1VQHA

Gene v protein mutant with ile 47 replaced by met 47 (i47m)
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
86
structure length
86
Chain Sequence
b'MIKVEIKPSQAQFTTRSGVSRQGKPYSLNEQLCYVDLGNEYPVLVKMTLDEGQPAYAPGLYTVHLSSFKVGQFGSLMIDRLRLVPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GENE V PROTEIN
publication title Potential use of additivity of mutational effects in simplifying protein engineering.
pubmed doi rcsb
source organism Enterobacteria phage f1
molecule tags Dna binding protein
total genus 9
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 1996-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02303 Phage_DNA_bind Helix-destabilising protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1vqhA00
3DLLA 1B7YB 3BZKA 1VQIA 1TWHH 1HNZL 2UUBQ 1ASYA 4POGA 1XNRL 2HHHL 1C9OA 4GN4B 3L0OA 1UE6A 4JI3Q 3H0GH 4B3TQ 2Q2HA 4A3LH 2OQKA 5IYDH 2VQEL 2R7ZG 2JA5H 5C44H 1KXLA 1E3PA 4GLAC 4OWXB 3PF5A 4BBRH 1SN8A 2BA0A 2E2HH 3PO3G 1PH5A 1H95A 3HFZB 5M3FH 2CWAA 1E1TA 4B3SQ 3WWVA 1QVFA 1U0LA 1KRTA 4DR5L 5M5XH 5AJ3L 5C4XG 1EUJA 3A5UA 1IBKQ 2RHSB 3CXCA 3CCQA 2KBNA 4YY3L 1VQ9A 3CCJA 4IO9A 2UUCL 2D0PA 3FKIH 4YWKA 1P8LA 2UXBL 3PCOB 3J81c 4JI7L 4DPGA 1EIYB 1P16A 4KHPQ 3T1YQ 1N34Q 3EN2A 1UE1A 1E24A 1KC8C 1PH1A 1L1OC 4LUOA 1BKBA 3A0JA 4NXMQ 3CMAA 5IE8A 5BR8L 4LF8L 1VQ7A 4DNIA 1O7IA 4DV4L 1Y14B 3MXNB 3I4NH 2DUDA 2H5XA 1X3FA 4A3EG 4DR4L 4NXNQ 4BY7G 3HOWH 2VQEQ 3NEMA 3RN2A 4A93G 1X65A 4LF5Q 4GKJL 2UXDL 5LMUL 4DV2L 4O2DA 3RR5A 4HJ5A 3AFPA 4DR1L 4DUYQ 3I56A 3S24A 2UU9L 2OWOA 4JOIA 2CCZA 2D0OA 3KYHC 2A1AA 4JG2A 2VS1A 2OQ0A 5LMNL 4A3FH 1DGSA 3FHWA 1Y1WG 3TREA 3PUYA 1PFSA 4IFDI 4IPHA 2K4KA 5IY0A 5M5WH 4BA1I 2WAQG 4P75A 1BBWA 3AQQA 1WCMG 4HIDA 3ICEA 3CCEA 4PG3A 1HNXQ 4GNXB 2YV5A 2UXBQ 1CKNA 1YNXA 3PGZA 4A3MH 1A62A 4L5QA 1V43A 4DV6L 1PH3A 4DV0L 4OWWB 4QGUA 4ME3A 1Q46A 1EOVA 5JJIA 1OXSC 1G51A 2F4VQ 1J6QA 2CKZB 5C4JH 3J7A5 3S1RH 2E2IH 1NBWA 3K8AA 3UE0A 4GNXA 1QVGA 3UDGA 1J5EQ 3KJOA 4OO1G 1JJCB 2JQOA 4JBMA 4LF7Q 4IPDA 1T9HA 5K36G 4QJFA 4LFCQ 5JEAG 3M3YH 3VDYA 3G71A 2Y0SG 1N33L 5LMUQ 2ASBA 3K80C 1IBLL 3I4OA 1PV4A 1Q8KA 2WAQE 4UP7A 1UE7A 2VQFQ 4JBKA 2GN5A 4BY7H 2IX0A 4YHHQ 2HT1A 2PI2E 4LUVA 1B8AA 3KOJA 4GLVB 3PIOA 1QZGA 4OONA 3AEVA 5JJKA 2MNAA 2Q2UA 2UUBL 1JT8A 2OTJA 3CCLA 4AYBG 4JI3L 3ZJYC 4HJAA 2GVAA 1QVCA 1VS0A 1L1OA 2CQOA 4APVA 4DV3L 2Q2TA 4B3TL 4L5SA 1K3RA 3PV0A 4FDBA 4JBJA 4DUZQ 1EQQA 2N78A 2BH2A 3KLWA 1N8RC 3M7NA 3CC4A 4C3IH 3HOYH 1HZCA 2VW9A 1WCMH 2E5LL 4IFDJ 2JE6I 3HKZG 3H15A 4JC0A 1XMOQ 2Y0SE 3EBEA 3TRZA 1D8LA 1Q1EA 2XGTA 3U58A 3M4OH 2N8NA 2V1CC 1IBKL 1NMGA 4JI4Q 2Z0SA 1X55A 1IBMQ 3RLFA 4BBSG 1Q1BA 4A3CH 3NELA 1YJ9A 4JI6L 4A3DG 4AYBE 4KHPL 1EFWA 3SGIA 4EX5A 1U5KA 5IP9H 4X62Q 1K0RA 3OTOL 1Q81C 1KIXA 2AWOA 3CP0A 2QEXA 2AKWB 5M5YH 3KF6A 1Q86C 3GTQH 5C0XI 5H1SE 1GO3E 3NENA 1YZ6A 4PZ6A 1XPRA 4NXML 5IP7G 2K5NA 2ZTEA 3W5OA 5GADC 4GOPB 3HOUG 3HKZE 3GTPH 5C3EH 3F2DA 1GVPA 4X66L 4DV3Q 4DV1Q 1R9TH 1PYBA 3HOVH 4LFBQ 4BXXG 4NXNL 4GN5A 5IYCG 1A8VA 3CMEA 3PF4A 2IHFA 1VQFA 3LGJA 4LF5L 3S14H 2L15A 2E5LQ 3RLNA 2NZHA 4DUYL 4GOPA 1GKHA 2EXDA 4UP8A 2B3GA 2CWPA 4WJ4A 2VNUD 2ZTCA 2NN6I 3CQZH 1L0WA 5IYBH 1TXYA 4A3JG 2PMZE 2RF4A 1EYGA 1RIPA 3KF8B 2JA6H 3HOZH 2KENA 2VZAA 2R93G 1PYSB 3GTMH 3AFQA 1MKHA 4EQ5A 4R4IA 1TWAH 2I5MX 2QA4A 4A3IH 2JA8G 1HNXL 3GTGH 3I4MG 1OXTA 1LTLA 4JI6Q 3JC66 4LF9L 1PH9A 1LYLA 2KCTA 3GO5A 3U4VA 3OTOQ 2BA1A 3HOXH 3UE1A 1TWGH 4BBSH 2F4VL 4QIWE 1CSQA 4MTNA 3M9BA 4A3DH 3STBC 4AIMA 3F2CA 4A3KH 1YI2A 1YEZA 3G48A 1J5EL 4PZ8A 5ELOA 4R4OA 2NVQH 1VQ4A 4X66Q 4LF7L 1HR0Q 2IX1A 2ZTDA 4LFCL 5IP7H 4JI5Q 5C0XJ 4YWMA 3CW2C 1CSPA 2JJQA 2K14A 2YTXA 2A8VA 1VQJA 1HZBA 1VQHA 4HIOA 2A19A 3M4QA 3T1HQ 1VQDA 3GTLH 1YHAA 4UP9A 2I0QA 1FVIA 3AYHB 2VQFL 1CUKA 1CKNB 1S3OA 3I2ZA 4YHHL 1X6OA 2R7ZH 1CKOA 1KRSA 1BBUA 1TWCH 3ULJA 1S72A 1E22A 3E9IA 2JK8A 3OYYA 4HIKA 1HR0W 4KLKA 1KD1C 2HQLA 2MQHA 1PH6A 1KHIA 1YHBA 2MFIA 3PO3H 3GTKH 2AMCB 3PUXA 4DR7Q 3EIVA 1JE5A 1XNQQ 3UDIA 1D7QA 4OWTB 3GTOH 4BY1G 1VQNA 5C4XH 4DUZL 4LF9Q 1XMQQ 4WJ3M 1IL2A 2FXQA 2R93H 4P72A 2E2JH 4P71A 3CCUA 3F8TA 1KL9A 4AQYQ 1I5FA 4XIGS 1XMOL 3TS0A 4X65Q 1MJCA 4JI1L 1XPOA 1G6PA 2ATWA 5GROA 4C3JH 3PSIA 3PUVA 1S40A 3G6EA 2VUMG 1B70B 3PO2G 2LSSA 4J15A 4DR3Q 2R92G 4JI4L 1JJ2A 4LF4Q 3MEFA 1IBML 1NTGA 2YU9H 1QUQB 3K7UC 1SRUA 3S2DH 4HIMA 1M90C 4GKKQ 1L1OB 4A3EH 1YITA 1K8AC 4LF6Q 4X62L 3CD6A 1CKMA 2NZOA 1PH8A 3S1NH 4JI8Q 1PH7A 4A93H 1OXVA 3PIPA 2R7DA 1YJWA 2ID0A 2B63G 1IYJB 1Q12A 1QUQA 3K7AH 4IJLA 4JCVE 4LW1A 3RN5A 1QZHA 4DAYB 4JV5Q 3J80i 1AE2A 1V1QA 1Y1WH 1VQ8A 2NVYH 3K0XA 4DV1L 3W1GA 4Y7NH 1HNWL 1Y1VG 4LFBL 1IZ6A 3BJUA 5IWAQ 4XTCS 2I5HA 4DR2Q 3CCMA 3I7FA 4JBWA 1PVOA 4BY1H 4MNOA 2WB1G 3I55A 1VQBA 1GM5A 2ES2A 4JI1Q 4OO1I 2IY5B 4LUZA 3TS2A 2K5HA 3CC7A 3H0GG 2IT1A 3KF6B 1VQ6A 1G291 4LNQA 5IYDG 1SR3A 5C44G 1PHJA 4IPCA 1FGUA 3U50C 1C7YA 1X3GA 1MIUA 2JEAI 2B29A 4IJHA 3ERSX 4BBRG 4LFAQ 2EQSA 2IHEA 1XJVA 1VQKA 1XPUA 2VUMH 5M3FG 4R4TA 5GAHC 4OX9Q 4B3MQ 5HY6A 1VQPA 3CCRA 4DKAC 2JA7G 3IRBA 4O0AA 1YJNA 2DGYA 3ULLA 1VQEA 2YTYA 1A0IA 2C35B 3FKIG 2GVBA 2JA9A 4L5TA 4DK6C 2WB1E 2LXJA 5FLMG 1HNWQ 1HR0L 1Z47A 1W2BA 1X54A 1ASZA 1OXUA 4JI5L 1E7ZA 1VQ5A 2ZJQA 2UUAL 2R6GA 2XTIA 1E1OA 3BU2A 5J3BA 3M85A 3W1BA 1X56A 4GLXA 3T1HL 1JB7A 1EWIA 1UEBA 1SROA 4DV5L 5HGQA 2ZM6Q 3L7ZC 1PH4A 1WOCA 2KCMA 4MZ9A 4YCWA 3I4NG 2PQAA 4X6AH 3RZDH 1K83H 1HZAA 2HIVA 1M1KC 1SMXA 1K73C 1VQMA 3HOWG 4B3RL 1VCIA 3J80c 4DR7L 1N36Q 3D0FA 4YCVA 4PZ7A 3G4SA 1XNQL 4JI2Q 2LXKA 1A63A 4A75A 1HH2P 1SE8A 2AWNA 3M4PA 2F52A 3J7ZC 1EQRA 4GNXC 4A3FG 1XMQL 3HKSA 3B6YA 1AH9A 5JEAJ 3KDFB 4UPAA 2E8GA 2K5VA 1VQOA 4JYAQ 4IOCA 2R7FA 4AQYL 4X64L 5M3MG 2ALYB 4X65L 4BA2I 1Q82C 4A3MG 3KJPA 3UDFA 1VQCA 4HJ9A 3FP9A 4YWLA 1YBYA 3KDFA 4DR3L 2ZJPA 1KAWA 1OXXK 1I50H 4KI0A 3PUZA 4LF4L 2JA7H 3HOUH 3CF5A 4IFDG 3E9HA 2UUAQ 5IT9c 1PH2A 3K81C 1NMFA 1I94Q 5FLMH 4NB3A 2D62A 4DV5Q 4GKKL 3Q8DA 1YHQA 4BXXH 4LF6L 2AHOB 5IYCH 3GD7A 2UXCL 4DR6L 1Z9FA 4JI8L 2YTVA 4A4IA 4P73A 4POFA 4JI0Q 1GD7A 5DLQE 2RHQB 4QY7A 4HJ8A 4B3RQ 1IXRA 1XNRQ 1HNZQ 4RG1A 2N49A 4A3GG 2HHHQ 3S15H 4JV5L 5GQOA 4TVAB 4RMFA 1X3EA 1HZ9A 2EIFA 2Z6KC 4A3JH 1XTDA 1UWVA 4A3BG 5IWAL 1C0AA 4DR2L 3H3VI 2JA8H 4X64Q 2JEBI 1VQAA 3I4MH 2RCNA 1K9MC 3S1MH 2BH8A 2K75A 5ELNA 3CCVA 5JJLA 1FL0A 4DR5Q 4LWCA 5E7NA 5AJ3Q 3H3VH 1N32L 4IOAA 1WFQA 3S1QH 5M3MH 4YY3Q 3ER0A 3HOYG 1I3QH 2UUCQ 1MJEA 2K50A 2K52A 2F3IA 1KQSA 4JI7Q 4R1JA 5FJ8G 3L2PA 4LFAL 3ULPA 1YIJA 1BVSA 2UXCQ 3DM3A 4DR6Q 4OX9L 3RLOA 4B3ML 3JAMi 3TEHB 3RZOH 3PUWA 3S16H 5BR8Q 1VQGA 4LF8Q 2PI2A 3S2HH 4DV4Q 3D31A 4OXPA 4KHZA 4GOPC 4AH6A 2Q2IA 4A3CG 2NVXH 2KHIA 3U4ZA 3GDEA 1FJGL 4DR4Q 2KHJA 5IP9G 4DK3C 5GAEC 2WP8J 1VQLA 4A3GH 4DV2Q 2UU9Q 4GKJQ 2UXDQ 2WFWA 4H02A 4DR1Q 2OTLA 2VY3A 1WJJA 2ZJRA 2ZM6L 4A3BH 5LMNQ 5C3EG 4GS3A 1W3SA 3CCSA 1WYDA 2VL6A 4DV7L 3HOVG 4R4QA 1V9PA 2CFMA 4A3LG 3CC2A 5C0XG 1N32Q 4K0KQ 3A5ZB 4QQBX 4IPGA 2JA5G 4L5RC 1OTCA 3S17H 1LUZA 4Y52H 2NVTH 3E0EA 3GTJH 1N36L 1I6HH 1L2FA 1HJPA 4R4CA 1UE5A 4JI2L 2HIXA 4TQUS 4DV6Q 1JJGA 4K0KL 1WI5A 4DV0Q 3OW2A 3PO2H 4QL5A 2YYZA 3J81i 3CPWA 5IYBG 2R92H 1YVCA 5GAGC 3J81j 3CPFA 5LMNW 4JYAL 4DAMA 3HOZG 1NE3A 2JA6G 3KFUA 4NPSA 2OCEA 2Z6KA 2PNHA 4C2MH 5FJ8H 1TWFH 1X9NA 4A3IG 1EIFA 1JMCA 1LM0A 2MO1A 4B3SL 5EAYA 2NN6G 4JOIC 4HJ7A 2N3SA 1N9WA 4GN3B 4ALPA 2PQAB 4UY8C 1FJGQ 3RNUA 2I5LX 4C3HH 3A74A 3HOXG 3BZCA 1SLJA 3F2BA 3F1ZA 1Q7YC 2B63H 4P74A 4YCUA 1N33Q 3NBHB 3UDXA 1RL2A 3CAMA 2QGQA 1SFOH 1PA6A 1K8GA 1IBLQ 4PMWA 1NY4A 2MO0A 3STBD 1I94L 4A3KG 1AE3A 1Y1VH 3JAMc 3T1YL 1NJIC 1N34L 4A76A 3TQYA 5FLXc 4DV7Q 4JI0L
chains in the Genus database with same CATH superfamily
3PMFA 4ME5A 1ASYA 1K8MA 3EA6A 2HHHL 3X3MA 4GN4B 1EYDA 4ULLA 4LJZC 2I46A 2R7ZB 3W2DA 2VQEL 3N6RA 2F03A 2R7ZG 2GA4B 5F2DA 4OWXB 3FRPB 2KA7A 3E3XA 4KN4C 2BA0A 2PW7A 3Q0AA 3HFZB 5M3FH 1E1TA 1WTQA 1U0LA 1CQFA 1SNMA 1DONA 1EUJA 1DD2A 1R4QB 2UUCL 4YWKA 1L0YB 3WOEA 1QILA 2L11A 2CH4W 5IGCA 1STHA 4R9WA 2EJGC 4A3EB 2Z4HA 3BVMA 4JK1C 4OGQC 1JC7A 4A3EG 2IPKD 1X65A 1CA6A 4DV2L 1SJHD 4HJ5A 3BVZA 1Y1WB 2D0OA 4QB4A 3KYHC 2VS1A 1TY0A 1Y1WG 1BQQT 2CQAA 4PNYA 2WAQB 4IPHA 2EYOA 2WAQG 3CHBD 1QE6A 4RAUC 5FK9C 5DAUA 5HURA 4A3MH 4DV6L 4DK0A 4DV0L 4N8X1 4UAIA 5CGKA 4QGUA 4ME3A 1EOVA 5JJIA 1OXSC 4CKEA 4J6HA 2Q8TA 1NBWA 1J5EQ 4OO1G 3S15B 2JQOA 3FPUB 5TSSA 4IPDA 4RHSA 1ESRA 4KMUC 3A8IE 5LMUQ 1EY0A 2CH4A 2H1EA 1H9RA 2CVRA 3VYSA 1R9TB 2IX0A 3EFXD 3E5SA 1SBBB 3M7GA 1GUTA 1VS0A 4APVA 1K3RA 4FDBA 1EQQA 4RGOS 2EVBA 3KLWA 2G9HD 1BO0A 1B50A 3HG9A 2VW9A 4CDFC 4JC0A 2Y0SE 2IL8A 3EBEA 3V96A 1D8LA 1Y8NB 3M4OH 2N8NA 3MXUA 2X6LA 4DF7A 1NMGA 4DA2A 4JI4Q 4NKLA 5CV7A 4A3DB 2QF7A 1Q1BA 3VA5A 1IYVA 1YJ9A 4HR7B 4A3DG 3R93A 3MXGA 3S15H 1CZWA 1K0RA 1U4PA 3CP0A 2QEXA 3A7LA 3KF6A 2JA7B 5H1SE 3HOUB 1XPRA 5IP7G 3X3NA 5GADC 3CRLC 2B39A 3FDTA 3HOUG 2OXPA 5FOBB 1PFBA 1GVPA 3F2DA 4DV1Q 1R9TH 1PYBA 1XYIA 5COYA 5C0XH 1G6ZA 1A8VA 2M9VA 3PF4A 2IHFA 3T51B 1VQFA 3LGJA 4KTAA 1JE4A 2NZHA 4GOPA 2EYHA 2EXDA 4A3JB 2VNUD 5IYBH 4A3JG 2RF4A 3BYYB 3KF8B 2NZ1D 4KKTA 2VZAA 1PYSB 3GTMH 1JOQA 5IODA 4A3IH 4JI6Q 3JC66 2KOLA 1PH9A 3OTOQ 1CK1A 3UE1A 1O78A 2RDFA 4QIWE 4A3DH 3STBC 3F2CA 1J5EL 1HQMC 1VQ4A 2QW7A 3S1NB 5IP7H 4JI5Q 2EJFC 2A68C 3DXJC 2A8VA 2L4NA 4HIOA 1WD0A 1WTHA 2A19A 3M4QA 2I0QA 1HTLD 3AYHB 1CKNB 3NP8A 4U673 3I2ZA 1KRSA 1BBUA 1E22A 4KLKA 2F0FA 2HQLA 2MQHA 1YHBA 4DR7Q 3PUXA 1XNQQ 1U9RA 1D7QA 4G7ZC 2LKVA 5C4XH 4CJ2C 2A6HD 2RQXA 1DYQA 1B44D 1S5FD 4AQYQ 1G2TA 1HUMA 3IFTA 3KK7A 4X65Q 5DEHA 3T13A 5J39A 1V8QA 3HGBA 3PSIA 3PO2B 1S40A 1KNEA 5E4WC 5BN3A 3PO2G 1D5XC 4JI4L 2EE1A 1D5ZC 1IKLA 3MEFA 1LTTD 4C2MB 2MPMA 2QEJC 5ELDA 1EIHA 4ZQ3A 4HIMA 1JQYD 1JOKA 2NZOA 3S1NH 4RGNA 4C3HB 4DGZA 3I70A 4OL7A 4C3HG 1SFOB 2HCCA 1QUQA 4LW1A 1QZHA 5I2YA 1PLFA 1Y1VB 4DAYB 3RN5A 1AE2A 1V1PA 4L8JA 3K0XA 4DV1L 4FP5D 1Y1VG 1K83B 4CHTB 1TIID 2WB1B 2WB1G 2RDGA 3OPOA 4RA8A 4JI1Q 4OO1I 5EKIA 5D3IB 2K5HA 2IT1A 2FINB 1WTPA 3K6OA 4WORA 1X3GA 1MIUA 2JSOA 3ERSX 2K7VA 4LFAQ 3P1HA 3BVGA 5JEAH 1LTGD 1YJNA 2DGYA 2YTYA 4DK6C 4EGVA 5C6AA 2LXJA 1HNWQ 1YNJC 2A6ED 1T5EA 5CV8A 5ELFA 4JI5L 3QR8A 1SSOA 2JP1A 2UUAL 1EWIA 1UEBA 1SROA 2ZM6Q 2E75C 4MZ9A 3SDZA 3QOLA 4RGTA 1K83H 2VB2X 1LABA 3TN2A 2WKDA 1D5MC 1NAPA 3NBHA 4DR7L 4YCVA 4A3FB 1XNQL 2LXKA 4K0KQ 1EYAA 1EZ6A 1W6JA 4A3FG 3HKSA 5KEEA 1STGA 1KDBA 2R7FA 4AQYL 1GJXA 5M3MG 4X65L 4BA2I 1EL0A 3OOCA 1FNUA 1VQCA 4HJ9A 2OT2A 3FP9A 4YWLA 4WJ3M 1QCBD 2X6GA 3K81C 1NMFA 1I94Q 3P75A 4DV5Q 3Q8DA 3SE0A 3GD7A 3TZDA 3ERQA 5DLQE 3Q6SA 4B3RQ 1XNRQ 1HNZQ 4RG1A 1RHPA 2N49A 3I3CA 1X3EA 2Z6KC 3DUZA 4A3BG 2HDLA 1C0AA 4RHRA 1DXMA 4I65A 2JA8H 1I6HB 4KK7A 1WTVA 2BH8A 5JJZA 5JJLA 2KHSA 3HRZC 1MSHA 1Q8IA 4DR5Q 4OEMB 1CI3M 4C3IB 3S1QH 1CT1D 5I6WA 5M3MH 3ER0A 4C3IG 1I3QH 3IFDA 1SAPA 2F0EA 1KQSA 5FJ8G 3L2PA 4LFAL 1YIJA 3A8KE 1BDOA 3TEHB 4L6TB 4LF8Q 1DJRD 2B8GA 3HZXA 4I7ZC 4A3CG 3U4ZA 2KHJA 1LT3D 3SK6A 4HSVA 2IJ0A 2WP8J 4XT3B 2UXDQ 2WFWA 4DR1Q 3GP7A 1KDAA 2ZM6L 2A73B 3DHQA 4A3BH 5CMDA 4CDEC 2VL6A 4RKBA 2JA5B 2CFMA 2JA5G 1OTCA 1LUZA 1KDCA 3GTJH 3WOFA 2E2HB 1I6HH 3CQZB 2F0LA 2TSSA 4K0KL 1WI5A 3OW2A 2R92H 4K5XA 1B3QA 5I4DA 3IKJA 2JA6B 2ICIA 5GAGC 3J81j 5LMNW 4DAMA 2JA6G 1HA6A 2OCEA 2Z6KA 5FJ8H 1TWFH 3RUZA 1JMCA 3VR4A 4ALPA 4GN3B 3HOXB 3C2PA 3A74A 3HOXG 3BZCA 1PRTD 4P74A 2KVMA 2SEBD 1TS2A 4F87A 1PA6A 5NUCA 4A3KB 2RBMA 1I94L 3STBD 2NVQB 4A3KG 3JAMc 1N34L 3IL8A 3KLRA 5DM63 4FXKC 4OHJA 3TQYA 4FF1A 1B7YB 1XNRL 1HNZL 1FR3A 4POGA 1HXYD 1C9OA 4JI3Q 1GUGA 4O42A 3VYTA 1VMCA 5IYDH 2JA5H 1G91A 5C44H 1KXLA 4GLAC 3PO3B 2EJMA 1SN8A 2E2HH 3PO3G 1H95A 1Y69U 4B3SQ 2F0KA 3PIO3 4DR5L 4J1MA 5M5XH 1IBKQ 2E2JB 2RHSB 3DWAA 1VQ9A 3NPPA 3J7AV 3FKIH 3C46A 1P8LA 3J81c 4C3JB 4DPGA 2L0CA 4C3JG 2IWHA 1UE1A 1PFMA 1KC8C 3M3YB 4LUOA 3OIQA 3A0JA 4KV6A 3CMAA 4LF8L 5KYLA 1GUNA 2BDNA 1SYBA 3ONAB 3I4NH 3MXNB 4BY7B 1LV9A 2H5XA 2PNRC 2PZUA 4BY7G 1SDFA 3SK5A 3HOWH 2VQEQ 3NEMA 1CHPD 2DY7A 1D1KA 2UXDL 3RR5A 4DR1L 2OWOA 3LX0A 3K7AB 5FKAC 2EYPA 2A1AA 4XQQA 4F88A 3FHWA 3TREA 3PUYA 2JXMB 3AQQA 4HIDA 1CFMA 1A62A 3QO2A 1V43A 3K5NA 4NW2A 4FF4A 4LAAA 1F9QA 1JR0D 1BCPD 1G51A 2F4VQ 3QOJA 1S5DD 2CKZB 1EY7A 3J7A5 4XYQA 1KTKA 3K8AA 4GNXA 3UDGA 1TS3A 3KJOA 1JJCB 4JBMA 1E2ZA 2BE5D 2Y0SB 3C1EA 3M3YH 1KLGD 3G71A 2Y0SG 1RTNA 3I4OA 1MSGA 4UP7A 3QWNA 4JBKA 1I4PA 4BY7H 4G4KA 4LUVA 1B8AA 1YNJD 4GLVB 4OIKA 3U9OA 5ELEA 1Z7TA 1B2TA 3MWYW 3CKIB 1CQVA 2MNAA 1LT5D 1JT8A 1FNVA 4JI3L 3EVQA 2GVAA 2Q2TA 3GTGH 4DV3L 4L5SA 4HSPA 4JBJA 2EY1A 2JYOA 3RZDB 1F77A 2K5DA 2AQ3B 1N8RC 3CC4A 1LT6D 1PTOH 1HZCA 4X3SA 3HOYH 1PTOF 2E5LL 2PPBC 4HN7A 4MTKA 1QOHA 1XMOQ 3D6CA 5LHY1 1EY5A 3MZ5A 1X3PA 2A69D 1HFGA 5EBDA 1IBKL 4IUUA 1TR5A 1X55A 4JVZA 1C48A 3RLFA 4MIUA 4BBSG 3KBGA 3BDCA 4ZUJA 2O2LD 4AYBE 4X62Q 2DN8A 3H91A 1Q81C 3GTQH 2AKWB 4OELB 1I50B 1GO3E 3NENA 1YZ6A 1BBXC 3Q24A 2K5NA 4GOPB 2FMMA 4ZKCB 1J9OA 5C3EH 3QIAA 4QIWB 4X66L 3HOVH 1TWCB 4BXXG 1EU4A 4GN5A 2D5DA 3CMEA 1ZXTA 4G57A 3S14H 1J8IA 3RLNA 1DM0B 5M9OA 3GTKB 4WJ4A 1L0WA 1SXTA 1VMPA 1TXYA 2PMZE 3NQTA 2R93B 1RIPA 3HOZH 4NP5A 4Q5VA 2P5ZX 2R93G 1PTOC 4R4IA 3I4MB 2QA4A 1K8OA 3S1MB 3I4MG 1OXTA 1LTLA 1QG7A 2C5CA 5C5LA 5IGBA 1HPCA 2BA1A 2TMPA 1YNNC 4BBSH 2F4VL 4TSSA 1CSQA 4HCSA 4MTNA 3OW7A 1M4VA 1YI2A 3G48A 2K03A 3GV6A 1S5BD 2IX1A 3RZOB 1RODA 4YWMA 3CW2C 1VQJA 3S2HB 1YHAA 1FVIA 5HGTA 2NVXB 1CUKA 1HUNA 2D9UA 2R7ZH 3SVMA 1CKOA 1TWCH 3ULJA 4FF2A 5CV4A 4HIKA 1HR0W 2AUKA 5T1GA 3K58A 1PH6A 1ILQA 1KHIA 4EQNA 2AMCB 2G5DA 3GTKH 2PYKA 2DJGC 3UDIA 1XMQQ 2J7ZA 2R93H 1I5FA 1XMOL 1RDPD 4X3TA 1G6PA 3AU7A 1WTXA 1AW7A 3G6EA 2ICEC 1RJTA 1EIGA 2F0OA 1B70B 3MA2B 5E1FA 1G2SA 4J15A 4K14A 4DK1A 4QMGA 4RFBA 4B9WA 1A15A 1ENCA 1QUQB 2QDLA 3K7UC 1SRUA 1M90C 3OWFA 1L1OB 4A3EH 1PRTB 1FD7D 4X62L 4LF6Q 3CD6A 1K3BC 4EQOA 3CU7A 1PH7A 1OXVA 3T4AC 3PIPA 4ZAIA 2Z6BA 4MN3A 4JV5Q 5I9PA 1EY6A 1Y1WH 1VQ8A 1IW7D 1B1ZA 4HMJA 1IYUA 4ID6A 5CBEE 1IZ6A 5IWAQ 5FO8B 2I5HA 4DR2Q 3CCMA 3PQIA 1H9SA 1PVOA 4MNOA 3I55A 4DXGA 3H0GB 1U4RA 1VF7A 5JVH3 3TS2A 3H0GG 2CW0C 1EY4A 1ZYRC 5J22A 5K5PA 1PHJA 2F0UA 4IPCA 4BBRB 2NUCA 5EBCA 3MAQA 4OO1H 2F0VA 2B29A 4BBRG 3SHLA 1VQKA 1EEFD 3TP7A 3VA7A 2QDBA 4OX9Q 4B3MQ 3FVQA 5ISRA 2KQ3A 3CCRA 2WINB 3TP6A 2JA7G 1GUWA 3ULLA 2DY8A 2A5HA 4RH6A 5IGGA 1BF4A 2JA9A 4RCNA 1PFNA 1CTMA 1PRTF 1ASZA 3R3OA 1F9SA 1EYCA 1OXUA 3QB3A 4DFAA 3TP5A 2XTIA 3BU2A 2PQEA 4CDDC 1A2UA 2PQAA 1KNAA 1K73C 4CGYB 1N36Q 3D0FA 4PZ7A 3G4SA 1STYA 2EY6A 4JI2Q 4A75A 2AWNA 3J7ZC 1ET9A 1EQRA 1XMQL 3B6YA 1VQOA 4IOCA 2BCOA 3D4DA 2EOTA 1Q82C 4KD4A 1BCPB 3OMCA 4O1NA 2EPBA 4RCOA 1S5ED 4K6DA 4P2CB 2JA7H 2ZJPA 1KAWA 5CV6A 3HOUH 2K6AA 3E9HA 2UUAQ 3S1RB 2SOBA 1PH2A 1RTOA 4NB3A 2D62A 1YHQA 4LF6L 2AHOB 4TKOB 4F8MA 4DR6L 1BR9A 4A4IA 5KGUA 4QY7A 4JV5L 4A3JH 1HZ9A 2EIFA 3OWEB 5IWAL 5KNBA 4DR2L 3H3VI 4H13C 4U68A 1ZEQX 2NVTB 2JEBI 4DU9A 1VQAA 1IHZA 2D2CC 2X69A 4DAVA 1IL8A 3CCVA 1TS5A 1FL0A 4LWCA 5E7NA 4IUQA 4PMCA 4QUFA 3D8GA 3WDNA 2F0DA 4YY3Q 3SK8A 4BWGB 3A54A 4DAPA 1SYFA 4R1JA 1EWHA 2SNMA 1BCPF 3I72A 3VR6A 1MI2A 4OX9L 4B3ML 3JAMi 5I9OA 2K5QA 5BR8Q 2PI2A 3K5LA 2ZXPA 3A8JE 5G3LD 5IP9G 1C4QA 3NE5B 2UU9Q 1A6XA 1TWHB 4H02A 5C5MA 1CM9A 2L1BA 5LMNQ 1B9NA 4GS3A 2Q8RE 1WYDA 4DV7L 4R4QA 3G7LA 4IZ8A 3CC2A 3MHBA 1EY9A 4Y52H 4K8IA 2EY5A 2NVTH 3E0EA 1N36L 1RF2D 1L2FA 4JI2L 4TQUS 3PO2H 2DJFC 4QL5A 3J81i 3K59A 3CPWA 3CPFA 1NE3A 1TWAB 4UDUC 4C2MH 1HRJA 1BXTA 1B3AA 1D6EC 1EIFA 5EAYA 3SR1A 2NN6G 4UY8C 1FGBD 2E2DC 3O13A 1TWGB 2I5LX 4C3HH 1M8AA 1YNND 3F1ZA 1MD2D 4YCUA 1SFOH 1RL2A 1IBLQ 4CBVA 1NY4A 4WJWA 1II3A 1Y1VH 3T1YL 1NJIC 2QILA 4KY7A 1FNWA 4A76A 5FLXc 1DOKA 2B2WC 3DLLA 1SE2A 1TWHH 2UUBQ 1MGSA 4ZUIA 4KJOA 4ZRZA 1B53A 2A74C 1E3PA 3PF5A 2F3WA 2PW5A 2XSCA 5C4ZA 4XYOA 1A3VA 2XNAC 3GTOB 2CWAA 1VDZA 2EYLA 3WWVA 1MHWC 3M4YA 3A5UA 3CXCA 5CV5A 1SYDA 5C4JB 4YY3L 4XQJA 1AP0A 2D0PA 3A56A 2UXBL 3PCOB 4IURA 1P16A 4KHPQ 3H94A 1N34Q 1SYEA 1E24A 4QUCA 1LLRD 4NXMQ 5IE8A 4HEDA 3S9WA 5BR8L 4R8IA 1VQ7A 2YU9B 4DNIA 5EGTA 1ML0D 2KUMA 2SDFA 1ZKOA 1Y14B 4XXEA 2DUDA 2QCPX 4A93B 5DM73 4ZCKA 5L37A 1EOTA 3RN2A 4A93G 4LF5Q 2UU9L 3AFPA 2K28A 5BN5A 4R8NA 1BOSA 3FPPA 4WFN3 4JG2A 4Y7NB 5LMNL 2OQ0A 4A3FH 1CZGA 1DGSA 2F3VA 4HAEA 3SK4A 1PFSA 3LNNA 4BA1I 2K33A 2KJXA 4PG3A 2EY2A 4GNXB 1HNXQ 3I91A 1CKNA 2B2WA 4FXDA 4L5QA 1PH3A 2LMCB 4OWWB 2CW0D 2EYJA 3EQLC 1HTPA 5C4JH 1IKMA 1AFPA 1JWUD 4YIJA 1QVGA 5K36G 1T9HA 2PZTA 4QJFA 3UI2A 4FVMA 3VDYA 2ASBA 4XDXA 2LFNA 1IBLL 4DN4M 1Q8KA 3GTPB 2VQFQ 3BS1A 2GN5A 1DCZA 3SXHA 4YHHQ 5CBAE 3KOJA 3MVVA 1QZGA 4HTHA 3T16A 4OONA 1WTWA 4AYBB 2UUBL 1VF5C 4AYBG 3ZJYC 2CQOA 2Z8LA 2FFKB 4DUZQ 3MFGA 1TVXA 4BS9A 4C3IH 4IFDJ 4DAYA 2N55A 2XGTA 3U58A 1H9KA 4M1UB 1ICFB 1ESFA 2V1CC 1JWMD 2XWJB 4IQZA 1IBMQ 2DNCA 2PMZB 4A3CH 4QCLA 3NELA 3TP8A 5K36H 4KHPL 1B9MA 5E3FA 1U5KA 3MEHA 2AWOA 3CRKC 1Q86C 3JAML 2V4DA 3R2IA 3SEBA 4NXML 1JOOA 2A68D 2F0HA 3W5OA 3GTLB 3HKZE 2M00A 2NTTA 3GTPH 4DV3Q 2JN4A 4LFBQ 3I90A 1STAA 5IYCG 4LF5L 2L15A 4RKLA 3T56B 2E5LQ 1GKHA 2L9HA 4UP8A 2B3GA 2ZTCA 2NN6I 3CQZH 4ABNA 1EYGA 2JA6H 4KD3A 2KENA 4EQ5A 1MKHA 2I5MX 1HNXL 2L12A 2E76C 4LF9L 3QJYA 3GO5A 3J81L 3U4VA 2K01A 3HOXH 3DEOA 3R2TA 5C4HA 2K5WA 2NWGA 2MGSA 1V1OA 4A3KH 2PO4A 4PZ8A 2NVQH 2QKIC 2RSOA 4X66Q 1HR0Q 2ZTDA 5C0XJ 3S16B 1XX8A 2JJQA 2YTXA 1HZBA 5ELBA 3GTLH 2VQFL 1S3OA 4YHHL 1X6OA 3J7YW 3RD4A 2PCFB 2JK8A 2EDGA 3BYTB 1JICA 2MFIA 3PO3H 2B8FA 4B08A 1E0BA 3EIVA 1JE5A 5EPLA 4OWTB 3MC0B 4PV1C 4DUZL 1SNPA 4J8QA 2FXQA 5CYUA 2E2JH 3S17B 3F8TA 3J7AF 4XIGS 3AB9A 1XPOA 2ATWA 2VUMB 4C3JH 3PUVA 2VUMG 2LSSA 1EU3A 2F1MA 1JJ2A 4HCEA 1OO9B 1IBML 1NTGA 3I4LA 1WVLA 4JI8Q 3ND9A 3DMUA 2B63B 3NUCA 2R7DA 1H9SB 2B63G 1Q12A 4IJLA 3K7AH 4JCVE 1FYCA 3NQIA 5G3LF 4V190 3VYUA 3BDOA 1AEXA 3C1FA 4LFBL 4FXGC 3BJUA 2OF1A 4XTCS 1NSNS 1QNUA 1Y8OB 4JBWA 2J0TD 4X3UA 2ES2A 3URYA 1VQBA 1GM5A 2IY5B 2A6HC 4LUZA 5EJWA 1O80A 1K28A 3KF6B 1TQOA 2LY7A 1G291 1VQ6A 4LNQA 3JAME 1SR3A 1STEA 1KLUD 1C7YA 1A3TA 1SNDA 5M3FB 4IJHA 1XJVA 2VUMH 4RWSC 4EQPA 3BZDB 4E6IA 2RDHA 5M3FG 1E2WA 5GAHC 1VQPA 5I6YA 1QJOA 4DKAC 3IRBA 3DWPA 4O0AA 1LACA 1VQEA 1A0IA 2GVBA 5JAVA 1TT2A 4KKUA 5FLMG 3TDQA 1HR0L 1Z47A 1E7ZA 1VQ5A 3EJIA 4IN3A 1Z6HA 2R6GA 3M85A 5DNFA 1I4RA 5J3BA 4GLXA 3W1BA 1X56A 1JB7A 3I8ZA 3L7ZC 3K5MA 4YCWA 4X6AH 3RZDH 2HIVA 1HZAA 3J81E 1M1KC 1SMXA 5LL6X 3J80c 2EXZA 3J80L 1STNA 2F0JA 1F9RA 1HH2P 1SE8A 5EPKA 1EEID 2F52A 1AH9A 2ZT9C 2ZXOA 5JEAJ 4UPAA 5IGEA 2E8GA 5KIXA 4X64L 3ITPA 4A3MB 3MTSA 1GHJA 2WACA 1WTOA 4A3MG 5EKLA 2HCIA 3UDFA 5IIFA 2O4XA 3KDFA 4KI0A 1I50H 3U9SA 3PUZA 4IFDG 3QG1A 5IT9c 1UNSA 3R8BA 4FYDA 1K0SA 5FLMH 5IT9L 2F4IA 4BXXH 2UXCL 2A6EC 4JI8L 5KNCA 2EZVA 3DWQA 1F9PA 4POFA 4JI0Q 1GD7A 4A3GB 2MP1A 2RHQB 1IXRA 4A3GG 1TS4A 1D2BA 1GXDC 2AUJD 1UWVA 3OHXC 4DXFA 2F0WA 5I2XA 5IGDA 3BDLA 3I4MH 1UAPA 3MXNA 3S1MH 2K75A 1DOLA 5AJ3Q 3H3VH 3VYRA 4IOAA 1N32L 1WFQA 1CHQD 2VB3X 1Y8PB 2IW3A 1I4QA 1QB5D 5IGFA 2K50A 2K52A 4JI7Q 3DM1A 2OEOA 3M4OB 4EVOA 3GQBA 1V1PB 1EFID 1E2VA 4CKBA 2B2TC 3DM3A 4DR6Q 4IFDH 3RLOA 3RZOH 3PUWA 3GV3A 1VQGA 2FJ2A 3AMUA 4IUTA 3K57A 3S2HH 4DV4Q 1QWYA 3ZYYX 4MHEA 4FO2A 4KHZA 4GOPC 4JPBW 4CJ1B 2NVXH 4NMZA 1FJGL 4DR4Q 5T1IA 4GKJQ 4A3GH 3W3AA 2OTLA 2ZJRA 3EROA 1JB3A 1PXUA 3L3OC 2G9DA 4CDCC 5A2QL 3CCSA 1V9PA 4A3LG 3LWEA 5C0XG 5E4XA 3A5ZB 4IPGA 1AN8A 2RA4A 4WRDA 1JJGA 1UE5A 2HIXA 1EWCA 1PZJD 2YYZA 5IYBG 3GTMB 3H3VC 2KCNA 3KFUA 4NPSA 4A3IB 2B2UC 2PNHA 1X9NA 2F0QA 4A3IG 5A35A 4JOIC 4HJ7A 2N3SA 1N9WA 2F0MA 3F2BA 2VXWA 1Q7YC 1SMYC 1N33Q 3NBHB 3CAMA 1K8GA 2QGQA 2Q8IB 4PMWA 2MO0A 4F7XA 4ZKBB 3P7JA 1SNOA 3J80E 5KYIA 4Z9CB 1O7ZA 4DV7Q 4JI0L 4KY5A 4S3SA 3HEJA 3BZKA 2R61A 1VQIA 1NNXA 2B2TA 2L55A 1UE6A 3H6MA 3L0OA 4DNRB 3H0GH 4B3TQ 2Q2HA 1HHVA 4A3LH 2OQKA 5KNDA 5FO9B 1F2MA 5M5WB 4BBRH 2Z1CA 1PH5A 5C4XB 2F0IA 2XRQD 5IT9E 1RKNA 1QVFA 1KRTA 5AJ3L 5C4XG 3OMGA 3CCQA 3KLSA 2KBNA 4JW0A 1U4LA 3CCJA 4IO9A 5AFWA 1O7LA 2E2IB 4JI7L 1EIYB 3T1YQ 3EN2A 2KECA 1PZID 2MJ8A 1PH1A 1L1OC 1TU2B 2F0PA 1PRTC 2R3ZA 1BKBA 4K5VA 4ODGA 2CHBD 2RVLA 4KJNA 4H44C 3L9AX 1O7IA 4DV4L 5J1ZA 1B4OA 1X3FA 2EYMA 2I07B 4NXNQ 4DR4L 1ENFA 2B2UA 4IUVA 4GKJL 5LMUL 4O2DA 4DUYQ 3I56A 3S24A 4JOIA 2CCZA 1EQVA 1R4PB 2RKSA 3E6ZX 1I4GA 2XRSD 2EYFA 4KN7C 4IFDI 2WKCA 1WCMB 2K4KA 5IY0A 5M5WH 4P75A 1BBWA 1WCMG 3ICEA 3CCEA 1PMRA 2YV5A 2UXBQ 1YNXA 3PGZA 1PYWD 2BOSA 1Q46A 1SJED 2FHTA 1J6QA 4N9PA 2B2VC 3S1RH 2E2IH 1HCZA 1DOMA 3UE0A 4KY6A 4LF7Q 3V05A 1NCVA 5M5YB 4LFCQ 5JEAG 5A2QE 1RCVD 2HQEA 1N33L 3K80C 1GUSA 1PV4A 5CORA 2WAQE 1UE7A 2HUGA 2WV6D 1GHKA 2HT1A 2PI2E 4G7HC 3I73A 3PIOA 3AEVA 5JJKA 1SEBD 3P20A 1WTRA 1CA5A 2Q2UA 2OTJA 1LTRD 3CCLA 4H7BA 4HJAA 3T53B 2KCCA 1QVCA 1L1OA 1L0XB 4B3TL 2BH2A 3PV0A 1G8ZD 3NHHA 1I4HA 2N78A 3M7NA 3HKZB 1WCMH 1LO5D 3NWTA 2JE6I 3HKZG 1ICWA 3H15A 1JORA 1PTOD 3TRZA 1Q1EA 3D4RA 3MXPA 2XWBB 4FNFA 4ILWA 1W6KA 3C3LA 1BCPC 3NTHA 2Z0SA 1H9MA 3KLSX 4KKSA 4JI6L 1EFWA 3SGIA 4EX5A 5IP9H 2BE5C 2K05A 4B9XA 3OTOL 1KIXA 1I6VC 3NBIA 5M5YH 5C0XI 1T5XD 4PZ6A 3D6WA 3NTIA 2ZTEA 5FLXL 2IX3A 2F0SA 2RCFA 1XWEA 3V2TA 2FMCA 4NXNL 5JOBA 2B2VA 5JVG3 4DUYL 4GZYC 3FMCA 1A2TA 2CWPA 4L63B 3PIP3 1I4XA 2B2YC 2JA8B 4UHVA 5D3DA 3AFQA 1TWAH 1XTCD 2JA8G 4V0BA 4C1NK 4PQXA 2NN6H 2A69C 3N52A 1LYLA 2KCTA 1GOZA 3S1QB 5M3MB 3KF8A 1TWGH 1I3QB 2O5IC 1S4ZA 2H4OA 3M9BA 5C3XA 4AIMA 3S2DB 2MUYA 3A7AB 3OIPA 1YEZA 2N88A 5ELOA 4R4OA 3D3RA 4LF7L 2XN9C 2ENBA 2HD3A 4LFCL 1CSPA 2O5JC 1JCKB 2K14A 1VQHA 2ZXRA 3T1HQ 1VQDA 4UP9A 2PZWA 3NK9A 3MFYA 2HDMA 1F2LA 2NVYB 2K1BA 3IAYA 1S72A 3E9IA 1LTID 1XXGA 3OYYA 1KD1C 3D4WA 1WD1A 4BY1B 4FF3A 3VR3A 4A3BB 3GTOH 5FO7B 4BY1G 1VQNA 4LF9Q 4K2KA 1IL2A 4P72A 1ZYRD 4IALA 4P71A 3CCUA 1KL9A 3GTJB 4G7OC 4LMQD 3TS0A 1MJCA 2F0NA 1TKWB 4JI1L 1SNCA 5GROA 1JWSD 2R92B 5CV9A 4DR3Q 2R92G 2E74C 4LF4Q 2YU9H 1TWFB 3S2DH 4GKKQ 1YITA 2B2YA 1K8AC 3G6JB 1CKMA 1PH8A 3LWUA 4A93H 1SNQA 3NTKA 1SMYD 1YJWA 2ID0A 1IYJB 1S5CD 4IUPA 4Q0FA 1BNZA 5JPNC 3J80i 1V1QA 5CC4A 2NVYH 1HNWL 3W1GA 4Y7NH 3Q22A 1UEAB 4N8FA 2DNEA 3TMEA 3I7FA 3TBIB 1U4MA 3FEWX 5CR3A 4BY1H 3TSSA 3CC7A 1D1IA 5C44B 5IYDG 5C44G 1FGUA 2AQ2B 3U50C 5FLXE 2JEAI 5EQ0A 1EY8A 2AQ1B 2EQSA 2IHEA 1XPUA 5M5XB 4R4TA 1SE4A 4XT1B 5KRUA 5HY6A 3FKIB 1TY2A 1X3QA 3FKIG 2C35B 2J4XA 4L5TA 5ELCA 4RGMA 2WB1E 1O7YA 3TZUA 1W2BA 1X54A 4M8AA 1KABA 1UUPA 2ZJQA 1E1OA 3T1HL 5D65A 1Q90A 4DV5L 5HGQA 3I4NB 1IW7C 1PH4A 1WOCA 1NUCA 2KCMA 3I4NG 3DEPA 3HOWB 1LTBD 1ENAA 2F0TA 1LTSD 1VQMA 3HOWG 4B3RL 1VCIA 1HQRD 1BUVT 1C8CA 1F2YA 1AZPA 1A63A 1MBYA 3M4PA 4GNXC 1QNKA 3KDFB 3HP3A 2K5VA 4JYAQ 1EQTA 4K6LA 5C3WA 1X32A 3Q23A 2ALYB 4CKCA 2LS01 3KJPA 1YBYA 4DR3L 4KHVA 1OXXK 2WIIB 4LF4L 4LK1C 1LTAD 3CF5A 4C1NI 3KUPA 4I7AA 4GKKL 1LT4D 5IYCH 1Z9FA 2YTVA 5LL6S 4P73A 2Z9HA 1HFNA 1NR2A 2SNSA 2Z4IA 4HJ8A 2RSNA 1H9JA 2HHHQ 4K5WA 4XQNA 5GQOA 4TVAB 4RMFA 1XTDA 4X3KA 1SYCA 2K32A 5JPMC 4X64Q 2NYZD 2RCNA 1K9MC 1SYGA 3GTGB 1STBA 5ELNA 1NR4A 5EKKA 1PTOB 3HOYB 3K5OA 2XIWA 3HS0C 3HOYG 2UUCQ 1PZKD 3E0JA 1MJEA 5IOCA 1Q3LA 2F3IA 2MHVA 5D14A 3ULPA 1BVSA 2C9OA 2UXCQ 4OIJA 2NBFA 1EZ8A 2BDOA 3S16H 3D31A 3F2UA 4OXPA 4ZK9B 3NSWA 2Q2IA 4AH6A 4C56C 2K04A 4CJ0B 2KHIA 1A3UA 3GTQB 3GDEA 2F0GA 1GUOA 4DK3C 5GAEC 1ET6A 2NB0A 1VQLA 4PMBA 3A55A 4DV2Q 2XVSA 4N9TA 2VY3A 1WJJA 5C3EB 4IUNA 3NWSA 1DZ1A 3H09A 3HOVB 5C3EG 1W3SA 2NTSA 3HOVG 3S14B 1N32Q 1HA5A 2M2LA 1PDQA 3K0YA 4L5RC 3S17H 4QQBX 3VR5A 1HJPA 4R4CA 4NDXA 4DV6Q 4DNTB 4DV0Q 4QF4A 3HOZB 1ONLA 1YVCA 4TRDA 4JYAL 1SE3A 3NXWA 3HOZG 2KEDA 1RD9D 1ILPA 3BG3A 3RMHA 1LM0A 2MO1A 4B3SL 4K2LA 2PQAB 1FJGQ 3RNUA 4BBSB 2B63H 1SLJA 4HMIA 3UDXA 3VR2A 4ZYSA 1AZQA 2L5TA 3ND8A 4ZLTF 4K8JA 4H0LC 2KEEA 3KBXA 1AE3A 1F2ZA 1KAAA 5BN4A 5EPJA 3OSOA
chains in the Genus database with same CATH topology
3DLLA 1B7YB 3BZKA 1VQIA 1TWHH 1HNZL 2UUBQ 1ASYA 4POGA 1XNRL 2HHHL 1C9OA 4GN4B 3L0OA 1UE6A 4JI3Q 3H0GH 4B3TQ 2Q2HA 4A3LH 2OQKA 5IYDH 2VQEL 2R7ZG 2JA5H 5C44H 1KXLA 1E3PA 4GLAC 4OWXB 3PF5A 4BBRH 1SN8A 2BA0A 2E2HH 3PO3G 1PH5A 1H95A 3HFZB 5M3FH 2CWAA 1E1TA 4B3SQ 3WWVA 1QVFA 1U0LA 1KRTA 4DR5L 5M5XH 5AJ3L 5C4XG 1EUJA 3A5UA 1IBKQ 2RHSB 3CXCA 3CCQA 2KBNA 4YY3L 1VQ9A 3CCJA 4IO9A 2UUCL 2D0PA 3FKIH 4YWKA 1P8LA 2UXBL 3PCOB 3J81c 4JI7L 4DPGA 1EIYB 1P16A 4KHPQ 3T1YQ 1N34Q 3EN2A 1UE1A 1E24A 1KC8C 1PH1A 1L1OC 4LUOA 1BKBA 3A0JA 4NXMQ 3CMAA 5IE8A 5BR8L 4LF8L 1VQ7A 4DNIA 1O7IA 4DV4L 1Y14B 3MXNB 3I4NH 2DUDA 2H5XA 1X3FA 4A3EG 4DR4L 4NXNQ 4BY7G 3HOWH 2VQEQ 3NEMA 3RN2A 4A93G 1X65A 4LF5Q 4GKJL 2UXDL 5LMUL 4DV2L 4O2DA 3RR5A 4HJ5A 3AFPA 4DR1L 4DUYQ 3I56A 3S24A 2UU9L 2OWOA 4JOIA 2CCZA 2D0OA 3KYHC 2A1AA 4JG2A 2VS1A 2OQ0A 5LMNL 4A3FH 1DGSA 3FHWA 1Y1WG 3TREA 3PUYA 1PFSA 4IFDI 4IPHA 2K4KA 5IY0A 5M5WH 4BA1I 2WAQG 4P75A 1BBWA 3AQQA 1WCMG 4HIDA 3ICEA 3CCEA 4PG3A 1HNXQ 4GNXB 2YV5A 2UXBQ 1CKNA 1YNXA 3PGZA 4A3MH 1A62A 4L5QA 1V43A 4DV6L 1PH3A 4DV0L 4OWWB 4QGUA 4ME3A 1Q46A 1EOVA 5JJIA 1OXSC 1G51A 2F4VQ 1J6QA 2CKZB 5C4JH 3J7A5 3S1RH 2E2IH 1NBWA 3K8AA 3UE0A 4GNXA 1QVGA 3UDGA 1J5EQ 3KJOA 4OO1G 1JJCB 2JQOA 4JBMA 4LF7Q 4IPDA 1T9HA 5K36G 4QJFA 4LFCQ 5JEAG 3M3YH 3VDYA 3G71A 2Y0SG 1N33L 5LMUQ 2ASBA 3K80C 1IBLL 3I4OA 1PV4A 1Q8KA 2WAQE 4UP7A 1UE7A 2VQFQ 4JBKA 2GN5A 4BY7H 2IX0A 4YHHQ 2HT1A 2PI2E 4LUVA 1B8AA 3KOJA 4GLVB 3PIOA 1QZGA 4OONA 3AEVA 5JJKA 2MNAA 2Q2UA 2UUBL 1JT8A 2OTJA 3CCLA 4AYBG 4JI3L 3ZJYC 4HJAA 2GVAA 1QVCA 1VS0A 1L1OA 2CQOA 4APVA 4DV3L 2Q2TA 4B3TL 4L5SA 1K3RA 3PV0A 4FDBA 4JBJA 4DUZQ 1EQQA 2N78A 2BH2A 3KLWA 1N8RC 3M7NA 3CC4A 4C3IH 3HOYH 1HZCA 2VW9A 1WCMH 2E5LL 4IFDJ 2JE6I 3HKZG 3H15A 4JC0A 1XMOQ 2Y0SE 3EBEA 3TRZA 1D8LA 1Q1EA 2XGTA 3U58A 3M4OH 2N8NA 2V1CC 1IBKL 1NMGA 4JI4Q 2Z0SA 1X55A 1IBMQ 3RLFA 4BBSG 1Q1BA 4A3CH 3NELA 1YJ9A 4JI6L 4A3DG 4AYBE 4KHPL 1EFWA 3SGIA 4EX5A 1U5KA 5IP9H 4X62Q 1K0RA 3OTOL 1Q81C 1KIXA 2AWOA 3CP0A 2QEXA 2AKWB 5M5YH 3KF6A 1Q86C 3GTQH 5C0XI 5H1SE 1GO3E 3NENA 1YZ6A 4PZ6A 1XPRA 4NXML 5IP7G 2K5NA 2ZTEA 3W5OA 5GADC 4GOPB 3HOUG 3HKZE 3GTPH 5C3EH 3F2DA 1GVPA 4X66L 4DV3Q 4DV1Q 1R9TH 1PYBA 3HOVH 4LFBQ 4BXXG 4NXNL 4GN5A 5IYCG 1A8VA 3CMEA 3PF4A 2IHFA 1VQFA 3LGJA 4LF5L 3S14H 2L15A 2E5LQ 3RLNA 2NZHA 4DUYL 4GOPA 1GKHA 2EXDA 4UP8A 2B3GA 2CWPA 4WJ4A 2VNUD 2ZTCA 2NN6I 3CQZH 1L0WA 5IYBH 1TXYA 4A3JG 2PMZE 2RF4A 1EYGA 1RIPA 3KF8B 2JA6H 3HOZH 2KENA 2VZAA 2R93G 1PYSB 3GTMH 3AFQA 1MKHA 4EQ5A 4R4IA 1TWAH 2I5MX 2QA4A 4A3IH 2JA8G 1HNXL 3GTGH 3I4MG 1OXTA 1LTLA 4JI6Q 3JC66 4LF9L 1PH9A 1LYLA 2KCTA 3GO5A 3U4VA 3OTOQ 2BA1A 3HOXH 3UE1A 1TWGH 4BBSH 2F4VL 4QIWE 1CSQA 4MTNA 3M9BA 4A3DH 3STBC 4AIMA 3F2CA 4A3KH 1YI2A 1YEZA 3G48A 1J5EL 4PZ8A 5ELOA 4R4OA 2NVQH 1VQ4A 4X66Q 4LF7L 1HR0Q 2IX1A 2ZTDA 4LFCL 5IP7H 4JI5Q 5C0XJ 4YWMA 3CW2C 1CSPA 2JJQA 2K14A 2YTXA 2A8VA 1VQJA 1HZBA 1VQHA 4HIOA 2A19A 3M4QA 3T1HQ 1VQDA 3GTLH 1YHAA 4UP9A 2I0QA 1FVIA 3AYHB 2VQFL 1CUKA 1CKNB 1S3OA 3I2ZA 4YHHL 1X6OA 2R7ZH 1CKOA 1KRSA 1BBUA 1TWCH 3ULJA 1S72A 1E22A 3E9IA 2JK8A 3OYYA 4HIKA 1HR0W 4KLKA 1KD1C 2HQLA 2MQHA 1PH6A 1KHIA 1YHBA 2MFIA 3PO3H 3GTKH 2AMCB 3PUXA 4DR7Q 3EIVA 1JE5A 1XNQQ 3UDIA 1D7QA 4OWTB 3GTOH 4BY1G 1VQNA 5C4XH 4DUZL 4LF9Q 1XMQQ 4WJ3M 1IL2A 2FXQA 2R93H 4P72A 2E2JH 4P71A 3CCUA 3F8TA 1KL9A 4AQYQ 1I5FA 4XIGS 1XMOL 3TS0A 4X65Q 1MJCA 4JI1L 1XPOA 1G6PA 2ATWA 5GROA 4C3JH 3PSIA 3PUVA 1S40A 3G6EA 2VUMG 1B70B 3PO2G 2LSSA 4J15A 4DR3Q 2R92G 4JI4L 1JJ2A 4LF4Q 3MEFA 1IBML 1NTGA 2YU9H 1QUQB 3K7UC 1SRUA 3S2DH 4HIMA 1M90C 4GKKQ 1L1OB 4A3EH 1YITA 1K8AC 4LF6Q 4X62L 3CD6A 1CKMA 2NZOA 1PH8A 3S1NH 4JI8Q 1PH7A 4A93H 1OXVA 3PIPA 2R7DA 1YJWA 2ID0A 2B63G 1IYJB 1Q12A 1QUQA 3K7AH 4IJLA 4JCVE 4LW1A 3RN5A 1QZHA 4DAYB 4JV5Q 3J80i 1AE2A 1V1QA 1Y1WH 1VQ8A 2NVYH 3K0XA 4DV1L 3W1GA 4Y7NH 1HNWL 1Y1VG 4LFBL 1IZ6A 3BJUA 5IWAQ 4XTCS 2I5HA 4DR2Q 3CCMA 3I7FA 4JBWA 1PVOA 4BY1H 4MNOA 2WB1G 3I55A 1VQBA 1GM5A 2ES2A 4JI1Q 4OO1I 2IY5B 4LUZA 3TS2A 2K5HA 3CC7A 3H0GG 2IT1A 3KF6B 1VQ6A 1G291 4LNQA 5IYDG 1SR3A 5C44G 1PHJA 4IPCA 1FGUA 3U50C 1C7YA 1X3GA 1MIUA 2JEAI 2B29A 4IJHA 3ERSX 4BBRG 4LFAQ 2EQSA 2IHEA 1XJVA 1VQKA 1XPUA 2VUMH 5M3FG 4R4TA 5GAHC 4OX9Q 4B3MQ 5HY6A 1VQPA 3CCRA 4DKAC 2JA7G 3IRBA 4O0AA 1YJNA 2DGYA 3ULLA 1VQEA 2YTYA 1A0IA 2C35B 3FKIG 2GVBA 2JA9A 4L5TA 4DK6C 2WB1E 2LXJA 5FLMG 1HNWQ 1HR0L 1Z47A 1W2BA 1X54A 1ASZA 1OXUA 4JI5L 1E7ZA 1VQ5A 2ZJQA 2UUAL 2R6GA 2XTIA 1E1OA 3BU2A 5J3BA 3M85A 3W1BA 1X56A 4GLXA 3T1HL 1JB7A 1EWIA 1UEBA 1SROA 4DV5L 5HGQA 2ZM6Q 3L7ZC 1PH4A 1WOCA 2KCMA 4MZ9A 4YCWA 3I4NG 2PQAA 4X6AH 3RZDH 1K83H 1HZAA 2HIVA 1M1KC 1SMXA 1K73C 1VQMA 3HOWG 4B3RL 1VCIA 3J80c 4DR7L 1N36Q 3D0FA 4YCVA 4PZ7A 3G4SA 1XNQL 4JI2Q 2LXKA 1A63A 4A75A 1HH2P 1SE8A 2AWNA 3M4PA 2F52A 3J7ZC 1EQRA 4GNXC 4A3FG 1XMQL 3HKSA 3B6YA 1AH9A 5JEAJ 3KDFB 4UPAA 2E8GA 2K5VA 1VQOA 4JYAQ 4IOCA 2R7FA 4AQYL 4X64L 5M3MG 2ALYB 4X65L 4BA2I 1Q82C 4A3MG 3KJPA 3UDFA 1VQCA 4HJ9A 3FP9A 4YWLA 1YBYA 3KDFA 4DR3L 2ZJPA 1KAWA 1OXXK 1I50H 4KI0A 3PUZA 4LF4L 2JA7H 3HOUH 3CF5A 4IFDG 3E9HA 2UUAQ 5IT9c 1PH2A 3K81C 1NMFA 1I94Q 5FLMH 4NB3A 2D62A 4DV5Q 4GKKL 3Q8DA 1YHQA 4BXXH 4LF6L 2AHOB 5IYCH 3GD7A 2UXCL 4DR6L 1Z9FA 4JI8L 2YTVA 4A4IA 4P73A 4POFA 4JI0Q 1GD7A 5DLQE 2RHQB 4QY7A 4HJ8A 4B3RQ 1IXRA 1XNRQ 1HNZQ 4RG1A 2N49A 4A3GG 2HHHQ 3S15H 4JV5L 5GQOA 4TVAB 4RMFA 1X3EA 1HZ9A 2EIFA 2Z6KC 4A3JH 1XTDA 1UWVA 4A3BG 5IWAL 1C0AA 4DR2L 3H3VI 2JA8H 4X64Q 2JEBI 1VQAA 3I4MH 2RCNA 1K9MC 3S1MH 2BH8A 2K75A 5ELNA 3CCVA 5JJLA 1FL0A 4DR5Q 4LWCA 5E7NA 5AJ3Q 3H3VH 1N32L 4IOAA 1WFQA 3S1QH 5M3MH 4YY3Q 3ER0A 3HOYG 1I3QH 2UUCQ 1MJEA 2K50A 2K52A 2F3IA 1KQSA 4JI7Q 4R1JA 5FJ8G 3L2PA 4LFAL 3ULPA 1YIJA 1BVSA 2UXCQ 3DM3A 4DR6Q 4OX9L 3RLOA 4B3ML 3JAMi 3TEHB 3RZOH 3PUWA 3S16H 5BR8Q 1VQGA 4LF8Q 2PI2A 3S2HH 4DV4Q 3D31A 4OXPA 4KHZA 4GOPC 4AH6A 2Q2IA 4A3CG 2NVXH 2KHIA 3U4ZA 3GDEA 1FJGL 4DR4Q 2KHJA 5IP9G 4DK3C 5GAEC 2WP8J 1VQLA 4A3GH 4DV2Q 2UU9Q 4GKJQ 2UXDQ 2WFWA 4H02A 4DR1Q 2OTLA 2VY3A 1WJJA 2ZJRA 2ZM6L 4A3BH 5LMNQ 5C3EG 4GS3A 1W3SA 3CCSA 1WYDA 2VL6A 4DV7L 3HOVG 4R4QA 1V9PA 2CFMA 4A3LG 3CC2A 5C0XG 1N32Q 4K0KQ 3A5ZB 4QQBX 4IPGA 2JA5G 4L5RC 1OTCA 3S17H 1LUZA 4Y52H 2NVTH 3E0EA 3GTJH 1N36L 1I6HH 1L2FA 1HJPA 4R4CA 1UE5A 4JI2L 2HIXA 4TQUS 4DV6Q 1JJGA 4K0KL 1WI5A 4DV0Q 3OW2A 3PO2H 4QL5A 2YYZA 3J81i 3CPWA 5IYBG 2R92H 1YVCA 5GAGC 3J81j 3CPFA 5LMNW 4JYAL 4DAMA 3HOZG 1NE3A 2JA6G 3KFUA 4NPSA 2OCEA 2Z6KA 2PNHA 4C2MH 5FJ8H 1TWFH 1X9NA 4A3IG 1EIFA 1JMCA 1LM0A 2MO1A 4B3SL 5EAYA 2NN6G 4JOIC 4HJ7A 2N3SA 1N9WA 4GN3B 4ALPA 2PQAB 4UY8C 1FJGQ 3RNUA 2I5LX 4C3HH 3A74A 3HOXG 3BZCA 1SLJA 3F2BA 3F1ZA 1Q7YC 2B63H 4P74A 4YCUA 1N33Q 3NBHB 3UDXA 1RL2A 3CAMA 2QGQA 1SFOH 1PA6A 1K8GA 1IBLQ 4PMWA 1NY4A 2MO0A 3STBD 1I94L 4A3KG 1AE3A 1Y1VH 3JAMc 3T1YL 1NJIC 1N34L 4A76A 3TQYA 5FLXc 4DV7Q 4JI0L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DLL A;  1B7Y B;  3BZK A;  1VQI A;  1TWH H;  1HNZ L;  2UUB Q;  1ASY A;  4POG A;  1XNR L;  2HHH L;  1C9O A;  4GN4 B;  3L0O A;  1UE6 A;  4JI3 Q;  3H0G H;  4B3T Q;  2Q2H A;  4A3L H;  2OQK A;  5IYD H;  2VQE L;  2R7Z G;  2JA5 H;  5C44 H;  1KXL A;  1E3P A;  4GLA C;  4OWX B;  3PF5 A;  4BBR H;  1SN8 A;  2BA0 A;  2E2H H;  3PO3 G;  1PH5 A;  1H95 A;  3HFZ B;  5M3F H;  2CWA A;  1E1T A;  4B3S Q;  3WWV A;  1QVF A;  1U0L A;  1KRT A;  4DR5 L;  5M5X H;  5AJ3 L;  5C4X G;  1EUJ A;  3A5U A;  1IBK Q;  2RHS B;  3CXC A;  3CCQ A;  2KBN A;  4YY3 L;  1VQ9 A;  3CCJ A;  4IO9 A;  2UUC L;  2D0P A;  3FKI H;  4YWK A;  1P8L A;  2UXB L;  3PCO B;  3J81 c;  4JI7 L;  4DPG A;  1EIY B;  1P16 A;  4KHP Q;  3T1Y Q;  1N34 Q;  3EN2 A;  1UE1 A;  1E24 A;  1KC8 C;  1PH1 A;  1L1O C;  4LUO A;  1BKB A;  3A0J A;  4NXM Q;  3CMA A;  5IE8 A;  5BR8 L;  4LF8 L;  1VQ7 A;  4DNI A;  1O7I A;  4DV4 L;  1Y14 B;  3MXN B;  3I4N H;  2DUD A;  2H5X A;  1X3F A;  4A3E G;  4DR4 L;  4NXN Q;  4BY7 G;  3HOW H;  2VQE Q;  3NEM A;  3RN2 A;  4A93 G;  1X65 A;  4LF5 Q;  4GKJ L;  2UXD L;  5LMU L;  4DV2 L;  4O2D A;  3RR5 A;  4HJ5 A;  3AFP A;  4DR1 L;  4DUY Q;  3I56 A;  3S24 A;  2UU9 L;  2OWO A;  4JOI A;  2CCZ A;  2D0O A;  3KYH C;  2A1A A;  4JG2 A;  2VS1 A;  2OQ0 A;  5LMN L;  4A3F H;  1DGS A;  3FHW A;  1Y1W G;  3TRE A;  3PUY A;  1PFS A;  4IFD I;  4IPH A;  2K4K A;  5IY0 A;  5M5W H;  4BA1 I;  2WAQ G;  4P75 A;  1BBW A;  3AQQ A;  1WCM G;  4HID A;  3ICE A;  3CCE A;  4PG3 A;  1HNX Q;  4GNX B;  2YV5 A;  2UXB Q;  1CKN A;  1YNX A;  3PGZ A;  4A3M H;  1A62 A;  4L5Q A;  1V43 A;  4DV6 L;  1PH3 A;  4DV0 L;  4OWW B;  4QGU A;  4ME3 A;  1Q46 A;  1EOV A;  5JJI A;  1OXS C;  1G51 A;  2F4V Q;  1J6Q A;  2CKZ B;  5C4J H;  3J7A 5;  3S1R H;  2E2I H;  1NBW A;  3K8A A;  3UE0 A;  4GNX A;  1QVG A;  3UDG A;  1J5E Q;  3KJO A;  4OO1 G;  1JJC B;  2JQO A;  4JBM A;  4LF7 Q;  4IPD A;  1T9H A;  5K36 G;  4QJF A;  4LFC Q;  5JEA G;  3M3Y H;  3VDY A;  3G71 A;  2Y0S G;  1N33 L;  5LMU Q;  2ASB A;  3K80 C;  1IBL L;  3I4O A;  1PV4 A;  1Q8K A;  2WAQ E;  4UP7 A;  1UE7 A;  2VQF Q;  4JBK A;  2GN5 A;  4BY7 H;  2IX0 A;  4YHH Q;  2HT1 A;  2PI2 E;  4LUV A;  1B8A A;  3KOJ A;  4GLV B;  3PIO A;  1QZG A;  4OON A;  3AEV A;  5JJK A;  2MNA A;  2Q2U A;  2UUB L;  1JT8 A;  2OTJ A;  3CCL A;  4AYB G;  4JI3 L;  3ZJY C;  4HJA A;  2GVA A;  1QVC A;  1VS0 A;  1L1O A;  2CQO A;  4APV A;  4DV3 L;  2Q2T A;  4B3T L;  4L5S A;  1K3R A;  3PV0 A;  4FDB A;  4JBJ A;  4DUZ Q;  1EQQ A;  2N78 A;  2BH2 A;  3KLW A;  1N8R C;  3M7N A;  3CC4 A;  4C3I H;  3HOY H;  1HZC A;  2VW9 A;  1WCM H;  2E5L L;  4IFD J;  2JE6 I;  3HKZ G;  3H15 A;  4JC0 A;  1XMO Q;  2Y0S E;  3EBE A;  3TRZ A;  1D8L A;  1Q1E A;  2XGT A;  3U58 A;  3M4O H;  2N8N A;  2V1C C;  1IBK L;  1NMG A;  4JI4 Q;  2Z0S A;  1X55 A;  1IBM Q;  3RLF A;  4BBS G;  1Q1B A;  4A3C H;  3NEL A;  1YJ9 A;  4JI6 L;  4A3D G;  4AYB E;  4KHP L;  1EFW A;  3SGI A;  4EX5 A;  1U5K A;  5IP9 H;  4X62 Q;  1K0R A;  3OTO L;  1Q81 C;  1KIX A;  2AWO A;  3CP0 A;  2QEX A;  2AKW B;  5M5Y H;  3KF6 A;  1Q86 C;  3GTQ H;  5C0X I;  5H1S E;  1GO3 E;  3NEN A;  1YZ6 A;  4PZ6 A;  1XPR A;  4NXM L;  5IP7 G;  2K5N A;  2ZTE A;  3W5O A;  5GAD C;  4GOP B;  3HOU G;  3HKZ E;  3GTP H;  5C3E H;  3F2D A;  1GVP A;  4X66 L;  4DV3 Q;  4DV1 Q;  1R9T H;  1PYB A;  3HOV H;  4LFB Q;  4BXX G;  4NXN L;  4GN5 A;  5IYC G;  1A8V A;  3CME A;  3PF4 A;  2IHF A;  1VQF A;  3LGJ A;  4LF5 L;  3S14 H;  2L15 A;  2E5L Q;  3RLN A;  2NZH A;  4DUY L;  4GOP A;  1GKH A;  2EXD A;  4UP8 A;  2B3G A;  2CWP A;  4WJ4 A;  2VNU D;  2ZTC A;  2NN6 I;  3CQZ H;  1L0W A;  5IYB H;  1TXY A;  4A3J G;  2PMZ E;  2RF4 A;  1EYG A;  1RIP A;  3KF8 B;  2JA6 H;  3HOZ H;  2KEN A;  2VZA A;  2R93 G;  1PYS B;  3GTM H;  3AFQ A;  1MKH A;  4EQ5 A;  4R4I A;  1TWA H;  2I5M X;  2QA4 A;  4A3I H;  2JA8 G;  1HNX L;  3GTG H;  3I4M G;  1OXT A;  1LTL A;  4JI6 Q;  3JC6 6;  4LF9 L;  1PH9 A;  1LYL A;  2KCT A;  3GO5 A;  3U4V A;  3OTO Q;  2BA1 A;  3HOX H;  3UE1 A;  1TWG H;  4BBS H;  2F4V L;  4QIW E;  1CSQ A;  4MTN A;  3M9B A;  4A3D H;  3STB C;  4AIM A;  3F2C A;  4A3K H;  1YI2 A;  1YEZ A;  3G48 A;  1J5E L;  4PZ8 A;  5ELO A;  4R4O A;  2NVQ H;  1VQ4 A;  4X66 Q;  4LF7 L;  1HR0 Q;  2IX1 A;  2ZTD A;  4LFC L;  5IP7 H;  4JI5 Q;  5C0X J;  4YWM A;  3CW2 C;  1CSP A;  2JJQ A;  2K14 A;  2YTX A;  2A8V A;  1VQJ A;  1HZB A;  1VQH A;  4HIO A;  2A19 A;  3M4Q A;  3T1H Q;  1VQD A;  3GTL H;  1YHA A;  4UP9 A;  2I0Q A;  1FVI A;  3AYH B;  2VQF L;  1CUK A;  1CKN B;  1S3O A;  3I2Z A;  4YHH L;  1X6O A;  2R7Z H;  1CKO A;  1KRS A;  1BBU A;  1TWC H;  3ULJ A;  1S72 A;  1E22 A;  3E9I A;  2JK8 A;  3OYY A;  4HIK A;  1HR0 W;  4KLK A;  1KD1 C;  2HQL A;  2MQH A;  1PH6 A;  1KHI A;  1YHB A;  2MFI A;  3PO3 H;  3GTK H;  2AMC B;  3PUX A;  4DR7 Q;  3EIV A;  1JE5 A;  1XNQ Q;  3UDI A;  1D7Q A;  4OWT B;  3GTO H;  4BY1 G;  1VQN A;  5C4X H;  4DUZ L;  4LF9 Q;  1XMQ Q;  4WJ3 M;  1IL2 A;  2FXQ A;  2R93 H;  4P72 A;  2E2J H;  4P71 A;  3CCU A;  3F8T A;  1KL9 A;  4AQY Q;  1I5F A;  4XIG S;  1XMO L;  3TS0 A;  4X65 Q;  1MJC A;  4JI1 L;  1XPO A;  1G6P A;  2ATW A;  5GRO A;  4C3J H;  3PSI A;  3PUV A;  1S40 A;  3G6E A;  2VUM G;  1B70 B;  3PO2 G;  2LSS A;  4J15 A;  4DR3 Q;  2R92 G;  4JI4 L;  1JJ2 A;  4LF4 Q;  3MEF A;  1IBM L;  1NTG A;  2YU9 H;  1QUQ B;  3K7U C;  1SRU A;  3S2D H;  4HIM A;  1M90 C;  4GKK Q;  1L1O B;  4A3E H;  1YIT A;  1K8A C;  4LF6 Q;  4X62 L;  3CD6 A;  1CKM A;  2NZO A;  1PH8 A;  3S1N H;  4JI8 Q;  1PH7 A;  4A93 H;  1OXV A;  3PIP A;  2R7D A;  1YJW A;  2ID0 A;  2B63 G;  1IYJ B;  1Q12 A;  1QUQ A;  3K7A H;  4IJL A;  4JCV E;  4LW1 A;  3RN5 A;  1QZH A;  4DAY B;  4JV5 Q;  3J80 i;  1AE2 A;  1V1Q A;  1Y1W H;  1VQ8 A;  2NVY H;  3K0X A;  4DV1 L;  3W1G A;  4Y7N H;  1HNW L;  1Y1V G;  4LFB L;  1IZ6 A;  3BJU A;  5IWA Q;  4XTC S;  2I5H A;  4DR2 Q;  3CCM A;  3I7F A;  4JBW A;  1PVO A;  4BY1 H;  4MNO A;  2WB1 G;  3I55 A;  1VQB A;  1GM5 A;  2ES2 A;  4JI1 Q;  4OO1 I;  2IY5 B;  4LUZ A;  3TS2 A;  2K5H A;  3CC7 A;  3H0G G;  2IT1 A;  3KF6 B;  1VQ6 A;  1G29 1;  4LNQ A;  5IYD G;  1SR3 A;  5C44 G;  1PHJ A;  4IPC A;  1FGU A;  3U50 C;  1C7Y A;  1X3G A;  1MIU A;  2JEA I;  2B29 A;  4IJH A;  3ERS X;  4BBR G;  4LFA Q;  2EQS A;  2IHE A;  1XJV A;  1VQK A;  1XPU A;  2VUM H;  5M3F G;  4R4T A;  5GAH C;  4OX9 Q;  4B3M Q;  5HY6 A;  1VQP A;  3CCR A;  4DKA C;  2JA7 G;  3IRB A;  4O0A A;  1YJN A;  2DGY A;  3ULL A;  1VQE A;  2YTY A;  1A0I A;  2C35 B;  3FKI G;  2GVB A;  2JA9 A;  4L5T A;  4DK6 C;  2WB1 E;  2LXJ A;  5FLM G;  1HNW Q;  1HR0 L;  1Z47 A;  1W2B A;  1X54 A;  1ASZ A;  1OXU A;  4JI5 L;  1E7Z A;  1VQ5 A;  2ZJQ A;  2UUA L;  2R6G A;  2XTI A;  1E1O A;  3BU2 A;  5J3B A;  3M85 A;  3W1B A;  1X56 A;  4GLX A;  3T1H L;  1JB7 A;  1EWI A;  1UEB A;  1SRO A;  4DV5 L;  5HGQ A;  2ZM6 Q;  3L7Z C;  1PH4 A;  1WOC A;  2KCM A;  4MZ9 A;  4YCW A;  3I4N G;  2PQA A;  4X6A H;  3RZD H;  1K83 H;  1HZA A;  2HIV A;  1M1K C;  1SMX A;  1K73 C;  1VQM A;  3HOW G;  4B3R L;  1VCI A;  3J80 c;  4DR7 L;  1N36 Q;  3D0F A;  4YCV A;  4PZ7 A;  3G4S A;  1XNQ L;  4JI2 Q;  2LXK A;  1A63 A;  4A75 A;  1HH2 P;  1SE8 A;  2AWN A;  3M4P A;  2F52 A;  3J7Z C;  1EQR A;  4GNX C;  4A3F G;  1XMQ L;  3HKS A;  3B6Y A;  1AH9 A;  5JEA J;  3KDF B;  4UPA A;  2E8G A;  2K5V A;  1VQO A;  4JYA Q;  4IOC A;  2R7F A;  4AQY L;  4X64 L;  5M3M G;  2ALY B;  4X65 L;  4BA2 I;  1Q82 C;  4A3M G;  3KJP A;  3UDF A;  1VQC A;  4HJ9 A;  3FP9 A;  4YWL A;  1YBY A;  3KDF A;  4DR3 L;  2ZJP A;  1KAW A;  1OXX K;  1I50 H;  4KI0 A;  3PUZ A;  4LF4 L;  2JA7 H;  3HOU H;  3CF5 A;  4IFD G;  3E9H A;  2UUA Q;  5IT9 c;  1PH2 A;  3K81 C;  1NMF A;  1I94 Q;  5FLM H;  4NB3 A;  2D62 A;  4DV5 Q;  4GKK L;  3Q8D A;  1YHQ A;  4BXX H;  4LF6 L;  2AHO B;  5IYC H;  3GD7 A;  2UXC L;  4DR6 L;  1Z9F A;  4JI8 L;  2YTV A;  4A4I A;  4P73 A;  4POF A;  4JI0 Q;  1GD7 A;  5DLQ E;  2RHQ B;  4QY7 A;  4HJ8 A;  4B3R Q;  1IXR A;  1XNR Q;  1HNZ Q;  4RG1 A;  2N49 A;  4A3G G;  2HHH Q;  3S15 H;  4JV5 L;  5GQO A;  4TVA B;  4RMF A;  1X3E A;  1HZ9 A;  2EIF A;  2Z6K C;  4A3J H;  1XTD A;  1UWV A;  4A3B G;  5IWA L;  1C0A A;  4DR2 L;  3H3V I;  2JA8 H;  4X64 Q;  2JEB I;  1VQA A;  3I4M H;  2RCN A;  1K9M C;  3S1M H;  2BH8 A;  2K75 A;  5ELN A;  3CCV A;  5JJL A;  1FL0 A;  4DR5 Q;  4LWC A;  5E7N A;  5AJ3 Q;  3H3V H;  1N32 L;  4IOA A;  1WFQ A;  3S1Q H;  5M3M H;  4YY3 Q;  3ER0 A;  3HOY G;  1I3Q H;  2UUC Q;  1MJE A;  2K50 A;  2K52 A;  2F3I A;  1KQS A;  4JI7 Q;  4R1J A;  5FJ8 G;  3L2P A;  4LFA L;  3ULP A;  1YIJ A;  1BVS A;  2UXC Q;  3DM3 A;  4DR6 Q;  4OX9 L;  3RLO A;  4B3M L;  3JAM i;  3TEH B;  3RZO H;  3PUW A;  3S16 H;  5BR8 Q;  1VQG A;  4LF8 Q;  2PI2 A;  3S2H H;  4DV4 Q;  3D31 A;  4OXP A;  4KHZ A;  4GOP C;  4AH6 A;  2Q2I A;  4A3C G;  2NVX H;  2KHI A;  3U4Z A;  3GDE A;  1FJG L;  4DR4 Q;  2KHJ A;  5IP9 G;  4DK3 C;  5GAE C;  2WP8 J;  1VQL A;  4A3G H;  4DV2 Q;  2UU9 Q;  4GKJ Q;  2UXD Q;  2WFW A;  4H02 A;  4DR1 Q;  2OTL A;  2VY3 A;  1WJJ A;  2ZJR A;  2ZM6 L;  4A3B H;  5LMN Q;  5C3E G;  4GS3 A;  1W3S A;  3CCS A;  1WYD A;  2VL6 A;  4DV7 L;  3HOV G;  4R4Q A;  1V9P A;  2CFM A;  4A3L G;  3CC2 A;  5C0X G;  1N32 Q;  4K0K Q;  3A5Z B;  4QQB X;  4IPG A;  2JA5 G;  4L5R C;  1OTC A;  3S17 H;  1LUZ A;  4Y52 H;  2NVT H;  3E0E A;  3GTJ H;  1N36 L;  1I6H H;  1L2F A;  1HJP A;  4R4C A;  1UE5 A;  4JI2 L;  2HIX A;  4TQU S;  4DV6 Q;  1JJG A;  4K0K L;  1WI5 A;  4DV0 Q;  3OW2 A;  3PO2 H;  4QL5 A;  2YYZ A;  3J81 i;  3CPW A;  5IYB G;  2R92 H;  1YVC A;  5GAG C;  3J81 j;  3CPF A;  5LMN W;  4JYA L;  4DAM A;  3HOZ G;  1NE3 A;  2JA6 G;  3KFU A;  4NPS A;  2OCE A;  2Z6K A;  2PNH A;  4C2M H;  5FJ8 H;  1TWF H;  1X9N A;  4A3I G;  1EIF A;  1JMC A;  1LM0 A;  2MO1 A;  4B3S L;  5EAY A;  2NN6 G;  4JOI C;  4HJ7 A;  2N3S A;  1N9W A;  4GN3 B;  4ALP A;  2PQA B;  4UY8 C;  1FJG Q;  3RNU A;  2I5L X;  4C3H H;  3A74 A;  3HOX G;  3BZC A;  1SLJ A;  3F2B A;  3F1Z A;  1Q7Y C;  2B63 H;  4P74 A;  4YCU A;  1N33 Q;  3NBH B;  3UDX A;  1RL2 A;  3CAM A;  2QGQ A;  1SFO H;  1PA6 A;  1K8G A;  1IBL Q;  4PMW A;  1NY4 A;  2MO0 A;  3STB D;  1I94 L;  4A3K G;  1AE3 A;  1Y1V H;  3JAM c;  3T1Y L;  1NJI C;  1N34 L;  4A76 A;  3TQY A;  5FLX c;  4DV7 Q;  4JI0 L; 
#chains in the Genus database with same CATH topology
 3PMF A;  4ME5 A;  1ASY A;  1K8M A;  3EA6 A;  2HHH L;  3X3M A;  4GN4 B;  1EYD A;  4ULL A;  4LJZ C;  2I46 A;  2R7Z B;  3W2D A;  2VQE L;  3N6R A;  2F03 A;  2R7Z G;  2GA4 B;  5F2D A;  4OWX B;  3FRP B;  2KA7 A;  3E3X A;  4KN4 C;  2BA0 A;  2PW7 A;  3Q0A A;  3HFZ B;  5M3F H;  1E1T A;  1WTQ A;  1U0L A;  1CQF A;  1SNM A;  1DON A;  1EUJ A;  1DD2 A;  1R4Q B;  2UUC L;  4YWK A;  1L0Y B;  3WOE A;  1QIL A;  2L11 A;  2CH4 W;  5IGC A;  1STH A;  4R9W A;  2EJG C;  4A3E B;  2Z4H A;  3BVM A;  4JK1 C;  4OGQ C;  1JC7 A;  4A3E G;  2IPK D;  1X65 A;  1CA6 A;  4DV2 L;  1SJH D;  4HJ5 A;  3BVZ A;  1Y1W B;  2D0O A;  4QB4 A;  3KYH C;  2VS1 A;  1TY0 A;  1Y1W G;  1BQQ T;  2CQA A;  4PNY A;  2WAQ B;  4IPH A;  2EYO A;  2WAQ G;  3CHB D;  1QE6 A;  4RAU C;  5FK9 C;  5DAU A;  5HUR A;  4A3M H;  4DV6 L;  4DK0 A;  4DV0 L;  4N8X 1;  4UAI A;  5CGK A;  4QGU A;  4ME3 A;  1EOV A;  5JJI A;  1OXS C;  4CKE A;  4J6H A;  2Q8T A;  1NBW A;  1J5E Q;  4OO1 G;  3S15 B;  2JQO A;  3FPU B;  5TSS A;  4IPD A;  4RHS A;  1ESR A;  4KMU C;  3A8I E;  5LMU Q;  1EY0 A;  2CH4 A;  2H1E A;  1H9R A;  2CVR A;  3VYS A;  1R9T B;  2IX0 A;  3EFX D;  3E5S A;  1SBB B;  3M7G A;  1GUT A;  1VS0 A;  4APV A;  1K3R A;  4FDB A;  1EQQ A;  4RGO S;  2EVB A;  3KLW A;  2G9H D;  1BO0 A;  1B50 A;  3HG9 A;  2VW9 A;  4CDF C;  4JC0 A;  2Y0S E;  2IL8 A;  3EBE A;  3V96 A;  1D8L A;  1Y8N B;  3M4O H;  2N8N A;  3MXU A;  2X6L A;  4DF7 A;  1NMG A;  4DA2 A;  4JI4 Q;  4NKL A;  5CV7 A;  4A3D B;  2QF7 A;  1Q1B A;  3VA5 A;  1IYV A;  1YJ9 A;  4HR7 B;  4A3D G;  3R93 A;  3MXG A;  3S15 H;  1CZW A;  1K0R A;  1U4P A;  3CP0 A;  2QEX A;  3A7L A;  3KF6 A;  2JA7 B;  5H1S E;  3HOU B;  1XPR A;  5IP7 G;  3X3N A;  5GAD C;  3CRL C;  2B39 A;  3FDT A;  3HOU G;  2OXP A;  5FOB B;  1PFB A;  1GVP A;  3F2D A;  4DV1 Q;  1R9T H;  1PYB A;  1XYI A;  5COY A;  5C0X H;  1G6Z A;  1A8V A;  2M9V A;  3PF4 A;  2IHF A;  3T51 B;  1VQF A;  3LGJ A;  4KTA A;  1JE4 A;  2NZH A;  4GOP A;  2EYH A;  2EXD A;  4A3J B;  2VNU D;  5IYB H;  4A3J G;  2RF4 A;  3BYY B;  3KF8 B;  2NZ1 D;  4KKT A;  2VZA A;  1PYS B;  3GTM H;  1JOQ A;  5IOD A;  4A3I H;  4JI6 Q;  3JC6 6;  2KOL A;  1PH9 A;  3OTO Q;  1CK1 A;  3UE1 A;  1O78 A;  2RDF A;  4QIW E;  4A3D H;  3STB C;  3F2C A;  1J5E L;  1HQM C;  1VQ4 A;  2QW7 A;  3S1N B;  5IP7 H;  4JI5 Q;  2EJF C;  2A68 C;  3DXJ C;  2A8V A;  2L4N A;  4HIO A;  1WD0 A;  1WTH A;  2A19 A;  3M4Q A;  2I0Q A;  1HTL D;  3AYH B;  1CKN B;  3NP8 A;  4U67 3;  3I2Z A;  1KRS A;  1BBU A;  1E22 A;  4KLK A;  2F0F A;  2HQL A;  2MQH A;  1YHB A;  4DR7 Q;  3PUX A;  1XNQ Q;  1U9R A;  1D7Q A;  4G7Z C;  2LKV A;  5C4X H;  4CJ2 C;  2A6H D;  2RQX A;  1DYQ A;  1B44 D;  1S5F D;  4AQY Q;  1G2T A;  1HUM A;  3IFT A;  3KK7 A;  4X65 Q;  5DEH A;  3T13 A;  5J39 A;  1V8Q A;  3HGB A;  3PSI A;  3PO2 B;  1S40 A;  1KNE A;  5E4W C;  5BN3 A;  3PO2 G;  1D5X C;  4JI4 L;  2EE1 A;  1D5Z C;  1IKL A;  3MEF A;  1LTT D;  4C2M B;  2MPM A;  2QEJ C;  5ELD A;  1EIH A;  4ZQ3 A;  4HIM A;  1JQY D;  1JOK A;  2NZO A;  3S1N H;  4RGN A;  4C3H B;  4DGZ A;  3I70 A;  4OL7 A;  4C3H G;  1SFO B;  2HCC A;  1QUQ A;  4LW1 A;  1QZH A;  5I2Y A;  1PLF A;  1Y1V B;  4DAY B;  3RN5 A;  1AE2 A;  1V1P A;  4L8J A;  3K0X A;  4DV1 L;  4FP5 D;  1Y1V G;  1K83 B;  4CHT B;  1TII D;  2WB1 B;  2WB1 G;  2RDG A;  3OPO A;  4RA8 A;  4JI1 Q;  4OO1 I;  5EKI A;  5D3I B;  2K5H A;  2IT1 A;  2FIN B;  1WTP A;  3K6O A;  4WOR A;  1X3G A;  1MIU A;  2JSO A;  3ERS X;  2K7V A;  4LFA Q;  3P1H A;  3BVG A;  5JEA H;  1LTG D;  1YJN A;  2DGY A;  2YTY A;  4DK6 C;  4EGV A;  5C6A A;  2LXJ A;  1HNW Q;  1YNJ C;  2A6E D;  1T5E A;  5CV8 A;  5ELF A;  4JI5 L;  3QR8 A;  1SSO A;  2JP1 A;  2UUA L;  1EWI A;  1UEB A;  1SRO A;  2ZM6 Q;  2E75 C;  4MZ9 A;  3SDZ A;  3QOL A;  4RGT A;  1K83 H;  2VB2 X;  1LAB A;  3TN2 A;  2WKD A;  1D5M C;  1NAP A;  3NBH A;  4DR7 L;  4YCV A;  4A3F B;  1XNQ L;  2LXK A;  4K0K Q;  1EYA A;  1EZ6 A;  1W6J A;  4A3F G;  3HKS A;  5KEE A;  1STG A;  1KDB A;  2R7F A;  4AQY L;  1GJX A;  5M3M G;  4X65 L;  4BA2 I;  1EL0 A;  3OOC A;  1FNU A;  1VQC A;  4HJ9 A;  2OT2 A;  3FP9 A;  4YWL A;  4WJ3 M;  1QCB D;  2X6G A;  3K81 C;  1NMF A;  1I94 Q;  3P75 A;  4DV5 Q;  3Q8D A;  3SE0 A;  3GD7 A;  3TZD A;  3ERQ A;  5DLQ E;  3Q6S A;  4B3R Q;  1XNR Q;  1HNZ Q;  4RG1 A;  1RHP A;  2N49 A;  3I3C A;  1X3E A;  2Z6K C;  3DUZ A;  4A3B G;  2HDL A;  1C0A A;  4RHR A;  1DXM A;  4I65 A;  2JA8 H;  1I6H B;  4KK7 A;  1WTV A;  2BH8 A;  5JJZ A;  5JJL A;  2KHS A;  3HRZ C;  1MSH A;  1Q8I A;  4DR5 Q;  4OEM B;  1CI3 M;  4C3I B;  3S1Q H;  1CT1 D;  5I6W A;  5M3M H;  3ER0 A;  4C3I G;  1I3Q H;  3IFD A;  1SAP A;  2F0E A;  1KQS A;  5FJ8 G;  3L2P A;  4LFA L;  1YIJ A;  3A8K E;  1BDO A;  3TEH B;  4L6T B;  4LF8 Q;  1DJR D;  2B8G A;  3HZX A;  4I7Z C;  4A3C G;  3U4Z A;  2KHJ A;  1LT3 D;  3SK6 A;  4HSV A;  2IJ0 A;  2WP8 J;  4XT3 B;  2UXD Q;  2WFW A;  4DR1 Q;  3GP7 A;  1KDA A;  2ZM6 L;  2A73 B;  3DHQ A;  4A3B H;  5CMD A;  4CDE C;  2VL6 A;  4RKB A;  2JA5 B;  2CFM A;  2JA5 G;  1OTC A;  1LUZ A;  1KDC A;  3GTJ H;  3WOF A;  2E2H B;  1I6H H;  3CQZ B;  2F0L A;  2TSS A;  4K0K L;  1WI5 A;  3OW2 A;  2R92 H;  4K5X A;  1B3Q A;  5I4D A;  3IKJ A;  2JA6 B;  2ICI A;  5GAG C;  3J81 j;  5LMN W;  4DAM A;  2JA6 G;  1HA6 A;  2OCE A;  2Z6K A;  5FJ8 H;  1TWF H;  3RUZ A;  1JMC A;  3VR4 A;  4ALP A;  4GN3 B;  3HOX B;  3C2P A;  3A74 A;  3HOX G;  3BZC A;  1PRT D;  4P74 A;  2KVM A;  2SEB D;  1TS2 A;  4F87 A;  1PA6 A;  5NUC A;  4A3K B;  2RBM A;  1I94 L;  3STB D;  2NVQ B;  4A3K G;  3JAM c;  1N34 L;  3IL8 A;  3KLR A;  5DM6 3;  4FXK C;  4OHJ A;  3TQY A;  4FF1 A;  1B7Y B;  1XNR L;  1HNZ L;  1FR3 A;  4POG A;  1HXY D;  1C9O A;  4JI3 Q;  1GUG A;  4O42 A;  3VYT A;  1VMC A;  5IYD H;  2JA5 H;  1G91 A;  5C44 H;  1KXL A;  4GLA C;  3PO3 B;  2EJM A;  1SN8 A;  2E2H H;  3PO3 G;  1H95 A;  1Y69 U;  4B3S Q;  2F0K A;  3PIO 3;  4DR5 L;  4J1M A;  5M5X H;  1IBK Q;  2E2J B;  2RHS B;  3DWA A;  1VQ9 A;  3NPP A;  3J7A V;  3FKI H;  3C46 A;  1P8L A;  3J81 c;  4C3J B;  4DPG A;  2L0C A;  4C3J G;  2IWH A;  1UE1 A;  1PFM A;  1KC8 C;  3M3Y B;  4LUO A;  3OIQ A;  3A0J A;  4KV6 A;  3CMA A;  4LF8 L;  5KYL A;  1GUN A;  2BDN A;  1SYB A;  3ONA B;  3I4N H;  3MXN B;  4BY7 B;  1LV9 A;  2H5X A;  2PNR C;  2PZU A;  4BY7 G;  1SDF A;  3SK5 A;  3HOW H;  2VQE Q;  3NEM A;  1CHP D;  2DY7 A;  1D1K A;  2UXD L;  3RR5 A;  4DR1 L;  2OWO A;  3LX0 A;  3K7A B;  5FKA C;  2EYP A;  2A1A A;  4XQQ A;  4F88 A;  3FHW A;  3TRE A;  3PUY A;  2JXM B;  3AQQ A;  4HID A;  1CFM A;  1A62 A;  3QO2 A;  1V43 A;  3K5N A;  4NW2 A;  4FF4 A;  4LAA A;  1F9Q A;  1JR0 D;  1BCP D;  1G51 A;  2F4V Q;  3QOJ A;  1S5D D;  2CKZ B;  1EY7 A;  3J7A 5;  4XYQ A;  1KTK A;  3K8A A;  4GNX A;  3UDG A;  1TS3 A;  3KJO A;  1JJC B;  4JBM A;  1E2Z A;  2BE5 D;  2Y0S B;  3C1E A;  3M3Y H;  1KLG D;  3G71 A;  2Y0S G;  1RTN A;  3I4O A;  1MSG A;  4UP7 A;  3QWN A;  4JBK A;  1I4P A;  4BY7 H;  4G4K A;  4LUV A;  1B8A A;  1YNJ D;  4GLV B;  4OIK A;  3U9O A;  5ELE A;  1Z7T A;  1B2T A;  3MWY W;  3CKI B;  1CQV A;  2MNA A;  1LT5 D;  1JT8 A;  1FNV A;  4JI3 L;  3EVQ A;  2GVA A;  2Q2T A;  3GTG H;  4DV3 L;  4L5S A;  4HSP A;  4JBJ A;  2EY1 A;  2JYO A;  3RZD B;  1F77 A;  2K5D A;  2AQ3 B;  1N8R C;  3CC4 A;  1LT6 D;  1PTO H;  1HZC A;  4X3S A;  3HOY H;  1PTO F;  2E5L L;  2PPB C;  4HN7 A;  4MTK A;  1QOH A;  1XMO Q;  3D6C A;  5LHY 1;  1EY5 A;  3MZ5 A;  1X3P A;  2A69 D;  1HFG A;  5EBD A;  1IBK L;  4IUU A;  1TR5 A;  1X55 A;  4JVZ A;  1C48 A;  3RLF A;  4MIU A;  4BBS G;  3KBG A;  3BDC A;  4ZUJ A;  2O2L D;  4AYB E;  4X62 Q;  2DN8 A;  3H91 A;  1Q81 C;  3GTQ H;  2AKW B;  4OEL B;  1I50 B;  1GO3 E;  3NEN A;  1YZ6 A;  1BBX C;  3Q24 A;  2K5N A;  4GOP B;  2FMM A;  4ZKC B;  1J9O A;  5C3E H;  3QIA A;  4QIW B;  4X66 L;  3HOV H;  1TWC B;  4BXX G;  1EU4 A;  4GN5 A;  2D5D A;  3CME A;  1ZXT A;  4G57 A;  3S14 H;  1J8I A;  3RLN A;  1DM0 B;  5M9O A;  3GTK B;  4WJ4 A;  1L0W A;  1SXT A;  1VMP A;  1TXY A;  2PMZ E;  3NQT A;  2R93 B;  1RIP A;  3HOZ H;  4NP5 A;  4Q5V A;  2P5Z X;  2R93 G;  1PTO C;  4R4I A;  3I4M B;  2QA4 A;  1K8O A;  3S1M B;  3I4M G;  1OXT A;  1LTL A;  1QG7 A;  2C5C A;  5C5L A;  5IGB A;  1HPC A;  2BA1 A;  2TMP A;  1YNN C;  4BBS H;  2F4V L;  4TSS A;  1CSQ A;  4HCS A;  4MTN A;  3OW7 A;  1M4V A;  1YI2 A;  3G48 A;  2K03 A;  3GV6 A;  1S5B D;  2IX1 A;  3RZO B;  1ROD A;  4YWM A;  3CW2 C;  1VQJ A;  3S2H B;  1YHA A;  1FVI A;  5HGT A;  2NVX B;  1CUK A;  1HUN A;  2D9U A;  2R7Z H;  3SVM A;  1CKO A;  1TWC H;  3ULJ A;  4FF2 A;  5CV4 A;  4HIK A;  1HR0 W;  2AUK A;  5T1G A;  3K58 A;  1PH6 A;  1ILQ A;  1KHI A;  4EQN A;  2AMC B;  2G5D A;  3GTK H;  2PYK A;  2DJG C;  3UDI A;  1XMQ Q;  2J7Z A;  2R93 H;  1I5F A;  1XMO L;  1RDP D;  4X3T A;  1G6P A;  3AU7 A;  1WTX A;  1AW7 A;  3G6E A;  2ICE C;  1RJT A;  1EIG A;  2F0O A;  1B70 B;  3MA2 B;  5E1F A;  1G2S A;  4J15 A;  4K14 A;  4DK1 A;  4QMG A;  4RFB A;  4B9W A;  1A15 A;  1ENC A;  1QUQ B;  2QDL A;  3K7U C;  1SRU A;  1M90 C;  3OWF A;  1L1O B;  4A3E H;  1PRT B;  1FD7 D;  4X62 L;  4LF6 Q;  3CD6 A;  1K3B C;  4EQO A;  3CU7 A;  1PH7 A;  1OXV A;  3T4A C;  3PIP A;  4ZAI A;  2Z6B A;  4MN3 A;  4JV5 Q;  5I9P A;  1EY6 A;  1Y1W H;  1VQ8 A;  1IW7 D;  1B1Z A;  4HMJ A;  1IYU A;  4ID6 A;  5CBE E;  1IZ6 A;  5IWA Q;  5FO8 B;  2I5H A;  4DR2 Q;  3CCM A;  3PQI A;  1H9S A;  1PVO A;  4MNO A;  3I55 A;  4DXG A;  3H0G B;  1U4R A;  1VF7 A;  5JVH 3;  3TS2 A;  3H0G G;  2CW0 C;  1EY4 A;  1ZYR C;  5J22 A;  5K5P A;  1PHJ A;  2F0U A;  4IPC A;  4BBR B;  2NUC A;  5EBC A;  3MAQ A;  4OO1 H;  2F0V A;  2B29 A;  4BBR G;  3SHL A;  1VQK A;  1EEF D;  3TP7 A;  3VA7 A;  2QDB A;  4OX9 Q;  4B3M Q;  3FVQ A;  5ISR A;  2KQ3 A;  3CCR A;  2WIN B;  3TP6 A;  2JA7 G;  1GUW A;  3ULL A;  2DY8 A;  2A5H A;  4RH6 A;  5IGG A;  1BF4 A;  2JA9 A;  4RCN A;  1PFN A;  1CTM A;  1PRT F;  1ASZ A;  3R3O A;  1F9S A;  1EYC A;  1OXU A;  3QB3 A;  4DFA A;  3TP5 A;  2XTI A;  3BU2 A;  2PQE A;  4CDD C;  1A2U A;  2PQA A;  1KNA A;  1K73 C;  4CGY B;  1N36 Q;  3D0F A;  4PZ7 A;  3G4S A;  1STY A;  2EY6 A;  4JI2 Q;  4A75 A;  2AWN A;  3J7Z C;  1ET9 A;  1EQR A;  1XMQ L;  3B6Y A;  1VQO A;  4IOC A;  2BCO A;  3D4D A;  2EOT A;  1Q82 C;  4KD4 A;  1BCP B;  3OMC A;  4O1N A;  2EPB A;  4RCO A;  1S5E D;  4K6D A;  4P2C B;  2JA7 H;  2ZJP A;  1KAW A;  5CV6 A;  3HOU H;  2K6A A;  3E9H A;  2UUA Q;  3S1R B;  2SOB A;  1PH2 A;  1RTO A;  4NB3 A;  2D62 A;  1YHQ A;  4LF6 L;  2AHO B;  4TKO B;  4F8M A;  4DR6 L;  1BR9 A;  4A4I A;  5KGU A;  4QY7 A;  4JV5 L;  4A3J H;  1HZ9 A;  2EIF A;  3OWE B;  5IWA L;  5KNB A;  4DR2 L;  3H3V I;  4H13 C;  4U68 A;  1ZEQ X;  2NVT B;  2JEB I;  4DU9 A;  1VQA A;  1IHZ A;  2D2C C;  2X69 A;  4DAV A;  1IL8 A;  3CCV A;  1TS5 A;  1FL0 A;  4LWC A;  5E7N A;  4IUQ A;  4PMC A;  4QUF A;  3D8G A;  3WDN A;  2F0D A;  4YY3 Q;  3SK8 A;  4BWG B;  3A54 A;  4DAP A;  1SYF A;  4R1J A;  1EWH A;  2SNM A;  1BCP F;  3I72 A;  3VR6 A;  1MI2 A;  4OX9 L;  4B3M L;  3JAM i;  5I9O A;  2K5Q A;  5BR8 Q;  2PI2 A;  3K5L A;  2ZXP A;  3A8J E;  5G3L D;  5IP9 G;  1C4Q A;  3NE5 B;  2UU9 Q;  1A6X A;  1TWH B;  4H02 A;  5C5M A;  1CM9 A;  2L1B A;  5LMN Q;  1B9N A;  4GS3 A;  2Q8R E;  1WYD A;  4DV7 L;  4R4Q A;  3G7L A;  4IZ8 A;  3CC2 A;  3MHB A;  1EY9 A;  4Y52 H;  4K8I A;  2EY5 A;  2NVT H;  3E0E A;  1N36 L;  1RF2 D;  1L2F A;  4JI2 L;  4TQU S;  3PO2 H;  2DJF C;  4QL5 A;  3J81 i;  3K59 A;  3CPW A;  3CPF A;  1NE3 A;  1TWA B;  4UDU C;  4C2M H;  1HRJ A;  1BXT A;  1B3A A;  1D6E C;  1EIF A;  5EAY A;  3SR1 A;  2NN6 G;  4UY8 C;  1FGB D;  2E2D C;  3O13 A;  1TWG B;  2I5L X;  4C3H H;  1M8A A;  1YNN D;  3F1Z A;  1MD2 D;  4YCU A;  1SFO H;  1RL2 A;  1IBL Q;  4CBV A;  1NY4 A;  4WJW A;  1II3 A;  1Y1V H;  3T1Y L;  1NJI C;  2QIL A;  4KY7 A;  1FNW A;  4A76 A;  5FLX c;  1DOK A;  2B2W C;  3DLL A;  1SE2 A;  1TWH H;  2UUB Q;  1MGS A;  4ZUI A;  4KJO A;  4ZRZ A;  1B53 A;  2A74 C;  1E3P A;  3PF5 A;  2F3W A;  2PW5 A;  2XSC A;  5C4Z A;  4XYO A;  1A3V A;  2XNA C;  3GTO B;  2CWA A;  1VDZ A;  2EYL A;  3WWV A;  1MHW C;  3M4Y A;  3A5U A;  3CXC A;  5CV5 A;  1SYD A;  5C4J B;  4YY3 L;  4XQJ A;  1AP0 A;  2D0P A;  3A56 A;  2UXB L;  3PCO B;  4IUR A;  1P16 A;  4KHP Q;  3H94 A;  1N34 Q;  1SYE A;  1E24 A;  4QUC A;  1LLR D;  4NXM Q;  5IE8 A;  4HED A;  3S9W A;  5BR8 L;  4R8I A;  1VQ7 A;  2YU9 B;  4DNI A;  5EGT A;  1ML0 D;  2KUM A;  2SDF A;  1ZKO A;  1Y14 B;  4XXE A;  2DUD A;  2QCP X;  4A93 B;  5DM7 3;  4ZCK A;  5L37 A;  1EOT A;  3RN2 A;  4A93 G;  4LF5 Q;  2UU9 L;  3AFP A;  2K28 A;  5BN5 A;  4R8N A;  1BOS A;  3FPP A;  4WFN 3;  4JG2 A;  4Y7N B;  5LMN L;  2OQ0 A;  4A3F H;  1CZG A;  1DGS A;  2F3V A;  4HAE A;  3SK4 A;  1PFS A;  3LNN A;  4BA1 I;  2K33 A;  2KJX A;  4PG3 A;  2EY2 A;  4GNX B;  1HNX Q;  3I91 A;  1CKN A;  2B2W A;  4FXD A;  4L5Q A;  1PH3 A;  2LMC B;  4OWW B;  2CW0 D;  2EYJ A;  3EQL C;  1HTP A;  5C4J H;  1IKM A;  1AFP A;  1JWU D;  4YIJ A;  1QVG A;  5K36 G;  1T9H A;  2PZT A;  4QJF A;  3UI2 A;  4FVM A;  3VDY A;  2ASB A;  4XDX A;  2LFN A;  1IBL L;  4DN4 M;  1Q8K A;  3GTP B;  2VQF Q;  3BS1 A;  2GN5 A;  1DCZ A;  3SXH A;  4YHH Q;  5CBA E;  3KOJ A;  3MVV A;  1QZG A;  4HTH A;  3T16 A;  4OON A;  1WTW A;  4AYB B;  2UUB L;  1VF5 C;  4AYB G;  3ZJY C;  2CQO A;  2Z8L A;  2FFK B;  4DUZ Q;  3MFG A;  1TVX A;  4BS9 A;  4C3I H;  4IFD J;  4DAY A;  2N55 A;  2XGT A;  3U58 A;  1H9K A;  4M1U B;  1ICF B;  1ESF A;  2V1C C;  1JWM D;  2XWJ B;  4IQZ A;  1IBM Q;  2DNC A;  2PMZ B;  4A3C H;  4QCL A;  3NEL A;  3TP8 A;  5K36 H;  4KHP L;  1B9M A;  5E3F A;  1U5K A;  3MEH A;  2AWO A;  3CRK C;  1Q86 C;  3JAM L;  2V4D A;  3R2I A;  3SEB A;  4NXM L;  1JOO A;  2A68 D;  2F0H A;  3W5O A;  3GTL B;  3HKZ E;  2M00 A;  2NTT A;  3GTP H;  4DV3 Q;  2JN4 A;  4LFB Q;  3I90 A;  1STA A;  5IYC G;  4LF5 L;  2L15 A;  4RKL A;  3T56 B;  2E5L Q;  1GKH A;  2L9H A;  4UP8 A;  2B3G A;  2ZTC A;  2NN6 I;  3CQZ H;  4ABN A;  1EYG A;  2JA6 H;  4KD3 A;  2KEN A;  4EQ5 A;  1MKH A;  2I5M X;  1HNX L;  2L12 A;  2E76 C;  4LF9 L;  3QJY A;  3GO5 A;  3J81 L;  3U4V A;  2K01 A;  3HOX H;  3DEO A;  3R2T A;  5C4H A;  2K5W A;  2NWG A;  2MGS A;  1V1O A;  4A3K H;  2PO4 A;  4PZ8 A;  2NVQ H;  2QKI C;  2RSO A;  4X66 Q;  1HR0 Q;  2ZTD A;  5C0X J;  3S16 B;  1XX8 A;  2JJQ A;  2YTX A;  1HZB A;  5ELB A;  3GTL H;  2VQF L;  1S3O A;  4YHH L;  1X6O A;  3J7Y W;  3RD4 A;  2PCF B;  2JK8 A;  2EDG A;  3BYT B;  1JIC A;  2MFI A;  3PO3 H;  2B8F A;  4B08 A;  1E0B A;  3EIV A;  1JE5 A;  5EPL A;  4OWT B;  3MC0 B;  4PV1 C;  4DUZ L;  1SNP A;  4J8Q A;  2FXQ A;  5CYU A;  2E2J H;  3S17 B;  3F8T A;  3J7A F;  4XIG S;  3AB9 A;  1XPO A;  2ATW A;  2VUM B;  4C3J H;  3PUV A;  2VUM G;  2LSS A;  1EU3 A;  2F1M A;  1JJ2 A;  4HCE A;  1OO9 B;  1IBM L;  1NTG A;  3I4L A;  1WVL A;  4JI8 Q;  3ND9 A;  3DMU A;  2B63 B;  3NUC A;  2R7D A;  1H9S B;  2B63 G;  1Q12 A;  4IJL A;  3K7A H;  4JCV E;  1FYC A;  3NQI A;  5G3L F;  4V19 0;  3VYU A;  3BDO A;  1AEX A;  3C1F A;  4LFB L;  4FXG C;  3BJU A;  2OF1 A;  4XTC S;  1NSN S;  1QNU A;  1Y8O B;  4JBW A;  2J0T D;  4X3U A;  2ES2 A;  3URY A;  1VQB A;  1GM5 A;  2IY5 B;  2A6H C;  4LUZ A;  5EJW A;  1O80 A;  1K28 A;  3KF6 B;  1TQO A;  2LY7 A;  1G29 1;  1VQ6 A;  4LNQ A;  3JAM E;  1SR3 A;  1STE A;  1KLU D;  1C7Y A;  1A3T A;  1SND A;  5M3F B;  4IJH A;  1XJV A;  2VUM H;  4RWS C;  4EQP A;  3BZD B;  4E6I A;  2RDH A;  5M3F G;  1E2W A;  5GAH C;  1VQP A;  5I6Y A;  1QJO A;  4DKA C;  3IRB A;  3DWP A;  4O0A A;  1LAC A;  1VQE A;  1A0I A;  2GVB A;  5JAV A;  1TT2 A;  4KKU A;  5FLM G;  3TDQ A;  1HR0 L;  1Z47 A;  1E7Z A;  1VQ5 A;  3EJI A;  4IN3 A;  1Z6H A;  2R6G A;  3M85 A;  5DNF A;  1I4R A;  5J3B A;  4GLX A;  3W1B A;  1X56 A;  1JB7 A;  3I8Z A;  3L7Z C;  3K5M A;  4YCW A;  4X6A H;  3RZD H;  2HIV A;  1HZA A;  3J81 E;  1M1K C;  1SMX A;  5LL6 X;  3J80 c;  2EXZ A;  3J80 L;  1STN A;  2F0J A;  1F9R A;  1HH2 P;  1SE8 A;  5EPK A;  1EEI D;  2F52 A;  1AH9 A;  2ZT9 C;  2ZXO A;  5JEA J;  4UPA A;  5IGE A;  2E8G A;  5KIX A;  4X64 L;  3ITP A;  4A3M B;  3MTS A;  1GHJ A;  2WAC A;  1WTO A;  4A3M G;  5EKL A;  2HCI A;  3UDF A;  5IIF A;  2O4X A;  3KDF A;  4KI0 A;  1I50 H;  3U9S A;  3PUZ A;  4IFD G;  3QG1 A;  5IT9 c;  1UNS A;  3R8B A;  4FYD A;  1K0S A;  5FLM H;  5IT9 L;  2F4I A;  4BXX H;  2UXC L;  2A6E C;  4JI8 L;  5KNC A;  2EZV A;  3DWQ A;  1F9P A;  4POF A;  4JI0 Q;  1GD7 A;  4A3G B;  2MP1 A;  2RHQ B;  1IXR A;  4A3G G;  1TS4 A;  1D2B A;  1GXD C;  2AUJ D;  1UWV A;  3OHX C;  4DXF A;  2F0W A;  5I2X A;  5IGD A;  3BDL A;  3I4M H;  1UAP A;  3MXN A;  3S1M H;  2K75 A;  1DOL A;  5AJ3 Q;  3H3V H;  3VYR A;  4IOA A;  1N32 L;  1WFQ A;  1CHQ D;  2VB3 X;  1Y8P B;  2IW3 A;  1I4Q A;  1QB5 D;  5IGF A;  2K50 A;  2K52 A;  4JI7 Q;  3DM1 A;  2OEO A;  3M4O B;  4EVO A;  3GQB A;  1V1P B;  1EFI D;  1E2V A;  4CKB A;  2B2T C;  3DM3 A;  4DR6 Q;  4IFD H;  3RLO A;  3RZO H;  3PUW A;  3GV3 A;  1VQG A;  2FJ2 A;  3AMU A;  4IUT A;  3K57 A;  3S2H H;  4DV4 Q;  1QWY A;  3ZYY X;  4MHE A;  4FO2 A;  4KHZ A;  4GOP C;  4JPB W;  4CJ1 B;  2NVX H;  4NMZ A;  1FJG L;  4DR4 Q;  5T1I A;  4GKJ Q;  4A3G H;  3W3A A;  2OTL A;  2ZJR A;  3ERO A;  1JB3 A;  1PXU A;  3L3O C;  2G9D A;  4CDC C;  5A2Q L;  3CCS A;  1V9P A;  4A3L G;  3LWE A;  5C0X G;  5E4X A;  3A5Z B;  4IPG A;  1AN8 A;  2RA4 A;  4WRD A;  1JJG A;  1UE5 A;  2HIX A;  1EWC A;  1PZJ D;  2YYZ A;  5IYB G;  3GTM B;  3H3V C;  2KCN A;  3KFU A;  4NPS A;  4A3I B;  2B2U C;  2PNH A;  1X9N A;  2F0Q A;  4A3I G;  5A35 A;  4JOI C;  4HJ7 A;  2N3S A;  1N9W A;  2F0M A;  3F2B A;  2VXW A;  1Q7Y C;  1SMY C;  1N33 Q;  3NBH B;  3CAM A;  1K8G A;  2QGQ A;  2Q8I B;  4PMW A;  2MO0 A;  4F7X A;  4ZKB B;  3P7J A;  1SNO A;  3J80 E;  5KYI A;  4Z9C B;  1O7Z A;  4DV7 Q;  4JI0 L;  4KY5 A;  4S3S A;  3HEJ A;  3BZK A;  2R61 A;  1VQI A;  1NNX A;  2B2T A;  2L55 A;  1UE6 A;  3H6M A;  3L0O A;  4DNR B;  3H0G H;  4B3T Q;  2Q2H A;  1HHV A;  4A3L H;  2OQK A;  5KND A;  5FO9 B;  1F2M A;  5M5W B;  4BBR H;  2Z1C A;  1PH5 A;  5C4X B;  2F0I A;  2XRQ D;  5IT9 E;  1RKN A;  1QVF A;  1KRT A;  5AJ3 L;  5C4X G;  3OMG A;  3CCQ A;  3KLS A;  2KBN A;  4JW0 A;  1U4L A;  3CCJ A;  4IO9 A;  5AFW A;  1O7L A;  2E2I B;  4JI7 L;  1EIY B;  3T1Y Q;  3EN2 A;  2KEC A;  1PZI D;  2MJ8 A;  1PH1 A;  1L1O C;  1TU2 B;  2F0P A;  1PRT C;  2R3Z A;  1BKB A;  4K5V A;  4ODG A;  2CHB D;  2RVL A;  4KJN A;  4H44 C;  3L9A X;  1O7I A;  4DV4 L;  5J1Z A;  1B4O A;  1X3F A;  2EYM A;  2I07 B;  4NXN Q;  4DR4 L;  1ENF A;  2B2U A;  4IUV A;  4GKJ L;  5LMU L;  4O2D A;  4DUY Q;  3I56 A;  3S24 A;  4JOI A;  2CCZ A;  1EQV A;  1R4P B;  2RKS A;  3E6Z X;  1I4G A;  2XRS D;  2EYF A;  4KN7 C;  4IFD I;  2WKC A;  1WCM B;  2K4K A;  5IY0 A;  5M5W H;  4P75 A;  1BBW A;  1WCM G;  3ICE A;  3CCE A;  1PMR A;  2YV5 A;  2UXB Q;  1YNX A;  3PGZ A;  1PYW D;  2BOS A;  1Q46 A;  1SJE D;  2FHT A;  1J6Q A;  4N9P A;  2B2V C;  3S1R H;  2E2I H;  1HCZ A;  1DOM A;  3UE0 A;  4KY6 A;  4LF7 Q;  3V05 A;  1NCV A;  5M5Y B;  4LFC Q;  5JEA G;  5A2Q E;  1RCV D;  2HQE A;  1N33 L;  3K80 C;  1GUS A;  1PV4 A;  5COR A;  2WAQ E;  1UE7 A;  2HUG A;  2WV6 D;  1GHK A;  2HT1 A;  2PI2 E;  4G7H C;  3I73 A;  3PIO A;  3AEV A;  5JJK A;  1SEB D;  3P20 A;  1WTR A;  1CA5 A;  2Q2U A;  2OTJ A;  1LTR D;  3CCL A;  4H7B A;  4HJA A;  3T53 B;  2KCC A;  1QVC A;  1L1O A;  1L0X B;  4B3T L;  2BH2 A;  3PV0 A;  1G8Z D;  3NHH A;  1I4H A;  2N78 A;  3M7N A;  3HKZ B;  1WCM H;  1LO5 D;  3NWT A;  2JE6 I;  3HKZ G;  1ICW A;  3H15 A;  1JOR A;  1PTO D;  3TRZ A;  1Q1E A;  3D4R A;  3MXP A;  2XWB B;  4FNF A;  4ILW A;  1W6K A;  3C3L A;  1BCP C;  3NTH A;  2Z0S A;  1H9M A;  3KLS X;  4KKS A;  4JI6 L;  1EFW A;  3SGI A;  4EX5 A;  5IP9 H;  2BE5 C;  2K05 A;  4B9X A;  3OTO L;  1KIX A;  1I6V C;  3NBI A;  5M5Y H;  5C0X I;  1T5X D;  4PZ6 A;  3D6W A;  3NTI A;  2ZTE A;  5FLX L;  2IX3 A;  2F0S A;  2RCF A;  1XWE A;  3V2T A;  2FMC A;  4NXN L;  5JOB A;  2B2V A;  5JVG 3;  4DUY L;  4GZY C;  3FMC A;  1A2T A;  2CWP A;  4L63 B;  3PIP 3;  1I4X A;  2B2Y C;  2JA8 B;  4UHV A;  5D3D A;  3AFQ A;  1TWA H;  1XTC D;  2JA8 G;  4V0B A;  4C1N K;  4PQX A;  2NN6 H;  2A69 C;  3N52 A;  1LYL A;  2KCT A;  1GOZ A;  3S1Q B;  5M3M B;  3KF8 A;  1TWG H;  1I3Q B;  2O5I C;  1S4Z A;  2H4O A;  3M9B A;  5C3X A;  4AIM A;  3S2D B;  2MUY A;  3A7A B;  3OIP A;  1YEZ A;  2N88 A;  5ELO A;  4R4O A;  3D3R A;  4LF7 L;  2XN9 C;  2ENB A;  2HD3 A;  4LFC L;  1CSP A;  2O5J C;  1JCK B;  2K14 A;  1VQH A;  2ZXR A;  3T1H Q;  1VQD A;  4UP9 A;  2PZW A;  3NK9 A;  3MFY A;  2HDM A;  1F2L A;  2NVY B;  2K1B A;  3IAY A;  1S72 A;  3E9I A;  1LTI D;  1XXG A;  3OYY A;  1KD1 C;  3D4W A;  1WD1 A;  4BY1 B;  4FF3 A;  3VR3 A;  4A3B B;  3GTO H;  5FO7 B;  4BY1 G;  1VQN A;  4LF9 Q;  4K2K A;  1IL2 A;  4P72 A;  1ZYR D;  4IAL A;  4P71 A;  3CCU A;  1KL9 A;  3GTJ B;  4G7O C;  4LMQ D;  3TS0 A;  1MJC A;  2F0N A;  1TKW B;  4JI1 L;  1SNC A;  5GRO A;  1JWS D;  2R92 B;  5CV9 A;  4DR3 Q;  2R92 G;  2E74 C;  4LF4 Q;  2YU9 H;  1TWF B;  3S2D H;  4GKK Q;  1YIT A;  2B2Y A;  1K8A C;  3G6J B;  1CKM A;  1PH8 A;  3LWU A;  4A93 H;  1SNQ A;  3NTK A;  1SMY D;  1YJW A;  2ID0 A;  1IYJ B;  1S5C D;  4IUP A;  4Q0F A;  1BNZ A;  5JPN C;  3J80 i;  1V1Q A;  5CC4 A;  2NVY H;  1HNW L;  3W1G A;  4Y7N H;  3Q22 A;  1UEA B;  4N8F A;  2DNE A;  3TME A;  3I7F A;  3TBI B;  1U4M A;  3FEW X;  5CR3 A;  4BY1 H;  3TSS A;  3CC7 A;  1D1I A;  5C44 B;  5IYD G;  5C44 G;  1FGU A;  2AQ2 B;  3U50 C;  5FLX E;  2JEA I;  5EQ0 A;  1EY8 A;  2AQ1 B;  2EQS A;  2IHE A;  1XPU A;  5M5X B;  4R4T A;  1SE4 A;  4XT1 B;  5KRU A;  5HY6 A;  3FKI B;  1TY2 A;  1X3Q A;  3FKI G;  2C35 B;  2J4X A;  4L5T A;  5ELC A;  4RGM A;  2WB1 E;  1O7Y A;  3TZU A;  1W2B A;  1X54 A;  4M8A A;  1KAB A;  1UUP A;  2ZJQ A;  1E1O A;  3T1H L;  5D65 A;  1Q90 A;  4DV5 L;  5HGQ A;  3I4N B;  1IW7 C;  1PH4 A;  1WOC A;  1NUC A;  2KCM A;  3I4N G;  3DEP A;  3HOW B;  1LTB D;  1ENA A;  2F0T A;  1LTS D;  1VQM A;  3HOW G;  4B3R L;  1VCI A;  1HQR D;  1BUV T;  1C8C A;  1F2Y A;  1AZP A;  1A63 A;  1MBY A;  3M4P A;  4GNX C;  1QNK A;  3KDF B;  3HP3 A;  2K5V A;  4JYA Q;  1EQT A;  4K6L A;  5C3W A;  1X32 A;  3Q23 A;  2ALY B;  4CKC A;  2LS0 1;  3KJP A;  1YBY A;  4DR3 L;  4KHV A;  1OXX K;  2WII B;  4LF4 L;  4LK1 C;  1LTA D;  3CF5 A;  4C1N I;  3KUP A;  4I7A A;  4GKK L;  1LT4 D;  5IYC H;  1Z9F A;  2YTV A;  5LL6 S;  4P73 A;  2Z9H A;  1HFN A;  1NR2 A;  2SNS A;  2Z4I A;  4HJ8 A;  2RSN A;  1H9J A;  2HHH Q;  4K5W A;  4XQN A;  5GQO A;  4TVA B;  4RMF A;  1XTD A;  4X3K A;  1SYC A;  2K32 A;  5JPM C;  4X64 Q;  2NYZ D;  2RCN A;  1K9M C;  1SYG A;  3GTG B;  1STB A;  5ELN A;  1NR4 A;  5EKK A;  1PTO B;  3HOY B;  3K5O A;  2XIW A;  3HS0 C;  3HOY G;  2UUC Q;  1PZK D;  3E0J A;  1MJE A;  5IOC A;  1Q3L A;  2F3I A;  2MHV A;  5D14 A;  3ULP A;  1BVS A;  2C9O A;  2UXC Q;  4OIJ A;  2NBF A;  1EZ8 A;  2BDO A;  3S16 H;  3D31 A;  3F2U A;  4OXP A;  4ZK9 B;  3NSW A;  2Q2I A;  4AH6 A;  4C56 C;  2K04 A;  4CJ0 B;  2KHI A;  1A3U A;  3GTQ B;  3GDE A;  2F0G A;  1GUO A;  4DK3 C;  5GAE C;  1ET6 A;  2NB0 A;  1VQL A;  4PMB A;  3A55 A;  4DV2 Q;  2XVS A;  4N9T A;  2VY3 A;  1WJJ A;  5C3E B;  4IUN A;  3NWS A;  1DZ1 A;  3H09 A;  3HOV B;  5C3E G;  1W3S A;  2NTS A;  3HOV G;  3S14 B;  1N32 Q;  1HA5 A;  2M2L A;  1PDQ A;  3K0Y A;  4L5R C;  3S17 H;  4QQB X;  3VR5 A;  1HJP A;  4R4C A;  4NDX A;  4DV6 Q;  4DNT B;  4DV0 Q;  4QF4 A;  3HOZ B;  1ONL A;  1YVC A;  4TRD A;  4JYA L;  1SE3 A;  3NXW A;  3HOZ G;  2KED A;  1RD9 D;  1ILP A;  3BG3 A;  3RMH A;  1LM0 A;  2MO1 A;  4B3S L;  4K2L A;  2PQA B;  1FJG Q;  3RNU A;  4BBS B;  2B63 H;  1SLJ A;  4HMI A;  3UDX A;  3VR2 A;  4ZYS A;  1AZQ A;  2L5T A;  3ND8 A;  4ZLT F;  4K8J A;  4H0L C;  2KEE A;  3KBX A;  1AE3 A;  1F2Z A;  1KAA A;  5BN4 A;  5EPJ A;  3OSO A; 
#chains in the Genus database with same CATH homology
 3DLL A;  1B7Y B;  3BZK A;  1VQI A;  1TWH H;  1HNZ L;  2UUB Q;  1ASY A;  4POG A;  1XNR L;  2HHH L;  1C9O A;  4GN4 B;  3L0O A;  1UE6 A;  4JI3 Q;  3H0G H;  4B3T Q;  2Q2H A;  4A3L H;  2OQK A;  5IYD H;  2VQE L;  2R7Z G;  2JA5 H;  5C44 H;  1KXL A;  1E3P A;  4GLA C;  4OWX B;  3PF5 A;  4BBR H;  1SN8 A;  2BA0 A;  2E2H H;  3PO3 G;  1PH5 A;  1H95 A;  3HFZ B;  5M3F H;  2CWA A;  1E1T A;  4B3S Q;  3WWV A;  1QVF A;  1U0L A;  1KRT A;  4DR5 L;  5M5X H;  5AJ3 L;  5C4X G;  1EUJ A;  3A5U A;  1IBK Q;  2RHS B;  3CXC A;  3CCQ A;  2KBN A;  4YY3 L;  1VQ9 A;  3CCJ A;  4IO9 A;  2UUC L;  2D0P A;  3FKI H;  4YWK A;  1P8L A;  2UXB L;  3PCO B;  3J81 c;  4JI7 L;  4DPG A;  1EIY B;  1P16 A;  4KHP Q;  3T1Y Q;  1N34 Q;  3EN2 A;  1UE1 A;  1E24 A;  1KC8 C;  1PH1 A;  1L1O C;  4LUO A;  1BKB A;  3A0J A;  4NXM Q;  3CMA A;  5IE8 A;  5BR8 L;  4LF8 L;  1VQ7 A;  4DNI A;  1O7I A;  4DV4 L;  1Y14 B;  3MXN B;  3I4N H;  2DUD A;  2H5X A;  1X3F A;  4A3E G;  4DR4 L;  4NXN Q;  4BY7 G;  3HOW H;  2VQE Q;  3NEM A;  3RN2 A;  4A93 G;  1X65 A;  4LF5 Q;  4GKJ L;  2UXD L;  5LMU L;  4DV2 L;  4O2D A;  3RR5 A;  4HJ5 A;  3AFP A;  4DR1 L;  4DUY Q;  3I56 A;  3S24 A;  2UU9 L;  2OWO A;  4JOI A;  2CCZ A;  2D0O A;  3KYH C;  2A1A A;  4JG2 A;  2VS1 A;  2OQ0 A;  5LMN L;  4A3F H;  1DGS A;  3FHW A;  1Y1W G;  3TRE A;  3PUY A;  1PFS A;  4IFD I;  4IPH A;  2K4K A;  5IY0 A;  5M5W H;  4BA1 I;  2WAQ G;  4P75 A;  1BBW A;  3AQQ A;  1WCM G;  4HID A;  3ICE A;  3CCE A;  4PG3 A;  1HNX Q;  4GNX B;  2YV5 A;  2UXB Q;  1CKN A;  1YNX A;  3PGZ A;  4A3M H;  1A62 A;  4L5Q A;  1V43 A;  4DV6 L;  1PH3 A;  4DV0 L;  4OWW B;  4QGU A;  4ME3 A;  1Q46 A;  1EOV A;  5JJI A;  1OXS C;  1G51 A;  2F4V Q;  1J6Q A;  2CKZ B;  5C4J H;  3J7A 5;  3S1R H;  2E2I H;  1NBW A;  3K8A A;  3UE0 A;  4GNX A;  1QVG A;  3UDG A;  1J5E Q;  3KJO A;  4OO1 G;  1JJC B;  2JQO A;  4JBM A;  4LF7 Q;  4IPD A;  1T9H A;  5K36 G;  4QJF A;  4LFC Q;  5JEA G;  3M3Y H;  3VDY A;  3G71 A;  2Y0S G;  1N33 L;  5LMU Q;  2ASB A;  3K80 C;  1IBL L;  3I4O A;  1PV4 A;  1Q8K A;  2WAQ E;  4UP7 A;  1UE7 A;  2VQF Q;  4JBK A;  2GN5 A;  4BY7 H;  2IX0 A;  4YHH Q;  2HT1 A;  2PI2 E;  4LUV A;  1B8A A;  3KOJ A;  4GLV B;  3PIO A;  1QZG A;  4OON A;  3AEV A;  5JJK A;  2MNA A;  2Q2U A;  2UUB L;  1JT8 A;  2OTJ A;  3CCL A;  4AYB G;  4JI3 L;  3ZJY C;  4HJA A;  2GVA A;  1QVC A;  1VS0 A;  1L1O A;  2CQO A;  4APV A;  4DV3 L;  2Q2T A;  4B3T L;  4L5S A;  1K3R A;  3PV0 A;  4FDB A;  4JBJ A;  4DUZ Q;  1EQQ A;  2N78 A;  2BH2 A;  3KLW A;  1N8R C;  3M7N A;  3CC4 A;  4C3I H;  3HOY H;  1HZC A;  2VW9 A;  1WCM H;  2E5L L;  4IFD J;  2JE6 I;  3HKZ G;  3H15 A;  4JC0 A;  1XMO Q;  2Y0S E;  3EBE A;  3TRZ A;  1D8L A;  1Q1E A;  2XGT A;  3U58 A;  3M4O H;  2N8N A;  2V1C C;  1IBK L;  1NMG A;  4JI4 Q;  2Z0S A;  1X55 A;  1IBM Q;  3RLF A;  4BBS G;  1Q1B A;  4A3C H;  3NEL A;  1YJ9 A;  4JI6 L;  4A3D G;  4AYB E;  4KHP L;  1EFW A;  3SGI A;  4EX5 A;  1U5K A;  5IP9 H;  4X62 Q;  1K0R A;  3OTO L;  1Q81 C;  1KIX A;  2AWO A;  3CP0 A;  2QEX A;  2AKW B;  5M5Y H;  3KF6 A;  1Q86 C;  3GTQ H;  5C0X I;  5H1S E;  1GO3 E;  3NEN A;  1YZ6 A;  4PZ6 A;  1XPR A;  4NXM L;  5IP7 G;  2K5N A;  2ZTE A;  3W5O A;  5GAD C;  4GOP B;  3HOU G;  3HKZ E;  3GTP H;  5C3E H;  3F2D A;  1GVP A;  4X66 L;  4DV3 Q;  4DV1 Q;  1R9T H;  1PYB A;  3HOV H;  4LFB Q;  4BXX G;  4NXN L;  4GN5 A;  5IYC G;  1A8V A;  3CME A;  3PF4 A;  2IHF A;  1VQF A;  3LGJ A;  4LF5 L;  3S14 H;  2L15 A;  2E5L Q;  3RLN A;  2NZH A;  4DUY L;  4GOP A;  1GKH A;  2EXD A;  4UP8 A;  2B3G A;  2CWP A;  4WJ4 A;  2VNU D;  2ZTC A;  2NN6 I;  3CQZ H;  1L0W A;  5IYB H;  1TXY A;  4A3J G;  2PMZ E;  2RF4 A;  1EYG A;  1RIP A;  3KF8 B;  2JA6 H;  3HOZ H;  2KEN A;  2VZA A;  2R93 G;  1PYS B;  3GTM H;  3AFQ A;  1MKH A;  4EQ5 A;  4R4I A;  1TWA H;  2I5M X;  2QA4 A;  4A3I H;  2JA8 G;  1HNX L;  3GTG H;  3I4M G;  1OXT A;  1LTL A;  4JI6 Q;  3JC6 6;  4LF9 L;  1PH9 A;  1LYL A;  2KCT A;  3GO5 A;  3U4V A;  3OTO Q;  2BA1 A;  3HOX H;  3UE1 A;  1TWG H;  4BBS H;  2F4V L;  4QIW E;  1CSQ A;  4MTN A;  3M9B A;  4A3D H;  3STB C;  4AIM A;  3F2C A;  4A3K H;  1YI2 A;  1YEZ A;  3G48 A;  1J5E L;  4PZ8 A;  5ELO A;  4R4O A;  2NVQ H;  1VQ4 A;  4X66 Q;  4LF7 L;  1HR0 Q;  2IX1 A;  2ZTD A;  4LFC L;  5IP7 H;  4JI5 Q;  5C0X J;  4YWM A;  3CW2 C;  1CSP A;  2JJQ A;  2K14 A;  2YTX A;  2A8V A;  1VQJ A;  1HZB A;  1VQH A;  4HIO A;  2A19 A;  3M4Q A;  3T1H Q;  1VQD A;  3GTL H;  1YHA A;  4UP9 A;  2I0Q A;  1FVI A;  3AYH B;  2VQF L;  1CUK A;  1CKN B;  1S3O A;  3I2Z A;  4YHH L;  1X6O A;  2R7Z H;  1CKO A;  1KRS A;  1BBU A;  1TWC H;  3ULJ A;  1S72 A;  1E22 A;  3E9I A;  2JK8 A;  3OYY A;  4HIK A;  1HR0 W;  4KLK A;  1KD1 C;  2HQL A;  2MQH A;  1PH6 A;  1KHI A;  1YHB A;  2MFI A;  3PO3 H;  3GTK H;  2AMC B;  3PUX A;  4DR7 Q;  3EIV A;  1JE5 A;  1XNQ Q;  3UDI A;  1D7Q A;  4OWT B;  3GTO H;  4BY1 G;  1VQN A;  5C4X H;  4DUZ L;  4LF9 Q;  1XMQ Q;  4WJ3 M;  1IL2 A;  2FXQ A;  2R93 H;  4P72 A;  2E2J H;  4P71 A;  3CCU A;  3F8T A;  1KL9 A;  4AQY Q;  1I5F A;  4XIG S;  1XMO L;  3TS0 A;  4X65 Q;  1MJC A;  4JI1 L;  1XPO A;  1G6P A;  2ATW A;  5GRO A;  4C3J H;  3PSI A;  3PUV A;  1S40 A;  3G6E A;  2VUM G;  1B70 B;  3PO2 G;  2LSS A;  4J15 A;  4DR3 Q;  2R92 G;  4JI4 L;  1JJ2 A;  4LF4 Q;  3MEF A;  1IBM L;  1NTG A;  2YU9 H;  1QUQ B;  3K7U C;  1SRU A;  3S2D H;  4HIM A;  1M90 C;  4GKK Q;  1L1O B;  4A3E H;  1YIT A;  1K8A C;  4LF6 Q;  4X62 L;  3CD6 A;  1CKM A;  2NZO A;  1PH8 A;  3S1N H;  4JI8 Q;  1PH7 A;  4A93 H;  1OXV A;  3PIP A;  2R7D A;  1YJW A;  2ID0 A;  2B63 G;  1IYJ B;  1Q12 A;  1QUQ A;  3K7A H;  4IJL A;  4JCV E;  4LW1 A;  3RN5 A;  1QZH A;  4DAY B;  4JV5 Q;  3J80 i;  1AE2 A;  1V1Q A;  1Y1W H;  1VQ8 A;  2NVY H;  3K0X A;  4DV1 L;  3W1G A;  4Y7N H;  1HNW L;  1Y1V G;  4LFB L;  1IZ6 A;  3BJU A;  5IWA Q;  4XTC S;  2I5H A;  4DR2 Q;  3CCM A;  3I7F A;  4JBW A;  1PVO A;  4BY1 H;  4MNO A;  2WB1 G;  3I55 A;  1VQB A;  1GM5 A;  2ES2 A;  4JI1 Q;  4OO1 I;  2IY5 B;  4LUZ A;  3TS2 A;  2K5H A;  3CC7 A;  3H0G G;  2IT1 A;  3KF6 B;  1VQ6 A;  1G29 1;  4LNQ A;  5IYD G;  1SR3 A;  5C44 G;  1PHJ A;  4IPC A;  1FGU A;  3U50 C;  1C7Y A;  1X3G A;  1MIU A;  2JEA I;  2B29 A;  4IJH A;  3ERS X;  4BBR G;  4LFA Q;  2EQS A;  2IHE A;  1XJV A;  1VQK A;  1XPU A;  2VUM H;  5M3F G;  4R4T A;  5GAH C;  4OX9 Q;  4B3M Q;  5HY6 A;  1VQP A;  3CCR A;  4DKA C;  2JA7 G;  3IRB A;  4O0A A;  1YJN A;  2DGY A;  3ULL A;  1VQE A;  2YTY A;  1A0I A;  2C35 B;  3FKI G;  2GVB A;  2JA9 A;  4L5T A;  4DK6 C;  2WB1 E;  2LXJ A;  5FLM G;  1HNW Q;  1HR0 L;  1Z47 A;  1W2B A;  1X54 A;  1ASZ A;  1OXU A;  4JI5 L;  1E7Z A;  1VQ5 A;  2ZJQ A;  2UUA L;  2R6G A;  2XTI A;  1E1O A;  3BU2 A;  5J3B A;  3M85 A;  3W1B A;  1X56 A;  4GLX A;  3T1H L;  1JB7 A;  1EWI A;  1UEB A;  1SRO A;  4DV5 L;  5HGQ A;  2ZM6 Q;  3L7Z C;  1PH4 A;  1WOC A;  2KCM A;  4MZ9 A;  4YCW A;  3I4N G;  2PQA A;  4X6A H;  3RZD H;  1K83 H;  1HZA A;  2HIV A;  1M1K C;  1SMX A;  1K73 C;  1VQM A;  3HOW G;  4B3R L;  1VCI A;  3J80 c;  4DR7 L;  1N36 Q;  3D0F A;  4YCV A;  4PZ7 A;  3G4S A;  1XNQ L;  4JI2 Q;  2LXK A;  1A63 A;  4A75 A;  1HH2 P;  1SE8 A;  2AWN A;  3M4P A;  2F52 A;  3J7Z C;  1EQR A;  4GNX C;  4A3F G;  1XMQ L;  3HKS A;  3B6Y A;  1AH9 A;  5JEA J;  3KDF B;  4UPA A;  2E8G A;  2K5V A;  1VQO A;  4JYA Q;  4IOC A;  2R7F A;  4AQY L;  4X64 L;  5M3M G;  2ALY B;  4X65 L;  4BA2 I;  1Q82 C;  4A3M G;  3KJP A;  3UDF A;  1VQC A;  4HJ9 A;  3FP9 A;  4YWL A;  1YBY A;  3KDF A;  4DR3 L;  2ZJP A;  1KAW A;  1OXX K;  1I50 H;  4KI0 A;  3PUZ A;  4LF4 L;  2JA7 H;  3HOU H;  3CF5 A;  4IFD G;  3E9H A;  2UUA Q;  5IT9 c;  1PH2 A;  3K81 C;  1NMF A;  1I94 Q;  5FLM H;  4NB3 A;  2D62 A;  4DV5 Q;  4GKK L;  3Q8D A;  1YHQ A;  4BXX H;  4LF6 L;  2AHO B;  5IYC H;  3GD7 A;  2UXC L;  4DR6 L;  1Z9F A;  4JI8 L;  2YTV A;  4A4I A;  4P73 A;  4POF A;  4JI0 Q;  1GD7 A;  5DLQ E;  2RHQ B;  4QY7 A;  4HJ8 A;  4B3R Q;  1IXR A;  1XNR Q;  1HNZ Q;  4RG1 A;  2N49 A;  4A3G G;  2HHH Q;  3S15 H;  4JV5 L;  5GQO A;  4TVA B;  4RMF A;  1X3E A;  1HZ9 A;  2EIF A;  2Z6K C;  4A3J H;  1XTD A;  1UWV A;  4A3B G;  5IWA L;  1C0A A;  4DR2 L;  3H3V I;  2JA8 H;  4X64 Q;  2JEB I;  1VQA A;  3I4M H;  2RCN A;  1K9M C;  3S1M H;  2BH8 A;  2K75 A;  5ELN A;  3CCV A;  5JJL A;  1FL0 A;  4DR5 Q;  4LWC A;  5E7N A;  5AJ3 Q;  3H3V H;  1N32 L;  4IOA A;  1WFQ A;  3S1Q H;  5M3M H;  4YY3 Q;  3ER0 A;  3HOY G;  1I3Q H;  2UUC Q;  1MJE A;  2K50 A;  2K52 A;  2F3I A;  1KQS A;  4JI7 Q;  4R1J A;  5FJ8 G;  3L2P A;  4LFA L;  3ULP A;  1YIJ A;  1BVS A;  2UXC Q;  3DM3 A;  4DR6 Q;  4OX9 L;  3RLO A;  4B3M L;  3JAM i;  3TEH B;  3RZO H;  3PUW A;  3S16 H;  5BR8 Q;  1VQG A;  4LF8 Q;  2PI2 A;  3S2H H;  4DV4 Q;  3D31 A;  4OXP A;  4KHZ A;  4GOP C;  4AH6 A;  2Q2I A;  4A3C G;  2NVX H;  2KHI A;  3U4Z A;  3GDE A;  1FJG L;  4DR4 Q;  2KHJ A;  5IP9 G;  4DK3 C;  5GAE C;  2WP8 J;  1VQL A;  4A3G H;  4DV2 Q;  2UU9 Q;  4GKJ Q;  2UXD Q;  2WFW A;  4H02 A;  4DR1 Q;  2OTL A;  2VY3 A;  1WJJ A;  2ZJR A;  2ZM6 L;  4A3B H;  5LMN Q;  5C3E G;  4GS3 A;  1W3S A;  3CCS A;  1WYD A;  2VL6 A;  4DV7 L;  3HOV G;  4R4Q A;  1V9P A;  2CFM A;  4A3L G;  3CC2 A;  5C0X G;  1N32 Q;  4K0K Q;  3A5Z B;  4QQB X;  4IPG A;  2JA5 G;  4L5R C;  1OTC A;  3S17 H;  1LUZ A;  4Y52 H;  2NVT H;  3E0E A;  3GTJ H;  1N36 L;  1I6H H;  1L2F A;  1HJP A;  4R4C A;  1UE5 A;  4JI2 L;  2HIX A;  4TQU S;  4DV6 Q;  1JJG A;  4K0K L;  1WI5 A;  4DV0 Q;  3OW2 A;  3PO2 H;  4QL5 A;  2YYZ A;  3J81 i;  3CPW A;  5IYB G;  2R92 H;  1YVC A;  5GAG C;  3J81 j;  3CPF A;  5LMN W;  4JYA L;  4DAM A;  3HOZ G;  1NE3 A;  2JA6 G;  3KFU A;  4NPS A;  2OCE A;  2Z6K A;  2PNH A;  4C2M H;  5FJ8 H;  1TWF H;  1X9N A;  4A3I G;  1EIF A;  1JMC A;  1LM0 A;  2MO1 A;  4B3S L;  5EAY A;  2NN6 G;  4JOI C;  4HJ7 A;  2N3S A;  1N9W A;  4GN3 B;  4ALP A;  2PQA B;  4UY8 C;  1FJG Q;  3RNU A;  2I5L X;  4C3H H;  3A74 A;  3HOX G;  3BZC A;  1SLJ A;  3F2B A;  3F1Z A;  1Q7Y C;  2B63 H;  4P74 A;  4YCU A;  1N33 Q;  3NBH B;  3UDX A;  1RL2 A;  3CAM A;  2QGQ A;  1SFO H;  1PA6 A;  1K8G A;  1IBL Q;  4PMW A;  1NY4 A;  2MO0 A;  3STB D;  1I94 L;  4A3K G;  1AE3 A;  1Y1V H;  3JAM c;  3T1Y L;  1NJI C;  1N34 L;  4A76 A;  3TQY A;  5FLX c;  4DV7 Q;  4JI0 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...