1VQHA

Gene v protein mutant with ile 47 replaced by met 47 (i47m)
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
86
structure length
86
Chain Sequence
MIKVEIKPSQAQFTTRSGVSRQGKPYSLNEQLCYVDLGNEYPVLVKMTLDEGQPAYAPGLYTVHLSSFKVGQFGSLMIDRLRLVPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GENE V PROTEIN
publication title Potential use of additivity of mutational effects in simplifying protein engineering.
pubmed doi rcsb
source organism Enterobacteria phage f1
molecule tags Dna binding protein
total genus 9
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 1996-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02303 Phage_DNA_bind Helix-destabilising protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1vqhA00
2NZHA 3FKIG 3KYHC 4B3RQ 3BZCA 4GN4B 4A3DG 1GM5A 1JE5A 1GKHA 1Z9FA 4X6AH 3CCEA 1NE3A 4HIDA 2E8GA 3K0XA 4JC0A 4LWCA 2R6GA 2IX0A 1L2FA 2WB1G 4L5QA 1VQ5A 4TVAB 4LF5Q 3PSIA 5IE8A 4JI4L 3GTJH 4YHHQ 1JJGA 1UEBA 4IOCA 1EIYB 3K8AA 3KOJA 1OXVA 1MKHA 5ELOA 2KHIA 3RZOH 2DUDA 4IOAA 1Q81C 1FJGQ 2GN5A 4EQ5A 3I4MH 3RR5A 4A75A 1XMOL 3J80c 4JBKA 4OX9Q 2IY5B 3I4MG 3AQQA 1RL2A 1W3SA 1E24A 3H15A 2R92G 4YY3L 3W1GA 1YITA 4BBRH 4LFBQ 1VQJA 3KFUA 3TQYA 4X66L 3T1HL 3I4NG 3S17H 3TS2A 5C0XJ 1EWIA 1YZ6A 4DV3Q 5JEAG 4P71A 3RLNA 2VQFQ 4EX5A 5IY0A 2HQLA 2OTLA 3PIPA 4AQYQ 4DUYQ 5DLQE 3L7ZC 3PF5A 3KF8B 1TWGH 3JC66 3UDXA 1A62A 5C0XI 1GO3E 1J6QA 2WP8J 4XIGS 2UU9L 2HIVA 3TRZA 1FVIA 1D8LA 3J81c 3S2DH 1IBML 4B3TL 4JCVE 4LUVA 4DPGA 5LMNW 4BA2I 1EQRA 4LF6L 1KC8C 1NJIC 2WAQE 4JYAQ 5GROA 3BU2A 3RLFA 1KIXA 3HOWH 3SGIA 1JJCB 1E1OA 1VQIA 4DR7Q 5K36G 1VQBA 3HOWG 3HOXG 2PI2E 4YCVA 4A3MG 3I7FA 1VQHA 4JBJA 4NPSA 1QZHA 1X56A 3E9IA 2UXBQ 5GADC 4A3GH 4DV0L 2JA6H 1PH4A 3M85A 4A3FG 3D31A 5JJIA 1UE5A 2I0QA 1BBWA 2JEAI 3BZKA 1PFSA 2CQOA 4LUOA 2H5XA 1J5EQ 1N34Q 3M4QA 4KHZA 2N78A 1IBKL 1N36L 1OXXK 4B3MQ 3CQZH 1K8GA 4IPGA 3S15H 3U50C 4APVA 4DV7L 3OTOQ 2ES2A 4DKAC 2YTXA 3PUYA 2D0PA 2UUCL 2UUBL 4DR1Q 4DV1Q 4GN3B 3KF6A 4JI3L 1WYDA 1VS0A 2JA5H 3GTQH 1WJJA 3HOYH 4JI8L 4DAMA 3H3VH 4O0AA 4TQUS 2ATWA 1QVCA 5IP9G 3CPWA 5LMNL 4BXXH 1SN8A 4JBMA 1LYLA 5AJ3L 2BA0A 3PIOA 1X9NA 1Q8KA 1P16A 4NXMQ 3M4PA 4A3LG 4DR6Q 1IYJB 4DUZL 3PF4A 1X65A 1CUKA 3NENA 3EIVA 4Y7NH 3CCJA 1CSQA 2MO1A 2Q2HA 4A3CH 1YNXA 3STBC 3CCRA 3M3YH 4A3JG 1QUQB 3GTKH 4DR5L 2D62A 1V43A 3GO5A 5BR8Q 1G51A 4DAYB 1N32Q 4NB3A 4O2DA 5EAYA 2Z0SA 1B7YB 1AE3A 1YBYA 2CCZA 1N33L 2E5LL 1PH5A 1KRSA 4HJAA 3FP9A 2NN6I 3K80C 4BY7H 1C0AA 3HKZG 2Z6KC 2Q2IA 2OQ0A 3TREA 1JMCA 2UXDL 1G6PA 1I94L 5HGQA 4DR3L 4PZ6A 2QEXA 2N3SA 4IPDA 3GD7A 1L0WA 1O7IA 3S2HH 2ZJQA 3ERSX 1YVCA 1RIPA 3I55A 2R7FA 2F4VL 4IJLA 2LSSA 1PA6A 4DNIA 3KDFB 4R4TA 1WCMH 1Z47A 5C3EG 1Y14B 1YJWA 1IBMQ 4JBWA 4BBSH 4JV5Q 3RNUA 1CKNB 4P74A 1IZ6A 3CXCA 4HJ8A 1KHIA 4KHPQ 2ZTDA 4DV2L 3PV0A 1T9HA 1XNQQ 1YHAA 2NZOA 4JG2A 4IFDJ 2VZAA 5GQOA 3F1ZA 5J3BA 1VQLA 1M1KC 2MO0A 5IWAQ 2VNUD 2OTJA 1NTGA 2I5HA 1OTCA 2NVTH 2K50A 1SRUA 4OO1I 3FKIH 1AH9A 4C3JH 1Q1BA 4JI1Q 1CKOA 1L1OC 2Y0SE 5C4JH 1HNXQ 4A3DH 3CMAA 1EFWA 3S14H 4LF9L 4IFDI 2GVBA 4B3SQ 1NMFA 4GKKL 1L1OA 2HHHL 4X65L 5IYBG 2K4KA 4FDBA 1PV4A 4LF7L 3J80i 1LUZA 5JEAJ 3KJOA 4POFA 3PO3G 2XGTA 1SROA 4GOPC 1K83H 3MEFA 4AIMA 3OYYA 2Q2UA 2MNAA 2B3GA 4A3BG 1Q12A 3KJPA 2WFWA 4GOPA 4IPCA 1KRTA 4MZ9A 2R92H 2UUAL 1XMQQ 5IYDG 1HR0W 3CCMA 3I4NH 1HNZQ 3TS0A 2JA8H 2JA8G 1Y1VH 3CCLA 4DR2L 1HZBA 4R4IA 1Y1VG 3TEHB 3J81i 3ULJA 4X64L 5LMUL 1IBLL 1V9PA 5IP7G 1P8LA 4JI5L 2NVQH 2KBNA 4HJ7A 5M5YH 3S16H 3ZJYC 2L15A 4DV4Q 1A63A 1UE7A 3S1RH 2JA9A 2AWOA 1QZGA 1WFQA 2N49A 1I6HH 2ZM6L 4DV5L 2C35B 2EQSA 2ZTCA 4DR4Q 1D7QA 4OWXB 2RHSB 2I5MX 3T1YL 4DV6Q 3HOUG 1E3PA 2WB1E 4X62Q 2DGYA 2IT1A 1U0LA 3HOXH 2VQEL 4A3MH 3GTOH 4YWMA 5GAHC 1CKMA 4JI7L 4GKJL 4LFCL 4JI6L 1VQ4A 4QJFA 4A3FH 1HR0L 4OONA 2KCMA 3HKSA 2PMZE 1SFOH 2B29A 1M90C 3HOZG 4LF4L 2A1AA 2BH2A 3J81j 2JEBI 1PVOA 2EXDA 4GNXB 4A3IG 4LFAQ 3CMEA 3KDFA 2UXCQ 1I5FA 2ZJPA 3E0EA 3HOVG 1HH2P 4R1JA 4UPAA 4NXNL 1R9TH 2E2IH 3H3VI 5M3MH 5C0XG 4H02A 3DM3A 5IYCG 5M3FH 4P72A 4JI2L 3AFQA 4J15A 5M3MG 1HZ9A 1YHBA 5M3FG 2R93H 4A93G 2F3IA 2R93G 4YWKA 1HJPA 5IP9H 1BVSA 1N8RC 5GAEC 4QY7A 4LUZA 1BBUA 1S3OA 1LM0A 1TXYA 1VQCA 3WWVA 3G6EA 1S72A 1E22A 1QVGA 4K0KL 4A3LH 3Q8DA 3JAMi 1HNWL 3CCQA 1HZAA 1C7YA 4JI4Q 4JI0L 4B3RL 2OWOA 1X55A 2CWPA 5C4XG 4A3JH 2AHOB 2K5HA 1NMGA 2AWNA 1XMOQ 3JAMc 2JA7G 3ULPA 4JOIC 4GN5A 3NBHB 4LF5L 1PYBA 4KI0A 1H95A 1E7ZA 4YY3Q 1FL0A 4YHHL 4QL5A 2K52A 1S40A 4X66Q 2D0OA 4JOIA 3T1HQ 2NVXH 1Q86C 1W2BA 1TWAH 2XTIA 4DR2Q 2ZJRA 1FJGL 3K81C 1JJ2A 1EUJA 4OX9L 2EIFA 3STBD 4A3KG 1C9OA 1KAWA 1G291 1B8AA 3AYHB 3CF5A 4A76A 1K8AC 5M5WH 4LFBL 1PYSB 3AFPA 4QQBX 2UU9Q 1Q1EA 4L5SA 1K9MC 2MFIA 5C3EH 1PH2A 4DV3L 1NBWA 2IX1A 2VQFL 4DV5Q 4B3TQ 1SE8A 5FLMH 4LF6Q 5FLMG 2OQKA 3RN2A 2MQHA 1I3QH 4MNOA 4HIOA 4AYBG 1LTLA 3CCSA 1XNRL 4IO9A 4GLXA 3I4OA 4POGA 2BA1A 4YCUA 4YWLA 1EYGA 4MTNA 3U4VA 2OCEA 4DV0Q 2NN6G 3BJUA 1PH3A 4PMWA 1VQ6A 2ALYB 2GVAA 4UP7A 2R7ZG 4GLAC 4ME3A 4JYAL 4ALPA 4P73A 4DR7L 3GDEA 1IBKQ 1N36Q 3DLLA 2KHJA 1NY4A 3PUXA 4DK3C 1OXTA 3HKZE 2CWAA 5IYBH 3L2PA 4DV7Q 3H0GH 1MJEA 2UUBQ 4LW1A 2UUCQ 4C3HH 3EBEA 2A8VA 3H0GG 4GLVB 5JJKA 4A4IA 3KF6B 4JI3Q 3S1MH 5M5XH 3PO3H 1XPOA 3U4ZA 1J5EL 2LXKA 1N34L 4UP8A 3S1QH 1VQOA 3K7UC 4JI8Q 4R4CA 2K5NA 4PZ8A 5H1SE 5C44G 1E1TA 4B3ML 4A3BH 2R7DA 5LMNQ 1Q46A 3PCOB 1VQ8A 5AJ3Q 2CFMA 3UDFA 3OTOL 3GTPH 3F2CA 4DR1L 1PH8A 4DV1L 1N9WA 2QGQA 4R4QA 3OW2A 1KQSA 4DUZQ 3UE1A 4JI0Q 5IYDH 2JQOA 4OXPA 1VQAA 3CW2C 1V1QA 1XTDA 3E9HA 3W1BA 3UDGA 3GTMH 3EN2A 1Y1WH 4OO1G 4AYBE 4DR5Q 1Y1WG 1VQ7A 1FGUA 2WAQG 3PUZA 4IFDG 1TWFH 4DR6L 5IP7H 5FJ8H 4NXML 1N33Q 3HFZB 2E5LQ 5FJ8G 1K73C 1Q7YC 4PG3A 1EIFA 3PUVA 1TWCH 4C3IH 1YI2A 2NVYH 1K3RA 2UXDQ 1VQNA 5JJLA 1QUQA 3ULLA 4IPHA 1I94Q 5BR8L 2VS1A 4DR3Q 5IT9c 3UE0A 4GS3A 2VUMH 2PQAB 1N32L 2VY3A 2VUMG 1ASYA 2I5LX 4OWTB 4RG1A 3HOUH 4BY1H 1QVFA 3M7NA 4LNQA 1WOCA 2F4VQ 4BY1G 3RLOA 4BBRG 2V1CC 1WI5A 3ICEA 2JE6I 3F8TA 4WJ4A 3IRBA 1EOVA 4C2MH 1TWHH 1JT8A 2A19A 4L5TA 1ASZA 1B70B 3HOZH 2VW9A 1VQGA 2YV5A 4DV2Q 2E2JH 4A3IH 2CKZB 1XNRQ 4HIKA 1UE1A 1XJVA 3I2ZA 5FLXc 3RZDH 3HOVH 2RCNA 2E2HH 3CC2A 1GD7A 1UWVA 1PH1A 4JV5L 5IYCH 4LF8L 1KD1C 1VQ9A 1CKNA 3F2BA 2PI2A 2YTYA 2ASBA 4KHPL 4A93H 3UDIA 4LF9Q 2KENA 1PH7A 1X3GA 1XNQL 3GTGH 1YJ9A 3AEVA 2PNHA 3CCUA 4GKKQ 1L1OB 1XPRA 1X6OA 2HHHQ 1UE6A 4X65Q 3G71A 1KL9A 5IWAL 3MXNB 1X54A 4UP9A 4LF7Q 1EQQA 4A3GG 3ER0A 2JA6G 4JI1L 3A5ZB 3M9BA 1HNXL 1PHJA 4HJ9A 1X3FA 5C4XH 2YU9H 4L5RC 3M4OH 4B3SL 2VL6A 1A0IA 3CPFA 4R4OA 3G4SA 4Y52H 1I50H 2LXJA 2JA7H 1GVPA 3PUWA 4GOPB 1CSPA 1PH9A 1IL2A 3S24A 2AMCB 3CD6A 3W5OA 1AE2A 1SR3A 2F52A 2UUAQ 1VQEA 2ID0A 4AH6A 1U5KA 4XTCS 3PGZA 4OWWB 3A0JA 3RN5A 2N8NA 2JA5G 1SLJA 2YTVA 3HOYG 2YYZA 3PO2H 1BKBA 2ZTEA 4BXXG 3PO2G 3NEMA 4A3KH 5LMUQ 4X64Q 4A3EH 2IHFA 1IBLQ 3KLWA 1DGSA 4A3EG 4JI5Q 3D0FA 1XMQL 3L0OA 1HNZL 1VQDA 4A3CG 3J7A5 3S1NH 1VCIA 2RHQB 5GAGC 5HY6A 4PZ7A 4HIMA 2ZM6Q 3VDYA 2Y0SG 4IJHA 1JB7A 2JJQA 2JK8A 1VQFA 1OXSC 3T1YQ 1KXLA 5ELNA 4DUYL 4AQYL 3CP0A 2VQEQ 1A8VA 1X3EA 4BY7G 3CC4A 2IHEA 4JI7Q 4DV4L 4GKJQ 1PH6A 4LFCQ 4JI6Q 1VQMA 3LGJA 2Z6KA 2K75A 2HIXA 1Q82C 2PQAA 1HR0Q 4UY8C 2R7ZH 2QA4A 4DR4L 4RMFA 2KCTA 3A5UA 4LF4Q 3J7ZC 3CC7A 4DV6L 3U58A 1MIUA 1MJCA 2K5VA 1SMXA 3A74A 4DK6C 4X62L 2BH8A 1IXRA 3CAMA 3NELA 3K7AH 4P75A 1VQPA 3F2DA 1WCMG 4NXNQ 4LF8Q 5E7NA 2HT1A 3CCVA 1YIJA 4BBSG 1OXUA 2UXBL 4GNXC 1YHQA 2RF4A 3G48A 4QIWE 4JI2Q 3I56A 4YCWA 1YJNA 1YEZA 5C44H 1HZCA 2Q2TA 4WJ3M 4KLKA 2B63H 1K0RA 4GNXA 4LFAL 1XPUA 3GTLH 2FXQA 4HJ5A 4BA1I 3B6YA 2B63G 2K14A 4QGUA 3FHWA 4K0KQ 2UXCL 2AKWB 1VQKA 1HNWQ
chains in the Genus database with same CATH superfamily
4B3RQ 4GN4B 3HOXB 1WTXA 4A3MB 1II3A 2B2UC 3I91A 1Z9FA 4X6AH 3CCEA 4HIDA 4IFDH 1CHPD 3R3OA 1ESRA 2IX0A 4UHVA 2WB1G 2B2UA 5C4HA 2F0TA 5IE8A 4JI4L 2E74C 5CV4A 2EY6A 3HRZC 3K8AA 2NTSA 3NSWA 5ELOA 2DUDA 5EKKA 3I4MH 2GN5A 2IY5B 1SJHD 4DA2A 5M3FB 1W3SA 1WTQA 3NBHA 1E24A 3W1GA 4LFBQ 2A6HC 4X66L 1BR9A 5JEAH 1CHQD 4H7BA 2PQEA 2CVRA 2HQLA 5IY0A 4ODGA 5DLQE 3KF8B 3UDXA 5C0XI 1GO3E 2UU9L 2JA7B 1D2BA 4LUVA 1EQRA 4LF6L 1KC8C 3DHQA 2F0JA 1SYBA 1KIXA 4DR7Q 1VQIA 5K36G 2DY8A 2NVXB 2PI2E 4DU9A 4RAUC 2PW5A 1X56A 3OMCA 5GADC 2IL8A 4A3FG 5JJIA 1UE5A 5F2DA 4O1NA 2Z1CA 3QG1A 5M5WB 4TKOB 1IBKL 1OXXK 3S15H 4APVA 4DV7L 3OTOQ 2D0PA 1H9RA 1B4OA 1VF5C 4DR1Q 3I4LA 4FP5D 1O80A 4BWGB 5I9OA 2L11A 4RCNA 2ATWA 3CPWA 1I6VC 4JBMA 5HURA 2EYOA 1Q8KA 1P16A 2EYJA 4NXMQ 4A3CH 1RF2D 1NCVA 2RDFA 4O42A 3GTKH 2D62A 4C3HB 4DAYB 3W2DA 1YBYA 1JOOA 1N33L 4ZKBB 3K80C 1C0AA 1CTMA 1MD2D 1SNQA 2HDLA 3SK5A 1I94L 3GTPB 5C3XA 5JJZA 4IPDA 4EQNA 1BCPD 4IUTA 1GUTA 1L0WA 4QUCA 1RHPA 1RIPA 2F4VL 1Y1WB 4XXEA 1DXMA 4HMIA 1ML0D 2XWJB 4MTKA 3URYA 3RNUA 1TWFB 4P74A 3CXCA 1TVXA 2ZTDA 4DV2L 1A3TA 2L4NA 1VMPA 3SE0A 5GQOA 2XVSA 5KEEA 2VNUD 1NTGA 2I5HA 1OTCA 1LTRD 2NVTH 1SRUA 3FKIH 4C3JH 4JI1Q 3BDCA 2Y0SE 4KN4C 5C4JH 4ZQ3A 4A3DH 3S14H 4LF9L 4B3SQ 1JR0D 4C2MB 1TWHB 4X65L 3PIO3 2AQ2B 1PV4A 1EEID 1LUZA 1EU4A 2JYOA 5CC4A 4GOPC 3QO2A 1K83H 3TN2A 3A56A 3RZDB 3HOVB 2E2HB 4GOPA 4HTHA 1J8IA 4ZCKA 2BE5C 2CH4A 4A93B 1XX8A 1XMQQ 4F8MA 2UUAL 3I4NH 3TS0A 1RTNA 1ENAA 2JA8G 4KD3A 3G7LA 4R4IA 3J81i 4X64L 2WV6D 5IP7G 1B3QA 2D2CC 2KECA 3ZJYC 4Q5VA 4H0LC 2L15A 3NTHA 2EXZA 2AWOA 4EQPA 1FD7D 2KJXA 1A2UA 3NXWA 4KJOA 4OWXB 2RHSB 1TR5A 4PMCA 2VQEL 2OF1A 1WTVA 4YWMA 5GAHC 4X3SA 3PO2B 1RODA 4JI6L 4J6HA 1H9MA 4A3EB 1M90C 3K5OA 1SFOH 3QOJA 3HOZG 1PTOB 2JEBI 1PVOA 1MSHA 2EXDA 4GNXB 4A3IG 3AB9A 5CV8A 1PXUA 3MFGA 1E2WA 1K28A 2WIIB 2SNSA 3VR4A 2M00A 5M3MH 5C0XG 3H3VI 1CI3M 3D4DA 2LMCB 2F3IA 2R93G 4YWKA 4DNTB 4QF4A 1GXDC 5IP9H 4QY7A 4LUZA 1BBUA 1LM0A 1V1PB 5EGTA 2KHSA 3CCQA 2RKSA 1EY7A 2AHOB 3D4WA 3G6JB 3MZ5A 3EROA 3NBHB 1PYBA 1E7ZA 4JPBW 4K5WA 4YHHL 1S40A 4CBVA 1W2BA 2ZJRA 4C1NK 4L6TB 1F2ZA 3K81C 2EOTA 1KNEA 4A3KG 1BXTA 1KAWA 2D5DA 3AYHB 3AFPA 1Q1EA 5C3EH 3C1EA 4DV3L 2K1BA 3OSOA 5FLMG 1GUSA 5KGUA 2OQKA 2MQHA 4P2CB 1XTCD 4GLXA 1JQYD 1KLGD 4YWLA 2NYZD 3I4MB 3U4VA 5E1FA 1BCPF 1PRTD 2A6EC 1SDFA 4PMWA 4UP7A 4DF7A 3OPOA 3GDEA 4WFN3 2CW0D 1NY4A 1OXTA 3L2PA 3H0GH 4N9PA 5TSSA 3EBEA 1SE4A 2B2WA 4A4IA 3DMUA 4CKBA 5M5XH 3U4ZA 1J5EL 3IFDA 1Y8NB 2Z4IA 1A15A 4R4CA 4JI8Q 1E1TA 4DNRB 1LTID 4R4QA 4DUZQ 4JI0Q 4OXPA 2NB0A 1V1QA 3E9HA 5EJWA 1EYCA 3UDGA 4JK1C 1SEBD 2F0WA 4DK0A 4F87A 4AYBE 1VQ7A 2EJFC 1O7YA 2WAQG 2IJ0A 2F4IA 5M9OA 3BYTB 4HEDA 1TT2A 1EIGA 3P1HA 5FJ8G 1K73C 3KK7A 1EYDA 5ELEA 1K3RA 3S15B 3K5LA 3N6RA 1STBA 3A7LA 3DWPA 3UE0A 4GS3A 2PQAB 2VY3A 2VUMG 1ASYA 4RG1A 1A3VA 3U9OA 3EVQA 1DCZA 3IKJA 4BY1H 4FF3A 4BBRG 2BCOA 4RGTA 2JE6I 4WJ4A 3QR8A 2A19A 1FR3A 3V96A 1B70B 3GV3A 1E0BA 3ONAB 3E0JA 2E2JH 1XNRQ 1XJVA 1JORA 3I2ZA 1GUWA 1JWMD 3GTKB 2Y0SB 4LF8L 1EY6A 3F2BA 2BOSA 3MVVA 3UDIA 3E3XA 3GTGH 1G91A 1JB3A 2XRSD 3T51B 1X54A 4LF7Q 3ER0A 2KUMA 3O13A 1LT4D 1SE3A 3M9BA 1PHJA 4L5RC 2NZ1D 5C4XH 4XYQA 2VL6A 4R4OA 2F0SA 1I50H 5FOBB 2JA7H 4GOPB 1C8CA 4TSSA 2H4OA 2B2TC 1RTOA 4OWWB 3A0JA 2JA5G 1SLJA 2YYZA 3BYYB 2B2TA 2F0HA 2Q8RE 1IYUA 2K33A 3NEMA 2NVTB 2K28A 3KLSA 2C5CA 3FKIB 4C3JB 3KLWA 1IBLQ 4IUPA 1DGSA 5C4JB 4A3DB 2OEOA 3S14B 3L0OA 1HNZL 3HP3A 2EY1A 5HY6A 3VDYA 5CBAE 2PZWA 1VF7A 1JCKB 4IJHA 4R8NA 1PDQA 1VQFA 1EWHA 1X3EA 1F2YA 1K83B 4GKJQ 1VQMA 5JPMC 3LGJA 2HIXA 2PO4A 4J8QA 3DUZA 3NHHA 4DR4L 1SNDA 2KCTA 2K03A 3J7ZC 5ELCA 1L0XB 4DV6L 1MIUA 1MJCA 2DY7A 3A74A 3I4NB 5D3DA 1ZYRD 3VYTA 3K7AH 1EY5A 5KYLA 1HQMC 2QEJC 1MBYA 4KKUA 5E7NA 2UXBL 3CCVA 1YIJA 1OXUA 2KCCA 2K01A 1M8AA 5LL6S 5C44H 4KLKA 3GTLH 1V8QA 4UDUC 2ZXPA 2UXCL 2FMCA 2K14A 4K0KQ 1PRTF 1HNWQ 1AEXA 3SK6A 1CT1D 3K59A 1B9MA 3BZCA 3SXHA 4OO1H 1GM5A 4HMJA 1NE3A 4CGYB 4LWCA 1IHZA 1TS5A 4RHSA 4L5QA 1SFOB 4TVAB 4K6DA 3PSIA 4EGVA 4B9XA 1UEBA 1EIYB 3KOJA 2J0TD 3RZOH 3D8GA 1FJGQ 4IOAA 4A75A 4OX9Q 1D1KA 1SMYC 3AQQA 5M3MB 2EJGC 3QIAA 3K5MA 4YY3L 3KFUA 3T1HL 1EWIA 1PFBA 2MGSA 1U4RA 4KN7C 4P71A 4EX5A 3VYSA 3PIPA 1A6XA 2G9HD 3JAME 2F0UA 4DUYQ 3PF5A 1RCVD 3JC66 1J6QA 3MTSA 4X3TA 1FVIA 4CDEC 2FINB 3J80L 3S2DH 1IBML 4B3TL 4DPGA 1IYVA 5ELBA 5LMNW 4RWSC 3NTIA 1K8OA 3RLFA 3SGIA 1E1OA 1JJCB 4K2KA 3L9AX 1SYEA 3HOXG 4A3MG 3I7FA 5JPNC 4NPSA 2WINB 4A3GH 4DV0L 2JA6H 3OWEB 1H9JA 3R93A 2DJFC 1BBWA 3DEPA 3MA2B 5DAUA 2K5WA 1NAPA 3OWFA 2N78A 1N36L 3CQZH 3VR5A 2RQXA 2ES2A 1Q90A 2YTXA 3PUYA 4OEMB 4DKAC 5I9PA 1CA6A 2UUCL 2UUBL 2J4XA 4X3KA 2HQEA 3KF6A 4AYBB 1WYDA 3DM1A 4I7AA 4KY7A 1WJJA 1Y8OB 1QVCA 5LMNL 1BQQT 1X32A 2NWGA 2OT2A 5AJ3L 1EU3A 1Q8IA 1X9NA 1SNMA 3M4PA 1D5MC 1X65A 4R8IA 1CUKA 5KNBA 2F0IA 2HCCA 3WOEA 4Y7NH 1JOQA 2MO1A 1YNXA 3STBC 3M3YH 4WRDA 1G2TA 4DR5L 3M4YA 3GO5A 1V43A 3H0GB 5BR8Q 5I4DA 4NB3A 3OIPA 2Z0SA 1B7YB 3CHBD 3C2PA 4MN3A 2QCPX 4FF1A 5M5XB 3AU7A 4HJAA 3FP9A 2EY2A 4BY7H 4IURA 2Q2IA 1ONLA 1PZJD 2UXDL 5HGQA 1QNUA 2LKVA 2N3SA 4DGZA 1O7IA 3IAYA 1YVCA 3I55A 2KEDA 3RMHA 2XRQD 1PLFA 3CU7A 4HCEA 4UAIA 3KDFB 4BBSH 3Q24A 1LO5D 5KYIA 5KIXA 3Q22A 1S4ZA 5J39A 5D14A 1I4HA 2G5DA 4FNFA 4JG2A 2VZAA 1M1KC 2MO0A 2K04A 4OL7A 1IKLA 4HSPA 2OTJA 2ENBA 1Q1BA 4BY1B 1PTOD 1EFWA 4IFDI 2RSOA 4NP5A 2K32A 1K3BC 4GKKL 5FLXE 3MXNA 1FNUA 2E2JB 3KJOA 3PO3G 2XGTA 5J22A 2EYMA 1KDAA 4KY5A 4ZLTF 2Q2UA 3MFYA 3I73A 2AUJD 3KJPA 3T4AC 4IPCA 1KRTA 2R92H 1BNZA 1F9RA 4RGMA 5IYDG 3GTGB 2JA8H 3CCLA 1HZBA 1Y1VG 5AFWA 3ULJA 4DK1A 2EYFA 4JI5L 2NVQH 3SDZA 2KBNA 5C4XB 4DV4Q 1UE7A 1I50B 2F0OA 2C9OA 2N49A 2A6HD 3L3OC 2MP1A 2C35B 2EQSA 2ZTCA 4DV5L 1D7QA 2CQAA 1B44D 2I5MX 1E3PA 4X62Q 2DGYA 2MHVA 2WACA 4JI7L 5CORA 4N8X1 4LFCL 4QJFA 4OONA 2KCMA 2SOBA 1I4RA 3WDNA 1HTLD 1Q3LA 3RD4A 4LFAQ 1HHVA 1H9SA 1OO9B 1I5FA 1L0YB 3E0EA 3HOVG 4NXNL 4UPAA 2E2IH 4H02A 5IYCG 4P72A 4JI2L 3AFQA 5IGFA 2R93H 1HRJA 4A93G 1JOKA 1HJPA 5GAEC 1S72A 1S3OA 1VQCA 4WORA 3WWVA 4A3LH 3JAMi 5IOCA 1XWEA 1YNNC 4B3RL 2OWOA 1X55A 1QNKA 1SYGA 2CWPA 4A3JH 2K5HA 3K7AB 3SR1A 4CHTB 1XMOQ 3JAMc 2FJ2A 4GN5A 4F88A 3VR3A 2F1MA 4KI0A 1XXGA 5C44B 1EL0A 2K52A 3I3CA 3GTLB 3H09A 1Q86C 1TWAH 2XTIA 5ELFA 2L1BA 2EPBA 1ILQA 1B8AA 1FYCA 1G291 1AN8A 4LFBL 1TS4A 1XYIA 4L5SA 3X3NA 2MFIA 5EBDA 3QOLA 4XDXA 5FLMH 3F2UA 1DOLA 1E2ZA 3J80E 1B2TA 1I3QH 3WOFA 3A8KE 1D6EC 3RZOB 1PFMA 4MTNA 3MEHA 3TP8A 3VR2A 4FO2A 4ID6A 4GLAC 3BVGA 5I6YA 4DR7L 5CV5A 4ZK9B 3DLLA 3IL8A 2K7VA 3PUXA 1EZ6A 3HKZE 5IYBH 1STNA 5A35A 3KF6B 4JI3Q 1XPOA 2LXKA 4UP8A 3TP5A 3CRKC 4A3BH 3KLRA 3S2DB 3OTOL 3UDFA 2O2LD 4OELB 4OHJA 4DR1L 1BBXC 3C3LA 4L8JA 1KQSA 1AZQA 1PTOF 2F0FA 2JQOA 4DFAA 5LHY1 1LTAD 2E2DC 4KV6A 4A3GB 4IFDG 2JA6B 4NXML 4OIKA 5FJ8H 3HFZB 2E5LQ 1EIHA 1Q7YC 3NK9A 1EIFA 3PUVA 4C3IH 4FF2A 2F0MA 4CKEA 2X6GA 3CQZB 2BE5D 4HR7B 4L63B 1VQNA 1B3AA 3VYUA 4IPHA 4DR3Q 2VUMH 3DEOA 4OWTB 3HOUH 4LNQA 4Q0FA 3RLOA 3FDTA 4TRDA 1PFNA 3F8TA 1B1ZA 1EOVA 2M9VA 4EVOA 4ZYSA 1YNJC 1PYWD 4J1MA 4KY6A 3GP7A 5G3LD 4Y7NB 1UE1A 3M3YB 5FLXc 3X3MA 2CHBD 5IT9L 1GUGA 3CC2A 4G7HC 4LAAA 3FPUB 2K5QA 4V0BA 5IGGA 4BY7B 2KENA 1I4XA 2A73B 2EYLA 1NSNS 3CCUA 1ET6A 2HHHQ 3TSSA 1KL9A 3MXNB 1O78A 2B39A 4UP9A 1X3PA 1EQTA 4JI1L 3A5ZB 2PCFB 3KBGA 4RGOS 4B3SL 1A0IA 4Y52H 2LXJA 1AFPA 2B2YA 4BBSB 2F0NA 1PH9A 1IL2A 3MXPA 1AE2A 1VQEA 1ICFB 2EYPA 4E6IA 2N8NA 2IX3A 1SYDA 4RHRA 3HG9A 2A74C 1U9RA 2QF7A 3J7AF 1C48A 5I2YA 4DXGA 5LMUQ 2IHFA 2EE1A 2PPBC 1XMQL 1ZKOA 4ME5A 5DEHA 4A3CG 3J7A5 5JVG3 5FKAC 1VCIA 2ZM6Q 3R8BA 5C4ZA 2Y0SG 3PIP3 2JJQA 1LT5D 2JK8A 1OXSC 3T1YQ 5FK9C 4AQYL 2NBFA 3CP0A 1A8VA 3CC4A 2IHEA 2F0GA 2NN6H 1JE4A 2K75A 2Z6KA 1HR0Q 5CMDA 2R7ZH 2R92B 4LF4Q 3CC7A 3SK4A 3K0YA 1ET9A 1G2SA 2BH8A 2JA8B 3NELA 5JOBA 4P75A 2LFNA 1D5ZC 1Y8PB 2B2WC 5DNFA 4LF8Q 2HT1A 4DAPA 1SNOA 3G48A 4QIWE 4RGNA 2NVQB 3I56A 1YEZA 1CM9A 2AQ3B 2Q2TA 3VR6A 1CQFA 1K0RA 2FMMA 4KD4A 1XPUA 2FXQA 4HJ5A 1KAAA 3B6YA 2B63G 2O4XA 3FKIG 3KYHC 1KDBA 3U9SA 2OXPA 4A3DG 4PMBA 1KTKA 2Z4HA 5IGCA 2PNRC 2A69C 1GKHA 1VMCA 4IUVA 2WKDA 5EQ0A 2P5ZX 3NQIA 1BF4A 2E8GA 4JC0A 1F9QA 3HOZB 4WJWA 1VQ5A 4LF5Q 2QKIC 2JXMB 1SNPA 2Z8LA 2XNAC 1QWYA 4RFBA 2VB2X 1JJGA 4IOCA 1IW7C 1MKHA 3FPPA 2XN9C 1Q81C 4EQ5A 3RR5A 4JBKA 2E2IB 3J80c 4NDXA 2R93B 1QCBD 3H15A 3HEJA 5EPJA 4QCLA 3I4NG 4EQOA 5C0XJ 3RLNA 2VQFQ 5EKIA 5A2QL 2DNCA 2I46A 5BN3A 3W3AA 1RD9D 3TZDA 3L7ZC 2KA7A 1TWGH 4XT1B 3V2TA 2DN8A 3FRPB 4A3JB 3A8JE 1STAA 2HIVA 3TRZA 1HUNA 3D6WA 1GUNA 1UUPA 5EKLA 3A7AB 4JYAQ 3BU2A 3HKZB 4KMUC 1VQBA 3HOWG 4YCVA 1CQVA 3A54A 1TWAB 2SEBD 1VQHA 1QZHA 5I2XA 5KNCA 2UXBQ 3E6ZX 4KJNA 2A68C 3BZKA 5G3LF 2CQOA 1N34Q 3M4QA 1SYCA 4KHZA 4B3MQ 3S1NB 3MHBA 4IPGA 3J81L 1K8GA 3U50C 5LL6X 1TY0A 4DV1Q 2EY5A 4GN3B 4KKTA 3K6OA 3EA6A 1I3QB 3GTQH 3HOYH 5C5LA 1QILA 1LV9A 4JI8L 4DAMA 4O0AA 2K6AA 3R2IA 3GQBA 5IP9G 4BXXH 4KTAA 1LYLA 2BA0A 3PIOA 3OW7A 1SSOA 4DR6Q 4DUZL 2EZVA 2RDHA 4RKBA 1WD1A 3CCJA 2PYKA 2Q2HA 3CCRA 1DONA 1G51A 3IFTA 3QJYA 1N32Q 2CCZA 4IZ8A 1PH5A 4A3BB 4PZ6A 2QEXA 4FYDA 2JP1A 1TS3A 3TZUA 3S2HH 2ZJQA 1T5XD 1S5BD 1CA5A 1SAPA 1JWUD 4R4TA 1WCMH 4HAEA 5C3EG 1IBMQ 1G6ZA 4JBWA 4JV5Q 1FGBD 4HJ8A 1KHIA 4KHPQ 5IT9E 3PV0A 1T9HA 3KF8A 1XNQQ 4C3IB 3SVMA 5E3FA 5CV7A 5J3BA 2VUMB 4LJZC 4YIJA 2NUCA 3OIQA 3Q6SA 5IWAQ 1STGA 4OO1I 2K50A 1AH9A 3HOUB 1CKOA 1L1OC 3DWQA 1HNXQ 3H6MA 1NMFA 1L1OA 2N88A 4FDBA 1B53A 4LF7L 1KNAA 1BDOA 3T16A 1GUOA 4POFA 4K5XA 1SROA 4HN7A 3MEFA 4AIMA 2MNAA 1Q12A 4CDFC 3QB3A 3VA7A 2EJMA 4G57A 3CCMA 4XQQA 2K5DA 2LS01 1G8ZD 1Y1VH 4DR2L 1SYFA 3EFXD 1IBLL 4RCOA 4G7OC 1V9PA 3H94A 2RCFA 1DOMA 1P8LA 1GHJA 1GJXA 3S16H 1SMYD 5EPKA 1A63A 2XSCA 1NR4A 2JA9A 3S1RH 1QZGA 1WFQA 4DAYA 1I6HH 1BOSA 4LMQD 4K6LA 2QDBA 3EJIA 2WB1E 5K36H 3GTOH 3D6CA 2F3WA 1CKMA 4GKJL 3UI2A 1I4PA 1D1IA 4QIWB 4A3FH 5C6AA 2PMZE 1ZXTA 2B29A 3J81j 3SK8A 4CDDC 2ZJPA 3Q23A 4B08A 1R9TH 1HXYD 3DM3A 1B50A 2EVBA 4J15A 1HZ9A 5M3FG 2CH4W 4IUUA 1WTRA 3G6EA 4K0KL 1E22A 1DOKA 4ZKCB 3K57A 1M4VA 1HNWL 2R7ZB 1H9KA 1HZAA 5JAVA 4JI4Q 2RBMA 2JSOA 1U4PA 5C4XG 2AWNA 1WTOA 4I65A 3NBIA 2JA7G 3ULPA 2F0QA 4JOIC 1Y69U 2MPMA 4C56C 1MI2A 4X66Q 2D0OA 4JOIA 4R9WA 1HPCA 2SNMA 1FJGL 3PQIA 1JJ2A 1EUJA 4OX9L 2EIFA 3LNNA 3STBD 4M8AA 5E4WC 4G4KA 4JVZA 3CF5A 1K8AC 1EOTA 1PYSB 2UU9Q 3NWSA 1K9MC 1PH2A 1NBWA 4DV5Q 1SE8A 3EQLC 4LF6Q 2KOLA 5CBEE 2QDLA 3P7JA 3RN2A 4HIOA 2B2VA 1LTLA 1ENFA 5DM73 4ULLA 4POGA 1EYGA 1F9SA 3BJUA 1VQ6A 5KNDA 2GVAA 1EY9A 3VA5A 3ND8A 1IBKQ 4DK3C 4XT3B 4DV7Q 1MJEA 1PTOC 5JJKA 4C3HG 3J81E 1QB5D 1PZID 3S1MH 1PMRA 1TWGB 1SNCA 1QG7A 4PNYA 1VQOA 3S1QH 1QE6A 1E2VA 2K5NA 2PW7A 4PZ8A 5H1SE 5C44G 1VQ8A 3QWNA 1PH8A 2QGQA 3OW2A 4NW2A 4KHVA 2X6LA 1VQAA 3W1BA 3GTMH 4OO1G 1AW7A 1Y1WG 1KDCA 1FGUA 1V1PA 5IP7H 1SE2A 1N33Q 4MHEA 1K8MA 3FVQA 1TWCH 1YI2A 4RKLA 1RKNA 4NKLA 1QUQA 2O5JC 1I94Q 5BR8L 2VS1A 5IT9c 1QVFA 3M7NA 5ISRA 5D3IB 2F4VQ 3GTQB 3HOYB 2AQ1B 2BDOA 4DN4M 2V1CC 4CKCA 1LTTD 2PZUA 1JT8A 1WTPA 4L5TA 1ASZA 3HOZH 2IWHA 1VQGA 2YV5A 4DV2Q 3T56B 4A3IH 5FO9B 1ZEQX 2CKZB 4HIKA 1DD2A 1UWVA 1PH1A 5C0XH 5IIFA 4CJ2C 1CKNA 2PI2A 5EBCA 2YTYA 2F0EA 1A2TA 4LF9Q 1X3GA 2PNHA 2TSSA 1L1OB 4ILWA 5BN4A 1UE6A 4X65Q 4PQXA 3HZXA 5CGKA 1EQQA 4A3GG 2JA6G 3S2HB 1TU2B 4HJ9A 2YU9H 3M4OH 3BS1A 1T5EA 1WCMB 3PUWA 2NTTA 1CSPA 3S24A 2AMCB 3CD6A 1U4LA 1SR3A 2F52A 2UUAQ 2ID0A 1U5KA 3PGZA 2TMPA 1S5ED 1YNND 1BKBA 1CFMA 3PO2G 4ZUIA 4CJ1B 4A3KH 4FVMA 4X64Q 4A3EG 1HFNA 1B9NA 1VQDA 1CK1A 1BCPC 3S1NH 5IGDA 2RHQB 2I07B 1MHWC 2WB1B 1U4MA 3PO3B 1K0SA 2V4DA 2VQEQ 4BY7G 4DV4L 2PMZB 1PH6A 4JI6Q 5D65A 1UEAB 5COYA 1Q82C 2PQAA 3NQTA 2QA4A 4RMFA 3A5UA 4X3UA 4QB4A 3U58A 2K5VA 4X62L 4DK6C 3NUCA 5CYUA 2ZXOA 1Y1VB 3T13A 2VXWA 1MSGA 4BBSG 1KABA 2L12A 1HFGA 2RF4A 3D3RA 3K5NA 4OIJA 1F9PA 1IKMA 3S16B 4ZAIA 2NVYB 4IUQA 2B63H 4LFAL 3S1RB 2AKWB 1I6HB 2F0LA 1BUVT 5HGTA 3C46A 2NZHA 5DM63 5T1IA 2F0PA 3GTOB 4C1NI 1JE5A 4CJ0B 2F3VA 1EYAA 1QOHA 3K0XA 4A3FB 2R6GA 1L2FA 1A3UA 3GTJH 4YHHQ 3R2TA 3D4RA 2BDNA 3J7AV 1OXVA 2KHIA 1S5CD 2RDGA 1DM0B 4K14A 1XMOL 1R9TB 3I4MG 1RDPD 5C3WA 1RL2A 5T1GA 2R92G 1YITA 1W6JA 3ZYYX 4BBRH 1VQJA 2E75C 3TQYA 3S17H 3TS2A 1EZ8A 1YZ6A 4DV3Q 5JEAG 4GZYC 2OTLA 1JICA 1HQRD 3DWAA 4AQYQ 3KLSX 1A62A 4FF4A 2WP8J 4XIGS 1D8LA 3J81c 2EYHA 3A8IE 4JCVE 4BA2I 1NJIC 2ICIA 2WAQE 5ELDA 5GROA 3HOWH 3MC0B 1YNJD 1LLRD 2N55A 3CKIB 4JBJA 3TMEA 3E9IA 3I8ZA 1EY8A 1PH4A 1DYQA 1I4QA 3D31A 3M85A 2JEAI 2I0QA 1PFSA 4LUOA 2H5XA 1J5EQ 3C1FA 2B2YC 1LACA 1HUMA 2J7ZA 3MWYW 1V1OA 3MXGA 1SBBB 1EWCA 1STYA 3NTKA 4JI3L 3BZDB 1VS0A 2JA5H 3SHLA 1Z7TA 2DJGC 3OOCA 3H3VH 4TQUS 1S5FD 1SN8A 1LT6D 4A3LG 5J1ZA 1IYJB 3TDQA 3PF4A 3NENA 3EIVA 1CSQA 3MXUA 3V05A 1CZWA 4A3JG 1QUQB 1KLUD 4O2DA 2HDMA 5EAYA 1GHKA 1AE3A 3I90A 2E5LL 3S1MB 1KRSA 3S1QB 2NN6I 3HKZG 2Z6KC 4IALA 4K8JA 2OQ0A 3TREA 1JMCA 1UNSA 1G6PA 2XIWA 4DR3L 1R4PB 1WTWA 3GD7A 3H3VC 3ERSX 2X69A 2L0CA 1WTHA 1MGSA 3GTMB 2R7FA 2F0VA 1PRTC 2LSSA 4IJLA 1PA6A 1H9SB 4DNIA 3JAML 1Z47A 1YJWA 1Y14B 4M1UB 3VYRA 1CKNB 1TY2A 1IZ6A 3PMFA 4H44C 1ILPA 4KK7A 2CW0C 1TWCB 1YHAA 2A6ED 2NZOA 4IFDJ 3F1ZA 1VQLA 5K5PA 5IGBA 2G9DA 1O7ZA 4C3JG 3MAQA 1ICWA 3CMAA 2GVBA 2Z6BA 2HHHL 2ZT9C 5IYBG 2K4KA 3DXJC 3J80i 5C5MA 5JEAJ 1DJRD 4A3IB 3I72A 2L5TA 4XYOA 3OYYA 2B3GA 4A3BG 2WFWA 1LABA 1EY0A 4MZ9A 2A69D 2L55A 4OGQC 1HR0W 1HNZQ 3BDLA 3TP7A 3LX0A 3TBIB 4H13C 3TEHB 1BCPB 1IW7D 5LMUL 2B8GA 1NUCA 4HJ7A 2YU9B 5M5YH 3M4OB 1RJTA 4C3IG 2RA4A 3LWEA 3GV6A 3ND9A 5BN5A 2ZM6L 4DAVA 1LT3D 4DR4Q 1BO0A 3T1YL 4DV6Q 3HOUG 2IT1A 1U0LA 3HOXH 1I4GA 2MUYA 1LTBD 4A3MH 1UAPA 2KCNA 3ERQA 2KQ3A 5CR3A 2VB3X 2K05A 1VQ4A 3BVMA 2MJ8A 4A3KB 4N8FA 1HR0L 3HKSA 4LF4L 2A1AA 2BH2A 3RUZA 3CMEA 1W6KA 3KDFA 2UXCQ 4ZUJA 4IN3A 4QUFA 4NMZA 5IODA 1HH2P 2FFKB 4R1JA 4RA8A 3OHXC 4ABNA 3S9WA 2H1EA 5M3FH 5M3MG 1YHBA 3HS0C 1QJOA 1AZPA 2A68D 1F2MA 1BVSA 1N8RC 3J7YW 1TXYA 1QVGA 4HCSA 3I70A 3H91A 3Q8DA 2ICEC 3ITPA 1LTGD 1ENCA 1C7YA 4JI0L 2F03A 2M2LA 5FLXL 1HCZA 3AMUA 1NMGA 4K8IA 2Q8TA 1JWSD 2O5IC 5FO8B 4LF5L 2GA4B 1DZ1A 1H95A 4YY3Q 1D5XC 1FL0A 3TP6A 4MIUA 4I7ZC 4QL5A 2B63B 3T1HQ 2NVXH 4DR2Q 1WD0A 2IW3A 4PV1C 4RH6A 1C9OA 4XQNA 1GOZA 4A76A 4QQBX 5M5WH 2D9UA 3M7GA 2WAQB 2IX1A 2VQFL 5IGEA 4B3TQ 2PZTA 2Z9HA 1Z6HA 2RVLA 1ZYRC 2XWBB 3GTJB 2ZXRA 4MNOA 4AYBG 3CCSA 1XNRL 2QW7A 4IO9A 3I4OA 1PZKD 2BA1A 4YCUA 2OCEA 4DV0Q 2NN6G 1PH3A 2ALYB 2R7ZG 3KBXA 4ME3A 4JYAL 4ALPA 1NNXA 5I6WA 4P73A 4BBRB 4KKSA 2Q8IB 3BVZA 3S17B 1N36Q 2JN4A 1LTSD 2KHJA 4K2LA 2CWAA 2UUBQ 2UUCQ 4LW1A 4C3HH 2A8VA 3H0GG 4GLVB 2F0KA 1R4QB 3PO3H 1S5DD 1N34L 1EFID 3K7UC 2LY7A 4B3ML 2R7DA 5LMNQ 1Q46A 3PCOB 2A5HA 5AJ3Q 2FHTA 2CFMA 3GTPH 2B8FA 3F2CA 4DV1L 1N9WA 3UE1A 5IYDH 3HOWB 3CW2C 4U68A 1XTDA 4IQZA 3EN2A 1Y1WH 4CDCC 2HUGA 4DR5Q 3PUZA 1TWFH 2R3ZA 4DR6L 2QILA 3OMGA 3BG3A 1F2LA 4PG3A 1EEFD 3NPPA 2NVYH 2UXDQ 5E4XA 5JJLA 2E76C 3ULLA 4FXDA 1HA5A 1N32L 1IL8A 2I5LX 4B9WA 4Z9CB 2R61A 1WOCA 2IPKD 2JA5B 4BY1G 3K58A 4LK1C 4QMGA 1STHA 1WI5A 3ICEA 3IRBA 1SJED 2F0DA 4C2MH 1TWHH 1PRTB 3KUPA 4BS9A 2KEEA 2VW9A 4FXKC 1HTPA 1J9OA 2HCIA 3RZDH 3HOVH 2RCNA 3T53B 3Q0AA 2E2HH 1GD7A 4XQJA 4JV5L 5IYCH 1KD1C 1VQ9A 2ASBA 5JVH3 4KHPL 3FEWX 4A93H 1PH7A 1XNQL 1YJ9A 3AEVA 1X3QA 1XPRA 3N52A 4GKKQ 1X6OA 3G71A 5IWAL 3NP8A 4K5VA 5NUCA 4DXFA 4U673 1CZGA 1HNXL 1X3FA 1C4QA 4HSVA 3CPFA 3HGBA 5C3EB 4JW0A 3CRLC 3G4SA 1FNVA 1GVPA 4G7ZC 3W5OA 1JC7A 2AUKA 4AH6A 4XTCS 1AP0A 3RN5A 1VDZA 3HOYG 2YTVA 1STEA 3PO2H 2ZTEA 3NWTA 4BXXG 3E5SA 4A3EH 5EPLA 2SDFA 3BDOA 1SXTA 4JI5Q 1PTOH 3D0FA 5A2QE 2HD3A 1ESFA 5GAGC 4PZ7A 4HIMA 5L37A 2B2VC 1JB7A 4ZRZA 1EY4A 1KXLA 5ELNA 4DUYL 5FO7B 1TIID 3FMCA 4JI7Q 4LFCQ 3LWUA 2WKCA 4IUNA 3SEBA 4UY8C 4FXGC 4V190 4S3SA 1HA6A 1SMXA 3A55A 4F7XA 3NE5B 1IXRA 3CAMA 4N9TA 2L9HA 1FNWA 1VQPA 5CV6A 1F77A 1NR2A 3F2DA 1WCMG 4NXNQ 1TS2A 3P75A 1TKWB 4GNXC 1WVLA 5KRUA 1YHQA 2RSNA 4JI2Q 1O7LA 1YJNA 4YCWA 1EQVA 5M5YB 1HZCA 2DNEA 4WJ3M 4GNXA 5CV9A 4BA1I 2EDGA 2KVMA 4QGUA 3FHWA 1VQKA 3P20A 1TQOA
chains in the Genus database with same CATH topology
2NZHA 3FKIG 3KYHC 4B3RQ 3BZCA 4GN4B 4A3DG 1GM5A 1JE5A 1GKHA 1Z9FA 4X6AH 3CCEA 1NE3A 4HIDA 2E8GA 3K0XA 4JC0A 4LWCA 2R6GA 2IX0A 1L2FA 2WB1G 4L5QA 1VQ5A 4TVAB 4LF5Q 3PSIA 5IE8A 4JI4L 3GTJH 4YHHQ 1JJGA 1UEBA 4IOCA 1EIYB 3K8AA 3KOJA 1OXVA 1MKHA 5ELOA 2KHIA 3RZOH 2DUDA 4IOAA 1Q81C 1FJGQ 2GN5A 4EQ5A 3I4MH 3RR5A 4A75A 1XMOL 3J80c 4JBKA 4OX9Q 2IY5B 3I4MG 3AQQA 1RL2A 1W3SA 1E24A 3H15A 2R92G 4YY3L 3W1GA 1YITA 4BBRH 4LFBQ 1VQJA 3KFUA 3TQYA 4X66L 3T1HL 3I4NG 3S17H 3TS2A 5C0XJ 1EWIA 1YZ6A 4DV3Q 5JEAG 4P71A 3RLNA 2VQFQ 4EX5A 5IY0A 2HQLA 2OTLA 3PIPA 4AQYQ 4DUYQ 5DLQE 3L7ZC 3PF5A 3KF8B 1TWGH 3JC66 3UDXA 1A62A 5C0XI 1GO3E 1J6QA 2WP8J 4XIGS 2UU9L 2HIVA 3TRZA 1FVIA 1D8LA 3J81c 3S2DH 1IBML 4B3TL 4JCVE 4LUVA 4DPGA 5LMNW 4BA2I 1EQRA 4LF6L 1KC8C 1NJIC 2WAQE 4JYAQ 5GROA 3BU2A 3RLFA 1KIXA 3HOWH 3SGIA 1JJCB 1E1OA 1VQIA 4DR7Q 5K36G 1VQBA 3HOWG 3HOXG 2PI2E 4YCVA 4A3MG 3I7FA 1VQHA 4JBJA 4NPSA 1QZHA 1X56A 3E9IA 2UXBQ 5GADC 4A3GH 4DV0L 2JA6H 1PH4A 3M85A 4A3FG 3D31A 5JJIA 1UE5A 2I0QA 1BBWA 2JEAI 3BZKA 1PFSA 2CQOA 4LUOA 2H5XA 1J5EQ 1N34Q 3M4QA 4KHZA 2N78A 1IBKL 1N36L 1OXXK 4B3MQ 3CQZH 1K8GA 4IPGA 3S15H 3U50C 4APVA 4DV7L 3OTOQ 2ES2A 4DKAC 2YTXA 3PUYA 2D0PA 2UUCL 2UUBL 4DR1Q 4DV1Q 4GN3B 3KF6A 4JI3L 1WYDA 1VS0A 2JA5H 3GTQH 1WJJA 3HOYH 4JI8L 4DAMA 3H3VH 4O0AA 4TQUS 2ATWA 1QVCA 5IP9G 3CPWA 5LMNL 4BXXH 1SN8A 4JBMA 1LYLA 5AJ3L 2BA0A 3PIOA 1X9NA 1Q8KA 1P16A 4NXMQ 3M4PA 4A3LG 4DR6Q 1IYJB 4DUZL 3PF4A 1X65A 1CUKA 3NENA 3EIVA 4Y7NH 3CCJA 1CSQA 2MO1A 2Q2HA 4A3CH 1YNXA 3STBC 3CCRA 3M3YH 4A3JG 1QUQB 3GTKH 4DR5L 2D62A 1V43A 3GO5A 5BR8Q 1G51A 4DAYB 1N32Q 4NB3A 4O2DA 5EAYA 2Z0SA 1B7YB 1AE3A 1YBYA 2CCZA 1N33L 2E5LL 1PH5A 1KRSA 4HJAA 3FP9A 2NN6I 3K80C 4BY7H 1C0AA 3HKZG 2Z6KC 2Q2IA 2OQ0A 3TREA 1JMCA 2UXDL 1G6PA 1I94L 5HGQA 4DR3L 4PZ6A 2QEXA 2N3SA 4IPDA 3GD7A 1L0WA 1O7IA 3S2HH 2ZJQA 3ERSX 1YVCA 1RIPA 3I55A 2R7FA 2F4VL 4IJLA 2LSSA 1PA6A 4DNIA 3KDFB 4R4TA 1WCMH 1Z47A 5C3EG 1Y14B 1YJWA 1IBMQ 4JBWA 4BBSH 4JV5Q 3RNUA 1CKNB 4P74A 1IZ6A 3CXCA 4HJ8A 1KHIA 4KHPQ 2ZTDA 4DV2L 3PV0A 1T9HA 1XNQQ 1YHAA 2NZOA 4JG2A 4IFDJ 2VZAA 5GQOA 3F1ZA 5J3BA 1VQLA 1M1KC 2MO0A 5IWAQ 2VNUD 2OTJA 1NTGA 2I5HA 1OTCA 2NVTH 2K50A 1SRUA 4OO1I 3FKIH 1AH9A 4C3JH 1Q1BA 4JI1Q 1CKOA 1L1OC 2Y0SE 5C4JH 1HNXQ 4A3DH 3CMAA 1EFWA 3S14H 4LF9L 4IFDI 2GVBA 4B3SQ 1NMFA 4GKKL 1L1OA 2HHHL 4X65L 5IYBG 2K4KA 4FDBA 1PV4A 4LF7L 3J80i 1LUZA 5JEAJ 3KJOA 4POFA 3PO3G 2XGTA 1SROA 4GOPC 1K83H 3MEFA 4AIMA 3OYYA 2Q2UA 2MNAA 2B3GA 4A3BG 1Q12A 3KJPA 2WFWA 4GOPA 4IPCA 1KRTA 4MZ9A 2R92H 2UUAL 1XMQQ 5IYDG 1HR0W 3CCMA 3I4NH 1HNZQ 3TS0A 2JA8H 2JA8G 1Y1VH 3CCLA 4DR2L 1HZBA 4R4IA 1Y1VG 3TEHB 3J81i 3ULJA 4X64L 5LMUL 1IBLL 1V9PA 5IP7G 1P8LA 4JI5L 2NVQH 2KBNA 4HJ7A 5M5YH 3S16H 3ZJYC 2L15A 4DV4Q 1A63A 1UE7A 3S1RH 2JA9A 2AWOA 1QZGA 1WFQA 2N49A 1I6HH 2ZM6L 4DV5L 2C35B 2EQSA 2ZTCA 4DR4Q 1D7QA 4OWXB 2RHSB 2I5MX 3T1YL 4DV6Q 3HOUG 1E3PA 2WB1E 4X62Q 2DGYA 2IT1A 1U0LA 3HOXH 2VQEL 4A3MH 3GTOH 4YWMA 5GAHC 1CKMA 4JI7L 4GKJL 4LFCL 4JI6L 1VQ4A 4QJFA 4A3FH 1HR0L 4OONA 2KCMA 3HKSA 2PMZE 1SFOH 2B29A 1M90C 3HOZG 4LF4L 2A1AA 2BH2A 3J81j 2JEBI 1PVOA 2EXDA 4GNXB 4A3IG 4LFAQ 3CMEA 3KDFA 2UXCQ 1I5FA 2ZJPA 3E0EA 3HOVG 1HH2P 4R1JA 4UPAA 4NXNL 1R9TH 2E2IH 3H3VI 5M3MH 5C0XG 4H02A 3DM3A 5IYCG 5M3FH 4P72A 4JI2L 3AFQA 4J15A 5M3MG 1HZ9A 1YHBA 5M3FG 2R93H 4A93G 2F3IA 2R93G 4YWKA 1HJPA 5IP9H 1BVSA 1N8RC 5GAEC 4QY7A 4LUZA 1BBUA 1S3OA 1LM0A 1TXYA 1VQCA 3WWVA 3G6EA 1S72A 1E22A 1QVGA 4K0KL 4A3LH 3Q8DA 3JAMi 1HNWL 3CCQA 1HZAA 1C7YA 4JI4Q 4JI0L 4B3RL 2OWOA 1X55A 2CWPA 5C4XG 4A3JH 2AHOB 2K5HA 1NMGA 2AWNA 1XMOQ 3JAMc 2JA7G 3ULPA 4JOIC 4GN5A 3NBHB 4LF5L 1PYBA 4KI0A 1H95A 1E7ZA 4YY3Q 1FL0A 4YHHL 4QL5A 2K52A 1S40A 4X66Q 2D0OA 4JOIA 3T1HQ 2NVXH 1Q86C 1W2BA 1TWAH 2XTIA 4DR2Q 2ZJRA 1FJGL 3K81C 1JJ2A 1EUJA 4OX9L 2EIFA 3STBD 4A3KG 1C9OA 1KAWA 1G291 1B8AA 3AYHB 3CF5A 4A76A 1K8AC 5M5WH 4LFBL 1PYSB 3AFPA 4QQBX 2UU9Q 1Q1EA 4L5SA 1K9MC 2MFIA 5C3EH 1PH2A 4DV3L 1NBWA 2IX1A 2VQFL 4DV5Q 4B3TQ 1SE8A 5FLMH 4LF6Q 5FLMG 2OQKA 3RN2A 2MQHA 1I3QH 4MNOA 4HIOA 4AYBG 1LTLA 3CCSA 1XNRL 4IO9A 4GLXA 3I4OA 4POGA 2BA1A 4YCUA 4YWLA 1EYGA 4MTNA 3U4VA 2OCEA 4DV0Q 2NN6G 3BJUA 1PH3A 4PMWA 1VQ6A 2ALYB 2GVAA 4UP7A 2R7ZG 4GLAC 4ME3A 4JYAL 4ALPA 4P73A 4DR7L 3GDEA 1IBKQ 1N36Q 3DLLA 2KHJA 1NY4A 3PUXA 4DK3C 1OXTA 3HKZE 2CWAA 5IYBH 3L2PA 4DV7Q 3H0GH 1MJEA 2UUBQ 4LW1A 2UUCQ 4C3HH 3EBEA 2A8VA 3H0GG 4GLVB 5JJKA 4A4IA 3KF6B 4JI3Q 3S1MH 5M5XH 3PO3H 1XPOA 3U4ZA 1J5EL 2LXKA 1N34L 4UP8A 3S1QH 1VQOA 3K7UC 4JI8Q 4R4CA 2K5NA 4PZ8A 5H1SE 5C44G 1E1TA 4B3ML 4A3BH 2R7DA 5LMNQ 1Q46A 3PCOB 1VQ8A 5AJ3Q 2CFMA 3UDFA 3OTOL 3GTPH 3F2CA 4DR1L 1PH8A 4DV1L 1N9WA 2QGQA 4R4QA 3OW2A 1KQSA 4DUZQ 3UE1A 4JI0Q 5IYDH 2JQOA 4OXPA 1VQAA 3CW2C 1V1QA 1XTDA 3E9HA 3W1BA 3UDGA 3GTMH 3EN2A 1Y1WH 4OO1G 4AYBE 4DR5Q 1Y1WG 1VQ7A 1FGUA 2WAQG 3PUZA 4IFDG 1TWFH 4DR6L 5IP7H 5FJ8H 4NXML 1N33Q 3HFZB 2E5LQ 5FJ8G 1K73C 1Q7YC 4PG3A 1EIFA 3PUVA 1TWCH 4C3IH 1YI2A 2NVYH 1K3RA 2UXDQ 1VQNA 5JJLA 1QUQA 3ULLA 4IPHA 1I94Q 5BR8L 2VS1A 4DR3Q 5IT9c 3UE0A 4GS3A 2VUMH 2PQAB 1N32L 2VY3A 2VUMG 1ASYA 2I5LX 4OWTB 4RG1A 3HOUH 4BY1H 1QVFA 3M7NA 4LNQA 1WOCA 2F4VQ 4BY1G 3RLOA 4BBRG 2V1CC 1WI5A 3ICEA 2JE6I 3F8TA 4WJ4A 3IRBA 1EOVA 4C2MH 1TWHH 1JT8A 2A19A 4L5TA 1ASZA 1B70B 3HOZH 2VW9A 1VQGA 2YV5A 4DV2Q 2E2JH 4A3IH 2CKZB 1XNRQ 4HIKA 1UE1A 1XJVA 3I2ZA 5FLXc 3RZDH 3HOVH 2RCNA 2E2HH 3CC2A 1GD7A 1UWVA 1PH1A 4JV5L 5IYCH 4LF8L 1KD1C 1VQ9A 1CKNA 3F2BA 2PI2A 2YTYA 2ASBA 4KHPL 4A93H 3UDIA 4LF9Q 2KENA 1PH7A 1X3GA 1XNQL 3GTGH 1YJ9A 3AEVA 2PNHA 3CCUA 4GKKQ 1L1OB 1XPRA 1X6OA 2HHHQ 1UE6A 4X65Q 3G71A 1KL9A 5IWAL 3MXNB 1X54A 4UP9A 4LF7Q 1EQQA 4A3GG 3ER0A 2JA6G 4JI1L 3A5ZB 3M9BA 1HNXL 1PHJA 4HJ9A 1X3FA 5C4XH 2YU9H 4L5RC 3M4OH 4B3SL 2VL6A 1A0IA 3CPFA 4R4OA 3G4SA 4Y52H 1I50H 2LXJA 2JA7H 1GVPA 3PUWA 4GOPB 1CSPA 1PH9A 1IL2A 3S24A 2AMCB 3CD6A 3W5OA 1AE2A 1SR3A 2F52A 2UUAQ 1VQEA 2ID0A 4AH6A 1U5KA 4XTCS 3PGZA 4OWWB 3A0JA 3RN5A 2N8NA 2JA5G 1SLJA 2YTVA 3HOYG 2YYZA 3PO2H 1BKBA 2ZTEA 4BXXG 3PO2G 3NEMA 4A3KH 5LMUQ 4X64Q 4A3EH 2IHFA 1IBLQ 3KLWA 1DGSA 4A3EG 4JI5Q 3D0FA 1XMQL 3L0OA 1HNZL 1VQDA 4A3CG 3J7A5 3S1NH 1VCIA 2RHQB 5GAGC 5HY6A 4PZ7A 4HIMA 2ZM6Q 3VDYA 2Y0SG 4IJHA 1JB7A 2JJQA 2JK8A 1VQFA 1OXSC 3T1YQ 1KXLA 5ELNA 4DUYL 4AQYL 3CP0A 2VQEQ 1A8VA 1X3EA 4BY7G 3CC4A 2IHEA 4JI7Q 4DV4L 4GKJQ 1PH6A 4LFCQ 4JI6Q 1VQMA 3LGJA 2Z6KA 2K75A 2HIXA 1Q82C 2PQAA 1HR0Q 4UY8C 2R7ZH 2QA4A 4DR4L 4RMFA 2KCTA 3A5UA 4LF4Q 3J7ZC 3CC7A 4DV6L 3U58A 1MIUA 1MJCA 2K5VA 1SMXA 3A74A 4DK6C 4X62L 2BH8A 1IXRA 3CAMA 3NELA 3K7AH 4P75A 1VQPA 3F2DA 1WCMG 4NXNQ 4LF8Q 5E7NA 2HT1A 3CCVA 1YIJA 4BBSG 1OXUA 2UXBL 4GNXC 1YHQA 2RF4A 3G48A 4QIWE 4JI2Q 3I56A 4YCWA 1YJNA 1YEZA 5C44H 1HZCA 2Q2TA 4WJ3M 4KLKA 2B63H 1K0RA 4GNXA 4LFAL 1XPUA 3GTLH 2FXQA 4HJ5A 4BA1I 3B6YA 2B63G 2K14A 4QGUA 3FHWA 4K0KQ 2UXCL 2AKWB 1VQKA 1HNWQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NZH A;  3FKI G;  3KYH C;  4B3R Q;  3BZC A;  4GN4 B;  4A3D G;  1GM5 A;  1JE5 A;  1GKH A;  1Z9F A;  4X6A H;  3CCE A;  1NE3 A;  4HID A;  2E8G A;  3K0X A;  4JC0 A;  4LWC A;  2R6G A;  2IX0 A;  1L2F A;  2WB1 G;  4L5Q A;  1VQ5 A;  4TVA B;  4LF5 Q;  3PSI A;  5IE8 A;  4JI4 L;  3GTJ H;  4YHH Q;  1JJG A;  1UEB A;  4IOC A;  1EIY B;  3K8A A;  3KOJ A;  1OXV A;  1MKH A;  5ELO A;  2KHI A;  3RZO H;  2DUD A;  4IOA A;  1Q81 C;  1FJG Q;  2GN5 A;  4EQ5 A;  3I4M H;  3RR5 A;  4A75 A;  1XMO L;  3J80 c;  4JBK A;  4OX9 Q;  2IY5 B;  3I4M G;  3AQQ A;  1RL2 A;  1W3S A;  1E24 A;  3H15 A;  2R92 G;  4YY3 L;  3W1G A;  1YIT A;  4BBR H;  4LFB Q;  1VQJ A;  3KFU A;  3TQY A;  4X66 L;  3T1H L;  3I4N G;  3S17 H;  3TS2 A;  5C0X J;  1EWI A;  1YZ6 A;  4DV3 Q;  5JEA G;  4P71 A;  3RLN A;  2VQF Q;  4EX5 A;  5IY0 A;  2HQL A;  2OTL A;  3PIP A;  4AQY Q;  4DUY Q;  5DLQ E;  3L7Z C;  3PF5 A;  3KF8 B;  1TWG H;  3JC6 6;  3UDX A;  1A62 A;  5C0X I;  1GO3 E;  1J6Q A;  2WP8 J;  4XIG S;  2UU9 L;  2HIV A;  3TRZ A;  1FVI A;  1D8L A;  3J81 c;  3S2D H;  1IBM L;  4B3T L;  4JCV E;  4LUV A;  4DPG A;  5LMN W;  4BA2 I;  1EQR A;  4LF6 L;  1KC8 C;  1NJI C;  2WAQ E;  4JYA Q;  5GRO A;  3BU2 A;  3RLF A;  1KIX A;  3HOW H;  3SGI A;  1JJC B;  1E1O A;  1VQI A;  4DR7 Q;  5K36 G;  1VQB A;  3HOW G;  3HOX G;  2PI2 E;  4YCV A;  4A3M G;  3I7F A;  1VQH A;  4JBJ A;  4NPS A;  1QZH A;  1X56 A;  3E9I A;  2UXB Q;  5GAD C;  4A3G H;  4DV0 L;  2JA6 H;  1PH4 A;  3M85 A;  4A3F G;  3D31 A;  5JJI A;  1UE5 A;  2I0Q A;  1BBW A;  2JEA I;  3BZK A;  1PFS A;  2CQO A;  4LUO A;  2H5X A;  1J5E Q;  1N34 Q;  3M4Q A;  4KHZ A;  2N78 A;  1IBK L;  1N36 L;  1OXX K;  4B3M Q;  3CQZ H;  1K8G A;  4IPG A;  3S15 H;  3U50 C;  4APV A;  4DV7 L;  3OTO Q;  2ES2 A;  4DKA C;  2YTX A;  3PUY A;  2D0P A;  2UUC L;  2UUB L;  4DR1 Q;  4DV1 Q;  4GN3 B;  3KF6 A;  4JI3 L;  1WYD A;  1VS0 A;  2JA5 H;  3GTQ H;  1WJJ A;  3HOY H;  4JI8 L;  4DAM A;  3H3V H;  4O0A A;  4TQU S;  2ATW A;  1QVC A;  5IP9 G;  3CPW A;  5LMN L;  4BXX H;  1SN8 A;  4JBM A;  1LYL A;  5AJ3 L;  2BA0 A;  3PIO A;  1X9N A;  1Q8K A;  1P16 A;  4NXM Q;  3M4P A;  4A3L G;  4DR6 Q;  1IYJ B;  4DUZ L;  3PF4 A;  1X65 A;  1CUK A;  3NEN A;  3EIV A;  4Y7N H;  3CCJ A;  1CSQ A;  2MO1 A;  2Q2H A;  4A3C H;  1YNX A;  3STB C;  3CCR A;  3M3Y H;  4A3J G;  1QUQ B;  3GTK H;  4DR5 L;  2D62 A;  1V43 A;  3GO5 A;  5BR8 Q;  1G51 A;  4DAY B;  1N32 Q;  4NB3 A;  4O2D A;  5EAY A;  2Z0S A;  1B7Y B;  1AE3 A;  1YBY A;  2CCZ A;  1N33 L;  2E5L L;  1PH5 A;  1KRS A;  4HJA A;  3FP9 A;  2NN6 I;  3K80 C;  4BY7 H;  1C0A A;  3HKZ G;  2Z6K C;  2Q2I A;  2OQ0 A;  3TRE A;  1JMC A;  2UXD L;  1G6P A;  1I94 L;  5HGQ A;  4DR3 L;  4PZ6 A;  2QEX A;  2N3S A;  4IPD A;  3GD7 A;  1L0W A;  1O7I A;  3S2H H;  2ZJQ A;  3ERS X;  1YVC A;  1RIP A;  3I55 A;  2R7F A;  2F4V L;  4IJL A;  2LSS A;  1PA6 A;  4DNI A;  3KDF B;  4R4T A;  1WCM H;  1Z47 A;  5C3E G;  1Y14 B;  1YJW A;  1IBM Q;  4JBW A;  4BBS H;  4JV5 Q;  3RNU A;  1CKN B;  4P74 A;  1IZ6 A;  3CXC A;  4HJ8 A;  1KHI A;  4KHP Q;  2ZTD A;  4DV2 L;  3PV0 A;  1T9H A;  1XNQ Q;  1YHA A;  2NZO A;  4JG2 A;  4IFD J;  2VZA A;  5GQO A;  3F1Z A;  5J3B A;  1VQL A;  1M1K C;  2MO0 A;  5IWA Q;  2VNU D;  2OTJ A;  1NTG A;  2I5H A;  1OTC A;  2NVT H;  2K50 A;  1SRU A;  4OO1 I;  3FKI H;  1AH9 A;  4C3J H;  1Q1B A;  4JI1 Q;  1CKO A;  1L1O C;  2Y0S E;  5C4J H;  1HNX Q;  4A3D H;  3CMA A;  1EFW A;  3S14 H;  4LF9 L;  4IFD I;  2GVB A;  4B3S Q;  1NMF A;  4GKK L;  1L1O A;  2HHH L;  4X65 L;  5IYB G;  2K4K A;  4FDB A;  1PV4 A;  4LF7 L;  3J80 i;  1LUZ A;  5JEA J;  3KJO A;  4POF A;  3PO3 G;  2XGT A;  1SRO A;  4GOP C;  1K83 H;  3MEF A;  4AIM A;  3OYY A;  2Q2U A;  2MNA A;  2B3G A;  4A3B G;  1Q12 A;  3KJP A;  2WFW A;  4GOP A;  4IPC A;  1KRT A;  4MZ9 A;  2R92 H;  2UUA L;  1XMQ Q;  5IYD G;  1HR0 W;  3CCM A;  3I4N H;  1HNZ Q;  3TS0 A;  2JA8 H;  2JA8 G;  1Y1V H;  3CCL A;  4DR2 L;  1HZB A;  4R4I A;  1Y1V G;  3TEH B;  3J81 i;  3ULJ A;  4X64 L;  5LMU L;  1IBL L;  1V9P A;  5IP7 G;  1P8L A;  4JI5 L;  2NVQ H;  2KBN A;  4HJ7 A;  5M5Y H;  3S16 H;  3ZJY C;  2L15 A;  4DV4 Q;  1A63 A;  1UE7 A;  3S1R H;  2JA9 A;  2AWO A;  1QZG A;  1WFQ A;  2N49 A;  1I6H H;  2ZM6 L;  4DV5 L;  2C35 B;  2EQS A;  2ZTC A;  4DR4 Q;  1D7Q A;  4OWX B;  2RHS B;  2I5M X;  3T1Y L;  4DV6 Q;  3HOU G;  1E3P A;  2WB1 E;  4X62 Q;  2DGY A;  2IT1 A;  1U0L A;  3HOX H;  2VQE L;  4A3M H;  3GTO H;  4YWM A;  5GAH C;  1CKM A;  4JI7 L;  4GKJ L;  4LFC L;  4JI6 L;  1VQ4 A;  4QJF A;  4A3F H;  1HR0 L;  4OON A;  2KCM A;  3HKS A;  2PMZ E;  1SFO H;  2B29 A;  1M90 C;  3HOZ G;  4LF4 L;  2A1A A;  2BH2 A;  3J81 j;  2JEB I;  1PVO A;  2EXD A;  4GNX B;  4A3I G;  4LFA Q;  3CME A;  3KDF A;  2UXC Q;  1I5F A;  2ZJP A;  3E0E A;  3HOV G;  1HH2 P;  4R1J A;  4UPA A;  4NXN L;  1R9T H;  2E2I H;  3H3V I;  5M3M H;  5C0X G;  4H02 A;  3DM3 A;  5IYC G;  5M3F H;  4P72 A;  4JI2 L;  3AFQ A;  4J15 A;  5M3M G;  1HZ9 A;  1YHB A;  5M3F G;  2R93 H;  4A93 G;  2F3I A;  2R93 G;  4YWK A;  1HJP A;  5IP9 H;  1BVS A;  1N8R C;  5GAE C;  4QY7 A;  4LUZ A;  1BBU A;  1S3O A;  1LM0 A;  1TXY A;  1VQC A;  3WWV A;  3G6E A;  1S72 A;  1E22 A;  1QVG A;  4K0K L;  4A3L H;  3Q8D A;  3JAM i;  1HNW L;  3CCQ A;  1HZA A;  1C7Y A;  4JI4 Q;  4JI0 L;  4B3R L;  2OWO A;  1X55 A;  2CWP A;  5C4X G;  4A3J H;  2AHO B;  2K5H A;  1NMG A;  2AWN A;  1XMO Q;  3JAM c;  2JA7 G;  3ULP A;  4JOI C;  4GN5 A;  3NBH B;  4LF5 L;  1PYB A;  4KI0 A;  1H95 A;  1E7Z A;  4YY3 Q;  1FL0 A;  4YHH L;  4QL5 A;  2K52 A;  1S40 A;  4X66 Q;  2D0O A;  4JOI A;  3T1H Q;  2NVX H;  1Q86 C;  1W2B A;  1TWA H;  2XTI A;  4DR2 Q;  2ZJR A;  1FJG L;  3K81 C;  1JJ2 A;  1EUJ A;  4OX9 L;  2EIF A;  3STB D;  4A3K G;  1C9O A;  1KAW A;  1G29 1;  1B8A A;  3AYH B;  3CF5 A;  4A76 A;  1K8A C;  5M5W H;  4LFB L;  1PYS B;  3AFP A;  4QQB X;  2UU9 Q;  1Q1E A;  4L5S A;  1K9M C;  2MFI A;  5C3E H;  1PH2 A;  4DV3 L;  1NBW A;  2IX1 A;  2VQF L;  4DV5 Q;  4B3T Q;  1SE8 A;  5FLM H;  4LF6 Q;  5FLM G;  2OQK A;  3RN2 A;  2MQH A;  1I3Q H;  4MNO A;  4HIO A;  4AYB G;  1LTL A;  3CCS A;  1XNR L;  4IO9 A;  4GLX A;  3I4O A;  4POG A;  2BA1 A;  4YCU A;  4YWL A;  1EYG A;  4MTN A;  3U4V A;  2OCE A;  4DV0 Q;  2NN6 G;  3BJU A;  1PH3 A;  4PMW A;  1VQ6 A;  2ALY B;  2GVA A;  4UP7 A;  2R7Z G;  4GLA C;  4ME3 A;  4JYA L;  4ALP A;  4P73 A;  4DR7 L;  3GDE A;  1IBK Q;  1N36 Q;  3DLL A;  2KHJ A;  1NY4 A;  3PUX A;  4DK3 C;  1OXT A;  3HKZ E;  2CWA A;  5IYB H;  3L2P A;  4DV7 Q;  3H0G H;  1MJE A;  2UUB Q;  4LW1 A;  2UUC Q;  4C3H H;  3EBE A;  2A8V A;  3H0G G;  4GLV B;  5JJK A;  4A4I A;  3KF6 B;  4JI3 Q;  3S1M H;  5M5X H;  3PO3 H;  1XPO A;  3U4Z A;  1J5E L;  2LXK A;  1N34 L;  4UP8 A;  3S1Q H;  1VQO A;  3K7U C;  4JI8 Q;  4R4C A;  2K5N A;  4PZ8 A;  5H1S E;  5C44 G;  1E1T A;  4B3M L;  4A3B H;  2R7D A;  5LMN Q;  1Q46 A;  3PCO B;  1VQ8 A;  5AJ3 Q;  2CFM A;  3UDF A;  3OTO L;  3GTP H;  3F2C A;  4DR1 L;  1PH8 A;  4DV1 L;  1N9W A;  2QGQ A;  4R4Q A;  3OW2 A;  1KQS A;  4DUZ Q;  3UE1 A;  4JI0 Q;  5IYD H;  2JQO A;  4OXP A;  1VQA A;  3CW2 C;  1V1Q A;  1XTD A;  3E9H A;  3W1B A;  3UDG A;  3GTM H;  3EN2 A;  1Y1W H;  4OO1 G;  4AYB E;  4DR5 Q;  1Y1W G;  1VQ7 A;  1FGU A;  2WAQ G;  3PUZ A;  4IFD G;  1TWF H;  4DR6 L;  5IP7 H;  5FJ8 H;  4NXM L;  1N33 Q;  3HFZ B;  2E5L Q;  5FJ8 G;  1K73 C;  1Q7Y C;  4PG3 A;  1EIF A;  3PUV A;  1TWC H;  4C3I H;  1YI2 A;  2NVY H;  1K3R A;  2UXD Q;  1VQN A;  5JJL A;  1QUQ A;  3ULL A;  4IPH A;  1I94 Q;  5BR8 L;  2VS1 A;  4DR3 Q;  5IT9 c;  3UE0 A;  4GS3 A;  2VUM H;  2PQA B;  1N32 L;  2VY3 A;  2VUM G;  1ASY A;  2I5L X;  4OWT B;  4RG1 A;  3HOU H;  4BY1 H;  1QVF A;  3M7N A;  4LNQ A;  1WOC A;  2F4V Q;  4BY1 G;  3RLO A;  4BBR G;  2V1C C;  1WI5 A;  3ICE A;  2JE6 I;  3F8T A;  4WJ4 A;  3IRB A;  1EOV A;  4C2M H;  1TWH H;  1JT8 A;  2A19 A;  4L5T A;  1ASZ A;  1B70 B;  3HOZ H;  2VW9 A;  1VQG A;  2YV5 A;  4DV2 Q;  2E2J H;  4A3I H;  2CKZ B;  1XNR Q;  4HIK A;  1UE1 A;  1XJV A;  3I2Z A;  5FLX c;  3RZD H;  3HOV H;  2RCN A;  2E2H H;  3CC2 A;  1GD7 A;  1UWV A;  1PH1 A;  4JV5 L;  5IYC H;  4LF8 L;  1KD1 C;  1VQ9 A;  1CKN A;  3F2B A;  2PI2 A;  2YTY A;  2ASB A;  4KHP L;  4A93 H;  3UDI A;  4LF9 Q;  2KEN A;  1PH7 A;  1X3G A;  1XNQ L;  3GTG H;  1YJ9 A;  3AEV A;  2PNH A;  3CCU A;  4GKK Q;  1L1O B;  1XPR A;  1X6O A;  2HHH Q;  1UE6 A;  4X65 Q;  3G71 A;  1KL9 A;  5IWA L;  3MXN B;  1X54 A;  4UP9 A;  4LF7 Q;  1EQQ A;  4A3G G;  3ER0 A;  2JA6 G;  4JI1 L;  3A5Z B;  3M9B A;  1HNX L;  1PHJ A;  4HJ9 A;  1X3F A;  5C4X H;  2YU9 H;  4L5R C;  3M4O H;  4B3S L;  2VL6 A;  1A0I A;  3CPF A;  4R4O A;  3G4S A;  4Y52 H;  1I50 H;  2LXJ A;  2JA7 H;  1GVP A;  3PUW A;  4GOP B;  1CSP A;  1PH9 A;  1IL2 A;  3S24 A;  2AMC B;  3CD6 A;  3W5O A;  1AE2 A;  1SR3 A;  2F52 A;  2UUA Q;  1VQE A;  2ID0 A;  4AH6 A;  1U5K A;  4XTC S;  3PGZ A;  4OWW B;  3A0J A;  3RN5 A;  2N8N A;  2JA5 G;  1SLJ A;  2YTV A;  3HOY G;  2YYZ A;  3PO2 H;  1BKB A;  2ZTE A;  4BXX G;  3PO2 G;  3NEM A;  4A3K H;  5LMU Q;  4X64 Q;  4A3E H;  2IHF A;  1IBL Q;  3KLW A;  1DGS A;  4A3E G;  4JI5 Q;  3D0F A;  1XMQ L;  3L0O A;  1HNZ L;  1VQD A;  4A3C G;  3J7A 5;  3S1N H;  1VCI A;  2RHQ B;  5GAG C;  5HY6 A;  4PZ7 A;  4HIM A;  2ZM6 Q;  3VDY A;  2Y0S G;  4IJH A;  1JB7 A;  2JJQ A;  2JK8 A;  1VQF A;  1OXS C;  3T1Y Q;  1KXL A;  5ELN A;  4DUY L;  4AQY L;  3CP0 A;  2VQE Q;  1A8V A;  1X3E A;  4BY7 G;  3CC4 A;  2IHE A;  4JI7 Q;  4DV4 L;  4GKJ Q;  1PH6 A;  4LFC Q;  4JI6 Q;  1VQM A;  3LGJ A;  2Z6K A;  2K75 A;  2HIX A;  1Q82 C;  2PQA A;  1HR0 Q;  4UY8 C;  2R7Z H;  2QA4 A;  4DR4 L;  4RMF A;  2KCT A;  3A5U A;  4LF4 Q;  3J7Z C;  3CC7 A;  4DV6 L;  3U58 A;  1MIU A;  1MJC A;  2K5V A;  1SMX A;  3A74 A;  4DK6 C;  4X62 L;  2BH8 A;  1IXR A;  3CAM A;  3NEL A;  3K7A H;  4P75 A;  1VQP A;  3F2D A;  1WCM G;  4NXN Q;  4LF8 Q;  5E7N A;  2HT1 A;  3CCV A;  1YIJ A;  4BBS G;  1OXU A;  2UXB L;  4GNX C;  1YHQ A;  2RF4 A;  3G48 A;  4QIW E;  4JI2 Q;  3I56 A;  4YCW A;  1YJN A;  1YEZ A;  5C44 H;  1HZC A;  2Q2T A;  4WJ3 M;  4KLK A;  2B63 H;  1K0R A;  4GNX A;  4LFA L;  1XPU A;  3GTL H;  2FXQ A;  4HJ5 A;  4BA1 I;  3B6Y A;  2B63 G;  2K14 A;  4QGU A;  3FHW A;  4K0K Q;  2UXC L;  2AKW B;  1VQK A;  1HNW Q; 
#chains in the Genus database with same CATH topology
 4B3R Q;  4GN4 B;  3HOX B;  1WTX A;  4A3M B;  1II3 A;  2B2U C;  3I91 A;  1Z9F A;  4X6A H;  3CCE A;  4HID A;  4IFD H;  1CHP D;  3R3O A;  1ESR A;  2IX0 A;  4UHV A;  2WB1 G;  2B2U A;  5C4H A;  2F0T A;  5IE8 A;  4JI4 L;  2E74 C;  5CV4 A;  2EY6 A;  3HRZ C;  3K8A A;  2NTS A;  3NSW A;  5ELO A;  2DUD A;  5EKK A;  3I4M H;  2GN5 A;  2IY5 B;  1SJH D;  4DA2 A;  5M3F B;  1W3S A;  1WTQ A;  3NBH A;  1E24 A;  3W1G A;  4LFB Q;  2A6H C;  4X66 L;  1BR9 A;  5JEA H;  1CHQ D;  4H7B A;  2PQE A;  2CVR A;  2HQL A;  5IY0 A;  4ODG A;  5DLQ E;  3KF8 B;  3UDX A;  5C0X I;  1GO3 E;  2UU9 L;  2JA7 B;  1D2B A;  4LUV A;  1EQR A;  4LF6 L;  1KC8 C;  3DHQ A;  2F0J A;  1SYB A;  1KIX A;  4DR7 Q;  1VQI A;  5K36 G;  2DY8 A;  2NVX B;  2PI2 E;  4DU9 A;  4RAU C;  2PW5 A;  1X56 A;  3OMC A;  5GAD C;  2IL8 A;  4A3F G;  5JJI A;  1UE5 A;  5F2D A;  4O1N A;  2Z1C A;  3QG1 A;  5M5W B;  4TKO B;  1IBK L;  1OXX K;  3S15 H;  4APV A;  4DV7 L;  3OTO Q;  2D0P A;  1H9R A;  1B4O A;  1VF5 C;  4DR1 Q;  3I4L A;  4FP5 D;  1O80 A;  4BWG B;  5I9O A;  2L11 A;  4RCN A;  2ATW A;  3CPW A;  1I6V C;  4JBM A;  5HUR A;  2EYO A;  1Q8K A;  1P16 A;  2EYJ A;  4NXM Q;  4A3C H;  1RF2 D;  1NCV A;  2RDF A;  4O42 A;  3GTK H;  2D62 A;  4C3H B;  4DAY B;  3W2D A;  1YBY A;  1JOO A;  1N33 L;  4ZKB B;  3K80 C;  1C0A A;  1CTM A;  1MD2 D;  1SNQ A;  2HDL A;  3SK5 A;  1I94 L;  3GTP B;  5C3X A;  5JJZ A;  4IPD A;  4EQN A;  1BCP D;  4IUT A;  1GUT A;  1L0W A;  4QUC A;  1RHP A;  1RIP A;  2F4V L;  1Y1W B;  4XXE A;  1DXM A;  4HMI A;  1ML0 D;  2XWJ B;  4MTK A;  3URY A;  3RNU A;  1TWF B;  4P74 A;  3CXC A;  1TVX A;  2ZTD A;  4DV2 L;  1A3T A;  2L4N A;  1VMP A;  3SE0 A;  5GQO A;  2XVS A;  5KEE A;  2VNU D;  1NTG A;  2I5H A;  1OTC A;  1LTR D;  2NVT H;  1SRU A;  3FKI H;  4C3J H;  4JI1 Q;  3BDC A;  2Y0S E;  4KN4 C;  5C4J H;  4ZQ3 A;  4A3D H;  3S14 H;  4LF9 L;  4B3S Q;  1JR0 D;  4C2M B;  1TWH B;  4X65 L;  3PIO 3;  2AQ2 B;  1PV4 A;  1EEI D;  1LUZ A;  1EU4 A;  2JYO A;  5CC4 A;  4GOP C;  3QO2 A;  1K83 H;  3TN2 A;  3A56 A;  3RZD B;  3HOV B;  2E2H B;  4GOP A;  4HTH A;  1J8I A;  4ZCK A;  2BE5 C;  2CH4 A;  4A93 B;  1XX8 A;  1XMQ Q;  4F8M A;  2UUA L;  3I4N H;  3TS0 A;  1RTN A;  1ENA A;  2JA8 G;  4KD3 A;  3G7L A;  4R4I A;  3J81 i;  4X64 L;  2WV6 D;  5IP7 G;  1B3Q A;  2D2C C;  2KEC A;  3ZJY C;  4Q5V A;  4H0L C;  2L15 A;  3NTH A;  2EXZ A;  2AWO A;  4EQP A;  1FD7 D;  2KJX A;  1A2U A;  3NXW A;  4KJO A;  4OWX B;  2RHS B;  1TR5 A;  4PMC A;  2VQE L;  2OF1 A;  1WTV A;  4YWM A;  5GAH C;  4X3S A;  3PO2 B;  1ROD A;  4JI6 L;  4J6H A;  1H9M A;  4A3E B;  1M90 C;  3K5O A;  1SFO H;  3QOJ A;  3HOZ G;  1PTO B;  2JEB I;  1PVO A;  1MSH A;  2EXD A;  4GNX B;  4A3I G;  3AB9 A;  5CV8 A;  1PXU A;  3MFG A;  1E2W A;  1K28 A;  2WII B;  2SNS A;  3VR4 A;  2M00 A;  5M3M H;  5C0X G;  3H3V I;  1CI3 M;  3D4D A;  2LMC B;  2F3I A;  2R93 G;  4YWK A;  4DNT B;  4QF4 A;  1GXD C;  5IP9 H;  4QY7 A;  4LUZ A;  1BBU A;  1LM0 A;  1V1P B;  5EGT A;  2KHS A;  3CCQ A;  2RKS A;  1EY7 A;  2AHO B;  3D4W A;  3G6J B;  3MZ5 A;  3ERO A;  3NBH B;  1PYB A;  1E7Z A;  4JPB W;  4K5W A;  4YHH L;  1S40 A;  4CBV A;  1W2B A;  2ZJR A;  4C1N K;  4L6T B;  1F2Z A;  3K81 C;  2EOT A;  1KNE A;  4A3K G;  1BXT A;  1KAW A;  2D5D A;  3AYH B;  3AFP A;  1Q1E A;  5C3E H;  3C1E A;  4DV3 L;  2K1B A;  3OSO A;  5FLM G;  1GUS A;  5KGU A;  2OQK A;  2MQH A;  4P2C B;  1XTC D;  4GLX A;  1JQY D;  1KLG D;  4YWL A;  2NYZ D;  3I4M B;  3U4V A;  5E1F A;  1BCP F;  1PRT D;  2A6E C;  1SDF A;  4PMW A;  4UP7 A;  4DF7 A;  3OPO A;  3GDE A;  4WFN 3;  2CW0 D;  1NY4 A;  1OXT A;  3L2P A;  3H0G H;  4N9P A;  5TSS A;  3EBE A;  1SE4 A;  2B2W A;  4A4I A;  3DMU A;  4CKB A;  5M5X H;  3U4Z A;  1J5E L;  3IFD A;  1Y8N B;  2Z4I A;  1A15 A;  4R4C A;  4JI8 Q;  1E1T A;  4DNR B;  1LTI D;  4R4Q A;  4DUZ Q;  4JI0 Q;  4OXP A;  2NB0 A;  1V1Q A;  3E9H A;  5EJW A;  1EYC A;  3UDG A;  4JK1 C;  1SEB D;  2F0W A;  4DK0 A;  4F87 A;  4AYB E;  1VQ7 A;  2EJF C;  1O7Y A;  2WAQ G;  2IJ0 A;  2F4I A;  5M9O A;  3BYT B;  4HED A;  1TT2 A;  1EIG A;  3P1H A;  5FJ8 G;  1K73 C;  3KK7 A;  1EYD A;  5ELE A;  1K3R A;  3S15 B;  3K5L A;  3N6R A;  1STB A;  3A7L A;  3DWP A;  3UE0 A;  4GS3 A;  2PQA B;  2VY3 A;  2VUM G;  1ASY A;  4RG1 A;  1A3V A;  3U9O A;  3EVQ A;  1DCZ A;  3IKJ A;  4BY1 H;  4FF3 A;  4BBR G;  2BCO A;  4RGT A;  2JE6 I;  4WJ4 A;  3QR8 A;  2A19 A;  1FR3 A;  3V96 A;  1B70 B;  3GV3 A;  1E0B A;  3ONA B;  3E0J A;  2E2J H;  1XNR Q;  1XJV A;  1JOR A;  3I2Z A;  1GUW A;  1JWM D;  3GTK B;  2Y0S B;  4LF8 L;  1EY6 A;  3F2B A;  2BOS A;  3MVV A;  3UDI A;  3E3X A;  3GTG H;  1G91 A;  1JB3 A;  2XRS D;  3T51 B;  1X54 A;  4LF7 Q;  3ER0 A;  2KUM A;  3O13 A;  1LT4 D;  1SE3 A;  3M9B A;  1PHJ A;  4L5R C;  2NZ1 D;  5C4X H;  4XYQ A;  2VL6 A;  4R4O A;  2F0S A;  1I50 H;  5FOB B;  2JA7 H;  4GOP B;  1C8C A;  4TSS A;  2H4O A;  2B2T C;  1RTO A;  4OWW B;  3A0J A;  2JA5 G;  1SLJ A;  2YYZ A;  3BYY B;  2B2T A;  2F0H A;  2Q8R E;  1IYU A;  2K33 A;  3NEM A;  2NVT B;  2K28 A;  3KLS A;  2C5C A;  3FKI B;  4C3J B;  3KLW A;  1IBL Q;  4IUP A;  1DGS A;  5C4J B;  4A3D B;  2OEO A;  3S14 B;  3L0O A;  1HNZ L;  3HP3 A;  2EY1 A;  5HY6 A;  3VDY A;  5CBA E;  2PZW A;  1VF7 A;  1JCK B;  4IJH A;  4R8N A;  1PDQ A;  1VQF A;  1EWH A;  1X3E A;  1F2Y A;  1K83 B;  4GKJ Q;  1VQM A;  5JPM C;  3LGJ A;  2HIX A;  2PO4 A;  4J8Q A;  3DUZ A;  3NHH A;  4DR4 L;  1SND A;  2KCT A;  2K03 A;  3J7Z C;  5ELC A;  1L0X B;  4DV6 L;  1MIU A;  1MJC A;  2DY7 A;  3A74 A;  3I4N B;  5D3D A;  1ZYR D;  3VYT A;  3K7A H;  1EY5 A;  5KYL A;  1HQM C;  2QEJ C;  1MBY A;  4KKU A;  5E7N A;  2UXB L;  3CCV A;  1YIJ A;  1OXU A;  2KCC A;  2K01 A;  1M8A A;  5LL6 S;  5C44 H;  4KLK A;  3GTL H;  1V8Q A;  4UDU C;  2ZXP A;  2UXC L;  2FMC A;  2K14 A;  4K0K Q;  1PRT F;  1HNW Q;  1AEX A;  3SK6 A;  1CT1 D;  3K59 A;  1B9M A;  3BZC A;  3SXH A;  4OO1 H;  1GM5 A;  4HMJ A;  1NE3 A;  4CGY B;  4LWC A;  1IHZ A;  1TS5 A;  4RHS A;  4L5Q A;  1SFO B;  4TVA B;  4K6D A;  3PSI A;  4EGV A;  4B9X A;  1UEB A;  1EIY B;  3KOJ A;  2J0T D;  3RZO H;  3D8G A;  1FJG Q;  4IOA A;  4A75 A;  4OX9 Q;  1D1K A;  1SMY C;  3AQQ A;  5M3M B;  2EJG C;  3QIA A;  3K5M A;  4YY3 L;  3KFU A;  3T1H L;  1EWI A;  1PFB A;  2MGS A;  1U4R A;  4KN7 C;  4P71 A;  4EX5 A;  3VYS A;  3PIP A;  1A6X A;  2G9H D;  3JAM E;  2F0U A;  4DUY Q;  3PF5 A;  1RCV D;  3JC6 6;  1J6Q A;  3MTS A;  4X3T A;  1FVI A;  4CDE C;  2FIN B;  3J80 L;  3S2D H;  1IBM L;  4B3T L;  4DPG A;  1IYV A;  5ELB A;  5LMN W;  4RWS C;  3NTI A;  1K8O A;  3RLF A;  3SGI A;  1E1O A;  1JJC B;  4K2K A;  3L9A X;  1SYE A;  3HOX G;  4A3M G;  3I7F A;  5JPN C;  4NPS A;  2WIN B;  4A3G H;  4DV0 L;  2JA6 H;  3OWE B;  1H9J A;  3R93 A;  2DJF C;  1BBW A;  3DEP A;  3MA2 B;  5DAU A;  2K5W A;  1NAP A;  3OWF A;  2N78 A;  1N36 L;  3CQZ H;  3VR5 A;  2RQX A;  2ES2 A;  1Q90 A;  2YTX A;  3PUY A;  4OEM B;  4DKA C;  5I9P A;  1CA6 A;  2UUC L;  2UUB L;  2J4X A;  4X3K A;  2HQE A;  3KF6 A;  4AYB B;  1WYD A;  3DM1 A;  4I7A A;  4KY7 A;  1WJJ A;  1Y8O B;  1QVC A;  5LMN L;  1BQQ T;  1X32 A;  2NWG A;  2OT2 A;  5AJ3 L;  1EU3 A;  1Q8I A;  1X9N A;  1SNM A;  3M4P A;  1D5M C;  1X65 A;  4R8I A;  1CUK A;  5KNB A;  2F0I A;  2HCC A;  3WOE A;  4Y7N H;  1JOQ A;  2MO1 A;  1YNX A;  3STB C;  3M3Y H;  4WRD A;  1G2T A;  4DR5 L;  3M4Y A;  3GO5 A;  1V43 A;  3H0G B;  5BR8 Q;  5I4D A;  4NB3 A;  3OIP A;  2Z0S A;  1B7Y B;  3CHB D;  3C2P A;  4MN3 A;  2QCP X;  4FF1 A;  5M5X B;  3AU7 A;  4HJA A;  3FP9 A;  2EY2 A;  4BY7 H;  4IUR A;  2Q2I A;  1ONL A;  1PZJ D;  2UXD L;  5HGQ A;  1QNU A;  2LKV A;  2N3S A;  4DGZ A;  1O7I A;  3IAY A;  1YVC A;  3I55 A;  2KED A;  3RMH A;  2XRQ D;  1PLF A;  3CU7 A;  4HCE A;  4UAI A;  3KDF B;  4BBS H;  3Q24 A;  1LO5 D;  5KYI A;  5KIX A;  3Q22 A;  1S4Z A;  5J39 A;  5D14 A;  1I4H A;  2G5D A;  4FNF A;  4JG2 A;  2VZA A;  1M1K C;  2MO0 A;  2K04 A;  4OL7 A;  1IKL A;  4HSP A;  2OTJ A;  2ENB A;  1Q1B A;  4BY1 B;  1PTO D;  1EFW A;  4IFD I;  2RSO A;  4NP5 A;  2K32 A;  1K3B C;  4GKK L;  5FLX E;  3MXN A;  1FNU A;  2E2J B;  3KJO A;  3PO3 G;  2XGT A;  5J22 A;  2EYM A;  1KDA A;  4KY5 A;  4ZLT F;  2Q2U A;  3MFY A;  3I73 A;  2AUJ D;  3KJP A;  3T4A C;  4IPC A;  1KRT A;  2R92 H;  1BNZ A;  1F9R A;  4RGM A;  5IYD G;  3GTG B;  2JA8 H;  3CCL A;  1HZB A;  1Y1V G;  5AFW A;  3ULJ A;  4DK1 A;  2EYF A;  4JI5 L;  2NVQ H;  3SDZ A;  2KBN A;  5C4X B;  4DV4 Q;  1UE7 A;  1I50 B;  2F0O A;  2C9O A;  2N49 A;  2A6H D;  3L3O C;  2MP1 A;  2C35 B;  2EQS A;  2ZTC A;  4DV5 L;  1D7Q A;  2CQA A;  1B44 D;  2I5M X;  1E3P A;  4X62 Q;  2DGY A;  2MHV A;  2WAC A;  4JI7 L;  5COR A;  4N8X 1;  4LFC L;  4QJF A;  4OON A;  2KCM A;  2SOB A;  1I4R A;  3WDN A;  1HTL D;  1Q3L A;  3RD4 A;  4LFA Q;  1HHV A;  1H9S A;  1OO9 B;  1I5F A;  1L0Y B;  3E0E A;  3HOV G;  4NXN L;  4UPA A;  2E2I H;  4H02 A;  5IYC G;  4P72 A;  4JI2 L;  3AFQ A;  5IGF A;  2R93 H;  1HRJ A;  4A93 G;  1JOK A;  1HJP A;  5GAE C;  1S72 A;  1S3O A;  1VQC A;  4WOR A;  3WWV A;  4A3L H;  3JAM i;  5IOC A;  1XWE A;  1YNN C;  4B3R L;  2OWO A;  1X55 A;  1QNK A;  1SYG A;  2CWP A;  4A3J H;  2K5H A;  3K7A B;  3SR1 A;  4CHT B;  1XMO Q;  3JAM c;  2FJ2 A;  4GN5 A;  4F88 A;  3VR3 A;  2F1M A;  4KI0 A;  1XXG A;  5C44 B;  1EL0 A;  2K52 A;  3I3C A;  3GTL B;  3H09 A;  1Q86 C;  1TWA H;  2XTI A;  5ELF A;  2L1B A;  2EPB A;  1ILQ A;  1B8A A;  1FYC A;  1G29 1;  1AN8 A;  4LFB L;  1TS4 A;  1XYI A;  4L5S A;  3X3N A;  2MFI A;  5EBD A;  3QOL A;  4XDX A;  5FLM H;  3F2U A;  1DOL A;  1E2Z A;  3J80 E;  1B2T A;  1I3Q H;  3WOF A;  3A8K E;  1D6E C;  3RZO B;  1PFM A;  4MTN A;  3MEH A;  3TP8 A;  3VR2 A;  4FO2 A;  4ID6 A;  4GLA C;  3BVG A;  5I6Y A;  4DR7 L;  5CV5 A;  4ZK9 B;  3DLL A;  3IL8 A;  2K7V A;  3PUX A;  1EZ6 A;  3HKZ E;  5IYB H;  1STN A;  5A35 A;  3KF6 B;  4JI3 Q;  1XPO A;  2LXK A;  4UP8 A;  3TP5 A;  3CRK C;  4A3B H;  3KLR A;  3S2D B;  3OTO L;  3UDF A;  2O2L D;  4OEL B;  4OHJ A;  4DR1 L;  1BBX C;  3C3L A;  4L8J A;  1KQS A;  1AZQ A;  1PTO F;  2F0F A;  2JQO A;  4DFA A;  5LHY 1;  1LTA D;  2E2D C;  4KV6 A;  4A3G B;  4IFD G;  2JA6 B;  4NXM L;  4OIK A;  5FJ8 H;  3HFZ B;  2E5L Q;  1EIH A;  1Q7Y C;  3NK9 A;  1EIF A;  3PUV A;  4C3I H;  4FF2 A;  2F0M A;  4CKE A;  2X6G A;  3CQZ B;  2BE5 D;  4HR7 B;  4L63 B;  1VQN A;  1B3A A;  3VYU A;  4IPH A;  4DR3 Q;  2VUM H;  3DEO A;  4OWT B;  3HOU H;  4LNQ A;  4Q0F A;  3RLO A;  3FDT A;  4TRD A;  1PFN A;  3F8T A;  1B1Z A;  1EOV A;  2M9V A;  4EVO A;  4ZYS A;  1YNJ C;  1PYW D;  4J1M A;  4KY6 A;  3GP7 A;  5G3L D;  4Y7N B;  1UE1 A;  3M3Y B;  5FLX c;  3X3M A;  2CHB D;  5IT9 L;  1GUG A;  3CC2 A;  4G7H C;  4LAA A;  3FPU B;  2K5Q A;  4V0B A;  5IGG A;  4BY7 B;  2KEN A;  1I4X A;  2A73 B;  2EYL A;  1NSN S;  3CCU A;  1ET6 A;  2HHH Q;  3TSS A;  1KL9 A;  3MXN B;  1O78 A;  2B39 A;  4UP9 A;  1X3P A;  1EQT A;  4JI1 L;  3A5Z B;  2PCF B;  3KBG A;  4RGO S;  4B3S L;  1A0I A;  4Y52 H;  2LXJ A;  1AFP A;  2B2Y A;  4BBS B;  2F0N A;  1PH9 A;  1IL2 A;  3MXP A;  1AE2 A;  1VQE A;  1ICF B;  2EYP A;  4E6I A;  2N8N A;  2IX3 A;  1SYD A;  4RHR A;  3HG9 A;  2A74 C;  1U9R A;  2QF7 A;  3J7A F;  1C48 A;  5I2Y A;  4DXG A;  5LMU Q;  2IHF A;  2EE1 A;  2PPB C;  1XMQ L;  1ZKO A;  4ME5 A;  5DEH A;  4A3C G;  3J7A 5;  5JVG 3;  5FKA C;  1VCI A;  2ZM6 Q;  3R8B A;  5C4Z A;  2Y0S G;  3PIP 3;  2JJQ A;  1LT5 D;  2JK8 A;  1OXS C;  3T1Y Q;  5FK9 C;  4AQY L;  2NBF A;  3CP0 A;  1A8V A;  3CC4 A;  2IHE A;  2F0G A;  2NN6 H;  1JE4 A;  2K75 A;  2Z6K A;  1HR0 Q;  5CMD A;  2R7Z H;  2R92 B;  4LF4 Q;  3CC7 A;  3SK4 A;  3K0Y A;  1ET9 A;  1G2S A;  2BH8 A;  2JA8 B;  3NEL A;  5JOB A;  4P75 A;  2LFN A;  1D5Z C;  1Y8P B;  2B2W C;  5DNF A;  4LF8 Q;  2HT1 A;  4DAP A;  1SNO A;  3G48 A;  4QIW E;  4RGN A;  2NVQ B;  3I56 A;  1YEZ A;  1CM9 A;  2AQ3 B;  2Q2T A;  3VR6 A;  1CQF A;  1K0R A;  2FMM A;  4KD4 A;  1XPU A;  2FXQ A;  4HJ5 A;  1KAA A;  3B6Y A;  2B63 G;  2O4X A;  3FKI G;  3KYH C;  1KDB A;  3U9S A;  2OXP A;  4A3D G;  4PMB A;  1KTK A;  2Z4H A;  5IGC A;  2PNR C;  2A69 C;  1GKH A;  1VMC A;  4IUV A;  2WKD A;  5EQ0 A;  2P5Z X;  3NQI A;  1BF4 A;  2E8G A;  4JC0 A;  1F9Q A;  3HOZ B;  4WJW A;  1VQ5 A;  4LF5 Q;  2QKI C;  2JXM B;  1SNP A;  2Z8L A;  2XNA C;  1QWY A;  4RFB A;  2VB2 X;  1JJG A;  4IOC A;  1IW7 C;  1MKH A;  3FPP A;  2XN9 C;  1Q81 C;  4EQ5 A;  3RR5 A;  4JBK A;  2E2I B;  3J80 c;  4NDX A;  2R93 B;  1QCB D;  3H15 A;  3HEJ A;  5EPJ A;  4QCL A;  3I4N G;  4EQO A;  5C0X J;  3RLN A;  2VQF Q;  5EKI A;  5A2Q L;  2DNC A;  2I46 A;  5BN3 A;  3W3A A;  1RD9 D;  3TZD A;  3L7Z C;  2KA7 A;  1TWG H;  4XT1 B;  3V2T A;  2DN8 A;  3FRP B;  4A3J B;  3A8J E;  1STA A;  2HIV A;  3TRZ A;  1HUN A;  3D6W A;  1GUN A;  1UUP A;  5EKL A;  3A7A B;  4JYA Q;  3BU2 A;  3HKZ B;  4KMU C;  1VQB A;  3HOW G;  4YCV A;  1CQV A;  3A54 A;  1TWA B;  2SEB D;  1VQH A;  1QZH A;  5I2X A;  5KNC A;  2UXB Q;  3E6Z X;  4KJN A;  2A68 C;  3BZK A;  5G3L F;  2CQO A;  1N34 Q;  3M4Q A;  1SYC A;  4KHZ A;  4B3M Q;  3S1N B;  3MHB A;  4IPG A;  3J81 L;  1K8G A;  3U50 C;  5LL6 X;  1TY0 A;  4DV1 Q;  2EY5 A;  4GN3 B;  4KKT A;  3K6O A;  3EA6 A;  1I3Q B;  3GTQ H;  3HOY H;  5C5L A;  1QIL A;  1LV9 A;  4JI8 L;  4DAM A;  4O0A A;  2K6A A;  3R2I A;  3GQB A;  5IP9 G;  4BXX H;  4KTA A;  1LYL A;  2BA0 A;  3PIO A;  3OW7 A;  1SSO A;  4DR6 Q;  4DUZ L;  2EZV A;  2RDH A;  4RKB A;  1WD1 A;  3CCJ A;  2PYK A;  2Q2H A;  3CCR A;  1DON A;  1G51 A;  3IFT A;  3QJY A;  1N32 Q;  2CCZ A;  4IZ8 A;  1PH5 A;  4A3B B;  4PZ6 A;  2QEX A;  4FYD A;  2JP1 A;  1TS3 A;  3TZU A;  3S2H H;  2ZJQ A;  1T5X D;  1S5B D;  1CA5 A;  1SAP A;  1JWU D;  4R4T A;  1WCM H;  4HAE A;  5C3E G;  1IBM Q;  1G6Z A;  4JBW A;  4JV5 Q;  1FGB D;  4HJ8 A;  1KHI A;  4KHP Q;  5IT9 E;  3PV0 A;  1T9H A;  3KF8 A;  1XNQ Q;  4C3I B;  3SVM A;  5E3F A;  5CV7 A;  5J3B A;  2VUM B;  4LJZ C;  4YIJ A;  2NUC A;  3OIQ A;  3Q6S A;  5IWA Q;  1STG A;  4OO1 I;  2K50 A;  1AH9 A;  3HOU B;  1CKO A;  1L1O C;  3DWQ A;  1HNX Q;  3H6M A;  1NMF A;  1L1O A;  2N88 A;  4FDB A;  1B53 A;  4LF7 L;  1KNA A;  1BDO A;  3T16 A;  1GUO A;  4POF A;  4K5X A;  1SRO A;  4HN7 A;  3MEF A;  4AIM A;  2MNA A;  1Q12 A;  4CDF C;  3QB3 A;  3VA7 A;  2EJM A;  4G57 A;  3CCM A;  4XQQ A;  2K5D A;  2LS0 1;  1G8Z D;  1Y1V H;  4DR2 L;  1SYF A;  3EFX D;  1IBL L;  4RCO A;  4G7O C;  1V9P A;  3H94 A;  2RCF A;  1DOM A;  1P8L A;  1GHJ A;  1GJX A;  3S16 H;  1SMY D;  5EPK A;  1A63 A;  2XSC A;  1NR4 A;  2JA9 A;  3S1R H;  1QZG A;  1WFQ A;  4DAY A;  1I6H H;  1BOS A;  4LMQ D;  4K6L A;  2QDB A;  3EJI A;  2WB1 E;  5K36 H;  3GTO H;  3D6C A;  2F3W A;  1CKM A;  4GKJ L;  3UI2 A;  1I4P A;  1D1I A;  4QIW B;  4A3F H;  5C6A A;  2PMZ E;  1ZXT A;  2B29 A;  3J81 j;  3SK8 A;  4CDD C;  2ZJP A;  3Q23 A;  4B08 A;  1R9T H;  1HXY D;  3DM3 A;  1B50 A;  2EVB A;  4J15 A;  1HZ9 A;  5M3F G;  2CH4 W;  4IUU A;  1WTR A;  3G6E A;  4K0K L;  1E22 A;  1DOK A;  4ZKC B;  3K57 A;  1M4V A;  1HNW L;  2R7Z B;  1H9K A;  1HZA A;  5JAV A;  4JI4 Q;  2RBM A;  2JSO A;  1U4P A;  5C4X G;  2AWN A;  1WTO A;  4I65 A;  3NBI A;  2JA7 G;  3ULP A;  2F0Q A;  4JOI C;  1Y69 U;  2MPM A;  4C56 C;  1MI2 A;  4X66 Q;  2D0O A;  4JOI A;  4R9W A;  1HPC A;  2SNM A;  1FJG L;  3PQI A;  1JJ2 A;  1EUJ A;  4OX9 L;  2EIF A;  3LNN A;  3STB D;  4M8A A;  5E4W C;  4G4K A;  4JVZ A;  3CF5 A;  1K8A C;  1EOT A;  1PYS B;  2UU9 Q;  3NWS A;  1K9M C;  1PH2 A;  1NBW A;  4DV5 Q;  1SE8 A;  3EQL C;  4LF6 Q;  2KOL A;  5CBE E;  2QDL A;  3P7J A;  3RN2 A;  4HIO A;  2B2V A;  1LTL A;  1ENF A;  5DM7 3;  4ULL A;  4POG A;  1EYG A;  1F9S A;  3BJU A;  1VQ6 A;  5KND A;  2GVA A;  1EY9 A;  3VA5 A;  3ND8 A;  1IBK Q;  4DK3 C;  4XT3 B;  4DV7 Q;  1MJE A;  1PTO C;  5JJK A;  4C3H G;  3J81 E;  1QB5 D;  1PZI D;  3S1M H;  1PMR A;  1TWG B;  1SNC A;  1QG7 A;  4PNY A;  1VQO A;  3S1Q H;  1QE6 A;  1E2V A;  2K5N A;  2PW7 A;  4PZ8 A;  5H1S E;  5C44 G;  1VQ8 A;  3QWN A;  1PH8 A;  2QGQ A;  3OW2 A;  4NW2 A;  4KHV A;  2X6L A;  1VQA A;  3W1B A;  3GTM H;  4OO1 G;  1AW7 A;  1Y1W G;  1KDC A;  1FGU A;  1V1P A;  5IP7 H;  1SE2 A;  1N33 Q;  4MHE A;  1K8M A;  3FVQ A;  1TWC H;  1YI2 A;  4RKL A;  1RKN A;  4NKL A;  1QUQ A;  2O5J C;  1I94 Q;  5BR8 L;  2VS1 A;  5IT9 c;  1QVF A;  3M7N A;  5ISR A;  5D3I B;  2F4V Q;  3GTQ B;  3HOY B;  2AQ1 B;  2BDO A;  4DN4 M;  2V1C C;  4CKC A;  1LTT D;  2PZU A;  1JT8 A;  1WTP A;  4L5T A;  1ASZ A;  3HOZ H;  2IWH A;  1VQG A;  2YV5 A;  4DV2 Q;  3T56 B;  4A3I H;  5FO9 B;  1ZEQ X;  2CKZ B;  4HIK A;  1DD2 A;  1UWV A;  1PH1 A;  5C0X H;  5IIF A;  4CJ2 C;  1CKN A;  2PI2 A;  5EBC A;  2YTY A;  2F0E A;  1A2T A;  4LF9 Q;  1X3G A;  2PNH A;  2TSS A;  1L1O B;  4ILW A;  5BN4 A;  1UE6 A;  4X65 Q;  4PQX A;  3HZX A;  5CGK A;  1EQQ A;  4A3G G;  2JA6 G;  3S2H B;  1TU2 B;  4HJ9 A;  2YU9 H;  3M4O H;  3BS1 A;  1T5E A;  1WCM B;  3PUW A;  2NTT A;  1CSP A;  3S24 A;  2AMC B;  3CD6 A;  1U4L A;  1SR3 A;  2F52 A;  2UUA Q;  2ID0 A;  1U5K A;  3PGZ A;  2TMP A;  1S5E D;  1YNN D;  1BKB A;  1CFM A;  3PO2 G;  4ZUI A;  4CJ1 B;  4A3K H;  4FVM A;  4X64 Q;  4A3E G;  1HFN A;  1B9N A;  1VQD A;  1CK1 A;  1BCP C;  3S1N H;  5IGD A;  2RHQ B;  2I07 B;  1MHW C;  2WB1 B;  1U4M A;  3PO3 B;  1K0S A;  2V4D A;  2VQE Q;  4BY7 G;  4DV4 L;  2PMZ B;  1PH6 A;  4JI6 Q;  5D65 A;  1UEA B;  5COY A;  1Q82 C;  2PQA A;  3NQT A;  2QA4 A;  4RMF A;  3A5U A;  4X3U A;  4QB4 A;  3U58 A;  2K5V A;  4X62 L;  4DK6 C;  3NUC A;  5CYU A;  2ZXO A;  1Y1V B;  3T13 A;  2VXW A;  1MSG A;  4BBS G;  1KAB A;  2L12 A;  1HFG A;  2RF4 A;  3D3R A;  3K5N A;  4OIJ A;  1F9P A;  1IKM A;  3S16 B;  4ZAI A;  2NVY B;  4IUQ A;  2B63 H;  4LFA L;  3S1R B;  2AKW B;  1I6H B;  2F0L A;  1BUV T;  5HGT A;  3C46 A;  2NZH A;  5DM6 3;  5T1I A;  2F0P A;  3GTO B;  4C1N I;  1JE5 A;  4CJ0 B;  2F3V A;  1EYA A;  1QOH A;  3K0X A;  4A3F B;  2R6G A;  1L2F A;  1A3U A;  3GTJ H;  4YHH Q;  3R2T A;  3D4R A;  2BDN A;  3J7A V;  1OXV A;  2KHI A;  1S5C D;  2RDG A;  1DM0 B;  4K14 A;  1XMO L;  1R9T B;  3I4M G;  1RDP D;  5C3W A;  1RL2 A;  5T1G A;  2R92 G;  1YIT A;  1W6J A;  3ZYY X;  4BBR H;  1VQJ A;  2E75 C;  3TQY A;  3S17 H;  3TS2 A;  1EZ8 A;  1YZ6 A;  4DV3 Q;  5JEA G;  4GZY C;  2OTL A;  1JIC A;  1HQR D;  3DWA A;  4AQY Q;  3KLS X;  1A62 A;  4FF4 A;  2WP8 J;  4XIG S;  1D8L A;  3J81 c;  2EYH A;  3A8I E;  4JCV E;  4BA2 I;  1NJI C;  2ICI A;  2WAQ E;  5ELD A;  5GRO A;  3HOW H;  3MC0 B;  1YNJ D;  1LLR D;  2N55 A;  3CKI B;  4JBJ A;  3TME A;  3E9I A;  3I8Z A;  1EY8 A;  1PH4 A;  1DYQ A;  1I4Q A;  3D31 A;  3M85 A;  2JEA I;  2I0Q A;  1PFS A;  4LUO A;  2H5X A;  1J5E Q;  3C1F A;  2B2Y C;  1LAC A;  1HUM A;  2J7Z A;  3MWY W;  1V1O A;  3MXG A;  1SBB B;  1EWC A;  1STY A;  3NTK A;  4JI3 L;  3BZD B;  1VS0 A;  2JA5 H;  3SHL A;  1Z7T A;  2DJG C;  3OOC A;  3H3V H;  4TQU S;  1S5F D;  1SN8 A;  1LT6 D;  4A3L G;  5J1Z A;  1IYJ B;  3TDQ A;  3PF4 A;  3NEN A;  3EIV A;  1CSQ A;  3MXU A;  3V05 A;  1CZW A;  4A3J G;  1QUQ B;  1KLU D;  4O2D A;  2HDM A;  5EAY A;  1GHK A;  1AE3 A;  3I90 A;  2E5L L;  3S1M B;  1KRS A;  3S1Q B;  2NN6 I;  3HKZ G;  2Z6K C;  4IAL A;  4K8J A;  2OQ0 A;  3TRE A;  1JMC A;  1UNS A;  1G6P A;  2XIW A;  4DR3 L;  1R4P B;  1WTW A;  3GD7 A;  3H3V C;  3ERS X;  2X69 A;  2L0C A;  1WTH A;  1MGS A;  3GTM B;  2R7F A;  2F0V A;  1PRT C;  2LSS A;  4IJL A;  1PA6 A;  1H9S B;  4DNI A;  3JAM L;  1Z47 A;  1YJW A;  1Y14 B;  4M1U B;  3VYR A;  1CKN B;  1TY2 A;  1IZ6 A;  3PMF A;  4H44 C;  1ILP A;  4KK7 A;  2CW0 C;  1TWC B;  1YHA A;  2A6E D;  2NZO A;  4IFD J;  3F1Z A;  1VQL A;  5K5P A;  5IGB A;  2G9D A;  1O7Z A;  4C3J G;  3MAQ A;  1ICW A;  3CMA A;  2GVB A;  2Z6B A;  2HHH L;  2ZT9 C;  5IYB G;  2K4K A;  3DXJ C;  3J80 i;  5C5M A;  5JEA J;  1DJR D;  4A3I B;  3I72 A;  2L5T A;  4XYO A;  3OYY A;  2B3G A;  4A3B G;  2WFW A;  1LAB A;  1EY0 A;  4MZ9 A;  2A69 D;  2L55 A;  4OGQ C;  1HR0 W;  1HNZ Q;  3BDL A;  3TP7 A;  3LX0 A;  3TBI B;  4H13 C;  3TEH B;  1BCP B;  1IW7 D;  5LMU L;  2B8G A;  1NUC A;  4HJ7 A;  2YU9 B;  5M5Y H;  3M4O B;  1RJT A;  4C3I G;  2RA4 A;  3LWE A;  3GV6 A;  3ND9 A;  5BN5 A;  2ZM6 L;  4DAV A;  1LT3 D;  4DR4 Q;  1BO0 A;  3T1Y L;  4DV6 Q;  3HOU G;  2IT1 A;  1U0L A;  3HOX H;  1I4G A;  2MUY A;  1LTB D;  4A3M H;  1UAP A;  2KCN A;  3ERQ A;  2KQ3 A;  5CR3 A;  2VB3 X;  2K05 A;  1VQ4 A;  3BVM A;  2MJ8 A;  4A3K B;  4N8F A;  1HR0 L;  3HKS A;  4LF4 L;  2A1A A;  2BH2 A;  3RUZ A;  3CME A;  1W6K A;  3KDF A;  2UXC Q;  4ZUJ A;  4IN3 A;  4QUF A;  4NMZ A;  5IOD A;  1HH2 P;  2FFK B;  4R1J A;  4RA8 A;  3OHX C;  4ABN A;  3S9W A;  2H1E A;  5M3F H;  5M3M G;  1YHB A;  3HS0 C;  1QJO A;  1AZP A;  2A68 D;  1F2M A;  1BVS A;  1N8R C;  3J7Y W;  1TXY A;  1QVG A;  4HCS A;  3I70 A;  3H91 A;  3Q8D A;  2ICE C;  3ITP A;  1LTG D;  1ENC A;  1C7Y A;  4JI0 L;  2F03 A;  2M2L A;  5FLX L;  1HCZ A;  3AMU A;  1NMG A;  4K8I A;  2Q8T A;  1JWS D;  2O5I C;  5FO8 B;  4LF5 L;  2GA4 B;  1DZ1 A;  1H95 A;  4YY3 Q;  1D5X C;  1FL0 A;  3TP6 A;  4MIU A;  4I7Z C;  4QL5 A;  2B63 B;  3T1H Q;  2NVX H;  4DR2 Q;  1WD0 A;  2IW3 A;  4PV1 C;  4RH6 A;  1C9O A;  4XQN A;  1GOZ A;  4A76 A;  4QQB X;  5M5W H;  2D9U A;  3M7G A;  2WAQ B;  2IX1 A;  2VQF L;  5IGE A;  4B3T Q;  2PZT A;  2Z9H A;  1Z6H A;  2RVL A;  1ZYR C;  2XWB B;  3GTJ B;  2ZXR A;  4MNO A;  4AYB G;  3CCS A;  1XNR L;  2QW7 A;  4IO9 A;  3I4O A;  1PZK D;  2BA1 A;  4YCU A;  2OCE A;  4DV0 Q;  2NN6 G;  1PH3 A;  2ALY B;  2R7Z G;  3KBX A;  4ME3 A;  4JYA L;  4ALP A;  1NNX A;  5I6W A;  4P73 A;  4BBR B;  4KKS A;  2Q8I B;  3BVZ A;  3S17 B;  1N36 Q;  2JN4 A;  1LTS D;  2KHJ A;  4K2L A;  2CWA A;  2UUB Q;  2UUC Q;  4LW1 A;  4C3H H;  2A8V A;  3H0G G;  4GLV B;  2F0K A;  1R4Q B;  3PO3 H;  1S5D D;  1N34 L;  1EFI D;  3K7U C;  2LY7 A;  4B3M L;  2R7D A;  5LMN Q;  1Q46 A;  3PCO B;  2A5H A;  5AJ3 Q;  2FHT A;  2CFM A;  3GTP H;  2B8F A;  3F2C A;  4DV1 L;  1N9W A;  3UE1 A;  5IYD H;  3HOW B;  3CW2 C;  4U68 A;  1XTD A;  4IQZ A;  3EN2 A;  1Y1W H;  4CDC C;  2HUG A;  4DR5 Q;  3PUZ A;  1TWF H;  2R3Z A;  4DR6 L;  2QIL A;  3OMG A;  3BG3 A;  1F2L A;  4PG3 A;  1EEF D;  3NPP A;  2NVY H;  2UXD Q;  5E4X A;  5JJL A;  2E76 C;  3ULL A;  4FXD A;  1HA5 A;  1N32 L;  1IL8 A;  2I5L X;  4B9W A;  4Z9C B;  2R61 A;  1WOC A;  2IPK D;  2JA5 B;  4BY1 G;  3K58 A;  4LK1 C;  4QMG A;  1STH A;  1WI5 A;  3ICE A;  3IRB A;  1SJE D;  2F0D A;  4C2M H;  1TWH H;  1PRT B;  3KUP A;  4BS9 A;  2KEE A;  2VW9 A;  4FXK C;  1HTP A;  1J9O A;  2HCI A;  3RZD H;  3HOV H;  2RCN A;  3T53 B;  3Q0A A;  2E2H H;  1GD7 A;  4XQJ A;  4JV5 L;  5IYC H;  1KD1 C;  1VQ9 A;  2ASB A;  5JVH 3;  4KHP L;  3FEW X;  4A93 H;  1PH7 A;  1XNQ L;  1YJ9 A;  3AEV A;  1X3Q A;  1XPR A;  3N52 A;  4GKK Q;  1X6O A;  3G71 A;  5IWA L;  3NP8 A;  4K5V A;  5NUC A;  4DXF A;  4U67 3;  1CZG A;  1HNX L;  1X3F A;  1C4Q A;  4HSV A;  3CPF A;  3HGB A;  5C3E B;  4JW0 A;  3CRL C;  3G4S A;  1FNV A;  1GVP A;  4G7Z C;  3W5O A;  1JC7 A;  2AUK A;  4AH6 A;  4XTC S;  1AP0 A;  3RN5 A;  1VDZ A;  3HOY G;  2YTV A;  1STE A;  3PO2 H;  2ZTE A;  3NWT A;  4BXX G;  3E5S A;  4A3E H;  5EPL A;  2SDF A;  3BDO A;  1SXT A;  4JI5 Q;  1PTO H;  3D0F A;  5A2Q E;  2HD3 A;  1ESF A;  5GAG C;  4PZ7 A;  4HIM A;  5L37 A;  2B2V C;  1JB7 A;  4ZRZ A;  1EY4 A;  1KXL A;  5ELN A;  4DUY L;  5FO7 B;  1TII D;  3FMC A;  4JI7 Q;  4LFC Q;  3LWU A;  2WKC A;  4IUN A;  3SEB A;  4UY8 C;  4FXG C;  4V19 0;  4S3S A;  1HA6 A;  1SMX A;  3A55 A;  4F7X A;  3NE5 B;  1IXR A;  3CAM A;  4N9T A;  2L9H A;  1FNW A;  1VQP A;  5CV6 A;  1F77 A;  1NR2 A;  3F2D A;  1WCM G;  4NXN Q;  1TS2 A;  3P75 A;  1TKW B;  4GNX C;  1WVL A;  5KRU A;  1YHQ A;  2RSN A;  4JI2 Q;  1O7L A;  1YJN A;  4YCW A;  1EQV A;  5M5Y B;  1HZC A;  2DNE A;  4WJ3 M;  4GNX A;  5CV9 A;  4BA1 I;  2EDG A;  2KVM A;  4QGU A;  3FHW A;  1VQK A;  3P20 A;  1TQO A; 
#chains in the Genus database with same CATH homology
 2NZH A;  3FKI G;  3KYH C;  4B3R Q;  3BZC A;  4GN4 B;  4A3D G;  1GM5 A;  1JE5 A;  1GKH A;  1Z9F A;  4X6A H;  3CCE A;  1NE3 A;  4HID A;  2E8G A;  3K0X A;  4JC0 A;  4LWC A;  2R6G A;  2IX0 A;  1L2F A;  2WB1 G;  4L5Q A;  1VQ5 A;  4TVA B;  4LF5 Q;  3PSI A;  5IE8 A;  4JI4 L;  3GTJ H;  4YHH Q;  1JJG A;  1UEB A;  4IOC A;  1EIY B;  3K8A A;  3KOJ A;  1OXV A;  1MKH A;  5ELO A;  2KHI A;  3RZO H;  2DUD A;  4IOA A;  1Q81 C;  1FJG Q;  2GN5 A;  4EQ5 A;  3I4M H;  3RR5 A;  4A75 A;  1XMO L;  3J80 c;  4JBK A;  4OX9 Q;  2IY5 B;  3I4M G;  3AQQ A;  1RL2 A;  1W3S A;  1E24 A;  3H15 A;  2R92 G;  4YY3 L;  3W1G A;  1YIT A;  4BBR H;  4LFB Q;  1VQJ A;  3KFU A;  3TQY A;  4X66 L;  3T1H L;  3I4N G;  3S17 H;  3TS2 A;  5C0X J;  1EWI A;  1YZ6 A;  4DV3 Q;  5JEA G;  4P71 A;  3RLN A;  2VQF Q;  4EX5 A;  5IY0 A;  2HQL A;  2OTL A;  3PIP A;  4AQY Q;  4DUY Q;  5DLQ E;  3L7Z C;  3PF5 A;  3KF8 B;  1TWG H;  3JC6 6;  3UDX A;  1A62 A;  5C0X I;  1GO3 E;  1J6Q A;  2WP8 J;  4XIG S;  2UU9 L;  2HIV A;  3TRZ A;  1FVI A;  1D8L A;  3J81 c;  3S2D H;  1IBM L;  4B3T L;  4JCV E;  4LUV A;  4DPG A;  5LMN W;  4BA2 I;  1EQR A;  4LF6 L;  1KC8 C;  1NJI C;  2WAQ E;  4JYA Q;  5GRO A;  3BU2 A;  3RLF A;  1KIX A;  3HOW H;  3SGI A;  1JJC B;  1E1O A;  1VQI A;  4DR7 Q;  5K36 G;  1VQB A;  3HOW G;  3HOX G;  2PI2 E;  4YCV A;  4A3M G;  3I7F A;  1VQH A;  4JBJ A;  4NPS A;  1QZH A;  1X56 A;  3E9I A;  2UXB Q;  5GAD C;  4A3G H;  4DV0 L;  2JA6 H;  1PH4 A;  3M85 A;  4A3F G;  3D31 A;  5JJI A;  1UE5 A;  2I0Q A;  1BBW A;  2JEA I;  3BZK A;  1PFS A;  2CQO A;  4LUO A;  2H5X A;  1J5E Q;  1N34 Q;  3M4Q A;  4KHZ A;  2N78 A;  1IBK L;  1N36 L;  1OXX K;  4B3M Q;  3CQZ H;  1K8G A;  4IPG A;  3S15 H;  3U50 C;  4APV A;  4DV7 L;  3OTO Q;  2ES2 A;  4DKA C;  2YTX A;  3PUY A;  2D0P A;  2UUC L;  2UUB L;  4DR1 Q;  4DV1 Q;  4GN3 B;  3KF6 A;  4JI3 L;  1WYD A;  1VS0 A;  2JA5 H;  3GTQ H;  1WJJ A;  3HOY H;  4JI8 L;  4DAM A;  3H3V H;  4O0A A;  4TQU S;  2ATW A;  1QVC A;  5IP9 G;  3CPW A;  5LMN L;  4BXX H;  1SN8 A;  4JBM A;  1LYL A;  5AJ3 L;  2BA0 A;  3PIO A;  1X9N A;  1Q8K A;  1P16 A;  4NXM Q;  3M4P A;  4A3L G;  4DR6 Q;  1IYJ B;  4DUZ L;  3PF4 A;  1X65 A;  1CUK A;  3NEN A;  3EIV A;  4Y7N H;  3CCJ A;  1CSQ A;  2MO1 A;  2Q2H A;  4A3C H;  1YNX A;  3STB C;  3CCR A;  3M3Y H;  4A3J G;  1QUQ B;  3GTK H;  4DR5 L;  2D62 A;  1V43 A;  3GO5 A;  5BR8 Q;  1G51 A;  4DAY B;  1N32 Q;  4NB3 A;  4O2D A;  5EAY A;  2Z0S A;  1B7Y B;  1AE3 A;  1YBY A;  2CCZ A;  1N33 L;  2E5L L;  1PH5 A;  1KRS A;  4HJA A;  3FP9 A;  2NN6 I;  3K80 C;  4BY7 H;  1C0A A;  3HKZ G;  2Z6K C;  2Q2I A;  2OQ0 A;  3TRE A;  1JMC A;  2UXD L;  1G6P A;  1I94 L;  5HGQ A;  4DR3 L;  4PZ6 A;  2QEX A;  2N3S A;  4IPD A;  3GD7 A;  1L0W A;  1O7I A;  3S2H H;  2ZJQ A;  3ERS X;  1YVC A;  1RIP A;  3I55 A;  2R7F A;  2F4V L;  4IJL A;  2LSS A;  1PA6 A;  4DNI A;  3KDF B;  4R4T A;  1WCM H;  1Z47 A;  5C3E G;  1Y14 B;  1YJW A;  1IBM Q;  4JBW A;  4BBS H;  4JV5 Q;  3RNU A;  1CKN B;  4P74 A;  1IZ6 A;  3CXC A;  4HJ8 A;  1KHI A;  4KHP Q;  2ZTD A;  4DV2 L;  3PV0 A;  1T9H A;  1XNQ Q;  1YHA A;  2NZO A;  4JG2 A;  4IFD J;  2VZA A;  5GQO A;  3F1Z A;  5J3B A;  1VQL A;  1M1K C;  2MO0 A;  5IWA Q;  2VNU D;  2OTJ A;  1NTG A;  2I5H A;  1OTC A;  2NVT H;  2K50 A;  1SRU A;  4OO1 I;  3FKI H;  1AH9 A;  4C3J H;  1Q1B A;  4JI1 Q;  1CKO A;  1L1O C;  2Y0S E;  5C4J H;  1HNX Q;  4A3D H;  3CMA A;  1EFW A;  3S14 H;  4LF9 L;  4IFD I;  2GVB A;  4B3S Q;  1NMF A;  4GKK L;  1L1O A;  2HHH L;  4X65 L;  5IYB G;  2K4K A;  4FDB A;  1PV4 A;  4LF7 L;  3J80 i;  1LUZ A;  5JEA J;  3KJO A;  4POF A;  3PO3 G;  2XGT A;  1SRO A;  4GOP C;  1K83 H;  3MEF A;  4AIM A;  3OYY A;  2Q2U A;  2MNA A;  2B3G A;  4A3B G;  1Q12 A;  3KJP A;  2WFW A;  4GOP A;  4IPC A;  1KRT A;  4MZ9 A;  2R92 H;  2UUA L;  1XMQ Q;  5IYD G;  1HR0 W;  3CCM A;  3I4N H;  1HNZ Q;  3TS0 A;  2JA8 H;  2JA8 G;  1Y1V H;  3CCL A;  4DR2 L;  1HZB A;  4R4I A;  1Y1V G;  3TEH B;  3J81 i;  3ULJ A;  4X64 L;  5LMU L;  1IBL L;  1V9P A;  5IP7 G;  1P8L A;  4JI5 L;  2NVQ H;  2KBN A;  4HJ7 A;  5M5Y H;  3S16 H;  3ZJY C;  2L15 A;  4DV4 Q;  1A63 A;  1UE7 A;  3S1R H;  2JA9 A;  2AWO A;  1QZG A;  1WFQ A;  2N49 A;  1I6H H;  2ZM6 L;  4DV5 L;  2C35 B;  2EQS A;  2ZTC A;  4DR4 Q;  1D7Q A;  4OWX B;  2RHS B;  2I5M X;  3T1Y L;  4DV6 Q;  3HOU G;  1E3P A;  2WB1 E;  4X62 Q;  2DGY A;  2IT1 A;  1U0L A;  3HOX H;  2VQE L;  4A3M H;  3GTO H;  4YWM A;  5GAH C;  1CKM A;  4JI7 L;  4GKJ L;  4LFC L;  4JI6 L;  1VQ4 A;  4QJF A;  4A3F H;  1HR0 L;  4OON A;  2KCM A;  3HKS A;  2PMZ E;  1SFO H;  2B29 A;  1M90 C;  3HOZ G;  4LF4 L;  2A1A A;  2BH2 A;  3J81 j;  2JEB I;  1PVO A;  2EXD A;  4GNX B;  4A3I G;  4LFA Q;  3CME A;  3KDF A;  2UXC Q;  1I5F A;  2ZJP A;  3E0E A;  3HOV G;  1HH2 P;  4R1J A;  4UPA A;  4NXN L;  1R9T H;  2E2I H;  3H3V I;  5M3M H;  5C0X G;  4H02 A;  3DM3 A;  5IYC G;  5M3F H;  4P72 A;  4JI2 L;  3AFQ A;  4J15 A;  5M3M G;  1HZ9 A;  1YHB A;  5M3F G;  2R93 H;  4A93 G;  2F3I A;  2R93 G;  4YWK A;  1HJP A;  5IP9 H;  1BVS A;  1N8R C;  5GAE C;  4QY7 A;  4LUZ A;  1BBU A;  1S3O A;  1LM0 A;  1TXY A;  1VQC A;  3WWV A;  3G6E A;  1S72 A;  1E22 A;  1QVG A;  4K0K L;  4A3L H;  3Q8D A;  3JAM i;  1HNW L;  3CCQ A;  1HZA A;  1C7Y A;  4JI4 Q;  4JI0 L;  4B3R L;  2OWO A;  1X55 A;  2CWP A;  5C4X G;  4A3J H;  2AHO B;  2K5H A;  1NMG A;  2AWN A;  1XMO Q;  3JAM c;  2JA7 G;  3ULP A;  4JOI C;  4GN5 A;  3NBH B;  4LF5 L;  1PYB A;  4KI0 A;  1H95 A;  1E7Z A;  4YY3 Q;  1FL0 A;  4YHH L;  4QL5 A;  2K52 A;  1S40 A;  4X66 Q;  2D0O A;  4JOI A;  3T1H Q;  2NVX H;  1Q86 C;  1W2B A;  1TWA H;  2XTI A;  4DR2 Q;  2ZJR A;  1FJG L;  3K81 C;  1JJ2 A;  1EUJ A;  4OX9 L;  2EIF A;  3STB D;  4A3K G;  1C9O A;  1KAW A;  1G29 1;  1B8A A;  3AYH B;  3CF5 A;  4A76 A;  1K8A C;  5M5W H;  4LFB L;  1PYS B;  3AFP A;  4QQB X;  2UU9 Q;  1Q1E A;  4L5S A;  1K9M C;  2MFI A;  5C3E H;  1PH2 A;  4DV3 L;  1NBW A;  2IX1 A;  2VQF L;  4DV5 Q;  4B3T Q;  1SE8 A;  5FLM H;  4LF6 Q;  5FLM G;  2OQK A;  3RN2 A;  2MQH A;  1I3Q H;  4MNO A;  4HIO A;  4AYB G;  1LTL A;  3CCS A;  1XNR L;  4IO9 A;  4GLX A;  3I4O A;  4POG A;  2BA1 A;  4YCU A;  4YWL A;  1EYG A;  4MTN A;  3U4V A;  2OCE A;  4DV0 Q;  2NN6 G;  3BJU A;  1PH3 A;  4PMW A;  1VQ6 A;  2ALY B;  2GVA A;  4UP7 A;  2R7Z G;  4GLA C;  4ME3 A;  4JYA L;  4ALP A;  4P73 A;  4DR7 L;  3GDE A;  1IBK Q;  1N36 Q;  3DLL A;  2KHJ A;  1NY4 A;  3PUX A;  4DK3 C;  1OXT A;  3HKZ E;  2CWA A;  5IYB H;  3L2P A;  4DV7 Q;  3H0G H;  1MJE A;  2UUB Q;  4LW1 A;  2UUC Q;  4C3H H;  3EBE A;  2A8V A;  3H0G G;  4GLV B;  5JJK A;  4A4I A;  3KF6 B;  4JI3 Q;  3S1M H;  5M5X H;  3PO3 H;  1XPO A;  3U4Z A;  1J5E L;  2LXK A;  1N34 L;  4UP8 A;  3S1Q H;  1VQO A;  3K7U C;  4JI8 Q;  4R4C A;  2K5N A;  4PZ8 A;  5H1S E;  5C44 G;  1E1T A;  4B3M L;  4A3B H;  2R7D A;  5LMN Q;  1Q46 A;  3PCO B;  1VQ8 A;  5AJ3 Q;  2CFM A;  3UDF A;  3OTO L;  3GTP H;  3F2C A;  4DR1 L;  1PH8 A;  4DV1 L;  1N9W A;  2QGQ A;  4R4Q A;  3OW2 A;  1KQS A;  4DUZ Q;  3UE1 A;  4JI0 Q;  5IYD H;  2JQO A;  4OXP A;  1VQA A;  3CW2 C;  1V1Q A;  1XTD A;  3E9H A;  3W1B A;  3UDG A;  3GTM H;  3EN2 A;  1Y1W H;  4OO1 G;  4AYB E;  4DR5 Q;  1Y1W G;  1VQ7 A;  1FGU A;  2WAQ G;  3PUZ A;  4IFD G;  1TWF H;  4DR6 L;  5IP7 H;  5FJ8 H;  4NXM L;  1N33 Q;  3HFZ B;  2E5L Q;  5FJ8 G;  1K73 C;  1Q7Y C;  4PG3 A;  1EIF A;  3PUV A;  1TWC H;  4C3I H;  1YI2 A;  2NVY H;  1K3R A;  2UXD Q;  1VQN A;  5JJL A;  1QUQ A;  3ULL A;  4IPH A;  1I94 Q;  5BR8 L;  2VS1 A;  4DR3 Q;  5IT9 c;  3UE0 A;  4GS3 A;  2VUM H;  2PQA B;  1N32 L;  2VY3 A;  2VUM G;  1ASY A;  2I5L X;  4OWT B;  4RG1 A;  3HOU H;  4BY1 H;  1QVF A;  3M7N A;  4LNQ A;  1WOC A;  2F4V Q;  4BY1 G;  3RLO A;  4BBR G;  2V1C C;  1WI5 A;  3ICE A;  2JE6 I;  3F8T A;  4WJ4 A;  3IRB A;  1EOV A;  4C2M H;  1TWH H;  1JT8 A;  2A19 A;  4L5T A;  1ASZ A;  1B70 B;  3HOZ H;  2VW9 A;  1VQG A;  2YV5 A;  4DV2 Q;  2E2J H;  4A3I H;  2CKZ B;  1XNR Q;  4HIK A;  1UE1 A;  1XJV A;  3I2Z A;  5FLX c;  3RZD H;  3HOV H;  2RCN A;  2E2H H;  3CC2 A;  1GD7 A;  1UWV A;  1PH1 A;  4JV5 L;  5IYC H;  4LF8 L;  1KD1 C;  1VQ9 A;  1CKN A;  3F2B A;  2PI2 A;  2YTY A;  2ASB A;  4KHP L;  4A93 H;  3UDI A;  4LF9 Q;  2KEN A;  1PH7 A;  1X3G A;  1XNQ L;  3GTG H;  1YJ9 A;  3AEV A;  2PNH A;  3CCU A;  4GKK Q;  1L1O B;  1XPR A;  1X6O A;  2HHH Q;  1UE6 A;  4X65 Q;  3G71 A;  1KL9 A;  5IWA L;  3MXN B;  1X54 A;  4UP9 A;  4LF7 Q;  1EQQ A;  4A3G G;  3ER0 A;  2JA6 G;  4JI1 L;  3A5Z B;  3M9B A;  1HNX L;  1PHJ A;  4HJ9 A;  1X3F A;  5C4X H;  2YU9 H;  4L5R C;  3M4O H;  4B3S L;  2VL6 A;  1A0I A;  3CPF A;  4R4O A;  3G4S A;  4Y52 H;  1I50 H;  2LXJ A;  2JA7 H;  1GVP A;  3PUW A;  4GOP B;  1CSP A;  1PH9 A;  1IL2 A;  3S24 A;  2AMC B;  3CD6 A;  3W5O A;  1AE2 A;  1SR3 A;  2F52 A;  2UUA Q;  1VQE A;  2ID0 A;  4AH6 A;  1U5K A;  4XTC S;  3PGZ A;  4OWW B;  3A0J A;  3RN5 A;  2N8N A;  2JA5 G;  1SLJ A;  2YTV A;  3HOY G;  2YYZ A;  3PO2 H;  1BKB A;  2ZTE A;  4BXX G;  3PO2 G;  3NEM A;  4A3K H;  5LMU Q;  4X64 Q;  4A3E H;  2IHF A;  1IBL Q;  3KLW A;  1DGS A;  4A3E G;  4JI5 Q;  3D0F A;  1XMQ L;  3L0O A;  1HNZ L;  1VQD A;  4A3C G;  3J7A 5;  3S1N H;  1VCI A;  2RHQ B;  5GAG C;  5HY6 A;  4PZ7 A;  4HIM A;  2ZM6 Q;  3VDY A;  2Y0S G;  4IJH A;  1JB7 A;  2JJQ A;  2JK8 A;  1VQF A;  1OXS C;  3T1Y Q;  1KXL A;  5ELN A;  4DUY L;  4AQY L;  3CP0 A;  2VQE Q;  1A8V A;  1X3E A;  4BY7 G;  3CC4 A;  2IHE A;  4JI7 Q;  4DV4 L;  4GKJ Q;  1PH6 A;  4LFC Q;  4JI6 Q;  1VQM A;  3LGJ A;  2Z6K A;  2K75 A;  2HIX A;  1Q82 C;  2PQA A;  1HR0 Q;  4UY8 C;  2R7Z H;  2QA4 A;  4DR4 L;  4RMF A;  2KCT A;  3A5U A;  4LF4 Q;  3J7Z C;  3CC7 A;  4DV6 L;  3U58 A;  1MIU A;  1MJC A;  2K5V A;  1SMX A;  3A74 A;  4DK6 C;  4X62 L;  2BH8 A;  1IXR A;  3CAM A;  3NEL A;  3K7A H;  4P75 A;  1VQP A;  3F2D A;  1WCM G;  4NXN Q;  4LF8 Q;  5E7N A;  2HT1 A;  3CCV A;  1YIJ A;  4BBS G;  1OXU A;  2UXB L;  4GNX C;  1YHQ A;  2RF4 A;  3G48 A;  4QIW E;  4JI2 Q;  3I56 A;  4YCW A;  1YJN A;  1YEZ A;  5C44 H;  1HZC A;  2Q2T A;  4WJ3 M;  4KLK A;  2B63 H;  1K0R A;  4GNX A;  4LFA L;  1XPU A;  3GTL H;  2FXQ A;  4HJ5 A;  4BA1 I;  3B6Y A;  2B63 G;  2K14 A;  4QGU A;  3FHW A;  4K0K Q;  2UXC L;  2AKW B;  1VQK A;  1HNW Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...