1SYBA

Transfer of a beta-turn structure to a new protein context
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
137
structure length
137
Chain Sequence
KLHKEPATLIKAIDGDTVKLMSSNGSPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title Transfer of a beta-turn structure to a new protein context.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase(phosphoric diester)
total genus 35
structure length 137
sequence length 137
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1994-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1sybA00
2ENBA 3OMCA 3T16A 5I9PA 5KYIA 3OMGA 2LKVA 5JAVA 2F0LA 2F0HA 2KHSA 5IOCA 4RKLA 2F0UA 3NHHA 4J6HA 3TP7A 4K2KA 1EY7A 1SYBA 4H7BA 5HURA 3ITPA 3TMEA 2F0JA 3D6CA 4QF4A 3H6MA 4QMGA 5EKLA 4F7XA 5CV6A 5IODA 4ZUJA 4R8NA 5C5LA 5ISRA 1A3VA 4NDXA 5J1ZA 2EY2A 2F0QA 1EYDA 2F0EA 1II3A 4K8IA 1STYA 4K8JA 2KQ3A 4YIJA 1EY9A 1KAAA 2F0SA 1EZ8A 3QOLA 4N9PA 2EYMA 3EJIA 2F0FA 4KY7A 3NP8A 4ZQ3A 3SK5A 2SNMA 4KY5A 3SR1A 4EQOA 5IIFA 3DMUA 5CC4A 1JORA 1STGA 3P75A 5DEHA 1SNOA 3NK9A 2RBMA 4PNYA 3EROA 2F0NA 4HMIA 2PZUA 1EQVA 3BDCA 4KHVA 4MIUA 5C6AA 4EVOA 1EZ6A 4I65A 4NP5A 4IZ8A 4OL7A 5C3WA 3MVVA 3TP5A 3D4WA 2WACA 3VA5A 1STBA 1A3TA 5C4ZA 1EY4A 1F2ZA 4DGZA 1STNA 1SYEA 2EY1A 3T13A 4RKBA 5C3XA 2EYOA 2F0OA 3SK8A 2PQEA 4K5VA 2SNSA 1EYAA 4K5XA 5KRUA 3OSOA 5CV4A 2PZWA 5CV7A 5IGCA 4IUNA 2F0WA 3BDLA 4S3SA 1NUCA 2HQEA 1JOOA 4F8MA 5KGUA 4ZUIA 5I6WA 4J1MA 1JOQA 5DAUA 5CV9A 4NKLA 3QOJA 5J39A 5KIXA 4ID6A 5KEEA 3OWFA 4KD3A 5CV5A 2EY5A 1SNDA 1EY0A 3RUZA 2F0TA 2EYPA 3SHLA 3C1EA 5J22A 2EXZA 2F3VA 3MXPA 4KTAA 1NSNS 5C5MA 1A3UA 4KY6A 1KDBA 2EYFA 3HZXA 1A2TA 3P1HA 4IALA 4KD4A 4ME5A 1SNQA 4N9TA 5E3FA 5EGTA 3TP8A 3U9OA 4DFAA 2EYLA 5K5PA 1ENCA 2OF1A 4ODGA 2SOBA 1AEXA 2NUCA 4TRDA 5IGGA 4WRDA 1EY6A 4K14A 3LX0A 4K6DA 4EQPA 1JOKA 4E6IA 4G57A 2F0VA 3HEJA 2O4XA 5IGDA 2EY6A 4KV6A 1TT2A 5CV8A 1SNCA 2QDBA 3SK6A 2F0KA 1IHZA 3E5SA 4K5WA 1U9RA 3SXHA 3V2TA 3D8GA 5KYLA 1F2YA 1KDCA 2PW7A 3NQTA 4PMBA 3PMFA 2F0PA 1EYCA 2M00A 2OEOA 2F0MA 2RDFA 4QB4A 4DF7A 2F0IA 2F3WA 3R3OA 5HGTA 2RKSA 1EY5A 4KJOA 1EY8A 4EQNA 5I6YA 4HMJA 4K2LA 4LAAA 5F2DA 5IGBA 1SYGA 1SNPA 3TP6A 5E1FA 4KJNA 3NXWA 4PMCA 3SK4A 1TR5A 5IGFA 3MEHA 5EKKA 1SYDA 3D4DA 1STAA 1SYCA 4B9XA 1A2UA 1SYFA 2OXPA 3MZ5A 2F0DA 4HTHA 5CGKA 2EYHA 4B9WA 3MHBA 3C1FA 5JOBA 3S9WA 2PW5A 5NUCA 4DU9A 3DHQA 2F0GA 3QB3A 2PZTA 2EYJA 3EVQA 1KDAA 1ENAA 5IGEA 1RKNA 1STHA 1SNMA 4NMZA 2PYKA 5CR3A 1KABA 3ERQA 3NUCA 5C4HA 1TQOA 4WORA 5I9OA 5M9OA 1F2MA
chains in the Genus database with same CATH superfamily
3OMCA 3HKZB 5KYIA 3J80c 2PMZB 4C3HH 1B9NA 3CF5A 5ELFA 4JI1Q 2F0JA 1YVCA 2KUMA 3L2PA 1SMYD 4HSPA 2JA8B 2E2DC 1KXLA 1YIJA 2JA7G 4JV5Q 5ISRA 1IBLL 1DXMA 2XRQD 3V05A 4KKTA 3HKSA 5C0XI 1BCPF 3K7AH 3HKZE 4LF7L 1EIHA 1ESRA 2PMZE 4TSSA 1YZ6A 1JWMD 1HZAA 3P75A 4GLAC 4DNRB 2JJQA 4HMIA 2BOSA 2UXBL 1QVCA 1N36Q 2JA6H 2X6GA 1WD0A 1N32L 1XTDA 3QJYA 5C4ZA 1F2ZA 1Y69U 1HRJA 4O2DA 2UUAL 2F0OA 4FXGC 4IQZA 4UDUC 3I8ZA 3GTOH 2JN4A 3GTQB 3MXNA 4DR5L 2WV6D 4R4IA 1AFPA 1B70B 3C46A 1FJGQ 1WD1A 3CCSA 4JI4L 2JXMB 2PO4A 3GTPH 2NN6H 1WTOA 2I5HA 1TY2A 1HH2P 1K8MA 5A2QE 2EY5A 1HR0W 3HKZG 4JI8L 2AQ3B 4QIWE 1HFGA 2RQXA 4OIJA 1VQHA 1Z6HA 2VW9A 2K4KA 1PFBA 1UEAB 4GS3A 2JA8G 1ILQA 1CQVA 2RVLA 4LF5Q 4CJ0B 1YNJD 5KNDA 1JJ2A 1G2SA 1TU2B 2K03A 4HJ8A 3I91A 1O7YA 2UU9L 5CV8A 4JI0L 1W6JA 3MAQA 2NWGA 1YHQA 2H1EA 3A7LA 5FLXE 1IBKL 1Q86C 5FJ8G 4B3MQ 4JI2L 2RKSA 4DR4L 2CW0C 2Y0SB 1RODA 1TS3A 5F2DA 5JJZA 5FLXc 3S1NB 4G7ZC 2A69C 3H3VC 2NBFA 1SYCA 1L0YB 1JWSD 2EVBA 3F2BA 4A3JB 3V96A 2L12A 3AMUA 5JOBA 4DU9A 3MA2B 1UUPA 2F0GA 4P73A 5LMUQ 1KQSA 1VMCA 1Y8OB 1HA6A 4A3GH 4FO2A 4CGYB 2XN9C 5CR3A 4DUZQ 4H13C 3ERQA 1QB5D 4GN3B 5KGUA 1Y1WH 2Y0SE 2EOTA 1F2MA 1UE6A 2M9VA 4DPGA 1S72A 2NYZD 3I55A 2A5HA 2QEXA 2OQKA 4CBVA 1SFOB 2EDGA 3BZCA 2MPMA 3D6CA 3H0GB 1S4ZA 1TY0A 1XWEA 4JI3Q 1Z47A 1FL0A 3A8JE 5CV6A 4NB3A 1ZKOA 2R92H 4QJFA 4DA2A 1KLUD 5IYDG 4NW2A 2NVXB 3QOLA 1D2BA 4KY7A 2F0FA 4POFA 1EOTA 1SSOA 3F2CA 4X6AH 1F9SA 1SNOA 5M5WB 3EROA 4JYAQ 3D4RA 3SDZA 1RIPA 1YHAA 4LUOA 5E7NA 2Y0SG 1N34Q 3PO3B 5EQ0A 1NY4A 1I4PA 1RCVD 1Q46A 2EJGC 1Q90A 1PTOF 2SNSA 2K28A 1X3FA 1H9RA 1N9WA 3E9IA 4A3JG 4IFDI 3D0FA 5A2QL 3T1HQ 4A3EB 1XJVA 4MZ9A 4C3JB 5AJ3Q 3U9SA 2PNHA 4DV1Q 3HOYB 1EFID 1JOOA 3NPPA 3BYTB 1JOQA 4BA1I 2YU9H 3QOJA 1PA6A 3G6JB 1LM0A 2EJMA 4OELB 2OTJA 1CFMA 2FFKB 3S1QH 4KTAA 2ZTDA 3HS0C 1NSNS 3I56A 1K8AC 4ME5A 5IY0A 4FP5D 3BDOA 3H0GG 1I3QB 1ENCA 5A35A 1HJPA 1TS4A 2ZXOA 5M3FG 2WKDA 5FLXL 4H02A 1CKOA 2IX1A 1UEBA 3A7AB 2C35B 2ZJPA 4DV2L 1TWHB 1U9RA 2K05A 3NENA 2EQSA 2IY5B 3I70A 3NQTA 3KYHC 5C4JH 1EYCA 4PG3A 4YCUA 4C3HB 1H9SB 1KC8C 1U4MA 4OWWB 3BJUA 2P5ZX 4XDXA 2WAQB 4R4OA 3PO3G 3NXWA 4G7OC 3KK7A 4NXML 3SE0A 1VQAA 3H94A 2WB1B 4O42A 1BCPD 4Y52H 1GM5A 2OQ0A 4C3JG 4LF7Q 3HOYG 3SVMA 5GQOA 2QDLA 4A76A 4BY7B 4JPBW 5M9OA 4RGMA 2VZAA 2JA6B 1CKMA 2WAQE 4GNXB 1EQQA 2UXBQ 2K5HA 2N3SA 4CKEA 2Z4IA 1Q3LA 3GTOB 2DJGC 1JB3A 2WB1E 3I73A 3GTMH 2UUAQ 1X65A 4F7XA 2IHEA 4DR5Q 1AW7A 1Q1BA 1Y1VB 4JI4Q 2SDFA 5AFWA 1B2TA 1STYA 1Q7YC 3WWVA 3CC4A 2SNMA 4JG2A 3CAMA 4JI8Q 5DNFA 2A6ED 4C3HG 2NVQH 3PIOA 4DNIA 4NP5A 5GROA 4RHRA 3R93A 1EY4A 2I46A 2WAQG 1I4QA 3BVZA 2R6GA 2YTXA 1SE2A 2WB1G 4N8FA 1EFWA 5C0XH 1CZWA 4A3CH 2UU9Q 1QZGA 2NVYH 2L11A 5ELOA 1RL2A 2B2VA 4J1MA 1CA5A 4LFBL 1IBKQ 5J39A 4R4TA 2L5TA 4BY7G 4KD3A 2B2UA 5ELBA 4JI2Q 1BF4A 3M3YH 4A93H 4DR4Q 2SEBD 2JA6G 3W5OA 4YCWA 2Z6KA 1DONA 5JEAH 2A8VA 4JI6L 4HIKA 1ASZA 3I90A 1VQ7A 5EPKA 4IO9A 3I4MB 3EIVA 3AEVA 1JOKA 1EWHA 1Y1VG 4AH6A 3BZDB 1PFSA 1LUZA 3G6EA 1PRTF 5E4WC 2NN6G 3SGIA 4RWSC 3GP7A 4ZLTF 1IBML 2JK8A 1VQPA 1D5XC 1E22A 3PUYA 3UDXA 4QB4A 4XQJA 1TVXA 3GTJH 4KJOA 1UNSA 4IOCA 3OIQA 5IGBA 1ASYA 2K04A 4ZKCB 2J7ZA 1ICFB 2HIVA 4JBMA 1BDOA 5EPJA 3S16H 1A2UA 3NTHA 3M7GA 3MZ5A 1YJ9A 3E3XA 4B3RL 5JEAJ 4CDFC 1ENAA 4LWCA 1L0XB 1STHA 4OWTB 4A3IB 1GOZA 2CWPA 1NMFA 1TQOA 5I9OA 5J22A 5LMNW 1J9OA 2ENBA 4LNQA 2L15A 2B2YC 3OHXC 2YTVA 1IYUA 3NQIA 2GA4B 1KLGD 3EBEA 1KL9A 1R4PB 3STBD 5D14A 2RDHA 4ZUJA 4IJLA 4Q0FA 1LTRD 4RMFA 5G3LF 1BCPC 1D1KA 1N33L 4L5TA 1Y1WG 2ZM6L 4DV6L 2L4NA 4PZ7A 2Z9HA 3CC2A 3S1QB 4PNYA 4HJ9A 1RTNA 5C6AA 1CKNA 4FF1A 4I65A 3U58A 4Y7NB 3SK8A 2K5QA 1X3GA 2B8GA 3TZUA 5KNBA 1EYAA 1L2FA 1AZQA 1C4QA 1H9KA 1ET9A 3M4QA 2KCNA 2CQAA 4S3SA 1JCKB 1I50B 1BBUA 5JJLA 5IYCH 4DV2Q 4PV1C 3KUPA 5C4JB 1K83H 4A3IG 4NKLA 1HCZA 2NVTH 2QILA 1TWCB 4DKAC 5H1SE 1R9TB 2A6EC 5IP7H 1E24A 5CV9A 5DLQE 3HZXA 3T1YL 4DFAA 2CH4A 3HP3A 1JQYD 3QIAA 2NUCA 4IFDH 4DK6C 4AIMA 4JI5L 2QA4A 1TWGH 2MFIA 3K81C 1O7LA 1TT2A 1UWVA 1HXYD 2RDFA 2F3WA 1WTWA 4GKKL 2MQHA 4LAAA 2K14A 2QEJC 3ERSX 1PH8A 3ZJYC 2F52A 3D4DA 3OWEB 2BDNA 2FMCA 1NAPA 2DJFC 2EYJA 1KDAA 1UAPA 1Q8IA 4IPGA 4LF6L 1A8VA 2AHOB 4QY7A 4ZCKA 1ENFA 3DXJC 3BYYB 2NVQB 4O0AA 2LKVA 2AQ2B 4UPAA 3GV3A 4CDDC 3ITPA 1K8OA 3CCMA 1A3VA 2E75C 2NVYB 2BA0A 5FOBB 2MUYA 5C3EH 1JB7A 4LFBQ 1FGBD 3SK5A 1OTCA 3NP8A 5IIFA 1DCZA 2Z4HA 4A93B 5C4XH 5CC4A 2PCFB 3A8KE 1WCMB 4ZKBB 1IZ6A 4AQYL 1NBWA 3G4SA 3BDCA 1EZ6A 3RN5A 5C3WA 4JI6Q 4LMQD 3I3CA 4RGNA 4DV4L 2NZHA 1PTOC 4WJ3M 4YWLA 1IKMA 1RTOA 3HRZC 4XIGS 1PRTD 4R9WA 2F0WA 3HOVB 3CCEA 2D0PA 1IBMQ 2JQOA 2ICEC 1UE1A 1B7YB 2XTIA 3GTJB 1PLFA 1T5XD 2F0TA 2EYPA 3WDNA 4QL5A 1CQFA 1V9PA 3KJPA 2F3VA 5C5MA 3NE5B 4UAIA 5E3FA 1GUTA 2B2WC 3IFDA 4P72A 2IW3A 1S5CD 3URYA 2HDMA 4B3RQ 1QE6A 4WRDA 5C0XG 4A3KH 1JT8A 5IGDA 5DM63 4AYBB 4HJ7A 4DAMA 3SK6A 4R1JA 3D8GA 3NBHA 1G91A 3PCOB 3CCQA 4A93G 3HOUH 2CW0D 1IYJB 2E5LL 3W3AA 1U5KA 1EY8A 1O80A 4JBWA 2A69D 4MN3A 5JEAG 2CFMA 4GLVB 1QUQA 5E1FA 1SN8A 5EKKA 2XWJB 2JA7B 4AYBE 4HTHA 5G3LD 2PW5A 3T51B 1YHBA 1XPRA 1LT3D 1N33Q 3A8IE 1X3EA 1SNMA 1OXTA 1VMPA 2B3GA 5EBCA 2ZM6Q 4DV6Q 1V1QA 1CSPA 1NE3A 3FDTA 1I5FA 4FVMA 1SYBA 3GTKB 1VCIA 1Z7TA 3TMEA 2F03A 3E9HA 1D5MC 3HOXH 5JJIA 1GUNA 1SMXA 3I4NH 1V1PB 3OOCA 3OW2A 3MXNB 3VA7A 3R8BA 2KHJA 1WTPA 4AYBG 1EY9A 2B63H 1STEA 2FINB 1AE3A 2NVTB 4UHVA 2KENA 1H9JA 2E74C 4JBJA 1ZYRC 4L5RC 4EQ5A 4BBRH 1PH9A 4F87A 1GVPA 1PYBA 4C1NI 1MSGA 2G9HD 4L5SA 1SYEA 1S5ED 3RLOA 4K5XA 4JI5Q 4YHHL 1Q1EA 3KJOA 3NELA 2HQEA 2K75A 2CQOA 1RHPA 3M4OH 5FKAC 4Q5VA 1TWFB 2ZJRA 3ND9A 1SROA 4GKKQ 2AWOA 4IUVA 1YJWA 1SE8A 3KOJA 4IALA 4JOIA 3U9OA 4QIWB 2BA1A 3K5LA 1V1PA 2OF1A 4ODGA 2SOBA 1I4RA 4TRDA 1XYIA 1XMOL 5GAGC 3PQIA 2E76C 2ZTCA 2RHQB 4G57A 1PRTC 1TIID 1SNCA 2KOLA 5IYCG 2VY3A 1E3PA 4LF6Q 4K5WA 1JORA 1GHKA 1EWCA 2R7ZH 3QR8A 2JP1A 3G48A 5I6YA 1FD7D 1ZEQX 2WP8J 3NBIA 3MFGA 5IGFA 3MEHA 5BN5A 3EFXD 5M5YH 1B44D 1SYFA 4C2MH 1A6XA 4B9WA 2B29A 2Q2IA 2K5NA 5NUCA 5BN4A 5C3EB 3ER0A 5JVH3 4UP8A 3ICEA 5K36H 1XPOA 4XYOA 3H15A 2X69A 2J4XA 3FP9A 4AQYQ 4MTKA 2JA5H 2BCOA 1JICA 4OO1I 1VQMA 1EY7A 1Y14B 3KBGA 4DV4Q 5FO7B 1AN8A 2KCTA 4KHZA 1SLJA 4A3MH 5IODA 4OXPA 1MJCA 3KLSX 1B1ZA 3FPUB 5J1ZA 4DR1L 3TQYA 3KF8A 3UI2A 4JBKA 2UUCL 1PDQA 2YV5A 3CHBD 4A3FH 3E6ZX 4KY5A 3GTLH 2X6LA 3PO2H 1WOCA 3A54A 3NEMA 1I6VC 2F0NA 1EQVA 3OTOL 2LXKA 3CQZH 1PH4A 1QNKA 3RNUA 2DNEA 4ILWA 1SR3A 2AQ1B 3A0JA 2VQEL 4DK1A 3KLSA 4WJ4A 2F4VL 2I07B 1ESFA 5CV4A 5M3FB 4A3KB 5EAYA 2PZWA 2NTSA 3S1RB 1HPCA 5C3EG 4ZUIA 3BZKA 5I6WA 1ML0D 1HTPA 4B3SQ 2D0OA 4G4KA 2JSOA 5CV5A 3SHLA 1B3AA 1W6KA 1X3QA 2E5LQ 1S5DD 3C1EA 3H09A 5I2XA 1PYSB 2JE6I 4EGVA 1A2TA 3WOEA 5IGGA 2QKIC 3J7ZC 4X65L 4K6DA 2DUDA 2C5CA 2O4XA 3X3MA 4IOAA 1M4VA 4X3TA 4H44C 1CK1A 1HZCA 3ZYYX 4V190 2K5VA 2PW7A 2BDOA 2M00A 2OEOA 1PVOA 3RLNA 1CHQD 1FNVA 4TVAB 1EY5A 3GTGH 4K2LA 3J7YW 4YCVA 1OXVA 3VR5A 3SK4A 1B50A 3HOWH 3RR5A 4GLXA 3C1FA 4X66L 4A3KG 3QB3A 1GUWA 2PZTA 5FO8B 2MP1A 1GHJA 1RF2D 1S40A 1PH6A 2PYKA 1JWUD 3EQLC 5C4HA 1SJED 3TRZA 4DR7Q 5I9PA 2DY8A 3FPPA 1IL2A 3U50C 1A15A 1LTSD 3MC0B 2G9DA 2GVBA 5HURA 1EU3A 3TZDA 2ALYB 5IYBH 2KVMA 4OONA 1N8RC 3FHWA 5DM73 4YHHQ 5EKIA 3BU2A 3PIP3 4KHPL 2EJFC 3BS1A 4RA8A 1IBLQ 4QUFA 1EYDA 4RHSA 1K9MC 4QGUA 2LFNA 3K7AB 2HIXA 4YIJA 3GO5A 2IWHA 2K52A 3SR1A 1IYVA 3DMUA 1IKLA 2FXQA 2I5LX 4CJ1B 1K73C 4BWGB 1LACA 1XNQL 5FO9B 3RLFA 1N32Q 3K0YA 3FRPB 2KA7A 2NZOA 3HOXG 4RKBA 2EYOA 4P75A 3OSOA 2KEDA 2Z6BA 1XMOQ 2IL8A 3GTPB 2XRSD 2ZT9C 1D6EC 2BH2A 3AU7A 4POGA 1J5EL 2R7ZB 3OPOA 3HOZH 1FNUA 3OWFA 4DXGA 1I4XA 1LYLA 3MXGA 4BBRG 1Q82C 3CKIB 1E1TA 1X54A 1MI2A 3JAMi 5M5YB 4PZ8A 2OT2A 4C2MB 3LX0A 3PUZA 2F3IA 4JI0Q 1VQGA 1IHZA 2LSSA 3F1ZA 5EPLA 3TBIB 5CMDA 2RA4A 5JVG3 2JA5B 3T56B 3RZDH 4LF9L 1PTOH 3PSIA 2XIWA 4MTNA 3Q8DA 4A3MB 1E7ZA 1TXYA 4QQBX 1PMRA 1JE5A 3LWUA 4FNFA 4DR1Q 1K0RA 4A3GB 1XMQL 4A3FB 1Y1WB 4NMZA 3GD7A 3GTLB 3PO2B 4LFAL 2R7ZG 3T16A 3CXCA 5C0XJ 3CQZB 2R93H 3OTOQ 2A6HC 2KHSA 2N8NA 4RKLA 2O2LD 5D3DA 1E0BA 1CKNB 5J3BA 2WFWA 4FF2A 1OXSC 4GN5A 1DD2A 2F4VQ 1G291 1X32A 3UDGA 2E2JH 2R92B 4K0KL 3EN2A 4XYQA 3I7FA 1FYCA 1CUKA 5K36G 1VQ5A 3M7NA 4R4QA 5JJKA 1HUNA 2JA5G 1YBYA 3PF5A 4OO1H 3X3NA 1VQIA 2HUGA 3DEPA 4HCSA 5LL6X 4IJHA 4G7HC 1IW7C 1PTOD 1BO0A 2VB3X 3BG3A 2K33A 4KK7A 1SE4A 5BR8L 1SDFA 2VL6A 5HY6A 4A3MG 1BCPB 2UUBL 1JJGA 4X65Q 1VQ8A 1D7QA 4HIDA 1EYGA 2OWOA 1EOVA 4XQNA 4A3GG 4A3FG 2YU9B 1U4LA 1HNZL 2ASBA 1F9RA 2IHFA 1K3RA 3PO2G 4X3SA 2ZJQA 3GTGB 2EXZA 4IPHA 1T9HA 1Y8PB 1B3QA 4KI0A 1W2BA 3HOWB 4KY6A 3AFPA 2YYZA 2A68C 3U4VA 1A62A 1LTGD 1AEXA 1BBWA 4X66Q 5HGQA 2R92G 3HEJA 1SXTA 2TSSA 2QDBA 4U673 1I4HA 2B2YA 4GZYC 1FGUA 3R3OA 3PGZA 1BNZA 2QGQA 2VNUD 2AMCB 1SNPA 2EPBA 3K57A 3TP6A 2N55A 1VQDA 3T53B 4NXMQ 4QUCA 2KJXA 2OXPA 3I4LA 4KHPQ 4A4IA 5LMNL 5C44H 1Y8NB 1BVSA 2GN5A 3PUVA 4APVA 4CDEC 4X3KA 5IGEA 4BXXH 1PV4A 2YTYA 2K1BA 2NN6I 1VQOA 1KAWA 3ULPA 2XSCA 1EU4A 1E2VA 5KNCA 2N49A 5HGTA 1VDZA 5IOCA 2OTLA 4DK0A 2F0UA 3D6WA 5EJWA 3S2HH 3GTMB 2VB2X 2UXDL 1XXGA 2CH4W 4RH6A 2JA8H 3HOWG 4JK1C 3S24A 2Z1CA 3M4YA 4C1NK 1WTVA 4IUPA 5TSSA 2KCCA 1A0IA 2LMCB 1II3A 1GUGA 3NSWA 2D5DA 1WTRA 3MTSA 1EZ8A 1F9QA 5ELCA 4LUVA 4DR2L 1J5EQ 1J8IA 4IFDJ 1ZYRD 4BY1H 3J81L 2JEBI 4DR6L 1RJTA 4EVOA 2KCMA 1CSQA 3GDEA 5JPNC 1V8QA 1EIGA 2JA9A 4CKCA 3O13A 4M8AA 4K5VA 5KRUA 1XNRL 1MIUA 1FJGL 2VS1A 1NUCA 3J7AV 3K5MA 3UE1A 1D1IA 3MXUA 3Q0AA 1LTTD 1B8AA 1FNWA 1ONLA 1CI3M 1X3PA 3HG9A 1DOKA 3M3YB 3NBHB 4N8X1 3W2DA 4LF9Q 4B08A 1PTOB 1ET6A 2F4IA 3RZOH 3LWEA 3ND8A 3TREA 3JC66 1H95A 1QUQB 2EZVA 4EQPA 1YEZA 1Q12A 2KECA 2F0VA 2CCZA 1XMQQ 3VYTA 4CHTB 3E5SA 1PH5A 4LFAQ 3HOZG 2R93B 2F0MA 2HCIA 1VQKA 4O1NA 1GUOA 1LT4D 3A55A 3S1NH 3P20A 1TR5A 3S16B 2I0QA 3LNNA 2E2JB 1STAA 2H5XA 5CGKA 2F0DA 4A3JH 4K0KQ 4I7AA 4HIOA 5LMUL 4A3CG 1EIFA 5ELDA 2PPBC 1WTXA 4CJ2C 4HJAA 1O7IA 4YY3L 1V1OA 4L8JA 2EXDA 3D31A 4CKBA 2F0LA 2F0HA 1I94L 3NTKA 3AYHB 4H0LC 2E2HH 1SFOH 3BVMA 3F8TA 4TKOB 5BR8Q 5IWAL 2UUBQ 1XTCD 5C5LA 4YWKA 3Q24A 3TS0A 4IUTA 3G71A 2F0EA 5IT9E 1KNAA 2Z0SA 3L9AX 2AWNA 3RN2A 4K8JA 2KQ3A 1QVGA 4C56C 4JI7L 2Q8IB 2NVXH 2A1AA 1CTMA 3J81i 1HNZQ 4EQOA 5IT9c 1EQTA 1G51A 3TN2A 4ALPA 2B2WA 2R93G 1IL8A 4KHVA 3ULLA 4A3LH 3R2TA 1M8AA 3KFUA 3L7ZC 3T13A 4A75A 2D2CC 2JYOA 3AB9A 1WJJA 1EEFD 2MNAA 1MGSA 2HDLA 2Q2HA 4ULLA 4A3EH 4IURA 2RHSB 4BBSH 1K83B 5DAUA 2QCPX 2L0CA 4WJWA 3Q6SA 3EA6A 2O5IC 1E2WA 4RFBA 4LF8L 4OO1G 3KDFB 1C8CA 1G6PA 2A74C 1TWAH 3IKJA 4OWXB 4DK3C 3TP8A 3T1YQ 2Q8TA 1LLRD 5K5PA 5D3IB 5LMNQ 1PFNA 1TWGB 1C7YA 1BBXC 2K01A 4LF4L 4WFN3 1Q81C 1NR4A 4B3TL 1VF5C 4XT1B 2F0PA 4DF7A 1FR3A 1NJIC 3S2HB 3RMHA 1HQRD 2UXDQ 1PZKD 1HNXL 2JEAI 3CCLA 5FK9C 1WTHA 3OIPA 4UY8C 1R4QB 2H4OA 1PRTB 2OCEA 3S17H 4PMWA 4RCNA 1PHJA 3I72A 1U4PA 5T1GA 2ZXPA 3IAYA 1C48A 3DHQA 4XT3B 4XQQA 3EVQA 3KF8B 4DR2Q 3JAME 4BY1B 4BY7H 2RF4A 1FVIA 2N88A 3KDFA 4K6LA 4A3BH 4DR6Q 3P7JA 2LY7A 2ICIA 2K50A 3NHHA 3JAMc 3VR3A 5IP7G 5IT9L 5T1IA 5GAEC 4R4CA 1XNRQ 3J7A5 1LTID 4ZAIA 4GN4B 4IFDG 4X64L 5C44G 1XPUA 1NMGA 1Y1VH 1CM9A 3CPWA 2UXCL 1VQBA 2DNCA 2KEEA 4K8IA 2AUJD 4BXXG 2GVAA 3W1GA 3PUXA 5CBAE 4IN3A 4KKSA 1T5EA 4V0BA 3EJIA 5CBEE 1WVLA 5C4XB 5EBDA 4RGOS 5IP9H 1W3SA 1QG7A 3NK9A 1JE4A 3RZOB 4DV7L 4QCLA 3NTIA 2HCCA 2XWBB 3D4WA 2WACA 2J0TD 3UE0A 1A3TA 4LK1C 3VA5A 2RDGA 3GQBA 4UP7A 1EL0A 2A73B 5M5XH 3U4ZA 1SJHD 3CPFA 3L3OC 4J15A 2R61A 4OEMB 1MJEA 3S2DH 1GD7A 2HHHL 1LTBD 2XVSA 1VQNA 3AFQA 2ES2A 2E8GA 3FVQA 4DNTB 4BY1G 3LGJA 4LJZC 4DV3L 3MXPA 2R3ZA 5FLMH 1VQJA 2F1MA 4N9TA 1ICWA 1DYQA 3K6OA 3J80L 5CORA 3I4MH 1A63A 5CYUA 5L37A 1Q8KA 1OXUA 4JW0A 3KLRA 4OX9L 3PIO3 3CP0A 1HR0L 2F0KA 1JR0D 2MGSA 5KYLA 3SXHA 4YY3Q 1VF7A 5E4XA 1F2YA 4DAVA 3PMFA 3HOUB 5C4XG 3A5UA 2VXWA 3J7AF 2E2HB 3G7LA 1I94Q 1EIYB 1XX8A 3CRLC 3DUZA 3QG1A 3QO2A 1CHPD 1PFMA 2B8FA 3S14H 3HFZB 4DUYL 5IWAQ 3D3RA 4C3IH 1K28A 1BR9A 1YNNC 3S9WA 3JAML 1PH1A 2L9HA 4MHEA 3KLWA 3FMCA 4JI7Q 1VQ4A 3M9BA 5D65A 1M90C 4A3IH 2CKZB 1BOSA 4DXFA 1SAPA 4KLKA 1B4OA 4JVZA 4P2CB 4J8QA 2A6HD 2ZTEA 1OO9B 5JPMC 3F2DA 4ZYSA 4HSVA 4FF4A 3HOXB 2R7DA 5LL6S 1SMYC 3I4NB 5ELEA 1CT1D 4NDXA 2EY2A 1BKBA 1SEBD 3DWPA 3VR4A 2L1BA 2C9OA 1YNXA 4BBSB 3CD6A 2Q8RE 3TEHB 2QF7A 4HR7B 4F88A 2B63B 2F0SA 1X9NA 1STGA 4LF8Q 3AQQA 3N6RA 1TWAB 3HOUG 4BBRB 1VQCA 4HEDA 4IZ8A 3Q22A 1HNWL 2EE1A 1MBYA 4Y7NH 1IW7D 1STNA 4DV5L 1E1OA 2B2TC 2TMPA 3ONAB 1QCBD 1HZ9A 4RG1A 1K8GA 2RSNA 4LF4Q 3I4OA 1I50H 1KD1C 3M4OB 2MO0A 2IPKD 3A56A 3WOFA 2IT1A 4B3TQ 4DV0L 3C3LA 4ABNA 2HT1A 1SNDA 4A3LG 1TWCH 4OHJA 1QNUA 4Z9CB 1R9TH 2FHTA 3J80i 1HNXQ 1A3UA 2EIFA 1SNQA 2A68D 4JCVE 3S17B 1Z9FA 3I4NG 3PF4A 1PYWD 3NWSA 1YNJC 4MNOA 5GADC 4HJ5A 1LT5D 4A3EG 2AUKA 2V1CC 4BBSG 2L55A 3A5ZB 3CCVA 3V2TA 2IX0A 3FKIH 4LUZA 2B63G 4PMBA 2MHVA 1B9MA 1G8ZD 4DR3L 4A3BB 1SBBB 2B2TA 1J6QA 4LFCL 2B2VC 4HMJA 1YITA 1L0WA 3VR2A 1X6OA 3I2ZA 1KIXA 3H3VI 2WINB 4GNXC 4KJNA 2B2UC 3CW2C 1CZGA 3J81j 1H9MA 1QZHA 1SYDA 1LV9A 1RDPD 3B6YA 3HGBA 2Z6KC 1RD9D 1TS5A 4X64Q 4FF3A 2UXCQ 2LXJA 4TQUS 1K3BC 1P8LA 1U4RA 1KTKA 3DLLA 1KHIA 2CVRA 2LS01 2ATWA 2D9UA 4U68A 4M1UB 1BUVT 2N78A 3NUCA 1H9SA 4WORA 3Q23A 1WTQA 1QJOA 2I5MX 1JC7A 4DV7Q 4HIMA 3TP7A 3S15H 2DGYA 4H7BA 3CCJA 4A3DH 2ID0A 5M5XB 2Q2UA 3S2DB 5EKLA 4IUUA 4R8NA 1D8LA 3DWAA 1DOLA 2F0QA 2HHHQ 1WFQA 2XNAC 3PV0A 3OYYA 3CMAA 3T4AC 4N9PA 4ZQ3A 2UUCQ 3C2PA 4HAEA 2BE5D 3F2UA 4GNXA 1WCMH 4A3BG 1PXUA 2HD3A 2NZ1D 3R2IA 4DV3Q 2E2IH 1QILA 4XXEA 2VQFL 4GKJL 3MVVA 1KRTA 4P74A 4DGZA 5C3XA 4X62L 1LT6D 2VQEQ 1V43A 2MJ8A 2CHBD 3W1BA 4ZRZA 3K59A 3K7UC 4OX9Q 1HUMA 1EWIA 1HR0Q 3HOVH 2CWAA 1O78A 1DGSA 1F77A 1PZID 4ID6A 5IP9G 2M2LA 1OXXK 5M3MH 1EEID 1M1KC 4X3UA 2IJ0A 3S14B 1HHVA 3UDFA 1VQEA 4CDCC 3E0EA 4C3IB 4YWMA 1CA6A 4LW1A 1JMCA 4DUYQ 3J81E 3BVGA 1HTLD 4PZ6A 1G2TA 4K14A 4FXDA 4E6IA 2VUMH 3S1MH 4KN4C 3J81c 2EY6A 1MSHA 3TS2A 4ME3A 1C9OA 4JC0A 4DAPA 3PIPA 3KF6B 1I6HH 3CRKC 5FLMG 1YJNA 1GUSA 4FDBA 1D5ZC 2PI2E 2KHIA 4NXNL 1YI2A 3I4MG 4DN4M 1DOMA 3TDQA 2JA7H 1K0SA 4XTCS 3M85A 4DAYB 4IPDA 1BXTA 1P16A 1RKNA 3VYRA 1LABA 1KABA 1B53A 3L0OA 4RGTA 1G6ZA 3OMGA 1S3OA 4L6TB 5LHY1 4J6HA 4K2KA 1HNWQ 2WKCA 3E0JA 2NB0A 2D62A 1WI5A 4DV5Q 3TSSA 3GTKH 2PQAB 4QMGA 3CC7A 2PI2A 4C3IG 2Q2TA 1L1OB 5ELNA 4RCOA 1DJRD 1JJCB 4UP9A 1L1OC 4DV0Q 3N52A 3KF6A 5DEHA 1HQMC 1QOHA 1O7ZA 2RBMA 3DEOA 3IFTA 4MIUA 1XNQQ 3DWQA 2NTTA 4HCEA 4EX5A 2RCFA 4OL7A 3K5NA 3TP5A 4JI1L 2EY1A 4IPCA 2PQEA 3K80C 4DAYA 4JV5L 1GJXA 3RD4A 1S5FD 3BDLA 3FKIB 4F8MA 5COYA 4FYDA 3HOZB 4DR3Q 2K7VA 3RUZA 1UE5A 2BE5C 1EY0A 1TWFH 5FJ8H 5I2YA 4LFCQ 1N36L 4GOPB 3MEFA 1KDBA 2EYFA 4KD4A 1LTAD 2PQAA 5EGTA 3DM3A 3M4PA 5BN3A 5IYBG 1DM0B 2K5DA 4GOPC 1L1OA 4FXKC 2FMMA 3UDIA 3GTQH 1AH9A 2WIIB 3K58A 4KN7C 2FJ2A 1NNXA 1NTGA 4P71A 3RZDB 1TS2A 1NCVA 3S15B 4EQNA 1EUJA 1HA5A 4A3DB 1SYGA 4I7ZC 3QWNA 1E2ZA 1LO5D 2QW7A 3GV6A 1VQ6A 2DN8A 4PQXA 3CCUA 4OIKA 3K5OA 1IXRA 4LF5L 1MHWC 2EYHA 1PH3A 5IYDH 1BQQT 1PZJD 5IE8A 1WYDA 1AZPA 4OGQC 3FKIG 4BS9A 1QWYA 1F2LA 2RCNA 2E2IB 1UE7A 2BH8A 5JAVA 4B3ML 4GOPA 3H3VH 2V4DA 4GKJQ 2VQFQ 2K5WA 4X62Q 4L5QA 4QF4A 3H6MA 2PNRC 1NR2A 3FEWX 3KBXA 2RSOA 3STBC 3NWTA 2MO1A 4L63B 3VYUA 2HQLA 1KAAA 2B39A 4KMUC 2EYMA 4DUZL 2G5DA 1KNEA 2XGTA 1S5BD 5M3MB 5GAHC 2AKWB 2PZUA 1KRSA 1MD2D 2Z8LA 1ZXTA 1STBA 4A3DG 3VDYA 1ILPA 4ZK9B 2R7FA 3H0GH 1PH2A 4JI3L 2A19A 4NPSA 1AE2A 3VYSA 3S1MB 2VUMB 3MWYW 1MKHA 5M3FH 5CV7A 5IGCA 3CMEA 4IUNA 3K8AA 3S1RH 1VQFA 3ULJA 3VR6A 1F9PA 1DZ1A 2K32A 3A74A 4B3SL 5KIXA 5KEEA 3H91A 1WCMG 1I6HB 4JYAL 1AP0A 5M5WH 1N34L 2O5JC 3PUWA 3P1HA 2IX3A 4NXNQ 3PO3H 3OW7A 1SRUA 5I4DA 2EYLA 4R8IA 3IRBA 1EY6A 1EQRA 1GKHA 3T1HL 1PH7A 1VS0A 1GXDC 4KV6A 1X56A 2K6AA 5AJ3L 3HOVG 4DV1L 3CCRA 4C3JH 2ZXRA 4KKUA 3HOYH 1C0AA 2DY7A 1KDCA 3DM1A 2F0IA 1HZBA 3SEBA 1TKWB 5M3MG 4HN7A 4PMCA 1X55A 1VQLA 1SE3A 3MFYA 4B9XA 4IUQA 1I3QH 1YNND 5C44B 3MHBA 4RAUC 3IL8A 1U0LA 4JOIC 2VUMG 4BA2I 2KBNA 3CU7A 3K0XA 1VQ9A 3J80E 1QVFA 1GO3E 1I4GA 1HFNA 1LTLA 1TWHH 4DR7L
chains in the Genus database with same CATH topology
3OMCA 3HKZB 5KYIA 2PMZB 1B9NA 5ELFA 2JA8B 2F0JA 2KUMA 1SMYD 4HSPA 2E2DC 5ISRA 1DXMA 2XRQD 3V05A 4KKTA 5C0XI 1BCPF 1EIHA 1ESRA 4TSSA 1JWMD 3P75A 4DNRB 4HMIA 2BOSA 2X6GA 1WD0A 3QJYA 5C4ZA 1F2ZA 1Y69U 1HRJA 2F0OA 4UDUC 4IQZA 4FXGC 3I8ZA 3GTQB 3MXNA 2WV6D 1AFPA 3C46A 1WD1A 2JXMB 2PO4A 2NN6H 1WTOA 1TY2A 1K8MA 5A2QE 2EY5A 2AQ3B 1HFGA 2RQXA 4OIJA 1Z6HA 1PFBA 1UEAB 1ILQA 1CQVA 2RVLA 4CJ0B 1YNJD 5KNDA 1G2SA 1TU2B 2K03A 3I91A 1O7YA 5CV8A 1W6JA 3MAQA 2NWGA 2H1EA 3A7LA 5FLXE 2RKSA 2CW0C 2Y0SB 1RODA 1TS3A 5F2DA 5JJZA 3S1NB 4G7ZC 2A69C 3H3VC 2NBFA 1SYCA 1L0YB 1JWSD 2EVBA 4A3JB 3V96A 2L12A 3AMUA 5JOBA 4DU9A 3MA2B 1UUPA 2F0GA 1HA6A 1VMCA 1Y8OB 4FO2A 4CGYB 2XN9C 5CR3A 4H13C 3ERQA 1QB5D 5KGUA 2EOTA 1F2MA 2M9VA 2NYZD 2A5HA 4CBVA 1SFOB 2EDGA 2MPMA 3D6CA 3H0GB 1S4ZA 1TY0A 1XWEA 1Z47A 3A8JE 5CV6A 1ZKOA 4DA2A 1KLUD 4NW2A 2NVXB 3QOLA 1D2BA 4KY7A 2F0FA 1EOTA 1SSOA 1F9SA 1SNOA 5M5WB 3EROA 3D4RA 3SDZA 3PO3B 5EQ0A 1I4PA 1RCVD 2EJGC 1Q90A 1PTOF 2SNSA 2K28A 1H9RA 4IFDI 5A2QL 4A3EB 4C3JB 3U9SA 3HOYB 1EFID 1JOOA 3NPPA 3BYTB 1JOQA 4BA1I 3QOJA 3G6JB 2EJMA 1CFMA 2FFKB 4KTAA 3HS0C 1NSNS 4ME5A 4FP5D 3BDOA 1I3QB 1ENCA 5A35A 1TS4A 2ZXOA 2WKDA 5FLXL 2IX1A 3A7AB 1TWHB 1U9RA 2K05A 3I70A 3NQTA 1EYCA 4C3HB 1H9SB 1U4MA 4XDXA 2WAQB 3NXWA 4G7OC 3KK7A 3SE0A 3H94A 2WB1B 4O42A 1BCPD 4C3JG 3SVMA 4BY7B 5M9OA 4RGMA 2JA6B 4CKEA 2Z4IA 1Q3LA 3GTOB 1JB3A 3I73A 4F7XA 1AW7A 1Q1BA 1Y1VB 2SDFA 5AFWA 1B2TA 1STYA 2SNMA 5DNFA 4C3HG 2A6ED 4NP5A 4RHRA 3R93A 1EY4A 2I46A 1I4QA 3BVZA 2R6GA 1SE2A 5C0XH 1CZWA 2L11A 2B2VA 4J1MA 1CA5A 5J39A 2L5TA 4KD3A 2B2UA 5ELBA 1BF4A 2SEBD 1DONA 5JEAH 3I90A 5EPKA 3I4MB 1JOKA 1EWHA 3BZDB 1PRTF 5E4WC 2NN6G 4RWSC 3GP7A 4ZLTF 1D5XC 3PUYA 4QB4A 4XQJA 1TVXA 4KJOA 1UNSA 3OIQA 5IGBA 2K04A 4ZKCB 2J7ZA 1BDOA 5EPJA 1A2UA 3NTHA 3M7GA 3MZ5A 5JEAJ 1ENAA 1L0XB 1STHA 4A3IB 1GOZA 1TQOA 5I9OA 5J22A 1J9OA 2ENBA 2B2YC 3OHXC 1IYUA 3NQIA 2GA4B 1KLGD 1R4PB 5D14A 2RDHA 4ZUJA 4Q0FA 1LTRD 5G3LF 1BCPC 1D1KA 2L4NA 3S1QB 4PNYA 1RTNA 5C6AA 4FF1A 4I65A 4Y7NB 3SK8A 2K5QA 2B8GA 3TZUA 5KNBA 1EYAA 1AZQA 1C4QA 1H9KA 1ET9A 2KCNA 2CQAA 4S3SA 1JCKB 1I50B 4PV1C 3KUPA 5C4JB 4NKLA 1HCZA 2QILA 1TWCB 1R9TB 2A6EC 5CV9A 3HZXA 4DFAA 3HP3A 1JQYD 3QIAA 2NUCA 4IFDH 1O7LA 1TT2A 1HXYD 2RDFA 2F3WA 1WTWA 4LAAA 2QEJC 3D4DA 3OWEB 2BDNA 2FMCA 1NAPA 2EYJA 1KDAA 1UAPA 1Q8IA 1ENFA 3DXJC 3BYYB 2NVQB 2LKVA 2AQ2B 3GV3A 3ITPA 1K8OA 1A3VA 2E75C 2NVYB 2BA0A 5FOBB 2MUYA 1FGBD 3SK5A 3NP8A 5IIFA 1DCZA 2Z4HA 4A93B 5CC4A 2PCFB 3A8KE 1WCMB 4ZKBB 3BDCA 1EZ6A 5C3WA 4LMQD 3I3CA 4RGNA 1PTOC 1IKMA 1RTOA 3HRZC 4XIGS 1PRTD 4R9WA 2F0WA 3HOVB 2ICEC 3GTJB 1PLFA 1T5XD 2F0TA 2EYPA 3WDNA 1CQFA 2F3VA 5C5MA 3NE5B 4UAIA 5E3FA 1GUTA 2B2WC 3IFDA 2IW3A 1S5CD 3URYA 2HDMA 1QE6A 4WRDA 5C0XG 5IGDA 5DM63 4AYBB 3SK6A 3D8GA 3NBHA 1G91A 2CW0D 3W3AA 1EY8A 1O80A 4JBWA 2A69D 4MN3A 5JEAG 5E1FA 5EKKA 2XWJB 2JA7B 4HTHA 5G3LD 2PW5A 3T51B 1LT3D 3A8IE 1SNMA 1OXTA 1VMPA 5EBCA 3FDTA 4FVMA 1SYBA 3GTKB 1VCIA 3TMEA 1Z7TA 2F03A 1D5MC 1GUNA 1V1PB 3OOCA 3VA7A 3R8BA 1WTPA 1EY9A 1STEA 2FINB 2NVTB 1H9JA 2E74C 1ZYRC 4F87A 4C1NI 1MSGA 2G9HD 1SYEA 1S5ED 4K5XA 1Q1EA 2HQEA 1RHPA 5FKAC 4Q5VA 1TWFB 3ND9A 2AWOA 4IUVA 4IALA 3U9OA 4QIWB 2BA1A 3K5LA 1V1PA 2OF1A 4ODGA 2SOBA 1I4RA 4TRDA 1XYIA 2E76C 4G57A 1PRTC 1TIID 1SNCA 2KOLA 4K5WA 1JORA 1GHKA 1EWCA 2JP1A 5I6YA 1FD7D 1ZEQX 2WP8J 3NBIA 3MFGA 5IGFA 3MEHA 5BN5A 3EFXD 1B44D 1SYFA 1A6XA 4B9WA 5NUCA 5BN4A 5C3EB 5JVH3 5K36H 4XYOA 2X69A 2J4XA 2BCOA 1JICA 4OO1I 1EY7A 3KBGA 5FO7B 1AN8A 4KHZA 5IODA 3KLSX 1B1ZA 3FPUB 5J1ZA 3KF8A 3UI2A 1PDQA 3CHBD 3E6ZX 4KY5A 2X6LA 3A54A 1I6VC 2F0NA 1EQVA 1QNKA 2DNEA 4ILWA 2AQ1B 4DK1A 3KLSA 2I07B 1ESFA 5CV4A 5M3FB 4A3KB 2PZWA 2NTSA 3S1RB 1HPCA 4ZUIA 5I6WA 1ML0D 1HTPA 4G4KA 2JSOA 5CV5A 3SHLA 1B3AA 1W6KA 1X3QA 1S5DD 3C1EA 3H09A 5I2XA 2JE6I 4EGVA 1A2TA 3WOEA 5IGGA 2QKIC 4K6DA 2C5CA 2O4XA 3X3MA 1M4VA 4X3TA 4H44C 1CK1A 3ZYYX 4V190 2PW7A 2BDOA 2M00A 2OEOA 1CHQD 1FNVA 1EY5A 4K2LA 3J7YW 1OXVA 3VR5A 3SK4A 1B50A 3C1FA 3QB3A 1GUWA 2PZTA 5FO8B 2MP1A 1GHJA 1RF2D 2PYKA 1JWUD 3EQLC 5C4HA 1SJED 5I9PA 2DY8A 3FPPA 1A15A 1LTSD 3MC0B 2G9DA 5HURA 1EU3A 3TZDA 2KVMA 5DM73 5EKIA 3PIP3 2EJFC 3BS1A 4RA8A 4QUFA 1EYDA 4RHSA 2LFNA 3K7AB 4YIJA 3GO5A 2IWHA 3SR1A 1IYVA 3DMUA 1IKLA 4CJ1B 4BWGB 1LACA 5FO9B 3RLFA 3K0YA 3FRPB 2KA7A 4RKBA 2EYOA 3OSOA 2KEDA 2IL8A 3GTPB 2XRSD 2ZT9C 1D6EC 3AU7A 2R7ZB 3OPOA 1FNUA 3OWFA 4DXGA 1I4XA 3MXGA 3CKIB 1MI2A 5M5YB 2OT2A 4C2MB 3LX0A 3PUZA 1IHZA 3TBIB 5EPLA 5CMDA 2RA4A 5JVG3 2JA5B 3T56B 1PTOH 2XIWA 4A3MB 1PMRA 3LWUA 4FNFA 4A3GB 4A3FB 1Y1WB 4NMZA 3GD7A 3GTLB 3PO2B 3T16A 5C0XJ 3CQZB 2A6HC 2KHSA 4RKLA 2O2LD 5D3DA 1E0BA 4FF2A 1OXSC 1DD2A 1G291 1X32A 2R92B 4XYQA 1FYCA 5K36G 3M7NA 1HUNA 4OO1H 3X3NA 2HUGA 3DEPA 4HCSA 5LL6X 4G7HC 1IW7C 1PTOD 1BO0A 2VB3X 3BG3A 2K33A 4KK7A 1SE4A 1SDFA 1BCPB 4XQNA 2YU9B 1U4LA 1F9RA 4X3SA 3GTGB 2EXZA 1Y8PB 4KI0A 3HOWB 4KY6A 2YYZA 2A68C 1LTGD 1AEXA 3HEJA 1SXTA 2TSSA 2QDBA 4U673 1I4HA 2B2YA 4GZYC 3R3OA 1BNZA 2VNUD 1SNPA 2EPBA 3K57A 3TP6A 2N55A 3T53B 4QUCA 2KJXA 2OXPA 3I4LA 1Y8NB 3PUVA 4X3KA 5IGEA 2K1BA 2NN6I 2XSCA 1EU4A 1E2VA 5KNCA 5HGTA 1VDZA 5IOCA 4DK0A 2F0UA 3D6WA 5EJWA 3GTMB 2VB2X 1XXGA 4RH6A 4JK1C 2Z1CA 3M4YA 4C1NK 1WTVA 4IUPA 5TSSA 2KCCA 2LMCB 1II3A 1GUGA 3NSWA 2D5DA 1WTRA 3MTSA 1EZ8A 1F9QA 5ELCA 1J8IA 4IFDJ 1ZYRD 3J81L 2JEBI 1RJTA 4EVOA 5JPNC 1V8QA 1EIGA 4CKCA 3O13A 4M8AA 4K5VA 5KRUA 1NUCA 3J7AV 3K5MA 1D1IA 3MXUA 3Q0AA 1LTTD 1FNWA 1ONLA 1CI3M 1X3PA 3HG9A 1DOKA 3M3YB 3W2DA 4B08A 1PTOB 1ET6A 2F4IA 3LWEA 3ND8A 2EZVA 4EQPA 1Q12A 2KECA 2F0VA 3VYTA 4CHTB 3E5SA 2R93B 2F0MA 2HCIA 4O1NA 1GUOA 1LT4D 3A55A 3P20A 1TR5A 3S16B 3LNNA 2E2JB 1STAA 5CGKA 2F0DA 5ELDA 2PPBC 1WTXA 4CJ2C 1V1OA 4L8JA 3D31A 4CKBA 2F0LA 2F0HA 3NTKA 4H0LC 3BVMA 4TKOB 1XTCD 5C5LA 3Q24A 4IUTA 2F0EA 5IT9E 1KNAA 3L9AX 2AWNA 4K8JA 2KQ3A 4C56C 2Q8IB 1CTMA 4EQOA 1EQTA 3TN2A 2B2WA 1IL8A 4KHVA 3R2TA 1M8AA 3L7ZC 3T13A 2D2CC 2JYOA 3AB9A 1EEFD 1MGSA 2HDLA 4ULLA 4IURA 1K83B 5DAUA 2QCPX 2L0CA 4WJWA 3Q6SA 3EA6A 2O5IC 1E2WA 4RFBA 4OO1G 1C8CA 2A74C 3IKJA 3TP8A 2Q8TA 1LLRD 5K5PA 5D3IB 1PFNA 1TWGB 1BBXC 2K01A 4WFN3 1NR4A 1VF5C 4XT1B 2F0PA 4DF7A 1FR3A 3S2HB 3RMHA 1HQRD 1PZKD 2JEAI 5FK9C 3OIPA 1R4QB 2H4OA 1PRTB 4PMWA 4RCNA 3I72A 1U4PA 5T1GA 2ZXPA 3IAYA 1C48A 3DHQA 4XT3B 4XQQA 3EVQA 3JAME 4BY1B 2N88A 4K6LA 3P7JA 2LY7A 2ICIA 3NHHA 3VR3A 5IT9L 5T1IA 1LTID 4ZAIA 4IFDG 1CM9A 2DNCA 4K8IA 2KEEA 2AUJD 3PUXA 5CBAE 4IN3A 4KKSA 1T5EA 4V0BA 3EJIA 5CBEE 1WVLA 5C4XB 5EBDA 4RGOS 1QG7A 3NK9A 1JE4A 3RZOB 4QCLA 3NTIA 2HCCA 2XWBB 3D4WA 2WACA 2J0TD 3VA5A 1A3TA 4LK1C 2RDGA 3GQBA 1EL0A 2A73B 1SJHD 3L3OC 2R61A 1LTBD 2XVSA 3FVQA 4DNTB 4LJZC 3MXPA 2R3ZA 2F1MA 4N9TA 1ICWA 1DYQA 3K6OA 3J80L 5CORA 5CYUA 1OXUA 3KLRA 3PIO3 2F0KA 1JR0D 2MGSA 5KYLA 3SXHA 1VF7A 5E4XA 1F2YA 4DAVA 3PMFA 3HOUB 2VXWA 3J7AF 2E2HB 3G7LA 1XX8A 3CRLC 3DUZA 3QG1A 3QO2A 1CHPD 1PFMA 2B8FA 3D3RA 1BR9A 1YNNC 3S9WA 3JAML 2L9HA 4MHEA 3FMCA 5D65A 4DXFA 1BOSA 1SAPA 1B4OA 4P2CB 4J8QA 2A6HD 5JPMC 1OO9B 4ZYSA 4HSVA 4FF4A 3HOXB 5LL6S 1SMYC 3I4NB 5ELEA 1CT1D 4NDXA 2EY2A 1SEBD 3DWPA 3VR4A 2L1BA 2C9OA 4BBSB 2Q8RE 2QF7A 4HR7B 4F88A 2B63B 2F0SA 1STGA 3N6RA 1TWAB 4BBRB 4HEDA 4IZ8A 3Q22A 2EE1A 1MBYA 1IW7D 1STNA 2B2TC 2TMPA 3ONAB 1QCBD 2RSNA 3M4OB 3A56A 2IPKD 3WOFA 2IT1A 3C3LA 4ABNA 1SNDA 4OHJA 1QNUA 4Z9CB 2FHTA 1A3UA 1SNQA 2A68D 3S17B 1PYWD 3NWSA 1YNJC 1LT5D 2AUKA 2L55A 3V2TA 2IX0A 4PMBA 2MHVA 1B9MA 1G8ZD 4A3BB 1SBBB 2B2TA 2B2VC 4HMJA 3VR2A 2WINB 4KJNA 2B2UC 1CZGA 1H9MA 1SYDA 1LV9A 1RDPD 3HGBA 1RD9D 1TS5A 4FF3A 4TQUS 1U4RA 1KTKA 2CVRA 2LS01 2D9UA 4U68A 4M1UB 1BUVT 3NUCA 1H9SA 4WORA 3Q23A 1WTQA 1QJOA 1JC7A 3TP7A 4H7BA 2ID0A 5M5XB 3S2DB 5EKLA 4IUUA 4R8NA 3DWAA 1DOLA 2F0QA 2XNAC 3PV0A 3T4AC 4ZQ3A 4N9PA 3C2PA 4HAEA 2BE5D 3F2UA 1PXUA 3R2IA 2NZ1D 1QILA 4XXEA 3MVVA 4DGZA 5C3XA 1LT6D 1V43A 2MJ8A 2CHBD 4ZRZA 3K59A 1HUMA 1O78A 1F77A 1PZID 4ID6A 2M2LA 1OXXK 1EEID 4X3UA 2IJ0A 3S14B 1HHVA 4C3IB 1CA6A 3J81E 3BVGA 1HTLD 1G2TA 4K14A 4FXDA 4E6IA 4KN4C 2EY6A 1MSHA 4DAPA 3CRKC 1GUSA 1D5ZC 4DN4M 1DOMA 3TDQA 4XTCS 3M85A 1BXTA 1RKNA 3VYRA 1LABA 1KABA 1B53A 4RGTA 1G6ZA 3OMGA 4L6TB 5LHY1 4J6HA 4K2KA 2WKCA 3E0JA 2NB0A 2D62A 3TSSA 4QMGA 4C3IG 4RCOA 1DJRD 3N52A 5DEHA 1HQMC 1QOHA 1O7ZA 2RBMA 3DEOA 3IFTA 4MIUA 3DWQA 2NTTA 4HCEA 4OL7A 3K5NA 3TP5A 2EY1A 2PQEA 4DAYA 1GJXA 3RD4A 1S5FD 3BDLA 3FKIB 4F8MA 5COYA 4FYDA 3HOZB 2K7VA 3RUZA 2BE5C 1EY0A 5I2YA 1KDBA 2EYFA 4KD4A 1LTAD 5EGTA 5BN3A 1DM0B 2K5DA 4FXKC 2FMMA 2WIIB 3K58A 4KN7C 2FJ2A 3RZDB 1TS2A 1NCVA 3S15B 4EQNA 1HA5A 4A3DB 1SYGA 4I7ZC 3QWNA 1E2ZA 1LO5D 3GV6A 2DN8A 4PQXA 4OIKA 3K5OA 2EYHA 1BQQT 1PZJD 1AZPA 4OGQC 4BS9A 1QWYA 1F2LA 2E2IB 5JAVA 2V4DA 2K5WA 4QF4A 3H6MA 2PNRC 1NR2A 3FEWX 3KBXA 2RSOA 3NWTA 4L63B 3VYUA 1KAAA 2B39A 4KMUC 2EYMA 1KNEA 1S5BD 5M3MB 2PZUA 1MD2D 2Z8LA 1ZXTA 1STBA 1ILPA 4ZK9B 3VYSA 3S1MB 2VUMB 3MWYW 5CV7A 5IGCA 4IUNA 3VR6A 1F9PA 1DZ1A 2K32A 5KIXA 5KEEA 3H91A 1I6HB 1AP0A 2O5JC 3PUWA 3P1HA 2IX3A 3OW7A 5I4DA 2EYLA 4R8IA 1EY6A 4KV6A 1GXDC 2K6AA 2ZXRA 4KKUA 2DY7A 1KDCA 3DM1A 2F0IA 3SEBA 1TKWB 4HN7A 4PMCA 1SE3A 3MFYA 4B9XA 4IUQA 1YNND 5C44B 3MHBA 4RAUC 3IL8A 4BA2I 3CU7A 3J80E 1I4GA 1HFNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ENB A;  3OMC A;  3T16 A;  5I9P A;  5KYI A;  3OMG A;  2LKV A;  5JAV A;  2F0L A;  2F0H A;  2KHS A;  5IOC A;  4RKL A;  2F0U A;  3NHH A;  4J6H A;  3TP7 A;  4K2K A;  1EY7 A;  1SYB A;  4H7B A;  5HUR A;  3ITP A;  3TME A;  2F0J A;  3D6C A;  4QF4 A;  3H6M A;  4QMG A;  5EKL A;  4F7X A;  5CV6 A;  5IOD A;  4ZUJ A;  4R8N A;  5C5L A;  5ISR A;  1A3V A;  4NDX A;  5J1Z A;  2EY2 A;  2F0Q A;  1EYD A;  2F0E A;  1II3 A;  4K8I A;  1STY A;  4K8J A;  2KQ3 A;  4YIJ A;  1EY9 A;  1KAA A;  2F0S A;  1EZ8 A;  3QOL A;  4N9P A;  2EYM A;  3EJI A;  2F0F A;  4KY7 A;  3NP8 A;  4ZQ3 A;  3SK5 A;  2SNM A;  4KY5 A;  3SR1 A;  4EQO A;  5IIF A;  3DMU A;  5CC4 A;  1JOR A;  1STG A;  3P75 A;  5DEH A;  1SNO A;  3NK9 A;  2RBM A;  4PNY A;  3ERO A;  2F0N A;  4HMI A;  2PZU A;  1EQV A;  3BDC A;  4KHV A;  4MIU A;  5C6A A;  4EVO A;  1EZ6 A;  4I65 A;  4NP5 A;  4IZ8 A;  4OL7 A;  5C3W A;  3MVV A;  3TP5 A;  3D4W A;  2WAC A;  3VA5 A;  1STB A;  1A3T A;  5C4Z A;  1EY4 A;  1F2Z A;  4DGZ A;  1STN A;  1SYE A;  2EY1 A;  3T13 A;  4RKB A;  5C3X A;  2EYO A;  2F0O A;  3SK8 A;  2PQE A;  4K5V A;  2SNS A;  1EYA A;  4K5X A;  5KRU A;  3OSO A;  5CV4 A;  2PZW A;  5CV7 A;  5IGC A;  4IUN A;  2F0W A;  3BDL A;  4S3S A;  1NUC A;  2HQE A;  1JOO A;  4F8M A;  5KGU A;  4ZUI A;  5I6W A;  4J1M A;  1JOQ A;  5DAU A;  5CV9 A;  4NKL A;  3QOJ A;  5J39 A;  5KIX A;  4ID6 A;  5KEE A;  3OWF A;  4KD3 A;  5CV5 A;  2EY5 A;  1SND A;  1EY0 A;  3RUZ A;  2F0T A;  2EYP A;  3SHL A;  3C1E A;  5J22 A;  2EXZ A;  2F3V A;  3MXP A;  4KTA A;  1NSN S;  5C5M A;  1A3U A;  4KY6 A;  1KDB A;  2EYF A;  3HZX A;  1A2T A;  3P1H A;  4IAL A;  4KD4 A;  4ME5 A;  1SNQ A;  4N9T A;  5E3F A;  5EGT A;  3TP8 A;  3U9O A;  4DFA A;  2EYL A;  5K5P A;  1ENC A;  2OF1 A;  4ODG A;  2SOB A;  1AEX A;  2NUC A;  4TRD A;  5IGG A;  4WRD A;  1EY6 A;  4K14 A;  3LX0 A;  4K6D A;  4EQP A;  1JOK A;  4E6I A;  4G57 A;  2F0V A;  3HEJ A;  2O4X A;  5IGD A;  2EY6 A;  4KV6 A;  1TT2 A;  5CV8 A;  1SNC A;  2QDB A;  3SK6 A;  2F0K A;  1IHZ A;  3E5S A;  4K5W A;  1U9R A;  3SXH A;  3V2T A;  3D8G A;  5KYL A;  1F2Y A;  1KDC A;  2PW7 A;  3NQT A;  4PMB A;  3PMF A;  2F0P A;  1EYC A;  2M00 A;  2OEO A;  2F0M A;  2RDF A;  4QB4 A;  4DF7 A;  2F0I A;  2F3W A;  3R3O A;  5HGT A;  2RKS A;  1EY5 A;  4KJO A;  1EY8 A;  4EQN A;  5I6Y A;  4HMJ A;  4K2L A;  4LAA A;  5F2D A;  5IGB A;  1SYG A;  1SNP A;  3TP6 A;  5E1F A;  4KJN A;  3NXW A;  4PMC A;  3SK4 A;  1TR5 A;  5IGF A;  3MEH A;  5EKK A;  1SYD A;  3D4D A;  1STA A;  1SYC A;  4B9X A;  1A2U A;  1SYF A;  2OXP A;  3MZ5 A;  2F0D A;  4HTH A;  5CGK A;  2EYH A;  4B9W A;  3MHB A;  3C1F A;  5JOB A;  3S9W A;  2PW5 A;  5NUC A;  4DU9 A;  3DHQ A;  2F0G A;  3QB3 A;  2PZT A;  2EYJ A;  3EVQ A;  1KDA A;  1ENA A;  5IGE A;  1RKN A;  1STH A;  1SNM A;  4NMZ A;  2PYK A;  5CR3 A;  1KAB A;  3ERQ A;  3NUC A;  5C4H A;  1TQO A;  4WOR A;  5I9O A;  5M9O A;  1F2M A; 
#chains in the Genus database with same CATH topology
 3OMC A;  3HKZ B;  5KYI A;  3J80 c;  2PMZ B;  4C3H H;  1B9N A;  3CF5 A;  5ELF A;  4JI1 Q;  2F0J A;  1YVC A;  2KUM A;  3L2P A;  1SMY D;  4HSP A;  2JA8 B;  2E2D C;  1KXL A;  1YIJ A;  2JA7 G;  4JV5 Q;  5ISR A;  1IBL L;  1DXM A;  2XRQ D;  3V05 A;  4KKT A;  3HKS A;  5C0X I;  1BCP F;  3K7A H;  3HKZ E;  4LF7 L;  1EIH A;  1ESR A;  2PMZ E;  4TSS A;  1YZ6 A;  1JWM D;  1HZA A;  3P75 A;  4GLA C;  4DNR B;  2JJQ A;  4HMI A;  2BOS A;  2UXB L;  1QVC A;  1N36 Q;  2JA6 H;  2X6G A;  1WD0 A;  1N32 L;  1XTD A;  3QJY A;  5C4Z A;  1F2Z A;  1Y69 U;  1HRJ A;  4O2D A;  2UUA L;  2F0O A;  4FXG C;  4IQZ A;  4UDU C;  3I8Z A;  3GTO H;  2JN4 A;  3GTQ B;  3MXN A;  4DR5 L;  2WV6 D;  4R4I A;  1AFP A;  1B70 B;  3C46 A;  1FJG Q;  1WD1 A;  3CCS A;  4JI4 L;  2JXM B;  2PO4 A;  3GTP H;  2NN6 H;  1WTO A;  2I5H A;  1TY2 A;  1HH2 P;  1K8M A;  5A2Q E;  2EY5 A;  1HR0 W;  3HKZ G;  4JI8 L;  2AQ3 B;  4QIW E;  1HFG A;  2RQX A;  4OIJ A;  1VQH A;  1Z6H A;  2VW9 A;  2K4K A;  1PFB A;  1UEA B;  4GS3 A;  2JA8 G;  1ILQ A;  1CQV A;  2RVL A;  4LF5 Q;  4CJ0 B;  1YNJ D;  5KND A;  1JJ2 A;  1G2S A;  1TU2 B;  2K03 A;  4HJ8 A;  3I91 A;  1O7Y A;  2UU9 L;  5CV8 A;  4JI0 L;  1W6J A;  3MAQ A;  2NWG A;  1YHQ A;  2H1E A;  3A7L A;  5FLX E;  1IBK L;  1Q86 C;  5FJ8 G;  4B3M Q;  4JI2 L;  2RKS A;  4DR4 L;  2CW0 C;  2Y0S B;  1ROD A;  1TS3 A;  5F2D A;  5JJZ A;  5FLX c;  3S1N B;  4G7Z C;  2A69 C;  3H3V C;  2NBF A;  1SYC A;  1L0Y B;  1JWS D;  2EVB A;  3F2B A;  4A3J B;  3V96 A;  2L12 A;  3AMU A;  5JOB A;  4DU9 A;  3MA2 B;  1UUP A;  2F0G A;  4P73 A;  5LMU Q;  1KQS A;  1VMC A;  1Y8O B;  1HA6 A;  4A3G H;  4FO2 A;  4CGY B;  2XN9 C;  5CR3 A;  4DUZ Q;  4H13 C;  3ERQ A;  1QB5 D;  4GN3 B;  5KGU A;  1Y1W H;  2Y0S E;  2EOT A;  1F2M A;  1UE6 A;  2M9V A;  4DPG A;  1S72 A;  2NYZ D;  3I55 A;  2A5H A;  2QEX A;  2OQK A;  4CBV A;  1SFO B;  2EDG A;  3BZC A;  2MPM A;  3D6C A;  3H0G B;  1S4Z A;  1TY0 A;  1XWE A;  4JI3 Q;  1Z47 A;  1FL0 A;  3A8J E;  5CV6 A;  4NB3 A;  1ZKO A;  2R92 H;  4QJF A;  4DA2 A;  1KLU D;  5IYD G;  4NW2 A;  2NVX B;  3QOL A;  1D2B A;  4KY7 A;  2F0F A;  4POF A;  1EOT A;  1SSO A;  3F2C A;  4X6A H;  1F9S A;  1SNO A;  5M5W B;  3ERO A;  4JYA Q;  3D4R A;  3SDZ A;  1RIP A;  1YHA A;  4LUO A;  5E7N A;  2Y0S G;  1N34 Q;  3PO3 B;  5EQ0 A;  1NY4 A;  1I4P A;  1RCV D;  1Q46 A;  2EJG C;  1Q90 A;  1PTO F;  2SNS A;  2K28 A;  1X3F A;  1H9R A;  1N9W A;  3E9I A;  4A3J G;  4IFD I;  3D0F A;  5A2Q L;  3T1H Q;  4A3E B;  1XJV A;  4MZ9 A;  4C3J B;  5AJ3 Q;  3U9S A;  2PNH A;  4DV1 Q;  3HOY B;  1EFI D;  1JOO A;  3NPP A;  3BYT B;  1JOQ A;  4BA1 I;  2YU9 H;  3QOJ A;  1PA6 A;  3G6J B;  1LM0 A;  2EJM A;  4OEL B;  2OTJ A;  1CFM A;  2FFK B;  3S1Q H;  4KTA A;  2ZTD A;  3HS0 C;  1NSN S;  3I56 A;  1K8A C;  4ME5 A;  5IY0 A;  4FP5 D;  3BDO A;  3H0G G;  1I3Q B;  1ENC A;  5A35 A;  1HJP A;  1TS4 A;  2ZXO A;  5M3F G;  2WKD A;  5FLX L;  4H02 A;  1CKO A;  2IX1 A;  1UEB A;  3A7A B;  2C35 B;  2ZJP A;  4DV2 L;  1TWH B;  1U9R A;  2K05 A;  3NEN A;  2EQS A;  2IY5 B;  3I70 A;  3NQT A;  3KYH C;  5C4J H;  1EYC A;  4PG3 A;  4YCU A;  4C3H B;  1H9S B;  1KC8 C;  1U4M A;  4OWW B;  3BJU A;  2P5Z X;  4XDX A;  2WAQ B;  4R4O A;  3PO3 G;  3NXW A;  4G7O C;  3KK7 A;  4NXM L;  3SE0 A;  1VQA A;  3H94 A;  2WB1 B;  4O42 A;  1BCP D;  4Y52 H;  1GM5 A;  2OQ0 A;  4C3J G;  4LF7 Q;  3HOY G;  3SVM A;  5GQO A;  2QDL A;  4A76 A;  4BY7 B;  4JPB W;  5M9O A;  4RGM A;  2VZA A;  2JA6 B;  1CKM A;  2WAQ E;  4GNX B;  1EQQ A;  2UXB Q;  2K5H A;  2N3S A;  4CKE A;  2Z4I A;  1Q3L A;  3GTO B;  2DJG C;  1JB3 A;  2WB1 E;  3I73 A;  3GTM H;  2UUA Q;  1X65 A;  4F7X A;  2IHE A;  4DR5 Q;  1AW7 A;  1Q1B A;  1Y1V B;  4JI4 Q;  2SDF A;  5AFW A;  1B2T A;  1STY A;  1Q7Y C;  3WWV A;  3CC4 A;  2SNM A;  4JG2 A;  3CAM A;  4JI8 Q;  5DNF A;  2A6E D;  4C3H G;  2NVQ H;  3PIO A;  4DNI A;  4NP5 A;  5GRO A;  4RHR A;  3R93 A;  1EY4 A;  2I46 A;  2WAQ G;  1I4Q A;  3BVZ A;  2R6G A;  2YTX A;  1SE2 A;  2WB1 G;  4N8F A;  1EFW A;  5C0X H;  1CZW A;  4A3C H;  2UU9 Q;  1QZG A;  2NVY H;  2L11 A;  5ELO A;  1RL2 A;  2B2V A;  4J1M A;  1CA5 A;  4LFB L;  1IBK Q;  5J39 A;  4R4T A;  2L5T A;  4BY7 G;  4KD3 A;  2B2U A;  5ELB A;  4JI2 Q;  1BF4 A;  3M3Y H;  4A93 H;  4DR4 Q;  2SEB D;  2JA6 G;  3W5O A;  4YCW A;  2Z6K A;  1DON A;  5JEA H;  2A8V A;  4JI6 L;  4HIK A;  1ASZ A;  3I90 A;  1VQ7 A;  5EPK A;  4IO9 A;  3I4M B;  3EIV A;  3AEV A;  1JOK A;  1EWH A;  1Y1V G;  4AH6 A;  3BZD B;  1PFS A;  1LUZ A;  3G6E A;  1PRT F;  5E4W C;  2NN6 G;  3SGI A;  4RWS C;  3GP7 A;  4ZLT F;  1IBM L;  2JK8 A;  1VQP A;  1D5X C;  1E22 A;  3PUY A;  3UDX A;  4QB4 A;  4XQJ A;  1TVX A;  3GTJ H;  4KJO A;  1UNS A;  4IOC A;  3OIQ A;  5IGB A;  1ASY A;  2K04 A;  4ZKC B;  2J7Z A;  1ICF B;  2HIV A;  4JBM A;  1BDO A;  5EPJ A;  3S16 H;  1A2U A;  3NTH A;  3M7G A;  3MZ5 A;  1YJ9 A;  3E3X A;  4B3R L;  5JEA J;  4CDF C;  1ENA A;  4LWC A;  1L0X B;  1STH A;  4OWT B;  4A3I B;  1GOZ A;  2CWP A;  1NMF A;  1TQO A;  5I9O A;  5J22 A;  5LMN W;  1J9O A;  2ENB A;  4LNQ A;  2L15 A;  2B2Y C;  3OHX C;  2YTV A;  1IYU A;  3NQI A;  2GA4 B;  1KLG D;  3EBE A;  1KL9 A;  1R4P B;  3STB D;  5D14 A;  2RDH A;  4ZUJ A;  4IJL A;  4Q0F A;  1LTR D;  4RMF A;  5G3L F;  1BCP C;  1D1K A;  1N33 L;  4L5T A;  1Y1W G;  2ZM6 L;  4DV6 L;  2L4N A;  4PZ7 A;  2Z9H A;  3CC2 A;  3S1Q B;  4PNY A;  4HJ9 A;  1RTN A;  5C6A A;  1CKN A;  4FF1 A;  4I65 A;  3U58 A;  4Y7N B;  3SK8 A;  2K5Q A;  1X3G A;  2B8G A;  3TZU A;  5KNB A;  1EYA A;  1L2F A;  1AZQ A;  1C4Q A;  1H9K A;  1ET9 A;  3M4Q A;  2KCN A;  2CQA A;  4S3S A;  1JCK B;  1I50 B;  1BBU A;  5JJL A;  5IYC H;  4DV2 Q;  4PV1 C;  3KUP A;  5C4J B;  1K83 H;  4A3I G;  4NKL A;  1HCZ A;  2NVT H;  2QIL A;  1TWC B;  4DKA C;  5H1S E;  1R9T B;  2A6E C;  5IP7 H;  1E24 A;  5CV9 A;  5DLQ E;  3HZX A;  3T1Y L;  4DFA A;  2CH4 A;  3HP3 A;  1JQY D;  3QIA A;  2NUC A;  4IFD H;  4DK6 C;  4AIM A;  4JI5 L;  2QA4 A;  1TWG H;  2MFI A;  3K81 C;  1O7L A;  1TT2 A;  1UWV A;  1HXY D;  2RDF A;  2F3W A;  1WTW A;  4GKK L;  2MQH A;  4LAA A;  2K14 A;  2QEJ C;  3ERS X;  1PH8 A;  3ZJY C;  2F52 A;  3D4D A;  3OWE B;  2BDN A;  2FMC A;  1NAP A;  2DJF C;  2EYJ A;  1KDA A;  1UAP A;  1Q8I A;  4IPG A;  4LF6 L;  1A8V A;  2AHO B;  4QY7 A;  4ZCK A;  1ENF A;  3DXJ C;  3BYY B;  2NVQ B;  4O0A A;  2LKV A;  2AQ2 B;  4UPA A;  3GV3 A;  4CDD C;  3ITP A;  1K8O A;  3CCM A;  1A3V A;  2E75 C;  2NVY B;  2BA0 A;  5FOB B;  2MUY A;  5C3E H;  1JB7 A;  4LFB Q;  1FGB D;  3SK5 A;  1OTC A;  3NP8 A;  5IIF A;  1DCZ A;  2Z4H A;  4A93 B;  5C4X H;  5CC4 A;  2PCF B;  3A8K E;  1WCM B;  4ZKB B;  1IZ6 A;  4AQY L;  1NBW A;  3G4S A;  3BDC A;  1EZ6 A;  3RN5 A;  5C3W A;  4JI6 Q;  4LMQ D;  3I3C A;  4RGN A;  4DV4 L;  2NZH A;  1PTO C;  4WJ3 M;  4YWL A;  1IKM A;  1RTO A;  3HRZ C;  4XIG S;  1PRT D;  4R9W A;  2F0W A;  3HOV B;  3CCE A;  2D0P A;  1IBM Q;  2JQO A;  2ICE C;  1UE1 A;  1B7Y B;  2XTI A;  3GTJ B;  1PLF A;  1T5X D;  2F0T A;  2EYP A;  3WDN A;  4QL5 A;  1CQF A;  1V9P A;  3KJP A;  2F3V A;  5C5M A;  3NE5 B;  4UAI A;  5E3F A;  1GUT A;  2B2W C;  3IFD A;  4P72 A;  2IW3 A;  1S5C D;  3URY A;  2HDM A;  4B3R Q;  1QE6 A;  4WRD A;  5C0X G;  4A3K H;  1JT8 A;  5IGD A;  5DM6 3;  4AYB B;  4HJ7 A;  4DAM A;  3SK6 A;  4R1J A;  3D8G A;  3NBH A;  1G91 A;  3PCO B;  3CCQ A;  4A93 G;  3HOU H;  2CW0 D;  1IYJ B;  2E5L L;  3W3A A;  1U5K A;  1EY8 A;  1O80 A;  4JBW A;  2A69 D;  4MN3 A;  5JEA G;  2CFM A;  4GLV B;  1QUQ A;  5E1F A;  1SN8 A;  5EKK A;  2XWJ B;  2JA7 B;  4AYB E;  4HTH A;  5G3L D;  2PW5 A;  3T51 B;  1YHB A;  1XPR A;  1LT3 D;  1N33 Q;  3A8I E;  1X3E A;  1SNM A;  1OXT A;  1VMP A;  2B3G A;  5EBC A;  2ZM6 Q;  4DV6 Q;  1V1Q A;  1CSP A;  1NE3 A;  3FDT A;  1I5F A;  4FVM A;  1SYB A;  3GTK B;  1VCI A;  1Z7T A;  3TME A;  2F03 A;  3E9H A;  1D5M C;  3HOX H;  5JJI A;  1GUN A;  1SMX A;  3I4N H;  1V1P B;  3OOC A;  3OW2 A;  3MXN B;  3VA7 A;  3R8B A;  2KHJ A;  1WTP A;  4AYB G;  1EY9 A;  2B63 H;  1STE A;  2FIN B;  1AE3 A;  2NVT B;  4UHV A;  2KEN A;  1H9J A;  2E74 C;  4JBJ A;  1ZYR C;  4L5R C;  4EQ5 A;  4BBR H;  1PH9 A;  4F87 A;  1GVP A;  1PYB A;  4C1N I;  1MSG A;  2G9H D;  4L5S A;  1SYE A;  1S5E D;  3RLO A;  4K5X A;  4JI5 Q;  4YHH L;  1Q1E A;  3KJO A;  3NEL A;  2HQE A;  2K75 A;  2CQO A;  1RHP A;  3M4O H;  5FKA C;  4Q5V A;  1TWF B;  2ZJR A;  3ND9 A;  1SRO A;  4GKK Q;  2AWO A;  4IUV A;  1YJW A;  1SE8 A;  3KOJ A;  4IAL A;  4JOI A;  3U9O A;  4QIW B;  2BA1 A;  3K5L A;  1V1P A;  2OF1 A;  4ODG A;  2SOB A;  1I4R A;  4TRD A;  1XYI A;  1XMO L;  5GAG C;  3PQI A;  2E76 C;  2ZTC A;  2RHQ B;  4G57 A;  1PRT C;  1TII D;  1SNC A;  2KOL A;  5IYC G;  2VY3 A;  1E3P A;  4LF6 Q;  4K5W A;  1JOR A;  1GHK A;  1EWC A;  2R7Z H;  3QR8 A;  2JP1 A;  3G48 A;  5I6Y A;  1FD7 D;  1ZEQ X;  2WP8 J;  3NBI A;  3MFG A;  5IGF A;  3MEH A;  5BN5 A;  3EFX D;  5M5Y H;  1B44 D;  1SYF A;  4C2M H;  1A6X A;  4B9W A;  2B29 A;  2Q2I A;  2K5N A;  5NUC A;  5BN4 A;  5C3E B;  3ER0 A;  5JVH 3;  4UP8 A;  3ICE A;  5K36 H;  1XPO A;  4XYO A;  3H15 A;  2X69 A;  2J4X A;  3FP9 A;  4AQY Q;  4MTK A;  2JA5 H;  2BCO A;  1JIC A;  4OO1 I;  1VQM A;  1EY7 A;  1Y14 B;  3KBG A;  4DV4 Q;  5FO7 B;  1AN8 A;  2KCT A;  4KHZ A;  1SLJ A;  4A3M H;  5IOD A;  4OXP A;  1MJC A;  3KLS X;  1B1Z A;  3FPU B;  5J1Z A;  4DR1 L;  3TQY A;  3KF8 A;  3UI2 A;  4JBK A;  2UUC L;  1PDQ A;  2YV5 A;  3CHB D;  4A3F H;  3E6Z X;  4KY5 A;  3GTL H;  2X6L A;  3PO2 H;  1WOC A;  3A54 A;  3NEM A;  1I6V C;  2F0N A;  1EQV A;  3OTO L;  2LXK A;  3CQZ H;  1PH4 A;  1QNK A;  3RNU A;  2DNE A;  4ILW A;  1SR3 A;  2AQ1 B;  3A0J A;  2VQE L;  4DK1 A;  3KLS A;  4WJ4 A;  2F4V L;  2I07 B;  1ESF A;  5CV4 A;  5M3F B;  4A3K B;  5EAY A;  2PZW A;  2NTS A;  3S1R B;  1HPC A;  5C3E G;  4ZUI A;  3BZK A;  5I6W A;  1ML0 D;  1HTP A;  4B3S Q;  2D0O A;  4G4K A;  2JSO A;  5CV5 A;  3SHL A;  1B3A A;  1W6K A;  1X3Q A;  2E5L Q;  1S5D D;  3C1E A;  3H09 A;  5I2X A;  1PYS B;  2JE6 I;  4EGV A;  1A2T A;  3WOE A;  5IGG A;  2QKI C;  3J7Z C;  4X65 L;  4K6D A;  2DUD A;  2C5C A;  2O4X A;  3X3M A;  4IOA A;  1M4V A;  4X3T A;  4H44 C;  1CK1 A;  1HZC A;  3ZYY X;  4V19 0;  2K5V A;  2PW7 A;  2BDO A;  2M00 A;  2OEO A;  1PVO A;  3RLN A;  1CHQ D;  1FNV A;  4TVA B;  1EY5 A;  3GTG H;  4K2L A;  3J7Y W;  4YCV A;  1OXV A;  3VR5 A;  3SK4 A;  1B50 A;  3HOW H;  3RR5 A;  4GLX A;  3C1F A;  4X66 L;  4A3K G;  3QB3 A;  1GUW A;  2PZT A;  5FO8 B;  2MP1 A;  1GHJ A;  1RF2 D;  1S40 A;  1PH6 A;  2PYK A;  1JWU D;  3EQL C;  5C4H A;  1SJE D;  3TRZ A;  4DR7 Q;  5I9P A;  2DY8 A;  3FPP A;  1IL2 A;  3U50 C;  1A15 A;  1LTS D;  3MC0 B;  2G9D A;  2GVB A;  5HUR A;  1EU3 A;  3TZD A;  2ALY B;  5IYB H;  2KVM A;  4OON A;  1N8R C;  3FHW A;  5DM7 3;  4YHH Q;  5EKI A;  3BU2 A;  3PIP 3;  4KHP L;  2EJF C;  3BS1 A;  4RA8 A;  1IBL Q;  4QUF A;  1EYD A;  4RHS A;  1K9M C;  4QGU A;  2LFN A;  3K7A B;  2HIX A;  4YIJ A;  3GO5 A;  2IWH A;  2K52 A;  3SR1 A;  1IYV A;  3DMU A;  1IKL A;  2FXQ A;  2I5L X;  4CJ1 B;  1K73 C;  4BWG B;  1LAC A;  1XNQ L;  5FO9 B;  3RLF A;  1N32 Q;  3K0Y A;  3FRP B;  2KA7 A;  2NZO A;  3HOX G;  4RKB A;  2EYO A;  4P75 A;  3OSO A;  2KED A;  2Z6B A;  1XMO Q;  2IL8 A;  3GTP B;  2XRS D;  2ZT9 C;  1D6E C;  2BH2 A;  3AU7 A;  4POG A;  1J5E L;  2R7Z B;  3OPO A;  3HOZ H;  1FNU A;  3OWF A;  4DXG A;  1I4X A;  1LYL A;  3MXG A;  4BBR G;  1Q82 C;  3CKI B;  1E1T A;  1X54 A;  1MI2 A;  3JAM i;  5M5Y B;  4PZ8 A;  2OT2 A;  4C2M B;  3LX0 A;  3PUZ A;  2F3I A;  4JI0 Q;  1VQG A;  1IHZ A;  2LSS A;  3F1Z A;  5EPL A;  3TBI B;  5CMD A;  2RA4 A;  5JVG 3;  2JA5 B;  3T56 B;  3RZD H;  4LF9 L;  1PTO H;  3PSI A;  2XIW A;  4MTN A;  3Q8D A;  4A3M B;  1E7Z A;  1TXY A;  4QQB X;  1PMR A;  1JE5 A;  3LWU A;  4FNF A;  4DR1 Q;  1K0R A;  4A3G B;  1XMQ L;  4A3F B;  1Y1W B;  4NMZ A;  3GD7 A;  3GTL B;  3PO2 B;  4LFA L;  2R7Z G;  3T16 A;  3CXC A;  5C0X J;  3CQZ B;  2R93 H;  3OTO Q;  2A6H C;  2KHS A;  2N8N A;  4RKL A;  2O2L D;  5D3D A;  1E0B A;  1CKN B;  5J3B A;  2WFW A;  4FF2 A;  1OXS C;  4GN5 A;  1DD2 A;  2F4V Q;  1G29 1;  1X32 A;  3UDG A;  2E2J H;  2R92 B;  4K0K L;  3EN2 A;  4XYQ A;  3I7F A;  1FYC A;  1CUK A;  5K36 G;  1VQ5 A;  3M7N A;  4R4Q A;  5JJK A;  1HUN A;  2JA5 G;  1YBY A;  3PF5 A;  4OO1 H;  3X3N A;  1VQI A;  2HUG A;  3DEP A;  4HCS A;  5LL6 X;  4IJH A;  4G7H C;  1IW7 C;  1PTO D;  1BO0 A;  2VB3 X;  3BG3 A;  2K33 A;  4KK7 A;  1SE4 A;  5BR8 L;  1SDF A;  2VL6 A;  5HY6 A;  4A3M G;  1BCP B;  2UUB L;  1JJG A;  4X65 Q;  1VQ8 A;  1D7Q A;  4HID A;  1EYG A;  2OWO A;  1EOV A;  4XQN A;  4A3G G;  4A3F G;  2YU9 B;  1U4L A;  1HNZ L;  2ASB A;  1F9R A;  2IHF A;  1K3R A;  3PO2 G;  4X3S A;  2ZJQ A;  3GTG B;  2EXZ A;  4IPH A;  1T9H A;  1Y8P B;  1B3Q A;  4KI0 A;  1W2B A;  3HOW B;  4KY6 A;  3AFP A;  2YYZ A;  2A68 C;  3U4V A;  1A62 A;  1LTG D;  1AEX A;  1BBW A;  4X66 Q;  5HGQ A;  2R92 G;  3HEJ A;  1SXT A;  2TSS A;  2QDB A;  4U67 3;  1I4H A;  2B2Y A;  4GZY C;  1FGU A;  3R3O A;  3PGZ A;  1BNZ A;  2QGQ A;  2VNU D;  2AMC B;  1SNP A;  2EPB A;  3K57 A;  3TP6 A;  2N55 A;  1VQD A;  3T53 B;  4NXM Q;  4QUC A;  2KJX A;  2OXP A;  3I4L A;  4KHP Q;  4A4I A;  5LMN L;  5C44 H;  1Y8N B;  1BVS A;  2GN5 A;  3PUV A;  4APV A;  4CDE C;  4X3K A;  5IGE A;  4BXX H;  1PV4 A;  2YTY A;  2K1B A;  2NN6 I;  1VQO A;  1KAW A;  3ULP A;  2XSC A;  1EU4 A;  1E2V A;  5KNC A;  2N49 A;  5HGT A;  1VDZ A;  5IOC A;  2OTL A;  4DK0 A;  2F0U A;  3D6W A;  5EJW A;  3S2H H;  3GTM B;  2VB2 X;  2UXD L;  1XXG A;  2CH4 W;  4RH6 A;  2JA8 H;  3HOW G;  4JK1 C;  3S24 A;  2Z1C A;  3M4Y A;  4C1N K;  1WTV A;  4IUP A;  5TSS A;  2KCC A;  1A0I A;  2LMC B;  1II3 A;  1GUG A;  3NSW A;  2D5D A;  1WTR A;  3MTS A;  1EZ8 A;  1F9Q A;  5ELC A;  4LUV A;  4DR2 L;  1J5E Q;  1J8I A;  4IFD J;  1ZYR D;  4BY1 H;  3J81 L;  2JEB I;  4DR6 L;  1RJT A;  4EVO A;  2KCM A;  1CSQ A;  3GDE A;  5JPN C;  1V8Q A;  1EIG A;  2JA9 A;  4CKC A;  3O13 A;  4M8A A;  4K5V A;  5KRU A;  1XNR L;  1MIU A;  1FJG L;  2VS1 A;  1NUC A;  3J7A V;  3K5M A;  3UE1 A;  1D1I A;  3MXU A;  3Q0A A;  1LTT D;  1B8A A;  1FNW A;  1ONL A;  1CI3 M;  1X3P A;  3HG9 A;  1DOK A;  3M3Y B;  3NBH B;  4N8X 1;  3W2D A;  4LF9 Q;  4B08 A;  1PTO B;  1ET6 A;  2F4I A;  3RZO H;  3LWE A;  3ND8 A;  3TRE A;  3JC6 6;  1H95 A;  1QUQ B;  2EZV A;  4EQP A;  1YEZ A;  1Q12 A;  2KEC A;  2F0V A;  2CCZ A;  1XMQ Q;  3VYT A;  4CHT B;  3E5S A;  1PH5 A;  4LFA Q;  3HOZ G;  2R93 B;  2F0M A;  2HCI A;  1VQK A;  4O1N A;  1GUO A;  1LT4 D;  3A55 A;  3S1N H;  3P20 A;  1TR5 A;  3S16 B;  2I0Q A;  3LNN A;  2E2J B;  1STA A;  2H5X A;  5CGK A;  2F0D A;  4A3J H;  4K0K Q;  4I7A A;  4HIO A;  5LMU L;  4A3C G;  1EIF A;  5ELD A;  2PPB C;  1WTX A;  4CJ2 C;  4HJA A;  1O7I A;  4YY3 L;  1V1O A;  4L8J A;  2EXD A;  3D31 A;  4CKB A;  2F0L A;  2F0H A;  1I94 L;  3NTK A;  3AYH B;  4H0L C;  2E2H H;  1SFO H;  3BVM A;  3F8T A;  4TKO B;  5BR8 Q;  5IWA L;  2UUB Q;  1XTC D;  5C5L A;  4YWK A;  3Q24 A;  3TS0 A;  4IUT A;  3G71 A;  2F0E A;  5IT9 E;  1KNA A;  2Z0S A;  3L9A X;  2AWN A;  3RN2 A;  4K8J A;  2KQ3 A;  1QVG A;  4C56 C;  4JI7 L;  2Q8I B;  2NVX H;  2A1A A;  1CTM A;  3J81 i;  1HNZ Q;  4EQO A;  5IT9 c;  1EQT A;  1G51 A;  3TN2 A;  4ALP A;  2B2W A;  2R93 G;  1IL8 A;  4KHV A;  3ULL A;  4A3L H;  3R2T A;  1M8A A;  3KFU A;  3L7Z C;  3T13 A;  4A75 A;  2D2C C;  2JYO A;  3AB9 A;  1WJJ A;  1EEF D;  2MNA A;  1MGS A;  2HDL A;  2Q2H A;  4ULL A;  4A3E H;  4IUR A;  2RHS B;  4BBS H;  1K83 B;  5DAU A;  2QCP X;  2L0C A;  4WJW A;  3Q6S A;  3EA6 A;  2O5I C;  1E2W A;  4RFB A;  4LF8 L;  4OO1 G;  3KDF B;  1C8C A;  1G6P A;  2A74 C;  1TWA H;  3IKJ A;  4OWX B;  4DK3 C;  3TP8 A;  3T1Y Q;  2Q8T A;  1LLR D;  5K5P A;  5D3I B;  5LMN Q;  1PFN A;  1TWG B;  1C7Y A;  1BBX C;  2K01 A;  4LF4 L;  4WFN 3;  1Q81 C;  1NR4 A;  4B3T L;  1VF5 C;  4XT1 B;  2F0P A;  4DF7 A;  1FR3 A;  1NJI C;  3S2H B;  3RMH A;  1HQR D;  2UXD Q;  1PZK D;  1HNX L;  2JEA I;  3CCL A;  5FK9 C;  1WTH A;  3OIP A;  4UY8 C;  1R4Q B;  2H4O A;  1PRT B;  2OCE A;  3S17 H;  4PMW A;  4RCN A;  1PHJ A;  3I72 A;  1U4P A;  5T1G A;  2ZXP A;  3IAY A;  1C48 A;  3DHQ A;  4XT3 B;  4XQQ A;  3EVQ A;  3KF8 B;  4DR2 Q;  3JAM E;  4BY1 B;  4BY7 H;  2RF4 A;  1FVI A;  2N88 A;  3KDF A;  4K6L A;  4A3B H;  4DR6 Q;  3P7J A;  2LY7 A;  2ICI A;  2K50 A;  3NHH A;  3JAM c;  3VR3 A;  5IP7 G;  5IT9 L;  5T1I A;  5GAE C;  4R4C A;  1XNR Q;  3J7A 5;  1LTI D;  4ZAI A;  4GN4 B;  4IFD G;  4X64 L;  5C44 G;  1XPU A;  1NMG A;  1Y1V H;  1CM9 A;  3CPW A;  2UXC L;  1VQB A;  2DNC A;  2KEE A;  4K8I A;  2AUJ D;  4BXX G;  2GVA A;  3W1G A;  3PUX A;  5CBA E;  4IN3 A;  4KKS A;  1T5E A;  4V0B A;  3EJI A;  5CBE E;  1WVL A;  5C4X B;  5EBD A;  4RGO S;  5IP9 H;  1W3S A;  1QG7 A;  3NK9 A;  1JE4 A;  3RZO B;  4DV7 L;  4QCL A;  3NTI A;  2HCC A;  2XWB B;  3D4W A;  2WAC A;  2J0T D;  3UE0 A;  1A3T A;  4LK1 C;  3VA5 A;  2RDG A;  3GQB A;  4UP7 A;  1EL0 A;  2A73 B;  5M5X H;  3U4Z A;  1SJH D;  3CPF A;  3L3O C;  4J15 A;  2R61 A;  4OEM B;  1MJE A;  3S2D H;  1GD7 A;  2HHH L;  1LTB D;  2XVS A;  1VQN A;  3AFQ A;  2ES2 A;  2E8G A;  3FVQ A;  4DNT B;  4BY1 G;  3LGJ A;  4LJZ C;  4DV3 L;  3MXP A;  2R3Z A;  5FLM H;  1VQJ A;  2F1M A;  4N9T A;  1ICW A;  1DYQ A;  3K6O A;  3J80 L;  5COR A;  3I4M H;  1A63 A;  5CYU A;  5L37 A;  1Q8K A;  1OXU A;  4JW0 A;  3KLR A;  4OX9 L;  3PIO 3;  3CP0 A;  1HR0 L;  2F0K A;  1JR0 D;  2MGS A;  5KYL A;  3SXH A;  4YY3 Q;  1VF7 A;  5E4X A;  1F2Y A;  4DAV A;  3PMF A;  3HOU B;  5C4X G;  3A5U A;  2VXW A;  3J7A F;  2E2H B;  3G7L A;  1I94 Q;  1EIY B;  1XX8 A;  3CRL C;  3DUZ A;  3QG1 A;  3QO2 A;  1CHP D;  1PFM A;  2B8F A;  3S14 H;  3HFZ B;  4DUY L;  5IWA Q;  3D3R A;  4C3I H;  1K28 A;  1BR9 A;  1YNN C;  3S9W A;  3JAM L;  1PH1 A;  2L9H A;  4MHE A;  3KLW A;  3FMC A;  4JI7 Q;  1VQ4 A;  3M9B A;  5D65 A;  1M90 C;  4A3I H;  2CKZ B;  1BOS A;  4DXF A;  1SAP A;  4KLK A;  1B4O A;  4JVZ A;  4P2C B;  4J8Q A;  2A6H D;  2ZTE A;  1OO9 B;  5JPM C;  3F2D A;  4ZYS A;  4HSV A;  4FF4 A;  3HOX B;  2R7D A;  5LL6 S;  1SMY C;  3I4N B;  5ELE A;  1CT1 D;  4NDX A;  2EY2 A;  1BKB A;  1SEB D;  3DWP A;  3VR4 A;  2L1B A;  2C9O A;  1YNX A;  4BBS B;  3CD6 A;  2Q8R E;  3TEH B;  2QF7 A;  4HR7 B;  4F88 A;  2B63 B;  2F0S A;  1X9N A;  1STG A;  4LF8 Q;  3AQQ A;  3N6R A;  1TWA B;  3HOU G;  4BBR B;  1VQC A;  4HED A;  4IZ8 A;  3Q22 A;  1HNW L;  2EE1 A;  1MBY A;  4Y7N H;  1IW7 D;  1STN A;  4DV5 L;  1E1O A;  2B2T C;  2TMP A;  3ONA B;  1QCB D;  1HZ9 A;  4RG1 A;  1K8G A;  2RSN A;  4LF4 Q;  3I4O A;  1I50 H;  1KD1 C;  3M4O B;  2MO0 A;  2IPK D;  3A56 A;  3WOF A;  2IT1 A;  4B3T Q;  4DV0 L;  3C3L A;  4ABN A;  2HT1 A;  1SND A;  4A3L G;  1TWC H;  4OHJ A;  1QNU A;  4Z9C B;  1R9T H;  2FHT A;  3J80 i;  1HNX Q;  1A3U A;  2EIF A;  1SNQ A;  2A68 D;  4JCV E;  3S17 B;  1Z9F A;  3I4N G;  3PF4 A;  1PYW D;  3NWS A;  1YNJ C;  4MNO A;  5GAD C;  4HJ5 A;  1LT5 D;  4A3E G;  2AUK A;  2V1C C;  4BBS G;  2L55 A;  3A5Z B;  3CCV A;  3V2T A;  2IX0 A;  3FKI H;  4LUZ A;  2B63 G;  4PMB A;  2MHV A;  1B9M A;  1G8Z D;  4DR3 L;  4A3B B;  1SBB B;  2B2T A;  1J6Q A;  4LFC L;  2B2V C;  4HMJ A;  1YIT A;  1L0W A;  3VR2 A;  1X6O A;  3I2Z A;  1KIX A;  3H3V I;  2WIN B;  4GNX C;  4KJN A;  2B2U C;  3CW2 C;  1CZG A;  3J81 j;  1H9M A;  1QZH A;  1SYD A;  1LV9 A;  1RDP D;  3B6Y A;  3HGB A;  2Z6K C;  1RD9 D;  1TS5 A;  4X64 Q;  4FF3 A;  2UXC Q;  2LXJ A;  4TQU S;  1K3B C;  1P8L A;  1U4R A;  1KTK A;  3DLL A;  1KHI A;  2CVR A;  2LS0 1;  2ATW A;  2D9U A;  4U68 A;  4M1U B;  1BUV T;  2N78 A;  3NUC A;  1H9S A;  4WOR A;  3Q23 A;  1WTQ A;  1QJO A;  2I5M X;  1JC7 A;  4DV7 Q;  4HIM A;  3TP7 A;  3S15 H;  2DGY A;  4H7B A;  3CCJ A;  4A3D H;  2ID0 A;  5M5X B;  2Q2U A;  3S2D B;  5EKL A;  4IUU A;  4R8N A;  1D8L A;  3DWA A;  1DOL A;  2F0Q A;  2HHH Q;  1WFQ A;  2XNA C;  3PV0 A;  3OYY A;  3CMA A;  3T4A C;  4N9P A;  4ZQ3 A;  2UUC Q;  3C2P A;  4HAE A;  2BE5 D;  3F2U A;  4GNX A;  1WCM H;  4A3B G;  1PXU A;  2HD3 A;  2NZ1 D;  3R2I A;  4DV3 Q;  2E2I H;  1QIL A;  4XXE A;  2VQF L;  4GKJ L;  3MVV A;  1KRT A;  4P74 A;  4DGZ A;  5C3X A;  4X62 L;  1LT6 D;  2VQE Q;  1V43 A;  2MJ8 A;  2CHB D;  3W1B A;  4ZRZ A;  3K59 A;  3K7U C;  4OX9 Q;  1HUM A;  1EWI A;  1HR0 Q;  3HOV H;  2CWA A;  1O78 A;  1DGS A;  1F77 A;  1PZI D;  4ID6 A;  5IP9 G;  2M2L A;  1OXX K;  5M3M H;  1EEI D;  1M1K C;  4X3U A;  2IJ0 A;  3S14 B;  1HHV A;  3UDF A;  1VQE A;  4CDC C;  3E0E A;  4C3I B;  4YWM A;  1CA6 A;  4LW1 A;  1JMC A;  4DUY Q;  3J81 E;  3BVG A;  1HTL D;  4PZ6 A;  1G2T A;  4K14 A;  4FXD A;  4E6I A;  2VUM H;  3S1M H;  4KN4 C;  3J81 c;  2EY6 A;  1MSH A;  3TS2 A;  4ME3 A;  1C9O A;  4JC0 A;  4DAP A;  3PIP A;  3KF6 B;  1I6H H;  3CRK C;  5FLM G;  1YJN A;  1GUS A;  4FDB A;  1D5Z C;  2PI2 E;  2KHI A;  4NXN L;  1YI2 A;  3I4M G;  4DN4 M;  1DOM A;  3TDQ A;  2JA7 H;  1K0S A;  4XTC S;  3M85 A;  4DAY B;  4IPD A;  1BXT A;  1P16 A;  1RKN A;  3VYR A;  1LAB A;  1KAB A;  1B53 A;  3L0O A;  4RGT A;  1G6Z A;  3OMG A;  1S3O A;  4L6T B;  5LHY 1;  4J6H A;  4K2K A;  1HNW Q;  2WKC A;  3E0J A;  2NB0 A;  2D62 A;  1WI5 A;  4DV5 Q;  3TSS A;  3GTK H;  2PQA B;  4QMG A;  3CC7 A;  2PI2 A;  4C3I G;  2Q2T A;  1L1O B;  5ELN A;  4RCO A;  1DJR D;  1JJC B;  4UP9 A;  1L1O C;  4DV0 Q;  3N52 A;  3KF6 A;  5DEH A;  1HQM C;  1QOH A;  1O7Z A;  2RBM A;  3DEO A;  3IFT A;  4MIU A;  1XNQ Q;  3DWQ A;  2NTT A;  4HCE A;  4EX5 A;  2RCF A;  4OL7 A;  3K5N A;  3TP5 A;  4JI1 L;  2EY1 A;  4IPC A;  2PQE A;  3K80 C;  4DAY A;  4JV5 L;  1GJX A;  3RD4 A;  1S5F D;  3BDL A;  3FKI B;  4F8M A;  5COY A;  4FYD A;  3HOZ B;  4DR3 Q;  2K7V A;  3RUZ A;  1UE5 A;  2BE5 C;  1EY0 A;  1TWF H;  5FJ8 H;  5I2Y A;  4LFC Q;  1N36 L;  4GOP B;  3MEF A;  1KDB A;  2EYF A;  4KD4 A;  1LTA D;  2PQA A;  5EGT A;  3DM3 A;  3M4P A;  5BN3 A;  5IYB G;  1DM0 B;  2K5D A;  4GOP C;  1L1O A;  4FXK C;  2FMM A;  3UDI A;  3GTQ H;  1AH9 A;  2WII B;  3K58 A;  4KN7 C;  2FJ2 A;  1NNX A;  1NTG A;  4P71 A;  3RZD B;  1TS2 A;  1NCV A;  3S15 B;  4EQN A;  1EUJ A;  1HA5 A;  4A3D B;  1SYG A;  4I7Z C;  3QWN A;  1E2Z A;  1LO5 D;  2QW7 A;  3GV6 A;  1VQ6 A;  2DN8 A;  4PQX A;  3CCU A;  4OIK A;  3K5O A;  1IXR A;  4LF5 L;  1MHW C;  2EYH A;  1PH3 A;  5IYD H;  1BQQ T;  1PZJ D;  5IE8 A;  1WYD A;  1AZP A;  4OGQ C;  3FKI G;  4BS9 A;  1QWY A;  1F2L A;  2RCN A;  2E2I B;  1UE7 A;  2BH8 A;  5JAV A;  4B3M L;  4GOP A;  3H3V H;  2V4D A;  4GKJ Q;  2VQF Q;  2K5W A;  4X62 Q;  4L5Q A;  4QF4 A;  3H6M A;  2PNR C;  1NR2 A;  3FEW X;  3KBX A;  2RSO A;  3STB C;  3NWT A;  2MO1 A;  4L63 B;  3VYU A;  2HQL A;  1KAA A;  2B39 A;  4KMU C;  2EYM A;  4DUZ L;  2G5D A;  1KNE A;  2XGT A;  1S5B D;  5M3M B;  5GAH C;  2AKW B;  2PZU A;  1KRS A;  1MD2 D;  2Z8L A;  1ZXT A;  1STB A;  4A3D G;  3VDY A;  1ILP A;  4ZK9 B;  2R7F A;  3H0G H;  1PH2 A;  4JI3 L;  2A19 A;  4NPS A;  1AE2 A;  3VYS A;  3S1M B;  2VUM B;  3MWY W;  1MKH A;  5M3F H;  5CV7 A;  5IGC A;  3CME A;  4IUN A;  3K8A A;  3S1R H;  1VQF A;  3ULJ A;  3VR6 A;  1F9P A;  1DZ1 A;  2K32 A;  3A74 A;  4B3S L;  5KIX A;  5KEE A;  3H91 A;  1WCM G;  1I6H B;  4JYA L;  1AP0 A;  5M5W H;  1N34 L;  2O5J C;  3PUW A;  3P1H A;  2IX3 A;  4NXN Q;  3PO3 H;  3OW7 A;  1SRU A;  5I4D A;  2EYL A;  4R8I A;  3IRB A;  1EY6 A;  1EQR A;  1GKH A;  3T1H L;  1PH7 A;  1VS0 A;  1GXD C;  4KV6 A;  1X56 A;  2K6A A;  5AJ3 L;  3HOV G;  4DV1 L;  3CCR A;  4C3J H;  2ZXR A;  4KKU A;  3HOY H;  1C0A A;  2DY7 A;  1KDC A;  3DM1 A;  2F0I A;  1HZB A;  3SEB A;  1TKW B;  5M3M G;  4HN7 A;  4PMC A;  1X55 A;  1VQL A;  1SE3 A;  3MFY A;  4B9X A;  4IUQ A;  1I3Q H;  1YNN D;  5C44 B;  3MHB A;  4RAU C;  3IL8 A;  1U0L A;  4JOI C;  2VUM G;  4BA2 I;  2KBN A;  3CU7 A;  3K0X A;  1VQ9 A;  3J80 E;  1QVF A;  1GO3 E;  1I4G A;  1HFN A;  1LTL A;  1TWH H;  4DR7 L; 
#chains in the Genus database with same CATH homology
 3OMC A;  3HKZ B;  5KYI A;  2PMZ B;  1B9N A;  5ELF A;  2JA8 B;  2F0J A;  2KUM A;  1SMY D;  4HSP A;  2E2D C;  5ISR A;  1DXM A;  2XRQ D;  3V05 A;  4KKT A;  5C0X I;  1BCP F;  1EIH A;  1ESR A;  4TSS A;  1JWM D;  3P75 A;  4DNR B;  4HMI A;  2BOS A;  2X6G A;  1WD0 A;  3QJY A;  5C4Z A;  1F2Z A;  1Y69 U;  1HRJ A;  2F0O A;  4UDU C;  4IQZ A;  4FXG C;  3I8Z A;  3GTQ B;  3MXN A;  2WV6 D;  1AFP A;  3C46 A;  1WD1 A;  2JXM B;  2PO4 A;  2NN6 H;  1WTO A;  1TY2 A;  1K8M A;  5A2Q E;  2EY5 A;  2AQ3 B;  1HFG A;  2RQX A;  4OIJ A;  1Z6H A;  1PFB A;  1UEA B;  1ILQ A;  1CQV A;  2RVL A;  4CJ0 B;  1YNJ D;  5KND A;  1G2S A;  1TU2 B;  2K03 A;  3I91 A;  1O7Y A;  5CV8 A;  1W6J A;  3MAQ A;  2NWG A;  2H1E A;  3A7L A;  5FLX E;  2RKS A;  2CW0 C;  2Y0S B;  1ROD A;  1TS3 A;  5F2D A;  5JJZ A;  3S1N B;  4G7Z C;  2A69 C;  3H3V C;  2NBF A;  1SYC A;  1L0Y B;  1JWS D;  2EVB A;  4A3J B;  3V96 A;  2L12 A;  3AMU A;  5JOB A;  4DU9 A;  3MA2 B;  1UUP A;  2F0G A;  1HA6 A;  1VMC A;  1Y8O B;  4FO2 A;  4CGY B;  2XN9 C;  5CR3 A;  4H13 C;  3ERQ A;  1QB5 D;  5KGU A;  2EOT A;  1F2M A;  2M9V A;  2NYZ D;  2A5H A;  4CBV A;  1SFO B;  2EDG A;  2MPM A;  3D6C A;  3H0G B;  1S4Z A;  1TY0 A;  1XWE A;  1Z47 A;  3A8J E;  5CV6 A;  1ZKO A;  4DA2 A;  1KLU D;  4NW2 A;  2NVX B;  3QOL A;  1D2B A;  4KY7 A;  2F0F A;  1EOT A;  1SSO A;  1F9S A;  1SNO A;  5M5W B;  3ERO A;  3D4R A;  3SDZ A;  3PO3 B;  5EQ0 A;  1I4P A;  1RCV D;  2EJG C;  1Q90 A;  1PTO F;  2SNS A;  2K28 A;  1H9R A;  4IFD I;  5A2Q L;  4A3E B;  4C3J B;  3U9S A;  3HOY B;  1EFI D;  1JOO A;  3NPP A;  3BYT B;  1JOQ A;  4BA1 I;  3QOJ A;  3G6J B;  2EJM A;  1CFM A;  2FFK B;  4KTA A;  3HS0 C;  1NSN S;  4ME5 A;  4FP5 D;  3BDO A;  1I3Q B;  1ENC A;  5A35 A;  1TS4 A;  2ZXO A;  2WKD A;  5FLX L;  2IX1 A;  3A7A B;  1TWH B;  1U9R A;  2K05 A;  3I70 A;  3NQT A;  1EYC A;  4C3H B;  1H9S B;  1U4M A;  4XDX A;  2WAQ B;  3NXW A;  4G7O C;  3KK7 A;  3SE0 A;  3H94 A;  2WB1 B;  4O42 A;  1BCP D;  4C3J G;  3SVM A;  4BY7 B;  5M9O A;  4RGM A;  2JA6 B;  4CKE A;  2Z4I A;  1Q3L A;  3GTO B;  1JB3 A;  3I73 A;  4F7X A;  1AW7 A;  1Q1B A;  1Y1V B;  2SDF A;  5AFW A;  1B2T A;  1STY A;  2SNM A;  5DNF A;  4C3H G;  2A6E D;  4NP5 A;  4RHR A;  3R93 A;  1EY4 A;  2I46 A;  1I4Q A;  3BVZ A;  2R6G A;  1SE2 A;  5C0X H;  1CZW A;  2L11 A;  2B2V A;  4J1M A;  1CA5 A;  5J39 A;  2L5T A;  4KD3 A;  2B2U A;  5ELB A;  1BF4 A;  2SEB D;  1DON A;  5JEA H;  3I90 A;  5EPK A;  3I4M B;  1JOK A;  1EWH A;  3BZD B;  1PRT F;  5E4W C;  2NN6 G;  4RWS C;  3GP7 A;  4ZLT F;  1D5X C;  3PUY A;  4QB4 A;  4XQJ A;  1TVX A;  4KJO A;  1UNS A;  3OIQ A;  5IGB A;  2K04 A;  4ZKC B;  2J7Z A;  1BDO A;  5EPJ A;  1A2U A;  3NTH A;  3M7G A;  3MZ5 A;  5JEA J;  1ENA A;  1L0X B;  1STH A;  4A3I B;  1GOZ A;  1TQO A;  5I9O A;  5J22 A;  1J9O A;  2ENB A;  2B2Y C;  3OHX C;  1IYU A;  3NQI A;  2GA4 B;  1KLG D;  1R4P B;  5D14 A;  2RDH A;  4ZUJ A;  4Q0F A;  1LTR D;  5G3L F;  1BCP C;  1D1K A;  2L4N A;  3S1Q B;  4PNY A;  1RTN A;  5C6A A;  4FF1 A;  4I65 A;  4Y7N B;  3SK8 A;  2K5Q A;  2B8G A;  3TZU A;  5KNB A;  1EYA A;  1AZQ A;  1C4Q A;  1H9K A;  1ET9 A;  2KCN A;  2CQA A;  4S3S A;  1JCK B;  1I50 B;  4PV1 C;  3KUP A;  5C4J B;  4NKL A;  1HCZ A;  2QIL A;  1TWC B;  1R9T B;  2A6E C;  5CV9 A;  3HZX A;  4DFA A;  3HP3 A;  1JQY D;  3QIA A;  2NUC A;  4IFD H;  1O7L A;  1TT2 A;  1HXY D;  2RDF A;  2F3W A;  1WTW A;  4LAA A;  2QEJ C;  3D4D A;  3OWE B;  2BDN A;  2FMC A;  1NAP A;  2EYJ A;  1KDA A;  1UAP A;  1Q8I A;  1ENF A;  3DXJ C;  3BYY B;  2NVQ B;  2LKV A;  2AQ2 B;  3GV3 A;  3ITP A;  1K8O A;  1A3V A;  2E75 C;  2NVY B;  2BA0 A;  5FOB B;  2MUY A;  1FGB D;  3SK5 A;  3NP8 A;  5IIF A;  1DCZ A;  2Z4H A;  4A93 B;  5CC4 A;  2PCF B;  3A8K E;  1WCM B;  4ZKB B;  3BDC A;  1EZ6 A;  5C3W A;  4LMQ D;  3I3C A;  4RGN A;  1PTO C;  1IKM A;  1RTO A;  3HRZ C;  4XIG S;  1PRT D;  4R9W A;  2F0W A;  3HOV B;  2ICE C;  3GTJ B;  1PLF A;  1T5X D;  2F0T A;  2EYP A;  3WDN A;  1CQF A;  2F3V A;  5C5M A;  3NE5 B;  4UAI A;  5E3F A;  1GUT A;  2B2W C;  3IFD A;  2IW3 A;  1S5C D;  3URY A;  2HDM A;  1QE6 A;  4WRD A;  5C0X G;  5IGD A;  5DM6 3;  4AYB B;  3SK6 A;  3D8G A;  3NBH A;  1G91 A;  2CW0 D;  3W3A A;  1EY8 A;  1O80 A;  4JBW A;  2A69 D;  4MN3 A;  5JEA G;  5E1F A;  5EKK A;  2XWJ B;  2JA7 B;  4HTH A;  5G3L D;  2PW5 A;  3T51 B;  1LT3 D;  3A8I E;  1SNM A;  1OXT A;  1VMP A;  5EBC A;  3FDT A;  4FVM A;  1SYB A;  3GTK B;  1VCI A;  3TME A;  1Z7T A;  2F03 A;  1D5M C;  1GUN A;  1V1P B;  3OOC A;  3VA7 A;  3R8B A;  1WTP A;  1EY9 A;  1STE A;  2FIN B;  2NVT B;  1H9J A;  2E74 C;  1ZYR C;  4F87 A;  4C1N I;  1MSG A;  2G9H D;  1SYE A;  1S5E D;  4K5X A;  1Q1E A;  2HQE A;  1RHP A;  5FKA C;  4Q5V A;  1TWF B;  3ND9 A;  2AWO A;  4IUV A;  4IAL A;  3U9O A;  4QIW B;  2BA1 A;  3K5L A;  1V1P A;  2OF1 A;  4ODG A;  2SOB A;  1I4R A;  4TRD A;  1XYI A;  2E76 C;  4G57 A;  1PRT C;  1TII D;  1SNC A;  2KOL A;  4K5W A;  1JOR A;  1GHK A;  1EWC A;  2JP1 A;  5I6Y A;  1FD7 D;  1ZEQ X;  2WP8 J;  3NBI A;  3MFG A;  5IGF A;  3MEH A;  5BN5 A;  3EFX D;  1B44 D;  1SYF A;  1A6X A;  4B9W A;  5NUC A;  5BN4 A;  5C3E B;  5JVH 3;  5K36 H;  4XYO A;  2X69 A;  2J4X A;  2BCO A;  1JIC A;  4OO1 I;  1EY7 A;  3KBG A;  5FO7 B;  1AN8 A;  4KHZ A;  5IOD A;  3KLS X;  1B1Z A;  3FPU B;  5J1Z A;  3KF8 A;  3UI2 A;  1PDQ A;  3CHB D;  3E6Z X;  4KY5 A;  2X6L A;  3A54 A;  1I6V C;  2F0N A;  1EQV A;  1QNK A;  2DNE A;  4ILW A;  2AQ1 B;  4DK1 A;  3KLS A;  2I07 B;  1ESF A;  5CV4 A;  5M3F B;  4A3K B;  2PZW A;  2NTS A;  3S1R B;  1HPC A;  4ZUI A;  5I6W A;  1ML0 D;  1HTP A;  4G4K A;  2JSO A;  5CV5 A;  3SHL A;  1B3A A;  1W6K A;  1X3Q A;  1S5D D;  3C1E A;  3H09 A;  5I2X A;  2JE6 I;  4EGV A;  1A2T A;  3WOE A;  5IGG A;  2QKI C;  4K6D A;  2C5C A;  2O4X A;  3X3M A;  1M4V A;  4X3T A;  4H44 C;  1CK1 A;  3ZYY X;  4V19 0;  2PW7 A;  2BDO A;  2M00 A;  2OEO A;  1CHQ D;  1FNV A;  1EY5 A;  4K2L A;  3J7Y W;  1OXV A;  3VR5 A;  3SK4 A;  1B50 A;  3C1F A;  3QB3 A;  1GUW A;  2PZT A;  5FO8 B;  2MP1 A;  1GHJ A;  1RF2 D;  2PYK A;  1JWU D;  3EQL C;  5C4H A;  1SJE D;  5I9P A;  2DY8 A;  3FPP A;  1A15 A;  1LTS D;  3MC0 B;  2G9D A;  5HUR A;  1EU3 A;  3TZD A;  2KVM A;  5DM7 3;  5EKI A;  3PIP 3;  2EJF C;  3BS1 A;  4RA8 A;  4QUF A;  1EYD A;  4RHS A;  2LFN A;  3K7A B;  4YIJ A;  3GO5 A;  2IWH A;  3SR1 A;  1IYV A;  3DMU A;  1IKL A;  4CJ1 B;  4BWG B;  1LAC A;  5FO9 B;  3RLF A;  3K0Y A;  3FRP B;  2KA7 A;  4RKB A;  2EYO A;  3OSO A;  2KED A;  2IL8 A;  3GTP B;  2XRS D;  2ZT9 C;  1D6E C;  3AU7 A;  2R7Z B;  3OPO A;  1FNU A;  3OWF A;  4DXG A;  1I4X A;  3MXG A;  3CKI B;  1MI2 A;  5M5Y B;  2OT2 A;  4C2M B;  3LX0 A;  3PUZ A;  1IHZ A;  3TBI B;  5EPL A;  5CMD A;  2RA4 A;  5JVG 3;  2JA5 B;  3T56 B;  1PTO H;  2XIW A;  4A3M B;  1PMR A;  3LWU A;  4FNF A;  4A3G B;  4A3F B;  1Y1W B;  4NMZ A;  3GD7 A;  3GTL B;  3PO2 B;  3T16 A;  5C0X J;  3CQZ B;  2A6H C;  2KHS A;  4RKL A;  2O2L D;  5D3D A;  1E0B A;  4FF2 A;  1OXS C;  1DD2 A;  1G29 1;  1X32 A;  2R92 B;  4XYQ A;  1FYC A;  5K36 G;  3M7N A;  1HUN A;  4OO1 H;  3X3N A;  2HUG A;  3DEP A;  4HCS A;  5LL6 X;  4G7H C;  1IW7 C;  1PTO D;  1BO0 A;  2VB3 X;  3BG3 A;  2K33 A;  4KK7 A;  1SE4 A;  1SDF A;  1BCP B;  4XQN A;  2YU9 B;  1U4L A;  1F9R A;  4X3S A;  3GTG B;  2EXZ A;  1Y8P B;  4KI0 A;  3HOW B;  4KY6 A;  2YYZ A;  2A68 C;  1LTG D;  1AEX A;  3HEJ A;  1SXT A;  2TSS A;  2QDB A;  4U67 3;  1I4H A;  2B2Y A;  4GZY C;  3R3O A;  1BNZ A;  2VNU D;  1SNP A;  2EPB A;  3K57 A;  3TP6 A;  2N55 A;  3T53 B;  4QUC A;  2KJX A;  2OXP A;  3I4L A;  1Y8N B;  3PUV A;  4X3K A;  5IGE A;  2K1B A;  2NN6 I;  2XSC A;  1EU4 A;  1E2V A;  5KNC A;  5HGT A;  1VDZ A;  5IOC A;  4DK0 A;  2F0U A;  3D6W A;  5EJW A;  3GTM B;  2VB2 X;  1XXG A;  4RH6 A;  4JK1 C;  2Z1C A;  3M4Y A;  4C1N K;  1WTV A;  4IUP A;  5TSS A;  2KCC A;  2LMC B;  1II3 A;  1GUG A;  3NSW A;  2D5D A;  1WTR A;  3MTS A;  1EZ8 A;  1F9Q A;  5ELC A;  1J8I A;  4IFD J;  1ZYR D;  3J81 L;  2JEB I;  1RJT A;  4EVO A;  5JPN C;  1V8Q A;  1EIG A;  4CKC A;  3O13 A;  4M8A A;  4K5V A;  5KRU A;  1NUC A;  3J7A V;  3K5M A;  1D1I A;  3MXU A;  3Q0A A;  1LTT D;  1FNW A;  1ONL A;  1CI3 M;  1X3P A;  3HG9 A;  1DOK A;  3M3Y B;  3W2D A;  4B08 A;  1PTO B;  1ET6 A;  2F4I A;  3LWE A;  3ND8 A;  2EZV A;  4EQP A;  1Q12 A;  2KEC A;  2F0V A;  3VYT A;  4CHT B;  3E5S A;  2R93 B;  2F0M A;  2HCI A;  4O1N A;  1GUO A;  1LT4 D;  3A55 A;  3P20 A;  1TR5 A;  3S16 B;  3LNN A;  2E2J B;  1STA A;  5CGK A;  2F0D A;  5ELD A;  2PPB C;  1WTX A;  4CJ2 C;  1V1O A;  4L8J A;  3D31 A;  4CKB A;  2F0L A;  2F0H A;  3NTK A;  4H0L C;  3BVM A;  4TKO B;  1XTC D;  5C5L A;  3Q24 A;  4IUT A;  2F0E A;  5IT9 E;  1KNA A;  3L9A X;  2AWN A;  4K8J A;  2KQ3 A;  4C56 C;  2Q8I B;  1CTM A;  4EQO A;  1EQT A;  3TN2 A;  2B2W A;  1IL8 A;  4KHV A;  3R2T A;  1M8A A;  3L7Z C;  3T13 A;  2D2C C;  2JYO A;  3AB9 A;  1EEF D;  1MGS A;  2HDL A;  4ULL A;  4IUR A;  1K83 B;  5DAU A;  2QCP X;  2L0C A;  4WJW A;  3Q6S A;  3EA6 A;  2O5I C;  1E2W A;  4RFB A;  4OO1 G;  1C8C A;  2A74 C;  3IKJ A;  3TP8 A;  2Q8T A;  1LLR D;  5K5P A;  5D3I B;  1PFN A;  1TWG B;  1BBX C;  2K01 A;  4WFN 3;  1NR4 A;  1VF5 C;  4XT1 B;  2F0P A;  4DF7 A;  1FR3 A;  3S2H B;  3RMH A;  1HQR D;  1PZK D;  2JEA I;  5FK9 C;  3OIP A;  1R4Q B;  2H4O A;  1PRT B;  4PMW A;  4RCN A;  3I72 A;  1U4P A;  5T1G A;  2ZXP A;  3IAY A;  1C48 A;  3DHQ A;  4XT3 B;  4XQQ A;  3EVQ A;  3JAM E;  4BY1 B;  2N88 A;  4K6L A;  3P7J A;  2LY7 A;  2ICI A;  3NHH A;  3VR3 A;  5IT9 L;  5T1I A;  1LTI D;  4ZAI A;  4IFD G;  1CM9 A;  2DNC A;  4K8I A;  2KEE A;  2AUJ D;  3PUX A;  5CBA E;  4IN3 A;  4KKS A;  1T5E A;  4V0B A;  3EJI A;  5CBE E;  1WVL A;  5C4X B;  5EBD A;  4RGO S;  1QG7 A;  3NK9 A;  1JE4 A;  3RZO B;  4QCL A;  3NTI A;  2HCC A;  2XWB B;  3D4W A;  2WAC A;  2J0T D;  3VA5 A;  1A3T A;  4LK1 C;  2RDG A;  3GQB A;  1EL0 A;  2A73 B;  1SJH D;  3L3O C;  2R61 A;  1LTB D;  2XVS A;  3FVQ A;  4DNT B;  4LJZ C;  3MXP A;  2R3Z A;  2F1M A;  4N9T A;  1ICW A;  1DYQ A;  3K6O A;  3J80 L;  5COR A;  5CYU A;  1OXU A;  3KLR A;  3PIO 3;  2F0K A;  1JR0 D;  2MGS A;  5KYL A;  3SXH A;  1VF7 A;  5E4X A;  1F2Y A;  4DAV A;  3PMF A;  3HOU B;  2VXW A;  3J7A F;  2E2H B;  3G7L A;  1XX8 A;  3CRL C;  3DUZ A;  3QG1 A;  3QO2 A;  1CHP D;  1PFM A;  2B8F A;  3D3R A;  1BR9 A;  1YNN C;  3S9W A;  3JAM L;  2L9H A;  4MHE A;  3FMC A;  5D65 A;  4DXF A;  1BOS A;  1SAP A;  1B4O A;  4P2C B;  4J8Q A;  2A6H D;  5JPM C;  1OO9 B;  4ZYS A;  4HSV A;  4FF4 A;  3HOX B;  5LL6 S;  1SMY C;  3I4N B;  5ELE A;  1CT1 D;  4NDX A;  2EY2 A;  1SEB D;  3DWP A;  3VR4 A;  2L1B A;  2C9O A;  4BBS B;  2Q8R E;  2QF7 A;  4HR7 B;  4F88 A;  2B63 B;  2F0S A;  1STG A;  3N6R A;  1TWA B;  4BBR B;  4HED A;  4IZ8 A;  3Q22 A;  2EE1 A;  1MBY A;  1IW7 D;  1STN A;  2B2T C;  2TMP A;  3ONA B;  1QCB D;  2RSN A;  3M4O B;  3A56 A;  2IPK D;  3WOF A;  2IT1 A;  3C3L A;  4ABN A;  1SND A;  4OHJ A;  1QNU A;  4Z9C B;  2FHT A;  1A3U A;  1SNQ A;  2A68 D;  3S17 B;  1PYW D;  3NWS A;  1YNJ C;  1LT5 D;  2AUK A;  2L55 A;  3V2T A;  2IX0 A;  4PMB A;  2MHV A;  1B9M A;  1G8Z D;  4A3B B;  1SBB B;  2B2T A;  2B2V C;  4HMJ A;  3VR2 A;  2WIN B;  4KJN A;  2B2U C;  1CZG A;  1H9M A;  1SYD A;  1LV9 A;  1RDP D;  3HGB A;  1RD9 D;  1TS5 A;  4FF3 A;  4TQU S;  1U4R A;  1KTK A;  2CVR A;  2LS0 1;  2D9U A;  4U68 A;  4M1U B;  1BUV T;  3NUC A;  1H9S A;  4WOR A;  3Q23 A;  1WTQ A;  1QJO A;  1JC7 A;  3TP7 A;  4H7B A;  2ID0 A;  5M5X B;  3S2D B;  5EKL A;  4IUU A;  4R8N A;  3DWA A;  1DOL A;  2F0Q A;  2XNA C;  3PV0 A;  3T4A C;  4ZQ3 A;  4N9P A;  3C2P A;  4HAE A;  2BE5 D;  3F2U A;  1PXU A;  3R2I A;  2NZ1 D;  1QIL A;  4XXE A;  3MVV A;  4DGZ A;  5C3X A;  1LT6 D;  1V43 A;  2MJ8 A;  2CHB D;  4ZRZ A;  3K59 A;  1HUM A;  1O78 A;  1F77 A;  1PZI D;  4ID6 A;  2M2L A;  1OXX K;  1EEI D;  4X3U A;  2IJ0 A;  3S14 B;  1HHV A;  4C3I B;  1CA6 A;  3J81 E;  3BVG A;  1HTL D;  1G2T A;  4K14 A;  4FXD A;  4E6I A;  4KN4 C;  2EY6 A;  1MSH A;  4DAP A;  3CRK C;  1GUS A;  1D5Z C;  4DN4 M;  1DOM A;  3TDQ A;  4XTC S;  3M85 A;  1BXT A;  1RKN A;  3VYR A;  1LAB A;  1KAB A;  1B53 A;  4RGT A;  1G6Z A;  3OMG A;  4L6T B;  5LHY 1;  4J6H A;  4K2K A;  2WKC A;  3E0J A;  2NB0 A;  2D62 A;  3TSS A;  4QMG A;  4C3I G;  4RCO A;  1DJR D;  3N52 A;  5DEH A;  1HQM C;  1QOH A;  1O7Z A;  2RBM A;  3DEO A;  3IFT A;  4MIU A;  3DWQ A;  2NTT A;  4HCE A;  4OL7 A;  3K5N A;  3TP5 A;  2EY1 A;  2PQE A;  4DAY A;  1GJX A;  3RD4 A;  1S5F D;  3BDL A;  3FKI B;  4F8M A;  5COY A;  4FYD A;  3HOZ B;  2K7V A;  3RUZ A;  2BE5 C;  1EY0 A;  5I2Y A;  1KDB A;  2EYF A;  4KD4 A;  1LTA D;  5EGT A;  5BN3 A;  1DM0 B;  2K5D A;  4FXK C;  2FMM A;  2WII B;  3K58 A;  4KN7 C;  2FJ2 A;  3RZD B;  1TS2 A;  1NCV A;  3S15 B;  4EQN A;  1HA5 A;  4A3D B;  1SYG A;  4I7Z C;  3QWN A;  1E2Z A;  1LO5 D;  3GV6 A;  2DN8 A;  4PQX A;  4OIK A;  3K5O A;  2EYH A;  1BQQ T;  1PZJ D;  1AZP A;  4OGQ C;  4BS9 A;  1QWY A;  1F2L A;  2E2I B;  5JAV A;  2V4D A;  2K5W A;  4QF4 A;  3H6M A;  2PNR C;  1NR2 A;  3FEW X;  3KBX A;  2RSO A;  3NWT A;  4L63 B;  3VYU A;  1KAA A;  2B39 A;  4KMU C;  2EYM A;  1KNE A;  1S5B D;  5M3M B;  2PZU A;  1MD2 D;  2Z8L A;  1ZXT A;  1STB A;  1ILP A;  4ZK9 B;  3VYS A;  3S1M B;  2VUM B;  3MWY W;  5CV7 A;  5IGC A;  4IUN A;  3VR6 A;  1F9P A;  1DZ1 A;  2K32 A;  5KIX A;  5KEE A;  3H91 A;  1I6H B;  1AP0 A;  2O5J C;  3PUW A;  3P1H A;  2IX3 A;  3OW7 A;  5I4D A;  2EYL A;  4R8I A;  1EY6 A;  4KV6 A;  1GXD C;  2K6A A;  2ZXR A;  4KKU A;  2DY7 A;  1KDC A;  3DM1 A;  2F0I A;  3SEB A;  1TKW B;  4HN7 A;  4PMC A;  1SE3 A;  3MFY A;  4B9X A;  4IUQ A;  1YNN D;  5C44 B;  3MHB A;  4RAU C;  3IL8 A;  4BA2 I;  3CU7 A;  3J80 E;  1I4G A;  1HFN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...