4JI5L

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
124
structure length
123
Chain Sequence
b'PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 13
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ji5L00
5M5YH 4JBMA 4ALPA 1QZGA 4NPSA 3J81c 1KAWA 4DR5Q 4A3FH 1L2FA 2Q2TA 4POFA 4JI4Q 1P8LA 1WFQA 5C4XG 4X65L 2JA8H 3J7A5 1SN8A 2EXDA 4LF5L 2WAQG 1HJPA 1HZAA 3PUXA 2AMCB 1KC8C 4KHPL 1YI2A 1N34L 2CCZA 4EX5A 4C3IH 5IYBG 4DR7Q 2VY3A 2K4KA 1L1OC 3CMAA 4IOAA 3CC7A 4HJ5A 4LUOA 2CFMA 1X3EA 2E2IH 3ZJYC 1L1OB 2PQAA 2IHEA 1E3PA 2Z0SA 3A5ZB 1VQNA 2BH2A 1NY4A 2E8GA 2YV5A 3I4NG 2VL6A 4QGUA 1BVSA 1VQ9A 2UUCQ 5JEAG 2VUMG 1X54A 1A63A 4TVAB 1SROA 2OQ0A 2K75A 1VCIA 1N9WA 1OXSC 1PYBA 4IPCA 3KDFB 4DAMA 2JA6G 4PG3A 1H95A 3EBEA 2L15A 5M5XH 4QIWE 3CCJA 1I94L 2UXBL 4ME3A 3KYHC 1PVOA 2R93H 3RN2A 4X62L 1UE7A 1YZ6A 2DGYA 1XNRQ 3CAMA 2OTLA 2KHJA 4UPAA 5GAHC 4DR3Q 1HR0Q 4LFBQ 4DR6Q 1QUQA 4GS3A 2OQKA 2GVAA 4LW1A 1JJCB 4DUZL 4JI6L 1QZHA 3S16H 1TWGH 1XPOA 3CCSA 2V1CC 4QY7A 3W1BA 3U58A 2BA0A 2OWOA 2I5HA 3G48A 5J3BA 5C3EH 1YJ9A 3M4OH 5BR8Q 3B6YA 2HIVA 1WI5A 4JYAL 3H0GG 4JI7Q 4LF4Q 2JEAI 4LF6Q 1XJVA 3GTJH 2CWAA 1K9MC 1OXXK 3RLFA 1EWIA 2NN6I 3KLWA 1T9HA 4BY1H 1SLJA 4GKKL 4DK3C 4GLVB 1AH9A 2KHIA 3MXNB 5IYDG 2VQFQ 4GOPA 1M1KC 4DV3Q 2EQSA 2RCNA 4P72A 2VQEQ 3HOYH 2F4VQ 1TWCH 2YTVA 3UDIA 2ALYB 4GN3B 3RLNA 2ZJPA 1XNQL 2Y0SE 2R92H 4AQYL 1YITA 4IPHA 3W5OA 4NXNQ 1Q46A 4DR1L 1X56A 1WJJA 2MQHA 2R6GA 2MNAA 4B3SQ 3TS2A 4A3CH 4JV5L 3PUYA 4K0KL 5IE8A 4PZ7A 4YWMA 3T1HL 4A3KG 1C0AA 1VQJA 3GTQH 2LSSA 4DR2L 1KXLA 4RG1A 2KENA 4A3JG 2N78A 2NVQH 4OO1I 1X3GA 4YY3L 2E2HH 2B63G 5M5WH 3I7FA 4LFAL 1N36L 2I0QA 5IYBH 3JC66 4NXML 1IBLL 4UY8C 4DUYL 4LWCA 4X64L 1PFSA 4PZ8A 5LMUL 3G4SA 1VQIA 2K5VA 3J81i 1K8GA 1FL0A 4GLXA 3D31A 1IBKQ 1Y1VG 1YIJA 4BY7H 4LF9Q 3CCLA 1EOVA 3K8AA 1S72A 4KLKA 3PGZA 3WWVA 1QUQB 1CKMA 5IYCH 1PH2A 1IBMQ 4A75A 1MKHA 4LF7L 4UP7A 1YBYA 1YNXA 3RLOA 5M3MG 3CC4A 4JI2L 2WP8J 4A3DG 5IP9G 4OONA 2D62A 2RHQB 3PUVA 2YYZA 1IYJB 3TEHB 2ZJQA 1J5EL 3F1ZA 4R4QA 4HIDA 1HNXL 1D7QA 5M3FH 4GKJQ 3I56A 3KFUA 5C44H 5GROA 4JI5Q 1NTGA 4OX9L 1E24A 5IWAQ 4P73A 3CPWA 4GOPC 3HOZH 4DR4L 2Y0SG 1G51A 3GTKH 4BBRH 4GOPB 5FLMG 2HHHL 1MJEA 1CSPA 2JEBI 4AIMA 3PF4A 4Y7NH 4A3IH 1TWFH 3PO2G 2RHSB 4OWXB 4X66Q 2B29A 1YHAA 2HIXA 2VW9A 1WCMH 1B70B 1L0WA 1N8RC 1SFOH 3OYYA 3AFPA 4JC0A 2A8VA 2CWPA 1I50H 4NB3A 3CCRA 2RF4A 3S24A 4AH6A 1Z9FA 2R7DA 3ULLA 3ICEA 2UUBL 3PO3H 1A62A 5LMNL 1CUKA 3EIVA 3T1YL 4DV2Q 4GNXA 3HOVH 4P75A 4OO1G 4YWLA 4JI1Q 2R7ZG 2CKZB 4O0AA 5JJKA 4O2DA 2CQOA 3KF6A 4DV4Q 5ELOA 2MO1A 4BXXG 4LFCL 4JBKA 1HH2P 3GTLH 4DNIA 1Y1WH 3NELA 1QVGA 1I94Q 2UXBQ 4IJLA 1Q1BA 1E7ZA 4JBJA 3LGJA 2PMZE 2ZTDA 5JJIA 1YEZA 2JE6I 4B3RL 1Y1WG 3S2DH 1SRUA 4GN4B 1XPRA 4B3TQ 1G6PA 1A8VA 5AJ3Q 3NBHB 1VQ8A 4DV6L 5IT9c 3S14H 3M3YH 2GVBA 4YHHL 3OTOQ 1XMOL 2UU9L 4A93H 3CCEA 4R4CA 2UXDQ 2I5MX 3U4ZA 3CCVA 3M4PA 1W3SA 4J15A 1Q7YC 4DV5L 3BZCA 4A3EH 3DLLA 1V9PA 1FGUA 4APVA 1KHIA 3SGIA 4DV1L 4HIMA 3UDXA 4AYBE 5IP7H 2QGQA 1NJIC 3GD7A 4GN5A 1KD1C 4DPGA 4A3MH 2E5LL 4BA2I 1CKOA 2QA4A 1JJGA 4JBWA 5FJ8H 3M9BA 1V43A 3CMEA 1HNZQ 3HOWG 4A3BH 1U5KA 4AQYQ 4DR5L 4JI4L 2UXCQ 2YTYA 2JA7G 1I6HH 3FKIH 4JI0Q 2Q2UA 3PUWA 2R7FA 3HOXG 1X55A 3CP0A 2ZTCA 4RMFA 2VS1A 1VQMA 4A3GG 1X6OA 4LUZA 4B3MQ 2ZJRA 2JA5H 2Z6KA 4OXPA 4DR7L 4DR2Q 4BBSG 4GNXC 3KF8B 2ID0A 3GTPH 1U0LA 2NVXH 2UUAQ 3F2BA 1N32Q 3HOUG 2NVTH 3KF6B 1VQ5A 1B8AA 4A3LH 2JJQA 4JI3L 4X6AH 1X65A 2D0PA 3NENA 2UUCL 1EIYB 3K0XA 4MZ9A 2KBNA 4YCVA 3RZOH 1YJWA 3I4OA 3I4MH 1K73C 2PQAB 2IT1A 1SMXA 2E2JH 4DV7Q 1VQEA 2A1AA 4BXXH 3TRZA 2ASBA 4YCWA 1XNRL 5C4XH 1HNWQ 4JI2Q 1CKNA 1Q12A 4DR3L 2AKWB 3A0JA 4UP8A 1HR0L 1EQRA 3S15H 1E22A 4JCVE 5LMNW 4AYBG 1EQQA 4A3FG 1J6QA 1XPUA 4GKKQ 3CCUA 2JA8G 4KI0A 3KJOA 5C0XI 1AE3A 2HQLA 1P16A 1IL2A 4MNOA 4JI7L 4LF4L 2K5HA 4LF6L 1PH5A 4LUVA 3GTGH 3I4NH 3S1MH 1N33Q 4KHPQ 2ZM6Q 2JK8A 3K7AH 2AWOA 2VUMH 2VNUD 1XTDA 2AHOB 1FJGQ 1OTCA 4R1JA 1XMQQ 4DV3L 1JMCA 2JA6H 2K50A 2VQEL 2F4VL 2K52A 1Q1EA 4YCUA 4JI8L 3H3VH 2WFWA 4Y52H 1K83H 3G6EA 2IHFA 2XGTA 3M4QA 4NXNL 2NN6G 4C2MH 1G291 4KHZA 3T1YQ 3GTMH 3M7NA 1Q86C 4B3SL 4DAYB 2R93G 2ATWA 1GKHA 1UE5A 4X65Q 1KRTA 1VQAA 3RNUA 3CF5A 4LF5Q 3OW2A 3RR5A 1W2BA 1N34Q 1HZCA 4C3HH 3H0GH 3KOJA 1LYLA 5GAGC 2H5XA 3KDFA 1GO3E 5C3EG 1UE1A 1PH8A 1M90C 1DGSA 1PYSB 3PCOB 3MEFA 4IPDA 5IYDH 1OXUA 5HGQA 1PH7A 2DUDA 1VQBA 3ERSX 3J7ZC 1SE8A 4LNQA 4LF9L 5DLQE 2IX0A 3AEVA 1CKNB 5ELNA 4FDBA 4BY1G 1C7YA 1Q82C 1HZ9A 3CCQA 4IOCA 3UE1A 3E0EA 2N3SA 3HOYG 5GAEC 4DV5Q 2OCEA 1JE5A 3K7UC 4R4TA 3JAMc 2QEXA 1K3RA 3ULPA 1K0RA 1LTLA 4X62Q 4DK6C 1VQ6A 2R92G 4A3KH 4QL5A 3VDYA 3DM3A 3L2PA 4IFDI 2K5NA 2NZHA 4UP9A 4GKJL 4A3CG 2C35B 4A3JH 4DR4Q 4IPGA 4DUZQ 4JI6Q 3I2ZA 2FXQA 4HIOA 5IWAL 2B63H 4DV0L 1SR3A 3K81C 4MTNA 4JYAQ 1C9OA 2A19A 2PNHA 4DKAC 1X9NA 1ASZA 4WJ3M 4X66L 1HR0W 1WYDA 1E1OA 1Y1VH 4OWTB 3J80i 4JG2A 3I55A 1I5FA 3STBD 3AYHB 1YHBA 4L5SA 1VQOA 1AE2A 2Q2IA 4JOIA 2JQOA 4L5QA 5EAYA 1EYGA 1GVPA 4A76A 4BY7G 5M3MH 1GM5A 5JJLA 1PH6A 3CC2A 4A3DH 5IP9H 4JI3Q 2NVYH 1XNQQ 3L7ZC 1VQCA 5IYCG 5C4JH 3HKZE 4DV2L 1YVCA 1VQKA 3CD6A 4JI1L 3GTOH 1KRSA 4DR1Q 2IX1A 4DV4L 3ER0A 3G71A 4LF8Q 4JV5Q 2IY5B 3IRBA 4K0KQ 1YJNA 1TWAH 3T1HQ 3S17H 1BBWA 1ASYA 5M3FG 1O7IA 2XTIA 2PI2E 2N8NA 5FLMH 4P71A 5IY0A 4QJFA 5C44G 1OXTA 1V1QA 4YY3Q 5C0XJ 3BZKA 3ULJA 1WOCA 4GNXB 4HIKA 4BA1I 3HOZG 3KJPA 3PO2H 4XIGS 1I3QH 1S40A 1NBWA 4LFAQ 4BBRG 1N36Q 1EIFA 4NXMQ 3FP9A 4PZ6A 3A5UA 1JB7A 1IBLQ 4B3TL 3CW2C 5AJ3L 2MO0A 4DUYQ 4X64Q 5LMUQ 2ZTEA 2EIFA 4PMWA 4A3IG 1R9TH 1IZ6A 4LF8L 3OTOL 4L5TA 1IXRA 4GLAC 2UXDL 1GD7A 2KCTA 1WCMG 1Y14B 3EN2A 3PIPA 2KCMA 4IFDG 3D0FA 3S1RH 2F52A 1NMGA 3A74A 5HY6A 3UDGA 4LF7Q 1BKBA 1RIPA 5E7NA 3FHWA 3STBC 3U50C 1KQSA 2R7ZH 3J80c 1VQHA 3F2DA 3PV0A 3PO3G 4LFBL 4DR6L 1VQGA 1UWVA 3HOVG 1J5EQ 1HNZL 3PF5A 4JI8Q 2D0OA 1HNXQ 1CSQA 3NEMA 3TREA 1YHQA 1JJ2A 3CXCA 2HT1A 2ES2A 3AQQA 4OX9Q 2UXCL 3K80C 5BR8L 3PIOA 2VZAA 4JI0L 4POGA 1TWHH 2LXJA 1UEBA 2MFIA 4JOIC 3AFQA 2JA9A 1MJCA 3F8TA 2LXKA 3HKZG 4XTCS 5JEAJ 2YTXA 3RZDH 4WJ4A 1PH4A 4B3ML 3RN5A 1X3FA 2HHHQ 1A0IA 2WB1E 3JAMi 3UE0A 1UE6A 3BJUA 1D8LA 1S3OA 2NZOA 2VQFL 2UUAL 2I5LX 4IJHA 4R4OA 1VS0A 4IO9A 2B3GA 1VQLA 1N32L 1EFWA 5GQOA 2Z6KC 4A93G 2Q2HA 5K36G 4P74A 2AWNA 1VQ4A 2UUBQ 1NMFA 2N49A 3CQZH 1LM0A 3Q8DA 5LMNQ 4A3EG 4A4IA 5FLXc 3L0OA 1L1OA 4HJ7A 1OXVA 4YWKA 3UDFA 2WAQE 1PA6A 3HOWH 3J81j 4R4IA 5IP7G 4HJ9A 4DV7L 1TXYA 4C3JH 4A3MG 1PV4A 4LFCQ 2JA7H 4IFDJ 1BBUA 5FJ8G 3F2CA 5H1SE 1KL9A 1HNWL 3HOXH 3S2HH 4A3BG 3PSIA 4A3GH 1VQ7A 2YU9H 1Q81C 1KIXA 3M85A 3HKSA 2BA1A 2BH8A 3FKIG 4BBSH 3HFZB 4QQBX 4B3RQ 1EUJA 1VQPA 1Z47A 1K8AC 1RL2A 3H3VI 1QVCA 1IBKL 5GADC 2JA5G 4DV0Q 3HOUH 1PH1A 4DV6Q 4L5RC 3S1NH 3U4VA 1E1TA 1MIUA 4YHHQ 2K14A 2ZM6L 1XMOQ 1PH9A 1IBML 2UU9Q 1N33L 3S1QH 3BU2A 1HZBA 1PHJA 1B7YB 3E9HA 3H15A 4HJ8A 4OWWB 1FJGL 4H02A 2OTJA 1JT8A 5C0XG 2WB1G 4TQUS 1XMQL 1QVFA 4A3LG 3E9IA 2F3IA 3PUZA 4DV1Q 1FVIA 1NE3A 1VQFA 4HJAA 2PI2A 1PH3A 2E5LQ 3CCMA 3GO5A 2GN5A 3CPFA 3GDEA 3W1GA 1LUZA 3TQYA 1VQDA 4JI5L 3TS0A 3I4MG 4EQ5A 1Q8KA
chains in the Genus database with same CATH superfamily
3EFXD 1QG7A 1D1KA 1QZGA 4DR5Q 1L2FA 2B2UA 4POFA 1P8LA 4EGVA 3QOLA 2EXDA 4LF5L 1SYCA 2AMCB 4BBRB 3BG3A 1L1OC 1X3PA 2EY6A 4KY5A 3CMAA 3CC7A 4IOAA 1ENAA 2CFMA 2PQAA 2DY8A 3A5ZB 4CDEC 1VQNA 1R4PB 4QGUA 2EVBA 1VQ9A 3MHBA 1W6KA 1A63A 1SROA 2K75A 1OXSC 1JWSD 3RD4A 4PG3A 1H95A 5M5XH 3KYHC 1PVOA 1UE7A 1YZ6A 4CKEA 5C5MA 2LKVA 4BWGB 1HR0Q 2K5QA 4GS3A 2CH4A 3LWEA 1B9NA 5ELEA 1B1ZA 4HCSA 1XPOA 3CCSA 2E2IB 1PDQA 2B2TC 2KEDA 3G48A 3GV6A 4QUFA 3M4OH 4J1MA 1ICWA 1WI5A 2NBFA 3H0GG 4LF4Q 2ICIA 2MPMA 1U4PA 3M3YB 1GXDC 4F7XA 4GKKL 1M8AA 2VQFQ 1U4RA 3DMUA 2F4VQ 5C0XH 1HRJA 1EFID 3T51B 1KLGD 1G2TA 2R92H 3RLNA 4A3MB 4ABNA 3BYTB 4IPHA 4KK7A 1S5CD 2R6GA 3TS2A 3PUYA 4K0KL 2CVRA 5IE8A 4QF4A 4YWMA 3FVQA 1LTGD 1C0AA 1GHKA 3FKIB 2LSSA 4DR2L 5FO7B 3MC0B 4RG1A 3VR6A 2KENA 4WFN3 1LLRD 1C4QA 2N55A 4RCOA 4LFAL 4NXML 4LF8L 2MHVA 5LMUL 2K5VA 1K8GA 2N88A 5KIXA 4LK1C 4LF9Q 3CCLA 1EOVA 2L9HA 3K8AA 3KK7A 3PGZA 3WWVA 1IBMQ 1A15A 3TP7A 1BXTA 1HTLD 1MKHA 1WD0A 1AEXA 4IN3A 1EQTA 3CC4A 1EY0A 1SYDA 3I4LA 4A3DG 2B2YC 3NQIA 3FMCA 2YYZA 3TEHB 3VYUA 1J5EL 4ZLTF 4R4QA 1EY6A 2WAQB 4OX9L 2XRSD 1CA6A 5IWAQ 3CPWA 3AMUA 4DR4L 2Y0SG 3GTKH 4BBRH 1B3AA 5EKIA 4FXKC 4EQPA 4AIMA 3IFTA 4Y7NH 4OWXB 4X66Q 2EJMA 4NW2A 4OHJA 5E1FA 3OYYA 1N8RC 3VYTA 1G6ZA 2FJ2A 5DAUA 1Z9FA 2K05A 3PIO3 5LMNL 1CUKA 3EIVA 2DY7A 1HA5A 4K8IA 3HOVH 2CKZB 4O2DA 4C2MB 1NAPA 4HCEA 1Q8IA 1EYCA 3LGJA 5C4ZA 2JN4A 1TWFB 2RA4A 4IALA 4KN7C 2JE6I 4GN4B 1YNJC 1F2ZA 1A8VA 5AJ3Q 3NBHB 1EY5A 5IT9c 4EVOA 1K0SA 3TZDA 3M3YH 1KDCA 5JPMC 5K36H 3HG9A 1V1PA 5AFWA 5ELFA 3DLLA 3OWEB 1V9PA 1FGUA 4JVZA 4QMGA 4APVA 1KHIA 1E2WA 3SGIA 3UDXA 4CKCA 4GKKQ 4DPGA 4A3MH 1BCPB 1CKOA 2QA4A 1RCVD 2F0UA 3HEJA 3HOWG 1Y8NB 4A3KB 4PNYA 2Z8LA 3CRLC 4ZYSA 4JI4L 1ZYRD 2YTYA 3FKIH 3S2DB 4OL7A 2R7FA 1X55A 4ODGA 2QKIC 4A3GG 2ZJRA 3S14B 1NCVA 4OXPA 2EE1A 4G7OC 4DR2Q 2PW7A 3JAME 1SYGA 4B9WA 2EYMA 4A3EB 1Y1VB 4KD3A 3HOUG 1D2BA 4JI3L 3FRPB 2Q8RE 1X65A 2D0PA 3NENA 1HA6A 2ICEC 3HS0C 3K0XA 2M2LA 3I4MH 2PQAB 1PFNA 2KCCA 2IT1A 4DV7Q 3TP5A 4YCWA 5C4XH 1VMPA 1Q12A 4K2LA 4DR3L 4UP8A 1EQRA 3S15H 4JCVE 2HCCA 3V2TA 3RMHA 3GTPB 1XPUA 2K32A 2JA8G 3NUCA 1HHVA 1P16A 4KTAA 4FVMA 3Q24A 2XWJB 4MIUA 4C3IG 4LF6L 5E4WC 4KHPQ 1R9TB 2AWOA 1H9KA 2AHOB 3A7LA 1WTXA 2QILA 3MXGA 4DV3L 2JA6H 2K50A 2VQEL 1LTSD 1Q1EA 4ZKBB 3QB3A 4NXNL 4C2MH 4MTKA 2DJGC 1TS4A 4B3SL 1GKHA 3SK6A 5K5PA 1H9JA 1KRTA 3ONAB 3X3NA 3VR2A 3DEPA 3OW2A 1DOLA 2NZ1D 1N34Q 1HZCA 4HSPA 3E0JA 2VUMB 1FD7D 2H5XA 1GO3E 1UE1A 4OEMB 1PYSB 4IPDA 3H3VC 2K1BA 1GHJA 1PH7A 4K6DA 3J7ZC 3TDQA 1ZEQX 2IX0A 3NE5B 3EROA 4BY1G 3CQZB 4IOCA 3HOYG 4IQZA 5GAEC 4DAPA 5EBDA 2OCEA 4WRDA 1A2UA 4OELB 4C3JB 4A3KH 2V4DA 1O7ZA 4QL5A 2JA7B 4U68A 1JQYD 1SEBD 1Z7TA 2AUKA 4JI6Q 2D9UA 3I2ZA 3GV3A 1SR3A 4BBSB 4EQNA 5CV8A 2EOTA 4DF7A 2B2WA 4JYAQ 3I73A 4QB4A 1ASZA 1WYDA 1Y1VH 3STBD 1VQOA 1GVPA 3OIPA 4BY7G 1GM5A 2BDNA 2A69C 4JI3Q 2NVYH 1XNQQ 1MSGA 1SYBA 3HKZE 4JI1L 1KRSA 4DR1Q 2RDHA 1BBWA 1ASYA 5M3FG 2XTIA 3MTSA 2EPBA 4CJ0B 5FLMH 4QJFA 1V1QA 1WTPA 4HIKA 2L0CA 4RH6A 2QW7A 3M4YA 1EOTA 1EIFA 4B3TL 3QWNA 1IBLQ 4DUYQ 2ZTEA 4A3IG 1R9TH 2WACA 3OTOL 3E3XA 3DWAA 2UXDL 3PIPA 3D0FA 1BOSA 3GTOB 1PTOH 2IPKD 1BKBA 2R7ZH 5E7NA 3FHWA 1STHA 3PO3G 4DR6L 1VQGA 1UWVA 1AZPA 2F0OA 3TREA 3VR5A 1YHQA 4F88A 3CXCA 2LXJA 1UEBA 3UE1A 3AFQA 3F8TA 1AN8A 1ET9A 1PH4A 1EU3A 2EY1A 4RHSA 4Z9CB 2I5LX 3Q6SA 2JP1A 2QDBA 5G3LD 4IO9A 1VS0A 1VQLA 2EYOA 4G7HC 4A93G 1CTMA 2Z6KC 1SJHD 5J1ZA 2HDMA 2AWNA 5IODA 3TN2A 2UUBQ 3CQZH 3L0OA 1PA6A 2IW3A 4UDUC 1LTID 1TXYA 4C3JH 4LFCQ 1PV4A 3FEWX 2JA7H 4IFDJ 5FJ8G 1HNWL 1LV9A 5T1IA 2DN8A 4A3BG 1TS3A 3ND8A 1KIXA 3M85A 2BA1A 2BH8A 4BBSH 4B3RQ 1RL2A 3H3VI 5GADC 2UU9Q 4ME5A 2ZM6L 4BS9A 3E9HA 4XYOA 1FJGL 4IUQA 4I7ZC 1QVFA 5CC4A 4DV1Q 1NE3A 3F2UA 4H0LC 3CCMA 3S2HB 3CPFA 1LUZA 2YU9B 4CHTB 4EQ5A 3K5OA 2X6LA 1Q8KA 4RAUC 3OOCA 4JBMA 5ELBA 4ALPA 3LNNA 1KAWA 2F0QA 4J6HA 1WFQA 2RDGA 2A6HD 4CKBA 1G8ZD 1QNKA 1SN8A 4RGOS 2M00A 2QCPX 3MXPA 1JOKA 3PUXA 4JW0A 3T13A 4L63B 2E2DC 4EX5A 1CK1A 1E2VA 3BDOA 1RTNA 3ZJYC 3MZ5A 1NY4A 2VL6A 3NSWA 2UUCQ 1DXMA 1X54A 2OQ0A 4QUCA 1PYBA 4IPCA 2IJ0A 3K5MA 2NN6H 4AYBB 3G7LA 1SMYC 4X62L 2DGYA 1XNRQ 2XVSA 2OTLA 2KHJA 4PQXA 4UPAA 5GAHC 3GTLB 1VDZA 1BNZA 4DR6Q 1SNDA 1JC7A 5CYUA 4DUZL 3S16H 2XSCA 4QY7A 3U58A 2OWOA 2BA0A 3FPPA 3MFYA 1FR3A 1DOKA 4C3HG 4JI7Q 1XJVA 3GTJH 2CWAA 1FNUA 1KTKA 1K9MC 1TT2A 1B44D 2B2UC 4ZQ3A 1WVLA 2KHIA 1M1KC 5IYDG 1F2YA 2YTVA 1IW7D 4K8JA 2ZJPA 2F1MA 4AQYL 4TRDA 1JWUD 1YITA 3W5OA 5CGKA 1Q46A 4ZRZA 5IT9E 1X56A 3Q0AA 4A3CH 4JV5L 4CGYB 1I4XA 3PMFA 4PZ7A 1QCBD 4LMQD 3M4OB 1PYWD 5I4DA 3GTQH 2NUCA 1KXLA 5D3DA 2O2LD 4A3JG 2DNCA 2N78A 2NVQH 1NSNS 1CI3M 1X3GA 4YY3L 2B63G 2Q8TA 1N36L 5KGUA 4UY8C 2BE5D 4X64L 4PZ8A 5JVG3 5DNFA 2WB1B 3U9SA 3VYRA 4IUTA 3KLRA 5LL6S 3A54A 1K8OA 4KLKA 4KMUC 1YNXA 1Q90A 1U9RA 5M3MG 4JI2L 5IP9G 2RHQB 2EY2A 2RSNA 4I7AA 3VA5A 2CQAA 3F1ZA 1HNXL 3MA2B 5C44H 3IFDA 1UEAB 3HOZH 5BN4A 1VMCA 4M1UB 4GOPB 4KV6A 3J81L 1ONLA 4KKUA 2B29A 1Q3LA 3S1MB 1B70B 4S3SA 1BCPD 3K7AB 2WKDA 4JC0A 1IYVA 2RF4A 4AH6A 3IKJA 5KYIA 1TR5A 1A62A 5J22A 3DEOA 1DONA 4DV2Q 4GNXA 1K83B 2KEEA 1PTOF 4FXDA 1JOOA 1SE4A 3GTLH 4DNIA 3GTKB 3NELA 3TBIB 1QVGA 4IJLA 4WORA 4JBJA 1GUGA 4Y7NB 2EXZA 2ZTDA 5JJIA 1LT5D 1Y1WG 3BVZA 4RHRA 3QJYA 3M4PA 1W3SA 4J15A 3I8ZA 3BZCA 3HOVB 2OF1A 3D8GA 1S4ZA 2R3ZA 1HUMA 3GQBA 1UUPA 4AYBE 2QGQA 5IP7H 4BA2I 2E5LL 4JBWA 3CMEA 1HNZQ 3V96A 2K28A 1U5KA 1D6EC 4AQYQ 4JI0Q 2Q2UA 3PUWA 4G4KA 3HOXG 3H94A 2B2VA 3P7JA 3CP0A 2ZTCA 5T1GA 2VS1A 4LUZA 2JA5H 4DR7L 3KF8B 2ID0A 5LHY1 1STAA 2D2CC 2UUAQ 4DN4M 1O7LA 1BQQT 1BF4A 3C46A 3KF6B 1VQ5A 2JJQA 4X6AH 2KVMA 3A7AB 1YJWA 1BBXC 4TKOB 4N8X1 1VQEA 2A1AA 3TRZA 1K3BC 2ASBA 1EY4A 4JI2Q 2SEBD 1VF5C 1XTCD 4A3FG 1S5ED 4H44C 4RGNA 1ZYRC 2HQLA 4RCNA 1IL2A 2K5HA 4LUVA 3S1MH 1LO5D 1PFMA 2EJFC 2JK8A 3K7AH 3I4MB 1OTCA 1BR9A 1DM0B 3AU7A 2VXWA 2JSOA 4ZUJA 5C4XB 4XQNA 3H3VH 2WFWA 4Y52H 1K83H 3R93A 5CBEE 2MUYA 3S15B 3M4QA 5BN5A 3GTMH 3M7NA 1STNA 2R93G 5A35A 2ATWA 1F9PA 2KECA 5A2QE 4LF5Q 1W2BA 2J7ZA 3H0GH 5I6YA 2L55A 3E6ZX 3AB9A 2JYOA 5C3EG 1PH8A 3ERQA 1DGSA 2JA6B 3MEFA 5BN3A 1TVXA 3BVGA 3SEBA 1TS2A 1OXUA 1U4MA 3ERSX 5KNDA 3W2DA 2F0IA 4PMBA 3AEVA 5ELNA 3OMCA 3VR4A 4FDBA 1C7YA 1J8IA 1Q82C 5ELDA 3NXWA 1JE5A 3K7UC 1G2SA 1CHPD 2I46A 4R4TA 2QEXA 3ULPA 3HOWB 4HMJA 5EBCA 4R9WA 3DM3A 2K5NA 1A6XA 2QF7A 2BOSA 4GKJL 2C35B 3TZUA 1S5BD 2FXQA 5IGDA 3TP8A 5EPJA 2GA4B 4ZKCB 2PNHA 1X9NA 3HOUB 4FF1A 1HR0W 1E1OA 4OWTB 3I55A 1I5FA 1WTVA 1FGBD 4JOIA 2JQOA 3EQLC 4A76A 5JJLA 4A3DH 1AW7A 3L7ZC 1VQCA 5IYCG 1VQKA 1YVCA 2A74C 4DV4L 3EA6A 1RF2D 1D5MC 3WOEA 5CMDA 2IY5B 3IRBA 4K0KQ 5DEHA 1SXTA 3K57A 2J0TD 3S17H 1DZ1A 5JPNC 5HGTA 1SJED 1II3A 1KDBA 1OXTA 4GNXB 5C0XJ 1QNUA 2OEOA 3BZKA 1WOCA 5CR3A 3ULJA 4C3IB 3J80L 2Z4IA 2PZUA 4LFAQ 4NXMQ 4PZ6A 3A5UA 1JB7A 3CW2C 3P75A 2K5WA 4LF8Q 5LMUQ 4PMWA 1SYFA 2EIFA 2RVLA 5DM63 4L5TA 1AZQA 3R2IA 2KCTA 1WCMG 2NVYB 3SHLA 4IFDG 3A74A 2WKCA 1DYQA 1RIPA 3STBC 3NWTA 3F2DA 3PV0A 2B2WC 1AFPA 5IGGA 4LFBL 3A55A 3QIAA 1GUOA 1J5EQ 2D0OA 3NEMA 1X3QA 3T56B 4OX9Q 2UXCL 5BR8L 1LT3D 2MFIA 4DR4Q 3HKZG 2WINB 1YNND 4XT3B 1H9MA 4B3ML 2PZTA 2F3WA 1A0IA 1EY9A 4H7BA 1D8LA 1S3OA 1BUVT 2L5TA 4K5WA 4RFBA 4X3KA 1PTOB 1N32L 1EFWA 1DOMA 2R7ZB 2F0WA 3J7AF 4KKSA 1NMFA 5LMNQ 3SK5A 2F0LA 4A4IA 4A3EG 2AQ1B 4HJ7A 4YWKA 3UDFA 2KOLA 2WAQE 3HOWH 3I3CA 4R4IA 2NB0A 3TSSA 2Z4HA 1QE6A 1T5XD 1KL9A 4O42A 3K58A 4A3GH 2PQEA 3N6RA 1VQ7A 3J7AV 3HKSA 3DXJC 1ZXTA 4M8AA 1VQPA 1Z47A 2LY7A 1K8AC 2XWBB 1QVCA 5M5WB 1IBKL 3HOUH 1FNWA 2A68D 3S1NH 1F9QA 4DXFA 1N33L 4DGZA 2NWGA 4BY7B 4H02A 3TMEA 4A3LG 1XMQL 1FVIA 1VQFA 1ET6A 4L8JA 4N8FA 2GN5A 3EJIA 1A3VA 1VQDA 4JI5L 3IL8A 1RDPD 2E75C 2O4XA 4NMZA 3A8JE 5JAVA 2Q2TA 4BXXG 4NPSA 3H09A 3J81c 5M3FB 4JI4Q 4Q5VA 5EKLA 1UAPA 4X65L 2SDFA 3G6JB 2JA8H 1HJPA 1HZAA 3QO2A 1KC8C 2PMZB 2CCZA 3K6OA 4CDDC 4IUPA 4C3IH 3MWYW 4UAIA 2K4KA 4HJ5A 1TQOA 4LUOA 1L1OB 2IHEA 1E3PA 5IGFA 2BH2A 2E8GA 2YV5A 3I4NG 1STYA 1SFOB 3K5LA 5JEAG 2VUMG 1EIHA 1IYUA 4TVAB 5IGCA 1WTWA 4RKBA 3EBEA 2UXBL 3CCJA 1JR0D 4ME3A 4CDCC 1MGSA 3CAMA 1ILQA 1GUTA 4DR3Q 4LFBQ 5D14A 3SK4A 2X69A 2GVAA 1JJCB 1QZHA 2V1CC 1X32A 5I2XA 2I5HA 5J3BA 1YJ9A 5BR8Q 3B6YA 1ICFB 1C48A 2A6HC 1U4LA 2HIVA 2RSOA 4LF6Q 2EY5A 1EYDA 1RJTA 2A6ED 2HQEA 4HN7A 1OXXK 1MSHA 2O5JC 3RLFA 1EWIA 2ZXOA 4BY1H 1SLJA 4GOPA 3MXNB 1I4GA 3QG1A 4DV3Q 2EQSA 1M4VA 1QOHA 2RCNA 2VQEQ 3HOYH 4HR7B 1TWCH 1IHZA 1ESFA 2ALYB 4ZAIA 5JVH3 1GUNA 1OO9B 3T16A 1STGA 4NXNQ 2TSSA 3S16B 2MNAA 4B3SQ 4A3BB 1RKNA 4G7ZC 3T1HL 4DAVA 5IOCA 4OGQC 5FLXL 1I6HB 1CFMA 2F0SA 3EVQA 3GTJB 4HEDA 1PZID 2E2HH 5M5WH 3I7FA 2NVXB 2FMCA 3H6MA 3G4SA 1VQIA 4F87A 3J81i 4KHVA 1SE2A 1FL0A 2NVTB 1IBKQ 3D31A 1SBBB 1TIID 4BY7H 2B39A 3FDTA 1HXYD 2JXMB 1KNAA 4TSSA 4ULLA 1PH2A 1QUQB 1CKMA 2KUMA 4LF7L 4A75A 4UP7A 1YBYA 4IURA 1EY7A 3RLOA 3M7GA 1CQVA 5KYLA 2D5DA 4IUVA 1D5XC 4OONA 2D62A 3GTQB 2ZJQA 1JE4A 1IW7C 4HIDA 1TY2A 2DNEA 5M3FH 2NVQB 4JI5Q 1E24A 4P73A 2HD3A 1G51A 3CRKC 4WJWA 2F0DA 1A3UA 4KJOA 2HHHL 2JEBI 3PF4A 5KRUA 1MI2A 4A3IH 5CV4A 3PO2G 2RHSB 2HIXA 3NTKA 2VW9A 1MHWC 1XXGA 1SFOH 4NKLA 2A8VA 2KHSA 3SE0A 1I50H 4NB3A 4K14A 3S24A 1SNMA 4IZ8A 2R7DA 3ULLA 2BE5C 3KF8A 3PO3H 1ILPA 1CQFA 3T1YL 2ZXPA 3BZDB 1PLFA 4OO1G 1B4OA 4YWLA 4JI1Q 2P5ZX 5C44B 3KF6A 2VB3X 5ELOA 2MO1A 3HOZB 3KUPA 3T53B 2UXBQ 4CBVA 1Q1BA 1I4HA 2PMZE 4DFAA 1YEZA 1SRUA 1PMRA 1PRTF 3H91A 4B3TQ 3NTIA 4DV6L 3ITPA 4A93H 1PXUA 4YHHL 2CW0D 4C56C 2IWHA 3OTOQ 1XMOL 4R4CA 4RGTA 2UXDQ 5LL6X 2QDLA 1Y8PB 2H4OA 1B2TA 1BCPC 5FK9C 2HUGA 4O1NA 4HIMA 1NJIC 4ZCKA 3GD7A 1JJGA 1TKWB 3DUZA 4K5XA 5FJ8H 3M9BA 1V43A 1G91A 4R8NA 4A3BH 4K6LA 4DR5L 1I6HH 4A3JB 5IGEA 2M9VA 2B63B 2Z6KA 1H9SB 1KDAA 4GNXC 1EZ6A 3N52A 5NUCA 2NVXH 2PYKA 3Q22A 3F2BA 4C1NK 2NVTH 1TY0A 1B8AA 1ENFA 3OWFA 4PV1C 1Y69U 1EIGA 1EIYB 4MZ9A 2X6GA 2KBNA 4YCVA 3I4OA 1PRTD 4J8QA 1LTAD 2E2JH 1ML0D 1F2LA 2SNMA 2VB2X 4OIJA 2ZXRA 5KNCA 1HNWQ 5C6AA 1TWAB 5FO9B 2JA5B 3A0JA 4KKTA 1HR0L 5D3IB 1E22A 1S5DD 4AYBG 1DJRD 2K5DA 3LWUA 1I4RA 3KJOA 1AE3A 3BVMA 2A73B 4MNOA 4LF4L 1SDFA 3K5NA 2ZM6Q 2VNUD 1FJGQ 4R1JA 2CH4W 2B2VC 1JMCA 2F4VL 4YCUA 4JI8L 1LTRD 3I91A 5C3WA 2ENBA 3G6EA 2RBMA 4KHZA 3T1YQ 3PIP3 4DAYB 3PQIA 1FYCA 3TP6A 4CJ1B 4YIJA 4B9XA 1JCKB 1VQAA 3RNUA 4MHEA 2Z6BA 4OIKA 3CF5A 1Y1WB 4IUNA 3DM1A 4C3HH 1ENCA 3KDFA 2XN9C 3WDNA 3PCOB 5IYDH 2DUDA 1VQBA 1SE8A 4LNQA 4LF9L 5DLQE 5FOBB 1CKNB 1DCZA 5EPKA 4XDXA 3CCQA 3GTMB 3E0EA 2F0VA 3OW7A 1A3TA 2H1EA 1K0RA 2Z1CA 4X62Q 2R92G 2AQ2B 3VDYA 4Q0FA 4H13C 3L2PA 4IFDI 2NZHA 3H0GB 4A3JH 4IPGA 4DUZQ 4FF4A 5IWAL 4NDXA 1STEA 4DV0L 2B63H 2F0JA 3K81C 2OXPA 3DWQA 1CM9A 4RKLA 1SNPA 1C9OA 2K6AA 3MFGA 3HRZC 1IKMA 4X66L 1PZJD 3J80i 3OSOA 3AYHB 1YHBA 4L5SA 4CJ2C 2Q2IA 5EAYA 4L5QA 5M3MH 5IP9H 2MGSA 5CBAE 3CD6A 1B50A 1CZWA 5I9PA 4XQJA 4QIWB 4L6TB 3ER0A 3G71A 2F0GA 4JV5Q 5M5YB 1TWAH 4A3FB 1EEID 2IL8A 5A2QL 3I90A 1PTOD 2EJGC 1K28A 1O78A 5IY0A 1SE3A 2F0HA 4G57A 4YY3Q 2FINB 4BA1I 2WV6D 2F0KA 1I3QH 1ESRA 1I4PA 4BBRG 1S40A 3P20A 1N36Q 1LTTD 5AJ3L 4K2KA 2E74C 4X64Q 3E5SA 1IXRA 2LS01 4GLAC 3BDCA 1GD7A 3J81E 3EN2A 1Y14B 1WTOA 1CA5A 4A3DB 2KCMA 2SOBA 3KLSA 3S1RH 4HAEA 5HY6A 1H9RA 4B08A 1HFNA 2K33A 3OHXC 1KQSA 1JOQA 3S17B 2Y0SB 2R93B 4DU9A 3HOVG 1CT1D 3PF5A 4JI8Q 1HNXQ 2ES2A 4LJZC 4FO2A 2VZAA 4POGA 1TWHH 4JOIC 1HQRD 1Y1WH 1TWGB 2JA9A 2K7VA 2LXKA 2PZWA 4XTCS 5C3XA 2YTXA 4FNFA 4WJ4A 3RN5A 1ZKOA 2AQ3B 5C3EB 2WB1E 3UE0A 4RGMA 3QOJA 1C8CA 2K01A 3NBIA 2MP1A 3NQTA 2RDFA 1B3QA 4N9TA 5CV9A 2Q2HA 5K36G 2QEJC 4P74A 2EYHA 1K8MA 3SDZA 1QB5D 2N49A 3Q8DA 1RHPA 5FLXc 4FYDA 1L1OA 1OXVA 3J81j 3MXUA 3T4AC 4DV7L 3R3OA 4A3MG 1PRTB 3W3AA 1BBUA 5H1SE 3HOXH 3L3OC 3PSIA 3JAML 3FKIG 1V1OA 1EUJA 1L0XB 1F9SA 4DV0Q 3CHBD 1YNNC 4L5RC 1EZ8A 1MIUA 2K14A 4KHPL 1UNSA 2NTSA 1HZBA 2FHTA 2KQ3A 4TQUS 2B2TA 2F3IA 1QJOA 3PUZA 4HJAA 2PI2A 1WD1A 1PH3A 2E5LQ 3GDEA 1O80A 3W1GA 1JICA 3TQYA 3TS0A 3I4MG 4A3GB 3L9AX 1WTHA 2F0FA 3SR1A 5M5YH 3MXNA 4A3FH 2PO4A 5C4XG 4UHVA 3J7A5 4KD4A 2CHBD 2WAQG 2K03A 1YI2A 3NP8A 1N34L 1VF7A 3S1NB 2NYZD 1MBYA 5IYBG 4DR7Q 2VY3A 4CDFC 2C9OA 3P1HA 4FF2A 2EZVA 4HTHA 2E2IH 1X3EA 1HUNA 1WCMB 2Z0SA 2ZT9C 3D4RA 4DNRB 1GJXA 1BVSA 2EYPA 4XXEA 3MEHA 2A68C 3C1FA 1VCIA 1N9WA 3I72A 2LFNA 3LX0A 5EPLA 3KDFB 4DAMA 2JA6G 3OMGA 4GZYC 2HDLA 2L15A 1I94L 4QIWE 2R93H 3NHHA 4XYQA 2JA8B 2L11A 3RN2A 1EWHA 5FO8B 3Q23A 4FXGC 4ZUIA 5I9OA 5DM73 4ZK9B 3GP7A 1QUQA 3HKZB 2RKSA 2OQKA 4LAAA 4LW1A 4JI6L 1TWGH 1E0BA 3W1BA 5C3EH 1RODA 3U9OA 4JYAL 1J9OA 2B2YA 2F0PA 2JEAI 1B9MA 3R8BA 3VYSA 2NN6I 3KLWA 1T9HA 3FPUB 4DK3C 4GLVB 1AH9A 4P72A 3UDIA 2J4XA 3MVVA 4GN3B 1XNQL 2XNAC 2Y0SE 3CU7A 4DR1L 5CV6A 1WJJA 2MQHA 1LTBD 4EQOA 4A3KG 2WIIB 1GOZA 1VQJA 4DK0A 4DA2A 1I6VC 3OPOA 5L37A 4I65A 4OO1I 1LT6D 3HGBA 1O7YA 3HZXA 2I0QA 4FF3A 5IYBH 4BY1B 3JC66 3QR8A 3IAYA 1IBLL 5FKAC 4DUYL 4LWCA 2PW5A 1PFSA 3HOYB 4XT1B 1TWCB 1SYEA 1FNVA 4GLXA 1Y1VG 2F0TA 1YIJA 3C2PA 2KA7A 1BO0A 2A6EC 1S72A 5IYCH 5E3FA 1SSOA 4PMCA 5ELCA 1KAAA 2LMCB 3D4WA 4K5VA 3RZOB 3A8IE 4X3UA 2WP8J 4IUUA 1NR4A 5I6WA 3PUVA 1IYJB 1D7QA 1SAPA 5JJZA 4GKJQ 3I56A 3X3MA 2Z9HA 2O5IC 3KFUA 2E2HB 5GROA 1NTGA 1KLUD 1YNJD 4GOPC 3HP3A 2F0MA 1QILA 5FLMG 4F8MA 1MJEA 1CSPA 1D1IA 4HMIA 1IL8A 1TWFH 1WTRA 1YHAA 3GTGB 3I4NB 1WCMH 1GUSA 1L0WA 4ID6A 5J39A 3J80E 4IFDH 2FMMA 3AFPA 5JOBA 2CWPA 3CCRA 4R8IA 3NPPA 5HURA 3ICEA 2XRQD 5COYA 5CORA 1H9SA 2UUBL 1STBA 2Q8IB 1S5FD 4P75A 2R7ZG 4O0AA 3DWPA 5JJKA 1W6JA 2CQOA 4DV4Q 4LFCL 3D6WA 4JBKA 1HH2P 5CV7A 2TMPA 5EQ0A 2B8GA 1I94Q 2B8FA 2L12A 2NTTA 1JWMD 5M9OA 1E7ZA 5E4XA 5IIFA 2I07B 4A3IB 1LT4D 1PFBA 3NTHA 4B3RL 3S2DH 1XPRA 1I50B 1SNCA 2PCFB 1G6PA 1VQ8A 2G9HD 3S14H 2GVBA 4RA8A 2UU9L 3CCEA 3PO3B 1Y8OB 2I5MX 3U4ZA 3CCVA 4KJNA 1Q7YC 4DV5L 4A3EH 4JK1C 4DV1L 1CHQD 3C1EA 1KD1C 4GN5A 1SNQA 5I2YA 3URYA 1KNEA 1XX8A 3DHQA 4P2CB 4C3JG 2UXCQ 2JA7G 1F77A 4RMFA 3K59A 1VQMA 1X6OA 4B3MQ 5G3LF 1A2TA 1GUWA 4A93B 1HPCA 2PNRC 4BBSG 3GTPH 4DAYA 1KABA 1U0LA 2IX3A 1XWEA 1N32Q 4FP5D 4A3LH 1AP0A 2UUCL 2G5DA 2F4IA 1XYIA 1EU4A 4U673 2CW0C 3A8KE 1NNXA 3RZOH 4XQQA 1K73C 5C4JB 1SMXA 4BXXH 1D5ZC 4MN3A 3KBGA 1XNRL 1CKNA 2AKWB 3J7YW 5LMNW 1EQQA 2F0EA 1J6QA 1TU2B 2RQXA 3CCUA 1V1PB 1EY8A 4KI0A 5EKKA 3BYYB 5C0XI 3PO2B 2KJXA 4KN4C 4JI7L 3UI2A 1PH5A 3GTGH 3I4NH 2AUJD 4E6IA 5ISRA 1N33Q 5KNBA 5JEAH 2VUMH 1LABA 1T5EA 1XTDA 3RUZA 1XMQQ 2E2JB 2K52A 1SNOA 3VR3A 1RD9D 1HTPA 3BDLA 3SVMA 3C3LA 2DJFC 2XIWA 2IHFA 2XGTA 2NN6G 1G291 2F3VA 3SK8A 2F03A 1Q86C 2KCNA 4DXGA 4QCLA 1PRTC 4X3TA 1UE5A 4X65Q 3RR5A 1IKLA 2EYLA 3RZDB 3BS1A 3A56A 1EQVA 3KOJA 1LYLA 5GAGC 5CV5A 1M90C 2L4NA 4DK1A 2A69D 5HGQA 1BDOA 4JPBW 2RCFA 1HZ9A 1JORA 5IT9L 2N3SA 3ND9A 4NP5A 4DV5Q 3K0YA 3JAMc 1K3RA 1I4QA 3S9WA 1LTLA 1VQ6A 4DK6C 4KY7A 4UP9A 4C3HB 4A3CG 1JB3A 2EDGA 4HIOA 1Z6HA 1PZKD 3D3RA 5FLXE 4MTNA 3WOFA 1E2ZA 5EGTA 2A19A 4DKAC 4WJ3M 4N9PA 3D4DA 4JG2A 3S1QB 1AE2A 1EYGA 3SXHA 2SNSA 1CZGA 1PH6A 3CC2A 2C5CA 4DV2L 5C4JH 3GTOH 2MJ8A 2IX1A 3NK9A 1YJNA 3T1HQ 4DNTB 2OT2A 3O13A 1O7IA 2PI2E 2N8NA 4X3SA 5EJWA 1EEFD 4P71A 5C44G 3I70A 4V0BA 3HOZG 3ZYYX 3PO2H 3KJPA 4XIGS 1NBWA 2K04A 4C1NI 3FP9A 2MO0A 4RWSC 1IZ6A 5M3MB 1V8QA 2EYJA 5C4HA 1L0YB 2F52A 1NMGA 3UDGA 4LF7Q 1HCZA 1F9RA 4OO1H 3U50C 3J80c 1VQHA 5M5XB 5IGBA 1NR2A 1MD2D 1HNZL 1CSQA 1JJ2A 3CKIB 2HT1A 3AQQA 3K80C 3PIOA 4JI0L 1I3QB 1DD2A 1EYAA 2EYFA 1MJCA 1R4QB 5JEAJ 3RZDH 1QWYA 1EL0A 1TS5A 1BCPF 1X3FA 2HHHQ 3JAMi 1WTQA 4V190 1UE6A 3BJUA 5TSSA 1PTOC 2NZOA 3S1RB 2VQFL 2HCIA 3KBXA 2UUAL 2G9DA 4IJHA 3V05A 4R4OA 2B3GA 5KEEA 5GQOA 1B53A 1VQ4A 3OIQA 1LM0A 3R2TA 2R92B 5D65A 5IP7G 4HJ9A 3VA7A 3NWSA 3MAQA 1HFGA 1TWHB 2L1BA 2E76C 4KY6A 3NBHA 3F2CA 1F2MA 3S2HH 4HSVA 2YU9H 1Q81C 2FFKB 3HFZB 4QQBX 2BDOA 3D6CA 2JA5G 2PPBC 1PH1A 2BCOA 4DV6Q 3U4VA 1E1TA 4YHHQ 4ILWA 1XMOQ 1PH9A 1IBML 5C5LA 3S1QH 3BU2A 1PHJA 1B7YB 3KLSX 3H15A 4HJ8A 4OWWB 2OTJA 1JT8A 5C0XG 2WB1G 1SMYD 3E9IA 1LACA 5F2DA 1NUCA 1EWCA 3HOXB 3GO5A 2A5HA 1HQMC 2R61A 1RTOA 2F0NA
chains in the Genus database with same CATH topology
5M5YH 4JBMA 4ALPA 1QZGA 4NPSA 3J81c 1KAWA 4DR5Q 4A3FH 1L2FA 2Q2TA 4POFA 4JI4Q 1P8LA 1WFQA 5C4XG 4X65L 2JA8H 3J7A5 1SN8A 2EXDA 4LF5L 2WAQG 1HJPA 1HZAA 3PUXA 2AMCB 1KC8C 4KHPL 1YI2A 1N34L 2CCZA 4EX5A 4C3IH 5IYBG 4DR7Q 2VY3A 2K4KA 1L1OC 3CMAA 4IOAA 3CC7A 4HJ5A 4LUOA 2CFMA 1X3EA 2E2IH 3ZJYC 1L1OB 2PQAA 2IHEA 1E3PA 2Z0SA 3A5ZB 1VQNA 2BH2A 1NY4A 2E8GA 2YV5A 3I4NG 2VL6A 4QGUA 1BVSA 1VQ9A 2UUCQ 5JEAG 2VUMG 1X54A 1A63A 4TVAB 1SROA 2OQ0A 2K75A 1VCIA 1N9WA 1OXSC 1PYBA 4IPCA 3KDFB 4DAMA 2JA6G 4PG3A 1H95A 3EBEA 2L15A 5M5XH 4QIWE 3CCJA 1I94L 2UXBL 4ME3A 3KYHC 1PVOA 2R93H 3RN2A 4X62L 1UE7A 1YZ6A 2DGYA 1XNRQ 3CAMA 2OTLA 2KHJA 4UPAA 5GAHC 4DR3Q 1HR0Q 4LFBQ 4DR6Q 1QUQA 4GS3A 2OQKA 2GVAA 4LW1A 1JJCB 4DUZL 4JI6L 1QZHA 3S16H 1TWGH 1XPOA 3CCSA 2V1CC 4QY7A 3W1BA 3U58A 2BA0A 2OWOA 2I5HA 3G48A 5J3BA 5C3EH 1YJ9A 3M4OH 5BR8Q 3B6YA 2HIVA 1WI5A 4JYAL 3H0GG 4JI7Q 4LF4Q 2JEAI 4LF6Q 1XJVA 3GTJH 2CWAA 1K9MC 1OXXK 3RLFA 1EWIA 2NN6I 3KLWA 1T9HA 4BY1H 1SLJA 4GKKL 4DK3C 4GLVB 1AH9A 2KHIA 3MXNB 5IYDG 2VQFQ 4GOPA 1M1KC 4DV3Q 2EQSA 2RCNA 4P72A 2VQEQ 3HOYH 2F4VQ 1TWCH 2YTVA 3UDIA 2ALYB 4GN3B 3RLNA 2ZJPA 1XNQL 2Y0SE 2R92H 4AQYL 1YITA 4IPHA 3W5OA 4NXNQ 1Q46A 4DR1L 1X56A 1WJJA 2MQHA 2R6GA 2MNAA 4B3SQ 3TS2A 4A3CH 4JV5L 3PUYA 4K0KL 5IE8A 4PZ7A 4YWMA 3T1HL 4A3KG 1C0AA 1VQJA 3GTQH 2LSSA 4DR2L 1KXLA 4RG1A 2KENA 4A3JG 2N78A 2NVQH 4OO1I 1X3GA 4YY3L 2E2HH 2B63G 5M5WH 3I7FA 4LFAL 1N36L 2I0QA 5IYBH 3JC66 4NXML 1IBLL 4UY8C 4DUYL 4LWCA 4X64L 1PFSA 4PZ8A 5LMUL 3G4SA 1VQIA 2K5VA 3J81i 1K8GA 1FL0A 4GLXA 3D31A 1IBKQ 1Y1VG 1YIJA 4BY7H 4LF9Q 3CCLA 1EOVA 3K8AA 1S72A 4KLKA 3PGZA 3WWVA 1QUQB 1CKMA 5IYCH 1PH2A 1IBMQ 4A75A 1MKHA 4LF7L 4UP7A 1YBYA 1YNXA 3RLOA 5M3MG 3CC4A 4JI2L 2WP8J 4A3DG 5IP9G 4OONA 2D62A 2RHQB 3PUVA 2YYZA 1IYJB 3TEHB 2ZJQA 1J5EL 3F1ZA 4R4QA 4HIDA 1HNXL 1D7QA 5M3FH 4GKJQ 3I56A 3KFUA 5C44H 5GROA 4JI5Q 1NTGA 4OX9L 1E24A 5IWAQ 4P73A 3CPWA 4GOPC 3HOZH 4DR4L 2Y0SG 1G51A 3GTKH 4BBRH 4GOPB 5FLMG 2HHHL 1MJEA 1CSPA 2JEBI 4AIMA 3PF4A 4Y7NH 4A3IH 1TWFH 3PO2G 2RHSB 4OWXB 4X66Q 2B29A 1YHAA 2HIXA 2VW9A 1WCMH 1B70B 1L0WA 1N8RC 1SFOH 3OYYA 3AFPA 4JC0A 2A8VA 2CWPA 1I50H 4NB3A 3CCRA 2RF4A 3S24A 4AH6A 1Z9FA 2R7DA 3ULLA 3ICEA 2UUBL 3PO3H 1A62A 5LMNL 1CUKA 3EIVA 3T1YL 4DV2Q 4GNXA 3HOVH 4P75A 4OO1G 4YWLA 4JI1Q 2R7ZG 2CKZB 4O0AA 5JJKA 4O2DA 2CQOA 3KF6A 4DV4Q 5ELOA 2MO1A 4BXXG 4LFCL 4JBKA 1HH2P 3GTLH 4DNIA 1Y1WH 3NELA 1QVGA 1I94Q 2UXBQ 4IJLA 1Q1BA 1E7ZA 4JBJA 3LGJA 2PMZE 2ZTDA 5JJIA 1YEZA 2JE6I 4B3RL 1Y1WG 3S2DH 1SRUA 4GN4B 1XPRA 4B3TQ 1G6PA 1A8VA 5AJ3Q 3NBHB 1VQ8A 4DV6L 5IT9c 3S14H 3M3YH 2GVBA 4YHHL 3OTOQ 1XMOL 2UU9L 4A93H 3CCEA 4R4CA 2UXDQ 2I5MX 3U4ZA 3CCVA 3M4PA 1W3SA 4J15A 1Q7YC 4DV5L 3BZCA 4A3EH 3DLLA 1V9PA 1FGUA 4APVA 1KHIA 3SGIA 4DV1L 4HIMA 3UDXA 4AYBE 5IP7H 2QGQA 1NJIC 3GD7A 4GN5A 1KD1C 4DPGA 4A3MH 2E5LL 4BA2I 1CKOA 2QA4A 1JJGA 4JBWA 5FJ8H 3M9BA 1V43A 3CMEA 1HNZQ 3HOWG 4A3BH 1U5KA 4AQYQ 4DR5L 4JI4L 2UXCQ 2YTYA 2JA7G 1I6HH 3FKIH 4JI0Q 2Q2UA 3PUWA 2R7FA 3HOXG 1X55A 3CP0A 2ZTCA 4RMFA 2VS1A 1VQMA 4A3GG 1X6OA 4LUZA 4B3MQ 2ZJRA 2JA5H 2Z6KA 4OXPA 4DR7L 4DR2Q 4BBSG 4GNXC 3KF8B 2ID0A 3GTPH 1U0LA 2NVXH 2UUAQ 3F2BA 1N32Q 3HOUG 2NVTH 3KF6B 1VQ5A 1B8AA 4A3LH 2JJQA 4JI3L 4X6AH 1X65A 2D0PA 3NENA 2UUCL 1EIYB 3K0XA 4MZ9A 2KBNA 4YCVA 3RZOH 1YJWA 3I4OA 3I4MH 1K73C 2PQAB 2IT1A 1SMXA 2E2JH 4DV7Q 1VQEA 2A1AA 4BXXH 3TRZA 2ASBA 4YCWA 1XNRL 5C4XH 1HNWQ 4JI2Q 1CKNA 1Q12A 4DR3L 2AKWB 3A0JA 4UP8A 1HR0L 1EQRA 3S15H 1E22A 4JCVE 5LMNW 4AYBG 1EQQA 4A3FG 1J6QA 1XPUA 4GKKQ 3CCUA 2JA8G 4KI0A 3KJOA 5C0XI 1AE3A 2HQLA 1P16A 1IL2A 4MNOA 4JI7L 4LF4L 2K5HA 4LF6L 1PH5A 4LUVA 3GTGH 3I4NH 3S1MH 1N33Q 4KHPQ 2ZM6Q 2JK8A 3K7AH 2AWOA 2VUMH 2VNUD 1XTDA 2AHOB 1FJGQ 1OTCA 4R1JA 1XMQQ 4DV3L 1JMCA 2JA6H 2K50A 2VQEL 2F4VL 2K52A 1Q1EA 4YCUA 4JI8L 3H3VH 2WFWA 4Y52H 1K83H 3G6EA 2IHFA 2XGTA 3M4QA 4NXNL 2NN6G 4C2MH 1G291 4KHZA 3T1YQ 3GTMH 3M7NA 1Q86C 4B3SL 4DAYB 2R93G 2ATWA 1GKHA 1UE5A 4X65Q 1KRTA 1VQAA 3RNUA 3CF5A 4LF5Q 3OW2A 3RR5A 1W2BA 1N34Q 1HZCA 4C3HH 3H0GH 3KOJA 1LYLA 5GAGC 2H5XA 3KDFA 1GO3E 5C3EG 1UE1A 1PH8A 1M90C 1DGSA 1PYSB 3PCOB 3MEFA 4IPDA 5IYDH 1OXUA 5HGQA 1PH7A 2DUDA 1VQBA 3ERSX 3J7ZC 1SE8A 4LNQA 4LF9L 5DLQE 2IX0A 3AEVA 1CKNB 5ELNA 4FDBA 4BY1G 1C7YA 1Q82C 1HZ9A 3CCQA 4IOCA 3UE1A 3E0EA 2N3SA 3HOYG 5GAEC 4DV5Q 2OCEA 1JE5A 3K7UC 4R4TA 3JAMc 2QEXA 1K3RA 3ULPA 1K0RA 1LTLA 4X62Q 4DK6C 1VQ6A 2R92G 4A3KH 4QL5A 3VDYA 3DM3A 3L2PA 4IFDI 2K5NA 2NZHA 4UP9A 4GKJL 4A3CG 2C35B 4A3JH 4DR4Q 4IPGA 4DUZQ 4JI6Q 3I2ZA 2FXQA 4HIOA 5IWAL 2B63H 4DV0L 1SR3A 3K81C 4MTNA 4JYAQ 1C9OA 2A19A 2PNHA 4DKAC 1X9NA 1ASZA 4WJ3M 4X66L 1HR0W 1WYDA 1E1OA 1Y1VH 4OWTB 3J80i 4JG2A 3I55A 1I5FA 3STBD 3AYHB 1YHBA 4L5SA 1VQOA 1AE2A 2Q2IA 4JOIA 2JQOA 4L5QA 5EAYA 1EYGA 1GVPA 4A76A 4BY7G 5M3MH 1GM5A 5JJLA 1PH6A 3CC2A 4A3DH 5IP9H 4JI3Q 2NVYH 1XNQQ 3L7ZC 1VQCA 5IYCG 5C4JH 3HKZE 4DV2L 1YVCA 1VQKA 3CD6A 4JI1L 3GTOH 1KRSA 4DR1Q 2IX1A 4DV4L 3ER0A 3G71A 4LF8Q 4JV5Q 2IY5B 3IRBA 4K0KQ 1YJNA 1TWAH 3T1HQ 3S17H 1BBWA 1ASYA 5M3FG 1O7IA 2XTIA 2PI2E 2N8NA 5FLMH 4P71A 5IY0A 4QJFA 5C44G 1OXTA 1V1QA 4YY3Q 5C0XJ 3BZKA 3ULJA 1WOCA 4GNXB 4HIKA 4BA1I 3HOZG 3KJPA 3PO2H 4XIGS 1I3QH 1S40A 1NBWA 4LFAQ 4BBRG 1N36Q 1EIFA 4NXMQ 3FP9A 4PZ6A 3A5UA 1JB7A 1IBLQ 4B3TL 3CW2C 5AJ3L 2MO0A 4DUYQ 4X64Q 5LMUQ 2ZTEA 2EIFA 4PMWA 4A3IG 1R9TH 1IZ6A 4LF8L 3OTOL 4L5TA 1IXRA 4GLAC 2UXDL 1GD7A 2KCTA 1WCMG 1Y14B 3EN2A 3PIPA 2KCMA 4IFDG 3D0FA 3S1RH 2F52A 1NMGA 3A74A 5HY6A 3UDGA 4LF7Q 1BKBA 1RIPA 5E7NA 3FHWA 3STBC 3U50C 1KQSA 2R7ZH 3J80c 1VQHA 3F2DA 3PV0A 3PO3G 4LFBL 4DR6L 1VQGA 1UWVA 3HOVG 1J5EQ 1HNZL 3PF5A 4JI8Q 2D0OA 1HNXQ 1CSQA 3NEMA 3TREA 1YHQA 1JJ2A 3CXCA 2HT1A 2ES2A 3AQQA 4OX9Q 2UXCL 3K80C 5BR8L 3PIOA 2VZAA 4JI0L 4POGA 1TWHH 2LXJA 1UEBA 2MFIA 4JOIC 3AFQA 2JA9A 1MJCA 3F8TA 2LXKA 3HKZG 4XTCS 5JEAJ 2YTXA 3RZDH 4WJ4A 1PH4A 4B3ML 3RN5A 1X3FA 2HHHQ 1A0IA 2WB1E 3JAMi 3UE0A 1UE6A 3BJUA 1D8LA 1S3OA 2NZOA 2VQFL 2UUAL 2I5LX 4IJHA 4R4OA 1VS0A 4IO9A 2B3GA 1VQLA 1N32L 1EFWA 5GQOA 2Z6KC 4A93G 2Q2HA 5K36G 4P74A 2AWNA 1VQ4A 2UUBQ 1NMFA 2N49A 3CQZH 1LM0A 3Q8DA 5LMNQ 4A3EG 4A4IA 5FLXc 3L0OA 1L1OA 4HJ7A 1OXVA 4YWKA 3UDFA 2WAQE 1PA6A 3HOWH 3J81j 4R4IA 5IP7G 4HJ9A 4DV7L 1TXYA 4C3JH 4A3MG 1PV4A 4LFCQ 2JA7H 4IFDJ 1BBUA 5FJ8G 3F2CA 5H1SE 1KL9A 1HNWL 3HOXH 3S2HH 4A3BG 3PSIA 4A3GH 1VQ7A 2YU9H 1Q81C 1KIXA 3M85A 3HKSA 2BA1A 2BH8A 3FKIG 4BBSH 3HFZB 4QQBX 4B3RQ 1EUJA 1VQPA 1Z47A 1K8AC 1RL2A 3H3VI 1QVCA 1IBKL 5GADC 2JA5G 4DV0Q 3HOUH 1PH1A 4DV6Q 4L5RC 3S1NH 3U4VA 1E1TA 1MIUA 4YHHQ 2K14A 2ZM6L 1XMOQ 1PH9A 1IBML 2UU9Q 1N33L 3S1QH 3BU2A 1HZBA 1PHJA 1B7YB 3E9HA 3H15A 4HJ8A 4OWWB 1FJGL 4H02A 2OTJA 1JT8A 5C0XG 2WB1G 4TQUS 1XMQL 1QVFA 4A3LG 3E9IA 2F3IA 3PUZA 4DV1Q 1FVIA 1NE3A 1VQFA 4HJAA 2PI2A 1PH3A 2E5LQ 3CCMA 3GO5A 2GN5A 3CPFA 3GDEA 3W1GA 1LUZA 3TQYA 1VQDA 4JI5L 3TS0A 3I4MG 4EQ5A 1Q8KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5M5Y H;  4JBM A;  4ALP A;  1QZG A;  4NPS A;  3J81 c;  1KAW A;  4DR5 Q;  4A3F H;  1L2F A;  2Q2T A;  4POF A;  4JI4 Q;  1P8L A;  1WFQ A;  5C4X G;  4X65 L;  2JA8 H;  3J7A 5;  1SN8 A;  2EXD A;  4LF5 L;  2WAQ G;  1HJP A;  1HZA A;  3PUX A;  2AMC B;  1KC8 C;  4KHP L;  1YI2 A;  1N34 L;  2CCZ A;  4EX5 A;  4C3I H;  5IYB G;  4DR7 Q;  2VY3 A;  2K4K A;  1L1O C;  3CMA A;  4IOA A;  3CC7 A;  4HJ5 A;  4LUO A;  2CFM A;  1X3E A;  2E2I H;  3ZJY C;  1L1O B;  2PQA A;  2IHE A;  1E3P A;  2Z0S A;  3A5Z B;  1VQN A;  2BH2 A;  1NY4 A;  2E8G A;  2YV5 A;  3I4N G;  2VL6 A;  4QGU A;  1BVS A;  1VQ9 A;  2UUC Q;  5JEA G;  2VUM G;  1X54 A;  1A63 A;  4TVA B;  1SRO A;  2OQ0 A;  2K75 A;  1VCI A;  1N9W A;  1OXS C;  1PYB A;  4IPC A;  3KDF B;  4DAM A;  2JA6 G;  4PG3 A;  1H95 A;  3EBE A;  2L15 A;  5M5X H;  4QIW E;  3CCJ A;  1I94 L;  2UXB L;  4ME3 A;  3KYH C;  1PVO A;  2R93 H;  3RN2 A;  4X62 L;  1UE7 A;  1YZ6 A;  2DGY A;  1XNR Q;  3CAM A;  2OTL A;  2KHJ A;  4UPA A;  5GAH C;  4DR3 Q;  1HR0 Q;  4LFB Q;  4DR6 Q;  1QUQ A;  4GS3 A;  2OQK A;  2GVA A;  4LW1 A;  1JJC B;  4DUZ L;  4JI6 L;  1QZH A;  3S16 H;  1TWG H;  1XPO A;  3CCS A;  2V1C C;  4QY7 A;  3W1B A;  3U58 A;  2BA0 A;  2OWO A;  2I5H A;  3G48 A;  5J3B A;  5C3E H;  1YJ9 A;  3M4O H;  5BR8 Q;  3B6Y A;  2HIV A;  1WI5 A;  4JYA L;  3H0G G;  4JI7 Q;  4LF4 Q;  2JEA I;  4LF6 Q;  1XJV A;  3GTJ H;  2CWA A;  1K9M C;  1OXX K;  3RLF A;  1EWI A;  2NN6 I;  3KLW A;  1T9H A;  4BY1 H;  1SLJ A;  4GKK L;  4DK3 C;  4GLV B;  1AH9 A;  2KHI A;  3MXN B;  5IYD G;  2VQF Q;  4GOP A;  1M1K C;  4DV3 Q;  2EQS A;  2RCN A;  4P72 A;  2VQE Q;  3HOY H;  2F4V Q;  1TWC H;  2YTV A;  3UDI A;  2ALY B;  4GN3 B;  3RLN A;  2ZJP A;  1XNQ L;  2Y0S E;  2R92 H;  4AQY L;  1YIT A;  4IPH A;  3W5O A;  4NXN Q;  1Q46 A;  4DR1 L;  1X56 A;  1WJJ A;  2MQH A;  2R6G A;  2MNA A;  4B3S Q;  3TS2 A;  4A3C H;  4JV5 L;  3PUY A;  4K0K L;  5IE8 A;  4PZ7 A;  4YWM A;  3T1H L;  4A3K G;  1C0A A;  1VQJ A;  3GTQ H;  2LSS A;  4DR2 L;  1KXL A;  4RG1 A;  2KEN A;  4A3J G;  2N78 A;  2NVQ H;  4OO1 I;  1X3G A;  4YY3 L;  2E2H H;  2B63 G;  5M5W H;  3I7F A;  4LFA L;  1N36 L;  2I0Q A;  5IYB H;  3JC6 6;  4NXM L;  1IBL L;  4UY8 C;  4DUY L;  4LWC A;  4X64 L;  1PFS A;  4PZ8 A;  5LMU L;  3G4S A;  1VQI A;  2K5V A;  3J81 i;  1K8G A;  1FL0 A;  4GLX A;  3D31 A;  1IBK Q;  1Y1V G;  1YIJ A;  4BY7 H;  4LF9 Q;  3CCL A;  1EOV A;  3K8A A;  1S72 A;  4KLK A;  3PGZ A;  3WWV A;  1QUQ B;  1CKM A;  5IYC H;  1PH2 A;  1IBM Q;  4A75 A;  1MKH A;  4LF7 L;  4UP7 A;  1YBY A;  1YNX A;  3RLO A;  5M3M G;  3CC4 A;  4JI2 L;  2WP8 J;  4A3D G;  5IP9 G;  4OON A;  2D62 A;  2RHQ B;  3PUV A;  2YYZ A;  1IYJ B;  3TEH B;  2ZJQ A;  1J5E L;  3F1Z A;  4R4Q A;  4HID A;  1HNX L;  1D7Q A;  5M3F H;  4GKJ Q;  3I56 A;  3KFU A;  5C44 H;  5GRO A;  4JI5 Q;  1NTG A;  4OX9 L;  1E24 A;  5IWA Q;  4P73 A;  3CPW A;  4GOP C;  3HOZ H;  4DR4 L;  2Y0S G;  1G51 A;  3GTK H;  4BBR H;  4GOP B;  5FLM G;  2HHH L;  1MJE A;  1CSP A;  2JEB I;  4AIM A;  3PF4 A;  4Y7N H;  4A3I H;  1TWF H;  3PO2 G;  2RHS B;  4OWX B;  4X66 Q;  2B29 A;  1YHA A;  2HIX A;  2VW9 A;  1WCM H;  1B70 B;  1L0W A;  1N8R C;  1SFO H;  3OYY A;  3AFP A;  4JC0 A;  2A8V A;  2CWP A;  1I50 H;  4NB3 A;  3CCR A;  2RF4 A;  3S24 A;  4AH6 A;  1Z9F A;  2R7D A;  3ULL A;  3ICE A;  2UUB L;  3PO3 H;  1A62 A;  5LMN L;  1CUK A;  3EIV A;  3T1Y L;  4DV2 Q;  4GNX A;  3HOV H;  4P75 A;  4OO1 G;  4YWL A;  4JI1 Q;  2R7Z G;  2CKZ B;  4O0A A;  5JJK A;  4O2D A;  2CQO A;  3KF6 A;  4DV4 Q;  5ELO A;  2MO1 A;  4BXX G;  4LFC L;  4JBK A;  1HH2 P;  3GTL H;  4DNI A;  1Y1W H;  3NEL A;  1QVG A;  1I94 Q;  2UXB Q;  4IJL A;  1Q1B A;  1E7Z A;  4JBJ A;  3LGJ A;  2PMZ E;  2ZTD A;  5JJI A;  1YEZ A;  2JE6 I;  4B3R L;  1Y1W G;  3S2D H;  1SRU A;  4GN4 B;  1XPR A;  4B3T Q;  1G6P A;  1A8V A;  5AJ3 Q;  3NBH B;  1VQ8 A;  4DV6 L;  5IT9 c;  3S14 H;  3M3Y H;  2GVB A;  4YHH L;  3OTO Q;  1XMO L;  2UU9 L;  4A93 H;  3CCE A;  4R4C A;  2UXD Q;  2I5M X;  3U4Z A;  3CCV A;  3M4P A;  1W3S A;  4J15 A;  1Q7Y C;  4DV5 L;  3BZC A;  4A3E H;  3DLL A;  1V9P A;  1FGU A;  4APV A;  1KHI A;  3SGI A;  4DV1 L;  4HIM A;  3UDX A;  4AYB E;  5IP7 H;  2QGQ A;  1NJI C;  3GD7 A;  4GN5 A;  1KD1 C;  4DPG A;  4A3M H;  2E5L L;  4BA2 I;  1CKO A;  2QA4 A;  1JJG A;  4JBW A;  5FJ8 H;  3M9B A;  1V43 A;  3CME A;  1HNZ Q;  3HOW G;  4A3B H;  1U5K A;  4AQY Q;  4DR5 L;  4JI4 L;  2UXC Q;  2YTY A;  2JA7 G;  1I6H H;  3FKI H;  4JI0 Q;  2Q2U A;  3PUW A;  2R7F A;  3HOX G;  1X55 A;  3CP0 A;  2ZTC A;  4RMF A;  2VS1 A;  1VQM A;  4A3G G;  1X6O A;  4LUZ A;  4B3M Q;  2ZJR A;  2JA5 H;  2Z6K A;  4OXP A;  4DR7 L;  4DR2 Q;  4BBS G;  4GNX C;  3KF8 B;  2ID0 A;  3GTP H;  1U0L A;  2NVX H;  2UUA Q;  3F2B A;  1N32 Q;  3HOU G;  2NVT H;  3KF6 B;  1VQ5 A;  1B8A A;  4A3L H;  2JJQ A;  4JI3 L;  4X6A H;  1X65 A;  2D0P A;  3NEN A;  2UUC L;  1EIY B;  3K0X A;  4MZ9 A;  2KBN A;  4YCV A;  3RZO H;  1YJW A;  3I4O A;  3I4M H;  1K73 C;  2PQA B;  2IT1 A;  1SMX A;  2E2J H;  4DV7 Q;  1VQE A;  2A1A A;  4BXX H;  3TRZ A;  2ASB A;  4YCW A;  1XNR L;  5C4X H;  1HNW Q;  4JI2 Q;  1CKN A;  1Q12 A;  4DR3 L;  2AKW B;  3A0J A;  4UP8 A;  1HR0 L;  1EQR A;  3S15 H;  1E22 A;  4JCV E;  5LMN W;  4AYB G;  1EQQ A;  4A3F G;  1J6Q A;  1XPU A;  4GKK Q;  3CCU A;  2JA8 G;  4KI0 A;  3KJO A;  5C0X I;  1AE3 A;  2HQL A;  1P16 A;  1IL2 A;  4MNO A;  4JI7 L;  4LF4 L;  2K5H A;  4LF6 L;  1PH5 A;  4LUV A;  3GTG H;  3I4N H;  3S1M H;  1N33 Q;  4KHP Q;  2ZM6 Q;  2JK8 A;  3K7A H;  2AWO A;  2VUM H;  2VNU D;  1XTD A;  2AHO B;  1FJG Q;  1OTC A;  4R1J A;  1XMQ Q;  4DV3 L;  1JMC A;  2JA6 H;  2K50 A;  2VQE L;  2F4V L;  2K52 A;  1Q1E A;  4YCU A;  4JI8 L;  3H3V H;  2WFW A;  4Y52 H;  1K83 H;  3G6E A;  2IHF A;  2XGT A;  3M4Q A;  4NXN L;  2NN6 G;  4C2M H;  1G29 1;  4KHZ A;  3T1Y Q;  3GTM H;  3M7N A;  1Q86 C;  4B3S L;  4DAY B;  2R93 G;  2ATW A;  1GKH A;  1UE5 A;  4X65 Q;  1KRT A;  1VQA A;  3RNU A;  3CF5 A;  4LF5 Q;  3OW2 A;  3RR5 A;  1W2B A;  1N34 Q;  1HZC A;  4C3H H;  3H0G H;  3KOJ A;  1LYL A;  5GAG C;  2H5X A;  3KDF A;  1GO3 E;  5C3E G;  1UE1 A;  1PH8 A;  1M90 C;  1DGS A;  1PYS B;  3PCO B;  3MEF A;  4IPD A;  5IYD H;  1OXU A;  5HGQ A;  1PH7 A;  2DUD A;  1VQB A;  3ERS X;  3J7Z C;  1SE8 A;  4LNQ A;  4LF9 L;  5DLQ E;  2IX0 A;  3AEV A;  1CKN B;  5ELN A;  4FDB A;  4BY1 G;  1C7Y A;  1Q82 C;  1HZ9 A;  3CCQ A;  4IOC A;  3UE1 A;  3E0E A;  2N3S A;  3HOY G;  5GAE C;  4DV5 Q;  2OCE A;  1JE5 A;  3K7U C;  4R4T A;  3JAM c;  2QEX A;  1K3R A;  3ULP A;  1K0R A;  1LTL A;  4X62 Q;  4DK6 C;  1VQ6 A;  2R92 G;  4A3K H;  4QL5 A;  3VDY A;  3DM3 A;  3L2P A;  4IFD I;  2K5N A;  2NZH A;  4UP9 A;  4GKJ L;  4A3C G;  2C35 B;  4A3J H;  4DR4 Q;  4IPG A;  4DUZ Q;  4JI6 Q;  3I2Z A;  2FXQ A;  4HIO A;  5IWA L;  2B63 H;  4DV0 L;  1SR3 A;  3K81 C;  4MTN A;  4JYA Q;  1C9O A;  2A19 A;  2PNH A;  4DKA C;  1X9N A;  1ASZ A;  4WJ3 M;  4X66 L;  1HR0 W;  1WYD A;  1E1O A;  1Y1V H;  4OWT B;  3J80 i;  4JG2 A;  3I55 A;  1I5F A;  3STB D;  3AYH B;  1YHB A;  4L5S A;  1VQO A;  1AE2 A;  2Q2I A;  4JOI A;  2JQO A;  4L5Q A;  5EAY A;  1EYG A;  1GVP A;  4A76 A;  4BY7 G;  5M3M H;  1GM5 A;  5JJL A;  1PH6 A;  3CC2 A;  4A3D H;  5IP9 H;  4JI3 Q;  2NVY H;  1XNQ Q;  3L7Z C;  1VQC A;  5IYC G;  5C4J H;  3HKZ E;  4DV2 L;  1YVC A;  1VQK A;  3CD6 A;  4JI1 L;  3GTO H;  1KRS A;  4DR1 Q;  2IX1 A;  4DV4 L;  3ER0 A;  3G71 A;  4LF8 Q;  4JV5 Q;  2IY5 B;  3IRB A;  4K0K Q;  1YJN A;  1TWA H;  3T1H Q;  3S17 H;  1BBW A;  1ASY A;  5M3F G;  1O7I A;  2XTI A;  2PI2 E;  2N8N A;  5FLM H;  4P71 A;  5IY0 A;  4QJF A;  5C44 G;  1OXT A;  1V1Q A;  4YY3 Q;  5C0X J;  3BZK A;  3ULJ A;  1WOC A;  4GNX B;  4HIK A;  4BA1 I;  3HOZ G;  3KJP A;  3PO2 H;  4XIG S;  1I3Q H;  1S40 A;  1NBW A;  4LFA Q;  4BBR G;  1N36 Q;  1EIF A;  4NXM Q;  3FP9 A;  4PZ6 A;  3A5U A;  1JB7 A;  1IBL Q;  4B3T L;  3CW2 C;  5AJ3 L;  2MO0 A;  4DUY Q;  4X64 Q;  5LMU Q;  2ZTE A;  2EIF A;  4PMW A;  4A3I G;  1R9T H;  1IZ6 A;  4LF8 L;  3OTO L;  4L5T A;  1IXR A;  4GLA C;  2UXD L;  1GD7 A;  2KCT A;  1WCM G;  1Y14 B;  3EN2 A;  3PIP A;  2KCM A;  4IFD G;  3D0F A;  3S1R H;  2F52 A;  1NMG A;  3A74 A;  5HY6 A;  3UDG A;  4LF7 Q;  1BKB A;  1RIP A;  5E7N A;  3FHW A;  3STB C;  3U50 C;  1KQS A;  2R7Z H;  3J80 c;  1VQH A;  3F2D A;  3PV0 A;  3PO3 G;  4LFB L;  4DR6 L;  1VQG A;  1UWV A;  3HOV G;  1J5E Q;  1HNZ L;  3PF5 A;  4JI8 Q;  2D0O A;  1HNX Q;  1CSQ A;  3NEM A;  3TRE A;  1YHQ A;  1JJ2 A;  3CXC A;  2HT1 A;  2ES2 A;  3AQQ A;  4OX9 Q;  2UXC L;  3K80 C;  5BR8 L;  3PIO A;  2VZA A;  4JI0 L;  4POG A;  1TWH H;  2LXJ A;  1UEB A;  2MFI A;  4JOI C;  3AFQ A;  2JA9 A;  1MJC A;  3F8T A;  2LXK A;  3HKZ G;  4XTC S;  5JEA J;  2YTX A;  3RZD H;  4WJ4 A;  1PH4 A;  4B3M L;  3RN5 A;  1X3F A;  2HHH Q;  1A0I A;  2WB1 E;  3JAM i;  3UE0 A;  1UE6 A;  3BJU A;  1D8L A;  1S3O A;  2NZO A;  2VQF L;  2UUA L;  2I5L X;  4IJH A;  4R4O A;  1VS0 A;  4IO9 A;  2B3G A;  1VQL A;  1N32 L;  1EFW A;  5GQO A;  2Z6K C;  4A93 G;  2Q2H A;  5K36 G;  4P74 A;  2AWN A;  1VQ4 A;  2UUB Q;  1NMF A;  2N49 A;  3CQZ H;  1LM0 A;  3Q8D A;  5LMN Q;  4A3E G;  4A4I A;  5FLX c;  3L0O A;  1L1O A;  4HJ7 A;  1OXV A;  4YWK A;  3UDF A;  2WAQ E;  1PA6 A;  3HOW H;  3J81 j;  4R4I A;  5IP7 G;  4HJ9 A;  4DV7 L;  1TXY A;  4C3J H;  4A3M G;  1PV4 A;  4LFC Q;  2JA7 H;  4IFD J;  1BBU A;  5FJ8 G;  3F2C A;  5H1S E;  1KL9 A;  1HNW L;  3HOX H;  3S2H H;  4A3B G;  3PSI A;  4A3G H;  1VQ7 A;  2YU9 H;  1Q81 C;  1KIX A;  3M85 A;  3HKS A;  2BA1 A;  2BH8 A;  3FKI G;  4BBS H;  3HFZ B;  4QQB X;  4B3R Q;  1EUJ A;  1VQP A;  1Z47 A;  1K8A C;  1RL2 A;  3H3V I;  1QVC A;  1IBK L;  5GAD C;  2JA5 G;  4DV0 Q;  3HOU H;  1PH1 A;  4DV6 Q;  4L5R C;  3S1N H;  3U4V A;  1E1T A;  1MIU A;  4YHH Q;  2K14 A;  2ZM6 L;  1XMO Q;  1PH9 A;  1IBM L;  2UU9 Q;  1N33 L;  3S1Q H;  3BU2 A;  1HZB A;  1PHJ A;  1B7Y B;  3E9H A;  3H15 A;  4HJ8 A;  4OWW B;  1FJG L;  4H02 A;  2OTJ A;  1JT8 A;  5C0X G;  2WB1 G;  4TQU S;  1XMQ L;  1QVF A;  4A3L G;  3E9I A;  2F3I A;  3PUZ A;  4DV1 Q;  1FVI A;  1NE3 A;  1VQF A;  4HJA A;  2PI2 A;  1PH3 A;  2E5L Q;  3CCM A;  3GO5 A;  2GN5 A;  3CPF A;  3GDE A;  3W1G A;  1LUZ A;  3TQY A;  1VQD A;  4JI5 L;  3TS0 A;  3I4M G;  4EQ5 A;  1Q8K A; 
#chains in the Genus database with same CATH topology
 3EFX D;  1QG7 A;  1D1K A;  1QZG A;  4DR5 Q;  1L2F A;  2B2U A;  4POF A;  1P8L A;  4EGV A;  3QOL A;  2EXD A;  4LF5 L;  1SYC A;  2AMC B;  4BBR B;  3BG3 A;  1L1O C;  1X3P A;  2EY6 A;  4KY5 A;  3CMA A;  3CC7 A;  4IOA A;  1ENA A;  2CFM A;  2PQA A;  2DY8 A;  3A5Z B;  4CDE C;  1VQN A;  1R4P B;  4QGU A;  2EVB A;  1VQ9 A;  3MHB A;  1W6K A;  1A63 A;  1SRO A;  2K75 A;  1OXS C;  1JWS D;  3RD4 A;  4PG3 A;  1H95 A;  5M5X H;  3KYH C;  1PVO A;  1UE7 A;  1YZ6 A;  4CKE A;  5C5M A;  2LKV A;  4BWG B;  1HR0 Q;  2K5Q A;  4GS3 A;  2CH4 A;  3LWE A;  1B9N A;  5ELE A;  1B1Z A;  4HCS A;  1XPO A;  3CCS A;  2E2I B;  1PDQ A;  2B2T C;  2KED A;  3G48 A;  3GV6 A;  4QUF A;  3M4O H;  4J1M A;  1ICW A;  1WI5 A;  2NBF A;  3H0G G;  4LF4 Q;  2ICI A;  2MPM A;  1U4P A;  3M3Y B;  1GXD C;  4F7X A;  4GKK L;  1M8A A;  2VQF Q;  1U4R A;  3DMU A;  2F4V Q;  5C0X H;  1HRJ A;  1EFI D;  3T51 B;  1KLG D;  1G2T A;  2R92 H;  3RLN A;  4A3M B;  4ABN A;  3BYT B;  4IPH A;  4KK7 A;  1S5C D;  2R6G A;  3TS2 A;  3PUY A;  4K0K L;  2CVR A;  5IE8 A;  4QF4 A;  4YWM A;  3FVQ A;  1LTG D;  1C0A A;  1GHK A;  3FKI B;  2LSS A;  4DR2 L;  5FO7 B;  3MC0 B;  4RG1 A;  3VR6 A;  2KEN A;  4WFN 3;  1LLR D;  1C4Q A;  2N55 A;  4RCO A;  4LFA L;  4NXM L;  4LF8 L;  2MHV A;  5LMU L;  2K5V A;  1K8G A;  2N88 A;  5KIX A;  4LK1 C;  4LF9 Q;  3CCL A;  1EOV A;  2L9H A;  3K8A A;  3KK7 A;  3PGZ A;  3WWV A;  1IBM Q;  1A15 A;  3TP7 A;  1BXT A;  1HTL D;  1MKH A;  1WD0 A;  1AEX A;  4IN3 A;  1EQT A;  3CC4 A;  1EY0 A;  1SYD A;  3I4L A;  4A3D G;  2B2Y C;  3NQI A;  3FMC A;  2YYZ A;  3TEH B;  3VYU A;  1J5E L;  4ZLT F;  4R4Q A;  1EY6 A;  2WAQ B;  4OX9 L;  2XRS D;  1CA6 A;  5IWA Q;  3CPW A;  3AMU A;  4DR4 L;  2Y0S G;  3GTK H;  4BBR H;  1B3A A;  5EKI A;  4FXK C;  4EQP A;  4AIM A;  3IFT A;  4Y7N H;  4OWX B;  4X66 Q;  2EJM A;  4NW2 A;  4OHJ A;  5E1F A;  3OYY A;  1N8R C;  3VYT A;  1G6Z A;  2FJ2 A;  5DAU A;  1Z9F A;  2K05 A;  3PIO 3;  5LMN L;  1CUK A;  3EIV A;  2DY7 A;  1HA5 A;  4K8I A;  3HOV H;  2CKZ B;  4O2D A;  4C2M B;  1NAP A;  4HCE A;  1Q8I A;  1EYC A;  3LGJ A;  5C4Z A;  2JN4 A;  1TWF B;  2RA4 A;  4IAL A;  4KN7 C;  2JE6 I;  4GN4 B;  1YNJ C;  1F2Z A;  1A8V A;  5AJ3 Q;  3NBH B;  1EY5 A;  5IT9 c;  4EVO A;  1K0S A;  3TZD A;  3M3Y H;  1KDC A;  5JPM C;  5K36 H;  3HG9 A;  1V1P A;  5AFW A;  5ELF A;  3DLL A;  3OWE B;  1V9P A;  1FGU A;  4JVZ A;  4QMG A;  4APV A;  1KHI A;  1E2W A;  3SGI A;  3UDX A;  4CKC A;  4GKK Q;  4DPG A;  4A3M H;  1BCP B;  1CKO A;  2QA4 A;  1RCV D;  2F0U A;  3HEJ A;  3HOW G;  1Y8N B;  4A3K B;  4PNY A;  2Z8L A;  3CRL C;  4ZYS A;  4JI4 L;  1ZYR D;  2YTY A;  3FKI H;  3S2D B;  4OL7 A;  2R7F A;  1X55 A;  4ODG A;  2QKI C;  4A3G G;  2ZJR A;  3S14 B;  1NCV A;  4OXP A;  2EE1 A;  4G7O C;  4DR2 Q;  2PW7 A;  3JAM E;  1SYG A;  4B9W A;  2EYM A;  4A3E B;  1Y1V B;  4KD3 A;  3HOU G;  1D2B A;  4JI3 L;  3FRP B;  2Q8R E;  1X65 A;  2D0P A;  3NEN A;  1HA6 A;  2ICE C;  3HS0 C;  3K0X A;  2M2L A;  3I4M H;  2PQA B;  1PFN A;  2KCC A;  2IT1 A;  4DV7 Q;  3TP5 A;  4YCW A;  5C4X H;  1VMP A;  1Q12 A;  4K2L A;  4DR3 L;  4UP8 A;  1EQR A;  3S15 H;  4JCV E;  2HCC A;  3V2T A;  3RMH A;  3GTP B;  1XPU A;  2K32 A;  2JA8 G;  3NUC A;  1HHV A;  1P16 A;  4KTA A;  4FVM A;  3Q24 A;  2XWJ B;  4MIU A;  4C3I G;  4LF6 L;  5E4W C;  4KHP Q;  1R9T B;  2AWO A;  1H9K A;  2AHO B;  3A7L A;  1WTX A;  2QIL A;  3MXG A;  4DV3 L;  2JA6 H;  2K50 A;  2VQE L;  1LTS D;  1Q1E A;  4ZKB B;  3QB3 A;  4NXN L;  4C2M H;  4MTK A;  2DJG C;  1TS4 A;  4B3S L;  1GKH A;  3SK6 A;  5K5P A;  1H9J A;  1KRT A;  3ONA B;  3X3N A;  3VR2 A;  3DEP A;  3OW2 A;  1DOL A;  2NZ1 D;  1N34 Q;  1HZC A;  4HSP A;  3E0J A;  2VUM B;  1FD7 D;  2H5X A;  1GO3 E;  1UE1 A;  4OEM B;  1PYS B;  4IPD A;  3H3V C;  2K1B A;  1GHJ A;  1PH7 A;  4K6D A;  3J7Z C;  3TDQ A;  1ZEQ X;  2IX0 A;  3NE5 B;  3ERO A;  4BY1 G;  3CQZ B;  4IOC A;  3HOY G;  4IQZ A;  5GAE C;  4DAP A;  5EBD A;  2OCE A;  4WRD A;  1A2U A;  4OEL B;  4C3J B;  4A3K H;  2V4D A;  1O7Z A;  4QL5 A;  2JA7 B;  4U68 A;  1JQY D;  1SEB D;  1Z7T A;  2AUK A;  4JI6 Q;  2D9U A;  3I2Z A;  3GV3 A;  1SR3 A;  4BBS B;  4EQN A;  5CV8 A;  2EOT A;  4DF7 A;  2B2W A;  4JYA Q;  3I73 A;  4QB4 A;  1ASZ A;  1WYD A;  1Y1V H;  3STB D;  1VQO A;  1GVP A;  3OIP A;  4BY7 G;  1GM5 A;  2BDN A;  2A69 C;  4JI3 Q;  2NVY H;  1XNQ Q;  1MSG A;  1SYB A;  3HKZ E;  4JI1 L;  1KRS A;  4DR1 Q;  2RDH A;  1BBW A;  1ASY A;  5M3F G;  2XTI A;  3MTS A;  2EPB A;  4CJ0 B;  5FLM H;  4QJF A;  1V1Q A;  1WTP A;  4HIK A;  2L0C A;  4RH6 A;  2QW7 A;  3M4Y A;  1EOT A;  1EIF A;  4B3T L;  3QWN A;  1IBL Q;  4DUY Q;  2ZTE A;  4A3I G;  1R9T H;  2WAC A;  3OTO L;  3E3X A;  3DWA A;  2UXD L;  3PIP A;  3D0F A;  1BOS A;  3GTO B;  1PTO H;  2IPK D;  1BKB A;  2R7Z H;  5E7N A;  3FHW A;  1STH A;  3PO3 G;  4DR6 L;  1VQG A;  1UWV A;  1AZP A;  2F0O A;  3TRE A;  3VR5 A;  1YHQ A;  4F88 A;  3CXC A;  2LXJ A;  1UEB A;  3UE1 A;  3AFQ A;  3F8T A;  1AN8 A;  1ET9 A;  1PH4 A;  1EU3 A;  2EY1 A;  4RHS A;  4Z9C B;  2I5L X;  3Q6S A;  2JP1 A;  2QDB A;  5G3L D;  4IO9 A;  1VS0 A;  1VQL A;  2EYO A;  4G7H C;  4A93 G;  1CTM A;  2Z6K C;  1SJH D;  5J1Z A;  2HDM A;  2AWN A;  5IOD A;  3TN2 A;  2UUB Q;  3CQZ H;  3L0O A;  1PA6 A;  2IW3 A;  4UDU C;  1LTI D;  1TXY A;  4C3J H;  4LFC Q;  1PV4 A;  3FEW X;  2JA7 H;  4IFD J;  5FJ8 G;  1HNW L;  1LV9 A;  5T1I A;  2DN8 A;  4A3B G;  1TS3 A;  3ND8 A;  1KIX A;  3M85 A;  2BA1 A;  2BH8 A;  4BBS H;  4B3R Q;  1RL2 A;  3H3V I;  5GAD C;  2UU9 Q;  4ME5 A;  2ZM6 L;  4BS9 A;  3E9H A;  4XYO A;  1FJG L;  4IUQ A;  4I7Z C;  1QVF A;  5CC4 A;  4DV1 Q;  1NE3 A;  3F2U A;  4H0L C;  3CCM A;  3S2H B;  3CPF A;  1LUZ A;  2YU9 B;  4CHT B;  4EQ5 A;  3K5O A;  2X6L A;  1Q8K A;  4RAU C;  3OOC A;  4JBM A;  5ELB A;  4ALP A;  3LNN A;  1KAW A;  2F0Q A;  4J6H A;  1WFQ A;  2RDG A;  2A6H D;  4CKB A;  1G8Z D;  1QNK A;  1SN8 A;  4RGO S;  2M00 A;  2QCP X;  3MXP A;  1JOK A;  3PUX A;  4JW0 A;  3T13 A;  4L63 B;  2E2D C;  4EX5 A;  1CK1 A;  1E2V A;  3BDO A;  1RTN A;  3ZJY C;  3MZ5 A;  1NY4 A;  2VL6 A;  3NSW A;  2UUC Q;  1DXM A;  1X54 A;  2OQ0 A;  4QUC A;  1PYB A;  4IPC A;  2IJ0 A;  3K5M A;  2NN6 H;  4AYB B;  3G7L A;  1SMY C;  4X62 L;  2DGY A;  1XNR Q;  2XVS A;  2OTL A;  2KHJ A;  4PQX A;  4UPA A;  5GAH C;  3GTL B;  1VDZ A;  1BNZ A;  4DR6 Q;  1SND A;  1JC7 A;  5CYU A;  4DUZ L;  3S16 H;  2XSC A;  4QY7 A;  3U58 A;  2OWO A;  2BA0 A;  3FPP A;  3MFY A;  1FR3 A;  1DOK A;  4C3H G;  4JI7 Q;  1XJV A;  3GTJ H;  2CWA A;  1FNU A;  1KTK A;  1K9M C;  1TT2 A;  1B44 D;  2B2U C;  4ZQ3 A;  1WVL A;  2KHI A;  1M1K C;  5IYD G;  1F2Y A;  2YTV A;  1IW7 D;  4K8J A;  2ZJP A;  2F1M A;  4AQY L;  4TRD A;  1JWU D;  1YIT A;  3W5O A;  5CGK A;  1Q46 A;  4ZRZ A;  5IT9 E;  1X56 A;  3Q0A A;  4A3C H;  4JV5 L;  4CGY B;  1I4X A;  3PMF A;  4PZ7 A;  1QCB D;  4LMQ D;  3M4O B;  1PYW D;  5I4D A;  3GTQ H;  2NUC A;  1KXL A;  5D3D A;  2O2L D;  4A3J G;  2DNC A;  2N78 A;  2NVQ H;  1NSN S;  1CI3 M;  1X3G A;  4YY3 L;  2B63 G;  2Q8T A;  1N36 L;  5KGU A;  4UY8 C;  2BE5 D;  4X64 L;  4PZ8 A;  5JVG 3;  5DNF A;  2WB1 B;  3U9S A;  3VYR A;  4IUT A;  3KLR A;  5LL6 S;  3A54 A;  1K8O A;  4KLK A;  4KMU C;  1YNX A;  1Q90 A;  1U9R A;  5M3M G;  4JI2 L;  5IP9 G;  2RHQ B;  2EY2 A;  2RSN A;  4I7A A;  3VA5 A;  2CQA A;  3F1Z A;  1HNX L;  3MA2 B;  5C44 H;  3IFD A;  1UEA B;  3HOZ H;  5BN4 A;  1VMC A;  4M1U B;  4GOP B;  4KV6 A;  3J81 L;  1ONL A;  4KKU A;  2B29 A;  1Q3L A;  3S1M B;  1B70 B;  4S3S A;  1BCP D;  3K7A B;  2WKD A;  4JC0 A;  1IYV A;  2RF4 A;  4AH6 A;  3IKJ A;  5KYI A;  1TR5 A;  1A62 A;  5J22 A;  3DEO A;  1DON A;  4DV2 Q;  4GNX A;  1K83 B;  2KEE A;  1PTO F;  4FXD A;  1JOO A;  1SE4 A;  3GTL H;  4DNI A;  3GTK B;  3NEL A;  3TBI B;  1QVG A;  4IJL A;  4WOR A;  4JBJ A;  1GUG A;  4Y7N B;  2EXZ A;  2ZTD A;  5JJI A;  1LT5 D;  1Y1W G;  3BVZ A;  4RHR A;  3QJY A;  3M4P A;  1W3S A;  4J15 A;  3I8Z A;  3BZC A;  3HOV B;  2OF1 A;  3D8G A;  1S4Z A;  2R3Z A;  1HUM A;  3GQB A;  1UUP A;  4AYB E;  2QGQ A;  5IP7 H;  4BA2 I;  2E5L L;  4JBW A;  3CME A;  1HNZ Q;  3V96 A;  2K28 A;  1U5K A;  1D6E C;  4AQY Q;  4JI0 Q;  2Q2U A;  3PUW A;  4G4K A;  3HOX G;  3H94 A;  2B2V A;  3P7J A;  3CP0 A;  2ZTC A;  5T1G A;  2VS1 A;  4LUZ A;  2JA5 H;  4DR7 L;  3KF8 B;  2ID0 A;  5LHY 1;  1STA A;  2D2C C;  2UUA Q;  4DN4 M;  1O7L A;  1BQQ T;  1BF4 A;  3C46 A;  3KF6 B;  1VQ5 A;  2JJQ A;  4X6A H;  2KVM A;  3A7A B;  1YJW A;  1BBX C;  4TKO B;  4N8X 1;  1VQE A;  2A1A A;  3TRZ A;  1K3B C;  2ASB A;  1EY4 A;  4JI2 Q;  2SEB D;  1VF5 C;  1XTC D;  4A3F G;  1S5E D;  4H44 C;  4RGN A;  1ZYR C;  2HQL A;  4RCN A;  1IL2 A;  2K5H A;  4LUV A;  3S1M H;  1LO5 D;  1PFM A;  2EJF C;  2JK8 A;  3K7A H;  3I4M B;  1OTC A;  1BR9 A;  1DM0 B;  3AU7 A;  2VXW A;  2JSO A;  4ZUJ A;  5C4X B;  4XQN A;  3H3V H;  2WFW A;  4Y52 H;  1K83 H;  3R93 A;  5CBE E;  2MUY A;  3S15 B;  3M4Q A;  5BN5 A;  3GTM H;  3M7N A;  1STN A;  2R93 G;  5A35 A;  2ATW A;  1F9P A;  2KEC A;  5A2Q E;  4LF5 Q;  1W2B A;  2J7Z A;  3H0G H;  5I6Y A;  2L55 A;  3E6Z X;  3AB9 A;  2JYO A;  5C3E G;  1PH8 A;  3ERQ A;  1DGS A;  2JA6 B;  3MEF A;  5BN3 A;  1TVX A;  3BVG A;  3SEB A;  1TS2 A;  1OXU A;  1U4M A;  3ERS X;  5KND A;  3W2D A;  2F0I A;  4PMB A;  3AEV A;  5ELN A;  3OMC A;  3VR4 A;  4FDB A;  1C7Y A;  1J8I A;  1Q82 C;  5ELD A;  3NXW A;  1JE5 A;  3K7U C;  1G2S A;  1CHP D;  2I46 A;  4R4T A;  2QEX A;  3ULP A;  3HOW B;  4HMJ A;  5EBC A;  4R9W A;  3DM3 A;  2K5N A;  1A6X A;  2QF7 A;  2BOS A;  4GKJ L;  2C35 B;  3TZU A;  1S5B D;  2FXQ A;  5IGD A;  3TP8 A;  5EPJ A;  2GA4 B;  4ZKC B;  2PNH A;  1X9N A;  3HOU B;  4FF1 A;  1HR0 W;  1E1O A;  4OWT B;  3I55 A;  1I5F A;  1WTV A;  1FGB D;  4JOI A;  2JQO A;  3EQL C;  4A76 A;  5JJL A;  4A3D H;  1AW7 A;  3L7Z C;  1VQC A;  5IYC G;  1VQK A;  1YVC A;  2A74 C;  4DV4 L;  3EA6 A;  1RF2 D;  1D5M C;  3WOE A;  5CMD A;  2IY5 B;  3IRB A;  4K0K Q;  5DEH A;  1SXT A;  3K57 A;  2J0T D;  3S17 H;  1DZ1 A;  5JPN C;  5HGT A;  1SJE D;  1II3 A;  1KDB A;  1OXT A;  4GNX B;  5C0X J;  1QNU A;  2OEO A;  3BZK A;  1WOC A;  5CR3 A;  3ULJ A;  4C3I B;  3J80 L;  2Z4I A;  2PZU A;  4LFA Q;  4NXM Q;  4PZ6 A;  3A5U A;  1JB7 A;  3CW2 C;  3P75 A;  2K5W A;  4LF8 Q;  5LMU Q;  4PMW A;  1SYF A;  2EIF A;  2RVL A;  5DM6 3;  4L5T A;  1AZQ A;  3R2I A;  2KCT A;  1WCM G;  2NVY B;  3SHL A;  4IFD G;  3A74 A;  2WKC A;  1DYQ A;  1RIP A;  3STB C;  3NWT A;  3F2D A;  3PV0 A;  2B2W C;  1AFP A;  5IGG A;  4LFB L;  3A55 A;  3QIA A;  1GUO A;  1J5E Q;  2D0O A;  3NEM A;  1X3Q A;  3T56 B;  4OX9 Q;  2UXC L;  5BR8 L;  1LT3 D;  2MFI A;  4DR4 Q;  3HKZ G;  2WIN B;  1YNN D;  4XT3 B;  1H9M A;  4B3M L;  2PZT A;  2F3W A;  1A0I A;  1EY9 A;  4H7B A;  1D8L A;  1S3O A;  1BUV T;  2L5T A;  4K5W A;  4RFB A;  4X3K A;  1PTO B;  1N32 L;  1EFW A;  1DOM A;  2R7Z B;  2F0W A;  3J7A F;  4KKS A;  1NMF A;  5LMN Q;  3SK5 A;  2F0L A;  4A4I A;  4A3E G;  2AQ1 B;  4HJ7 A;  4YWK A;  3UDF A;  2KOL A;  2WAQ E;  3HOW H;  3I3C A;  4R4I A;  2NB0 A;  3TSS A;  2Z4H A;  1QE6 A;  1T5X D;  1KL9 A;  4O42 A;  3K58 A;  4A3G H;  2PQE A;  3N6R A;  1VQ7 A;  3J7A V;  3HKS A;  3DXJ C;  1ZXT A;  4M8A A;  1VQP A;  1Z47 A;  2LY7 A;  1K8A C;  2XWB B;  1QVC A;  5M5W B;  1IBK L;  3HOU H;  1FNW A;  2A68 D;  3S1N H;  1F9Q A;  4DXF A;  1N33 L;  4DGZ A;  2NWG A;  4BY7 B;  4H02 A;  3TME A;  4A3L G;  1XMQ L;  1FVI A;  1VQF A;  1ET6 A;  4L8J A;  4N8F A;  2GN5 A;  3EJI A;  1A3V A;  1VQD A;  4JI5 L;  3IL8 A;  1RDP D;  2E75 C;  2O4X A;  4NMZ A;  3A8J E;  5JAV A;  2Q2T A;  4BXX G;  4NPS A;  3H09 A;  3J81 c;  5M3F B;  4JI4 Q;  4Q5V A;  5EKL A;  1UAP A;  4X65 L;  2SDF A;  3G6J B;  2JA8 H;  1HJP A;  1HZA A;  3QO2 A;  1KC8 C;  2PMZ B;  2CCZ A;  3K6O A;  4CDD C;  4IUP A;  4C3I H;  3MWY W;  4UAI A;  2K4K A;  4HJ5 A;  1TQO A;  4LUO A;  1L1O B;  2IHE A;  1E3P A;  5IGF A;  2BH2 A;  2E8G A;  2YV5 A;  3I4N G;  1STY A;  1SFO B;  3K5L A;  5JEA G;  2VUM G;  1EIH A;  1IYU A;  4TVA B;  5IGC A;  1WTW A;  4RKB A;  3EBE A;  2UXB L;  3CCJ A;  1JR0 D;  4ME3 A;  4CDC C;  1MGS A;  3CAM A;  1ILQ A;  1GUT A;  4DR3 Q;  4LFB Q;  5D14 A;  3SK4 A;  2X69 A;  2GVA A;  1JJC B;  1QZH A;  2V1C C;  1X32 A;  5I2X A;  2I5H A;  5J3B A;  1YJ9 A;  5BR8 Q;  3B6Y A;  1ICF B;  1C48 A;  2A6H C;  1U4L A;  2HIV A;  2RSO A;  4LF6 Q;  2EY5 A;  1EYD A;  1RJT A;  2A6E D;  2HQE A;  4HN7 A;  1OXX K;  1MSH A;  2O5J C;  3RLF A;  1EWI A;  2ZXO A;  4BY1 H;  1SLJ A;  4GOP A;  3MXN B;  1I4G A;  3QG1 A;  4DV3 Q;  2EQS A;  1M4V A;  1QOH A;  2RCN A;  2VQE Q;  3HOY H;  4HR7 B;  1TWC H;  1IHZ A;  1ESF A;  2ALY B;  4ZAI A;  5JVH 3;  1GUN A;  1OO9 B;  3T16 A;  1STG A;  4NXN Q;  2TSS A;  3S16 B;  2MNA A;  4B3S Q;  4A3B B;  1RKN A;  4G7Z C;  3T1H L;  4DAV A;  5IOC A;  4OGQ C;  5FLX L;  1I6H B;  1CFM A;  2F0S A;  3EVQ A;  3GTJ B;  4HED A;  1PZI D;  2E2H H;  5M5W H;  3I7F A;  2NVX B;  2FMC A;  3H6M A;  3G4S A;  1VQI A;  4F87 A;  3J81 i;  4KHV A;  1SE2 A;  1FL0 A;  2NVT B;  1IBK Q;  3D31 A;  1SBB B;  1TII D;  4BY7 H;  2B39 A;  3FDT A;  1HXY D;  2JXM B;  1KNA A;  4TSS A;  4ULL A;  1PH2 A;  1QUQ B;  1CKM A;  2KUM A;  4LF7 L;  4A75 A;  4UP7 A;  1YBY A;  4IUR A;  1EY7 A;  3RLO A;  3M7G A;  1CQV A;  5KYL A;  2D5D A;  4IUV A;  1D5X C;  4OON A;  2D62 A;  3GTQ B;  2ZJQ A;  1JE4 A;  1IW7 C;  4HID A;  1TY2 A;  2DNE A;  5M3F H;  2NVQ B;  4JI5 Q;  1E24 A;  4P73 A;  2HD3 A;  1G51 A;  3CRK C;  4WJW A;  2F0D A;  1A3U A;  4KJO A;  2HHH L;  2JEB I;  3PF4 A;  5KRU A;  1MI2 A;  4A3I H;  5CV4 A;  3PO2 G;  2RHS B;  2HIX A;  3NTK A;  2VW9 A;  1MHW C;  1XXG A;  1SFO H;  4NKL A;  2A8V A;  2KHS A;  3SE0 A;  1I50 H;  4NB3 A;  4K14 A;  3S24 A;  1SNM A;  4IZ8 A;  2R7D A;  3ULL A;  2BE5 C;  3KF8 A;  3PO3 H;  1ILP A;  1CQF A;  3T1Y L;  2ZXP A;  3BZD B;  1PLF A;  4OO1 G;  1B4O A;  4YWL A;  4JI1 Q;  2P5Z X;  5C44 B;  3KF6 A;  2VB3 X;  5ELO A;  2MO1 A;  3HOZ B;  3KUP A;  3T53 B;  2UXB Q;  4CBV A;  1Q1B A;  1I4H A;  2PMZ E;  4DFA A;  1YEZ A;  1SRU A;  1PMR A;  1PRT F;  3H91 A;  4B3T Q;  3NTI A;  4DV6 L;  3ITP A;  4A93 H;  1PXU A;  4YHH L;  2CW0 D;  4C56 C;  2IWH A;  3OTO Q;  1XMO L;  4R4C A;  4RGT A;  2UXD Q;  5LL6 X;  2QDL A;  1Y8P B;  2H4O A;  1B2T A;  1BCP C;  5FK9 C;  2HUG A;  4O1N A;  4HIM A;  1NJI C;  4ZCK A;  3GD7 A;  1JJG A;  1TKW B;  3DUZ A;  4K5X A;  5FJ8 H;  3M9B A;  1V43 A;  1G91 A;  4R8N A;  4A3B H;  4K6L A;  4DR5 L;  1I6H H;  4A3J B;  5IGE A;  2M9V A;  2B63 B;  2Z6K A;  1H9S B;  1KDA A;  4GNX C;  1EZ6 A;  3N52 A;  5NUC A;  2NVX H;  2PYK A;  3Q22 A;  3F2B A;  4C1N K;  2NVT H;  1TY0 A;  1B8A A;  1ENF A;  3OWF A;  4PV1 C;  1Y69 U;  1EIG A;  1EIY B;  4MZ9 A;  2X6G A;  2KBN A;  4YCV A;  3I4O A;  1PRT D;  4J8Q A;  1LTA D;  2E2J H;  1ML0 D;  1F2L A;  2SNM A;  2VB2 X;  4OIJ A;  2ZXR A;  5KNC A;  1HNW Q;  5C6A A;  1TWA B;  5FO9 B;  2JA5 B;  3A0J A;  4KKT A;  1HR0 L;  5D3I B;  1E22 A;  1S5D D;  4AYB G;  1DJR D;  2K5D A;  3LWU A;  1I4R A;  3KJO A;  1AE3 A;  3BVM A;  2A73 B;  4MNO A;  4LF4 L;  1SDF A;  3K5N A;  2ZM6 Q;  2VNU D;  1FJG Q;  4R1J A;  2CH4 W;  2B2V C;  1JMC A;  2F4V L;  4YCU A;  4JI8 L;  1LTR D;  3I91 A;  5C3W A;  2ENB A;  3G6E A;  2RBM A;  4KHZ A;  3T1Y Q;  3PIP 3;  4DAY B;  3PQI A;  1FYC A;  3TP6 A;  4CJ1 B;  4YIJ A;  4B9X A;  1JCK B;  1VQA A;  3RNU A;  4MHE A;  2Z6B A;  4OIK A;  3CF5 A;  1Y1W B;  4IUN A;  3DM1 A;  4C3H H;  1ENC A;  3KDF A;  2XN9 C;  3WDN A;  3PCO B;  5IYD H;  2DUD A;  1VQB A;  1SE8 A;  4LNQ A;  4LF9 L;  5DLQ E;  5FOB B;  1CKN B;  1DCZ A;  5EPK A;  4XDX A;  3CCQ A;  3GTM B;  3E0E A;  2F0V A;  3OW7 A;  1A3T A;  2H1E A;  1K0R A;  2Z1C A;  4X62 Q;  2R92 G;  2AQ2 B;  3VDY A;  4Q0F A;  4H13 C;  3L2P A;  4IFD I;  2NZH A;  3H0G B;  4A3J H;  4IPG A;  4DUZ Q;  4FF4 A;  5IWA L;  4NDX A;  1STE A;  4DV0 L;  2B63 H;  2F0J A;  3K81 C;  2OXP A;  3DWQ A;  1CM9 A;  4RKL A;  1SNP A;  1C9O A;  2K6A A;  3MFG A;  3HRZ C;  1IKM A;  4X66 L;  1PZJ D;  3J80 i;  3OSO A;  3AYH B;  1YHB A;  4L5S A;  4CJ2 C;  2Q2I A;  5EAY A;  4L5Q A;  5M3M H;  5IP9 H;  2MGS A;  5CBA E;  3CD6 A;  1B50 A;  1CZW A;  5I9P A;  4XQJ A;  4QIW B;  4L6T B;  3ER0 A;  3G71 A;  2F0G A;  4JV5 Q;  5M5Y B;  1TWA H;  4A3F B;  1EEI D;  2IL8 A;  5A2Q L;  3I90 A;  1PTO D;  2EJG C;  1K28 A;  1O78 A;  5IY0 A;  1SE3 A;  2F0H A;  4G57 A;  4YY3 Q;  2FIN B;  4BA1 I;  2WV6 D;  2F0K A;  1I3Q H;  1ESR A;  1I4P A;  4BBR G;  1S40 A;  3P20 A;  1N36 Q;  1LTT D;  5AJ3 L;  4K2K A;  2E74 C;  4X64 Q;  3E5S A;  1IXR A;  2LS0 1;  4GLA C;  3BDC A;  1GD7 A;  3J81 E;  3EN2 A;  1Y14 B;  1WTO A;  1CA5 A;  4A3D B;  2KCM A;  2SOB A;  3KLS A;  3S1R H;  4HAE A;  5HY6 A;  1H9R A;  4B08 A;  1HFN A;  2K33 A;  3OHX C;  1KQS A;  1JOQ A;  3S17 B;  2Y0S B;  2R93 B;  4DU9 A;  3HOV G;  1CT1 D;  3PF5 A;  4JI8 Q;  1HNX Q;  2ES2 A;  4LJZ C;  4FO2 A;  2VZA A;  4POG A;  1TWH H;  4JOI C;  1HQR D;  1Y1W H;  1TWG B;  2JA9 A;  2K7V A;  2LXK A;  2PZW A;  4XTC S;  5C3X A;  2YTX A;  4FNF A;  4WJ4 A;  3RN5 A;  1ZKO A;  2AQ3 B;  5C3E B;  2WB1 E;  3UE0 A;  4RGM A;  3QOJ A;  1C8C A;  2K01 A;  3NBI A;  2MP1 A;  3NQT A;  2RDF A;  1B3Q A;  4N9T A;  5CV9 A;  2Q2H A;  5K36 G;  2QEJ C;  4P74 A;  2EYH A;  1K8M A;  3SDZ A;  1QB5 D;  2N49 A;  3Q8D A;  1RHP A;  5FLX c;  4FYD A;  1L1O A;  1OXV A;  3J81 j;  3MXU A;  3T4A C;  4DV7 L;  3R3O A;  4A3M G;  1PRT B;  3W3A A;  1BBU A;  5H1S E;  3HOX H;  3L3O C;  3PSI A;  3JAM L;  3FKI G;  1V1O A;  1EUJ A;  1L0X B;  1F9S A;  4DV0 Q;  3CHB D;  1YNN C;  4L5R C;  1EZ8 A;  1MIU A;  2K14 A;  4KHP L;  1UNS A;  2NTS A;  1HZB A;  2FHT A;  2KQ3 A;  4TQU S;  2B2T A;  2F3I A;  1QJO A;  3PUZ A;  4HJA A;  2PI2 A;  1WD1 A;  1PH3 A;  2E5L Q;  3GDE A;  1O80 A;  3W1G A;  1JIC A;  3TQY A;  3TS0 A;  3I4M G;  4A3G B;  3L9A X;  1WTH A;  2F0F A;  3SR1 A;  5M5Y H;  3MXN A;  4A3F H;  2PO4 A;  5C4X G;  4UHV A;  3J7A 5;  4KD4 A;  2CHB D;  2WAQ G;  2K03 A;  1YI2 A;  3NP8 A;  1N34 L;  1VF7 A;  3S1N B;  2NYZ D;  1MBY A;  5IYB G;  4DR7 Q;  2VY3 A;  4CDF C;  2C9O A;  3P1H A;  4FF2 A;  2EZV A;  4HTH A;  2E2I H;  1X3E A;  1HUN A;  1WCM B;  2Z0S A;  2ZT9 C;  3D4R A;  4DNR B;  1GJX A;  1BVS A;  2EYP A;  4XXE A;  3MEH A;  2A68 C;  3C1F A;  1VCI A;  1N9W A;  3I72 A;  2LFN A;  3LX0 A;  5EPL A;  3KDF B;  4DAM A;  2JA6 G;  3OMG A;  4GZY C;  2HDL A;  2L15 A;  1I94 L;  4QIW E;  2R93 H;  3NHH A;  4XYQ A;  2JA8 B;  2L11 A;  3RN2 A;  1EWH A;  5FO8 B;  3Q23 A;  4FXG C;  4ZUI A;  5I9O A;  5DM7 3;  4ZK9 B;  3GP7 A;  1QUQ A;  3HKZ B;  2RKS A;  2OQK A;  4LAA A;  4LW1 A;  4JI6 L;  1TWG H;  1E0B A;  3W1B A;  5C3E H;  1ROD A;  3U9O A;  4JYA L;  1J9O A;  2B2Y A;  2F0P A;  2JEA I;  1B9M A;  3R8B A;  3VYS A;  2NN6 I;  3KLW A;  1T9H A;  3FPU B;  4DK3 C;  4GLV B;  1AH9 A;  4P72 A;  3UDI A;  2J4X A;  3MVV A;  4GN3 B;  1XNQ L;  2XNA C;  2Y0S E;  3CU7 A;  4DR1 L;  5CV6 A;  1WJJ A;  2MQH A;  1LTB D;  4EQO A;  4A3K G;  2WII B;  1GOZ A;  1VQJ A;  4DK0 A;  4DA2 A;  1I6V C;  3OPO A;  5L37 A;  4I65 A;  4OO1 I;  1LT6 D;  3HGB A;  1O7Y A;  3HZX A;  2I0Q A;  4FF3 A;  5IYB H;  4BY1 B;  3JC6 6;  3QR8 A;  3IAY A;  1IBL L;  5FKA C;  4DUY L;  4LWC A;  2PW5 A;  1PFS A;  3HOY B;  4XT1 B;  1TWC B;  1SYE A;  1FNV A;  4GLX A;  1Y1V G;  2F0T A;  1YIJ A;  3C2P A;  2KA7 A;  1BO0 A;  2A6E C;  1S72 A;  5IYC H;  5E3F A;  1SSO A;  4PMC A;  5ELC A;  1KAA A;  2LMC B;  3D4W A;  4K5V A;  3RZO B;  3A8I E;  4X3U A;  2WP8 J;  4IUU A;  1NR4 A;  5I6W A;  3PUV A;  1IYJ B;  1D7Q A;  1SAP A;  5JJZ A;  4GKJ Q;  3I56 A;  3X3M A;  2Z9H A;  2O5I C;  3KFU A;  2E2H B;  5GRO A;  1NTG A;  1KLU D;  1YNJ D;  4GOP C;  3HP3 A;  2F0M A;  1QIL A;  5FLM G;  4F8M A;  1MJE A;  1CSP A;  1D1I A;  4HMI A;  1IL8 A;  1TWF H;  1WTR A;  1YHA A;  3GTG B;  3I4N B;  1WCM H;  1GUS A;  1L0W A;  4ID6 A;  5J39 A;  3J80 E;  4IFD H;  2FMM A;  3AFP A;  5JOB A;  2CWP A;  3CCR A;  4R8I A;  3NPP A;  5HUR A;  3ICE A;  2XRQ D;  5COY A;  5COR A;  1H9S A;  2UUB L;  1STB A;  2Q8I B;  1S5F D;  4P75 A;  2R7Z G;  4O0A A;  3DWP A;  5JJK A;  1W6J A;  2CQO A;  4DV4 Q;  4LFC L;  3D6W A;  4JBK A;  1HH2 P;  5CV7 A;  2TMP A;  5EQ0 A;  2B8G A;  1I94 Q;  2B8F A;  2L12 A;  2NTT A;  1JWM D;  5M9O A;  1E7Z A;  5E4X A;  5IIF A;  2I07 B;  4A3I B;  1LT4 D;  1PFB A;  3NTH A;  4B3R L;  3S2D H;  1XPR A;  1I50 B;  1SNC A;  2PCF B;  1G6P A;  1VQ8 A;  2G9H D;  3S14 H;  2GVB A;  4RA8 A;  2UU9 L;  3CCE A;  3PO3 B;  1Y8O B;  2I5M X;  3U4Z A;  3CCV A;  4KJN A;  1Q7Y C;  4DV5 L;  4A3E H;  4JK1 C;  4DV1 L;  1CHQ D;  3C1E A;  1KD1 C;  4GN5 A;  1SNQ A;  5I2Y A;  3URY A;  1KNE A;  1XX8 A;  3DHQ A;  4P2C B;  4C3J G;  2UXC Q;  2JA7 G;  1F77 A;  4RMF A;  3K59 A;  1VQM A;  1X6O A;  4B3M Q;  5G3L F;  1A2T A;  1GUW A;  4A93 B;  1HPC A;  2PNR C;  4BBS G;  3GTP H;  4DAY A;  1KAB A;  1U0L A;  2IX3 A;  1XWE A;  1N32 Q;  4FP5 D;  4A3L H;  1AP0 A;  2UUC L;  2G5D A;  2F4I A;  1XYI A;  1EU4 A;  4U67 3;  2CW0 C;  3A8K E;  1NNX A;  3RZO H;  4XQQ A;  1K73 C;  5C4J B;  1SMX A;  4BXX H;  1D5Z C;  4MN3 A;  3KBG A;  1XNR L;  1CKN A;  2AKW B;  3J7Y W;  5LMN W;  1EQQ A;  2F0E A;  1J6Q A;  1TU2 B;  2RQX A;  3CCU A;  1V1P B;  1EY8 A;  4KI0 A;  5EKK A;  3BYY B;  5C0X I;  3PO2 B;  2KJX A;  4KN4 C;  4JI7 L;  3UI2 A;  1PH5 A;  3GTG H;  3I4N H;  2AUJ D;  4E6I A;  5ISR A;  1N33 Q;  5KNB A;  5JEA H;  2VUM H;  1LAB A;  1T5E A;  1XTD A;  3RUZ A;  1XMQ Q;  2E2J B;  2K52 A;  1SNO A;  3VR3 A;  1RD9 D;  1HTP A;  3BDL A;  3SVM A;  3C3L A;  2DJF C;  2XIW A;  2IHF A;  2XGT A;  2NN6 G;  1G29 1;  2F3V A;  3SK8 A;  2F03 A;  1Q86 C;  2KCN A;  4DXG A;  4QCL A;  1PRT C;  4X3T A;  1UE5 A;  4X65 Q;  3RR5 A;  1IKL A;  2EYL A;  3RZD B;  3BS1 A;  3A56 A;  1EQV A;  3KOJ A;  1LYL A;  5GAG C;  5CV5 A;  1M90 C;  2L4N A;  4DK1 A;  2A69 D;  5HGQ A;  1BDO A;  4JPB W;  2RCF A;  1HZ9 A;  1JOR A;  5IT9 L;  2N3S A;  3ND9 A;  4NP5 A;  4DV5 Q;  3K0Y A;  3JAM c;  1K3R A;  1I4Q A;  3S9W A;  1LTL A;  1VQ6 A;  4DK6 C;  4KY7 A;  4UP9 A;  4C3H B;  4A3C G;  1JB3 A;  2EDG A;  4HIO A;  1Z6H A;  1PZK D;  3D3R A;  5FLX E;  4MTN A;  3WOF A;  1E2Z A;  5EGT A;  2A19 A;  4DKA C;  4WJ3 M;  4N9P A;  3D4D A;  4JG2 A;  3S1Q B;  1AE2 A;  1EYG A;  3SXH A;  2SNS A;  1CZG A;  1PH6 A;  3CC2 A;  2C5C A;  4DV2 L;  5C4J H;  3GTO H;  2MJ8 A;  2IX1 A;  3NK9 A;  1YJN A;  3T1H Q;  4DNT B;  2OT2 A;  3O13 A;  1O7I A;  2PI2 E;  2N8N A;  4X3S A;  5EJW A;  1EEF D;  4P71 A;  5C44 G;  3I70 A;  4V0B A;  3HOZ G;  3ZYY X;  3PO2 H;  3KJP A;  4XIG S;  1NBW A;  2K04 A;  4C1N I;  3FP9 A;  2MO0 A;  4RWS C;  1IZ6 A;  5M3M B;  1V8Q A;  2EYJ A;  5C4H A;  1L0Y B;  2F52 A;  1NMG A;  3UDG A;  4LF7 Q;  1HCZ A;  1F9R A;  4OO1 H;  3U50 C;  3J80 c;  1VQH A;  5M5X B;  5IGB A;  1NR2 A;  1MD2 D;  1HNZ L;  1CSQ A;  1JJ2 A;  3CKI B;  2HT1 A;  3AQQ A;  3K80 C;  3PIO A;  4JI0 L;  1I3Q B;  1DD2 A;  1EYA A;  2EYF A;  1MJC A;  1R4Q B;  5JEA J;  3RZD H;  1QWY A;  1EL0 A;  1TS5 A;  1BCP F;  1X3F A;  2HHH Q;  3JAM i;  1WTQ A;  4V19 0;  1UE6 A;  3BJU A;  5TSS A;  1PTO C;  2NZO A;  3S1R B;  2VQF L;  2HCI A;  3KBX A;  2UUA L;  2G9D A;  4IJH A;  3V05 A;  4R4O A;  2B3G A;  5KEE A;  5GQO A;  1B53 A;  1VQ4 A;  3OIQ A;  1LM0 A;  3R2T A;  2R92 B;  5D65 A;  5IP7 G;  4HJ9 A;  3VA7 A;  3NWS A;  3MAQ A;  1HFG A;  1TWH B;  2L1B A;  2E76 C;  4KY6 A;  3NBH A;  3F2C A;  1F2M A;  3S2H H;  4HSV A;  2YU9 H;  1Q81 C;  2FFK B;  3HFZ B;  4QQB X;  2BDO A;  3D6C A;  2JA5 G;  2PPB C;  1PH1 A;  2BCO A;  4DV6 Q;  3U4V A;  1E1T A;  4YHH Q;  4ILW A;  1XMO Q;  1PH9 A;  1IBM L;  5C5L A;  3S1Q H;  3BU2 A;  1PHJ A;  1B7Y B;  3KLS X;  3H15 A;  4HJ8 A;  4OWW B;  2OTJ A;  1JT8 A;  5C0X G;  2WB1 G;  1SMY D;  3E9I A;  1LAC A;  5F2D A;  1NUC A;  1EWC A;  3HOX B;  3GO5 A;  2A5H A;  1HQM C;  2R61 A;  1RTO A;  2F0N A; 
#chains in the Genus database with same CATH homology
 5M5Y H;  4JBM A;  4ALP A;  1QZG A;  4NPS A;  3J81 c;  1KAW A;  4DR5 Q;  4A3F H;  1L2F A;  2Q2T A;  4POF A;  4JI4 Q;  1P8L A;  1WFQ A;  5C4X G;  4X65 L;  2JA8 H;  3J7A 5;  1SN8 A;  2EXD A;  4LF5 L;  2WAQ G;  1HJP A;  1HZA A;  3PUX A;  2AMC B;  1KC8 C;  4KHP L;  1YI2 A;  1N34 L;  2CCZ A;  4EX5 A;  4C3I H;  5IYB G;  4DR7 Q;  2VY3 A;  2K4K A;  1L1O C;  3CMA A;  4IOA A;  3CC7 A;  4HJ5 A;  4LUO A;  2CFM A;  1X3E A;  2E2I H;  3ZJY C;  1L1O B;  2PQA A;  2IHE A;  1E3P A;  2Z0S A;  3A5Z B;  1VQN A;  2BH2 A;  1NY4 A;  2E8G A;  2YV5 A;  3I4N G;  2VL6 A;  4QGU A;  1BVS A;  1VQ9 A;  2UUC Q;  5JEA G;  2VUM G;  1X54 A;  1A63 A;  4TVA B;  1SRO A;  2OQ0 A;  2K75 A;  1VCI A;  1N9W A;  1OXS C;  1PYB A;  4IPC A;  3KDF B;  4DAM A;  2JA6 G;  4PG3 A;  1H95 A;  3EBE A;  2L15 A;  5M5X H;  4QIW E;  3CCJ A;  1I94 L;  2UXB L;  4ME3 A;  3KYH C;  1PVO A;  2R93 H;  3RN2 A;  4X62 L;  1UE7 A;  1YZ6 A;  2DGY A;  1XNR Q;  3CAM A;  2OTL A;  2KHJ A;  4UPA A;  5GAH C;  4DR3 Q;  1HR0 Q;  4LFB Q;  4DR6 Q;  1QUQ A;  4GS3 A;  2OQK A;  2GVA A;  4LW1 A;  1JJC B;  4DUZ L;  4JI6 L;  1QZH A;  3S16 H;  1TWG H;  1XPO A;  3CCS A;  2V1C C;  4QY7 A;  3W1B A;  3U58 A;  2BA0 A;  2OWO A;  2I5H A;  3G48 A;  5J3B A;  5C3E H;  1YJ9 A;  3M4O H;  5BR8 Q;  3B6Y A;  2HIV A;  1WI5 A;  4JYA L;  3H0G G;  4JI7 Q;  4LF4 Q;  2JEA I;  4LF6 Q;  1XJV A;  3GTJ H;  2CWA A;  1K9M C;  1OXX K;  3RLF A;  1EWI A;  2NN6 I;  3KLW A;  1T9H A;  4BY1 H;  1SLJ A;  4GKK L;  4DK3 C;  4GLV B;  1AH9 A;  2KHI A;  3MXN B;  5IYD G;  2VQF Q;  4GOP A;  1M1K C;  4DV3 Q;  2EQS A;  2RCN A;  4P72 A;  2VQE Q;  3HOY H;  2F4V Q;  1TWC H;  2YTV A;  3UDI A;  2ALY B;  4GN3 B;  3RLN A;  2ZJP A;  1XNQ L;  2Y0S E;  2R92 H;  4AQY L;  1YIT A;  4IPH A;  3W5O A;  4NXN Q;  1Q46 A;  4DR1 L;  1X56 A;  1WJJ A;  2MQH A;  2R6G A;  2MNA A;  4B3S Q;  3TS2 A;  4A3C H;  4JV5 L;  3PUY A;  4K0K L;  5IE8 A;  4PZ7 A;  4YWM A;  3T1H L;  4A3K G;  1C0A A;  1VQJ A;  3GTQ H;  2LSS A;  4DR2 L;  1KXL A;  4RG1 A;  2KEN A;  4A3J G;  2N78 A;  2NVQ H;  4OO1 I;  1X3G A;  4YY3 L;  2E2H H;  2B63 G;  5M5W H;  3I7F A;  4LFA L;  1N36 L;  2I0Q A;  5IYB H;  3JC6 6;  4NXM L;  1IBL L;  4UY8 C;  4DUY L;  4LWC A;  4X64 L;  1PFS A;  4PZ8 A;  5LMU L;  3G4S A;  1VQI A;  2K5V A;  3J81 i;  1K8G A;  1FL0 A;  4GLX A;  3D31 A;  1IBK Q;  1Y1V G;  1YIJ A;  4BY7 H;  4LF9 Q;  3CCL A;  1EOV A;  3K8A A;  1S72 A;  4KLK A;  3PGZ A;  3WWV A;  1QUQ B;  1CKM A;  5IYC H;  1PH2 A;  1IBM Q;  4A75 A;  1MKH A;  4LF7 L;  4UP7 A;  1YBY A;  1YNX A;  3RLO A;  5M3M G;  3CC4 A;  4JI2 L;  2WP8 J;  4A3D G;  5IP9 G;  4OON A;  2D62 A;  2RHQ B;  3PUV A;  2YYZ A;  1IYJ B;  3TEH B;  2ZJQ A;  1J5E L;  3F1Z A;  4R4Q A;  4HID A;  1HNX L;  1D7Q A;  5M3F H;  4GKJ Q;  3I56 A;  3KFU A;  5C44 H;  5GRO A;  4JI5 Q;  1NTG A;  4OX9 L;  1E24 A;  5IWA Q;  4P73 A;  3CPW A;  4GOP C;  3HOZ H;  4DR4 L;  2Y0S G;  1G51 A;  3GTK H;  4BBR H;  4GOP B;  5FLM G;  2HHH L;  1MJE A;  1CSP A;  2JEB I;  4AIM A;  3PF4 A;  4Y7N H;  4A3I H;  1TWF H;  3PO2 G;  2RHS B;  4OWX B;  4X66 Q;  2B29 A;  1YHA A;  2HIX A;  2VW9 A;  1WCM H;  1B70 B;  1L0W A;  1N8R C;  1SFO H;  3OYY A;  3AFP A;  4JC0 A;  2A8V A;  2CWP A;  1I50 H;  4NB3 A;  3CCR A;  2RF4 A;  3S24 A;  4AH6 A;  1Z9F A;  2R7D A;  3ULL A;  3ICE A;  2UUB L;  3PO3 H;  1A62 A;  5LMN L;  1CUK A;  3EIV A;  3T1Y L;  4DV2 Q;  4GNX A;  3HOV H;  4P75 A;  4OO1 G;  4YWL A;  4JI1 Q;  2R7Z G;  2CKZ B;  4O0A A;  5JJK A;  4O2D A;  2CQO A;  3KF6 A;  4DV4 Q;  5ELO A;  2MO1 A;  4BXX G;  4LFC L;  4JBK A;  1HH2 P;  3GTL H;  4DNI A;  1Y1W H;  3NEL A;  1QVG A;  1I94 Q;  2UXB Q;  4IJL A;  1Q1B A;  1E7Z A;  4JBJ A;  3LGJ A;  2PMZ E;  2ZTD A;  5JJI A;  1YEZ A;  2JE6 I;  4B3R L;  1Y1W G;  3S2D H;  1SRU A;  4GN4 B;  1XPR A;  4B3T Q;  1G6P A;  1A8V A;  5AJ3 Q;  3NBH B;  1VQ8 A;  4DV6 L;  5IT9 c;  3S14 H;  3M3Y H;  2GVB A;  4YHH L;  3OTO Q;  1XMO L;  2UU9 L;  4A93 H;  3CCE A;  4R4C A;  2UXD Q;  2I5M X;  3U4Z A;  3CCV A;  3M4P A;  1W3S A;  4J15 A;  1Q7Y C;  4DV5 L;  3BZC A;  4A3E H;  3DLL A;  1V9P A;  1FGU A;  4APV A;  1KHI A;  3SGI A;  4DV1 L;  4HIM A;  3UDX A;  4AYB E;  5IP7 H;  2QGQ A;  1NJI C;  3GD7 A;  4GN5 A;  1KD1 C;  4DPG A;  4A3M H;  2E5L L;  4BA2 I;  1CKO A;  2QA4 A;  1JJG A;  4JBW A;  5FJ8 H;  3M9B A;  1V43 A;  3CME A;  1HNZ Q;  3HOW G;  4A3B H;  1U5K A;  4AQY Q;  4DR5 L;  4JI4 L;  2UXC Q;  2YTY A;  2JA7 G;  1I6H H;  3FKI H;  4JI0 Q;  2Q2U A;  3PUW A;  2R7F A;  3HOX G;  1X55 A;  3CP0 A;  2ZTC A;  4RMF A;  2VS1 A;  1VQM A;  4A3G G;  1X6O A;  4LUZ A;  4B3M Q;  2ZJR A;  2JA5 H;  2Z6K A;  4OXP A;  4DR7 L;  4DR2 Q;  4BBS G;  4GNX C;  3KF8 B;  2ID0 A;  3GTP H;  1U0L A;  2NVX H;  2UUA Q;  3F2B A;  1N32 Q;  3HOU G;  2NVT H;  3KF6 B;  1VQ5 A;  1B8A A;  4A3L H;  2JJQ A;  4JI3 L;  4X6A H;  1X65 A;  2D0P A;  3NEN A;  2UUC L;  1EIY B;  3K0X A;  4MZ9 A;  2KBN A;  4YCV A;  3RZO H;  1YJW A;  3I4O A;  3I4M H;  1K73 C;  2PQA B;  2IT1 A;  1SMX A;  2E2J H;  4DV7 Q;  1VQE A;  2A1A A;  4BXX H;  3TRZ A;  2ASB A;  4YCW A;  1XNR L;  5C4X H;  1HNW Q;  4JI2 Q;  1CKN A;  1Q12 A;  4DR3 L;  2AKW B;  3A0J A;  4UP8 A;  1HR0 L;  1EQR A;  3S15 H;  1E22 A;  4JCV E;  5LMN W;  4AYB G;  1EQQ A;  4A3F G;  1J6Q A;  1XPU A;  4GKK Q;  3CCU A;  2JA8 G;  4KI0 A;  3KJO A;  5C0X I;  1AE3 A;  2HQL A;  1P16 A;  1IL2 A;  4MNO A;  4JI7 L;  4LF4 L;  2K5H A;  4LF6 L;  1PH5 A;  4LUV A;  3GTG H;  3I4N H;  3S1M H;  1N33 Q;  4KHP Q;  2ZM6 Q;  2JK8 A;  3K7A H;  2AWO A;  2VUM H;  2VNU D;  1XTD A;  2AHO B;  1FJG Q;  1OTC A;  4R1J A;  1XMQ Q;  4DV3 L;  1JMC A;  2JA6 H;  2K50 A;  2VQE L;  2F4V L;  2K52 A;  1Q1E A;  4YCU A;  4JI8 L;  3H3V H;  2WFW A;  4Y52 H;  1K83 H;  3G6E A;  2IHF A;  2XGT A;  3M4Q A;  4NXN L;  2NN6 G;  4C2M H;  1G29 1;  4KHZ A;  3T1Y Q;  3GTM H;  3M7N A;  1Q86 C;  4B3S L;  4DAY B;  2R93 G;  2ATW A;  1GKH A;  1UE5 A;  4X65 Q;  1KRT A;  1VQA A;  3RNU A;  3CF5 A;  4LF5 Q;  3OW2 A;  3RR5 A;  1W2B A;  1N34 Q;  1HZC A;  4C3H H;  3H0G H;  3KOJ A;  1LYL A;  5GAG C;  2H5X A;  3KDF A;  1GO3 E;  5C3E G;  1UE1 A;  1PH8 A;  1M90 C;  1DGS A;  1PYS B;  3PCO B;  3MEF A;  4IPD A;  5IYD H;  1OXU A;  5HGQ A;  1PH7 A;  2DUD A;  1VQB A;  3ERS X;  3J7Z C;  1SE8 A;  4LNQ A;  4LF9 L;  5DLQ E;  2IX0 A;  3AEV A;  1CKN B;  5ELN A;  4FDB A;  4BY1 G;  1C7Y A;  1Q82 C;  1HZ9 A;  3CCQ A;  4IOC A;  3UE1 A;  3E0E A;  2N3S A;  3HOY G;  5GAE C;  4DV5 Q;  2OCE A;  1JE5 A;  3K7U C;  4R4T A;  3JAM c;  2QEX A;  1K3R A;  3ULP A;  1K0R A;  1LTL A;  4X62 Q;  4DK6 C;  1VQ6 A;  2R92 G;  4A3K H;  4QL5 A;  3VDY A;  3DM3 A;  3L2P A;  4IFD I;  2K5N A;  2NZH A;  4UP9 A;  4GKJ L;  4A3C G;  2C35 B;  4A3J H;  4DR4 Q;  4IPG A;  4DUZ Q;  4JI6 Q;  3I2Z A;  2FXQ A;  4HIO A;  5IWA L;  2B63 H;  4DV0 L;  1SR3 A;  3K81 C;  4MTN A;  4JYA Q;  1C9O A;  2A19 A;  2PNH A;  4DKA C;  1X9N A;  1ASZ A;  4WJ3 M;  4X66 L;  1HR0 W;  1WYD A;  1E1O A;  1Y1V H;  4OWT B;  3J80 i;  4JG2 A;  3I55 A;  1I5F A;  3STB D;  3AYH B;  1YHB A;  4L5S A;  1VQO A;  1AE2 A;  2Q2I A;  4JOI A;  2JQO A;  4L5Q A;  5EAY A;  1EYG A;  1GVP A;  4A76 A;  4BY7 G;  5M3M H;  1GM5 A;  5JJL A;  1PH6 A;  3CC2 A;  4A3D H;  5IP9 H;  4JI3 Q;  2NVY H;  1XNQ Q;  3L7Z C;  1VQC A;  5IYC G;  5C4J H;  3HKZ E;  4DV2 L;  1YVC A;  1VQK A;  3CD6 A;  4JI1 L;  3GTO H;  1KRS A;  4DR1 Q;  2IX1 A;  4DV4 L;  3ER0 A;  3G71 A;  4LF8 Q;  4JV5 Q;  2IY5 B;  3IRB A;  4K0K Q;  1YJN A;  1TWA H;  3T1H Q;  3S17 H;  1BBW A;  1ASY A;  5M3F G;  1O7I A;  2XTI A;  2PI2 E;  2N8N A;  5FLM H;  4P71 A;  5IY0 A;  4QJF A;  5C44 G;  1OXT A;  1V1Q A;  4YY3 Q;  5C0X J;  3BZK A;  3ULJ A;  1WOC A;  4GNX B;  4HIK A;  4BA1 I;  3HOZ G;  3KJP A;  3PO2 H;  4XIG S;  1I3Q H;  1S40 A;  1NBW A;  4LFA Q;  4BBR G;  1N36 Q;  1EIF A;  4NXM Q;  3FP9 A;  4PZ6 A;  3A5U A;  1JB7 A;  1IBL Q;  4B3T L;  3CW2 C;  5AJ3 L;  2MO0 A;  4DUY Q;  4X64 Q;  5LMU Q;  2ZTE A;  2EIF A;  4PMW A;  4A3I G;  1R9T H;  1IZ6 A;  4LF8 L;  3OTO L;  4L5T A;  1IXR A;  4GLA C;  2UXD L;  1GD7 A;  2KCT A;  1WCM G;  1Y14 B;  3EN2 A;  3PIP A;  2KCM A;  4IFD G;  3D0F A;  3S1R H;  2F52 A;  1NMG A;  3A74 A;  5HY6 A;  3UDG A;  4LF7 Q;  1BKB A;  1RIP A;  5E7N A;  3FHW A;  3STB C;  3U50 C;  1KQS A;  2R7Z H;  3J80 c;  1VQH A;  3F2D A;  3PV0 A;  3PO3 G;  4LFB L;  4DR6 L;  1VQG A;  1UWV A;  3HOV G;  1J5E Q;  1HNZ L;  3PF5 A;  4JI8 Q;  2D0O A;  1HNX Q;  1CSQ A;  3NEM A;  3TRE A;  1YHQ A;  1JJ2 A;  3CXC A;  2HT1 A;  2ES2 A;  3AQQ A;  4OX9 Q;  2UXC L;  3K80 C;  5BR8 L;  3PIO A;  2VZA A;  4JI0 L;  4POG A;  1TWH H;  2LXJ A;  1UEB A;  2MFI A;  4JOI C;  3AFQ A;  2JA9 A;  1MJC A;  3F8T A;  2LXK A;  3HKZ G;  4XTC S;  5JEA J;  2YTX A;  3RZD H;  4WJ4 A;  1PH4 A;  4B3M L;  3RN5 A;  1X3F A;  2HHH Q;  1A0I A;  2WB1 E;  3JAM i;  3UE0 A;  1UE6 A;  3BJU A;  1D8L A;  1S3O A;  2NZO A;  2VQF L;  2UUA L;  2I5L X;  4IJH A;  4R4O A;  1VS0 A;  4IO9 A;  2B3G A;  1VQL A;  1N32 L;  1EFW A;  5GQO A;  2Z6K C;  4A93 G;  2Q2H A;  5K36 G;  4P74 A;  2AWN A;  1VQ4 A;  2UUB Q;  1NMF A;  2N49 A;  3CQZ H;  1LM0 A;  3Q8D A;  5LMN Q;  4A3E G;  4A4I A;  5FLX c;  3L0O A;  1L1O A;  4HJ7 A;  1OXV A;  4YWK A;  3UDF A;  2WAQ E;  1PA6 A;  3HOW H;  3J81 j;  4R4I A;  5IP7 G;  4HJ9 A;  4DV7 L;  1TXY A;  4C3J H;  4A3M G;  1PV4 A;  4LFC Q;  2JA7 H;  4IFD J;  1BBU A;  5FJ8 G;  3F2C A;  5H1S E;  1KL9 A;  1HNW L;  3HOX H;  3S2H H;  4A3B G;  3PSI A;  4A3G H;  1VQ7 A;  2YU9 H;  1Q81 C;  1KIX A;  3M85 A;  3HKS A;  2BA1 A;  2BH8 A;  3FKI G;  4BBS H;  3HFZ B;  4QQB X;  4B3R Q;  1EUJ A;  1VQP A;  1Z47 A;  1K8A C;  1RL2 A;  3H3V I;  1QVC A;  1IBK L;  5GAD C;  2JA5 G;  4DV0 Q;  3HOU H;  1PH1 A;  4DV6 Q;  4L5R C;  3S1N H;  3U4V A;  1E1T A;  1MIU A;  4YHH Q;  2K14 A;  2ZM6 L;  1XMO Q;  1PH9 A;  1IBM L;  2UU9 Q;  1N33 L;  3S1Q H;  3BU2 A;  1HZB A;  1PHJ A;  1B7Y B;  3E9H A;  3H15 A;  4HJ8 A;  4OWW B;  1FJG L;  4H02 A;  2OTJ A;  1JT8 A;  5C0X G;  2WB1 G;  4TQU S;  1XMQ L;  1QVF A;  4A3L G;  3E9I A;  2F3I A;  3PUZ A;  4DV1 Q;  1FVI A;  1NE3 A;  1VQF A;  4HJA A;  2PI2 A;  1PH3 A;  2E5L Q;  3CCM A;  3GO5 A;  2GN5 A;  3CPF A;  3GDE A;  3W1G A;  1LUZ A;  3TQY A;  1VQD A;  4JI5 L;  3TS0 A;  3I4M G;  4EQ5 A;  1Q8K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...