4JI5L

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
124
structure length
123
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 13
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ji5L00
1WI5A 1K73C 2KHIA 3ZJYC 2BH2A 3CPFA 3UDXA 1EIFA 4A3LH 3T1YL 2E2IH 1CKNB 4JI2L 4LF7L 2Q2HA 4C2MH 1JE5A 2JA9A 3PSIA 3CCJA 3CP0A 4YWMA 1Z9FA 1PH8A 4ALPA 1EIYB 4X6AH 2AHOB 3CCQA 1X6OA 4A76A 4JI1L 1N8RC 1ASZA 1Y14B 4JI7Q 2UUCQ 4JCVE 3RZDH 3A74A 1B8AA 2K75A 5K36G 4KHPL 3W5OA 3KOJA 3GO5A 3K81C 3PO2G 5JEAG 2JK8A 1L0WA 1VQDA 1HNWL 1YEZA 3G71A 1I3QH 3HKZG 3AEVA 2KHJA 1KRSA 4O2DA 4X64Q 4KI0A 1Q81C 1PH7A 3CAMA 3I7FA 4YY3Q 4JI0Q 4LF6Q 3PO2H 1X3FA 2B29A 3H15A 3J80i 5C0XJ 4HIKA 1YJ9A 3M4QA 3S24A 1CSPA 2ZJRA 3S1NH 2Z6KA 1FJGQ 2EQSA 2RHQB 1CKOA 3GTOH 4DV2L 1E22A 1N32Q 3U50C 1GO3E 4LF8L 5ELOA 4GKKL 2PI2E 2ZJPA 4HJAA 2UXBQ 2ZTEA 5M5WH 4YHHL 4BY1G 3RLNA 2VL6A 4JI8Q 3LGJA 2Z6KC 2UU9L 1CKMA 1KC8C 4LF9Q 1E7ZA 5AJ3L 1PYSB 2MNAA 3KF6B 2Y0SG 2WFWA 3UE0A 4WJ4A 4Y7NH 2OQ0A 4X65L 3CMAA 1BBUA 4DNIA 5M3FG 4BY1H 3WWVA 4POGA 3CD6A 2R7ZG 2VS1A 3JC66 2JE6I 1CSQA 4A4IA 4DV3L 4A3BG 2Q2UA 2EXDA 1G291 1K8GA 2R7ZH 2E2JH 4LFBL 4IFDI 4P75A 3DM3A 4ME3A 1XNQL 3EBEA 1E1OA 4DR3Q 1VQLA 4A3BH 3PV0A 1OXSC 3OTOQ 1T9HA 4HJ7A 2I0QA 4LFCL 4IOCA 3AFPA 1UWVA 3RR5A 1HJPA 1YJNA 2ZM6L 2F52A 3PUYA 5E7NA 4DPGA 4HIDA 4OONA 4A3IG 2OTLA 1WCMG 4BXXG 1D7QA 1XTDA 2GVBA 4O0AA 1OXTA 3F1ZA 2HHHL 4MZ9A 3KYHC 2R92G 3PO3G 4A3IH 1XNRL 3AFQA 4IPGA 4OXPA 4PZ6A 4BXXH 2CKZB 1KXLA 1ASYA 1IBKL 3I4NG 2R92H 1M90C 3PCOB 3PO3H 3OW2A 1BKBA 4NXNQ 1VQHA 3I4NH 5GROA 1HZ9A 3RN2A 1WFQA 1M1KC 4IPCA 4AIMA 1XPOA 2AWNA 2GN5A 4K0KL 4BBSG 4DUZL 3GTJH 1IBLL 4B3TQ 3HOUG 3ULLA 1TWGH 4BA2I 2IT1A 2JA7H 1K83H 3ERSX 4K0KQ 2K14A 1N34L 4C3IH 3F2DA 4IOAA 3HOUH 4JI2Q 1VQ6A 1IYJB 2YYZA 1KAWA 1QZGA 2JA5G 4POFA 4OX9Q 3TREA 1KRTA 1YITA 2LSSA 1KL9A 5C4XG 4QY7A 4B3RL 2NVYH 1JMCA 2JA5H 4Y52H 4OWTB 1QZHA 4JYAL 4RG1A 3I2ZA 1FL0A 1SRUA 3M9BA 2MO0A 4JOIA 5C4XH 2ASBA 3NELA 3E9IA 2PQAB 3A0JA 4FDBA 4YWLA 4GKJL 2Q2TA 1S3OA 2D62A 2NN6G 4AYBG 1XPRA 1HR0L 1N36Q 4JI6L 1B7YB 3CW2C 1W2BA 5C0XG 4JOIC 4PZ8A 1X3GA 2I5MX 2VQFL 4DR5L 5IT9c 4QIWE 3L2PA 4X62Q 1TWAH 3J80c 4DUYQ 2F4VQ 3J7A5 3NEMA 1Q1BA 2CFMA 4IJLA 3K8AA 4B3MQ 3E0EA 4WJ3M 1VQIA 1Q46A 2HIXA 1HNXL 1MJCA 3KDFB 1J5EL 2R7DA 4X65Q 2V1CC 3S2DH 4JBJA 3W1BA 2VQEQ 3PF5A 1SE8A 4DKAC 4JG2A 4DR6L 3HOYG 1I94Q 5H1SE 2PNHA 4IJHA 2JA6G 1JJ2A 4LFBQ 2AMCB 1E3PA 1AE3A 2WB1E 2XGTA 1VQKA 4JI3Q 4LWCA 4GOPB 4QQBX 4DR1Q 5IE8A 3HOYH 1L2FA 2FXQA 3Q8DA 1WYDA 4LFCQ 3A5UA 1G51A 2E5LQ 3KF6A 4APVA 3HOVG 2IX0A 4H02A 3KJOA 2YTVA 1HNZL 3TS2A 5IP7G 4JC0A 2D0OA 3PGZA 1NMFA 3F2CA 3RLOA 1YHQA 4JI4L 1JB7A 2JA8G 4DV6L 1MIUA 2HHHQ 3JAMi 3HOVH 1K3RA 1VQ7A 1XNRQ 5IP7H 2JEAI 4JV5Q 1L1OC 3BJUA 1IBKQ 3K80C 1XMQQ 1SMXA 2JA8H 4KHZA 2ATWA 1SROA 2N3SA 3U4ZA 4DV5L 3CCVA 1OTCA 5HGQA 3L0OA 1N33Q 4QGUA 5IWAL 3PUXA 4L5TA 5BR8Q 4QL5A 2D0PA 2UXCQ 5EAYA 1LUZA 5IYCG 1L1OB 3BZCA 3HOXG 2KENA 3MEFA 5IYBG 1X3EA 3U4VA 4DR2Q 4DUZQ 3FKIG 3UDFA 4A3FG 1GM5A 3PUWA 2L15A 3SGIA 5IYCH 3HOXH 4JI5L 3H3VH 4OO1G 4JBWA 4PMWA 5M3FH 1U0LA 1YNXA 4A3FH 1IBML 4DV7L 2UXDL 1V9PA 4DV4L 3S15H 4DR7Q 4A3KG 1E1TA 3B6YA 2ZJQA 4NXMQ 1OXVA 3UDGA 4LFAL 4R4QA 4DV0Q 2NN6I 2UUAQ 3STBD 1VQAA 3CC2A 4LF4L 2CQOA 3M3YH 3K0XA 1I50H 3UDIA 4DV1L 3OYYA 1XMOQ 2AWOA 2HQLA 2DUDA 1SFOH 2ES2A 4DR4Q 2C35B 3NENA 3I56A 1EFWA 1WJJA 1PYBA 1A63A 1X9NA 4X66Q 1SR3A 5IP9G 1YIJA 1WCMH 3CF5A 1GD7A 1A62A 4JI7L 4DK6C 4GNXC 1S72A 2UUCL 4HIOA 1VQGA 3T1HQ 1JT8A 2KCMA 2K5NA 1AH9A 1VQ8A 2VQFQ 4UP7A 2IX1A 3AQQA 3HKZE 3U58A 2HT1A 2VZAA 1V1QA 3EN2A 5GAGC 1VS0A 4X64L 4GNXB 4LF5Q 1RIPA 2BH8A 4AQYQ 4YY3L 2Q2IA 1KIXA 4LF6L 1HNXQ 4LNQA 2XTIA 4GN4B 4A3MG 1D8LA 1VQEA 1EWIA 2K5VA 1NY4A 3I4OA 1VQCA 4GLAC 4BBSH 3T1YQ 1N32L 1UE5A 5FLXc 1NJIC 4YWKA 4LF7Q 3STBC 5LMNL 4A3MH 2UXBL 4LUZA 1X65A 4MNOA 2Y0SE 2UUBL 4KLKA 4JI1Q 1C0AA 1B70B 1TWHH 4LF9L 1P8LA 1FVIA 4PG3A 3GD7A 1VCIA 4UPAA 3TS0A 1EYGA 2RHSB 4GN5A 3GTPH 4KHPQ 1VQ9A 4IPHA 5M5XH 1VQPA 2WAQG 3NBHB 3GDEA 2QA4A 1HNWQ 2K5HA 4R4IA 1K8AC 3HKSA 2K4KA 3KDFA 2F3IA 2N8NA 2KBNA 2HIVA 5JJIA 4A3DG 3H3VI 1CKNA 1JJGA 2VW9A 4P72A 4IPDA 1YJWA 3AYHB 2PMZE 3CCSA 4DR3L 4XIGS 1NBWA 1XPUA 3OTOL 2JEBI 4DV2Q 1PHJA 4A3DH 4LF8Q 3MXNB 5FJ8G 4GKKQ 1EQRA 4OO1I 2BA0A 3CC7A 2YTXA 2E8GA 4GOPA 4YHHQ 1QVCA 1I5FA 1IXRA 2K50A 3RNUA 4B3SL 2PI2A 3RN5A 2UU9Q 3PIPA 3E9HA 5AJ3Q 3HOWG 5FJ8H 2QEXA 2NZOA 3UE1A 3S1MH 3TRZA 4P71A 1AE2A 3G6EA 1IL2A 2I5HA 4GOPC 1NTGA 4R4CA 4JBKA 1Q82C 3HOWH 4DV3Q 5GAHC 2NVXH 2KCTA 5LMUL 1VQNA 1DGSA 3VDYA 3FHWA 2EIFA 1PFSA 4NXNL 4DV7Q 1PA6A 5M5YH 3HFZB 4DV4Q 1K9MC 1XNQQ 4YCWA 5C44G 4GLXA 1YVCA 5LMNW 2N49A 4B3TL 4LF4Q 2JA6H 1TXYA 4A75A 1HH2P 3FP9A 4EQ5A 4HJ8A 1Y1WG 1N9WA 3TEHB 2N78A 2GVAA 3J81j 4A3GG 4DV1Q 5C44H 2ZM6Q 4OWXB 1VQFA 1L1OA 3EIVA 3G4SA 1VQ4A 4QJFA 2OWOA 3KF8B 1BVSA 2Z0SA 3BU2A 1Y1WH 4A93G 2CWAA 2RF4A 1LTLA 5GAEC 2I5LX 3I4MG 4A3GH 1EUJA 4OX9L 5FLMG 3RZOH 1A0IA 3D0FA 2H5XA 4AH6A 1YHBA 5GADC 3A5ZB 4L5RC 1KQSA 2LXKA 4A93H 2WAQE 3I4MH 3CCRA 5FLMH 3S1QH 1GKHA 1HR0W 2K52A 1QUQB 3ULJA 3J81i 1V43A 1QVGA 4IFDJ 2CCZA 1EOVA 4NPSA 2ALYB 3M4OH 2IHFA 1NE3A 4AYBE 5JJKA 1IBLQ 4UP9A 2DGYA 4OWWB 3K7UC 1SN8A 1E24A 1X55A 1EQQA 1A8VA 1HZCA 1N36L 3S16H 1IZ6A 4TQUS 4A3JG 2RCNA 1N34Q 2BA1A 5IYBH 1JJCB 1W3SA 3FKIH 4X62L 1NMGA 4DUYL 1HZAA 3BZKA 2F4VL 5LMNQ 3CMEA 1VQBA 1VQJA 3CXCA 3CC4A 3PIOA 4HIMA 4A3JH 1KD1C 2R7FA 3CQZH 4B3ML 2UUBQ 4L5QA 3KJPA 5C0XI 1VQ5A 2NVQH 1CUKA 1UE7A 4B3RQ 1Q12A 4A3KH 1MJEA 4GS3A 5C3EG 2AKWB 3DLLA 3CPWA 5IYDG 3PUVA 4JYAQ 4GNXA 2JJQA 1PH6A 4BBRG 2VUMG 3GTGH 2NVTH 5DLQE 2VQEL 4R4OA 1Y1VG 1OXXK 1C9OA 1PVOA 1PH1A 5C3EH 1I94L 4GN3B 5IYDH 2MO1A 4GKJQ 4BBRH 2VUMH 2R6GA 4JI3L 1Y1VH 1HR0Q 4JI6Q 1WOCA 4DR1L 1PH9A 5C4JH 3ICEA 5JEAJ 5IP9H 4IO9A 4DR5Q 1UE1A 3GTLH 1I6HH 4LW1A 1FGUA 1RL2A 3RLFA 4R4TA 3J7ZC 4A3EG 2E5LL 4NB3A 1GVPA 3S2HH 1H95A 2ZTDA 4UP8A 3ULPA 4B3SQ 4JI0L 3CCLA 2A19A 3H0GG 2CWPA 3TQYA 4A3EH 1S40A 3HOZG 3IRBA 1J5EQ 3KLWA 1FJGL 2OCEA 2PQAA 3F2BA 4JV5L 1LYLA 3GTQH 2A8VA 4XTCS 2OQKA 1XMQL 3H0GH 3HOZH 1YZ6A 4C3HH 4UY8C 4DR6Q 1J6QA 2IHEA 5LMUQ 1LM0A 1TWCH 2VY3A 4JI8L 1N33L 2LXJA 2B63G 4EX5A 2IY5B 3ER0A 5BR8L 1VQMA 4YCVA 1Q86C 2JA7G 4JBMA 4HJ9A 2YU9H 2UXCL 4BA1I 4BY7G 1O7IA 4DR2L 5IY0A 4DK3C 2MFIA 4PZ7A 3GTKH 3F8TA 2WB1G 5HY6A 2QGQA 2B63H 1MKHA 1K0RA 1VQOA 3M7NA 1P16A 3M85A 1OXUA 4C3JH 2ID0A 4BY7H 1KHIA 1Q1EA 3PUZA 1YBYA 5GQOA 1HNZQ 1Q7YC 1G6PA 1UE6A 3S1RH 1XJVA 1PH2A 3CCEA 2MQHA 4DR7L 4JI4Q 1TWFH 3CCMA 4DV6Q 2A1AA 4NXML 2ZTCA 4J15A 4DV0L 3G48A 4DAMA 2UUAL 1PH5A 4MTNA 4YCUA 1X54A 3JAMc 4HJ5A 1R9TH 1YHAA 1XMOL 2WP8J 4DV5Q 5M3MG 5ELNA 1X56A 2E2HH 4DR4L 2YV5A 5IWAQ 1C7YA 4LUOA 1BBWA 3S17H 3KFUA 3K7AH 1HZBA 3L7ZC 3M4PA 2OTJA 4X66L 4R1JA 3CCUA 2YTYA 1UEBA 4IFDG 2VNUD 1PV4A 5M3MH 1PH3A 4A3CG 1U5KA 3J81c 3I55A 2R93G 1Z47A 1SLJA 4LUVA 3D31A 4RMFA 3T1HL 4JI5Q 3GTMH 4L5SA 1IBMQ 1QVFA 4A3CH 2B3GA 1Q8KA 4P73A 2UXDQ 5J3BA 4DAYB 2R93H 4TVAB 5JJLA 4LFAQ 2NZHA 2JQOA 1YI2A 4A3LG 4LF5L 3PF4A 1PH4A 4AQYL 4P74A 3W1GA 1QUQA 4GLVB 3S14H
chains in the Genus database with same CATH superfamily
3UDXA 3TSSA 3E3XA 1EIFA 3T1YL 4K2LA 2E2IH 4A3DB 2B2VA 4X6AH 4YWMA 1Z9FA 4ALPA 3QB3A 4JI1L 2F0DA 3V96A 5C3XA 1MBYA 5IGDA 4JI7Q 3URYA 3A74A 1B8AA 4K14A 3W5OA 3SE0A 3VYSA 1TU2B 1VQDA 3TP7A 1I3QH 3AEVA 1EWCA 2KHJA 4O2DA 4KI0A 3K6OA 4KJNA 3M7GA 1S5CD 3M4QA 2F0WA 1D5MC 1GUSA 2RHQB 3GTOH 4DV2L 4X3KA 4LF8L 1XTCD 2ZJPA 2KQ3A 2UXBQ 2ZTEA 1QILA 5M5WH 3A54A 4YHHL 3RLNA 2L11A 4JI8Q 4LF9Q 5AJ3L 3BS1A 1WVLA 3UE0A 2R7ZG 1BBUA 1B1ZA 1BO0A 4RKBA 2VXWA 5C5LA 2M9VA 1Y8OB 1CA5A 2EXDA 2R7ZH 2QW7A 4LFBL 4IFDI 4H7BA 1XNQL 4DR3Q 1VQLA 3PV0A 1OXSC 3N52A 3OTOQ 3SVMA 1LTTD 3MXPA 5J1ZA 2SNSA 1VMPA 2PW7A 4OONA 4CHTB 4BXXG 5ELBA 4RAUC 5CV8A 1PTOF 1XTDA 2A74C 3SK6A 2CVRA 2R92G 3A55A 1LT5D 3MA2B 2D9UA 4BXXH 4IPGA 4OXPA 4PZ6A 2CKZB 1KXLA 5CV7A 3VYUA 1D1IA 2R92H 1KNEA 3PCOB 4NXNQ 1B9MA 1HZ9A 2BE5D 1XX8A 5CBAE 4BBSG 4DUZL 1WTPA 4BA2I 2Z4IA 2L12A 2K14A 1N34L 1DM0B 1PLFA 5BN3A 1VQ6A 1IYJB 2ZT9C 2XNAC 3S2HB 4ZK9B 4ZCKA 3J80L 4K5WA 1ICWA 2LSSA 1JWSD 2MJ8A 2PCFB 5LL6S 1FL0A 3NTKA 2MO0A 5NUCA 1DOKA 3NELA 1T5EA 4XQNA 1S5BD 2NN6G 1SSOA 1N36Q 5C0XG 4PZ8A 4X62Q 3J80c 4DUYQ 3BVGA 2NN6H 2MHVA 4IJLA 3K8AA 5C0XH 4B3MQ 3E0EA 1IL8A 4WJ3M 3OWEB 5JAVA 1A3UA 1TWFB 3MVVA 3KDFB 4QCLA 2F3VA 3D4WA 4X65Q 1CTMA 4XQJA 5I9PA 3PF5A 4L8JA 1SE8A 4DKAC 3EFXD 3BVMA 3NQTA 3NTIA 1SBBB 4QQBX 2WB1E 1AE3A 4CJ0B 4DR1Q 5M3MB 3Q8DA 1WYDA 4LFCQ 3D6WA 3KF6A 5JOBA 3HOVG 2IX0A 2AQ2B 3KJOA 1HNZL 4JC0A 2D0OA 1D6EC 2J0TD 2HHHQ 4I65A 1CHQD 3JAMi 3HOVH 2JEAI 1L1OC 1ZYRD 5ISRA 1W6JA 4ODGA 2ATWA 1M8AA 2A68D 4QGUA 2QEJC 5BR8Q 1Y1WB 4C2MB 1YNNC 2UXCQ 1A6XA 1GM5A 4A3FG 2SOBA 3UDFA 3PUWA 3RZDB 1LT4D 2RQXA 5JPMC 1CM9A 4JBWA 4A3FH 1FNWA 5IIFA 2KVMA 4DV4L 4A3KG 1U4PA 1E1TA 3M4OB 5I6YA 4NXMQ 2QDLA 3UDGA 4LFAL 2Q8TA 4DV0Q 3BDCA 1AZPA 4FO2A 2RBMA 4ZKCB 1I50H 1PTOH 3UDIA 4DV1L 4F87A 3AMUA 3S1NB 2Z9HA 1SFOH 5G3LD 1HUMA 4JPBW 1A62A 1FNUA 2MPMA 1S72A 5EBDA 2UUCL 4HIOA 1M4VA 5EBCA 5CBEE 1HCZA 5D3DA 1AH9A 2VQFQ 3MHBA 4N8X1 5GAGC 2ZXRA 3K58A 1IKLA 1JOKA 4MIUA 5E3FA 4GNXB 4LF5Q 1RIPA 2BH8A 4AQYQ 2Q2IA 1B53A 2XTIA 5E4XA 4C1NK 4K5XA 4RKLA 3T1YQ 1N32L 1WD0A 1RTNA 2RSNA 2A73B 4LUZA 1X65A 1F2ZA 2Y0SE 1AP0A 2FMMA 4JI1Q 1BDOA 1B70B 2F1MA 3GD7A 1E2WA 1VCIA 1EY8A 2RHSB 3KLRA 4IPHA 1VQPA 2WAQG 1B50A 2B2WC 1LACA 4N9TA 3HOZB 1F9PA 4S3SA 4P2CB 2KBNA 2HIVA 3QG1A 4A3DG 3H91A 3OPOA 5DNFA 2KJXA 1YJWA 2KA7A 1KAAA 3AYHB 3CCSA 3J81E 1EIHA 1NCVA 4DV2Q 1TWGB 4A3DH 4LF8Q 2B8GA 4OO1I 1K83B 2BA0A 2YTXA 1XYIA 4GOPA 4YHHQ 4B3SL 1IXRA 1O80A 3RN5A 3HOUB 5AJ3Q 2QEXA 3UE1A 1OO9B 3QJYA 3V05A 2N88A 4P71A 3G6EA 1IL2A 2I5HA 2HCIA 1NTGA 4R4CA 4CJ2C 1R9TB 5GAHC 1YNJD 1VQNA 3VDYA 2KOLA 2XN9C 1K28A 4DV7Q 4RCOA 1XNQQ 1MSHA 1WTQA 4HAEA 2A6HC 4GLXA 2J7ZA 4LF4Q 1TXYA 1TKWB 1N9WA 3TEHB 2GVAA 4K0KL 3K5NA 3C46A 1BVSA 4H0LC 1BCPC 2CWAA 1LTLA 5GAEC 2I5LX 3QOLA 3TN2A 4AH6A 1YHBA 4L5RC 1EOTA 1GOZA 1KQSA 2LXKA 2AUJD 2X6LA 1HR0W 2E2IB 1PXUA 3S2DB 4IFDJ 1V43A 3U9OA 2CCZA 2IHFA 3DXJC 1IHZA 1NE3A 1ILPA 1QWYA 4AYBE 3KK7A 2DGYA 2K04A 1EY7A 2EYLA 3EQLC 3Q24A 2RCNA 4KY7A 2BA1A 5IYBH 1N34Q 1A3TA 5LMNQ 1TS4A 1VQJA 1I3QB 1O78A 3CC4A 3PIOA 1FR3A 2QKIC 5KNDA 2UUBQ 4L5QA 4C1NI 4ZYSA 3KJPA 1VQ5A 2JXMB 3CPWA 4OGQC 4QMGA 3GTOB 3KUPA 1OXXK 2JA8B 3F2UA 2EOTA 2R6GA 1GUTA 4CDFC 1WOCA 3ICEA 4K6LA 4A3EG 5HURA 1GVPA 3S2HH 1H95A 1RF2D 2CH4A 1GUWA 3S15B 2TMPA 5J22A 3A7LA 1EIGA 4A3EH 3IRBA 4HN7A 3M3YB 3F2BA 4JV5L 1LYLA 4XTCS 2GA4B 4UY8C 1Q8IA 2H4OA 2IHEA 1UAPA 1LM0A 1QE6A 2VY3A 4JI8L 2LXJA 1PDQA 2IY5B 2JA7G 2FFKB 4DK3C 2MFIA 4PZ7A 3IL8A 2WB1G 5HY6A 4N9PA 1JORA 1K0RA 3G6JB 3P1HA 5JVH3 3J81L 1KHIA 2K05A 1HNZQ 3J7AF 1XJVA 1DOLA 3O13A 1RHPA 5CMDA 3CCEA 4HMIA 4DR7L 1TWFH 3BDOA 1LV9A 4NW2A 4J15A 1WTRA 2UUAL 3A7AB 3T53B 5CR3A 4HJ5A 2B2YC 3AB9A 5M3MG 1LTRD 5K5PA 1X56A 4BBSB 2F0OA 5IODA 1BBWA 2RDGA 3FRPB 1HZBA 4B9WA 4A3MB 2OTJA 3ZYYX 2VNUD 1KNAA 5M3MH 5CV4A 3I55A 3J81c 2SEBD 1F9RA 4RMFA 3D31A 3T1HL 2A69C 3GTPB 1NAPA 5M5XB 1QVFA 4P73A 4TVAB 5EPJA 5JJLA 3DEOA 4BS9A 4LFAQ 2NZHA 2JQOA 1IW7D 1I4QA 5KNBA 4UP7A 4R8IA 1E2ZA 3VR2A 3Q23A 1BQQT 3MZ5A 3ZJYC 4RGTA 3CRLC 2Q2HA 4C2MH 1JE5A 2PQEA 1EIYB 3CP0A 2AHOB 1X6OA 1F9QA 2Z8LA 4O42A 2UUCQ 4JCVE 3RZDH 2K75A 5K36G 1PRTD 2NB0A 2VB3X 4J6HA 4KHPL 2F0UA 4KY6A 3PO2G 2JK8A 1HNWL 4IUUA 3HOWB 1PZID 2EYHA 1SNQA 1Q81C 1DD2A 1PH7A 1Q3LA 4JI0Q 2O5IC 3PO2H 4RCNA 5M5YB 2B29A 3S1NH 2ZJRA 1C48A 4OIJA 2BOSA 1N32Q 5ELOA 2IJ0A 2PI2E 1K8OA 4HJAA 5IGEA 1JWUD 2VL6A 1GXDC 1I4XA 2Z6KC 1SYFA 1AEXA 3KF6B 2Y0SG 2RVLA 3HOVB 2AUKA 3CMAA 4RA8A 4X65L 4DNIA 3RZOB 4DF7A 3JC66 1F2YA 2JE6I 1CSQA 3VYRA 1S5ED 1RCVD 5JPNC 3EBEA 1E1OA 1A15A 4HJ7A 4LFCL 2XIWA 4IOCA 1HJPA 4DU9A 1YJNA 3DWPA 2F52A 3PUYA 3V2TA 4ZKBB 4A3FB 5FO8B 2GVBA 4O0AA 4RFBA 1OXTA 3F1ZA 2HHHL 4MZ9A 3S9WA 1ZYRC 5ELEA 3CQZB 1O7ZA 1KDAA 4CKEA 1ASYA 1PTOB 3MTSA 2A68C 3TZDA 4A3KB 3NPPA 2K33A 3LNNA 1M90C 1SFOB 2QCPX 3OW2A 1BKBA 4U68A 4CBVA 5C6AA 2NZ1D 5GROA 3RN2A 1WFQA 1M1KC 4IPCA 4AIMA 1XPOA 1IYVA 4L6TB 1IBLL 3HOUG 3ULLA 1TWGH 4KD3A 1KTKA 1K83H 1Y1VB 1SYEA 3BDLA 4K0KQ 1I6HB 3F2DA 2DNCA 4IOAA 3HOUH 1EYCA 2C5CA 3MWYW 3SXHA 1SYDA 3I3CA 1KL9A 4QY7A 4DAYA 3C1EA 1SNCA 4KK7A 3DEPA 5FO9B 1JMCA 1U4LA 4Y52H 2K03A 2JN4A 1SRUA 2ASBA 3E9IA 4YWLA 4MTKA 4RGNA 2D62A 5D65A 4AYBG 2D2CC 3CW2C 5J39A 3GTKB 2VQFL 4DR5L 4QIWE 3J7A5 2HQEA 2B2UC 3DM1A 2WIIB 2R3ZA 2HIXA 1Q46A 1MJCA 2EJFC 2KCNA 2QF7A 4CDDC 3K5MA 4RHSA 2KECA 3S2DH 1STEA 4IUPA 2EJMA 4DR6L 3OW7A 4IJHA 3NK9A 1UEAB 1JJ2A 1JQYD 1E3PA 4GOPB 1L2FA 2FXQA 3I73A 3CRKC 3A5UA 1TY2A 3ONAB 3I90A 1S4ZA 2F0PA 3PGZA 3F2CA 3RLOA 1YHQA 1GJXA 1WTWA 1JB7A 4JI4L 1PTOD 1MIUA 2JA8G 5I2YA 1SMYD 1K3RA 2QDBA 2RDHA 5HGTA 1XNRQ 4JV5Q 3BJUA 4RGMA 5KYLA 3K80C 2MP1A 3SEBA 2JA8H 4KHZA 1SROA 2N3SA 4WRDA 3U4ZA 1OTCA 1VF5C 3PUXA 4L5TA 1HA5A 4FNFA 3HOXG 3BZCA 3TP5A 3FKIG 5KIXA 2L15A 3HOXH 3H3VH 4CKBA 4PMWA 4DV7L 2UXDL 1V9PA 1XWEA 4FXKC 3S15H 4DR7Q 2O4XA 1I4RA 3TMEA 4U673 3NWSA 2NN6I 5M9OA 3STBD 2UUAQ 4LF4L 3M3YH 2CQOA 3K0XA 3OYYA 2AWOA 2WKDA 3HKZB 2HQLA 4JVZA 1RODA 1V1PA 4M8AA 2C35B 3NENA 5EPLA 1A63A 1X9NA 1I4HA 1I6VC 4CJ1B 1YIJA 4GNXC 2B2TA 3T1HQ 1JT8A 2K5NA 1BUVT 3FPPA 1VQ8A 1EL0A 3HKZE 3NUCA 2F0QA 2HT1A 1NR4A 1V1QA 2VZAA 3EN2A 1VS0A 5F2DA 2E2JB 1HNXQ 2XWJB 4A3MG 1VQEA 1EWIA 3H6MA 4A3BB 4BBSH 5FKAC 1NJIC 5LMNL 1DXMA 4J8QA 4A3MH 3A56A 4MNOA 2B2WA 2UUBL 4A3EB 3X3MA 1EYGA 3GTPH 1SNPA 1EFID 2K7VA 4GN5A 4KHPQ 1VQ9A 5M5XH 1HFGA 2QA4A 1HNWQ 3PO3B 2JSOA 1AW7A 1H9MA 5JJIA 3MEHA 1JJGA 2AQ3B 2VW9A 4HEDA 1EQTA 1ESRA 1L0XB 1PHJA 2JA7B 1B44D 3VR5A 3RNUA 2D5DA 3SK4A 2WB1B 2PI2A 3E9HA 4ME5A 3HOWG 3L9AX 2NZOA 3TRZA 2K1BA 3NXWA 1ML0D 2O2LD 1Q90A 1Q82C 3HOWH 3HZXA 2NVXH 2E76C 2KCTA 4XT3B 3SR1A 1PFSA 1HQMC 5M5YH 5C5MA 5C44G 1PFMA 5LMNW 1HA6A 2N49A 4B3TL 1EEID 1HTPA 3CHBD 2N78A 1AFPA 5C44H 4KKTA 4OWXB 1VQFA 1RTOA 3G4SA 4QJFA 1TWAB 2OT2A 3BU2A 5T1GA 2RF4A 1NSNS 3I4MG 3RZOH 2Z1CA 3D0FA 3QIAA 2H5XA 1RD9D 2F0FA 1F2MA 3T4AC 3R93A 3I4MH 1ET6A 1WTOA 3S1QH 2OXPA 3I4LA 2WAQB 1TIID 4IN3A 1QVGA 2F0HA 2WKCA 1IBLQ 1SN8A 4E6IA 2CHBD 1EQQA 2NWGA 4RHRA 3S16H 2PW5A 4TQUS 4M1UB 3NE5B 4F8MA 1JJCB 1W3SA 1ET9A 2F4VL 2F0KA 1ILQA 3I91A 3CMEA 1KDBA 5DEHA 3DHQA 4HIMA 2R7FA 3CQZH 4K8IA 3PO2B 5IGCA 4KMUC 1Q12A 4A3KH 2HDLA 5C3EG 2AKWB 2JP1A 1CFMA 3PUVA 2JJQA 4DAPA 3T56B 2NVTH 2VQEL 4R4OA 1Y1VG 1PVOA 4KJOA 4HTHA 5C3EH 1H9SA 1PRTC 2DNEA 5I9OA 1SYCA 4JI3L 1Y1VH 1B3QA 3KLSX 1I6HH 4DR5Q 3RLFA 1EU3A 3J7ZC 2HDMA 2Y0SB 4NB3A 4JI0L 3FPUB 2ICIA 2A19A 5BN5A 3TQYA 2F3WA 1SXTA 1SE2A 2XVSA 2A8VA 2F0SA 3FVQA 1XMQL 4DR6Q 1J6QA 3HEJA 1N33L 5CYUA 1TR5A 3OSOA 1G2SA 4HJ9A 4FF2A 1O7IA 4DR2L 3GTKH 2QGQA 1QCBD 1STNA 1P16A 3P20A 1OXUA 3NHHA 1Q1EA 1V1OA 1YBYA 2PZWA 5GQOA 2EY5A 1Q7YC 2B2YA 1PH2A 1RKNA 4IUTA 4EGVA 4JI4Q 2G9DA 3G48A 4HSPA 3IFDA 1UUPA 1X54A 3H94A 5EQ0A 1XMOL 2WP8J 4FXGC 2YV5A 4H44C 4LUOA 5IGFA 1TS2A 3KFUA 1HRJA 3L7ZC 3HP3A 4R1JA 4N8FA 2B8FA 4NKLA 1QNUA 1TWHB 1Z47A 3R2IA 1II3A 4R8NA 4IUVA 4DK1A 3T51B 2UXDQ 4DAYB 5EKKA 2A5HA 4ZUIA 1QUQA 3AU7A 1EZ8A 1HFNA 1D1KA 2JA9A 3LX0A 3PSIA 2K32A 2RCFA 4AYBB 1JCKB 4A76A 1ASZA 2PPBC 1D5ZC 3SDZA 1Z6HA 3KOJA 2CH4W 3GO5A 1PFNA 4HCEA 5JEAG 1L0WA 4Q5VA 5IOCA 4GZYC 3HKZG 3CAMA 1F9SA 5JEAH 4JW0A 1V8QA 4NP5A 5C0XJ 3H15A 4HIKA 3S24A 1CSPA 2Z6KA 2L5TA 1FJGQ 2EQSA 4EQPA 1CKOA 1E22A 1G8ZD 1GO3E 5D14A 2XRSD 2BDOA 4BY1G 1F77A 1EYDA 3EROA 4YIJA 3LGJA 2F0GA 4G7HC 1E7ZA 1PYSB 2MNAA 4A3GB 2WFWA 4LAAA 4WJ4A 3QWNA 2OQ0A 4BY1H 5M3FG 3CD6A 1VMCA 2VS1A 4DV3L 4A4IA 4A3BG 3D8GA 3OIQA 1JE4A 2Q2UA 1K8GA 4DXGA 3E0JA 2E2JH 4P75A 4ME3A 1NUCA 3PQIA 2Z6BA 4A3BH 2HD3A 4EQNA 2I0QA 1T9HA 5KYIA 3P75A 2EY2A 3RR5A 1ENFA 4RGOS 2ZM6L 5E7NA 4A3IG 3HOXB 1PTOC 2OTLA 1HHVA 1WCMG 5I4DA 1SMYC 3FKIB 4DN4M 4H13C 3HS0C 1O7YA 3SK8A 2RSOA 3PO3G 4A3IH 4LK1C 3AFQA 1B9NA 1XNRL 1QG7A 5D3IB 3HRZC 3FMCA 3I4NG 5CV9A 2NVQB 1U9RA 2X6GA 4WORA 4KV6A 3PO3H 4L63B 2DJGC 1VQHA 3I4NH 1V1PB 1Y8NB 1X32A 3R8BA 4C3IG 3GTJH 4B3TQ 4BBRB 2LFNA 2JA7H 2J4XA 3ERSX 4WJWA 2EVBA 4HCSA 4C3IH 1ZEQX 4JI2Q 2EXZA 1KAWA 5A2QE 1QZGA 4ABNA 5IT9L 3TREA 1KRTA 1YITA 2FJ2A 2NYZD 5A35A 5C4XG 1GHKA 4LJZC 4CKCA 2EY1A 1STYA 4OWTB 1STGA 3T13A 4JYAL 3C3LA 4PMBA 4RG1A 3I2ZA 4F7XA 5C4XH 2EDGA 2IPKD 4V190 2PQAB 2B2UA 2Q2TA 1S3OA 1EY9A 1XPRA 5EJWA 2YU9B 4JI6L 4JK1C 2BE5C 4JOIC 1JOQA 5IT9c 1TWAH 1PMRA 2F4VQ 2NTSA 1H9KA 3NEMA 1CI3M 3FEWX 1VQIA 1HNXL 5FK9C 1MGSA 4HMJA 1SE4A 1K3BC 1J5EL 4IUQA 4IZ8A 1ICFB 3PIP3 3W1BA 2VQEQ 4ZAIA 2K6AA 3HOYG 1JR0D 2JA6G 2PNHA 3K7AB 4B9XA 4JI3Q 4LWCA 3HOYH 1CHPD 5FO7B 4PV1C 1G51A 1TVXA 2NVXB 1Y8PB 5K36H 2YTVA 3TS2A 4IURA 1SEBD 5IP7G 1O7LA 3J7YW 4DV6L 1U4MA 4K8JA 2L1BA 1BOSA 1VQ7A 4Q0FA 5IP7H 1KLUD 2K5QA 4HSVA 1IBKQ 2PNRC 1XMQQ 5LHY1 1SMXA 5C44B 1DYQA 3Q6SA 3CCVA 5HGQA 1N33Q 1TS3A 2LS01 3SHLA 2JYOA 1SYBA 3RUZA 4CGYB 5EAYA 1KLGD 4DR2Q 3MEFA 1X3EA 3U4VA 3I4MB 3S1QB 4Z9CB 1IBML 2IL8A 2I07B 2ZJQA 1OXVA 4R4QA 3OHXC 3KBXA 2DY8A 5EGTA 3S16B 1XMOQ 2DUDA 4MN3A 2ES2A 3I56A 2DN8A 1EFWA 4RWSC 1SR3A 3I70A 5IP9G 3TP6A 3CF5A 3MFYA 1LTSD 4DK6C 1E0BA 2EYJA 3C2PA 1R4QB 4Y7NB 1LTAD 4EQOA 2IWHA 2NVTB 4OELB 5C4HA 1GHJA 3QO2A 5C3EB 2ICEC 5DM63 4XYOA 2FHTA 4X64L 3KLSA 1ENAA 3Q0AA 4YY3L 1KIXA 4LF6L 4LNQA 2K5VA 5A2QL 1NY4A 3I4OA 1H9SB 1VQCA 4GLAC 5FLXc 3QOJA 3DWAA 1Z7TA 4KLKA 1H9JA 2K5DA 1TWHH 2LY7A 1UNSA 1FGBD 4QIWB 3GV6A 4KY5A 3JAME 2A6HD 1K8AC 3KBGA 3HKSA 4NDXA 2K4KA 2F3IA 1ZKOA 3H3VI 1FD7D 4PNYA 4IPDA 4DAVA 4KKUA 1G91A 3K57A 1JC7A 2KCCA 1EQRA 3CC7A 1QVCA 1BBXC 3VR3A 3S1MH 3PMFA 4RH6A 1AE2A 3A8IE 2FINB 1B2TA 4JBKA 2PO4A 1JB3A 4DV3Q 2JA5B 2KHSA 1TY0A 2EIFA 5DM73 2ZXPA 1BF4A 4PQXA 4TKOB 4YCWA 3TZUA 3IKJA 4A75A 3FP9A 3J81j 3TDQA 4A3GG 2ZM6Q 1VQ4A 1L1OA 2OWOA 4KN4C 2Z0SA 2KUMA 1VDZA 4A93G 1DCZA 4DA2A 4A3GH 1BCPF 1EUJA 4OX9L 4FVMA 3A8JE 2IW3A 1A0IA 4F88A 4FF4A 3OWFA 2EE1A 3CU7A 5GADC 4A93H 2WAQE 5C4ZA 3DUZA 1GKHA 1QUQB 3D6CA 3ULJA 4X3SA 1EOVA 2ALYB 3R2TA 1S5FD 1YNJC 4UP9A 3VA5A 3SK5A 1X55A 1A8VA 1HZCA 4IQZA 4A3JG 3FKIH 1NMGA 1JWMD 1HZAA 2X69A 4A3JH 1PYWD 2ZXOA 5C0XI 2NVQH 4OEMB 1NR2A 1BXTA 1MJEA 3DLLA 1STBA 4JYAQ 4BBRG 3GTGH 5DLQE 4OHJA 1C9OA 1I94L 3MXUA 2CQAA 4EVOA 3DWQA 4BBRH 4K2KA 3VYTA 4JI6Q 3WDNA 1AN8A 4BY1B 2EYFA 1MSGA 4IO9A 1UE1A 4LMQD 4LW1A 2E5LL 3BYYB 4FP5D 2LMCB 4UHVA 2ZTDA 4UP8A 3ULPA 1SJHD 5M3FB 3NBHA 1HTLD 4C3HG 2OEOA 1J5EQ 2E2DC 3KLWA 1FJGL 2KEDA 2PQAA 3GTQH 1W6KA 2OQKA 2EZVA 1CK1A 1YZ6A 4J1MA 4C3HH 3NSWA 1LABA 5LMUQ 2MGSA 1TWCH 3JAML 3MXNA 4YCVA 2A69D 2YU9H 4BA1I 4KD4A 4A3IB 4BY7G 1WCMB 2EYPA 4XQQA 2B39A 1MKHA 1VQOA 3M7NA 3M85A 2ID0A 1SDFA 4KN7C 4BY7H 2PZUA 1UE6A 3S1RH 1ZXTA 3UI2A 4V0BA 2MQHA 5KEEA 3I4NB 4DV6Q 2A1AA 1WTXA 2G5DA 1J9OA 2ZTCA 3GTJB 2A6ED 4YCUA 3JAMc 4X3UA 1HXYD 5ELNA 5ELDA 4C3IB 4DR4L 2ENBA 5E1FA 3K7AH 3GP7A 3H09A 4X66L 5TSSA 2V4DA 4IFDG 2MUYA 3NTHA 1PV4A 1PH3A 4A3CG 5KNCA 2WINB 3KF8A 1G2TA 2R93G 4LUVA 3VR6A 1HQRD 3HGBA 4IFDH 2NTTA 3GTMH 2IX3A 4L5SA 1IBMQ 4A3CH 2B3GA 5J3BA 2R93H 5C4XB 3MFGA 2EJGC 4K5VA 1YI2A 3J7AV 4A3LG 3PF4A 1PH4A 4P74A 4FF3A 1CZGA 4GLVB 4DGZA 1GUOA 5JJZA 1WI5A 3W3AA 1K73C 2KHIA 4G57A 2BH2A 3CPFA 3R3OA 1KABA 3RMHA 4A3LH 4B08A 1CKNB 4JI2L 5EPKA 4LF7L 2E74C 2M2LA 2PYKA 2PZTA 3CCJA 1PH8A 2F0MA 5AFWA 1VF7A 2VB2X 1B4OA 3CCQA 1N8RC 1Y14B 4DK0A 4CDEC 3K59A 2B2VC 3K81C 2Q8IB 1EY6A 1RJTA 1YEZA 3G71A 4X64Q 1KRSA 3I7FA 4MHEA 4DXFA 4YY3Q 4LF6Q 1X3FA 1YJ9A 3J80i 3HOYB 3ND9A 1WTVA 2JA6B 2TSSA 3W2DA 3U50C 1IW7C 3DMUA 4GKKL 1HPCA 2K28A 3BVZA 3E6ZX 2H1EA 3ITPA 1G6ZA 2UU9L 1CKMA 1KC8C 3TBIB 4QUCA 4Y7NH 4POGA 3WWVA 1EYAA 4DNTB 2F03A 1JICA 1LLRD 1G291 4XT1B 2NUCA 3ERQA 3H3VC 3MXGA 3DM3A 1PZKD 2L9HA 3A8KE 1EU4A 2RKSA 1KDCA 3AFPA 1UWVA 4ZRZA 2K01A 4DPGA 4HIDA 1PFBA 1D7QA 2L55A 3KYHC 1FNVA 1CA6A 4UDUC 3EVQA 1EZ6A 1IBKL 1U4RA 1EY5A 3OIPA 2AWNA 1EWHA 1A2TA 2B2TC 2GN5A 1CQFA 1ENCA 4ZUJA 2VUMB 2IT1A 4FXDA 2K5WA 1CZWA 5C4JB 2OF1A 2CW0D 3GTLB 4HR7B 1EY4A 2YYZA 4G4KA 2JA5G 4POFA 5I2XA 4BWGB 4OX9Q 4ILWA 5EKIA 4B3RL 2NVYH 5IT9E 2AQ1B 4KKSA 2JA5H 5G3LF 1QZHA 3ND8A 4TRDA 1LTID 3H0GB 3M9BA 4JOIA 1K0SA 3A0JA 4FDBA 4GKJL 1LTBD 1HR0L 1K8MA 1B7YB 1W2BA 5L37A 1X3GA 2I5MX 4DFAA 3L2PA 2B63B 2F4IA 2F0EA 4C3JB 1Q1BA 2CFMA 3BG3A 1SNDA 4OIKA 4ULLA 1RDPD 2R7DA 2V1CC 2BDNA 4JBJA 4JG2A 1I4GA 1L0YB 1I94Q 1IKMA 2E2HB 5H1SE 2RDFA 4LFBQ 3E5SA 3S17B 3S1MB 2AMCB 2F0LA 2XGTA 1VQKA 5IE8A 1DOMA 2Q8RE 5I6WA 4C56C 2E5LQ 1B3AA 4XYQA 4APVA 2XSCA 4H02A 3LWEA 1STAA 1JOOA 5IGGA 1NMFA 1NNXA 4O1NA 2FMCA 3S14B 4DV5L 1SNOA 3L0OA 1MHWC 1QJOA 5IWAL 4QL5A 5ELFA 1D5XC 2D0PA 1LUZA 3CKIB 1L1OB 5IYCG 1X3QA 2KENA 5IYBG 1S5DD 4DUZQ 5LL6X 2M00A 2HUGA 3P7JA 4A93B 3SGIA 3GQBA 3NP8A 1PZJD 5T1IA 4JI5L 5IYCH 4OO1G 5M3FH 1U0LA 1YNXA 5E4WC 1T5XD 1Y69U 3EJIA 1I4PA 3QR8A 3B6YA 1BNZA 2O5JC 3CC2A 4OO1H 1VQAA 4DNRB 5CORA 4UAIA 3T16A 3PIO3 4KTAA 4DR4Q 1WJJA 1PYBA 2DJFC 1A3VA 4X66Q 5M5WB 4X3TA 4A3JB 1WCMH 2KEEA 1MI2A 1GD7A 4JI7L 1VQGA 5FLXE 2KCMA 2IX1A 1A2UA 3AQQA 3U58A 3GTGB 2EYOA 2WV6D 1PRTB 4CDCC 1X3PA 2R7ZB 4FYDA 3I72A 1ESFA 2L0CA 4GN4B 1D8LA 4TSSA 1UE5A 4LF7Q 1R4PB 4YWKA 3STBC 3K5LA 3OMGA 2UXBL 4QB4A 2EY6A 1E2VA 2C9OA 3IAYA 3NQIA 3MAQA 1C0AA 2PMZB 4LF9L 3NWTA 1P8LA 1FVIA 4PG3A 4G7ZC 3X3NA 1ONLA 4UPAA 3TS0A 2N55A 5EKLA 3BYTB 5CV5A 1AZQA 3GTQB 3NBHB 2SDFA 3GDEA 1QB5D 4C3HB 3LWUA 2K5HA 4R4IA 2R92B 2R61A 3KDFA 1TWCB 2N8NA 1CKNA 4K6DA 4P72A 3K5OA 3TP8A 2PMZE 4DR3L 4XIGS 1NBWA 1XPUA 3OTOL 2JEBI 3FDTA 3MXNB 3NBIA 5FJ8G 4GKKQ 2F0IA 2E8GA 4BY7B 2K50A 1I5FA 1STHA 2XWBB 3S1RB 2UU9Q 1C4QA 3U9SA 3PIPA 5KGUA 5FJ8H 3HG9A 1DZ1A 4GOPC 1YNND 2F0TA 2RA4A 5LMUL 1DGSA 1SYGA 3FHWA 4NXNL 1TT2A 1FYCA 1PA6A 4DV4Q 3HFZB 1K9MC 4XXEA 1LO5D 3OMCA 1YVCA 1SE3A 2JA6H 5CV6A 1CQVA 1HH2P 4EQ5A 4PMCA 4HJ8A 1Y1WG 3D4DA 4XDXA 4ID6A 4DV1Q 1F2LA 2Z4HA 3EIVA 3GTMB 3KF8B 1SJED 2R93B 1Y1WH 2A6EC 3K0YA 4OL7A 1DJRD 4G7OC 5FLMG 1J8IA 2E75C 4R9WA 3WOFA 3A5ZB 1BCPB 5FLMH 3CCRA 4FF1A 5CGKA 2K52A 1LT6D 1GUGA 3J81i 4NPSA 3M4OH 2LKVA 3G7LA 5JJKA 2F0NA 2DY7A 4OWWB 3K7UC 1E24A 3VA7A 1N36L 1IZ6A 1LTGD 4X62L 4DUYL 3BZKA 3L3OC 1VQBA 3CXCA 1HUNA 4ZLTF 1KD1C 4B3ML 1TS5A 1CUKA 1UE7A 4B3RQ 4GS3A 5IYDG 1QNKA 4GNXA 1PH6A 2VUMG 5COYA 1PH1A 1D2BA 5KRUA 5FLXL 4GN3B 4WFN3 5IYDH 1TQOA 4KHVA 2MO1A 4GKJQ 4ZQ3A 2VUMH 1PRTF 5JVG3 3Q22A 1HR0Q 4QUFA 4DR1L 1PH9A 5C4JH 1WD1A 5JEAJ 5IP9H 5IGBA 3GTLH 4IUNA 1FGUA 1RL2A 4R4TA 2BCOA 3N6RA 3OOCA 3EA6A 3WOEA 3M4YA 4B3SQ 1DONA 5DAUA 3CCLA 1C8CA 3H0GG 3HOZG 2CWPA 1S40A 1BR9A 2WACA 2OCEA 1H9RA 1QOHA 2F0VA 4I7ZC 5ELCA 5FOBB 1I50B 3H0GH 3HOZH 3C1FA 1SAPA 2B63G 2QILA 4EX5A 3ER0A 5BR8L 1VQMA 1Q86C 4JBMA 4C3JG 3BZDB 2UXCL 1WTHA 5IY0A 3D3RA 3F8TA 2XRQD 2B63H 4C3JH 2G9HD 1G6PA 3PUZA 2F0JA 3VR4A 1XXGA 1MD2D 3CCMA 4NXML 4NMZA 2I46A 4DV0L 4DAMA 1EEFD 1BCPD 5CC4A 1PH5A 4MTNA 2P5ZX 3MC0B 1CT1D 1SNMA 2HCCA 1R9TH 4I7AA 1YHAA 4IALA 3J80E 4DV5Q 2E2HH 1C7YA 2EYMA 5IWAQ 3S17H 3M4PA 1LT3D 2NBFA 4QF4A 3CCUA 2YTYA 1UEBA 3I8ZA 1U5KA 3RD4A 2NVYB 1SLJA 3D4RA 4JI5Q 3IFTA 3GV3A 1Q8KA 1GUNA 1EY0A 5BN4A 2SNMA 2L4NA 5C3WA 2EPBA 4LF5L 1EQVA 4AQYL 3W1GA 2CW0C 3S14H 1IYUA
chains in the Genus database with same CATH topology
1WI5A 1K73C 2KHIA 3ZJYC 2BH2A 3CPFA 3UDXA 1EIFA 4A3LH 3T1YL 2E2IH 1CKNB 4JI2L 4LF7L 2Q2HA 4C2MH 1JE5A 2JA9A 3PSIA 3CCJA 3CP0A 4YWMA 1Z9FA 1PH8A 4ALPA 1EIYB 4X6AH 2AHOB 3CCQA 1X6OA 4A76A 4JI1L 1N8RC 1ASZA 1Y14B 4JI7Q 2UUCQ 4JCVE 3RZDH 3A74A 1B8AA 2K75A 5K36G 4KHPL 3W5OA 3KOJA 3GO5A 3K81C 3PO2G 5JEAG 2JK8A 1L0WA 1VQDA 1HNWL 1YEZA 3G71A 1I3QH 3HKZG 3AEVA 2KHJA 1KRSA 4O2DA 4X64Q 4KI0A 1Q81C 1PH7A 3CAMA 3I7FA 4YY3Q 4JI0Q 4LF6Q 3PO2H 1X3FA 2B29A 3H15A 3J80i 5C0XJ 4HIKA 1YJ9A 3M4QA 3S24A 1CSPA 2ZJRA 3S1NH 2Z6KA 1FJGQ 2EQSA 2RHQB 1CKOA 3GTOH 4DV2L 1E22A 1N32Q 3U50C 1GO3E 4LF8L 5ELOA 4GKKL 2PI2E 2ZJPA 4HJAA 2UXBQ 2ZTEA 5M5WH 4YHHL 4BY1G 3RLNA 2VL6A 4JI8Q 3LGJA 2Z6KC 2UU9L 1CKMA 1KC8C 4LF9Q 1E7ZA 5AJ3L 1PYSB 2MNAA 3KF6B 2Y0SG 2WFWA 3UE0A 4WJ4A 4Y7NH 2OQ0A 4X65L 3CMAA 1BBUA 4DNIA 5M3FG 4BY1H 3WWVA 4POGA 3CD6A 2R7ZG 2VS1A 3JC66 2JE6I 1CSQA 4A4IA 4DV3L 4A3BG 2Q2UA 2EXDA 1G291 1K8GA 2R7ZH 2E2JH 4LFBL 4IFDI 4P75A 3DM3A 4ME3A 1XNQL 3EBEA 1E1OA 4DR3Q 1VQLA 4A3BH 3PV0A 1OXSC 3OTOQ 1T9HA 4HJ7A 2I0QA 4LFCL 4IOCA 3AFPA 1UWVA 3RR5A 1HJPA 1YJNA 2ZM6L 2F52A 3PUYA 5E7NA 4DPGA 4HIDA 4OONA 4A3IG 2OTLA 1WCMG 4BXXG 1D7QA 1XTDA 2GVBA 4O0AA 1OXTA 3F1ZA 2HHHL 4MZ9A 3KYHC 2R92G 3PO3G 4A3IH 1XNRL 3AFQA 4IPGA 4OXPA 4PZ6A 4BXXH 2CKZB 1KXLA 1ASYA 1IBKL 3I4NG 2R92H 1M90C 3PCOB 3PO3H 3OW2A 1BKBA 4NXNQ 1VQHA 3I4NH 5GROA 1HZ9A 3RN2A 1WFQA 1M1KC 4IPCA 4AIMA 1XPOA 2AWNA 2GN5A 4K0KL 4BBSG 4DUZL 3GTJH 1IBLL 4B3TQ 3HOUG 3ULLA 1TWGH 4BA2I 2IT1A 2JA7H 1K83H 3ERSX 4K0KQ 2K14A 1N34L 4C3IH 3F2DA 4IOAA 3HOUH 4JI2Q 1VQ6A 1IYJB 2YYZA 1KAWA 1QZGA 2JA5G 4POFA 4OX9Q 3TREA 1KRTA 1YITA 2LSSA 1KL9A 5C4XG 4QY7A 4B3RL 2NVYH 1JMCA 2JA5H 4Y52H 4OWTB 1QZHA 4JYAL 4RG1A 3I2ZA 1FL0A 1SRUA 3M9BA 2MO0A 4JOIA 5C4XH 2ASBA 3NELA 3E9IA 2PQAB 3A0JA 4FDBA 4YWLA 4GKJL 2Q2TA 1S3OA 2D62A 2NN6G 4AYBG 1XPRA 1HR0L 1N36Q 4JI6L 1B7YB 3CW2C 1W2BA 5C0XG 4JOIC 4PZ8A 1X3GA 2I5MX 2VQFL 4DR5L 5IT9c 4QIWE 3L2PA 4X62Q 1TWAH 3J80c 4DUYQ 2F4VQ 3J7A5 3NEMA 1Q1BA 2CFMA 4IJLA 3K8AA 4B3MQ 3E0EA 4WJ3M 1VQIA 1Q46A 2HIXA 1HNXL 1MJCA 3KDFB 1J5EL 2R7DA 4X65Q 2V1CC 3S2DH 4JBJA 3W1BA 2VQEQ 3PF5A 1SE8A 4DKAC 4JG2A 4DR6L 3HOYG 1I94Q 5H1SE 2PNHA 4IJHA 2JA6G 1JJ2A 4LFBQ 2AMCB 1E3PA 1AE3A 2WB1E 2XGTA 1VQKA 4JI3Q 4LWCA 4GOPB 4QQBX 4DR1Q 5IE8A 3HOYH 1L2FA 2FXQA 3Q8DA 1WYDA 4LFCQ 3A5UA 1G51A 2E5LQ 3KF6A 4APVA 3HOVG 2IX0A 4H02A 3KJOA 2YTVA 1HNZL 3TS2A 5IP7G 4JC0A 2D0OA 3PGZA 1NMFA 3F2CA 3RLOA 1YHQA 4JI4L 1JB7A 2JA8G 4DV6L 1MIUA 2HHHQ 3JAMi 3HOVH 1K3RA 1VQ7A 1XNRQ 5IP7H 2JEAI 4JV5Q 1L1OC 3BJUA 1IBKQ 3K80C 1XMQQ 1SMXA 2JA8H 4KHZA 2ATWA 1SROA 2N3SA 3U4ZA 4DV5L 3CCVA 1OTCA 5HGQA 3L0OA 1N33Q 4QGUA 5IWAL 3PUXA 4L5TA 5BR8Q 4QL5A 2D0PA 2UXCQ 5EAYA 1LUZA 5IYCG 1L1OB 3BZCA 3HOXG 2KENA 3MEFA 5IYBG 1X3EA 3U4VA 4DR2Q 4DUZQ 3FKIG 3UDFA 4A3FG 1GM5A 3PUWA 2L15A 3SGIA 5IYCH 3HOXH 4JI5L 3H3VH 4OO1G 4JBWA 4PMWA 5M3FH 1U0LA 1YNXA 4A3FH 1IBML 4DV7L 2UXDL 1V9PA 4DV4L 3S15H 4DR7Q 4A3KG 1E1TA 3B6YA 2ZJQA 4NXMQ 1OXVA 3UDGA 4LFAL 4R4QA 4DV0Q 2NN6I 2UUAQ 3STBD 1VQAA 3CC2A 4LF4L 2CQOA 3M3YH 3K0XA 1I50H 3UDIA 4DV1L 3OYYA 1XMOQ 2AWOA 2HQLA 2DUDA 1SFOH 2ES2A 4DR4Q 2C35B 3NENA 3I56A 1EFWA 1WJJA 1PYBA 1A63A 1X9NA 4X66Q 1SR3A 5IP9G 1YIJA 1WCMH 3CF5A 1GD7A 1A62A 4JI7L 4DK6C 4GNXC 1S72A 2UUCL 4HIOA 1VQGA 3T1HQ 1JT8A 2KCMA 2K5NA 1AH9A 1VQ8A 2VQFQ 4UP7A 2IX1A 3AQQA 3HKZE 3U58A 2HT1A 2VZAA 1V1QA 3EN2A 5GAGC 1VS0A 4X64L 4GNXB 4LF5Q 1RIPA 2BH8A 4AQYQ 4YY3L 2Q2IA 1KIXA 4LF6L 1HNXQ 4LNQA 2XTIA 4GN4B 4A3MG 1D8LA 1VQEA 1EWIA 2K5VA 1NY4A 3I4OA 1VQCA 4GLAC 4BBSH 3T1YQ 1N32L 1UE5A 5FLXc 1NJIC 4YWKA 4LF7Q 3STBC 5LMNL 4A3MH 2UXBL 4LUZA 1X65A 4MNOA 2Y0SE 2UUBL 4KLKA 4JI1Q 1C0AA 1B70B 1TWHH 4LF9L 1P8LA 1FVIA 4PG3A 3GD7A 1VCIA 4UPAA 3TS0A 1EYGA 2RHSB 4GN5A 3GTPH 4KHPQ 1VQ9A 4IPHA 5M5XH 1VQPA 2WAQG 3NBHB 3GDEA 2QA4A 1HNWQ 2K5HA 4R4IA 1K8AC 3HKSA 2K4KA 3KDFA 2F3IA 2N8NA 2KBNA 2HIVA 5JJIA 4A3DG 3H3VI 1CKNA 1JJGA 2VW9A 4P72A 4IPDA 1YJWA 3AYHB 2PMZE 3CCSA 4DR3L 4XIGS 1NBWA 1XPUA 3OTOL 2JEBI 4DV2Q 1PHJA 4A3DH 4LF8Q 3MXNB 5FJ8G 4GKKQ 1EQRA 4OO1I 2BA0A 3CC7A 2YTXA 2E8GA 4GOPA 4YHHQ 1QVCA 1I5FA 1IXRA 2K50A 3RNUA 4B3SL 2PI2A 3RN5A 2UU9Q 3PIPA 3E9HA 5AJ3Q 3HOWG 5FJ8H 2QEXA 2NZOA 3UE1A 3S1MH 3TRZA 4P71A 1AE2A 3G6EA 1IL2A 2I5HA 4GOPC 1NTGA 4R4CA 4JBKA 1Q82C 3HOWH 4DV3Q 5GAHC 2NVXH 2KCTA 5LMUL 1VQNA 1DGSA 3VDYA 3FHWA 2EIFA 1PFSA 4NXNL 4DV7Q 1PA6A 5M5YH 3HFZB 4DV4Q 1K9MC 1XNQQ 4YCWA 5C44G 4GLXA 1YVCA 5LMNW 2N49A 4B3TL 4LF4Q 2JA6H 1TXYA 4A75A 1HH2P 3FP9A 4EQ5A 4HJ8A 1Y1WG 1N9WA 3TEHB 2N78A 2GVAA 3J81j 4A3GG 4DV1Q 5C44H 2ZM6Q 4OWXB 1VQFA 1L1OA 3EIVA 3G4SA 1VQ4A 4QJFA 2OWOA 3KF8B 1BVSA 2Z0SA 3BU2A 1Y1WH 4A93G 2CWAA 2RF4A 1LTLA 5GAEC 2I5LX 3I4MG 4A3GH 1EUJA 4OX9L 5FLMG 3RZOH 1A0IA 3D0FA 2H5XA 4AH6A 1YHBA 5GADC 3A5ZB 4L5RC 1KQSA 2LXKA 4A93H 2WAQE 3I4MH 3CCRA 5FLMH 3S1QH 1GKHA 1HR0W 2K52A 1QUQB 3ULJA 3J81i 1V43A 1QVGA 4IFDJ 2CCZA 1EOVA 4NPSA 2ALYB 3M4OH 2IHFA 1NE3A 4AYBE 5JJKA 1IBLQ 4UP9A 2DGYA 4OWWB 3K7UC 1SN8A 1E24A 1X55A 1EQQA 1A8VA 1HZCA 1N36L 3S16H 1IZ6A 4TQUS 4A3JG 2RCNA 1N34Q 2BA1A 5IYBH 1JJCB 1W3SA 3FKIH 4X62L 1NMGA 4DUYL 1HZAA 3BZKA 2F4VL 5LMNQ 3CMEA 1VQBA 1VQJA 3CXCA 3CC4A 3PIOA 4HIMA 4A3JH 1KD1C 2R7FA 3CQZH 4B3ML 2UUBQ 4L5QA 3KJPA 5C0XI 1VQ5A 2NVQH 1CUKA 1UE7A 4B3RQ 1Q12A 4A3KH 1MJEA 4GS3A 5C3EG 2AKWB 3DLLA 3CPWA 5IYDG 3PUVA 4JYAQ 4GNXA 2JJQA 1PH6A 4BBRG 2VUMG 3GTGH 2NVTH 5DLQE 2VQEL 4R4OA 1Y1VG 1OXXK 1C9OA 1PVOA 1PH1A 5C3EH 1I94L 4GN3B 5IYDH 2MO1A 4GKJQ 4BBRH 2VUMH 2R6GA 4JI3L 1Y1VH 1HR0Q 4JI6Q 1WOCA 4DR1L 1PH9A 5C4JH 3ICEA 5JEAJ 5IP9H 4IO9A 4DR5Q 1UE1A 3GTLH 1I6HH 4LW1A 1FGUA 1RL2A 3RLFA 4R4TA 3J7ZC 4A3EG 2E5LL 4NB3A 1GVPA 3S2HH 1H95A 2ZTDA 4UP8A 3ULPA 4B3SQ 4JI0L 3CCLA 2A19A 3H0GG 2CWPA 3TQYA 4A3EH 1S40A 3HOZG 3IRBA 1J5EQ 3KLWA 1FJGL 2OCEA 2PQAA 3F2BA 4JV5L 1LYLA 3GTQH 2A8VA 4XTCS 2OQKA 1XMQL 3H0GH 3HOZH 1YZ6A 4C3HH 4UY8C 4DR6Q 1J6QA 2IHEA 5LMUQ 1LM0A 1TWCH 2VY3A 4JI8L 1N33L 2LXJA 2B63G 4EX5A 2IY5B 3ER0A 5BR8L 1VQMA 4YCVA 1Q86C 2JA7G 4JBMA 4HJ9A 2YU9H 2UXCL 4BA1I 4BY7G 1O7IA 4DR2L 5IY0A 4DK3C 2MFIA 4PZ7A 3GTKH 3F8TA 2WB1G 5HY6A 2QGQA 2B63H 1MKHA 1K0RA 1VQOA 3M7NA 1P16A 3M85A 1OXUA 4C3JH 2ID0A 4BY7H 1KHIA 1Q1EA 3PUZA 1YBYA 5GQOA 1HNZQ 1Q7YC 1G6PA 1UE6A 3S1RH 1XJVA 1PH2A 3CCEA 2MQHA 4DR7L 4JI4Q 1TWFH 3CCMA 4DV6Q 2A1AA 4NXML 2ZTCA 4J15A 4DV0L 3G48A 4DAMA 2UUAL 1PH5A 4MTNA 4YCUA 1X54A 3JAMc 4HJ5A 1R9TH 1YHAA 1XMOL 2WP8J 4DV5Q 5M3MG 5ELNA 1X56A 2E2HH 4DR4L 2YV5A 5IWAQ 1C7YA 4LUOA 1BBWA 3S17H 3KFUA 3K7AH 1HZBA 3L7ZC 3M4PA 2OTJA 4X66L 4R1JA 3CCUA 2YTYA 1UEBA 4IFDG 2VNUD 1PV4A 5M3MH 1PH3A 4A3CG 1U5KA 3J81c 3I55A 2R93G 1Z47A 1SLJA 4LUVA 3D31A 4RMFA 3T1HL 4JI5Q 3GTMH 4L5SA 1IBMQ 1QVFA 4A3CH 2B3GA 1Q8KA 4P73A 2UXDQ 5J3BA 4DAYB 2R93H 4TVAB 5JJLA 4LFAQ 2NZHA 2JQOA 1YI2A 4A3LG 4LF5L 3PF4A 1PH4A 4AQYL 4P74A 3W1GA 1QUQA 4GLVB 3S14H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WI5 A;  1K73 C;  2KHI A;  3ZJY C;  2BH2 A;  3CPF A;  3UDX A;  1EIF A;  4A3L H;  3T1Y L;  2E2I H;  1CKN B;  4JI2 L;  4LF7 L;  2Q2H A;  4C2M H;  1JE5 A;  2JA9 A;  3PSI A;  3CCJ A;  3CP0 A;  4YWM A;  1Z9F A;  1PH8 A;  4ALP A;  1EIY B;  4X6A H;  2AHO B;  3CCQ A;  1X6O A;  4A76 A;  4JI1 L;  1N8R C;  1ASZ A;  1Y14 B;  4JI7 Q;  2UUC Q;  4JCV E;  3RZD H;  3A74 A;  1B8A A;  2K75 A;  5K36 G;  4KHP L;  3W5O A;  3KOJ A;  3GO5 A;  3K81 C;  3PO2 G;  5JEA G;  2JK8 A;  1L0W A;  1VQD A;  1HNW L;  1YEZ A;  3G71 A;  1I3Q H;  3HKZ G;  3AEV A;  2KHJ A;  1KRS A;  4O2D A;  4X64 Q;  4KI0 A;  1Q81 C;  1PH7 A;  3CAM A;  3I7F A;  4YY3 Q;  4JI0 Q;  4LF6 Q;  3PO2 H;  1X3F A;  2B29 A;  3H15 A;  3J80 i;  5C0X J;  4HIK A;  1YJ9 A;  3M4Q A;  3S24 A;  1CSP A;  2ZJR A;  3S1N H;  2Z6K A;  1FJG Q;  2EQS A;  2RHQ B;  1CKO A;  3GTO H;  4DV2 L;  1E22 A;  1N32 Q;  3U50 C;  1GO3 E;  4LF8 L;  5ELO A;  4GKK L;  2PI2 E;  2ZJP A;  4HJA A;  2UXB Q;  2ZTE A;  5M5W H;  4YHH L;  4BY1 G;  3RLN A;  2VL6 A;  4JI8 Q;  3LGJ A;  2Z6K C;  2UU9 L;  1CKM A;  1KC8 C;  4LF9 Q;  1E7Z A;  5AJ3 L;  1PYS B;  2MNA A;  3KF6 B;  2Y0S G;  2WFW A;  3UE0 A;  4WJ4 A;  4Y7N H;  2OQ0 A;  4X65 L;  3CMA A;  1BBU A;  4DNI A;  5M3F G;  4BY1 H;  3WWV A;  4POG A;  3CD6 A;  2R7Z G;  2VS1 A;  3JC6 6;  2JE6 I;  1CSQ A;  4A4I A;  4DV3 L;  4A3B G;  2Q2U A;  2EXD A;  1G29 1;  1K8G A;  2R7Z H;  2E2J H;  4LFB L;  4IFD I;  4P75 A;  3DM3 A;  4ME3 A;  1XNQ L;  3EBE A;  1E1O A;  4DR3 Q;  1VQL A;  4A3B H;  3PV0 A;  1OXS C;  3OTO Q;  1T9H A;  4HJ7 A;  2I0Q A;  4LFC L;  4IOC A;  3AFP A;  1UWV A;  3RR5 A;  1HJP A;  1YJN A;  2ZM6 L;  2F52 A;  3PUY A;  5E7N A;  4DPG A;  4HID A;  4OON A;  4A3I G;  2OTL A;  1WCM G;  4BXX G;  1D7Q A;  1XTD A;  2GVB A;  4O0A A;  1OXT A;  3F1Z A;  2HHH L;  4MZ9 A;  3KYH C;  2R92 G;  3PO3 G;  4A3I H;  1XNR L;  3AFQ A;  4IPG A;  4OXP A;  4PZ6 A;  4BXX H;  2CKZ B;  1KXL A;  1ASY A;  1IBK L;  3I4N G;  2R92 H;  1M90 C;  3PCO B;  3PO3 H;  3OW2 A;  1BKB A;  4NXN Q;  1VQH A;  3I4N H;  5GRO A;  1HZ9 A;  3RN2 A;  1WFQ A;  1M1K C;  4IPC A;  4AIM A;  1XPO A;  2AWN A;  2GN5 A;  4K0K L;  4BBS G;  4DUZ L;  3GTJ H;  1IBL L;  4B3T Q;  3HOU G;  3ULL A;  1TWG H;  4BA2 I;  2IT1 A;  2JA7 H;  1K83 H;  3ERS X;  4K0K Q;  2K14 A;  1N34 L;  4C3I H;  3F2D A;  4IOA A;  3HOU H;  4JI2 Q;  1VQ6 A;  1IYJ B;  2YYZ A;  1KAW A;  1QZG A;  2JA5 G;  4POF A;  4OX9 Q;  3TRE A;  1KRT A;  1YIT A;  2LSS A;  1KL9 A;  5C4X G;  4QY7 A;  4B3R L;  2NVY H;  1JMC A;  2JA5 H;  4Y52 H;  4OWT B;  1QZH A;  4JYA L;  4RG1 A;  3I2Z A;  1FL0 A;  1SRU A;  3M9B A;  2MO0 A;  4JOI A;  5C4X H;  2ASB A;  3NEL A;  3E9I A;  2PQA B;  3A0J A;  4FDB A;  4YWL A;  4GKJ L;  2Q2T A;  1S3O A;  2D62 A;  2NN6 G;  4AYB G;  1XPR A;  1HR0 L;  1N36 Q;  4JI6 L;  1B7Y B;  3CW2 C;  1W2B A;  5C0X G;  4JOI C;  4PZ8 A;  1X3G A;  2I5M X;  2VQF L;  4DR5 L;  5IT9 c;  4QIW E;  3L2P A;  4X62 Q;  1TWA H;  3J80 c;  4DUY Q;  2F4V Q;  3J7A 5;  3NEM A;  1Q1B A;  2CFM A;  4IJL A;  3K8A A;  4B3M Q;  3E0E A;  4WJ3 M;  1VQI A;  1Q46 A;  2HIX A;  1HNX L;  1MJC A;  3KDF B;  1J5E L;  2R7D A;  4X65 Q;  2V1C C;  3S2D H;  4JBJ A;  3W1B A;  2VQE Q;  3PF5 A;  1SE8 A;  4DKA C;  4JG2 A;  4DR6 L;  3HOY G;  1I94 Q;  5H1S E;  2PNH A;  4IJH A;  2JA6 G;  1JJ2 A;  4LFB Q;  2AMC B;  1E3P A;  1AE3 A;  2WB1 E;  2XGT A;  1VQK A;  4JI3 Q;  4LWC A;  4GOP B;  4QQB X;  4DR1 Q;  5IE8 A;  3HOY H;  1L2F A;  2FXQ A;  3Q8D A;  1WYD A;  4LFC Q;  3A5U A;  1G51 A;  2E5L Q;  3KF6 A;  4APV A;  3HOV G;  2IX0 A;  4H02 A;  3KJO A;  2YTV A;  1HNZ L;  3TS2 A;  5IP7 G;  4JC0 A;  2D0O A;  3PGZ A;  1NMF A;  3F2C A;  3RLO A;  1YHQ A;  4JI4 L;  1JB7 A;  2JA8 G;  4DV6 L;  1MIU A;  2HHH Q;  3JAM i;  3HOV H;  1K3R A;  1VQ7 A;  1XNR Q;  5IP7 H;  2JEA I;  4JV5 Q;  1L1O C;  3BJU A;  1IBK Q;  3K80 C;  1XMQ Q;  1SMX A;  2JA8 H;  4KHZ A;  2ATW A;  1SRO A;  2N3S A;  3U4Z A;  4DV5 L;  3CCV A;  1OTC A;  5HGQ A;  3L0O A;  1N33 Q;  4QGU A;  5IWA L;  3PUX A;  4L5T A;  5BR8 Q;  4QL5 A;  2D0P A;  2UXC Q;  5EAY A;  1LUZ A;  5IYC G;  1L1O B;  3BZC A;  3HOX G;  2KEN A;  3MEF A;  5IYB G;  1X3E A;  3U4V A;  4DR2 Q;  4DUZ Q;  3FKI G;  3UDF A;  4A3F G;  1GM5 A;  3PUW A;  2L15 A;  3SGI A;  5IYC H;  3HOX H;  4JI5 L;  3H3V H;  4OO1 G;  4JBW A;  4PMW A;  5M3F H;  1U0L A;  1YNX A;  4A3F H;  1IBM L;  4DV7 L;  2UXD L;  1V9P A;  4DV4 L;  3S15 H;  4DR7 Q;  4A3K G;  1E1T A;  3B6Y A;  2ZJQ A;  4NXM Q;  1OXV A;  3UDG A;  4LFA L;  4R4Q A;  4DV0 Q;  2NN6 I;  2UUA Q;  3STB D;  1VQA A;  3CC2 A;  4LF4 L;  2CQO A;  3M3Y H;  3K0X A;  1I50 H;  3UDI A;  4DV1 L;  3OYY A;  1XMO Q;  2AWO A;  2HQL A;  2DUD A;  1SFO H;  2ES2 A;  4DR4 Q;  2C35 B;  3NEN A;  3I56 A;  1EFW A;  1WJJ A;  1PYB A;  1A63 A;  1X9N A;  4X66 Q;  1SR3 A;  5IP9 G;  1YIJ A;  1WCM H;  3CF5 A;  1GD7 A;  1A62 A;  4JI7 L;  4DK6 C;  4GNX C;  1S72 A;  2UUC L;  4HIO A;  1VQG A;  3T1H Q;  1JT8 A;  2KCM A;  2K5N A;  1AH9 A;  1VQ8 A;  2VQF Q;  4UP7 A;  2IX1 A;  3AQQ A;  3HKZ E;  3U58 A;  2HT1 A;  2VZA A;  1V1Q A;  3EN2 A;  5GAG C;  1VS0 A;  4X64 L;  4GNX B;  4LF5 Q;  1RIP A;  2BH8 A;  4AQY Q;  4YY3 L;  2Q2I A;  1KIX A;  4LF6 L;  1HNX Q;  4LNQ A;  2XTI A;  4GN4 B;  4A3M G;  1D8L A;  1VQE A;  1EWI A;  2K5V A;  1NY4 A;  3I4O A;  1VQC A;  4GLA C;  4BBS H;  3T1Y Q;  1N32 L;  1UE5 A;  5FLX c;  1NJI C;  4YWK A;  4LF7 Q;  3STB C;  5LMN L;  4A3M H;  2UXB L;  4LUZ A;  1X65 A;  4MNO A;  2Y0S E;  2UUB L;  4KLK A;  4JI1 Q;  1C0A A;  1B70 B;  1TWH H;  4LF9 L;  1P8L A;  1FVI A;  4PG3 A;  3GD7 A;  1VCI A;  4UPA A;  3TS0 A;  1EYG A;  2RHS B;  4GN5 A;  3GTP H;  4KHP Q;  1VQ9 A;  4IPH A;  5M5X H;  1VQP A;  2WAQ G;  3NBH B;  3GDE A;  2QA4 A;  1HNW Q;  2K5H A;  4R4I A;  1K8A C;  3HKS A;  2K4K A;  3KDF A;  2F3I A;  2N8N A;  2KBN A;  2HIV A;  5JJI A;  4A3D G;  3H3V I;  1CKN A;  1JJG A;  2VW9 A;  4P72 A;  4IPD A;  1YJW A;  3AYH B;  2PMZ E;  3CCS A;  4DR3 L;  4XIG S;  1NBW A;  1XPU A;  3OTO L;  2JEB I;  4DV2 Q;  1PHJ A;  4A3D H;  4LF8 Q;  3MXN B;  5FJ8 G;  4GKK Q;  1EQR A;  4OO1 I;  2BA0 A;  3CC7 A;  2YTX A;  2E8G A;  4GOP A;  4YHH Q;  1QVC A;  1I5F A;  1IXR A;  2K50 A;  3RNU A;  4B3S L;  2PI2 A;  3RN5 A;  2UU9 Q;  3PIP A;  3E9H A;  5AJ3 Q;  3HOW G;  5FJ8 H;  2QEX A;  2NZO A;  3UE1 A;  3S1M H;  3TRZ A;  4P71 A;  1AE2 A;  3G6E A;  1IL2 A;  2I5H A;  4GOP C;  1NTG A;  4R4C A;  4JBK A;  1Q82 C;  3HOW H;  4DV3 Q;  5GAH C;  2NVX H;  2KCT A;  5LMU L;  1VQN A;  1DGS A;  3VDY A;  3FHW A;  2EIF A;  1PFS A;  4NXN L;  4DV7 Q;  1PA6 A;  5M5Y H;  3HFZ B;  4DV4 Q;  1K9M C;  1XNQ Q;  4YCW A;  5C44 G;  4GLX A;  1YVC A;  5LMN W;  2N49 A;  4B3T L;  4LF4 Q;  2JA6 H;  1TXY A;  4A75 A;  1HH2 P;  3FP9 A;  4EQ5 A;  4HJ8 A;  1Y1W G;  1N9W A;  3TEH B;  2N78 A;  2GVA A;  3J81 j;  4A3G G;  4DV1 Q;  5C44 H;  2ZM6 Q;  4OWX B;  1VQF A;  1L1O A;  3EIV A;  3G4S A;  1VQ4 A;  4QJF A;  2OWO A;  3KF8 B;  1BVS A;  2Z0S A;  3BU2 A;  1Y1W H;  4A93 G;  2CWA A;  2RF4 A;  1LTL A;  5GAE C;  2I5L X;  3I4M G;  4A3G H;  1EUJ A;  4OX9 L;  5FLM G;  3RZO H;  1A0I A;  3D0F A;  2H5X A;  4AH6 A;  1YHB A;  5GAD C;  3A5Z B;  4L5R C;  1KQS A;  2LXK A;  4A93 H;  2WAQ E;  3I4M H;  3CCR A;  5FLM H;  3S1Q H;  1GKH A;  1HR0 W;  2K52 A;  1QUQ B;  3ULJ A;  3J81 i;  1V43 A;  1QVG A;  4IFD J;  2CCZ A;  1EOV A;  4NPS A;  2ALY B;  3M4O H;  2IHF A;  1NE3 A;  4AYB E;  5JJK A;  1IBL Q;  4UP9 A;  2DGY A;  4OWW B;  3K7U C;  1SN8 A;  1E24 A;  1X55 A;  1EQQ A;  1A8V A;  1HZC A;  1N36 L;  3S16 H;  1IZ6 A;  4TQU S;  4A3J G;  2RCN A;  1N34 Q;  2BA1 A;  5IYB H;  1JJC B;  1W3S A;  3FKI H;  4X62 L;  1NMG A;  4DUY L;  1HZA A;  3BZK A;  2F4V L;  5LMN Q;  3CME A;  1VQB A;  1VQJ A;  3CXC A;  3CC4 A;  3PIO A;  4HIM A;  4A3J H;  1KD1 C;  2R7F A;  3CQZ H;  4B3M L;  2UUB Q;  4L5Q A;  3KJP A;  5C0X I;  1VQ5 A;  2NVQ H;  1CUK A;  1UE7 A;  4B3R Q;  1Q12 A;  4A3K H;  1MJE A;  4GS3 A;  5C3E G;  2AKW B;  3DLL A;  3CPW A;  5IYD G;  3PUV A;  4JYA Q;  4GNX A;  2JJQ A;  1PH6 A;  4BBR G;  2VUM G;  3GTG H;  2NVT H;  5DLQ E;  2VQE L;  4R4O A;  1Y1V G;  1OXX K;  1C9O A;  1PVO A;  1PH1 A;  5C3E H;  1I94 L;  4GN3 B;  5IYD H;  2MO1 A;  4GKJ Q;  4BBR H;  2VUM H;  2R6G A;  4JI3 L;  1Y1V H;  1HR0 Q;  4JI6 Q;  1WOC A;  4DR1 L;  1PH9 A;  5C4J H;  3ICE A;  5JEA J;  5IP9 H;  4IO9 A;  4DR5 Q;  1UE1 A;  3GTL H;  1I6H H;  4LW1 A;  1FGU A;  1RL2 A;  3RLF A;  4R4T A;  3J7Z C;  4A3E G;  2E5L L;  4NB3 A;  1GVP A;  3S2H H;  1H95 A;  2ZTD A;  4UP8 A;  3ULP A;  4B3S Q;  4JI0 L;  3CCL A;  2A19 A;  3H0G G;  2CWP A;  3TQY A;  4A3E H;  1S40 A;  3HOZ G;  3IRB A;  1J5E Q;  3KLW A;  1FJG L;  2OCE A;  2PQA A;  3F2B A;  4JV5 L;  1LYL A;  3GTQ H;  2A8V A;  4XTC S;  2OQK A;  1XMQ L;  3H0G H;  3HOZ H;  1YZ6 A;  4C3H H;  4UY8 C;  4DR6 Q;  1J6Q A;  2IHE A;  5LMU Q;  1LM0 A;  1TWC H;  2VY3 A;  4JI8 L;  1N33 L;  2LXJ A;  2B63 G;  4EX5 A;  2IY5 B;  3ER0 A;  5BR8 L;  1VQM A;  4YCV A;  1Q86 C;  2JA7 G;  4JBM A;  4HJ9 A;  2YU9 H;  2UXC L;  4BA1 I;  4BY7 G;  1O7I A;  4DR2 L;  5IY0 A;  4DK3 C;  2MFI A;  4PZ7 A;  3GTK H;  3F8T A;  2WB1 G;  5HY6 A;  2QGQ A;  2B63 H;  1MKH A;  1K0R A;  1VQO A;  3M7N A;  1P16 A;  3M85 A;  1OXU A;  4C3J H;  2ID0 A;  4BY7 H;  1KHI A;  1Q1E A;  3PUZ A;  1YBY A;  5GQO A;  1HNZ Q;  1Q7Y C;  1G6P A;  1UE6 A;  3S1R H;  1XJV A;  1PH2 A;  3CCE A;  2MQH A;  4DR7 L;  4JI4 Q;  1TWF H;  3CCM A;  4DV6 Q;  2A1A A;  4NXM L;  2ZTC A;  4J15 A;  4DV0 L;  3G48 A;  4DAM A;  2UUA L;  1PH5 A;  4MTN A;  4YCU A;  1X54 A;  3JAM c;  4HJ5 A;  1R9T H;  1YHA A;  1XMO L;  2WP8 J;  4DV5 Q;  5M3M G;  5ELN A;  1X56 A;  2E2H H;  4DR4 L;  2YV5 A;  5IWA Q;  1C7Y A;  4LUO A;  1BBW A;  3S17 H;  3KFU A;  3K7A H;  1HZB A;  3L7Z C;  3M4P A;  2OTJ A;  4X66 L;  4R1J A;  3CCU A;  2YTY A;  1UEB A;  4IFD G;  2VNU D;  1PV4 A;  5M3M H;  1PH3 A;  4A3C G;  1U5K A;  3J81 c;  3I55 A;  2R93 G;  1Z47 A;  1SLJ A;  4LUV A;  3D31 A;  4RMF A;  3T1H L;  4JI5 Q;  3GTM H;  4L5S A;  1IBM Q;  1QVF A;  4A3C H;  2B3G A;  1Q8K A;  4P73 A;  2UXD Q;  5J3B A;  4DAY B;  2R93 H;  4TVA B;  5JJL A;  4LFA Q;  2NZH A;  2JQO A;  1YI2 A;  4A3L G;  4LF5 L;  3PF4 A;  1PH4 A;  4AQY L;  4P74 A;  3W1G A;  1QUQ A;  4GLV B;  3S14 H; 
#chains in the Genus database with same CATH topology
 3UDX A;  3TSS A;  3E3X A;  1EIF A;  3T1Y L;  4K2L A;  2E2I H;  4A3D B;  2B2V A;  4X6A H;  4YWM A;  1Z9F A;  4ALP A;  3QB3 A;  4JI1 L;  2F0D A;  3V96 A;  5C3X A;  1MBY A;  5IGD A;  4JI7 Q;  3URY A;  3A74 A;  1B8A A;  4K14 A;  3W5O A;  3SE0 A;  3VYS A;  1TU2 B;  1VQD A;  3TP7 A;  1I3Q H;  3AEV A;  1EWC A;  2KHJ A;  4O2D A;  4KI0 A;  3K6O A;  4KJN A;  3M7G A;  1S5C D;  3M4Q A;  2F0W A;  1D5M C;  1GUS A;  2RHQ B;  3GTO H;  4DV2 L;  4X3K A;  4LF8 L;  1XTC D;  2ZJP A;  2KQ3 A;  2UXB Q;  2ZTE A;  1QIL A;  5M5W H;  3A54 A;  4YHH L;  3RLN A;  2L11 A;  4JI8 Q;  4LF9 Q;  5AJ3 L;  3BS1 A;  1WVL A;  3UE0 A;  2R7Z G;  1BBU A;  1B1Z A;  1BO0 A;  4RKB A;  2VXW A;  5C5L A;  2M9V A;  1Y8O B;  1CA5 A;  2EXD A;  2R7Z H;  2QW7 A;  4LFB L;  4IFD I;  4H7B A;  1XNQ L;  4DR3 Q;  1VQL A;  3PV0 A;  1OXS C;  3N52 A;  3OTO Q;  3SVM A;  1LTT D;  3MXP A;  5J1Z A;  2SNS A;  1VMP A;  2PW7 A;  4OON A;  4CHT B;  4BXX G;  5ELB A;  4RAU C;  5CV8 A;  1PTO F;  1XTD A;  2A74 C;  3SK6 A;  2CVR A;  2R92 G;  3A55 A;  1LT5 D;  3MA2 B;  2D9U A;  4BXX H;  4IPG A;  4OXP A;  4PZ6 A;  2CKZ B;  1KXL A;  5CV7 A;  3VYU A;  1D1I A;  2R92 H;  1KNE A;  3PCO B;  4NXN Q;  1B9M A;  1HZ9 A;  2BE5 D;  1XX8 A;  5CBA E;  4BBS G;  4DUZ L;  1WTP A;  4BA2 I;  2Z4I A;  2L12 A;  2K14 A;  1N34 L;  1DM0 B;  1PLF A;  5BN3 A;  1VQ6 A;  1IYJ B;  2ZT9 C;  2XNA C;  3S2H B;  4ZK9 B;  4ZCK A;  3J80 L;  4K5W A;  1ICW A;  2LSS A;  1JWS D;  2MJ8 A;  2PCF B;  5LL6 S;  1FL0 A;  3NTK A;  2MO0 A;  5NUC A;  1DOK A;  3NEL A;  1T5E A;  4XQN A;  1S5B D;  2NN6 G;  1SSO A;  1N36 Q;  5C0X G;  4PZ8 A;  4X62 Q;  3J80 c;  4DUY Q;  3BVG A;  2NN6 H;  2MHV A;  4IJL A;  3K8A A;  5C0X H;  4B3M Q;  3E0E A;  1IL8 A;  4WJ3 M;  3OWE B;  5JAV A;  1A3U A;  1TWF B;  3MVV A;  3KDF B;  4QCL A;  2F3V A;  3D4W A;  4X65 Q;  1CTM A;  4XQJ A;  5I9P A;  3PF5 A;  4L8J A;  1SE8 A;  4DKA C;  3EFX D;  3BVM A;  3NQT A;  3NTI A;  1SBB B;  4QQB X;  2WB1 E;  1AE3 A;  4CJ0 B;  4DR1 Q;  5M3M B;  3Q8D A;  1WYD A;  4LFC Q;  3D6W A;  3KF6 A;  5JOB A;  3HOV G;  2IX0 A;  2AQ2 B;  3KJO A;  1HNZ L;  4JC0 A;  2D0O A;  1D6E C;  2J0T D;  2HHH Q;  4I65 A;  1CHQ D;  3JAM i;  3HOV H;  2JEA I;  1L1O C;  1ZYR D;  5ISR A;  1W6J A;  4ODG A;  2ATW A;  1M8A A;  2A68 D;  4QGU A;  2QEJ C;  5BR8 Q;  1Y1W B;  4C2M B;  1YNN C;  2UXC Q;  1A6X A;  1GM5 A;  4A3F G;  2SOB A;  3UDF A;  3PUW A;  3RZD B;  1LT4 D;  2RQX A;  5JPM C;  1CM9 A;  4JBW A;  4A3F H;  1FNW A;  5IIF A;  2KVM A;  4DV4 L;  4A3K G;  1U4P A;  1E1T A;  3M4O B;  5I6Y A;  4NXM Q;  2QDL A;  3UDG A;  4LFA L;  2Q8T A;  4DV0 Q;  3BDC A;  1AZP A;  4FO2 A;  2RBM A;  4ZKC B;  1I50 H;  1PTO H;  3UDI A;  4DV1 L;  4F87 A;  3AMU A;  3S1N B;  2Z9H A;  1SFO H;  5G3L D;  1HUM A;  4JPB W;  1A62 A;  1FNU A;  2MPM A;  1S72 A;  5EBD A;  2UUC L;  4HIO A;  1M4V A;  5EBC A;  5CBE E;  1HCZ A;  5D3D A;  1AH9 A;  2VQF Q;  3MHB A;  4N8X 1;  5GAG C;  2ZXR A;  3K58 A;  1IKL A;  1JOK A;  4MIU A;  5E3F A;  4GNX B;  4LF5 Q;  1RIP A;  2BH8 A;  4AQY Q;  2Q2I A;  1B53 A;  2XTI A;  5E4X A;  4C1N K;  4K5X A;  4RKL A;  3T1Y Q;  1N32 L;  1WD0 A;  1RTN A;  2RSN A;  2A73 B;  4LUZ A;  1X65 A;  1F2Z A;  2Y0S E;  1AP0 A;  2FMM A;  4JI1 Q;  1BDO A;  1B70 B;  2F1M A;  3GD7 A;  1E2W A;  1VCI A;  1EY8 A;  2RHS B;  3KLR A;  4IPH A;  1VQP A;  2WAQ G;  1B50 A;  2B2W C;  1LAC A;  4N9T A;  3HOZ B;  1F9P A;  4S3S A;  4P2C B;  2KBN A;  2HIV A;  3QG1 A;  4A3D G;  3H91 A;  3OPO A;  5DNF A;  2KJX A;  1YJW A;  2KA7 A;  1KAA A;  3AYH B;  3CCS A;  3J81 E;  1EIH A;  1NCV A;  4DV2 Q;  1TWG B;  4A3D H;  4LF8 Q;  2B8G A;  4OO1 I;  1K83 B;  2BA0 A;  2YTX A;  1XYI A;  4GOP A;  4YHH Q;  4B3S L;  1IXR A;  1O80 A;  3RN5 A;  3HOU B;  5AJ3 Q;  2QEX A;  3UE1 A;  1OO9 B;  3QJY A;  3V05 A;  2N88 A;  4P71 A;  3G6E A;  1IL2 A;  2I5H A;  2HCI A;  1NTG A;  4R4C A;  4CJ2 C;  1R9T B;  5GAH C;  1YNJ D;  1VQN A;  3VDY A;  2KOL A;  2XN9 C;  1K28 A;  4DV7 Q;  4RCO A;  1XNQ Q;  1MSH A;  1WTQ A;  4HAE A;  2A6H C;  4GLX A;  2J7Z A;  4LF4 Q;  1TXY A;  1TKW B;  1N9W A;  3TEH B;  2GVA A;  4K0K L;  3K5N A;  3C46 A;  1BVS A;  4H0L C;  1BCP C;  2CWA A;  1LTL A;  5GAE C;  2I5L X;  3QOL A;  3TN2 A;  4AH6 A;  1YHB A;  4L5R C;  1EOT A;  1GOZ A;  1KQS A;  2LXK A;  2AUJ D;  2X6L A;  1HR0 W;  2E2I B;  1PXU A;  3S2D B;  4IFD J;  1V43 A;  3U9O A;  2CCZ A;  2IHF A;  3DXJ C;  1IHZ A;  1NE3 A;  1ILP A;  1QWY A;  4AYB E;  3KK7 A;  2DGY A;  2K04 A;  1EY7 A;  2EYL A;  3EQL C;  3Q24 A;  2RCN A;  4KY7 A;  2BA1 A;  5IYB H;  1N34 Q;  1A3T A;  5LMN Q;  1TS4 A;  1VQJ A;  1I3Q B;  1O78 A;  3CC4 A;  3PIO A;  1FR3 A;  2QKI C;  5KND A;  2UUB Q;  4L5Q A;  4C1N I;  4ZYS A;  3KJP A;  1VQ5 A;  2JXM B;  3CPW A;  4OGQ C;  4QMG A;  3GTO B;  3KUP A;  1OXX K;  2JA8 B;  3F2U A;  2EOT A;  2R6G A;  1GUT A;  4CDF C;  1WOC A;  3ICE A;  4K6L A;  4A3E G;  5HUR A;  1GVP A;  3S2H H;  1H95 A;  1RF2 D;  2CH4 A;  1GUW A;  3S15 B;  2TMP A;  5J22 A;  3A7L A;  1EIG A;  4A3E H;  3IRB A;  4HN7 A;  3M3Y B;  3F2B A;  4JV5 L;  1LYL A;  4XTC S;  2GA4 B;  4UY8 C;  1Q8I A;  2H4O A;  2IHE A;  1UAP A;  1LM0 A;  1QE6 A;  2VY3 A;  4JI8 L;  2LXJ A;  1PDQ A;  2IY5 B;  2JA7 G;  2FFK B;  4DK3 C;  2MFI A;  4PZ7 A;  3IL8 A;  2WB1 G;  5HY6 A;  4N9P A;  1JOR A;  1K0R A;  3G6J B;  3P1H A;  5JVH 3;  3J81 L;  1KHI A;  2K05 A;  1HNZ Q;  3J7A F;  1XJV A;  1DOL A;  3O13 A;  1RHP A;  5CMD A;  3CCE A;  4HMI A;  4DR7 L;  1TWF H;  3BDO A;  1LV9 A;  4NW2 A;  4J15 A;  1WTR A;  2UUA L;  3A7A B;  3T53 B;  5CR3 A;  4HJ5 A;  2B2Y C;  3AB9 A;  5M3M G;  1LTR D;  5K5P A;  1X56 A;  4BBS B;  2F0O A;  5IOD A;  1BBW A;  2RDG A;  3FRP B;  1HZB A;  4B9W A;  4A3M B;  2OTJ A;  3ZYY X;  2VNU D;  1KNA A;  5M3M H;  5CV4 A;  3I55 A;  3J81 c;  2SEB D;  1F9R A;  4RMF A;  3D31 A;  3T1H L;  2A69 C;  3GTP B;  1NAP A;  5M5X B;  1QVF A;  4P73 A;  4TVA B;  5EPJ A;  5JJL A;  3DEO A;  4BS9 A;  4LFA Q;  2NZH A;  2JQO A;  1IW7 D;  1I4Q A;  5KNB A;  4UP7 A;  4R8I A;  1E2Z A;  3VR2 A;  3Q23 A;  1BQQ T;  3MZ5 A;  3ZJY C;  4RGT A;  3CRL C;  2Q2H A;  4C2M H;  1JE5 A;  2PQE A;  1EIY B;  3CP0 A;  2AHO B;  1X6O A;  1F9Q A;  2Z8L A;  4O42 A;  2UUC Q;  4JCV E;  3RZD H;  2K75 A;  5K36 G;  1PRT D;  2NB0 A;  2VB3 X;  4J6H A;  4KHP L;  2F0U A;  4KY6 A;  3PO2 G;  2JK8 A;  1HNW L;  4IUU A;  3HOW B;  1PZI D;  2EYH A;  1SNQ A;  1Q81 C;  1DD2 A;  1PH7 A;  1Q3L A;  4JI0 Q;  2O5I C;  3PO2 H;  4RCN A;  5M5Y B;  2B29 A;  3S1N H;  2ZJR A;  1C48 A;  4OIJ A;  2BOS A;  1N32 Q;  5ELO A;  2IJ0 A;  2PI2 E;  1K8O A;  4HJA A;  5IGE A;  1JWU D;  2VL6 A;  1GXD C;  1I4X A;  2Z6K C;  1SYF A;  1AEX A;  3KF6 B;  2Y0S G;  2RVL A;  3HOV B;  2AUK A;  3CMA A;  4RA8 A;  4X65 L;  4DNI A;  3RZO B;  4DF7 A;  3JC6 6;  1F2Y A;  2JE6 I;  1CSQ A;  3VYR A;  1S5E D;  1RCV D;  5JPN C;  3EBE A;  1E1O A;  1A15 A;  4HJ7 A;  4LFC L;  2XIW A;  4IOC A;  1HJP A;  4DU9 A;  1YJN A;  3DWP A;  2F52 A;  3PUY A;  3V2T A;  4ZKB B;  4A3F B;  5FO8 B;  2GVB A;  4O0A A;  4RFB A;  1OXT A;  3F1Z A;  2HHH L;  4MZ9 A;  3S9W A;  1ZYR C;  5ELE A;  3CQZ B;  1O7Z A;  1KDA A;  4CKE A;  1ASY A;  1PTO B;  3MTS A;  2A68 C;  3TZD A;  4A3K B;  3NPP A;  2K33 A;  3LNN A;  1M90 C;  1SFO B;  2QCP X;  3OW2 A;  1BKB A;  4U68 A;  4CBV A;  5C6A A;  2NZ1 D;  5GRO A;  3RN2 A;  1WFQ A;  1M1K C;  4IPC A;  4AIM A;  1XPO A;  1IYV A;  4L6T B;  1IBL L;  3HOU G;  3ULL A;  1TWG H;  4KD3 A;  1KTK A;  1K83 H;  1Y1V B;  1SYE A;  3BDL A;  4K0K Q;  1I6H B;  3F2D A;  2DNC A;  4IOA A;  3HOU H;  1EYC A;  2C5C A;  3MWY W;  3SXH A;  1SYD A;  3I3C A;  1KL9 A;  4QY7 A;  4DAY A;  3C1E A;  1SNC A;  4KK7 A;  3DEP A;  5FO9 B;  1JMC A;  1U4L A;  4Y52 H;  2K03 A;  2JN4 A;  1SRU A;  2ASB A;  3E9I A;  4YWL A;  4MTK A;  4RGN A;  2D62 A;  5D65 A;  4AYB G;  2D2C C;  3CW2 C;  5J39 A;  3GTK B;  2VQF L;  4DR5 L;  4QIW E;  3J7A 5;  2HQE A;  2B2U C;  3DM1 A;  2WII B;  2R3Z A;  2HIX A;  1Q46 A;  1MJC A;  2EJF C;  2KCN A;  2QF7 A;  4CDD C;  3K5M A;  4RHS A;  2KEC A;  3S2D H;  1STE A;  4IUP A;  2EJM A;  4DR6 L;  3OW7 A;  4IJH A;  3NK9 A;  1UEA B;  1JJ2 A;  1JQY D;  1E3P A;  4GOP B;  1L2F A;  2FXQ A;  3I73 A;  3CRK C;  3A5U A;  1TY2 A;  3ONA B;  3I90 A;  1S4Z A;  2F0P A;  3PGZ A;  3F2C A;  3RLO A;  1YHQ A;  1GJX A;  1WTW A;  1JB7 A;  4JI4 L;  1PTO D;  1MIU A;  2JA8 G;  5I2Y A;  1SMY D;  1K3R A;  2QDB A;  2RDH A;  5HGT A;  1XNR Q;  4JV5 Q;  3BJU A;  4RGM A;  5KYL A;  3K80 C;  2MP1 A;  3SEB A;  2JA8 H;  4KHZ A;  1SRO A;  2N3S A;  4WRD A;  3U4Z A;  1OTC A;  1VF5 C;  3PUX A;  4L5T A;  1HA5 A;  4FNF A;  3HOX G;  3BZC A;  3TP5 A;  3FKI G;  5KIX A;  2L15 A;  3HOX H;  3H3V H;  4CKB A;  4PMW A;  4DV7 L;  2UXD L;  1V9P A;  1XWE A;  4FXK C;  3S15 H;  4DR7 Q;  2O4X A;  1I4R A;  3TME A;  4U67 3;  3NWS A;  2NN6 I;  5M9O A;  3STB D;  2UUA Q;  4LF4 L;  3M3Y H;  2CQO A;  3K0X A;  3OYY A;  2AWO A;  2WKD A;  3HKZ B;  2HQL A;  4JVZ A;  1ROD A;  1V1P A;  4M8A A;  2C35 B;  3NEN A;  5EPL A;  1A63 A;  1X9N A;  1I4H A;  1I6V C;  4CJ1 B;  1YIJ A;  4GNX C;  2B2T A;  3T1H Q;  1JT8 A;  2K5N A;  1BUV T;  3FPP A;  1VQ8 A;  1EL0 A;  3HKZ E;  3NUC A;  2F0Q A;  2HT1 A;  1NR4 A;  1V1Q A;  2VZA A;  3EN2 A;  1VS0 A;  5F2D A;  2E2J B;  1HNX Q;  2XWJ B;  4A3M G;  1VQE A;  1EWI A;  3H6M A;  4A3B B;  4BBS H;  5FKA C;  1NJI C;  5LMN L;  1DXM A;  4J8Q A;  4A3M H;  3A56 A;  4MNO A;  2B2W A;  2UUB L;  4A3E B;  3X3M A;  1EYG A;  3GTP H;  1SNP A;  1EFI D;  2K7V A;  4GN5 A;  4KHP Q;  1VQ9 A;  5M5X H;  1HFG A;  2QA4 A;  1HNW Q;  3PO3 B;  2JSO A;  1AW7 A;  1H9M A;  5JJI A;  3MEH A;  1JJG A;  2AQ3 B;  2VW9 A;  4HED A;  1EQT A;  1ESR A;  1L0X B;  1PHJ A;  2JA7 B;  1B44 D;  3VR5 A;  3RNU A;  2D5D A;  3SK4 A;  2WB1 B;  2PI2 A;  3E9H A;  4ME5 A;  3HOW G;  3L9A X;  2NZO A;  3TRZ A;  2K1B A;  3NXW A;  1ML0 D;  2O2L D;  1Q90 A;  1Q82 C;  3HOW H;  3HZX A;  2NVX H;  2E76 C;  2KCT A;  4XT3 B;  3SR1 A;  1PFS A;  1HQM C;  5M5Y H;  5C5M A;  5C44 G;  1PFM A;  5LMN W;  1HA6 A;  2N49 A;  4B3T L;  1EEI D;  1HTP A;  3CHB D;  2N78 A;  1AFP A;  5C44 H;  4KKT A;  4OWX B;  1VQF A;  1RTO A;  3G4S A;  4QJF A;  1TWA B;  2OT2 A;  3BU2 A;  5T1G A;  2RF4 A;  1NSN S;  3I4M G;  3RZO H;  2Z1C A;  3D0F A;  3QIA A;  2H5X A;  1RD9 D;  2F0F A;  1F2M A;  3T4A C;  3R93 A;  3I4M H;  1ET6 A;  1WTO A;  3S1Q H;  2OXP A;  3I4L A;  2WAQ B;  1TII D;  4IN3 A;  1QVG A;  2F0H A;  2WKC A;  1IBL Q;  1SN8 A;  4E6I A;  2CHB D;  1EQQ A;  2NWG A;  4RHR A;  3S16 H;  2PW5 A;  4TQU S;  4M1U B;  3NE5 B;  4F8M A;  1JJC B;  1W3S A;  1ET9 A;  2F4V L;  2F0K A;  1ILQ A;  3I91 A;  3CME A;  1KDB A;  5DEH A;  3DHQ A;  4HIM A;  2R7F A;  3CQZ H;  4K8I A;  3PO2 B;  5IGC A;  4KMU C;  1Q12 A;  4A3K H;  2HDL A;  5C3E G;  2AKW B;  2JP1 A;  1CFM A;  3PUV A;  2JJQ A;  4DAP A;  3T56 B;  2NVT H;  2VQE L;  4R4O A;  1Y1V G;  1PVO A;  4KJO A;  4HTH A;  5C3E H;  1H9S A;  1PRT C;  2DNE A;  5I9O A;  1SYC A;  4JI3 L;  1Y1V H;  1B3Q A;  3KLS X;  1I6H H;  4DR5 Q;  3RLF A;  1EU3 A;  3J7Z C;  2HDM A;  2Y0S B;  4NB3 A;  4JI0 L;  3FPU B;  2ICI A;  2A19 A;  5BN5 A;  3TQY A;  2F3W A;  1SXT A;  1SE2 A;  2XVS A;  2A8V A;  2F0S A;  3FVQ A;  1XMQ L;  4DR6 Q;  1J6Q A;  3HEJ A;  1N33 L;  5CYU A;  1TR5 A;  3OSO A;  1G2S A;  4HJ9 A;  4FF2 A;  1O7I A;  4DR2 L;  3GTK H;  2QGQ A;  1QCB D;  1STN A;  1P16 A;  3P20 A;  1OXU A;  3NHH A;  1Q1E A;  1V1O A;  1YBY A;  2PZW A;  5GQO A;  2EY5 A;  1Q7Y C;  2B2Y A;  1PH2 A;  1RKN A;  4IUT A;  4EGV A;  4JI4 Q;  2G9D A;  3G48 A;  4HSP A;  3IFD A;  1UUP A;  1X54 A;  3H94 A;  5EQ0 A;  1XMO L;  2WP8 J;  4FXG C;  2YV5 A;  4H44 C;  4LUO A;  5IGF A;  1TS2 A;  3KFU A;  1HRJ A;  3L7Z C;  3HP3 A;  4R1J A;  4N8F A;  2B8F A;  4NKL A;  1QNU A;  1TWH B;  1Z47 A;  3R2I A;  1II3 A;  4R8N A;  4IUV A;  4DK1 A;  3T51 B;  2UXD Q;  4DAY B;  5EKK A;  2A5H A;  4ZUI A;  1QUQ A;  3AU7 A;  1EZ8 A;  1HFN A;  1D1K A;  2JA9 A;  3LX0 A;  3PSI A;  2K32 A;  2RCF A;  4AYB B;  1JCK B;  4A76 A;  1ASZ A;  2PPB C;  1D5Z C;  3SDZ A;  1Z6H A;  3KOJ A;  2CH4 W;  3GO5 A;  1PFN A;  4HCE A;  5JEA G;  1L0W A;  4Q5V A;  5IOC A;  4GZY C;  3HKZ G;  3CAM A;  1F9S A;  5JEA H;  4JW0 A;  1V8Q A;  4NP5 A;  5C0X J;  3H15 A;  4HIK A;  3S24 A;  1CSP A;  2Z6K A;  2L5T A;  1FJG Q;  2EQS A;  4EQP A;  1CKO A;  1E22 A;  1G8Z D;  1GO3 E;  5D14 A;  2XRS D;  2BDO A;  4BY1 G;  1F77 A;  1EYD A;  3ERO A;  4YIJ A;  3LGJ A;  2F0G A;  4G7H C;  1E7Z A;  1PYS B;  2MNA A;  4A3G B;  2WFW A;  4LAA A;  4WJ4 A;  3QWN A;  2OQ0 A;  4BY1 H;  5M3F G;  3CD6 A;  1VMC A;  2VS1 A;  4DV3 L;  4A4I A;  4A3B G;  3D8G A;  3OIQ A;  1JE4 A;  2Q2U A;  1K8G A;  4DXG A;  3E0J A;  2E2J H;  4P75 A;  4ME3 A;  1NUC A;  3PQI A;  2Z6B A;  4A3B H;  2HD3 A;  4EQN A;  2I0Q A;  1T9H A;  5KYI A;  3P75 A;  2EY2 A;  3RR5 A;  1ENF A;  4RGO S;  2ZM6 L;  5E7N A;  4A3I G;  3HOX B;  1PTO C;  2OTL A;  1HHV A;  1WCM G;  5I4D A;  1SMY C;  3FKI B;  4DN4 M;  4H13 C;  3HS0 C;  1O7Y A;  3SK8 A;  2RSO A;  3PO3 G;  4A3I H;  4LK1 C;  3AFQ A;  1B9N A;  1XNR L;  1QG7 A;  5D3I B;  3HRZ C;  3FMC A;  3I4N G;  5CV9 A;  2NVQ B;  1U9R A;  2X6G A;  4WOR A;  4KV6 A;  3PO3 H;  4L63 B;  2DJG C;  1VQH A;  3I4N H;  1V1P B;  1Y8N B;  1X32 A;  3R8B A;  4C3I G;  3GTJ H;  4B3T Q;  4BBR B;  2LFN A;  2JA7 H;  2J4X A;  3ERS X;  4WJW A;  2EVB A;  4HCS A;  4C3I H;  1ZEQ X;  4JI2 Q;  2EXZ A;  1KAW A;  5A2Q E;  1QZG A;  4ABN A;  5IT9 L;  3TRE A;  1KRT A;  1YIT A;  2FJ2 A;  2NYZ D;  5A35 A;  5C4X G;  1GHK A;  4LJZ C;  4CKC A;  2EY1 A;  1STY A;  4OWT B;  1STG A;  3T13 A;  4JYA L;  3C3L A;  4PMB A;  4RG1 A;  3I2Z A;  4F7X A;  5C4X H;  2EDG A;  2IPK D;  4V19 0;  2PQA B;  2B2U A;  2Q2T A;  1S3O A;  1EY9 A;  1XPR A;  5EJW A;  2YU9 B;  4JI6 L;  4JK1 C;  2BE5 C;  4JOI C;  1JOQ A;  5IT9 c;  1TWA H;  1PMR A;  2F4V Q;  2NTS A;  1H9K A;  3NEM A;  1CI3 M;  3FEW X;  1VQI A;  1HNX L;  5FK9 C;  1MGS A;  4HMJ A;  1SE4 A;  1K3B C;  1J5E L;  4IUQ A;  4IZ8 A;  1ICF B;  3PIP 3;  3W1B A;  2VQE Q;  4ZAI A;  2K6A A;  3HOY G;  1JR0 D;  2JA6 G;  2PNH A;  3K7A B;  4B9X A;  4JI3 Q;  4LWC A;  3HOY H;  1CHP D;  5FO7 B;  4PV1 C;  1G51 A;  1TVX A;  2NVX B;  1Y8P B;  5K36 H;  2YTV A;  3TS2 A;  4IUR A;  1SEB D;  5IP7 G;  1O7L A;  3J7Y W;  4DV6 L;  1U4M A;  4K8J A;  2L1B A;  1BOS A;  1VQ7 A;  4Q0F A;  5IP7 H;  1KLU D;  2K5Q A;  4HSV A;  1IBK Q;  2PNR C;  1XMQ Q;  5LHY 1;  1SMX A;  5C44 B;  1DYQ A;  3Q6S A;  3CCV A;  5HGQ A;  1N33 Q;  1TS3 A;  2LS0 1;  3SHL A;  2JYO A;  1SYB A;  3RUZ A;  4CGY B;  5EAY A;  1KLG D;  4DR2 Q;  3MEF A;  1X3E A;  3U4V A;  3I4M B;  3S1Q B;  4Z9C B;  1IBM L;  2IL8 A;  2I07 B;  2ZJQ A;  1OXV A;  4R4Q A;  3OHX C;  3KBX A;  2DY8 A;  5EGT A;  3S16 B;  1XMO Q;  2DUD A;  4MN3 A;  2ES2 A;  3I56 A;  2DN8 A;  1EFW A;  4RWS C;  1SR3 A;  3I70 A;  5IP9 G;  3TP6 A;  3CF5 A;  3MFY A;  1LTS D;  4DK6 C;  1E0B A;  2EYJ A;  3C2P A;  1R4Q B;  4Y7N B;  1LTA D;  4EQO A;  2IWH A;  2NVT B;  4OEL B;  5C4H A;  1GHJ A;  3QO2 A;  5C3E B;  2ICE C;  5DM6 3;  4XYO A;  2FHT A;  4X64 L;  3KLS A;  1ENA A;  3Q0A A;  4YY3 L;  1KIX A;  4LF6 L;  4LNQ A;  2K5V A;  5A2Q L;  1NY4 A;  3I4O A;  1H9S B;  1VQC A;  4GLA C;  5FLX c;  3QOJ A;  3DWA A;  1Z7T A;  4KLK A;  1H9J A;  2K5D A;  1TWH H;  2LY7 A;  1UNS A;  1FGB D;  4QIW B;  3GV6 A;  4KY5 A;  3JAM E;  2A6H D;  1K8A C;  3KBG A;  3HKS A;  4NDX A;  2K4K A;  2F3I A;  1ZKO A;  3H3V I;  1FD7 D;  4PNY A;  4IPD A;  4DAV A;  4KKU A;  1G91 A;  3K57 A;  1JC7 A;  2KCC A;  1EQR A;  3CC7 A;  1QVC A;  1BBX C;  3VR3 A;  3S1M H;  3PMF A;  4RH6 A;  1AE2 A;  3A8I E;  2FIN B;  1B2T A;  4JBK A;  2PO4 A;  1JB3 A;  4DV3 Q;  2JA5 B;  2KHS A;  1TY0 A;  2EIF A;  5DM7 3;  2ZXP A;  1BF4 A;  4PQX A;  4TKO B;  4YCW A;  3TZU A;  3IKJ A;  4A75 A;  3FP9 A;  3J81 j;  3TDQ A;  4A3G G;  2ZM6 Q;  1VQ4 A;  1L1O A;  2OWO A;  4KN4 C;  2Z0S A;  2KUM A;  1VDZ A;  4A93 G;  1DCZ A;  4DA2 A;  4A3G H;  1BCP F;  1EUJ A;  4OX9 L;  4FVM A;  3A8J E;  2IW3 A;  1A0I A;  4F88 A;  4FF4 A;  3OWF A;  2EE1 A;  3CU7 A;  5GAD C;  4A93 H;  2WAQ E;  5C4Z A;  3DUZ A;  1GKH A;  1QUQ B;  3D6C A;  3ULJ A;  4X3S A;  1EOV A;  2ALY B;  3R2T A;  1S5F D;  1YNJ C;  4UP9 A;  3VA5 A;  3SK5 A;  1X55 A;  1A8V A;  1HZC A;  4IQZ A;  4A3J G;  3FKI H;  1NMG A;  1JWM D;  1HZA A;  2X69 A;  4A3J H;  1PYW D;  2ZXO A;  5C0X I;  2NVQ H;  4OEM B;  1NR2 A;  1BXT A;  1MJE A;  3DLL A;  1STB A;  4JYA Q;  4BBR G;  3GTG H;  5DLQ E;  4OHJ A;  1C9O A;  1I94 L;  3MXU A;  2CQA A;  4EVO A;  3DWQ A;  4BBR H;  4K2K A;  3VYT A;  4JI6 Q;  3WDN A;  1AN8 A;  4BY1 B;  2EYF A;  1MSG A;  4IO9 A;  1UE1 A;  4LMQ D;  4LW1 A;  2E5L L;  3BYY B;  4FP5 D;  2LMC B;  4UHV A;  2ZTD A;  4UP8 A;  3ULP A;  1SJH D;  5M3F B;  3NBH A;  1HTL D;  4C3H G;  2OEO A;  1J5E Q;  2E2D C;  3KLW A;  1FJG L;  2KED A;  2PQA A;  3GTQ H;  1W6K A;  2OQK A;  2EZV A;  1CK1 A;  1YZ6 A;  4J1M A;  4C3H H;  3NSW A;  1LAB A;  5LMU Q;  2MGS A;  1TWC H;  3JAM L;  3MXN A;  4YCV A;  2A69 D;  2YU9 H;  4BA1 I;  4KD4 A;  4A3I B;  4BY7 G;  1WCM B;  2EYP A;  4XQQ A;  2B39 A;  1MKH A;  1VQO A;  3M7N A;  3M85 A;  2ID0 A;  1SDF A;  4KN7 C;  4BY7 H;  2PZU A;  1UE6 A;  3S1R H;  1ZXT A;  3UI2 A;  4V0B A;  2MQH A;  5KEE A;  3I4N B;  4DV6 Q;  2A1A A;  1WTX A;  2G5D A;  1J9O A;  2ZTC A;  3GTJ B;  2A6E D;  4YCU A;  3JAM c;  4X3U A;  1HXY D;  5ELN A;  5ELD A;  4C3I B;  4DR4 L;  2ENB A;  5E1F A;  3K7A H;  3GP7 A;  3H09 A;  4X66 L;  5TSS A;  2V4D A;  4IFD G;  2MUY A;  3NTH A;  1PV4 A;  1PH3 A;  4A3C G;  5KNC A;  2WIN B;  3KF8 A;  1G2T A;  2R93 G;  4LUV A;  3VR6 A;  1HQR D;  3HGB A;  4IFD H;  2NTT A;  3GTM H;  2IX3 A;  4L5S A;  1IBM Q;  4A3C H;  2B3G A;  5J3B A;  2R93 H;  5C4X B;  3MFG A;  2EJG C;  4K5V A;  1YI2 A;  3J7A V;  4A3L G;  3PF4 A;  1PH4 A;  4P74 A;  4FF3 A;  1CZG A;  4GLV B;  4DGZ A;  1GUO A;  5JJZ A;  1WI5 A;  3W3A A;  1K73 C;  2KHI A;  4G57 A;  2BH2 A;  3CPF A;  3R3O A;  1KAB A;  3RMH A;  4A3L H;  4B08 A;  1CKN B;  4JI2 L;  5EPK A;  4LF7 L;  2E74 C;  2M2L A;  2PYK A;  2PZT A;  3CCJ A;  1PH8 A;  2F0M A;  5AFW A;  1VF7 A;  2VB2 X;  1B4O A;  3CCQ A;  1N8R C;  1Y14 B;  4DK0 A;  4CDE C;  3K59 A;  2B2V C;  3K81 C;  2Q8I B;  1EY6 A;  1RJT A;  1YEZ A;  3G71 A;  4X64 Q;  1KRS A;  3I7F A;  4MHE A;  4DXF A;  4YY3 Q;  4LF6 Q;  1X3F A;  1YJ9 A;  3J80 i;  3HOY B;  3ND9 A;  1WTV A;  2JA6 B;  2TSS A;  3W2D A;  3U50 C;  1IW7 C;  3DMU A;  4GKK L;  1HPC A;  2K28 A;  3BVZ A;  3E6Z X;  2H1E A;  3ITP A;  1G6Z A;  2UU9 L;  1CKM A;  1KC8 C;  3TBI B;  4QUC A;  4Y7N H;  4POG A;  3WWV A;  1EYA A;  4DNT B;  2F03 A;  1JIC A;  1LLR D;  1G29 1;  4XT1 B;  2NUC A;  3ERQ A;  3H3V C;  3MXG A;  3DM3 A;  1PZK D;  2L9H A;  3A8K E;  1EU4 A;  2RKS A;  1KDC A;  3AFP A;  1UWV A;  4ZRZ A;  2K01 A;  4DPG A;  4HID A;  1PFB A;  1D7Q A;  2L55 A;  3KYH C;  1FNV A;  1CA6 A;  4UDU C;  3EVQ A;  1EZ6 A;  1IBK L;  1U4R A;  1EY5 A;  3OIP A;  2AWN A;  1EWH A;  1A2T A;  2B2T C;  2GN5 A;  1CQF A;  1ENC A;  4ZUJ A;  2VUM B;  2IT1 A;  4FXD A;  2K5W A;  1CZW A;  5C4J B;  2OF1 A;  2CW0 D;  3GTL B;  4HR7 B;  1EY4 A;  2YYZ A;  4G4K A;  2JA5 G;  4POF A;  5I2X A;  4BWG B;  4OX9 Q;  4ILW A;  5EKI A;  4B3R L;  2NVY H;  5IT9 E;  2AQ1 B;  4KKS A;  2JA5 H;  5G3L F;  1QZH A;  3ND8 A;  4TRD A;  1LTI D;  3H0G B;  3M9B A;  4JOI A;  1K0S A;  3A0J A;  4FDB A;  4GKJ L;  1LTB D;  1HR0 L;  1K8M A;  1B7Y B;  1W2B A;  5L37 A;  1X3G A;  2I5M X;  4DFA A;  3L2P A;  2B63 B;  2F4I A;  2F0E A;  4C3J B;  1Q1B A;  2CFM A;  3BG3 A;  1SND A;  4OIK A;  4ULL A;  1RDP D;  2R7D A;  2V1C C;  2BDN A;  4JBJ A;  4JG2 A;  1I4G A;  1L0Y B;  1I94 Q;  1IKM A;  2E2H B;  5H1S E;  2RDF A;  4LFB Q;  3E5S A;  3S17 B;  3S1M B;  2AMC B;  2F0L A;  2XGT A;  1VQK A;  5IE8 A;  1DOM A;  2Q8R E;  5I6W A;  4C56 C;  2E5L Q;  1B3A A;  4XYQ A;  4APV A;  2XSC A;  4H02 A;  3LWE A;  1STA A;  1JOO A;  5IGG A;  1NMF A;  1NNX A;  4O1N A;  2FMC A;  3S14 B;  4DV5 L;  1SNO A;  3L0O A;  1MHW C;  1QJO A;  5IWA L;  4QL5 A;  5ELF A;  1D5X C;  2D0P A;  1LUZ A;  3CKI B;  1L1O B;  5IYC G;  1X3Q A;  2KEN A;  5IYB G;  1S5D D;  4DUZ Q;  5LL6 X;  2M00 A;  2HUG A;  3P7J A;  4A93 B;  3SGI A;  3GQB A;  3NP8 A;  1PZJ D;  5T1I A;  4JI5 L;  5IYC H;  4OO1 G;  5M3F H;  1U0L A;  1YNX A;  5E4W C;  1T5X D;  1Y69 U;  3EJI A;  1I4P A;  3QR8 A;  3B6Y A;  1BNZ A;  2O5J C;  3CC2 A;  4OO1 H;  1VQA A;  4DNR B;  5COR A;  4UAI A;  3T16 A;  3PIO 3;  4KTA A;  4DR4 Q;  1WJJ A;  1PYB A;  2DJF C;  1A3V A;  4X66 Q;  5M5W B;  4X3T A;  4A3J B;  1WCM H;  2KEE A;  1MI2 A;  1GD7 A;  4JI7 L;  1VQG A;  5FLX E;  2KCM A;  2IX1 A;  1A2U A;  3AQQ A;  3U58 A;  3GTG B;  2EYO A;  2WV6 D;  1PRT B;  4CDC C;  1X3P A;  2R7Z B;  4FYD A;  3I72 A;  1ESF A;  2L0C A;  4GN4 B;  1D8L A;  4TSS A;  1UE5 A;  4LF7 Q;  1R4P B;  4YWK A;  3STB C;  3K5L A;  3OMG A;  2UXB L;  4QB4 A;  2EY6 A;  1E2V A;  2C9O A;  3IAY A;  3NQI A;  3MAQ A;  1C0A A;  2PMZ B;  4LF9 L;  3NWT A;  1P8L A;  1FVI A;  4PG3 A;  4G7Z C;  3X3N A;  1ONL A;  4UPA A;  3TS0 A;  2N55 A;  5EKL A;  3BYT B;  5CV5 A;  1AZQ A;  3GTQ B;  3NBH B;  2SDF A;  3GDE A;  1QB5 D;  4C3H B;  3LWU A;  2K5H A;  4R4I A;  2R92 B;  2R61 A;  3KDF A;  1TWC B;  2N8N A;  1CKN A;  4K6D A;  4P72 A;  3K5O A;  3TP8 A;  2PMZ E;  4DR3 L;  4XIG S;  1NBW A;  1XPU A;  3OTO L;  2JEB I;  3FDT A;  3MXN B;  3NBI A;  5FJ8 G;  4GKK Q;  2F0I A;  2E8G A;  4BY7 B;  2K50 A;  1I5F A;  1STH A;  2XWB B;  3S1R B;  2UU9 Q;  1C4Q A;  3U9S A;  3PIP A;  5KGU A;  5FJ8 H;  3HG9 A;  1DZ1 A;  4GOP C;  1YNN D;  2F0T A;  2RA4 A;  5LMU L;  1DGS A;  1SYG A;  3FHW A;  4NXN L;  1TT2 A;  1FYC A;  1PA6 A;  4DV4 Q;  3HFZ B;  1K9M C;  4XXE A;  1LO5 D;  3OMC A;  1YVC A;  1SE3 A;  2JA6 H;  5CV6 A;  1CQV A;  1HH2 P;  4EQ5 A;  4PMC A;  4HJ8 A;  1Y1W G;  3D4D A;  4XDX A;  4ID6 A;  4DV1 Q;  1F2L A;  2Z4H A;  3EIV A;  3GTM B;  3KF8 B;  1SJE D;  2R93 B;  1Y1W H;  2A6E C;  3K0Y A;  4OL7 A;  1DJR D;  4G7O C;  5FLM G;  1J8I A;  2E75 C;  4R9W A;  3WOF A;  3A5Z B;  1BCP B;  5FLM H;  3CCR A;  4FF1 A;  5CGK A;  2K52 A;  1LT6 D;  1GUG A;  3J81 i;  4NPS A;  3M4O H;  2LKV A;  3G7L A;  5JJK A;  2F0N A;  2DY7 A;  4OWW B;  3K7U C;  1E24 A;  3VA7 A;  1N36 L;  1IZ6 A;  1LTG D;  4X62 L;  4DUY L;  3BZK A;  3L3O C;  1VQB A;  3CXC A;  1HUN A;  4ZLT F;  1KD1 C;  4B3M L;  1TS5 A;  1CUK A;  1UE7 A;  4B3R Q;  4GS3 A;  5IYD G;  1QNK A;  4GNX A;  1PH6 A;  2VUM G;  5COY A;  1PH1 A;  1D2B A;  5KRU A;  5FLX L;  4GN3 B;  4WFN 3;  5IYD H;  1TQO A;  4KHV A;  2MO1 A;  4GKJ Q;  4ZQ3 A;  2VUM H;  1PRT F;  5JVG 3;  3Q22 A;  1HR0 Q;  4QUF A;  4DR1 L;  1PH9 A;  5C4J H;  1WD1 A;  5JEA J;  5IP9 H;  5IGB A;  3GTL H;  4IUN A;  1FGU A;  1RL2 A;  4R4T A;  2BCO A;  3N6R A;  3OOC A;  3EA6 A;  3WOE A;  3M4Y A;  4B3S Q;  1DON A;  5DAU A;  3CCL A;  1C8C A;  3H0G G;  3HOZ G;  2CWP A;  1S40 A;  1BR9 A;  2WAC A;  2OCE A;  1H9R A;  1QOH A;  2F0V A;  4I7Z C;  5ELC A;  5FOB B;  1I50 B;  3H0G H;  3HOZ H;  3C1F A;  1SAP A;  2B63 G;  2QIL A;  4EX5 A;  3ER0 A;  5BR8 L;  1VQM A;  1Q86 C;  4JBM A;  4C3J G;  3BZD B;  2UXC L;  1WTH A;  5IY0 A;  3D3R A;  3F8T A;  2XRQ D;  2B63 H;  4C3J H;  2G9H D;  1G6P A;  3PUZ A;  2F0J A;  3VR4 A;  1XXG A;  1MD2 D;  3CCM A;  4NXM L;  4NMZ A;  2I46 A;  4DV0 L;  4DAM A;  1EEF D;  1BCP D;  5CC4 A;  1PH5 A;  4MTN A;  2P5Z X;  3MC0 B;  1CT1 D;  1SNM A;  2HCC A;  1R9T H;  4I7A A;  1YHA A;  4IAL A;  3J80 E;  4DV5 Q;  2E2H H;  1C7Y A;  2EYM A;  5IWA Q;  3S17 H;  3M4P A;  1LT3 D;  2NBF A;  4QF4 A;  3CCU A;  2YTY A;  1UEB A;  3I8Z A;  1U5K A;  3RD4 A;  2NVY B;  1SLJ A;  3D4R A;  4JI5 Q;  3IFT A;  3GV3 A;  1Q8K A;  1GUN A;  1EY0 A;  5BN4 A;  2SNM A;  2L4N A;  5C3W A;  2EPB A;  4LF5 L;  1EQV A;  4AQY L;  3W1G A;  2CW0 C;  3S14 H;  1IYU A; 
#chains in the Genus database with same CATH homology
 1WI5 A;  1K73 C;  2KHI A;  3ZJY C;  2BH2 A;  3CPF A;  3UDX A;  1EIF A;  4A3L H;  3T1Y L;  2E2I H;  1CKN B;  4JI2 L;  4LF7 L;  2Q2H A;  4C2M H;  1JE5 A;  2JA9 A;  3PSI A;  3CCJ A;  3CP0 A;  4YWM A;  1Z9F A;  1PH8 A;  4ALP A;  1EIY B;  4X6A H;  2AHO B;  3CCQ A;  1X6O A;  4A76 A;  4JI1 L;  1N8R C;  1ASZ A;  1Y14 B;  4JI7 Q;  2UUC Q;  4JCV E;  3RZD H;  3A74 A;  1B8A A;  2K75 A;  5K36 G;  4KHP L;  3W5O A;  3KOJ A;  3GO5 A;  3K81 C;  3PO2 G;  5JEA G;  2JK8 A;  1L0W A;  1VQD A;  1HNW L;  1YEZ A;  3G71 A;  1I3Q H;  3HKZ G;  3AEV A;  2KHJ A;  1KRS A;  4O2D A;  4X64 Q;  4KI0 A;  1Q81 C;  1PH7 A;  3CAM A;  3I7F A;  4YY3 Q;  4JI0 Q;  4LF6 Q;  3PO2 H;  1X3F A;  2B29 A;  3H15 A;  3J80 i;  5C0X J;  4HIK A;  1YJ9 A;  3M4Q A;  3S24 A;  1CSP A;  2ZJR A;  3S1N H;  2Z6K A;  1FJG Q;  2EQS A;  2RHQ B;  1CKO A;  3GTO H;  4DV2 L;  1E22 A;  1N32 Q;  3U50 C;  1GO3 E;  4LF8 L;  5ELO A;  4GKK L;  2PI2 E;  2ZJP A;  4HJA A;  2UXB Q;  2ZTE A;  5M5W H;  4YHH L;  4BY1 G;  3RLN A;  2VL6 A;  4JI8 Q;  3LGJ A;  2Z6K C;  2UU9 L;  1CKM A;  1KC8 C;  4LF9 Q;  1E7Z A;  5AJ3 L;  1PYS B;  2MNA A;  3KF6 B;  2Y0S G;  2WFW A;  3UE0 A;  4WJ4 A;  4Y7N H;  2OQ0 A;  4X65 L;  3CMA A;  1BBU A;  4DNI A;  5M3F G;  4BY1 H;  3WWV A;  4POG A;  3CD6 A;  2R7Z G;  2VS1 A;  3JC6 6;  2JE6 I;  1CSQ A;  4A4I A;  4DV3 L;  4A3B G;  2Q2U A;  2EXD A;  1G29 1;  1K8G A;  2R7Z H;  2E2J H;  4LFB L;  4IFD I;  4P75 A;  3DM3 A;  4ME3 A;  1XNQ L;  3EBE A;  1E1O A;  4DR3 Q;  1VQL A;  4A3B H;  3PV0 A;  1OXS C;  3OTO Q;  1T9H A;  4HJ7 A;  2I0Q A;  4LFC L;  4IOC A;  3AFP A;  1UWV A;  3RR5 A;  1HJP A;  1YJN A;  2ZM6 L;  2F52 A;  3PUY A;  5E7N A;  4DPG A;  4HID A;  4OON A;  4A3I G;  2OTL A;  1WCM G;  4BXX G;  1D7Q A;  1XTD A;  2GVB A;  4O0A A;  1OXT A;  3F1Z A;  2HHH L;  4MZ9 A;  3KYH C;  2R92 G;  3PO3 G;  4A3I H;  1XNR L;  3AFQ A;  4IPG A;  4OXP A;  4PZ6 A;  4BXX H;  2CKZ B;  1KXL A;  1ASY A;  1IBK L;  3I4N G;  2R92 H;  1M90 C;  3PCO B;  3PO3 H;  3OW2 A;  1BKB A;  4NXN Q;  1VQH A;  3I4N H;  5GRO A;  1HZ9 A;  3RN2 A;  1WFQ A;  1M1K C;  4IPC A;  4AIM A;  1XPO A;  2AWN A;  2GN5 A;  4K0K L;  4BBS G;  4DUZ L;  3GTJ H;  1IBL L;  4B3T Q;  3HOU G;  3ULL A;  1TWG H;  4BA2 I;  2IT1 A;  2JA7 H;  1K83 H;  3ERS X;  4K0K Q;  2K14 A;  1N34 L;  4C3I H;  3F2D A;  4IOA A;  3HOU H;  4JI2 Q;  1VQ6 A;  1IYJ B;  2YYZ A;  1KAW A;  1QZG A;  2JA5 G;  4POF A;  4OX9 Q;  3TRE A;  1KRT A;  1YIT A;  2LSS A;  1KL9 A;  5C4X G;  4QY7 A;  4B3R L;  2NVY H;  1JMC A;  2JA5 H;  4Y52 H;  4OWT B;  1QZH A;  4JYA L;  4RG1 A;  3I2Z A;  1FL0 A;  1SRU A;  3M9B A;  2MO0 A;  4JOI A;  5C4X H;  2ASB A;  3NEL A;  3E9I A;  2PQA B;  3A0J A;  4FDB A;  4YWL A;  4GKJ L;  2Q2T A;  1S3O A;  2D62 A;  2NN6 G;  4AYB G;  1XPR A;  1HR0 L;  1N36 Q;  4JI6 L;  1B7Y B;  3CW2 C;  1W2B A;  5C0X G;  4JOI C;  4PZ8 A;  1X3G A;  2I5M X;  2VQF L;  4DR5 L;  5IT9 c;  4QIW E;  3L2P A;  4X62 Q;  1TWA H;  3J80 c;  4DUY Q;  2F4V Q;  3J7A 5;  3NEM A;  1Q1B A;  2CFM A;  4IJL A;  3K8A A;  4B3M Q;  3E0E A;  4WJ3 M;  1VQI A;  1Q46 A;  2HIX A;  1HNX L;  1MJC A;  3KDF B;  1J5E L;  2R7D A;  4X65 Q;  2V1C C;  3S2D H;  4JBJ A;  3W1B A;  2VQE Q;  3PF5 A;  1SE8 A;  4DKA C;  4JG2 A;  4DR6 L;  3HOY G;  1I94 Q;  5H1S E;  2PNH A;  4IJH A;  2JA6 G;  1JJ2 A;  4LFB Q;  2AMC B;  1E3P A;  1AE3 A;  2WB1 E;  2XGT A;  1VQK A;  4JI3 Q;  4LWC A;  4GOP B;  4QQB X;  4DR1 Q;  5IE8 A;  3HOY H;  1L2F A;  2FXQ A;  3Q8D A;  1WYD A;  4LFC Q;  3A5U A;  1G51 A;  2E5L Q;  3KF6 A;  4APV A;  3HOV G;  2IX0 A;  4H02 A;  3KJO A;  2YTV A;  1HNZ L;  3TS2 A;  5IP7 G;  4JC0 A;  2D0O A;  3PGZ A;  1NMF A;  3F2C A;  3RLO A;  1YHQ A;  4JI4 L;  1JB7 A;  2JA8 G;  4DV6 L;  1MIU A;  2HHH Q;  3JAM i;  3HOV H;  1K3R A;  1VQ7 A;  1XNR Q;  5IP7 H;  2JEA I;  4JV5 Q;  1L1O C;  3BJU A;  1IBK Q;  3K80 C;  1XMQ Q;  1SMX A;  2JA8 H;  4KHZ A;  2ATW A;  1SRO A;  2N3S A;  3U4Z A;  4DV5 L;  3CCV A;  1OTC A;  5HGQ A;  3L0O A;  1N33 Q;  4QGU A;  5IWA L;  3PUX A;  4L5T A;  5BR8 Q;  4QL5 A;  2D0P A;  2UXC Q;  5EAY A;  1LUZ A;  5IYC G;  1L1O B;  3BZC A;  3HOX G;  2KEN A;  3MEF A;  5IYB G;  1X3E A;  3U4V A;  4DR2 Q;  4DUZ Q;  3FKI G;  3UDF A;  4A3F G;  1GM5 A;  3PUW A;  2L15 A;  3SGI A;  5IYC H;  3HOX H;  4JI5 L;  3H3V H;  4OO1 G;  4JBW A;  4PMW A;  5M3F H;  1U0L A;  1YNX A;  4A3F H;  1IBM L;  4DV7 L;  2UXD L;  1V9P A;  4DV4 L;  3S15 H;  4DR7 Q;  4A3K G;  1E1T A;  3B6Y A;  2ZJQ A;  4NXM Q;  1OXV A;  3UDG A;  4LFA L;  4R4Q A;  4DV0 Q;  2NN6 I;  2UUA Q;  3STB D;  1VQA A;  3CC2 A;  4LF4 L;  2CQO A;  3M3Y H;  3K0X A;  1I50 H;  3UDI A;  4DV1 L;  3OYY A;  1XMO Q;  2AWO A;  2HQL A;  2DUD A;  1SFO H;  2ES2 A;  4DR4 Q;  2C35 B;  3NEN A;  3I56 A;  1EFW A;  1WJJ A;  1PYB A;  1A63 A;  1X9N A;  4X66 Q;  1SR3 A;  5IP9 G;  1YIJ A;  1WCM H;  3CF5 A;  1GD7 A;  1A62 A;  4JI7 L;  4DK6 C;  4GNX C;  1S72 A;  2UUC L;  4HIO A;  1VQG A;  3T1H Q;  1JT8 A;  2KCM A;  2K5N A;  1AH9 A;  1VQ8 A;  2VQF Q;  4UP7 A;  2IX1 A;  3AQQ A;  3HKZ E;  3U58 A;  2HT1 A;  2VZA A;  1V1Q A;  3EN2 A;  5GAG C;  1VS0 A;  4X64 L;  4GNX B;  4LF5 Q;  1RIP A;  2BH8 A;  4AQY Q;  4YY3 L;  2Q2I A;  1KIX A;  4LF6 L;  1HNX Q;  4LNQ A;  2XTI A;  4GN4 B;  4A3M G;  1D8L A;  1VQE A;  1EWI A;  2K5V A;  1NY4 A;  3I4O A;  1VQC A;  4GLA C;  4BBS H;  3T1Y Q;  1N32 L;  1UE5 A;  5FLX c;  1NJI C;  4YWK A;  4LF7 Q;  3STB C;  5LMN L;  4A3M H;  2UXB L;  4LUZ A;  1X65 A;  4MNO A;  2Y0S E;  2UUB L;  4KLK A;  4JI1 Q;  1C0A A;  1B70 B;  1TWH H;  4LF9 L;  1P8L A;  1FVI A;  4PG3 A;  3GD7 A;  1VCI A;  4UPA A;  3TS0 A;  1EYG A;  2RHS B;  4GN5 A;  3GTP H;  4KHP Q;  1VQ9 A;  4IPH A;  5M5X H;  1VQP A;  2WAQ G;  3NBH B;  3GDE A;  2QA4 A;  1HNW Q;  2K5H A;  4R4I A;  1K8A C;  3HKS A;  2K4K A;  3KDF A;  2F3I A;  2N8N A;  2KBN A;  2HIV A;  5JJI A;  4A3D G;  3H3V I;  1CKN A;  1JJG A;  2VW9 A;  4P72 A;  4IPD A;  1YJW A;  3AYH B;  2PMZ E;  3CCS A;  4DR3 L;  4XIG S;  1NBW A;  1XPU A;  3OTO L;  2JEB I;  4DV2 Q;  1PHJ A;  4A3D H;  4LF8 Q;  3MXN B;  5FJ8 G;  4GKK Q;  1EQR A;  4OO1 I;  2BA0 A;  3CC7 A;  2YTX A;  2E8G A;  4GOP A;  4YHH Q;  1QVC A;  1I5F A;  1IXR A;  2K50 A;  3RNU A;  4B3S L;  2PI2 A;  3RN5 A;  2UU9 Q;  3PIP A;  3E9H A;  5AJ3 Q;  3HOW G;  5FJ8 H;  2QEX A;  2NZO A;  3UE1 A;  3S1M H;  3TRZ A;  4P71 A;  1AE2 A;  3G6E A;  1IL2 A;  2I5H A;  4GOP C;  1NTG A;  4R4C A;  4JBK A;  1Q82 C;  3HOW H;  4DV3 Q;  5GAH C;  2NVX H;  2KCT A;  5LMU L;  1VQN A;  1DGS A;  3VDY A;  3FHW A;  2EIF A;  1PFS A;  4NXN L;  4DV7 Q;  1PA6 A;  5M5Y H;  3HFZ B;  4DV4 Q;  1K9M C;  1XNQ Q;  4YCW A;  5C44 G;  4GLX A;  1YVC A;  5LMN W;  2N49 A;  4B3T L;  4LF4 Q;  2JA6 H;  1TXY A;  4A75 A;  1HH2 P;  3FP9 A;  4EQ5 A;  4HJ8 A;  1Y1W G;  1N9W A;  3TEH B;  2N78 A;  2GVA A;  3J81 j;  4A3G G;  4DV1 Q;  5C44 H;  2ZM6 Q;  4OWX B;  1VQF A;  1L1O A;  3EIV A;  3G4S A;  1VQ4 A;  4QJF A;  2OWO A;  3KF8 B;  1BVS A;  2Z0S A;  3BU2 A;  1Y1W H;  4A93 G;  2CWA A;  2RF4 A;  1LTL A;  5GAE C;  2I5L X;  3I4M G;  4A3G H;  1EUJ A;  4OX9 L;  5FLM G;  3RZO H;  1A0I A;  3D0F A;  2H5X A;  4AH6 A;  1YHB A;  5GAD C;  3A5Z B;  4L5R C;  1KQS A;  2LXK A;  4A93 H;  2WAQ E;  3I4M H;  3CCR A;  5FLM H;  3S1Q H;  1GKH A;  1HR0 W;  2K52 A;  1QUQ B;  3ULJ A;  3J81 i;  1V43 A;  1QVG A;  4IFD J;  2CCZ A;  1EOV A;  4NPS A;  2ALY B;  3M4O H;  2IHF A;  1NE3 A;  4AYB E;  5JJK A;  1IBL Q;  4UP9 A;  2DGY A;  4OWW B;  3K7U C;  1SN8 A;  1E24 A;  1X55 A;  1EQQ A;  1A8V A;  1HZC A;  1N36 L;  3S16 H;  1IZ6 A;  4TQU S;  4A3J G;  2RCN A;  1N34 Q;  2BA1 A;  5IYB H;  1JJC B;  1W3S A;  3FKI H;  4X62 L;  1NMG A;  4DUY L;  1HZA A;  3BZK A;  2F4V L;  5LMN Q;  3CME A;  1VQB A;  1VQJ A;  3CXC A;  3CC4 A;  3PIO A;  4HIM A;  4A3J H;  1KD1 C;  2R7F A;  3CQZ H;  4B3M L;  2UUB Q;  4L5Q A;  3KJP A;  5C0X I;  1VQ5 A;  2NVQ H;  1CUK A;  1UE7 A;  4B3R Q;  1Q12 A;  4A3K H;  1MJE A;  4GS3 A;  5C3E G;  2AKW B;  3DLL A;  3CPW A;  5IYD G;  3PUV A;  4JYA Q;  4GNX A;  2JJQ A;  1PH6 A;  4BBR G;  2VUM G;  3GTG H;  2NVT H;  5DLQ E;  2VQE L;  4R4O A;  1Y1V G;  1OXX K;  1C9O A;  1PVO A;  1PH1 A;  5C3E H;  1I94 L;  4GN3 B;  5IYD H;  2MO1 A;  4GKJ Q;  4BBR H;  2VUM H;  2R6G A;  4JI3 L;  1Y1V H;  1HR0 Q;  4JI6 Q;  1WOC A;  4DR1 L;  1PH9 A;  5C4J H;  3ICE A;  5JEA J;  5IP9 H;  4IO9 A;  4DR5 Q;  1UE1 A;  3GTL H;  1I6H H;  4LW1 A;  1FGU A;  1RL2 A;  3RLF A;  4R4T A;  3J7Z C;  4A3E G;  2E5L L;  4NB3 A;  1GVP A;  3S2H H;  1H95 A;  2ZTD A;  4UP8 A;  3ULP A;  4B3S Q;  4JI0 L;  3CCL A;  2A19 A;  3H0G G;  2CWP A;  3TQY A;  4A3E H;  1S40 A;  3HOZ G;  3IRB A;  1J5E Q;  3KLW A;  1FJG L;  2OCE A;  2PQA A;  3F2B A;  4JV5 L;  1LYL A;  3GTQ H;  2A8V A;  4XTC S;  2OQK A;  1XMQ L;  3H0G H;  3HOZ H;  1YZ6 A;  4C3H H;  4UY8 C;  4DR6 Q;  1J6Q A;  2IHE A;  5LMU Q;  1LM0 A;  1TWC H;  2VY3 A;  4JI8 L;  1N33 L;  2LXJ A;  2B63 G;  4EX5 A;  2IY5 B;  3ER0 A;  5BR8 L;  1VQM A;  4YCV A;  1Q86 C;  2JA7 G;  4JBM A;  4HJ9 A;  2YU9 H;  2UXC L;  4BA1 I;  4BY7 G;  1O7I A;  4DR2 L;  5IY0 A;  4DK3 C;  2MFI A;  4PZ7 A;  3GTK H;  3F8T A;  2WB1 G;  5HY6 A;  2QGQ A;  2B63 H;  1MKH A;  1K0R A;  1VQO A;  3M7N A;  1P16 A;  3M85 A;  1OXU A;  4C3J H;  2ID0 A;  4BY7 H;  1KHI A;  1Q1E A;  3PUZ A;  1YBY A;  5GQO A;  1HNZ Q;  1Q7Y C;  1G6P A;  1UE6 A;  3S1R H;  1XJV A;  1PH2 A;  3CCE A;  2MQH A;  4DR7 L;  4JI4 Q;  1TWF H;  3CCM A;  4DV6 Q;  2A1A A;  4NXM L;  2ZTC A;  4J15 A;  4DV0 L;  3G48 A;  4DAM A;  2UUA L;  1PH5 A;  4MTN A;  4YCU A;  1X54 A;  3JAM c;  4HJ5 A;  1R9T H;  1YHA A;  1XMO L;  2WP8 J;  4DV5 Q;  5M3M G;  5ELN A;  1X56 A;  2E2H H;  4DR4 L;  2YV5 A;  5IWA Q;  1C7Y A;  4LUO A;  1BBW A;  3S17 H;  3KFU A;  3K7A H;  1HZB A;  3L7Z C;  3M4P A;  2OTJ A;  4X66 L;  4R1J A;  3CCU A;  2YTY A;  1UEB A;  4IFD G;  2VNU D;  1PV4 A;  5M3M H;  1PH3 A;  4A3C G;  1U5K A;  3J81 c;  3I55 A;  2R93 G;  1Z47 A;  1SLJ A;  4LUV A;  3D31 A;  4RMF A;  3T1H L;  4JI5 Q;  3GTM H;  4L5S A;  1IBM Q;  1QVF A;  4A3C H;  2B3G A;  1Q8K A;  4P73 A;  2UXD Q;  5J3B A;  4DAY B;  2R93 H;  4TVA B;  5JJL A;  4LFA Q;  2NZH A;  2JQO A;  1YI2 A;  4A3L G;  4LF5 L;  3PF4 A;  1PH4 A;  4AQY L;  4P74 A;  3W1G A;  1QUQ A;  4GLV B;  3S14 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...