1VQHA

Gene v protein mutant with ile 47 replaced by met 47 (i47m)
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
86
structure length
86
Chain Sequence
MIKVEIKPSQAQFTTRSGVSRQGKPYSLNEQLCYVDLGNEYPVLVKMTLDEGQPAYAPGLYTVHLSSFKVGQFGSLMIDRLRLVPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords GENE V PROTEIN
publication title Potential use of additivity of mutational effects in simplifying protein engineering.
pubmed doi rcsb
source organism Enterobacteria phage f1
total genus 9
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 1996-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02303 Phage_DNA_bind Helix-destabilising protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1vqhA00
2QA4A 3T1YL 1Q82C 3M3YH 1GO3E 1C0AA 1QVCA 1Q1BA 4AH6A 1NBWA 4IPDA 4DUZQ 4A3FH 1VQ9A 1UE5A 1CKNB 2I0QA 4JI3Q 5JJIA 3UDIA 3S2DH 2ZTEA 4A3FG 2KHIA 4JCVE 1E7ZA 1I94L 4P72A 2UXCQ 2OWOA 2VUMH 1TWFH 1LYLA 1OXTA 3M4OH 4UP9A 4LF6L 1SFOH 4DV1Q 1RL2A 3HOXH 1XMQQ 1Y1VH 5C4XH 2VUMG 1G6PA 2H5XA 1K0RA 2HIVA 1CSQA 2ES2A 4AYBE 1X56A 1PV4A 2UUCL 3HOXG 1Y1VG 1SRUA 4IOAA 5C4XG 3Q8DA 1PH4A 3BZCA 3ERSX 2Q2TA 4LFBQ 5IE8A 4A3IH 2AKWB 1XMOL 2UU9L 4XTCS 4R4CA 4BY1G 1GM5A 3E9HA 3L0OA 4DR7Q 4GLAC 4A3IG 3I55A 4X66Q 1N34L 2F4VQ 1J5EL 1L0WA 1TWCH 3AFQA 3CP0A 1VQOA 3NEMA 2MNAA 1EIYB 1MIUA 4R4OA 3HOVH 3PF4A 2VQFQ 4FDBA 3CC4A 5IWAQ 5LMNL 4GLXA 4OONA 3J81i 3CCLA 4R4IA 3HOVG 1VS0A 2UUAL 4BXXH 3S17H 2E2IH 1X55A 3KDFB 3OTOL 1X54A 4Y52H 2JA6H 1A63A 5EAYA 3KOJA 4GS3A 4QIWE 4BXXG 2NZOA 4R1JA 1K9MC 3HKSA 4OX9L 2JA6G 1K73C 2Z6KA 2XGTA 3E0EA 1QZGA 3U58A 4P73A 3M4QA 1NMGA 4LUOA 2ZTCA 4YCWA 4WJ4A 2ZTDA 3E9IA 2D0OA 4X65Q 4JI7Q 2EQSA 3RLOA 3DM3A 2E8GA 1VQMA 4PZ7A 1PH9A 3AFPA 1IBML 3CCMA 3GTKH 2A8VA 3S1MH 1YBYA 2FXQA 4NXMQ 1UEBA 1EIFA 2CQOA 1EQQA 4LF7Q 3TS0A 5K36G 1V1QA 3RLNA 4HJ9A 1VQ4A 3I4MH 3KLWA 3UDXA 5M5WH 1VQ5A 3U4ZA 3H0GH 2XTIA 2ASBA 1CUKA 3HFZB 4UP7A 3PIPA 2YV5A 1Q8KA 2WB1E 3GTJH 1IL2A 4JI2Q 2NVTH 3I4MG 4EQ5A 4X62Q 1KAWA 4DR1L 3H0GG 4IJLA 4GKJL 4JI5L 1HNZQ 1RIPA 2KCMA 4AIMA 4OO1I 1YITA 5IT9c 3CC2A 4B3TQ 2UXDQ 3FKIH 4HIKA 4B3SL 1Q86C 4JYAQ 5FLXc 4OXPA 4B3RQ 4DV3Q 3ICEA 2LSSA 3FKIG 2UUBL 2WFWA 2OTJA 3KF6A 4DR2Q 4A93H 4POFA 4DV7Q 2HHHQ 2R7FA 4RMFA 2I5MX 1YI2A 4JI3L 4C2MH 2CFMA 4DUZL 4GN3B 4A93G 1PHJA 1B7YB 3T1HL 3GTMH 2KENA 1QUQA 3HOWH 1L1OA 4JI1Q 2ZM6L 1FJGQ 5M5XH 2D0PA 1BKBA 3PGZA 4DR3L 2CWAA 1B70B 2NZHA 2AWOA 4IJHA 5FLMH 3J81c 1XMQL 4JI0L 3HOWG 1PVOA 4BA1I 2RF4A 3FHWA 5LMUL 3RNUA 1VQ7A 1XNRL 4JBJA 1KC8C 2NVYH 5FLMG 2JEAI 2UXBQ 2KBNA 4IPHA 2NVXH 4NB3A 3CMAA 4GKKL 3NENA 1N8RC 3K7AH 4LFAQ 1X3GA 3GTOH 4DUYQ 4JI8L 1JMCA 4DR4L 3CAMA 5JJLA 2ATWA 1AE2A 3NBHB 3H15A 4JV5Q 1V9PA 3OYYA 3KJOA 4K0KQ 4X66L 3GO5A 2Y0SG 3LGJA 5BR8Q 4QGUA 4DV2Q 1D7QA 1FVIA 4PG3A 1KIXA 1AH9A 4R4QA 1YVCA 3CCRA 3H3VH 1Q7YC 4LF5L 3F8TA 4L5TA 4OWTB 2DGYA 4PMWA 1XNQQ 1Z9FA 3I7FA 1M1KC 5LMNW 3WWVA 5AJ3Q 1EUJA 4HJAA 4JI4L 1X3FA 2YTXA 1TWGH 1VQLA 3GTQH 1KHIA 3PUXA 4TVAB 2K50A 2IX1A 4A3DH 1YNXA 1C9OA 1NE3A 1VQIA 4DK6C 1X3EA 4A3DG 1XTDA 4X65L 4JI7L 1VQKA 1JJ2A 3CQZH 4JBKA 1A8VA 3S16H 4NXML 2CKZB 3PO3H 3GDEA 2DUDA 3J80c 3AEVA 1I6HH 3CF5A 4NXNL 1W2BA 4P75A 1Q46A 3PO3G 4DV5L 3PSIA 3GTGH 4JI6L 4DPGA 4JI2L 1LM0A 4DV0Q 2PQAB 1IBLL 1IXRA 1JJGA 5GAEC 1N32L 2VS1A 4BY1H 1PH8A 2QEXA 2E5LQ 1LUZA 1UE7A 1KXLA 4C3HH 3IRBA 3J7A5 1S3OA 4DV3L 3KFUA 4A3KH 2YTVA 4X64L 1WI5A 1PH3A 2VZAA 2AHOB 1PH1A 2Q2UA 2BH2A 4A3KG 1PH6A 1CSPA 2AMCB 4LFCL 2PI2A 3AYHB 3I4NH 1NJIC 1MKHA 4L5SA 1E3PA 1HH2P 3HKZG 4IFDI 1FGUA 3MEFA 4JI1L 3G4SA 1ASYA 1FJGL 4DV4Q 4EX5A 3CCVA 4A3JH 3I4NG 1HNWQ 4A76A 3PV0A 3CCSA 4DR5Q 2R6GA 2R7DA 4DKAC 1PH7A 1HR0L 4GNXC 4A3JG 4HJ5A 4OO1G 1YHQA 4IFDJ 4AQYQ 3AQQA 3GTLH 4IPGA 1PYBA 3OW2A 1PH2A 4LF4Q 4LF8L 4LFAL 4DUYL 1PFSA 2VQEQ 5GQOA 4GNXB 3CCEA 1EYGA 3JAMc 2YYZA 4JV5L 2Q2HA 4K0KL 3K8AA 3UE0A 2Z6KC 5BR8L 3PCOB 2IT1A 4DV2L 1HNXQ 4KHPQ 2PI2E 4GOPC 3BZKA 1IYJB 2OQKA 3RLFA 5H1SE 1N36L 4Y7NH 4JG2A 3F2CA 1OXSC 4B3ML 1BBWA 1XNQL 1I3QH 1OXUA 2IHEA 2K5NA 3S24A 3NELA 4P74A 2L15A 3CPWA 4DV6L 3T1YQ 1OTCA 4GOPB 4YCUA 4LNQA 3JC66 2RHQB 1SMXA 3HOUH 4BY7H 4JOIC 5IY0A 3M85A 1YJ9A 1VQBA 2F52A 1UE1A 4YY3Q 3HOUG 2N8NA 3PO2H 4BY7G 1OXXK 1UWVA 5GADC 1CKMA 1L2FA 4YHHQ 2VNUD 3A0JA 3J80i 4POGA 2Y0SE 3L2PA 4HIOA 4BBSH 3PO2G 2VY3A 3K80C 2B3GA 2EIFA 2V1CC 4QL5A 2UXCL 2MFIA 4NPSA 3UDFA 2A1AA 1WCMH 4BBSG 3BJUA 2PMZE 4DV1L 1XMOQ 3PF5A 2UU9Q 2YU9H 3BU2A 1GVPA 1BBUA 1WCMG 3J81j 4YWMA 1IBKQ 3FP9A 4A3BH 2IX0A 4DV0L 4LWCA 4UPAA 2WAQG 1N33Q 3S15H 3TS2A 3DLLA 2RCNA 4C3IH 4A3BG 4DAMA 2ZJQA 4LFBL 1WFQA 3HOZH 3M4PA 1YJNA 2K75A 4PZ6A 2MO0A 1JJCB 3K81C 1WJJA 2VW9A 2JJQA 4DK3C 1KRTA 3HOZG 4DR7L 5LMNQ 3F2DA 2OQ0A 1QUQB 2F3IA 4UY8C 1AE3A 2F4VL 1VQHA 2EXDA 4L5RC 2JA7H 2IY5B 2WB1G 1W3SA 4PZ8A 2ID0A 4ALPA 2JA7G 2OTLA 3A5ZB 4MNOA 2VQFL 1VQPA 5IWAL 3CCJA 4OX9Q 1XPOA 3PUWA 4A3MH 4LW1A 3I2ZA 2Z0SA 1MJCA 2HQLA 4A4IA 1G291 2MQHA 1UE6A 1QVFA 1XPRA 4A3MG 1CKOA 1H95A 2AWNA 3ZJYC 3D31A 3U50C 3L7ZC 1YHAA 1MJEA 1T9HA 1YZ6A 4O0AA 1GKHA 2YTYA 1QZHA 1HR0W 3JAMi 2I5LX 5M3FH 2ZJRA 1ASZA 1TXYA 2C35B 2R7ZH 3F1ZA 2N49A 2VQEL 1Q81C 2BH8A 5M3FG 3STBC 1CKNA 2B63H 4A3GH 2KHJA 1J6QA 1VQJA 1EWIA 3MXNB 1SN8A 3KJPA 2R7ZG 2B63G 4GKJQ 4XIGS 4LF7L 4A3GG 1HNXL 3M9BA 4GN5A 5C4JH 1Y1WH 4YCVA 3HKZE 5C0XI 4IFDG 1SLJA 3ULPA 2Q2IA 3PIOA 3UDGA 4B3SQ 3UE1A 4LF9Q 3A74A 4GN4B 4X62L 3CCQA 1Y1WG 2JE6I 2PQAA 1HNZL 5GAHC 1A62A 5C0XJ 4O2DA 4B3TL 2UXDL 4BBRH 2K5HA 1EQRA 1EFWA 5M5YH 3S2HH 1YJWA 3TRZA 4JYAL 4KLKA 3CW2C 4MZ9A 2OCEA 4BBRG 4HIDA 3T1HQ 4B3RL 1I50H 4DR2L 1GD7A 2ZM6Q 4A3EH 4DV7L 1V43A 2HHHL 2MO1A 2NN6I 4YY3L 1I5FA 4LUZA 1K8AC 4DR3Q 1WYDA 4YHHL 3H3VI 1JT8A 2D62A 5E7NA 1KRSA 5GROA 4DNIA 5LMUQ 4A3EG 3PUVA 4JI0Q 4DR6Q 4WJ3M 1XNRQ 1HZCA 1VQEA 3TREA 4JBMA 3S1QH 4R4TA 3EN2A 2E2HH 1YEZA 4GKKQ 1VQGA 2B29A 3KDFA 4UP8A 3ULJA 1BVSA 4JC0A 4JI8Q 2R92H 4DR4Q 1IBKL 1NY4A 4J15A 3K7UC 1S72A 2UXBL 1EOVA 1N33L 1Q12A 2R92G 5JEAJ 3S14H 4ME3A 1QVGA 1SE8A 2GVAA 4P71A 1G51A 2JK8A 4IPCA 5IYDH 3CCUA 4RG1A 3VDYA 4KI0A 4HJ7A 4LF5Q 2JQOA 4X6AH 4GNXA 1JE5A 4KHZA 2WP8J 3GD7A 5IYDG 3RN2A 1VCIA 3CPFA 5IYBH 2JA8H 4QQBX 4AYBG 1P16A 2HT1A 1M90C 2GN5A 5ELNA 4JI4Q 3RN5A 5IYBG 2JA8G 3RZOH 1K3RA 1XPUA 1Q1EA 1DGSA 1VQ6A 5AJ3L 3EIVA 1IZ6A 4GOPA 1VQCA 2WAQE 3KYHC 1HJPA 3G71A 2CCZA 2A19A 1PA6A 4A3LH 2ALYB 3CXCA 1K83H 5JJKA 1SROA 1O7IA 1I94Q 1JB7A 3PUYA 4A3LG 1E22A 1TWHH 3EBEA 1P8LA 4LF6Q 1HZ9A 1VQAA 4NXNQ 2K14A 2N3SA 3PUZA 4DV5Q 4JI6Q 5J3BA 2UUCQ 2HIXA 4JOIA 1C7YA 1IBLQ 3HOYH 1N32Q 1Y14B 1SR3A 4GLVB 1NMFA 2LXJA 4YWLA 5IYCH 3B6YA 1A0IA 3HOYG 3U4VA 4LF9L 2K4KA 3D0FA 1VQ8A 3M7NA 1E1OA 1L1OC 4TQUS 3KF6B 5IYCG 4X64Q 1N34Q 3I56A 1J5EQ 4QJFA 3GTPH 3KF8B 5ELOA 2E5LL 2BA0A 3S1RH 1OXVA 4APVA 3STBD 2IHFA 2N78A 3ER0A 3I4OA 1YIJA 1XJVA 4LUVA 4LFCQ 1E24A 4BA2I 4A3CH 1TWAH 2JA9A 2VL6A 1L1OB 1VQNA 1D8LA 3RR5A 2UUAQ 3S1NH 1X65A 1HZBA 2I5HA 3CMEA 1S40A 4A3CG 3OTOQ 1NTGA 5C3EH 1WOCA 5C44H 1B8AA 1VQDA 1N9WA 5HGQA 1HR0Q 3SGIA 2PNHA 4A75A 4DR6L 1KL9A 2CWPA 4OWXB 3W1BA 3W1GA 5C3EG 2K5VA 5IP7H 5C0XG 3A5UA 1K8GA 5C44G 1FL0A 4DV4L 1HNWL 1KQSA 4IO9A 5DLQE 3W5OA 4LF8Q 3G6EA 1X6OA 5IP7G 3CC7A 4DR5L 2JA5H 4OWWB 4HJ8A 1KD1C 2E2JH 1IBMQ 3TQYA 1U5KA 4AQYL 1YHBA 4MTNA 2JA5G 5IP9H 4YWKA 1R9TH 4HIMA 4LF4L 2RHSB 2ZJPA 2NVQH 2GVBA 2K52A 5IP9G 3CD6A 2LXKA 5HY6A 2R93H 1N36Q 4JBWA 2NN6G 4B3MQ 5GAGC 3K0XA 1PYSB 4IOCA 5FJ8H 1VQFA 4DR1Q 5M3MH 2R93G 4C3JH 1PH5A 4JI5Q 2JEBI 4KHPL 3G48A 1U0LA 3TEHB 4DAYB 1X9NA 2BA1A 5FJ8G 4DV6Q 1E1TA 3RZDH 5M3MG 3ULLA 1Z47A 2KCTA 5JEAG 4L5QA 2UUBQ 4H02A 4QY7A 3F2BA 1HZAA 2QGQA 1LTLA 3J7ZC
chains in the Genus database with same CATH superfamily
3BYTB 2B2VA 3TSSA 5K36G 4AH6A 3I70A 3UDIA 4LMQD 1SYGA 4JCVE 5G3LF 3NWSA 4P72A 4E6IA 1TWFH 4UP9A 1B1ZA 2F3WA 1SE4A 2HQEA 2KCNA 1G6PA 3ERQA 3I4MB 1K0RA 1CSQA 1CZGA 4AYBE 3H0GB 4IOAA 1SRUA 3PMFA 2L9HA 1XMOL 1QG7A 1HUNA 1GM5A 3L0OA 3FKIB 4U68A 4A3IG 3HOUB 1W6KA 2ICEC 1VQOA 3G6JB 4R4OA 3PF4A 1EZ6A 4OONA 4GLXA 3CCLA 1EEFD 3HOVG 2ICIA 4BXXH 1CA6A 2E2IH 1X55A 5NUCA 3TP6A 2LS01 5EAYA 4R1JA 4DNRB 2B2WA 2JA6G 1SXTA 3OW7A 5KEEA 2PPBC 4K5WA 4P73A 4WJ4A 2D0OA 3K7AB 1PH9A 3RLOA 1ASYA 3CCMA 3I4LA 2A8VA 1XWEA 1LTAD 1UEBA 1B53A 2CQOA 3QIAA 1BF4A 3E3XA 4HCSA 1AFPA 2D2CC 3UDXA 5M5WH 1VQ5A 1ONLA 2KEDA 2CQAA 1UEAB 5G3LD 5ISRA 4CKEA 2KCMA 4LJZC 1MSHA 4B3TQ 4HIKA 1II3A 2F4IA 4B3RQ 2LSSA 4S3SA 1SYEA 2KEEA 2OTJA 4DR2Q 4DV7Q 2HHHQ 3DM1A 4RFBA 4MIUA 2I5MX 5IGDA 2CFMA 2EYOA 1B7YB 5JJZA 2EDGA 2F0SA 5D14A 4JI1Q 1FJGQ 3PGZA 1B70B 5FLMH 4IJHA 4BA1I 1VQ7A 3RNUA 2UXBQ 2EPBA 2KBNA 3KLSA 4IPHA 3GTGB 3CMAA 1X3GA 4DR4L 1PYWD 4RGNA 3NBHB 5LL6S 4I7AA 5BR8Q 4DV2Q 2A69D 4C56C 2LMCB 3H3VH 1Q7YC 3HEJA 4G4KA 3QJYA 3EJIA 4PMWA 1XNQQ 1NCVA 4ZKCB 2B39A 3I4NB 4XDXA 5LMNW 1V1PB 2FINB 5AJ3Q 4HJAA 3CRLC 1X3FA 2YTXA 3A7AB 1KLUD 4QB4A 1VQLA 3GTQH 4KD4A 1ML0D 2SNSA 4RKBA 4A3DH 3HGBA 1C9OA 4HMJA 4RAUC 1ZXTA 2MGSA 2F0VA 1VQKA 3CQZH 4JBKA 1LTRD 1FNVA 4NXML 3GDEA 1PMRA 2DUDA 3J80c 2A69C 3AEVA 3D8GA 2A73B 4H44C 3PSIA 4JI6L 1IKMA 4JI2L 1IBLL 5GAEC 1Y8OB 4XYQA 3VR6A 4K6LA 1DYQA 2RA4A 1KAAA 1JR0D 2P5ZX 4BS9A 2F0KA 3IRBA 4QUFA 1LV9A 4DV3L 4C3HG 4X64L 3D4DA 1K83B 2VZAA 1PRTF 3NTKA 1QCBD 1PH6A 1X3QA 4LFCL 2RVLA 3KUPA 1HH2P 3HP3A 1FGUA 4BBSB 3G4SA 1IL8A 4DR5Q 2RSOA 1XXGA 1PH7A 4IFDJ 5F2DA 1CQVA 4HTHA 1SYBA 1DOMA 3NBIA 4LF8L 3S15B 2Z9HA 4RA8A 1PFSA 3HZXA 2VQEQ 1AZPA 3HOZB 4GNXB 1EYGA 3JAMc 2YYZA 1GUWA 2EY1A 1H9MA 2Z6KC 1CM9A 3PCOB 1TWAB 1MHWC 2JA7B 1KNAA 2K04A 5H1SE 3S1NB 3F2CA 1OXSC 1EWCA 1OXUA 2F0EA 2IHEA 3S24A 1OTCA 4PMCA 4QMGA 4F87A 3T56B 3U9SA 3JC66 3MA2B 1SMXA 3HOUH 1H9SA 3HS0C 1U4LA 3I8ZA 3PO2H 3JAME 2N8NA 5JPNC 4BY7G 2FHTA 2JN4A 3A0JA 2A5HA 4HIOA 3ONAB 2R7ZB 2VY3A 3SE0A 2B3GA 2EIFA 4RH6A 2UXCL 1EFID 2MFIA 1WD1A 4A3GB 1PRTD 2HDMA 2X6GA 1JORA 1K0SA 3VR3A 1XMOQ 5E3FA 1GVPA 4ID6A 5C4JB 3MFGA 1STBA 2IX0A 4DV0L 4LWCA 5J1ZA 2WAQG 3RUZA 2DNCA 1O78A 3D4RA 4KHVA 2K75A 3K81C 4N8FA 4C3IG 1KRTA 4DR7L 1EQVA 4KJOA 3F2DA 1QUQB 1AE3A 1H9KA 2WB1G 4DXFA 1I50B 3RD4A 3MXUA 1AEXA 4ZUIA 3A5ZB 4MNOA 1K3BC 1D5MC 4JW0A 5C4XB 2PZWA 4A3MH 1PRTC 4ZCKA 1MJCA 4OIJA 1CKOA 2F0WA 5C6AA 2R92B 3L7ZC 1MJEA 1T9HA 1YZ6A 4O0AA 4KN4C 2ZJRA 1ASZA 3T13A 1AW7A 1QB5D 1CKNA 1TWCB 2K33A 1VQJA 3MXNB 2L12A 2RCFA 4RCNA 2L1BA 3I73A 5C0XI 1SLJA 3PIOA 1E2ZA 4OIKA 5D65A 1Y1WG 2JE6I 3TZUA 1HNZL 4ZLTF 1MI2A 3RZOB 1TY0A 4BBRH 2K5HA 1EQRA 1EFWA 3TRZA 3A8KE 4KLKA 4MZ9A 1GD7A 1I6VC 1V43A 2F0JA 1WYDA 3H3VI 1JT8A 2D62A 4DNIA 1KRSA 3PUVA 4ZKBB 2B8GA 4DR6Q 1VQEA 5E4XA 2CHBD 3IKJA 4JBMA 3S1QH 1PFMA 4O1NA 3M7GA 1YEZA 1VQGA 3KDFA 2MJ8A 4DR4Q 1NY4A 1JWMD 1N33L 1Q12A 4MN3A 3OPOA 2GVAA 1IKLA 1PTOH 2FJ2A 1G51A 1EEID 3VDYA 2EJFC 4X6AH 2QEJC 4KHZA 5EKKA 4X3TA 2K5WA 3CPFA 3LWEA 5IYBH 2NTTA 1P16A 4OL7A 3P7JA 5M5XB 4FP5D 2B2YC 2JA8G 1K3RA 1Q1EA 2EY2A 1DGSA 4XQNA 1I4XA 2WAQE 3KYHC 2A19A 2M00A 4F88A 4A3LH 2ALYB 3GTOB 3BVGA 1K83H 2JA5B 3H3VC 1P8LA 1KABA 1VQAA 5HURA 4ZK9B 2N3SA 3PUZA 4CDDC 3BS1A 4JI6Q 2NTSA 1DXMA 3DHQA 1C7YA 1IBLQ 4GLVB 2AUJD 1NMFA 3DWAA 3P20A 4YWLA 2FMCA 3B6YA 4JPBW 1WTRA 5DNFA 2O2LD 3M7NA 4M8AA 2NWGA 4X64Q 1J5EQ 1RDPD 5D3DA 3GTPH 2K6AA 1GUGA 3STBD 4LFCQ 3OSOA 1TWAH 1HA5A 5K5PA 1VQNA 3RR5A 3S1NH 1HZBA 5C3EH 1WOCA 5HGQA 2C9OA 2PNHA 3SGIA 4OWXB 3W1GA 5C0XG 1WTVA 2F0GA 1FL0A 3T4AC 1DM0B 1KQSA 4LF8Q 3G6EA 4OWWB 2F0UA 2Z6BA 2PZUA 4BY1B 4DXGA 4AQYL 4FF3A 5IP9H 2F3VA 1FR3A 3TDQA 2NN6H 2ZJPA 1EY8A 4DFAA 4A3KB 2NVQH 5HY6A 1EYDA 1B3QA 1AZQA 1E0BA 1PYSB 3HKZB 2X6LA 5FJ8H 2R93G 1AN8A 1U0LA 4J1MA 4DAYB 5JEAH 2BA1A 4R9WA 2L11A 3FRPB 1SNDA 1JE4A 2UUBQ 4H02A 1Y8NB 4CDFC 2QGQA 1LTGD 1LTLA 1XTCD 1LTID 1QILA 2QA4A 1C48A 1ILQA 1QVCA 4A3FH 1UE5A 4J8QA 2ZTEA 1SDFA 2F0LA 2KHIA 5I9OA 2UXCQ 2VUMH 1OXTA 3QR8A 1SFOH 5EKIA 3EA6A 1Y1VH 5C4XH 1XMQQ 5I2XA 4RCOA 1EY9A 3HOXG 3NQIA 4Y7NB 3HG9A 3Q8DA 1PH4A 3BZCA 2Q2TA 5IE8A 4DU9A 3HRZC 1PDQA 4XTCS 4R4CA 4DR7Q 1JC7A 4X66Q 2BE5D 1KDAA 1STYA 1TWCH 3AFQA 4KV6A 4CKCA 3NEMA 1MIUA 1VF5C 2SEBD 4G7HC 1B4OA 3CC4A 4R4IA 1JOOA 5IGBA 3WOEA 1A63A 1KDCA 1ZYRD 1Y69U 2IL8A 3KOJA 4GS3A 4QIWE 2NZOA 4NP5A 1K9MC 4G7ZC 4OX9L 1DOLA 2XGTA 3W3AA 3U58A 3JAML 1A3TA 3M4QA 1RCVD 1SAPA 2L0CA 4X65Q 4JI7Q 1IBML 2E8GA 3GTKH 4PZ7A 2B2YA 3AFPA 1R4QB 3S1MH 2FXQA 1F9QA 2BE5C 3O13A 2EYLA 3R3OA 4K2KA 1QWYA 2XTIA 3H09A 2NVTH 4UP7A 2YV5A 3GTJH 3CRKC 1IL2A 3I4MG 1FGBD 4EQ5A 1KAWA 1SYDA 2MUYA 3SK8A 4DR1L 2E76C 3H0GG 4JI5L 1HNZQ 2LFNA 4OO1I 1WVLA 3CC2A 4HMIA 2G5DA 3FDTA 1ZYRC 5CV7A 3URYA 1I4RA 1U4PA 3FVQA 5KIXA 3FKIG 4FVMA 3KF6A 5DM63 1EWHA 4A93H 2EYJA 2R7FA 4RMFA 4A3DB 1YI2A 4JI3L 4DUZL 4GN3B 4N9TA 3KK7A 3MAQA 2B63B 3HOWH 5CV9A 3CQZB 5M5XH 4DK0A 2D0PA 2CWAA 3J81c 4JI0L 1PVOA 5LMUL 3FHWA 4K8JA 1GHJA 4JBJA 3P75A 2NVYH 4B9WA 2NVXH 2K1BA 4GKKL 1N8RC 3GTOH 4LFAQ 4EVOA 4G57A 4DUYQ 3D4WA 3CAMA 3SK6A 1AE2A 1ESRA 4ABNA 3OYYA 4K0KQ 3LGJA 4QGUA 1D7QA 1LTSD 4R4QA 3LX0A 4LF5L 4OWTB 3TZDA 3J81E 4P2CB 3I7FA 5FO9B 1M1KC 1VDZA 1HRJA 1ICFB 4JI4L 2K03A 1SEBD 1TWGH 1ZEQX 1Z7TA 3PUXA 1YNXA 1VQIA 4ULLA 2BDOA 1X3EA 4RHRA 4HCEA 4CJ0B 3T51B 4Q5VA 1E2VA 2PCFB 3PO3H 2F03A 3K5NA 2HD3A 4NXNL 4P75A 1A3VA 4DV5L 4ZQ3A 1LM0A 4PV1C 2A6HD 1HCZA 1IXRA 4XYOA 5ELDA 4BY1H 2DJGC 2QEXA 1LUZA 3TP5A 3KFUA 2L5TA 4A3KH 2YTVA 2XNAC 1SNOA 2WKCA 1CHQD 2AHOB 2BH2A 3P1HA 3PO2B 4QCLA 2PI2A 3AYHB 3EVQA 2A74C 1G6ZA 1E3PA 2EE1A 3CCVA 4A3JH 3I4NG 3PV0A 3M4YA 5CGKA 3HOYB 2R7DA 1HR0L 4OO1G 2NBFA 4GNXC 4HJ5A 5C5LA 4AQYQ 2A6HC 3OW2A 1OO9B 2B2TA 2EJGC 5GQOA 4JVZA 3CCEA 4CBVA 3G7LA 4JV5L 1SSOA 5JPMC 3SK4A 1NR2A 3A8IE 1HNXQ 2PI2E 5CBAE 2XN9C 3BZKA 2OQKA 3RLFA 1SJED 4OEMB 4RWSC 4Y7NH 4JG2A 1I3QH 2K5NA 2PNRC 4QF4A 3NELA 5KRUA 3CPWA 4LNQA 4A3MB 2EYMA 4JK1C 4RGOS 3NHHA 3FPPA 3I91A 2F52A 1OXXK 5GADC 2X69A 3NPPA 1BDOA 4QL5A 1D6EC 1WCMH 2AQ3B 5I6WA 4BBSG 2N55A 3WOFA 1GUNA 2PMZE 1JB3A 4DV1L 2B2UC 2YU9H 4RKLA 4A3BH 4YWMA 1DONA 3WDNA 1D1KA 4UPAA 5EPKA 3SEBA 3VR4A 4LFBL 3M4PA 1YJNA 2PQEA 1WJJA 4BBRB 3HOZG 2F0PA 2RDFA 5FKAC 2F4VL 1VQHA 1ENFA 4L5RC 3S2DB 2MHVA 2JA7G 2OTLA 3D6CA 3DEPA 3TBIB 4OX9Q 2Q8TA 3VR2A 1XPOA 3PUWA 4OELB 2H4OA 1HPCA 4RGMA 3S1QB 3EROA 2MQHA 1UE6A 1SJHD 1G2SA 1JOQA 1H95A 3A8JE 2YTYA 5M3FH 2I5LX 3F1ZA 3NSWA 2N49A 2B63H 2QDLA 1PTOB 4OGQC 3TP7A 1J6QA 2R7ZG 1SN8A 4HAEA 4IFDH 1WTPA 2QCPX 4IQZA 4LF7L 4A3GG 3M9BA 4YCVA 3BVZA 4I65A 2FFKB 3ULPA 2Q2IA 3UDGA 4LF9Q 3A74A 3CCQA 4X62L 2F0QA 3R8BA 2IJ0A 2K32A 5C0XJ 1F2ZA 2UXDL 2WINB 4K6DA 4JYAL 3CW2C 1LTBD 3PIP3 4IUTA 4A3EH 5AFWA 3KLRA 4YY3L 4WORA 1I5FA 4YHHL 5E7NA 5GROA 3J80E 4JI0Q 5LMUQ 4WJ3M 1EIHA 5LL6X 2K01A 3J7AV 2DY7A 4GKKQ 2B29A 2EOTA 4UP8A 5CMDA 2JSOA 1BVSA 4JC0A 2WIIB 1IBKL 4DF7A 2R92G 2PYKA 1MSGA 1JWSD 3S14H 3VYUA 1SE8A 2OT2A 3N52A 2DN8A 4IPCA 4ME5A 3GTPB 4LF5Q 2JQOA 4GNXA 2JXMB 3RN2A 2F1MA 5IYDG 2K7VA 1TY2A 5FO8B 1M90C 4JI4Q 1KDBA 3RN5A 5C3EB 1TKWB 2EZVA 2OF1A 1C4QA 4KY6A 4EQPA 3NK9A 2IWHA 1CI3M 1LLRD 2K5DA 3PUYA 1O7YA 1DZ1A 1E22A 1TWHH 2KJXA 3E6ZX 3R93A 4NXNQ 1KLGD 4DV5Q 2NVQB 1DCZA 3SXHA 2RKSA 1GUSA 5J3BA 1BQQT 2HIXA 3A7LA 3HOYH 1BNZA 2LXJA 1D1IA 3U4VA 2LKVA 3D0FA 4K8IA 1E1OA 1SYFA 1VMCA 5J22A 5IYCG 4QJFA 1M8AA 3KF8B 5ELOA 2E5LL 3S1RH 4APVA 3I4OA 4A3CH 1O7LA 4KJNA 4XQQA 2JA9A 4A3FB 3J81L 1L1OB 1HQRD 1I4QA 2GA4B 5C4HA 4HR7B 2VUMB 5C44H 2FMMA 1HR0Q 1I6HB 2CWPA 1SFOB 3A5UA 2K5VA 5IP7H 1Y1VB 2SOBA 1HNWL 4IO9A 5DLQE 4HJ8A 3X3MA 2E2JH 4F8MA 1U5KA 2JA5G 1YNJD 4HIMA 2O5JC 4LF4L 2GVBA 4IUPA 2K52A 2K5QA 3CD6A 2LXKA 4IN3A 4KKSA 3K0XA 4TRDA 3CHBD 5M3MH 4C3JH 2Q8IB 2JEBI 3D6WA 1I4PA 3J7AF 1X9NA 1BCPD 1E1TA 3LNNA 3N6RA 1D5XC 4KD3A 4L6TB 4N9PA 4L5QA 4DK1A 5K36H 1GXDC 2LY7A 3F2BA 4KTAA 3J7ZC 1MBYA 1Q82C 3M3YH 1GO3E 3IFDA 1C0AA 1Q1BA 2I0QA 1CKNB 5JJIA 3S2DH 4WJWA 4DN4M 1I94L 1YNJC 2KHSA 2A68D 2OWOA 3GTKB 1HFGA 3V05A 1LYLA 3S1MB 4LF6L 2VB3X 4DV1Q 3H6MA 2H5XA 4IZ8A 5BN5A 2UUCL 2NVTB 3GTJB 4CJ2C 1BR9A 5J39A 4LFBQ 1BCPC 4A3IH 2AKWB 2UU9L 1X3PA 4BY1G 4X3KA 3I90A 4GLAC 4B9XA 2OEOA 4K5XA 1N34L 2F4VQ 2WACA 2ZXPA 2XSCA 1BUVT 4A93B 3HOVH 1YNND 5LMNL 2AQ1B 2F0FA 3J81i 1GUOA 1VS0A 2A68C 3MWYW 2UUAL 3S17H 3KDFB 3OTOL 3HOWB 2F0IA 4RGTA 1U4RA 4FNFA 2JA6H 2KCCA 4BXXG 3HKSA 1Q90A 4K2LA 1K73C 2Z6KA 3E0EA 4CJ1B 5IGGA 2NVYB 1NMGA 4YCWA 3VR5A 3E9IA 2NVXB 4V190 2EQSA 2F0HA 3DM3A 1VQMA 2F0MA 2CW0D 4NXMQ 2R61A 1EIFA 2HCIA 4LF7Q 1WTOA 1V1QA 4HJ9A 1BBXC 2DJFC 3PIPA 1Q8KA 2WB1E 1SNMA 2E74C 4JI2Q 1YNNC 4X62Q 1WTHA 4GKJL 1S5BD 1RIPA 1EOTA 3OIQA 5IT9c 1YITA 2UXDQ 1F9SA 1LT6D 1G8ZD 1Q86C 4JYAQ 4MTKA 5FLXc 4OXPA 4DV3Q 3ICEA 1TWGB 2WFWA 1JICA 4KY7A 3Q24A 4FF4A 5ELEA 4C2MH 4H0LC 1LT3D 1EZ8A 4UDUC 5A35A 2KENA 2CW0C 2ZM6L 1CA5A 1S5FD 4XXEA 2SDFA 1BKBA 3A54A 4DR3L 3PO3B 2NZHA 1ICWA 1QNKA 2QKIC 2NZ1D 4Z9CB 2R3ZA 3T16A 5IT9E 5FLMG 5JVG3 1E2WA 1CTMA 3NENA 5FLXE 2F0OA 1JMCA 2ATWA 4ZAIA 3BYYB 1V9PA 1O80A 3KJOA 4IUQA 4GZYC 2Y0SG 5EKLA 1QOHA 4PG3A 2KVMA 1FD7D 1F2LA 4L5TA 3AB9A 3C1FA 1TQOA 2DGYA 1H9RA 3BDCA 1ZKOA 3WWVA 4DAYA 1U4MA 4A3JB 1EIGA 3SDZA 5EBDA 1KHIA 3VYRA 2K50A 4PMBA 1B3AA 2TSSA 1NE3A 4DK6C 4A3DG 1QJOA 1XTDA 3J80L 2F0TA 3H94A 5EBCA 2ENBA 3S16H 1I6HH 1W2BA 5IGEA 1Q46A 1S5CD 4DPGA 3NTHA 3VA7A 4IUNA 4DV0Q 2PQAB 4KY5A 1IHZA 2RDGA 1PH8A 1S4ZA 1I3QB 2E5LQ 1KTKA 3MC0B 4C3HH 3GP7A 1EU3A 4TKOB 3IAYA 1A15A 1WI5A 2NYZD 1PH3A 4ZYSA 1D2BA 1PH1A 2Q2UA 1BCPB 1CSPA 2AMCB 1IW7D 1MKHA 1PTOF 1PZID 1RHPA 3C2PA 2XWBB 3MEFA 4JI1L 1RD9D 1FJGL 1HNWQ 2J4XA 1WCMB 4DKAC 2NUCA 1YHQA 3MZ5A 5I2YA 3AQQA 2YU9B 4A3BB 1UUPA 1GOZA 4IPGA 3OOCA 4LF4Q 4R8NA 1B9NA 1L0YB 4NKLA 1F2MA 3DEOA 1PLFA 2B2WC 5BR8L 4DV2L 4ODGA 4HSVA 3LWUA 1SNCA 2K05A 3NP8A 4B3ML 3VA5A 3C46A 4KKUA 1IW7C 1BBWA 5DAUA 1XNQL 2SNMA 4L8JA 4P74A 2L15A 4DV6L 4GOPB 4YCUA 4X3UA 2RBMA 2RHQB 2Z4HA 3GQBA 4BY7H 4JOIC 3M85A 2A6ED 1VQBA 1PZKD 5CV6A 3HOUG 1UWVA 4K14A 1L2FA 4DAVA 2VNUD 5M3FB 3J80i 4POGA 2Y0SE 2HDLA 3PO2G 3K80C 2R93B 3MHBA 4EQNA 3UDFA 2A1AA 3TP8A 4KN7C 3BJUA 1EL0A 3PF5A 2UU9Q 1BBUA 1PTOD 5C3XA 4I7ZC 3I3CA 2M9VA 3Q0AA 1N33Q 2L4NA 5DEHA 3TS2A 3DLLA 4C3IH 3TMEA 2BDNA 4YIJA 3SVMA 4PZ6A 2MO0A 1JJCB 4BWGB 2IX3A 2JJQA 4DK3C 1HFNA 5LMNQ 2OQ0A 2KUMA 5ELBA 4IALA 3EFXD 2A6EC 2EXDA 1EY6A 3W2DA 1W3SA 2WV6D 1V1OA 4PZ8A 1O7ZA 4A3EB 4H7BA 2VQFL 5IWAL 3CCJA 1GJXA 5JOBA 1S5ED 1NSNS 1STNA 3I2ZA 1B50A 1G291 2F0NA 4A3MG 1XPRA 1PFBA 1PTOC 2AWNA 5DM73 1GKHA 3JAMi 5L37A 1TXYA 2C35B 3S14B 3FEWX 2VQEL 3AU7A 2KHJA 2D9UA 3SR1A 3KJPA 1NR4A 5EPLA 4GKJQ 5IGFA 4AYBB 1Y1WH 3D3RA 5IODA 3UE1A 2ZXOA 5GAHC 4PQXA 1SNQA 3S2HH 5A2QE 2WKDA 2OCEA 4IURA 4BBRG 1RTOA 2ZM6Q 1D5ZC 2I46A 3V2TA 2NN6I 3MEHA 4DR3Q 1TWHB 2PW5A 3QB3A 1HZCA 3TREA 1TVXA 3EN2A 3PQIA 2E2HH 4ZRZA 5EGTA 1CFMA 4U673 1CZWA 2EY6A 3K7UC 4RHSA 1S72A 1EOVA 4ME3A 1JWUD 2ZXRA 2JK8A 3CCUA 2N88A 4KI0A 1EY4A 3GD7A 3S1RB 2D5DA 1U9RA 4XT1B 2O4XA 3RMHA 2JA8H 3GTMB 3OWEB 4TSSA 2HT1A 2GN5A 3K6OA 4FXGC 1Q8IA 2EY5A 5IYBG 1GHKA 5EJWA 3E0JA 5C44B 1ET6A 2PO4A 4UHVA 3QOJA 1VQ6A 1IZ6A 1GUTA 5I9PA 2J7ZA 3MTSA 4N8X1 2CCZA 1ILPA 1PA6A 1WD0A 3NWTA 5JJKA 1SROA 2VXWA 1JB7A 2E2JB 4A3LG 1PFNA 2K14A 2PMZB 5IT9L 2G9DA 3NQTA 4JOIA 1Y14B 3DXJC 5FLXL 5M3MB 5CV5A 4C3JB 1A0IA 5CBEE 4CDCC 2K4KA 4TQUS 1L1OC 3R2TA 4K5VA 2JYOA 3QO2A 2BA0A 1YIJA 2IHFA 3M3YB 1QE6A 3NBHA 1EY5A 1D8LA 4C1NI 2XRSD 3PIO3 2I5HA 1STGA 1NTGA 2CVRA 5C0XH 2KOLA 1VQDA 3A55A 1EU4A 2NB0A 3TN2A 4DR6L 1KL9A 3NE5B 3W1BA 1K8GA 5C3EG 2K28A 4DV4L 4DGZA 3T53B 1V1PA 1X6OA 3CC7A 2IPKD 2KECA 5CV8A 5JAVA 1IBMQ 4Q0FA 1DD2A 4A3IB 1YHBA 4YWKA 1G91A 1R9TH 1A6XA 4J6HA 5IP9G 3OMCA 2R93H 3K57A 2NN6G 4B3MQ 5GAGC 4IOCA 1VQFA 4DR1Q 3HOVB 5KGUA 1F2YA 3FPUB 2VB2X 1PH5A 4JI5Q 4KHPL 3TEHB 3DMUA 5FJ8G 4DV6Q 3RZDH 2MPMA 3S17B 4CDEC 5JEAG 4ZUJA 2JA6B 4IUUA 1EYCA 1RODA 4PNYA 4ALPA 1SMYD 3T1YL 1WTWA 3GTLB 1TS2A 1NBWA 4IPDA 5EQ0A 4DUZQ 1VQ9A 4JI3Q 2PW7A 4A3FG 1E7ZA 1SE3A 3M4OH 4HSPA 2IW3A 3X3NA 1RL2A 3HOXH 3OIPA 2VUMG 2EYHA 2QDBA 2JP1A 2HIVA 3DUZA 2ES2A 2I07B 1X56A 1PV4A 2PZTA 1SNPA 5LHY1 1Y1VG 5C4XG 1VF7A 3ERSX 3VYSA 4DAPA 1CT1D 2TMPA 1F9PA 3E9HA 1IYVA 3I55A 1XX8A 1FNUA 1J5EL 1L0WA 1SMYC 3CP0A 2MNAA 1EIYB 2VQFQ 4FDBA 2KA7A 5IWAQ 1B2TA 5KYLA 4C2MB 4NDXA 2CH4A 5ELCA 1G2TA 1X54A 4Y52H 1JQYD 4ILWA 1Z6HA 4LAAA 2RSNA 4EGVA 2QILA 1QZGA 1B44D 4LUOA 2ZTCA 2ZTDA 3IFTA 5ELFA 1W6JA 1CHPD 1YBYA 1EQQA 3TS0A 3RLNA 1VQ4A 3I4MH 3KLWA 3U4ZA 1BCPF 3H0GH 5IIFA 1CUKA 3HFZB 2ASBA 3QOLA 3ND8A 2XVSA 1DJRD 3QG1A 1JCKB 4IJLA 4KMUC 4AIMA 3KBGA 1QNUA 3OWFA 4FXDA 1RKNA 3FKIH 1ESFA 4B3SL 1H9SB 4OHJA 4WRDA 2UUBL 1DOKA 4POFA 1RJTA 3KF8A 2B2UA 1A3UA 4A93G 1KNEA 1PHJA 1BO0A 3T1HL 3GTMH 2HUGA 4DNTB 3MVVA 1QUQA 1L1OA 5M9OA 3S16B 2AWOA 3HOWG 1XMQL 1LT4D 2RF4A 4LK1C 1XNRL 1KC8C 2JEAI 2Q8RE 3OHXC 1ENAA 4NB3A 1NAPA 3K7AH 4JI8L 3A56A 5JJLA 2G9HD 5KNBA 3K58A 3H15A 4JV5Q 3MXGA 4C3HB 5M5YB 1WTXA 3F2UA 4X66L 1L0XB 3GO5A 4EQOA 2H1EA 4FYDA 1FVIA 1KIXA 3C3LA 1AH9A 1YVCA 3CCRA 4CHTB 3R2IA 3F8TA 3MXNA 3ITPA 1XYIA 1Z9FA 1A2UA 2CH4W 2Z1CA 1EUJA 2Z8LA 5A2QL 1UAPA 4B08A 2IX1A 4TVAB 3E5SA 3NTIA 4G7OC 1M4VA 4X65L 4NW2A 4JI7L 1JJ2A 1LO5D 5KYIA 4M1UB 5C4ZA 1A8VA 3VYTA 2CKZB 1STEA 2AUKA 3GV3A 2B8FA 1TT2A 3BDOA 3CF5A 3PO3G 2E2DC 3GTGH 3K5OA 1HTPA 1JJGA 4UAIA 4XT3B 1N32L 2VS1A 3BVMA 1LTTD 1UE7A 1KXLA 1CK1A 3J7A5 1S3OA 1SYCA 4DA2A 5BN3A 4BY7B 2RDHA 2L55A 5T1GA 4A3KG 1Y8PB 3K5LA 4MHEA 3I4NH 1NJIC 4L5SA 3HKZG 4IFDI 1BOSA 5BN4A 4DV4Q 4EX5A 4OO1H 4IUVA 4A76A 3CU7A 3CCSA 3AMUA 2R6GA 4A3JG 2WAQB 2EVBA 3K5MA 3GTLH 1PYBA 1PH2A 4LFAL 4DUYL 4C3IB 1HA6A 2AQ2B 5FO7B 1LACA 2Q2HA 3FMCA 3UI2A 2OXPA 2MP1A 3K8AA 3UE0A 4K0KL 2WB1B 1TR5A 5TSSA 2IT1A 5COYA 4KHPQ 5CC4A 2QF7A 3MFYA 4GOPC 1IYJB 1N36L 1B9MA 1EQTA 5D3IB 1J8IA 4KK7A 3T1YQ 1K28A 4CGYB 2XRQD 2KQ3A 3BG3A 3C1EA 5IGCA 1HQMC 4F7XA 1CQFA 5IY0A 5C5MA 1YJ9A 1I4HA 1UE1A 4YY3Q 5CR3A 1CKMA 4YHHQ 1TS5A 3L2PA 4BBSH 2V1CC 4NPSA 3L9AX 3U9OA 2J0TD 4H13C 3BU2A 1WCMG 3J81j 3DWQA 1FYCA 3IL8A 1IBKQ 3FP9A 1MGSA 1Y1WB 5FOBB 4CKBA 4NMZA 3S15H 1TS4A 2RCNA 4A3BG 4DAMA 2ZJQA 1WFQA 3HOZH 1RTNA 2VW9A 2RQXA 3S2HB 1IYUA 2F3IA 4UY8C 2JA7H 2IY5B 2ID0A 2DY8A 1FNWA 1TWFB 3OMGA 1VQPA 4FF1A 1X32A 2Z0SA 2HQLA 1LT5D 4A4IA 1NUCA 1QVFA 1UNSA 2E2HB 2HCCA 5E1FA 3S9WA 3K59A 3ZJYC 3Q22A 3D31A 3U50C 2QW7A 1YHAA 1QZHA 1HR0W 5I4DA 1PRTB 5KNCA 5C3WA 2R7ZH 1S5DD 2XWJB 1ENCA 1Q81C 2BH8A 5M3FG 1JOKA 3STBC 5JVH3 4A3GH 4KKTA 2XIWA 1EWIA 5EPJA 5E4WC 2B63G 2EYPA 4XIGS 1HNXL 5C4JH 2B2VC 4GN5A 4IFDG 3HKZE 3BDLA 4B3SQ 2JA8B 1HTLD 2E2IB 4GN4B 2EYFA 2PQAA 1A62A 3V96A 4O2DA 5IOCA 4B3TL 4FO2A 5M5YH 1Q3LA 1YJWA 4B3RL 3J7YW 4HIDA 3T1HQ 1I50H 2F0DA 4DR2L 1TS3A 1NNXA 4DV7L 2HHHL 1SE2A 2MO1A 4LUZA 1K8AC 4A3EG 1XNRQ 5M5WB 4R4TA 3SHLA 4QIWB 5CYUA 5CORA 3Q6SA 2C5CA 3ULJA 2R92H 4JI8Q 1RF2D 1F77A 4J15A 1TIID 2UXBL 5JEAJ 1QVGA 2M2LA 4P71A 1T5EA 5IYDH 1J9OA 4RG1A 1LABA 4HJ7A 1K8MA 1JE5A 2WP8J 1VCIA 4QQBX 4AYBG 1C8CA 2B2TC 5ELNA 3K0YA 1VMPA 2EXZA 3RZOH 1BXTA 3CKIB 1XPUA 4WFN3 4QUCA 3BZDB 4FXKC 5AJ3L 3EIVA 2EJMA 3H91A 4GOPA 1VQCA 1AP0A 1HJPA 1I4GA 3G71A 1A2TA 1HXYD 3KLSX 5I6YA 3CXCA 1TU2B 1O7IA 2Y0SB 1I94Q 3EBEA 4HEDA 4LF6Q 1HZ9A 1R9TB 1K8OA 3Q23A 2BCOA 1EY0A 2UUCQ 4V0BA 4R8IA 1N32Q 1SR3A 5CV4A 4O42A 2E75C 5IYCH 3HOYG 3ND9A 4LF9L 3RZDB 5KNDA 1VQ8A 1HUMA 1STHA 1MD2D 3KF6B 1N34Q 3I56A 3GTQB 1STAA 4FF2A 3SK5A 1OXVA 4X3SA 2N78A 3ER0A 4XQJA 1XJVA 4BA2I 4LUVA 1E24A 1H9JA 2VL6A 1ET9A 3NXWA 1PZJD 2UUAQ 4A3CG 1V8QA 1X65A 3CMEA 1S40A 2ZT9C 3GV6A 5T1IA 3OTOQ 4HN7A 1B8AA 1N9WA 1EYAA 1SBBB 4L63B 4A75A 3M4OB 3HOXB 1EY7A 3MXPA 5C44G 2Z4IA 2DNEA 3QWNA 3W5OA 5IP7G 4DR5L 2JA5H 2O5IC 1KD1C 2V4DA 1PXUA 3DWPA 3KBXA 3TQYA 4MTNA 4C1NK 2RHSB 5FK9C 1R4PB 1F9RA 5HGTA 1N36Q 4JBWA 3L3OC 3G48A 1HHVA 3I72A 5M3MG 4C3JG 3ULLA 1Z47A 2KCTA 3NUCA 3ZYYX 1T5XD 4QY7A 3EQLC 1HZAA 4LW1A 1WTQA 2BOSA
chains in the Genus database with same CATH topology
2QA4A 3T1YL 1Q82C 3M3YH 1GO3E 1C0AA 1QVCA 1Q1BA 4AH6A 1NBWA 4IPDA 4DUZQ 4A3FH 1VQ9A 1UE5A 1CKNB 2I0QA 4JI3Q 5JJIA 3UDIA 3S2DH 2ZTEA 4A3FG 2KHIA 4JCVE 1E7ZA 1I94L 4P72A 2UXCQ 2OWOA 2VUMH 1TWFH 1LYLA 1OXTA 3M4OH 4UP9A 4LF6L 1SFOH 4DV1Q 1RL2A 3HOXH 1XMQQ 1Y1VH 5C4XH 2VUMG 1G6PA 2H5XA 1K0RA 2HIVA 1CSQA 2ES2A 4AYBE 1X56A 1PV4A 2UUCL 3HOXG 1Y1VG 1SRUA 4IOAA 5C4XG 3Q8DA 1PH4A 3BZCA 3ERSX 2Q2TA 4LFBQ 5IE8A 4A3IH 2AKWB 1XMOL 2UU9L 4XTCS 4R4CA 4BY1G 1GM5A 3E9HA 3L0OA 4DR7Q 4GLAC 4A3IG 3I55A 4X66Q 1N34L 2F4VQ 1J5EL 1L0WA 1TWCH 3AFQA 3CP0A 1VQOA 3NEMA 2MNAA 1EIYB 1MIUA 4R4OA 3HOVH 3PF4A 2VQFQ 4FDBA 3CC4A 5IWAQ 5LMNL 4GLXA 4OONA 3J81i 3CCLA 4R4IA 3HOVG 1VS0A 2UUAL 4BXXH 3S17H 2E2IH 1X55A 3KDFB 3OTOL 1X54A 4Y52H 2JA6H 1A63A 5EAYA 3KOJA 4GS3A 4QIWE 4BXXG 2NZOA 4R1JA 1K9MC 3HKSA 4OX9L 2JA6G 1K73C 2Z6KA 2XGTA 3E0EA 1QZGA 3U58A 4P73A 3M4QA 1NMGA 4LUOA 2ZTCA 4YCWA 4WJ4A 2ZTDA 3E9IA 2D0OA 4X65Q 4JI7Q 2EQSA 3RLOA 3DM3A 2E8GA 1VQMA 4PZ7A 1PH9A 3AFPA 1IBML 3CCMA 3GTKH 2A8VA 3S1MH 1YBYA 2FXQA 4NXMQ 1UEBA 1EIFA 2CQOA 1EQQA 4LF7Q 3TS0A 5K36G 1V1QA 3RLNA 4HJ9A 1VQ4A 3I4MH 3KLWA 3UDXA 5M5WH 1VQ5A 3U4ZA 3H0GH 2XTIA 2ASBA 1CUKA 3HFZB 4UP7A 3PIPA 2YV5A 1Q8KA 2WB1E 3GTJH 1IL2A 4JI2Q 2NVTH 3I4MG 4EQ5A 4X62Q 1KAWA 4DR1L 3H0GG 4IJLA 4GKJL 4JI5L 1HNZQ 1RIPA 2KCMA 4AIMA 4OO1I 1YITA 5IT9c 3CC2A 4B3TQ 2UXDQ 3FKIH 4HIKA 4B3SL 1Q86C 4JYAQ 5FLXc 4OXPA 4B3RQ 4DV3Q 3ICEA 2LSSA 3FKIG 2UUBL 2WFWA 2OTJA 3KF6A 4DR2Q 4A93H 4POFA 4DV7Q 2HHHQ 2R7FA 4RMFA 2I5MX 1YI2A 4JI3L 4C2MH 2CFMA 4DUZL 4GN3B 4A93G 1PHJA 1B7YB 3T1HL 3GTMH 2KENA 1QUQA 3HOWH 1L1OA 4JI1Q 2ZM6L 1FJGQ 5M5XH 2D0PA 1BKBA 3PGZA 4DR3L 2CWAA 1B70B 2NZHA 2AWOA 4IJHA 5FLMH 3J81c 1XMQL 4JI0L 3HOWG 1PVOA 4BA1I 2RF4A 3FHWA 5LMUL 3RNUA 1VQ7A 1XNRL 4JBJA 1KC8C 2NVYH 5FLMG 2JEAI 2UXBQ 2KBNA 4IPHA 2NVXH 4NB3A 3CMAA 4GKKL 3NENA 1N8RC 3K7AH 4LFAQ 1X3GA 3GTOH 4DUYQ 4JI8L 1JMCA 4DR4L 3CAMA 5JJLA 2ATWA 1AE2A 3NBHB 3H15A 4JV5Q 1V9PA 3OYYA 3KJOA 4K0KQ 4X66L 3GO5A 2Y0SG 3LGJA 5BR8Q 4QGUA 4DV2Q 1D7QA 1FVIA 4PG3A 1KIXA 1AH9A 4R4QA 1YVCA 3CCRA 3H3VH 1Q7YC 4LF5L 3F8TA 4L5TA 4OWTB 2DGYA 4PMWA 1XNQQ 1Z9FA 3I7FA 1M1KC 5LMNW 3WWVA 5AJ3Q 1EUJA 4HJAA 4JI4L 1X3FA 2YTXA 1TWGH 1VQLA 3GTQH 1KHIA 3PUXA 4TVAB 2K50A 2IX1A 4A3DH 1YNXA 1C9OA 1NE3A 1VQIA 4DK6C 1X3EA 4A3DG 1XTDA 4X65L 4JI7L 1VQKA 1JJ2A 3CQZH 4JBKA 1A8VA 3S16H 4NXML 2CKZB 3PO3H 3GDEA 2DUDA 3J80c 3AEVA 1I6HH 3CF5A 4NXNL 1W2BA 4P75A 1Q46A 3PO3G 4DV5L 3PSIA 3GTGH 4JI6L 4DPGA 4JI2L 1LM0A 4DV0Q 2PQAB 1IBLL 1IXRA 1JJGA 5GAEC 1N32L 2VS1A 4BY1H 1PH8A 2QEXA 2E5LQ 1LUZA 1UE7A 1KXLA 4C3HH 3IRBA 3J7A5 1S3OA 4DV3L 3KFUA 4A3KH 2YTVA 4X64L 1WI5A 1PH3A 2VZAA 2AHOB 1PH1A 2Q2UA 2BH2A 4A3KG 1PH6A 1CSPA 2AMCB 4LFCL 2PI2A 3AYHB 3I4NH 1NJIC 1MKHA 4L5SA 1E3PA 1HH2P 3HKZG 4IFDI 1FGUA 3MEFA 4JI1L 3G4SA 1ASYA 1FJGL 4DV4Q 4EX5A 3CCVA 4A3JH 3I4NG 1HNWQ 4A76A 3PV0A 3CCSA 4DR5Q 2R6GA 2R7DA 4DKAC 1PH7A 1HR0L 4GNXC 4A3JG 4HJ5A 4OO1G 1YHQA 4IFDJ 4AQYQ 3AQQA 3GTLH 4IPGA 1PYBA 3OW2A 1PH2A 4LF4Q 4LF8L 4LFAL 4DUYL 1PFSA 2VQEQ 5GQOA 4GNXB 3CCEA 1EYGA 3JAMc 2YYZA 4JV5L 2Q2HA 4K0KL 3K8AA 3UE0A 2Z6KC 5BR8L 3PCOB 2IT1A 4DV2L 1HNXQ 4KHPQ 2PI2E 4GOPC 3BZKA 1IYJB 2OQKA 3RLFA 5H1SE 1N36L 4Y7NH 4JG2A 3F2CA 1OXSC 4B3ML 1BBWA 1XNQL 1I3QH 1OXUA 2IHEA 2K5NA 3S24A 3NELA 4P74A 2L15A 3CPWA 4DV6L 3T1YQ 1OTCA 4GOPB 4YCUA 4LNQA 3JC66 2RHQB 1SMXA 3HOUH 4BY7H 4JOIC 5IY0A 3M85A 1YJ9A 1VQBA 2F52A 1UE1A 4YY3Q 3HOUG 2N8NA 3PO2H 4BY7G 1OXXK 1UWVA 5GADC 1CKMA 1L2FA 4YHHQ 2VNUD 3A0JA 3J80i 4POGA 2Y0SE 3L2PA 4HIOA 4BBSH 3PO2G 2VY3A 3K80C 2B3GA 2EIFA 2V1CC 4QL5A 2UXCL 2MFIA 4NPSA 3UDFA 2A1AA 1WCMH 4BBSG 3BJUA 2PMZE 4DV1L 1XMOQ 3PF5A 2UU9Q 2YU9H 3BU2A 1GVPA 1BBUA 1WCMG 3J81j 4YWMA 1IBKQ 3FP9A 4A3BH 2IX0A 4DV0L 4LWCA 4UPAA 2WAQG 1N33Q 3S15H 3TS2A 3DLLA 2RCNA 4C3IH 4A3BG 4DAMA 2ZJQA 4LFBL 1WFQA 3HOZH 3M4PA 1YJNA 2K75A 4PZ6A 2MO0A 1JJCB 3K81C 1WJJA 2VW9A 2JJQA 4DK3C 1KRTA 3HOZG 4DR7L 5LMNQ 3F2DA 2OQ0A 1QUQB 2F3IA 4UY8C 1AE3A 2F4VL 1VQHA 2EXDA 4L5RC 2JA7H 2IY5B 2WB1G 1W3SA 4PZ8A 2ID0A 4ALPA 2JA7G 2OTLA 3A5ZB 4MNOA 2VQFL 1VQPA 5IWAL 3CCJA 4OX9Q 1XPOA 3PUWA 4A3MH 4LW1A 3I2ZA 2Z0SA 1MJCA 2HQLA 4A4IA 1G291 2MQHA 1UE6A 1QVFA 1XPRA 4A3MG 1CKOA 1H95A 2AWNA 3ZJYC 3D31A 3U50C 3L7ZC 1YHAA 1MJEA 1T9HA 1YZ6A 4O0AA 1GKHA 2YTYA 1QZHA 1HR0W 3JAMi 2I5LX 5M3FH 2ZJRA 1ASZA 1TXYA 2C35B 2R7ZH 3F1ZA 2N49A 2VQEL 1Q81C 2BH8A 5M3FG 3STBC 1CKNA 2B63H 4A3GH 2KHJA 1J6QA 1VQJA 1EWIA 3MXNB 1SN8A 3KJPA 2R7ZG 2B63G 4GKJQ 4XIGS 4LF7L 4A3GG 1HNXL 3M9BA 4GN5A 5C4JH 1Y1WH 4YCVA 3HKZE 5C0XI 4IFDG 1SLJA 3ULPA 2Q2IA 3PIOA 3UDGA 4B3SQ 3UE1A 4LF9Q 3A74A 4GN4B 4X62L 3CCQA 1Y1WG 2JE6I 2PQAA 1HNZL 5GAHC 1A62A 5C0XJ 4O2DA 4B3TL 2UXDL 4BBRH 2K5HA 1EQRA 1EFWA 5M5YH 3S2HH 1YJWA 3TRZA 4JYAL 4KLKA 3CW2C 4MZ9A 2OCEA 4BBRG 4HIDA 3T1HQ 4B3RL 1I50H 4DR2L 1GD7A 2ZM6Q 4A3EH 4DV7L 1V43A 2HHHL 2MO1A 2NN6I 4YY3L 1I5FA 4LUZA 1K8AC 4DR3Q 1WYDA 4YHHL 3H3VI 1JT8A 2D62A 5E7NA 1KRSA 5GROA 4DNIA 5LMUQ 4A3EG 3PUVA 4JI0Q 4DR6Q 4WJ3M 1XNRQ 1HZCA 1VQEA 3TREA 4JBMA 3S1QH 4R4TA 3EN2A 2E2HH 1YEZA 4GKKQ 1VQGA 2B29A 3KDFA 4UP8A 3ULJA 1BVSA 4JC0A 4JI8Q 2R92H 4DR4Q 1IBKL 1NY4A 4J15A 3K7UC 1S72A 2UXBL 1EOVA 1N33L 1Q12A 2R92G 5JEAJ 3S14H 4ME3A 1QVGA 1SE8A 2GVAA 4P71A 1G51A 2JK8A 4IPCA 5IYDH 3CCUA 4RG1A 3VDYA 4KI0A 4HJ7A 4LF5Q 2JQOA 4X6AH 4GNXA 1JE5A 4KHZA 2WP8J 3GD7A 5IYDG 3RN2A 1VCIA 3CPFA 5IYBH 2JA8H 4QQBX 4AYBG 1P16A 2HT1A 1M90C 2GN5A 5ELNA 4JI4Q 3RN5A 5IYBG 2JA8G 3RZOH 1K3RA 1XPUA 1Q1EA 1DGSA 1VQ6A 5AJ3L 3EIVA 1IZ6A 4GOPA 1VQCA 2WAQE 3KYHC 1HJPA 3G71A 2CCZA 2A19A 1PA6A 4A3LH 2ALYB 3CXCA 1K83H 5JJKA 1SROA 1O7IA 1I94Q 1JB7A 3PUYA 4A3LG 1E22A 1TWHH 3EBEA 1P8LA 4LF6Q 1HZ9A 1VQAA 4NXNQ 2K14A 2N3SA 3PUZA 4DV5Q 4JI6Q 5J3BA 2UUCQ 2HIXA 4JOIA 1C7YA 1IBLQ 3HOYH 1N32Q 1Y14B 1SR3A 4GLVB 1NMFA 2LXJA 4YWLA 5IYCH 3B6YA 1A0IA 3HOYG 3U4VA 4LF9L 2K4KA 3D0FA 1VQ8A 3M7NA 1E1OA 1L1OC 4TQUS 3KF6B 5IYCG 4X64Q 1N34Q 3I56A 1J5EQ 4QJFA 3GTPH 3KF8B 5ELOA 2E5LL 2BA0A 3S1RH 1OXVA 4APVA 3STBD 2IHFA 2N78A 3ER0A 3I4OA 1YIJA 1XJVA 4LUVA 4LFCQ 1E24A 4BA2I 4A3CH 1TWAH 2JA9A 2VL6A 1L1OB 1VQNA 1D8LA 3RR5A 2UUAQ 3S1NH 1X65A 1HZBA 2I5HA 3CMEA 1S40A 4A3CG 3OTOQ 1NTGA 5C3EH 1WOCA 5C44H 1B8AA 1VQDA 1N9WA 5HGQA 1HR0Q 3SGIA 2PNHA 4A75A 4DR6L 1KL9A 2CWPA 4OWXB 3W1BA 3W1GA 5C3EG 2K5VA 5IP7H 5C0XG 3A5UA 1K8GA 5C44G 1FL0A 4DV4L 1HNWL 1KQSA 4IO9A 5DLQE 3W5OA 4LF8Q 3G6EA 1X6OA 5IP7G 3CC7A 4DR5L 2JA5H 4OWWB 4HJ8A 1KD1C 2E2JH 1IBMQ 3TQYA 1U5KA 4AQYL 1YHBA 4MTNA 2JA5G 5IP9H 4YWKA 1R9TH 4HIMA 4LF4L 2RHSB 2ZJPA 2NVQH 2GVBA 2K52A 5IP9G 3CD6A 2LXKA 5HY6A 2R93H 1N36Q 4JBWA 2NN6G 4B3MQ 5GAGC 3K0XA 1PYSB 4IOCA 5FJ8H 1VQFA 4DR1Q 5M3MH 2R93G 4C3JH 1PH5A 4JI5Q 2JEBI 4KHPL 3G48A 1U0LA 3TEHB 4DAYB 1X9NA 2BA1A 5FJ8G 4DV6Q 1E1TA 3RZDH 5M3MG 3ULLA 1Z47A 2KCTA 5JEAG 4L5QA 2UUBQ 4H02A 4QY7A 3F2BA 1HZAA 2QGQA 1LTLA 3J7ZC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QA4 A;  3T1Y L;  1Q82 C;  3M3Y H;  1GO3 E;  1C0A A;  1QVC A;  1Q1B A;  4AH6 A;  1NBW A;  4IPD A;  4DUZ Q;  4A3F H;  1VQ9 A;  1UE5 A;  1CKN B;  2I0Q A;  4JI3 Q;  5JJI A;  3UDI A;  3S2D H;  2ZTE A;  4A3F G;  2KHI A;  4JCV E;  1E7Z A;  1I94 L;  4P72 A;  2UXC Q;  2OWO A;  2VUM H;  1TWF H;  1LYL A;  1OXT A;  3M4O H;  4UP9 A;  4LF6 L;  1SFO H;  4DV1 Q;  1RL2 A;  3HOX H;  1XMQ Q;  1Y1V H;  5C4X H;  2VUM G;  1G6P A;  2H5X A;  1K0R A;  2HIV A;  1CSQ A;  2ES2 A;  4AYB E;  1X56 A;  1PV4 A;  2UUC L;  3HOX G;  1Y1V G;  1SRU A;  4IOA A;  5C4X G;  3Q8D A;  1PH4 A;  3BZC A;  3ERS X;  2Q2T A;  4LFB Q;  5IE8 A;  4A3I H;  2AKW B;  1XMO L;  2UU9 L;  4XTC S;  4R4C A;  4BY1 G;  1GM5 A;  3E9H A;  3L0O A;  4DR7 Q;  4GLA C;  4A3I G;  3I55 A;  4X66 Q;  1N34 L;  2F4V Q;  1J5E L;  1L0W A;  1TWC H;  3AFQ A;  3CP0 A;  1VQO A;  3NEM A;  2MNA A;  1EIY B;  1MIU A;  4R4O A;  3HOV H;  3PF4 A;  2VQF Q;  4FDB A;  3CC4 A;  5IWA Q;  5LMN L;  4GLX A;  4OON A;  3J81 i;  3CCL A;  4R4I A;  3HOV G;  1VS0 A;  2UUA L;  4BXX H;  3S17 H;  2E2I H;  1X55 A;  3KDF B;  3OTO L;  1X54 A;  4Y52 H;  2JA6 H;  1A63 A;  5EAY A;  3KOJ A;  4GS3 A;  4QIW E;  4BXX G;  2NZO A;  4R1J A;  1K9M C;  3HKS A;  4OX9 L;  2JA6 G;  1K73 C;  2Z6K A;  2XGT A;  3E0E A;  1QZG A;  3U58 A;  4P73 A;  3M4Q A;  1NMG A;  4LUO A;  2ZTC A;  4YCW A;  4WJ4 A;  2ZTD A;  3E9I A;  2D0O A;  4X65 Q;  4JI7 Q;  2EQS A;  3RLO A;  3DM3 A;  2E8G A;  1VQM A;  4PZ7 A;  1PH9 A;  3AFP A;  1IBM L;  3CCM A;  3GTK H;  2A8V A;  3S1M H;  1YBY A;  2FXQ A;  4NXM Q;  1UEB A;  1EIF A;  2CQO A;  1EQQ A;  4LF7 Q;  3TS0 A;  5K36 G;  1V1Q A;  3RLN A;  4HJ9 A;  1VQ4 A;  3I4M H;  3KLW A;  3UDX A;  5M5W H;  1VQ5 A;  3U4Z A;  3H0G H;  2XTI A;  2ASB A;  1CUK A;  3HFZ B;  4UP7 A;  3PIP A;  2YV5 A;  1Q8K A;  2WB1 E;  3GTJ H;  1IL2 A;  4JI2 Q;  2NVT H;  3I4M G;  4EQ5 A;  4X62 Q;  1KAW A;  4DR1 L;  3H0G G;  4IJL A;  4GKJ L;  4JI5 L;  1HNZ Q;  1RIP A;  2KCM A;  4AIM A;  4OO1 I;  1YIT A;  5IT9 c;  3CC2 A;  4B3T Q;  2UXD Q;  3FKI H;  4HIK A;  4B3S L;  1Q86 C;  4JYA Q;  5FLX c;  4OXP A;  4B3R Q;  4DV3 Q;  3ICE A;  2LSS A;  3FKI G;  2UUB L;  2WFW A;  2OTJ A;  3KF6 A;  4DR2 Q;  4A93 H;  4POF A;  4DV7 Q;  2HHH Q;  2R7F A;  4RMF A;  2I5M X;  1YI2 A;  4JI3 L;  4C2M H;  2CFM A;  4DUZ L;  4GN3 B;  4A93 G;  1PHJ A;  1B7Y B;  3T1H L;  3GTM H;  2KEN A;  1QUQ A;  3HOW H;  1L1O A;  4JI1 Q;  2ZM6 L;  1FJG Q;  5M5X H;  2D0P A;  1BKB A;  3PGZ A;  4DR3 L;  2CWA A;  1B70 B;  2NZH A;  2AWO A;  4IJH A;  5FLM H;  3J81 c;  1XMQ L;  4JI0 L;  3HOW G;  1PVO A;  4BA1 I;  2RF4 A;  3FHW A;  5LMU L;  3RNU A;  1VQ7 A;  1XNR L;  4JBJ A;  1KC8 C;  2NVY H;  5FLM G;  2JEA I;  2UXB Q;  2KBN A;  4IPH A;  2NVX H;  4NB3 A;  3CMA A;  4GKK L;  3NEN A;  1N8R C;  3K7A H;  4LFA Q;  1X3G A;  3GTO H;  4DUY Q;  4JI8 L;  1JMC A;  4DR4 L;  3CAM A;  5JJL A;  2ATW A;  1AE2 A;  3NBH B;  3H15 A;  4JV5 Q;  1V9P A;  3OYY A;  3KJO A;  4K0K Q;  4X66 L;  3GO5 A;  2Y0S G;  3LGJ A;  5BR8 Q;  4QGU A;  4DV2 Q;  1D7Q A;  1FVI A;  4PG3 A;  1KIX A;  1AH9 A;  4R4Q A;  1YVC A;  3CCR A;  3H3V H;  1Q7Y C;  4LF5 L;  3F8T A;  4L5T A;  4OWT B;  2DGY A;  4PMW A;  1XNQ Q;  1Z9F A;  3I7F A;  1M1K C;  5LMN W;  3WWV A;  5AJ3 Q;  1EUJ A;  4HJA A;  4JI4 L;  1X3F A;  2YTX A;  1TWG H;  1VQL A;  3GTQ H;  1KHI A;  3PUX A;  4TVA B;  2K50 A;  2IX1 A;  4A3D H;  1YNX A;  1C9O A;  1NE3 A;  1VQI A;  4DK6 C;  1X3E A;  4A3D G;  1XTD A;  4X65 L;  4JI7 L;  1VQK A;  1JJ2 A;  3CQZ H;  4JBK A;  1A8V A;  3S16 H;  4NXM L;  2CKZ B;  3PO3 H;  3GDE A;  2DUD A;  3J80 c;  3AEV A;  1I6H H;  3CF5 A;  4NXN L;  1W2B A;  4P75 A;  1Q46 A;  3PO3 G;  4DV5 L;  3PSI A;  3GTG H;  4JI6 L;  4DPG A;  4JI2 L;  1LM0 A;  4DV0 Q;  2PQA B;  1IBL L;  1IXR A;  1JJG A;  5GAE C;  1N32 L;  2VS1 A;  4BY1 H;  1PH8 A;  2QEX A;  2E5L Q;  1LUZ A;  1UE7 A;  1KXL A;  4C3H H;  3IRB A;  3J7A 5;  1S3O A;  4DV3 L;  3KFU A;  4A3K H;  2YTV A;  4X64 L;  1WI5 A;  1PH3 A;  2VZA A;  2AHO B;  1PH1 A;  2Q2U A;  2BH2 A;  4A3K G;  1PH6 A;  1CSP A;  2AMC B;  4LFC L;  2PI2 A;  3AYH B;  3I4N H;  1NJI C;  1MKH A;  4L5S A;  1E3P A;  1HH2 P;  3HKZ G;  4IFD I;  1FGU A;  3MEF A;  4JI1 L;  3G4S A;  1ASY A;  1FJG L;  4DV4 Q;  4EX5 A;  3CCV A;  4A3J H;  3I4N G;  1HNW Q;  4A76 A;  3PV0 A;  3CCS A;  4DR5 Q;  2R6G A;  2R7D A;  4DKA C;  1PH7 A;  1HR0 L;  4GNX C;  4A3J G;  4HJ5 A;  4OO1 G;  1YHQ A;  4IFD J;  4AQY Q;  3AQQ A;  3GTL H;  4IPG A;  1PYB A;  3OW2 A;  1PH2 A;  4LF4 Q;  4LF8 L;  4LFA L;  4DUY L;  1PFS A;  2VQE Q;  5GQO A;  4GNX B;  3CCE A;  1EYG A;  3JAM c;  2YYZ A;  4JV5 L;  2Q2H A;  4K0K L;  3K8A A;  3UE0 A;  2Z6K C;  5BR8 L;  3PCO B;  2IT1 A;  4DV2 L;  1HNX Q;  4KHP Q;  2PI2 E;  4GOP C;  3BZK A;  1IYJ B;  2OQK A;  3RLF A;  5H1S E;  1N36 L;  4Y7N H;  4JG2 A;  3F2C A;  1OXS C;  4B3M L;  1BBW A;  1XNQ L;  1I3Q H;  1OXU A;  2IHE A;  2K5N A;  3S24 A;  3NEL A;  4P74 A;  2L15 A;  3CPW A;  4DV6 L;  3T1Y Q;  1OTC A;  4GOP B;  4YCU A;  4LNQ A;  3JC6 6;  2RHQ B;  1SMX A;  3HOU H;  4BY7 H;  4JOI C;  5IY0 A;  3M85 A;  1YJ9 A;  1VQB A;  2F52 A;  1UE1 A;  4YY3 Q;  3HOU G;  2N8N A;  3PO2 H;  4BY7 G;  1OXX K;  1UWV A;  5GAD C;  1CKM A;  1L2F A;  4YHH Q;  2VNU D;  3A0J A;  3J80 i;  4POG A;  2Y0S E;  3L2P A;  4HIO A;  4BBS H;  3PO2 G;  2VY3 A;  3K80 C;  2B3G A;  2EIF A;  2V1C C;  4QL5 A;  2UXC L;  2MFI A;  4NPS A;  3UDF A;  2A1A A;  1WCM H;  4BBS G;  3BJU A;  2PMZ E;  4DV1 L;  1XMO Q;  3PF5 A;  2UU9 Q;  2YU9 H;  3BU2 A;  1GVP A;  1BBU A;  1WCM G;  3J81 j;  4YWM A;  1IBK Q;  3FP9 A;  4A3B H;  2IX0 A;  4DV0 L;  4LWC A;  4UPA A;  2WAQ G;  1N33 Q;  3S15 H;  3TS2 A;  3DLL A;  2RCN A;  4C3I H;  4A3B G;  4DAM A;  2ZJQ A;  4LFB L;  1WFQ A;  3HOZ H;  3M4P A;  1YJN A;  2K75 A;  4PZ6 A;  2MO0 A;  1JJC B;  3K81 C;  1WJJ A;  2VW9 A;  2JJQ A;  4DK3 C;  1KRT A;  3HOZ G;  4DR7 L;  5LMN Q;  3F2D A;  2OQ0 A;  1QUQ B;  2F3I A;  4UY8 C;  1AE3 A;  2F4V L;  1VQH A;  2EXD A;  4L5R C;  2JA7 H;  2IY5 B;  2WB1 G;  1W3S A;  4PZ8 A;  2ID0 A;  4ALP A;  2JA7 G;  2OTL A;  3A5Z B;  4MNO A;  2VQF L;  1VQP A;  5IWA L;  3CCJ A;  4OX9 Q;  1XPO A;  3PUW A;  4A3M H;  4LW1 A;  3I2Z A;  2Z0S A;  1MJC A;  2HQL A;  4A4I A;  1G29 1;  2MQH A;  1UE6 A;  1QVF A;  1XPR A;  4A3M G;  1CKO A;  1H95 A;  2AWN A;  3ZJY C;  3D31 A;  3U50 C;  3L7Z C;  1YHA A;  1MJE A;  1T9H A;  1YZ6 A;  4O0A A;  1GKH A;  2YTY A;  1QZH A;  1HR0 W;  3JAM i;  2I5L X;  5M3F H;  2ZJR A;  1ASZ A;  1TXY A;  2C35 B;  2R7Z H;  3F1Z A;  2N49 A;  2VQE L;  1Q81 C;  2BH8 A;  5M3F G;  3STB C;  1CKN A;  2B63 H;  4A3G H;  2KHJ A;  1J6Q A;  1VQJ A;  1EWI A;  3MXN B;  1SN8 A;  3KJP A;  2R7Z G;  2B63 G;  4GKJ Q;  4XIG S;  4LF7 L;  4A3G G;  1HNX L;  3M9B A;  4GN5 A;  5C4J H;  1Y1W H;  4YCV A;  3HKZ E;  5C0X I;  4IFD G;  1SLJ A;  3ULP A;  2Q2I A;  3PIO A;  3UDG A;  4B3S Q;  3UE1 A;  4LF9 Q;  3A74 A;  4GN4 B;  4X62 L;  3CCQ A;  1Y1W G;  2JE6 I;  2PQA A;  1HNZ L;  5GAH C;  1A62 A;  5C0X J;  4O2D A;  4B3T L;  2UXD L;  4BBR H;  2K5H A;  1EQR A;  1EFW A;  5M5Y H;  3S2H H;  1YJW A;  3TRZ A;  4JYA L;  4KLK A;  3CW2 C;  4MZ9 A;  2OCE A;  4BBR G;  4HID A;  3T1H Q;  4B3R L;  1I50 H;  4DR2 L;  1GD7 A;  2ZM6 Q;  4A3E H;  4DV7 L;  1V43 A;  2HHH L;  2MO1 A;  2NN6 I;  4YY3 L;  1I5F A;  4LUZ A;  1K8A C;  4DR3 Q;  1WYD A;  4YHH L;  3H3V I;  1JT8 A;  2D62 A;  5E7N A;  1KRS A;  5GRO A;  4DNI A;  5LMU Q;  4A3E G;  3PUV A;  4JI0 Q;  4DR6 Q;  4WJ3 M;  1XNR Q;  1HZC A;  1VQE A;  3TRE A;  4JBM A;  3S1Q H;  4R4T A;  3EN2 A;  2E2H H;  1YEZ A;  4GKK Q;  1VQG A;  2B29 A;  3KDF A;  4UP8 A;  3ULJ A;  1BVS A;  4JC0 A;  4JI8 Q;  2R92 H;  4DR4 Q;  1IBK L;  1NY4 A;  4J15 A;  3K7U C;  1S72 A;  2UXB L;  1EOV A;  1N33 L;  1Q12 A;  2R92 G;  5JEA J;  3S14 H;  4ME3 A;  1QVG A;  1SE8 A;  2GVA A;  4P71 A;  1G51 A;  2JK8 A;  4IPC A;  5IYD H;  3CCU A;  4RG1 A;  3VDY A;  4KI0 A;  4HJ7 A;  4LF5 Q;  2JQO A;  4X6A H;  4GNX A;  1JE5 A;  4KHZ A;  2WP8 J;  3GD7 A;  5IYD G;  3RN2 A;  1VCI A;  3CPF A;  5IYB H;  2JA8 H;  4QQB X;  4AYB G;  1P16 A;  2HT1 A;  1M90 C;  2GN5 A;  5ELN A;  4JI4 Q;  3RN5 A;  5IYB G;  2JA8 G;  3RZO H;  1K3R A;  1XPU A;  1Q1E A;  1DGS A;  1VQ6 A;  5AJ3 L;  3EIV A;  1IZ6 A;  4GOP A;  1VQC A;  2WAQ E;  3KYH C;  1HJP A;  3G71 A;  2CCZ A;  2A19 A;  1PA6 A;  4A3L H;  2ALY B;  3CXC A;  1K83 H;  5JJK A;  1SRO A;  1O7I A;  1I94 Q;  1JB7 A;  3PUY A;  4A3L G;  1E22 A;  1TWH H;  3EBE A;  1P8L A;  4LF6 Q;  1HZ9 A;  1VQA A;  4NXN Q;  2K14 A;  2N3S A;  3PUZ A;  4DV5 Q;  4JI6 Q;  5J3B A;  2UUC Q;  2HIX A;  4JOI A;  1C7Y A;  1IBL Q;  3HOY H;  1N32 Q;  1Y14 B;  1SR3 A;  4GLV B;  1NMF A;  2LXJ A;  4YWL A;  5IYC H;  3B6Y A;  1A0I A;  3HOY G;  3U4V A;  4LF9 L;  2K4K A;  3D0F A;  1VQ8 A;  3M7N A;  1E1O A;  1L1O C;  4TQU S;  3KF6 B;  5IYC G;  4X64 Q;  1N34 Q;  3I56 A;  1J5E Q;  4QJF A;  3GTP H;  3KF8 B;  5ELO A;  2E5L L;  2BA0 A;  3S1R H;  1OXV A;  4APV A;  3STB D;  2IHF A;  2N78 A;  3ER0 A;  3I4O A;  1YIJ A;  1XJV A;  4LUV A;  4LFC Q;  1E24 A;  4BA2 I;  4A3C H;  1TWA H;  2JA9 A;  2VL6 A;  1L1O B;  1VQN A;  1D8L A;  3RR5 A;  2UUA Q;  3S1N H;  1X65 A;  1HZB A;  2I5H A;  3CME A;  1S40 A;  4A3C G;  3OTO Q;  1NTG A;  5C3E H;  1WOC A;  5C44 H;  1B8A A;  1VQD A;  1N9W A;  5HGQ A;  1HR0 Q;  3SGI A;  2PNH A;  4A75 A;  4DR6 L;  1KL9 A;  2CWP A;  4OWX B;  3W1B A;  3W1G A;  5C3E G;  2K5V A;  5IP7 H;  5C0X G;  3A5U A;  1K8G A;  5C44 G;  1FL0 A;  4DV4 L;  1HNW L;  1KQS A;  4IO9 A;  5DLQ E;  3W5O A;  4LF8 Q;  3G6E A;  1X6O A;  5IP7 G;  3CC7 A;  4DR5 L;  2JA5 H;  4OWW B;  4HJ8 A;  1KD1 C;  2E2J H;  1IBM Q;  3TQY A;  1U5K A;  4AQY L;  1YHB A;  4MTN A;  2JA5 G;  5IP9 H;  4YWK A;  1R9T H;  4HIM A;  4LF4 L;  2RHS B;  2ZJP A;  2NVQ H;  2GVB A;  2K52 A;  5IP9 G;  3CD6 A;  2LXK A;  5HY6 A;  2R93 H;  1N36 Q;  4JBW A;  2NN6 G;  4B3M Q;  5GAG C;  3K0X A;  1PYS B;  4IOC A;  5FJ8 H;  1VQF A;  4DR1 Q;  5M3M H;  2R93 G;  4C3J H;  1PH5 A;  4JI5 Q;  2JEB I;  4KHP L;  3G48 A;  1U0L A;  3TEH B;  4DAY B;  1X9N A;  2BA1 A;  5FJ8 G;  4DV6 Q;  1E1T A;  3RZD H;  5M3M G;  3ULL A;  1Z47 A;  2KCT A;  5JEA G;  4L5Q A;  2UUB Q;  4H02 A;  4QY7 A;  3F2B A;  1HZA A;  2QGQ A;  1LTL A;  3J7Z C; 
#chains in the Genus database with same CATH topology
 3BYT B;  2B2V A;  3TSS A;  5K36 G;  4AH6 A;  3I70 A;  3UDI A;  4LMQ D;  1SYG A;  4JCV E;  5G3L F;  3NWS A;  4P72 A;  4E6I A;  1TWF H;  4UP9 A;  1B1Z A;  2F3W A;  1SE4 A;  2HQE A;  2KCN A;  1G6P A;  3ERQ A;  3I4M B;  1K0R A;  1CSQ A;  1CZG A;  4AYB E;  3H0G B;  4IOA A;  1SRU A;  3PMF A;  2L9H A;  1XMO L;  1QG7 A;  1HUN A;  1GM5 A;  3L0O A;  3FKI B;  4U68 A;  4A3I G;  3HOU B;  1W6K A;  2ICE C;  1VQO A;  3G6J B;  4R4O A;  3PF4 A;  1EZ6 A;  4OON A;  4GLX A;  3CCL A;  1EEF D;  3HOV G;  2ICI A;  4BXX H;  1CA6 A;  2E2I H;  1X55 A;  5NUC A;  3TP6 A;  2LS0 1;  5EAY A;  4R1J A;  4DNR B;  2B2W A;  2JA6 G;  1SXT A;  3OW7 A;  5KEE A;  2PPB C;  4K5W A;  4P73 A;  4WJ4 A;  2D0O A;  3K7A B;  1PH9 A;  3RLO A;  1ASY A;  3CCM A;  3I4L A;  2A8V A;  1XWE A;  1LTA D;  1UEB A;  1B53 A;  2CQO A;  3QIA A;  1BF4 A;  3E3X A;  4HCS A;  1AFP A;  2D2C C;  3UDX A;  5M5W H;  1VQ5 A;  1ONL A;  2KED A;  2CQA A;  1UEA B;  5G3L D;  5ISR A;  4CKE A;  2KCM A;  4LJZ C;  1MSH A;  4B3T Q;  4HIK A;  1II3 A;  2F4I A;  4B3R Q;  2LSS A;  4S3S A;  1SYE A;  2KEE A;  2OTJ A;  4DR2 Q;  4DV7 Q;  2HHH Q;  3DM1 A;  4RFB A;  4MIU A;  2I5M X;  5IGD A;  2CFM A;  2EYO A;  1B7Y B;  5JJZ A;  2EDG A;  2F0S A;  5D14 A;  4JI1 Q;  1FJG Q;  3PGZ A;  1B70 B;  5FLM H;  4IJH A;  4BA1 I;  1VQ7 A;  3RNU A;  2UXB Q;  2EPB A;  2KBN A;  3KLS A;  4IPH A;  3GTG B;  3CMA A;  1X3G A;  4DR4 L;  1PYW D;  4RGN A;  3NBH B;  5LL6 S;  4I7A A;  5BR8 Q;  4DV2 Q;  2A69 D;  4C56 C;  2LMC B;  3H3V H;  1Q7Y C;  3HEJ A;  4G4K A;  3QJY A;  3EJI A;  4PMW A;  1XNQ Q;  1NCV A;  4ZKC B;  2B39 A;  3I4N B;  4XDX A;  5LMN W;  1V1P B;  2FIN B;  5AJ3 Q;  4HJA A;  3CRL C;  1X3F A;  2YTX A;  3A7A B;  1KLU D;  4QB4 A;  1VQL A;  3GTQ H;  4KD4 A;  1ML0 D;  2SNS A;  4RKB A;  4A3D H;  3HGB A;  1C9O A;  4HMJ A;  4RAU C;  1ZXT A;  2MGS A;  2F0V A;  1VQK A;  3CQZ H;  4JBK A;  1LTR D;  1FNV A;  4NXM L;  3GDE A;  1PMR A;  2DUD A;  3J80 c;  2A69 C;  3AEV A;  3D8G A;  2A73 B;  4H44 C;  3PSI A;  4JI6 L;  1IKM A;  4JI2 L;  1IBL L;  5GAE C;  1Y8O B;  4XYQ A;  3VR6 A;  4K6L A;  1DYQ A;  2RA4 A;  1KAA A;  1JR0 D;  2P5Z X;  4BS9 A;  2F0K A;  3IRB A;  4QUF A;  1LV9 A;  4DV3 L;  4C3H G;  4X64 L;  3D4D A;  1K83 B;  2VZA A;  1PRT F;  3NTK A;  1QCB D;  1PH6 A;  1X3Q A;  4LFC L;  2RVL A;  3KUP A;  1HH2 P;  3HP3 A;  1FGU A;  4BBS B;  3G4S A;  1IL8 A;  4DR5 Q;  2RSO A;  1XXG A;  1PH7 A;  4IFD J;  5F2D A;  1CQV A;  4HTH A;  1SYB A;  1DOM A;  3NBI A;  4LF8 L;  3S15 B;  2Z9H A;  4RA8 A;  1PFS A;  3HZX A;  2VQE Q;  1AZP A;  3HOZ B;  4GNX B;  1EYG A;  3JAM c;  2YYZ A;  1GUW A;  2EY1 A;  1H9M A;  2Z6K C;  1CM9 A;  3PCO B;  1TWA B;  1MHW C;  2JA7 B;  1KNA A;  2K04 A;  5H1S E;  3S1N B;  3F2C A;  1OXS C;  1EWC A;  1OXU A;  2F0E A;  2IHE A;  3S24 A;  1OTC A;  4PMC A;  4QMG A;  4F87 A;  3T56 B;  3U9S A;  3JC6 6;  3MA2 B;  1SMX A;  3HOU H;  1H9S A;  3HS0 C;  1U4L A;  3I8Z A;  3PO2 H;  3JAM E;  2N8N A;  5JPN C;  4BY7 G;  2FHT A;  2JN4 A;  3A0J A;  2A5H A;  4HIO A;  3ONA B;  2R7Z B;  2VY3 A;  3SE0 A;  2B3G A;  2EIF A;  4RH6 A;  2UXC L;  1EFI D;  2MFI A;  1WD1 A;  4A3G B;  1PRT D;  2HDM A;  2X6G A;  1JOR A;  1K0S A;  3VR3 A;  1XMO Q;  5E3F A;  1GVP A;  4ID6 A;  5C4J B;  3MFG A;  1STB A;  2IX0 A;  4DV0 L;  4LWC A;  5J1Z A;  2WAQ G;  3RUZ A;  2DNC A;  1O78 A;  3D4R A;  4KHV A;  2K75 A;  3K81 C;  4N8F A;  4C3I G;  1KRT A;  4DR7 L;  1EQV A;  4KJO A;  3F2D A;  1QUQ B;  1AE3 A;  1H9K A;  2WB1 G;  4DXF A;  1I50 B;  3RD4 A;  3MXU A;  1AEX A;  4ZUI A;  3A5Z B;  4MNO A;  1K3B C;  1D5M C;  4JW0 A;  5C4X B;  2PZW A;  4A3M H;  1PRT C;  4ZCK A;  1MJC A;  4OIJ A;  1CKO A;  2F0W A;  5C6A A;  2R92 B;  3L7Z C;  1MJE A;  1T9H A;  1YZ6 A;  4O0A A;  4KN4 C;  2ZJR A;  1ASZ A;  3T13 A;  1AW7 A;  1QB5 D;  1CKN A;  1TWC B;  2K33 A;  1VQJ A;  3MXN B;  2L12 A;  2RCF A;  4RCN A;  2L1B A;  3I73 A;  5C0X I;  1SLJ A;  3PIO A;  1E2Z A;  4OIK A;  5D65 A;  1Y1W G;  2JE6 I;  3TZU A;  1HNZ L;  4ZLT F;  1MI2 A;  3RZO B;  1TY0 A;  4BBR H;  2K5H A;  1EQR A;  1EFW A;  3TRZ A;  3A8K E;  4KLK A;  4MZ9 A;  1GD7 A;  1I6V C;  1V43 A;  2F0J A;  1WYD A;  3H3V I;  1JT8 A;  2D62 A;  4DNI A;  1KRS A;  3PUV A;  4ZKB B;  2B8G A;  4DR6 Q;  1VQE A;  5E4X A;  2CHB D;  3IKJ A;  4JBM A;  3S1Q H;  1PFM A;  4O1N A;  3M7G A;  1YEZ A;  1VQG A;  3KDF A;  2MJ8 A;  4DR4 Q;  1NY4 A;  1JWM D;  1N33 L;  1Q12 A;  4MN3 A;  3OPO A;  2GVA A;  1IKL A;  1PTO H;  2FJ2 A;  1G51 A;  1EEI D;  3VDY A;  2EJF C;  4X6A H;  2QEJ C;  4KHZ A;  5EKK A;  4X3T A;  2K5W A;  3CPF A;  3LWE A;  5IYB H;  2NTT A;  1P16 A;  4OL7 A;  3P7J A;  5M5X B;  4FP5 D;  2B2Y C;  2JA8 G;  1K3R A;  1Q1E A;  2EY2 A;  1DGS A;  4XQN A;  1I4X A;  2WAQ E;  3KYH C;  2A19 A;  2M00 A;  4F88 A;  4A3L H;  2ALY B;  3GTO B;  3BVG A;  1K83 H;  2JA5 B;  3H3V C;  1P8L A;  1KAB A;  1VQA A;  5HUR A;  4ZK9 B;  2N3S A;  3PUZ A;  4CDD C;  3BS1 A;  4JI6 Q;  2NTS A;  1DXM A;  3DHQ A;  1C7Y A;  1IBL Q;  4GLV B;  2AUJ D;  1NMF A;  3DWA A;  3P20 A;  4YWL A;  2FMC A;  3B6Y A;  4JPB W;  1WTR A;  5DNF A;  2O2L D;  3M7N A;  4M8A A;  2NWG A;  4X64 Q;  1J5E Q;  1RDP D;  5D3D A;  3GTP H;  2K6A A;  1GUG A;  3STB D;  4LFC Q;  3OSO A;  1TWA H;  1HA5 A;  5K5P A;  1VQN A;  3RR5 A;  3S1N H;  1HZB A;  5C3E H;  1WOC A;  5HGQ A;  2C9O A;  2PNH A;  3SGI A;  4OWX B;  3W1G A;  5C0X G;  1WTV A;  2F0G A;  1FL0 A;  3T4A C;  1DM0 B;  1KQS A;  4LF8 Q;  3G6E A;  4OWW B;  2F0U A;  2Z6B A;  2PZU A;  4BY1 B;  4DXG A;  4AQY L;  4FF3 A;  5IP9 H;  2F3V A;  1FR3 A;  3TDQ A;  2NN6 H;  2ZJP A;  1EY8 A;  4DFA A;  4A3K B;  2NVQ H;  5HY6 A;  1EYD A;  1B3Q A;  1AZQ A;  1E0B A;  1PYS B;  3HKZ B;  2X6L A;  5FJ8 H;  2R93 G;  1AN8 A;  1U0L A;  4J1M A;  4DAY B;  5JEA H;  2BA1 A;  4R9W A;  2L11 A;  3FRP B;  1SND A;  1JE4 A;  2UUB Q;  4H02 A;  1Y8N B;  4CDF C;  2QGQ A;  1LTG D;  1LTL A;  1XTC D;  1LTI D;  1QIL A;  2QA4 A;  1C48 A;  1ILQ A;  1QVC A;  4A3F H;  1UE5 A;  4J8Q A;  2ZTE A;  1SDF A;  2F0L A;  2KHI A;  5I9O A;  2UXC Q;  2VUM H;  1OXT A;  3QR8 A;  1SFO H;  5EKI A;  3EA6 A;  1Y1V H;  5C4X H;  1XMQ Q;  5I2X A;  4RCO A;  1EY9 A;  3HOX G;  3NQI A;  4Y7N B;  3HG9 A;  3Q8D A;  1PH4 A;  3BZC A;  2Q2T A;  5IE8 A;  4DU9 A;  3HRZ C;  1PDQ A;  4XTC S;  4R4C A;  4DR7 Q;  1JC7 A;  4X66 Q;  2BE5 D;  1KDA A;  1STY A;  1TWC H;  3AFQ A;  4KV6 A;  4CKC A;  3NEM A;  1MIU A;  1VF5 C;  2SEB D;  4G7H C;  1B4O A;  3CC4 A;  4R4I A;  1JOO A;  5IGB A;  3WOE A;  1A63 A;  1KDC A;  1ZYR D;  1Y69 U;  2IL8 A;  3KOJ A;  4GS3 A;  4QIW E;  2NZO A;  4NP5 A;  1K9M C;  4G7Z C;  4OX9 L;  1DOL A;  2XGT A;  3W3A A;  3U58 A;  3JAM L;  1A3T A;  3M4Q A;  1RCV D;  1SAP A;  2L0C A;  4X65 Q;  4JI7 Q;  1IBM L;  2E8G A;  3GTK H;  4PZ7 A;  2B2Y A;  3AFP A;  1R4Q B;  3S1M H;  2FXQ A;  1F9Q A;  2BE5 C;  3O13 A;  2EYL A;  3R3O A;  4K2K A;  1QWY A;  2XTI A;  3H09 A;  2NVT H;  4UP7 A;  2YV5 A;  3GTJ H;  3CRK C;  1IL2 A;  3I4M G;  1FGB D;  4EQ5 A;  1KAW A;  1SYD A;  2MUY A;  3SK8 A;  4DR1 L;  2E76 C;  3H0G G;  4JI5 L;  1HNZ Q;  2LFN A;  4OO1 I;  1WVL A;  3CC2 A;  4HMI A;  2G5D A;  3FDT A;  1ZYR C;  5CV7 A;  3URY A;  1I4R A;  1U4P A;  3FVQ A;  5KIX A;  3FKI G;  4FVM A;  3KF6 A;  5DM6 3;  1EWH A;  4A93 H;  2EYJ A;  2R7F A;  4RMF A;  4A3D B;  1YI2 A;  4JI3 L;  4DUZ L;  4GN3 B;  4N9T A;  3KK7 A;  3MAQ A;  2B63 B;  3HOW H;  5CV9 A;  3CQZ B;  5M5X H;  4DK0 A;  2D0P A;  2CWA A;  3J81 c;  4JI0 L;  1PVO A;  5LMU L;  3FHW A;  4K8J A;  1GHJ A;  4JBJ A;  3P75 A;  2NVY H;  4B9W A;  2NVX H;  2K1B A;  4GKK L;  1N8R C;  3GTO H;  4LFA Q;  4EVO A;  4G57 A;  4DUY Q;  3D4W A;  3CAM A;  3SK6 A;  1AE2 A;  1ESR A;  4ABN A;  3OYY A;  4K0K Q;  3LGJ A;  4QGU A;  1D7Q A;  1LTS D;  4R4Q A;  3LX0 A;  4LF5 L;  4OWT B;  3TZD A;  3J81 E;  4P2C B;  3I7F A;  5FO9 B;  1M1K C;  1VDZ A;  1HRJ A;  1ICF B;  4JI4 L;  2K03 A;  1SEB D;  1TWG H;  1ZEQ X;  1Z7T A;  3PUX A;  1YNX A;  1VQI A;  4ULL A;  2BDO A;  1X3E A;  4RHR A;  4HCE A;  4CJ0 B;  3T51 B;  4Q5V A;  1E2V A;  2PCF B;  3PO3 H;  2F03 A;  3K5N A;  2HD3 A;  4NXN L;  4P75 A;  1A3V A;  4DV5 L;  4ZQ3 A;  1LM0 A;  4PV1 C;  2A6H D;  1HCZ A;  1IXR A;  4XYO A;  5ELD A;  4BY1 H;  2DJG C;  2QEX A;  1LUZ A;  3TP5 A;  3KFU A;  2L5T A;  4A3K H;  2YTV A;  2XNA C;  1SNO A;  2WKC A;  1CHQ D;  2AHO B;  2BH2 A;  3P1H A;  3PO2 B;  4QCL A;  2PI2 A;  3AYH B;  3EVQ A;  2A74 C;  1G6Z A;  1E3P A;  2EE1 A;  3CCV A;  4A3J H;  3I4N G;  3PV0 A;  3M4Y A;  5CGK A;  3HOY B;  2R7D A;  1HR0 L;  4OO1 G;  2NBF A;  4GNX C;  4HJ5 A;  5C5L A;  4AQY Q;  2A6H C;  3OW2 A;  1OO9 B;  2B2T A;  2EJG C;  5GQO A;  4JVZ A;  3CCE A;  4CBV A;  3G7L A;  4JV5 L;  1SSO A;  5JPM C;  3SK4 A;  1NR2 A;  3A8I E;  1HNX Q;  2PI2 E;  5CBA E;  2XN9 C;  3BZK A;  2OQK A;  3RLF A;  1SJE D;  4OEM B;  4RWS C;  4Y7N H;  4JG2 A;  1I3Q H;  2K5N A;  2PNR C;  4QF4 A;  3NEL A;  5KRU A;  3CPW A;  4LNQ A;  4A3M B;  2EYM A;  4JK1 C;  4RGO S;  3NHH A;  3FPP A;  3I91 A;  2F52 A;  1OXX K;  5GAD C;  2X69 A;  3NPP A;  1BDO A;  4QL5 A;  1D6E C;  1WCM H;  2AQ3 B;  5I6W A;  4BBS G;  2N55 A;  3WOF A;  1GUN A;  2PMZ E;  1JB3 A;  4DV1 L;  2B2U C;  2YU9 H;  4RKL A;  4A3B H;  4YWM A;  1DON A;  3WDN A;  1D1K A;  4UPA A;  5EPK A;  3SEB A;  3VR4 A;  4LFB L;  3M4P A;  1YJN A;  2PQE A;  1WJJ A;  4BBR B;  3HOZ G;  2F0P A;  2RDF A;  5FKA C;  2F4V L;  1VQH A;  1ENF A;  4L5R C;  3S2D B;  2MHV A;  2JA7 G;  2OTL A;  3D6C A;  3DEP A;  3TBI B;  4OX9 Q;  2Q8T A;  3VR2 A;  1XPO A;  3PUW A;  4OEL B;  2H4O A;  1HPC A;  4RGM A;  3S1Q B;  3ERO A;  2MQH A;  1UE6 A;  1SJH D;  1G2S A;  1JOQ A;  1H95 A;  3A8J E;  2YTY A;  5M3F H;  2I5L X;  3F1Z A;  3NSW A;  2N49 A;  2B63 H;  2QDL A;  1PTO B;  4OGQ C;  3TP7 A;  1J6Q A;  2R7Z G;  1SN8 A;  4HAE A;  4IFD H;  1WTP A;  2QCP X;  4IQZ A;  4LF7 L;  4A3G G;  3M9B A;  4YCV A;  3BVZ A;  4I65 A;  2FFK B;  3ULP A;  2Q2I A;  3UDG A;  4LF9 Q;  3A74 A;  3CCQ A;  4X62 L;  2F0Q A;  3R8B A;  2IJ0 A;  2K32 A;  5C0X J;  1F2Z A;  2UXD L;  2WIN B;  4K6D A;  4JYA L;  3CW2 C;  1LTB D;  3PIP 3;  4IUT A;  4A3E H;  5AFW A;  3KLR A;  4YY3 L;  4WOR A;  1I5F A;  4YHH L;  5E7N A;  5GRO A;  3J80 E;  4JI0 Q;  5LMU Q;  4WJ3 M;  1EIH A;  5LL6 X;  2K01 A;  3J7A V;  2DY7 A;  4GKK Q;  2B29 A;  2EOT A;  4UP8 A;  5CMD A;  2JSO A;  1BVS A;  4JC0 A;  2WII B;  1IBK L;  4DF7 A;  2R92 G;  2PYK A;  1MSG A;  1JWS D;  3S14 H;  3VYU A;  1SE8 A;  2OT2 A;  3N52 A;  2DN8 A;  4IPC A;  4ME5 A;  3GTP B;  4LF5 Q;  2JQO A;  4GNX A;  2JXM B;  3RN2 A;  2F1M A;  5IYD G;  2K7V A;  1TY2 A;  5FO8 B;  1M90 C;  4JI4 Q;  1KDB A;  3RN5 A;  5C3E B;  1TKW B;  2EZV A;  2OF1 A;  1C4Q A;  4KY6 A;  4EQP A;  3NK9 A;  2IWH A;  1CI3 M;  1LLR D;  2K5D A;  3PUY A;  1O7Y A;  1DZ1 A;  1E22 A;  1TWH H;  2KJX A;  3E6Z X;  3R93 A;  4NXN Q;  1KLG D;  4DV5 Q;  2NVQ B;  1DCZ A;  3SXH A;  2RKS A;  1GUS A;  5J3B A;  1BQQ T;  2HIX A;  3A7L A;  3HOY H;  1BNZ A;  2LXJ A;  1D1I A;  3U4V A;  2LKV A;  3D0F A;  4K8I A;  1E1O A;  1SYF A;  1VMC A;  5J22 A;  5IYC G;  4QJF A;  1M8A A;  3KF8 B;  5ELO A;  2E5L L;  3S1R H;  4APV A;  3I4O A;  4A3C H;  1O7L A;  4KJN A;  4XQQ A;  2JA9 A;  4A3F B;  3J81 L;  1L1O B;  1HQR D;  1I4Q A;  2GA4 B;  5C4H A;  4HR7 B;  2VUM B;  5C44 H;  2FMM A;  1HR0 Q;  1I6H B;  2CWP A;  1SFO B;  3A5U A;  2K5V A;  5IP7 H;  1Y1V B;  2SOB A;  1HNW L;  4IO9 A;  5DLQ E;  4HJ8 A;  3X3M A;  2E2J H;  4F8M A;  1U5K A;  2JA5 G;  1YNJ D;  4HIM A;  2O5J C;  4LF4 L;  2GVB A;  4IUP A;  2K52 A;  2K5Q A;  3CD6 A;  2LXK A;  4IN3 A;  4KKS A;  3K0X A;  4TRD A;  3CHB D;  5M3M H;  4C3J H;  2Q8I B;  2JEB I;  3D6W A;  1I4P A;  3J7A F;  1X9N A;  1BCP D;  1E1T A;  3LNN A;  3N6R A;  1D5X C;  4KD3 A;  4L6T B;  4N9P A;  4L5Q A;  4DK1 A;  5K36 H;  1GXD C;  2LY7 A;  3F2B A;  4KTA A;  3J7Z C;  1MBY A;  1Q82 C;  3M3Y H;  1GO3 E;  3IFD A;  1C0A A;  1Q1B A;  2I0Q A;  1CKN B;  5JJI A;  3S2D H;  4WJW A;  4DN4 M;  1I94 L;  1YNJ C;  2KHS A;  2A68 D;  2OWO A;  3GTK B;  1HFG A;  3V05 A;  1LYL A;  3S1M B;  4LF6 L;  2VB3 X;  4DV1 Q;  3H6M A;  2H5X A;  4IZ8 A;  5BN5 A;  2UUC L;  2NVT B;  3GTJ B;  4CJ2 C;  1BR9 A;  5J39 A;  4LFB Q;  1BCP C;  4A3I H;  2AKW B;  2UU9 L;  1X3P A;  4BY1 G;  4X3K A;  3I90 A;  4GLA C;  4B9X A;  2OEO A;  4K5X A;  1N34 L;  2F4V Q;  2WAC A;  2ZXP A;  2XSC A;  1BUV T;  4A93 B;  3HOV H;  1YNN D;  5LMN L;  2AQ1 B;  2F0F A;  3J81 i;  1GUO A;  1VS0 A;  2A68 C;  3MWY W;  2UUA L;  3S17 H;  3KDF B;  3OTO L;  3HOW B;  2F0I A;  4RGT A;  1U4R A;  4FNF A;  2JA6 H;  2KCC A;  4BXX G;  3HKS A;  1Q90 A;  4K2L A;  1K73 C;  2Z6K A;  3E0E A;  4CJ1 B;  5IGG A;  2NVY B;  1NMG A;  4YCW A;  3VR5 A;  3E9I A;  2NVX B;  4V19 0;  2EQS A;  2F0H A;  3DM3 A;  1VQM A;  2F0M A;  2CW0 D;  4NXM Q;  2R61 A;  1EIF A;  2HCI A;  4LF7 Q;  1WTO A;  1V1Q A;  4HJ9 A;  1BBX C;  2DJF C;  3PIP A;  1Q8K A;  2WB1 E;  1SNM A;  2E74 C;  4JI2 Q;  1YNN C;  4X62 Q;  1WTH A;  4GKJ L;  1S5B D;  1RIP A;  1EOT A;  3OIQ A;  5IT9 c;  1YIT A;  2UXD Q;  1F9S A;  1LT6 D;  1G8Z D;  1Q86 C;  4JYA Q;  4MTK A;  5FLX c;  4OXP A;  4DV3 Q;  3ICE A;  1TWG B;  2WFW A;  1JIC A;  4KY7 A;  3Q24 A;  4FF4 A;  5ELE A;  4C2M H;  4H0L C;  1LT3 D;  1EZ8 A;  4UDU C;  5A35 A;  2KEN A;  2CW0 C;  2ZM6 L;  1CA5 A;  1S5F D;  4XXE A;  2SDF A;  1BKB A;  3A54 A;  4DR3 L;  3PO3 B;  2NZH A;  1ICW A;  1QNK A;  2QKI C;  2NZ1 D;  4Z9C B;  2R3Z A;  3T16 A;  5IT9 E;  5FLM G;  5JVG 3;  1E2W A;  1CTM A;  3NEN A;  5FLX E;  2F0O A;  1JMC A;  2ATW A;  4ZAI A;  3BYY B;  1V9P A;  1O80 A;  3KJO A;  4IUQ A;  4GZY C;  2Y0S G;  5EKL A;  1QOH A;  4PG3 A;  2KVM A;  1FD7 D;  1F2L A;  4L5T A;  3AB9 A;  3C1F A;  1TQO A;  2DGY A;  1H9R A;  3BDC A;  1ZKO A;  3WWV A;  4DAY A;  1U4M A;  4A3J B;  1EIG A;  3SDZ A;  5EBD A;  1KHI A;  3VYR A;  2K50 A;  4PMB A;  1B3A A;  2TSS A;  1NE3 A;  4DK6 C;  4A3D G;  1QJO A;  1XTD A;  3J80 L;  2F0T A;  3H94 A;  5EBC A;  2ENB A;  3S16 H;  1I6H H;  1W2B A;  5IGE A;  1Q46 A;  1S5C D;  4DPG A;  3NTH A;  3VA7 A;  4IUN A;  4DV0 Q;  2PQA B;  4KY5 A;  1IHZ A;  2RDG A;  1PH8 A;  1S4Z A;  1I3Q B;  2E5L Q;  1KTK A;  3MC0 B;  4C3H H;  3GP7 A;  1EU3 A;  4TKO B;  3IAY A;  1A15 A;  1WI5 A;  2NYZ D;  1PH3 A;  4ZYS A;  1D2B A;  1PH1 A;  2Q2U A;  1BCP B;  1CSP A;  2AMC B;  1IW7 D;  1MKH A;  1PTO F;  1PZI D;  1RHP A;  3C2P A;  2XWB B;  3MEF A;  4JI1 L;  1RD9 D;  1FJG L;  1HNW Q;  2J4X A;  1WCM B;  4DKA C;  2NUC A;  1YHQ A;  3MZ5 A;  5I2Y A;  3AQQ A;  2YU9 B;  4A3B B;  1UUP A;  1GOZ A;  4IPG A;  3OOC A;  4LF4 Q;  4R8N A;  1B9N A;  1L0Y B;  4NKL A;  1F2M A;  3DEO A;  1PLF A;  2B2W C;  5BR8 L;  4DV2 L;  4ODG A;  4HSV A;  3LWU A;  1SNC A;  2K05 A;  3NP8 A;  4B3M L;  3VA5 A;  3C46 A;  4KKU A;  1IW7 C;  1BBW A;  5DAU A;  1XNQ L;  2SNM A;  4L8J A;  4P74 A;  2L15 A;  4DV6 L;  4GOP B;  4YCU A;  4X3U A;  2RBM A;  2RHQ B;  2Z4H A;  3GQB A;  4BY7 H;  4JOI C;  3M85 A;  2A6E D;  1VQB A;  1PZK D;  5CV6 A;  3HOU G;  1UWV A;  4K14 A;  1L2F A;  4DAV A;  2VNU D;  5M3F B;  3J80 i;  4POG A;  2Y0S E;  2HDL A;  3PO2 G;  3K80 C;  2R93 B;  3MHB A;  4EQN A;  3UDF A;  2A1A A;  3TP8 A;  4KN7 C;  3BJU A;  1EL0 A;  3PF5 A;  2UU9 Q;  1BBU A;  1PTO D;  5C3X A;  4I7Z C;  3I3C A;  2M9V A;  3Q0A A;  1N33 Q;  2L4N A;  5DEH A;  3TS2 A;  3DLL A;  4C3I H;  3TME A;  2BDN A;  4YIJ A;  3SVM A;  4PZ6 A;  2MO0 A;  1JJC B;  4BWG B;  2IX3 A;  2JJQ A;  4DK3 C;  1HFN A;  5LMN Q;  2OQ0 A;  2KUM A;  5ELB A;  4IAL A;  3EFX D;  2A6E C;  2EXD A;  1EY6 A;  3W2D A;  1W3S A;  2WV6 D;  1V1O A;  4PZ8 A;  1O7Z A;  4A3E B;  4H7B A;  2VQF L;  5IWA L;  3CCJ A;  1GJX A;  5JOB A;  1S5E D;  1NSN S;  1STN A;  3I2Z A;  1B50 A;  1G29 1;  2F0N A;  4A3M G;  1XPR A;  1PFB A;  1PTO C;  2AWN A;  5DM7 3;  1GKH A;  3JAM i;  5L37 A;  1TXY A;  2C35 B;  3S14 B;  3FEW X;  2VQE L;  3AU7 A;  2KHJ A;  2D9U A;  3SR1 A;  3KJP A;  1NR4 A;  5EPL A;  4GKJ Q;  5IGF A;  4AYB B;  1Y1W H;  3D3R A;  5IOD A;  3UE1 A;  2ZXO A;  5GAH C;  4PQX A;  1SNQ A;  3S2H H;  5A2Q E;  2WKD A;  2OCE A;  4IUR A;  4BBR G;  1RTO A;  2ZM6 Q;  1D5Z C;  2I46 A;  3V2T A;  2NN6 I;  3MEH A;  4DR3 Q;  1TWH B;  2PW5 A;  3QB3 A;  1HZC A;  3TRE A;  1TVX A;  3EN2 A;  3PQI A;  2E2H H;  4ZRZ A;  5EGT A;  1CFM A;  4U67 3;  1CZW A;  2EY6 A;  3K7U C;  4RHS A;  1S72 A;  1EOV A;  4ME3 A;  1JWU D;  2ZXR A;  2JK8 A;  3CCU A;  2N88 A;  4KI0 A;  1EY4 A;  3GD7 A;  3S1R B;  2D5D A;  1U9R A;  4XT1 B;  2O4X A;  3RMH A;  2JA8 H;  3GTM B;  3OWE B;  4TSS A;  2HT1 A;  2GN5 A;  3K6O A;  4FXG C;  1Q8I A;  2EY5 A;  5IYB G;  1GHK A;  5EJW A;  3E0J A;  5C44 B;  1ET6 A;  2PO4 A;  4UHV A;  3QOJ A;  1VQ6 A;  1IZ6 A;  1GUT A;  5I9P A;  2J7Z A;  3MTS A;  4N8X 1;  2CCZ A;  1ILP A;  1PA6 A;  1WD0 A;  3NWT A;  5JJK A;  1SRO A;  2VXW A;  1JB7 A;  2E2J B;  4A3L G;  1PFN A;  2K14 A;  2PMZ B;  5IT9 L;  2G9D A;  3NQT A;  4JOI A;  1Y14 B;  3DXJ C;  5FLX L;  5M3M B;  5CV5 A;  4C3J B;  1A0I A;  5CBE E;  4CDC C;  2K4K A;  4TQU S;  1L1O C;  3R2T A;  4K5V A;  2JYO A;  3QO2 A;  2BA0 A;  1YIJ A;  2IHF A;  3M3Y B;  1QE6 A;  3NBH A;  1EY5 A;  1D8L A;  4C1N I;  2XRS D;  3PIO 3;  2I5H A;  1STG A;  1NTG A;  2CVR A;  5C0X H;  2KOL A;  1VQD A;  3A55 A;  1EU4 A;  2NB0 A;  3TN2 A;  4DR6 L;  1KL9 A;  3NE5 B;  3W1B A;  1K8G A;  5C3E G;  2K28 A;  4DV4 L;  4DGZ A;  3T53 B;  1V1P A;  1X6O A;  3CC7 A;  2IPK D;  2KEC A;  5CV8 A;  5JAV A;  1IBM Q;  4Q0F A;  1DD2 A;  4A3I B;  1YHB A;  4YWK A;  1G91 A;  1R9T H;  1A6X A;  4J6H A;  5IP9 G;  3OMC A;  2R93 H;  3K57 A;  2NN6 G;  4B3M Q;  5GAG C;  4IOC A;  1VQF A;  4DR1 Q;  3HOV B;  5KGU A;  1F2Y A;  3FPU B;  2VB2 X;  1PH5 A;  4JI5 Q;  4KHP L;  3TEH B;  3DMU A;  5FJ8 G;  4DV6 Q;  3RZD H;  2MPM A;  3S17 B;  4CDE C;  5JEA G;  4ZUJ A;  2JA6 B;  4IUU A;  1EYC A;  1ROD A;  4PNY A;  4ALP A;  1SMY D;  3T1Y L;  1WTW A;  3GTL B;  1TS2 A;  1NBW A;  4IPD A;  5EQ0 A;  4DUZ Q;  1VQ9 A;  4JI3 Q;  2PW7 A;  4A3F G;  1E7Z A;  1SE3 A;  3M4O H;  4HSP A;  2IW3 A;  3X3N A;  1RL2 A;  3HOX H;  3OIP A;  2VUM G;  2EYH A;  2QDB A;  2JP1 A;  2HIV A;  3DUZ A;  2ES2 A;  2I07 B;  1X56 A;  1PV4 A;  2PZT A;  1SNP A;  5LHY 1;  1Y1V G;  5C4X G;  1VF7 A;  3ERS X;  3VYS A;  4DAP A;  1CT1 D;  2TMP A;  1F9P A;  3E9H A;  1IYV A;  3I55 A;  1XX8 A;  1FNU A;  1J5E L;  1L0W A;  1SMY C;  3CP0 A;  2MNA A;  1EIY B;  2VQF Q;  4FDB A;  2KA7 A;  5IWA Q;  1B2T A;  5KYL A;  4C2M B;  4NDX A;  2CH4 A;  5ELC A;  1G2T A;  1X54 A;  4Y52 H;  1JQY D;  4ILW A;  1Z6H A;  4LAA A;  2RSN A;  4EGV A;  2QIL A;  1QZG A;  1B44 D;  4LUO A;  2ZTC A;  2ZTD A;  3IFT A;  5ELF A;  1W6J A;  1CHP D;  1YBY A;  1EQQ A;  3TS0 A;  3RLN A;  1VQ4 A;  3I4M H;  3KLW A;  3U4Z A;  1BCP F;  3H0G H;  5IIF A;  1CUK A;  3HFZ B;  2ASB A;  3QOL A;  3ND8 A;  2XVS A;  1DJR D;  3QG1 A;  1JCK B;  4IJL A;  4KMU C;  4AIM A;  3KBG A;  1QNU A;  3OWF A;  4FXD A;  1RKN A;  3FKI H;  1ESF A;  4B3S L;  1H9S B;  4OHJ A;  4WRD A;  2UUB L;  1DOK A;  4POF A;  1RJT A;  3KF8 A;  2B2U A;  1A3U A;  4A93 G;  1KNE A;  1PHJ A;  1BO0 A;  3T1H L;  3GTM H;  2HUG A;  4DNT B;  3MVV A;  1QUQ A;  1L1O A;  5M9O A;  3S16 B;  2AWO A;  3HOW G;  1XMQ L;  1LT4 D;  2RF4 A;  4LK1 C;  1XNR L;  1KC8 C;  2JEA I;  2Q8R E;  3OHX C;  1ENA A;  4NB3 A;  1NAP A;  3K7A H;  4JI8 L;  3A56 A;  5JJL A;  2G9H D;  5KNB A;  3K58 A;  3H15 A;  4JV5 Q;  3MXG A;  4C3H B;  5M5Y B;  1WTX A;  3F2U A;  4X66 L;  1L0X B;  3GO5 A;  4EQO A;  2H1E A;  4FYD A;  1FVI A;  1KIX A;  3C3L A;  1AH9 A;  1YVC A;  3CCR A;  4CHT B;  3R2I A;  3F8T A;  3MXN A;  3ITP A;  1XYI A;  1Z9F A;  1A2U A;  2CH4 W;  2Z1C A;  1EUJ A;  2Z8L A;  5A2Q L;  1UAP A;  4B08 A;  2IX1 A;  4TVA B;  3E5S A;  3NTI A;  4G7O C;  1M4V A;  4X65 L;  4NW2 A;  4JI7 L;  1JJ2 A;  1LO5 D;  5KYI A;  4M1U B;  5C4Z A;  1A8V A;  3VYT A;  2CKZ B;  1STE A;  2AUK A;  3GV3 A;  2B8F A;  1TT2 A;  3BDO A;  3CF5 A;  3PO3 G;  2E2D C;  3GTG H;  3K5O A;  1HTP A;  1JJG A;  4UAI A;  4XT3 B;  1N32 L;  2VS1 A;  3BVM A;  1LTT D;  1UE7 A;  1KXL A;  1CK1 A;  3J7A 5;  1S3O A;  1SYC A;  4DA2 A;  5BN3 A;  4BY7 B;  2RDH A;  2L55 A;  5T1G A;  4A3K G;  1Y8P B;  3K5L A;  4MHE A;  3I4N H;  1NJI C;  4L5S A;  3HKZ G;  4IFD I;  1BOS A;  5BN4 A;  4DV4 Q;  4EX5 A;  4OO1 H;  4IUV A;  4A76 A;  3CU7 A;  3CCS A;  3AMU A;  2R6G A;  4A3J G;  2WAQ B;  2EVB A;  3K5M A;  3GTL H;  1PYB A;  1PH2 A;  4LFA L;  4DUY L;  4C3I B;  1HA6 A;  2AQ2 B;  5FO7 B;  1LAC A;  2Q2H A;  3FMC A;  3UI2 A;  2OXP A;  2MP1 A;  3K8A A;  3UE0 A;  4K0K L;  2WB1 B;  1TR5 A;  5TSS A;  2IT1 A;  5COY A;  4KHP Q;  5CC4 A;  2QF7 A;  3MFY A;  4GOP C;  1IYJ B;  1N36 L;  1B9M A;  1EQT A;  5D3I B;  1J8I A;  4KK7 A;  3T1Y Q;  1K28 A;  4CGY B;  2XRQ D;  2KQ3 A;  3BG3 A;  3C1E A;  5IGC A;  1HQM C;  4F7X A;  1CQF A;  5IY0 A;  5C5M A;  1YJ9 A;  1I4H A;  1UE1 A;  4YY3 Q;  5CR3 A;  1CKM A;  4YHH Q;  1TS5 A;  3L2P A;  4BBS H;  2V1C C;  4NPS A;  3L9A X;  3U9O A;  2J0T D;  4H13 C;  3BU2 A;  1WCM G;  3J81 j;  3DWQ A;  1FYC A;  3IL8 A;  1IBK Q;  3FP9 A;  1MGS A;  1Y1W B;  5FOB B;  4CKB A;  4NMZ A;  3S15 H;  1TS4 A;  2RCN A;  4A3B G;  4DAM A;  2ZJQ A;  1WFQ A;  3HOZ H;  1RTN A;  2VW9 A;  2RQX A;  3S2H B;  1IYU A;  2F3I A;  4UY8 C;  2JA7 H;  2IY5 B;  2ID0 A;  2DY8 A;  1FNW A;  1TWF B;  3OMG A;  1VQP A;  4FF1 A;  1X32 A;  2Z0S A;  2HQL A;  1LT5 D;  4A4I A;  1NUC A;  1QVF A;  1UNS A;  2E2H B;  2HCC A;  5E1F A;  3S9W A;  3K59 A;  3ZJY C;  3Q22 A;  3D31 A;  3U50 C;  2QW7 A;  1YHA A;  1QZH A;  1HR0 W;  5I4D A;  1PRT B;  5KNC A;  5C3W A;  2R7Z H;  1S5D D;  2XWJ B;  1ENC A;  1Q81 C;  2BH8 A;  5M3F G;  1JOK A;  3STB C;  5JVH 3;  4A3G H;  4KKT A;  2XIW A;  1EWI A;  5EPJ A;  5E4W C;  2B63 G;  2EYP A;  4XIG S;  1HNX L;  5C4J H;  2B2V C;  4GN5 A;  4IFD G;  3HKZ E;  3BDL A;  4B3S Q;  2JA8 B;  1HTL D;  2E2I B;  4GN4 B;  2EYF A;  2PQA A;  1A62 A;  3V96 A;  4O2D A;  5IOC A;  4B3T L;  4FO2 A;  5M5Y H;  1Q3L A;  1YJW A;  4B3R L;  3J7Y W;  4HID A;  3T1H Q;  1I50 H;  2F0D A;  4DR2 L;  1TS3 A;  1NNX A;  4DV7 L;  2HHH L;  1SE2 A;  2MO1 A;  4LUZ A;  1K8A C;  4A3E G;  1XNR Q;  5M5W B;  4R4T A;  3SHL A;  4QIW B;  5CYU A;  5COR A;  3Q6S A;  2C5C A;  3ULJ A;  2R92 H;  4JI8 Q;  1RF2 D;  1F77 A;  4J15 A;  1TII D;  2UXB L;  5JEA J;  1QVG A;  2M2L A;  4P71 A;  1T5E A;  5IYD H;  1J9O A;  4RG1 A;  1LAB A;  4HJ7 A;  1K8M A;  1JE5 A;  2WP8 J;  1VCI A;  4QQB X;  4AYB G;  1C8C A;  2B2T C;  5ELN A;  3K0Y A;  1VMP A;  2EXZ A;  3RZO H;  1BXT A;  3CKI B;  1XPU A;  4WFN 3;  4QUC A;  3BZD B;  4FXK C;  5AJ3 L;  3EIV A;  2EJM A;  3H91 A;  4GOP A;  1VQC A;  1AP0 A;  1HJP A;  1I4G A;  3G71 A;  1A2T A;  1HXY D;  3KLS X;  5I6Y A;  3CXC A;  1TU2 B;  1O7I A;  2Y0S B;  1I94 Q;  3EBE A;  4HED A;  4LF6 Q;  1HZ9 A;  1R9T B;  1K8O A;  3Q23 A;  2BCO A;  1EY0 A;  2UUC Q;  4V0B A;  4R8I A;  1N32 Q;  1SR3 A;  5CV4 A;  4O42 A;  2E75 C;  5IYC H;  3HOY G;  3ND9 A;  4LF9 L;  3RZD B;  5KND A;  1VQ8 A;  1HUM A;  1STH A;  1MD2 D;  3KF6 B;  1N34 Q;  3I56 A;  3GTQ B;  1STA A;  4FF2 A;  3SK5 A;  1OXV A;  4X3S A;  2N78 A;  3ER0 A;  4XQJ A;  1XJV A;  4BA2 I;  4LUV A;  1E24 A;  1H9J A;  2VL6 A;  1ET9 A;  3NXW A;  1PZJ D;  2UUA Q;  4A3C G;  1V8Q A;  1X65 A;  3CME A;  1S40 A;  2ZT9 C;  3GV6 A;  5T1I A;  3OTO Q;  4HN7 A;  1B8A A;  1N9W A;  1EYA A;  1SBB B;  4L63 B;  4A75 A;  3M4O B;  3HOX B;  1EY7 A;  3MXP A;  5C44 G;  2Z4I A;  2DNE A;  3QWN A;  3W5O A;  5IP7 G;  4DR5 L;  2JA5 H;  2O5I C;  1KD1 C;  2V4D A;  1PXU A;  3DWP A;  3KBX A;  3TQY A;  4MTN A;  4C1N K;  2RHS B;  5FK9 C;  1R4P B;  1F9R A;  5HGT A;  1N36 Q;  4JBW A;  3L3O C;  3G48 A;  1HHV A;  3I72 A;  5M3M G;  4C3J G;  3ULL A;  1Z47 A;  2KCT A;  3NUC A;  3ZYY X;  1T5X D;  4QY7 A;  3EQL C;  1HZA A;  4LW1 A;  1WTQ A;  2BOS A; 
#chains in the Genus database with same CATH homology
 2QA4 A;  3T1Y L;  1Q82 C;  3M3Y H;  1GO3 E;  1C0A A;  1QVC A;  1Q1B A;  4AH6 A;  1NBW A;  4IPD A;  4DUZ Q;  4A3F H;  1VQ9 A;  1UE5 A;  1CKN B;  2I0Q A;  4JI3 Q;  5JJI A;  3UDI A;  3S2D H;  2ZTE A;  4A3F G;  2KHI A;  4JCV E;  1E7Z A;  1I94 L;  4P72 A;  2UXC Q;  2OWO A;  2VUM H;  1TWF H;  1LYL A;  1OXT A;  3M4O H;  4UP9 A;  4LF6 L;  1SFO H;  4DV1 Q;  1RL2 A;  3HOX H;  1XMQ Q;  1Y1V H;  5C4X H;  2VUM G;  1G6P A;  2H5X A;  1K0R A;  2HIV A;  1CSQ A;  2ES2 A;  4AYB E;  1X56 A;  1PV4 A;  2UUC L;  3HOX G;  1Y1V G;  1SRU A;  4IOA A;  5C4X G;  3Q8D A;  1PH4 A;  3BZC A;  3ERS X;  2Q2T A;  4LFB Q;  5IE8 A;  4A3I H;  2AKW B;  1XMO L;  2UU9 L;  4XTC S;  4R4C A;  4BY1 G;  1GM5 A;  3E9H A;  3L0O A;  4DR7 Q;  4GLA C;  4A3I G;  3I55 A;  4X66 Q;  1N34 L;  2F4V Q;  1J5E L;  1L0W A;  1TWC H;  3AFQ A;  3CP0 A;  1VQO A;  3NEM A;  2MNA A;  1EIY B;  1MIU A;  4R4O A;  3HOV H;  3PF4 A;  2VQF Q;  4FDB A;  3CC4 A;  5IWA Q;  5LMN L;  4GLX A;  4OON A;  3J81 i;  3CCL A;  4R4I A;  3HOV G;  1VS0 A;  2UUA L;  4BXX H;  3S17 H;  2E2I H;  1X55 A;  3KDF B;  3OTO L;  1X54 A;  4Y52 H;  2JA6 H;  1A63 A;  5EAY A;  3KOJ A;  4GS3 A;  4QIW E;  4BXX G;  2NZO A;  4R1J A;  1K9M C;  3HKS A;  4OX9 L;  2JA6 G;  1K73 C;  2Z6K A;  2XGT A;  3E0E A;  1QZG A;  3U58 A;  4P73 A;  3M4Q A;  1NMG A;  4LUO A;  2ZTC A;  4YCW A;  4WJ4 A;  2ZTD A;  3E9I A;  2D0O A;  4X65 Q;  4JI7 Q;  2EQS A;  3RLO A;  3DM3 A;  2E8G A;  1VQM A;  4PZ7 A;  1PH9 A;  3AFP A;  1IBM L;  3CCM A;  3GTK H;  2A8V A;  3S1M H;  1YBY A;  2FXQ A;  4NXM Q;  1UEB A;  1EIF A;  2CQO A;  1EQQ A;  4LF7 Q;  3TS0 A;  5K36 G;  1V1Q A;  3RLN A;  4HJ9 A;  1VQ4 A;  3I4M H;  3KLW A;  3UDX A;  5M5W H;  1VQ5 A;  3U4Z A;  3H0G H;  2XTI A;  2ASB A;  1CUK A;  3HFZ B;  4UP7 A;  3PIP A;  2YV5 A;  1Q8K A;  2WB1 E;  3GTJ H;  1IL2 A;  4JI2 Q;  2NVT H;  3I4M G;  4EQ5 A;  4X62 Q;  1KAW A;  4DR1 L;  3H0G G;  4IJL A;  4GKJ L;  4JI5 L;  1HNZ Q;  1RIP A;  2KCM A;  4AIM A;  4OO1 I;  1YIT A;  5IT9 c;  3CC2 A;  4B3T Q;  2UXD Q;  3FKI H;  4HIK A;  4B3S L;  1Q86 C;  4JYA Q;  5FLX c;  4OXP A;  4B3R Q;  4DV3 Q;  3ICE A;  2LSS A;  3FKI G;  2UUB L;  2WFW A;  2OTJ A;  3KF6 A;  4DR2 Q;  4A93 H;  4POF A;  4DV7 Q;  2HHH Q;  2R7F A;  4RMF A;  2I5M X;  1YI2 A;  4JI3 L;  4C2M H;  2CFM A;  4DUZ L;  4GN3 B;  4A93 G;  1PHJ A;  1B7Y B;  3T1H L;  3GTM H;  2KEN A;  1QUQ A;  3HOW H;  1L1O A;  4JI1 Q;  2ZM6 L;  1FJG Q;  5M5X H;  2D0P A;  1BKB A;  3PGZ A;  4DR3 L;  2CWA A;  1B70 B;  2NZH A;  2AWO A;  4IJH A;  5FLM H;  3J81 c;  1XMQ L;  4JI0 L;  3HOW G;  1PVO A;  4BA1 I;  2RF4 A;  3FHW A;  5LMU L;  3RNU A;  1VQ7 A;  1XNR L;  4JBJ A;  1KC8 C;  2NVY H;  5FLM G;  2JEA I;  2UXB Q;  2KBN A;  4IPH A;  2NVX H;  4NB3 A;  3CMA A;  4GKK L;  3NEN A;  1N8R C;  3K7A H;  4LFA Q;  1X3G A;  3GTO H;  4DUY Q;  4JI8 L;  1JMC A;  4DR4 L;  3CAM A;  5JJL A;  2ATW A;  1AE2 A;  3NBH B;  3H15 A;  4JV5 Q;  1V9P A;  3OYY A;  3KJO A;  4K0K Q;  4X66 L;  3GO5 A;  2Y0S G;  3LGJ A;  5BR8 Q;  4QGU A;  4DV2 Q;  1D7Q A;  1FVI A;  4PG3 A;  1KIX A;  1AH9 A;  4R4Q A;  1YVC A;  3CCR A;  3H3V H;  1Q7Y C;  4LF5 L;  3F8T A;  4L5T A;  4OWT B;  2DGY A;  4PMW A;  1XNQ Q;  1Z9F A;  3I7F A;  1M1K C;  5LMN W;  3WWV A;  5AJ3 Q;  1EUJ A;  4HJA A;  4JI4 L;  1X3F A;  2YTX A;  1TWG H;  1VQL A;  3GTQ H;  1KHI A;  3PUX A;  4TVA B;  2K50 A;  2IX1 A;  4A3D H;  1YNX A;  1C9O A;  1NE3 A;  1VQI A;  4DK6 C;  1X3E A;  4A3D G;  1XTD A;  4X65 L;  4JI7 L;  1VQK A;  1JJ2 A;  3CQZ H;  4JBK A;  1A8V A;  3S16 H;  4NXM L;  2CKZ B;  3PO3 H;  3GDE A;  2DUD A;  3J80 c;  3AEV A;  1I6H H;  3CF5 A;  4NXN L;  1W2B A;  4P75 A;  1Q46 A;  3PO3 G;  4DV5 L;  3PSI A;  3GTG H;  4JI6 L;  4DPG A;  4JI2 L;  1LM0 A;  4DV0 Q;  2PQA B;  1IBL L;  1IXR A;  1JJG A;  5GAE C;  1N32 L;  2VS1 A;  4BY1 H;  1PH8 A;  2QEX A;  2E5L Q;  1LUZ A;  1UE7 A;  1KXL A;  4C3H H;  3IRB A;  3J7A 5;  1S3O A;  4DV3 L;  3KFU A;  4A3K H;  2YTV A;  4X64 L;  1WI5 A;  1PH3 A;  2VZA A;  2AHO B;  1PH1 A;  2Q2U A;  2BH2 A;  4A3K G;  1PH6 A;  1CSP A;  2AMC B;  4LFC L;  2PI2 A;  3AYH B;  3I4N H;  1NJI C;  1MKH A;  4L5S A;  1E3P A;  1HH2 P;  3HKZ G;  4IFD I;  1FGU A;  3MEF A;  4JI1 L;  3G4S A;  1ASY A;  1FJG L;  4DV4 Q;  4EX5 A;  3CCV A;  4A3J H;  3I4N G;  1HNW Q;  4A76 A;  3PV0 A;  3CCS A;  4DR5 Q;  2R6G A;  2R7D A;  4DKA C;  1PH7 A;  1HR0 L;  4GNX C;  4A3J G;  4HJ5 A;  4OO1 G;  1YHQ A;  4IFD J;  4AQY Q;  3AQQ A;  3GTL H;  4IPG A;  1PYB A;  3OW2 A;  1PH2 A;  4LF4 Q;  4LF8 L;  4LFA L;  4DUY L;  1PFS A;  2VQE Q;  5GQO A;  4GNX B;  3CCE A;  1EYG A;  3JAM c;  2YYZ A;  4JV5 L;  2Q2H A;  4K0K L;  3K8A A;  3UE0 A;  2Z6K C;  5BR8 L;  3PCO B;  2IT1 A;  4DV2 L;  1HNX Q;  4KHP Q;  2PI2 E;  4GOP C;  3BZK A;  1IYJ B;  2OQK A;  3RLF A;  5H1S E;  1N36 L;  4Y7N H;  4JG2 A;  3F2C A;  1OXS C;  4B3M L;  1BBW A;  1XNQ L;  1I3Q H;  1OXU A;  2IHE A;  2K5N A;  3S24 A;  3NEL A;  4P74 A;  2L15 A;  3CPW A;  4DV6 L;  3T1Y Q;  1OTC A;  4GOP B;  4YCU A;  4LNQ A;  3JC6 6;  2RHQ B;  1SMX A;  3HOU H;  4BY7 H;  4JOI C;  5IY0 A;  3M85 A;  1YJ9 A;  1VQB A;  2F52 A;  1UE1 A;  4YY3 Q;  3HOU G;  2N8N A;  3PO2 H;  4BY7 G;  1OXX K;  1UWV A;  5GAD C;  1CKM A;  1L2F A;  4YHH Q;  2VNU D;  3A0J A;  3J80 i;  4POG A;  2Y0S E;  3L2P A;  4HIO A;  4BBS H;  3PO2 G;  2VY3 A;  3K80 C;  2B3G A;  2EIF A;  2V1C C;  4QL5 A;  2UXC L;  2MFI A;  4NPS A;  3UDF A;  2A1A A;  1WCM H;  4BBS G;  3BJU A;  2PMZ E;  4DV1 L;  1XMO Q;  3PF5 A;  2UU9 Q;  2YU9 H;  3BU2 A;  1GVP A;  1BBU A;  1WCM G;  3J81 j;  4YWM A;  1IBK Q;  3FP9 A;  4A3B H;  2IX0 A;  4DV0 L;  4LWC A;  4UPA A;  2WAQ G;  1N33 Q;  3S15 H;  3TS2 A;  3DLL A;  2RCN A;  4C3I H;  4A3B G;  4DAM A;  2ZJQ A;  4LFB L;  1WFQ A;  3HOZ H;  3M4P A;  1YJN A;  2K75 A;  4PZ6 A;  2MO0 A;  1JJC B;  3K81 C;  1WJJ A;  2VW9 A;  2JJQ A;  4DK3 C;  1KRT A;  3HOZ G;  4DR7 L;  5LMN Q;  3F2D A;  2OQ0 A;  1QUQ B;  2F3I A;  4UY8 C;  1AE3 A;  2F4V L;  1VQH A;  2EXD A;  4L5R C;  2JA7 H;  2IY5 B;  2WB1 G;  1W3S A;  4PZ8 A;  2ID0 A;  4ALP A;  2JA7 G;  2OTL A;  3A5Z B;  4MNO A;  2VQF L;  1VQP A;  5IWA L;  3CCJ A;  4OX9 Q;  1XPO A;  3PUW A;  4A3M H;  4LW1 A;  3I2Z A;  2Z0S A;  1MJC A;  2HQL A;  4A4I A;  1G29 1;  2MQH A;  1UE6 A;  1QVF A;  1XPR A;  4A3M G;  1CKO A;  1H95 A;  2AWN A;  3ZJY C;  3D31 A;  3U50 C;  3L7Z C;  1YHA A;  1MJE A;  1T9H A;  1YZ6 A;  4O0A A;  1GKH A;  2YTY A;  1QZH A;  1HR0 W;  3JAM i;  2I5L X;  5M3F H;  2ZJR A;  1ASZ A;  1TXY A;  2C35 B;  2R7Z H;  3F1Z A;  2N49 A;  2VQE L;  1Q81 C;  2BH8 A;  5M3F G;  3STB C;  1CKN A;  2B63 H;  4A3G H;  2KHJ A;  1J6Q A;  1VQJ A;  1EWI A;  3MXN B;  1SN8 A;  3KJP A;  2R7Z G;  2B63 G;  4GKJ Q;  4XIG S;  4LF7 L;  4A3G G;  1HNX L;  3M9B A;  4GN5 A;  5C4J H;  1Y1W H;  4YCV A;  3HKZ E;  5C0X I;  4IFD G;  1SLJ A;  3ULP A;  2Q2I A;  3PIO A;  3UDG A;  4B3S Q;  3UE1 A;  4LF9 Q;  3A74 A;  4GN4 B;  4X62 L;  3CCQ A;  1Y1W G;  2JE6 I;  2PQA A;  1HNZ L;  5GAH C;  1A62 A;  5C0X J;  4O2D A;  4B3T L;  2UXD L;  4BBR H;  2K5H A;  1EQR A;  1EFW A;  5M5Y H;  3S2H H;  1YJW A;  3TRZ A;  4JYA L;  4KLK A;  3CW2 C;  4MZ9 A;  2OCE A;  4BBR G;  4HID A;  3T1H Q;  4B3R L;  1I50 H;  4DR2 L;  1GD7 A;  2ZM6 Q;  4A3E H;  4DV7 L;  1V43 A;  2HHH L;  2MO1 A;  2NN6 I;  4YY3 L;  1I5F A;  4LUZ A;  1K8A C;  4DR3 Q;  1WYD A;  4YHH L;  3H3V I;  1JT8 A;  2D62 A;  5E7N A;  1KRS A;  5GRO A;  4DNI A;  5LMU Q;  4A3E G;  3PUV A;  4JI0 Q;  4DR6 Q;  4WJ3 M;  1XNR Q;  1HZC A;  1VQE A;  3TRE A;  4JBM A;  3S1Q H;  4R4T A;  3EN2 A;  2E2H H;  1YEZ A;  4GKK Q;  1VQG A;  2B29 A;  3KDF A;  4UP8 A;  3ULJ A;  1BVS A;  4JC0 A;  4JI8 Q;  2R92 H;  4DR4 Q;  1IBK L;  1NY4 A;  4J15 A;  3K7U C;  1S72 A;  2UXB L;  1EOV A;  1N33 L;  1Q12 A;  2R92 G;  5JEA J;  3S14 H;  4ME3 A;  1QVG A;  1SE8 A;  2GVA A;  4P71 A;  1G51 A;  2JK8 A;  4IPC A;  5IYD H;  3CCU A;  4RG1 A;  3VDY A;  4KI0 A;  4HJ7 A;  4LF5 Q;  2JQO A;  4X6A H;  4GNX A;  1JE5 A;  4KHZ A;  2WP8 J;  3GD7 A;  5IYD G;  3RN2 A;  1VCI A;  3CPF A;  5IYB H;  2JA8 H;  4QQB X;  4AYB G;  1P16 A;  2HT1 A;  1M90 C;  2GN5 A;  5ELN A;  4JI4 Q;  3RN5 A;  5IYB G;  2JA8 G;  3RZO H;  1K3R A;  1XPU A;  1Q1E A;  1DGS A;  1VQ6 A;  5AJ3 L;  3EIV A;  1IZ6 A;  4GOP A;  1VQC A;  2WAQ E;  3KYH C;  1HJP A;  3G71 A;  2CCZ A;  2A19 A;  1PA6 A;  4A3L H;  2ALY B;  3CXC A;  1K83 H;  5JJK A;  1SRO A;  1O7I A;  1I94 Q;  1JB7 A;  3PUY A;  4A3L G;  1E22 A;  1TWH H;  3EBE A;  1P8L A;  4LF6 Q;  1HZ9 A;  1VQA A;  4NXN Q;  2K14 A;  2N3S A;  3PUZ A;  4DV5 Q;  4JI6 Q;  5J3B A;  2UUC Q;  2HIX A;  4JOI A;  1C7Y A;  1IBL Q;  3HOY H;  1N32 Q;  1Y14 B;  1SR3 A;  4GLV B;  1NMF A;  2LXJ A;  4YWL A;  5IYC H;  3B6Y A;  1A0I A;  3HOY G;  3U4V A;  4LF9 L;  2K4K A;  3D0F A;  1VQ8 A;  3M7N A;  1E1O A;  1L1O C;  4TQU S;  3KF6 B;  5IYC G;  4X64 Q;  1N34 Q;  3I56 A;  1J5E Q;  4QJF A;  3GTP H;  3KF8 B;  5ELO A;  2E5L L;  2BA0 A;  3S1R H;  1OXV A;  4APV A;  3STB D;  2IHF A;  2N78 A;  3ER0 A;  3I4O A;  1YIJ A;  1XJV A;  4LUV A;  4LFC Q;  1E24 A;  4BA2 I;  4A3C H;  1TWA H;  2JA9 A;  2VL6 A;  1L1O B;  1VQN A;  1D8L A;  3RR5 A;  2UUA Q;  3S1N H;  1X65 A;  1HZB A;  2I5H A;  3CME A;  1S40 A;  4A3C G;  3OTO Q;  1NTG A;  5C3E H;  1WOC A;  5C44 H;  1B8A A;  1VQD A;  1N9W A;  5HGQ A;  1HR0 Q;  3SGI A;  2PNH A;  4A75 A;  4DR6 L;  1KL9 A;  2CWP A;  4OWX B;  3W1B A;  3W1G A;  5C3E G;  2K5V A;  5IP7 H;  5C0X G;  3A5U A;  1K8G A;  5C44 G;  1FL0 A;  4DV4 L;  1HNW L;  1KQS A;  4IO9 A;  5DLQ E;  3W5O A;  4LF8 Q;  3G6E A;  1X6O A;  5IP7 G;  3CC7 A;  4DR5 L;  2JA5 H;  4OWW B;  4HJ8 A;  1KD1 C;  2E2J H;  1IBM Q;  3TQY A;  1U5K A;  4AQY L;  1YHB A;  4MTN A;  2JA5 G;  5IP9 H;  4YWK A;  1R9T H;  4HIM A;  4LF4 L;  2RHS B;  2ZJP A;  2NVQ H;  2GVB A;  2K52 A;  5IP9 G;  3CD6 A;  2LXK A;  5HY6 A;  2R93 H;  1N36 Q;  4JBW A;  2NN6 G;  4B3M Q;  5GAG C;  3K0X A;  1PYS B;  4IOC A;  5FJ8 H;  1VQF A;  4DR1 Q;  5M3M H;  2R93 G;  4C3J H;  1PH5 A;  4JI5 Q;  2JEB I;  4KHP L;  3G48 A;  1U0L A;  3TEH B;  4DAY B;  1X9N A;  2BA1 A;  5FJ8 G;  4DV6 Q;  1E1T A;  3RZD H;  5M3M G;  3ULL A;  1Z47 A;  2KCT A;  5JEA G;  4L5Q A;  2UUB Q;  4H02 A;  4QY7 A;  3F2B A;  1HZA A;  2QGQ A;  1LTL A;  3J7Z C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...