1VQHA

Gene v protein mutant with ile 47 replaced by met 47 (i47m)
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
86
structure length
86
Chain Sequence
MIKVEIKPSQAQFTTRSGVSRQGKPYSLNEQLCYVDLGNEYPVLVKMTLDEGQPAYAPGLYTVHLSSFKVGQFGSLMIDRLRLVPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GENE V PROTEIN
publication title Potential use of additivity of mutational effects in simplifying protein engineering.
pubmed doi rcsb
source organism Enterobacteria phage f1
molecule tags Dna binding protein
total genus 9
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 1996-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02303 Phage_DNA_bind Helix-destabilising protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1vqhA00
5ELNA 1EFWA 2QGQA 4PMWA 1YJWA 4A3LH 3B6YA 4A93G 3PCOB 4BBSH 4PZ7A 5C4XG 1EIYB 2L15A 3K7AH 5E7NA 2VW9A 2JA6H 5GAEC 2K4KA 4IJHA 1S40A 1L2FA 4LW1A 2KCTA 2Z0SA 1KIXA 3PO3G 4RMFA 1PH9A 1YBYA 1OTCA 3I4NG 4TQUS 4OO1I 2YTVA 3HOZG 3HOXG 4A76A 2YU9H 3U4ZA 5K36G 1PH2A 1HJPA 4DV7L 2NZOA 2ZM6Q 4PZ6A 2KBNA 2B63H 5IYCG 1H95A 2OQKA 4GNXA 5JJKA 4X65Q 2ES2A 2OTJA 1MIUA 1JMCA 1ASYA 2CCZA 3E9IA 4POGA 4FDBA 2AWNA 4A3DH 1M90C 3TEHB 3J80c 1PH6A 3KOJA 1NE3A 2ALYB 4LF4Q 1Z47A 4X62Q 3CAMA 2JA8G 3I4MH 4KLKA 1W3SA 1A0IA 2IHFA 3CP0A 5GQOA 3I55A 2B3GA 4JYAQ 1S3OA 1DGSA 2CQOA 2UUBQ 1XPUA 3KDFB 5GAHC 2MNAA 3HFZB 4A3EH 1QZGA 1WOCA 1U5KA 1I6HH 5M5XH 3CQZH 1IYJB 2KENA 1GO3E 4R4IA 1WJJA 4C3HH 4GLXA 3RZDH 1XMOQ 2JA7H 4O0AA 3E9HA 1MJEA 1HNWL 1WYDA 4X64Q 3S1QH 1KHIA 1M1KC 4UY8C 4BY7H 1W2BA 1C7YA 1PYBA 1EQRA 3ULLA 3PO2H 1K73C 3DLLA 4DV4L 2IHEA 2PMZE 3S24A 2VUMG 2UUAQ 2VS1A 2VQFQ 3A5ZB 4YHHQ 4HIKA 1Q46A 2H5XA 3U4VA 3PUYA 5C4JH 1VQ7A 1L1OC 2WB1E 1PFSA 4H02A 5M3FH 3BJUA 3BZKA 1X55A 5M5YH 1VQEA 1MJCA 4Y52H 1X3FA 4X65L 1Q8KA 4LF7L 4L5TA 4HJ8A 3GTOH 5C44G 2E2IH 1VQ4A 2OQ0A 2PNHA 1VQNA 4K0KQ 1VQKA 1YNXA 4LF4L 4X62L 3EBEA 4LFCQ 4A3MH 4QIWE 4JI4Q 4R4OA 4JI3Q 4APVA 4HIMA 4JOIC 1N8RC 1E7ZA 1X3EA 2JA9A 4LF6Q 3AQQA 4JCVE 4B3TQ 4JYAL 4TVAB 2D0PA 1YIJA 3GDEA 2N78A 3UDFA 4IJLA 4JI0Q 4JG2A 1QVGA 4DUZQ 3H0GG 2WAQG 1CUKA 4LUZA 1QUQB 1YVCA 1XMOL 5LMNW 5IWAQ 4R1JA 4X64L 4BA2I 1N34Q 1TXYA 2UXCL 3HOUH 4R4QA 4C2MH 4J15A 3JAMi 3KDFA 4O2DA 5FJ8G 4P75A 2ZJRA 2A19A 2RF4A 4JI1Q 1XJVA 2UUCQ 1Q12A 1B7YB 3F2CA 1Q86C 5DLQE 2UUAL 3I4OA 2VQFL 3RZOH 1SE8A 4GKJQ 2R92H 4KHZA 1E22A 3SGIA 3IRBA 4YHHL 3RLOA 1KL9A 1EIFA 2I5LX 4UPAA 4DR3L 1G51A 1NBWA 3T1HQ 3M4QA 4DV5Q 3MXNB 1I94Q 2MFIA 4DR4Q 1Z9FA 5M5WH 3CCLA 3K80C 5GAGC 2VNUD 3BU2A 5IYDG 3K8AA 1KC8C 1NJIC 3I56A 1PH7A 2OTLA 4A3KH 2UXBQ 2VZAA 1Y1WG 1CKNA 2K75A 4K0KL 4DV6Q 4BBSG 1U0LA 4LFCL 1SN8A 4JI4L 2K52A 2BA0A 2AKWB 4JI3L 1KQSA 4JI8Q 1S72A 3UE1A 2E5LQ 1K3RA 2UU9L 4LF6L 3KF6A 2JA6G 4RG1A 1T9HA 3PIOA 4B3TL 2ATWA 4DNIA 3F2DA 3RN2A 1L1OA 3Q8DA 4UP8A 2N49A 5IT9c 1EUJA 4MTNA 1VQAA 3STBD 2VQEQ 1B70B 4DKAC 1K8AC 5AJ3Q 3FP9A 3PGZA 4JI0L 3K81C 4IFDJ 2D62A 3F8TA 3M4PA 3PIPA 3CC7A 2Q2IA 1GD7A 4KI0A 1X56A 5IWAL 2UXDQ 4UP7A 1OXSC 1N34L 4A3DG 2NVTH 4QJFA 2CWAA 5ELOA 2R7ZH 4A3FH 1D7QA 3I4MG 3S14H 4JI1L 1V1QA 2UUCL 1IBMQ 3CC4A 5J3BA 4GKJL 4DV4Q 1GKHA 4JOIA 5FLXc 2ZJQA 1X65A 3GO5A 1BBWA 4A3EG 3A74A 5M3MG 3J81i 3HOYG 3T1HL 2IX0A 3NENA 1E1TA 4DV5L 4HJAA 1UE1A 1QVCA 3WWVA 3OW2A 1I94L 1HZCA 4DR4L 1Q1EA 3RNUA 1YHQA 4JC0A 3S2DH 3S15H 2GVBA 1IBKQ 3KFUA 4LF7Q 2UXBL 4YWKA 4B3MQ 1IBLL 4L5SA 1N33Q 3PO2G 2NN6G 4A4IA 4DV6L 4L5QA 3CPWA 3AYHB 1HNXQ 1ASZA 2F52A 5IYBH 2E5LL 4JI8L 1OXTA 3RLFA 3M9BA 2LSSA 1OXUA 4NXNQ 1LM0A 1NY4A 1PH5A 1NMFA 1YHAA 1LYLA 1D8LA 3A0JA 2VQEL 1VQ9A 4XTCS 3HKZG 1Y1VH 3HOVH 2ZTCA 2PQAB 5AJ3L 1XNRQ 4A3GH 2N8NA 4DR2Q 3TS2A 2JQOA 4JI7Q 2MO0A 4DV0Q 2UXDL 2C35B 3I7FA 3W5OA 4QY7A 1SMXA 1XTDA 2UXCQ 2BH8A 1JT8A 1PH8A 1VQFA 3F1ZA 4PG3A 1KXLA 1RL2A 2AWOA 4A3JH 1IBML 1IXRA 3KJOA 3U58A 4NB3A 4YWMA 3J81j 2K5VA 3I2ZA 3CMAA 5IP9G 1PA6A 1PYSB 5C4XH 3M4OH 1Q81C 5JJLA 4A3BH 1TWCH 4HIOA 3PO3H 4JI5Q 3OTOL 4DR3Q 1A62A 3D31A 3J7ZC 4HIDA 3HOZH 2LXKA 1IBKL 4ALPA 2N3SA 4R4TA 2JA5H 1WCMH 5FLMH 4IPGA 4BBRH 1PH3A 4HJ5A 5IYCH 5C0XG 2R7DA 4B3ML 1N33L 4QGUA 4A3CH 2R93H 2WFWA 4NPSA 3M7NA 4OWTB 1P8LA 3CMEA 2YTXA 3L7ZC 1HNXL 2EQSA 3CCQA 1PV4A 4B3SL 4L5RC 3JC66 4NXNL 4BXXG 3PUVA 2JA8H 1A8VA 2UU9Q 1HR0L 1SFOH 2R7FA 1CKMA 5EAYA 5C0XJ 1K83H 1XMQQ 2JK8A 4MNOA 1C9OA 1XNRL 3K0XA 4QL5A 4DK6C 1E3PA 4DR2L 4GOPB 1TWFH 4JI7L 1V43A 3GTLH 3DM3A 1FGUA 1AE2A 4DV0L 2Q2UA 3GTPH 1NTGA 1JJCB 4AYBG 4A3KG 2E2HH 4LF5Q 4BY1H 4P72A 4YCUA 1CSPA 2CFMA 2K5HA 1IZ6A 4LWCA 3KJPA 3T1YQ 4DUYQ 1VQOA 3S17H 2MO1A 2WAQE 3J80i 1PHJA 2E2JH 2Q2HA 4LFAL 2RHQB 2FXQA 4HJ7A 1KRTA 4LNQA 1SROA 1FVIA 1K9MC 5IY0A 4XIGS 4KHPQ 4IPDA 1EYGA 4JI5L 1JB7A 4JBJA 2HQLA 4OWXB 1HNZQ 4NXMQ 3CCSA 1EQQA 2CWPA 2F3IA 3ULPA 5IP7H 4GS3A 3ULJA 1JJ2A 2IT1A 1O7IA 2NVYH 3L0OA 4AH6A 3NELA 1YJ9A 4A3FG 2R7ZG 1E1OA 2HHHL 3CF5A 1IBLQ 2XTIA 4GN3B 1VS0A 4A3LG 2CKZB 4DK3C 1MKHA 3FKIH 2HIXA 5H1SE 5C3EH 2Q2TA 2JEAI 2NVXH 1BBUA 2WP8J 4GNXB 2PI2A 3S1RH 3CCRA 1XMQL 1JJGA 1K0RA 1CKOA 2R6GA 2HT1A 4B3RQ 3K7UC 3OYYA 1YEZA 4LF8Q 2B63G 4P73A 3H3VI 1WI5A 1L0WA 1KRSA 1SLJA 4OXPA 4LF5L 1V9PA 2IX1A 4DR5Q 1VQGA 3RR5A 4OO1G 1BKBA 3CCMA 3AEVA 3G6EA 3TS0A 3T1YL 4DUYL 3KF8B 5IYBG 3H3VH 3KLWA 2Y0SG 4GKKL 4DR1Q 4IOCA 4PZ8A 1X54A 5FJ8H 4GOPA 1EWIA 1A63A 1QZHA 1QUQA 2NVQH 4KHPL 1Y1VG 2QEXA 4HJ9A 1HNZL 4NXML 3M85A 3GTGH 5JEAG 3G48A 3UDIA 3KYHC 3OTOQ 5LMNQ 4R4CA 4IO9A 4LF9L 3GTQH 2JA7G 3HOWH 4GLAC 1VQ8A 2VL6A 4AQYQ 3CXCA 1OXVA 4UP9A 4AIMA 4BY7G 3NEMA 2AMCB 3S16H 4IFDI 2ZTEA 2YYZA 1J6QA 4A3JG 1FJGQ 1N36Q 3RN5A 2NZHA 5JEAJ 4JI6Q 2PI2E 3S2HH 1Y1WH 3VDYA 1Y14B 1FL0A 1AH9A 1VQDA 1UEBA 4B3SQ 4IPHA 2A8VA 3TRZA 4A3BG 2HIVA 2DGYA 3ZJYC 2ZJPA 4A3IH 1HR0Q 3CCUA 4DPGA 4MZ9A 1LUZA 5M3FG 3S1MH 1UE7A 4B3RL 2KCMA 1Q1BA 4LF8L 5JJIA 4DV3Q 1HZBA 4X66L 4QQBX 2JA5G 1WCMG 2RHSB 4LUOA 5FLMG 1VQIA 1RIPA 3CCEA 4BBRG 3M3YH 4IOAA 3TREA 1E24A 4A3CG 2R93G 4DR5L 3HKZE 3PF4A 1HZAA 3STBC 1GM5A 1C0AA 1TWHH 2BH2A 2B29A 3JAMc 1WFQA 4A3MG 4DR1L 1NMGA 4YWLA 4LFAQ 1YJNA 1TWAH 4YY3Q 4A93H 4LFBQ 4JI2Q 1VQ5A 1XNQQ 1OXXK 3E0EA 1N9WA 4C3JH 3U50C 1VQLA 3EIVA 2I5MX 1VQHA 4X6AH 2QA4A 5M3MH 5BR8L 5LMNL 3HOYH 3GTMH 3I4NH 2I5HA 3W1GA 2NN6I 3HOXH 4AQYL 2JJQA 5HY6A 1G6PA 4BY1G 3F2BA 2F4VQ 1LTLA 4EX5A 1VQJA 1X6OA 3AFPA 3PUXA 4GLVB 3HOUG 3PV0A 1FJGL 1N36L 4GN5A 4OONA 2HHHQ 4JI6L 1BVSA 4DR7Q 3UDXA 1EOVA 4DV2Q 2KHIA 3G71A 2RCNA 2GN5A 3W1BA 1N32Q 2R92G 3L2PA 2WB1G 3D0FA 3ICEA 1AE3A 3CCVA 4GOPC 1K8GA 3CCJA 1J5EQ 3S1NH 2IY5B 3A5UA 5LMUQ 4WJ4A 1CKNB 1VQ6A 3PUZA 3ERSX 4DV3L 2DUDA 1XPOA 1GVPA 3UE0A 2AHOB 3AFQA 5IP7G 1PH4A 5GROA 3CPFA 1G291 2ZM6L 1SR3A 4DV1Q 1I3QH 2KHJA 3KF6B 4A75A 4JBMA 4OWWB 3GTKH 3TQYA 1PVOA 2EXDA 1L1OB 1XPRA 2Z6KC 4P74A 3G4SA 3FKIG 1CSQA 5C3EG 2PQAA 4OX9Q 3CC2A 4GKKQ 3CW2C 4AYBE 4Y7NH 4YY3L 4LUVA 2BA1A 4JI2L 1XNQL 4LFBL 4JV5Q 1UE5A 2VUMH 4P71A 5IP9H 1YITA 3J81c 4DAYB 4JBKA 2UUBL 2GVAA 2VY3A 1P16A 1KD1C 5C0XI 3PUWA 4LF9Q 3HKSA 1HH2P 1VQBA 1YZ6A 3GD7A 1Q7YC 4EQ5A 2F4VL 3LGJA 2V1CC 4DR6Q 3EN2A 2K14A 4GNXC 1X9NA 2JE6I 4DR7L 3FHWA 3CD6A 3H15A 1HZ9A 3ER0A 1SRUA 1B8AA 2D0OA 4DAMA 5C44H 4DV2L 1N32L 1VQCA 4GN4B 3RLNA 5HGQA 1J5EL 4BXXH 2OCEA 5LMUL 1TWGH 3PF5A 2YV5A 1Q82C 4YCWA 3HOWG 2YTYA 4JBWA 1VQMA 1HR0W 2K5NA 4X66Q 4DV1L 3PSIA 1VCIA 3MEFA 4DV7Q 2ASBA 2OWOA 3H0GH 1UE6A 1R9TH 4WJ3M 2ID0A 2E8GA 1X3GA 2ZTDA 3NBHB 1UWVA 4OX9L 3UDGA 4IFDG 1I5FA 4ME3A 3GTJH 4JV5L 4A3IG 2K50A 4POFA 5GADC 4IPCA 3HOVG 5IE8A 4YCVA 2Y0SE 4BA1I 2JEBI 1KAWA 4A3GG 1I50H 1VQPA 5BR8Q 2I0QA 2A1AA 4DUZL 2LXJA 1YI2A 2XGTA 1PH1A 1IL2A 4C3IH 2EIFA 3J7A5 4DR6L 1JE5A 1HNWQ 1YHBA 3BZCA 2MQHA 1QVFA 5IYDH 2Z6KA
chains in the Genus database with same CATH superfamily
3PMFA 1ZKOA 2HUGA 3B6YA 4CDEC 1FD7D 3K7AH 1HPCA 3NK9A 3PO3G 4IJHA 2Z0SA 2F0LA 1YBYA 3I4NG 1PDQA 4TQUS 4OO1I 3K0YA 3HOZG 1ICFB 5IGCA 1QOHA 5D3IB 1BBXC 3U4ZA 3W3AA 2ZM6Q 5IYCG 5JJKA 2PYKA 1ASYA 3C1EA 2DJFC 3E9IA 2NUCA 4LMQD 1M90C 2RBMA 3J80c 3KOJA 1A2UA 1NE3A 4X62Q 3CAMA 3K7AB 3J7YW 1W3SA 1RTOA 5GQOA 1X3QA 1B2TA 1S3OA 2CQOA 3T4AC 5GAHC 2MNAA 1QZGA 3H94A 3NBHA 1U5KA 4CJ2C 2KENA 2EYLA 3GQBA 1MJEA 4O42A 3S1QH 4BY7H 4UY8C 1M1KC 5CGKA 1PYBA 4MHEA 1OO9B 1EY9A 2NN6H 5I6WA 4DV4L 1A2TA 2F0QA 3A5ZB 4YHHQ 1Q46A 2F0OA 4NKLA 5CV8A 1PZKD 1STYA 2PW5A 1VQEA 1X3FA 4X65L 3R8BA 2B2WC 1U4PA 1IW7D 4DNRB 2OQ0A 2PNHA 3EJIA 1YNXA 4LF4L 4FXGC 4JI4Q 4JI3Q 2F0UA 4JOIC 5LL6X 2JA9A 5CV6A 1LTGD 2XWBB 4DU9A 2D0PA 2N78A 3HKZB 1VF5C 1SAPA 4IJLA 1QVGA 1Z6HA 3I70A 5NUCA 3RD4A 4DUZQ 1CUKA 4LUZA 1QUQB 1XMOL 1TXYA 5I2XA 1V1OA 3A7LA 3LWEA 3JAMi 1CQFA 1LABA 4Y7NB 2ZJRA 1JB3A 5HGTA 1Q86C 2NYZD 5DLQE 3I4OA 1SE8A 4KHZA 5DM73 1EIFA 1VDZA 3FEWX 5EBDA 3K80C 5GAGC 1MI2A 4EGVA 3R3OA 1PH7A 3CRKC 4EQOA 2N55A 1Y1WG 3VYUA 1U0LA 2BA0A 1KQSA 1WTHA 3UE1A 1W6KA 2UU9L 4LF6L 3A7AB 2A6EC 4DNIA 3VR6A 1JE4A 3F2DA 2VQEQ 1VQAA 4DKAC 1K8AC 2O4XA 3PGZA 4IFDJ 3CHBD 3CC7A 5DM63 1X56A 1Y8OB 5IWAL 2UXDQ 4UP7A 4KN4C 4A3DG 4NDXA 5ELOA 1I4XA 1D7QA 2F0DA 4JI1L 1V1QA 2RKSA 1F77A 1U4LA 1IBMQ 4IUVA 4GKJL 1GKHA 5FLXc 3FDTA 4NW2A 2JSOA 3T1HL 4HJAA 3G7LA 1UE1A 1QVCA 3OW2A 2NBFA 4XQNA 3GV3A 4YIJA 1IBKQ 4K8IA 1DOMA 2O2LD 3KFUA 4XT1B 3A55A 3NTHA 4LF7Q 2UXBL 2O5IC 3PO2G 4A4IA 4DV6L 5K5PA 4E6IA 1D2BA 2FMCA 4G57A 3CPWA 1ASZA 3A56A 1RDPD 4JI8L 1OXTA 4ZQ3A 3RLFA 2E5LL 4HAEA 4K2KA 4J8QA 1NMFA 1YHAA 1VQ9A 4XTCS 1BQQT 2LMCB 1WVLA 1WTRA 1G91A 4IURA 5JEAH 3TS2A 2E76C 3BG3A 5IGGA 4QMGA 4CKEA 3I7FA 4JVZA 3MFGA 1XTDA 2B8GA 2UXCQ 1JT8A 1D5ZC 1PH8A 4PG3A 1BCPB 3C3LA 2Y0SB 3KJOA 1I4GA 4NB3A 3J81j 4KD4A 5JPNC 2XRQD 3NWSA 1PA6A 2Z1CA 4G7OC 2RQXA 5JJLA 1MGSA 3U9OA 3PO3H 5EBCA 3J7ZC 4HIDA 3HOZH 4B9WA 1PRTB 1GUWA 1LT3D 2JA5H 1WCMH 1AZQA 2M00A 5IYCH 2X69A 2R7DA 5C0XG 4B3ML 4QGUA 1N33L 4NPSA 1FNUA 2YTXA 1HNXL 2F0SA 1ZEQX 2QKIC 2Z4HA 1HR0L 5EAYA 3PO3B 5D65A 1XMQQ 2EY1A 2JK8A 2VB3X 1EU3A 4GOPB 2JA5B 1V43A 1WCMB 1CZGA 4OIJA 3J81L 1NTGA 3IL8A 4AYBG 4YCUA 1S5FD 1E2VA 3KJPA 3S17H 1PYWD 2MO1A 3J80i 2E2JH 4LFAL 1VMPA 2FXQA 4HJ7A 1HQRD 4HMIA 5IY0A 4XQQA 2AUJD 4IPDA 1JB7A 2HQLA 5EKLA 5A2QL 3IFTA 4GS3A 4ABNA 1JJ2A 2IT1A 1O7IA 2NVYH 4AH6A 5IGEA 1YJ9A 3S17B 4A3FG 3HOUB 1IBLQ 5D14A 2XTIA 1EOTA 2L11A 2KJXA 2E2JB 3FKIH 1TR5A 1WTPA 5H1SE 2JEAI 1BCPF 4OHJA 2WP8J 1G2SA 3S1RH 1B3AA 3DUZA 2EYOA 1K0RA 4ZUJA 3EFXD 2R3ZA 2R6GA 3SE0A 3TN2A 2HT1A 3K7UC 2A68C 1YEZA 2B63G 3SK4A 3D6CA 3OIQA 2NVYB 1J9OA 3RR5A 1PRTF 2DN8A 1QG7A 3TS0A 5CORA 1PRTD 3T1YL 3FKIB 3HP3A 5IT9E 1Q3LA 3KLWA 3PQIA 4DR1Q 1QJOA 4GOPA 3S1RB 4KJNA 2EZVA 2DNEA 4LAAA 2QEXA 4HJ9A 4NXML 2EYFA 3UDIA 4IO9A 2EYPA 4LF9L 1GOZA 4H44C 4AQYQ 2B2UA 1OXVA 2CHBD 2AMCB 2ZTEA 1J6QA 3OSOA 2NZHA 2I07B 3S2HH 2NB0A 1Y1WH 1Y14B 1FL0A 1AH9A 4TSSA 1VQDA 2A8VA 3ZJYC 2ZJPA 4KKSA 5M3FG 1H9SB 4LF8L 4DV3Q 1HZBA 5JJIA 2EYJA 4DK0A 1SJHD 5FLMG 1KNAA 2F0GA 3FVQA 3J80E 4IOAA 2R93G 1EYCA 1C0AA 3S2HB 4S3SA 2X6GA 1STBA 3E0JA 3MHBA 1G6ZA 1TWAH 3QR8A 4A93H 1N9WA 1JOQA 2BDOA 3K5OA 4HTHA 3PIO3 1CA5A 4X6AH 1ESRA 5LMNL 1F9PA 3W1GA 2NN6I 3AB9A 4N8FA 3H09A 3F2BA 5EGTA 3TSSA 1C8CA 1LTLA 3KLSA 4EX5A 3PUXA 1RTNA 1N36L 4OONA 1QNUA 2HHHQ 1BVSA 1SBBB 2KHIA 3NXWA 1TWAB 4A93B 2R92G 4GZYC 3D0FA 1PZID 5C4XB 1LLRD 3W2DA 2F0KA 1J5EQ 1SE3A 4KTAA 2NZ1D 3A5UA 1CKNB 1IYVA 1RODA 1V1PB 3CPFA 1G291 2G9DA 1PVOA 1B1ZA 1ZXTA 1R4PB 3G4SA 1CSQA 2A6ED 3VA5A 2PQAA 4P2CB 1B9NA 1XTCD 2BA1A 4JI2L 1XNQL 2VUMH 3UI2A 1YITA 5BN5A 3J81c 3MXPA 2MHVA 1PTOC 1I4HA 1KD1C 1TWFB 1SE4A 1VQBA 1YZ6A 1Q7YC 2F4VL 3EN2A 2KEEA 1EWCA 2M9VA 5CYUA 1KAAA 3CD6A 5C0XH 2RVLA 1SRUA 5C44H 1HFGA 3BDCA 1VQCA 3RLNA 2VUMB 2OCEA 4DXGA 3HOWG 5FO9B 4DV1L 4J1MA 1EY5A 4K6LA 1O80A 1UE6A 4IQZA 2E8GA 3R93A 4KY7A 2FINB 4IUTA 5C44B 4OX9L 4UAIA 2NVXB 1SMYC 4FNFA 3GTJH 5CBEE 4IPCA 3HOVG 4DK1A 3ONAB 2JEBI 3K59A 4A3GG 1T5XD 2I0QA 1SNCA 1YI2A 2EIFA 2K5DA 3J7A5 1NNXA 5FLXE 1CZWA 1YHBA 1QVFA 2Z6KA 3DEOA 1XYIA 3GTJB 4BBSH 1T5EA 2L15A 4C3JG 1JQYD 2JA6H 5GAEC 3OMGA 1L2FA 1G8ZD 2KCTA 4LW1A 1KIXA 1TKWB 1HJPA 2SNMA 2NZOA 4DFAA 2B63H 1JR0D 3SHLA 4X65Q 4M8AA 1MIUA 1JMCA 2CCZA 2EJMA 4POGA 3I4LA 4BBSB 2Z6BA 4WJWA 4LF4Q 1Z47A 2WIIB 2JA6B 3KBXA 3DHQA 3OHXC 2B3GA 2B2YA 3KDFB 2PCFB 3QO2A 3KF8A 1DONA 5E1FA 1I6HH 5M5XH 1HA5A 1H9JA 4R4IA 3RZDH 1XMOQ 3E9HA 1WYDA 2WINB 1L0XB 2D2CC 2L4NA 1K73C 3DLLA 1BO0A 4IUQA 5IIFA 2VS1A 4RKLA 3WOEA 1GUNA 3PUYA 2Q8RE 1DZ1A 3DMUA 5M3MB 1EQVA 2WB1E 5M3FH 1MHWC 1I6HB 5M5XB 1X55A 2MP1A 3RZDB 1SJED 2E2IH 2MPMA 1VQ4A 1E2WA 1R4QB 2D9UA 3D4WA 2A68D 4APVA 1N8RC 1X3EA 4LF6Q 3AQQA 4JYAL 1YIJA 1JICA 1KTKA 4FXDA 1AW7A 4J6HA 3H0GG 1K8MA 2WAQG 1YVCA 5IWAQ 2E2IB 4BA2I 1PTOH 2OF1A 4IUPA 3NHHA 3KDFA 5ELBA 2L9HA 4P75A 4JI1Q 1XJVA 1Q12A 2F0PA 1NR2A 2UUAL 4GKJQ 5KIXA 2R92H 3HG9A 1DCZA 1KL9A 2F0EA 4UPAA 5L37A 1BR9A 1NBWA 4DR3L 3T1HQ 1GUGA 3E3XA 5CV9A 1NAPA 3CCLA 2SEBD 4K6DA 3MEHA 1ILQA 3BU2A 1NJIC 2OTLA 4A3KH 2UXBQ 2VZAA 1EIHA 5E4WC 4K0KL 4DV6Q 1KNEA 2B2VA 3V96A 2EOTA 2E5LQ 4JI8Q 3NWTA 3CU7A 3E6ZX 4RG1A 4B3TL 5BN4A 2QF7A 3RN2A 1L1OA 4UP8A 5IT9c 1EUJA 5FO7B 1E2ZA 3SR1A 1GD7A 4A3KB 4N9PA 1F2ZA 1N34L 3SDZA 2R7ZH 2CW0D 3I4MG 2G9HD 3FMCA 2UUCL 3CKIB 2VXWA 2ZJQA 1X65A 3GO5A 2XVSA 4A3EG 1GJXA 3J81i 3HOYG 2IX0A 2HCCA 1E1TA 4FF3A 1I94L 2RDGA 5CC4A 1HZCA 3GP7A 3RNUA 3S2DH 1IKLA 5G3LF 4B9XA 5G3LD 3D3RA 4B3MQ 4L5SA 1N33Q 2R7ZB 2EYMA 5ISRA 1K28A 4IUUA 1HNXQ 4ILWA 1A15A 2F52A 5IYBH 4KN7C 4RFBA 2LSSA 1GUSA 3X3NA 4UHVA 1TS5A 1PH5A 1D8LA 4OL7A 3DWAA 5DAUA 1Y1VH 3HOVH 3E5SA 1RKNA 4A3GH 3S2DB 4RHSA 2MO0A 1WD0A 2HDLA 2K04A 4OELB 3DWPA 4QY7A 1SMXA 1PLFA 2BH8A 1PTOF 1VQFA 1KXLA 2AWOA 1PTOD 3U58A 2PZTA 3OIPA 3TP8A 2K5VA 3D4DA 3CMAA 5IP9G 5FO8B 1Q81C 1Y1VB 4HIOA 1LV9A 3D31A 5F2DA 2HD3A 2IW3A 5KYIA 2N3SA 3S1QB 4BY7B 4A3CH 2WFWA 1AEXA 3F2UA 4ZUIA 3C1FA 4EQNA 4QB4A 4B3SL 3JC66 2F0NA 3P20A 4NXNL 1U4RA 1STGA 1O7LA 4BS9A 5KNCA 5C0XJ 1C9OA 3K0XA 4QL5A 1JOKA 4ID6A 4DK6C 4DR2L 4JI7L 2L5TA 3GTLH 3KLSX 3DM3A 2EJFC 1AE2A 4DV0L 1SMYD 4X3SA 2Q2UA 2B2UC 2BCOA 4P72A 1CSPA 2CFMA 2K5HA 1IZ6A 2F0IA 4C56C 3T1YQ 2EXZA 3J81E 1LTID 5E3FA 2K7VA 2EPBA 4WORA 1FVIA 4KY5A 1STEA 4JI5L 4NXMQ 3GTLB 2WACA 4C3IG 2F3IA 5IP7H 5A2QE 2QEJC 3AU7A 2L0CA 1VS0A 2A6HC 2XIWA 2IL8A 4F88A 2F1MA 2WB1B 1S4ZA 4GNXB 1EEFD 1EQTA 3CCRA 1JJGA 1EEID 1XWEA 4LF8Q 4P73A 3H3VI 2PQEA 3Q24A 1KRSA 1SLJA 3D6WA 1V9PA 2IX1A 4OO1G 1IYUA 1BKBA 2PO4A 3G6EA 4K2LA 4RGOS 2IPKD 4GKKL 4HEDA 1IKMA 1EWIA 3MC0B 1QUQA 3M7GA 2ENBA 1F2MA 1I6VC 2F0WA 1XX8A 3GTGH 3OTOQ 3G48A 5LMNQ 4R4CA 4C3HG 2JA7G 2VL6A 4IFDI 3S16H 3K5LA 4A3JG 1N36Q 1KDAA 2PI2E 2XN9C 2ZXRA 2K33A 4JK1C 1HUNA 1F9QA 1LT6D 4A3BG 4ZKBB 4A3IH 3GTGB 1S5DD 3TBIB 3R2IA 1C48A 1HQMC 4QQBX 1CT1D 2RHSB 5AFWA 4BBRG 1EZ8A 1E24A 3S16B 4R9WA 4DR5L 1SNMA 1HZAA 4RGMA 5C5LA 4G7HC 3FRPB 1S5ED 2B29A 1EU4A 5JAVA 4JI2Q 1XNQQ 4A3IB 1OXXK 3E0EA 3EIVA 2I5MX 4FXKC 1VQHA 2QA4A 5BR8L 3HOYH 3GTMH 3I4NH 3KK7A 2NTSA 4HCEA 2I5HA 2BE5C 2JJQA 3OOCA 5HY6A 4BY1G 1G6PA 2F4VQ 2KA7A 3PIP3 1X6OA 1FJGL 1F2LA 3G71A 2GN5A 3ICEA 1AE3A 4MN3A 3ERSX 4KK7A 3GTMB 3I4NB 1FGBD 2JN4A 3HOZB 2AHOB 2ZM6L 1SR3A 4DV1Q 1I3QH 3KF6B 3MXGA 4HSVA 4JBMA 4OWWB 2F0FA 2Z6KC 5C3EG 4OX9Q 1SNPA 4AYBE 4YY3L 5IP9H 2E74C 4DAYB 1ILPA 1I3QB 3HKSA 1IL8A 1D1KA 2F3WA 1UUPA 2EY5A 3LGJA 2V1CC 2JE6I 4DR7L 4U673 2K5QA 3FHWA 3H15A 2PNRC 4DV2L 1B8AA 1HUMA 2WKDA 3I8ZA 4ZLTF 3AMUA 1NCVA 5LMUL 2YV5A 1Q82C 2B2YC 4YCWA 4RCOA 3TP6A 3MFYA 4ZRZA 4JBWA 2F0TA 4X66Q 3PSIA 1VCIA 2ASBA 3HRZC 1LT5D 1R9TH 1FNWA 1B53A 4C1NI 2E2DC 1EY4A 4KKUA 4CJ0B 4IFDG 4ME3A 4PMBA 1DYQA 4NMZA 4POFA 1LO5D 4PNYA 5IE8A 4B08A 1F9RA 4YCVA 3NTKA 2J4XA 4KY6A 3H3VC 4DUZL 4TRDA 3A8IE 4C3IH 1R9TB 2B2WA 2RSOA 1O7YA 3QB3A 5ELNA 3I91A 4PMWA 1HHVA 4HMJA 1JCKB 3TP5A 2K1BA 2PW7A 3NBIA 1EIYB 3QJYA 2VW9A 1EY6A 4K8JA 3TP7A 4QUCA 2J0TD 4BWGB 4RMFA 1PH9A 1OTCA 2YTVA 1CFMA 3HOXG 5K36G 4RWSC 5KYLA 4DV7L 4C3IB 4PZ6A 3MWYW 3NUCA 1H95A 2A73B 4KV6A 2ES2A 2OTJA 4OO1H 1Y1WB 3IFDA 4A3DH 3K57A 1PH6A 1FNVA 3A8JE 2JA8G 5CMDA 1STHA 1A0IA 2IHFA 1TS4A 2Q8IB 3I55A 4JYAQ 4RHRA 1DGSA 2UUBQ 4DAVA 2IJ0A 1EL0A 1HTLD 5I6YA 4C3HH 1IYJB 2JA7H 1WJJA 3NP8A 4CHTB 5FK9C 2IWHA 1KHIA 3BYTB 4A3DB 3NQTA 1PFBA 1A6XA 1EQRA 3PO2H 2F0VA 3K6OA 2B2VC 4FO2A 1K8OA 1D1IA 2IHEA 2PMZE 2KEDA 2UUAQ 2B2TA 4HIKA 1M4VA 1O78A 4IALA 3U4VA 2A69C 1VQ7A 4QUFA 1L1OC 1SNDA 2HDMA 1PFSA 4H02A 3BJUA 2FJ2A 3BZKA 1I4QA 3P1HA 5JPMC 2A6HD 1VMCA 4C3HB 4RCNA 3Q6SA 1RHPA 1CHPD 4HR7B 5ELFA 1Q8KA 4LF7L 4L5TA 4HJ8A 4V190 1FYCA 1F2YA 3LNNA 4FF2A 3PO2B 1VQNA 3RMHA 3I73A 4X3TA 4K0KQ 1H9SA 2EVBA 3EBEA 4OIKA 1E7ZA 4B3TQ 4TVAB 3GDEA 2SNSA 4DNTB 2X6LA 3BVMA 4JG2A 3SK5A 3SEBA 5EPJA 4R1JA 4X64L 3KBGA 1N34Q 3QWNA 2UXCL 3BYYB 2A5HA 4R4QA 4J15A 4O2DA 5FJ8G 4F7XA 2UUCQ 1FR3A 3F2CA 1B7YB 5COYA 3RZOH 2VQFL 2CH4W 1E22A 1DM0B 1ONLA 3RLOA 4JPBW 3VR5A 1G51A 2AQ3B 2FFKB 3M4QA 4RH6A 3MXNB 5JVH3 1I94Q 2L1BA 2MFIA 3H91A 1PFNA 1SYEA 2XRSD 2VNUD 5IYDG 1HA6A 4RKBA 4KJOA 1KC8C 3I56A 1U9RA 1DJRD 1XXGA 1CKNA 2K75A 1KLUD 3I3CA 1V1PA 4LFCL 4H13C 2K52A 1S72A 4KKTA 2NWGA 1GUOA 3PIOA 5IGFA 2ATWA 3Q8DA 1QILA 3FP9A 4JI0L 3M4PA 1Y8PB 3MXUA 2Q2IA 4KI0A 5EKIA 4AYBB 2NVTH 2CWAA 2H1EA 4A3FH 2B8FA 3FPUB 5J3BA 4DV4Q 2BE5D 1BBWA 2N88A 4DV5L 3CRLC 5CV4A 2K5WA 3WWVA 4ZYSA 4DR4L 1YHQA 2EE1A 4K5WA 3FPPA 3QIAA 3HZXA 4XQJA 2NVTB 4NP5A 1IBLL 4A3FB 2OEOA 2NN6G 3T56B 2CVRA 2LFNA 3MXNA 1HTPA 5EPLA 4NXNQ 1PMRA 1LM0A 1LYLA 5TSSA 4ZAIA 3HKZG 4R8NA 5AJ3L 2B63B 1H9KA 2EJGC 4DR2Q 2JQOA 2D5DA 4JI7Q 3BVGA 4DV0Q 2EYHA 2C35B 4PMCA 4O1NA 4KHVA 1I4RA 4XYQA 2RDHA 3W5OA 2I46A 5KGUA 1H9RA 4OEMB 3Q23A 3I2ZA 1PYSB 2PPBC 4PQXA 1F9SA 4CGYB 1TWCH 4JI5Q 1A62A 3N52A 4X3KA 5KEEA 2LXKA 4ALPA 4R4TA 5A35A 4IPGA 3TDQA 5FLMH 2R93H 2Z4IA 2DJGC 3CCQA 1PV4A 4L5RC 4BXXG 3PUVA 1ET6A 2JA8H 1A8VA 2UU9Q 1CKMA 1K83H 1TWCB 5M3FB 1KLGD 4MNOA 1XNRL 4ODGA 1FGUA 1K0SA 5JOBA 1JJCB 2R93B 3A54A 1NSNS 1LACA 5KRUA 3VR2A 4FF4A 2WAQE 2J7ZA 2Q2HA 2BOSA 1DXMA 3L3OC 1STAA 1SROA 2K6AA 5ELDA 1EYGA 4OWXB 1RJTA 1EQQA 1ENCA 2CWPA 2KUMA 3ULPA 1SDFA 2AQ2B 1TU2B 1PTOB 2PMZB 3NELA 2HHHL 4A3LG 4GN3B 2CKZB 1MKHA 1SYCA 2Q2TA 3EROA 2R92B 1B3QA 1BBUA 4TKOB 1EYDA 3DWQA 5E4XA 4I65A 1CKOA 1VF7A 4OGQC 1WI5A 4OXPA 4EVOA 4LF5L 4DR5Q 3AEVA 3NE5B 5IGBA 4K14A 4DUYL 2Y0SG 1WTXA 4PZ8A 5FJ8H 1A63A 3ITPA 1QZHA 2NVQH 4KHPL 1HXYD 4RA8A 1BUVT 1HNZL 2FMMA 5JEAG 3HOWH 3KUPA 5JJZA 5FOBB 4GLAC 1VQ8A 4AIMA 3NEMA 1FJGQ 3RN5A 2A69D 3URYA 3VDYA 4G4KA 5C3WA 3QOJA 1UEBA 5BN3A 2EDGA 4IPHA 3IAYA 2NVQB 1HR0Q 3U9SA 3CCUA 4DPGA 1UE7A 2CH4A 2KCMA 3HOWB 1Q1BA 4B3RL 2Z8LA 2JA5G 1WCMG 1BCPC 4LUOA 1VQIA 1EYAA 3STBC 1QE6A 3NTIA 1TWHH 2B39A 3J7AV 1TY2A 1WFQA 3OPOA 4A3MG 1LT4D 1NMGA 4YWLA 4LFAQ 4YY3Q 2QILA 1VQ5A 3OWEB 1PRTC 3GV6A 4C3JH 3U50C 3P75A 1VQLA 3J7AF 3HOVB 3T53B 2F3VA 3SK8A 4A3GB 1STNA 5I9PA 4GLVB 1TWHB 3HOUG 3PV0A 4GN5A 4DR7Q 4JI6L 5J39A 2TMPA 1JWMD 3TMEA 1EOVA 4DV2Q 3G6JB 5C6AA 2MJ8A 3L2PA 5LHY1 3CCVA 2IY5B 4C3JB 4GOPC 3CCJA 1EY7A 1K8GA 3S1NH 5LMUQ 2XWJB 4WJ4A 2V4DA 1U4MA 1ZYRC 4QF4A 1I4PA 2TSSA 2DUDA 1GVPA 3AFQA 1PH4A 5GROA 4A75A 3MA2B 4XYOA 3GTKH 1A3VA 1DOLA 2EXDA 1XPRA 2EY6A 3FKIG 4CDDC 4DAPA 1CI3M 3CW2C 4Y7NH 4ZCKA 3S1NB 4LUVA 4LFBL 3WOFA 4P71A 2VY3A 3Q0AA 1P16A 2K01A 3PUWA 5C0XI 4LF9Q 1HH2P 3GD7A 3GTKB 4EQ5A 2K14A 5ELCA 2P5ZX 5C4ZA 1TVXA 1HZ9A 3ER0A 4DAMA 2O5JC 3M4YA 2QDLA 1N32L 5CBAE 4HN7A 5HGQA 5FKAC 4UDUC 4BXXH 1TWGH 2K28A 3BZDB 1A3UA 3PF5A 2F4IA 1VQMA 1HR0W 5CV5A 3TZUA 4DV7Q 2OWOA 4C1NK 1QB5D 3H0GH 4WJ3M 1X3GA 1SXTA 4CDCC 1UWVA 4KD3A 3UDGA 4FYDA 3O13A 5KNDA 4JV5L 1TWGB 2K50A 5GADC 2KOLA 1CM9A 1A3TA 2B2TC 2PZUA 3V05A 4BA1I 1KAWA 1I50H 1VQPA 1AP0A 1GXDC 3K5MA 1PFMA 2LXJA 4CDFC 1CK1A 2XGTA 3H0GB 2WAQB 1PH1A 1SYDA 1IL2A 4DR6L 1JE5A 1WTWA 2QCPX 3VR4A 3BZCA 3L0OA 4X3UA 3S14H 2EY2A 2HCIA 1BF4A 1EFWA 2QGQA 1YJWA 4A3LH 4A93G 3PCOB 4PZ7A 5C4XG 4DGZA 1Q8IA 4CKCA 5E7NA 2QDBA 2K4KA 1S40A 1TT2A 3QG1A 1I50B 3BVZA 1SYBA 4I7ZC 4CBVA 4A76A 1TY0A 2KCCA 2YU9H 1PH2A 2KBNA 3N6RA 2OQKA 4PV1C 4GNXA 3S14B 4FDBA 4XXEA 2AWNA 3TEHB 1BXTA 2ALYB 3I4MH 3BS1A 4F8MA 4KLKA 2XSCA 3MVVA 4V0BA 3CP0A 1EY0A 1XPUA 4A3EH 3HFZB 2GA4B 2MUYA 2YU9B 3JAME 1WOCA 1J8IA 2OXPA 3CQZH 1GO3E 2ZXOA 4GLXA 3DEPA 1HNWL 4O0AA 1RD9D 4X64Q 1W2BA 1C7YA 3A8KE 1QCBD 3ULLA 3I4MB 5JVG3 1CHQD 3S24A 2VUMG 1II3A 2VQFQ 1ET9A 3VR3A 2H5XA 3IKJA 2MGSA 5C4JH 3MAQA 4A3EB 3HOYB 1B50A 3CQZB 5M5YH 3Q22A 1MJCA 4Y52H 4Q5VA 2DY7A 3LX0A 3GTOH 5C44G 1O7ZA 5IOCA 1W6JA 1VQKA 4LFCQ 4X62L 1EWHA 3X3MA 4A3MH 4QIWE 4R4OA 3K5NA 4HIMA 1S5BD 4ZKCB 4JCVE 5C4JB 3UDFA 1X3PA 3KLRA 4RGNA 2LKVA 5M5YB 4JI0Q 3DM1A 4CJ1B 4F87A 5LMNW 3GTOB 4KMUC 5M9OA 1JWUD 3HOUH 4C2MH 2C5CA 4A3MB 2A19A 2RF4A 2IX3A 1YNJC 4YHHL 3SGIA 3IRBA 5T1IA 5LL6S 1AN8A 4IUNA 2I5LX 2NTTA 4DV5Q 1MSHA 4DR4Q 1Z9FA 5M5WH 3H6MA 1JC7A 3K8AA 1EY8A 4C2MB 3I72A 2XNAC 4BBSG 1M8AA 1SN8A 4JI4L 4JI3L 2AKWB 2JA6G 1K3RA 3KF6A 4JW0A 1BCPD 1T9HA 2KHSA 2WV6D 5CV7A 1MD2D 2N49A 4MTNA 3STBD 2KCNA 1B70B 5D3DA 5AJ3Q 4I7AA 4L6TB 3T51B 5M5WB 3K81C 2D62A 5KNBA 3F8TA 3P7JA 3PIPA 3NSWA 2A74C 2KECA 1UNSA 3ND8A 1OXSC 1V8QA 4QJFA 5I4DA 4DAYA 4DF7A 1YNNC 2E75C 1C4QA 1DD2A 3CC4A 4JOIA 3OMCA 3HGBA 3A74A 5M3MG 3NENA 3S9WA 2ICEC 3VA7A 1Q1EA 1EFID 4K5VA 3S15H 2GVBA 4Z9CB 2BDNA 4YWKA 4L63B 1RF2D 1ZYRD 4L5QA 3AYHB 1Q90A 3M9BA 1OXUA 1NY4A 1HCZA 1TS3A 3JAML 1UEAB 3A0JA 2VQEL 2ZTCA 2PQAB 1B9MA 2DY8A 5EPKA 4L8JA 1XNRQ 3S15B 2N8NA 3K58A 1JORA 2UXDL 4DXFA 1LTBD 5C5MA 3WDNA 3F1ZA 1RL2A 4A3JH 4XDXA 1IBML 1IXRA 4YWMA 2K03A 1CQVA 4RAUC 5C4XH 1WD1A 3M4OH 2CW0C 3EVQA 4A3BH 3OTOL 4DR3Q 3L9AX 2JA7B 1IBKL 1GHKA 4ME5A 4BBRH 1PH3A 4HJ5A 3V2TA 4LK1C 2LS01 3M7NA 4OWTB 4HSPA 4A3JB 1P8LA 3C46A 3CMEA 3L7ZC 5EJWA 2EQSA 1LTSD 2AUKA 3M4OB 1SFOH 2R7FA 4A3BB 1LTRD 1L0YB 4G7ZC 1E3PA 1JOOA 1LTAD 2DNCA 1X32A 1TWFH 2RCFA 1QWYA 3MZ5A 4BBRB 3LWUA 4A3KG 4LF5Q 2E2HH 3GTPH 4BY1H 4LWCA 1VQOA 1Z7TA 4DUYQ 1TS2A 1KABA 1PHJA 1TIID 2RHQB 1PZJD 4XT3B 1KRTA 1QNKA 1SFOB 2WKCA 4LNQA 1SYFA 2F03A 1E0BA 2OT2A 1K9MC 2KVMA 4XIGS 3SXHA 4KHPQ 3VYTA 2K05A 4JBJA 1HNZQ 5EQ0A 3CCSA 5J22A 3GTPB 2VB2X 2E2HB 3QOLA 3ULJA 4BY1B 3DXJC 2R7ZG 1E1OA 4FVMA 3CF5A 4DK3C 2HIXA 3RZOB 5C4HA 5C3EH 1ICWA 4H7BA 3NQIA 4N8X1 2NVXH 1Y69U 1GUTA 2PI2A 1IW7C 2Z9HA 5J1ZA 3ND9A 1XMQL 4FP5D 1ESFA 2K32A 2ZXPA 4B3RQ 3OYYA 3ZYYX 4WRDA 1L0WA 2HQEA 5IT9L 2F0JA 1VQGA 2AQ1B 4QIWB 3CCMA 3KF8B 4Q0FA 5IYBG 1ML0D 3H3VH 5C3EB 4EQPA 4IOCA 5ELEA 1X54A 1AZPA 4R8IA 3EQLC 5HURA 1Y1VG 2SOBA 4IN3A 1ENFA 2SDFA 3M85A 4U68A 3KYHC 3GTQH 1KDBA 3OWFA 3CXCA 4UP9A 4BY7G 2YYZA 1NR4A 1Y8NB 1D5MC 4JI6Q 5JEAJ 2H4OA 1WTOA 3HS0C 4B3SQ 4IFDH 3TRZA 2F0HA 2HIVA 2DGYA 3RUZA 3SVMA 4MZ9A 1LUZA 3J80L 3S1MH 5DEHA 3BDOA 4K5XA 3GTQB 1SNQA 4X66L 5CR3A 1PXUA 1HFNA 3M3YH 1RIPA 3CCEA 3TREA 4A3CG 2RDFA 1B44D 3HKZE 3PF4A 1GM5A 4FF1A 4QCLA 1KDCA 2BH2A 4MIUA 1AFPA 3JAMc 3HEJA 1WTQA 3D4RA 4DR1L 5EKKA 1YJNA 4LFBQ 1SNOA 4M1UB 3I90A 3S1MB 1SEBD 3SK6A 1GHJA 5M3MH 3M3YB 1G2TA 1RCVD 3HOXH 4AQYL 1SSOA 5K36H 1D6EC 1H9MA 1VQJA 3AFPA 2G5DA 1YNJD 1B4OA 3OW7A 3UDXA 1DOKA 2RCNA 3W1BA 2RSNA 1EIGA 1N32Q 2WB1G 3C2PA 2JXMB 2FHTA 1VQ6A 2L55A 3PUZA 4DV3L 1XPOA 3NPPA 2ZT9C 2KQ3A 3UE0A 5IP7G 2F0MA 3HOXB 3R2TA 1MBYA 2KHJA 3TQYA 4CKBA 4IZ8A 1L1OB 4H0LC 4ULLA 4P74A 3BDLA 3MTSA 1NUCA 5IODA 4LJZC 3CC2A 4GKKQ 5DNFA 2JA8B 3D8GA 2C9OA 3TZDA 4JV5Q 1UE5A 1K83B 2Q8TA 4JBKA 4RGTA 2R61A 4N9TA 2UUBL 2GVAA 1S5CD 1YNND 2JP1A 1IHZA 1UAPA 5T1GA 1EZ6A 3VYRA 4DR6Q 4ZK9B 4GNXC 2PZWA 1X9NA 3ERQA 4DN4M 4MTKA 1CTMA 1JWSD 2D0OA 1SE2A 1BDOA 1WTVA 4GN4B 3EA6A 3T16A 1J5EL 5I2YA 1CA6A 1SYGA 2QW7A 5I9OA 2ICIA 2YTYA 1BNZA 2LY7A 2K5NA 4HCSA 2CQAA 3MEFA 4DA2A 2ID0A 2RA4A 1TQOA 2ZTDA 3VYSA 1D5XC 2L12A 3NBHB 4WFN3 1ENAA 1I5FA 1MSGA 5C3XA 4A3IG 2JYOA 1BOSA 2Y0SE 1K3BC 5IGDA 5BR8Q 1HRJA 5FLXL 2A1AA 2M2LA 1LTTD 3T13A 1HNWQ 4JC0A 2MQHA 5IYDH
chains in the Genus database with same CATH topology
5ELNA 1EFWA 2QGQA 4PMWA 1YJWA 4A3LH 3B6YA 4A93G 3PCOB 4BBSH 4PZ7A 5C4XG 1EIYB 2L15A 3K7AH 5E7NA 2VW9A 2JA6H 5GAEC 2K4KA 4IJHA 1S40A 1L2FA 4LW1A 2KCTA 2Z0SA 1KIXA 3PO3G 4RMFA 1PH9A 1YBYA 1OTCA 3I4NG 4TQUS 4OO1I 2YTVA 3HOZG 3HOXG 4A76A 2YU9H 3U4ZA 5K36G 1PH2A 1HJPA 4DV7L 2NZOA 2ZM6Q 4PZ6A 2KBNA 2B63H 5IYCG 1H95A 2OQKA 4GNXA 5JJKA 4X65Q 2ES2A 2OTJA 1MIUA 1JMCA 1ASYA 2CCZA 3E9IA 4POGA 4FDBA 2AWNA 4A3DH 1M90C 3TEHB 3J80c 1PH6A 3KOJA 1NE3A 2ALYB 4LF4Q 1Z47A 4X62Q 3CAMA 2JA8G 3I4MH 4KLKA 1W3SA 1A0IA 2IHFA 3CP0A 5GQOA 3I55A 2B3GA 4JYAQ 1S3OA 1DGSA 2CQOA 2UUBQ 1XPUA 3KDFB 5GAHC 2MNAA 3HFZB 4A3EH 1QZGA 1WOCA 1U5KA 1I6HH 5M5XH 3CQZH 1IYJB 2KENA 1GO3E 4R4IA 1WJJA 4C3HH 4GLXA 3RZDH 1XMOQ 2JA7H 4O0AA 3E9HA 1MJEA 1HNWL 1WYDA 4X64Q 3S1QH 1KHIA 1M1KC 4UY8C 4BY7H 1W2BA 1C7YA 1PYBA 1EQRA 3ULLA 3PO2H 1K73C 3DLLA 4DV4L 2IHEA 2PMZE 3S24A 2VUMG 2UUAQ 2VS1A 2VQFQ 3A5ZB 4YHHQ 4HIKA 1Q46A 2H5XA 3U4VA 3PUYA 5C4JH 1VQ7A 1L1OC 2WB1E 1PFSA 4H02A 5M3FH 3BJUA 3BZKA 1X55A 5M5YH 1VQEA 1MJCA 4Y52H 1X3FA 4X65L 1Q8KA 4LF7L 4L5TA 4HJ8A 3GTOH 5C44G 2E2IH 1VQ4A 2OQ0A 2PNHA 1VQNA 4K0KQ 1VQKA 1YNXA 4LF4L 4X62L 3EBEA 4LFCQ 4A3MH 4QIWE 4JI4Q 4R4OA 4JI3Q 4APVA 4HIMA 4JOIC 1N8RC 1E7ZA 1X3EA 2JA9A 4LF6Q 3AQQA 4JCVE 4B3TQ 4JYAL 4TVAB 2D0PA 1YIJA 3GDEA 2N78A 3UDFA 4IJLA 4JI0Q 4JG2A 1QVGA 4DUZQ 3H0GG 2WAQG 1CUKA 4LUZA 1QUQB 1YVCA 1XMOL 5LMNW 5IWAQ 4R1JA 4X64L 4BA2I 1N34Q 1TXYA 2UXCL 3HOUH 4R4QA 4C2MH 4J15A 3JAMi 3KDFA 4O2DA 5FJ8G 4P75A 2ZJRA 2A19A 2RF4A 4JI1Q 1XJVA 2UUCQ 1Q12A 1B7YB 3F2CA 1Q86C 5DLQE 2UUAL 3I4OA 2VQFL 3RZOH 1SE8A 4GKJQ 2R92H 4KHZA 1E22A 3SGIA 3IRBA 4YHHL 3RLOA 1KL9A 1EIFA 2I5LX 4UPAA 4DR3L 1G51A 1NBWA 3T1HQ 3M4QA 4DV5Q 3MXNB 1I94Q 2MFIA 4DR4Q 1Z9FA 5M5WH 3CCLA 3K80C 5GAGC 2VNUD 3BU2A 5IYDG 3K8AA 1KC8C 1NJIC 3I56A 1PH7A 2OTLA 4A3KH 2UXBQ 2VZAA 1Y1WG 1CKNA 2K75A 4K0KL 4DV6Q 4BBSG 1U0LA 4LFCL 1SN8A 4JI4L 2K52A 2BA0A 2AKWB 4JI3L 1KQSA 4JI8Q 1S72A 3UE1A 2E5LQ 1K3RA 2UU9L 4LF6L 3KF6A 2JA6G 4RG1A 1T9HA 3PIOA 4B3TL 2ATWA 4DNIA 3F2DA 3RN2A 1L1OA 3Q8DA 4UP8A 2N49A 5IT9c 1EUJA 4MTNA 1VQAA 3STBD 2VQEQ 1B70B 4DKAC 1K8AC 5AJ3Q 3FP9A 3PGZA 4JI0L 3K81C 4IFDJ 2D62A 3F8TA 3M4PA 3PIPA 3CC7A 2Q2IA 1GD7A 4KI0A 1X56A 5IWAL 2UXDQ 4UP7A 1OXSC 1N34L 4A3DG 2NVTH 4QJFA 2CWAA 5ELOA 2R7ZH 4A3FH 1D7QA 3I4MG 3S14H 4JI1L 1V1QA 2UUCL 1IBMQ 3CC4A 5J3BA 4GKJL 4DV4Q 1GKHA 4JOIA 5FLXc 2ZJQA 1X65A 3GO5A 1BBWA 4A3EG 3A74A 5M3MG 3J81i 3HOYG 3T1HL 2IX0A 3NENA 1E1TA 4DV5L 4HJAA 1UE1A 1QVCA 3WWVA 3OW2A 1I94L 1HZCA 4DR4L 1Q1EA 3RNUA 1YHQA 4JC0A 3S2DH 3S15H 2GVBA 1IBKQ 3KFUA 4LF7Q 2UXBL 4YWKA 4B3MQ 1IBLL 4L5SA 1N33Q 3PO2G 2NN6G 4A4IA 4DV6L 4L5QA 3CPWA 3AYHB 1HNXQ 1ASZA 2F52A 5IYBH 2E5LL 4JI8L 1OXTA 3RLFA 3M9BA 2LSSA 1OXUA 4NXNQ 1LM0A 1NY4A 1PH5A 1NMFA 1YHAA 1LYLA 1D8LA 3A0JA 2VQEL 1VQ9A 4XTCS 3HKZG 1Y1VH 3HOVH 2ZTCA 2PQAB 5AJ3L 1XNRQ 4A3GH 2N8NA 4DR2Q 3TS2A 2JQOA 4JI7Q 2MO0A 4DV0Q 2UXDL 2C35B 3I7FA 3W5OA 4QY7A 1SMXA 1XTDA 2UXCQ 2BH8A 1JT8A 1PH8A 1VQFA 3F1ZA 4PG3A 1KXLA 1RL2A 2AWOA 4A3JH 1IBML 1IXRA 3KJOA 3U58A 4NB3A 4YWMA 3J81j 2K5VA 3I2ZA 3CMAA 5IP9G 1PA6A 1PYSB 5C4XH 3M4OH 1Q81C 5JJLA 4A3BH 1TWCH 4HIOA 3PO3H 4JI5Q 3OTOL 4DR3Q 1A62A 3D31A 3J7ZC 4HIDA 3HOZH 2LXKA 1IBKL 4ALPA 2N3SA 4R4TA 2JA5H 1WCMH 5FLMH 4IPGA 4BBRH 1PH3A 4HJ5A 5IYCH 5C0XG 2R7DA 4B3ML 1N33L 4QGUA 4A3CH 2R93H 2WFWA 4NPSA 3M7NA 4OWTB 1P8LA 3CMEA 2YTXA 3L7ZC 1HNXL 2EQSA 3CCQA 1PV4A 4B3SL 4L5RC 3JC66 4NXNL 4BXXG 3PUVA 2JA8H 1A8VA 2UU9Q 1HR0L 1SFOH 2R7FA 1CKMA 5EAYA 5C0XJ 1K83H 1XMQQ 2JK8A 4MNOA 1C9OA 1XNRL 3K0XA 4QL5A 4DK6C 1E3PA 4DR2L 4GOPB 1TWFH 4JI7L 1V43A 3GTLH 3DM3A 1FGUA 1AE2A 4DV0L 2Q2UA 3GTPH 1NTGA 1JJCB 4AYBG 4A3KG 2E2HH 4LF5Q 4BY1H 4P72A 4YCUA 1CSPA 2CFMA 2K5HA 1IZ6A 4LWCA 3KJPA 3T1YQ 4DUYQ 1VQOA 3S17H 2MO1A 2WAQE 3J80i 1PHJA 2E2JH 2Q2HA 4LFAL 2RHQB 2FXQA 4HJ7A 1KRTA 4LNQA 1SROA 1FVIA 1K9MC 5IY0A 4XIGS 4KHPQ 4IPDA 1EYGA 4JI5L 1JB7A 4JBJA 2HQLA 4OWXB 1HNZQ 4NXMQ 3CCSA 1EQQA 2CWPA 2F3IA 3ULPA 5IP7H 4GS3A 3ULJA 1JJ2A 2IT1A 1O7IA 2NVYH 3L0OA 4AH6A 3NELA 1YJ9A 4A3FG 2R7ZG 1E1OA 2HHHL 3CF5A 1IBLQ 2XTIA 4GN3B 1VS0A 4A3LG 2CKZB 4DK3C 1MKHA 3FKIH 2HIXA 5H1SE 5C3EH 2Q2TA 2JEAI 2NVXH 1BBUA 2WP8J 4GNXB 2PI2A 3S1RH 3CCRA 1XMQL 1JJGA 1K0RA 1CKOA 2R6GA 2HT1A 4B3RQ 3K7UC 3OYYA 1YEZA 4LF8Q 2B63G 4P73A 3H3VI 1WI5A 1L0WA 1KRSA 1SLJA 4OXPA 4LF5L 1V9PA 2IX1A 4DR5Q 1VQGA 3RR5A 4OO1G 1BKBA 3CCMA 3AEVA 3G6EA 3TS0A 3T1YL 4DUYL 3KF8B 5IYBG 3H3VH 3KLWA 2Y0SG 4GKKL 4DR1Q 4IOCA 4PZ8A 1X54A 5FJ8H 4GOPA 1EWIA 1A63A 1QZHA 1QUQA 2NVQH 4KHPL 1Y1VG 2QEXA 4HJ9A 1HNZL 4NXML 3M85A 3GTGH 5JEAG 3G48A 3UDIA 3KYHC 3OTOQ 5LMNQ 4R4CA 4IO9A 4LF9L 3GTQH 2JA7G 3HOWH 4GLAC 1VQ8A 2VL6A 4AQYQ 3CXCA 1OXVA 4UP9A 4AIMA 4BY7G 3NEMA 2AMCB 3S16H 4IFDI 2ZTEA 2YYZA 1J6QA 4A3JG 1FJGQ 1N36Q 3RN5A 2NZHA 5JEAJ 4JI6Q 2PI2E 3S2HH 1Y1WH 3VDYA 1Y14B 1FL0A 1AH9A 1VQDA 1UEBA 4B3SQ 4IPHA 2A8VA 3TRZA 4A3BG 2HIVA 2DGYA 3ZJYC 2ZJPA 4A3IH 1HR0Q 3CCUA 4DPGA 4MZ9A 1LUZA 5M3FG 3S1MH 1UE7A 4B3RL 2KCMA 1Q1BA 4LF8L 5JJIA 4DV3Q 1HZBA 4X66L 4QQBX 2JA5G 1WCMG 2RHSB 4LUOA 5FLMG 1VQIA 1RIPA 3CCEA 4BBRG 3M3YH 4IOAA 3TREA 1E24A 4A3CG 2R93G 4DR5L 3HKZE 3PF4A 1HZAA 3STBC 1GM5A 1C0AA 1TWHH 2BH2A 2B29A 3JAMc 1WFQA 4A3MG 4DR1L 1NMGA 4YWLA 4LFAQ 1YJNA 1TWAH 4YY3Q 4A93H 4LFBQ 4JI2Q 1VQ5A 1XNQQ 1OXXK 3E0EA 1N9WA 4C3JH 3U50C 1VQLA 3EIVA 2I5MX 1VQHA 4X6AH 2QA4A 5M3MH 5BR8L 5LMNL 3HOYH 3GTMH 3I4NH 2I5HA 3W1GA 2NN6I 3HOXH 4AQYL 2JJQA 5HY6A 1G6PA 4BY1G 3F2BA 2F4VQ 1LTLA 4EX5A 1VQJA 1X6OA 3AFPA 3PUXA 4GLVB 3HOUG 3PV0A 1FJGL 1N36L 4GN5A 4OONA 2HHHQ 4JI6L 1BVSA 4DR7Q 3UDXA 1EOVA 4DV2Q 2KHIA 3G71A 2RCNA 2GN5A 3W1BA 1N32Q 2R92G 3L2PA 2WB1G 3D0FA 3ICEA 1AE3A 3CCVA 4GOPC 1K8GA 3CCJA 1J5EQ 3S1NH 2IY5B 3A5UA 5LMUQ 4WJ4A 1CKNB 1VQ6A 3PUZA 3ERSX 4DV3L 2DUDA 1XPOA 1GVPA 3UE0A 2AHOB 3AFQA 5IP7G 1PH4A 5GROA 3CPFA 1G291 2ZM6L 1SR3A 4DV1Q 1I3QH 2KHJA 3KF6B 4A75A 4JBMA 4OWWB 3GTKH 3TQYA 1PVOA 2EXDA 1L1OB 1XPRA 2Z6KC 4P74A 3G4SA 3FKIG 1CSQA 5C3EG 2PQAA 4OX9Q 3CC2A 4GKKQ 3CW2C 4AYBE 4Y7NH 4YY3L 4LUVA 2BA1A 4JI2L 1XNQL 4LFBL 4JV5Q 1UE5A 2VUMH 4P71A 5IP9H 1YITA 3J81c 4DAYB 4JBKA 2UUBL 2GVAA 2VY3A 1P16A 1KD1C 5C0XI 3PUWA 4LF9Q 3HKSA 1HH2P 1VQBA 1YZ6A 3GD7A 1Q7YC 4EQ5A 2F4VL 3LGJA 2V1CC 4DR6Q 3EN2A 2K14A 4GNXC 1X9NA 2JE6I 4DR7L 3FHWA 3CD6A 3H15A 1HZ9A 3ER0A 1SRUA 1B8AA 2D0OA 4DAMA 5C44H 4DV2L 1N32L 1VQCA 4GN4B 3RLNA 5HGQA 1J5EL 4BXXH 2OCEA 5LMUL 1TWGH 3PF5A 2YV5A 1Q82C 4YCWA 3HOWG 2YTYA 4JBWA 1VQMA 1HR0W 2K5NA 4X66Q 4DV1L 3PSIA 1VCIA 3MEFA 4DV7Q 2ASBA 2OWOA 3H0GH 1UE6A 1R9TH 4WJ3M 2ID0A 2E8GA 1X3GA 2ZTDA 3NBHB 1UWVA 4OX9L 3UDGA 4IFDG 1I5FA 4ME3A 3GTJH 4JV5L 4A3IG 2K50A 4POFA 5GADC 4IPCA 3HOVG 5IE8A 4YCVA 2Y0SE 4BA1I 2JEBI 1KAWA 4A3GG 1I50H 1VQPA 5BR8Q 2I0QA 2A1AA 4DUZL 2LXJA 1YI2A 2XGTA 1PH1A 1IL2A 4C3IH 2EIFA 3J7A5 4DR6L 1JE5A 1HNWQ 1YHBA 3BZCA 2MQHA 1QVFA 5IYDH 2Z6KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ELN A;  1EFW A;  2QGQ A;  4PMW A;  1YJW A;  4A3L H;  3B6Y A;  4A93 G;  3PCO B;  4BBS H;  4PZ7 A;  5C4X G;  1EIY B;  2L15 A;  3K7A H;  5E7N A;  2VW9 A;  2JA6 H;  5GAE C;  2K4K A;  4IJH A;  1S40 A;  1L2F A;  4LW1 A;  2KCT A;  2Z0S A;  1KIX A;  3PO3 G;  4RMF A;  1PH9 A;  1YBY A;  1OTC A;  3I4N G;  4TQU S;  4OO1 I;  2YTV A;  3HOZ G;  3HOX G;  4A76 A;  2YU9 H;  3U4Z A;  5K36 G;  1PH2 A;  1HJP A;  4DV7 L;  2NZO A;  2ZM6 Q;  4PZ6 A;  2KBN A;  2B63 H;  5IYC G;  1H95 A;  2OQK A;  4GNX A;  5JJK A;  4X65 Q;  2ES2 A;  2OTJ A;  1MIU A;  1JMC A;  1ASY A;  2CCZ A;  3E9I A;  4POG A;  4FDB A;  2AWN A;  4A3D H;  1M90 C;  3TEH B;  3J80 c;  1PH6 A;  3KOJ A;  1NE3 A;  2ALY B;  4LF4 Q;  1Z47 A;  4X62 Q;  3CAM A;  2JA8 G;  3I4M H;  4KLK A;  1W3S A;  1A0I A;  2IHF A;  3CP0 A;  5GQO A;  3I55 A;  2B3G A;  4JYA Q;  1S3O A;  1DGS A;  2CQO A;  2UUB Q;  1XPU A;  3KDF B;  5GAH C;  2MNA A;  3HFZ B;  4A3E H;  1QZG A;  1WOC A;  1U5K A;  1I6H H;  5M5X H;  3CQZ H;  1IYJ B;  2KEN A;  1GO3 E;  4R4I A;  1WJJ A;  4C3H H;  4GLX A;  3RZD H;  1XMO Q;  2JA7 H;  4O0A A;  3E9H A;  1MJE A;  1HNW L;  1WYD A;  4X64 Q;  3S1Q H;  1KHI A;  1M1K C;  4UY8 C;  4BY7 H;  1W2B A;  1C7Y A;  1PYB A;  1EQR A;  3ULL A;  3PO2 H;  1K73 C;  3DLL A;  4DV4 L;  2IHE A;  2PMZ E;  3S24 A;  2VUM G;  2UUA Q;  2VS1 A;  2VQF Q;  3A5Z B;  4YHH Q;  4HIK A;  1Q46 A;  2H5X A;  3U4V A;  3PUY A;  5C4J H;  1VQ7 A;  1L1O C;  2WB1 E;  1PFS A;  4H02 A;  5M3F H;  3BJU A;  3BZK A;  1X55 A;  5M5Y H;  1VQE A;  1MJC A;  4Y52 H;  1X3F A;  4X65 L;  1Q8K A;  4LF7 L;  4L5T A;  4HJ8 A;  3GTO H;  5C44 G;  2E2I H;  1VQ4 A;  2OQ0 A;  2PNH A;  1VQN A;  4K0K Q;  1VQK A;  1YNX A;  4LF4 L;  4X62 L;  3EBE A;  4LFC Q;  4A3M H;  4QIW E;  4JI4 Q;  4R4O A;  4JI3 Q;  4APV A;  4HIM A;  4JOI C;  1N8R C;  1E7Z A;  1X3E A;  2JA9 A;  4LF6 Q;  3AQQ A;  4JCV E;  4B3T Q;  4JYA L;  4TVA B;  2D0P A;  1YIJ A;  3GDE A;  2N78 A;  3UDF A;  4IJL A;  4JI0 Q;  4JG2 A;  1QVG A;  4DUZ Q;  3H0G G;  2WAQ G;  1CUK A;  4LUZ A;  1QUQ B;  1YVC A;  1XMO L;  5LMN W;  5IWA Q;  4R1J A;  4X64 L;  4BA2 I;  1N34 Q;  1TXY A;  2UXC L;  3HOU H;  4R4Q A;  4C2M H;  4J15 A;  3JAM i;  3KDF A;  4O2D A;  5FJ8 G;  4P75 A;  2ZJR A;  2A19 A;  2RF4 A;  4JI1 Q;  1XJV A;  2UUC Q;  1Q12 A;  1B7Y B;  3F2C A;  1Q86 C;  5DLQ E;  2UUA L;  3I4O A;  2VQF L;  3RZO H;  1SE8 A;  4GKJ Q;  2R92 H;  4KHZ A;  1E22 A;  3SGI A;  3IRB A;  4YHH L;  3RLO A;  1KL9 A;  1EIF A;  2I5L X;  4UPA A;  4DR3 L;  1G51 A;  1NBW A;  3T1H Q;  3M4Q A;  4DV5 Q;  3MXN B;  1I94 Q;  2MFI A;  4DR4 Q;  1Z9F A;  5M5W H;  3CCL A;  3K80 C;  5GAG C;  2VNU D;  3BU2 A;  5IYD G;  3K8A A;  1KC8 C;  1NJI C;  3I56 A;  1PH7 A;  2OTL A;  4A3K H;  2UXB Q;  2VZA A;  1Y1W G;  1CKN A;  2K75 A;  4K0K L;  4DV6 Q;  4BBS G;  1U0L A;  4LFC L;  1SN8 A;  4JI4 L;  2K52 A;  2BA0 A;  2AKW B;  4JI3 L;  1KQS A;  4JI8 Q;  1S72 A;  3UE1 A;  2E5L Q;  1K3R A;  2UU9 L;  4LF6 L;  3KF6 A;  2JA6 G;  4RG1 A;  1T9H A;  3PIO A;  4B3T L;  2ATW A;  4DNI A;  3F2D A;  3RN2 A;  1L1O A;  3Q8D A;  4UP8 A;  2N49 A;  5IT9 c;  1EUJ A;  4MTN A;  1VQA A;  3STB D;  2VQE Q;  1B70 B;  4DKA C;  1K8A C;  5AJ3 Q;  3FP9 A;  3PGZ A;  4JI0 L;  3K81 C;  4IFD J;  2D62 A;  3F8T A;  3M4P A;  3PIP A;  3CC7 A;  2Q2I A;  1GD7 A;  4KI0 A;  1X56 A;  5IWA L;  2UXD Q;  4UP7 A;  1OXS C;  1N34 L;  4A3D G;  2NVT H;  4QJF A;  2CWA A;  5ELO A;  2R7Z H;  4A3F H;  1D7Q A;  3I4M G;  3S14 H;  4JI1 L;  1V1Q A;  2UUC L;  1IBM Q;  3CC4 A;  5J3B A;  4GKJ L;  4DV4 Q;  1GKH A;  4JOI A;  5FLX c;  2ZJQ A;  1X65 A;  3GO5 A;  1BBW A;  4A3E G;  3A74 A;  5M3M G;  3J81 i;  3HOY G;  3T1H L;  2IX0 A;  3NEN A;  1E1T A;  4DV5 L;  4HJA A;  1UE1 A;  1QVC A;  3WWV A;  3OW2 A;  1I94 L;  1HZC A;  4DR4 L;  1Q1E A;  3RNU A;  1YHQ A;  4JC0 A;  3S2D H;  3S15 H;  2GVB A;  1IBK Q;  3KFU A;  4LF7 Q;  2UXB L;  4YWK A;  4B3M Q;  1IBL L;  4L5S A;  1N33 Q;  3PO2 G;  2NN6 G;  4A4I A;  4DV6 L;  4L5Q A;  3CPW A;  3AYH B;  1HNX Q;  1ASZ A;  2F52 A;  5IYB H;  2E5L L;  4JI8 L;  1OXT A;  3RLF A;  3M9B A;  2LSS A;  1OXU A;  4NXN Q;  1LM0 A;  1NY4 A;  1PH5 A;  1NMF A;  1YHA A;  1LYL A;  1D8L A;  3A0J A;  2VQE L;  1VQ9 A;  4XTC S;  3HKZ G;  1Y1V H;  3HOV H;  2ZTC A;  2PQA B;  5AJ3 L;  1XNR Q;  4A3G H;  2N8N A;  4DR2 Q;  3TS2 A;  2JQO A;  4JI7 Q;  2MO0 A;  4DV0 Q;  2UXD L;  2C35 B;  3I7F A;  3W5O A;  4QY7 A;  1SMX A;  1XTD A;  2UXC Q;  2BH8 A;  1JT8 A;  1PH8 A;  1VQF A;  3F1Z A;  4PG3 A;  1KXL A;  1RL2 A;  2AWO A;  4A3J H;  1IBM L;  1IXR A;  3KJO A;  3U58 A;  4NB3 A;  4YWM A;  3J81 j;  2K5V A;  3I2Z A;  3CMA A;  5IP9 G;  1PA6 A;  1PYS B;  5C4X H;  3M4O H;  1Q81 C;  5JJL A;  4A3B H;  1TWC H;  4HIO A;  3PO3 H;  4JI5 Q;  3OTO L;  4DR3 Q;  1A62 A;  3D31 A;  3J7Z C;  4HID A;  3HOZ H;  2LXK A;  1IBK L;  4ALP A;  2N3S A;  4R4T A;  2JA5 H;  1WCM H;  5FLM H;  4IPG A;  4BBR H;  1PH3 A;  4HJ5 A;  5IYC H;  5C0X G;  2R7D A;  4B3M L;  1N33 L;  4QGU A;  4A3C H;  2R93 H;  2WFW A;  4NPS A;  3M7N A;  4OWT B;  1P8L A;  3CME A;  2YTX A;  3L7Z C;  1HNX L;  2EQS A;  3CCQ A;  1PV4 A;  4B3S L;  4L5R C;  3JC6 6;  4NXN L;  4BXX G;  3PUV A;  2JA8 H;  1A8V A;  2UU9 Q;  1HR0 L;  1SFO H;  2R7F A;  1CKM A;  5EAY A;  5C0X J;  1K83 H;  1XMQ Q;  2JK8 A;  4MNO A;  1C9O A;  1XNR L;  3K0X A;  4QL5 A;  4DK6 C;  1E3P A;  4DR2 L;  4GOP B;  1TWF H;  4JI7 L;  1V43 A;  3GTL H;  3DM3 A;  1FGU A;  1AE2 A;  4DV0 L;  2Q2U A;  3GTP H;  1NTG A;  1JJC B;  4AYB G;  4A3K G;  2E2H H;  4LF5 Q;  4BY1 H;  4P72 A;  4YCU A;  1CSP A;  2CFM A;  2K5H A;  1IZ6 A;  4LWC A;  3KJP A;  3T1Y Q;  4DUY Q;  1VQO A;  3S17 H;  2MO1 A;  2WAQ E;  3J80 i;  1PHJ A;  2E2J H;  2Q2H A;  4LFA L;  2RHQ B;  2FXQ A;  4HJ7 A;  1KRT A;  4LNQ A;  1SRO A;  1FVI A;  1K9M C;  5IY0 A;  4XIG S;  4KHP Q;  4IPD A;  1EYG A;  4JI5 L;  1JB7 A;  4JBJ A;  2HQL A;  4OWX B;  1HNZ Q;  4NXM Q;  3CCS A;  1EQQ A;  2CWP A;  2F3I A;  3ULP A;  5IP7 H;  4GS3 A;  3ULJ A;  1JJ2 A;  2IT1 A;  1O7I A;  2NVY H;  3L0O A;  4AH6 A;  3NEL A;  1YJ9 A;  4A3F G;  2R7Z G;  1E1O A;  2HHH L;  3CF5 A;  1IBL Q;  2XTI A;  4GN3 B;  1VS0 A;  4A3L G;  2CKZ B;  4DK3 C;  1MKH A;  3FKI H;  2HIX A;  5H1S E;  5C3E H;  2Q2T A;  2JEA I;  2NVX H;  1BBU A;  2WP8 J;  4GNX B;  2PI2 A;  3S1R H;  3CCR A;  1XMQ L;  1JJG A;  1K0R A;  1CKO A;  2R6G A;  2HT1 A;  4B3R Q;  3K7U C;  3OYY A;  1YEZ A;  4LF8 Q;  2B63 G;  4P73 A;  3H3V I;  1WI5 A;  1L0W A;  1KRS A;  1SLJ A;  4OXP A;  4LF5 L;  1V9P A;  2IX1 A;  4DR5 Q;  1VQG A;  3RR5 A;  4OO1 G;  1BKB A;  3CCM A;  3AEV A;  3G6E A;  3TS0 A;  3T1Y L;  4DUY L;  3KF8 B;  5IYB G;  3H3V H;  3KLW A;  2Y0S G;  4GKK L;  4DR1 Q;  4IOC A;  4PZ8 A;  1X54 A;  5FJ8 H;  4GOP A;  1EWI A;  1A63 A;  1QZH A;  1QUQ A;  2NVQ H;  4KHP L;  1Y1V G;  2QEX A;  4HJ9 A;  1HNZ L;  4NXM L;  3M85 A;  3GTG H;  5JEA G;  3G48 A;  3UDI A;  3KYH C;  3OTO Q;  5LMN Q;  4R4C A;  4IO9 A;  4LF9 L;  3GTQ H;  2JA7 G;  3HOW H;  4GLA C;  1VQ8 A;  2VL6 A;  4AQY Q;  3CXC A;  1OXV A;  4UP9 A;  4AIM A;  4BY7 G;  3NEM A;  2AMC B;  3S16 H;  4IFD I;  2ZTE A;  2YYZ A;  1J6Q A;  4A3J G;  1FJG Q;  1N36 Q;  3RN5 A;  2NZH A;  5JEA J;  4JI6 Q;  2PI2 E;  3S2H H;  1Y1W H;  3VDY A;  1Y14 B;  1FL0 A;  1AH9 A;  1VQD A;  1UEB A;  4B3S Q;  4IPH A;  2A8V A;  3TRZ A;  4A3B G;  2HIV A;  2DGY A;  3ZJY C;  2ZJP A;  4A3I H;  1HR0 Q;  3CCU A;  4DPG A;  4MZ9 A;  1LUZ A;  5M3F G;  3S1M H;  1UE7 A;  4B3R L;  2KCM A;  1Q1B A;  4LF8 L;  5JJI A;  4DV3 Q;  1HZB A;  4X66 L;  4QQB X;  2JA5 G;  1WCM G;  2RHS B;  4LUO A;  5FLM G;  1VQI A;  1RIP A;  3CCE A;  4BBR G;  3M3Y H;  4IOA A;  3TRE A;  1E24 A;  4A3C G;  2R93 G;  4DR5 L;  3HKZ E;  3PF4 A;  1HZA A;  3STB C;  1GM5 A;  1C0A A;  1TWH H;  2BH2 A;  2B29 A;  3JAM c;  1WFQ A;  4A3M G;  4DR1 L;  1NMG A;  4YWL A;  4LFA Q;  1YJN A;  1TWA H;  4YY3 Q;  4A93 H;  4LFB Q;  4JI2 Q;  1VQ5 A;  1XNQ Q;  1OXX K;  3E0E A;  1N9W A;  4C3J H;  3U50 C;  1VQL A;  3EIV A;  2I5M X;  1VQH A;  4X6A H;  2QA4 A;  5M3M H;  5BR8 L;  5LMN L;  3HOY H;  3GTM H;  3I4N H;  2I5H A;  3W1G A;  2NN6 I;  3HOX H;  4AQY L;  2JJQ A;  5HY6 A;  1G6P A;  4BY1 G;  3F2B A;  2F4V Q;  1LTL A;  4EX5 A;  1VQJ A;  1X6O A;  3AFP A;  3PUX A;  4GLV B;  3HOU G;  3PV0 A;  1FJG L;  1N36 L;  4GN5 A;  4OON A;  2HHH Q;  4JI6 L;  1BVS A;  4DR7 Q;  3UDX A;  1EOV A;  4DV2 Q;  2KHI A;  3G71 A;  2RCN A;  2GN5 A;  3W1B A;  1N32 Q;  2R92 G;  3L2P A;  2WB1 G;  3D0F A;  3ICE A;  1AE3 A;  3CCV A;  4GOP C;  1K8G A;  3CCJ A;  1J5E Q;  3S1N H;  2IY5 B;  3A5U A;  5LMU Q;  4WJ4 A;  1CKN B;  1VQ6 A;  3PUZ A;  3ERS X;  4DV3 L;  2DUD A;  1XPO A;  1GVP A;  3UE0 A;  2AHO B;  3AFQ A;  5IP7 G;  1PH4 A;  5GRO A;  3CPF A;  1G29 1;  2ZM6 L;  1SR3 A;  4DV1 Q;  1I3Q H;  2KHJ A;  3KF6 B;  4A75 A;  4JBM A;  4OWW B;  3GTK H;  3TQY A;  1PVO A;  2EXD A;  1L1O B;  1XPR A;  2Z6K C;  4P74 A;  3G4S A;  3FKI G;  1CSQ A;  5C3E G;  2PQA A;  4OX9 Q;  3CC2 A;  4GKK Q;  3CW2 C;  4AYB E;  4Y7N H;  4YY3 L;  4LUV A;  2BA1 A;  4JI2 L;  1XNQ L;  4LFB L;  4JV5 Q;  1UE5 A;  2VUM H;  4P71 A;  5IP9 H;  1YIT A;  3J81 c;  4DAY B;  4JBK A;  2UUB L;  2GVA A;  2VY3 A;  1P16 A;  1KD1 C;  5C0X I;  3PUW A;  4LF9 Q;  3HKS A;  1HH2 P;  1VQB A;  1YZ6 A;  3GD7 A;  1Q7Y C;  4EQ5 A;  2F4V L;  3LGJ A;  2V1C C;  4DR6 Q;  3EN2 A;  2K14 A;  4GNX C;  1X9N A;  2JE6 I;  4DR7 L;  3FHW A;  3CD6 A;  3H15 A;  1HZ9 A;  3ER0 A;  1SRU A;  1B8A A;  2D0O A;  4DAM A;  5C44 H;  4DV2 L;  1N32 L;  1VQC A;  4GN4 B;  3RLN A;  5HGQ A;  1J5E L;  4BXX H;  2OCE A;  5LMU L;  1TWG H;  3PF5 A;  2YV5 A;  1Q82 C;  4YCW A;  3HOW G;  2YTY A;  4JBW A;  1VQM A;  1HR0 W;  2K5N A;  4X66 Q;  4DV1 L;  3PSI A;  1VCI A;  3MEF A;  4DV7 Q;  2ASB A;  2OWO A;  3H0G H;  1UE6 A;  1R9T H;  4WJ3 M;  2ID0 A;  2E8G A;  1X3G A;  2ZTD A;  3NBH B;  1UWV A;  4OX9 L;  3UDG A;  4IFD G;  1I5F A;  4ME3 A;  3GTJ H;  4JV5 L;  4A3I G;  2K50 A;  4POF A;  5GAD C;  4IPC A;  3HOV G;  5IE8 A;  4YCV A;  2Y0S E;  4BA1 I;  2JEB I;  1KAW A;  4A3G G;  1I50 H;  1VQP A;  5BR8 Q;  2I0Q A;  2A1A A;  4DUZ L;  2LXJ A;  1YI2 A;  2XGT A;  1PH1 A;  1IL2 A;  4C3I H;  2EIF A;  3J7A 5;  4DR6 L;  1JE5 A;  1HNW Q;  1YHB A;  3BZC A;  2MQH A;  1QVF A;  5IYD H;  2Z6K A; 
#chains in the Genus database with same CATH topology
 3PMF A;  1ZKO A;  2HUG A;  3B6Y A;  4CDE C;  1FD7 D;  3K7A H;  1HPC A;  3NK9 A;  3PO3 G;  4IJH A;  2Z0S A;  2F0L A;  1YBY A;  3I4N G;  1PDQ A;  4TQU S;  4OO1 I;  3K0Y A;  3HOZ G;  1ICF B;  5IGC A;  1QOH A;  5D3I B;  1BBX C;  3U4Z A;  3W3A A;  2ZM6 Q;  5IYC G;  5JJK A;  2PYK A;  1ASY A;  3C1E A;  2DJF C;  3E9I A;  2NUC A;  4LMQ D;  1M90 C;  2RBM A;  3J80 c;  3KOJ A;  1A2U A;  1NE3 A;  4X62 Q;  3CAM A;  3K7A B;  3J7Y W;  1W3S A;  1RTO A;  5GQO A;  1X3Q A;  1B2T A;  1S3O A;  2CQO A;  3T4A C;  5GAH C;  2MNA A;  1QZG A;  3H94 A;  3NBH A;  1U5K A;  4CJ2 C;  2KEN A;  2EYL A;  3GQB A;  1MJE A;  4O42 A;  3S1Q H;  4BY7 H;  4UY8 C;  1M1K C;  5CGK A;  1PYB A;  4MHE A;  1OO9 B;  1EY9 A;  2NN6 H;  5I6W A;  4DV4 L;  1A2T A;  2F0Q A;  3A5Z B;  4YHH Q;  1Q46 A;  2F0O A;  4NKL A;  5CV8 A;  1PZK D;  1STY A;  2PW5 A;  1VQE A;  1X3F A;  4X65 L;  3R8B A;  2B2W C;  1U4P A;  1IW7 D;  4DNR B;  2OQ0 A;  2PNH A;  3EJI A;  1YNX A;  4LF4 L;  4FXG C;  4JI4 Q;  4JI3 Q;  2F0U A;  4JOI C;  5LL6 X;  2JA9 A;  5CV6 A;  1LTG D;  2XWB B;  4DU9 A;  2D0P A;  2N78 A;  3HKZ B;  1VF5 C;  1SAP A;  4IJL A;  1QVG A;  1Z6H A;  3I70 A;  5NUC A;  3RD4 A;  4DUZ Q;  1CUK A;  4LUZ A;  1QUQ B;  1XMO L;  1TXY A;  5I2X A;  1V1O A;  3A7L A;  3LWE A;  3JAM i;  1CQF A;  1LAB A;  4Y7N B;  2ZJR A;  1JB3 A;  5HGT A;  1Q86 C;  2NYZ D;  5DLQ E;  3I4O A;  1SE8 A;  4KHZ A;  5DM7 3;  1EIF A;  1VDZ A;  3FEW X;  5EBD A;  3K80 C;  5GAG C;  1MI2 A;  4EGV A;  3R3O A;  1PH7 A;  3CRK C;  4EQO A;  2N55 A;  1Y1W G;  3VYU A;  1U0L A;  2BA0 A;  1KQS A;  1WTH A;  3UE1 A;  1W6K A;  2UU9 L;  4LF6 L;  3A7A B;  2A6E C;  4DNI A;  3VR6 A;  1JE4 A;  3F2D A;  2VQE Q;  1VQA A;  4DKA C;  1K8A C;  2O4X A;  3PGZ A;  4IFD J;  3CHB D;  3CC7 A;  5DM6 3;  1X56 A;  1Y8O B;  5IWA L;  2UXD Q;  4UP7 A;  4KN4 C;  4A3D G;  4NDX A;  5ELO A;  1I4X A;  1D7Q A;  2F0D A;  4JI1 L;  1V1Q A;  2RKS A;  1F77 A;  1U4L A;  1IBM Q;  4IUV A;  4GKJ L;  1GKH A;  5FLX c;  3FDT A;  4NW2 A;  2JSO A;  3T1H L;  4HJA A;  3G7L A;  1UE1 A;  1QVC A;  3OW2 A;  2NBF A;  4XQN A;  3GV3 A;  4YIJ A;  1IBK Q;  4K8I A;  1DOM A;  2O2L D;  3KFU A;  4XT1 B;  3A55 A;  3NTH A;  4LF7 Q;  2UXB L;  2O5I C;  3PO2 G;  4A4I A;  4DV6 L;  5K5P A;  4E6I A;  1D2B A;  2FMC A;  4G57 A;  3CPW A;  1ASZ A;  3A56 A;  1RDP D;  4JI8 L;  1OXT A;  4ZQ3 A;  3RLF A;  2E5L L;  4HAE A;  4K2K A;  4J8Q A;  1NMF A;  1YHA A;  1VQ9 A;  4XTC S;  1BQQ T;  2LMC B;  1WVL A;  1WTR A;  1G91 A;  4IUR A;  5JEA H;  3TS2 A;  2E76 C;  3BG3 A;  5IGG A;  4QMG A;  4CKE A;  3I7F A;  4JVZ A;  3MFG A;  1XTD A;  2B8G A;  2UXC Q;  1JT8 A;  1D5Z C;  1PH8 A;  4PG3 A;  1BCP B;  3C3L A;  2Y0S B;  3KJO A;  1I4G A;  4NB3 A;  3J81 j;  4KD4 A;  5JPN C;  2XRQ D;  3NWS A;  1PA6 A;  2Z1C A;  4G7O C;  2RQX A;  5JJL A;  1MGS A;  3U9O A;  3PO3 H;  5EBC A;  3J7Z C;  4HID A;  3HOZ H;  4B9W A;  1PRT B;  1GUW A;  1LT3 D;  2JA5 H;  1WCM H;  1AZQ A;  2M00 A;  5IYC H;  2X69 A;  2R7D A;  5C0X G;  4B3M L;  4QGU A;  1N33 L;  4NPS A;  1FNU A;  2YTX A;  1HNX L;  2F0S A;  1ZEQ X;  2QKI C;  2Z4H A;  1HR0 L;  5EAY A;  3PO3 B;  5D65 A;  1XMQ Q;  2EY1 A;  2JK8 A;  2VB3 X;  1EU3 A;  4GOP B;  2JA5 B;  1V43 A;  1WCM B;  1CZG A;  4OIJ A;  3J81 L;  1NTG A;  3IL8 A;  4AYB G;  4YCU A;  1S5F D;  1E2V A;  3KJP A;  3S17 H;  1PYW D;  2MO1 A;  3J80 i;  2E2J H;  4LFA L;  1VMP A;  2FXQ A;  4HJ7 A;  1HQR D;  4HMI A;  5IY0 A;  4XQQ A;  2AUJ D;  4IPD A;  1JB7 A;  2HQL A;  5EKL A;  5A2Q L;  3IFT A;  4GS3 A;  4ABN A;  1JJ2 A;  2IT1 A;  1O7I A;  2NVY H;  4AH6 A;  5IGE A;  1YJ9 A;  3S17 B;  4A3F G;  3HOU B;  1IBL Q;  5D14 A;  2XTI A;  1EOT A;  2L11 A;  2KJX A;  2E2J B;  3FKI H;  1TR5 A;  1WTP A;  5H1S E;  2JEA I;  1BCP F;  4OHJ A;  2WP8 J;  1G2S A;  3S1R H;  1B3A A;  3DUZ A;  2EYO A;  1K0R A;  4ZUJ A;  3EFX D;  2R3Z A;  2R6G A;  3SE0 A;  3TN2 A;  2HT1 A;  3K7U C;  2A68 C;  1YEZ A;  2B63 G;  3SK4 A;  3D6C A;  3OIQ A;  2NVY B;  1J9O A;  3RR5 A;  1PRT F;  2DN8 A;  1QG7 A;  3TS0 A;  5COR A;  1PRT D;  3T1Y L;  3FKI B;  3HP3 A;  5IT9 E;  1Q3L A;  3KLW A;  3PQI A;  4DR1 Q;  1QJO A;  4GOP A;  3S1R B;  4KJN A;  2EZV A;  2DNE A;  4LAA A;  2QEX A;  4HJ9 A;  4NXM L;  2EYF A;  3UDI A;  4IO9 A;  2EYP A;  4LF9 L;  1GOZ A;  4H44 C;  4AQY Q;  2B2U A;  1OXV A;  2CHB D;  2AMC B;  2ZTE A;  1J6Q A;  3OSO A;  2NZH A;  2I07 B;  3S2H H;  2NB0 A;  1Y1W H;  1Y14 B;  1FL0 A;  1AH9 A;  4TSS A;  1VQD A;  2A8V A;  3ZJY C;  2ZJP A;  4KKS A;  5M3F G;  1H9S B;  4LF8 L;  4DV3 Q;  1HZB A;  5JJI A;  2EYJ A;  4DK0 A;  1SJH D;  5FLM G;  1KNA A;  2F0G A;  3FVQ A;  3J80 E;  4IOA A;  2R93 G;  1EYC A;  1C0A A;  3S2H B;  4S3S A;  2X6G A;  1STB A;  3E0J A;  3MHB A;  1G6Z A;  1TWA H;  3QR8 A;  4A93 H;  1N9W A;  1JOQ A;  2BDO A;  3K5O A;  4HTH A;  3PIO 3;  1CA5 A;  4X6A H;  1ESR A;  5LMN L;  1F9P A;  3W1G A;  2NN6 I;  3AB9 A;  4N8F A;  3H09 A;  3F2B A;  5EGT A;  3TSS A;  1C8C A;  1LTL A;  3KLS A;  4EX5 A;  3PUX A;  1RTN A;  1N36 L;  4OON A;  1QNU A;  2HHH Q;  1BVS A;  1SBB B;  2KHI A;  3NXW A;  1TWA B;  4A93 B;  2R92 G;  4GZY C;  3D0F A;  1PZI D;  5C4X B;  1LLR D;  3W2D A;  2F0K A;  1J5E Q;  1SE3 A;  4KTA A;  2NZ1 D;  3A5U A;  1CKN B;  1IYV A;  1ROD A;  1V1P B;  3CPF A;  1G29 1;  2G9D A;  1PVO A;  1B1Z A;  1ZXT A;  1R4P B;  3G4S A;  1CSQ A;  2A6E D;  3VA5 A;  2PQA A;  4P2C B;  1B9N A;  1XTC D;  2BA1 A;  4JI2 L;  1XNQ L;  2VUM H;  3UI2 A;  1YIT A;  5BN5 A;  3J81 c;  3MXP A;  2MHV A;  1PTO C;  1I4H A;  1KD1 C;  1TWF B;  1SE4 A;  1VQB A;  1YZ6 A;  1Q7Y C;  2F4V L;  3EN2 A;  2KEE A;  1EWC A;  2M9V A;  5CYU A;  1KAA A;  3CD6 A;  5C0X H;  2RVL A;  1SRU A;  5C44 H;  1HFG A;  3BDC A;  1VQC A;  3RLN A;  2VUM B;  2OCE A;  4DXG A;  3HOW G;  5FO9 B;  4DV1 L;  4J1M A;  1EY5 A;  4K6L A;  1O80 A;  1UE6 A;  4IQZ A;  2E8G A;  3R93 A;  4KY7 A;  2FIN B;  4IUT A;  5C44 B;  4OX9 L;  4UAI A;  2NVX B;  1SMY C;  4FNF A;  3GTJ H;  5CBE E;  4IPC A;  3HOV G;  4DK1 A;  3ONA B;  2JEB I;  3K59 A;  4A3G G;  1T5X D;  2I0Q A;  1SNC A;  1YI2 A;  2EIF A;  2K5D A;  3J7A 5;  1NNX A;  5FLX E;  1CZW A;  1YHB A;  1QVF A;  2Z6K A;  3DEO A;  1XYI A;  3GTJ B;  4BBS H;  1T5E A;  2L15 A;  4C3J G;  1JQY D;  2JA6 H;  5GAE C;  3OMG A;  1L2F A;  1G8Z D;  2KCT A;  4LW1 A;  1KIX A;  1TKW B;  1HJP A;  2SNM A;  2NZO A;  4DFA A;  2B63 H;  1JR0 D;  3SHL A;  4X65 Q;  4M8A A;  1MIU A;  1JMC A;  2CCZ A;  2EJM A;  4POG A;  3I4L A;  4BBS B;  2Z6B A;  4WJW A;  4LF4 Q;  1Z47 A;  2WII B;  2JA6 B;  3KBX A;  3DHQ A;  3OHX C;  2B3G A;  2B2Y A;  3KDF B;  2PCF B;  3QO2 A;  3KF8 A;  1DON A;  5E1F A;  1I6H H;  5M5X H;  1HA5 A;  1H9J A;  4R4I A;  3RZD H;  1XMO Q;  3E9H A;  1WYD A;  2WIN B;  1L0X B;  2D2C C;  2L4N A;  1K73 C;  3DLL A;  1BO0 A;  4IUQ A;  5IIF A;  2VS1 A;  4RKL A;  3WOE A;  1GUN A;  3PUY A;  2Q8R E;  1DZ1 A;  3DMU A;  5M3M B;  1EQV A;  2WB1 E;  5M3F H;  1MHW C;  1I6H B;  5M5X B;  1X55 A;  2MP1 A;  3RZD B;  1SJE D;  2E2I H;  2MPM A;  1VQ4 A;  1E2W A;  1R4Q B;  2D9U A;  3D4W A;  2A68 D;  4APV A;  1N8R C;  1X3E A;  4LF6 Q;  3AQQ A;  4JYA L;  1YIJ A;  1JIC A;  1KTK A;  4FXD A;  1AW7 A;  4J6H A;  3H0G G;  1K8M A;  2WAQ G;  1YVC A;  5IWA Q;  2E2I B;  4BA2 I;  1PTO H;  2OF1 A;  4IUP A;  3NHH A;  3KDF A;  5ELB A;  2L9H A;  4P75 A;  4JI1 Q;  1XJV A;  1Q12 A;  2F0P A;  1NR2 A;  2UUA L;  4GKJ Q;  5KIX A;  2R92 H;  3HG9 A;  1DCZ A;  1KL9 A;  2F0E A;  4UPA A;  5L37 A;  1BR9 A;  1NBW A;  4DR3 L;  3T1H Q;  1GUG A;  3E3X A;  5CV9 A;  1NAP A;  3CCL A;  2SEB D;  4K6D A;  3MEH A;  1ILQ A;  3BU2 A;  1NJI C;  2OTL A;  4A3K H;  2UXB Q;  2VZA A;  1EIH A;  5E4W C;  4K0K L;  4DV6 Q;  1KNE A;  2B2V A;  3V96 A;  2EOT A;  2E5L Q;  4JI8 Q;  3NWT A;  3CU7 A;  3E6Z X;  4RG1 A;  4B3T L;  5BN4 A;  2QF7 A;  3RN2 A;  1L1O A;  4UP8 A;  5IT9 c;  1EUJ A;  5FO7 B;  1E2Z A;  3SR1 A;  1GD7 A;  4A3K B;  4N9P A;  1F2Z A;  1N34 L;  3SDZ A;  2R7Z H;  2CW0 D;  3I4M G;  2G9H D;  3FMC A;  2UUC L;  3CKI B;  2VXW A;  2ZJQ A;  1X65 A;  3GO5 A;  2XVS A;  4A3E G;  1GJX A;  3J81 i;  3HOY G;  2IX0 A;  2HCC A;  1E1T A;  4FF3 A;  1I94 L;  2RDG A;  5CC4 A;  1HZC A;  3GP7 A;  3RNU A;  3S2D H;  1IKL A;  5G3L F;  4B9X A;  5G3L D;  3D3R A;  4B3M Q;  4L5S A;  1N33 Q;  2R7Z B;  2EYM A;  5ISR A;  1K28 A;  4IUU A;  1HNX Q;  4ILW A;  1A15 A;  2F52 A;  5IYB H;  4KN7 C;  4RFB A;  2LSS A;  1GUS A;  3X3N A;  4UHV A;  1TS5 A;  1PH5 A;  1D8L A;  4OL7 A;  3DWA A;  5DAU A;  1Y1V H;  3HOV H;  3E5S A;  1RKN A;  4A3G H;  3S2D B;  4RHS A;  2MO0 A;  1WD0 A;  2HDL A;  2K04 A;  4OEL B;  3DWP A;  4QY7 A;  1SMX A;  1PLF A;  2BH8 A;  1PTO F;  1VQF A;  1KXL A;  2AWO A;  1PTO D;  3U58 A;  2PZT A;  3OIP A;  3TP8 A;  2K5V A;  3D4D A;  3CMA A;  5IP9 G;  5FO8 B;  1Q81 C;  1Y1V B;  4HIO A;  1LV9 A;  3D31 A;  5F2D A;  2HD3 A;  2IW3 A;  5KYI A;  2N3S A;  3S1Q B;  4BY7 B;  4A3C H;  2WFW A;  1AEX A;  3F2U A;  4ZUI A;  3C1F A;  4EQN A;  4QB4 A;  4B3S L;  3JC6 6;  2F0N A;  3P20 A;  4NXN L;  1U4R A;  1STG A;  1O7L A;  4BS9 A;  5KNC A;  5C0X J;  1C9O A;  3K0X A;  4QL5 A;  1JOK A;  4ID6 A;  4DK6 C;  4DR2 L;  4JI7 L;  2L5T A;  3GTL H;  3KLS X;  3DM3 A;  2EJF C;  1AE2 A;  4DV0 L;  1SMY D;  4X3S A;  2Q2U A;  2B2U C;  2BCO A;  4P72 A;  1CSP A;  2CFM A;  2K5H A;  1IZ6 A;  2F0I A;  4C56 C;  3T1Y Q;  2EXZ A;  3J81 E;  1LTI D;  5E3F A;  2K7V A;  2EPB A;  4WOR A;  1FVI A;  4KY5 A;  1STE A;  4JI5 L;  4NXM Q;  3GTL B;  2WAC A;  4C3I G;  2F3I A;  5IP7 H;  5A2Q E;  2QEJ C;  3AU7 A;  2L0C A;  1VS0 A;  2A6H C;  2XIW A;  2IL8 A;  4F88 A;  2F1M A;  2WB1 B;  1S4Z A;  4GNX B;  1EEF D;  1EQT A;  3CCR A;  1JJG A;  1EEI D;  1XWE A;  4LF8 Q;  4P73 A;  3H3V I;  2PQE A;  3Q24 A;  1KRS A;  1SLJ A;  3D6W A;  1V9P A;  2IX1 A;  4OO1 G;  1IYU A;  1BKB A;  2PO4 A;  3G6E A;  4K2L A;  4RGO S;  2IPK D;  4GKK L;  4HED A;  1IKM A;  1EWI A;  3MC0 B;  1QUQ A;  3M7G A;  2ENB A;  1F2M A;  1I6V C;  2F0W A;  1XX8 A;  3GTG H;  3OTO Q;  3G48 A;  5LMN Q;  4R4C A;  4C3H G;  2JA7 G;  2VL6 A;  4IFD I;  3S16 H;  3K5L A;  4A3J G;  1N36 Q;  1KDA A;  2PI2 E;  2XN9 C;  2ZXR A;  2K33 A;  4JK1 C;  1HUN A;  1F9Q A;  1LT6 D;  4A3B G;  4ZKB B;  4A3I H;  3GTG B;  1S5D D;  3TBI B;  3R2I A;  1C48 A;  1HQM C;  4QQB X;  1CT1 D;  2RHS B;  5AFW A;  4BBR G;  1EZ8 A;  1E24 A;  3S16 B;  4R9W A;  4DR5 L;  1SNM A;  1HZA A;  4RGM A;  5C5L A;  4G7H C;  3FRP B;  1S5E D;  2B29 A;  1EU4 A;  5JAV A;  4JI2 Q;  1XNQ Q;  4A3I B;  1OXX K;  3E0E A;  3EIV A;  2I5M X;  4FXK C;  1VQH A;  2QA4 A;  5BR8 L;  3HOY H;  3GTM H;  3I4N H;  3KK7 A;  2NTS A;  4HCE A;  2I5H A;  2BE5 C;  2JJQ A;  3OOC A;  5HY6 A;  4BY1 G;  1G6P A;  2F4V Q;  2KA7 A;  3PIP 3;  1X6O A;  1FJG L;  1F2L A;  3G71 A;  2GN5 A;  3ICE A;  1AE3 A;  4MN3 A;  3ERS X;  4KK7 A;  3GTM B;  3I4N B;  1FGB D;  2JN4 A;  3HOZ B;  2AHO B;  2ZM6 L;  1SR3 A;  4DV1 Q;  1I3Q H;  3KF6 B;  3MXG A;  4HSV A;  4JBM A;  4OWW B;  2F0F A;  2Z6K C;  5C3E G;  4OX9 Q;  1SNP A;  4AYB E;  4YY3 L;  5IP9 H;  2E74 C;  4DAY B;  1ILP A;  1I3Q B;  3HKS A;  1IL8 A;  1D1K A;  2F3W A;  1UUP A;  2EY5 A;  3LGJ A;  2V1C C;  2JE6 I;  4DR7 L;  4U67 3;  2K5Q A;  3FHW A;  3H15 A;  2PNR C;  4DV2 L;  1B8A A;  1HUM A;  2WKD A;  3I8Z A;  4ZLT F;  3AMU A;  1NCV A;  5LMU L;  2YV5 A;  1Q82 C;  2B2Y C;  4YCW A;  4RCO A;  3TP6 A;  3MFY A;  4ZRZ A;  4JBW A;  2F0T A;  4X66 Q;  3PSI A;  1VCI A;  2ASB A;  3HRZ C;  1LT5 D;  1R9T H;  1FNW A;  1B53 A;  4C1N I;  2E2D C;  1EY4 A;  4KKU A;  4CJ0 B;  4IFD G;  4ME3 A;  4PMB A;  1DYQ A;  4NMZ A;  4POF A;  1LO5 D;  4PNY A;  5IE8 A;  4B08 A;  1F9R A;  4YCV A;  3NTK A;  2J4X A;  4KY6 A;  3H3V C;  4DUZ L;  4TRD A;  3A8I E;  4C3I H;  1R9T B;  2B2W A;  2RSO A;  1O7Y A;  3QB3 A;  5ELN A;  3I91 A;  4PMW A;  1HHV A;  4HMJ A;  1JCK B;  3TP5 A;  2K1B A;  2PW7 A;  3NBI A;  1EIY B;  3QJY A;  2VW9 A;  1EY6 A;  4K8J A;  3TP7 A;  4QUC A;  2J0T D;  4BWG B;  4RMF A;  1PH9 A;  1OTC A;  2YTV A;  1CFM A;  3HOX G;  5K36 G;  4RWS C;  5KYL A;  4DV7 L;  4C3I B;  4PZ6 A;  3MWY W;  3NUC A;  1H95 A;  2A73 B;  4KV6 A;  2ES2 A;  2OTJ A;  4OO1 H;  1Y1W B;  3IFD A;  4A3D H;  3K57 A;  1PH6 A;  1FNV A;  3A8J E;  2JA8 G;  5CMD A;  1STH A;  1A0I A;  2IHF A;  1TS4 A;  2Q8I B;  3I55 A;  4JYA Q;  4RHR A;  1DGS A;  2UUB Q;  4DAV A;  2IJ0 A;  1EL0 A;  1HTL D;  5I6Y A;  4C3H H;  1IYJ B;  2JA7 H;  1WJJ A;  3NP8 A;  4CHT B;  5FK9 C;  2IWH A;  1KHI A;  3BYT B;  4A3D B;  3NQT A;  1PFB A;  1A6X A;  1EQR A;  3PO2 H;  2F0V A;  3K6O A;  2B2V C;  4FO2 A;  1K8O A;  1D1I A;  2IHE A;  2PMZ E;  2KED A;  2UUA Q;  2B2T A;  4HIK A;  1M4V A;  1O78 A;  4IAL A;  3U4V A;  2A69 C;  1VQ7 A;  4QUF A;  1L1O C;  1SND A;  2HDM A;  1PFS A;  4H02 A;  3BJU A;  2FJ2 A;  3BZK A;  1I4Q A;  3P1H A;  5JPM C;  2A6H D;  1VMC A;  4C3H B;  4RCN A;  3Q6S A;  1RHP A;  1CHP D;  4HR7 B;  5ELF A;  1Q8K A;  4LF7 L;  4L5T A;  4HJ8 A;  4V19 0;  1FYC A;  1F2Y A;  3LNN A;  4FF2 A;  3PO2 B;  1VQN A;  3RMH A;  3I73 A;  4X3T A;  4K0K Q;  1H9S A;  2EVB A;  3EBE A;  4OIK A;  1E7Z A;  4B3T Q;  4TVA B;  3GDE A;  2SNS A;  4DNT B;  2X6L A;  3BVM A;  4JG2 A;  3SK5 A;  3SEB A;  5EPJ A;  4R1J A;  4X64 L;  3KBG A;  1N34 Q;  3QWN A;  2UXC L;  3BYY B;  2A5H A;  4R4Q A;  4J15 A;  4O2D A;  5FJ8 G;  4F7X A;  2UUC Q;  1FR3 A;  3F2C A;  1B7Y B;  5COY A;  3RZO H;  2VQF L;  2CH4 W;  1E22 A;  1DM0 B;  1ONL A;  3RLO A;  4JPB W;  3VR5 A;  1G51 A;  2AQ3 B;  2FFK B;  3M4Q A;  4RH6 A;  3MXN B;  5JVH 3;  1I94 Q;  2L1B A;  2MFI A;  3H91 A;  1PFN A;  1SYE A;  2XRS D;  2VNU D;  5IYD G;  1HA6 A;  4RKB A;  4KJO A;  1KC8 C;  3I56 A;  1U9R A;  1DJR D;  1XXG A;  1CKN A;  2K75 A;  1KLU D;  3I3C A;  1V1P A;  4LFC L;  4H13 C;  2K52 A;  1S72 A;  4KKT A;  2NWG A;  1GUO A;  3PIO A;  5IGF A;  2ATW A;  3Q8D A;  1QIL A;  3FP9 A;  4JI0 L;  3M4P A;  1Y8P B;  3MXU A;  2Q2I A;  4KI0 A;  5EKI A;  4AYB B;  2NVT H;  2CWA A;  2H1E A;  4A3F H;  2B8F A;  3FPU B;  5J3B A;  4DV4 Q;  2BE5 D;  1BBW A;  2N88 A;  4DV5 L;  3CRL C;  5CV4 A;  2K5W A;  3WWV A;  4ZYS A;  4DR4 L;  1YHQ A;  2EE1 A;  4K5W A;  3FPP A;  3QIA A;  3HZX A;  4XQJ A;  2NVT B;  4NP5 A;  1IBL L;  4A3F B;  2OEO A;  2NN6 G;  3T56 B;  2CVR A;  2LFN A;  3MXN A;  1HTP A;  5EPL A;  4NXN Q;  1PMR A;  1LM0 A;  1LYL A;  5TSS A;  4ZAI A;  3HKZ G;  4R8N A;  5AJ3 L;  2B63 B;  1H9K A;  2EJG C;  4DR2 Q;  2JQO A;  2D5D A;  4JI7 Q;  3BVG A;  4DV0 Q;  2EYH A;  2C35 B;  4PMC A;  4O1N A;  4KHV A;  1I4R A;  4XYQ A;  2RDH A;  3W5O A;  2I46 A;  5KGU A;  1H9R A;  4OEM B;  3Q23 A;  3I2Z A;  1PYS B;  2PPB C;  4PQX A;  1F9S A;  4CGY B;  1TWC H;  4JI5 Q;  1A62 A;  3N52 A;  4X3K A;  5KEE A;  2LXK A;  4ALP A;  4R4T A;  5A35 A;  4IPG A;  3TDQ A;  5FLM H;  2R93 H;  2Z4I A;  2DJG C;  3CCQ A;  1PV4 A;  4L5R C;  4BXX G;  3PUV A;  1ET6 A;  2JA8 H;  1A8V A;  2UU9 Q;  1CKM A;  1K83 H;  1TWC B;  5M3F B;  1KLG D;  4MNO A;  1XNR L;  4ODG A;  1FGU A;  1K0S A;  5JOB A;  1JJC B;  2R93 B;  3A54 A;  1NSN S;  1LAC A;  5KRU A;  3VR2 A;  4FF4 A;  2WAQ E;  2J7Z A;  2Q2H A;  2BOS A;  1DXM A;  3L3O C;  1STA A;  1SRO A;  2K6A A;  5ELD A;  1EYG A;  4OWX B;  1RJT A;  1EQQ A;  1ENC A;  2CWP A;  2KUM A;  3ULP A;  1SDF A;  2AQ2 B;  1TU2 B;  1PTO B;  2PMZ B;  3NEL A;  2HHH L;  4A3L G;  4GN3 B;  2CKZ B;  1MKH A;  1SYC A;  2Q2T A;  3ERO A;  2R92 B;  1B3Q A;  1BBU A;  4TKO B;  1EYD A;  3DWQ A;  5E4X A;  4I65 A;  1CKO A;  1VF7 A;  4OGQ C;  1WI5 A;  4OXP A;  4EVO A;  4LF5 L;  4DR5 Q;  3AEV A;  3NE5 B;  5IGB A;  4K14 A;  4DUY L;  2Y0S G;  1WTX A;  4PZ8 A;  5FJ8 H;  1A63 A;  3ITP A;  1QZH A;  2NVQ H;  4KHP L;  1HXY D;  4RA8 A;  1BUV T;  1HNZ L;  2FMM A;  5JEA G;  3HOW H;  3KUP A;  5JJZ A;  5FOB B;  4GLA C;  1VQ8 A;  4AIM A;  3NEM A;  1FJG Q;  3RN5 A;  2A69 D;  3URY A;  3VDY A;  4G4K A;  5C3W A;  3QOJ A;  1UEB A;  5BN3 A;  2EDG A;  4IPH A;  3IAY A;  2NVQ B;  1HR0 Q;  3U9S A;  3CCU A;  4DPG A;  1UE7 A;  2CH4 A;  2KCM A;  3HOW B;  1Q1B A;  4B3R L;  2Z8L A;  2JA5 G;  1WCM G;  1BCP C;  4LUO A;  1VQI A;  1EYA A;  3STB C;  1QE6 A;  3NTI A;  1TWH H;  2B39 A;  3J7A V;  1TY2 A;  1WFQ A;  3OPO A;  4A3M G;  1LT4 D;  1NMG A;  4YWL A;  4LFA Q;  4YY3 Q;  2QIL A;  1VQ5 A;  3OWE B;  1PRT C;  3GV6 A;  4C3J H;  3U50 C;  3P75 A;  1VQL A;  3J7A F;  3HOV B;  3T53 B;  2F3V A;  3SK8 A;  4A3G B;  1STN A;  5I9P A;  4GLV B;  1TWH B;  3HOU G;  3PV0 A;  4GN5 A;  4DR7 Q;  4JI6 L;  5J39 A;  2TMP A;  1JWM D;  3TME A;  1EOV A;  4DV2 Q;  3G6J B;  5C6A A;  2MJ8 A;  3L2P A;  5LHY 1;  3CCV A;  2IY5 B;  4C3J B;  4GOP C;  3CCJ A;  1EY7 A;  1K8G A;  3S1N H;  5LMU Q;  2XWJ B;  4WJ4 A;  2V4D A;  1U4M A;  1ZYR C;  4QF4 A;  1I4P A;  2TSS A;  2DUD A;  1GVP A;  3AFQ A;  1PH4 A;  5GRO A;  4A75 A;  3MA2 B;  4XYO A;  3GTK H;  1A3V A;  1DOL A;  2EXD A;  1XPR A;  2EY6 A;  3FKI G;  4CDD C;  4DAP A;  1CI3 M;  3CW2 C;  4Y7N H;  4ZCK A;  3S1N B;  4LUV A;  4LFB L;  3WOF A;  4P71 A;  2VY3 A;  3Q0A A;  1P16 A;  2K01 A;  3PUW A;  5C0X I;  4LF9 Q;  1HH2 P;  3GD7 A;  3GTK B;  4EQ5 A;  2K14 A;  5ELC A;  2P5Z X;  5C4Z A;  1TVX A;  1HZ9 A;  3ER0 A;  4DAM A;  2O5J C;  3M4Y A;  2QDL A;  1N32 L;  5CBA E;  4HN7 A;  5HGQ A;  5FKA C;  4UDU C;  4BXX H;  1TWG H;  2K28 A;  3BZD B;  1A3U A;  3PF5 A;  2F4I A;  1VQM A;  1HR0 W;  5CV5 A;  3TZU A;  4DV7 Q;  2OWO A;  4C1N K;  1QB5 D;  3H0G H;  4WJ3 M;  1X3G A;  1SXT A;  4CDC C;  1UWV A;  4KD3 A;  3UDG A;  4FYD A;  3O13 A;  5KND A;  4JV5 L;  1TWG B;  2K50 A;  5GAD C;  2KOL A;  1CM9 A;  1A3T A;  2B2T C;  2PZU A;  3V05 A;  4BA1 I;  1KAW A;  1I50 H;  1VQP A;  1AP0 A;  1GXD C;  3K5M A;  1PFM A;  2LXJ A;  4CDF C;  1CK1 A;  2XGT A;  3H0G B;  2WAQ B;  1PH1 A;  1SYD A;  1IL2 A;  4DR6 L;  1JE5 A;  1WTW A;  2QCP X;  3VR4 A;  3BZC A;  3L0O A;  4X3U A;  3S14 H;  2EY2 A;  2HCI A;  1BF4 A;  1EFW A;  2QGQ A;  1YJW A;  4A3L H;  4A93 G;  3PCO B;  4PZ7 A;  5C4X G;  4DGZ A;  1Q8I A;  4CKC A;  5E7N A;  2QDB A;  2K4K A;  1S40 A;  1TT2 A;  3QG1 A;  1I50 B;  3BVZ A;  1SYB A;  4I7Z C;  4CBV A;  4A76 A;  1TY0 A;  2KCC A;  2YU9 H;  1PH2 A;  2KBN A;  3N6R A;  2OQK A;  4PV1 C;  4GNX A;  3S14 B;  4FDB A;  4XXE A;  2AWN A;  3TEH B;  1BXT A;  2ALY B;  3I4M H;  3BS1 A;  4F8M A;  4KLK A;  2XSC A;  3MVV A;  4V0B A;  3CP0 A;  1EY0 A;  1XPU A;  4A3E H;  3HFZ B;  2GA4 B;  2MUY A;  2YU9 B;  3JAM E;  1WOC A;  1J8I A;  2OXP A;  3CQZ H;  1GO3 E;  2ZXO A;  4GLX A;  3DEP A;  1HNW L;  4O0A A;  1RD9 D;  4X64 Q;  1W2B A;  1C7Y A;  3A8K E;  1QCB D;  3ULL A;  3I4M B;  5JVG 3;  1CHQ D;  3S24 A;  2VUM G;  1II3 A;  2VQF Q;  1ET9 A;  3VR3 A;  2H5X A;  3IKJ A;  2MGS A;  5C4J H;  3MAQ A;  4A3E B;  3HOY B;  1B50 A;  3CQZ B;  5M5Y H;  3Q22 A;  1MJC A;  4Y52 H;  4Q5V A;  2DY7 A;  3LX0 A;  3GTO H;  5C44 G;  1O7Z A;  5IOC A;  1W6J A;  1VQK A;  4LFC Q;  4X62 L;  1EWH A;  3X3M A;  4A3M H;  4QIW E;  4R4O A;  3K5N A;  4HIM A;  1S5B D;  4ZKC B;  4JCV E;  5C4J B;  3UDF A;  1X3P A;  3KLR A;  4RGN A;  2LKV A;  5M5Y B;  4JI0 Q;  3DM1 A;  4CJ1 B;  4F87 A;  5LMN W;  3GTO B;  4KMU C;  5M9O A;  1JWU D;  3HOU H;  4C2M H;  2C5C A;  4A3M B;  2A19 A;  2RF4 A;  2IX3 A;  1YNJ C;  4YHH L;  3SGI A;  3IRB A;  5T1I A;  5LL6 S;  1AN8 A;  4IUN A;  2I5L X;  2NTT A;  4DV5 Q;  1MSH A;  4DR4 Q;  1Z9F A;  5M5W H;  3H6M A;  1JC7 A;  3K8A A;  1EY8 A;  4C2M B;  3I72 A;  2XNA C;  4BBS G;  1M8A A;  1SN8 A;  4JI4 L;  4JI3 L;  2AKW B;  2JA6 G;  1K3R A;  3KF6 A;  4JW0 A;  1BCP D;  1T9H A;  2KHS A;  2WV6 D;  5CV7 A;  1MD2 D;  2N49 A;  4MTN A;  3STB D;  2KCN A;  1B70 B;  5D3D A;  5AJ3 Q;  4I7A A;  4L6T B;  3T51 B;  5M5W B;  3K81 C;  2D62 A;  5KNB A;  3F8T A;  3P7J A;  3PIP A;  3NSW A;  2A74 C;  2KEC A;  1UNS A;  3ND8 A;  1OXS C;  1V8Q A;  4QJF A;  5I4D A;  4DAY A;  4DF7 A;  1YNN C;  2E75 C;  1C4Q A;  1DD2 A;  3CC4 A;  4JOI A;  3OMC A;  3HGB A;  3A74 A;  5M3M G;  3NEN A;  3S9W A;  2ICE C;  3VA7 A;  1Q1E A;  1EFI D;  4K5V A;  3S15 H;  2GVB A;  4Z9C B;  2BDN A;  4YWK A;  4L63 B;  1RF2 D;  1ZYR D;  4L5Q A;  3AYH B;  1Q90 A;  3M9B A;  1OXU A;  1NY4 A;  1HCZ A;  1TS3 A;  3JAM L;  1UEA B;  3A0J A;  2VQE L;  2ZTC A;  2PQA B;  1B9M A;  2DY8 A;  5EPK A;  4L8J A;  1XNR Q;  3S15 B;  2N8N A;  3K58 A;  1JOR A;  2UXD L;  4DXF A;  1LTB D;  5C5M A;  3WDN A;  3F1Z A;  1RL2 A;  4A3J H;  4XDX A;  1IBM L;  1IXR A;  4YWM A;  2K03 A;  1CQV A;  4RAU C;  5C4X H;  1WD1 A;  3M4O H;  2CW0 C;  3EVQ A;  4A3B H;  3OTO L;  4DR3 Q;  3L9A X;  2JA7 B;  1IBK L;  1GHK A;  4ME5 A;  4BBR H;  1PH3 A;  4HJ5 A;  3V2T A;  4LK1 C;  2LS0 1;  3M7N A;  4OWT B;  4HSP A;  4A3J B;  1P8L A;  3C46 A;  3CME A;  3L7Z C;  5EJW A;  2EQS A;  1LTS D;  2AUK A;  3M4O B;  1SFO H;  2R7F A;  4A3B B;  1LTR D;  1L0Y B;  4G7Z C;  1E3P A;  1JOO A;  1LTA D;  2DNC A;  1X32 A;  1TWF H;  2RCF A;  1QWY A;  3MZ5 A;  4BBR B;  3LWU A;  4A3K G;  4LF5 Q;  2E2H H;  3GTP H;  4BY1 H;  4LWC A;  1VQO A;  1Z7T A;  4DUY Q;  1TS2 A;  1KAB A;  1PHJ A;  1TII D;  2RHQ B;  1PZJ D;  4XT3 B;  1KRT A;  1QNK A;  1SFO B;  2WKC A;  4LNQ A;  1SYF A;  2F03 A;  1E0B A;  2OT2 A;  1K9M C;  2KVM A;  4XIG S;  3SXH A;  4KHP Q;  3VYT A;  2K05 A;  4JBJ A;  1HNZ Q;  5EQ0 A;  3CCS A;  5J22 A;  3GTP B;  2VB2 X;  2E2H B;  3QOL A;  3ULJ A;  4BY1 B;  3DXJ C;  2R7Z G;  1E1O A;  4FVM A;  3CF5 A;  4DK3 C;  2HIX A;  3RZO B;  5C4H A;  5C3E H;  1ICW A;  4H7B A;  3NQI A;  4N8X 1;  2NVX H;  1Y69 U;  1GUT A;  2PI2 A;  1IW7 C;  2Z9H A;  5J1Z A;  3ND9 A;  1XMQ L;  4FP5 D;  1ESF A;  2K32 A;  2ZXP A;  4B3R Q;  3OYY A;  3ZYY X;  4WRD A;  1L0W A;  2HQE A;  5IT9 L;  2F0J A;  1VQG A;  2AQ1 B;  4QIW B;  3CCM A;  3KF8 B;  4Q0F A;  5IYB G;  1ML0 D;  3H3V H;  5C3E B;  4EQP A;  4IOC A;  5ELE A;  1X54 A;  1AZP A;  4R8I A;  3EQL C;  5HUR A;  1Y1V G;  2SOB A;  4IN3 A;  1ENF A;  2SDF A;  3M85 A;  4U68 A;  3KYH C;  3GTQ H;  1KDB A;  3OWF A;  3CXC A;  4UP9 A;  4BY7 G;  2YYZ A;  1NR4 A;  1Y8N B;  1D5M C;  4JI6 Q;  5JEA J;  2H4O A;  1WTO A;  3HS0 C;  4B3S Q;  4IFD H;  3TRZ A;  2F0H A;  2HIV A;  2DGY A;  3RUZ A;  3SVM A;  4MZ9 A;  1LUZ A;  3J80 L;  3S1M H;  5DEH A;  3BDO A;  4K5X A;  3GTQ B;  1SNQ A;  4X66 L;  5CR3 A;  1PXU A;  1HFN A;  3M3Y H;  1RIP A;  3CCE A;  3TRE A;  4A3C G;  2RDF A;  1B44 D;  3HKZ E;  3PF4 A;  1GM5 A;  4FF1 A;  4QCL A;  1KDC A;  2BH2 A;  4MIU A;  1AFP A;  3JAM c;  3HEJ A;  1WTQ A;  3D4R A;  4DR1 L;  5EKK A;  1YJN A;  4LFB Q;  1SNO A;  4M1U B;  3I90 A;  3S1M B;  1SEB D;  3SK6 A;  1GHJ A;  5M3M H;  3M3Y B;  1G2T A;  1RCV D;  3HOX H;  4AQY L;  1SSO A;  5K36 H;  1D6E C;  1H9M A;  1VQJ A;  3AFP A;  2G5D A;  1YNJ D;  1B4O A;  3OW7 A;  3UDX A;  1DOK A;  2RCN A;  3W1B A;  2RSN A;  1EIG A;  1N32 Q;  2WB1 G;  3C2P A;  2JXM B;  2FHT A;  1VQ6 A;  2L55 A;  3PUZ A;  4DV3 L;  1XPO A;  3NPP A;  2ZT9 C;  2KQ3 A;  3UE0 A;  5IP7 G;  2F0M A;  3HOX B;  3R2T A;  1MBY A;  2KHJ A;  3TQY A;  4CKB A;  4IZ8 A;  1L1O B;  4H0L C;  4ULL A;  4P74 A;  3BDL A;  3MTS A;  1NUC A;  5IOD A;  4LJZ C;  3CC2 A;  4GKK Q;  5DNF A;  2JA8 B;  3D8G A;  2C9O A;  3TZD A;  4JV5 Q;  1UE5 A;  1K83 B;  2Q8T A;  4JBK A;  4RGT A;  2R61 A;  4N9T A;  2UUB L;  2GVA A;  1S5C D;  1YNN D;  2JP1 A;  1IHZ A;  1UAP A;  5T1G A;  1EZ6 A;  3VYR A;  4DR6 Q;  4ZK9 B;  4GNX C;  2PZW A;  1X9N A;  3ERQ A;  4DN4 M;  4MTK A;  1CTM A;  1JWS D;  2D0O A;  1SE2 A;  1BDO A;  1WTV A;  4GN4 B;  3EA6 A;  3T16 A;  1J5E L;  5I2Y A;  1CA6 A;  1SYG A;  2QW7 A;  5I9O A;  2ICI A;  2YTY A;  1BNZ A;  2LY7 A;  2K5N A;  4HCS A;  2CQA A;  3MEF A;  4DA2 A;  2ID0 A;  2RA4 A;  1TQO A;  2ZTD A;  3VYS A;  1D5X C;  2L12 A;  3NBH B;  4WFN 3;  1ENA A;  1I5F A;  1MSG A;  5C3X A;  4A3I G;  2JYO A;  1BOS A;  2Y0S E;  1K3B C;  5IGD A;  5BR8 Q;  1HRJ A;  5FLX L;  2A1A A;  2M2L A;  1LTT D;  3T13 A;  1HNW Q;  4JC0 A;  2MQH A;  5IYD H; 
#chains in the Genus database with same CATH homology
 5ELN A;  1EFW A;  2QGQ A;  4PMW A;  1YJW A;  4A3L H;  3B6Y A;  4A93 G;  3PCO B;  4BBS H;  4PZ7 A;  5C4X G;  1EIY B;  2L15 A;  3K7A H;  5E7N A;  2VW9 A;  2JA6 H;  5GAE C;  2K4K A;  4IJH A;  1S40 A;  1L2F A;  4LW1 A;  2KCT A;  2Z0S A;  1KIX A;  3PO3 G;  4RMF A;  1PH9 A;  1YBY A;  1OTC A;  3I4N G;  4TQU S;  4OO1 I;  2YTV A;  3HOZ G;  3HOX G;  4A76 A;  2YU9 H;  3U4Z A;  5K36 G;  1PH2 A;  1HJP A;  4DV7 L;  2NZO A;  2ZM6 Q;  4PZ6 A;  2KBN A;  2B63 H;  5IYC G;  1H95 A;  2OQK A;  4GNX A;  5JJK A;  4X65 Q;  2ES2 A;  2OTJ A;  1MIU A;  1JMC A;  1ASY A;  2CCZ A;  3E9I A;  4POG A;  4FDB A;  2AWN A;  4A3D H;  1M90 C;  3TEH B;  3J80 c;  1PH6 A;  3KOJ A;  1NE3 A;  2ALY B;  4LF4 Q;  1Z47 A;  4X62 Q;  3CAM A;  2JA8 G;  3I4M H;  4KLK A;  1W3S A;  1A0I A;  2IHF A;  3CP0 A;  5GQO A;  3I55 A;  2B3G A;  4JYA Q;  1S3O A;  1DGS A;  2CQO A;  2UUB Q;  1XPU A;  3KDF B;  5GAH C;  2MNA A;  3HFZ B;  4A3E H;  1QZG A;  1WOC A;  1U5K A;  1I6H H;  5M5X H;  3CQZ H;  1IYJ B;  2KEN A;  1GO3 E;  4R4I A;  1WJJ A;  4C3H H;  4GLX A;  3RZD H;  1XMO Q;  2JA7 H;  4O0A A;  3E9H A;  1MJE A;  1HNW L;  1WYD A;  4X64 Q;  3S1Q H;  1KHI A;  1M1K C;  4UY8 C;  4BY7 H;  1W2B A;  1C7Y A;  1PYB A;  1EQR A;  3ULL A;  3PO2 H;  1K73 C;  3DLL A;  4DV4 L;  2IHE A;  2PMZ E;  3S24 A;  2VUM G;  2UUA Q;  2VS1 A;  2VQF Q;  3A5Z B;  4YHH Q;  4HIK A;  1Q46 A;  2H5X A;  3U4V A;  3PUY A;  5C4J H;  1VQ7 A;  1L1O C;  2WB1 E;  1PFS A;  4H02 A;  5M3F H;  3BJU A;  3BZK A;  1X55 A;  5M5Y H;  1VQE A;  1MJC A;  4Y52 H;  1X3F A;  4X65 L;  1Q8K A;  4LF7 L;  4L5T A;  4HJ8 A;  3GTO H;  5C44 G;  2E2I H;  1VQ4 A;  2OQ0 A;  2PNH A;  1VQN A;  4K0K Q;  1VQK A;  1YNX A;  4LF4 L;  4X62 L;  3EBE A;  4LFC Q;  4A3M H;  4QIW E;  4JI4 Q;  4R4O A;  4JI3 Q;  4APV A;  4HIM A;  4JOI C;  1N8R C;  1E7Z A;  1X3E A;  2JA9 A;  4LF6 Q;  3AQQ A;  4JCV E;  4B3T Q;  4JYA L;  4TVA B;  2D0P A;  1YIJ A;  3GDE A;  2N78 A;  3UDF A;  4IJL A;  4JI0 Q;  4JG2 A;  1QVG A;  4DUZ Q;  3H0G G;  2WAQ G;  1CUK A;  4LUZ A;  1QUQ B;  1YVC A;  1XMO L;  5LMN W;  5IWA Q;  4R1J A;  4X64 L;  4BA2 I;  1N34 Q;  1TXY A;  2UXC L;  3HOU H;  4R4Q A;  4C2M H;  4J15 A;  3JAM i;  3KDF A;  4O2D A;  5FJ8 G;  4P75 A;  2ZJR A;  2A19 A;  2RF4 A;  4JI1 Q;  1XJV A;  2UUC Q;  1Q12 A;  1B7Y B;  3F2C A;  1Q86 C;  5DLQ E;  2UUA L;  3I4O A;  2VQF L;  3RZO H;  1SE8 A;  4GKJ Q;  2R92 H;  4KHZ A;  1E22 A;  3SGI A;  3IRB A;  4YHH L;  3RLO A;  1KL9 A;  1EIF A;  2I5L X;  4UPA A;  4DR3 L;  1G51 A;  1NBW A;  3T1H Q;  3M4Q A;  4DV5 Q;  3MXN B;  1I94 Q;  2MFI A;  4DR4 Q;  1Z9F A;  5M5W H;  3CCL A;  3K80 C;  5GAG C;  2VNU D;  3BU2 A;  5IYD G;  3K8A A;  1KC8 C;  1NJI C;  3I56 A;  1PH7 A;  2OTL A;  4A3K H;  2UXB Q;  2VZA A;  1Y1W G;  1CKN A;  2K75 A;  4K0K L;  4DV6 Q;  4BBS G;  1U0L A;  4LFC L;  1SN8 A;  4JI4 L;  2K52 A;  2BA0 A;  2AKW B;  4JI3 L;  1KQS A;  4JI8 Q;  1S72 A;  3UE1 A;  2E5L Q;  1K3R A;  2UU9 L;  4LF6 L;  3KF6 A;  2JA6 G;  4RG1 A;  1T9H A;  3PIO A;  4B3T L;  2ATW A;  4DNI A;  3F2D A;  3RN2 A;  1L1O A;  3Q8D A;  4UP8 A;  2N49 A;  5IT9 c;  1EUJ A;  4MTN A;  1VQA A;  3STB D;  2VQE Q;  1B70 B;  4DKA C;  1K8A C;  5AJ3 Q;  3FP9 A;  3PGZ A;  4JI0 L;  3K81 C;  4IFD J;  2D62 A;  3F8T A;  3M4P A;  3PIP A;  3CC7 A;  2Q2I A;  1GD7 A;  4KI0 A;  1X56 A;  5IWA L;  2UXD Q;  4UP7 A;  1OXS C;  1N34 L;  4A3D G;  2NVT H;  4QJF A;  2CWA A;  5ELO A;  2R7Z H;  4A3F H;  1D7Q A;  3I4M G;  3S14 H;  4JI1 L;  1V1Q A;  2UUC L;  1IBM Q;  3CC4 A;  5J3B A;  4GKJ L;  4DV4 Q;  1GKH A;  4JOI A;  5FLX c;  2ZJQ A;  1X65 A;  3GO5 A;  1BBW A;  4A3E G;  3A74 A;  5M3M G;  3J81 i;  3HOY G;  3T1H L;  2IX0 A;  3NEN A;  1E1T A;  4DV5 L;  4HJA A;  1UE1 A;  1QVC A;  3WWV A;  3OW2 A;  1I94 L;  1HZC A;  4DR4 L;  1Q1E A;  3RNU A;  1YHQ A;  4JC0 A;  3S2D H;  3S15 H;  2GVB A;  1IBK Q;  3KFU A;  4LF7 Q;  2UXB L;  4YWK A;  4B3M Q;  1IBL L;  4L5S A;  1N33 Q;  3PO2 G;  2NN6 G;  4A4I A;  4DV6 L;  4L5Q A;  3CPW A;  3AYH B;  1HNX Q;  1ASZ A;  2F52 A;  5IYB H;  2E5L L;  4JI8 L;  1OXT A;  3RLF A;  3M9B A;  2LSS A;  1OXU A;  4NXN Q;  1LM0 A;  1NY4 A;  1PH5 A;  1NMF A;  1YHA A;  1LYL A;  1D8L A;  3A0J A;  2VQE L;  1VQ9 A;  4XTC S;  3HKZ G;  1Y1V H;  3HOV H;  2ZTC A;  2PQA B;  5AJ3 L;  1XNR Q;  4A3G H;  2N8N A;  4DR2 Q;  3TS2 A;  2JQO A;  4JI7 Q;  2MO0 A;  4DV0 Q;  2UXD L;  2C35 B;  3I7F A;  3W5O A;  4QY7 A;  1SMX A;  1XTD A;  2UXC Q;  2BH8 A;  1JT8 A;  1PH8 A;  1VQF A;  3F1Z A;  4PG3 A;  1KXL A;  1RL2 A;  2AWO A;  4A3J H;  1IBM L;  1IXR A;  3KJO A;  3U58 A;  4NB3 A;  4YWM A;  3J81 j;  2K5V A;  3I2Z A;  3CMA A;  5IP9 G;  1PA6 A;  1PYS B;  5C4X H;  3M4O H;  1Q81 C;  5JJL A;  4A3B H;  1TWC H;  4HIO A;  3PO3 H;  4JI5 Q;  3OTO L;  4DR3 Q;  1A62 A;  3D31 A;  3J7Z C;  4HID A;  3HOZ H;  2LXK A;  1IBK L;  4ALP A;  2N3S A;  4R4T A;  2JA5 H;  1WCM H;  5FLM H;  4IPG A;  4BBR H;  1PH3 A;  4HJ5 A;  5IYC H;  5C0X G;  2R7D A;  4B3M L;  1N33 L;  4QGU A;  4A3C H;  2R93 H;  2WFW A;  4NPS A;  3M7N A;  4OWT B;  1P8L A;  3CME A;  2YTX A;  3L7Z C;  1HNX L;  2EQS A;  3CCQ A;  1PV4 A;  4B3S L;  4L5R C;  3JC6 6;  4NXN L;  4BXX G;  3PUV A;  2JA8 H;  1A8V A;  2UU9 Q;  1HR0 L;  1SFO H;  2R7F A;  1CKM A;  5EAY A;  5C0X J;  1K83 H;  1XMQ Q;  2JK8 A;  4MNO A;  1C9O A;  1XNR L;  3K0X A;  4QL5 A;  4DK6 C;  1E3P A;  4DR2 L;  4GOP B;  1TWF H;  4JI7 L;  1V43 A;  3GTL H;  3DM3 A;  1FGU A;  1AE2 A;  4DV0 L;  2Q2U A;  3GTP H;  1NTG A;  1JJC B;  4AYB G;  4A3K G;  2E2H H;  4LF5 Q;  4BY1 H;  4P72 A;  4YCU A;  1CSP A;  2CFM A;  2K5H A;  1IZ6 A;  4LWC A;  3KJP A;  3T1Y Q;  4DUY Q;  1VQO A;  3S17 H;  2MO1 A;  2WAQ E;  3J80 i;  1PHJ A;  2E2J H;  2Q2H A;  4LFA L;  2RHQ B;  2FXQ A;  4HJ7 A;  1KRT A;  4LNQ A;  1SRO A;  1FVI A;  1K9M C;  5IY0 A;  4XIG S;  4KHP Q;  4IPD A;  1EYG A;  4JI5 L;  1JB7 A;  4JBJ A;  2HQL A;  4OWX B;  1HNZ Q;  4NXM Q;  3CCS A;  1EQQ A;  2CWP A;  2F3I A;  3ULP A;  5IP7 H;  4GS3 A;  3ULJ A;  1JJ2 A;  2IT1 A;  1O7I A;  2NVY H;  3L0O A;  4AH6 A;  3NEL A;  1YJ9 A;  4A3F G;  2R7Z G;  1E1O A;  2HHH L;  3CF5 A;  1IBL Q;  2XTI A;  4GN3 B;  1VS0 A;  4A3L G;  2CKZ B;  4DK3 C;  1MKH A;  3FKI H;  2HIX A;  5H1S E;  5C3E H;  2Q2T A;  2JEA I;  2NVX H;  1BBU A;  2WP8 J;  4GNX B;  2PI2 A;  3S1R H;  3CCR A;  1XMQ L;  1JJG A;  1K0R A;  1CKO A;  2R6G A;  2HT1 A;  4B3R Q;  3K7U C;  3OYY A;  1YEZ A;  4LF8 Q;  2B63 G;  4P73 A;  3H3V I;  1WI5 A;  1L0W A;  1KRS A;  1SLJ A;  4OXP A;  4LF5 L;  1V9P A;  2IX1 A;  4DR5 Q;  1VQG A;  3RR5 A;  4OO1 G;  1BKB A;  3CCM A;  3AEV A;  3G6E A;  3TS0 A;  3T1Y L;  4DUY L;  3KF8 B;  5IYB G;  3H3V H;  3KLW A;  2Y0S G;  4GKK L;  4DR1 Q;  4IOC A;  4PZ8 A;  1X54 A;  5FJ8 H;  4GOP A;  1EWI A;  1A63 A;  1QZH A;  1QUQ A;  2NVQ H;  4KHP L;  1Y1V G;  2QEX A;  4HJ9 A;  1HNZ L;  4NXM L;  3M85 A;  3GTG H;  5JEA G;  3G48 A;  3UDI A;  3KYH C;  3OTO Q;  5LMN Q;  4R4C A;  4IO9 A;  4LF9 L;  3GTQ H;  2JA7 G;  3HOW H;  4GLA C;  1VQ8 A;  2VL6 A;  4AQY Q;  3CXC A;  1OXV A;  4UP9 A;  4AIM A;  4BY7 G;  3NEM A;  2AMC B;  3S16 H;  4IFD I;  2ZTE A;  2YYZ A;  1J6Q A;  4A3J G;  1FJG Q;  1N36 Q;  3RN5 A;  2NZH A;  5JEA J;  4JI6 Q;  2PI2 E;  3S2H H;  1Y1W H;  3VDY A;  1Y14 B;  1FL0 A;  1AH9 A;  1VQD A;  1UEB A;  4B3S Q;  4IPH A;  2A8V A;  3TRZ A;  4A3B G;  2HIV A;  2DGY A;  3ZJY C;  2ZJP A;  4A3I H;  1HR0 Q;  3CCU A;  4DPG A;  4MZ9 A;  1LUZ A;  5M3F G;  3S1M H;  1UE7 A;  4B3R L;  2KCM A;  1Q1B A;  4LF8 L;  5JJI A;  4DV3 Q;  1HZB A;  4X66 L;  4QQB X;  2JA5 G;  1WCM G;  2RHS B;  4LUO A;  5FLM G;  1VQI A;  1RIP A;  3CCE A;  4BBR G;  3M3Y H;  4IOA A;  3TRE A;  1E24 A;  4A3C G;  2R93 G;  4DR5 L;  3HKZ E;  3PF4 A;  1HZA A;  3STB C;  1GM5 A;  1C0A A;  1TWH H;  2BH2 A;  2B29 A;  3JAM c;  1WFQ A;  4A3M G;  4DR1 L;  1NMG A;  4YWL A;  4LFA Q;  1YJN A;  1TWA H;  4YY3 Q;  4A93 H;  4LFB Q;  4JI2 Q;  1VQ5 A;  1XNQ Q;  1OXX K;  3E0E A;  1N9W A;  4C3J H;  3U50 C;  1VQL A;  3EIV A;  2I5M X;  1VQH A;  4X6A H;  2QA4 A;  5M3M H;  5BR8 L;  5LMN L;  3HOY H;  3GTM H;  3I4N H;  2I5H A;  3W1G A;  2NN6 I;  3HOX H;  4AQY L;  2JJQ A;  5HY6 A;  1G6P A;  4BY1 G;  3F2B A;  2F4V Q;  1LTL A;  4EX5 A;  1VQJ A;  1X6O A;  3AFP A;  3PUX A;  4GLV B;  3HOU G;  3PV0 A;  1FJG L;  1N36 L;  4GN5 A;  4OON A;  2HHH Q;  4JI6 L;  1BVS A;  4DR7 Q;  3UDX A;  1EOV A;  4DV2 Q;  2KHI A;  3G71 A;  2RCN A;  2GN5 A;  3W1B A;  1N32 Q;  2R92 G;  3L2P A;  2WB1 G;  3D0F A;  3ICE A;  1AE3 A;  3CCV A;  4GOP C;  1K8G A;  3CCJ A;  1J5E Q;  3S1N H;  2IY5 B;  3A5U A;  5LMU Q;  4WJ4 A;  1CKN B;  1VQ6 A;  3PUZ A;  3ERS X;  4DV3 L;  2DUD A;  1XPO A;  1GVP A;  3UE0 A;  2AHO B;  3AFQ A;  5IP7 G;  1PH4 A;  5GRO A;  3CPF A;  1G29 1;  2ZM6 L;  1SR3 A;  4DV1 Q;  1I3Q H;  2KHJ A;  3KF6 B;  4A75 A;  4JBM A;  4OWW B;  3GTK H;  3TQY A;  1PVO A;  2EXD A;  1L1O B;  1XPR A;  2Z6K C;  4P74 A;  3G4S A;  3FKI G;  1CSQ A;  5C3E G;  2PQA A;  4OX9 Q;  3CC2 A;  4GKK Q;  3CW2 C;  4AYB E;  4Y7N H;  4YY3 L;  4LUV A;  2BA1 A;  4JI2 L;  1XNQ L;  4LFB L;  4JV5 Q;  1UE5 A;  2VUM H;  4P71 A;  5IP9 H;  1YIT A;  3J81 c;  4DAY B;  4JBK A;  2UUB L;  2GVA A;  2VY3 A;  1P16 A;  1KD1 C;  5C0X I;  3PUW A;  4LF9 Q;  3HKS A;  1HH2 P;  1VQB A;  1YZ6 A;  3GD7 A;  1Q7Y C;  4EQ5 A;  2F4V L;  3LGJ A;  2V1C C;  4DR6 Q;  3EN2 A;  2K14 A;  4GNX C;  1X9N A;  2JE6 I;  4DR7 L;  3FHW A;  3CD6 A;  3H15 A;  1HZ9 A;  3ER0 A;  1SRU A;  1B8A A;  2D0O A;  4DAM A;  5C44 H;  4DV2 L;  1N32 L;  1VQC A;  4GN4 B;  3RLN A;  5HGQ A;  1J5E L;  4BXX H;  2OCE A;  5LMU L;  1TWG H;  3PF5 A;  2YV5 A;  1Q82 C;  4YCW A;  3HOW G;  2YTY A;  4JBW A;  1VQM A;  1HR0 W;  2K5N A;  4X66 Q;  4DV1 L;  3PSI A;  1VCI A;  3MEF A;  4DV7 Q;  2ASB A;  2OWO A;  3H0G H;  1UE6 A;  1R9T H;  4WJ3 M;  2ID0 A;  2E8G A;  1X3G A;  2ZTD A;  3NBH B;  1UWV A;  4OX9 L;  3UDG A;  4IFD G;  1I5F A;  4ME3 A;  3GTJ H;  4JV5 L;  4A3I G;  2K50 A;  4POF A;  5GAD C;  4IPC A;  3HOV G;  5IE8 A;  4YCV A;  2Y0S E;  4BA1 I;  2JEB I;  1KAW A;  4A3G G;  1I50 H;  1VQP A;  5BR8 Q;  2I0Q A;  2A1A A;  4DUZ L;  2LXJ A;  1YI2 A;  2XGT A;  1PH1 A;  1IL2 A;  4C3I H;  2EIF A;  3J7A 5;  4DR6 L;  1JE5 A;  1HNW Q;  1YHB A;  3BZC A;  2MQH A;  1QVF A;  5IYD H;  2Z6K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...