2KVMA

Solution structure of the cbx7 chromodomain in complex with a h3k27me2 peptide
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
71
structure length
71
Chain Sequence
MELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEERDRASGYRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Chromobox protein homolog 7
publication title Molecular interplay of the noncoding RNA ANRIL and methylated histone H3 lysine 27 by polycomb CBX7 in transcriptional silencing of INK4a.
pubmed doi rcsb
source organism Mus musculus
total genus 11
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2010-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2kvmA00
4U68A 2N55A 4CJ1B 1Q3LA 1MSHA 1RTNA 2MJ8A 4OIKA 2H1EA 2HCCA 1JE4A 2R3ZA 3G7LA 1BO0A 1B50A 1C8CA 2KVMA 1CM9A 2MPMA 1IKMA 2RSNA 2JYOA 1F9SA 3FDTA 2IL8A 3I3CA 3IFDA 3KUPA 2EPBA 4MHEA 2L1BA 5E4XA 1HFNA 5CBEE 1HFGA 1RJTA 2HCIA 2KEDA 2MGSA 5COYA 1BNZA 1J8IA 1O7ZA 1EIHA 2FMMA 1A15A 2CVRA 1F9RA 2EE1A 4RAUC 4IUPA 4IUUA 1KNEA 1B53A 1F9QA 5EPLA 4X3SA 1DONA 1HA6A 5D14A 1O80A 2JP1A 2X69A 1NR4A 5EPKA 3QO2A 3TN2A 1QG7A 3UI2A 1S4ZA 1ICWA 1E0BA 4HEDA 4MN3A 1DOLA 4ZAIA 4R8IA 1GUWA 2B2TA 1HUNA 1X32A 2B2VC 1LV9A 1F9PA 2B2WC 2XIWA 3Q6SA 2B2VA 5T1IA 1QE6A 1EL0A 2KECA 1WTWA 4QUFA 3DM1A 2B2WA 1U4LA 4IURA 2L11A 2K1BA 5EKIA 1U4PA 4CJ2C 3I91A 5DNFA 5EQ0A 2VXWA 2L9HA 2DY8A 2FINB 3H91A 1WTQA 2DY7A 1MI2A 2M2LA 1IL8A 4ZLTF 1RTOA 5D65A 1WTVA 1ZXTA 4HCSA 1G6ZA 2FJ2A 2L4NA 1RHPA 4XDXA 4UAIA 2NYZD 5CORA 1HHVA 2K04A 1DOMA 3N52A 1WTRA 1EIGA 1EQTA 2B2TC 2FHTA 2Q8TA 1JICA 1HRJA 4RWSC 5E4WC 2K05A 1ML0D 3DEOA 1B3AA 4XT1B 4DN4M 2B2UC 1AP0A 2RA4A 1VMCA 3DEPA 1WD1A 1SSOA 2B2UA 1BF4A 3SVMA 3FPUB 3P7JA 2K01A 4IUQA 1PLFA 4O42A 1WTXA 1U4RA 3IL8A 1DOKA 2SDFA 1WTOA 1IKLA 1ESRA 1ILQA 1F2LA 1MSGA 1XX8A 3MTSA 5EJWA 1WVLA 5JJZA 1CA6A 4ZK9B 2NZ1D 3ONAB 5T1GA 1G91A 1SAPA 4QUCA 1X3QA 4ZKCB 2K03A 2KUMA 4OIJA 4X3UA 1KNAA 1M8AA 1SDFA 4X3KA 4ZKBB 3MWYW 1NCVA 2Q8RE 5CMDA 1MGSA 1ILPA 2KOLA 3D6WA 3KBXA 2RSOA 1XYIA 1VMPA 2EOTA 1QNKA 2FFKB 3LWEA 3GV6A 4LMQD 1X3PA 5AFWA 1WD0A 1B2TA 4R9WA 4NW2A 1PFBA 4X3TA 1AZPA 2J7ZA 4HAEA 3TZDA 2B2YC 2K28A 4IUVA 2HDLA 4HSVA 2X6GA 3R93A 3F2UA 3HP3A 2KEEA 2NWGA 5EPJA 2B2YA 1J9OA 4IUTA 1RODA 1G2TA 4XT3B 2HDMA 2MP1A 4CJ0B 2X6LA 2RVLA 1DZ1A 2BDNA 2HUGA 3I8ZA 3GV3A 5CBAE 1CA5A 1NAPA 1O7YA 1PDQA 1BBXC 2N88A 1AZQA 3I90A 1NR2A 2L12A 1B4OA 1PFMA 4RA8A 1WTPA 1EOTA 2D9UA 1HUMA 1U4MA 1TVXA 1G2SA 1PFNA
chains in the Genus database with same CATH superfamily
3PSIA 4U68A 2KBNA 1K28A 2PNRC 3J7A5 4Y7NH 2DJGC 2NVQH 1B50A 2Q2TA 2ATWA 1SEBD 4MHEA 4KV6A 2BA1A 2J4XA 3EROA 2KEDA 2L5TA 1UEBA 5I6WA 4YHHL 4YWMA 4LF5Q 1TWGB 4AYBE 4IUUA 4ME3A 2A8VA 1KNEA 2PQAA 4CKCA 1B53A 1HTLD 2VQFL 2ES2A 1LTGD 4FVMA 1S4ZA 2EY6A 2YV5A 2K6AA 4K2LA 5CV5A 2VB2X 4BXXH 1HUNA 2CHBD 1X32A 1PA6A 3WWVA 2OCEA 3T16A 1PH2A 2F3WA 3ULJA 4JI8Q 5M3MH 2G9HD 3PV0A 4ID6A 4B3TL 2RHQB 3MXPA 2A73B 4GOPC 2I5LX 2XVSA 3PGZA 4GOPA 3K81C 1KAAA 1QWYA 3A7LA 3A5UA 3A7AB 1RHPA 1N32L 4DAPA 3CCMA 4DV1Q 1HHVA 2K5NA 1LLRD 1LO5D 1A0IA 4GNXC 1O7IA 2NVQB 2ID0A 2B2TC 1CQVA 3MEFA 4V190 4GNXA 2AQ1B 1HR0W 1TR5A 4DN4M 1STGA 1WD1A 1VMCA 5JPNC 4G7OC 4DR2Q 3P7JA 4DV0L 1V1OA 1K8AC 2LMCB 2PCFB 1JR0D 4QY7A 1VQEA 1KDAA 1VQIA 1XX8A 4IUNA 3S1RH 3S1QH 2JJQA 3B6YA 4DK3C 4B3RL 4YCUA 2PZWA 5HY6A 3AU7A 3I7FA 3PF4A 4DR7L 3CKIB 1VQHA 1H9SA 3PIP3 1NTGA 4TQUS 4JI6Q 3Q0AA 4IFDH 2JA6H 1IBKL 1RD9D 5C4HA 3D6WA 2RHSB 1VQOA 1CHQD 1QNKA 4LMQD 3Q23A 4DV7Q 4BBSH 2ALYB 4JI2L 2F0GA 1K8MA 3A5ZB 2JK8A 4A3BG 4X6AH 1PZJD 1EQRA 4HR7B 2B63G 4JBKA 1K0RA 4GOPB 4X62L 1O7YA 1NR2A 3IRBA 1B4OA 1X9NA 4JI7Q 2D9UA 5I2YA 5C4JH 4XXEA 2CH4A 3M85A 4GNXB 4DV6L 2WB1E 3G7LA 1JT8A 1ZEQX 3KK7A 2RSNA 3NWSA 1HFNA 3UDFA 1VQCA 3H3VC 3S1QB 4ZQ3A 2YU9B 1XNRQ 2J0TD 3CC4A 5C0XH 1XTDA 2L0CA 2CVRA 2F0NA 3BZCA 1LTAD 3H3VH 4A76A 4JBWA 3I4MG 1H9SB 2VUMG 3RUZA 4HCEA 4M1UB 4KHPQ 3QO2A 4MN3A 4R8IA 4DV4L 2NB0A 4BBRB 1I4PA 3J7YW 3FRPB 4BBSB 1YHAA 5IT9c 5GAEC 5FLXc 2F0VA 4AQYL 3T56B 4CJ2C 3I91A 5EQ0A 1XMOL 5I2XA 4A3KH 3BVZA 2E8GA 4MIUA 3H91A 4F88A 3GTLB 1HNWQ 2SEBD 2UXCQ 1LT6D 3NSWA 1GUTA 1ZXTA 4LFBQ 4LFAL 1C48A 4F7XA 4OONA 3NHHA 1Z7TA 3K7AB 3LNNA 3CP0A 2MO1A 4PNYA 3HRZC 1HPCA 5DAUA 2A69C 1BF4A 3S24A 3BS1A 2F0KA 2PZTA 1D6EC 3HOZG 3I4LA 1Z9FA 1SJED 4OXPA 3BZKA 3GTGH 4RKBA 2I0QA 1Y8OB 1X54A 4LF8Q 2ZXRA 4A3IG 2A68C 3OTOQ 1F2ZA 3PUXA 1NCVA 3TS2A 4JI4L 3OMCA 4UP9A 4UP7A 3ERQA 1BCPF 3FVQA 5DLQE 3CCLA 4A3KB 2HHHQ 1RF2D 4AIMA 3M4OB 3GTPH 2X6GA 2D5DA 1EEFD 1RODA 2NTSA 4DV3L 3J80c 4IPGA 2X6LA 5M5XH 3AFPA 5GQOA 4JV5L 1JB3A 1CA5A 1KRSA 2DNEA 1HNZL 4RA8A 3DWAA 4GKKQ 1AW7A 1PH3A 3KOJA 2FXQA 3E9HA 3DEOA 1S72A 2A19A 4B08A 4PZ6A 3AYHB 1H9MA 1I6VC 1A3UA 3P1HA 3GD7A 4FF4A 4WFN3 1PH1A 1CM9A 1L1OB 1LABA 3GTJB 1RJTA 1STHA 3HKZG 3UDGA 4J8QA 4RAUC 2N8NA 1HXYD 1V43A 4KD3A 2K5HA 1FVIA 4P73A 4GZYC 1N33Q 1E2WA 1QG7A 2V1CC 1FNWA 2PI2A 1HNXQ 3GTKB 5JOBA 5H1SE 1A6XA 5IOCA 1EFID 1X3GA 3GTPB 4QUFA 2B63H 2IHEA 1PRTF 5DNFA 1VQKA 4L5TA 2VXWA 4OWWB 1TXYA 4OO1I 2SNSA 2XRQD 3K6OA 1YHBA 1QZHA 1Y69U 2D0OA 2EJMA 1YJ9A 1WTVA 4YY3L 4L5QA 3KFUA 3EN2A 3J81E 1IHZA 3N52A 1TWAH 1KD1C 2F0FA 4K8JA 3S15H 3H0GH 1JICA 3DM3A 5DM63 1TS4A 2EY5A 2K05A 4LF7Q 4JVZA 5JEAG 3BU2A 2Q2UA 5J1ZA 3SK6A 1TWFH 3NK9A 3QOLA 2KA7A 1SSOA 4IUQA 4DUZL 3U58A 5L37A 2VUMH 3NWTA 3E6ZX 3MEHA 2IWHA 3HOUG 1LT4D 1HH2P 3KF8B 4NDXA 4RG1A 4ZKCB 4LF6Q 1B8AA 4X65L 4A3BB 2QDLA 3FEWX 4R8NA 5C5MA 4CGYB 3J7AV 3M7NA 3I56A 2B63B 1HR0L 3JC66 4Q5VA 1LTRD 4DNIA 2F4VL 3VDYA 4R9WA 1KC8C 2J7ZA 2KJXA 5M5WH 5IP9H 1BBUA 1II3A 2NWGA 4K5XA 2F0OA 1EFWA 1YNNC 5M9OA 5HGTA 1IBMQ 2HUGA 1TWAB 1PDQA 1HZCA 3S15B 2N88A 1SN8A 3S14H 3H09A 2E5LL 1HUMA 1C9OA 4LJZC 1EU4A 1TVXA 1S40A 4A3CG 3ULLA 1GJXA 1TWFB 2RDHA 3V96A 4K0KL 1YNJD 3HOZH 1MSHA 4R4CA 1JB7A 3I4MB 2Z4HA 2VUMB 2KVMA 4LUOA 1IKMA 2LFNA 3GP7A 5AJ3L 1STNA 1WCMH 5EBCA 5FK9C 3CCSA 1EWHA 4HIKA 3TP5A 4ZYSA 1J8IA 3J81L 3KDFA 3J80i 1I50B 4GKJQ 1FGBD 1S5BD 5D14A 5J3BA 2JP1A 1B9NA 1BCPC 4HEDA 2N3SA 1M4VA 4O0AA 5KYIA 3JAMc 3S2DH 4K2KA 1CK1A 2EVBA 3DUZA 1D5MC 2XWJB 2ZTEA 5EKIA 3T51B 4A3MG 1XXGA 2F0EA 1HCZA 1V8QA 1PXUA 1P8LA 4CKEA 1WTQA 1RCVD 2R7FA 2WKCA 1MJCA 4JI5Q 3D6CA 4LF5L 2HD3A 4QF4A 1X3FA 3HOZB 1B1ZA 3TREA 2K04A 2AQ2B 1AEXA 3S1NH 1UWVA 1MJEA 2K5DA 1ENCA 3ITPA 4TSSA 2EZVA 1A2TA 4A3IB 1VQMA 1SYCA 1GM5A 1LUZA 4DK6C 3S9WA 2I46A 5LMNW 3MVVA 5IWAQ 4JI8L 3PQIA 4ZUIA 1S5DD 2BCOA 1YEZA 1SAPA 3KDFB 3C46A 2Y0SE 1LACA 5JJLA 5EKKA 1JWMD 1EY0A 2I5HA 2VS1A 3BDOA 3S2DB 4QQBX 5IYDG 1S5FD 5HGQA 3RMHA 4DV1L 1CKNA 1BCPB 3I4OA 2CCZA 2F0UA 1PRTC 1HZBA 2EOTA 2EXDA 4LAAA 2EDGA 4DA2A 1B2TA 1F2YA 1PFBA 4X3TA 4K6LA 3CC7A 1JQYD 4IALA 4UDUC 3VYTA 4WJ3M 2AWNA 1O78A 2A6EC 4DR2L 3KLRA 3G6JB 3G4SA 4RFBA 1VQ4A 1G291 1NAPA 5JEAH 5C4ZA 5JPMC 2I5MX 1EIFA 3ND8A 3HKZB 1SE3A 3HOUH 5EAYA 4JI6L 2K33A 1KQSA 3HOVG 2KQ3A 4S3SA 2WAQE 1I4QA 4KKTA 4DV7L 1VQBA 5J22A 1YNND 3RLNA 4U673 3T4AC 4G7ZC 2JA5H 3UE0A 4DXFA 1HA6A 5CV8A 1QVCA 5M3MG 1B3QA 2B8FA 2NN6G 1E0BA 1KAWA 4JI7L 1JJCB 2B2VC 4XYQA 3TZUA 1ICFB 3CU7A 3Q6SA 3VYRA 2B2VA 3CCRA 1PRTB 5C5LA 3VA5A 3KYHC 1CT1D 1BOSA 2K5QA 2DY8A 2KCCA 1K9MC 4OL7A 1XNRL 2DY7A 4G4KA 2K52A 4ALPA 4ZLTF 1I4GA 1LTSD 3K5LA 1IYUA 2MHVA 2FJ2A 1TWHH 1SNCA 1BXTA 1FYCA 1EYDA 2XWBB 4L6TB 1JJGA 1OXTA 3HOUB 3TDQA 1EY8A 1BCPD 2Q8TA 3A8JE 3ER0A 2E2DC 2Z6KC 5E4WC 3EQLC 5IGDA 4KHPL 2BDOA 4H02A 4XT1B 5FJ8G 1HA5A 2Z6KA 1AP0A 2RA4A 2PQEA 2UXBL 3AB9A 5KNCA 1WTXA 2QILA 3CD6A 1U4RA 1M1KC 4X64Q 4A93G 4IFDG 2JA6G 4LF9Q 1D2BA 1FL0A 2BE5C 3MTSA 1BBWA 5JJZA 2ZM6Q 2K5WA 3IFTA 3RD4A 2R93H 4RMFA 1HNWL 2KHSA 5C44H 3I55A 3ZYYX 2Q8RE 4MTKA 4NKLA 2CFMA 4P75A 5C3XA 4LFBL 3CXCA 1U0LA 3PO2B 4JW0A 4JI1Q 4A3MH 3VR6A 1P16A 2EYJA 3KBXA 1ENFA 4ODGA 3LWEA 1JORA 1X3PA 5ELCA 2JA7G 1DYQA 2F3VA 3S17H 3QOJA 1Q1BA 1J9OA 2CW0D 4XT3B 1YI2A 1TWHB 4TKOB 2RDGA 5GROA 1HQMC 1L0XB 3GV3A 4K5VA 4X66Q 1QJOA 5C0XG 3K57A 1Q81C 4LF8L 3IKJA 3OTOL 1PRTD 2H5XA 1A8VA 2JYOA 3M4PA 3OSOA 4C1NI 3FP9A 1EEID 1HFGA 2IPKD 4YIJA 2HHHL 2A6ED 5C3EB 1SYDA 1VQDA 1EIHA 2EE1A 3K0XA 1A63A 3L9AX 3PUVA 2QEJC 2Z0SA 4A3MB 1KLUD 2HQEA 4DV5Q 3WDNA 2Q8IB 2OF1A 3CCJA 1JOOA 3A54A 4GKKL 1CQFA 3D31A 2Z8LA 3K5OA 4LK1C 1HQRD 1Q46A 3SEBA 2Q2IA 2PO4A 3S17B 3C1EA 2F0WA 1EY4A 1YITA 2R92G 1SNQA 3RN5A 2FINB 5M3FH 3W1BA 2NVTH 4UP8A 1OXSC 4HCSA 1E2ZA 1NJIC 2CKZB 1EQVA 1E1TA 1T9HA 2D2CC 3NQIA 4KY6A 3OW2A 2JA8H 2BH2A 3CPFA 4L5SA 3HOVH 4A3LG 1K3BC 2A1AA 4LF4Q 3RNUA 4JK1C 5ISRA 1EY6A 3NEMA 4B3SL 4KHZA 1QNUA 1N33L 3J81j 1HNXL 1D8LA 4A3FH 3MA2B 4DR6L 3SDZA 2LKVA 3SVMA 2AHOB 4C2MH 2EYHA 4JI0Q 2WACA 2VNUD 2V4DA 5G3LF 5IY0A 1IKLA 2R7DA 5JJIA 5TSSA 2NN6H 3K5NA 4HMJA 4PQXA 4C3IG 3F8TA 5KGUA 1D1KA 4N8FA 3S14B 4X3KA 5C6AA 4Y7NB 2RDFA 1Q8KA 5IODA 4FYDA 2KCNA 4OWXB 1WD0A 2HIXA 2DGYA 4XQQA 5C4XH 2F0JA 3V05A 3RR5A 2NVTB 1I6HH 5ELDA 4CJ0B 5LMNL 5IT9E 3Q24A 3EVQA 3HOVB 3SGIA 2PQAB 5FJ8H 4FF1A 3VR3A 4FP5D 3PIOA 1U4MA 1G2SA 4LF6L 1TQOA 3IAYA 4QIWE 4HJ5A 4A93H 1RTNA 4YWLA 2HCCA 1NBWA 2KHJA 2MPMA 1EY9A 1W6JA 3IFDA 5M3MB 3TS0A 4J1MA 2EPBA 3CC2A 5BR8Q 4B3ML 4KJOA 5CV7A 4EVOA 1XJVA 4PZ8A 1A15A 3CF5A 3CAMA 3NENA 1S5ED 4TVAB 3UE1A 1X55A 1X56A 1IBML 5D3DA 2SOBA 2JA7H 1KHIA 4ZAIA 1EZ8A 4KHVA 4I7ZC 3UDXA 4I65A 4RGTA 5J39A 4RHSA 2BOSA 3HS0C 2WIIB 4OX9L 3HOWH 1QE6A 4R4QA 3MXGA 4APVA 5KYLA 4O2DA 2R7ZG 1YBYA 2L11A 2MNAA 3S1RB 3WOFA 1K8GA 1OXUA 3H0GG 5IGBA 2M9VA 1XPRA 1TIID 5M5YH 2F0PA 3HOXH 3QR8A 4A93B 3A56A 3TRZA 2JA6B 2JE6I 4GKJL 3P75A 1NUCA 3FPPA 4KTAA 1UAPA 4NPSA 3G48A 3L2PA 4R4IA 2K01A 2IHFA 2UU9Q 4RGNA 3EIVA 2JA7B 5C4JB 1J6QA 4OIJA 3T1HQ 1M8AA 1ASYA 5IP9G 4JI5L 1ONLA 3OOCA 3R8BA 1TWCH 3KF6A 2XTIA 5ELNA 2R92H 1MGSA 2NZHA 1OTCA 3OW7A 4KJNA 2K50A 4GN5A 2EY2A 4HAEA 1E24A 4IUVA 2MO0A 2VY3A 5I6YA 5M5YB 2N78A 1G2TA 1Y1VH 4A3LH 1I94L 2BDNA 5IWAL 3PUYA 1WCMG 1PFMA 1PMRA 1NMGA 3RZOH 1F77A 2SNMA 4KMUC 1PYWD 2L15A 4OIKA 1I4RA 2O5IC 1LM0A 4NB3A 3KLWA 1BO0A 4C3IH 1VQ5A 1RL2A 3KUPA 4L8JA 5DEHA 3NTIA 1J5EQ 3NELA 3I4NG 1PYSB 1IW7C 5C3WA 4XYOA 1SR3A 5BN3A 5CGKA 1IBLQ 4G7HC 1TWCB 1HZ9A 2R92B 2FMCA 2RCNA 3NTKA 3S16H 2F0SA 3CCVA 3OMGA 1B7YB 1SNOA 1FNUA 3W5OA 3NXWA 5JJKA 1WTWA 3R2TA 2EYOA 1PH7A 2LY7A 5EGTA 2RQXA 1LT3D 2M00A 3BJUA 3K0YA 4HIDA 3GTGB 2L9HA 4LFCQ 3U4ZA 4BY7G 1NNXA 1LYLA 3WOEA 3EFXD 1G6ZA 4BA2I 4PV1C 1AFPA 4EQOA 1EQTA 2ICIA 4C3IB 1TU2B 4FF2A 2GN5A 2Y0SG 1W2BA 2OTLA 2VZAA 1K8OA 3GTQH 3DEPA 3W3AA 4YHHQ 2EQSA 3DXJC 4GN3B 1NMFA 3RN2A 1KXLA 2MFIA 3NP8A 5M5XB 1DOKA 4DR5L 2IY5B 1MSGA 1ESRA 5IYBH 4B9XA 1Y14B 4NXML 3ONAB 3S16B 2PW7A 2K03A 1X6OA 3QG1A 2G5DA 4FXDA 3TP6A 4WRDA 1VQNA 3K5MA 3MWYW 2R7ZH 1VF7A 1EU3A 1LTLA 1B9MA 3ZJYC 3PO3H 2VB3X 1ILPA 4KI0A 4CDCC 1UE6A 1KABA 2F0LA 2NBFA 3F1ZA 3R93A 5EPJA 2KEEA 1CKOA 4KN7C 2D62A 2OQ0A 1BDOA 1SE4A 4MNOA 4ME5A 4X64L 1UE1A 1I3QH 2O2LD 3BYYB 2QGQA 2ZM6L 4IPDA 2N55A 1EY7A 3TSSA 2EXZA 2QF7A 2XRSD 1ZKOA 2JA5G 2H1EA 1JE4A 2R3ZA 5KEEA 4LW1A 5FOBB 4JI1L 4GLXA 2YTYA 5E4XA 3AFQA 2KENA 2A69D 1SE2A 4B3RQ 2NUCA 4FXGC 1EYCA 3PF5A 1BQQT 1ET9A 2QKIC 1JOQA 2BH8A 2R7ZB 5A35A 1F9QA 4X3SA 3H0GB 1E2VA 1UEAB 1ICWA 1A62A 2A68D 2ZTDA 1DOLA 1H9KA 2QA4A 3GTOH 1IYJB 1G51A 4FNFA 4DUYL 1GUSA 4X66L 2B2WC 5T1IA 1CSQA 4A3EH 1WJJA 2B2WA 2WP8J 5G3LD 3O13A 3AEVA 1IW7D 4EQ5A 1VQLA 2VQEL 1MD2D 1WYDA 2M2LA 1IL8A 1GHJA 5D65A 1TS3A 5A2QE 1EZ6A 4RGOS 2F52A 2KCMA 4DV6Q 4HN7A 3K59A 4DFAA 4JI3Q 1X3EA 1WTRA 2PMZE 3I4NH 4IJLA 4RWSC 1D5XC 2O4XA 2JEBI 2R93G 1LT5D 2B2UC 5M5WB 1S5CD 3L3OC 4K6DA 2UUAQ 2B2UA 3DWPA 3J81c 5C44G 5JAVA 5IGEA 1SNPA 1Q82C 4C3JG 3AQQA 1CKMA 2A6HC 3PUZA 3GTMH 2OWOA 3H15A 4ZK9B 2NZ1D 4QB4A 1VQ9A 5LL6S 4DV4Q 4X3UA 3GTOB 3HOYH 2C5CA 4M8AA 2F0DA 4KLKA 3CCQA 2XNAC 4AQYQ 4RH6A 1N9WA 1WCMB 1XYIA 1VMPA 4BY7H 5AFWA 4LF4L 3T13A 1B44D 4KY5A 3TP7A 4CBVA 1EWCA 1HZAA 2JA9A 3STBC 5K5PA 2ZTCA 3BVGA 3D4RA 4R4OA 4LFAQ 5GADC 4JI0L 1PH5A 2WKDA 3TP8A 3K7UC 1UUPA 1PTOF 1DJRD 3I4NB 1SBBB 3CQZH 1EOTA 2PZUA 4IPHA 2LSSA 2E2HH 1PFNA 2EYPA 1SJHD 1ZYRC 1CUKA 5F2DA 4DV2Q 4DAMA 3DLLA 4IFDJ 2QEXA 1XPOA 1WTHA 2NN6I 1YJNA 1EOVA 2UUCQ 3ND9A 3F2DA 3OHXC 2D0PA 5A2QL 3N6RA 4P72A 3OYYA 5FKAC 2L55A 1WI5A 1OO9B 2AUJD 5I9PA 3OIPA 3S1NB 1T5XD 3VA7A 2WFWA 2E2IH 3BG3A 4IJHA 1B70B 1QOHA 2IJ0A 1FJGQ 2AMCB 1AE2A 4BA1I 3LGJA 3CPWA 5M3FG 1PZKD 4N9TA 4AYBG 5I4DA 1Q90A 1K0SA 2K1BA 3NE5B 1U4PA 1PH8A 2JA8G 1KRTA 2O5JC 1LTTD 3NQTA 3CRKC 1YVCA 3AMUA 1HNZQ 2C35B 1R4PB 3CCEA 2Y0SB 3CQZB 5HURA 2ZXOA 3DHQA 5C0XJ 4C56C 4A3FG 1AN8A 4DK0A 2E2HB 2R6GA 1Z6HA 4XDXA 4IFDI 5IGGA 1GUOA 5BN5A 5ELBA 1JOKA 1Q1EA 2RCFA 1TKWB 3RLOA 2FHTA 2XGTA 4HJAA 1CKNB 1JE5A 1O7LA 1R9TH 5E3FA 4FF3A 4AH6A 2E2JH 2XSCA 5LMUQ 3OWFA 4K8IA 2AWOA 1ILQA 3SK5A 1PFSA 2F0QA 2OEOA 1JC7A 2E2IB 2RF4A 2Z9HA 1LTBD 4QUCA 1HTPA 2F4IA 5C4XG 4POFA 1K83H 4DF7A 4DR4Q 4DKAC 1T5EA 3I73A 4WORA 3I72A 1GUGA 4IOAA 4L5RC 1YZ6A 2FFKB 3URYA 1G8ZD 1W3SA 5C0XI 1Q86C 3JAMi 1BKBA 4OEMB 4CDDC 4Y52H 3J81i 3H3VI 2JA5B 2A6HD 2BA0A 1BVSA 1DZ1A 4HTHA 1SYBA 3SXHA 5KIXA 4IQZA 1XPUA 4F87A 4A3GH 1L2FA 2AUKA 2UXCL 4CJ1B 3T1HL 1R9TB 4HJ9A 4C3JH 4DNTB 3C1FA 2E2JB 1SYFA 4L63B 1A3VA 3ICEA 4CDFC 3I3CA 1BUVT 4A3JH 2DUDA 3HKSA 5CBEE 2HCIA 3STBD 4IPCA 2RBMA 5LHY1 1FR3A 3FKIG 3RLFA 3HOWG 2WB1G 1K83B 1TY2A 1PYBA 2CH4W 4H0LC 1WFQA 1DONA 1WOCA 2LXKA 4UY8C 1HR0Q 1GXDC 5CR3A 3UI2A 1STYA 3D0FA 1ZYRD 2K32A 2VW9A 3HOXG 1YHQA 1SMYC 1N34Q 3KLSX 2IX3A 1FNVA 2XIWA 4JC0A 4ZCKA 3SHLA 4IURA 3T53B 4ZUJA 5E7NA 1PTOC 2R93B 1J5EL 3I2ZA 1STEA 2F0HA 5C44B 1RTOA 3H94A 4XQNA 1PTOH 1IBLL 1Y8PB 3MHBA 3X3MA 3J7ZC 5AJ3Q 1G6PA 5JVG3 5IP7G 3OWEB 2ASBA 1SMXA 5LL6X 4JYAQ 1PLFA 1I4HA 4O42A 1N36Q 4DR1Q 1WTOA 3KBGA 4IN3A 4DAYA 3TQYA 4HMIA 1FGUA 1X3QA 4LFCL 5FO9B 4FO2A 4YCWA 1KL9A 4K5WA 4ZKBB 2JEAI 1E1OA 1H9JA 2JQOA 1YJWA 1Y1VG 4P2CB 1E7ZA 5IIFA 1STBA 2I07B 3QB3A 4KKUA 4PZ7A 1DD2A 2KHIA 1QCBD 1V1PA 5IGCA 2B2YC 2MUYA 2Z6BA 4UPAA 1SRUA 4DXGA 2B2YA 1CTMA 2JN4A 4IUTA 1KTKA 3EBEA 4ILWA 1PTOB 1SYGA 3SK8A 1JCKB 1BR9A 4QJFA 4GLVB 3NUCA 2AQ3B 3A8KE 4R4TA 2IT1A 1L0YB 2ICEC 4DNRB 5EPLA 4DR3Q 2IL8A 4LF7L 5M3FB 5K36H 3R3OA 4DAYB 4AYBB 1QILA 2BE5D 1H95A 5BN4A 2DN8A 5FLXE 4OELB 4R1JA 2JA8B 1DCZA 1XTCD 4NXNQ 5EPKA 2N49A 1MIUA 2B2TA 1K73C 4J15A 4A3FB 3ERSX 1Q7YC 1F9PA 3HGBA 2KECA 4C2MB 1SROA 1U4LA 1V1PB 3BYTB 3A0JA 4EX5A 3W1GA 2YU9H 5KNDA 1EQQA 3GO5A 1PH4A 3HFZB 3V2TA 5JVH3 2E75C 4DPGA 2HT1A 3CMAA 2ZT9C 5CORA 5DM73 4H7BA 2XN9C 2NTTA 3HG9A 4EQNA 5IYBG 1JMCA 1PZID 5EKLA 1ENAA 5C4XB 1PVOA 4P74A 1SMYD 4BBRH 4IZ8A 2KCTA 3FKIH 3CMEA 3GDEA 1I6HB 1S3OA 3PO3G 1F2LA 1M90C 1PTOD 2YTXA 3GTLH 3KJOA 1GOZA 1KNAA 3MFGA 1F2MA 4DGZA 4QIWB 5CMDA 1I4XA 2NVXH 3OPOA 3J80E 4WJ4A 4JI3L 4N8X1 1QVGA 2EJFC 4HJ7A 4KN4C 4ZRZA 3K7AH 1Y1WG 4QMGA 4OHJA 5IT9L 5FLXL 2UUAL 1L0WA 2HDMA 2TSSA 2DJFC 3HZXA 3CRLC 1VQ7A 5CBAE 5IYCG 5KNBA 1VS0A 5IP7H 5CC4A 1K3RA 3FKIB 1Q3LA 4A4IA 3HOWB 2UXBQ 2WB1B 2MJ8A 3FMCA 1HJPA 2JSOA 5FLMG 1PHJA 1PV4A 2F0MA 3DWQA 3FDTA 3BDLA 3U9OA 2ZJQA 2OT2A 4DK1A 3PUWA 3HOXB 2QW7A 3M4OH 2UUBQ 2R61A 1O7ZA 2F3IA 3ULPA 4A3EG 1E22A 2NVXB 1NY4A 5IE8A 1NR4A 3SR1A 5JEAJ 1GUWA 1GHKA 3K58A 3K80C 1L1OC 4P71A 1TS2A 1CZGA 1L1OA 2CQOA 4QGUA 4DV2L 2EYFA 4HIMA 3GTJH 3E9IA 2Q2HA 3T1YQ 2UUCL 4XTCS 4RHRA 3Q8DA 4PMBA 4ABNA 2PPBC 2G9DA 3J80L 3P20A 4PMWA 3U50C 4BY1G 1DOMA 4BS9A 1YNJC 1V9PA 1U5KA 4JCVE 3KF6B 4C3HG 2UXDQ 2P5ZX 3RZDH 1FJGL 2IX1A 1STAA 3GTKH 3HOYG 4HJ8A 3L7ZC 2EJGC 3FPUB 1Y1VB 1EYGA 1H9RA 2ZXPA 3C3LA 1XNQQ 1XMQQ 5FO7B 1C7YA 4K14A 1LTID 3PIO3 2B39A 2NZOA 2Z4IA 1G91A 5T1GA 3D4WA 3EJIA 3RZOB 2KUMA 1SDFA 3OIQA 2F1MA 3X3NA 2E74C 2RSOA 4DAVA 1GUNA 3CW2C 1VQJA 2ZJRA 4NW2A 1AZPA 1SNMA 5EBDA 3TZDA 1SE8A 2HDLA 1UNSA 3HP3A 5CV4A 2VQFQ 3KF8A 5LMUL 4MTNA 4H13C 1IZ6A 3U4VA 3NBIA 3VYUA 1BBXC 2PNHA 3NTHA 4B3SQ 1A3TA 3MC0B 3RZDB 4CKBA 4FXKC 4F8MA 3H6MA 3PMFA 4A3BH 4DR6Q 1RKNA 4DR4L 2PI2E 3I70A 1RIPA 4B3TQ 1A2UA 5COYA 1CHPD 1MBYA 3G6EA 1QVFA 1UE7A 2WV6D 3JAME 1F9RA 1N32Q 2E76C 1NSNS 2PYKA 4LF9L 1JWSD 3NPPA 4XIGS 1Y1WH 2GVBA 2WAQG 3F2CA 3GTQB 4WJWA 4JBJA 4DV0Q 1D1IA 5IYCH 4V0BA 1VQ6A 5LMNQ 2C9OA 3I4MH 1GKHA 3TMEA 2AKWB 4UHVA 5I9OA 4KKSA 4DR7Q 4LWCA 4PG3A 5ELEA 3M9BA 5FLMH 2JXMB 3K8AA 1XWEA 1AH9A 1IL2A 1IBKQ 3PO3B 1I50H 1V1QA 1EIGA 1CZWA 5GAHC 4GS3A 1MHWC 1KLGD 1VQPA 4B3MQ 4OO1G 1EWIA 2VL6A 2B8GA 4JI2Q 4A3DG 1EUJA 1C4QA 2LXJA 1N34L 4GLAC 1OXXK 3IL8A 2SDFA 3EA6A 4X62Q 1I3QB 3E0EA 2NVYH 1N8RC 3PO2G 2CQAA 1Y1WB 1KDCA 2PW5A 1PH9A 4EQPA 4OX9Q 1VF5C 1X65A 3W2DA 2OTJA 4HIOA 2KOLA 3QIAA 1W6KA 3LWUA 2GVAA 4DV5L 4XQJA 3GV6A 4IOCA 4YWKA 3S1MH 4A3GG 3JAML 2IW3A 4HSVA 4A3IH 1ET6A 1GVPA 3A74A 4IO9A 4BY1H 4TRDA 4JYAL 1N36L 2RVLA 1QUQA 4C3HH 3BDCA 1KDBA 3I8ZA 4DR1L 2K14A 4NMZA 5KRUA 4A3JG 1AZQA 3I90A 5IGFA 2B3GA 2ZJPA 2EIFA 3QJYA 4JG2A 1EY5A 2YTVA 4E6IA 3SK4A 4A3EB 5NUCA 1DGSA 3M4YA 5C3EG 3LX0A 1I5FA 1F9SA 1XMOQ 4KD4A 1VQ8A 2NVYB 4GN4B 2HIVA 1BNZA 2LS01 2MGSA 4RKLA 1GO3E 1D7QA 3FHWA 4G57A 4IUPA 3PCOB 4Z9CB 1ASZA 2PMZB 3BZDB 5CYUA 2B29A 3TN2A 2QCPX 3TEHB 3D4DA 2F03A 3S1MB 1DXMA 3HKZE 1LV9A 1OXVA 4RCOA 1RDPD 4BY1B 3DM1A 4J6HA 1D5ZC 1I94Q 3GTMB 2A74C 1SFOH 4C3HB 1NE3A 1U9RA 2CW0C 2ENBA 5CV9A 4DR3L 4PMCA 1IXRA 5FO8B 4QL5A 1QUQB 3F2BA 3HOYB 1VQGA 3CCUA 3M7GA 2EYMA 4UAIA 2MQHA 4JI4Q 1YNXA 4BY7B 2CWAA 4JBMA 4NXNL 1ML0D 3M3YH 4O1NA 4EGVA 4OWTB 2GA4B 2QDBA 2K75A 4DV3Q 3E3XA 4H44C 4ULLA 4JV5Q 4MZ9A 4I7AA 4RGMA 1WVLA 3QWNA 5BR8L 2F0TA 1CA6A 2EYLA 2YYZA 3D8GA 1VCIA 4QCLA 4N9PA 4KK7A 3L0OA 2A5HA 3A55A 2K5VA 1KIXA 3SE0A 1E3PA 3MXNA 1TS5A 1PH6A 1SFOB 1SNDA 3KJPA 5CV6A 4JOIC 4RCNA 2K28A 1SXTA 1EYAA 4BXXG 4JOIA 1R4QB 1JJ2A 3E5SA 2MP1A 3E0JA 4FDBA 4Q0FA 3BVMA 3UDIA 4OO1H 3NBHA 2L12A 1WTPA 1EIYB 4A3DH 4LUVA 3M3YB 2K4KA 5K36G 1CI3M 4POGA 1CFMA 1GD7A 2HQLA 4NP5A 3VR4A 1Z47A 2DNCA 3S2HH 4DR5Q 1C8CA 5E1FA 3C2PA 4C1NK 3PO2H 1JWUD 2L1BA 2WAQB 3CHBD 4LNQA 4NXMQ 5D3IB 4A3CH 4YY3Q 4YCVA 2FMMA 1C0AA 3A8IE 1UE5A 3MFYA 2UU9L 1O80A 2X69A 2CWPA 1YIJA 5GAGC 3HEJA 1AE3A 3MXNB 4HSPA 3PIPA 4OGQC 4DUZQ 1EL0A 3DMUA 1Q8IA 4A75A 2IX0A 3R2IA 4JPBW 2OXPA 1QZGA 3TBIB 4BWGB 5ELFA 4A3DB 3VYSA 4X65Q 4BBRG 4CHTB 1MI2A 1ESFA 5C3EH 2UUBL 1DM0B 4BBSG 3NBHB 2NYZD 2EY1A 1IYVA 1FD7D 3KLSA 3S2HB 3D3RA 1HRJA 1Y8NB 3G71A 2F4VQ 1B3AA 3MAQA 1TY0A 3GQBA 4LUZA 1QB5D 1VDZA 3J7AF 4KY7A 3VR2A 2H4OA 3VR5A 5EJWA 1SLJA 2E5LQ 4B9WA 4A3GB 3T1YL 1TT2A 2TMPA 4K0KQ 1TWGH 4DUYQ 4C3JB 2F0IA 2RKSA 3MXUA 1Q12A 1SYEA 4DU9A 4A3JB 3Q22A 2UXDL 1MKHA 3MZ5A 2VQEQ 3U9SA 5ELOA 3F2UA 5IYDH 2OQKA 3M4QA 1XNQL 1VQFA 1XMQL 2K7VA 2WINB 4CDEC 1CSPA 1VQAA 4A3KG 2L4NA 2Z1CA
chains in the Genus database with same CATH topology
4U68A 2PNRC 1B50A 1SEBD 4MHEA 4KV6A 2BA1A 2J4XA 3EROA 2KEDA 2L5TA 5I6WA 1TWGB 4IUUA 1KNEA 4CKCA 1B53A 1HTLD 1LTGD 4FVMA 1S4ZA 2EY6A 4K2LA 2K6AA 5CV5A 2VB2X 1HUNA 2CHBD 1X32A 3T16A 2F3WA 2G9HD 3PV0A 4ID6A 3MXPA 2A73B 2XVSA 1KAAA 1QWYA 3A7LA 3A7AB 1RHPA 4DAPA 1HHVA 1LLRD 1LO5D 2NVQB 2ID0A 2B2TC 1CQVA 4V190 2AQ1B 1TR5A 4DN4M 1STGA 1WD1A 1VMCA 5JPNC 4G7OC 3P7JA 1V1OA 2LMCB 2PCFB 1JR0D 1KDAA 1XX8A 4IUNA 2PZWA 3AU7A 3CKIB 1H9SA 3PIP3 4TQUS 3Q0AA 4IFDH 1RD9D 5C4HA 3D6WA 1CHQD 1QNKA 4LMQD 3Q23A 2F0GA 1K8MA 1PZJD 4HR7B 1O7YA 1NR2A 1B4OA 2D9UA 5I2YA 4XXEA 3M85A 3G7LA 1ZEQX 3KK7A 2RSNA 3NWSA 1HFNA 3H3VC 3S1QB 4ZQ3A 2YU9B 2J0TD 5C0XH 2L0CA 2CVRA 2F0NA 1LTAD 4JBWA 1H9SB 3RUZA 4HCEA 4M1UB 3QO2A 4MN3A 4R8IA 2NB0A 4BBRB 1I4PA 3J7YW 3FRPB 4BBSB 2F0VA 3T56B 4CJ2C 3I91A 5EQ0A 5I2XA 3BVZA 3GTLB 4MIUA 3H91A 4F88A 2SEBD 1LT6D 3NSWA 1GUTA 1ZXTA 1C48A 4F7XA 3NHHA 1Z7TA 3K7AB 3LNNA 4PNYA 3HRZC 1HPCA 5DAUA 2A69C 1BF4A 3BS1A 2F0KA 2PZTA 1D6EC 3I4LA 1SJED 4RKBA 1Y8OB 2ZXRA 2A68C 1F2ZA 3PUXA 1NCVA 3OMCA 3ERQA 1BCPF 3FVQA 4A3KB 1RF2D 3M4OB 2X6GA 2D5DA 1EEFD 1RODA 2NTSA 2X6LA 1JB3A 1CA5A 2DNEA 4RA8A 3DWAA 1AW7A 3DEOA 4B08A 1H9MA 1I6VC 1A3UA 3P1HA 3GD7A 4FF4A 4WFN3 1CM9A 1LABA 3GTJB 1RJTA 1STHA 4J8QA 4RAUC 1HXYD 1V43A 4KD3A 4GZYC 1E2WA 1QG7A 1FNWA 3GTKB 5JOBA 1A6XA 5IOCA 1EFID 3GTPB 4QUFA 1PRTF 5DNFA 2VXWA 4OO1I 2SNSA 2XRQD 3K6OA 1Y69U 2EJMA 1WTVA 3J81E 1IHZA 3N52A 2F0FA 4K8JA 1JICA 5DM63 1TS4A 2EY5A 2K05A 5JEAG 5J1ZA 3SK6A 3NK9A 3QOLA 2KA7A 1SSOA 4IUQA 3NWTA 3E6ZX 3MEHA 2IWHA 1LT4D 4NDXA 4ZKCB 4A3BB 3FEWX 4R8NA 5C5MA 4CGYB 3J7AV 3M7NA 2B63B 4Q5VA 1LTRD 4R9WA 2J7ZA 2KJXA 1II3A 2NWGA 4K5XA 2F0OA 1YNNC 5M9OA 5HGTA 2HUGA 1TWAB 1PDQA 3S15B 2N88A 3H09A 1HUMA 4LJZC 1EU4A 1TVXA 1GJXA 1TWFB 3V96A 2RDHA 1YNJD 1MSHA 3I4MB 2Z4HA 2VUMB 2KVMA 1IKMA 2LFNA 3GP7A 1STNA 5EBCA 5FK9C 1EWHA 3TP5A 4ZYSA 1J8IA 3J81L 1I50B 1FGBD 1S5BD 5D14A 2JP1A 1B9NA 1BCPC 4HEDA 1M4VA 5KYIA 4K2KA 1CK1A 2EVBA 3DUZA 1D5MC 2XWJB 5EKIA 3T51B 1XXGA 2F0EA 1HCZA 1V8QA 1PXUA 4CKEA 1WTQA 1RCVD 2WKCA 3D6CA 4QF4A 3HOZB 1B1ZA 2K04A 2AQ2B 1AEXA 2K5DA 1ENCA 3ITPA 4TSSA 2EZVA 1A2TA 4A3IB 1SYCA 3S9WA 2I46A 3MVVA 4ZUIA 1S5DD 2BCOA 1SAPA 3C46A 1LACA 5EKKA 1JWMD 1EY0A 3BDOA 3S2DB 1S5FD 3RMHA 1BCPB 2F0UA 1PRTC 2EOTA 4LAAA 2EDGA 4DA2A 1B2TA 1F2YA 1PFBA 4X3TA 4K6LA 1JQYD 4IALA 4UDUC 3VYTA 2AWNA 1O78A 2A6EC 3KLRA 3G6JB 4RFBA 1G291 1NAPA 5JEAH 5C4ZA 5JPMC 3ND8A 3HKZB 1SE3A 2K33A 2KQ3A 4S3SA 1I4QA 4KKTA 5J22A 1YNND 4U673 3T4AC 4G7ZC 4DXFA 1HA6A 5CV8A 2B8FA 2NN6G 1E0BA 2B2VC 4XYQA 3TZUA 3CU7A 3Q6SA 3VYRA 2B2VA 1PRTB 5C5LA 3VA5A 1CT1D 1BOSA 2K5QA 2DY8A 2KCCA 4OL7A 2DY7A 4G4KA 4ZLTF 1I4GA 1LTSD 3K5LA 1IYUA 2MHVA 2FJ2A 1SNCA 1BXTA 1FYCA 1EYDA 2XWBB 4L6TB 1OXTA 3HOUB 3TDQA 1EY8A 1BCPD 2Q8TA 3A8JE 2E2DC 5E4WC 3EQLC 5IGDA 2BDOA 4XT1B 1HA5A 1AP0A 2RA4A 2PQEA 3AB9A 5KNCA 1WTXA 2QILA 1U4RA 4IFDG 1D2BA 2BE5C 3MTSA 5JJZA 2K5WA 3IFTA 3RD4A 2KHSA 3ZYYX 2Q8RE 4NKLA 5C3XA 3PO2B 3VR6A 2EYJA 3KBXA 1ENFA 4ODGA 3LWEA 1JORA 1X3PA 5ELCA 1DYQA 2F3VA 3QOJA 1Q1BA 1J9OA 2CW0D 4XT3B 1TWHB 4TKOB 2RDGA 1HQMC 1L0XB 3GV3A 4K5VA 1QJOA 5C0XG 3K57A 3IKJA 1PRTD 2JYOA 3OSOA 4C1NI 1EEID 1HFGA 2IPKD 4YIJA 2A6ED 5C3EB 1SYDA 1EIHA 2EE1A 3L9AX 3PUVA 2QEJC 4A3MB 1KLUD 2HQEA 3WDNA 2Q8IB 2OF1A 1JOOA 3A54A 1CQFA 3D31A 2Z8LA 3K5OA 4LK1C 1HQRD 3SEBA 3S17B 2PO4A 3C1EA 2F0WA 1EY4A 1SNQA 2FINB 1OXSC 4HCSA 1E2ZA 4KY6A 1EQVA 2D2CC 3NQIA 4JK1C 5ISRA 1EY6A 4KHZA 1QNUA 3MA2B 3SDZA 2LKVA 3SVMA 2EYHA 2WACA 2VNUD 2V4DA 5G3LF 1IKLA 5TSSA 2NN6H 3K5NA 4HMJA 4PQXA 4C3IG 5KGUA 1D1KA 3S14B 4X3KA 5C6AA 4Y7NB 2RDFA 5IODA 4FYDA 2KCNA 1WD0A 4XQQA 2F0JA 3V05A 2NVTB 5ELDA 4CJ0B 5IT9E 3Q24A 3EVQA 3HOVB 4FF1A 3VR3A 4FP5D 1U4MA 1G2SA 1TQOA 3IAYA 1RTNA 2HCCA 2MPMA 1EY9A 1W6JA 3IFDA 5M3MB 4J1MA 2EPBA 4KJOA 5CV7A 4EVOA 1A15A 1S5ED 5D3DA 2SOBA 4ZAIA 1EZ8A 4KHVA 4I7ZC 4I65A 4RGTA 5J39A 4RHSA 2BOSA 3HS0C 2WIIB 1QE6A 5KYLA 3MXGA 2L11A 3S1RB 3WOFA 1OXUA 5IGBA 2M9VA 1TIID 2F0PA 4A93B 3A56A 2JA6B 2JE6I 3P75A 1NUCA 3FPPA 4KTAA 1UAPA 2K01A 4RGNA 2JA7B 5C4JB 4OIJA 1M8AA 1ONLA 3OOCA 3R8BA 1MGSA 3OW7A 4KJNA 2EY2A 4HAEA 4IUVA 5I6YA 5M5YB 1G2TA 2BDNA 3PUYA 1PFMA 1PMRA 1F77A 2SNMA 4KMUC 1PYWD 4OIKA 1I4RA 2O5IC 1BO0A 3KUPA 4L8JA 5DEHA 3NTIA 1IW7C 5C3WA 4XYOA 5BN3A 5CGKA 4G7HC 1TWCB 2R92B 2FMCA 3NTKA 2F0SA 3OMGA 1SNOA 1FNUA 3NXWA 1WTWA 3R2TA 2EYOA 2LY7A 5EGTA 2RQXA 1LT3D 2M00A 3K0YA 3GTGB 2L9HA 3WOEA 3EFXD 1G6ZA 4BA2I 4PV1C 1AFPA 4EQOA 1EQTA 2ICIA 4C3IB 1TU2B 4FF2A 1K8OA 3DEPA 3W3AA 3DXJC 3NP8A 5M5XB 1DOKA 1MSGA 1ESRA 4B9XA 3ONAB 3S16B 2PW7A 2K03A 3QG1A 4FXDA 3TP6A 4WRDA 3K5MA 3MWYW 1VF7A 1EU3A 1B9MA 2VB3X 1ILPA 4KI0A 1KABA 2F0LA 2NBFA 3R93A 5EPJA 2KEEA 4KN7C 2D62A 1BDOA 1SE4A 4ME5A 2O2LD 3BYYB 2N55A 1EY7A 3TSSA 2EXZA 2QF7A 2XRSD 1ZKOA 2H1EA 1JE4A 2R3ZA 5KEEA 5FOBB 5E4XA 2A69D 1SE2A 2NUCA 4FXGC 1EYCA 1BQQT 1ET9A 2QKIC 1JOQA 2R7ZB 5A35A 1F9QA 4X3SA 3H0GB 1E2VA 1UEAB 1ICWA 2A68D 1DOLA 1H9KA 4FNFA 1GUSA 2B2WC 5T1IA 2B2WA 2WP8J 5G3LD 3O13A 1IW7D 1MD2D 2M2LA 1IL8A 1GHJA 5D65A 1TS3A 5A2QE 1EZ6A 4RGOS 4HN7A 3K59A 4DFAA 1WTRA 4RWSC 1D5XC 2O4XA 2JEBI 1LT5D 2B2UC 5M5WB 1S5CD 3L3OC 4K6DA 2B2UA 3DWPA 5JAVA 5IGEA 1SNPA 4C3JG 2A6HC 3PUZA 4ZK9B 2NZ1D 4QB4A 5LL6S 4X3UA 3GTOB 2C5CA 4M8AA 2F0DA 2XNAC 4RH6A 1WCMB 1XYIA 1VMPA 5AFWA 3T13A 1B44D 4KY5A 3TP7A 4CBVA 1EWCA 5K5PA 3BVGA 3D4RA 2WKDA 3TP8A 1UUPA 1PTOF 1DJRD 3I4NB 1SBBB 1EOTA 2PZUA 1PFNA 2EYPA 1SJHD 1ZYRC 5F2DA 4IFDJ 2NN6I 3ND9A 3OHXC 5A2QL 3N6RA 5FKAC 2L55A 1OO9B 2AUJD 5I9PA 3OIPA 3S1NB 1T5XD 3VA7A 3BG3A 1QOHA 2IJ0A 4BA1I 1PZKD 4N9TA 5I4DA 1Q90A 2K1BA 3NE5B 1U4PA 2O5JC 1LTTD 3NQTA 3CRKC 3AMUA 1R4PB 2Y0SB 3CQZB 5HURA 2ZXOA 3DHQA 5C0XJ 4C56C 2E2HB 1AN8A 4DK0A 2R6GA 1Z6HA 4XDXA 4IFDI 5IGGA 1GUOA 5BN5A 5ELBA 1JOKA 1Q1EA 1TKWB 2FHTA 1O7LA 5E3FA 4FF3A 2XSCA 3OWFA 4K8IA 2AWOA 1ILQA 3SK5A 2F0QA 2OEOA 2E2IB 1JC7A 1LTBD 4QUCA 1HTPA 2F4IA 4DF7A 1T5EA 3I73A 4WORA 3I72A 1GUGA 2FFKB 3URYA 1G8ZD 5C0XI 2JA5B 2A6HD 2BA0A 1DZ1A 4HTHA 1SYBA 3SXHA 5KIXA 4IQZA 4F87A 2AUKA 4CJ1B 1R9TB 4DNTB 3C1FA 2E2JB 1SYFA 4L63B 1A3VA 3I3CA 1BUVT 5CBEE 2HCIA 2RBMA 5LHY1 1FR3A 3RLFA 1K83B 1TY2A 4H0LC 1DONA 1GXDC 5CR3A 3UI2A 1STYA 1ZYRD 2K32A 1SMYC 3KLSX 2IX3A 1FNVA 2XIWA 3SHLA 4IURA 3T53B 4ZUJA 1PTOC 2R93B 1STEA 2F0HA 5C44B 1RTOA 3H94A 4XQNA 1PTOH 1Y8PB 3MHBA 3X3MA 5JVG3 3OWEB 5LL6X 1PLFA 1I4HA 4O42A 1WTOA 3KBGA 4IN3A 4DAYA 4HMIA 1X3QA 5FO9B 4FO2A 4K5WA 4ZKBB 2JEAI 1H9JA 4P2CB 5IIFA 1STBA 2I07B 3QB3A 4KKUA 1DD2A 1QCBD 1V1PA 5IGCA 2B2YC 2MUYA 4DXGA 2B2YA 1CTMA 4IUTA 1KTKA 4ILWA 1PTOB 1SYGA 3SK8A 1JCKB 1BR9A 3NUCA 2AQ3B 3A8KE 2IT1A 1L0YB 2ICEC 4DNRB 5EPLA 2IL8A 5M3FB 5K36H 3R3OA 4AYBB 1QILA 2BE5D 5BN4A 2DN8A 5FLXE 2JA8B 1DCZA 1XTCD 5EPKA 2B2TA 4A3FB 1F9PA 3HGBA 2KECA 4C2MB 1U4LA 1V1PB 3BYTB 5KNDA 3GO5A 3V2TA 5JVH3 2E75C 2ZT9C 5CORA 5DM73 4H7BA 2XN9C 2NTTA 3HG9A 4EQNA 1PZID 5EKLA 1ENAA 5C4XB 1SMYD 4IZ8A 1I6HB 1F2LA 1PTOD 1GOZA 1KNAA 3MFGA 1F2MA 4DGZA 4QIWB 5CMDA 1I4XA 3OPOA 3J80E 2EJFC 4KN4C 4ZRZA 4QMGA 4OHJA 5IT9L 5FLXL 2HDMA 2TSSA 3HZXA 3CRLC 5CBAE 5KNBA 5CC4A 3FKIB 1Q3LA 3HOWB 2WB1B 2MJ8A 3FMCA 2JSOA 2F0MA 3DWQA 3FDTA 3BDLA 3U9OA 2OT2A 4DK1A 3PUWA 3HOXB 2R61A 1O7ZA 2NVXB 1NR4A 3SR1A 5JEAJ 1GUWA 1GHKA 3K58A 1TS2A 1CZGA 2EYFA 4XTCS 4RHRA 4PMBA 4ABNA 2PPBC 2G9DA 3J80L 3P20A 4PMWA 1DOMA 4BS9A 1YNJC 4C3HG 2IX1A 1STAA 3L7ZC 2EJGC 3FPUB 1Y1VB 1H9RA 2ZXPA 3C3LA 5FO7B 4K14A 1LTID 3PIO3 2B39A 2Z4IA 1G91A 5T1GA 3D4WA 3EJIA 3RZOB 2KUMA 1SDFA 3OIQA 2F1MA 3X3NA 2E74C 2RSOA 4DAVA 1GUNA 4NW2A 1AZPA 1SNMA 5EBDA 3TZDA 2HDLA 1UNSA 3HP3A 5CV4A 3KF8A 4H13C 3NBIA 3VYUA 1BBXC 3NTHA 1A3TA 3MC0B 3RZDB 4CKBA 4FXKC 4F8MA 3H6MA 3PMFA 1RKNA 3I70A 1A2UA 5COYA 1CHPD 1MBYA 2WV6D 3JAME 1F9RA 2E76C 1NSNS 2PYKA 1JWSD 3NPPA 4XIGS 3GTQB 4WJWA 1D1IA 4V0BA 2C9OA 3TMEA 5I9OA 4KKSA 5ELEA 2JXMB 1XWEA 3PO3B 1EIGA 1CZWA 1KLGD 4OO1G 2B8GA 1C4QA 1OXXK 3IL8A 2SDFA 3EA6A 1I3QB 2CQAA 1Y1WB 1KDCA 2PW5A 4EQPA 1VF5C 3W2DA 2KOLA 3QIAA 1W6KA 3LWUA 4XQJA 3GV6A 3JAML 2IW3A 4HSVA 1ET6A 4TRDA 2RVLA 3BDCA 1KDBA 3I8ZA 4NMZA 5KRUA 1AZQA 3I90A 5IGFA 3QJYA 1EY5A 4E6IA 3SK4A 4A3EB 5NUCA 3M4YA 3LX0A 1F9SA 4KD4A 2NVYB 1BNZA 2LS01 2MGSA 4RKLA 4G57A 4IUPA 4Z9CB 2PMZB 3BZDB 5CYUA 3TN2A 2QCPX 2F03A 3D4DA 3S1MB 1DXMA 1LV9A 1OXVA 4RCOA 1RDPD 4BY1B 3DM1A 4J6HA 1D5ZC 3GTMB 2A74C 4C3HB 1U9RA 2CW0C 2ENBA 5CV9A 4PMCA 5FO8B 3HOYB 3M7GA 2EYMA 4UAIA 4BY7B 1ML0D 4O1NA 4EGVA 2GA4B 2QDBA 4H44C 4ULLA 4RGMA 1WVLA 3QWNA 1CA6A 2F0TA 2EYLA 2YYZA 3D8GA 1VCIA 4QCLA 4N9PA 4KK7A 2A5HA 3A55A 3SE0A 3MXNA 1TS5A 1SFOB 1SNDA 5CV6A 4RCNA 2K28A 1SXTA 1EYAA 1R4QB 3E5SA 2MP1A 3E0JA 4Q0FA 3BVMA 4OO1H 3NBHA 2L12A 1WTPA 3M3YB 5K36G 1CI3M 1CFMA 4NP5A 3VR4A 1Z47A 2DNCA 1C8CA 3C2PA 5E1FA 4C1NK 1JWUD 2L1BA 2WAQB 3CHBD 5D3IB 2FMMA 3A8IE 3MFYA 1O80A 2X69A 3HEJA 4HSPA 4OGQC 1EL0A 3DMUA 1Q8IA 2IX0A 3R2IA 2OXPA 3TBIB 4BWGB 5ELFA 4A3DB 3VYSA 4CHTB 1MI2A 1ESFA 1DM0B 2NYZD 2EY1A 1IYVA 1FD7D 3KLSA 3S2HB 3D3RA 1HRJA 1Y8NB 1B3AA 3MAQA 1TY0A 3GQBA 1QB5D 1VDZA 3J7AF 4KY7A 3VR2A 2H4OA 3VR5A 5EJWA 4B9WA 4A3GB 1TT2A 2TMPA 4C3JB 2F0IA 2RKSA 3MXUA 1Q12A 1SYEA 4DU9A 4A3JB 3Q22A 3MZ5A 3U9SA 3F2UA 2K7VA 2WINB 2L4NA 2Z1CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U68 A;  2N55 A;  4CJ1 B;  1Q3L A;  1MSH A;  1RTN A;  2MJ8 A;  4OIK A;  2H1E A;  2HCC A;  1JE4 A;  2R3Z A;  3G7L A;  1BO0 A;  1B50 A;  1C8C A;  2KVM A;  1CM9 A;  2MPM A;  1IKM A;  2RSN A;  2JYO A;  1F9S A;  3FDT A;  2IL8 A;  3I3C A;  3IFD A;  3KUP A;  2EPB A;  4MHE A;  2L1B A;  5E4X A;  1HFN A;  5CBE E;  1HFG A;  1RJT A;  2HCI A;  2KED A;  2MGS A;  5COY A;  1BNZ A;  1J8I A;  1O7Z A;  1EIH A;  2FMM A;  1A15 A;  2CVR A;  1F9R A;  2EE1 A;  4RAU C;  4IUP A;  4IUU A;  1KNE A;  1B53 A;  1F9Q A;  5EPL A;  4X3S A;  1DON A;  1HA6 A;  5D14 A;  1O80 A;  2JP1 A;  2X69 A;  1NR4 A;  5EPK A;  3QO2 A;  3TN2 A;  1QG7 A;  3UI2 A;  1S4Z A;  1ICW A;  1E0B A;  4HED A;  4MN3 A;  1DOL A;  4ZAI A;  4R8I A;  1GUW A;  2B2T A;  1HUN A;  1X32 A;  2B2V C;  1LV9 A;  1F9P A;  2B2W C;  2XIW A;  3Q6S A;  2B2V A;  5T1I A;  1QE6 A;  1EL0 A;  2KEC A;  1WTW A;  4QUF A;  3DM1 A;  2B2W A;  1U4L A;  4IUR A;  2L11 A;  2K1B A;  5EKI A;  1U4P A;  4CJ2 C;  3I91 A;  5DNF A;  5EQ0 A;  2VXW A;  2L9H A;  2DY8 A;  2FIN B;  3H91 A;  1WTQ A;  2DY7 A;  1MI2 A;  2M2L A;  1IL8 A;  4ZLT F;  1RTO A;  5D65 A;  1WTV A;  1ZXT A;  4HCS A;  1G6Z A;  2FJ2 A;  2L4N A;  1RHP A;  4XDX A;  4UAI A;  2NYZ D;  5COR A;  1HHV A;  2K04 A;  1DOM A;  3N52 A;  1WTR A;  1EIG A;  1EQT A;  2B2T C;  2FHT A;  2Q8T A;  1JIC A;  1HRJ A;  4RWS C;  5E4W C;  2K05 A;  1ML0 D;  3DEO A;  1B3A A;  4XT1 B;  4DN4 M;  2B2U C;  1AP0 A;  2RA4 A;  1VMC A;  3DEP A;  1WD1 A;  1SSO A;  2B2U A;  1BF4 A;  3SVM A;  3FPU B;  3P7J A;  2K01 A;  4IUQ A;  1PLF A;  4O42 A;  1WTX A;  1U4R A;  3IL8 A;  1DOK A;  2SDF A;  1WTO A;  1IKL A;  1ESR A;  1ILQ A;  1F2L A;  1MSG A;  1XX8 A;  3MTS A;  5EJW A;  1WVL A;  5JJZ A;  1CA6 A;  4ZK9 B;  2NZ1 D;  3ONA B;  5T1G A;  1G91 A;  1SAP A;  4QUC A;  1X3Q A;  4ZKC B;  2K03 A;  2KUM A;  4OIJ A;  4X3U A;  1KNA A;  1M8A A;  1SDF A;  4X3K A;  4ZKB B;  3MWY W;  1NCV A;  2Q8R E;  5CMD A;  1MGS A;  1ILP A;  2KOL A;  3D6W A;  3KBX A;  2RSO A;  1XYI A;  1VMP A;  2EOT A;  1QNK A;  2FFK B;  3LWE A;  3GV6 A;  4LMQ D;  1X3P A;  5AFW A;  1WD0 A;  1B2T A;  4R9W A;  4NW2 A;  1PFB A;  4X3T A;  1AZP A;  2J7Z A;  4HAE A;  3TZD A;  2B2Y C;  2K28 A;  4IUV A;  2HDL A;  4HSV A;  2X6G A;  3R93 A;  3F2U A;  3HP3 A;  2KEE A;  2NWG A;  5EPJ A;  2B2Y A;  1J9O A;  4IUT A;  1ROD A;  1G2T A;  4XT3 B;  2HDM A;  2MP1 A;  4CJ0 B;  2X6L A;  2RVL A;  1DZ1 A;  2BDN A;  2HUG A;  3I8Z A;  3GV3 A;  5CBA E;  1CA5 A;  1NAP A;  1O7Y A;  1PDQ A;  1BBX C;  2N88 A;  1AZQ A;  3I90 A;  1NR2 A;  2L12 A;  1B4O A;  1PFM A;  4RA8 A;  1WTP A;  1EOT A;  2D9U A;  1HUM A;  1U4M A;  1TVX A;  1G2S A;  1PFN A; 
#chains in the Genus database with same CATH topology
 3PSI A;  4U68 A;  2KBN A;  1K28 A;  2PNR C;  3J7A 5;  4Y7N H;  2DJG C;  2NVQ H;  1B50 A;  2Q2T A;  2ATW A;  1SEB D;  4MHE A;  4KV6 A;  2BA1 A;  2J4X A;  3ERO A;  2KED A;  2L5T A;  1UEB A;  5I6W A;  4YHH L;  4YWM A;  4LF5 Q;  1TWG B;  4AYB E;  4IUU A;  4ME3 A;  2A8V A;  1KNE A;  2PQA A;  4CKC A;  1B53 A;  1HTL D;  2VQF L;  2ES2 A;  1LTG D;  4FVM A;  1S4Z A;  2EY6 A;  2YV5 A;  2K6A A;  4K2L A;  5CV5 A;  2VB2 X;  4BXX H;  1HUN A;  2CHB D;  1X32 A;  1PA6 A;  3WWV A;  2OCE A;  3T16 A;  1PH2 A;  2F3W A;  3ULJ A;  4JI8 Q;  5M3M H;  2G9H D;  3PV0 A;  4ID6 A;  4B3T L;  2RHQ B;  3MXP A;  2A73 B;  4GOP C;  2I5L X;  2XVS A;  3PGZ A;  4GOP A;  3K81 C;  1KAA A;  1QWY A;  3A7L A;  3A5U A;  3A7A B;  1RHP A;  1N32 L;  4DAP A;  3CCM A;  4DV1 Q;  1HHV A;  2K5N A;  1LLR D;  1LO5 D;  1A0I A;  4GNX C;  1O7I A;  2NVQ B;  2ID0 A;  2B2T C;  1CQV A;  3MEF A;  4V19 0;  4GNX A;  2AQ1 B;  1HR0 W;  1TR5 A;  4DN4 M;  1STG A;  1WD1 A;  1VMC A;  5JPN C;  4G7O C;  4DR2 Q;  3P7J A;  4DV0 L;  1V1O A;  1K8A C;  2LMC B;  2PCF B;  1JR0 D;  4QY7 A;  1VQE A;  1KDA A;  1VQI A;  1XX8 A;  4IUN A;  3S1R H;  3S1Q H;  2JJQ A;  3B6Y A;  4DK3 C;  4B3R L;  4YCU A;  2PZW A;  5HY6 A;  3AU7 A;  3I7F A;  3PF4 A;  4DR7 L;  3CKI B;  1VQH A;  1H9S A;  3PIP 3;  1NTG A;  4TQU S;  4JI6 Q;  3Q0A A;  4IFD H;  2JA6 H;  1IBK L;  1RD9 D;  5C4H A;  3D6W A;  2RHS B;  1VQO A;  1CHQ D;  1QNK A;  4LMQ D;  3Q23 A;  4DV7 Q;  4BBS H;  2ALY B;  4JI2 L;  2F0G A;  1K8M A;  3A5Z B;  2JK8 A;  4A3B G;  4X6A H;  1PZJ D;  1EQR A;  4HR7 B;  2B63 G;  4JBK A;  1K0R A;  4GOP B;  4X62 L;  1O7Y A;  1NR2 A;  3IRB A;  1B4O A;  1X9N A;  4JI7 Q;  2D9U A;  5I2Y A;  5C4J H;  4XXE A;  2CH4 A;  3M85 A;  4GNX B;  4DV6 L;  2WB1 E;  3G7L A;  1JT8 A;  1ZEQ X;  3KK7 A;  2RSN A;  3NWS A;  1HFN A;  3UDF A;  1VQC A;  3H3V C;  3S1Q B;  4ZQ3 A;  2YU9 B;  1XNR Q;  2J0T D;  3CC4 A;  5C0X H;  1XTD A;  2L0C A;  2CVR A;  2F0N A;  3BZC A;  1LTA D;  3H3V H;  4A76 A;  4JBW A;  3I4M G;  1H9S B;  2VUM G;  3RUZ A;  4HCE A;  4M1U B;  4KHP Q;  3QO2 A;  4MN3 A;  4R8I A;  4DV4 L;  2NB0 A;  4BBR B;  1I4P A;  3J7Y W;  3FRP B;  4BBS B;  1YHA A;  5IT9 c;  5GAE C;  5FLX c;  2F0V A;  4AQY L;  3T56 B;  4CJ2 C;  3I91 A;  5EQ0 A;  1XMO L;  5I2X A;  4A3K H;  3BVZ A;  2E8G A;  4MIU A;  3H91 A;  4F88 A;  3GTL B;  1HNW Q;  2SEB D;  2UXC Q;  1LT6 D;  3NSW A;  1GUT A;  1ZXT A;  4LFB Q;  4LFA L;  1C48 A;  4F7X A;  4OON A;  3NHH A;  1Z7T A;  3K7A B;  3LNN A;  3CP0 A;  2MO1 A;  4PNY A;  3HRZ C;  1HPC A;  5DAU A;  2A69 C;  1BF4 A;  3S24 A;  3BS1 A;  2F0K A;  2PZT A;  1D6E C;  3HOZ G;  3I4L A;  1Z9F A;  1SJE D;  4OXP A;  3BZK A;  3GTG H;  4RKB A;  2I0Q A;  1Y8O B;  1X54 A;  4LF8 Q;  2ZXR A;  4A3I G;  2A68 C;  3OTO Q;  1F2Z A;  3PUX A;  1NCV A;  3TS2 A;  4JI4 L;  3OMC A;  4UP9 A;  4UP7 A;  3ERQ A;  1BCP F;  3FVQ A;  5DLQ E;  3CCL A;  4A3K B;  2HHH Q;  1RF2 D;  4AIM A;  3M4O B;  3GTP H;  2X6G A;  2D5D A;  1EEF D;  1ROD A;  2NTS A;  4DV3 L;  3J80 c;  4IPG A;  2X6L A;  5M5X H;  3AFP A;  5GQO A;  4JV5 L;  1JB3 A;  1CA5 A;  1KRS A;  2DNE A;  1HNZ L;  4RA8 A;  3DWA A;  4GKK Q;  1AW7 A;  1PH3 A;  3KOJ A;  2FXQ A;  3E9H A;  3DEO A;  1S72 A;  2A19 A;  4B08 A;  4PZ6 A;  3AYH B;  1H9M A;  1I6V C;  1A3U A;  3P1H A;  3GD7 A;  4FF4 A;  4WFN 3;  1PH1 A;  1CM9 A;  1L1O B;  1LAB A;  3GTJ B;  1RJT A;  1STH A;  3HKZ G;  3UDG A;  4J8Q A;  4RAU C;  2N8N A;  1HXY D;  1V43 A;  4KD3 A;  2K5H A;  1FVI A;  4P73 A;  4GZY C;  1N33 Q;  1E2W A;  1QG7 A;  2V1C C;  1FNW A;  2PI2 A;  1HNX Q;  3GTK B;  5JOB A;  5H1S E;  1A6X A;  5IOC A;  1EFI D;  1X3G A;  3GTP B;  4QUF A;  2B63 H;  2IHE A;  1PRT F;  5DNF A;  1VQK A;  4L5T A;  2VXW A;  4OWW B;  1TXY A;  4OO1 I;  2SNS A;  2XRQ D;  3K6O A;  1YHB A;  1QZH A;  1Y69 U;  2D0O A;  2EJM A;  1YJ9 A;  1WTV A;  4YY3 L;  4L5Q A;  3KFU A;  3EN2 A;  3J81 E;  1IHZ A;  3N52 A;  1TWA H;  1KD1 C;  2F0F A;  4K8J A;  3S15 H;  3H0G H;  1JIC A;  3DM3 A;  5DM6 3;  1TS4 A;  2EY5 A;  2K05 A;  4LF7 Q;  4JVZ A;  5JEA G;  3BU2 A;  2Q2U A;  5J1Z A;  3SK6 A;  1TWF H;  3NK9 A;  3QOL A;  2KA7 A;  1SSO A;  4IUQ A;  4DUZ L;  3U58 A;  5L37 A;  2VUM H;  3NWT A;  3E6Z X;  3MEH A;  2IWH A;  3HOU G;  1LT4 D;  1HH2 P;  3KF8 B;  4NDX A;  4RG1 A;  4ZKC B;  4LF6 Q;  1B8A A;  4X65 L;  4A3B B;  2QDL A;  3FEW X;  4R8N A;  5C5M A;  4CGY B;  3J7A V;  3M7N A;  3I56 A;  2B63 B;  1HR0 L;  3JC6 6;  4Q5V A;  1LTR D;  4DNI A;  2F4V L;  3VDY A;  4R9W A;  1KC8 C;  2J7Z A;  2KJX A;  5M5W H;  5IP9 H;  1BBU A;  1II3 A;  2NWG A;  4K5X A;  2F0O A;  1EFW A;  1YNN C;  5M9O A;  5HGT A;  1IBM Q;  2HUG A;  1TWA B;  1PDQ A;  1HZC A;  3S15 B;  2N88 A;  1SN8 A;  3S14 H;  3H09 A;  2E5L L;  1HUM A;  1C9O A;  4LJZ C;  1EU4 A;  1TVX A;  1S40 A;  4A3C G;  3ULL A;  1GJX A;  1TWF B;  2RDH A;  3V96 A;  4K0K L;  1YNJ D;  3HOZ H;  1MSH A;  4R4C A;  1JB7 A;  3I4M B;  2Z4H A;  2VUM B;  2KVM A;  4LUO A;  1IKM A;  2LFN A;  3GP7 A;  5AJ3 L;  1STN A;  1WCM H;  5EBC A;  5FK9 C;  3CCS A;  1EWH A;  4HIK A;  3TP5 A;  4ZYS A;  1J8I A;  3J81 L;  3KDF A;  3J80 i;  1I50 B;  4GKJ Q;  1FGB D;  1S5B D;  5D14 A;  5J3B A;  2JP1 A;  1B9N A;  1BCP C;  4HED A;  2N3S A;  1M4V A;  4O0A A;  5KYI A;  3JAM c;  3S2D H;  4K2K A;  1CK1 A;  2EVB A;  3DUZ A;  1D5M C;  2XWJ B;  2ZTE A;  5EKI A;  3T51 B;  4A3M G;  1XXG A;  2F0E A;  1HCZ A;  1V8Q A;  1PXU A;  1P8L A;  4CKE A;  1WTQ A;  1RCV D;  2R7F A;  2WKC A;  1MJC A;  4JI5 Q;  3D6C A;  4LF5 L;  2HD3 A;  4QF4 A;  1X3F A;  3HOZ B;  1B1Z A;  3TRE A;  2K04 A;  2AQ2 B;  1AEX A;  3S1N H;  1UWV A;  1MJE A;  2K5D A;  1ENC A;  3ITP A;  4TSS A;  2EZV A;  1A2T A;  4A3I B;  1VQM A;  1SYC A;  1GM5 A;  1LUZ A;  4DK6 C;  3S9W A;  2I46 A;  5LMN W;  3MVV A;  5IWA Q;  4JI8 L;  3PQI A;  4ZUI A;  1S5D D;  2BCO A;  1YEZ A;  1SAP A;  3KDF B;  3C46 A;  2Y0S E;  1LAC A;  5JJL A;  5EKK A;  1JWM D;  1EY0 A;  2I5H A;  2VS1 A;  3BDO A;  3S2D B;  4QQB X;  5IYD G;  1S5F D;  5HGQ A;  3RMH A;  4DV1 L;  1CKN A;  1BCP B;  3I4O A;  2CCZ A;  2F0U A;  1PRT C;  1HZB A;  2EOT A;  2EXD A;  4LAA A;  2EDG A;  4DA2 A;  1B2T A;  1F2Y A;  1PFB A;  4X3T A;  4K6L A;  3CC7 A;  1JQY D;  4IAL A;  4UDU C;  3VYT A;  4WJ3 M;  2AWN A;  1O78 A;  2A6E C;  4DR2 L;  3KLR A;  3G6J B;  3G4S A;  4RFB A;  1VQ4 A;  1G29 1;  1NAP A;  5JEA H;  5C4Z A;  5JPM C;  2I5M X;  1EIF A;  3ND8 A;  3HKZ B;  1SE3 A;  3HOU H;  5EAY A;  4JI6 L;  2K33 A;  1KQS A;  3HOV G;  2KQ3 A;  4S3S A;  2WAQ E;  1I4Q A;  4KKT A;  4DV7 L;  1VQB A;  5J22 A;  1YNN D;  3RLN A;  4U67 3;  3T4A C;  4G7Z C;  2JA5 H;  3UE0 A;  4DXF A;  1HA6 A;  5CV8 A;  1QVC A;  5M3M G;  1B3Q A;  2B8F A;  2NN6 G;  1E0B A;  1KAW A;  4JI7 L;  1JJC B;  2B2V C;  4XYQ A;  3TZU A;  1ICF B;  3CU7 A;  3Q6S A;  3VYR A;  2B2V A;  3CCR A;  1PRT B;  5C5L A;  3VA5 A;  3KYH C;  1CT1 D;  1BOS A;  2K5Q A;  2DY8 A;  2KCC A;  1K9M C;  4OL7 A;  1XNR L;  2DY7 A;  4G4K A;  2K52 A;  4ALP A;  4ZLT F;  1I4G A;  1LTS D;  3K5L A;  1IYU A;  2MHV A;  2FJ2 A;  1TWH H;  1SNC A;  1BXT A;  1FYC A;  1EYD A;  2XWB B;  4L6T B;  1JJG A;  1OXT A;  3HOU B;  3TDQ A;  1EY8 A;  1BCP D;  2Q8T A;  3A8J E;  3ER0 A;  2E2D C;  2Z6K C;  5E4W C;  3EQL C;  5IGD A;  4KHP L;  2BDO A;  4H02 A;  4XT1 B;  5FJ8 G;  1HA5 A;  2Z6K A;  1AP0 A;  2RA4 A;  2PQE A;  2UXB L;  3AB9 A;  5KNC A;  1WTX A;  2QIL A;  3CD6 A;  1U4R A;  1M1K C;  4X64 Q;  4A93 G;  4IFD G;  2JA6 G;  4LF9 Q;  1D2B A;  1FL0 A;  2BE5 C;  3MTS A;  1BBW A;  5JJZ A;  2ZM6 Q;  2K5W A;  3IFT A;  3RD4 A;  2R93 H;  4RMF A;  1HNW L;  2KHS A;  5C44 H;  3I55 A;  3ZYY X;  2Q8R E;  4MTK A;  4NKL A;  2CFM A;  4P75 A;  5C3X A;  4LFB L;  3CXC A;  1U0L A;  3PO2 B;  4JW0 A;  4JI1 Q;  4A3M H;  3VR6 A;  1P16 A;  2EYJ A;  3KBX A;  1ENF A;  4ODG A;  3LWE A;  1JOR A;  1X3P A;  5ELC A;  2JA7 G;  1DYQ A;  2F3V A;  3S17 H;  3QOJ A;  1Q1B A;  1J9O A;  2CW0 D;  4XT3 B;  1YI2 A;  1TWH B;  4TKO B;  2RDG A;  5GRO A;  1HQM C;  1L0X B;  3GV3 A;  4K5V A;  4X66 Q;  1QJO A;  5C0X G;  3K57 A;  1Q81 C;  4LF8 L;  3IKJ A;  3OTO L;  1PRT D;  2H5X A;  1A8V A;  2JYO A;  3M4P A;  3OSO A;  4C1N I;  3FP9 A;  1EEI D;  1HFG A;  2IPK D;  4YIJ A;  2HHH L;  2A6E D;  5C3E B;  1SYD A;  1VQD A;  1EIH A;  2EE1 A;  3K0X A;  1A63 A;  3L9A X;  3PUV A;  2QEJ C;  2Z0S A;  4A3M B;  1KLU D;  2HQE A;  4DV5 Q;  3WDN A;  2Q8I B;  2OF1 A;  3CCJ A;  1JOO A;  3A54 A;  4GKK L;  1CQF A;  3D31 A;  2Z8L A;  3K5O A;  4LK1 C;  1HQR D;  1Q46 A;  3SEB A;  2Q2I A;  2PO4 A;  3S17 B;  3C1E A;  2F0W A;  1EY4 A;  1YIT A;  2R92 G;  1SNQ A;  3RN5 A;  2FIN B;  5M3F H;  3W1B A;  2NVT H;  4UP8 A;  1OXS C;  4HCS A;  1E2Z A;  1NJI C;  2CKZ B;  1EQV A;  1E1T A;  1T9H A;  2D2C C;  3NQI A;  4KY6 A;  3OW2 A;  2JA8 H;  2BH2 A;  3CPF A;  4L5S A;  3HOV H;  4A3L G;  1K3B C;  2A1A A;  4LF4 Q;  3RNU A;  4JK1 C;  5ISR A;  1EY6 A;  3NEM A;  4B3S L;  4KHZ A;  1QNU A;  1N33 L;  3J81 j;  1HNX L;  1D8L A;  4A3F H;  3MA2 B;  4DR6 L;  3SDZ A;  2LKV A;  3SVM A;  2AHO B;  4C2M H;  2EYH A;  4JI0 Q;  2WAC A;  2VNU D;  2V4D A;  5G3L F;  5IY0 A;  1IKL A;  2R7D A;  5JJI A;  5TSS A;  2NN6 H;  3K5N A;  4HMJ A;  4PQX A;  4C3I G;  3F8T A;  5KGU A;  1D1K A;  4N8F A;  3S14 B;  4X3K A;  5C6A A;  4Y7N B;  2RDF A;  1Q8K A;  5IOD A;  4FYD A;  2KCN A;  4OWX B;  1WD0 A;  2HIX A;  2DGY A;  4XQQ A;  5C4X H;  2F0J A;  3V05 A;  3RR5 A;  2NVT B;  1I6H H;  5ELD A;  4CJ0 B;  5LMN L;  5IT9 E;  3Q24 A;  3EVQ A;  3HOV B;  3SGI A;  2PQA B;  5FJ8 H;  4FF1 A;  3VR3 A;  4FP5 D;  3PIO A;  1U4M A;  1G2S A;  4LF6 L;  1TQO A;  3IAY A;  4QIW E;  4HJ5 A;  4A93 H;  1RTN A;  4YWL A;  2HCC A;  1NBW A;  2KHJ A;  2MPM A;  1EY9 A;  1W6J A;  3IFD A;  5M3M B;  3TS0 A;  4J1M A;  2EPB A;  3CC2 A;  5BR8 Q;  4B3M L;  4KJO A;  5CV7 A;  4EVO A;  1XJV A;  4PZ8 A;  1A15 A;  3CF5 A;  3CAM A;  3NEN A;  1S5E D;  4TVA B;  3UE1 A;  1X55 A;  1X56 A;  1IBM L;  5D3D A;  2SOB A;  2JA7 H;  1KHI A;  4ZAI A;  1EZ8 A;  4KHV A;  4I7Z C;  3UDX A;  4I65 A;  4RGT A;  5J39 A;  4RHS A;  2BOS A;  3HS0 C;  2WII B;  4OX9 L;  3HOW H;  1QE6 A;  4R4Q A;  3MXG A;  4APV A;  5KYL A;  4O2D A;  2R7Z G;  1YBY A;  2L11 A;  2MNA A;  3S1R B;  3WOF A;  1K8G A;  1OXU A;  3H0G G;  5IGB A;  2M9V A;  1XPR A;  1TII D;  5M5Y H;  2F0P A;  3HOX H;  3QR8 A;  4A93 B;  3A56 A;  3TRZ A;  2JA6 B;  2JE6 I;  4GKJ L;  3P75 A;  1NUC A;  3FPP A;  4KTA A;  1UAP A;  4NPS A;  3G48 A;  3L2P A;  4R4I A;  2K01 A;  2IHF A;  2UU9 Q;  4RGN A;  3EIV A;  2JA7 B;  5C4J B;  1J6Q A;  4OIJ A;  3T1H Q;  1M8A A;  1ASY A;  5IP9 G;  4JI5 L;  1ONL A;  3OOC A;  3R8B A;  1TWC H;  3KF6 A;  2XTI A;  5ELN A;  2R92 H;  1MGS A;  2NZH A;  1OTC A;  3OW7 A;  4KJN A;  2K50 A;  4GN5 A;  2EY2 A;  4HAE A;  1E24 A;  4IUV A;  2MO0 A;  2VY3 A;  5I6Y A;  5M5Y B;  2N78 A;  1G2T A;  1Y1V H;  4A3L H;  1I94 L;  2BDN A;  5IWA L;  3PUY A;  1WCM G;  1PFM A;  1PMR A;  1NMG A;  3RZO H;  1F77 A;  2SNM A;  4KMU C;  1PYW D;  2L15 A;  4OIK A;  1I4R A;  2O5I C;  1LM0 A;  4NB3 A;  3KLW A;  1BO0 A;  4C3I H;  1VQ5 A;  1RL2 A;  3KUP A;  4L8J A;  5DEH A;  3NTI A;  1J5E Q;  3NEL A;  3I4N G;  1PYS B;  1IW7 C;  5C3W A;  4XYO A;  1SR3 A;  5BN3 A;  5CGK A;  1IBL Q;  4G7H C;  1TWC B;  1HZ9 A;  2R92 B;  2FMC A;  2RCN A;  3NTK A;  3S16 H;  2F0S A;  3CCV A;  3OMG A;  1B7Y B;  1SNO A;  1FNU A;  3W5O A;  3NXW A;  5JJK A;  1WTW A;  3R2T A;  2EYO A;  1PH7 A;  2LY7 A;  5EGT A;  2RQX A;  1LT3 D;  2M00 A;  3BJU A;  3K0Y A;  4HID A;  3GTG B;  2L9H A;  4LFC Q;  3U4Z A;  4BY7 G;  1NNX A;  1LYL A;  3WOE A;  3EFX D;  1G6Z A;  4BA2 I;  4PV1 C;  1AFP A;  4EQO A;  1EQT A;  2ICI A;  4C3I B;  1TU2 B;  4FF2 A;  2GN5 A;  2Y0S G;  1W2B A;  2OTL A;  2VZA A;  1K8O A;  3GTQ H;  3DEP A;  3W3A A;  4YHH Q;  2EQS A;  3DXJ C;  4GN3 B;  1NMF A;  3RN2 A;  1KXL A;  2MFI A;  3NP8 A;  5M5X B;  1DOK A;  4DR5 L;  2IY5 B;  1MSG A;  1ESR A;  5IYB H;  4B9X A;  1Y14 B;  4NXM L;  3ONA B;  3S16 B;  2PW7 A;  2K03 A;  1X6O A;  3QG1 A;  2G5D A;  4FXD A;  3TP6 A;  4WRD A;  1VQN A;  3K5M A;  3MWY W;  2R7Z H;  1VF7 A;  1EU3 A;  1LTL A;  1B9M A;  3ZJY C;  3PO3 H;  2VB3 X;  1ILP A;  4KI0 A;  4CDC C;  1UE6 A;  1KAB A;  2F0L A;  2NBF A;  3F1Z A;  3R93 A;  5EPJ A;  2KEE A;  1CKO A;  4KN7 C;  2D62 A;  2OQ0 A;  1BDO A;  1SE4 A;  4MNO A;  4ME5 A;  4X64 L;  1UE1 A;  1I3Q H;  2O2L D;  3BYY B;  2QGQ A;  2ZM6 L;  4IPD A;  2N55 A;  1EY7 A;  3TSS A;  2EXZ A;  2QF7 A;  2XRS D;  1ZKO A;  2JA5 G;  2H1E A;  1JE4 A;  2R3Z A;  5KEE A;  4LW1 A;  5FOB B;  4JI1 L;  4GLX A;  2YTY A;  5E4X A;  3AFQ A;  2KEN A;  2A69 D;  1SE2 A;  4B3R Q;  2NUC A;  4FXG C;  1EYC A;  3PF5 A;  1BQQ T;  1ET9 A;  2QKI C;  1JOQ A;  2BH8 A;  2R7Z B;  5A35 A;  1F9Q A;  4X3S A;  3H0G B;  1E2V A;  1UEA B;  1ICW A;  1A62 A;  2A68 D;  2ZTD A;  1DOL A;  1H9K A;  2QA4 A;  3GTO H;  1IYJ B;  1G51 A;  4FNF A;  4DUY L;  1GUS A;  4X66 L;  2B2W C;  5T1I A;  1CSQ A;  4A3E H;  1WJJ A;  2B2W A;  2WP8 J;  5G3L D;  3O13 A;  3AEV A;  1IW7 D;  4EQ5 A;  1VQL A;  2VQE L;  1MD2 D;  1WYD A;  2M2L A;  1IL8 A;  1GHJ A;  5D65 A;  1TS3 A;  5A2Q E;  1EZ6 A;  4RGO S;  2F52 A;  2KCM A;  4DV6 Q;  4HN7 A;  3K59 A;  4DFA A;  4JI3 Q;  1X3E A;  1WTR A;  2PMZ E;  3I4N H;  4IJL A;  4RWS C;  1D5X C;  2O4X A;  2JEB I;  2R93 G;  1LT5 D;  2B2U C;  5M5W B;  1S5C D;  3L3O C;  4K6D A;  2UUA Q;  2B2U A;  3DWP A;  3J81 c;  5C44 G;  5JAV A;  5IGE A;  1SNP A;  1Q82 C;  4C3J G;  3AQQ A;  1CKM A;  2A6H C;  3PUZ A;  3GTM H;  2OWO A;  3H15 A;  4ZK9 B;  2NZ1 D;  4QB4 A;  1VQ9 A;  5LL6 S;  4DV4 Q;  4X3U A;  3GTO B;  3HOY H;  2C5C A;  4M8A A;  2F0D A;  4KLK A;  3CCQ A;  2XNA C;  4AQY Q;  4RH6 A;  1N9W A;  1WCM B;  1XYI A;  1VMP A;  4BY7 H;  5AFW A;  4LF4 L;  3T13 A;  1B44 D;  4KY5 A;  3TP7 A;  4CBV A;  1EWC A;  1HZA A;  2JA9 A;  3STB C;  5K5P A;  2ZTC A;  3BVG A;  3D4R A;  4R4O A;  4LFA Q;  5GAD C;  4JI0 L;  1PH5 A;  2WKD A;  3TP8 A;  3K7U C;  1UUP A;  1PTO F;  1DJR D;  3I4N B;  1SBB B;  3CQZ H;  1EOT A;  2PZU A;  4IPH A;  2LSS A;  2E2H H;  1PFN A;  2EYP A;  1SJH D;  1ZYR C;  1CUK A;  5F2D A;  4DV2 Q;  4DAM A;  3DLL A;  4IFD J;  2QEX A;  1XPO A;  1WTH A;  2NN6 I;  1YJN A;  1EOV A;  2UUC Q;  3ND9 A;  3F2D A;  3OHX C;  2D0P A;  5A2Q L;  3N6R A;  4P72 A;  3OYY A;  5FKA C;  2L55 A;  1WI5 A;  1OO9 B;  2AUJ D;  5I9P A;  3OIP A;  3S1N B;  1T5X D;  3VA7 A;  2WFW A;  2E2I H;  3BG3 A;  4IJH A;  1B70 B;  1QOH A;  2IJ0 A;  1FJG Q;  2AMC B;  1AE2 A;  4BA1 I;  3LGJ A;  3CPW A;  5M3F G;  1PZK D;  4N9T A;  4AYB G;  5I4D A;  1Q90 A;  1K0S A;  2K1B A;  3NE5 B;  1U4P A;  1PH8 A;  2JA8 G;  1KRT A;  2O5J C;  1LTT D;  3NQT A;  3CRK C;  1YVC A;  3AMU A;  1HNZ Q;  2C35 B;  1R4P B;  3CCE A;  2Y0S B;  3CQZ B;  5HUR A;  2ZXO A;  3DHQ A;  5C0X J;  4C56 C;  4A3F G;  1AN8 A;  4DK0 A;  2E2H B;  2R6G A;  1Z6H A;  4XDX A;  4IFD I;  5IGG A;  1GUO A;  5BN5 A;  5ELB A;  1JOK A;  1Q1E A;  2RCF A;  1TKW B;  3RLO A;  2FHT A;  2XGT A;  4HJA A;  1CKN B;  1JE5 A;  1O7L A;  1R9T H;  5E3F A;  4FF3 A;  4AH6 A;  2E2J H;  2XSC A;  5LMU Q;  3OWF A;  4K8I A;  2AWO A;  1ILQ A;  3SK5 A;  1PFS A;  2F0Q A;  2OEO A;  1JC7 A;  2E2I B;  2RF4 A;  2Z9H A;  1LTB D;  4QUC A;  1HTP A;  2F4I A;  5C4X G;  4POF A;  1K83 H;  4DF7 A;  4DR4 Q;  4DKA C;  1T5E A;  3I73 A;  4WOR A;  3I72 A;  1GUG A;  4IOA A;  4L5R C;  1YZ6 A;  2FFK B;  3URY A;  1G8Z D;  1W3S A;  5C0X I;  1Q86 C;  3JAM i;  1BKB A;  4OEM B;  4CDD C;  4Y52 H;  3J81 i;  3H3V I;  2JA5 B;  2A6H D;  2BA0 A;  1BVS A;  1DZ1 A;  4HTH A;  1SYB A;  3SXH A;  5KIX A;  4IQZ A;  1XPU A;  4F87 A;  4A3G H;  1L2F A;  2AUK A;  2UXC L;  4CJ1 B;  3T1H L;  1R9T B;  4HJ9 A;  4C3J H;  4DNT B;  3C1F A;  2E2J B;  1SYF A;  4L63 B;  1A3V A;  3ICE A;  4CDF C;  3I3C A;  1BUV T;  4A3J H;  2DUD A;  3HKS A;  5CBE E;  2HCI A;  3STB D;  4IPC A;  2RBM A;  5LHY 1;  1FR3 A;  3FKI G;  3RLF A;  3HOW G;  2WB1 G;  1K83 B;  1TY2 A;  1PYB A;  2CH4 W;  4H0L C;  1WFQ A;  1DON A;  1WOC A;  2LXK A;  4UY8 C;  1HR0 Q;  1GXD C;  5CR3 A;  3UI2 A;  1STY A;  3D0F A;  1ZYR D;  2K32 A;  2VW9 A;  3HOX G;  1YHQ A;  1SMY C;  1N34 Q;  3KLS X;  2IX3 A;  1FNV A;  2XIW A;  4JC0 A;  4ZCK A;  3SHL A;  4IUR A;  3T53 B;  4ZUJ A;  5E7N A;  1PTO C;  2R93 B;  1J5E L;  3I2Z A;  1STE A;  2F0H A;  5C44 B;  1RTO A;  3H94 A;  4XQN A;  1PTO H;  1IBL L;  1Y8P B;  3MHB A;  3X3M A;  3J7Z C;  5AJ3 Q;  1G6P A;  5JVG 3;  5IP7 G;  3OWE B;  2ASB A;  1SMX A;  5LL6 X;  4JYA Q;  1PLF A;  1I4H A;  4O42 A;  1N36 Q;  4DR1 Q;  1WTO A;  3KBG A;  4IN3 A;  4DAY A;  3TQY A;  4HMI A;  1FGU A;  1X3Q A;  4LFC L;  5FO9 B;  4FO2 A;  4YCW A;  1KL9 A;  4K5W A;  4ZKB B;  2JEA I;  1E1O A;  1H9J A;  2JQO A;  1YJW A;  1Y1V G;  4P2C B;  1E7Z A;  5IIF A;  1STB A;  2I07 B;  3QB3 A;  4KKU A;  4PZ7 A;  1DD2 A;  2KHI A;  1QCB D;  1V1P A;  5IGC A;  2B2Y C;  2MUY A;  2Z6B A;  4UPA A;  1SRU A;  4DXG A;  2B2Y A;  1CTM A;  2JN4 A;  4IUT A;  1KTK A;  3EBE A;  4ILW A;  1PTO B;  1SYG A;  3SK8 A;  1JCK B;  1BR9 A;  4QJF A;  4GLV B;  3NUC A;  2AQ3 B;  3A8K E;  4R4T A;  2IT1 A;  1L0Y B;  2ICE C;  4DNR B;  5EPL A;  4DR3 Q;  2IL8 A;  4LF7 L;  5M3F B;  5K36 H;  3R3O A;  4DAY B;  4AYB B;  1QIL A;  2BE5 D;  1H95 A;  5BN4 A;  2DN8 A;  5FLX E;  4OEL B;  4R1J A;  2JA8 B;  1DCZ A;  1XTC D;  4NXN Q;  5EPK A;  2N49 A;  1MIU A;  2B2T A;  1K73 C;  4J15 A;  4A3F B;  3ERS X;  1Q7Y C;  1F9P A;  3HGB A;  2KEC A;  4C2M B;  1SRO A;  1U4L A;  1V1P B;  3BYT B;  3A0J A;  4EX5 A;  3W1G A;  2YU9 H;  5KND A;  1EQQ A;  3GO5 A;  1PH4 A;  3HFZ B;  3V2T A;  5JVH 3;  2E75 C;  4DPG A;  2HT1 A;  3CMA A;  2ZT9 C;  5COR A;  5DM7 3;  4H7B A;  2XN9 C;  2NTT A;  3HG9 A;  4EQN A;  5IYB G;  1JMC A;  1PZI D;  5EKL A;  1ENA A;  5C4X B;  1PVO A;  4P74 A;  1SMY D;  4BBR H;  4IZ8 A;  2KCT A;  3FKI H;  3CME A;  3GDE A;  1I6H B;  1S3O A;  3PO3 G;  1F2L A;  1M90 C;  1PTO D;  2YTX A;  3GTL H;  3KJO A;  1GOZ A;  1KNA A;  3MFG A;  1F2M A;  4DGZ A;  4QIW B;  5CMD A;  1I4X A;  2NVX H;  3OPO A;  3J80 E;  4WJ4 A;  4JI3 L;  4N8X 1;  1QVG A;  2EJF C;  4HJ7 A;  4KN4 C;  4ZRZ A;  3K7A H;  1Y1W G;  4QMG A;  4OHJ A;  5IT9 L;  5FLX L;  2UUA L;  1L0W A;  2HDM A;  2TSS A;  2DJF C;  3HZX A;  3CRL C;  1VQ7 A;  5CBA E;  5IYC G;  5KNB A;  1VS0 A;  5IP7 H;  5CC4 A;  1K3R A;  3FKI B;  1Q3L A;  4A4I A;  3HOW B;  2UXB Q;  2WB1 B;  2MJ8 A;  3FMC A;  1HJP A;  2JSO A;  5FLM G;  1PHJ A;  1PV4 A;  2F0M A;  3DWQ A;  3FDT A;  3BDL A;  3U9O A;  2ZJQ A;  2OT2 A;  4DK1 A;  3PUW A;  3HOX B;  2QW7 A;  3M4O H;  2UUB Q;  2R61 A;  1O7Z A;  2F3I A;  3ULP A;  4A3E G;  1E22 A;  2NVX B;  1NY4 A;  5IE8 A;  1NR4 A;  3SR1 A;  5JEA J;  1GUW A;  1GHK A;  3K58 A;  3K80 C;  1L1O C;  4P71 A;  1TS2 A;  1CZG A;  1L1O A;  2CQO A;  4QGU A;  4DV2 L;  2EYF A;  4HIM A;  3GTJ H;  3E9I A;  2Q2H A;  3T1Y Q;  2UUC L;  4XTC S;  4RHR A;  3Q8D A;  4PMB A;  4ABN A;  2PPB C;  2G9D A;  3J80 L;  3P20 A;  4PMW A;  3U50 C;  4BY1 G;  1DOM A;  4BS9 A;  1YNJ C;  1V9P A;  1U5K A;  4JCV E;  3KF6 B;  4C3H G;  2UXD Q;  2P5Z X;  3RZD H;  1FJG L;  2IX1 A;  1STA A;  3GTK H;  3HOY G;  4HJ8 A;  3L7Z C;  2EJG C;  3FPU B;  1Y1V B;  1EYG A;  1H9R A;  2ZXP A;  3C3L A;  1XNQ Q;  1XMQ Q;  5FO7 B;  1C7Y A;  4K14 A;  1LTI D;  3PIO 3;  2B39 A;  2NZO A;  2Z4I A;  1G91 A;  5T1G A;  3D4W A;  3EJI A;  3RZO B;  2KUM A;  1SDF A;  3OIQ A;  2F1M A;  3X3N A;  2E74 C;  2RSO A;  4DAV A;  1GUN A;  3CW2 C;  1VQJ A;  2ZJR A;  4NW2 A;  1AZP A;  1SNM A;  5EBD A;  3TZD A;  1SE8 A;  2HDL A;  1UNS A;  3HP3 A;  5CV4 A;  2VQF Q;  3KF8 A;  5LMU L;  4MTN A;  4H13 C;  1IZ6 A;  3U4V A;  3NBI A;  3VYU A;  1BBX C;  2PNH A;  3NTH A;  4B3S Q;  1A3T A;  3MC0 B;  3RZD B;  4CKB A;  4FXK C;  4F8M A;  3H6M A;  3PMF A;  4A3B H;  4DR6 Q;  1RKN A;  4DR4 L;  2PI2 E;  3I70 A;  1RIP A;  4B3T Q;  1A2U A;  5COY A;  1CHP D;  1MBY A;  3G6E A;  1QVF A;  1UE7 A;  2WV6 D;  3JAM E;  1F9R A;  1N32 Q;  2E76 C;  1NSN S;  2PYK A;  4LF9 L;  1JWS D;  3NPP A;  4XIG S;  1Y1W H;  2GVB A;  2WAQ G;  3F2C A;  3GTQ B;  4WJW A;  4JBJ A;  4DV0 Q;  1D1I A;  5IYC H;  4V0B A;  1VQ6 A;  5LMN Q;  2C9O A;  3I4M H;  1GKH A;  3TME A;  2AKW B;  4UHV A;  5I9O A;  4KKS A;  4DR7 Q;  4LWC A;  4PG3 A;  5ELE A;  3M9B A;  5FLM H;  2JXM B;  3K8A A;  1XWE A;  1AH9 A;  1IL2 A;  1IBK Q;  3PO3 B;  1I50 H;  1V1Q A;  1EIG A;  1CZW A;  5GAH C;  4GS3 A;  1MHW C;  1KLG D;  1VQP A;  4B3M Q;  4OO1 G;  1EWI A;  2VL6 A;  2B8G A;  4JI2 Q;  4A3D G;  1EUJ A;  1C4Q A;  2LXJ A;  1N34 L;  4GLA C;  1OXX K;  3IL8 A;  2SDF A;  3EA6 A;  4X62 Q;  1I3Q B;  3E0E A;  2NVY H;  1N8R C;  3PO2 G;  2CQA A;  1Y1W B;  1KDC A;  2PW5 A;  1PH9 A;  4EQP A;  4OX9 Q;  1VF5 C;  1X65 A;  3W2D A;  2OTJ A;  4HIO A;  2KOL A;  3QIA A;  1W6K A;  3LWU A;  2GVA A;  4DV5 L;  4XQJ A;  3GV6 A;  4IOC A;  4YWK A;  3S1M H;  4A3G G;  3JAM L;  2IW3 A;  4HSV A;  4A3I H;  1ET6 A;  1GVP A;  3A74 A;  4IO9 A;  4BY1 H;  4TRD A;  4JYA L;  1N36 L;  2RVL A;  1QUQ A;  4C3H H;  3BDC A;  1KDB A;  3I8Z A;  4DR1 L;  2K14 A;  4NMZ A;  5KRU A;  4A3J G;  1AZQ A;  3I90 A;  5IGF A;  2B3G A;  2ZJP A;  2EIF A;  3QJY A;  4JG2 A;  1EY5 A;  2YTV A;  4E6I A;  3SK4 A;  4A3E B;  5NUC A;  1DGS A;  3M4Y A;  5C3E G;  3LX0 A;  1I5F A;  1F9S A;  1XMO Q;  4KD4 A;  1VQ8 A;  2NVY B;  4GN4 B;  2HIV A;  1BNZ A;  2LS0 1;  2MGS A;  4RKL A;  1GO3 E;  1D7Q A;  3FHW A;  4G57 A;  4IUP A;  3PCO B;  4Z9C B;  1ASZ A;  2PMZ B;  3BZD B;  5CYU A;  2B29 A;  3TN2 A;  2QCP X;  3TEH B;  3D4D A;  2F03 A;  3S1M B;  1DXM A;  3HKZ E;  1LV9 A;  1OXV A;  4RCO A;  1RDP D;  4BY1 B;  3DM1 A;  4J6H A;  1D5Z C;  1I94 Q;  3GTM B;  2A74 C;  1SFO H;  4C3H B;  1NE3 A;  1U9R A;  2CW0 C;  2ENB A;  5CV9 A;  4DR3 L;  4PMC A;  1IXR A;  5FO8 B;  4QL5 A;  1QUQ B;  3F2B A;  3HOY B;  1VQG A;  3CCU A;  3M7G A;  2EYM A;  4UAI A;  2MQH A;  4JI4 Q;  1YNX A;  4BY7 B;  2CWA A;  4JBM A;  4NXN L;  1ML0 D;  3M3Y H;  4O1N A;  4EGV A;  4OWT B;  2GA4 B;  2QDB A;  2K75 A;  4DV3 Q;  3E3X A;  4H44 C;  4ULL A;  4JV5 Q;  4MZ9 A;  4I7A A;  4RGM A;  1WVL A;  3QWN A;  5BR8 L;  2F0T A;  1CA6 A;  2EYL A;  2YYZ A;  3D8G A;  1VCI A;  4QCL A;  4N9P A;  4KK7 A;  3L0O A;  2A5H A;  3A55 A;  2K5V A;  1KIX A;  3SE0 A;  1E3P A;  3MXN A;  1TS5 A;  1PH6 A;  1SFO B;  1SND A;  3KJP A;  5CV6 A;  4JOI C;  4RCN A;  2K28 A;  1SXT A;  1EYA A;  4BXX G;  4JOI A;  1R4Q B;  1JJ2 A;  3E5S A;  2MP1 A;  3E0J A;  4FDB A;  4Q0F A;  3BVM A;  3UDI A;  4OO1 H;  3NBH A;  2L12 A;  1WTP A;  1EIY B;  4A3D H;  4LUV A;  3M3Y B;  2K4K A;  5K36 G;  1CI3 M;  4POG A;  1CFM A;  1GD7 A;  2HQL A;  4NP5 A;  3VR4 A;  1Z47 A;  2DNC A;  3S2H H;  4DR5 Q;  1C8C A;  5E1F A;  3C2P A;  4C1N K;  3PO2 H;  1JWU D;  2L1B A;  2WAQ B;  3CHB D;  4LNQ A;  4NXM Q;  5D3I B;  4A3C H;  4YY3 Q;  4YCV A;  2FMM A;  1C0A A;  3A8I E;  1UE5 A;  3MFY A;  2UU9 L;  1O80 A;  2X69 A;  2CWP A;  1YIJ A;  5GAG C;  3HEJ A;  1AE3 A;  3MXN B;  4HSP A;  3PIP A;  4OGQ C;  4DUZ Q;  1EL0 A;  3DMU A;  1Q8I A;  4A75 A;  2IX0 A;  3R2I A;  4JPB W;  2OXP A;  1QZG A;  3TBI B;  4BWG B;  5ELF A;  4A3D B;  3VYS A;  4X65 Q;  4BBR G;  4CHT B;  1MI2 A;  1ESF A;  5C3E H;  2UUB L;  1DM0 B;  4BBS G;  3NBH B;  2NYZ D;  2EY1 A;  1IYV A;  1FD7 D;  3KLS A;  3S2H B;  3D3R A;  1HRJ A;  1Y8N B;  3G71 A;  2F4V Q;  1B3A A;  3MAQ A;  1TY0 A;  3GQB A;  4LUZ A;  1QB5 D;  1VDZ A;  3J7A F;  4KY7 A;  3VR2 A;  2H4O A;  3VR5 A;  5EJW A;  1SLJ A;  2E5L Q;  4B9W A;  4A3G B;  3T1Y L;  1TT2 A;  2TMP A;  4K0K Q;  1TWG H;  4DUY Q;  4C3J B;  2F0I A;  2RKS A;  3MXU A;  1Q12 A;  1SYE A;  4DU9 A;  4A3J B;  3Q22 A;  2UXD L;  1MKH A;  3MZ5 A;  2VQE Q;  3U9S A;  5ELO A;  3F2U A;  5IYD H;  2OQK A;  3M4Q A;  1XNQ L;  1VQF A;  1XMQ L;  2K7V A;  2WIN B;  4CDE C;  1CSP A;  1VQA A;  4A3K G;  2L4N A;  2Z1C A; 
#chains in the Genus database with same CATH homology
 4U68 A;  2PNR C;  1B50 A;  1SEB D;  4MHE A;  4KV6 A;  2BA1 A;  2J4X A;  3ERO A;  2KED A;  2L5T A;  5I6W A;  1TWG B;  4IUU A;  1KNE A;  4CKC A;  1B53 A;  1HTL D;  1LTG D;  4FVM A;  1S4Z A;  2EY6 A;  4K2L A;  2K6A A;  5CV5 A;  2VB2 X;  1HUN A;  2CHB D;  1X32 A;  3T16 A;  2F3W A;  2G9H D;  3PV0 A;  4ID6 A;  3MXP A;  2A73 B;  2XVS A;  1KAA A;  1QWY A;  3A7L A;  3A7A B;  1RHP A;  4DAP A;  1HHV A;  1LLR D;  1LO5 D;  2NVQ B;  2ID0 A;  2B2T C;  1CQV A;  4V19 0;  2AQ1 B;  1TR5 A;  4DN4 M;  1STG A;  1WD1 A;  1VMC A;  5JPN C;  4G7O C;  3P7J A;  1V1O A;  2LMC B;  2PCF B;  1JR0 D;  1KDA A;  1XX8 A;  4IUN A;  2PZW A;  3AU7 A;  3CKI B;  1H9S A;  3PIP 3;  4TQU S;  3Q0A A;  4IFD H;  1RD9 D;  5C4H A;  3D6W A;  1CHQ D;  1QNK A;  4LMQ D;  3Q23 A;  2F0G A;  1K8M A;  1PZJ D;  4HR7 B;  1O7Y A;  1NR2 A;  1B4O A;  2D9U A;  5I2Y A;  4XXE A;  3M85 A;  3G7L A;  1ZEQ X;  3KK7 A;  2RSN A;  3NWS A;  1HFN A;  3H3V C;  3S1Q B;  4ZQ3 A;  2YU9 B;  2J0T D;  5C0X H;  2L0C A;  2CVR A;  2F0N A;  1LTA D;  4JBW A;  1H9S B;  3RUZ A;  4HCE A;  4M1U B;  3QO2 A;  4MN3 A;  4R8I A;  2NB0 A;  4BBR B;  1I4P A;  3J7Y W;  3FRP B;  4BBS B;  2F0V A;  3T56 B;  4CJ2 C;  3I91 A;  5EQ0 A;  5I2X A;  3BVZ A;  3GTL B;  4MIU A;  3H91 A;  4F88 A;  2SEB D;  1LT6 D;  3NSW A;  1GUT A;  1ZXT A;  1C48 A;  4F7X A;  3NHH A;  1Z7T A;  3K7A B;  3LNN A;  4PNY A;  3HRZ C;  1HPC A;  5DAU A;  2A69 C;  1BF4 A;  3BS1 A;  2F0K A;  2PZT A;  1D6E C;  3I4L A;  1SJE D;  4RKB A;  1Y8O B;  2ZXR A;  2A68 C;  1F2Z A;  3PUX A;  1NCV A;  3OMC A;  3ERQ A;  1BCP F;  3FVQ A;  4A3K B;  1RF2 D;  3M4O B;  2X6G A;  2D5D A;  1EEF D;  1ROD A;  2NTS A;  2X6L A;  1JB3 A;  1CA5 A;  2DNE A;  4RA8 A;  3DWA A;  1AW7 A;  3DEO A;  4B08 A;  1H9M A;  1I6V C;  1A3U A;  3P1H A;  3GD7 A;  4FF4 A;  4WFN 3;  1CM9 A;  1LAB A;  3GTJ B;  1RJT A;  1STH A;  4J8Q A;  4RAU C;  1HXY D;  1V43 A;  4KD3 A;  4GZY C;  1E2W A;  1QG7 A;  1FNW A;  3GTK B;  5JOB A;  1A6X A;  5IOC A;  1EFI D;  3GTP B;  4QUF A;  1PRT F;  5DNF A;  2VXW A;  4OO1 I;  2SNS A;  2XRQ D;  3K6O A;  1Y69 U;  2EJM A;  1WTV A;  3J81 E;  1IHZ A;  3N52 A;  2F0F A;  4K8J A;  1JIC A;  5DM6 3;  1TS4 A;  2EY5 A;  2K05 A;  5JEA G;  5J1Z A;  3SK6 A;  3NK9 A;  3QOL A;  2KA7 A;  1SSO A;  4IUQ A;  3NWT A;  3E6Z X;  3MEH A;  2IWH A;  1LT4 D;  4NDX A;  4ZKC B;  4A3B B;  3FEW X;  4R8N A;  5C5M A;  4CGY B;  3J7A V;  3M7N A;  2B63 B;  4Q5V A;  1LTR D;  4R9W A;  2J7Z A;  2KJX A;  1II3 A;  2NWG A;  4K5X A;  2F0O A;  1YNN C;  5M9O A;  5HGT A;  2HUG A;  1TWA B;  1PDQ A;  3S15 B;  2N88 A;  3H09 A;  1HUM A;  4LJZ C;  1EU4 A;  1TVX A;  1GJX A;  1TWF B;  3V96 A;  2RDH A;  1YNJ D;  1MSH A;  3I4M B;  2Z4H A;  2VUM B;  2KVM A;  1IKM A;  2LFN A;  3GP7 A;  1STN A;  5EBC A;  5FK9 C;  1EWH A;  3TP5 A;  4ZYS A;  1J8I A;  3J81 L;  1I50 B;  1FGB D;  1S5B D;  5D14 A;  2JP1 A;  1B9N A;  1BCP C;  4HED A;  1M4V A;  5KYI A;  4K2K A;  1CK1 A;  2EVB A;  3DUZ A;  1D5M C;  2XWJ B;  5EKI A;  3T51 B;  1XXG A;  2F0E A;  1HCZ A;  1V8Q A;  1PXU A;  4CKE A;  1WTQ A;  1RCV D;  2WKC A;  3D6C A;  4QF4 A;  3HOZ B;  1B1Z A;  2K04 A;  2AQ2 B;  1AEX A;  2K5D A;  1ENC A;  3ITP A;  4TSS A;  2EZV A;  1A2T A;  4A3I B;  1SYC A;  3S9W A;  2I46 A;  3MVV A;  4ZUI A;  1S5D D;  2BCO A;  1SAP A;  3C46 A;  1LAC A;  5EKK A;  1JWM D;  1EY0 A;  3BDO A;  3S2D B;  1S5F D;  3RMH A;  1BCP B;  2F0U A;  1PRT C;  2EOT A;  4LAA A;  2EDG A;  4DA2 A;  1B2T A;  1F2Y A;  1PFB A;  4X3T A;  4K6L A;  1JQY D;  4IAL A;  4UDU C;  3VYT A;  2AWN A;  1O78 A;  2A6E C;  3KLR A;  3G6J B;  4RFB A;  1G29 1;  1NAP A;  5JEA H;  5C4Z A;  5JPM C;  3ND8 A;  3HKZ B;  1SE3 A;  2K33 A;  2KQ3 A;  4S3S A;  1I4Q A;  4KKT A;  5J22 A;  1YNN D;  4U67 3;  3T4A C;  4G7Z C;  4DXF A;  1HA6 A;  5CV8 A;  2B8F A;  2NN6 G;  1E0B A;  2B2V C;  4XYQ A;  3TZU A;  3CU7 A;  3Q6S A;  3VYR A;  2B2V A;  1PRT B;  5C5L A;  3VA5 A;  1CT1 D;  1BOS A;  2K5Q A;  2DY8 A;  2KCC A;  4OL7 A;  2DY7 A;  4G4K A;  4ZLT F;  1I4G A;  1LTS D;  3K5L A;  1IYU A;  2MHV A;  2FJ2 A;  1SNC A;  1BXT A;  1FYC A;  1EYD A;  2XWB B;  4L6T B;  1OXT A;  3HOU B;  3TDQ A;  1EY8 A;  1BCP D;  2Q8T A;  3A8J E;  2E2D C;  5E4W C;  3EQL C;  5IGD A;  2BDO A;  4XT1 B;  1HA5 A;  1AP0 A;  2RA4 A;  2PQE A;  3AB9 A;  5KNC A;  1WTX A;  2QIL A;  1U4R A;  4IFD G;  1D2B A;  2BE5 C;  3MTS A;  5JJZ A;  2K5W A;  3IFT A;  3RD4 A;  2KHS A;  3ZYY X;  2Q8R E;  4NKL A;  5C3X A;  3PO2 B;  3VR6 A;  2EYJ A;  3KBX A;  1ENF A;  4ODG A;  3LWE A;  1JOR A;  1X3P A;  5ELC A;  1DYQ A;  2F3V A;  3QOJ A;  1Q1B A;  1J9O A;  2CW0 D;  4XT3 B;  1TWH B;  4TKO B;  2RDG A;  1HQM C;  1L0X B;  3GV3 A;  4K5V A;  1QJO A;  5C0X G;  3K57 A;  3IKJ A;  1PRT D;  2JYO A;  3OSO A;  4C1N I;  1EEI D;  1HFG A;  2IPK D;  4YIJ A;  2A6E D;  5C3E B;  1SYD A;  1EIH A;  2EE1 A;  3L9A X;  3PUV A;  2QEJ C;  4A3M B;  1KLU D;  2HQE A;  3WDN A;  2Q8I B;  2OF1 A;  1JOO A;  3A54 A;  1CQF A;  3D31 A;  2Z8L A;  3K5O A;  4LK1 C;  1HQR D;  3SEB A;  3S17 B;  2PO4 A;  3C1E A;  2F0W A;  1EY4 A;  1SNQ A;  2FIN B;  1OXS C;  4HCS A;  1E2Z A;  4KY6 A;  1EQV A;  2D2C C;  3NQI A;  4JK1 C;  5ISR A;  1EY6 A;  4KHZ A;  1QNU A;  3MA2 B;  3SDZ A;  2LKV A;  3SVM A;  2EYH A;  2WAC A;  2VNU D;  2V4D A;  5G3L F;  1IKL A;  5TSS A;  2NN6 H;  3K5N A;  4HMJ A;  4PQX A;  4C3I G;  5KGU A;  1D1K A;  3S14 B;  4X3K A;  5C6A A;  4Y7N B;  2RDF A;  5IOD A;  4FYD A;  2KCN A;  1WD0 A;  4XQQ A;  2F0J A;  3V05 A;  2NVT B;  5ELD A;  4CJ0 B;  5IT9 E;  3Q24 A;  3EVQ A;  3HOV B;  4FF1 A;  3VR3 A;  4FP5 D;  1U4M A;  1G2S A;  1TQO A;  3IAY A;  1RTN A;  2HCC A;  2MPM A;  1EY9 A;  1W6J A;  3IFD A;  5M3M B;  4J1M A;  2EPB A;  4KJO A;  5CV7 A;  4EVO A;  1A15 A;  1S5E D;  5D3D A;  2SOB A;  4ZAI A;  1EZ8 A;  4KHV A;  4I7Z C;  4I65 A;  4RGT A;  5J39 A;  4RHS A;  2BOS A;  3HS0 C;  2WII B;  1QE6 A;  5KYL A;  3MXG A;  2L11 A;  3S1R B;  3WOF A;  1OXU A;  5IGB A;  2M9V A;  1TII D;  2F0P A;  4A93 B;  3A56 A;  2JA6 B;  2JE6 I;  3P75 A;  1NUC A;  3FPP A;  4KTA A;  1UAP A;  2K01 A;  4RGN A;  2JA7 B;  5C4J B;  4OIJ A;  1M8A A;  1ONL A;  3OOC A;  3R8B A;  1MGS A;  3OW7 A;  4KJN A;  2EY2 A;  4HAE A;  4IUV A;  5I6Y A;  5M5Y B;  1G2T A;  2BDN A;  3PUY A;  1PFM A;  1PMR A;  1F77 A;  2SNM A;  4KMU C;  1PYW D;  4OIK A;  1I4R A;  2O5I C;  1BO0 A;  3KUP A;  4L8J A;  5DEH A;  3NTI A;  1IW7 C;  5C3W A;  4XYO A;  5BN3 A;  5CGK A;  4G7H C;  1TWC B;  2R92 B;  2FMC A;  3NTK A;  2F0S A;  3OMG A;  1SNO A;  1FNU A;  3NXW A;  1WTW A;  3R2T A;  2EYO A;  2LY7 A;  5EGT A;  2RQX A;  1LT3 D;  2M00 A;  3K0Y A;  3GTG B;  2L9H A;  3WOE A;  3EFX D;  1G6Z A;  4BA2 I;  4PV1 C;  1AFP A;  4EQO A;  1EQT A;  2ICI A;  4C3I B;  1TU2 B;  4FF2 A;  1K8O A;  3DEP A;  3W3A A;  3DXJ C;  3NP8 A;  5M5X B;  1DOK A;  1MSG A;  1ESR A;  4B9X A;  3ONA B;  3S16 B;  2PW7 A;  2K03 A;  3QG1 A;  4FXD A;  3TP6 A;  4WRD A;  3K5M A;  3MWY W;  1VF7 A;  1EU3 A;  1B9M A;  2VB3 X;  1ILP A;  4KI0 A;  1KAB A;  2F0L A;  2NBF A;  3R93 A;  5EPJ A;  2KEE A;  4KN7 C;  2D62 A;  1BDO A;  1SE4 A;  4ME5 A;  2O2L D;  3BYY B;  2N55 A;  1EY7 A;  3TSS A;  2EXZ A;  2QF7 A;  2XRS D;  1ZKO A;  2H1E A;  1JE4 A;  2R3Z A;  5KEE A;  5FOB B;  5E4X A;  2A69 D;  1SE2 A;  2NUC A;  4FXG C;  1EYC A;  1BQQ T;  1ET9 A;  2QKI C;  1JOQ A;  2R7Z B;  5A35 A;  1F9Q A;  4X3S A;  3H0G B;  1E2V A;  1UEA B;  1ICW A;  2A68 D;  1DOL A;  1H9K A;  4FNF A;  1GUS A;  2B2W C;  5T1I A;  2B2W A;  2WP8 J;  5G3L D;  3O13 A;  1IW7 D;  1MD2 D;  2M2L A;  1IL8 A;  1GHJ A;  5D65 A;  1TS3 A;  5A2Q E;  1EZ6 A;  4RGO S;  4HN7 A;  3K59 A;  4DFA A;  1WTR A;  4RWS C;  1D5X C;  2O4X A;  2JEB I;  1LT5 D;  2B2U C;  5M5W B;  1S5C D;  3L3O C;  4K6D A;  2B2U A;  3DWP A;  5JAV A;  5IGE A;  1SNP A;  4C3J G;  2A6H C;  3PUZ A;  4ZK9 B;  2NZ1 D;  4QB4 A;  5LL6 S;  4X3U A;  3GTO B;  2C5C A;  4M8A A;  2F0D A;  2XNA C;  4RH6 A;  1WCM B;  1XYI A;  1VMP A;  5AFW A;  3T13 A;  1B44 D;  4KY5 A;  3TP7 A;  4CBV A;  1EWC A;  5K5P A;  3BVG A;  3D4R A;  2WKD A;  3TP8 A;  1UUP A;  1PTO F;  1DJR D;  3I4N B;  1SBB B;  1EOT A;  2PZU A;  1PFN A;  2EYP A;  1SJH D;  1ZYR C;  5F2D A;  4IFD J;  2NN6 I;  3ND9 A;  3OHX C;  5A2Q L;  3N6R A;  5FKA C;  2L55 A;  1OO9 B;  2AUJ D;  5I9P A;  3OIP A;  3S1N B;  1T5X D;  3VA7 A;  3BG3 A;  1QOH A;  2IJ0 A;  4BA1 I;  1PZK D;  4N9T A;  5I4D A;  1Q90 A;  2K1B A;  3NE5 B;  1U4P A;  2O5J C;  1LTT D;  3NQT A;  3CRK C;  3AMU A;  1R4P B;  2Y0S B;  3CQZ B;  5HUR A;  2ZXO A;  3DHQ A;  5C0X J;  4C56 C;  2E2H B;  1AN8 A;  4DK0 A;  2R6G A;  1Z6H A;  4XDX A;  4IFD I;  5IGG A;  1GUO A;  5BN5 A;  5ELB A;  1JOK A;  1Q1E A;  1TKW B;  2FHT A;  1O7L A;  5E3F A;  4FF3 A;  2XSC A;  3OWF A;  4K8I A;  2AWO A;  1ILQ A;  3SK5 A;  2F0Q A;  2OEO A;  2E2I B;  1JC7 A;  1LTB D;  4QUC A;  1HTP A;  2F4I A;  4DF7 A;  1T5E A;  3I73 A;  4WOR A;  3I72 A;  1GUG A;  2FFK B;  3URY A;  1G8Z D;  5C0X I;  2JA5 B;  2A6H D;  2BA0 A;  1DZ1 A;  4HTH A;  1SYB A;  3SXH A;  5KIX A;  4IQZ A;  4F87 A;  2AUK A;  4CJ1 B;  1R9T B;  4DNT B;  3C1F A;  2E2J B;  1SYF A;  4L63 B;  1A3V A;  3I3C A;  1BUV T;  5CBE E;  2HCI A;  2RBM A;  5LHY 1;  1FR3 A;  3RLF A;  1K83 B;  1TY2 A;  4H0L C;  1DON A;  1GXD C;  5CR3 A;  3UI2 A;  1STY A;  1ZYR D;  2K32 A;  1SMY C;  3KLS X;  2IX3 A;  1FNV A;  2XIW A;  3SHL A;  4IUR A;  3T53 B;  4ZUJ A;  1PTO C;  2R93 B;  1STE A;  2F0H A;  5C44 B;  1RTO A;  3H94 A;  4XQN A;  1PTO H;  1Y8P B;  3MHB A;  3X3M A;  5JVG 3;  3OWE B;  5LL6 X;  1PLF A;  1I4H A;  4O42 A;  1WTO A;  3KBG A;  4IN3 A;  4DAY A;  4HMI A;  1X3Q A;  5FO9 B;  4FO2 A;  4K5W A;  4ZKB B;  2JEA I;  1H9J A;  4P2C B;  5IIF A;  1STB A;  2I07 B;  3QB3 A;  4KKU A;  1DD2 A;  1QCB D;  1V1P A;  5IGC A;  2B2Y C;  2MUY A;  4DXG A;  2B2Y A;  1CTM A;  4IUT A;  1KTK A;  4ILW A;  1PTO B;  1SYG A;  3SK8 A;  1JCK B;  1BR9 A;  3NUC A;  2AQ3 B;  3A8K E;  2IT1 A;  1L0Y B;  2ICE C;  4DNR B;  5EPL A;  2IL8 A;  5M3F B;  5K36 H;  3R3O A;  4AYB B;  1QIL A;  2BE5 D;  5BN4 A;  2DN8 A;  5FLX E;  2JA8 B;  1DCZ A;  1XTC D;  5EPK A;  2B2T A;  4A3F B;  1F9P A;  3HGB A;  2KEC A;  4C2M B;  1U4L A;  1V1P B;  3BYT B;  5KND A;  3GO5 A;  3V2T A;  5JVH 3;  2E75 C;  2ZT9 C;  5COR A;  5DM7 3;  4H7B A;  2XN9 C;  2NTT A;  3HG9 A;  4EQN A;  1PZI D;  5EKL A;  1ENA A;  5C4X B;  1SMY D;  4IZ8 A;  1I6H B;  1F2L A;  1PTO D;  1GOZ A;  1KNA A;  3MFG A;  1F2M A;  4DGZ A;  4QIW B;  5CMD A;  1I4X A;  3OPO A;  3J80 E;  2EJF C;  4KN4 C;  4ZRZ A;  4QMG A;  4OHJ A;  5IT9 L;  5FLX L;  2HDM A;  2TSS A;  3HZX A;  3CRL C;  5CBA E;  5KNB A;  5CC4 A;  3FKI B;  1Q3L A;  3HOW B;  2WB1 B;  2MJ8 A;  3FMC A;  2JSO A;  2F0M A;  3DWQ A;  3FDT A;  3BDL A;  3U9O A;  2OT2 A;  4DK1 A;  3PUW A;  3HOX B;  2R61 A;  1O7Z A;  2NVX B;  1NR4 A;  3SR1 A;  5JEA J;  1GUW A;  1GHK A;  3K58 A;  1TS2 A;  1CZG A;  2EYF A;  4XTC S;  4RHR A;  4PMB A;  4ABN A;  2PPB C;  2G9D A;  3J80 L;  3P20 A;  4PMW A;  1DOM A;  4BS9 A;  1YNJ C;  4C3H G;  2IX1 A;  1STA A;  3L7Z C;  2EJG C;  3FPU B;  1Y1V B;  1H9R A;  2ZXP A;  3C3L A;  5FO7 B;  4K14 A;  1LTI D;  3PIO 3;  2B39 A;  2Z4I A;  1G91 A;  5T1G A;  3D4W A;  3EJI A;  3RZO B;  2KUM A;  1SDF A;  3OIQ A;  2F1M A;  3X3N A;  2E74 C;  2RSO A;  4DAV A;  1GUN A;  4NW2 A;  1AZP A;  1SNM A;  5EBD A;  3TZD A;  2HDL A;  1UNS A;  3HP3 A;  5CV4 A;  3KF8 A;  4H13 C;  3NBI A;  3VYU A;  1BBX C;  3NTH A;  1A3T A;  3MC0 B;  3RZD B;  4CKB A;  4FXK C;  4F8M A;  3H6M A;  3PMF A;  1RKN A;  3I70 A;  1A2U A;  5COY A;  1CHP D;  1MBY A;  2WV6 D;  3JAM E;  1F9R A;  2E76 C;  1NSN S;  2PYK A;  1JWS D;  3NPP A;  4XIG S;  3GTQ B;  4WJW A;  1D1I A;  4V0B A;  2C9O A;  3TME A;  5I9O A;  4KKS A;  5ELE A;  2JXM B;  1XWE A;  3PO3 B;  1EIG A;  1CZW A;  1KLG D;  4OO1 G;  2B8G A;  1C4Q A;  1OXX K;  3IL8 A;  2SDF A;  3EA6 A;  1I3Q B;  2CQA A;  1Y1W B;  1KDC A;  2PW5 A;  4EQP A;  1VF5 C;  3W2D A;  2KOL A;  3QIA A;  1W6K A;  3LWU A;  4XQJ A;  3GV6 A;  3JAM L;  2IW3 A;  4HSV A;  1ET6 A;  4TRD A;  2RVL A;  3BDC A;  1KDB A;  3I8Z A;  4NMZ A;  5KRU A;  1AZQ A;  3I90 A;  5IGF A;  3QJY A;  1EY5 A;  4E6I A;  3SK4 A;  4A3E B;  5NUC A;  3M4Y A;  3LX0 A;  1F9S A;  4KD4 A;  2NVY B;  1BNZ A;  2LS0 1;  2MGS A;  4RKL A;  4G57 A;  4IUP A;  4Z9C B;  2PMZ B;  3BZD B;  5CYU A;  3TN2 A;  2QCP X;  2F03 A;  3D4D A;  3S1M B;  1DXM A;  1LV9 A;  1OXV A;  4RCO A;  1RDP D;  4BY1 B;  3DM1 A;  4J6H A;  1D5Z C;  3GTM B;  2A74 C;  4C3H B;  1U9R A;  2CW0 C;  2ENB A;  5CV9 A;  4PMC A;  5FO8 B;  3HOY B;  3M7G A;  2EYM A;  4UAI A;  4BY7 B;  1ML0 D;  4O1N A;  4EGV A;  2GA4 B;  2QDB A;  4H44 C;  4ULL A;  4RGM A;  1WVL A;  3QWN A;  1CA6 A;  2F0T A;  2EYL A;  2YYZ A;  3D8G A;  1VCI A;  4QCL A;  4N9P A;  4KK7 A;  2A5H A;  3A55 A;  3SE0 A;  3MXN A;  1TS5 A;  1SFO B;  1SND A;  5CV6 A;  4RCN A;  2K28 A;  1SXT A;  1EYA A;  1R4Q B;  3E5S A;  2MP1 A;  3E0J A;  4Q0F A;  3BVM A;  4OO1 H;  3NBH A;  2L12 A;  1WTP A;  3M3Y B;  5K36 G;  1CI3 M;  1CFM A;  4NP5 A;  3VR4 A;  1Z47 A;  2DNC A;  1C8C A;  3C2P A;  5E1F A;  4C1N K;  1JWU D;  2L1B A;  2WAQ B;  3CHB D;  5D3I B;  2FMM A;  3A8I E;  3MFY A;  1O80 A;  2X69 A;  3HEJ A;  4HSP A;  4OGQ C;  1EL0 A;  3DMU A;  1Q8I A;  2IX0 A;  3R2I A;  2OXP A;  3TBI B;  4BWG B;  5ELF A;  4A3D B;  3VYS A;  4CHT B;  1MI2 A;  1ESF A;  1DM0 B;  2NYZ D;  2EY1 A;  1IYV A;  1FD7 D;  3KLS A;  3S2H B;  3D3R A;  1HRJ A;  1Y8N B;  1B3A A;  3MAQ A;  1TY0 A;  3GQB A;  1QB5 D;  1VDZ A;  3J7A F;  4KY7 A;  3VR2 A;  2H4O A;  3VR5 A;  5EJW A;  4B9W A;  4A3G B;  1TT2 A;  2TMP A;  4C3J B;  2F0I A;  2RKS A;  3MXU A;  1Q12 A;  1SYE A;  4DU9 A;  4A3J B;  3Q22 A;  3MZ5 A;  3U9S A;  3F2U A;  2K7V A;  2WIN B;  2L4N A;  2Z1C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...