1SYBA

Transfer of a beta-turn structure to a new protein context
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
137
structure length
137
Chain Sequence
KLHKEPATLIKAIDGDTVKLMSSNGSPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase(phosphoric diester)
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title Transfer of a beta-turn structure to a new protein context.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 35
structure length 137
sequence length 137
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1994-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1sybA00
1STHA 5KRUA 1EY6A 3QOJA 5C5MA 4J6HA 1STAA 5J1ZA 3D6CA 5C5LA 2EY1A 2EY5A 2OXPA 4KHVA 2F0LA 1EY0A 1EY5A 2F3WA 1SNOA 3OMCA 3HZXA 3NUCA 4HMIA 2PZTA 1KDAA 1JOQA 2F0HA 2F0OA 2F0PA 1A3VA 3EROA 4K8JA 4RKBA 5KGUA 5CV7A 3SK8A 5KIXA 2F0KA 4KV6A 3VA5A 5C4ZA 5K5PA 3E5SA 1TT2A 2EY2A 5IOCA 2F0GA 4WRDA 2F0WA 4NDXA 4HMJA 3NHHA 5DEHA 1A3UA 5JOBA 4DFAA 4EQPA 4F7XA 2HQEA 5E3FA 3T13A 4TRDA 4ODGA 3BDCA 2PZUA 3TP8A 1KABA 5KYLA 3C1EA 2RDFA 3MXPA 5I6YA 1ENCA 4KY5A 5CV6A 2EYHA 5IGGA 2QDBA 3D4WA 5IGBA 4KTAA 4DU9A 1JOKA 2F0TA 3ERQA 5CR3A 2KQ3A 1EYCA 2RBMA 2F0SA 1SNMA 5EKLA 2KHSA 5IGEA 1A2TA 1SNQA 2EYOA 2NUCA 2EYPA 3H6MA 2OEOA 1KAAA 3NQTA 4K8IA 5KEEA 1SYCA 1EY7A 2PZWA 2EXZA 1EY4A 2F0IA 3QOLA 2WACA 4PNYA 2ENBA 2O4XA 4KJOA 2EY6A 4EQNA 3D4DA 3LX0A 3MHBA 5M9OA 1SYBA 4K2KA 1RKNA 3TP7A 5F2DA 1STYA 1JORA 2SNSA 4ID6A 3MVVA 4HTHA 3NXWA 3T16A 5KYIA 4PMCA 4B9XA 5ISRA 3EVQA 4QF4A 1EZ8A 4QMGA 3S9WA 1U9RA 1JOOA 2SNMA 3ITPA 3U9OA 5J22A 1SNPA 5IODA 5DAUA 2F0DA 2F3VA 2F0FA 1KDCA 2EYLA 4H7BA 4K2LA 4NP5A 5HGTA 3R3OA 1STGA 1SYGA 2RKSA 4N9PA 1STBA 4K5WA 3P1HA 5E1FA 4YIJA 5CV8A 3NK9A 1SYDA 3NP8A 4RKLA 1TR5A 4ZQ3A 5JAVA 2PW7A 2PQEA 3OWFA 5C6AA 5J39A 4IZ8A 4KY7A 2F0JA 1IHZA 3MEHA 2PW5A 4IALA 4OL7A 4S3SA 1SYFA 4DF7A 4ZUJA 4K14A 4LAAA 3EJIA 1KDBA 5CV5A 3V2TA 4KY6A 5I9PA 3SHLA 3MZ5A 4MIUA 3C1FA 4K6DA 2F0NA 4B9WA 5C4HA 5EGTA 5IGFA 3SR1A 2PYKA 3DHQA 3TP5A 5CV4A 4R8NA 4F8MA 1STNA 1EY9A 2F0MA 2EYFA 2M00A 1A2UA 3D8GA 3DMUA 4I65A 1SNDA 4J1MA 4N9TA 4WORA 2F0QA 3TP6A 3PMFA 1EQVA 2EYJA 1EYDA 3BDLA 3SK6A 1A3TA 1II3A 5IGDA 1TQOA 4K5XA 4EVOA 3HEJA 3RUZA 2SOBA 5CGKA 4NKLA 4EQOA 4E6IA 1AEXA 3OSOA 5I9OA 1EY8A 1F2MA 4KJNA 1EYAA 1SYEA 3SK4A 4NMZA 5CC4A 5IIFA 4G57A 5NUCA 5C3WA 1NUCA 5EKKA 1EZ6A 3SXHA 2LKVA 1NSNS 3SK5A 4ME5A 5C3XA 1F2YA 4DGZA 2EYMA 4QB4A 4K5VA 2F0EA 4IUNA 2F0UA 4KD4A 4ZUIA 3QB3A 4PMBA 2F0VA 5IGCA 3P75A 1SNCA 5CV9A 3TMEA 5I6WA 3OMGA 5HURA 2OF1A 4KD3A 1F2ZA 1ENAA
chains in the Genus database with same CATH superfamily
1CA5A 3OYYA 1EY6A 1B70B 3BVZA 3LGJA 2I46A 4BBRG 2A8VA 4GN4B 2F3WA 1SNOA 3LWEA 3FDTA 2G9HD 3HOWH 2DUDA 4I7ZC 1VQBA 2EY2A 2F0WA 2A69C 4HMJA 3IL8A 4DFAA 1X65A 2VL6A 5EKIA 1YNJD 4A93H 1PV4A 4TRDA 1W2BA 2CW0D 1J6QA 1S4ZA 3TP8A 5LMUL 4Y7NH 5I6YA 2NVYB 1YITA 1STEA 1EYGA 2NUCA 1KAAA 4RGNA 1TY0A 1EY4A 3M85A 2NVQH 4UY8C 1BCPB 1N32L 4IPGA 2R93G 4MZ9A 4YWLA 5I4DA 3TZUA 2AWNA 1DGSA 1STYA 2RVLA 1H9SA 3T16A 2D5DA 2NN6H 5ELDA 2JA7B 1U4LA 3PUVA 1HTPA 1G51A 1VQHA 4FXGC 4NP5A 5BR8Q 1KNEA 1Q8IA 4JOIA 1I3QB 1BKBA 1QCBD 3ND9A 4X3UA 1FR3A 2VB3X 1JICA 3Q6SA 5K36G 2WKDA 3WOFA 1EOVA 3GV6A 4LJZC 1I50B 5DNFA 4JI0L 3J7A5 4R1JA 1K83B 4MIUA 4QUCA 4H44C 1X9NA 5M5XH 2PYKA 2RHSB 3TEHB 2PMZB 3Q22A 4Y52H 3D8GA 4CKEA 2KUMA 1SBBB 2RQXA 4R4OA 1R4PB 1A15A 5IP9G 4DUYQ 4OIJA 1DCZA 3TN2A 4DNTB 2EIFA 4CDCC 2VNUD 1VMPA 4CBVA 4FVMA 1AZQA 2B2WA 3PIO3 3S15H 1B53A 4DAYA 4C3JB 3RZOH 2NTTA 3VYRA 2VUMG 3U9SA 1IBKL 3RZDH 1A63A 4A3FB 4LW1A 1PMRA 1YEZA 2H5XA 1ZYRC 2VQFL 1ENAA 4GNXC 1VQMA 3K57A 5KRUA 4LUZA 1CA6A 2JJQA 1KRSA 3OMCA 5IYDG 2F0HA 1XWEA 4A3EG 2F0OA 3T1HQ 5KIXA 3GTQH 2ZM6L 3GTPH 1TWHH 2PQAB 5C3EB 1MBYA 3CQZH 2OCEA 2Z4HA 1NBWA 1QVGA 2NVTH 4F7XA 1NCVA 4DR6Q 3S2DB 2AMCB 1M90C 1WD0A 1VQAA 4DV3L 1KLGD 2VW9A 4JI6Q 2JQOA 3DM1A 3GO5A 4KY5A 5TSSA 3TRZA 3H0GG 2OTJA 1TWAH 1SRUA 4XDXA 5A2QL 1EYCA 3BS1A 3CAMA 4V190 3PF4A 2C9OA 1MJEA 3GTKH 2D62A 2FJ2A 1VQ6A 1NR4A 3UDGA 1J9OA 3H91A 2KEDA 1OTCA 3BVMA 1C4QA 1X3PA 4FP5D 2UUCQ 1PH5A 5ISRA 2VQEL 1V8QA 2NTSA 5COYA 4Q5VA 1HZAA 2E2DC 2LSSA 4GOPB 3ITPA 3SEBA 3J81i 3E0EA 3FKIB 2XWJB 4AH6A 5A35A 2ZJQA 4OX9L 3J80c 1QZHA 2Y0SG 4R4QA 4KN4C 1SMYD 3WOEA 3GTGH 1UEBA 2DNCA 4KY7A 4A3GB 1HNWL 3URYA 2BE5C 3KBXA 4S3SA 3T1YQ 3PO2H 3AYHB 4GKKL 4KY6A 1HXYD 1PTOH 3SHLA 5EJWA 2ES2A 5D65A 4LMQD 4BA2I 1WTVA 2A6HD 2YU9H 4DV1L 1KIXA 3I4MH 3RN5A 4I65A 4BA1I 3H3VH 2JA8H 1PZKD 4G7OC 1G6ZA 5IGDA 3I4LA 1AZPA 4AYBB 3OSOA 5CYUA 2RF4A 5LL6S 3H94A 3NELA 3ULJA 1VQEA 3OTOL 1A0IA 4C3HG 2DJFC 3AB9A 5JVH3 3C2PA 4BBSG 1SJED 3TZDA 4AQYL 1VQ5A 4LF4L 4DR4Q 5JJLA 1ET9A 3P75A 4PZ8A 3OMGA 1IW7D 1Q86C 3MFYA 3K8AA 1VQPA 1PYSB 1STAA 2Z6KA 5IP7H 1CHQD 4B3TQ 4A76A 4BY1B 1TWCH 2XWBB 4BS9A 4DV5Q 2PZTA 3UE0A 3HOZB 2IHFA 2F0PA 2L1BA 4C3IG 1EIHA 2JA5B 5CV7A 3ND8A 3JAML 2KA7A 2K33A 4QCLA 5M3MB 4WRDA 4RHSA 1UEAB 1A3UA 1VF5C 1U5KA 1FVIA 4NPSA 3OPOA 2P5ZX 3FVQA 3OHXC 4JI8L 2KCMA 1FNUA 5CBAE 4DR5Q 2HD3A 2XNAC 1G2TA 5C0XG 1K0SA 2ZJRA 2QCPX 2O2LD 4LFBQ 4IPCA 3AU7A 1GM5A 3BYTB 2ENBA 3D4DA 1GVPA 3I56A 3E9HA 1S40A 1E2VA 2R3ZA 3VR3A 1KRTA 1HFNA 5IYCH 2F1MA 2XTIA 5IYBH 1U9RA 5AJ3L 3S14H 3PV0A 1HH2P 1TXYA 2X6LA 5ELEA 1EEFD 2EYLA 1KDCA 4A3DB 3I7FA 1SFOH 1ML0D 4JC0A 4N9PA 5E1FA 1H9MA 2CHBD 3KUPA 4LFCL 4UP7A 2PNRC 4LUOA 4V0BA 3HOWG 1B3QA 4IUVA 4ZAIA 3RD4A 4IALA 4P75A 4ZUJA 4B3MQ 1CK1A 3H15A 2BDOA 3GTOB 3CP0A 4A3BH 1DOKA 4A93G 2F0NA 3H09A 1I4PA 3HFZB 2BDNA 5EGTA 1PXUA 1Q1BA 5IGFA 2N3SA 2UUAL 1XNRL 3A8JE 2V4DA 1R4QB 1XXGA 4BBRH 1A2UA 3CPWA 4K5XA 4JI2L 1UAPA 3PGZA 2NB0A 5IIFA 2L9HA 3N52A 5NUCA 1DM0B 5FO7B 3SK5A 1VQCA 4X66L 3U58A 1YJNA 1PHJA 1RF2D 3M3YB 4IJHA 1F2ZA 3QR8A 4LF9Q 3TQYA 2NN6G 2H4OA 1SXTA 4OGQC 3S15B 1L2FA 4R4CA 1MD2D 1E2ZA 4QIWE 3RZOB 1GUSA 1TWFH 4LF5L 3HZXA 1Q46A 4CJ2C 1WOCA 3C46A 5K5PA 2R93H 3E5SA 2Z9HA 5DEHA 2E5LQ 4IO9A 2MPMA 1PA6A 2XSCA 3GTQB 2K6AA 3GTPB 2F3IA 3L9AX 1WTWA 2PQAA 1RODA 3D4WA 4BY7H 1ILPA 3HGBA 2RBMA 1NE3A 5EBDA 4OHJA 5LMNW 1GUOA 1QNKA 2IT1A 1CKOA 4ZYSA 3KLSX 1D1IA 2Q2HA 1O7ZA 2EJFC 5T1IA 5FLXL 1Q90A 3LX0A 4FF2A 1RKNA 1NNXA 1NTGA 2QGQA 3HS0C 3GTLB 4IJLA 4PMCA 1L0XB 1Z47A 1EWIA 3GTKB 2ZJPA 3S9WA 1PH1A 4DV6Q 3KBGA 4NB3A 4YY3L 1TIID 1VQFA 4HCEA 3VR2A 5IP9H 1I6VC 1HCZA 2AUKA 3AEVA 2A68C 2E2JH 2PW7A 2PQEA 1XMQQ 1NMGA 4RWSC 2QDLA 5IWAQ 1XPRA 2CQOA 4GOPA 1RTNA 1U4MA 5M5WB 2JA6B 4DF7A 2NVXH 4PMWA 5C4JH 1WTOA 5C44H 3MWYW 3IAYA 5E4WC 3GTGB 3SR1A 5FKAC 1YVCA 1EY9A 2I5LX 2MGSA 4J1MA 3PO2B 4DR2Q 1OO9B 4P74A 1PTOB 3BDLA 1CKNB 1II3A 3J81c 2YTXA 2R7ZG 1AE2A 2CWAA 4DK0A 4IFDJ 4JI1Q 1EYAA 1TKWB 1XYIA 2EXDA 3M7GA 3NQIA 3I4MB 5D3DA 1EZ6A 1VF7A 1OXSC 2KHJA 3K5LA 2LKVA 3S1MB 3E3XA 4QB4A 1E22A 3STBD 3QB3A 4PZ6A 3G6JB 1QB5D 2B2YA 2UXCQ 1PFMA 5DM73 4HIDA 1F9QA 5T1GA 3HOXB 1PRTC 1E0BA 4N8X1 1B1ZA 2I5MX 2X69A 1KTKA 1K0RA 1I6HB 1JR0D 2N49A 4IQZA 1A3VA 1MI2A 4IN3A 2NZ1D 5KNDA 1EIYB 4IUQA 2IX3A 4NDXA 2DNEA 3F2UA 1TWCB 1GUTA 5GAGC 4BWGB 3DUZA 4L8JA 1OXXK 5BR8L 1K8GA 1KABA 1C0AA 3CMAA 4CDDC 2K5VA 2QW7A 4IPDA 1BDOA 3VDYA 2K4KA 1KXLA 3S1NH 1VQKA 4B08A 5CR3A 5J3BA 4HEDA 3F2DA 1BCPD 1YNJC 3WDNA 2JA8G 1HNZQ 3KYHC 5ELBA 2OEOA 2KHIA 1WTXA 2CW0C 2N88A 3ULLA 3AFQA 1BCPF 1TS3A 1EFWA 1LLRD 1GO3E 4A3MG 4XQJA 2F52A 3ZYYX 4A3KG 4FNFA 3I4NB 4ZRZA 5BN3A 4A3IH 4DUYL 4JI3Q 2IY5B 4K2LA 4L63B 1PH4A 3J7AV 1FNWA 1YJ9A 3W2DA 3A8KE 2R92H 1WJJA 1B2TA 1QILA 4X62Q 2A6ED 2EOTA 1BF4A 1N33L 1SE2A 1HZ9A 5ELOA 4C3HH 5IT9L 4BBSH 2I5HA 4WJWA 3EJIA 4JCVE 4POGA 1VDZA 1WCMB 1Y1VB 3MZ5A 4XTCS 1D1KA 1HZBA 1HNXL 1GUNA 2AQ2B 1EEID 3TBIB 3HKZG 3T56B 3M7NA 3T1HL 1TU2B 2I0QA 1B7YB 1SNDA 4YWKA 2MO1A 1XNQQ 2NZOA 1A8VA 1PFNA 2E74C 1C9OA 4A3BB 1HA6A 4EQOA 4E6IA 4DK6C 1TS4A 3CCJA 1SYEA 4DR6L 2QEXA 3V05A 4BBRB 1VQGA 1E1TA 1F2YA 2L11A 3CCMA 1E24A 5A2QE 3SE0A 3S1RH 4JI6L 4KHPQ 2B29A 2N55A 4LF6Q 4M8AA 4LK1C 5IYCG 3U50C 2EY1A 5L37A 1WTQA 2JK8A 2GA4B 4JBKA 5C4XG 3CPFA 2UUCL 4RAUC 1GUGA 4U68A 2MJ8A 3CCUA 1DOLA 4R9WA 3VR5A 1K8AC 2NBFA 1NJIC 3GQBA 2R93B 4KI0A 3RNUA 4X6AH 1EQTA 2B2VC 5CV6A 4JBWA 2PPBC 4HJ9A 3ERQA 1KHIA 2KQ3A 1EU4A 1SNQA 3T1YL 1JJGA 2K5WA 1EOTA 3I8ZA 2NYZD 4PNYA 1IZ6A 5EPKA 2OQ0A 1SYBA 3I73A 4C1NK 2E2HB 1HRJA 3DEOA 3M4QA 4HN7A 4DV0Q 2FFKB 4FO2A 1LO5D 4OWWB 2SNMA 1RL2A 2HIVA 3NEMA 5LL6X 3S2HH 3R3OA 4JBMA 3L7ZC 4X3KA 4ME3A 3S16H 4DR4L 1K28A 3SVMA 1M1KC 2VS1A 4K0KQ 3HOUG 3OIPA 1XPUA 5CV5A 4X3TA 3GTMB 1IYVA 3JAME 1F9RA 1ONLA 4DV5L 2XRSD 3T51B 1R9TH 1SMYC 3A0JA 5KNCA 4F8MA 1IKMA 4O2DA 3HOYH 1SJHD 2VUMB 3S24A 2HCCA 2ZXOA 4ZLTF 4RA8A 2NVXB 2Z1CA 2PNHA 2EYJA 1Y1WG 4BY7G 1LTTD 3KJPA 3MA2B 2CVRA 1FYCA 3M9BA 2A6HC 2RCFA 4DV2Q 2F4VQ 1FL0A 4GKJQ 4A3JG 4MTNA 1GUWA 4LWCA 4A3EB 3TSSA 5CV9A 4DR5L 4OO1H 1CKNA 5C0XI 3ICEA 2LMCB 2MQHA 5AFWA 3V96A 1N34Q 5C5MA 3A55A 4JBJA 4RFBA 5CORA 2ASBA 1CHPD 1EQRA 4I7AA 1JOQA 1KDAA 1V1PB 1F77A 3EROA 4EGVA 1ASYA 4RKBA 1TS2A 2F0KA 1IW7C 3ONAB 3TS2A 1ILQA 3VYSA 4A3LH 2K1BA 3H0GB 4NXMQ 3QG1A 1JB3A 4TVAB 1IXRA 4PG3A 1UUPA 5D14A 3OW7A 2QF7A 5C44G 4TKOB 3W1GA 1CZGA 3D31A 1J5EQ 1AN8A 2AKWB 1CI3M 1MSHA 3H6MA 4B3ML 1Y8OB 1VS0A 1TWGB 2WACA 5IE8A 4IUTA 5I2YA 5M9OA 4DR3Q 2Y0SB 1PVOA 2HHHQ 4ID6A 4DR7Q 2OWOA 2WP8J 3VR6A 1H9RA 3CMEA 2ZT9C 4JOIC 4QF4A 4NXNQ 1YNND 1O78A 4JW0A 1S72A 2PMZE 3PIPA 3I55A 2EVBA 4P73A 2R7ZH 1WYDA 4YIJA 4RKLA 4B3SQ 3QWNA 3M4OH 2YYZA 2PW5A 2NN6I 4LF9L 1ENFA 2JP1A 1EWCA 1W6KA 1B9MA 3R2IA 4HR7B 1YIJA 2FMMA 1BR9A 3K5NA 1D5ZC 3A56A 1Z7TA 3DHQA 4JPBW 4C3HB 3F2CA 1MIUA 4BBSB 1ASZA 1HZCA 2B2WC 4IOAA 3G4SA 1A3TA 2E2IH 3RUZA 3PUZA 1SE4A 2LXKA 5JVG3 1VQ4A 1SE3A 2E5LL 4P71A 4IUPA 1ESRA 5C3XA 2YTYA 3NE5B 3X3MA 5BN5A 3KLRA 4QL5A 3GTJB 4C3IB 4OELB 5I6WA 1HR0Q 4R4IA 1QJOA 1K8MA 1T5XD 5FLXE 5J1ZA 1XMOQ 4A3IG 3D6CA 3A5ZB 4K8JA 1KNAA 5JJIA 2B2UA 3BZKA 3FRPB 3SK8A 2R92G 3RLNA 3K7AB 5ELNA 4RCOA 1V9PA 4YCUA 3MXNB 5BN4A 3NHHA 3BJUA 4M1UB 2WV6D 4DV6L 4A3MH 4A3KH 2B63H 3CCQA 2X6GA 4X65Q 4RHRA 3MXPA 3S17B 1LT3D 4XYOA 3N6RA 3AMUA 4DU9A 3IKJA 1JOKA 1D5MC 5IWAL 1FD7D 2F0SA 5IGEA 3EA6A 2KHSA 5EKLA 1A2TA 4DN4M 3DM3A 5M3FG 2K14A 4CDEC 1LABA 2I07B 4QY7A 5FJ8H 2HT1A 1X3EA 2EY6A 4GLVB 3E6ZX 4XT3B 3DLLA 3K0YA 4AIMA 2G5DA 4IPHA 1HUMA 1TY2A 3MVVA 1C7YA 2IWHA 4DR2L 5E7NA 2DGYA 1S5DD 3EFXD 3HOWB 1VQOA 2JN4A 1HPCA 2F3VA 4JI1L 1JJCB 5M5YH 5LHY1 3BZDB 3UDXA 4A93B 1SYGA 1QG7A 4IOCA 1SR3A 2K04A 3NP8A 3CC7A 2UXCL 3OWFA 3FP9A 4IUUA 2K52A 4Y7NB 2CCZA 3NTIA 2EPBA 2EE1A 2Z6BA 4DV4Q 1CQFA 1JWUD 1MGSA 1JJ2A 1AH9A 1VQDA 1Q1EA 1AP0A 2FINB 3S16B 1BVSA 3KDFB 4EX5A 2DY7A 2IX0A 2Q8TA 3X3NA 1PTOD 2NVQB 1STNA 2EYFA 3TP6A 1X54A 1LM0A 1U4PA 4KHZA 2MNAA 2R7DA 1TQOA 3EN2A 3HEJA 5C4XH 4DNRB 4KJNA 3NWTA 3J80L 4G57A 1L1OB 1YHQA 2UU9Q 1G2SA 1VQLA 3SXHA 4JI5Q 3S1QH 3K80C 5ELFA 5EAYA 2IHEA 1I4XA 1D5XC 2F0UA 2Z6KC 3BYYB 2KCNA 5JEAH 3HOVG 2R61A 3TMEA 3A8IE 3KK7A 3H3VI 2ICEC 3VYUA 1STHA 1OXUA 1HNZL 1V1QA 2MUYA 3A7LA 2EY5A 2VQFQ 1EY5A 2Z4IA 3STBC 1S5FD 4X64Q 2K5DA 4C56C 5M5XB 4HJ7A 3VA5A 2QEJC 4OONA 1PFSA 1KAWA 1VMCA 3EQLC 1CT1D 1K8OA 4DXFA 3T4AC 3T53B 3U4ZA 1Q7YC 1JE4A 1K3RA 1V1PA 3C1EA 1LTSD 2ICIA 4ZKCB 5IT9E 4X62L 1MKHA 4MNOA 4HIMA 1VQNA 3HOYG 1LTGD 4OWXB 3MEFA 4APVA 3RZDB 3NQTA 5EQ0A 2K75A 3I3CA 2EXZA 2XGTA 4L5TA 3HOUH 2RHQB 4WJ3M 2FHTA 4DKAC 1Q81C 3A5UA 1C8CA 4LF8L 2D0PA 2XRQD 2SNSA 5KYIA 1BCPC 2B8FA 2GVAA 2B39A 2KEEA 3EVQA 1XNQL 4OO1G 1TWHB 2BH2A 2B8GA 1LACA 3CQZB 2PI2A 2IPKD 3KLWA 2NVTB 2F0DA 1WI5A 1Y1WH 3TS0A 2TSSA 2B2TA 4CJ1B 3BDOA 2RSNA 1DXMA 4KHPL 4A3JH 3C3LA 4IZ8A 4LF6L 2F0JA 3I4OA 4GLAC 4A3LG 2R7ZB 1TWAB 4CHTB 3R93A 1W6JA 1UE7A 3C1FA 4K6DA 5GROA 2A6EC 4YHHL 1IBLQ 3K6OA 2RSOA 3PIP3 4LUVA 4A4IA 2F0QA 3MXUA 3TREA 4DAMA 1EYDA 4RH6A 2AUJD 4LF7Q 1AEXA 2E76C 5I9OA 2OQKA 1DD2A 1SDFA 4ULLA 4GNXB 1OXTA 2E2IB 3OTOQ 1VQ8A 4GN3B 1FGBD 2Q2UA 3OWEB 4LF4Q 4N8FA 2HUGA 4KN7C 2YTVA 2KCCA 3F1ZA 3B6YA 2F0LA 4ZCKA 4DAPA 4FXKC 4HMIA 2N8NA 2HQLA 3UI2A 2A19A 2AQ1B 3IFDA 2YU9B 2AWOA 1DOMA 2JA7H 1XTDA 4DV0L 5IOCA 5EBCA 1ET6A 3K58A 2LFNA 1Q82C 2JA8B 1X3QA 1I3QH 1KD1C 3D4RA 2JE6I 1B50A 1I4RA 1JMCA 1CTMA 5KYLA 4JYAQ 3QIAA 5IGGA 1IL8A 4CJ0B 1I50H 4KTAA 4A3MB 3RR5A 4CKCA 4UP8A 3MXNA 1HR0W 1K83H 2RDGA 4K0KL 4A3KB 1WTRA 4R4TA 1JC7A 3MXGA 2JEAI 1X3FA 3OW2A 2B3GA 1A6XA 4K2KA 2BCOA 2BA1A 4QQBX 1U0LA 3R2TA 3L2PA 4DAVA 3U9OA 1HJPA 3JAMi 5DAUA 5EPLA 2F0FA 1IKLA 4C3JH 3PO3G 4GKJL 4DV2L 1O7LA 4UAIA 2Q2IA 3M4PA 4GOPC 2K03A 2JSOA 1BBWA 2UUBQ 5CV8A 3PUWA 3HKZB 3E0JA 1QOHA 5M5YB 1SYFA 1N34L 5I9PA 2CQAA 1SE8A 4IFDH 1Y8NB 1AW7A 2CH4W 1GHJA 5C3EH 3ERSX 1IYUA 1T5EA 2B63G 4MN3A 1QUQB 4FDBA 2K7VA 4WFN3 4G7HC 3VR4A 1K9MC 4NXML 1B3AA 3VYTA 5JJKA 2B2YC 1XPOA 3KDFA 1PH7A 3S14B 4JI2Q 4C2MH 4KKSA 2RDHA 5FJ8G 4F88A 5C0XJ 3SDZA 1SFOB 1CSPA 3J7AF 1LTRD 2WB1E 5C4XB 2L5TA 2HDLA 3KOJA 1F2LA 5CBEE 4DNIA 4QUFA 1NR2A 3CCVA 1L1OA 1CM9A 4TQUS 4L5RC 3D3RA 2QILA 2WB1G 2D0OA 4IURA 5M3FH 3MC0B 3IRBA 1HHVA 2M2LA 3DWAA 2HHHL 3J81L 5I2XA 4LF5Q 4DR7L 1TT2A 1JQYD 4G4KA 3FKIH 4NXNL 3PSIA 2PCFB 3GDEA 5E3FA 1YJWA 3CKIB 4A3GH 4JI4Q 4B3SL 1LYLA 2KCTA 4RGMA 1EIFA 3NTHA 1A62A 2JYOA 2KENA 2UXBQ 1HUNA 2F0IA 4ABNA 2O4XA 1YNXA 1JWMD 1TWFB 1QVCA 2Z8LA 1ZEQX 1GHKA 5JEAG 4CDFC 4DV7Q 3P7JA 2HCIA 3Q23A 4HSPA 3HOUB 5IODA 4H0LC 5FO8B 4OEMB 2F4IA 1EUJA 3E9IA 1SN8A 1LT6D 4PQXA 4YY3Q 3AQQA 1VQ9A 3NSWA 4UP9A 1RHPA 3KJOA 1YNNC 1HR0L 2MFIA 1O7YA 1HQMC 4OL7A 1Y1WB 1DJRD 4BY7B 4BY1H 3V2TA 3HOVH 1XMOL 1PH6A 3FPPA 2V1CC 2JA5H 1K73C 1F9SA 1E3PA 3RLOA 4DUZQ 4A3JB 5M3MH 1V1OA 3DEPA 3PMFA 4ILWA 4JVZA 2SOBA 3JC66 2A1AA 3I2ZA 4DR1Q 3SK4A 2XIWA 3LNNA 3HRZC 4X65L 1TS5A 1PH8A 1VQIA 2IJ0A 1J8IA 4PMBA 3KF8B 4X3SA 2A74C 1GOZA 5GQOA 2OF1A 4KD3A 2DY8A 2G9DA 2WAQE 4B3TL 2E2JB 2AQ3B 3QOJA 2K5QA 1BUVT 2CWPA 1I4GA 1YHAA 1D7QA 2CH4A 4JK1C 5GAEC 4GNXA 1BOSA 3KF6B 2N78A 3K0XA 5C4JB 2WAQG 5C44B 4KV6A 1CFMA 5C4ZA 3PUYA 4A3DH 3F8TA 1QZGA 4EQPA 1D8LA 2SEBD 4BXXH 3HKSA 4UHVA 1Z9FA 2RDFA 4LFBL 1MJCA 1YHBA 3GTOH 1NY4A 1N8RC 3VA7A 4DV4L 4JI7Q 1E2WA 1PYWD 2PZWA 4OXPA 2QA4A 3FEWX 1N9WA 1RJTA 1TVXA 4JG2A 4OWTB 3SGIA 4DK1A 4U673 4JV5Q 4HTHA 4ZKBB 3UDIA 3J80E 3BVGA 1SAPA 2ZXPA 5FLMG 3W3AA 2Q2TA 4H7BA 2HDMA 2UU9L 2ALYB 4JI5L 4K5WA 3M3YH 1Z6HA 3K5MA 5J39A 1BO0A 4Z9CB 1FJGQ 3S1NB 2JA7G 2EQSA 1WTHA 1N33Q 1ZXTA 2FMCA 5IY0A 1WD1A 3MFGA 5LMNQ 4B3RQ 5CV4A 5JPNC 1YZ6A 4X64L 2L12A 1HNXQ 4ALPA 1EQVA 3JAMc 3OOCA 3D6WA 4EVOA 4O0AA 5CC4A 4O42A 4A3IB 5C3WA 1PTOC 5EKKA 1IBMQ 4XIGS 2NWGA 4DGZA 2K50A 1PRTB 4GN5A 4IUNA 1QUQA 1QVFA 2F0VA 5IGCA 2R92B 1SROA 3H3VC 2TMPA 3G71A 4C2MB 3ER0A 2A69D 3LWUA 2J0TD 4KHVA 1EY0A 4C3JG 3NUCA 1B44D 3GTLH 4L5QA 1N36Q 2KOLA 4LFAQ 4A3FG 2PI2E 3DWQA 3NBHB 4J15A 4OO1I 1C48A 4HIOA 5CMDA 4XT1B 4K6LA 1BXTA 2Y0SE 5M3FB 1GXDC 4ODGA 3BDCA 2EDGA 3RMHA 3KLSA 4IFDG 1U4RA 1I94Q 2UXDQ 4KK7A 5C3EG 2O5IC 2EJMA 4PV1C 3PO3H 2WIIB 5ELCA 1JB7A 5IGBA 3FMCA 5M5WH 2JA6H 2VXWA 3S1RB 3BG3A 1EIGA 2EYOA 2EYPA 4WJ4A 1SYCA 4R8IA 1QNUA 3OIQA 1JT8A 3FHWA 1WFQA 1IBLL 1L0WA 5F2DA 2E75C 4HJAA 2LY7A 2VB2X 4QMGA 4P72A 1Y14B 2FXQA 4LF7L 2IW3A 3S1MH 1XJVA 1XMQL 5LMUQ 2J4XA 1BBUA 4ZQ3A 5EPJA 3NK9A 1SYDA 3HOXH 1Y69U 3A54A 1L0YB 1DYQA 5C6AA 1RIPA 3CD6A 1UE1A 4XQQA 1CZWA 1NAPA 1CSQA 1JE5A 3QO2A 1Y8PB 3FKIG 5DLQE 1KLUD 1I6HH 1ZKOA 1N32Q 3Q0AA 4GS3A 1WTPA 4KKTA 2F03A 3AFPA 2K5HA 4N9TA 5CGKA 3ULPA 4A3GG 4FF3A 3HOVB 3IFTA 5JEAJ 3FPUB 3U4VA 3BU2A 3KFUA 3MAQA 1RDPD 1ZYRD 2WFWA 1EY8A 3K7UC 4AYBE 2BA0A 1RTOA 4FF4A 4YCVA 2L4NA 4KD4A 4JYAL 3S2HB 2EZVA 1SNCA 3K59A 5HURA 1UNSA 4L6TB 2IL8A 4AYBG 4JI0Q 2B2UC 4J6HA 2M9VA 3J81j 4LNQA 5C5LA 1UE6A 3CC4A 3I4NH 3KF8A 5FLXc 2XVSA 4FYDA 1PTOF 1R9TB 5G3LD 2F0GA 1FNVA 3HOYB 1I4QA 3CHBD 5JOBA 1X6OA 1ICFB 2K28A 2ZTDA 1LTLA 1D2BA 4BY1G 4TSSA 3T13A 1X32A 1LT5D 3HOZG 3KF6A 5G3LF 2JA5G 1IBKQ 2UUBL 1ENCA 4QIWB 5M3MG 1PZJD 3CCSA 1CQVA 1WCMH 1Y1VH 2O5JC 1QWYA 2H1EA 2L55A 5HGQA 3A74A 4H02A 2VZAA 3L0OA 1LTID 2NZHA 4DA2A 3O13A 4GZYC 1PH2A 3A7AB 4A3CH 3MHBA 2JEBI 5JPMC 2ZM6Q 4YWMA 1JORA 4JI3L 3DXJC 2KVMA 1EZ8A 3NWSA 3MTSA 2BE5D 1S5BD 5KNBA 2K01A 1HFGA 4DV3Q 4XXEA 1EQQA 1S3OA 3PF5A 1SSOA 1HQRD 1NMFA 2WKCA 3G48A 1X55A 3ZJYC 2HIXA 2RCNA 4HSVA 3MEHA 1GJXA 2DN8A 1LV9A 3P20A 1JCKB 4Q0FA 1PH3A 4A3DG 1I5FA 1RD9D 4B9WA 3J81E 1LT4D 1KC8C 4BXXG 4R8NA 4HJ8A 3L3OC 4HJ5A 5GADC 1MHWC 2VQEQ 3SK6A 1MSGA 1PDQA 3PCOB 4KLKA 4NKLA 1EU3A 1F2MA 1B8AA 1P16A 3WWVA 4O1NA 1PLFA 3NENA 1XTCD 2R7FA 4OX9Q 1NSNS 2F0EA 1JWSD 4JI4L 3GP7A 1LTAD 1HNWQ 1W3SA 3G6EA 4GKKQ 3M4OB 3HP3A 4QJFA 1KL9A 2A73B 4J8QA 2UXBL 2E2HH 3PQIA 4CKBA 3M4YA 2D9UA 2ZXRA 4DV1Q 1HTLD 4NW2A 5FO9B 2WINB 5K36H 3G7LA 1BBXC 4RMFA 5KGUA 2ID0A 2KBNA 2C35B 2L0CA 4KMUC 4HCSA 1WVLA 4DV7L 2NVYH 4MTKA 4PZ7A 1VQJA 1SMXA 2GVBA 1T9HA 2HQEA 4OIKA 3CRLC 4RG1A 3CCEA 2BOSA 1E7ZA 1P8LA 2DJGC 3J7ZC 2PZUA 5FLMH 4AQYQ 3UE1A 3D0FA 2EYHA 1BNZA 1X56A 2QDBA 3NBHA 1EL0A 1H9SB 2JXMB 3GTMH 2F0TA 2IX1A 2AHOB 1SLJA 1SNMA 4QGUA 3TDQA 1XX8A 1G6PA 5KEEA 4K8IA 5IT9c 3F2BA 4HIKA 1PFBA 1UE5A 1BQQT 1O80A 2CFMA 3Q8DA 3PO3B 2VUMH 1EFID 4EQNA 5D3IB 4DUZL 2KJXA 1Q12A 1H95A 4YCWA 1PZID 1G8ZD 1E1OA 3NBIA 5DM63 3NXWA 4B9XA 1SEBD 1OXVA 2B2TC 2E8GA 1D6EC 1JOOA 1PYBA 4RCNA 1SNPA 1M8AA 2K5NA 4DR1L 5IYDH 3GD7A 3RN2A 5HGTA 4A3EH 3EIVA 5GAHC 1V43A 3BZCA 1M4VA 1EWHA 2Q8IB 3P1HA 4JI8Q 2Z0SA 4F87A 2ATWA 2B63B 1IYJB 5JAVA 5FOBB 1PH9A 2MHVA 1IHZA 3PUXA 3PIOA 1S5CD 4MHEA 4K14A 1KDBA 3HG9A 1LUZA 1LTBD 1B4OA 4DAYB 2CKZB 2A5HA 2F0MA 3H0GH 3J7YW 5FK9C 1Q3LA 2F4VL 2JA6G 2K05A 3CF5A 5AJ3Q 3I72A 4A3FH 1CUKA 2XN9C 5E4XA 4UPAA 4NMZA 1NUCA 5H1SE 1YBYA 2EYMA 4K5VA 2WB1B 5JJZA 3PO2G 4LFCQ 4POFA 3I91A 3W5OA 4RGOS 3NTKA 3W1BA 1X3GA 2D2CC 1TWGH 3CC2A 1AE3A 3I90A 4JI7L 3I4MG 3R8BA 2JA9A 2OXPA 2K32A 2UUAQ 1XNRQ 2ZTCA 3S2DH 2OT2A 4JV5L 2VY3A 4FF1A 4G7ZC 3HOXG 2LXJA 1G291 3EBEA 1F9PA 1H9JA 4GLXA 3Q24A 4DPGA 2LS01 4X66Q 1J5EL 1UWVA 3J80i 3K81C 5IP7G 3S1QB 2QKIC 1DZ1A 4CGYB 4L5SA 1FJGL 5HY6A 1AFPA 4H13C 1VQ7A 2YV5A 1ICWA 2B2VA 1EY7A 3HKZE 4DR3L 3QOLA 1K3BC 4KJOA 2ZTEA 2PO4A 4ZK9B 2MO0A 3CCLA 5LMNL 1O7IA 4B3RL 1DONA 3CXCA 3TP7A 4UDUC 3RLFA 2OTLA 2A68D 1GKHA 4LF8Q 1I4HA 3NPPA 5J22A 1HA5A 4DK3C 1VCIA 2EJGC 3GTJH 4C3IH 1STGA 2RKSA 1IBML 1STBA 1QE6A 4A75A 2BH8A 4HAEA 1TR5A 3I4NG 1ESFA 1IL2A 1Q8KA 4C1NI 3CCRA 1H9KA 4LAAA 3CRKC 2J7ZA 3UDFA 4EQ5A 1S5ED 1B9NA 2C5CA 3DWPA 5C4HA 3K7AH 4KKUA 3TP5A 1N36L 4FXDA 5IYBG 1FGUA 3CU7A 4LFAL 2M00A 3DMUA 4WORA 5C0XH 4YHHQ 2L15A 4XQNA 3GV3A 3QJYA 2Q8RE 1WCMG 1Y1VG 1PRTD 4P2CB 3I70A 2R6GA 4DXGA 3S17H 1GD7A 2GN5A 1RCVD 1YI2A 4IFDI 1KQSA 4ME5A 4RGTA 3K5OA 1I94L 2UXDL 4A3CG 4ZUIA 1CKMA 2KECA 1L1OC 3CW2C 2WAQB 2RA4A 4XYQA 1PRTF 3HOZH 4A3BG 2SDFA 1G91A 2MP1A
chains in the Genus database with same CATH topology
1CA5A 1EY6A 3BVZA 2I46A 2F3WA 1SNOA 3LWEA 3FDTA 2G9HD 4I7ZC 2EY2A 2F0WA 2A69C 4HMJA 3IL8A 4DFAA 5EKIA 1YNJD 4TRDA 2CW0D 1S4ZA 3TP8A 5I6YA 2NVYB 1STEA 2NUCA 1KAAA 4RGNA 1TY0A 1EY4A 3M85A 1BCPB 5I4DA 3TZUA 2AWNA 1STYA 2RVLA 1H9SA 3T16A 2D5DA 2NN6H 5ELDA 2JA7B 1U4LA 3PUVA 1HTPA 4FXGC 4NP5A 1KNEA 1Q8IA 1I3QB 1QCBD 3ND9A 4X3UA 1FR3A 2VB3X 1JICA 3Q6SA 5K36G 2WKDA 3WOFA 3GV6A 4LJZC 1I50B 5DNFA 1K83B 4MIUA 4QUCA 4H44C 2PYKA 2PMZB 3Q22A 3D8GA 4CKEA 2KUMA 1SBBB 2RQXA 1R4PB 1A15A 4OIJA 1DCZA 3TN2A 4DNTB 2VNUD 1VMPA 4CBVA 4FVMA 1AZQA 2B2WA 3PIO3 1B53A 4DAYA 4C3JB 2NTTA 3VYRA 3U9SA 4A3FB 1PMRA 1ZYRC 1ENAA 3K57A 5KRUA 1CA6A 3OMCA 2F0HA 1XWEA 2F0OA 5KIXA 5C3EB 1MBYA 2Z4HA 4F7XA 1NCVA 3S2DB 1WD0A 1KLGD 3DM1A 3GO5A 4KY5A 5TSSA 5A2QL 4XDXA 1EYCA 3BS1A 4V190 2C9OA 2D62A 2FJ2A 1NR4A 1J9OA 3H91A 2KEDA 3BVMA 1C4QA 1X3PA 4FP5D 5ISRA 1V8QA 2NTSA 5COYA 4Q5VA 2E2DC 3ITPA 3SEBA 3FKIB 2XWJB 5A35A 4KN4C 1SMYD 3WOEA 2DNCA 4KY7A 4A3GB 3URYA 2BE5C 3KBXA 4S3SA 4KY6A 1HXYD 1PTOH 3SHLA 5EJWA 5D65A 4LMQD 4BA2I 1WTVA 2A6HD 4I65A 4BA1I 1PZKD 4G7OC 1G6ZA 5IGDA 3I4LA 1AZPA 4AYBB 3OSOA 5CYUA 5LL6S 3H94A 4C3HG 3AB9A 5JVH3 3C2PA 1SJED 3TZDA 1ET9A 3P75A 3OMGA 1IW7D 3MFYA 1STAA 1CHQD 4BY1B 2XWBB 4BS9A 2PZTA 1EIHA 3HOZB 2F0PA 2L1BA 4C3IG 2JA5B 5CV7A 3ND8A 3JAML 2KA7A 2K33A 4QCLA 5M3MB 4WRDA 4RHSA 1UEAB 1A3UA 1VF5C 3OPOA 3FVQA 3OHXC 1FNUA 5CBAE 2XNAC 1G2TA 5C0XG 2QCPX 2O2LD 3AU7A 3BYTB 2ENBA 3D4DA 1E2VA 2R3ZA 3VR3A 1HFNA 2F1MA 1U9RA 3PV0A 5ELEA 2X6LA 1EEFD 2EYLA 1KDCA 4A3DB 1ML0D 4N9PA 5E1FA 1H9MA 2CHBD 3KUPA 2PNRC 4V0BA 3RD4A 4IUVA 4ZAIA 4IALA 4ZUJA 1CK1A 2BDOA 3GTOB 1DOKA 2F0NA 3H09A 1I4PA 2BDNA 5EGTA 1PXUA 1Q1BA 5IGFA 3A8JE 2V4DA 1R4QB 1XXGA 1A2UA 4K5XA 1UAPA 2NB0A 5IIFA 2L9HA 3N52A 5NUCA 1DM0B 5FO7B 3SK5A 1RF2D 3M3YB 1F2ZA 2NN6G 2H4OA 1SXTA 4OGQC 3S15B 1MD2D 1E2ZA 3RZOB 1GUSA 3HZXA 4CJ2C 3C46A 5K5PA 3E5SA 5DEHA 2MPMA 2XSCA 3GTQB 2K6AA 3GTPB 3L9AX 1WTWA 1RODA 3D4WA 1ILPA 3HGBA 2RBMA 5EBDA 4OHJA 1GUOA 1QNKA 2IT1A 4ZYSA 3KLSX 1D1IA 5T1IA 1O7ZA 2EJFC 5FLXL 1Q90A 3LX0A 4FF2A 1RKNA 3HS0C 3GTLB 4PMCA 1L0XB 1Z47A 3GTKB 3S9WA 3KBGA 1TIID 4HCEA 3VR2A 1I6VC 1HCZA 2AUKA 2A68C 2PW7A 2PQEA 4RWSC 1RTNA 1U4MA 5M5WB 2JA6B 4DF7A 4PMWA 1WTOA 3MWYW 3IAYA 5E4WC 3GTGB 3SR1A 5FKAC 1EY9A 2MGSA 4J1MA 3PO2B 1OO9B 1PTOB 3BDLA 1II3A 4DK0A 4IFDJ 1EYAA 1TKWB 1XYIA 3M7GA 3NQIA 3I4MB 5D3DA 1EZ6A 1VF7A 1OXSC 3K5LA 2LKVA 3S1MB 4QB4A 3QB3A 3G6JB 1QB5D 2B2YA 1PFMA 5DM73 1F9QA 5T1GA 3HOXB 1PRTC 1E0BA 1B1ZA 2X69A 1KTKA 1I6HB 1JR0D 4IQZA 1A3VA 1MI2A 4IN3A 2NZ1D 5KNDA 4IUQA 2IX3A 4NDXA 2DNEA 3F2UA 1TWCB 1GUTA 4BWGB 3DUZA 4L8JA 1OXXK 1KABA 1BDOA 4B08A 5CR3A 4HEDA 1BCPD 1YNJC 3WDNA 5ELBA 2OEOA 1WTXA 2CW0C 2N88A 1BCPF 1TS3A 1LLRD 4XQJA 3ZYYX 4FNFA 3I4NB 4ZRZA 5BN3A 4K2LA 4L63B 3J7AV 1FNWA 3W2DA 3A8KE 1B2TA 1QILA 2A6ED 2EOTA 1BF4A 1SE2A 5IT9L 4WJWA 3EJIA 1VDZA 1WCMB 1Y1VB 3MZ5A 4XTCS 1D1KA 1GUNA 2AQ2B 1EEID 3TBIB 3T56B 3M7NA 1TU2B 1SNDA 1PFNA 2E74C 4A3BB 1HA6A 4EQOA 4E6IA 1TS4A 1SYEA 3V05A 4BBRB 1F2YA 2L11A 5A2QE 3SE0A 2N55A 4M8AA 4LK1C 2EY1A 1WTQA 2GA4B 4RAUC 1GUGA 4U68A 2MJ8A 1DOLA 4R9WA 3VR5A 2NBFA 3GQBA 2R93B 4KI0A 1EQTA 2B2VC 5CV6A 4JBWA 2PPBC 3ERQA 2KQ3A 1EU4A 1SNQA 2K5WA 1EOTA 3I8ZA 2NYZD 4PNYA 5EPKA 1SYBA 3I73A 4C1NK 2E2HB 1HRJA 3DEOA 4HN7A 2FFKB 4FO2A 1LO5D 2SNMA 5LL6X 3R3OA 3L7ZC 4X3KA 3SVMA 3OIPA 5CV5A 4X3TA 3GTMB 1IYVA 3JAME 1F9RA 1ONLA 2XRSD 3T51B 1SMYC 5KNCA 4F8MA 1IKMA 1SJHD 2VUMB 2HCCA 2ZXOA 4ZLTF 4RA8A 2NVXB 2Z1CA 2EYJA 1LTTD 3MA2B 2CVRA 1FYCA 2A6HC 1GUWA 4A3EB 3TSSA 5CV9A 4OO1H 5C0XI 2LMCB 5AFWA 3V96A 5C5MA 3A55A 4RFBA 5CORA 1CHPD 1JOQA 1KDAA 1V1PB 1F77A 3EROA 4EGVA 4RKBA 1TS2A 2F0KA 1IW7C 3ONAB 1ILQA 3VYSA 2K1BA 3H0GB 3QG1A 1JB3A 1UUPA 5D14A 3OW7A 2QF7A 4TKOB 1CZGA 3D31A 1AN8A 1CI3M 1MSHA 3H6MA 1Y8OB 1TWGB 2WACA 4IUTA 5I2YA 5M9OA 2Y0SB 4ID6A 2WP8J 3VR6A 1H9RA 2ZT9C 4QF4A 1YNND 1O78A 2EVBA 4YIJA 4RKLA 3QWNA 2YYZA 2PW5A 2NN6I 1ENFA 2JP1A 1EWCA 1W6KA 1B9MA 3R2IA 4HR7B 2FMMA 1BR9A 3K5NA 1D5ZC 3A56A 1Z7TA 3DHQA 4C3HB 4BBSB 2B2WC 1A3TA 3RUZA 3PUZA 1SE4A 5JVG3 1SE3A 4IUPA 1ESRA 5C3XA 3NE5B 3X3MA 5BN5A 3KLRA 3GTJB 4C3IB 5I6WA 1QJOA 1K8MA 1T5XD 5FLXE 5J1ZA 3D6CA 4K8JA 1KNAA 2B2UA 3FRPB 3SK8A 3K7AB 4RCOA 5BN4A 3NHHA 4M1UB 2WV6D 2X6GA 4RHRA 3MXPA 3S17B 1LT3D 4XYOA 3N6RA 3AMUA 4DU9A 3IKJA 1JOKA 1D5MC 1FD7D 2F0SA 5IGEA 3EA6A 2KHSA 5EKLA 1A2TA 4DN4M 1LABA 2I07B 2EY6A 3E6ZX 4XT3B 3K0YA 1HUMA 1TY2A 3MVVA 2IWHA 1S5DD 3EFXD 3HOWB 1HPCA 2F3VA 5LHY1 3BZDB 4A93B 1SYGA 1QG7A 2K04A 3NP8A 3OWFA 4IUUA 4Y7NB 3NTIA 2EPBA 2EE1A 1CQFA 1JWUD 1MGSA 1Q1EA 1AP0A 2FINB 3S16B 2DY7A 2IX0A 2Q8TA 3X3NA 1PTOD 2NVQB 1STNA 2EYFA 3TP6A 1U4PA 4KHZA 1TQOA 3HEJA 4DNRB 4KJNA 3NWTA 3J80L 4G57A 1G2SA 3SXHA 5ELFA 1I4XA 1D5XC 2F0UA 3BYYB 2KCNA 5JEAH 2R61A 3TMEA 3A8IE 3KK7A 3VYUA 2ICEC 1STHA 1OXUA 2MUYA 3A7LA 2EY5A 1EY5A 2Z4IA 1S5FD 2K5DA 4C56C 5M5XB 3VA5A 2QEJC 1VMCA 3EQLC 1CT1D 1K8OA 4DXFA 3T4AC 3T53B 1JE4A 1V1PA 3C1EA 1LTSD 2ICIA 4ZKCB 5IT9E 1LTGD 3RZDB 3NQTA 5EQ0A 3I3CA 2EXZA 2FHTA 1C8CA 2XRQD 2SNSA 5KYIA 1BCPC 2B8FA 2B39A 2KEEA 3EVQA 4OO1G 1TWHB 2B8GA 1LACA 3CQZB 2IPKD 2NVTB 2F0DA 2TSSA 2B2TA 4CJ1B 3BDOA 2RSNA 1DXMA 3C3LA 4IZ8A 2F0JA 2R7ZB 1TWAB 4CHTB 3R93A 1W6JA 3C1FA 4K6DA 2A6EC 3K6OA 2RSOA 3PIP3 2F0QA 3MXUA 1EYDA 4RH6A 2AUJD 1AEXA 2E76C 5I9OA 1DD2A 1SDFA 4ULLA 1OXTA 2E2IB 1FGBD 3OWEB 2HUGA 4KN7C 2KCCA 2F0LA 4DAPA 4FXKC 4HMIA 3UI2A 2AQ1B 3IFDA 2YU9B 2AWOA 1DOMA 5IOCA 5EBCA 1ET6A 3K58A 2LFNA 2JA8B 1X3QA 3D4RA 2JE6I 1B50A 1I4RA 1CTMA 5KYLA 3QIAA 5IGGA 1IL8A 4CJ0B 4KTAA 4A3MB 4CKCA 3MXNA 2RDGA 4A3KB 1WTRA 1JC7A 3MXGA 2JEAI 1A6XA 4K2KA 2BCOA 2BA1A 3R2TA 4DAVA 3U9OA 5DAUA 5EPLA 2F0FA 1IKLA 1O7LA 4UAIA 2K03A 2JSOA 5CV8A 3PUWA 3HKZB 3E0JA 1QOHA 5M5YB 1SYFA 5I9PA 2CQAA 4IFDH 1Y8NB 1AW7A 1GHJA 1IYUA 1T5EA 4MN3A 2K7VA 4WFN3 4G7HC 3VR4A 1B3AA 3VYTA 2B2YC 3S14B 4KKSA 2RDHA 4F88A 5C0XJ 3SDZA 1SFOB 3J7AF 1LTRD 5C4XB 2L5TA 2HDLA 1F2LA 5CBEE 4QUFA 1NR2A 4TQUS 1CM9A 3D3RA 2QILA 4IURA 3MC0B 1HHVA 2M2LA 3DWAA 3J81L 5I2XA 1TT2A 1JQYD 4G4KA 2PCFB 5E3FA 3CKIB 4RGMA 3NTHA 2JYOA 1HUNA 2F0IA 4ABNA 2O4XA 1JWMD 1TWFB 2Z8LA 1GHKA 1ZEQX 5JEAG 3P7JA 2HCIA 3Q23A 4HSPA 3HOUB 5IODA 4H0LC 5FO8B 2F4IA 1LT6D 4PQXA 3NSWA 1RHPA 1YNNC 4OL7A 1O7YA 1HQMC 1Y1WB 1DJRD 4BY7B 3V2TA 3FPPA 1F9SA 4A3JB 1V1OA 3DEPA 3PMFA 4ILWA 2SOBA 3SK4A 2XIWA 3LNNA 3HRZC 1TS5A 2IJ0A 1J8IA 4PMBA 4X3SA 2A74C 1GOZA 2OF1A 4KD3A 2DY8A 2G9DA 2E2JB 2AQ3B 3QOJA 2K5QA 1BUVT 1I4GA 4JK1C 1BOSA 5C4JB 5C44B 4KV6A 1CFMA 5C4ZA 3PUYA 4EQPA 2SEBD 2RDFA 3VA7A 1E2WA 1PYWD 2PZWA 3FEWX 1RJTA 1TVXA 4DK1A 4U673 4HTHA 4ZKBB 3J80E 3BVGA 1SAPA 2ZXPA 3W3AA 4H7BA 2HDMA 4K5WA 1Z6HA 3K5MA 5J39A 1BO0A 4Z9CB 3S1NB 1ZXTA 2FMCA 1WD1A 3MFGA 5CV4A 5JPNC 2L12A 1EQVA 3OOCA 3D6WA 4EVOA 5CC4A 4O42A 4A3IB 5C3WA 1PTOC 5EKKA 4XIGS 2NWGA 4DGZA 1PRTB 4IUNA 2F0VA 5IGCA 2R92B 3H3VC 2TMPA 4C2MB 2A69D 3LWUA 2J0TD 4KHVA 1EY0A 4C3JG 3NUCA 1B44D 2KOLA 3DWQA 4OO1I 1C48A 5CMDA 4XT1B 4K6LA 1BXTA 5M3FB 1GXDC 4ODGA 3BDCA 2EDGA 3RMHA 3KLSA 4IFDG 1U4RA 4KK7A 2O5IC 2EJMA 4PV1C 2WIIB 5ELCA 5IGBA 3FMCA 2VXWA 3S1RB 3BG3A 1EIGA 2EYOA 2EYPA 1SYCA 4R8IA 1QNUA 3OIQA 5F2DA 2E75C 2LY7A 2VB2X 4QMGA 2IW3A 2J4XA 4ZQ3A 5EPJA 3NK9A 1SYDA 1Y69U 3A54A 1L0YB 1DYQA 5C6AA 4XQQA 1CZWA 1NAPA 3QO2A 1Y8PB 1KLUD 1ZKOA 3Q0AA 1WTPA 4KKTA 2F03A 4N9TA 5CGKA 4FF3A 3HOVB 3IFTA 5JEAJ 3FPUB 3MAQA 1RDPD 1ZYRD 1EY8A 2BA0A 1RTOA 4FF4A 2L4NA 4KD4A 3S2HB 2EZVA 1SNCA 3K59A 5HURA 1UNSA 4L6TB 2IL8A 2B2UC 4J6HA 2M9VA 5C5LA 3KF8A 2XVSA 4FYDA 1PTOF 1R9TB 5G3LD 2F0GA 1FNVA 3HOYB 1I4QA 3CHBD 5JOBA 2K28A 1D2BA 4TSSA 3T13A 1X32A 1LT5D 5G3LF 1ENCA 4QIWB 1PZJD 1CQVA 2O5JC 1QWYA 2H1EA 2L55A 1LTID 4DA2A 3O13A 4GZYC 3A7AB 3MHBA 2JEBI 5JPMC 1JORA 3DXJC 2KVMA 1EZ8A 3NWSA 3MTSA 2BE5D 1S5BD 5KNBA 2K01A 1HFGA 4XXEA 1SSOA 1HQRD 2WKCA 4HSVA 3MEHA 1GJXA 2DN8A 1LV9A 3P20A 1JCKB 4Q0FA 1RD9D 4B9WA 3J81E 1LT4D 4R8NA 3L3OC 3SK6A 1MSGA 1PDQA 4NKLA 1EU3A 1F2MA 4O1NA 1PLFA 1XTCD 1NSNS 2F0EA 1JWSD 3GP7A 1LTAD 3M4OB 3HP3A 2A73B 4J8QA 4CKBA 3M4YA 2D9UA 2ZXRA 4NW2A 5FO9B 1HTLD 2WINB 5K36H 3G7LA 1BBXC 5KGUA 2ID0A 2L0CA 4KMUC 4HCSA 1WVLA 2HQEA 4OIKA 3CRLC 2BOSA 2PZUA 2EYHA 1BNZA 1EL0A 2QDBA 3NBHA 1H9SB 2JXMB 2F0TA 2IX1A 1SNMA 3TDQA 1XX8A 5KEEA 4K8IA 1PFBA 1BQQT 1O80A 3PO3B 1EFID 4EQNA 5D3IB 2KJXA 1Q12A 1PZID 1G8ZD 3NBIA 5DM63 3NXWA 4B9XA 1SEBD 1OXVA 2B2TC 1D6EC 1JOOA 4RCNA 1SNPA 1M8AA 3GD7A 5HGTA 1V43A 1M4VA 1EWHA 2Q8IB 3P1HA 4F87A 2B63B 5JAVA 5FOBB 2MHVA 1IHZA 3PUXA 1S5CD 4MHEA 4K14A 1KDBA 3HG9A 1LTBD 1B4OA 2A5HA 2F0MA 3J7YW 5FK9C 1Q3LA 2K05A 3I72A 2XN9C 5E4XA 4NMZA 1NUCA 2EYMA 4K5VA 2WB1B 5JJZA 3I91A 4RGOS 3NTKA 2D2CC 3I90A 3R8BA 2OXPA 2K32A 2OT2A 4FF1A 4G7ZC 1G291 1F9PA 1H9JA 3Q24A 2LS01 3S1QB 2QKIC 1DZ1A 4CGYB 1AFPA 4H13C 1ICWA 2B2VA 1EY7A 3QOLA 4KJOA 2PO4A 4ZK9B 1DONA 3TP7A 4UDUC 3RLFA 2A68D 1I4HA 3NPPA 5J22A 1HA5A 1VCIA 2EJGC 1STGA 2RKSA 1STBA 1QE6A 4HAEA 1TR5A 1ESFA 4C1NI 1H9KA 4LAAA 3CRKC 2J7ZA 1S5ED 1B9NA 2C5CA 3DWPA 5C4HA 4KKUA 3TP5A 4FXDA 3CU7A 2M00A 3DMUA 4WORA 5C0XH 4XQNA 3GV3A 3QJYA 2Q8RE 1PRTD 4P2CB 3I70A 2R6GA 4DXGA 1RCVD 4IFDI 4ME5A 4RGTA 3K5OA 4ZUIA 2KECA 4XYQA 2WAQB 2RA4A 1PRTF 2SDFA 1G91A 2MP1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1STH A;  5KRU A;  1EY6 A;  3QOJ A;  5C5M A;  4J6H A;  1STA A;  5J1Z A;  3D6C A;  5C5L A;  2EY1 A;  2EY5 A;  2OXP A;  4KHV A;  2F0L A;  1EY0 A;  1EY5 A;  2F3W A;  1SNO A;  3OMC A;  3HZX A;  3NUC A;  4HMI A;  2PZT A;  1KDA A;  1JOQ A;  2F0H A;  2F0O A;  2F0P A;  1A3V A;  3ERO A;  4K8J A;  4RKB A;  5KGU A;  5CV7 A;  3SK8 A;  5KIX A;  2F0K A;  4KV6 A;  3VA5 A;  5C4Z A;  5K5P A;  3E5S A;  1TT2 A;  2EY2 A;  5IOC A;  2F0G A;  4WRD A;  2F0W A;  4NDX A;  4HMJ A;  3NHH A;  5DEH A;  1A3U A;  5JOB A;  4DFA A;  4EQP A;  4F7X A;  2HQE A;  5E3F A;  3T13 A;  4TRD A;  4ODG A;  3BDC A;  2PZU A;  3TP8 A;  1KAB A;  5KYL A;  3C1E A;  2RDF A;  3MXP A;  5I6Y A;  1ENC A;  4KY5 A;  5CV6 A;  2EYH A;  5IGG A;  2QDB A;  3D4W A;  5IGB A;  4KTA A;  4DU9 A;  1JOK A;  2F0T A;  3ERQ A;  5CR3 A;  2KQ3 A;  1EYC A;  2RBM A;  2F0S A;  1SNM A;  5EKL A;  2KHS A;  5IGE A;  1A2T A;  1SNQ A;  2EYO A;  2NUC A;  2EYP A;  3H6M A;  2OEO A;  1KAA A;  3NQT A;  4K8I A;  5KEE A;  1SYC A;  1EY7 A;  2PZW A;  2EXZ A;  1EY4 A;  2F0I A;  3QOL A;  2WAC A;  4PNY A;  2ENB A;  2O4X A;  4KJO A;  2EY6 A;  4EQN A;  3D4D A;  3LX0 A;  3MHB A;  5M9O A;  1SYB A;  4K2K A;  1RKN A;  3TP7 A;  5F2D A;  1STY A;  1JOR A;  2SNS A;  4ID6 A;  3MVV A;  4HTH A;  3NXW A;  3T16 A;  5KYI A;  4PMC A;  4B9X A;  5ISR A;  3EVQ A;  4QF4 A;  1EZ8 A;  4QMG A;  3S9W A;  1U9R A;  1JOO A;  2SNM A;  3ITP A;  3U9O A;  5J22 A;  1SNP A;  5IOD A;  5DAU A;  2F0D A;  2F3V A;  2F0F A;  1KDC A;  2EYL A;  4H7B A;  4K2L A;  4NP5 A;  5HGT A;  3R3O A;  1STG A;  1SYG A;  2RKS A;  4N9P A;  1STB A;  4K5W A;  3P1H A;  5E1F A;  4YIJ A;  5CV8 A;  3NK9 A;  1SYD A;  3NP8 A;  4RKL A;  1TR5 A;  4ZQ3 A;  5JAV A;  2PW7 A;  2PQE A;  3OWF A;  5C6A A;  5J39 A;  4IZ8 A;  4KY7 A;  2F0J A;  1IHZ A;  3MEH A;  2PW5 A;  4IAL A;  4OL7 A;  4S3S A;  1SYF A;  4DF7 A;  4ZUJ A;  4K14 A;  4LAA A;  3EJI A;  1KDB A;  5CV5 A;  3V2T A;  4KY6 A;  5I9P A;  3SHL A;  3MZ5 A;  4MIU A;  3C1F A;  4K6D A;  2F0N A;  4B9W A;  5C4H A;  5EGT A;  5IGF A;  3SR1 A;  2PYK A;  3DHQ A;  3TP5 A;  5CV4 A;  4R8N A;  4F8M A;  1STN A;  1EY9 A;  2F0M A;  2EYF A;  2M00 A;  1A2U A;  3D8G A;  3DMU A;  4I65 A;  1SND A;  4J1M A;  4N9T A;  4WOR A;  2F0Q A;  3TP6 A;  3PMF A;  1EQV A;  2EYJ A;  1EYD A;  3BDL A;  3SK6 A;  1A3T A;  1II3 A;  5IGD A;  1TQO A;  4K5X A;  4EVO A;  3HEJ A;  3RUZ A;  2SOB A;  5CGK A;  4NKL A;  4EQO A;  4E6I A;  1AEX A;  3OSO A;  5I9O A;  1EY8 A;  1F2M A;  4KJN A;  1EYA A;  1SYE A;  3SK4 A;  4NMZ A;  5CC4 A;  5IIF A;  4G57 A;  5NUC A;  5C3W A;  1NUC A;  5EKK A;  1EZ6 A;  3SXH A;  2LKV A;  1NSN S;  3SK5 A;  4ME5 A;  5C3X A;  1F2Y A;  4DGZ A;  2EYM A;  4QB4 A;  4K5V A;  2F0E A;  4IUN A;  2F0U A;  4KD4 A;  4ZUI A;  3QB3 A;  4PMB A;  2F0V A;  5IGC A;  3P75 A;  1SNC A;  5CV9 A;  3TME A;  5I6W A;  3OMG A;  5HUR A;  2OF1 A;  4KD3 A;  1F2Z A;  1ENA A; 
#chains in the Genus database with same CATH topology
 1CA5 A;  3OYY A;  1EY6 A;  1B70 B;  3BVZ A;  3LGJ A;  2I46 A;  4BBR G;  2A8V A;  4GN4 B;  2F3W A;  1SNO A;  3LWE A;  3FDT A;  2G9H D;  3HOW H;  2DUD A;  4I7Z C;  1VQB A;  2EY2 A;  2F0W A;  2A69 C;  4HMJ A;  3IL8 A;  4DFA A;  1X65 A;  2VL6 A;  5EKI A;  1YNJ D;  4A93 H;  1PV4 A;  4TRD A;  1W2B A;  2CW0 D;  1J6Q A;  1S4Z A;  3TP8 A;  5LMU L;  4Y7N H;  5I6Y A;  2NVY B;  1YIT A;  1STE A;  1EYG A;  2NUC A;  1KAA A;  4RGN A;  1TY0 A;  1EY4 A;  3M85 A;  2NVQ H;  4UY8 C;  1BCP B;  1N32 L;  4IPG A;  2R93 G;  4MZ9 A;  4YWL A;  5I4D A;  3TZU A;  2AWN A;  1DGS A;  1STY A;  2RVL A;  1H9S A;  3T16 A;  2D5D A;  2NN6 H;  5ELD A;  2JA7 B;  1U4L A;  3PUV A;  1HTP A;  1G51 A;  1VQH A;  4FXG C;  4NP5 A;  5BR8 Q;  1KNE A;  1Q8I A;  4JOI A;  1I3Q B;  1BKB A;  1QCB D;  3ND9 A;  4X3U A;  1FR3 A;  2VB3 X;  1JIC A;  3Q6S A;  5K36 G;  2WKD A;  3WOF A;  1EOV A;  3GV6 A;  4LJZ C;  1I50 B;  5DNF A;  4JI0 L;  3J7A 5;  4R1J A;  1K83 B;  4MIU A;  4QUC A;  4H44 C;  1X9N A;  5M5X H;  2PYK A;  2RHS B;  3TEH B;  2PMZ B;  3Q22 A;  4Y52 H;  3D8G A;  4CKE A;  2KUM A;  1SBB B;  2RQX A;  4R4O A;  1R4P B;  1A15 A;  5IP9 G;  4DUY Q;  4OIJ A;  1DCZ A;  3TN2 A;  4DNT B;  2EIF A;  4CDC C;  2VNU D;  1VMP A;  4CBV A;  4FVM A;  1AZQ A;  2B2W A;  3PIO 3;  3S15 H;  1B53 A;  4DAY A;  4C3J B;  3RZO H;  2NTT A;  3VYR A;  2VUM G;  3U9S A;  1IBK L;  3RZD H;  1A63 A;  4A3F B;  4LW1 A;  1PMR A;  1YEZ A;  2H5X A;  1ZYR C;  2VQF L;  1ENA A;  4GNX C;  1VQM A;  3K57 A;  5KRU A;  4LUZ A;  1CA6 A;  2JJQ A;  1KRS A;  3OMC A;  5IYD G;  2F0H A;  1XWE A;  4A3E G;  2F0O A;  3T1H Q;  5KIX A;  3GTQ H;  2ZM6 L;  3GTP H;  1TWH H;  2PQA B;  5C3E B;  1MBY A;  3CQZ H;  2OCE A;  2Z4H A;  1NBW A;  1QVG A;  2NVT H;  4F7X A;  1NCV A;  4DR6 Q;  3S2D B;  2AMC B;  1M90 C;  1WD0 A;  1VQA A;  4DV3 L;  1KLG D;  2VW9 A;  4JI6 Q;  2JQO A;  3DM1 A;  3GO5 A;  4KY5 A;  5TSS A;  3TRZ A;  3H0G G;  2OTJ A;  1TWA H;  1SRU A;  4XDX A;  5A2Q L;  1EYC A;  3BS1 A;  3CAM A;  4V19 0;  3PF4 A;  2C9O A;  1MJE A;  3GTK H;  2D62 A;  2FJ2 A;  1VQ6 A;  1NR4 A;  3UDG A;  1J9O A;  3H91 A;  2KED A;  1OTC A;  3BVM A;  1C4Q A;  1X3P A;  4FP5 D;  2UUC Q;  1PH5 A;  5ISR A;  2VQE L;  1V8Q A;  2NTS A;  5COY A;  4Q5V A;  1HZA A;  2E2D C;  2LSS A;  4GOP B;  3ITP A;  3SEB A;  3J81 i;  3E0E A;  3FKI B;  2XWJ B;  4AH6 A;  5A35 A;  2ZJQ A;  4OX9 L;  3J80 c;  1QZH A;  2Y0S G;  4R4Q A;  4KN4 C;  1SMY D;  3WOE A;  3GTG H;  1UEB A;  2DNC A;  4KY7 A;  4A3G B;  1HNW L;  3URY A;  2BE5 C;  3KBX A;  4S3S A;  3T1Y Q;  3PO2 H;  3AYH B;  4GKK L;  4KY6 A;  1HXY D;  1PTO H;  3SHL A;  5EJW A;  2ES2 A;  5D65 A;  4LMQ D;  4BA2 I;  1WTV A;  2A6H D;  2YU9 H;  4DV1 L;  1KIX A;  3I4M H;  3RN5 A;  4I65 A;  4BA1 I;  3H3V H;  2JA8 H;  1PZK D;  4G7O C;  1G6Z A;  5IGD A;  3I4L A;  1AZP A;  4AYB B;  3OSO A;  5CYU A;  2RF4 A;  5LL6 S;  3H94 A;  3NEL A;  3ULJ A;  1VQE A;  3OTO L;  1A0I A;  4C3H G;  2DJF C;  3AB9 A;  5JVH 3;  3C2P A;  4BBS G;  1SJE D;  3TZD A;  4AQY L;  1VQ5 A;  4LF4 L;  4DR4 Q;  5JJL A;  1ET9 A;  3P75 A;  4PZ8 A;  3OMG A;  1IW7 D;  1Q86 C;  3MFY A;  3K8A A;  1VQP A;  1PYS B;  1STA A;  2Z6K A;  5IP7 H;  1CHQ D;  4B3T Q;  4A76 A;  4BY1 B;  1TWC H;  2XWB B;  4BS9 A;  4DV5 Q;  2PZT A;  3UE0 A;  3HOZ B;  2IHF A;  2F0P A;  2L1B A;  4C3I G;  1EIH A;  2JA5 B;  5CV7 A;  3ND8 A;  3JAM L;  2KA7 A;  2K33 A;  4QCL A;  5M3M B;  4WRD A;  4RHS A;  1UEA B;  1A3U A;  1VF5 C;  1U5K A;  1FVI A;  4NPS A;  3OPO A;  2P5Z X;  3FVQ A;  3OHX C;  4JI8 L;  2KCM A;  1FNU A;  5CBA E;  4DR5 Q;  2HD3 A;  2XNA C;  1G2T A;  5C0X G;  1K0S A;  2ZJR A;  2QCP X;  2O2L D;  4LFB Q;  4IPC A;  3AU7 A;  1GM5 A;  3BYT B;  2ENB A;  3D4D A;  1GVP A;  3I56 A;  3E9H A;  1S40 A;  1E2V A;  2R3Z A;  3VR3 A;  1KRT A;  1HFN A;  5IYC H;  2F1M A;  2XTI A;  5IYB H;  1U9R A;  5AJ3 L;  3S14 H;  3PV0 A;  1HH2 P;  1TXY A;  2X6L A;  5ELE A;  1EEF D;  2EYL A;  1KDC A;  4A3D B;  3I7F A;  1SFO H;  1ML0 D;  4JC0 A;  4N9P A;  5E1F A;  1H9M A;  2CHB D;  3KUP A;  4LFC L;  4UP7 A;  2PNR C;  4LUO A;  4V0B A;  3HOW G;  1B3Q A;  4IUV A;  4ZAI A;  3RD4 A;  4IAL A;  4P75 A;  4ZUJ A;  4B3M Q;  1CK1 A;  3H15 A;  2BDO A;  3GTO B;  3CP0 A;  4A3B H;  1DOK A;  4A93 G;  2F0N A;  3H09 A;  1I4P A;  3HFZ B;  2BDN A;  5EGT A;  1PXU A;  1Q1B A;  5IGF A;  2N3S A;  2UUA L;  1XNR L;  3A8J E;  2V4D A;  1R4Q B;  1XXG A;  4BBR H;  1A2U A;  3CPW A;  4K5X A;  4JI2 L;  1UAP A;  3PGZ A;  2NB0 A;  5IIF A;  2L9H A;  3N52 A;  5NUC A;  1DM0 B;  5FO7 B;  3SK5 A;  1VQC A;  4X66 L;  3U58 A;  1YJN A;  1PHJ A;  1RF2 D;  3M3Y B;  4IJH A;  1F2Z A;  3QR8 A;  4LF9 Q;  3TQY A;  2NN6 G;  2H4O A;  1SXT A;  4OGQ C;  3S15 B;  1L2F A;  4R4C A;  1MD2 D;  1E2Z A;  4QIW E;  3RZO B;  1GUS A;  1TWF H;  4LF5 L;  3HZX A;  1Q46 A;  4CJ2 C;  1WOC A;  3C46 A;  5K5P A;  2R93 H;  3E5S A;  2Z9H A;  5DEH A;  2E5L Q;  4IO9 A;  2MPM A;  1PA6 A;  2XSC A;  3GTQ B;  2K6A A;  3GTP B;  2F3I A;  3L9A X;  1WTW A;  2PQA A;  1ROD A;  3D4W A;  4BY7 H;  1ILP A;  3HGB A;  2RBM A;  1NE3 A;  5EBD A;  4OHJ A;  5LMN W;  1GUO A;  1QNK A;  2IT1 A;  1CKO A;  4ZYS A;  3KLS X;  1D1I A;  2Q2H A;  1O7Z A;  2EJF C;  5T1I A;  5FLX L;  1Q90 A;  3LX0 A;  4FF2 A;  1RKN A;  1NNX A;  1NTG A;  2QGQ A;  3HS0 C;  3GTL B;  4IJL A;  4PMC A;  1L0X B;  1Z47 A;  1EWI A;  3GTK B;  2ZJP A;  3S9W A;  1PH1 A;  4DV6 Q;  3KBG A;  4NB3 A;  4YY3 L;  1TII D;  1VQF A;  4HCE A;  3VR2 A;  5IP9 H;  1I6V C;  1HCZ A;  2AUK A;  3AEV A;  2A68 C;  2E2J H;  2PW7 A;  2PQE A;  1XMQ Q;  1NMG A;  4RWS C;  2QDL A;  5IWA Q;  1XPR A;  2CQO A;  4GOP A;  1RTN A;  1U4M A;  5M5W B;  2JA6 B;  4DF7 A;  2NVX H;  4PMW A;  5C4J H;  1WTO A;  5C44 H;  3MWY W;  3IAY A;  5E4W C;  3GTG B;  3SR1 A;  5FKA C;  1YVC A;  1EY9 A;  2I5L X;  2MGS A;  4J1M A;  3PO2 B;  4DR2 Q;  1OO9 B;  4P74 A;  1PTO B;  3BDL A;  1CKN B;  1II3 A;  3J81 c;  2YTX A;  2R7Z G;  1AE2 A;  2CWA A;  4DK0 A;  4IFD J;  4JI1 Q;  1EYA A;  1TKW B;  1XYI A;  2EXD A;  3M7G A;  3NQI A;  3I4M B;  5D3D A;  1EZ6 A;  1VF7 A;  1OXS C;  2KHJ A;  3K5L A;  2LKV A;  3S1M B;  3E3X A;  4QB4 A;  1E22 A;  3STB D;  3QB3 A;  4PZ6 A;  3G6J B;  1QB5 D;  2B2Y A;  2UXC Q;  1PFM A;  5DM7 3;  4HID A;  1F9Q A;  5T1G A;  3HOX B;  1PRT C;  1E0B A;  4N8X 1;  1B1Z A;  2I5M X;  2X69 A;  1KTK A;  1K0R A;  1I6H B;  1JR0 D;  2N49 A;  4IQZ A;  1A3V A;  1MI2 A;  4IN3 A;  2NZ1 D;  5KND A;  1EIY B;  4IUQ A;  2IX3 A;  4NDX A;  2DNE A;  3F2U A;  1TWC B;  1GUT A;  5GAG C;  4BWG B;  3DUZ A;  4L8J A;  1OXX K;  5BR8 L;  1K8G A;  1KAB A;  1C0A A;  3CMA A;  4CDD C;  2K5V A;  2QW7 A;  4IPD A;  1BDO A;  3VDY A;  2K4K A;  1KXL A;  3S1N H;  1VQK A;  4B08 A;  5CR3 A;  5J3B A;  4HED A;  3F2D A;  1BCP D;  1YNJ C;  3WDN A;  2JA8 G;  1HNZ Q;  3KYH C;  5ELB A;  2OEO A;  2KHI A;  1WTX A;  2CW0 C;  2N88 A;  3ULL A;  3AFQ A;  1BCP F;  1TS3 A;  1EFW A;  1LLR D;  1GO3 E;  4A3M G;  4XQJ A;  2F52 A;  3ZYY X;  4A3K G;  4FNF A;  3I4N B;  4ZRZ A;  5BN3 A;  4A3I H;  4DUY L;  4JI3 Q;  2IY5 B;  4K2L A;  4L63 B;  1PH4 A;  3J7A V;  1FNW A;  1YJ9 A;  3W2D A;  3A8K E;  2R92 H;  1WJJ A;  1B2T A;  1QIL A;  4X62 Q;  2A6E D;  2EOT A;  1BF4 A;  1N33 L;  1SE2 A;  1HZ9 A;  5ELO A;  4C3H H;  5IT9 L;  4BBS H;  2I5H A;  4WJW A;  3EJI A;  4JCV E;  4POG A;  1VDZ A;  1WCM B;  1Y1V B;  3MZ5 A;  4XTC S;  1D1K A;  1HZB A;  1HNX L;  1GUN A;  2AQ2 B;  1EEI D;  3TBI B;  3HKZ G;  3T56 B;  3M7N A;  3T1H L;  1TU2 B;  2I0Q A;  1B7Y B;  1SND A;  4YWK A;  2MO1 A;  1XNQ Q;  2NZO A;  1A8V A;  1PFN A;  2E74 C;  1C9O A;  4A3B B;  1HA6 A;  4EQO A;  4E6I A;  4DK6 C;  1TS4 A;  3CCJ A;  1SYE A;  4DR6 L;  2QEX A;  3V05 A;  4BBR B;  1VQG A;  1E1T A;  1F2Y A;  2L11 A;  3CCM A;  1E24 A;  5A2Q E;  3SE0 A;  3S1R H;  4JI6 L;  4KHP Q;  2B29 A;  2N55 A;  4LF6 Q;  4M8A A;  4LK1 C;  5IYC G;  3U50 C;  2EY1 A;  5L37 A;  1WTQ A;  2JK8 A;  2GA4 B;  4JBK A;  5C4X G;  3CPF A;  2UUC L;  4RAU C;  1GUG A;  4U68 A;  2MJ8 A;  3CCU A;  1DOL A;  4R9W A;  3VR5 A;  1K8A C;  2NBF A;  1NJI C;  3GQB A;  2R93 B;  4KI0 A;  3RNU A;  4X6A H;  1EQT A;  2B2V C;  5CV6 A;  4JBW A;  2PPB C;  4HJ9 A;  3ERQ A;  1KHI A;  2KQ3 A;  1EU4 A;  1SNQ A;  3T1Y L;  1JJG A;  2K5W A;  1EOT A;  3I8Z A;  2NYZ D;  4PNY A;  1IZ6 A;  5EPK A;  2OQ0 A;  1SYB A;  3I73 A;  4C1N K;  2E2H B;  1HRJ A;  3DEO A;  3M4Q A;  4HN7 A;  4DV0 Q;  2FFK B;  4FO2 A;  1LO5 D;  4OWW B;  2SNM A;  1RL2 A;  2HIV A;  3NEM A;  5LL6 X;  3S2H H;  3R3O A;  4JBM A;  3L7Z C;  4X3K A;  4ME3 A;  3S16 H;  4DR4 L;  1K28 A;  3SVM A;  1M1K C;  2VS1 A;  4K0K Q;  3HOU G;  3OIP A;  1XPU A;  5CV5 A;  4X3T A;  3GTM B;  1IYV A;  3JAM E;  1F9R A;  1ONL A;  4DV5 L;  2XRS D;  3T51 B;  1R9T H;  1SMY C;  3A0J A;  5KNC A;  4F8M A;  1IKM A;  4O2D A;  3HOY H;  1SJH D;  2VUM B;  3S24 A;  2HCC A;  2ZXO A;  4ZLT F;  4RA8 A;  2NVX B;  2Z1C A;  2PNH A;  2EYJ A;  1Y1W G;  4BY7 G;  1LTT D;  3KJP A;  3MA2 B;  2CVR A;  1FYC A;  3M9B A;  2A6H C;  2RCF A;  4DV2 Q;  2F4V Q;  1FL0 A;  4GKJ Q;  4A3J G;  4MTN A;  1GUW A;  4LWC A;  4A3E B;  3TSS A;  5CV9 A;  4DR5 L;  4OO1 H;  1CKN A;  5C0X I;  3ICE A;  2LMC B;  2MQH A;  5AFW A;  3V96 A;  1N34 Q;  5C5M A;  3A55 A;  4JBJ A;  4RFB A;  5COR A;  2ASB A;  1CHP D;  1EQR A;  4I7A A;  1JOQ A;  1KDA A;  1V1P B;  1F77 A;  3ERO A;  4EGV A;  1ASY A;  4RKB A;  1TS2 A;  2F0K A;  1IW7 C;  3ONA B;  3TS2 A;  1ILQ A;  3VYS A;  4A3L H;  2K1B A;  3H0G B;  4NXM Q;  3QG1 A;  1JB3 A;  4TVA B;  1IXR A;  4PG3 A;  1UUP A;  5D14 A;  3OW7 A;  2QF7 A;  5C44 G;  4TKO B;  3W1G A;  1CZG A;  3D31 A;  1J5E Q;  1AN8 A;  2AKW B;  1CI3 M;  1MSH A;  3H6M A;  4B3M L;  1Y8O B;  1VS0 A;  1TWG B;  2WAC A;  5IE8 A;  4IUT A;  5I2Y A;  5M9O A;  4DR3 Q;  2Y0S B;  1PVO A;  2HHH Q;  4ID6 A;  4DR7 Q;  2OWO A;  2WP8 J;  3VR6 A;  1H9R A;  3CME A;  2ZT9 C;  4JOI C;  4QF4 A;  4NXN Q;  1YNN D;  1O78 A;  4JW0 A;  1S72 A;  2PMZ E;  3PIP A;  3I55 A;  2EVB A;  4P73 A;  2R7Z H;  1WYD A;  4YIJ A;  4RKL A;  4B3S Q;  3QWN A;  3M4O H;  2YYZ A;  2PW5 A;  2NN6 I;  4LF9 L;  1ENF A;  2JP1 A;  1EWC A;  1W6K A;  1B9M A;  3R2I A;  4HR7 B;  1YIJ A;  2FMM A;  1BR9 A;  3K5N A;  1D5Z C;  3A56 A;  1Z7T A;  3DHQ A;  4JPB W;  4C3H B;  3F2C A;  1MIU A;  4BBS B;  1ASZ A;  1HZC A;  2B2W C;  4IOA A;  3G4S A;  1A3T A;  2E2I H;  3RUZ A;  3PUZ A;  1SE4 A;  2LXK A;  5JVG 3;  1VQ4 A;  1SE3 A;  2E5L L;  4P71 A;  4IUP A;  1ESR A;  5C3X A;  2YTY A;  3NE5 B;  3X3M A;  5BN5 A;  3KLR A;  4QL5 A;  3GTJ B;  4C3I B;  4OEL B;  5I6W A;  1HR0 Q;  4R4I A;  1QJO A;  1K8M A;  1T5X D;  5FLX E;  5J1Z A;  1XMO Q;  4A3I G;  3D6C A;  3A5Z B;  4K8J A;  1KNA A;  5JJI A;  2B2U A;  3BZK A;  3FRP B;  3SK8 A;  2R92 G;  3RLN A;  3K7A B;  5ELN A;  4RCO A;  1V9P A;  4YCU A;  3MXN B;  5BN4 A;  3NHH A;  3BJU A;  4M1U B;  2WV6 D;  4DV6 L;  4A3M H;  4A3K H;  2B63 H;  3CCQ A;  2X6G A;  4X65 Q;  4RHR A;  3MXP A;  3S17 B;  1LT3 D;  4XYO A;  3N6R A;  3AMU A;  4DU9 A;  3IKJ A;  1JOK A;  1D5M C;  5IWA L;  1FD7 D;  2F0S A;  5IGE A;  3EA6 A;  2KHS A;  5EKL A;  1A2T A;  4DN4 M;  3DM3 A;  5M3F G;  2K14 A;  4CDE C;  1LAB A;  2I07 B;  4QY7 A;  5FJ8 H;  2HT1 A;  1X3E A;  2EY6 A;  4GLV B;  3E6Z X;  4XT3 B;  3DLL A;  3K0Y A;  4AIM A;  2G5D A;  4IPH A;  1HUM A;  1TY2 A;  3MVV A;  1C7Y A;  2IWH A;  4DR2 L;  5E7N A;  2DGY A;  1S5D D;  3EFX D;  3HOW B;  1VQO A;  2JN4 A;  1HPC A;  2F3V A;  4JI1 L;  1JJC B;  5M5Y H;  5LHY 1;  3BZD B;  3UDX A;  4A93 B;  1SYG A;  1QG7 A;  4IOC A;  1SR3 A;  2K04 A;  3NP8 A;  3CC7 A;  2UXC L;  3OWF A;  3FP9 A;  4IUU A;  2K52 A;  4Y7N B;  2CCZ A;  3NTI A;  2EPB A;  2EE1 A;  2Z6B A;  4DV4 Q;  1CQF A;  1JWU D;  1MGS A;  1JJ2 A;  1AH9 A;  1VQD A;  1Q1E A;  1AP0 A;  2FIN B;  3S16 B;  1BVS A;  3KDF B;  4EX5 A;  2DY7 A;  2IX0 A;  2Q8T A;  3X3N A;  1PTO D;  2NVQ B;  1STN A;  2EYF A;  3TP6 A;  1X54 A;  1LM0 A;  1U4P A;  4KHZ A;  2MNA A;  2R7D A;  1TQO A;  3EN2 A;  3HEJ A;  5C4X H;  4DNR B;  4KJN A;  3NWT A;  3J80 L;  4G57 A;  1L1O B;  1YHQ A;  2UU9 Q;  1G2S A;  1VQL A;  3SXH A;  4JI5 Q;  3S1Q H;  3K80 C;  5ELF A;  5EAY A;  2IHE A;  1I4X A;  1D5X C;  2F0U A;  2Z6K C;  3BYY B;  2KCN A;  5JEA H;  3HOV G;  2R61 A;  3TME A;  3A8I E;  3KK7 A;  3H3V I;  2ICE C;  3VYU A;  1STH A;  1OXU A;  1HNZ L;  1V1Q A;  2MUY A;  3A7L A;  2EY5 A;  2VQF Q;  1EY5 A;  2Z4I A;  3STB C;  1S5F D;  4X64 Q;  2K5D A;  4C56 C;  5M5X B;  4HJ7 A;  3VA5 A;  2QEJ C;  4OON A;  1PFS A;  1KAW A;  1VMC A;  3EQL C;  1CT1 D;  1K8O A;  4DXF A;  3T4A C;  3T53 B;  3U4Z A;  1Q7Y C;  1JE4 A;  1K3R A;  1V1P A;  3C1E A;  1LTS D;  2ICI A;  4ZKC B;  5IT9 E;  4X62 L;  1MKH A;  4MNO A;  4HIM A;  1VQN A;  3HOY G;  1LTG D;  4OWX B;  3MEF A;  4APV A;  3RZD B;  3NQT A;  5EQ0 A;  2K75 A;  3I3C A;  2EXZ A;  2XGT A;  4L5T A;  3HOU H;  2RHQ B;  4WJ3 M;  2FHT A;  4DKA C;  1Q81 C;  3A5U A;  1C8C A;  4LF8 L;  2D0P A;  2XRQ D;  2SNS A;  5KYI A;  1BCP C;  2B8F A;  2GVA A;  2B39 A;  2KEE A;  3EVQ A;  1XNQ L;  4OO1 G;  1TWH B;  2BH2 A;  2B8G A;  1LAC A;  3CQZ B;  2PI2 A;  2IPK D;  3KLW A;  2NVT B;  2F0D A;  1WI5 A;  1Y1W H;  3TS0 A;  2TSS A;  2B2T A;  4CJ1 B;  3BDO A;  2RSN A;  1DXM A;  4KHP L;  4A3J H;  3C3L A;  4IZ8 A;  4LF6 L;  2F0J A;  3I4O A;  4GLA C;  4A3L G;  2R7Z B;  1TWA B;  4CHT B;  3R93 A;  1W6J A;  1UE7 A;  3C1F A;  4K6D A;  5GRO A;  2A6E C;  4YHH L;  1IBL Q;  3K6O A;  2RSO A;  3PIP 3;  4LUV A;  4A4I A;  2F0Q A;  3MXU A;  3TRE A;  4DAM A;  1EYD A;  4RH6 A;  2AUJ D;  4LF7 Q;  1AEX A;  2E76 C;  5I9O A;  2OQK A;  1DD2 A;  1SDF A;  4ULL A;  4GNX B;  1OXT A;  2E2I B;  3OTO Q;  1VQ8 A;  4GN3 B;  1FGB D;  2Q2U A;  3OWE B;  4LF4 Q;  4N8F A;  2HUG A;  4KN7 C;  2YTV A;  2KCC A;  3F1Z A;  3B6Y A;  2F0L A;  4ZCK A;  4DAP A;  4FXK C;  4HMI A;  2N8N A;  2HQL A;  3UI2 A;  2A19 A;  2AQ1 B;  3IFD A;  2YU9 B;  2AWO A;  1DOM A;  2JA7 H;  1XTD A;  4DV0 L;  5IOC A;  5EBC A;  1ET6 A;  3K58 A;  2LFN A;  1Q82 C;  2JA8 B;  1X3Q A;  1I3Q H;  1KD1 C;  3D4R A;  2JE6 I;  1B50 A;  1I4R A;  1JMC A;  1CTM A;  5KYL A;  4JYA Q;  3QIA A;  5IGG A;  1IL8 A;  4CJ0 B;  1I50 H;  4KTA A;  4A3M B;  3RR5 A;  4CKC A;  4UP8 A;  3MXN A;  1HR0 W;  1K83 H;  2RDG A;  4K0K L;  4A3K B;  1WTR A;  4R4T A;  1JC7 A;  3MXG A;  2JEA I;  1X3F A;  3OW2 A;  2B3G A;  1A6X A;  4K2K A;  2BCO A;  2BA1 A;  4QQB X;  1U0L A;  3R2T A;  3L2P A;  4DAV A;  3U9O A;  1HJP A;  3JAM i;  5DAU A;  5EPL A;  2F0F A;  1IKL A;  4C3J H;  3PO3 G;  4GKJ L;  4DV2 L;  1O7L A;  4UAI A;  2Q2I A;  3M4P A;  4GOP C;  2K03 A;  2JSO A;  1BBW A;  2UUB Q;  5CV8 A;  3PUW A;  3HKZ B;  3E0J A;  1QOH A;  5M5Y B;  1SYF A;  1N34 L;  5I9P A;  2CQA A;  1SE8 A;  4IFD H;  1Y8N B;  1AW7 A;  2CH4 W;  1GHJ A;  5C3E H;  3ERS X;  1IYU A;  1T5E A;  2B63 G;  4MN3 A;  1QUQ B;  4FDB A;  2K7V A;  4WFN 3;  4G7H C;  3VR4 A;  1K9M C;  4NXM L;  1B3A A;  3VYT A;  5JJK A;  2B2Y C;  1XPO A;  3KDF A;  1PH7 A;  3S14 B;  4JI2 Q;  4C2M H;  4KKS A;  2RDH A;  5FJ8 G;  4F88 A;  5C0X J;  3SDZ A;  1SFO B;  1CSP A;  3J7A F;  1LTR D;  2WB1 E;  5C4X B;  2L5T A;  2HDL A;  3KOJ A;  1F2L A;  5CBE E;  4DNI A;  4QUF A;  1NR2 A;  3CCV A;  1L1O A;  1CM9 A;  4TQU S;  4L5R C;  3D3R A;  2QIL A;  2WB1 G;  2D0O A;  4IUR A;  5M3F H;  3MC0 B;  3IRB A;  1HHV A;  2M2L A;  3DWA A;  2HHH L;  3J81 L;  5I2X A;  4LF5 Q;  4DR7 L;  1TT2 A;  1JQY D;  4G4K A;  3FKI H;  4NXN L;  3PSI A;  2PCF B;  3GDE A;  5E3F A;  1YJW A;  3CKI B;  4A3G H;  4JI4 Q;  4B3S L;  1LYL A;  2KCT A;  4RGM A;  1EIF A;  3NTH A;  1A62 A;  2JYO A;  2KEN A;  2UXB Q;  1HUN A;  2F0I A;  4ABN A;  2O4X A;  1YNX A;  1JWM D;  1TWF B;  1QVC A;  2Z8L A;  1ZEQ X;  1GHK A;  5JEA G;  4CDF C;  4DV7 Q;  3P7J A;  2HCI A;  3Q23 A;  4HSP A;  3HOU B;  5IOD A;  4H0L C;  5FO8 B;  4OEM B;  2F4I A;  1EUJ A;  3E9I A;  1SN8 A;  1LT6 D;  4PQX A;  4YY3 Q;  3AQQ A;  1VQ9 A;  3NSW A;  4UP9 A;  1RHP A;  3KJO A;  1YNN C;  1HR0 L;  2MFI A;  1O7Y A;  1HQM C;  4OL7 A;  1Y1W B;  1DJR D;  4BY7 B;  4BY1 H;  3V2T A;  3HOV H;  1XMO L;  1PH6 A;  3FPP A;  2V1C C;  2JA5 H;  1K73 C;  1F9S A;  1E3P A;  3RLO A;  4DUZ Q;  4A3J B;  5M3M H;  1V1O A;  3DEP A;  3PMF A;  4ILW A;  4JVZ A;  2SOB A;  3JC6 6;  2A1A A;  3I2Z A;  4DR1 Q;  3SK4 A;  2XIW A;  3LNN A;  3HRZ C;  4X65 L;  1TS5 A;  1PH8 A;  1VQI A;  2IJ0 A;  1J8I A;  4PMB A;  3KF8 B;  4X3S A;  2A74 C;  1GOZ A;  5GQO A;  2OF1 A;  4KD3 A;  2DY8 A;  2G9D A;  2WAQ E;  4B3T L;  2E2J B;  2AQ3 B;  3QOJ A;  2K5Q A;  1BUV T;  2CWP A;  1I4G A;  1YHA A;  1D7Q A;  2CH4 A;  4JK1 C;  5GAE C;  4GNX A;  1BOS A;  3KF6 B;  2N78 A;  3K0X A;  5C4J B;  2WAQ G;  5C44 B;  4KV6 A;  1CFM A;  5C4Z A;  3PUY A;  4A3D H;  3F8T A;  1QZG A;  4EQP A;  1D8L A;  2SEB D;  4BXX H;  3HKS A;  4UHV A;  1Z9F A;  2RDF A;  4LFB L;  1MJC A;  1YHB A;  3GTO H;  1NY4 A;  1N8R C;  3VA7 A;  4DV4 L;  4JI7 Q;  1E2W A;  1PYW D;  2PZW A;  4OXP A;  2QA4 A;  3FEW X;  1N9W A;  1RJT A;  1TVX A;  4JG2 A;  4OWT B;  3SGI A;  4DK1 A;  4U67 3;  4JV5 Q;  4HTH A;  4ZKB B;  3UDI A;  3J80 E;  3BVG A;  1SAP A;  2ZXP A;  5FLM G;  3W3A A;  2Q2T A;  4H7B A;  2HDM A;  2UU9 L;  2ALY B;  4JI5 L;  4K5W A;  3M3Y H;  1Z6H A;  3K5M A;  5J39 A;  1BO0 A;  4Z9C B;  1FJG Q;  3S1N B;  2JA7 G;  2EQS A;  1WTH A;  1N33 Q;  1ZXT A;  2FMC A;  5IY0 A;  1WD1 A;  3MFG A;  5LMN Q;  4B3R Q;  5CV4 A;  5JPN C;  1YZ6 A;  4X64 L;  2L12 A;  1HNX Q;  4ALP A;  1EQV A;  3JAM c;  3OOC A;  3D6W A;  4EVO A;  4O0A A;  5CC4 A;  4O42 A;  4A3I B;  5C3W A;  1PTO C;  5EKK A;  1IBM Q;  4XIG S;  2NWG A;  4DGZ A;  2K50 A;  1PRT B;  4GN5 A;  4IUN A;  1QUQ A;  1QVF A;  2F0V A;  5IGC A;  2R92 B;  1SRO A;  3H3V C;  2TMP A;  3G71 A;  4C2M B;  3ER0 A;  2A69 D;  3LWU A;  2J0T D;  4KHV A;  1EY0 A;  4C3J G;  3NUC A;  1B44 D;  3GTL H;  4L5Q A;  1N36 Q;  2KOL A;  4LFA Q;  4A3F G;  2PI2 E;  3DWQ A;  3NBH B;  4J15 A;  4OO1 I;  1C48 A;  4HIO A;  5CMD A;  4XT1 B;  4K6L A;  1BXT A;  2Y0S E;  5M3F B;  1GXD C;  4ODG A;  3BDC A;  2EDG A;  3RMH A;  3KLS A;  4IFD G;  1U4R A;  1I94 Q;  2UXD Q;  4KK7 A;  5C3E G;  2O5I C;  2EJM A;  4PV1 C;  3PO3 H;  2WII B;  5ELC A;  1JB7 A;  5IGB A;  3FMC A;  5M5W H;  2JA6 H;  2VXW A;  3S1R B;  3BG3 A;  1EIG A;  2EYO A;  2EYP A;  4WJ4 A;  1SYC A;  4R8I A;  1QNU A;  3OIQ A;  1JT8 A;  3FHW A;  1WFQ A;  1IBL L;  1L0W A;  5F2D A;  2E75 C;  4HJA A;  2LY7 A;  2VB2 X;  4QMG A;  4P72 A;  1Y14 B;  2FXQ A;  4LF7 L;  2IW3 A;  3S1M H;  1XJV A;  1XMQ L;  5LMU Q;  2J4X A;  1BBU A;  4ZQ3 A;  5EPJ A;  3NK9 A;  1SYD A;  3HOX H;  1Y69 U;  3A54 A;  1L0Y B;  1DYQ A;  5C6A A;  1RIP A;  3CD6 A;  1UE1 A;  4XQQ A;  1CZW A;  1NAP A;  1CSQ A;  1JE5 A;  3QO2 A;  1Y8P B;  3FKI G;  5DLQ E;  1KLU D;  1I6H H;  1ZKO A;  1N32 Q;  3Q0A A;  4GS3 A;  1WTP A;  4KKT A;  2F03 A;  3AFP A;  2K5H A;  4N9T A;  5CGK A;  3ULP A;  4A3G G;  4FF3 A;  3HOV B;  3IFT A;  5JEA J;  3FPU B;  3U4V A;  3BU2 A;  3KFU A;  3MAQ A;  1RDP D;  1ZYR D;  2WFW A;  1EY8 A;  3K7U C;  4AYB E;  2BA0 A;  1RTO A;  4FF4 A;  4YCV A;  2L4N A;  4KD4 A;  4JYA L;  3S2H B;  2EZV A;  1SNC A;  3K59 A;  5HUR A;  1UNS A;  4L6T B;  2IL8 A;  4AYB G;  4JI0 Q;  2B2U C;  4J6H A;  2M9V A;  3J81 j;  4LNQ A;  5C5L A;  1UE6 A;  3CC4 A;  3I4N H;  3KF8 A;  5FLX c;  2XVS A;  4FYD A;  1PTO F;  1R9T B;  5G3L D;  2F0G A;  1FNV A;  3HOY B;  1I4Q A;  3CHB D;  5JOB A;  1X6O A;  1ICF B;  2K28 A;  2ZTD A;  1LTL A;  1D2B A;  4BY1 G;  4TSS A;  3T13 A;  1X32 A;  1LT5 D;  3HOZ G;  3KF6 A;  5G3L F;  2JA5 G;  1IBK Q;  2UUB L;  1ENC A;  4QIW B;  5M3M G;  1PZJ D;  3CCS A;  1CQV A;  1WCM H;  1Y1V H;  2O5J C;  1QWY A;  2H1E A;  2L55 A;  5HGQ A;  3A74 A;  4H02 A;  2VZA A;  3L0O A;  1LTI D;  2NZH A;  4DA2 A;  3O13 A;  4GZY C;  1PH2 A;  3A7A B;  4A3C H;  3MHB A;  2JEB I;  5JPM C;  2ZM6 Q;  4YWM A;  1JOR A;  4JI3 L;  3DXJ C;  2KVM A;  1EZ8 A;  3NWS A;  3MTS A;  2BE5 D;  1S5B D;  5KNB A;  2K01 A;  1HFG A;  4DV3 Q;  4XXE A;  1EQQ A;  1S3O A;  3PF5 A;  1SSO A;  1HQR D;  1NMF A;  2WKC A;  3G48 A;  1X55 A;  3ZJY C;  2HIX A;  2RCN A;  4HSV A;  3MEH A;  1GJX A;  2DN8 A;  1LV9 A;  3P20 A;  1JCK B;  4Q0F A;  1PH3 A;  4A3D G;  1I5F A;  1RD9 D;  4B9W A;  3J81 E;  1LT4 D;  1KC8 C;  4BXX G;  4R8N A;  4HJ8 A;  3L3O C;  4HJ5 A;  5GAD C;  1MHW C;  2VQE Q;  3SK6 A;  1MSG A;  1PDQ A;  3PCO B;  4KLK A;  4NKL A;  1EU3 A;  1F2M A;  1B8A A;  1P16 A;  3WWV A;  4O1N A;  1PLF A;  3NEN A;  1XTC D;  2R7F A;  4OX9 Q;  1NSN S;  2F0E A;  1JWS D;  4JI4 L;  3GP7 A;  1LTA D;  1HNW Q;  1W3S A;  3G6E A;  4GKK Q;  3M4O B;  3HP3 A;  4QJF A;  1KL9 A;  2A73 B;  4J8Q A;  2UXB L;  2E2H H;  3PQI A;  4CKB A;  3M4Y A;  2D9U A;  2ZXR A;  4DV1 Q;  1HTL D;  4NW2 A;  5FO9 B;  2WIN B;  5K36 H;  3G7L A;  1BBX C;  4RMF A;  5KGU A;  2ID0 A;  2KBN A;  2C35 B;  2L0C A;  4KMU C;  4HCS A;  1WVL A;  4DV7 L;  2NVY H;  4MTK A;  4PZ7 A;  1VQJ A;  1SMX A;  2GVB A;  1T9H A;  2HQE A;  4OIK A;  3CRL C;  4RG1 A;  3CCE A;  2BOS A;  1E7Z A;  1P8L A;  2DJG C;  3J7Z C;  2PZU A;  5FLM H;  4AQY Q;  3UE1 A;  3D0F A;  2EYH A;  1BNZ A;  1X56 A;  2QDB A;  3NBH A;  1EL0 A;  1H9S B;  2JXM B;  3GTM H;  2F0T A;  2IX1 A;  2AHO B;  1SLJ A;  1SNM A;  4QGU A;  3TDQ A;  1XX8 A;  1G6P A;  5KEE A;  4K8I A;  5IT9 c;  3F2B A;  4HIK A;  1PFB A;  1UE5 A;  1BQQ T;  1O80 A;  2CFM A;  3Q8D A;  3PO3 B;  2VUM H;  1EFI D;  4EQN A;  5D3I B;  4DUZ L;  2KJX A;  1Q12 A;  1H95 A;  4YCW A;  1PZI D;  1G8Z D;  1E1O A;  3NBI A;  5DM6 3;  3NXW A;  4B9X A;  1SEB D;  1OXV A;  2B2T C;  2E8G A;  1D6E C;  1JOO A;  1PYB A;  4RCN A;  1SNP A;  1M8A A;  2K5N A;  4DR1 L;  5IYD H;  3GD7 A;  3RN2 A;  5HGT A;  4A3E H;  3EIV A;  5GAH C;  1V43 A;  3BZC A;  1M4V A;  1EWH A;  2Q8I B;  3P1H A;  4JI8 Q;  2Z0S A;  4F87 A;  2ATW A;  2B63 B;  1IYJ B;  5JAV A;  5FOB B;  1PH9 A;  2MHV A;  1IHZ A;  3PUX A;  3PIO A;  1S5C D;  4MHE A;  4K14 A;  1KDB A;  3HG9 A;  1LUZ A;  1LTB D;  1B4O A;  4DAY B;  2CKZ B;  2A5H A;  2F0M A;  3H0G H;  3J7Y W;  5FK9 C;  1Q3L A;  2F4V L;  2JA6 G;  2K05 A;  3CF5 A;  5AJ3 Q;  3I72 A;  4A3F H;  1CUK A;  2XN9 C;  5E4X A;  4UPA A;  4NMZ A;  1NUC A;  5H1S E;  1YBY A;  2EYM A;  4K5V A;  2WB1 B;  5JJZ A;  3PO2 G;  4LFC Q;  4POF A;  3I91 A;  3W5O A;  4RGO S;  3NTK A;  3W1B A;  1X3G A;  2D2C C;  1TWG H;  3CC2 A;  1AE3 A;  3I90 A;  4JI7 L;  3I4M G;  3R8B A;  2JA9 A;  2OXP A;  2K32 A;  2UUA Q;  1XNR Q;  2ZTC A;  3S2D H;  2OT2 A;  4JV5 L;  2VY3 A;  4FF1 A;  4G7Z C;  3HOX G;  2LXJ A;  1G29 1;  3EBE A;  1F9P A;  1H9J A;  4GLX A;  3Q24 A;  4DPG A;  2LS0 1;  4X66 Q;  1J5E L;  1UWV A;  3J80 i;  3K81 C;  5IP7 G;  3S1Q B;  2QKI C;  1DZ1 A;  4CGY B;  4L5S A;  1FJG L;  5HY6 A;  1AFP A;  4H13 C;  1VQ7 A;  2YV5 A;  1ICW A;  2B2V A;  1EY7 A;  3HKZ E;  4DR3 L;  3QOL A;  1K3B C;  4KJO A;  2ZTE A;  2PO4 A;  4ZK9 B;  2MO0 A;  3CCL A;  5LMN L;  1O7I A;  4B3R L;  1DON A;  3CXC A;  3TP7 A;  4UDU C;  3RLF A;  2OTL A;  2A68 D;  1GKH A;  4LF8 Q;  1I4H A;  3NPP A;  5J22 A;  1HA5 A;  4DK3 C;  1VCI A;  2EJG C;  3GTJ H;  4C3I H;  1STG A;  2RKS A;  1IBM L;  1STB A;  1QE6 A;  4A75 A;  2BH8 A;  4HAE A;  1TR5 A;  3I4N G;  1ESF A;  1IL2 A;  1Q8K A;  4C1N I;  3CCR A;  1H9K A;  4LAA A;  3CRK C;  2J7Z A;  3UDF A;  4EQ5 A;  1S5E D;  1B9N A;  2C5C A;  3DWP A;  5C4H A;  3K7A H;  4KKU A;  3TP5 A;  1N36 L;  4FXD A;  5IYB G;  1FGU A;  3CU7 A;  4LFA L;  2M00 A;  3DMU A;  4WOR A;  5C0X H;  4YHH Q;  2L15 A;  4XQN A;  3GV3 A;  3QJY A;  2Q8R E;  1WCM G;  1Y1V G;  1PRT D;  4P2C B;  3I70 A;  2R6G A;  4DXG A;  3S17 H;  1GD7 A;  2GN5 A;  1RCV D;  1YI2 A;  4IFD I;  1KQS A;  4ME5 A;  4RGT A;  3K5O A;  1I94 L;  2UXD L;  4A3C G;  4ZUI A;  1CKM A;  2KEC A;  1L1O C;  3CW2 C;  2WAQ B;  2RA4 A;  4XYQ A;  1PRT F;  3HOZ H;  4A3B G;  2SDF A;  1G91 A;  2MP1 A; 
#chains in the Genus database with same CATH homology
 1CA5 A;  1EY6 A;  3BVZ A;  2I46 A;  2F3W A;  1SNO A;  3LWE A;  3FDT A;  2G9H D;  4I7Z C;  2EY2 A;  2F0W A;  2A69 C;  4HMJ A;  3IL8 A;  4DFA A;  5EKI A;  1YNJ D;  4TRD A;  2CW0 D;  1S4Z A;  3TP8 A;  5I6Y A;  2NVY B;  1STE A;  2NUC A;  1KAA A;  4RGN A;  1TY0 A;  1EY4 A;  3M85 A;  1BCP B;  5I4D A;  3TZU A;  2AWN A;  1STY A;  2RVL A;  1H9S A;  3T16 A;  2D5D A;  2NN6 H;  5ELD A;  2JA7 B;  1U4L A;  3PUV A;  1HTP A;  4FXG C;  4NP5 A;  1KNE A;  1Q8I A;  1I3Q B;  1QCB D;  3ND9 A;  4X3U A;  1FR3 A;  2VB3 X;  1JIC A;  3Q6S A;  5K36 G;  2WKD A;  3WOF A;  3GV6 A;  4LJZ C;  1I50 B;  5DNF A;  1K83 B;  4MIU A;  4QUC A;  4H44 C;  2PYK A;  2PMZ B;  3Q22 A;  3D8G A;  4CKE A;  2KUM A;  1SBB B;  2RQX A;  1R4P B;  1A15 A;  4OIJ A;  1DCZ A;  3TN2 A;  4DNT B;  2VNU D;  1VMP A;  4CBV A;  4FVM A;  1AZQ A;  2B2W A;  3PIO 3;  1B53 A;  4DAY A;  4C3J B;  2NTT A;  3VYR A;  3U9S A;  4A3F B;  1PMR A;  1ZYR C;  1ENA A;  3K57 A;  5KRU A;  1CA6 A;  3OMC A;  2F0H A;  1XWE A;  2F0O A;  5KIX A;  5C3E B;  1MBY A;  2Z4H A;  4F7X A;  1NCV A;  3S2D B;  1WD0 A;  1KLG D;  3DM1 A;  3GO5 A;  4KY5 A;  5TSS A;  5A2Q L;  4XDX A;  1EYC A;  3BS1 A;  4V19 0;  2C9O A;  2D62 A;  2FJ2 A;  1NR4 A;  1J9O A;  3H91 A;  2KED A;  3BVM A;  1C4Q A;  1X3P A;  4FP5 D;  5ISR A;  1V8Q A;  2NTS A;  5COY A;  4Q5V A;  2E2D C;  3ITP A;  3SEB A;  3FKI B;  2XWJ B;  5A35 A;  4KN4 C;  1SMY D;  3WOE A;  2DNC A;  4KY7 A;  4A3G B;  3URY A;  2BE5 C;  3KBX A;  4S3S A;  4KY6 A;  1HXY D;  1PTO H;  3SHL A;  5EJW A;  5D65 A;  4LMQ D;  4BA2 I;  1WTV A;  2A6H D;  4I65 A;  4BA1 I;  1PZK D;  4G7O C;  1G6Z A;  5IGD A;  3I4L A;  1AZP A;  4AYB B;  3OSO A;  5CYU A;  5LL6 S;  3H94 A;  4C3H G;  3AB9 A;  5JVH 3;  3C2P A;  1SJE D;  3TZD A;  1ET9 A;  3P75 A;  3OMG A;  1IW7 D;  3MFY A;  1STA A;  1CHQ D;  4BY1 B;  2XWB B;  4BS9 A;  2PZT A;  1EIH A;  3HOZ B;  2F0P A;  2L1B A;  4C3I G;  2JA5 B;  5CV7 A;  3ND8 A;  3JAM L;  2KA7 A;  2K33 A;  4QCL A;  5M3M B;  4WRD A;  4RHS A;  1UEA B;  1A3U A;  1VF5 C;  3OPO A;  3FVQ A;  3OHX C;  1FNU A;  5CBA E;  2XNA C;  1G2T A;  5C0X G;  2QCP X;  2O2L D;  3AU7 A;  3BYT B;  2ENB A;  3D4D A;  1E2V A;  2R3Z A;  3VR3 A;  1HFN A;  2F1M A;  1U9R A;  3PV0 A;  5ELE A;  2X6L A;  1EEF D;  2EYL A;  1KDC A;  4A3D B;  1ML0 D;  4N9P A;  5E1F A;  1H9M A;  2CHB D;  3KUP A;  2PNR C;  4V0B A;  3RD4 A;  4IUV A;  4ZAI A;  4IAL A;  4ZUJ A;  1CK1 A;  2BDO A;  3GTO B;  1DOK A;  2F0N A;  3H09 A;  1I4P A;  2BDN A;  5EGT A;  1PXU A;  1Q1B A;  5IGF A;  3A8J E;  2V4D A;  1R4Q B;  1XXG A;  1A2U A;  4K5X A;  1UAP A;  2NB0 A;  5IIF A;  2L9H A;  3N52 A;  5NUC A;  1DM0 B;  5FO7 B;  3SK5 A;  1RF2 D;  3M3Y B;  1F2Z A;  2NN6 G;  2H4O A;  1SXT A;  4OGQ C;  3S15 B;  1MD2 D;  1E2Z A;  3RZO B;  1GUS A;  3HZX A;  4CJ2 C;  3C46 A;  5K5P A;  3E5S A;  5DEH A;  2MPM A;  2XSC A;  3GTQ B;  2K6A A;  3GTP B;  3L9A X;  1WTW A;  1ROD A;  3D4W A;  1ILP A;  3HGB A;  2RBM A;  5EBD A;  4OHJ A;  1GUO A;  1QNK A;  2IT1 A;  4ZYS A;  3KLS X;  1D1I A;  5T1I A;  1O7Z A;  2EJF C;  5FLX L;  1Q90 A;  3LX0 A;  4FF2 A;  1RKN A;  3HS0 C;  3GTL B;  4PMC A;  1L0X B;  1Z47 A;  3GTK B;  3S9W A;  3KBG A;  1TII D;  4HCE A;  3VR2 A;  1I6V C;  1HCZ A;  2AUK A;  2A68 C;  2PW7 A;  2PQE A;  4RWS C;  1RTN A;  1U4M A;  5M5W B;  2JA6 B;  4DF7 A;  4PMW A;  1WTO A;  3MWY W;  3IAY A;  5E4W C;  3GTG B;  3SR1 A;  5FKA C;  1EY9 A;  2MGS A;  4J1M A;  3PO2 B;  1OO9 B;  1PTO B;  3BDL A;  1II3 A;  4DK0 A;  4IFD J;  1EYA A;  1TKW B;  1XYI A;  3M7G A;  3NQI A;  3I4M B;  5D3D A;  1EZ6 A;  1VF7 A;  1OXS C;  3K5L A;  2LKV A;  3S1M B;  4QB4 A;  3QB3 A;  3G6J B;  1QB5 D;  2B2Y A;  1PFM A;  5DM7 3;  1F9Q A;  5T1G A;  3HOX B;  1PRT C;  1E0B A;  1B1Z A;  2X69 A;  1KTK A;  1I6H B;  1JR0 D;  4IQZ A;  1A3V A;  1MI2 A;  4IN3 A;  2NZ1 D;  5KND A;  4IUQ A;  2IX3 A;  4NDX A;  2DNE A;  3F2U A;  1TWC B;  1GUT A;  4BWG B;  3DUZ A;  4L8J A;  1OXX K;  1KAB A;  1BDO A;  4B08 A;  5CR3 A;  4HED A;  1BCP D;  1YNJ C;  3WDN A;  5ELB A;  2OEO A;  1WTX A;  2CW0 C;  2N88 A;  1BCP F;  1TS3 A;  1LLR D;  4XQJ A;  3ZYY X;  4FNF A;  3I4N B;  4ZRZ A;  5BN3 A;  4K2L A;  4L63 B;  3J7A V;  1FNW A;  3W2D A;  3A8K E;  1B2T A;  1QIL A;  2A6E D;  2EOT A;  1BF4 A;  1SE2 A;  5IT9 L;  4WJW A;  3EJI A;  1VDZ A;  1WCM B;  1Y1V B;  3MZ5 A;  4XTC S;  1D1K A;  1GUN A;  2AQ2 B;  1EEI D;  3TBI B;  3T56 B;  3M7N A;  1TU2 B;  1SND A;  1PFN A;  2E74 C;  4A3B B;  1HA6 A;  4EQO A;  4E6I A;  1TS4 A;  1SYE A;  3V05 A;  4BBR B;  1F2Y A;  2L11 A;  5A2Q E;  3SE0 A;  2N55 A;  4M8A A;  4LK1 C;  2EY1 A;  1WTQ A;  2GA4 B;  4RAU C;  1GUG A;  4U68 A;  2MJ8 A;  1DOL A;  4R9W A;  3VR5 A;  2NBF A;  3GQB A;  2R93 B;  4KI0 A;  1EQT A;  2B2V C;  5CV6 A;  4JBW A;  2PPB C;  3ERQ A;  2KQ3 A;  1EU4 A;  1SNQ A;  2K5W A;  1EOT A;  3I8Z A;  2NYZ D;  4PNY A;  5EPK A;  1SYB A;  3I73 A;  4C1N K;  2E2H B;  1HRJ A;  3DEO A;  4HN7 A;  2FFK B;  4FO2 A;  1LO5 D;  2SNM A;  5LL6 X;  3R3O A;  3L7Z C;  4X3K A;  3SVM A;  3OIP A;  5CV5 A;  4X3T A;  3GTM B;  1IYV A;  3JAM E;  1F9R A;  1ONL A;  2XRS D;  3T51 B;  1SMY C;  5KNC A;  4F8M A;  1IKM A;  1SJH D;  2VUM B;  2HCC A;  2ZXO A;  4ZLT F;  4RA8 A;  2NVX B;  2Z1C A;  2EYJ A;  1LTT D;  3MA2 B;  2CVR A;  1FYC A;  2A6H C;  1GUW A;  4A3E B;  3TSS A;  5CV9 A;  4OO1 H;  5C0X I;  2LMC B;  5AFW A;  3V96 A;  5C5M A;  3A55 A;  4RFB A;  5COR A;  1CHP D;  1JOQ A;  1KDA A;  1V1P B;  1F77 A;  3ERO A;  4EGV A;  4RKB A;  1TS2 A;  2F0K A;  1IW7 C;  3ONA B;  1ILQ A;  3VYS A;  2K1B A;  3H0G B;  3QG1 A;  1JB3 A;  1UUP A;  5D14 A;  3OW7 A;  2QF7 A;  4TKO B;  1CZG A;  3D31 A;  1AN8 A;  1CI3 M;  1MSH A;  3H6M A;  1Y8O B;  1TWG B;  2WAC A;  4IUT A;  5I2Y A;  5M9O A;  2Y0S B;  4ID6 A;  2WP8 J;  3VR6 A;  1H9R A;  2ZT9 C;  4QF4 A;  1YNN D;  1O78 A;  2EVB A;  4YIJ A;  4RKL A;  3QWN A;  2YYZ A;  2PW5 A;  2NN6 I;  1ENF A;  2JP1 A;  1EWC A;  1W6K A;  1B9M A;  3R2I A;  4HR7 B;  2FMM A;  1BR9 A;  3K5N A;  1D5Z C;  3A56 A;  1Z7T A;  3DHQ A;  4C3H B;  4BBS B;  2B2W C;  1A3T A;  3RUZ A;  3PUZ A;  1SE4 A;  5JVG 3;  1SE3 A;  4IUP A;  1ESR A;  5C3X A;  3NE5 B;  3X3M A;  5BN5 A;  3KLR A;  3GTJ B;  4C3I B;  5I6W A;  1QJO A;  1K8M A;  1T5X D;  5FLX E;  5J1Z A;  3D6C A;  4K8J A;  1KNA A;  2B2U A;  3FRP B;  3SK8 A;  3K7A B;  4RCO A;  5BN4 A;  3NHH A;  4M1U B;  2WV6 D;  2X6G A;  4RHR A;  3MXP A;  3S17 B;  1LT3 D;  4XYO A;  3N6R A;  3AMU A;  4DU9 A;  3IKJ A;  1JOK A;  1D5M C;  1FD7 D;  2F0S A;  5IGE A;  3EA6 A;  2KHS A;  5EKL A;  1A2T A;  4DN4 M;  1LAB A;  2I07 B;  2EY6 A;  3E6Z X;  4XT3 B;  3K0Y A;  1HUM A;  1TY2 A;  3MVV A;  2IWH A;  1S5D D;  3EFX D;  3HOW B;  1HPC A;  2F3V A;  5LHY 1;  3BZD B;  4A93 B;  1SYG A;  1QG7 A;  2K04 A;  3NP8 A;  3OWF A;  4IUU A;  4Y7N B;  3NTI A;  2EPB A;  2EE1 A;  1CQF A;  1JWU D;  1MGS A;  1Q1E A;  1AP0 A;  2FIN B;  3S16 B;  2DY7 A;  2IX0 A;  2Q8T A;  3X3N A;  1PTO D;  2NVQ B;  1STN A;  2EYF A;  3TP6 A;  1U4P A;  4KHZ A;  1TQO A;  3HEJ A;  4DNR B;  4KJN A;  3NWT A;  3J80 L;  4G57 A;  1G2S A;  3SXH A;  5ELF A;  1I4X A;  1D5X C;  2F0U A;  3BYY B;  2KCN A;  5JEA H;  2R61 A;  3TME A;  3A8I E;  3KK7 A;  3VYU A;  2ICE C;  1STH A;  1OXU A;  2MUY A;  3A7L A;  2EY5 A;  1EY5 A;  2Z4I A;  1S5F D;  2K5D A;  4C56 C;  5M5X B;  3VA5 A;  2QEJ C;  1VMC A;  3EQL C;  1CT1 D;  1K8O A;  4DXF A;  3T4A C;  3T53 B;  1JE4 A;  1V1P A;  3C1E A;  1LTS D;  2ICI A;  4ZKC B;  5IT9 E;  1LTG D;  3RZD B;  3NQT A;  5EQ0 A;  3I3C A;  2EXZ A;  2FHT A;  1C8C A;  2XRQ D;  2SNS A;  5KYI A;  1BCP C;  2B8F A;  2B39 A;  2KEE A;  3EVQ A;  4OO1 G;  1TWH B;  2B8G A;  1LAC A;  3CQZ B;  2IPK D;  2NVT B;  2F0D A;  2TSS A;  2B2T A;  4CJ1 B;  3BDO A;  2RSN A;  1DXM A;  3C3L A;  4IZ8 A;  2F0J A;  2R7Z B;  1TWA B;  4CHT B;  3R93 A;  1W6J A;  3C1F A;  4K6D A;  2A6E C;  3K6O A;  2RSO A;  3PIP 3;  2F0Q A;  3MXU A;  1EYD A;  4RH6 A;  2AUJ D;  1AEX A;  2E76 C;  5I9O A;  1DD2 A;  1SDF A;  4ULL A;  1OXT A;  2E2I B;  1FGB D;  3OWE B;  2HUG A;  4KN7 C;  2KCC A;  2F0L A;  4DAP A;  4FXK C;  4HMI A;  3UI2 A;  2AQ1 B;  3IFD A;  2YU9 B;  2AWO A;  1DOM A;  5IOC A;  5EBC A;  1ET6 A;  3K58 A;  2LFN A;  2JA8 B;  1X3Q A;  3D4R A;  2JE6 I;  1B50 A;  1I4R A;  1CTM A;  5KYL A;  3QIA A;  5IGG A;  1IL8 A;  4CJ0 B;  4KTA A;  4A3M B;  4CKC A;  3MXN A;  2RDG A;  4A3K B;  1WTR A;  1JC7 A;  3MXG A;  2JEA I;  1A6X A;  4K2K A;  2BCO A;  2BA1 A;  3R2T A;  4DAV A;  3U9O A;  5DAU A;  5EPL A;  2F0F A;  1IKL A;  1O7L A;  4UAI A;  2K03 A;  2JSO A;  5CV8 A;  3PUW A;  3HKZ B;  3E0J A;  1QOH A;  5M5Y B;  1SYF A;  5I9P A;  2CQA A;  4IFD H;  1Y8N B;  1AW7 A;  1GHJ A;  1IYU A;  1T5E A;  4MN3 A;  2K7V A;  4WFN 3;  4G7H C;  3VR4 A;  1B3A A;  3VYT A;  2B2Y C;  3S14 B;  4KKS A;  2RDH A;  4F88 A;  5C0X J;  3SDZ A;  1SFO B;  3J7A F;  1LTR D;  5C4X B;  2L5T A;  2HDL A;  1F2L A;  5CBE E;  4QUF A;  1NR2 A;  4TQU S;  1CM9 A;  3D3R A;  2QIL A;  4IUR A;  3MC0 B;  1HHV A;  2M2L A;  3DWA A;  3J81 L;  5I2X A;  1TT2 A;  1JQY D;  4G4K A;  2PCF B;  5E3F A;  3CKI B;  4RGM A;  3NTH A;  2JYO A;  1HUN A;  2F0I A;  4ABN A;  2O4X A;  1JWM D;  1TWF B;  2Z8L A;  1GHK A;  1ZEQ X;  5JEA G;  3P7J A;  2HCI A;  3Q23 A;  4HSP A;  3HOU B;  5IOD A;  4H0L C;  5FO8 B;  2F4I A;  1LT6 D;  4PQX A;  3NSW A;  1RHP A;  1YNN C;  4OL7 A;  1O7Y A;  1HQM C;  1Y1W B;  1DJR D;  4BY7 B;  3V2T A;  3FPP A;  1F9S A;  4A3J B;  1V1O A;  3DEP A;  3PMF A;  4ILW A;  2SOB A;  3SK4 A;  2XIW A;  3LNN A;  3HRZ C;  1TS5 A;  2IJ0 A;  1J8I A;  4PMB A;  4X3S A;  2A74 C;  1GOZ A;  2OF1 A;  4KD3 A;  2DY8 A;  2G9D A;  2E2J B;  2AQ3 B;  3QOJ A;  2K5Q A;  1BUV T;  1I4G A;  4JK1 C;  1BOS A;  5C4J B;  5C44 B;  4KV6 A;  1CFM A;  5C4Z A;  3PUY A;  4EQP A;  2SEB D;  2RDF A;  3VA7 A;  1E2W A;  1PYW D;  2PZW A;  3FEW X;  1RJT A;  1TVX A;  4DK1 A;  4U67 3;  4HTH A;  4ZKB B;  3J80 E;  3BVG A;  1SAP A;  2ZXP A;  3W3A A;  4H7B A;  2HDM A;  4K5W A;  1Z6H A;  3K5M A;  5J39 A;  1BO0 A;  4Z9C B;  3S1N B;  1ZXT A;  2FMC A;  1WD1 A;  3MFG A;  5CV4 A;  5JPN C;  2L12 A;  1EQV A;  3OOC A;  3D6W A;  4EVO A;  5CC4 A;  4O42 A;  4A3I B;  5C3W A;  1PTO C;  5EKK A;  4XIG S;  2NWG A;  4DGZ A;  1PRT B;  4IUN A;  2F0V A;  5IGC A;  2R92 B;  3H3V C;  2TMP A;  4C2M B;  2A69 D;  3LWU A;  2J0T D;  4KHV A;  1EY0 A;  4C3J G;  3NUC A;  1B44 D;  2KOL A;  3DWQ A;  4OO1 I;  1C48 A;  5CMD A;  4XT1 B;  4K6L A;  1BXT A;  5M3F B;  1GXD C;  4ODG A;  3BDC A;  2EDG A;  3RMH A;  3KLS A;  4IFD G;  1U4R A;  4KK7 A;  2O5I C;  2EJM A;  4PV1 C;  2WII B;  5ELC A;  5IGB A;  3FMC A;  2VXW A;  3S1R B;  3BG3 A;  1EIG A;  2EYO A;  2EYP A;  1SYC A;  4R8I A;  1QNU A;  3OIQ A;  5F2D A;  2E75 C;  2LY7 A;  2VB2 X;  4QMG A;  2IW3 A;  2J4X A;  4ZQ3 A;  5EPJ A;  3NK9 A;  1SYD A;  1Y69 U;  3A54 A;  1L0Y B;  1DYQ A;  5C6A A;  4XQQ A;  1CZW A;  1NAP A;  3QO2 A;  1Y8P B;  1KLU D;  1ZKO A;  3Q0A A;  1WTP A;  4KKT A;  2F03 A;  4N9T A;  5CGK A;  4FF3 A;  3HOV B;  3IFT A;  5JEA J;  3FPU B;  3MAQ A;  1RDP D;  1ZYR D;  1EY8 A;  2BA0 A;  1RTO A;  4FF4 A;  2L4N A;  4KD4 A;  3S2H B;  2EZV A;  1SNC A;  3K59 A;  5HUR A;  1UNS A;  4L6T B;  2IL8 A;  2B2U C;  4J6H A;  2M9V A;  5C5L A;  3KF8 A;  2XVS A;  4FYD A;  1PTO F;  1R9T B;  5G3L D;  2F0G A;  1FNV A;  3HOY B;  1I4Q A;  3CHB D;  5JOB A;  2K28 A;  1D2B A;  4TSS A;  3T13 A;  1X32 A;  1LT5 D;  5G3L F;  1ENC A;  4QIW B;  1PZJ D;  1CQV A;  2O5J C;  1QWY A;  2H1E A;  2L55 A;  1LTI D;  4DA2 A;  3O13 A;  4GZY C;  3A7A B;  3MHB A;  2JEB I;  5JPM C;  1JOR A;  3DXJ C;  2KVM A;  1EZ8 A;  3NWS A;  3MTS A;  2BE5 D;  1S5B D;  5KNB A;  2K01 A;  1HFG A;  4XXE A;  1SSO A;  1HQR D;  2WKC A;  4HSV A;  3MEH A;  1GJX A;  2DN8 A;  1LV9 A;  3P20 A;  1JCK B;  4Q0F A;  1RD9 D;  4B9W A;  3J81 E;  1LT4 D;  4R8N A;  3L3O C;  3SK6 A;  1MSG A;  1PDQ A;  4NKL A;  1EU3 A;  1F2M A;  4O1N A;  1PLF A;  1XTC D;  1NSN S;  2F0E A;  1JWS D;  3GP7 A;  1LTA D;  3M4O B;  3HP3 A;  2A73 B;  4J8Q A;  4CKB A;  3M4Y A;  2D9U A;  2ZXR A;  4NW2 A;  5FO9 B;  1HTL D;  2WIN B;  5K36 H;  3G7L A;  1BBX C;  5KGU A;  2ID0 A;  2L0C A;  4KMU C;  4HCS A;  1WVL A;  2HQE A;  4OIK A;  3CRL C;  2BOS A;  2PZU A;  2EYH A;  1BNZ A;  1EL0 A;  2QDB A;  3NBH A;  1H9S B;  2JXM B;  2F0T A;  2IX1 A;  1SNM A;  3TDQ A;  1XX8 A;  5KEE A;  4K8I A;  1PFB A;  1BQQ T;  1O80 A;  3PO3 B;  1EFI D;  4EQN A;  5D3I B;  2KJX A;  1Q12 A;  1PZI D;  1G8Z D;  3NBI A;  5DM6 3;  3NXW A;  4B9X A;  1SEB D;  1OXV A;  2B2T C;  1D6E C;  1JOO A;  4RCN A;  1SNP A;  1M8A A;  3GD7 A;  5HGT A;  1V43 A;  1M4V A;  1EWH A;  2Q8I B;  3P1H A;  4F87 A;  2B63 B;  5JAV A;  5FOB B;  2MHV A;  1IHZ A;  3PUX A;  1S5C D;  4MHE A;  4K14 A;  1KDB A;  3HG9 A;  1LTB D;  1B4O A;  2A5H A;  2F0M A;  3J7Y W;  5FK9 C;  1Q3L A;  2K05 A;  3I72 A;  2XN9 C;  5E4X A;  4NMZ A;  1NUC A;  2EYM A;  4K5V A;  2WB1 B;  5JJZ A;  3I91 A;  4RGO S;  3NTK A;  2D2C C;  3I90 A;  3R8B A;  2OXP A;  2K32 A;  2OT2 A;  4FF1 A;  4G7Z C;  1G29 1;  1F9P A;  1H9J A;  3Q24 A;  2LS0 1;  3S1Q B;  2QKI C;  1DZ1 A;  4CGY B;  1AFP A;  4H13 C;  1ICW A;  2B2V A;  1EY7 A;  3QOL A;  4KJO A;  2PO4 A;  4ZK9 B;  1DON A;  3TP7 A;  4UDU C;  3RLF A;  2A68 D;  1I4H A;  3NPP A;  5J22 A;  1HA5 A;  1VCI A;  2EJG C;  1STG A;  2RKS A;  1STB A;  1QE6 A;  4HAE A;  1TR5 A;  1ESF A;  4C1N I;  1H9K A;  4LAA A;  3CRK C;  2J7Z A;  1S5E D;  1B9N A;  2C5C A;  3DWP A;  5C4H A;  4KKU A;  3TP5 A;  4FXD A;  3CU7 A;  2M00 A;  3DMU A;  4WOR A;  5C0X H;  4XQN A;  3GV3 A;  3QJY A;  2Q8R E;  1PRT D;  4P2C B;  3I70 A;  2R6G A;  4DXG A;  1RCV D;  4IFD I;  4ME5 A;  4RGT A;  3K5O A;  4ZUI A;  2KEC A;  4XYQ A;  2WAQ B;  2RA4 A;  1PRT F;  2SDF A;  1G91 A;  2MP1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...