2KVMA

Solution structure of the cbx7 chromodomain in complex with a h3k27me2 peptide
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
71
structure length
71
Chain Sequence
b'MELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEERDRASGYRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chromobox protein homolog 7
molecule tags Transcription
source organism Mus musculus
publication title Molecular interplay of the noncoding RNA ANRIL and methylated histone H3 lysine 27 by polycomb CBX7 in transcriptional silencing of INK4a.
pubmed doi rcsb
total genus 11
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2010-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2kvmA00
1RJTA 2HUGA 3I8ZA 2RA4A 2K01A 1VMCA 2KUMA 3G7LA 1AZQA 1WTVA 1IL8A 2CVRA 2EE1A 1U4RA 2HDMA 1HHVA 2MP1A 1X3PA 2IL8A 1EOTA 1ESRA 3MWYW 1CM9A 5E4WC 3GV3A 1KNAA 3I3CA 2KEDA 2HCIA 2X69A 2EPBA 3GV6A 3DEPA 5DNFA 1MI2A 1DOKA 1AZPA 4UAIA 1QG7A 2JYOA 1BNZA 1PFBA 4X3KA 2B2TA 1G2SA 2FFKB 1O80A 2XIWA 2B2UA 2B2YA 2K03A 5D65A 1A15A 2K04A 4IUTA 4HCSA 4U68A 1ZXTA 2K28A 2RSOA 1WTPA 1WD0A 2BDNA 3MTSA 1B4OA 3UI2A 1CA5A 1HUMA 3I91A 1X32A 2L9HA 1U4PA 3IFDA 1NCVA 5T1IA 3HP3A 1BF4A 2SDFA 1J9OA 1J8IA 3R93A 5T1GA 1DOMA 2X6LA 4IURA 5JJZA 1WD1A 1ILPA 4QUFA 5COYA 1HFGA 3KUPA 5EPJA 1F9RA 3SVMA 4XDXA 3FPUB 4NW2A 1C8CA 1EL0A 1SAPA 2DY7A 3KBXA 5EQ0A 1WTRA 2VXWA 2MPMA 5CBAE 2NWGA 4RWSC 1MGSA 1BBXC 1HA6A 1EIGA 1B2TA 1LV9A 1M8AA 1O7YA 4OIJA 2Q8TA 2D9UA 1VMPA 2B2VC 4IUQA 2NYZD 1XX8A 3D6WA 4HAEA 1F9PA 4MHEA 1PFMA 2B2YC 2MJ8A 3P7JA 4CJ2C 2K05A 4ZK9B 1DZ1A 1B3AA 3IL8A 2RSNA 5CBEE 1HRJA 2B2WA 1WTQA 1PLFA 1NR4A 1CA6A 3F2UA 4CJ1B 1IKMA 2L4NA 1G6ZA 1RTNA 1DOLA 1NAPA 4LMQD 4DN4M 4IUVA 3TN2A 1ML0D 1SSOA 2HDLA 2JP1A 3DEOA 4OIKA 4R9WA 1KNEA 1WTXA 1XYIA 4HEDA 4XT1B 1GUWA 2KEEA 1WTOA 1PFNA 2K1BA 1O7ZA 3I90A 4R8IA 2KECA 1WVLA 1G91A 1F9QA 4HSVA 4X3UA 5EJWA 3TZDA 1MSGA 1ICWA 1JE4A 2N55A 4ZKBB 1HFNA 4RA8A 2MGSA 4ZKCB 1DONA 3Q6SA 1ILQA 1QE6A 1Q3LA 3FDTA 3N52A 1U4MA 4O42A 2J7ZA 5EPLA 1MSHA 2B2TC 2B2UC 5E4XA 1G2TA 4QUCA 5D14A 3LWEA 2FMMA 4IUUA 2FJ2A 5CMDA 1RHPA 1TVXA 2R3ZA 1EIHA 2B2WC 2Q8RE 2HCCA 4ZLTF 4X3SA 1AP0A 2EOTA 2L12A 2L11A 1NR2A 5AFWA 2H1EA 1X3QA 2RVLA 5EKIA 1IKLA 2KVMA 1JICA 1SDFA 4MN3A 4ZAIA 1B50A 2M2LA 1EQTA 4X3TA 4CJ0B 2B2VA 1F2LA 1QNKA 2X6GA 3DM1A 4RAUC 2FHTA 1HUNA 1B53A 2N88A 3ONAB 4XT3B 5CORA 1E0BA 1PDQA 1RODA 1U4LA 2DY8A 2L1BA 3H91A 3QO2A 1BO0A 1S4ZA 2FINB 4IUPA 1WTWA 2KOLA 1RTOA 2NZ1D 5EPKA 1F9SA
chains in the Genus database with same CATH superfamily
3C2PA 2RA4A 2YU9H 2E2IB 3FRPB 4DV6L 1YJNA 3HKZG 1IL8A 1GUSA 4BBSG 5FLMH 4DR1Q 1TIID 3MWYW 4K14A 4A93H 1MI2A 3URYA 2XN9C 4IPGA 2HHHQ 4EQNA 2EY1A 1O80A 4XQNA 1Q86C 5C0XJ 4KMUC 4IUTA 1EEFD 1IL2A 4ZCKA 1WTPA 1LT5D 4Z9CB 2LKVA 1YBYA 2GVBA 3PCOB 3M85A 4Y7NH 1A3TA 2B8FA 3HOXG 1B9NA 1KDAA 4JC0A 1GHKA 3NBIA 5FLXL 4HIMA 5HGTA 3J7A5 2ZJQA 3E3XA 1PTOF 4JI3L 4OWXB 1V1PA 4JG2A 4N8FA 1CQVA 3FPUB 1Y8OB 5ELEA 5CBAE 1YITA 1X55A 2NZHA 4RWSC 1JB7A 1EIGA 2F0PA 2F0NA 1CZWA 3I4LA 4C3IH 4CKBA 1TU2B 1PRTD 4YWLA 3S24A 3K5MA 3CC7A 3S1MH 4OO1H 1D7QA 1HZBA 1FNUA 4YY3Q 4O1NA 1KL9A 4BBSB 3EJIA 2L4NA 1MHWC 1SMYD 2F3IA 2A68D 1OXUA 2D0PA 1SBBB 2JE6I 3MAQA 1K9MC 3PIOA 3I7FA 3TRZA 1Q1BA 1SE2A 4GKJQ 3GD7A 5I2YA 2NVQB 4KK7A 1DD2A 1YJ9A 1IBKQ 4RGOS 3E0EA 3PO3B 1EWCA 1Q3LA 2KJXA 1UWVA 3C1EA 1LM0A 3RR5A 3EA6A 1CI3M 3CAMA 3KK7A 1BCPD 3ERSX 4A76A 1SE4A 3GO5A 1ASZA 2R7ZB 1HNXL 2B2WC 1VQGA 3V2TA 4LFBL 3R2IA 2L11A 1I3QH 2UXCQ 1PH4A 4JOIA 2NB0A 2R93G 2FHTA 4I7ZC 5IYCH 1XNRQ 4GZYC 4A3LH 1UE5A 2DY8A 2F0GA 3PGZA 4A3JB 2KOLA 1SXTA 4H0LC 2JA7H 3A55A 1HQRD 1TS4A 4RMFA 1P16A 1SNPA 3OW7A 4UPAA 2DN8A 1Y1WG 2A5HA 4JBMA 4HR7B 3ITPA 4YWMA 4QGUA 2PZWA 1EYDA 3E6ZX 4N9TA 4GLXA 1A2TA 3V96A 1YJWA 5J3BA 4ZYSA 1HCZA 3HZXA 4IALA 4A3LG 1PHJA 5KYLA 4OGQC 4B3ML 1Y1VB 3CPWA 3NPPA 4OL7A 1IBMQ 1CSPA 4NP5A 1E22A 2JA5H 4LF9Q 4IPDA 4XIGS 3GTOH 1TWGB 3I4NB 4ME3A 3HP3A 1H9RA 5CV7A 1SMXA 1CK1A 3HGBA 4KTAA 5IGFA 4F8MA 1ILPA 3K80C 3CC4A 1AE2A 1TWFH 5EPJA 3T53B 2EJMA 4JI1L 3SK6A 4XDXA 3SHLA 5IODA 3VR3A 3KDFB 2G9HD 3K0XA 4RCNA 1F2YA 2D9UA 1F2ZA 4PQXA 4A3EG 1PFMA 1DZ1A 4TKOB 1JOOA 4JW0A 1II3A 3WDNA 4CJ1B 3GTKB 3RLOA 4N8X1 1R4PB 1VQLA 2N78A 1Q82C 1HQMC 3M4YA 3BZKA 4C2MB 1VS0A 5K5PA 3KJPA 4X3UA 3TZDA 1ICWA 3PUYA 3S1NB 2MGSA 4ZKCB 1DGSA 1FJGL 4DAYA 2CHBD 2F4VL 4BBRH 1TWHB 3VR4A 2AUKA 2VW9A 1SROA 3CQZB 2KCTA 3O13A 4GN3B 3SDZA 3GTGH 3RZDH 3S17B 1D6EC 2HCCA 1ET9A 3HEJA 4G57A 1SN8A 1V1QA 4L5TA 3E0JA 1IW7C 5G3LF 2A69D 3CCQA 3BZDB 2K5DA 3EIVA 5KNDA 3K0YA 4A3GB 2UU9Q 3E9HA 1CKNB 3P1HA 1RJTA 4B3TQ 4CGYB 5M5WH 1J5EL 5LL6X 3RZOH 4TSSA 2FMCA 4DV7L 1LABA 1KNAA 2HCIA 5IOCA 3TP8A 4IJHA 3H3VI 1CQFA 4RGTA 3WOFA 2PQAB 1OO9B 1B8AA 5KRUA 2DNEA 4KY7A 4O0AA 2RDHA 2XRQD 4DV2Q 1X32A 3T16A 1PA6A 3H0GG 4KKSA 2ZXPA 2CH4A 2YYZA 4HJAA 1WTHA 2XRSD 4G7ZC 2KBNA 1WD1A 2Q2UA 2YTVA 2ZM6Q 5J39A 4X65Q 2UUBL 4GKKQ 4PZ8A 1Q1EA 2E2HB 1WTRA 3BVZA 1PH9A 3AEVA 1NMGA 5D3DA 1M8AA 1V1PB 1XX8A 4IZ8A 3GTMB 1SE8A 3A5UA 3HFZB 5M3FB 4KV6A 4DR7L 4BY1B 1XXGA 4F88A 4LMQD 1Q8KA 4IUVA 3FEWX 4YHHL 1HTPA 4PMBA 3J7YW 2A8VA 1L1OB 2PMZB 4HEDA 3NSWA 4A3FH 2WINB 1EY7A 1HA5A 2PZTA 3M7NA 3TREA 1VF5C 4IJLA 4A3IB 3E9IA 1B9MA 1MSGA 1GD7A 3ER0A 1ASYA 2PI2E 1VQJA 5IGGA 2B2UC 4A3GG 4XQJA 3HOWB 2JA6B 3AU7A 1HZ9A 4QCLA 2IJ0A 2BH8A 3AB9A 3G4SA 2ZTEA 4ZLTF 3SEBA 4LF8L 5L37A 3CF5A 1CZGA 4CDDC 4IOAA 1Z7TA 2KCMA 4OONA 3HKSA 4RAUC 1Q12A 2HD3A 2D0OA 3H0GH 1PDQA 5A35A 1JQYD 3T1HL 1BUVT 1KQSA 2F1MA 1NNXA 4DNRB 3NEMA 1L0YB 3GTPB 2Q2TA 4OX9L 3N6RA 4DV1Q 2HDMA 1YHBA 1AW7A 1CKMA 4JI5L 3W1BA 4HCEA 1XPUA 4K5WA 4BS9A 1KABA 2X69A 2LS01 1VQ7A 1DOKA 1DCZA 4TVAB 1PFBA 1B3QA 3NWTA 1CHQD 4XXEA 1G2SA 3CCLA 4DUZL 3PO2G 2RCFA 2XIWA 5FLMG 2O2LD 1EZ8A 3S9WA 3HS0C 3KBGA 4LF4L 1E1OA 4F7XA 4L6TB 1WD0A 2JA7G 1L1OC 4JBWA 3I91A 5KNCA 4C1NI 3MXGA 1NCVA 1S5BD 1PH6A 4KHPL 4DK6C 4KY6A 2XTIA 4J8QA 1KRTA 4HJ8A 5CV8A 1PH5A 4MTKA 2X6LA 3QR8A 1JJ2A 4QUFA 4QQBX 3MXPA 1K73C 1AE3A 1I4HA 3ZYYX 5IYBH 1KDBA 1PTOB 3EN2A 1X65A 2IWHA 2VQEQ 3PUZA 4DV5Q 1O7YA 2XVSA 4FO2A 2PMZE 1PH7A 5LL6S 4AIMA 4IQZA 1HNWQ 5M5XH 1K0RA 2B2WA 3J7AF 4RFBA 4DUYQ 3DM3A 3M9BA 4JI7Q 1FJGQ 4JI4L 2A73B 5E7NA 1B70B 1BCPF 5KIXA 2RDGA 4A3JG 3MHBA 2KEEA 1OXTA 3E5SA 4DU9A 2MQHA 3JAME 1C0AA 1SYBA 1XTCD 2A68C 3Q6SA 3FDTA 1NBWA 4XTCS 4TQUS 4GS3A 2F0DA 4JYAQ 1IBLL 2EY6A 5IYCG 4X64Q 1G2TA 4IUUA 2DJFC 1KTKA 2QGQA 4DKAC 1TY2A 1SLJA 4O2DA 1N32Q 1NR2A 2PO4A 5AFWA 5IWAL 4IO9A 1J5EQ 2F0TA 2RVLA 1CFMA 4RKLA 3VA7A 4DV3L 4JI1Q 1TS3A 1PRTF 4M8AA 2N49A 2NTSA 2UUCQ 3W2DA 2L15A 2N88A 1W3SA 1IHZA 2CKZB 1U5KA 2F0EA 3FKIB 2AQ1B 1VQFA 1RTOA 2I0QA 5IYDH 5M5YB 4GLAC 2K52A 3CHBD 3W1GA 2JA8B 4DA2A 3BDOA 5C5MA 1EY0A 1EZ6A 5GADC 4K0KQ 5DNFA 3W5OA 4APVA 1GOZA 1TKWB 1QG7A 2JYOA 3J81c 3FVQA 4GNXC 4K8IA 5ELFA 3I4NH 5M3FG 2K04A 2Z6BA 2WAQG 1VQPA 2L5TA 3UI2A 3AFQA 1HUMA 1JC7A 3Q24A 4L5SA 1H95A 1VQHA 3KDFA 4K5VA 4ABNA 3T51B 2WB1G 3NELA 3V05A 3EQLC 3R93A 3EVQA 5DEHA 2P5ZX 3A0JA 1XMQQ 5EKKA 4X62Q 5C4XB 1X6OA 2TSSA 5EKLA 2MUYA 1QILA 5M3MB 1YI2A 5FJ8G 1D1IA 4ZUJA 2L0CA 4JI8Q 1LV9A 4ZUIA 2Q8TA 1VMPA 2HHHL 3J80E 3HOZH 1MIUA 2KA7A 1XMOQ 4C2MH 3STBC 2E75C 1WTQA 1EFID 2JA8G 1CA6A 2ZM6L 2L55A 4DPGA 1E2WA 3AYHB 3K57A 2UUAQ 2HDLA 5LMNW 3A8JE 1JB3A 4GKJL 1SNDA 2F0VA 5M3MG 1LT3D 2F0KA 2WFWA 1RIPA 4HN7A 4S3SA 5FK9C 3S17H 4A3EB 1NSNS 3LNNA 4DV2L 1IZ6A 3ULJA 1QE6A 1XPOA 2IX3A 3FKIG 2SNSA 5TSSA 2H5XA 2IT1A 1EY9A 3T1HQ 4QF4A 3TZUA 3S1RB 4LNQA 1EWIA 2B8GA 3I4MH 1YNNC 4KD3A 4A3GH 4DXGA 3R8BA 1X3EA 2L12A 1N36Q 1PZKD 4NXNL 4EQOA 2K6AA 2KVMA 1JICA 4QIWE 2M2LA 3A7LA 4CJ0B 2ZXOA 1FL0A 2VZAA 5C0XI 1SMYC 1HUNA 2Z9HA 5KYIA 3GDEA 4RGNA 5BN5A 1LTGD 3CMAA 5IT9L 5JEAG 1EY4A 4A3BH 2OCEA 2K5VA 2EE1A 4DR3Q 2YV5A 2V4DA 3C46A 1EOTA 1V8QA 3GV3A 1TWCH 1GUGA 1WCMH 2CFMA 1BNZA 4FF2A 4V0BA 1UEAB 5ELCA 1Y1WH 2B2UA 2RHSB 5IP7H 3D31A 2F4IA 1EIFA 4CDCC 2QA4A 5JJKA 4DK3C 4A3DB 3OHXC 1Q46A 1FYCA 2UU9L 1JMCA 5IGBA 1BXTA 3AFPA 4OXPA 4DNIA 1SR3A 2K5QA 1YNJD 4IUNA 4LW1A 2A6HC 3GTMH 5IP7G 3UDXA 3PO2H 3NENA 4HTHA 2AHOB 4NKLA 1L1OA 5EQ0A 1B1ZA 4BY1H 3R2TA 3MXNB 4KN4C 3R3OA 4LF6Q 4L5QA 2KHIA 2F0LA 1STBA 2R6GA 3K6OA 3P7JA 5BR8Q 1KXLA 1YHQA 4DR1L 1EU3A 4X62L 4EVOA 3NUCA 3D6CA 1HPCA 3F2UA 1I4QA 2PQEA 3CU7A 3DEOA 4GN4B 3L0OA 4K0KL 2EYHA 1PH2A 1EFWA 1WVLA 1K8OA 2WKDA 1XMOL 1C48A 2QCPX 1T9HA 1N33Q 3OMGA 1B44D 2I46A 1DONA 4ILWA 2KCNA 1I94Q 1QNUA 2CQOA 2HIXA 2QDLA 2B2TC 1A3UA 2K32A 1SFOB 1A63A 1OXSC 1I5FA 3T1YL 1HR0Q 2DGYA 4G4KA 5LMNL 2F52A 5J1ZA 4KHPQ 4A3CG 2IHEA 3PO3G 4DV6Q 5K36G 1GXDC 4JI5Q 3J80i 1L2FA 3CC2A 2L1BA 2D2CC 3H91A 1LACA 3A5ZB 4KJOA 1S4ZA 5H1SE 2FINB 1F9SA 1K8AC 1HJPA 4R1JA 4DV0L 1A6XA 3PF4A 1O7LA 1VQEA 1MBYA 5E4WC 4DR3L 4HIOA 3PF5A 2BE5C 5C44H 3DMUA 1K3RA 2ES2A 3GV6A 4ALPA 1QCBD 4LFCL 2PNRC 4C1NK 2B3GA 1JORA 2LXKA 2ZJPA 4HCSA 4U673 3NQTA 4QB4A 2RSOA 1UE6A 4DR4L 2IY5B 1CA5A 2Z4IA 1V1OA 3I73A 1PTOH 2JA6G 4C3HG 4PG3A 3K58A 3I2ZA 3VYSA 1HNWL 1CT1D 1QZGA 1HZAA 3KUPA 3S1MB 2JK8A 1KAAA 2D62A 2VL6A 3HOYB 2VB2X 2KQ3A 3MXUA 2NWGA 4BBRG 2F0JA 1I4GA 1EQQA 2O5IC 4H13C 3J7ZC 1STYA 1LT4D 2MJ8A 3KLSX 1HNZQ 2RSNA 1IBKL 2NVQH 4MIUA 2F0SA 1EY5A 4XYQA 4DN4M 1MJEA 4GOPB 1LT6D 4GN5A 2BH2A 4ODGA 3OYYA 4A93G 1U0LA 4YCWA 4B3TL 2KECA 1RL2A 2I5LX 1F9QA 3EBEA 3FPPA 5C3XA 4ZQ3A 5I2XA 2ZJRA 2BDOA 2EVBA 3N52A 3RLNA 1STAA 1I3QB 2RHQB 4P72A 2EYJA 4AH6A 4X66Q 1Y8NB 1JR0D 3RLFA 1YEZA 2JN4A 2EYLA 2Q8RE 3FKIH 4X3SA 4RH6A 3JAMc 5M5YH 1BBWA 4FXKC 1B50A 3I4MG 1E3PA 4P71A 4X3TA 2EXDA 4CDEC 4JI8L 4KKUA 2UXBQ 1U4LA 4IUPA 1KD1C 3DXJC 1JJCB 1S5DD 2NZ1D 1WOCA 1BQQT 1VMCA 1LTID 3NTKA 4OHJA 3OW2A 4YY3L 2VUMG 3A54A 4ME5A 2F0QA 2F0FA 1X3PA 1FD7D 4JI2Q 5IE8A 2VNUD 2EJGC 3I3CA 4DV7Q 4A3BG 3KFUA 4C3JB 1R9TH 5E3FA 4B3RL 3L7ZC 1VCIA 1YNJC 3CKIB 4RKBA 3GTOB 4KD4A 1YVCA 4FP5D 1B7YB 5HURA 1ZXTA 2K28A 4M1UB 4PMWA 4P73A 2MO1A 3G48A 3IAYA 1VQIA 5C4XH 3IFDA 3QOJA 5FJ8H 1TWFB 5GAEC 3I56A 3HOUB 2DUDA 2Z4HA 4RGMA 4K6DA 2SDFA 5CV5A 4UDUC 2QW7A 2BA1A 2E74C 3HG9A 1P8LA 5AJ3L 1H9MA 1QJOA 5JJZA 2LFNA 3A7AB 2F0IA 3GTKH 2F3VA 1SNCA 2IW3A 2LMCB 4A3KG 2Y0SE 3WWVA 1VQDA 4ZK9B 2JEAI 1NY4A 1C9OA 2O5JC 3VR2A 4JI7L 2B63G 1N33L 2SEBD 1IYJB 3X3MA 3WOEA 4LF7L 1SJHD 4BA2I 1VQCA 1ZEQX 4A3EH 1NJIC 3AMUA 2JP1A 1XYIA 4GOPA 1TWHH 1WFQA 3K81C 1XJVA 3GTQH 3RZDB 5ELOA 4RCOA 2CW0C 2VUMH 3I4MB 2BA0A 2IPKD 4ZKBB 3D8GA 1FNVA 4B9XA 1CUKA 2RKSA 4O42A 2A6HD 3MZ5A 4DR5Q 4V190 3LWUA 4BXXG 1EYGA 2A74C 3H94A 3QG1A 4AYBE 3CCUA 1L0WA 5FLXE 1UEBA 1I6HB 1D5XC 3ICEA 1HZCA 5CV9A 4A3BB 3RZOB 4CKCA 3DUZA 5CV4A 3M7GA 4K2LA 1RODA 2F0OA 3SK4A 4BY7G 1W2BA 1BO0A 1TWCB 2BCOA 1YIJA 4YWKA 1VQ9A 3S2HH 3S14H 2TMPA 1WTVA 2BOSA 1Y1WB 5BR8L 2IL8A 1ESRA 1S5CD 2EPBA 3J81L 3TS2A 5IT9E 4JYAL 1BVSA 3DWPA 4HSPA 1IBLQ 3VYUA 2EY5A 2A69C 4X3KA 3RN2A 4A3DH 1DYQA 2FFKB 3SR1A 3TP5A 4Y52H 5I4DA 2B2YA 5CGKA 1I50B 2OTJA 3F8TA 1I4XA 2R7DA 1F2MA 1FNWA 1PZID 4JOIC 3T1YQ 2HQLA 2R92B 4A3MB 1BR9A 1OXVA 4AYBG 4C3HH 1K0SA 3PO2B 2EY2A 4OWTB 1X3FA 4PZ7A 1A2UA 5T1GA 4LAAA 4JBKA 4QIWB 2AWNA 3TBIB 3MEFA 5M3FH 3BYTB 3EFXD 3NTHA 5C0XG 4ID6A 4BXXH 3G6EA 1HA6A 3VDYA 5J22A 1GVPA 2UXBL 3NK9A 3H6MA 3L3OC 1QUQB 2ZTCA 4N9PA 1K83B 1HRJA 3TP7A 2KHJA 2VB3X 3BG3A 2C35B 3MA2B 1N34Q 4NXML 4B3SL 3NWSA 4LK1C 3OIQA 4R9WA 4LF7Q 4UP8A 2QKIC 1ZKOA 4BY7H 2AWOA 1SFOH 1O7ZA 5JPNC 2Q8IB 1PTOC 3PIP3 3Q22A 3KOJA 1ONLA 3OSOA 5I6WA 2ALYB 3M3YB 1I4RA 4C3JG 4MTNA 1MSHA 4JBJA 5E4XA 2K75A 3D4RA 2FMMA 4FXDA 4FF4A 1EIHA 3H0GB 1GO3E 3NE5B 3BYYB 4PNYA 3ND9A 2A1AA 5GAHC 1KDCA 4LUVA 3Q0AA 1D5ZC 3CCVA 4G7HC 4R8NA 2HQEA 1BBUA 5JPMC 5EKIA 1IKLA 5G3LD 2Z1CA 1A8VA 1PYSB 5DM73 1QNKA 1TS5A 2NVYB 2EDGA 3HOUG 3J81j 4CHTB 5IT9c 2NZOA 4H7BA 5EPKA 4YIJA 4B08A 1H9SA 2K01A 4EQ5A 2CVRA 3SK8A 1GKHA 2I07B 1STHA 4JCVE 1S5ED 3DEPA 4DR2Q 4IPCA 1TXYA 2QILA 3PIO3 1UAPA 2OQ0A 1YNND 4DNTB 4HJ5A 4U68A 2NVTB 4DR5L 4C3IG 4K8JA 2PYKA 3MTSA 2E8GA 1XPRA 2ZXRA 3HKZE 3HOYH 3HRZC 4G7OC 2CWAA 3OPOA 1STEA 2A19A 1XMQL 3CMEA 3HOYG 3BZCA 1Q81C 3OMCA 1C8CA 3T13A 2WKCA 1EL0A 1MD2D 2N8NA 2MPMA 1QVGA 2CW0D 4LJZC 2QDBA 4FVMA 4HIKA 1AH9A 1JWMD 4KHZA 5DM63 1ET6A 2IX1A 5CBEE 1D1KA 3FHWA 1G6PA 4AQYL 3S2DB 1G6ZA 2K5NA 4LUZA 2Q2HA 4B3RQ 4J6HA 4QL5A 3TN2A 2Y0SB 5C4JH 2K1BA 4R8IA 1RCVD 1X9NA 1VF7A 2A6ED 1J6QA 1I94L 5IWAQ 1HFNA 4FF3A 3S16H 1ILQA 4A3KH 3DWAA 1MJCA 1SRUA 2WAQE 2EYOA 1LUZA 4CDFC 1GUTA 1U9RA 3LWEA 5IYBG 3KLWA 4QJFA 3MFGA 5EBCA 1SNOA 1VQ5A 3D4WA 3C3LA 1X3QA 3RMHA 4XYOA 4DF7A 1TWAH 2AMCB 1CKOA 2PZUA 1UE1A 3DM1A 4I7AA 3HOVG 1TY0A 2PI2A 1BKBA 1R9TB 2KENA 1EYAA 4KKTA 1W6KA 3P75A 4CBVA 4JI6Q 3J80L 4DAYB 4DV4Q 5FKAC 1HHVA 2AUJD 4LF4Q 5NUCA 4B3SQ 1VDZA 3GTJH 2VQFL 1DJRD 1ZYRC 1PVOA 1STGA 5JOBA 2Z8LA 2F03A 2PW5A 2YU9B 2MFIA 2DNCA 4BY1G 4EQPA 3K5NA 3KJOA 2K03A 1VQMA 1KC8C 3I4OA 2MHVA 3VR5A 2ICEC 5CR3A 5KEEA 1U4PA 2R7ZG 2WB1B 2QEXA 2M9VA 5T1IA 2WIIB 2VQEL 4HJ9A 1ENFA 2RCNA 4K2KA 1Q90A 3CCRA 1DOMA 1E2VA 4OWWB 2PNHA 1QB5D 1VQ4A 4JI0Q 5LMUQ 1YZ6A 1JJGA 1HFGA 5IY0A 1F9RA 3RN5A 4Y7NB 2VXWA 3GP7A 3BDLA 1QVCA 1EUJA 1K8MA 1CSQA 1T5XD 4MHEA 4HJ7A 1DXMA 3GTQB 2QEJC 4R4QA 4BWGB 3D4DA 3NXWA 3A8IE 1NR4A 1ENCA 1V9PA 1QUQA 2AQ2B 3DHQA 2K5WA 2SOBA 1ENAA 1EYCA 4C3IB 2M00A 4XT1B 3HOVH 2N3SA 4KLKA 4IOCA 2CH4W 1H9KA 4Q5VA 2B63H 2EZVA 5EJWA 1F77A 2K7VA 1EEID 2JEBI 1JWUD 1I6HH 3TMEA 2VQFQ 3S1QB 5EPLA 2F0WA 1YNXA 1LLRD 3RD4A 1I4PA 3S15H 3I70A 5C0XH 1Y69U 2JA9A 2Z6KC 3KYHC 3JAML 1RHPA 4MNOA 2F0HA 4NB3A 3D3RA 4PMCA 5LMNQ 3PO3H 2OQKA 2H1EA 3NTIA 4NPSA 3S2HB 4L5RC 5F2DA 4L63B 2EQSA 2R7FA 4LF8Q 5ELDA 1X54A 1E7ZA 4R4OA 1NUCA 2R7ZH 3J80c 5EAYA 1LYLA 3PMFA 5KNBA 2R3ZA 1Q7YC 1WCMB 4OX9Q 4DV1L 5DLQE 5AJ3Q 4B3MQ 1OXXK 4UP7A 1EOVA 1U4RA 3I4NG 1SYCA 4A75A 4WJ3M 2E76C 3K7UC 2V1CC 1H9SB 3PIPA 3CCEA 4ULLA 4AQYQ 4A3JH 3K5LA 1D2BA 2JA7B 3CCSA 3OWEB 2RQXA 1JE5A 2IHFA 1S3OA 4LWCA 2ASBA 1VQAA 2YTXA 3CPFA 4C3HB 1A0IA 1NTGA 3A74A 4PV1C 5DAUA 2AKWB 5D65A 4IFDI 3DLLA 2K33A 2UXDQ 2G9DA 4JI4Q 2NN6H 3ULLA 1KAWA 4DFAA 4CKEA 1GUNA 1J9OA 5KGUA 2OXPA 4NXNQ 1BCPC 3T56B 1R4QB 4QMGA 2LXJA 2JA5B 5IIFA 5COYA 1XNRL 5CV6A 4KJNA 1AZPA 3KBXA 5HY6A 2OF1A 2A6EC 4RHRA 1LTAD 3J81E 2NYZD 3HOXB 5BN4A 4BY7B 1G8ZD 1YHAA 5IGDA 3IFTA 2BE5D 1PLFA 4EGVA 1IYUA 3K59A 2PCFB 3CRLC 2OEOA 1KLUD 3CD6A 4DAMA 3M3YH 1O78A 3JAMi 1G291 4DK0A 1N8RC 1PRTC 2KHSA 1PFNA 1PH8A 1LTRD 4GLVB 1E24A 4HSVA 2C5CA 4RA8A 3CCJA 5A2QE 1U4MA 3PUVA 3H3VC 3UDFA 4GNXA 1SYDA 5M9OA 2NUCA 4QUCA 2NVYH 2R93B 5CMDA 3RNUA 2H4OA 3OIPA 4IFDH 2MNAA 3S1NH 3VYTA 4DV3Q 1K8GA 1AFPA 4BBRB 1FVIA 4OELB 1K28A 3CQZH 3MEHA 4NXMQ 1B53A 3D0FA 3ONAB 1HTLD 4IFDJ 3QO2A 4R4IA 4A3FG 5C44B 4FF1A 5C5LA 4HIDA 3UE0A 1VQOA 3NP8A 1AZQA 4PZ6A 2XWBB 4FNFA 4GNXB 5CC4A 2MP1A 1HR0W 1S5FD 1KHIA 1TQOA 4FXGC 1C7YA 4R4CA 2R92G 1PZJD 4K6LA 2E2JH 1ESFA 1X3GA 4X64L 3GTLB 1LTTD 2CCZA 1MKHA 5C3EH 3SK5A 5FO7B 1ICFB 2E2DC 1W6JA 2J4XA 1BCPB 3C1FA 3TP6A 2WP8J 5ELBA 4LFAL 2E5LL 1N34L 2UUCL 2GA4B 3K7AH 4YCUA 2HT1A 5C6AA 3NHHA 1J8IA 1Z6HA 1GM5A 3CW2C 4DK1A 4IURA 4IPHA 1QWYA 1DM0B 4RHSA 4JV5Q 1X56A 3G71A 4A3IG 3UDIA 3T4AC 4NW2A 2DY7A 1MGSA 4DV4L 2B2VC 3D6WA 1PRTB 1F9PA 1NE3A 5C4JB 5I6YA 1XNQQ 1B3AA 1EIYB 3F2CA 1SEBD 3U9SA 1V43A 5E1FA 1XWEA 4HMJA 2E2HH 1RTNA 1G51A 2NVXB 1NAPA 3S16B 1A3VA 1QOHA 1ML0D 1FGBD 1SSOA 3F1ZA 1KNEA 1GUWA 4R4TA 3I90A 1SJED 2SNMA 2LSSA 3ND8A 1RF2D 5IYDG 4JV5L 4F87A 2J7ZA 2RBMA 2XGTA 3TEHB 4A3FB 1TWAB 1Z47A 2WACA 5C4HA 4A3IH 1Y14B 1CKNA 3ERQA 4WRDA 1CHPD 1KRSA 3FP9A 3KF8A 3IRBA 4MN3A 3NBHA 3HOWH 2PPBC 1F2LA 3G6JB 5CORA 1BOSA 3GTJB 3QJYA 1LTSD 1LO5D 4JI6L 4C3JH 3K5OA 1FGUA 3L2PA 1PH3A 2KUMA 1HXYD 3G7LA 1C4QA 3OTOQ 4J1MA 2PQAA 2CQAA 3M4OB 5LHY1 3NQIA 1EQRA 3SE0A 1S40A 2K5HA 2O4XA 3I55A 4DR6L 3I72A 2KEDA 2R61A 3STBD 3BU2A 4P74A 2E2IH 2K4KA 3GTPH 2B2TA 3K8AA 3QB3A 2OTLA 3HOUH 1WYDA 4YCVA 1A15A 2EYMA 4DR4Q 4A93B 5FO9B 2LY7A 1SYGA 1PV4A 3VA5A 5ELNA 2ZTDA 3M4PA 5I9PA 1K3BC 1VQKA 4DV5L 4DUZQ 3KF6A 4MZ9A 2JA5G 1H9JA 2K50A 1FR3A 2QF7A 2GVAA 3PQIA 3QOLA 1D8LA 4DUYL 4WORA 3F2DA 4OEMB 1SAPA 4A3DG 1N9WA 5C3WA 4HMIA 1RKNA 4LF6L 4OIJA 2ID0A 3FMCA 4IUQA 4DGZA 1N36L 3HOVB 4DXFA 2K05A 2OWOA 3BVGA 2B63B 1IKMA 2VUMB 1IBML 1I6VC 1KLGD 2GN5A 2K14A 3S1QH 3KLRA 1WTOA 2WAQB 3S15B 1TT2A 5M5XB 2RF4A 3Q23A 4BBSH 3H15A 4LFAQ 1JE4A 2Z0SA 3P20A 2N55A 2EXZA 1Z9FA 4I65A 4GOPC 1EY8A 2C9OA 2WV6D 3MFYA 4LF5Q 2ICIA 2WB1E 3CP0A 4X6AH 5C4XG 3LGJA 1AP0A 2EOTA 3CRKC 1RDPD 5ISRA 3MC0B 3S14B 1EQTA 4IFDG 1Y1VG 2UXCL 3A56A 5C3EG 1PMRA 4DAPA 4A3MG 1E0BA 3U4VA 1IYVA 1D5MC 3OWFA 1WCMG 4JVZA 2VS1A 4RG1A 1GJXA 4H02A 4B9WA 1HNXQ 4LFBQ 3I8ZA 1JOKA 2NN6I 2B29A 4TRDA 1UUPA 1CM9A 1I50H 4X65L 1PXUA 3UE1A 3HOZG 1VQ6A 4LF5L 2F3WA 3H3VH 1KIXA 1PTOD 1M90C 4KHVA 2R92H 4A3MH 4DR2L 3TS0A 2JA8H 1SNQA 5FOBB 3BDCA 4OO1G 4LFCQ 1Q8IA 3MVVA 2UXDL 4H44C 5GQOA 1BDOA 1E2ZA 1TR5A 2NBFA 4DR7Q 1VQBA 1GUOA 4KI0A 4DR6Q 4JI3Q 3BVMA 2BDNA 1B4OA 1IW7D 2L9HA 4NDXA 2JXMB 1Y1VH 5FLXc 1BF4A 5GAGC 1N32L 2EIFA 2EJFC 3L9AX 3KF6B 4FYDA 3PV0A 5IP9H 3TDQA 3VYRA 3HOXH 4A3CH 1PYBA 5BN3A 1K83H 4IN3A 4P2CB 1TWGH 3VR6A 2G5DA 2JJQA 2RDFA 2FXQA 3MXNA 4A4IA 4HAEA 4Q0FA 4CJ2C 4LUOA 3IL8A 2EYFA 2NTTA 2MO0A 3EROA 5M3MH 2Z6KA 5IGCA 2OT2A 4WJWA 1WTXA 3HOZB 3DWQA 3OOCA 3U58A 3UDGA 1PH1A 1LTLA 4ZRZA 1M4VA 1G91A 2IX0A 2R93H 3HOWG 2I5HA 1EWHA 5CYUA 4WJ4A 5K36H 1VQ8A 5LMUL 4LF9L 2JQOA 5GROA 5D14A 2KCCA 1SYEA 3AQQA 4X66L 1M1KC 2F0MA 1PYWD 4BA1I 1JOQA 1HR0L 4WFN3 3B6YA 1SDFA 1QZHA 1SNMA 1NMFA 1A62A 2B2VA 3KLSA 1LTBD 3IKJA 3GTGB 3KF8B 2PW7A 1AEXA 4C56C 3S1RH 3J7AV 4UHVA 3Q8DA 3F2BA 3U4ZA 1IXRA 2X6GA 2E2JB 2HUGA 5JEAJ 1EY6A 4L8JA 2VY3A 4DAVA 3GTLH 1EU4A 5C3EB 3PUWA 1JCKB 4JI0L 3SGIA 2E5LQ 1RD9D 1Y8PB 4E6IA 2NVTH 3JC66 2DJGC 2ZT9C 2XSCA 3TSSA 4J15A 2JSOA 4UAIA 5M5WB 4XQQA 3A8KE 1L0XB 3PSIA 3QIAA 2HIVA 3K7AB 3OTOL 4OO1I 1XTDA 1CTMA 2I5MX 5EGTA 1JWSD 3J81i 3BS1A 3W3AA 5A2QL 2F4VQ 4EX5A 5FO8B 1VQNA 2Q2IA 4POGA 5HGQA 1SE3A 5C4ZA 2J0TD 4JPBW 4KN7C 2ATWA 3H09A 1QVFA 2YTYA 3GQBA 3LX0A 1XNQL 1E1TA 3QWNA 5D3IB 1AN8A 2EYPA 1UNSA 3SVMA 1HH2P 3S2DH 3X3NA 1S72A 5JJLA 3PUXA 4NMZA 2UUAL 4UP9A 1WJJA 1BBXC 2UUBQ 2D5DA 2NVXH 2F0UA 1SYFA 1GHJA 4GKKL 1B2TA 2NN6G 3M4QA 1WI5A 2B2YC 5C44G 3ZJYC 4QY7A 1TS2A 3CCMA 4DV0Q 4AYBB 4JK1C 1DOLA 2AQ3B 3U9OA 4FDBA 3BJUA 4OIKA 4A3KB 5I9OA 1JT8A 1OTCA 3RUZA 4UY8C 4P75A 4KY5A 2ENBA 1STNA 1ZYRD 5JEAH 3CXCA 4JI2L 3NBHB 3U50C 1T5EA 3ULPA 4YHHQ 4POFA 1EQVA 2XNAC 4K5XA 5JVH3 2FJ2A 1PFSA 1TVXA 3HKZB 5IGEA 5JVG3 5JJIA 5EBDA 5IP9G 1O7IA 2Y0SG 2B39A 4ZAIA 3TQYA 2JA6H 3M4OH 4XT3B 2CWPA 1UE7A 5JAVA 1WTWA 2XWJB 3SXHA 1HNZL
chains in the Genus database with same CATH topology
3C2PA 2RA4A 2E2IB 3FRPB 1IL8A 1GUSA 1TIID 3MWYW 4K14A 1MI2A 3URYA 2XN9C 4EQNA 2EY1A 1O80A 4XQNA 5C0XJ 4KMUC 4IUTA 1EEFD 1WTPA 1LT5D 4Z9CB 2LKVA 3M85A 1A3TA 2B8FA 1B9NA 1KDAA 1GHKA 3NBIA 5FLXL 5HGTA 1PTOF 1V1PA 1CQVA 3FPUB 1Y8OB 5ELEA 5CBAE 4RWSC 1EIGA 2F0PA 2F0NA 1CZWA 3I4LA 4CKBA 1TU2B 1PRTD 3K5MA 4OO1H 1FNUA 4O1NA 4BBSB 3EJIA 2L4NA 1SMYD 2A68D 1OXUA 1SBBB 2JE6I 3MAQA 1Q1BA 1SE2A 3GD7A 5I2YA 2NVQB 4KK7A 1DD2A 4RGOS 3PO3B 1EWCA 1Q3LA 2KJXA 3C1EA 3EA6A 1CI3M 3KK7A 1BCPD 1SE4A 3GO5A 2R7ZB 2B2WC 3V2TA 3R2IA 2L11A 2NB0A 2FHTA 4I7ZC 4GZYC 2DY8A 2F0GA 4A3JB 2KOLA 1SXTA 4H0LC 3A55A 1HQRD 1TS4A 1SNPA 3OW7A 2DN8A 2A5HA 4HR7B 3ITPA 2PZWA 1EYDA 3E6ZX 4N9TA 1A2TA 3V96A 4ZYSA 1HCZA 3HZXA 4IALA 5KYLA 4OGQC 1Y1VB 3NPPA 4OL7A 4NP5A 4XIGS 1TWGB 3I4NB 3HP3A 1H9RA 5CV7A 1CK1A 3HGBA 4KTAA 5IGFA 4F8MA 1ILPA 3T53B 5EPJA 2EJMA 3SK6A 4XDXA 3SHLA 5IODA 3VR3A 2G9HD 4RCNA 1F2YA 2D9UA 1F2ZA 4PQXA 1PFMA 1DZ1A 4TKOB 1JOOA 1II3A 3WDNA 4CJ1B 3GTKB 1R4PB 1HQMC 3M4YA 4C2MB 5K5PA 4X3UA 3TZDA 1ICWA 3PUYA 3S1NB 2MGSA 4ZKCB 4DAYA 2CHBD 1TWHB 3VR4A 2AUKA 3CQZB 3O13A 3SDZA 3S17B 1D6EC 2HCCA 1ET9A 3HEJA 4G57A 3E0JA 1IW7C 5G3LF 2A69D 3BZDB 2K5DA 5KNDA 3K0YA 4A3GB 3P1HA 1RJTA 4CGYB 5LL6X 4TSSA 2FMCA 1LABA 1KNAA 2HCIA 5IOCA 3TP8A 1CQFA 4RGTA 3WOFA 1OO9B 5KRUA 2DNEA 4KY7A 2RDHA 2XRQD 1X32A 3T16A 4KKSA 2ZXPA 2YYZA 2XRSD 4G7ZC 1WD1A 5J39A 1Q1EA 2E2HB 1WTRA 3BVZA 5D3DA 1M8AA 1V1PB 1XX8A 4IZ8A 3GTMB 5M3FB 4KV6A 4BY1B 1XXGA 4F88A 4LMQD 4IUVA 3FEWX 1HTPA 4PMBA 3J7YW 2PMZB 4HEDA 3NSWA 2WINB 1EY7A 1HA5A 2PZTA 3M7NA 1VF5C 4A3IB 1B9MA 1MSGA 5IGGA 2B2UC 4XQJA 3HOWB 2JA6B 3AU7A 4QCLA 2IJ0A 3AB9A 4ZLTF 3SEBA 1CZGA 1Z7TA 4RAUC 1Q12A 5A35A 1PDQA 1JQYD 1BUVT 2F1MA 4DNRB 1L0YB 3GTPB 3N6RA 2HDMA 1AW7A 4HCEA 4K5WA 4BS9A 1KABA 2X69A 2LS01 1DOKA 1DCZA 1PFBA 4XXEA 3NWTA 1CHQD 1G2SA 2XIWA 2O2LD 1EZ8A 3S9WA 3HS0C 3KBGA 4F7XA 4L6TB 1WD0A 4JBWA 3I91A 5KNCA 4C1NI 3MXGA 1NCVA 1S5BD 4KY6A 4J8QA 5CV8A 2X6LA 4QUFA 3MXPA 1I4HA 3ZYYX 1KDBA 1PTOB 2IWHA 3PUZA 1O7YA 2XVSA 4FO2A 5LL6S 4IQZA 2B2WA 3J7AF 4RFBA 2A73B 1BCPF 5KIXA 2RDGA 3MHBA 2KEEA 1OXTA 3E5SA 4DU9A 3JAME 1SYBA 1XTCD 2A68C 3Q6SA 3FDTA 4XTCS 4TQUS 2F0DA 2EY6A 1G2TA 4IUUA 1KTKA 1TY2A 1NR2A 2PO4A 5AFWA 2F0TA 2RVLA 1CFMA 4RKLA 3VA7A 1TS3A 1PRTF 4M8AA 2NTSA 3W2DA 2N88A 1IHZA 2F0EA 3FKIB 2AQ1B 1RTOA 5M5YB 3CHBD 2JA8B 4DA2A 3BDOA 5C5MA 1EY0A 1EZ6A 5DNFA 1GOZA 1TKWB 1QG7A 2JYOA 3FVQA 4K8IA 5ELFA 2K04A 2L5TA 3UI2A 1HUMA 1JC7A 3Q24A 4K5VA 4ABNA 3T51B 3V05A 3EQLC 3R93A 3EVQA 5DEHA 5EKKA 5C4XB 2TSSA 5EKLA 2MUYA 1QILA 5M3MB 1D1IA 4ZUJA 2L0CA 1LV9A 4ZUIA 2Q8TA 1VMPA 3J80E 2KA7A 2E75C 1WTQA 1EFID 1CA6A 2L55A 1E2WA 3K57A 2HDLA 3A8JE 1JB3A 1SNDA 2F0VA 1LT3D 2F0KA 4HN7A 4S3SA 5FK9C 4A3EB 1NSNS 3LNNA 1QE6A 2IX3A 2SNSA 5TSSA 2IT1A 1EY9A 4QF4A 3TZUA 3S1RB 2B8GA 1YNNC 4KD3A 4DXGA 3R8BA 2L12A 1PZKD 4EQOA 2K6AA 2KVMA 1JICA 2M2LA 3A7LA 4CJ0B 2ZXOA 5C0XI 1SMYC 1HUNA 5KYIA 4RGNA 5BN5A 1LTGD 5IT9L 5JEAG 1EY4A 2EE1A 3C46A 2V4DA 1EOTA 1V8QA 3GV3A 1GUGA 1BNZA 4FF2A 4V0BA 1UEAB 5ELCA 2B2UA 3D31A 2F4IA 4A3DB 3OHXC 1FYCA 5IGBA 1BXTA 2K5QA 1YNJD 4IUNA 2A6HC 4HTHA 4NKLA 5EQ0A 1B1ZA 3R2TA 4KN4C 3R3OA 2F0LA 2R6GA 1STBA 3K6OA 3P7JA 1EU3A 4EVOA 3NUCA 3D6CA 1HPCA 3F2UA 1I4QA 2PQEA 3CU7A 3DEOA 2EYHA 1WVLA 1K8OA 2WKDA 1C48A 2QCPX 3OMGA 1B44D 2I46A 1DONA 4ILWA 2KCNA 1QNUA 2B2TC 1A3UA 2K32A 1SFOB 1OXSC 4G4KA 5J1ZA 5K36G 1GXDC 2L1BA 2D2CC 3H91A 1LACA 4KJOA 1S4ZA 2FINB 1F9SA 1A6XA 1O7LA 1MBYA 5E4WC 2BE5C 3DMUA 3GV6A 1QCBD 2PNRC 4C1NK 1JORA 4HCSA 4U673 3NQTA 4QB4A 2RSOA 1CA5A 2Z4IA 1V1OA 3I73A 1PTOH 4C3HG 3K58A 3VYSA 1CT1D 3KUPA 3S1MB 1KAAA 2D62A 3HOYB 2VB2X 2KQ3A 3MXUA 2NWGA 2F0JA 1I4GA 2O5IC 4H13C 1STYA 1LT4D 2MJ8A 3KLSX 2RSNA 4MIUA 2F0SA 1EY5A 4XYQA 4DN4M 1LT6D 4ODGA 2KECA 1F9QA 3FPPA 5C3XA 4ZQ3A 5I2XA 2BDOA 2EVBA 3N52A 1STAA 1I3QB 2EYJA 1Y8NB 1JR0D 3RLFA 2EYLA 2Q8RE 4X3SA 4RH6A 4FXKC 1B50A 4X3TA 4KKUA 1U4LA 4IUPA 3DXJC 1S5DD 2NZ1D 1BQQT 1VMCA 1LTID 3NTKA 4OHJA 4ME5A 2F0QA 3A54A 2F0FA 1X3PA 1FD7D 2VNUD 2EJGC 3I3CA 4C3JB 5E3FA 3L7ZC 1VCIA 1YNJC 3CKIB 4RKBA 3GTOB 4KD4A 4FP5D 5HURA 1ZXTA 2K28A 4M1UB 4PMWA 3IAYA 3IFDA 3QOJA 1TWFB 3HOUB 2Z4HA 4RGMA 4K6DA 2SDFA 5CV5A 4UDUC 2BA1A 2E74C 3HG9A 1H9MA 1QJOA 5JJZA 2LFNA 3A7AB 2F0IA 2F3VA 1SNCA 2IW3A 2LMCB 4ZK9B 2JEAI 2O5JC 3VR2A 2SEBD 3X3MA 3WOEA 1SJHD 4BA2I 1ZEQX 3AMUA 2JP1A 1XYIA 3RZDB 4RCOA 3I4MB 2CW0C 2BA0A 2IPKD 4ZKBB 3D8GA 1FNVA 4B9XA 2RKSA 4O42A 2A6HD 3MZ5A 4V190 3LWUA 2A74C 3H94A 3QG1A 5FLXE 1I6HB 1D5XC 5CV9A 4A3BB 3RZOB 4CKCA 3DUZA 5CV4A 3M7GA 4K2LA 1RODA 2F0OA 3SK4A 1BO0A 1TWCB 2BCOA 2TMPA 1WTVA 2BOSA 1Y1WB 2IL8A 1ESRA 1S5CD 2EPBA 3J81L 5IT9E 4HSPA 3DWPA 3VYUA 2EY5A 2A69C 4X3KA 1DYQA 2FFKB 3SR1A 3TP5A 5I4DA 2B2YA 5CGKA 1I50B 1I4XA 1F2MA 1FNWA 1PZID 2R92B 4A3MB 1BR9A 1OXVA 3PO2B 2EY2A 1A2UA 5T1GA 4LAAA 4QIWB 2AWNA 3TBIB 3BYTB 3EFXD 3NTHA 5C0XG 4ID6A 1HA6A 5J22A 3NK9A 3H6MA 3L3OC 4N9PA 1K83B 1HRJA 3TP7A 2VB3X 3BG3A 3MA2B 3NWSA 4LK1C 3OIQA 4R9WA 2QKIC 1ZKOA 2AWOA 1O7ZA 5JPNC 2Q8IB 1PTOC 3PIP3 3Q22A 1ONLA 3OSOA 5I6WA 3M3YB 1I4RA 4C3JG 1MSHA 5E4XA 3D4RA 2FMMA 4FXDA 4FF4A 1EIHA 3H0GB 4PNYA 3NE5B 3BYYB 3ND9A 1KDCA 3Q0AA 1D5ZC 4G7HC 4R8NA 2HQEA 5JPMC 5EKIA 1IKLA 5G3LD 2Z1CA 5DM73 1QNKA 1TS5A 2NVYB 2EDGA 4CHTB 4H7BA 5EPKA 4YIJA 4B08A 1H9SA 2K01A 2CVRA 3SK8A 2I07B 1STHA 1S5ED 3DEPA 2QILA 3PIO3 1UAPA 1YNND 4DNTB 4U68A 2NVTB 4C3IG 4K8JA 2PYKA 3MTSA 2ZXRA 3HRZC 4G7OC 3OPOA 1STEA 3OMCA 1C8CA 3T13A 2WKCA 1EL0A 1MD2D 2MPMA 2CW0D 4LJZC 2QDBA 4FVMA 1JWMD 4KHZA 5DM63 1ET6A 2IX1A 5CBEE 1D1KA 3S2DB 1G6ZA 4J6HA 3TN2A 2Y0SB 2K1BA 4R8IA 1RCVD 1VF7A 2A6ED 1HFNA 4FF3A 1ILQA 3DWAA 2EYOA 1GUTA 1U9RA 3LWEA 3MFGA 5EBCA 1SNOA 3D4WA 3C3LA 1X3QA 3RMHA 4XYOA 4DF7A 2PZUA 3DM1A 1TY0A 1R9TB 1EYAA 4KKTA 1W6KA 3P75A 4CBVA 3J80L 5FKAC 1HHVA 2AUJD 5NUCA 1VDZA 1DJRD 1ZYRC 1STGA 5JOBA 2Z8LA 2F03A 2PW5A 2YU9B 2DNCA 4EQPA 3K5NA 2K03A 2MHVA 3VR5A 2ICEC 5CR3A 5KEEA 1U4PA 2WB1B 2M9VA 5T1IA 2WIIB 1ENFA 4K2KA 1Q90A 1DOMA 1E2VA 1QB5D 1HFGA 1F9RA 4Y7NB 2VXWA 3GP7A 3BDLA 1K8MA 1T5XD 4MHEA 1DXMA 3GTQB 2QEJC 4BWGB 3D4DA 3NXWA 3A8IE 1NR4A 1ENCA 2AQ2B 3DHQA 2K5WA 2SOBA 4C3IB 1ENAA 1EYCA 2M00A 4XT1B 1H9KA 4Q5VA 2EZVA 5EJWA 1F77A 2K7VA 1EEID 2JEBI 1JWUD 3TMEA 3S1QB 5EPLA 2F0WA 1LLRD 3RD4A 1I4PA 3I70A 5C0XH 1Y69U 3JAML 1RHPA 2F0HA 3D3RA 4PMCA 2H1EA 3NTIA 3S2HB 5F2DA 4L63B 5ELDA 1NUCA 3PMFA 5KNBA 2R3ZA 1WCMB 1OXXK 1U4RA 1SYCA 2E76C 1H9SB 4ULLA 3K5LA 1D2BA 2JA7B 3OWEB 2RQXA 4C3HB 5DAUA 4PV1C 5D65A 4IFDI 2K33A 2G9DA 2NN6H 4DFAA 4CKEA 1GUNA 1J9OA 5KGUA 2OXPA 1BCPC 3T56B 1R4QB 4QMGA 2JA5B 5IIFA 5COYA 5CV6A 4KJNA 1AZPA 3KBXA 2OF1A 2A6EC 4RHRA 1LTAD 3J81E 2NYZD 3HOXB 5BN4A 4BY7B 1G8ZD 5IGDA 3IFTA 2BE5D 1PLFA 4EGVA 1IYUA 3K59A 2PCFB 3CRLC 2OEOA 1KLUD 1O78A 1G291 4DK0A 1PRTC 2KHSA 1PFNA 1LTRD 4HSVA 2C5CA 4RA8A 5A2QE 1U4MA 3PUVA 3H3VC 1SYDA 5M9OA 2NUCA 4QUCA 2R93B 5CMDA 2H4OA 3OIPA 4IFDH 3VYTA 1AFPA 4BBRB 3MEHA 1B53A 3ONAB 1HTLD 4IFDJ 3QO2A 4FF1A 5C44B 5C5LA 3NP8A 1AZQA 2XWBB 4FNFA 5CC4A 2MP1A 1S5FD 1TQOA 4FXGC 1PZJD 4K6LA 1ESFA 3GTLB 1LTTD 3SK5A 5FO7B 2E2DC 1W6JA 2J4XA 1BCPB 3C1FA 3TP6A 2WP8J 5ELBA 2GA4B 5C6AA 3NHHA 1J8IA 1Z6HA 4DK1A 4IURA 1QWYA 1DM0B 4RHSA 3T4AC 4NW2A 2DY7A 1MGSA 2B2VC 3D6WA 1PRTB 1F9PA 5C4JB 5I6YA 1B3AA 1SEBD 3U9SA 1V43A 5E1FA 1XWEA 4HMJA 1RTNA 2NVXB 1NAPA 3S16B 1A3VA 1QOHA 1FGBD 1ML0D 1SSOA 1KNEA 1GUWA 3I90A 1SJED 2SNMA 3ND8A 1RF2D 4F87A 2J7ZA 2RBMA 4A3FB 1TWAB 1Z47A 2WACA 5C4HA 3ERQA 4WRDA 1CHPD 3KF8A 4MN3A 3NBHA 2PPBC 1F2LA 3G6JB 5CORA 1BOSA 3GTJB 3QJYA 1LTSD 1LO5D 3K5OA 2KUMA 1HXYD 3G7LA 1C4QA 4J1MA 2CQAA 3M4OB 5LHY1 3NQIA 3SE0A 2O4XA 3I72A 2KEDA 2R61A 2B2TA 3QB3A 1A15A 2EYMA 4A93B 5FO9B 2LY7A 1SYGA 3VA5A 5I9PA 1H9JA 1FR3A 2QF7A 3QOLA 4WORA 1SAPA 5C3WA 4HMIA 1RKNA 4OIJA 2ID0A 3FMCA 4IUQA 4DGZA 3HOVB 4DXFA 2K05A 3BVGA 2B63B 1IKMA 2VUMB 1I6VC 1KLGD 3KLRA 1WTOA 2WAQB 3S15B 1TT2A 5M5XB 3Q23A 1JE4A 3P20A 2N55A 2EXZA 4I65A 1EY8A 2C9OA 2WV6D 3MFYA 2ICIA 1AP0A 2EOTA 3CRKC 1RDPD 5ISRA 3MC0B 3S14B 1EQTA 4IFDG 3A56A 1PMRA 4DAPA 1E0BA 1IYVA 1D5MC 3OWFA 1GJXA 4B9WA 3I8ZA 1JOKA 2NN6I 4TRDA 1UUPA 1CM9A 1PXUA 2F3WA 1PTOD 4KHVA 1SNQA 5FOBB 3BDCA 4OO1G 1Q8IA 3MVVA 4H44C 1BDOA 1E2ZA 1TR5A 2NBFA 1GUOA 4KI0A 3BVMA 2BDNA 1B4OA 1IW7D 2L9HA 4NDXA 2JXMB 1BF4A 2EJFC 3L9AX 4FYDA 3PV0A 3TDQA 3VYRA 5BN3A 4IN3A 4P2CB 3VR6A 2RDFA 3MXNA 4HAEA 4Q0FA 4CJ2C 3IL8A 2EYFA 2NTTA 3EROA 5IGCA 2OT2A 4WJWA 1WTXA 3HOZB 3DWQA 3OOCA 4ZRZA 1M4VA 1G91A 2IX0A 1EWHA 5CYUA 5K36H 5D14A 2KCCA 1SYEA 2F0MA 1PYWD 4BA1I 1JOQA 4WFN3 1SDFA 1SNMA 2B2VA 3KLSA 1LTBD 3IKJA 3GTGB 2PW7A 1AEXA 4C56C 3J7AV 2X6GA 2E2JB 2HUGA 5JEAJ 1EY6A 4L8JA 4DAVA 1EU4A 5C3EB 3PUWA 1JCKB 1RD9D 1Y8PB 4E6IA 2ZT9C 2XSCA 3TSSA 4UAIA 2JSOA 5M5WB 4XQQA 3A8KE 1L0XB 3K7AB 3QIAA 4OO1I 1CTMA 5EGTA 1JWSD 3BS1A 3W3AA 5A2QL 5FO8B 1SE3A 5C4ZA 2J0TD 4KN7C 3H09A 3GQBA 3LX0A 3QWNA 5D3IB 1AN8A 2EYPA 1UNSA 3SVMA 3X3NA 3PUXA 4NMZA 1BBXC 2D5DA 2F0UA 1SYFA 1GHJA 1B2TA 2NN6G 2B2YC 1TS2A 4AYBB 4JK1C 1DOLA 2AQ3B 3U9OA 4A3KB 4OIKA 5I9OA 3RUZA 4KY5A 2ENBA 1STNA 1ZYRD 5JEAH 1T5EA 1EQVA 2XNAC 4K5XA 5JVH3 2FJ2A 3HKZB 1TVXA 5IGEA 5JVG3 5EBDA 2B39A 4ZAIA 4XT3B 5JAVA 1WTWA 2XWJB 3SXHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RJT A;  2HUG A;  3I8Z A;  2RA4 A;  2K01 A;  1VMC A;  2KUM A;  3G7L A;  1AZQ A;  1WTV A;  1IL8 A;  2CVR A;  2EE1 A;  1U4R A;  2HDM A;  1HHV A;  2MP1 A;  1X3P A;  2IL8 A;  1EOT A;  1ESR A;  3MWY W;  1CM9 A;  5E4W C;  3GV3 A;  1KNA A;  3I3C A;  2KED A;  2HCI A;  2X69 A;  2EPB A;  3GV6 A;  3DEP A;  5DNF A;  1MI2 A;  1DOK A;  1AZP A;  4UAI A;  1QG7 A;  2JYO A;  1BNZ A;  1PFB A;  4X3K A;  2B2T A;  1G2S A;  2FFK B;  1O80 A;  2XIW A;  2B2U A;  2B2Y A;  2K03 A;  5D65 A;  1A15 A;  2K04 A;  4IUT A;  4HCS A;  4U68 A;  1ZXT A;  2K28 A;  2RSO A;  1WTP A;  1WD0 A;  2BDN A;  3MTS A;  1B4O A;  3UI2 A;  1CA5 A;  1HUM A;  3I91 A;  1X32 A;  2L9H A;  1U4P A;  3IFD A;  1NCV A;  5T1I A;  3HP3 A;  1BF4 A;  2SDF A;  1J9O A;  1J8I A;  3R93 A;  5T1G A;  1DOM A;  2X6L A;  4IUR A;  5JJZ A;  1WD1 A;  1ILP A;  4QUF A;  5COY A;  1HFG A;  3KUP A;  5EPJ A;  1F9R A;  3SVM A;  4XDX A;  3FPU B;  4NW2 A;  1C8C A;  1EL0 A;  1SAP A;  2DY7 A;  3KBX A;  5EQ0 A;  1WTR A;  2VXW A;  2MPM A;  5CBA E;  2NWG A;  4RWS C;  1MGS A;  1BBX C;  1HA6 A;  1EIG A;  1B2T A;  1LV9 A;  1M8A A;  1O7Y A;  4OIJ A;  2Q8T A;  2D9U A;  1VMP A;  2B2V C;  4IUQ A;  2NYZ D;  1XX8 A;  3D6W A;  4HAE A;  1F9P A;  4MHE A;  1PFM A;  2B2Y C;  2MJ8 A;  3P7J A;  4CJ2 C;  2K05 A;  4ZK9 B;  1DZ1 A;  1B3A A;  3IL8 A;  2RSN A;  5CBE E;  1HRJ A;  2B2W A;  1WTQ A;  1PLF A;  1NR4 A;  1CA6 A;  3F2U A;  4CJ1 B;  1IKM A;  2L4N A;  1G6Z A;  1RTN A;  1DOL A;  1NAP A;  4LMQ D;  4DN4 M;  4IUV A;  3TN2 A;  1ML0 D;  1SSO A;  2HDL A;  2JP1 A;  3DEO A;  4OIK A;  4R9W A;  1KNE A;  1WTX A;  1XYI A;  4HED A;  4XT1 B;  1GUW A;  2KEE A;  1WTO A;  1PFN A;  2K1B A;  1O7Z A;  3I90 A;  4R8I A;  2KEC A;  1WVL A;  1G91 A;  1F9Q A;  4HSV A;  4X3U A;  5EJW A;  3TZD A;  1MSG A;  1ICW A;  1JE4 A;  2N55 A;  4ZKB B;  1HFN A;  4RA8 A;  2MGS A;  4ZKC B;  1DON A;  3Q6S A;  1ILQ A;  1QE6 A;  1Q3L A;  3FDT A;  3N52 A;  1U4M A;  4O42 A;  2J7Z A;  5EPL A;  1MSH A;  2B2T C;  2B2U C;  5E4X A;  1G2T A;  4QUC A;  5D14 A;  3LWE A;  2FMM A;  4IUU A;  2FJ2 A;  5CMD A;  1RHP A;  1TVX A;  2R3Z A;  1EIH A;  2B2W C;  2Q8R E;  2HCC A;  4ZLT F;  4X3S A;  1AP0 A;  2EOT A;  2L12 A;  2L11 A;  1NR2 A;  5AFW A;  2H1E A;  1X3Q A;  2RVL A;  5EKI A;  1IKL A;  2KVM A;  1JIC A;  1SDF A;  4MN3 A;  4ZAI A;  1B50 A;  2M2L A;  1EQT A;  4X3T A;  4CJ0 B;  2B2V A;  1F2L A;  1QNK A;  2X6G A;  3DM1 A;  4RAU C;  2FHT A;  1HUN A;  1B53 A;  2N88 A;  3ONA B;  4XT3 B;  5COR A;  1E0B A;  1PDQ A;  1ROD A;  1U4L A;  2DY8 A;  2L1B A;  3H91 A;  3QO2 A;  1BO0 A;  1S4Z A;  2FIN B;  4IUP A;  1WTW A;  2KOL A;  1RTO A;  2NZ1 D;  5EPK A;  1F9S A; 
#chains in the Genus database with same CATH topology
 3C2P A;  2RA4 A;  2YU9 H;  2E2I B;  3FRP B;  4DV6 L;  1YJN A;  3HKZ G;  1IL8 A;  1GUS A;  4BBS G;  5FLM H;  4DR1 Q;  1TII D;  3MWY W;  4K14 A;  4A93 H;  1MI2 A;  3URY A;  2XN9 C;  4IPG A;  2HHH Q;  4EQN A;  2EY1 A;  1O80 A;  4XQN A;  1Q86 C;  5C0X J;  4KMU C;  4IUT A;  1EEF D;  1IL2 A;  4ZCK A;  1WTP A;  1LT5 D;  4Z9C B;  2LKV A;  1YBY A;  2GVB A;  3PCO B;  3M85 A;  4Y7N H;  1A3T A;  2B8F A;  3HOX G;  1B9N A;  1KDA A;  4JC0 A;  1GHK A;  3NBI A;  5FLX L;  4HIM A;  5HGT A;  3J7A 5;  2ZJQ A;  3E3X A;  1PTO F;  4JI3 L;  4OWX B;  1V1P A;  4JG2 A;  4N8F A;  1CQV A;  3FPU B;  1Y8O B;  5ELE A;  5CBA E;  1YIT A;  1X55 A;  2NZH A;  4RWS C;  1JB7 A;  1EIG A;  2F0P A;  2F0N A;  1CZW A;  3I4L A;  4C3I H;  4CKB A;  1TU2 B;  1PRT D;  4YWL A;  3S24 A;  3K5M A;  3CC7 A;  3S1M H;  4OO1 H;  1D7Q A;  1HZB A;  1FNU A;  4YY3 Q;  4O1N A;  1KL9 A;  4BBS B;  3EJI A;  2L4N A;  1MHW C;  1SMY D;  2F3I A;  2A68 D;  1OXU A;  2D0P A;  1SBB B;  2JE6 I;  3MAQ A;  1K9M C;  3PIO A;  3I7F A;  3TRZ A;  1Q1B A;  1SE2 A;  4GKJ Q;  3GD7 A;  5I2Y A;  2NVQ B;  4KK7 A;  1DD2 A;  1YJ9 A;  1IBK Q;  4RGO S;  3E0E A;  3PO3 B;  1EWC A;  1Q3L A;  2KJX A;  1UWV A;  3C1E A;  1LM0 A;  3RR5 A;  3EA6 A;  1CI3 M;  3CAM A;  3KK7 A;  1BCP D;  3ERS X;  4A76 A;  1SE4 A;  3GO5 A;  1ASZ A;  2R7Z B;  1HNX L;  2B2W C;  1VQG A;  3V2T A;  4LFB L;  3R2I A;  2L11 A;  1I3Q H;  2UXC Q;  1PH4 A;  4JOI A;  2NB0 A;  2R93 G;  2FHT A;  4I7Z C;  5IYC H;  1XNR Q;  4GZY C;  4A3L H;  1UE5 A;  2DY8 A;  2F0G A;  3PGZ A;  4A3J B;  2KOL A;  1SXT A;  4H0L C;  2JA7 H;  3A55 A;  1HQR D;  1TS4 A;  4RMF A;  1P16 A;  1SNP A;  3OW7 A;  4UPA A;  2DN8 A;  1Y1W G;  2A5H A;  4JBM A;  4HR7 B;  3ITP A;  4YWM A;  4QGU A;  2PZW A;  1EYD A;  3E6Z X;  4N9T A;  4GLX A;  1A2T A;  3V96 A;  1YJW A;  5J3B A;  4ZYS A;  1HCZ A;  3HZX A;  4IAL A;  4A3L G;  1PHJ A;  5KYL A;  4OGQ C;  4B3M L;  1Y1V B;  3CPW A;  3NPP A;  4OL7 A;  1IBM Q;  1CSP A;  4NP5 A;  1E22 A;  2JA5 H;  4LF9 Q;  4IPD A;  4XIG S;  3GTO H;  1TWG B;  3I4N B;  4ME3 A;  3HP3 A;  1H9R A;  5CV7 A;  1SMX A;  1CK1 A;  3HGB A;  4KTA A;  5IGF A;  4F8M A;  1ILP A;  3K80 C;  3CC4 A;  1AE2 A;  1TWF H;  5EPJ A;  3T53 B;  2EJM A;  4JI1 L;  3SK6 A;  4XDX A;  3SHL A;  5IOD A;  3VR3 A;  3KDF B;  2G9H D;  3K0X A;  4RCN A;  1F2Y A;  2D9U A;  1F2Z A;  4PQX A;  4A3E G;  1PFM A;  1DZ1 A;  4TKO B;  1JOO A;  4JW0 A;  1II3 A;  3WDN A;  4CJ1 B;  3GTK B;  3RLO A;  4N8X 1;  1R4P B;  1VQL A;  2N78 A;  1Q82 C;  1HQM C;  3M4Y A;  3BZK A;  4C2M B;  1VS0 A;  5K5P A;  3KJP A;  4X3U A;  3TZD A;  1ICW A;  3PUY A;  3S1N B;  2MGS A;  4ZKC B;  1DGS A;  1FJG L;  4DAY A;  2CHB D;  2F4V L;  4BBR H;  1TWH B;  3VR4 A;  2AUK A;  2VW9 A;  1SRO A;  3CQZ B;  2KCT A;  3O13 A;  4GN3 B;  3SDZ A;  3GTG H;  3RZD H;  3S17 B;  1D6E C;  2HCC A;  1ET9 A;  3HEJ A;  4G57 A;  1SN8 A;  1V1Q A;  4L5T A;  3E0J A;  1IW7 C;  5G3L F;  2A69 D;  3CCQ A;  3BZD B;  2K5D A;  3EIV A;  5KND A;  3K0Y A;  4A3G B;  2UU9 Q;  3E9H A;  1CKN B;  3P1H A;  1RJT A;  4B3T Q;  4CGY B;  5M5W H;  1J5E L;  5LL6 X;  3RZO H;  4TSS A;  2FMC A;  4DV7 L;  1LAB A;  1KNA A;  2HCI A;  5IOC A;  3TP8 A;  4IJH A;  3H3V I;  1CQF A;  4RGT A;  3WOF A;  2PQA B;  1OO9 B;  1B8A A;  5KRU A;  2DNE A;  4KY7 A;  4O0A A;  2RDH A;  2XRQ D;  4DV2 Q;  1X32 A;  3T16 A;  1PA6 A;  3H0G G;  4KKS A;  2ZXP A;  2CH4 A;  2YYZ A;  4HJA A;  1WTH A;  2XRS D;  4G7Z C;  2KBN A;  1WD1 A;  2Q2U A;  2YTV A;  2ZM6 Q;  5J39 A;  4X65 Q;  2UUB L;  4GKK Q;  4PZ8 A;  1Q1E A;  2E2H B;  1WTR A;  3BVZ A;  1PH9 A;  3AEV A;  1NMG A;  5D3D A;  1M8A A;  1V1P B;  1XX8 A;  4IZ8 A;  3GTM B;  1SE8 A;  3A5U A;  3HFZ B;  5M3F B;  4KV6 A;  4DR7 L;  4BY1 B;  1XXG A;  4F88 A;  4LMQ D;  1Q8K A;  4IUV A;  3FEW X;  4YHH L;  1HTP A;  4PMB A;  3J7Y W;  2A8V A;  1L1O B;  2PMZ B;  4HED A;  3NSW A;  4A3F H;  2WIN B;  1EY7 A;  1HA5 A;  2PZT A;  3M7N A;  3TRE A;  1VF5 C;  4IJL A;  4A3I B;  3E9I A;  1B9M A;  1MSG A;  1GD7 A;  3ER0 A;  1ASY A;  2PI2 E;  1VQJ A;  5IGG A;  2B2U C;  4A3G G;  4XQJ A;  3HOW B;  2JA6 B;  3AU7 A;  1HZ9 A;  4QCL A;  2IJ0 A;  2BH8 A;  3AB9 A;  3G4S A;  2ZTE A;  4ZLT F;  3SEB A;  4LF8 L;  5L37 A;  3CF5 A;  1CZG A;  4CDD C;  4IOA A;  1Z7T A;  2KCM A;  4OON A;  3HKS A;  4RAU C;  1Q12 A;  2HD3 A;  2D0O A;  3H0G H;  1PDQ A;  5A35 A;  1JQY D;  3T1H L;  1BUV T;  1KQS A;  2F1M A;  1NNX A;  4DNR B;  3NEM A;  1L0Y B;  3GTP B;  2Q2T A;  4OX9 L;  3N6R A;  4DV1 Q;  2HDM A;  1YHB A;  1AW7 A;  1CKM A;  4JI5 L;  3W1B A;  4HCE A;  1XPU A;  4K5W A;  4BS9 A;  1KAB A;  2X69 A;  2LS0 1;  1VQ7 A;  1DOK A;  1DCZ A;  4TVA B;  1PFB A;  1B3Q A;  3NWT A;  1CHQ D;  4XXE A;  1G2S A;  3CCL A;  4DUZ L;  3PO2 G;  2RCF A;  2XIW A;  5FLM G;  2O2L D;  1EZ8 A;  3S9W A;  3HS0 C;  3KBG A;  4LF4 L;  1E1O A;  4F7X A;  4L6T B;  1WD0 A;  2JA7 G;  1L1O C;  4JBW A;  3I91 A;  5KNC A;  4C1N I;  3MXG A;  1NCV A;  1S5B D;  1PH6 A;  4KHP L;  4DK6 C;  4KY6 A;  2XTI A;  4J8Q A;  1KRT A;  4HJ8 A;  5CV8 A;  1PH5 A;  4MTK A;  2X6L A;  3QR8 A;  1JJ2 A;  4QUF A;  4QQB X;  3MXP A;  1K73 C;  1AE3 A;  1I4H A;  3ZYY X;  5IYB H;  1KDB A;  1PTO B;  3EN2 A;  1X65 A;  2IWH A;  2VQE Q;  3PUZ A;  4DV5 Q;  1O7Y A;  2XVS A;  4FO2 A;  2PMZ E;  1PH7 A;  5LL6 S;  4AIM A;  4IQZ A;  1HNW Q;  5M5X H;  1K0R A;  2B2W A;  3J7A F;  4RFB A;  4DUY Q;  3DM3 A;  3M9B A;  4JI7 Q;  1FJG Q;  4JI4 L;  2A73 B;  5E7N A;  1B70 B;  1BCP F;  5KIX A;  2RDG A;  4A3J G;  3MHB A;  2KEE A;  1OXT A;  3E5S A;  4DU9 A;  2MQH A;  3JAM E;  1C0A A;  1SYB A;  1XTC D;  2A68 C;  3Q6S A;  3FDT A;  1NBW A;  4XTC S;  4TQU S;  4GS3 A;  2F0D A;  4JYA Q;  1IBL L;  2EY6 A;  5IYC G;  4X64 Q;  1G2T A;  4IUU A;  2DJF C;  1KTK A;  2QGQ A;  4DKA C;  1TY2 A;  1SLJ A;  4O2D A;  1N32 Q;  1NR2 A;  2PO4 A;  5AFW A;  5IWA L;  4IO9 A;  1J5E Q;  2F0T A;  2RVL A;  1CFM A;  4RKL A;  3VA7 A;  4DV3 L;  4JI1 Q;  1TS3 A;  1PRT F;  4M8A A;  2N49 A;  2NTS A;  2UUC Q;  3W2D A;  2L15 A;  2N88 A;  1W3S A;  1IHZ A;  2CKZ B;  1U5K A;  2F0E A;  3FKI B;  2AQ1 B;  1VQF A;  1RTO A;  2I0Q A;  5IYD H;  5M5Y B;  4GLA C;  2K52 A;  3CHB D;  3W1G A;  2JA8 B;  4DA2 A;  3BDO A;  5C5M A;  1EY0 A;  1EZ6 A;  5GAD C;  4K0K Q;  5DNF A;  3W5O A;  4APV A;  1GOZ A;  1TKW B;  1QG7 A;  2JYO A;  3J81 c;  3FVQ A;  4GNX C;  4K8I A;  5ELF A;  3I4N H;  5M3F G;  2K04 A;  2Z6B A;  2WAQ G;  1VQP A;  2L5T A;  3UI2 A;  3AFQ A;  1HUM A;  1JC7 A;  3Q24 A;  4L5S A;  1H95 A;  1VQH A;  3KDF A;  4K5V A;  4ABN A;  3T51 B;  2WB1 G;  3NEL A;  3V05 A;  3EQL C;  3R93 A;  3EVQ A;  5DEH A;  2P5Z X;  3A0J A;  1XMQ Q;  5EKK A;  4X62 Q;  5C4X B;  1X6O A;  2TSS A;  5EKL A;  2MUY A;  1QIL A;  5M3M B;  1YI2 A;  5FJ8 G;  1D1I A;  4ZUJ A;  2L0C A;  4JI8 Q;  1LV9 A;  4ZUI A;  2Q8T A;  1VMP A;  2HHH L;  3J80 E;  3HOZ H;  1MIU A;  2KA7 A;  1XMO Q;  4C2M H;  3STB C;  2E75 C;  1WTQ A;  1EFI D;  2JA8 G;  1CA6 A;  2ZM6 L;  2L55 A;  4DPG A;  1E2W A;  3AYH B;  3K57 A;  2UUA Q;  2HDL A;  5LMN W;  3A8J E;  1JB3 A;  4GKJ L;  1SND A;  2F0V A;  5M3M G;  1LT3 D;  2F0K A;  2WFW A;  1RIP A;  4HN7 A;  4S3S A;  5FK9 C;  3S17 H;  4A3E B;  1NSN S;  3LNN A;  4DV2 L;  1IZ6 A;  3ULJ A;  1QE6 A;  1XPO A;  2IX3 A;  3FKI G;  2SNS A;  5TSS A;  2H5X A;  2IT1 A;  1EY9 A;  3T1H Q;  4QF4 A;  3TZU A;  3S1R B;  4LNQ A;  1EWI A;  2B8G A;  3I4M H;  1YNN C;  4KD3 A;  4A3G H;  4DXG A;  3R8B A;  1X3E A;  2L12 A;  1N36 Q;  1PZK D;  4NXN L;  4EQO A;  2K6A A;  2KVM A;  1JIC A;  4QIW E;  2M2L A;  3A7L A;  4CJ0 B;  2ZXO A;  1FL0 A;  2VZA A;  5C0X I;  1SMY C;  1HUN A;  2Z9H A;  5KYI A;  3GDE A;  4RGN A;  5BN5 A;  1LTG D;  3CMA A;  5IT9 L;  5JEA G;  1EY4 A;  4A3B H;  2OCE A;  2K5V A;  2EE1 A;  4DR3 Q;  2YV5 A;  2V4D A;  3C46 A;  1EOT A;  1V8Q A;  3GV3 A;  1TWC H;  1GUG A;  1WCM H;  2CFM A;  1BNZ A;  4FF2 A;  4V0B A;  1UEA B;  5ELC A;  1Y1W H;  2B2U A;  2RHS B;  5IP7 H;  3D31 A;  2F4I A;  1EIF A;  4CDC C;  2QA4 A;  5JJK A;  4DK3 C;  4A3D B;  3OHX C;  1Q46 A;  1FYC A;  2UU9 L;  1JMC A;  5IGB A;  1BXT A;  3AFP A;  4OXP A;  4DNI A;  1SR3 A;  2K5Q A;  1YNJ D;  4IUN A;  4LW1 A;  2A6H C;  3GTM H;  5IP7 G;  3UDX A;  3PO2 H;  3NEN A;  4HTH A;  2AHO B;  4NKL A;  1L1O A;  5EQ0 A;  1B1Z A;  4BY1 H;  3R2T A;  3MXN B;  4KN4 C;  3R3O A;  4LF6 Q;  4L5Q A;  2KHI A;  2F0L A;  1STB A;  2R6G A;  3K6O A;  3P7J A;  5BR8 Q;  1KXL A;  1YHQ A;  4DR1 L;  1EU3 A;  4X62 L;  4EVO A;  3NUC A;  3D6C A;  1HPC A;  3F2U A;  1I4Q A;  2PQE A;  3CU7 A;  3DEO A;  4GN4 B;  3L0O A;  4K0K L;  2EYH A;  1PH2 A;  1EFW A;  1WVL A;  1K8O A;  2WKD A;  1XMO L;  1C48 A;  2QCP X;  1T9H A;  1N33 Q;  3OMG A;  1B44 D;  2I46 A;  1DON A;  4ILW A;  2KCN A;  1I94 Q;  1QNU A;  2CQO A;  2HIX A;  2QDL A;  2B2T C;  1A3U A;  2K32 A;  1SFO B;  1A63 A;  1OXS C;  1I5F A;  3T1Y L;  1HR0 Q;  2DGY A;  4G4K A;  5LMN L;  2F52 A;  5J1Z A;  4KHP Q;  4A3C G;  2IHE A;  3PO3 G;  4DV6 Q;  5K36 G;  1GXD C;  4JI5 Q;  3J80 i;  1L2F A;  3CC2 A;  2L1B A;  2D2C C;  3H91 A;  1LAC A;  3A5Z B;  4KJO A;  1S4Z A;  5H1S E;  2FIN B;  1F9S A;  1K8A C;  1HJP A;  4R1J A;  4DV0 L;  1A6X A;  3PF4 A;  1O7L A;  1VQE A;  1MBY A;  5E4W C;  4DR3 L;  4HIO A;  3PF5 A;  2BE5 C;  5C44 H;  3DMU A;  1K3R A;  2ES2 A;  3GV6 A;  4ALP A;  1QCB D;  4LFC L;  2PNR C;  4C1N K;  2B3G A;  1JOR A;  2LXK A;  2ZJP A;  4HCS A;  4U67 3;  3NQT A;  4QB4 A;  2RSO A;  1UE6 A;  4DR4 L;  2IY5 B;  1CA5 A;  2Z4I A;  1V1O A;  3I73 A;  1PTO H;  2JA6 G;  4C3H G;  4PG3 A;  3K58 A;  3I2Z A;  3VYS A;  1HNW L;  1CT1 D;  1QZG A;  1HZA A;  3KUP A;  3S1M B;  2JK8 A;  1KAA A;  2D62 A;  2VL6 A;  3HOY B;  2VB2 X;  2KQ3 A;  3MXU A;  2NWG A;  4BBR G;  2F0J A;  1I4G A;  1EQQ A;  2O5I C;  4H13 C;  3J7Z C;  1STY A;  1LT4 D;  2MJ8 A;  3KLS X;  1HNZ Q;  2RSN A;  1IBK L;  2NVQ H;  4MIU A;  2F0S A;  1EY5 A;  4XYQ A;  4DN4 M;  1MJE A;  4GOP B;  1LT6 D;  4GN5 A;  2BH2 A;  4ODG A;  3OYY A;  4A93 G;  1U0L A;  4YCW A;  4B3T L;  2KEC A;  1RL2 A;  2I5L X;  1F9Q A;  3EBE A;  3FPP A;  5C3X A;  4ZQ3 A;  5I2X A;  2ZJR A;  2BDO A;  2EVB A;  3N52 A;  3RLN A;  1STA A;  1I3Q B;  2RHQ B;  4P72 A;  2EYJ A;  4AH6 A;  4X66 Q;  1Y8N B;  1JR0 D;  3RLF A;  1YEZ A;  2JN4 A;  2EYL A;  2Q8R E;  3FKI H;  4X3S A;  4RH6 A;  3JAM c;  5M5Y H;  1BBW A;  4FXK C;  1B50 A;  3I4M G;  1E3P A;  4P71 A;  4X3T A;  2EXD A;  4CDE C;  4JI8 L;  4KKU A;  2UXB Q;  1U4L A;  4IUP A;  1KD1 C;  3DXJ C;  1JJC B;  1S5D D;  2NZ1 D;  1WOC A;  1BQQ T;  1VMC A;  1LTI D;  3NTK A;  4OHJ A;  3OW2 A;  4YY3 L;  2VUM G;  3A54 A;  4ME5 A;  2F0Q A;  2F0F A;  1X3P A;  1FD7 D;  4JI2 Q;  5IE8 A;  2VNU D;  2EJG C;  3I3C A;  4DV7 Q;  4A3B G;  3KFU A;  4C3J B;  1R9T H;  5E3F A;  4B3R L;  3L7Z C;  1VCI A;  1YNJ C;  3CKI B;  4RKB A;  3GTO B;  4KD4 A;  1YVC A;  4FP5 D;  1B7Y B;  5HUR A;  1ZXT A;  2K28 A;  4M1U B;  4PMW A;  4P73 A;  2MO1 A;  3G48 A;  3IAY A;  1VQI A;  5C4X H;  3IFD A;  3QOJ A;  5FJ8 H;  1TWF B;  5GAE C;  3I56 A;  3HOU B;  2DUD A;  2Z4H A;  4RGM A;  4K6D A;  2SDF A;  5CV5 A;  4UDU C;  2QW7 A;  2BA1 A;  2E74 C;  3HG9 A;  1P8L A;  5AJ3 L;  1H9M A;  1QJO A;  5JJZ A;  2LFN A;  3A7A B;  2F0I A;  3GTK H;  2F3V A;  1SNC A;  2IW3 A;  2LMC B;  4A3K G;  2Y0S E;  3WWV A;  1VQD A;  4ZK9 B;  2JEA I;  1NY4 A;  1C9O A;  2O5J C;  3VR2 A;  4JI7 L;  2B63 G;  1N33 L;  2SEB D;  1IYJ B;  3X3M A;  3WOE A;  4LF7 L;  1SJH D;  4BA2 I;  1VQC A;  1ZEQ X;  4A3E H;  1NJI C;  3AMU A;  2JP1 A;  1XYI A;  4GOP A;  1TWH H;  1WFQ A;  3K81 C;  1XJV A;  3GTQ H;  3RZD B;  5ELO A;  4RCO A;  2CW0 C;  2VUM H;  3I4M B;  2BA0 A;  2IPK D;  4ZKB B;  3D8G A;  1FNV A;  4B9X A;  1CUK A;  2RKS A;  4O42 A;  2A6H D;  3MZ5 A;  4DR5 Q;  4V19 0;  3LWU A;  4BXX G;  1EYG A;  2A74 C;  3H94 A;  3QG1 A;  4AYB E;  3CCU A;  1L0W A;  5FLX E;  1UEB A;  1I6H B;  1D5X C;  3ICE A;  1HZC A;  5CV9 A;  4A3B B;  3RZO B;  4CKC A;  3DUZ A;  5CV4 A;  3M7G A;  4K2L A;  1ROD A;  2F0O A;  3SK4 A;  4BY7 G;  1W2B A;  1BO0 A;  1TWC B;  2BCO A;  1YIJ A;  4YWK A;  1VQ9 A;  3S2H H;  3S14 H;  2TMP A;  1WTV A;  2BOS A;  1Y1W B;  5BR8 L;  2IL8 A;  1ESR A;  1S5C D;  2EPB A;  3J81 L;  3TS2 A;  5IT9 E;  4JYA L;  1BVS A;  3DWP A;  4HSP A;  1IBL Q;  3VYU A;  2EY5 A;  2A69 C;  4X3K A;  3RN2 A;  4A3D H;  1DYQ A;  2FFK B;  3SR1 A;  3TP5 A;  4Y52 H;  5I4D A;  2B2Y A;  5CGK A;  1I50 B;  2OTJ A;  3F8T A;  1I4X A;  2R7D A;  1F2M A;  1FNW A;  1PZI D;  4JOI C;  3T1Y Q;  2HQL A;  2R92 B;  4A3M B;  1BR9 A;  1OXV A;  4AYB G;  4C3H H;  1K0S A;  3PO2 B;  2EY2 A;  4OWT B;  1X3F A;  4PZ7 A;  1A2U A;  5T1G A;  4LAA A;  4JBK A;  4QIW B;  2AWN A;  3TBI B;  3MEF A;  5M3F H;  3BYT B;  3EFX D;  3NTH A;  5C0X G;  4ID6 A;  4BXX H;  3G6E A;  1HA6 A;  3VDY A;  5J22 A;  1GVP A;  2UXB L;  3NK9 A;  3H6M A;  3L3O C;  1QUQ B;  2ZTC A;  4N9P A;  1K83 B;  1HRJ A;  3TP7 A;  2KHJ A;  2VB3 X;  3BG3 A;  2C35 B;  3MA2 B;  1N34 Q;  4NXM L;  4B3S L;  3NWS A;  4LK1 C;  3OIQ A;  4R9W A;  4LF7 Q;  4UP8 A;  2QKI C;  1ZKO A;  4BY7 H;  2AWO A;  1SFO H;  1O7Z A;  5JPN C;  2Q8I B;  1PTO C;  3PIP 3;  3Q22 A;  3KOJ A;  1ONL A;  3OSO A;  5I6W A;  2ALY B;  3M3Y B;  1I4R A;  4C3J G;  4MTN A;  1MSH A;  4JBJ A;  5E4X A;  2K75 A;  3D4R A;  2FMM A;  4FXD A;  4FF4 A;  1EIH A;  3H0G B;  1GO3 E;  3NE5 B;  3BYY B;  4PNY A;  3ND9 A;  2A1A A;  5GAH C;  1KDC A;  4LUV A;  3Q0A A;  1D5Z C;  3CCV A;  4G7H C;  4R8N A;  2HQE A;  1BBU A;  5JPM C;  5EKI A;  1IKL A;  5G3L D;  2Z1C A;  1A8V A;  1PYS B;  5DM7 3;  1QNK A;  1TS5 A;  2NVY B;  2EDG A;  3HOU G;  3J81 j;  4CHT B;  5IT9 c;  2NZO A;  4H7B A;  5EPK A;  4YIJ A;  4B08 A;  1H9S A;  2K01 A;  4EQ5 A;  2CVR A;  3SK8 A;  1GKH A;  2I07 B;  1STH A;  4JCV E;  1S5E D;  3DEP A;  4DR2 Q;  4IPC A;  1TXY A;  2QIL A;  3PIO 3;  1UAP A;  2OQ0 A;  1YNN D;  4DNT B;  4HJ5 A;  4U68 A;  2NVT B;  4DR5 L;  4C3I G;  4K8J A;  2PYK A;  3MTS A;  2E8G A;  1XPR A;  2ZXR A;  3HKZ E;  3HOY H;  3HRZ C;  4G7O C;  2CWA A;  3OPO A;  1STE A;  2A19 A;  1XMQ L;  3CME A;  3HOY G;  3BZC A;  1Q81 C;  3OMC A;  1C8C A;  3T13 A;  2WKC A;  1EL0 A;  1MD2 D;  2N8N A;  2MPM A;  1QVG A;  2CW0 D;  4LJZ C;  2QDB A;  4FVM A;  4HIK A;  1AH9 A;  1JWM D;  4KHZ A;  5DM6 3;  1ET6 A;  2IX1 A;  5CBE E;  1D1K A;  3FHW A;  1G6P A;  4AQY L;  3S2D B;  1G6Z A;  2K5N A;  4LUZ A;  2Q2H A;  4B3R Q;  4J6H A;  4QL5 A;  3TN2 A;  2Y0S B;  5C4J H;  2K1B A;  4R8I A;  1RCV D;  1X9N A;  1VF7 A;  2A6E D;  1J6Q A;  1I94 L;  5IWA Q;  1HFN A;  4FF3 A;  3S16 H;  1ILQ A;  4A3K H;  3DWA A;  1MJC A;  1SRU A;  2WAQ E;  2EYO A;  1LUZ A;  4CDF C;  1GUT A;  1U9R A;  3LWE A;  5IYB G;  3KLW A;  4QJF A;  3MFG A;  5EBC A;  1SNO A;  1VQ5 A;  3D4W A;  3C3L A;  1X3Q A;  3RMH A;  4XYO A;  4DF7 A;  1TWA H;  2AMC B;  1CKO A;  2PZU A;  1UE1 A;  3DM1 A;  4I7A A;  3HOV G;  1TY0 A;  2PI2 A;  1BKB A;  1R9T B;  2KEN A;  1EYA A;  4KKT A;  1W6K A;  3P75 A;  4CBV A;  4JI6 Q;  3J80 L;  4DAY B;  4DV4 Q;  5FKA C;  1HHV A;  2AUJ D;  4LF4 Q;  5NUC A;  4B3S Q;  1VDZ A;  3GTJ H;  2VQF L;  1DJR D;  1ZYR C;  1PVO A;  1STG A;  5JOB A;  2Z8L A;  2F03 A;  2PW5 A;  2YU9 B;  2MFI A;  2DNC A;  4BY1 G;  4EQP A;  3K5N A;  3KJO A;  2K03 A;  1VQM A;  1KC8 C;  3I4O A;  2MHV A;  3VR5 A;  2ICE C;  5CR3 A;  5KEE A;  1U4P A;  2R7Z G;  2WB1 B;  2QEX A;  2M9V A;  5T1I A;  2WII B;  2VQE L;  4HJ9 A;  1ENF A;  2RCN A;  4K2K A;  1Q90 A;  3CCR A;  1DOM A;  1E2V A;  4OWW B;  2PNH A;  1QB5 D;  1VQ4 A;  4JI0 Q;  5LMU Q;  1YZ6 A;  1JJG A;  1HFG A;  5IY0 A;  1F9R A;  3RN5 A;  4Y7N B;  2VXW A;  3GP7 A;  3BDL A;  1QVC A;  1EUJ A;  1K8M A;  1CSQ A;  1T5X D;  4MHE A;  4HJ7 A;  1DXM A;  3GTQ B;  2QEJ C;  4R4Q A;  4BWG B;  3D4D A;  3NXW A;  3A8I E;  1NR4 A;  1ENC A;  1V9P A;  1QUQ A;  2AQ2 B;  3DHQ A;  2K5W A;  2SOB A;  1ENA A;  1EYC A;  4C3I B;  2M00 A;  4XT1 B;  3HOV H;  2N3S A;  4KLK A;  4IOC A;  2CH4 W;  1H9K A;  4Q5V A;  2B63 H;  2EZV A;  5EJW A;  1F77 A;  2K7V A;  1EEI D;  2JEB I;  1JWU D;  1I6H H;  3TME A;  2VQF Q;  3S1Q B;  5EPL A;  2F0W A;  1YNX A;  1LLR D;  3RD4 A;  1I4P A;  3S15 H;  3I70 A;  5C0X H;  1Y69 U;  2JA9 A;  2Z6K C;  3KYH C;  3JAM L;  1RHP A;  4MNO A;  2F0H A;  4NB3 A;  3D3R A;  4PMC A;  5LMN Q;  3PO3 H;  2OQK A;  2H1E A;  3NTI A;  4NPS A;  3S2H B;  4L5R C;  5F2D A;  4L63 B;  2EQS A;  2R7F A;  4LF8 Q;  5ELD A;  1X54 A;  1E7Z A;  4R4O A;  1NUC A;  2R7Z H;  3J80 c;  5EAY A;  1LYL A;  3PMF A;  5KNB A;  2R3Z A;  1Q7Y C;  1WCM B;  4OX9 Q;  4DV1 L;  5DLQ E;  5AJ3 Q;  4B3M Q;  1OXX K;  4UP7 A;  1EOV A;  1U4R A;  3I4N G;  1SYC A;  4A75 A;  4WJ3 M;  2E76 C;  3K7U C;  2V1C C;  1H9S B;  3PIP A;  3CCE A;  4ULL A;  4AQY Q;  4A3J H;  3K5L A;  1D2B A;  2JA7 B;  3CCS A;  3OWE B;  2RQX A;  1JE5 A;  2IHF A;  1S3O A;  4LWC A;  2ASB A;  1VQA A;  2YTX A;  3CPF A;  4C3H B;  1A0I A;  1NTG A;  3A74 A;  4PV1 C;  5DAU A;  2AKW B;  5D65 A;  4IFD I;  3DLL A;  2K33 A;  2UXD Q;  2G9D A;  4JI4 Q;  2NN6 H;  3ULL A;  1KAW A;  4DFA A;  4CKE A;  1GUN A;  1J9O A;  5KGU A;  2OXP A;  4NXN Q;  1BCP C;  3T56 B;  1R4Q B;  4QMG A;  2LXJ A;  2JA5 B;  5IIF A;  5COY A;  1XNR L;  5CV6 A;  4KJN A;  1AZP A;  3KBX A;  5HY6 A;  2OF1 A;  2A6E C;  4RHR A;  1LTA D;  3J81 E;  2NYZ D;  3HOX B;  5BN4 A;  4BY7 B;  1G8Z D;  1YHA A;  5IGD A;  3IFT A;  2BE5 D;  1PLF A;  4EGV A;  1IYU A;  3K59 A;  2PCF B;  3CRL C;  2OEO A;  1KLU D;  3CD6 A;  4DAM A;  3M3Y H;  1O78 A;  3JAM i;  1G29 1;  4DK0 A;  1N8R C;  1PRT C;  2KHS A;  1PFN A;  1PH8 A;  1LTR D;  4GLV B;  1E24 A;  4HSV A;  2C5C A;  4RA8 A;  3CCJ A;  5A2Q E;  1U4M A;  3PUV A;  3H3V C;  3UDF A;  4GNX A;  1SYD A;  5M9O A;  2NUC A;  4QUC A;  2NVY H;  2R93 B;  5CMD A;  3RNU A;  2H4O A;  3OIP A;  4IFD H;  2MNA A;  3S1N H;  3VYT A;  4DV3 Q;  1K8G A;  1AFP A;  4BBR B;  1FVI A;  4OEL B;  1K28 A;  3CQZ H;  3MEH A;  4NXM Q;  1B53 A;  3D0F A;  3ONA B;  1HTL D;  4IFD J;  3QO2 A;  4R4I A;  4A3F G;  5C44 B;  4FF1 A;  5C5L A;  4HID A;  3UE0 A;  1VQO A;  3NP8 A;  1AZQ A;  4PZ6 A;  2XWB B;  4FNF A;  4GNX B;  5CC4 A;  2MP1 A;  1HR0 W;  1S5F D;  1KHI A;  1TQO A;  4FXG C;  1C7Y A;  4R4C A;  2R92 G;  1PZJ D;  4K6L A;  2E2J H;  1ESF A;  1X3G A;  4X64 L;  3GTL B;  1LTT D;  2CCZ A;  1MKH A;  5C3E H;  3SK5 A;  5FO7 B;  1ICF B;  2E2D C;  1W6J A;  2J4X A;  1BCP B;  3C1F A;  3TP6 A;  2WP8 J;  5ELB A;  4LFA L;  2E5L L;  1N34 L;  2UUC L;  2GA4 B;  3K7A H;  4YCU A;  2HT1 A;  5C6A A;  3NHH A;  1J8I A;  1Z6H A;  1GM5 A;  3CW2 C;  4DK1 A;  4IUR A;  4IPH A;  1QWY A;  1DM0 B;  4RHS A;  4JV5 Q;  1X56 A;  3G71 A;  4A3I G;  3UDI A;  3T4A C;  4NW2 A;  2DY7 A;  1MGS A;  4DV4 L;  2B2V C;  3D6W A;  1PRT B;  1F9P A;  1NE3 A;  5C4J B;  5I6Y A;  1XNQ Q;  1B3A A;  1EIY B;  3F2C A;  1SEB D;  3U9S A;  1V43 A;  5E1F A;  1XWE A;  4HMJ A;  2E2H H;  1RTN A;  1G51 A;  2NVX B;  1NAP A;  3S16 B;  1A3V A;  1QOH A;  1ML0 D;  1FGB D;  1SSO A;  3F1Z A;  1KNE A;  1GUW A;  4R4T A;  3I90 A;  1SJE D;  2SNM A;  2LSS A;  3ND8 A;  1RF2 D;  5IYD G;  4JV5 L;  4F87 A;  2J7Z A;  2RBM A;  2XGT A;  3TEH B;  4A3F B;  1TWA B;  1Z47 A;  2WAC A;  5C4H A;  4A3I H;  1Y14 B;  1CKN A;  3ERQ A;  4WRD A;  1CHP D;  1KRS A;  3FP9 A;  3KF8 A;  3IRB A;  4MN3 A;  3NBH A;  3HOW H;  2PPB C;  1F2L A;  3G6J B;  5COR A;  1BOS A;  3GTJ B;  3QJY A;  1LTS D;  1LO5 D;  4JI6 L;  4C3J H;  3K5O A;  1FGU A;  3L2P A;  1PH3 A;  2KUM A;  1HXY D;  3G7L A;  1C4Q A;  3OTO Q;  4J1M A;  2PQA A;  2CQA A;  3M4O B;  5LHY 1;  3NQI A;  1EQR A;  3SE0 A;  1S40 A;  2K5H A;  2O4X A;  3I55 A;  4DR6 L;  3I72 A;  2KED A;  2R61 A;  3STB D;  3BU2 A;  4P74 A;  2E2I H;  2K4K A;  3GTP H;  2B2T A;  3K8A A;  3QB3 A;  2OTL A;  3HOU H;  1WYD A;  4YCV A;  1A15 A;  2EYM A;  4DR4 Q;  4A93 B;  5FO9 B;  2LY7 A;  1SYG A;  1PV4 A;  3VA5 A;  5ELN A;  2ZTD A;  3M4P A;  5I9P A;  1K3B C;  1VQK A;  4DV5 L;  4DUZ Q;  3KF6 A;  4MZ9 A;  2JA5 G;  1H9J A;  2K50 A;  1FR3 A;  2QF7 A;  2GVA A;  3PQI A;  3QOL A;  1D8L A;  4DUY L;  4WOR A;  3F2D A;  4OEM B;  1SAP A;  4A3D G;  1N9W A;  5C3W A;  4HMI A;  1RKN A;  4LF6 L;  4OIJ A;  2ID0 A;  3FMC A;  4IUQ A;  4DGZ A;  1N36 L;  3HOV B;  4DXF A;  2K05 A;  2OWO A;  3BVG A;  2B63 B;  1IKM A;  2VUM B;  1IBM L;  1I6V C;  1KLG D;  2GN5 A;  2K14 A;  3S1Q H;  3KLR A;  1WTO A;  2WAQ B;  3S15 B;  1TT2 A;  5M5X B;  2RF4 A;  3Q23 A;  4BBS H;  3H15 A;  4LFA Q;  1JE4 A;  2Z0S A;  3P20 A;  2N55 A;  2EXZ A;  1Z9F A;  4I65 A;  4GOP C;  1EY8 A;  2C9O A;  2WV6 D;  3MFY A;  4LF5 Q;  2ICI A;  2WB1 E;  3CP0 A;  4X6A H;  5C4X G;  3LGJ A;  1AP0 A;  2EOT A;  3CRK C;  1RDP D;  5ISR A;  3MC0 B;  3S14 B;  1EQT A;  4IFD G;  1Y1V G;  2UXC L;  3A56 A;  5C3E G;  1PMR A;  4DAP A;  4A3M G;  1E0B A;  3U4V A;  1IYV A;  1D5M C;  3OWF A;  1WCM G;  4JVZ A;  2VS1 A;  4RG1 A;  1GJX A;  4H02 A;  4B9W A;  1HNX Q;  4LFB Q;  3I8Z A;  1JOK A;  2NN6 I;  2B29 A;  4TRD A;  1UUP A;  1CM9 A;  1I50 H;  4X65 L;  1PXU A;  3UE1 A;  3HOZ G;  1VQ6 A;  4LF5 L;  2F3W A;  3H3V H;  1KIX A;  1PTO D;  1M90 C;  4KHV A;  2R92 H;  4A3M H;  4DR2 L;  3TS0 A;  2JA8 H;  1SNQ A;  5FOB B;  3BDC A;  4OO1 G;  4LFC Q;  1Q8I A;  3MVV A;  2UXD L;  4H44 C;  5GQO A;  1BDO A;  1E2Z A;  1TR5 A;  2NBF A;  4DR7 Q;  1VQB A;  1GUO A;  4KI0 A;  4DR6 Q;  4JI3 Q;  3BVM A;  2BDN A;  1B4O A;  1IW7 D;  2L9H A;  4NDX A;  2JXM B;  1Y1V H;  5FLX c;  1BF4 A;  5GAG C;  1N32 L;  2EIF A;  2EJF C;  3L9A X;  3KF6 B;  4FYD A;  3PV0 A;  5IP9 H;  3TDQ A;  3VYR A;  3HOX H;  4A3C H;  1PYB A;  5BN3 A;  1K83 H;  4IN3 A;  4P2C B;  1TWG H;  3VR6 A;  2G5D A;  2JJQ A;  2RDF A;  2FXQ A;  3MXN A;  4A4I A;  4HAE A;  4Q0F A;  4CJ2 C;  4LUO A;  3IL8 A;  2EYF A;  2NTT A;  2MO0 A;  3ERO A;  5M3M H;  2Z6K A;  5IGC A;  2OT2 A;  4WJW A;  1WTX A;  3HOZ B;  3DWQ A;  3OOC A;  3U58 A;  3UDG A;  1PH1 A;  1LTL A;  4ZRZ A;  1M4V A;  1G91 A;  2IX0 A;  2R93 H;  3HOW G;  2I5H A;  1EWH A;  5CYU A;  4WJ4 A;  5K36 H;  1VQ8 A;  5LMU L;  4LF9 L;  2JQO A;  5GRO A;  5D14 A;  2KCC A;  1SYE A;  3AQQ A;  4X66 L;  1M1K C;  2F0M A;  1PYW D;  4BA1 I;  1JOQ A;  1HR0 L;  4WFN 3;  3B6Y A;  1SDF A;  1QZH A;  1SNM A;  1NMF A;  1A62 A;  2B2V A;  3KLS A;  1LTB D;  3IKJ A;  3GTG B;  3KF8 B;  2PW7 A;  1AEX A;  4C56 C;  3S1R H;  3J7A V;  4UHV A;  3Q8D A;  3F2B A;  3U4Z A;  1IXR A;  2X6G A;  2E2J B;  2HUG A;  5JEA J;  1EY6 A;  4L8J A;  2VY3 A;  4DAV A;  3GTL H;  1EU4 A;  5C3E B;  3PUW A;  1JCK B;  4JI0 L;  3SGI A;  2E5L Q;  1RD9 D;  1Y8P B;  4E6I A;  2NVT H;  3JC6 6;  2DJG C;  2ZT9 C;  2XSC A;  3TSS A;  4J15 A;  2JSO A;  4UAI A;  5M5W B;  4XQQ A;  3A8K E;  1L0X B;  3PSI A;  3QIA A;  2HIV A;  3K7A B;  3OTO L;  4OO1 I;  1XTD A;  1CTM A;  2I5M X;  5EGT A;  1JWS D;  3J81 i;  3BS1 A;  3W3A A;  5A2Q L;  2F4V Q;  4EX5 A;  5FO8 B;  1VQN A;  2Q2I A;  4POG A;  5HGQ A;  1SE3 A;  5C4Z A;  2J0T D;  4JPB W;  4KN7 C;  2ATW A;  3H09 A;  1QVF A;  2YTY A;  3GQB A;  3LX0 A;  1XNQ L;  1E1T A;  3QWN A;  5D3I B;  1AN8 A;  2EYP A;  1UNS A;  3SVM A;  1HH2 P;  3S2D H;  3X3N A;  1S72 A;  5JJL A;  3PUX A;  4NMZ A;  2UUA L;  4UP9 A;  1WJJ A;  1BBX C;  2UUB Q;  2D5D A;  2NVX H;  2F0U A;  1SYF A;  1GHJ A;  4GKK L;  1B2T A;  2NN6 G;  3M4Q A;  1WI5 A;  2B2Y C;  5C44 G;  3ZJY C;  4QY7 A;  1TS2 A;  3CCM A;  4DV0 Q;  4AYB B;  4JK1 C;  1DOL A;  2AQ3 B;  3U9O A;  4FDB A;  3BJU A;  4OIK A;  4A3K B;  5I9O A;  1JT8 A;  1OTC A;  3RUZ A;  4UY8 C;  4P75 A;  4KY5 A;  2ENB A;  1STN A;  1ZYR D;  5JEA H;  3CXC A;  4JI2 L;  3NBH B;  3U50 C;  1T5E A;  3ULP A;  4YHH Q;  4POF A;  1EQV A;  2XNA C;  4K5X A;  5JVH 3;  2FJ2 A;  1PFS A;  1TVX A;  3HKZ B;  5IGE A;  5JVG 3;  5JJI A;  5EBD A;  5IP9 G;  1O7I A;  2Y0S G;  2B39 A;  4ZAI A;  3TQY A;  2JA6 H;  3M4O H;  4XT3 B;  2CWP A;  1UE7 A;  5JAV A;  1WTW A;  2XWJ B;  3SXH A;  1HNZ L; 
#chains in the Genus database with same CATH homology
 3C2P A;  2RA4 A;  2E2I B;  3FRP B;  1IL8 A;  1GUS A;  1TII D;  3MWY W;  4K14 A;  1MI2 A;  3URY A;  2XN9 C;  4EQN A;  2EY1 A;  1O80 A;  4XQN A;  5C0X J;  4KMU C;  4IUT A;  1EEF D;  1WTP A;  1LT5 D;  4Z9C B;  2LKV A;  3M85 A;  1A3T A;  2B8F A;  1B9N A;  1KDA A;  1GHK A;  3NBI A;  5FLX L;  5HGT A;  1PTO F;  1V1P A;  1CQV A;  3FPU B;  1Y8O B;  5ELE A;  5CBA E;  4RWS C;  1EIG A;  2F0P A;  2F0N A;  1CZW A;  3I4L A;  4CKB A;  1TU2 B;  1PRT D;  3K5M A;  4OO1 H;  1FNU A;  4O1N A;  4BBS B;  3EJI A;  2L4N A;  1SMY D;  2A68 D;  1OXU A;  1SBB B;  2JE6 I;  3MAQ A;  1Q1B A;  1SE2 A;  3GD7 A;  5I2Y A;  2NVQ B;  4KK7 A;  1DD2 A;  4RGO S;  3PO3 B;  1EWC A;  1Q3L A;  2KJX A;  3C1E A;  3EA6 A;  1CI3 M;  3KK7 A;  1BCP D;  1SE4 A;  3GO5 A;  2R7Z B;  2B2W C;  3V2T A;  3R2I A;  2L11 A;  2NB0 A;  2FHT A;  4I7Z C;  4GZY C;  2DY8 A;  2F0G A;  4A3J B;  2KOL A;  1SXT A;  4H0L C;  3A55 A;  1HQR D;  1TS4 A;  1SNP A;  3OW7 A;  2DN8 A;  2A5H A;  4HR7 B;  3ITP A;  2PZW A;  1EYD A;  3E6Z X;  4N9T A;  1A2T A;  3V96 A;  4ZYS A;  1HCZ A;  3HZX A;  4IAL A;  5KYL A;  4OGQ C;  1Y1V B;  3NPP A;  4OL7 A;  4NP5 A;  4XIG S;  1TWG B;  3I4N B;  3HP3 A;  1H9R A;  5CV7 A;  1CK1 A;  3HGB A;  4KTA A;  5IGF A;  4F8M A;  1ILP A;  3T53 B;  5EPJ A;  2EJM A;  3SK6 A;  4XDX A;  3SHL A;  5IOD A;  3VR3 A;  2G9H D;  4RCN A;  1F2Y A;  2D9U A;  1F2Z A;  4PQX A;  1PFM A;  1DZ1 A;  4TKO B;  1JOO A;  1II3 A;  3WDN A;  4CJ1 B;  3GTK B;  1R4P B;  1HQM C;  3M4Y A;  4C2M B;  5K5P A;  4X3U A;  3TZD A;  1ICW A;  3PUY A;  3S1N B;  2MGS A;  4ZKC B;  4DAY A;  2CHB D;  1TWH B;  3VR4 A;  2AUK A;  3CQZ B;  3O13 A;  3SDZ A;  3S17 B;  1D6E C;  2HCC A;  1ET9 A;  3HEJ A;  4G57 A;  3E0J A;  1IW7 C;  5G3L F;  2A69 D;  3BZD B;  2K5D A;  5KND A;  3K0Y A;  4A3G B;  3P1H A;  1RJT A;  4CGY B;  5LL6 X;  4TSS A;  2FMC A;  1LAB A;  1KNA A;  2HCI A;  5IOC A;  3TP8 A;  1CQF A;  4RGT A;  3WOF A;  1OO9 B;  5KRU A;  2DNE A;  4KY7 A;  2RDH A;  2XRQ D;  1X32 A;  3T16 A;  4KKS A;  2ZXP A;  2YYZ A;  2XRS D;  4G7Z C;  1WD1 A;  5J39 A;  1Q1E A;  2E2H B;  1WTR A;  3BVZ A;  5D3D A;  1M8A A;  1V1P B;  1XX8 A;  4IZ8 A;  3GTM B;  5M3F B;  4KV6 A;  4BY1 B;  1XXG A;  4F88 A;  4LMQ D;  4IUV A;  3FEW X;  1HTP A;  4PMB A;  3J7Y W;  2PMZ B;  4HED A;  3NSW A;  2WIN B;  1EY7 A;  1HA5 A;  2PZT A;  3M7N A;  1VF5 C;  4A3I B;  1B9M A;  1MSG A;  5IGG A;  2B2U C;  4XQJ A;  3HOW B;  2JA6 B;  3AU7 A;  4QCL A;  2IJ0 A;  3AB9 A;  4ZLT F;  3SEB A;  1CZG A;  1Z7T A;  4RAU C;  1Q12 A;  5A35 A;  1PDQ A;  1JQY D;  1BUV T;  2F1M A;  4DNR B;  1L0Y B;  3GTP B;  3N6R A;  2HDM A;  1AW7 A;  4HCE A;  4K5W A;  4BS9 A;  1KAB A;  2X69 A;  2LS0 1;  1DOK A;  1DCZ A;  1PFB A;  4XXE A;  3NWT A;  1CHQ D;  1G2S A;  2XIW A;  2O2L D;  1EZ8 A;  3S9W A;  3HS0 C;  3KBG A;  4F7X A;  4L6T B;  1WD0 A;  4JBW A;  3I91 A;  5KNC A;  4C1N I;  3MXG A;  1NCV A;  1S5B D;  4KY6 A;  4J8Q A;  5CV8 A;  2X6L A;  4QUF A;  3MXP A;  1I4H A;  3ZYY X;  1KDB A;  1PTO B;  2IWH A;  3PUZ A;  1O7Y A;  2XVS A;  4FO2 A;  5LL6 S;  4IQZ A;  2B2W A;  3J7A F;  4RFB A;  2A73 B;  1BCP F;  5KIX A;  2RDG A;  3MHB A;  2KEE A;  1OXT A;  3E5S A;  4DU9 A;  3JAM E;  1SYB A;  1XTC D;  2A68 C;  3Q6S A;  3FDT A;  4XTC S;  4TQU S;  2F0D A;  2EY6 A;  1G2T A;  4IUU A;  1KTK A;  1TY2 A;  1NR2 A;  2PO4 A;  5AFW A;  2F0T A;  2RVL A;  1CFM A;  4RKL A;  3VA7 A;  1TS3 A;  1PRT F;  4M8A A;  2NTS A;  3W2D A;  2N88 A;  1IHZ A;  2F0E A;  3FKI B;  2AQ1 B;  1RTO A;  5M5Y B;  3CHB D;  2JA8 B;  4DA2 A;  3BDO A;  5C5M A;  1EY0 A;  1EZ6 A;  5DNF A;  1GOZ A;  1TKW B;  1QG7 A;  2JYO A;  3FVQ A;  4K8I A;  5ELF A;  2K04 A;  2L5T A;  3UI2 A;  1HUM A;  1JC7 A;  3Q24 A;  4K5V A;  4ABN A;  3T51 B;  3V05 A;  3EQL C;  3R93 A;  3EVQ A;  5DEH A;  5EKK A;  5C4X B;  2TSS A;  5EKL A;  2MUY A;  1QIL A;  5M3M B;  1D1I A;  4ZUJ A;  2L0C A;  1LV9 A;  4ZUI A;  2Q8T A;  1VMP A;  3J80 E;  2KA7 A;  2E75 C;  1WTQ A;  1EFI D;  1CA6 A;  2L55 A;  1E2W A;  3K57 A;  2HDL A;  3A8J E;  1JB3 A;  1SND A;  2F0V A;  1LT3 D;  2F0K A;  4HN7 A;  4S3S A;  5FK9 C;  4A3E B;  1NSN S;  3LNN A;  1QE6 A;  2IX3 A;  2SNS A;  5TSS A;  2IT1 A;  1EY9 A;  4QF4 A;  3TZU A;  3S1R B;  2B8G A;  1YNN C;  4KD3 A;  4DXG A;  3R8B A;  2L12 A;  1PZK D;  4EQO A;  2K6A A;  2KVM A;  1JIC A;  2M2L A;  3A7L A;  4CJ0 B;  2ZXO A;  5C0X I;  1SMY C;  1HUN A;  5KYI A;  4RGN A;  5BN5 A;  1LTG D;  5IT9 L;  5JEA G;  1EY4 A;  2EE1 A;  3C46 A;  2V4D A;  1EOT A;  1V8Q A;  3GV3 A;  1GUG A;  1BNZ A;  4FF2 A;  4V0B A;  1UEA B;  5ELC A;  2B2U A;  3D31 A;  2F4I A;  4A3D B;  3OHX C;  1FYC A;  5IGB A;  1BXT A;  2K5Q A;  1YNJ D;  4IUN A;  2A6H C;  4HTH A;  4NKL A;  5EQ0 A;  1B1Z A;  3R2T A;  4KN4 C;  3R3O A;  2F0L A;  2R6G A;  1STB A;  3K6O A;  3P7J A;  1EU3 A;  4EVO A;  3NUC A;  3D6C A;  1HPC A;  3F2U A;  1I4Q A;  2PQE A;  3CU7 A;  3DEO A;  2EYH A;  1WVL A;  1K8O A;  2WKD A;  1C48 A;  2QCP X;  3OMG A;  1B44 D;  2I46 A;  1DON A;  4ILW A;  2KCN A;  1QNU A;  2B2T C;  1A3U A;  2K32 A;  1SFO B;  1OXS C;  4G4K A;  5J1Z A;  5K36 G;  1GXD C;  2L1B A;  2D2C C;  3H91 A;  1LAC A;  4KJO A;  1S4Z A;  2FIN B;  1F9S A;  1A6X A;  1O7L A;  1MBY A;  5E4W C;  2BE5 C;  3DMU A;  3GV6 A;  1QCB D;  2PNR C;  4C1N K;  1JOR A;  4HCS A;  4U67 3;  3NQT A;  4QB4 A;  2RSO A;  1CA5 A;  2Z4I A;  1V1O A;  3I73 A;  1PTO H;  4C3H G;  3K58 A;  3VYS A;  1CT1 D;  3KUP A;  3S1M B;  1KAA A;  2D62 A;  3HOY B;  2VB2 X;  2KQ3 A;  3MXU A;  2NWG A;  2F0J A;  1I4G A;  2O5I C;  4H13 C;  1STY A;  1LT4 D;  2MJ8 A;  3KLS X;  2RSN A;  4MIU A;  2F0S A;  1EY5 A;  4XYQ A;  4DN4 M;  1LT6 D;  4ODG A;  2KEC A;  1F9Q A;  3FPP A;  5C3X A;  4ZQ3 A;  5I2X A;  2BDO A;  2EVB A;  3N52 A;  1STA A;  1I3Q B;  2EYJ A;  1Y8N B;  1JR0 D;  3RLF A;  2EYL A;  2Q8R E;  4X3S A;  4RH6 A;  4FXK C;  1B50 A;  4X3T A;  4KKU A;  1U4L A;  4IUP A;  3DXJ C;  1S5D D;  2NZ1 D;  1BQQ T;  1VMC A;  1LTI D;  3NTK A;  4OHJ A;  4ME5 A;  2F0Q A;  3A54 A;  2F0F A;  1X3P A;  1FD7 D;  2VNU D;  2EJG C;  3I3C A;  4C3J B;  5E3F A;  3L7Z C;  1VCI A;  1YNJ C;  3CKI B;  4RKB A;  3GTO B;  4KD4 A;  4FP5 D;  5HUR A;  1ZXT A;  2K28 A;  4M1U B;  4PMW A;  3IAY A;  3IFD A;  3QOJ A;  1TWF B;  3HOU B;  2Z4H A;  4RGM A;  4K6D A;  2SDF A;  5CV5 A;  4UDU C;  2BA1 A;  2E74 C;  3HG9 A;  1H9M A;  1QJO A;  5JJZ A;  2LFN A;  3A7A B;  2F0I A;  2F3V A;  1SNC A;  2IW3 A;  2LMC B;  4ZK9 B;  2JEA I;  2O5J C;  3VR2 A;  2SEB D;  3X3M A;  3WOE A;  1SJH D;  4BA2 I;  1ZEQ X;  3AMU A;  2JP1 A;  1XYI A;  3RZD B;  4RCO A;  3I4M B;  2CW0 C;  2BA0 A;  2IPK D;  4ZKB B;  3D8G A;  1FNV A;  4B9X A;  2RKS A;  4O42 A;  2A6H D;  3MZ5 A;  4V19 0;  3LWU A;  2A74 C;  3H94 A;  3QG1 A;  5FLX E;  1I6H B;  1D5X C;  5CV9 A;  4A3B B;  3RZO B;  4CKC A;  3DUZ A;  5CV4 A;  3M7G A;  4K2L A;  1ROD A;  2F0O A;  3SK4 A;  1BO0 A;  1TWC B;  2BCO A;  2TMP A;  1WTV A;  2BOS A;  1Y1W B;  2IL8 A;  1ESR A;  1S5C D;  2EPB A;  3J81 L;  5IT9 E;  4HSP A;  3DWP A;  3VYU A;  2EY5 A;  2A69 C;  4X3K A;  1DYQ A;  2FFK B;  3SR1 A;  3TP5 A;  5I4D A;  2B2Y A;  5CGK A;  1I50 B;  1I4X A;  1F2M A;  1FNW A;  1PZI D;  2R92 B;  4A3M B;  1BR9 A;  1OXV A;  3PO2 B;  2EY2 A;  1A2U A;  5T1G A;  4LAA A;  4QIW B;  2AWN A;  3TBI B;  3BYT B;  3EFX D;  3NTH A;  5C0X G;  4ID6 A;  1HA6 A;  5J22 A;  3NK9 A;  3H6M A;  3L3O C;  4N9P A;  1K83 B;  1HRJ A;  3TP7 A;  2VB3 X;  3BG3 A;  3MA2 B;  3NWS A;  4LK1 C;  3OIQ A;  4R9W A;  2QKI C;  1ZKO A;  2AWO A;  1O7Z A;  5JPN C;  2Q8I B;  1PTO C;  3PIP 3;  3Q22 A;  1ONL A;  3OSO A;  5I6W A;  3M3Y B;  1I4R A;  4C3J G;  1MSH A;  5E4X A;  3D4R A;  2FMM A;  4FXD A;  4FF4 A;  1EIH A;  3H0G B;  4PNY A;  3NE5 B;  3BYY B;  3ND9 A;  1KDC A;  3Q0A A;  1D5Z C;  4G7H C;  4R8N A;  2HQE A;  5JPM C;  5EKI A;  1IKL A;  5G3L D;  2Z1C A;  5DM7 3;  1QNK A;  1TS5 A;  2NVY B;  2EDG A;  4CHT B;  4H7B A;  5EPK A;  4YIJ A;  4B08 A;  1H9S A;  2K01 A;  2CVR A;  3SK8 A;  2I07 B;  1STH A;  1S5E D;  3DEP A;  2QIL A;  3PIO 3;  1UAP A;  1YNN D;  4DNT B;  4U68 A;  2NVT B;  4C3I G;  4K8J A;  2PYK A;  3MTS A;  2ZXR A;  3HRZ C;  4G7O C;  3OPO A;  1STE A;  3OMC A;  1C8C A;  3T13 A;  2WKC A;  1EL0 A;  1MD2 D;  2MPM A;  2CW0 D;  4LJZ C;  2QDB A;  4FVM A;  1JWM D;  4KHZ A;  5DM6 3;  1ET6 A;  2IX1 A;  5CBE E;  1D1K A;  3S2D B;  1G6Z A;  4J6H A;  3TN2 A;  2Y0S B;  2K1B A;  4R8I A;  1RCV D;  1VF7 A;  2A6E D;  1HFN A;  4FF3 A;  1ILQ A;  3DWA A;  2EYO A;  1GUT A;  1U9R A;  3LWE A;  3MFG A;  5EBC A;  1SNO A;  3D4W A;  3C3L A;  1X3Q A;  3RMH A;  4XYO A;  4DF7 A;  2PZU A;  3DM1 A;  1TY0 A;  1R9T B;  1EYA A;  4KKT A;  1W6K A;  3P75 A;  4CBV A;  3J80 L;  5FKA C;  1HHV A;  2AUJ D;  5NUC A;  1VDZ A;  1DJR D;  1ZYR C;  1STG A;  5JOB A;  2Z8L A;  2F03 A;  2PW5 A;  2YU9 B;  2DNC A;  4EQP A;  3K5N A;  2K03 A;  2MHV A;  3VR5 A;  2ICE C;  5CR3 A;  5KEE A;  1U4P A;  2WB1 B;  2M9V A;  5T1I A;  2WII B;  1ENF A;  4K2K A;  1Q90 A;  1DOM A;  1E2V A;  1QB5 D;  1HFG A;  1F9R A;  4Y7N B;  2VXW A;  3GP7 A;  3BDL A;  1K8M A;  1T5X D;  4MHE A;  1DXM A;  3GTQ B;  2QEJ C;  4BWG B;  3D4D A;  3NXW A;  3A8I E;  1NR4 A;  1ENC A;  2AQ2 B;  3DHQ A;  2K5W A;  2SOB A;  4C3I B;  1ENA A;  1EYC A;  2M00 A;  4XT1 B;  1H9K A;  4Q5V A;  2EZV A;  5EJW A;  1F77 A;  2K7V A;  1EEI D;  2JEB I;  1JWU D;  3TME A;  3S1Q B;  5EPL A;  2F0W A;  1LLR D;  3RD4 A;  1I4P A;  3I70 A;  5C0X H;  1Y69 U;  3JAM L;  1RHP A;  2F0H A;  3D3R A;  4PMC A;  2H1E A;  3NTI A;  3S2H B;  5F2D A;  4L63 B;  5ELD A;  1NUC A;  3PMF A;  5KNB A;  2R3Z A;  1WCM B;  1OXX K;  1U4R A;  1SYC A;  2E76 C;  1H9S B;  4ULL A;  3K5L A;  1D2B A;  2JA7 B;  3OWE B;  2RQX A;  4C3H B;  5DAU A;  4PV1 C;  5D65 A;  4IFD I;  2K33 A;  2G9D A;  2NN6 H;  4DFA A;  4CKE A;  1GUN A;  1J9O A;  5KGU A;  2OXP A;  1BCP C;  3T56 B;  1R4Q B;  4QMG A;  2JA5 B;  5IIF A;  5COY A;  5CV6 A;  4KJN A;  1AZP A;  3KBX A;  2OF1 A;  2A6E C;  4RHR A;  1LTA D;  3J81 E;  2NYZ D;  3HOX B;  5BN4 A;  4BY7 B;  1G8Z D;  5IGD A;  3IFT A;  2BE5 D;  1PLF A;  4EGV A;  1IYU A;  3K59 A;  2PCF B;  3CRL C;  2OEO A;  1KLU D;  1O78 A;  1G29 1;  4DK0 A;  1PRT C;  2KHS A;  1PFN A;  1LTR D;  4HSV A;  2C5C A;  4RA8 A;  5A2Q E;  1U4M A;  3PUV A;  3H3V C;  1SYD A;  5M9O A;  2NUC A;  4QUC A;  2R93 B;  5CMD A;  2H4O A;  3OIP A;  4IFD H;  3VYT A;  1AFP A;  4BBR B;  3MEH A;  1B53 A;  3ONA B;  1HTL D;  4IFD J;  3QO2 A;  4FF1 A;  5C44 B;  5C5L A;  3NP8 A;  1AZQ A;  2XWB B;  4FNF A;  5CC4 A;  2MP1 A;  1S5F D;  1TQO A;  4FXG C;  1PZJ D;  4K6L A;  1ESF A;  3GTL B;  1LTT D;  3SK5 A;  5FO7 B;  2E2D C;  1W6J A;  2J4X A;  1BCP B;  3C1F A;  3TP6 A;  2WP8 J;  5ELB A;  2GA4 B;  5C6A A;  3NHH A;  1J8I A;  1Z6H A;  4DK1 A;  4IUR A;  1QWY A;  1DM0 B;  4RHS A;  3T4A C;  4NW2 A;  2DY7 A;  1MGS A;  2B2V C;  3D6W A;  1PRT B;  1F9P A;  5C4J B;  5I6Y A;  1B3A A;  1SEB D;  3U9S A;  1V43 A;  5E1F A;  1XWE A;  4HMJ A;  1RTN A;  2NVX B;  1NAP A;  3S16 B;  1A3V A;  1QOH A;  1FGB D;  1ML0 D;  1SSO A;  1KNE A;  1GUW A;  3I90 A;  1SJE D;  2SNM A;  3ND8 A;  1RF2 D;  4F87 A;  2J7Z A;  2RBM A;  4A3F B;  1TWA B;  1Z47 A;  2WAC A;  5C4H A;  3ERQ A;  4WRD A;  1CHP D;  3KF8 A;  4MN3 A;  3NBH A;  2PPB C;  1F2L A;  3G6J B;  5COR A;  1BOS A;  3GTJ B;  3QJY A;  1LTS D;  1LO5 D;  3K5O A;  2KUM A;  1HXY D;  3G7L A;  1C4Q A;  4J1M A;  2CQA A;  3M4O B;  5LHY 1;  3NQI A;  3SE0 A;  2O4X A;  3I72 A;  2KED A;  2R61 A;  2B2T A;  3QB3 A;  1A15 A;  2EYM A;  4A93 B;  5FO9 B;  2LY7 A;  1SYG A;  3VA5 A;  5I9P A;  1H9J A;  1FR3 A;  2QF7 A;  3QOL A;  4WOR A;  1SAP A;  5C3W A;  4HMI A;  1RKN A;  4OIJ A;  2ID0 A;  3FMC A;  4IUQ A;  4DGZ A;  3HOV B;  4DXF A;  2K05 A;  3BVG A;  2B63 B;  1IKM A;  2VUM B;  1I6V C;  1KLG D;  3KLR A;  1WTO A;  2WAQ B;  3S15 B;  1TT2 A;  5M5X B;  3Q23 A;  1JE4 A;  3P20 A;  2N55 A;  2EXZ A;  4I65 A;  1EY8 A;  2C9O A;  2WV6 D;  3MFY A;  2ICI A;  1AP0 A;  2EOT A;  3CRK C;  1RDP D;  5ISR A;  3MC0 B;  3S14 B;  1EQT A;  4IFD G;  3A56 A;  1PMR A;  4DAP A;  1E0B A;  1IYV A;  1D5M C;  3OWF A;  1GJX A;  4B9W A;  3I8Z A;  1JOK A;  2NN6 I;  4TRD A;  1UUP A;  1CM9 A;  1PXU A;  2F3W A;  1PTO D;  4KHV A;  1SNQ A;  5FOB B;  3BDC A;  4OO1 G;  1Q8I A;  3MVV A;  4H44 C;  1BDO A;  1E2Z A;  1TR5 A;  2NBF A;  1GUO A;  4KI0 A;  3BVM A;  2BDN A;  1B4O A;  1IW7 D;  2L9H A;  4NDX A;  2JXM B;  1BF4 A;  2EJF C;  3L9A X;  4FYD A;  3PV0 A;  3TDQ A;  3VYR A;  5BN3 A;  4IN3 A;  4P2C B;  3VR6 A;  2RDF A;  3MXN A;  4HAE A;  4Q0F A;  4CJ2 C;  3IL8 A;  2EYF A;  2NTT A;  3ERO A;  5IGC A;  2OT2 A;  4WJW A;  1WTX A;  3HOZ B;  3DWQ A;  3OOC A;  4ZRZ A;  1M4V A;  1G91 A;  2IX0 A;  1EWH A;  5CYU A;  5K36 H;  5D14 A;  2KCC A;  1SYE A;  2F0M A;  1PYW D;  4BA1 I;  1JOQ A;  4WFN 3;  1SDF A;  1SNM A;  2B2V A;  3KLS A;  1LTB D;  3IKJ A;  3GTG B;  2PW7 A;  1AEX A;  4C56 C;  3J7A V;  2X6G A;  2E2J B;  2HUG A;  5JEA J;  1EY6 A;  4L8J A;  4DAV A;  1EU4 A;  5C3E B;  3PUW A;  1JCK B;  1RD9 D;  1Y8P B;  4E6I A;  2ZT9 C;  2XSC A;  3TSS A;  4UAI A;  2JSO A;  5M5W B;  4XQQ A;  3A8K E;  1L0X B;  3K7A B;  3QIA A;  4OO1 I;  1CTM A;  5EGT A;  1JWS D;  3BS1 A;  3W3A A;  5A2Q L;  5FO8 B;  1SE3 A;  5C4Z A;  2J0T D;  4KN7 C;  3H09 A;  3GQB A;  3LX0 A;  3QWN A;  5D3I B;  1AN8 A;  2EYP A;  1UNS A;  3SVM A;  3X3N A;  3PUX A;  4NMZ A;  1BBX C;  2D5D A;  2F0U A;  1SYF A;  1GHJ A;  1B2T A;  2NN6 G;  2B2Y C;  1TS2 A;  4AYB B;  4JK1 C;  1DOL A;  2AQ3 B;  3U9O A;  4A3K B;  4OIK A;  5I9O A;  3RUZ A;  4KY5 A;  2ENB A;  1STN A;  1ZYR D;  5JEA H;  1T5E A;  1EQV A;  2XNA C;  4K5X A;  5JVH 3;  2FJ2 A;  3HKZ B;  1TVX A;  5IGE A;  5JVG 3;  5EBD A;  2B39 A;  4ZAI A;  4XT3 B;  5JAV A;  1WTW A;  2XWJ B;  3SXH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...