4JI5L

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
124
structure length
123
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 13
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ji5L00
4LF5Q 3A5ZB 3KJPA 2ZM6L 1L2FA 3I55A 2JEAI 3PF4A 4Y7NH 3CCQA 1I94Q 5M3FG 2Q2IA 5C44G 2IT1A 4JI8L 5IYCG 1E24A 1UE5A 4MZ9A 3S16H 1KAWA 4GLAC 4BY7H 1EOVA 2AMCB 3H0GG 4IJLA 3AQQA 3E9HA 3CC2A 2JA6G 4LF5L 3BU2A 1EQRA 2RCNA 3EIVA 3PUWA 2Y0SE 1A8VA 4TVAB 2N49A 4PZ8A 4DV2L 1YJNA 3F2BA 1HNWL 1V43A 4A3FG 1HJPA 2KENA 3I56A 2IY5B 1I94L 3W1BA 4YY3Q 4A3LH 3KF6B 3MXNB 4JI2L 4DV4L 2UXBQ 1CKNB 2CKZB 3OYYA 4X65L 2HIVA 3D0FA 4BBRH 4LF9Q 5IP7H 5C0XI 4LFCQ 4GN5A 1P8LA 4R4QA 4A3FH 1YJ9A 3CMEA 1Q1BA 2UXCL 3HOWG 3PUZA 2I5MX 1EIFA 4A3CH 2YYZA 4JYAL 4B3TQ 4JI6Q 3RLFA 3ULLA 3HOXH 4GNXC 4JI7Q 2N78A 4LF8Q 1N34Q 4MNOA 1YBYA 4L5RC 2WP8J 5H1SE 1YITA 3TRZA 2R7ZH 4LUOA 4JI2Q 2NZOA 4R4OA 2DGYA 3TS0A 1VQCA 1JJCB 1G51A 1Q12A 4GLXA 3M7NA 4JYAQ 3GTLH 3TEHB 1X56A 3PCOB 1OTCA 1QUQB 2VUMG 1VQHA 3TQYA 1V9PA 3ZJYC 3F8TA 4L5TA 1BVSA 4RG1A 3CCMA 4KI0A 2ES2A 2PI2E 2GVAA 4GN3B 4LWCA 2OTJA 1X65A 3S1MH 5M3MG 1TWHH 4A3IH 2A1AA 3NBHB 4B3SL 4UP9A 4DV2Q 4LF4Q 4YHHQ 4BXXH 2VS1A 1PH1A 2HQLA 2QEXA 4DR3L 1K73C 4DR5L 5IP7G 1Q7YC 4QJFA 4KHPL 4A3GG 1YHBA 2Z0SA 1XJVA 3CCUA 1HNZL 1I3QH 3CQZH 3CC4A 1VQDA 1EYGA 1P16A 4KHZA 5FLXc 1VCIA 2CFMA 2Y0SG 4LF4L 2ZM6Q 3I4OA 1YIJA 1NY4A 4OONA 2CWAA 4JI0L 3OTOQ 1FGUA 1MJCA 1X54A 4B3SQ 4JBKA 1RIPA 3RR5A 5JJLA 5AJ3L 1K0RA 1L1OC 2CQOA 4PZ7A 4X62Q 3STBD 4B3RQ 4X66L 1SFOH 2IX1A 4OXPA 3CCRA 4DV7L 1EWIA 3SGIA 4DR1Q 4GOPC 1XMQQ 4IPDA 1IBML 1ASYA 2JA7G 5EAYA 4A3GH 2OQKA 3ER0A 1YI2A 4A3BH 4GNXA 3RZDH 3CD6A 2K52A 1YHAA 3HKZG 1HZAA 3KYHC 5IP9H 5C3EH 1VQAA 5LMUQ 1Q81C 1VQ5A 4A3CG 3M9BA 5M5YH 5C4XH 3HOUG 3A0JA 1C9OA 1HZCA 1E22A 3JAMi 4OX9Q 4BBRG 1VQOA 3GDEA 1WCMH 2D0PA 1HNWQ 3ULPA 2PQAA 3H3VI 3G71A 5IWAL 4DV0Q 2MFIA 1UE6A 2JA9A 2ZJQA 1HZ9A 1XMOL 3A5UA 2VQFL 3PUVA 4NB3A 2Q2HA 4RMFA 4C3JH 1NMGA 4AQYL 1MJEA 4L5QA 3CXCA 1IYJB 5FJ8H 1KL9A 4NXML 1EFWA 4JG2A 2AKWB 5M3FH 3KOJA 4GKJL 1XPRA 4PMWA 5M5XH 4DR2Q 3K7UC 4XTCS 1EQQA 4A76A 4A3JG 1J6QA 2K4KA 1NJIC 4LNQA 1VQNA 2KCTA 3OTOL 4A3MH 3PIOA 3J81c 1SN8A 2Q2UA 1VQFA 1MIUA 2ZTDA 2R92H 3J81j 4AQYQ 5LMNL 2OCEA 1PV4A 2NN6G 3ERSX 2RHQB 3CW2C 4GN4B 1XNQL 1AE3A 1PYBA 3CAMA 4OWXB 1HR0L 4JI5L 4A3LG 3PF5A 4JI1L 1VQ4A 4DV5L 1FJGL 4DR7L 2BA0A 2KCMA 4LFCL 1PH4A 1N33L 1NTGA 5IT9c 5IYBG 1PH8A 2A8VA 4YHHL 4ME3A 4HIMA 3BJUA 1TWFH 3OW2A 1QVFA 4K0KL 1E1TA 3HOZH 3CCVA 2K5HA 1CKNA 3KDFA 3RZOH 5GAHC 2WAQE 3S2HH 4BA2I 1GM5A 4JV5Q 3CC7A 3CP0A 1QVCA 3J81i 1M90C 1HR0Q 4A3KG 2HHHQ 3AFQA 3CCLA 3I4NG 3K81C 5C44H 4DV3Q 1PHJA 2JEBI 4OO1G 1SMXA 1UEBA 1L1OA 3NELA 3WWVA 4A75A 2FXQA 3F2DA 1PYSB 4HJ7A 4AYBE 1LM0A 4DV1Q 3S17H 1VQEA 2D0OA 1V1QA 5JEAJ 1OXVA 2JA8G 1VQLA 1GVPA 3KFUA 2HIXA 4X62L 1HH2P 2WAQG 3CCJA 1SROA 4DK3C 1VQKA 4Y52H 3PO2G 2PNHA 4DKAC 2V1CC 3PV0A 1J5EQ 3LGJA 3M4QA 4H02A 4DAYB 3M85A 1PH2A 3S2DH 4IFDJ 1VQGA 3I4MH 2PMZE 3A74A 5HY6A 4X64Q 2VUMH 1U0LA 4UPAA 3J7A5 3GTOH 4HJ8A 5LMUL 4JI8Q 2ZTEA 4L5SA 1HNZQ 3S15H 1PH7A 1OXTA 1T9HA 4BY1G 1S72A 4DR6L 3K7AH 4YWLA 1YEZA 4EQ5A 2BH8A 1QVGA 3DM3A 3JC66 3FKIH 3RLNA 4GNXB 1TXYA 2OQ0A 4P74A 3K80C 1KRTA 2YU9H 1UE7A 1FVIA 3I2ZA 3HOXG 1X55A 1X3GA 2WFWA 2R7FA 4C3IH 1NE3A 1XTDA 2LXJA 2UUAQ 4JI0Q 1XNRL 3PO3G 3F1ZA 2F52A 4YWMA 2E2JH 2K5VA 4DAMA 2JE6I 1CSPA 4YCVA 4X65Q 4YCUA 4PG3A 1X3FA 2D62A 4A3EG 2NVQH 5DLQE 5HGQA 3UDGA 1B7YB 1KD1C 4DV4Q 4JI4Q 1X9NA 1YNXA 4POGA 2KHJA 3U4VA 1HR0W 1QZHA 3BZKA 1N36L 1SRUA 2UXCQ 1Z9FA 2K75A 5GADC 1SLJA 3VDYA 1A0IA 2QGQA 1KIXA 1Q46A 1Y14B 2ID0A 2R93H 1HNXQ 1GO3E 1AH9A 3GTQH 4A4IA 3E0EA 3GTJH 4A93H 2YTYA 3CPFA 4P75A 5C0XJ 4KLKA 3PIPA 1S40A 2KHIA 2JA6H 3GTKH 4OWWB 4DR4Q 3K8AA 1OXXK 1H95A 1EUJA 3U50C 4JI7L 1VQPA 3GO5A 1XNQQ 1X3EA 2K50A 1RL2A 3FKIG 2JA5H 3GTMH 4HIKA 3HOYH 2VQFQ 1XPUA 2CCZA 2DUDA 1CKOA 3UE0A 2F3IA 4QIWE 5E7NA 4LF7L 2UXDQ 3FHWA 4J15A 5C0XG 4OO1I 1SR3A 4BBSG 2IHEA 1IBLQ 4IOAA 3ULJA 2L15A 4JV5L 2OWOA 1PA6A 1AE2A 3GTPH 4EX5A 2Z6KC 4OWTB 2B63G 3U58A 4XIGS 2R93G 3NENA 1WOCA 1R9TH 2UU9L 2I5LX 1O7IA 1IL2A 3KJOA 4MTNA 2B63H 1JT8A 3J80i 4A3EH 1IBMQ 4JC0A 3K0XA 2ZJRA 2UUCQ 2WB1E 1Z47A 4YCWA 2ZTCA 1Y1WH 4JI3Q 3GTGH 5IP9G 3HOVG 1IXRA 1Y1VG 2GN5A 1PVOA 1KRSA 1YZ6A 2K14A 4HJ5A 2NVYH 1M1KC 4DR3Q 2Q2TA 1Q1EA 1WI5A 2R6GA 2R7ZG 4A3BG 1C0AA 4QQBX 5IWAQ 4R1JA 3PO2H 1K8AC 1WCMG 1U5KA 4C3HH 2E5LQ 4B3ML 4O2DA 1N32L 5IE8A 1N36Q 1W2BA 4GKKL 4BA1I 4TQUS 1Y1VH 3UDXA 4IJHA 3RNUA 1MKHA 1LUZA 1KC8C 5LMNW 4IO9A 1W3SA 5IYBH 2LSSA 1JJGA 4NXNL 3M4OH 1B70B 4DV7Q 3F2CA 3EBEA 3UDFA 3STBC 3HOVH 1LTLA 1XMQL 5ELNA 4X66Q 4UP8A 4GKKQ 4LFBL 2PI2A 3Q8DA 4IPHA 4X6AH 5K36G 4DR2L 3KLWA 3FP9A 4B3MQ 1N32Q 1HZBA 4JCVE 5JEAG 4GKJQ 5IYDH 4DV1L 2C35B 4R4TA 5IYDG 3L2PA 4LFAQ 3HKSA 2VQEQ 3IRBA 4LF8L 1TWGH 4BBSH 1BBWA 4OX9L 1N34L 4P71A 2K5NA 2IHFA 2LXKA 4LFBQ 3UE1A 4IFDG 3MEFA 1K9MC 4JI5Q 2NN6I 2YV5A 3RN5A 5FJ8G 1XMOQ 2RF4A 5FLMH 1Q82C 4DUZQ 1Q86C 1NBWA 4BXXG 1YJWA 2YTVA 1PH5A 2ATWA 3PGZA 2B29A 2MNAA 2VZAA 3AFPA 1K83H 3W5OA 5FLMG 2NVXH 2GVBA 1KHIA 4POFA 1E3PA 1I50H 1YHQA 1CSQA 1BBUA 5IY0A 4ALPA 2Z6KA 4DUZL 1KQSA 4LF7Q 4R4CA 3RLOA 2I0QA 2UXDL 1G291 3D31A 4JBWA 4DV3L 5BR8L 2UUAL 1GKHA 5C3EG 3T1YQ 2BA1A 1TWCH 5GAGC 4DR5Q 4KHPQ 4IPGA 2NZHA 1VQ9A 3JAMc 3I4NH 3G48A 4DPGA 4O0AA 2ASBA 4LW1A 2HT1A 4JOIC 5M5WH 1N33Q 1D8LA 1UWVA 2H5XA 3HOUH 4DV5Q 1FJGQ 5C4XG 2AWNA 4FDBA 3J7ZC 2UUCL 3T1YL 5BR8Q 3S1QH 4WJ4A 4HJ9A 1ASZA 2CWPA 4X64L 1OXUA 2VW9A 4DR4L 3CF5A 1VQ6A 3CCEA 1PH3A 4NPSA 4C2MH 2EQSA 2XGTA 4GS3A 4R4IA 3HOYG 1Q8KA 1SE8A 4PZ6A 2MQHA 2UXBL 4A3DG 3PUYA 4YY3L 2HHHL 5IYCH 3J80c 1VQBA 4B3RL 4DUYQ 4IOCA 2R92G 3S1NH 1JMCA 2VL6A 4DK6C 2N3SA 5GQOA 2E5LL 1IBLL 3U4ZA 2JK8A 1A63A 2A19A 1K8GA 1I6HH 4GLVB 2NVTH 2IX0A 4BY7G 2VNUD 2E2HH 2JJQA 1E1OA 4B3TL 3KDFB 5GAEC 4JI6L 1IBKQ 1L0WA 2F4VQ 3EN2A 2B3GA 4AIMA 4JI4L 3ICEA 2R7DA 1VQIA 1WFQA 3B6YA 2JQOA 1G6PA 1I5FA 4QGUA 3PO3H 4P72A 2VY3A 3G6EA 4QL5A 2VQEL 4LFAL 3S14H 2EXDA 2MO1A 1BKBA 3GD7A 2QA4A 4DR6Q 1N8RC 2PQAB 4P73A 4UY8C 4GOPB 3CCSA 2MO0A 1UE1A 1KXLA 5AJ3Q 3PSIA 2F4VL 2AWOA 3G4SA 1IBKL 4WJ3M 4A3DH 2JA5G 4HJAA 2EIFA 1S3OA 4QY7A 4NXMQ 2RHSB 4HIOA 2AHOB 2YTXA 2XTIA 3AYHB 2ZJPA 4LF6Q 5ELOA 3HKZE 1JE5A 1QUQA 3PUXA 1VQ7A 5C4JH 1WJJA 2E2IH 1C7YA 3H15A 4A3MG 1WYDA 3T1HL 3I7FA 2OTLA 3I4MG 1CUKA 1VS0A 3NEMA 2KBNA 1JJ2A 5M3MH 3RN2A 4A3IG 4DV6Q 1VQ8A 1D7QA 1HNXL 4LF6L 3S1RH 1A62A 4LUVA 4AH6A 3TS2A 3M4PA 4JI1Q 4DR7Q 4AYBG 3W1GA 3AEVA 4JI3L 3HOWH 3T1HQ 5GROA 1K3RA 1NMFA 2WB1G 4UP7A 4A3JH 1Y1WG 1EIYB 4IFDI 1IZ6A 5J3BA 1PH6A 5JJIA 2UUBQ 1VQJA 3TREA 2BH2A 1PFSA 2JA7H 4K0KQ 3HFZB 3L0OA 1CKMA 2N8NA 4DV6L 4DR1L 3S24A 3E9IA 3L7ZC 3DLLA 1XNRQ 3H3VH 1GD7A 1X6OA 1E7ZA 4BY1H 3HOZG 2I5HA 1N9WA 4LUZA 1JB7A 1PH9A 4YWKA 3UDIA 4IPCA 1LYLA 4JBJA 5LMNQ 1VQMA 4NXNQ 4APVA 4LF9L 3H0GH 2UUBL 2ALYB 1L1OB 4JOIA 4HIDA 2UU9Q 1B8AA 1QZGA 4DNIA 3CPWA 3KF8B 1XPOA 3KF6A 4A3KH 1TWAH 1OXSC 3M3YH 4DUYL 1YVCA 4JBMA 3CMAA 1FL0A 2JA8H 4DV0L 3BZCA 1J5EL 1DGSA 4GOPA 4A93G 2E8GA 5JJKA
chains in the Genus database with same CATH superfamily
3A5ZB 3KJPA 1HRJA 3PF4A 1UNSA 3CCQA 1E0BA 3V2TA 1EY4A 4JI8L 5IYCG 1UE5A 3DWQA 1KABA 1LTRD 2AMCB 4IJLA 2G9HD 3NSWA 4LF5L 5EPLA 3PUWA 2RCNA 4LK1C 3A8KE 1YJNA 2X69A 2R92B 1HNWL 2L5TA 3E6ZX 4IN3A 1QE6A 4JI2L 4DV4L 3N6RA 5KNBA 3OYYA 3K5NA 4RGOS 1EY0A 1PZID 1STNA 5IODA 2MP1A 1PFBA 1P8LA 2P5ZX 2KHSA 1YJ9A 1Q1BA 2IJ0A 2I5MX 4RCNA 1M8AA 5FO9B 3RLFA 3HOXH 4GNXC 2WIIB 1EWCA 4MNOA 3U9SA 5M3MB 4S3SA 5CGKA 1YITA 5CR3A 2ZXPA 2R7ZB 4R4OA 2DGYA 3I73A 2K28A 1JJCB 1G51A 5J1ZA 3M7NA 1F2ZA 3TEHB 1X56A 3PCOB 1OTCA 2RQXA 3P1HA 3H3VC 4G7ZC 1EY6A 1BVSA 4RG1A 3HZXA 4DAPA 1PRTC 4B9WA 1MSGA 2D5DA 4A3IB 1WTWA 3VYUA 1SNOA 1STYA 1TWHH 1QWYA 2A1AA 2XVSA 4K5XA 2QF7A 3T53B 4YHHQ 2WACA 1SYCA 4KHPL 5IP7G 3NUCA 4A3GG 2CQAA 1YHBA 2Z0SA 3GTGB 3DEOA 1SNCA 2EYFA 2MUYA 1VQDA 5DNFA 1TR5A 4J1MA 2NTTA 2ICEC 1PTOD 1STAA 2FJ2A 4KN7C 1LT4D 4WORA 4KD4A 3T13A 3STBD 1VMCA 4DV7L 1XMQQ 5G3LF 4IPDA 5EAYA 2VXWA 3ER0A 4A3BH 3NP8A 4GNXA 3CD6A 5C3EB 5IP9H 3KYHC 3HOVH 1VQAA 2D2CC 2FMMA 2QDLA 3JAMi 1HZCA 1RF2D 5ELCA 2Y0SB 2CH4W 3ULPA 3H3VI 5IWAL 1RJTA 2KCCA 1CT1D 2ZJQA 1XMOL 3LNNA 1AN8A 4WJWA 4PV1C 4ILWA 3JAML 4C3JH 1NMGA 3CXCA 1KL9A 4Y7NB 2Z1CA 4NXML 1PTOF 5I9PA 4V0BA 2B2VC 4PMWA 5M5XH 2EYOA 3BDLA 1K0SA 2O5IC 2F0QA 2RDGA 4LNQA 1VQNA 2KCTA 4A3MH 3NPPA 4AQYQ 1Q3LA 2OCEA 2RHQB 1QCBD 4OWXB 1HR0L 3D3RA 4A3LG 4DV5L 1FJGL 4DNTB 3FPUB 5CBEE 4JVZA 5IT9c 4YHHL 1II3A 2RDHA 2AUKA 3CCVA 4FF2A 2E76C 2K5HA 3RZOH 3S2HH 4G4KA 4BA2I 2K03A 1K8MA 4XT3B 1WTXA 3H09A 4MIUA 2F0JA 2PYKA 3HG9A 3P20A 4OO1G 1L1OA 1X32A 2FXQA 1PYSB 4AYBE 1HHVA 4QUFA 1V1QA 1OXVA 2NYZD 3MVVA 1SYBA 4X62L 1HH2P 1KNEA 1DOMA 4Y52H 3DHQA 1J5EQ 4ULLA 3M4QA 4DAYB 3OW7A 4IFDJ 1PTOH 4BS9A 3J7A5 3GTOH 2VUMB 5LMUL 1PH7A 1O80A 3KF8A 3A8JE 3BDCA 2RDFA 4YWLA 2PNRC 1Y8PB 2BH8A 5M5WB 4GNXB 1TXYA 1KRTA 2WAQB 1EZ8A 3RZOB 2SEBD 1O78A 3QG1A 3GQBA 5C5MA 3OWFA 3K7AB 4X65Q 1X3FA 2F4IA 1SAPA 5DLQE 2XWBB 1B7YB 5HGQA 4BBSB 3NBIA 4POGA 3CQZB 2EVBA 1N36L 2UXCQ 1Z9FA 5DEHA 5GADC 2QGQA 1Q46A 2ID0A 2R93H 4ZQ3A 3GTJH 3CPFA 2JA6H 1E2WA 4KLKA 3PIPA 2KQ3A 4OWWB 1OXXK 1H9MA 4JI7L 2SDFA 4KJOA 1EIHA 3GO5A 1YNNC 2K50A 1RL2A 1T5XD 4HIKA 2X6LA 2VQFQ 3T51B 3U9OA 1XPUA 1CKOA 3UE0A 5E7NA 4QIWE 5DM73 1SYFA 1TWGB 4N9PA 4IOAA 1MD2D 1PTOC 1CZGA 4C3HG 3U58A 1WOCA 2ZXOA 4EQOA 1GHKA 1OO9B 2I5LX 3K0YA 3C3LA 3EJIA 3TSSA 3KJOA 2B2WC 1X3PA 2LKVA 4JC0A 1IBMQ 4OHJA 4YCWA 3PIP3 3GTGH 3GTLB 1DZ1A 1PRTF 3EQLC 1Y1VG 2GN5A 4HJ5A 2Q2TA 1AEXA 1WI5A 1LV9A 1U5KA 1N32L 5IE8A 4GKKL 1TWHB 4BA1I 4TQUS 1Y1VH 3RNUA 1MKHA 1KC8C 2XRSD 4QIWB 3GP7A 1PLFA 1DJRD 5E3FA 4H0LC 4DV7Q 4K2KA 3EBEA 1HFGA 1SEBD 1LTLA 5ELNA 5EKIA 4X6AH 3NTKA 5K36G 1AZQA 3FP9A 4B3MQ 1HZBA 5JEAG 2C35B 5EBDA 2Q8IB 1RTNA 3HKSA 3L3OC 5NUCA 4LF8L 2MHVA 1BBWA 4OX9L 5JVH3 1N34L 4LFBQ 2CW0D 1X3QA 1S5CD 3MEFA 5T1GA 2YV5A 3AMUA 5FLMH 2KEDA 1XX8A 3RZDB 3OMCA 1I6HB 2ATWA 3AFPA 4X3TA 1LTTD 2A73B 3W5OA 4HN7A 2GVBA 5CV8A 3J80E 3WDNA 3P7JA 3FMCA 1CSQA 3J7YW 1SJHD 2SNSA 1KQSA 4LF7Q 4R4CA 2I0QA 1CHQD 2Z8LA 2UUAL 1EY5A 1TS5A 3S16B 4ZKBB 4DR5Q 3JAMc 1BNZA 2F0IA 2EJMA 2EE1A 4LW1A 2F0FA 4JOIC 3DM1A 2A6EC 1D8LA 4XDXA 3HOUH 4DV5Q 1FJGQ 2AWNA 4FDBA 3J7ZC 2UUCL 3T1YL 5C44B 2CWPA 4X64L 4DR4L 2LS01 4TRDA 4NPSA 3HOYG 1Q8KA 2UXBL 3MWYW 4A3DG 1U4LA 5IYCH 4ZAIA 2R92G 1MGSA 1CA6A 3S1NH 1HUMA 1GUSA 2N3SA 2E5LL 2EY1A 1CZWA 4OELB 1ET6A 2EJGC 1MI2A 2XN9C 4K6LA 5I6WA 1B4OA 2JJQA 5C4HA 4EQPA 1KDAA 1KLGD 5TSSA 1Q8IA 3HOWB 4JI4L 2R7DA 1V8QA 4QB4A 4NKLA 4P72A 4QL5A 2MO1A 4GOPB 4K8JA 2KA7A 3PSIA 4DK0A 4A3DH 2EIFA 3MXGA 4KN4C 4NXMQ 1G6ZA 1XWEA 2VB3X 2XTIA 3NQTA 4LF6Q 2NVQB 1WJJA 2N55A 2L4NA 1EYCA 1H9JA 1VS0A 2B8FA 4ODGA 4CHTB 2KBNA 3VR4A 4A3IG 3MFYA 4LF6L 3M4PA 4JI1Q 1I4PA 1UUPA 3W1GA 2NVTB 4G7OC 4JI3L 3HOWH 5GROA 1NMFA 1K3RA 1BQQT 4A3JH 1EIYB 1IKMA 5J3BA 3GTMB 4UHVA 1SFOB 2Z4IA 4LMQD 3TREA 3L0OA 1V1PA 3L7ZC 4B08A 1EU4A 2K5WA 1X6OA 3HOZG 1ONLA 1ESFA 1JWSD 1RKNA 3VR3A 2JN4A 1GUTA 1TS2A 1DYQA 3D4WA 2H4OA 5LMNQ 1ILQA 3PO3B 4NXNQ 1H9KA 3H0GH 2ALYB 1SJED 2EYLA 4HIDA 2UU9Q 4RH6A 1JOKA 3KF6A 3M3YH 1YVCA 1JORA 4K8IA 2NVYB 2VW9A 5CC4A 4LF5Q 2JEAI 1I94Q 1ZXTA 3S16H 2NBFA 4DAYA 1KAWA 4GLAC 1EOVA 5DM63 2KECA 3KBXA 3AQQA 3E9HA 5ELEA 3BU2A 1XNRQ 2EXZA 2Y0SE 4DV2L 2N49A 3F2BA 2DNCA 4A3FG 1HJPA 3KLSX 2EYMA 1I94L 4YY3Q 4A3LH 3KF6B 3MXNB 4O1NA 4KKTA 2CKZB 2V4DA 3I91A 3D0FA 5C0XI 5M3FB 2EYJA 4A3FH 3PUZA 3SK6A 1EIFA 1Y1VB 4L63B 2YYZA 1RDPD 2E74C 3H91A 4LF8Q 4OIKA 4RGNA 2F0PA 1GOZA 3IFTA 2WP8J 4JI2Q 2RA4A 1DONA 1VQCA 4GLXA 1Q12A 1D6EC 2O5JC 4N8X1 1J8IA 1PYWD 5KNDA 2A5HA 3FPPA 4KY7A 3TQYA 5KIXA 3MXNA 1RTOA 2PI2E 4GN3B 4LWCA 3NBHA 3S1QB 2OTJA 5J39A 3S1MH 2C9OA 4A3IH 1WVLA 3ONAB 1UAPA 3R2TA 5I4DA 4DR3L 1V1PB 4DR5L 4A3EB 1XJVA 1HNZL 1KDCA 5FLXc 1O7LA 4LF4L 2ZM6Q 1YIJA 1NY4A 4JI0L 2G9DA 3K6OA 2HDLA 3RR5A 2IX1A 3HOXB 1EWIA 3SGIA 2JA7G 1EY7A 1IBML 5CYUA 1SE2A 4A3GB 2B2YC 4OIJA 2K52A 1CQFA 1F2YA 1SNMA 3M9BA 1SE4A 5C4XH 4OX9Q 1F9PA 3GDEA 1WCMH 2D0PA 5JPNC 2L9HA 4DV0Q 4XQNA 1UE6A 2JA9A 1MHWC 2VQFL 2PZTA 1SYDA 4PMCA 5C4XB 2IX3A 4RMFA 5C0XH 1AW7A 4L5QA 4NMZA 1FR3A 3T4AC 4HR7B 4JG2A 1LT3D 5M3FH 4L8JA 1JR0D 1XPRA 4XQJA 4HSPA 1SE3A 4XTCS 3TP6A 5KGUA 3BZDB 1RCVD 2VB2X 1SN8A 2XIWA 4RAUC 2NN6G 5KNCA 3CW2C 1F9RA 2X6GA 3CAMA 1WD0A 4BY7B 2EY5A 3MXPA 1VQ4A 1U9RA 4DR7L 4LFCL 1HCZA 1NTGA 4FF1A 2TMPA 2CH4A 3PMFA 4QF4A 4HIMA 4K0KL 3HOZH 1B44D 5ELBA 3KDFA 4LAAA 5GAHC 2WAQE 3CP0A 3CCLA 1CA5A 3I4LA 3K81C 3TMEA 2JEBI 1PHJA 3KUPA 1UEAB 4DV1Q 4C3IG 1QG7A 1VF7A 2WAQG 3PO2G 4OEMB 2PZUA 1U4PA 3LGJA 3GTQB 1WD1A 4DXFA 2A69D 2PMZE 5HY6A 4UPAA 1TQOA 3J7AF 4L5SA 2ZTEA 3PQIA 1T9HA 3MEHA 2E2JB 1WTPA 1S72A 4DR6L 2EJFC 1QVGA 3FKIH 3RLNA 1EY9A 4DXGA 1UE7A 5E4WC 3CKIB 1X3GA 2R3ZA 4C3IH 1TWCB 1DOKA 1NE3A 4JI0Q 3PO3G 1XNRL 4M1UB 5ELFA 2E2JH 2B2VA 2AUJD 1CSPA 4A3EG 4XYOA 4YCUA 2RVLA 4PG3A 4FXKC 3UDGA 1EWHA 4HTHA 3SK5A 1YNXA 2KHJA 4XT1B 1B9NA 5KEEA 3N52A 4FVMA 4FXDA 1H9RA 1D5XC 1A0IA 5LL6X 1GO3E 2PPBC 3GTQH 2XSCA 2RCFA 5C0XJ 2DY8A 4P75A 1G8ZD 5JOBA 1H95A 3U50C 3FKIG 3C46A 1KNAA 2DUDA 2K32A 2F0WA 2XRQD 3FHWA 4OO1I 3OOCA 4A3BB 3GV3A 4DA2A 1IBLQ 1ESRA 1AE2A 1PRTB 3E3XA 1A3VA 4EX5A 1R9TH 2UU9L 3IFDA 1PRTD 1Y8OB 4ABNA 3Q22A 1KTKA 4JI3Q 1Y1WH 5IP9G 3HOVG 2Z6BA 1F9SA 1S5FD 4CDFC 4ZLTF 1G2TA 1KRSA 1YZ6A 2K14A 5JJKA 1Q1EA 2GA4B 5IOCA 4C3HB 2OF1A 1TY2A 4TSSA 2Z4HA 2LSSA 1IL8A 1SYGA 1JJGA 2CVRA 2PO4A 4WRDA 1EQVA 2I07B 1S5DD 3STBC 1GJXA 4F87A 3BG3A 4ZUIA 3R3OA 4IPHA 1HXYD 1AP0A 4C56C 5FOBB 4FXGC 5IYDG 1WCMB 5A2QE 4X3KA 1WTOA 1EFID 2PCFB 3IRBA 1TY0A 4HMJA 2HD3A 2K5NA 3UE1A 1TIID 4AYBB 2NZ1D 1XMOQ 3MC0B 4DUZQ 4BXXG 1YJWA 2B29A 4A93B 3TP5A 3HRZC 3HP3A 5HURA 4V190 3R93A 4F7XA 4TKOB 5IY0A 4DUZL 1KLUD 2UXDL 2PZWA 4JBWA 3BVZA 1PTOB 2BA1A 1TWCH 3A56A 3D8GA 4KHPQ 4IPGA 4RCOA 1VQ9A 4BBRB 3I4NH 3G48A 2ASBA 4O0AA 3UI2A 2HT1A 4X3UA 1N33Q 1JOQA 1UWVA 5BN4A 3AB9A 3S1QH 4WJ4A 3SXHA 3A55A 4M8AA 3DUZA 5L37A 3CCEA 1A2UA 4C2MH 4R4IA 4PZ6A 3VR6A 2HHHL 1EU3A 3J80c 2KVMA 4GZYC 1VQBA 1JMCA 2NVXB 2VL6A 3NWSA 1IBLL 3LX0A 1A63A 2H1EA 1I6HH 4GLVB 2NTSA 3WOFA 4BY7G 2VNUD 5GAEC 2NN6H 3JAME 1WFQA 3B6YA 2JQOA 1G6PA 3OPOA 1ZYRD 3SK8A 2VY3A 3IL8A 2VQEL 4LFAL 3QOJA 3R8BA 2EXDA 5CORA 4DR6Q 4DN4M 3J81L 5FO7B 5CBAE 1HQMC 2MO0A 1UE1A 3A7LA 4XYQA 3TN2A 3M3YB 1D1KA 1RODA 3G4SA 3Q24A 2B2UA 4RGMA 2WB1B 2RHSB 1NUCA 3K5MA 5JPMC 2ZJPA 4FP5D 2YTXA 5ELOA 1VQ7A 1JE5A 4ZYSA 3Q0AA 2E2IH 1B53A 1C7YA 4A3MG 2M00A 5K36H 2R61A 3RN2A 1VQ8A 1O7YA 1D7QA 4IUUA 1JCKB 1BBXC 4LUVA 3TS2A 4KHVA 1Q90A 3AEVA 1HTPA 2E2HB 1ENCA 1Y1WG 1IZ6A 1PH6A 3T16A 1VQJA 2BH2A 2K04A 2JA7H 4K0KQ 2N8NA 4HMIA 4DV6L 3S24A 1YNND 1KAAA 3E9IA 4R9WA 1E7ZA 4PNYA 2BE5D 4YWKA 2RKSA 3EROA 4P2CB 3SR1A 1LYLA 4JBJA 1NCVA 4APVA 1B8AA 3KF8B 1TWAH 3X3MA 3NXWA 3CMAA 2JA8H 3BYTB 1EOTA 1DGSA 3O13A 4CDDC 4A93G 4J8QA 3I55A 4Y7NH 1TU2B 5M3FG 2Q2IA 4YIJA 2IT1A 5C44G 1E24A 4MZ9A 5A35A 3P75A 2AQ1B 4DNRB 2IL8A 4F88A 3EIVA 4LF9L 4TVAB 1SBBB 4PZ8A 5CV5A 1E2VA 3DMUA 2KENA 1SNDA 3I56A 1AZPA 3C1FA 4O42A 3ITPA 2UXBQ 1CKNB 2OEOA 4X65L 3SK4A 1EEID 4LFCQ 4GN5A 2F0OA 3CMEA 3D6WA 4IQZA 1ENFA 2ICIA 3HOWG 4A3CH 2B2TA 1FD7D 2K05A 4JI6Q 4JYAL 3S2HB 3ULLA 1A15A 4R8IA 3QWNA 1A6XA 5EPJA 4LUOA 3TS0A 1WTHA 5LL6S 2E2IB 3NTIA 3ERQA 2ZT9C 3GTLH 4JYAQ 1QNUA 2WINB 1QUQB 4RHSA 2VUMG 1VQHA 4G57A 1V9PA 1SXTA 4KI0A 2GVAA 2EZVA 1ZEQX 2L12A 2YU9B 1X65A 4C3IB 3QOLA 3DWAA 4B3SL 4UP9A 4LF4Q 2QKIC 2VS1A 4CGYB 1IW7C 1PH1A 2HQLA 2QEXA 5JAVA 4NP5A 2EOTA 4QJFA 1V1OA 2A74C 3A8IE 5ISRA 4RKBA 1I3QH 1D2BA 3CQZH 3CC4A 1XYIA 3E0JA 4KHZA 1VCIA 2CFMA 1A3TA 2JSOA 1R9TB 1EL0A 1LTAD 5FKAC 3I4MB 3OTOQ 4JBKA 1MJCA 1X54A 3OMGA 3PIO3 4B3SQ 5JJLA 1K0RA 1GHJA 4PZ7A 4OXPA 4DR1Q 2E2DC 4GOPC 3NTHA 1ASYA 4A3GH 4XXEA 2OQKA 1YI2A 1GUNA 3RZDH 3M4YA 4RGTA 3HKZG 2HUGA 5LMUQ 1VQ5A 3GTKB 5I9OA 5M5YH 3HOUG 3A0JA 2B2YA 2SNMA 4BBRG 1VQOA 3KLRA 1TWFB 1H9SA 4CKBA 3VR5A 2MFIA 1HZ9A 3A5UA 3PUVA 3J80L 5D3IB 4NB3A 2C5CA 2CHBD 3W2DA 4B9XA 2Q2HA 1B1ZA 2MGSA 1TKWB 1IYJB 5FJ8H 2BDOA 1EFWA 3VA7A 3HOYB 2JP1A 2Q8TA 2G5DA 3K7UC 2RBMA 2K1BA 5K5PA 2QW7A 2K4KA 2J0TD 1PZJD 1B50A 3OTOL 3PIOA 2IW3A 2Q2UA 1GUOA 1T5EA 2A68C 2R92H 2ZTDA 3J81j 3MAQA 5LMNL 3ERSX 4GN4B 1XNQL 1AE3A 1PYBA 3S15B 4JI5L 4MHEA 2F3VA 2BA0A 2KCMA 1I50B 1R4PB 2BDNA 5J22A 5EJWA 1CK1A 4ZUJA 1PH8A 2A8VA 1QVFA 1TWFH 1E1TA 1FNUA 1CKNA 3CC7A 3G7LA 1M90C 1HR0Q 1BCPD 4A3KG 4DV3Q 4IFDH 1SMXA 2KEEA 2QILA 1S5ED 2SOBA 3WWVA 3F2DA 4A75A 1LM0A 1VQEA 2D0OA 5JVG3 2JA8G 1VQLA 1SROA 4DK3C 1VQKA 3OIPA 4DKAC 4JPBW 1CM9A 5D65A 2F3WA 3M85A 2PW7A 4C2MB 5C4ZA 4CJ1B 1VQGA 3I4MH 3A74A 1U0LA 2F0UA 3I70A 4ZKCB 3M7GA 4HJ8A 3S15H 5M9OA 1B3AA 1HNZQ 4U673 1AFPA 2F0TA 4BY1G 5KYLA 3BVGA 3K7AH 2L0CA 1YEZA 3A7AB 4IUNA 3VR2A 5CV4A 4EQ5A 3VYRA 5CMDA 2RSOA 3JC66 3RUZA 3S1RB 3GTPB 3K80C 2YU9H 4KJNA 3TP8A 1FVIA 3HOXG 1IKLA 2WFWA 4CDCC 5IGGA 2F0SA 1S4ZA 1XTDA 3KBGA 4ME5A 2K5VA 4R8NA 3RMHA 1KD1C 5C4JB 1LTBD 4DV4Q 2F0DA 1X9NA 1WTRA 4Q0FA 1QZHA 5FLXL 4FNFA 2K75A 3W3AA 1PFMA 1F2MA 1Y14B 1AH9A 1HQRD 4A4IA 4A93H 2B39A 2YTYA 2F0MA 3GTKH 4DR4Q 3K8AA 5M5YB 1EUJA 1VQPA 1ILPA 1XNQQ 3HOYH 1X3EA 2JA5H 2EDGA 3GTMH 2L11A 3AU7A 4UAIA 2F3IA 3DEPA 5BN3A 4J15A 5C0XG 1SR3A 3EVQA 1R4QB 3HOUB 2JA6B 3ULJA 1G2SA 2L15A 4JV5L 1PA6A 3GTPH 2R93G 2Z6KC 3GV6A 4OWTB 4OGQC 2F1MA 1F2LA 1IL2A 3DWPA 1J9OA 2B63H 1PDQA 3J80i 4A3EH 3K57A 2UUCQ 1ZYRC 2WB1E 4U68A 1STBA 2MPMA 1I3QB 2L55A 1PVOA 1M1KC 4A3BG 2NVYH 4DR3Q 2R6GA 2R7ZG 5IWAQ 2M9VA 4R1JA 3PO2H 1K83B 1K8AC 1WCMG 3BDOA 4C3HH 2E5LQ 4O2DA 1W2BA 3KLSA 2K6AA 3MTSA 3ND8A 1TWAB 5LMNW 1W3SA 4CKCA 5IYBH 1BCPF 4NXNL 3M4OH 1B70B 1HTLD 2MJ8A 1BCPC 1U4RA 3UDFA 4CDEC 1XMQL 1L0XB 2PI2A 3Q8DA 4DR2L 3KLWA 4GKJQ 3MFGA 2RSNA 4R4TA 5I2XA 1ML0D 1K8OA 2QDBA 4LFAQ 2VQEQ 1PFNA 4KKSA 4P71A 4PMBA 2LXKA 2FMCA 1K9MC 5HGTA 1QILA 3RN5A 5FJ8G 1S5BD 1Q82C 4DU9A 1JWMD 2A6HC 1ET9A 1PH5A 5C6AA 3PGZA 2VZAA 1K83H 4IUQA 1KHIA 2IPKD 3TBIB 1E3PA 4POFA 5F2DA 1BBUA 5EBCA 4ALPA 2A6ED 3BYYB 3HKZB 3ND9A 4HAEA 3RLOA 3S9WA 3VYTA 3M4OB 1G291 3D31A 5E4XA 3K59A 4DV3L 4I7ZC 3VYSA 3HS0C 1QB5D 5GAGC 4OO1H 2NZHA 4RA8A 3NWTA 3FKIB 5M5XB 1I4GA 3WOEA 1SYEA 5BR8Q 2BCOA 4HJ9A 1ASZA 1OXUA 3QJYA 1VQ6A 1PH3A 3NQIA 1BXTA 1EIGA 1A3UA 1NSNS 4GS3A 2DJFC 2MQHA 2B63B 1TS4A 1VMPA 4B3RL 4DUYQ 5EPKA 4IOCA 1DOLA 4DK6C 5GQOA 4UDUC 1STHA 3V05A 2JK8A 2FHTA 2FINB 2NVTH 3TZDA 4B3TL 3HOVB 2PMZB 3KDFB 4CKEA 1IBKQ 1ZKOA 2F4VQ 2B3GA 5IGDA 1VQIA 1XXGA 1CTMA 3TP7A 4JK1C 1BKBA 3GD7A 2DJGC 1Y8NB 4C1NK 2PQAB 1N8RC 3CCSA 4A3KB 4IURA 5AJ3Q 4H44C 4RFBA 2AWOA 2ZXRA 4WJ3M 1WTVA 2JA5G 3MA2B 4QY7A 3AYHB 3H94A 3HKZE 3PUXA 2F0EA 3C2PA 1Z6HA 1DXMA 4KK7A 1I4RA 1WYDA 3VA5A 1CUKA 2B2WA 1IW7D 1JJ2A 5M3MH 4DV6Q 4KV6A 2HCIA 1BUVT 1LABA 3PO2B 4RWSC 2I46A 1F77A 4EVOA 3S1RH 1A62A 4AH6A 4DR7Q 4AYBG 3K5OA 2K33A 4C3JG 3T1HQ 2N88A 2WB1G 5G3LD 3SDZA 2UUBQ 1IHZA 3HFZB 2F0GA 1EY8A 4DR1L 1WTQA 3H3VH 3DLLA 3S2DB 1GD7A 4JW0A 3QB3A 2F03A 4I65A 3D6CA 2I5HA 1N9WA 1L0YB 1JB7A 1PH9A 1SNPA 3UDIA 3G6JB 5T1IA 3K5LA 2UUBL 3S17B 2QCPX 1L1OB 1W6JA 3CPWA 1TT2A 1HPCA 1OXSC 4DUYL 4JBMA 1JOOA 2WKDA 1LTGD 4DV0L 3BZCA 1J5EL 1ENAA 1I4HA 1MSHA 2E8GA 2ZM6L 1L2FA 4I7AA 5C3XA 4BY7H 1XTCD 3H0GG 1NNXA 3CC2A 2JA6G 3D4DA 3FDTA 1EQRA 2ES2A 4HSVA 1A8VA 4IUVA 5AFWA 1V43A 2IY5B 3TZUA 3W1BA 1EYDA 3S1MB 3FEWX 3I3CA 2HIVA 4X3SA 4BBRH 1I6VC 4LF9Q 3I4NB 5IP7H 1O7ZA 4R4QA 2UXCL 4MN3A 3QIAA 4KMUC 1LTID 1YNJC 4B3TQ 1SSOA 2N78A 4JI7Q 1N34Q 1YBYA 4L5RC 2HDMA 4MTKA 1STEA 4DF7A 5H1SE 3TRZA 2R7ZH 2NZOA 2Q8RE 5C3WA 3CRKC 5CV6A 1FNVA 3LWEA 4KY6A 1IYVA 5DAUA 3F8TA 1LLRD 4L5TA 3ZJYC 4DGZA 4A3MB 3QR8A 3CCMA 5IT9L 4J6HA 3CRLC 5M3MG 4ZRZA 3NBHB 4DV2Q 4BXXH 4F8MA 1K73C 4XQQA 1Q7YC 1Y1WB 3CCUA 2O4XA 2BOSA 1E2ZA 4K5WA 1NAPA 1EYGA 1P16A 3C1EA 4C1NI 2LY7A 2Y0SG 2F0NA 3I4OA 1SMYD 2CWAA 4OONA 1FGUA 1RIPA 2JXMB 4N9TA 2K7VA 5AJ3L 5D14A 1L1OC 2CQOA 2QEJC 3SEBA 4X62Q 4B3RQ 3V96A 4X66L 1SFOH 1I4QA 3CCRA 1W6KA 5IIFA 1LO5D 2F0KA 5KRUA 4ZCKA 1YHAA 1Q81C 1HZAA 4A3CG 5C3EH 1LT6D 1QNKA 4DK1A 1B2TA 1C9OA 1E22A 4FO2A 1JICA 5IGBA 3F2UA 1HNWQ 2CW0C 2PQAA 3G71A 3HOZB 1D5MC 3S1NB 2HCCA 2EPBA 1C4QA 1STGA 4CJ0B 2AQ3B 1LACA 1C8CA 2LMCB 4AQYL 1MJEA 2E75C 1QOHA 1KDBA 2AKWB 3RD4A 3KOJA 4GKJL 1D1IA 2K5DA 4OL7A 4LJZC 4DR2Q 1B9MA 3URYA 1EQQA 4A76A 4A3JG 1J6QA 1NJIC 3L9AX 3J81c 3SHLA 1VQFA 4NW2A 1MIUA 1JC7A 2WV6D 1PV4A 1PMRA 4IUPA 5D3DA 4HEDA 3PF5A 4JI1L 5CV7A 1RD9D 1PH4A 1N33L 1B3QA 5IYBG 4ME3A 3OW2A 3BJUA 4RKLA 4G7HC 1GM5A 4JV5Q 1VF5C 1QVCA 2K5QA 5CV9A 1D5ZC 4EQNA 3J81i 3AFQA 2HHHQ 3I4NG 5C44H 3E5SA 3BVMA 1UEBA 2A69C 3NELA 3D4RA 4HJ7A 5IGEA 1M4VA 3S17H 5JEAJ 1GVPA 2EY2A 2HIXA 3KFUA 5JEAH 3CCJA 1BOSA 5COYA 2PNHA 1LT5D 2F0HA 1HUNA 5IGFA 3MXUA 2V1CC 3PV0A 4H02A 1PH2A 3S2DH 3J81E 1RHPA 4X64Q 2VUMH 3GTOB 2IWHA 4CJ2C 2WKCA 4JI8Q 1K3BC 3OSOA 1YNJD 1EZ6A 1OXTA 1G91A 2Z9HA 5A2QL 1FNWA 3DM3A 2OQ0A 2KOLA 4P74A 2OXPA 3I2ZA 5EGTA 1X55A 1DCZA 2R7FA 2LXJA 2UUAQ 3F1ZA 2F52A 4KTAA 4YWMA 4DAMA 2JE6I 4YCVA 3TDQA 2D62A 2NVQH 1H9SB 3T56B 3OIQA 4JI4Q 5I2YA 2F0VA 3U4VA 1HR0W 4BY1B 3BZKA 3SE0A 2ENBA 1SRUA 1EYAA 3OWEB 3VDYA 1SLJA 1KIXA 2R93B 1HNXQ 1DM0B 3E0EA 4Q5VA 1MBYA 1S40A 2KHIA 2DNEA 4K14A 5C5LA 1EEFD 1TS3A 4RHRA 3I90A 2CCZA 3OHXC 4KD3A 4LF7L 2UXDQ 4BBSG 2IHEA 4K6DA 4A3FB 1SMYC 3R2IA 2M2LA 4EGVA 2OWOA 3HEJA 3NK9A 3Q6SA 5FLXE 2B63G 4XIGS 1GUWA 3NENA 3EFXD 3J7AV 1U4MA 1O7IA 4WFN3 4QMGA 1NR2A 4MTNA 2HQEA 1JT8A 2KUMA 3K0XA 2ZJRA 1Z47A 2ZTCA 5EKKA 1ICFB 1IXRA 4K2LA 5I6YA 1C0AA 4QQBX 2FFKB 3HGBA 3QO2A 2PW5A 5BN5A 3Q23A 4B3ML 3K58A 1F9QA 1N36Q 4A3JB 3UDXA 4IJHA 1LUZA 1IYUA 1ICWA 2L1BA 4IO9A 5LHY1 3F2CA 1VDZA 3MHBA 2K01A 4X66Q 4UP8A 2PQEA 4GKKQ 4QUCA 4LFBL 4FF3A 1N32Q 2A6HD 1A2TA 4JCVE 4HCEA 5IYDH 2B2UC 1CHPD 4DV1L 3L2PA 4HCSA 1LTSD 4BBSH 2A68D 1TWGH 1FGBD 2IHFA 5FO8B 4IFDG 4JI5Q 1CI3M 1HA5A 1JE4A 2NN6I 2NWGA 2RF4A 1Q86C 1NBWA 1PZKD 2YTVA 5EKLA 3I72A 2MNAA 5IT9E 3GTJB 5FLMG 2NVXH 1SDFA 1I50H 1YHQA 2LFNA 3DXJC 1BF4A 4ID6A 2Z6KA 2XWJB 4KKUA 4QCLA 5BR8L 2EYHA 1HA6A 1GKHA 5C3EG 3T1YQ 1GUGA 4A3DB 4K5VA 1SNQA 3X3NA 4FF4A 1CFMA 3CU7A 4DPGA 5FK9C 2NUCA 2B2TC 3S14B 5M5WH 3KK7A 4PQXA 2H5XA 5C4XG 2O2LD 3H6MA 4KY5A 1JB3A 2TSSA 1NR4A 2KJXA 4H13C 3CF5A 3H0GB 5KYIA 2EQSA 2J4XA 2XGTA 1SE8A 3PUYA 1BDOA 4YY3L 2JYOA 1CQVA 1BO0A 3ZYYX 3FRPB 3LWUA 3U4ZA 2F0LA 2A19A 1K8GA 3A54A 2IX0A 2E2HH 4JI6L 1E1OA 1L0WA 3EN2A 4AIMA 3ICEA 1I5FA 2AQ2B 3EA6A 4QGUA 2EYPA 2OT2A 5JJZA 3G6EA 3PO3H 3S14H 3I8ZA 5ELDA 2QA4A 4UY8C 1JQYD 4P73A 1HFNA 1KXLA 2F4VL 1IBKL 4C3JB 4HJAA 1S3OA 2NB0A 4HIOA 2AHOB 2B8GA 2DY7A 1QUQA 5C4JH 3H15A 3T1HL 3MZ5A 3I7FA 2OTLA 3I4MG 3NEMA 1FYCA 2XNAC 4IZ8A 4FYDA 2JA8B 1BCPB 1JWUD 1TVXA 4N8FA 1HNXL 2KCNA 4CBVA 4NDXA 4IUTA 2JA5B 4ZK9B 3BS1A 4UP7A 4L6TB 4IFDI 5JJIA 5E1FA 1PXUA 4BWGB 1Z7TA 3FVQA 1PFSA 4E6IA 1GXDC 1CKMA 2D9UA 3CHBD 4DFAA 4DAVA 4BY1H 5IGCA 4LUZA 2EY6A 2J7ZA 1C48A 3NHHA 1Y69U 4IPCA 3SVMA 1EQTA 5EQ0A 1BR9A 4IALA 3IKJA 1VQMA 2JA7B 4Z9CB 3NE5B 4H7BA 4JOIA 3IAYA 1QZGA 4DNIA 1K28A 1XPOA 4A3KH 1QJOA 1I4XA 2BE5C 1FL0A 2DN8A 4GOPA 1DD2A
chains in the Genus database with same CATH topology
4LF5Q 3A5ZB 3KJPA 2ZM6L 1L2FA 3I55A 2JEAI 3PF4A 4Y7NH 3CCQA 1I94Q 5M3FG 2Q2IA 5C44G 2IT1A 4JI8L 5IYCG 1E24A 1UE5A 4MZ9A 3S16H 1KAWA 4GLAC 4BY7H 1EOVA 2AMCB 3H0GG 4IJLA 3AQQA 3E9HA 3CC2A 2JA6G 4LF5L 3BU2A 1EQRA 2RCNA 3EIVA 3PUWA 2Y0SE 1A8VA 4TVAB 2N49A 4PZ8A 4DV2L 1YJNA 3F2BA 1HNWL 1V43A 4A3FG 1HJPA 2KENA 3I56A 2IY5B 1I94L 3W1BA 4YY3Q 4A3LH 3KF6B 3MXNB 4JI2L 4DV4L 2UXBQ 1CKNB 2CKZB 3OYYA 4X65L 2HIVA 3D0FA 4BBRH 4LF9Q 5IP7H 5C0XI 4LFCQ 4GN5A 1P8LA 4R4QA 4A3FH 1YJ9A 3CMEA 1Q1BA 2UXCL 3HOWG 3PUZA 2I5MX 1EIFA 4A3CH 2YYZA 4JYAL 4B3TQ 4JI6Q 3RLFA 3ULLA 3HOXH 4GNXC 4JI7Q 2N78A 4LF8Q 1N34Q 4MNOA 1YBYA 4L5RC 2WP8J 5H1SE 1YITA 3TRZA 2R7ZH 4LUOA 4JI2Q 2NZOA 4R4OA 2DGYA 3TS0A 1VQCA 1JJCB 1G51A 1Q12A 4GLXA 3M7NA 4JYAQ 3GTLH 3TEHB 1X56A 3PCOB 1OTCA 1QUQB 2VUMG 1VQHA 3TQYA 1V9PA 3ZJYC 3F8TA 4L5TA 1BVSA 4RG1A 3CCMA 4KI0A 2ES2A 2PI2E 2GVAA 4GN3B 4LWCA 2OTJA 1X65A 3S1MH 5M3MG 1TWHH 4A3IH 2A1AA 3NBHB 4B3SL 4UP9A 4DV2Q 4LF4Q 4YHHQ 4BXXH 2VS1A 1PH1A 2HQLA 2QEXA 4DR3L 1K73C 4DR5L 5IP7G 1Q7YC 4QJFA 4KHPL 4A3GG 1YHBA 2Z0SA 1XJVA 3CCUA 1HNZL 1I3QH 3CQZH 3CC4A 1VQDA 1EYGA 1P16A 4KHZA 5FLXc 1VCIA 2CFMA 2Y0SG 4LF4L 2ZM6Q 3I4OA 1YIJA 1NY4A 4OONA 2CWAA 4JI0L 3OTOQ 1FGUA 1MJCA 1X54A 4B3SQ 4JBKA 1RIPA 3RR5A 5JJLA 5AJ3L 1K0RA 1L1OC 2CQOA 4PZ7A 4X62Q 3STBD 4B3RQ 4X66L 1SFOH 2IX1A 4OXPA 3CCRA 4DV7L 1EWIA 3SGIA 4DR1Q 4GOPC 1XMQQ 4IPDA 1IBML 1ASYA 2JA7G 5EAYA 4A3GH 2OQKA 3ER0A 1YI2A 4A3BH 4GNXA 3RZDH 3CD6A 2K52A 1YHAA 3HKZG 1HZAA 3KYHC 5IP9H 5C3EH 1VQAA 5LMUQ 1Q81C 1VQ5A 4A3CG 3M9BA 5M5YH 5C4XH 3HOUG 3A0JA 1C9OA 1HZCA 1E22A 3JAMi 4OX9Q 4BBRG 1VQOA 3GDEA 1WCMH 2D0PA 1HNWQ 3ULPA 2PQAA 3H3VI 3G71A 5IWAL 4DV0Q 2MFIA 1UE6A 2JA9A 2ZJQA 1HZ9A 1XMOL 3A5UA 2VQFL 3PUVA 4NB3A 2Q2HA 4RMFA 4C3JH 1NMGA 4AQYL 1MJEA 4L5QA 3CXCA 1IYJB 5FJ8H 1KL9A 4NXML 1EFWA 4JG2A 2AKWB 5M3FH 3KOJA 4GKJL 1XPRA 4PMWA 5M5XH 4DR2Q 3K7UC 4XTCS 1EQQA 4A76A 4A3JG 1J6QA 2K4KA 1NJIC 4LNQA 1VQNA 2KCTA 3OTOL 4A3MH 3PIOA 3J81c 1SN8A 2Q2UA 1VQFA 1MIUA 2ZTDA 2R92H 3J81j 4AQYQ 5LMNL 2OCEA 1PV4A 2NN6G 3ERSX 2RHQB 3CW2C 4GN4B 1XNQL 1AE3A 1PYBA 3CAMA 4OWXB 1HR0L 4JI5L 4A3LG 3PF5A 4JI1L 1VQ4A 4DV5L 1FJGL 4DR7L 2BA0A 2KCMA 4LFCL 1PH4A 1N33L 1NTGA 5IT9c 5IYBG 1PH8A 2A8VA 4YHHL 4ME3A 4HIMA 3BJUA 1TWFH 3OW2A 1QVFA 4K0KL 1E1TA 3HOZH 3CCVA 2K5HA 1CKNA 3KDFA 3RZOH 5GAHC 2WAQE 3S2HH 4BA2I 1GM5A 4JV5Q 3CC7A 3CP0A 1QVCA 3J81i 1M90C 1HR0Q 4A3KG 2HHHQ 3AFQA 3CCLA 3I4NG 3K81C 5C44H 4DV3Q 1PHJA 2JEBI 4OO1G 1SMXA 1UEBA 1L1OA 3NELA 3WWVA 4A75A 2FXQA 3F2DA 1PYSB 4HJ7A 4AYBE 1LM0A 4DV1Q 3S17H 1VQEA 2D0OA 1V1QA 5JEAJ 1OXVA 2JA8G 1VQLA 1GVPA 3KFUA 2HIXA 4X62L 1HH2P 2WAQG 3CCJA 1SROA 4DK3C 1VQKA 4Y52H 3PO2G 2PNHA 4DKAC 2V1CC 3PV0A 1J5EQ 3LGJA 3M4QA 4H02A 4DAYB 3M85A 1PH2A 3S2DH 4IFDJ 1VQGA 3I4MH 2PMZE 3A74A 5HY6A 4X64Q 2VUMH 1U0LA 4UPAA 3J7A5 3GTOH 4HJ8A 5LMUL 4JI8Q 2ZTEA 4L5SA 1HNZQ 3S15H 1PH7A 1OXTA 1T9HA 4BY1G 1S72A 4DR6L 3K7AH 4YWLA 1YEZA 4EQ5A 2BH8A 1QVGA 3DM3A 3JC66 3FKIH 3RLNA 4GNXB 1TXYA 2OQ0A 4P74A 3K80C 1KRTA 2YU9H 1UE7A 1FVIA 3I2ZA 3HOXG 1X55A 1X3GA 2WFWA 2R7FA 4C3IH 1NE3A 1XTDA 2LXJA 2UUAQ 4JI0Q 1XNRL 3PO3G 3F1ZA 2F52A 4YWMA 2E2JH 2K5VA 4DAMA 2JE6I 1CSPA 4YCVA 4X65Q 4YCUA 4PG3A 1X3FA 2D62A 4A3EG 2NVQH 5DLQE 5HGQA 3UDGA 1B7YB 1KD1C 4DV4Q 4JI4Q 1X9NA 1YNXA 4POGA 2KHJA 3U4VA 1HR0W 1QZHA 3BZKA 1N36L 1SRUA 2UXCQ 1Z9FA 2K75A 5GADC 1SLJA 3VDYA 1A0IA 2QGQA 1KIXA 1Q46A 1Y14B 2ID0A 2R93H 1HNXQ 1GO3E 1AH9A 3GTQH 4A4IA 3E0EA 3GTJH 4A93H 2YTYA 3CPFA 4P75A 5C0XJ 4KLKA 3PIPA 1S40A 2KHIA 2JA6H 3GTKH 4OWWB 4DR4Q 3K8AA 1OXXK 1H95A 1EUJA 3U50C 4JI7L 1VQPA 3GO5A 1XNQQ 1X3EA 2K50A 1RL2A 3FKIG 2JA5H 3GTMH 4HIKA 3HOYH 2VQFQ 1XPUA 2CCZA 2DUDA 1CKOA 3UE0A 2F3IA 4QIWE 5E7NA 4LF7L 2UXDQ 3FHWA 4J15A 5C0XG 4OO1I 1SR3A 4BBSG 2IHEA 1IBLQ 4IOAA 3ULJA 2L15A 4JV5L 2OWOA 1PA6A 1AE2A 3GTPH 4EX5A 2Z6KC 4OWTB 2B63G 3U58A 4XIGS 2R93G 3NENA 1WOCA 1R9TH 2UU9L 2I5LX 1O7IA 1IL2A 3KJOA 4MTNA 2B63H 1JT8A 3J80i 4A3EH 1IBMQ 4JC0A 3K0XA 2ZJRA 2UUCQ 2WB1E 1Z47A 4YCWA 2ZTCA 1Y1WH 4JI3Q 3GTGH 5IP9G 3HOVG 1IXRA 1Y1VG 2GN5A 1PVOA 1KRSA 1YZ6A 2K14A 4HJ5A 2NVYH 1M1KC 4DR3Q 2Q2TA 1Q1EA 1WI5A 2R6GA 2R7ZG 4A3BG 1C0AA 4QQBX 5IWAQ 4R1JA 3PO2H 1K8AC 1WCMG 1U5KA 4C3HH 2E5LQ 4B3ML 4O2DA 1N32L 5IE8A 1N36Q 1W2BA 4GKKL 4BA1I 4TQUS 1Y1VH 3UDXA 4IJHA 3RNUA 1MKHA 1LUZA 1KC8C 5LMNW 4IO9A 1W3SA 5IYBH 2LSSA 1JJGA 4NXNL 3M4OH 1B70B 4DV7Q 3F2CA 3EBEA 3UDFA 3STBC 3HOVH 1LTLA 1XMQL 5ELNA 4X66Q 4UP8A 4GKKQ 4LFBL 2PI2A 3Q8DA 4IPHA 4X6AH 5K36G 4DR2L 3KLWA 3FP9A 4B3MQ 1N32Q 1HZBA 4JCVE 5JEAG 4GKJQ 5IYDH 4DV1L 2C35B 4R4TA 5IYDG 3L2PA 4LFAQ 3HKSA 2VQEQ 3IRBA 4LF8L 1TWGH 4BBSH 1BBWA 4OX9L 1N34L 4P71A 2K5NA 2IHFA 2LXKA 4LFBQ 3UE1A 4IFDG 3MEFA 1K9MC 4JI5Q 2NN6I 2YV5A 3RN5A 5FJ8G 1XMOQ 2RF4A 5FLMH 1Q82C 4DUZQ 1Q86C 1NBWA 4BXXG 1YJWA 2YTVA 1PH5A 2ATWA 3PGZA 2B29A 2MNAA 2VZAA 3AFPA 1K83H 3W5OA 5FLMG 2NVXH 2GVBA 1KHIA 4POFA 1E3PA 1I50H 1YHQA 1CSQA 1BBUA 5IY0A 4ALPA 2Z6KA 4DUZL 1KQSA 4LF7Q 4R4CA 3RLOA 2I0QA 2UXDL 1G291 3D31A 4JBWA 4DV3L 5BR8L 2UUAL 1GKHA 5C3EG 3T1YQ 2BA1A 1TWCH 5GAGC 4DR5Q 4KHPQ 4IPGA 2NZHA 1VQ9A 3JAMc 3I4NH 3G48A 4DPGA 4O0AA 2ASBA 4LW1A 2HT1A 4JOIC 5M5WH 1N33Q 1D8LA 1UWVA 2H5XA 3HOUH 4DV5Q 1FJGQ 5C4XG 2AWNA 4FDBA 3J7ZC 2UUCL 3T1YL 5BR8Q 3S1QH 4WJ4A 4HJ9A 1ASZA 2CWPA 4X64L 1OXUA 2VW9A 4DR4L 3CF5A 1VQ6A 3CCEA 1PH3A 4NPSA 4C2MH 2EQSA 2XGTA 4GS3A 4R4IA 3HOYG 1Q8KA 1SE8A 4PZ6A 2MQHA 2UXBL 4A3DG 3PUYA 4YY3L 2HHHL 5IYCH 3J80c 1VQBA 4B3RL 4DUYQ 4IOCA 2R92G 3S1NH 1JMCA 2VL6A 4DK6C 2N3SA 5GQOA 2E5LL 1IBLL 3U4ZA 2JK8A 1A63A 2A19A 1K8GA 1I6HH 4GLVB 2NVTH 2IX0A 4BY7G 2VNUD 2E2HH 2JJQA 1E1OA 4B3TL 3KDFB 5GAEC 4JI6L 1IBKQ 1L0WA 2F4VQ 3EN2A 2B3GA 4AIMA 4JI4L 3ICEA 2R7DA 1VQIA 1WFQA 3B6YA 2JQOA 1G6PA 1I5FA 4QGUA 3PO3H 4P72A 2VY3A 3G6EA 4QL5A 2VQEL 4LFAL 3S14H 2EXDA 2MO1A 1BKBA 3GD7A 2QA4A 4DR6Q 1N8RC 2PQAB 4P73A 4UY8C 4GOPB 3CCSA 2MO0A 1UE1A 1KXLA 5AJ3Q 3PSIA 2F4VL 2AWOA 3G4SA 1IBKL 4WJ3M 4A3DH 2JA5G 4HJAA 2EIFA 1S3OA 4QY7A 4NXMQ 2RHSB 4HIOA 2AHOB 2YTXA 2XTIA 3AYHB 2ZJPA 4LF6Q 5ELOA 3HKZE 1JE5A 1QUQA 3PUXA 1VQ7A 5C4JH 1WJJA 2E2IH 1C7YA 3H15A 4A3MG 1WYDA 3T1HL 3I7FA 2OTLA 3I4MG 1CUKA 1VS0A 3NEMA 2KBNA 1JJ2A 5M3MH 3RN2A 4A3IG 4DV6Q 1VQ8A 1D7QA 1HNXL 4LF6L 3S1RH 1A62A 4LUVA 4AH6A 3TS2A 3M4PA 4JI1Q 4DR7Q 4AYBG 3W1GA 3AEVA 4JI3L 3HOWH 3T1HQ 5GROA 1K3RA 1NMFA 2WB1G 4UP7A 4A3JH 1Y1WG 1EIYB 4IFDI 1IZ6A 5J3BA 1PH6A 5JJIA 2UUBQ 1VQJA 3TREA 2BH2A 1PFSA 2JA7H 4K0KQ 3HFZB 3L0OA 1CKMA 2N8NA 4DV6L 4DR1L 3S24A 3E9IA 3L7ZC 3DLLA 1XNRQ 3H3VH 1GD7A 1X6OA 1E7ZA 4BY1H 3HOZG 2I5HA 1N9WA 4LUZA 1JB7A 1PH9A 4YWKA 3UDIA 4IPCA 1LYLA 4JBJA 5LMNQ 1VQMA 4NXNQ 4APVA 4LF9L 3H0GH 2UUBL 2ALYB 1L1OB 4JOIA 4HIDA 2UU9Q 1B8AA 1QZGA 4DNIA 3CPWA 3KF8B 1XPOA 3KF6A 4A3KH 1TWAH 1OXSC 3M3YH 4DUYL 1YVCA 4JBMA 3CMAA 1FL0A 2JA8H 4DV0L 3BZCA 1J5EL 1DGSA 4GOPA 4A93G 2E8GA 5JJKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF5 Q;  3A5Z B;  3KJP A;  2ZM6 L;  1L2F A;  3I55 A;  2JEA I;  3PF4 A;  4Y7N H;  3CCQ A;  1I94 Q;  5M3F G;  2Q2I A;  5C44 G;  2IT1 A;  4JI8 L;  5IYC G;  1E24 A;  1UE5 A;  4MZ9 A;  3S16 H;  1KAW A;  4GLA C;  4BY7 H;  1EOV A;  2AMC B;  3H0G G;  4IJL A;  3AQQ A;  3E9H A;  3CC2 A;  2JA6 G;  4LF5 L;  3BU2 A;  1EQR A;  2RCN A;  3EIV A;  3PUW A;  2Y0S E;  1A8V A;  4TVA B;  2N49 A;  4PZ8 A;  4DV2 L;  1YJN A;  3F2B A;  1HNW L;  1V43 A;  4A3F G;  1HJP A;  2KEN A;  3I56 A;  2IY5 B;  1I94 L;  3W1B A;  4YY3 Q;  4A3L H;  3KF6 B;  3MXN B;  4JI2 L;  4DV4 L;  2UXB Q;  1CKN B;  2CKZ B;  3OYY A;  4X65 L;  2HIV A;  3D0F A;  4BBR H;  4LF9 Q;  5IP7 H;  5C0X I;  4LFC Q;  4GN5 A;  1P8L A;  4R4Q A;  4A3F H;  1YJ9 A;  3CME A;  1Q1B A;  2UXC L;  3HOW G;  3PUZ A;  2I5M X;  1EIF A;  4A3C H;  2YYZ A;  4JYA L;  4B3T Q;  4JI6 Q;  3RLF A;  3ULL A;  3HOX H;  4GNX C;  4JI7 Q;  2N78 A;  4LF8 Q;  1N34 Q;  4MNO A;  1YBY A;  4L5R C;  2WP8 J;  5H1S E;  1YIT A;  3TRZ A;  2R7Z H;  4LUO A;  4JI2 Q;  2NZO A;  4R4O A;  2DGY A;  3TS0 A;  1VQC A;  1JJC B;  1G51 A;  1Q12 A;  4GLX A;  3M7N A;  4JYA Q;  3GTL H;  3TEH B;  1X56 A;  3PCO B;  1OTC A;  1QUQ B;  2VUM G;  1VQH A;  3TQY A;  1V9P A;  3ZJY C;  3F8T A;  4L5T A;  1BVS A;  4RG1 A;  3CCM A;  4KI0 A;  2ES2 A;  2PI2 E;  2GVA A;  4GN3 B;  4LWC A;  2OTJ A;  1X65 A;  3S1M H;  5M3M G;  1TWH H;  4A3I H;  2A1A A;  3NBH B;  4B3S L;  4UP9 A;  4DV2 Q;  4LF4 Q;  4YHH Q;  4BXX H;  2VS1 A;  1PH1 A;  2HQL A;  2QEX A;  4DR3 L;  1K73 C;  4DR5 L;  5IP7 G;  1Q7Y C;  4QJF A;  4KHP L;  4A3G G;  1YHB A;  2Z0S A;  1XJV A;  3CCU A;  1HNZ L;  1I3Q H;  3CQZ H;  3CC4 A;  1VQD A;  1EYG A;  1P16 A;  4KHZ A;  5FLX c;  1VCI A;  2CFM A;  2Y0S G;  4LF4 L;  2ZM6 Q;  3I4O A;  1YIJ A;  1NY4 A;  4OON A;  2CWA A;  4JI0 L;  3OTO Q;  1FGU A;  1MJC A;  1X54 A;  4B3S Q;  4JBK A;  1RIP A;  3RR5 A;  5JJL A;  5AJ3 L;  1K0R A;  1L1O C;  2CQO A;  4PZ7 A;  4X62 Q;  3STB D;  4B3R Q;  4X66 L;  1SFO H;  2IX1 A;  4OXP A;  3CCR A;  4DV7 L;  1EWI A;  3SGI A;  4DR1 Q;  4GOP C;  1XMQ Q;  4IPD A;  1IBM L;  1ASY A;  2JA7 G;  5EAY A;  4A3G H;  2OQK A;  3ER0 A;  1YI2 A;  4A3B H;  4GNX A;  3RZD H;  3CD6 A;  2K52 A;  1YHA A;  3HKZ G;  1HZA A;  3KYH C;  5IP9 H;  5C3E H;  1VQA A;  5LMU Q;  1Q81 C;  1VQ5 A;  4A3C G;  3M9B A;  5M5Y H;  5C4X H;  3HOU G;  3A0J A;  1C9O A;  1HZC A;  1E22 A;  3JAM i;  4OX9 Q;  4BBR G;  1VQO A;  3GDE A;  1WCM H;  2D0P A;  1HNW Q;  3ULP A;  2PQA A;  3H3V I;  3G71 A;  5IWA L;  4DV0 Q;  2MFI A;  1UE6 A;  2JA9 A;  2ZJQ A;  1HZ9 A;  1XMO L;  3A5U A;  2VQF L;  3PUV A;  4NB3 A;  2Q2H A;  4RMF A;  4C3J H;  1NMG A;  4AQY L;  1MJE A;  4L5Q A;  3CXC A;  1IYJ B;  5FJ8 H;  1KL9 A;  4NXM L;  1EFW A;  4JG2 A;  2AKW B;  5M3F H;  3KOJ A;  4GKJ L;  1XPR A;  4PMW A;  5M5X H;  4DR2 Q;  3K7U C;  4XTC S;  1EQQ A;  4A76 A;  4A3J G;  1J6Q A;  2K4K A;  1NJI C;  4LNQ A;  1VQN A;  2KCT A;  3OTO L;  4A3M H;  3PIO A;  3J81 c;  1SN8 A;  2Q2U A;  1VQF A;  1MIU A;  2ZTD A;  2R92 H;  3J81 j;  4AQY Q;  5LMN L;  2OCE A;  1PV4 A;  2NN6 G;  3ERS X;  2RHQ B;  3CW2 C;  4GN4 B;  1XNQ L;  1AE3 A;  1PYB A;  3CAM A;  4OWX B;  1HR0 L;  4JI5 L;  4A3L G;  3PF5 A;  4JI1 L;  1VQ4 A;  4DV5 L;  1FJG L;  4DR7 L;  2BA0 A;  2KCM A;  4LFC L;  1PH4 A;  1N33 L;  1NTG A;  5IT9 c;  5IYB G;  1PH8 A;  2A8V A;  4YHH L;  4ME3 A;  4HIM A;  3BJU A;  1TWF H;  3OW2 A;  1QVF A;  4K0K L;  1E1T A;  3HOZ H;  3CCV A;  2K5H A;  1CKN A;  3KDF A;  3RZO H;  5GAH C;  2WAQ E;  3S2H H;  4BA2 I;  1GM5 A;  4JV5 Q;  3CC7 A;  3CP0 A;  1QVC A;  3J81 i;  1M90 C;  1HR0 Q;  4A3K G;  2HHH Q;  3AFQ A;  3CCL A;  3I4N G;  3K81 C;  5C44 H;  4DV3 Q;  1PHJ A;  2JEB I;  4OO1 G;  1SMX A;  1UEB A;  1L1O A;  3NEL A;  3WWV A;  4A75 A;  2FXQ A;  3F2D A;  1PYS B;  4HJ7 A;  4AYB E;  1LM0 A;  4DV1 Q;  3S17 H;  1VQE A;  2D0O A;  1V1Q A;  5JEA J;  1OXV A;  2JA8 G;  1VQL A;  1GVP A;  3KFU A;  2HIX A;  4X62 L;  1HH2 P;  2WAQ G;  3CCJ A;  1SRO A;  4DK3 C;  1VQK A;  4Y52 H;  3PO2 G;  2PNH A;  4DKA C;  2V1C C;  3PV0 A;  1J5E Q;  3LGJ A;  3M4Q A;  4H02 A;  4DAY B;  3M85 A;  1PH2 A;  3S2D H;  4IFD J;  1VQG A;  3I4M H;  2PMZ E;  3A74 A;  5HY6 A;  4X64 Q;  2VUM H;  1U0L A;  4UPA A;  3J7A 5;  3GTO H;  4HJ8 A;  5LMU L;  4JI8 Q;  2ZTE A;  4L5S A;  1HNZ Q;  3S15 H;  1PH7 A;  1OXT A;  1T9H A;  4BY1 G;  1S72 A;  4DR6 L;  3K7A H;  4YWL A;  1YEZ A;  4EQ5 A;  2BH8 A;  1QVG A;  3DM3 A;  3JC6 6;  3FKI H;  3RLN A;  4GNX B;  1TXY A;  2OQ0 A;  4P74 A;  3K80 C;  1KRT A;  2YU9 H;  1UE7 A;  1FVI A;  3I2Z A;  3HOX G;  1X55 A;  1X3G A;  2WFW A;  2R7F A;  4C3I H;  1NE3 A;  1XTD A;  2LXJ A;  2UUA Q;  4JI0 Q;  1XNR L;  3PO3 G;  3F1Z A;  2F52 A;  4YWM A;  2E2J H;  2K5V A;  4DAM A;  2JE6 I;  1CSP A;  4YCV A;  4X65 Q;  4YCU A;  4PG3 A;  1X3F A;  2D62 A;  4A3E G;  2NVQ H;  5DLQ E;  5HGQ A;  3UDG A;  1B7Y B;  1KD1 C;  4DV4 Q;  4JI4 Q;  1X9N A;  1YNX A;  4POG A;  2KHJ A;  3U4V A;  1HR0 W;  1QZH A;  3BZK A;  1N36 L;  1SRU A;  2UXC Q;  1Z9F A;  2K75 A;  5GAD C;  1SLJ A;  3VDY A;  1A0I A;  2QGQ A;  1KIX A;  1Q46 A;  1Y14 B;  2ID0 A;  2R93 H;  1HNX Q;  1GO3 E;  1AH9 A;  3GTQ H;  4A4I A;  3E0E A;  3GTJ H;  4A93 H;  2YTY A;  3CPF A;  4P75 A;  5C0X J;  4KLK A;  3PIP A;  1S40 A;  2KHI A;  2JA6 H;  3GTK H;  4OWW B;  4DR4 Q;  3K8A A;  1OXX K;  1H95 A;  1EUJ A;  3U50 C;  4JI7 L;  1VQP A;  3GO5 A;  1XNQ Q;  1X3E A;  2K50 A;  1RL2 A;  3FKI G;  2JA5 H;  3GTM H;  4HIK A;  3HOY H;  2VQF Q;  1XPU A;  2CCZ A;  2DUD A;  1CKO A;  3UE0 A;  2F3I A;  4QIW E;  5E7N A;  4LF7 L;  2UXD Q;  3FHW A;  4J15 A;  5C0X G;  4OO1 I;  1SR3 A;  4BBS G;  2IHE A;  1IBL Q;  4IOA A;  3ULJ A;  2L15 A;  4JV5 L;  2OWO A;  1PA6 A;  1AE2 A;  3GTP H;  4EX5 A;  2Z6K C;  4OWT B;  2B63 G;  3U58 A;  4XIG S;  2R93 G;  3NEN A;  1WOC A;  1R9T H;  2UU9 L;  2I5L X;  1O7I A;  1IL2 A;  3KJO A;  4MTN A;  2B63 H;  1JT8 A;  3J80 i;  4A3E H;  1IBM Q;  4JC0 A;  3K0X A;  2ZJR A;  2UUC Q;  2WB1 E;  1Z47 A;  4YCW A;  2ZTC A;  1Y1W H;  4JI3 Q;  3GTG H;  5IP9 G;  3HOV G;  1IXR A;  1Y1V G;  2GN5 A;  1PVO A;  1KRS A;  1YZ6 A;  2K14 A;  4HJ5 A;  2NVY H;  1M1K C;  4DR3 Q;  2Q2T A;  1Q1E A;  1WI5 A;  2R6G A;  2R7Z G;  4A3B G;  1C0A A;  4QQB X;  5IWA Q;  4R1J A;  3PO2 H;  1K8A C;  1WCM G;  1U5K A;  4C3H H;  2E5L Q;  4B3M L;  4O2D A;  1N32 L;  5IE8 A;  1N36 Q;  1W2B A;  4GKK L;  4BA1 I;  4TQU S;  1Y1V H;  3UDX A;  4IJH A;  3RNU A;  1MKH A;  1LUZ A;  1KC8 C;  5LMN W;  4IO9 A;  1W3S A;  5IYB H;  2LSS A;  1JJG A;  4NXN L;  3M4O H;  1B70 B;  4DV7 Q;  3F2C A;  3EBE A;  3UDF A;  3STB C;  3HOV H;  1LTL A;  1XMQ L;  5ELN A;  4X66 Q;  4UP8 A;  4GKK Q;  4LFB L;  2PI2 A;  3Q8D A;  4IPH A;  4X6A H;  5K36 G;  4DR2 L;  3KLW A;  3FP9 A;  4B3M Q;  1N32 Q;  1HZB A;  4JCV E;  5JEA G;  4GKJ Q;  5IYD H;  4DV1 L;  2C35 B;  4R4T A;  5IYD G;  3L2P A;  4LFA Q;  3HKS A;  2VQE Q;  3IRB A;  4LF8 L;  1TWG H;  4BBS H;  1BBW A;  4OX9 L;  1N34 L;  4P71 A;  2K5N A;  2IHF A;  2LXK A;  4LFB Q;  3UE1 A;  4IFD G;  3MEF A;  1K9M C;  4JI5 Q;  2NN6 I;  2YV5 A;  3RN5 A;  5FJ8 G;  1XMO Q;  2RF4 A;  5FLM H;  1Q82 C;  4DUZ Q;  1Q86 C;  1NBW A;  4BXX G;  1YJW A;  2YTV A;  1PH5 A;  2ATW A;  3PGZ A;  2B29 A;  2MNA A;  2VZA A;  3AFP A;  1K83 H;  3W5O A;  5FLM G;  2NVX H;  2GVB A;  1KHI A;  4POF A;  1E3P A;  1I50 H;  1YHQ A;  1CSQ A;  1BBU A;  5IY0 A;  4ALP A;  2Z6K A;  4DUZ L;  1KQS A;  4LF7 Q;  4R4C A;  3RLO A;  2I0Q A;  2UXD L;  1G29 1;  3D31 A;  4JBW A;  4DV3 L;  5BR8 L;  2UUA L;  1GKH A;  5C3E G;  3T1Y Q;  2BA1 A;  1TWC H;  5GAG C;  4DR5 Q;  4KHP Q;  4IPG A;  2NZH A;  1VQ9 A;  3JAM c;  3I4N H;  3G48 A;  4DPG A;  4O0A A;  2ASB A;  4LW1 A;  2HT1 A;  4JOI C;  5M5W H;  1N33 Q;  1D8L A;  1UWV A;  2H5X A;  3HOU H;  4DV5 Q;  1FJG Q;  5C4X G;  2AWN A;  4FDB A;  3J7Z C;  2UUC L;  3T1Y L;  5BR8 Q;  3S1Q H;  4WJ4 A;  4HJ9 A;  1ASZ A;  2CWP A;  4X64 L;  1OXU A;  2VW9 A;  4DR4 L;  3CF5 A;  1VQ6 A;  3CCE A;  1PH3 A;  4NPS A;  4C2M H;  2EQS A;  2XGT A;  4GS3 A;  4R4I A;  3HOY G;  1Q8K A;  1SE8 A;  4PZ6 A;  2MQH A;  2UXB L;  4A3D G;  3PUY A;  4YY3 L;  2HHH L;  5IYC H;  3J80 c;  1VQB A;  4B3R L;  4DUY Q;  4IOC A;  2R92 G;  3S1N H;  1JMC A;  2VL6 A;  4DK6 C;  2N3S A;  5GQO A;  2E5L L;  1IBL L;  3U4Z A;  2JK8 A;  1A63 A;  2A19 A;  1K8G A;  1I6H H;  4GLV B;  2NVT H;  2IX0 A;  4BY7 G;  2VNU D;  2E2H H;  2JJQ A;  1E1O A;  4B3T L;  3KDF B;  5GAE C;  4JI6 L;  1IBK Q;  1L0W A;  2F4V Q;  3EN2 A;  2B3G A;  4AIM A;  4JI4 L;  3ICE A;  2R7D A;  1VQI A;  1WFQ A;  3B6Y A;  2JQO A;  1G6P A;  1I5F A;  4QGU A;  3PO3 H;  4P72 A;  2VY3 A;  3G6E A;  4QL5 A;  2VQE L;  4LFA L;  3S14 H;  2EXD A;  2MO1 A;  1BKB A;  3GD7 A;  2QA4 A;  4DR6 Q;  1N8R C;  2PQA B;  4P73 A;  4UY8 C;  4GOP B;  3CCS A;  2MO0 A;  1UE1 A;  1KXL A;  5AJ3 Q;  3PSI A;  2F4V L;  2AWO A;  3G4S A;  1IBK L;  4WJ3 M;  4A3D H;  2JA5 G;  4HJA A;  2EIF A;  1S3O A;  4QY7 A;  4NXM Q;  2RHS B;  4HIO A;  2AHO B;  2YTX A;  2XTI A;  3AYH B;  2ZJP A;  4LF6 Q;  5ELO A;  3HKZ E;  1JE5 A;  1QUQ A;  3PUX A;  1VQ7 A;  5C4J H;  1WJJ A;  2E2I H;  1C7Y A;  3H15 A;  4A3M G;  1WYD A;  3T1H L;  3I7F A;  2OTL A;  3I4M G;  1CUK A;  1VS0 A;  3NEM A;  2KBN A;  1JJ2 A;  5M3M H;  3RN2 A;  4A3I G;  4DV6 Q;  1VQ8 A;  1D7Q A;  1HNX L;  4LF6 L;  3S1R H;  1A62 A;  4LUV A;  4AH6 A;  3TS2 A;  3M4P A;  4JI1 Q;  4DR7 Q;  4AYB G;  3W1G A;  3AEV A;  4JI3 L;  3HOW H;  3T1H Q;  5GRO A;  1K3R A;  1NMF A;  2WB1 G;  4UP7 A;  4A3J H;  1Y1W G;  1EIY B;  4IFD I;  1IZ6 A;  5J3B A;  1PH6 A;  5JJI A;  2UUB Q;  1VQJ A;  3TRE A;  2BH2 A;  1PFS A;  2JA7 H;  4K0K Q;  3HFZ B;  3L0O A;  1CKM A;  2N8N A;  4DV6 L;  4DR1 L;  3S24 A;  3E9I A;  3L7Z C;  3DLL A;  1XNR Q;  3H3V H;  1GD7 A;  1X6O A;  1E7Z A;  4BY1 H;  3HOZ G;  2I5H A;  1N9W A;  4LUZ A;  1JB7 A;  1PH9 A;  4YWK A;  3UDI A;  4IPC A;  1LYL A;  4JBJ A;  5LMN Q;  1VQM A;  4NXN Q;  4APV A;  4LF9 L;  3H0G H;  2UUB L;  2ALY B;  1L1O B;  4JOI A;  4HID A;  2UU9 Q;  1B8A A;  1QZG A;  4DNI A;  3CPW A;  3KF8 B;  1XPO A;  3KF6 A;  4A3K H;  1TWA H;  1OXS C;  3M3Y H;  4DUY L;  1YVC A;  4JBM A;  3CMA A;  1FL0 A;  2JA8 H;  4DV0 L;  3BZC A;  1J5E L;  1DGS A;  4GOP A;  4A93 G;  2E8G A;  5JJK A; 
#chains in the Genus database with same CATH topology
 3A5Z B;  3KJP A;  1HRJ A;  3PF4 A;  1UNS A;  3CCQ A;  1E0B A;  3V2T A;  1EY4 A;  4JI8 L;  5IYC G;  1UE5 A;  3DWQ A;  1KAB A;  1LTR D;  2AMC B;  4IJL A;  2G9H D;  3NSW A;  4LF5 L;  5EPL A;  3PUW A;  2RCN A;  4LK1 C;  3A8K E;  1YJN A;  2X69 A;  2R92 B;  1HNW L;  2L5T A;  3E6Z X;  4IN3 A;  1QE6 A;  4JI2 L;  4DV4 L;  3N6R A;  5KNB A;  3OYY A;  3K5N A;  4RGO S;  1EY0 A;  1PZI D;  1STN A;  5IOD A;  2MP1 A;  1PFB A;  1P8L A;  2P5Z X;  2KHS A;  1YJ9 A;  1Q1B A;  2IJ0 A;  2I5M X;  4RCN A;  1M8A A;  5FO9 B;  3RLF A;  3HOX H;  4GNX C;  2WII B;  1EWC A;  4MNO A;  3U9S A;  5M3M B;  4S3S A;  5CGK A;  1YIT A;  5CR3 A;  2ZXP A;  2R7Z B;  4R4O A;  2DGY A;  3I73 A;  2K28 A;  1JJC B;  1G51 A;  5J1Z A;  3M7N A;  1F2Z A;  3TEH B;  1X56 A;  3PCO B;  1OTC A;  2RQX A;  3P1H A;  3H3V C;  4G7Z C;  1EY6 A;  1BVS A;  4RG1 A;  3HZX A;  4DAP A;  1PRT C;  4B9W A;  1MSG A;  2D5D A;  4A3I B;  1WTW A;  3VYU A;  1SNO A;  1STY A;  1TWH H;  1QWY A;  2A1A A;  2XVS A;  4K5X A;  2QF7 A;  3T53 B;  4YHH Q;  2WAC A;  1SYC A;  4KHP L;  5IP7 G;  3NUC A;  4A3G G;  2CQA A;  1YHB A;  2Z0S A;  3GTG B;  3DEO A;  1SNC A;  2EYF A;  2MUY A;  1VQD A;  5DNF A;  1TR5 A;  4J1M A;  2NTT A;  2ICE C;  1PTO D;  1STA A;  2FJ2 A;  4KN7 C;  1LT4 D;  4WOR A;  4KD4 A;  3T13 A;  3STB D;  1VMC A;  4DV7 L;  1XMQ Q;  5G3L F;  4IPD A;  5EAY A;  2VXW A;  3ER0 A;  4A3B H;  3NP8 A;  4GNX A;  3CD6 A;  5C3E B;  5IP9 H;  3KYH C;  3HOV H;  1VQA A;  2D2C C;  2FMM A;  2QDL A;  3JAM i;  1HZC A;  1RF2 D;  5ELC A;  2Y0S B;  2CH4 W;  3ULP A;  3H3V I;  5IWA L;  1RJT A;  2KCC A;  1CT1 D;  2ZJQ A;  1XMO L;  3LNN A;  1AN8 A;  4WJW A;  4PV1 C;  4ILW A;  3JAM L;  4C3J H;  1NMG A;  3CXC A;  1KL9 A;  4Y7N B;  2Z1C A;  4NXM L;  1PTO F;  5I9P A;  4V0B A;  2B2V C;  4PMW A;  5M5X H;  2EYO A;  3BDL A;  1K0S A;  2O5I C;  2F0Q A;  2RDG A;  4LNQ A;  1VQN A;  2KCT A;  4A3M H;  3NPP A;  4AQY Q;  1Q3L A;  2OCE A;  2RHQ B;  1QCB D;  4OWX B;  1HR0 L;  3D3R A;  4A3L G;  4DV5 L;  1FJG L;  4DNT B;  3FPU B;  5CBE E;  4JVZ A;  5IT9 c;  4YHH L;  1II3 A;  2RDH A;  2AUK A;  3CCV A;  4FF2 A;  2E76 C;  2K5H A;  3RZO H;  3S2H H;  4G4K A;  4BA2 I;  2K03 A;  1K8M A;  4XT3 B;  1WTX A;  3H09 A;  4MIU A;  2F0J A;  2PYK A;  3HG9 A;  3P20 A;  4OO1 G;  1L1O A;  1X32 A;  2FXQ A;  1PYS B;  4AYB E;  1HHV A;  4QUF A;  1V1Q A;  1OXV A;  2NYZ D;  3MVV A;  1SYB A;  4X62 L;  1HH2 P;  1KNE A;  1DOM A;  4Y52 H;  3DHQ A;  1J5E Q;  4ULL A;  3M4Q A;  4DAY B;  3OW7 A;  4IFD J;  1PTO H;  4BS9 A;  3J7A 5;  3GTO H;  2VUM B;  5LMU L;  1PH7 A;  1O80 A;  3KF8 A;  3A8J E;  3BDC A;  2RDF A;  4YWL A;  2PNR C;  1Y8P B;  2BH8 A;  5M5W B;  4GNX B;  1TXY A;  1KRT A;  2WAQ B;  1EZ8 A;  3RZO B;  2SEB D;  1O78 A;  3QG1 A;  3GQB A;  5C5M A;  3OWF A;  3K7A B;  4X65 Q;  1X3F A;  2F4I A;  1SAP A;  5DLQ E;  2XWB B;  1B7Y B;  5HGQ A;  4BBS B;  3NBI A;  4POG A;  3CQZ B;  2EVB A;  1N36 L;  2UXC Q;  1Z9F A;  5DEH A;  5GAD C;  2QGQ A;  1Q46 A;  2ID0 A;  2R93 H;  4ZQ3 A;  3GTJ H;  3CPF A;  2JA6 H;  1E2W A;  4KLK A;  3PIP A;  2KQ3 A;  4OWW B;  1OXX K;  1H9M A;  4JI7 L;  2SDF A;  4KJO A;  1EIH A;  3GO5 A;  1YNN C;  2K50 A;  1RL2 A;  1T5X D;  4HIK A;  2X6L A;  2VQF Q;  3T51 B;  3U9O A;  1XPU A;  1CKO A;  3UE0 A;  5E7N A;  4QIW E;  5DM7 3;  1SYF A;  1TWG B;  4N9P A;  4IOA A;  1MD2 D;  1PTO C;  1CZG A;  4C3H G;  3U58 A;  1WOC A;  2ZXO A;  4EQO A;  1GHK A;  1OO9 B;  2I5L X;  3K0Y A;  3C3L A;  3EJI A;  3TSS A;  3KJO A;  2B2W C;  1X3P A;  2LKV A;  4JC0 A;  1IBM Q;  4OHJ A;  4YCW A;  3PIP 3;  3GTG H;  3GTL B;  1DZ1 A;  1PRT F;  3EQL C;  1Y1V G;  2GN5 A;  4HJ5 A;  2Q2T A;  1AEX A;  1WI5 A;  1LV9 A;  1U5K A;  1N32 L;  5IE8 A;  4GKK L;  1TWH B;  4BA1 I;  4TQU S;  1Y1V H;  3RNU A;  1MKH A;  1KC8 C;  2XRS D;  4QIW B;  3GP7 A;  1PLF A;  1DJR D;  5E3F A;  4H0L C;  4DV7 Q;  4K2K A;  3EBE A;  1HFG A;  1SEB D;  1LTL A;  5ELN A;  5EKI A;  4X6A H;  3NTK A;  5K36 G;  1AZQ A;  3FP9 A;  4B3M Q;  1HZB A;  5JEA G;  2C35 B;  5EBD A;  2Q8I B;  1RTN A;  3HKS A;  3L3O C;  5NUC A;  4LF8 L;  2MHV A;  1BBW A;  4OX9 L;  5JVH 3;  1N34 L;  4LFB Q;  2CW0 D;  1X3Q A;  1S5C D;  3MEF A;  5T1G A;  2YV5 A;  3AMU A;  5FLM H;  2KED A;  1XX8 A;  3RZD B;  3OMC A;  1I6H B;  2ATW A;  3AFP A;  4X3T A;  1LTT D;  2A73 B;  3W5O A;  4HN7 A;  2GVB A;  5CV8 A;  3J80 E;  3WDN A;  3P7J A;  3FMC A;  1CSQ A;  3J7Y W;  1SJH D;  2SNS A;  1KQS A;  4LF7 Q;  4R4C A;  2I0Q A;  1CHQ D;  2Z8L A;  2UUA L;  1EY5 A;  1TS5 A;  3S16 B;  4ZKB B;  4DR5 Q;  3JAM c;  1BNZ A;  2F0I A;  2EJM A;  2EE1 A;  4LW1 A;  2F0F A;  4JOI C;  3DM1 A;  2A6E C;  1D8L A;  4XDX A;  3HOU H;  4DV5 Q;  1FJG Q;  2AWN A;  4FDB A;  3J7Z C;  2UUC L;  3T1Y L;  5C44 B;  2CWP A;  4X64 L;  4DR4 L;  2LS0 1;  4TRD A;  4NPS A;  3HOY G;  1Q8K A;  2UXB L;  3MWY W;  4A3D G;  1U4L A;  5IYC H;  4ZAI A;  2R92 G;  1MGS A;  1CA6 A;  3S1N H;  1HUM A;  1GUS A;  2N3S A;  2E5L L;  2EY1 A;  1CZW A;  4OEL B;  1ET6 A;  2EJG C;  1MI2 A;  2XN9 C;  4K6L A;  5I6W A;  1B4O A;  2JJQ A;  5C4H A;  4EQP A;  1KDA A;  1KLG D;  5TSS A;  1Q8I A;  3HOW B;  4JI4 L;  2R7D A;  1V8Q A;  4QB4 A;  4NKL A;  4P72 A;  4QL5 A;  2MO1 A;  4GOP B;  4K8J A;  2KA7 A;  3PSI A;  4DK0 A;  4A3D H;  2EIF A;  3MXG A;  4KN4 C;  4NXM Q;  1G6Z A;  1XWE A;  2VB3 X;  2XTI A;  3NQT A;  4LF6 Q;  2NVQ B;  1WJJ A;  2N55 A;  2L4N A;  1EYC A;  1H9J A;  1VS0 A;  2B8F A;  4ODG A;  4CHT B;  2KBN A;  3VR4 A;  4A3I G;  3MFY A;  4LF6 L;  3M4P A;  4JI1 Q;  1I4P A;  1UUP A;  3W1G A;  2NVT B;  4G7O C;  4JI3 L;  3HOW H;  5GRO A;  1NMF A;  1K3R A;  1BQQ T;  4A3J H;  1EIY B;  1IKM A;  5J3B A;  3GTM B;  4UHV A;  1SFO B;  2Z4I A;  4LMQ D;  3TRE A;  3L0O A;  1V1P A;  3L7Z C;  4B08 A;  1EU4 A;  2K5W A;  1X6O A;  3HOZ G;  1ONL A;  1ESF A;  1JWS D;  1RKN A;  3VR3 A;  2JN4 A;  1GUT A;  1TS2 A;  1DYQ A;  3D4W A;  2H4O A;  5LMN Q;  1ILQ A;  3PO3 B;  4NXN Q;  1H9K A;  3H0G H;  2ALY B;  1SJE D;  2EYL A;  4HID A;  2UU9 Q;  4RH6 A;  1JOK A;  3KF6 A;  3M3Y H;  1YVC A;  1JOR A;  4K8I A;  2NVY B;  2VW9 A;  5CC4 A;  4LF5 Q;  2JEA I;  1I94 Q;  1ZXT A;  3S16 H;  2NBF A;  4DAY A;  1KAW A;  4GLA C;  1EOV A;  5DM6 3;  2KEC A;  3KBX A;  3AQQ A;  3E9H A;  5ELE A;  3BU2 A;  1XNR Q;  2EXZ A;  2Y0S E;  4DV2 L;  2N49 A;  3F2B A;  2DNC A;  4A3F G;  1HJP A;  3KLS X;  2EYM A;  1I94 L;  4YY3 Q;  4A3L H;  3KF6 B;  3MXN B;  4O1N A;  4KKT A;  2CKZ B;  2V4D A;  3I91 A;  3D0F A;  5C0X I;  5M3F B;  2EYJ A;  4A3F H;  3PUZ A;  3SK6 A;  1EIF A;  1Y1V B;  4L63 B;  2YYZ A;  1RDP D;  2E74 C;  3H91 A;  4LF8 Q;  4OIK A;  4RGN A;  2F0P A;  1GOZ A;  3IFT A;  2WP8 J;  4JI2 Q;  2RA4 A;  1DON A;  1VQC A;  4GLX A;  1Q12 A;  1D6E C;  2O5J C;  4N8X 1;  1J8I A;  1PYW D;  5KND A;  2A5H A;  3FPP A;  4KY7 A;  3TQY A;  5KIX A;  3MXN A;  1RTO A;  2PI2 E;  4GN3 B;  4LWC A;  3NBH A;  3S1Q B;  2OTJ A;  5J39 A;  3S1M H;  2C9O A;  4A3I H;  1WVL A;  3ONA B;  1UAP A;  3R2T A;  5I4D A;  4DR3 L;  1V1P B;  4DR5 L;  4A3E B;  1XJV A;  1HNZ L;  1KDC A;  5FLX c;  1O7L A;  4LF4 L;  2ZM6 Q;  1YIJ A;  1NY4 A;  4JI0 L;  2G9D A;  3K6O A;  2HDL A;  3RR5 A;  2IX1 A;  3HOX B;  1EWI A;  3SGI A;  2JA7 G;  1EY7 A;  1IBM L;  5CYU A;  1SE2 A;  4A3G B;  2B2Y C;  4OIJ A;  2K52 A;  1CQF A;  1F2Y A;  1SNM A;  3M9B A;  1SE4 A;  5C4X H;  4OX9 Q;  1F9P A;  3GDE A;  1WCM H;  2D0P A;  5JPN C;  2L9H A;  4DV0 Q;  4XQN A;  1UE6 A;  2JA9 A;  1MHW C;  2VQF L;  2PZT A;  1SYD A;  4PMC A;  5C4X B;  2IX3 A;  4RMF A;  5C0X H;  1AW7 A;  4L5Q A;  4NMZ A;  1FR3 A;  3T4A C;  4HR7 B;  4JG2 A;  1LT3 D;  5M3F H;  4L8J A;  1JR0 D;  1XPR A;  4XQJ A;  4HSP A;  1SE3 A;  4XTC S;  3TP6 A;  5KGU A;  3BZD B;  1RCV D;  2VB2 X;  1SN8 A;  2XIW A;  4RAU C;  2NN6 G;  5KNC A;  3CW2 C;  1F9R A;  2X6G A;  3CAM A;  1WD0 A;  4BY7 B;  2EY5 A;  3MXP A;  1VQ4 A;  1U9R A;  4DR7 L;  4LFC L;  1HCZ A;  1NTG A;  4FF1 A;  2TMP A;  2CH4 A;  3PMF A;  4QF4 A;  4HIM A;  4K0K L;  3HOZ H;  1B44 D;  5ELB A;  3KDF A;  4LAA A;  5GAH C;  2WAQ E;  3CP0 A;  3CCL A;  1CA5 A;  3I4L A;  3K81 C;  3TME A;  2JEB I;  1PHJ A;  3KUP A;  1UEA B;  4DV1 Q;  4C3I G;  1QG7 A;  1VF7 A;  2WAQ G;  3PO2 G;  4OEM B;  2PZU A;  1U4P A;  3LGJ A;  3GTQ B;  1WD1 A;  4DXF A;  2A69 D;  2PMZ E;  5HY6 A;  4UPA A;  1TQO A;  3J7A F;  4L5S A;  2ZTE A;  3PQI A;  1T9H A;  3MEH A;  2E2J B;  1WTP A;  1S72 A;  4DR6 L;  2EJF C;  1QVG A;  3FKI H;  3RLN A;  1EY9 A;  4DXG A;  1UE7 A;  5E4W C;  3CKI B;  1X3G A;  2R3Z A;  4C3I H;  1TWC B;  1DOK A;  1NE3 A;  4JI0 Q;  3PO3 G;  1XNR L;  4M1U B;  5ELF A;  2E2J H;  2B2V A;  2AUJ D;  1CSP A;  4A3E G;  4XYO A;  4YCU A;  2RVL A;  4PG3 A;  4FXK C;  3UDG A;  1EWH A;  4HTH A;  3SK5 A;  1YNX A;  2KHJ A;  4XT1 B;  1B9N A;  5KEE A;  3N52 A;  4FVM A;  4FXD A;  1H9R A;  1D5X C;  1A0I A;  5LL6 X;  1GO3 E;  2PPB C;  3GTQ H;  2XSC A;  2RCF A;  5C0X J;  2DY8 A;  4P75 A;  1G8Z D;  5JOB A;  1H95 A;  3U50 C;  3FKI G;  3C46 A;  1KNA A;  2DUD A;  2K32 A;  2F0W A;  2XRQ D;  3FHW A;  4OO1 I;  3OOC A;  4A3B B;  3GV3 A;  4DA2 A;  1IBL Q;  1ESR A;  1AE2 A;  1PRT B;  3E3X A;  1A3V A;  4EX5 A;  1R9T H;  2UU9 L;  3IFD A;  1PRT D;  1Y8O B;  4ABN A;  3Q22 A;  1KTK A;  4JI3 Q;  1Y1W H;  5IP9 G;  3HOV G;  2Z6B A;  1F9S A;  1S5F D;  4CDF C;  4ZLT F;  1G2T A;  1KRS A;  1YZ6 A;  2K14 A;  5JJK A;  1Q1E A;  2GA4 B;  5IOC A;  4C3H B;  2OF1 A;  1TY2 A;  4TSS A;  2Z4H A;  2LSS A;  1IL8 A;  1SYG A;  1JJG A;  2CVR A;  2PO4 A;  4WRD A;  1EQV A;  2I07 B;  1S5D D;  3STB C;  1GJX A;  4F87 A;  3BG3 A;  4ZUI A;  3R3O A;  4IPH A;  1HXY D;  1AP0 A;  4C56 C;  5FOB B;  4FXG C;  5IYD G;  1WCM B;  5A2Q E;  4X3K A;  1WTO A;  1EFI D;  2PCF B;  3IRB A;  1TY0 A;  4HMJ A;  2HD3 A;  2K5N A;  3UE1 A;  1TII D;  4AYB B;  2NZ1 D;  1XMO Q;  3MC0 B;  4DUZ Q;  4BXX G;  1YJW A;  2B29 A;  4A93 B;  3TP5 A;  3HRZ C;  3HP3 A;  5HUR A;  4V19 0;  3R93 A;  4F7X A;  4TKO B;  5IY0 A;  4DUZ L;  1KLU D;  2UXD L;  2PZW A;  4JBW A;  3BVZ A;  1PTO B;  2BA1 A;  1TWC H;  3A56 A;  3D8G A;  4KHP Q;  4IPG A;  4RCO A;  1VQ9 A;  4BBR B;  3I4N H;  3G48 A;  2ASB A;  4O0A A;  3UI2 A;  2HT1 A;  4X3U A;  1N33 Q;  1JOQ A;  1UWV A;  5BN4 A;  3AB9 A;  3S1Q H;  4WJ4 A;  3SXH A;  3A55 A;  4M8A A;  3DUZ A;  5L37 A;  3CCE A;  1A2U A;  4C2M H;  4R4I A;  4PZ6 A;  3VR6 A;  2HHH L;  1EU3 A;  3J80 c;  2KVM A;  4GZY C;  1VQB A;  1JMC A;  2NVX B;  2VL6 A;  3NWS A;  1IBL L;  3LX0 A;  1A63 A;  2H1E A;  1I6H H;  4GLV B;  2NTS A;  3WOF A;  4BY7 G;  2VNU D;  5GAE C;  2NN6 H;  3JAM E;  1WFQ A;  3B6Y A;  2JQO A;  1G6P A;  3OPO A;  1ZYR D;  3SK8 A;  2VY3 A;  3IL8 A;  2VQE L;  4LFA L;  3QOJ A;  3R8B A;  2EXD A;  5COR A;  4DR6 Q;  4DN4 M;  3J81 L;  5FO7 B;  5CBA E;  1HQM C;  2MO0 A;  1UE1 A;  3A7L A;  4XYQ A;  3TN2 A;  3M3Y B;  1D1K A;  1ROD A;  3G4S A;  3Q24 A;  2B2U A;  4RGM A;  2WB1 B;  2RHS B;  1NUC A;  3K5M A;  5JPM C;  2ZJP A;  4FP5 D;  2YTX A;  5ELO A;  1VQ7 A;  1JE5 A;  4ZYS A;  3Q0A A;  2E2I H;  1B53 A;  1C7Y A;  4A3M G;  2M00 A;  5K36 H;  2R61 A;  3RN2 A;  1VQ8 A;  1O7Y A;  1D7Q A;  4IUU A;  1JCK B;  1BBX C;  4LUV A;  3TS2 A;  4KHV A;  1Q90 A;  3AEV A;  1HTP A;  2E2H B;  1ENC A;  1Y1W G;  1IZ6 A;  1PH6 A;  3T16 A;  1VQJ A;  2BH2 A;  2K04 A;  2JA7 H;  4K0K Q;  2N8N A;  4HMI A;  4DV6 L;  3S24 A;  1YNN D;  1KAA A;  3E9I A;  4R9W A;  1E7Z A;  4PNY A;  2BE5 D;  4YWK A;  2RKS A;  3ERO A;  4P2C B;  3SR1 A;  1LYL A;  4JBJ A;  1NCV A;  4APV A;  1B8A A;  3KF8 B;  1TWA H;  3X3M A;  3NXW A;  3CMA A;  2JA8 H;  3BYT B;  1EOT A;  1DGS A;  3O13 A;  4CDD C;  4A93 G;  4J8Q A;  3I55 A;  4Y7N H;  1TU2 B;  5M3F G;  2Q2I A;  4YIJ A;  2IT1 A;  5C44 G;  1E24 A;  4MZ9 A;  5A35 A;  3P75 A;  2AQ1 B;  4DNR B;  2IL8 A;  4F88 A;  3EIV A;  4LF9 L;  4TVA B;  1SBB B;  4PZ8 A;  5CV5 A;  1E2V A;  3DMU A;  2KEN A;  1SND A;  3I56 A;  1AZP A;  3C1F A;  4O42 A;  3ITP A;  2UXB Q;  1CKN B;  2OEO A;  4X65 L;  3SK4 A;  1EEI D;  4LFC Q;  4GN5 A;  2F0O A;  3CME A;  3D6W A;  4IQZ A;  1ENF A;  2ICI A;  3HOW G;  4A3C H;  2B2T A;  1FD7 D;  2K05 A;  4JI6 Q;  4JYA L;  3S2H B;  3ULL A;  1A15 A;  4R8I A;  3QWN A;  1A6X A;  5EPJ A;  4LUO A;  3TS0 A;  1WTH A;  5LL6 S;  2E2I B;  3NTI A;  3ERQ A;  2ZT9 C;  3GTL H;  4JYA Q;  1QNU A;  2WIN B;  1QUQ B;  4RHS A;  2VUM G;  1VQH A;  4G57 A;  1V9P A;  1SXT A;  4KI0 A;  2GVA A;  2EZV A;  1ZEQ X;  2L12 A;  2YU9 B;  1X65 A;  4C3I B;  3QOL A;  3DWA A;  4B3S L;  4UP9 A;  4LF4 Q;  2QKI C;  2VS1 A;  4CGY B;  1IW7 C;  1PH1 A;  2HQL A;  2QEX A;  5JAV A;  4NP5 A;  2EOT A;  4QJF A;  1V1O A;  2A74 C;  3A8I E;  5ISR A;  4RKB A;  1I3Q H;  1D2B A;  3CQZ H;  3CC4 A;  1XYI A;  3E0J A;  4KHZ A;  1VCI A;  2CFM A;  1A3T A;  2JSO A;  1R9T B;  1EL0 A;  1LTA D;  5FKA C;  3I4M B;  3OTO Q;  4JBK A;  1MJC A;  1X54 A;  3OMG A;  3PIO 3;  4B3S Q;  5JJL A;  1K0R A;  1GHJ A;  4PZ7 A;  4OXP A;  4DR1 Q;  2E2D C;  4GOP C;  3NTH A;  1ASY A;  4A3G H;  4XXE A;  2OQK A;  1YI2 A;  1GUN A;  3RZD H;  3M4Y A;  4RGT A;  3HKZ G;  2HUG A;  5LMU Q;  1VQ5 A;  3GTK B;  5I9O A;  5M5Y H;  3HOU G;  3A0J A;  2B2Y A;  2SNM A;  4BBR G;  1VQO A;  3KLR A;  1TWF B;  1H9S A;  4CKB A;  3VR5 A;  2MFI A;  1HZ9 A;  3A5U A;  3PUV A;  3J80 L;  5D3I B;  4NB3 A;  2C5C A;  2CHB D;  3W2D A;  4B9X A;  2Q2H A;  1B1Z A;  2MGS A;  1TKW B;  1IYJ B;  5FJ8 H;  2BDO A;  1EFW A;  3VA7 A;  3HOY B;  2JP1 A;  2Q8T A;  2G5D A;  3K7U C;  2RBM A;  2K1B A;  5K5P A;  2QW7 A;  2K4K A;  2J0T D;  1PZJ D;  1B50 A;  3OTO L;  3PIO A;  2IW3 A;  2Q2U A;  1GUO A;  1T5E A;  2A68 C;  2R92 H;  2ZTD A;  3J81 j;  3MAQ A;  5LMN L;  3ERS X;  4GN4 B;  1XNQ L;  1AE3 A;  1PYB A;  3S15 B;  4JI5 L;  4MHE A;  2F3V A;  2BA0 A;  2KCM A;  1I50 B;  1R4P B;  2BDN A;  5J22 A;  5EJW A;  1CK1 A;  4ZUJ A;  1PH8 A;  2A8V A;  1QVF A;  1TWF H;  1E1T A;  1FNU A;  1CKN A;  3CC7 A;  3G7L A;  1M90 C;  1HR0 Q;  1BCP D;  4A3K G;  4DV3 Q;  4IFD H;  1SMX A;  2KEE A;  2QIL A;  1S5E D;  2SOB A;  3WWV A;  3F2D A;  4A75 A;  1LM0 A;  1VQE A;  2D0O A;  5JVG 3;  2JA8 G;  1VQL A;  1SRO A;  4DK3 C;  1VQK A;  3OIP A;  4DKA C;  4JPB W;  1CM9 A;  5D65 A;  2F3W A;  3M85 A;  2PW7 A;  4C2M B;  5C4Z A;  4CJ1 B;  1VQG A;  3I4M H;  3A74 A;  1U0L A;  2F0U A;  3I70 A;  4ZKC B;  3M7G A;  4HJ8 A;  3S15 H;  5M9O A;  1B3A A;  1HNZ Q;  4U67 3;  1AFP A;  2F0T A;  4BY1 G;  5KYL A;  3BVG A;  3K7A H;  2L0C A;  1YEZ A;  3A7A B;  4IUN A;  3VR2 A;  5CV4 A;  4EQ5 A;  3VYR A;  5CMD A;  2RSO A;  3JC6 6;  3RUZ A;  3S1R B;  3GTP B;  3K80 C;  2YU9 H;  4KJN A;  3TP8 A;  1FVI A;  3HOX G;  1IKL A;  2WFW A;  4CDC C;  5IGG A;  2F0S A;  1S4Z A;  1XTD A;  3KBG A;  4ME5 A;  2K5V A;  4R8N A;  3RMH A;  1KD1 C;  5C4J B;  1LTB D;  4DV4 Q;  2F0D A;  1X9N A;  1WTR A;  4Q0F A;  1QZH A;  5FLX L;  4FNF A;  2K75 A;  3W3A A;  1PFM A;  1F2M A;  1Y14 B;  1AH9 A;  1HQR D;  4A4I A;  4A93 H;  2B39 A;  2YTY A;  2F0M A;  3GTK H;  4DR4 Q;  3K8A A;  5M5Y B;  1EUJ A;  1VQP A;  1ILP A;  1XNQ Q;  3HOY H;  1X3E A;  2JA5 H;  2EDG A;  3GTM H;  2L11 A;  3AU7 A;  4UAI A;  2F3I A;  3DEP A;  5BN3 A;  4J15 A;  5C0X G;  1SR3 A;  3EVQ A;  1R4Q B;  3HOU B;  2JA6 B;  3ULJ A;  1G2S A;  2L15 A;  4JV5 L;  1PA6 A;  3GTP H;  2R93 G;  2Z6K C;  3GV6 A;  4OWT B;  4OGQ C;  2F1M A;  1F2L A;  1IL2 A;  3DWP A;  1J9O A;  2B63 H;  1PDQ A;  3J80 i;  4A3E H;  3K57 A;  2UUC Q;  1ZYR C;  2WB1 E;  4U68 A;  1STB A;  2MPM A;  1I3Q B;  2L55 A;  1PVO A;  1M1K C;  4A3B G;  2NVY H;  4DR3 Q;  2R6G A;  2R7Z G;  5IWA Q;  2M9V A;  4R1J A;  3PO2 H;  1K83 B;  1K8A C;  1WCM G;  3BDO A;  4C3H H;  2E5L Q;  4O2D A;  1W2B A;  3KLS A;  2K6A A;  3MTS A;  3ND8 A;  1TWA B;  5LMN W;  1W3S A;  4CKC A;  5IYB H;  1BCP F;  4NXN L;  3M4O H;  1B70 B;  1HTL D;  2MJ8 A;  1BCP C;  1U4R A;  3UDF A;  4CDE C;  1XMQ L;  1L0X B;  2PI2 A;  3Q8D A;  4DR2 L;  3KLW A;  4GKJ Q;  3MFG A;  2RSN A;  4R4T A;  5I2X A;  1ML0 D;  1K8O A;  2QDB A;  4LFA Q;  2VQE Q;  1PFN A;  4KKS A;  4P71 A;  4PMB A;  2LXK A;  2FMC A;  1K9M C;  5HGT A;  1QIL A;  3RN5 A;  5FJ8 G;  1S5B D;  1Q82 C;  4DU9 A;  1JWM D;  2A6H C;  1ET9 A;  1PH5 A;  5C6A A;  3PGZ A;  2VZA A;  1K83 H;  4IUQ A;  1KHI A;  2IPK D;  3TBI B;  1E3P A;  4POF A;  5F2D A;  1BBU A;  5EBC A;  4ALP A;  2A6E D;  3BYY B;  3HKZ B;  3ND9 A;  4HAE A;  3RLO A;  3S9W A;  3VYT A;  3M4O B;  1G29 1;  3D31 A;  5E4X A;  3K59 A;  4DV3 L;  4I7Z C;  3VYS A;  3HS0 C;  1QB5 D;  5GAG C;  4OO1 H;  2NZH A;  4RA8 A;  3NWT A;  3FKI B;  5M5X B;  1I4G A;  3WOE A;  1SYE A;  5BR8 Q;  2BCO A;  4HJ9 A;  1ASZ A;  1OXU A;  3QJY A;  1VQ6 A;  1PH3 A;  3NQI A;  1BXT A;  1EIG A;  1A3U A;  1NSN S;  4GS3 A;  2DJF C;  2MQH A;  2B63 B;  1TS4 A;  1VMP A;  4B3R L;  4DUY Q;  5EPK A;  4IOC A;  1DOL A;  4DK6 C;  5GQO A;  4UDU C;  1STH A;  3V05 A;  2JK8 A;  2FHT A;  2FIN B;  2NVT H;  3TZD A;  4B3T L;  3HOV B;  2PMZ B;  3KDF B;  4CKE A;  1IBK Q;  1ZKO A;  2F4V Q;  2B3G A;  5IGD A;  1VQI A;  1XXG A;  1CTM A;  3TP7 A;  4JK1 C;  1BKB A;  3GD7 A;  2DJG C;  1Y8N B;  4C1N K;  2PQA B;  1N8R C;  3CCS A;  4A3K B;  4IUR A;  5AJ3 Q;  4H44 C;  4RFB A;  2AWO A;  2ZXR A;  4WJ3 M;  1WTV A;  2JA5 G;  3MA2 B;  4QY7 A;  3AYH B;  3H94 A;  3HKZ E;  3PUX A;  2F0E A;  3C2P A;  1Z6H A;  1DXM A;  4KK7 A;  1I4R A;  1WYD A;  3VA5 A;  1CUK A;  2B2W A;  1IW7 D;  1JJ2 A;  5M3M H;  4DV6 Q;  4KV6 A;  2HCI A;  1BUV T;  1LAB A;  3PO2 B;  4RWS C;  2I46 A;  1F77 A;  4EVO A;  3S1R H;  1A62 A;  4AH6 A;  4DR7 Q;  4AYB G;  3K5O A;  2K33 A;  4C3J G;  3T1H Q;  2N88 A;  2WB1 G;  5G3L D;  3SDZ A;  2UUB Q;  1IHZ A;  3HFZ B;  2F0G A;  1EY8 A;  4DR1 L;  1WTQ A;  3H3V H;  3DLL A;  3S2D B;  1GD7 A;  4JW0 A;  3QB3 A;  2F03 A;  4I65 A;  3D6C A;  2I5H A;  1N9W A;  1L0Y B;  1JB7 A;  1PH9 A;  1SNP A;  3UDI A;  3G6J B;  5T1I A;  3K5L A;  2UUB L;  3S17 B;  2QCP X;  1L1O B;  1W6J A;  3CPW A;  1TT2 A;  1HPC A;  1OXS C;  4DUY L;  4JBM A;  1JOO A;  2WKD A;  1LTG D;  4DV0 L;  3BZC A;  1J5E L;  1ENA A;  1I4H A;  1MSH A;  2E8G A;  2ZM6 L;  1L2F A;  4I7A A;  5C3X A;  4BY7 H;  1XTC D;  3H0G G;  1NNX A;  3CC2 A;  2JA6 G;  3D4D A;  3FDT A;  1EQR A;  2ES2 A;  4HSV A;  1A8V A;  4IUV A;  5AFW A;  1V43 A;  2IY5 B;  3TZU A;  3W1B A;  1EYD A;  3S1M B;  3FEW X;  3I3C A;  2HIV A;  4X3S A;  4BBR H;  1I6V C;  4LF9 Q;  3I4N B;  5IP7 H;  1O7Z A;  4R4Q A;  2UXC L;  4MN3 A;  3QIA A;  4KMU C;  1LTI D;  1YNJ C;  4B3T Q;  1SSO A;  2N78 A;  4JI7 Q;  1N34 Q;  1YBY A;  4L5R C;  2HDM A;  4MTK A;  1STE A;  4DF7 A;  5H1S E;  3TRZ A;  2R7Z H;  2NZO A;  2Q8R E;  5C3W A;  3CRK C;  5CV6 A;  1FNV A;  3LWE A;  4KY6 A;  1IYV A;  5DAU A;  3F8T A;  1LLR D;  4L5T A;  3ZJY C;  4DGZ A;  4A3M B;  3QR8 A;  3CCM A;  5IT9 L;  4J6H A;  3CRL C;  5M3M G;  4ZRZ A;  3NBH B;  4DV2 Q;  4BXX H;  4F8M A;  1K73 C;  4XQQ A;  1Q7Y C;  1Y1W B;  3CCU A;  2O4X A;  2BOS A;  1E2Z A;  4K5W A;  1NAP A;  1EYG A;  1P16 A;  3C1E A;  4C1N I;  2LY7 A;  2Y0S G;  2F0N A;  3I4O A;  1SMY D;  2CWA A;  4OON A;  1FGU A;  1RIP A;  2JXM B;  4N9T A;  2K7V A;  5AJ3 L;  5D14 A;  1L1O C;  2CQO A;  2QEJ C;  3SEB A;  4X62 Q;  4B3R Q;  3V96 A;  4X66 L;  1SFO H;  1I4Q A;  3CCR A;  1W6K A;  5IIF A;  1LO5 D;  2F0K A;  5KRU A;  4ZCK A;  1YHA A;  1Q81 C;  1HZA A;  4A3C G;  5C3E H;  1LT6 D;  1QNK A;  4DK1 A;  1B2T A;  1C9O A;  1E22 A;  4FO2 A;  1JIC A;  5IGB A;  3F2U A;  1HNW Q;  2CW0 C;  2PQA A;  3G71 A;  3HOZ B;  1D5M C;  3S1N B;  2HCC A;  2EPB A;  1C4Q A;  1STG A;  4CJ0 B;  2AQ3 B;  1LAC A;  1C8C A;  2LMC B;  4AQY L;  1MJE A;  2E75 C;  1QOH A;  1KDB A;  2AKW B;  3RD4 A;  3KOJ A;  4GKJ L;  1D1I A;  2K5D A;  4OL7 A;  4LJZ C;  4DR2 Q;  1B9M A;  3URY A;  1EQQ A;  4A76 A;  4A3J G;  1J6Q A;  1NJI C;  3L9A X;  3J81 c;  3SHL A;  1VQF A;  4NW2 A;  1MIU A;  1JC7 A;  2WV6 D;  1PV4 A;  1PMR A;  4IUP A;  5D3D A;  4HED A;  3PF5 A;  4JI1 L;  5CV7 A;  1RD9 D;  1PH4 A;  1N33 L;  1B3Q A;  5IYB G;  4ME3 A;  3OW2 A;  3BJU A;  4RKL A;  4G7H C;  1GM5 A;  4JV5 Q;  1VF5 C;  1QVC A;  2K5Q A;  5CV9 A;  1D5Z C;  4EQN A;  3J81 i;  3AFQ A;  2HHH Q;  3I4N G;  5C44 H;  3E5S A;  3BVM A;  1UEB A;  2A69 C;  3NEL A;  3D4R A;  4HJ7 A;  5IGE A;  1M4V A;  3S17 H;  5JEA J;  1GVP A;  2EY2 A;  2HIX A;  3KFU A;  5JEA H;  3CCJ A;  1BOS A;  5COY A;  2PNH A;  1LT5 D;  2F0H A;  1HUN A;  5IGF A;  3MXU A;  2V1C C;  3PV0 A;  4H02 A;  1PH2 A;  3S2D H;  3J81 E;  1RHP A;  4X64 Q;  2VUM H;  3GTO B;  2IWH A;  4CJ2 C;  2WKC A;  4JI8 Q;  1K3B C;  3OSO A;  1YNJ D;  1EZ6 A;  1OXT A;  1G91 A;  2Z9H A;  5A2Q L;  1FNW A;  3DM3 A;  2OQ0 A;  2KOL A;  4P74 A;  2OXP A;  3I2Z A;  5EGT A;  1X55 A;  1DCZ A;  2R7F A;  2LXJ A;  2UUA Q;  3F1Z A;  2F52 A;  4KTA A;  4YWM A;  4DAM A;  2JE6 I;  4YCV A;  3TDQ A;  2D62 A;  2NVQ H;  1H9S B;  3T56 B;  3OIQ A;  4JI4 Q;  5I2Y A;  2F0V A;  3U4V A;  1HR0 W;  4BY1 B;  3BZK A;  3SE0 A;  2ENB A;  1SRU A;  1EYA A;  3OWE B;  3VDY A;  1SLJ A;  1KIX A;  2R93 B;  1HNX Q;  1DM0 B;  3E0E A;  4Q5V A;  1MBY A;  1S40 A;  2KHI A;  2DNE A;  4K14 A;  5C5L A;  1EEF D;  1TS3 A;  4RHR A;  3I90 A;  2CCZ A;  3OHX C;  4KD3 A;  4LF7 L;  2UXD Q;  4BBS G;  2IHE A;  4K6D A;  4A3F B;  1SMY C;  3R2I A;  2M2L A;  4EGV A;  2OWO A;  3HEJ A;  3NK9 A;  3Q6S A;  5FLX E;  2B63 G;  4XIG S;  1GUW A;  3NEN A;  3EFX D;  3J7A V;  1U4M A;  1O7I A;  4WFN 3;  4QMG A;  1NR2 A;  4MTN A;  2HQE A;  1JT8 A;  2KUM A;  3K0X A;  2ZJR A;  1Z47 A;  2ZTC A;  5EKK A;  1ICF B;  1IXR A;  4K2L A;  5I6Y A;  1C0A A;  4QQB X;  2FFK B;  3HGB A;  3QO2 A;  2PW5 A;  5BN5 A;  3Q23 A;  4B3M L;  3K58 A;  1F9Q A;  1N36 Q;  4A3J B;  3UDX A;  4IJH A;  1LUZ A;  1IYU A;  1ICW A;  2L1B A;  4IO9 A;  5LHY 1;  3F2C A;  1VDZ A;  3MHB A;  2K01 A;  4X66 Q;  4UP8 A;  2PQE A;  4GKK Q;  4QUC A;  4LFB L;  4FF3 A;  1N32 Q;  2A6H D;  1A2T A;  4JCV E;  4HCE A;  5IYD H;  2B2U C;  1CHP D;  4DV1 L;  3L2P A;  4HCS A;  1LTS D;  4BBS H;  2A68 D;  1TWG H;  1FGB D;  2IHF A;  5FO8 B;  4IFD G;  4JI5 Q;  1CI3 M;  1HA5 A;  1JE4 A;  2NN6 I;  2NWG A;  2RF4 A;  1Q86 C;  1NBW A;  1PZK D;  2YTV A;  5EKL A;  3I72 A;  2MNA A;  5IT9 E;  3GTJ B;  5FLM G;  2NVX H;  1SDF A;  1I50 H;  1YHQ A;  2LFN A;  3DXJ C;  1BF4 A;  4ID6 A;  2Z6K A;  2XWJ B;  4KKU A;  4QCL A;  5BR8 L;  2EYH A;  1HA6 A;  1GKH A;  5C3E G;  3T1Y Q;  1GUG A;  4A3D B;  4K5V A;  1SNQ A;  3X3N A;  4FF4 A;  1CFM A;  3CU7 A;  4DPG A;  5FK9 C;  2NUC A;  2B2T C;  3S14 B;  5M5W H;  3KK7 A;  4PQX A;  2H5X A;  5C4X G;  2O2L D;  3H6M A;  4KY5 A;  1JB3 A;  2TSS A;  1NR4 A;  2KJX A;  4H13 C;  3CF5 A;  3H0G B;  5KYI A;  2EQS A;  2J4X A;  2XGT A;  1SE8 A;  3PUY A;  1BDO A;  4YY3 L;  2JYO A;  1CQV A;  1BO0 A;  3ZYY X;  3FRP B;  3LWU A;  3U4Z A;  2F0L A;  2A19 A;  1K8G A;  3A54 A;  2IX0 A;  2E2H H;  4JI6 L;  1E1O A;  1L0W A;  3EN2 A;  4AIM A;  3ICE A;  1I5F A;  2AQ2 B;  3EA6 A;  4QGU A;  2EYP A;  2OT2 A;  5JJZ A;  3G6E A;  3PO3 H;  3S14 H;  3I8Z A;  5ELD A;  2QA4 A;  4UY8 C;  1JQY D;  4P73 A;  1HFN A;  1KXL A;  2F4V L;  1IBK L;  4C3J B;  4HJA A;  1S3O A;  2NB0 A;  4HIO A;  2AHO B;  2B8G A;  2DY7 A;  1QUQ A;  5C4J H;  3H15 A;  3T1H L;  3MZ5 A;  3I7F A;  2OTL A;  3I4M G;  3NEM A;  1FYC A;  2XNA C;  4IZ8 A;  4FYD A;  2JA8 B;  1BCP B;  1JWU D;  1TVX A;  4N8F A;  1HNX L;  2KCN A;  4CBV A;  4NDX A;  4IUT A;  2JA5 B;  4ZK9 B;  3BS1 A;  4UP7 A;  4L6T B;  4IFD I;  5JJI A;  5E1F A;  1PXU A;  4BWG B;  1Z7T A;  3FVQ A;  1PFS A;  4E6I A;  1GXD C;  1CKM A;  2D9U A;  3CHB D;  4DFA A;  4DAV A;  4BY1 H;  5IGC A;  4LUZ A;  2EY6 A;  2J7Z A;  1C48 A;  3NHH A;  1Y69 U;  4IPC A;  3SVM A;  1EQT A;  5EQ0 A;  1BR9 A;  4IAL A;  3IKJ A;  1VQM A;  2JA7 B;  4Z9C B;  3NE5 B;  4H7B A;  4JOI A;  3IAY A;  1QZG A;  4DNI A;  1K28 A;  1XPO A;  4A3K H;  1QJO A;  1I4X A;  2BE5 C;  1FL0 A;  2DN8 A;  4GOP A;  1DD2 A; 
#chains in the Genus database with same CATH homology
 4LF5 Q;  3A5Z B;  3KJP A;  2ZM6 L;  1L2F A;  3I55 A;  2JEA I;  3PF4 A;  4Y7N H;  3CCQ A;  1I94 Q;  5M3F G;  2Q2I A;  5C44 G;  2IT1 A;  4JI8 L;  5IYC G;  1E24 A;  1UE5 A;  4MZ9 A;  3S16 H;  1KAW A;  4GLA C;  4BY7 H;  1EOV A;  2AMC B;  3H0G G;  4IJL A;  3AQQ A;  3E9H A;  3CC2 A;  2JA6 G;  4LF5 L;  3BU2 A;  1EQR A;  2RCN A;  3EIV A;  3PUW A;  2Y0S E;  1A8V A;  4TVA B;  2N49 A;  4PZ8 A;  4DV2 L;  1YJN A;  3F2B A;  1HNW L;  1V43 A;  4A3F G;  1HJP A;  2KEN A;  3I56 A;  2IY5 B;  1I94 L;  3W1B A;  4YY3 Q;  4A3L H;  3KF6 B;  3MXN B;  4JI2 L;  4DV4 L;  2UXB Q;  1CKN B;  2CKZ B;  3OYY A;  4X65 L;  2HIV A;  3D0F A;  4BBR H;  4LF9 Q;  5IP7 H;  5C0X I;  4LFC Q;  4GN5 A;  1P8L A;  4R4Q A;  4A3F H;  1YJ9 A;  3CME A;  1Q1B A;  2UXC L;  3HOW G;  3PUZ A;  2I5M X;  1EIF A;  4A3C H;  2YYZ A;  4JYA L;  4B3T Q;  4JI6 Q;  3RLF A;  3ULL A;  3HOX H;  4GNX C;  4JI7 Q;  2N78 A;  4LF8 Q;  1N34 Q;  4MNO A;  1YBY A;  4L5R C;  2WP8 J;  5H1S E;  1YIT A;  3TRZ A;  2R7Z H;  4LUO A;  4JI2 Q;  2NZO A;  4R4O A;  2DGY A;  3TS0 A;  1VQC A;  1JJC B;  1G51 A;  1Q12 A;  4GLX A;  3M7N A;  4JYA Q;  3GTL H;  3TEH B;  1X56 A;  3PCO B;  1OTC A;  1QUQ B;  2VUM G;  1VQH A;  3TQY A;  1V9P A;  3ZJY C;  3F8T A;  4L5T A;  1BVS A;  4RG1 A;  3CCM A;  4KI0 A;  2ES2 A;  2PI2 E;  2GVA A;  4GN3 B;  4LWC A;  2OTJ A;  1X65 A;  3S1M H;  5M3M G;  1TWH H;  4A3I H;  2A1A A;  3NBH B;  4B3S L;  4UP9 A;  4DV2 Q;  4LF4 Q;  4YHH Q;  4BXX H;  2VS1 A;  1PH1 A;  2HQL A;  2QEX A;  4DR3 L;  1K73 C;  4DR5 L;  5IP7 G;  1Q7Y C;  4QJF A;  4KHP L;  4A3G G;  1YHB A;  2Z0S A;  1XJV A;  3CCU A;  1HNZ L;  1I3Q H;  3CQZ H;  3CC4 A;  1VQD A;  1EYG A;  1P16 A;  4KHZ A;  5FLX c;  1VCI A;  2CFM A;  2Y0S G;  4LF4 L;  2ZM6 Q;  3I4O A;  1YIJ A;  1NY4 A;  4OON A;  2CWA A;  4JI0 L;  3OTO Q;  1FGU A;  1MJC A;  1X54 A;  4B3S Q;  4JBK A;  1RIP A;  3RR5 A;  5JJL A;  5AJ3 L;  1K0R A;  1L1O C;  2CQO A;  4PZ7 A;  4X62 Q;  3STB D;  4B3R Q;  4X66 L;  1SFO H;  2IX1 A;  4OXP A;  3CCR A;  4DV7 L;  1EWI A;  3SGI A;  4DR1 Q;  4GOP C;  1XMQ Q;  4IPD A;  1IBM L;  1ASY A;  2JA7 G;  5EAY A;  4A3G H;  2OQK A;  3ER0 A;  1YI2 A;  4A3B H;  4GNX A;  3RZD H;  3CD6 A;  2K52 A;  1YHA A;  3HKZ G;  1HZA A;  3KYH C;  5IP9 H;  5C3E H;  1VQA A;  5LMU Q;  1Q81 C;  1VQ5 A;  4A3C G;  3M9B A;  5M5Y H;  5C4X H;  3HOU G;  3A0J A;  1C9O A;  1HZC A;  1E22 A;  3JAM i;  4OX9 Q;  4BBR G;  1VQO A;  3GDE A;  1WCM H;  2D0P A;  1HNW Q;  3ULP A;  2PQA A;  3H3V I;  3G71 A;  5IWA L;  4DV0 Q;  2MFI A;  1UE6 A;  2JA9 A;  2ZJQ A;  1HZ9 A;  1XMO L;  3A5U A;  2VQF L;  3PUV A;  4NB3 A;  2Q2H A;  4RMF A;  4C3J H;  1NMG A;  4AQY L;  1MJE A;  4L5Q A;  3CXC A;  1IYJ B;  5FJ8 H;  1KL9 A;  4NXM L;  1EFW A;  4JG2 A;  2AKW B;  5M3F H;  3KOJ A;  4GKJ L;  1XPR A;  4PMW A;  5M5X H;  4DR2 Q;  3K7U C;  4XTC S;  1EQQ A;  4A76 A;  4A3J G;  1J6Q A;  2K4K A;  1NJI C;  4LNQ A;  1VQN A;  2KCT A;  3OTO L;  4A3M H;  3PIO A;  3J81 c;  1SN8 A;  2Q2U A;  1VQF A;  1MIU A;  2ZTD A;  2R92 H;  3J81 j;  4AQY Q;  5LMN L;  2OCE A;  1PV4 A;  2NN6 G;  3ERS X;  2RHQ B;  3CW2 C;  4GN4 B;  1XNQ L;  1AE3 A;  1PYB A;  3CAM A;  4OWX B;  1HR0 L;  4JI5 L;  4A3L G;  3PF5 A;  4JI1 L;  1VQ4 A;  4DV5 L;  1FJG L;  4DR7 L;  2BA0 A;  2KCM A;  4LFC L;  1PH4 A;  1N33 L;  1NTG A;  5IT9 c;  5IYB G;  1PH8 A;  2A8V A;  4YHH L;  4ME3 A;  4HIM A;  3BJU A;  1TWF H;  3OW2 A;  1QVF A;  4K0K L;  1E1T A;  3HOZ H;  3CCV A;  2K5H A;  1CKN A;  3KDF A;  3RZO H;  5GAH C;  2WAQ E;  3S2H H;  4BA2 I;  1GM5 A;  4JV5 Q;  3CC7 A;  3CP0 A;  1QVC A;  3J81 i;  1M90 C;  1HR0 Q;  4A3K G;  2HHH Q;  3AFQ A;  3CCL A;  3I4N G;  3K81 C;  5C44 H;  4DV3 Q;  1PHJ A;  2JEB I;  4OO1 G;  1SMX A;  1UEB A;  1L1O A;  3NEL A;  3WWV A;  4A75 A;  2FXQ A;  3F2D A;  1PYS B;  4HJ7 A;  4AYB E;  1LM0 A;  4DV1 Q;  3S17 H;  1VQE A;  2D0O A;  1V1Q A;  5JEA J;  1OXV A;  2JA8 G;  1VQL A;  1GVP A;  3KFU A;  2HIX A;  4X62 L;  1HH2 P;  2WAQ G;  3CCJ A;  1SRO A;  4DK3 C;  1VQK A;  4Y52 H;  3PO2 G;  2PNH A;  4DKA C;  2V1C C;  3PV0 A;  1J5E Q;  3LGJ A;  3M4Q A;  4H02 A;  4DAY B;  3M85 A;  1PH2 A;  3S2D H;  4IFD J;  1VQG A;  3I4M H;  2PMZ E;  3A74 A;  5HY6 A;  4X64 Q;  2VUM H;  1U0L A;  4UPA A;  3J7A 5;  3GTO H;  4HJ8 A;  5LMU L;  4JI8 Q;  2ZTE A;  4L5S A;  1HNZ Q;  3S15 H;  1PH7 A;  1OXT A;  1T9H A;  4BY1 G;  1S72 A;  4DR6 L;  3K7A H;  4YWL A;  1YEZ A;  4EQ5 A;  2BH8 A;  1QVG A;  3DM3 A;  3JC6 6;  3FKI H;  3RLN A;  4GNX B;  1TXY A;  2OQ0 A;  4P74 A;  3K80 C;  1KRT A;  2YU9 H;  1UE7 A;  1FVI A;  3I2Z A;  3HOX G;  1X55 A;  1X3G A;  2WFW A;  2R7F A;  4C3I H;  1NE3 A;  1XTD A;  2LXJ A;  2UUA Q;  4JI0 Q;  1XNR L;  3PO3 G;  3F1Z A;  2F52 A;  4YWM A;  2E2J H;  2K5V A;  4DAM A;  2JE6 I;  1CSP A;  4YCV A;  4X65 Q;  4YCU A;  4PG3 A;  1X3F A;  2D62 A;  4A3E G;  2NVQ H;  5DLQ E;  5HGQ A;  3UDG A;  1B7Y B;  1KD1 C;  4DV4 Q;  4JI4 Q;  1X9N A;  1YNX A;  4POG A;  2KHJ A;  3U4V A;  1HR0 W;  1QZH A;  3BZK A;  1N36 L;  1SRU A;  2UXC Q;  1Z9F A;  2K75 A;  5GAD C;  1SLJ A;  3VDY A;  1A0I A;  2QGQ A;  1KIX A;  1Q46 A;  1Y14 B;  2ID0 A;  2R93 H;  1HNX Q;  1GO3 E;  1AH9 A;  3GTQ H;  4A4I A;  3E0E A;  3GTJ H;  4A93 H;  2YTY A;  3CPF A;  4P75 A;  5C0X J;  4KLK A;  3PIP A;  1S40 A;  2KHI A;  2JA6 H;  3GTK H;  4OWW B;  4DR4 Q;  3K8A A;  1OXX K;  1H95 A;  1EUJ A;  3U50 C;  4JI7 L;  1VQP A;  3GO5 A;  1XNQ Q;  1X3E A;  2K50 A;  1RL2 A;  3FKI G;  2JA5 H;  3GTM H;  4HIK A;  3HOY H;  2VQF Q;  1XPU A;  2CCZ A;  2DUD A;  1CKO A;  3UE0 A;  2F3I A;  4QIW E;  5E7N A;  4LF7 L;  2UXD Q;  3FHW A;  4J15 A;  5C0X G;  4OO1 I;  1SR3 A;  4BBS G;  2IHE A;  1IBL Q;  4IOA A;  3ULJ A;  2L15 A;  4JV5 L;  2OWO A;  1PA6 A;  1AE2 A;  3GTP H;  4EX5 A;  2Z6K C;  4OWT B;  2B63 G;  3U58 A;  4XIG S;  2R93 G;  3NEN A;  1WOC A;  1R9T H;  2UU9 L;  2I5L X;  1O7I A;  1IL2 A;  3KJO A;  4MTN A;  2B63 H;  1JT8 A;  3J80 i;  4A3E H;  1IBM Q;  4JC0 A;  3K0X A;  2ZJR A;  2UUC Q;  2WB1 E;  1Z47 A;  4YCW A;  2ZTC A;  1Y1W H;  4JI3 Q;  3GTG H;  5IP9 G;  3HOV G;  1IXR A;  1Y1V G;  2GN5 A;  1PVO A;  1KRS A;  1YZ6 A;  2K14 A;  4HJ5 A;  2NVY H;  1M1K C;  4DR3 Q;  2Q2T A;  1Q1E A;  1WI5 A;  2R6G A;  2R7Z G;  4A3B G;  1C0A A;  4QQB X;  5IWA Q;  4R1J A;  3PO2 H;  1K8A C;  1WCM G;  1U5K A;  4C3H H;  2E5L Q;  4B3M L;  4O2D A;  1N32 L;  5IE8 A;  1N36 Q;  1W2B A;  4GKK L;  4BA1 I;  4TQU S;  1Y1V H;  3UDX A;  4IJH A;  3RNU A;  1MKH A;  1LUZ A;  1KC8 C;  5LMN W;  4IO9 A;  1W3S A;  5IYB H;  2LSS A;  1JJG A;  4NXN L;  3M4O H;  1B70 B;  4DV7 Q;  3F2C A;  3EBE A;  3UDF A;  3STB C;  3HOV H;  1LTL A;  1XMQ L;  5ELN A;  4X66 Q;  4UP8 A;  4GKK Q;  4LFB L;  2PI2 A;  3Q8D A;  4IPH A;  4X6A H;  5K36 G;  4DR2 L;  3KLW A;  3FP9 A;  4B3M Q;  1N32 Q;  1HZB A;  4JCV E;  5JEA G;  4GKJ Q;  5IYD H;  4DV1 L;  2C35 B;  4R4T A;  5IYD G;  3L2P A;  4LFA Q;  3HKS A;  2VQE Q;  3IRB A;  4LF8 L;  1TWG H;  4BBS H;  1BBW A;  4OX9 L;  1N34 L;  4P71 A;  2K5N A;  2IHF A;  2LXK A;  4LFB Q;  3UE1 A;  4IFD G;  3MEF A;  1K9M C;  4JI5 Q;  2NN6 I;  2YV5 A;  3RN5 A;  5FJ8 G;  1XMO Q;  2RF4 A;  5FLM H;  1Q82 C;  4DUZ Q;  1Q86 C;  1NBW A;  4BXX G;  1YJW A;  2YTV A;  1PH5 A;  2ATW A;  3PGZ A;  2B29 A;  2MNA A;  2VZA A;  3AFP A;  1K83 H;  3W5O A;  5FLM G;  2NVX H;  2GVB A;  1KHI A;  4POF A;  1E3P A;  1I50 H;  1YHQ A;  1CSQ A;  1BBU A;  5IY0 A;  4ALP A;  2Z6K A;  4DUZ L;  1KQS A;  4LF7 Q;  4R4C A;  3RLO A;  2I0Q A;  2UXD L;  1G29 1;  3D31 A;  4JBW A;  4DV3 L;  5BR8 L;  2UUA L;  1GKH A;  5C3E G;  3T1Y Q;  2BA1 A;  1TWC H;  5GAG C;  4DR5 Q;  4KHP Q;  4IPG A;  2NZH A;  1VQ9 A;  3JAM c;  3I4N H;  3G48 A;  4DPG A;  4O0A A;  2ASB A;  4LW1 A;  2HT1 A;  4JOI C;  5M5W H;  1N33 Q;  1D8L A;  1UWV A;  2H5X A;  3HOU H;  4DV5 Q;  1FJG Q;  5C4X G;  2AWN A;  4FDB A;  3J7Z C;  2UUC L;  3T1Y L;  5BR8 Q;  3S1Q H;  4WJ4 A;  4HJ9 A;  1ASZ A;  2CWP A;  4X64 L;  1OXU A;  2VW9 A;  4DR4 L;  3CF5 A;  1VQ6 A;  3CCE A;  1PH3 A;  4NPS A;  4C2M H;  2EQS A;  2XGT A;  4GS3 A;  4R4I A;  3HOY G;  1Q8K A;  1SE8 A;  4PZ6 A;  2MQH A;  2UXB L;  4A3D G;  3PUY A;  4YY3 L;  2HHH L;  5IYC H;  3J80 c;  1VQB A;  4B3R L;  4DUY Q;  4IOC A;  2R92 G;  3S1N H;  1JMC A;  2VL6 A;  4DK6 C;  2N3S A;  5GQO A;  2E5L L;  1IBL L;  3U4Z A;  2JK8 A;  1A63 A;  2A19 A;  1K8G A;  1I6H H;  4GLV B;  2NVT H;  2IX0 A;  4BY7 G;  2VNU D;  2E2H H;  2JJQ A;  1E1O A;  4B3T L;  3KDF B;  5GAE C;  4JI6 L;  1IBK Q;  1L0W A;  2F4V Q;  3EN2 A;  2B3G A;  4AIM A;  4JI4 L;  3ICE A;  2R7D A;  1VQI A;  1WFQ A;  3B6Y A;  2JQO A;  1G6P A;  1I5F A;  4QGU A;  3PO3 H;  4P72 A;  2VY3 A;  3G6E A;  4QL5 A;  2VQE L;  4LFA L;  3S14 H;  2EXD A;  2MO1 A;  1BKB A;  3GD7 A;  2QA4 A;  4DR6 Q;  1N8R C;  2PQA B;  4P73 A;  4UY8 C;  4GOP B;  3CCS A;  2MO0 A;  1UE1 A;  1KXL A;  5AJ3 Q;  3PSI A;  2F4V L;  2AWO A;  3G4S A;  1IBK L;  4WJ3 M;  4A3D H;  2JA5 G;  4HJA A;  2EIF A;  1S3O A;  4QY7 A;  4NXM Q;  2RHS B;  4HIO A;  2AHO B;  2YTX A;  2XTI A;  3AYH B;  2ZJP A;  4LF6 Q;  5ELO A;  3HKZ E;  1JE5 A;  1QUQ A;  3PUX A;  1VQ7 A;  5C4J H;  1WJJ A;  2E2I H;  1C7Y A;  3H15 A;  4A3M G;  1WYD A;  3T1H L;  3I7F A;  2OTL A;  3I4M G;  1CUK A;  1VS0 A;  3NEM A;  2KBN A;  1JJ2 A;  5M3M H;  3RN2 A;  4A3I G;  4DV6 Q;  1VQ8 A;  1D7Q A;  1HNX L;  4LF6 L;  3S1R H;  1A62 A;  4LUV A;  4AH6 A;  3TS2 A;  3M4P A;  4JI1 Q;  4DR7 Q;  4AYB G;  3W1G A;  3AEV A;  4JI3 L;  3HOW H;  3T1H Q;  5GRO A;  1K3R A;  1NMF A;  2WB1 G;  4UP7 A;  4A3J H;  1Y1W G;  1EIY B;  4IFD I;  1IZ6 A;  5J3B A;  1PH6 A;  5JJI A;  2UUB Q;  1VQJ A;  3TRE A;  2BH2 A;  1PFS A;  2JA7 H;  4K0K Q;  3HFZ B;  3L0O A;  1CKM A;  2N8N A;  4DV6 L;  4DR1 L;  3S24 A;  3E9I A;  3L7Z C;  3DLL A;  1XNR Q;  3H3V H;  1GD7 A;  1X6O A;  1E7Z A;  4BY1 H;  3HOZ G;  2I5H A;  1N9W A;  4LUZ A;  1JB7 A;  1PH9 A;  4YWK A;  3UDI A;  4IPC A;  1LYL A;  4JBJ A;  5LMN Q;  1VQM A;  4NXN Q;  4APV A;  4LF9 L;  3H0G H;  2UUB L;  2ALY B;  1L1O B;  4JOI A;  4HID A;  2UU9 Q;  1B8A A;  1QZG A;  4DNI A;  3CPW A;  3KF8 B;  1XPO A;  3KF6 A;  4A3K H;  1TWA H;  1OXS C;  3M3Y H;  4DUY L;  1YVC A;  4JBM A;  3CMA A;  1FL0 A;  2JA8 H;  4DV0 L;  3BZC A;  1J5E L;  1DGS A;  4GOP A;  4A93 G;  2E8G A;  5JJK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...