4JI5L

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
124
structure length
123
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
total genus 13
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ji5L00
3OTOQ 5LMNL 2FXQA 1IBMQ 4B3TL 4A3MH 4DR4L 4DK3C 5M3FH 4LFAL 1IL2A 1X9NA 3PF4A 1HNWL 3PCOB 1J5EL 2EQSA 4X62L 1B70B 4HJ7A 5JEAJ 3J7ZC 5C0XJ 3PUZA 1XPRA 4DV1Q 4LUZA 1EOVA 2ID0A 2ZJPA 3GTJH 3AEVA 1VQAA 2L15A 3H3VI 2JA7G 2AWOA 2XGTA 4BXXG 1Q46A 1EYGA 4WJ4A 2UXBL 3GO5A 3CAMA 5BR8Q 2YTVA 1QUQA 2Z6KA 1KQSA 1K83H 3RR5A 3J81j 3F2CA 5HY6A 4PG3A 1VQFA 3S24A 3GDEA 2JEAI 2NVYH 2BH8A 1SMXA 4NXMQ 5FLXc 1Z47A 3CCQA 3T1YQ 1PH4A 4RMFA 3KF6B 5J3BA 2DGYA 2CWPA 4GNXB 1PH6A 3I4OA 2K5NA 3I2ZA 4RG1A 3RLOA 3PSIA 3ZJYC 4KI0A 4HIDA 4JI5Q 1U5KA 1V1QA 5M5XH 4A3FH 4R4OA 1ASZA 3LGJA 3HOYH 3PUVA 1N32L 5M5YH 3NELA 1YHAA 4DV6Q 3Q8DA 1K0RA 4UP9A 4X65Q 4IPGA 1YHQA 3RNUA 2D0PA 5AJ3L 2RHQB 5IP7G 3PUWA 5FJ8G 5LMNQ 1HNZQ 4R4IA 2R7ZH 4B3TQ 4DR4Q 2UXCL 4LFAQ 1N34L 3GTMH 1OXXK 1HNWQ 1J5EQ 1Q81C 4R4TA 4X62Q 3FP9A 4R1JA 3H15A 5FLMG 2QGQA 3CQZH 2IHEA 2Q2IA 2YYZA 3U4ZA 2F4VL 1VS0A 2R92H 4GOPA 1QVGA 2CWAA 3IRBA 4GNXC 4IOCA 4P73A 4LF8L 2WB1G 1S3OA 2HIVA 3KJOA 4JI4L 1RIPA 1X55A 3KDFA 4OO1G 3J80c 4A3KH 2UXBQ 1YNXA 3G6EA 4A3CH 3T1HL 2VL6A 2MO0A 1TWGH 1YEZA 1L1OB 1EIYB 2CKZB 1DGSA 3I4MG 1VQOA 4A3DG 4LWCA 1X56A 1Y14B 1TWAH 3D31A 5C44H 4JBMA 1IBLL 3F8TA 2BA0A 2KHIA 3L0OA 4FDBA 2JA5H 5C4JH 1TWHH 4DNIA 1N32Q 2OTLA 1YITA 4HJAA 1HJPA 5IE8A 2HT1A 2R7FA 3ERSX 2VUMH 4R4CA 3AYHB 4JV5L 3PO2H 2NVQH 4DV0L 3ULLA 3S2DH 3PV0A 1LTLA 2JJQA 4X66L 4IJHA 4B3SL 5GROA 4A3EG 1N34Q 2UXCQ 2NN6G 1CKOA 1XMOL 1K73C 3W1GA 1BBUA 4UP7A 2WB1E 1V9PA 5GAGC 1L1OC 5IWAL 1HH2P 5IYCG 2F4VQ 1HR0W 1NTGA 1WCMH 1MIUA 4IJLA 2YV5A 1HZBA 1OXVA 2WAQE 3F2DA 1Y1VG 3FKIH 4QJFA 4JI4Q 4LF8Q 4LFBL 2V1CC 4J15A 3U50C 2VW9A 3T1HQ 3TEHB 1Y1WH 4JOIC 3WWVA 2ZTEA 3CD6A 1A0IA 4JBWA 4BY1G 4HIOA 1X6OA 3SGIA 3RZDH 1W2BA 1IBLQ 1XNRL 3U4VA 3HOZH 2WFWA 3S1RH 2OQKA 1GVPA 1QVCA 2VS1A 3CCJA 3ICEA 4IO9A 3UE0A 1GD7A 1PHJA 4YWKA 4C3JH 3CCEA 1PH2A 1KL9A 4QQBX 1HZAA 1HZCA 3CC7A 2MO1A 4P74A 2K75A 4P72A 5LMUL 3KYHC 1K9MC 4OX9L 4QIWE 4JV5Q 2VNUD 5IYBH 1JE5A 2QEXA 3PUYA 3UDGA 1EFWA 1TWCH 1E7ZA 1XNQL 4DV4L 4X66Q 3S1NH 1Q82C 4B3SQ 4A3MG 5DLQE 5C4XH 1XMOQ 4K0KL 1RL2A 2JE6I 3UDFA 5IWAQ 1A8VA 3G48A 1XPOA 4LF4L 2JA9A 1CKMA 1VQBA 3PUXA 3K8AA 4NXML 3H3VH 2CQOA 1NJIC 4GS3A 4OO1I 4LF5L 4JBJA 4APVA 5GAEC 1VQNA 3H0GH 4LFBQ 3KOJA 2JK8A 4HIMA 4MZ9A 4A3JH 4KLKA 4AQYL 2Q2HA 1VQCA 2B63H 1M90C 2RF4A 3F1ZA 4LUVA 2ZTCA 1KRTA 1FGUA 4OWTB 2PI2E 1I3QH 1UEBA 3CF5A 1XNRQ 4JBKA 4A93H 3GTLH 1VQHA 1X54A 1CUKA 4P71A 1UWVA 1MKHA 4PMWA 4LUOA 3CMEA 4A3FG 3CC2A 3HOYG 2JA6G 4O2DA 4QY7A 5IP9H 1ASYA 1VQEA 3A74A 5LMUQ 4AYBE 4OX9Q 4JG2A 4GLXA 1XMQQ 1PH1A 1P16A 2UUBL 3UDXA 1XNQQ 4DV4Q 4JI6L 2MFIA 4DUZL 3S14H 3NEMA 4K0KQ 1WYDA 2F3IA 4GN3B 4L5QA 4HJ8A 5C3EH 1OXTA 2CFMA 4LF4Q 2PQAA 2UXDL 4POFA 5M3MH 4MTNA 4IPHA 1FVIA 1YJNA 2R92G 1WJJA 3M4OH 2YTYA 4LF5Q 4A3IH 4L5RC 3K7AH 4A3KG 2NVTH 4A3GH 2R93H 2ZM6L 1JB7A 1EWIA 1KIXA 4GN5A 1Q8KA 4AQYQ 1OTCA 2N78A 2RCNA 3S2HH 3PGZA 4H02A 4X64L 1N8RC 1FJGL 4AIMA 1YIJA 1K8GA 3UE1A 3I7FA 3M3YH 2EXDA 4BBRG 5C44G 2BH2A 1VCIA 3J7A5 1TXYA 3NBHB 1Q1BA 2JA5G 2OTJA 1V43A 4B3ML 4IFDG 2OWOA 5IYDH 5JJIA 1I6HH 4YCWA 5IT9c 1VQJA 2NZOA 2I5HA 2VUMG 1S40A 2CCZA 1VQGA 1WOCA 2UUBQ 4EX5A 2IHFA 3E9IA 3M4PA 3RN2A 4JI1L 3MXNB 4JI6Q 1UE6A 1L0WA 4DUZQ 4HIKA 1VQ4A 2PI2A 3ULJA 2UXDQ 2Y0SG 2I5LX 1KXLA 2AMCB 1R9TH 1BKBA 4X6AH 1EQRA 1WCMG 3S17H 2JA7H 4DR1L 1GM5A 4BXXH 3FKIG 5GADC 1KRSA 3CCMA 4IPDA 1CKNB 5E7NA 2ZM6Q 4GKKL 3KF8B 1O7IA 1X3FA 3PF5A 2A19A 1HR0L 2XTIA 3M7NA 1YJ9A 4X64Q 2I5MX 3CW2C 5GAHC 1Y1WG 1FJGQ 4NXNL 5JEAG 4UY8C 2E2HH 5C0XG 3J80i 3CPWA 4IOAA 4JI2L 4GLVB 2ZTDA 1E1OA 2VY3A 1KC8C 4B3MQ 2B3GA 3KF6A 2WP8J 4GNXA 3K80C 1PH9A 1JMCA 1X3GA 2E2IH 3GTOH 1X3EA 1WFQA 1E1TA 1NMGA 4YCUA 1Q7YC 1MJEA 1D7QA 1C0AA 4Y7NH 3TS0A 1VQLA 3HOUH 4ALPA 1UE7A 5IP7H 4LW1A 5FJ8H 4GN4B 5IYBG 2ZJRA 4LF6L 1UE1A 4JI1Q 4KHPL 3K81C 2LSSA 1Z9FA 2OQ0A 4O0AA 3HOWG 4GKJL 4Y52H 1PH8A 4POGA 1LM0A 2KHJA 3DM3A 2I0QA 1E3PA 1N36L 2KENA 2AHOB 2IX1A 1J6QA 4DR1Q 1JT8A 3DLLA 3B6YA 3AQQA 3JAMc 4GKKQ 3W1BA 2C35B 3CCVA 1OXSC 1EUJA 5ELOA 1I50H 1HR0Q 4DV3L 4NXNQ 2GN5A 4DV5L 3I56A 5IY0A 1G51A 1Q1EA 1VQ7A 4JI2Q 2K50A 1EQQA 3J81c 1XMQL 4BBSG 3PO3H 1L1OA 1PA6A 2IY5B 5C4XG 4UP8A 3JC66 5M3FG 1IXRA 1PV4A 4IFDI 1JJGA 4BY7H 1VQIA 1CKNA 5IP9G 2UUAL 1G6PA 1GKHA 2AWNA 3I4NH 3KFUA 4OWXB 2VQEL 2H5XA 4DR3L 2ZJQA 1QUQB 4YWLA 4YCVA 4LF6Q 2ES2A 1KHIA 4JOIA 3I55A 2KCTA 4A3EH 4LF7L 4KHPQ 3GTKH 1OXUA 4A4IA 4GKJQ 5C3EG 1PFSA 4A3BH 4DR6L 3EN2A 4UPAA 1N36Q 5M3MG 1TWFH 1Y1VH 3W5OA 1Q12A 4IPCA 3E9HA 3TQYA 4PZ6A 4A75A 3HOVH 4A3LG 2N49A 3CCUA 1QZGA 2R93G 1L2FA 4JI0L 5JJKA 1T9HA 4DV3Q 2K14A 2ASBA 2YTXA 4DV5Q 2Z6KC 1HNXL 2ATWA 2RHSB 1SN8A 1VQ6A 3HKZG 1E22A 2HQLA 2NZHA 1PH5A 4DKAC 2R7ZG 1SROA 3RN5A 1PVOA 3TS2A 1C7YA 1N9WA 2AKWB 2NN6I 2D0OA 4GOPB 1YI2A 1LYLA 4C2MH 4YWMA 2UUAQ 3CCSA 1XJVA 3KDFB 4DR3Q 2VQEQ 3TRZA 4BA1I 3HKSA 3S1QH 2KBNA 2MNAA 4C3IH 4LF7Q 1NE3A 1XTDA 1IZ6A 4OONA 4MNOA 4OWWB 4A3CG 2KCMA 1NBWA 4DR6Q 2JA8H 1SE8A 1U0LA 1X65A 3D0FA 3K0XA 3G4SA 1P8LA 4PZ8A 1VQMA 4C3HH 4LNQA 1NY4A 2R6GA 4PZ7A 4DAMA 4L5SA 1HZ9A 2UU9L 4JYAL 3OYYA 3M9BA 4GOPC 1PYSB 4B3RL 4JI0Q 2BA1A 3L2PA 5LMNW 3UDIA 3HKZE 4XTCS 3HOXH 4GLAC 3CP0A 1HNXQ 2Z0SA 2EIFA 1YZ6A 2HIXA 1W3SA 3K7UC 5M5WH 1AE3A 3PO2G 4ME3A 1BBWA 4YY3L 3A5ZB 1JJCB 2PMZE 1QVFA 1KD1C 1XPUA 3CPFA 2JA6H 2IT1A 1IYJB 3KLWA 5ELNA 5HGQA 3GD7A 3PIOA 4DR2L 3GTGH 1Q86C 4JCVE 3OW2A 1CSQA 4KHZA 2NVXH 3HOUG 4XIGS 2K5HA 1IBKL 2R7DA 4OXPA 4DV7L 2LXJA 1S72A 1A63A 1LUZA 1EIFA 1E24A 1BVSA 3AFPA 1PYBA 3VDYA 1YJWA 4JI7L 4AH6A 2A8VA 2JEBI 4TVAB 2YU9H 1SRUA 4DV2L 3EIVA 2MQHA 2UU9Q 3HOZG 2DUDA 3U58A 4DAYB 4JYAQ 4B3RQ 2WAQG 4L5TA 4JC0A 2IX0A 4DK6C 2E5LL 3S16H 3M85A 5JJLA 3A0JA 4YHHL 4LF9L 3A5UA 3E0EA 4LFCL 4BBRH 4JI8L 1VQ9A 2VQFL 3PO3G 4YY3Q 2Y0SE 3TREA 4NPSA 2Q2UA 4JI3L 3BJUA 4TQUS 3GTQH 3HFZB 4BY7G 5FLMH 3KJPA 4DR2Q 4P75A 1K8AC 2VZAA 1YHBA 3I4NG 2GVBA 3ER0A 3BZKA 2Q2TA 5AJ3Q 1IBKQ 3RZOH 4DV7Q 3CCLA 1I5FA 3H0GG 3NENA 2HHHL 2K52A 1A62A 4DPGA 4HJ9A 4A3JG 3M4QA 1VQPA 4A3BG 3CXCA 3BZCA 2K4KA 1JJ2A 1SFOH 2E2JH 1SR3A 2B63G 3I4MH 1VQKA 1I94L 4A3DH 1AE2A 2N3SA 4JI7Q 1FL0A 4DV2Q 2UUCL 3HOVG 4DR7L 4A93G 1UE5A 1WI5A 2ALYB 1KAWA 1M1KC 1GO3E 3FHWA 1B8AA 4DUYL 2E5LQ 4A76A 4DR5L 2F52A 2OCEA 4YHHQ 1QZHA 4LF9Q 3AFQA 3CMAA 3RLNA 3JAMi 4LFCQ 1N33L 4QL5A 4JI8Q 3G71A 2VQFQ 3OTOL 2E8GA 2LXKA 4R4QA 2PQAB 1NMFA 5EAYA 1IBML 3BU2A 4JI3Q 4A3LH 5IYCH 3J81i 4DV1L 3S1MH 3CCRA 1VQ8A 4DV0Q 1B7YB 3GTPH 3ULPA 1AH9A 4EQ5A 4A3IG 1YBYA 4IFDJ 4HJ5A 5BR8L 2PNHA 4AYBG 2HHHQ 3HOWH 4A3GG 3S15H 3MEFA 2JA8G 2K5VA 1SLJA 1PH7A 2GVAA 1I94Q 4BY1H 3L7ZC 5C0XI 1H95A 3T1YL 1MJCA 1PH3A 5K36G 2D62A 2A1AA 1VQDA 2N8NA 2UUCQ 4JI5L 3PIPA 4DR7Q 1K3RA 4WJ3M 1CSPA 3STBD 4QGUA 2QA4A 5IYDG 4DUYQ 3HOXG 3CC4A 1VQ5A 4DR5Q 4NB3A 3RLFA 3STBC 3F2BA 4DV6L 4X65L 1YVCA 1D8LA 1C9OA 2B29A 1G291 2JQOA 3EBEA 5GQOA 1N33Q 4BBSH 5H1SE 1HNZL 4BA2I
chains in the Genus database with same CATH superfamily
4G7ZC 2FXQA 2F0TA 1IBMQ 1IL2A 3PCOB 5JEAJ 3J7ZC 1CHQD 4OIKA 4XT3B 4LUZA 2ID0A 4C3IB 1EYGA 1DOMA 1SNQA 1QUQA 2Z6KA 4QF4A 1K83H 3KK7A 1GUGA 5HY6A 3S24A 3M3YB 2NUCA 4NXMQ 5FLXc 4XQQA 3CCQA 1AW7A 5KNDA 4GNXB 4HSPA 3I2ZA 3ZJYC 5ISRA 3HOXB 4QUCA 1CQVA 2P5ZX 3TZUA 1V1QA 1ASZA 2XRSD 1KABA 2SNMA 1B44D 2BCOA 4U68A 4IPGA 1KDCA 5AJ3L 3D8GA 1NNXA 3KBGA 5BN3A 4X3KA 1Y8PB 1OXXK 2WKDA 3H15A 2RDFA 4HCEA 1HQMC 1V1PA 4HTHA 3BYTB 5D65A 1TS3A 1VS0A 1QVGA 1PZJD 4GNXC 5JPMC 5FOBB 5CMDA 2AQ1B 2D9UA 4A3KH 1WTWA 4CDFC 1TWGH 1I4QA 3GV6A 1D5ZC 2OF1A 1EIYB 3I4MG 1X56A 2B2TA 5C44H 2F0NA 5C4JH 2A6HC 2EPBA 2VUMH 3AYHB 3PO2H 2QW7A 3PV0A 1SE4A 1SYFA 4X66L 3QB3A 1FNWA 2F3VA 1GJXA 4FVMA 1K73C 4LJZC 2GA4B 2Z1CA 3OMGA 3NHHA 3A8IE 1MI2A 1DYQA 1WCMH 1MIUA 1LTAD 4XYQA 1HZBA 1OXVA 4QJFA 3D6WA 2E2JB 1KNAA 1SJHD 4A3DB 3WWVA 2L11A 2ZTEA 4EVOA 3CD6A 2WV6D 1LTGD 1SYCA 3D6CA 1X6OA 3TZDA 1PFMA 3HOZH 2RA4A 4FO2A 1O7ZA 4KY7A 5EBCA 2OQKA 4RGNA 1KAAA 4CKCA 2HD3A 5I4DA 4IO9A 5JJZA 3ICEA 1PHJA 1QILA 3A8JE 4YWKA 5G3LF 2K05A 4DAYA 4P74A 3IL8A 3KYHC 1K9MC 4OX9L 4R8IA 2VNUD 3UDGA 1DONA 4XXEA 4IUNA 4X66Q 3IFDA 2R61A 1Q82C 4C3IG 2M9VA 5DLQE 1H9RA 2JE6I 1GXDC 4JVZA 5COYA 1CKMA 3GTPB 1EY5A 4ZKBB 4C3HG 4LF5L 4JBJA 1V8QA 4JK1C 4RGOS 2EJMA 3KOJA 1G91A 1JOQA 2Q2HA 3ND9A 2RF4A 3BVZA 2ZTCA 1KRTA 1DOKA 2M2LA 2PI2E 3CF5A 1X54A 1CUKA 4P71A 4RCNA 4PMWA 4LUOA 3CMEA 3HOYG 5CV5A 1EU3A 4QY7A 1ASYA 1VQEA 3CU7A 2NWGA 4OX9Q 4DUZL 5HGTA 5EKIA 3SK5A 5C3EH 2CFMA 2PQAA 4KD4A 1JR0D 3DWQA 2R92G 3CKIB 1IL8A 1M4VA 5IGEA 1SEBD 4LF5Q 1D1KA 2FINB 3Q22A 2R93H 3K7AH 5ELDA 1JB7A 1Q8KA 4PV1C 1OTCA 1TVXA 2RCNA 3LWUA 1L0YB 4OGQC 1N8RC 1C8CA 1FJGL 2G9DA 2G5DA 4XT1B 1K8GA 1BBXC 4BWGB 4ZCKA 3UE1A 3I7FA 4ZUIA 5M5XB 2BH2A 1VCIA 1RHPA 1TXYA 3K59A 5M5YB 3DM1A 1F2MA 1V43A 4B3ML 4B9XA 1I6HH 4TRDA 4YCWA 4HMJA 2NZOA 2R7ZB 5JVG3 1ENFA 3M7GA 1VQGA 1WD0A 3RN2A 3M4PA 4DUZQ 2PI2A 2RSNA 3DWPA 2I5LX 1R9TH 1BKBA 1EQRA 5A2QL 3FKIG 5DNFA 1PFBA 5E7NA 3M7NA 2A19A 2XTIA 1YJ9A 1FJGQ 1TWAB 5DM63 2I46A 5C0XG 1DM0B 5CV8A 1TWHB 1G2TA 2KOLA 3NE5B 1EYCA 4GLVB 2QKIC 2ZTDA 4CBVA 1BCPF 4KMUC 4B3MQ 1UAPA 4A3LG 4YCUA 1WFQA 2NB0A 3OHXC 3TSSA 4QUFA 1MJEA 4EQOA 3V05A 1F2ZA 3HOUH 3H09A 4GN4B 1O78A 5DM73 2PW7A 3T13A 1E2ZA 3OWFA 1ZYRD 3HOWG 4O0AA 1LTBD 4GKJL 2EY2A 5E4XA 2KHJA 3DM3A 1N36L 4FXGC 3A56A 2AHOB 4KKTA 4DU9A 1JT8A 1EEFD 2XWJB 1Y1WB 3OPOA 2PZTA 1FD7D 1HQRD 1TIID 3CCVA 1I50H 1QOHA 1G51A 1Q1EA 1XMQL 5C4XG 3R93A 1L1OA 2J4XA 2XN9C 1PA6A 2IY5B 1K0SA 2CHBD 4UP8A 1WTOA 1EOTA 5M3FG 1SYGA 4DNRB 1IXRA 4IFDI 3HRZC 1JJGA 2F1MA 1W6KA 4K8IA 3S1MB 1VQIA 1UUPA 4IUUA 3I4NH 4DR3L 1AP0A 3E5SA 3L3OC 1I4XA 3S15B 1KHIA 3ITPA 4GKJQ 1PFSA 1N36Q 3VA5A 5M3MG 4IPCA 3E9HA 3TQYA 3QR8A 3CCUA 2F0OA 2XIWA 1L2FA 4XYOA 2IPKD 2QF7A 2RBMA 1SBBB 1I3QB 2YTXA 2L55A 1SDFA 3GTLB 2F0MA 2K28A 1E22A 4CDEC 2R7ZG 3C2PA 3H3VC 2NN6I 1YI2A 4GOPB 1ENAA 3CCSA 2Z4HA 4DR3Q 3TRZA 2TMPA 5KIXA 3SDZA 1K83B 1J9OA 1EFID 4C3IH 5I2YA 1NSNS 2HCCA 1SYBA 4MNOA 1TS5A 3M4OB 1HRJA 3AU7A 3TP5A 1S5DD 2NZ1D 1EWCA 3K0XA 3G4SA 4C3HH 1VMCA 1BQQT 3V96A 3S2HB 4GOPC 2NYZD 5LMNW 3L2PA 3UDIA 3SEBA 4XTCS 3HOXH 2IJ0A 3LNNA 4GLAC 1SSOA 3TP7A 3SXHA 3A8KE 3HEJA 4FF2A 4C1NI 2F0HA 3DEOA 1JJCB 1XPUA 2RQXA 3GD7A 1GHKA 3N52A 4JCVE 1D6EC 1IBKL 2OT2A 1SNDA 1TWGB 4OXPA 4CDCC 4V190 1TQOA 1E24A 2B2UC 2QDLA 4JI7L 5C4JB 2A8VA 2JEBI 4FF3A 4L5TA 2E2HB 1F2LA 4IUTA 4LFCL 1UNSA 4JI8L 1VQ9A 2WKCA 2Y0SE 4NPSA 2Q2UA 3J80E 4BY7G 4FXKC 5FLMH 4P75A 3C46A 3KLSX 3ER0A 1FR3A 1R4PB 4HCSA 1IBKQ 3CCLA 4KHVA 2RSOA 2WB1B 2E2JH 3TMEA 2MGSA 1VQKA 4A3DH 1S5CD 5J1ZA 5J22A 4JI7Q 2WAQB 4IN3A 3FVQA 2K32A 2R3ZA 1IW7C 1QZHA 1LABA 1ICWA 3RLNA 4CJ0B 3JAMi 1WTRA 1TT2A 1D1IA 2F0GA 4JI8Q 2BDNA 5EAYA 5ELCA 2EXZA 3VYRA 3BU2A 4A3LH 1CK1A 3J81i 1VQ8A 4DV0Q 1B7YB 5T1GA 3GTPH 3K0YA 4EQ5A 2O5JC 4AYBG 3HOWH 4OL7A 1TWFB 4G57A 3MEFA 2JA8G 2EYOA 3R8BA 3HOVB 3HP3A 5K36G 2D62A 2A73B 4KKSA 1WTHA 1K3RA 1PTOD 5C6AA 2L5TA 3F2UA 3STBC 4IURA 1CHPD 1G291 2JQOA 5C4XH 4XDXA 5H1SE 2AQ3B 5C3WA 1M8AA 1SNCA 4C2MB 4DR4L 5M3FH 3PF4A 2EQSA 1B70B 5KNCA 4HJ7A 5IGCA 5BN4A 3NQIA 1EOVA 2L15A 2JA7G 1O7LA 2AWOA 1CA5A 1PXUA 4BXXG 1Q46A 2DJGC 3CAMA 1KQSA 4L63B 3J81j 1TR5A 4PG3A 2JSOA 3GDEA 2JEAI 2ZXPA 2BH8A 1SMXA 3RD4A 2WACA 1PH4A 2CWPA 1PH6A 3I4OA 4RG1A 4HIDA 1GUWA 1U5KA 5M5XH 5M5YH 4GZYC 1MGSA 3Q8DA 5KEEA 1YHQA 4I7ZC 3RUZA 4G7OC 2D0PA 2F0VA 3I70A 5FJ8G 1ESFA 2R7ZH 4DR4Q 2A68C 2UXCL 3A55A 1LT6D 2WIIB 3GTGB 1Q81C 2LY7A 3FP9A 4R1JA 2NVXB 2KUMA 2QGQA 3U9OA 2IHEA 2Q2IA 2F4VL 3IRBA 2WB1G 3EQLC 3MZ5A 3KJOA 4JI4L 1RIPA 3KDFA 2A6ED 3T1HL 2PZWA 3MFGA 1YEZA 1MHWC 1DGSA 2SEBD 4ZYSA 2XVSA 1TWAH 2Z4IA 4FDBA 1YNJD 3KLSA 1TWHH 4DNIA 2LKVA 1EYAA 1YITA 5DAUA 5IE8A 3CRLC 1ILPA 4DFAA 1ET6A 4JV5L 3I90A 5JAVA 4G4KA 2UXCQ 5GROA 1CKOA 3DMUA 3W1GA 1BBUA 4UP7A 3FMCA 4K5XA 1V9PA 5IWAL 3PIO3 3FPUB 1HR0W 2F4VQ 4LFCQ 2HCIA 4DK0A 1Y1VG 5I9PA 3NP8A 4JI4Q 2B2WC 4LFBL 4K2KA 3T1HQ 3I4MB 1DCZA 1Y1WH 2IX3A 1A0IA 4BY1G 2HQEA 4M1UB 3RZDH 1L0XB 2WFWA 1GVPA 5TSSA 3UE0A 1Z6HA 1GD7A 5LL6S 1PH2A 1KL9A 1RODA 1U9RA 1HZCA 3CC7A 5LMUL 2K75A 4P72A 4QIWE 4IALA 3SHLA 2ENBA 3VA7A 1F9QA 2QEXA 4JV5Q 1EFWA 1XNQL 5I6WA 2MP1A 4HMIA 4A3MG 4PMBA 4K0KL 2KJXA 1RL2A 1EL0A 5IWAQ 1SJED 2JA9A 1VQBA 3PUXA 4NXML 3H3VH 1HUNA 4UDUC 2QDBA 1II3A 5GAEC 1EZ8A 1VQNA 5CV4A 1EZ6A 4LFBQ 4KLKA 1PRTD 4RKLA 3K5OA 5FKAC 2AQ2B 1I3QH 1X3QA 1HUMA 2F0WA 3GTLH 4A3FG 3CC2A 5IP9H 5LMUQ 1ILQA 2B39A 1HFGA 4GLXA 2A69D 1P16A 1PH1A 2UUBL 1XNQQ 1EQVA 4JI6L 1HA5A 3K5LA 1A15A 4K0KQ 2F3IA 1IKLA 4GN3B 4L5QA 4HJ8A 2UXDL 4C3HB 1WTVA 1WJJA 4R8NA 3M4OH 1HHVA 2MUYA 2ZM6L 1JORA 1KIXA 2N78A 3S2HH 4X64L 3JAML 1YIJA 1XXGA 2EY5A 1STEA 2PO4A 4J6HA 1XWEA 5K36H 4FF4A 3HOYB 3OOCA 3J7AF 2JA5G 1SNMA 3J81L 1BCPD 5JJIA 4J1MA 3VR3A 3HKZB 2KCNA 2BE5C 1S40A 1VF5C 2CCZA 3P20A 3GTMB 3R2IA 2UUBQ 2IHFA 4JI6Q 1UE6A 3WDNA 2PMZB 2R92B 1IKMA 3ULJA 1AZQA 2UXDQ 4RGTA 1RCVD 3MEHA 2JA7H 4DR1L 3VYTA 5IGGA 5IT9E 1GM5A 4BXXH 1CKNB 2ZM6Q 1X3FA 4X64Q 5JEAG 3KLRA 4UY8C 2E2HH 3CPWA 2ZXRA 1V1OA 2KEEA 1JC7A 3BYYB 3I72A 3I8ZA 4GNXA 1PH9A 5LL6X 1JMCA 1D7QA 1Q7YC 1E1TA 4Y7NH 5KNBA 1UE7A 2CW0C 5IYBG 5FJ8H 1UE1A 2DNEA 3K81C 2LSSA 4CHTB 2L0CA 4Y52H 1LM0A 3FKIB 2I0QA 1E3PA 2KENA 4IUVA 4N9TA 3AB9A 4DR1Q 3AQQA 4RGMA 3FRPB 2K6AA 3JAMc 4FYDA 1IYUA 4DV3L 2KCCA 2MPMA 2GN5A 4DV5L 2BDOA 3I56A 2FMCA 4DXGA 1ML0D 1JE4A 2Q8IB 1EY4A 5JVH3 2B2YC 3J81c 4BS9A 1LTID 1O7YA 5ELEA 4MTKA 1ZXTA 1H9MA 1CKNA 2UUAL 1KDAA 2D5DA 1TWCB 2AWNA 4OWXB 2H5XA 2NTTA 2ZJQA 3HOWB 2ES2A 3I55A 4FXDA 3BDOA 1EQTA 1HPCA 4UHVA 2OEOA 4H0LC 1TWFH 1ICFB 1QE6A 3MXGA 1Y1VH 3W5OA 3HOVH 2N49A 1QZGA 2N55A 2B63B 1NR2A 3H6MA 1GHJA 4DV3Q 1I4HA 4DV5Q 4DAVA 5C4XB 4A93B 1PZID 3H91A 5M3FB 1GOZA 3SR1A 3HKZG 4ZUJA 1PVOA 4Q5VA 1N9WA 2AKWB 2D0OA 4NW2A 1PTOC 2Q8TA 4C2MH 1LV9A 2UUAQ 1XJVA 2IW3A 1ZKOA 2MNAA 2EYFA 3MFYA 4IZ8A 2H1EA 1K8OA 4OONA 5M3MB 2KCMA 4YIJA 1NBWA 1UEAB 5DEHA 1U4PA 1X65A 3V2TA 2CQAA 4L5SA 2LMCB 4JYAL 1PYSB 4B3RL 3MTSA 1JB3A 1YNND 2HIXA 3WOFA 1AE3A 1WVLA 4ME3A 2Q8RE 3A5ZB 1AEXA 1KD1C 1PFNA 3CPFA 2F03A 1G2SA 4DA2A 3PIOA 3GTGH 1Q86C 1CSQA 2NVXH 1RTNA 5FLXE 4KN7C 1D5XC 2O4XA 1WTPA 2EYLA 4RWSC 1BVSA 2XWBB 3A54A 3VDYA 1YJWA 3EIVA 4JYAQ 4B3RQ 1QG7A 4DK6C 5JJLA 3A0JA 2RCFA 4LF9L 2QILA 4MIUA 4FF1A 1B3QA 1CM9A 3PO3G 2E2IB 3GTOB 5I9OA 5IGBA 1PMRA 3TREA 1S5ED 4JI3L 4TQUS 5CBEE 5D3IB 2VZAA 1YHBA 2K1BA 2RKSA 1EY9A 2K33A 3BZKA 2F0JA 1KTKA 3RZOH 1B50A 4KN4C 4H13C 4DPGA 4ZQ3A 4HJ9A 4A3BG 3CXCA 3RZDB 2B63G 3I4MH 1I94L 3NQTA 2UUCL 4A93G 2XNAC 2SDFA 4CJ1B 1UE5A 3UI2A 1KAWA 3FHWA 1B8AA 2F52A 1SAPA 4LF9Q 4QL5A 1NUCA 2KVMA 3OTOL 1STAA 4BY7B 2PNRC 1HTPA 1ET9A 2OXPA 4JI3Q 2K04A 2F3WA 3VR4A 4DV1L 1CZWA 1HTLD 3CCRA 1JOOA 3OWEB 1EIGA 3ULPA 1AH9A 4A3IG 1YBYA 4IFDJ 2PNHA 1STNA 2CVRA 1SNPA 1F2YA 4TSSA 1I94Q 2E2DC 3L7ZC 3QWNA 1H95A 3T1YL 1VQDA 2N8NA 2UUCQ 4JI5L 2DNCA 1B9NA 2F0KA 1CSPA 1SMYC 2PZUA 1H9SB 3CC4A 1FGBD 3NTHA 4G7HC 4NB3A 2CH4A 2EYJA 4X65L 1RKNA 2L12A 3WOEA 3C3LA 1HNZL 3OTOQ 5LMNL 2E74C 2HDMA 4NKLA 4X62L 4C1NK 2QCPX 4EGVA 3PUZA 3BVGA 4Z9CB 1XPRA 4DV1Q 3S1QB 2ZJPA 1JWSD 1U4MA 4AYBB 3AEVA 3H3VI 3NK9A 1T5EA 4WJ4A 1S4ZA 2YTVA 3ZYYX 3S9WA 2JA8B 1JWMD 3RR5A 4ULLA 3F2CA 3DXJC 3T1YQ 4RMFA 2NBFA 3KF6B 5J3BA 2K5NA 3RLOA 4JI5Q 3PSIA 4KI0A 4NP5A 3HOYH 3LGJA 2ZT9C 4Q0FA 3NELA 1WTXA 5M5WB 1YHAA 2L9HA 4X65Q 1X3PA 3NTKA 1DOLA 3RNUA 5K5PA 2EDGA 1HNZQ 3PUWA 5LMNQ 3PIP3 5M9OA 1N34L 1FNVA 3GTMH 1CTMA 4DNTB 4X62Q 2JA7B 2X69A 4PMCA 2YYZA 4RA8A 5KGUA 2R92H 4GOPA 1H9SA 4LF8L 1S3OA 2HIVA 4OO1G 1X55A 1YNXA 2EVBA 1DZ1A 1Y69U 4PQXA 2PW5A 4K5WA 5CV7A 4WJWA 1VQOA 3R3OA 1Y14B 4JBMA 1IBLL 3L0OA 2BA0A 2KHIA 2A6HD 3S16B 4Y7NB 5IODA 1HJPA 4BBRB 2F0QA 2R7FA 3ERSX 2PQEA 3MC0B 5FO9B 4DV0L 1EYDA 1JQYD 1LTLA 2JJQA 5EPLA 5BN5A 1N34Q 1BUVT 4A3EG 4B3SL 2NN6G 2B2UA 2WB1E 4K8JA 5IYCG 3P75A 1NTGA 1HFNA 2C9OA 4CKBA 2D2CC 4IJLA 3MVVA 2WAQE 3F2DA 4LF8Q 3FKIH 1I4PA 4IUQA 1QNUA 2VW9A 2K5QA 1LT4D 4JOIC 3K6OA 5C0XH 1TS4A 4HIOA 1W2BA 1IBLQ 1XNRL 3U4VA 3HS0C 2B2VC 3CCJA 4RKBA 5CBAE 3IAYA 4RFBA 2Z8LA 3I73A 1HZAA 1A2UA 2WINB 3BS1A 3C1FA 1JE5A 1BF4A 1TWCH 1E7ZA 4ZK9B 4B3SQ 1EY0A 4HAEA 3EVQA 1A8VA 3G48A 4UAIA 5FO7B 1Y1VB 1XPOA 5I6YA 3K8AA 1TS2A 1AZPA 2CQOA 1U4LA 1AN8A 4APVA 2JK8A 4HIMA 4MZ9A 4BY1B 3KUPA 4HN7A 4ODGA 1M90C 2B63H 4LUVA 5F2DA 4WFN3 4OWTB 2RVLA 1XNRQ 4A93H 1MD2D 5ELBA 1BXTA 5A2QE 3QG1A 4A3MB 3ND8A 2EE1A 4XQJA 2MFIA 2KQ3A 3EFXD 3NEMA 1WYDA 2EYPA 1OXTA 3GTJB 5M3MH 4IPHA 1FVIA 3A7LA 3FPPA 4A3IH 1Y8OB 4A3KG 2NVTH 3TN2A 2JYOA 2NVYB 2EY6A 1EWIA 1BOSA 2FJ2A 2NTSA 3PGZA 4AIMA 2F4IA 3KBXA 1RDPD 5C44G 4BBRG 4A3FB 1ONLA 3J7A5 3NBHB 1Q1BA 2OTJA 1J8IA 2O2LD 2OWOA 4E6IA 5IT9c 2MHVA 4ABNA 2FFKB 1VQJA 2I5HA 2VUMG 5KYIA 1WOCA 4EX5A 4WRDA 3K5NA 3MXNB 1L0WA 1VMPA 3URYA 3CQZB 4NDXA 3GQBA 2Y0SG 2Z9HA 4B9WA 4F8MA 3K57A 1WCMG 4KK7A 1CA6A 2BOSA 3MAQA 2A74C 4X3UA 1STGA 1EWHA 4OELB 5ELFA 4GKKL 2B8FA 1O7IA 3KF8B 3PF5A 1HR0L 2I5MX 5G3LD 3J80i 2JA5B 4IOAA 4FP5D 4R9WA 4JI2L 1A3VA 1W6JA 1KC8C 1KNEA 1IHZA 3K80C 2E2IH 3GTOH 2C5CA 1NMGA 2EZVA 2NVQB 3S2DB 2PYKA 1C0AA 3RZOB 3TS0A 1VQLA 4ALPA 4LF6L 3TP8A 3CRKC 1CQFA 4KHPL 4OHJA 1PH8A 4POGA 1ZYRC 1GUNA 1B2TA 1Y8NB 2IX1A 4OO1H 5EGTA 3DLLA 1JCKB 4GKKQ 3VR2A 3W1BA 2C35B 3O13A 3E0JA 1HR0Q 3MXNA 3ERQA 3MXPA 2TSSA 5IY0A 1R4QB 1VQ7A 4JI2Q 4BBSG 1ENCA 2F0PA 3T4AC 2IWHA 3NSWA 4BY7H 1G6PA 1GKHA 2B2WA 3S1NB 2AUKA 3BVMA 1QUQB 4YWLA 4YCVA 4LF6Q 3T56B 1XTCD 3OIPA 2KCTA 4A3EH 4LF7L 4KHPQ 3GTKH 5CV9A 2DJFC 5C3EG 4DR6L 4UPAA 3H0GB 3QOJA 3M4YA 4A3JB 4PZ6A 2R93G 4JPBW 3J7YW 5JJKA 2K14A 3MWYW 2Z6KC 2ATWA 4O42A 4QCLA 2L1BA 2RHSB 2F0SA 5AFWA 1SN8A 2Z6BA 1EY8A 2HQLA 2NZHA 3RN5A 3TS2A 2KA7A 1CZGA 1LYLA 2JXMB 3DHQA 5CC4A 1H9JA 5JPNC 2QEJC 4BA1I 3HKSA 3SE0A 3S1QH 4RAUC 4HR7B 4LF7Q 1NE3A 5T1IA 1IZ6A 1B3AA 4A3CG 1Z7TA 4CKEA 4OEMB 4DR6Q 2CH4W 2FMMA 3BG3A 2JA8H 1QNKA 1SE8A 1U0LA 3D0FA 1VQMA 5E4WC 3QIAA 4A3GB 4CDDC 4LNQA 1NY4A 2DY7A 2R6GA 4MHEA 4PZ7A 4DAMA 1QWYA 2J0TD 3OYYA 4QMGA 1F77A 1STYA 2BA1A 5C5MA 2KHSA 3HKZE 4ZKCB 2Z0SA 2EIFA 1W3SA 3K7UC 5M5WH 1TKWB 4IQZA 4DAPA 1BBWA 1PTOF 1B9MA 4KY5A 2PMZE 2B2TC 5ELNA 3KLWA 3N6RA 5HGQA 2J7ZA 4DR2L 1DD2A 3OW2A 1B4OA 3HOUG 1PYWD 3QJYA 2F0UA 4DV7L 1ESRA 5KRUA 1LUZA 3LX0A 1EIFA 3S17B 1QJOA 1BDOA 5C5LA 3OSOA 4AH6A 1SRUA 3MA2B 4M8AA 4DV2L 3VYUA 2DUDA 4DAYB 2EJGC 1B53A 4C3JG 3S16H 3M85A 4YHHL 4S3SA 3I3CA 4BBRH 2DN8A 5C4HA 3J7AV 5EQ0A 1E2VA 3BJUA 3GTQH 3HFZB 3KJPA 4DR2Q 4CJ2C 1K8AC 3I4NG 5AJ3Q 1A3TA 1BO0A 1LTRD 4DV7Q 3H0GG 2HHHL 3NENA 4ME5A 4A3JG 4J8QA 3M4QA 1VQPA 1JJ2A 2K4KA 1Q90A 2N3SA 1FL0A 4DV2Q 3I91A 3HZXA 4IUPA 1WI5A 2ALYB 4K2LA 1IW7D 1I4RA 5IIFA 1M1KC 1TY2A 5FK9C 4DR5L 2OCEA 4YHHQ 3PO3B 3AFQA 2LFNA 1N33L 3G71A 4H7BA 1HCZA 2LXKA 4R4QA 2PQAB 5IGFA 4F7XA 4I65A 1U4RA 1XYIA 1KLGD 2H4OA 2F0FA 3EA6A 1PTOB 3R2TA 3SVMA 1CFMA 2DY8A 1EIHA 4A3BB 3H94A 5BR8L 2HHHQ 4A3GG 3J80L 2B2YA 1Q3LA 1PH7A 4BY1H 4TKOB 5C0XI 5L37A 2A1AA 3SK6A 4XQNA 1HXYD 3GV3A 3STBD 4H44C 2QA4A 5IYDG 3HOXG 1DXMA 4DR5Q 3RLFA 3F2BA 4DV6L 1D8LA 1H9KA 3TDQA 1N33Q 4BBSH 5IOCA 4BA2I 4B3TL 4A3MH 4DK3C 4LFAL 1X9NA 1HNWL 1J5EL 5CV6A 5C0XJ 2L4NA 1F9SA 4A3IB 1RTOA 2JN4A 3GTJH 2NVTB 1VQAA 2XGTA 2UXBL 3GO5A 5BR8Q 3TBIB 3QO2A 3U9SA 4F87A 4ILWA 1VQFA 1G6ZA 4MN3A 3T16A 2NVYH 1Z47A 2G9HD 2DGYA 3DEPA 4KY6A 1PRTF 2F0LA 4A3FH 1N32L 4R4OA 3PUVA 4N8FA 4DV6Q 1K0RA 4UP9A 4KD3A 2A68D 2RHQB 5IP7G 2JA6B 1OO9B 4R4IA 4B3TQ 4LFAQ 4DN4M 1J5EQ 1HNWQ 4R4TA 4U673 1EEID 5FLMG 3CQZH 3U4ZA 3S14H 2CWAA 4IOCA 3P1HA 4P73A 2UXBQ 1DJRD 1LACA 1SYDA 3J80c 3G6EA 4A3CH 2VL6A 2MO0A 2A6EC 5CR3A 2YU9B 1L1OB 2CKZB 2EOTA 4A3DG 4LWCA 3D31A 3F8TA 2JA5H 1FYCA 1N32Q 1YNJC 2OTLA 4HJAA 1VDZA 4C56C 5KYLA 2HT1A 4R4CA 1A6XA 2EYMA 2NVQH 3S2DH 3ULLA 4IJHA 4K6LA 1XMOL 4RHSA 2K7VA 1L1OC 5GAGC 1HH2P 1MSHA 1SXTA 2YV5A 2N88A 2V1CC 4J15A 5NUCA 3U50C 1SFOB 3NWTA 4DXFA 3TEHB 3X3MA 5JEAH 4JBWA 3SGIA 3S1RH 2K5WA 1QVCA 2VS1A 3MXUA 4C3JH 3CCEA 5CGKA 4QQBX 1AFPA 3VR6A 3W2DA 2MO1A 5EKLA 5C3XA 1PRTB 4A3EB 5IYBH 3PUYA 3GTKB 3S1NH 4DV4L 4KV6A 2XSCA 1JOKA 2O5IC 1XMOQ 4WORA 3UDFA 3JAME 4ZLTF 4LF4L 1Q8IA 1NJIC 2F0IA 4GS3A 4OO1I 3H0GH 2E75C 3EROA 3A7AB 3D4WA 3NTIA 3J81E 4AQYL 4A3JH 1ZEQX 2F0DA 3VR5A 1VQCA 3F1ZA 1PRTC 3Q24A 1FGUA 3ONAB 1UEBA 2I07B 4NMZA 1EY6A 4JBKA 1VQHA 3GP7A 4DF7A 1UWVA 1MKHA 1I6VC 2JA6G 4O1NA 3K58A 4O2DA 1LLRD 1LTTD 3A74A 2EYHA 1S5FD 4AYBE 4EQPA 4JG2A 1XMQQ 3SK4A 1LTSD 3UDXA 4DV4Q 2IL8A 3D3RA 2A69C 2A5HA 4LF4Q 3FDTA 4POFA 4MTNA 1YJNA 1BCPB 3CHBD 2YTYA 2RDHA 4L5RC 4A3GH 2K5DA 4GN5A 4AQYQ 2M00A 4H02A 5FO8B 1C48A 5LHY1 3M3YH 2EY1A 2EXDA 2VXWA 1STBA 2K03A 4IFDG 5IYDH 4X3TA 2BE5D 1CT1D 5EPKA 2FHTA 2SOBA 1BCPC 3NBIA 3I4LA 5E1FA 3E9IA 4N8X1 4JI1L 4HIKA 1VQ4A 1GUSA 1STHA 5C4ZA 1O80A 1A2TA 1KXLA 2AMCB 4RHRA 4X6AH 4A3KB 3S17H 1XX8A 1K8MA 1E2WA 4P2CB 5GADC 1KRSA 3CCMA 4IPDA 2X6LA 1WD1A 1EY7A 3CW2C 5GAHC 5C44B 1Y1WG 4NXNL 2VB3X 3C1EA 5HURA 3PMFA 1KDBA 1SNOA 3LWEA 3OIQA 2JP1A 5CORA 5JOBA 3GTQB 1E1OA 2VY3A 2B3GA 3KF6A 2WP8J 2VUMB 1X3GA 1X3EA 2KECA 3D4RA 3PO2B 5EBDA 2CW0D 3IKJA 5IP7H 4LW1A 2ZJRA 3MHBA 4JI1Q 1RD9D 1PZKD 2Y0SB 2ZXOA 5CYUA 1Z9FA 2OQ0A 4K5VA 4RCOA 4CGYB 3NPPA 1WCMB 4KKUA 5D14A 2MJ8A 1J6QA 1T5XD 1IYVA 3B6YA 4N9PA 1PDQA 1OXSC 1EUJA 5ELOA 3SK8A 4ID6A 1X32A 5A35A 4NXNQ 1QB5D 1C4QA 3HOZB 3Q23A 2LS01 2K01A 2K50A 5IT9L 1EQQA 1MSGA 3PO3H 1K28A 4FNFA 3JC66 3HGBA 1MBYA 3L9AX 1PV4A 4LMQD 5IP9G 3KFUA 3AMUA 2VQEL 2HUGA 4ZRZA 4HEDA 4QB4A 3FEWX 1PTOH 4HSVA 1SE3A 3HG9A 4JOIA 1OXUA 4A4IA 4X3SA 3PQIA 4A3BH 2B2VA 3EN2A 3EJIA 3T53B 1Q12A 2X6GA 4A75A 2ICEC 4JI0L 1TY0A 5J39A 1T9HA 2E76C 2ASBA 4BBSB 2V4DA 3Q0AA 1HA6A 1HNXL 5EJWA 1LT3D 1VQ6A 1PH5A 4DKAC 1SROA 1C7YA 2F0EA 4YWMA 1A3UA 3KDFB 2VQEQ 4LAAA 3G6JB 2KBNA 3K5MA 5C3EB 1XTDA 4OWWB 2XRQD 1D5MC 2B8GA 3TP6A 2R93B 3K7AB 1P8LA 4PZ8A 4RH6A 4ZAIA 1HZ9A 4DK1A 2UU9L 3M9BA 4JI0Q 2EJFC 3E6ZX 1LO5D 4KJNA 4OIJA 3EBEA 2PPBC 3CP0A 1HNXQ 4LK1C 1RJTA 1YZ6A 3QOLA 1YNNC 5EPJA 3PO2G 1KLUD 4YY3L 1I6HB 1K3BC 1QVFA 2JA6H 2IT1A 1IYJB 3S14B 3P7JA 4K14A 1F9PA 1SE2A 4KHZA 4L6TB 4XIGS 2K5HA 2R7DA 1JICA 5IGDA 2LXJA 1R9TB 2HDLA 1S72A 1A63A 3AFPA 4EQNA 1PYBA 1NR4A 1FNUA 5EKKA 1F9RA 4TVAB 2YU9H 3HOZG 2MQHA 4B08A 2UU9Q 3U58A 3BDCA 2WAQG 4JC0A 2IX0A 2E5LL 3D4DA 3A5UA 3E0EA 2VQFL 2SNSA 3E3XA 4YY3Q 1E0BA 1TU2B 4L8JA 4IFDH 1QCBD 3HOUB 1BR9A 3NBHA 1I4GA 3DUZA 2GVBA 2Q2TA 3VYSA 3IFTA 4V0BA 1I5FA 2K52A 1A62A 2KEDA 4I7AA 3BZCA 4KTAA 1SFOH 1SR3A 4JW0A 1AE2A 3S1RB 1I50B 3HOVG 4DR7L 2ICIA 4C3JB 5FLXL 5I2XA 1CI3M 1WTQA 1LT5D 1GO3E 2E5LQ 4DUYL 4A76A 2AUJD 2PCFB 3KF8A 2RDGA 3CMAA 1PLFA 4KJOA 1JWUD 2VQFQ 4PNYA 2E8GA 1D2BA 1IBML 1NMFA 2NN6H 3I4NB 3NWSA 3X3NA 1SYEA 1BNZA 3T51B 5IYCH 1VF7A 3S1MH 5D3DA 1RF2D 3BDLA 4QIWB 3OMCA 4HJ5A 4F88A 1G8ZD 3S15H 3BZDB 4DGZA 3RMHA 3DWAA 2K5VA 1SLJA 2GVAA 1S5BD 1GUOA 5E3FA 1MJCA 1PH3A 1EU4A 3OW7A 4DR7Q 1NAPA 3PIPA 1SMYD 3Q6SA 1V1PB 4WJ3M 3W3AA 1GUTA 4QGUA 4DUYQ 3G7LA 1NCVA 1VQ5A 2VB2X 1YVCA 1C9OA 2B29A 1B1ZA 4K6DA 3NUCA 5GQOA 3NXWA
chains in the Genus database with same CATH topology
3OTOQ 5LMNL 2FXQA 1IBMQ 4B3TL 4A3MH 4DR4L 4DK3C 5M3FH 4LFAL 1IL2A 1X9NA 3PF4A 1HNWL 3PCOB 1J5EL 2EQSA 4X62L 1B70B 4HJ7A 5JEAJ 3J7ZC 5C0XJ 3PUZA 1XPRA 4DV1Q 4LUZA 1EOVA 2ID0A 2ZJPA 3GTJH 3AEVA 1VQAA 2L15A 3H3VI 2JA7G 2AWOA 2XGTA 4BXXG 1Q46A 1EYGA 4WJ4A 2UXBL 3GO5A 3CAMA 5BR8Q 2YTVA 1QUQA 2Z6KA 1KQSA 1K83H 3RR5A 3J81j 3F2CA 5HY6A 4PG3A 1VQFA 3S24A 3GDEA 2JEAI 2NVYH 2BH8A 1SMXA 4NXMQ 5FLXc 1Z47A 3CCQA 3T1YQ 1PH4A 4RMFA 3KF6B 5J3BA 2DGYA 2CWPA 4GNXB 1PH6A 3I4OA 2K5NA 3I2ZA 4RG1A 3RLOA 3PSIA 3ZJYC 4KI0A 4HIDA 4JI5Q 1U5KA 1V1QA 5M5XH 4A3FH 4R4OA 1ASZA 3LGJA 3HOYH 3PUVA 1N32L 5M5YH 3NELA 1YHAA 4DV6Q 3Q8DA 1K0RA 4UP9A 4X65Q 4IPGA 1YHQA 3RNUA 2D0PA 5AJ3L 2RHQB 5IP7G 3PUWA 5FJ8G 5LMNQ 1HNZQ 4R4IA 2R7ZH 4B3TQ 4DR4Q 2UXCL 4LFAQ 1N34L 3GTMH 1OXXK 1HNWQ 1J5EQ 1Q81C 4R4TA 4X62Q 3FP9A 4R1JA 3H15A 5FLMG 2QGQA 3CQZH 2IHEA 2Q2IA 2YYZA 3U4ZA 2F4VL 1VS0A 2R92H 4GOPA 1QVGA 2CWAA 3IRBA 4GNXC 4IOCA 4P73A 4LF8L 2WB1G 1S3OA 2HIVA 3KJOA 4JI4L 1RIPA 1X55A 3KDFA 4OO1G 3J80c 4A3KH 2UXBQ 1YNXA 3G6EA 4A3CH 3T1HL 2VL6A 2MO0A 1TWGH 1YEZA 1L1OB 1EIYB 2CKZB 1DGSA 3I4MG 1VQOA 4A3DG 4LWCA 1X56A 1Y14B 1TWAH 3D31A 5C44H 4JBMA 1IBLL 3F8TA 2BA0A 2KHIA 3L0OA 4FDBA 2JA5H 5C4JH 1TWHH 4DNIA 1N32Q 2OTLA 1YITA 4HJAA 1HJPA 5IE8A 2HT1A 2R7FA 3ERSX 2VUMH 4R4CA 3AYHB 4JV5L 3PO2H 2NVQH 4DV0L 3ULLA 3S2DH 3PV0A 1LTLA 2JJQA 4X66L 4IJHA 4B3SL 5GROA 4A3EG 1N34Q 2UXCQ 2NN6G 1CKOA 1XMOL 1K73C 3W1GA 1BBUA 4UP7A 2WB1E 1V9PA 5GAGC 1L1OC 5IWAL 1HH2P 5IYCG 2F4VQ 1HR0W 1NTGA 1WCMH 1MIUA 4IJLA 2YV5A 1HZBA 1OXVA 2WAQE 3F2DA 1Y1VG 3FKIH 4QJFA 4JI4Q 4LF8Q 4LFBL 2V1CC 4J15A 3U50C 2VW9A 3T1HQ 3TEHB 1Y1WH 4JOIC 3WWVA 2ZTEA 3CD6A 1A0IA 4JBWA 4BY1G 4HIOA 1X6OA 3SGIA 3RZDH 1W2BA 1IBLQ 1XNRL 3U4VA 3HOZH 2WFWA 3S1RH 2OQKA 1GVPA 1QVCA 2VS1A 3CCJA 3ICEA 4IO9A 3UE0A 1GD7A 1PHJA 4YWKA 4C3JH 3CCEA 1PH2A 1KL9A 4QQBX 1HZAA 1HZCA 3CC7A 2MO1A 4P74A 2K75A 4P72A 5LMUL 3KYHC 1K9MC 4OX9L 4QIWE 4JV5Q 2VNUD 5IYBH 1JE5A 2QEXA 3PUYA 3UDGA 1EFWA 1TWCH 1E7ZA 1XNQL 4DV4L 4X66Q 3S1NH 1Q82C 4B3SQ 4A3MG 5DLQE 5C4XH 1XMOQ 4K0KL 1RL2A 2JE6I 3UDFA 5IWAQ 1A8VA 3G48A 1XPOA 4LF4L 2JA9A 1CKMA 1VQBA 3PUXA 3K8AA 4NXML 3H3VH 2CQOA 1NJIC 4GS3A 4OO1I 4LF5L 4JBJA 4APVA 5GAEC 1VQNA 3H0GH 4LFBQ 3KOJA 2JK8A 4HIMA 4MZ9A 4A3JH 4KLKA 4AQYL 2Q2HA 1VQCA 2B63H 1M90C 2RF4A 3F1ZA 4LUVA 2ZTCA 1KRTA 1FGUA 4OWTB 2PI2E 1I3QH 1UEBA 3CF5A 1XNRQ 4JBKA 4A93H 3GTLH 1VQHA 1X54A 1CUKA 4P71A 1UWVA 1MKHA 4PMWA 4LUOA 3CMEA 4A3FG 3CC2A 3HOYG 2JA6G 4O2DA 4QY7A 5IP9H 1ASYA 1VQEA 3A74A 5LMUQ 4AYBE 4OX9Q 4JG2A 4GLXA 1XMQQ 1PH1A 1P16A 2UUBL 3UDXA 1XNQQ 4DV4Q 4JI6L 2MFIA 4DUZL 3S14H 3NEMA 4K0KQ 1WYDA 2F3IA 4GN3B 4L5QA 4HJ8A 5C3EH 1OXTA 2CFMA 4LF4Q 2PQAA 2UXDL 4POFA 5M3MH 4MTNA 4IPHA 1FVIA 1YJNA 2R92G 1WJJA 3M4OH 2YTYA 4LF5Q 4A3IH 4L5RC 3K7AH 4A3KG 2NVTH 4A3GH 2R93H 2ZM6L 1JB7A 1EWIA 1KIXA 4GN5A 1Q8KA 4AQYQ 1OTCA 2N78A 2RCNA 3S2HH 3PGZA 4H02A 4X64L 1N8RC 1FJGL 4AIMA 1YIJA 1K8GA 3UE1A 3I7FA 3M3YH 2EXDA 4BBRG 5C44G 2BH2A 1VCIA 3J7A5 1TXYA 3NBHB 1Q1BA 2JA5G 2OTJA 1V43A 4B3ML 4IFDG 2OWOA 5IYDH 5JJIA 1I6HH 4YCWA 5IT9c 1VQJA 2NZOA 2I5HA 2VUMG 1S40A 2CCZA 1VQGA 1WOCA 2UUBQ 4EX5A 2IHFA 3E9IA 3M4PA 3RN2A 4JI1L 3MXNB 4JI6Q 1UE6A 1L0WA 4DUZQ 4HIKA 1VQ4A 2PI2A 3ULJA 2UXDQ 2Y0SG 2I5LX 1KXLA 2AMCB 1R9TH 1BKBA 4X6AH 1EQRA 1WCMG 3S17H 2JA7H 4DR1L 1GM5A 4BXXH 3FKIG 5GADC 1KRSA 3CCMA 4IPDA 1CKNB 5E7NA 2ZM6Q 4GKKL 3KF8B 1O7IA 1X3FA 3PF5A 2A19A 1HR0L 2XTIA 3M7NA 1YJ9A 4X64Q 2I5MX 3CW2C 5GAHC 1Y1WG 1FJGQ 4NXNL 5JEAG 4UY8C 2E2HH 5C0XG 3J80i 3CPWA 4IOAA 4JI2L 4GLVB 2ZTDA 1E1OA 2VY3A 1KC8C 4B3MQ 2B3GA 3KF6A 2WP8J 4GNXA 3K80C 1PH9A 1JMCA 1X3GA 2E2IH 3GTOH 1X3EA 1WFQA 1E1TA 1NMGA 4YCUA 1Q7YC 1MJEA 1D7QA 1C0AA 4Y7NH 3TS0A 1VQLA 3HOUH 4ALPA 1UE7A 5IP7H 4LW1A 5FJ8H 4GN4B 5IYBG 2ZJRA 4LF6L 1UE1A 4JI1Q 4KHPL 3K81C 2LSSA 1Z9FA 2OQ0A 4O0AA 3HOWG 4GKJL 4Y52H 1PH8A 4POGA 1LM0A 2KHJA 3DM3A 2I0QA 1E3PA 1N36L 2KENA 2AHOB 2IX1A 1J6QA 4DR1Q 1JT8A 3DLLA 3B6YA 3AQQA 3JAMc 4GKKQ 3W1BA 2C35B 3CCVA 1OXSC 1EUJA 5ELOA 1I50H 1HR0Q 4DV3L 4NXNQ 2GN5A 4DV5L 3I56A 5IY0A 1G51A 1Q1EA 1VQ7A 4JI2Q 2K50A 1EQQA 3J81c 1XMQL 4BBSG 3PO3H 1L1OA 1PA6A 2IY5B 5C4XG 4UP8A 3JC66 5M3FG 1IXRA 1PV4A 4IFDI 1JJGA 4BY7H 1VQIA 1CKNA 5IP9G 2UUAL 1G6PA 1GKHA 2AWNA 3I4NH 3KFUA 4OWXB 2VQEL 2H5XA 4DR3L 2ZJQA 1QUQB 4YWLA 4YCVA 4LF6Q 2ES2A 1KHIA 4JOIA 3I55A 2KCTA 4A3EH 4LF7L 4KHPQ 3GTKH 1OXUA 4A4IA 4GKJQ 5C3EG 1PFSA 4A3BH 4DR6L 3EN2A 4UPAA 1N36Q 5M3MG 1TWFH 1Y1VH 3W5OA 1Q12A 4IPCA 3E9HA 3TQYA 4PZ6A 4A75A 3HOVH 4A3LG 2N49A 3CCUA 1QZGA 2R93G 1L2FA 4JI0L 5JJKA 1T9HA 4DV3Q 2K14A 2ASBA 2YTXA 4DV5Q 2Z6KC 1HNXL 2ATWA 2RHSB 1SN8A 1VQ6A 3HKZG 1E22A 2HQLA 2NZHA 1PH5A 4DKAC 2R7ZG 1SROA 3RN5A 1PVOA 3TS2A 1C7YA 1N9WA 2AKWB 2NN6I 2D0OA 4GOPB 1YI2A 1LYLA 4C2MH 4YWMA 2UUAQ 3CCSA 1XJVA 3KDFB 4DR3Q 2VQEQ 3TRZA 4BA1I 3HKSA 3S1QH 2KBNA 2MNAA 4C3IH 4LF7Q 1NE3A 1XTDA 1IZ6A 4OONA 4MNOA 4OWWB 4A3CG 2KCMA 1NBWA 4DR6Q 2JA8H 1SE8A 1U0LA 1X65A 3D0FA 3K0XA 3G4SA 1P8LA 4PZ8A 1VQMA 4C3HH 4LNQA 1NY4A 2R6GA 4PZ7A 4DAMA 4L5SA 1HZ9A 2UU9L 4JYAL 3OYYA 3M9BA 4GOPC 1PYSB 4B3RL 4JI0Q 2BA1A 3L2PA 5LMNW 3UDIA 3HKZE 4XTCS 3HOXH 4GLAC 3CP0A 1HNXQ 2Z0SA 2EIFA 1YZ6A 2HIXA 1W3SA 3K7UC 5M5WH 1AE3A 3PO2G 4ME3A 1BBWA 4YY3L 3A5ZB 1JJCB 2PMZE 1QVFA 1KD1C 1XPUA 3CPFA 2JA6H 2IT1A 1IYJB 3KLWA 5ELNA 5HGQA 3GD7A 3PIOA 4DR2L 3GTGH 1Q86C 4JCVE 3OW2A 1CSQA 4KHZA 2NVXH 3HOUG 4XIGS 2K5HA 1IBKL 2R7DA 4OXPA 4DV7L 2LXJA 1S72A 1A63A 1LUZA 1EIFA 1E24A 1BVSA 3AFPA 1PYBA 3VDYA 1YJWA 4JI7L 4AH6A 2A8VA 2JEBI 4TVAB 2YU9H 1SRUA 4DV2L 3EIVA 2MQHA 2UU9Q 3HOZG 2DUDA 3U58A 4DAYB 4JYAQ 4B3RQ 2WAQG 4L5TA 4JC0A 2IX0A 4DK6C 2E5LL 3S16H 3M85A 5JJLA 3A0JA 4YHHL 4LF9L 3A5UA 3E0EA 4LFCL 4BBRH 4JI8L 1VQ9A 2VQFL 3PO3G 4YY3Q 2Y0SE 3TREA 4NPSA 2Q2UA 4JI3L 3BJUA 4TQUS 3GTQH 3HFZB 4BY7G 5FLMH 3KJPA 4DR2Q 4P75A 1K8AC 2VZAA 1YHBA 3I4NG 2GVBA 3ER0A 3BZKA 2Q2TA 5AJ3Q 1IBKQ 3RZOH 4DV7Q 3CCLA 1I5FA 3H0GG 3NENA 2HHHL 2K52A 1A62A 4DPGA 4HJ9A 4A3JG 3M4QA 1VQPA 4A3BG 3CXCA 3BZCA 2K4KA 1JJ2A 1SFOH 2E2JH 1SR3A 2B63G 3I4MH 1VQKA 1I94L 4A3DH 1AE2A 2N3SA 4JI7Q 1FL0A 4DV2Q 2UUCL 3HOVG 4DR7L 4A93G 1UE5A 1WI5A 2ALYB 1KAWA 1M1KC 1GO3E 3FHWA 1B8AA 4DUYL 2E5LQ 4A76A 4DR5L 2F52A 2OCEA 4YHHQ 1QZHA 4LF9Q 3AFQA 3CMAA 3RLNA 3JAMi 4LFCQ 1N33L 4QL5A 4JI8Q 3G71A 2VQFQ 3OTOL 2E8GA 2LXKA 4R4QA 2PQAB 1NMFA 5EAYA 1IBML 3BU2A 4JI3Q 4A3LH 5IYCH 3J81i 4DV1L 3S1MH 3CCRA 1VQ8A 4DV0Q 1B7YB 3GTPH 3ULPA 1AH9A 4EQ5A 4A3IG 1YBYA 4IFDJ 4HJ5A 5BR8L 2PNHA 4AYBG 2HHHQ 3HOWH 4A3GG 3S15H 3MEFA 2JA8G 2K5VA 1SLJA 1PH7A 2GVAA 1I94Q 4BY1H 3L7ZC 5C0XI 1H95A 3T1YL 1MJCA 1PH3A 5K36G 2D62A 2A1AA 1VQDA 2N8NA 2UUCQ 4JI5L 3PIPA 4DR7Q 1K3RA 4WJ3M 1CSPA 3STBD 4QGUA 2QA4A 5IYDG 4DUYQ 3HOXG 3CC4A 1VQ5A 4DR5Q 4NB3A 3RLFA 3STBC 3F2BA 4DV6L 4X65L 1YVCA 1D8LA 1C9OA 2B29A 1G291 2JQOA 3EBEA 5GQOA 1N33Q 4BBSH 5H1SE 1HNZL 4BA2I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OTO Q;  5LMN L;  2FXQ A;  1IBM Q;  4B3T L;  4A3M H;  4DR4 L;  4DK3 C;  5M3F H;  4LFA L;  1IL2 A;  1X9N A;  3PF4 A;  1HNW L;  3PCO B;  1J5E L;  2EQS A;  4X62 L;  1B70 B;  4HJ7 A;  5JEA J;  3J7Z C;  5C0X J;  3PUZ A;  1XPR A;  4DV1 Q;  4LUZ A;  1EOV A;  2ID0 A;  2ZJP A;  3GTJ H;  3AEV A;  1VQA A;  2L15 A;  3H3V I;  2JA7 G;  2AWO A;  2XGT A;  4BXX G;  1Q46 A;  1EYG A;  4WJ4 A;  2UXB L;  3GO5 A;  3CAM A;  5BR8 Q;  2YTV A;  1QUQ A;  2Z6K A;  1KQS A;  1K83 H;  3RR5 A;  3J81 j;  3F2C A;  5HY6 A;  4PG3 A;  1VQF A;  3S24 A;  3GDE A;  2JEA I;  2NVY H;  2BH8 A;  1SMX A;  4NXM Q;  5FLX c;  1Z47 A;  3CCQ A;  3T1Y Q;  1PH4 A;  4RMF A;  3KF6 B;  5J3B A;  2DGY A;  2CWP A;  4GNX B;  1PH6 A;  3I4O A;  2K5N A;  3I2Z A;  4RG1 A;  3RLO A;  3PSI A;  3ZJY C;  4KI0 A;  4HID A;  4JI5 Q;  1U5K A;  1V1Q A;  5M5X H;  4A3F H;  4R4O A;  1ASZ A;  3LGJ A;  3HOY H;  3PUV A;  1N32 L;  5M5Y H;  3NEL A;  1YHA A;  4DV6 Q;  3Q8D A;  1K0R A;  4UP9 A;  4X65 Q;  4IPG A;  1YHQ A;  3RNU A;  2D0P A;  5AJ3 L;  2RHQ B;  5IP7 G;  3PUW A;  5FJ8 G;  5LMN Q;  1HNZ Q;  4R4I A;  2R7Z H;  4B3T Q;  4DR4 Q;  2UXC L;  4LFA Q;  1N34 L;  3GTM H;  1OXX K;  1HNW Q;  1J5E Q;  1Q81 C;  4R4T A;  4X62 Q;  3FP9 A;  4R1J A;  3H15 A;  5FLM G;  2QGQ A;  3CQZ H;  2IHE A;  2Q2I A;  2YYZ A;  3U4Z A;  2F4V L;  1VS0 A;  2R92 H;  4GOP A;  1QVG A;  2CWA A;  3IRB A;  4GNX C;  4IOC A;  4P73 A;  4LF8 L;  2WB1 G;  1S3O A;  2HIV A;  3KJO A;  4JI4 L;  1RIP A;  1X55 A;  3KDF A;  4OO1 G;  3J80 c;  4A3K H;  2UXB Q;  1YNX A;  3G6E A;  4A3C H;  3T1H L;  2VL6 A;  2MO0 A;  1TWG H;  1YEZ A;  1L1O B;  1EIY B;  2CKZ B;  1DGS A;  3I4M G;  1VQO A;  4A3D G;  4LWC A;  1X56 A;  1Y14 B;  1TWA H;  3D31 A;  5C44 H;  4JBM A;  1IBL L;  3F8T A;  2BA0 A;  2KHI A;  3L0O A;  4FDB A;  2JA5 H;  5C4J H;  1TWH H;  4DNI A;  1N32 Q;  2OTL A;  1YIT A;  4HJA A;  1HJP A;  5IE8 A;  2HT1 A;  2R7F A;  3ERS X;  2VUM H;  4R4C A;  3AYH B;  4JV5 L;  3PO2 H;  2NVQ H;  4DV0 L;  3ULL A;  3S2D H;  3PV0 A;  1LTL A;  2JJQ A;  4X66 L;  4IJH A;  4B3S L;  5GRO A;  4A3E G;  1N34 Q;  2UXC Q;  2NN6 G;  1CKO A;  1XMO L;  1K73 C;  3W1G A;  1BBU A;  4UP7 A;  2WB1 E;  1V9P A;  5GAG C;  1L1O C;  5IWA L;  1HH2 P;  5IYC G;  2F4V Q;  1HR0 W;  1NTG A;  1WCM H;  1MIU A;  4IJL A;  2YV5 A;  1HZB A;  1OXV A;  2WAQ E;  3F2D A;  1Y1V G;  3FKI H;  4QJF A;  4JI4 Q;  4LF8 Q;  4LFB L;  2V1C C;  4J15 A;  3U50 C;  2VW9 A;  3T1H Q;  3TEH B;  1Y1W H;  4JOI C;  3WWV A;  2ZTE A;  3CD6 A;  1A0I A;  4JBW A;  4BY1 G;  4HIO A;  1X6O A;  3SGI A;  3RZD H;  1W2B A;  1IBL Q;  1XNR L;  3U4V A;  3HOZ H;  2WFW A;  3S1R H;  2OQK A;  1GVP A;  1QVC A;  2VS1 A;  3CCJ A;  3ICE A;  4IO9 A;  3UE0 A;  1GD7 A;  1PHJ A;  4YWK A;  4C3J H;  3CCE A;  1PH2 A;  1KL9 A;  4QQB X;  1HZA A;  1HZC A;  3CC7 A;  2MO1 A;  4P74 A;  2K75 A;  4P72 A;  5LMU L;  3KYH C;  1K9M C;  4OX9 L;  4QIW E;  4JV5 Q;  2VNU D;  5IYB H;  1JE5 A;  2QEX A;  3PUY A;  3UDG A;  1EFW A;  1TWC H;  1E7Z A;  1XNQ L;  4DV4 L;  4X66 Q;  3S1N H;  1Q82 C;  4B3S Q;  4A3M G;  5DLQ E;  5C4X H;  1XMO Q;  4K0K L;  1RL2 A;  2JE6 I;  3UDF A;  5IWA Q;  1A8V A;  3G48 A;  1XPO A;  4LF4 L;  2JA9 A;  1CKM A;  1VQB A;  3PUX A;  3K8A A;  4NXM L;  3H3V H;  2CQO A;  1NJI C;  4GS3 A;  4OO1 I;  4LF5 L;  4JBJ A;  4APV A;  5GAE C;  1VQN A;  3H0G H;  4LFB Q;  3KOJ A;  2JK8 A;  4HIM A;  4MZ9 A;  4A3J H;  4KLK A;  4AQY L;  2Q2H A;  1VQC A;  2B63 H;  1M90 C;  2RF4 A;  3F1Z A;  4LUV A;  2ZTC A;  1KRT A;  1FGU A;  4OWT B;  2PI2 E;  1I3Q H;  1UEB A;  3CF5 A;  1XNR Q;  4JBK A;  4A93 H;  3GTL H;  1VQH A;  1X54 A;  1CUK A;  4P71 A;  1UWV A;  1MKH A;  4PMW A;  4LUO A;  3CME A;  4A3F G;  3CC2 A;  3HOY G;  2JA6 G;  4O2D A;  4QY7 A;  5IP9 H;  1ASY A;  1VQE A;  3A74 A;  5LMU Q;  4AYB E;  4OX9 Q;  4JG2 A;  4GLX A;  1XMQ Q;  1PH1 A;  1P16 A;  2UUB L;  3UDX A;  1XNQ Q;  4DV4 Q;  4JI6 L;  2MFI A;  4DUZ L;  3S14 H;  3NEM A;  4K0K Q;  1WYD A;  2F3I A;  4GN3 B;  4L5Q A;  4HJ8 A;  5C3E H;  1OXT A;  2CFM A;  4LF4 Q;  2PQA A;  2UXD L;  4POF A;  5M3M H;  4MTN A;  4IPH A;  1FVI A;  1YJN A;  2R92 G;  1WJJ A;  3M4O H;  2YTY A;  4LF5 Q;  4A3I H;  4L5R C;  3K7A H;  4A3K G;  2NVT H;  4A3G H;  2R93 H;  2ZM6 L;  1JB7 A;  1EWI A;  1KIX A;  4GN5 A;  1Q8K A;  4AQY Q;  1OTC A;  2N78 A;  2RCN A;  3S2H H;  3PGZ A;  4H02 A;  4X64 L;  1N8R C;  1FJG L;  4AIM A;  1YIJ A;  1K8G A;  3UE1 A;  3I7F A;  3M3Y H;  2EXD A;  4BBR G;  5C44 G;  2BH2 A;  1VCI A;  3J7A 5;  1TXY A;  3NBH B;  1Q1B A;  2JA5 G;  2OTJ A;  1V43 A;  4B3M L;  4IFD G;  2OWO A;  5IYD H;  5JJI A;  1I6H H;  4YCW A;  5IT9 c;  1VQJ A;  2NZO A;  2I5H A;  2VUM G;  1S40 A;  2CCZ A;  1VQG A;  1WOC A;  2UUB Q;  4EX5 A;  2IHF A;  3E9I A;  3M4P A;  3RN2 A;  4JI1 L;  3MXN B;  4JI6 Q;  1UE6 A;  1L0W A;  4DUZ Q;  4HIK A;  1VQ4 A;  2PI2 A;  3ULJ A;  2UXD Q;  2Y0S G;  2I5L X;  1KXL A;  2AMC B;  1R9T H;  1BKB A;  4X6A H;  1EQR A;  1WCM G;  3S17 H;  2JA7 H;  4DR1 L;  1GM5 A;  4BXX H;  3FKI G;  5GAD C;  1KRS A;  3CCM A;  4IPD A;  1CKN B;  5E7N A;  2ZM6 Q;  4GKK L;  3KF8 B;  1O7I A;  1X3F A;  3PF5 A;  2A19 A;  1HR0 L;  2XTI A;  3M7N A;  1YJ9 A;  4X64 Q;  2I5M X;  3CW2 C;  5GAH C;  1Y1W G;  1FJG Q;  4NXN L;  5JEA G;  4UY8 C;  2E2H H;  5C0X G;  3J80 i;  3CPW A;  4IOA A;  4JI2 L;  4GLV B;  2ZTD A;  1E1O A;  2VY3 A;  1KC8 C;  4B3M Q;  2B3G A;  3KF6 A;  2WP8 J;  4GNX A;  3K80 C;  1PH9 A;  1JMC A;  1X3G A;  2E2I H;  3GTO H;  1X3E A;  1WFQ A;  1E1T A;  1NMG A;  4YCU A;  1Q7Y C;  1MJE A;  1D7Q A;  1C0A A;  4Y7N H;  3TS0 A;  1VQL A;  3HOU H;  4ALP A;  1UE7 A;  5IP7 H;  4LW1 A;  5FJ8 H;  4GN4 B;  5IYB G;  2ZJR A;  4LF6 L;  1UE1 A;  4JI1 Q;  4KHP L;  3K81 C;  2LSS A;  1Z9F A;  2OQ0 A;  4O0A A;  3HOW G;  4GKJ L;  4Y52 H;  1PH8 A;  4POG A;  1LM0 A;  2KHJ A;  3DM3 A;  2I0Q A;  1E3P A;  1N36 L;  2KEN A;  2AHO B;  2IX1 A;  1J6Q A;  4DR1 Q;  1JT8 A;  3DLL A;  3B6Y A;  3AQQ A;  3JAM c;  4GKK Q;  3W1B A;  2C35 B;  3CCV A;  1OXS C;  1EUJ A;  5ELO A;  1I50 H;  1HR0 Q;  4DV3 L;  4NXN Q;  2GN5 A;  4DV5 L;  3I56 A;  5IY0 A;  1G51 A;  1Q1E A;  1VQ7 A;  4JI2 Q;  2K50 A;  1EQQ A;  3J81 c;  1XMQ L;  4BBS G;  3PO3 H;  1L1O A;  1PA6 A;  2IY5 B;  5C4X G;  4UP8 A;  3JC6 6;  5M3F G;  1IXR A;  1PV4 A;  4IFD I;  1JJG A;  4BY7 H;  1VQI A;  1CKN A;  5IP9 G;  2UUA L;  1G6P A;  1GKH A;  2AWN A;  3I4N H;  3KFU A;  4OWX B;  2VQE L;  2H5X A;  4DR3 L;  2ZJQ A;  1QUQ B;  4YWL A;  4YCV A;  4LF6 Q;  2ES2 A;  1KHI A;  4JOI A;  3I55 A;  2KCT A;  4A3E H;  4LF7 L;  4KHP Q;  3GTK H;  1OXU A;  4A4I A;  4GKJ Q;  5C3E G;  1PFS A;  4A3B H;  4DR6 L;  3EN2 A;  4UPA A;  1N36 Q;  5M3M G;  1TWF H;  1Y1V H;  3W5O A;  1Q12 A;  4IPC A;  3E9H A;  3TQY A;  4PZ6 A;  4A75 A;  3HOV H;  4A3L G;  2N49 A;  3CCU A;  1QZG A;  2R93 G;  1L2F A;  4JI0 L;  5JJK A;  1T9H A;  4DV3 Q;  2K14 A;  2ASB A;  2YTX A;  4DV5 Q;  2Z6K C;  1HNX L;  2ATW A;  2RHS B;  1SN8 A;  1VQ6 A;  3HKZ G;  1E22 A;  2HQL A;  2NZH A;  1PH5 A;  4DKA C;  2R7Z G;  1SRO A;  3RN5 A;  1PVO A;  3TS2 A;  1C7Y A;  1N9W A;  2AKW B;  2NN6 I;  2D0O A;  4GOP B;  1YI2 A;  1LYL A;  4C2M H;  4YWM A;  2UUA Q;  3CCS A;  1XJV A;  3KDF B;  4DR3 Q;  2VQE Q;  3TRZ A;  4BA1 I;  3HKS A;  3S1Q H;  2KBN A;  2MNA A;  4C3I H;  4LF7 Q;  1NE3 A;  1XTD A;  1IZ6 A;  4OON A;  4MNO A;  4OWW B;  4A3C G;  2KCM A;  1NBW A;  4DR6 Q;  2JA8 H;  1SE8 A;  1U0L A;  1X65 A;  3D0F A;  3K0X A;  3G4S A;  1P8L A;  4PZ8 A;  1VQM A;  4C3H H;  4LNQ A;  1NY4 A;  2R6G A;  4PZ7 A;  4DAM A;  4L5S A;  1HZ9 A;  2UU9 L;  4JYA L;  3OYY A;  3M9B A;  4GOP C;  1PYS B;  4B3R L;  4JI0 Q;  2BA1 A;  3L2P A;  5LMN W;  3UDI A;  3HKZ E;  4XTC S;  3HOX H;  4GLA C;  3CP0 A;  1HNX Q;  2Z0S A;  2EIF A;  1YZ6 A;  2HIX A;  1W3S A;  3K7U C;  5M5W H;  1AE3 A;  3PO2 G;  4ME3 A;  1BBW A;  4YY3 L;  3A5Z B;  1JJC B;  2PMZ E;  1QVF A;  1KD1 C;  1XPU A;  3CPF A;  2JA6 H;  2IT1 A;  1IYJ B;  3KLW A;  5ELN A;  5HGQ A;  3GD7 A;  3PIO A;  4DR2 L;  3GTG H;  1Q86 C;  4JCV E;  3OW2 A;  1CSQ A;  4KHZ A;  2NVX H;  3HOU G;  4XIG S;  2K5H A;  1IBK L;  2R7D A;  4OXP A;  4DV7 L;  2LXJ A;  1S72 A;  1A63 A;  1LUZ A;  1EIF A;  1E24 A;  1BVS A;  3AFP A;  1PYB A;  3VDY A;  1YJW A;  4JI7 L;  4AH6 A;  2A8V A;  2JEB I;  4TVA B;  2YU9 H;  1SRU A;  4DV2 L;  3EIV A;  2MQH A;  2UU9 Q;  3HOZ G;  2DUD A;  3U58 A;  4DAY B;  4JYA Q;  4B3R Q;  2WAQ G;  4L5T A;  4JC0 A;  2IX0 A;  4DK6 C;  2E5L L;  3S16 H;  3M85 A;  5JJL A;  3A0J A;  4YHH L;  4LF9 L;  3A5U A;  3E0E A;  4LFC L;  4BBR H;  4JI8 L;  1VQ9 A;  2VQF L;  3PO3 G;  4YY3 Q;  2Y0S E;  3TRE A;  4NPS A;  2Q2U A;  4JI3 L;  3BJU A;  4TQU S;  3GTQ H;  3HFZ B;  4BY7 G;  5FLM H;  3KJP A;  4DR2 Q;  4P75 A;  1K8A C;  2VZA A;  1YHB A;  3I4N G;  2GVB A;  3ER0 A;  3BZK A;  2Q2T A;  5AJ3 Q;  1IBK Q;  3RZO H;  4DV7 Q;  3CCL A;  1I5F A;  3H0G G;  3NEN A;  2HHH L;  2K52 A;  1A62 A;  4DPG A;  4HJ9 A;  4A3J G;  3M4Q A;  1VQP A;  4A3B G;  3CXC A;  3BZC A;  2K4K A;  1JJ2 A;  1SFO H;  2E2J H;  1SR3 A;  2B63 G;  3I4M H;  1VQK A;  1I94 L;  4A3D H;  1AE2 A;  2N3S A;  4JI7 Q;  1FL0 A;  4DV2 Q;  2UUC L;  3HOV G;  4DR7 L;  4A93 G;  1UE5 A;  1WI5 A;  2ALY B;  1KAW A;  1M1K C;  1GO3 E;  3FHW A;  1B8A A;  4DUY L;  2E5L Q;  4A76 A;  4DR5 L;  2F52 A;  2OCE A;  4YHH Q;  1QZH A;  4LF9 Q;  3AFQ A;  3CMA A;  3RLN A;  3JAM i;  4LFC Q;  1N33 L;  4QL5 A;  4JI8 Q;  3G71 A;  2VQF Q;  3OTO L;  2E8G A;  2LXK A;  4R4Q A;  2PQA B;  1NMF A;  5EAY A;  1IBM L;  3BU2 A;  4JI3 Q;  4A3L H;  5IYC H;  3J81 i;  4DV1 L;  3S1M H;  3CCR A;  1VQ8 A;  4DV0 Q;  1B7Y B;  3GTP H;  3ULP A;  1AH9 A;  4EQ5 A;  4A3I G;  1YBY A;  4IFD J;  4HJ5 A;  5BR8 L;  2PNH A;  4AYB G;  2HHH Q;  3HOW H;  4A3G G;  3S15 H;  3MEF A;  2JA8 G;  2K5V A;  1SLJ A;  1PH7 A;  2GVA A;  1I94 Q;  4BY1 H;  3L7Z C;  5C0X I;  1H95 A;  3T1Y L;  1MJC A;  1PH3 A;  5K36 G;  2D62 A;  2A1A A;  1VQD A;  2N8N A;  2UUC Q;  4JI5 L;  3PIP A;  4DR7 Q;  1K3R A;  4WJ3 M;  1CSP A;  3STB D;  4QGU A;  2QA4 A;  5IYD G;  4DUY Q;  3HOX G;  3CC4 A;  1VQ5 A;  4DR5 Q;  4NB3 A;  3RLF A;  3STB C;  3F2B A;  4DV6 L;  4X65 L;  1YVC A;  1D8L A;  1C9O A;  2B29 A;  1G29 1;  2JQO A;  3EBE A;  5GQO A;  1N33 Q;  4BBS H;  5H1S E;  1HNZ L;  4BA2 I; 
#chains in the Genus database with same CATH topology
 4G7Z C;  2FXQ A;  2F0T A;  1IBM Q;  1IL2 A;  3PCO B;  5JEA J;  3J7Z C;  1CHQ D;  4OIK A;  4XT3 B;  4LUZ A;  2ID0 A;  4C3I B;  1EYG A;  1DOM A;  1SNQ A;  1QUQ A;  2Z6K A;  4QF4 A;  1K83 H;  3KK7 A;  1GUG A;  5HY6 A;  3S24 A;  3M3Y B;  2NUC A;  4NXM Q;  5FLX c;  4XQQ A;  3CCQ A;  1AW7 A;  5KND A;  4GNX B;  4HSP A;  3I2Z A;  3ZJY C;  5ISR A;  3HOX B;  4QUC A;  1CQV A;  2P5Z X;  3TZU A;  1V1Q A;  1ASZ A;  2XRS D;  1KAB A;  2SNM A;  1B44 D;  2BCO A;  4U68 A;  4IPG A;  1KDC A;  5AJ3 L;  3D8G A;  1NNX A;  3KBG A;  5BN3 A;  4X3K A;  1Y8P B;  1OXX K;  2WKD A;  3H15 A;  2RDF A;  4HCE A;  1HQM C;  1V1P A;  4HTH A;  3BYT B;  5D65 A;  1TS3 A;  1VS0 A;  1QVG A;  1PZJ D;  4GNX C;  5JPM C;  5FOB B;  5CMD A;  2AQ1 B;  2D9U A;  4A3K H;  1WTW A;  4CDF C;  1TWG H;  1I4Q A;  3GV6 A;  1D5Z C;  2OF1 A;  1EIY B;  3I4M G;  1X56 A;  2B2T A;  5C44 H;  2F0N A;  5C4J H;  2A6H C;  2EPB A;  2VUM H;  3AYH B;  3PO2 H;  2QW7 A;  3PV0 A;  1SE4 A;  1SYF A;  4X66 L;  3QB3 A;  1FNW A;  2F3V A;  1GJX A;  4FVM A;  1K73 C;  4LJZ C;  2GA4 B;  2Z1C A;  3OMG A;  3NHH A;  3A8I E;  1MI2 A;  1DYQ A;  1WCM H;  1MIU A;  1LTA D;  4XYQ A;  1HZB A;  1OXV A;  4QJF A;  3D6W A;  2E2J B;  1KNA A;  1SJH D;  4A3D B;  3WWV A;  2L11 A;  2ZTE A;  4EVO A;  3CD6 A;  2WV6 D;  1LTG D;  1SYC A;  3D6C A;  1X6O A;  3TZD A;  1PFM A;  3HOZ H;  2RA4 A;  4FO2 A;  1O7Z A;  4KY7 A;  5EBC A;  2OQK A;  4RGN A;  1KAA A;  4CKC A;  2HD3 A;  5I4D A;  4IO9 A;  5JJZ A;  3ICE A;  1PHJ A;  1QIL A;  3A8J E;  4YWK A;  5G3L F;  2K05 A;  4DAY A;  4P74 A;  3IL8 A;  3KYH C;  1K9M C;  4OX9 L;  4R8I A;  2VNU D;  3UDG A;  1DON A;  4XXE A;  4IUN A;  4X66 Q;  3IFD A;  2R61 A;  1Q82 C;  4C3I G;  2M9V A;  5DLQ E;  1H9R A;  2JE6 I;  1GXD C;  4JVZ A;  5COY A;  1CKM A;  3GTP B;  1EY5 A;  4ZKB B;  4C3H G;  4LF5 L;  4JBJ A;  1V8Q A;  4JK1 C;  4RGO S;  2EJM A;  3KOJ A;  1G91 A;  1JOQ A;  2Q2H A;  3ND9 A;  2RF4 A;  3BVZ A;  2ZTC A;  1KRT A;  1DOK A;  2M2L A;  2PI2 E;  3CF5 A;  1X54 A;  1CUK A;  4P71 A;  4RCN A;  4PMW A;  4LUO A;  3CME A;  3HOY G;  5CV5 A;  1EU3 A;  4QY7 A;  1ASY A;  1VQE A;  3CU7 A;  2NWG A;  4OX9 Q;  4DUZ L;  5HGT A;  5EKI A;  3SK5 A;  5C3E H;  2CFM A;  2PQA A;  4KD4 A;  1JR0 D;  3DWQ A;  2R92 G;  3CKI B;  1IL8 A;  1M4V A;  5IGE A;  1SEB D;  4LF5 Q;  1D1K A;  2FIN B;  3Q22 A;  2R93 H;  3K7A H;  5ELD A;  1JB7 A;  1Q8K A;  4PV1 C;  1OTC A;  1TVX A;  2RCN A;  3LWU A;  1L0Y B;  4OGQ C;  1N8R C;  1C8C A;  1FJG L;  2G9D A;  2G5D A;  4XT1 B;  1K8G A;  1BBX C;  4BWG B;  4ZCK A;  3UE1 A;  3I7F A;  4ZUI A;  5M5X B;  2BH2 A;  1VCI A;  1RHP A;  1TXY A;  3K59 A;  5M5Y B;  3DM1 A;  1F2M A;  1V43 A;  4B3M L;  4B9X A;  1I6H H;  4TRD A;  4YCW A;  4HMJ A;  2NZO A;  2R7Z B;  5JVG 3;  1ENF A;  3M7G A;  1VQG A;  1WD0 A;  3RN2 A;  3M4P A;  4DUZ Q;  2PI2 A;  2RSN A;  3DWP A;  2I5L X;  1R9T H;  1BKB A;  1EQR A;  5A2Q L;  3FKI G;  5DNF A;  1PFB A;  5E7N A;  3M7N A;  2A19 A;  2XTI A;  1YJ9 A;  1FJG Q;  1TWA B;  5DM6 3;  2I46 A;  5C0X G;  1DM0 B;  5CV8 A;  1TWH B;  1G2T A;  2KOL A;  3NE5 B;  1EYC A;  4GLV B;  2QKI C;  2ZTD A;  4CBV A;  1BCP F;  4KMU C;  4B3M Q;  1UAP A;  4A3L G;  4YCU A;  1WFQ A;  2NB0 A;  3OHX C;  3TSS A;  4QUF A;  1MJE A;  4EQO A;  3V05 A;  1F2Z A;  3HOU H;  3H09 A;  4GN4 B;  1O78 A;  5DM7 3;  2PW7 A;  3T13 A;  1E2Z A;  3OWF A;  1ZYR D;  3HOW G;  4O0A A;  1LTB D;  4GKJ L;  2EY2 A;  5E4X A;  2KHJ A;  3DM3 A;  1N36 L;  4FXG C;  3A56 A;  2AHO B;  4KKT A;  4DU9 A;  1JT8 A;  1EEF D;  2XWJ B;  1Y1W B;  3OPO A;  2PZT A;  1FD7 D;  1HQR D;  1TII D;  3CCV A;  1I50 H;  1QOH A;  1G51 A;  1Q1E A;  1XMQ L;  5C4X G;  3R93 A;  1L1O A;  2J4X A;  2XN9 C;  1PA6 A;  2IY5 B;  1K0S A;  2CHB D;  4UP8 A;  1WTO A;  1EOT A;  5M3F G;  1SYG A;  4DNR B;  1IXR A;  4IFD I;  3HRZ C;  1JJG A;  2F1M A;  1W6K A;  4K8I A;  3S1M B;  1VQI A;  1UUP A;  4IUU A;  3I4N H;  4DR3 L;  1AP0 A;  3E5S A;  3L3O C;  1I4X A;  3S15 B;  1KHI A;  3ITP A;  4GKJ Q;  1PFS A;  1N36 Q;  3VA5 A;  5M3M G;  4IPC A;  3E9H A;  3TQY A;  3QR8 A;  3CCU A;  2F0O A;  2XIW A;  1L2F A;  4XYO A;  2IPK D;  2QF7 A;  2RBM A;  1SBB B;  1I3Q B;  2YTX A;  2L55 A;  1SDF A;  3GTL B;  2F0M A;  2K28 A;  1E22 A;  4CDE C;  2R7Z G;  3C2P A;  3H3V C;  2NN6 I;  1YI2 A;  4GOP B;  1ENA A;  3CCS A;  2Z4H A;  4DR3 Q;  3TRZ A;  2TMP A;  5KIX A;  3SDZ A;  1K83 B;  1J9O A;  1EFI D;  4C3I H;  5I2Y A;  1NSN S;  2HCC A;  1SYB A;  4MNO A;  1TS5 A;  3M4O B;  1HRJ A;  3AU7 A;  3TP5 A;  1S5D D;  2NZ1 D;  1EWC A;  3K0X A;  3G4S A;  4C3H H;  1VMC A;  1BQQ T;  3V96 A;  3S2H B;  4GOP C;  2NYZ D;  5LMN W;  3L2P A;  3UDI A;  3SEB A;  4XTC S;  3HOX H;  2IJ0 A;  3LNN A;  4GLA C;  1SSO A;  3TP7 A;  3SXH A;  3A8K E;  3HEJ A;  4FF2 A;  4C1N I;  2F0H A;  3DEO A;  1JJC B;  1XPU A;  2RQX A;  3GD7 A;  1GHK A;  3N52 A;  4JCV E;  1D6E C;  1IBK L;  2OT2 A;  1SND A;  1TWG B;  4OXP A;  4CDC C;  4V19 0;  1TQO A;  1E24 A;  2B2U C;  2QDL A;  4JI7 L;  5C4J B;  2A8V A;  2JEB I;  4FF3 A;  4L5T A;  2E2H B;  1F2L A;  4IUT A;  4LFC L;  1UNS A;  4JI8 L;  1VQ9 A;  2WKC A;  2Y0S E;  4NPS A;  2Q2U A;  3J80 E;  4BY7 G;  4FXK C;  5FLM H;  4P75 A;  3C46 A;  3KLS X;  3ER0 A;  1FR3 A;  1R4P B;  4HCS A;  1IBK Q;  3CCL A;  4KHV A;  2RSO A;  2WB1 B;  2E2J H;  3TME A;  2MGS A;  1VQK A;  4A3D H;  1S5C D;  5J1Z A;  5J22 A;  4JI7 Q;  2WAQ B;  4IN3 A;  3FVQ A;  2K32 A;  2R3Z A;  1IW7 C;  1QZH A;  1LAB A;  1ICW A;  3RLN A;  4CJ0 B;  3JAM i;  1WTR A;  1TT2 A;  1D1I A;  2F0G A;  4JI8 Q;  2BDN A;  5EAY A;  5ELC A;  2EXZ A;  3VYR A;  3BU2 A;  4A3L H;  1CK1 A;  3J81 i;  1VQ8 A;  4DV0 Q;  1B7Y B;  5T1G A;  3GTP H;  3K0Y A;  4EQ5 A;  2O5J C;  4AYB G;  3HOW H;  4OL7 A;  1TWF B;  4G57 A;  3MEF A;  2JA8 G;  2EYO A;  3R8B A;  3HOV B;  3HP3 A;  5K36 G;  2D62 A;  2A73 B;  4KKS A;  1WTH A;  1K3R A;  1PTO D;  5C6A A;  2L5T A;  3F2U A;  3STB C;  4IUR A;  1CHP D;  1G29 1;  2JQO A;  5C4X H;  4XDX A;  5H1S E;  2AQ3 B;  5C3W A;  1M8A A;  1SNC A;  4C2M B;  4DR4 L;  5M3F H;  3PF4 A;  2EQS A;  1B70 B;  5KNC A;  4HJ7 A;  5IGC A;  5BN4 A;  3NQI A;  1EOV A;  2L15 A;  2JA7 G;  1O7L A;  2AWO A;  1CA5 A;  1PXU A;  4BXX G;  1Q46 A;  2DJG C;  3CAM A;  1KQS A;  4L63 B;  3J81 j;  1TR5 A;  4PG3 A;  2JSO A;  3GDE A;  2JEA I;  2ZXP A;  2BH8 A;  1SMX A;  3RD4 A;  2WAC A;  1PH4 A;  2CWP A;  1PH6 A;  3I4O A;  4RG1 A;  4HID A;  1GUW A;  1U5K A;  5M5X H;  5M5Y H;  4GZY C;  1MGS A;  3Q8D A;  5KEE A;  1YHQ A;  4I7Z C;  3RUZ A;  4G7O C;  2D0P A;  2F0V A;  3I70 A;  5FJ8 G;  1ESF A;  2R7Z H;  4DR4 Q;  2A68 C;  2UXC L;  3A55 A;  1LT6 D;  2WII B;  3GTG B;  1Q81 C;  2LY7 A;  3FP9 A;  4R1J A;  2NVX B;  2KUM A;  2QGQ A;  3U9O A;  2IHE A;  2Q2I A;  2F4V L;  3IRB A;  2WB1 G;  3EQL C;  3MZ5 A;  3KJO A;  4JI4 L;  1RIP A;  3KDF A;  2A6E D;  3T1H L;  2PZW A;  3MFG A;  1YEZ A;  1MHW C;  1DGS A;  2SEB D;  4ZYS A;  2XVS A;  1TWA H;  2Z4I A;  4FDB A;  1YNJ D;  3KLS A;  1TWH H;  4DNI A;  2LKV A;  1EYA A;  1YIT A;  5DAU A;  5IE8 A;  3CRL C;  1ILP A;  4DFA A;  1ET6 A;  4JV5 L;  3I90 A;  5JAV A;  4G4K A;  2UXC Q;  5GRO A;  1CKO A;  3DMU A;  3W1G A;  1BBU A;  4UP7 A;  3FMC A;  4K5X A;  1V9P A;  5IWA L;  3PIO 3;  3FPU B;  1HR0 W;  2F4V Q;  4LFC Q;  2HCI A;  4DK0 A;  1Y1V G;  5I9P A;  3NP8 A;  4JI4 Q;  2B2W C;  4LFB L;  4K2K A;  3T1H Q;  3I4M B;  1DCZ A;  1Y1W H;  2IX3 A;  1A0I A;  4BY1 G;  2HQE A;  4M1U B;  3RZD H;  1L0X B;  2WFW A;  1GVP A;  5TSS A;  3UE0 A;  1Z6H A;  1GD7 A;  5LL6 S;  1PH2 A;  1KL9 A;  1ROD A;  1U9R A;  1HZC A;  3CC7 A;  5LMU L;  2K75 A;  4P72 A;  4QIW E;  4IAL A;  3SHL A;  2ENB A;  3VA7 A;  1F9Q A;  2QEX A;  4JV5 Q;  1EFW A;  1XNQ L;  5I6W A;  2MP1 A;  4HMI A;  4A3M G;  4PMB A;  4K0K L;  2KJX A;  1RL2 A;  1EL0 A;  5IWA Q;  1SJE D;  2JA9 A;  1VQB A;  3PUX A;  4NXM L;  3H3V H;  1HUN A;  4UDU C;  2QDB A;  1II3 A;  5GAE C;  1EZ8 A;  1VQN A;  5CV4 A;  1EZ6 A;  4LFB Q;  4KLK A;  1PRT D;  4RKL A;  3K5O A;  5FKA C;  2AQ2 B;  1I3Q H;  1X3Q A;  1HUM A;  2F0W A;  3GTL H;  4A3F G;  3CC2 A;  5IP9 H;  5LMU Q;  1ILQ A;  2B39 A;  1HFG A;  4GLX A;  2A69 D;  1P16 A;  1PH1 A;  2UUB L;  1XNQ Q;  1EQV A;  4JI6 L;  1HA5 A;  3K5L A;  1A15 A;  4K0K Q;  2F3I A;  1IKL A;  4GN3 B;  4L5Q A;  4HJ8 A;  2UXD L;  4C3H B;  1WTV A;  1WJJ A;  4R8N A;  3M4O H;  1HHV A;  2MUY A;  2ZM6 L;  1JOR A;  1KIX A;  2N78 A;  3S2H H;  4X64 L;  3JAM L;  1YIJ A;  1XXG A;  2EY5 A;  1STE A;  2PO4 A;  4J6H A;  1XWE A;  5K36 H;  4FF4 A;  3HOY B;  3OOC A;  3J7A F;  2JA5 G;  1SNM A;  3J81 L;  1BCP D;  5JJI A;  4J1M A;  3VR3 A;  3HKZ B;  2KCN A;  2BE5 C;  1S40 A;  1VF5 C;  2CCZ A;  3P20 A;  3GTM B;  3R2I A;  2UUB Q;  2IHF A;  4JI6 Q;  1UE6 A;  3WDN A;  2PMZ B;  2R92 B;  1IKM A;  3ULJ A;  1AZQ A;  2UXD Q;  4RGT A;  1RCV D;  3MEH A;  2JA7 H;  4DR1 L;  3VYT A;  5IGG A;  5IT9 E;  1GM5 A;  4BXX H;  1CKN B;  2ZM6 Q;  1X3F A;  4X64 Q;  5JEA G;  3KLR A;  4UY8 C;  2E2H H;  3CPW A;  2ZXR A;  1V1O A;  2KEE A;  1JC7 A;  3BYY B;  3I72 A;  3I8Z A;  4GNX A;  1PH9 A;  5LL6 X;  1JMC A;  1D7Q A;  1Q7Y C;  1E1T A;  4Y7N H;  5KNB A;  1UE7 A;  2CW0 C;  5IYB G;  5FJ8 H;  1UE1 A;  2DNE A;  3K81 C;  2LSS A;  4CHT B;  2L0C A;  4Y52 H;  1LM0 A;  3FKI B;  2I0Q A;  1E3P A;  2KEN A;  4IUV A;  4N9T A;  3AB9 A;  4DR1 Q;  3AQQ A;  4RGM A;  3FRP B;  2K6A A;  3JAM c;  4FYD A;  1IYU A;  4DV3 L;  2KCC A;  2MPM A;  2GN5 A;  4DV5 L;  2BDO A;  3I56 A;  2FMC A;  4DXG A;  1ML0 D;  1JE4 A;  2Q8I B;  1EY4 A;  5JVH 3;  2B2Y C;  3J81 c;  4BS9 A;  1LTI D;  1O7Y A;  5ELE A;  4MTK A;  1ZXT A;  1H9M A;  1CKN A;  2UUA L;  1KDA A;  2D5D A;  1TWC B;  2AWN A;  4OWX B;  2H5X A;  2NTT A;  2ZJQ A;  3HOW B;  2ES2 A;  3I55 A;  4FXD A;  3BDO A;  1EQT A;  1HPC A;  4UHV A;  2OEO A;  4H0L C;  1TWF H;  1ICF B;  1QE6 A;  3MXG A;  1Y1V H;  3W5O A;  3HOV H;  2N49 A;  1QZG A;  2N55 A;  2B63 B;  1NR2 A;  3H6M A;  1GHJ A;  4DV3 Q;  1I4H A;  4DV5 Q;  4DAV A;  5C4X B;  4A93 B;  1PZI D;  3H91 A;  5M3F B;  1GOZ A;  3SR1 A;  3HKZ G;  4ZUJ A;  1PVO A;  4Q5V A;  1N9W A;  2AKW B;  2D0O A;  4NW2 A;  1PTO C;  2Q8T A;  4C2M H;  1LV9 A;  2UUA Q;  1XJV A;  2IW3 A;  1ZKO A;  2MNA A;  2EYF A;  3MFY A;  4IZ8 A;  2H1E A;  1K8O A;  4OON A;  5M3M B;  2KCM A;  4YIJ A;  1NBW A;  1UEA B;  5DEH A;  1U4P A;  1X65 A;  3V2T A;  2CQA A;  4L5S A;  2LMC B;  4JYA L;  1PYS B;  4B3R L;  3MTS A;  1JB3 A;  1YNN D;  2HIX A;  3WOF A;  1AE3 A;  1WVL A;  4ME3 A;  2Q8R E;  3A5Z B;  1AEX A;  1KD1 C;  1PFN A;  3CPF A;  2F03 A;  1G2S A;  4DA2 A;  3PIO A;  3GTG H;  1Q86 C;  1CSQ A;  2NVX H;  1RTN A;  5FLX E;  4KN7 C;  1D5X C;  2O4X A;  1WTP A;  2EYL A;  4RWS C;  1BVS A;  2XWB B;  3A54 A;  3VDY A;  1YJW A;  3EIV A;  4JYA Q;  4B3R Q;  1QG7 A;  4DK6 C;  5JJL A;  3A0J A;  2RCF A;  4LF9 L;  2QIL A;  4MIU A;  4FF1 A;  1B3Q A;  1CM9 A;  3PO3 G;  2E2I B;  3GTO B;  5I9O A;  5IGB A;  1PMR A;  3TRE A;  1S5E D;  4JI3 L;  4TQU S;  5CBE E;  5D3I B;  2VZA A;  1YHB A;  2K1B A;  2RKS A;  1EY9 A;  2K33 A;  3BZK A;  2F0J A;  1KTK A;  3RZO H;  1B50 A;  4KN4 C;  4H13 C;  4DPG A;  4ZQ3 A;  4HJ9 A;  4A3B G;  3CXC A;  3RZD B;  2B63 G;  3I4M H;  1I94 L;  3NQT A;  2UUC L;  4A93 G;  2XNA C;  2SDF A;  4CJ1 B;  1UE5 A;  3UI2 A;  1KAW A;  3FHW A;  1B8A A;  2F52 A;  1SAP A;  4LF9 Q;  4QL5 A;  1NUC A;  2KVM A;  3OTO L;  1STA A;  4BY7 B;  2PNR C;  1HTP A;  1ET9 A;  2OXP A;  4JI3 Q;  2K04 A;  2F3W A;  3VR4 A;  4DV1 L;  1CZW A;  1HTL D;  3CCR A;  1JOO A;  3OWE B;  1EIG A;  3ULP A;  1AH9 A;  4A3I G;  1YBY A;  4IFD J;  2PNH A;  1STN A;  2CVR A;  1SNP A;  1F2Y A;  4TSS A;  1I94 Q;  2E2D C;  3L7Z C;  3QWN A;  1H95 A;  3T1Y L;  1VQD A;  2N8N A;  2UUC Q;  4JI5 L;  2DNC A;  1B9N A;  2F0K A;  1CSP A;  1SMY C;  2PZU A;  1H9S B;  3CC4 A;  1FGB D;  3NTH A;  4G7H C;  4NB3 A;  2CH4 A;  2EYJ A;  4X65 L;  1RKN A;  2L12 A;  3WOE A;  3C3L A;  1HNZ L;  3OTO Q;  5LMN L;  2E74 C;  2HDM A;  4NKL A;  4X62 L;  4C1N K;  2QCP X;  4EGV A;  3PUZ A;  3BVG A;  4Z9C B;  1XPR A;  4DV1 Q;  3S1Q B;  2ZJP A;  1JWS D;  1U4M A;  4AYB B;  3AEV A;  3H3V I;  3NK9 A;  1T5E A;  4WJ4 A;  1S4Z A;  2YTV A;  3ZYY X;  3S9W A;  2JA8 B;  1JWM D;  3RR5 A;  4ULL A;  3F2C A;  3DXJ C;  3T1Y Q;  4RMF A;  2NBF A;  3KF6 B;  5J3B A;  2K5N A;  3RLO A;  4JI5 Q;  3PSI A;  4KI0 A;  4NP5 A;  3HOY H;  3LGJ A;  2ZT9 C;  4Q0F A;  3NEL A;  1WTX A;  5M5W B;  1YHA A;  2L9H A;  4X65 Q;  1X3P A;  3NTK A;  1DOL A;  3RNU A;  5K5P A;  2EDG A;  1HNZ Q;  3PUW A;  5LMN Q;  3PIP 3;  5M9O A;  1N34 L;  1FNV A;  3GTM H;  1CTM A;  4DNT B;  4X62 Q;  2JA7 B;  2X69 A;  4PMC A;  2YYZ A;  4RA8 A;  5KGU A;  2R92 H;  4GOP A;  1H9S A;  4LF8 L;  1S3O A;  2HIV A;  4OO1 G;  1X55 A;  1YNX A;  2EVB A;  1DZ1 A;  1Y69 U;  4PQX A;  2PW5 A;  4K5W A;  5CV7 A;  4WJW A;  1VQO A;  3R3O A;  1Y14 B;  4JBM A;  1IBL L;  3L0O A;  2BA0 A;  2KHI A;  2A6H D;  3S16 B;  4Y7N B;  5IOD A;  1HJP A;  4BBR B;  2F0Q A;  2R7F A;  3ERS X;  2PQE A;  3MC0 B;  5FO9 B;  4DV0 L;  1EYD A;  1JQY D;  1LTL A;  2JJQ A;  5EPL A;  5BN5 A;  1N34 Q;  1BUV T;  4A3E G;  4B3S L;  2NN6 G;  2B2U A;  2WB1 E;  4K8J A;  5IYC G;  3P75 A;  1NTG A;  1HFN A;  2C9O A;  4CKB A;  2D2C C;  4IJL A;  3MVV A;  2WAQ E;  3F2D A;  4LF8 Q;  3FKI H;  1I4P A;  4IUQ A;  1QNU A;  2VW9 A;  2K5Q A;  1LT4 D;  4JOI C;  3K6O A;  5C0X H;  1TS4 A;  4HIO A;  1W2B A;  1IBL Q;  1XNR L;  3U4V A;  3HS0 C;  2B2V C;  3CCJ A;  4RKB A;  5CBA E;  3IAY A;  4RFB A;  2Z8L A;  3I73 A;  1HZA A;  1A2U A;  2WIN B;  3BS1 A;  3C1F A;  1JE5 A;  1BF4 A;  1TWC H;  1E7Z A;  4ZK9 B;  4B3S Q;  1EY0 A;  4HAE A;  3EVQ A;  1A8V A;  3G48 A;  4UAI A;  5FO7 B;  1Y1V B;  1XPO A;  5I6Y A;  3K8A A;  1TS2 A;  1AZP A;  2CQO A;  1U4L A;  1AN8 A;  4APV A;  2JK8 A;  4HIM A;  4MZ9 A;  4BY1 B;  3KUP A;  4HN7 A;  4ODG A;  1M90 C;  2B63 H;  4LUV A;  5F2D A;  4WFN 3;  4OWT B;  2RVL A;  1XNR Q;  4A93 H;  1MD2 D;  5ELB A;  1BXT A;  5A2Q E;  3QG1 A;  4A3M B;  3ND8 A;  2EE1 A;  4XQJ A;  2MFI A;  2KQ3 A;  3EFX D;  3NEM A;  1WYD A;  2EYP A;  1OXT A;  3GTJ B;  5M3M H;  4IPH A;  1FVI A;  3A7L A;  3FPP A;  4A3I H;  1Y8O B;  4A3K G;  2NVT H;  3TN2 A;  2JYO A;  2NVY B;  2EY6 A;  1EWI A;  1BOS A;  2FJ2 A;  2NTS A;  3PGZ A;  4AIM A;  2F4I A;  3KBX A;  1RDP D;  5C44 G;  4BBR G;  4A3F B;  1ONL A;  3J7A 5;  3NBH B;  1Q1B A;  2OTJ A;  1J8I A;  2O2L D;  2OWO A;  4E6I A;  5IT9 c;  2MHV A;  4ABN A;  2FFK B;  1VQJ A;  2I5H A;  2VUM G;  5KYI A;  1WOC A;  4EX5 A;  4WRD A;  3K5N A;  3MXN B;  1L0W A;  1VMP A;  3URY A;  3CQZ B;  4NDX A;  3GQB A;  2Y0S G;  2Z9H A;  4B9W A;  4F8M A;  3K57 A;  1WCM G;  4KK7 A;  1CA6 A;  2BOS A;  3MAQ A;  2A74 C;  4X3U A;  1STG A;  1EWH A;  4OEL B;  5ELF A;  4GKK L;  2B8F A;  1O7I A;  3KF8 B;  3PF5 A;  1HR0 L;  2I5M X;  5G3L D;  3J80 i;  2JA5 B;  4IOA A;  4FP5 D;  4R9W A;  4JI2 L;  1A3V A;  1W6J A;  1KC8 C;  1KNE A;  1IHZ A;  3K80 C;  2E2I H;  3GTO H;  2C5C A;  1NMG A;  2EZV A;  2NVQ B;  3S2D B;  2PYK A;  1C0A A;  3RZO B;  3TS0 A;  1VQL A;  4ALP A;  4LF6 L;  3TP8 A;  3CRK C;  1CQF A;  4KHP L;  4OHJ A;  1PH8 A;  4POG A;  1ZYR C;  1GUN A;  1B2T A;  1Y8N B;  2IX1 A;  4OO1 H;  5EGT A;  3DLL A;  1JCK B;  4GKK Q;  3VR2 A;  3W1B A;  2C35 B;  3O13 A;  3E0J A;  1HR0 Q;  3MXN A;  3ERQ A;  3MXP A;  2TSS A;  5IY0 A;  1R4Q B;  1VQ7 A;  4JI2 Q;  4BBS G;  1ENC A;  2F0P A;  3T4A C;  2IWH A;  3NSW A;  4BY7 H;  1G6P A;  1GKH A;  2B2W A;  3S1N B;  2AUK A;  3BVM A;  1QUQ B;  4YWL A;  4YCV A;  4LF6 Q;  3T56 B;  1XTC D;  3OIP A;  2KCT A;  4A3E H;  4LF7 L;  4KHP Q;  3GTK H;  5CV9 A;  2DJF C;  5C3E G;  4DR6 L;  4UPA A;  3H0G B;  3QOJ A;  3M4Y A;  4A3J B;  4PZ6 A;  2R93 G;  4JPB W;  3J7Y W;  5JJK A;  2K14 A;  3MWY W;  2Z6K C;  2ATW A;  4O42 A;  4QCL A;  2L1B A;  2RHS B;  2F0S A;  5AFW A;  1SN8 A;  2Z6B A;  1EY8 A;  2HQL A;  2NZH A;  3RN5 A;  3TS2 A;  2KA7 A;  1CZG A;  1LYL A;  2JXM B;  3DHQ A;  5CC4 A;  1H9J A;  5JPN C;  2QEJ C;  4BA1 I;  3HKS A;  3SE0 A;  3S1Q H;  4RAU C;  4HR7 B;  4LF7 Q;  1NE3 A;  5T1I A;  1IZ6 A;  1B3A A;  4A3C G;  1Z7T A;  4CKE A;  4OEM B;  4DR6 Q;  2CH4 W;  2FMM A;  3BG3 A;  2JA8 H;  1QNK A;  1SE8 A;  1U0L A;  3D0F A;  1VQM A;  5E4W C;  3QIA A;  4A3G B;  4CDD C;  4LNQ A;  1NY4 A;  2DY7 A;  2R6G A;  4MHE A;  4PZ7 A;  4DAM A;  1QWY A;  2J0T D;  3OYY A;  4QMG A;  1F77 A;  1STY A;  2BA1 A;  5C5M A;  2KHS A;  3HKZ E;  4ZKC B;  2Z0S A;  2EIF A;  1W3S A;  3K7U C;  5M5W H;  1TKW B;  4IQZ A;  4DAP A;  1BBW A;  1PTO F;  1B9M A;  4KY5 A;  2PMZ E;  2B2T C;  5ELN A;  3KLW A;  3N6R A;  5HGQ A;  2J7Z A;  4DR2 L;  1DD2 A;  3OW2 A;  1B4O A;  3HOU G;  1PYW D;  3QJY A;  2F0U A;  4DV7 L;  1ESR A;  5KRU A;  1LUZ A;  3LX0 A;  1EIF A;  3S17 B;  1QJO A;  1BDO A;  5C5L A;  3OSO A;  4AH6 A;  1SRU A;  3MA2 B;  4M8A A;  4DV2 L;  3VYU A;  2DUD A;  4DAY B;  2EJG C;  1B53 A;  4C3J G;  3S16 H;  3M85 A;  4YHH L;  4S3S A;  3I3C A;  4BBR H;  2DN8 A;  5C4H A;  3J7A V;  5EQ0 A;  1E2V A;  3BJU A;  3GTQ H;  3HFZ B;  3KJP A;  4DR2 Q;  4CJ2 C;  1K8A C;  3I4N G;  5AJ3 Q;  1A3T A;  1BO0 A;  1LTR D;  4DV7 Q;  3H0G G;  2HHH L;  3NEN A;  4ME5 A;  4A3J G;  4J8Q A;  3M4Q A;  1VQP A;  1JJ2 A;  2K4K A;  1Q90 A;  2N3S A;  1FL0 A;  4DV2 Q;  3I91 A;  3HZX A;  4IUP A;  1WI5 A;  2ALY B;  4K2L A;  1IW7 D;  1I4R A;  5IIF A;  1M1K C;  1TY2 A;  5FK9 C;  4DR5 L;  2OCE A;  4YHH Q;  3PO3 B;  3AFQ A;  2LFN A;  1N33 L;  3G71 A;  4H7B A;  1HCZ A;  2LXK A;  4R4Q A;  2PQA B;  5IGF A;  4F7X A;  4I65 A;  1U4R A;  1XYI A;  1KLG D;  2H4O A;  2F0F A;  3EA6 A;  1PTO B;  3R2T A;  3SVM A;  1CFM A;  2DY8 A;  1EIH A;  4A3B B;  3H94 A;  5BR8 L;  2HHH Q;  4A3G G;  3J80 L;  2B2Y A;  1Q3L A;  1PH7 A;  4BY1 H;  4TKO B;  5C0X I;  5L37 A;  2A1A A;  3SK6 A;  4XQN A;  1HXY D;  3GV3 A;  3STB D;  4H44 C;  2QA4 A;  5IYD G;  3HOX G;  1DXM A;  4DR5 Q;  3RLF A;  3F2B A;  4DV6 L;  1D8L A;  1H9K A;  3TDQ A;  1N33 Q;  4BBS H;  5IOC A;  4BA2 I;  4B3T L;  4A3M H;  4DK3 C;  4LFA L;  1X9N A;  1HNW L;  1J5E L;  5CV6 A;  5C0X J;  2L4N A;  1F9S A;  4A3I B;  1RTO A;  2JN4 A;  3GTJ H;  2NVT B;  1VQA A;  2XGT A;  2UXB L;  3GO5 A;  5BR8 Q;  3TBI B;  3QO2 A;  3U9S A;  4F87 A;  4ILW A;  1VQF A;  1G6Z A;  4MN3 A;  3T16 A;  2NVY H;  1Z47 A;  2G9H D;  2DGY A;  3DEP A;  4KY6 A;  1PRT F;  2F0L A;  4A3F H;  1N32 L;  4R4O A;  3PUV A;  4N8F A;  4DV6 Q;  1K0R A;  4UP9 A;  4KD3 A;  2A68 D;  2RHQ B;  5IP7 G;  2JA6 B;  1OO9 B;  4R4I A;  4B3T Q;  4LFA Q;  4DN4 M;  1J5E Q;  1HNW Q;  4R4T A;  4U67 3;  1EEI D;  5FLM G;  3CQZ H;  3U4Z A;  3S14 H;  2CWA A;  4IOC A;  3P1H A;  4P73 A;  2UXB Q;  1DJR D;  1LAC A;  1SYD A;  3J80 c;  3G6E A;  4A3C H;  2VL6 A;  2MO0 A;  2A6E C;  5CR3 A;  2YU9 B;  1L1O B;  2CKZ B;  2EOT A;  4A3D G;  4LWC A;  3D31 A;  3F8T A;  2JA5 H;  1FYC A;  1N32 Q;  1YNJ C;  2OTL A;  4HJA A;  1VDZ A;  4C56 C;  5KYL A;  2HT1 A;  4R4C A;  1A6X A;  2EYM A;  2NVQ H;  3S2D H;  3ULL A;  4IJH A;  4K6L A;  1XMO L;  4RHS A;  2K7V A;  1L1O C;  5GAG C;  1HH2 P;  1MSH A;  1SXT A;  2YV5 A;  2N88 A;  2V1C C;  4J15 A;  5NUC A;  3U50 C;  1SFO B;  3NWT A;  4DXF A;  3TEH B;  3X3M A;  5JEA H;  4JBW A;  3SGI A;  3S1R H;  2K5W A;  1QVC A;  2VS1 A;  3MXU A;  4C3J H;  3CCE A;  5CGK A;  4QQB X;  1AFP A;  3VR6 A;  3W2D A;  2MO1 A;  5EKL A;  5C3X A;  1PRT B;  4A3E B;  5IYB H;  3PUY A;  3GTK B;  3S1N H;  4DV4 L;  4KV6 A;  2XSC A;  1JOK A;  2O5I C;  1XMO Q;  4WOR A;  3UDF A;  3JAM E;  4ZLT F;  4LF4 L;  1Q8I A;  1NJI C;  2F0I A;  4GS3 A;  4OO1 I;  3H0G H;  2E75 C;  3ERO A;  3A7A B;  3D4W A;  3NTI A;  3J81 E;  4AQY L;  4A3J H;  1ZEQ X;  2F0D A;  3VR5 A;  1VQC A;  3F1Z A;  1PRT C;  3Q24 A;  1FGU A;  3ONA B;  1UEB A;  2I07 B;  4NMZ A;  1EY6 A;  4JBK A;  1VQH A;  3GP7 A;  4DF7 A;  1UWV A;  1MKH A;  1I6V C;  2JA6 G;  4O1N A;  3K58 A;  4O2D A;  1LLR D;  1LTT D;  3A74 A;  2EYH A;  1S5F D;  4AYB E;  4EQP A;  4JG2 A;  1XMQ Q;  3SK4 A;  1LTS D;  3UDX A;  4DV4 Q;  2IL8 A;  3D3R A;  2A69 C;  2A5H A;  4LF4 Q;  3FDT A;  4POF A;  4MTN A;  1YJN A;  1BCP B;  3CHB D;  2YTY A;  2RDH A;  4L5R C;  4A3G H;  2K5D A;  4GN5 A;  4AQY Q;  2M00 A;  4H02 A;  5FO8 B;  1C48 A;  5LHY 1;  3M3Y H;  2EY1 A;  2EXD A;  2VXW A;  1STB A;  2K03 A;  4IFD G;  5IYD H;  4X3T A;  2BE5 D;  1CT1 D;  5EPK A;  2FHT A;  2SOB A;  1BCP C;  3NBI A;  3I4L A;  5E1F A;  3E9I A;  4N8X 1;  4JI1 L;  4HIK A;  1VQ4 A;  1GUS A;  1STH A;  5C4Z A;  1O80 A;  1A2T A;  1KXL A;  2AMC B;  4RHR A;  4X6A H;  4A3K B;  3S17 H;  1XX8 A;  1K8M A;  1E2W A;  4P2C B;  5GAD C;  1KRS A;  3CCM A;  4IPD A;  2X6L A;  1WD1 A;  1EY7 A;  3CW2 C;  5GAH C;  5C44 B;  1Y1W G;  4NXN L;  2VB3 X;  3C1E A;  5HUR A;  3PMF A;  1KDB A;  1SNO A;  3LWE A;  3OIQ A;  2JP1 A;  5COR A;  5JOB A;  3GTQ B;  1E1O A;  2VY3 A;  2B3G A;  3KF6 A;  2WP8 J;  2VUM B;  1X3G A;  1X3E A;  2KEC A;  3D4R A;  3PO2 B;  5EBD A;  2CW0 D;  3IKJ A;  5IP7 H;  4LW1 A;  2ZJR A;  3MHB A;  4JI1 Q;  1RD9 D;  1PZK D;  2Y0S B;  2ZXO A;  5CYU A;  1Z9F A;  2OQ0 A;  4K5V A;  4RCO A;  4CGY B;  3NPP A;  1WCM B;  4KKU A;  5D14 A;  2MJ8 A;  1J6Q A;  1T5X D;  1IYV A;  3B6Y A;  4N9P A;  1PDQ A;  1OXS C;  1EUJ A;  5ELO A;  3SK8 A;  4ID6 A;  1X32 A;  5A35 A;  4NXN Q;  1QB5 D;  1C4Q A;  3HOZ B;  3Q23 A;  2LS0 1;  2K01 A;  2K50 A;  5IT9 L;  1EQQ A;  1MSG A;  3PO3 H;  1K28 A;  4FNF A;  3JC6 6;  3HGB A;  1MBY A;  3L9A X;  1PV4 A;  4LMQ D;  5IP9 G;  3KFU A;  3AMU A;  2VQE L;  2HUG A;  4ZRZ A;  4HED A;  4QB4 A;  3FEW X;  1PTO H;  4HSV A;  1SE3 A;  3HG9 A;  4JOI A;  1OXU A;  4A4I A;  4X3S A;  3PQI A;  4A3B H;  2B2V A;  3EN2 A;  3EJI A;  3T53 B;  1Q12 A;  2X6G A;  4A75 A;  2ICE C;  4JI0 L;  1TY0 A;  5J39 A;  1T9H A;  2E76 C;  2ASB A;  4BBS B;  2V4D A;  3Q0A A;  1HA6 A;  1HNX L;  5EJW A;  1LT3 D;  1VQ6 A;  1PH5 A;  4DKA C;  1SRO A;  1C7Y A;  2F0E A;  4YWM A;  1A3U A;  3KDF B;  2VQE Q;  4LAA A;  3G6J B;  2KBN A;  3K5M A;  5C3E B;  1XTD A;  4OWW B;  2XRQ D;  1D5M C;  2B8G A;  3TP6 A;  2R93 B;  3K7A B;  1P8L A;  4PZ8 A;  4RH6 A;  4ZAI A;  1HZ9 A;  4DK1 A;  2UU9 L;  3M9B A;  4JI0 Q;  2EJF C;  3E6Z X;  1LO5 D;  4KJN A;  4OIJ A;  3EBE A;  2PPB C;  3CP0 A;  1HNX Q;  4LK1 C;  1RJT A;  1YZ6 A;  3QOL A;  1YNN C;  5EPJ A;  3PO2 G;  1KLU D;  4YY3 L;  1I6H B;  1K3B C;  1QVF A;  2JA6 H;  2IT1 A;  1IYJ B;  3S14 B;  3P7J A;  4K14 A;  1F9P A;  1SE2 A;  4KHZ A;  4L6T B;  4XIG S;  2K5H A;  2R7D A;  1JIC A;  5IGD A;  2LXJ A;  1R9T B;  2HDL A;  1S72 A;  1A63 A;  3AFP A;  4EQN A;  1PYB A;  1NR4 A;  1FNU A;  5EKK A;  1F9R A;  4TVA B;  2YU9 H;  3HOZ G;  2MQH A;  4B08 A;  2UU9 Q;  3U58 A;  3BDC A;  2WAQ G;  4JC0 A;  2IX0 A;  2E5L L;  3D4D A;  3A5U A;  3E0E A;  2VQF L;  2SNS A;  3E3X A;  4YY3 Q;  1E0B A;  1TU2 B;  4L8J A;  4IFD H;  1QCB D;  3HOU B;  1BR9 A;  3NBH A;  1I4G A;  3DUZ A;  2GVB A;  2Q2T A;  3VYS A;  3IFT A;  4V0B A;  1I5F A;  2K52 A;  1A62 A;  2KED A;  4I7A A;  3BZC A;  4KTA A;  1SFO H;  1SR3 A;  4JW0 A;  1AE2 A;  3S1R B;  1I50 B;  3HOV G;  4DR7 L;  2ICI A;  4C3J B;  5FLX L;  5I2X A;  1CI3 M;  1WTQ A;  1LT5 D;  1GO3 E;  2E5L Q;  4DUY L;  4A76 A;  2AUJ D;  2PCF B;  3KF8 A;  2RDG A;  3CMA A;  1PLF A;  4KJO A;  1JWU D;  2VQF Q;  4PNY A;  2E8G A;  1D2B A;  1IBM L;  1NMF A;  2NN6 H;  3I4N B;  3NWS A;  3X3N A;  1SYE A;  1BNZ A;  3T51 B;  5IYC H;  1VF7 A;  3S1M H;  5D3D A;  1RF2 D;  3BDL A;  4QIW B;  3OMC A;  4HJ5 A;  4F88 A;  1G8Z D;  3S15 H;  3BZD B;  4DGZ A;  3RMH A;  3DWA A;  2K5V A;  1SLJ A;  2GVA A;  1S5B D;  1GUO A;  5E3F A;  1MJC A;  1PH3 A;  1EU4 A;  3OW7 A;  4DR7 Q;  1NAP A;  3PIP A;  1SMY D;  3Q6S A;  1V1P B;  4WJ3 M;  3W3A A;  1GUT A;  4QGU A;  4DUY Q;  3G7L A;  1NCV A;  1VQ5 A;  2VB2 X;  1YVC A;  1C9O A;  2B29 A;  1B1Z A;  4K6D A;  3NUC A;  5GQO A;  3NXW A; 
#chains in the Genus database with same CATH homology
 3OTO Q;  5LMN L;  2FXQ A;  1IBM Q;  4B3T L;  4A3M H;  4DR4 L;  4DK3 C;  5M3F H;  4LFA L;  1IL2 A;  1X9N A;  3PF4 A;  1HNW L;  3PCO B;  1J5E L;  2EQS A;  4X62 L;  1B70 B;  4HJ7 A;  5JEA J;  3J7Z C;  5C0X J;  3PUZ A;  1XPR A;  4DV1 Q;  4LUZ A;  1EOV A;  2ID0 A;  2ZJP A;  3GTJ H;  3AEV A;  1VQA A;  2L15 A;  3H3V I;  2JA7 G;  2AWO A;  2XGT A;  4BXX G;  1Q46 A;  1EYG A;  4WJ4 A;  2UXB L;  3GO5 A;  3CAM A;  5BR8 Q;  2YTV A;  1QUQ A;  2Z6K A;  1KQS A;  1K83 H;  3RR5 A;  3J81 j;  3F2C A;  5HY6 A;  4PG3 A;  1VQF A;  3S24 A;  3GDE A;  2JEA I;  2NVY H;  2BH8 A;  1SMX A;  4NXM Q;  5FLX c;  1Z47 A;  3CCQ A;  3T1Y Q;  1PH4 A;  4RMF A;  3KF6 B;  5J3B A;  2DGY A;  2CWP A;  4GNX B;  1PH6 A;  3I4O A;  2K5N A;  3I2Z A;  4RG1 A;  3RLO A;  3PSI A;  3ZJY C;  4KI0 A;  4HID A;  4JI5 Q;  1U5K A;  1V1Q A;  5M5X H;  4A3F H;  4R4O A;  1ASZ A;  3LGJ A;  3HOY H;  3PUV A;  1N32 L;  5M5Y H;  3NEL A;  1YHA A;  4DV6 Q;  3Q8D A;  1K0R A;  4UP9 A;  4X65 Q;  4IPG A;  1YHQ A;  3RNU A;  2D0P A;  5AJ3 L;  2RHQ B;  5IP7 G;  3PUW A;  5FJ8 G;  5LMN Q;  1HNZ Q;  4R4I A;  2R7Z H;  4B3T Q;  4DR4 Q;  2UXC L;  4LFA Q;  1N34 L;  3GTM H;  1OXX K;  1HNW Q;  1J5E Q;  1Q81 C;  4R4T A;  4X62 Q;  3FP9 A;  4R1J A;  3H15 A;  5FLM G;  2QGQ A;  3CQZ H;  2IHE A;  2Q2I A;  2YYZ A;  3U4Z A;  2F4V L;  1VS0 A;  2R92 H;  4GOP A;  1QVG A;  2CWA A;  3IRB A;  4GNX C;  4IOC A;  4P73 A;  4LF8 L;  2WB1 G;  1S3O A;  2HIV A;  3KJO A;  4JI4 L;  1RIP A;  1X55 A;  3KDF A;  4OO1 G;  3J80 c;  4A3K H;  2UXB Q;  1YNX A;  3G6E A;  4A3C H;  3T1H L;  2VL6 A;  2MO0 A;  1TWG H;  1YEZ A;  1L1O B;  1EIY B;  2CKZ B;  1DGS A;  3I4M G;  1VQO A;  4A3D G;  4LWC A;  1X56 A;  1Y14 B;  1TWA H;  3D31 A;  5C44 H;  4JBM A;  1IBL L;  3F8T A;  2BA0 A;  2KHI A;  3L0O A;  4FDB A;  2JA5 H;  5C4J H;  1TWH H;  4DNI A;  1N32 Q;  2OTL A;  1YIT A;  4HJA A;  1HJP A;  5IE8 A;  2HT1 A;  2R7F A;  3ERS X;  2VUM H;  4R4C A;  3AYH B;  4JV5 L;  3PO2 H;  2NVQ H;  4DV0 L;  3ULL A;  3S2D H;  3PV0 A;  1LTL A;  2JJQ A;  4X66 L;  4IJH A;  4B3S L;  5GRO A;  4A3E G;  1N34 Q;  2UXC Q;  2NN6 G;  1CKO A;  1XMO L;  1K73 C;  3W1G A;  1BBU A;  4UP7 A;  2WB1 E;  1V9P A;  5GAG C;  1L1O C;  5IWA L;  1HH2 P;  5IYC G;  2F4V Q;  1HR0 W;  1NTG A;  1WCM H;  1MIU A;  4IJL A;  2YV5 A;  1HZB A;  1OXV A;  2WAQ E;  3F2D A;  1Y1V G;  3FKI H;  4QJF A;  4JI4 Q;  4LF8 Q;  4LFB L;  2V1C C;  4J15 A;  3U50 C;  2VW9 A;  3T1H Q;  3TEH B;  1Y1W H;  4JOI C;  3WWV A;  2ZTE A;  3CD6 A;  1A0I A;  4JBW A;  4BY1 G;  4HIO A;  1X6O A;  3SGI A;  3RZD H;  1W2B A;  1IBL Q;  1XNR L;  3U4V A;  3HOZ H;  2WFW A;  3S1R H;  2OQK A;  1GVP A;  1QVC A;  2VS1 A;  3CCJ A;  3ICE A;  4IO9 A;  3UE0 A;  1GD7 A;  1PHJ A;  4YWK A;  4C3J H;  3CCE A;  1PH2 A;  1KL9 A;  4QQB X;  1HZA A;  1HZC A;  3CC7 A;  2MO1 A;  4P74 A;  2K75 A;  4P72 A;  5LMU L;  3KYH C;  1K9M C;  4OX9 L;  4QIW E;  4JV5 Q;  2VNU D;  5IYB H;  1JE5 A;  2QEX A;  3PUY A;  3UDG A;  1EFW A;  1TWC H;  1E7Z A;  1XNQ L;  4DV4 L;  4X66 Q;  3S1N H;  1Q82 C;  4B3S Q;  4A3M G;  5DLQ E;  5C4X H;  1XMO Q;  4K0K L;  1RL2 A;  2JE6 I;  3UDF A;  5IWA Q;  1A8V A;  3G48 A;  1XPO A;  4LF4 L;  2JA9 A;  1CKM A;  1VQB A;  3PUX A;  3K8A A;  4NXM L;  3H3V H;  2CQO A;  1NJI C;  4GS3 A;  4OO1 I;  4LF5 L;  4JBJ A;  4APV A;  5GAE C;  1VQN A;  3H0G H;  4LFB Q;  3KOJ A;  2JK8 A;  4HIM A;  4MZ9 A;  4A3J H;  4KLK A;  4AQY L;  2Q2H A;  1VQC A;  2B63 H;  1M90 C;  2RF4 A;  3F1Z A;  4LUV A;  2ZTC A;  1KRT A;  1FGU A;  4OWT B;  2PI2 E;  1I3Q H;  1UEB A;  3CF5 A;  1XNR Q;  4JBK A;  4A93 H;  3GTL H;  1VQH A;  1X54 A;  1CUK A;  4P71 A;  1UWV A;  1MKH A;  4PMW A;  4LUO A;  3CME A;  4A3F G;  3CC2 A;  3HOY G;  2JA6 G;  4O2D A;  4QY7 A;  5IP9 H;  1ASY A;  1VQE A;  3A74 A;  5LMU Q;  4AYB E;  4OX9 Q;  4JG2 A;  4GLX A;  1XMQ Q;  1PH1 A;  1P16 A;  2UUB L;  3UDX A;  1XNQ Q;  4DV4 Q;  4JI6 L;  2MFI A;  4DUZ L;  3S14 H;  3NEM A;  4K0K Q;  1WYD A;  2F3I A;  4GN3 B;  4L5Q A;  4HJ8 A;  5C3E H;  1OXT A;  2CFM A;  4LF4 Q;  2PQA A;  2UXD L;  4POF A;  5M3M H;  4MTN A;  4IPH A;  1FVI A;  1YJN A;  2R92 G;  1WJJ A;  3M4O H;  2YTY A;  4LF5 Q;  4A3I H;  4L5R C;  3K7A H;  4A3K G;  2NVT H;  4A3G H;  2R93 H;  2ZM6 L;  1JB7 A;  1EWI A;  1KIX A;  4GN5 A;  1Q8K A;  4AQY Q;  1OTC A;  2N78 A;  2RCN A;  3S2H H;  3PGZ A;  4H02 A;  4X64 L;  1N8R C;  1FJG L;  4AIM A;  1YIJ A;  1K8G A;  3UE1 A;  3I7F A;  3M3Y H;  2EXD A;  4BBR G;  5C44 G;  2BH2 A;  1VCI A;  3J7A 5;  1TXY A;  3NBH B;  1Q1B A;  2JA5 G;  2OTJ A;  1V43 A;  4B3M L;  4IFD G;  2OWO A;  5IYD H;  5JJI A;  1I6H H;  4YCW A;  5IT9 c;  1VQJ A;  2NZO A;  2I5H A;  2VUM G;  1S40 A;  2CCZ A;  1VQG A;  1WOC A;  2UUB Q;  4EX5 A;  2IHF A;  3E9I A;  3M4P A;  3RN2 A;  4JI1 L;  3MXN B;  4JI6 Q;  1UE6 A;  1L0W A;  4DUZ Q;  4HIK A;  1VQ4 A;  2PI2 A;  3ULJ A;  2UXD Q;  2Y0S G;  2I5L X;  1KXL A;  2AMC B;  1R9T H;  1BKB A;  4X6A H;  1EQR A;  1WCM G;  3S17 H;  2JA7 H;  4DR1 L;  1GM5 A;  4BXX H;  3FKI G;  5GAD C;  1KRS A;  3CCM A;  4IPD A;  1CKN B;  5E7N A;  2ZM6 Q;  4GKK L;  3KF8 B;  1O7I A;  1X3F A;  3PF5 A;  2A19 A;  1HR0 L;  2XTI A;  3M7N A;  1YJ9 A;  4X64 Q;  2I5M X;  3CW2 C;  5GAH C;  1Y1W G;  1FJG Q;  4NXN L;  5JEA G;  4UY8 C;  2E2H H;  5C0X G;  3J80 i;  3CPW A;  4IOA A;  4JI2 L;  4GLV B;  2ZTD A;  1E1O A;  2VY3 A;  1KC8 C;  4B3M Q;  2B3G A;  3KF6 A;  2WP8 J;  4GNX A;  3K80 C;  1PH9 A;  1JMC A;  1X3G A;  2E2I H;  3GTO H;  1X3E A;  1WFQ A;  1E1T A;  1NMG A;  4YCU A;  1Q7Y C;  1MJE A;  1D7Q A;  1C0A A;  4Y7N H;  3TS0 A;  1VQL A;  3HOU H;  4ALP A;  1UE7 A;  5IP7 H;  4LW1 A;  5FJ8 H;  4GN4 B;  5IYB G;  2ZJR A;  4LF6 L;  1UE1 A;  4JI1 Q;  4KHP L;  3K81 C;  2LSS A;  1Z9F A;  2OQ0 A;  4O0A A;  3HOW G;  4GKJ L;  4Y52 H;  1PH8 A;  4POG A;  1LM0 A;  2KHJ A;  3DM3 A;  2I0Q A;  1E3P A;  1N36 L;  2KEN A;  2AHO B;  2IX1 A;  1J6Q A;  4DR1 Q;  1JT8 A;  3DLL A;  3B6Y A;  3AQQ A;  3JAM c;  4GKK Q;  3W1B A;  2C35 B;  3CCV A;  1OXS C;  1EUJ A;  5ELO A;  1I50 H;  1HR0 Q;  4DV3 L;  4NXN Q;  2GN5 A;  4DV5 L;  3I56 A;  5IY0 A;  1G51 A;  1Q1E A;  1VQ7 A;  4JI2 Q;  2K50 A;  1EQQ A;  3J81 c;  1XMQ L;  4BBS G;  3PO3 H;  1L1O A;  1PA6 A;  2IY5 B;  5C4X G;  4UP8 A;  3JC6 6;  5M3F G;  1IXR A;  1PV4 A;  4IFD I;  1JJG A;  4BY7 H;  1VQI A;  1CKN A;  5IP9 G;  2UUA L;  1G6P A;  1GKH A;  2AWN A;  3I4N H;  3KFU A;  4OWX B;  2VQE L;  2H5X A;  4DR3 L;  2ZJQ A;  1QUQ B;  4YWL A;  4YCV A;  4LF6 Q;  2ES2 A;  1KHI A;  4JOI A;  3I55 A;  2KCT A;  4A3E H;  4LF7 L;  4KHP Q;  3GTK H;  1OXU A;  4A4I A;  4GKJ Q;  5C3E G;  1PFS A;  4A3B H;  4DR6 L;  3EN2 A;  4UPA A;  1N36 Q;  5M3M G;  1TWF H;  1Y1V H;  3W5O A;  1Q12 A;  4IPC A;  3E9H A;  3TQY A;  4PZ6 A;  4A75 A;  3HOV H;  4A3L G;  2N49 A;  3CCU A;  1QZG A;  2R93 G;  1L2F A;  4JI0 L;  5JJK A;  1T9H A;  4DV3 Q;  2K14 A;  2ASB A;  2YTX A;  4DV5 Q;  2Z6K C;  1HNX L;  2ATW A;  2RHS B;  1SN8 A;  1VQ6 A;  3HKZ G;  1E22 A;  2HQL A;  2NZH A;  1PH5 A;  4DKA C;  2R7Z G;  1SRO A;  3RN5 A;  1PVO A;  3TS2 A;  1C7Y A;  1N9W A;  2AKW B;  2NN6 I;  2D0O A;  4GOP B;  1YI2 A;  1LYL A;  4C2M H;  4YWM A;  2UUA Q;  3CCS A;  1XJV A;  3KDF B;  4DR3 Q;  2VQE Q;  3TRZ A;  4BA1 I;  3HKS A;  3S1Q H;  2KBN A;  2MNA A;  4C3I H;  4LF7 Q;  1NE3 A;  1XTD A;  1IZ6 A;  4OON A;  4MNO A;  4OWW B;  4A3C G;  2KCM A;  1NBW A;  4DR6 Q;  2JA8 H;  1SE8 A;  1U0L A;  1X65 A;  3D0F A;  3K0X A;  3G4S A;  1P8L A;  4PZ8 A;  1VQM A;  4C3H H;  4LNQ A;  1NY4 A;  2R6G A;  4PZ7 A;  4DAM A;  4L5S A;  1HZ9 A;  2UU9 L;  4JYA L;  3OYY A;  3M9B A;  4GOP C;  1PYS B;  4B3R L;  4JI0 Q;  2BA1 A;  3L2P A;  5LMN W;  3UDI A;  3HKZ E;  4XTC S;  3HOX H;  4GLA C;  3CP0 A;  1HNX Q;  2Z0S A;  2EIF A;  1YZ6 A;  2HIX A;  1W3S A;  3K7U C;  5M5W H;  1AE3 A;  3PO2 G;  4ME3 A;  1BBW A;  4YY3 L;  3A5Z B;  1JJC B;  2PMZ E;  1QVF A;  1KD1 C;  1XPU A;  3CPF A;  2JA6 H;  2IT1 A;  1IYJ B;  3KLW A;  5ELN A;  5HGQ A;  3GD7 A;  3PIO A;  4DR2 L;  3GTG H;  1Q86 C;  4JCV E;  3OW2 A;  1CSQ A;  4KHZ A;  2NVX H;  3HOU G;  4XIG S;  2K5H A;  1IBK L;  2R7D A;  4OXP A;  4DV7 L;  2LXJ A;  1S72 A;  1A63 A;  1LUZ A;  1EIF A;  1E24 A;  1BVS A;  3AFP A;  1PYB A;  3VDY A;  1YJW A;  4JI7 L;  4AH6 A;  2A8V A;  2JEB I;  4TVA B;  2YU9 H;  1SRU A;  4DV2 L;  3EIV A;  2MQH A;  2UU9 Q;  3HOZ G;  2DUD A;  3U58 A;  4DAY B;  4JYA Q;  4B3R Q;  2WAQ G;  4L5T A;  4JC0 A;  2IX0 A;  4DK6 C;  2E5L L;  3S16 H;  3M85 A;  5JJL A;  3A0J A;  4YHH L;  4LF9 L;  3A5U A;  3E0E A;  4LFC L;  4BBR H;  4JI8 L;  1VQ9 A;  2VQF L;  3PO3 G;  4YY3 Q;  2Y0S E;  3TRE A;  4NPS A;  2Q2U A;  4JI3 L;  3BJU A;  4TQU S;  3GTQ H;  3HFZ B;  4BY7 G;  5FLM H;  3KJP A;  4DR2 Q;  4P75 A;  1K8A C;  2VZA A;  1YHB A;  3I4N G;  2GVB A;  3ER0 A;  3BZK A;  2Q2T A;  5AJ3 Q;  1IBK Q;  3RZO H;  4DV7 Q;  3CCL A;  1I5F A;  3H0G G;  3NEN A;  2HHH L;  2K52 A;  1A62 A;  4DPG A;  4HJ9 A;  4A3J G;  3M4Q A;  1VQP A;  4A3B G;  3CXC A;  3BZC A;  2K4K A;  1JJ2 A;  1SFO H;  2E2J H;  1SR3 A;  2B63 G;  3I4M H;  1VQK A;  1I94 L;  4A3D H;  1AE2 A;  2N3S A;  4JI7 Q;  1FL0 A;  4DV2 Q;  2UUC L;  3HOV G;  4DR7 L;  4A93 G;  1UE5 A;  1WI5 A;  2ALY B;  1KAW A;  1M1K C;  1GO3 E;  3FHW A;  1B8A A;  4DUY L;  2E5L Q;  4A76 A;  4DR5 L;  2F52 A;  2OCE A;  4YHH Q;  1QZH A;  4LF9 Q;  3AFQ A;  3CMA A;  3RLN A;  3JAM i;  4LFC Q;  1N33 L;  4QL5 A;  4JI8 Q;  3G71 A;  2VQF Q;  3OTO L;  2E8G A;  2LXK A;  4R4Q A;  2PQA B;  1NMF A;  5EAY A;  1IBM L;  3BU2 A;  4JI3 Q;  4A3L H;  5IYC H;  3J81 i;  4DV1 L;  3S1M H;  3CCR A;  1VQ8 A;  4DV0 Q;  1B7Y B;  3GTP H;  3ULP A;  1AH9 A;  4EQ5 A;  4A3I G;  1YBY A;  4IFD J;  4HJ5 A;  5BR8 L;  2PNH A;  4AYB G;  2HHH Q;  3HOW H;  4A3G G;  3S15 H;  3MEF A;  2JA8 G;  2K5V A;  1SLJ A;  1PH7 A;  2GVA A;  1I94 Q;  4BY1 H;  3L7Z C;  5C0X I;  1H95 A;  3T1Y L;  1MJC A;  1PH3 A;  5K36 G;  2D62 A;  2A1A A;  1VQD A;  2N8N A;  2UUC Q;  4JI5 L;  3PIP A;  4DR7 Q;  1K3R A;  4WJ3 M;  1CSP A;  3STB D;  4QGU A;  2QA4 A;  5IYD G;  4DUY Q;  3HOX G;  3CC4 A;  1VQ5 A;  4DR5 Q;  4NB3 A;  3RLF A;  3STB C;  3F2B A;  4DV6 L;  4X65 L;  1YVC A;  1D8L A;  1C9O A;  2B29 A;  1G29 1;  2JQO A;  3EBE A;  5GQO A;  1N33 Q;  4BBS H;  5H1S E;  1HNZ L;  4BA2 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...