1SYBA

Transfer of a beta-turn structure to a new protein context
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
137
structure length
137
Chain Sequence
KLHKEPATLIKAIDGDTVKLMSSNGSPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Transfer of a beta-turn structure to a new protein context.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase(phosphoric diester)
molecule keywords STAPHYLOCOCCAL NUCLEASE
total genus 35
structure length 137
sequence length 137
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1994-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1sybA00
1A3VA 1F2MA 1KDAA 5IOCA 1A2TA 2F0FA 2F0TA 5IGEA 3P75A 3LX0A 5CV6A 2F0VA 1EY4A 5C3XA 5IGBA 4S3SA 4EQOA 1SNCA 2EYFA 4HMJA 3VA5A 5CC4A 2ENBA 1SNPA 5CV7A 5JOBA 3SK6A 4DF7A 4K2LA 5KYLA 1EY5A 1NUCA 5CV5A 3V2TA 3MHBA 5CR3A 1STHA 1A2UA 2SNMA 3EVQA 2WACA 5KRUA 1RKNA 4H7BA 1EQVA 2PZUA 1SYCA 1TQOA 3C1FA 2KHSA 2PYKA 2PW7A 4J1MA 1JOQA 1EY0A 2F0LA 4QB4A 1U9RA 1SNOA 2F0QA 4KJNA 4KY7A 5IGDA 4IZ8A 4K14A 1STAA 4J6HA 2KQ3A 5EKKA 4K6DA 5C5MA 1EY9A 4B9XA 5CV8A 2RKSA 4KD4A 3SHLA 2F0MA 1SNMA 2EYHA 2PZTA 3SXHA 2F3WA 3D6CA 1A3UA 4OL7A 5IODA 3TMEA 3MEHA 4EQNA 2F0WA 4F8MA 1IHZA 3D8GA 3DMUA 3ERQA 3NHHA 5EGTA 4N9TA 3HZXA 1TR5A 5NUCA 2HQEA 3OMGA 3TP5A 5DAUA 1SNQA 4QF4A 1KDBA 4HTHA 3NXWA 5I9PA 5IGFA 3PMFA 4ZUJA 5CV9A 4E6IA 4MIUA 3ITPA 4KJOA 1SNDA 1AEXA 4NMZA 5ISRA 1EYDA 4K5WA 5I6YA 4QMGA 2F0OA 4PMCA 2F0IA 1STNA 4IUNA 1EY7A 4KY5A 1JOKA 5K5PA 2F0HA 4ID6A 4KD3A 3NQTA 4KHVA 5DEHA 4NDXA 4K5XA 2EYJA 3D4DA 4EVOA 4F7XA 2RBMA 4N9PA 4I65A 3R3OA 4G57A 4DGZA 2F0UA 3MXPA 3OWFA 4ME5A 3TP7A 4B9WA 1STBA 4DFAA 5C4HA 2LKVA 2O4XA 3C1EA 3EROA 4RKBA 3HEJA 3OMCA 3SK4A 5HURA 2EY6A 5KGUA 4K5VA 2F3VA 4PMBA 1JOOA 2QDBA 3NK9A 2M00A 5F2DA 3MZ5A 5C3WA 1F2ZA 1EYCA 2OF1A 5KYIA 3H6MA 2F0JA 5C5LA 2EY2A 3EJIA 1ENCA 4NP5A 2EYMA 2F0GA 2F0DA 2OEOA 4RKLA 4YIJA 1SYDA 5KEEA 3SR1A 1KABA 4TRDA 4WRDA 5HGTA 5J39A 2EYLA 3U9OA 4HMIA 3NUCA 1A3TA 5E3FA 1EZ8A 4DU9A 1JORA 1EY6A 1II3A 1STYA 3RUZA 1SYFA 4KTAA 3E5SA 3SK5A 1EZ6A 4IALA 3D4WA 5I6WA 4PNYA 2EY5A 4K8IA 5IIFA 5I9OA 2F0EA 1KDCA 5JAVA 1SYBA 2F0PA 2OXPA 5IGCA 2F0NA 5C6AA 3BDCA 1STGA 1KAAA 3T13A 3TP8A 5M9OA 2F0KA 3TP6A 1F2YA 1SYGA 3S9WA 2PZWA 4K8JA 1ENAA 2EYPA 3QB3A 5J22A 4ODGA 3P1HA 4R8NA 4KV6A 2NUCA 2SOBA 4WORA 4ZQ3A 5J1ZA 5KIXA 1SYEA 4KY6A 4LAAA 5E1FA 1EYAA 4ZUIA 5IGGA 2PQEA 3NP8A 2EY1A 5CGKA 2EYOA 2PW5A 2SNSA 3OSOA 5CV4A 3QOLA 4EQPA 1EY8A 2RDFA 3MVVA 5C4ZA 2F0SA 3BDLA 2EXZA 4K2KA 3QOJA 3SK8A 4NKLA 3T16A 5EKLA 1TT2A 3DHQA 1NSNS
chains in the Genus database with same CATH superfamily
2ICIA 4OX9L 1A2TA 1E3PA 3BVGA 5CV6A 1PRTD 2B2UC 1FR3A 2EYFA 4X62L 1NUCA 1ESRA 2KBNA 3PIP3 4JG2A 4YY3Q 1K9MC 2UXCL 1Q3LA 2KHJA 3PIO3 5I2YA 3VR6A 1Y1WH 4JC0A 3E0JA 4PZ7A 3HOVG 4A3JB 4DA2A 1XTDA 1MKHA 4DK1A 2C35B 3NPPA 5T1GA 3FKIG 1Y1WB 2R7DA 2QW7A 1LABA 4KD4A 3S24A 3K0XA 1DONA 2RHQB 4AH6A 1BCPD 1XX8A 4A3FG 1A8VA 2VNUD 1LT4D 4LUOA 2K33A 2OTLA 3R2IA 4C2MB 3NXWA 4IUQA 5C3EH 4V0BA 5A2QL 3S2HB 1AEXA 1NAPA 1TS5A 5EKIA 5K5PA 3J81c 1EY7A 3CCSA 2HIVA 3HS0C 2B2TA 2F0HA 1T9HA 4KHVA 3QR8A 3LWUA 4FNFA 4RGMA 4CKBA 2EE1A 1I4QA 4CDCC 2WAQG 4G57A 1VQHA 2ZTEA 1HNZQ 1SEBD 2KOLA 1KNEA 1WCMB 3NK9A 5C0XJ 1SE8A 1EFWA 5ELCA 5C3WA 1HNXQ 5A2QE 4A3JG 4X62Q 3A54A 1EU3A 1QUQB 1QUQA 1RTNA 1JWSD 1I6HH 3Q23A 2AHOB 1K8MA 3ND8A 1A3TA 1VQAA 4H0LC 4CHTB 3S1MH 2JA8G 1FNVA 2EY5A 5I9OA 1Z6HA 4GNXA 4L8JA 4DPGA 1STGA 3TP8A 3TBIB 2TMPA 4JK1C 5M3FH 2LMCB 4IO9A 5M5XB 4RFBA 2YV5A 4JW0A 4QIWB 3HGBA 3RN2A 4DK3C 4DR3Q 5EAYA 1J8IA 2K5VA 1IXRA 3KDFB 2JP1A 2EY1A 3D6WA 4TKOB 1RF2D 2B2VA 5EPJA 1WYDA 1DOLA 4DUZQ 3K59A 5C4ZA 2A1AA 3BDLA 2NVXB 1WD1A 1CTMA 4KI0A 1M8AA 2RSNA 3HG9A 1Y1WG 1CM9A 1S5FD 4CBVA 2UXBL 1Z47A 4HMJA 2HHHQ 1B4OA 5DLQE 1KD1C 1CZWA 4AYBG 4KN4C 2F4IA 2PW7A 1JOQA 2LXKA 4QB4A 1OXSC 1MSGA 1I94L 4YCWA 1X9NA 3BU2A 2BE5C 1PDQA 1GD7A 1VMPA 2L4NA 3R8BA 1OXXK 4JBMA 1B9NA 1SNMA 1IBKL 4XYOA 4JI3L 3SDZA 4N9TA 3TP5A 2N8NA 3FMCA 3RNUA 3NBHB 1O7YA 3X3MA 3H3VI 1EYDA 2WB1G 2WIIB 1XTCD 3HOYG 4JI8Q 3F2UA 1CA5A 2L5TA 4X3KA 1JB7A 4ME3A 4LJZC 3U4VA 1O80A 4GLAC 4ME5A 2RHSB 3KF8A 3NBIA 2IY5B 2JA7G 3C1EA 3T56B 2B8GA 3PO3G 3CRLC 3MAQA 4BY1G 5C0XH 1JOOA 2NZ1D 2UXBQ 3MZ5A 2D0OA 3QG1A 1YZ6A 1MGSA 3W5OA 1L1OC 2A19A 2F0JA 2PMZB 5IP9H 1BXTA 2QDLA 1GVPA 5M3FG 2PI2E 1B3AA 1BUVT 1H9JA 1PRTC 4R8IA 4C2MH 4CJ1B 4DV0L 4NXNQ 2E5LQ 1SYFA 3EQLC 2R7ZG 1QVGA 5M5WH 3KBGA 1QOHA 3T13A 4JI4L 3JAMc 1YHBA 2B2WA 3CCVA 4KMUC 4L5SA 4OEMB 4XQQA 4X64L 3HOYB 5LMNW 1B9MA 2PQAA 3M7NA 5JEAJ 4HSVA 2NUCA 3PUZA 1IYJB 4APVA 1GOZA 1SYEA 4LWCA 2EYOA 3SK8A 3K57A 2EXDA 4JI8L 4OXPA 5FJ8H 4A3MG 4POFA 4B3SQ 1H9MA 2N55A 1MD2D 2AUKA 5C3XA 2K5QA 4UP7A 1Y1VG 1TWFB 5LL6S 1PH1A 1IYVA 3QJYA 4XIGS 3FDTA 1IKLA 1D7QA 2B2UA 4H7BA 2CHBD 3BS1A 1J6QA 1U9RA 3WWVA 2UUAQ 3CCQA 4JV5L 1RIPA 3OWEB 5EKKA 4IOAA 1PH2A 3HOYH 3K5MA 4GOPC 1PH7A 2E5LL 1X6OA 2VXWA 4C3JG 3BJUA 4FO2A 1A3UA 2D62A 2JQOA 3TMEA 1A6XA 4LMQD 3ULJA 4BY7H 3J80L 3DMUA 4MTNA 4FF2A 4X64Q 1GJXA 3KDFA 3K8AA 1STNA 2I07B 3GP7A 3FPUB 1GUSA 4JI6L 2K04A 1JMCA 3ER0A 1Q7YC 1TU2B 1I50B 2L1BA 3I7FA 2JA5G 3MC0B 2XVSA 2CWPA 4RKBA 5C4HA 3J7AF 5C4JB 2R7FA 4K5VA 4K6LA 3A8IE 1D8LA 2NN6H 4NP5A 2BH8A 4OHJA 1SYDA 4N8FA 2A8VA 3PCOB 1WTWA 3K58A 2K32A 1CQFA 4HCEA 5E3FA 3I4NH 1EY6A 1NCVA 1VCIA 1C4QA 2ICEC 5IGCA 1E1TA 1Q8IA 5ELBA 3KLWA 4N8X1 2WKCA 1PTOF 3PIPA 2NVQB 2I5MX 1ILPA 3TQYA 1XYIA 5EPKA 1U4LA 4K8JA 4HAEA 1AH9A 4F87A 4ODGA 1PYSB 4RAUC 5E1FA 4O1NA 1RJTA 3K7AH 2N3SA 1X3EA 2JA5B 3NP8A 1IZ6A 1JB3A 1SE3A 1V9PA 2EXZA 1K83B 5I4DA 1GUTA 3AQQA 4C3JB 2AWOA 1H9RA 2F0FA 4M8AA 2EJMA 1EY4A 3CQZB 2DY8A 2N49A 4DV1Q 2BOSA 2AMCB 1K73C 2ENBA 4OGQC 2YU9B 4A3FH 5M5WB 2YTXA 3TZDA 1SLJA 4BY7G 3MA2B 2ZJPA 2PNRC 1K3BC 4J1MA 1Q1EA 1DOKA 4LF6L 4A3BG 1VF5C 4LNQA 1WTOA 1GUWA 1BBWA 4J6HA 5C5MA 2VQFQ 1ET6A 2KCMA 4GN3B 4ZKBB 4X3UA 1YHAA 3DM1A 3HKSA 5M5YH 2UUBL 2ZXOA 1DGSA 1KL9A 2Z6KC 2F4VL 1UE6A 4YWMA 1IW7C 3GV3A 1HNWL 3IKJA 2FJ2A 4ZKCB 1HJPA 5EPLA 1KDBA 4JOIA 2DN8A 2VUMB 3V96A 4L6TB 1HUNA 4QMGA 2H5XA 1KAWA 4KD3A 4HSPA 3T1YQ 3HP3A 4BBRB 4EVOA 3D4DA 3LGJA 4DV4L 4JI2Q 4FF3A 3OWFA 5A35A 3F2BA 4FF4A 5FLXc 3HEJA 5KGUA 1HCZA 2EY6A 1IBLL 3MFYA 3S14B 3Q22A 4GKJL 2VY3A 3NWTA 3P7JA 1F2ZA 1UE1A 1XNQQ 2OF1A 3BYTB 1X3FA 3CCMA 3GTLH 3R93A 1WTXA 2OEOA 1PXUA 3A5UA 4UP9A 5IYCH 2JSOA 4WRDA 4X6AH 4H02A 5D3IB 3V05A 2B63H 1JORA 2K01A 1STYA 4OWWB 1ZYRD 2OTJA 2VQFL 2JA8B 3GTKB 4LF4L 1VQ8A 1TWFH 4GS3A 5C6AA 1HZBA 4BA2I 1JWMD 1W6JA 2IX3A 3A74A 1QCBD 2XRQD 4BXXG 1HNWQ 5J22A 1CSQA 2L15A 2KA7A 3HOZB 1NR4A 4ZUIA 3KF6A 3M3YH 1A63A 1YI2A 2JA8H 2KEDA 1RD9D 1EY8A 1HTLD 5JEAH 5CORA 1TVXA 1LTRD 3CMEA 2V1CC 3UDXA 1Y1VB 3EN2A 3MXGA 3HFZB 1NSNS 3VYTA 5IOCA 3T1YL 2QA4A 1C0AA 2CVRA 3BVMA 5IWAQ 2IT1A 3PO2B 4LK1C 1X3QA 3J81L 4B3TQ 3SK6A 4DR7L 1EY5A 1L1OB 3A8KE 1RL2A 4GKJQ 2UU9Q 1BR9A 5CBEE 5KRUA 4B3MQ 1QVFA 1XNQL 1LTTD 5LL6X 2SDFA 2IHEA 2PYKA 2VS1A 3I4OA 4P71A 1CK1A 1D6EC 4DXFA 4K6DA 2R93B 1FGUA 1UWVA 2HDLA 4DUYQ 1BKBA 2KECA 4LF4Q 5TSSA 4IQZA 1MI2A 1D2BA 1IW7D 1S5ED 1VQNA 1N32Q 5ELFA 5IGFA 5C44H 3I55A 2QEJC 2E76C 4KJOA 3I3CA 2MNAA 3PO2H 4NMZA 1F9QA 1JOKA 5BN4A 5DEHA 1FGBD 4MTKA 2K1BA 1LTAD 2ZTDA 3D0FA 3J80E 4LFAL 2E2DC 5G3LF 4F7XA 4H13C 2F1MA 2PPBC 5JJKA 5I6WA 1U4RA 1STBA 1A0IA 1EIHA 5HURA 5E4WC 1VQ6A 5IWAL 5C4XH 1IYUA 4PMBA 1CKMA 1SN8A 5F2DA 3EIVA 2I46A 2AUJD 4M1UB 4DR7Q 3HOZG 2Q2HA 1AFPA 5KEEA 3T4AC 2RVLA 4TRDA 1EIYB 1BO0A 4JI0L 2JA6B 1VQGA 2KCCA 5D65A 3GV6A 3U9OA 1LT3D 1EZ8A 4GOPB 4A93H 4XT3B 5ISRA 1QG7A 5GAHC 3RLOA 2CFMA 5C0XG 4BY1H 4JI1Q 1N33L 3I73A 3M4YA 1I4HA 5FLMH 3S1QH 2LY7A 3KOJA 1LV9A 2Q8IB 4X66L 2UXDL 1HUMA 2R92G 3K5LA 1N32L 5KNDA 3HOUH 1IL2A 1TWAB 2R61A 1X54A 3S14H 5KIXA 1AZPA 4DNTB 4KY6A 3TSSA 1GO3E 3AFPA 3T1HL 1X65A 1XNRQ 1V8QA 5BN5A 4DR1L 1BBXC 3OSOA 2RCFA 2RDFA 2X6LA 3TREA 1LACA 3KLRA 3QOJA 1I6HB 4A3DB 3GTMB 1TT2A 1LTLA 3OIPA 1YNJC 4LFAQ 2AWNA 5CYUA 5IGEA 3GTMH 1DYQA 2NTTA 1SNCA 1H9KA 3W3AA 1WVLA 5CV7A 4XQJA 3J81i 2BE5D 3GTOH 2IX0A 1AP0A 2JJQA 2MGSA 1SMYD 1V1QA 4KKUA 1PH8A 3A56A 1F9RA 3X3NA 4RHSA 2J7ZA 3DUZA 4DV5L 1B50A 3E3XA 2P5ZX 3A0JA 3W2DA 4OELB 4GLVB 2MO1A 2R92B 3STBD 1L0XB 3CD6A 3S2HH 2MPMA 2F0MA 4IFDG 3J7YW 4A93B 5IODA 3MEHA 2JA7B 3M4QA 2HT1A 3HKZB 1VQLA 5DAUA 1EQTA 4HTHA 2OQ0A 2UXDQ 1CUKA 5C4XG 4DR5L 3CXCA 1E24A 3S2DH 4O2DA 4EGVA 4CDEC 3T1HQ 4A3IB 4C3JH 1XNRL 4A3BB 3JC66 5LMNL 4DXGA 2D0PA 1WOCA 3HKZE 3KF8B 3MXPA 1NMFA 1VMCA 1F9SA 4UDUC 1PV4A 2BDOA 2JK8A 2F3IA 1LT6D 2ZXPA 4A75A 1IBML 2I0QA 4HIMA 1Y8NB 1MBYA 4OIJA 4MNOA 3PUYA 4AQYQ 1K28A 1W3SA 3SGIA 1UE5A 1HHVA 1ICFB 3I2ZA 3CCEA 4RWSC 4DU9A 3RUZA 2MP1A 1BNZA 2NVTH 1CFMA 5JAVA 1UE7A 3I56A 2ASBA 3FPPA 4Y7NH 2B63B 3WDNA 3J7ZC 1VQ7A 4AIMA 2FMCA 1E0BA 1J5EQ 1FL0A 1HH2P 2E2IH 5BR8L 5DM63 4YWLA 1V1PA 3OW7A 4C3IB 2SOBA 4WORA 2RA4A 4DR5Q 1CT1D 1XMOQ 3UDGA 1H95A 4K2KA 2I5LX 4NKLA 3RR5A 2JEAI 4A3KH 4A3IG 1YHQA 2Z8LA 1IKMA 1HZCA 3LX0A 2J0TD 3F1ZA 1PMRA 5E7NA 1KLUD 2O5IC 1FD7D 1LT5D 3D3RA 2A69D 3S15H 3K0YA 1VQMA 2XTIA 2AQ3B 4BY7B 1E2WA 1TQOA 3C1FA 4DR2L 1KQSA 2ZM6Q 4KY7A 1DD2A 2KCTA 1HTPA 2XRSD 3I72A 4IPCA 2RKSA 1RTOA 1SJHD 2GVAA 1WTQA 4F8MA 2A68D 4LFBQ 3CP0A 3BYYB 2HQEA 4QF4A 5JVG3 1J5EL 3LWEA 1KXLA 1EL0A 5BR8Q 4OIKA 4RMFA 3DWAA 3R2TA 4IJHA 2F0IA 1DZ1A 1I4RA 3ULPA 2YU9H 4LF8L 2A6ED 3F8TA 4K5XA 2B2WC 1VQCA 1Q90A 1FNWA 3L3OC 5IYCG 1FJGQ 4N9PA 1CSPA 4DFAA 3TP7A 3NE5B 3SK4A 5GAGC 3RN5A 1SRUA 1N9WA 3IAYA 1BOSA 1VQJA 3AU7A 3RZOB 4UAIA 4WFN3 4BBSG 3KJPA 4RKLA 1N34L 1JC7A 4DR2Q 1D1KA 1GXDC 4R9WA 1VQ9A 1EEID 4JI6Q 2E8GA 2ZM6L 1R4PB 4OX9Q 2KVMA 3ICEA 1B7YB 4PNYA 1GM5A 1KDCA 3A7AB 1WJJA 4KHZA 2CH4W 1V1PB 4UY8C 1N36Q 4L5QA 4X3SA 4KHPQ 1I4XA 4A3DH 1S5BD 3S9WA 2UXCQ 3VYUA 2L12A 4ZQ3A 2WINB 2B63G 1S72A 1PLFA 2HQLA 4GOPA 5CV4A 1VQ5A 2QILA 4C3IG 1YEZA 2K7VA 2HUGA 3MXUA 4A3EG 3DHQA 4H44C 2DUDA 4QY7A 2ZXRA 3H09A 3QIAA 4S3SA 4RH6A 4BXXH 1X32A 2V4DA 2J4XA 1J9OA 2WB1B 3V2TA 2NZOA 1STHA 1U5KA 4A3EB 3FRPB 2JXMB 4BWGB 5GROA 2A6HD 3M85A 2MHVA 4U68A 1TWGH 3GTJH 2E2HB 3E9HA 2JN4A 1SFOH 1XPOA 2Q2IA 2Q2TA 4DR4L 2R93G 4C1NI 4OO1H 3QWNA 2EOTA 2LS01 1X55A 2KUMA 4IUTA 2G5DA 3SXHA 3PGZA 1YNJD 3JAML 4IOCA 3GTKH 3ERQA 2ATWA 5NUCA 5J3BA 1PH5A 4C3HB 2L9HA 4E6IA 2QF7A 1E1OA 1GHJA 1SE4A 3KJOA 2I5HA 4ZRZA 2K28A 4FVMA 4IUNA 3HOZH 3GQBA 2VL6A 4NDXA 2BDNA 1YNNC 4HIKA 3B6YA 5JJZA 4A3CG 2QGQA 3BZKA 3SVMA 4OWXB 4AYBB 1I4GA 2NVYB 2LKVA 2CQAA 1EIFA 1G91A 4A93G 5C44G 1TWGB 2E2HH 3BZCA 4X65L 1LUZA 3H0GB 4GKKQ 2B2YC 4BBRH 5KYIA 3URYA 3N6RA 5M3FB 4DNIA 2F0GA 2F0DA 2R92H 4ZLTF 1EOVA 2PO4A 4Y52H 1GUGA 4DUZL 4IJLA 5HGTA 4AYBE 4QUCA 2E2JB 3PUWA 2RSOA 2R3ZA 3S1RB 4HJ7A 1DM0B 2XGTA 1EZ6A 2JYOA 1SYBA 2EIFA 5G3LD 2OXPA 4C3IH 1R9TH 1KAAA 4FXDA 4POGA 3GDEA 4HIDA 3M9BA 2EYPA 3QB3A 3GTPH 1Q82C 1EWCA 4PQXA 1W6KA 3DLLA 1I94Q 4FDBA 4L63B 5E4XA 4A76A 3U9SA 4LFCQ 4IUPA 5M3MG 1F77A 1ET9A 3AFQA 5FLMG 3OTOQ 1KDAA 2WAQB 3ONAB 3ZYYX 3M4OB 4JI3Q 2F0VA 4DV6Q 2FFKB 2Z9HA 4A3LG 1EFID 5GADC 3W1BA 1X3PA 2MFIA 1O78A 2SNMA 1G2TA 4NW2A 4DKAC 5JJIA 1IL8A 3EBEA 1OXTA 2M2LA 2EQSA 4FXKC 1DXMA 3CCUA 2QCPX 1WI5A 3TS2A 4RCNA 1CKOA 2UUCL 1QILA 1TWHB 2OCEA 2NVXH 4A3CH 5C0XI 4WJWA 1OO9B 3RZDB 1EWHA 2JA7H 1BVSA 1NE3A 4MHEA 3I4NB 3GTGH 1ZYRC 1LTSD 4DV0Q 1AE2A 4DAVA 3U58A 4CJ2C 1K8AC 4F88A 3M4OH 1EU4A 3VR4A 4IFDH 3S1NH 1YVCA 4I7ZC 1VQKA 2HD3A 4LFCL 4GNXC 3KF6B 3K80C 4C56C 3PF5A 1YJWA 2AQ1B 3HOWH 3OTOL 1EQRA 1B44D 5IP7G 5FLXE 4V190 3E6ZX 1E2VA 3D31A 2R7ZH 1UNSA 1NNXA 3H91A 2MUYA 3CC2A 3K81C 4RGNA 4YIJA 3GD7A 3IFDA 1HA5A 4B3SL 4NXMQ 3CAMA 4KTAA 4J8QA 3Q24A 2K4KA 2AKWB 5IIFA 5M3MH 2TSSA 1RODA 2KENA 2MO0A 4YCUA 2M9VA 2UUCQ 2FHTA 2XIWA 1BCPF 2E2IB 5CBAE 2RQXA 1F2YA 3U4ZA 4Q5VA 1W2BA 3H3VH 3VR3A 3G48A 4R8NA 2DNCA 1Y1VH 2NZHA 2UUAL 3GTGB 4JV5Q 1EIGA 1BCPB 1I4PA 1MSHA 2R7ZB 2PW5A 2PCFB 4EQPA 2LXJA 2GVBA 4A3FB 2A69C 3Q8DA 1HXYD 3PF4A 1JT8A 5CV8A 2X69A 4KLKA 1TWAH 4BA1I 1XXGA 1GHKA 1BQQT 5FOBB 2EPBA 3KUPA 1HQRD 3M4PA 3FHWA 1A2UA 1TS3A 3EVQA 1VF7A 1EQVA 4JCVE 5IYDH 3O13A 5JJLA 3VR2A 1CHPD 2JA6G 1MJEA 2VZAA 1HZAA 4XYQA 1D1IA 3EFXD 2NB0A 4NPSA 2EZVA 2G9HD 1NY4A 4NXML 5C44B 1PVOA 2VW9A 1U4PA 3J7A5 2F0WA 2HDMA 3FP9A 5IP7H 4TSSA 4HEDA 1BF4A 3BDOA 3G4SA 3PMFA 2B3GA 1WTRA 2R6GA 3TEHB 3L9AX 3WOFA 5I6YA 1F9PA 3FKIH 4FXGC 4G7ZC 1E2ZA 4ID6A 4JVZA 1R9TB 1GUOA 3HKZG 4DGZA 1AN8A 4CJ0B 3L0OA 1UEAB 1SXTA 4ZCKA 3DWQA 1YIJA 2K52A 1FVIA 1SAPA 1LLRD 3NEMA 3SEBA 3NENA 5M5YB 5H1SE 1ZXTA 1WTPA 2F03A 2E75C 1PH3A 3NUCA 3GTQB 3E9IA 5ELNA 2VQEQ 3S17H 4ZAIA 3NTKA 4CKCA 2XN9C 2E2JH 4A3JH 1HNZL 3TP6A 2QEXA 1PZID 2PZWA 3OPOA 4DAMA 5COYA 1ONLA 3P1HA 1HNXL 1EOTA 3CPWA 1K8GA 5ELOA 1ASZA 4G7HC 1KHIA 2LSSA 1Q12A 4DK6C 1YNXA 1PTOC 1P8LA 4ABNA 2UUBQ 4IFDJ 4A3BH 4GNXB 2JA6H 1CQVA 1WD0A 1Q81C 2K5WA 2K05A 1G8ZD 4UHVA 3VA5A 3J81j 2ALYB 1JR0D 2WFWA 1NMGA 5KNBA 5KYLA 3AMUA 1KIXA 2Z0SA 3MHBA 4TVAB 1UEBA 2Z4HA 1HR0Q 3F2DA 2WACA 4RCOA 1EYGA 1Q1BA 3I4MH 2AQ2B 4HJ9A 4A3EH 1JQYD 1KTKA 4DR3L 3F2CA 4BBSB 1SNOA 2FXQA 4B3RQ 4K14A 1STAA 1YNND 3RLNA 4DV4Q 4YHHQ 1KRSA 4EQ5A 3SHLA 1H9SA 2WP8J 3JAME 3D6CA 1B53A 3PV0A 4HCSA 1I3QB 3MXNA 2VQEL 4R4TA 4DAYB 1G6PA 2BH2A 1IHZA 3D8GA 5EGTA 3IL8A 1B1ZA 2A74C 2N88A 3CC7A 1SFOB 2HHHL 1I5FA 1T5EA 4FP5D 1SNQA 1QZHA 4DN4M 4ZUJA 3K5NA 1B3QA 4K5WA 1CHQD 4OO1G 1RDPD 3BZDB 5FK9C 1HA6A 2HIXA 2BA0A 5LHY1 2NVYH 2CKZB 2ZT9C 1VQDA 1V1OA 2RDGA 3OMCA 1IBKQ 4ALPA 2ZTCA 2M00A 3A5ZB 1XMQL 1JWUD 4KK7A 2EY2A 1ENCA 4OO1I 2OQKA 1QNKA 1TS2A 1HR0L 3SR1A 4Y7NB 1KABA 1E7ZA 1K83H 4U673 1Z7TA 4G4KA 5BN3A 2G9DA 3M3YB 4B3RL 4KKTA 3MTSA 4YHHL 3JAMi 1VQEA 4O0AA 5IP9G 1VQBA 4A3MB 5AFWA 1PH9A 2UU9L 4HN7A 2FINB 3S1NB 4A3GG 1PZKD 4PZ6A 2A5HA 1G291 1PH4A 3S16H 4BY1B 5IY0A 3QOLA 3I4MG 4NXNL 1SROA 1I6VC 3RZDH 5AJ3L 5JVH3 3LNNA 3A7LA 5M5XH 4IFDI 2IPKD 5JPNC 1S5CD 2CH4A 2SEBD 4JI4Q 2HCIA 5CV5A 3S1MB 3N52A 1S40A 1PA6A 3GTJB 3E0EA 1XMQQ 4X3TA 1RKNA 1KNAA 2PNHA 1JJCB 2CW0C 4ULLA 2XWBB 1CI3M 1C7YA 2VB3X 2YYZA 4IZ8A 2EJFC 2NBFA 3PO2G 1XPRA 3VR5A 4A3LH 3MXNB 2VUMG 5D14A 1TKWB 3CU7A 4EQNA 1PYWD 2XSCA 2Z4IA 3TN2A 3CKIB 3NHHA 4LF7L 1Z9FA 1PYBA 2O2LD 3OMGA 4NB3A 5I9PA 1I50H 4FF1A 3U50C 2K6AA 1BCPC 4JI0Q 2WB1E 3NWSA 2F0OA 3J7AV 5K36G 4QUFA 2IL8A 3NQTA 3GTPB 4BS9A 5C3EB 4JI5Q 1GKHA 1N33Q 1DCZA 4JI1L 4I65A 1F2LA 1B2TA 3R3OA 1HFNA 2F0UA 1JCKB 2YTVA 5AJ3Q 2O4XA 4CDDC 3EROA 1Q46A 4JYAL 2DNEA 4X66Q 3HOWB 4Q0FA 2QDBA 3MEFA 4DK0A 2Z6KA 1D5ZC 4WJ4A 1GUNA 3KLSX 1Y14B 1PFNA 1OTCA 4RHRA 1TS4A 3HOWG 5IT9c 3UE0A 1LTGD 3H0GH 3CHBD 1UUPA 2L11A 4YCVA 3D4WA 4R4CA 2JE6I 4JBWA 2F0NA 3T51B 3AYHB 3I8ZA 4YWKA 1Q8KA 1SE2A 3ULLA 3OYYA 1ENAA 4LF7Q 1SR3A 1C9OA 1KRTA 3VYSA 3RD4A 1XWEA 4DV5Q 3HOXB 4P73A 1LYLA 4RGTA 1VS0A 3DWPA 4LF5L 3UDIA 1VQPA 4A3GB 3T16A 3IFTA 5IT9E 3MWYW 5IYBH 4JI5L 2Q2UA 1F2MA 4A3KB 1ILQA 1PRTF 4EQOA 1CZGA 4JYAQ 2VUMH 5JOBA 4DF7A 4C3HG 4P72A 5FO8B 5M3MB 2PZUA 1SYCA 1PFBA 1HZ9A 3H15A 2H1EA 5LMNQ 5KNCA 4DAPA 1EY9A 2FMMA 1NBWA 2RDHA 1T5XD 1C8CA 3STBC 1QNUA 1SMXA 3CC4A 3I4LA 2B2VC 1YBYA 2F3WA 3FEWX 1SJED 1IBMQ 1R4QB 3G7LA 4IURA 2XWJB 4DV1L 2WAQE 4R4IA 2DJFC 3HZXA 1Q86C 4HJ8A 4IPHA 4DAYA 1H9SB 1SNDA 2EJGC 2K5DA 5IT9L 1PH6A 4DNRB 3H3VC 3I90A 3SE0A 3L2PA 4KY5A 3HOVB 1PTOB 2B8FA 3WOEA 1VQ4A 4LF6Q 4XQNA 4JBKA 4LF5Q 3T53B 2CW0D 3TS0A 1JICA 1QJOA 3RLFA 4PMWA 5IGBA 1ENFA 1U4MA 1TXYA 2YTYA 1HFGA 3KBXA 2F4VQ 1MHWC 1B8AA 5FO9B 5D3DA 3KK7A 2ES2A 2RF4A 3Q6SA 1PHJA 1L0WA 1RCVD 1A62A 5C4XB 3A55A 3S1QB 4DV7Q 5LMUL 3ND9A 4P75A 1HPCA 4P74A 3SK5A 4QL5A 4UPAA 1STEA 4J15A 1SSOA 1O7LA 4JI2L 3BDCA 2ID0A 4KKSA 3I70A 3CRKC 4A3KG 2GA4B 3CW2C 4A3IH 3GTLB 2LFNA 2E74C 4DV3Q 1KLGD 2PI2A 1IBLQ 1K3RA 4MZ9A 1LM0A 2BCOA 2CCZA 5J1ZA 4L5TA 3FVQA 5CMDA 1EYAA 5JPMC 4RA8A 2RCNA 1K0RA 1DOMA 4C1NK 1L1OA 3DM3A 4DV2Q 4JI7L 1A3VA 1U0LA 2F0TA 3CPFA 4IPDA 4LFBL 1K8OA 2IW3A 2Y0SB 2IJ0A 4CDFC 3Q0AA 1G6ZA 3IRBA 4R1JA 1HRJA 2QKIC 3G6EA 5JEAG 2KHSA 1SMYC 1VQIA 2JA9A 1EY0A 2F0LA 2ZJQA 5C3EG 4LW1A 2DJGC 2A6EC 4R4OA 3PUXA 3J81E 3TRZA 2KQ3A 4DV7L 5LMUQ 2C9OA 4OL7A 3CCLA 2B39A 1WCMG 3J80i 4B3TL 4DV3L 3HOXH 1N34Q 1Y8PB 5CV9A 4MIUA 3ITPA 1WFQA 1JE5A 1JJGA 4B3ML 2BA1A 3MFGA 4PMCA 5GAEC 4HIOA 2KCNA 4QCLA 2Z6BA 3PIOA 4ZYSA 1FNUA 4UP8A 2RBMA 1M90C 1XPUA 2O5JC 3W1GA 1O7ZA 1ASYA 4B9WA 4DV2L 1Y69U 4DUYL 3L7ZC 4JI7Q 4GN5A 1N36L 2ZJRA 3I4MB 4KHPL 3PUVA 5GQOA 2F3VA 2WKDA 2Q8RE 3G6JB 1TWHH 3K6OA 5C5LA 1UAPA 3TDQA 2EYMA 4XXEA 3NBHA 4A3DG 3NTHA 1TY2A 1PRTB 2EDGA 4RG1A 2WV6D 5J39A 3DEPA 5ELEA 4HMIA 4IN3A 3BVZA 4K8IA 1G51A 2F0PA 2CWAA 2Y0SG 4XDXA 3J80c 2IHFA 1SYGA 4CKEA 4DR6L 4KV6A 3K7UC 4K0KL 3S2DB 4LAAA 4HJ5A 3QO2A 3S1RH 3S17B 5DM73 3C46A 1BBUA 4DR4Q 2SNSA 4QIWE 2F0SA 1YJNA 3CF5A 3S15B 2L0CA 4IUVA 1WTVA 1K0SA 4R4QA 4ZK9B 1M4VA 5FKAC 2R93H 1ML0D 2B29A 3HOUG 4A3GH 1ICWA 1SNPA 4K2LA 3M7GA 2EVBA 1WTHA 2K03A 4IUUA 1WCMH 3NSWA 2NWGA 3HOXG 4KJNA 2KEEA 5IGDA 4DR1Q 1CA6A 3AB9A 5K36H 1LTBD 4XT1B 2EYHA 2PZTA 3DXJC 1EEFD 4X65Q 1C48A 5FLXL 4GKKL 1EUJA 2DY7A 3KLSA 2B2TC 3S16B 4GZYC 3PO3H 2A6HC 2K5NA 2NYZD 4P2CB 4DR6Q 1JE4A 2C5CA 4CGYB 4K0KQ 4JPBW 4BBRG 2KHIA 4ILWA 1AZQA 3DEOA 3HOUB 1A15A 1SBBB 2K50A 3BG3A 1OXUA 3VDYA 3P20A 1OXVA 5CC4A 2K5HA 2A73B 3PO3B 2K75A 5ELDA 2HCCA 1JJ2A 4GLXA 3C3LA 2K14A 3K7AB 3H6MA 1MIUA 2MJ8A 3EJIA 1RHPA 5DNFA 1NTGA 1EWIA 4I7AA 4QGUA 1KC8C 4JOIC 1PFSA 2PQAB 3HRZC 1PZJD 1L0YB 3NTIA 2Y0SE 3GTOB 5IE8A 2IX1A 2D5DA 2XNAC 3GO5A 1TWCH 4DV6L 2F0EA 5M9OA 1QB5D 2JEBI 2F0KA 3A8JE 1VQFA 1TIID 2OWOA 1CKNB 1X3GA 5FO7B 5EJWA 1QZGA 4HJAA 1ZKOA 4AQYL 2L55A 3H0GG 5IGGA 3OIQA 5C4JH 1PFMA 5EKLA 3OHXC 4MN3A 3P75A 5T1IA 1X56A 4XTCS 3UE1A 1BDOA 4FYDA 3K5OA 5L37A 1S3OA 5CR3A 4PV1C 4QJFA 1TWCB 2DGYA 4LUVA 4OWTB 4JBJA 1YITA 1NR2A 4PZ8A 1G2SA 2NVTB 3ZJYC 1P16A 5IYBG 2A68C 5FJ8G 4A3MH 2F0QA 4HR7B 1I3QH 3CQZH 4B9XA 4IPGA 2NN6I 3KYHC 2VB2X 1XMOL 1S4ZA 2D2CC 3RZOH 4C3HH 1HR0W 1V43A 1YJ9A 3ERSX 2JA5H 3AEVA 1D5MC 1TR5A 2F52A 4TQUS 3UI2A 3CMAA 4QQBX 2IWHA 1LO5D 3HOVH 1QWYA 2OT2A 2CQOA 4KN7C 1CKNA 3G71A 4LF9L 1NJIC 2NVQH 1ZEQX 2GN5A 1MJCA 1B70B 5EQ0A 3KFUA 2EYJA 3I91A 3VYRA 2N78A 3NQIA 4B08A 2D9UA 1L2FA 3I4NG 1E22A 3EA6A 1D5XC 4Z9CB 1O7IA 5HY6A 1EYCA 5HGQA 1TY0A 4YY3L 3C2PA 1PTOH 3D4RA 1AW7A 3RMHA 3PSIA 2KJXA 4A4IA 4PG3A 1N8RC 5EBCA 1PTOD 1XJVA 4GN4B 2MQHA 2EYLA 4LF8Q 1M1KC 3OOCA 1Y8OB 1LTID 1II3A 3E5SA 4IALA 3CCJA 4O42A 1FJGL 4LUZA 2H4OA 5I2XA 3TZUA 3GTQH 3PQIA 4RGOS 1AE3A 3UDFA 1SDFA 1VQOA 2NN6G 4BBSH 1VDZA 3NELA 4EX5A 3FKIB 4L5RC 1HQMC 3VA7A 4OONA 4G7OC 1S5DD 2B2YA 3OW2A 1ESFA 2NTSA 5EBDA 2Q8TA 2Z1CA 1DJRD 1QVCA 2PQEA 5CGKA 2PMZE 4WJ3M 1QE6A 3MVVA 5IYDG 3CCRA 4LF9Q 3H94A 1EQQA 1FYCA 2X6GA
chains in the Genus database with same CATH topology
2ICIA 1A2TA 3BVGA 5CV6A 1PRTD 2B2UC 1FR3A 2EYFA 1NUCA 1ESRA 3PIP3 1Q3LA 3PIO3 5I2YA 3VR6A 3E0JA 4A3JB 4DA2A 4DK1A 3NPPA 5T1GA 1Y1WB 1LABA 4KD4A 1DONA 1BCPD 1XX8A 2VNUD 1LT4D 2K33A 3R2IA 4C2MB 3NXWA 4IUQA 4V0BA 5A2QL 3S2HB 1AEXA 1NAPA 1TS5A 5EKIA 5K5PA 1EY7A 3HS0C 2B2TA 2F0HA 4KHVA 3LWUA 4FNFA 4RGMA 4CKBA 2EE1A 1I4QA 4G57A 1SEBD 2KOLA 1KNEA 1WCMB 3NK9A 5C0XJ 5ELCA 5C3WA 5A2QE 3A54A 1EU3A 1RTNA 1JWSD 3Q23A 1K8MA 3ND8A 1A3TA 4H0LC 4CHTB 1FNVA 2EY5A 5I9OA 1Z6HA 4L8JA 1STGA 3TP8A 3TBIB 2TMPA 4JK1C 2LMCB 5M5XB 4RFBA 4QIWB 3HGBA 1J8IA 2JP1A 2EY1A 3D6WA 4TKOB 1RF2D 2B2VA 5EPJA 1DOLA 3K59A 5C4ZA 3BDLA 2NVXB 1WD1A 1CTMA 4KI0A 1M8AA 2RSNA 3HG9A 1CM9A 1S5FD 4CBVA 1Z47A 4HMJA 1B4OA 1CZWA 4KN4C 2F4IA 2PW7A 1JOQA 4QB4A 1OXSC 1MSGA 2BE5C 1PDQA 1VMPA 2L4NA 3R8BA 1OXXK 1B9NA 1SNMA 4XYOA 3SDZA 4N9TA 3TP5A 3FMCA 1O7YA 3X3MA 1EYDA 2WIIB 1XTCD 3F2UA 1CA5A 2L5TA 4X3KA 4LJZC 1O80A 4ME5A 3KF8A 3NBIA 3C1EA 3T56B 2B8GA 3CRLC 3MAQA 5C0XH 1JOOA 2NZ1D 3MZ5A 3QG1A 1MGSA 2F0JA 2PMZB 1BXTA 1B3AA 1BUVT 1H9JA 1PRTC 4R8IA 4CJ1B 1SYFA 3EQLC 3KBGA 1QOHA 3T13A 2B2WA 4KMUC 4XQQA 3HOYB 1B9MA 3M7NA 5JEAJ 4HSVA 2NUCA 3PUZA 1GOZA 1SYEA 2EYOA 3SK8A 3K57A 1H9MA 2N55A 1MD2D 2AUKA 5C3XA 2K5QA 1TWFB 5LL6S 1IYVA 3QJYA 4XIGS 3FDTA 1IKLA 2B2UA 4H7BA 2CHBD 3BS1A 1U9RA 3OWEB 5EKKA 3K5MA 2VXWA 4C3JG 4FO2A 1A3UA 2D62A 3TMEA 1A6XA 4LMQD 3J80L 3DMUA 4FF2A 1GJXA 1STNA 2I07B 3GP7A 3FPUB 1GUSA 2K04A 1TU2B 1I50B 2L1BA 3MC0B 2XVSA 5C4HA 4RKBA 3J7AF 5C4JB 4K5VA 4K6LA 3A8IE 2NN6H 4NP5A 4OHJA 1SYDA 1WTWA 3K58A 2K32A 1CQFA 4HCEA 5E3FA 1EY6A 1NCVA 1VCIA 1C4QA 2ICEC 5IGCA 5ELBA 1Q8IA 2WKCA 1PTOF 2NVQB 1ILPA 1XYIA 5EPKA 1U4LA 4K8JA 4HAEA 4F87A 4ODGA 4RAUC 5E1FA 4O1NA 1RJTA 2JA5B 3NP8A 1JB3A 1SE3A 2EXZA 1K83B 5I4DA 1GUTA 4C3JB 2AWOA 1H9RA 2F0FA 4M8AA 2EJMA 1EY4A 3CQZB 2DY8A 2BOSA 2ENBA 4OGQC 2YU9B 5M5WB 3TZDA 3MA2B 2PNRC 4J1MA 1Q1EA 1DOKA 1VF5C 1GUWA 1WTOA 5C5MA 4J6HA 1ET6A 4ZKBB 4X3UA 3DM1A 2ZXOA 1IW7C 3GV3A 3IKJA 2FJ2A 4ZKCB 5EPLA 1KDBA 2DN8A 2VUMB 3V96A 4L6TB 1HUNA 4QMGA 4KD3A 4HSPA 3HP3A 4BBRB 4EVOA 3D4DA 4FF3A 3OWFA 5A35A 4FF4A 3HEJA 5KGUA 1HCZA 2EY6A 3MFYA 3S14B 3Q22A 3NWTA 3P7JA 1F2ZA 2OF1A 3BYTB 3R93A 1WTXA 2OEOA 1PXUA 2JSOA 4WRDA 5D3IB 3V05A 1JORA 2K01A 1STYA 1ZYRD 2JA8B 3GTKB 5C6AA 4BA2I 1JWMD 1W6JA 2IX3A 1QCBD 2XRQD 5J22A 2KA7A 3HOZB 1NR4A 4ZUIA 2KEDA 1RD9D 1EY8A 1HTLD 5JEAH 5CORA 1TVXA 1LTRD 1Y1VB 3MXGA 1NSNS 3VYTA 5IOCA 2CVRA 3BVMA 2IT1A 3PO2B 4LK1C 1X3QA 3J81L 3SK6A 1EY5A 3A8KE 1BR9A 5CBEE 5KRUA 1LTTD 5LL6X 2SDFA 2PYKA 1CK1A 1D6EC 4DXFA 4K6DA 2R93B 2HDLA 2KECA 5TSSA 4IQZA 1MI2A 1D2BA 1IW7D 1S5ED 5ELFA 5IGFA 2QEJC 2E76C 4KJOA 3I3CA 4NMZA 1F9QA 1JOKA 5BN4A 5DEHA 1FGBD 2K1BA 1LTAD 3J80E 2E2DC 5G3LF 4F7XA 4H13C 2F1MA 2PPBC 5I6WA 1U4RA 1STBA 1EIHA 5HURA 5E4WC 1IYUA 4PMBA 5F2DA 2I46A 2AUJD 4M1UB 1AFPA 5KEEA 3T4AC 2RVLA 4TRDA 1BO0A 2JA6B 2KCCA 5D65A 3GV6A 3U9OA 1LT3D 1EZ8A 4XT3B 5ISRA 1QG7A 5C0XG 3I73A 3M4YA 1I4HA 2LY7A 1LV9A 2Q8IB 1HUMA 3K5LA 5KNDA 1TWAB 2R61A 5KIXA 1AZPA 4DNTB 4KY6A 3TSSA 1V8QA 5BN5A 1BBXC 3OSOA 2RDFA 2X6LA 1LACA 3KLRA 3QOJA 1I6HB 4A3DB 3GTMB 1TT2A 3OIPA 1YNJC 2AWNA 5CYUA 5IGEA 1DYQA 2NTTA 1SNCA 1H9KA 3W3AA 1WVLA 5CV7A 4XQJA 2BE5D 2IX0A 1AP0A 2MGSA 1SMYD 4KKUA 3A56A 1F9RA 3X3NA 4RHSA 2J7ZA 3DUZA 1B50A 3W2DA 2R92B 1L0XB 2MPMA 2F0MA 4IFDG 3J7YW 4A93B 5IODA 3MEHA 2JA7B 3HKZB 5DAUA 1EQTA 4HTHA 4EGVA 4A3IB 4A3BB 4DXGA 3MXPA 1VMCA 1F9SA 4UDUC 2BDOA 1LT6D 2ZXPA 1Y8NB 1MBYA 4OIJA 3PUYA 1HHVA 4RWSC 4DU9A 3RUZA 2MP1A 1BNZA 1CFMA 5JAVA 3FPPA 2B63B 3WDNA 2FMCA 1E0BA 5DM63 1V1PA 3OW7A 4C3IB 2SOBA 4WORA 2RA4A 1CT1D 4K2KA 4NKLA 2JEAI 2Z8LA 1IKMA 3LX0A 2J0TD 1PMRA 1KLUD 2O5IC 1FD7D 1LT5D 3D3RA 2A69D 3K0YA 2AQ3B 4BY7B 1E2WA 1TQOA 3C1FA 4KY7A 1DD2A 1HTPA 2XRSD 3I72A 2RKSA 1RTOA 1SJHD 1WTQA 4F8MA 2A68D 3BYYB 2HQEA 4QF4A 5JVG3 3LWEA 1EL0A 4OIKA 3DWAA 3R2TA 2F0IA 1DZ1A 1I4RA 2A6ED 4K5XA 2B2WC 1Q90A 1FNWA 3L3OC 4N9PA 4DFAA 3TP7A 3NE5B 3SK4A 3IAYA 1BOSA 3AU7A 3RZOB 4UAIA 4WFN3 4RKLA 1JC7A 1D1KA 1GXDC 4R9WA 1EEID 1R4PB 2KVMA 4PNYA 1KDCA 3A7AB 4KHZA 1V1PB 4X3SA 1I4XA 1S5BD 3S9WA 3VYUA 2L12A 4ZQ3A 2WINB 1PLFA 5CV4A 2QILA 4C3IG 3MXUA 2K7VA 2HUGA 3DHQA 4H44C 2ZXRA 3H09A 3QIAA 4S3SA 4RH6A 1X32A 2V4DA 2J4XA 1J9OA 2WB1B 3V2TA 1STHA 4A3EB 3FRPB 2JXMB 4BWGB 2A6HD 3M85A 2MHVA 4U68A 2E2HB 4C1NI 4OO1H 3QWNA 2EOTA 2LS01 2KUMA 4IUTA 3SXHA 1YNJD 3JAML 3ERQA 5NUCA 4C3HB 2L9HA 4E6IA 2QF7A 1GHJA 1SE4A 4ZRZA 2K28A 4FVMA 4IUNA 3GQBA 4NDXA 2BDNA 1YNNC 5JJZA 3SVMA 4AYBB 1I4GA 2NVYB 2LKVA 2CQAA 1G91A 1TWGB 3H0GB 2B2YC 5KYIA 3URYA 3N6RA 5M3FB 2F0GA 2F0DA 4ZLTF 2PO4A 1GUGA 5HGTA 4QUCA 2E2JB 3PUWA 2RSOA 2R3ZA 3S1RB 1DM0B 1EZ6A 2JYOA 1SYBA 5G3LD 2OXPA 1KAAA 4FXDA 2EYPA 3QB3A 1EWCA 4PQXA 1W6KA 4L63B 5E4XA 3U9SA 4IUPA 1F77A 1ET9A 1KDAA 2WAQB 3ONAB 3ZYYX 3M4OB 2F0VA 2FFKB 1EFID 1X3PA 1O78A 2SNMA 1G2TA 4NW2A 1IL8A 1OXTA 2M2LA 4FXKC 1DXMA 2QCPX 4RCNA 1QILA 1TWHB 5C0XI 4WJWA 1OO9B 3RZDB 1EWHA 4MHEA 3I4NB 1ZYRC 1LTSD 4DAVA 4CJ2C 4F88A 1EU4A 3VR4A 4IFDH 4I7ZC 4C56C 2AQ1B 1B44D 5FLXE 4V190 3E6ZX 1E2VA 3D31A 1UNSA 3H91A 2MUYA 4RGNA 4YIJA 3GD7A 3IFDA 1HA5A 4KTAA 4J8QA 3Q24A 5IIFA 2TSSA 1RODA 2M9VA 2FHTA 2XIWA 1BCPF 2E2IB 5CBAE 2RQXA 1F2YA 4Q5VA 3VR3A 4R8NA 2DNCA 3GTGB 1EIGA 1BCPB 1I4PA 1MSHA 2R7ZB 2PW5A 2PCFB 4EQPA 4A3FB 2A69C 1HXYD 5CV8A 2X69A 4BA1I 1XXGA 1GHKA 1BQQT 5FOBB 2EPBA 3KUPA 1HQRD 1A2UA 1TS3A 3EVQA 1VF7A 1EQVA 3O13A 3VR2A 1CHPD 4XYQA 1D1IA 3EFXD 2NB0A 2EZVA 2G9HD 5C44B 1U4PA 2F0WA 2HDMA 4TSSA 4HEDA 1BF4A 3BDOA 3PMFA 1WTRA 2R6GA 3L9AX 3WOFA 5I6YA 1F9PA 4FXGC 4G7ZC 1E2ZA 4ID6A 1R9TB 1GUOA 4DGZA 1AN8A 4CJ0B 1UEAB 1SXTA 3DWQA 1SAPA 1LLRD 3SEBA 5M5YB 1ZXTA 1WTPA 2F03A 2E75C 3NUCA 3GTQB 4ZAIA 3NTKA 4CKCA 2XN9C 3TP6A 1PZID 2PZWA 3OPOA 5COYA 1ONLA 3P1HA 1EOTA 4G7HC 1Q12A 1PTOC 4ABNA 4IFDJ 1CQVA 1WD0A 2K5WA 2K05A 1G8ZD 3VA5A 1JR0D 5KNBA 3AMUA 5KYLA 3MHBA 2Z4HA 2WACA 4RCOA 1Q1BA 2AQ2B 1JQYD 1KTKA 4BBSB 1SNOA 4K14A 1STAA 1YNND 3SHLA 1H9SA 2WP8J 3JAME 3D6CA 1B53A 3PV0A 4HCSA 1I3QB 3MXNA 1IHZA 3D8GA 5EGTA 3IL8A 1B1ZA 2A74C 2N88A 1SFOB 1T5EA 4FP5D 1SNQA 4DN4M 4ZUJA 3K5NA 4K5WA 1CHQD 4OO1G 1RDPD 3BZDB 5FK9C 1HA6A 2BA0A 5LHY1 2ZT9C 1V1OA 2RDGA 3OMCA 2M00A 1JWUD 4KK7A 2EY2A 1ENCA 4OO1I 1QNKA 1TS2A 3SR1A 4Y7NB 1KABA 4U673 1Z7TA 4G4KA 5BN3A 2G9DA 3M3YB 4KKTA 3MTSA 4A3MB 5AFWA 4HN7A 2FINB 3S1NB 1PZKD 2A5HA 1G291 4BY1B 3QOLA 1I6VC 5JVH3 3LNNA 3A7LA 4IFDI 2IPKD 5JPNC 1S5CD 2SEBD 2HCIA 5CV5A 3S1MB 3N52A 3GTJB 4X3TA 1RKNA 1KNAA 2CW0C 4ULLA 2XWBB 1CI3M 2VB3X 2YYZA 4IZ8A 2EJFC 2NBFA 3VR5A 5D14A 1TKWB 3CU7A 4EQNA 1PYWD 2XSCA 2Z4IA 3TN2A 3CKIB 3NHHA 2O2LD 3OMGA 5I9PA 4FF1A 2K6AA 1BCPC 3NWSA 2F0OA 3J7AV 5K36G 4QUFA 2IL8A 3NQTA 3GTPB 4BS9A 5C3EB 1DCZA 4I65A 1F2LA 1B2TA 3R3OA 1HFNA 2F0UA 1JCKB 2O4XA 3EROA 2DNEA 3HOWB 4Q0FA 2QDBA 4DK0A 1D5ZC 1GUNA 3KLSX 1PFNA 4RHRA 1TS4A 1LTGD 3CHBD 1UUPA 2L11A 3D4WA 2JE6I 4JBWA 2F0NA 3T51B 3I8ZA 1SE2A 1ENAA 3VYSA 3RD4A 1XWEA 3HOXB 4RGTA 3DWPA 4A3GB 3T16A 3IFTA 5IT9E 3MWYW 1F2MA 4A3KB 1ILQA 1PRTF 4EQOA 1CZGA 5JOBA 4DF7A 4C3HG 5FO8B 5M3MB 2PZUA 1SYCA 1PFBA 2H1EA 5KNCA 4DAPA 1EY9A 2FMMA 2RDHA 1T5XD 1C8CA 1QNUA 3I4LA 2B2VC 2F3WA 3FEWX 1SJED 1R4QB 3G7LA 4IURA 2XWJB 3HZXA 4DAYA 1H9SB 1SNDA 2EJGC 2K5DA 5IT9L 4DNRB 3H3VC 3I90A 3SE0A 4KY5A 3HOVB 1PTOB 2B8FA 3WOEA 4XQNA 3T53B 2CW0D 1JICA 1QJOA 3RLFA 4PMWA 5IGBA 1ENFA 1U4MA 1HFGA 3KBXA 5FO9B 5D3DA 3KK7A 3Q6SA 1RCVD 5C4XB 3A55A 3S1QB 3ND9A 1HPCA 3SK5A 1STEA 1SSOA 1O7LA 3BDCA 2ID0A 4KKSA 3I70A 3CRKC 2GA4B 3GTLB 2LFNA 2E74C 1KLGD 2BCOA 5J1ZA 3FVQA 5CMDA 1EYAA 5JPMC 4RA8A 1DOMA 4C1NK 1A3VA 2F0TA 1K8OA 2IW3A 2Y0SB 2IJ0A 3Q0AA 1G6ZA 1HRJA 2QKIC 5JEAG 2KHSA 1SMYC 1EY0A 2F0LA 2A6EC 3PUXA 3J81E 2KQ3A 2C9OA 4OL7A 2B39A 1Y8PB 5CV9A 4MIUA 3ITPA 2BA1A 3MFGA 4PMCA 2KCNA 4QCLA 4ZYSA 1FNUA 2RBMA 2O5JC 1O7ZA 4B9WA 1Y69U 3L7ZC 3I4MB 3PUVA 2F3VA 2WKDA 2Q8RE 3G6JB 3K6OA 5C5LA 1UAPA 3TDQA 2EYMA 4XXEA 3NBHA 3NTHA 1TY2A 1PRTB 2EDGA 2WV6D 5J39A 3DEPA 5ELEA 4HMIA 4IN3A 3BVZA 4K8IA 2F0PA 4XDXA 1SYGA 4CKEA 4KV6A 3S2DB 4LAAA 3QO2A 3S17B 5DM73 3C46A 2SNSA 2F0SA 3S15B 2L0CA 4IUVA 1WTVA 4ZK9B 1M4VA 5FKAC 1ML0D 1ICWA 1SNPA 4K2LA 3M7GA 2EVBA 2K03A 4IUUA 3NSWA 2NWGA 4KJNA 2KEEA 5IGDA 1CA6A 3AB9A 5K36H 1LTBD 4XT1B 2EYHA 2PZTA 3DXJC 1EEFD 1C48A 5FLXL 2DY7A 3KLSA 2B2TC 3S16B 4GZYC 2A6HC 2NYZD 4P2CB 1JE4A 2C5CA 4CGYB 4ILWA 1AZQA 3DEOA 3HOUB 1A15A 1SBBB 3BG3A 1OXUA 3P20A 1OXVA 5CC4A 2A73B 3PO3B 5ELDA 2HCCA 3C3LA 3K7AB 3H6MA 2MJ8A 3EJIA 1RHPA 5DNFA 3HRZC 1PZJD 1L0YB 3NTIA 3GTOB 2IX1A 2D5DA 2XNAC 3GO5A 2F0EA 5M9OA 1QB5D 2JEBI 2F0KA 3A8JE 1TIID 5FO7B 5EJWA 1ZKOA 2L55A 5IGGA 3OIQA 1PFMA 5EKLA 3OHXC 4MN3A 3P75A 5T1IA 4XTCS 1BDOA 4FYDA 3K5OA 5CR3A 4PV1C 1TWCB 1NR2A 1G2SA 2NVTB 2A68C 2F0QA 4HR7B 4B9XA 2NN6I 2VB2X 1S4ZA 2D2CC 1V43A 1D5MC 1TR5A 4TQUS 3UI2A 2IWHA 1LO5D 1QWYA 2OT2A 4KN7C 1ZEQX 5EQ0A 2EYJA 3I91A 3VYRA 3NQIA 4B08A 2D9UA 3EA6A 1D5XC 4Z9CB 1EYCA 1TY0A 3C2PA 1PTOH 3D4RA 1AW7A 3RMHA 2KJXA 5EBCA 1PTOD 2EYLA 3OOCA 1Y8OB 1LTID 1II3A 3E5SA 4IALA 4O42A 5I2XA 2H4OA 3TZUA 4RGOS 1SDFA 2NN6G 1VDZA 3FKIB 1HQMC 3VA7A 4G7OC 1S5DD 2B2YA 1ESFA 2NTSA 5EBDA 2Q8TA 2Z1CA 1DJRD 2PQEA 5CGKA 1QE6A 3MVVA 3H94A 1FYCA 2X6GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A3V A;  1F2M A;  1KDA A;  5IOC A;  1A2T A;  2F0F A;  2F0T A;  5IGE A;  3P75 A;  3LX0 A;  5CV6 A;  2F0V A;  1EY4 A;  5C3X A;  5IGB A;  4S3S A;  4EQO A;  1SNC A;  2EYF A;  4HMJ A;  3VA5 A;  5CC4 A;  2ENB A;  1SNP A;  5CV7 A;  5JOB A;  3SK6 A;  4DF7 A;  4K2L A;  5KYL A;  1EY5 A;  1NUC A;  5CV5 A;  3V2T A;  3MHB A;  5CR3 A;  1STH A;  1A2U A;  2SNM A;  3EVQ A;  2WAC A;  5KRU A;  1RKN A;  4H7B A;  1EQV A;  2PZU A;  1SYC A;  1TQO A;  3C1F A;  2KHS A;  2PYK A;  2PW7 A;  4J1M A;  1JOQ A;  1EY0 A;  2F0L A;  4QB4 A;  1U9R A;  1SNO A;  2F0Q A;  4KJN A;  4KY7 A;  5IGD A;  4IZ8 A;  4K14 A;  1STA A;  4J6H A;  2KQ3 A;  5EKK A;  4K6D A;  5C5M A;  1EY9 A;  4B9X A;  5CV8 A;  2RKS A;  4KD4 A;  3SHL A;  2F0M A;  1SNM A;  2EYH A;  2PZT A;  3SXH A;  2F3W A;  3D6C A;  1A3U A;  4OL7 A;  5IOD A;  3TME A;  3MEH A;  4EQN A;  2F0W A;  4F8M A;  1IHZ A;  3D8G A;  3DMU A;  3ERQ A;  3NHH A;  5EGT A;  4N9T A;  3HZX A;  1TR5 A;  5NUC A;  2HQE A;  3OMG A;  3TP5 A;  5DAU A;  1SNQ A;  4QF4 A;  1KDB A;  4HTH A;  3NXW A;  5I9P A;  5IGF A;  3PMF A;  4ZUJ A;  5CV9 A;  4E6I A;  4MIU A;  3ITP A;  4KJO A;  1SND A;  1AEX A;  4NMZ A;  5ISR A;  1EYD A;  4K5W A;  5I6Y A;  4QMG A;  2F0O A;  4PMC A;  2F0I A;  1STN A;  4IUN A;  1EY7 A;  4KY5 A;  1JOK A;  5K5P A;  2F0H A;  4ID6 A;  4KD3 A;  3NQT A;  4KHV A;  5DEH A;  4NDX A;  4K5X A;  2EYJ A;  3D4D A;  4EVO A;  4F7X A;  2RBM A;  4N9P A;  4I65 A;  3R3O A;  4G57 A;  4DGZ A;  2F0U A;  3MXP A;  3OWF A;  4ME5 A;  3TP7 A;  4B9W A;  1STB A;  4DFA A;  5C4H A;  2LKV A;  2O4X A;  3C1E A;  3ERO A;  4RKB A;  3HEJ A;  3OMC A;  3SK4 A;  5HUR A;  2EY6 A;  5KGU A;  4K5V A;  2F3V A;  4PMB A;  1JOO A;  2QDB A;  3NK9 A;  2M00 A;  5F2D A;  3MZ5 A;  5C3W A;  1F2Z A;  1EYC A;  2OF1 A;  5KYI A;  3H6M A;  2F0J A;  5C5L A;  2EY2 A;  3EJI A;  1ENC A;  4NP5 A;  2EYM A;  2F0G A;  2F0D A;  2OEO A;  4RKL A;  4YIJ A;  1SYD A;  5KEE A;  3SR1 A;  1KAB A;  4TRD A;  4WRD A;  5HGT A;  5J39 A;  2EYL A;  3U9O A;  4HMI A;  3NUC A;  1A3T A;  5E3F A;  1EZ8 A;  4DU9 A;  1JOR A;  1EY6 A;  1II3 A;  1STY A;  3RUZ A;  1SYF A;  4KTA A;  3E5S A;  3SK5 A;  1EZ6 A;  4IAL A;  3D4W A;  5I6W A;  4PNY A;  2EY5 A;  4K8I A;  5IIF A;  5I9O A;  2F0E A;  1KDC A;  5JAV A;  1SYB A;  2F0P A;  2OXP A;  5IGC A;  2F0N A;  5C6A A;  3BDC A;  1STG A;  1KAA A;  3T13 A;  3TP8 A;  5M9O A;  2F0K A;  3TP6 A;  1F2Y A;  1SYG A;  3S9W A;  2PZW A;  4K8J A;  1ENA A;  2EYP A;  3QB3 A;  5J22 A;  4ODG A;  3P1H A;  4R8N A;  4KV6 A;  2NUC A;  2SOB A;  4WOR A;  4ZQ3 A;  5J1Z A;  5KIX A;  1SYE A;  4KY6 A;  4LAA A;  5E1F A;  1EYA A;  4ZUI A;  5IGG A;  2PQE A;  3NP8 A;  2EY1 A;  5CGK A;  2EYO A;  2PW5 A;  2SNS A;  3OSO A;  5CV4 A;  3QOL A;  4EQP A;  1EY8 A;  2RDF A;  3MVV A;  5C4Z A;  2F0S A;  3BDL A;  2EXZ A;  4K2K A;  3QOJ A;  3SK8 A;  4NKL A;  3T16 A;  5EKL A;  1TT2 A;  3DHQ A;  1NSN S; 
#chains in the Genus database with same CATH topology
 2ICI A;  4OX9 L;  1A2T A;  1E3P A;  3BVG A;  5CV6 A;  1PRT D;  2B2U C;  1FR3 A;  2EYF A;  4X62 L;  1NUC A;  1ESR A;  2KBN A;  3PIP 3;  4JG2 A;  4YY3 Q;  1K9M C;  2UXC L;  1Q3L A;  2KHJ A;  3PIO 3;  5I2Y A;  3VR6 A;  1Y1W H;  4JC0 A;  3E0J A;  4PZ7 A;  3HOV G;  4A3J B;  4DA2 A;  1XTD A;  1MKH A;  4DK1 A;  2C35 B;  3NPP A;  5T1G A;  3FKI G;  1Y1W B;  2R7D A;  2QW7 A;  1LAB A;  4KD4 A;  3S24 A;  3K0X A;  1DON A;  2RHQ B;  4AH6 A;  1BCP D;  1XX8 A;  4A3F G;  1A8V A;  2VNU D;  1LT4 D;  4LUO A;  2K33 A;  2OTL A;  3R2I A;  4C2M B;  3NXW A;  4IUQ A;  5C3E H;  4V0B A;  5A2Q L;  3S2H B;  1AEX A;  1NAP A;  1TS5 A;  5EKI A;  5K5P A;  3J81 c;  1EY7 A;  3CCS A;  2HIV A;  3HS0 C;  2B2T A;  2F0H A;  1T9H A;  4KHV A;  3QR8 A;  3LWU A;  4FNF A;  4RGM A;  4CKB A;  2EE1 A;  1I4Q A;  4CDC C;  2WAQ G;  4G57 A;  1VQH A;  2ZTE A;  1HNZ Q;  1SEB D;  2KOL A;  1KNE A;  1WCM B;  3NK9 A;  5C0X J;  1SE8 A;  1EFW A;  5ELC A;  5C3W A;  1HNX Q;  5A2Q E;  4A3J G;  4X62 Q;  3A54 A;  1EU3 A;  1QUQ B;  1QUQ A;  1RTN A;  1JWS D;  1I6H H;  3Q23 A;  2AHO B;  1K8M A;  3ND8 A;  1A3T A;  1VQA A;  4H0L C;  4CHT B;  3S1M H;  2JA8 G;  1FNV A;  2EY5 A;  5I9O A;  1Z6H A;  4GNX A;  4L8J A;  4DPG A;  1STG A;  3TP8 A;  3TBI B;  2TMP A;  4JK1 C;  5M3F H;  2LMC B;  4IO9 A;  5M5X B;  4RFB A;  2YV5 A;  4JW0 A;  4QIW B;  3HGB A;  3RN2 A;  4DK3 C;  4DR3 Q;  5EAY A;  1J8I A;  2K5V A;  1IXR A;  3KDF B;  2JP1 A;  2EY1 A;  3D6W A;  4TKO B;  1RF2 D;  2B2V A;  5EPJ A;  1WYD A;  1DOL A;  4DUZ Q;  3K59 A;  5C4Z A;  2A1A A;  3BDL A;  2NVX B;  1WD1 A;  1CTM A;  4KI0 A;  1M8A A;  2RSN A;  3HG9 A;  1Y1W G;  1CM9 A;  1S5F D;  4CBV A;  2UXB L;  1Z47 A;  4HMJ A;  2HHH Q;  1B4O A;  5DLQ E;  1KD1 C;  1CZW A;  4AYB G;  4KN4 C;  2F4I A;  2PW7 A;  1JOQ A;  2LXK A;  4QB4 A;  1OXS C;  1MSG A;  1I94 L;  4YCW A;  1X9N A;  3BU2 A;  2BE5 C;  1PDQ A;  1GD7 A;  1VMP A;  2L4N A;  3R8B A;  1OXX K;  4JBM A;  1B9N A;  1SNM A;  1IBK L;  4XYO A;  4JI3 L;  3SDZ A;  4N9T A;  3TP5 A;  2N8N A;  3FMC A;  3RNU A;  3NBH B;  1O7Y A;  3X3M A;  3H3V I;  1EYD A;  2WB1 G;  2WII B;  1XTC D;  3HOY G;  4JI8 Q;  3F2U A;  1CA5 A;  2L5T A;  4X3K A;  1JB7 A;  4ME3 A;  4LJZ C;  3U4V A;  1O80 A;  4GLA C;  4ME5 A;  2RHS B;  3KF8 A;  3NBI A;  2IY5 B;  2JA7 G;  3C1E A;  3T56 B;  2B8G A;  3PO3 G;  3CRL C;  3MAQ A;  4BY1 G;  5C0X H;  1JOO A;  2NZ1 D;  2UXB Q;  3MZ5 A;  2D0O A;  3QG1 A;  1YZ6 A;  1MGS A;  3W5O A;  1L1O C;  2A19 A;  2F0J A;  2PMZ B;  5IP9 H;  1BXT A;  2QDL A;  1GVP A;  5M3F G;  2PI2 E;  1B3A A;  1BUV T;  1H9J A;  1PRT C;  4R8I A;  4C2M H;  4CJ1 B;  4DV0 L;  4NXN Q;  2E5L Q;  1SYF A;  3EQL C;  2R7Z G;  1QVG A;  5M5W H;  3KBG A;  1QOH A;  3T13 A;  4JI4 L;  3JAM c;  1YHB A;  2B2W A;  3CCV A;  4KMU C;  4L5S A;  4OEM B;  4XQQ A;  4X64 L;  3HOY B;  5LMN W;  1B9M A;  2PQA A;  3M7N A;  5JEA J;  4HSV A;  2NUC A;  3PUZ A;  1IYJ B;  4APV A;  1GOZ A;  1SYE A;  4LWC A;  2EYO A;  3SK8 A;  3K57 A;  2EXD A;  4JI8 L;  4OXP A;  5FJ8 H;  4A3M G;  4POF A;  4B3S Q;  1H9M A;  2N55 A;  1MD2 D;  2AUK A;  5C3X A;  2K5Q A;  4UP7 A;  1Y1V G;  1TWF B;  5LL6 S;  1PH1 A;  1IYV A;  3QJY A;  4XIG S;  3FDT A;  1IKL A;  1D7Q A;  2B2U A;  4H7B A;  2CHB D;  3BS1 A;  1J6Q A;  1U9R A;  3WWV A;  2UUA Q;  3CCQ A;  4JV5 L;  1RIP A;  3OWE B;  5EKK A;  4IOA A;  1PH2 A;  3HOY H;  3K5M A;  4GOP C;  1PH7 A;  2E5L L;  1X6O A;  2VXW A;  4C3J G;  3BJU A;  4FO2 A;  1A3U A;  2D62 A;  2JQO A;  3TME A;  1A6X A;  4LMQ D;  3ULJ A;  4BY7 H;  3J80 L;  3DMU A;  4MTN A;  4FF2 A;  4X64 Q;  1GJX A;  3KDF A;  3K8A A;  1STN A;  2I07 B;  3GP7 A;  3FPU B;  1GUS A;  4JI6 L;  2K04 A;  1JMC A;  3ER0 A;  1Q7Y C;  1TU2 B;  1I50 B;  2L1B A;  3I7F A;  2JA5 G;  3MC0 B;  2XVS A;  2CWP A;  4RKB A;  5C4H A;  3J7A F;  5C4J B;  2R7F A;  4K5V A;  4K6L A;  3A8I E;  1D8L A;  2NN6 H;  4NP5 A;  2BH8 A;  4OHJ A;  1SYD A;  4N8F A;  2A8V A;  3PCO B;  1WTW A;  3K58 A;  2K32 A;  1CQF A;  4HCE A;  5E3F A;  3I4N H;  1EY6 A;  1NCV A;  1VCI A;  1C4Q A;  2ICE C;  5IGC A;  1E1T A;  1Q8I A;  5ELB A;  3KLW A;  4N8X 1;  2WKC A;  1PTO F;  3PIP A;  2NVQ B;  2I5M X;  1ILP A;  3TQY A;  1XYI A;  5EPK A;  1U4L A;  4K8J A;  4HAE A;  1AH9 A;  4F87 A;  4ODG A;  1PYS B;  4RAU C;  5E1F A;  4O1N A;  1RJT A;  3K7A H;  2N3S A;  1X3E A;  2JA5 B;  3NP8 A;  1IZ6 A;  1JB3 A;  1SE3 A;  1V9P A;  2EXZ A;  1K83 B;  5I4D A;  1GUT A;  3AQQ A;  4C3J B;  2AWO A;  1H9R A;  2F0F A;  4M8A A;  2EJM A;  1EY4 A;  3CQZ B;  2DY8 A;  2N49 A;  4DV1 Q;  2BOS A;  2AMC B;  1K73 C;  2ENB A;  4OGQ C;  2YU9 B;  4A3F H;  5M5W B;  2YTX A;  3TZD A;  1SLJ A;  4BY7 G;  3MA2 B;  2ZJP A;  2PNR C;  1K3B C;  4J1M A;  1Q1E A;  1DOK A;  4LF6 L;  4A3B G;  1VF5 C;  4LNQ A;  1WTO A;  1GUW A;  1BBW A;  4J6H A;  5C5M A;  2VQF Q;  1ET6 A;  2KCM A;  4GN3 B;  4ZKB B;  4X3U A;  1YHA A;  3DM1 A;  3HKS A;  5M5Y H;  2UUB L;  2ZXO A;  1DGS A;  1KL9 A;  2Z6K C;  2F4V L;  1UE6 A;  4YWM A;  1IW7 C;  3GV3 A;  1HNW L;  3IKJ A;  2FJ2 A;  4ZKC B;  1HJP A;  5EPL A;  1KDB A;  4JOI A;  2DN8 A;  2VUM B;  3V96 A;  4L6T B;  1HUN A;  4QMG A;  2H5X A;  1KAW A;  4KD3 A;  4HSP A;  3T1Y Q;  3HP3 A;  4BBR B;  4EVO A;  3D4D A;  3LGJ A;  4DV4 L;  4JI2 Q;  4FF3 A;  3OWF A;  5A35 A;  3F2B A;  4FF4 A;  5FLX c;  3HEJ A;  5KGU A;  1HCZ A;  2EY6 A;  1IBL L;  3MFY A;  3S14 B;  3Q22 A;  4GKJ L;  2VY3 A;  3NWT A;  3P7J A;  1F2Z A;  1UE1 A;  1XNQ Q;  2OF1 A;  3BYT B;  1X3F A;  3CCM A;  3GTL H;  3R93 A;  1WTX A;  2OEO A;  1PXU A;  3A5U A;  4UP9 A;  5IYC H;  2JSO A;  4WRD A;  4X6A H;  4H02 A;  5D3I B;  3V05 A;  2B63 H;  1JOR A;  2K01 A;  1STY A;  4OWW B;  1ZYR D;  2OTJ A;  2VQF L;  2JA8 B;  3GTK B;  4LF4 L;  1VQ8 A;  1TWF H;  4GS3 A;  5C6A A;  1HZB A;  4BA2 I;  1JWM D;  1W6J A;  2IX3 A;  3A74 A;  1QCB D;  2XRQ D;  4BXX G;  1HNW Q;  5J22 A;  1CSQ A;  2L15 A;  2KA7 A;  3HOZ B;  1NR4 A;  4ZUI A;  3KF6 A;  3M3Y H;  1A63 A;  1YI2 A;  2JA8 H;  2KED A;  1RD9 D;  1EY8 A;  1HTL D;  5JEA H;  5COR A;  1TVX A;  1LTR D;  3CME A;  2V1C C;  3UDX A;  1Y1V B;  3EN2 A;  3MXG A;  3HFZ B;  1NSN S;  3VYT A;  5IOC A;  3T1Y L;  2QA4 A;  1C0A A;  2CVR A;  3BVM A;  5IWA Q;  2IT1 A;  3PO2 B;  4LK1 C;  1X3Q A;  3J81 L;  4B3T Q;  3SK6 A;  4DR7 L;  1EY5 A;  1L1O B;  3A8K E;  1RL2 A;  4GKJ Q;  2UU9 Q;  1BR9 A;  5CBE E;  5KRU A;  4B3M Q;  1QVF A;  1XNQ L;  1LTT D;  5LL6 X;  2SDF A;  2IHE A;  2PYK A;  2VS1 A;  3I4O A;  4P71 A;  1CK1 A;  1D6E C;  4DXF A;  4K6D A;  2R93 B;  1FGU A;  1UWV A;  2HDL A;  4DUY Q;  1BKB A;  2KEC A;  4LF4 Q;  5TSS A;  4IQZ A;  1MI2 A;  1D2B A;  1IW7 D;  1S5E D;  1VQN A;  1N32 Q;  5ELF A;  5IGF A;  5C44 H;  3I55 A;  2QEJ C;  2E76 C;  4KJO A;  3I3C A;  2MNA A;  3PO2 H;  4NMZ A;  1F9Q A;  1JOK A;  5BN4 A;  5DEH A;  1FGB D;  4MTK A;  2K1B A;  1LTA D;  2ZTD A;  3D0F A;  3J80 E;  4LFA L;  2E2D C;  5G3L F;  4F7X A;  4H13 C;  2F1M A;  2PPB C;  5JJK A;  5I6W A;  1U4R A;  1STB A;  1A0I A;  1EIH A;  5HUR A;  5E4W C;  1VQ6 A;  5IWA L;  5C4X H;  1IYU A;  4PMB A;  1CKM A;  1SN8 A;  5F2D A;  3EIV A;  2I46 A;  2AUJ D;  4M1U B;  4DR7 Q;  3HOZ G;  2Q2H A;  1AFP A;  5KEE A;  3T4A C;  2RVL A;  4TRD A;  1EIY B;  1BO0 A;  4JI0 L;  2JA6 B;  1VQG A;  2KCC A;  5D65 A;  3GV6 A;  3U9O A;  1LT3 D;  1EZ8 A;  4GOP B;  4A93 H;  4XT3 B;  5ISR A;  1QG7 A;  5GAH C;  3RLO A;  2CFM A;  5C0X G;  4BY1 H;  4JI1 Q;  1N33 L;  3I73 A;  3M4Y A;  1I4H A;  5FLM H;  3S1Q H;  2LY7 A;  3KOJ A;  1LV9 A;  2Q8I B;  4X66 L;  2UXD L;  1HUM A;  2R92 G;  3K5L A;  1N32 L;  5KND A;  3HOU H;  1IL2 A;  1TWA B;  2R61 A;  1X54 A;  3S14 H;  5KIX A;  1AZP A;  4DNT B;  4KY6 A;  3TSS A;  1GO3 E;  3AFP A;  3T1H L;  1X65 A;  1XNR Q;  1V8Q A;  5BN5 A;  4DR1 L;  1BBX C;  3OSO A;  2RCF A;  2RDF A;  2X6L A;  3TRE A;  1LAC A;  3KLR A;  3QOJ A;  1I6H B;  4A3D B;  3GTM B;  1TT2 A;  1LTL A;  3OIP A;  1YNJ C;  4LFA Q;  2AWN A;  5CYU A;  5IGE A;  3GTM H;  1DYQ A;  2NTT A;  1SNC A;  1H9K A;  3W3A A;  1WVL A;  5CV7 A;  4XQJ A;  3J81 i;  2BE5 D;  3GTO H;  2IX0 A;  1AP0 A;  2JJQ A;  2MGS A;  1SMY D;  1V1Q A;  4KKU A;  1PH8 A;  3A56 A;  1F9R A;  3X3N A;  4RHS A;  2J7Z A;  3DUZ A;  4DV5 L;  1B50 A;  3E3X A;  2P5Z X;  3A0J A;  3W2D A;  4OEL B;  4GLV B;  2MO1 A;  2R92 B;  3STB D;  1L0X B;  3CD6 A;  3S2H H;  2MPM A;  2F0M A;  4IFD G;  3J7Y W;  4A93 B;  5IOD A;  3MEH A;  2JA7 B;  3M4Q A;  2HT1 A;  3HKZ B;  1VQL A;  5DAU A;  1EQT A;  4HTH A;  2OQ0 A;  2UXD Q;  1CUK A;  5C4X G;  4DR5 L;  3CXC A;  1E24 A;  3S2D H;  4O2D A;  4EGV A;  4CDE C;  3T1H Q;  4A3I B;  4C3J H;  1XNR L;  4A3B B;  3JC6 6;  5LMN L;  4DXG A;  2D0P A;  1WOC A;  3HKZ E;  3KF8 B;  3MXP A;  1NMF A;  1VMC A;  1F9S A;  4UDU C;  1PV4 A;  2BDO A;  2JK8 A;  2F3I A;  1LT6 D;  2ZXP A;  4A75 A;  1IBM L;  2I0Q A;  4HIM A;  1Y8N B;  1MBY A;  4OIJ A;  4MNO A;  3PUY A;  4AQY Q;  1K28 A;  1W3S A;  3SGI A;  1UE5 A;  1HHV A;  1ICF B;  3I2Z A;  3CCE A;  4RWS C;  4DU9 A;  3RUZ A;  2MP1 A;  1BNZ A;  2NVT H;  1CFM A;  5JAV A;  1UE7 A;  3I56 A;  2ASB A;  3FPP A;  4Y7N H;  2B63 B;  3WDN A;  3J7Z C;  1VQ7 A;  4AIM A;  2FMC A;  1E0B A;  1J5E Q;  1FL0 A;  1HH2 P;  2E2I H;  5BR8 L;  5DM6 3;  4YWL A;  1V1P A;  3OW7 A;  4C3I B;  2SOB A;  4WOR A;  2RA4 A;  4DR5 Q;  1CT1 D;  1XMO Q;  3UDG A;  1H95 A;  4K2K A;  2I5L X;  4NKL A;  3RR5 A;  2JEA I;  4A3K H;  4A3I G;  1YHQ A;  2Z8L A;  1IKM A;  1HZC A;  3LX0 A;  2J0T D;  3F1Z A;  1PMR A;  5E7N A;  1KLU D;  2O5I C;  1FD7 D;  1LT5 D;  3D3R A;  2A69 D;  3S15 H;  3K0Y A;  1VQM A;  2XTI A;  2AQ3 B;  4BY7 B;  1E2W A;  1TQO A;  3C1F A;  4DR2 L;  1KQS A;  2ZM6 Q;  4KY7 A;  1DD2 A;  2KCT A;  1HTP A;  2XRS D;  3I72 A;  4IPC A;  2RKS A;  1RTO A;  1SJH D;  2GVA A;  1WTQ A;  4F8M A;  2A68 D;  4LFB Q;  3CP0 A;  3BYY B;  2HQE A;  4QF4 A;  5JVG 3;  1J5E L;  3LWE A;  1KXL A;  1EL0 A;  5BR8 Q;  4OIK A;  4RMF A;  3DWA A;  3R2T A;  4IJH A;  2F0I A;  1DZ1 A;  1I4R A;  3ULP A;  2YU9 H;  4LF8 L;  2A6E D;  3F8T A;  4K5X A;  2B2W C;  1VQC A;  1Q90 A;  1FNW A;  3L3O C;  5IYC G;  1FJG Q;  4N9P A;  1CSP A;  4DFA A;  3TP7 A;  3NE5 B;  3SK4 A;  5GAG C;  3RN5 A;  1SRU A;  1N9W A;  3IAY A;  1BOS A;  1VQJ A;  3AU7 A;  3RZO B;  4UAI A;  4WFN 3;  4BBS G;  3KJP A;  4RKL A;  1N34 L;  1JC7 A;  4DR2 Q;  1D1K A;  1GXD C;  4R9W A;  1VQ9 A;  1EEI D;  4JI6 Q;  2E8G A;  2ZM6 L;  1R4P B;  4OX9 Q;  2KVM A;  3ICE A;  1B7Y B;  4PNY A;  1GM5 A;  1KDC A;  3A7A B;  1WJJ A;  4KHZ A;  2CH4 W;  1V1P B;  4UY8 C;  1N36 Q;  4L5Q A;  4X3S A;  4KHP Q;  1I4X A;  4A3D H;  1S5B D;  3S9W A;  2UXC Q;  3VYU A;  2L12 A;  4ZQ3 A;  2WIN B;  2B63 G;  1S72 A;  1PLF A;  2HQL A;  4GOP A;  5CV4 A;  1VQ5 A;  2QIL A;  4C3I G;  1YEZ A;  2K7V A;  2HUG A;  3MXU A;  4A3E G;  3DHQ A;  4H44 C;  2DUD A;  4QY7 A;  2ZXR A;  3H09 A;  3QIA A;  4S3S A;  4RH6 A;  4BXX H;  1X32 A;  2V4D A;  2J4X A;  1J9O A;  2WB1 B;  3V2T A;  2NZO A;  1STH A;  1U5K A;  4A3E B;  3FRP B;  2JXM B;  4BWG B;  5GRO A;  2A6H D;  3M85 A;  2MHV A;  4U68 A;  1TWG H;  3GTJ H;  2E2H B;  3E9H A;  2JN4 A;  1SFO H;  1XPO A;  2Q2I A;  2Q2T A;  4DR4 L;  2R93 G;  4C1N I;  4OO1 H;  3QWN A;  2EOT A;  2LS0 1;  1X55 A;  2KUM A;  4IUT A;  2G5D A;  3SXH A;  3PGZ A;  1YNJ D;  3JAM L;  4IOC A;  3GTK H;  3ERQ A;  2ATW A;  5NUC A;  5J3B A;  1PH5 A;  4C3H B;  2L9H A;  4E6I A;  2QF7 A;  1E1O A;  1GHJ A;  1SE4 A;  3KJO A;  2I5H A;  4ZRZ A;  2K28 A;  4FVM A;  4IUN A;  3HOZ H;  3GQB A;  2VL6 A;  4NDX A;  2BDN A;  1YNN C;  4HIK A;  3B6Y A;  5JJZ A;  4A3C G;  2QGQ A;  3BZK A;  3SVM A;  4OWX B;  4AYB B;  1I4G A;  2NVY B;  2LKV A;  2CQA A;  1EIF A;  1G91 A;  4A93 G;  5C44 G;  1TWG B;  2E2H H;  3BZC A;  4X65 L;  1LUZ A;  3H0G B;  4GKK Q;  2B2Y C;  4BBR H;  5KYI A;  3URY A;  3N6R A;  5M3F B;  4DNI A;  2F0G A;  2F0D A;  2R92 H;  4ZLT F;  1EOV A;  2PO4 A;  4Y52 H;  1GUG A;  4DUZ L;  4IJL A;  5HGT A;  4AYB E;  4QUC A;  2E2J B;  3PUW A;  2RSO A;  2R3Z A;  3S1R B;  4HJ7 A;  1DM0 B;  2XGT A;  1EZ6 A;  2JYO A;  1SYB A;  2EIF A;  5G3L D;  2OXP A;  4C3I H;  1R9T H;  1KAA A;  4FXD A;  4POG A;  3GDE A;  4HID A;  3M9B A;  2EYP A;  3QB3 A;  3GTP H;  1Q82 C;  1EWC A;  4PQX A;  1W6K A;  3DLL A;  1I94 Q;  4FDB A;  4L63 B;  5E4X A;  4A76 A;  3U9S A;  4LFC Q;  4IUP A;  5M3M G;  1F77 A;  1ET9 A;  3AFQ A;  5FLM G;  3OTO Q;  1KDA A;  2WAQ B;  3ONA B;  3ZYY X;  3M4O B;  4JI3 Q;  2F0V A;  4DV6 Q;  2FFK B;  2Z9H A;  4A3L G;  1EFI D;  5GAD C;  3W1B A;  1X3P A;  2MFI A;  1O78 A;  2SNM A;  1G2T A;  4NW2 A;  4DKA C;  5JJI A;  1IL8 A;  3EBE A;  1OXT A;  2M2L A;  2EQS A;  4FXK C;  1DXM A;  3CCU A;  2QCP X;  1WI5 A;  3TS2 A;  4RCN A;  1CKO A;  2UUC L;  1QIL A;  1TWH B;  2OCE A;  2NVX H;  4A3C H;  5C0X I;  4WJW A;  1OO9 B;  3RZD B;  1EWH A;  2JA7 H;  1BVS A;  1NE3 A;  4MHE A;  3I4N B;  3GTG H;  1ZYR C;  1LTS D;  4DV0 Q;  1AE2 A;  4DAV A;  3U58 A;  4CJ2 C;  1K8A C;  4F88 A;  3M4O H;  1EU4 A;  3VR4 A;  4IFD H;  3S1N H;  1YVC A;  4I7Z C;  1VQK A;  2HD3 A;  4LFC L;  4GNX C;  3KF6 B;  3K80 C;  4C56 C;  3PF5 A;  1YJW A;  2AQ1 B;  3HOW H;  3OTO L;  1EQR A;  1B44 D;  5IP7 G;  5FLX E;  4V19 0;  3E6Z X;  1E2V A;  3D31 A;  2R7Z H;  1UNS A;  1NNX A;  3H91 A;  2MUY A;  3CC2 A;  3K81 C;  4RGN A;  4YIJ A;  3GD7 A;  3IFD A;  1HA5 A;  4B3S L;  4NXM Q;  3CAM A;  4KTA A;  4J8Q A;  3Q24 A;  2K4K A;  2AKW B;  5IIF A;  5M3M H;  2TSS A;  1ROD A;  2KEN A;  2MO0 A;  4YCU A;  2M9V A;  2UUC Q;  2FHT A;  2XIW A;  1BCP F;  2E2I B;  5CBA E;  2RQX A;  1F2Y A;  3U4Z A;  4Q5V A;  1W2B A;  3H3V H;  3VR3 A;  3G48 A;  4R8N A;  2DNC A;  1Y1V H;  2NZH A;  2UUA L;  3GTG B;  4JV5 Q;  1EIG A;  1BCP B;  1I4P A;  1MSH A;  2R7Z B;  2PW5 A;  2PCF B;  4EQP A;  2LXJ A;  2GVB A;  4A3F B;  2A69 C;  3Q8D A;  1HXY D;  3PF4 A;  1JT8 A;  5CV8 A;  2X69 A;  4KLK A;  1TWA H;  4BA1 I;  1XXG A;  1GHK A;  1BQQ T;  5FOB B;  2EPB A;  3KUP A;  1HQR D;  3M4P A;  3FHW A;  1A2U A;  1TS3 A;  3EVQ A;  1VF7 A;  1EQV A;  4JCV E;  5IYD H;  3O13 A;  5JJL A;  3VR2 A;  1CHP D;  2JA6 G;  1MJE A;  2VZA A;  1HZA A;  4XYQ A;  1D1I A;  3EFX D;  2NB0 A;  4NPS A;  2EZV A;  2G9H D;  1NY4 A;  4NXM L;  5C44 B;  1PVO A;  2VW9 A;  1U4P A;  3J7A 5;  2F0W A;  2HDM A;  3FP9 A;  5IP7 H;  4TSS A;  4HED A;  1BF4 A;  3BDO A;  3G4S A;  3PMF A;  2B3G A;  1WTR A;  2R6G A;  3TEH B;  3L9A X;  3WOF A;  5I6Y A;  1F9P A;  3FKI H;  4FXG C;  4G7Z C;  1E2Z A;  4ID6 A;  4JVZ A;  1R9T B;  1GUO A;  3HKZ G;  4DGZ A;  1AN8 A;  4CJ0 B;  3L0O A;  1UEA B;  1SXT A;  4ZCK A;  3DWQ A;  1YIJ A;  2K52 A;  1FVI A;  1SAP A;  1LLR D;  3NEM A;  3SEB A;  3NEN A;  5M5Y B;  5H1S E;  1ZXT A;  1WTP A;  2F03 A;  2E75 C;  1PH3 A;  3NUC A;  3GTQ B;  3E9I A;  5ELN A;  2VQE Q;  3S17 H;  4ZAI A;  3NTK A;  4CKC A;  2XN9 C;  2E2J H;  4A3J H;  1HNZ L;  3TP6 A;  2QEX A;  1PZI D;  2PZW A;  3OPO A;  4DAM A;  5COY A;  1ONL A;  3P1H A;  1HNX L;  1EOT A;  3CPW A;  1K8G A;  5ELO A;  1ASZ A;  4G7H C;  1KHI A;  2LSS A;  1Q12 A;  4DK6 C;  1YNX A;  1PTO C;  1P8L A;  4ABN A;  2UUB Q;  4IFD J;  4A3B H;  4GNX B;  2JA6 H;  1CQV A;  1WD0 A;  1Q81 C;  2K5W A;  2K05 A;  1G8Z D;  4UHV A;  3VA5 A;  3J81 j;  2ALY B;  1JR0 D;  2WFW A;  1NMG A;  5KNB A;  5KYL A;  3AMU A;  1KIX A;  2Z0S A;  3MHB A;  4TVA B;  1UEB A;  2Z4H A;  1HR0 Q;  3F2D A;  2WAC A;  4RCO A;  1EYG A;  1Q1B A;  3I4M H;  2AQ2 B;  4HJ9 A;  4A3E H;  1JQY D;  1KTK A;  4DR3 L;  3F2C A;  4BBS B;  1SNO A;  2FXQ A;  4B3R Q;  4K14 A;  1STA A;  1YNN D;  3RLN A;  4DV4 Q;  4YHH Q;  1KRS A;  4EQ5 A;  3SHL A;  1H9S A;  2WP8 J;  3JAM E;  3D6C A;  1B53 A;  3PV0 A;  4HCS A;  1I3Q B;  3MXN A;  2VQE L;  4R4T A;  4DAY B;  1G6P A;  2BH2 A;  1IHZ A;  3D8G A;  5EGT A;  3IL8 A;  1B1Z A;  2A74 C;  2N88 A;  3CC7 A;  1SFO B;  2HHH L;  1I5F A;  1T5E A;  4FP5 D;  1SNQ A;  1QZH A;  4DN4 M;  4ZUJ A;  3K5N A;  1B3Q A;  4K5W A;  1CHQ D;  4OO1 G;  1RDP D;  3BZD B;  5FK9 C;  1HA6 A;  2HIX A;  2BA0 A;  5LHY 1;  2NVY H;  2CKZ B;  2ZT9 C;  1VQD A;  1V1O A;  2RDG A;  3OMC A;  1IBK Q;  4ALP A;  2ZTC A;  2M00 A;  3A5Z B;  1XMQ L;  1JWU D;  4KK7 A;  2EY2 A;  1ENC A;  4OO1 I;  2OQK A;  1QNK A;  1TS2 A;  1HR0 L;  3SR1 A;  4Y7N B;  1KAB A;  1E7Z A;  1K83 H;  4U67 3;  1Z7T A;  4G4K A;  5BN3 A;  2G9D A;  3M3Y B;  4B3R L;  4KKT A;  3MTS A;  4YHH L;  3JAM i;  1VQE A;  4O0A A;  5IP9 G;  1VQB A;  4A3M B;  5AFW A;  1PH9 A;  2UU9 L;  4HN7 A;  2FIN B;  3S1N B;  4A3G G;  1PZK D;  4PZ6 A;  2A5H A;  1G29 1;  1PH4 A;  3S16 H;  4BY1 B;  5IY0 A;  3QOL A;  3I4M G;  4NXN L;  1SRO A;  1I6V C;  3RZD H;  5AJ3 L;  5JVH 3;  3LNN A;  3A7L A;  5M5X H;  4IFD I;  2IPK D;  5JPN C;  1S5C D;  2CH4 A;  2SEB D;  4JI4 Q;  2HCI A;  5CV5 A;  3S1M B;  3N52 A;  1S40 A;  1PA6 A;  3GTJ B;  3E0E A;  1XMQ Q;  4X3T A;  1RKN A;  1KNA A;  2PNH A;  1JJC B;  2CW0 C;  4ULL A;  2XWB B;  1CI3 M;  1C7Y A;  2VB3 X;  2YYZ A;  4IZ8 A;  2EJF C;  2NBF A;  3PO2 G;  1XPR A;  3VR5 A;  4A3L H;  3MXN B;  2VUM G;  5D14 A;  1TKW B;  3CU7 A;  4EQN A;  1PYW D;  2XSC A;  2Z4I A;  3TN2 A;  3CKI B;  3NHH A;  4LF7 L;  1Z9F A;  1PYB A;  2O2L D;  3OMG A;  4NB3 A;  5I9P A;  1I50 H;  4FF1 A;  3U50 C;  2K6A A;  1BCP C;  4JI0 Q;  2WB1 E;  3NWS A;  2F0O A;  3J7A V;  5K36 G;  4QUF A;  2IL8 A;  3NQT A;  3GTP B;  4BS9 A;  5C3E B;  4JI5 Q;  1GKH A;  1N33 Q;  1DCZ A;  4JI1 L;  4I65 A;  1F2L A;  1B2T A;  3R3O A;  1HFN A;  2F0U A;  1JCK B;  2YTV A;  5AJ3 Q;  2O4X A;  4CDD C;  3ERO A;  1Q46 A;  4JYA L;  2DNE A;  4X66 Q;  3HOW B;  4Q0F A;  2QDB A;  3MEF A;  4DK0 A;  2Z6K A;  1D5Z C;  4WJ4 A;  1GUN A;  3KLS X;  1Y14 B;  1PFN A;  1OTC A;  4RHR A;  1TS4 A;  3HOW G;  5IT9 c;  3UE0 A;  1LTG D;  3H0G H;  3CHB D;  1UUP A;  2L11 A;  4YCV A;  3D4W A;  4R4C A;  2JE6 I;  4JBW A;  2F0N A;  3T51 B;  3AYH B;  3I8Z A;  4YWK A;  1Q8K A;  1SE2 A;  3ULL A;  3OYY A;  1ENA A;  4LF7 Q;  1SR3 A;  1C9O A;  1KRT A;  3VYS A;  3RD4 A;  1XWE A;  4DV5 Q;  3HOX B;  4P73 A;  1LYL A;  4RGT A;  1VS0 A;  3DWP A;  4LF5 L;  3UDI A;  1VQP A;  4A3G B;  3T16 A;  3IFT A;  5IT9 E;  3MWY W;  5IYB H;  4JI5 L;  2Q2U A;  1F2M A;  4A3K B;  1ILQ A;  1PRT F;  4EQO A;  1CZG A;  4JYA Q;  2VUM H;  5JOB A;  4DF7 A;  4C3H G;  4P72 A;  5FO8 B;  5M3M B;  2PZU A;  1SYC A;  1PFB A;  1HZ9 A;  3H15 A;  2H1E A;  5LMN Q;  5KNC A;  4DAP A;  1EY9 A;  2FMM A;  1NBW A;  2RDH A;  1T5X D;  1C8C A;  3STB C;  1QNU A;  1SMX A;  3CC4 A;  3I4L A;  2B2V C;  1YBY A;  2F3W A;  3FEW X;  1SJE D;  1IBM Q;  1R4Q B;  3G7L A;  4IUR A;  2XWJ B;  4DV1 L;  2WAQ E;  4R4I A;  2DJF C;  3HZX A;  1Q86 C;  4HJ8 A;  4IPH A;  4DAY A;  1H9S B;  1SND A;  2EJG C;  2K5D A;  5IT9 L;  1PH6 A;  4DNR B;  3H3V C;  3I90 A;  3SE0 A;  3L2P A;  4KY5 A;  3HOV B;  1PTO B;  2B8F A;  3WOE A;  1VQ4 A;  4LF6 Q;  4XQN A;  4JBK A;  4LF5 Q;  3T53 B;  2CW0 D;  3TS0 A;  1JIC A;  1QJO A;  3RLF A;  4PMW A;  5IGB A;  1ENF A;  1U4M A;  1TXY A;  2YTY A;  1HFG A;  3KBX A;  2F4V Q;  1MHW C;  1B8A A;  5FO9 B;  5D3D A;  3KK7 A;  2ES2 A;  2RF4 A;  3Q6S A;  1PHJ A;  1L0W A;  1RCV D;  1A62 A;  5C4X B;  3A55 A;  3S1Q B;  4DV7 Q;  5LMU L;  3ND9 A;  4P75 A;  1HPC A;  4P74 A;  3SK5 A;  4QL5 A;  4UPA A;  1STE A;  4J15 A;  1SSO A;  1O7L A;  4JI2 L;  3BDC A;  2ID0 A;  4KKS A;  3I70 A;  3CRK C;  4A3K G;  2GA4 B;  3CW2 C;  4A3I H;  3GTL B;  2LFN A;  2E74 C;  4DV3 Q;  1KLG D;  2PI2 A;  1IBL Q;  1K3R A;  4MZ9 A;  1LM0 A;  2BCO A;  2CCZ A;  5J1Z A;  4L5T A;  3FVQ A;  5CMD A;  1EYA A;  5JPM C;  4RA8 A;  2RCN A;  1K0R A;  1DOM A;  4C1N K;  1L1O A;  3DM3 A;  4DV2 Q;  4JI7 L;  1A3V A;  1U0L A;  2F0T A;  3CPF A;  4IPD A;  4LFB L;  1K8O A;  2IW3 A;  2Y0S B;  2IJ0 A;  4CDF C;  3Q0A A;  1G6Z A;  3IRB A;  4R1J A;  1HRJ A;  2QKI C;  3G6E A;  5JEA G;  2KHS A;  1SMY C;  1VQI A;  2JA9 A;  1EY0 A;  2F0L A;  2ZJQ A;  5C3E G;  4LW1 A;  2DJG C;  2A6E C;  4R4O A;  3PUX A;  3J81 E;  3TRZ A;  2KQ3 A;  4DV7 L;  5LMU Q;  2C9O A;  4OL7 A;  3CCL A;  2B39 A;  1WCM G;  3J80 i;  4B3T L;  4DV3 L;  3HOX H;  1N34 Q;  1Y8P B;  5CV9 A;  4MIU A;  3ITP A;  1WFQ A;  1JE5 A;  1JJG A;  4B3M L;  2BA1 A;  3MFG A;  4PMC A;  5GAE C;  4HIO A;  2KCN A;  4QCL A;  2Z6B A;  3PIO A;  4ZYS A;  1FNU A;  4UP8 A;  2RBM A;  1M90 C;  1XPU A;  2O5J C;  3W1G A;  1O7Z A;  1ASY A;  4B9W A;  4DV2 L;  1Y69 U;  4DUY L;  3L7Z C;  4JI7 Q;  4GN5 A;  1N36 L;  2ZJR A;  3I4M B;  4KHP L;  3PUV A;  5GQO A;  2F3V A;  2WKD A;  2Q8R E;  3G6J B;  1TWH H;  3K6O A;  5C5L A;  1UAP A;  3TDQ A;  2EYM A;  4XXE A;  3NBH A;  4A3D G;  3NTH A;  1TY2 A;  1PRT B;  2EDG A;  4RG1 A;  2WV6 D;  5J39 A;  3DEP A;  5ELE A;  4HMI A;  4IN3 A;  3BVZ A;  4K8I A;  1G51 A;  2F0P A;  2CWA A;  2Y0S G;  4XDX A;  3J80 c;  2IHF A;  1SYG A;  4CKE A;  4DR6 L;  4KV6 A;  3K7U C;  4K0K L;  3S2D B;  4LAA A;  4HJ5 A;  3QO2 A;  3S1R H;  3S17 B;  5DM7 3;  3C46 A;  1BBU A;  4DR4 Q;  2SNS A;  4QIW E;  2F0S A;  1YJN A;  3CF5 A;  3S15 B;  2L0C A;  4IUV A;  1WTV A;  1K0S A;  4R4Q A;  4ZK9 B;  1M4V A;  5FKA C;  2R93 H;  1ML0 D;  2B29 A;  3HOU G;  4A3G H;  1ICW A;  1SNP A;  4K2L A;  3M7G A;  2EVB A;  1WTH A;  2K03 A;  4IUU A;  1WCM H;  3NSW A;  2NWG A;  3HOX G;  4KJN A;  2KEE A;  5IGD A;  4DR1 Q;  1CA6 A;  3AB9 A;  5K36 H;  1LTB D;  4XT1 B;  2EYH A;  2PZT A;  3DXJ C;  1EEF D;  4X65 Q;  1C48 A;  5FLX L;  4GKK L;  1EUJ A;  2DY7 A;  3KLS A;  2B2T C;  3S16 B;  4GZY C;  3PO3 H;  2A6H C;  2K5N A;  2NYZ D;  4P2C B;  4DR6 Q;  1JE4 A;  2C5C A;  4CGY B;  4K0K Q;  4JPB W;  4BBR G;  2KHI A;  4ILW A;  1AZQ A;  3DEO A;  3HOU B;  1A15 A;  1SBB B;  2K50 A;  3BG3 A;  1OXU A;  3VDY A;  3P20 A;  1OXV A;  5CC4 A;  2K5H A;  2A73 B;  3PO3 B;  2K75 A;  5ELD A;  2HCC A;  1JJ2 A;  4GLX A;  3C3L A;  2K14 A;  3K7A B;  3H6M A;  1MIU A;  2MJ8 A;  3EJI A;  1RHP A;  5DNF A;  1NTG A;  1EWI A;  4I7A A;  4QGU A;  1KC8 C;  4JOI C;  1PFS A;  2PQA B;  3HRZ C;  1PZJ D;  1L0Y B;  3NTI A;  2Y0S E;  3GTO B;  5IE8 A;  2IX1 A;  2D5D A;  2XNA C;  3GO5 A;  1TWC H;  4DV6 L;  2F0E A;  5M9O A;  1QB5 D;  2JEB I;  2F0K A;  3A8J E;  1VQF A;  1TII D;  2OWO A;  1CKN B;  1X3G A;  5FO7 B;  5EJW A;  1QZG A;  4HJA A;  1ZKO A;  4AQY L;  2L55 A;  3H0G G;  5IGG A;  3OIQ A;  5C4J H;  1PFM A;  5EKL A;  3OHX C;  4MN3 A;  3P75 A;  5T1I A;  1X56 A;  4XTC S;  3UE1 A;  1BDO A;  4FYD A;  3K5O A;  5L37 A;  1S3O A;  5CR3 A;  4PV1 C;  4QJF A;  1TWC B;  2DGY A;  4LUV A;  4OWT B;  4JBJ A;  1YIT A;  1NR2 A;  4PZ8 A;  1G2S A;  2NVT B;  3ZJY C;  1P16 A;  5IYB G;  2A68 C;  5FJ8 G;  4A3M H;  2F0Q A;  4HR7 B;  1I3Q H;  3CQZ H;  4B9X A;  4IPG A;  2NN6 I;  3KYH C;  2VB2 X;  1XMO L;  1S4Z A;  2D2C C;  3RZO H;  4C3H H;  1HR0 W;  1V43 A;  1YJ9 A;  3ERS X;  2JA5 H;  3AEV A;  1D5M C;  1TR5 A;  2F52 A;  4TQU S;  3UI2 A;  3CMA A;  4QQB X;  2IWH A;  1LO5 D;  3HOV H;  1QWY A;  2OT2 A;  2CQO A;  4KN7 C;  1CKN A;  3G71 A;  4LF9 L;  1NJI C;  2NVQ H;  1ZEQ X;  2GN5 A;  1MJC A;  1B70 B;  5EQ0 A;  3KFU A;  2EYJ A;  3I91 A;  3VYR A;  2N78 A;  3NQI A;  4B08 A;  2D9U A;  1L2F A;  3I4N G;  1E22 A;  3EA6 A;  1D5X C;  4Z9C B;  1O7I A;  5HY6 A;  1EYC A;  5HGQ A;  1TY0 A;  4YY3 L;  3C2P A;  1PTO H;  3D4R A;  1AW7 A;  3RMH A;  3PSI A;  2KJX A;  4A4I A;  4PG3 A;  1N8R C;  5EBC A;  1PTO D;  1XJV A;  4GN4 B;  2MQH A;  2EYL A;  4LF8 Q;  1M1K C;  3OOC A;  1Y8O B;  1LTI D;  1II3 A;  3E5S A;  4IAL A;  3CCJ A;  4O42 A;  1FJG L;  4LUZ A;  2H4O A;  5I2X A;  3TZU A;  3GTQ H;  3PQI A;  4RGO S;  1AE3 A;  3UDF A;  1SDF A;  1VQO A;  2NN6 G;  4BBS H;  1VDZ A;  3NEL A;  4EX5 A;  3FKI B;  4L5R C;  1HQM C;  3VA7 A;  4OON A;  4G7O C;  1S5D D;  2B2Y A;  3OW2 A;  1ESF A;  2NTS A;  5EBD A;  2Q8T A;  2Z1C A;  1DJR D;  1QVC A;  2PQE A;  5CGK A;  2PMZ E;  4WJ3 M;  1QE6 A;  3MVV A;  5IYD G;  3CCR A;  4LF9 Q;  3H94 A;  1EQQ A;  1FYC A;  2X6G A; 
#chains in the Genus database with same CATH homology
 2ICI A;  1A2T A;  3BVG A;  5CV6 A;  1PRT D;  2B2U C;  1FR3 A;  2EYF A;  1NUC A;  1ESR A;  3PIP 3;  1Q3L A;  3PIO 3;  5I2Y A;  3VR6 A;  3E0J A;  4A3J B;  4DA2 A;  4DK1 A;  3NPP A;  5T1G A;  1Y1W B;  1LAB A;  4KD4 A;  1DON A;  1BCP D;  1XX8 A;  2VNU D;  1LT4 D;  2K33 A;  3R2I A;  4C2M B;  3NXW A;  4IUQ A;  4V0B A;  5A2Q L;  3S2H B;  1AEX A;  1NAP A;  1TS5 A;  5EKI A;  5K5P A;  1EY7 A;  3HS0 C;  2B2T A;  2F0H A;  4KHV A;  3LWU A;  4FNF A;  4RGM A;  4CKB A;  2EE1 A;  1I4Q A;  4G57 A;  1SEB D;  2KOL A;  1KNE A;  1WCM B;  3NK9 A;  5C0X J;  5ELC A;  5C3W A;  5A2Q E;  3A54 A;  1EU3 A;  1RTN A;  1JWS D;  3Q23 A;  1K8M A;  3ND8 A;  1A3T A;  4H0L C;  4CHT B;  1FNV A;  2EY5 A;  5I9O A;  1Z6H A;  4L8J A;  1STG A;  3TP8 A;  3TBI B;  2TMP A;  4JK1 C;  2LMC B;  5M5X B;  4RFB A;  4QIW B;  3HGB A;  1J8I A;  2JP1 A;  2EY1 A;  3D6W A;  4TKO B;  1RF2 D;  2B2V A;  5EPJ A;  1DOL A;  3K59 A;  5C4Z A;  3BDL A;  2NVX B;  1WD1 A;  1CTM A;  4KI0 A;  1M8A A;  2RSN A;  3HG9 A;  1CM9 A;  1S5F D;  4CBV A;  1Z47 A;  4HMJ A;  1B4O A;  1CZW A;  4KN4 C;  2F4I A;  2PW7 A;  1JOQ A;  4QB4 A;  1OXS C;  1MSG A;  2BE5 C;  1PDQ A;  1VMP A;  2L4N A;  3R8B A;  1OXX K;  1B9N A;  1SNM A;  4XYO A;  3SDZ A;  4N9T A;  3TP5 A;  3FMC A;  1O7Y A;  3X3M A;  1EYD A;  2WII B;  1XTC D;  3F2U A;  1CA5 A;  2L5T A;  4X3K A;  4LJZ C;  1O80 A;  4ME5 A;  3KF8 A;  3NBI A;  3C1E A;  3T56 B;  2B8G A;  3CRL C;  3MAQ A;  5C0X H;  1JOO A;  2NZ1 D;  3MZ5 A;  3QG1 A;  1MGS A;  2F0J A;  2PMZ B;  1BXT A;  1B3A A;  1BUV T;  1H9J A;  1PRT C;  4R8I A;  4CJ1 B;  1SYF A;  3EQL C;  3KBG A;  1QOH A;  3T13 A;  2B2W A;  4KMU C;  4XQQ A;  3HOY B;  1B9M A;  3M7N A;  5JEA J;  4HSV A;  2NUC A;  3PUZ A;  1GOZ A;  1SYE A;  2EYO A;  3SK8 A;  3K57 A;  1H9M A;  2N55 A;  1MD2 D;  2AUK A;  5C3X A;  2K5Q A;  1TWF B;  5LL6 S;  1IYV A;  3QJY A;  4XIG S;  3FDT A;  1IKL A;  2B2U A;  4H7B A;  2CHB D;  3BS1 A;  1U9R A;  3OWE B;  5EKK A;  3K5M A;  2VXW A;  4C3J G;  4FO2 A;  1A3U A;  2D62 A;  3TME A;  1A6X A;  4LMQ D;  3J80 L;  3DMU A;  4FF2 A;  1GJX A;  1STN A;  2I07 B;  3GP7 A;  3FPU B;  1GUS A;  2K04 A;  1TU2 B;  1I50 B;  2L1B A;  3MC0 B;  2XVS A;  5C4H A;  4RKB A;  3J7A F;  5C4J B;  4K5V A;  4K6L A;  3A8I E;  2NN6 H;  4NP5 A;  4OHJ A;  1SYD A;  1WTW A;  3K58 A;  2K32 A;  1CQF A;  4HCE A;  5E3F A;  1EY6 A;  1NCV A;  1VCI A;  1C4Q A;  2ICE C;  5IGC A;  5ELB A;  1Q8I A;  2WKC A;  1PTO F;  2NVQ B;  1ILP A;  1XYI A;  5EPK A;  1U4L A;  4K8J A;  4HAE A;  4F87 A;  4ODG A;  4RAU C;  5E1F A;  4O1N A;  1RJT A;  2JA5 B;  3NP8 A;  1JB3 A;  1SE3 A;  2EXZ A;  1K83 B;  5I4D A;  1GUT A;  4C3J B;  2AWO A;  1H9R A;  2F0F A;  4M8A A;  2EJM A;  1EY4 A;  3CQZ B;  2DY8 A;  2BOS A;  2ENB A;  4OGQ C;  2YU9 B;  5M5W B;  3TZD A;  3MA2 B;  2PNR C;  4J1M A;  1Q1E A;  1DOK A;  1VF5 C;  1GUW A;  1WTO A;  5C5M A;  4J6H A;  1ET6 A;  4ZKB B;  4X3U A;  3DM1 A;  2ZXO A;  1IW7 C;  3GV3 A;  3IKJ A;  2FJ2 A;  4ZKC B;  5EPL A;  1KDB A;  2DN8 A;  2VUM B;  3V96 A;  4L6T B;  1HUN A;  4QMG A;  4KD3 A;  4HSP A;  3HP3 A;  4BBR B;  4EVO A;  3D4D A;  4FF3 A;  3OWF A;  5A35 A;  4FF4 A;  3HEJ A;  5KGU A;  1HCZ A;  2EY6 A;  3MFY A;  3S14 B;  3Q22 A;  3NWT A;  3P7J A;  1F2Z A;  2OF1 A;  3BYT B;  3R93 A;  1WTX A;  2OEO A;  1PXU A;  2JSO A;  4WRD A;  5D3I B;  3V05 A;  1JOR A;  2K01 A;  1STY A;  1ZYR D;  2JA8 B;  3GTK B;  5C6A A;  4BA2 I;  1JWM D;  1W6J A;  2IX3 A;  1QCB D;  2XRQ D;  5J22 A;  2KA7 A;  3HOZ B;  1NR4 A;  4ZUI A;  2KED A;  1RD9 D;  1EY8 A;  1HTL D;  5JEA H;  5COR A;  1TVX A;  1LTR D;  1Y1V B;  3MXG A;  1NSN S;  3VYT A;  5IOC A;  2CVR A;  3BVM A;  2IT1 A;  3PO2 B;  4LK1 C;  1X3Q A;  3J81 L;  3SK6 A;  1EY5 A;  3A8K E;  1BR9 A;  5CBE E;  5KRU A;  1LTT D;  5LL6 X;  2SDF A;  2PYK A;  1CK1 A;  1D6E C;  4DXF A;  4K6D A;  2R93 B;  2HDL A;  2KEC A;  5TSS A;  4IQZ A;  1MI2 A;  1D2B A;  1IW7 D;  1S5E D;  5ELF A;  5IGF A;  2QEJ C;  2E76 C;  4KJO A;  3I3C A;  4NMZ A;  1F9Q A;  1JOK A;  5BN4 A;  5DEH A;  1FGB D;  2K1B A;  1LTA D;  3J80 E;  2E2D C;  5G3L F;  4F7X A;  4H13 C;  2F1M A;  2PPB C;  5I6W A;  1U4R A;  1STB A;  1EIH A;  5HUR A;  5E4W C;  1IYU A;  4PMB A;  5F2D A;  2I46 A;  2AUJ D;  4M1U B;  1AFP A;  5KEE A;  3T4A C;  2RVL A;  4TRD A;  1BO0 A;  2JA6 B;  2KCC A;  5D65 A;  3GV6 A;  3U9O A;  1LT3 D;  1EZ8 A;  4XT3 B;  5ISR A;  1QG7 A;  5C0X G;  3I73 A;  3M4Y A;  1I4H A;  2LY7 A;  1LV9 A;  2Q8I B;  1HUM A;  3K5L A;  5KND A;  1TWA B;  2R61 A;  5KIX A;  1AZP A;  4DNT B;  4KY6 A;  3TSS A;  1V8Q A;  5BN5 A;  1BBX C;  3OSO A;  2RDF A;  2X6L A;  1LAC A;  3KLR A;  3QOJ A;  1I6H B;  4A3D B;  3GTM B;  1TT2 A;  3OIP A;  1YNJ C;  2AWN A;  5CYU A;  5IGE A;  1DYQ A;  2NTT A;  1SNC A;  1H9K A;  3W3A A;  1WVL A;  5CV7 A;  4XQJ A;  2BE5 D;  2IX0 A;  1AP0 A;  2MGS A;  1SMY D;  4KKU A;  3A56 A;  1F9R A;  3X3N A;  4RHS A;  2J7Z A;  3DUZ A;  1B50 A;  3W2D A;  2R92 B;  1L0X B;  2MPM A;  2F0M A;  4IFD G;  3J7Y W;  4A93 B;  5IOD A;  3MEH A;  2JA7 B;  3HKZ B;  5DAU A;  1EQT A;  4HTH A;  4EGV A;  4A3I B;  4A3B B;  4DXG A;  3MXP A;  1VMC A;  1F9S A;  4UDU C;  2BDO A;  1LT6 D;  2ZXP A;  1Y8N B;  1MBY A;  4OIJ A;  3PUY A;  1HHV A;  4RWS C;  4DU9 A;  3RUZ A;  2MP1 A;  1BNZ A;  1CFM A;  5JAV A;  3FPP A;  2B63 B;  3WDN A;  2FMC A;  1E0B A;  5DM6 3;  1V1P A;  3OW7 A;  4C3I B;  2SOB A;  4WOR A;  2RA4 A;  1CT1 D;  4K2K A;  4NKL A;  2JEA I;  2Z8L A;  1IKM A;  3LX0 A;  2J0T D;  1PMR A;  1KLU D;  2O5I C;  1FD7 D;  1LT5 D;  3D3R A;  2A69 D;  3K0Y A;  2AQ3 B;  4BY7 B;  1E2W A;  1TQO A;  3C1F A;  4KY7 A;  1DD2 A;  1HTP A;  2XRS D;  3I72 A;  2RKS A;  1RTO A;  1SJH D;  1WTQ A;  4F8M A;  2A68 D;  3BYY B;  2HQE A;  4QF4 A;  5JVG 3;  3LWE A;  1EL0 A;  4OIK A;  3DWA A;  3R2T A;  2F0I A;  1DZ1 A;  1I4R A;  2A6E D;  4K5X A;  2B2W C;  1Q90 A;  1FNW A;  3L3O C;  4N9P A;  4DFA A;  3TP7 A;  3NE5 B;  3SK4 A;  3IAY A;  1BOS A;  3AU7 A;  3RZO B;  4UAI A;  4WFN 3;  4RKL A;  1JC7 A;  1D1K A;  1GXD C;  4R9W A;  1EEI D;  1R4P B;  2KVM A;  4PNY A;  1KDC A;  3A7A B;  4KHZ A;  1V1P B;  4X3S A;  1I4X A;  1S5B D;  3S9W A;  3VYU A;  2L12 A;  4ZQ3 A;  2WIN B;  1PLF A;  5CV4 A;  2QIL A;  4C3I G;  3MXU A;  2K7V A;  2HUG A;  3DHQ A;  4H44 C;  2ZXR A;  3H09 A;  3QIA A;  4S3S A;  4RH6 A;  1X32 A;  2V4D A;  2J4X A;  1J9O A;  2WB1 B;  3V2T A;  1STH A;  4A3E B;  3FRP B;  2JXM B;  4BWG B;  2A6H D;  3M85 A;  2MHV A;  4U68 A;  2E2H B;  4C1N I;  4OO1 H;  3QWN A;  2EOT A;  2LS0 1;  2KUM A;  4IUT A;  3SXH A;  1YNJ D;  3JAM L;  3ERQ A;  5NUC A;  4C3H B;  2L9H A;  4E6I A;  2QF7 A;  1GHJ A;  1SE4 A;  4ZRZ A;  2K28 A;  4FVM A;  4IUN A;  3GQB A;  4NDX A;  2BDN A;  1YNN C;  5JJZ A;  3SVM A;  4AYB B;  1I4G A;  2NVY B;  2LKV A;  2CQA A;  1G91 A;  1TWG B;  3H0G B;  2B2Y C;  5KYI A;  3URY A;  3N6R A;  5M3F B;  2F0G A;  2F0D A;  4ZLT F;  2PO4 A;  1GUG A;  5HGT A;  4QUC A;  2E2J B;  3PUW A;  2RSO A;  2R3Z A;  3S1R B;  1DM0 B;  1EZ6 A;  2JYO A;  1SYB A;  5G3L D;  2OXP A;  1KAA A;  4FXD A;  2EYP A;  3QB3 A;  1EWC A;  4PQX A;  1W6K A;  4L63 B;  5E4X A;  3U9S A;  4IUP A;  1F77 A;  1ET9 A;  1KDA A;  2WAQ B;  3ONA B;  3ZYY X;  3M4O B;  2F0V A;  2FFK B;  1EFI D;  1X3P A;  1O78 A;  2SNM A;  1G2T A;  4NW2 A;  1IL8 A;  1OXT A;  2M2L A;  4FXK C;  1DXM A;  2QCP X;  4RCN A;  1QIL A;  1TWH B;  5C0X I;  4WJW A;  1OO9 B;  3RZD B;  1EWH A;  4MHE A;  3I4N B;  1ZYR C;  1LTS D;  4DAV A;  4CJ2 C;  4F88 A;  1EU4 A;  3VR4 A;  4IFD H;  4I7Z C;  4C56 C;  2AQ1 B;  1B44 D;  5FLX E;  4V19 0;  3E6Z X;  1E2V A;  3D31 A;  1UNS A;  3H91 A;  2MUY A;  4RGN A;  4YIJ A;  3GD7 A;  3IFD A;  1HA5 A;  4KTA A;  4J8Q A;  3Q24 A;  5IIF A;  2TSS A;  1ROD A;  2M9V A;  2FHT A;  2XIW A;  1BCP F;  2E2I B;  5CBA E;  2RQX A;  1F2Y A;  4Q5V A;  3VR3 A;  4R8N A;  2DNC A;  3GTG B;  1EIG A;  1BCP B;  1I4P A;  1MSH A;  2R7Z B;  2PW5 A;  2PCF B;  4EQP A;  4A3F B;  2A69 C;  1HXY D;  5CV8 A;  2X69 A;  4BA1 I;  1XXG A;  1GHK A;  1BQQ T;  5FOB B;  2EPB A;  3KUP A;  1HQR D;  1A2U A;  1TS3 A;  3EVQ A;  1VF7 A;  1EQV A;  3O13 A;  3VR2 A;  1CHP D;  4XYQ A;  1D1I A;  3EFX D;  2NB0 A;  2EZV A;  2G9H D;  5C44 B;  1U4P A;  2F0W A;  2HDM A;  4TSS A;  4HED A;  1BF4 A;  3BDO A;  3PMF A;  1WTR A;  2R6G A;  3L9A X;  3WOF A;  5I6Y A;  1F9P A;  4FXG C;  4G7Z C;  1E2Z A;  4ID6 A;  1R9T B;  1GUO A;  4DGZ A;  1AN8 A;  4CJ0 B;  1UEA B;  1SXT A;  3DWQ A;  1SAP A;  1LLR D;  3SEB A;  5M5Y B;  1ZXT A;  1WTP A;  2F03 A;  2E75 C;  3NUC A;  3GTQ B;  4ZAI A;  3NTK A;  4CKC A;  2XN9 C;  3TP6 A;  1PZI D;  2PZW A;  3OPO A;  5COY A;  1ONL A;  3P1H A;  1EOT A;  4G7H C;  1Q12 A;  1PTO C;  4ABN A;  4IFD J;  1CQV A;  1WD0 A;  2K5W A;  2K05 A;  1G8Z D;  3VA5 A;  1JR0 D;  5KNB A;  3AMU A;  5KYL A;  3MHB A;  2Z4H A;  2WAC A;  4RCO A;  1Q1B A;  2AQ2 B;  1JQY D;  1KTK A;  4BBS B;  1SNO A;  4K14 A;  1STA A;  1YNN D;  3SHL A;  1H9S A;  2WP8 J;  3JAM E;  3D6C A;  1B53 A;  3PV0 A;  4HCS A;  1I3Q B;  3MXN A;  1IHZ A;  3D8G A;  5EGT A;  3IL8 A;  1B1Z A;  2A74 C;  2N88 A;  1SFO B;  1T5E A;  4FP5 D;  1SNQ A;  4DN4 M;  4ZUJ A;  3K5N A;  4K5W A;  1CHQ D;  4OO1 G;  1RDP D;  3BZD B;  5FK9 C;  1HA6 A;  2BA0 A;  5LHY 1;  2ZT9 C;  1V1O A;  2RDG A;  3OMC A;  2M00 A;  1JWU D;  4KK7 A;  2EY2 A;  1ENC A;  4OO1 I;  1QNK A;  1TS2 A;  3SR1 A;  4Y7N B;  1KAB A;  4U67 3;  1Z7T A;  4G4K A;  5BN3 A;  2G9D A;  3M3Y B;  4KKT A;  3MTS A;  4A3M B;  5AFW A;  4HN7 A;  2FIN B;  3S1N B;  1PZK D;  2A5H A;  1G29 1;  4BY1 B;  3QOL A;  1I6V C;  5JVH 3;  3LNN A;  3A7L A;  4IFD I;  2IPK D;  5JPN C;  1S5C D;  2SEB D;  2HCI A;  5CV5 A;  3S1M B;  3N52 A;  3GTJ B;  4X3T A;  1RKN A;  1KNA A;  2CW0 C;  4ULL A;  2XWB B;  1CI3 M;  2VB3 X;  2YYZ A;  4IZ8 A;  2EJF C;  2NBF A;  3VR5 A;  5D14 A;  1TKW B;  3CU7 A;  4EQN A;  1PYW D;  2XSC A;  2Z4I A;  3TN2 A;  3CKI B;  3NHH A;  2O2L D;  3OMG A;  5I9P A;  4FF1 A;  2K6A A;  1BCP C;  3NWS A;  2F0O A;  3J7A V;  5K36 G;  4QUF A;  2IL8 A;  3NQT A;  3GTP B;  4BS9 A;  5C3E B;  1DCZ A;  4I65 A;  1F2L A;  1B2T A;  3R3O A;  1HFN A;  2F0U A;  1JCK B;  2O4X A;  3ERO A;  2DNE A;  3HOW B;  4Q0F A;  2QDB A;  4DK0 A;  1D5Z C;  1GUN A;  3KLS X;  1PFN A;  4RHR A;  1TS4 A;  1LTG D;  3CHB D;  1UUP A;  2L11 A;  3D4W A;  2JE6 I;  4JBW A;  2F0N A;  3T51 B;  3I8Z A;  1SE2 A;  1ENA A;  3VYS A;  3RD4 A;  1XWE A;  3HOX B;  4RGT A;  3DWP A;  4A3G B;  3T16 A;  3IFT A;  5IT9 E;  3MWY W;  1F2M A;  4A3K B;  1ILQ A;  1PRT F;  4EQO A;  1CZG A;  5JOB A;  4DF7 A;  4C3H G;  5FO8 B;  5M3M B;  2PZU A;  1SYC A;  1PFB A;  2H1E A;  5KNC A;  4DAP A;  1EY9 A;  2FMM A;  2RDH A;  1T5X D;  1C8C A;  1QNU A;  3I4L A;  2B2V C;  2F3W A;  3FEW X;  1SJE D;  1R4Q B;  3G7L A;  4IUR A;  2XWJ B;  3HZX A;  4DAY A;  1H9S B;  1SND A;  2EJG C;  2K5D A;  5IT9 L;  4DNR B;  3H3V C;  3I90 A;  3SE0 A;  4KY5 A;  3HOV B;  1PTO B;  2B8F A;  3WOE A;  4XQN A;  3T53 B;  2CW0 D;  1JIC A;  1QJO A;  3RLF A;  4PMW A;  5IGB A;  1ENF A;  1U4M A;  1HFG A;  3KBX A;  5FO9 B;  5D3D A;  3KK7 A;  3Q6S A;  1RCV D;  5C4X B;  3A55 A;  3S1Q B;  3ND9 A;  1HPC A;  3SK5 A;  1STE A;  1SSO A;  1O7L A;  3BDC A;  2ID0 A;  4KKS A;  3I70 A;  3CRK C;  2GA4 B;  3GTL B;  2LFN A;  2E74 C;  1KLG D;  2BCO A;  5J1Z A;  3FVQ A;  5CMD A;  1EYA A;  5JPM C;  4RA8 A;  1DOM A;  4C1N K;  1A3V A;  2F0T A;  1K8O A;  2IW3 A;  2Y0S B;  2IJ0 A;  3Q0A A;  1G6Z A;  1HRJ A;  2QKI C;  5JEA G;  2KHS A;  1SMY C;  1EY0 A;  2F0L A;  2A6E C;  3PUX A;  3J81 E;  2KQ3 A;  2C9O A;  4OL7 A;  2B39 A;  1Y8P B;  5CV9 A;  4MIU A;  3ITP A;  2BA1 A;  3MFG A;  4PMC A;  2KCN A;  4QCL A;  4ZYS A;  1FNU A;  2RBM A;  2O5J C;  1O7Z A;  4B9W A;  1Y69 U;  3L7Z C;  3I4M B;  3PUV A;  2F3V A;  2WKD A;  2Q8R E;  3G6J B;  3K6O A;  5C5L A;  1UAP A;  3TDQ A;  2EYM A;  4XXE A;  3NBH A;  3NTH A;  1TY2 A;  1PRT B;  2EDG A;  2WV6 D;  5J39 A;  3DEP A;  5ELE A;  4HMI A;  4IN3 A;  3BVZ A;  4K8I A;  2F0P A;  4XDX A;  1SYG A;  4CKE A;  4KV6 A;  3S2D B;  4LAA A;  3QO2 A;  3S17 B;  5DM7 3;  3C46 A;  2SNS A;  2F0S A;  3S15 B;  2L0C A;  4IUV A;  1WTV A;  4ZK9 B;  1M4V A;  5FKA C;  1ML0 D;  1ICW A;  1SNP A;  4K2L A;  3M7G A;  2EVB A;  2K03 A;  4IUU A;  3NSW A;  2NWG A;  4KJN A;  2KEE A;  5IGD A;  1CA6 A;  3AB9 A;  5K36 H;  1LTB D;  4XT1 B;  2EYH A;  2PZT A;  3DXJ C;  1EEF D;  1C48 A;  5FLX L;  2DY7 A;  3KLS A;  2B2T C;  3S16 B;  4GZY C;  2A6H C;  2NYZ D;  4P2C B;  1JE4 A;  2C5C A;  4CGY B;  4ILW A;  1AZQ A;  3DEO A;  3HOU B;  1A15 A;  1SBB B;  3BG3 A;  1OXU A;  3P20 A;  1OXV A;  5CC4 A;  2A73 B;  3PO3 B;  5ELD A;  2HCC A;  3C3L A;  3K7A B;  3H6M A;  2MJ8 A;  3EJI A;  1RHP A;  5DNF A;  3HRZ C;  1PZJ D;  1L0Y B;  3NTI A;  3GTO B;  2IX1 A;  2D5D A;  2XNA C;  3GO5 A;  2F0E A;  5M9O A;  1QB5 D;  2JEB I;  2F0K A;  3A8J E;  1TII D;  5FO7 B;  5EJW A;  1ZKO A;  2L55 A;  5IGG A;  3OIQ A;  1PFM A;  5EKL A;  3OHX C;  4MN3 A;  3P75 A;  5T1I A;  4XTC S;  1BDO A;  4FYD A;  3K5O A;  5CR3 A;  4PV1 C;  1TWC B;  1NR2 A;  1G2S A;  2NVT B;  2A68 C;  2F0Q A;  4HR7 B;  4B9X A;  2NN6 I;  2VB2 X;  1S4Z A;  2D2C C;  1V43 A;  1D5M C;  1TR5 A;  4TQU S;  3UI2 A;  2IWH A;  1LO5 D;  1QWY A;  2OT2 A;  4KN7 C;  1ZEQ X;  5EQ0 A;  2EYJ A;  3I91 A;  3VYR A;  3NQI A;  4B08 A;  2D9U A;  3EA6 A;  1D5X C;  4Z9C B;  1EYC A;  1TY0 A;  3C2P A;  1PTO H;  3D4R A;  1AW7 A;  3RMH A;  2KJX A;  5EBC A;  1PTO D;  2EYL A;  3OOC A;  1Y8O B;  1LTI D;  1II3 A;  3E5S A;  4IAL A;  4O42 A;  5I2X A;  2H4O A;  3TZU A;  4RGO S;  1SDF A;  2NN6 G;  1VDZ A;  3FKI B;  1HQM C;  3VA7 A;  4G7O C;  1S5D D;  2B2Y A;  1ESF A;  2NTS A;  5EBD A;  2Q8T A;  2Z1C A;  1DJR D;  2PQE A;  5CGK A;  1QE6 A;  3MVV A;  3H94 A;  1FYC A;  2X6G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...