2KVMA

Solution structure of the cbx7 chromodomain in complex with a h3k27me2 peptide
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
71
structure length
71
Chain Sequence
MELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEERDRASGYRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chromobox protein homolog 7
publication title Molecular interplay of the noncoding RNA ANRIL and methylated histone H3 lysine 27 by polycomb CBX7 in transcriptional silencing of INK4a.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
total genus 11
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2010-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2kvmA00
1B4OA 4RWSC 1G2SA 1MSHA 1PFBA 1NR2A 4U68A 2RSNA 1EOTA 5EPJA 2MP1A 1XX8A 4X3KA 1A15A 5DNFA 2X69A 2B2YA 1U4MA 2H1EA 5T1GA 4R8IA 4LMQD 1B53A 3GV6A 2NYZD 1PFNA 5E4WC 5EJWA 4CJ0B 1BO0A 2EOTA 1IKLA 2HDMA 5CMDA 1XYIA 1ILPA 1F9QA 1RJTA 3FDTA 4CJ1B 1BF4A 2MGSA 1HUNA 1AP0A 4HCSA 2R3ZA 2KUMA 3KUPA 1NR4A 3TN2A 1ML0D 1X32A 4ZKCB 4IUPA 1QG7A 2FJ2A 1F9PA 1SSOA 2N55A 1Q3LA 3MTSA 1NCVA 1WTXA 1B3AA 1WTQA 4OIJA 4MN3A 1HUMA 1M8AA 1ICWA 4IUVA 2K04A 2B2YC 1BNZA 2B2WA 1PLFA 3KBXA 2MJ8A 1ZXTA 1WTPA 4UAIA 2KEEA 4ZK9B 1DZ1A 3DM1A 1F2LA 2BDNA 3G7LA 1HFNA 1HFGA 1J8IA 2L12A 1JE4A 1WD1A 3IFDA 3FPUB 3HP3A 2FINB 1KNEA 3H91A 2VXWA 5JJZA 2B2VA 2RVLA 3TZDA 3SVMA 2FMMA 4QUFA 2K28A 1QE6A 2K1BA 1WTRA 2B2UA 1B50A 1CM9A 2Q8TA 2X6GA 4MHEA 2EE1A 4IURA 1F9SA 1ILQA 1WVLA 2K03A 1J9OA 2EPBA 1ESRA 2FFKB 5E4XA 1PFMA 2B2TA 3MWYW 5T1IA 1DONA 3P7JA 4IUQA 5COYA 1F9RA 1EL0A 4HEDA 5EPKA 2HCIA 1PDQA 4ZKBB 1AZPA 3I90A 1HA6A 2JYOA 2L4NA 1CA6A 4X3UA 5EPLA 4XT3B 1SAPA 1KNAA 1DOLA 2FHTA 2JP1A 3QO2A 5EQ0A 1O7ZA 4R9WA 3R93A 3I8ZA 2KEDA 1X3QA 4HSVA 2X6LA 2HCCA 2KECA 4O42A 4QUCA 1RHPA 1X3PA 1C8CA 1U4PA 2D9UA 1RTOA 2SDFA 2L1BA 1SDFA 5EKIA 4X3TA 2CVRA 1EIHA 2HDLA 3IL8A 1S4ZA 3GV3A 3ONAB 4X3SA 1GUWA 2KVMA 2HUGA 1JICA 1VMCA 1G2TA 1QNKA 5D65A 1WTOA 1RTNA 4RA8A 2RSOA 1CA5A 2NWGA 2J7ZA 2XIWA 1HRJA 4OIKA 3Q6SA 1O80A 1EIGA 2B2WC 1G6ZA 3D6WA 3F2UA 1MSGA 4XT1B 1TVXA 5CORA 1NAPA 3I91A 1VMPA 1WTWA 1U4RA 2N88A 2KOLA 1B2TA 1DOKA 4IUUA 4XDXA 4ZAIA 2DY7A 1DOMA 1BBXC 3LWEA 4IUTA 1E0BA 1IL8A 3DEPA 4HAEA 4DN4M 3UI2A 2IL8A 2B2VC 1O7YA 2L9HA 1U4LA 3N52A 4CJ2C 1WTVA 4NW2A 5AFWA 2B2UC 2M2LA 1EQTA 1G91A 1LV9A 2K01A 1WD0A 2Q8RE 1HHVA 2RA4A 1IKMA 2NZ1D 4ZLTF 2MPMA 1MI2A 1RODA 2K05A 3DEOA 3I3CA 5D14A 5CBAE 4RAUC 5CBEE 2L11A 2DY8A 2B2TC 1AZQA 1MGSA
chains in the Genus database with same CATH superfamily
1A62A 1ICFB 1G2SA 2UU9L 2NVQB 2HQEA 3S9WA 3CC2A 4XXEA 3IAYA 1HNXQ 3Q23A 5JEAJ 1U4MA 3C46A 3CCUA 3GTLB 1STAA 1PFNA 4BXXG 5E4WC 1RF2D 2EIFA 1UAPA 2JA9A 5KRUA 3NSWA 1FNVA 2JK8A 3BVGA 1YNND 3W3AA 2C9OA 4JI2Q 1TKWB 5IP9G 3S1NH 3F8TA 3PV0A 5ELCA 3BZDB 4IJLA 4B3SQ 1PMRA 2RF4A 1PTOH 4P73A 4G57A 1XNQL 2B2YC 4TRDA 4HJAA 1JORA 3T13A 4C1NK 3K7AH 4UP7A 4KTAA 3PIO3 1CKMA 3ERQA 3A0JA 1NBWA 3HOZH 3GD7A 3K0XA 1I94L 2R61A 3J80i 1E24A 4Y7NH 4DF7A 3IFDA 1GM5A 3DHQA 1GO3E 2SNSA 3BYTB 3K5NA 2E8GA 2PI2A 4BY7H 1I50B 2CFMA 5C44H 5DM73 4QUFA 2ZM6Q 3VR3A 4B9WA 2DUDA 5M5XB 1TIID 2K03A 4HJ8A 3T1YQ 3S2HB 2B29A 1MD2D 5LMNQ 2R92G 2EJFC 5FKAC 2QGQA 3L0OA 1ASZA 5IYCG 4A93H 5K36H 3M7NA 2Z1CA 1H9RA 5M9OA 4LUVA 4KKTA 4JI4Q 3KF6A 4KY7A 3I8ZA 2Q2UA 5FLXc 2X6LA 4QUCA 3MXNA 1I4PA 3R3OA 1XPOA 1TWCB 1DJRD 2JEAI 4FF3A 1OXTA 3PUXA 3GTGH 2BCOA 1LT3D 3P20A 4MZ9A 4LF5L 4HIOA 1FGUA 3T1YL 1CSQA 5CORA 3LGJA 1EEID 4P74A 4FYDA 4A3MB 1FD7D 4IUTA 2F0TA 1SNQA 2Q2IA 3D0FA 1TWFH 4JI4L 1LTAD 1SFOH 3S1MB 5JOBA 2LKVA 2Q8RE 1W2BA 1A63A 1TXYA 4DV4Q 4J8QA 1AZQA 3MFYA 2L0CA 2JA6H 3MXGA 4GLVB 3OSOA 3K59A 1PFBA 1I6HH 4FDBA 1NR2A 4POGA 4GLAC 1EIYB 2DGYA 2R7ZH 5E3FA 1JOQA 2Y0SG 4DK3C 4E6IA 4GOPC 1GUSA 2HDMA 4C3JB 2BDOA 1LTGD 2E5LL 4BY7G 3K0YA 2AWOA 2R3ZA 1E1TA 5I2YA 4A3KH 1YIJA 3KUPA 4QY7A 2E74C 1T5XD 3ND9A 5FO8B 4A3GG 5CV6A 4HIKA 1WOCA 1K9MC 4OIJA 1HUMA 1BNZA 2WB1B 1WTHA 1UE1A 2ALYB 3ULLA 1BCPC 1CQVA 1N36L 1RDPD 4H02A 1BDOA 3BDOA 1U0LA 3NTIA 5ISRA 2ZTDA 1S5FD 3CPWA 1PXUA 1Z47A 2BE5C 3I56A 2MO1A 1WYDA 1SEBD 4NP5A 2EE1A 3M4OB 1X3EA 1ZEQX 3S17B 5IIFA 1LACA 1JCKB 5IYBH 1K0RA 4ZUJA 5JJIA 4X3UA 2HD3A 1KNAA 2JP1A 2IHFA 2RHSB 3DXJC 4R9WA 5K5PA 4LNQA 4HSVA 1IBKL 3NHHA 5J39A 2E76C 2RCFA 3GTKB 5C4XB 2JA8H 1HQMC 3NBIA 1Z9FA 4EQ5A 5EKIA 2AMCB 4LFBL 1PFSA 1YITA 1C0AA 2FMCA 5C4HA 4PMBA 1JICA 1Y14B 5IT9E 4Z9CB 2Q2TA 2NWGA 4O0AA 5EBCA 2QKIC 4YIJA 2JA6G 2F0EA 2LFNA 3HKSA 3SXHA 1W3SA 1VMPA 2L15A 3GTJB 1JJGA 2PQAB 2ES2A 1SJED 3J81L 1Y1WB 3LWEA 1N32L 1E0BA 1CHPD 1SROA 4NW2A 4EX5A 4A3DG 1X9NA 4MNOA 5FO9B 1KABA 1BBUA 2VQEQ 4ZLTF 5D14A 1SMXA 3PO3B 3HOVB 4RWSC 1MSHA 3HOXH 1Y8NB 3BZCA 3GTOB 1JWSD 1XX8A 4CDFC 5A2QL 2NVYB 2NYZD 2N49A 3PUZA 5IP7G 2KA7A 1BO0A 4X64Q 2MFIA 3PMFA 4DR4L 4KKUA 4K8JA 3KJOA 1AP0A 1WFQA 2F0NA 2F0WA 3S16H 1ML0D 5C6AA 1XJVA 4A3CG 3BG3A 2R93G 2VQEL 2UXDQ 2CWAA 2M00A 5JJKA 1L1OA 5C3EG 2MJ8A 4IJHA 2JSOA 2E75C 2RHQB 1NUCA 3Q0AA 5HGQA 4A3JH 1EY0A 3TZDA 4DV6Q 4RGOS 1RD9D 2X6GA 1LTBD 4DV5Q 2JA7G 1HNZQ 1B44D 3OMGA 1EL0A 2LMCB 2TSSA 4TQUS 4LFAQ 3I90A 3J80E 1CA6A 2UXDL 4WFN3 3BZKA 3R93A 4DGZA 4GKKQ 1EY6A 1C8CA 4K0KQ 1TQOA 1RTOA 3EJIA 3S24A 1CQFA 4BBSH 2K5DA 3TBIB 1BR9A 3T4AC 2PQAA 3FVQA 2RCNA 4JI8Q 1PRTB 3BDLA 2RDHA 1SMYC 1L1OC 4IPCA 4OONA 1V8QA 3GTPB 1C4QA 1TVXA 1EYAA 1SYDA 4B3ML 1SXTA 1NJIC 3S1QH 4FXGC 2A6HC 4K2LA 3GQBA 2AHOB 1KIXA 1IL8A 2ZTCA 1E2VA 4DV3Q 1C7YA 4GKKL 2WAQE 3H94A 2QDLA 5KNCA 4K0KL 3S2DH 4C3IH 3DEOA 1SNDA 4FXDA 4X65Q 2JYOA 1MBYA 1AW7A 1K8MA 2F0HA 3QOJA 4JI8L 3O13A 2RSNA 2ICIA 4DAVA 4DR2Q 1Q81C 2R92B 4ULLA 1B53A 3GV6A 4QGUA 1Y69U 2A68D 1NTGA 4C56C 1XYIA 5LL6S 3QWNA 2Z6KA 2VUMG 3U4ZA 3HOUG 3I73A 3WDNA 2KUMA 2V1CC 4A4IA 4DR7Q 4ABNA 2PO4A 3MTSA 1Q3LA 1KAAA 4YWKA 1S5CD 3CMEA 4A3FB 1WTXA 1MIUA 3CCSA 4JI5Q 1VQ8A 2G9DA 4ZK9B 5NUCA 1BXTA 2NB0A 4RGTA 2VB3X 2VB2X 1EEFD 1F2YA 2CCZA 1VQ5A 2HT1A 2B2VA 3EN2A 4MIUA 1W6JA 3ULJA 4BBSG 2YU9B 5CV8A 4JK1C 4QIWE 3J80c 1VCIA 4NPSA 4I7ZC 3NTHA 3KDFB 2NN6G 1PZID 4AYBG 5KEEA 4ZKBB 3UDIA 4XT3B 3S14H 4JI0Q 1Y1VH 2XN9C 4DV1L 5CC4A 1B7YB 4JI5L 3SGIA 3L2PA 1VQOA 2ZJQA 2LY7A 2B39A 4R4TA 2D5DA 3CAMA 3RZDH 1V9PA 2B63H 2XVSA 5I2XA 1D7QA 3G6JB 1ENFA 2Y0SB 3NUCA 5C3WA 3DLLA 3ITPA 2KHSA 3KK7A 1K73C 1N33L 2J7ZA 2F3VA 4NDXA 4KLKA 3C3LA 3PO2G 4FVMA 4IALA 4GN4B 4A3GB 4X62L 1B2TA 2KOLA 1TR5A 3FRPB 1Q86C 4F87A 4I65A 3T16A 3NQIA 2EY6A 4BBRH 1C48A 3HOYH 2B2VC 4IPDA 3JAME 4X6AH 3HS0C 1G91A 4JBKA 5AFWA 3H0GH 4K8IA 4BY1G 4DXFA 2PCFB 3D3RA 3K57A 1TS2A 4FF4A 4WORA 3V96A 4KJOA 5DEHA 3SE0A 1QWYA 1TT2A 3P75A 5C0XH 4LUZA 1LLRD 3LX0A 4GKJQ 5J22A 4CJ1B 3HKZG 1UE5A 3IKJA 3H3VI 1JJ2A 2QILA 2NZHA 3TN2A 4OWWB 2K52A 3GTQB 3AYHB 3L9AX 4JI3L 2RKSA 1HR0W 2K04A 2QDBA 1QNUA 4XIGS 3RZOB 4LF6L 1HTPA 5KIXA 3K5LA 3U9OA 2PMZB 4A3EG 1XNRQ 2K4KA 2WB1E 1CZGA 1PRTD 2F3IA 1WD1A 2KCNA 3KDFA 3EVQA 4U673 2VQFL 1O78A 5CV5A 2VXWA 4GN3B 4PZ6A 2B63G 1A8VA 1E3PA 1HCZA 3OMCA 1YNJC 5M5YB 1RL2A 4A3BG 1WTRA 1B50A 3S1RB 2R7FA 4J1MA 3T53B 3M3YB 1J9OA 1FNUA 4DFAA 4A3DB 4EGVA 2L5TA 5M3MG 3TP6A 1CUKA 5CV9A 1M1KC 3CU7A 1QB5D 4B3TL 1BBWA 1EYGA 3EROA 3NENA 1K28A 2KCCA 3RN5A 3RLNA 1IW7C 3QIAA 4BBRG 1QVCA 4C2MH 1VQJA 2BOSA 1SDFA 1SNOA 3MFGA 3CCEA 4N9TA 4JI7L 1EY4A 5GAHC 2EYMA 2XIWA 2JA5G 1K83H 1A6XA 4YCVA 2HHHQ 1L0XB 2A8VA 3I4MH 5I4DA 2R93B 2IY5B 4JI6Q 1S5BD 5C3EB 3KLSX 1A0IA 2NVTH 1UNSA 2K7VA 1FJGQ 2UUAQ 2BH8A 2A5HA 3OHXC 1HHVA 1PH9A 1X3FA 3VYRA 2UU9Q 3KF6B 3V05A 1D1KA 3MXNB 2VS1A 1GVPA 4G7HC 4GOPB 1FNWA 2F0LA 4K5XA 4X3KA 1J5EL 2JA7B 2B2YA 1PHJA 1VQKA 5HURA 1Q8KA 2EJMA 2WFWA 1STEA 4JI6L 1A3UA 4IPHA 5C0XI 1F2MA 4JBJA 1EQQA 4HN7A 1FJGL 1VQBA 1X32A 2ZXRA 4R4OA 1SSOA 2E2IB 1NCVA 4G7ZC 4N8FA 1BCPB 1B3AA 2MO0A 3M4PA 5EAYA 5FJ8H 4IOCA 1I94Q 4PMCA 1VQEA 2OEOA 2BDNA 1HFNA 1R4PB 4IFDH 3LWUA 4K14A 4DV2L 3HOWH 3HFZB 2VNUD 3MHBA 4P71A 1CM9A 1X65A 4MHEA 3FKIG 5JEAG 4IUNA 4ID6A 4BA1I 2IT1A 4N8X1 2MHVA 1I4HA 3NBHB 4NKLA 1VQ4A 1LABA 4HEDA 2HCIA 3V2TA 3OTOL 4WJ3M 4IN3A 2L55A 3GTMB 2NBFA 1U9RA 4QQBX 1HXYD 4NXML 1X3PA 2D9UA 1X55A 3D8GA 3ERSX 3X3MA 5GQOA 4DK0A 1Q8IA 2EYLA 1TWAH 5GAEC 5GADC 4GLXA 1OXUA 3E3XA 3C1FA 1EQVA 3BVZA 4LF5Q 1VF5C 2VUMB 3HOUB 2E2DC 3PF5A 1QZGA 1O80A 1TS4A 3K5OA 1U4RA 1HH2P 1QVGA 1HZBA 3A8JE 4XYQA 1FGBD 2IL8A 4K5WA 4GOPA 4LF9Q 4IOAA 1WCMG 1Q1EA 1AN8A 4CKEA 4IO9A 3CCLA 1KLGD 1TY0A 1AE2A 3CPFA 2L11A 3I4NB 4A3IG 2AWNA 4MTNA 3G48A 1JWMD 3MAQA 4FP5D 1CKNB 2IPKD 4QCLA 1ZKOA 2E5LQ 3E9IA 4HIMA 1ILPA 3KF8A 2V4DA 1L0YB 3CRLC 2KJXA 1R9TH 1ONLA 2EXZA 4LF9L 1UE7A 3STBC 4V0BA 1SNCA 3MZ5A 1WTPA 1N36Q 1DCZA 3A5UA 5C4JH 3HOZG 3PO2B 2VW9A 3NBHA 1D1IA 1EOVA 2F0SA 1XMQQ 4IFDI 1TU2B 4QJFA 5C44G 1CFMA 5KYIA 1I6VC 1ESRA 5E4XA 1PFMA 1II3A 4UP9A 4BY1B 2YTXA 1AZPA 5IOCA 4OEMB 2PYKA 4A93G 5K36G 2AQ1B 3T56B 1IBKQ 5EQ0A 1QJOA 4I7AA 4C3HH 3QG1A 3CHBD 2ICEC 2KECA 1IBLL 1MJEA 4LFBQ 5FK9C 4B9XA 4RGMA 3SK4A 4GZYC 2KENA 5I9OA 3PIP3 2F0PA 4HJ7A 1JB3A 2E2HH 2HDLA 1L1OB 1XMQL 4OO1H 5CV4A 4X3SA 1IYUA 2HUGA 1EY7A 5BR8Q 1G2TA 3HKZB 1P16A 5JPMC 4F8MA 3Q6SA 4XT1B 1Q1BA 4LAAA 1N32Q 2H5XA 4ZAIA 2JE6I 2I5HA 3RD4A 1BCPD 4HAEA 1B1ZA 1SYBA 3AMUA 1HNWQ 1D5ZC 4A3EB 2G5DA 2GVAA 1GOZA 1QCBD 2VY3A 1CKNA 1STBA 2EY2A 2BE5D 1LM0A 2VL6A 3JAMi 3BJUA 4HJ9A 3M9BA 2O2LD 4A3BB 5M3FH 5BR8L 1EWHA 3SHLA 3T1HL 3TSSA 3OIPA 1WJJA 2QEXA 4V190 1E2ZA 5T1GA 2PZUA 3ER0A 4WJ4A 5M3MB 4JBMA 4PG3A 2R7ZG 4Q0FA 2PW5A 4DR4Q 3ZYYX 1P8LA 1TWGB 1EZ8A 1HZ9A 1I4QA 2QA4A 4A3LH 3CQZH 3MEHA 2K14A 4A3KG 1HNWL 4BA2I 3J81E 2F0MA 3PIOA 3SR1A 4FXKC 1F9PA 4KKSA 3W2DA 2I5MX 4WRDA 3K6OA 1KHIA 2DNEA 3CD6A 4DNIA 4KD3A 2JA5B 1UE6A 1I4XA 2C35B 1HFGA 2PMZE 3J7ZC 1EU3A 1PH3A 4DR6L 5IY0A 2RVLA 4GS3A 1QE6A 2K1BA 2NVQH 2B2UA 3NE5B 1ILQA 2OQ0A 3GTLH 3P7JA 5IYBG 2K5WA 2H4OA 2A74C 4O42A 1VQGA 1S72A 2JA8G 4X3TA 1CI3M 3I70A 4QB4A 3ONAB 1XTDA 1DYQA 3OYYA 1GUWA 4OO1I 2F52A 1QNKA 4X66L 3FEWX 1GKHA 5D65A 5I6YA 1CA5A 2RSOA 4AQYL 1SBBB 1EIGA 1SN8A 4B3MQ 4JVZA 1MSGA 1MKHA 2F0QA 2F0JA 1FL0A 4JG2A 3D4WA 1KAWA 4YWLA 1L0WA 1BKBA 2NVXB 1I50H 3H3VC 2PI2E 1DM0B 4IUUA 2VZAA 1YJNA 2PPBC 1SE8A 3D6CA 5M5XH 3S2HH 1U4LA 5IT9c 2B2UC 5C3XA 5FLMH 2KHIA 1I4RA 2K01A 2CKZB 1C9OA 3HG9A 3S15B 5CBAE 5D3IB 4JYAQ 4L8JA 1Z7TA 1MGSA 5ELOA 1KDBA 4H13C 1B4OA 2Z4IA 3W5OA 4LFCQ 3PQIA 3R2TA 3FKIB 4L5QA 3HOXG 1EOTA 2RQXA 2MP1A 2WAQG 1FVIA 4NMZA 3IRBA 5C5LA 1TWCH 2CWPA 4NXNQ 1GUTA 3AU7A 1SYCA 2TMPA 5EJWA 1IKLA 5HY6A 1W6KA 4HMJA 1AH9A 2MGSA 2NTTA 3VA7A 2EQSA 4DUYQ 4DR5Q 1SE4A 5M5WB 1OO9B 4A3MH 1E7ZA 1SMYD 2EYOA 2K5NA 1HR0Q 4JYAL 4FF1A 2XWJB 4LF8L 1TWHB 4ZCKA 3S1MH 1V43A 3C2PA 4LFCL 3K58A 4DUZQ 2A6HD 2IJ0A 3FPUB 1GUNA 4NXNL 2E2JB 4A3JG 4DU9A 2ZXPA 4CGYB 1QVFA 1YJ9A 4QMGA 3RN2A 1V1PB 2LXKA 1X6OA 5JAVA 4DV7Q 3R8BA 4DPGA 2EPBA 4DUYL 1WCMB 2FFKB 4DR5L 1I3QB 4POFA 4IUQA 1S5DD 5IWAL 2KCTA 2NTSA 2A69C 4C3JH 4DV1Q 2P5ZX 2O5JC 2CQOA 2BA0A 3W1BA 2ZJPA 4A3IB 1HR0L 3J7AF 4HJ5A 3W1GA 1MJCA 4DUZL 1EYDA 1Q46A 3GV3A 1VQ6A 1N33Q 1K8GA 2FXQA 2KVMA 3I55A 1TS3A 4LW1A 3SDZA 1EWIA 3M7GA 1B3QA 1X3GA 1DGSA 4ME3A 2EYFA 4JC0A 2LSSA 2ID0A 4X62Q 2DJGC 3KJPA 4DV7L 2N78A 1VDZA 3KLSA 1M90C 3S1NB 1WTWA 1PH4A 4RKLA 3U9SA 2DY7A 1PTOB 5IGEA 1PH1A 1BBXC 3ZJYC 1SYFA 1Q7YC 3M4OH 3UI2A 3K7AB 2CH4W 3S17H 4LF4L 1O7YA 4CJ2C 1EQTA 3HOZB 1G51A 4Y7NB 4C3IG 4BS9A 5KGUA 4A3MG 3VR5A 4BY7B 3CRKC 5C44B 2UUCQ 1EIFA 2PNHA 5C4XH 3GTKH 1I5FA 3EBEA 2WP8J 5HGTA 1EY9A 2F0DA 2IX1A 1PYWD 1N8RC 1V1QA 3G4SA 2BA1A 4DK6C 3F2CA 4HMIA 4A93B 1H9JA 1BF4A 3RNUA 1EY8A 1KD1C 1N34Q 2WINB 3TZUA 4OX9Q 1NR4A 2OXPA 4JI3Q 3VA5A 3CCRA 3GTJH 3URYA 4APVA 1QILA 4LF6Q 1Y1WH 4YCUA 2UUCL 1YHBA 4DV0L 3GTGB 1V1PA 2VQFQ 3PF4A 3GO5A 1YNXA 4YWMA 3B6YA 3LNNA 3F2DA 2EZVA 3PO3H 3HOVH 2FMMA 4XQJA 4R1JA 1YBYA 2JXMB 2Q8TA 3GTOH 4R4CA 5E7NA 4Y52H 1TWFB 2PNRC 4DAPA 3U4VA 1N34L 1SFOB 4OX9L 2F4VQ 4B3TQ 1VQLA 2NVYH 1BOSA 5COYA 1PH8A 1K8OA 4KK7A 1PDQA 3F1ZA 3OW2A 4BWGB 1Q12A 3QO2A 2XSCA 2A6EC 1Y1VG 2Q2HA 2JA6B 3DWAA 4R4QA 1X3QA 3RLOA 5F2DA 1D2BA 1I6HB 3GDEA 2ZXOA 5CR3A 3AEVA 4L63B 3TP5A 4JI7Q 3D4RA 3TRZA 4J6HA 2R7ZB 4GNXC 5KYLA 5JJLA 1S4ZA 1ZYRC 3KOJA 2GVBA 3KBGA 1RTNA 4UP8A 3HKZE 3J81j 1PRTF 3CC4A 1G6PA 4A3KB 1LO5D 3D6WA 1X54A 2F0IA 2F4VL 2R6GA 5KNDA 3I91A 3L3OC 5IYDH 1EWCA 3E0JA 4XDXA 5EKLA 1DOMA 1VQ7A 2F3WA 2EDGA 5IGDA 3QJYA 3VYUA 3NWSA 1HJPA 3HOYG 2B3GA 1ENCA 1HZCA 3NK9A 1LV9A 5CYUA 2IHEA 1MHWC 1E22A 1YNJD 3H0GG 4IPGA 3I3CA 2UXCL 3TDQA 3VR6A 1K0SA 4JBWA 4QL5A 1KLUD 3WOEA 3MXPA 5C0XJ 2K5VA 2PW7A 1J5EQ 5ELNA 3PUYA 1LT6D 1RKNA 2JJQA 2SOBA 1DD2A 3JAMc 3TREA 1IW7D 4BXXH 2I07B 2EOTA 3EA6A 2F0FA 5C0XG 4N9PA 2QCPX 3DM3A 2EVBA 2ZTEA 3I4LA 3A56A 3HOVG 3A7AB 2A1AA 2D2CC 1PTOC 5IP9H 3GTPH 4ZKCB 1QG7A 2D62A 4LWCA 2IWHA 2JA8B 2F03A 5KNBA 3J81i 2CW0C 3MXUA 2XNAC 3KBXA 1KC8C 1YI2A 3DWPA 3TEHB 5FLXL 4CDDC 4DV2Q 2JEBI 3L7ZC 3G71A 1B70B 2A19A 3H91A 1S40A 4HR7B 1SR3A 1HA5A 4DKAC 3SVMA 3P1HA 4RFBA 1JJCB 2GA4B 3BVMA 3DWQA 5IGBA 5I9PA 2K75A 5IGGA 2R92H 1ESFA 1V1OA 3OPOA 3OTOQ 4RKBA 1S5ED 5IYCH 3KF8B 4YHHQ 5J1ZA 5EPLA 1SAPA 1DOLA 2FHTA 4NXMQ 4HSPA 4CBVA 1PH2A 1QUQA 4DR3L 4PV1C 3NXWA 4CDEC 2WAQB 1YNNC 3UDGA 2L1BA 4PMWA 5BN3A 4A3FH 2K5HA 2CVRA 4EQNA 4HIDA 3K5MA 4PNYA 1YJWA 1HTLD 2J4XA 1LTRD 1A2TA 4P72A 2WKCA 3F2UA 3A54A 5DLQE 3S16B 1A2UA 1NAPA 4XQNA 3I4MG 3TS0A 4YHHL 2YU9H 4O2DA 2SNMA 5FOBB 1GUGA 1YEZA 3JC66 3VYSA 4C1NI 4YY3L 1EY5A 4RMFA 5CBEE 4RAUC 2JN4A 2IW3A 3C1EA 4A3JB 2XRQD 5A35A 4JOIA 3ICEA 5EPJA 1UEAB 1VF7A 1YHQA 3HZXA 3U50C 1HNXL 3EIVA 1SNPA 3CW2C 1LT4D 2CH4A 1H9KA 1OTCA 3FHWA 5GAGC 5BN5A 5CGKA 2DN8A 1A3TA 1JR0D 4QIWB 3A5ZB 4A3GH 3MC0B 2OQKA 4IUPA 4JI2L 4IQZA 3I72A 3MEFA 5JVH3 1CKOA 1WTQA 4B3SL 4MN3A 4IFDJ 4BBSB 1OXVA 1R4QB 4DAMA 5FJ8G 1H9MA 2D0OA 4G7OC 3TP7A 1J8IA 4AYBB 2KBNA 3EFXD 2F0OA 2CQAA 2F0UA 4IFDG 5IE8A 3HOWG 3HRZC 4A3FG 3S1QB 5JVG3 1JWUD 1PZKD 4Q5VA 2ZM6L 2PQEA 3A74A 2ENBA 1WVLA 3NWTA 4DNTB 1SE3A 1IYJB 4JOIC 1EZ6A 5T1IA 1H95A 5LMNL 5EPKA 3S2DB 4C3IB 4XTCS 4JW0A 3OW7A 1IBLQ 3RMHA 1O7ZA 3VR4A 1OXSC 1DXMA 1K3BC 4OELB 3CCJA 3GTQH 2K32A 2Q8IB 2QW7A 4KHPQ 2Z9HA 2F0KA 1EIHA 4LK1C 3RZOH 4K5VA 1EU4A 2ZJRA 3CKIB 3STBD 1HRJA 1JB7A 4UY8C 2YYZA 1T9HA 2GN5A 3BYYB 1CZWA 3IFTA 4ME5A 5LHY1 4A75A 5M5YH 3S1RH 1ASYA 4LUOA 4JPBW 3HEJA 3T51B 3M3YH 2AKWB 2F1MA 2K50A 4A3DH 5J3BA 1VQCA 4CDCC 1E1OA 1SE2A 3E9HA 3CP0A 4KHPL 2EYHA 3RR5A 2Y0SE 1VQPA 2EY5A 1SLJA 1VQ9A 2OF1A 1CK1A 1STHA 3CCQA 4DV4L 3DUZA 3T1HQ 1JQYD 4U68A 2AQ2B 1L2FA 1EQRA 5DNFA 1K3RA 2EXDA 2DNCA 4UPAA 5IP7H 1SYGA 3FDTA 3CCVA 3S14B 4RHRA 1Y1VB 3BU2A 3UE0A 3R2IA 3J7AV 1ET6A 3M4YA 4RGNA 3RZDB 4A3CH 2R93H 2B63B 2RDGA 3H6MA 2C5CA 4HCEA 5C3EH 1VQHA 4PZ7A 1BCPF 2O5IC 3AFPA 1PLFA 5ELDA 2KEEA 5DM63 1T5EA 5GROA 3DM1A 1DZ1A 4DR6Q 4YCWA 2K5QA 5IT9L 2AQ3B 3HP3A 1KNEA 1VQNA 1QZHA 3KFUA 5I6WA 3KLWA 1EFID 1K8AC 4BBRB 1O7IA 5EKKA 2A73B 3HOYB 1F9SA 2Z4HA 2JA7H 5LMNW 3H0GB 1DONA 4TVAB 3UDXA 1D5XC 2L4NA 1UEBA 5TSSA 2NUCA 4C3HG 4CHTB 1GXDC 1RHPA 1STGA 1U4PA 4EQOA 1XWEA 5EGTA 3FPPA 2E2IH 3H15A 1VQAA 3F2BA 3BDCA 4X66Q 3A8KE 4OO1G 5A2QE 3E5SA 4AQYQ 2M9VA 4P75A 2KCMA 1G6ZA 3Q22A 2KQ3A 4KHZA 3A8IE 1PYBA 4PZ8A 3ND8A 4LJZC 2KHJA 2WKDA 2WV6D 1PZJD 1STYA 1X56A 1UWVA 4GN5A 4B3RQ 1B9NA 4KY5A 1SYEA 2L9HA 4FNFA 2Z8LA 3GP7A 1JOOA 1NSNS 2I5LX 3I2ZA 2MPMA 5C4ZA 1RODA 2K05A 2R7DA 1KXLA 1RIPA 1VQIA 2UUBQ 2DY8A 3A55A 4KN7C 1HPCA 3GTMH 1KL9A 2OTLA 2ATWA 3PSIA 5M3FG 1H9SB 3PUVA 4KJNA 2H1EA 3UDFA 5BN4A 5EBDA 2XRSD 4JV5Q 4L5TA 4CJ0B 5CMDA 3CC7A 4LF7Q 4PQXA 2Z6BA 3SK6A 2VUMH 4DNRB 3HOUH 1F9QA 4A3LG 4FO2A 1S3OA 1LUZA 4X64L 2XWBB 4B3RL 3J80L 1IYVA 4TKOB 3VR2A 4C2MB 1O7LA 2N55A 2EYPA 4J15A 2J0TD 4LF8Q 2MQHA 1GHJA 2BH2A 1M8AA 4IUVA 2UUBL 1D8LA 1PYSB 1NNXA 4UAIA 3TP8A 1F2LA 1K83B 3G7LA 5E1FA 1KDAA 2O4XA 3N6RA 4FF2A 2SEBD 4OXPA 2FINB 4AIMA 3J81c 4H44C 2K33A 2ASBA 3I4NH 3I4MB 4RCNA 4JV5L 2YTVA 4R8NA 3FMCA 2K28A 4LF7L 1YVCA 1GJXA 4ZRZA 3ULPA 4QF4A 4DV6L 4DR1Q 2NVTB 5IWAQ 2NN6H 3M85A 1FR3A 4DV5L 1PH6A 1N9WA 2CHBD 1HNZL 2PZWA 1KQSA 2EY1A 2B8FA 3PIPA 3QR8A 2DJFC 4LFAL 2A68C 1D6EC 4GNXB 2HCCA 1F2ZA 2Z0SA 1JE5A 2XTIA 4JCVE 1PH7A 5L37A 4KHVA 3HGBA 2IX0A 1EYCA 1VMCA 2UXBQ 4RA8A 4DR1L 1CT1D 3M4QA 4OIKA 3PO2H 4JI1Q 1PV4A 5IODA 1NMGA 3TS2A 1JOKA 2YV5A 2HQLA 3J7A5 2MUYA 1BUVT 4KMUC 4LF4Q 1CHQD 3RUZA 4OHJA 4DXGA 1SNMA 1XMOQ 2OT2A 3H3VH 3N52A 1H9SA 1E2WA 2OWOA 4DV3L 1LTTD 5FLMG 4BY1H 2RA4A 4KD4A 2NZ1D 3PUWA 1MI2A 4OL7A 4ILWA 3HOWB 2JQOA 3D4DA 4O1NA 4X65L 2UXBL 2IX3A 1BVSA 4KI0A 2YTYA 2A69D 1A15A 2HIVA 4ZUIA 3A7LA 4JI1L 1J6QA 4DK1A 5FO7B 3D31A 3MA2B 1G291 5AJ3Q 4KY6A 4EQPA 4DR2L 1B9MA 2EYJA 5LL6X 1LTID 3I4NG 1RJTA 1SJHD 2G9HD 4HCSA 3AFQA 5LMUQ 1ET9A 1KRTA 1XMOL 4AH6A 1M4VA 4XQQA 4DR7L 3Q8DA 1KDCA 1XXGA 4P2CB 1EFWA 1UUPA 1STNA 1TWAB 2NZOA 1Z6HA 4DAYB 1VQMA 1NY4A 1XTCD 4DV0Q 1CSPA 2I46A 1U5KA 5G3LD 4A3EH 3CF5A 1QOHA 4TSSA 2L12A 3J7YW 2Z6KC 2RBMA 4AYBE 2OTJA 3U58A 1ENAA 5AJ3L 4DA2A 4G4KA 4A3BH 4L6TB 2AUKA 3SK8A 3CXCA 1JC7A 3AQQA 4L5RC 4IURA 5G3LF 1WI5A 4GNXA 5LMUL 2N8NA 3AB9A 5M3MH 1G8ZD 3K80C 3MWYW 2NN6I 1PVOA 1F9RA 1XPRA 1TWGH 3WOFA 3JAML 1A3VA 1HA6A 1Q90A 2HIXA 3DMUA 3RLFA 4C3JG 2F0GA 2N3SA 1JMCA 4L5SA 3I7FA 4UHVA 2KEDA 4R4IA 2I0QA 4JI0L 3QOLA 1CTMA 1LYLA 3TQYA 1D5MC 4NB3A 5ELFA 2SDFA 5C5MA 5ELBA 4B08A 4ALPA 1HQRD 3OIQA 3X3NA 4MTKA 2WB1G 2D0PA 2JA5H 1IZ6A 3QB3A 1R9TB 1PH5A 1Y8PB 1BQQT 2K6AA 1JT8A 4M1UB 2F4IA 1PRTC 3K8AA 4K6LA 1NMFA 3EQLC 3FP9A 3H09A 5DAUA 1OXXK 1LT5D 2LXJA 4A76A 1SRUA 5H1SE 1WTVA 2UXCQ 3OWEB 1WD0A 4RCOA 5C4JB 2EJGC 4KN4C 2WACA 1KRSA 1LTLA 3CMAA 3E0EA 1YZ6A 1QUQB 1AFPA 3NTKA 3KYHC 3MVVA 3NQTA 1IHZA 3CCMA 2AUJD 5C4XG 5JPNC 1PA6A 1VS0A 1XPUA 3NP8A 2X69A 4OGQC 3SK5A 4R8IA 2A6ED 4LMQD 4KV6A 1NE3A 4RG1A 4DAYA 1HUNA 4C3HB 4H0LC 4GKJL 2LS01 2RDFA 1IBMQ 2NVXH 1ZYRD 4RH6A 2FJ2A 4UDUC 3PCOB 4H7BA 1IXRA 1AE3A 2E2HB 1ICWA 1Y1WG 3PGZA 2XGTA 2B2WA 3UE1A 1ZXTA 4ZYSA 4K6DA 1KTKA 1I4GA 2WIIB 1JE4A 3G6EA 1VQFA 4EVOA 1XNRL 3S15H 3OOCA 4CKBA 5JJZA 4CKCA 4F88A 3PO3G 1IL2A 1RCVD 3NELA 5JEAH 3FKIH 1VQDA 3K7UC 2OCEA 3NEMA 3KLRA 2MNAA 4F7XA 1HZAA 4WJWA 3VYTA 4OWXB 3VDYA 2B2TA 3WWVA 1IBML 4ZQ3A 1GUOA 3NPPA 1LTSD 3K81C 1B8AA 4DR3Q 3OWFA 2ZT9C 4K2KA 1GD7A 4S3SA 5M3FB 2F0VA 1EUJA 5M5WH 5IGFA 4ODGA 3I4OA 2QF7A 3IL8A 2B8GA 5FLXE 5D3DA 1FYCA 5CV7A 3Q24A 1PTOD 1TWHH 4OWTB 3SEBA 1WTOA 3CQZB 1Q82C 1AEXA 2B2WC 4XYOA 2CW0D 1F77A 3TMEA 2N88A 1TS5A 2E2JH 1DOKA 2HHHL 1GHKA 5IYDG 2QEJC 1TY2A 3DEPA 4DN4M 1Y8OB 1PTOF 4HTHA 2PZTA 3HOXB 4YY3Q 1WCMH 4IZ8A 1I3QH 4RHSA 2M2LA 5IGCA 1YHAA 3BS1A 4M8AA 3E6ZX 1IKMA 2UUAL 1XNQQ 4A3IH 2B2TC 5ELEA
chains in the Genus database with same CATH topology
1G2SA 2NVQB 2HQEA 3S9WA 4XXEA 3IAYA 3Q23A 5JEAJ 1U4MA 3C46A 3GTLB 1STAA 1PFNA 5E4WC 1RF2D 5KRUA 1UAPA 3NSWA 1FNVA 3BVGA 1YNND 3W3AA 2C9OA 1TKWB 3PV0A 5ELCA 3BZDB 1PMRA 1PTOH 4G57A 2B2YC 4TRDA 1JORA 3T13A 4C1NK 4KTAA 3PIO3 3ERQA 3GD7A 2R61A 4DF7A 3IFDA 3DHQA 2SNSA 3BYTB 3K5NA 1I50B 5DM73 4QUFA 3VR3A 4B9WA 5M5XB 1TIID 2K03A 3S2HB 1MD2D 2EJFC 5FKAC 5K36H 3M7NA 2Z1CA 1H9RA 5M9OA 4KKTA 4KY7A 3I8ZA 2X6LA 4QUCA 3MXNA 1I4PA 3R3OA 1TWCB 1DJRD 2JEAI 4FF3A 1OXTA 3PUXA 2BCOA 1LT3D 3P20A 5CORA 1EEID 4FYDA 4A3MB 1FD7D 4IUTA 2F0TA 1SNQA 1LTAD 3S1MB 5JOBA 2LKVA 2Q8RE 4J8QA 1AZQA 3MFYA 2L0CA 3MXGA 3OSOA 3K59A 1PFBA 1NR2A 5E3FA 1JOQA 4E6IA 1GUSA 2HDMA 4C3JB 2BDOA 1LTGD 3K0YA 2AWOA 2R3ZA 5I2YA 3KUPA 2E74C 1T5XD 3ND9A 5FO8B 5CV6A 4OIJA 1HUMA 1BNZA 2WB1B 1BCPC 1CQVA 1RDPD 1BDOA 3BDOA 3NTIA 5ISRA 1S5FD 1PXUA 1Z47A 2BE5C 4NP5A 1SEBD 2EE1A 3M4OB 1ZEQX 3S17B 5IIFA 1LACA 1JCKB 4ZUJA 4X3UA 1KNAA 2JP1A 3DXJC 4R9WA 5K5PA 4HSVA 3NHHA 5J39A 2E76C 3GTKB 5C4XB 1HQMC 3NBIA 5EKIA 2FMCA 5C4HA 4PMBA 1JICA 5IT9E 4Z9CB 2NWGA 5EBCA 2QKIC 4YIJA 2F0EA 2LFNA 3SXHA 1VMPA 3GTJB 1SJED 3J81L 1Y1WB 3LWEA 1E0BA 1CHPD 4NW2A 5FO9B 1KABA 4ZLTF 5D14A 3PO3B 3HOVB 4RWSC 1MSHA 1Y8NB 3GTOB 1JWSD 1XX8A 5A2QL 2NVYB 2NYZD 3PUZA 2KA7A 1BO0A 3PMFA 4KKUA 4K8JA 1AP0A 2F0NA 2F0WA 1ML0D 5C6AA 3BG3A 2M00A 2MJ8A 2JSOA 2E75C 1NUCA 3Q0AA 1EY0A 3TZDA 4RGOS 1RD9D 2X6GA 1LTBD 1B44D 3OMGA 1EL0A 2LMCB 2TSSA 4TQUS 3J80E 3I90A 1CA6A 4WFN3 3R93A 4DGZA 1EY6A 1C8CA 1TQOA 1RTOA 3EJIA 1CQFA 2K5DA 3TBIB 1BR9A 3T4AC 3FVQA 1PRTB 3BDLA 2RDHA 1SMYC 1V8QA 3GTPB 1C4QA 1TVXA 1EYAA 1SYDA 1SXTA 4FXGC 2A6HC 4K2LA 3GQBA 1IL8A 1E2VA 3H94A 5KNCA 3DEOA 1SNDA 4FXDA 2JYOA 1MBYA 1AW7A 1K8MA 2F0HA 3QOJA 3O13A 2RSNA 2ICIA 4DAVA 2R92B 4ULLA 1B53A 3GV6A 1Y69U 2A68D 4C56C 1XYIA 5LL6S 3QWNA 3I73A 3WDNA 2KUMA 4ABNA 2PO4A 3MTSA 1Q3LA 1KAAA 1S5CD 4A3FB 1WTXA 2G9DA 4ZK9B 5NUCA 1BXTA 2NB0A 4RGTA 2VB3X 2VB2X 1EEFD 1F2YA 2B2VA 4MIUA 1W6JA 2YU9B 5CV8A 4JK1C 1VCIA 4I7ZC 3NTHA 2NN6G 1PZID 5KEEA 4ZKBB 4XT3B 2XN9C 5CC4A 2LY7A 2B39A 2D5DA 2XVSA 5I2XA 3G6JB 1ENFA 2Y0SB 3NUCA 5C3WA 3ITPA 2KHSA 3KK7A 2J7ZA 2F3VA 4NDXA 3C3LA 4FVMA 4IALA 4A3GB 1B2TA 2KOLA 1TR5A 3FRPB 4F87A 4I65A 3T16A 3NQIA 2EY6A 1C48A 2B2VC 3JAME 3HS0C 1G91A 5AFWA 4K8IA 4DXFA 2PCFB 3D3RA 3K57A 1TS2A 4FF4A 4WORA 3V96A 4KJOA 5DEHA 3SE0A 1QWYA 1TT2A 3P75A 5C0XH 1LLRD 3LX0A 5J22A 4CJ1B 3IKJA 2QILA 3TN2A 3GTQB 3L9AX 2RKSA 2K04A 2QDBA 1QNUA 4XIGS 3RZOB 1HTPA 5KIXA 3K5LA 3U9OA 2PMZB 1PRTD 1CZGA 1WD1A 2KCNA 3EVQA 4U673 1O78A 5CV5A 2VXWA 1HCZA 3OMCA 1YNJC 5M5YB 1WTRA 1B50A 3S1RB 4J1MA 3T53B 3M3YB 1J9OA 1FNUA 4DFAA 4A3DB 4EGVA 2L5TA 3TP6A 5CV9A 3CU7A 1QB5D 3EROA 2KCCA 1IW7C 3QIAA 2BOSA 1SDFA 1SNOA 3MFGA 4N9TA 1EY4A 2EYMA 2XIWA 1A6XA 1L0XB 5I4DA 2R93B 1S5BD 5C3EB 3KLSX 1UNSA 2K7VA 2A5HA 3OHXC 1HHVA 3VYRA 3V05A 1D1KA 4G7HC 1FNWA 2F0LA 4K5XA 4X3KA 2JA7B 2B2YA 5HURA 2EJMA 1STEA 1A3UA 5C0XI 1F2MA 4HN7A 1X32A 2ZXRA 1SSOA 2E2IB 1NCVA 4G7ZC 1BCPB 1B3AA 4PMCA 2OEOA 2BDNA 1HFNA 1R4PB 4IFDH 3LWUA 4K14A 2VNUD 3MHBA 1CM9A 4MHEA 5JEAG 4IUNA 4ID6A 4BA1I 2IT1A 2MHVA 1I4HA 4NKLA 1LABA 4HEDA 2HCIA 3V2TA 4IN3A 2L55A 3GTMB 2NBFA 1U9RA 1HXYD 1X3PA 2D9UA 3D8GA 3X3MA 4DK0A 1Q8IA 2EYLA 1OXUA 3C1FA 1EQVA 3BVZA 1VF5C 2VUMB 3HOUB 2E2DC 1O80A 1TS4A 3K5OA 1U4RA 3A8JE 4XYQA 1FGBD 2IL8A 4K5WA 1Q1EA 1AN8A 4CKEA 1KLGD 1TY0A 2L11A 3I4NB 2AWNA 1JWMD 3MAQA 2IPKD 4FP5D 4QCLA 1ZKOA 1ILPA 3KF8A 2V4DA 1L0YB 3CRLC 2KJXA 1ONLA 2EXZA 4V0BA 1SNCA 3MZ5A 1WTPA 1DCZA 3PO2B 3NBHA 1D1IA 2F0SA 4IFDI 1TU2B 1CFMA 5KYIA 1I6VC 1ESRA 5E4XA 1PFMA 1II3A 4BY1B 1AZPA 5IOCA 2PYKA 5K36G 2AQ1B 3T56B 5EQ0A 1QJOA 3QG1A 3CHBD 2ICEC 2KECA 5FK9C 4B9XA 4RGMA 3SK4A 4GZYC 5I9OA 3PIP3 2F0PA 1JB3A 2HDLA 4OO1H 5CV4A 4X3SA 1IYUA 2HUGA 1EY7A 1G2TA 3HKZB 5JPMC 4F8MA 3Q6SA 4XT1B 1Q1BA 4LAAA 4ZAIA 2JE6I 3RD4A 1BCPD 4HAEA 1B1ZA 1SYBA 3AMUA 1D5ZC 4A3EB 1GOZA 1QCBD 1STBA 2EY2A 2BE5D 2O2LD 4A3BB 1EWHA 3SHLA 3TSSA 3OIPA 4V190 1E2ZA 5T1GA 2PZUA 5M3MB 4Q0FA 2PW5A 3ZYYX 1TWGB 1EZ8A 1I4QA 3MEHA 4BA2I 3J81E 2F0MA 3SR1A 4FXKC 1F9PA 4KKSA 3W2DA 4WRDA 3K6OA 2DNEA 4KD3A 2JA5B 1I4XA 1HFGA 1EU3A 2RVLA 1QE6A 2K1BA 2B2UA 3NE5B 1ILQA 3P7JA 2K5WA 2H4OA 2A74C 4O42A 4X3TA 1CI3M 3I70A 4QB4A 3ONAB 1DYQA 1GUWA 4OO1I 1QNKA 3FEWX 5D65A 5I6YA 1CA5A 2RSOA 1SBBB 1EIGA 1MSGA 2F0QA 2F0JA 3D4WA 2NVXB 3H3VC 1DM0B 4IUUA 2PPBC 3D6CA 1U4LA 2B2UC 5C3XA 1I4RA 2K01A 3HG9A 3S15B 5CBAE 5D3IB 4L8JA 1Z7TA 1MGSA 1KDBA 4H13C 1B4OA 2Z4IA 3R2TA 3FKIB 1EOTA 2RQXA 2MP1A 4NMZA 5C5LA 1GUTA 3AU7A 1SYCA 2TMPA 5EJWA 1IKLA 1W6KA 4HMJA 2MGSA 2NTTA 3VA7A 1SE4A 5M5WB 1OO9B 1SMYD 2EYOA 4FF1A 2XWJB 1TWHB 1V43A 3C2PA 3K58A 2A6HD 2IJ0A 3FPUB 1GUNA 2E2JB 4DU9A 2ZXPA 4CGYB 4QMGA 1V1PB 5JAVA 3R8BA 2EPBA 1WCMB 2FFKB 1I3QB 4IUQA 1S5DD 2NTSA 2A69C 2O5JC 4A3IB 2BA0A 3J7AF 1EYDA 3GV3A 2KVMA 1TS3A 3SDZA 3M7GA 2EYFA 2ID0A 1VDZA 3KLSA 3S1NB 1WTWA 4RKLA 3U9SA 2DY7A 1PTOB 5IGEA 1BBXC 1SYFA 3UI2A 3K7AB 1O7YA 4CJ2C 1EQTA 3HOZB 4Y7NB 4C3IG 4BS9A 5KGUA 4BY7B 3VR5A 3CRKC 5C44B 2WP8J 5HGTA 1EY9A 2F0DA 2IX1A 1PYWD 2BA1A 4HMIA 4A93B 1H9JA 1BF4A 1EY8A 2WINB 3TZUA 1NR4A 2OXPA 3VA5A 3URYA 1QILA 3GTGB 1V1PA 3GO5A 3LNNA 2EZVA 2FMMA 4XQJA 2JXMB 2Q8TA 1TWFB 2PNRC 4DAPA 1SFOB 1BOSA 5COYA 1K8OA 4KK7A 1PDQA 4BWGB 1Q12A 2XSCA 3QO2A 2A6EC 2JA6B 3DWAA 1X3QA 5F2DA 1D2BA 1I6HB 2ZXOA 5CR3A 4L63B 3TP5A 3D4RA 4J6HA 2R7ZB 5KYLA 1S4ZA 1ZYRC 3KBGA 1RTNA 1PRTF 4A3KB 1LO5D 3D6WA 2F0IA 2R6GA 5KNDA 3I91A 3L3OC 1EWCA 3E0JA 4XDXA 5EKLA 1DOMA 2F3WA 2EDGA 5IGDA 3QJYA 3VYUA 3NWSA 1ENCA 3NK9A 1LV9A 5CYUA 1YNJD 3I3CA 3TDQA 3VR6A 4JBWA 1KLUD 3WOEA 3MXPA 5C0XJ 2PW7A 3PUYA 1LT6D 1RKNA 2SOBA 1DD2A 1IW7D 2I07B 2EOTA 3EA6A 2F0FA 5C0XG 4N9PA 2QCPX 2EVBA 3I4LA 3A56A 3A7AB 2D2CC 1PTOC 4ZKCB 1QG7A 2D62A 2IWHA 2JA8B 2F03A 5KNBA 2CW0C 3MXUA 2XNAC 3KBXA 3DWPA 5FLXL 2JEBI 3L7ZC 3H91A 4HR7B 1HA5A 3SVMA 3P1HA 4RFBA 2GA4B 3BVMA 3DWQA 5IGBA 5I9PA 5IGGA 1ESFA 1V1OA 3OPOA 4RKBA 1S5ED 5J1ZA 5EPLA 1SAPA 1DOLA 2FHTA 4HSPA 4CBVA 4PV1C 3NXWA 2WAQB 1YNNC 2L1BA 4PMWA 5BN3A 2CVRA 4EQNA 3K5MA 4PNYA 1HTLD 2J4XA 1LTRD 1A2TA 2WKCA 3F2UA 3A54A 3S16B 1A2UA 1NAPA 4XQNA 2SNMA 5FOBB 1GUGA 4C1NI 3VYSA 1EY5A 5CBEE 4RAUC 2IW3A 3C1EA 4A3JB 2XRQD 5A35A 5EPJA 1UEAB 1VF7A 3HZXA 1SNPA 1LT4D 1H9KA 5BN5A 5CGKA 2DN8A 1A3TA 1JR0D 4QIWB 3MC0B 4IUPA 4IQZA 3I72A 5JVH3 1WTQA 4IFDJ 4MN3A 4BBSB 1OXVA 1R4QB 1H9MA 4G7OC 3TP7A 1J8IA 4AYBB 3EFXD 2F0OA 2CQAA 2F0UA 4IFDG 3HRZC 3S1QB 5JVG3 1JWUD 1PZKD 4Q5VA 2PQEA 1WVLA 2ENBA 3NWTA 4DNTB 1SE3A 1EZ6A 5T1IA 5EPKA 3S2DB 4C3IB 4XTCS 3OW7A 3RMHA 1O7ZA 3VR4A 1OXSC 1DXMA 2K32A 2Q8IB 2F0KA 1EIHA 4LK1C 4K5VA 1EU4A 3CKIB 1HRJA 2YYZA 3BYYB 1CZWA 3IFTA 4ME5A 5LHY1 3HEJA 3T51B 2F1MA 1SE2A 2EYHA 2EY5A 2OF1A 1CK1A 1STHA 3DUZA 1JQYD 4U68A 2AQ2B 5DNFA 2DNCA 1SYGA 3FDTA 3S14B 4RHRA 1Y1VB 3R2IA 3J7AV 1ET6A 3M4YA 4RGNA 3RZDB 2B63B 2RDGA 3H6MA 2C5CA 4HCEA 1BCPF 2O5IC 1PLFA 5ELDA 2KEEA 5DM63 1T5EA 1DZ1A 3DM1A 2K5QA 5IT9L 2AQ3B 3HP3A 1KNEA 5I6WA 1EFID 4BBRB 5EKKA 2A73B 3HOYB 1F9SA 2Z4HA 3H0GB 1DONA 1D5XC 2L4NA 5TSSA 2NUCA 4C3HG 4CHTB 1GXDC 1RHPA 1STGA 1U4PA 4EQOA 1XWEA 5EGTA 3FPPA 3BDCA 3A8KE 4OO1G 5A2QE 3E5SA 2M9VA 1G6ZA 3Q22A 2KQ3A 4KHZA 3A8IE 3ND8A 4LJZC 2WKDA 2WV6D 1STYA 1PZJD 1B9NA 4KY5A 1SYEA 2L9HA 4FNFA 2Z8LA 3GP7A 1JOOA 1NSNS 2MPMA 5C4ZA 1RODA 2K05A 2DY8A 3A55A 4KN7C 1HPCA 1H9SB 3PUVA 4KJNA 2H1EA 5BN4A 5EBDA 2XRSD 4CJ0B 5CMDA 4PQXA 3SK6A 4DNRB 1F9QA 4FO2A 2XWBB 3J80L 1IYVA 4TKOB 3VR2A 4C2MB 1O7LA 2N55A 2EYPA 2J0TD 1GHJA 1M8AA 4IUVA 4UAIA 3TP8A 1F2LA 1K83B 3G7LA 5E1FA 1KDAA 2O4XA 3N6RA 4FF2A 2SEBD 2FINB 3I4MB 4H44C 2K33A 4RCNA 4R8NA 3FMCA 2K28A 1GJXA 4ZRZA 4QF4A 2NVTB 2NN6H 3M85A 1FR3A 2CHBD 2PZWA 2EY1A 2B8FA 2A68C 1D6EC 2HCCA 1F2ZA 4KHVA 3HGBA 2IX0A 1EYCA 1VMCA 4RA8A 1CT1D 4OIKA 5IODA 1JOKA 2MUYA 1BUVT 4KMUC 1CHQD 3RUZA 4OHJA 4DXGA 1SNMA 2OT2A 3N52A 1H9SA 1E2WA 2B2TC 1LTTD 2RA4A 4KD4A 2NZ1D 3PUWA 1MI2A 4OL7A 4ILWA 3HOWB 3D4DA 4O1NA 2IX3A 4KI0A 2A69D 1A15A 4ZUIA 3A7LA 4DK1A 5FO7B 3D31A 3MA2B 1G291 4KY6A 4EQPA 1B9MA 2EYJA 5LL6X 1LTID 1RJTA 1SJHD 2G9HD 4HCSA 1ET9A 1M4VA 4XQQA 1KDCA 1XXGA 4P2CB 1UUPA 1STNA 1TWAB 1Z6HA 1XTCD 2I46A 5G3LD 1QOHA 4TSSA 2L12A 3J7YW 2RBMA 1ENAA 4G4KA 4L6TB 2AUKA 3SK8A 1JC7A 4IURA 5G3LF 3AB9A 1G8ZD 3MWYW 2NN6I 1F9RA 3WOFA 3JAML 1A3VA 1HA6A 1Q90A 3DMUA 3RLFA 4C3JG 2F0GA 2KEDA 3QOLA 1CTMA 1D5MC 5ELFA 2SDFA 5C5MA 5ELBA 4B08A 1HQRD 3OIQA 3X3NA 3QB3A 1R9TB 1Y8PB 1BQQT 2K6AA 4M1UB 2F4IA 1PRTC 4K6LA 3EQLC 5DAUA 3H09A 1OXXK 1LT5D 1WTVA 3OWEB 1WD0A 4RCOA 5C4JB 2EJGC 4KN4C 2WACA 1AFPA 3NTKA 3MVVA 3NQTA 1IHZA 2AUJD 5JPNC 3NP8A 2X69A 4OGQC 3SK5A 4R8IA 2A6ED 4LMQD 4KV6A 4DAYA 1HUNA 4C3HB 4H0LC 2LS01 2RDFA 1ZYRD 4RH6A 2FJ2A 4UDUC 4H7BA 2E2HB 1ICWA 2B2WA 1ZXTA 4ZYSA 4K6DA 1KTKA 1I4GA 2WIIB 1JE4A 4EVOA 3OOCA 4CKBA 5JJZA 4CKCA 4F88A 1RCVD 5JEAH 3KLRA 4F7XA 4WJWA 3VYTA 2B2TA 4ZQ3A 1GUOA 3NPPA 1LTSD 3OWFA 2ZT9C 4K2KA 4S3SA 5M3FB 2F0VA 5IGFA 4ODGA 2QF7A 5FLXE 2B8GA 3IL8A 5D3DA 1FYCA 5CV7A 3Q24A 1PTOD 3SEBA 1WTOA 3CQZB 1AEXA 2B2WC 4XYOA 2CW0D 1F77A 3TMEA 2N88A 1TS5A 1DOKA 1GHKA 2QEJC 1TY2A 3DEPA 4DN4M 1Y8OB 1PTOF 4HTHA 2PZTA 3HOXB 4IZ8A 4RHSA 2M2LA 5IGCA 3BS1A 4M8AA 3E6ZX 1IKMA 4DA2A 5ELEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B4O A;  4RWS C;  1G2S A;  1MSH A;  1PFB A;  1NR2 A;  4U68 A;  2RSN A;  1EOT A;  5EPJ A;  2MP1 A;  1XX8 A;  4X3K A;  1A15 A;  5DNF A;  2X69 A;  2B2Y A;  1U4M A;  2H1E A;  5T1G A;  4R8I A;  4LMQ D;  1B53 A;  3GV6 A;  2NYZ D;  1PFN A;  5E4W C;  5EJW A;  4CJ0 B;  1BO0 A;  2EOT A;  1IKL A;  2HDM A;  5CMD A;  1XYI A;  1ILP A;  1F9Q A;  1RJT A;  3FDT A;  4CJ1 B;  1BF4 A;  2MGS A;  1HUN A;  1AP0 A;  4HCS A;  2R3Z A;  2KUM A;  3KUP A;  1NR4 A;  3TN2 A;  1ML0 D;  1X32 A;  4ZKC B;  4IUP A;  1QG7 A;  2FJ2 A;  1F9P A;  1SSO A;  2N55 A;  1Q3L A;  3MTS A;  1NCV A;  1WTX A;  1B3A A;  1WTQ A;  4OIJ A;  4MN3 A;  1HUM A;  1M8A A;  1ICW A;  4IUV A;  2K04 A;  2B2Y C;  1BNZ A;  2B2W A;  1PLF A;  3KBX A;  2MJ8 A;  1ZXT A;  1WTP A;  4UAI A;  2KEE A;  4ZK9 B;  1DZ1 A;  3DM1 A;  1F2L A;  2BDN A;  3G7L A;  1HFN A;  1HFG A;  1J8I A;  2L12 A;  1JE4 A;  1WD1 A;  3IFD A;  3FPU B;  3HP3 A;  2FIN B;  1KNE A;  3H91 A;  2VXW A;  5JJZ A;  2B2V A;  2RVL A;  3TZD A;  3SVM A;  2FMM A;  4QUF A;  2K28 A;  1QE6 A;  2K1B A;  1WTR A;  2B2U A;  1B50 A;  1CM9 A;  2Q8T A;  2X6G A;  4MHE A;  2EE1 A;  4IUR A;  1F9S A;  1ILQ A;  1WVL A;  2K03 A;  1J9O A;  2EPB A;  1ESR A;  2FFK B;  5E4X A;  1PFM A;  2B2T A;  3MWY W;  5T1I A;  1DON A;  3P7J A;  4IUQ A;  5COY A;  1F9R A;  1EL0 A;  4HED A;  5EPK A;  2HCI A;  1PDQ A;  4ZKB B;  1AZP A;  3I90 A;  1HA6 A;  2JYO A;  2L4N A;  1CA6 A;  4X3U A;  5EPL A;  4XT3 B;  1SAP A;  1KNA A;  1DOL A;  2FHT A;  2JP1 A;  3QO2 A;  5EQ0 A;  1O7Z A;  4R9W A;  3R93 A;  3I8Z A;  2KED A;  1X3Q A;  4HSV A;  2X6L A;  2HCC A;  2KEC A;  4O42 A;  4QUC A;  1RHP A;  1X3P A;  1C8C A;  1U4P A;  2D9U A;  1RTO A;  2SDF A;  2L1B A;  1SDF A;  5EKI A;  4X3T A;  2CVR A;  1EIH A;  2HDL A;  3IL8 A;  1S4Z A;  3GV3 A;  3ONA B;  4X3S A;  1GUW A;  2KVM A;  2HUG A;  1JIC A;  1VMC A;  1G2T A;  1QNK A;  5D65 A;  1WTO A;  1RTN A;  4RA8 A;  2RSO A;  1CA5 A;  2NWG A;  2J7Z A;  2XIW A;  1HRJ A;  4OIK A;  3Q6S A;  1O80 A;  1EIG A;  2B2W C;  1G6Z A;  3D6W A;  3F2U A;  1MSG A;  4XT1 B;  1TVX A;  5COR A;  1NAP A;  3I91 A;  1VMP A;  1WTW A;  1U4R A;  2N88 A;  2KOL A;  1B2T A;  1DOK A;  4IUU A;  4XDX A;  4ZAI A;  2DY7 A;  1DOM A;  1BBX C;  3LWE A;  4IUT A;  1E0B A;  1IL8 A;  3DEP A;  4HAE A;  4DN4 M;  3UI2 A;  2IL8 A;  2B2V C;  1O7Y A;  2L9H A;  1U4L A;  3N52 A;  4CJ2 C;  1WTV A;  4NW2 A;  5AFW A;  2B2U C;  2M2L A;  1EQT A;  1G91 A;  1LV9 A;  2K01 A;  1WD0 A;  2Q8R E;  1HHV A;  2RA4 A;  1IKM A;  2NZ1 D;  4ZLT F;  2MPM A;  1MI2 A;  1ROD A;  2K05 A;  3DEO A;  3I3C A;  5D14 A;  5CBA E;  4RAU C;  5CBE E;  2L11 A;  2DY8 A;  2B2T C;  1AZQ A;  1MGS A; 
#chains in the Genus database with same CATH topology
 1A62 A;  1ICF B;  1G2S A;  2UU9 L;  2NVQ B;  2HQE A;  3S9W A;  3CC2 A;  4XXE A;  3IAY A;  1HNX Q;  3Q23 A;  5JEA J;  1U4M A;  3C46 A;  3CCU A;  3GTL B;  1STA A;  1PFN A;  4BXX G;  5E4W C;  1RF2 D;  2EIF A;  1UAP A;  2JA9 A;  5KRU A;  3NSW A;  1FNV A;  2JK8 A;  3BVG A;  1YNN D;  3W3A A;  2C9O A;  4JI2 Q;  1TKW B;  5IP9 G;  3S1N H;  3F8T A;  3PV0 A;  5ELC A;  3BZD B;  4IJL A;  4B3S Q;  1PMR A;  2RF4 A;  1PTO H;  4P73 A;  4G57 A;  1XNQ L;  2B2Y C;  4TRD A;  4HJA A;  1JOR A;  3T13 A;  4C1N K;  3K7A H;  4UP7 A;  4KTA A;  3PIO 3;  1CKM A;  3ERQ A;  3A0J A;  1NBW A;  3HOZ H;  3GD7 A;  3K0X A;  1I94 L;  2R61 A;  3J80 i;  1E24 A;  4Y7N H;  4DF7 A;  3IFD A;  1GM5 A;  3DHQ A;  1GO3 E;  2SNS A;  3BYT B;  3K5N A;  2E8G A;  2PI2 A;  4BY7 H;  1I50 B;  2CFM A;  5C44 H;  5DM7 3;  4QUF A;  2ZM6 Q;  3VR3 A;  4B9W A;  2DUD A;  5M5X B;  1TII D;  2K03 A;  4HJ8 A;  3T1Y Q;  3S2H B;  2B29 A;  1MD2 D;  5LMN Q;  2R92 G;  2EJF C;  5FKA C;  2QGQ A;  3L0O A;  1ASZ A;  5IYC G;  4A93 H;  5K36 H;  3M7N A;  2Z1C A;  1H9R A;  5M9O A;  4LUV A;  4KKT A;  4JI4 Q;  3KF6 A;  4KY7 A;  3I8Z A;  2Q2U A;  5FLX c;  2X6L A;  4QUC A;  3MXN A;  1I4P A;  3R3O A;  1XPO A;  1TWC B;  1DJR D;  2JEA I;  4FF3 A;  1OXT A;  3PUX A;  3GTG H;  2BCO A;  1LT3 D;  3P20 A;  4MZ9 A;  4LF5 L;  4HIO A;  1FGU A;  3T1Y L;  1CSQ A;  5COR A;  3LGJ A;  1EEI D;  4P74 A;  4FYD A;  4A3M B;  1FD7 D;  4IUT A;  2F0T A;  1SNQ A;  2Q2I A;  3D0F A;  1TWF H;  4JI4 L;  1LTA D;  1SFO H;  3S1M B;  5JOB A;  2LKV A;  2Q8R E;  1W2B A;  1A63 A;  1TXY A;  4DV4 Q;  4J8Q A;  1AZQ A;  3MFY A;  2L0C A;  2JA6 H;  3MXG A;  4GLV B;  3OSO A;  3K59 A;  1PFB A;  1I6H H;  4FDB A;  1NR2 A;  4POG A;  4GLA C;  1EIY B;  2DGY A;  2R7Z H;  5E3F A;  1JOQ A;  2Y0S G;  4DK3 C;  4E6I A;  4GOP C;  1GUS A;  2HDM A;  4C3J B;  2BDO A;  1LTG D;  2E5L L;  4BY7 G;  3K0Y A;  2AWO A;  2R3Z A;  1E1T A;  5I2Y A;  4A3K H;  1YIJ A;  3KUP A;  4QY7 A;  2E74 C;  1T5X D;  3ND9 A;  5FO8 B;  4A3G G;  5CV6 A;  4HIK A;  1WOC A;  1K9M C;  4OIJ A;  1HUM A;  1BNZ A;  2WB1 B;  1WTH A;  1UE1 A;  2ALY B;  3ULL A;  1BCP C;  1CQV A;  1N36 L;  1RDP D;  4H02 A;  1BDO A;  3BDO A;  1U0L A;  3NTI A;  5ISR A;  2ZTD A;  1S5F D;  3CPW A;  1PXU A;  1Z47 A;  2BE5 C;  3I56 A;  2MO1 A;  1WYD A;  1SEB D;  4NP5 A;  2EE1 A;  3M4O B;  1X3E A;  1ZEQ X;  3S17 B;  5IIF A;  1LAC A;  1JCK B;  5IYB H;  1K0R A;  4ZUJ A;  5JJI A;  4X3U A;  2HD3 A;  1KNA A;  2JP1 A;  2IHF A;  2RHS B;  3DXJ C;  4R9W A;  5K5P A;  4LNQ A;  4HSV A;  1IBK L;  3NHH A;  5J39 A;  2E76 C;  2RCF A;  3GTK B;  5C4X B;  2JA8 H;  1HQM C;  3NBI A;  1Z9F A;  4EQ5 A;  5EKI A;  2AMC B;  4LFB L;  1PFS A;  1YIT A;  1C0A A;  2FMC A;  5C4H A;  4PMB A;  1JIC A;  1Y14 B;  5IT9 E;  4Z9C B;  2Q2T A;  2NWG A;  4O0A A;  5EBC A;  2QKI C;  4YIJ A;  2JA6 G;  2F0E A;  2LFN A;  3HKS A;  3SXH A;  1W3S A;  1VMP A;  2L15 A;  3GTJ B;  1JJG A;  2PQA B;  2ES2 A;  1SJE D;  3J81 L;  1Y1W B;  3LWE A;  1N32 L;  1E0B A;  1CHP D;  1SRO A;  4NW2 A;  4EX5 A;  4A3D G;  1X9N A;  4MNO A;  5FO9 B;  1KAB A;  1BBU A;  2VQE Q;  4ZLT F;  5D14 A;  1SMX A;  3PO3 B;  3HOV B;  4RWS C;  1MSH A;  3HOX H;  1Y8N B;  3BZC A;  3GTO B;  1JWS D;  1XX8 A;  4CDF C;  5A2Q L;  2NVY B;  2NYZ D;  2N49 A;  3PUZ A;  5IP7 G;  2KA7 A;  1BO0 A;  4X64 Q;  2MFI A;  3PMF A;  4DR4 L;  4KKU A;  4K8J A;  3KJO A;  1AP0 A;  1WFQ A;  2F0N A;  2F0W A;  3S16 H;  1ML0 D;  5C6A A;  1XJV A;  4A3C G;  3BG3 A;  2R93 G;  2VQE L;  2UXD Q;  2CWA A;  2M00 A;  5JJK A;  1L1O A;  5C3E G;  2MJ8 A;  4IJH A;  2JSO A;  2E75 C;  2RHQ B;  1NUC A;  3Q0A A;  5HGQ A;  4A3J H;  1EY0 A;  3TZD A;  4DV6 Q;  4RGO S;  1RD9 D;  2X6G A;  1LTB D;  4DV5 Q;  2JA7 G;  1HNZ Q;  1B44 D;  3OMG A;  1EL0 A;  2LMC B;  2TSS A;  4TQU S;  4LFA Q;  3I90 A;  3J80 E;  1CA6 A;  2UXD L;  4WFN 3;  3BZK A;  3R93 A;  4DGZ A;  4GKK Q;  1EY6 A;  1C8C A;  4K0K Q;  1TQO A;  1RTO A;  3EJI A;  3S24 A;  1CQF A;  4BBS H;  2K5D A;  3TBI B;  1BR9 A;  3T4A C;  2PQA A;  3FVQ A;  2RCN A;  4JI8 Q;  1PRT B;  3BDL A;  2RDH A;  1SMY C;  1L1O C;  4IPC A;  4OON A;  1V8Q A;  3GTP B;  1C4Q A;  1TVX A;  1EYA A;  1SYD A;  4B3M L;  1SXT A;  1NJI C;  3S1Q H;  4FXG C;  2A6H C;  4K2L A;  3GQB A;  2AHO B;  1KIX A;  1IL8 A;  2ZTC A;  1E2V A;  4DV3 Q;  1C7Y A;  4GKK L;  2WAQ E;  3H94 A;  2QDL A;  5KNC A;  4K0K L;  3S2D H;  4C3I H;  3DEO A;  1SND A;  4FXD A;  4X65 Q;  2JYO A;  1MBY A;  1AW7 A;  1K8M A;  2F0H A;  3QOJ A;  4JI8 L;  3O13 A;  2RSN A;  2ICI A;  4DAV A;  4DR2 Q;  1Q81 C;  2R92 B;  4ULL A;  1B53 A;  3GV6 A;  4QGU A;  1Y69 U;  2A68 D;  1NTG A;  4C56 C;  1XYI A;  5LL6 S;  3QWN A;  2Z6K A;  2VUM G;  3U4Z A;  3HOU G;  3I73 A;  3WDN A;  2KUM A;  2V1C C;  4A4I A;  4DR7 Q;  4ABN A;  2PO4 A;  3MTS A;  1Q3L A;  1KAA A;  4YWK A;  1S5C D;  3CME A;  4A3F B;  1WTX A;  1MIU A;  3CCS A;  4JI5 Q;  1VQ8 A;  2G9D A;  4ZK9 B;  5NUC A;  1BXT A;  2NB0 A;  4RGT A;  2VB3 X;  2VB2 X;  1EEF D;  1F2Y A;  2CCZ A;  1VQ5 A;  2HT1 A;  2B2V A;  3EN2 A;  4MIU A;  1W6J A;  3ULJ A;  4BBS G;  2YU9 B;  5CV8 A;  4JK1 C;  4QIW E;  3J80 c;  1VCI A;  4NPS A;  4I7Z C;  3NTH A;  3KDF B;  2NN6 G;  1PZI D;  4AYB G;  5KEE A;  4ZKB B;  3UDI A;  4XT3 B;  3S14 H;  4JI0 Q;  1Y1V H;  2XN9 C;  4DV1 L;  5CC4 A;  1B7Y B;  4JI5 L;  3SGI A;  3L2P A;  1VQO A;  2ZJQ A;  2LY7 A;  2B39 A;  4R4T A;  2D5D A;  3CAM A;  3RZD H;  1V9P A;  2B63 H;  2XVS A;  5I2X A;  1D7Q A;  3G6J B;  1ENF A;  2Y0S B;  3NUC A;  5C3W A;  3DLL A;  3ITP A;  2KHS A;  3KK7 A;  1K73 C;  1N33 L;  2J7Z A;  2F3V A;  4NDX A;  4KLK A;  3C3L A;  3PO2 G;  4FVM A;  4IAL A;  4GN4 B;  4A3G B;  4X62 L;  1B2T A;  2KOL A;  1TR5 A;  3FRP B;  1Q86 C;  4F87 A;  4I65 A;  3T16 A;  3NQI A;  2EY6 A;  4BBR H;  1C48 A;  3HOY H;  2B2V C;  4IPD A;  3JAM E;  4X6A H;  3HS0 C;  1G91 A;  4JBK A;  5AFW A;  3H0G H;  4K8I A;  4BY1 G;  4DXF A;  2PCF B;  3D3R A;  3K57 A;  1TS2 A;  4FF4 A;  4WOR A;  3V96 A;  4KJO A;  5DEH A;  3SE0 A;  1QWY A;  1TT2 A;  3P75 A;  5C0X H;  4LUZ A;  1LLR D;  3LX0 A;  4GKJ Q;  5J22 A;  4CJ1 B;  3HKZ G;  1UE5 A;  3IKJ A;  3H3V I;  1JJ2 A;  2QIL A;  2NZH A;  3TN2 A;  4OWW B;  2K52 A;  3GTQ B;  3AYH B;  3L9A X;  4JI3 L;  2RKS A;  1HR0 W;  2K04 A;  2QDB A;  1QNU A;  4XIG S;  3RZO B;  4LF6 L;  1HTP A;  5KIX A;  3K5L A;  3U9O A;  2PMZ B;  4A3E G;  1XNR Q;  2K4K A;  2WB1 E;  1CZG A;  1PRT D;  2F3I A;  1WD1 A;  2KCN A;  3KDF A;  3EVQ A;  4U67 3;  2VQF L;  1O78 A;  5CV5 A;  2VXW A;  4GN3 B;  4PZ6 A;  2B63 G;  1A8V A;  1E3P A;  1HCZ A;  3OMC A;  1YNJ C;  5M5Y B;  1RL2 A;  4A3B G;  1WTR A;  1B50 A;  3S1R B;  2R7F A;  4J1M A;  3T53 B;  3M3Y B;  1J9O A;  1FNU A;  4DFA A;  4A3D B;  4EGV A;  2L5T A;  5M3M G;  3TP6 A;  1CUK A;  5CV9 A;  1M1K C;  3CU7 A;  1QB5 D;  4B3T L;  1BBW A;  1EYG A;  3ERO A;  3NEN A;  1K28 A;  2KCC A;  3RN5 A;  3RLN A;  1IW7 C;  3QIA A;  4BBR G;  1QVC A;  4C2M H;  1VQJ A;  2BOS A;  1SDF A;  1SNO A;  3MFG A;  3CCE A;  4N9T A;  4JI7 L;  1EY4 A;  5GAH C;  2EYM A;  2XIW A;  2JA5 G;  1K83 H;  1A6X A;  4YCV A;  2HHH Q;  1L0X B;  2A8V A;  3I4M H;  5I4D A;  2R93 B;  2IY5 B;  4JI6 Q;  1S5B D;  5C3E B;  3KLS X;  1A0I A;  2NVT H;  1UNS A;  2K7V A;  1FJG Q;  2UUA Q;  2BH8 A;  2A5H A;  3OHX C;  1HHV A;  1PH9 A;  1X3F A;  3VYR A;  2UU9 Q;  3KF6 B;  3V05 A;  1D1K A;  3MXN B;  2VS1 A;  1GVP A;  4G7H C;  4GOP B;  1FNW A;  2F0L A;  4K5X A;  4X3K A;  1J5E L;  2JA7 B;  2B2Y A;  1PHJ A;  1VQK A;  5HUR A;  1Q8K A;  2EJM A;  2WFW A;  1STE A;  4JI6 L;  1A3U A;  4IPH A;  5C0X I;  1F2M A;  4JBJ A;  1EQQ A;  4HN7 A;  1FJG L;  1VQB A;  1X32 A;  2ZXR A;  4R4O A;  1SSO A;  2E2I B;  1NCV A;  4G7Z C;  4N8F A;  1BCP B;  1B3A A;  2MO0 A;  3M4P A;  5EAY A;  5FJ8 H;  4IOC A;  1I94 Q;  4PMC A;  1VQE A;  2OEO A;  2BDN A;  1HFN A;  1R4P B;  4IFD H;  3LWU A;  4K14 A;  4DV2 L;  3HOW H;  3HFZ B;  2VNU D;  3MHB A;  4P71 A;  1CM9 A;  1X65 A;  4MHE A;  3FKI G;  5JEA G;  4IUN A;  4ID6 A;  4BA1 I;  2IT1 A;  4N8X 1;  2MHV A;  1I4H A;  3NBH B;  4NKL A;  1VQ4 A;  1LAB A;  4HED A;  2HCI A;  3V2T A;  3OTO L;  4WJ3 M;  4IN3 A;  2L55 A;  3GTM B;  2NBF A;  1U9R A;  4QQB X;  1HXY D;  4NXM L;  1X3P A;  2D9U A;  1X55 A;  3D8G A;  3ERS X;  3X3M A;  5GQO A;  4DK0 A;  1Q8I A;  2EYL A;  1TWA H;  5GAE C;  5GAD C;  4GLX A;  1OXU A;  3E3X A;  3C1F A;  1EQV A;  3BVZ A;  4LF5 Q;  1VF5 C;  2VUM B;  3HOU B;  2E2D C;  3PF5 A;  1QZG A;  1O80 A;  1TS4 A;  3K5O A;  1U4R A;  1HH2 P;  1QVG A;  1HZB A;  3A8J E;  4XYQ A;  1FGB D;  2IL8 A;  4K5W A;  4GOP A;  4LF9 Q;  4IOA A;  1WCM G;  1Q1E A;  1AN8 A;  4CKE A;  4IO9 A;  3CCL A;  1KLG D;  1TY0 A;  1AE2 A;  3CPF A;  2L11 A;  3I4N B;  4A3I G;  2AWN A;  4MTN A;  3G48 A;  1JWM D;  3MAQ A;  4FP5 D;  1CKN B;  2IPK D;  4QCL A;  1ZKO A;  2E5L Q;  3E9I A;  4HIM A;  1ILP A;  3KF8 A;  2V4D A;  1L0Y B;  3CRL C;  2KJX A;  1R9T H;  1ONL A;  2EXZ A;  4LF9 L;  1UE7 A;  3STB C;  4V0B A;  1SNC A;  3MZ5 A;  1WTP A;  1N36 Q;  1DCZ A;  3A5U A;  5C4J H;  3HOZ G;  3PO2 B;  2VW9 A;  3NBH A;  1D1I A;  1EOV A;  2F0S A;  1XMQ Q;  4IFD I;  1TU2 B;  4QJF A;  5C44 G;  1CFM A;  5KYI A;  1I6V C;  1ESR A;  5E4X A;  1PFM A;  1II3 A;  4UP9 A;  4BY1 B;  2YTX A;  1AZP A;  5IOC A;  4OEM B;  2PYK A;  4A93 G;  5K36 G;  2AQ1 B;  3T56 B;  1IBK Q;  5EQ0 A;  1QJO A;  4I7A A;  4C3H H;  3QG1 A;  3CHB D;  2ICE C;  2KEC A;  1IBL L;  1MJE A;  4LFB Q;  5FK9 C;  4B9X A;  4RGM A;  3SK4 A;  4GZY C;  2KEN A;  5I9O A;  3PIP 3;  2F0P A;  4HJ7 A;  1JB3 A;  2E2H H;  2HDL A;  1L1O B;  1XMQ L;  4OO1 H;  5CV4 A;  4X3S A;  1IYU A;  2HUG A;  1EY7 A;  5BR8 Q;  1G2T A;  3HKZ B;  1P16 A;  5JPM C;  4F8M A;  3Q6S A;  4XT1 B;  1Q1B A;  4LAA A;  1N32 Q;  2H5X A;  4ZAI A;  2JE6 I;  2I5H A;  3RD4 A;  1BCP D;  4HAE A;  1B1Z A;  1SYB A;  3AMU A;  1HNW Q;  1D5Z C;  4A3E B;  2G5D A;  2GVA A;  1GOZ A;  1QCB D;  2VY3 A;  1CKN A;  1STB A;  2EY2 A;  2BE5 D;  1LM0 A;  2VL6 A;  3JAM i;  3BJU A;  4HJ9 A;  3M9B A;  2O2L D;  4A3B B;  5M3F H;  5BR8 L;  1EWH A;  3SHL A;  3T1H L;  3TSS A;  3OIP A;  1WJJ A;  2QEX A;  4V19 0;  1E2Z A;  5T1G A;  2PZU A;  3ER0 A;  4WJ4 A;  5M3M B;  4JBM A;  4PG3 A;  2R7Z G;  4Q0F A;  2PW5 A;  4DR4 Q;  3ZYY X;  1P8L A;  1TWG B;  1EZ8 A;  1HZ9 A;  1I4Q A;  2QA4 A;  4A3L H;  3CQZ H;  3MEH A;  2K14 A;  4A3K G;  1HNW L;  4BA2 I;  3J81 E;  2F0M A;  3PIO A;  3SR1 A;  4FXK C;  1F9P A;  4KKS A;  3W2D A;  2I5M X;  4WRD A;  3K6O A;  1KHI A;  2DNE A;  3CD6 A;  4DNI A;  4KD3 A;  2JA5 B;  1UE6 A;  1I4X A;  2C35 B;  1HFG A;  2PMZ E;  3J7Z C;  1EU3 A;  1PH3 A;  4DR6 L;  5IY0 A;  2RVL A;  4GS3 A;  1QE6 A;  2K1B A;  2NVQ H;  2B2U A;  3NE5 B;  1ILQ A;  2OQ0 A;  3GTL H;  3P7J A;  5IYB G;  2K5W A;  2H4O A;  2A74 C;  4O42 A;  1VQG A;  1S72 A;  2JA8 G;  4X3T A;  1CI3 M;  3I70 A;  4QB4 A;  3ONA B;  1XTD A;  1DYQ A;  3OYY A;  1GUW A;  4OO1 I;  2F52 A;  1QNK A;  4X66 L;  3FEW X;  1GKH A;  5D65 A;  5I6Y A;  1CA5 A;  2RSO A;  4AQY L;  1SBB B;  1EIG A;  1SN8 A;  4B3M Q;  4JVZ A;  1MSG A;  1MKH A;  2F0Q A;  2F0J A;  1FL0 A;  4JG2 A;  3D4W A;  1KAW A;  4YWL A;  1L0W A;  1BKB A;  2NVX B;  1I50 H;  3H3V C;  2PI2 E;  1DM0 B;  4IUU A;  2VZA A;  1YJN A;  2PPB C;  1SE8 A;  3D6C A;  5M5X H;  3S2H H;  1U4L A;  5IT9 c;  2B2U C;  5C3X A;  5FLM H;  2KHI A;  1I4R A;  2K01 A;  2CKZ B;  1C9O A;  3HG9 A;  3S15 B;  5CBA E;  5D3I B;  4JYA Q;  4L8J A;  1Z7T A;  1MGS A;  5ELO A;  1KDB A;  4H13 C;  1B4O A;  2Z4I A;  3W5O A;  4LFC Q;  3PQI A;  3R2T A;  3FKI B;  4L5Q A;  3HOX G;  1EOT A;  2RQX A;  2MP1 A;  2WAQ G;  1FVI A;  4NMZ A;  3IRB A;  5C5L A;  1TWC H;  2CWP A;  4NXN Q;  1GUT A;  3AU7 A;  1SYC A;  2TMP A;  5EJW A;  1IKL A;  5HY6 A;  1W6K A;  4HMJ A;  1AH9 A;  2MGS A;  2NTT A;  3VA7 A;  2EQS A;  4DUY Q;  4DR5 Q;  1SE4 A;  5M5W B;  1OO9 B;  4A3M H;  1E7Z A;  1SMY D;  2EYO A;  2K5N A;  1HR0 Q;  4JYA L;  4FF1 A;  2XWJ B;  4LF8 L;  1TWH B;  4ZCK A;  3S1M H;  1V43 A;  3C2P A;  4LFC L;  3K58 A;  4DUZ Q;  2A6H D;  2IJ0 A;  3FPU B;  1GUN A;  4NXN L;  2E2J B;  4A3J G;  4DU9 A;  2ZXP A;  4CGY B;  1QVF A;  1YJ9 A;  4QMG A;  3RN2 A;  1V1P B;  2LXK A;  1X6O A;  5JAV A;  4DV7 Q;  3R8B A;  4DPG A;  2EPB A;  4DUY L;  1WCM B;  2FFK B;  4DR5 L;  1I3Q B;  4POF A;  4IUQ A;  1S5D D;  5IWA L;  2KCT A;  2NTS A;  2A69 C;  4C3J H;  4DV1 Q;  2P5Z X;  2O5J C;  2CQO A;  2BA0 A;  3W1B A;  2ZJP A;  4A3I B;  1HR0 L;  3J7A F;  4HJ5 A;  3W1G A;  1MJC A;  4DUZ L;  1EYD A;  1Q46 A;  3GV3 A;  1VQ6 A;  1N33 Q;  1K8G A;  2FXQ A;  2KVM A;  3I55 A;  1TS3 A;  4LW1 A;  3SDZ A;  1EWI A;  3M7G A;  1B3Q A;  1X3G A;  1DGS A;  4ME3 A;  2EYF A;  4JC0 A;  2LSS A;  2ID0 A;  4X62 Q;  2DJG C;  3KJP A;  4DV7 L;  2N78 A;  1VDZ A;  3KLS A;  1M90 C;  3S1N B;  1WTW A;  1PH4 A;  4RKL A;  3U9S A;  2DY7 A;  1PTO B;  5IGE A;  1PH1 A;  1BBX C;  3ZJY C;  1SYF A;  1Q7Y C;  3M4O H;  3UI2 A;  3K7A B;  2CH4 W;  3S17 H;  4LF4 L;  1O7Y A;  4CJ2 C;  1EQT A;  3HOZ B;  1G51 A;  4Y7N B;  4C3I G;  4BS9 A;  5KGU A;  4A3M G;  3VR5 A;  4BY7 B;  3CRK C;  5C44 B;  2UUC Q;  1EIF A;  2PNH A;  5C4X H;  3GTK H;  1I5F A;  3EBE A;  2WP8 J;  5HGT A;  1EY9 A;  2F0D A;  2IX1 A;  1PYW D;  1N8R C;  1V1Q A;  3G4S A;  2BA1 A;  4DK6 C;  3F2C A;  4HMI A;  4A93 B;  1H9J A;  1BF4 A;  3RNU A;  1EY8 A;  1KD1 C;  1N34 Q;  2WIN B;  3TZU A;  4OX9 Q;  1NR4 A;  2OXP A;  4JI3 Q;  3VA5 A;  3CCR A;  3GTJ H;  3URY A;  4APV A;  1QIL A;  4LF6 Q;  1Y1W H;  4YCU A;  2UUC L;  1YHB A;  4DV0 L;  3GTG B;  1V1P A;  2VQF Q;  3PF4 A;  3GO5 A;  1YNX A;  4YWM A;  3B6Y A;  3LNN A;  3F2D A;  2EZV A;  3PO3 H;  3HOV H;  2FMM A;  4XQJ A;  4R1J A;  1YBY A;  2JXM B;  2Q8T A;  3GTO H;  4R4C A;  5E7N A;  4Y52 H;  1TWF B;  2PNR C;  4DAP A;  3U4V A;  1N34 L;  1SFO B;  4OX9 L;  2F4V Q;  4B3T Q;  1VQL A;  2NVY H;  1BOS A;  5COY A;  1PH8 A;  1K8O A;  4KK7 A;  1PDQ A;  3F1Z A;  3OW2 A;  4BWG B;  1Q12 A;  3QO2 A;  2XSC A;  2A6E C;  1Y1V G;  2Q2H A;  2JA6 B;  3DWA A;  4R4Q A;  1X3Q A;  3RLO A;  5F2D A;  1D2B A;  1I6H B;  3GDE A;  2ZXO A;  5CR3 A;  3AEV A;  4L63 B;  3TP5 A;  4JI7 Q;  3D4R A;  3TRZ A;  4J6H A;  2R7Z B;  4GNX C;  5KYL A;  5JJL A;  1S4Z A;  1ZYR C;  3KOJ A;  2GVB A;  3KBG A;  1RTN A;  4UP8 A;  3HKZ E;  3J81 j;  1PRT F;  3CC4 A;  1G6P A;  4A3K B;  1LO5 D;  3D6W A;  1X54 A;  2F0I A;  2F4V L;  2R6G A;  5KND A;  3I91 A;  3L3O C;  5IYD H;  1EWC A;  3E0J A;  4XDX A;  5EKL A;  1DOM A;  1VQ7 A;  2F3W A;  2EDG A;  5IGD A;  3QJY A;  3VYU A;  3NWS A;  1HJP A;  3HOY G;  2B3G A;  1ENC A;  1HZC A;  3NK9 A;  1LV9 A;  5CYU A;  2IHE A;  1MHW C;  1E22 A;  1YNJ D;  3H0G G;  4IPG A;  3I3C A;  2UXC L;  3TDQ A;  3VR6 A;  1K0S A;  4JBW A;  4QL5 A;  1KLU D;  3WOE A;  3MXP A;  5C0X J;  2K5V A;  2PW7 A;  1J5E Q;  5ELN A;  3PUY A;  1LT6 D;  1RKN A;  2JJQ A;  2SOB A;  1DD2 A;  3JAM c;  3TRE A;  1IW7 D;  4BXX H;  2I07 B;  2EOT A;  3EA6 A;  2F0F A;  5C0X G;  4N9P A;  2QCP X;  3DM3 A;  2EVB A;  2ZTE A;  3I4L A;  3A56 A;  3HOV G;  3A7A B;  2A1A A;  2D2C C;  1PTO C;  5IP9 H;  3GTP H;  4ZKC B;  1QG7 A;  2D62 A;  4LWC A;  2IWH A;  2JA8 B;  2F03 A;  5KNB A;  3J81 i;  2CW0 C;  3MXU A;  2XNA C;  3KBX A;  1KC8 C;  1YI2 A;  3DWP A;  3TEH B;  5FLX L;  4CDD C;  4DV2 Q;  2JEB I;  3L7Z C;  3G71 A;  1B70 B;  2A19 A;  3H91 A;  1S40 A;  4HR7 B;  1SR3 A;  1HA5 A;  4DKA C;  3SVM A;  3P1H A;  4RFB A;  1JJC B;  2GA4 B;  3BVM A;  3DWQ A;  5IGB A;  5I9P A;  2K75 A;  5IGG A;  2R92 H;  1ESF A;  1V1O A;  3OPO A;  3OTO Q;  4RKB A;  1S5E D;  5IYC H;  3KF8 B;  4YHH Q;  5J1Z A;  5EPL A;  1SAP A;  1DOL A;  2FHT A;  4NXM Q;  4HSP A;  4CBV A;  1PH2 A;  1QUQ A;  4DR3 L;  4PV1 C;  3NXW A;  4CDE C;  2WAQ B;  1YNN C;  3UDG A;  2L1B A;  4PMW A;  5BN3 A;  4A3F H;  2K5H A;  2CVR A;  4EQN A;  4HID A;  3K5M A;  4PNY A;  1YJW A;  1HTL D;  2J4X A;  1LTR D;  1A2T A;  4P72 A;  2WKC A;  3F2U A;  3A54 A;  5DLQ E;  3S16 B;  1A2U A;  1NAP A;  4XQN A;  3I4M G;  3TS0 A;  4YHH L;  2YU9 H;  4O2D A;  2SNM A;  5FOB B;  1GUG A;  1YEZ A;  3JC6 6;  3VYS A;  4C1N I;  4YY3 L;  1EY5 A;  4RMF A;  5CBE E;  4RAU C;  2JN4 A;  2IW3 A;  3C1E A;  4A3J B;  2XRQ D;  5A35 A;  4JOI A;  3ICE A;  5EPJ A;  1UEA B;  1VF7 A;  1YHQ A;  3HZX A;  3U50 C;  1HNX L;  3EIV A;  1SNP A;  3CW2 C;  1LT4 D;  2CH4 A;  1H9K A;  1OTC A;  3FHW A;  5GAG C;  5BN5 A;  5CGK A;  2DN8 A;  1A3T A;  1JR0 D;  4QIW B;  3A5Z B;  4A3G H;  3MC0 B;  2OQK A;  4IUP A;  4JI2 L;  4IQZ A;  3I72 A;  3MEF A;  5JVH 3;  1CKO A;  1WTQ A;  4B3S L;  4MN3 A;  4IFD J;  4BBS B;  1OXV A;  1R4Q B;  4DAM A;  5FJ8 G;  1H9M A;  2D0O A;  4G7O C;  3TP7 A;  1J8I A;  4AYB B;  2KBN A;  3EFX D;  2F0O A;  2CQA A;  2F0U A;  4IFD G;  5IE8 A;  3HOW G;  3HRZ C;  4A3F G;  3S1Q B;  5JVG 3;  1JWU D;  1PZK D;  4Q5V A;  2ZM6 L;  2PQE A;  3A74 A;  2ENB A;  1WVL A;  3NWT A;  4DNT B;  1SE3 A;  1IYJ B;  4JOI C;  1EZ6 A;  5T1I A;  1H95 A;  5LMN L;  5EPK A;  3S2D B;  4C3I B;  4XTC S;  4JW0 A;  3OW7 A;  1IBL Q;  3RMH A;  1O7Z A;  3VR4 A;  1OXS C;  1DXM A;  1K3B C;  4OEL B;  3CCJ A;  3GTQ H;  2K32 A;  2Q8I B;  2QW7 A;  4KHP Q;  2Z9H A;  2F0K A;  1EIH A;  4LK1 C;  3RZO H;  4K5V A;  1EU4 A;  2ZJR A;  3CKI B;  3STB D;  1HRJ A;  1JB7 A;  4UY8 C;  2YYZ A;  1T9H A;  2GN5 A;  3BYY B;  1CZW A;  3IFT A;  4ME5 A;  5LHY 1;  4A75 A;  5M5Y H;  3S1R H;  1ASY A;  4LUO A;  4JPB W;  3HEJ A;  3T51 B;  3M3Y H;  2AKW B;  2F1M A;  2K50 A;  4A3D H;  5J3B A;  1VQC A;  4CDC C;  1E1O A;  1SE2 A;  3E9H A;  3CP0 A;  4KHP L;  2EYH A;  3RR5 A;  2Y0S E;  1VQP A;  2EY5 A;  1SLJ A;  1VQ9 A;  2OF1 A;  1CK1 A;  1STH A;  3CCQ A;  4DV4 L;  3DUZ A;  3T1H Q;  1JQY D;  4U68 A;  2AQ2 B;  1L2F A;  1EQR A;  5DNF A;  1K3R A;  2EXD A;  2DNC A;  4UPA A;  5IP7 H;  1SYG A;  3FDT A;  3CCV A;  3S14 B;  4RHR A;  1Y1V B;  3BU2 A;  3UE0 A;  3R2I A;  3J7A V;  1ET6 A;  3M4Y A;  4RGN A;  3RZD B;  4A3C H;  2R93 H;  2B63 B;  2RDG A;  3H6M A;  2C5C A;  4HCE A;  5C3E H;  1VQH A;  4PZ7 A;  1BCP F;  2O5I C;  3AFP A;  1PLF A;  5ELD A;  2KEE A;  5DM6 3;  1T5E A;  5GRO A;  3DM1 A;  1DZ1 A;  4DR6 Q;  4YCW A;  2K5Q A;  5IT9 L;  2AQ3 B;  3HP3 A;  1KNE A;  1VQN A;  1QZH A;  3KFU A;  5I6W A;  3KLW A;  1EFI D;  1K8A C;  4BBR B;  1O7I A;  5EKK A;  2A73 B;  3HOY B;  1F9S A;  2Z4H A;  2JA7 H;  5LMN W;  3H0G B;  1DON A;  4TVA B;  3UDX A;  1D5X C;  2L4N A;  1UEB A;  5TSS A;  2NUC A;  4C3H G;  4CHT B;  1GXD C;  1RHP A;  1STG A;  1U4P A;  4EQO A;  1XWE A;  5EGT A;  3FPP A;  2E2I H;  3H15 A;  1VQA A;  3F2B A;  3BDC A;  4X66 Q;  3A8K E;  4OO1 G;  5A2Q E;  3E5S A;  4AQY Q;  2M9V A;  4P75 A;  2KCM A;  1G6Z A;  3Q22 A;  2KQ3 A;  4KHZ A;  3A8I E;  1PYB A;  4PZ8 A;  3ND8 A;  4LJZ C;  2KHJ A;  2WKD A;  2WV6 D;  1PZJ D;  1STY A;  1X56 A;  1UWV A;  4GN5 A;  4B3R Q;  1B9N A;  4KY5 A;  1SYE A;  2L9H A;  4FNF A;  2Z8L A;  3GP7 A;  1JOO A;  1NSN S;  2I5L X;  3I2Z A;  2MPM A;  5C4Z A;  1ROD A;  2K05 A;  2R7D A;  1KXL A;  1RIP A;  1VQI A;  2UUB Q;  2DY8 A;  3A55 A;  4KN7 C;  1HPC A;  3GTM H;  1KL9 A;  2OTL A;  2ATW A;  3PSI A;  5M3F G;  1H9S B;  3PUV A;  4KJN A;  2H1E A;  3UDF A;  5BN4 A;  5EBD A;  2XRS D;  4JV5 Q;  4L5T A;  4CJ0 B;  5CMD A;  3CC7 A;  4LF7 Q;  4PQX A;  2Z6B A;  3SK6 A;  2VUM H;  4DNR B;  3HOU H;  1F9Q A;  4A3L G;  4FO2 A;  1S3O A;  1LUZ A;  4X64 L;  2XWB B;  4B3R L;  3J80 L;  1IYV A;  4TKO B;  3VR2 A;  4C2M B;  1O7L A;  2N55 A;  2EYP A;  4J15 A;  2J0T D;  4LF8 Q;  2MQH A;  1GHJ A;  2BH2 A;  1M8A A;  4IUV A;  2UUB L;  1D8L A;  1PYS B;  1NNX A;  4UAI A;  3TP8 A;  1F2L A;  1K83 B;  3G7L A;  5E1F A;  1KDA A;  2O4X A;  3N6R A;  4FF2 A;  2SEB D;  4OXP A;  2FIN B;  4AIM A;  3J81 c;  4H44 C;  2K33 A;  2ASB A;  3I4N H;  3I4M B;  4RCN A;  4JV5 L;  2YTV A;  4R8N A;  3FMC A;  2K28 A;  4LF7 L;  1YVC A;  1GJX A;  4ZRZ A;  3ULP A;  4QF4 A;  4DV6 L;  4DR1 Q;  2NVT B;  5IWA Q;  2NN6 H;  3M85 A;  1FR3 A;  4DV5 L;  1PH6 A;  1N9W A;  2CHB D;  1HNZ L;  2PZW A;  1KQS A;  2EY1 A;  2B8F A;  3PIP A;  3QR8 A;  2DJF C;  4LFA L;  2A68 C;  1D6E C;  4GNX B;  2HCC A;  1F2Z A;  2Z0S A;  1JE5 A;  2XTI A;  4JCV E;  1PH7 A;  5L37 A;  4KHV A;  3HGB A;  2IX0 A;  1EYC A;  1VMC A;  2UXB Q;  4RA8 A;  4DR1 L;  1CT1 D;  3M4Q A;  4OIK A;  3PO2 H;  4JI1 Q;  1PV4 A;  5IOD A;  1NMG A;  3TS2 A;  1JOK A;  2YV5 A;  2HQL A;  3J7A 5;  2MUY A;  1BUV T;  4KMU C;  4LF4 Q;  1CHQ D;  3RUZ A;  4OHJ A;  4DXG A;  1SNM A;  1XMO Q;  2OT2 A;  3H3V H;  3N52 A;  1H9S A;  1E2W A;  2OWO A;  4DV3 L;  1LTT D;  5FLM G;  4BY1 H;  2RA4 A;  4KD4 A;  2NZ1 D;  3PUW A;  1MI2 A;  4OL7 A;  4ILW A;  3HOW B;  2JQO A;  3D4D A;  4O1N A;  4X65 L;  2UXB L;  2IX3 A;  1BVS A;  4KI0 A;  2YTY A;  2A69 D;  1A15 A;  2HIV A;  4ZUI A;  3A7L A;  4JI1 L;  1J6Q A;  4DK1 A;  5FO7 B;  3D31 A;  3MA2 B;  1G29 1;  5AJ3 Q;  4KY6 A;  4EQP A;  4DR2 L;  1B9M A;  2EYJ A;  5LL6 X;  1LTI D;  3I4N G;  1RJT A;  1SJH D;  2G9H D;  4HCS A;  3AFQ A;  5LMU Q;  1ET9 A;  1KRT A;  1XMO L;  4AH6 A;  1M4V A;  4XQQ A;  4DR7 L;  3Q8D A;  1KDC A;  1XXG A;  4P2C B;  1EFW A;  1UUP A;  1STN A;  1TWA B;  2NZO A;  1Z6H A;  4DAY B;  1VQM A;  1NY4 A;  1XTC D;  4DV0 Q;  1CSP A;  2I46 A;  1U5K A;  5G3L D;  4A3E H;  3CF5 A;  1QOH A;  4TSS A;  2L12 A;  3J7Y W;  2Z6K C;  2RBM A;  4AYB E;  2OTJ A;  3U58 A;  1ENA A;  5AJ3 L;  4DA2 A;  4G4K A;  4A3B H;  4L6T B;  2AUK A;  3SK8 A;  3CXC A;  1JC7 A;  3AQQ A;  4L5R C;  4IUR A;  5G3L F;  1WI5 A;  4GNX A;  5LMU L;  2N8N A;  3AB9 A;  5M3M H;  1G8Z D;  3K80 C;  3MWY W;  2NN6 I;  1PVO A;  1F9R A;  1XPR A;  1TWG H;  3WOF A;  3JAM L;  1A3V A;  1HA6 A;  1Q90 A;  2HIX A;  3DMU A;  3RLF A;  4C3J G;  2F0G A;  2N3S A;  1JMC A;  4L5S A;  3I7F A;  4UHV A;  2KED A;  4R4I A;  2I0Q A;  4JI0 L;  3QOL A;  1CTM A;  1LYL A;  3TQY A;  1D5M C;  4NB3 A;  5ELF A;  2SDF A;  5C5M A;  5ELB A;  4B08 A;  4ALP A;  1HQR D;  3OIQ A;  3X3N A;  4MTK A;  2WB1 G;  2D0P A;  2JA5 H;  1IZ6 A;  3QB3 A;  1R9T B;  1PH5 A;  1Y8P B;  1BQQ T;  2K6A A;  1JT8 A;  4M1U B;  2F4I A;  1PRT C;  3K8A A;  4K6L A;  1NMF A;  3EQL C;  3FP9 A;  3H09 A;  5DAU A;  1OXX K;  1LT5 D;  2LXJ A;  4A76 A;  1SRU A;  5H1S E;  1WTV A;  2UXC Q;  3OWE B;  1WD0 A;  4RCO A;  5C4J B;  2EJG C;  4KN4 C;  2WAC A;  1KRS A;  1LTL A;  3CMA A;  3E0E A;  1YZ6 A;  1QUQ B;  1AFP A;  3NTK A;  3KYH C;  3MVV A;  3NQT A;  1IHZ A;  3CCM A;  2AUJ D;  5C4X G;  5JPN C;  1PA6 A;  1VS0 A;  1XPU A;  3NP8 A;  2X69 A;  4OGQ C;  3SK5 A;  4R8I A;  2A6E D;  4LMQ D;  4KV6 A;  1NE3 A;  4RG1 A;  4DAY A;  1HUN A;  4C3H B;  4H0L C;  4GKJ L;  2LS0 1;  2RDF A;  1IBM Q;  2NVX H;  1ZYR D;  4RH6 A;  2FJ2 A;  4UDU C;  3PCO B;  4H7B A;  1IXR A;  1AE3 A;  2E2H B;  1ICW A;  1Y1W G;  3PGZ A;  2XGT A;  2B2W A;  3UE1 A;  1ZXT A;  4ZYS A;  4K6D A;  1KTK A;  1I4G A;  2WII B;  1JE4 A;  3G6E A;  1VQF A;  4EVO A;  1XNR L;  3S15 H;  3OOC A;  4CKB A;  5JJZ A;  4CKC A;  4F88 A;  3PO3 G;  1IL2 A;  1RCV D;  3NEL A;  5JEA H;  3FKI H;  1VQD A;  3K7U C;  2OCE A;  3NEM A;  3KLR A;  2MNA A;  4F7X A;  1HZA A;  4WJW A;  3VYT A;  4OWX B;  3VDY A;  2B2T A;  3WWV A;  1IBM L;  4ZQ3 A;  1GUO A;  3NPP A;  1LTS D;  3K81 C;  1B8A A;  4DR3 Q;  3OWF A;  2ZT9 C;  4K2K A;  1GD7 A;  4S3S A;  5M3F B;  2F0V A;  1EUJ A;  5M5W H;  5IGF A;  4ODG A;  3I4O A;  2QF7 A;  3IL8 A;  2B8G A;  5FLX E;  5D3D A;  1FYC A;  5CV7 A;  3Q24 A;  1PTO D;  1TWH H;  4OWT B;  3SEB A;  1WTO A;  3CQZ B;  1Q82 C;  1AEX A;  2B2W C;  4XYO A;  2CW0 D;  1F77 A;  3TME A;  2N88 A;  1TS5 A;  2E2J H;  1DOK A;  2HHH L;  1GHK A;  5IYD G;  2QEJ C;  1TY2 A;  3DEP A;  4DN4 M;  1Y8O B;  1PTO F;  4HTH A;  2PZT A;  3HOX B;  4YY3 Q;  1WCM H;  4IZ8 A;  1I3Q H;  4RHS A;  2M2L A;  5IGC A;  1YHA A;  3BS1 A;  4M8A A;  3E6Z X;  1IKM A;  2UUA L;  1XNQ Q;  4A3I H;  2B2T C;  5ELE A; 
#chains in the Genus database with same CATH homology
 1G2S A;  2NVQ B;  2HQE A;  3S9W A;  4XXE A;  3IAY A;  3Q23 A;  5JEA J;  1U4M A;  3C46 A;  3GTL B;  1STA A;  1PFN A;  5E4W C;  1RF2 D;  5KRU A;  1UAP A;  3NSW A;  1FNV A;  3BVG A;  1YNN D;  3W3A A;  2C9O A;  1TKW B;  3PV0 A;  5ELC A;  3BZD B;  1PMR A;  1PTO H;  4G57 A;  2B2Y C;  4TRD A;  1JOR A;  3T13 A;  4C1N K;  4KTA A;  3PIO 3;  3ERQ A;  3GD7 A;  2R61 A;  4DF7 A;  3IFD A;  3DHQ A;  2SNS A;  3BYT B;  3K5N A;  1I50 B;  5DM7 3;  4QUF A;  3VR3 A;  4B9W A;  5M5X B;  1TII D;  2K03 A;  3S2H B;  1MD2 D;  2EJF C;  5FKA C;  5K36 H;  3M7N A;  2Z1C A;  1H9R A;  5M9O A;  4KKT A;  4KY7 A;  3I8Z A;  2X6L A;  4QUC A;  3MXN A;  1I4P A;  3R3O A;  1TWC B;  1DJR D;  2JEA I;  4FF3 A;  1OXT A;  3PUX A;  2BCO A;  1LT3 D;  3P20 A;  5COR A;  1EEI D;  4FYD A;  4A3M B;  1FD7 D;  4IUT A;  2F0T A;  1SNQ A;  1LTA D;  3S1M B;  5JOB A;  2LKV A;  2Q8R E;  4J8Q A;  1AZQ A;  3MFY A;  2L0C A;  3MXG A;  3OSO A;  3K59 A;  1PFB A;  1NR2 A;  5E3F A;  1JOQ A;  4E6I A;  1GUS A;  2HDM A;  4C3J B;  2BDO A;  1LTG D;  3K0Y A;  2AWO A;  2R3Z A;  5I2Y A;  3KUP A;  2E74 C;  1T5X D;  3ND9 A;  5FO8 B;  5CV6 A;  4OIJ A;  1HUM A;  1BNZ A;  2WB1 B;  1BCP C;  1CQV A;  1RDP D;  1BDO A;  3BDO A;  3NTI A;  5ISR A;  1S5F D;  1PXU A;  1Z47 A;  2BE5 C;  4NP5 A;  1SEB D;  2EE1 A;  3M4O B;  1ZEQ X;  3S17 B;  5IIF A;  1LAC A;  1JCK B;  4ZUJ A;  4X3U A;  1KNA A;  2JP1 A;  3DXJ C;  4R9W A;  5K5P A;  4HSV A;  3NHH A;  5J39 A;  2E76 C;  3GTK B;  5C4X B;  1HQM C;  3NBI A;  5EKI A;  2FMC A;  5C4H A;  4PMB A;  1JIC A;  5IT9 E;  4Z9C B;  2NWG A;  5EBC A;  2QKI C;  4YIJ A;  2F0E A;  2LFN A;  3SXH A;  1VMP A;  3GTJ B;  1SJE D;  3J81 L;  1Y1W B;  3LWE A;  1E0B A;  1CHP D;  4NW2 A;  5FO9 B;  1KAB A;  4ZLT F;  5D14 A;  3PO3 B;  3HOV B;  4RWS C;  1MSH A;  1Y8N B;  3GTO B;  1JWS D;  1XX8 A;  5A2Q L;  2NVY B;  2NYZ D;  3PUZ A;  2KA7 A;  1BO0 A;  3PMF A;  4KKU A;  4K8J A;  1AP0 A;  2F0N A;  2F0W A;  1ML0 D;  5C6A A;  3BG3 A;  2M00 A;  2MJ8 A;  2JSO A;  2E75 C;  1NUC A;  3Q0A A;  1EY0 A;  3TZD A;  4RGO S;  1RD9 D;  2X6G A;  1LTB D;  1B44 D;  3OMG A;  1EL0 A;  2LMC B;  2TSS A;  4TQU S;  3J80 E;  3I90 A;  1CA6 A;  4WFN 3;  3R93 A;  4DGZ A;  1EY6 A;  1C8C A;  1TQO A;  1RTO A;  3EJI A;  1CQF A;  2K5D A;  3TBI B;  1BR9 A;  3T4A C;  3FVQ A;  1PRT B;  3BDL A;  2RDH A;  1SMY C;  1V8Q A;  3GTP B;  1C4Q A;  1TVX A;  1EYA A;  1SYD A;  1SXT A;  4FXG C;  2A6H C;  4K2L A;  3GQB A;  1IL8 A;  1E2V A;  3H94 A;  5KNC A;  3DEO A;  1SND A;  4FXD A;  2JYO A;  1MBY A;  1AW7 A;  1K8M A;  2F0H A;  3QOJ A;  3O13 A;  2RSN A;  2ICI A;  4DAV A;  2R92 B;  4ULL A;  1B53 A;  3GV6 A;  1Y69 U;  2A68 D;  4C56 C;  1XYI A;  5LL6 S;  3QWN A;  3I73 A;  3WDN A;  2KUM A;  4ABN A;  2PO4 A;  3MTS A;  1Q3L A;  1KAA A;  1S5C D;  4A3F B;  1WTX A;  2G9D A;  4ZK9 B;  5NUC A;  1BXT A;  2NB0 A;  4RGT A;  2VB3 X;  2VB2 X;  1EEF D;  1F2Y A;  2B2V A;  4MIU A;  1W6J A;  2YU9 B;  5CV8 A;  4JK1 C;  1VCI A;  4I7Z C;  3NTH A;  2NN6 G;  1PZI D;  5KEE A;  4ZKB B;  4XT3 B;  2XN9 C;  5CC4 A;  2LY7 A;  2B39 A;  2D5D A;  2XVS A;  5I2X A;  3G6J B;  1ENF A;  2Y0S B;  3NUC A;  5C3W A;  3ITP A;  2KHS A;  3KK7 A;  2J7Z A;  2F3V A;  4NDX A;  3C3L A;  4FVM A;  4IAL A;  4A3G B;  1B2T A;  2KOL A;  1TR5 A;  3FRP B;  4F87 A;  4I65 A;  3T16 A;  3NQI A;  2EY6 A;  1C48 A;  2B2V C;  3JAM E;  3HS0 C;  1G91 A;  5AFW A;  4K8I A;  4DXF A;  2PCF B;  3D3R A;  3K57 A;  1TS2 A;  4FF4 A;  4WOR A;  3V96 A;  4KJO A;  5DEH A;  3SE0 A;  1QWY A;  1TT2 A;  3P75 A;  5C0X H;  1LLR D;  3LX0 A;  5J22 A;  4CJ1 B;  3IKJ A;  2QIL A;  3TN2 A;  3GTQ B;  3L9A X;  2RKS A;  2K04 A;  2QDB A;  1QNU A;  4XIG S;  3RZO B;  1HTP A;  5KIX A;  3K5L A;  3U9O A;  2PMZ B;  1PRT D;  1CZG A;  1WD1 A;  2KCN A;  3EVQ A;  4U67 3;  1O78 A;  5CV5 A;  2VXW A;  1HCZ A;  3OMC A;  1YNJ C;  5M5Y B;  1WTR A;  1B50 A;  3S1R B;  4J1M A;  3T53 B;  3M3Y B;  1J9O A;  1FNU A;  4DFA A;  4A3D B;  4EGV A;  2L5T A;  3TP6 A;  5CV9 A;  3CU7 A;  1QB5 D;  3ERO A;  2KCC A;  1IW7 C;  3QIA A;  2BOS A;  1SDF A;  1SNO A;  3MFG A;  4N9T A;  1EY4 A;  2EYM A;  2XIW A;  1A6X A;  1L0X B;  5I4D A;  2R93 B;  1S5B D;  5C3E B;  3KLS X;  1UNS A;  2K7V A;  2A5H A;  3OHX C;  1HHV A;  3VYR A;  3V05 A;  1D1K A;  4G7H C;  1FNW A;  2F0L A;  4K5X A;  4X3K A;  2JA7 B;  2B2Y A;  5HUR A;  2EJM A;  1STE A;  1A3U A;  5C0X I;  1F2M A;  4HN7 A;  1X32 A;  2ZXR A;  1SSO A;  2E2I B;  1NCV A;  4G7Z C;  1BCP B;  1B3A A;  4PMC A;  2OEO A;  2BDN A;  1HFN A;  1R4P B;  4IFD H;  3LWU A;  4K14 A;  2VNU D;  3MHB A;  1CM9 A;  4MHE A;  5JEA G;  4IUN A;  4ID6 A;  4BA1 I;  2IT1 A;  2MHV A;  1I4H A;  4NKL A;  1LAB A;  4HED A;  2HCI A;  3V2T A;  4IN3 A;  2L55 A;  3GTM B;  2NBF A;  1U9R A;  1HXY D;  1X3P A;  2D9U A;  3D8G A;  3X3M A;  4DK0 A;  1Q8I A;  2EYL A;  1OXU A;  3C1F A;  1EQV A;  3BVZ A;  1VF5 C;  2VUM B;  3HOU B;  2E2D C;  1O80 A;  1TS4 A;  3K5O A;  1U4R A;  3A8J E;  4XYQ A;  1FGB D;  2IL8 A;  4K5W A;  1Q1E A;  1AN8 A;  4CKE A;  1KLG D;  1TY0 A;  2L11 A;  3I4N B;  2AWN A;  1JWM D;  3MAQ A;  2IPK D;  4FP5 D;  4QCL A;  1ZKO A;  1ILP A;  3KF8 A;  2V4D A;  1L0Y B;  3CRL C;  2KJX A;  1ONL A;  2EXZ A;  4V0B A;  1SNC A;  3MZ5 A;  1WTP A;  1DCZ A;  3PO2 B;  3NBH A;  1D1I A;  2F0S A;  4IFD I;  1TU2 B;  1CFM A;  5KYI A;  1I6V C;  1ESR A;  5E4X A;  1PFM A;  1II3 A;  4BY1 B;  1AZP A;  5IOC A;  2PYK A;  5K36 G;  2AQ1 B;  3T56 B;  5EQ0 A;  1QJO A;  3QG1 A;  3CHB D;  2ICE C;  2KEC A;  5FK9 C;  4B9X A;  4RGM A;  3SK4 A;  4GZY C;  5I9O A;  3PIP 3;  2F0P A;  1JB3 A;  2HDL A;  4OO1 H;  5CV4 A;  4X3S A;  1IYU A;  2HUG A;  1EY7 A;  1G2T A;  3HKZ B;  5JPM C;  4F8M A;  3Q6S A;  4XT1 B;  1Q1B A;  4LAA A;  4ZAI A;  2JE6 I;  3RD4 A;  1BCP D;  4HAE A;  1B1Z A;  1SYB A;  3AMU A;  1D5Z C;  4A3E B;  1GOZ A;  1QCB D;  1STB A;  2EY2 A;  2BE5 D;  2O2L D;  4A3B B;  1EWH A;  3SHL A;  3TSS A;  3OIP A;  4V19 0;  1E2Z A;  5T1G A;  2PZU A;  5M3M B;  4Q0F A;  2PW5 A;  3ZYY X;  1TWG B;  1EZ8 A;  1I4Q A;  3MEH A;  4BA2 I;  3J81 E;  2F0M A;  3SR1 A;  4FXK C;  1F9P A;  4KKS A;  3W2D A;  4WRD A;  3K6O A;  2DNE A;  4KD3 A;  2JA5 B;  1I4X A;  1HFG A;  1EU3 A;  2RVL A;  1QE6 A;  2K1B A;  2B2U A;  3NE5 B;  1ILQ A;  3P7J A;  2K5W A;  2H4O A;  2A74 C;  4O42 A;  4X3T A;  1CI3 M;  3I70 A;  4QB4 A;  3ONA B;  1DYQ A;  1GUW A;  4OO1 I;  1QNK A;  3FEW X;  5D65 A;  5I6Y A;  1CA5 A;  2RSO A;  1SBB B;  1EIG A;  1MSG A;  2F0Q A;  2F0J A;  3D4W A;  2NVX B;  3H3V C;  1DM0 B;  4IUU A;  2PPB C;  3D6C A;  1U4L A;  2B2U C;  5C3X A;  1I4R A;  2K01 A;  3HG9 A;  3S15 B;  5CBA E;  5D3I B;  4L8J A;  1Z7T A;  1MGS A;  1KDB A;  4H13 C;  1B4O A;  2Z4I A;  3R2T A;  3FKI B;  1EOT A;  2RQX A;  2MP1 A;  4NMZ A;  5C5L A;  1GUT A;  3AU7 A;  1SYC A;  2TMP A;  5EJW A;  1IKL A;  1W6K A;  4HMJ A;  2MGS A;  2NTT A;  3VA7 A;  1SE4 A;  5M5W B;  1OO9 B;  1SMY D;  2EYO A;  4FF1 A;  2XWJ B;  1TWH B;  1V43 A;  3C2P A;  3K58 A;  2A6H D;  2IJ0 A;  3FPU B;  1GUN A;  2E2J B;  4DU9 A;  2ZXP A;  4CGY B;  4QMG A;  1V1P B;  5JAV A;  3R8B A;  2EPB A;  1WCM B;  2FFK B;  1I3Q B;  4IUQ A;  1S5D D;  2NTS A;  2A69 C;  2O5J C;  4A3I B;  2BA0 A;  3J7A F;  1EYD A;  3GV3 A;  2KVM A;  1TS3 A;  3SDZ A;  3M7G A;  2EYF A;  2ID0 A;  1VDZ A;  3KLS A;  3S1N B;  1WTW A;  4RKL A;  3U9S A;  2DY7 A;  1PTO B;  5IGE A;  1BBX C;  1SYF A;  3UI2 A;  3K7A B;  1O7Y A;  4CJ2 C;  1EQT A;  3HOZ B;  4Y7N B;  4C3I G;  4BS9 A;  5KGU A;  4BY7 B;  3VR5 A;  3CRK C;  5C44 B;  2WP8 J;  5HGT A;  1EY9 A;  2F0D A;  2IX1 A;  1PYW D;  2BA1 A;  4HMI A;  4A93 B;  1H9J A;  1BF4 A;  1EY8 A;  2WIN B;  3TZU A;  1NR4 A;  2OXP A;  3VA5 A;  3URY A;  1QIL A;  3GTG B;  1V1P A;  3GO5 A;  3LNN A;  2EZV A;  2FMM A;  4XQJ A;  2JXM B;  2Q8T A;  1TWF B;  2PNR C;  4DAP A;  1SFO B;  1BOS A;  5COY A;  1K8O A;  4KK7 A;  1PDQ A;  4BWG B;  1Q12 A;  2XSC A;  3QO2 A;  2A6E C;  2JA6 B;  3DWA A;  1X3Q A;  5F2D A;  1D2B A;  1I6H B;  2ZXO A;  5CR3 A;  4L63 B;  3TP5 A;  3D4R A;  4J6H A;  2R7Z B;  5KYL A;  1S4Z A;  1ZYR C;  3KBG A;  1RTN A;  1PRT F;  4A3K B;  1LO5 D;  3D6W A;  2F0I A;  2R6G A;  5KND A;  3I91 A;  3L3O C;  1EWC A;  3E0J A;  4XDX A;  5EKL A;  1DOM A;  2F3W A;  2EDG A;  5IGD A;  3QJY A;  3VYU A;  3NWS A;  1ENC A;  3NK9 A;  1LV9 A;  5CYU A;  1YNJ D;  3I3C A;  3TDQ A;  3VR6 A;  4JBW A;  1KLU D;  3WOE A;  3MXP A;  5C0X J;  2PW7 A;  3PUY A;  1LT6 D;  1RKN A;  2SOB A;  1DD2 A;  1IW7 D;  2I07 B;  2EOT A;  3EA6 A;  2F0F A;  5C0X G;  4N9P A;  2QCP X;  2EVB A;  3I4L A;  3A56 A;  3A7A B;  2D2C C;  1PTO C;  4ZKC B;  1QG7 A;  2D62 A;  2IWH A;  2JA8 B;  2F03 A;  5KNB A;  2CW0 C;  3MXU A;  2XNA C;  3KBX A;  3DWP A;  5FLX L;  2JEB I;  3L7Z C;  3H91 A;  4HR7 B;  1HA5 A;  3SVM A;  3P1H A;  4RFB A;  2GA4 B;  3BVM A;  3DWQ A;  5IGB A;  5I9P A;  5IGG A;  1ESF A;  1V1O A;  3OPO A;  4RKB A;  1S5E D;  5J1Z A;  5EPL A;  1SAP A;  1DOL A;  2FHT A;  4HSP A;  4CBV A;  4PV1 C;  3NXW A;  2WAQ B;  1YNN C;  2L1B A;  4PMW A;  5BN3 A;  2CVR A;  4EQN A;  3K5M A;  4PNY A;  1HTL D;  2J4X A;  1LTR D;  1A2T A;  2WKC A;  3F2U A;  3A54 A;  3S16 B;  1A2U A;  1NAP A;  4XQN A;  2SNM A;  5FOB B;  1GUG A;  4C1N I;  3VYS A;  1EY5 A;  5CBE E;  4RAU C;  2IW3 A;  3C1E A;  4A3J B;  2XRQ D;  5A35 A;  5EPJ A;  1UEA B;  1VF7 A;  3HZX A;  1SNP A;  1LT4 D;  1H9K A;  5BN5 A;  5CGK A;  2DN8 A;  1A3T A;  1JR0 D;  4QIW B;  3MC0 B;  4IUP A;  4IQZ A;  3I72 A;  5JVH 3;  1WTQ A;  4IFD J;  4MN3 A;  4BBS B;  1OXV A;  1R4Q B;  1H9M A;  4G7O C;  3TP7 A;  1J8I A;  4AYB B;  3EFX D;  2F0O A;  2CQA A;  2F0U A;  4IFD G;  3HRZ C;  3S1Q B;  5JVG 3;  1JWU D;  1PZK D;  4Q5V A;  2PQE A;  1WVL A;  2ENB A;  3NWT A;  4DNT B;  1SE3 A;  1EZ6 A;  5T1I A;  5EPK A;  3S2D B;  4C3I B;  4XTC S;  3OW7 A;  3RMH A;  1O7Z A;  3VR4 A;  1OXS C;  1DXM A;  2K32 A;  2Q8I B;  2F0K A;  1EIH A;  4LK1 C;  4K5V A;  1EU4 A;  3CKI B;  1HRJ A;  2YYZ A;  3BYY B;  1CZW A;  3IFT A;  4ME5 A;  5LHY 1;  3HEJ A;  3T51 B;  2F1M A;  1SE2 A;  2EYH A;  2EY5 A;  2OF1 A;  1CK1 A;  1STH A;  3DUZ A;  1JQY D;  4U68 A;  2AQ2 B;  5DNF A;  2DNC A;  1SYG A;  3FDT A;  3S14 B;  4RHR A;  1Y1V B;  3R2I A;  3J7A V;  1ET6 A;  3M4Y A;  4RGN A;  3RZD B;  2B63 B;  2RDG A;  3H6M A;  2C5C A;  4HCE A;  1BCP F;  2O5I C;  1PLF A;  5ELD A;  2KEE A;  5DM6 3;  1T5E A;  1DZ1 A;  3DM1 A;  2K5Q A;  5IT9 L;  2AQ3 B;  3HP3 A;  1KNE A;  5I6W A;  1EFI D;  4BBR B;  5EKK A;  2A73 B;  3HOY B;  1F9S A;  2Z4H A;  3H0G B;  1DON A;  1D5X C;  2L4N A;  5TSS A;  2NUC A;  4C3H G;  4CHT B;  1GXD C;  1RHP A;  1STG A;  1U4P A;  4EQO A;  1XWE A;  5EGT A;  3FPP A;  3BDC A;  3A8K E;  4OO1 G;  5A2Q E;  3E5S A;  2M9V A;  1G6Z A;  3Q22 A;  2KQ3 A;  4KHZ A;  3A8I E;  3ND8 A;  4LJZ C;  2WKD A;  2WV6 D;  1STY A;  1PZJ D;  1B9N A;  4KY5 A;  1SYE A;  2L9H A;  4FNF A;  2Z8L A;  3GP7 A;  1JOO A;  1NSN S;  2MPM A;  5C4Z A;  1ROD A;  2K05 A;  2DY8 A;  3A55 A;  4KN7 C;  1HPC A;  1H9S B;  3PUV A;  4KJN A;  2H1E A;  5BN4 A;  5EBD A;  2XRS D;  4CJ0 B;  5CMD A;  4PQX A;  3SK6 A;  4DNR B;  1F9Q A;  4FO2 A;  2XWB B;  3J80 L;  1IYV A;  4TKO B;  3VR2 A;  4C2M B;  1O7L A;  2N55 A;  2EYP A;  2J0T D;  1GHJ A;  1M8A A;  4IUV A;  4UAI A;  3TP8 A;  1F2L A;  1K83 B;  3G7L A;  5E1F A;  1KDA A;  2O4X A;  3N6R A;  4FF2 A;  2SEB D;  2FIN B;  3I4M B;  4H44 C;  2K33 A;  4RCN A;  4R8N A;  3FMC A;  2K28 A;  1GJX A;  4ZRZ A;  4QF4 A;  2NVT B;  2NN6 H;  3M85 A;  1FR3 A;  2CHB D;  2PZW A;  2EY1 A;  2B8F A;  2A68 C;  1D6E C;  2HCC A;  1F2Z A;  4KHV A;  3HGB A;  2IX0 A;  1EYC A;  1VMC A;  4RA8 A;  1CT1 D;  4OIK A;  5IOD A;  1JOK A;  2MUY A;  1BUV T;  4KMU C;  1CHQ D;  3RUZ A;  4OHJ A;  4DXG A;  1SNM A;  2OT2 A;  3N52 A;  1H9S A;  1E2W A;  2B2T C;  1LTT D;  2RA4 A;  4KD4 A;  2NZ1 D;  3PUW A;  1MI2 A;  4OL7 A;  4ILW A;  3HOW B;  3D4D A;  4O1N A;  2IX3 A;  4KI0 A;  2A69 D;  1A15 A;  4ZUI A;  3A7L A;  4DK1 A;  5FO7 B;  3D31 A;  3MA2 B;  1G29 1;  4KY6 A;  4EQP A;  1B9M A;  2EYJ A;  5LL6 X;  1LTI D;  1RJT A;  1SJH D;  2G9H D;  4HCS A;  1ET9 A;  1M4V A;  4XQQ A;  1KDC A;  1XXG A;  4P2C B;  1UUP A;  1STN A;  1TWA B;  1Z6H A;  1XTC D;  2I46 A;  5G3L D;  1QOH A;  4TSS A;  2L12 A;  3J7Y W;  2RBM A;  1ENA A;  4G4K A;  4L6T B;  2AUK A;  3SK8 A;  1JC7 A;  4IUR A;  5G3L F;  3AB9 A;  1G8Z D;  3MWY W;  2NN6 I;  1F9R A;  3WOF A;  3JAM L;  1A3V A;  1HA6 A;  1Q90 A;  3DMU A;  3RLF A;  4C3J G;  2F0G A;  2KED A;  3QOL A;  1CTM A;  1D5M C;  5ELF A;  2SDF A;  5C5M A;  5ELB A;  4B08 A;  1HQR D;  3OIQ A;  3X3N A;  3QB3 A;  1R9T B;  1Y8P B;  1BQQ T;  2K6A A;  4M1U B;  2F4I A;  1PRT C;  4K6L A;  3EQL C;  5DAU A;  3H09 A;  1OXX K;  1LT5 D;  1WTV A;  3OWE B;  1WD0 A;  4RCO A;  5C4J B;  2EJG C;  4KN4 C;  2WAC A;  1AFP A;  3NTK A;  3MVV A;  3NQT A;  1IHZ A;  2AUJ D;  5JPN C;  3NP8 A;  2X69 A;  4OGQ C;  3SK5 A;  4R8I A;  2A6E D;  4LMQ D;  4KV6 A;  4DAY A;  1HUN A;  4C3H B;  4H0L C;  2LS0 1;  2RDF A;  1ZYR D;  4RH6 A;  2FJ2 A;  4UDU C;  4H7B A;  2E2H B;  1ICW A;  2B2W A;  1ZXT A;  4ZYS A;  4K6D A;  1KTK A;  1I4G A;  2WII B;  1JE4 A;  4EVO A;  3OOC A;  4CKB A;  5JJZ A;  4CKC A;  4F88 A;  1RCV D;  5JEA H;  3KLR A;  4F7X A;  4WJW A;  3VYT A;  2B2T A;  4ZQ3 A;  1GUO A;  3NPP A;  1LTS D;  3OWF A;  2ZT9 C;  4K2K A;  4S3S A;  5M3F B;  2F0V A;  5IGF A;  4ODG A;  2QF7 A;  5FLX E;  2B8G A;  3IL8 A;  5D3D A;  1FYC A;  5CV7 A;  3Q24 A;  1PTO D;  3SEB A;  1WTO A;  3CQZ B;  1AEX A;  2B2W C;  4XYO A;  2CW0 D;  1F77 A;  3TME A;  2N88 A;  1TS5 A;  1DOK A;  1GHK A;  2QEJ C;  1TY2 A;  3DEP A;  4DN4 M;  1Y8O B;  1PTO F;  4HTH A;  2PZT A;  3HOX B;  4IZ8 A;  4RHS A;  2M2L A;  5IGC A;  3BS1 A;  4M8A A;  3E6Z X;  1IKM A;  4DA2 A;  5ELE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...