4IFDH

Crystal structure of an 11-subunit eukaryotic exosome complex bound to rna
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
356
structure length
295
Chain Sequence
SEVITITKRNGAFQNSSDSQIVTPGELVTDDPIWMRGHGTYFLDNMTYSSVAGTVSRVNRLLSVIPLKGRYAPETGDHVVGRIAEVGNKRWKVDIGGKQHAVLMLGSVNLPGGILRRKSESDELQMRSFLKEGDLLNAEVQSLFQDGSASLHTRSLKYGKLRNGMFCQVPSSLIVRAKNHTHNLPGNITVVLGVNGYIWLRKTSQMDLARDTESSWQIYSDENDPSISNNIRQAICRYANVIKALAFCEIGITQQRIVSAYEASMVYSNVGELIEKNVMESIGSDILTAEKMRGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exosome complex component RRP45
publication title Crystal structure of an RNA-bound 11-subunit eukaryotic exosome complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/rna
total genus 79
structure length 295
sequence length 356
ec nomenclature
pdb deposition date 2012-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF14382 ECR1_N Exosome complex exonuclease RRP4 N-terminal region
H PF15985 KH_6 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4ifdH01
1GHKA 1OXVA 3A7AB 3ND9A 2DNCA 2K33A 3PUZA 4XTCS 3VR4A 1Q12A 3AB9A 2O5IC 2A6HD 3PUYA 1H9KA 2A68D 3OOCA 1VF7A 4G7ZC 3NE5B 3ND8A 1DXMA 3PUWA 4DK1A 2PNRC 5C0XG 2O5JC 1O78A 2NN6G 1K8OA 1GUNA 1YNJC 5KNBA 3T53B 1O7LA 1GUTA 3SDZA 2BA1A 2AWOA 2BE5C 4OO1H 1CTMA 1YNNC 1A6XA 1CFMA 3VR5A 4OGQC 1T5EA 1Y8OB 1IYUA 4TKOB 3OPOA 1I6VC 3A7LA 3VR6A 1LABA 2IT1A 1Q1EA 4KMUC 3FPPA 3GQBA 1H9SA 3FMCA 1E2WA 3A8IE 3A8KE 1G291 1GUGA 1ONLA 4H44C 1H9RA 5KNCA 2Q8IB 3M85A 2PPBC 1GHJA 1TKWB 2A69C 1FYCA 3MFYA 2A6EC 1HTPA 3LNNA 2LMCB 2EVBA 3GD7A 3N6RA 2BDOA 2JE6I 2EJMA 3BG3A 4OO1G 3CRLC 3T56B 1E2ZA 5BN3A 2E74C 5KNDA 2JXMB 3IKJA 1HQMC 1QJOA 2CW0C 4G7OC 4KKSA 1ZKOA 1HPCA 2EJFC 1BDOA 4I7ZC 3QJYA 3EQLC 4LJZC 4KI0A 1H9JA 1Y8PB 2AUJD 4DNRB 3D4RA 1GUSA 5K36H 1LACA 1OXSC 2EJGC 2E76C 2JEAI 2E75C 2K7VA 3VR3A 1Q90A 3KLRA 1VDZA 3IFTA 1IW7C 1PMRA 2QF7A 3HGBA 2KA7A 3PV0A 2YYZA 3T51B 1H9SB 2V4DA 2BE5D 4H13C 4PV1C 4G7HC 2F1MA 4HR7B 3BDOA 2D5DA 3DXJC 3QIAA 2JEBI 3I73A 1V43A 3M4YA 4KHZA 1HCZA 4KN7C 3WDNA 4IFDH 3OW7A 2A6HC 2DNEA 3I72A 1IYVA 1V8QA 2A68C 1ZYRC 3D31A 3LWUA 3L7ZC 3U9SA 5K36G 1OXTA 5A35A 1VF5C 1GJXA 2A69D 3SE0A 2L5TA 1Y8NB 4BA1I 4KKUA 2AUKA 5JEAH 2PCFB 1FR3A 2A6ED 4JBWA 1TU2B 2B8GA 2K32A 5BN4A 1B9NA 4BA2I 4TQUS 3PUXA 5BN5A 4DK0A 1CI3M 4L8JA 3H94A 4DNTB 3CRKC 2NN6I 4KKTA 4IFDG 4H0LC 1GUOA 4RCNA 2EDGA 1OXXK 2D62A 3A8JE 1VCIA 2B8FA 1EWHA 5C0XH 2R6GA 1E2VA 2DN8A 2NN6H 3I4LA 3P20A 2ZT9C 3RLFA 2BA0A 1Y69U 4GZYC 3PUVA 3QG1A 4XIGS 3TZUA 1OXUA 3VR2A 1Q1BA 2KCCA 5JEAG 1IW7D 4JK1C 4KN4C 1Z6HA 3M7NA 3VA7A 2D2CC 1B9MA 4LK1C 4IQZA 1DD2A 1Z7TA 1K8MA 3W3AA 1H9MA 1DCZA 1SMYC 3MXUA
chains in the Genus database with same CATH superfamily
1Z47A 4XTCS 2WACA 2HD3A 4B3SQ 1HTLD 3GTMH 5CV6A 3DEPA 5C3WA 4RG1A 3P7JA 2SNSA 2WV6D 1O7LA 1IHZA 2ZTDA 2AWOA 1CTMA 1YHQA 2L11A 3SXHA 4PMBA 3A7LA 2JA8B 1L0XB 2IT1A 4KMUC 1V1PA 1WTHA 4K5XA 2F0NA 1PZKD 2WFWA 3A8KE 2A5HA 2PMZB 4DN4M 4LF9L 5FKAC 1GUWA 1W2BA 3BZKA 1EYAA 1EZ6A 3CC4A 1NY4A 3SEBA 5T1GA 2ZXRA 2OQ0A 1UAPA 4YWKA 4FF1A 1LTSD 1I50B 1PFBA 1E2ZA 3CCEA 5M5XH 1WYDA 4GN4B 1SR3A 5I2YA 3ER0A 3CQZH 4IZ8A 2EIFA 1XNQQ 1CHPD 1RHPA 5JPMC 4F7XA 1MKHA 3D6WA 2K7VA 3FDTA 5FLXL 2Y0SG 3UE1A 2NYZD 1B4OA 2M2LA 3I4MH 2QF7A 3E9IA 2HQLA 2B2UC 5LMUQ 2WAQG 4B3ML 5HURA 1F9RA 3CCLA 2PZWA 2JA7B 3I73A 2KHJA 3T4AC 2RVLA 4ID6A 4P2CB 3S2DH 1VQOA 4OIKA 2ID0A 2R7FA 1PH9A 1RIPA 1D6EC 2LSSA 2NTTA 2PW7A 5JVG3 1X3EA 3NUCA 4OWTB 2F0IA 1Y8NB 3TS0A 2FHTA 1X3FA 1CHQD 5C44H 4CGYB 2MNAA 2B2UA 4DK0A 4K2LA 4DAMA 3S15H 4OIJA 1VCIA 2B8FA 4LWCA 1XPUA 2LKVA 4XXEA 3HKZE 2NUCA 5JEAJ 4A3KB 1TY2A 4PNYA 5IP9G 1HJPA 2A1AA 1HRJA 3FP9A 3NENA 4UAIA 1BR9A 4Y7NH 3S24A 2AMCB 3KDFB 1HNXQ 2C9OA 1PFNA 5EPJA 1TY0A 2K33A 1VQFA 1VQAA 5KRUA 1Q12A 3X3MA 1N8RC 1AZPA 3HOVB 2VQEQ 3CC2A 3H0GG 2OT2A 3NE5B 3ND8A 3I7FA 1JOKA 1YNJC 1LLRD 1GUTA 2J4XA 3DWAA 1G2TA 4P75A 4C3HG 3RR5A 2R7ZG 1Y8OB 1IYUA 1KQSA 5CGKA 5M5WB 3FPPA 1GUGA 3NQIA 4PZ8A 1KDBA 5CC4A 5C4JB 3J81E 1HFNA 3C1FA 2QGQA 2FMMA 1EWCA 2A6EC 5EPKA 3GD7A 2JE6I 3HOXB 2JXMB 4OONA 3H3VH 4DF7A 1GVPA 1ZKOA 3H3VC 2CQOA 5E1FA 5LL6S 2R93B 4JI2L 1VQJA 2X6GA 1PZJD 4JI6Q 2SNMA 4FP5D 1PFSA 3J80c 4BBRB 3RZOH 2R92H 1SDFA 2JK8A 3GTOH 1VDZA 1EUJA 5CV4A 3NQTA 1KC8C 3RLNA 2F4VQ 4FF4A 1L2FA 1B7YB 2D5DA 5ELEA 4HJ7A 2JEBI 4FVMA 4R8IA 2E2HB 4IFDH 2VL6A 1XJVA 4NXNQ 1KIXA 4A3LG 2VUMG 3ERQA 5A35A 3A56A 1VQ9A 1K9MC 2J0TD 2IWHA 4CDCC 1X54A 5JOBA 2F0DA 4Y52H 1FR3A 1X3GA 3EIVA 3RN2A 1YNXA 3R93A 5JPNC 1CKNB 4DV5L 1PLFA 3CCVA 3N52A 2RSNA 1X6OA 5AJ3Q 2KECA 2NVQH 3QWNA 4BS9A 4DV3L 1PTOB 1C8CA 2GA4B 4KN4C 1EIGA 1I4GA 1W6JA 3PIOA 2JA6B 2E8GA 3MXUA 4IUNA 2JQOA 5M3MH 1MIUA 4C3JG 5EBDA 5M9OA 4A3CH 2EE1A 2RCNA 3PUWA 3Q8DA 1IYJB 3OTOL 4LF4Q 3J81i 1VQ7A 1HZBA 4YHHL 4GKJL 3NWTA 4PZ6A 4JI1L 3BVMA 4M8AA 1WOCA 3CU7A 5DAUA 3FPUB 3BDLA 1PH1A 5JJIA 4DR6Q 4WRDA 4L63B 3K58A 4UY8C 4IN3A 2EVBA 2SDFA 3TDQA 3D8GA 2NZ1D 3OIQA 1PV4A 3GTQH 4C3IG 3PF4A 2XWJB 2E74C 2RHSB 4AQYQ 4U673 1PVOA 1EZ8A 1QVFA 2YTXA 4AYBB 1HR0Q 4DV7L 1X3QA 3V96A 3GTGH 2B2YC 1HNWL 1I4RA 4B9WA 4DK3C 4DNRB 2Q2HA 4JOIA 1DONA 3EN2A 1BQQT 1EU4A 1YHBA 4BBSH 5I2XA 1YVCA 3KUPA 2RSOA 4MTKA 1YZ6A 3TRZA 4A3IH 4A3GB 1JCKB 2YTVA 1CT1D 1NE3A 1GM5A 2K5QA 1JB7A 1QVCA 4DR7L 3PO2H 1I5FA 4DR3Q 1EY4A 1WD0A 1Q7YC 4K5VA 3MHBA 2KUMA 5COYA 4JBWA 1Y1VG 5LMNW 3HOUH 3A54A 5BN4A 1WVLA 3HKZG 3DM1A 1B3QA 1D5ZC 4L8JA 4ZQ3A 1Q3LA 2NN6I 2IW3A 5T1IA 1VQ5A 4RCNA 4TVAB 4DAPA 3ULLA 3UDIA 1PFMA 4BY1H 2F0OA 4DV1Q 3F8TA 2EYFA 2WINB 3TZUA 3L3OC 3T1YL 1LO5D 2HHHQ 2ENBA 1K3RA 4GLVB 3PO3H 2WB1E 4A3FG 1SBBB 3F2UA 1LT6D 1LTRD 3A7AB 4QQBX 5GAEC 1DOKA 3I4NG 2ALYB 2F3WA 4XT1B 2A68D 2KJXA 3I8ZA 4G7ZC 5C0XG 3NBHB 1O78A 3BJUA 3OHXC 3GTPH 4DUZL 3SDZA 4EGVA 1K0SA 1JWMD 4TKOB 2K14A 3VR6A 2KEDA 4H02A 4C3HH 3CCRA 1BCPF 3TN2A 3M85A 2V1CC 1V1QA 1J5EL 2CKZB 2NVTH 4V190 2C5CA 2FJ2A 1STAA 1JICA 1PDQA 3MXPA 4OO1I 5IIFA 4FNFA 4XQJA 5E4WC 4I65A 4L5TA 1ML0D 4X62L 2CFMA 5IGEA 3Q6SA 3TBIB 1HPCA 1UE6A 4EQNA 4BXXH 4ILWA 1A3UA 3EQLC 4DV4L 2Q2IA 2CHBD 3T13A 4QUCA 3H0GB 5DLQE 3M3YH 4LFCL 1VQDA 4YY3Q 5IYBH 5JAVA 3PV0A 1J8IA 1H9SB 2EY5A 3ERSX 2I46A 2L9HA 5JVH3 2D0OA 2F0VA 2R7ZB 5C6AA 1VQ4A 4R9WA 2DNEA 1TWAB 3HOWH 1ZYRC 3BVGA 3D31A 3AFQA 2KENA 3DMUA 1KHIA 1O7ZA 2XGTA 1C7YA 1M90C 4ME3A 1VF5C 2UUBQ 2UUAL 1PYBA 3K57A 2EPBA 2L5TA 5EKIA 2L4NA 2PNHA 4O42A 2VUMH 4GOPC 1EY5A 5IGBA 4ZAIA 1JC7A 4KD4A 3VYRA 1UE1A 1F9QA 1I3QH 3RZDH 4A3JH 1IBML 1ICWA 1BUVT 3K5OA 4HCSA 2UXCQ 2D62A 1I94L 4RAUC 2DN8A 1RCVD 3FEWX 1YJWA 5M5YB 2PYKA 1S3OA 1TT2A 4A75A 3S1NH 1LTTD 4YCWA 4DPGA 5C44G 2K5HA 4EQ5A 1SNOA 1JWUD 4R1JA 4KTAA 2XSCA 5GAGC 4A3MG 3HZXA 1X56A 4GS3A 4RHSA 4DR1L 4NB3A 2IX0A 4A3BG 2EYHA 4LUZA 3DUZA 3A5UA 5ISRA 1MSHA 2F0UA 2KOLA 1VQHA 4IPGA 5EQ0A 1STHA 1LABA 5E4XA 4E6IA 4LFBL 1O80A 3W1BA 2QDBA 3GQBA 3NTHA 4RFBA 4HSPA 1EU3A 1NAPA 3E6ZX 2BDNA 3OWFA 3CXCA 3CPWA 3TREA 3SGIA 4IUVA 2I5HA 3TSSA 2HT1A 4K6LA 1EQRA 3DHQA 1IL2A 2F03A 2EY6A 3S2HH 4HJ8A 2B2TC 1R9TB 4C3IH 1F9SA 4UP7A 4X66L 5H1SE 3J80L 1N33L 2VS1A 2I0QA 1KNAA 1PTOD 2UXBL 1HQRD 1MHWC 1PH8A 3CCQA 2E2JB 4KV6A 3ITPA 1WCMB 2AWNA 5FLXE 4FXGC 1JB3A 3M4YA 4HIDA 4C56C 1GXDC 3OW7A 3OSOA 4JI1Q 5IP7H 1HA5A 5BR8Q 1BF4A 1WD1A 5E7NA 1IKMA 3Q22A 4QMGA 4XYQA 2R92G 3TP8A 1HR0W 1N36Q 3FKIH 4HMIA 4LF8L 4A3DB 3M4PA 1Y1WH 2E2IB 2HDMA 5NUCA 1L0YB 2F0FA 1KABA 2CW0D 4DNTB 4IFDG 3I91A 5D65A 3T1HL 1I6HB 1SE4A 4DFAA 4EX5A 2BH2A 1E2VA 1U4RA 3TS2A 2JJQA 2JSOA 1A63A 5AFWA 5ELBA 1C9OA 4ZKBB 1OXUA 4GNXC 4DR5Q 1FGUA 2NZOA 1KXLA 1S5DD 1U4PA 4ZCKA 1H9MA 1E0BA 5L37A 4NDXA 1OXVA 2KHIA 3K6OA 2ZJRA 2G5DA 1L1OC 2Q8TA 3BVZA 2Q8RE 5C4HA 2Z8LA 4JW0A 1QVGA 1SYCA 3ULPA 3MAQA 5HY6A 4XYOA 5JJKA 3D3RA 2E5LL 1CFMA 3UE0A 4ZYSA 4JI4L 3GTLH 1NR2A 4RGMA 2PQAA 3S16H 1Y1VB 4X65Q 3U50C 4NW2A 3GV3A 3JAMc 4B9XA 2KCTA 4S3SA 4N9TA 4O1NA 5M3MG 2MQHA 2VQFL 2JA8H 5KGUA 4A3CG 3MXGA 1FYCA 5EKKA 1M1KC 3F2BA 1S5FD 3U4VA 2KHSA 3CCUA 5KYLA 2PW5A 2B2WC 2VZAA 1F2YA 4DUYQ 3I3CA 3T56B 3K7AB 1BVSA 2RF4A 4KKSA 4MN3A 3G6EA 2HQEA 3QJYA 2UUCL 1Y8PB 4A3EG 1E1TA 1CUKA 1I50H 3CHBD 4N8FA 1A2UA 3I4NB 2EJGC 2E76C 2HDLA 4HJAA 1Q8KA 1U9RA 1YHAA 2B29A 5EJWA 1MD2D 4MIUA 4R4QA 1H95A 4WJWA 1V1PB 3T51B 2QEXA 2K1BA 1XPRA 4JG2A 1R4PB 4KHPL 1P16A 1N32L 4JV5L 3QIAA 1N34Q 3HKSA 3C3LA 5FO9B 1SFOH 1HHVA 1IYVA 2A68C 5EPLA 3GO5A 2X6LA 1QZHA 1MSGA 2JA7H 3IFDA 5IWAQ 5LMNQ 5CR3A 1K83B 3OMGA 4JCVE 2PCFB 4BBSG 5EGTA 2QILA 3RN5A 2H5XA 1VQLA 1HZ9A 4A3IG 2ATWA 4JI3L 1I4PA 5J39A 3S17B 1OO9B 3KK7A 2WKDA 1CSQA 2JP1A 1GOZA 1PXUA 3PO2G 5K5PA 5C4XB 2EY1A 1VQMA 3CP0A 3PUVA 4XIGS 3RMHA 4DV6L 4JI0Q 3QOLA 5DM63 3MWYW 3VYUA 4LFAL 3HOUG 2A73B 3QOJA 5CV9A 2RBMA 5C5MA 2EYPA 4WFN3 1GHKA 4NMZA 4MHEA 4A3KH 3BDCA 3ND9A 2DNCA 2H1EA 3NWSA 4NXMQ 2O5IC 2ES2A 3RD4A 3KF6A 4BY1G 3CQZB 3PCOB 4A3MH 4LF7L 4RGNA 2NWGA 4B3TQ 4EVOA 2OEOA 1K0RA 2MO1A 2BA1A 4OO1H 3I4MB 2DJFC 4A3BH 3WWVA 3PO3G 4DV0L 4JI5Q 2IX3A 2KQ3A 1KAAA 1UEAB 1JWSD 4H44C 5KNCA 3S2DB 4RKLA 5M5WH 1D5MC 5GADC 3MFYA 4G4KA 3LNNA 1VMPA 1X32A 2MP1A 4RKBA 3TP5A 1BNZA 5GAHC 1DJRD 5KNDA 1K8AC 1S4ZA 3KDFA 3WOEA 1TWHB 1SMYD 5DNFA 5I6WA 4K0KL 5CV5A 3G4SA 3CAMA 3S15B 4A76A 2JEAI 1K28A 2MPMA 4F87A 3IAYA 4YWLA 2XNAC 2F0PA 1NR4A 2D0PA 2F0MA 1ENCA 1VQBA 4A4IA 4BBRH 5IGFA 1KDCA 4Y7NB 1TS2A 4BXXG 4LF6Q 1WTVA 1XX8A 1AP0A 1SNPA 4X64Q 1GKHA 2EYOA 2K03A 1OXTA 4CHTB 2JA5H 2A69D 1EY6A 1D1IA 5IYBG 4HTHA 2B2VC 4R4IA 1V9PA 2WP8J 2OCEA 2G9DA 3PIP3 4JI8Q 1LT4D 2Z6KC 4OX9Q 3T16A 1PYWD 1SAPA 3HOWG 2CH4W 1YIJA 2CWAA 1PRTB 4B08A 1G6ZA 2XRQD 4DAVA 1EY7A 1A15A 2N8NA 1HA6A 3W5OA 1QB5D 1S5BD 3G71A 4IQZA 4QUFA 1R4QB 2ZM6L 1II3A 4A3JG 2IY5B 1PTOH 1SMXA 5C0XJ 4HAEA 3MA2B 4LUVA 3K59A 1Q81C 1PTOC 4GKKQ 1XNRQ 3MXNB 1XTDA 1B44D 1HFGA 1JORA 1NMGA 1SE2A 5FOBB 1TS4A 3RZOB 5I4DA 4AH6A 1CZWA 2ICIA 2QW7A 5CYUA 4HIKA 1N9WA 3VA5A 3UDGA 3VYSA 4DKAC 3A0JA 2RHQB 1CKNA 2MUYA 3DEOA 2B63H 1LTAD 4R8NA 1LTGD 2P5ZX 4DNIA 2WB1B 2K04A 1K73C 3GTJB 2BDOA 4B3RL 1HH2P 4DAYB 5BN3A 1MBYA 3I56A 1QNKA 1GD7A 3ULJA 2SOBA 2KCNA 1L0WA 2JA9A 2CW0C 1BKBA 4Q0FA 4ABNA 1IBLQ 4ZKCB 3QO2A 1BO0A 4IURA 1XMOL 5K36H 1LACA 2KVMA 1RD9D 2RDHA 4LF5Q 2E75C 4XQNA 4A3EH 1NSNS 1X9NA 1DYQA 3HGBA 2NVQB 4ZUJA 2YYZA 1ICFB 2F1MA 2GVBA 1T9HA 2VXWA 4CDDC 1IL8A 2EZVA 2NVXH 3HOZB 4K14A 4POGA 2DJGC 3W2DA 4JI4Q 4L5QA 3KYHC 2AQ1B 2HCCA 2IHEA 2K01A 4BY7B 1STBA 1T5XD 1ILPA 4A3GH 1G6PA 2AUKA 4JYAL 1PTOF 5IYDH 4IALA 4DR2Q 3IL8A 1PH5A 2QA4A 4IO9A 2TMPA 1KDAA 3E9HA 5ELDA 1FJGL 3H94A 4TSSA 2M00A 5GQOA 5IP7G 1OXXK 3A8JE 5IGGA 1AW7A 1XMQL 3MZ5A 4UP8A 4CDEC 3QG1A 3FKIG 1IBKL 3GTKH 1IKLA 1Y1WG 1Z6HA 2K05A 3J7A5 1WTXA 2B2YA 1Z7TA 3GTQB 4LF9Q 4DV2L 1G51A 1CK1A 2ICEC 1DOMA 2DY7A 3C46A 3VR4A 1CA6A 1UE5A 4P73A 3GTGB 1C0AA 3F1ZA 1N32Q 5EBCA 1LYLA 2K52A 1I4XA 1STYA 4HCEA 3JAML 5IT9c 1A6XA 1FGBD 1JT8A 2HCIA 3BYTB 1AE2A 1EFID 3NTIA 3EFXD 4BBSB 5CORA 1Q1EA 4DR4L 1KRTA 2Y0SB 1HZAA 1FD7D 1HZCA 3L2PA 2UU9L 1EIYB 1NUCA 5G3LF 4KY6A 2WAQB 3CMEA 4DU9A 4JBKA 4POFA 3OYYA 3K0YA 2MO0A 3J7YW 2IJ0A 3G48A 3LGJA 4B3MQ 1SNCA 5D14A 2DUDA 2EJMA 5EAYA 1IZ6A 2KEEA 4IPDA 5D3DA 4G7OC 1JMCA 3H09A 1YBYA 5IE8A 4C2MH 2EJFC 3TP6A 4J15A 5CV8A 4IOAA 1SYEA 1UE7A 1RTNA 3NBHA 4BY1B 3J80E 1YI2A 4IJHA 2JA8G 1KTKA 3BZDB 5ELOA 5EKLA 2V4DA 2F0JA 2X69A 1EQQA 1RDPD 4WORA 3CF5A 1QILA 3PO3B 2PZUA 4KN7C 5FJ8H 4C1NI 2EYLA 2BH8A 3U9SA 1Q46A 1XNQL 1TWCH 3K81C 1DOLA 2N49A 3S1MH 1TWAH 2PI2A 1SXTA 4EQOA 5LMUL 4IFDJ 4RCOA 5KIXA 3TZDA 2RKSA 3CRKC 3H91A 4C3HB 4H0LC 1UUPA 4K6DA 1TS3A 4OL7A 1EWHA 2BA0A 2JA7G 1Y69U 1TS5A 3S1QH 1Q82C 1F9PA 4QJFA 2D2CC 1SEBD 1BXTA 1SMYC 3MEFA 4IJLA 2L55A 4M1UB 3SK8A 1CA5A 4ULLA 4RA8A 3Q24A 4KY5A 1UEBA 1VF7A 1D5XC 1OTCA 2O5JC 3AFPA 2OF1A 1EIHA 2NVYB 5KNBA 1JOOA 2N55A 1TWFH 3M3YB 1XXGA 1TWGH 3M4QA 5HGQA 3PIO3 3J7ZC 3M4OH 4MZ9A 4JI2Q 1HUMA 1E2WA 4A3KG 1HNXL 2Z0SA 3KF8B 1W3SA 1EQTA 4GOPA 1Q8IA 2MHVA 2A69C 3CPFA 2VQEL 4XQQA 3VYTA 1QUQB 3J80i 4UP9A 4L5RC 1UWVA 5A2QL 2DY8A 4OO1G 3CRLC 3HOVG 4I7AA 2VUMB 3SVMA 3IKJA 2OTJA 1I3QB 1QG7A 1SRUA 1PRTD 3NELA 4K5WA 5IY0A 3SHLA 3ZYYX 2AHOB 4HJ5A 1GUSA 3NXWA 3J7AF 1EYGA 5FLMH 3R2IA 1R9TH 1B50A 4JI7L 1DM0B 3HOYH 5IYCH 3ZJYC 2RDGA 1LT5D 3DXJC 2FMCA 4KHZA 3S1NB 4DV5Q 1STGA 2IL8A 3D4WA 2F0QA 3I72A 1YITA 1EL0A 3LWUA 1WCMH 3I90A 1B70B 3S14H 4PQXA 4DV3Q 4JI6L 3KJPA 2VB2X 3PGZA 3SE0A 1JR0D 2E2DC 5JEAH 1EYDA 2Z9HA 4C3JB 3S9WA 3UI2A 2PI2E 2MGSA 5J22A 1A0IA 1AH9A 4BA2I 3A5ZB 4BBRG 4TQUS 2F4VL 3MFGA 3EVQA 4DK6C 2E2IH 2EDGA 2F0TA 2RDFA 3OTOQ 3K5MA 1VQCA 3H6MA 4GKJQ 1EWIA 5ELNA 4YHHQ 4A93H 5FK9C 3I4LA 3KBGA 3P20A 3RLFA 4NXNL 1AFPA 2HUGA 2JA5G 1NBWA 1CSPA 3BU2A 2B2TA 2OTLA 3U4ZA 4XDXA 4KY7A 5CBEE 1JE5A 1I6HH 2IPKD 4CJ2C 1A3TA 1K8MA 3W3AA 3S2HB 2UXDL 1G8ZD 4CKEA 1JQYD 1CKMA 4C3IB 3I2ZA 3NTKA 1MJCA 1DXMA 1D1KA 4LMQD 5AJ3L 3F2DA 3C2PA 4FF2A 5C3EH 1VQ8A 4DV7Q 1HNWQ 2K50A 1DGSA 1B53A 4HMJA 1B2TA 4MTNA 1JJCB 1G291 4JYAQ 2Q2TA 2YU9H 3J81c 1FNUA 4FO2A 4IUUA 5M3FH 2H4OA 1FJGQ 1ENAA 2JA6G 3S1RH 1KLGD 1GO3E 1HTPA 1KRSA 4LF4L 3N6RA 5IGCA 3PIPA 3FKIB 1V1OA 4QB4A 2DGYA 1Y1WB 3TP7A 4DR7Q 1KD1C 4DXGA 1H9JA 1A62A 2AUJD 4LUOA 4GNXA 3FHWA 4IUQA 1S5CD 1SE3A 1RJTA 1ASZA 2B63G 4QL5A 3HKZB 1EIFA 4DR6L 2VY3A 1VQGA 2PQAB 4YCVA 1E24A 1PMRA 3FVQA 2L15A 2I5MX 2LFNA 4G57A 4RMFA 2BE5D 2EXDA 1W6KA 1L1OA 3BDOA 5LHY1 1X65A 2EXZA 1WJJA 3EBEA 2XRSD 5IODA 3NP8A 1HR0L 2XTIA 4OELB 5K36G 3P75A 2XIWA 4A3FB 3T1YQ 4AYBG 5CV7A 4KD3A 5CMDA 1KAWA 3SK4A 3D6CA 1BCPD 2O4XA 2B8GA 2FFKB 2FINB 2MJ8A 3GTLB 3PUXA 3KFUA 2B3GA 3S16B 3AQQA 3GP7A 1PH6A 5I9OA 1K83H 2KCMA 2B39A 2N78A 3PSIA 2B2WA 2R61A 2QDLA 2ZJQA 2NN6H 3BYYB 4DUZQ 3H15A 1ASYA 4A3GG 3S17H 4HJ9A 4FF3A 1CZGA 4DR3L 5GROA 5IYDG 3VA7A 4RWSC 4LK1C 3B6YA 3GTMB 1J9OA 1M4VA 3D0FA 1AN8A 4JBMA 5C4XH 4H7BA 1X55A 2BOSA 4UHVA 3QR8A 1J5EQ 4QCLA 2QKIC 2L0CA 3KLSX 1CKOA 3PUYA 1H9KA 5IT9L 4DV1L 4Q5VA 1F2LA 4X62Q 4F8MA 4LW1A 3CCSA 1EOVA 1PH3A 2EOTA 1U5KA 2JYOA 2HHHL 5I9PA 2WKCA 5D3IB 4DV4Q 3A8IE 1ONLA 2XN9C 2QEJC 2Q8IB 1SFOB 3V2TA 1GHJA 4LFCQ 5M5XB 1SJHD 4QIWE 2J7ZA 1P8LA 3HFZB 2A8VA 1Y14B 3IRBA 1G2SA 2OXPA 3KF6B 2Z6BA 1MJEA 3HOVH 1SSOA 2F3VA 4DXFA 1PH4A 1O7YA 2UUAQ 3X3NA 3PMFA 1WI5A 3V05A 1TWHH 3KLSA 3EROA 3E5SA 2R3ZA 3IFTA 3NEMA 4FDBA 4OXPA 1G91A 2OWOA 1YNND 4G7HC 1IBMQ 2CCZA 5DM73 1PH2A 5C4JH 1LTID 2QCPX 3OIPA 1I94Q 2VB3X 1RL2A 1NNXA 5J1ZA 5E3FA 5C44B 1GJXA 3D4DA 3A74A 4NP5A 3MC0B 3GDEA 4KKUA 4KLKA 5KYIA 4A3MB 2ASBA 3HOXH 1SYBA 4HSVA 4YY3L 2K5VA 1IXRA 3WOFA 2R93H 1ZYRD 4A3BB 2ZJPA 3HP3A 5FJ8G 1VMCA 1GUOA 4K2KA 4U68A 2LY7A 4DR1Q 1U0LA 2R6GA 2AQ2B 1YEZA 2PMZE 1JJGA 2UUBL 1Q1BA 2EYMA 4RGOS 1HUNA 4LFBQ 2E2HH 1JE4A 4R4TA 3BG3A 1PRTC 1O7IA 3R8BA 4JI7Q 2A19A 4X3KA 4JVZA 3AB9A 4ZRZA 4O2DA 3K7UC 1ILQA 3PF5A 4KJOA 1QZGA 4FXDA 2AKWB 4ZUIA 3FRPB 2G9HD 2UXCL 3ONAB 4FYDA 1EFWA 3URYA 1XWEA 1T5EA 3E0EA 2CVRA 3EA6A 4X66Q 2K6AA 2L1BA 3JAME 1S72A 4R4OA 1N33Q 4QF4A 5FO8B 2UXBQ 3LX0A 3LWEA 1H9RA 2IX1A 1RODA 3AU7A 1VQIA 1ZEQX 3RNUA 2B2VA 1VS0A 3F2CA 3KJOA 3EJIA 5TSSA 5IOCA 4IPHA 2JA5B 3Q0AA 2Z6KA 2F0KA 4L6TB 2JA6H 2R92B 4P74A 4CJ0B 3GTOB 1F77A 2JN4A 3GTJH 1EQVA 2I07B 4OWXB 3RLOA 3D4RA 1RF2D 1LV9A 1ET9A 3MXNA 4LF8Q 1CQFA 1A2TA 2UXDQ 1Q90A 2A74C 4PV1C 4DA2A 4HR7B 1F2MA 1LTBD 4X3SA 2CQAA 2C35B 2ZXPA 1HCZA 2Z1CA 3T1HQ 3WDNA 3HRZC 4ME5A 4APVA 1J6QA 1MI2A 1KNEA 1PRTF 4J1MA 5FLMG 2Z4IA 3DM3A 1EEID 4OHJA 3HOZH 4IUPA 4ZLTF 1K8GA 1D7QA 3NHHA 2OQKA 3STBD 4DAYA 4BY7H 1WFQA 1QE6A 3HOYG 5IYCG 3PQIA 2FXQA 1DZ1A 2MFIA 4R4CA 1TQOA 1U4MA 4N9PA 4GLXA 1XYIA 4PMCA 5ELFA 2EY2A 1WCMG 5BR8L 4KJNA 1S5ED 2PZTA 3K0XA 4X3TA 2B63B 2E5LQ 4UDUC 5M3MB 5JEAG 4X3UA 1IW7D 4JK1C 1N36L 4JOIC 1EEFD 1EY0A 1DD2A 3MTSA 4JPBW 4P72A 2VQFQ 4A3DG 3JAMi 1SLJA 2A6HD 1SYDA 2PO4A 3OOCA 5I6YA 1HNZL 4A93G 3VDYA 5C0XI 4C1NK 1X3PA 4HEDA 3T53B 2BCOA 2F0SA 3TEHB 2BE5C 1B8AA 3KOJA 4A3EB 2M9VA 3BS1A 3DWPA 3OPOA 1I6VC 1FNWA 3RUZA 2Q2UA 4DR5L 2PQEA 1CM9A 2UUCQ 1E1OA 5DEHA 3J81L 4AIMA 1TR5A 1C4QA 4Z9CB 2NVXB 4ODGA 1EY8A 1TKWB 5JJLA 1WTOA 1BCPC 4KHPQ 4JV5Q 1YJ9A 5C3EG 4HIMA 2F0GA 1VQEA 5JJZA 3DWQA 5A2QE 1LM0A 1BDOA 4X65L 4QGUA 1AEXA 3O13A 1JJ2A 4K8JA 1BCPB 5HGTA 1PYSB 5C4ZA 4CKBA 2ZTEA 4A3IB 5M3FG 4XT3B 3OMCA 1KLUD 1FL0A 2ZTCA 5FLXc 1VQNA 3TMEA 3GTKB 3PO2B 3JC66 4B3SL 3C1EA 4JI3Q 4DUYL 4YIJA 1HXYD 1V43A 3A55A 4QY7A 4TRDA 3CKIB 1WTQA 3L7ZC 3HOUB 4NKLA 4DV6Q 2XVSA 3M7GA 1WTPA 1SYFA 5IP9H 1ENFA 3SK5A 1LUZA 4LFAQ 1JOQA 1NTGA 1NCVA 1QCBD 1MGSA 4JC0A 1SNDA 1SNQA 3J81j 1M8AA 1CI3M 4KKTA 5LL6X 3KLWA 1S40A 1E3PA 1N34L 3H0GH 3OWEB 4LF7Q 2F0LA 1ZXTA 4KHVA 3NK9A 3VR2A 5IWAL 2R7ZH 4DV0Q 5LMNL 1B9MA 1BBWA 3M9BA 3MVVA 3UDXA 3K5NA 1DCZA 2NZHA 5ELCA 3I4OA 3NSWA 3L0OA 4EQPA 3GTPB 3U9OA 1EY9A 1D2BA 4MNOA 4C2MB 4AYBE 1KL9A 4DK1A 2NBFA 3R3OA 2PNRC 2NN6G 1STEA 1GUNA 1XTCD 1WTWA 2L12A 1A3VA 1Z9FA 3DLLA 1YNNC 4OGQC 4JI0L 3AEVA 2F52A 4J6HA 4PG3A 4V0BA 2NVTB 4K0KQ 2N3SA 2NVYH 4F88A 1BOSA 1BBUA 1H9SA 2K28A 3FMCA 3CCJA 5C4XG 5C5LA 2F0EA 4GN5A 2GN5A 3I70A 4YWMA 2PPBC 2F4IA 4NXML 1VQPA 1CQVA 3MEHA 1QWYA 5M5YH 4GN3B 3L9AX 1SE8A 1NMFA 2VNUD 1TWCB 1TXYA 5KEEA 4B3TL 1VQ6A 3S1MB 2YTYA 1HQMC 2K5DA 2O2LD 1NJIC 3NPPA 1LTLA 4KI0A 4P71A 4JI5L 4ZK9B 1A8VA 4A3LH 1OXSC 1C48A 5F2DA 4HN7A 3I4MG 1TVXA 1I4HA 1SN8A 2TSSA 4GLAC 2D9UA 3G6JB 1YNJD 1SROA 3TQYA 3HOWB 3S1QB 3OW2A 3HG9A 2CWPA 3E3XA 4OEMB 3H3VI 4L5SA 2AQ3B 3R2TA 4GOPB 2Y0SE 4PZ7A 2GVAA 2NB0A 1ET6A 1EYCA 1TIID 1E7ZA 3KF8A 2WAQE 3U58A 3J7AV 4K8IA 5J3BA 2XWBB 3Q23A 3RZDB 2ZXOA 4A3JB 2F0WA 1QUQA 4J8QA 2LS01 4JBJA 4PMWA 2A6ED 1VQKA 2ZM6Q 1PH7A 2RCFA 5IGDA 4WJ4A 3G7LA 1TWFB 1B1ZA 1YJNA 2EYJA 1TWGB 3M4OB 1BBXC 4UPAA 4IPCA 4IFDI 4X6AH 1F2ZA 4YCUA 4C3JH 4RH6A 3E0JA 4LF6L 1D8LA 1SYGA 1WTRA 3AMUA 2ZT9C 4X64L 2E2JH 4GZYC 2LXKA 2KCCA 3HOXG 2KBNA 2SEBD 2K75A 4LAAA 1UNSA 2Z4HA 2R93G 4RHRA 3PUZA 1AE3A 2YV5A 4JI8L 1QNUA 1RKNA 4WJ3M 3GV6A 1U4LA 4OX9L 1E22A 4RGTA 4NPSA 4A3DH 1SJED 1K8OA 4CJ1B 4B3RQ 3KBXA 4IUTA 3CD6A 1AZQA 2HIVA 2F0HA 3VR5A 5IT9E 3P1HA 3K80C 3HOYB 2N88A 1XMOQ 2NTSA 3HS0C 2RQXA 3I55A 2K5WA 3CCMA 3NBIA 4GKKL 4HIOA 1XNRL 3S14B 3K5LA 1QOHA 2LMCB 3STBC 2LXJA 2VW9A 1FVIA 5CBAE 3K8AA 2F3IA 1QJOA 4I7ZC 2IHFA 4KK7A 4LJZC 1STNA 1PHJA 5FO7B 3CW2C 1EOTA 1SNMA 3AYHB 1PZID 3VR3A 4A93B 3KLRA 2K5NA 1IW7C 3HEJA 2KA7A 1Y1VH 4H13C 1HNZQ 1LT3D 3BZCA 3SR1A 4N8X1 4QIWB 2WB1G 2A6HC 1XMQQ 1IBLL 1V8QA 2HIXA 3CC7A 4IOCA 2WIIB 3CMAA 1PA6A 1K3BC 1IBKQ 4LNQA 4BA1I 2R7DA 5G3LD 4LF5L 3ICEA 3K7AH 1TU2B 1ESRA 3SK6A 2K32A 4DV2Q 4O0AA 1B9NA 4A3FH 4OWWB 5C3EB 2RA4A 4GNXB 1FNVA 5BN5A 1Q86C 1RTOA 3QB3A 4FXKC 5C3XA 2K4KA 3I4NH 4ALPA 4CKCA 2CH4A 3W1GA 4BWGB 1ESFA 5C0XH 4DGZA 4AQYL 2YU9B 3HOZG 1L1OB 5M3FB 3S1RB 1XPOA 3M7NA 4DR4Q 1B3AA 3UDFA 2UU9Q 4CDFC 4BY7G 2EQSA 1I4QA 4DR2L 2I5LX 4CBVA
chains in the Genus database with same CATH topology
1Z47A 4XTCS 2WACA 1HTLD 5CV6A 3DEPA 5C3WA 3P7JA 2SNSA 2WV6D 1O7LA 1IHZA 2AWOA 1CTMA 2L11A 3SXHA 4PMBA 3A7LA 2JA8B 1L0XB 2IT1A 4KMUC 1V1PA 4K5XA 2F0NA 1PZKD 3A8KE 2A5HA 2PMZB 4DN4M 5FKAC 1GUWA 1EYAA 1EZ6A 3SEBA 5T1GA 2ZXRA 1UAPA 4FF1A 1LTSD 1I50B 1PFBA 1E2ZA 5I2YA 4IZ8A 1CHPD 1RHPA 5JPMC 4F7XA 3D6WA 2K7VA 3FDTA 5FLXL 2NYZD 1B4OA 2M2LA 2QF7A 2B2UC 5HURA 1F9RA 2PZWA 2JA7B 3I73A 3T4AC 2RVLA 4ID6A 4P2CB 4OIKA 2ID0A 2NTTA 1D6EC 5JVG3 2PW7A 3NUCA 2F0IA 1Y8NB 2FHTA 1CHQD 4CGYB 2B2UA 4DK0A 4K2LA 4OIJA 1VCIA 2B8FA 2LKVA 4XXEA 2NUCA 5JEAJ 4A3KB 1TY2A 4PNYA 1HRJA 4UAIA 1BR9A 2C9OA 1PFNA 5EPJA 1TY0A 2K33A 5KRUA 1Q12A 3X3MA 1AZPA 3HOVB 2OT2A 3NE5B 3ND8A 1JOKA 1YNJC 1LLRD 1GUTA 2J4XA 3DWAA 1G2TA 4C3HG 1Y8OB 1IYUA 5CGKA 5M5WB 3FPPA 1GUGA 3NQIA 1KDBA 5CC4A 5C4JB 3J81E 1HFNA 3C1FA 2FMMA 1EWCA 2A6EC 5EPKA 3GD7A 2JE6I 3HOXB 2JXMB 4DF7A 1ZKOA 3H3VC 5E1FA 5LL6S 2R93B 2X6GA 1PZJD 2SNMA 4FP5D 4BBRB 1SDFA 1VDZA 5CV4A 3NQTA 4FF4A 2D5DA 5ELEA 2JEBI 4FVMA 4R8IA 2E2HB 4IFDH 3ERQA 5A35A 3A56A 2J0TD 2IWHA 5JOBA 2F0DA 1FR3A 3R93A 5JPNC 1PLFA 3N52A 2RSNA 2KECA 3QWNA 4BS9A 1PTOB 1C8CA 2GA4B 4KN4C 1EIGA 1I4GA 1W6JA 2JA6B 3MXUA 4IUNA 4C3JG 5EBDA 5M9OA 2EE1A 3PUWA 3NWTA 3BVMA 4M8AA 3CU7A 5DAUA 3FPUB 3BDLA 4WRDA 4L63B 3K58A 4IN3A 2EVBA 2SDFA 3TDQA 3D8GA 2NZ1D 3OIQA 4C3IG 2XWJB 2E74C 4U673 1EZ8A 4AYBB 1X3QA 3V96A 2B2YC 1I4RA 4B9WA 4DNRB 1DONA 1BQQT 1EU4A 5I2XA 3KUPA 2RSOA 4A3GB 1JCKB 1CT1D 2K5QA 1EY4A 1WD0A 4K5VA 3MHBA 2KUMA 5COYA 4JBWA 3A54A 5BN4A 1WVLA 3DM1A 1D5ZC 4L8JA 4ZQ3A 1Q3LA 2NN6I 2IW3A 5T1IA 4RCNA 4DAPA 1PFMA 2F0OA 2EYFA 2WINB 3TZUA 3L3OC 1LO5D 2ENBA 1SBBB 3F2UA 1LT6D 1LTRD 3A7AB 1DOKA 4XT1B 2F3WA 2A68D 2KJXA 3I8ZA 4G7ZC 5C0XG 1O78A 3OHXC 3SDZA 4EGVA 1JWMD 4TKOB 3VR6A 2KEDA 1BCPF 3TN2A 3M85A 4V190 2C5CA 2FJ2A 1STAA 1JICA 1PDQA 3MXPA 4OO1I 5IIFA 4FNFA 4XQJA 5E4WC 4I65A 1ML0D 5IGEA 3Q6SA 3TBIB 1HPCA 4EQNA 4ILWA 1A3UA 3EQLC 2CHBD 3T13A 4QUCA 3H0GB 5JAVA 3PV0A 1J8IA 1H9SB 2EY5A 2I46A 2L9HA 5JVH3 2F0VA 2R7ZB 5C6AA 4R9WA 2DNEA 1TWAB 1ZYRC 3BVGA 3D31A 3DMUA 1O7ZA 1VF5C 3K57A 2EPBA 2L5TA 5EKIA 2L4NA 4O42A 1EY5A 5IGBA 4ZAIA 1JC7A 4KD4A 3VYRA 1F9QA 1ICWA 1BUVT 3K5OA 4HCSA 2D62A 4RAUC 2DN8A 1RCVD 3FEWX 5M5YB 2PYKA 1TT2A 1LTTD 1SNOA 1JWUD 4KTAA 2XSCA 3HZXA 4RHSA 2IX0A 2EYHA 3DUZA 5ISRA 1MSHA 2F0UA 2KOLA 5EQ0A 1STHA 1LABA 5E4XA 4E6IA 1O80A 2QDBA 3GQBA 3NTHA 4RFBA 4HSPA 1EU3A 1NAPA 3E6ZX 2BDNA 3OWFA 4IUVA 3TSSA 4K6LA 3DHQA 2F03A 2EY6A 2B2TC 1R9TB 1F9SA 3J80L 1KNAA 1PTOD 1HQRD 2E2JB 4KV6A 3ITPA 1WCMB 2AWNA 5FLXE 4FXGC 1JB3A 3M4YA 4C56C 1GXDC 3OW7A 3OSOA 1HA5A 1BF4A 1WD1A 1IKMA 3Q22A 4QMGA 4XYQA 3TP8A 4HMIA 4A3DB 2E2IB 2HDMA 5NUCA 1L0YB 2F0FA 1KABA 2CW0D 4DNTB 4IFDG 3I91A 5D65A 1I6HB 1SE4A 4DFAA 1E2VA 1U4RA 2JSOA 5AFWA 5ELBA 4ZKBB 1OXUA 1S5DD 1U4PA 1H9MA 1E0BA 4NDXA 1OXVA 3K6OA 2Q8TA 3BVZA 2Q8RE 5C4HA 2Z8LA 1SYCA 3MAQA 4XYOA 3D3RA 1CFMA 4ZYSA 1NR2A 4RGMA 1Y1VB 4NW2A 3GV3A 4B9XA 4S3SA 4N9TA 4O1NA 5KGUA 3MXGA 1FYCA 5EKKA 1S5FD 2KHSA 5KYLA 2PW5A 2B2WC 1F2YA 3I3CA 3T56B 3K7AB 4KKSA 4MN3A 2HQEA 3QJYA 1Y8PB 3CHBD 1A2UA 3I4NB 2EJGC 2E76C 2HDLA 1U9RA 5EJWA 1MD2D 4MIUA 4WJWA 1V1PB 3T51B 2K1BA 1R4PB 3QIAA 3C3LA 5FO9B 1HHVA 1IYVA 2A68C 5EPLA 3GO5A 2X6LA 1MSGA 3IFDA 5CR3A 1K83B 3OMGA 2PCFB 5EGTA 2QILA 1I4PA 5J39A 3S17B 1OO9B 3KK7A 2WKDA 2JP1A 1GOZA 1PXUA 5K5PA 5C4XB 2EY1A 3PUVA 3RMHA 4XIGS 3QOLA 5DM63 3MWYW 3VYUA 2A73B 3QOJA 5CV9A 2RBMA 5C5MA 2EYPA 4WFN3 1GHKA 4NMZA 4MHEA 3BDCA 3ND9A 2DNCA 2H1EA 3NWSA 2O5IC 3RD4A 3CQZB 4RGNA 2NWGA 4EVOA 2OEOA 2BA1A 4OO1H 3I4MB 2IX3A 2KQ3A 1KAAA 1UEAB 1JWSD 4H44C 5KNCA 3S2DB 4RKLA 1D5MC 3MFYA 4G4KA 3LNNA 1VMPA 1X32A 2MP1A 4RKBA 3TP5A 1BNZA 1DJRD 5KNDA 1S4ZA 3WOEA 1TWHB 1SMYD 5DNFA 5I6WA 5CV5A 3S15B 2JEAI 2MPMA 4F87A 3IAYA 2XNAC 2F0PA 1NR4A 2F0MA 1ENCA 5IGFA 1KDCA 4Y7NB 1TS2A 1WTVA 1XX8A 1AP0A 1SNPA 2EYOA 2K03A 1OXTA 4CHTB 2A69D 1EY6A 1D1IA 4HTHA 2B2VC 2WP8J 2G9DA 3PIP3 1LT4D 3T16A 1PYWD 1SAPA 1PRTB 4B08A 1G6ZA 2XRQD 4DAVA 1EY7A 1A15A 1HA6A 1QB5D 1S5BD 4IQZA 4QUFA 1R4QB 1II3A 1PTOH 5C0XJ 4HAEA 3MA2B 3K59A 1PTOC 1B44D 1HFGA 1JORA 1SE2A 5FOBB 1TS4A 3RZOB 5I4DA 1CZWA 2ICIA 5CYUA 3VA5A 3VYSA 2MUYA 3DEOA 1LTAD 4R8NA 1LTGD 2WB1B 2K04A 3GTJB 2BDOA 5BN3A 1MBYA 1QNKA 2SOBA 2KCNA 4Q0FA 2CW0C 4ABNA 4ZKCB 3QO2A 1BO0A 4IURA 5K36H 1LACA 2KVMA 1RD9D 2RDHA 2E75C 4XQNA 1NSNS 1DYQA 3HGBA 2NVQB 4ZUJA 2YYZA 2F1MA 2VXWA 1IL8A 2EZVA 3HOZB 4K14A 3W2DA 2AQ1B 2HCCA 2K01A 4BY7B 1STBA 1T5XD 1ILPA 2AUKA 1PTOF 4IALA 3IL8A 2TMPA 1KDAA 5ELDA 3H94A 4TSSA 2M00A 1OXXK 3A8JE 5IGGA 1AW7A 3MZ5A 3QG1A 1IKLA 1Z6HA 2K05A 1WTXA 2B2YA 1Z7TA 3GTQB 1CK1A 2ICEC 1DOMA 2DY7A 3C46A 3VR4A 1CA6A 3GTGB 5EBCA 1I4XA 1STYA 4HCEA 3JAML 1A6XA 1FGBD 2HCIA 3BYTB 3NTIA 1EFID 4BBSB 3EFXD 5CORA 1Q1EA 2Y0SB 1FD7D 1NUCA 5G3LF 4KY6A 2WAQB 4DU9A 3K0YA 3J7YW 2IJ0A 1SNCA 5D14A 2EJMA 2KEEA 5D3DA 4G7OC 3H09A 2EJFC 3TP6A 5CV8A 1SYEA 1RTNA 3NBHA 4BY1B 3J80E 1KTKA 3BZDB 5EKLA 2V4DA 2F0JA 2X69A 1RDPD 4WORA 1QILA 3PO3B 2PZUA 4KN7C 4C1NI 2EYLA 3U9SA 1DOLA 1SXTA 4EQOA 4IFDJ 4RCOA 5KIXA 3TZDA 2RKSA 3CRKC 3H91A 4C3HB 4H0LC 1UUPA 4K6DA 1TS3A 4OL7A 1EWHA 2BA0A 1Y69U 1TS5A 1F9PA 2D2CC 1SEBD 1BXTA 1SMYC 2L55A 4M1UB 3SK8A 1CA5A 4ULLA 4RA8A 3Q24A 4KY5A 1VF7A 1D5XC 2O5JC 2OF1A 1EIHA 2NVYB 5KNBA 1JOOA 2N55A 3M3YB 1XXGA 3PIO3 1HUMA 1E2WA 1EQTA 1Q8IA 2MHVA 2A69C 4XQQA 3VYTA 5A2QL 2DY8A 4OO1G 3CRLC 2VUMB 3SVMA 3IKJA 1I3QB 1QG7A 1PRTD 4K5WA 3SHLA 3ZYYX 1GUSA 3NXWA 3J7AF 3R2IA 1B50A 1DM0B 2RDGA 1LT5D 3DXJC 2FMCA 4KHZA 3S1NB 1STGA 2IL8A 3D4WA 2F0QA 3I72A 1EL0A 3LWUA 3I90A 4PQXA 2VB2X 3SE0A 1JR0D 2E2DC 5JEAH 1EYDA 4C3JB 3S9WA 3UI2A 2MGSA 5J22A 4BA2I 4TQUS 3MFGA 3EVQA 2EDGA 2F0TA 2RDFA 3K5MA 3H6MA 5FK9C 3I4LA 3KBGA 3P20A 3RLFA 1AFPA 2HUGA 2B2TA 4XDXA 4KY7A 5CBEE 2IPKD 4CJ2C 1A3TA 1K8MA 3W3AA 3S2HB 1G8ZD 4CKEA 1JQYD 4C3IB 3NTKA 1DXMA 1D1KA 4LMQD 3C2PA 4FF2A 1B53A 4HMJA 1B2TA 1G291 1FNUA 4FO2A 4IUUA 2H4OA 1ENAA 1KLGD 1HTPA 5IGCA 3N6RA 3FKIB 1V1OA 4QB4A 1Y1WB 3TP7A 4DXGA 1H9JA 2AUJD 4IUQA 1S5CD 1SE3A 1RJTA 3HKZB 1PMRA 3FVQA 2LFNA 4G57A 2BE5D 1W6KA 3BDOA 5LHY1 2EXZA 2XRSD 5IODA 3NP8A 5K36G 3P75A 2XIWA 4A3FB 5CV7A 4KD3A 5CMDA 3SK4A 3D6CA 1BCPD 2O4XA 2B8GA 2FFKB 2FINB 2MJ8A 3GTLB 3PUXA 3S16B 3GP7A 5I9OA 2B39A 2B2WA 2R61A 2NN6H 3BYYB 4FF3A 1CZGA 3VA7A 4RWSC 4LK1C 3GTMB 1J9OA 1M4VA 1AN8A 4H7BA 2BOSA 4QCLA 2QKIC 2L0CA 3KLSX 3PUYA 1H9KA 5IT9L 4Q5VA 1F2LA 4F8MA 2EOTA 2JYOA 5I9PA 2WKCA 5D3IB 3A8IE 1ONLA 2XN9C 2QEJC 2Q8IB 1SFOB 3V2TA 1GHJA 5M5XB 1SJHD 2J7ZA 1G2SA 2OXPA 1SSOA 2F3VA 4DXFA 1O7YA 3X3NA 3PMFA 3V05A 3KLSA 3EROA 3E5SA 2R3ZA 3IFTA 1G91A 1YNND 4G7HC 5DM73 1LTID 2QCPX 3OIPA 2VB3X 5J1ZA 5E3FA 5C44B 1GJXA 3D4DA 4NP5A 3MC0B 4KKUA 5KYIA 4A3MB 1SYBA 4HSVA 3WOFA 1ZYRD 4A3BB 3HP3A 1VMCA 1GUOA 4K2KA 4U68A 2LY7A 2R6GA 2AQ2B 1Q1BA 2EYMA 4RGOS 1HUNA 1JE4A 3BG3A 1PRTC 3R8BA 4X3KA 3AB9A 4ZRZA 1ILQA 4KJOA 4FXDA 4ZUIA 3FRPB 2G9HD 3ONAB 4FYDA 3URYA 1XWEA 1T5EA 2CVRA 3EA6A 2K6AA 2L1BA 3JAME 4QF4A 5FO8B 3LX0A 3LWEA 1H9RA 2IX1A 1RODA 3AU7A 1ZEQX 2B2VA 3EJIA 5TSSA 5IOCA 2JA5B 3Q0AA 2F0KA 4L6TB 2R92B 4CJ0B 3GTOB 1F77A 1EQVA 2I07B 3D4RA 1RF2D 1LV9A 1ET9A 3MXNA 1CQFA 1A2TA 1Q90A 2A74C 4PV1C 4DA2A 4HR7B 1F2MA 1LTBD 4X3SA 2CQAA 2ZXPA 1HCZA 2Z1CA 3WDNA 3HRZC 4ME5A 1MI2A 1KNEA 1PRTF 4J1MA 2Z4IA 1EEID 4OHJA 4IUPA 4ZLTF 3NHHA 4DAYA 1QE6A 1DZ1A 1TQOA 1U4MA 4N9PA 1XYIA 4PMCA 5ELFA 2EY2A 4KJNA 1S5ED 2PZTA 4X3TA 2B63B 4UDUC 5M3MB 5JEAG 4X3UA 1IW7D 4JK1C 1EEFD 1EY0A 1DD2A 3MTSA 2A6HD 1SYDA 2PO4A 3OOCA 5I6YA 5C0XI 4C1NK 1X3PA 4HEDA 3T53B 2BCOA 2F0SA 2BE5C 4A3EB 2M9VA 3BS1A 3DWPA 3OPOA 1I6VC 1FNWA 3RUZA 2PQEA 1CM9A 5DEHA 3J81L 1TR5A 1C4QA 4Z9CB 2NVXB 4ODGA 1EY8A 1TKWB 1WTOA 1BCPC 2F0GA 5JJZA 3DWQA 5A2QE 1BDOA 1AEXA 3O13A 4K8JA 1BCPB 5HGTA 5C4ZA 4CKBA 4A3IB 4XT3B 3OMCA 1KLUD 3TMEA 3GTKB 3PO2B 3C1EA 4YIJA 1HXYD 1V43A 3A55A 4TRDA 3CKIB 1WTQA 3L7ZC 3HOUB 4NKLA 2XVSA 3M7GA 1WTPA 1SYFA 1ENFA 3SK5A 1JOQA 1NCVA 1QCBD 1MGSA 1SNDA 1SNQA 1M8AA 1CI3M 4KKTA 5LL6X 3OWEB 2F0LA 1ZXTA 4KHVA 3NK9A 3VR2A 1B9MA 3MVVA 3K5NA 1DCZA 5ELCA 3NSWA 4EQPA 3GTPB 3U9OA 1EY9A 1D2BA 4C2MB 4DK1A 2NBFA 3R3OA 2PNRC 2NN6G 1STEA 1GUNA 1XTCD 1WTWA 2L12A 1A3VA 1YNNC 4OGQC 4J6HA 4V0BA 2NVTB 4F88A 1BOSA 2K28A 1H9SA 3FMCA 5C5LA 2F0EA 3I70A 2PPBC 2F4IA 1CQVA 3MEHA 1QWYA 3L9AX 2VNUD 1TWCB 5KEEA 3S1MB 1HQMC 2K5DA 2O2LD 3NPPA 4KI0A 4ZK9B 1OXSC 1C48A 5F2DA 4HN7A 1TVXA 1I4HA 2TSSA 2D9UA 3G6JB 1YNJD 3HOWB 3S1QB 3HG9A 2AQ3B 3R2TA 2NB0A 1ET6A 1EYCA 1TIID 3KF8A 3J7AV 4K8IA 2XWBB 3Q23A 3RZDB 2ZXOA 4A3JB 2F0WA 4J8QA 2LS01 4PMWA 2A6ED 5IGDA 1TWFB 3G7LA 1B1ZA 2EYJA 1TWGB 3M4OB 1BBXC 4IFDI 1F2ZA 4RH6A 3E0JA 1SYGA 1WTRA 3AMUA 2ZT9C 4GZYC 2KCCA 2SEBD 4LAAA 1UNSA 2Z4HA 4RHRA 3PUZA 1QNUA 1RKNA 3GV6A 1U4LA 4RGTA 1SJED 1K8OA 4CJ1B 3KBXA 4IUTA 1AZQA 2F0HA 3VR5A 5IT9E 3P1HA 3HOYB 2N88A 2NTSA 3HS0C 2RQXA 2K5WA 3NBIA 3S14B 3K5LA 1QOHA 2LMCB 5CBAE 1QJOA 4I7ZC 4KK7A 4LJZC 1STNA 5FO7B 1EOTA 1SNMA 1PZID 3VR3A 4A93B 3KLRA 1IW7C 3HEJA 2KA7A 4H13C 1LT3D 3SR1A 4QIWB 2A6HC 1V8QA 2WIIB 4BA1I 5G3LD 1TU2B 1ESRA 3SK6A 2K32A 1B9NA 5C3EB 2RA4A 1FNVA 5BN5A 1RTOA 3QB3A 4FXKC 5C3XA 4CKCA 4BWGB 1ESFA 5C0XH 4DGZA 2YU9B 5M3FB 3S1RB 3M7NA 1B3AA 1I4QA 4CBVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GHK A;  1OXV A;  3A7A B;  3ND9 A;  2DNC A;  2K33 A;  3PUZ A;  4XTC S;  3VR4 A;  1Q12 A;  3AB9 A;  2O5I C;  2A6H D;  3PUY A;  1H9K A;  2A68 D;  3OOC A;  1VF7 A;  4G7Z C;  3NE5 B;  3ND8 A;  1DXM A;  3PUW A;  4DK1 A;  2PNR C;  5C0X G;  2O5J C;  1O78 A;  2NN6 G;  1K8O A;  1GUN A;  1YNJ C;  5KNB A;  3T53 B;  1O7L A;  1GUT A;  3SDZ A;  2BA1 A;  2AWO A;  2BE5 C;  4OO1 H;  1CTM A;  1YNN C;  1A6X A;  1CFM A;  3VR5 A;  4OGQ C;  1T5E A;  1Y8O B;  1IYU A;  4TKO B;  3OPO A;  1I6V C;  3A7L A;  3VR6 A;  1LAB A;  2IT1 A;  1Q1E A;  4KMU C;  3FPP A;  3GQB A;  1H9S A;  3FMC A;  1E2W A;  3A8I E;  3A8K E;  1G29 1;  1GUG A;  1ONL A;  4H44 C;  1H9R A;  5KNC A;  2Q8I B;  3M85 A;  2PPB C;  1GHJ A;  1TKW B;  2A69 C;  1FYC A;  3MFY A;  2A6E C;  1HTP A;  3LNN A;  2LMC B;  2EVB A;  3GD7 A;  3N6R A;  2BDO A;  2JE6 I;  2EJM A;  3BG3 A;  4OO1 G;  3CRL C;  3T56 B;  1E2Z A;  5BN3 A;  2E74 C;  5KND A;  2JXM B;  3IKJ A;  1HQM C;  1QJO A;  2CW0 C;  4G7O C;  4KKS A;  1ZKO A;  1HPC A;  2EJF C;  1BDO A;  4I7Z C;  3QJY A;  3EQL C;  4LJZ C;  4KI0 A;  1H9J A;  1Y8P B;  2AUJ D;  4DNR B;  3D4R A;  1GUS A;  5K36 H;  1LAC A;  1OXS C;  2EJG C;  2E76 C;  2JEA I;  2E75 C;  2K7V A;  3VR3 A;  1Q90 A;  3KLR A;  1VDZ A;  3IFT A;  1IW7 C;  1PMR A;  2QF7 A;  3HGB A;  2KA7 A;  3PV0 A;  2YYZ A;  3T51 B;  1H9S B;  2V4D A;  2BE5 D;  4H13 C;  4PV1 C;  4G7H C;  2F1M A;  4HR7 B;  3BDO A;  2D5D A;  3DXJ C;  3QIA A;  2JEB I;  3I73 A;  1V43 A;  3M4Y A;  4KHZ A;  1HCZ A;  4KN7 C;  3WDN A;  4IFD H;  3OW7 A;  2A6H C;  2DNE A;  3I72 A;  1IYV A;  1V8Q A;  2A68 C;  1ZYR C;  3D31 A;  3LWU A;  3L7Z C;  3U9S A;  5K36 G;  1OXT A;  5A35 A;  1VF5 C;  1GJX A;  2A69 D;  3SE0 A;  2L5T A;  1Y8N B;  4BA1 I;  4KKU A;  2AUK A;  5JEA H;  2PCF B;  1FR3 A;  2A6E D;  4JBW A;  1TU2 B;  2B8G A;  2K32 A;  5BN4 A;  1B9N A;  4BA2 I;  4TQU S;  3PUX A;  5BN5 A;  4DK0 A;  1CI3 M;  4L8J A;  3H94 A;  4DNT B;  3CRK C;  2NN6 I;  4KKT A;  4IFD G;  4H0L C;  1GUO A;  4RCN A;  2EDG A;  1OXX K;  2D62 A;  3A8J E;  1VCI A;  2B8F A;  1EWH A;  5C0X H;  2R6G A;  1E2V A;  2DN8 A;  2NN6 H;  3I4L A;  3P20 A;  2ZT9 C;  3RLF A;  2BA0 A;  1Y69 U;  4GZY C;  3PUV A;  3QG1 A;  4XIG S;  3TZU A;  1OXU A;  3VR2 A;  1Q1B A;  2KCC A;  5JEA G;  1IW7 D;  4JK1 C;  4KN4 C;  1Z6H A;  3M7N A;  3VA7 A;  2D2C C;  1B9M A;  4LK1 C;  4IQZ A;  1DD2 A;  1Z7T A;  1K8M A;  3W3A A;  1H9M A;  1DCZ A;  1SMY C;  3MXU A; 
#chains in the Genus database with same CATH topology
 1Z47 A;  4XTC S;  2WAC A;  2HD3 A;  4B3S Q;  1HTL D;  3GTM H;  5CV6 A;  3DEP A;  5C3W A;  4RG1 A;  3P7J A;  2SNS A;  2WV6 D;  1O7L A;  1IHZ A;  2ZTD A;  2AWO A;  1CTM A;  1YHQ A;  2L11 A;  3SXH A;  4PMB A;  3A7L A;  2JA8 B;  1L0X B;  2IT1 A;  4KMU C;  1V1P A;  1WTH A;  4K5X A;  2F0N A;  1PZK D;  2WFW A;  3A8K E;  2A5H A;  2PMZ B;  4DN4 M;  4LF9 L;  5FKA C;  1GUW A;  1W2B A;  3BZK A;  1EYA A;  1EZ6 A;  3CC4 A;  1NY4 A;  3SEB A;  5T1G A;  2ZXR A;  2OQ0 A;  1UAP A;  4YWK A;  4FF1 A;  1LTS D;  1I50 B;  1PFB A;  1E2Z A;  3CCE A;  5M5X H;  1WYD A;  4GN4 B;  1SR3 A;  5I2Y A;  3ER0 A;  3CQZ H;  4IZ8 A;  2EIF A;  1XNQ Q;  1CHP D;  1RHP A;  5JPM C;  4F7X A;  1MKH A;  3D6W A;  2K7V A;  3FDT A;  5FLX L;  2Y0S G;  3UE1 A;  2NYZ D;  1B4O A;  2M2L A;  3I4M H;  2QF7 A;  3E9I A;  2HQL A;  2B2U C;  5LMU Q;  2WAQ G;  4B3M L;  5HUR A;  1F9R A;  3CCL A;  2PZW A;  2JA7 B;  3I73 A;  2KHJ A;  3T4A C;  2RVL A;  4ID6 A;  4P2C B;  3S2D H;  1VQO A;  4OIK A;  2ID0 A;  2R7F A;  1PH9 A;  1RIP A;  1D6E C;  2LSS A;  2NTT A;  2PW7 A;  5JVG 3;  1X3E A;  3NUC A;  4OWT B;  2F0I A;  1Y8N B;  3TS0 A;  2FHT A;  1X3F A;  1CHQ D;  5C44 H;  4CGY B;  2MNA A;  2B2U A;  4DK0 A;  4K2L A;  4DAM A;  3S15 H;  4OIJ A;  1VCI A;  2B8F A;  4LWC A;  1XPU A;  2LKV A;  4XXE A;  3HKZ E;  2NUC A;  5JEA J;  4A3K B;  1TY2 A;  4PNY A;  5IP9 G;  1HJP A;  2A1A A;  1HRJ A;  3FP9 A;  3NEN A;  4UAI A;  1BR9 A;  4Y7N H;  3S24 A;  2AMC B;  3KDF B;  1HNX Q;  2C9O A;  1PFN A;  5EPJ A;  1TY0 A;  2K33 A;  1VQF A;  1VQA A;  5KRU A;  1Q12 A;  3X3M A;  1N8R C;  1AZP A;  3HOV B;  2VQE Q;  3CC2 A;  3H0G G;  2OT2 A;  3NE5 B;  3ND8 A;  3I7F A;  1JOK A;  1YNJ C;  1LLR D;  1GUT A;  2J4X A;  3DWA A;  1G2T A;  4P75 A;  4C3H G;  3RR5 A;  2R7Z G;  1Y8O B;  1IYU A;  1KQS A;  5CGK A;  5M5W B;  3FPP A;  1GUG A;  3NQI A;  4PZ8 A;  1KDB A;  5CC4 A;  5C4J B;  3J81 E;  1HFN A;  3C1F A;  2QGQ A;  2FMM A;  1EWC A;  2A6E C;  5EPK A;  3GD7 A;  2JE6 I;  3HOX B;  2JXM B;  4OON A;  3H3V H;  4DF7 A;  1GVP A;  1ZKO A;  3H3V C;  2CQO A;  5E1F A;  5LL6 S;  2R93 B;  4JI2 L;  1VQJ A;  2X6G A;  1PZJ D;  4JI6 Q;  2SNM A;  4FP5 D;  1PFS A;  3J80 c;  4BBR B;  3RZO H;  2R92 H;  1SDF A;  2JK8 A;  3GTO H;  1VDZ A;  1EUJ A;  5CV4 A;  3NQT A;  1KC8 C;  3RLN A;  2F4V Q;  4FF4 A;  1L2F A;  1B7Y B;  2D5D A;  5ELE A;  4HJ7 A;  2JEB I;  4FVM A;  4R8I A;  2E2H B;  4IFD H;  2VL6 A;  1XJV A;  4NXN Q;  1KIX A;  4A3L G;  2VUM G;  3ERQ A;  5A35 A;  3A56 A;  1VQ9 A;  1K9M C;  2J0T D;  2IWH A;  4CDC C;  1X54 A;  5JOB A;  2F0D A;  4Y52 H;  1FR3 A;  1X3G A;  3EIV A;  3RN2 A;  1YNX A;  3R93 A;  5JPN C;  1CKN B;  4DV5 L;  1PLF A;  3CCV A;  3N52 A;  2RSN A;  1X6O A;  5AJ3 Q;  2KEC A;  2NVQ H;  3QWN A;  4BS9 A;  4DV3 L;  1PTO B;  1C8C A;  2GA4 B;  4KN4 C;  1EIG A;  1I4G A;  1W6J A;  3PIO A;  2JA6 B;  2E8G A;  3MXU A;  4IUN A;  2JQO A;  5M3M H;  1MIU A;  4C3J G;  5EBD A;  5M9O A;  4A3C H;  2EE1 A;  2RCN A;  3PUW A;  3Q8D A;  1IYJ B;  3OTO L;  4LF4 Q;  3J81 i;  1VQ7 A;  1HZB A;  4YHH L;  4GKJ L;  3NWT A;  4PZ6 A;  4JI1 L;  3BVM A;  4M8A A;  1WOC A;  3CU7 A;  5DAU A;  3FPU B;  3BDL A;  1PH1 A;  5JJI A;  4DR6 Q;  4WRD A;  4L63 B;  3K58 A;  4UY8 C;  4IN3 A;  2EVB A;  2SDF A;  3TDQ A;  3D8G A;  2NZ1 D;  3OIQ A;  1PV4 A;  3GTQ H;  4C3I G;  3PF4 A;  2XWJ B;  2E74 C;  2RHS B;  4AQY Q;  4U67 3;  1PVO A;  1EZ8 A;  1QVF A;  2YTX A;  4AYB B;  1HR0 Q;  4DV7 L;  1X3Q A;  3V96 A;  3GTG H;  2B2Y C;  1HNW L;  1I4R A;  4B9W A;  4DK3 C;  4DNR B;  2Q2H A;  4JOI A;  1DON A;  3EN2 A;  1BQQ T;  1EU4 A;  1YHB A;  4BBS H;  5I2X A;  1YVC A;  3KUP A;  2RSO A;  4MTK A;  1YZ6 A;  3TRZ A;  4A3I H;  4A3G B;  1JCK B;  2YTV A;  1CT1 D;  1NE3 A;  1GM5 A;  2K5Q A;  1JB7 A;  1QVC A;  4DR7 L;  3PO2 H;  1I5F A;  4DR3 Q;  1EY4 A;  1WD0 A;  1Q7Y C;  4K5V A;  3MHB A;  2KUM A;  5COY A;  4JBW A;  1Y1V G;  5LMN W;  3HOU H;  3A54 A;  5BN4 A;  1WVL A;  3HKZ G;  3DM1 A;  1B3Q A;  1D5Z C;  4L8J A;  4ZQ3 A;  1Q3L A;  2NN6 I;  2IW3 A;  5T1I A;  1VQ5 A;  4RCN A;  4TVA B;  4DAP A;  3ULL A;  3UDI A;  1PFM A;  4BY1 H;  2F0O A;  4DV1 Q;  3F8T A;  2EYF A;  2WIN B;  3TZU A;  3L3O C;  3T1Y L;  1LO5 D;  2HHH Q;  2ENB A;  1K3R A;  4GLV B;  3PO3 H;  2WB1 E;  4A3F G;  1SBB B;  3F2U A;  1LT6 D;  1LTR D;  3A7A B;  4QQB X;  5GAE C;  1DOK A;  3I4N G;  2ALY B;  2F3W A;  4XT1 B;  2A68 D;  2KJX A;  3I8Z A;  4G7Z C;  5C0X G;  3NBH B;  1O78 A;  3BJU A;  3OHX C;  3GTP H;  4DUZ L;  3SDZ A;  4EGV A;  1K0S A;  1JWM D;  4TKO B;  2K14 A;  3VR6 A;  2KED A;  4H02 A;  4C3H H;  3CCR A;  1BCP F;  3TN2 A;  3M85 A;  2V1C C;  1V1Q A;  1J5E L;  2CKZ B;  2NVT H;  4V19 0;  2C5C A;  2FJ2 A;  1STA A;  1JIC A;  1PDQ A;  3MXP A;  4OO1 I;  5IIF A;  4FNF A;  4XQJ A;  5E4W C;  4I65 A;  4L5T A;  1ML0 D;  4X62 L;  2CFM A;  5IGE A;  3Q6S A;  3TBI B;  1HPC A;  1UE6 A;  4EQN A;  4BXX H;  4ILW A;  1A3U A;  3EQL C;  4DV4 L;  2Q2I A;  2CHB D;  3T13 A;  4QUC A;  3H0G B;  5DLQ E;  3M3Y H;  4LFC L;  1VQD A;  4YY3 Q;  5IYB H;  5JAV A;  3PV0 A;  1J8I A;  1H9S B;  2EY5 A;  3ERS X;  2I46 A;  2L9H A;  5JVH 3;  2D0O A;  2F0V A;  2R7Z B;  5C6A A;  1VQ4 A;  4R9W A;  2DNE A;  1TWA B;  3HOW H;  1ZYR C;  3BVG A;  3D31 A;  3AFQ A;  2KEN A;  3DMU A;  1KHI A;  1O7Z A;  2XGT A;  1C7Y A;  1M90 C;  4ME3 A;  1VF5 C;  2UUB Q;  2UUA L;  1PYB A;  3K57 A;  2EPB A;  2L5T A;  5EKI A;  2L4N A;  2PNH A;  4O42 A;  2VUM H;  4GOP C;  1EY5 A;  5IGB A;  4ZAI A;  1JC7 A;  4KD4 A;  3VYR A;  1UE1 A;  1F9Q A;  1I3Q H;  3RZD H;  4A3J H;  1IBM L;  1ICW A;  1BUV T;  3K5O A;  4HCS A;  2UXC Q;  2D62 A;  1I94 L;  4RAU C;  2DN8 A;  1RCV D;  3FEW X;  1YJW A;  5M5Y B;  2PYK A;  1S3O A;  1TT2 A;  4A75 A;  3S1N H;  1LTT D;  4YCW A;  4DPG A;  5C44 G;  2K5H A;  4EQ5 A;  1SNO A;  1JWU D;  4R1J A;  4KTA A;  2XSC A;  5GAG C;  4A3M G;  3HZX A;  1X56 A;  4GS3 A;  4RHS A;  4DR1 L;  4NB3 A;  2IX0 A;  4A3B G;  2EYH A;  4LUZ A;  3DUZ A;  3A5U A;  5ISR A;  1MSH A;  2F0U A;  2KOL A;  1VQH A;  4IPG A;  5EQ0 A;  1STH A;  1LAB A;  5E4X A;  4E6I A;  4LFB L;  1O80 A;  3W1B A;  2QDB A;  3GQB A;  3NTH A;  4RFB A;  4HSP A;  1EU3 A;  1NAP A;  3E6Z X;  2BDN A;  3OWF A;  3CXC A;  3CPW A;  3TRE A;  3SGI A;  4IUV A;  2I5H A;  3TSS A;  2HT1 A;  4K6L A;  1EQR A;  3DHQ A;  1IL2 A;  2F03 A;  2EY6 A;  3S2H H;  4HJ8 A;  2B2T C;  1R9T B;  4C3I H;  1F9S A;  4UP7 A;  4X66 L;  5H1S E;  3J80 L;  1N33 L;  2VS1 A;  2I0Q A;  1KNA A;  1PTO D;  2UXB L;  1HQR D;  1MHW C;  1PH8 A;  3CCQ A;  2E2J B;  4KV6 A;  3ITP A;  1WCM B;  2AWN A;  5FLX E;  4FXG C;  1JB3 A;  3M4Y A;  4HID A;  4C56 C;  1GXD C;  3OW7 A;  3OSO A;  4JI1 Q;  5IP7 H;  1HA5 A;  5BR8 Q;  1BF4 A;  1WD1 A;  5E7N A;  1IKM A;  3Q22 A;  4QMG A;  4XYQ A;  2R92 G;  3TP8 A;  1HR0 W;  1N36 Q;  3FKI H;  4HMI A;  4LF8 L;  4A3D B;  3M4P A;  1Y1W H;  2E2I B;  2HDM A;  5NUC A;  1L0Y B;  2F0F A;  1KAB A;  2CW0 D;  4DNT B;  4IFD G;  3I91 A;  5D65 A;  3T1H L;  1I6H B;  1SE4 A;  4DFA A;  4EX5 A;  2BH2 A;  1E2V A;  1U4R A;  3TS2 A;  2JJQ A;  2JSO A;  1A63 A;  5AFW A;  5ELB A;  1C9O A;  4ZKB B;  1OXU A;  4GNX C;  4DR5 Q;  1FGU A;  2NZO A;  1KXL A;  1S5D D;  1U4P A;  4ZCK A;  1H9M A;  1E0B A;  5L37 A;  4NDX A;  1OXV A;  2KHI A;  3K6O A;  2ZJR A;  2G5D A;  1L1O C;  2Q8T A;  3BVZ A;  2Q8R E;  5C4H A;  2Z8L A;  4JW0 A;  1QVG A;  1SYC A;  3ULP A;  3MAQ A;  5HY6 A;  4XYO A;  5JJK A;  3D3R A;  2E5L L;  1CFM A;  3UE0 A;  4ZYS A;  4JI4 L;  3GTL H;  1NR2 A;  4RGM A;  2PQA A;  3S16 H;  1Y1V B;  4X65 Q;  3U50 C;  4NW2 A;  3GV3 A;  3JAM c;  4B9X A;  2KCT A;  4S3S A;  4N9T A;  4O1N A;  5M3M G;  2MQH A;  2VQF L;  2JA8 H;  5KGU A;  4A3C G;  3MXG A;  1FYC A;  5EKK A;  1M1K C;  3F2B A;  1S5F D;  3U4V A;  2KHS A;  3CCU A;  5KYL A;  2PW5 A;  2B2W C;  2VZA A;  1F2Y A;  4DUY Q;  3I3C A;  3T56 B;  3K7A B;  1BVS A;  2RF4 A;  4KKS A;  4MN3 A;  3G6E A;  2HQE A;  3QJY A;  2UUC L;  1Y8P B;  4A3E G;  1E1T A;  1CUK A;  1I50 H;  3CHB D;  4N8F A;  1A2U A;  3I4N B;  2EJG C;  2E76 C;  2HDL A;  4HJA A;  1Q8K A;  1U9R A;  1YHA A;  2B29 A;  5EJW A;  1MD2 D;  4MIU A;  4R4Q A;  1H95 A;  4WJW A;  1V1P B;  3T51 B;  2QEX A;  2K1B A;  1XPR A;  4JG2 A;  1R4P B;  4KHP L;  1P16 A;  1N32 L;  4JV5 L;  3QIA A;  1N34 Q;  3HKS A;  3C3L A;  5FO9 B;  1SFO H;  1HHV A;  1IYV A;  2A68 C;  5EPL A;  3GO5 A;  2X6L A;  1QZH A;  1MSG A;  2JA7 H;  3IFD A;  5IWA Q;  5LMN Q;  5CR3 A;  1K83 B;  3OMG A;  4JCV E;  2PCF B;  4BBS G;  5EGT A;  2QIL A;  3RN5 A;  2H5X A;  1VQL A;  1HZ9 A;  4A3I G;  2ATW A;  4JI3 L;  1I4P A;  5J39 A;  3S17 B;  1OO9 B;  3KK7 A;  2WKD A;  1CSQ A;  2JP1 A;  1GOZ A;  1PXU A;  3PO2 G;  5K5P A;  5C4X B;  2EY1 A;  1VQM A;  3CP0 A;  3PUV A;  4XIG S;  3RMH A;  4DV6 L;  4JI0 Q;  3QOL A;  5DM6 3;  3MWY W;  3VYU A;  4LFA L;  3HOU G;  2A73 B;  3QOJ A;  5CV9 A;  2RBM A;  5C5M A;  2EYP A;  4WFN 3;  1GHK A;  4NMZ A;  4MHE A;  4A3K H;  3BDC A;  3ND9 A;  2DNC A;  2H1E A;  3NWS A;  4NXM Q;  2O5I C;  2ES2 A;  3RD4 A;  3KF6 A;  4BY1 G;  3CQZ B;  3PCO B;  4A3M H;  4LF7 L;  4RGN A;  2NWG A;  4B3T Q;  4EVO A;  2OEO A;  1K0R A;  2MO1 A;  2BA1 A;  4OO1 H;  3I4M B;  2DJF C;  4A3B H;  3WWV A;  3PO3 G;  4DV0 L;  4JI5 Q;  2IX3 A;  2KQ3 A;  1KAA A;  1UEA B;  1JWS D;  4H44 C;  5KNC A;  3S2D B;  4RKL A;  5M5W H;  1D5M C;  5GAD C;  3MFY A;  4G4K A;  3LNN A;  1VMP A;  1X32 A;  2MP1 A;  4RKB A;  3TP5 A;  1BNZ A;  5GAH C;  1DJR D;  5KND A;  1K8A C;  1S4Z A;  3KDF A;  3WOE A;  1TWH B;  1SMY D;  5DNF A;  5I6W A;  4K0K L;  5CV5 A;  3G4S A;  3CAM A;  3S15 B;  4A76 A;  2JEA I;  1K28 A;  2MPM A;  4F87 A;  3IAY A;  4YWL A;  2XNA C;  2F0P A;  1NR4 A;  2D0P A;  2F0M A;  1ENC A;  1VQB A;  4A4I A;  4BBR H;  5IGF A;  1KDC A;  4Y7N B;  1TS2 A;  4BXX G;  4LF6 Q;  1WTV A;  1XX8 A;  1AP0 A;  1SNP A;  4X64 Q;  1GKH A;  2EYO A;  2K03 A;  1OXT A;  4CHT B;  2JA5 H;  2A69 D;  1EY6 A;  1D1I A;  5IYB G;  4HTH A;  2B2V C;  4R4I A;  1V9P A;  2WP8 J;  2OCE A;  2G9D A;  3PIP 3;  4JI8 Q;  1LT4 D;  2Z6K C;  4OX9 Q;  3T16 A;  1PYW D;  1SAP A;  3HOW G;  2CH4 W;  1YIJ A;  2CWA A;  1PRT B;  4B08 A;  1G6Z A;  2XRQ D;  4DAV A;  1EY7 A;  1A15 A;  2N8N A;  1HA6 A;  3W5O A;  1QB5 D;  1S5B D;  3G71 A;  4IQZ A;  4QUF A;  1R4Q B;  2ZM6 L;  1II3 A;  4A3J G;  2IY5 B;  1PTO H;  1SMX A;  5C0X J;  4HAE A;  3MA2 B;  4LUV A;  3K59 A;  1Q81 C;  1PTO C;  4GKK Q;  1XNR Q;  3MXN B;  1XTD A;  1B44 D;  1HFG A;  1JOR A;  1NMG A;  1SE2 A;  5FOB B;  1TS4 A;  3RZO B;  5I4D A;  4AH6 A;  1CZW A;  2ICI A;  2QW7 A;  5CYU A;  4HIK A;  1N9W A;  3VA5 A;  3UDG A;  3VYS A;  4DKA C;  3A0J A;  2RHQ B;  1CKN A;  2MUY A;  3DEO A;  2B63 H;  1LTA D;  4R8N A;  1LTG D;  2P5Z X;  4DNI A;  2WB1 B;  2K04 A;  1K73 C;  3GTJ B;  2BDO A;  4B3R L;  1HH2 P;  4DAY B;  5BN3 A;  1MBY A;  3I56 A;  1QNK A;  1GD7 A;  3ULJ A;  2SOB A;  2KCN A;  1L0W A;  2JA9 A;  2CW0 C;  1BKB A;  4Q0F A;  4ABN A;  1IBL Q;  4ZKC B;  3QO2 A;  1BO0 A;  4IUR A;  1XMO L;  5K36 H;  1LAC A;  2KVM A;  1RD9 D;  2RDH A;  4LF5 Q;  2E75 C;  4XQN A;  4A3E H;  1NSN S;  1X9N A;  1DYQ A;  3HGB A;  2NVQ B;  4ZUJ A;  2YYZ A;  1ICF B;  2F1M A;  2GVB A;  1T9H A;  2VXW A;  4CDD C;  1IL8 A;  2EZV A;  2NVX H;  3HOZ B;  4K14 A;  4POG A;  2DJG C;  3W2D A;  4JI4 Q;  4L5Q A;  3KYH C;  2AQ1 B;  2HCC A;  2IHE A;  2K01 A;  4BY7 B;  1STB A;  1T5X D;  1ILP A;  4A3G H;  1G6P A;  2AUK A;  4JYA L;  1PTO F;  5IYD H;  4IAL A;  4DR2 Q;  3IL8 A;  1PH5 A;  2QA4 A;  4IO9 A;  2TMP A;  1KDA A;  3E9H A;  5ELD A;  1FJG L;  3H94 A;  4TSS A;  2M00 A;  5GQO A;  5IP7 G;  1OXX K;  3A8J E;  5IGG A;  1AW7 A;  1XMQ L;  3MZ5 A;  4UP8 A;  4CDE C;  3QG1 A;  3FKI G;  1IBK L;  3GTK H;  1IKL A;  1Y1W G;  1Z6H A;  2K05 A;  3J7A 5;  1WTX A;  2B2Y A;  1Z7T A;  3GTQ B;  4LF9 Q;  4DV2 L;  1G51 A;  1CK1 A;  2ICE C;  1DOM A;  2DY7 A;  3C46 A;  3VR4 A;  1CA6 A;  1UE5 A;  4P73 A;  3GTG B;  1C0A A;  3F1Z A;  1N32 Q;  5EBC A;  1LYL A;  2K52 A;  1I4X A;  1STY A;  4HCE A;  3JAM L;  5IT9 c;  1A6X A;  1FGB D;  1JT8 A;  2HCI A;  3BYT B;  1AE2 A;  1EFI D;  3NTI A;  3EFX D;  4BBS B;  5COR A;  1Q1E A;  4DR4 L;  1KRT A;  2Y0S B;  1HZA A;  1FD7 D;  1HZC A;  3L2P A;  2UU9 L;  1EIY B;  1NUC A;  5G3L F;  4KY6 A;  2WAQ B;  3CME A;  4DU9 A;  4JBK A;  4POF A;  3OYY A;  3K0Y A;  2MO0 A;  3J7Y W;  2IJ0 A;  3G48 A;  3LGJ A;  4B3M Q;  1SNC A;  5D14 A;  2DUD A;  2EJM A;  5EAY A;  1IZ6 A;  2KEE A;  4IPD A;  5D3D A;  4G7O C;  1JMC A;  3H09 A;  1YBY A;  5IE8 A;  4C2M H;  2EJF C;  3TP6 A;  4J15 A;  5CV8 A;  4IOA A;  1SYE A;  1UE7 A;  1RTN A;  3NBH A;  4BY1 B;  3J80 E;  1YI2 A;  4IJH A;  2JA8 G;  1KTK A;  3BZD B;  5ELO A;  5EKL A;  2V4D A;  2F0J A;  2X69 A;  1EQQ A;  1RDP D;  4WOR A;  3CF5 A;  1QIL A;  3PO3 B;  2PZU A;  4KN7 C;  5FJ8 H;  4C1N I;  2EYL A;  2BH8 A;  3U9S A;  1Q46 A;  1XNQ L;  1TWC H;  3K81 C;  1DOL A;  2N49 A;  3S1M H;  1TWA H;  2PI2 A;  1SXT A;  4EQO A;  5LMU L;  4IFD J;  4RCO A;  5KIX A;  3TZD A;  2RKS A;  3CRK C;  3H91 A;  4C3H B;  4H0L C;  1UUP A;  4K6D A;  1TS3 A;  4OL7 A;  1EWH A;  2BA0 A;  2JA7 G;  1Y69 U;  1TS5 A;  3S1Q H;  1Q82 C;  1F9P A;  4QJF A;  2D2C C;  1SEB D;  1BXT A;  1SMY C;  3MEF A;  4IJL A;  2L55 A;  4M1U B;  3SK8 A;  1CA5 A;  4ULL A;  4RA8 A;  3Q24 A;  4KY5 A;  1UEB A;  1VF7 A;  1D5X C;  1OTC A;  2O5J C;  3AFP A;  2OF1 A;  1EIH A;  2NVY B;  5KNB A;  1JOO A;  2N55 A;  1TWF H;  3M3Y B;  1XXG A;  1TWG H;  3M4Q A;  5HGQ A;  3PIO 3;  3J7Z C;  3M4O H;  4MZ9 A;  4JI2 Q;  1HUM A;  1E2W A;  4A3K G;  1HNX L;  2Z0S A;  3KF8 B;  1W3S A;  1EQT A;  4GOP A;  1Q8I A;  2MHV A;  2A69 C;  3CPF A;  2VQE L;  4XQQ A;  3VYT A;  1QUQ B;  3J80 i;  4UP9 A;  4L5R C;  1UWV A;  5A2Q L;  2DY8 A;  4OO1 G;  3CRL C;  3HOV G;  4I7A A;  2VUM B;  3SVM A;  3IKJ A;  2OTJ A;  1I3Q B;  1QG7 A;  1SRU A;  1PRT D;  3NEL A;  4K5W A;  5IY0 A;  3SHL A;  3ZYY X;  2AHO B;  4HJ5 A;  1GUS A;  3NXW A;  3J7A F;  1EYG A;  5FLM H;  3R2I A;  1R9T H;  1B50 A;  4JI7 L;  1DM0 B;  3HOY H;  5IYC H;  3ZJY C;  2RDG A;  1LT5 D;  3DXJ C;  2FMC A;  4KHZ A;  3S1N B;  4DV5 Q;  1STG A;  2IL8 A;  3D4W A;  2F0Q A;  3I72 A;  1YIT A;  1EL0 A;  3LWU A;  1WCM H;  3I90 A;  1B70 B;  3S14 H;  4PQX A;  4DV3 Q;  4JI6 L;  3KJP A;  2VB2 X;  3PGZ A;  3SE0 A;  1JR0 D;  2E2D C;  5JEA H;  1EYD A;  2Z9H A;  4C3J B;  3S9W A;  3UI2 A;  2PI2 E;  2MGS A;  5J22 A;  1A0I A;  1AH9 A;  4BA2 I;  3A5Z B;  4BBR G;  4TQU S;  2F4V L;  3MFG A;  3EVQ A;  4DK6 C;  2E2I H;  2EDG A;  2F0T A;  2RDF A;  3OTO Q;  3K5M A;  1VQC A;  3H6M A;  4GKJ Q;  1EWI A;  5ELN A;  4YHH Q;  4A93 H;  5FK9 C;  3I4L A;  3KBG A;  3P20 A;  3RLF A;  4NXN L;  1AFP A;  2HUG A;  2JA5 G;  1NBW A;  1CSP A;  3BU2 A;  2B2T A;  2OTL A;  3U4Z A;  4XDX A;  4KY7 A;  5CBE E;  1JE5 A;  1I6H H;  2IPK D;  4CJ2 C;  1A3T A;  1K8M A;  3W3A A;  3S2H B;  2UXD L;  1G8Z D;  4CKE A;  1JQY D;  1CKM A;  4C3I B;  3I2Z A;  3NTK A;  1MJC A;  1DXM A;  1D1K A;  4LMQ D;  5AJ3 L;  3F2D A;  3C2P A;  4FF2 A;  5C3E H;  1VQ8 A;  4DV7 Q;  1HNW Q;  2K50 A;  1DGS A;  1B53 A;  4HMJ A;  1B2T A;  4MTN A;  1JJC B;  1G29 1;  4JYA Q;  2Q2T A;  2YU9 H;  3J81 c;  1FNU A;  4FO2 A;  4IUU A;  5M3F H;  2H4O A;  1FJG Q;  1ENA A;  2JA6 G;  3S1R H;  1KLG D;  1GO3 E;  1HTP A;  1KRS A;  4LF4 L;  3N6R A;  5IGC A;  3PIP A;  3FKI B;  1V1O A;  4QB4 A;  2DGY A;  1Y1W B;  3TP7 A;  4DR7 Q;  1KD1 C;  4DXG A;  1H9J A;  1A62 A;  2AUJ D;  4LUO A;  4GNX A;  3FHW A;  4IUQ A;  1S5C D;  1SE3 A;  1RJT A;  1ASZ A;  2B63 G;  4QL5 A;  3HKZ B;  1EIF A;  4DR6 L;  2VY3 A;  1VQG A;  2PQA B;  4YCV A;  1E24 A;  1PMR A;  3FVQ A;  2L15 A;  2I5M X;  2LFN A;  4G57 A;  4RMF A;  2BE5 D;  2EXD A;  1W6K A;  1L1O A;  3BDO A;  5LHY 1;  1X65 A;  2EXZ A;  1WJJ A;  3EBE A;  2XRS D;  5IOD A;  3NP8 A;  1HR0 L;  2XTI A;  4OEL B;  5K36 G;  3P75 A;  2XIW A;  4A3F B;  3T1Y Q;  4AYB G;  5CV7 A;  4KD3 A;  5CMD A;  1KAW A;  3SK4 A;  3D6C A;  1BCP D;  2O4X A;  2B8G A;  2FFK B;  2FIN B;  2MJ8 A;  3GTL B;  3PUX A;  3KFU A;  2B3G A;  3S16 B;  3AQQ A;  3GP7 A;  1PH6 A;  5I9O A;  1K83 H;  2KCM A;  2B39 A;  2N78 A;  3PSI A;  2B2W A;  2R61 A;  2QDL A;  2ZJQ A;  2NN6 H;  3BYY B;  4DUZ Q;  3H15 A;  1ASY A;  4A3G G;  3S17 H;  4HJ9 A;  4FF3 A;  1CZG A;  4DR3 L;  5GRO A;  5IYD G;  3VA7 A;  4RWS C;  4LK1 C;  3B6Y A;  3GTM B;  1J9O A;  1M4V A;  3D0F A;  1AN8 A;  4JBM A;  5C4X H;  4H7B A;  1X55 A;  2BOS A;  4UHV A;  3QR8 A;  1J5E Q;  4QCL A;  2QKI C;  2L0C A;  3KLS X;  1CKO A;  3PUY A;  1H9K A;  5IT9 L;  4DV1 L;  4Q5V A;  1F2L A;  4X62 Q;  4F8M A;  4LW1 A;  3CCS A;  1EOV A;  1PH3 A;  2EOT A;  1U5K A;  2JYO A;  2HHH L;  5I9P A;  2WKC A;  5D3I B;  4DV4 Q;  3A8I E;  1ONL A;  2XN9 C;  2QEJ C;  2Q8I B;  1SFO B;  3V2T A;  1GHJ A;  4LFC Q;  5M5X B;  1SJH D;  4QIW E;  2J7Z A;  1P8L A;  3HFZ B;  2A8V A;  1Y14 B;  3IRB A;  1G2S A;  2OXP A;  3KF6 B;  2Z6B A;  1MJE A;  3HOV H;  1SSO A;  2F3V A;  4DXF A;  1PH4 A;  1O7Y A;  2UUA Q;  3X3N A;  3PMF A;  1WI5 A;  3V05 A;  1TWH H;  3KLS A;  3ERO A;  3E5S A;  2R3Z A;  3IFT A;  3NEM A;  4FDB A;  4OXP A;  1G91 A;  2OWO A;  1YNN D;  4G7H C;  1IBM Q;  2CCZ A;  5DM7 3;  1PH2 A;  5C4J H;  1LTI D;  2QCP X;  3OIP A;  1I94 Q;  2VB3 X;  1RL2 A;  1NNX A;  5J1Z A;  5E3F A;  5C44 B;  1GJX A;  3D4D A;  3A74 A;  4NP5 A;  3MC0 B;  3GDE A;  4KKU A;  4KLK A;  5KYI A;  4A3M B;  2ASB A;  3HOX H;  1SYB A;  4HSV A;  4YY3 L;  2K5V A;  1IXR A;  3WOF A;  2R93 H;  1ZYR D;  4A3B B;  2ZJP A;  3HP3 A;  5FJ8 G;  1VMC A;  1GUO A;  4K2K A;  4U68 A;  2LY7 A;  4DR1 Q;  1U0L A;  2R6G A;  2AQ2 B;  1YEZ A;  2PMZ E;  1JJG A;  2UUB L;  1Q1B A;  2EYM A;  4RGO S;  1HUN A;  4LFB Q;  2E2H H;  1JE4 A;  4R4T A;  3BG3 A;  1PRT C;  1O7I A;  3R8B A;  4JI7 Q;  2A19 A;  4X3K A;  4JVZ A;  3AB9 A;  4ZRZ A;  4O2D A;  3K7U C;  1ILQ A;  3PF5 A;  4KJO A;  1QZG A;  4FXD A;  2AKW B;  4ZUI A;  3FRP B;  2G9H D;  2UXC L;  3ONA B;  4FYD A;  1EFW A;  3URY A;  1XWE A;  1T5E A;  3E0E A;  2CVR A;  3EA6 A;  4X66 Q;  2K6A A;  2L1B A;  3JAM E;  1S72 A;  4R4O A;  1N33 Q;  4QF4 A;  5FO8 B;  2UXB Q;  3LX0 A;  3LWE A;  1H9R A;  2IX1 A;  1ROD A;  3AU7 A;  1VQI A;  1ZEQ X;  3RNU A;  2B2V A;  1VS0 A;  3F2C A;  3KJO A;  3EJI A;  5TSS A;  5IOC A;  4IPH A;  2JA5 B;  3Q0A A;  2Z6K A;  2F0K A;  4L6T B;  2JA6 H;  2R92 B;  4P74 A;  4CJ0 B;  3GTO B;  1F77 A;  2JN4 A;  3GTJ H;  1EQV A;  2I07 B;  4OWX B;  3RLO A;  3D4R A;  1RF2 D;  1LV9 A;  1ET9 A;  3MXN A;  4LF8 Q;  1CQF A;  1A2T A;  2UXD Q;  1Q90 A;  2A74 C;  4PV1 C;  4DA2 A;  4HR7 B;  1F2M A;  1LTB D;  4X3S A;  2CQA A;  2C35 B;  2ZXP A;  1HCZ A;  2Z1C A;  3T1H Q;  3WDN A;  3HRZ C;  4ME5 A;  4APV A;  1J6Q A;  1MI2 A;  1KNE A;  1PRT F;  4J1M A;  5FLM G;  2Z4I A;  3DM3 A;  1EEI D;  4OHJ A;  3HOZ H;  4IUP A;  4ZLT F;  1K8G A;  1D7Q A;  3NHH A;  2OQK A;  3STB D;  4DAY A;  4BY7 H;  1WFQ A;  1QE6 A;  3HOY G;  5IYC G;  3PQI A;  2FXQ A;  1DZ1 A;  2MFI A;  4R4C A;  1TQO A;  1U4M A;  4N9P A;  4GLX A;  1XYI A;  4PMC A;  5ELF A;  2EY2 A;  1WCM G;  5BR8 L;  4KJN A;  1S5E D;  2PZT A;  3K0X A;  4X3T A;  2B63 B;  2E5L Q;  4UDU C;  5M3M B;  5JEA G;  4X3U A;  1IW7 D;  4JK1 C;  1N36 L;  4JOI C;  1EEF D;  1EY0 A;  1DD2 A;  3MTS A;  4JPB W;  4P72 A;  2VQF Q;  4A3D G;  3JAM i;  1SLJ A;  2A6H D;  1SYD A;  2PO4 A;  3OOC A;  5I6Y A;  1HNZ L;  4A93 G;  3VDY A;  5C0X I;  4C1N K;  1X3P A;  4HED A;  3T53 B;  2BCO A;  2F0S A;  3TEH B;  2BE5 C;  1B8A A;  3KOJ A;  4A3E B;  2M9V A;  3BS1 A;  3DWP A;  3OPO A;  1I6V C;  1FNW A;  3RUZ A;  2Q2U A;  4DR5 L;  2PQE A;  1CM9 A;  2UUC Q;  1E1O A;  5DEH A;  3J81 L;  4AIM A;  1TR5 A;  1C4Q A;  4Z9C B;  2NVX B;  4ODG A;  1EY8 A;  1TKW B;  5JJL A;  1WTO A;  1BCP C;  4KHP Q;  4JV5 Q;  1YJ9 A;  5C3E G;  4HIM A;  2F0G A;  1VQE A;  5JJZ A;  3DWQ A;  5A2Q E;  1LM0 A;  1BDO A;  4X65 L;  4QGU A;  1AEX A;  3O13 A;  1JJ2 A;  4K8J A;  1BCP B;  5HGT A;  1PYS B;  5C4Z A;  4CKB A;  2ZTE A;  4A3I B;  5M3F G;  4XT3 B;  3OMC A;  1KLU D;  1FL0 A;  2ZTC A;  5FLX c;  1VQN A;  3TME A;  3GTK B;  3PO2 B;  3JC6 6;  4B3S L;  3C1E A;  4JI3 Q;  4DUY L;  4YIJ A;  1HXY D;  1V43 A;  3A55 A;  4QY7 A;  4TRD A;  3CKI B;  1WTQ A;  3L7Z C;  3HOU B;  4NKL A;  4DV6 Q;  2XVS A;  3M7G A;  1WTP A;  1SYF A;  5IP9 H;  1ENF A;  3SK5 A;  1LUZ A;  4LFA Q;  1JOQ A;  1NTG A;  1NCV A;  1QCB D;  1MGS A;  4JC0 A;  1SND A;  1SNQ A;  3J81 j;  1M8A A;  1CI3 M;  4KKT A;  5LL6 X;  3KLW A;  1S40 A;  1E3P A;  1N34 L;  3H0G H;  3OWE B;  4LF7 Q;  2F0L A;  1ZXT A;  4KHV A;  3NK9 A;  3VR2 A;  5IWA L;  2R7Z H;  4DV0 Q;  5LMN L;  1B9M A;  1BBW A;  3M9B A;  3MVV A;  3UDX A;  3K5N A;  1DCZ A;  2NZH A;  5ELC A;  3I4O A;  3NSW A;  3L0O A;  4EQP A;  3GTP B;  3U9O A;  1EY9 A;  1D2B A;  4MNO A;  4C2M B;  4AYB E;  1KL9 A;  4DK1 A;  2NBF A;  3R3O A;  2PNR C;  2NN6 G;  1STE A;  1GUN A;  1XTC D;  1WTW A;  2L12 A;  1A3V A;  1Z9F A;  3DLL A;  1YNN C;  4OGQ C;  4JI0 L;  3AEV A;  2F52 A;  4J6H A;  4PG3 A;  4V0B A;  2NVT B;  4K0K Q;  2N3S A;  2NVY H;  4F88 A;  1BOS A;  1BBU A;  1H9S A;  2K28 A;  3FMC A;  3CCJ A;  5C4X G;  5C5L A;  2F0E A;  4GN5 A;  2GN5 A;  3I70 A;  4YWM A;  2PPB C;  2F4I A;  4NXM L;  1VQP A;  1CQV A;  3MEH A;  1QWY A;  5M5Y H;  4GN3 B;  3L9A X;  1SE8 A;  1NMF A;  2VNU D;  1TWC B;  1TXY A;  5KEE A;  4B3T L;  1VQ6 A;  3S1M B;  2YTY A;  1HQM C;  2K5D A;  2O2L D;  1NJI C;  3NPP A;  1LTL A;  4KI0 A;  4P71 A;  4JI5 L;  4ZK9 B;  1A8V A;  4A3L H;  1OXS C;  1C48 A;  5F2D A;  4HN7 A;  3I4M G;  1TVX A;  1I4H A;  1SN8 A;  2TSS A;  4GLA C;  2D9U A;  3G6J B;  1YNJ D;  1SRO A;  3TQY A;  3HOW B;  3S1Q B;  3OW2 A;  3HG9 A;  2CWP A;  3E3X A;  4OEM B;  3H3V I;  4L5S A;  2AQ3 B;  3R2T A;  4GOP B;  2Y0S E;  4PZ7 A;  2GVA A;  2NB0 A;  1ET6 A;  1EYC A;  1TII D;  1E7Z A;  3KF8 A;  2WAQ E;  3U58 A;  3J7A V;  4K8I A;  5J3B A;  2XWB B;  3Q23 A;  3RZD B;  2ZXO A;  4A3J B;  2F0W A;  1QUQ A;  4J8Q A;  2LS0 1;  4JBJ A;  4PMW A;  2A6E D;  1VQK A;  2ZM6 Q;  1PH7 A;  2RCF A;  5IGD A;  4WJ4 A;  3G7L A;  1TWF B;  1B1Z A;  1YJN A;  2EYJ A;  1TWG B;  3M4O B;  1BBX C;  4UPA A;  4IPC A;  4IFD I;  4X6A H;  1F2Z A;  4YCU A;  4C3J H;  4RH6 A;  3E0J A;  4LF6 L;  1D8L A;  1SYG A;  1WTR A;  3AMU A;  2ZT9 C;  4X64 L;  2E2J H;  4GZY C;  2LXK A;  2KCC A;  3HOX G;  2KBN A;  2SEB D;  2K75 A;  4LAA A;  1UNS A;  2Z4H A;  2R93 G;  4RHR A;  3PUZ A;  1AE3 A;  2YV5 A;  4JI8 L;  1QNU A;  1RKN A;  4WJ3 M;  3GV6 A;  1U4L A;  4OX9 L;  1E22 A;  4RGT A;  4NPS A;  4A3D H;  1SJE D;  1K8O A;  4CJ1 B;  4B3R Q;  3KBX A;  4IUT A;  3CD6 A;  1AZQ A;  2HIV A;  2F0H A;  3VR5 A;  5IT9 E;  3P1H A;  3K80 C;  3HOY B;  2N88 A;  1XMO Q;  2NTS A;  3HS0 C;  2RQX A;  3I55 A;  2K5W A;  3CCM A;  3NBI A;  4GKK L;  4HIO A;  1XNR L;  3S14 B;  3K5L A;  1QOH A;  2LMC B;  3STB C;  2LXJ A;  2VW9 A;  1FVI A;  5CBA E;  3K8A A;  2F3I A;  1QJO A;  4I7Z C;  2IHF A;  4KK7 A;  4LJZ C;  1STN A;  1PHJ A;  5FO7 B;  3CW2 C;  1EOT A;  1SNM A;  3AYH B;  1PZI D;  3VR3 A;  4A93 B;  3KLR A;  2K5N A;  1IW7 C;  3HEJ A;  2KA7 A;  1Y1V H;  4H13 C;  1HNZ Q;  1LT3 D;  3BZC A;  3SR1 A;  4N8X 1;  4QIW B;  2WB1 G;  2A6H C;  1XMQ Q;  1IBL L;  1V8Q A;  2HIX A;  3CC7 A;  4IOC A;  2WII B;  3CMA A;  1PA6 A;  1K3B C;  1IBK Q;  4LNQ A;  4BA1 I;  2R7D A;  5G3L D;  4LF5 L;  3ICE A;  3K7A H;  1TU2 B;  1ESR A;  3SK6 A;  2K32 A;  4DV2 Q;  4O0A A;  1B9N A;  4A3F H;  4OWW B;  5C3E B;  2RA4 A;  4GNX B;  1FNV A;  5BN5 A;  1Q86 C;  1RTO A;  3QB3 A;  4FXK C;  5C3X A;  2K4K A;  3I4N H;  4ALP A;  4CKC A;  2CH4 A;  3W1G A;  4BWG B;  1ESF A;  5C0X H;  4DGZ A;  4AQY L;  2YU9 B;  3HOZ G;  1L1O B;  5M3F B;  3S1R B;  1XPO A;  3M7N A;  4DR4 Q;  1B3A A;  3UDF A;  2UU9 Q;  4CDF C;  4BY7 G;  2EQS A;  1I4Q A;  4DR2 L;  2I5L X;  4CBV A; 
#chains in the Genus database with same CATH homology
 1Z47 A;  4XTC S;  2WAC A;  1HTL D;  5CV6 A;  3DEP A;  5C3W A;  3P7J A;  2SNS A;  2WV6 D;  1O7L A;  1IHZ A;  2AWO A;  1CTM A;  2L11 A;  3SXH A;  4PMB A;  3A7L A;  2JA8 B;  1L0X B;  2IT1 A;  4KMU C;  1V1P A;  4K5X A;  2F0N A;  1PZK D;  3A8K E;  2A5H A;  2PMZ B;  4DN4 M;  5FKA C;  1GUW A;  1EYA A;  1EZ6 A;  3SEB A;  5T1G A;  2ZXR A;  1UAP A;  4FF1 A;  1LTS D;  1I50 B;  1PFB A;  1E2Z A;  5I2Y A;  4IZ8 A;  1CHP D;  1RHP A;  5JPM C;  4F7X A;  3D6W A;  2K7V A;  3FDT A;  5FLX L;  2NYZ D;  1B4O A;  2M2L A;  2QF7 A;  2B2U C;  5HUR A;  1F9R A;  2PZW A;  2JA7 B;  3I73 A;  3T4A C;  2RVL A;  4ID6 A;  4P2C B;  4OIK A;  2ID0 A;  2NTT A;  1D6E C;  5JVG 3;  2PW7 A;  3NUC A;  2F0I A;  1Y8N B;  2FHT A;  1CHQ D;  4CGY B;  2B2U A;  4DK0 A;  4K2L A;  4OIJ A;  1VCI A;  2B8F A;  2LKV A;  4XXE A;  2NUC A;  5JEA J;  4A3K B;  1TY2 A;  4PNY A;  1HRJ A;  4UAI A;  1BR9 A;  2C9O A;  1PFN A;  5EPJ A;  1TY0 A;  2K33 A;  5KRU A;  1Q12 A;  3X3M A;  1AZP A;  3HOV B;  2OT2 A;  3NE5 B;  3ND8 A;  1JOK A;  1YNJ C;  1LLR D;  1GUT A;  2J4X A;  3DWA A;  1G2T A;  4C3H G;  1Y8O B;  1IYU A;  5CGK A;  5M5W B;  3FPP A;  1GUG A;  3NQI A;  1KDB A;  5CC4 A;  5C4J B;  3J81 E;  1HFN A;  3C1F A;  2FMM A;  1EWC A;  2A6E C;  5EPK A;  3GD7 A;  2JE6 I;  3HOX B;  2JXM B;  4DF7 A;  1ZKO A;  3H3V C;  5E1F A;  5LL6 S;  2R93 B;  2X6G A;  1PZJ D;  2SNM A;  4FP5 D;  4BBR B;  1SDF A;  1VDZ A;  5CV4 A;  3NQT A;  4FF4 A;  2D5D A;  5ELE A;  2JEB I;  4FVM A;  4R8I A;  2E2H B;  4IFD H;  3ERQ A;  5A35 A;  3A56 A;  2J0T D;  2IWH A;  5JOB A;  2F0D A;  1FR3 A;  3R93 A;  5JPN C;  1PLF A;  3N52 A;  2RSN A;  2KEC A;  3QWN A;  4BS9 A;  1PTO B;  1C8C A;  2GA4 B;  4KN4 C;  1EIG A;  1I4G A;  1W6J A;  2JA6 B;  3MXU A;  4IUN A;  4C3J G;  5EBD A;  5M9O A;  2EE1 A;  3PUW A;  3NWT A;  3BVM A;  4M8A A;  3CU7 A;  5DAU A;  3FPU B;  3BDL A;  4WRD A;  4L63 B;  3K58 A;  4IN3 A;  2EVB A;  2SDF A;  3TDQ A;  3D8G A;  2NZ1 D;  3OIQ A;  4C3I G;  2XWJ B;  2E74 C;  4U67 3;  1EZ8 A;  4AYB B;  1X3Q A;  3V96 A;  2B2Y C;  1I4R A;  4B9W A;  4DNR B;  1DON A;  1BQQ T;  1EU4 A;  5I2X A;  3KUP A;  2RSO A;  4A3G B;  1JCK B;  1CT1 D;  2K5Q A;  1EY4 A;  1WD0 A;  4K5V A;  3MHB A;  2KUM A;  5COY A;  4JBW A;  3A54 A;  5BN4 A;  1WVL A;  3DM1 A;  1D5Z C;  4L8J A;  4ZQ3 A;  1Q3L A;  2NN6 I;  2IW3 A;  5T1I A;  4RCN A;  4DAP A;  1PFM A;  2F0O A;  2EYF A;  2WIN B;  3TZU A;  3L3O C;  1LO5 D;  2ENB A;  1SBB B;  3F2U A;  1LT6 D;  1LTR D;  3A7A B;  1DOK A;  4XT1 B;  2F3W A;  2A68 D;  2KJX A;  3I8Z A;  4G7Z C;  5C0X G;  1O78 A;  3OHX C;  3SDZ A;  4EGV A;  1JWM D;  4TKO B;  3VR6 A;  2KED A;  1BCP F;  3TN2 A;  3M85 A;  4V19 0;  2C5C A;  2FJ2 A;  1STA A;  1JIC A;  1PDQ A;  3MXP A;  4OO1 I;  5IIF A;  4FNF A;  4XQJ A;  5E4W C;  4I65 A;  1ML0 D;  5IGE A;  3Q6S A;  3TBI B;  1HPC A;  4EQN A;  4ILW A;  1A3U A;  3EQL C;  2CHB D;  3T13 A;  4QUC A;  3H0G B;  5JAV A;  3PV0 A;  1J8I A;  1H9S B;  2EY5 A;  2I46 A;  2L9H A;  5JVH 3;  2F0V A;  2R7Z B;  5C6A A;  4R9W A;  2DNE A;  1TWA B;  1ZYR C;  3BVG A;  3D31 A;  3DMU A;  1O7Z A;  1VF5 C;  3K57 A;  2EPB A;  2L5T A;  5EKI A;  2L4N A;  4O42 A;  1EY5 A;  5IGB A;  4ZAI A;  1JC7 A;  4KD4 A;  3VYR A;  1F9Q A;  1ICW A;  1BUV T;  3K5O A;  4HCS A;  2D62 A;  4RAU C;  2DN8 A;  1RCV D;  3FEW X;  5M5Y B;  2PYK A;  1TT2 A;  1LTT D;  1SNO A;  1JWU D;  4KTA A;  2XSC A;  3HZX A;  4RHS A;  2IX0 A;  2EYH A;  3DUZ A;  5ISR A;  1MSH A;  2F0U A;  2KOL A;  5EQ0 A;  1STH A;  1LAB A;  5E4X A;  4E6I A;  1O80 A;  2QDB A;  3GQB A;  3NTH A;  4RFB A;  4HSP A;  1EU3 A;  1NAP A;  3E6Z X;  2BDN A;  3OWF A;  4IUV A;  3TSS A;  4K6L A;  3DHQ A;  2F03 A;  2EY6 A;  2B2T C;  1R9T B;  1F9S A;  3J80 L;  1KNA A;  1PTO D;  1HQR D;  2E2J B;  4KV6 A;  3ITP A;  1WCM B;  2AWN A;  5FLX E;  4FXG C;  1JB3 A;  3M4Y A;  4C56 C;  1GXD C;  3OW7 A;  3OSO A;  1HA5 A;  1BF4 A;  1WD1 A;  1IKM A;  3Q22 A;  4QMG A;  4XYQ A;  3TP8 A;  4HMI A;  4A3D B;  2E2I B;  2HDM A;  5NUC A;  1L0Y B;  2F0F A;  1KAB A;  2CW0 D;  4DNT B;  4IFD G;  3I91 A;  5D65 A;  1I6H B;  1SE4 A;  4DFA A;  1E2V A;  1U4R A;  2JSO A;  5AFW A;  5ELB A;  4ZKB B;  1OXU A;  1S5D D;  1U4P A;  1H9M A;  1E0B A;  4NDX A;  1OXV A;  3K6O A;  2Q8T A;  3BVZ A;  2Q8R E;  5C4H A;  2Z8L A;  1SYC A;  3MAQ A;  4XYO A;  3D3R A;  1CFM A;  4ZYS A;  1NR2 A;  4RGM A;  1Y1V B;  4NW2 A;  3GV3 A;  4B9X A;  4S3S A;  4N9T A;  4O1N A;  5KGU A;  3MXG A;  1FYC A;  5EKK A;  1S5F D;  2KHS A;  5KYL A;  2PW5 A;  2B2W C;  1F2Y A;  3I3C A;  3T56 B;  3K7A B;  4KKS A;  4MN3 A;  2HQE A;  3QJY A;  1Y8P B;  3CHB D;  1A2U A;  3I4N B;  2EJG C;  2E76 C;  2HDL A;  1U9R A;  5EJW A;  1MD2 D;  4MIU A;  4WJW A;  1V1P B;  3T51 B;  2K1B A;  1R4P B;  3QIA A;  3C3L A;  5FO9 B;  1HHV A;  1IYV A;  2A68 C;  5EPL A;  3GO5 A;  2X6L A;  1MSG A;  3IFD A;  5CR3 A;  1K83 B;  3OMG A;  2PCF B;  5EGT A;  2QIL A;  1I4P A;  5J39 A;  3S17 B;  1OO9 B;  3KK7 A;  2WKD A;  2JP1 A;  1GOZ A;  1PXU A;  5K5P A;  5C4X B;  2EY1 A;  3PUV A;  3RMH A;  4XIG S;  3QOL A;  5DM6 3;  3MWY W;  3VYU A;  2A73 B;  3QOJ A;  5CV9 A;  2RBM A;  5C5M A;  2EYP A;  4WFN 3;  1GHK A;  4NMZ A;  4MHE A;  3BDC A;  3ND9 A;  2DNC A;  2H1E A;  3NWS A;  2O5I C;  3RD4 A;  3CQZ B;  4RGN A;  2NWG A;  4EVO A;  2OEO A;  2BA1 A;  4OO1 H;  3I4M B;  2IX3 A;  2KQ3 A;  1KAA A;  1UEA B;  1JWS D;  4H44 C;  5KNC A;  3S2D B;  4RKL A;  1D5M C;  3MFY A;  4G4K A;  3LNN A;  1VMP A;  1X32 A;  2MP1 A;  4RKB A;  3TP5 A;  1BNZ A;  1DJR D;  5KND A;  1S4Z A;  3WOE A;  1TWH B;  1SMY D;  5DNF A;  5I6W A;  5CV5 A;  3S15 B;  2JEA I;  2MPM A;  4F87 A;  3IAY A;  2XNA C;  2F0P A;  1NR4 A;  2F0M A;  1ENC A;  5IGF A;  1KDC A;  4Y7N B;  1TS2 A;  1WTV A;  1XX8 A;  1AP0 A;  1SNP A;  2EYO A;  2K03 A;  1OXT A;  4CHT B;  2A69 D;  1EY6 A;  1D1I A;  4HTH A;  2B2V C;  2WP8 J;  2G9D A;  3PIP 3;  1LT4 D;  3T16 A;  1PYW D;  1SAP A;  1PRT B;  4B08 A;  1G6Z A;  2XRQ D;  4DAV A;  1EY7 A;  1A15 A;  1HA6 A;  1QB5 D;  1S5B D;  4IQZ A;  4QUF A;  1R4Q B;  1II3 A;  1PTO H;  5C0X J;  4HAE A;  3MA2 B;  3K59 A;  1PTO C;  1B44 D;  1HFG A;  1JOR A;  1SE2 A;  5FOB B;  1TS4 A;  3RZO B;  5I4D A;  1CZW A;  2ICI A;  5CYU A;  3VA5 A;  3VYS A;  2MUY A;  3DEO A;  1LTA D;  4R8N A;  1LTG D;  2WB1 B;  2K04 A;  3GTJ B;  2BDO A;  5BN3 A;  1MBY A;  1QNK A;  2SOB A;  2KCN A;  4Q0F A;  2CW0 C;  4ABN A;  4ZKC B;  3QO2 A;  1BO0 A;  4IUR A;  5K36 H;  1LAC A;  2KVM A;  1RD9 D;  2RDH A;  2E75 C;  4XQN A;  1NSN S;  1DYQ A;  3HGB A;  2NVQ B;  4ZUJ A;  2YYZ A;  2F1M A;  2VXW A;  1IL8 A;  2EZV A;  3HOZ B;  4K14 A;  3W2D A;  2AQ1 B;  2HCC A;  2K01 A;  4BY7 B;  1STB A;  1T5X D;  1ILP A;  2AUK A;  1PTO F;  4IAL A;  3IL8 A;  2TMP A;  1KDA A;  5ELD A;  3H94 A;  4TSS A;  2M00 A;  1OXX K;  3A8J E;  5IGG A;  1AW7 A;  3MZ5 A;  3QG1 A;  1IKL A;  1Z6H A;  2K05 A;  1WTX A;  2B2Y A;  1Z7T A;  3GTQ B;  1CK1 A;  2ICE C;  1DOM A;  2DY7 A;  3C46 A;  3VR4 A;  1CA6 A;  3GTG B;  5EBC A;  1I4X A;  1STY A;  4HCE A;  3JAM L;  1A6X A;  1FGB D;  2HCI A;  3BYT B;  3NTI A;  1EFI D;  4BBS B;  3EFX D;  5COR A;  1Q1E A;  2Y0S B;  1FD7 D;  1NUC A;  5G3L F;  4KY6 A;  2WAQ B;  4DU9 A;  3K0Y A;  3J7Y W;  2IJ0 A;  1SNC A;  5D14 A;  2EJM A;  2KEE A;  5D3D A;  4G7O C;  3H09 A;  2EJF C;  3TP6 A;  5CV8 A;  1SYE A;  1RTN A;  3NBH A;  4BY1 B;  3J80 E;  1KTK A;  3BZD B;  5EKL A;  2V4D A;  2F0J A;  2X69 A;  1RDP D;  4WOR A;  1QIL A;  3PO3 B;  2PZU A;  4KN7 C;  4C1N I;  2EYL A;  3U9S A;  1DOL A;  1SXT A;  4EQO A;  4IFD J;  4RCO A;  5KIX A;  3TZD A;  2RKS A;  3CRK C;  3H91 A;  4C3H B;  4H0L C;  1UUP A;  4K6D A;  1TS3 A;  4OL7 A;  1EWH A;  2BA0 A;  1Y69 U;  1TS5 A;  1F9P A;  2D2C C;  1SEB D;  1BXT A;  1SMY C;  2L55 A;  4M1U B;  3SK8 A;  1CA5 A;  4ULL A;  4RA8 A;  3Q24 A;  4KY5 A;  1VF7 A;  1D5X C;  2O5J C;  2OF1 A;  1EIH A;  2NVY B;  5KNB A;  1JOO A;  2N55 A;  3M3Y B;  1XXG A;  3PIO 3;  1HUM A;  1E2W A;  1EQT A;  1Q8I A;  2MHV A;  2A69 C;  4XQQ A;  3VYT A;  5A2Q L;  2DY8 A;  4OO1 G;  3CRL C;  2VUM B;  3SVM A;  3IKJ A;  1I3Q B;  1QG7 A;  1PRT D;  4K5W A;  3SHL A;  3ZYY X;  1GUS A;  3NXW A;  3J7A F;  3R2I A;  1B50 A;  1DM0 B;  2RDG A;  1LT5 D;  3DXJ C;  2FMC A;  4KHZ A;  3S1N B;  1STG A;  2IL8 A;  3D4W A;  2F0Q A;  3I72 A;  1EL0 A;  3LWU A;  3I90 A;  4PQX A;  2VB2 X;  3SE0 A;  1JR0 D;  2E2D C;  5JEA H;  1EYD A;  4C3J B;  3S9W A;  3UI2 A;  2MGS A;  5J22 A;  4BA2 I;  4TQU S;  3MFG A;  3EVQ A;  2EDG A;  2F0T A;  2RDF A;  3K5M A;  3H6M A;  5FK9 C;  3I4L A;  3KBG A;  3P20 A;  3RLF A;  1AFP A;  2HUG A;  2B2T A;  4XDX A;  4KY7 A;  5CBE E;  2IPK D;  4CJ2 C;  1A3T A;  1K8M A;  3W3A A;  3S2H B;  1G8Z D;  4CKE A;  1JQY D;  4C3I B;  3NTK A;  1DXM A;  1D1K A;  4LMQ D;  3C2P A;  4FF2 A;  1B53 A;  4HMJ A;  1B2T A;  1G29 1;  1FNU A;  4FO2 A;  4IUU A;  2H4O A;  1ENA A;  1KLG D;  1HTP A;  5IGC A;  3N6R A;  3FKI B;  1V1O A;  4QB4 A;  1Y1W B;  3TP7 A;  4DXG A;  1H9J A;  2AUJ D;  4IUQ A;  1S5C D;  1SE3 A;  1RJT A;  3HKZ B;  1PMR A;  3FVQ A;  2LFN A;  4G57 A;  2BE5 D;  1W6K A;  3BDO A;  5LHY 1;  2EXZ A;  2XRS D;  5IOD A;  3NP8 A;  5K36 G;  3P75 A;  2XIW A;  4A3F B;  5CV7 A;  4KD3 A;  5CMD A;  3SK4 A;  3D6C A;  1BCP D;  2O4X A;  2B8G A;  2FFK B;  2FIN B;  2MJ8 A;  3GTL B;  3PUX A;  3S16 B;  3GP7 A;  5I9O A;  2B39 A;  2B2W A;  2R61 A;  2NN6 H;  3BYY B;  4FF3 A;  1CZG A;  3VA7 A;  4RWS C;  4LK1 C;  3GTM B;  1J9O A;  1M4V A;  1AN8 A;  4H7B A;  2BOS A;  4QCL A;  2QKI C;  2L0C A;  3KLS X;  3PUY A;  1H9K A;  5IT9 L;  4Q5V A;  1F2L A;  4F8M A;  2EOT A;  2JYO A;  5I9P A;  2WKC A;  5D3I B;  3A8I E;  1ONL A;  2XN9 C;  2QEJ C;  2Q8I B;  1SFO B;  3V2T A;  1GHJ A;  5M5X B;  1SJH D;  2J7Z A;  1G2S A;  2OXP A;  1SSO A;  2F3V A;  4DXF A;  1O7Y A;  3X3N A;  3PMF A;  3V05 A;  3KLS A;  3ERO A;  3E5S A;  2R3Z A;  3IFT A;  1G91 A;  1YNN D;  4G7H C;  5DM7 3;  1LTI D;  2QCP X;  3OIP A;  2VB3 X;  5J1Z A;  5E3F A;  5C44 B;  1GJX A;  3D4D A;  4NP5 A;  3MC0 B;  4KKU A;  5KYI A;  4A3M B;  1SYB A;  4HSV A;  3WOF A;  1ZYR D;  4A3B B;  3HP3 A;  1VMC A;  1GUO A;  4K2K A;  4U68 A;  2LY7 A;  2R6G A;  2AQ2 B;  1Q1B A;  2EYM A;  4RGO S;  1HUN A;  1JE4 A;  3BG3 A;  1PRT C;  3R8B A;  4X3K A;  3AB9 A;  4ZRZ A;  1ILQ A;  4KJO A;  4FXD A;  4ZUI A;  3FRP B;  2G9H D;  3ONA B;  4FYD A;  3URY A;  1XWE A;  1T5E A;  2CVR A;  3EA6 A;  2K6A A;  2L1B A;  3JAM E;  4QF4 A;  5FO8 B;  3LX0 A;  3LWE A;  1H9R A;  2IX1 A;  1ROD A;  3AU7 A;  1ZEQ X;  2B2V A;  3EJI A;  5TSS A;  5IOC A;  2JA5 B;  3Q0A A;  2F0K A;  4L6T B;  2R92 B;  4CJ0 B;  3GTO B;  1F77 A;  1EQV A;  2I07 B;  3D4R A;  1RF2 D;  1LV9 A;  1ET9 A;  3MXN A;  1CQF A;  1A2T A;  1Q90 A;  2A74 C;  4PV1 C;  4DA2 A;  4HR7 B;  1F2M A;  1LTB D;  4X3S A;  2CQA A;  2ZXP A;  1HCZ A;  2Z1C A;  3WDN A;  3HRZ C;  4ME5 A;  1MI2 A;  1KNE A;  1PRT F;  4J1M A;  2Z4I A;  1EEI D;  4OHJ A;  4IUP A;  4ZLT F;  3NHH A;  4DAY A;  1QE6 A;  1DZ1 A;  1TQO A;  1U4M A;  4N9P A;  1XYI A;  4PMC A;  5ELF A;  2EY2 A;  4KJN A;  1S5E D;  2PZT A;  4X3T A;  2B63 B;  4UDU C;  5M3M B;  5JEA G;  4X3U A;  1IW7 D;  4JK1 C;  1EEF D;  1EY0 A;  1DD2 A;  3MTS A;  2A6H D;  1SYD A;  2PO4 A;  3OOC A;  5I6Y A;  5C0X I;  4C1N K;  1X3P A;  4HED A;  3T53 B;  2BCO A;  2F0S A;  2BE5 C;  4A3E B;  2M9V A;  3BS1 A;  3DWP A;  3OPO A;  1I6V C;  1FNW A;  3RUZ A;  2PQE A;  1CM9 A;  5DEH A;  3J81 L;  1TR5 A;  1C4Q A;  4Z9C B;  2NVX B;  4ODG A;  1EY8 A;  1TKW B;  1WTO A;  1BCP C;  2F0G A;  5JJZ A;  3DWQ A;  5A2Q E;  1BDO A;  1AEX A;  3O13 A;  4K8J A;  1BCP B;  5HGT A;  5C4Z A;  4CKB A;  4A3I B;  4XT3 B;  3OMC A;  1KLU D;  3TME A;  3GTK B;  3PO2 B;  3C1E A;  4YIJ A;  1HXY D;  1V43 A;  3A55 A;  4TRD A;  3CKI B;  1WTQ A;  3L7Z C;  3HOU B;  4NKL A;  2XVS A;  3M7G A;  1WTP A;  1SYF A;  1ENF A;  3SK5 A;  1JOQ A;  1NCV A;  1QCB D;  1MGS A;  1SND A;  1SNQ A;  1M8A A;  1CI3 M;  4KKT A;  5LL6 X;  3OWE B;  2F0L A;  1ZXT A;  4KHV A;  3NK9 A;  3VR2 A;  1B9M A;  3MVV A;  3K5N A;  1DCZ A;  5ELC A;  3NSW A;  4EQP A;  3GTP B;  3U9O A;  1EY9 A;  1D2B A;  4C2M B;  4DK1 A;  2NBF A;  3R3O A;  2PNR C;  2NN6 G;  1STE A;  1GUN A;  1XTC D;  1WTW A;  2L12 A;  1A3V A;  1YNN C;  4OGQ C;  4J6H A;  4V0B A;  2NVT B;  4F88 A;  1BOS A;  2K28 A;  1H9S A;  3FMC A;  5C5L A;  2F0E A;  3I70 A;  2PPB C;  2F4I A;  1CQV A;  3MEH A;  1QWY A;  3L9A X;  2VNU D;  1TWC B;  5KEE A;  3S1M B;  1HQM C;  2K5D A;  2O2L D;  3NPP A;  4KI0 A;  4ZK9 B;  1OXS C;  1C48 A;  5F2D A;  4HN7 A;  1TVX A;  1I4H A;  2TSS A;  2D9U A;  3G6J B;  1YNJ D;  3HOW B;  3S1Q B;  3HG9 A;  2AQ3 B;  3R2T A;  2NB0 A;  1ET6 A;  1EYC A;  1TII D;  3KF8 A;  3J7A V;  4K8I A;  2XWB B;  3Q23 A;  3RZD B;  2ZXO A;  4A3J B;  2F0W A;  4J8Q A;  2LS0 1;  4PMW A;  2A6E D;  5IGD A;  1TWF B;  3G7L A;  1B1Z A;  2EYJ A;  1TWG B;  3M4O B;  1BBX C;  4IFD I;  1F2Z A;  4RH6 A;  3E0J A;  1SYG A;  1WTR A;  3AMU A;  2ZT9 C;  4GZY C;  2KCC A;  2SEB D;  4LAA A;  1UNS A;  2Z4H A;  4RHR A;  3PUZ A;  1QNU A;  1RKN A;  3GV6 A;  1U4L A;  4RGT A;  1SJE D;  1K8O A;  4CJ1 B;  3KBX A;  4IUT A;  1AZQ A;  2F0H A;  3VR5 A;  5IT9 E;  3P1H A;  3HOY B;  2N88 A;  2NTS A;  3HS0 C;  2RQX A;  2K5W A;  3NBI A;  3S14 B;  3K5L A;  1QOH A;  2LMC B;  5CBA E;  1QJO A;  4I7Z C;  4KK7 A;  4LJZ C;  1STN A;  5FO7 B;  1EOT A;  1SNM A;  1PZI D;  3VR3 A;  4A93 B;  3KLR A;  1IW7 C;  3HEJ A;  2KA7 A;  4H13 C;  1LT3 D;  3SR1 A;  4QIW B;  2A6H C;  1V8Q A;  2WII B;  4BA1 I;  5G3L D;  1TU2 B;  1ESR A;  3SK6 A;  2K32 A;  1B9N A;  5C3E B;  2RA4 A;  1FNV A;  5BN5 A;  1RTO A;  3QB3 A;  4FXK C;  5C3X A;  4CKC A;  4BWG B;  1ESF A;  5C0X H;  4DGZ A;  2YU9 B;  5M3F B;  3S1R B;  3M7N A;  1B3A A;  1I4Q A;  4CBV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...