2KVMA

Solution structure of the cbx7 chromodomain in complex with a h3k27me2 peptide
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
71
structure length
71
Chain Sequence
MELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEERDRASGYRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular interplay of the noncoding RNA ANRIL and methylated histone H3 lysine 27 by polycomb CBX7 in transcriptional silencing of INK4a.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
molecule keywords Chromobox protein homolog 7
total genus 11
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2010-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2kvmA00
2M2LA 2K05A 1M8AA 5E4WC 3R93A 2X69A 3GV3A 2X6LA 1NR2A 4NW2A 5EPLA 2K28A 5CBEE 4ZK9B 4ZAIA 1B3AA 1JE4A 2EOTA 4OIKA 4X3UA 5CBAE 4HAEA 5EPJA 2EPBA 2MPMA 1B50A 1ML0D 4X3SA 1F9RA 3N52A 2FHTA 2HDMA 2B2VA 2RA4A 4LMQD 4ZKBB 1J8IA 4IUVA 5T1IA 4CJ0B 4ZKCB 2B2UC 1PDQA 3I3CA 1X3PA 2RSNA 3IL8A 5JJZA 2RVLA 3GV6A 2NZ1D 2KEEA 1WVLA 1ILQA 1HHVA 2JP1A 1NCVA 1Q3LA 4IUPA 1B53A 2B2WC 2Q8RE 1BF4A 1MGSA 1DOLA 1HUMA 1IL8A 1O80A 3DEPA 3LWEA 4RWSC 2CVRA 2HCIA 2IL8A 3Q6SA 2FMMA 5CORA 5T1GA 1DZ1A 4R9WA 1DOKA 2B2WA 1EQTA 2B2TA 4CJ1B 1DONA 1NAPA 2NYZD 4CJ2C 2FFKB 1J9OA 1G2SA 1E0BA 2B2TC 1WTWA 2X6GA 4RAUC 4XT3B 1AZQA 1CA6A 3F2UA 3KBXA 4DN4M 1G91A 2K1BA 1JICA 1QG7A 2RSOA 2H1EA 2B2VC 4OIJA 1EIGA 1EOTA 1MI2A 2KOLA 2JYOA 1SSOA 2L12A 2N88A 1BO0A 2MGSA 3I90A 1MSHA 4QUCA 3TN2A 5EKIA 1TVXA 3UI2A 1BNZA 2K01A 1A15A 1QE6A 1LV9A 2L4NA 4X3TA 3D6WA 4IURA 1VMPA 3H91A 1X32A 1ZXTA 5AFWA 5COYA 2MJ8A 1X3QA 1U4RA 2KEDA 1RODA 4HSVA 1C8CA 2VXWA 1F9PA 1O7YA 3IFDA 3ONAB 1U4PA 1PFNA 3I91A 3QO2A 1WTOA 1RTOA 2L1BA 1WTVA 1ILPA 3DEOA 1NR4A 1AP0A 1HA6A 2Q8TA 2FINB 1G6ZA 1EL0A 4R8IA 2K03A 1WTRA 1WD1A 1AZPA 1RTNA 4X3KA 4QUFA 4MN3A 1SDFA 1MSGA 1HFNA 1SAPA 4O42A 1B4OA 1HFGA 1XYIA 1U4MA 1GUWA 2MP1A 2B2UA 2HDLA 1F9QA 1F9SA 5E4XA 4U68A 1WTQA 1HRJA 4HEDA 1HUNA 1O7ZA 1F2LA 3I8ZA 4HCSA 4MHEA 4IUUA 4IUTA 1ESRA 5EPKA 4ZLTF 1BBXC 1DOMA 2KUMA 1VMCA 1XX8A 1PFBA 2HCCA 3G7LA 2J7ZA 5D14A 5D65A 2KVMA 1G2TA 3SVMA 2R3ZA 2KECA 2FJ2A 3P7JA 1S4ZA 1B2TA 1KNEA 2BDNA 1EIHA 3TZDA 2B2YA 2EE1A 4UAIA 1RHPA 3KUPA 2XIWA 3DM1A 3FPUB 1WD0A 1U4LA 5EQ0A 2B2YC 4XT1B 2HUGA 1ICWA 4RA8A 1IKMA 5EJWA 1WTPA 4IUQA 2NWGA 3MWYW 5CMDA 2L9HA 2SDFA 1PLFA 1RJTA 2DY8A 2L11A 3MTSA 1CA5A 3FDTA 5DNFA 2N55A 2K04A 2D9UA 1PFMA 2DY7A 1WTXA 1IKLA 4XDXA 1CM9A 3HP3A 1KNAA 1QNKA
chains in the Genus database with same CATH superfamily
1B1ZA 2F0UA 4OEMB 5EPLA 2JJQA 4B3RQ 3M9BA 4ZK9B 4A75A 4DR1L 1IYUA 5FKAC 1CI3M 2K5DA 5LL6X 3ULJA 2CFMA 4IPCA 1LACA 2MNAA 4CJ0B 1UE6A 4ZKCB 2DUDA 4JV5L 1SNOA 1T5XD 3FKIG 1WVLA 5CV4A 1E1TA 4EX5A 2OWOA 4QB4A 2EDGA 2R7ZB 1Q8KA 1B9NA 4GOPB 4F7XA 3HKZE 4GKKQ 2LXJA 3HOUG 4DAVA 1R9TH 5FO7B 3CCQA 3TEHB 1EFWA 4AYBB 1VQ7A 1JWMD 4CJ2C 4K8IA 2AQ2B 2B2TC 3HFZB 2F0MA 2PQAB 3I72A 1GUNA 2JA5B 1HXYD 2XSCA 4OELB 3ND8A 5EKKA 3T56B 4AIMA 1IXRA 1D6EC 1BCPB 2JYOA 3TN2A 2N88A 5IP9G 1VS0A 3E9IA 1BNZA 1IHZA 4IQZA 3D4RA 2DNCA 1RF2D 1YNND 1FVIA 1PH5A 3J80E 4LF8Q 1SMYD 1LYLA 4K5VA 1ET9A 1HNZQ 3S17B 1VQ9A 1WD1A 2R93B 4X3KA 4A3LH 2JA8G 4LF5L 3PIO3 5I2YA 5IYDG 1PXUA 1K8OA 4R4QA 2N49A 1JMCA 3S1RH 3WDNA 2BA0A 3GTKB 4J1MA 1IBKL 2EYHA 4DV1L 1PTOH 3CCMA 5D14A 4DR5Q 5M5WH 1G2TA 2YTVA 3A74A 2QKIC 2HD3A 1W3SA 2R3ZA 1PYBA 2FJ2A 3H0GG 3T16A 2QDLA 2QILA 1BDOA 2B3GA 2PI2E 3T1HL 3CCEA 2Z6BA 4ZUIA 4LF6L 1GHKA 1SJED 5C44B 5NUCA 1VQCA 4K5WA 1M90C 1YEZA 4RGTA 5DNFA 2GVBA 4FVMA 1SJHD 4GKJL 1PFMA 1S3OA 5LL6S 1VQHA 1QNKA 1Q82C 2RDHA 5IWAL 4L5TA 2G9DA 5IYCH 4KKTA 4JI5Q 1A0IA 2Z4IA 3O13A 3H09A 5JEAH 3OMGA 2A73B 3MEHA 4DV4L 4WJ3M 1ML0D 1F9RA 3H0GB 3FKIB 4YWKA 4POGA 4QMGA 2XWJB 4JPBW 1TS2A 2RSNA 2LSSA 3OSOA 1GUTA 4DK0A 1FGUA 1IZ6A 1N36Q 1LTBD 2IW3A 3RZDB 3LWEA 1A3TA 1HZCA 3SGIA 5CORA 1BXTA 3NUCA 2K4KA 4HMJA 3VYRA 2L15A 1NSNS 2F1MA 5AJ3L 2O5IC 4HIOA 1J9OA 2WP8J 2VB2X 1YVCA 2M00A 2R61A 3I4MG 5IP7H 2PYKA 4X66Q 1EEID 3KOJA 5GAEC 5JAVA 2E2DC 4QIWE 3VR4A 4Y52H 1S5CD 1ZEQX 2NVYB 3UDXA 3R3OA 1NMGA 4C2MB 1SXTA 3EVQA 2ES2A 4KMUC 1DD2A 2JA9A 1SFOH 5M3MG 1CK1A 4BBSB 4H13C 4X62L 1O78A 2H4OA 3K8AA 3H3VH 3PV0A 3SHLA 3A56A 3JC66 4POFA 2RKSA 4RGOS 5GAHC 3U50C 2JXMB 1XPRA 2B39A 1E7ZA 2YTYA 5J1ZA 1PZJD 2E2JH 2NVQH 5E7NA 4I65A 4PQXA 3GTPB 4S3SA 3NWTA 4DKAC 3BU2A 2EXZA 2Z8LA 5EPKA 1A2TA 4FDBA 1WTHA 4F88A 5DM73 4X64L 4JBKA 4GKKL 1FJGQ 4G7ZC 5FLMH 4ZCKA 2PZWA 4WORA 3BS1A 1I3QH 1LTAD 4A3DB 1HNWL 4DR4Q 1EWHA 2LY7A 2I5MX 2UXDL 2F03A 4MTNA 3HOVG 4KKSA 2AWNA 3RN5A 4DK3C 4KN7C 3PO3H 4BXXG 1TWCH 1IKLA 3A7AB 1STAA 5FK9C 2R7DA 1H9KA 2K5WA 5IYBG 3VR6A 4RH6A 4JI0Q 2B8FA 5LMNW 2ZTCA 4KY7A 4NP5A 3K5NA 4BY1B 4UP8A 3S15B 2ICEC 2PW7A 5CV5A 3G71A 4C3IB 1B50A 5DM63 2NVTH 3HOYH 4P75A 3MZ5A 1Q8IA 1TWHB 1HH2P 2J0TD 4N9TA 4CDDC 1X3PA 4DNIA 2EYPA 2EY2A 2NZ1D 4KHPQ 4B3SQ 3S1QH 1WCMH 1SR3A 1AE2A 3RLFA 4GOPC 3HEJA 4GNXA 2E2HB 1SNMA 1ENAA 5LMNQ 2F0NA 1YNJD 4LF4L 1KLGD 4R9WA 1HTLD 5DAUA 5LMUL 4J6HA 3SK8A 2Q2HA 4CHTB 4EQOA 3H15A 4UP9A 5A2QE 2GVAA 5DEHA 5EBCA 1AZQA 4A3KH 4LFBQ 2ID0A 3C1EA 4LF6Q 3SK4A 5C4XG 4Q5VA 1HR0L 2VUMB 4R1JA 3A5ZB 4PV1C 4NXMQ 2I5LX 1SYBA 2K01A 1QE6A 4JBJA 4TVAB 4BY7H 4IURA 2BH2A 1VMPA 5CC4A 1X32A 3HKSA 1ZXTA 1UE7A 2FMCA 2EY6A 3D4WA 5BN3A 3PO2H 4A3JG 4JW0A 4DR1Q 1S5FD 3BVMA 2ASBA 1B44D 4FP5D 2EYOA 2XTIA 1N33Q 2H5XA 2WB1B 5C3XA 1VQAA 3H3VI 4L6TB 2B2UA 4DUZL 3NXWA 5M5XH 3TMEA 2IWHA 5C3EH 3J80c 1TS5A 3CQZB 3J7YW 3MHBA 1G51A 1H95A 5D65A 5IGGA 4AQYQ 3V2TA 1XMQL 4LAAA 4JVZA 5IE8A 3J7AV 5C4XH 3TZDA 3DUZA 2EE1A 1PRTB 3KLRA 3FPUB 3DM1A 1WD0A 2EJFC 2L0CA 1BOSA 3E9HA 1KAWA 2EY1A 2R7ZG 3RLOA 3MXPA 1I94Q 5BR8L 3C3LA 3ICEA 1UWVA 2D9UA 3A0JA 1CM9A 4K6LA 1S5DD 1STYA 3CC4A 1H9RA 3MA2B 3GTOB 1XTCD 1B3AA 1JE4A 5JPMC 2F0PA 1SE2A 3A55A 3E0EA 4QY7A 5I4DA 4DR6Q 3H6MA 4K6DA 2VS1A 3S2DB 1I4PA 1GUGA 2E2IB 2F0TA 3NHHA 3KF8B 5AJ3Q 1NCVA 1Q3LA 1FD7D 3L2PA 5C5MA 1MGSA 2XNAC 1MHWC 2UUAQ 2WACA 3UDIA 1L0YB 4B08A 2P5ZX 4X64Q 3SEBA 2PQEA 2IT1A 1I50B 1SNDA 3HOVH 4QGUA 4L8JA 4WRDA 4P72A 2Y0SB 3T1HQ 2DN8A 1G91A 1PTOC 1VF7A 1KRSA 4JBWA 2O4XA 2VQEQ 5ELBA 3NBHB 1KTKA 4DV7Q 2NZHA 1E22A 2KQ3A 2VL6A 4BA1I 1V1PB 1VF5C 2SNSA 4LFAL 3AMUA 5AFWA 4A3IB 2OTLA 5M5XB 1U4RA 2DJFC 1AE3A 3QO2A 1PFNA 1RTOA 5IGEA 1XJVA 1JORA 4DR7Q 1JWUD 2WB1G 1AH9A 1X54A 3PGZA 4R8IA 3T1YQ 1C4QA 1L1OB 3M4YA 1AN8A 4QUFA 3M4OB 2L5TA 1HFGA 4IZ8A 1L0XB 3M7GA 1QILA 3I73A 1DM0B 3J81i 5E4XA 2AUJD 4B3TL 1D5ZC 2QCPX 5K36G 2WB1E 4HIKA 1DGSA 3MC0B 2NN6H 3S1NH 4A3FG 1PFBA 1HZBA 2Z6KA 1U5KA 1VQFA 4LNQA 2B2YA 2D0PA 4XYQA 4A3BB 1PZKD 1Y1VH 4F87A 3I4MH 3NQIA 4XTCS 1K83H 4RA8A 1IKMA 3MFGA 4JI0L 1X55A 2UXCL 4HIDA 1CQFA 1QZHA 1WCMB 5JVG3 4M8AA 4ME3A 3PIP3 1G291 1W6JA 2CH4A 3GTLH 3W3AA 2X6LA 3CAMA 3CP0A 2K28A 1OXVA 2EYJA 4ZAIA 4C3IH 3S15H 4B3SL 1NNXA 4BY1H 1S5ED 2HT1A 1CHQD 3VR2A 2RF4A 4IUVA 1IW7C 3GTQB 4FF4A 1ZYRC 3QIAA 4HJ8A 2D5DA 4DA2A 1ESFA 2PW5A 5JJZA 5IIFA 3S14B 3VDYA 2JP1A 4YY3L 2B2WC 2A6HC 3NQTA 3DEPA 4A3GB 3CPFA 3EA6A 3Q6SA 5C3WA 1VQ8A 3HOZH 4LF7L 2OCEA 1TIID 2JA7G 1D5XC 1CKNB 4NXML 2XVSA 4CBVA 4J8QA 4DV3L 1I3QB 4NKLA 4A3DH 2UXDQ 4ULLA 4OX9L 4MTKA 1EIGA 1EOTA 1MI2A 3TRZA 4NDXA 1OO9B 2F0VA 5KIXA 3TS0A 1LV9A 4KJOA 1TWAH 3J81j 4HSVA 1PH1A 5M3FG 4DU9A 1O7YA 2NVQB 4MZ9A 2K5VA 4KHVA 4JG2A 4DUZQ 2F52A 4UY8C 3OTOQ 2R92G 3S2HB 1HJPA 1B9MA 4JI1L 3J81L 3ZYYX 3CW2C 3E5SA 4LFCQ 2VZAA 2Z0SA 4PMWA 2XRSD 3NBHA 3KFUA 1SMYC 1EYAA 1LTTD 1XWEA 1V9PA 2B63G 1T5EA 3MXNB 1TWAB 1B7YB 3SXHA 3KLWA 1J5EL 4YCVA 2UUAL 1K3BC 1LT3D 4BY1G 1VMCA 2HCCA 4R4CA 2J7ZA 1IYJB 5BN4A 4A3BG 2DGYA 2KVMA 3HOXB 1KLUD 3K81C 4DXFA 1JE5A 4CKBA 5HGTA 1K0SA 2G9HD 3MXNA 3PUYA 4UAIA 3RN2A 2F4IA 2EZVA 3TZUA 2UXBQ 1BCPD 3F2DA 4GN5A 3CPWA 3BZDB 5BN5A 5C4JH 1IBML 2HHHQ 5M5YH 4ZKBB 2PI2A 2M2LA 5KGUA 3MEFA 5J22A 1WI5A 3GTQH 2UUCQ 4NW2A 2KCCA 3FKIH 2F0HA 3TP5A 3DM3A 1V43A 2NTTA 1PA6A 1K9MC 1EIYB 2OT2A 3TP7A 5K36H 1LTLA 1UNSA 1H9SB 5CV7A 2EY5A 3X3MA 2F0SA 2KEEA 1EYGA 1GUOA 1BCPC 3RMHA 1O80A 2WKDA 5TSSA 3I56A 1DOKA 1I4QA 1OXXK 2B2WA 2F0LA 4AQYL 1XMOL 3E0JA 1VQJA 1Y69U 2O5JC 1Y1VB 5E3FA 1HNXL 1CA6A 1W2BA 2F0KA 4ME5A 1JICA 3R8BA 4OIJA 1PTOB 1Q1BA 1TXYA 3ERQA 4XXEA 1EZ6A 2CCZA 3R2TA 4V190 1HA5A 1I4HA 1U9RA 5C0XH 3JAMi 1X3QA 1PH8A 1CKOA 2Y0SE 1RL2A 1JQYD 2CHBD 1YITA 3DEOA 3S17H 4FNFA 1YJWA 2K7VA 1XNRQ 1WTRA 1Y1WG 2K5QA 1VQLA 1HFNA 1OXSC 1FNUA 1JOKA 2QA4A 3AEVA 2KHSA 3HOXG 4RGNA 3CHBD 1LM0A 3TDQA 1XX8A 1JR0D 4HR7B 5JPNC 4C3HH 4BWGB 2ZJQA 4KV6A 4B3TQ 2JA5H 2ZTDA 5A35A 4JI2Q 1Z9FA 1I50H 1KABA 5H1SE 3HOVB 5EQ0A 5EGTA 1SRUA 1HQRD 5DLQE 2CQAA 1SE8A 1WJJA 1G8ZD 4ABNA 3M85A 5A2QL 2R7ZH 1Z6HA 3EFXD 1TWFB 4PMBA 4DUYQ 3M3YH 5JEAJ 1T9HA 2OTJA 2EIFA 2A1AA 3CCSA 3GV3A 3KYHC 2LFNA 3VR5A 3OTOL 1UE1A 4HAEA 1NMFA 2A69C 5EAYA 2EPBA 3R2IA 3OW7A 3V05A 1D2BA 4O0AA 1DCZA 3TREA 3HGBA 1NY4A 1H9JA 1TWFH 1A3VA 2KCMA 4DV3Q 1B53A 2BE5C 3BZKA 3IRBA 4RWSC 3EQLC 4GNXC 4JV5Q 4GOPA 2B2TA 1B8AA 1VQ5A 4A3JH 4YY3Q 2XWBB 1YNJC 3DWPA 4RCNA 5FO8B 3QJYA 2RSOA 3CXCA 4C3HB 4KKUA 1PYWD 2MHVA 2EYLA 3LX0A 1FL0A 1ICFB 4A3FB 4QIWB 4HN7A 4JYAQ 4HJ9A 3IFDA 1U4PA 4DFAA 2Z6KC 3I91A 4B3RL 1ASZA 1GKHA 4N8X1 3UE1A 1EWCA 5IOCA 2FINB 1SNQA 2NBFA 3GQBA 1M1KC 3LNNA 3S16B 1SAPA 4O42A 1B4OA 4X6AH 1S72A 3NTIA 1TU2B 1ENCA 3PUWA 1HNZL 5IGDA 3D0FA 4OO1G 4YWMA 4K2LA 4GLXA 5D3IB 3TSSA 5M9OA 1LTSD 1CUKA 1I6HH 2PPBC 1PTOF 1HNXQ 2BDNA 1J5EQ 3FVQA 1AW7A 2ZT9C 1U4LA 3HS0C 5IYBH 3NELA 1IBKQ 1EY6A 2Q8IB 4K14A 3KLSX 3C46A 2BDOA 1STGA 4KY6A 2A8VA 2IX1A 3M7NA 3MXGA 2MO1A 3S1QB 1BUVT 1QCBD 3F8TA 2KCNA 1I4GA 3GTJH 3J7AF 3K0XA 3P1HA 4GS3A 1Q46A 1JOOA 2N78A 4OIKA 4TSSA 4KLKA 5EPJA 4KN4C 1IW7D 1N36L 3ULLA 1DXMA 3N52A 1I4RA 4K5XA 3FP9A 5M3FB 5C4JB 3X3NA 2Q8RE 2WFWA 4LUOA 1TKWB 3TP8A 2JSOA 1HTPA 4DNRB 1IYVA 1K3RA 2EYFA 1CZGA 4GNXB 2F0GA 1K28A 3MFYA 1X6OA 3KBGA 4OL7A 1TWGH 3VYTA 4RAUC 4JBMA 1EIFA 3KBXA 4Q0FA 4DN4M 2ZM6Q 2B2VC 2C9OA 2MGSA 3D3RA 2F0JA 1CT1D 3BJUA 3N6RA 4N9PA 2RHSB 4QF4A 4DR2Q 3OMCA 1JJCB 2DNEA 1XNRL 3GTPH 2VB3X 1STHA 4XQQA 1LT5D 3WOEA 2E2JB 1TQOA 2A6EC 1XTDA 4OWXB 2E5LQ 4HCEA 1QVCA 2AUKA 1O7IA 1N8RC 2KA7A 2A69D 2BA1A 1Y8PB 3BG3A 1MSGA 4BBSH 2ICIA 1GUWA 5L37A 4DK1A 2MP1A 5KNDA 4G4KA 4JI3L 1F9SA 4C2MH 1V1OA 2NVYH 1Q12A 3KLSA 3SK5A 1EWIA 1GHJA 4IOCA 4P71A 4IUUA 4IUTA 1E2WA 2G5DA 3HG9A 4QCLA 4I7ZC 3E3XA 1GUSA 4KD4A 4RKLA 5JEAG 2C35B 2F3VA 1LUZA 1KNEA 1L1OC 5IYCG 3A8KE 3Q0AA 1TWGB 1DJRD 1PRTC 3BDCA 3PUZA 4DAMA 1ASYA 1PZID 4HSPA 3CF5A 3HOZB 5ISRA 2R92H 1B70B 3KK7A 5G3LD 3RZDH 4IFDH 5I9PA 2BCOA 3KF8A 5M3FH 1F2MA 1WFQA 3BYTB 1X3GA 1YZ6A 5E4WC 5C0XJ 2K5HA 2X69A 3AU7A 4JYAL 3H0GH 4B9WA 4KHPL 1B3QA 1A8VA 3LGJA 4HJAA 1HR0W 1BBWA 4FYDA 4A3DG 3J7ZC 2WIIB 2LXKA 4DAYB 1HCZA 3DHQA 4O1NA 3I3CA 1PH2A 3GV6A 5IYDH 5KNCA 2JA7H 1V1PA 3BZCA 1DOLA 1CQVA 4LFBL 4A3EB 1K8AC 1PRTF 2QDBA 4MIUA 2AMCB 2ZXPA 1JB3A 2OF1A 3RUZA 1XMQQ 2PO4A 1PYSB 1SYFA 2I46A 5IT9c 1G2SA 2NZOA 4JI2L 4Y7NH 1P16A 3K57A 1RIPA 2DJGC 1QG7A 1I6HB 5M5WB 1EY4A 2ZXRA 1HZAA 2F4VL 5JJLA 2L12A 3FPPA 4C3IG 1MSHA 1XPOA 2J4XA 2IX3A 1VCIA 2L4NA 4HMIA 1N9WA 2V4DA 4XIGS 3CCLA 1KRTA 3M4OH 3K7UC 3S16H 3F2CA 3K5MA 1RDPD 3NPPA 4ILWA 1ILPA 3CRLC 4DV0L 1YIJA 3CCJA 2CWPA 3KF6A 3L0OA 3NSWA 2MQHA 2OQKA 3T13A 2OXPA 1YHBA 2R6GA 3L7ZC 4A3FH 4FXGC 3OPOA 1HRJA 3I8ZA 5LMNL 4UP7A 1BBXC 4CGYB 4GLVB 3FRPB 3K5OA 4KK7A 5IGBA 3CC7A 1ZKOA 1XPUA 1I94L 2E76C 2RHQB 3IFTA 4A3JB 1PMRA 3I7FA 1JJ2A 4OO1I 4KHZA 5CMDA 1PLFA 3G6JB 1EEFD 3U4VA 1N34Q 2N55A 2PQAA 4X65Q 4EGVA 3EJIA 4XDXA 2E2IH 1LTID 3V96A 1AEXA 1QUQB 2K6AA 3BDOA 3T4AC 4OXPA 3R93A 4NMZA 2F0IA 3GO5A 5I9OA 2Q2TA 4PG3A 1EFID 2EJGC 3CU7A 3MXUA 1X56A 2E74C 1N33L 2SOBA 1D5MC 4CDFC 2ZTEA 1LT4D 2AQ3B 1D1IA 2B2UC 4NB3A 3UDFA 5K5PA 5CR3A 3HKZB 1ILQA 3M3YB 4YIJA 4IUPA 4R8NA 1BF4A 1BKBA 5JJIA 4DK6C 4DGZA 5T1GA 2VQEL 3NWSA 2RCFA 1E1OA 3K6OA 2NYZD 4P74A 5C4XB 1CKNA 4XYOA 3GTMB 4RGMA 4OO1H 1A63A 4B3MQ 4DAYA 4DAPA 3U9SA 3I90A 4YHHQ 1VDZA 3ERSX 1QNUA 5GADC 3CRKC 2EQSA 2I07B 1TS3A 2C5CA 3D6WA 5C3EB 4HJ7A 3H91A 4JOIA 1YJNA 3RR5A 2EYMA 2PMZE 1E24A 3FMCA 3PSIA 5IY0A 4A3IG 2LKVA 3ITPA 3KJPA 1YNNC 5CGKA 2OQ0A 2AKWB 1JCKB 2K03A 1GM5A 4JI7L 3DWAA 1LABA 1SYDA 3FEWX 1EYDA 3D31A 4ID6A 4B9XA 4BY7B 1GO3E 1VQOA 5HGQA 2IHEA 4ZLTF 4P73A 4JI3Q 1CZWA 3DLLA 1BBUA 1BVSA 3KF6B 4L5QA 1V1QA 3KDFB 2F0OA 4GLAC 4EQ5A 2XIWA 3K58A 1A3UA 4RFBA 2HUGA 2BH8A 1ICWA 3HOWG 2Z1CA 3NBIA 3Q24A 1WTPA 1GOZA 2BE5D 3W2DA 4DV7L 3CMAA 2YYZA 3A8IE 1SMXA 4DR2L 4EVOA 5C44G 3HOUB 5CV9A 1TR5A 4M1UB 1F2ZA 3C1FA 1CSPA 3GD7A 4UPAA 4BY7G 4PNYA 5HY6A 4LF8L 3K0YA 4JK1C 2L55A 1D8LA 1KAAA 1SEBD 5GROA 1LLRD 4IFDJ 4QL5A 4JI4L 1FNWA 5G3LF 3RLNA 2RA4A 2B2VA 1Q81C 1K8GA 1Z47A 1EU4A 2YV5A 2PNHA 4LF5Q 4KJNA 3SDZA 4WJ4A 5M5YB 2MUYA 3HOWB 2ZJRA 3VYUA 3QG1A 1EY9A 2HQLA 1WCMG 2CW0D 5HURA 2KCTA 4LUVA 4DR3L 4L5RC 2WINB 1NAPA 4C3HG 1HQMC 1KQSA 1E0BA 2X6GA 3S1MB 1PV4A 4XT3B 2JEBI 2RDFA 3HOYG 2VQFQ 3HOXH 2JA6G 4TQUS 1O7LA 4GZYC 2FXQA 3K80C 1QVFA 4K2KA 4JI1Q 3CD6A 4DV2L 4H0LC 2F0DA 4OGQC 1Q86C 1Y1WH 4OWTB 1II3A 4IJHA 3PO3G 2ENBA 1VQPA 2GN5A 2ALYB 5C0XI 3K5LA 1STEA 3M4QA 5IGCA 3S2HH 3PF4A 5ELNA 1FYCA 3S24A 3Q23A 3P75A 4ZQ3A 5EKLA 3T53B 1SFOB 2HQEA 2LS01 2XGTA 5EBDA 4C3JH 2EVBA 3C2PA 3Q22A 1ENFA 1VQ6A 1PRTD 5F2DA 1O7ZA 3GP7A 4KTAA 4ZRZA 2B63B 5ELEA 2BOSA 1KDBA 1QZGA 3L3OC 1SNPA 3I2ZA 1JOQA 3FHWA 4BBRB 2D2CC 3GDEA 2KECA 3P7JA 1EY8A 5FOBB 2UU9L 2JA6H 1SE4A 2B2YC 4X66L 3QR8A 2K32A 2NWGA 4C1NK 4KI0A 4TKOB 4A3GH 1UEBA 2RBMA 3Q8DA 1VQ4A 3FDTA 1UE5A 1RKNA 3S9WA 2K04A 3NTHA 3STBD 2IY5B 2B29A 3S14H 2D0OA 2M9VA 3NK9A 1YJ9A 1XNQL 5FLXE 1ZYRD 5FLXc 1N34L 4DV5L 1CHPD 4GKJQ 4R4TA 4X3UA 1IBMQ 4IFDI 2MPMA 5GQOA 4X3SA 5IP7G 2HDMA 5IWAQ 4RCOA 3URYA 4JI7Q 3PIPA 2UUBL 3A7LA 4KD3A 3GTLB 3I70A 1GVPA 4FXKC 3ULPA 3CC2A 2JEAI 2A6ED 2AQ1B 3IKJA 3RNUA 2HCIA 4DV1Q 5C44H 1DZ1A 4DNTB 4DR5L 1K8MA 1K83B 1SYCA 3A54A 5I6YA 3I55A 1GJXA 3I4MB 2KENA 1KC8C 4FF1A 4IOAA 4A3BH 2TMPA 4LJZC 1VQMA 1WTWA 3VA5A 4JI6L 3NTKA 1NTGA 1U0LA 3I4OA 4J15A 2UXBL 3S1NB 5FJ8H 4RHSA 1CSQA 2B63H 1BQQT 3GTKH 5EKIA 1V8QA 4CDEC 3S1RB 2IX0A 3F2BA 3MVVA 2QEJC 1RODA 1K73C 1SBBB 2VXWA 1F9PA 3PUXA 2K5NA 2R93H 2NVXB 3KJOA 1KD1C 1K0RA 2NB0A 2ATWA 1YNXA 4DV4Q 2Q8TA 2K50A 4A93G 2K52A 2F0QA 1VQDA 5ELDA 4PZ7A 1SDFA 4I7AA 5KYIA 1A2UA 4JI8L 1F9QA 1Y1WB 4A3IH 2GA4B 3VA7A 3J7A5 4DR4L 3TQYA 3AQQA 4QJFA 1EYCA 1X9NA 1GXDC 1LT6D 1UEAB 2KUMA 4G7OC 3G7LA 3H3VC 3PUVA 1YHQA 5D3DA 3VYSA 4JC0A 2F0EA 1B2TA 3EN2A 3S1MH 3QWNA 3HOZG 4A3LG 3KUPA 3BYYB 4ALPA 2O2LD 5EJWA 1LO5D 3J80i 4YHHL 3G6EA 4A3MH 2L11A 1CA5A 4ZYSA 5ELCA 2XRQD 5CV6A 1RCVD 4HJ5A 2DY7A 2MO0A 1E3PA 4U673 3HP3A 1KNAA 3S2DH 1M8AA 4PZ6A 1NUCA 2N3SA 1OXUA 1W6KA 5CBEE 2E75C 3OOCA 4V0BA 2VUMG 4QQBX 2FHTA 3GTOH 1J8IA 1LTGD 3SE0A 1TY0A 4DR3Q 1JC7A 5I6WA 1SN8A 3HOUH 1XXGA 1EU3A 3D8GA 1TT2A 1Y1VG 3P20A 1L0WA 4XQJA 4XQNA 1FJGL 3TBIB 1S40A 3TS2A 2FFKB 3G48A 2NN6G 5ELOA 2K1BA 1PVOA 1EOVA 1X3EA 3CQZH 1A15A 5IGFA 4UDUC 2VQFL 4CDCC 4DV6L 4FF2A 4PZ8A 4FF3A 2WAQG 1CFMA 3VR3A 1H9SA 1QVGA 3BVGA 1HPCA 4DV5Q 3F1ZA 2LMCB 1AP0A 4JI4Q 1Y14B 1MD2D 2PZUA 1PHJA 1EL0A 1I6VC 1AZPA 1X65A 2TSSA 3PO2B 2CKZB 5C4ZA 3CMEA 4H44C 1EY5A 4OHJA 3EROA 3STBC 1QUQA 1SYEA 1PH6A 2OEOA 1OTCA 5J3BA 1HUNA 1FNVA 3E6ZX 3QB3A 3PIOA 1Z7TA 5IT9E 3AYHB 1ESRA 1KIXA 2VUMH 2WAQE 4LF4Q 5LMUQ 2WV6D 4A4IA 4A3KB 3GTMH 2QGQA 1EIHA 3AB9A 3PCOB 3QOLA 3NENA 4JI6Q 1RHPA 2PCFB 2N8NA 3UE0A 1SLJA 1TY2A 4XT1B 1XNQQ 4IUQA 1Q7YC 2L9HA 1HR0Q 2DY8A 2E2HH 1G6PA 1PH9A 2IPKD 3J81E 1JT8A 4A3MG 2UU9Q 4FO2A 4TRDA 4DV2Q 2E8GA 4CKEA 1EY7A 1KDAA 3NEMA 2MFIA 5GAGC 4DR6L 2IJ0A 2UUBQ 1NR2A 2SEBD 1TWHH 1YBYA 5C4HA 3HOYB 2NVTB 1PH7A 1PH3A 4DR7L 1ONLA 1UAPA 5CBAE 2WKCA 1D7QA 5E1FA 1EUJA 3NP8A 1VQIA 1STBA 2QF7A 4IN3A 1PDQA 2XN9C 3EIVA 2JN4A 4JI8Q 1D1KA 3U9OA 3K7AB 2F0WA 2KJXA 1TWCB 1EQVA 1IBLL 3PO3B 3GTGH 1N32Q 1IL8A 2A68C 4A93H 2IL8A 4A3MB 2Z4HA 3W1BA 4LF9Q 3DWQA 4IFDG 3L9AX 5KNBA 1EQTA 1SROA 2Y0SG 2R93G 5J39A 1JWSD 1Y8NB 4IALA 2KHJA 1C9OA 4LFAQ 4AH6A 2CW0C 2HIVA 2CH4W 5C3EG 1QWYA 3HRZC 1WYDA 1SSOA 3OIPA 2KHIA 4QUCA 1A6XA 1TVXA 2E5LL 5BR8Q 5FJ8G 4X3TA 1BR9A 1QJOA 2RCNA 4FXDA 1KXLA 4O2DA 2ZM6L 3T1YL 2KEDA 1C8CA 3PMFA 4APVA 5C5LA 1FGBD 3ONAB 1F2YA 5C6AA 1SYGA 1J6QA 1WTVA 1JJGA 3PO2G 1A62A 5M3MB 3SK6A 2ZJPA 4IPDA 1VQNA 1VQGA 4BBSG 1Q90A 2JQOA 3RZOB 1G6ZA 4K0KQ 1DYQA 2NVXH 4NPSA 4IUNA 2QW7A 3BVZA 1XYIA 1U4MA 4RHRA 4NXNQ 5IODA 3D6CA 3DXJC 1F77A 3I4NH 4H02A 1VQBA 1KL9A 1CKMA 4A3KG 4HCSA 4MHEA 1KHIA 1LTRD 2ZXOA 3B6YA 1DOMA 1SNCA 2A5HA 4WJWA 1YHAA 1S4ZA 4Y7NB 1PFSA 3NE5B 2HIXA 1I5FA 4LK1C 1GD7A 3HZXA 3I4LA 3K59A 2PNRC 4RKBA 4A3EH 2VNUD 3RD4A 4G7HC 4A3CH 3TP6A 4A3GG 1IL2A 2JA7B 1R4QB 5IT9L 3A5UA 4YCUA 4WFN3 4DV6Q 3AFPA 4C1NI 4G57A 5JVH3 2EOTA 1H9MA 4KY5A 3LWUA 1ET6A 2NTSA 4BBRG 2F0FA 3U4ZA 4UHVA 3JAME 3J81c 5T1IA 4BXXH 3UDGA 4LF7Q 3H94A 1STNA 1QOHA 3ND9A 4C3JG 5LHY1 2EXDA 1HHVA 1TS4A 2SNMA 3CCRA 2D62A 1I4XA 1HUMA 1C7YA 1EY0A 2R92B 2CVRA 1PTOD 3AFQA 5FLXL 3QOJA 3OWFA 5FLMG 1DONA 2JA6B 1SE3A 1VQEA 3MAQA 1MBYA 4EQNA 2Z9HA 1FR3A 4BBRH 3JAML 3T51B 1HZ9A 1MKHA 1R4PB 2UXCQ 3J80L 2IHFA 1BO0A 2K75A 4RG1A 3WOFA 2B8GA 3UI2A 4E6IA 1WOCA 1S5BD 2EJMA 4X65L 3I4NB 2NUCA 5KEEA 5COYA 4R4IA 4C3JB 2F3IA 4DPGA 1Y8OB 1QB5D 2A6HD 2JK8A 3OHXC 5JJKA 2CQOA 2F4VQ 1EQRA 1WTOA 2UUCL 2R7FA 4A3CG 2L1BA 1X3FA 1L1OA 3RZOH 4A3EG 4R4OA 3KDFA 5M3MH 1C48A 1CTMA 2K14A 2AHOB 3CCUA 4MN3A 3WWVA 3CCVA 2KBNA 2HDLA 4RMFA 3A8JE 4MNOA 4DV0Q 4IJLA 5FO9B 4IPHA 4U68A 4LFCL 3SR1A 1WTQA 4HEDA 3W1GA 3PQIA 2PZTA 2F3WA 1E2VA 3BDLA 1L2FA 3I4NG 2RQXA 4LF9L 3SVMA 3M4PA 4IPGA 4CKCA 5ELFA 5JOBA 4EQPA 1BCPF 1PH4A 4BS9A 4N8FA 4PMCA 2HHHL 1R9TB 4OX9Q 3EBEA 3MWYW 1MJCA 2SDFA 4A93B 1NBWA 3MTSA 3OW2A 3GTGB 4JOIC 1NE3A 3HOWH 3K7AH 5CV8A 2JE6I 2K05A 4L63B 4HIMA 2A74C 2CWAA 4X62Q 2VY3A 5I2XA 4IO9A 1IBLQ 1Q1EA 4HTHA 4ODGA 4LWCA 2RDGA 4LMQD 4A76A 1RD9D 3JAMc 3IAYA 3IL8A 2RVLA 1UUPA 3GTJB 4C56C 1NJIC 4AYBE 4P2CB 2I0QA 2FMMA 2V1CC 4B3ML 2VW9A 2Q2UA 4CJ1B 1HNWQ 3PF5A 3G4SA 2PMZB 1N32L 4LUZA 3F2UA 3ZJYC 1AFPA 2H1EA 4AYBG 1OXTA 1VQKA 4JCVE 2KOLA 1XMOQ 3OIQA 2JA5G 4LW1A 4YCWA 1E2ZA 2JA8H 4OONA 2Q2IA 4DUYL 2K33A 4H7BA 1JB7A 4K0KL 2A68D 2MJ8A 2I5HA 3HKZG 1C0AA 5CYUA 3CKIB 4JI5L 4DXGA 3ER0A 2YU9H 5KRUA 3W5OA 1NR4A 4GN4B 1HA6A 4YWLA 2YU9B 3OYYA 1MJEA 1RTNA 4DF7A 4K8JA 3D4DA 3OWEB 5IP9H 4L5SA 3U58A 1P8LA 2A19A 2JA8B 4ZUJA 2NN6I 1F2LA 4BA2I 1EQQA 5C0XG 4NXNL 3DMUA 4Z9CB 4F8MA 2WAQB 1KDCA 1M4VA 4OWWB 1EZ8A 1YI2A 4GN3B 1MIUA 1RJTA 2AWOA 1WTXA 2YTXA 2QEXA 5KYLA
chains in the Genus database with same CATH topology
1B1ZA 2F0UA 5EPLA 4ZK9B 1IYUA 5FKAC 1CI3M 2K5DA 5LL6X 1LACA 4CJ0B 4ZKCB 1SNOA 1T5XD 1WVLA 5CV4A 4QB4A 2EDGA 2R7ZB 1B9NA 4F7XA 4DAVA 5FO7B 4AYBB 1JWMD 4CJ2C 4K8IA 2AQ2B 2B2TC 2F0MA 3I72A 1GUNA 2JA5B 1HXYD 2XSCA 3ND8A 5EKKA 3T56B 1D6EC 1BCPB 2JYOA 3TN2A 2N88A 1BNZA 1IHZA 4IQZA 3D4RA 2DNCA 1RF2D 1YNND 3J80E 1SMYD 4K5VA 1ET9A 3S17B 1WD1A 2R93B 4X3KA 3PIO3 5I2YA 1PXUA 1K8OA 3WDNA 2BA0A 3GTKB 4J1MA 2EYHA 1PTOH 5D14A 1G2TA 2QKIC 2R3ZA 2FJ2A 3T16A 2QILA 1BDOA 4ZUIA 1GHKA 1SJED 5C44B 5NUCA 4K5WA 4RGTA 5DNFA 4FVMA 1SJHD 1PFMA 5LL6S 1QNKA 2RDHA 2G9DA 4KKTA 3O13A 2Z4IA 3H09A 5JEAH 3OMGA 2A73B 3MEHA 1ML0D 1F9RA 3H0GB 3FKIB 4QMGA 2XWJB 1TS2A 2RSNA 3OSOA 1GUTA 4DK0A 1LTBD 2IW3A 3RZDB 3LWEA 1A3TA 5CORA 1BXTA 3NUCA 4HMJA 3VYRA 1NSNS 2F1MA 2O5IC 1J9OA 2WP8J 2VB2X 2M00A 2R61A 2PYKA 1EEID 5JAVA 2E2DC 3VR4A 1S5CD 1ZEQX 2NVYB 3R3OA 4C2MB 1SXTA 3EVQA 4KMUC 1DD2A 1CK1A 4BBSB 4H13C 1O78A 2H4OA 3PV0A 3SHLA 3A56A 2RKSA 4RGOS 2JXMB 2B39A 5J1ZA 1PZJD 4I65A 4PQXA 3GTPB 4S3SA 3NWTA 2EXZA 2Z8LA 5EPKA 1A2TA 4F88A 5DM73 4G7ZC 2PZWA 4WORA 3BS1A 4A3DB 1LTAD 1EWHA 2LY7A 2F03A 4KKSA 2AWNA 4KN7C 1IKLA 3A7AB 1STAA 5FK9C 1H9KA 2K5WA 3VR6A 4RH6A 2B8FA 3K5NA 4KY7A 4NP5A 4BY1B 3S15B 2ICEC 2PW7A 5CV5A 1B50A 4C3IB 5DM63 3MZ5A 1Q8IA 1TWHB 2J0TD 4N9TA 1X3PA 2EYPA 2EY2A 2NZ1D 3RLFA 3HEJA 2E2HB 1SNMA 1ENAA 2F0NA 1YNJD 1KLGD 4R9WA 1HTLD 5DAUA 4J6HA 3SK8A 4CHTB 4EQOA 5A2QE 5DEHA 5EBCA 1AZQA 2ID0A 3C1EA 3SK4A 4Q5VA 2VUMB 4PV1C 1SYBA 2K01A 1QE6A 4IURA 1VMPA 5CC4A 1X32A 1ZXTA 2FMCA 2EY6A 3D4WA 5BN3A 1S5FD 3BVMA 1B44D 4FP5D 2EYOA 2WB1B 5C3XA 4L6TB 2B2UA 3NXWA 3TMEA 2IWHA 1TS5A 3CQZB 3J7YW 3MHBA 5D65A 5IGGA 3V2TA 4LAAA 3J7AV 3TZDA 3DUZA 2EE1A 1PRTB 3KLRA 3FPUB 3DM1A 1WD0A 2EJFC 2L0CA 1BOSA 2EY1A 3MXPA 3C3LA 2D9UA 1CM9A 4K6LA 1S5DD 1STYA 1H9RA 3MA2B 3GTOB 1XTCD 1B3AA 1JE4A 5JPMC 2F0PA 1SE2A 3A55A 5I4DA 3H6MA 4K6DA 3S2DB 1I4PA 1GUGA 2E2IB 2F0TA 3NHHA 1NCVA 1Q3LA 1FD7D 5C5MA 1MGSA 2XNAC 2WACA 1L0YB 4B08A 3SEBA 2PQEA 2IT1A 1I50B 1SNDA 4L8JA 4WRDA 2Y0SB 1G91A 2DN8A 1PTOC 1VF7A 4JBWA 2O4XA 5ELBA 1KTKA 2KQ3A 4BA1I 1V1PB 1VF5C 2SNSA 3AMUA 5AFWA 4A3IB 5M5XB 1U4RA 3QO2A 1PFNA 1RTOA 5IGEA 1JORA 1JWUD 4R8IA 1C4QA 3M4YA 1AN8A 4QUFA 3M4OB 2L5TA 1HFGA 4IZ8A 1L0XB 3M7GA 1QILA 3I73A 1DM0B 5E4XA 2AUJD 1D5ZC 2QCPX 5K36G 3MC0B 2NN6H 1PFBA 2B2YA 4XYQA 4A3BB 1PZKD 4F87A 3NQIA 4XTCS 4RA8A 1IKMA 3MFGA 1CQFA 1WCMB 5JVG3 4M8AA 3PIP3 1G291 1W6JA 3W3AA 2X6LA 2K28A 1OXVA 2EYJA 4ZAIA 1S5ED 1CHQD 3VR2A 4IUVA 1IW7C 3GTQB 4FF4A 1ZYRC 3QIAA 2D5DA 4DA2A 1ESFA 2PW5A 5JJZA 5IIFA 3S14B 2JP1A 2B2WC 2A6HC 3NQTA 3DEPA 4A3GB 3EA6A 3Q6SA 5C3WA 1TIID 1D5XC 2XVSA 4CBVA 4J8QA 1I3QB 4NKLA 4ULLA 1EIGA 1EOTA 1MI2A 4NDXA 1OO9B 2F0VA 5KIXA 1LV9A 4KJOA 4HSVA 2NVQB 4DU9A 1O7YA 4KHVA 3S2HB 1B9MA 3J81L 3ZYYX 3E5SA 4PMWA 2XRSD 3NBHA 1SMYC 1EYAA 1LTTD 1XWEA 1T5EA 1TWAB 3SXHA 1LT3D 1VMCA 2HCCA 2J7ZA 5BN4A 2KVMA 3HOXB 1KLUD 4DXFA 5HGTA 4CKBA 2G9HD 3MXNA 3PUYA 4UAIA 2F4IA 2EZVA 3TZUA 1BCPD 3BZDB 5BN5A 4ZKBB 2M2LA 5KGUA 5J22A 4NW2A 2KCCA 2F0HA 3TP5A 1V43A 2NTTA 2OT2A 3TP7A 5K36H 1UNSA 1H9SB 5CV7A 2EY5A 3X3MA 2F0SA 2KEEA 1GUOA 1BCPC 3RMHA 1O80A 2WKDA 5TSSA 1DOKA 1I4QA 1OXXK 2B2WA 2F0LA 3E0JA 1Y69U 2O5JC 1Y1VB 5E3FA 1CA6A 2F0KA 4ME5A 1JICA 3R8BA 4OIJA 1PTOB 1Q1BA 3ERQA 4XXEA 1EZ6A 3R2TA 4V190 1HA5A 1I4HA 1U9RA 5C0XH 1X3QA 1JQYD 2CHBD 3DEOA 4FNFA 2K7VA 1WTRA 2K5QA 1HFNA 1OXSC 1FNUA 1JOKA 2KHSA 4RGNA 3CHBD 3TDQA 1XX8A 1JR0D 4HR7B 5JPNC 4BWGB 4KV6A 5A35A 3HOVB 1KABA 5EQ0A 5EGTA 1HQRD 2CQAA 1G8ZD 4ABNA 3M85A 5A2QL 1Z6HA 3EFXD 1TWFB 4PMBA 5JEAJ 3GV3A 2LFNA 3VR5A 4HAEA 2A69C 2EPBA 3R2IA 3OW7A 3V05A 1D2BA 1DCZA 3HGBA 1H9JA 1A3VA 1B53A 2BE5C 4RWSC 3EQLC 2B2TA 2XWBB 1YNJC 3DWPA 4RCNA 5FO8B 3QJYA 2RSOA 4C3HB 4KKUA 1PYWD 2MHVA 2EYLA 3LX0A 4A3FB 4QIWB 4HN7A 3IFDA 1U4PA 4DFAA 3I91A 1EWCA 5IOCA 2FINB 1SNQA 2NBFA 3GQBA 3LNNA 3S16B 1SAPA 4O42A 1B4OA 3NTIA 1TU2B 1ENCA 3PUWA 5IGDA 4OO1G 4K2LA 5D3IB 3TSSA 5M9OA 1LTSD 2PPBC 1PTOF 2BDNA 3FVQA 1AW7A 2ZT9C 1U4LA 3HS0C 1EY6A 2Q8IB 4K14A 3KLSX 3C46A 2BDOA 1STGA 4KY6A 3M7NA 2IX1A 3MXGA 3S1QB 1BUVT 1QCBD 2KCNA 1I4GA 3J7AF 3P1HA 1JOOA 4OIKA 4TSSA 5EPJA 4KN4C 1IW7D 1DXMA 3N52A 1I4RA 4K5XA 5M3FB 5C4JB 3X3NA 2Q8RE 1TKWB 3TP8A 2JSOA 1HTPA 4DNRB 1IYVA 2EYFA 1CZGA 2F0GA 3MFYA 3KBGA 4OL7A 3VYTA 4RAUC 3KBXA 4Q0FA 4DN4M 2B2VC 2C9OA 2MGSA 3D3RA 2F0JA 1CT1D 4N9PA 3N6RA 4QF4A 3OMCA 2DNEA 2VB3X 1STHA 4XQQA 1LT5D 3WOEA 2E2JB 1TQOA 2A6EC 4HCEA 2AUKA 2KA7A 2A69D 2BA1A 1Y8PB 3BG3A 1MSGA 2ICIA 1GUWA 4DK1A 2MP1A 5KNDA 4G4KA 1F9SA 1V1OA 1Q12A 3KLSA 3SK5A 1GHJA 4IUUA 4IUTA 1E2WA 3HG9A 4QCLA 4I7ZC 4KD4A 1GUSA 4RKLA 5JEAG 2F3VA 1KNEA 3A8KE 3Q0AA 1TWGB 1DJRD 1PRTC 3BDCA 3PUZA 1PZID 4HSPA 3HOZB 5ISRA 3KK7A 5G3LD 4IFDH 5I9PA 2BCOA 3KF8A 1F2MA 3BYTB 5E4WC 5C0XJ 2X69A 3AU7A 4B9WA 4FYDA 2WIIB 1HCZA 3DHQA 4O1NA 3I3CA 3GV6A 5KNCA 1V1PA 1DOLA 1CQVA 4A3EB 1PRTF 2QDBA 4MIUA 2ZXPA 3RUZA 1JB3A 2OF1A 2PO4A 1SYFA 2I46A 1G2SA 3K57A 1QG7A 1I6HB 5M5WB 1EY4A 2ZXRA 2L12A 3FPPA 4C3IG 1MSHA 2J4XA 2IX3A 1VCIA 2L4NA 4HMIA 4XIGS 2V4DA 3K5MA 1RDPD 3NPPA 4ILWA 1ILPA 3CRLC 3NSWA 3T13A 2OXPA 2R6GA 3L7ZC 4FXGC 3OPOA 1HRJA 3I8ZA 1BBXC 4CGYB 3FRPB 3K5OA 4KK7A 5IGBA 1ZKOA 2E76C 3IFTA 4A3JB 1PMRA 4OO1I 4KHZA 5CMDA 1PLFA 3G6JB 1EEFD 2N55A 4EGVA 3EJIA 4XDXA 1LTID 3V96A 1AEXA 2K6AA 3BDOA 3T4AC 3R93A 4NMZA 2F0IA 3GO5A 5I9OA 1EFID 2EJGC 3CU7A 3MXUA 2E74C 2SOBA 1D5MC 1LT4D 2AQ3B 1D1IA 2B2UC 5K5PA 5CR3A 3HKZB 1ILQA 3M3YB 4YIJA 4IUPA 4R8NA 1BF4A 4DGZA 5T1GA 3NWSA 3K6OA 2NYZD 5C4XB 4XYOA 3GTMB 4RGMA 4OO1H 4DAYA 4DAPA 3U9SA 3I90A 1VDZA 1QNUA 3CRKC 2I07B 1TS3A 2C5CA 3D6WA 5C3EB 3H91A 2EYMA 3FMCA 2LKVA 3ITPA 1YNNC 5CGKA 1JCKB 2K03A 3DWAA 1LABA 1SYDA 3FEWX 1EYDA 3D31A 4ID6A 4B9XA 4BY7B 4ZLTF 1CZWA 2F0OA 2XIWA 3K58A 1A3UA 4RFBA 2HUGA 1ICWA 2Z1CA 3NBIA 3Q24A 1WTPA 1GOZA 2BE5D 3W2DA 2YYZA 3A8IE 4EVOA 3HOUB 5CV9A 1TR5A 4M1UB 1F2ZA 3C1FA 3GD7A 4PNYA 3K0YA 4JK1C 2L55A 1KAAA 1SEBD 1LLRD 4IFDJ 1FNWA 5G3LF 2RA4A 2B2VA 1Z47A 1EU4A 4KJNA 3SDZA 5M5YB 2MUYA 3HOWB 3VYUA 3QG1A 1EY9A 2CW0D 5HURA 2WINB 1NAPA 4C3HG 1HQMC 1E0BA 2X6GA 3S1MB 4XT3B 2JEBI 2RDFA 4TQUS 1O7LA 4GZYC 4K2KA 4H0LC 2F0DA 4OGQC 1II3A 2ENBA 5C0XI 3K5LA 1STEA 5IGCA 1FYCA 3Q23A 3P75A 4ZQ3A 3T53B 1SFOB 5EKLA 2HQEA 2LS01 5EBDA 2EVBA 3C2PA 3Q22A 1ENFA 5F2DA 1PRTD 1O7ZA 3GP7A 4KTAA 4ZRZA 2B63B 5ELEA 2BOSA 1KDBA 3L3OC 1SNPA 1JOQA 4BBRB 2D2CC 2KECA 3P7JA 1EY8A 5FOBB 1SE4A 2B2YC 2K32A 2NWGA 4C1NK 4KI0A 4TKOB 2RBMA 3FDTA 1RKNA 3S9WA 2K04A 3NTHA 2M9VA 3NK9A 5FLXE 1ZYRD 1CHPD 4X3UA 4IFDI 2MPMA 4X3SA 2HDMA 4RCOA 3URYA 3A7LA 4KD3A 3GTLB 3I70A 2JEAI 4FXKC 2A6ED 2AQ1B 3IKJA 2HCIA 1DZ1A 4DNTB 1K8MA 1K83B 1SYCA 3A54A 5I6YA 1GJXA 3I4MB 4FF1A 2TMPA 4LJZC 1WTWA 3VA5A 3NTKA 3S1NB 4RHSA 1BQQT 5EKIA 1V8QA 3S1RB 2IX0A 3MVVA 2QEJC 1RODA 1SBBB 2VXWA 1F9PA 3PUXA 2NVXB 2NB0A 2Q8TA 2F0QA 5ELDA 1SDFA 5KYIA 1A2UA 1F9QA 1Y1WB 2GA4B 3VA7A 1EYCA 1GXDC 1LT6D 1UEAB 2KUMA 4G7OC 3G7LA 3H3VC 3PUVA 5D3DA 3VYSA 2F0EA 1B2TA 3QWNA 3KUPA 3BYYB 2O2LD 5EJWA 1LO5D 2L11A 1CA5A 4ZYSA 5ELCA 2XRQD 5CV6A 1RCVD 2DY7A 4U673 3HP3A 1KNAA 1M8AA 1NUCA 1OXUA 1W6KA 5CBEE 2E75C 3OOCA 4V0BA 2FHTA 1J8IA 1LTGD 3SE0A 1TY0A 1JC7A 5I6WA 1XXGA 1EU3A 3D8GA 1TT2A 3P20A 4XQJA 4XQNA 3TBIB 2FFKB 2NN6G 2K1BA 1A15A 5IGFA 4UDUC 4FF2A 4FF3A 1CFMA 3VR3A 1H9SA 3BVGA 1HPCA 2LMCB 1AP0A 2PZUA 1MD2D 1EL0A 1I6VC 1AZPA 2TSSA 3PO2B 5C4ZA 4H44C 1EY5A 4OHJA 3EROA 1SYEA 2OEOA 1HUNA 1FNVA 3E6ZX 3QB3A 1Z7TA 5IT9E 1ESRA 2WV6D 4A3KB 1EIHA 3AB9A 3QOLA 1RHPA 2PCFB 1TY2A 4XT1B 4IUQA 2L9HA 2DY8A 2IPKD 3J81E 4FO2A 4TRDA 4CKEA 1EY7A 1KDAA 2IJ0A 1NR2A 2SEBD 5C4HA 3HOYB 2NVTB 1ONLA 1UAPA 5CBAE 2WKCA 5E1FA 3NP8A 1STBA 2QF7A 4IN3A 1PDQA 2XN9C 1D1KA 3U9OA 3K7AB 2F0WA 2KJXA 1TWCB 1EQVA 3PO3B 1IL8A 2A68C 2IL8A 4A3MB 2Z4HA 3DWQA 4IFDG 3L9AX 5KNBA 1EQTA 5J39A 1JWSD 1Y8NB 4IALA 2CW0C 1QWYA 3HRZC 3OIPA 1SSOA 4QUCA 1A6XA 1TVXA 4X3TA 1BR9A 1QJOA 4FXDA 2KEDA 1C8CA 3PMFA 5C5LA 1FGBD 3ONAB 1F2YA 5C6AA 1SYGA 1WTVA 5M3MB 3SK6A 1Q90A 1G6ZA 3RZOB 1DYQA 4IUNA 3BVZA 1XYIA 1U4MA 4RHRA 5IODA 3D6CA 3DXJC 1F77A 4HCSA 4MHEA 2ZXOA 1LTRD 1DOMA 1SNCA 2A5HA 4WJWA 1S4ZA 4Y7NB 3NE5B 4LK1C 3HZXA 3I4LA 3K59A 2PNRC 4RKBA 2VNUD 3RD4A 4G7HC 3TP6A 2JA7B 1R4QB 5IT9L 4WFN3 4C1NI 4G57A 5JVH3 2EOTA 1H9MA 4KY5A 3LWUA 1ET6A 2NTSA 2F0FA 3JAME 5T1IA 3H94A 1STNA 1QOHA 3ND9A 4C3JG 5LHY1 1HHVA 1TS4A 2SNMA 2D62A 1I4XA 1HUMA 1EY0A 2R92B 2CVRA 1PTOD 5FLXL 3QOJA 3OWFA 1DONA 2JA6B 1SE3A 3MAQA 1MBYA 4EQNA 1FR3A 3JAML 3T51B 1R4PB 3J80L 1BO0A 3WOFA 2B8GA 3UI2A 4E6IA 1S5BD 2EJMA 3I4NB 2NUCA 5KEEA 5COYA 4C3JB 1Y8OB 1QB5D 2A6HD 3OHXC 1WTOA 2L1BA 1C48A 1CTMA 4MN3A 2HDLA 3A8JE 5FO9B 4U68A 3SR1A 1WTQA 4HEDA 2PZTA 2F3WA 1E2VA 3BDLA 2RQXA 3SVMA 4CKCA 5ELFA 5JOBA 4EQPA 1BCPF 4BS9A 4PMCA 1R9TB 3MWYW 2SDFA 4A93B 3MTSA 3GTGB 5CV8A 2JE6I 2K05A 4L63B 2A74C 5I2XA 1Q1EA 4HTHA 4ODGA 2RDGA 4LMQD 1RD9D 3IAYA 3IL8A 2RVLA 1UUPA 3GTJB 4C56C 4P2CB 2FMMA 4CJ1B 2PMZB 3F2UA 1AFPA 2H1EA 1OXTA 2KOLA 3OIQA 1E2ZA 2K33A 4H7BA 2A68D 2MJ8A 5CYUA 3CKIB 4DXGA 5KRUA 1NR4A 1HA6A 2YU9B 1RTNA 4DF7A 3D4DA 4K8JA 3OWEB 2JA8B 4ZUJA 2NN6I 1F2LA 4BA2I 5C0XG 3DMUA 4Z9CB 4F8MA 2WAQB 1KDCA 1M4VA 1EZ8A 1RJTA 2AWOA 1WTXA 5KYLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M2L A;  2K05 A;  1M8A A;  5E4W C;  3R93 A;  2X69 A;  3GV3 A;  2X6L A;  1NR2 A;  4NW2 A;  5EPL A;  2K28 A;  5CBE E;  4ZK9 B;  4ZAI A;  1B3A A;  1JE4 A;  2EOT A;  4OIK A;  4X3U A;  5CBA E;  4HAE A;  5EPJ A;  2EPB A;  2MPM A;  1B50 A;  1ML0 D;  4X3S A;  1F9R A;  3N52 A;  2FHT A;  2HDM A;  2B2V A;  2RA4 A;  4LMQ D;  4ZKB B;  1J8I A;  4IUV A;  5T1I A;  4CJ0 B;  4ZKC B;  2B2U C;  1PDQ A;  3I3C A;  1X3P A;  2RSN A;  3IL8 A;  5JJZ A;  2RVL A;  3GV6 A;  2NZ1 D;  2KEE A;  1WVL A;  1ILQ A;  1HHV A;  2JP1 A;  1NCV A;  1Q3L A;  4IUP A;  1B53 A;  2B2W C;  2Q8R E;  1BF4 A;  1MGS A;  1DOL A;  1HUM A;  1IL8 A;  1O80 A;  3DEP A;  3LWE A;  4RWS C;  2CVR A;  2HCI A;  2IL8 A;  3Q6S A;  2FMM A;  5COR A;  5T1G A;  1DZ1 A;  4R9W A;  1DOK A;  2B2W A;  1EQT A;  2B2T A;  4CJ1 B;  1DON A;  1NAP A;  2NYZ D;  4CJ2 C;  2FFK B;  1J9O A;  1G2S A;  1E0B A;  2B2T C;  1WTW A;  2X6G A;  4RAU C;  4XT3 B;  1AZQ A;  1CA6 A;  3F2U A;  3KBX A;  4DN4 M;  1G91 A;  2K1B A;  1JIC A;  1QG7 A;  2RSO A;  2H1E A;  2B2V C;  4OIJ A;  1EIG A;  1EOT A;  1MI2 A;  2KOL A;  2JYO A;  1SSO A;  2L12 A;  2N88 A;  1BO0 A;  2MGS A;  3I90 A;  1MSH A;  4QUC A;  3TN2 A;  5EKI A;  1TVX A;  3UI2 A;  1BNZ A;  2K01 A;  1A15 A;  1QE6 A;  1LV9 A;  2L4N A;  4X3T A;  3D6W A;  4IUR A;  1VMP A;  3H91 A;  1X32 A;  1ZXT A;  5AFW A;  5COY A;  2MJ8 A;  1X3Q A;  1U4R A;  2KED A;  1ROD A;  4HSV A;  1C8C A;  2VXW A;  1F9P A;  1O7Y A;  3IFD A;  3ONA B;  1U4P A;  1PFN A;  3I91 A;  3QO2 A;  1WTO A;  1RTO A;  2L1B A;  1WTV A;  1ILP A;  3DEO A;  1NR4 A;  1AP0 A;  1HA6 A;  2Q8T A;  2FIN B;  1G6Z A;  1EL0 A;  4R8I A;  2K03 A;  1WTR A;  1WD1 A;  1AZP A;  1RTN A;  4X3K A;  4QUF A;  4MN3 A;  1SDF A;  1MSG A;  1HFN A;  1SAP A;  4O42 A;  1B4O A;  1HFG A;  1XYI A;  1U4M A;  1GUW A;  2MP1 A;  2B2U A;  2HDL A;  1F9Q A;  1F9S A;  5E4X A;  4U68 A;  1WTQ A;  1HRJ A;  4HED A;  1HUN A;  1O7Z A;  1F2L A;  3I8Z A;  4HCS A;  4MHE A;  4IUU A;  4IUT A;  1ESR A;  5EPK A;  4ZLT F;  1BBX C;  1DOM A;  2KUM A;  1VMC A;  1XX8 A;  1PFB A;  2HCC A;  3G7L A;  2J7Z A;  5D14 A;  5D65 A;  2KVM A;  1G2T A;  3SVM A;  2R3Z A;  2KEC A;  2FJ2 A;  3P7J A;  1S4Z A;  1B2T A;  1KNE A;  2BDN A;  1EIH A;  3TZD A;  2B2Y A;  2EE1 A;  4UAI A;  1RHP A;  3KUP A;  2XIW A;  3DM1 A;  3FPU B;  1WD0 A;  1U4L A;  5EQ0 A;  2B2Y C;  4XT1 B;  2HUG A;  1ICW A;  4RA8 A;  1IKM A;  5EJW A;  1WTP A;  4IUQ A;  2NWG A;  3MWY W;  5CMD A;  2L9H A;  2SDF A;  1PLF A;  1RJT A;  2DY8 A;  2L11 A;  3MTS A;  1CA5 A;  3FDT A;  5DNF A;  2N55 A;  2K04 A;  2D9U A;  1PFM A;  2DY7 A;  1WTX A;  1IKL A;  4XDX A;  1CM9 A;  3HP3 A;  1KNA A;  1QNK A; 
#chains in the Genus database with same CATH topology
 1B1Z A;  2F0U A;  4OEM B;  5EPL A;  2JJQ A;  4B3R Q;  3M9B A;  4ZK9 B;  4A75 A;  4DR1 L;  1IYU A;  5FKA C;  1CI3 M;  2K5D A;  5LL6 X;  3ULJ A;  2CFM A;  4IPC A;  1LAC A;  2MNA A;  4CJ0 B;  1UE6 A;  4ZKC B;  2DUD A;  4JV5 L;  1SNO A;  1T5X D;  3FKI G;  1WVL A;  5CV4 A;  1E1T A;  4EX5 A;  2OWO A;  4QB4 A;  2EDG A;  2R7Z B;  1Q8K A;  1B9N A;  4GOP B;  4F7X A;  3HKZ E;  4GKK Q;  2LXJ A;  3HOU G;  4DAV A;  1R9T H;  5FO7 B;  3CCQ A;  3TEH B;  1EFW A;  4AYB B;  1VQ7 A;  1JWM D;  4CJ2 C;  4K8I A;  2AQ2 B;  2B2T C;  3HFZ B;  2F0M A;  2PQA B;  3I72 A;  1GUN A;  2JA5 B;  1HXY D;  2XSC A;  4OEL B;  3ND8 A;  5EKK A;  3T56 B;  4AIM A;  1IXR A;  1D6E C;  1BCP B;  2JYO A;  3TN2 A;  2N88 A;  5IP9 G;  1VS0 A;  3E9I A;  1BNZ A;  1IHZ A;  4IQZ A;  3D4R A;  2DNC A;  1RF2 D;  1YNN D;  1FVI A;  1PH5 A;  3J80 E;  4LF8 Q;  1SMY D;  1LYL A;  4K5V A;  1ET9 A;  1HNZ Q;  3S17 B;  1VQ9 A;  1WD1 A;  2R93 B;  4X3K A;  4A3L H;  2JA8 G;  4LF5 L;  3PIO 3;  5I2Y A;  5IYD G;  1PXU A;  1K8O A;  4R4Q A;  2N49 A;  1JMC A;  3S1R H;  3WDN A;  2BA0 A;  3GTK B;  4J1M A;  1IBK L;  2EYH A;  4DV1 L;  1PTO H;  3CCM A;  5D14 A;  4DR5 Q;  5M5W H;  1G2T A;  2YTV A;  3A74 A;  2QKI C;  2HD3 A;  1W3S A;  2R3Z A;  1PYB A;  2FJ2 A;  3H0G G;  3T16 A;  2QDL A;  2QIL A;  1BDO A;  2B3G A;  2PI2 E;  3T1H L;  3CCE A;  2Z6B A;  4ZUI A;  4LF6 L;  1GHK A;  1SJE D;  5C44 B;  5NUC A;  1VQC A;  4K5W A;  1M90 C;  1YEZ A;  4RGT A;  5DNF A;  2GVB A;  4FVM A;  1SJH D;  4GKJ L;  1PFM A;  1S3O A;  5LL6 S;  1VQH A;  1QNK A;  1Q82 C;  2RDH A;  5IWA L;  4L5T A;  2G9D A;  5IYC H;  4KKT A;  4JI5 Q;  1A0I A;  2Z4I A;  3O13 A;  3H09 A;  5JEA H;  3OMG A;  2A73 B;  3MEH A;  4DV4 L;  4WJ3 M;  1ML0 D;  1F9R A;  3H0G B;  3FKI B;  4YWK A;  4POG A;  4QMG A;  2XWJ B;  4JPB W;  1TS2 A;  2RSN A;  2LSS A;  3OSO A;  1GUT A;  4DK0 A;  1FGU A;  1IZ6 A;  1N36 Q;  1LTB D;  2IW3 A;  3RZD B;  3LWE A;  1A3T A;  1HZC A;  3SGI A;  5COR A;  1BXT A;  3NUC A;  2K4K A;  4HMJ A;  3VYR A;  2L15 A;  1NSN S;  2F1M A;  5AJ3 L;  2O5I C;  4HIO A;  1J9O A;  2WP8 J;  2VB2 X;  1YVC A;  2M00 A;  2R61 A;  3I4M G;  5IP7 H;  2PYK A;  4X66 Q;  1EEI D;  3KOJ A;  5GAE C;  5JAV A;  2E2D C;  4QIW E;  3VR4 A;  4Y52 H;  1S5C D;  1ZEQ X;  2NVY B;  3UDX A;  3R3O A;  1NMG A;  4C2M B;  1SXT A;  3EVQ A;  2ES2 A;  4KMU C;  1DD2 A;  2JA9 A;  1SFO H;  5M3M G;  1CK1 A;  4BBS B;  4H13 C;  4X62 L;  1O78 A;  2H4O A;  3K8A A;  3H3V H;  3PV0 A;  3SHL A;  3A56 A;  3JC6 6;  4POF A;  2RKS A;  4RGO S;  5GAH C;  3U50 C;  2JXM B;  1XPR A;  2B39 A;  1E7Z A;  2YTY A;  5J1Z A;  1PZJ D;  2E2J H;  2NVQ H;  5E7N A;  4I65 A;  4PQX A;  3GTP B;  4S3S A;  3NWT A;  4DKA C;  3BU2 A;  2EXZ A;  2Z8L A;  5EPK A;  1A2T A;  4FDB A;  1WTH A;  4F88 A;  5DM7 3;  4X64 L;  4JBK A;  4GKK L;  1FJG Q;  4G7Z C;  5FLM H;  4ZCK A;  2PZW A;  4WOR A;  3BS1 A;  1I3Q H;  1LTA D;  4A3D B;  1HNW L;  4DR4 Q;  1EWH A;  2LY7 A;  2I5M X;  2UXD L;  2F03 A;  4MTN A;  3HOV G;  4KKS A;  2AWN A;  3RN5 A;  4DK3 C;  4KN7 C;  3PO3 H;  4BXX G;  1TWC H;  1IKL A;  3A7A B;  1STA A;  5FK9 C;  2R7D A;  1H9K A;  2K5W A;  5IYB G;  3VR6 A;  4RH6 A;  4JI0 Q;  2B8F A;  5LMN W;  2ZTC A;  4KY7 A;  4NP5 A;  3K5N A;  4BY1 B;  4UP8 A;  3S15 B;  2ICE C;  2PW7 A;  5CV5 A;  3G71 A;  4C3I B;  1B50 A;  5DM6 3;  2NVT H;  3HOY H;  4P75 A;  3MZ5 A;  1Q8I A;  1TWH B;  1HH2 P;  2J0T D;  4N9T A;  4CDD C;  1X3P A;  4DNI A;  2EYP A;  2EY2 A;  2NZ1 D;  4KHP Q;  4B3S Q;  3S1Q H;  1WCM H;  1SR3 A;  1AE2 A;  3RLF A;  4GOP C;  3HEJ A;  4GNX A;  2E2H B;  1SNM A;  1ENA A;  5LMN Q;  2F0N A;  1YNJ D;  4LF4 L;  1KLG D;  4R9W A;  1HTL D;  5DAU A;  5LMU L;  4J6H A;  3SK8 A;  2Q2H A;  4CHT B;  4EQO A;  3H15 A;  4UP9 A;  5A2Q E;  2GVA A;  5DEH A;  5EBC A;  1AZQ A;  4A3K H;  4LFB Q;  2ID0 A;  3C1E A;  4LF6 Q;  3SK4 A;  5C4X G;  4Q5V A;  1HR0 L;  2VUM B;  4R1J A;  3A5Z B;  4PV1 C;  4NXM Q;  2I5L X;  1SYB A;  2K01 A;  1QE6 A;  4JBJ A;  4TVA B;  4BY7 H;  4IUR A;  2BH2 A;  1VMP A;  5CC4 A;  1X32 A;  3HKS A;  1ZXT A;  1UE7 A;  2FMC A;  2EY6 A;  3D4W A;  5BN3 A;  3PO2 H;  4A3J G;  4JW0 A;  4DR1 Q;  1S5F D;  3BVM A;  2ASB A;  1B44 D;  4FP5 D;  2EYO A;  2XTI A;  1N33 Q;  2H5X A;  2WB1 B;  5C3X A;  1VQA A;  3H3V I;  4L6T B;  2B2U A;  4DUZ L;  3NXW A;  5M5X H;  3TME A;  2IWH A;  5C3E H;  3J80 c;  1TS5 A;  3CQZ B;  3J7Y W;  3MHB A;  1G51 A;  1H95 A;  5D65 A;  5IGG A;  4AQY Q;  3V2T A;  1XMQ L;  4LAA A;  4JVZ A;  5IE8 A;  3J7A V;  5C4X H;  3TZD A;  3DUZ A;  2EE1 A;  1PRT B;  3KLR A;  3FPU B;  3DM1 A;  1WD0 A;  2EJF C;  2L0C A;  1BOS A;  3E9H A;  1KAW A;  2EY1 A;  2R7Z G;  3RLO A;  3MXP A;  1I94 Q;  5BR8 L;  3C3L A;  3ICE A;  1UWV A;  2D9U A;  3A0J A;  1CM9 A;  4K6L A;  1S5D D;  1STY A;  3CC4 A;  1H9R A;  3MA2 B;  3GTO B;  1XTC D;  1B3A A;  1JE4 A;  5JPM C;  2F0P A;  1SE2 A;  3A55 A;  3E0E A;  4QY7 A;  5I4D A;  4DR6 Q;  3H6M A;  4K6D A;  2VS1 A;  3S2D B;  1I4P A;  1GUG A;  2E2I B;  2F0T A;  3NHH A;  3KF8 B;  5AJ3 Q;  1NCV A;  1Q3L A;  1FD7 D;  3L2P A;  5C5M A;  1MGS A;  2XNA C;  1MHW C;  2UUA Q;  2WAC A;  3UDI A;  1L0Y B;  4B08 A;  2P5Z X;  4X64 Q;  3SEB A;  2PQE A;  2IT1 A;  1I50 B;  1SND A;  3HOV H;  4QGU A;  4L8J A;  4WRD A;  4P72 A;  2Y0S B;  3T1H Q;  2DN8 A;  1G91 A;  1PTO C;  1VF7 A;  1KRS A;  4JBW A;  2O4X A;  2VQE Q;  5ELB A;  3NBH B;  1KTK A;  4DV7 Q;  2NZH A;  1E22 A;  2KQ3 A;  2VL6 A;  4BA1 I;  1V1P B;  1VF5 C;  2SNS A;  4LFA L;  3AMU A;  5AFW A;  4A3I B;  2OTL A;  5M5X B;  1U4R A;  2DJF C;  1AE3 A;  3QO2 A;  1PFN A;  1RTO A;  5IGE A;  1XJV A;  1JOR A;  4DR7 Q;  1JWU D;  2WB1 G;  1AH9 A;  1X54 A;  3PGZ A;  4R8I A;  3T1Y Q;  1C4Q A;  1L1O B;  3M4Y A;  1AN8 A;  4QUF A;  3M4O B;  2L5T A;  1HFG A;  4IZ8 A;  1L0X B;  3M7G A;  1QIL A;  3I73 A;  1DM0 B;  3J81 i;  5E4X A;  2AUJ D;  4B3T L;  1D5Z C;  2QCP X;  5K36 G;  2WB1 E;  4HIK A;  1DGS A;  3MC0 B;  2NN6 H;  3S1N H;  4A3F G;  1PFB A;  1HZB A;  2Z6K A;  1U5K A;  1VQF A;  4LNQ A;  2B2Y A;  2D0P A;  4XYQ A;  4A3B B;  1PZK D;  1Y1V H;  4F87 A;  3I4M H;  3NQI A;  4XTC S;  1K83 H;  4RA8 A;  1IKM A;  3MFG A;  4JI0 L;  1X55 A;  2UXC L;  4HID A;  1CQF A;  1QZH A;  1WCM B;  5JVG 3;  4M8A A;  4ME3 A;  3PIP 3;  1G29 1;  1W6J A;  2CH4 A;  3GTL H;  3W3A A;  2X6L A;  3CAM A;  3CP0 A;  2K28 A;  1OXV A;  2EYJ A;  4ZAI A;  4C3I H;  3S15 H;  4B3S L;  1NNX A;  4BY1 H;  1S5E D;  2HT1 A;  1CHQ D;  3VR2 A;  2RF4 A;  4IUV A;  1IW7 C;  3GTQ B;  4FF4 A;  1ZYR C;  3QIA A;  4HJ8 A;  2D5D A;  4DA2 A;  1ESF A;  2PW5 A;  5JJZ A;  5IIF A;  3S14 B;  3VDY A;  2JP1 A;  4YY3 L;  2B2W C;  2A6H C;  3NQT A;  3DEP A;  4A3G B;  3CPF A;  3EA6 A;  3Q6S A;  5C3W A;  1VQ8 A;  3HOZ H;  4LF7 L;  2OCE A;  1TII D;  2JA7 G;  1D5X C;  1CKN B;  4NXM L;  2XVS A;  4CBV A;  4J8Q A;  4DV3 L;  1I3Q B;  4NKL A;  4A3D H;  2UXD Q;  4ULL A;  4OX9 L;  4MTK A;  1EIG A;  1EOT A;  1MI2 A;  3TRZ A;  4NDX A;  1OO9 B;  2F0V A;  5KIX A;  3TS0 A;  1LV9 A;  4KJO A;  1TWA H;  3J81 j;  4HSV A;  1PH1 A;  5M3F G;  4DU9 A;  1O7Y A;  2NVQ B;  4MZ9 A;  2K5V A;  4KHV A;  4JG2 A;  4DUZ Q;  2F52 A;  4UY8 C;  3OTO Q;  2R92 G;  3S2H B;  1HJP A;  1B9M A;  4JI1 L;  3J81 L;  3ZYY X;  3CW2 C;  3E5S A;  4LFC Q;  2VZA A;  2Z0S A;  4PMW A;  2XRS D;  3NBH A;  3KFU A;  1SMY C;  1EYA A;  1LTT D;  1XWE A;  1V9P A;  2B63 G;  1T5E A;  3MXN B;  1TWA B;  1B7Y B;  3SXH A;  3KLW A;  1J5E L;  4YCV A;  2UUA L;  1K3B C;  1LT3 D;  4BY1 G;  1VMC A;  2HCC A;  4R4C A;  2J7Z A;  1IYJ B;  5BN4 A;  4A3B G;  2DGY A;  2KVM A;  3HOX B;  1KLU D;  3K81 C;  4DXF A;  1JE5 A;  4CKB A;  5HGT A;  1K0S A;  2G9H D;  3MXN A;  3PUY A;  4UAI A;  3RN2 A;  2F4I A;  2EZV A;  3TZU A;  2UXB Q;  1BCP D;  3F2D A;  4GN5 A;  3CPW A;  3BZD B;  5BN5 A;  5C4J H;  1IBM L;  2HHH Q;  5M5Y H;  4ZKB B;  2PI2 A;  2M2L A;  5KGU A;  3MEF A;  5J22 A;  1WI5 A;  3GTQ H;  2UUC Q;  4NW2 A;  2KCC A;  3FKI H;  2F0H A;  3TP5 A;  3DM3 A;  1V43 A;  2NTT A;  1PA6 A;  1K9M C;  1EIY B;  2OT2 A;  3TP7 A;  5K36 H;  1LTL A;  1UNS A;  1H9S B;  5CV7 A;  2EY5 A;  3X3M A;  2F0S A;  2KEE A;  1EYG A;  1GUO A;  1BCP C;  3RMH A;  1O80 A;  2WKD A;  5TSS A;  3I56 A;  1DOK A;  1I4Q A;  1OXX K;  2B2W A;  2F0L A;  4AQY L;  1XMO L;  3E0J A;  1VQJ A;  1Y69 U;  2O5J C;  1Y1V B;  5E3F A;  1HNX L;  1CA6 A;  1W2B A;  2F0K A;  4ME5 A;  1JIC A;  3R8B A;  4OIJ A;  1PTO B;  1Q1B A;  1TXY A;  3ERQ A;  4XXE A;  1EZ6 A;  2CCZ A;  3R2T A;  4V19 0;  1HA5 A;  1I4H A;  1U9R A;  5C0X H;  3JAM i;  1X3Q A;  1PH8 A;  1CKO A;  2Y0S E;  1RL2 A;  1JQY D;  2CHB D;  1YIT A;  3DEO A;  3S17 H;  4FNF A;  1YJW A;  2K7V A;  1XNR Q;  1WTR A;  1Y1W G;  2K5Q A;  1VQL A;  1HFN A;  1OXS C;  1FNU A;  1JOK A;  2QA4 A;  3AEV A;  2KHS A;  3HOX G;  4RGN A;  3CHB D;  1LM0 A;  3TDQ A;  1XX8 A;  1JR0 D;  4HR7 B;  5JPN C;  4C3H H;  4BWG B;  2ZJQ A;  4KV6 A;  4B3T Q;  2JA5 H;  2ZTD A;  5A35 A;  4JI2 Q;  1Z9F A;  1I50 H;  1KAB A;  5H1S E;  3HOV B;  5EQ0 A;  5EGT A;  1SRU A;  1HQR D;  5DLQ E;  2CQA A;  1SE8 A;  1WJJ A;  1G8Z D;  4ABN A;  3M85 A;  5A2Q L;  2R7Z H;  1Z6H A;  3EFX D;  1TWF B;  4PMB A;  4DUY Q;  3M3Y H;  5JEA J;  1T9H A;  2OTJ A;  2EIF A;  2A1A A;  3CCS A;  3GV3 A;  3KYH C;  2LFN A;  3VR5 A;  3OTO L;  1UE1 A;  4HAE A;  1NMF A;  2A69 C;  5EAY A;  2EPB A;  3R2I A;  3OW7 A;  3V05 A;  1D2B A;  4O0A A;  1DCZ A;  3TRE A;  3HGB A;  1NY4 A;  1H9J A;  1TWF H;  1A3V A;  2KCM A;  4DV3 Q;  1B53 A;  2BE5 C;  3BZK A;  3IRB A;  4RWS C;  3EQL C;  4GNX C;  4JV5 Q;  4GOP A;  2B2T A;  1B8A A;  1VQ5 A;  4A3J H;  4YY3 Q;  2XWB B;  1YNJ C;  3DWP A;  4RCN A;  5FO8 B;  3QJY A;  2RSO A;  3CXC A;  4C3H B;  4KKU A;  1PYW D;  2MHV A;  2EYL A;  3LX0 A;  1FL0 A;  1ICF B;  4A3F B;  4QIW B;  4HN7 A;  4JYA Q;  4HJ9 A;  3IFD A;  1U4P A;  4DFA A;  2Z6K C;  3I91 A;  4B3R L;  1ASZ A;  1GKH A;  4N8X 1;  3UE1 A;  1EWC A;  5IOC A;  2FIN B;  1SNQ A;  2NBF A;  3GQB A;  1M1K C;  3LNN A;  3S16 B;  1SAP A;  4O42 A;  1B4O A;  4X6A H;  1S72 A;  3NTI A;  1TU2 B;  1ENC A;  3PUW A;  1HNZ L;  5IGD A;  3D0F A;  4OO1 G;  4YWM A;  4K2L A;  4GLX A;  5D3I B;  3TSS A;  5M9O A;  1LTS D;  1CUK A;  1I6H H;  2PPB C;  1PTO F;  1HNX Q;  2BDN A;  1J5E Q;  3FVQ A;  1AW7 A;  2ZT9 C;  1U4L A;  3HS0 C;  5IYB H;  3NEL A;  1IBK Q;  1EY6 A;  2Q8I B;  4K14 A;  3KLS X;  3C46 A;  2BDO A;  1STG A;  4KY6 A;  2A8V A;  2IX1 A;  3M7N A;  3MXG A;  2MO1 A;  3S1Q B;  1BUV T;  1QCB D;  3F8T A;  2KCN A;  1I4G A;  3GTJ H;  3J7A F;  3K0X A;  3P1H A;  4GS3 A;  1Q46 A;  1JOO A;  2N78 A;  4OIK A;  4TSS A;  4KLK A;  5EPJ A;  4KN4 C;  1IW7 D;  1N36 L;  3ULL A;  1DXM A;  3N52 A;  1I4R A;  4K5X A;  3FP9 A;  5M3F B;  5C4J B;  3X3N A;  2Q8R E;  2WFW A;  4LUO A;  1TKW B;  3TP8 A;  2JSO A;  1HTP A;  4DNR B;  1IYV A;  1K3R A;  2EYF A;  1CZG A;  4GNX B;  2F0G A;  1K28 A;  3MFY A;  1X6O A;  3KBG A;  4OL7 A;  1TWG H;  3VYT A;  4RAU C;  4JBM A;  1EIF A;  3KBX A;  4Q0F A;  4DN4 M;  2ZM6 Q;  2B2V C;  2C9O A;  2MGS A;  3D3R A;  2F0J A;  1CT1 D;  3BJU A;  3N6R A;  4N9P A;  2RHS B;  4QF4 A;  4DR2 Q;  3OMC A;  1JJC B;  2DNE A;  1XNR L;  3GTP H;  2VB3 X;  1STH A;  4XQQ A;  1LT5 D;  3WOE A;  2E2J B;  1TQO A;  2A6E C;  1XTD A;  4OWX B;  2E5L Q;  4HCE A;  1QVC A;  2AUK A;  1O7I A;  1N8R C;  2KA7 A;  2A69 D;  2BA1 A;  1Y8P B;  3BG3 A;  1MSG A;  4BBS H;  2ICI A;  1GUW A;  5L37 A;  4DK1 A;  2MP1 A;  5KND A;  4G4K A;  4JI3 L;  1F9S A;  4C2M H;  1V1O A;  2NVY H;  1Q12 A;  3KLS A;  3SK5 A;  1EWI A;  1GHJ A;  4IOC A;  4P71 A;  4IUU A;  4IUT A;  1E2W A;  2G5D A;  3HG9 A;  4QCL A;  4I7Z C;  3E3X A;  1GUS A;  4KD4 A;  4RKL A;  5JEA G;  2C35 B;  2F3V A;  1LUZ A;  1KNE A;  1L1O C;  5IYC G;  3A8K E;  3Q0A A;  1TWG B;  1DJR D;  1PRT C;  3BDC A;  3PUZ A;  4DAM A;  1ASY A;  1PZI D;  4HSP A;  3CF5 A;  3HOZ B;  5ISR A;  2R92 H;  1B70 B;  3KK7 A;  5G3L D;  3RZD H;  4IFD H;  5I9P A;  2BCO A;  3KF8 A;  5M3F H;  1F2M A;  1WFQ A;  3BYT B;  1X3G A;  1YZ6 A;  5E4W C;  5C0X J;  2K5H A;  2X69 A;  3AU7 A;  4JYA L;  3H0G H;  4B9W A;  4KHP L;  1B3Q A;  1A8V A;  3LGJ A;  4HJA A;  1HR0 W;  1BBW A;  4FYD A;  4A3D G;  3J7Z C;  2WII B;  2LXK A;  4DAY B;  1HCZ A;  3DHQ A;  4O1N A;  3I3C A;  1PH2 A;  3GV6 A;  5IYD H;  5KNC A;  2JA7 H;  1V1P A;  3BZC A;  1DOL A;  1CQV A;  4LFB L;  4A3E B;  1K8A C;  1PRT F;  2QDB A;  4MIU A;  2AMC B;  2ZXP A;  1JB3 A;  2OF1 A;  3RUZ A;  1XMQ Q;  2PO4 A;  1PYS B;  1SYF A;  2I46 A;  5IT9 c;  1G2S A;  2NZO A;  4JI2 L;  4Y7N H;  1P16 A;  3K57 A;  1RIP A;  2DJG C;  1QG7 A;  1I6H B;  5M5W B;  1EY4 A;  2ZXR A;  1HZA A;  2F4V L;  5JJL A;  2L12 A;  3FPP A;  4C3I G;  1MSH A;  1XPO A;  2J4X A;  2IX3 A;  1VCI A;  2L4N A;  4HMI A;  1N9W A;  2V4D A;  4XIG S;  3CCL A;  1KRT A;  3M4O H;  3K7U C;  3S16 H;  3F2C A;  3K5M A;  1RDP D;  3NPP A;  4ILW A;  1ILP A;  3CRL C;  4DV0 L;  1YIJ A;  3CCJ A;  2CWP A;  3KF6 A;  3L0O A;  3NSW A;  2MQH A;  2OQK A;  3T13 A;  2OXP A;  1YHB A;  2R6G A;  3L7Z C;  4A3F H;  4FXG C;  3OPO A;  1HRJ A;  3I8Z A;  5LMN L;  4UP7 A;  1BBX C;  4CGY B;  4GLV B;  3FRP B;  3K5O A;  4KK7 A;  5IGB A;  3CC7 A;  1ZKO A;  1XPU A;  1I94 L;  2E76 C;  2RHQ B;  3IFT A;  4A3J B;  1PMR A;  3I7F A;  1JJ2 A;  4OO1 I;  4KHZ A;  5CMD A;  1PLF A;  3G6J B;  1EEF D;  3U4V A;  1N34 Q;  2N55 A;  2PQA A;  4X65 Q;  4EGV A;  3EJI A;  4XDX A;  2E2I H;  1LTI D;  3V96 A;  1AEX A;  1QUQ B;  2K6A A;  3BDO A;  3T4A C;  4OXP A;  3R93 A;  4NMZ A;  2F0I A;  3GO5 A;  5I9O A;  2Q2T A;  4PG3 A;  1EFI D;  2EJG C;  3CU7 A;  3MXU A;  1X56 A;  2E74 C;  1N33 L;  2SOB A;  1D5M C;  4CDF C;  2ZTE A;  1LT4 D;  2AQ3 B;  1D1I A;  2B2U C;  4NB3 A;  3UDF A;  5K5P A;  5CR3 A;  3HKZ B;  1ILQ A;  3M3Y B;  4YIJ A;  4IUP A;  4R8N A;  1BF4 A;  1BKB A;  5JJI A;  4DK6 C;  4DGZ A;  5T1G A;  2VQE L;  3NWS A;  2RCF A;  1E1O A;  3K6O A;  2NYZ D;  4P74 A;  5C4X B;  1CKN A;  4XYO A;  3GTM B;  4RGM A;  4OO1 H;  1A63 A;  4B3M Q;  4DAY A;  4DAP A;  3U9S A;  3I90 A;  4YHH Q;  1VDZ A;  3ERS X;  1QNU A;  5GAD C;  3CRK C;  2EQS A;  2I07 B;  1TS3 A;  2C5C A;  3D6W A;  5C3E B;  4HJ7 A;  3H91 A;  4JOI A;  1YJN A;  3RR5 A;  2EYM A;  2PMZ E;  1E24 A;  3FMC A;  3PSI A;  5IY0 A;  4A3I G;  2LKV A;  3ITP A;  3KJP A;  1YNN C;  5CGK A;  2OQ0 A;  2AKW B;  1JCK B;  2K03 A;  1GM5 A;  4JI7 L;  3DWA A;  1LAB A;  1SYD A;  3FEW X;  1EYD A;  3D31 A;  4ID6 A;  4B9X A;  4BY7 B;  1GO3 E;  1VQO A;  5HGQ A;  2IHE A;  4ZLT F;  4P73 A;  4JI3 Q;  1CZW A;  3DLL A;  1BBU A;  1BVS A;  3KF6 B;  4L5Q A;  1V1Q A;  3KDF B;  2F0O A;  4GLA C;  4EQ5 A;  2XIW A;  3K58 A;  1A3U A;  4RFB A;  2HUG A;  2BH8 A;  1ICW A;  3HOW G;  2Z1C A;  3NBI A;  3Q24 A;  1WTP A;  1GOZ A;  2BE5 D;  3W2D A;  4DV7 L;  3CMA A;  2YYZ A;  3A8I E;  1SMX A;  4DR2 L;  4EVO A;  5C44 G;  3HOU B;  5CV9 A;  1TR5 A;  4M1U B;  1F2Z A;  3C1F A;  1CSP A;  3GD7 A;  4UPA A;  4BY7 G;  4PNY A;  5HY6 A;  4LF8 L;  3K0Y A;  4JK1 C;  2L55 A;  1D8L A;  1KAA A;  1SEB D;  5GRO A;  1LLR D;  4IFD J;  4QL5 A;  4JI4 L;  1FNW A;  5G3L F;  3RLN A;  2RA4 A;  2B2V A;  1Q81 C;  1K8G A;  1Z47 A;  1EU4 A;  2YV5 A;  2PNH A;  4LF5 Q;  4KJN A;  3SDZ A;  4WJ4 A;  5M5Y B;  2MUY A;  3HOW B;  2ZJR A;  3VYU A;  3QG1 A;  1EY9 A;  2HQL A;  1WCM G;  2CW0 D;  5HUR A;  2KCT A;  4LUV A;  4DR3 L;  4L5R C;  2WIN B;  1NAP A;  4C3H G;  1HQM C;  1KQS A;  1E0B A;  2X6G A;  3S1M B;  1PV4 A;  4XT3 B;  2JEB I;  2RDF A;  3HOY G;  2VQF Q;  3HOX H;  2JA6 G;  4TQU S;  1O7L A;  4GZY C;  2FXQ A;  3K80 C;  1QVF A;  4K2K A;  4JI1 Q;  3CD6 A;  4DV2 L;  4H0L C;  2F0D A;  4OGQ C;  1Q86 C;  1Y1W H;  4OWT B;  1II3 A;  4IJH A;  3PO3 G;  2ENB A;  1VQP A;  2GN5 A;  2ALY B;  5C0X I;  3K5L A;  1STE A;  3M4Q A;  5IGC A;  3S2H H;  3PF4 A;  5ELN A;  1FYC A;  3S24 A;  3Q23 A;  3P75 A;  4ZQ3 A;  5EKL A;  3T53 B;  1SFO B;  2HQE A;  2LS0 1;  2XGT A;  5EBD A;  4C3J H;  2EVB A;  3C2P A;  3Q22 A;  1ENF A;  1VQ6 A;  1PRT D;  5F2D A;  1O7Z A;  3GP7 A;  4KTA A;  4ZRZ A;  2B63 B;  5ELE A;  2BOS A;  1KDB A;  1QZG A;  3L3O C;  1SNP A;  3I2Z A;  1JOQ A;  3FHW A;  4BBR B;  2D2C C;  3GDE A;  2KEC A;  3P7J A;  1EY8 A;  5FOB B;  2UU9 L;  2JA6 H;  1SE4 A;  2B2Y C;  4X66 L;  3QR8 A;  2K32 A;  2NWG A;  4C1N K;  4KI0 A;  4TKO B;  4A3G H;  1UEB A;  2RBM A;  3Q8D A;  1VQ4 A;  3FDT A;  1UE5 A;  1RKN A;  3S9W A;  2K04 A;  3NTH A;  3STB D;  2IY5 B;  2B29 A;  3S14 H;  2D0O A;  2M9V A;  3NK9 A;  1YJ9 A;  1XNQ L;  5FLX E;  1ZYR D;  5FLX c;  1N34 L;  4DV5 L;  1CHP D;  4GKJ Q;  4R4T A;  4X3U A;  1IBM Q;  4IFD I;  2MPM A;  5GQO A;  4X3S A;  5IP7 G;  2HDM A;  5IWA Q;  4RCO A;  3URY A;  4JI7 Q;  3PIP A;  2UUB L;  3A7L A;  4KD3 A;  3GTL B;  3I70 A;  1GVP A;  4FXK C;  3ULP A;  3CC2 A;  2JEA I;  2A6E D;  2AQ1 B;  3IKJ A;  3RNU A;  2HCI A;  4DV1 Q;  5C44 H;  1DZ1 A;  4DNT B;  4DR5 L;  1K8M A;  1K83 B;  1SYC A;  3A54 A;  5I6Y A;  3I55 A;  1GJX A;  3I4M B;  2KEN A;  1KC8 C;  4FF1 A;  4IOA A;  4A3B H;  2TMP A;  4LJZ C;  1VQM A;  1WTW A;  3VA5 A;  4JI6 L;  3NTK A;  1NTG A;  1U0L A;  3I4O A;  4J15 A;  2UXB L;  3S1N B;  5FJ8 H;  4RHS A;  1CSQ A;  2B63 H;  1BQQ T;  3GTK H;  5EKI A;  1V8Q A;  4CDE C;  3S1R B;  2IX0 A;  3F2B A;  3MVV A;  2QEJ C;  1ROD A;  1K73 C;  1SBB B;  2VXW A;  1F9P A;  3PUX A;  2K5N A;  2R93 H;  2NVX B;  3KJO A;  1KD1 C;  1K0R A;  2NB0 A;  2ATW A;  1YNX A;  4DV4 Q;  2Q8T A;  2K50 A;  4A93 G;  2K52 A;  2F0Q A;  1VQD A;  5ELD A;  4PZ7 A;  1SDF A;  4I7A A;  5KYI A;  1A2U A;  4JI8 L;  1F9Q A;  1Y1W B;  4A3I H;  2GA4 B;  3VA7 A;  3J7A 5;  4DR4 L;  3TQY A;  3AQQ A;  4QJF A;  1EYC A;  1X9N A;  1GXD C;  1LT6 D;  1UEA B;  2KUM A;  4G7O C;  3G7L A;  3H3V C;  3PUV A;  1YHQ A;  5D3D A;  3VYS A;  4JC0 A;  2F0E A;  1B2T A;  3EN2 A;  3S1M H;  3QWN A;  3HOZ G;  4A3L G;  3KUP A;  3BYY B;  4ALP A;  2O2L D;  5EJW A;  1LO5 D;  3J80 i;  4YHH L;  3G6E A;  4A3M H;  2L11 A;  1CA5 A;  4ZYS A;  5ELC A;  2XRQ D;  5CV6 A;  1RCV D;  4HJ5 A;  2DY7 A;  2MO0 A;  1E3P A;  4U67 3;  3HP3 A;  1KNA A;  3S2D H;  1M8A A;  4PZ6 A;  1NUC A;  2N3S A;  1OXU A;  1W6K A;  5CBE E;  2E75 C;  3OOC A;  4V0B A;  2VUM G;  4QQB X;  2FHT A;  3GTO H;  1J8I A;  1LTG D;  3SE0 A;  1TY0 A;  4DR3 Q;  1JC7 A;  5I6W A;  1SN8 A;  3HOU H;  1XXG A;  1EU3 A;  3D8G A;  1TT2 A;  1Y1V G;  3P20 A;  1L0W A;  4XQJ A;  4XQN A;  1FJG L;  3TBI B;  1S40 A;  3TS2 A;  2FFK B;  3G48 A;  2NN6 G;  5ELO A;  2K1B A;  1PVO A;  1EOV A;  1X3E A;  3CQZ H;  1A15 A;  5IGF A;  4UDU C;  2VQF L;  4CDC C;  4DV6 L;  4FF2 A;  4PZ8 A;  4FF3 A;  2WAQ G;  1CFM A;  3VR3 A;  1H9S A;  1QVG A;  3BVG A;  1HPC A;  4DV5 Q;  3F1Z A;  2LMC B;  1AP0 A;  4JI4 Q;  1Y14 B;  1MD2 D;  2PZU A;  1PHJ A;  1EL0 A;  1I6V C;  1AZP A;  1X65 A;  2TSS A;  3PO2 B;  2CKZ B;  5C4Z A;  3CME A;  4H44 C;  1EY5 A;  4OHJ A;  3ERO A;  3STB C;  1QUQ A;  1SYE A;  1PH6 A;  2OEO A;  1OTC A;  5J3B A;  1HUN A;  1FNV A;  3E6Z X;  3QB3 A;  3PIO A;  1Z7T A;  5IT9 E;  3AYH B;  1ESR A;  1KIX A;  2VUM H;  2WAQ E;  4LF4 Q;  5LMU Q;  2WV6 D;  4A4I A;  4A3K B;  3GTM H;  2QGQ A;  1EIH A;  3AB9 A;  3PCO B;  3QOL A;  3NEN A;  4JI6 Q;  1RHP A;  2PCF B;  2N8N A;  3UE0 A;  1SLJ A;  1TY2 A;  4XT1 B;  1XNQ Q;  4IUQ A;  1Q7Y C;  2L9H A;  1HR0 Q;  2DY8 A;  2E2H H;  1G6P A;  1PH9 A;  2IPK D;  3J81 E;  1JT8 A;  4A3M G;  2UU9 Q;  4FO2 A;  4TRD A;  4DV2 Q;  2E8G A;  4CKE A;  1EY7 A;  1KDA A;  3NEM A;  2MFI A;  5GAG C;  4DR6 L;  2IJ0 A;  2UUB Q;  1NR2 A;  2SEB D;  1TWH H;  1YBY A;  5C4H A;  3HOY B;  2NVT B;  1PH7 A;  1PH3 A;  4DR7 L;  1ONL A;  1UAP A;  5CBA E;  2WKC A;  1D7Q A;  5E1F A;  1EUJ A;  3NP8 A;  1VQI A;  1STB A;  2QF7 A;  4IN3 A;  1PDQ A;  2XN9 C;  3EIV A;  2JN4 A;  4JI8 Q;  1D1K A;  3U9O A;  3K7A B;  2F0W A;  2KJX A;  1TWC B;  1EQV A;  1IBL L;  3PO3 B;  3GTG H;  1N32 Q;  1IL8 A;  2A68 C;  4A93 H;  2IL8 A;  4A3M B;  2Z4H A;  3W1B A;  4LF9 Q;  3DWQ A;  4IFD G;  3L9A X;  5KNB A;  1EQT A;  1SRO A;  2Y0S G;  2R93 G;  5J39 A;  1JWS D;  1Y8N B;  4IAL A;  2KHJ A;  1C9O A;  4LFA Q;  4AH6 A;  2CW0 C;  2HIV A;  2CH4 W;  5C3E G;  1QWY A;  3HRZ C;  1WYD A;  1SSO A;  3OIP A;  2KHI A;  4QUC A;  1A6X A;  1TVX A;  2E5L L;  5BR8 Q;  5FJ8 G;  4X3T A;  1BR9 A;  1QJO A;  2RCN A;  4FXD A;  1KXL A;  4O2D A;  2ZM6 L;  3T1Y L;  2KED A;  1C8C A;  3PMF A;  4APV A;  5C5L A;  1FGB D;  3ONA B;  1F2Y A;  5C6A A;  1SYG A;  1J6Q A;  1WTV A;  1JJG A;  3PO2 G;  1A62 A;  5M3M B;  3SK6 A;  2ZJP A;  4IPD A;  1VQN A;  1VQG A;  4BBS G;  1Q90 A;  2JQO A;  3RZO B;  1G6Z A;  4K0K Q;  1DYQ A;  2NVX H;  4NPS A;  4IUN A;  2QW7 A;  3BVZ A;  1XYI A;  1U4M A;  4RHR A;  4NXN Q;  5IOD A;  3D6C A;  3DXJ C;  1F77 A;  3I4N H;  4H02 A;  1VQB A;  1KL9 A;  1CKM A;  4A3K G;  4HCS A;  4MHE A;  1KHI A;  1LTR D;  2ZXO A;  3B6Y A;  1DOM A;  1SNC A;  2A5H A;  4WJW A;  1YHA A;  1S4Z A;  4Y7N B;  1PFS A;  3NE5 B;  2HIX A;  1I5F A;  4LK1 C;  1GD7 A;  3HZX A;  3I4L A;  3K59 A;  2PNR C;  4RKB A;  4A3E H;  2VNU D;  3RD4 A;  4G7H C;  4A3C H;  3TP6 A;  4A3G G;  1IL2 A;  2JA7 B;  1R4Q B;  5IT9 L;  3A5U A;  4YCU A;  4WFN 3;  4DV6 Q;  3AFP A;  4C1N I;  4G57 A;  5JVH 3;  2EOT A;  1H9M A;  4KY5 A;  3LWU A;  1ET6 A;  2NTS A;  4BBR G;  2F0F A;  3U4Z A;  4UHV A;  3JAM E;  3J81 c;  5T1I A;  4BXX H;  3UDG A;  4LF7 Q;  3H94 A;  1STN A;  1QOH A;  3ND9 A;  4C3J G;  5LHY 1;  2EXD A;  1HHV A;  1TS4 A;  2SNM A;  3CCR A;  2D62 A;  1I4X A;  1HUM A;  1C7Y A;  1EY0 A;  2R92 B;  2CVR A;  1PTO D;  3AFQ A;  5FLX L;  3QOJ A;  3OWF A;  5FLM G;  1DON A;  2JA6 B;  1SE3 A;  1VQE A;  3MAQ A;  1MBY A;  4EQN A;  2Z9H A;  1FR3 A;  4BBR H;  3JAM L;  3T51 B;  1HZ9 A;  1MKH A;  1R4P B;  2UXC Q;  3J80 L;  2IHF A;  1BO0 A;  2K75 A;  4RG1 A;  3WOF A;  2B8G A;  3UI2 A;  4E6I A;  1WOC A;  1S5B D;  2EJM A;  4X65 L;  3I4N B;  2NUC A;  5KEE A;  5COY A;  4R4I A;  4C3J B;  2F3I A;  4DPG A;  1Y8O B;  1QB5 D;  2A6H D;  2JK8 A;  3OHX C;  5JJK A;  2CQO A;  2F4V Q;  1EQR A;  1WTO A;  2UUC L;  2R7F A;  4A3C G;  2L1B A;  1X3F A;  1L1O A;  3RZO H;  4A3E G;  4R4O A;  3KDF A;  5M3M H;  1C48 A;  1CTM A;  2K14 A;  2AHO B;  3CCU A;  4MN3 A;  3WWV A;  3CCV A;  2KBN A;  2HDL A;  4RMF A;  3A8J E;  4MNO A;  4DV0 Q;  4IJL A;  5FO9 B;  4IPH A;  4U68 A;  4LFC L;  3SR1 A;  1WTQ A;  4HED A;  3W1G A;  3PQI A;  2PZT A;  2F3W A;  1E2V A;  3BDL A;  1L2F A;  3I4N G;  2RQX A;  4LF9 L;  3SVM A;  3M4P A;  4IPG A;  4CKC A;  5ELF A;  5JOB A;  4EQP A;  1BCP F;  1PH4 A;  4BS9 A;  4N8F A;  4PMC A;  2HHH L;  1R9T B;  4OX9 Q;  3EBE A;  3MWY W;  1MJC A;  2SDF A;  4A93 B;  1NBW A;  3MTS A;  3OW2 A;  3GTG B;  4JOI C;  1NE3 A;  3HOW H;  3K7A H;  5CV8 A;  2JE6 I;  2K05 A;  4L63 B;  4HIM A;  2A74 C;  2CWA A;  4X62 Q;  2VY3 A;  5I2X A;  4IO9 A;  1IBL Q;  1Q1E A;  4HTH A;  4ODG A;  4LWC A;  2RDG A;  4LMQ D;  4A76 A;  1RD9 D;  3JAM c;  3IAY A;  3IL8 A;  2RVL A;  1UUP A;  3GTJ B;  4C56 C;  1NJI C;  4AYB E;  4P2C B;  2I0Q A;  2FMM A;  2V1C C;  4B3M L;  2VW9 A;  2Q2U A;  4CJ1 B;  1HNW Q;  3PF5 A;  3G4S A;  2PMZ B;  1N32 L;  4LUZ A;  3F2U A;  3ZJY C;  1AFP A;  2H1E A;  4AYB G;  1OXT A;  1VQK A;  4JCV E;  2KOL A;  1XMO Q;  3OIQ A;  2JA5 G;  4LW1 A;  4YCW A;  1E2Z A;  2JA8 H;  4OON A;  2Q2I A;  4DUY L;  2K33 A;  4H7B A;  1JB7 A;  4K0K L;  2A68 D;  2MJ8 A;  2I5H A;  3HKZ G;  1C0A A;  5CYU A;  3CKI B;  4JI5 L;  4DXG A;  3ER0 A;  2YU9 H;  5KRU A;  3W5O A;  1NR4 A;  4GN4 B;  1HA6 A;  4YWL A;  2YU9 B;  3OYY A;  1MJE A;  1RTN A;  4DF7 A;  4K8J A;  3D4D A;  3OWE B;  5IP9 H;  4L5S A;  3U58 A;  1P8L A;  2A19 A;  2JA8 B;  4ZUJ A;  2NN6 I;  1F2L A;  4BA2 I;  1EQQ A;  5C0X G;  4NXN L;  3DMU A;  4Z9C B;  4F8M A;  2WAQ B;  1KDC A;  1M4V A;  4OWW B;  1EZ8 A;  1YI2 A;  4GN3 B;  1MIU A;  1RJT A;  2AWO A;  1WTX A;  2YTX A;  2QEX A;  5KYL A; 
#chains in the Genus database with same CATH homology
 1B1Z A;  2F0U A;  5EPL A;  4ZK9 B;  1IYU A;  5FKA C;  1CI3 M;  2K5D A;  5LL6 X;  1LAC A;  4CJ0 B;  4ZKC B;  1SNO A;  1T5X D;  1WVL A;  5CV4 A;  4QB4 A;  2EDG A;  2R7Z B;  1B9N A;  4F7X A;  4DAV A;  5FO7 B;  4AYB B;  1JWM D;  4CJ2 C;  4K8I A;  2AQ2 B;  2B2T C;  2F0M A;  3I72 A;  1GUN A;  2JA5 B;  1HXY D;  2XSC A;  3ND8 A;  5EKK A;  3T56 B;  1D6E C;  1BCP B;  2JYO A;  3TN2 A;  2N88 A;  1BNZ A;  1IHZ A;  4IQZ A;  3D4R A;  2DNC A;  1RF2 D;  1YNN D;  3J80 E;  1SMY D;  4K5V A;  1ET9 A;  3S17 B;  1WD1 A;  2R93 B;  4X3K A;  3PIO 3;  5I2Y A;  1PXU A;  1K8O A;  3WDN A;  2BA0 A;  3GTK B;  4J1M A;  2EYH A;  1PTO H;  5D14 A;  1G2T A;  2QKI C;  2R3Z A;  2FJ2 A;  3T16 A;  2QIL A;  1BDO A;  4ZUI A;  1GHK A;  1SJE D;  5C44 B;  5NUC A;  4K5W A;  4RGT A;  5DNF A;  4FVM A;  1SJH D;  1PFM A;  5LL6 S;  1QNK A;  2RDH A;  2G9D A;  4KKT A;  3O13 A;  2Z4I A;  3H09 A;  5JEA H;  3OMG A;  2A73 B;  3MEH A;  1ML0 D;  1F9R A;  3H0G B;  3FKI B;  4QMG A;  2XWJ B;  1TS2 A;  2RSN A;  3OSO A;  1GUT A;  4DK0 A;  1LTB D;  2IW3 A;  3RZD B;  3LWE A;  1A3T A;  5COR A;  1BXT A;  3NUC A;  4HMJ A;  3VYR A;  1NSN S;  2F1M A;  2O5I C;  1J9O A;  2WP8 J;  2VB2 X;  2M00 A;  2R61 A;  2PYK A;  1EEI D;  5JAV A;  2E2D C;  3VR4 A;  1S5C D;  1ZEQ X;  2NVY B;  3R3O A;  4C2M B;  1SXT A;  3EVQ A;  4KMU C;  1DD2 A;  1CK1 A;  4BBS B;  4H13 C;  1O78 A;  2H4O A;  3PV0 A;  3SHL A;  3A56 A;  2RKS A;  4RGO S;  2JXM B;  2B39 A;  5J1Z A;  1PZJ D;  4I65 A;  4PQX A;  3GTP B;  4S3S A;  3NWT A;  2EXZ A;  2Z8L A;  5EPK A;  1A2T A;  4F88 A;  5DM7 3;  4G7Z C;  2PZW A;  4WOR A;  3BS1 A;  4A3D B;  1LTA D;  1EWH A;  2LY7 A;  2F03 A;  4KKS A;  2AWN A;  4KN7 C;  1IKL A;  3A7A B;  1STA A;  5FK9 C;  1H9K A;  2K5W A;  3VR6 A;  4RH6 A;  2B8F A;  3K5N A;  4KY7 A;  4NP5 A;  4BY1 B;  3S15 B;  2ICE C;  2PW7 A;  5CV5 A;  1B50 A;  4C3I B;  5DM6 3;  3MZ5 A;  1Q8I A;  1TWH B;  2J0T D;  4N9T A;  1X3P A;  2EYP A;  2EY2 A;  2NZ1 D;  3RLF A;  3HEJ A;  2E2H B;  1SNM A;  1ENA A;  2F0N A;  1YNJ D;  1KLG D;  4R9W A;  1HTL D;  5DAU A;  4J6H A;  3SK8 A;  4CHT B;  4EQO A;  5A2Q E;  5DEH A;  5EBC A;  1AZQ A;  2ID0 A;  3C1E A;  3SK4 A;  4Q5V A;  2VUM B;  4PV1 C;  1SYB A;  2K01 A;  1QE6 A;  4IUR A;  1VMP A;  5CC4 A;  1X32 A;  1ZXT A;  2FMC A;  2EY6 A;  3D4W A;  5BN3 A;  1S5F D;  3BVM A;  1B44 D;  4FP5 D;  2EYO A;  2WB1 B;  5C3X A;  4L6T B;  2B2U A;  3NXW A;  3TME A;  2IWH A;  1TS5 A;  3CQZ B;  3J7Y W;  3MHB A;  5D65 A;  5IGG A;  3V2T A;  4LAA A;  3J7A V;  3TZD A;  3DUZ A;  2EE1 A;  1PRT B;  3KLR A;  3FPU B;  3DM1 A;  1WD0 A;  2EJF C;  2L0C A;  1BOS A;  2EY1 A;  3MXP A;  3C3L A;  2D9U A;  1CM9 A;  4K6L A;  1S5D D;  1STY A;  1H9R A;  3MA2 B;  3GTO B;  1XTC D;  1B3A A;  1JE4 A;  5JPM C;  2F0P A;  1SE2 A;  3A55 A;  5I4D A;  3H6M A;  4K6D A;  3S2D B;  1I4P A;  1GUG A;  2E2I B;  2F0T A;  3NHH A;  1NCV A;  1Q3L A;  1FD7 D;  5C5M A;  1MGS A;  2XNA C;  2WAC A;  1L0Y B;  4B08 A;  3SEB A;  2PQE A;  2IT1 A;  1I50 B;  1SND A;  4L8J A;  4WRD A;  2Y0S B;  1G91 A;  2DN8 A;  1PTO C;  1VF7 A;  4JBW A;  2O4X A;  5ELB A;  1KTK A;  2KQ3 A;  4BA1 I;  1V1P B;  1VF5 C;  2SNS A;  3AMU A;  5AFW A;  4A3I B;  5M5X B;  1U4R A;  3QO2 A;  1PFN A;  1RTO A;  5IGE A;  1JOR A;  1JWU D;  4R8I A;  1C4Q A;  3M4Y A;  1AN8 A;  4QUF A;  3M4O B;  2L5T A;  1HFG A;  4IZ8 A;  1L0X B;  3M7G A;  1QIL A;  3I73 A;  1DM0 B;  5E4X A;  2AUJ D;  1D5Z C;  2QCP X;  5K36 G;  3MC0 B;  2NN6 H;  1PFB A;  2B2Y A;  4XYQ A;  4A3B B;  1PZK D;  4F87 A;  3NQI A;  4XTC S;  4RA8 A;  1IKM A;  3MFG A;  1CQF A;  1WCM B;  5JVG 3;  4M8A A;  3PIP 3;  1G29 1;  1W6J A;  3W3A A;  2X6L A;  2K28 A;  1OXV A;  2EYJ A;  4ZAI A;  1S5E D;  1CHQ D;  3VR2 A;  4IUV A;  1IW7 C;  3GTQ B;  4FF4 A;  1ZYR C;  3QIA A;  2D5D A;  4DA2 A;  1ESF A;  2PW5 A;  5JJZ A;  5IIF A;  3S14 B;  2JP1 A;  2B2W C;  2A6H C;  3NQT A;  3DEP A;  4A3G B;  3EA6 A;  3Q6S A;  5C3W A;  1TII D;  1D5X C;  2XVS A;  4CBV A;  4J8Q A;  1I3Q B;  4NKL A;  4ULL A;  1EIG A;  1EOT A;  1MI2 A;  4NDX A;  1OO9 B;  2F0V A;  5KIX A;  1LV9 A;  4KJO A;  4HSV A;  2NVQ B;  4DU9 A;  1O7Y A;  4KHV A;  3S2H B;  1B9M A;  3J81 L;  3ZYY X;  3E5S A;  4PMW A;  2XRS D;  3NBH A;  1SMY C;  1EYA A;  1LTT D;  1XWE A;  1T5E A;  1TWA B;  3SXH A;  1LT3 D;  1VMC A;  2HCC A;  2J7Z A;  5BN4 A;  2KVM A;  3HOX B;  1KLU D;  4DXF A;  5HGT A;  4CKB A;  2G9H D;  3MXN A;  3PUY A;  4UAI A;  2F4I A;  2EZV A;  3TZU A;  1BCP D;  3BZD B;  5BN5 A;  4ZKB B;  2M2L A;  5KGU A;  5J22 A;  4NW2 A;  2KCC A;  2F0H A;  3TP5 A;  1V43 A;  2NTT A;  2OT2 A;  3TP7 A;  5K36 H;  1UNS A;  1H9S B;  5CV7 A;  2EY5 A;  3X3M A;  2F0S A;  2KEE A;  1GUO A;  1BCP C;  3RMH A;  1O80 A;  2WKD A;  5TSS A;  1DOK A;  1I4Q A;  1OXX K;  2B2W A;  2F0L A;  3E0J A;  1Y69 U;  2O5J C;  1Y1V B;  5E3F A;  1CA6 A;  2F0K A;  4ME5 A;  1JIC A;  3R8B A;  4OIJ A;  1PTO B;  1Q1B A;  3ERQ A;  4XXE A;  1EZ6 A;  3R2T A;  4V19 0;  1HA5 A;  1I4H A;  1U9R A;  5C0X H;  1X3Q A;  1JQY D;  2CHB D;  3DEO A;  4FNF A;  2K7V A;  1WTR A;  2K5Q A;  1HFN A;  1OXS C;  1FNU A;  1JOK A;  2KHS A;  4RGN A;  3CHB D;  3TDQ A;  1XX8 A;  1JR0 D;  4HR7 B;  5JPN C;  4BWG B;  4KV6 A;  5A35 A;  3HOV B;  1KAB A;  5EQ0 A;  5EGT A;  1HQR D;  2CQA A;  1G8Z D;  4ABN A;  3M85 A;  5A2Q L;  1Z6H A;  3EFX D;  1TWF B;  4PMB A;  5JEA J;  3GV3 A;  2LFN A;  3VR5 A;  4HAE A;  2A69 C;  2EPB A;  3R2I A;  3OW7 A;  3V05 A;  1D2B A;  1DCZ A;  3HGB A;  1H9J A;  1A3V A;  1B53 A;  2BE5 C;  4RWS C;  3EQL C;  2B2T A;  2XWB B;  1YNJ C;  3DWP A;  4RCN A;  5FO8 B;  3QJY A;  2RSO A;  4C3H B;  4KKU A;  1PYW D;  2MHV A;  2EYL A;  3LX0 A;  4A3F B;  4QIW B;  4HN7 A;  3IFD A;  1U4P A;  4DFA A;  3I91 A;  1EWC A;  5IOC A;  2FIN B;  1SNQ A;  2NBF A;  3GQB A;  3LNN A;  3S16 B;  1SAP A;  4O42 A;  1B4O A;  3NTI A;  1TU2 B;  1ENC A;  3PUW A;  5IGD A;  4OO1 G;  4K2L A;  5D3I B;  3TSS A;  5M9O A;  1LTS D;  2PPB C;  1PTO F;  2BDN A;  3FVQ A;  1AW7 A;  2ZT9 C;  1U4L A;  3HS0 C;  1EY6 A;  2Q8I B;  4K14 A;  3KLS X;  3C46 A;  2BDO A;  1STG A;  4KY6 A;  3M7N A;  2IX1 A;  3MXG A;  3S1Q B;  1BUV T;  1QCB D;  2KCN A;  1I4G A;  3J7A F;  3P1H A;  1JOO A;  4OIK A;  4TSS A;  5EPJ A;  4KN4 C;  1IW7 D;  1DXM A;  3N52 A;  1I4R A;  4K5X A;  5M3F B;  5C4J B;  3X3N A;  2Q8R E;  1TKW B;  3TP8 A;  2JSO A;  1HTP A;  4DNR B;  1IYV A;  2EYF A;  1CZG A;  2F0G A;  3MFY A;  3KBG A;  4OL7 A;  3VYT A;  4RAU C;  3KBX A;  4Q0F A;  4DN4 M;  2B2V C;  2C9O A;  2MGS A;  3D3R A;  2F0J A;  1CT1 D;  4N9P A;  3N6R A;  4QF4 A;  3OMC A;  2DNE A;  2VB3 X;  1STH A;  4XQQ A;  1LT5 D;  3WOE A;  2E2J B;  1TQO A;  2A6E C;  4HCE A;  2AUK A;  2KA7 A;  2A69 D;  2BA1 A;  1Y8P B;  3BG3 A;  1MSG A;  2ICI A;  1GUW A;  4DK1 A;  2MP1 A;  5KND A;  4G4K A;  1F9S A;  1V1O A;  1Q12 A;  3KLS A;  3SK5 A;  1GHJ A;  4IUU A;  4IUT A;  1E2W A;  3HG9 A;  4QCL A;  4I7Z C;  4KD4 A;  1GUS A;  4RKL A;  5JEA G;  2F3V A;  1KNE A;  3A8K E;  3Q0A A;  1TWG B;  1DJR D;  1PRT C;  3BDC A;  3PUZ A;  1PZI D;  4HSP A;  3HOZ B;  5ISR A;  3KK7 A;  5G3L D;  4IFD H;  5I9P A;  2BCO A;  3KF8 A;  1F2M A;  3BYT B;  5E4W C;  5C0X J;  2X69 A;  3AU7 A;  4B9W A;  4FYD A;  2WII B;  1HCZ A;  3DHQ A;  4O1N A;  3I3C A;  3GV6 A;  5KNC A;  1V1P A;  1DOL A;  1CQV A;  4A3E B;  1PRT F;  2QDB A;  4MIU A;  2ZXP A;  3RUZ A;  1JB3 A;  2OF1 A;  2PO4 A;  1SYF A;  2I46 A;  1G2S A;  3K57 A;  1QG7 A;  1I6H B;  5M5W B;  1EY4 A;  2ZXR A;  2L12 A;  3FPP A;  4C3I G;  1MSH A;  2J4X A;  2IX3 A;  1VCI A;  2L4N A;  4HMI A;  4XIG S;  2V4D A;  3K5M A;  1RDP D;  3NPP A;  4ILW A;  1ILP A;  3CRL C;  3NSW A;  3T13 A;  2OXP A;  2R6G A;  3L7Z C;  4FXG C;  3OPO A;  1HRJ A;  3I8Z A;  1BBX C;  4CGY B;  3FRP B;  3K5O A;  4KK7 A;  5IGB A;  1ZKO A;  2E76 C;  3IFT A;  4A3J B;  1PMR A;  4OO1 I;  4KHZ A;  5CMD A;  1PLF A;  3G6J B;  1EEF D;  2N55 A;  4EGV A;  3EJI A;  4XDX A;  1LTI D;  3V96 A;  1AEX A;  2K6A A;  3BDO A;  3T4A C;  3R93 A;  4NMZ A;  2F0I A;  3GO5 A;  5I9O A;  1EFI D;  2EJG C;  3CU7 A;  3MXU A;  2E74 C;  2SOB A;  1D5M C;  1LT4 D;  2AQ3 B;  1D1I A;  2B2U C;  5K5P A;  5CR3 A;  3HKZ B;  1ILQ A;  3M3Y B;  4YIJ A;  4IUP A;  4R8N A;  1BF4 A;  4DGZ A;  5T1G A;  3NWS A;  3K6O A;  2NYZ D;  5C4X B;  4XYO A;  3GTM B;  4RGM A;  4OO1 H;  4DAY A;  4DAP A;  3U9S A;  3I90 A;  1VDZ A;  1QNU A;  3CRK C;  2I07 B;  1TS3 A;  2C5C A;  3D6W A;  5C3E B;  3H91 A;  2EYM A;  3FMC A;  2LKV A;  3ITP A;  1YNN C;  5CGK A;  1JCK B;  2K03 A;  3DWA A;  1LAB A;  1SYD A;  3FEW X;  1EYD A;  3D31 A;  4ID6 A;  4B9X A;  4BY7 B;  4ZLT F;  1CZW A;  2F0O A;  2XIW A;  3K58 A;  1A3U A;  4RFB A;  2HUG A;  1ICW A;  2Z1C A;  3NBI A;  3Q24 A;  1WTP A;  1GOZ A;  2BE5 D;  3W2D A;  2YYZ A;  3A8I E;  4EVO A;  3HOU B;  5CV9 A;  1TR5 A;  4M1U B;  1F2Z A;  3C1F A;  3GD7 A;  4PNY A;  3K0Y A;  4JK1 C;  2L55 A;  1KAA A;  1SEB D;  1LLR D;  4IFD J;  1FNW A;  5G3L F;  2RA4 A;  2B2V A;  1Z47 A;  1EU4 A;  4KJN A;  3SDZ A;  5M5Y B;  2MUY A;  3HOW B;  3VYU A;  3QG1 A;  1EY9 A;  2CW0 D;  5HUR A;  2WIN B;  1NAP A;  4C3H G;  1HQM C;  1E0B A;  2X6G A;  3S1M B;  4XT3 B;  2JEB I;  2RDF A;  4TQU S;  1O7L A;  4GZY C;  4K2K A;  4H0L C;  2F0D A;  4OGQ C;  1II3 A;  2ENB A;  5C0X I;  3K5L A;  1STE A;  5IGC A;  1FYC A;  3Q23 A;  3P75 A;  4ZQ3 A;  3T53 B;  1SFO B;  5EKL A;  2HQE A;  2LS0 1;  5EBD A;  2EVB A;  3C2P A;  3Q22 A;  1ENF A;  5F2D A;  1PRT D;  1O7Z A;  3GP7 A;  4KTA A;  4ZRZ A;  2B63 B;  5ELE A;  2BOS A;  1KDB A;  3L3O C;  1SNP A;  1JOQ A;  4BBR B;  2D2C C;  2KEC A;  3P7J A;  1EY8 A;  5FOB B;  1SE4 A;  2B2Y C;  2K32 A;  2NWG A;  4C1N K;  4KI0 A;  4TKO B;  2RBM A;  3FDT A;  1RKN A;  3S9W A;  2K04 A;  3NTH A;  2M9V A;  3NK9 A;  5FLX E;  1ZYR D;  1CHP D;  4X3U A;  4IFD I;  2MPM A;  4X3S A;  2HDM A;  4RCO A;  3URY A;  3A7L A;  4KD3 A;  3GTL B;  3I70 A;  2JEA I;  4FXK C;  2A6E D;  2AQ1 B;  3IKJ A;  2HCI A;  1DZ1 A;  4DNT B;  1K8M A;  1K83 B;  1SYC A;  3A54 A;  5I6Y A;  1GJX A;  3I4M B;  4FF1 A;  2TMP A;  4LJZ C;  1WTW A;  3VA5 A;  3NTK A;  3S1N B;  4RHS A;  1BQQ T;  5EKI A;  1V8Q A;  3S1R B;  2IX0 A;  3MVV A;  2QEJ C;  1ROD A;  1SBB B;  2VXW A;  1F9P A;  3PUX A;  2NVX B;  2NB0 A;  2Q8T A;  2F0Q A;  5ELD A;  1SDF A;  5KYI A;  1A2U A;  1F9Q A;  1Y1W B;  2GA4 B;  3VA7 A;  1EYC A;  1GXD C;  1LT6 D;  1UEA B;  2KUM A;  4G7O C;  3G7L A;  3H3V C;  3PUV A;  5D3D A;  3VYS A;  2F0E A;  1B2T A;  3QWN A;  3KUP A;  3BYY B;  2O2L D;  5EJW A;  1LO5 D;  2L11 A;  1CA5 A;  4ZYS A;  5ELC A;  2XRQ D;  5CV6 A;  1RCV D;  2DY7 A;  4U67 3;  3HP3 A;  1KNA A;  1M8A A;  1NUC A;  1OXU A;  1W6K A;  5CBE E;  2E75 C;  3OOC A;  4V0B A;  2FHT A;  1J8I A;  1LTG D;  3SE0 A;  1TY0 A;  1JC7 A;  5I6W A;  1XXG A;  1EU3 A;  3D8G A;  1TT2 A;  3P20 A;  4XQJ A;  4XQN A;  3TBI B;  2FFK B;  2NN6 G;  2K1B A;  1A15 A;  5IGF A;  4UDU C;  4FF2 A;  4FF3 A;  1CFM A;  3VR3 A;  1H9S A;  3BVG A;  1HPC A;  2LMC B;  1AP0 A;  2PZU A;  1MD2 D;  1EL0 A;  1I6V C;  1AZP A;  2TSS A;  3PO2 B;  5C4Z A;  4H44 C;  1EY5 A;  4OHJ A;  3ERO A;  1SYE A;  2OEO A;  1HUN A;  1FNV A;  3E6Z X;  3QB3 A;  1Z7T A;  5IT9 E;  1ESR A;  2WV6 D;  4A3K B;  1EIH A;  3AB9 A;  3QOL A;  1RHP A;  2PCF B;  1TY2 A;  4XT1 B;  4IUQ A;  2L9H A;  2DY8 A;  2IPK D;  3J81 E;  4FO2 A;  4TRD A;  4CKE A;  1EY7 A;  1KDA A;  2IJ0 A;  1NR2 A;  2SEB D;  5C4H A;  3HOY B;  2NVT B;  1ONL A;  1UAP A;  5CBA E;  2WKC A;  5E1F A;  3NP8 A;  1STB A;  2QF7 A;  4IN3 A;  1PDQ A;  2XN9 C;  1D1K A;  3U9O A;  3K7A B;  2F0W A;  2KJX A;  1TWC B;  1EQV A;  3PO3 B;  1IL8 A;  2A68 C;  2IL8 A;  4A3M B;  2Z4H A;  3DWQ A;  4IFD G;  3L9A X;  5KNB A;  1EQT A;  5J39 A;  1JWS D;  1Y8N B;  4IAL A;  2CW0 C;  1QWY A;  3HRZ C;  3OIP A;  1SSO A;  4QUC A;  1A6X A;  1TVX A;  4X3T A;  1BR9 A;  1QJO A;  4FXD A;  2KED A;  1C8C A;  3PMF A;  5C5L A;  1FGB D;  3ONA B;  1F2Y A;  5C6A A;  1SYG A;  1WTV A;  5M3M B;  3SK6 A;  1Q90 A;  1G6Z A;  3RZO B;  1DYQ A;  4IUN A;  3BVZ A;  1XYI A;  1U4M A;  4RHR A;  5IOD A;  3D6C A;  3DXJ C;  1F77 A;  4HCS A;  4MHE A;  2ZXO A;  1LTR D;  1DOM A;  1SNC A;  2A5H A;  4WJW A;  1S4Z A;  4Y7N B;  3NE5 B;  4LK1 C;  3HZX A;  3I4L A;  3K59 A;  2PNR C;  4RKB A;  2VNU D;  3RD4 A;  4G7H C;  3TP6 A;  2JA7 B;  1R4Q B;  5IT9 L;  4WFN 3;  4C1N I;  4G57 A;  5JVH 3;  2EOT A;  1H9M A;  4KY5 A;  3LWU A;  1ET6 A;  2NTS A;  2F0F A;  3JAM E;  5T1I A;  3H94 A;  1STN A;  1QOH A;  3ND9 A;  4C3J G;  5LHY 1;  1HHV A;  1TS4 A;  2SNM A;  2D62 A;  1I4X A;  1HUM A;  1EY0 A;  2R92 B;  2CVR A;  1PTO D;  5FLX L;  3QOJ A;  3OWF A;  1DON A;  2JA6 B;  1SE3 A;  3MAQ A;  1MBY A;  4EQN A;  1FR3 A;  3JAM L;  3T51 B;  1R4P B;  3J80 L;  1BO0 A;  3WOF A;  2B8G A;  3UI2 A;  4E6I A;  1S5B D;  2EJM A;  3I4N B;  2NUC A;  5KEE A;  5COY A;  4C3J B;  1Y8O B;  1QB5 D;  2A6H D;  3OHX C;  1WTO A;  2L1B A;  1C48 A;  1CTM A;  4MN3 A;  2HDL A;  3A8J E;  5FO9 B;  4U68 A;  3SR1 A;  1WTQ A;  4HED A;  2PZT A;  2F3W A;  1E2V A;  3BDL A;  2RQX A;  3SVM A;  4CKC A;  5ELF A;  5JOB A;  4EQP A;  1BCP F;  4BS9 A;  4PMC A;  1R9T B;  3MWY W;  2SDF A;  4A93 B;  3MTS A;  3GTG B;  5CV8 A;  2JE6 I;  2K05 A;  4L63 B;  2A74 C;  5I2X A;  1Q1E A;  4HTH A;  4ODG A;  2RDG A;  4LMQ D;  1RD9 D;  3IAY A;  3IL8 A;  2RVL A;  1UUP A;  3GTJ B;  4C56 C;  4P2C B;  2FMM A;  4CJ1 B;  2PMZ B;  3F2U A;  1AFP A;  2H1E A;  1OXT A;  2KOL A;  3OIQ A;  1E2Z A;  2K33 A;  4H7B A;  2A68 D;  2MJ8 A;  5CYU A;  3CKI B;  4DXG A;  5KRU A;  1NR4 A;  1HA6 A;  2YU9 B;  1RTN A;  4DF7 A;  3D4D A;  4K8J A;  3OWE B;  2JA8 B;  4ZUJ A;  2NN6 I;  1F2L A;  4BA2 I;  5C0X G;  3DMU A;  4Z9C B;  4F8M A;  2WAQ B;  1KDC A;  1M4V A;  1EZ8 A;  1RJT A;  2AWO A;  1WTX A;  5KYL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...