2KVMA

Solution structure of the cbx7 chromodomain in complex with a h3k27me2 peptide
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
71
structure length
71
Chain Sequence
MELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEERDRASGYRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chromobox protein homolog 7
publication title Molecular interplay of the noncoding RNA ANRIL and methylated histone H3 lysine 27 by polycomb CBX7 in transcriptional silencing of INK4a.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
total genus 11
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2010-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2kvmA00
1BBXC 1WD1A 1WTVA 2L11A 1JICA 2K05A 2KEDA 1F9SA 1G2TA 1AZQA 1GUWA 1VMCA 2VXWA 1B53A 1NCVA 5AFWA 5DNFA 2FMMA 1WVLA 1MI2A 2RVLA 4ZK9B 1EQTA 1DOKA 3ONAB 1WTOA 5EJWA 2L12A 2KECA 4ZAIA 3DEOA 1X3PA 1MSGA 2RSNA 1B2TA 1E0BA 4MHEA 1PLFA 2N88A 2DY8A 2X6LA 1G6ZA 3P7JA 1HHVA 4RWSC 3I91A 1QNKA 1BO0A 1HRJA 2H1EA 2DY7A 4IUQA 3TN2A 1DZ1A 3TZDA 2K1BA 3LWEA 4IURA 2KOLA 3H91A 1HFNA 2B2TC 2EPBA 4HEDA 2Q8RE 1EIGA 2HUGA 1O7ZA 2MPMA 2K01A 1IKLA 1ILQA 3N52A 4R9WA 4ZLTF 5E4XA 2RSOA 1B3AA 2FJ2A 5E4WC 1AZPA 4CJ1B 2B2WC 5EKIA 3G7LA 1X32A 1XX8A 2M2LA 3QO2A 1PFNA 2B2UC 3Q6SA 1RTNA 2K04A 4RA8A 1AP0A 1WTRA 4IUPA 1HUNA 1F9PA 4XDXA 1O80A 1EL0A 2RA4A 1A15A 1NAPA 2MGSA 1MGSA 1PFBA 5D14A 3SVMA 1B4OA 1KNAA 2B2YC 1BNZA 1J8IA 1LV9A 1U4MA 1ZXTA 3GV3A 2MJ8A 4ZKCB 1PDQA 1PFMA 1S4ZA 4HSVA 2EE1A 1O7YA 4CJ0B 1U4RA 1CM9A 2N55A 1ILPA 1SDFA 1KNEA 2KUMA 5EPKA 1G91A 2X69A 5D65A 4CJ2C 1M8AA 4UAIA 2JYOA 4U68A 5EPLA 4IUUA 4OIKA 3D6WA 1QE6A 1X3QA 2K28A 2BDNA 1SAPA 2FINB 1RTOA 2L1BA 4X3SA 2X6GA 2R3ZA 4QUFA 1EIHA 1DOLA 3DEPA 5EPJA 2B2VC 3FPUB 2KVMA 3IL8A 2NYZD 4R8IA 1ML0D 1RODA 4XT1B 3GV6A 3MWYW 1U4PA 3HP3A 3IFDA 2B2TA 1IL8A 5CBAE 1WTXA 1WTPA 1CA5A 5CMDA 1B50A 1JE4A 5JJZA 1F2LA 4ZKBB 1HUMA 4HCSA 4RAUC 1ICWA 1MSHA 2FFKB 1G2SA 2IL8A 5CORA 2HCCA 2SDFA 1NR2A 3I3CA 4MN3A 3UI2A 1QG7A 2B2WA 2B2VA 2JP1A 2KEEA 2B2UA 5EQ0A 2HCIA 1ESRA 1EOTA 1NR4A 2NZ1D 4HAEA 5COYA 1CA6A 1TVXA 2FHTA 5T1IA 1J9OA 2L4NA 3KBXA 4QUCA 4XT3B 1F9RA 4OIJA 5CBEE 1WTQA 1WD0A 1BF4A 4LMQD 1WTWA 2B2YA 3MTSA 2K03A 1U4LA 1SSOA 3FDTA 4NW2A 4DN4M 1HA6A 4IUVA 2HDLA 1HFGA 1RJTA 4O42A 2Q8TA 4X3KA 1DOMA 1IKMA 2L9HA 2MP1A 2CVRA 2HDMA 2D9UA 3R93A 1RHPA 1F9QA 1VMPA 2EOTA 5T1GA 1C8CA 4IUTA 3I8ZA 3KUPA 2J7ZA 3I90A 1Q3LA 1DONA 2XIWA 4X3UA 3F2UA 4X3TA 2NWGA 1XYIA 3DM1A
chains in the Genus database with same CATH superfamily
1FJGL 1Q1EA 2Z6BA 1I94Q 4JI6Q 1PA6A 3G71A 1C7YA 4DR1Q 4A3GG 1MIUA 1NMGA 1WVLA 4ZK9B 1YNXA 1ZYRC 2EYLA 1A63A 4GN3B 5JOBA 4ZAIA 5IYCG 1UE1A 2CW0D 3NWTA 1YITA 3K7AH 4YHHL 2UU9Q 2HIVA 2WB1B 2K5DA 4P2CB 4UY8C 5IGBA 2UXDL 3LWUA 5M3FB 3RN2A 1G6ZA 4RGOS 2ENBA 4V190 4OXPA 3KJPA 2F0JA 1WI5A 1TWCH 1JWSD 4X66Q 1HXYD 3J7YW 2K01A 4I7ZC 1EEID 2PNHA 2NTTA 4HJ7A 1HR0W 3TMEA 1ET6A 2ZXPA 2I5LX 3CCEA 1YNJC 1CQVA 1SEBD 1JOQA 2A68C 3C46A 1IYUA 1CZWA 4X64L 1F9PA 3A8IE 1O80A 3VA5A 3W2DA 3ZYYX 4OX9Q 5C4XB 3PUXA 4A3CG 4MZ9A 4GKJQ 1QCBD 3BDOA 4LWCA 4IPHA 2ES2A 2N55A 1SDFA 3QJYA 3SK4A 2GVAA 2EJGC 2HIXA 3RLOA 1HJPA 4KY5A 5I2XA 1SFOB 4IPDA 4RMFA 4FF1A 2FINB 3H3VH 3HKZG 4PMWA 3W1GA 1FD7D 4CBVA 5BR8L 1KD1C 1TIID 4BS9A 1XNQL 3U4ZA 3VYUA 1YI2A 4IO9A 3MWYW 3KDFB 1JMCA 4MTKA 4RGTA 5CV5A 1EIYB 2YV5A 2MHVA 3MHBA 2WAQE 3KYHC 3VA7A 4LF8Q 3S16H 1VQIA 2B2UA 4DV7L 1F2MA 4WRDA 5J3BA 3DMUA 4JI3L 2R92B 4GN4B 4KD3A 1QUQB 1NSNS 1BCPF 4K2LA 2R7FA 4B08A 4EQNA 3MXNA 1SNDA 3NP8A 4LF9L 3H3VI 3PUWA 3IFTA 1QVGA 3EJIA 2R61A 3U4VA 1YIJA 2JA5G 1JICA 1Q8KA 1ZKOA 2K05A 1CFMA 2HQEA 3AFQA 1X6OA 3CRLC 5DLQE 3OW7A 4JPBW 2ZM6L 3FMCA 1ONLA 2D62A 3P20A 4PZ7A 1CUKA 3S1RB 4H44C 4K2KA 4C3HH 1MSGA 2K4KA 1IYJB 3J80c 4S3SA 1NUCA 2FXQA 1IHZA 4JI5Q 1W6KA 2A1AA 4GOPA 1PH4A 2I0QA 1VQPA 4EQ5A 4JVZA 2EY5A 5I9PA 5C4JH 4DV6Q 3V05A 4X65L 3Q22A 3F2DA 1HNXQ 2Z9HA 4FXDA 3AU7A 2N8NA 3RZOB 1HNZL 4DV3L 1KRSA 1HCZA 2CHBD 3A54A 4WJ3M 4HIKA 3BS1A 1M4VA 4YWLA 2E2JB 4OWXB 1PTOH 3GTQB 4B9WA 4DUZQ 1QVFA 3CF5A 1GO3E 1PFMA 4FDBA 4BBSG 4QIWE 4N9TA 4DR5Q 3RZDH 3I70A 4UAIA 4IZ8A 2JA6G 1TWGH 2UUAL 4AYBG 3STBC 3HOWH 1XNRQ 2IY5B 3OIPA 3ND8A 5D3IB 1SNQA 1PRTF 5KNCA 4B3TL 5CGKA 5IP9G 1PRTB 4R8IA 4I65A 1RKNA 3CCUA 1B50A 2XNAC 1JE4A 4FXKC 2NVYB 3J81j 1CSQA 1EUJA 2B2WA 5LMUQ 1N8RC 1VQMA 4JI7Q 4HAEA 5M5WH 2F0HA 3HOZG 4K0KQ 3MEHA 1FJGQ 4A3IB 1N34L 1KL9A 4O42A 2PPBC 2F0KA 4FF3A 1B9NA 3S14B 2WB1E 2NN6G 1FNUA 3OMCA 5J22A 1SMYD 2MNAA 4Y7NB 4YHHQ 4QJFA 4JBJA 1PRTD 1EFWA 2UXDQ 3GTLB 2XVSA 2HHHQ 4BBRB 2EXZA 2FMMA 4LUOA 5IWAL 5J39A 2PQAA 4CKBA 1Y8NB 5KNBA 1PLFA 5K36H 3T53B 1CZGA 2N88A 4OGQC 3VR2A 3HOYH 3TN2A 2Z4IA 3D31A 3MXUA 3ER0A 3KLRA 4X64Q 3ICEA 3J7AF 2F03A 3N52A 4BY1B 5FJ8H 3ERSX 4CJ1B 5IGEA 3MC0B 1AP0A 1RTNA 5C6AA 1PV4A 1V1OA 1G291 3W5OA 4XQNA 2R93G 3J7AV 3OYYA 1PDQA 2YU9H 3UE1A 5BR8Q 3SK5A 1NE3A 1XNQQ 4A3BG 4A3KH 3CCLA 1LT6D 4A3MB 3PO3H 1LYLA 4DF7A 3HZXA 1QILA 3K80C 2RDHA 2G9HD 1Q12A 4IPCA 3J81E 1MD2D 4HJ9A 2ZTCA 2QKIC 4X3SA 3S2HB 3AMUA 4DR6Q 1ENFA 3CU7A 3M4QA 1C9OA 2JA8B 4A3LH 2M00A 2DN8A 4JI3Q 1IL8A 4OWTB 4CDEC 5JJZA 1ICWA 2A8VA 2I5HA 4N8X1 1NR2A 4MN3A 4EQPA 1E24A 1XMQL 4LF9Q 1QWYA 3U9SA 2QILA 1K9MC 4JI4L 2BH2A 3H09A 3L3OC 5IE8A 3ULJA 2BA1A 4LF4Q 1KDBA 4M8AA 5E3FA 2NVQH 3AEVA 2MO0A 1HA6A 3BDCA 2XN9C 3BU2A 1HZBA 1SYBA 3KLSX 3A5ZB 1S3OA 2KCNA 2ZM6Q 1N32L 1BQQT 2D9UA 5FLMH 1SYEA 2EDGA 3EVQA 2PO4A 1D6EC 4LAAA 4ZUIA 1LTBD 2NZOA 3KFUA 1D5ZC 2LKVA 2OQKA 3R2IA 4POGA 1V8QA 5ELDA 1DOKA 3ONAB 1SFOH 1BCPC 1K3BC 2L12A 2KECA 1GUGA 3EA6A 4IOAA 4X65Q 1VQ6A 4MHEA 2F0OA 1SYGA 3NWSA 4JI0L 4HSPA 4A3DB 1HNZQ 1HHVA 4DV3Q 4IUQA 1Q46A 1K3RA 4B3RQ 4LFBL 5LHY1 3PO2B 2F0QA 2SOBA 5LMNL 1K0SA 3HEJA 1L0YB 1VQFA 4QQBX 5E1FA 5FO9B 1UEAB 3CXCA 5GAGC 2AMCB 1GJXA 1XX8A 3IKJA 1W3SA 4LW1A 4E6IA 2F0PA 4DK0A 1B9MA 4BWGB 2UUAQ 1EY5A 3PUZA 5CV6A 4GLAC 3D8GA 1O7LA 2BOSA 4HSVA 3S16B 1DONA 1PFSA 1G91A 2QGQA 1B7YB 1ZYRD 3T51B 3CCRA 2EXDA 1VS0A 1X56A 1QE6A 2EYHA 2K28A 4DNIA 1KTKA 3J7A5 2UXCL 5FLXc 1SNOA 1UEBA 4OONA 2PZTA 4LF6L 2WB1G 4ZUJA 3IL8A 2PI2A 2IPKD 5M3FG 4B3ML 2Y0SG 3NK9A 5IT9E 1YJNA 4ZKBB 1C48A 1LTTD 2F0TA 2MUYA 5CORA 5J1ZA 4DFAA 1N34Q 3KJOA 1QG7A 4A3EH 1YNJD 3TP8A 3VYSA 2Z6KA 2A68D 2FHTA 2F4VL 4C3HB 1Q1BA 2K03A 1Y8PB 2G5DA 5C4XG 3I4NH 2MP1A 1BUVT 3LNNA 2XWJB 2A69C 1PH9A 5C4JB 1UNSA 2BCOA 3GTQH 2B63B 1X3FA 4QB4A 4FF4A 1WD1A 4DAMA 3BDLA 2L11A 2MQHA 4KJNA 3U50C 3KBGA 1K8MA 2NTSA 4Y52H 1AZQA 4ULLA 2PI2E 1VQEA 5C4HA 4UP7A 1Y14B 5JPNC 3CRKC 3NUCA 1WTOA 2D2CC 3HOXB 5IGCA 4K5XA 3MAQA 1PTOB 2K5WA 1LT4D 4HTHA 3NELA 4DV4L 4B3SQ 2ZXRA 4R1JA 1J6QA 3J81L 3RZDB 2WAQB 5DM63 4DR2L 1T9HA 1H9SA 3I4MH 1SE4A 1QZHA 1E7ZA 1TWGB 2NVYH 1MHWC 2R92G 1O7ZA 2MPMA 1ILQA 3HOWB 3VR4A 4K5VA 5IOCA 1A6XA 3QO2A 1E22A 2EYOA 4RA8A 3Q6SA 3DWAA 2D0PA 3UDFA 2IW3A 2F0SA 1GD7A 4IUPA 2BE5C 4DNRB 4A3IH 1B4OA 1KNAA 3D4DA 3D0FA 3FKIB 4QY7A 4F7XA 3HOUG 4CDFC 5I6YA 4IFDH 2R7ZH 3OPOA 1PH2A 4XTCS 4HJAA 4A3JB 1D8LA 1C4QA 1X65A 3PSIA 1UE5A 4DKAC 5M5WB 1ASYA 1Z6HA 2WACA 4GLXA 2RBMA 4ID6A 3TRZA 3OSOA 3M85A 4QUFA 3GTLH 1DOLA 4BBRH 1EEFD 2IX3A 2OTLA 3AFPA 3K5LA 2Z6KC 3TZUA 1UUPA 3PUYA 1GVPA 2DUDA 1Q81C 5ELBA 3PUVA 3BZCA 4G4KA 1Q90A 1TWHB 4NDXA 4XYOA 2LY7A 1Q8IA 3MXNB 3ND9A 1N32Q 1F2ZA 2YTYA 1DJRD 1Y1WH 4ZCKA 4XT3B 4MTNA 1A3VA 4P71A 2AUKA 1WTQA 5LL6X 1SYDA 4FO2A 4RHRA 4IUVA 3A56A 4BY7B 1MBYA 3S2DH 4PNYA 4C3IG 2J7ZA 5IYDH 1JJGA 4JG2A 2R7DA 3STBD 1OXSC 4FF2A 1JWMD 1E1TA 1YHAA 2H5XA 2PZWA 4A3MH 5DNFA 1SXTA 2RVLA 3L0OA 1SE8A 1X3PA 5CV4A 4LFBQ 5IGFA 1MJEA 3BVZA 5LMNQ 2RF4A 2YU9B 5EGTA 3P7JA 2JA8H 5KEEA 1CHQD 4DGZA 4POFA 4F8MA 1EU3A 1GUNA 4LJZC 2K1BA 4DAPA 3PO3B 3PCOB 1LLRD 4A93B 2XRQD 3JAMi 1RD9D 2L0CA 3KOJA 1K8GA 1SNMA 1R4PB 5IT9L 4UPAA 1ET9A 2FJ2A 1IL2A 1IBKL 1TQOA 1JCKB 3CD6A 1STYA 1EOVA 1PFBA 5D14A 1OTCA 3BVMA 2UXCQ 1H9KA 4CKEA 1JOKA 3HOVG 1O7YA 4K8JA 4CJ0B 4LF6Q 3I4LA 4BA2I 2QEJC 2AWNA 1BBUA 3RUZA 5IP7H 1FGBD 4G7HC 4B3MQ 1SMXA 2JA5H 5EPLA 3R8BA 4IUUA 2NVQB 3OOCA 3MVVA 1X3QA 3I73A 1XMOL 1NTGA 4LK1C 4DU9A 5G3LD 1VQKA 3DM3A 3E3XA 1Q82C 2LFNA 3HP3A 1CA5A 2KA7A 4RHSA 3K5MA 4GS3A 5C44H 4H7BA 4C3JG 4A3DH 4X62L 3M4OH 1Y1VB 2A5HA 2KEEA 5EQ0A 2HCIA 2Z8LA 1Z7TA 4BY1G 2IHFA 5LL6S 2JA7B 2EYMA 4JYAL 2EZVA 1K73C 3PO2H 1F9RA 4N8FA 2N78A 4CGYB 4V0BA 4XQJA 1VQ5A 2VUMG 1EQVA 4LFAL 2AQ2B 2ALYB 1IKMA 2WKDA 2CVRA 1DGSA 2WIIB 1WFQA 4DV2L 1WTHA 3EQLC 3I90A 4B9XA 1EYDA 2P5ZX 3T1HL 3FPPA 2JA9A 5I6WA 3A5UA 1XPRA 2B29A 4BBSH 2VB2X 2PQAB 2F0UA 4UP8A 5IYBH 2YTXA 1EQTA 1EYCA 4CDDC 1MKHA 4DR2Q 1OXTA 5EJWA 1M90C 4LF7Q 1F77A 1FL0A 2AHOB 2LSSA 2WV6D 3TQYA 1BCPB 3T4AC 4C1NI 2A6EC 3A0JA 4Q5VA 2DGYA 4G57A 1EYGA 1T5XD 2QW7A 1EWHA 2IX0A 4DV5L 3C3LA 2HUGA 2O4XA 4DA2A 2VQEQ 1TXYA 1IKLA 4ZLTF 3K6OA 3CAMA 2RSOA 1I3QH 4HIDA 1HZ9A 1OXUA 1STHA 2OT2A 1VDZA 2Q8IB 2VQFQ 5BN5A 1HUNA 3H0GH 1O7IA 4DV0L 1FNVA 4A3FH 3K7UC 3M7NA 4A3EB 2KHIA 1UWVA 1PYBA 3Q23A 2CWAA 3PMFA 2F0IA 2E75C 1EQRA 2B63H 2O5JC 1BCPD 1K28A 2CQOA 4DUYL 2VY3A 2RCNA 4OIKA 5A2QE 2PZUA 3CCSA 5KYLA 5CV9A 2K32A 1TWFH 3I4NB 1YEZA 1ESFA 1TU2B 3FPUB 4MIUA 5C4ZA 2EQSA 3HOXH 4ZYSA 3GV6A 2K5QA 2ZJPA 5JEAH 1PXUA 4RAUC 2JXMB 2FFKB 2IL8A 1CQFA 2L15A 1VQHA 3O13A 4F88A 2B2VA 3JAMc 1LTSD 3CPFA 3VYRA 1TVXA 5M3MB 3K5OA 5CBEE 1LO5D 3MTSA 1PH5A 2ZTEA 4PZ8A 1CKMA 4JC0A 4DV1L 1TY0A 1QNUA 3PF5A 3KUPA 3I4MB 3RNUA 1X3GA 3SDZA 1HZCA 2CKZB 1M1KC 3F2UA 4M1UB 3FKIH 1HRJA 1WCMB 3DXJC 4A3JH 4TRDA 1SJHD 4KI0A 2CQAA 4ALPA 1IBLL 5JJKA 1VQ4A 3GTKH 1AEXA 3L7ZC 3W1BA 1I4QA 4JI8L 3H6MA 2Z4HA 4DK3C 4HJ8A 5CV8A 3PF4A 5EKLA 3QOLA 4KKSA 4PZ6A 2R7ZB 2F0DA 3I56A 1N33L 1H9MA 5FOBB 1P8LA 2AUJD 3C2PA 4IURA 1R9TH 5C3EB 1HNWL 3BYYB 5GQOA 2B2TC 4CDCC 2RDFA 5HY6A 4C3HG 1TWHH 1XTDA 1B8AA 5IY0A 1XPUA 4JBWA 2KCTA 3HKSA 1SYFA 1LABA 4H02A 4XQQA 4BY7H 1GUSA 2CW0C 1XMOQ 2MJ8A 2B8GA 5E7NA 4HCEA 4CJ2C 4JI1L 2CCZA 1Y1WB 3U9OA 2AWOA 2XRSD 5HGTA 2K5HA 3PIPA 2N3SA 4KKUA 1PVOA 2X6GA 1PYSB 3D6CA 3V96A 2VZAA 1O78A 2B2VC 3S2DB 2KVMA 3EFXD 2J4XA 3AQQA 1YNNC 2YTVA 4XT1B 3QR8A 3NBIA 1WTPA 1TWAB 4JYAQ 2WAQG 3OMGA 2EJMA 3G6JB 3FHWA 4WJ4A 1Z47A 3NSWA 3OHXC 3HOWG 1QVCA 4ODGA 1EY0A 2RQXA 3Q24A 4A93H 4DV2Q 3KBXA 2BE5D 1N36L 1CSPA 1WTWA 3T1HQ 4G7OC 4XYQA 1G51A 3HKZB 1KDAA 1JT8A 2F0FA 2A19A 2L9HA 4DV7Q 4UDUC 3NHHA 4R8NA 4UHVA 4DPGA 4A76A 4YIJA 4X3UA 1RDPD 1KHIA 2NWGA 5H1SE 1TT2A 4J15A 3K0YA 3J80E 3K57A 4FP5D 2ATWA 2NB0A 2TMPA 5GAEC 2J0TD 1EZ8A 1MI2A 2EYPA 4IFDJ 4JBMA 2PMZB 1E0BA 1LTID 1H9SB 4DV5Q 3WDNA 1STNA 4LF5L 2VB3X 3A8JE 1FGUA 2X6LA 4GNXC 4RWSC 4IQZA 5A2QL 2GVBA 2IWHA 3CCJA 1SR3A 2DJFC 4WJWA 2JA5B 4OEMB 2Q8RE 3ITPA 1VQ9A 1KXLA 1ZEQX 5F2DA 1Y1VH 4DAVA 3K5NA 1X55A 5K36G 2JA7H 3UE0A 3HOYG 2O2LD 1LTGD 3NBHB 2AQ1B 4DUYQ 3GP7A 4EX5A 5C0XH 5C44B 1EL0A 1BNZA 4NXML 4YCVA 4G7ZC 4OO1H 2QDLA 3L9AX 3M4OB 1BBWA 1KNEA 5L37A 3GTMB 2VNUD 4Z9CB 2V4DA 2CWPA 2F0LA 5FJ8G 1KIXA 3CCQA 3BJUA 2MO1A 2E74C 5BN3A 1WJJA 2Q2IA 1HQMC 2ZJQA 4KN4C 1EIHA 3S1NH 4K6LA 4L5RC 2RDGA 3DEPA 1S5CD 1KRTA 1H9JA 2GA4B 1KABA 2KBNA 2NYZD 3T16A 3M7GA 1CT1D 2EY6A 4A3KG 3SHLA 4CHTB 2LS01 4L5SA 3KLSA 4BBSB 1U5KA 4B3TQ 5C0XI 3FEWX 3A7LA 4DV1Q 3GD7A 4OO1I 4L8JA 2JA6B 5T1IA 2AQ3B 1HQRD 4A3LG 4JI2L 3M4PA 2FMCA 4YCWA 2LMCB 2DNEA 4DK6C 2ID0A 1U0LA 2JEBI 3NTIA 4NMZA 4JI6L 1VF7A 4DR1L 4KN7C 1OXVA 3FP9A 4OELB 1RHPA 2IT1A 5T1GA 1CK1A 1YBYA 1S5FD 2EYFA 2OEOA 3I7FA 3X3MA 2D5DA 3SK8A 4JI8Q 1Q86C 1TR5A 1BOSA 1BBXC 4P74A 3FVQA 4DK1A 1G6PA 3K8AA 1N33Q 1HTPA 1I3QB 2ZJRA 4KMUC 1EFID 2KJXA 3SK6A 5EKKA 3IAYA 2NZHA 1HNWQ 1KAAA 2WINB 2NVXH 5FLMG 3H0GB 4AIMA 2ZTDA 4A3FB 4DNTB 3A7AB 4QGUA 2MFIA 1JB7A 1VQGA 1HZAA 3LWEA 3DUZA 1WOCA 5IWAQ 4OX9L 1A3TA 4GKJL 3R2TA 1TWFB 2K50A 4WORA 1A62A 3S1QH 2KQ3A 4C2MH 2M2LA 3HRZC 5M3MH 3GTPH 3E6ZX 4RCOA 1WTRA 4JI1Q 1B1ZA 2IJ0A 4YCUA 4IJLA 5TSSA 1NAPA 2OCEA 2JN4A 2B2YC 1LV9A 1ZXTA 1S4ZA 3VDYA 3RD4A 4NP5A 1OXXK 1I6HH 1SE2A 3TEHB 2HT1A 3CHBD 1K0RA 2LXKA 1LTRD 2JYOA 1AN8A 4U68A 5HGQA 2HD3A 1LTLA 1WCMH 2A6ED 2EY2A 1XWEA 3I72A 1HA5A 5EPJA 1S5DD 3TS0A 1ML0D 3J80L 2E5LL 3HKZE 2Q2HA 2ZT9C 1N36Q 1HUMA 2K75A 1HR0L 1G2SA 3SR1A 1PMRA 1S40A 3UI2A 1LM0A 1AE2A 1EY9A 3NBHA 4PV1C 1ESRA 1A0IA 2PW5A 4PG3A 1D1IA 4XXEA 5C3EH 3E9HA 3MZ5A 3GTKB 1J9OA 1NBWA 4K6DA 4A3GH 2EYJA 3GTGB 2Q8TA 2Z1CA 2RHSB 3L2PA 5LMNW 1XMQQ 2PMZE 3S15B 3B6YA 3R93A 4JI4Q 5IYCH 1W6JA 5I4DA 4JW0A 4A3EG 1R9TB 2UXBL 1L1OC 2ICIA 3LX0A 2QDBA 1JB3A 1KC8C 1Q3LA 2IHEA 1DM0B 4DR4L 1CI3M 1XYIA 3QWNA 4LF5Q 1BR9A 4LFCL 3DWQA 4IFDI 1EZ6A 1EY6A 1EWIA 5AFWA 2CH4W 4RG1A 3I4NG 4YWKA 4PMBA 2O5IC 1I4PA 1EIFA 1JR0D 2K52A 1HNXL 2LXJA 3J81i 3CQZB 3CMAA 5CR3A 1PH8A 3I91A 1BO0A 1PH1A 5CC4A 1CKNA 4NPSA 3TZDA 1TWAH 4FNFA 4A3CH 3CP0A 1PZKD 1WYDA 1DCZA 2EPBA 1A8VA 1TY2A 1VQ8A 3SGIA 4JI0Q 2HQLA 3I2ZA 4NKLA 4NXMQ 4KK7A 1TKWB 5ELCA 2JQOA 5JEAJ 1X32A 1GXDC 2K04A 4JOIC 4DR5L 1V1PA 2XSCA 1AH9A 5JVH3 1BKBA 4R4QA 4DR3L 3I4MG 1U4MA 4ZKCB 1YZ6A 1Q7YC 5FLXE 4FXGC 1PZJD 1PZID 3OWEB 4TQUS 3T56B 2X69A 4K5WA 5FO8B 4BXXG 2DNCA 3X3NA 2WKCA 4R4CA 4TSSA 3Q8DA 3CKIB 1SAPA 1K83B 3LGJA 4AYBE 5IODA 3IRBA 4A3IG 4KHVA 1TS4A 4RGNA 1DYQA 5LMUL 4RKBA 4RFBA 4IFDG 2R7ZG 2VS1A 4ZRZA 3E0JA 4L63B 5CBAE 1HPCA 4EQOA 1F2LA 4JI2Q 3MA2B 3DWPA 1K8AC 4EGVA 2OQ0A 4L6TB 2EY1A 1E2WA 1D2BA 2PW7A 1SYCA 3A8KE 3G48A 1J5EL 2KHJA 1CA6A 4BBRG 3AYHB 4QUCA 4LMQD 3MEFA 3S17B 4JV5L 1E2VA 1U4LA 4OWWB 3PGZA 1IBML 2IX1A 1I50B 1RJTA 4X3KA 2HHHL 3URYA 1F2YA 2Y0SB 1B44D 1UE7A 4UP9A 2I46A 3J7ZC 3GO5A 1C8CA 2F4VQ 3VR5A 4ME3A 3KLWA 4WFN3 4TVAB 1Y1WG 1WTVA 1ENAA 3H3VC 3OWFA 4QF4A 5C5MA 1IW7C 4LNQA 3P75A 3GTMH 4Q0FA 1JQYD 4IALA 1B53A 4QMGA 1YNND 2A6HC 1S5BD 1X3EA 1KAWA 5C5LA 2OXPA 1SBBB 5IYDG 1LT3D 4NB3A 3BVGA 1N9WA 1DZ1A 4GNXB 5JVG3 3EROA 2K6AA 2KOLA 4LUVA 1RIPA 4A3MG 1T5EA 3HGBA 4HIOA 4DV4Q 3RLFA 1L2FA 2E76C 3S1NB 5JAVA 1IYVA 5E4XA 5E4WC 1A2TA 2ASBA 4AQYL 4OHJA 3G7LA 2JA6H 1PFNA 3W3AA 3VR6A 3OTOL 3SEBA 2NVTH 5ELEA 2JA8G 3MXGA 4XDXA 3NEMA 1A15A 1CKOA 2MGSA 3GQBA 4JCVE 5CV7A 5IP9H 3GV3A 1ENCA 4DR6L 1U4RA 1CM9A 4O0AA 2F3WA 4ILWA 5D65A 1AFPA 3NE5B 2E5LQ 1M8AA 4DXFA 1ICFB 1JOOA 2K5NA 3DLLA 3D6WA 4MNOA 1E1OA 3WOEA 1HR0Q 3HFZB 1I4XA 3KF8A 5GROA 3HOZH 3BYTB 1DD2A 2K14A 5FKAC 1GHJA 2PCFB 4DAYA 1I4RA 1U4PA 3M3YB 2B2TA 1II3A 3J81c 3MFGA 5IIFA 4LF4L 5HURA 5K5PA 3TBIB 3PIO3 5IP7G 3AB9A 1MSHA 3HOUB 2EJFC 3WOFA 2NN6H 5ELOA 3CC4A 3OIQA 2QEXA 2NZ1D 1EY7A 5COYA 3CMEA 2F52A 3K58A 1R4QB 2E2IH 2UXBQ 1PTOC 3KF6A 3GTJH 2NVXB 4KHPL 1PYWD 4PQXA 1SSOA 1YHBA 4DR4Q 3MXPA 1W2BA 3F1ZA 2HDLA 4LFCQ 1DOMA 5C44G 4A3DG 3EN2A 3I8ZA 4F87A 3NENA 3CCMA 2NBFA 1OO9B 4GKKL 3GTOB 3PO2G 1F9SA 2H4OA 1G2TA 5DEHA 3S1QB 2VXWA 4C2MB 2F3IA 2NN6I 5DM73 1PH3A 3ULPA 3GTPB 1VQCA 5C0XJ 2D0OA 2UUBL 4B3RL 5FLXL 2RSNA 3M4YA 2K33A 3TSSA 1BXTA 2JEAI 2CH4A 2DY8A 4C3IB 1QNKA 2H1EA 3U58A 5A35A 1I6HB 1VQBA 4IN3A 2L55A 3A74A 5IYBG 3RN5A 3K59A 2R93H 5JPMC 1D1KA 3ZJYC 2A74C 4DR3Q 4R9WA 3QG1A 4A3BH 3S1MH 1B3AA 1AZPA 3T13A 1X54A 2B2UC 2YYZA 2ICEC 4FYDA 1STGA 1GHKA 2F0NA 3F8TA 1I4GA 1VQOA 2F0GA 1QB5D 3GTGH 1NMFA 3S15H 2F0MA 3I55A 1IBKQ 5EPKA 2E2HB 1E2ZA 1V43A 2NUCA 5M5YB 1Z9FA 2C9OA 1XTCD 4A3GB 1V1QA 1JWUD 1D5MC 4OL7A 1XXGA 1VQJA 4GNXA 3H0GG 1RF2D 2A73B 3F2BA 1H9RA 1IXRA 4CKCA 3EBEA 3G6EA 1LTAD 4A3FG 3MFYA 2A69D 1J5EQ 3QIAA 5CMDA 1GM5A 3NQIA 4HMIA 1A2UA 2B63G 2B39A 2Y0SE 4L5TA 4YY3L 4JV5Q 3CQZH 3HOVB 1IBMQ 5KNDA 3KDFA 1NR4A 4GOPC 1IZ6A 5IT9c 4DXGA 2EVBA 1HH2P 4KY7A 1SN8A 1JC7A 1WD0A 3HOXG 4O1NA 3CC7A 1AW7A 5JEAG 4JK1C 4X62Q 4K14A 1B70B 2CFMA 3HG9A 4J8QA 1QOHA 3CW2C 1CTMA 1QUQA 5CYUA 1F9QA 2RCFA 2EOTA 3P1HA 5M5XH 4KV6A 1XJVA 4C3JB 2C5CA 1TS2A 5C3WA 1L1OB 4X3TA 3VR3A 4LFAQ 4B3SL 3E5SA 1GUWA 4R4IA 3F2CA 5AJ3L 2E8GA 5D3DA 3DEOA 1B2TA 1RCVD 2QF7A 1PHJA 3H94A 2VUMB 1K83H 5JJLA 3BZKA 1GUTA 3K81C 3TP7A 3FKIG 4J1MA 1I4HA 4AQYQ 2B8FA 3UDIA 4KJOA 1KQSA 2RHQB 3OTOQ 4A3JG 2KCCA 2F0WA 2UUCL 1EIGA 2AKWB 4ABNA 2V1CC 2B2WC 5EKIA 1EQQA 1YHQA 1KLGD 4IUNA 3RR5A 5JJIA 3S17H 2Q2UA 3RMHA 1C0AA 4JBKA 2RA4A 4NXNL 1MGSA 1I50H 4RKLA 5M3FH 2KUMA 2OTJA 1YJWA 1U9RA 3S9WA 3BG3A 4DV0Q 1I6VC 2KHSA 1XPOA 5NUCA 4IJHA 3K7AB 2L1BA 3EIVA 4RCNA 4BY7G 1VQ7A 5KRUA 1RODA 1STEA 1WTXA 2PYKA 3NTHA 3JAME 5ISRA 1VQLA 1JJCB 1LUZA 4X6AH 5C4XH 1TWCB 3CPWA 2SEBD 5EBCA 4KHPQ 1FVIA 1P16A 4KD4A 5GAHC 2SDFA 3I3CA 3TP5A 1KLUD 4R4OA 4GZYC 1EYAA 3T1YL 2L4NA 1STBA 3CCVA 4DR7L 2B2YA 4GKKQ 1NY4A 5ELNA 1YVCA 3OW2A 3TREA 4IPGA 1S5ED 1X9NA 2SNMA 4GLVB 5I9OA 4FVMA 3TP6A 2N49A 4P75A 1VF5C 2Z0SA 2UUBQ 1SJED 3PO3G 4A93G 2E2DC 2KEDA 3UDXA 4QCLA 2JJQA 1SRUA 3S24A 4KTAA 2GN5A 4AYBB 2NVTB 2R92H 1CKNB 1GKHA 4ME5A 4PMCA 2K7VA 3E9IA 1SLJA 1JJ2A 1I94L 2JE6I 5KGUA 3C1FA 1I5FA 3VYTA 2RKSA 1IBLQ 1SROA 2DY7A 5BN4A 1K8OA 2ZXOA 1UE6A 3A55A 2BA0A 2I07B 4KHZA 3M3YH 2WFWA 1YJ9A 3H91A 4O2DA 4I7AA 3HOUH 1V1PB 2UU9L 4QL5A 1UAPA 1D7QA 1QJOA 2OF1A 3HOZB 1TS3A 1L1OA 2F0EA 3S1RH 5KIXA 4X66L 1V9PA 3SVMA 4K8IA 4EVOA 1J8IA 1FNWA 3JC66 2C35B 2XGTA 1IW7D 4L5QA 4H13C 2F3VA 2PQEA 1ILPA 1Y1VG 2A6HD 2E2IB 1SMYC 4RH6A 1EU4A 2JA7G 3GTOH 1LACA 3GTJB 1Y8OB 2SNSA 1QZGA 2BDNA 5I2YA 4YY3Q 3RZOH 2R3ZA 4KKTA 1PRTC 4GN5A 1VQDA 3NTKA 2QCPX 5C0XG 2JK8A 4OO1G 1KDCA 4XIGS 2XTIA 3H15A 2E2JH 1VQAA 4HJ5A 1EY4A 1VCIA 3PIOA 3UDGA 2Q2TA 2HCCA 4C3IH 3NXWA 3D4WA 2VL6A 4JOIA 2XWBB 1EOTA 1PTOF 1BF4A 4OIJA 2OWOA 5EBDA 2JSOA 4KLKA 2R6GA 4R4TA 3FDTA 4NW2A 5DAUA 4C1NK 4YWMA 1FYCA 5GADC 5KYIA 1HFGA 4C56C 2QA4A 4LF8L 3Q0AA 2HDMA 1E3PA 2F0VA 3KK7A 4BA1I 1VMPA 3V2TA 5AJ3Q 4IUTA 4LF7L 2R93B 3E0EA 4P72A 2XIWA 3DM1A 3HS0C 3NPPA 3D4RA 4A3BB 3S1MB 1VMCA 5C3XA 2E2HH 4BXXH 1NCVA 5M5YH 1PH6A 2BDOA 2VW9A 1MJCA 1A3UA 1G8ZD 4APVA 2UUCQ 1SNPA 3I4OA 4AH6A 3WWVA 2VQEL 3BZDB 5FK9C 4A75A 2G9DA 1NNXA 3S14H 2I5MX 2TSSA 1BVSA 4ZQ3A 3PV0A 1HFNA 1PTOD 3DHQA 2VQFL 3SE0A 4Y7NH 4HEDA 1NJIC 4NXNQ 3HOVH 3PIP3 3NQTA 3JAML 4JI5L 3TS2A 1AE3A 1CHPD 1HTLD 2KCMA 1FR3A 2DJGC 3TDQA 1L0WA 4IOCA 1LT5D 4DV6L 3G4SA 1EY8A 2B3GA 4J6HA 4HN7A 4RGMA 1B3QA 2M9VA 1SE3A 1GOZA 2L5TA 5ELFA 2EE1A 3N6RA 3KF8B 3QOJA 1BDOA 4C3JH 4H0LC 1SNCA 3CC2A 1PH7A 4DAYB 5M3MG 1S72A 5IGDA 4DUZL 3D3RA 1EWCA 1RTOA 4A4IA 4BY1H 3J80i 1RL2A 3PQIA 3HOYB 3M9BA 2K5VA 4LUZA 5M5XB 3IFDA 3T1YQ 2VUMH 4QIWB 4HCSA 4DR7Q 3RLNA 1H95A 3KF6B 1XNRL 5FO7B 2F1MA 3C1EA 2PNRC 1JE5A 3ERQA 3K0XA 4KY6A 1VQNA 1TS5A 3FRPB 3R3OA 3SXHA 1JORA 1WCMG 2JP1A 4U673 1DXMA 2KENA 3GDEA 5M9OA 4GOPB 4TKOB 1GUOA 1L0XB 1ASZA 4N9PA 5EAYA 4HIMA 1D5XC 4DN4M 5IGGA 3QB3A 3S2HH 3ULLA 1STAA 4HMJA 5G3LF 2EIFA 4JI7L 1Y69U 4P73A 4HR7B 4A3KB 2F4IA 2BH8A 2WP8J 4K0KL 5C3EG
chains in the Genus database with same CATH topology
1Q1EA 1WVLA 4ZK9B 2EYLA 1ZYRC 5JOBA 4ZAIA 3NWTA 2CW0D 2WB1B 2K5DA 4P2CB 5IGBA 3LWUA 5M3FB 1G6ZA 4RGOS 2ENBA 4V190 2F0JA 1JWSD 1HXYD 3J7YW 2K01A 4I7ZC 1EEID 2NTTA 3TMEA 1ET6A 2ZXPA 1YNJC 1CQVA 1SEBD 1JOQA 2A68C 3C46A 1IYUA 1CZWA 1F9PA 3A8IE 1O80A 3VA5A 3W2DA 3ZYYX 5C4XB 3PUXA 1QCBD 3BDOA 2N55A 1SDFA 3QJYA 3SK4A 2EJGC 4KY5A 5I2XA 1SFOB 4FF1A 2FINB 4PMWA 4CBVA 1FD7D 1TIID 4BS9A 3VYUA 3MWYW 4RGTA 5CV5A 2MHVA 3MHBA 3VA7A 2B2UA 1F2MA 4WRDA 3DMUA 2R92B 4KD3A 1NSNS 1BCPF 4K2LA 4B08A 4EQNA 3MXNA 1SNDA 3NP8A 3PUWA 3IFTA 3EJIA 2R61A 1JICA 1ZKOA 2K05A 1CFMA 2HQEA 3CRLC 3OW7A 3FMCA 1ONLA 2D62A 3P20A 3S1RB 4H44C 4K2KA 1MSGA 4S3SA 1NUCA 1IHZA 1W6KA 5I9PA 2EY5A 3V05A 3Q22A 4FXDA 3AU7A 3RZOB 1HCZA 2CHBD 3A54A 3BS1A 1M4VA 2E2JB 1PTOH 3GTQB 4B9WA 1PFMA 4N9TA 3I70A 4UAIA 4IZ8A 3OIPA 3ND8A 5D3IB 1SNQA 1PRTF 5KNCA 5CGKA 1PRTB 4R8IA 4I65A 1RKNA 1B50A 2XNAC 1JE4A 4FXKC 2NVYB 2B2WA 4HAEA 2F0HA 3MEHA 4A3IB 4O42A 2PPBC 2F0KA 4FF3A 1B9NA 3S14B 2NN6G 1FNUA 3OMCA 5J22A 1SMYD 4Y7NB 1PRTD 3GTLB 2XVSA 4BBRB 2EXZA 2FMMA 5J39A 4CKBA 5KNBA 1Y8NB 5K36H 1PLFA 3T53B 1CZGA 2N88A 4OGQC 3VR2A 3TN2A 2Z4IA 3D31A 3MXUA 3KLRA 3J7AF 2F03A 3N52A 4BY1B 4CJ1B 5IGEA 3MC0B 1AP0A 1RTNA 5C6AA 1V1OA 1G291 4XQNA 3J7AV 1PDQA 3SK5A 1LT6D 4A3MB 4DF7A 3HZXA 1QILA 2RDHA 2G9HD 1Q12A 3J81E 1MD2D 2QKIC 4X3SA 3S2HB 3AMUA 1ENFA 3CU7A 2JA8B 2M00A 2DN8A 1IL8A 5JJZA 1ICWA 1NR2A 4MN3A 4EQPA 1QWYA 3U9SA 2QILA 3H09A 3L3OC 2BA1A 1KDBA 4M8AA 5E3FA 1HA6A 3BDCA 2XN9C 1SYBA 3KLSX 2KCNA 1BQQT 2D9UA 1SYEA 2EDGA 3EVQA 2PO4A 1D6EC 4LAAA 4ZUIA 1LTBD 1D5ZC 2LKVA 3R2IA 1V8QA 5ELDA 1DOKA 3ONAB 1BCPC 2L12A 3EA6A 2KECA 1GUGA 4MHEA 2F0OA 1SYGA 3NWSA 4HSPA 4A3DB 1HHVA 4IUQA 5LHY1 3PO2B 2F0QA 2SOBA 3HEJA 1L0YB 5E1FA 5FO9B 1UEAB 1GJXA 1XX8A 3IKJA 4E6IA 2F0PA 4DK0A 1B9MA 4BWGB 1EY5A 3PUZA 5CV6A 3D8GA 1O7LA 2BOSA 4HSVA 3S16B 1DONA 1G91A 1ZYRD 3T51B 1QE6A 2EYHA 2K28A 1KTKA 1SNOA 2PZTA 4ZUJA 3IL8A 2IPKD 3NK9A 5IT9E 4ZKBB 1C48A 1LTTD 2F0TA 2MUYA 5CORA 5J1ZA 4DFAA 1QG7A 1YNJD 3TP8A 3VYSA 2A68D 2FHTA 4C3HB 1Q1BA 2K03A 1Y8PB 2MP1A 1BUVT 3LNNA 2XWJB 2A69C 5C4JB 1UNSA 2BCOA 2B63B 4QB4A 4FF4A 1WD1A 3BDLA 2L11A 4KJNA 3KBGA 1K8MA 2NTSA 1AZQA 4ULLA 5C4HA 5JPNC 3CRKC 3NUCA 1WTOA 2D2CC 3HOXB 5IGCA 4K5XA 3MAQA 1PTOB 2K5WA 1LT4D 4HTHA 2ZXRA 3J81L 3RZDB 2WAQB 5DM63 1H9SA 1SE4A 1TWGB 1O7ZA 2MPMA 1ILQA 3HOWB 3VR4A 4K5VA 5IOCA 1A6XA 3QO2A 2EYOA 4RA8A 3Q6SA 3DWAA 2IW3A 2F0SA 4IUPA 2BE5C 4DNRB 1B4OA 1KNAA 3D4DA 3FKIB 4F7XA 5I6YA 4IFDH 3OPOA 4XTCS 4A3JB 1C4QA 5M5WB 1Z6HA 2WACA 2RBMA 4ID6A 3OSOA 3M85A 4QUFA 1DOLA 1EEFD 2IX3A 3K5LA 3TZUA 1UUPA 3PUYA 5ELBA 3PUVA 4G4KA 1Q90A 1TWHB 4NDXA 4XYOA 2LY7A 1Q8IA 3ND9A 1F2ZA 1DJRD 4XT3B 1A3VA 2AUKA 1WTQA 5LL6X 1SYDA 4FO2A 4RHRA 4IUVA 3A56A 4BY7B 1MBYA 4PNYA 4C3IG 2J7ZA 1OXSC 4FF2A 1JWMD 2PZWA 5DNFA 1SXTA 2RVLA 1X3PA 5CV4A 5IGFA 3BVZA 2YU9B 5EGTA 3P7JA 5KEEA 1CHQD 4DGZA 4F8MA 1EU3A 1GUNA 4LJZC 2K1BA 4DAPA 3PO3B 1LLRD 4A93B 2XRQD 1RD9D 2L0CA 1SNMA 1R4PB 5IT9L 1ET9A 2FJ2A 1TQOA 1JCKB 1STYA 1PFBA 5D14A 3BVMA 1H9KA 4CKEA 1JOKA 1O7YA 4K8JA 4CJ0B 3I4LA 4BA2I 2QEJC 2AWNA 3RUZA 4G7HC 1FGBD 5EPLA 3R8BA 4IUUA 2NVQB 3OOCA 3MVVA 1X3QA 3I73A 4LK1C 4DU9A 5G3LD 2LFNA 3HP3A 1CA5A 2KA7A 4RHSA 3K5MA 4H7BA 4C3JG 1Y1VB 2A5HA 2KEEA 5EQ0A 2HCIA 2Z8LA 1Z7TA 5LL6S 2JA7B 2EYMA 2EZVA 1F9RA 4CGYB 4V0BA 4XQJA 1EQVA 2AQ2B 1IKMA 2WKDA 2CVRA 2WIIB 3EQLC 3I90A 4B9XA 1EYDA 3FPPA 5I6WA 2VB2X 2F0UA 1EQTA 1EYCA 1OXTA 5EJWA 1F77A 2WV6D 1BCPB 3T4AC 4C1NI 2A6EC 4Q5VA 4G57A 1T5XD 1EWHA 2IX0A 3C3LA 2HUGA 2O4XA 4DA2A 1IKLA 4ZLTF 3K6OA 2RSOA 1STHA 1OXUA 2OT2A 1VDZA 2Q8IB 5BN5A 1HUNA 1FNVA 3M7NA 4A3EB 3Q23A 3PMFA 2F0IA 2E75C 2O5JC 1BCPD 4OIKA 5A2QE 2PZUA 5KYLA 5CV9A 2K32A 3I4NB 1ESFA 1TU2B 3FPUB 4MIUA 5C4ZA 4ZYSA 3GV6A 2K5QA 5JEAH 1PXUA 4RAUC 2JXMB 2FFKB 2IL8A 1CQFA 3O13A 4F88A 2B2VA 1LTSD 3VYRA 1TVXA 5M3MB 3K5OA 5CBEE 1LO5D 3MTSA 1TY0A 1QNUA 3KUPA 3I4MB 3SDZA 3F2UA 4M1UB 1HRJA 1WCMB 3DXJC 4TRDA 1SJHD 4KI0A 2CQAA 1AEXA 3L7ZC 1I4QA 3H6MA 2Z4HA 5CV8A 5EKLA 3QOLA 4KKSA 2R7ZB 2F0DA 1H9MA 5FOBB 2AUJD 3C2PA 4IURA 5C3EB 3BYYB 2B2TC 2RDFA 4C3HG 4JBWA 1SYFA 1LABA 4XQQA 1GUSA 2CW0C 2MJ8A 2B8GA 4HCEA 4CJ2C 1Y1WB 3U9OA 2AWOA 2XRSD 5HGTA 4KKUA 2X6GA 3D6CA 3V96A 1O78A 2B2VC 3S2DB 2KVMA 3EFXD 2J4XA 1YNNC 4XT1B 3NBIA 1WTPA 1TWAB 3OMGA 2EJMA 3G6JB 1Z47A 3NSWA 3OHXC 4ODGA 1EY0A 2RQXA 3Q24A 3KBXA 2BE5D 1WTWA 4G7OC 4XYQA 3HKZB 1KDAA 2F0FA 2L9HA 4UDUC 3NHHA 4R8NA 4YIJA 4X3UA 1RDPD 2NWGA 1TT2A 3K0YA 3J80E 3K57A 4FP5D 2NB0A 2TMPA 2J0TD 1EZ8A 1MI2A 2EYPA 4IFDJ 2PMZB 1E0BA 1LTID 1H9SB 3WDNA 1STNA 2VB3X 3A8JE 2X6LA 4RWSC 4IQZA 5A2QL 2IWHA 4WJWA 2JA5B 2Q8RE 3ITPA 1ZEQX 5F2DA 4DAVA 3K5NA 5K36G 2O2LD 1LTGD 2AQ1B 3GP7A 5C0XH 5C44B 1EL0A 1BNZA 4G7ZC 4OO1H 3L9AX 3M4OB 3GTMB 1KNEA 2VNUD 4Z9CB 2V4DA 2F0LA 2E74C 5BN3A 1HQMC 4KN4C 1EIHA 4K6LA 2RDGA 3DEPA 1S5CD 1H9JA 2GA4B 1KABA 2NYZD 3T16A 3M7GA 1CT1D 2EY6A 3SHLA 4CHTB 2LS01 3KLSA 4BBSB 5C0XI 3FEWX 3A7LA 3GD7A 4OO1I 4L8JA 2JA6B 5T1IA 2AQ3B 1HQRD 2FMCA 2LMCB 2DNEA 2ID0A 2JEBI 3NTIA 4NMZA 1VF7A 4KN7C 1OXVA 1RHPA 2IT1A 5T1GA 1CK1A 2EYFA 1S5FD 2OEOA 3X3MA 2D5DA 3SK8A 1TR5A 1BOSA 1BBXC 3FVQA 4DK1A 1HTPA 1I3QB 4KMUC 1EFID 2KJXA 3SK6A 5EKKA 3IAYA 1KAAA 2WINB 3H0GB 4A3FB 4DNTB 3A7AB 3LWEA 3DUZA 1A3TA 3R2TA 1TWFB 4WORA 2KQ3A 2M2LA 3HRZC 3E6ZX 4RCOA 1WTRA 1B1ZA 2IJ0A 5TSSA 1NAPA 2B2YC 1LV9A 1ZXTA 1S4ZA 3RD4A 4NP5A 1OXXK 1SE2A 3CHBD 1LTRD 2JYOA 1AN8A 4U68A 2A6ED 2EY2A 1XWEA 3I72A 1HA5A 5EPJA 1S5DD 1ML0D 3J80L 2ZT9C 1HUMA 1G2SA 3SR1A 1PMRA 3UI2A 1EY9A 3NBHA 4PV1C 1ESRA 2PW5A 1D1IA 4XXEA 3MZ5A 3GTKB 1J9OA 4K6DA 2EYJA 3GTGB 2Q8TA 2Z1CA 3S15B 3R93A 1W6JA 5I4DA 1R9TB 2ICIA 3LX0A 2QDBA 1JB3A 1Q3LA 1DM0B 1CI3M 1XYIA 3QWNA 1BR9A 3DWQA 4IFDI 1EZ6A 1EY6A 5AFWA 4PMBA 2O5IC 1I4PA 1JR0D 3CQZB 5CR3A 3I91A 1BO0A 5CC4A 3TZDA 4FNFA 1PZKD 1DCZA 2EPBA 1TY2A 4NKLA 4KK7A 1TKWB 5ELCA 5JEAJ 1X32A 1GXDC 2K04A 1V1PA 2XSCA 5JVH3 1U4MA 4ZKCB 5FLXE 4FXGC 1PZJD 1PZID 3OWEB 4TQUS 3T56B 2X69A 4K5WA 5FO8B 2DNCA 3X3NA 2WKCA 4TSSA 3CKIB 1SAPA 1K83B 5IODA 4KHVA 1TS4A 4RGNA 1DYQA 4RKBA 4RFBA 4IFDG 4ZRZA 3E0JA 4L63B 5CBAE 1HPCA 4EQOA 1F2LA 3MA2B 3DWPA 4EGVA 4L6TB 2EY1A 1E2WA 1D2BA 2PW7A 1SYCA 3A8KE 1CA6A 4QUCA 4LMQD 3S17B 1E2VA 1U4LA 2IX1A 1I50B 1RJTA 4X3KA 3URYA 1F2YA 2Y0SB 1B44D 2I46A 3GO5A 1C8CA 3VR5A 4WFN3 1WTVA 1ENAA 3H3VC 3OWFA 4QF4A 5C5MA 1IW7C 3P75A 4Q0FA 1JQYD 4IALA 1B53A 4QMGA 1YNND 2A6HC 1S5BD 5C5LA 2OXPA 1SBBB 1LT3D 3BVGA 1DZ1A 5JVG3 3EROA 2K6AA 2KOLA 1T5EA 3HGBA 3RLFA 2E76C 3S1NB 5JAVA 1IYVA 5E4XA 5E4WC 1A2TA 4OHJA 3G7LA 1PFNA 3W3AA 3VR6A 3SEBA 5ELEA 3MXGA 4XDXA 1A15A 2MGSA 3GQBA 5CV7A 3GV3A 1ENCA 1U4RA 1CM9A 2F3WA 4ILWA 5D65A 1AFPA 3NE5B 1M8AA 4DXFA 1JOOA 3D6WA 3WOEA 3KF8A 1I4XA 3BYTB 1DD2A 5FKAC 1GHJA 2PCFB 4DAYA 1I4RA 1U4PA 3M3YB 2B2TA 1II3A 3MFGA 5IIFA 5HURA 5K5PA 3TBIB 3PIO3 3HOUB 3AB9A 1MSHA 2EJFC 3WOFA 2NN6H 3OIQA 2NZ1D 1EY7A 5COYA 3K58A 1R4QB 1PTOC 2NVXB 1PYWD 4PQXA 1SSOA 3MXPA 2HDLA 1DOMA 3I8ZA 4F87A 2NBFA 1OO9B 3GTOB 1F9SA 2H4OA 1G2TA 5DEHA 3S1QB 2VXWA 4C2MB 2NN6I 5DM73 3GTPB 5C0XJ 5FLXL 2RSNA 3M4YA 2K33A 3TSSA 1BXTA 2JEAI 2DY8A 4C3IB 1QNKA 2H1EA 5A35A 1I6HB 4IN3A 2L55A 3K59A 5JPMC 1D1KA 2A74C 4R9WA 3QG1A 1B3AA 1AZPA 3T13A 2B2UC 2YYZA 2ICEC 4FYDA 1STGA 1GHKA 2F0NA 1I4GA 2F0GA 1QB5D 2F0MA 5EPKA 2E2HB 1E2ZA 1V43A 2NUCA 5M5YB 2C9OA 1XTCD 4A3GB 1JWUD 1D5MC 4OL7A 1XXGA 1RF2D 2A73B 1H9RA 4CKCA 1LTAD 3MFYA 2A69D 3QIAA 5CMDA 3NQIA 4HMIA 1A2UA 2B39A 3HOVB 5KNDA 1NR4A 4DXGA 2EVBA 4KY7A 1JC7A 1WD0A 4O1NA 1AW7A 5JEAG 4JK1C 4K14A 3HG9A 4J8QA 1QOHA 1CTMA 5CYUA 1F9QA 3P1HA 2EOTA 4KV6A 4C3JB 2C5CA 1TS2A 5C3WA 4X3TA 3VR3A 3E5SA 1GUWA 5D3DA 3DEOA 1B2TA 1RCVD 2QF7A 3H94A 2VUMB 1GUTA 3TP7A 4J1MA 1I4HA 2B8FA 4KJOA 2KCCA 2F0WA 1EIGA 4ABNA 2B2WC 5EKIA 1KLGD 4IUNA 3RMHA 2RA4A 1MGSA 4RKLA 2KUMA 1U9RA 3S9WA 3BG3A 1I6VC 2KHSA 5NUCA 3K7AB 2L1BA 4RCNA 5KRUA 1RODA 1STEA 1WTXA 2PYKA 3NTHA 3JAME 5ISRA 1TWCB 2SEBD 5EBCA 4KD4A 2SDFA 3I3CA 3TP5A 1KLUD 4GZYC 1EYAA 2L4NA 1STBA 2B2YA 1S5ED 2SNMA 5I9OA 4FVMA 3TP6A 1VF5C 1SJED 2E2DC 2KEDA 4QCLA 4KTAA 4AYBB 2NVTB 4ME5A 4PMCA 2K7VA 2JE6I 5KGUA 3C1FA 3VYTA 2RKSA 5BN4A 2DY7A 1K8OA 2ZXOA 3A55A 2BA0A 2I07B 4KHZA 3H91A 1V1PB 1UAPA 1QJOA 2OF1A 3HOZB 1TS3A 2F0EA 5KIXA 3SVMA 4K8IA 4EVOA 1J8IA 1FNWA 1IW7D 4H13C 2F3VA 2PQEA 1ILPA 2A6HD 2E2IB 1SMYC 4RH6A 1EU4A 1LACA 3GTJB 1Y8OB 2SNSA 2BDNA 5I2YA 2R3ZA 4KKTA 1PRTC 5C0XG 2QCPX 3NTKA 4OO1G 1KDCA 4XIGS 1EY4A 1VCIA 2HCCA 3NXWA 3D4WA 2XWBB 1EOTA 1PTOF 1BF4A 4OIJA 5EBDA 2JSOA 5DAUA 2R6GA 4C1NK 3FDTA 4NW2A 1FYCA 5KYIA 1HFGA 4C56C 3Q0AA 2HDMA 2F0VA 3KK7A 4BA1I 1VMPA 3V2TA 4IUTA 2R93B 2XIWA 3DM1A 3HS0C 3NPPA 3D4RA 4A3BB 3S1MB 5C3XA 1VMCA 1NCVA 2BDOA 1A3UA 1G8ZD 1SNPA 3BZDB 5FK9C 2G9DA 2TSSA 4ZQ3A 3PV0A 1HFNA 1PTOD 3DHQA 3SE0A 4HEDA 3PIP3 3NQTA 3JAML 1CHPD 1HTLD 1FR3A 3TDQA 1LT5D 1EY8A 4J6HA 4HN7A 4RGMA 2M9VA 1SE3A 1GOZA 2L5TA 5ELFA 2EE1A 3N6RA 3QOJA 1BDOA 4H0LC 1SNCA 5IGDA 3D3RA 1EWCA 1RTOA 3HOYB 5M5XB 3IFDA 4QIWB 4HCSA 5FO7B 2F1MA 3C1EA 2PNRC 3ERQA 4KY6A 1TS5A 3FRPB 3R3OA 3SXHA 1JORA 2JP1A 4U673 1DXMA 5M9OA 4TKOB 1GUOA 1L0XB 4N9PA 1D5XC 4DN4M 5IGGA 3QB3A 1STAA 4HMJA 5G3LF 1Y69U 4HR7B 4A3KB 2F4IA 2WP8J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BBX C;  1WD1 A;  1WTV A;  2L11 A;  1JIC A;  2K05 A;  2KED A;  1F9S A;  1G2T A;  1AZQ A;  1GUW A;  1VMC A;  2VXW A;  1B53 A;  1NCV A;  5AFW A;  5DNF A;  2FMM A;  1WVL A;  1MI2 A;  2RVL A;  4ZK9 B;  1EQT A;  1DOK A;  3ONA B;  1WTO A;  5EJW A;  2L12 A;  2KEC A;  4ZAI A;  3DEO A;  1X3P A;  1MSG A;  2RSN A;  1B2T A;  1E0B A;  4MHE A;  1PLF A;  2N88 A;  2DY8 A;  2X6L A;  1G6Z A;  3P7J A;  1HHV A;  4RWS C;  3I91 A;  1QNK A;  1BO0 A;  1HRJ A;  2H1E A;  2DY7 A;  4IUQ A;  3TN2 A;  1DZ1 A;  3TZD A;  2K1B A;  3LWE A;  4IUR A;  2KOL A;  3H91 A;  1HFN A;  2B2T C;  2EPB A;  4HED A;  2Q8R E;  1EIG A;  2HUG A;  1O7Z A;  2MPM A;  2K01 A;  1IKL A;  1ILQ A;  3N52 A;  4R9W A;  4ZLT F;  5E4X A;  2RSO A;  1B3A A;  2FJ2 A;  5E4W C;  1AZP A;  4CJ1 B;  2B2W C;  5EKI A;  3G7L A;  1X32 A;  1XX8 A;  2M2L A;  3QO2 A;  1PFN A;  2B2U C;  3Q6S A;  1RTN A;  2K04 A;  4RA8 A;  1AP0 A;  1WTR A;  4IUP A;  1HUN A;  1F9P A;  4XDX A;  1O80 A;  1EL0 A;  2RA4 A;  1A15 A;  1NAP A;  2MGS A;  1MGS A;  1PFB A;  5D14 A;  3SVM A;  1B4O A;  1KNA A;  2B2Y C;  1BNZ A;  1J8I A;  1LV9 A;  1U4M A;  1ZXT A;  3GV3 A;  2MJ8 A;  4ZKC B;  1PDQ A;  1PFM A;  1S4Z A;  4HSV A;  2EE1 A;  1O7Y A;  4CJ0 B;  1U4R A;  1CM9 A;  2N55 A;  1ILP A;  1SDF A;  1KNE A;  2KUM A;  5EPK A;  1G91 A;  2X69 A;  5D65 A;  4CJ2 C;  1M8A A;  4UAI A;  2JYO A;  4U68 A;  5EPL A;  4IUU A;  4OIK A;  3D6W A;  1QE6 A;  1X3Q A;  2K28 A;  2BDN A;  1SAP A;  2FIN B;  1RTO A;  2L1B A;  4X3S A;  2X6G A;  2R3Z A;  4QUF A;  1EIH A;  1DOL A;  3DEP A;  5EPJ A;  2B2V C;  3FPU B;  2KVM A;  3IL8 A;  2NYZ D;  4R8I A;  1ML0 D;  1ROD A;  4XT1 B;  3GV6 A;  3MWY W;  1U4P A;  3HP3 A;  3IFD A;  2B2T A;  1IL8 A;  5CBA E;  1WTX A;  1WTP A;  1CA5 A;  5CMD A;  1B50 A;  1JE4 A;  5JJZ A;  1F2L A;  4ZKB B;  1HUM A;  4HCS A;  4RAU C;  1ICW A;  1MSH A;  2FFK B;  1G2S A;  2IL8 A;  5COR A;  2HCC A;  2SDF A;  1NR2 A;  3I3C A;  4MN3 A;  3UI2 A;  1QG7 A;  2B2W A;  2B2V A;  2JP1 A;  2KEE A;  2B2U A;  5EQ0 A;  2HCI A;  1ESR A;  1EOT A;  1NR4 A;  2NZ1 D;  4HAE A;  5COY A;  1CA6 A;  1TVX A;  2FHT A;  5T1I A;  1J9O A;  2L4N A;  3KBX A;  4QUC A;  4XT3 B;  1F9R A;  4OIJ A;  5CBE E;  1WTQ A;  1WD0 A;  1BF4 A;  4LMQ D;  1WTW A;  2B2Y A;  3MTS A;  2K03 A;  1U4L A;  1SSO A;  3FDT A;  4NW2 A;  4DN4 M;  1HA6 A;  4IUV A;  2HDL A;  1HFG A;  1RJT A;  4O42 A;  2Q8T A;  4X3K A;  1DOM A;  1IKM A;  2L9H A;  2MP1 A;  2CVR A;  2HDM A;  2D9U A;  3R93 A;  1RHP A;  1F9Q A;  1VMP A;  2EOT A;  5T1G A;  1C8C A;  4IUT A;  3I8Z A;  3KUP A;  2J7Z A;  3I90 A;  1Q3L A;  1DON A;  2XIW A;  4X3U A;  3F2U A;  4X3T A;  2NWG A;  1XYI A;  3DM1 A; 
#chains in the Genus database with same CATH topology
 1FJG L;  1Q1E A;  2Z6B A;  1I94 Q;  4JI6 Q;  1PA6 A;  3G71 A;  1C7Y A;  4DR1 Q;  4A3G G;  1MIU A;  1NMG A;  1WVL A;  4ZK9 B;  1YNX A;  1ZYR C;  2EYL A;  1A63 A;  4GN3 B;  5JOB A;  4ZAI A;  5IYC G;  1UE1 A;  2CW0 D;  3NWT A;  1YIT A;  3K7A H;  4YHH L;  2UU9 Q;  2HIV A;  2WB1 B;  2K5D A;  4P2C B;  4UY8 C;  5IGB A;  2UXD L;  3LWU A;  5M3F B;  3RN2 A;  1G6Z A;  4RGO S;  2ENB A;  4V19 0;  4OXP A;  3KJP A;  2F0J A;  1WI5 A;  1TWC H;  1JWS D;  4X66 Q;  1HXY D;  3J7Y W;  2K01 A;  4I7Z C;  1EEI D;  2PNH A;  2NTT A;  4HJ7 A;  1HR0 W;  3TME A;  1ET6 A;  2ZXP A;  2I5L X;  3CCE A;  1YNJ C;  1CQV A;  1SEB D;  1JOQ A;  2A68 C;  3C46 A;  1IYU A;  1CZW A;  4X64 L;  1F9P A;  3A8I E;  1O80 A;  3VA5 A;  3W2D A;  3ZYY X;  4OX9 Q;  5C4X B;  3PUX A;  4A3C G;  4MZ9 A;  4GKJ Q;  1QCB D;  3BDO A;  4LWC A;  4IPH A;  2ES2 A;  2N55 A;  1SDF A;  3QJY A;  3SK4 A;  2GVA A;  2EJG C;  2HIX A;  3RLO A;  1HJP A;  4KY5 A;  5I2X A;  1SFO B;  4IPD A;  4RMF A;  4FF1 A;  2FIN B;  3H3V H;  3HKZ G;  4PMW A;  3W1G A;  1FD7 D;  4CBV A;  5BR8 L;  1KD1 C;  1TII D;  4BS9 A;  1XNQ L;  3U4Z A;  3VYU A;  1YI2 A;  4IO9 A;  3MWY W;  3KDF B;  1JMC A;  4MTK A;  4RGT A;  5CV5 A;  1EIY B;  2YV5 A;  2MHV A;  3MHB A;  2WAQ E;  3KYH C;  3VA7 A;  4LF8 Q;  3S16 H;  1VQI A;  2B2U A;  4DV7 L;  1F2M A;  4WRD A;  5J3B A;  3DMU A;  4JI3 L;  2R92 B;  4GN4 B;  4KD3 A;  1QUQ B;  1NSN S;  1BCP F;  4K2L A;  2R7F A;  4B08 A;  4EQN A;  3MXN A;  1SND A;  3NP8 A;  4LF9 L;  3H3V I;  3PUW A;  3IFT A;  1QVG A;  3EJI A;  2R61 A;  3U4V A;  1YIJ A;  2JA5 G;  1JIC A;  1Q8K A;  1ZKO A;  2K05 A;  1CFM A;  2HQE A;  3AFQ A;  1X6O A;  3CRL C;  5DLQ E;  3OW7 A;  4JPB W;  2ZM6 L;  3FMC A;  1ONL A;  2D62 A;  3P20 A;  4PZ7 A;  1CUK A;  3S1R B;  4H44 C;  4K2K A;  4C3H H;  1MSG A;  2K4K A;  1IYJ B;  3J80 c;  4S3S A;  1NUC A;  2FXQ A;  1IHZ A;  4JI5 Q;  1W6K A;  2A1A A;  4GOP A;  1PH4 A;  2I0Q A;  1VQP A;  4EQ5 A;  4JVZ A;  2EY5 A;  5I9P A;  5C4J H;  4DV6 Q;  3V05 A;  4X65 L;  3Q22 A;  3F2D A;  1HNX Q;  2Z9H A;  4FXD A;  3AU7 A;  2N8N A;  3RZO B;  1HNZ L;  4DV3 L;  1KRS A;  1HCZ A;  2CHB D;  3A54 A;  4WJ3 M;  4HIK A;  3BS1 A;  1M4V A;  4YWL A;  2E2J B;  4OWX B;  1PTO H;  3GTQ B;  4B9W A;  4DUZ Q;  1QVF A;  3CF5 A;  1GO3 E;  1PFM A;  4FDB A;  4BBS G;  4QIW E;  4N9T A;  4DR5 Q;  3RZD H;  3I70 A;  4UAI A;  4IZ8 A;  2JA6 G;  1TWG H;  2UUA L;  4AYB G;  3STB C;  3HOW H;  1XNR Q;  2IY5 B;  3OIP A;  3ND8 A;  5D3I B;  1SNQ A;  1PRT F;  5KNC A;  4B3T L;  5CGK A;  5IP9 G;  1PRT B;  4R8I A;  4I65 A;  1RKN A;  3CCU A;  1B50 A;  2XNA C;  1JE4 A;  4FXK C;  2NVY B;  3J81 j;  1CSQ A;  1EUJ A;  2B2W A;  5LMU Q;  1N8R C;  1VQM A;  4JI7 Q;  4HAE A;  5M5W H;  2F0H A;  3HOZ G;  4K0K Q;  3MEH A;  1FJG Q;  4A3I B;  1N34 L;  1KL9 A;  4O42 A;  2PPB C;  2F0K A;  4FF3 A;  1B9N A;  3S14 B;  2WB1 E;  2NN6 G;  1FNU A;  3OMC A;  5J22 A;  1SMY D;  2MNA A;  4Y7N B;  4YHH Q;  4QJF A;  4JBJ A;  1PRT D;  1EFW A;  2UXD Q;  3GTL B;  2XVS A;  2HHH Q;  4BBR B;  2EXZ A;  2FMM A;  4LUO A;  5IWA L;  5J39 A;  2PQA A;  4CKB A;  1Y8N B;  5KNB A;  1PLF A;  5K36 H;  3T53 B;  1CZG A;  2N88 A;  4OGQ C;  3VR2 A;  3HOY H;  3TN2 A;  2Z4I A;  3D31 A;  3MXU A;  3ER0 A;  3KLR A;  4X64 Q;  3ICE A;  3J7A F;  2F03 A;  3N52 A;  4BY1 B;  5FJ8 H;  3ERS X;  4CJ1 B;  5IGE A;  3MC0 B;  1AP0 A;  1RTN A;  5C6A A;  1PV4 A;  1V1O A;  1G29 1;  3W5O A;  4XQN A;  2R93 G;  3J7A V;  3OYY A;  1PDQ A;  2YU9 H;  3UE1 A;  5BR8 Q;  3SK5 A;  1NE3 A;  1XNQ Q;  4A3B G;  4A3K H;  3CCL A;  1LT6 D;  4A3M B;  3PO3 H;  1LYL A;  4DF7 A;  3HZX A;  1QIL A;  3K80 C;  2RDH A;  2G9H D;  1Q12 A;  4IPC A;  3J81 E;  1MD2 D;  4HJ9 A;  2ZTC A;  2QKI C;  4X3S A;  3S2H B;  3AMU A;  4DR6 Q;  1ENF A;  3CU7 A;  3M4Q A;  1C9O A;  2JA8 B;  4A3L H;  2M00 A;  2DN8 A;  4JI3 Q;  1IL8 A;  4OWT B;  4CDE C;  5JJZ A;  1ICW A;  2A8V A;  2I5H A;  4N8X 1;  1NR2 A;  4MN3 A;  4EQP A;  1E24 A;  1XMQ L;  4LF9 Q;  1QWY A;  3U9S A;  2QIL A;  1K9M C;  4JI4 L;  2BH2 A;  3H09 A;  3L3O C;  5IE8 A;  3ULJ A;  2BA1 A;  4LF4 Q;  1KDB A;  4M8A A;  5E3F A;  2NVQ H;  3AEV A;  2MO0 A;  1HA6 A;  3BDC A;  2XN9 C;  3BU2 A;  1HZB A;  1SYB A;  3KLS X;  3A5Z B;  1S3O A;  2KCN A;  2ZM6 Q;  1N32 L;  1BQQ T;  2D9U A;  5FLM H;  1SYE A;  2EDG A;  3EVQ A;  2PO4 A;  1D6E C;  4LAA A;  4ZUI A;  1LTB D;  2NZO A;  3KFU A;  1D5Z C;  2LKV A;  2OQK A;  3R2I A;  4POG A;  1V8Q A;  5ELD A;  1DOK A;  3ONA B;  1SFO H;  1BCP C;  1K3B C;  2L12 A;  2KEC A;  1GUG A;  3EA6 A;  4IOA A;  4X65 Q;  1VQ6 A;  4MHE A;  2F0O A;  1SYG A;  3NWS A;  4JI0 L;  4HSP A;  4A3D B;  1HNZ Q;  1HHV A;  4DV3 Q;  4IUQ A;  1Q46 A;  1K3R A;  4B3R Q;  4LFB L;  5LHY 1;  3PO2 B;  2F0Q A;  2SOB A;  5LMN L;  1K0S A;  3HEJ A;  1L0Y B;  1VQF A;  4QQB X;  5E1F A;  5FO9 B;  1UEA B;  3CXC A;  5GAG C;  2AMC B;  1GJX A;  1XX8 A;  3IKJ A;  1W3S A;  4LW1 A;  4E6I A;  2F0P A;  4DK0 A;  1B9M A;  4BWG B;  2UUA Q;  1EY5 A;  3PUZ A;  5CV6 A;  4GLA C;  3D8G A;  1O7L A;  2BOS A;  4HSV A;  3S16 B;  1DON A;  1PFS A;  1G91 A;  2QGQ A;  1B7Y B;  1ZYR D;  3T51 B;  3CCR A;  2EXD A;  1VS0 A;  1X56 A;  1QE6 A;  2EYH A;  2K28 A;  4DNI A;  1KTK A;  3J7A 5;  2UXC L;  5FLX c;  1SNO A;  1UEB A;  4OON A;  2PZT A;  4LF6 L;  2WB1 G;  4ZUJ A;  3IL8 A;  2PI2 A;  2IPK D;  5M3F G;  4B3M L;  2Y0S G;  3NK9 A;  5IT9 E;  1YJN A;  4ZKB B;  1C48 A;  1LTT D;  2F0T A;  2MUY A;  5COR A;  5J1Z A;  4DFA A;  1N34 Q;  3KJO A;  1QG7 A;  4A3E H;  1YNJ D;  3TP8 A;  3VYS A;  2Z6K A;  2A68 D;  2FHT A;  2F4V L;  4C3H B;  1Q1B A;  2K03 A;  1Y8P B;  2G5D A;  5C4X G;  3I4N H;  2MP1 A;  1BUV T;  3LNN A;  2XWJ B;  2A69 C;  1PH9 A;  5C4J B;  1UNS A;  2BCO A;  3GTQ H;  2B63 B;  1X3F A;  4QB4 A;  4FF4 A;  1WD1 A;  4DAM A;  3BDL A;  2L11 A;  2MQH A;  4KJN A;  3U50 C;  3KBG A;  1K8M A;  2NTS A;  4Y52 H;  1AZQ A;  4ULL A;  2PI2 E;  1VQE A;  5C4H A;  4UP7 A;  1Y14 B;  5JPN C;  3CRK C;  3NUC A;  1WTO A;  2D2C C;  3HOX B;  5IGC A;  4K5X A;  3MAQ A;  1PTO B;  2K5W A;  1LT4 D;  4HTH A;  3NEL A;  4DV4 L;  4B3S Q;  2ZXR A;  4R1J A;  1J6Q A;  3J81 L;  3RZD B;  2WAQ B;  5DM6 3;  4DR2 L;  1T9H A;  1H9S A;  3I4M H;  1SE4 A;  1QZH A;  1E7Z A;  1TWG B;  2NVY H;  1MHW C;  2R92 G;  1O7Z A;  2MPM A;  1ILQ A;  3HOW B;  3VR4 A;  4K5V A;  5IOC A;  1A6X A;  3QO2 A;  1E22 A;  2EYO A;  4RA8 A;  3Q6S A;  3DWA A;  2D0P A;  3UDF A;  2IW3 A;  2F0S A;  1GD7 A;  4IUP A;  2BE5 C;  4DNR B;  4A3I H;  1B4O A;  1KNA A;  3D4D A;  3D0F A;  3FKI B;  4QY7 A;  4F7X A;  3HOU G;  4CDF C;  5I6Y A;  4IFD H;  2R7Z H;  3OPO A;  1PH2 A;  4XTC S;  4HJA A;  4A3J B;  1D8L A;  1C4Q A;  1X65 A;  3PSI A;  1UE5 A;  4DKA C;  5M5W B;  1ASY A;  1Z6H A;  2WAC A;  4GLX A;  2RBM A;  4ID6 A;  3TRZ A;  3OSO A;  3M85 A;  4QUF A;  3GTL H;  1DOL A;  4BBR H;  1EEF D;  2IX3 A;  2OTL A;  3AFP A;  3K5L A;  2Z6K C;  3TZU A;  1UUP A;  3PUY A;  1GVP A;  2DUD A;  1Q81 C;  5ELB A;  3PUV A;  3BZC A;  4G4K A;  1Q90 A;  1TWH B;  4NDX A;  4XYO A;  2LY7 A;  1Q8I A;  3MXN B;  3ND9 A;  1N32 Q;  1F2Z A;  2YTY A;  1DJR D;  1Y1W H;  4ZCK A;  4XT3 B;  4MTN A;  1A3V A;  4P71 A;  2AUK A;  1WTQ A;  5LL6 X;  1SYD A;  4FO2 A;  4RHR A;  4IUV A;  3A56 A;  4BY7 B;  1MBY A;  3S2D H;  4PNY A;  4C3I G;  2J7Z A;  5IYD H;  1JJG A;  4JG2 A;  2R7D A;  3STB D;  1OXS C;  4FF2 A;  1JWM D;  1E1T A;  1YHA A;  2H5X A;  2PZW A;  4A3M H;  5DNF A;  1SXT A;  2RVL A;  3L0O A;  1SE8 A;  1X3P A;  5CV4 A;  4LFB Q;  5IGF A;  1MJE A;  3BVZ A;  5LMN Q;  2RF4 A;  2YU9 B;  5EGT A;  3P7J A;  2JA8 H;  5KEE A;  1CHQ D;  4DGZ A;  4POF A;  4F8M A;  1EU3 A;  1GUN A;  4LJZ C;  2K1B A;  4DAP A;  3PO3 B;  3PCO B;  1LLR D;  4A93 B;  2XRQ D;  3JAM i;  1RD9 D;  2L0C A;  3KOJ A;  1K8G A;  1SNM A;  1R4P B;  5IT9 L;  4UPA A;  1ET9 A;  2FJ2 A;  1IL2 A;  1IBK L;  1TQO A;  1JCK B;  3CD6 A;  1STY A;  1EOV A;  1PFB A;  5D14 A;  1OTC A;  3BVM A;  2UXC Q;  1H9K A;  4CKE A;  1JOK A;  3HOV G;  1O7Y A;  4K8J A;  4CJ0 B;  4LF6 Q;  3I4L A;  4BA2 I;  2QEJ C;  2AWN A;  1BBU A;  3RUZ A;  5IP7 H;  1FGB D;  4G7H C;  4B3M Q;  1SMX A;  2JA5 H;  5EPL A;  3R8B A;  4IUU A;  2NVQ B;  3OOC A;  3MVV A;  1X3Q A;  3I73 A;  1XMO L;  1NTG A;  4LK1 C;  4DU9 A;  5G3L D;  1VQK A;  3DM3 A;  3E3X A;  1Q82 C;  2LFN A;  3HP3 A;  1CA5 A;  2KA7 A;  4RHS A;  3K5M A;  4GS3 A;  5C44 H;  4H7B A;  4C3J G;  4A3D H;  4X62 L;  3M4O H;  1Y1V B;  2A5H A;  2KEE A;  5EQ0 A;  2HCI A;  2Z8L A;  1Z7T A;  4BY1 G;  2IHF A;  5LL6 S;  2JA7 B;  2EYM A;  4JYA L;  2EZV A;  1K73 C;  3PO2 H;  1F9R A;  4N8F A;  2N78 A;  4CGY B;  4V0B A;  4XQJ A;  1VQ5 A;  2VUM G;  1EQV A;  4LFA L;  2AQ2 B;  2ALY B;  1IKM A;  2WKD A;  2CVR A;  1DGS A;  2WII B;  1WFQ A;  4DV2 L;  1WTH A;  3EQL C;  3I90 A;  4B9X A;  1EYD A;  2P5Z X;  3T1H L;  3FPP A;  2JA9 A;  5I6W A;  3A5U A;  1XPR A;  2B29 A;  4BBS H;  2VB2 X;  2PQA B;  2F0U A;  4UP8 A;  5IYB H;  2YTX A;  1EQT A;  1EYC A;  4CDD C;  1MKH A;  4DR2 Q;  1OXT A;  5EJW A;  1M90 C;  4LF7 Q;  1F77 A;  1FL0 A;  2AHO B;  2LSS A;  2WV6 D;  3TQY A;  1BCP B;  3T4A C;  4C1N I;  2A6E C;  3A0J A;  4Q5V A;  2DGY A;  4G57 A;  1EYG A;  1T5X D;  2QW7 A;  1EWH A;  2IX0 A;  4DV5 L;  3C3L A;  2HUG A;  2O4X A;  4DA2 A;  2VQE Q;  1TXY A;  1IKL A;  4ZLT F;  3K6O A;  3CAM A;  2RSO A;  1I3Q H;  4HID A;  1HZ9 A;  1OXU A;  1STH A;  2OT2 A;  1VDZ A;  2Q8I B;  2VQF Q;  5BN5 A;  1HUN A;  3H0G H;  1O7I A;  4DV0 L;  1FNV A;  4A3F H;  3K7U C;  3M7N A;  4A3E B;  2KHI A;  1UWV A;  1PYB A;  3Q23 A;  2CWA A;  3PMF A;  2F0I A;  2E75 C;  1EQR A;  2B63 H;  2O5J C;  1BCP D;  1K28 A;  2CQO A;  4DUY L;  2VY3 A;  2RCN A;  4OIK A;  5A2Q E;  2PZU A;  3CCS A;  5KYL A;  5CV9 A;  2K32 A;  1TWF H;  3I4N B;  1YEZ A;  1ESF A;  1TU2 B;  3FPU B;  4MIU A;  5C4Z A;  2EQS A;  3HOX H;  4ZYS A;  3GV6 A;  2K5Q A;  2ZJP A;  5JEA H;  1PXU A;  4RAU C;  2JXM B;  2FFK B;  2IL8 A;  1CQF A;  2L15 A;  1VQH A;  3O13 A;  4F88 A;  2B2V A;  3JAM c;  1LTS D;  3CPF A;  3VYR A;  1TVX A;  5M3M B;  3K5O A;  5CBE E;  1LO5 D;  3MTS A;  1PH5 A;  2ZTE A;  4PZ8 A;  1CKM A;  4JC0 A;  4DV1 L;  1TY0 A;  1QNU A;  3PF5 A;  3KUP A;  3I4M B;  3RNU A;  1X3G A;  3SDZ A;  1HZC A;  2CKZ B;  1M1K C;  3F2U A;  4M1U B;  3FKI H;  1HRJ A;  1WCM B;  3DXJ C;  4A3J H;  4TRD A;  1SJH D;  4KI0 A;  2CQA A;  4ALP A;  1IBL L;  5JJK A;  1VQ4 A;  3GTK H;  1AEX A;  3L7Z C;  3W1B A;  1I4Q A;  4JI8 L;  3H6M A;  2Z4H A;  4DK3 C;  4HJ8 A;  5CV8 A;  3PF4 A;  5EKL A;  3QOL A;  4KKS A;  4PZ6 A;  2R7Z B;  2F0D A;  3I56 A;  1N33 L;  1H9M A;  5FOB B;  1P8L A;  2AUJ D;  3C2P A;  4IUR A;  1R9T H;  5C3E B;  1HNW L;  3BYY B;  5GQO A;  2B2T C;  4CDC C;  2RDF A;  5HY6 A;  4C3H G;  1TWH H;  1XTD A;  1B8A A;  5IY0 A;  1XPU A;  4JBW A;  2KCT A;  3HKS A;  1SYF A;  1LAB A;  4H02 A;  4XQQ A;  4BY7 H;  1GUS A;  2CW0 C;  1XMO Q;  2MJ8 A;  2B8G A;  5E7N A;  4HCE A;  4CJ2 C;  4JI1 L;  2CCZ A;  1Y1W B;  3U9O A;  2AWO A;  2XRS D;  5HGT A;  2K5H A;  3PIP A;  2N3S A;  4KKU A;  1PVO A;  2X6G A;  1PYS B;  3D6C A;  3V96 A;  2VZA A;  1O78 A;  2B2V C;  3S2D B;  2KVM A;  3EFX D;  2J4X A;  3AQQ A;  1YNN C;  2YTV A;  4XT1 B;  3QR8 A;  3NBI A;  1WTP A;  1TWA B;  4JYA Q;  2WAQ G;  3OMG A;  2EJM A;  3G6J B;  3FHW A;  4WJ4 A;  1Z47 A;  3NSW A;  3OHX C;  3HOW G;  1QVC A;  4ODG A;  1EY0 A;  2RQX A;  3Q24 A;  4A93 H;  4DV2 Q;  3KBX A;  2BE5 D;  1N36 L;  1CSP A;  1WTW A;  3T1H Q;  4G7O C;  4XYQ A;  1G51 A;  3HKZ B;  1KDA A;  1JT8 A;  2F0F A;  2A19 A;  2L9H A;  4DV7 Q;  4UDU C;  3NHH A;  4R8N A;  4UHV A;  4DPG A;  4A76 A;  4YIJ A;  4X3U A;  1RDP D;  1KHI A;  2NWG A;  5H1S E;  1TT2 A;  4J15 A;  3K0Y A;  3J80 E;  3K57 A;  4FP5 D;  2ATW A;  2NB0 A;  2TMP A;  5GAE C;  2J0T D;  1EZ8 A;  1MI2 A;  2EYP A;  4IFD J;  4JBM A;  2PMZ B;  1E0B A;  1LTI D;  1H9S B;  4DV5 Q;  3WDN A;  1STN A;  4LF5 L;  2VB3 X;  3A8J E;  1FGU A;  2X6L A;  4GNX C;  4RWS C;  4IQZ A;  5A2Q L;  2GVB A;  2IWH A;  3CCJ A;  1SR3 A;  2DJF C;  4WJW A;  2JA5 B;  4OEM B;  2Q8R E;  3ITP A;  1VQ9 A;  1KXL A;  1ZEQ X;  5F2D A;  1Y1V H;  4DAV A;  3K5N A;  1X55 A;  5K36 G;  2JA7 H;  3UE0 A;  3HOY G;  2O2L D;  1LTG D;  3NBH B;  2AQ1 B;  4DUY Q;  3GP7 A;  4EX5 A;  5C0X H;  5C44 B;  1EL0 A;  1BNZ A;  4NXM L;  4YCV A;  4G7Z C;  4OO1 H;  2QDL A;  3L9A X;  3M4O B;  1BBW A;  1KNE A;  5L37 A;  3GTM B;  2VNU D;  4Z9C B;  2V4D A;  2CWP A;  2F0L A;  5FJ8 G;  1KIX A;  3CCQ A;  3BJU A;  2MO1 A;  2E74 C;  5BN3 A;  1WJJ A;  2Q2I A;  1HQM C;  2ZJQ A;  4KN4 C;  1EIH A;  3S1N H;  4K6L A;  4L5R C;  2RDG A;  3DEP A;  1S5C D;  1KRT A;  1H9J A;  2GA4 B;  1KAB A;  2KBN A;  2NYZ D;  3T16 A;  3M7G A;  1CT1 D;  2EY6 A;  4A3K G;  3SHL A;  4CHT B;  2LS0 1;  4L5S A;  3KLS A;  4BBS B;  1U5K A;  4B3T Q;  5C0X I;  3FEW X;  3A7L A;  4DV1 Q;  3GD7 A;  4OO1 I;  4L8J A;  2JA6 B;  5T1I A;  2AQ3 B;  1HQR D;  4A3L G;  4JI2 L;  3M4P A;  2FMC A;  4YCW A;  2LMC B;  2DNE A;  4DK6 C;  2ID0 A;  1U0L A;  2JEB I;  3NTI A;  4NMZ A;  4JI6 L;  1VF7 A;  4DR1 L;  4KN7 C;  1OXV A;  3FP9 A;  4OEL B;  1RHP A;  2IT1 A;  5T1G A;  1CK1 A;  1YBY A;  1S5F D;  2EYF A;  2OEO A;  3I7F A;  3X3M A;  2D5D A;  3SK8 A;  4JI8 Q;  1Q86 C;  1TR5 A;  1BOS A;  1BBX C;  4P74 A;  3FVQ A;  4DK1 A;  1G6P A;  3K8A A;  1N33 Q;  1HTP A;  1I3Q B;  2ZJR A;  4KMU C;  1EFI D;  2KJX A;  3SK6 A;  5EKK A;  3IAY A;  2NZH A;  1HNW Q;  1KAA A;  2WIN B;  2NVX H;  5FLM G;  3H0G B;  4AIM A;  2ZTD A;  4A3F B;  4DNT B;  3A7A B;  4QGU A;  2MFI A;  1JB7 A;  1VQG A;  1HZA A;  3LWE A;  3DUZ A;  1WOC A;  5IWA Q;  4OX9 L;  1A3T A;  4GKJ L;  3R2T A;  1TWF B;  2K50 A;  4WOR A;  1A62 A;  3S1Q H;  2KQ3 A;  4C2M H;  2M2L A;  3HRZ C;  5M3M H;  3GTP H;  3E6Z X;  4RCO A;  1WTR A;  4JI1 Q;  1B1Z A;  2IJ0 A;  4YCU A;  4IJL A;  5TSS A;  1NAP A;  2OCE A;  2JN4 A;  2B2Y C;  1LV9 A;  1ZXT A;  1S4Z A;  3VDY A;  3RD4 A;  4NP5 A;  1OXX K;  1I6H H;  1SE2 A;  3TEH B;  2HT1 A;  3CHB D;  1K0R A;  2LXK A;  1LTR D;  2JYO A;  1AN8 A;  4U68 A;  5HGQ A;  2HD3 A;  1LTL A;  1WCM H;  2A6E D;  2EY2 A;  1XWE A;  3I72 A;  1HA5 A;  5EPJ A;  1S5D D;  3TS0 A;  1ML0 D;  3J80 L;  2E5L L;  3HKZ E;  2Q2H A;  2ZT9 C;  1N36 Q;  1HUM A;  2K75 A;  1HR0 L;  1G2S A;  3SR1 A;  1PMR A;  1S40 A;  3UI2 A;  1LM0 A;  1AE2 A;  1EY9 A;  3NBH A;  4PV1 C;  1ESR A;  1A0I A;  2PW5 A;  4PG3 A;  1D1I A;  4XXE A;  5C3E H;  3E9H A;  3MZ5 A;  3GTK B;  1J9O A;  1NBW A;  4K6D A;  4A3G H;  2EYJ A;  3GTG B;  2Q8T A;  2Z1C A;  2RHS B;  3L2P A;  5LMN W;  1XMQ Q;  2PMZ E;  3S15 B;  3B6Y A;  3R93 A;  4JI4 Q;  5IYC H;  1W6J A;  5I4D A;  4JW0 A;  4A3E G;  1R9T B;  2UXB L;  1L1O C;  2ICI A;  3LX0 A;  2QDB A;  1JB3 A;  1KC8 C;  1Q3L A;  2IHE A;  1DM0 B;  4DR4 L;  1CI3 M;  1XYI A;  3QWN A;  4LF5 Q;  1BR9 A;  4LFC L;  3DWQ A;  4IFD I;  1EZ6 A;  1EY6 A;  1EWI A;  5AFW A;  2CH4 W;  4RG1 A;  3I4N G;  4YWK A;  4PMB A;  2O5I C;  1I4P A;  1EIF A;  1JR0 D;  2K52 A;  1HNX L;  2LXJ A;  3J81 i;  3CQZ B;  3CMA A;  5CR3 A;  1PH8 A;  3I91 A;  1BO0 A;  1PH1 A;  5CC4 A;  1CKN A;  4NPS A;  3TZD A;  1TWA H;  4FNF A;  4A3C H;  3CP0 A;  1PZK D;  1WYD A;  1DCZ A;  2EPB A;  1A8V A;  1TY2 A;  1VQ8 A;  3SGI A;  4JI0 Q;  2HQL A;  3I2Z A;  4NKL A;  4NXM Q;  4KK7 A;  1TKW B;  5ELC A;  2JQO A;  5JEA J;  1X32 A;  1GXD C;  2K04 A;  4JOI C;  4DR5 L;  1V1P A;  2XSC A;  1AH9 A;  5JVH 3;  1BKB A;  4R4Q A;  4DR3 L;  3I4M G;  1U4M A;  4ZKC B;  1YZ6 A;  1Q7Y C;  5FLX E;  4FXG C;  1PZJ D;  1PZI D;  3OWE B;  4TQU S;  3T56 B;  2X69 A;  4K5W A;  5FO8 B;  4BXX G;  2DNC A;  3X3N A;  2WKC A;  4R4C A;  4TSS A;  3Q8D A;  3CKI B;  1SAP A;  1K83 B;  3LGJ A;  4AYB E;  5IOD A;  3IRB A;  4A3I G;  4KHV A;  1TS4 A;  4RGN A;  1DYQ A;  5LMU L;  4RKB A;  4RFB A;  4IFD G;  2R7Z G;  2VS1 A;  4ZRZ A;  3E0J A;  4L63 B;  5CBA E;  1HPC A;  4EQO A;  1F2L A;  4JI2 Q;  3MA2 B;  3DWP A;  1K8A C;  4EGV A;  2OQ0 A;  4L6T B;  2EY1 A;  1E2W A;  1D2B A;  2PW7 A;  1SYC A;  3A8K E;  3G48 A;  1J5E L;  2KHJ A;  1CA6 A;  4BBR G;  3AYH B;  4QUC A;  4LMQ D;  3MEF A;  3S17 B;  4JV5 L;  1E2V A;  1U4L A;  4OWW B;  3PGZ A;  1IBM L;  2IX1 A;  1I50 B;  1RJT A;  4X3K A;  2HHH L;  3URY A;  1F2Y A;  2Y0S B;  1B44 D;  1UE7 A;  4UP9 A;  2I46 A;  3J7Z C;  3GO5 A;  1C8C A;  2F4V Q;  3VR5 A;  4ME3 A;  3KLW A;  4WFN 3;  4TVA B;  1Y1W G;  1WTV A;  1ENA A;  3H3V C;  3OWF A;  4QF4 A;  5C5M A;  1IW7 C;  4LNQ A;  3P75 A;  3GTM H;  4Q0F A;  1JQY D;  4IAL A;  1B53 A;  4QMG A;  1YNN D;  2A6H C;  1S5B D;  1X3E A;  1KAW A;  5C5L A;  2OXP A;  1SBB B;  5IYD G;  1LT3 D;  4NB3 A;  3BVG A;  1N9W A;  1DZ1 A;  4GNX B;  5JVG 3;  3ERO A;  2K6A A;  2KOL A;  4LUV A;  1RIP A;  4A3M G;  1T5E A;  3HGB A;  4HIO A;  4DV4 Q;  3RLF A;  1L2F A;  2E76 C;  3S1N B;  5JAV A;  1IYV A;  5E4X A;  5E4W C;  1A2T A;  2ASB A;  4AQY L;  4OHJ A;  3G7L A;  2JA6 H;  1PFN A;  3W3A A;  3VR6 A;  3OTO L;  3SEB A;  2NVT H;  5ELE A;  2JA8 G;  3MXG A;  4XDX A;  3NEM A;  1A15 A;  1CKO A;  2MGS A;  3GQB A;  4JCV E;  5CV7 A;  5IP9 H;  3GV3 A;  1ENC A;  4DR6 L;  1U4R A;  1CM9 A;  4O0A A;  2F3W A;  4ILW A;  5D65 A;  1AFP A;  3NE5 B;  2E5L Q;  1M8A A;  4DXF A;  1ICF B;  1JOO A;  2K5N A;  3DLL A;  3D6W A;  4MNO A;  1E1O A;  3WOE A;  1HR0 Q;  3HFZ B;  1I4X A;  3KF8 A;  5GRO A;  3HOZ H;  3BYT B;  1DD2 A;  2K14 A;  5FKA C;  1GHJ A;  2PCF B;  4DAY A;  1I4R A;  1U4P A;  3M3Y B;  2B2T A;  1II3 A;  3J81 c;  3MFG A;  5IIF A;  4LF4 L;  5HUR A;  5K5P A;  3TBI B;  3PIO 3;  5IP7 G;  3AB9 A;  1MSH A;  3HOU B;  2EJF C;  3WOF A;  2NN6 H;  5ELO A;  3CC4 A;  3OIQ A;  2QEX A;  2NZ1 D;  1EY7 A;  5COY A;  3CME A;  2F52 A;  3K58 A;  1R4Q B;  2E2I H;  2UXB Q;  1PTO C;  3KF6 A;  3GTJ H;  2NVX B;  4KHP L;  1PYW D;  4PQX A;  1SSO A;  1YHB A;  4DR4 Q;  3MXP A;  1W2B A;  3F1Z A;  2HDL A;  4LFC Q;  1DOM A;  5C44 G;  4A3D G;  3EN2 A;  3I8Z A;  4F87 A;  3NEN A;  3CCM A;  2NBF A;  1OO9 B;  4GKK L;  3GTO B;  3PO2 G;  1F9S A;  2H4O A;  1G2T A;  5DEH A;  3S1Q B;  2VXW A;  4C2M B;  2F3I A;  2NN6 I;  5DM7 3;  1PH3 A;  3ULP A;  3GTP B;  1VQC A;  5C0X J;  2D0O A;  2UUB L;  4B3R L;  5FLX L;  2RSN A;  3M4Y A;  2K33 A;  3TSS A;  1BXT A;  2JEA I;  2CH4 A;  2DY8 A;  4C3I B;  1QNK A;  2H1E A;  3U58 A;  5A35 A;  1I6H B;  1VQB A;  4IN3 A;  2L55 A;  3A74 A;  5IYB G;  3RN5 A;  3K59 A;  2R93 H;  5JPM C;  1D1K A;  3ZJY C;  2A74 C;  4DR3 Q;  4R9W A;  3QG1 A;  4A3B H;  3S1M H;  1B3A A;  1AZP A;  3T13 A;  1X54 A;  2B2U C;  2YYZ A;  2ICE C;  4FYD A;  1STG A;  1GHK A;  2F0N A;  3F8T A;  1I4G A;  1VQO A;  2F0G A;  1QB5 D;  3GTG H;  1NMF A;  3S15 H;  2F0M A;  3I55 A;  1IBK Q;  5EPK A;  2E2H B;  1E2Z A;  1V43 A;  2NUC A;  5M5Y B;  1Z9F A;  2C9O A;  1XTC D;  4A3G B;  1V1Q A;  1JWU D;  1D5M C;  4OL7 A;  1XXG A;  1VQJ A;  4GNX A;  3H0G G;  1RF2 D;  2A73 B;  3F2B A;  1H9R A;  1IXR A;  4CKC A;  3EBE A;  3G6E A;  1LTA D;  4A3F G;  3MFY A;  2A69 D;  1J5E Q;  3QIA A;  5CMD A;  1GM5 A;  3NQI A;  4HMI A;  1A2U A;  2B63 G;  2B39 A;  2Y0S E;  4L5T A;  4YY3 L;  4JV5 Q;  3CQZ H;  3HOV B;  1IBM Q;  5KND A;  3KDF A;  1NR4 A;  4GOP C;  1IZ6 A;  5IT9 c;  4DXG A;  2EVB A;  1HH2 P;  4KY7 A;  1SN8 A;  1JC7 A;  1WD0 A;  3HOX G;  4O1N A;  3CC7 A;  1AW7 A;  5JEA G;  4JK1 C;  4X62 Q;  4K14 A;  1B70 B;  2CFM A;  3HG9 A;  4J8Q A;  1QOH A;  3CW2 C;  1CTM A;  1QUQ A;  5CYU A;  1F9Q A;  2RCF A;  2EOT A;  3P1H A;  5M5X H;  4KV6 A;  1XJV A;  4C3J B;  2C5C A;  1TS2 A;  5C3W A;  1L1O B;  4X3T A;  3VR3 A;  4LFA Q;  4B3S L;  3E5S A;  1GUW A;  4R4I A;  3F2C A;  5AJ3 L;  2E8G A;  5D3D A;  3DEO A;  1B2T A;  1RCV D;  2QF7 A;  1PHJ A;  3H94 A;  2VUM B;  1K83 H;  5JJL A;  3BZK A;  1GUT A;  3K81 C;  3TP7 A;  3FKI G;  4J1M A;  1I4H A;  4AQY Q;  2B8F A;  3UDI A;  4KJO A;  1KQS A;  2RHQ B;  3OTO Q;  4A3J G;  2KCC A;  2F0W A;  2UUC L;  1EIG A;  2AKW B;  4ABN A;  2V1C C;  2B2W C;  5EKI A;  1EQQ A;  1YHQ A;  1KLG D;  4IUN A;  3RR5 A;  5JJI A;  3S17 H;  2Q2U A;  3RMH A;  1C0A A;  4JBK A;  2RA4 A;  4NXN L;  1MGS A;  1I50 H;  4RKL A;  5M3F H;  2KUM A;  2OTJ A;  1YJW A;  1U9R A;  3S9W A;  3BG3 A;  4DV0 Q;  1I6V C;  2KHS A;  1XPO A;  5NUC A;  4IJH A;  3K7A B;  2L1B A;  3EIV A;  4RCN A;  4BY7 G;  1VQ7 A;  5KRU A;  1ROD A;  1STE A;  1WTX A;  2PYK A;  3NTH A;  3JAM E;  5ISR A;  1VQL A;  1JJC B;  1LUZ A;  4X6A H;  5C4X H;  1TWC B;  3CPW A;  2SEB D;  5EBC A;  4KHP Q;  1FVI A;  1P16 A;  4KD4 A;  5GAH C;  2SDF A;  3I3C A;  3TP5 A;  1KLU D;  4R4O A;  4GZY C;  1EYA A;  3T1Y L;  2L4N A;  1STB A;  3CCV A;  4DR7 L;  2B2Y A;  4GKK Q;  1NY4 A;  5ELN A;  1YVC A;  3OW2 A;  3TRE A;  4IPG A;  1S5E D;  1X9N A;  2SNM A;  4GLV B;  5I9O A;  4FVM A;  3TP6 A;  2N49 A;  4P75 A;  1VF5 C;  2Z0S A;  2UUB Q;  1SJE D;  3PO3 G;  4A93 G;  2E2D C;  2KED A;  3UDX A;  4QCL A;  2JJQ A;  1SRU A;  3S24 A;  4KTA A;  2GN5 A;  4AYB B;  2NVT B;  2R92 H;  1CKN B;  1GKH A;  4ME5 A;  4PMC A;  2K7V A;  3E9I A;  1SLJ A;  1JJ2 A;  1I94 L;  2JE6 I;  5KGU A;  3C1F A;  1I5F A;  3VYT A;  2RKS A;  1IBL Q;  1SRO A;  2DY7 A;  5BN4 A;  1K8O A;  2ZXO A;  1UE6 A;  3A55 A;  2BA0 A;  2I07 B;  4KHZ A;  3M3Y H;  2WFW A;  1YJ9 A;  3H91 A;  4O2D A;  4I7A A;  3HOU H;  1V1P B;  2UU9 L;  4QL5 A;  1UAP A;  1D7Q A;  1QJO A;  2OF1 A;  3HOZ B;  1TS3 A;  1L1O A;  2F0E A;  3S1R H;  5KIX A;  4X66 L;  1V9P A;  3SVM A;  4K8I A;  4EVO A;  1J8I A;  1FNW A;  3JC6 6;  2C35 B;  2XGT A;  1IW7 D;  4L5Q A;  4H13 C;  2F3V A;  2PQE A;  1ILP A;  1Y1V G;  2A6H D;  2E2I B;  1SMY C;  4RH6 A;  1EU4 A;  2JA7 G;  3GTO H;  1LAC A;  3GTJ B;  1Y8O B;  2SNS A;  1QZG A;  2BDN A;  5I2Y A;  4YY3 Q;  3RZO H;  2R3Z A;  4KKT A;  1PRT C;  4GN5 A;  1VQD A;  3NTK A;  2QCP X;  5C0X G;  2JK8 A;  4OO1 G;  1KDC A;  4XIG S;  2XTI A;  3H15 A;  2E2J H;  1VQA A;  4HJ5 A;  1EY4 A;  1VCI A;  3PIO A;  3UDG A;  2Q2T A;  2HCC A;  4C3I H;  3NXW A;  3D4W A;  2VL6 A;  4JOI A;  2XWB B;  1EOT A;  1PTO F;  1BF4 A;  4OIJ A;  2OWO A;  5EBD A;  2JSO A;  4KLK A;  2R6G A;  4R4T A;  3FDT A;  4NW2 A;  5DAU A;  4C1N K;  4YWM A;  1FYC A;  5GAD C;  5KYI A;  1HFG A;  4C56 C;  2QA4 A;  4LF8 L;  3Q0A A;  2HDM A;  1E3P A;  2F0V A;  3KK7 A;  4BA1 I;  1VMP A;  3V2T A;  5AJ3 Q;  4IUT A;  4LF7 L;  2R93 B;  3E0E A;  4P72 A;  2XIW A;  3DM1 A;  3HS0 C;  3NPP A;  3D4R A;  4A3B B;  3S1M B;  1VMC A;  5C3X A;  2E2H H;  4BXX H;  1NCV A;  5M5Y H;  1PH6 A;  2BDO A;  2VW9 A;  1MJC A;  1A3U A;  1G8Z D;  4APV A;  2UUC Q;  1SNP A;  3I4O A;  4AH6 A;  3WWV A;  2VQE L;  3BZD B;  5FK9 C;  4A75 A;  2G9D A;  1NNX A;  3S14 H;  2I5M X;  2TSS A;  1BVS A;  4ZQ3 A;  3PV0 A;  1HFN A;  1PTO D;  3DHQ A;  2VQF L;  3SE0 A;  4Y7N H;  4HED A;  1NJI C;  4NXN Q;  3HOV H;  3PIP 3;  3NQT A;  3JAM L;  4JI5 L;  3TS2 A;  1AE3 A;  1CHP D;  1HTL D;  2KCM A;  1FR3 A;  2DJG C;  3TDQ A;  1L0W A;  4IOC A;  1LT5 D;  4DV6 L;  3G4S A;  1EY8 A;  2B3G A;  4J6H A;  4HN7 A;  4RGM A;  1B3Q A;  2M9V A;  1SE3 A;  1GOZ A;  2L5T A;  5ELF A;  2EE1 A;  3N6R A;  3KF8 B;  3QOJ A;  1BDO A;  4C3J H;  4H0L C;  1SNC A;  3CC2 A;  1PH7 A;  4DAY B;  5M3M G;  1S72 A;  5IGD A;  4DUZ L;  3D3R A;  1EWC A;  1RTO A;  4A4I A;  4BY1 H;  3J80 i;  1RL2 A;  3PQI A;  3HOY B;  3M9B A;  2K5V A;  4LUZ A;  5M5X B;  3IFD A;  3T1Y Q;  2VUM H;  4QIW B;  4HCS A;  4DR7 Q;  3RLN A;  1H95 A;  3KF6 B;  1XNR L;  5FO7 B;  2F1M A;  3C1E A;  2PNR C;  1JE5 A;  3ERQ A;  3K0X A;  4KY6 A;  1VQN A;  1TS5 A;  3FRP B;  3R3O A;  3SXH A;  1JOR A;  1WCM G;  2JP1 A;  4U67 3;  1DXM A;  2KEN A;  3GDE A;  5M9O A;  4GOP B;  4TKO B;  1GUO A;  1L0X B;  1ASZ A;  4N9P A;  5EAY A;  4HIM A;  1D5X C;  4DN4 M;  5IGG A;  3QB3 A;  3S2H H;  3ULL A;  1STA A;  4HMJ A;  5G3L F;  2EIF A;  4JI7 L;  1Y69 U;  4P73 A;  4HR7 B;  4A3K B;  2F4I A;  2BH8 A;  2WP8 J;  4K0K L;  5C3E G; 
#chains in the Genus database with same CATH homology
 1Q1E A;  1WVL A;  4ZK9 B;  2EYL A;  1ZYR C;  5JOB A;  4ZAI A;  3NWT A;  2CW0 D;  2WB1 B;  2K5D A;  4P2C B;  5IGB A;  3LWU A;  5M3F B;  1G6Z A;  4RGO S;  2ENB A;  4V19 0;  2F0J A;  1JWS D;  1HXY D;  3J7Y W;  2K01 A;  4I7Z C;  1EEI D;  2NTT A;  3TME A;  1ET6 A;  2ZXP A;  1YNJ C;  1CQV A;  1SEB D;  1JOQ A;  2A68 C;  3C46 A;  1IYU A;  1CZW A;  1F9P A;  3A8I E;  1O80 A;  3VA5 A;  3W2D A;  3ZYY X;  5C4X B;  3PUX A;  1QCB D;  3BDO A;  2N55 A;  1SDF A;  3QJY A;  3SK4 A;  2EJG C;  4KY5 A;  5I2X A;  1SFO B;  4FF1 A;  2FIN B;  4PMW A;  4CBV A;  1FD7 D;  1TII D;  4BS9 A;  3VYU A;  3MWY W;  4RGT A;  5CV5 A;  2MHV A;  3MHB A;  3VA7 A;  2B2U A;  1F2M A;  4WRD A;  3DMU A;  2R92 B;  4KD3 A;  1NSN S;  1BCP F;  4K2L A;  4B08 A;  4EQN A;  3MXN A;  1SND A;  3NP8 A;  3PUW A;  3IFT A;  3EJI A;  2R61 A;  1JIC A;  1ZKO A;  2K05 A;  1CFM A;  2HQE A;  3CRL C;  3OW7 A;  3FMC A;  1ONL A;  2D62 A;  3P20 A;  3S1R B;  4H44 C;  4K2K A;  1MSG A;  4S3S A;  1NUC A;  1IHZ A;  1W6K A;  5I9P A;  2EY5 A;  3V05 A;  3Q22 A;  4FXD A;  3AU7 A;  3RZO B;  1HCZ A;  2CHB D;  3A54 A;  3BS1 A;  1M4V A;  2E2J B;  1PTO H;  3GTQ B;  4B9W A;  1PFM A;  4N9T A;  3I70 A;  4UAI A;  4IZ8 A;  3OIP A;  3ND8 A;  5D3I B;  1SNQ A;  1PRT F;  5KNC A;  5CGK A;  1PRT B;  4R8I A;  4I65 A;  1RKN A;  1B50 A;  2XNA C;  1JE4 A;  4FXK C;  2NVY B;  2B2W A;  4HAE A;  2F0H A;  3MEH A;  4A3I B;  4O42 A;  2PPB C;  2F0K A;  4FF3 A;  1B9N A;  3S14 B;  2NN6 G;  1FNU A;  3OMC A;  5J22 A;  1SMY D;  4Y7N B;  1PRT D;  3GTL B;  2XVS A;  4BBR B;  2EXZ A;  2FMM A;  5J39 A;  4CKB A;  5KNB A;  1Y8N B;  5K36 H;  1PLF A;  3T53 B;  1CZG A;  2N88 A;  4OGQ C;  3VR2 A;  3TN2 A;  2Z4I A;  3D31 A;  3MXU A;  3KLR A;  3J7A F;  2F03 A;  3N52 A;  4BY1 B;  4CJ1 B;  5IGE A;  3MC0 B;  1AP0 A;  1RTN A;  5C6A A;  1V1O A;  1G29 1;  4XQN A;  3J7A V;  1PDQ A;  3SK5 A;  1LT6 D;  4A3M B;  4DF7 A;  3HZX A;  1QIL A;  2RDH A;  2G9H D;  1Q12 A;  3J81 E;  1MD2 D;  2QKI C;  4X3S A;  3S2H B;  3AMU A;  1ENF A;  3CU7 A;  2JA8 B;  2M00 A;  2DN8 A;  1IL8 A;  5JJZ A;  1ICW A;  1NR2 A;  4MN3 A;  4EQP A;  1QWY A;  3U9S A;  2QIL A;  3H09 A;  3L3O C;  2BA1 A;  1KDB A;  4M8A A;  5E3F A;  1HA6 A;  3BDC A;  2XN9 C;  1SYB A;  3KLS X;  2KCN A;  1BQQ T;  2D9U A;  1SYE A;  2EDG A;  3EVQ A;  2PO4 A;  1D6E C;  4LAA A;  4ZUI A;  1LTB D;  1D5Z C;  2LKV A;  3R2I A;  1V8Q A;  5ELD A;  1DOK A;  3ONA B;  1BCP C;  2L12 A;  3EA6 A;  2KEC A;  1GUG A;  4MHE A;  2F0O A;  1SYG A;  3NWS A;  4HSP A;  4A3D B;  1HHV A;  4IUQ A;  5LHY 1;  3PO2 B;  2F0Q A;  2SOB A;  3HEJ A;  1L0Y B;  5E1F A;  5FO9 B;  1UEA B;  1GJX A;  1XX8 A;  3IKJ A;  4E6I A;  2F0P A;  4DK0 A;  1B9M A;  4BWG B;  1EY5 A;  3PUZ A;  5CV6 A;  3D8G A;  1O7L A;  2BOS A;  4HSV A;  3S16 B;  1DON A;  1G91 A;  1ZYR D;  3T51 B;  1QE6 A;  2EYH A;  2K28 A;  1KTK A;  1SNO A;  2PZT A;  4ZUJ A;  3IL8 A;  2IPK D;  3NK9 A;  5IT9 E;  4ZKB B;  1C48 A;  1LTT D;  2F0T A;  2MUY A;  5COR A;  5J1Z A;  4DFA A;  1QG7 A;  1YNJ D;  3TP8 A;  3VYS A;  2A68 D;  2FHT A;  4C3H B;  1Q1B A;  2K03 A;  1Y8P B;  2MP1 A;  1BUV T;  3LNN A;  2XWJ B;  2A69 C;  5C4J B;  1UNS A;  2BCO A;  2B63 B;  4QB4 A;  4FF4 A;  1WD1 A;  3BDL A;  2L11 A;  4KJN A;  3KBG A;  1K8M A;  2NTS A;  1AZQ A;  4ULL A;  5C4H A;  5JPN C;  3CRK C;  3NUC A;  1WTO A;  2D2C C;  3HOX B;  5IGC A;  4K5X A;  3MAQ A;  1PTO B;  2K5W A;  1LT4 D;  4HTH A;  2ZXR A;  3J81 L;  3RZD B;  2WAQ B;  5DM6 3;  1H9S A;  1SE4 A;  1TWG B;  1O7Z A;  2MPM A;  1ILQ A;  3HOW B;  3VR4 A;  4K5V A;  5IOC A;  1A6X A;  3QO2 A;  2EYO A;  4RA8 A;  3Q6S A;  3DWA A;  2IW3 A;  2F0S A;  4IUP A;  2BE5 C;  4DNR B;  1B4O A;  1KNA A;  3D4D A;  3FKI B;  4F7X A;  5I6Y A;  4IFD H;  3OPO A;  4XTC S;  4A3J B;  1C4Q A;  5M5W B;  1Z6H A;  2WAC A;  2RBM A;  4ID6 A;  3OSO A;  3M85 A;  4QUF A;  1DOL A;  1EEF D;  2IX3 A;  3K5L A;  3TZU A;  1UUP A;  3PUY A;  5ELB A;  3PUV A;  4G4K A;  1Q90 A;  1TWH B;  4NDX A;  4XYO A;  2LY7 A;  1Q8I A;  3ND9 A;  1F2Z A;  1DJR D;  4XT3 B;  1A3V A;  2AUK A;  1WTQ A;  5LL6 X;  1SYD A;  4FO2 A;  4RHR A;  4IUV A;  3A56 A;  4BY7 B;  1MBY A;  4PNY A;  4C3I G;  2J7Z A;  1OXS C;  4FF2 A;  1JWM D;  2PZW A;  5DNF A;  1SXT A;  2RVL A;  1X3P A;  5CV4 A;  5IGF A;  3BVZ A;  2YU9 B;  5EGT A;  3P7J A;  5KEE A;  1CHQ D;  4DGZ A;  4F8M A;  1EU3 A;  1GUN A;  4LJZ C;  2K1B A;  4DAP A;  3PO3 B;  1LLR D;  4A93 B;  2XRQ D;  1RD9 D;  2L0C A;  1SNM A;  1R4P B;  5IT9 L;  1ET9 A;  2FJ2 A;  1TQO A;  1JCK B;  1STY A;  1PFB A;  5D14 A;  3BVM A;  1H9K A;  4CKE A;  1JOK A;  1O7Y A;  4K8J A;  4CJ0 B;  3I4L A;  4BA2 I;  2QEJ C;  2AWN A;  3RUZ A;  4G7H C;  1FGB D;  5EPL A;  3R8B A;  4IUU A;  2NVQ B;  3OOC A;  3MVV A;  1X3Q A;  3I73 A;  4LK1 C;  4DU9 A;  5G3L D;  2LFN A;  3HP3 A;  1CA5 A;  2KA7 A;  4RHS A;  3K5M A;  4H7B A;  4C3J G;  1Y1V B;  2A5H A;  2KEE A;  5EQ0 A;  2HCI A;  2Z8L A;  1Z7T A;  5LL6 S;  2JA7 B;  2EYM A;  2EZV A;  1F9R A;  4CGY B;  4V0B A;  4XQJ A;  1EQV A;  2AQ2 B;  1IKM A;  2WKD A;  2CVR A;  2WII B;  3EQL C;  3I90 A;  4B9X A;  1EYD A;  3FPP A;  5I6W A;  2VB2 X;  2F0U A;  1EQT A;  1EYC A;  1OXT A;  5EJW A;  1F77 A;  2WV6 D;  1BCP B;  3T4A C;  4C1N I;  2A6E C;  4Q5V A;  4G57 A;  1T5X D;  1EWH A;  2IX0 A;  3C3L A;  2HUG A;  2O4X A;  4DA2 A;  1IKL A;  4ZLT F;  3K6O A;  2RSO A;  1STH A;  1OXU A;  2OT2 A;  1VDZ A;  2Q8I B;  5BN5 A;  1HUN A;  1FNV A;  3M7N A;  4A3E B;  3Q23 A;  3PMF A;  2F0I A;  2E75 C;  2O5J C;  1BCP D;  4OIK A;  5A2Q E;  2PZU A;  5KYL A;  5CV9 A;  2K32 A;  3I4N B;  1ESF A;  1TU2 B;  3FPU B;  4MIU A;  5C4Z A;  4ZYS A;  3GV6 A;  2K5Q A;  5JEA H;  1PXU A;  4RAU C;  2JXM B;  2FFK B;  2IL8 A;  1CQF A;  3O13 A;  4F88 A;  2B2V A;  1LTS D;  3VYR A;  1TVX A;  5M3M B;  3K5O A;  5CBE E;  1LO5 D;  3MTS A;  1TY0 A;  1QNU A;  3KUP A;  3I4M B;  3SDZ A;  3F2U A;  4M1U B;  1HRJ A;  1WCM B;  3DXJ C;  4TRD A;  1SJH D;  4KI0 A;  2CQA A;  1AEX A;  3L7Z C;  1I4Q A;  3H6M A;  2Z4H A;  5CV8 A;  5EKL A;  3QOL A;  4KKS A;  2R7Z B;  2F0D A;  1H9M A;  5FOB B;  2AUJ D;  3C2P A;  4IUR A;  5C3E B;  3BYY B;  2B2T C;  2RDF A;  4C3H G;  4JBW A;  1SYF A;  1LAB A;  4XQQ A;  1GUS A;  2CW0 C;  2MJ8 A;  2B8G A;  4HCE A;  4CJ2 C;  1Y1W B;  3U9O A;  2AWO A;  2XRS D;  5HGT A;  4KKU A;  2X6G A;  3D6C A;  3V96 A;  1O78 A;  2B2V C;  3S2D B;  2KVM A;  3EFX D;  2J4X A;  1YNN C;  4XT1 B;  3NBI A;  1WTP A;  1TWA B;  3OMG A;  2EJM A;  3G6J B;  1Z47 A;  3NSW A;  3OHX C;  4ODG A;  1EY0 A;  2RQX A;  3Q24 A;  3KBX A;  2BE5 D;  1WTW A;  4G7O C;  4XYQ A;  3HKZ B;  1KDA A;  2F0F A;  2L9H A;  4UDU C;  3NHH A;  4R8N A;  4YIJ A;  4X3U A;  1RDP D;  2NWG A;  1TT2 A;  3K0Y A;  3J80 E;  3K57 A;  4FP5 D;  2NB0 A;  2TMP A;  2J0T D;  1EZ8 A;  1MI2 A;  2EYP A;  4IFD J;  2PMZ B;  1E0B A;  1LTI D;  1H9S B;  3WDN A;  1STN A;  2VB3 X;  3A8J E;  2X6L A;  4RWS C;  4IQZ A;  5A2Q L;  2IWH A;  4WJW A;  2JA5 B;  2Q8R E;  3ITP A;  1ZEQ X;  5F2D A;  4DAV A;  3K5N A;  5K36 G;  2O2L D;  1LTG D;  2AQ1 B;  3GP7 A;  5C0X H;  5C44 B;  1EL0 A;  1BNZ A;  4G7Z C;  4OO1 H;  3L9A X;  3M4O B;  3GTM B;  1KNE A;  2VNU D;  4Z9C B;  2V4D A;  2F0L A;  2E74 C;  5BN3 A;  1HQM C;  4KN4 C;  1EIH A;  4K6L A;  2RDG A;  3DEP A;  1S5C D;  1H9J A;  2GA4 B;  1KAB A;  2NYZ D;  3T16 A;  3M7G A;  1CT1 D;  2EY6 A;  3SHL A;  4CHT B;  2LS0 1;  3KLS A;  4BBS B;  5C0X I;  3FEW X;  3A7L A;  3GD7 A;  4OO1 I;  4L8J A;  2JA6 B;  5T1I A;  2AQ3 B;  1HQR D;  2FMC A;  2LMC B;  2DNE A;  2ID0 A;  2JEB I;  3NTI A;  4NMZ A;  1VF7 A;  4KN7 C;  1OXV A;  1RHP A;  2IT1 A;  5T1G A;  1CK1 A;  2EYF A;  1S5F D;  2OEO A;  3X3M A;  2D5D A;  3SK8 A;  1TR5 A;  1BOS A;  1BBX C;  3FVQ A;  4DK1 A;  1HTP A;  1I3Q B;  4KMU C;  1EFI D;  2KJX A;  3SK6 A;  5EKK A;  3IAY A;  1KAA A;  2WIN B;  3H0G B;  4A3F B;  4DNT B;  3A7A B;  3LWE A;  3DUZ A;  1A3T A;  3R2T A;  1TWF B;  4WOR A;  2KQ3 A;  2M2L A;  3HRZ C;  3E6Z X;  4RCO A;  1WTR A;  1B1Z A;  2IJ0 A;  5TSS A;  1NAP A;  2B2Y C;  1LV9 A;  1ZXT A;  1S4Z A;  3RD4 A;  4NP5 A;  1OXX K;  1SE2 A;  3CHB D;  1LTR D;  2JYO A;  1AN8 A;  4U68 A;  2A6E D;  2EY2 A;  1XWE A;  3I72 A;  1HA5 A;  5EPJ A;  1S5D D;  1ML0 D;  3J80 L;  2ZT9 C;  1HUM A;  1G2S A;  3SR1 A;  1PMR A;  3UI2 A;  1EY9 A;  3NBH A;  4PV1 C;  1ESR A;  2PW5 A;  1D1I A;  4XXE A;  3MZ5 A;  3GTK B;  1J9O A;  4K6D A;  2EYJ A;  3GTG B;  2Q8T A;  2Z1C A;  3S15 B;  3R93 A;  1W6J A;  5I4D A;  1R9T B;  2ICI A;  3LX0 A;  2QDB A;  1JB3 A;  1Q3L A;  1DM0 B;  1CI3 M;  1XYI A;  3QWN A;  1BR9 A;  3DWQ A;  4IFD I;  1EZ6 A;  1EY6 A;  5AFW A;  4PMB A;  2O5I C;  1I4P A;  1JR0 D;  3CQZ B;  5CR3 A;  3I91 A;  1BO0 A;  5CC4 A;  3TZD A;  4FNF A;  1PZK D;  1DCZ A;  2EPB A;  1TY2 A;  4NKL A;  4KK7 A;  1TKW B;  5ELC A;  5JEA J;  1X32 A;  1GXD C;  2K04 A;  1V1P A;  2XSC A;  5JVH 3;  1U4M A;  4ZKC B;  5FLX E;  4FXG C;  1PZJ D;  1PZI D;  3OWE B;  4TQU S;  3T56 B;  2X69 A;  4K5W A;  5FO8 B;  2DNC A;  3X3N A;  2WKC A;  4TSS A;  3CKI B;  1SAP A;  1K83 B;  5IOD A;  4KHV A;  1TS4 A;  4RGN A;  1DYQ A;  4RKB A;  4RFB A;  4IFD G;  4ZRZ A;  3E0J A;  4L63 B;  5CBA E;  1HPC A;  4EQO A;  1F2L A;  3MA2 B;  3DWP A;  4EGV A;  4L6T B;  2EY1 A;  1E2W A;  1D2B A;  2PW7 A;  1SYC A;  3A8K E;  1CA6 A;  4QUC A;  4LMQ D;  3S17 B;  1E2V A;  1U4L A;  2IX1 A;  1I50 B;  1RJT A;  4X3K A;  3URY A;  1F2Y A;  2Y0S B;  1B44 D;  2I46 A;  3GO5 A;  1C8C A;  3VR5 A;  4WFN 3;  1WTV A;  1ENA A;  3H3V C;  3OWF A;  4QF4 A;  5C5M A;  1IW7 C;  3P75 A;  4Q0F A;  1JQY D;  4IAL A;  1B53 A;  4QMG A;  1YNN D;  2A6H C;  1S5B D;  5C5L A;  2OXP A;  1SBB B;  1LT3 D;  3BVG A;  1DZ1 A;  5JVG 3;  3ERO A;  2K6A A;  2KOL A;  1T5E A;  3HGB A;  3RLF A;  2E76 C;  3S1N B;  5JAV A;  1IYV A;  5E4X A;  5E4W C;  1A2T A;  4OHJ A;  3G7L A;  1PFN A;  3W3A A;  3VR6 A;  3SEB A;  5ELE A;  3MXG A;  4XDX A;  1A15 A;  2MGS A;  3GQB A;  5CV7 A;  3GV3 A;  1ENC A;  1U4R A;  1CM9 A;  2F3W A;  4ILW A;  5D65 A;  1AFP A;  3NE5 B;  1M8A A;  4DXF A;  1JOO A;  3D6W A;  3WOE A;  3KF8 A;  1I4X A;  3BYT B;  1DD2 A;  5FKA C;  1GHJ A;  2PCF B;  4DAY A;  1I4R A;  1U4P A;  3M3Y B;  2B2T A;  1II3 A;  3MFG A;  5IIF A;  5HUR A;  5K5P A;  3TBI B;  3PIO 3;  3HOU B;  3AB9 A;  1MSH A;  2EJF C;  3WOF A;  2NN6 H;  3OIQ A;  2NZ1 D;  1EY7 A;  5COY A;  3K58 A;  1R4Q B;  1PTO C;  2NVX B;  1PYW D;  4PQX A;  1SSO A;  3MXP A;  2HDL A;  1DOM A;  3I8Z A;  4F87 A;  2NBF A;  1OO9 B;  3GTO B;  1F9S A;  2H4O A;  1G2T A;  5DEH A;  3S1Q B;  2VXW A;  4C2M B;  2NN6 I;  5DM7 3;  3GTP B;  5C0X J;  5FLX L;  2RSN A;  3M4Y A;  2K33 A;  3TSS A;  1BXT A;  2JEA I;  2DY8 A;  4C3I B;  1QNK A;  2H1E A;  5A35 A;  1I6H B;  4IN3 A;  2L55 A;  3K59 A;  5JPM C;  1D1K A;  2A74 C;  4R9W A;  3QG1 A;  1B3A A;  1AZP A;  3T13 A;  2B2U C;  2YYZ A;  2ICE C;  4FYD A;  1STG A;  1GHK A;  2F0N A;  1I4G A;  2F0G A;  1QB5 D;  2F0M A;  5EPK A;  2E2H B;  1E2Z A;  1V43 A;  2NUC A;  5M5Y B;  2C9O A;  1XTC D;  4A3G B;  1JWU D;  1D5M C;  4OL7 A;  1XXG A;  1RF2 D;  2A73 B;  1H9R A;  4CKC A;  1LTA D;  3MFY A;  2A69 D;  3QIA A;  5CMD A;  3NQI A;  4HMI A;  1A2U A;  2B39 A;  3HOV B;  5KND A;  1NR4 A;  4DXG A;  2EVB A;  4KY7 A;  1JC7 A;  1WD0 A;  4O1N A;  1AW7 A;  5JEA G;  4JK1 C;  4K14 A;  3HG9 A;  4J8Q A;  1QOH A;  1CTM A;  5CYU A;  1F9Q A;  3P1H A;  2EOT A;  4KV6 A;  4C3J B;  2C5C A;  1TS2 A;  5C3W A;  4X3T A;  3VR3 A;  3E5S A;  1GUW A;  5D3D A;  3DEO A;  1B2T A;  1RCV D;  2QF7 A;  3H94 A;  2VUM B;  1GUT A;  3TP7 A;  4J1M A;  1I4H A;  2B8F A;  4KJO A;  2KCC A;  2F0W A;  1EIG A;  4ABN A;  2B2W C;  5EKI A;  1KLG D;  4IUN A;  3RMH A;  2RA4 A;  1MGS A;  4RKL A;  2KUM A;  1U9R A;  3S9W A;  3BG3 A;  1I6V C;  2KHS A;  5NUC A;  3K7A B;  2L1B A;  4RCN A;  5KRU A;  1ROD A;  1STE A;  1WTX A;  2PYK A;  3NTH A;  3JAM E;  5ISR A;  1TWC B;  2SEB D;  5EBC A;  4KD4 A;  2SDF A;  3I3C A;  3TP5 A;  1KLU D;  4GZY C;  1EYA A;  2L4N A;  1STB A;  2B2Y A;  1S5E D;  2SNM A;  5I9O A;  4FVM A;  3TP6 A;  1VF5 C;  1SJE D;  2E2D C;  2KED A;  4QCL A;  4KTA A;  4AYB B;  2NVT B;  4ME5 A;  4PMC A;  2K7V A;  2JE6 I;  5KGU A;  3C1F A;  3VYT A;  2RKS A;  5BN4 A;  2DY7 A;  1K8O A;  2ZXO A;  3A55 A;  2BA0 A;  2I07 B;  4KHZ A;  3H91 A;  1V1P B;  1UAP A;  1QJO A;  2OF1 A;  3HOZ B;  1TS3 A;  2F0E A;  5KIX A;  3SVM A;  4K8I A;  4EVO A;  1J8I A;  1FNW A;  1IW7 D;  4H13 C;  2F3V A;  2PQE A;  1ILP A;  2A6H D;  2E2I B;  1SMY C;  4RH6 A;  1EU4 A;  1LAC A;  3GTJ B;  1Y8O B;  2SNS A;  2BDN A;  5I2Y A;  2R3Z A;  4KKT A;  1PRT C;  5C0X G;  2QCP X;  3NTK A;  4OO1 G;  1KDC A;  4XIG S;  1EY4 A;  1VCI A;  2HCC A;  3NXW A;  3D4W A;  2XWB B;  1EOT A;  1PTO F;  1BF4 A;  4OIJ A;  5EBD A;  2JSO A;  5DAU A;  2R6G A;  4C1N K;  3FDT A;  4NW2 A;  1FYC A;  5KYI A;  1HFG A;  4C56 C;  3Q0A A;  2HDM A;  2F0V A;  3KK7 A;  4BA1 I;  1VMP A;  3V2T A;  4IUT A;  2R93 B;  2XIW A;  3DM1 A;  3HS0 C;  3NPP A;  3D4R A;  4A3B B;  3S1M B;  5C3X A;  1VMC A;  1NCV A;  2BDO A;  1A3U A;  1G8Z D;  1SNP A;  3BZD B;  5FK9 C;  2G9D A;  2TSS A;  4ZQ3 A;  3PV0 A;  1HFN A;  1PTO D;  3DHQ A;  3SE0 A;  4HED A;  3PIP 3;  3NQT A;  3JAM L;  1CHP D;  1HTL D;  1FR3 A;  3TDQ A;  1LT5 D;  1EY8 A;  4J6H A;  4HN7 A;  4RGM A;  2M9V A;  1SE3 A;  1GOZ A;  2L5T A;  5ELF A;  2EE1 A;  3N6R A;  3QOJ A;  1BDO A;  4H0L C;  1SNC A;  5IGD A;  3D3R A;  1EWC A;  1RTO A;  3HOY B;  5M5X B;  3IFD A;  4QIW B;  4HCS A;  5FO7 B;  2F1M A;  3C1E A;  2PNR C;  3ERQ A;  4KY6 A;  1TS5 A;  3FRP B;  3R3O A;  3SXH A;  1JOR A;  2JP1 A;  4U67 3;  1DXM A;  5M9O A;  4TKO B;  1GUO A;  1L0X B;  4N9P A;  1D5X C;  4DN4 M;  5IGG A;  3QB3 A;  1STA A;  4HMJ A;  5G3L F;  1Y69 U;  4HR7 B;  4A3K B;  2F4I A;  2WP8 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...