4JI5L

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
124
structure length
123
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 13
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ji5L00
4OWTB 3UE0A 4B3RQ 4GKJL 3JAMi 1XPOA 3RZOH 3NELA 3U4ZA 4X65Q 2F4VL 2RF4A 1C0AA 3K80C 1D7QA 2QA4A 3H15A 1UE6A 4DV0L 3BU2A 1XJVA 4HIMA 4AQYL 3KOJA 1JMCA 4AIMA 1O7IA 4LFCL 2OTLA 1HR0L 3S16H 4P75A 4KHPL 1EIFA 4DV3Q 2JQOA 3M4PA 4PZ6A 3CCLA 1SR3A 3STBC 1K0RA 2EXDA 3E0EA 1YHBA 3U58A 1E3PA 4R4CA 2KCTA 2NVQH 4KLKA 4POFA 2OCEA 3I4MH 1HZCA 1ASZA 1YJNA 4DR4Q 2VQEL 5IY0A 5FJ8H 1Q12A 2MNAA 3K0XA 5IYBG 4YWMA 1N34Q 5ELOA 1FL0A 2PI2E 3KDFA 5C44H 5FLMH 3S1RH 1Y1VG 4GNXA 2K75A 3UDGA 1OTCA 1IXRA 1EQRA 3PUWA 2QGQA 5IWAQ 2VQFL 4DR3Q 2L15A 2VUMH 1C9OA 1P16A 1Q46A 1N36Q 3GTQH 3HOVH 4R4TA 5K36G 2BA0A 3HOYH 4QGUA 4BA2I 2JK8A 1XNQL 4NB3A 1K9MC 2Q2IA 4PZ7A 4DR6Q 1N8RC 3M7NA 2EIFA 5GROA 1EUJA 3KF6A 2JA5H 4O0AA 4A3MG 3K7AH 1PH8A 1BBWA 3GD7A 1TWGH 4A3DG 5AJ3L 2N3SA 3H0GG 3PO3H 4GN5A 3HOWH 1N32Q 1I6HH 2K5NA 3SGIA 2A19A 3PF4A 4IOAA 2Z6KC 4AQYQ 5GAGC 2K50A 2XTIA 1HR0Q 4KHPQ 4LFAQ 1L1OA 3PSIA 1L1OB 4YCWA 1TWHH 1PH4A 4GOPA 3S15H 5FJ8G 4LF6L 4LF9Q 3M9BA 1NTGA 2UUBQ 2B29A 4OWXB 4HJ9A 3CQZH 4BY7G 1U5KA 1BVSA 4DR2Q 4LF4Q 4A3MH 2VQEQ 3ER0A 1NMGA 4DR7L 3EN2A 4APVA 1X65A 4BBSH 4JI8Q 1QVFA 3CW2C 2ZTCA 3RLFA 4DAYB 4GNXC 4A76A 1N34L 4JI6Q 3BJUA 1CUKA 2CWAA 4GS3A 4IOCA 1YJ9A 3S17H 2IX1A 1J5EL 2B63H 4YCVA 4JI3L 5C4XH 2IT1A 4FDBA 4DKAC 1X9NA 1EYGA 4LFCQ 3CCVA 4OX9Q 1XPUA 2MO0A 2GVBA 4C2MH 1YITA 1RL2A 3TEHB 3A0JA 1MKHA 1VQPA 3E9IA 4BBSG 2MQHA 3J80c 1X55A 4LF9L 4GN4B 3CCJA 2UUBL 3CC2A 1IBLQ 1R9TH 1UE7A 2NVYH 4A3CH 3F2BA 1B70B 1K8AC 2VW9A 1CKNB 1VQEA 2QEXA 4A3FG 1HZ9A 1K8GA 2F3IA 3U4VA 1N33Q 3H3VH 2YTYA 4HJ7A 4ME3A 3PUVA 3S1MH 2OTJA 1MIUA 2NZHA 4NXML 1HJPA 3PUYA 4DV4Q 4HIDA 5IP7H 1EOVA 3G6EA 1T9HA 1PH5A 1OXTA 2KHJA 1YEZA 1VQAA 1L1OC 5FLMG 1PH1A 4A3BG 2YU9H 1TWCH 3EIVA 2JA5G 3AFQA 1CKOA 2I5HA 3I7FA 5IYDG 1AE2A 1M1KC 1PVOA 3NBHB 4Y7NH 4LFBQ 3G4SA 1YJWA 2Q2HA 2UUAL 3FKIH 4A3GH 1EFWA 3K8AA 4DUYQ 4A3IH 2XGTA 5M5WH 3BZCA 4KI0A 1VQ9A 4K0KL 5BR8L 1I5FA 4DR6L 1I3QH 2ZTEA 2WAQG 2WFWA 3T1HQ 4JI7L 1A63A 4AYBG 4NPSA 3S14H 1GVPA 1UWVA 1V9PA 4YHHQ 2AWOA 5C0XJ 4DV1Q 4LUVA 1PHJA 5M3MG 1IBMQ 4OWWB 1W2BA 1PA6A 3F8TA 3L0OA 2RHSB 4JI2Q 1VQOA 1Q8KA 1Q81C 1JB7A 3M4OH 5C3EG 2UXCL 2D0PA 2Q2UA 4OX9L 4DR5Q 3AFPA 5J3BA 3OTOQ 2NVXH 1VQFA 2UU9Q 2D0OA 2ASBA 3J7A5 2N78A 3L7ZC 4J15A 1FGUA 1HR0W 1JJGA 5LMNW 4MNOA 3STBD 2UUAQ 4A3JG 4ALPA 1KL9A 4A4IA 5IP9H 1XMQQ 4P72A 4JYAQ 3TREA 1XPRA 5C4XG 4LF5L 1IYJB 3TS2A 4GOPC 1KIXA 4A3BH 4DR7Q 3I55A 1CSPA 5GADC 4DK6C 1XMOQ 1KAWA 4BY1H 3I4NG 4JCVE 4GKJQ 2A1AA 3ULJA 4IO9A 1S72A 1VQ7A 4NXMQ 1VQ6A 1X3FA 1AE3A 3A5ZB 4TQUS 1VQBA 3ZJYC 4GNXB 3TRZA 2VS1A 2JA9A 5C3EH 4AH6A 3F2CA 4OO1I 4OXPA 5LMNQ 3TS0A 4A3LG 2K5VA 1K83H 1Q1BA 2DGYA 1QZGA 1RIPA 3IRBA 2VNUD 1YZ6A 4DAMA 1N9WA 3G71A 1UE5A 1JT8A 3M3YH 1Q82C 3NENA 5BR8Q 4DV5Q 1K73C 1BKBA 3J81i 1YVCA 3RZDH 1KC8C 2IY5B 3D31A 4DUZQ 2R92H 1A0IA 1VQCA 4C3HH 1P8LA 2RCNA 1WI5A 3MXNB 4X62L 4LUOA 3T1YL 1HNZQ 1OXXK 1TXYA 2UXBQ 5JEAJ 4DV4L 4A3EG 1S40A 1KXLA 4X64L 1SRUA 3PV0A 4IFDJ 3UDFA 4DV0Q 3PIPA 4JV5L 2UXCQ 3I2ZA 1Z9FA 3HFZB 3EBEA 2YV5A 4AYBE 1WYDA 2AMCB 3JC66 4MTNA 4JI1Q 4A3KH 1VQKA 1YI2A 2CKZB 4X6AH 1JJCB 2ZTDA 3GO5A 3DM3A 3MEFA 4P73A 5IE8A 4GLXA 3OW2A 2E8GA 4HIOA 1PH6A 1N36L 2VL6A 4IPCA 1EIYB 2JA7H 1UE1A 4JI0L 4A3IG 1XNRL 4QY7A 3KJOA 3KJPA 4A3EH 1PH9A 2WB1G 2LXKA 3RLNA 3H3VI 3J81j 1QUQA 4UY8C 2HHHQ 2ZJRA 4YHHL 1PH2A 4JBJA 3HOUH 4DR1Q 1XMOL 4B3TQ 4YCUA 3I4OA 2NZOA 4A75A 3CC4A 2AKWB 3GTLH 4JI8L 1G291 2I5MX 2UXBL 1LM0A 4RMFA 5AJ3Q 2JA6H 4HJ5A 1E22A 1HNWL 4JBMA 3PGZA 1X3EA 2ZM6L 4BXXG 3HOXG 1DGSA 4JI5Q 3CCEA 2H5XA 3GTJH 1PFSA 1VQJA 4DR5L 1KHIA 3AYHB 3OTOL 1Q86C 3RN5A 3WWVA 4HIKA 3K7UC 5M3FH 4WJ3M 1G6PA 4LF6Q 5IYCH 1HZBA 3L2PA 3UE1A 1YNXA 1MJEA 3CPWA 3ICEA 4R1JA 1GD7A 4DV2Q 1X3GA 3GTMH 4JOIA 3S1QH 1EWIA 4JI4Q 1PH3A 2ATWA 3A5UA 2UUCQ 2KENA 1IBKQ 3S2HH 3HOZH 1U0LA 1G51A 1HNZL 4JC0A 1VS0A 3W1BA 4DNIA 4BY1G 3I4NH 1GO3E 3RNUA 1NJIC 1E1TA 3DLLA 4OONA 1SFOH 2CFMA 3HOWG 4X64Q 2HT1A 3PO3G 1E7ZA 3W5OA 3HKZE 1BBUA 2HIXA 5M3FG 1KD1C 2NVTH 3KFUA 1CKMA 4IJLA 4A3DH 2MFIA 1QVGA 1FJGL 1B8AA 5FLXc 3W1GA 2B3GA 3UDIA 4C3JH 5C0XI 3Q8DA 1Z47A 1QZHA 1XNRQ 4A3LH 2JA6G 4O2DA 1Y1WH 4GN3B 1KQSA 4DPGA 1PYSB 2LXJA 4GLVB 3T1HL 3KDFB 1VQ8A 3CXCA 5M5XH 1S3OA 5C44G 4B3RL 1VQMA 1CKNA 2OQKA 4LF8L 4IPDA 1D8LA 2NN6G 4XIGS 1WCMG 1W3SA 3J81c 1HNWQ 4JV5Q 2ZM6Q 2WB1E 4GKKL 4QQBX 2OQ0A 4IJHA 4DV7Q 3B6YA 3CC7A 4B3SQ 2E2HH 3ULLA 3I4MG 3UDXA 2JE6I 3S24A 5H1SE 4LNQA 3HOYG 3M4QA 1HH2P 2PMZE 3HOVG 4L5SA 3PO2G 4LFBL 4R4QA 4DV3L 5GAHC 2Q2TA 4K0KQ 2HQLA 3J80i 2IHEA 1VQNA 2KHIA 3LGJA 4DV6Q 1VQGA 1ASYA 1E24A 1KRTA 3VDYA 2K14A 1JE5A 4BA1I 4IFDG 1IBKL 4B3TL 3CMAA 3RLOA 1XTDA 4YWKA 2E2IH 1NY4A 4MZ9A 4X65L 2F4VQ 4HJAA 5GQOA 2K52A 3J7ZC 2N49A 1WJJA 4JI2L 2UXDQ 2CCZA 5LMNL 1V1QA 2Y0SG 2YTXA 5EAYA 2BH8A 4EX5A 2KCMA 1OXUA 1FJGQ 3CP0A 4PMWA 4JOIC 3F1ZA 1SMXA 1SROA 1VQ5A 2V1CC 3S2DH 5IYCG 5C4JH 1QUQB 1YHQA 3K81C 4DV5L 4LF5Q 1SE8A 2K5HA 3OYYA 3CCRA 4JYAL 4LUZA 1Y14B 3CPFA 3HKZG 4L5TA 3A74A 4R4OA 1PH7A 1NBWA 2BA1A 2IX0A 3KF6B 1X56A 3U50C 4YY3L 3FHWA 3I56A 4EQ5A 3ULPA 2VY3A 1SLJA 5LMUL 2E5LL 1UEBA 4KHZA 3FP9A 1QVCA 5M3MH 4LF8Q 4JI6L 5HGQA 4L5QA 4B3MQ 1B7YB 3CCSA 1K3RA 2WAQE 2LSSA 5IT9c 5C0XG 4GKKQ 4IFDI 4UP7A 5ELNA 3CCMA 1Y1VH 4B3SL 2UXDL 4GLAC 5JJIA 4LFAL 1WOCA 2F52A 2N8NA 5IWAL 2VQFQ 3HOZG 4JI1L 4GOPB 2GN5A 3RN2A 3KYHC 3CD6A 1Q1EA 3NEMA 4A3FH 1TWAH 1EQQA 1V43A 1IL2A 3PIOA 2CWPA 1YHAA 3KF8B 1OXVA 4P74A 4QL5A 4A93G 1CSQA 1LYLA 1Y1WG 4LF7L 2JEAI 2MO1A 4JG2A 4OO1G 4X62Q 2YTVA 4DK3C 1GM5A 2R93G 2HIVA 2PQAB 2ES2A 3TQYA 4YY3Q 1YBYA 4NXNL 4DR1L 3T1YQ 2D62A 3E9HA 3PUZA 2GVAA 4L5RC 2OWOA 5LMUQ 1FVIA 2JEBI 1LTLA 1MJCA 3F2DA 1PV4A 4UPAA 2JA8G 3KLWA 4X66L 3HOXH 4BY7H 3CMEA 4JBKA 2ID0A 1J5EQ 4DV7L 2PNHA 4Y52H 4HJ8A 4A93H 4A3CG 3JAMc 4JBWA 4C3IH 1Q7YC 3S1NH 4UP9A 2RHQB 1J6QA 2BH2A 4H02A 1HNXQ 1PYBA 5JJLA 4JI0Q 1VQLA 4PG3A 4BBRH 5IP7G 1JJ2A 4DV2L 4DV6L 1VQDA 3M85A 1IBLL 1GKHA 1X6OA 4BXXH 5JJKA 2R7DA 2Y0SE 3G48A 4YWLA 4JI7Q 1VCIA 3PO2H 2JJQA 4DR4L 4UP8A 2Z6KA 1VQHA 4PZ8A 2PQAA 4NXNQ 2JA8H 3HKSA 4QIWE 3CCUA 1C7YA 2A8VA 3D0FA 3CAMA 4IPHA 4WJ4A 2I0QA 2VZAA 5E7NA 4JI3Q 1H95A 1KRSA 2AHOB 1HZAA 3GTPH 1L2FA 1NMFA 4R4IA 3CCQA 3HOUG 2VUMG 3PCOB 2Z0SA 2FXQA 3BZKA 5DLQE 2R93H 5IP9G 4DR3L 4A3JH 1A62A 1TWFH 1E1OA 2B63G 4BBRG 2R7ZG 1HNXL 3GTKH 2R6GA 1A8VA 2YYZA 1NE3A 1XNQQ 2JA7G 4LW1A 2NN6I 4LWCA 2IHFA 3CF5A 1I94L 2HHHL 4A3KG 4JI4L 4IPGA 2UUCL 3AQQA 5GAEC 1N33L 1VQIA 4RG1A 2K4KA 2ZJQA 2E5LQ 4DV1L 1M90C 3H0GH 1WFQA 3PF5A 2C35B 2E2JH 1IBML 3GTOH 2AWNA 2PI2A 1X54A 2I5LX 5M5YH 1YIJA 4B3ML 3AEVA 1LUZA 2ALYB 3ERSX 3GDEA 4X66Q 5HY6A 4JI5L 1N32L 4P71A 4XTCS 2EQSA 2WP8J 3RR5A 2ZJPA 1AH9A 1I50H 5IYBH 4TVAB 1IZ6A 2UU9L 4DUYL 2R7ZH 2CQOA 2DUDA 4POGA 1XMQL 3FKIG 4A3GG 4QJFA 2R92G 1WCMH 2KBNA 4LF7Q 3GTGH 2R7FA 1L0WA 5IYDH 3PUXA 1OXSC 5JEAG 4DUZL 1I94Q 1SN8A 4DR2L 4LF4L 1VQ4A
chains in the Genus database with same CATH superfamily
2DY7A 5FLXL 4ILWA 2F4VL 4OGQC 2EY2A 5G3LF 3K80C 4RA8A 4F88A 1D7QA 1XXGA 5CR3A 3H15A 1U4LA 3S16H 1DD2A 1S5CD 4DV3Q 2A6HD 1II3A 3CCLA 1K0RA 2F0DA 5IOCA 1ILPA 1BCPB 1YHBA 2X6GA 3U58A 2KCTA 3RMHA 4POFA 2OCEA 2WKCA 1BR9A 5E3FA 1WCMB 1Q12A 3R93A 5IYBG 1KTKA 5JOBA 4QUCA 3IFDA 4GNXA 2PMZB 1QILA 4KV6A 1FNWA 3PUWA 2QGQA 2G5DA 1SYGA 5IWAQ 1UUPA 1P16A 5KYIA 1YNJC 4QGUA 1K28A 4BA2I 1XNQL 3C1FA 4NB3A 3K5OA 4K2KA 4IUTA 5EPJA 5C3XA 1XTCD 2SDFA 2JA5H 2F0WA 4L6TB 4I7ZC 3C2PA 2F0JA 2LMCB 4GN5A 4G7HC 1I6HH 1OO9B 1AFPA 3PF4A 1GXDC 5M9OA 1TS2A 2P5ZX 1CZGA 1PH4A 1L1OB 1EOTA 1I6VC 1TWHH 4NW2A 3D8GA 2F0HA 1PZKD 3SK8A 2NN6H 4OEMB 1BVSA 1X65A 3RLFA 4G4KA 5BN5A 4HR7B 3J81L 3KLSX 1DZ1A 3MVVA 3BJUA 1JWMD 4KY5A 3SR1A 1EYGA 4LFCQ 3CCVA 2GVBA 5C5LA 1RL2A 1STNA 1S5BD 2MQHA 1HTLD 1F77A 1IBLQ 5JJZA 2NVYH 3M3YB 1B70B 5JAVA 1CKNB 4A3FG 4CJ0B 2YTYA 4ME3A 3KLSA 1MIUA 3SK4A 5FO8B 2D9UA 1T9HA 1PH5A 2KHJA 1WTPA 1L1OC 1TWCH 1JOOA 1CKOA 1SNQA 1STBA 2I5HA 1PVOA 3NBHB 3I90A 4Y7NH 3MC0B 5D3IB 1EFWA 2XGTA 3BZCA 1V8QA 1EU4A 1I5FA 1SYFA 4CKCA 2ZTEA 2WFWA 1I4HA 1A63A 3MEHA 4I65A 3TP8A 3NE5B 4AYBG 1RKNA 1V9PA 1SNMA 3GTKB 1PHJA 4OWWB 5M3MG 1RD9D 3HGBA 3BVZA 5IGGA 2EVBA 5C3EG 3FPPA 3WOFA 5IGEA 5J3BA 3OTOQ 4FO2A 1VQFA 2UU9Q 4OELB 2K7VA 2N78A 1CTMA 4MNOA 4A4IA 4P72A 1ML0D 3TREA 2EJGC 4LF5L 3TS2A 5E4XA 4DR7Q 3NQTA 1KAWA 1JQYD 4JCVE 4GKJQ 3E3XA 1B9NA 1VQ7A 1AE3A 3A5ZB 3F2CA 4AH6A 3HKZB 1Y8PB 1JR0D 4EVOA 2DGYA 1QZGA 4FNFA 1LTTD 2E76C 3OW7A 5JPMC 3G71A 2YU9B 1A3UA 1Q82C 2EYPA 1BKBA 1KC8C 2R92H 1HXYD 1A0IA 2QF7A 2XWJB 2RCNA 3A8IE 1QCBD 2UXBQ 2QKIC 4F7XA 4X64L 1SRUA 3I2ZA 2YV5A 4OHJA 2CKZB 2KCCA 1PH6A 3HOXB 4P73A 3O13A 1HPCA 3VR6A 2E8GA 4HIOA 3OW2A 1EIYB 4G7ZC 3KJOA 3KJPA 1CM9A 2LXKA 4IURA 3H3VI 4JW0A 3J81j 4UY8C 2KQ3A 2ZJRA 4JBJA 3HOUH 1JICA 1SNPA 2AKWB 5EKKA 1G291 2I5MX 4RMFA 1HNWL 4JBMA 5CYUA 2A5HA 1PFSA 3I73A 3AYHB 5M3FH 1NSNS 1YNXA 3CPWA 3ICEA 1GD7A 4DV2Q 3KBXA 3GTMH 1O78A 3HOUB 3RD4A 4JI4Q 1PFMA 3NXWA 3TDQA 1IL8A 1TWGB 1KNAA 1IBKQ 4A3GB 2IL8A 3HOZH 1HNZL 5J22A 3RNUA 5J39A 4OONA 1SFOH 3HOWG 3PO3G 1E7ZA 1D1IA 3W5OA 1BBUA 5M3FG 3TP6A 2Z6BA 2O5IC 2MFIA 3NPPA 2JSOA 3W1GA 5C5MA 4C3JH 5EGTA 3CHBD 4GN3B 3KDFB 1S4ZA 5CV7A 1JB3A 3EFXD 3CXCA 1PRTF 2EOTA 2B2TC 5AFWA 4CGYB 2QILA 4RGOS 4R8IA 5C4HA 1SYCA 2QDLA 4JV5Q 4IJHA 3CC7A 2LY7A 2E2HH 3I4MG 3UDXA 4L63B 2BE5D 3VYRA 5H1SE 1TS5A 2K05A 3VR4A 3PO2G 4DV3L 1GHJA 4RHRA 2Q2TA 1QJOA 4EQNA 2RA4A 4WFN3 4ZUIA 1F2LA 5EBCA 1PFBA 1ASYA 3VDYA 2K14A 2LS01 1JE5A 3CMAA 1Y1WB 1SSOA 1MSHA 2E2IH 1NY4A 4C1NK 4X65L 1U4PA 1AZPA 5GQOA 5M3FB 2K52A 4U673 2N49A 1WJJA 4JI2L 2UXDQ 5E4WC 2CCZA 2BCOA 4EGVA 2BH8A 3D4WA 2KCMA 3TZUA 2PNRC 1FJGQ 3E6ZX 3NHHA 4PMWA 4B9XA 5I2YA 1VQ5A 2V1CC 3ONAB 3S2DH 2K33A 1TY2A 1CA6A 2HQEA 1SE8A 1QE6A 3CCRA 2OXPA 1Y14B 3HKZG 3KF6B 1X56A 1F2YA 3ULPA 2VY3A 1EY9A 1SLJA 5LMUL 4JI6L 4L5QA 4B3MQ 1B7YB 4OO1H 4GKKQ 2LSSA 1HFNA 3UI2A 2F52A 2F0UA 3I8ZA 1Q1EA 3NEMA 3BYTB 1IW7C 1V43A 5CV5A 3PIOA 3NQIA 1UEAB 3TZDA 3KF8B 4P74A 3KF8A 1LYLA 2JXMB 2E2DC 1Y1WG 3DWPA 4OO1G 4JG2A 4X62Q 3LX0A 4DK3C 4RWSC 3TQYA 3T1YQ 3KLRA 2GVAA 2PQEA 3DWAA 1F9QA 5EPKA 1VDZA 3LNNA 4JBKA 4C3HG 2PCFB 2PNHA 4HJ8A 1KAAA 2AQ1B 1BUVT 4TRDA 4H02A 1HNXQ 1CI3M 1PYBA 4JI0Q 4PG3A 5IP7G 4DV2L 1VQDA 2XNAC 1IBLL 5JJKA 2BDNA 2F0LA 2J0TD 3VYTA 3MXPA 3CQZB 4V0BA 1PXUA 4X3KA 1CHQD 2JJQA 1PTOD 2EYMA 1WTOA 2PQAA 1PTOF 2KHSA 3HKSA 1SEBD 3D0FA 4IPHA 4WJ4A 5CBEE 3H94A 2J4XA 1HZAA 4XQNA 3DXJC 4IN3A 3HOUG 5KGUA 3A7AB 2J7ZA 1J9OA 1GOZA 3MAQA 4XYQA 5IP9G 1A62A 5TSSA 3X3MA 4Z9CB 2B63G 2L5TA 2R7ZG 1U4MA 4KJOA 1A8VA 3K7AB 2JA5B 4KMUC 4LW1A 2IJ0A 3QOLA 1I94L 1LTRD 3AQQA 1N33L 2AQ2B 1RODA 3K59A 5JEAH 3GTOH 4K8IA 2C35B 1LABA 4EQPA 1YIJA 1PRTB 3CU7A 2F3WA 4X66Q 1N32L 3S2DB 4K6DA 3RR5A 3URYA 2ZJPA 1AH9A 3FDTA 1ENCA 4TVAB 5C44B 1IZ6A 4K5WA 2F0GA 4LAAA 2UU9L 1EZ6A 2DUDA 4TSSA 3D6WA 1XMQL 2N55A 1WCMH 2D5DA 5IYDH 1PMRA 4XXEA 3CRKC 4DR2L 2IW3A 4OWTB 3GV6A 4GKJL 1HCZA 3RZOH 4X65Q 3H09A 1C0AA 1MSGA 3MWYW 1F2ZA 1DYQA 2R61A 2O4XA 4AQYL 2B63B 1HR0L 4KHPL 4P75A 3V2TA 1EIFA 5FO9B 1HUMA 1SR3A 1SMYD 4HEDA 2F0VA 2CW0D 1WTHA 1D6EC 1E3PA 4R4CA 4KLKA 3I4MH 4HAEA 3OIQA 1YJNA 2FINB 3T16A 1R9TB 5IY0A 5FJ8H 2F0MA 2WB1B 4YWMA 1N34Q 2PI2E 1GUSA 5LL6X 1TWHB 3PMFA 2EDGA 1OTCA 1IXRA 2K04A 3BDLA 2RCFA 3FRPB 1QOHA 2B2VA 1R4QB 5IGFA 4DR3Q 1BF4A 3FVQA 1JOQA 1Q46A 1B3AA 2EY1A 2FFKB 1N36Q 4KKTA 3HOVH 3HOYH 3J7AV 2FMMA 3OIPA 2B2YC 3I91A 3A8KE 2Q2IA 4PZ7A 3U9OA 3M7NA 2EIFA 2HDMA 3EQLC 3GP7A 3HOZB 1K8MA 2Q8TA 5LHY1 4CJ1B 1TWGH 4A3DG 1SJHD 2KVMA 3S15B 1SE3A 3J7AF 2K5NA 2RSNA 4DA2A 2Z6KC 2K50A 2XTIA 2K6AA 4NMZA 5A2QL 3DEOA 3MFYA 3S15H 1GUWA 3BVGA 1NTGA 2H1EA 2UUBQ 3GTOB 4HJ9A 4BY7G 1O80A 1KDAA 3KBGA 4LF4Q 1UAPA 4A3MH 3ER0A 4DXGA 2E74C 4APVA 1Y69U 4BBRB 2WAQB 1QVFA 4A76A 4DAYB 5JPNC 4GNXC 5KIXA 1B44D 2E2HB 4JI6Q 4GS3A 2CWAA 3S17H 3S16B 1FNUA 5C4XH 3LWEA 1X9NA 1VMCA 1GUTA 4G7OC 2MO0A 1YITA 1MKHA 1ENAA 2L4NA 3J80c 4R8NA 4GN4B 3CCJA 3CC2A 1R9TH 3SK6A 2XRQD 3K0YA 1K8AC 1VQEA 1N33Q 2F3IA 3PUVA 2OTJA 2R92B 3BDCA 4NXML 1HJPA 1E0BA 2PW5A 1JORA 1GJXA 2B2WA 3TN2A 3P20A 1FNVA 1I50B 2F0QA 1D5XC 3ND8A 5FLMG 1PH1A 3X3NA 4A3BG 3BZDB 2JA5G 3AFQA 3I7FA 3NBHA 1LTBD 2Q2HA 5ELCA 4Q5VA 4A3GH 1PYWD 5M5WH 1QNKA 4KI0A 4EQOA 5BR8L 4RCOA 2WAQG 4NPSA 4H7BA 3W3AA 5KNDA 1EWCA 2AWOA 2M2LA 4K5XA 1GUOA 3L0OA 1VQOA 4IUPA 2D2CC 3A55A 4IZ8A 2RQXA 2D0PA 2Q8RE 2Q2UA 1QNUA 1ZXTA 4DR5Q 2NVXH 5FLXE 4K8JA 2D0OA 4XQJA 5JVG3 3A56A 4J15A 5T1IA 4ALPA 1ICFB 2EYLA 4JYAQ 3K58A 1IYJB 1V1PA 3OSOA 1KIXA 1NCVA 4A3IB 1CSPA 4HSPA 4PMCA 2A1AA 1X3FA 4CDDC 3ZJYC 2VS1A 1HTPA 3S1NB 4OO1I 1B2TA 3IRBA 3H6MA 1N9WA 2CW0C 2XWBB 1NR2A 3NENA 2A6HC 5FO7B 3M7GA 3J81i 2K5WA 3D31A 1P8LA 2DY8A 4X62L 1RTOA 4RCNA 2F0TA 3EVQA 5EKIA 4KY7A 1S40A 2B2TA 3U9SA 2WKDA 1BBXC 1GUGA 3PV0A 4IFDJ 1TIID 3OPOA 3PIPA 2UXCQ 1Z9FA 3HFZB 3EBEA 2NUCA 1CQFA 2OEOA 1VQKA 1YI2A 4X6AH 1TVXA 1JJCB 2ZTDA 1EY6A 3GO5A 3I70A 5IE8A 2VL6A 1UE1A 4JI0L 1RCVD 2ZXRA 4CKEA 3J80E 4A3IG 1XNRL 2BE5C 3NTKA 2L12A 2A69C 1XMOL 2NZOA 1Q90A 2UXBL 3BG3A 2PYKA 3SE0A 3BS1A 3PGZA 1ESRA 2XVSA 1DGSA 1Y8OB 5ELBA 3CCEA 3GTJH 3OTOL 3WWVA 4WJ3M 1G6PA 2B2WC 3S14B 3UE1A 2NBFA 1MJEA 4R1JA 4JOIA 2HCIA 1EWIA 1PH3A 3A5UA 2UUCQ 3NP8A 3VA5A 3FKIB 3S2HH 1ET6A 1SYEA 3GTMB 1G51A 1DOLA 4BY1G 1A3VA 4YIJA 3KUPA 1E1TA 3DLLA 4A3KB 3HKZE 2DNEA 2NVTH 4IJLA 1B8AA 4DNRB 1K8OA 2B3GA 3UDIA 1H9KA 1Z47A 2NVYB 2K32A 2RDHA 3DEPA 2JA6G 4O2DA 4DPGA 3SHLA 4DNTB 4QMGA 4ZK9B 3G7LA 5IGDA 5M5XH 1CKNA 4LF8L 4XIGS 1WCMG 4Q0FA 2ZM6Q 4QQBX 2CQAA 4DK1A 2PMZE 4L5SA 4R4QA 5GAHC 2MGSA 4K0KQ 1DCZA 1SYBA 3OWFA 2IHEA 2KHIA 4DV6Q 1VQGA 3I3CA 4JVZA 3V05A 4BWGB 1XTDA 2NWGA 2XRSD 4KD3A 2FJ2A 4IUUA 1RHPA 1DXMA 1JWUD 2Y0SG 2E2JB 3QG1A 2KJXA 3F1ZA 1SMXA 1Y1VB 2NB0A 4DFAA 3G6JB 5C4JH 3GTLB 1QUQB 4LUZA 4NP5A 4L5TA 3CPFA 2DNCA 3A74A 1E2WA 1LT3D 1QG7A 1I3QB 2BA1A 2IX0A 3U50C 3DM1A 3I56A 1EYCA 2E5LL 1Z7TA 1UEBA 3FP9A 5ISRA 4HMJA 1K3RA 2WAQE 5IT9c 5C0XG 2UXDL 1TWFB 5CORA 4GLAC 5F2DA 1WVLA 4LFAL 2JA8B 1XWEA 4IUQA 2VQFQ 4O1NA 3KYHC 3RN2A 3CD6A 4A3FH 3GTPB 4HMIA 1IL2A 1YHAA 2AUKA 4C3HB 5C6AA 4QUFA 4LF7L 2MO1A 4RFBA 1SYDA 2ES2A 1SNOA 3IL8A 2D62A 2ZXOA 3PUZA 5LMUQ 1FVIA 4R9WA 3F2DA 1MJCA 4DF7A 4BY7H 4DGZA 3HRZC 3NWTA 3N6RA 3CMEA 1D5ZC 4Y7NB 1CQVA 2ID0A 1SBBB 2C5CA 4CKBA 1SDFA 1Q7YC 4UP9A 1I4RA 1EQTA 2RHQB 2K01A 4A93B 1LTID 1FD7D 1BO0A 2KEEA 1H9SA 1TWAB 4E6IA 3G48A 4N8X1 3K57A 1VCIA 1MD2D 4DR4L 2XN9C 3TMEA 2E75C 4PZ8A 2JA8H 4XT1B 1T5XD 5G3LD 2A8VA 5E1FA 3CAMA 4AYBB 2WV6D 5E7NA 4JI3Q 5COYA 1KRSA 2AHOB 5CV6A 3GTPH 3P1HA 3LWUA 1L2FA 4R4IA 3A54A 3H3VC 1AP0A 5C3EB 2NVTB 2OT2A 4K2LA 1TWFH 3T53B 1X32A 2L0CA 4BBRG 4NDXA 1HNXL 5CC4A 4M8AA 2YYZA 1NE3A 2JA7G 4BY1B 1G2SA 1VF5C 2IHFA 4A3KG 4JI4L 5D65A 4FXGC 1VQIA 3T4AC 3N52A 2AWNA 1SE4A 2PI2A 2VUMB 4B3ML 1VF7A 3GDEA 1E2VA 2NTSA 5HY6A 2A68D 4P71A 3Q24A 1I50H 2F0NA 3AB9A 4JK1C 2WIIB 1CFMA 5IYBH 4RGTA 3GTJB 2F0PA 4ZCKA 4QJFA 2WACA 5ELDA 2R92G 3R3OA 1MI2A 3GTGH 2R7FA 3SXHA 2C9OA 4K5VA 1I94Q 1B1ZA 4IALA 2NZ1D 1VQ4A 2HCCA 3UE0A 4B3RQ 1XPOA 1EEFD 3U4ZA 4BS9A 4C2MB 2QA4A 4HCEA 4DV0L 3S9WA 1XJVA 1EQVA 2OTLA 4AIMA 5EPLA 3ZYYX 3S17B 1I4PA 5J1ZA 2JQOA 3M4PA 3E0EA 1Y8NB 1ZEQX 1CA5A 3OHXC 4CDEC 2NVQH 2VQEL 4ZUJA 2QDBA 3VR2A 2MNAA 3K0XA 2PZTA 5ELOA 1FL0A 5C44H 4FXKC 1Y1VG 3BYYB 4ID6A 2K75A 1SE2A 3UDGA 1JOKA 4CHTB 1SNCA 1L0YB 2QEJC 2VQFL 4MTKA 2BA0A 1K9MC 4BBSB 4DR6Q 4PV1C 3MFGA 1S5ED 5GROA 4XDXA 3KF6A 4O0AA 4A3MG 5DAUA 3K7AH 4ZYSA 1PRTC 1KDCA 5AJ3L 3H0GG 3PO3H 4KK7A 3HOWH 1N32Q 2L11A 2B8GA 1C48A 3SGIA 4IOAA 4AQYQ 5GAGC 1HR0Q 4KHPQ 1L1OA 3PSIA 4YCWA 4ABNA 3HOWB 3PO3B 4LF9Q 1JCKB 5CMDA 4XYOA 2B29A 1K3BC 4OWXB 1W6KA 3CQZH 4WJWA 1U5KA 4LK1C 1BQQT 4DR2Q 2JA7B 1NMGA 3NSWA 2CH4W 1UNSA 4BBSH 3M4YA 3CW2C 1N34L 4KHVA 1FYCA 1BOSA 1YJ9A 3QWNA 2B63H 4DXFA 4YCVA 1EU3A 1ICWA 4JI3L 2B2VC 4FDBA 3SEBA 4QF4A 1K0SA 4OX9Q 3TEHB 2VB2X 3A0JA 1VQPA 3E9IA 4BBSG 1WTXA 1X55A 1F2MA 2UUBL 2SNMA 3C46A 1UE7A 3I4LA 1HQMC 3PO2B 1EWHA 3T56B 2G9HD 1ET9A 1HRJA 1K8GA 3D4DA 4HJ7A 2NZHA 1H9RA 4DV4Q 5IP7H 1EOVA 3K5LA 2HUGA 1OXTA 1PTOC 1YEZA 1VQAA 3EIVA 3D3RA 3HP3A 4LFBQ 2ICIA 1YJWA 1STAA 2UUAL 3FKIH 1D2BA 4A3IH 1L0XB 1YNNC 1VQ9A 4K0KL 3BVMA 3WDNA 2R3ZA 2KA7A 1AW7A 5K5PA 2EYJA 1LTSD 1NAPA 2ENBA 3S14H 1GVPA 1UWVA 3GTGB 4YHHQ 4DV1Q 4N9TA 4MIUA 2L55A 1NUCA 4LUVA 1IBMQ 4MN3A 1JC7A 1PA6A 3F8TA 4FP5D 1E2ZA 2RHSB 4K14A 4U68A 4X3TA 5IIFA 2RVLA 2Z8LA 4FF2A 2JA6B 5C4ZA 3P7JA 3E0JA 4B9WA 1NNXA 2F0EA 3L7ZC 1FGUA 4HTHA 1YNND 1HR0W 5LMNW 3STBD 1YNJD 1WTQA 2QCPX 1HFGA 2X6LA 1XMQQ 1EY5A 2JN4A 5C4XG 2XIWA 1STGA 4A3BH 5GADC 4RKBA 4BY1H 2F1MA 1X3QA 4RHSA 4IO9A 4NXMQ 1BCPC 4TQUS 3R8BA 4A3JB 3Q22A 2JA9A 5C3EH 4C3IB 4KKUA 5LMNQ 4A3LG 1IKLA 5M5WB 3IFTA 3Q23A 3HOYB 2K5VA 4XT3B 3HOVB 1K83H 1Q1BA 2EJMA 2SNSA 3GTQB 2VNUD 3OMGA 4DAMA 3PIP3 1BNZA 5I6YA 5KRUA 1JT8A 1U4RA 1HA6A 5BR8Q 4DV5Q 1WTRA 1K73C 4RKLA 2A6EC 2IY5B 1XX8A 1EYDA 1O7LA 1RTNA 1VQCA 1WTWA 3QIAA 1HNZQ 1OXXK 1D5MC 5JEAJ 4A3EG 1A2TA 1KXLA 1SXTA 1ENFA 5I9OA 3UDFA 3QJYA 4DV0Q 1AZQA 5KNBA 1WYDA 2AMCB 4JI1Q 1WD1A 1SFOB 5BN4A 3HG9A 3DM3A 4GLXA 5C4XB 4A3MB 1TKWB 1N36L 2F3VA 4KN4C 4A3EH 2K1BA 1I4QA 3RLNA 3VR3A 1QUQA 4UAIA 2HHHQ 1D1KA 1SJED 5JVH3 1PFNA 1EYAA 3K6OA 4DAYA 4B3TQ 1A2UA 3I4OA 4YCUA 3J80L 1Q3LA 4HJ5A 1E22A 3IAYA 1X3EA 3NTHA 2RBMA 3HOXG 4HCSA 1EIGA 2H5XA 3DMUA 4DR5L 1HA5A 3RN5A 4HIKA 4QCLA 4LF6Q 1ESFA 5CV8A 1X3GA 1RDPD 1DOKA 5M5YB 5FOBB 2ATWA 2EYFA 3VYSA 4S3SA 4A3EB 2CVRA 1ILQA 3W1BA 4DNIA 3I4NH 1GO3E 2BOSA 1WTVA 4ZLTF 4X64Q 2HT1A 4UDUC 4KN7C 1QVGA 1B3QA 4H0LC 4X3UA 5C0XI 3Q8DA 1XNRQ 3I4MB 4A3LH 3J81E 3JAML 1KQSA 1U9RA 2A73B 4GLVB 3H91A 1VQ8A 4ZKCB 4B3RL 1VQMA 2OQKA 4OIKA 1D8LA 2NN6G 1W3SA 1HNWQ 1EL0A 2GA4B 2OQ0A 4DV7Q 4B3SQ 3RZOB 4C3IG 3S24A 3HOYG 3M4QA 1DJRD 1HH2P 3HOVG 2KCNA 3HZXA 3I72A 4J1MA 3J80i 4RGMA 5M5XB 3LGJA 2Y0SB 5IODA 1E24A 5ELEA 2RDFA 2LFNA 4IFDG 2DJGC 1IBKL 1BCPF 2L1BA 4QIWB 3RLOA 4YWKA 4MZ9A 4HJAA 1DM0B 4DN4M 2SEBD 4C3JG 5HURA 2F03A 5LMNL 1V1QA 2YTXA 4A3DB 3P75A 4EX5A 1GHKA 4ODGA 1RJTA 3CP0A 1SROA 2KUMA 5IYCG 5KYLA 3K81C 1BXTA 1O7YA 4DV5L 1HUNA 3S2HB 5M3MB 2O5JC 3OYYA 4JYAL 1PH7A 2AQ3B 1NBWA 2A68C 1T5EA 4YY3L 2B2UA 4ZAIA 4EQ5A 5K36H 2F0FA 3ITPA 3A7LA 4KHZA 5M3MH 3VA7A 5HGQA 3CCSA 4FXDA 5FKAC 4IFDI 4UP7A 3DWQA 3CCMA 1WD0A 4RAUC 5JJIA 1G2TA 5IGBA 1STYA 2N8NA 5DNFA 4JI1L 1EQQA 1S5DD 2CWPA 1IYVA 1CSQA 1J8IA 4TKOB 5EKLA 2M00A 3AMUA 4O42A 1GM5A 2ZXPA 2R93G 1STHA 2PQAB 2JYOA 4NXNL 4ZRZA 2F0SA 3TP7A 4L5RC 2OWOA 1I4GA 2CH4A 2B2UC 1LTLA 2BDOA 2JEBI 4UPAA 1PRTD 3KLWA 4X66L 3T13A 1EIHA 1AEXA 4P2CB 3C3LA 1IYUA 1ZYRD 5DM63 4DAVA 4Y52H 4A3CG 3JAMc 4FVMA 1Q8IA 4C3IH 1TT2A 3E5SA 1EFID 1VQLA 3QOJA 1JJ2A 2EYOA 3A8JE 4DV6L 2EY5A 2RSOA 4YWLA 4JI7Q 1DOMA 4KY6A 2R7ZB 1ONLA 2Z6KA 3BDOA 3ERQA 1C7YA 4IUNA 1V1OA 2I0QA 2VZAA 1H95A 2FMCA 2A69D 3NWSA 4M1UB 1NMFA 1PLFA 4ME5A 3EJIA 1LT4D 3C1EA 5DEHA 2Z0SA 2FXQA 2PZUA 3BZKA 4J8QA 5DLQE 2G9DA 1E1OA 3W2DA 2RDGA 2Z4IA 3GTKH 3SK5A 1XNQQ 5CBAE 4LWCA 5ELFA 2HHHL 1G8ZD 3OWEB 4IPGA 2UUCL 1TS4A 1XYIA 4RG1A 2ZJQA 2E5LQ 4DV1L 1M90C 4KKSA 1PZID 1WFQA 3PF5A 1IBML 2MJ8A 1X54A 2I5LX 5M5YH 3AEVA 2NVXB 3MXGA 2EQSA 1TU2B 2E2IB 3M4OB 4DUYL 1EY0A 2R7ZH 4G57A 4POGA 4A3GG 3MHBA 2TMPA 3CRLC 4LF7Q 2F0OA 2M9VA 3PUXA 4GZYC 4DUZL 1SN8A 3Q6SA 3PQIA 3JAMi 3NELA 1BDOA 2RF4A 1LV9A 2MPMA 1UE6A 3BU2A 4HIMA 3KOJA 1JMCA 1G6ZA 1O7IA 4LFCL 1B53A 2I07B 4PZ6A 2X69A 4HN7A 4LMQD 3STBC 2EXDA 2HDLA 3S1MB 3ND9A 4RH6A 1HZCA 1KABA 4DK0A 4C3JB 1ASZA 4DR4Q 3QB3A 2PPBC 2DN8A 1BCPD 4OIJA 3KDFA 5FLMH 3S1RH 4F8MA 3J7YW 1TR5A 1H9JA 5IT9L 1EQRA 1S5FD 1I6HB 1LT5D 5NUCA 4LJZC 2L15A 2VUMH 1C9OA 1K83B 1IW7D 3GTQH 4R4TA 3EROA 5K36G 1NR4A 2JK8A 1H9SB 4N9PA 3MXUA 1N8RC 3AU7A 3I4NB 1EUJA 1PH8A 3IKJA 1BBWA 3GD7A 2N3SA 5CV9A 1JWSD 2HD3A 2K28A 2A19A 2PW7A 4LFAQ 4RGNA 4GOPA 5FJ8G 4LF6L 3M9BA 5IT9E 4FF3A 1R4PB 1B9MA 4OL7A 2VQEQ 2NVQB 4DR7L 3OMCA 3EN2A 4JI8Q 1F9SA 2ZTCA 1G91A 4C1NI 2L9HA 1CUKA 4IOCA 2IX1A 1J5EL 4CBVA 1CK1A 5BN3A 2IT1A 4DKAC 5I4DA 1LACA 1A6XA 1XPUA 1X3PA 1IHZA 4C2MH 5FK9C 3S1RB 3K5NA 4LF9L 2FHTA 3VR5A 4A3CH 3F2BA 3NK9A 2VW9A 2EZVA 2QEXA 1HZ9A 2LKVA 3U4VA 3J7A5 3S1MH 3H3VH 3PUYA 4HIDA 3G6EA 4HSVA 3VYUA 4MHEA 2YU9H 2K5QA 5IYDG 1AE2A 1AN8A 2MHVA 5CV4A 1M1KC 2A6ED 3G4SA 2K5DA 3K8AA 4DUYQ 3DHQA 4DR6L 4B08A 1I3QH 4WORA 4ULLA 1EY7A 3T1HQ 1ZYRC 4JI7L 5C0XH 3V96A 5C0XJ 4A3BB 1W2BA 4JI2Q 1Q81C 1Q8KA 2N88A 1JB7A 5I9PA 3M4OH 2UXCL 4PMBA 4OX9L 3AFPA 2ASBA 5C3WA 4KJNA 1JJGA 1SMYC 5A35A 2UUAQ 3NUCA 3SDZA 4A3JG 3NBIA 1KL9A 5IP9H 1LLRD 1XPRA 3WOEA 4GOPC 3RUZA 3I55A 4F87A 2PO4A 4DK6C 1XMOQ 4JPBW 4PNYA 3I4NG 3SVMA 4FF1A 3ULJA 1S72A 1VQ6A 1VQBA 4GNXB 3TRZA 5T1GA 1W6JA 4OXPA 2Z4HA 3TS0A 3GV3A 5HGTA 2K03A 3D4RA 2AUJD 1RIPA 5EBDA 1YZ6A 1UE5A 3MZ5A 3M3YH 2ZT9C 4CDCC 1PZJD 3Q0AA 1YVCA 1CT1D 3RZDH 3R2IA 1TS3A 4DUZQ 1FR3A 3GQBA 4C3HH 1CZWA 1WI5A 3MXNB 3MXNA 4LUOA 3T1YL 1TXYA 4DV4L 2QW7A 1V1PB 2EXZA 2EE1A 4XQQA 1CHPD 4JV5L 2IPKD 1VMPA 4AYBE 4MTNA 3FPUB 3JC66 4A3KH 1F9PA 4IFDH 2B39A 3MEFA 2JA7H 5EQ0A 4IPCA 2KECA 4C56C 4FYDA 4QY7A 2EPBA 1PH9A 2WB1G 4YHHL 1PH2A 1LO5D 4DR1Q 5C4JB 4A75A 3CC4A 3GTLH 4H13C 4JI8L 1LM0A 1ZKOA 5AJ3Q 2JA6H 1GUNA 1H9MA 2ZM6L 2MUYA 2NYZD 4BXXG 4JI5Q 1VQJA 1KHIA 1LTAD 1Q86C 4J6HA 2ICEC 2I46A 3K7UC 4L8JA 1MBYA 5IYCH 1HZBA 3L2PA 4FF4A 3QR8A 2Q8IB 3CKIB 5I6WA 3S1QH 2NTTA 4CJ2C 2KENA 4K6LA 5L37A 3T51B 1LTGD 4X3SA 1U0LA 2O2LD 4JC0A 1VS0A 4IQZA 1TWCB 1NJIC 2CFMA 4H44C 2HIXA 2TSSA 1KD1C 2KEDA 3KFUA 1CKMA 4A3DH 1FJGL 1KNEA 5FLXc 1QZHA 2A74C 4NKLA 1Y1WH 1MHWC 1PYSB 2JP1A 2LXJA 1IKMA 3T1HL 3RZDB 1S3OA 5C44G 3KK7A 1B50A 4IPDA 3J81c 3D6CA 2WB1E 4GKKL 1QB5D 1SNDA 3B6YA 3ULLA 2JE6I 4LNQA 1M8AA 4LFBL 1PTOB 2HQLA 3OOCA 4I7AA 5DM73 1VQNA 3HEJA 2VB3X 1KRTA 4BA1I 1JE4A 2DJFC 4B3TL 1STEA 5LL6S 2F4VQ 3NTIA 1TQOA 4ZQ3A 2XSCA 3J7ZC 4KD4A 1EEID 3EA6A 3DUZA 5EAYA 2F4IA 1OXUA 3H0GB 1B4OA 4UHVA 2PZWA 1HHVA 4JOIC 1C4QA 2CHBD 1A3TA 1EY4A 1SAPA 1YHQA 4LF5Q 2K5HA 4R4OA 2B2YA 3FHWA 4DAPA 1KLGD 1QVCA 4LF8Q 2Z9HA 2EYHA 5ELNA 4B3SL 1Y1VH 2IWHA 4N8FA 2R93B 1WOCA 3HOZG 1DONA 5IWAL 4GOPB 2GN5A 1TWAH 4IUVA 4V190 4QL5A 1OXVA 1A15A 4A93G 1LT6D 1QWYA 2F0IA 2JEAI 2YTVA 2HIVA 4YY3Q 1YBYA 4DR1L 3E9HA 3TP5A 5A2QE 2VXWA 5KNCA 2JA8G 1PV4A 1C8CA 3HOXH 2EJFC 1J5EQ 4DV7L 3L3OC 4BY7B 4WRDA 1PTOH 4A93H 4JBWA 3PIO3 4CDFC 3S1NH 1J6QA 2BH2A 3HS0C 2OF1A 1O7ZA 2SOBA 4ZKBB 4BBRH 4KTAA 3M85A 3L9AX 1GKHA 1X6OA 4BXXH 2EY6A 2R7DA 2Y0SE 3PO2H 1M4VA 4UP8A 1VQHA 4NXNQ 4QIWE 3CCUA 4DU9A 5D14A 1F9RA 4A3FB 3CCQA 1EY8A 4QB4A 3MA2B 2KOLA 1HQRD 3PCOB 4PQXA 2VUMG 2R93H 5D3DA 4DR3L 4A3JH 1I4XA 3R2TA 1TY0A 5IGCA 2R6GA 3QO2A 5EJWA 3TBIB 1Z6HA 2H4OA 2NN6I 2IX3A 3CF5A 2F0KA 5GAEC 2K4KA 3H0GH 2E2JH 3JAME 1PDQA 5JJLA 1KDBA 3TSSA 1MGSA 3S1QB 1LUZA 2ALYB 3ERSX 4JI5L 4XTCS 2WINB 2WP8J 2MP1A 5I2XA 1FGBD 2RKSA 5CGKA 1KLUD 2V4DA 3K5MA 2CQOA 3F2UA 3FKIG 2KBNA 3FEWX 1L0WA 1EZ8A 2B8FA 1OXSC 3FMCA 2Z1CA 5JEAG 4LF4L 3MTSA 5KEEA 1RF2D
chains in the Genus database with same CATH topology
4OWTB 3UE0A 4B3RQ 4GKJL 3JAMi 1XPOA 3RZOH 3NELA 3U4ZA 4X65Q 2F4VL 2RF4A 1C0AA 3K80C 1D7QA 2QA4A 3H15A 1UE6A 4DV0L 3BU2A 1XJVA 4HIMA 4AQYL 3KOJA 1JMCA 4AIMA 1O7IA 4LFCL 2OTLA 1HR0L 3S16H 4P75A 4KHPL 1EIFA 4DV3Q 2JQOA 3M4PA 4PZ6A 3CCLA 1SR3A 3STBC 1K0RA 2EXDA 3E0EA 1YHBA 3U58A 1E3PA 4R4CA 2KCTA 2NVQH 4KLKA 4POFA 2OCEA 3I4MH 1HZCA 1ASZA 1YJNA 4DR4Q 2VQEL 5IY0A 5FJ8H 1Q12A 2MNAA 3K0XA 5IYBG 4YWMA 1N34Q 5ELOA 1FL0A 2PI2E 3KDFA 5C44H 5FLMH 3S1RH 1Y1VG 4GNXA 2K75A 3UDGA 1OTCA 1IXRA 1EQRA 3PUWA 2QGQA 5IWAQ 2VQFL 4DR3Q 2L15A 2VUMH 1C9OA 1P16A 1Q46A 1N36Q 3GTQH 3HOVH 4R4TA 5K36G 2BA0A 3HOYH 4QGUA 4BA2I 2JK8A 1XNQL 4NB3A 1K9MC 2Q2IA 4PZ7A 4DR6Q 1N8RC 3M7NA 2EIFA 5GROA 1EUJA 3KF6A 2JA5H 4O0AA 4A3MG 3K7AH 1PH8A 1BBWA 3GD7A 1TWGH 4A3DG 5AJ3L 2N3SA 3H0GG 3PO3H 4GN5A 3HOWH 1N32Q 1I6HH 2K5NA 3SGIA 2A19A 3PF4A 4IOAA 2Z6KC 4AQYQ 5GAGC 2K50A 2XTIA 1HR0Q 4KHPQ 4LFAQ 1L1OA 3PSIA 1L1OB 4YCWA 1TWHH 1PH4A 4GOPA 3S15H 5FJ8G 4LF6L 4LF9Q 3M9BA 1NTGA 2UUBQ 2B29A 4OWXB 4HJ9A 3CQZH 4BY7G 1U5KA 1BVSA 4DR2Q 4LF4Q 4A3MH 2VQEQ 3ER0A 1NMGA 4DR7L 3EN2A 4APVA 1X65A 4BBSH 4JI8Q 1QVFA 3CW2C 2ZTCA 3RLFA 4DAYB 4GNXC 4A76A 1N34L 4JI6Q 3BJUA 1CUKA 2CWAA 4GS3A 4IOCA 1YJ9A 3S17H 2IX1A 1J5EL 2B63H 4YCVA 4JI3L 5C4XH 2IT1A 4FDBA 4DKAC 1X9NA 1EYGA 4LFCQ 3CCVA 4OX9Q 1XPUA 2MO0A 2GVBA 4C2MH 1YITA 1RL2A 3TEHB 3A0JA 1MKHA 1VQPA 3E9IA 4BBSG 2MQHA 3J80c 1X55A 4LF9L 4GN4B 3CCJA 2UUBL 3CC2A 1IBLQ 1R9TH 1UE7A 2NVYH 4A3CH 3F2BA 1B70B 1K8AC 2VW9A 1CKNB 1VQEA 2QEXA 4A3FG 1HZ9A 1K8GA 2F3IA 3U4VA 1N33Q 3H3VH 2YTYA 4HJ7A 4ME3A 3PUVA 3S1MH 2OTJA 1MIUA 2NZHA 4NXML 1HJPA 3PUYA 4DV4Q 4HIDA 5IP7H 1EOVA 3G6EA 1T9HA 1PH5A 1OXTA 2KHJA 1YEZA 1VQAA 1L1OC 5FLMG 1PH1A 4A3BG 2YU9H 1TWCH 3EIVA 2JA5G 3AFQA 1CKOA 2I5HA 3I7FA 5IYDG 1AE2A 1M1KC 1PVOA 3NBHB 4Y7NH 4LFBQ 3G4SA 1YJWA 2Q2HA 2UUAL 3FKIH 4A3GH 1EFWA 3K8AA 4DUYQ 4A3IH 2XGTA 5M5WH 3BZCA 4KI0A 1VQ9A 4K0KL 5BR8L 1I5FA 4DR6L 1I3QH 2ZTEA 2WAQG 2WFWA 3T1HQ 4JI7L 1A63A 4AYBG 4NPSA 3S14H 1GVPA 1UWVA 1V9PA 4YHHQ 2AWOA 5C0XJ 4DV1Q 4LUVA 1PHJA 5M3MG 1IBMQ 4OWWB 1W2BA 1PA6A 3F8TA 3L0OA 2RHSB 4JI2Q 1VQOA 1Q8KA 1Q81C 1JB7A 3M4OH 5C3EG 2UXCL 2D0PA 2Q2UA 4OX9L 4DR5Q 3AFPA 5J3BA 3OTOQ 2NVXH 1VQFA 2UU9Q 2D0OA 2ASBA 3J7A5 2N78A 3L7ZC 4J15A 1FGUA 1HR0W 1JJGA 5LMNW 4MNOA 3STBD 2UUAQ 4A3JG 4ALPA 1KL9A 4A4IA 5IP9H 1XMQQ 4P72A 4JYAQ 3TREA 1XPRA 5C4XG 4LF5L 1IYJB 3TS2A 4GOPC 1KIXA 4A3BH 4DR7Q 3I55A 1CSPA 5GADC 4DK6C 1XMOQ 1KAWA 4BY1H 3I4NG 4JCVE 4GKJQ 2A1AA 3ULJA 4IO9A 1S72A 1VQ7A 4NXMQ 1VQ6A 1X3FA 1AE3A 3A5ZB 4TQUS 1VQBA 3ZJYC 4GNXB 3TRZA 2VS1A 2JA9A 5C3EH 4AH6A 3F2CA 4OO1I 4OXPA 5LMNQ 3TS0A 4A3LG 2K5VA 1K83H 1Q1BA 2DGYA 1QZGA 1RIPA 3IRBA 2VNUD 1YZ6A 4DAMA 1N9WA 3G71A 1UE5A 1JT8A 3M3YH 1Q82C 3NENA 5BR8Q 4DV5Q 1K73C 1BKBA 3J81i 1YVCA 3RZDH 1KC8C 2IY5B 3D31A 4DUZQ 2R92H 1A0IA 1VQCA 4C3HH 1P8LA 2RCNA 1WI5A 3MXNB 4X62L 4LUOA 3T1YL 1HNZQ 1OXXK 1TXYA 2UXBQ 5JEAJ 4DV4L 4A3EG 1S40A 1KXLA 4X64L 1SRUA 3PV0A 4IFDJ 3UDFA 4DV0Q 3PIPA 4JV5L 2UXCQ 3I2ZA 1Z9FA 3HFZB 3EBEA 2YV5A 4AYBE 1WYDA 2AMCB 3JC66 4MTNA 4JI1Q 4A3KH 1VQKA 1YI2A 2CKZB 4X6AH 1JJCB 2ZTDA 3GO5A 3DM3A 3MEFA 4P73A 5IE8A 4GLXA 3OW2A 2E8GA 4HIOA 1PH6A 1N36L 2VL6A 4IPCA 1EIYB 2JA7H 1UE1A 4JI0L 4A3IG 1XNRL 4QY7A 3KJOA 3KJPA 4A3EH 1PH9A 2WB1G 2LXKA 3RLNA 3H3VI 3J81j 1QUQA 4UY8C 2HHHQ 2ZJRA 4YHHL 1PH2A 4JBJA 3HOUH 4DR1Q 1XMOL 4B3TQ 4YCUA 3I4OA 2NZOA 4A75A 3CC4A 2AKWB 3GTLH 4JI8L 1G291 2I5MX 2UXBL 1LM0A 4RMFA 5AJ3Q 2JA6H 4HJ5A 1E22A 1HNWL 4JBMA 3PGZA 1X3EA 2ZM6L 4BXXG 3HOXG 1DGSA 4JI5Q 3CCEA 2H5XA 3GTJH 1PFSA 1VQJA 4DR5L 1KHIA 3AYHB 3OTOL 1Q86C 3RN5A 3WWVA 4HIKA 3K7UC 5M3FH 4WJ3M 1G6PA 4LF6Q 5IYCH 1HZBA 3L2PA 3UE1A 1YNXA 1MJEA 3CPWA 3ICEA 4R1JA 1GD7A 4DV2Q 1X3GA 3GTMH 4JOIA 3S1QH 1EWIA 4JI4Q 1PH3A 2ATWA 3A5UA 2UUCQ 2KENA 1IBKQ 3S2HH 3HOZH 1U0LA 1G51A 1HNZL 4JC0A 1VS0A 3W1BA 4DNIA 4BY1G 3I4NH 1GO3E 3RNUA 1NJIC 1E1TA 3DLLA 4OONA 1SFOH 2CFMA 3HOWG 4X64Q 2HT1A 3PO3G 1E7ZA 3W5OA 3HKZE 1BBUA 2HIXA 5M3FG 1KD1C 2NVTH 3KFUA 1CKMA 4IJLA 4A3DH 2MFIA 1QVGA 1FJGL 1B8AA 5FLXc 3W1GA 2B3GA 3UDIA 4C3JH 5C0XI 3Q8DA 1Z47A 1QZHA 1XNRQ 4A3LH 2JA6G 4O2DA 1Y1WH 4GN3B 1KQSA 4DPGA 1PYSB 2LXJA 4GLVB 3T1HL 3KDFB 1VQ8A 3CXCA 5M5XH 1S3OA 5C44G 4B3RL 1VQMA 1CKNA 2OQKA 4LF8L 4IPDA 1D8LA 2NN6G 4XIGS 1WCMG 1W3SA 3J81c 1HNWQ 4JV5Q 2ZM6Q 2WB1E 4GKKL 4QQBX 2OQ0A 4IJHA 4DV7Q 3B6YA 3CC7A 4B3SQ 2E2HH 3ULLA 3I4MG 3UDXA 2JE6I 3S24A 5H1SE 4LNQA 3HOYG 3M4QA 1HH2P 2PMZE 3HOVG 4L5SA 3PO2G 4LFBL 4R4QA 4DV3L 5GAHC 2Q2TA 4K0KQ 2HQLA 3J80i 2IHEA 1VQNA 2KHIA 3LGJA 4DV6Q 1VQGA 1ASYA 1E24A 1KRTA 3VDYA 2K14A 1JE5A 4BA1I 4IFDG 1IBKL 4B3TL 3CMAA 3RLOA 1XTDA 4YWKA 2E2IH 1NY4A 4MZ9A 4X65L 2F4VQ 4HJAA 5GQOA 2K52A 3J7ZC 2N49A 1WJJA 4JI2L 2UXDQ 2CCZA 5LMNL 1V1QA 2Y0SG 2YTXA 5EAYA 2BH8A 4EX5A 2KCMA 1OXUA 1FJGQ 3CP0A 4PMWA 4JOIC 3F1ZA 1SMXA 1SROA 1VQ5A 2V1CC 3S2DH 5IYCG 5C4JH 1QUQB 1YHQA 3K81C 4DV5L 4LF5Q 1SE8A 2K5HA 3OYYA 3CCRA 4JYAL 4LUZA 1Y14B 3CPFA 3HKZG 4L5TA 3A74A 4R4OA 1PH7A 1NBWA 2BA1A 2IX0A 3KF6B 1X56A 3U50C 4YY3L 3FHWA 3I56A 4EQ5A 3ULPA 2VY3A 1SLJA 5LMUL 2E5LL 1UEBA 4KHZA 3FP9A 1QVCA 5M3MH 4LF8Q 4JI6L 5HGQA 4L5QA 4B3MQ 1B7YB 3CCSA 1K3RA 2WAQE 2LSSA 5IT9c 5C0XG 4GKKQ 4IFDI 4UP7A 5ELNA 3CCMA 1Y1VH 4B3SL 2UXDL 4GLAC 5JJIA 4LFAL 1WOCA 2F52A 2N8NA 5IWAL 2VQFQ 3HOZG 4JI1L 4GOPB 2GN5A 3RN2A 3KYHC 3CD6A 1Q1EA 3NEMA 4A3FH 1TWAH 1EQQA 1V43A 1IL2A 3PIOA 2CWPA 1YHAA 3KF8B 1OXVA 4P74A 4QL5A 4A93G 1CSQA 1LYLA 1Y1WG 4LF7L 2JEAI 2MO1A 4JG2A 4OO1G 4X62Q 2YTVA 4DK3C 1GM5A 2R93G 2HIVA 2PQAB 2ES2A 3TQYA 4YY3Q 1YBYA 4NXNL 4DR1L 3T1YQ 2D62A 3E9HA 3PUZA 2GVAA 4L5RC 2OWOA 5LMUQ 1FVIA 2JEBI 1LTLA 1MJCA 3F2DA 1PV4A 4UPAA 2JA8G 3KLWA 4X66L 3HOXH 4BY7H 3CMEA 4JBKA 2ID0A 1J5EQ 4DV7L 2PNHA 4Y52H 4HJ8A 4A93H 4A3CG 3JAMc 4JBWA 4C3IH 1Q7YC 3S1NH 4UP9A 2RHQB 1J6QA 2BH2A 4H02A 1HNXQ 1PYBA 5JJLA 4JI0Q 1VQLA 4PG3A 4BBRH 5IP7G 1JJ2A 4DV2L 4DV6L 1VQDA 3M85A 1IBLL 1GKHA 1X6OA 4BXXH 5JJKA 2R7DA 2Y0SE 3G48A 4YWLA 4JI7Q 1VCIA 3PO2H 2JJQA 4DR4L 4UP8A 2Z6KA 1VQHA 4PZ8A 2PQAA 4NXNQ 2JA8H 3HKSA 4QIWE 3CCUA 1C7YA 2A8VA 3D0FA 3CAMA 4IPHA 4WJ4A 2I0QA 2VZAA 5E7NA 4JI3Q 1H95A 1KRSA 2AHOB 1HZAA 3GTPH 1L2FA 1NMFA 4R4IA 3CCQA 3HOUG 2VUMG 3PCOB 2Z0SA 2FXQA 3BZKA 5DLQE 2R93H 5IP9G 4DR3L 4A3JH 1A62A 1TWFH 1E1OA 2B63G 4BBRG 2R7ZG 1HNXL 3GTKH 2R6GA 1A8VA 2YYZA 1NE3A 1XNQQ 2JA7G 4LW1A 2NN6I 4LWCA 2IHFA 3CF5A 1I94L 2HHHL 4A3KG 4JI4L 4IPGA 2UUCL 3AQQA 5GAEC 1N33L 1VQIA 4RG1A 2K4KA 2ZJQA 2E5LQ 4DV1L 1M90C 3H0GH 1WFQA 3PF5A 2C35B 2E2JH 1IBML 3GTOH 2AWNA 2PI2A 1X54A 2I5LX 5M5YH 1YIJA 4B3ML 3AEVA 1LUZA 2ALYB 3ERSX 3GDEA 4X66Q 5HY6A 4JI5L 1N32L 4P71A 4XTCS 2EQSA 2WP8J 3RR5A 2ZJPA 1AH9A 1I50H 5IYBH 4TVAB 1IZ6A 2UU9L 4DUYL 2R7ZH 2CQOA 2DUDA 4POGA 1XMQL 3FKIG 4A3GG 4QJFA 2R92G 1WCMH 2KBNA 4LF7Q 3GTGH 2R7FA 1L0WA 5IYDH 3PUXA 1OXSC 5JEAG 4DUZL 1I94Q 1SN8A 4DR2L 4LF4L 1VQ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OWT B;  3UE0 A;  4B3R Q;  4GKJ L;  3JAM i;  1XPO A;  3RZO H;  3NEL A;  3U4Z A;  4X65 Q;  2F4V L;  2RF4 A;  1C0A A;  3K80 C;  1D7Q A;  2QA4 A;  3H15 A;  1UE6 A;  4DV0 L;  3BU2 A;  1XJV A;  4HIM A;  4AQY L;  3KOJ A;  1JMC A;  4AIM A;  1O7I A;  4LFC L;  2OTL A;  1HR0 L;  3S16 H;  4P75 A;  4KHP L;  1EIF A;  4DV3 Q;  2JQO A;  3M4P A;  4PZ6 A;  3CCL A;  1SR3 A;  3STB C;  1K0R A;  2EXD A;  3E0E A;  1YHB A;  3U58 A;  1E3P A;  4R4C A;  2KCT A;  2NVQ H;  4KLK A;  4POF A;  2OCE A;  3I4M H;  1HZC A;  1ASZ A;  1YJN A;  4DR4 Q;  2VQE L;  5IY0 A;  5FJ8 H;  1Q12 A;  2MNA A;  3K0X A;  5IYB G;  4YWM A;  1N34 Q;  5ELO A;  1FL0 A;  2PI2 E;  3KDF A;  5C44 H;  5FLM H;  3S1R H;  1Y1V G;  4GNX A;  2K75 A;  3UDG A;  1OTC A;  1IXR A;  1EQR A;  3PUW A;  2QGQ A;  5IWA Q;  2VQF L;  4DR3 Q;  2L15 A;  2VUM H;  1C9O A;  1P16 A;  1Q46 A;  1N36 Q;  3GTQ H;  3HOV H;  4R4T A;  5K36 G;  2BA0 A;  3HOY H;  4QGU A;  4BA2 I;  2JK8 A;  1XNQ L;  4NB3 A;  1K9M C;  2Q2I A;  4PZ7 A;  4DR6 Q;  1N8R C;  3M7N A;  2EIF A;  5GRO A;  1EUJ A;  3KF6 A;  2JA5 H;  4O0A A;  4A3M G;  3K7A H;  1PH8 A;  1BBW A;  3GD7 A;  1TWG H;  4A3D G;  5AJ3 L;  2N3S A;  3H0G G;  3PO3 H;  4GN5 A;  3HOW H;  1N32 Q;  1I6H H;  2K5N A;  3SGI A;  2A19 A;  3PF4 A;  4IOA A;  2Z6K C;  4AQY Q;  5GAG C;  2K50 A;  2XTI A;  1HR0 Q;  4KHP Q;  4LFA Q;  1L1O A;  3PSI A;  1L1O B;  4YCW A;  1TWH H;  1PH4 A;  4GOP A;  3S15 H;  5FJ8 G;  4LF6 L;  4LF9 Q;  3M9B A;  1NTG A;  2UUB Q;  2B29 A;  4OWX B;  4HJ9 A;  3CQZ H;  4BY7 G;  1U5K A;  1BVS A;  4DR2 Q;  4LF4 Q;  4A3M H;  2VQE Q;  3ER0 A;  1NMG A;  4DR7 L;  3EN2 A;  4APV A;  1X65 A;  4BBS H;  4JI8 Q;  1QVF A;  3CW2 C;  2ZTC A;  3RLF A;  4DAY B;  4GNX C;  4A76 A;  1N34 L;  4JI6 Q;  3BJU A;  1CUK A;  2CWA A;  4GS3 A;  4IOC A;  1YJ9 A;  3S17 H;  2IX1 A;  1J5E L;  2B63 H;  4YCV A;  4JI3 L;  5C4X H;  2IT1 A;  4FDB A;  4DKA C;  1X9N A;  1EYG A;  4LFC Q;  3CCV A;  4OX9 Q;  1XPU A;  2MO0 A;  2GVB A;  4C2M H;  1YIT A;  1RL2 A;  3TEH B;  3A0J A;  1MKH A;  1VQP A;  3E9I A;  4BBS G;  2MQH A;  3J80 c;  1X55 A;  4LF9 L;  4GN4 B;  3CCJ A;  2UUB L;  3CC2 A;  1IBL Q;  1R9T H;  1UE7 A;  2NVY H;  4A3C H;  3F2B A;  1B70 B;  1K8A C;  2VW9 A;  1CKN B;  1VQE A;  2QEX A;  4A3F G;  1HZ9 A;  1K8G A;  2F3I A;  3U4V A;  1N33 Q;  3H3V H;  2YTY A;  4HJ7 A;  4ME3 A;  3PUV A;  3S1M H;  2OTJ A;  1MIU A;  2NZH A;  4NXM L;  1HJP A;  3PUY A;  4DV4 Q;  4HID A;  5IP7 H;  1EOV A;  3G6E A;  1T9H A;  1PH5 A;  1OXT A;  2KHJ A;  1YEZ A;  1VQA A;  1L1O C;  5FLM G;  1PH1 A;  4A3B G;  2YU9 H;  1TWC H;  3EIV A;  2JA5 G;  3AFQ A;  1CKO A;  2I5H A;  3I7F A;  5IYD G;  1AE2 A;  1M1K C;  1PVO A;  3NBH B;  4Y7N H;  4LFB Q;  3G4S A;  1YJW A;  2Q2H A;  2UUA L;  3FKI H;  4A3G H;  1EFW A;  3K8A A;  4DUY Q;  4A3I H;  2XGT A;  5M5W H;  3BZC A;  4KI0 A;  1VQ9 A;  4K0K L;  5BR8 L;  1I5F A;  4DR6 L;  1I3Q H;  2ZTE A;  2WAQ G;  2WFW A;  3T1H Q;  4JI7 L;  1A63 A;  4AYB G;  4NPS A;  3S14 H;  1GVP A;  1UWV A;  1V9P A;  4YHH Q;  2AWO A;  5C0X J;  4DV1 Q;  4LUV A;  1PHJ A;  5M3M G;  1IBM Q;  4OWW B;  1W2B A;  1PA6 A;  3F8T A;  3L0O A;  2RHS B;  4JI2 Q;  1VQO A;  1Q8K A;  1Q81 C;  1JB7 A;  3M4O H;  5C3E G;  2UXC L;  2D0P A;  2Q2U A;  4OX9 L;  4DR5 Q;  3AFP A;  5J3B A;  3OTO Q;  2NVX H;  1VQF A;  2UU9 Q;  2D0O A;  2ASB A;  3J7A 5;  2N78 A;  3L7Z C;  4J15 A;  1FGU A;  1HR0 W;  1JJG A;  5LMN W;  4MNO A;  3STB D;  2UUA Q;  4A3J G;  4ALP A;  1KL9 A;  4A4I A;  5IP9 H;  1XMQ Q;  4P72 A;  4JYA Q;  3TRE A;  1XPR A;  5C4X G;  4LF5 L;  1IYJ B;  3TS2 A;  4GOP C;  1KIX A;  4A3B H;  4DR7 Q;  3I55 A;  1CSP A;  5GAD C;  4DK6 C;  1XMO Q;  1KAW A;  4BY1 H;  3I4N G;  4JCV E;  4GKJ Q;  2A1A A;  3ULJ A;  4IO9 A;  1S72 A;  1VQ7 A;  4NXM Q;  1VQ6 A;  1X3F A;  1AE3 A;  3A5Z B;  4TQU S;  1VQB A;  3ZJY C;  4GNX B;  3TRZ A;  2VS1 A;  2JA9 A;  5C3E H;  4AH6 A;  3F2C A;  4OO1 I;  4OXP A;  5LMN Q;  3TS0 A;  4A3L G;  2K5V A;  1K83 H;  1Q1B A;  2DGY A;  1QZG A;  1RIP A;  3IRB A;  2VNU D;  1YZ6 A;  4DAM A;  1N9W A;  3G71 A;  1UE5 A;  1JT8 A;  3M3Y H;  1Q82 C;  3NEN A;  5BR8 Q;  4DV5 Q;  1K73 C;  1BKB A;  3J81 i;  1YVC A;  3RZD H;  1KC8 C;  2IY5 B;  3D31 A;  4DUZ Q;  2R92 H;  1A0I A;  1VQC A;  4C3H H;  1P8L A;  2RCN A;  1WI5 A;  3MXN B;  4X62 L;  4LUO A;  3T1Y L;  1HNZ Q;  1OXX K;  1TXY A;  2UXB Q;  5JEA J;  4DV4 L;  4A3E G;  1S40 A;  1KXL A;  4X64 L;  1SRU A;  3PV0 A;  4IFD J;  3UDF A;  4DV0 Q;  3PIP A;  4JV5 L;  2UXC Q;  3I2Z A;  1Z9F A;  3HFZ B;  3EBE A;  2YV5 A;  4AYB E;  1WYD A;  2AMC B;  3JC6 6;  4MTN A;  4JI1 Q;  4A3K H;  1VQK A;  1YI2 A;  2CKZ B;  4X6A H;  1JJC B;  2ZTD A;  3GO5 A;  3DM3 A;  3MEF A;  4P73 A;  5IE8 A;  4GLX A;  3OW2 A;  2E8G A;  4HIO A;  1PH6 A;  1N36 L;  2VL6 A;  4IPC A;  1EIY B;  2JA7 H;  1UE1 A;  4JI0 L;  4A3I G;  1XNR L;  4QY7 A;  3KJO A;  3KJP A;  4A3E H;  1PH9 A;  2WB1 G;  2LXK A;  3RLN A;  3H3V I;  3J81 j;  1QUQ A;  4UY8 C;  2HHH Q;  2ZJR A;  4YHH L;  1PH2 A;  4JBJ A;  3HOU H;  4DR1 Q;  1XMO L;  4B3T Q;  4YCU A;  3I4O A;  2NZO A;  4A75 A;  3CC4 A;  2AKW B;  3GTL H;  4JI8 L;  1G29 1;  2I5M X;  2UXB L;  1LM0 A;  4RMF A;  5AJ3 Q;  2JA6 H;  4HJ5 A;  1E22 A;  1HNW L;  4JBM A;  3PGZ A;  1X3E A;  2ZM6 L;  4BXX G;  3HOX G;  1DGS A;  4JI5 Q;  3CCE A;  2H5X A;  3GTJ H;  1PFS A;  1VQJ A;  4DR5 L;  1KHI A;  3AYH B;  3OTO L;  1Q86 C;  3RN5 A;  3WWV A;  4HIK A;  3K7U C;  5M3F H;  4WJ3 M;  1G6P A;  4LF6 Q;  5IYC H;  1HZB A;  3L2P A;  3UE1 A;  1YNX A;  1MJE A;  3CPW A;  3ICE A;  4R1J A;  1GD7 A;  4DV2 Q;  1X3G A;  3GTM H;  4JOI A;  3S1Q H;  1EWI A;  4JI4 Q;  1PH3 A;  2ATW A;  3A5U A;  2UUC Q;  2KEN A;  1IBK Q;  3S2H H;  3HOZ H;  1U0L A;  1G51 A;  1HNZ L;  4JC0 A;  1VS0 A;  3W1B A;  4DNI A;  4BY1 G;  3I4N H;  1GO3 E;  3RNU A;  1NJI C;  1E1T A;  3DLL A;  4OON A;  1SFO H;  2CFM A;  3HOW G;  4X64 Q;  2HT1 A;  3PO3 G;  1E7Z A;  3W5O A;  3HKZ E;  1BBU A;  2HIX A;  5M3F G;  1KD1 C;  2NVT H;  3KFU A;  1CKM A;  4IJL A;  4A3D H;  2MFI A;  1QVG A;  1FJG L;  1B8A A;  5FLX c;  3W1G A;  2B3G A;  3UDI A;  4C3J H;  5C0X I;  3Q8D A;  1Z47 A;  1QZH A;  1XNR Q;  4A3L H;  2JA6 G;  4O2D A;  1Y1W H;  4GN3 B;  1KQS A;  4DPG A;  1PYS B;  2LXJ A;  4GLV B;  3T1H L;  3KDF B;  1VQ8 A;  3CXC A;  5M5X H;  1S3O A;  5C44 G;  4B3R L;  1VQM A;  1CKN A;  2OQK A;  4LF8 L;  4IPD A;  1D8L A;  2NN6 G;  4XIG S;  1WCM G;  1W3S A;  3J81 c;  1HNW Q;  4JV5 Q;  2ZM6 Q;  2WB1 E;  4GKK L;  4QQB X;  2OQ0 A;  4IJH A;  4DV7 Q;  3B6Y A;  3CC7 A;  4B3S Q;  2E2H H;  3ULL A;  3I4M G;  3UDX A;  2JE6 I;  3S24 A;  5H1S E;  4LNQ A;  3HOY G;  3M4Q A;  1HH2 P;  2PMZ E;  3HOV G;  4L5S A;  3PO2 G;  4LFB L;  4R4Q A;  4DV3 L;  5GAH C;  2Q2T A;  4K0K Q;  2HQL A;  3J80 i;  2IHE A;  1VQN A;  2KHI A;  3LGJ A;  4DV6 Q;  1VQG A;  1ASY A;  1E24 A;  1KRT A;  3VDY A;  2K14 A;  1JE5 A;  4BA1 I;  4IFD G;  1IBK L;  4B3T L;  3CMA A;  3RLO A;  1XTD A;  4YWK A;  2E2I H;  1NY4 A;  4MZ9 A;  4X65 L;  2F4V Q;  4HJA A;  5GQO A;  2K52 A;  3J7Z C;  2N49 A;  1WJJ A;  4JI2 L;  2UXD Q;  2CCZ A;  5LMN L;  1V1Q A;  2Y0S G;  2YTX A;  5EAY A;  2BH8 A;  4EX5 A;  2KCM A;  1OXU A;  1FJG Q;  3CP0 A;  4PMW A;  4JOI C;  3F1Z A;  1SMX A;  1SRO A;  1VQ5 A;  2V1C C;  3S2D H;  5IYC G;  5C4J H;  1QUQ B;  1YHQ A;  3K81 C;  4DV5 L;  4LF5 Q;  1SE8 A;  2K5H A;  3OYY A;  3CCR A;  4JYA L;  4LUZ A;  1Y14 B;  3CPF A;  3HKZ G;  4L5T A;  3A74 A;  4R4O A;  1PH7 A;  1NBW A;  2BA1 A;  2IX0 A;  3KF6 B;  1X56 A;  3U50 C;  4YY3 L;  3FHW A;  3I56 A;  4EQ5 A;  3ULP A;  2VY3 A;  1SLJ A;  5LMU L;  2E5L L;  1UEB A;  4KHZ A;  3FP9 A;  1QVC A;  5M3M H;  4LF8 Q;  4JI6 L;  5HGQ A;  4L5Q A;  4B3M Q;  1B7Y B;  3CCS A;  1K3R A;  2WAQ E;  2LSS A;  5IT9 c;  5C0X G;  4GKK Q;  4IFD I;  4UP7 A;  5ELN A;  3CCM A;  1Y1V H;  4B3S L;  2UXD L;  4GLA C;  5JJI A;  4LFA L;  1WOC A;  2F52 A;  2N8N A;  5IWA L;  2VQF Q;  3HOZ G;  4JI1 L;  4GOP B;  2GN5 A;  3RN2 A;  3KYH C;  3CD6 A;  1Q1E A;  3NEM A;  4A3F H;  1TWA H;  1EQQ A;  1V43 A;  1IL2 A;  3PIO A;  2CWP A;  1YHA A;  3KF8 B;  1OXV A;  4P74 A;  4QL5 A;  4A93 G;  1CSQ A;  1LYL A;  1Y1W G;  4LF7 L;  2JEA I;  2MO1 A;  4JG2 A;  4OO1 G;  4X62 Q;  2YTV A;  4DK3 C;  1GM5 A;  2R93 G;  2HIV A;  2PQA B;  2ES2 A;  3TQY A;  4YY3 Q;  1YBY A;  4NXN L;  4DR1 L;  3T1Y Q;  2D62 A;  3E9H A;  3PUZ A;  2GVA A;  4L5R C;  2OWO A;  5LMU Q;  1FVI A;  2JEB I;  1LTL A;  1MJC A;  3F2D A;  1PV4 A;  4UPA A;  2JA8 G;  3KLW A;  4X66 L;  3HOX H;  4BY7 H;  3CME A;  4JBK A;  2ID0 A;  1J5E Q;  4DV7 L;  2PNH A;  4Y52 H;  4HJ8 A;  4A93 H;  4A3C G;  3JAM c;  4JBW A;  4C3I H;  1Q7Y C;  3S1N H;  4UP9 A;  2RHQ B;  1J6Q A;  2BH2 A;  4H02 A;  1HNX Q;  1PYB A;  5JJL A;  4JI0 Q;  1VQL A;  4PG3 A;  4BBR H;  5IP7 G;  1JJ2 A;  4DV2 L;  4DV6 L;  1VQD A;  3M85 A;  1IBL L;  1GKH A;  1X6O A;  4BXX H;  5JJK A;  2R7D A;  2Y0S E;  3G48 A;  4YWL A;  4JI7 Q;  1VCI A;  3PO2 H;  2JJQ A;  4DR4 L;  4UP8 A;  2Z6K A;  1VQH A;  4PZ8 A;  2PQA A;  4NXN Q;  2JA8 H;  3HKS A;  4QIW E;  3CCU A;  1C7Y A;  2A8V A;  3D0F A;  3CAM A;  4IPH A;  4WJ4 A;  2I0Q A;  2VZA A;  5E7N A;  4JI3 Q;  1H95 A;  1KRS A;  2AHO B;  1HZA A;  3GTP H;  1L2F A;  1NMF A;  4R4I A;  3CCQ A;  3HOU G;  2VUM G;  3PCO B;  2Z0S A;  2FXQ A;  3BZK A;  5DLQ E;  2R93 H;  5IP9 G;  4DR3 L;  4A3J H;  1A62 A;  1TWF H;  1E1O A;  2B63 G;  4BBR G;  2R7Z G;  1HNX L;  3GTK H;  2R6G A;  1A8V A;  2YYZ A;  1NE3 A;  1XNQ Q;  2JA7 G;  4LW1 A;  2NN6 I;  4LWC A;  2IHF A;  3CF5 A;  1I94 L;  2HHH L;  4A3K G;  4JI4 L;  4IPG A;  2UUC L;  3AQQ A;  5GAE C;  1N33 L;  1VQI A;  4RG1 A;  2K4K A;  2ZJQ A;  2E5L Q;  4DV1 L;  1M90 C;  3H0G H;  1WFQ A;  3PF5 A;  2C35 B;  2E2J H;  1IBM L;  3GTO H;  2AWN A;  2PI2 A;  1X54 A;  2I5L X;  5M5Y H;  1YIJ A;  4B3M L;  3AEV A;  1LUZ A;  2ALY B;  3ERS X;  3GDE A;  4X66 Q;  5HY6 A;  4JI5 L;  1N32 L;  4P71 A;  4XTC S;  2EQS A;  2WP8 J;  3RR5 A;  2ZJP A;  1AH9 A;  1I50 H;  5IYB H;  4TVA B;  1IZ6 A;  2UU9 L;  4DUY L;  2R7Z H;  2CQO A;  2DUD A;  4POG A;  1XMQ L;  3FKI G;  4A3G G;  4QJF A;  2R92 G;  1WCM H;  2KBN A;  4LF7 Q;  3GTG H;  2R7F A;  1L0W A;  5IYD H;  3PUX A;  1OXS C;  5JEA G;  4DUZ L;  1I94 Q;  1SN8 A;  4DR2 L;  4LF4 L;  1VQ4 A; 
#chains in the Genus database with same CATH topology
 2DY7 A;  5FLX L;  4ILW A;  2F4V L;  4OGQ C;  2EY2 A;  5G3L F;  3K80 C;  4RA8 A;  4F88 A;  1D7Q A;  1XXG A;  5CR3 A;  3H15 A;  1U4L A;  3S16 H;  1DD2 A;  1S5C D;  4DV3 Q;  2A6H D;  1II3 A;  3CCL A;  1K0R A;  2F0D A;  5IOC A;  1ILP A;  1BCP B;  1YHB A;  2X6G A;  3U58 A;  2KCT A;  3RMH A;  4POF A;  2OCE A;  2WKC A;  1BR9 A;  5E3F A;  1WCM B;  1Q12 A;  3R93 A;  5IYB G;  1KTK A;  5JOB A;  4QUC A;  3IFD A;  4GNX A;  2PMZ B;  1QIL A;  4KV6 A;  1FNW A;  3PUW A;  2QGQ A;  2G5D A;  1SYG A;  5IWA Q;  1UUP A;  1P16 A;  5KYI A;  1YNJ C;  4QGU A;  1K28 A;  4BA2 I;  1XNQ L;  3C1F A;  4NB3 A;  3K5O A;  4K2K A;  4IUT A;  5EPJ A;  5C3X A;  1XTC D;  2SDF A;  2JA5 H;  2F0W A;  4L6T B;  4I7Z C;  3C2P A;  2F0J A;  2LMC B;  4GN5 A;  4G7H C;  1I6H H;  1OO9 B;  1AFP A;  3PF4 A;  1GXD C;  5M9O A;  1TS2 A;  2P5Z X;  1CZG A;  1PH4 A;  1L1O B;  1EOT A;  1I6V C;  1TWH H;  4NW2 A;  3D8G A;  2F0H A;  1PZK D;  3SK8 A;  2NN6 H;  4OEM B;  1BVS A;  1X65 A;  3RLF A;  4G4K A;  5BN5 A;  4HR7 B;  3J81 L;  3KLS X;  1DZ1 A;  3MVV A;  3BJU A;  1JWM D;  4KY5 A;  3SR1 A;  1EYG A;  4LFC Q;  3CCV A;  2GVB A;  5C5L A;  1RL2 A;  1STN A;  1S5B D;  2MQH A;  1HTL D;  1F77 A;  1IBL Q;  5JJZ A;  2NVY H;  3M3Y B;  1B70 B;  5JAV A;  1CKN B;  4A3F G;  4CJ0 B;  2YTY A;  4ME3 A;  3KLS A;  1MIU A;  3SK4 A;  5FO8 B;  2D9U A;  1T9H A;  1PH5 A;  2KHJ A;  1WTP A;  1L1O C;  1TWC H;  1JOO A;  1CKO A;  1SNQ A;  1STB A;  2I5H A;  1PVO A;  3NBH B;  3I90 A;  4Y7N H;  3MC0 B;  5D3I B;  1EFW A;  2XGT A;  3BZC A;  1V8Q A;  1EU4 A;  1I5F A;  1SYF A;  4CKC A;  2ZTE A;  2WFW A;  1I4H A;  1A63 A;  3MEH A;  4I65 A;  3TP8 A;  3NE5 B;  4AYB G;  1RKN A;  1V9P A;  1SNM A;  3GTK B;  1PHJ A;  4OWW B;  5M3M G;  1RD9 D;  3HGB A;  3BVZ A;  5IGG A;  2EVB A;  5C3E G;  3FPP A;  3WOF A;  5IGE A;  5J3B A;  3OTO Q;  4FO2 A;  1VQF A;  2UU9 Q;  4OEL B;  2K7V A;  2N78 A;  1CTM A;  4MNO A;  4A4I A;  4P72 A;  1ML0 D;  3TRE A;  2EJG C;  4LF5 L;  3TS2 A;  5E4X A;  4DR7 Q;  3NQT A;  1KAW A;  1JQY D;  4JCV E;  4GKJ Q;  3E3X A;  1B9N A;  1VQ7 A;  1AE3 A;  3A5Z B;  3F2C A;  4AH6 A;  3HKZ B;  1Y8P B;  1JR0 D;  4EVO A;  2DGY A;  1QZG A;  4FNF A;  1LTT D;  2E76 C;  3OW7 A;  5JPM C;  3G71 A;  2YU9 B;  1A3U A;  1Q82 C;  2EYP A;  1BKB A;  1KC8 C;  2R92 H;  1HXY D;  1A0I A;  2QF7 A;  2XWJ B;  2RCN A;  3A8I E;  1QCB D;  2UXB Q;  2QKI C;  4F7X A;  4X64 L;  1SRU A;  3I2Z A;  2YV5 A;  4OHJ A;  2CKZ B;  2KCC A;  1PH6 A;  3HOX B;  4P73 A;  3O13 A;  1HPC A;  3VR6 A;  2E8G A;  4HIO A;  3OW2 A;  1EIY B;  4G7Z C;  3KJO A;  3KJP A;  1CM9 A;  2LXK A;  4IUR A;  3H3V I;  4JW0 A;  3J81 j;  4UY8 C;  2KQ3 A;  2ZJR A;  4JBJ A;  3HOU H;  1JIC A;  1SNP A;  2AKW B;  5EKK A;  1G29 1;  2I5M X;  4RMF A;  1HNW L;  4JBM A;  5CYU A;  2A5H A;  1PFS A;  3I73 A;  3AYH B;  5M3F H;  1NSN S;  1YNX A;  3CPW A;  3ICE A;  1GD7 A;  4DV2 Q;  3KBX A;  3GTM H;  1O78 A;  3HOU B;  3RD4 A;  4JI4 Q;  1PFM A;  3NXW A;  3TDQ A;  1IL8 A;  1TWG B;  1KNA A;  1IBK Q;  4A3G B;  2IL8 A;  3HOZ H;  1HNZ L;  5J22 A;  3RNU A;  5J39 A;  4OON A;  1SFO H;  3HOW G;  3PO3 G;  1E7Z A;  1D1I A;  3W5O A;  1BBU A;  5M3F G;  3TP6 A;  2Z6B A;  2O5I C;  2MFI A;  3NPP A;  2JSO A;  3W1G A;  5C5M A;  4C3J H;  5EGT A;  3CHB D;  4GN3 B;  3KDF B;  1S4Z A;  5CV7 A;  1JB3 A;  3EFX D;  3CXC A;  1PRT F;  2EOT A;  2B2T C;  5AFW A;  4CGY B;  2QIL A;  4RGO S;  4R8I A;  5C4H A;  1SYC A;  2QDL A;  4JV5 Q;  4IJH A;  3CC7 A;  2LY7 A;  2E2H H;  3I4M G;  3UDX A;  4L63 B;  2BE5 D;  3VYR A;  5H1S E;  1TS5 A;  2K05 A;  3VR4 A;  3PO2 G;  4DV3 L;  1GHJ A;  4RHR A;  2Q2T A;  1QJO A;  4EQN A;  2RA4 A;  4WFN 3;  4ZUI A;  1F2L A;  5EBC A;  1PFB A;  1ASY A;  3VDY A;  2K14 A;  2LS0 1;  1JE5 A;  3CMA A;  1Y1W B;  1SSO A;  1MSH A;  2E2I H;  1NY4 A;  4C1N K;  4X65 L;  1U4P A;  1AZP A;  5GQO A;  5M3F B;  2K52 A;  4U67 3;  2N49 A;  1WJJ A;  4JI2 L;  2UXD Q;  5E4W C;  2CCZ A;  2BCO A;  4EGV A;  2BH8 A;  3D4W A;  2KCM A;  3TZU A;  2PNR C;  1FJG Q;  3E6Z X;  3NHH A;  4PMW A;  4B9X A;  5I2Y A;  1VQ5 A;  2V1C C;  3ONA B;  3S2D H;  2K33 A;  1TY2 A;  1CA6 A;  2HQE A;  1SE8 A;  1QE6 A;  3CCR A;  2OXP A;  1Y14 B;  3HKZ G;  3KF6 B;  1X56 A;  1F2Y A;  3ULP A;  2VY3 A;  1EY9 A;  1SLJ A;  5LMU L;  4JI6 L;  4L5Q A;  4B3M Q;  1B7Y B;  4OO1 H;  4GKK Q;  2LSS A;  1HFN A;  3UI2 A;  2F52 A;  2F0U A;  3I8Z A;  1Q1E A;  3NEM A;  3BYT B;  1IW7 C;  1V43 A;  5CV5 A;  3PIO A;  3NQI A;  1UEA B;  3TZD A;  3KF8 B;  4P74 A;  3KF8 A;  1LYL A;  2JXM B;  2E2D C;  1Y1W G;  3DWP A;  4OO1 G;  4JG2 A;  4X62 Q;  3LX0 A;  4DK3 C;  4RWS C;  3TQY A;  3T1Y Q;  3KLR A;  2GVA A;  2PQE A;  3DWA A;  1F9Q A;  5EPK A;  1VDZ A;  3LNN A;  4JBK A;  4C3H G;  2PCF B;  2PNH A;  4HJ8 A;  1KAA A;  2AQ1 B;  1BUV T;  4TRD A;  4H02 A;  1HNX Q;  1CI3 M;  1PYB A;  4JI0 Q;  4PG3 A;  5IP7 G;  4DV2 L;  1VQD A;  2XNA C;  1IBL L;  5JJK A;  2BDN A;  2F0L A;  2J0T D;  3VYT A;  3MXP A;  3CQZ B;  4V0B A;  1PXU A;  4X3K A;  1CHQ D;  2JJQ A;  1PTO D;  2EYM A;  1WTO A;  2PQA A;  1PTO F;  2KHS A;  3HKS A;  1SEB D;  3D0F A;  4IPH A;  4WJ4 A;  5CBE E;  3H94 A;  2J4X A;  1HZA A;  4XQN A;  3DXJ C;  4IN3 A;  3HOU G;  5KGU A;  3A7A B;  2J7Z A;  1J9O A;  1GOZ A;  3MAQ A;  4XYQ A;  5IP9 G;  1A62 A;  5TSS A;  3X3M A;  4Z9C B;  2B63 G;  2L5T A;  2R7Z G;  1U4M A;  4KJO A;  1A8V A;  3K7A B;  2JA5 B;  4KMU C;  4LW1 A;  2IJ0 A;  3QOL A;  1I94 L;  1LTR D;  3AQQ A;  1N33 L;  2AQ2 B;  1ROD A;  3K59 A;  5JEA H;  3GTO H;  4K8I A;  2C35 B;  1LAB A;  4EQP A;  1YIJ A;  1PRT B;  3CU7 A;  2F3W A;  4X66 Q;  1N32 L;  3S2D B;  4K6D A;  3RR5 A;  3URY A;  2ZJP A;  1AH9 A;  3FDT A;  1ENC A;  4TVA B;  5C44 B;  1IZ6 A;  4K5W A;  2F0G A;  4LAA A;  2UU9 L;  1EZ6 A;  2DUD A;  4TSS A;  3D6W A;  1XMQ L;  2N55 A;  1WCM H;  2D5D A;  5IYD H;  1PMR A;  4XXE A;  3CRK C;  4DR2 L;  2IW3 A;  4OWT B;  3GV6 A;  4GKJ L;  1HCZ A;  3RZO H;  4X65 Q;  3H09 A;  1C0A A;  1MSG A;  3MWY W;  1F2Z A;  1DYQ A;  2R61 A;  2O4X A;  4AQY L;  2B63 B;  1HR0 L;  4KHP L;  4P75 A;  3V2T A;  1EIF A;  5FO9 B;  1HUM A;  1SR3 A;  1SMY D;  4HED A;  2F0V A;  2CW0 D;  1WTH A;  1D6E C;  1E3P A;  4R4C A;  4KLK A;  3I4M H;  4HAE A;  3OIQ A;  1YJN A;  2FIN B;  3T16 A;  1R9T B;  5IY0 A;  5FJ8 H;  2F0M A;  2WB1 B;  4YWM A;  1N34 Q;  2PI2 E;  1GUS A;  5LL6 X;  1TWH B;  3PMF A;  2EDG A;  1OTC A;  1IXR A;  2K04 A;  3BDL A;  2RCF A;  3FRP B;  1QOH A;  2B2V A;  1R4Q B;  5IGF A;  4DR3 Q;  1BF4 A;  3FVQ A;  1JOQ A;  1Q46 A;  1B3A A;  2EY1 A;  2FFK B;  1N36 Q;  4KKT A;  3HOV H;  3HOY H;  3J7A V;  2FMM A;  3OIP A;  2B2Y C;  3I91 A;  3A8K E;  2Q2I A;  4PZ7 A;  3U9O A;  3M7N A;  2EIF A;  2HDM A;  3EQL C;  3GP7 A;  3HOZ B;  1K8M A;  2Q8T A;  5LHY 1;  4CJ1 B;  1TWG H;  4A3D G;  1SJH D;  2KVM A;  3S15 B;  1SE3 A;  3J7A F;  2K5N A;  2RSN A;  4DA2 A;  2Z6K C;  2K50 A;  2XTI A;  2K6A A;  4NMZ A;  5A2Q L;  3DEO A;  3MFY A;  3S15 H;  1GUW A;  3BVG A;  1NTG A;  2H1E A;  2UUB Q;  3GTO B;  4HJ9 A;  4BY7 G;  1O80 A;  1KDA A;  3KBG A;  4LF4 Q;  1UAP A;  4A3M H;  3ER0 A;  4DXG A;  2E74 C;  4APV A;  1Y69 U;  4BBR B;  2WAQ B;  1QVF A;  4A76 A;  4DAY B;  5JPN C;  4GNX C;  5KIX A;  1B44 D;  2E2H B;  4JI6 Q;  4GS3 A;  2CWA A;  3S17 H;  3S16 B;  1FNU A;  5C4X H;  3LWE A;  1X9N A;  1VMC A;  1GUT A;  4G7O C;  2MO0 A;  1YIT A;  1MKH A;  1ENA A;  2L4N A;  3J80 c;  4R8N A;  4GN4 B;  3CCJ A;  3CC2 A;  1R9T H;  3SK6 A;  2XRQ D;  3K0Y A;  1K8A C;  1VQE A;  1N33 Q;  2F3I A;  3PUV A;  2OTJ A;  2R92 B;  3BDC A;  4NXM L;  1HJP A;  1E0B A;  2PW5 A;  1JOR A;  1GJX A;  2B2W A;  3TN2 A;  3P20 A;  1FNV A;  1I50 B;  2F0Q A;  1D5X C;  3ND8 A;  5FLM G;  1PH1 A;  3X3N A;  4A3B G;  3BZD B;  2JA5 G;  3AFQ A;  3I7F A;  3NBH A;  1LTB D;  2Q2H A;  5ELC A;  4Q5V A;  4A3G H;  1PYW D;  5M5W H;  1QNK A;  4KI0 A;  4EQO A;  5BR8 L;  4RCO A;  2WAQ G;  4NPS A;  4H7B A;  3W3A A;  5KND A;  1EWC A;  2AWO A;  2M2L A;  4K5X A;  1GUO A;  3L0O A;  1VQO A;  4IUP A;  2D2C C;  3A55 A;  4IZ8 A;  2RQX A;  2D0P A;  2Q8R E;  2Q2U A;  1QNU A;  1ZXT A;  4DR5 Q;  2NVX H;  5FLX E;  4K8J A;  2D0O A;  4XQJ A;  5JVG 3;  3A56 A;  4J15 A;  5T1I A;  4ALP A;  1ICF B;  2EYL A;  4JYA Q;  3K58 A;  1IYJ B;  1V1P A;  3OSO A;  1KIX A;  1NCV A;  4A3I B;  1CSP A;  4HSP A;  4PMC A;  2A1A A;  1X3F A;  4CDD C;  3ZJY C;  2VS1 A;  1HTP A;  3S1N B;  4OO1 I;  1B2T A;  3IRB A;  3H6M A;  1N9W A;  2CW0 C;  2XWB B;  1NR2 A;  3NEN A;  2A6H C;  5FO7 B;  3M7G A;  3J81 i;  2K5W A;  3D31 A;  1P8L A;  2DY8 A;  4X62 L;  1RTO A;  4RCN A;  2F0T A;  3EVQ A;  5EKI A;  4KY7 A;  1S40 A;  2B2T A;  3U9S A;  2WKD A;  1BBX C;  1GUG A;  3PV0 A;  4IFD J;  1TII D;  3OPO A;  3PIP A;  2UXC Q;  1Z9F A;  3HFZ B;  3EBE A;  2NUC A;  1CQF A;  2OEO A;  1VQK A;  1YI2 A;  4X6A H;  1TVX A;  1JJC B;  2ZTD A;  1EY6 A;  3GO5 A;  3I70 A;  5IE8 A;  2VL6 A;  1UE1 A;  4JI0 L;  1RCV D;  2ZXR A;  4CKE A;  3J80 E;  4A3I G;  1XNR L;  2BE5 C;  3NTK A;  2L12 A;  2A69 C;  1XMO L;  2NZO A;  1Q90 A;  2UXB L;  3BG3 A;  2PYK A;  3SE0 A;  3BS1 A;  3PGZ A;  1ESR A;  2XVS A;  1DGS A;  1Y8O B;  5ELB A;  3CCE A;  3GTJ H;  3OTO L;  3WWV A;  4WJ3 M;  1G6P A;  2B2W C;  3S14 B;  3UE1 A;  2NBF A;  1MJE A;  4R1J A;  4JOI A;  2HCI A;  1EWI A;  1PH3 A;  3A5U A;  2UUC Q;  3NP8 A;  3VA5 A;  3FKI B;  3S2H H;  1ET6 A;  1SYE A;  3GTM B;  1G51 A;  1DOL A;  4BY1 G;  1A3V A;  4YIJ A;  3KUP A;  1E1T A;  3DLL A;  4A3K B;  3HKZ E;  2DNE A;  2NVT H;  4IJL A;  1B8A A;  4DNR B;  1K8O A;  2B3G A;  3UDI A;  1H9K A;  1Z47 A;  2NVY B;  2K32 A;  2RDH A;  3DEP A;  2JA6 G;  4O2D A;  4DPG A;  3SHL A;  4DNT B;  4QMG A;  4ZK9 B;  3G7L A;  5IGD A;  5M5X H;  1CKN A;  4LF8 L;  4XIG S;  1WCM G;  4Q0F A;  2ZM6 Q;  4QQB X;  2CQA A;  4DK1 A;  2PMZ E;  4L5S A;  4R4Q A;  5GAH C;  2MGS A;  4K0K Q;  1DCZ A;  1SYB A;  3OWF A;  2IHE A;  2KHI A;  4DV6 Q;  1VQG A;  3I3C A;  4JVZ A;  3V05 A;  4BWG B;  1XTD A;  2NWG A;  2XRS D;  4KD3 A;  2FJ2 A;  4IUU A;  1RHP A;  1DXM A;  1JWU D;  2Y0S G;  2E2J B;  3QG1 A;  2KJX A;  3F1Z A;  1SMX A;  1Y1V B;  2NB0 A;  4DFA A;  3G6J B;  5C4J H;  3GTL B;  1QUQ B;  4LUZ A;  4NP5 A;  4L5T A;  3CPF A;  2DNC A;  3A74 A;  1E2W A;  1LT3 D;  1QG7 A;  1I3Q B;  2BA1 A;  2IX0 A;  3U50 C;  3DM1 A;  3I56 A;  1EYC A;  2E5L L;  1Z7T A;  1UEB A;  3FP9 A;  5ISR A;  4HMJ A;  1K3R A;  2WAQ E;  5IT9 c;  5C0X G;  2UXD L;  1TWF B;  5COR A;  4GLA C;  5F2D A;  1WVL A;  4LFA L;  2JA8 B;  1XWE A;  4IUQ A;  2VQF Q;  4O1N A;  3KYH C;  3RN2 A;  3CD6 A;  4A3F H;  3GTP B;  4HMI A;  1IL2 A;  1YHA A;  2AUK A;  4C3H B;  5C6A A;  4QUF A;  4LF7 L;  2MO1 A;  4RFB A;  1SYD A;  2ES2 A;  1SNO A;  3IL8 A;  2D62 A;  2ZXO A;  3PUZ A;  5LMU Q;  1FVI A;  4R9W A;  3F2D A;  1MJC A;  4DF7 A;  4BY7 H;  4DGZ A;  3HRZ C;  3NWT A;  3N6R A;  3CME A;  1D5Z C;  4Y7N B;  1CQV A;  2ID0 A;  1SBB B;  2C5C A;  4CKB A;  1SDF A;  1Q7Y C;  4UP9 A;  1I4R A;  1EQT A;  2RHQ B;  2K01 A;  4A93 B;  1LTI D;  1FD7 D;  1BO0 A;  2KEE A;  1H9S A;  1TWA B;  4E6I A;  3G48 A;  4N8X 1;  3K57 A;  1VCI A;  1MD2 D;  4DR4 L;  2XN9 C;  3TME A;  2E75 C;  4PZ8 A;  2JA8 H;  4XT1 B;  1T5X D;  5G3L D;  2A8V A;  5E1F A;  3CAM A;  4AYB B;  2WV6 D;  5E7N A;  4JI3 Q;  5COY A;  1KRS A;  2AHO B;  5CV6 A;  3GTP H;  3P1H A;  3LWU A;  1L2F A;  4R4I A;  3A54 A;  3H3V C;  1AP0 A;  5C3E B;  2NVT B;  2OT2 A;  4K2L A;  1TWF H;  3T53 B;  1X32 A;  2L0C A;  4BBR G;  4NDX A;  1HNX L;  5CC4 A;  4M8A A;  2YYZ A;  1NE3 A;  2JA7 G;  4BY1 B;  1G2S A;  1VF5 C;  2IHF A;  4A3K G;  4JI4 L;  5D65 A;  4FXG C;  1VQI A;  3T4A C;  3N52 A;  2AWN A;  1SE4 A;  2PI2 A;  2VUM B;  4B3M L;  1VF7 A;  3GDE A;  1E2V A;  2NTS A;  5HY6 A;  2A68 D;  4P71 A;  3Q24 A;  1I50 H;  2F0N A;  3AB9 A;  4JK1 C;  2WII B;  1CFM A;  5IYB H;  4RGT A;  3GTJ B;  2F0P A;  4ZCK A;  4QJF A;  2WAC A;  5ELD A;  2R92 G;  3R3O A;  1MI2 A;  3GTG H;  2R7F A;  3SXH A;  2C9O A;  4K5V A;  1I94 Q;  1B1Z A;  4IAL A;  2NZ1 D;  1VQ4 A;  2HCC A;  3UE0 A;  4B3R Q;  1XPO A;  1EEF D;  3U4Z A;  4BS9 A;  4C2M B;  2QA4 A;  4HCE A;  4DV0 L;  3S9W A;  1XJV A;  1EQV A;  2OTL A;  4AIM A;  5EPL A;  3ZYY X;  3S17 B;  1I4P A;  5J1Z A;  2JQO A;  3M4P A;  3E0E A;  1Y8N B;  1ZEQ X;  1CA5 A;  3OHX C;  4CDE C;  2NVQ H;  2VQE L;  4ZUJ A;  2QDB A;  3VR2 A;  2MNA A;  3K0X A;  2PZT A;  5ELO A;  1FL0 A;  5C44 H;  4FXK C;  1Y1V G;  3BYY B;  4ID6 A;  2K75 A;  1SE2 A;  3UDG A;  1JOK A;  4CHT B;  1SNC A;  1L0Y B;  2QEJ C;  2VQF L;  4MTK A;  2BA0 A;  1K9M C;  4BBS B;  4DR6 Q;  4PV1 C;  3MFG A;  1S5E D;  5GRO A;  4XDX A;  3KF6 A;  4O0A A;  4A3M G;  5DAU A;  3K7A H;  4ZYS A;  1PRT C;  1KDC A;  5AJ3 L;  3H0G G;  3PO3 H;  4KK7 A;  3HOW H;  1N32 Q;  2L11 A;  2B8G A;  1C48 A;  3SGI A;  4IOA A;  4AQY Q;  5GAG C;  1HR0 Q;  4KHP Q;  1L1O A;  3PSI A;  4YCW A;  4ABN A;  3HOW B;  3PO3 B;  4LF9 Q;  1JCK B;  5CMD A;  4XYO A;  2B29 A;  1K3B C;  4OWX B;  1W6K A;  3CQZ H;  4WJW A;  1U5K A;  4LK1 C;  1BQQ T;  4DR2 Q;  2JA7 B;  1NMG A;  3NSW A;  2CH4 W;  1UNS A;  4BBS H;  3M4Y A;  3CW2 C;  1N34 L;  4KHV A;  1FYC A;  1BOS A;  1YJ9 A;  3QWN A;  2B63 H;  4DXF A;  4YCV A;  1EU3 A;  1ICW A;  4JI3 L;  2B2V C;  4FDB A;  3SEB A;  4QF4 A;  1K0S A;  4OX9 Q;  3TEH B;  2VB2 X;  3A0J A;  1VQP A;  3E9I A;  4BBS G;  1WTX A;  1X55 A;  1F2M A;  2UUB L;  2SNM A;  3C46 A;  1UE7 A;  3I4L A;  1HQM C;  3PO2 B;  1EWH A;  3T56 B;  2G9H D;  1ET9 A;  1HRJ A;  1K8G A;  3D4D A;  4HJ7 A;  2NZH A;  1H9R A;  4DV4 Q;  5IP7 H;  1EOV A;  3K5L A;  2HUG A;  1OXT A;  1PTO C;  1YEZ A;  1VQA A;  3EIV A;  3D3R A;  3HP3 A;  4LFB Q;  2ICI A;  1YJW A;  1STA A;  2UUA L;  3FKI H;  1D2B A;  4A3I H;  1L0X B;  1YNN C;  1VQ9 A;  4K0K L;  3BVM A;  3WDN A;  2R3Z A;  2KA7 A;  1AW7 A;  5K5P A;  2EYJ A;  1LTS D;  1NAP A;  2ENB A;  3S14 H;  1GVP A;  1UWV A;  3GTG B;  4YHH Q;  4DV1 Q;  4N9T A;  4MIU A;  2L55 A;  1NUC A;  4LUV A;  1IBM Q;  4MN3 A;  1JC7 A;  1PA6 A;  3F8T A;  4FP5 D;  1E2Z A;  2RHS B;  4K14 A;  4U68 A;  4X3T A;  5IIF A;  2RVL A;  2Z8L A;  4FF2 A;  2JA6 B;  5C4Z A;  3P7J A;  3E0J A;  4B9W A;  1NNX A;  2F0E A;  3L7Z C;  1FGU A;  4HTH A;  1YNN D;  1HR0 W;  5LMN W;  3STB D;  1YNJ D;  1WTQ A;  2QCP X;  1HFG A;  2X6L A;  1XMQ Q;  1EY5 A;  2JN4 A;  5C4X G;  2XIW A;  1STG A;  4A3B H;  5GAD C;  4RKB A;  4BY1 H;  2F1M A;  1X3Q A;  4RHS A;  4IO9 A;  4NXM Q;  1BCP C;  4TQU S;  3R8B A;  4A3J B;  3Q22 A;  2JA9 A;  5C3E H;  4C3I B;  4KKU A;  5LMN Q;  4A3L G;  1IKL A;  5M5W B;  3IFT A;  3Q23 A;  3HOY B;  2K5V A;  4XT3 B;  3HOV B;  1K83 H;  1Q1B A;  2EJM A;  2SNS A;  3GTQ B;  2VNU D;  3OMG A;  4DAM A;  3PIP 3;  1BNZ A;  5I6Y A;  5KRU A;  1JT8 A;  1U4R A;  1HA6 A;  5BR8 Q;  4DV5 Q;  1WTR A;  1K73 C;  4RKL A;  2A6E C;  2IY5 B;  1XX8 A;  1EYD A;  1O7L A;  1RTN A;  1VQC A;  1WTW A;  3QIA A;  1HNZ Q;  1OXX K;  1D5M C;  5JEA J;  4A3E G;  1A2T A;  1KXL A;  1SXT A;  1ENF A;  5I9O A;  3UDF A;  3QJY A;  4DV0 Q;  1AZQ A;  5KNB A;  1WYD A;  2AMC B;  4JI1 Q;  1WD1 A;  1SFO B;  5BN4 A;  3HG9 A;  3DM3 A;  4GLX A;  5C4X B;  4A3M B;  1TKW B;  1N36 L;  2F3V A;  4KN4 C;  4A3E H;  2K1B A;  1I4Q A;  3RLN A;  3VR3 A;  1QUQ A;  4UAI A;  2HHH Q;  1D1K A;  1SJE D;  5JVH 3;  1PFN A;  1EYA A;  3K6O A;  4DAY A;  4B3T Q;  1A2U A;  3I4O A;  4YCU A;  3J80 L;  1Q3L A;  4HJ5 A;  1E22 A;  3IAY A;  1X3E A;  3NTH A;  2RBM A;  3HOX G;  4HCS A;  1EIG A;  2H5X A;  3DMU A;  4DR5 L;  1HA5 A;  3RN5 A;  4HIK A;  4QCL A;  4LF6 Q;  1ESF A;  5CV8 A;  1X3G A;  1RDP D;  1DOK A;  5M5Y B;  5FOB B;  2ATW A;  2EYF A;  3VYS A;  4S3S A;  4A3E B;  2CVR A;  1ILQ A;  3W1B A;  4DNI A;  3I4N H;  1GO3 E;  2BOS A;  1WTV A;  4ZLT F;  4X64 Q;  2HT1 A;  4UDU C;  4KN7 C;  1QVG A;  1B3Q A;  4H0L C;  4X3U A;  5C0X I;  3Q8D A;  1XNR Q;  3I4M B;  4A3L H;  3J81 E;  3JAM L;  1KQS A;  1U9R A;  2A73 B;  4GLV B;  3H91 A;  1VQ8 A;  4ZKC B;  4B3R L;  1VQM A;  2OQK A;  4OIK A;  1D8L A;  2NN6 G;  1W3S A;  1HNW Q;  1EL0 A;  2GA4 B;  2OQ0 A;  4DV7 Q;  4B3S Q;  3RZO B;  4C3I G;  3S24 A;  3HOY G;  3M4Q A;  1DJR D;  1HH2 P;  3HOV G;  2KCN A;  3HZX A;  3I72 A;  4J1M A;  3J80 i;  4RGM A;  5M5X B;  3LGJ A;  2Y0S B;  5IOD A;  1E24 A;  5ELE A;  2RDF A;  2LFN A;  4IFD G;  2DJG C;  1IBK L;  1BCP F;  2L1B A;  4QIW B;  3RLO A;  4YWK A;  4MZ9 A;  4HJA A;  1DM0 B;  4DN4 M;  2SEB D;  4C3J G;  5HUR A;  2F03 A;  5LMN L;  1V1Q A;  2YTX A;  4A3D B;  3P75 A;  4EX5 A;  1GHK A;  4ODG A;  1RJT A;  3CP0 A;  1SRO A;  2KUM A;  5IYC G;  5KYL A;  3K81 C;  1BXT A;  1O7Y A;  4DV5 L;  1HUN A;  3S2H B;  5M3M B;  2O5J C;  3OYY A;  4JYA L;  1PH7 A;  2AQ3 B;  1NBW A;  2A68 C;  1T5E A;  4YY3 L;  2B2U A;  4ZAI A;  4EQ5 A;  5K36 H;  2F0F A;  3ITP A;  3A7L A;  4KHZ A;  5M3M H;  3VA7 A;  5HGQ A;  3CCS A;  4FXD A;  5FKA C;  4IFD I;  4UP7 A;  3DWQ A;  3CCM A;  1WD0 A;  4RAU C;  5JJI A;  1G2T A;  5IGB A;  1STY A;  2N8N A;  5DNF A;  4JI1 L;  1EQQ A;  1S5D D;  2CWP A;  1IYV A;  1CSQ A;  1J8I A;  4TKO B;  5EKL A;  2M00 A;  3AMU A;  4O42 A;  1GM5 A;  2ZXP A;  2R93 G;  1STH A;  2PQA B;  2JYO A;  4NXN L;  4ZRZ A;  2F0S A;  3TP7 A;  4L5R C;  2OWO A;  1I4G A;  2CH4 A;  2B2U C;  1LTL A;  2BDO A;  2JEB I;  4UPA A;  1PRT D;  3KLW A;  4X66 L;  3T13 A;  1EIH A;  1AEX A;  4P2C B;  3C3L A;  1IYU A;  1ZYR D;  5DM6 3;  4DAV A;  4Y52 H;  4A3C G;  3JAM c;  4FVM A;  1Q8I A;  4C3I H;  1TT2 A;  3E5S A;  1EFI D;  1VQL A;  3QOJ A;  1JJ2 A;  2EYO A;  3A8J E;  4DV6 L;  2EY5 A;  2RSO A;  4YWL A;  4JI7 Q;  1DOM A;  4KY6 A;  2R7Z B;  1ONL A;  2Z6K A;  3BDO A;  3ERQ A;  1C7Y A;  4IUN A;  1V1O A;  2I0Q A;  2VZA A;  1H95 A;  2FMC A;  2A69 D;  3NWS A;  4M1U B;  1NMF A;  1PLF A;  4ME5 A;  3EJI A;  1LT4 D;  3C1E A;  5DEH A;  2Z0S A;  2FXQ A;  2PZU A;  3BZK A;  4J8Q A;  5DLQ E;  2G9D A;  1E1O A;  3W2D A;  2RDG A;  2Z4I A;  3GTK H;  3SK5 A;  1XNQ Q;  5CBA E;  4LWC A;  5ELF A;  2HHH L;  1G8Z D;  3OWE B;  4IPG A;  2UUC L;  1TS4 A;  1XYI A;  4RG1 A;  2ZJQ A;  2E5L Q;  4DV1 L;  1M90 C;  4KKS A;  1PZI D;  1WFQ A;  3PF5 A;  1IBM L;  2MJ8 A;  1X54 A;  2I5L X;  5M5Y H;  3AEV A;  2NVX B;  3MXG A;  2EQS A;  1TU2 B;  2E2I B;  3M4O B;  4DUY L;  1EY0 A;  2R7Z H;  4G57 A;  4POG A;  4A3G G;  3MHB A;  2TMP A;  3CRL C;  4LF7 Q;  2F0O A;  2M9V A;  3PUX A;  4GZY C;  4DUZ L;  1SN8 A;  3Q6S A;  3PQI A;  3JAM i;  3NEL A;  1BDO A;  2RF4 A;  1LV9 A;  2MPM A;  1UE6 A;  3BU2 A;  4HIM A;  3KOJ A;  1JMC A;  1G6Z A;  1O7I A;  4LFC L;  1B53 A;  2I07 B;  4PZ6 A;  2X69 A;  4HN7 A;  4LMQ D;  3STB C;  2EXD A;  2HDL A;  3S1M B;  3ND9 A;  4RH6 A;  1HZC A;  1KAB A;  4DK0 A;  4C3J B;  1ASZ A;  4DR4 Q;  3QB3 A;  2PPB C;  2DN8 A;  1BCP D;  4OIJ A;  3KDF A;  5FLM H;  3S1R H;  4F8M A;  3J7Y W;  1TR5 A;  1H9J A;  5IT9 L;  1EQR A;  1S5F D;  1I6H B;  1LT5 D;  5NUC A;  4LJZ C;  2L15 A;  2VUM H;  1C9O A;  1K83 B;  1IW7 D;  3GTQ H;  4R4T A;  3ERO A;  5K36 G;  1NR4 A;  2JK8 A;  1H9S B;  4N9P A;  3MXU A;  1N8R C;  3AU7 A;  3I4N B;  1EUJ A;  1PH8 A;  3IKJ A;  1BBW A;  3GD7 A;  2N3S A;  5CV9 A;  1JWS D;  2HD3 A;  2K28 A;  2A19 A;  2PW7 A;  4LFA Q;  4RGN A;  4GOP A;  5FJ8 G;  4LF6 L;  3M9B A;  5IT9 E;  4FF3 A;  1R4P B;  1B9M A;  4OL7 A;  2VQE Q;  2NVQ B;  4DR7 L;  3OMC A;  3EN2 A;  4JI8 Q;  1F9S A;  2ZTC A;  1G91 A;  4C1N I;  2L9H A;  1CUK A;  4IOC A;  2IX1 A;  1J5E L;  4CBV A;  1CK1 A;  5BN3 A;  2IT1 A;  4DKA C;  5I4D A;  1LAC A;  1A6X A;  1XPU A;  1X3P A;  1IHZ A;  4C2M H;  5FK9 C;  3S1R B;  3K5N A;  4LF9 L;  2FHT A;  3VR5 A;  4A3C H;  3F2B A;  3NK9 A;  2VW9 A;  2EZV A;  2QEX A;  1HZ9 A;  2LKV A;  3U4V A;  3J7A 5;  3S1M H;  3H3V H;  3PUY A;  4HID A;  3G6E A;  4HSV A;  3VYU A;  4MHE A;  2YU9 H;  2K5Q A;  5IYD G;  1AE2 A;  1AN8 A;  2MHV A;  5CV4 A;  1M1K C;  2A6E D;  3G4S A;  2K5D A;  3K8A A;  4DUY Q;  3DHQ A;  4DR6 L;  4B08 A;  1I3Q H;  4WOR A;  4ULL A;  1EY7 A;  3T1H Q;  1ZYR C;  4JI7 L;  5C0X H;  3V96 A;  5C0X J;  4A3B B;  1W2B A;  4JI2 Q;  1Q81 C;  1Q8K A;  2N88 A;  1JB7 A;  5I9P A;  3M4O H;  2UXC L;  4PMB A;  4OX9 L;  3AFP A;  2ASB A;  5C3W A;  4KJN A;  1JJG A;  1SMY C;  5A35 A;  2UUA Q;  3NUC A;  3SDZ A;  4A3J G;  3NBI A;  1KL9 A;  5IP9 H;  1LLR D;  1XPR A;  3WOE A;  4GOP C;  3RUZ A;  3I55 A;  4F87 A;  2PO4 A;  4DK6 C;  1XMO Q;  4JPB W;  4PNY A;  3I4N G;  3SVM A;  4FF1 A;  3ULJ A;  1S72 A;  1VQ6 A;  1VQB A;  4GNX B;  3TRZ A;  5T1G A;  1W6J A;  4OXP A;  2Z4H A;  3TS0 A;  3GV3 A;  5HGT A;  2K03 A;  3D4R A;  2AUJ D;  1RIP A;  5EBD A;  1YZ6 A;  1UE5 A;  3MZ5 A;  3M3Y H;  2ZT9 C;  4CDC C;  1PZJ D;  3Q0A A;  1YVC A;  1CT1 D;  3RZD H;  3R2I A;  1TS3 A;  4DUZ Q;  1FR3 A;  3GQB A;  4C3H H;  1CZW A;  1WI5 A;  3MXN B;  3MXN A;  4LUO A;  3T1Y L;  1TXY A;  4DV4 L;  2QW7 A;  1V1P B;  2EXZ A;  2EE1 A;  4XQQ A;  1CHP D;  4JV5 L;  2IPK D;  1VMP A;  4AYB E;  4MTN A;  3FPU B;  3JC6 6;  4A3K H;  1F9P A;  4IFD H;  2B39 A;  3MEF A;  2JA7 H;  5EQ0 A;  4IPC A;  2KEC A;  4C56 C;  4FYD A;  4QY7 A;  2EPB A;  1PH9 A;  2WB1 G;  4YHH L;  1PH2 A;  1LO5 D;  4DR1 Q;  5C4J B;  4A75 A;  3CC4 A;  3GTL H;  4H13 C;  4JI8 L;  1LM0 A;  1ZKO A;  5AJ3 Q;  2JA6 H;  1GUN A;  1H9M A;  2ZM6 L;  2MUY A;  2NYZ D;  4BXX G;  4JI5 Q;  1VQJ A;  1KHI A;  1LTA D;  1Q86 C;  4J6H A;  2ICE C;  2I46 A;  3K7U C;  4L8J A;  1MBY A;  5IYC H;  1HZB A;  3L2P A;  4FF4 A;  3QR8 A;  2Q8I B;  3CKI B;  5I6W A;  3S1Q H;  2NTT A;  4CJ2 C;  2KEN A;  4K6L A;  5L37 A;  3T51 B;  1LTG D;  4X3S A;  1U0L A;  2O2L D;  4JC0 A;  1VS0 A;  4IQZ A;  1TWC B;  1NJI C;  2CFM A;  4H44 C;  2HIX A;  2TSS A;  1KD1 C;  2KED A;  3KFU A;  1CKM A;  4A3D H;  1FJG L;  1KNE A;  5FLX c;  1QZH A;  2A74 C;  4NKL A;  1Y1W H;  1MHW C;  1PYS B;  2JP1 A;  2LXJ A;  1IKM A;  3T1H L;  3RZD B;  1S3O A;  5C44 G;  3KK7 A;  1B50 A;  4IPD A;  3J81 c;  3D6C A;  2WB1 E;  4GKK L;  1QB5 D;  1SND A;  3B6Y A;  3ULL A;  2JE6 I;  4LNQ A;  1M8A A;  4LFB L;  1PTO B;  2HQL A;  3OOC A;  4I7A A;  5DM7 3;  1VQN A;  3HEJ A;  2VB3 X;  1KRT A;  4BA1 I;  1JE4 A;  2DJF C;  4B3T L;  1STE A;  5LL6 S;  2F4V Q;  3NTI A;  1TQO A;  4ZQ3 A;  2XSC A;  3J7Z C;  4KD4 A;  1EEI D;  3EA6 A;  3DUZ A;  5EAY A;  2F4I A;  1OXU A;  3H0G B;  1B4O A;  4UHV A;  2PZW A;  1HHV A;  4JOI C;  1C4Q A;  2CHB D;  1A3T A;  1EY4 A;  1SAP A;  1YHQ A;  4LF5 Q;  2K5H A;  4R4O A;  2B2Y A;  3FHW A;  4DAP A;  1KLG D;  1QVC A;  4LF8 Q;  2Z9H A;  2EYH A;  5ELN A;  4B3S L;  1Y1V H;  2IWH A;  4N8F A;  2R93 B;  1WOC A;  3HOZ G;  1DON A;  5IWA L;  4GOP B;  2GN5 A;  1TWA H;  4IUV A;  4V19 0;  4QL5 A;  1OXV A;  1A15 A;  4A93 G;  1LT6 D;  1QWY A;  2F0I A;  2JEA I;  2YTV A;  2HIV A;  4YY3 Q;  1YBY A;  4DR1 L;  3E9H A;  3TP5 A;  5A2Q E;  2VXW A;  5KNC A;  2JA8 G;  1PV4 A;  1C8C A;  3HOX H;  2EJF C;  1J5E Q;  4DV7 L;  3L3O C;  4BY7 B;  4WRD A;  1PTO H;  4A93 H;  4JBW A;  3PIO 3;  4CDF C;  3S1N H;  1J6Q A;  2BH2 A;  3HS0 C;  2OF1 A;  1O7Z A;  2SOB A;  4ZKB B;  4BBR H;  4KTA A;  3M85 A;  3L9A X;  1GKH A;  1X6O A;  4BXX H;  2EY6 A;  2R7D A;  2Y0S E;  3PO2 H;  1M4V A;  4UP8 A;  1VQH A;  4NXN Q;  4QIW E;  3CCU A;  4DU9 A;  5D14 A;  1F9R A;  4A3F B;  3CCQ A;  1EY8 A;  4QB4 A;  3MA2 B;  2KOL A;  1HQR D;  3PCO B;  4PQX A;  2VUM G;  2R93 H;  5D3D A;  4DR3 L;  4A3J H;  1I4X A;  3R2T A;  1TY0 A;  5IGC A;  2R6G A;  3QO2 A;  5EJW A;  3TBI B;  1Z6H A;  2H4O A;  2NN6 I;  2IX3 A;  3CF5 A;  2F0K A;  5GAE C;  2K4K A;  3H0G H;  2E2J H;  3JAM E;  1PDQ A;  5JJL A;  1KDB A;  3TSS A;  1MGS A;  3S1Q B;  1LUZ A;  2ALY B;  3ERS X;  4JI5 L;  4XTC S;  2WIN B;  2WP8 J;  2MP1 A;  5I2X A;  1FGB D;  2RKS A;  5CGK A;  1KLU D;  2V4D A;  3K5M A;  2CQO A;  3F2U A;  3FKI G;  2KBN A;  3FEW X;  1L0W A;  1EZ8 A;  2B8F A;  1OXS C;  3FMC A;  2Z1C A;  5JEA G;  4LF4 L;  3MTS A;  5KEE A;  1RF2 D; 
#chains in the Genus database with same CATH homology
 4OWT B;  3UE0 A;  4B3R Q;  4GKJ L;  3JAM i;  1XPO A;  3RZO H;  3NEL A;  3U4Z A;  4X65 Q;  2F4V L;  2RF4 A;  1C0A A;  3K80 C;  1D7Q A;  2QA4 A;  3H15 A;  1UE6 A;  4DV0 L;  3BU2 A;  1XJV A;  4HIM A;  4AQY L;  3KOJ A;  1JMC A;  4AIM A;  1O7I A;  4LFC L;  2OTL A;  1HR0 L;  3S16 H;  4P75 A;  4KHP L;  1EIF A;  4DV3 Q;  2JQO A;  3M4P A;  4PZ6 A;  3CCL A;  1SR3 A;  3STB C;  1K0R A;  2EXD A;  3E0E A;  1YHB A;  3U58 A;  1E3P A;  4R4C A;  2KCT A;  2NVQ H;  4KLK A;  4POF A;  2OCE A;  3I4M H;  1HZC A;  1ASZ A;  1YJN A;  4DR4 Q;  2VQE L;  5IY0 A;  5FJ8 H;  1Q12 A;  2MNA A;  3K0X A;  5IYB G;  4YWM A;  1N34 Q;  5ELO A;  1FL0 A;  2PI2 E;  3KDF A;  5C44 H;  5FLM H;  3S1R H;  1Y1V G;  4GNX A;  2K75 A;  3UDG A;  1OTC A;  1IXR A;  1EQR A;  3PUW A;  2QGQ A;  5IWA Q;  2VQF L;  4DR3 Q;  2L15 A;  2VUM H;  1C9O A;  1P16 A;  1Q46 A;  1N36 Q;  3GTQ H;  3HOV H;  4R4T A;  5K36 G;  2BA0 A;  3HOY H;  4QGU A;  4BA2 I;  2JK8 A;  1XNQ L;  4NB3 A;  1K9M C;  2Q2I A;  4PZ7 A;  4DR6 Q;  1N8R C;  3M7N A;  2EIF A;  5GRO A;  1EUJ A;  3KF6 A;  2JA5 H;  4O0A A;  4A3M G;  3K7A H;  1PH8 A;  1BBW A;  3GD7 A;  1TWG H;  4A3D G;  5AJ3 L;  2N3S A;  3H0G G;  3PO3 H;  4GN5 A;  3HOW H;  1N32 Q;  1I6H H;  2K5N A;  3SGI A;  2A19 A;  3PF4 A;  4IOA A;  2Z6K C;  4AQY Q;  5GAG C;  2K50 A;  2XTI A;  1HR0 Q;  4KHP Q;  4LFA Q;  1L1O A;  3PSI A;  1L1O B;  4YCW A;  1TWH H;  1PH4 A;  4GOP A;  3S15 H;  5FJ8 G;  4LF6 L;  4LF9 Q;  3M9B A;  1NTG A;  2UUB Q;  2B29 A;  4OWX B;  4HJ9 A;  3CQZ H;  4BY7 G;  1U5K A;  1BVS A;  4DR2 Q;  4LF4 Q;  4A3M H;  2VQE Q;  3ER0 A;  1NMG A;  4DR7 L;  3EN2 A;  4APV A;  1X65 A;  4BBS H;  4JI8 Q;  1QVF A;  3CW2 C;  2ZTC A;  3RLF A;  4DAY B;  4GNX C;  4A76 A;  1N34 L;  4JI6 Q;  3BJU A;  1CUK A;  2CWA A;  4GS3 A;  4IOC A;  1YJ9 A;  3S17 H;  2IX1 A;  1J5E L;  2B63 H;  4YCV A;  4JI3 L;  5C4X H;  2IT1 A;  4FDB A;  4DKA C;  1X9N A;  1EYG A;  4LFC Q;  3CCV A;  4OX9 Q;  1XPU A;  2MO0 A;  2GVB A;  4C2M H;  1YIT A;  1RL2 A;  3TEH B;  3A0J A;  1MKH A;  1VQP A;  3E9I A;  4BBS G;  2MQH A;  3J80 c;  1X55 A;  4LF9 L;  4GN4 B;  3CCJ A;  2UUB L;  3CC2 A;  1IBL Q;  1R9T H;  1UE7 A;  2NVY H;  4A3C H;  3F2B A;  1B70 B;  1K8A C;  2VW9 A;  1CKN B;  1VQE A;  2QEX A;  4A3F G;  1HZ9 A;  1K8G A;  2F3I A;  3U4V A;  1N33 Q;  3H3V H;  2YTY A;  4HJ7 A;  4ME3 A;  3PUV A;  3S1M H;  2OTJ A;  1MIU A;  2NZH A;  4NXM L;  1HJP A;  3PUY A;  4DV4 Q;  4HID A;  5IP7 H;  1EOV A;  3G6E A;  1T9H A;  1PH5 A;  1OXT A;  2KHJ A;  1YEZ A;  1VQA A;  1L1O C;  5FLM G;  1PH1 A;  4A3B G;  2YU9 H;  1TWC H;  3EIV A;  2JA5 G;  3AFQ A;  1CKO A;  2I5H A;  3I7F A;  5IYD G;  1AE2 A;  1M1K C;  1PVO A;  3NBH B;  4Y7N H;  4LFB Q;  3G4S A;  1YJW A;  2Q2H A;  2UUA L;  3FKI H;  4A3G H;  1EFW A;  3K8A A;  4DUY Q;  4A3I H;  2XGT A;  5M5W H;  3BZC A;  4KI0 A;  1VQ9 A;  4K0K L;  5BR8 L;  1I5F A;  4DR6 L;  1I3Q H;  2ZTE A;  2WAQ G;  2WFW A;  3T1H Q;  4JI7 L;  1A63 A;  4AYB G;  4NPS A;  3S14 H;  1GVP A;  1UWV A;  1V9P A;  4YHH Q;  2AWO A;  5C0X J;  4DV1 Q;  4LUV A;  1PHJ A;  5M3M G;  1IBM Q;  4OWW B;  1W2B A;  1PA6 A;  3F8T A;  3L0O A;  2RHS B;  4JI2 Q;  1VQO A;  1Q8K A;  1Q81 C;  1JB7 A;  3M4O H;  5C3E G;  2UXC L;  2D0P A;  2Q2U A;  4OX9 L;  4DR5 Q;  3AFP A;  5J3B A;  3OTO Q;  2NVX H;  1VQF A;  2UU9 Q;  2D0O A;  2ASB A;  3J7A 5;  2N78 A;  3L7Z C;  4J15 A;  1FGU A;  1HR0 W;  1JJG A;  5LMN W;  4MNO A;  3STB D;  2UUA Q;  4A3J G;  4ALP A;  1KL9 A;  4A4I A;  5IP9 H;  1XMQ Q;  4P72 A;  4JYA Q;  3TRE A;  1XPR A;  5C4X G;  4LF5 L;  1IYJ B;  3TS2 A;  4GOP C;  1KIX A;  4A3B H;  4DR7 Q;  3I55 A;  1CSP A;  5GAD C;  4DK6 C;  1XMO Q;  1KAW A;  4BY1 H;  3I4N G;  4JCV E;  4GKJ Q;  2A1A A;  3ULJ A;  4IO9 A;  1S72 A;  1VQ7 A;  4NXM Q;  1VQ6 A;  1X3F A;  1AE3 A;  3A5Z B;  4TQU S;  1VQB A;  3ZJY C;  4GNX B;  3TRZ A;  2VS1 A;  2JA9 A;  5C3E H;  4AH6 A;  3F2C A;  4OO1 I;  4OXP A;  5LMN Q;  3TS0 A;  4A3L G;  2K5V A;  1K83 H;  1Q1B A;  2DGY A;  1QZG A;  1RIP A;  3IRB A;  2VNU D;  1YZ6 A;  4DAM A;  1N9W A;  3G71 A;  1UE5 A;  1JT8 A;  3M3Y H;  1Q82 C;  3NEN A;  5BR8 Q;  4DV5 Q;  1K73 C;  1BKB A;  3J81 i;  1YVC A;  3RZD H;  1KC8 C;  2IY5 B;  3D31 A;  4DUZ Q;  2R92 H;  1A0I A;  1VQC A;  4C3H H;  1P8L A;  2RCN A;  1WI5 A;  3MXN B;  4X62 L;  4LUO A;  3T1Y L;  1HNZ Q;  1OXX K;  1TXY A;  2UXB Q;  5JEA J;  4DV4 L;  4A3E G;  1S40 A;  1KXL A;  4X64 L;  1SRU A;  3PV0 A;  4IFD J;  3UDF A;  4DV0 Q;  3PIP A;  4JV5 L;  2UXC Q;  3I2Z A;  1Z9F A;  3HFZ B;  3EBE A;  2YV5 A;  4AYB E;  1WYD A;  2AMC B;  3JC6 6;  4MTN A;  4JI1 Q;  4A3K H;  1VQK A;  1YI2 A;  2CKZ B;  4X6A H;  1JJC B;  2ZTD A;  3GO5 A;  3DM3 A;  3MEF A;  4P73 A;  5IE8 A;  4GLX A;  3OW2 A;  2E8G A;  4HIO A;  1PH6 A;  1N36 L;  2VL6 A;  4IPC A;  1EIY B;  2JA7 H;  1UE1 A;  4JI0 L;  4A3I G;  1XNR L;  4QY7 A;  3KJO A;  3KJP A;  4A3E H;  1PH9 A;  2WB1 G;  2LXK A;  3RLN A;  3H3V I;  3J81 j;  1QUQ A;  4UY8 C;  2HHH Q;  2ZJR A;  4YHH L;  1PH2 A;  4JBJ A;  3HOU H;  4DR1 Q;  1XMO L;  4B3T Q;  4YCU A;  3I4O A;  2NZO A;  4A75 A;  3CC4 A;  2AKW B;  3GTL H;  4JI8 L;  1G29 1;  2I5M X;  2UXB L;  1LM0 A;  4RMF A;  5AJ3 Q;  2JA6 H;  4HJ5 A;  1E22 A;  1HNW L;  4JBM A;  3PGZ A;  1X3E A;  2ZM6 L;  4BXX G;  3HOX G;  1DGS A;  4JI5 Q;  3CCE A;  2H5X A;  3GTJ H;  1PFS A;  1VQJ A;  4DR5 L;  1KHI A;  3AYH B;  3OTO L;  1Q86 C;  3RN5 A;  3WWV A;  4HIK A;  3K7U C;  5M3F H;  4WJ3 M;  1G6P A;  4LF6 Q;  5IYC H;  1HZB A;  3L2P A;  3UE1 A;  1YNX A;  1MJE A;  3CPW A;  3ICE A;  4R1J A;  1GD7 A;  4DV2 Q;  1X3G A;  3GTM H;  4JOI A;  3S1Q H;  1EWI A;  4JI4 Q;  1PH3 A;  2ATW A;  3A5U A;  2UUC Q;  2KEN A;  1IBK Q;  3S2H H;  3HOZ H;  1U0L A;  1G51 A;  1HNZ L;  4JC0 A;  1VS0 A;  3W1B A;  4DNI A;  4BY1 G;  3I4N H;  1GO3 E;  3RNU A;  1NJI C;  1E1T A;  3DLL A;  4OON A;  1SFO H;  2CFM A;  3HOW G;  4X64 Q;  2HT1 A;  3PO3 G;  1E7Z A;  3W5O A;  3HKZ E;  1BBU A;  2HIX A;  5M3F G;  1KD1 C;  2NVT H;  3KFU A;  1CKM A;  4IJL A;  4A3D H;  2MFI A;  1QVG A;  1FJG L;  1B8A A;  5FLX c;  3W1G A;  2B3G A;  3UDI A;  4C3J H;  5C0X I;  3Q8D A;  1Z47 A;  1QZH A;  1XNR Q;  4A3L H;  2JA6 G;  4O2D A;  1Y1W H;  4GN3 B;  1KQS A;  4DPG A;  1PYS B;  2LXJ A;  4GLV B;  3T1H L;  3KDF B;  1VQ8 A;  3CXC A;  5M5X H;  1S3O A;  5C44 G;  4B3R L;  1VQM A;  1CKN A;  2OQK A;  4LF8 L;  4IPD A;  1D8L A;  2NN6 G;  4XIG S;  1WCM G;  1W3S A;  3J81 c;  1HNW Q;  4JV5 Q;  2ZM6 Q;  2WB1 E;  4GKK L;  4QQB X;  2OQ0 A;  4IJH A;  4DV7 Q;  3B6Y A;  3CC7 A;  4B3S Q;  2E2H H;  3ULL A;  3I4M G;  3UDX A;  2JE6 I;  3S24 A;  5H1S E;  4LNQ A;  3HOY G;  3M4Q A;  1HH2 P;  2PMZ E;  3HOV G;  4L5S A;  3PO2 G;  4LFB L;  4R4Q A;  4DV3 L;  5GAH C;  2Q2T A;  4K0K Q;  2HQL A;  3J80 i;  2IHE A;  1VQN A;  2KHI A;  3LGJ A;  4DV6 Q;  1VQG A;  1ASY A;  1E24 A;  1KRT A;  3VDY A;  2K14 A;  1JE5 A;  4BA1 I;  4IFD G;  1IBK L;  4B3T L;  3CMA A;  3RLO A;  1XTD A;  4YWK A;  2E2I H;  1NY4 A;  4MZ9 A;  4X65 L;  2F4V Q;  4HJA A;  5GQO A;  2K52 A;  3J7Z C;  2N49 A;  1WJJ A;  4JI2 L;  2UXD Q;  2CCZ A;  5LMN L;  1V1Q A;  2Y0S G;  2YTX A;  5EAY A;  2BH8 A;  4EX5 A;  2KCM A;  1OXU A;  1FJG Q;  3CP0 A;  4PMW A;  4JOI C;  3F1Z A;  1SMX A;  1SRO A;  1VQ5 A;  2V1C C;  3S2D H;  5IYC G;  5C4J H;  1QUQ B;  1YHQ A;  3K81 C;  4DV5 L;  4LF5 Q;  1SE8 A;  2K5H A;  3OYY A;  3CCR A;  4JYA L;  4LUZ A;  1Y14 B;  3CPF A;  3HKZ G;  4L5T A;  3A74 A;  4R4O A;  1PH7 A;  1NBW A;  2BA1 A;  2IX0 A;  3KF6 B;  1X56 A;  3U50 C;  4YY3 L;  3FHW A;  3I56 A;  4EQ5 A;  3ULP A;  2VY3 A;  1SLJ A;  5LMU L;  2E5L L;  1UEB A;  4KHZ A;  3FP9 A;  1QVC A;  5M3M H;  4LF8 Q;  4JI6 L;  5HGQ A;  4L5Q A;  4B3M Q;  1B7Y B;  3CCS A;  1K3R A;  2WAQ E;  2LSS A;  5IT9 c;  5C0X G;  4GKK Q;  4IFD I;  4UP7 A;  5ELN A;  3CCM A;  1Y1V H;  4B3S L;  2UXD L;  4GLA C;  5JJI A;  4LFA L;  1WOC A;  2F52 A;  2N8N A;  5IWA L;  2VQF Q;  3HOZ G;  4JI1 L;  4GOP B;  2GN5 A;  3RN2 A;  3KYH C;  3CD6 A;  1Q1E A;  3NEM A;  4A3F H;  1TWA H;  1EQQ A;  1V43 A;  1IL2 A;  3PIO A;  2CWP A;  1YHA A;  3KF8 B;  1OXV A;  4P74 A;  4QL5 A;  4A93 G;  1CSQ A;  1LYL A;  1Y1W G;  4LF7 L;  2JEA I;  2MO1 A;  4JG2 A;  4OO1 G;  4X62 Q;  2YTV A;  4DK3 C;  1GM5 A;  2R93 G;  2HIV A;  2PQA B;  2ES2 A;  3TQY A;  4YY3 Q;  1YBY A;  4NXN L;  4DR1 L;  3T1Y Q;  2D62 A;  3E9H A;  3PUZ A;  2GVA A;  4L5R C;  2OWO A;  5LMU Q;  1FVI A;  2JEB I;  1LTL A;  1MJC A;  3F2D A;  1PV4 A;  4UPA A;  2JA8 G;  3KLW A;  4X66 L;  3HOX H;  4BY7 H;  3CME A;  4JBK A;  2ID0 A;  1J5E Q;  4DV7 L;  2PNH A;  4Y52 H;  4HJ8 A;  4A93 H;  4A3C G;  3JAM c;  4JBW A;  4C3I H;  1Q7Y C;  3S1N H;  4UP9 A;  2RHQ B;  1J6Q A;  2BH2 A;  4H02 A;  1HNX Q;  1PYB A;  5JJL A;  4JI0 Q;  1VQL A;  4PG3 A;  4BBR H;  5IP7 G;  1JJ2 A;  4DV2 L;  4DV6 L;  1VQD A;  3M85 A;  1IBL L;  1GKH A;  1X6O A;  4BXX H;  5JJK A;  2R7D A;  2Y0S E;  3G48 A;  4YWL A;  4JI7 Q;  1VCI A;  3PO2 H;  2JJQ A;  4DR4 L;  4UP8 A;  2Z6K A;  1VQH A;  4PZ8 A;  2PQA A;  4NXN Q;  2JA8 H;  3HKS A;  4QIW E;  3CCU A;  1C7Y A;  2A8V A;  3D0F A;  3CAM A;  4IPH A;  4WJ4 A;  2I0Q A;  2VZA A;  5E7N A;  4JI3 Q;  1H95 A;  1KRS A;  2AHO B;  1HZA A;  3GTP H;  1L2F A;  1NMF A;  4R4I A;  3CCQ A;  3HOU G;  2VUM G;  3PCO B;  2Z0S A;  2FXQ A;  3BZK A;  5DLQ E;  2R93 H;  5IP9 G;  4DR3 L;  4A3J H;  1A62 A;  1TWF H;  1E1O A;  2B63 G;  4BBR G;  2R7Z G;  1HNX L;  3GTK H;  2R6G A;  1A8V A;  2YYZ A;  1NE3 A;  1XNQ Q;  2JA7 G;  4LW1 A;  2NN6 I;  4LWC A;  2IHF A;  3CF5 A;  1I94 L;  2HHH L;  4A3K G;  4JI4 L;  4IPG A;  2UUC L;  3AQQ A;  5GAE C;  1N33 L;  1VQI A;  4RG1 A;  2K4K A;  2ZJQ A;  2E5L Q;  4DV1 L;  1M90 C;  3H0G H;  1WFQ A;  3PF5 A;  2C35 B;  2E2J H;  1IBM L;  3GTO H;  2AWN A;  2PI2 A;  1X54 A;  2I5L X;  5M5Y H;  1YIJ A;  4B3M L;  3AEV A;  1LUZ A;  2ALY B;  3ERS X;  3GDE A;  4X66 Q;  5HY6 A;  4JI5 L;  1N32 L;  4P71 A;  4XTC S;  2EQS A;  2WP8 J;  3RR5 A;  2ZJP A;  1AH9 A;  1I50 H;  5IYB H;  4TVA B;  1IZ6 A;  2UU9 L;  4DUY L;  2R7Z H;  2CQO A;  2DUD A;  4POG A;  1XMQ L;  3FKI G;  4A3G G;  4QJF A;  2R92 G;  1WCM H;  2KBN A;  4LF7 Q;  3GTG H;  2R7F A;  1L0W A;  5IYD H;  3PUX A;  1OXS C;  5JEA G;  4DUZ L;  1I94 Q;  1SN8 A;  4DR2 L;  4LF4 L;  1VQ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...