H7BA

Crystal structure of staphylococcal nuclease mutant i72v/v99l
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKVEVEFDKGQRTDKYGRGLAYIYADGKMLNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Hydrophobic core mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 36
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2012-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4h7bA00
5NUCA 5CC4A 2F0GA 4IUNA 1A2TA 4F7XA 5CR3A 5CV7A 3QOLA 1A3UA 4ID6A 4LAAA 4ME5A 5F2DA 5C6AA 2QDBA 5IGDA 1EZ8A 3V2TA 3D4WA 4KHVA 2F0JA 5IGCA 5KGUA 1EY7A 1SNOA 4WRDA 3BDCA 4K5VA 4OL7A 4DF7A 1STYA 2LKVA 5IGFA 1EYDA 2F0DA 4J1MA 1AEXA 1KDAA 1SNPA 4IALA 4K8IA 2WACA 3U9OA 1SYFA 5CGKA 2OXPA 5ISRA 2EY1A 3SK4A 3H6MA 4DGZA 2F0PA 4MIUA 2PW5A 5I9PA 1SNQA 4K2LA 1EY0A 5EKLA 1KDBA 2EYMA 5I6WA 3T16A 2EY5A 4H7BA 3P1HA 1F2MA 2RBMA 1NUCA 2EYFA 1IHZA 3HEJA 2PZWA 2KHSA 3EROA 1NSNS 1STHA 2F0NA 3MZ5A 4K5WA 3TMEA 2PZTA 1KDCA 4DFAA 5C3XA 1A2UA 2O4XA 2EY6A 1STAA 4B9XA 4N9TA 4RKLA 2OEOA 1EY5A 5E1FA 1U9RA 4PMBA 1SYCA 2F0WA 4KD3A 3TP5A 4B9WA 1JORA 5C5MA 4IZ8A 4K8JA 2F0IA 1EQVA 4ODGA 2F0OA 5IOCA 3P75A 2PQEA 5J1ZA 3OMCA 3OMGA 3VA5A 2SNMA 5KIXA 2EYOA 4HTHA 1SNCA 2F0TA 3SK5A 5IODA 2HQEA 3MVVA 3RUZA 5CV6A 1II3A 4KY6A 1SNDA 2EYHA 2RDFA 3LX0A 4KV6A 5HGTA 1ENCA 5IGBA 4KJOA 2F3WA 2F0FA 2EY2A 3NK9A 4YIJA 5E3FA 5C3WA 5DEHA 4KTAA 4EQPA 5KRUA 2KQ3A 4K5XA 4R8NA 1F2YA 5I9OA 5CV4A 3EVQA 3NXWA 5IIFA 1EYAA 1SYGA 3NUCA 5J22A 1EY8A 1STGA 4WORA 5DAUA 1SYBA 5EKKA 1F2ZA 2F0VA 3QOJA 2EYLA 5M9OA 1RKNA 1JOQA 5CV8A 4NP5A 2M00A 3QB3A 4EVOA 4KY7A 3PMFA 3SR1A 2SNSA 2F0EA 1SYEA 2F0LA 4J6HA 3T13A 2EYPA 4NDXA 1ENAA 5C5LA 3SHLA 1EZ6A 5KYIA 2EYJA 4EQOA 4E6IA 1KABA 2EXZA 3OWFA 4ZUJA 4RKBA 1EY9A 3DMUA 1A3TA 1SNMA 3MXPA 4K6DA 3TP7A 3DHQA 3NP8A 3S9WA 2OF1A 4ZQ3A 3SK8A 1KAAA 4N9PA 4QB4A 1SYDA 5KEEA 5CV5A 4EQNA 4NMZA 3C1EA 1A3VA 5EGTA 4HMIA 2F0MA 1EY6A 1EYCA 5KYLA 2F0QA 2NUCA 5JAVA 2PZUA 3BDLA 3NQTA 2F0UA 4ZUIA 3TP6A 2SOBA 5CV9A 4DU9A 3TP8A 5HURA 3MHBA 4S3SA 5K5PA 5C4ZA 3HZXA 3EJIA 3C1FA 1JOOA 3R3OA 4K14A 1TR5A 4KY5A 4TRDA 5I6YA 5IGGA 1EY4A 3ITPA 5IGEA 4I65A 3ERQA 1JOKA 1TQOA 2PYKA 4G57A 2F0HA 4NKLA 4KD4A 4PMCA 4F8MA 2F0KA 3NHHA 1STBA 4QMGA 3SXHA 2RKSA 3D8GA 4PNYA 2F0SA 5C4HA 4HMJA 5J39A 3E5SA 4KJNA 5JOBA 4QF4A 2F3VA 1TT2A 3D6CA 2ENBA 3MEHA 3D4DA 3SK6A 3OSOA 1STNA 2PW7A 4K2KA
chains in the Genus database with same CATH superfamily
1X65A 3JC66 2CFMA 1HQMC 5C6AA 3QOLA 4DV6Q 1PH8A 3PGZA 1BBXC 3T53B 4K5VA 4O1NA 1N33Q 1IYVA 4A3GG 4WFN3 1AEXA 2A6EC 4RH6A 3J81c 3RN5A 2DJFC 3VR3A 1B9NA 3NQIA 3CCLA 1IW7C 1KNAA 3H3VC 1EY0A 1F9SA 1Q1EA 4A3BH 4ID6A 3E6ZX 5IGDA 2WIIB 5M3FH 1AZQA 1BNZA 4B9XA 3QR8A 4A3EB 2IHEA 2WAQE 3TP5A 3HOUH 2F0OA 1OXTA 3PIO3 5FO7B 4A3DG 3H3VH 3S1RH 4FXDA 2Y0SG 4AQYL 1PH1A 4DAYA 2ZTCA 3RUZA 4AIMA 4IO9A 1YNXA 1WD0A 3PUYA 3HKZG 5C44B 3FMCA 5IYBH 4GN5A 4DNIA 1V1PB 4X62Q 1VQHA 4Y7NH 5I9OA 3T56B 1GO3E 1HR0W 1HFGA 3FEWX 2Z0SA 1RKNA 2BOSA 1O80A 2N8NA 4FDBA 3RLNA 3PMFA 1KLGD 1CZGA 2EYJA 1LO5D 1HTPA 5E7NA 5ELDA 2NWGA 4KI0A 3CQZH 4RKBA 5CBAE 4ZKCB 1SR3A 3NEMA 5JJLA 2EDGA 5IP9H 1EIFA 4KMUC 5DLQE 4NPSA 3C1EA 1GVPA 2ID0A 3ONAB 2QA4A 4IUQA 4JI1L 1LTTD 4TRDA 5BN5A 4CKCA 3K8AA 2K1BA 2ZXPA 4JPBW 3U58A 1H9MA 5COYA 2JA6H 1IL2A 2RKSA 2FINB 2VB3X 3ULPA 3E5SA 2UXBL 4DV1Q 3T1YQ 3UDFA 4QUFA 5FLXE 1VS0A 3V96A 4MNOA 5G3LF 4M8AA 5F2DA 1JE4A 1A6XA 1A63A 3V2TA 3D4WA 4JI0L 5IGCA 5IWAQ 1H9RA 3O13A 1JJGA 1K8AC 2K52A 1KTKA 1HRJA 3QJYA 2HCCA 1MBYA 4BY7H 4IALA 4LF8Q 3TEHB 4CJ0B 2F0PA 4IUPA 1CI3M 4N8X1 1AW7A 4C3JH 4OO1I 1YHAA 2NVXH 3P1HA 2QW7A 5AJ3Q 2KCTA 2QEJC 4KN4C 4DK0A 4N9TA 1JB7A 2JA8G 2K03A 1J6QA 3HGBA 3CC2A 4HIDA 3BVGA 1TWGH 4C3IH 2UUBL 2R93G 1ESFA 3VA5A 1FL0A 2QEXA 5LMNQ 3S15H 4RG1A 3KLSX 3DM3A 4JYAL 2A6HD 5C0XH 3I56A 2KCMA 1EU4A 2HUGA 1XMQQ 4I7AA 1CKNA 3EVQA 3ER0A 3NUCA 1TIID 3AYHB 3H94A 1CKMA 4LWCA 1K3BC 1PFSA 4UAIA 5FLXL 4RCNA 1VQGA 4OO1H 1EOTA 2HQLA 3J7A5 5M5WH 3I2ZA 3M7GA 2PI2A 3LGJA 4P75A 2RF4A 4JI4L 2WP8J 4NB3A 2ZJRA 2L12A 2F52A 2Q2IA 1IZ6A 1WD1A 3CKIB 2NYZD 3S14H 3PO2B 4BWGB 3VDYA 3CCRA 3HOYB 4PZ7A 1WTWA 4XIGS 2KJXA 1HNXL 4RMFA 1Q8IA 1Y1VH 1TQOA 3CMAA 2F0KA 4LF4L 4LFBL 1EL0A 2FFKB 5C4JB 4B3SQ 1D7QA 4HMJA 2NVTH 1K8MA 1D6EC 4QF4A 5JVH3 2JA7G 4AQYQ 1TT2A 3FDTA 3CD6A 2EIFA 5EJWA 2R7ZH 4K2KA 5IYCG 1LTSD 3HOWG 3GTOH 3X3NA 4OGQC 1PYWD 1ILQA 3MTSA 5KGUA 1LTBD 1KIXA 4WRDA 4GZYC 2LKVA 5IY0A 1SNPA 5C4XB 1VQAA 3GTJB 4OHJA 1L1OC 2I5HA 3I8ZA 2K50A 1EQQA 2EYMA 4A3IH 2PNRC 1MGSA 3S16B 2XRSD 1I5FA 4OIJA 3GP7A 3MWYW 1E7ZA 3BYYB 4IUUA 1DM0B 3MFGA 4PMBA 4JW0A 4FF2A 4KD3A 4C3HG 4LUZA 5FOBB 1VQ8A 4K8JA 2IW3A 4OONA 1LYLA 4A4IA 2UU9Q 1A15A 1AN8A 4JI1Q 2CKZB 5K36H 3BDOA 1B70B 1SNCA 2UUCL 1LTRD 4FXGC 1CA6A 5IGBA 1C9OA 3H0GG 1E2WA 1ICWA 3KJPA 4LNQA 1B9MA 4XT3B 1PFBA 1WTXA 2E75C 3DUZA 5CV4A 3S1QH 1Q90A 3VYUA 3M4OB 1D5MC 3OIQA 2B2VC 1ICFB 2Q8RE 3LWUA 3GTPB 2GA4B 4LF7L 3TN2A 2EJFC 1D1IA 1MJCA 2ZTDA 4A3FG 3K57A 4PZ6A 3QWNA 1SNMA 3TP7A 4HJAA 1SEBD 1NNXA 4DAYB 1AP0A 3S9WA 4YY3L 2NTSA 1ASYA 1XJVA 1DONA 2OWOA 1L1OA 5ELOA 5GQOA 2KOLA 4DR1Q 4JC0A 1VQKA 4HSPA 1HFNA 1RD9D 3A55A 1QZGA 3PUWA 1XMOQ 3GQBA 3PF5A 4RFBA 4KY5A 4JOIC 2ZXOA 4A75A 1BO0A 1RF2D 4A3EH 3NHHA 3KYHC 3VR5A 5JJIA 2N88A 2F0SA 4KJNA 2E2JB 2VUMG 2XSCA 1IKMA 1VQDA 3N6RA 4AYBE 3Q23A 4JYAQ 1XNRL 3OHXC 2B39A 2XVSA 5CR3A 5C44H 3BVZA 1W6JA 4EGVA 2Z4HA 2FMCA 1PTOD 3I4OA 2XNAC 1EY7A 2Q2TA 1VMCA 4FO2A 2Q8IB 1F77A 3J80c 1Y1WG 5ISRA 5GAHC 1XPRA 1WCMB 4C1NI 2R92G 1HXYD 3AEVA 4QQBX 2ZM6L 1F2MA 2AQ3B 3CF5A 2B2TC 1NY4A 4KLKA 3JAMc 2OT2A 2I5MX 2F3IA 2OEOA 1A0IA 4JI4Q 1J8IA 5LL6X 4A3JB 3J7ZC 3UDGA 5M3MB 1MHWC 2O5JC 4MTNA 2IPKD 4JOIA 3UDIA 2ICEC 4X66Q 4B3RQ 4DK3C 1PRTC 2EY2A 2BA1A 2MGSA 5DEHA 2V4DA 5EBDA 4LFBQ 5CMDA 1BCPC 1EYAA 1SYGA 1J5EQ 3EN2A 1SYBA 3KLSA 5EKKA 4DV7Q 3FPUB 1PLFA 4L63B 1WTPA 4DR4Q 3KOJA 4A3BG 1SJHD 4LFCQ 2C5CA 3OOCA 3G48A 2RDHA 1ZYRC 2AQ1B 4K6DA 2LXJA 4ZQ3A 2Z9HA 1IBKQ 2JEAI 4CDDC 2M2LA 1GUGA 3E0JA 1CK1A 4DV6L 1WVLA 3HOUG 1A3VA 3CPWA 2F0MA 3KBXA 1C4QA 2NUCA 1PYSB 1IL8A 1T5EA 1CKNB 4YWLA 1HR0Q 1N33L 1NBWA 2E2DC 1YJ9A 2KEEA 5G3LD 1FYCA 3ND8A 2H4OA 3WOEA 2DGYA 3SE0A 1UNSA 3MXNA 1KLUD 2CH4A 5D3IB 3KF8B 4JBWA 4HCEA 1A2TA 3OPOA 1AH9A 1A3UA 2RHSB 2EPBA 1BKBA 4KHZA 1SNOA 5IP9G 1C7YA 1JR0D 2JE6I 2F0DA 3K5MA 1QUQA 1KQSA 4LF7Q 1VQEA 1BQQT 3HOXB 4X62L 1X3QA 2JEBI 2OTLA 1H9SA 3W3AA 4K2LA 5GADC 4O0AA 5H1SE 3NBHA 2EXDA 3R2IA 1DCZA 4K5WA 5I6YA 3I4MG 1A2UA 2O4XA 3PIOA 4A3CH 1X6OA 2A69D 2WAQG 5E1FA 5IT9c 5FJ8G 4HIKA 2JA6G 1GJXA 2X6GA 4CDEC 1M90C 4A93G 2IWHA 1F9RA 1WTOA 1RDPD 4HTHA 3A5UA 1WTRA 3PO2H 3NELA 5CV6A 4Q0FA 1M4VA 1B2TA 5C3EH 2VB2X 4FVMA 2LY7A 4YIJA 1UE6A 4Q5VA 2XWBB 3DXJC 1OXUA 3NXWA 1FVIA 4BY7G 5C4JH 4U68A 1FGUA 2EYLA 2JK8A 3ICEA 1XXGA 2M00A 1VQNA 1GUSA 2F0EA 2WKDA 2ZTEA 3T13A 3R93A 2RDGA 1NTGA 3SHLA 3TS0A 2BE5D 3NPPA 1I6VC 1SXTA 2I5LX 3L0OA 1EYGA 3T1YL 1PVOA 3T51B 3J7AF 1VQ9A 5ELFA 1B53A 4BA2I 1ENFA 4R4CA 2VZAA 5EBCA 3A54A 3TREA 5C4XH 3GTJH 1PTOB 2EZVA 1I50B 2LSSA 5IWAL 1TKWB 4MN3A 3TP8A 3J81E 2WB1E 1RL2A 2VQEQ 5M5XB 1KC8C 1SAPA 1UEAB 3Q6SA 1JT8A 3S16H 5ELBA 4DR5Q 1TS4A 4LF8L 5J3BA 4A3GB 1TXYA 3NTKA 4KD4A 5D14A 5FO9B 4XQNA 1TS3A 2CQOA 1S4ZA 2OQ0A 1BOSA 3QO2A 4QMGA 2A68D 1E0BA 1VQIA 3S2DB 4A3LH 1JB3A 2QF7A 4KHPQ 1LTLA 2MO1A 1CT1D 4QJFA 1I4GA 4GKKL 3S17B 1J9OA 1VDZA 3H09A 3NWTA 1EWCA 2QDBA 5FLMH 1O7ZA 1VQ7A 1B1ZA 1XPUA 1M8AA 1TY2A 4A3DB 3M4OH 3I70A 4UP8A 2Y0SB 4IUTA 1YI2A 1U4LA 5GAEC 4IFDH 3NENA 1TWFB 4DGZA 2NZHA 3GTPH 1XMQL 3HKZB 5I9PA 4GLXA 1SNQA 2YTXA 5EKLA 4CKBA 2EYFA 2RSNA 5I4DA 1Q7YC 1VMPA 4LF9Q 2QCPX 1SMYD 1PMRA 1SYCA 4BXXH 2H1EA 5A2QE 1BUVT 4ZYSA 3K7AB 1VQJA 5EAYA 1SE4A 2PQEA 2MHVA 4L8JA 3CRKC 1XTCD 3BYTB 3GTQB 5IP7G 3J81L 2NVQB 4DV4Q 5FKAC 4EX5A 4L5QA 3NTHA 5KRUA 4HR7B 1HZBA 4LUOA 2PO4A 4BBRG 1F2LA 2A6HC 3UI2A 3QOJA 3SGIA 2E2JH 5M5YB 2BCOA 4KY7A 1L0WA 3SR1A 2DN8A 4X3UA 4RGNA 5AFWA 1N9WA 1EZ6A 4B3SL 2I46A 2NB0A 2EXZA 2JP1A 2DJGC 1JICA 3DEOA 1QILA 3A56A 2BH8A 3L2PA 2D2CC 5BR8Q 1S5BD 4XTCS 3NP8A 4CGYB 1EOVA 2D9UA 1AE2A 2B8FA 1XWEA 1W2BA 1WCMH 3NQTA 4DXFA 4DAPA 4NXNQ 3HZXA 1DOMA 1V8QA 3HFZB 2CCZA 3E9HA 4FF3A 1CQVA 3HOVG 5IYDH 1F9PA 3AQQA 1PH7A 4A3JH 1B50A 3D8GA 1BBUA 4B3MQ 4OELB 5J39A 1BDOA 5M3MH 2PMZE 5A2QL 3G4SA 3DWPA 3SK6A 3K0YA 2JA5G 2PW7A 2YV5A 2JA8B 2QILA 2HD3A 4C2MB 2UU9L 2K75A 2EJGC 2F0JA 2E2IB 2R93B 1NMGA 1FD7D 3FKIB 1WJJA 4GN4B 3D4RA 1XYIA 1JQYD 3E0EA 4X64Q 3G71A 2WACA 4I7ZC 3L3OC 1BF4A 3FHWA 3D31A 3T16A 4H7BA 5J1ZA 4CHTB 1HTLD 2UUAQ 3MXNB 2PZWA 2KHSA 2FHTA 1GUTA 1KDCA 4JVZA 2BH2A 4BBSG 2NZ1D 3F2CA 4RKLA 1HNZQ 1PRTB 2VQFQ 4B9WA 3Q24A 1PH4A 2CW0D 1VF7A 2DNCA 1BCPB 1LV9A 1PA6A 1WTVA 2EYOA 1TWAB 2KUMA 3SK5A 1EQRA 1QUQB 4DR1L 2X69A 1Y8PB 1H9SB 4EQPA 2JQOA 3NBHB 3M4PA 1XMOL 4LJZC 5IIFA 4J8QA 1A8VA 3IAYA 1STGA 1CZWA 5LMUQ 5M9OA 3I4NG 4DR6Q 3R2TA 1I94Q 4GKKQ 1F9QA 1SE2A 2SNSA 4P71A 3RMHA 2KENA 2R7DA 3V05A 2CWAA 3L7ZC 2MNAA 1N8RC 1T9HA 1D5XC 5JEAJ 4UP9A 1E3PA 2JA7B 1IBLL 2HIVA 2B29A 1ONLA 3RZOB 4EQNA 1S40A 5KYLA 3HOWB 1EYCA 2K6AA 1FR3A 4ZUIA 4DV0L 1X3GA 4BY1G 4V0BA 3TP6A 3PO3G 1GUNA 2XRQD 4C1NK 1K73C 3F2DA 5EQ0A 3CXCA 1HA5A 3ITPA 3ULJA 4GNXA 4R1JA 5JEAG 3ERQA 3LNNA 1GXDC 3AU7A 3W5OA 4G7ZC 4YCVA 2QDLA 3M3YB 1Z47A 4PNYA 4ZCKA 4LF6L 1NAPA 1GD7A 4AYBG 1QB5D 3MEHA 3D4DA 1EFWA 1MIUA 3KF8A 4O2DA 1W6KA 2NN6G 4MTKA 3K7UC 4QCLA 4C3HB 4DA2A 3M4YA 2AKWB 1LTGD 4X66L 3UE0A 4B3RL 1PXUA 1R4QB 4JI3Q 4DR2Q 1KDAA 2ASBA 1D5ZC 2K05A 3AB9A 3H91A 4MIUA 1PTOC 3H0GB 1KDBA 4GLAC 1H95A 2CH4W 2RBMA 5FK9C 1J5EL 5TSSA 3TMEA 4DV7L 1STHA 4JCVE 2N78A 5C3XA 1XNQQ 1PH6A 1IBMQ 2B63B 4DR4L 1SBBB 4DNTB 1D1KA 1EY5A 3CRLC 1U9RA 1DGSA 1K8GA 4LFCL 1JORA 1PH9A 2ZJQA 1O7LA 3ZYYX 2R6GA 5BN4A 1BVSA 1CKOA 3H15A 1Z9FA 1PTOH 1I50H 3TZDA 1TWCB 5M5XH 1IBKL 2Z1CA 4UY8C 1FGBD 2BDNA 3OYYA 4FXKC 1SE3A 1ILPA 1TS5A 1QOHA 4DUYL 1HR0L 4A3GH 4ZRZA 2M9VA 1U4RA 3S2DH 1EY8A 4PMWA 1YNJD 3M4QA 1SE8A 3K81C 3A8IE 3TDQA 1RODA 4J6HA 3S17H 4L5RC 3AFPA 4JI2L 3OWFA 2Q2HA 1YNND 2DNEA 3U4ZA 1A3TA 1TWHH 3I4LA 1OXVA 2HDLA 2OF1A 2VUMB 2VXWA 3I3CA 4A3DH 1KRTA 3I7FA 3I55A 3HKSA 1BR9A 1EY6A 4P2CB 1G6PA 3J80E 1TWFH 4R4QA 5HURA 4DU9A 4QIWB 4YCUA 3J81i 3PQIA 1DOLA 5C4ZA 4L6TB 4JI6Q 3W1GA 5C3EG 5ELCA 1CQFA 1HA6A 1HUMA 4IN3A 2XN9C 1Y1WB 3JAME 2YTVA 1N34L 3HP3A 3AFQA 3K7AH 2PNHA 2A19A 4ZAIA 4POGA 5LHY1 3OTOL 1QJOA 4RAUC 5KNDA 3GTQH 2ZT9C 3TZUA 2NVQH 2D0OA 3EFXD 2E2HB 4KHVA 1D2BA 1SFOB 1LT6D 1K3RA 1JJCB 2MQHA 5IGFA 4B3TQ 4J1MA 4CJ1B 3U9OA 2SDFA 5M5YH 1B3QA 3ZJYC 2CHBD 3VYRA 1JJ2A 3BZDB 3HEJA 2CWPA 5A35A 4TKOB 1L0YB 1IBLQ 5T1IA 3RN2A 3J7YW 1K83B 2KCNA 4A3LG 2F0IA 2HCIA 1OTCA 4DV0Q 4ODGA 3F1ZA 4QL5A 4X3SA 3KJOA 2A69C 3CW2C 3J81j 1X3PA 3PF4A 3J80L 3IRBA 3HOZG 1JE5A 3EIVA 3SVMA 4K5XA 2VQEL 2GVBA 4LF6Q 2K5NA 3JAML 4IJHA 4DR5L 4IFDG 4X65Q 1W3SA 2A74C 4ILWA 5GAGC 4NDXA 2G9DA 4CKEA 2JA8H 4E6IA 4KHPL 4C2MH 3MXPA 3E9IA 4ULLA 2E2IH 4BXXG 4JI7Q 2R93H 3FKIH 2MPMA 2ATWA 4QB4A 2UXCQ 2PQAB 3CCUA 2BE5C 2VL6A 4NMZA 1OO9B 1N32Q 4A3MB 2CQAA 1BBWA 2F0QA 2WB1G 1HHVA 2L11A 1TVXA 2ES2A 3EBEA 4UHVA 4JBMA 1P8LA 5FO8B 1KD1C 3G6JB 4K0KL 1ML0D 1JOKA 4NKLA 4F8MA 5LMNW 4KKSA 4CJ2C 4XXEA 3DM1A 5M3FG 4DUZL 1ZKOA 5IT9E 1UUPA 3WWVA 5C4HA 4LF9L 1ESRA 3CPFA 5E4WC 4A3KB 4JI8Q 1BXTA 2KA7A 3I4MB 1TWAH 3OSOA 1YJNA 1KXLA 3S24A 4JI5Q 1I3QB 2A68C 2WAQB 1SMXA 1PZJD 4NW2A 4DUYQ 1AE3A 4CBVA 5HY6A 1K0RA 4UPAA 4A93B 2K5VA 2PCFB 5IYBG 5EPLA 1PHJA 4GNXB 2J7ZA 4PQXA 4DV4L 1S5ED 4L5SA 3H6MA 3URYA 1R4PB 1QVFA 1QVCA 3RLFA 4JI2Q 3WOFA 4H02A 3MZ5A 1NSNS 4RGOS 2F0NA 1ZXTA 3X3MA 4YWKA 1IKLA 1MSGA 2JA7H 1YITA 4HJ9A 5DM63 3RZOH 5IYCH 5BN3A 3HOWH 3P75A 3VYTA 5BR8L 4FYDA 1KL9A 1UWVA 3OMGA 1SMYC 1UE5A 3M9BA 1PZID 3HS0C 3K0XA 1Q86C 2HQEA 3VA7A 1G291 2F3WA 1I4RA 1S5FD 4FP5D 1N34Q 3TRZA 4R4TA 3CAMA 1RHPA 4NXNL 4WORA 3BG3A 3GTLB 5IT9L 3VR2A 3OTOQ 2XIWA 2ZXRA 5C5LA 3IFDA 3K5OA 2UXDQ 4NXMQ 4B3ML 1HH2P 2ZJPA 2A1AA 4C3HH 2Z6KC 1MJEA 1K0SA 3HOYH 1UEBA 1QG7A 2R61A 3VYSA 1Q12A 4OWWB 3QIAA 3RLOA 1MI2A 4A76A 3GV3A 3MXUA 1G51A 1VQFA 5CV9A 2I0QA 3H0GH 2K33A 1VF5C 4K14A 4X64L 1K28A 3U4VA 4C3JG 3CU7A 2B63H 2L1BA 4LFAQ 1HCZA 2BA0A 4OXPA 3E3XA 2UUAL 2ALYB 4GN3B 2OQKA 5C0XJ 1I6HB 4FF1A 1CTMA 4DV2Q 4JV5Q 1EEFD 2F3VA 4C3IG 1HNZL 1TWCH 3OIPA 2VQFL 4QGUA 1STNA 4HCSA 2F0GA 3RZDB 1IXRA 3OW2A 4F7XA 5CV7A 4KKUA 1SRUA 1JWMD 4DR3L 2E5LQ 1EZ8A 2C9OA 2B2UA 3D6WA 3GD7A 1UE7A 5C0XG 3I90A 2IX1A 3VR4A 5I2YA 2HT1A 1HNWQ 1K9MC 2KEDA 2EY1A 2MO0A 1LUZA 2IJ0A 1YZ6A 4HJ8A 2Z6KA 1B3AA 3CP0A 3ULLA 1UE1A 5LMUL 3K59A 4DR6L 4BBRB 1I94L 4XYOA 4MHEA 1YHQA 4HJ5A 4DR7L 1EUJA 2F0WA 2VUMH 4OO1G 3PUZA 5DNFA 1P16A 4UDUC 5CORA 3T1HL 4Y52H 1EQVA 4EQ5A 2IX0A 5IOCA 2B3GA 3S2HB 1CUKA 3OMCA 4OWTB 2NTTA 3A0JA 3GTMB 1TS2A 3MVVA 4K0KQ 2EYHA 2RDFA 2CW0C 5HGTA 1ENCA 5E3FA 3S1MB 2L4NA 1KNEA 3K5LA 2KQ3A 4DUZQ 1E24A 1Y1WH 1VQMA 1Y1VG 1S72A 2JJQA 1N36L 2F0VA 2JSOA 2NZOA 4XT1B 1GKHA 2IY5B 4N8FA 1Q1BA 2RQXA 4HEDA 3CHBD 2F0LA 2EYPA 2XGTA 2E76C 1SDFA 2WFWA 4IUVA 3HOVB 2R7ZG 3NE5B 2E2HH 1NE3A 2SEBD 1X9NA 1SFOH 1C0AA 1E22A 2GVAA 1AFPA 2K01A 2KBNA 2J0TD 2TSSA 3CCSA 1Y69U 1O7YA 2JA5B 3D3RA 2XWJB 1I4PA 1G8ZD 3J80i 4JBKA 4ZLTF 1JMCA 1EFID 1FJGQ 1PH5A 3BVMA 4JI3L 4DR2L 4LUVA 2Z8LA 2NVYB 4A3IG 1NR2A 2F0HA 5KNCA 3OWEB 2XTIA 3JAMi 1GOZA 1STBA 1K83H 2KVMA 3SXHA 3B6YA 1LABA 1XNQL 1NJIC 1IBML 1U4MA 2C35B 5IE8A 3BU2A 2MP1A 1U5KA 3STBC 1SN8A 3G7LA 1VQ4A 1PTOF 4Z9CB 4BBSB 5D65A 2E8GA 3A5ZB 4JG2A 5CC4A 2AHOB 5K36G 2WKCA 3KBGA 3K58A 1CA5A 2FMMA 1YVCA 2RCFA 1G91A 4IPGA 3I91A 1E1TA 2RHQB 5CGKA 1QVGA 1QNKA 2K14A 1IYUA 2D5DA 1GM5A 4U673 1NUCA 3U50C 2VNUD 2PI2E 3MAQA 3TQYA 3NBIA 1RCVD 2IT1A 3C2PA 1NR4A 2L0CA 4DV3Q 1EIYB 3I4NB 4IZ8A 2EE1A 3N52A 3RD4A 3RR5A 3MFYA 4A3MH 4XQQA 4ZK9B 2RCNA 2MUYA 2L5TA 3U9SA 1GUWA 4KJOA 1VCIA 3NK9A 1S5CD 1R9TB 1F2YA 1S3OA 3FVQA 5LL6S 4JI6L 3PO3B 4BY1B 1NMFA 4GNXC 4A3EG 4LK1C 4DAVA 2HHHL 2DY8A 4RWSC 4TSSA 4A3KH 5CV8A 3C46A 3PIP3 2A8VA 3I4MH 3P7JA 1I3QH 4DR3Q 3W2DA 5FJ8H 4IPHA 2L55A 4JK1C 4PG3A 1YNJC 2LS01 3RNUA 4A93H 3KF6A 5C44G 4DNRB 1PDQA 2PQAA 4AYBB 3CC7A 3W1BA 4QUCA 5C0XI 4CDCC 3M7NA 5DM73 2EOTA 1YNNC 4GKJQ 2SOBA 3MHBA 4B3TL 2FXQA 3C1FA 1LM0A 1TR5A 5IGGA 1H9KA 1VQLA 2B2WC 4DR7Q 4WJWA 3DWQA 2PYKA 3KUPA 3GV6A 3EA6A 3T1HQ 2NBFA 4LMQD 4HAEA 1EIGA 4KKTA 4XDXA 1JC7A 2B2YC 4GOPC 2HIXA 4DV5Q 2JYOA 2AMCB 1H9JA 2EJMA 2DUDA 3HOXH 1S5DD 4LAAA 3S1NB 2A6ED 1Q3LA 3DWAA 3A7AB 2IX3A 2VS1A 1I4QA 4P72A 2E74C 4LW1A 1IW7D 1KAWA 4ME3A 1HZCA 3FKIG 1WTHA 4DF7A 1V9PA 3IKJA 1N36Q 1EYDA 2F4VQ 3R8BA 3STBD 3GTLH 3KDFA 1ZEQX 2OXPA 4DXGA 4RHSA 3PUXA 4APVA 2JXMB 4YHHQ 5I6WA 2IL8A 1YJWA 1GHJA 1XTDA 2PZTA 2ICIA 3CCJA 2EY6A 4X65L 1PH2A 3MC0B 2F1MA 1JWSD 3EQLC 1YHBA 5JPNC 1VQBA 2G5DA 3CCQA 4MZ9A 2K4KA 3HRZC 4YWMA 1CHQD 5FLXc 1DD2A 3GTKB 3DEPA 5KIXA 2RA4A 4JI7L 4F87A 2F0TA 2K32A 2UXCL 2B2WA 2Y0SE 3BS1A 4KY6A 3A8KE 3KK7A 4R4IA 1N32L 3HKZE 1V43A 2JN4A 4KTAA 1PFNA 1RIPA 3LWEA 1JWUD 1QWYA 2GN5A 4XQJA 4GLVB 5J22A 1PRTF 4TVAB 2B2YA 4GOPA 1EWIA 1I6HH 3TS2A 2O2LD 1G2SA 1PZKD 1SJED 5C3EB 2AUJD 1UAPA 1BCPF 5JVG3 1SYEA 3RZDH 4OWXB 1WTQA 4A3FB 1EY9A 1U4PA 4JI8L 2BDOA 2VW9A 4FNFA 4JI5L 3I72A 5JJZA 1HZAA 4LF5L 5KEEA 5CYUA 2AWNA 3BZCA 4RHRA 1DZ1A 3UDXA 2DY7A 5IP7H 2PZUA 2LMCB 2F0UA 2N55A 3NTIA 5K5PA 3GTGB 3EJIA 1JOOA 5JJKA 2AUKA 4BBRH 1KRSA 4BS9A 1Z6HA 4A3CG 2AWOA 3CCEA 1HQRD 1SLJA 3S2HH 1O7IA 2ENBA 3GTMH 3T4AC 1HJPA 4F88A 1PYBA 1AZPA 2Q8TA 3J7AV 1LT3D 3K6OA 3PO2G 4ALPA 3S1MH 1MKHA 3HOYG 2KHJA 2RVLA 3IL8A 3BDCA 4OL7A 1TY0A 4H0LC 5I2XA 2HHHQ 3KLRA 3HG9A 4PZ8A 1PFMA 5GROA 1EIHA 3Q0AA 2N49A 3SK4A 3HOZB 1Y8NB 2IHFA 2R92B 3BZKA 2QKIC 2N3SA 1JCKB 3EROA 3FP9A 3HOVH 1YEZA 2B63G 3KFUA 2UXBQ 2OTJA 2EVBA 1LTAD 4AH6A 3TSSA 2UXDL 4NXML 1XX8A 1VQPA 2JA5H 1WI5A 2D0PA 2YU9B 1DJRD 2Z6BA 4K6LA 4JI0Q 4OX9L 5C4XG 4OEMB 5JPMC 4O42A 2X6LA 1X32A 2NVYH 5C3WA 5EPJA 1OXXK 2R3ZA 1Q8KA 4DK6C 1YIJA 3TBIB 2WB1B 1LT5D 1F2ZA 1JOQA 2K5WA 1V1OA 4NP5A 4EVOA 3A74A 4LFAL 3BJUA 3DLLA 3CC4A 4BBSH 4A3BB 1ENAA 2UUBQ 1KABA 4IPDA 5M3FB 1G2TA 4ZUJA 4DV2L 4JV5L 4IFDJ 1CSPA 1C8CA 3A8JE 4HIMA 1V1QA 1KAAA 5FLMG 1MSHA 1SYDA 3G6EA 2OCEA 2E5LL 5EGTA 3HOUB 1E2ZA 2RSOA 1B8AA 4X3KA 3MXGA 3AMUA 4IQZA 4ABNA 3S1RB 4ZKBB 2VY3A 5CBEE 2WINB 4YCWA 2MFIA 4POFA 1HNWL 1PV4A 4UP7A 4X6AH 2B2VA 4M1UB 1GHKA 4RGTA 2PPBC 1CM9A 2L15A 4Y7NB 3I4NH 2V1CC 2NN6I 3PV0A 1CSQA 1WOCA 1Y14B 3KLWA 5JOBA 3KF6B 3D6CA 3PUVA 1VQCA 4G57A 1SROA 1QNUA 1GUOA 3CQZB 1HZ9A 5L37A 4JBJA 1R9TH 3PO3H 4BY1H 4K8IA 1NCVA 1HNXQ 3K5NA 1LLRD 4H13C 2G9HD 1T5XD 5JEAH 4R4OA 1L0XB 4KN7C 1V1PA 4P74A 4LF4Q 3CMEA 4PV1C 3K80C 5ELEA 4X3TA 1U0LA 1G6ZA 3F2UA 1Q82C 4LF5Q 3GDEA 4IOAA 2JA6B 3SEBA 1Q81C 3MA2B 5EPKA 1EEID 4L5TA 4RA8A 5C5MA 4HJ7A 2R7FA 1MD2D 1EU3A 3IFTA 2NN6H 2SNMA 2YYZA 3C3LA 2F03A 1DOKA 1WCMG 3KDFB 4KV6A 1VQOA 2A5HA 2P5ZX 1FJGL 2LFNA 1X3EA 4FF4A 2J4XA 2B2TA 4BY7B 4DN4M 5IYDG 3D0FA 4A3JG 3CCVA 2KHIA 3QB3A 2EQSA 4C3JB 5M3MG 2NVXB 1DXMA 1HUNA 1O78A 5KYIA 3NSWA 3S1NH 2QGQA 1LTID 2PMZB 1Q46A 1LACA 3SK8A 2UUCQ 1RJTA 1TWGB 4C3IB 4V190 1EWHA 4TQUS 4HMIA 4A3MG 5JAVA 2B2UC 2L9HA 4B08A 1B4OA 4HSVA 1XPOA 3M3YH 3S15B 4G7HC 4DKAC 4GOPB 5E4XA 5IGEA 2CVRA 1B7YB 2K28A 1X55A 4H44C 2K5HA 2Q2UA 3FRPB 4DPGA 1HPCA 1EQTA 2B8GA 4R9WA 1WFQA 1Z7TA 2K5QA 1I4HA 1CHPD 4A3KG 4OX9Q 4DV3L 3GTKH 3A7LA 1KHIA 4IURA 2K5DA 4YY3Q 5NUCA 1X54A 2I07B 3F2BA 3P20A 4G4KA 2D62A 4ME5A 3NWSA 4QIWE 5M5WB 2KECA 5T1GA 1ET6A 4RGMA 1DYQA 1STYA 1LT4D 2WV6D 2F4IA 4OIKA 1RTNA 2K7VA 5KNBA 4IJLA 1SYFA 2PW5A 2YTYA 3S14B 1E1OA 2EY5A 4IUNA 2A73B 1VQ5A 1IHZA 1M1KC 5D3DA 4A3FH 1Y1VB 4DFAA 1FNVA 1STAA 3ERSX 4CDFC 1I4XA 4C56C 3SDZA 1XNRQ 2H5XA 1PRTD 2NVTB 2K04A 3FPPA 1YBYA 4GS3A 3M85A 4DV1L 3PCOB 3CCMA 5IODA 2R7ZB 1BCPD 3GTGH 3GTOB 1II3A 2O5IC 4P73A 1X56A 3Q8DA 1SNDA 4R8IA 1TU2B 4XYQA 3HOXG 3LX0A 1Y8OB 1QCBD 1E2VA 4IFDI 2F0FA 3GO5A 4GKJL 1C48A 1STEA 3PIPA 4R8NA 1QZHA 2ZM6Q 4HIOA 1FNWA 1ASZA 5DAUA 2AQ2B 1ZYRD 1OXSC 2HDMA 3VR6A 2KCCA 2LXKA 3UE1A 5ELNA 4DK1A 4A3IB 3F8TA 4EQOA 1B44D 2MJ8A 1ET9A 5HGQA 3DMUA 4BA1I 4DV5L 5AJ3L 3DHQA 1IYJB 4J15A 4QY7A 1K8OA 1CFMA 5EKIA 3QG1A 1FNUA 4N9PA 1PH3A 1WYDA 5CV5A 1L1OB 1VQ6A 1QE6A 2JA9A 3BDLA 3HOZH 2R92H 4HN7A 4S3SA 2F4VL 1TWHB 3R3OA 5LMNL 4RCOA 1EY4A 1L2FA 4I65A 4WJ3M 3MEFA 4PMCA 3L9AX 4IOCA 3OW7A 1D8LA 2TMPA 3I73A 1A62A 4IPCA 2Z4IA 4DAMA 4KK7A 4YHHL 3Q22A 3S1QB 4G7OC 2FJ2A 3H3VI 3PSIA 1SSOA 1RTOA 1X3FA 4WJ4A 2YU9H 3WDNA 3ND9A
chains in the Genus database with same CATH topology
1HQMC 5C6AA 3QOLA 1BBXC 3T53B 4K5VA 4O1NA 1IYVA 4WFN3 1AEXA 2A6EC 4RH6A 3VR3A 1B9NA 3NQIA 1IW7C 1KNAA 3H3VC 1EY0A 1F9SA 1Q1EA 4ID6A 3E6ZX 5IGDA 2WIIB 1AZQA 1BNZA 4B9XA 4A3EB 3TP5A 2F0OA 1OXTA 3PIO3 5FO7B 4FXDA 4DAYA 3RUZA 1WD0A 3PUYA 5C44B 3FMCA 1V1PB 5I9OA 3T56B 1HFGA 3FEWX 1RKNA 2BOSA 1O80A 3PMFA 1KLGD 1CZGA 2EYJA 1LO5D 1HTPA 5ELDA 2NWGA 4KI0A 4RKBA 5CBAE 4ZKCB 2EDGA 4KMUC 3C1EA 2ID0A 3ONAB 4IUQA 1LTTD 4TRDA 5BN5A 4CKCA 2K1BA 2ZXPA 1H9MA 5COYA 2RKSA 2FINB 2VB3X 3E5SA 4QUFA 5FLXE 3V96A 5G3LF 4M8AA 5F2DA 1JE4A 1A6XA 3V2TA 3D4WA 5IGCA 1H9RA 3O13A 1KTKA 1HRJA 3QJYA 2HCCA 1MBYA 4IALA 4CJ0B 2F0PA 4IUPA 1CI3M 1AW7A 4OO1I 3P1HA 2QEJC 4KN4C 4DK0A 4N9TA 2K03A 3HGBA 3BVGA 1ESFA 3VA5A 3KLSX 2A6HD 5C0XH 1EU4A 2HUGA 3EVQA 3NUCA 1TIID 3H94A 4UAIA 5FLXL 4RCNA 4OO1H 1EOTA 3M7GA 2WP8J 2L12A 1WD1A 3CKIB 2NYZD 3PO2B 4BWGB 3HOYB 1WTWA 4XIGS 2KJXA 1Q8IA 1TQOA 2F0KA 1EL0A 2FFKB 5C4JB 4HMJA 1K8MA 1D6EC 4QF4A 5JVH3 1TT2A 3FDTA 5EJWA 4K2KA 1LTSD 3X3NA 4OGQC 1PYWD 1ILQA 3MTSA 5KGUA 1LTBD 4WRDA 4GZYC 2LKVA 1SNPA 5C4XB 3GTJB 4OHJA 3I8ZA 2EYMA 2PNRC 1MGSA 3S16B 2XRSD 4OIJA 3GP7A 3MWYW 3BYYB 4IUUA 1DM0B 3MFGA 4PMBA 4FF2A 4KD3A 4C3HG 5FOBB 4K8JA 2IW3A 1A15A 1AN8A 5K36H 3BDOA 1SNCA 1LTRD 4FXGC 1CA6A 5IGBA 1E2WA 1ICWA 1B9MA 4XT3B 1PFBA 1WTXA 2E75C 3DUZA 5CV4A 1Q90A 3VYUA 3M4OB 1D5MC 3OIQA 2B2VC 2Q8RE 3LWUA 3GTPB 2GA4B 3TN2A 2EJFC 1D1IA 3K57A 3QWNA 1SNMA 3TP7A 1SEBD 1AP0A 3S9WA 2NTSA 1DONA 2KOLA 4HSPA 1HFNA 1RD9D 3A55A 3PUWA 3GQBA 4RFBA 4KY5A 2ZXOA 1BO0A 1RF2D 3NHHA 3VR5A 2N88A 2F0SA 4KJNA 2E2JB 2XSCA 1IKMA 3N6RA 3Q23A 3OHXC 2B39A 2XVSA 5CR3A 3BVZA 1W6JA 4EGVA 2Z4HA 2FMCA 1PTOD 2XNAC 1EY7A 1VMCA 4FO2A 2Q8IB 1F77A 5ISRA 1WCMB 4C1NI 1HXYD 1F2MA 2AQ3B 2B2TC 2OT2A 2OEOA 1J8IA 5LL6X 4A3JB 5M3MB 2O5JC 2IPKD 2ICEC 1PRTC 2EY2A 2BA1A 2MGSA 5DEHA 2V4DA 5EBDA 5CMDA 1BCPC 1EYAA 1SYGA 1SYBA 3KLSA 5EKKA 3FPUB 1PLFA 4L63B 1WTPA 1SJHD 2C5CA 3OOCA 2RDHA 1ZYRC 2AQ1B 4K6DA 4ZQ3A 2JEAI 2M2LA 1GUGA 3E0JA 1CK1A 1WVLA 1A3VA 2F0MA 3KBXA 1C4QA 2NUCA 1IL8A 1T5EA 2E2DC 2KEEA 5G3LD 1FYCA 3ND8A 2H4OA 3WOEA 3SE0A 1UNSA 3MXNA 1KLUD 5D3IB 4JBWA 4HCEA 1A2TA 3OPOA 1A3UA 2EPBA 4KHZA 1SNOA 1JR0D 2JE6I 2F0DA 3K5MA 1BQQT 3HOXB 1X3QA 2JEBI 1H9SA 3W3AA 4K2LA 3NBHA 3R2IA 1DCZA 4K5WA 5I6YA 1A2UA 2O4XA 2A69D 5E1FA 1GJXA 2X6GA 2IWHA 1F9RA 1WTOA 1RDPD 4HTHA 1WTRA 5CV6A 4Q0FA 1M4VA 1B2TA 2VB2X 4FVMA 2LY7A 4YIJA 4Q5VA 2XWBB 3DXJC 1OXUA 3NXWA 4U68A 2EYLA 1XXGA 2M00A 1GUSA 2F0EA 2WKDA 3T13A 3R93A 2RDGA 3SHLA 2BE5D 3NPPA 1I6VC 1SXTA 3T51B 3J7AF 5ELFA 1B53A 4BA2I 1ENFA 5EBCA 3A54A 1PTOB 2EZVA 1I50B 1TKWB 4MN3A 3TP8A 3J81E 5M5XB 1SAPA 1UEAB 3Q6SA 5ELBA 1TS4A 4A3GB 3NTKA 4KD4A 5D14A 5FO9B 4XQNA 1TS3A 1S4ZA 3QO2A 1BOSA 4QMGA 2A68D 1E0BA 3S2DB 1JB3A 2QF7A 1CT1D 1I4GA 3S17B 1J9OA 1VDZA 3H09A 3NWTA 1EWCA 2QDBA 1O7ZA 1B1ZA 1M8AA 1TY2A 4A3DB 3I70A 2Y0SB 4IUTA 1U4LA 4IFDH 1TWFB 4DGZA 3HKZB 5I9PA 1SNQA 5EKLA 4CKBA 2EYFA 2RSNA 5I4DA 1VMPA 2QCPX 1SMYD 1PMRA 1SYCA 2H1EA 5A2QE 1BUVT 4ZYSA 3K7AB 1SE4A 2PQEA 2MHVA 4L8JA 3CRKC 1XTCD 3BYTB 3GTQB 3J81L 2NVQB 5FKAC 3NTHA 5KRUA 4HR7B 2PO4A 1F2LA 2A6HC 3UI2A 3QOJA 5M5YB 2BCOA 4KY7A 3SR1A 2DN8A 4X3UA 4RGNA 5AFWA 1EZ6A 2I46A 2NB0A 2EXZA 2JP1A 1JICA 3DEOA 1QILA 3A56A 2D2CC 1S5BD 4XTCS 3NP8A 4CGYB 2D9UA 2B8FA 1XWEA 3NQTA 4DXFA 4DAPA 3HZXA 1DOMA 1V8QA 4FF3A 1CQVA 1F9PA 1B50A 3D8GA 5J39A 1BDOA 5A2QL 3DWPA 3SK6A 3K0YA 2PW7A 2JA8B 2QILA 4C2MB 2EJGC 2F0JA 2E2IB 2R93B 1FD7D 3FKIB 3D4RA 1XYIA 1JQYD 2WACA 4I7ZC 3L3OC 1BF4A 3D31A 3T16A 4H7BA 5J1ZA 4CHTB 1HTLD 2PZWA 2KHSA 2FHTA 1GUTA 1KDCA 2NZ1D 4RKLA 1PRTB 4B9WA 3Q24A 2CW0D 1VF7A 2DNCA 1BCPB 1LV9A 1WTVA 2EYOA 1TWAB 2KUMA 3SK5A 2X69A 1Y8PB 1H9SB 4EQPA 4LJZC 5IIFA 4J8QA 3IAYA 1STGA 1CZWA 5M9OA 3R2TA 1F9QA 1SE2A 2SNSA 3RMHA 3V05A 3L7ZC 1D5XC 5JEAJ 2JA7B 1ONLA 3RZOB 4EQNA 5KYLA 3HOWB 1EYCA 2K6AA 1FR3A 4ZUIA 3TP6A 4V0BA 1GUNA 2XRQD 4C1NK 5EQ0A 1HA5A 3ITPA 5JEAG 3ERQA 3LNNA 1GXDC 3AU7A 4G7ZC 3M3YB 1Z47A 4PNYA 1NAPA 1QB5D 3MEHA 3D4DA 3KF8A 1W6KA 2NN6G 4QCLA 4C3HB 4DA2A 3M4YA 1LTGD 1PXUA 1R4QB 1KDAA 1D5ZC 2K05A 3AB9A 3H91A 4MIUA 1PTOC 3H0GB 1KDBA 2RBMA 5FK9C 5TSSA 3TMEA 1STHA 5C3XA 2B63B 1SBBB 4DNTB 1D1KA 1EY5A 3CRLC 1U9RA 1JORA 1O7LA 3ZYYX 2R6GA 5BN4A 1PTOH 3TZDA 1TWCB 2Z1CA 1FGBD 2BDNA 4FXKC 1SE3A 1ILPA 1TS5A 1QOHA 4ZRZA 2M9VA 1U4RA 1EY8A 4PMWA 1YNJD 3A8IE 3TDQA 1RODA 4J6HA 3OWFA 1YNND 2DNEA 1A3TA 3I4LA 1OXVA 2HDLA 2OF1A 2VUMB 2VXWA 3I3CA 4P2CB 1BR9A 1EY6A 3J80E 5HURA 4DU9A 4QIWB 1DOLA 5C4ZA 4L6TB 5ELCA 1CQFA 1HA6A 1HUMA 4IN3A 2XN9C 1Y1WB 3JAME 3HP3A 4ZAIA 5LHY1 1QJOA 4RAUC 5KNDA 2ZT9C 3TZUA 3EFXD 2E2HB 4KHVA 1D2BA 1SFOB 1LT6D 5IGFA 4J1MA 4CJ1B 3U9OA 2SDFA 2CHBD 3VYRA 3BZDB 3HEJA 5A35A 4TKOB 1L0YB 5T1IA 3J7YW 1K83B 2KCNA 2F0IA 2HCIA 4ODGA 4X3SA 2A69C 1X3PA 3J80L 3SVMA 4K5XA 3JAML 4IFDG 2A74C 4ILWA 4NDXA 2G9DA 4CKEA 4E6IA 3MXPA 4ULLA 2MPMA 4QB4A 2BE5C 4NMZA 1OO9B 4A3MB 2CQAA 2F0QA 1HHVA 2L11A 1TVXA 5FO8B 3G6JB 1ML0D 1JOKA 4NKLA 4F8MA 4KKSA 4CJ2C 4XXEA 3DM1A 1ZKOA 5IT9E 1UUPA 5C4HA 1ESRA 5E4WC 4A3KB 1BXTA 2KA7A 3I4MB 3OSOA 1I3QB 2A68C 2WAQB 1PZJD 4NW2A 4CBVA 4A93B 2PCFB 5EPLA 2J7ZA 4PQXA 1S5ED 3H6MA 3URYA 1R4PB 3RLFA 3WOFA 3MZ5A 1NSNS 4RGOS 2F0NA 1ZXTA 3X3MA 1IKLA 1MSGA 5DM63 5BN3A 3P75A 3VYTA 4FYDA 3OMGA 1SMYC 1PZID 3HS0C 2HQEA 3VA7A 1G291 2F3WA 1I4RA 1S5FD 4FP5D 1RHPA 4WORA 3BG3A 3GTLB 5IT9L 3VR2A 2XIWA 2ZXRA 5C5LA 3IFDA 3K5OA 1QG7A 2R61A 3VYSA 1Q12A 3QIAA 1MI2A 3GV3A 3MXUA 5CV9A 2K33A 1VF5C 4K14A 4C3JG 3CU7A 2L1BA 1HCZA 2BA0A 5C0XJ 1I6HB 4FF1A 1CTMA 1EEFD 2F3VA 4C3IG 3OIPA 1STNA 4HCSA 2F0GA 3RZDB 4F7XA 5CV7A 4KKUA 1JWMD 1EZ8A 2C9OA 2B2UA 3D6WA 3GD7A 5C0XG 3I90A 2IX1A 3VR4A 5I2YA 2KEDA 2EY1A 2IJ0A 1B3AA 3K59A 4BBRB 4XYOA 4MHEA 2F0WA 4OO1G 3PUZA 5DNFA 4UDUC 5CORA 1EQVA 2IX0A 5IOCA 3S2HB 3OMCA 2NTTA 3GTMB 1TS2A 3MVVA 2EYHA 2RDFA 2CW0C 5HGTA 1ENCA 5E3FA 3S1MB 2L4NA 1KNEA 3K5LA 2KQ3A 2F0VA 2JSOA 4XT1B 1Q1BA 2RQXA 4HEDA 3CHBD 2F0LA 2EYPA 2E76C 1SDFA 4IUVA 3HOVB 3NE5B 2SEBD 1AFPA 2K01A 2TSSA 2J0TD 1Y69U 1O7YA 2JA5B 3D3RA 2XWJB 1I4PA 1G8ZD 4ZLTF 1EFID 3BVMA 2Z8LA 2NVYB 1NR2A 2F0HA 5KNCA 3OWEB 1GOZA 1STBA 2KVMA 3SXHA 1LABA 1U4MA 2MP1A 3G7LA 1PTOF 4Z9CB 4BBSB 5D65A 5CC4A 5K36G 2WKCA 3KBGA 3K58A 1CA5A 2FMMA 1G91A 3I91A 5CGKA 1QNKA 1IYUA 2D5DA 4U673 1NUCA 2VNUD 3MAQA 3NBIA 1RCVD 2IT1A 3C2PA 1NR4A 2L0CA 3I4NB 4IZ8A 2EE1A 3N52A 3RD4A 3MFYA 4XQQA 4ZK9B 2MUYA 2L5TA 3U9SA 1GUWA 4KJOA 1VCIA 3NK9A 1S5CD 1R9TB 1F2YA 3FVQA 5LL6S 3PO3B 4BY1B 4LK1C 4DAVA 2DY8A 4RWSC 4TSSA 5CV8A 3C46A 3PIP3 3P7JA 3W2DA 2L55A 4JK1C 1YNJC 2LS01 4DNRB 1PDQA 4AYBB 4QUCA 5C0XI 3M7NA 5DM73 2EOTA 1YNNC 2SOBA 3MHBA 3C1FA 1TR5A 5IGGA 1H9KA 2B2WC 4WJWA 3DWQA 2PYKA 3KUPA 3GV6A 3EA6A 2NBFA 4LMQD 4HAEA 1EIGA 4KKTA 4XDXA 1JC7A 2B2YC 2JYOA 1H9JA 2EJMA 1S5DD 4LAAA 3S1NB 2A6ED 1Q3LA 3DWAA 3A7AB 2IX3A 1I4QA 2E74C 1IW7D 4DF7A 3IKJA 1EYDA 3R8BA 1ZEQX 2OXPA 4DXGA 4RHSA 3PUXA 2JXMB 5I6WA 2IL8A 1GHJA 2PZTA 2ICIA 2EY6A 3MC0B 2F1MA 1JWSD 3EQLC 5JPNC 3HRZC 1CHQD 1DD2A 3GTKB 3DEPA 5KIXA 2RA4A 4F87A 2F0TA 2K32A 2B2WA 3BS1A 4KY6A 3A8KE 3KK7A 1V43A 4KTAA 1PFNA 3LWEA 1JWUD 1QWYA 4XQJA 5J22A 1PRTF 2B2YA 2O2LD 1G2SA 1PZKD 1SJED 5C3EB 2AUJD 1UAPA 1BCPF 5JVG3 1SYEA 1WTQA 4A3FB 1EY9A 1U4PA 2BDOA 4FNFA 3I72A 5JJZA 5KEEA 5CYUA 2AWNA 4RHRA 1DZ1A 2DY7A 2PZUA 2LMCB 2F0UA 2N55A 3NTIA 5K5PA 3GTGB 3EJIA 1JOOA 2AUKA 4BS9A 1Z6HA 2AWOA 1HQRD 2ENBA 3T4AC 4F88A 1AZPA 2Q8TA 3J7AV 1LT3D 3K6OA 2RVLA 3IL8A 3BDCA 4OL7A 1TY0A 4H0LC 5I2XA 3KLRA 3HG9A 1PFMA 1EIHA 3Q0AA 3SK4A 3HOZB 1Y8NB 2R92B 2QKIC 3EROA 1JCKB 2EVBA 1LTAD 3TSSA 1XX8A 2YU9B 1DJRD 4K6LA 5JPMC 4O42A 2X6LA 1X32A 5C3WA 5EPJA 1OXXK 2R3ZA 3TBIB 2WB1B 1LT5D 1F2ZA 1JOQA 2K5WA 1V1OA 4NP5A 4EVOA 4A3BB 1ENAA 1KABA 5M3FB 1G2TA 4ZUJA 4IFDJ 1C8CA 3A8JE 1KAAA 1MSHA 1SYDA 5EGTA 3HOUB 1E2ZA 2RSOA 4X3KA 3AMUA 3MXGA 4IQZA 4ABNA 3S1RB 4ZKBB 5CBEE 2WINB 2B2VA 4M1UB 1GHKA 4RGTA 2PPBC 1CM9A 4Y7NB 2NN6I 3PV0A 5JOBA 3D6CA 3PUVA 4G57A 1QNUA 1GUOA 3CQZB 4K8IA 1NCVA 3K5NA 1LLRD 4H13C 2G9HD 1T5XD 5JEAH 1L0XB 4KN7C 1V1PA 4PV1C 5ELEA 4X3TA 1G6ZA 3F2UA 2JA6B 3SEBA 3MA2B 5EPKA 1EEID 4RA8A 5C5MA 1MD2D 1EU3A 3IFTA 2NN6H 2SNMA 2YYZA 3C3LA 2F03A 1DOKA 4KV6A 2A5HA 2LFNA 4FF4A 2J4XA 2B2TA 4BY7B 4DN4M 3QB3A 4C3JB 2NVXB 1DXMA 1HUNA 1O78A 5KYIA 3NSWA 1LTID 2PMZB 1LACA 3SK8A 1RJTA 1TWGB 4C3IB 4V190 1EWHA 4TQUS 4HMIA 5JAVA 2B2UC 2L9HA 4B08A 1B4OA 4HSVA 3S15B 4G7HC 5E4XA 5IGEA 2CVRA 2K28A 4H44C 3FRPB 1HPCA 1EQTA 2B8GA 4R9WA 1Z7TA 2K5QA 1I4HA 1CHPD 3A7LA 4IURA 2K5DA 5NUCA 2I07B 3P20A 4G4KA 2D62A 4ME5A 3NWSA 5M5WB 2KECA 5T1GA 1ET6A 4RGMA 1DYQA 1STYA 1LT4D 2WV6D 2F4IA 4OIKA 1RTNA 2K7VA 5KNBA 1SYFA 2PW5A 3S14B 2EY5A 4IUNA 2A73B 1IHZA 5D3DA 1Y1VB 4DFAA 1FNVA 1STAA 1I4XA 4C56C 3SDZA 1PRTD 2NVTB 2K04A 3FPPA 3M85A 5IODA 2R7ZB 1BCPD 3GTOB 1II3A 2O5IC 1SNDA 4R8IA 1TU2B 4XYQA 3LX0A 1Y8OB 1QCBD 1E2VA 4IFDI 2F0FA 3GO5A 1C48A 1STEA 4R8NA 1FNWA 5DAUA 2AQ2B 1ZYRD 1OXSC 2HDMA 3VR6A 2KCCA 4DK1A 4A3IB 4EQOA 1B44D 2MJ8A 1ET9A 3DMUA 4BA1I 3DHQA 1K8OA 1CFMA 5EKIA 3QG1A 1FNUA 4N9PA 5CV5A 1QE6A 3BDLA 4HN7A 4S3SA 1TWHB 3R3OA 4RCOA 1EY4A 4I65A 4PMCA 3L9AX 3OW7A 3I73A 2TMPA 3Q22A 2Z4IA 4KK7A 3S1QB 4G7OC 2FJ2A 1SSOA 1RTOA 3WDNA 3ND9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5NUC A;  5CC4 A;  2F0G A;  4IUN A;  1A2T A;  4F7X A;  5CR3 A;  5CV7 A;  3QOL A;  1A3U A;  4ID6 A;  4LAA A;  4ME5 A;  5F2D A;  5C6A A;  2QDB A;  5IGD A;  1EZ8 A;  3V2T A;  3D4W A;  4KHV A;  2F0J A;  5IGC A;  5KGU A;  1EY7 A;  1SNO A;  4WRD A;  3BDC A;  4K5V A;  4OL7 A;  4DF7 A;  1STY A;  2LKV A;  5IGF A;  1EYD A;  2F0D A;  4J1M A;  1AEX A;  1KDA A;  1SNP A;  4IAL A;  4K8I A;  2WAC A;  3U9O A;  1SYF A;  5CGK A;  2OXP A;  5ISR A;  2EY1 A;  3SK4 A;  3H6M A;  4DGZ A;  2F0P A;  4MIU A;  2PW5 A;  5I9P A;  1SNQ A;  4K2L A;  1EY0 A;  5EKL A;  1KDB A;  2EYM A;  5I6W A;  3T16 A;  2EY5 A;  4H7B A;  3P1H A;  1F2M A;  2RBM A;  1NUC A;  2EYF A;  1IHZ A;  3HEJ A;  2PZW A;  2KHS A;  3ERO A;  1NSN S;  1STH A;  2F0N A;  3MZ5 A;  4K5W A;  3TME A;  2PZT A;  1KDC A;  4DFA A;  5C3X A;  1A2U A;  2O4X A;  2EY6 A;  1STA A;  4B9X A;  4N9T A;  4RKL A;  2OEO A;  1EY5 A;  5E1F A;  1U9R A;  4PMB A;  1SYC A;  2F0W A;  4KD3 A;  3TP5 A;  4B9W A;  1JOR A;  5C5M A;  4IZ8 A;  4K8J A;  2F0I A;  1EQV A;  4ODG A;  2F0O A;  5IOC A;  3P75 A;  2PQE A;  5J1Z A;  3OMC A;  3OMG A;  3VA5 A;  2SNM A;  5KIX A;  2EYO A;  4HTH A;  1SNC A;  2F0T A;  3SK5 A;  5IOD A;  2HQE A;  3MVV A;  3RUZ A;  5CV6 A;  1II3 A;  4KY6 A;  1SND A;  2EYH A;  2RDF A;  3LX0 A;  4KV6 A;  5HGT A;  1ENC A;  5IGB A;  4KJO A;  2F3W A;  2F0F A;  2EY2 A;  3NK9 A;  4YIJ A;  5E3F A;  5C3W A;  5DEH A;  4KTA A;  4EQP A;  5KRU A;  2KQ3 A;  4K5X A;  4R8N A;  1F2Y A;  5I9O A;  5CV4 A;  3EVQ A;  3NXW A;  5IIF A;  1EYA A;  1SYG A;  3NUC A;  5J22 A;  1EY8 A;  1STG A;  4WOR A;  5DAU A;  1SYB A;  5EKK A;  1F2Z A;  2F0V A;  3QOJ A;  2EYL A;  5M9O A;  1RKN A;  1JOQ A;  5CV8 A;  4NP5 A;  2M00 A;  3QB3 A;  4EVO A;  4KY7 A;  3PMF A;  3SR1 A;  2SNS A;  2F0E A;  1SYE A;  2F0L A;  4J6H A;  3T13 A;  2EYP A;  4NDX A;  1ENA A;  5C5L A;  3SHL A;  1EZ6 A;  5KYI A;  2EYJ A;  4EQO A;  4E6I A;  1KAB A;  2EXZ A;  3OWF A;  4ZUJ A;  4RKB A;  1EY9 A;  3DMU A;  1A3T A;  1SNM A;  3MXP A;  4K6D A;  3TP7 A;  3DHQ A;  3NP8 A;  3S9W A;  2OF1 A;  4ZQ3 A;  3SK8 A;  1KAA A;  4N9P A;  4QB4 A;  1SYD A;  5KEE A;  5CV5 A;  4EQN A;  4NMZ A;  3C1E A;  1A3V A;  5EGT A;  4HMI A;  2F0M A;  1EY6 A;  1EYC A;  5KYL A;  2F0Q A;  2NUC A;  5JAV A;  2PZU A;  3BDL A;  3NQT A;  2F0U A;  4ZUI A;  3TP6 A;  2SOB A;  5CV9 A;  4DU9 A;  3TP8 A;  5HUR A;  3MHB A;  4S3S A;  5K5P A;  5C4Z A;  3HZX A;  3EJI A;  3C1F A;  1JOO A;  3R3O A;  4K14 A;  1TR5 A;  4KY5 A;  4TRD A;  5I6Y A;  5IGG A;  1EY4 A;  3ITP A;  5IGE A;  4I65 A;  3ERQ A;  1JOK A;  1TQO A;  2PYK A;  4G57 A;  2F0H A;  4NKL A;  4KD4 A;  4PMC A;  4F8M A;  2F0K A;  3NHH A;  1STB A;  4QMG A;  3SXH A;  2RKS A;  3D8G A;  4PNY A;  2F0S A;  5C4H A;  4HMJ A;  5J39 A;  3E5S A;  4KJN A;  5JOB A;  4QF4 A;  2F3V A;  1TT2 A;  3D6C A;  2ENB A;  3MEH A;  3D4D A;  3SK6 A;  3OSO A;  1STN A;  2PW7 A;  4K2K A; 
#chains in the Genus database with same CATH topology
 1X65 A;  3JC6 6;  2CFM A;  1HQM C;  5C6A A;  3QOL A;  4DV6 Q;  1PH8 A;  3PGZ A;  1BBX C;  3T53 B;  4K5V A;  4O1N A;  1N33 Q;  1IYV A;  4A3G G;  4WFN 3;  1AEX A;  2A6E C;  4RH6 A;  3J81 c;  3RN5 A;  2DJF C;  3VR3 A;  1B9N A;  3NQI A;  3CCL A;  1IW7 C;  1KNA A;  3H3V C;  1EY0 A;  1F9S A;  1Q1E A;  4A3B H;  4ID6 A;  3E6Z X;  5IGD A;  2WII B;  5M3F H;  1AZQ A;  1BNZ A;  4B9X A;  3QR8 A;  4A3E B;  2IHE A;  2WAQ E;  3TP5 A;  3HOU H;  2F0O A;  1OXT A;  3PIO 3;  5FO7 B;  4A3D G;  3H3V H;  3S1R H;  4FXD A;  2Y0S G;  4AQY L;  1PH1 A;  4DAY A;  2ZTC A;  3RUZ A;  4AIM A;  4IO9 A;  1YNX A;  1WD0 A;  3PUY A;  3HKZ G;  5C44 B;  3FMC A;  5IYB H;  4GN5 A;  4DNI A;  1V1P B;  4X62 Q;  1VQH A;  4Y7N H;  5I9O A;  3T56 B;  1GO3 E;  1HR0 W;  1HFG A;  3FEW X;  2Z0S A;  1RKN A;  2BOS A;  1O80 A;  2N8N A;  4FDB A;  3RLN A;  3PMF A;  1KLG D;  1CZG A;  2EYJ A;  1LO5 D;  1HTP A;  5E7N A;  5ELD A;  2NWG A;  4KI0 A;  3CQZ H;  4RKB A;  5CBA E;  4ZKC B;  1SR3 A;  3NEM A;  5JJL A;  2EDG A;  5IP9 H;  1EIF A;  4KMU C;  5DLQ E;  4NPS A;  3C1E A;  1GVP A;  2ID0 A;  3ONA B;  2QA4 A;  4IUQ A;  4JI1 L;  1LTT D;  4TRD A;  5BN5 A;  4CKC A;  3K8A A;  2K1B A;  2ZXP A;  4JPB W;  3U58 A;  1H9M A;  5COY A;  2JA6 H;  1IL2 A;  2RKS A;  2FIN B;  2VB3 X;  3ULP A;  3E5S A;  2UXB L;  4DV1 Q;  3T1Y Q;  3UDF A;  4QUF A;  5FLX E;  1VS0 A;  3V96 A;  4MNO A;  5G3L F;  4M8A A;  5F2D A;  1JE4 A;  1A6X A;  1A63 A;  3V2T A;  3D4W A;  4JI0 L;  5IGC A;  5IWA Q;  1H9R A;  3O13 A;  1JJG A;  1K8A C;  2K52 A;  1KTK A;  1HRJ A;  3QJY A;  2HCC A;  1MBY A;  4BY7 H;  4IAL A;  4LF8 Q;  3TEH B;  4CJ0 B;  2F0P A;  4IUP A;  1CI3 M;  4N8X 1;  1AW7 A;  4C3J H;  4OO1 I;  1YHA A;  2NVX H;  3P1H A;  2QW7 A;  5AJ3 Q;  2KCT A;  2QEJ C;  4KN4 C;  4DK0 A;  4N9T A;  1JB7 A;  2JA8 G;  2K03 A;  1J6Q A;  3HGB A;  3CC2 A;  4HID A;  3BVG A;  1TWG H;  4C3I H;  2UUB L;  2R93 G;  1ESF A;  3VA5 A;  1FL0 A;  2QEX A;  5LMN Q;  3S15 H;  4RG1 A;  3KLS X;  3DM3 A;  4JYA L;  2A6H D;  5C0X H;  3I56 A;  2KCM A;  1EU4 A;  2HUG A;  1XMQ Q;  4I7A A;  1CKN A;  3EVQ A;  3ER0 A;  3NUC A;  1TII D;  3AYH B;  3H94 A;  1CKM A;  4LWC A;  1K3B C;  1PFS A;  4UAI A;  5FLX L;  4RCN A;  1VQG A;  4OO1 H;  1EOT A;  2HQL A;  3J7A 5;  5M5W H;  3I2Z A;  3M7G A;  2PI2 A;  3LGJ A;  4P75 A;  2RF4 A;  4JI4 L;  2WP8 J;  4NB3 A;  2ZJR A;  2L12 A;  2F52 A;  2Q2I A;  1IZ6 A;  1WD1 A;  3CKI B;  2NYZ D;  3S14 H;  3PO2 B;  4BWG B;  3VDY A;  3CCR A;  3HOY B;  4PZ7 A;  1WTW A;  4XIG S;  2KJX A;  1HNX L;  4RMF A;  1Q8I A;  1Y1V H;  1TQO A;  3CMA A;  2F0K A;  4LF4 L;  4LFB L;  1EL0 A;  2FFK B;  5C4J B;  4B3S Q;  1D7Q A;  4HMJ A;  2NVT H;  1K8M A;  1D6E C;  4QF4 A;  5JVH 3;  2JA7 G;  4AQY Q;  1TT2 A;  3FDT A;  3CD6 A;  2EIF A;  5EJW A;  2R7Z H;  4K2K A;  5IYC G;  1LTS D;  3HOW G;  3GTO H;  3X3N A;  4OGQ C;  1PYW D;  1ILQ A;  3MTS A;  5KGU A;  1LTB D;  1KIX A;  4WRD A;  4GZY C;  2LKV A;  5IY0 A;  1SNP A;  5C4X B;  1VQA A;  3GTJ B;  4OHJ A;  1L1O C;  2I5H A;  3I8Z A;  2K50 A;  1EQQ A;  2EYM A;  4A3I H;  2PNR C;  1MGS A;  3S16 B;  2XRS D;  1I5F A;  4OIJ A;  3GP7 A;  3MWY W;  1E7Z A;  3BYY B;  4IUU A;  1DM0 B;  3MFG A;  4PMB A;  4JW0 A;  4FF2 A;  4KD3 A;  4C3H G;  4LUZ A;  5FOB B;  1VQ8 A;  4K8J A;  2IW3 A;  4OON A;  1LYL A;  4A4I A;  2UU9 Q;  1A15 A;  1AN8 A;  4JI1 Q;  2CKZ B;  5K36 H;  3BDO A;  1B70 B;  1SNC A;  2UUC L;  1LTR D;  4FXG C;  1CA6 A;  5IGB A;  1C9O A;  3H0G G;  1E2W A;  1ICW A;  3KJP A;  4LNQ A;  1B9M A;  4XT3 B;  1PFB A;  1WTX A;  2E75 C;  3DUZ A;  5CV4 A;  3S1Q H;  1Q90 A;  3VYU A;  3M4O B;  1D5M C;  3OIQ A;  2B2V C;  1ICF B;  2Q8R E;  3LWU A;  3GTP B;  2GA4 B;  4LF7 L;  3TN2 A;  2EJF C;  1D1I A;  1MJC A;  2ZTD A;  4A3F G;  3K57 A;  4PZ6 A;  3QWN A;  1SNM A;  3TP7 A;  4HJA A;  1SEB D;  1NNX A;  4DAY B;  1AP0 A;  3S9W A;  4YY3 L;  2NTS A;  1ASY A;  1XJV A;  1DON A;  2OWO A;  1L1O A;  5ELO A;  5GQO A;  2KOL A;  4DR1 Q;  4JC0 A;  1VQK A;  4HSP A;  1HFN A;  1RD9 D;  3A55 A;  1QZG A;  3PUW A;  1XMO Q;  3GQB A;  3PF5 A;  4RFB A;  4KY5 A;  4JOI C;  2ZXO A;  4A75 A;  1BO0 A;  1RF2 D;  4A3E H;  3NHH A;  3KYH C;  3VR5 A;  5JJI A;  2N88 A;  2F0S A;  4KJN A;  2E2J B;  2VUM G;  2XSC A;  1IKM A;  1VQD A;  3N6R A;  4AYB E;  3Q23 A;  4JYA Q;  1XNR L;  3OHX C;  2B39 A;  2XVS A;  5CR3 A;  5C44 H;  3BVZ A;  1W6J A;  4EGV A;  2Z4H A;  2FMC A;  1PTO D;  3I4O A;  2XNA C;  1EY7 A;  2Q2T A;  1VMC A;  4FO2 A;  2Q8I B;  1F77 A;  3J80 c;  1Y1W G;  5ISR A;  5GAH C;  1XPR A;  1WCM B;  4C1N I;  2R92 G;  1HXY D;  3AEV A;  4QQB X;  2ZM6 L;  1F2M A;  2AQ3 B;  3CF5 A;  2B2T C;  1NY4 A;  4KLK A;  3JAM c;  2OT2 A;  2I5M X;  2F3I A;  2OEO A;  1A0I A;  4JI4 Q;  1J8I A;  5LL6 X;  4A3J B;  3J7Z C;  3UDG A;  5M3M B;  1MHW C;  2O5J C;  4MTN A;  2IPK D;  4JOI A;  3UDI A;  2ICE C;  4X66 Q;  4B3R Q;  4DK3 C;  1PRT C;  2EY2 A;  2BA1 A;  2MGS A;  5DEH A;  2V4D A;  5EBD A;  4LFB Q;  5CMD A;  1BCP C;  1EYA A;  1SYG A;  1J5E Q;  3EN2 A;  1SYB A;  3KLS A;  5EKK A;  4DV7 Q;  3FPU B;  1PLF A;  4L63 B;  1WTP A;  4DR4 Q;  3KOJ A;  4A3B G;  1SJH D;  4LFC Q;  2C5C A;  3OOC A;  3G48 A;  2RDH A;  1ZYR C;  2AQ1 B;  4K6D A;  2LXJ A;  4ZQ3 A;  2Z9H A;  1IBK Q;  2JEA I;  4CDD C;  2M2L A;  1GUG A;  3E0J A;  1CK1 A;  4DV6 L;  1WVL A;  3HOU G;  1A3V A;  3CPW A;  2F0M A;  3KBX A;  1C4Q A;  2NUC A;  1PYS B;  1IL8 A;  1T5E A;  1CKN B;  4YWL A;  1HR0 Q;  1N33 L;  1NBW A;  2E2D C;  1YJ9 A;  2KEE A;  5G3L D;  1FYC A;  3ND8 A;  2H4O A;  3WOE A;  2DGY A;  3SE0 A;  1UNS A;  3MXN A;  1KLU D;  2CH4 A;  5D3I B;  3KF8 B;  4JBW A;  4HCE A;  1A2T A;  3OPO A;  1AH9 A;  1A3U A;  2RHS B;  2EPB A;  1BKB A;  4KHZ A;  1SNO A;  5IP9 G;  1C7Y A;  1JR0 D;  2JE6 I;  2F0D A;  3K5M A;  1QUQ A;  1KQS A;  4LF7 Q;  1VQE A;  1BQQ T;  3HOX B;  4X62 L;  1X3Q A;  2JEB I;  2OTL A;  1H9S A;  3W3A A;  4K2L A;  5GAD C;  4O0A A;  5H1S E;  3NBH A;  2EXD A;  3R2I A;  1DCZ A;  4K5W A;  5I6Y A;  3I4M G;  1A2U A;  2O4X A;  3PIO A;  4A3C H;  1X6O A;  2A69 D;  2WAQ G;  5E1F A;  5IT9 c;  5FJ8 G;  4HIK A;  2JA6 G;  1GJX A;  2X6G A;  4CDE C;  1M90 C;  4A93 G;  2IWH A;  1F9R A;  1WTO A;  1RDP D;  4HTH A;  3A5U A;  1WTR A;  3PO2 H;  3NEL A;  5CV6 A;  4Q0F A;  1M4V A;  1B2T A;  5C3E H;  2VB2 X;  4FVM A;  2LY7 A;  4YIJ A;  1UE6 A;  4Q5V A;  2XWB B;  3DXJ C;  1OXU A;  3NXW A;  1FVI A;  4BY7 G;  5C4J H;  4U68 A;  1FGU A;  2EYL A;  2JK8 A;  3ICE A;  1XXG A;  2M00 A;  1VQN A;  1GUS A;  2F0E A;  2WKD A;  2ZTE A;  3T13 A;  3R93 A;  2RDG A;  1NTG A;  3SHL A;  3TS0 A;  2BE5 D;  3NPP A;  1I6V C;  1SXT A;  2I5L X;  3L0O A;  1EYG A;  3T1Y L;  1PVO A;  3T51 B;  3J7A F;  1VQ9 A;  5ELF A;  1B53 A;  4BA2 I;  1ENF A;  4R4C A;  2VZA A;  5EBC A;  3A54 A;  3TRE A;  5C4X H;  3GTJ H;  1PTO B;  2EZV A;  1I50 B;  2LSS A;  5IWA L;  1TKW B;  4MN3 A;  3TP8 A;  3J81 E;  2WB1 E;  1RL2 A;  2VQE Q;  5M5X B;  1KC8 C;  1SAP A;  1UEA B;  3Q6S A;  1JT8 A;  3S16 H;  5ELB A;  4DR5 Q;  1TS4 A;  4LF8 L;  5J3B A;  4A3G B;  1TXY A;  3NTK A;  4KD4 A;  5D14 A;  5FO9 B;  4XQN A;  1TS3 A;  2CQO A;  1S4Z A;  2OQ0 A;  1BOS A;  3QO2 A;  4QMG A;  2A68 D;  1E0B A;  1VQI A;  3S2D B;  4A3L H;  1JB3 A;  2QF7 A;  4KHP Q;  1LTL A;  2MO1 A;  1CT1 D;  4QJF A;  1I4G A;  4GKK L;  3S17 B;  1J9O A;  1VDZ A;  3H09 A;  3NWT A;  1EWC A;  2QDB A;  5FLM H;  1O7Z A;  1VQ7 A;  1B1Z A;  1XPU A;  1M8A A;  1TY2 A;  4A3D B;  3M4O H;  3I70 A;  4UP8 A;  2Y0S B;  4IUT A;  1YI2 A;  1U4L A;  5GAE C;  4IFD H;  3NEN A;  1TWF B;  4DGZ A;  2NZH A;  3GTP H;  1XMQ L;  3HKZ B;  5I9P A;  4GLX A;  1SNQ A;  2YTX A;  5EKL A;  4CKB A;  2EYF A;  2RSN A;  5I4D A;  1Q7Y C;  1VMP A;  4LF9 Q;  2QCP X;  1SMY D;  1PMR A;  1SYC A;  4BXX H;  2H1E A;  5A2Q E;  1BUV T;  4ZYS A;  3K7A B;  1VQJ A;  5EAY A;  1SE4 A;  2PQE A;  2MHV A;  4L8J A;  3CRK C;  1XTC D;  3BYT B;  3GTQ B;  5IP7 G;  3J81 L;  2NVQ B;  4DV4 Q;  5FKA C;  4EX5 A;  4L5Q A;  3NTH A;  5KRU A;  4HR7 B;  1HZB A;  4LUO A;  2PO4 A;  4BBR G;  1F2L A;  2A6H C;  3UI2 A;  3QOJ A;  3SGI A;  2E2J H;  5M5Y B;  2BCO A;  4KY7 A;  1L0W A;  3SR1 A;  2DN8 A;  4X3U A;  4RGN A;  5AFW A;  1N9W A;  1EZ6 A;  4B3S L;  2I46 A;  2NB0 A;  2EXZ A;  2JP1 A;  2DJG C;  1JIC A;  3DEO A;  1QIL A;  3A56 A;  2BH8 A;  3L2P A;  2D2C C;  5BR8 Q;  1S5B D;  4XTC S;  3NP8 A;  4CGY B;  1EOV A;  2D9U A;  1AE2 A;  2B8F A;  1XWE A;  1W2B A;  1WCM H;  3NQT A;  4DXF A;  4DAP A;  4NXN Q;  3HZX A;  1DOM A;  1V8Q A;  3HFZ B;  2CCZ A;  3E9H A;  4FF3 A;  1CQV A;  3HOV G;  5IYD H;  1F9P A;  3AQQ A;  1PH7 A;  4A3J H;  1B50 A;  3D8G A;  1BBU A;  4B3M Q;  4OEL B;  5J39 A;  1BDO A;  5M3M H;  2PMZ E;  5A2Q L;  3G4S A;  3DWP A;  3SK6 A;  3K0Y A;  2JA5 G;  2PW7 A;  2YV5 A;  2JA8 B;  2QIL A;  2HD3 A;  4C2M B;  2UU9 L;  2K75 A;  2EJG C;  2F0J A;  2E2I B;  2R93 B;  1NMG A;  1FD7 D;  3FKI B;  1WJJ A;  4GN4 B;  3D4R A;  1XYI A;  1JQY D;  3E0E A;  4X64 Q;  3G71 A;  2WAC A;  4I7Z C;  3L3O C;  1BF4 A;  3FHW A;  3D31 A;  3T16 A;  4H7B A;  5J1Z A;  4CHT B;  1HTL D;  2UUA Q;  3MXN B;  2PZW A;  2KHS A;  2FHT A;  1GUT A;  1KDC A;  4JVZ A;  2BH2 A;  4BBS G;  2NZ1 D;  3F2C A;  4RKL A;  1HNZ Q;  1PRT B;  2VQF Q;  4B9W A;  3Q24 A;  1PH4 A;  2CW0 D;  1VF7 A;  2DNC A;  1BCP B;  1LV9 A;  1PA6 A;  1WTV A;  2EYO A;  1TWA B;  2KUM A;  3SK5 A;  1EQR A;  1QUQ B;  4DR1 L;  2X69 A;  1Y8P B;  1H9S B;  4EQP A;  2JQO A;  3NBH B;  3M4P A;  1XMO L;  4LJZ C;  5IIF A;  4J8Q A;  1A8V A;  3IAY A;  1STG A;  1CZW A;  5LMU Q;  5M9O A;  3I4N G;  4DR6 Q;  3R2T A;  1I94 Q;  4GKK Q;  1F9Q A;  1SE2 A;  2SNS A;  4P71 A;  3RMH A;  2KEN A;  2R7D A;  3V05 A;  2CWA A;  3L7Z C;  2MNA A;  1N8R C;  1T9H A;  1D5X C;  5JEA J;  4UP9 A;  1E3P A;  2JA7 B;  1IBL L;  2HIV A;  2B29 A;  1ONL A;  3RZO B;  4EQN A;  1S40 A;  5KYL A;  3HOW B;  1EYC A;  2K6A A;  1FR3 A;  4ZUI A;  4DV0 L;  1X3G A;  4BY1 G;  4V0B A;  3TP6 A;  3PO3 G;  1GUN A;  2XRQ D;  4C1N K;  1K73 C;  3F2D A;  5EQ0 A;  3CXC A;  1HA5 A;  3ITP A;  3ULJ A;  4GNX A;  4R1J A;  5JEA G;  3ERQ A;  3LNN A;  1GXD C;  3AU7 A;  3W5O A;  4G7Z C;  4YCV A;  2QDL A;  3M3Y B;  1Z47 A;  4PNY A;  4ZCK A;  4LF6 L;  1NAP A;  1GD7 A;  4AYB G;  1QB5 D;  3MEH A;  3D4D A;  1EFW A;  1MIU A;  3KF8 A;  4O2D A;  1W6K A;  2NN6 G;  4MTK A;  3K7U C;  4QCL A;  4C3H B;  4DA2 A;  3M4Y A;  2AKW B;  1LTG D;  4X66 L;  3UE0 A;  4B3R L;  1PXU A;  1R4Q B;  4JI3 Q;  4DR2 Q;  1KDA A;  2ASB A;  1D5Z C;  2K05 A;  3AB9 A;  3H91 A;  4MIU A;  1PTO C;  3H0G B;  1KDB A;  4GLA C;  1H95 A;  2CH4 W;  2RBM A;  5FK9 C;  1J5E L;  5TSS A;  3TME A;  4DV7 L;  1STH A;  4JCV E;  2N78 A;  5C3X A;  1XNQ Q;  1PH6 A;  1IBM Q;  2B63 B;  4DR4 L;  1SBB B;  4DNT B;  1D1K A;  1EY5 A;  3CRL C;  1U9R A;  1DGS A;  1K8G A;  4LFC L;  1JOR A;  1PH9 A;  2ZJQ A;  1O7L A;  3ZYY X;  2R6G A;  5BN4 A;  1BVS A;  1CKO A;  3H15 A;  1Z9F A;  1PTO H;  1I50 H;  3TZD A;  1TWC B;  5M5X H;  1IBK L;  2Z1C A;  4UY8 C;  1FGB D;  2BDN A;  3OYY A;  4FXK C;  1SE3 A;  1ILP A;  1TS5 A;  1QOH A;  4DUY L;  1HR0 L;  4A3G H;  4ZRZ A;  2M9V A;  1U4R A;  3S2D H;  1EY8 A;  4PMW A;  1YNJ D;  3M4Q A;  1SE8 A;  3K81 C;  3A8I E;  3TDQ A;  1ROD A;  4J6H A;  3S17 H;  4L5R C;  3AFP A;  4JI2 L;  3OWF A;  2Q2H A;  1YNN D;  2DNE A;  3U4Z A;  1A3T A;  1TWH H;  3I4L A;  1OXV A;  2HDL A;  2OF1 A;  2VUM B;  2VXW A;  3I3C A;  4A3D H;  1KRT A;  3I7F A;  3I55 A;  3HKS A;  1BR9 A;  1EY6 A;  4P2C B;  1G6P A;  3J80 E;  1TWF H;  4R4Q A;  5HUR A;  4DU9 A;  4QIW B;  4YCU A;  3J81 i;  3PQI A;  1DOL A;  5C4Z A;  4L6T B;  4JI6 Q;  3W1G A;  5C3E G;  5ELC A;  1CQF A;  1HA6 A;  1HUM A;  4IN3 A;  2XN9 C;  1Y1W B;  3JAM E;  2YTV A;  1N34 L;  3HP3 A;  3AFQ A;  3K7A H;  2PNH A;  2A19 A;  4ZAI A;  4POG A;  5LHY 1;  3OTO L;  1QJO A;  4RAU C;  5KND A;  3GTQ H;  2ZT9 C;  3TZU A;  2NVQ H;  2D0O A;  3EFX D;  2E2H B;  4KHV A;  1D2B A;  1SFO B;  1LT6 D;  1K3R A;  1JJC B;  2MQH A;  5IGF A;  4B3T Q;  4J1M A;  4CJ1 B;  3U9O A;  2SDF A;  5M5Y H;  1B3Q A;  3ZJY C;  2CHB D;  3VYR A;  1JJ2 A;  3BZD B;  3HEJ A;  2CWP A;  5A35 A;  4TKO B;  1L0Y B;  1IBL Q;  5T1I A;  3RN2 A;  3J7Y W;  1K83 B;  2KCN A;  4A3L G;  2F0I A;  2HCI A;  1OTC A;  4DV0 Q;  4ODG A;  3F1Z A;  4QL5 A;  4X3S A;  3KJO A;  2A69 C;  3CW2 C;  3J81 j;  1X3P A;  3PF4 A;  3J80 L;  3IRB A;  3HOZ G;  1JE5 A;  3EIV A;  3SVM A;  4K5X A;  2VQE L;  2GVB A;  4LF6 Q;  2K5N A;  3JAM L;  4IJH A;  4DR5 L;  4IFD G;  4X65 Q;  1W3S A;  2A74 C;  4ILW A;  5GAG C;  4NDX A;  2G9D A;  4CKE A;  2JA8 H;  4E6I A;  4KHP L;  4C2M H;  3MXP A;  3E9I A;  4ULL A;  2E2I H;  4BXX G;  4JI7 Q;  2R93 H;  3FKI H;  2MPM A;  2ATW A;  4QB4 A;  2UXC Q;  2PQA B;  3CCU A;  2BE5 C;  2VL6 A;  4NMZ A;  1OO9 B;  1N32 Q;  4A3M B;  2CQA A;  1BBW A;  2F0Q A;  2WB1 G;  1HHV A;  2L11 A;  1TVX A;  2ES2 A;  3EBE A;  4UHV A;  4JBM A;  1P8L A;  5FO8 B;  1KD1 C;  3G6J B;  4K0K L;  1ML0 D;  1JOK A;  4NKL A;  4F8M A;  5LMN W;  4KKS A;  4CJ2 C;  4XXE A;  3DM1 A;  5M3F G;  4DUZ L;  1ZKO A;  5IT9 E;  1UUP A;  3WWV A;  5C4H A;  4LF9 L;  1ESR A;  3CPF A;  5E4W C;  4A3K B;  4JI8 Q;  1BXT A;  2KA7 A;  3I4M B;  1TWA H;  3OSO A;  1YJN A;  1KXL A;  3S24 A;  4JI5 Q;  1I3Q B;  2A68 C;  2WAQ B;  1SMX A;  1PZJ D;  4NW2 A;  4DUY Q;  1AE3 A;  4CBV A;  5HY6 A;  1K0R A;  4UPA A;  4A93 B;  2K5V A;  2PCF B;  5IYB G;  5EPL A;  1PHJ A;  4GNX B;  2J7Z A;  4PQX A;  4DV4 L;  1S5E D;  4L5S A;  3H6M A;  3URY A;  1R4P B;  1QVF A;  1QVC A;  3RLF A;  4JI2 Q;  3WOF A;  4H02 A;  3MZ5 A;  1NSN S;  4RGO S;  2F0N A;  1ZXT A;  3X3M A;  4YWK A;  1IKL A;  1MSG A;  2JA7 H;  1YIT A;  4HJ9 A;  5DM6 3;  3RZO H;  5IYC H;  5BN3 A;  3HOW H;  3P75 A;  3VYT A;  5BR8 L;  4FYD A;  1KL9 A;  1UWV A;  3OMG A;  1SMY C;  1UE5 A;  3M9B A;  1PZI D;  3HS0 C;  3K0X A;  1Q86 C;  2HQE A;  3VA7 A;  1G29 1;  2F3W A;  1I4R A;  1S5F D;  4FP5 D;  1N34 Q;  3TRZ A;  4R4T A;  3CAM A;  1RHP A;  4NXN L;  4WOR A;  3BG3 A;  3GTL B;  5IT9 L;  3VR2 A;  3OTO Q;  2XIW A;  2ZXR A;  5C5L A;  3IFD A;  3K5O A;  2UXD Q;  4NXM Q;  4B3M L;  1HH2 P;  2ZJP A;  2A1A A;  4C3H H;  2Z6K C;  1MJE A;  1K0S A;  3HOY H;  1UEB A;  1QG7 A;  2R61 A;  3VYS A;  1Q12 A;  4OWW B;  3QIA A;  3RLO A;  1MI2 A;  4A76 A;  3GV3 A;  3MXU A;  1G51 A;  1VQF A;  5CV9 A;  2I0Q A;  3H0G H;  2K33 A;  1VF5 C;  4K14 A;  4X64 L;  1K28 A;  3U4V A;  4C3J G;  3CU7 A;  2B63 H;  2L1B A;  4LFA Q;  1HCZ A;  2BA0 A;  4OXP A;  3E3X A;  2UUA L;  2ALY B;  4GN3 B;  2OQK A;  5C0X J;  1I6H B;  4FF1 A;  1CTM A;  4DV2 Q;  4JV5 Q;  1EEF D;  2F3V A;  4C3I G;  1HNZ L;  1TWC H;  3OIP A;  2VQF L;  4QGU A;  1STN A;  4HCS A;  2F0G A;  3RZD B;  1IXR A;  3OW2 A;  4F7X A;  5CV7 A;  4KKU A;  1SRU A;  1JWM D;  4DR3 L;  2E5L Q;  1EZ8 A;  2C9O A;  2B2U A;  3D6W A;  3GD7 A;  1UE7 A;  5C0X G;  3I90 A;  2IX1 A;  3VR4 A;  5I2Y A;  2HT1 A;  1HNW Q;  1K9M C;  2KED A;  2EY1 A;  2MO0 A;  1LUZ A;  2IJ0 A;  1YZ6 A;  4HJ8 A;  2Z6K A;  1B3A A;  3CP0 A;  3ULL A;  1UE1 A;  5LMU L;  3K59 A;  4DR6 L;  4BBR B;  1I94 L;  4XYO A;  4MHE A;  1YHQ A;  4HJ5 A;  4DR7 L;  1EUJ A;  2F0W A;  2VUM H;  4OO1 G;  3PUZ A;  5DNF A;  1P16 A;  4UDU C;  5COR A;  3T1H L;  4Y52 H;  1EQV A;  4EQ5 A;  2IX0 A;  5IOC A;  2B3G A;  3S2H B;  1CUK A;  3OMC A;  4OWT B;  2NTT A;  3A0J A;  3GTM B;  1TS2 A;  3MVV A;  4K0K Q;  2EYH A;  2RDF A;  2CW0 C;  5HGT A;  1ENC A;  5E3F A;  3S1M B;  2L4N A;  1KNE A;  3K5L A;  2KQ3 A;  4DUZ Q;  1E24 A;  1Y1W H;  1VQM A;  1Y1V G;  1S72 A;  2JJQ A;  1N36 L;  2F0V A;  2JSO A;  2NZO A;  4XT1 B;  1GKH A;  2IY5 B;  4N8F A;  1Q1B A;  2RQX A;  4HED A;  3CHB D;  2F0L A;  2EYP A;  2XGT A;  2E76 C;  1SDF A;  2WFW A;  4IUV A;  3HOV B;  2R7Z G;  3NE5 B;  2E2H H;  1NE3 A;  2SEB D;  1X9N A;  1SFO H;  1C0A A;  1E22 A;  2GVA A;  1AFP A;  2K01 A;  2KBN A;  2J0T D;  2TSS A;  3CCS A;  1Y69 U;  1O7Y A;  2JA5 B;  3D3R A;  2XWJ B;  1I4P A;  1G8Z D;  3J80 i;  4JBK A;  4ZLT F;  1JMC A;  1EFI D;  1FJG Q;  1PH5 A;  3BVM A;  4JI3 L;  4DR2 L;  4LUV A;  2Z8L A;  2NVY B;  4A3I G;  1NR2 A;  2F0H A;  5KNC A;  3OWE B;  2XTI A;  3JAM i;  1GOZ A;  1STB A;  1K83 H;  2KVM A;  3SXH A;  3B6Y A;  1LAB A;  1XNQ L;  1NJI C;  1IBM L;  1U4M A;  2C35 B;  5IE8 A;  3BU2 A;  2MP1 A;  1U5K A;  3STB C;  1SN8 A;  3G7L A;  1VQ4 A;  1PTO F;  4Z9C B;  4BBS B;  5D65 A;  2E8G A;  3A5Z B;  4JG2 A;  5CC4 A;  2AHO B;  5K36 G;  2WKC A;  3KBG A;  3K58 A;  1CA5 A;  2FMM A;  1YVC A;  2RCF A;  1G91 A;  4IPG A;  3I91 A;  1E1T A;  2RHQ B;  5CGK A;  1QVG A;  1QNK A;  2K14 A;  1IYU A;  2D5D A;  1GM5 A;  4U67 3;  1NUC A;  3U50 C;  2VNU D;  2PI2 E;  3MAQ A;  3TQY A;  3NBI A;  1RCV D;  2IT1 A;  3C2P A;  1NR4 A;  2L0C A;  4DV3 Q;  1EIY B;  3I4N B;  4IZ8 A;  2EE1 A;  3N52 A;  3RD4 A;  3RR5 A;  3MFY A;  4A3M H;  4XQQ A;  4ZK9 B;  2RCN A;  2MUY A;  2L5T A;  3U9S A;  1GUW A;  4KJO A;  1VCI A;  3NK9 A;  1S5C D;  1R9T B;  1F2Y A;  1S3O A;  3FVQ A;  5LL6 S;  4JI6 L;  3PO3 B;  4BY1 B;  1NMF A;  4GNX C;  4A3E G;  4LK1 C;  4DAV A;  2HHH L;  2DY8 A;  4RWS C;  4TSS A;  4A3K H;  5CV8 A;  3C46 A;  3PIP 3;  2A8V A;  3I4M H;  3P7J A;  1I3Q H;  4DR3 Q;  3W2D A;  5FJ8 H;  4IPH A;  2L55 A;  4JK1 C;  4PG3 A;  1YNJ C;  2LS0 1;  3RNU A;  4A93 H;  3KF6 A;  5C44 G;  4DNR B;  1PDQ A;  2PQA A;  4AYB B;  3CC7 A;  3W1B A;  4QUC A;  5C0X I;  4CDC C;  3M7N A;  5DM7 3;  2EOT A;  1YNN C;  4GKJ Q;  2SOB A;  3MHB A;  4B3T L;  2FXQ A;  3C1F A;  1LM0 A;  1TR5 A;  5IGG A;  1H9K A;  1VQL A;  2B2W C;  4DR7 Q;  4WJW A;  3DWQ A;  2PYK A;  3KUP A;  3GV6 A;  3EA6 A;  3T1H Q;  2NBF A;  4LMQ D;  4HAE A;  1EIG A;  4KKT A;  4XDX A;  1JC7 A;  2B2Y C;  4GOP C;  2HIX A;  4DV5 Q;  2JYO A;  2AMC B;  1H9J A;  2EJM A;  2DUD A;  3HOX H;  1S5D D;  4LAA A;  3S1N B;  2A6E D;  1Q3L A;  3DWA A;  3A7A B;  2IX3 A;  2VS1 A;  1I4Q A;  4P72 A;  2E74 C;  4LW1 A;  1IW7 D;  1KAW A;  4ME3 A;  1HZC A;  3FKI G;  1WTH A;  4DF7 A;  1V9P A;  3IKJ A;  1N36 Q;  1EYD A;  2F4V Q;  3R8B A;  3STB D;  3GTL H;  3KDF A;  1ZEQ X;  2OXP A;  4DXG A;  4RHS A;  3PUX A;  4APV A;  2JXM B;  4YHH Q;  5I6W A;  2IL8 A;  1YJW A;  1GHJ A;  1XTD A;  2PZT A;  2ICI A;  3CCJ A;  2EY6 A;  4X65 L;  1PH2 A;  3MC0 B;  2F1M A;  1JWS D;  3EQL C;  1YHB A;  5JPN C;  1VQB A;  2G5D A;  3CCQ A;  4MZ9 A;  2K4K A;  3HRZ C;  4YWM A;  1CHQ D;  5FLX c;  1DD2 A;  3GTK B;  3DEP A;  5KIX A;  2RA4 A;  4JI7 L;  4F87 A;  2F0T A;  2K32 A;  2UXC L;  2B2W A;  2Y0S E;  3BS1 A;  4KY6 A;  3A8K E;  3KK7 A;  4R4I A;  1N32 L;  3HKZ E;  1V43 A;  2JN4 A;  4KTA A;  1PFN A;  1RIP A;  3LWE A;  1JWU D;  1QWY A;  2GN5 A;  4XQJ A;  4GLV B;  5J22 A;  1PRT F;  4TVA B;  2B2Y A;  4GOP A;  1EWI A;  1I6H H;  3TS2 A;  2O2L D;  1G2S A;  1PZK D;  1SJE D;  5C3E B;  2AUJ D;  1UAP A;  1BCP F;  5JVG 3;  1SYE A;  3RZD H;  4OWX B;  1WTQ A;  4A3F B;  1EY9 A;  1U4P A;  4JI8 L;  2BDO A;  2VW9 A;  4FNF A;  4JI5 L;  3I72 A;  5JJZ A;  1HZA A;  4LF5 L;  5KEE A;  5CYU A;  2AWN A;  3BZC A;  4RHR A;  1DZ1 A;  3UDX A;  2DY7 A;  5IP7 H;  2PZU A;  2LMC B;  2F0U A;  2N55 A;  3NTI A;  5K5P A;  3GTG B;  3EJI A;  1JOO A;  5JJK A;  2AUK A;  4BBR H;  1KRS A;  4BS9 A;  1Z6H A;  4A3C G;  2AWO A;  3CCE A;  1HQR D;  1SLJ A;  3S2H H;  1O7I A;  2ENB A;  3GTM H;  3T4A C;  1HJP A;  4F88 A;  1PYB A;  1AZP A;  2Q8T A;  3J7A V;  1LT3 D;  3K6O A;  3PO2 G;  4ALP A;  3S1M H;  1MKH A;  3HOY G;  2KHJ A;  2RVL A;  3IL8 A;  3BDC A;  4OL7 A;  1TY0 A;  4H0L C;  5I2X A;  2HHH Q;  3KLR A;  3HG9 A;  4PZ8 A;  1PFM A;  5GRO A;  1EIH A;  3Q0A A;  2N49 A;  3SK4 A;  3HOZ B;  1Y8N B;  2IHF A;  2R92 B;  3BZK A;  2QKI C;  2N3S A;  1JCK B;  3ERO A;  3FP9 A;  3HOV H;  1YEZ A;  2B63 G;  3KFU A;  2UXB Q;  2OTJ A;  2EVB A;  1LTA D;  4AH6 A;  3TSS A;  2UXD L;  4NXM L;  1XX8 A;  1VQP A;  2JA5 H;  1WI5 A;  2D0P A;  2YU9 B;  1DJR D;  2Z6B A;  4K6L A;  4JI0 Q;  4OX9 L;  5C4X G;  4OEM B;  5JPM C;  4O42 A;  2X6L A;  1X32 A;  2NVY H;  5C3W A;  5EPJ A;  1OXX K;  2R3Z A;  1Q8K A;  4DK6 C;  1YIJ A;  3TBI B;  2WB1 B;  1LT5 D;  1F2Z A;  1JOQ A;  2K5W A;  1V1O A;  4NP5 A;  4EVO A;  3A74 A;  4LFA L;  3BJU A;  3DLL A;  3CC4 A;  4BBS H;  4A3B B;  1ENA A;  2UUB Q;  1KAB A;  4IPD A;  5M3F B;  1G2T A;  4ZUJ A;  4DV2 L;  4JV5 L;  4IFD J;  1CSP A;  1C8C A;  3A8J E;  4HIM A;  1V1Q A;  1KAA A;  5FLM G;  1MSH A;  1SYD A;  3G6E A;  2OCE A;  2E5L L;  5EGT A;  3HOU B;  1E2Z A;  2RSO A;  1B8A A;  4X3K A;  3MXG A;  3AMU A;  4IQZ A;  4ABN A;  3S1R B;  4ZKB B;  2VY3 A;  5CBE E;  2WIN B;  4YCW A;  2MFI A;  4POF A;  1HNW L;  1PV4 A;  4UP7 A;  4X6A H;  2B2V A;  4M1U B;  1GHK A;  4RGT A;  2PPB C;  1CM9 A;  2L15 A;  4Y7N B;  3I4N H;  2V1C C;  2NN6 I;  3PV0 A;  1CSQ A;  1WOC A;  1Y14 B;  3KLW A;  5JOB A;  3KF6 B;  3D6C A;  3PUV A;  1VQC A;  4G57 A;  1SRO A;  1QNU A;  1GUO A;  3CQZ B;  1HZ9 A;  5L37 A;  4JBJ A;  1R9T H;  3PO3 H;  4BY1 H;  4K8I A;  1NCV A;  1HNX Q;  3K5N A;  1LLR D;  4H13 C;  2G9H D;  1T5X D;  5JEA H;  4R4O A;  1L0X B;  4KN7 C;  1V1P A;  4P74 A;  4LF4 Q;  3CME A;  4PV1 C;  3K80 C;  5ELE A;  4X3T A;  1U0L A;  1G6Z A;  3F2U A;  1Q82 C;  4LF5 Q;  3GDE A;  4IOA A;  2JA6 B;  3SEB A;  1Q81 C;  3MA2 B;  5EPK A;  1EEI D;  4L5T A;  4RA8 A;  5C5M A;  4HJ7 A;  2R7F A;  1MD2 D;  1EU3 A;  3IFT A;  2NN6 H;  2SNM A;  2YYZ A;  3C3L A;  2F03 A;  1DOK A;  1WCM G;  3KDF B;  4KV6 A;  1VQO A;  2A5H A;  2P5Z X;  1FJG L;  2LFN A;  1X3E A;  4FF4 A;  2J4X A;  2B2T A;  4BY7 B;  4DN4 M;  5IYD G;  3D0F A;  4A3J G;  3CCV A;  2KHI A;  3QB3 A;  2EQS A;  4C3J B;  5M3M G;  2NVX B;  1DXM A;  1HUN A;  1O78 A;  5KYI A;  3NSW A;  3S1N H;  2QGQ A;  1LTI D;  2PMZ B;  1Q46 A;  1LAC A;  3SK8 A;  2UUC Q;  1RJT A;  1TWG B;  4C3I B;  4V19 0;  1EWH A;  4TQU S;  4HMI A;  4A3M G;  5JAV A;  2B2U C;  2L9H A;  4B08 A;  1B4O A;  4HSV A;  1XPO A;  3M3Y H;  3S15 B;  4G7H C;  4DKA C;  4GOP B;  5E4X A;  5IGE A;  2CVR A;  1B7Y B;  2K28 A;  1X55 A;  4H44 C;  2K5H A;  2Q2U A;  3FRP B;  4DPG A;  1HPC A;  1EQT A;  2B8G A;  4R9W A;  1WFQ A;  1Z7T A;  2K5Q A;  1I4H A;  1CHP D;  4A3K G;  4OX9 Q;  4DV3 L;  3GTK H;  3A7L A;  1KHI A;  4IUR A;  2K5D A;  4YY3 Q;  5NUC A;  1X54 A;  2I07 B;  3F2B A;  3P20 A;  4G4K A;  2D62 A;  4ME5 A;  3NWS A;  4QIW E;  5M5W B;  2KEC A;  5T1G A;  1ET6 A;  4RGM A;  1DYQ A;  1STY A;  1LT4 D;  2WV6 D;  2F4I A;  4OIK A;  1RTN A;  2K7V A;  5KNB A;  4IJL A;  1SYF A;  2PW5 A;  2YTY A;  3S14 B;  1E1O A;  2EY5 A;  4IUN A;  2A73 B;  1VQ5 A;  1IHZ A;  1M1K C;  5D3D A;  4A3F H;  1Y1V B;  4DFA A;  1FNV A;  1STA A;  3ERS X;  4CDF C;  1I4X A;  4C56 C;  3SDZ A;  1XNR Q;  2H5X A;  1PRT D;  2NVT B;  2K04 A;  3FPP A;  1YBY A;  4GS3 A;  3M85 A;  4DV1 L;  3PCO B;  3CCM A;  5IOD A;  2R7Z B;  1BCP D;  3GTG H;  3GTO B;  1II3 A;  2O5I C;  4P73 A;  1X56 A;  3Q8D A;  1SND A;  4R8I A;  1TU2 B;  4XYQ A;  3HOX G;  3LX0 A;  1Y8O B;  1QCB D;  1E2V A;  4IFD I;  2F0F A;  3GO5 A;  4GKJ L;  1C48 A;  1STE A;  3PIP A;  4R8N A;  1QZH A;  2ZM6 Q;  4HIO A;  1FNW A;  1ASZ A;  5DAU A;  2AQ2 B;  1ZYR D;  1OXS C;  2HDM A;  3VR6 A;  2KCC A;  2LXK A;  3UE1 A;  5ELN A;  4DK1 A;  4A3I B;  3F8T A;  4EQO A;  1B44 D;  2MJ8 A;  1ET9 A;  5HGQ A;  3DMU A;  4BA1 I;  4DV5 L;  5AJ3 L;  3DHQ A;  1IYJ B;  4J15 A;  4QY7 A;  1K8O A;  1CFM A;  5EKI A;  3QG1 A;  1FNU A;  4N9P A;  1PH3 A;  1WYD A;  5CV5 A;  1L1O B;  1VQ6 A;  1QE6 A;  2JA9 A;  3BDL A;  3HOZ H;  2R92 H;  4HN7 A;  4S3S A;  2F4V L;  1TWH B;  3R3O A;  5LMN L;  4RCO A;  1EY4 A;  1L2F A;  4I65 A;  4WJ3 M;  3MEF A;  4PMC A;  3L9A X;  4IOC A;  3OW7 A;  1D8L A;  2TMP A;  3I73 A;  1A62 A;  4IPC A;  2Z4I A;  4DAM A;  4KK7 A;  4YHH L;  3Q22 A;  3S1Q B;  4G7O C;  2FJ2 A;  3H3V I;  3PSI A;  1SSO A;  1RTO A;  1X3F A;  4WJ4 A;  2YU9 H;  3WDN A;  3ND9 A; 
#chains in the Genus database with same CATH homology
 1HQM C;  5C6A A;  3QOL A;  1BBX C;  3T53 B;  4K5V A;  4O1N A;  1IYV A;  4WFN 3;  1AEX A;  2A6E C;  4RH6 A;  3VR3 A;  1B9N A;  3NQI A;  1IW7 C;  1KNA A;  3H3V C;  1EY0 A;  1F9S A;  1Q1E A;  4ID6 A;  3E6Z X;  5IGD A;  2WII B;  1AZQ A;  1BNZ A;  4B9X A;  4A3E B;  3TP5 A;  2F0O A;  1OXT A;  3PIO 3;  5FO7 B;  4FXD A;  4DAY A;  3RUZ A;  1WD0 A;  3PUY A;  5C44 B;  3FMC A;  1V1P B;  5I9O A;  3T56 B;  1HFG A;  3FEW X;  1RKN A;  2BOS A;  1O80 A;  3PMF A;  1KLG D;  1CZG A;  2EYJ A;  1LO5 D;  1HTP A;  5ELD A;  2NWG A;  4KI0 A;  4RKB A;  5CBA E;  4ZKC B;  2EDG A;  4KMU C;  3C1E A;  2ID0 A;  3ONA B;  4IUQ A;  1LTT D;  4TRD A;  5BN5 A;  4CKC A;  2K1B A;  2ZXP A;  1H9M A;  5COY A;  2RKS A;  2FIN B;  2VB3 X;  3E5S A;  4QUF A;  5FLX E;  3V96 A;  5G3L F;  4M8A A;  5F2D A;  1JE4 A;  1A6X A;  3V2T A;  3D4W A;  5IGC A;  1H9R A;  3O13 A;  1KTK A;  1HRJ A;  3QJY A;  2HCC A;  1MBY A;  4IAL A;  4CJ0 B;  2F0P A;  4IUP A;  1CI3 M;  1AW7 A;  4OO1 I;  3P1H A;  2QEJ C;  4KN4 C;  4DK0 A;  4N9T A;  2K03 A;  3HGB A;  3BVG A;  1ESF A;  3VA5 A;  3KLS X;  2A6H D;  5C0X H;  1EU4 A;  2HUG A;  3EVQ A;  3NUC A;  1TII D;  3H94 A;  4UAI A;  5FLX L;  4RCN A;  4OO1 H;  1EOT A;  3M7G A;  2WP8 J;  2L12 A;  1WD1 A;  3CKI B;  2NYZ D;  3PO2 B;  4BWG B;  3HOY B;  1WTW A;  4XIG S;  2KJX A;  1Q8I A;  1TQO A;  2F0K A;  1EL0 A;  2FFK B;  5C4J B;  4HMJ A;  1K8M A;  1D6E C;  4QF4 A;  5JVH 3;  1TT2 A;  3FDT A;  5EJW A;  4K2K A;  1LTS D;  3X3N A;  4OGQ C;  1PYW D;  1ILQ A;  3MTS A;  5KGU A;  1LTB D;  4WRD A;  4GZY C;  2LKV A;  1SNP A;  5C4X B;  3GTJ B;  4OHJ A;  3I8Z A;  2EYM A;  2PNR C;  1MGS A;  3S16 B;  2XRS D;  4OIJ A;  3GP7 A;  3MWY W;  3BYY B;  4IUU A;  1DM0 B;  3MFG A;  4PMB A;  4FF2 A;  4KD3 A;  4C3H G;  5FOB B;  4K8J A;  2IW3 A;  1A15 A;  1AN8 A;  5K36 H;  3BDO A;  1SNC A;  1LTR D;  4FXG C;  1CA6 A;  5IGB A;  1E2W A;  1ICW A;  1B9M A;  4XT3 B;  1PFB A;  1WTX A;  2E75 C;  3DUZ A;  5CV4 A;  1Q90 A;  3VYU A;  3M4O B;  1D5M C;  3OIQ A;  2B2V C;  2Q8R E;  3LWU A;  3GTP B;  2GA4 B;  3TN2 A;  2EJF C;  1D1I A;  3K57 A;  3QWN A;  1SNM A;  3TP7 A;  1SEB D;  1AP0 A;  3S9W A;  2NTS A;  1DON A;  2KOL A;  4HSP A;  1HFN A;  1RD9 D;  3A55 A;  3PUW A;  3GQB A;  4RFB A;  4KY5 A;  2ZXO A;  1BO0 A;  1RF2 D;  3NHH A;  3VR5 A;  2N88 A;  2F0S A;  4KJN A;  2E2J B;  2XSC A;  1IKM A;  3N6R A;  3Q23 A;  3OHX C;  2B39 A;  2XVS A;  5CR3 A;  3BVZ A;  1W6J A;  4EGV A;  2Z4H A;  2FMC A;  1PTO D;  2XNA C;  1EY7 A;  1VMC A;  4FO2 A;  2Q8I B;  1F77 A;  5ISR A;  1WCM B;  4C1N I;  1HXY D;  1F2M A;  2AQ3 B;  2B2T C;  2OT2 A;  2OEO A;  1J8I A;  5LL6 X;  4A3J B;  5M3M B;  2O5J C;  2IPK D;  2ICE C;  1PRT C;  2EY2 A;  2BA1 A;  2MGS A;  5DEH A;  2V4D A;  5EBD A;  5CMD A;  1BCP C;  1EYA A;  1SYG A;  1SYB A;  3KLS A;  5EKK A;  3FPU B;  1PLF A;  4L63 B;  1WTP A;  1SJH D;  2C5C A;  3OOC A;  2RDH A;  1ZYR C;  2AQ1 B;  4K6D A;  4ZQ3 A;  2JEA I;  2M2L A;  1GUG A;  3E0J A;  1CK1 A;  1WVL A;  1A3V A;  2F0M A;  3KBX A;  1C4Q A;  2NUC A;  1IL8 A;  1T5E A;  2E2D C;  2KEE A;  5G3L D;  1FYC A;  3ND8 A;  2H4O A;  3WOE A;  3SE0 A;  1UNS A;  3MXN A;  1KLU D;  5D3I B;  4JBW A;  4HCE A;  1A2T A;  3OPO A;  1A3U A;  2EPB A;  4KHZ A;  1SNO A;  1JR0 D;  2JE6 I;  2F0D A;  3K5M A;  1BQQ T;  3HOX B;  1X3Q A;  2JEB I;  1H9S A;  3W3A A;  4K2L A;  3NBH A;  3R2I A;  1DCZ A;  4K5W A;  5I6Y A;  1A2U A;  2O4X A;  2A69 D;  5E1F A;  1GJX A;  2X6G A;  2IWH A;  1F9R A;  1WTO A;  1RDP D;  4HTH A;  1WTR A;  5CV6 A;  4Q0F A;  1M4V A;  1B2T A;  2VB2 X;  4FVM A;  2LY7 A;  4YIJ A;  4Q5V A;  2XWB B;  3DXJ C;  1OXU A;  3NXW A;  4U68 A;  2EYL A;  1XXG A;  2M00 A;  1GUS A;  2F0E A;  2WKD A;  3T13 A;  3R93 A;  2RDG A;  3SHL A;  2BE5 D;  3NPP A;  1I6V C;  1SXT A;  3T51 B;  3J7A F;  5ELF A;  1B53 A;  4BA2 I;  1ENF A;  5EBC A;  3A54 A;  1PTO B;  2EZV A;  1I50 B;  1TKW B;  4MN3 A;  3TP8 A;  3J81 E;  5M5X B;  1SAP A;  1UEA B;  3Q6S A;  5ELB A;  1TS4 A;  4A3G B;  3NTK A;  4KD4 A;  5D14 A;  5FO9 B;  4XQN A;  1TS3 A;  1S4Z A;  3QO2 A;  1BOS A;  4QMG A;  2A68 D;  1E0B A;  3S2D B;  1JB3 A;  2QF7 A;  1CT1 D;  1I4G A;  3S17 B;  1J9O A;  1VDZ A;  3H09 A;  3NWT A;  1EWC A;  2QDB A;  1O7Z A;  1B1Z A;  1M8A A;  1TY2 A;  4A3D B;  3I70 A;  2Y0S B;  4IUT A;  1U4L A;  4IFD H;  1TWF B;  4DGZ A;  3HKZ B;  5I9P A;  1SNQ A;  5EKL A;  4CKB A;  2EYF A;  2RSN A;  5I4D A;  1VMP A;  2QCP X;  1SMY D;  1PMR A;  1SYC A;  2H1E A;  5A2Q E;  1BUV T;  4ZYS A;  3K7A B;  1SE4 A;  2PQE A;  2MHV A;  4L8J A;  3CRK C;  1XTC D;  3BYT B;  3GTQ B;  3J81 L;  2NVQ B;  5FKA C;  3NTH A;  5KRU A;  4HR7 B;  2PO4 A;  1F2L A;  2A6H C;  3UI2 A;  3QOJ A;  5M5Y B;  2BCO A;  4KY7 A;  3SR1 A;  2DN8 A;  4X3U A;  4RGN A;  5AFW A;  1EZ6 A;  2I46 A;  2NB0 A;  2EXZ A;  2JP1 A;  1JIC A;  3DEO A;  1QIL A;  3A56 A;  2D2C C;  1S5B D;  4XTC S;  3NP8 A;  4CGY B;  2D9U A;  2B8F A;  1XWE A;  3NQT A;  4DXF A;  4DAP A;  3HZX A;  1DOM A;  1V8Q A;  4FF3 A;  1CQV A;  1F9P A;  1B50 A;  3D8G A;  5J39 A;  1BDO A;  5A2Q L;  3DWP A;  3SK6 A;  3K0Y A;  2PW7 A;  2JA8 B;  2QIL A;  4C2M B;  2EJG C;  2F0J A;  2E2I B;  2R93 B;  1FD7 D;  3FKI B;  3D4R A;  1XYI A;  1JQY D;  2WAC A;  4I7Z C;  3L3O C;  1BF4 A;  3D31 A;  3T16 A;  4H7B A;  5J1Z A;  4CHT B;  1HTL D;  2PZW A;  2KHS A;  2FHT A;  1GUT A;  1KDC A;  2NZ1 D;  4RKL A;  1PRT B;  4B9W A;  3Q24 A;  2CW0 D;  1VF7 A;  2DNC A;  1BCP B;  1LV9 A;  1WTV A;  2EYO A;  1TWA B;  2KUM A;  3SK5 A;  2X69 A;  1Y8P B;  1H9S B;  4EQP A;  4LJZ C;  5IIF A;  4J8Q A;  3IAY A;  1STG A;  1CZW A;  5M9O A;  3R2T A;  1F9Q A;  1SE2 A;  2SNS A;  3RMH A;  3V05 A;  3L7Z C;  1D5X C;  5JEA J;  2JA7 B;  1ONL A;  3RZO B;  4EQN A;  5KYL A;  3HOW B;  1EYC A;  2K6A A;  1FR3 A;  4ZUI A;  3TP6 A;  4V0B A;  1GUN A;  2XRQ D;  4C1N K;  5EQ0 A;  1HA5 A;  3ITP A;  5JEA G;  3ERQ A;  3LNN A;  1GXD C;  3AU7 A;  4G7Z C;  3M3Y B;  1Z47 A;  4PNY A;  1NAP A;  1QB5 D;  3MEH A;  3D4D A;  3KF8 A;  1W6K A;  2NN6 G;  4QCL A;  4C3H B;  4DA2 A;  3M4Y A;  1LTG D;  1PXU A;  1R4Q B;  1KDA A;  1D5Z C;  2K05 A;  3AB9 A;  3H91 A;  4MIU A;  1PTO C;  3H0G B;  1KDB A;  2RBM A;  5FK9 C;  5TSS A;  3TME A;  1STH A;  5C3X A;  2B63 B;  1SBB B;  4DNT B;  1D1K A;  1EY5 A;  3CRL C;  1U9R A;  1JOR A;  1O7L A;  3ZYY X;  2R6G A;  5BN4 A;  1PTO H;  3TZD A;  1TWC B;  2Z1C A;  1FGB D;  2BDN A;  4FXK C;  1SE3 A;  1ILP A;  1TS5 A;  1QOH A;  4ZRZ A;  2M9V A;  1U4R A;  1EY8 A;  4PMW A;  1YNJ D;  3A8I E;  3TDQ A;  1ROD A;  4J6H A;  3OWF A;  1YNN D;  2DNE A;  1A3T A;  3I4L A;  1OXV A;  2HDL A;  2OF1 A;  2VUM B;  2VXW A;  3I3C A;  4P2C B;  1BR9 A;  1EY6 A;  3J80 E;  5HUR A;  4DU9 A;  4QIW B;  1DOL A;  5C4Z A;  4L6T B;  5ELC A;  1CQF A;  1HA6 A;  1HUM A;  4IN3 A;  2XN9 C;  1Y1W B;  3JAM E;  3HP3 A;  4ZAI A;  5LHY 1;  1QJO A;  4RAU C;  5KND A;  2ZT9 C;  3TZU A;  3EFX D;  2E2H B;  4KHV A;  1D2B A;  1SFO B;  1LT6 D;  5IGF A;  4J1M A;  4CJ1 B;  3U9O A;  2SDF A;  2CHB D;  3VYR A;  3BZD B;  3HEJ A;  5A35 A;  4TKO B;  1L0Y B;  5T1I A;  3J7Y W;  1K83 B;  2KCN A;  2F0I A;  2HCI A;  4ODG A;  4X3S A;  2A69 C;  1X3P A;  3J80 L;  3SVM A;  4K5X A;  3JAM L;  4IFD G;  2A74 C;  4ILW A;  4NDX A;  2G9D A;  4CKE A;  4E6I A;  3MXP A;  4ULL A;  2MPM A;  4QB4 A;  2BE5 C;  4NMZ A;  1OO9 B;  4A3M B;  2CQA A;  2F0Q A;  1HHV A;  2L11 A;  1TVX A;  5FO8 B;  3G6J B;  1ML0 D;  1JOK A;  4NKL A;  4F8M A;  4KKS A;  4CJ2 C;  4XXE A;  3DM1 A;  1ZKO A;  5IT9 E;  1UUP A;  5C4H A;  1ESR A;  5E4W C;  4A3K B;  1BXT A;  2KA7 A;  3I4M B;  3OSO A;  1I3Q B;  2A68 C;  2WAQ B;  1PZJ D;  4NW2 A;  4CBV A;  4A93 B;  2PCF B;  5EPL A;  2J7Z A;  4PQX A;  1S5E D;  3H6M A;  3URY A;  1R4P B;  3RLF A;  3WOF A;  3MZ5 A;  1NSN S;  4RGO S;  2F0N A;  1ZXT A;  3X3M A;  1IKL A;  1MSG A;  5DM6 3;  5BN3 A;  3P75 A;  3VYT A;  4FYD A;  3OMG A;  1SMY C;  1PZI D;  3HS0 C;  2HQE A;  3VA7 A;  1G29 1;  2F3W A;  1I4R A;  1S5F D;  4FP5 D;  1RHP A;  4WOR A;  3BG3 A;  3GTL B;  5IT9 L;  3VR2 A;  2XIW A;  2ZXR A;  5C5L A;  3IFD A;  3K5O A;  1QG7 A;  2R61 A;  3VYS A;  1Q12 A;  3QIA A;  1MI2 A;  3GV3 A;  3MXU A;  5CV9 A;  2K33 A;  1VF5 C;  4K14 A;  4C3J G;  3CU7 A;  2L1B A;  1HCZ A;  2BA0 A;  5C0X J;  1I6H B;  4FF1 A;  1CTM A;  1EEF D;  2F3V A;  4C3I G;  3OIP A;  1STN A;  4HCS A;  2F0G A;  3RZD B;  4F7X A;  5CV7 A;  4KKU A;  1JWM D;  1EZ8 A;  2C9O A;  2B2U A;  3D6W A;  3GD7 A;  5C0X G;  3I90 A;  2IX1 A;  3VR4 A;  5I2Y A;  2KED A;  2EY1 A;  2IJ0 A;  1B3A A;  3K59 A;  4BBR B;  4XYO A;  4MHE A;  2F0W A;  4OO1 G;  3PUZ A;  5DNF A;  4UDU C;  5COR A;  1EQV A;  2IX0 A;  5IOC A;  3S2H B;  3OMC A;  2NTT A;  3GTM B;  1TS2 A;  3MVV A;  2EYH A;  2RDF A;  2CW0 C;  5HGT A;  1ENC A;  5E3F A;  3S1M B;  2L4N A;  1KNE A;  3K5L A;  2KQ3 A;  2F0V A;  2JSO A;  4XT1 B;  1Q1B A;  2RQX A;  4HED A;  3CHB D;  2F0L A;  2EYP A;  2E76 C;  1SDF A;  4IUV A;  3HOV B;  3NE5 B;  2SEB D;  1AFP A;  2K01 A;  2TSS A;  2J0T D;  1Y69 U;  1O7Y A;  2JA5 B;  3D3R A;  2XWJ B;  1I4P A;  1G8Z D;  4ZLT F;  1EFI D;  3BVM A;  2Z8L A;  2NVY B;  1NR2 A;  2F0H A;  5KNC A;  3OWE B;  1GOZ A;  1STB A;  2KVM A;  3SXH A;  1LAB A;  1U4M A;  2MP1 A;  3G7L A;  1PTO F;  4Z9C B;  4BBS B;  5D65 A;  5CC4 A;  5K36 G;  2WKC A;  3KBG A;  3K58 A;  1CA5 A;  2FMM A;  1G91 A;  3I91 A;  5CGK A;  1QNK A;  1IYU A;  2D5D A;  4U67 3;  1NUC A;  2VNU D;  3MAQ A;  3NBI A;  1RCV D;  2IT1 A;  3C2P A;  1NR4 A;  2L0C A;  3I4N B;  4IZ8 A;  2EE1 A;  3N52 A;  3RD4 A;  3MFY A;  4XQQ A;  4ZK9 B;  2MUY A;  2L5T A;  3U9S A;  1GUW A;  4KJO A;  1VCI A;  3NK9 A;  1S5C D;  1R9T B;  1F2Y A;  3FVQ A;  5LL6 S;  3PO3 B;  4BY1 B;  4LK1 C;  4DAV A;  2DY8 A;  4RWS C;  4TSS A;  5CV8 A;  3C46 A;  3PIP 3;  3P7J A;  3W2D A;  2L55 A;  4JK1 C;  1YNJ C;  2LS0 1;  4DNR B;  1PDQ A;  4AYB B;  4QUC A;  5C0X I;  3M7N A;  5DM7 3;  2EOT A;  1YNN C;  2SOB A;  3MHB A;  3C1F A;  1TR5 A;  5IGG A;  1H9K A;  2B2W C;  4WJW A;  3DWQ A;  2PYK A;  3KUP A;  3GV6 A;  3EA6 A;  2NBF A;  4LMQ D;  4HAE A;  1EIG A;  4KKT A;  4XDX A;  1JC7 A;  2B2Y C;  2JYO A;  1H9J A;  2EJM A;  1S5D D;  4LAA A;  3S1N B;  2A6E D;  1Q3L A;  3DWA A;  3A7A B;  2IX3 A;  1I4Q A;  2E74 C;  1IW7 D;  4DF7 A;  3IKJ A;  1EYD A;  3R8B A;  1ZEQ X;  2OXP A;  4DXG A;  4RHS A;  3PUX A;  2JXM B;  5I6W A;  2IL8 A;  1GHJ A;  2PZT A;  2ICI A;  2EY6 A;  3MC0 B;  2F1M A;  1JWS D;  3EQL C;  5JPN C;  3HRZ C;  1CHQ D;  1DD2 A;  3GTK B;  3DEP A;  5KIX A;  2RA4 A;  4F87 A;  2F0T A;  2K32 A;  2B2W A;  3BS1 A;  4KY6 A;  3A8K E;  3KK7 A;  1V43 A;  4KTA A;  1PFN A;  3LWE A;  1JWU D;  1QWY A;  4XQJ A;  5J22 A;  1PRT F;  2B2Y A;  2O2L D;  1G2S A;  1PZK D;  1SJE D;  5C3E B;  2AUJ D;  1UAP A;  1BCP F;  5JVG 3;  1SYE A;  1WTQ A;  4A3F B;  1EY9 A;  1U4P A;  2BDO A;  4FNF A;  3I72 A;  5JJZ A;  5KEE A;  5CYU A;  2AWN A;  4RHR A;  1DZ1 A;  2DY7 A;  2PZU A;  2LMC B;  2F0U A;  2N55 A;  3NTI A;  5K5P A;  3GTG B;  3EJI A;  1JOO A;  2AUK A;  4BS9 A;  1Z6H A;  2AWO A;  1HQR D;  2ENB A;  3T4A C;  4F88 A;  1AZP A;  2Q8T A;  3J7A V;  1LT3 D;  3K6O A;  2RVL A;  3IL8 A;  3BDC A;  4OL7 A;  1TY0 A;  4H0L C;  5I2X A;  3KLR A;  3HG9 A;  1PFM A;  1EIH A;  3Q0A A;  3SK4 A;  3HOZ B;  1Y8N B;  2R92 B;  2QKI C;  3ERO A;  1JCK B;  2EVB A;  1LTA D;  3TSS A;  1XX8 A;  2YU9 B;  1DJR D;  4K6L A;  5JPM C;  4O42 A;  2X6L A;  1X32 A;  5C3W A;  5EPJ A;  1OXX K;  2R3Z A;  3TBI B;  2WB1 B;  1LT5 D;  1F2Z A;  1JOQ A;  2K5W A;  1V1O A;  4NP5 A;  4EVO A;  4A3B B;  1ENA A;  1KAB A;  5M3F B;  1G2T A;  4ZUJ A;  4IFD J;  1C8C A;  3A8J E;  1KAA A;  1MSH A;  1SYD A;  5EGT A;  3HOU B;  1E2Z A;  2RSO A;  4X3K A;  3AMU A;  3MXG A;  4IQZ A;  4ABN A;  3S1R B;  4ZKB B;  5CBE E;  2WIN B;  2B2V A;  4M1U B;  1GHK A;  4RGT A;  2PPB C;  1CM9 A;  4Y7N B;  2NN6 I;  3PV0 A;  5JOB A;  3D6C A;  3PUV A;  4G57 A;  1QNU A;  1GUO A;  3CQZ B;  4K8I A;  1NCV A;  3K5N A;  1LLR D;  4H13 C;  2G9H D;  1T5X D;  5JEA H;  1L0X B;  4KN7 C;  1V1P A;  4PV1 C;  5ELE A;  4X3T A;  1G6Z A;  3F2U A;  2JA6 B;  3SEB A;  3MA2 B;  5EPK A;  1EEI D;  4RA8 A;  5C5M A;  1MD2 D;  1EU3 A;  3IFT A;  2NN6 H;  2SNM A;  2YYZ A;  3C3L A;  2F03 A;  1DOK A;  4KV6 A;  2A5H A;  2LFN A;  4FF4 A;  2J4X A;  2B2T A;  4BY7 B;  4DN4 M;  3QB3 A;  4C3J B;  2NVX B;  1DXM A;  1HUN A;  1O78 A;  5KYI A;  3NSW A;  1LTI D;  2PMZ B;  1LAC A;  3SK8 A;  1RJT A;  1TWG B;  4C3I B;  4V19 0;  1EWH A;  4TQU S;  4HMI A;  5JAV A;  2B2U C;  2L9H A;  4B08 A;  1B4O A;  4HSV A;  3S15 B;  4G7H C;  5E4X A;  5IGE A;  2CVR A;  2K28 A;  4H44 C;  3FRP B;  1HPC A;  1EQT A;  2B8G A;  4R9W A;  1Z7T A;  2K5Q A;  1I4H A;  1CHP D;  3A7L A;  4IUR A;  2K5D A;  5NUC A;  2I07 B;  3P20 A;  4G4K A;  2D62 A;  4ME5 A;  3NWS A;  5M5W B;  2KEC A;  5T1G A;  1ET6 A;  4RGM A;  1DYQ A;  1STY A;  1LT4 D;  2WV6 D;  2F4I A;  4OIK A;  1RTN A;  2K7V A;  5KNB A;  1SYF A;  2PW5 A;  3S14 B;  2EY5 A;  4IUN A;  2A73 B;  1IHZ A;  5D3D A;  1Y1V B;  4DFA A;  1FNV A;  1STA A;  1I4X A;  4C56 C;  3SDZ A;  1PRT D;  2NVT B;  2K04 A;  3FPP A;  3M85 A;  5IOD A;  2R7Z B;  1BCP D;  3GTO B;  1II3 A;  2O5I C;  1SND A;  4R8I A;  1TU2 B;  4XYQ A;  3LX0 A;  1Y8O B;  1QCB D;  1E2V A;  4IFD I;  2F0F A;  3GO5 A;  1C48 A;  1STE A;  4R8N A;  1FNW A;  5DAU A;  2AQ2 B;  1ZYR D;  1OXS C;  2HDM A;  3VR6 A;  2KCC A;  4DK1 A;  4A3I B;  4EQO A;  1B44 D;  2MJ8 A;  1ET9 A;  3DMU A;  4BA1 I;  3DHQ A;  1K8O A;  1CFM A;  5EKI A;  3QG1 A;  1FNU A;  4N9P A;  5CV5 A;  1QE6 A;  3BDL A;  4HN7 A;  4S3S A;  1TWH B;  3R3O A;  4RCO A;  1EY4 A;  4I65 A;  4PMC A;  3L9A X;  3OW7 A;  3I73 A;  2TMP A;  3Q22 A;  2Z4I A;  4KK7 A;  3S1Q B;  4G7O C;  2FJ2 A;  1SSO A;  1RTO A;  3WDN A;  3ND9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...