4IFDH

Crystal structure of an 11-subunit eukaryotic exosome complex bound to rna
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
356
structure length
295
Chain Sequence
SEVITITKRNGAFQNSSDSQIVTPGELVTDDPIWMRGHGTYFLDNMTYSSVAGTVSRVNRLLSVIPLKGRYAPETGDHVVGRIAEVGNKRWKVDIGGKQHAVLMLGSVNLPGGILRRKSESDELQMRSFLKEGDLLNAEVQSLFQDGSASLHTRSLKYGKLRNGMFCQVPSSLIVRAKNHTHNLPGNITVVLGVNGYIWLRKTSQMDLARDTESSWQIYSDENDPSISNNIRQAICRYANVIKALAFCEIGITQQRIVSAYEASMVYSNVGELIEKNVMESIGSDILTAEKMRGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an RNA-bound 11-subunit eukaryotic exosome complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/rna
molecule keywords Exosome complex component RRP45
total genus 79
structure length 295
sequence length 356
ec nomenclature
pdb deposition date 2012-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF14382 ECR1_N Exosome complex exonuclease RRP4 N-terminal region
H PF15985 KH_6 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4ifdH01
1GHKA 2NN6G 2BA1A 1V43A 1YNJC 2V4DA 3A7LA 1Q1EA 1PMRA 3CRKC 3W3AA 4H0LC 2JEBI 2L5TA 1Y8OB 3IKJA 3QG1A 4KN7C 4TKOB 1VF5C 4KHZA 4G7ZC 1H9MA 3CRLC 1H9JA 4KN4C 3FPPA 3SE0A 3U9SA 1I6VC 2ZT9C 3QJYA 3MXUA 3VR6A 1OXXK 2BDOA 3VR3A 1VF7A 2NN6H 3TZUA 1HTPA 2Q8IB 1O7LA 5KNDA 3A7AB 3PUWA 2JE6I 3M7NA 4H44C 1Q12A 2K33A 2B8FA 1IYVA 3PV0A 1IYUA 4DK1A 1GUGA 4HR7B 3PUZA 3MFYA 3I4LA 1O78A 2EJGC 2DNCA 3PUYA 1GUOA 1Q90A 3D31A 3T53B 4DNRB 5K36H 1B9NA 4PV1C 2KA7A 1G291 3BDOA 1H9RA 2EJMA 3H94A 1GUSA 3M85A 2AUKA 1E2WA 5BN3A 3A8JE 1H9SA 1T5EA 1FR3A 1A6XA 1GUNA 1HQMC 3LNNA 2A69C 4GZYC 1GJXA 1OXSC 3DXJC 3OW7A 1LACA 2DN8A 5BN5A 4IFDH 1SMYC 4KMUC 2A6HC 3AB9A 4RCNA 1Y69U 4KKSA 5K36G 4DNTB 4IQZA 4LJZC 4OGQC 3FMCA 2D5DA 2AWOA 2A6HD 3KLRA 2EDGA 5JEAH 1OXVA 4KI0A 3VR4A 2E76C 4L8JA 3VA7A 3GQBA 4I7ZC 2CW0C 2E75C 1IW7D 2A68C 2DNEA 3HGBA 1LABA 1QJOA 4LK1C 2F1MA 1H9SB 3BG3A 3RLFA 2K32A 1K8OA 4KKTA 2O5IC 1CI3M 1B9MA 1E2ZA 1E2VA 1Z6HA 4TQUS 1DCZA 3M4YA 5C0XH 1EWHA 3ND9A 4IFDG 4BA2I 2BE5D 3VR2A 1TU2B 1BDOA 1VCIA 1FYCA 1Q1BA 2KCCA 1OXTA 2AUJD 2D2CC 3LWUA 2BE5C 1GUTA 3P20A 1VDZA 2E74C 1HPCA 1TKWB 2BA0A 2K7VA 3I73A 4OO1H 3NE5B 4JBWA 4DK0A 1HCZA 3N6RA 1Y8PB 1ZKOA 4G7HC 3L7ZC 2D62A 3A8KE 3PUVA 3T51B 4G7OC 3T56B 4XIGS 1K8MA 5KNBA 1IW7C 1GHJA 2A68D 2LMCB 2JEAI 4XTCS 3IFTA 3ND8A 3SDZA 1Y8NB 4H13C 2JXMB 1CFMA 2A69D 3EQLC 3GD7A 3OOCA 3QIAA 2PPBC 5C0XG 3I72A 2R6GA 3WDNA 1ZYRC 2PCFB 1Z7TA 2QF7A 2A6ED 3VR5A 1YNNC 1H9KA 3A8IE 3D4RA 4JK1C 5JEAG 2O5JC 3OPOA 4BA1I 2EVBA 1ONLA 2A6EC 1V8QA 1CTMA 5KNCA 4OO1G 2EJFC 2NN6I 5A35A 3PUXA 1DD2A 1DXMA 5BN4A 4KKUA 2B8GA 2PNRC 1OXUA 2IT1A 2YYZA
chains in the Genus database with same CATH superfamily
1CUKA 4JI2L 2F4VL 3JAME 2E2JB 4KY6A 3Q23A 1MKHA 5JVH3 1I50H 4K6DA 3K0XA 2F0OA 2IPKD 3DWPA 4TKOB 4JI8L 5LMUL 2CQAA 4JI7Q 1QOHA 3S24A 1G6ZA 2ICIA 4C1NI 2B2WC 2MHVA 4DN4M 3I8ZA 1IYVA 1KHIA 1ZEQX 2XNAC 4WJ4A 2F0NA 1HXYD 1EQRA 2A73B 4CJ0B 3DLLA 4MTKA 1SJHD 1YZ6A 2RKSA 3KLSX 4K5XA 3JAMc 1M1KC 3CCQA 5EGTA 2D9UA 3MEHA 2EYJA 3G7LA 3NP8A 4LF5L 4KHVA 1Y69U 1QB5D 3NPPA 3LX0A 3C2PA 4QY7A 1A3UA 3KBGA 4JI7L 4P74A 5I2YA 4JI1Q 1B8AA 2B2UA 3PO2G 2RCNA 4FF2A 1LABA 2R3ZA 2WKDA 1TWCH 4KHPL 2O5IC 3BZDB 4PMBA 5IT9L 4B9WA 4A3EH 4DR6Q 2KEDA 2EY1A 4X62Q 4LUOA 2BH8A 4B3RQ 1SDFA 4Z9CB 1AP0A 4HJ9A 4FXDA 4GNXC 2F0DA 1X3EA 5M5YH 5CBAE 1SBBB 2ENBA 4ABNA 4K8JA 2NVXB 1PTOC 5C4XG 4UY8C 1S5DD 3S1NH 1Y8NB 2PPBC 3GDEA 5DLQE 5C3WA 5J3BA 5KYLA 1AFPA 3J7A5 2UXBQ 4KJNA 3S2HB 2A6EC 1V8QA 1CTMA 4OO1G 2K75A 1XJVA 4J6HA 2WIIB 1BCPD 4X66Q 3FKIH 2EXDA 4A3IG 5M5YB 4DFAA 2ZTCA 3S2DB 5ELCA 1IKLA 1LLRD 3P75A 4BY7G 4DV3Q 3BZCA 2L5TA 3IKJA 5FLXE 2AQ3B 3ICEA 1AW7A 4M1UB 4MIUA 1PTOH 1DM0B 4A3MG 3VR3A 1SE2A 2Q2UA 3M7NA 1HH2P 4AQYQ 4XXEA 2OXPA 4A76A 5M3FB 3NTIA 1IYUA 2O4XA 2CFMA 4QGUA 4DV0L 4PZ8A 4JG2A 3E0JA 3CCEA 2NZOA 3D6CA 1LM0A 4PZ7A 5CV8A 2AUKA 3CW2C 1NUCA 2Z6KC 1PH3A 1KLUD 1FR3A 2IL8A 4YCWA 1A6XA 1XNQL 5IP7G 3IRBA 3FPUB 3I4NB 1VMCA 2VQEQ 1PFSA 3WWVA 1EY5A 1IKMA 4MZ9A 1YHAA 4WJ3M 5FLMG 3G4SA 3GQBA 2GVAA 2KHSA 1PH1A 1B7YB 2EQSA 2ID0A 1IW7D 2A68C 3NBHA 1RD9D 1BCPB 2XRQD 4QJFA 5JJKA 2NVYH 1K9MC 2UXDL 2PI2A 4YCVA 1U4MA 1F2YA 5GADC 4B3RL 3TZDA 2MNAA 1QUQA 5HGQA 1K8GA 2NYZD 4CDCC 4DAYA 3CMAA 1L1OA 4E6IA 3HKSA 1BDOA 4DAYB 1N32L 5M3MG 3V05A 2NVQB 2BE5C 4C3HB 2EPBA 4A93H 5C3XA 2WB1G 3TP6A 3PCOB 4DNIA 4KK7A 2FFKB 1O7ZA 2X69A 4XIGS 3GTKB 1ET9A 1BKBA 1G6PA 4EGVA 1MGSA 3EQLC 1RCVD 3GTJB 4CKEA 4LF5Q 3EVQA 3D8GA 1S72A 3T13A 1SYFA 3NWSA 1A0IA 2F0TA 2EVBA 1ONLA 3F2UA 3NK9A 2Z9HA 4PMCA 1X3QA 2X6LA 2B8GA 4QUCA 2Q8TA 1O7YA 3J7YW 1JR0D 2NN6G 5M3FH 1SYGA 1EIFA 1TR5A 2OT2A 1BOSA 4A3GB 3DM3A 2L12A 2KUMA 4LMQD 4IFDJ 5EBDA 2E2JH 3FDTA 1N32Q 5EPLA 3SE0A 1KDCA 3K80C 2BDOA 1EWCA 3SK5A 2NVTB 4LFAL 1MJCA 1O7LA 3I4NH 2A19A 1MHWC 4DV2L 2AHOB 4KJOA 2K04A 3H0GG 1SR3A 3ITPA 3I4LA 5IGBA 1F9RA 2VUMB 1GUOA 2QILA 2WB1E 5ELDA 3OHXC 4DV1L 1MSHA 2EJMA 4IUTA 2ZJPA 1DYQA 4A3FG 1SXTA 4OXPA 3K7AB 3GTMB 3MXNB 3HOYG 1B50A 1O7IA 4P73A 3CCMA 3SEBA 1OXSC 1GJXA 3CPFA 1O80A 3AYHB 1WCMG 3GTOH 4RCNA 5K36G 2F0KA 3D3RA 1EY4A 4DXFA 4IN3A 2O2LD 3H91A 1JWUD 2ZXPA 4C3JG 5LMNL 4I7ZC 4LF8Q 1Y1WB 2KEEA 1I4QA 1KRSA 4JI1L 2N55A 1T9HA 3HOWG 2PMZB 3TQYA 1WTHA 5CC4A 3B6YA 4G57A 3TS2A 2QDLA 1EQVA 2Z8LA 1E2ZA 1Z6HA 1LTRD 1DCZA 4PZ6A 1HR0L 1CM9A 1A3VA 3ZJYC 4FF3A 1FYCA 2NTSA 2Z0SA 5KRUA 4MHEA 4DK0A 2VW9A 3HS0C 4YCUA 1YJWA 2C5CA 1Y8PB 3I7FA 1PRTB 4G7HC 3NUCA 3L7ZC 4OELB 4ZUIA 2CH4W 3E5SA 1TVXA 4X66L 1VQOA 1K8MA 3S1NB 4DR4L 1K28A 1CFMA 1W3SA 4OEMB 2CH4A 3T4AC 3W2DA 1IBML 1VQEA 2R92B 1SNDA 2JJQA 1L2FA 1Q7YC 2KVMA 1N33Q 4X6AH 3UE0A 2B2VC 3TN2A 3J81j 1AE2A 3GTQB 4JI2Q 4QQBX 4DPGA 5H1SE 4HTHA 1Y8OB 1EYDA 1H9JA 1SNMA 4JI6Q 3ULLA 3U9SA 2YTXA 5LL6X 4HMIA 1RTNA 4ILWA 2DUDA 4C3IH 5EPJA 2NB0A 1BF4A 1NAPA 3VYUA 4OHJA 1PZID 2IX3A 4ODGA 5C44B 2WAQG 2UXCQ 4QL5A 3E3XA 3GTPB 2M2LA 2JP1A 4BXXH 1EQQA 1TWGH 5ELNA 3GTKH 1VMPA 1L0XB 1XNRQ 2ZTEA 1TS2A 2L55A 5C44H 1WTPA 3MA2B 1XXGA 1ICWA 2EYFA 1LO5D 2N49A 1H95A 5JOBA 3A55A 4XQJA 2F0WA 2K5NA 1WCMH 3NWTA 4CGYB 3CKIB 1DZ1A 2ZM6Q 1STAA 4BWGB 1A2UA 2E76C 3IAYA 1PH9A 1RKNA 1VQPA 1VQ4A 2E75C 4O42A 2F1MA 1VQBA 3BG3A 3UE1A 4BY7B 4CKBA 1TWFB 5IT9c 3GTQH 1M4VA 1EZ8A 1JMCA 1ML0D 1WFQA 2CKZB 2EYHA 5J39A 1PV4A 4QCLA 4TVAB 3RN5A 5CBEE 1TU2B 1GVPA 3GO5A 4GN4B 3BZKA 4R9WA 3LWUA 1CSQA 2R92H 5NUCA 3MXPA 2K7VA 3AQQA 4DGZA 5IE8A 5M5XB 2F0JA 4L5QA 4OWTB 3G6JB 3T56B 2LMCB 2KENA 3DEPA 4HN7A 2A69D 1I4PA 4BBRH 1J8IA 3OWEB 2RBMA 2KJXA 4DR3Q 3L9AX 1EOVA 2R93B 3RZOH 1EYAA 4C3JB 4ME5A 1K83H 3I56A 1SMYD 4V0BA 5EQ0A 4YHHQ 2JA7B 3SGIA 4RHSA 4Y52H 2ICEC 5CV5A 1YITA 2LY7A 1PVOA 5A2QE 3NTKA 4POFA 2VB2X 3E9IA 3RUZA 3BVZA 4GKJQ 2EYPA 1TY2A 3VYSA 1LTSD 1EY6A 3EFXD 4DR2Q 1HNWL 4L6TB 4F7XA 1SNPA 2AMCB 2EYMA 1TT2A 4IURA 4IUUA 1TXYA 1LTBD 1VF7A 4P72A 4JCVE 3S1MH 4JBJA 3S2HH 1CKMA 1EQTA 3PUWA 2DJGC 4F88A 1D2BA 3JAMi 2KOLA 2B2TC 4YY3Q 2B63H 3TREA 2RDHA 2ES2A 5JPMC 2WP8J 2UU9L 4BY1H 4O2DA 4C2MB 1HNZL 3GTLB 1AN8A 5E1FA 2L11A 2EJGC 2IJ0A 3T53B 1Q90A 2N78A 5CGKA 1W2BA 1PA6A 3GTOB 1K8AC 4NXNQ 3RZOB 3HOWB 4NMZA 1Y1VG 1L1OB 1RODA 4QIWB 4Y7NH 3A54A 1B4OA 4RAUC 3OW7A 4RGOS 2JA7G 3PO2B 4GLVB 1DOMA 1WOCA 2IW3A 4RGMA 4UPAA 5AFWA 3PGZA 2TSSA 5IYBH 2R93G 2K50A 1WTOA 3M9BA 5IT9E 2B2UC 2KECA 1TWCB 2K6AA 2FJ2A 1PDQA 5C6AA 2MP1A 4LK1C 1RTOA 2JN4A 1SE4A 3QB3A 1Q8IA 3KUPA 4LFAQ 1PH6A 2KBNA 4X62L 1JT8A 3M4YA 2OQKA 4LFBL 2E2HB 4BY7H 3NQTA 2UXDQ 1K0SA 4N9TA 2IX0A 1FGUA 4LFCL 1MIUA 1OXTA 3DEOA 5GAHC 4A3GH 4FYDA 3VYRA 1I94Q 5FO9B 2E74C 5TSSA 2F4VQ 1NMGA 4HJ7A 3S15H 4A3MH 1XMQQ 2YTYA 3N6RA 2L4NA 2QCPX 3A8KE 5IIFA 4A3DG 1GHJA 2JEAI 4FNFA 4A3KG 3NEMA 3S17B 1YI2A 2QF7A 1CHQD 4OO1I 3TP8A 3S1QH 2PZUA 2LKVA 1LTLA 1S4ZA 4YWKA 2I46A 1SYBA 1SN8A 5DEHA 2UUAL 5JJLA 5IYCH 4KKUA 2F4IA 1UUPA 2UUBL 4DR1Q 4CKCA 1CKNB 2WINB 5IYDG 4HSVA 2F0VA 4DKAC 4AQYL 4C3IB 1U4PA 3EA6A 2N8NA 2RQXA 5C5LA 3TSSA 1KL9A 2EYLA 5DM63 3MAQA 2B39A 3S14H 3MXUA 4DR2L 1HNWQ 3VR6A 4A3CH 2RHSB 4IZ8A 1TS5A 3RR5A 1EY9A 1JJGA 3A7AB 1XTCD 1E3PA 3ULPA 1PH8A 1G91A 4F8MA 5LMNQ 5I9PA 3PUZA 3HOYB 5COYA 1II3A 4DV6Q 1K0RA 2F0SA 4OX9L 2DY8A 1I4XA 3K5OA 2MFIA 5E4WC 4L63B 1QVCA 1E2WA 3SK6A 4NB3A 2IX1A 1Y1VH 3P1HA 1B70B 1HA6A 1JWSD 3OTOQ 5GAGC 2PW7A 1EYCA 5HGTA 4ZCKA 4LF9L 2AWNA 5ELFA 1HZ9A 4IQZA 1QVFA 1YIJA 2HIXA 1UEAB 1XYIA 2PI2E 2V1CC 4DAMA 2Q2TA 2PZTA 3MXNA 4P75A 4IOCA 1PH7A 2K32A 2VQFQ 4WORA 1CZWA 3QOLA 1RJTA 2QEJC 4JPBW 1GO3E 1HHVA 4IFDG 1KTKA 1R9TB 3HOUH 2ZTDA 3NXWA 1S40A 2VZAA 3PO2H 2KHJA 1HFNA 3CHBD 1AZQA 2EZVA 4OWWB 1HJPA 4IPHA 2BA0A 3LGJA 3HOXB 2XGTA 2I0QA 5JPNC 1ZKOA 3J81i 1EZ6A 2YU9H 4IO9A 4A3EG 1D5ZC 4R4TA 4NXML 2F0GA 1KNEA 4XYQA 3ND8A 5K5PA 3H3VI 2H5XA 3JC66 3GD7A 3QIAA 4C2MH 5C0XG 3PQIA 3C46A 4UP7A 4JV5Q 4WJWA 2ZXRA 4I7AA 3VR5A 1SROA 1XTDA 3A8IE 4JBKA 1SNCA 3S1MB 4C56C 4GN5A 1VS0A 1ENCA 4R1JA 5J1ZA 2NN6I 1L0WA 3HOUB 3HOYH 2K05A 4ZYSA 1X3FA 5IYCG 2IT1A 3STBC 4ZKCB 1V43A 2C35B 1HUMA 4B3SQ 4X65L 4B3SL 2XN9C 2GA4B 1IBLL 1TS4A 1HFGA 5C4XB 3QJYA 1TWHH 3AMUA 1XPRA 4PNYA 3I4MB 1GOZA 4GOPA 4L5SA 1FVIA 1SLJA 2NZHA 4B08A 1Q3LA 1LT4D 3TEHB 4LW1A 1BBXC 1JE4A 1QG7A 4FP5D 1Q81C 5M3MB 2DNCA 4DNRB 2PW5A 3EROA 3F8TA 3S1QB 4JVZA 3H94A 3K5MA 1GUSA 5FJ8H 2A8VA 2B2YC 1STNA 2XRSD 1X56A 3U4VA 3CPWA 2A69C 1YNXA 2GVBA 2DN8A 5C4HA 3S1RH 1YVCA 4IJLA 4LJZC 4DV0Q 2NTTA 4A3MB 1OXVA 4LUZA 3KJPA 1ASYA 3KDFA 4C3HH 4A3BH 2PYKA 1QILA 3HGBA 5IP7H 3RN2A 2BH2A 3QO2A 3A56A 1S5FD 3C3LA 2I07B 3HEJA 2K01A 3M3YB 1B9MA 5LL6S 1WD1A 3MTSA 4HEDA 4DU9A 1FJGQ 4BA2I 1LT6D 3VR2A 3I4OA 4FO2A 4JI3L 1Q1BA 3MVVA 1I50B 2XTIA 4R8NA 5BR8L 2MO0A 1F2ZA 5DAUA 1X55A 3C1EA 3Q6SA 1FNWA 1W6JA 2D62A 4CJ1B 1Y14B 4R4IA 4QF4A 3KJOA 2LS01 1N8RC 2R7ZH 2F3WA 3GTGH 2MJ8A 2EOTA 5M3MH 3K8AA 3OOCA 1PFMA 2Z1CA 1Q86C 3OIPA 4GLAC 5BR8Q 2J4XA 4XDXA 1I3QB 1KDAA 2JA9A 4JC0A 1FJGL 1JOKA 1ZXTA 1ICFB 3I55A 4POGA 1SJED 4HJ8A 1EIGA 5GQOA 2VXWA 1VQAA 2G9HD 4H0LC 2PMZE 1JQYD 4RGTA 4DR6L 1VF5C 2F0MA 1H9MA 2JA8G 4BBSH 4X3TA 2UUAQ 1UNSA 4KHPQ 4HAEA 1DOLA 2NN6H 2K5WA 5M3FG 4LF7L 1JOQA 4HSPA 3H0GB 2HDLA 5T1GA 3G48A 1D6EC 1STBA 2PNHA 5FKAC 3PO3H 5FLXc 3MFGA 4HIDA 2JYOA 1I6HB 5IGEA 3MWYW 2NZ1D 2CVRA 3AU7A 1HZCA 1XX8A 2VY3A 2PQAB 1SMYC 4KTAA 3CXCA 3G6EA 4KD3A 1NNXA 4IUPA 5I6YA 4EX5A 1VQFA 2AWOA 2RDGA 4DA2A 1BXTA 1FL0A 4ZUJA 2L1BA 2WFWA 2LXJA 4MTNA 5EJWA 5I9OA 1JORA 3U50C 4A3BG 5CMDA 3HFZB 2BOSA 1IYJB 1ILPA 2ZXOA 4C3JH 2KCCA 2L9HA 3RNUA 5D3IB 2F0FA 3KDFB 2B3GA 1X65A 2E8GA 3AFPA 4KLKA 1IBKL 2N3SA 1HCZA 4JI5Q 2VL6A 1WCMB 4K2KA 4AYBB 3E9HA 1KXLA 3MC0B 2MO1A 3SDZA 2B63G 1EIYB 4OIKA 3J80L 2MUYA 4EQ5A 1XWEA 1CZGA 3SK4A 4JI3Q 2AQ2B 2MGSA 3S16B 3R93A 3GTGB 1G51A 2UUCL 2HCIA 1TWGB 2F0UA 4LF6L 2L0CA 2K5QA 3KF8B 3U58A 4KD4A 4B3ML 2BCOA 3Q8DA 1OXUA 2VB3X 1Z9FA 4B3TL 2HQEA 1QNUA 1RF2D 4K5WA 4G7ZC 3DUZA 3NHHA 1PHJA 1OXXK 4BBSG 3K58A 3P7JA 2FXQA 4LWCA 1VQ9A 2I5HA 2F3IA 2RHQB 1P16A 1Q12A 1SE8A 3K5NA 4HJAA 1B2TA 4CDDC 1TY0A 3DMUA 4RH6A 4O0AA 4X3KA 4PV1C 5JJZA 1QNKA 4DV6L 2CCZA 2JK8A 4IALA 1BCPF 1LUZA 3OW2A 1T5EA 1X3PA 1WTVA 3ERQA 3KF8A 3PF4A 2KCMA 1X3GA 1VQMA 2A74C 1Q8KA 4A4IA 2JA5B 4IUVA 1MD2D 3AB9A 3HZXA 4HMJA 4KKSA 1PH5A 3HOVH 5CV7A 1WJJA 3UI2A 1TWHB 3W5OA 2Q2HA 4IFDI 5A2QL 4K0KL 4GNXB 2CW0C 4OONA 5FO7B 1E24A 4DUZQ 1H9SB 5CORA 5D3DA 5GAEC 4A3DB 2F0HA 4GN3B 5IYDH 2PQAA 5EPKA 2ALYB 1PFBA 1VCIA 4JV5L 2HCCA 4HIKA 2Q2IA 3STBD 5IP9G 2OEOA 4JBWA 4NXMQ 1EOTA 3H3VC 1QWYA 4QUFA 2LFNA 4L5TA 5IWAQ 1IW7C 2A68D 4UP8A 2HT1A 2F0IA 2YU9B 1IXRA 1RIPA 2Q8RE 4Q0FA 3ZYYX 4CDFC 3GTLH 3K7AH 3OYYA 4ZKBB 5AJ3Q 2B63B 1CHPD 4DF7A 2O5JC 1I94L 2HIVA 1I6HH 4JI4Q 1PXUA 1I5FA 5FO8B 4GKKQ 3H09A 1JOOA 4EQOA 4ZK9B 3PO3B 2F0EA 4DUZL 1IL2A 3Q22A 1STYA 1EY8A 2NBFA 4A3JB 2JEBI 3UDGA 1SRUA 1BBUA 5CV6A 5T1IA 2G9DA 4LF9Q 1P8LA 2JA6G 3D4WA 2ZT9C 4M8AA 1X6OA 3LWEA 2YV5A 3ERSX 1E1TA 2JE6I 4DV5L 4NPSA 2E2IB 3HOUG 4IUQA 4HR7B 5CYUA 5GROA 5JJIA 2N88A 4N8FA 3Q24A 3Q0AA 2ZJRA 4DR5Q 1KAAA 1HUNA 1U0LA 1GM5A 2HQLA 1F9QA 3GV6A 4K14A 2K28A 1HNXL 2K5HA 3CCSA 5D65A 4GZYC 4C3IG 1LACA 1LT5D 2FMCA 2NVTH 1B3QA 2JQOA 3SVMA 2RSNA 3CD6A 1Q82C 2EDGA 1EU4A 2LSSA 1AE3A 2RF4A 3KK7A 4BXXG 4RCOA 2DY7A 1JJCB 3J7AF 3NBHB 4LF8L 2EXZA 3EJIA 4X64L 2XSCA 2VUMG 1CI3M 3CCLA 4YHHL 2KCNA 1PYWD 4XYOA 5IOCA 4DV4L 1KNAA 1HNXQ 4EVOA 4DV7L 1VDZA 2ATWA 1KD1C 3F1ZA 3PIOA 4DR5L 3TRZA 1BO0A 3PUVA 2Z4IA 3R2IA 4YWMA 3F2BA 3S16H 4CDEC 4A3GG 1VQIA 1J5EL 4LFCQ 2K03A 2PCFB 3A5ZB 5EAYA 4DK3C 2I5LX 3D4RA 3PIP3 1N34L 1C0AA 3HOZG 4DAPA 2XIWA 2B2YA 2AKWB 3QOJA 4A3KH 1B53A 3K7UC 2HDMA 4U673 2R7FA 4PQXA 3D6WA 3QG1A 1F9SA 4MNOA 4A3JG 5IGFA 4DR1L 1PZKD 4LF4Q 3AEVA 1ZYRD 3A5UA 1KLGD 1NTGA 1VQHA 1N36Q 1MSGA 4O1NA 1HTPA 5KNDA 1Q46A 3FKIB 1UWVA 2R61A 3PUYA 1PRTF 5C0XJ 1EU3A 4N8X1 1JJ2A 1HNZQ 4JYAL 2I5MX 1CKNA 1G291 4XT3B 5ELOA 4B3MQ 3NENA 1VQ8A 4QIWE 2WKCA 3KF6B 4OIJA 2K5DA 4Y7NB 3A8JE 3PIO3 1X9NA 3VA5A 3DXJC 3DWAA 2R7ZG 3F2DA 2E5LL 4KMUC 1KQSA 1NR4A 1A8VA 1FNUA 2WAQB 4LFBQ 4YWLA 5C4JB 2D5DA 2H1EA 1U4RA 2CW0D 3KLRA 4ZLTF 4X3UA 1RDPD 3I4MG 3VYTA 1LYLA 1CT1D 4N9PA 5E3FA 4AYBE 1BUVT 1E1OA 5DM73 1XMOL 1OTCA 4GLXA 4ALPA 1Y1WH 3BYYB 3TBIB 1NE3A 2QKIC 2JA7H 3K81C 3H3VH 4RG1A 4ULLA 2BDNA 3NBIA 2KCTA 4ME3A 2F03A 2D2CC 2R93H 5EKLA 2Y0SB 1IBMQ 1T5XD 4DR7Q 4OO1H 3I73A 3GTMH 4YIJA 5I2XA 2K1BA 4XQQA 4BBRB 4JBMA 3V2TA 4A3IH 2RCFA 4G7OC 1LV9A 3TDQA 2PQEA 1UE5A 3OIQA 4BS9A 4V190 1Y1VB 4GKKL 4DUYQ 3R3OA 1EFWA 1YEZA 2WB1B 3I3CA 5AJ3L 2E2DC 2NUCA 3QR8A 3U4ZA 2VS1A 1HR0Q 2B2TA 3OWFA 1TQOA 4G4KA 2MQHA 2BA1A 2VQFL 4DV7Q 3A7LA 1S5BD 5LMNW 2WAQE 2ZM6L 5E7NA 4DV4Q 2TMPA 1UE7A 3CC7A 5G3LD 3BYTB 3CRLC 4H02A 1EUJA 4KN4C 4LF7Q 4LF6Q 1CA5A 1HZAA 4R4OA 1LTID 1W6KA 3FEWX 2JA5H 5DNFA 1F9PA 2F0QA 2HHHL 5M5WH 1PRTD 1JICA 1YJ9A 2OF1A 3ER0A 3MFYA 4RA8A 1R4QB 3I90A 4IOAA 1EEID 1MJEA 1KIXA 4LNQA 4XT1B 4AIMA 1U4LA 5ISRA 4ZRZA 4KY7A 4HIMA 4A3CG 1V1PB 3T1YQ 1GXDC 1LTAD 3KOJA 2EY5A 2FMMA 4GNXA 3CQZH 2ZJQA 2DGYA 4FF4A 3GP7A 4WRDA 1VQLA 1D7QA 1MBYA 4LAAA 2R7DA 1STGA 5HY6A 4L8JA 5IGCA 3J7ZC 3I4MH 1SEBD 2A5HA 4AH6A 2HHHQ 1KAWA 5I6WA 4K5VA 5C4XH 4TSSA 3S9WA 1F2LA 4EQNA 1SMXA 4FF1A 2EY6A 3OMGA 2AUJD 2C9OA 1GUTA 1UE6A 3J80E 3WOFA 2Y0SG 3M7GA 3F2CA 3HKZG 4JOIA 1NJIC 3HRZC 4K6LA 1WTWA 1V1PA 4JI4L 1YNND 2D0PA 3SK8A 1EY0A 2Z4HA 1XPOA 1CSPA 1DOKA 1STHA 2F3VA 4A75A 4NP5A 2E2IH 1H9KA 2EE1A 5JEAG 4DUYL 1LTTD 1JCKB 4J1MA 5KNCA 2SDFA 5EKIA 4JYAQ 1NMFA 2EJFC 3OSOA 5A35A 3CCVA 1PTOB 4A3IB 5BN4A 3I4NG 3J81L 5E4XA 4DAVA 1GHKA 1KC8C 5M9OA 3H0GH 4CHTB 2IWHA 2V4DA 1Q1EA 1PMRA 1K73C 1G2TA 1ENAA 1PFNA 3FRPB 3RLOA 4DR7L 1YNJD 1F77A 4KN7C 1JE5A 2FHTA 3K6OA 1U5KA 1UE1A 3M4QA 5JAVA 4CJ2C 3OTOL 1A63A 4WFN3 4DR3L 1NCVA 1D5XC 1G8ZD 2JA5G 2K33A 4UP9A 1S5CD 2RDFA 3PV0A 4H7BA 1XMOQ 4X65Q 1AH9A 2OQ0A 4DV1Q 5C5MA 1SNQA 4P71A 1EWIA 2JA6B 5D14A 4DK6C 2OTLA 2KA7A 1H9RA 1Z47A 3NELA 4JOIC 5FLMH 3M85A 2H4OA 4GS3A 4UHVA 3T1YL 4PMWA 1CKOA 5BN3A 1DONA 2E5LQ 1WD0A 2G5DA 1I4RA 1GUNA 1HQMC 2K4KA 3A0JA 3V96A 3PO3G 4DNTB 3HOXG 1C4QA 3MZ5A 4QB4A 2A6HD 1QZHA 5IWAL 1VQ5A 4BBSB 4CBVA 1UAPA 4HCSA 4P2CB 3VR4A 3BDCA 4HJ5A 1F2MA 2RVLA 2YTVA 1TS3A 3HOZB 4R4QA 5G3LF 3BJUA 1QJOA 1HQRD 1XPUA 5FJ8G 2KQ3A 3KYHC 3E6ZX 4RGNA 1VQNA 4A3KB 2JSOA 3ND9A 3SR1A 2RA4A 3BVGA 3D4DA 1BBWA 4LF4L 1C48A 1R4PB 3TMEA 3M4PA 1I3QH 1KRTA 1A62A 4U68A 4B3TQ 4FXKC 1RHPA 4C3HG 5KIXA 1BCPC 1S5ED 3O13A 2PZWA 3BVMA 1CA6A 3H6MA 4EQPA 5IODA 3W1GA 2UUCQ 3PMFA 1QE6A 4H13C 3J81E 1C8CA 1ILQA 1VQCA 1WI5A 2QGQA 3RMHA 3UDXA 3WDNA 4B9XA 1N34Q 1Z7TA 4DV2Q 4JI0L 2A6ED 3J80i 1DGSA 3CP0A 4RWSC 5KYIA 3HKZB 1MI2A 1J5EQ 5HURA 2NVQH 4BA1I 4JI6L 4IPDA 1PZJD 1DD2A 3PUXA 4FVMA 3GV3A 3EIVA 2PNRC 3ULJA 3S14B 2YYZA 3M3YH 4A93B 2B2WA 4DV5Q 3AFQA 1WTXA 4MN3A 1J9OA 2SOBA 3BDLA 1IHZA 3BS1A 1QVGA 4KHZA 3JAML 2CWAA 3DM1A 1E22A 4JW0A 2PO4A 2VQEL 1BNZA 5JEAJ 1FD7D 3CCUA 4XQNA 3FP9A 2NVYB 4A3FH 3CAMA 2Q8IB 3S1RB 1V1QA 1VQ6A 2IY5B 1NSNS 4H44C 2D0OA 2CHBD 2AQ1B 2OTJA 1IZ6A 1GUGA 1HA5A 4NXNL 1FGBD 3I2ZA 5K36H 1XNRL 2UU9Q 1B9NA 1AZPA 1STEA 1SYCA 1B3AA 2EY2A 2JA8H 3T1HQ 4F87A 5ELEA 3CF5A 1EEFD 3RD4A 1YJNA 5L37A 3S15B 1TIID 3EN2A 1EYGA 3FKIG 3HOWH 1SNOA 4L5RC 3K5LA 3KLWA 1YBYA 4OGQC 3FMCA 1CQVA 3K57A 1TWAH 5C3EH 5I4DA 1N9WA 3HOXH 2QW7A 1SSOA 4KY5A 1E0BA 1XMQL 4RMFA 3RLFA 1LT3D 1S3OA 1CK1A 1I4HA 2MPMA 5IY0A 3S2DH 4DXGA 4ID6A 3HOVG 1PLFA 5KGUA 1E2VA 4APVA 3X3NA 3ONAB 4BBRG 4RHRA 3PSIA 1D1KA 1G2SA 2BE5D 3QWNA 1BQQT 1GKHA 2WV6D 1A15A 2K14A 4A3JH 2L15A 2P5ZX 1QUQB 1V1OA 3C1FA 3P20A 1XNQQ 3N52A 4RKLA 3MXGA 4ZAIA 2F52A 4GOPB 1HR0W 4A3LH 5C4ZA 1BR9A 4C1NK 1K83B 5LHY1 3T51B 1WVLA 4XTCS 3IFTA 1DJRD 2R6GA 5IGGA 2XVSA 5IP9H 1OO9B 3OPOA 3BU2A 2SEBD 4GOPC 2OWOA 2GN5A 1PRTC 2M9VA 1HTLD 4IUNA 2SNMA 2NVXH 3R2TA 1U9RA 3NSWA 2Z6BA 2B29A 4DV3L 1YNJC 1UEBA 1PTOD 4A3FB 3L2PA 1JWMD 2IHFA 4I65A 1I6VC 4A93G 1CQFA 4UAIA 3DHQA 4ZQ3A 1HZBA 4NKLA 1VQDA 2QEXA 1Y1WG 4R4CA 2UXBL 1B1ZA 5C44G 3W1BA 1VQGA 4GKJL 1FNVA 4DK1A 5IYBG 1WTRA 1NBWA 2EYOA 3U9OA 3TS0A 1O78A 3CQZB 1GUWA 2R7ZB 2UXCL 1IL8A 3BDOA 3FVQA 4LUVA 1BVSA 1ET6A 1WTQA 2A1AA 3T16A 4IPGA 1JB3A 2J7ZA 1C9OA 1JC7A 3I70A 2A6HC 2EIFA 2DJFC 5LMUQ 4K8IA 4NDXA 1RL2A 2LXKA 1QCBD 3EBEA 4PG3A 4RFBA 5M5WB 4OX9Q 5C3EG 3VA7A 1NY4A 3TP5A 1D8LA 2R92G 1EIHA 2QA4A 1SAPA 1ESRA 2E2HH 4A3BB 3MEFA 1K8OA 3CC2A 1JB7A 1N33L 3SXHA 4TQUS 3URYA 1ENFA 1A2TA 1B44D 1IBLQ 1PH2A 1PYSB 4Q5VA 5KEEA 5C0XI 1HPCA 3MHBA 3NE5B 2HD3A 2CWPA 3CCJA 3T1HL 4HCEA 2XWJB 3S17H 4A3LG 3RZDH 5JVG3 2OCEA 2UUBQ 2ASBA 1V9PA 4YY3L 5EKKA 1SFOB 2QDBA 3J80c 2JXMB 3GTPH 1E7ZA 3L3OC 1K3BC 1VQJA 2F0LA 5CV9A 1SYEA 4RKBA 1EY7A 3KFUA 3J81c 1VQKA 2SNSA 2M00A 3D0FA 1ESFA 4FDBA 1D5MC 4JI8Q 4JI5L 1QZGA 3CRKC 4NW2A 2HUGA 3W3AA 1IBKQ 2CQOA 3CC4A 1N36L 1D1IA 3CCRA 4BY1G 3HOZH 1SYDA 4OL7A 4J8QA 4AYBG 2K5VA 3FPPA 1HRJA 3SHLA 3TZUA 1L0YB 5FOBB 3FHWA 4JI0Q 3K0YA 2B8FA 3HKZE 4K0KQ 1YHQA 2X6GA 1EFID 3HG9A 3PF5A 1AEXA 4K2LA 1WYDA 3D31A 1PYBA 4KV6A 1KDBA 4X3SA 3J7AV 5IGDA 5EBCA 3IL8A 3R8BA 5J22A 2JA6H 2B2VA 4J15A 3OMCA 4HIOA 3M4OH 4BY1B 1H9SA 5F2DA 2K52A 3M4OB 3CU7A 3DWQA 3LNNA 5FLXL 1J6QA 5BN5A 4IFDH 3HP3A 2NWGA 1C7YA 3E0EA 1M8AA 3KBXA 1ASZA 3H15A 3TP7A 1YHBA 1R9TH 1I4GA 1PTOF 4UDUC 1M90C 4DR4Q 1PH4A 5JEAH 3KF6A 4KI0A 2F0PA 4QMGA 2DNEA 3VDYA 3NTHA 1L1OC 1X54A 5ELBA 3A74A 1GD7A 4A3EB 3UDIA 1EL0A 4IJHA 3UDFA 3K59A 3X3MA 4KKTA 5CR3A 1TWAB 2J0TD 5C3EB 5C0XH 4IPCA 4A3DH 1EWHA 1TWFH 5CV4A 4X64Q 5C4JH 3PIPA 3G71A 2FINB 3KLSA 5FK9C 3WOEA 2VNUD 1K3RA 2KHIA 3RLNA 1TKWB 4FXGC 1NR2A 2JA8B 1X32A 1LTGD 2RSOA 1SFOH 3HOVB 3IFDA 1SE3A 5KNBA 3CMEA 2IHEA 4TRDA 4OWXB 2VUMH 1VQ7A 3L0OA 4S3SA 2Z6KA 3I72A 3GTJH 4R8IA 1ZYRC 5M5XH 1YNNC 2WACA 4JK1C 2Y0SE 3RZDB 2XWBB 1A3TA 3I91A 1DXMA 1KABA 3NQIA
chains in the Genus database with same CATH topology
3JAME 2E2JB 4KY6A 3Q23A 5JVH3 4K6DA 2F0OA 2IPKD 3DWPA 4TKOB 2CQAA 1QOHA 1G6ZA 2ICIA 4C1NI 2B2WC 2MHVA 4DN4M 3I8ZA 1IYVA 1ZEQX 2XNAC 2F0NA 1HXYD 2A73B 4CJ0B 1SJHD 2RKSA 3KLSX 4K5XA 5EGTA 2D9UA 3MEHA 2EYJA 3G7LA 3NP8A 4KHVA 1Y69U 1QB5D 3NPPA 3LX0A 3C2PA 1A3UA 3KBGA 5I2YA 2B2UA 4FF2A 1LABA 2R3ZA 2WKDA 2O5IC 3BZDB 4PMBA 5IT9L 4B9WA 2KEDA 2EY1A 1SDFA 4Z9CB 1AP0A 4FXDA 2F0DA 5CBAE 1SBBB 2ENBA 4ABNA 4K8JA 2NVXB 1PTOC 1S5DD 1Y8NB 2PPBC 5C3WA 5KYLA 1AFPA 4KJNA 3S2HB 2A6EC 1V8QA 1CTMA 4OO1G 4J6HA 2WIIB 1BCPD 5M5YB 4DFAA 3S2DB 5ELCA 1IKLA 1LLRD 3P75A 2L5TA 3IKJA 5FLXE 2AQ3B 1AW7A 4M1UB 4MIUA 1PTOH 1DM0B 3VR3A 1SE2A 3M7NA 4XXEA 2OXPA 5M3FB 3NTIA 1IYUA 2O4XA 3E0JA 3D6CA 5CV8A 2AUKA 1NUCA 1KLUD 1FR3A 2IL8A 1A6XA 3FPUB 3I4NB 1VMCA 1EY5A 1IKMA 3GQBA 2KHSA 2ID0A 1IW7D 2A68C 3NBHA 1RD9D 1BCPB 2XRQD 1U4MA 1F2YA 3TZDA 2NYZD 4DAYA 4E6IA 1BDOA 3V05A 2NVQB 2BE5C 4C3HB 2EPBA 5C3XA 3TP6A 4KK7A 2FFKB 1O7ZA 2X69A 4XIGS 3GTKB 1ET9A 4EGVA 1MGSA 3EQLC 1RCVD 3GTJB 4CKEA 3EVQA 3D8GA 3T13A 1SYFA 3NWSA 2F0TA 2EVBA 1ONLA 3F2UA 3NK9A 4PMCA 1X3QA 2X6LA 2B8GA 4QUCA 2Q8TA 1O7YA 3J7YW 1JR0D 2NN6G 1SYGA 1TR5A 2OT2A 1BOSA 4A3GB 2L12A 2KUMA 4LMQD 4IFDJ 5EBDA 3FDTA 5EPLA 3SE0A 1KDCA 2BDOA 1EWCA 3SK5A 2NVTB 1O7LA 4KJOA 2K04A 3ITPA 3I4LA 5IGBA 1F9RA 2VUMB 1GUOA 2QILA 5ELDA 3OHXC 1MSHA 2EJMA 4IUTA 1DYQA 1SXTA 3K7AB 3GTMB 1B50A 1GJXA 3SEBA 1OXSC 1O80A 4RCNA 5K36G 2F0KA 3D3RA 1EY4A 4DXFA 4IN3A 2O2LD 3H91A 1JWUD 2ZXPA 4C3JG 4I7ZC 1Y1WB 2KEEA 1I4QA 2N55A 2PMZB 5CC4A 4G57A 2Z8LA 1EQVA 1E2ZA 1Z6HA 1LTRD 1DCZA 1CM9A 1A3VA 4FF3A 1FYCA 2NTSA 5KRUA 4MHEA 4DK0A 3HS0C 2C5CA 1Y8PB 4G7HC 1PRTB 3NUCA 3L7ZC 4ZUIA 3E5SA 1TVXA 3S1NB 1K8MA 1CFMA 3T4AC 3W2DA 2R92B 1SNDA 2KVMA 2B2VC 3TN2A 3GTQB 4HTHA 1Y8OB 1EYDA 1H9JA 1SNMA 3U9SA 5LL6X 4HMIA 1RTNA 4ILWA 5EPJA 2NB0A 1BF4A 1NAPA 3VYUA 4OHJA 1PZID 2IX3A 4ODGA 5C44B 3GTPB 2M2LA 2JP1A 1VMPA 1L0XB 1TS2A 2L55A 1WTPA 3MA2B 1XXGA 1ICWA 2EYFA 1LO5D 5JOBA 3A55A 4XQJA 2F0WA 3NWTA 4CGYB 3CKIB 1DZ1A 1STAA 4BWGB 1A2UA 2E76C 3IAYA 1RKNA 2E75C 4O42A 2F1MA 3BG3A 4BY7B 4CKBA 1TWFB 1M4VA 1EZ8A 1ML0D 2EYHA 5J39A 4QCLA 5CBEE 1TU2B 3GO5A 4R9WA 3LWUA 5NUCA 3MXPA 2K7VA 4DGZA 5M5XB 2F0JA 3G6JB 3T56B 2LMCB 3DEPA 4HN7A 2A69D 1I4PA 1J8IA 3OWEB 2KJXA 2RBMA 3L9AX 2R93B 1EYAA 4C3JB 4ME5A 1SMYD 4V0BA 5EQ0A 2JA7B 4RHSA 2ICEC 5CV5A 2LY7A 5A2QE 3NTKA 2VB2X 3RUZA 3BVZA 2EYPA 1TY2A 3VYSA 1LTSD 1EY6A 3EFXD 4L6TB 4F7XA 1SNPA 2EYMA 1TT2A 4IURA 4IUUA 1LTBD 1VF7A 1EQTA 3PUWA 4F88A 1D2BA 2KOLA 2B2TC 2RDHA 5JPMC 2WP8J 3GTLB 4C2MB 1AN8A 3T53B 5E1FA 2EJGC 2IJ0A 2L11A 1Q90A 5CGKA 3GTOB 3RZOB 3HOWB 4NMZA 1RODA 4QIWB 3A54A 1B4OA 4RAUC 3OW7A 4RGOS 3PO2B 1DOMA 2IW3A 4RGMA 5AFWA 2TSSA 1WTOA 5IT9E 2B2UC 2KECA 1TWCB 2K6AA 2FJ2A 1PDQA 5C6AA 2MP1A 4LK1C 1RTOA 3QB3A 1SE4A 1Q8IA 3KUPA 3M4YA 2E2HB 3NQTA 2IX0A 4N9TA 1OXTA 3DEOA 4FYDA 3VYRA 5FO9B 2E74C 5TSSA 3N6RA 2L4NA 2QCPX 3A8KE 5IIFA 1GHJA 2JEAI 4FNFA 3S17B 2QF7A 1CHQD 4OO1I 3TP8A 2PZUA 2LKVA 1S4ZA 2I46A 1SYBA 5DEHA 4KKUA 2F4IA 1UUPA 4CKCA 2WINB 4HSVA 2F0VA 4C3IB 1U4PA 3EA6A 2RQXA 5C5LA 3TSSA 2EYLA 5DM63 3MAQA 2B39A 3MXUA 3VR6A 4IZ8A 1TS5A 1EY9A 3A7AB 1XTCD 1G91A 4F8MA 5I9PA 3PUZA 3HOYB 5COYA 1II3A 2F0SA 2DY8A 1I4XA 3K5OA 5E4WC 4L63B 1E2WA 3SK6A 2IX1A 3P1HA 1HA6A 1JWSD 2PW7A 1EYCA 5HGTA 2AWNA 5ELFA 4IQZA 1UEAB 1XYIA 2PZTA 3MXNA 2K32A 4WORA 1CZWA 3QOLA 1RJTA 2QEJC 1HHVA 4IFDG 1KTKA 1R9TB 3NXWA 1HFNA 3CHBD 1AZQA 2EZVA 2BA0A 3HOXB 5JPNC 1ZKOA 1EZ6A 1D5ZC 2F0GA 1KNEA 4XYQA 3ND8A 5K5PA 3GD7A 3QIAA 5C0XG 3C46A 4WJWA 2ZXRA 3VR5A 3A8IE 1SNCA 3S1MB 4C56C 1ENCA 5J1ZA 2NN6I 3HOUB 2K05A 4ZYSA 2IT1A 4ZKCB 1V43A 1HUMA 2XN9C 2GA4B 1TS4A 1HFGA 5C4XB 3QJYA 3AMUA 4PNYA 3I4MB 1GOZA 4B08A 1Q3LA 1LT4D 1BBXC 1JE4A 1QG7A 4FP5D 5M3MB 2DNCA 4DNRB 2PW5A 3EROA 3S1QB 3H94A 3K5MA 1GUSA 2B2YC 1STNA 2XRSD 2A69C 2DN8A 5C4HA 4LJZC 2NTTA 4A3MB 1OXVA 2PYKA 1QILA 3HGBA 3QO2A 3A56A 1S5FD 3C3LA 2I07B 3HEJA 2K01A 3M3YB 1B9MA 5LL6S 1WD1A 3MTSA 4HEDA 4DU9A 4BA2I 1LT6D 3VR2A 4FO2A 1Q1BA 3MVVA 1I50B 4R8NA 1F2ZA 5DAUA 3C1EA 3Q6SA 1FNWA 1W6JA 2D62A 4CJ1B 4QF4A 2LS01 2F3WA 2MJ8A 2EOTA 3OOCA 1PFMA 2Z1CA 3OIPA 2J4XA 4XDXA 1I3QB 1KDAA 1JOKA 1ZXTA 1SJED 1EIGA 2VXWA 2G9HD 4H0LC 1JQYD 4RGTA 1VF5C 2F0MA 1H9MA 4X3TA 1UNSA 4HAEA 1DOLA 2NN6H 2K5WA 1JOQA 4HSPA 3H0GB 2HDLA 5T1GA 1D6EC 1STBA 5FKAC 3MFGA 2JYOA 1I6HB 5IGEA 3MWYW 2NZ1D 2CVRA 3AU7A 1XX8A 4KTAA 1SMYC 4KD3A 4IUPA 5I6YA 2AWOA 2RDGA 4DA2A 1BXTA 4ZUJA 2L1BA 5I9OA 5EJWA 1JORA 5CMDA 2BOSA 1ILPA 2ZXOA 2KCCA 2L9HA 5D3IB 2F0FA 1HCZA 1WCMB 4K2KA 4AYBB 3MC0B 3SDZA 4OIKA 3J80L 2MUYA 3SK4A 1CZGA 1XWEA 2AQ2B 2MGSA 3S16B 3R93A 3GTGB 2HCIA 1TWGB 2F0UA 2L0CA 2K5QA 4KD4A 2BCOA 1OXUA 2VB3X 2HQEA 1QNUA 1RF2D 4K5WA 4G7ZC 3DUZA 3NHHA 1OXXK 3K58A 3P7JA 1Q12A 3K5NA 1B2TA 1TY0A 3DMUA 4RH6A 4X3KA 4PV1C 5JJZA 1QNKA 4IALA 1BCPF 1T5EA 1X3PA 1WTVA 3ERQA 3KF8A 2A74C 2JA5B 4IUVA 1MD2D 3AB9A 3HZXA 4HMJA 4KKSA 5CV7A 3UI2A 1TWHB 4IFDI 5A2QL 2CW0C 5FO7B 1H9SB 5CORA 5D3DA 4A3DB 2F0HA 5EPKA 1PFBA 1VCIA 2HCCA 2OEOA 4JBWA 1EOTA 3H3VC 1QWYA 4QUFA 2LFNA 1IW7C 2A68D 2F0IA 2YU9B 2Q8RE 4Q0FA 3ZYYX 4ZKBB 2B63B 1CHPD 4DF7A 2O5JC 1PXUA 5FO8B 3H09A 1JOOA 4EQOA 4ZK9B 3PO3B 2F0EA 3Q22A 1STYA 1EY8A 2NBFA 4A3JB 2JEBI 5CV6A 5T1IA 2G9DA 3D4WA 2ZT9C 4M8AA 3LWEA 2JE6I 2E2IB 4IUQA 4HR7B 5CYUA 2N88A 3Q24A 3Q0AA 1KAAA 1HUNA 1F9QA 3GV6A 4K14A 2K28A 5D65A 4GZYC 4C3IG 1LACA 1LT5D 2FMCA 3SVMA 2RSNA 2EDGA 1EU4A 3KK7A 4RCOA 2DY7A 3J7AF 2EXZA 3EJIA 2XSCA 1CI3M 2KCNA 1PYWD 4XYOA 5IOCA 1KNAA 4EVOA 1VDZA 1BO0A 3PUVA 2Z4IA 3R2IA 2K03A 2PCFB 3D4RA 3PIP3 4DAPA 2XIWA 2B2YA 3QOJA 1B53A 2HDMA 4U673 4PQXA 3D6WA 3QG1A 1F9SA 5IGFA 1PZKD 1ZYRD 1KLGD 1MSGA 4O1NA 1HTPA 5KNDA 3FKIB 2R61A 3PUYA 1PRTF 5C0XJ 1EU3A 4XT3B 1G291 2WKCA 4OIJA 2K5DA 4Y7NB 3A8JE 3PIO3 3VA5A 3DXJC 3DWAA 4KMUC 1NR4A 2WAQB 1FNUA 5C4JB 2D5DA 2H1EA 1U4RA 2CW0D 3KLRA 4ZLTF 4X3UA 1RDPD 3VYTA 1CT1D 4N9PA 5E3FA 5DM73 1BUVT 3BYYB 3TBIB 2QKIC 4ULLA 2BDNA 3NBIA 2F03A 2D2CC 5EKLA 2Y0SB 1T5XD 4OO1H 3I73A 4YIJA 5I2XA 2K1BA 4XQQA 4BBRB 3V2TA 4G7OC 1LV9A 3TDQA 2PQEA 3OIQA 4BS9A 4V190 1Y1VB 3R3OA 2WB1B 3I3CA 2E2DC 2NUCA 2B2TA 3OWFA 1TQOA 4G4KA 2BA1A 3A7LA 1S5BD 2TMPA 5G3LD 3BYTB 3CRLC 4KN4C 1CA5A 1LTID 1W6KA 3FEWX 5DNFA 1F9PA 2F0QA 1PRTD 1JICA 2OF1A 3MFYA 4RA8A 1R4QB 3I90A 1EEID 4XT1B 1U4LA 5ISRA 4ZRZA 4KY7A 1V1PB 1GXDC 1LTAD 2EY5A 2FMMA 4FF4A 3GP7A 4WRDA 1MBYA 4LAAA 1STGA 4L8JA 5IGCA 1SEBD 2A5HA 5I6WA 4K5VA 4TSSA 3S9WA 1F2LA 4EQNA 4FF1A 2EY6A 3OMGA 2AUJD 2C9OA 1GUTA 3J80E 3WOFA 3M7GA 3HRZC 4K6LA 1WTWA 1V1PA 1YNND 3SK8A 1EY0A 2Z4HA 1DOKA 2F3VA 1STHA 4NP5A 1H9KA 2EE1A 5JEAG 1LTTD 1JCKB 4J1MA 5KNCA 2SDFA 5EKIA 4A3IB 5A35A 2EJFC 3OSOA 1PTOB 5BN4A 3J81L 5E4XA 4DAVA 1GHKA 5M9OA 4CHTB 2IWHA 2V4DA 1Q1EA 1PMRA 1G2TA 1ENAA 1PFNA 3FRPB 1YNJD 1F77A 4KN7C 2FHTA 3K6OA 5JAVA 4CJ2C 4WFN3 1NCVA 1D5XC 1G8ZD 2K33A 1S5CD 2RDFA 3PV0A 4H7BA 5C5MA 1SNQA 2JA6B 5D14A 2KA7A 1H9RA 1Z47A 3M85A 2H4OA 4PMWA 5BN3A 1DONA 1WD0A 1I4RA 1GUNA 1HQMC 3V96A 4DNTB 1C4QA 3MZ5A 4QB4A 2A6HD 4BBSB 4CBVA 1UAPA 4HCSA 4P2CB 3VR4A 3BDCA 1F2MA 2RVLA 1TS3A 3HOZB 5G3LF 1QJOA 1HQRD 2KQ3A 3E6ZX 4RGNA 4A3KB 2JSOA 3ND9A 3SR1A 2RA4A 3BVGA 3D4DA 1C48A 1R4PB 3TMEA 4U68A 4FXKC 1RHPA 4C3HG 5KIXA 1BCPC 1S5ED 3O13A 2PZWA 3BVMA 1CA6A 3H6MA 4EQPA 5IODA 3PMFA 1QE6A 4H13C 3J81E 1C8CA 1ILQA 4B9XA 3RMHA 3WDNA 1Z7TA 2A6ED 4RWSC 5KYIA 3HKZB 1MI2A 5HURA 4BA1I 1PZJD 1DD2A 3PUXA 4FVMA 3GV3A 2PNRC 3S14B 2YYZA 4A93B 2B2WA 1WTXA 4MN3A 1J9OA 2SOBA 3BDLA 1IHZA 3BS1A 4KHZA 3JAML 3DM1A 2PO4A 1BNZA 5JEAJ 1FD7D 4XQNA 2NVYB 2Q8IB 3S1RB 1NSNS 4H44C 2CHBD 2AQ1B 1GUGA 1HA5A 1FGBD 5K36H 1B9NA 1AZPA 1STEA 1SYCA 1B3AA 2EY2A 4F87A 5ELEA 1EEFD 3RD4A 3S15B 1TIID 1SNOA 3K5LA 4OGQC 3FMCA 1CQVA 3K57A 5I4DA 1SSOA 4KY5A 1E0BA 3RLFA 1LT3D 1CK1A 1I4HA 2MPMA 4DXGA 4ID6A 1PLFA 5KGUA 1E2VA 3X3NA 3ONAB 4RHRA 1D1KA 1G2SA 2BE5D 3QWNA 1BQQT 2WV6D 1A15A 1V1OA 3C1FA 3P20A 3N52A 4RKLA 3MXGA 4ZAIA 5C4ZA 1BR9A 4C1NK 1K83B 5LHY1 3T51B 1WVLA 4XTCS 3IFTA 1DJRD 2R6GA 5IGGA 2XVSA 1OO9B 3OPOA 2SEBD 1PRTC 2M9VA 1HTLD 2SNMA 4IUNA 3R2TA 1U9RA 3NSWA 1YNJC 1PTOD 4A3FB 1JWMD 4I65A 1I6VC 1CQFA 4UAIA 3DHQA 4ZQ3A 4NKLA 1B1ZA 1FNVA 4DK1A 1WTRA 2EYOA 3U9OA 1O78A 3CQZB 1GUWA 2R7ZB 1IL8A 3BDOA 3FVQA 1ET6A 1WTQA 3T16A 1JB3A 2J7ZA 1JC7A 3I70A 2A6HC 4K8IA 4NDXA 1QCBD 4RFBA 5M5WB 3VA7A 3TP5A 1EIHA 1SAPA 1ESRA 4A3BB 1K8OA 3SXHA 4TQUS 3URYA 1ENFA 1A2TA 1B44D 4Q5VA 5KEEA 5C0XI 1HPCA 3MHBA 3NE5B 4HCEA 2XWJB 5JVG3 5EKKA 1SFOB 2QDBA 2JXMB 3L3OC 2F0LA 5CV9A 1SYEA 4RKBA 1EY7A 2SNSA 2M00A 1ESFA 1D5MC 3CRKC 4NW2A 2HUGA 3W3AA 1D1IA 1SYDA 4OL7A 4J8QA 3FPPA 1HRJA 3SHLA 3TZUA 1L0YB 5FOBB 3K0YA 2B8FA 2X6GA 1EFID 3HG9A 1AEXA 4K2LA 3D31A 4KV6A 1KDBA 4X3SA 3J7AV 5IGDA 5EBCA 3IL8A 3R8BA 5J22A 2B2VA 3OMCA 4BY1B 1H9SA 5F2DA 3M4OB 3CU7A 3DWQA 5FLXL 3LNNA 5BN5A 4IFDH 3HP3A 2NWGA 1M8AA 3KBXA 3TP7A 1I4GA 1PTOF 4UDUC 5JEAH 4KI0A 2F0PA 4QMGA 2DNEA 3NTHA 5ELBA 1EL0A 4A3EB 3K59A 3X3MA 4KKTA 5CR3A 1TWAB 2J0TD 5C3EB 5C0XH 1EWHA 5CV4A 2FINB 3KLSA 5FK9C 3WOEA 2VNUD 1TKWB 4FXGC 1NR2A 2JA8B 1X32A 1LTGD 2RSOA 3HOVB 3IFDA 1SE3A 5KNBA 4TRDA 4S3SA 3I72A 4R8IA 1ZYRC 1YNNC 2WACA 4JK1C 3RZDB 2XWBB 1A3TA 3I91A 1DXMA 1KABA 3NQIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GHK A;  2NN6 G;  2BA1 A;  1V43 A;  1YNJ C;  2V4D A;  3A7L A;  1Q1E A;  1PMR A;  3CRK C;  3W3A A;  4H0L C;  2JEB I;  2L5T A;  1Y8O B;  3IKJ A;  3QG1 A;  4KN7 C;  4TKO B;  1VF5 C;  4KHZ A;  4G7Z C;  1H9M A;  3CRL C;  1H9J A;  4KN4 C;  3FPP A;  3SE0 A;  3U9S A;  1I6V C;  2ZT9 C;  3QJY A;  3MXU A;  3VR6 A;  1OXX K;  2BDO A;  3VR3 A;  1VF7 A;  2NN6 H;  3TZU A;  1HTP A;  2Q8I B;  1O7L A;  5KND A;  3A7A B;  3PUW A;  2JE6 I;  3M7N A;  4H44 C;  1Q12 A;  2K33 A;  2B8F A;  1IYV A;  3PV0 A;  1IYU A;  4DK1 A;  1GUG A;  4HR7 B;  3PUZ A;  3MFY A;  3I4L A;  1O78 A;  2EJG C;  2DNC A;  3PUY A;  1GUO A;  1Q90 A;  3D31 A;  3T53 B;  4DNR B;  5K36 H;  1B9N A;  4PV1 C;  2KA7 A;  1G29 1;  3BDO A;  1H9R A;  2EJM A;  3H94 A;  1GUS A;  3M85 A;  2AUK A;  1E2W A;  5BN3 A;  3A8J E;  1H9S A;  1T5E A;  1FR3 A;  1A6X A;  1GUN A;  1HQM C;  3LNN A;  2A69 C;  4GZY C;  1GJX A;  1OXS C;  3DXJ C;  3OW7 A;  1LAC A;  2DN8 A;  5BN5 A;  4IFD H;  1SMY C;  4KMU C;  2A6H C;  3AB9 A;  4RCN A;  1Y69 U;  4KKS A;  5K36 G;  4DNT B;  4IQZ A;  4LJZ C;  4OGQ C;  3FMC A;  2D5D A;  2AWO A;  2A6H D;  3KLR A;  2EDG A;  5JEA H;  1OXV A;  4KI0 A;  3VR4 A;  2E76 C;  4L8J A;  3VA7 A;  3GQB A;  4I7Z C;  2CW0 C;  2E75 C;  1IW7 D;  2A68 C;  2DNE A;  3HGB A;  1LAB A;  1QJO A;  4LK1 C;  2F1M A;  1H9S B;  3BG3 A;  3RLF A;  2K32 A;  1K8O A;  4KKT A;  2O5I C;  1CI3 M;  1B9M A;  1E2Z A;  1E2V A;  1Z6H A;  4TQU S;  1DCZ A;  3M4Y A;  5C0X H;  1EWH A;  3ND9 A;  4IFD G;  4BA2 I;  2BE5 D;  3VR2 A;  1TU2 B;  1BDO A;  1VCI A;  1FYC A;  1Q1B A;  2KCC A;  1OXT A;  2AUJ D;  2D2C C;  3LWU A;  2BE5 C;  1GUT A;  3P20 A;  1VDZ A;  2E74 C;  1HPC A;  1TKW B;  2BA0 A;  2K7V A;  3I73 A;  4OO1 H;  3NE5 B;  4JBW A;  4DK0 A;  1HCZ A;  3N6R A;  1Y8P B;  1ZKO A;  4G7H C;  3L7Z C;  2D62 A;  3A8K E;  3PUV A;  3T51 B;  4G7O C;  3T56 B;  4XIG S;  1K8M A;  5KNB A;  1IW7 C;  1GHJ A;  2A68 D;  2LMC B;  2JEA I;  4XTC S;  3IFT A;  3ND8 A;  3SDZ A;  1Y8N B;  4H13 C;  2JXM B;  1CFM A;  2A69 D;  3EQL C;  3GD7 A;  3OOC A;  3QIA A;  2PPB C;  5C0X G;  3I72 A;  2R6G A;  3WDN A;  1ZYR C;  2PCF B;  1Z7T A;  2QF7 A;  2A6E D;  3VR5 A;  1YNN C;  1H9K A;  3A8I E;  3D4R A;  4JK1 C;  5JEA G;  2O5J C;  3OPO A;  4BA1 I;  2EVB A;  1ONL A;  2A6E C;  1V8Q A;  1CTM A;  5KNC A;  4OO1 G;  2EJF C;  2NN6 I;  5A35 A;  3PUX A;  1DD2 A;  1DXM A;  5BN4 A;  4KKU A;  2B8G A;  2PNR C;  1OXU A;  2IT1 A;  2YYZ A; 
#chains in the Genus database with same CATH topology
 1CUK A;  4JI2 L;  2F4V L;  3JAM E;  2E2J B;  4KY6 A;  3Q23 A;  1MKH A;  5JVH 3;  1I50 H;  4K6D A;  3K0X A;  2F0O A;  2IPK D;  3DWP A;  4TKO B;  4JI8 L;  5LMU L;  2CQA A;  4JI7 Q;  1QOH A;  3S24 A;  1G6Z A;  2ICI A;  4C1N I;  2B2W C;  2MHV A;  4DN4 M;  3I8Z A;  1IYV A;  1KHI A;  1ZEQ X;  2XNA C;  4WJ4 A;  2F0N A;  1HXY D;  1EQR A;  2A73 B;  4CJ0 B;  3DLL A;  4MTK A;  1SJH D;  1YZ6 A;  2RKS A;  3KLS X;  4K5X A;  3JAM c;  1M1K C;  3CCQ A;  5EGT A;  2D9U A;  3MEH A;  2EYJ A;  3G7L A;  3NP8 A;  4LF5 L;  4KHV A;  1Y69 U;  1QB5 D;  3NPP A;  3LX0 A;  3C2P A;  4QY7 A;  1A3U A;  3KBG A;  4JI7 L;  4P74 A;  5I2Y A;  4JI1 Q;  1B8A A;  2B2U A;  3PO2 G;  2RCN A;  4FF2 A;  1LAB A;  2R3Z A;  2WKD A;  1TWC H;  4KHP L;  2O5I C;  3BZD B;  4PMB A;  5IT9 L;  4B9W A;  4A3E H;  4DR6 Q;  2KED A;  2EY1 A;  4X62 Q;  4LUO A;  2BH8 A;  4B3R Q;  1SDF A;  4Z9C B;  1AP0 A;  4HJ9 A;  4FXD A;  4GNX C;  2F0D A;  1X3E A;  5M5Y H;  5CBA E;  1SBB B;  2ENB A;  4ABN A;  4K8J A;  2NVX B;  1PTO C;  5C4X G;  4UY8 C;  1S5D D;  3S1N H;  1Y8N B;  2PPB C;  3GDE A;  5DLQ E;  5C3W A;  5J3B A;  5KYL A;  1AFP A;  3J7A 5;  2UXB Q;  4KJN A;  3S2H B;  2A6E C;  1V8Q A;  1CTM A;  4OO1 G;  2K75 A;  1XJV A;  4J6H A;  2WII B;  1BCP D;  4X66 Q;  3FKI H;  2EXD A;  4A3I G;  5M5Y B;  4DFA A;  2ZTC A;  3S2D B;  5ELC A;  1IKL A;  1LLR D;  3P75 A;  4BY7 G;  4DV3 Q;  3BZC A;  2L5T A;  3IKJ A;  5FLX E;  2AQ3 B;  3ICE A;  1AW7 A;  4M1U B;  4MIU A;  1PTO H;  1DM0 B;  4A3M G;  3VR3 A;  1SE2 A;  2Q2U A;  3M7N A;  1HH2 P;  4AQY Q;  4XXE A;  2OXP A;  4A76 A;  5M3F B;  3NTI A;  1IYU A;  2O4X A;  2CFM A;  4QGU A;  4DV0 L;  4PZ8 A;  4JG2 A;  3E0J A;  3CCE A;  2NZO A;  3D6C A;  1LM0 A;  4PZ7 A;  5CV8 A;  2AUK A;  3CW2 C;  1NUC A;  2Z6K C;  1PH3 A;  1KLU D;  1FR3 A;  2IL8 A;  4YCW A;  1A6X A;  1XNQ L;  5IP7 G;  3IRB A;  3FPU B;  3I4N B;  1VMC A;  2VQE Q;  1PFS A;  3WWV A;  1EY5 A;  1IKM A;  4MZ9 A;  1YHA A;  4WJ3 M;  5FLM G;  3G4S A;  3GQB A;  2GVA A;  2KHS A;  1PH1 A;  1B7Y B;  2EQS A;  2ID0 A;  1IW7 D;  2A68 C;  3NBH A;  1RD9 D;  1BCP B;  2XRQ D;  4QJF A;  5JJK A;  2NVY H;  1K9M C;  2UXD L;  2PI2 A;  4YCV A;  1U4M A;  1F2Y A;  5GAD C;  4B3R L;  3TZD A;  2MNA A;  1QUQ A;  5HGQ A;  1K8G A;  2NYZ D;  4CDC C;  4DAY A;  3CMA A;  1L1O A;  4E6I A;  3HKS A;  1BDO A;  4DAY B;  1N32 L;  5M3M G;  3V05 A;  2NVQ B;  2BE5 C;  4C3H B;  2EPB A;  4A93 H;  5C3X A;  2WB1 G;  3TP6 A;  3PCO B;  4DNI A;  4KK7 A;  2FFK B;  1O7Z A;  2X69 A;  4XIG S;  3GTK B;  1ET9 A;  1BKB A;  1G6P A;  4EGV A;  1MGS A;  3EQL C;  1RCV D;  3GTJ B;  4CKE A;  4LF5 Q;  3EVQ A;  3D8G A;  1S72 A;  3T13 A;  1SYF A;  3NWS A;  1A0I A;  2F0T A;  2EVB A;  1ONL A;  3F2U A;  3NK9 A;  2Z9H A;  4PMC A;  1X3Q A;  2X6L A;  2B8G A;  4QUC A;  2Q8T A;  1O7Y A;  3J7Y W;  1JR0 D;  2NN6 G;  5M3F H;  1SYG A;  1EIF A;  1TR5 A;  2OT2 A;  1BOS A;  4A3G B;  3DM3 A;  2L12 A;  2KUM A;  4LMQ D;  4IFD J;  5EBD A;  2E2J H;  3FDT A;  1N32 Q;  5EPL A;  3SE0 A;  1KDC A;  3K80 C;  2BDO A;  1EWC A;  3SK5 A;  2NVT B;  4LFA L;  1MJC A;  1O7L A;  3I4N H;  2A19 A;  1MHW C;  4DV2 L;  2AHO B;  4KJO A;  2K04 A;  3H0G G;  1SR3 A;  3ITP A;  3I4L A;  5IGB A;  1F9R A;  2VUM B;  1GUO A;  2QIL A;  2WB1 E;  5ELD A;  3OHX C;  4DV1 L;  1MSH A;  2EJM A;  4IUT A;  2ZJP A;  1DYQ A;  4A3F G;  1SXT A;  4OXP A;  3K7A B;  3GTM B;  3MXN B;  3HOY G;  1B50 A;  1O7I A;  4P73 A;  3CCM A;  3SEB A;  1OXS C;  1GJX A;  3CPF A;  1O80 A;  3AYH B;  1WCM G;  3GTO H;  4RCN A;  5K36 G;  2F0K A;  3D3R A;  1EY4 A;  4DXF A;  4IN3 A;  2O2L D;  3H91 A;  1JWU D;  2ZXP A;  4C3J G;  5LMN L;  4I7Z C;  4LF8 Q;  1Y1W B;  2KEE A;  1I4Q A;  1KRS A;  4JI1 L;  2N55 A;  1T9H A;  3HOW G;  2PMZ B;  3TQY A;  1WTH A;  5CC4 A;  3B6Y A;  4G57 A;  3TS2 A;  2QDL A;  1EQV A;  2Z8L A;  1E2Z A;  1Z6H A;  1LTR D;  1DCZ A;  4PZ6 A;  1HR0 L;  1CM9 A;  1A3V A;  3ZJY C;  4FF3 A;  1FYC A;  2NTS A;  2Z0S A;  5KRU A;  4MHE A;  4DK0 A;  2VW9 A;  3HS0 C;  4YCU A;  1YJW A;  2C5C A;  1Y8P B;  3I7F A;  1PRT B;  4G7H C;  3NUC A;  3L7Z C;  4OEL B;  4ZUI A;  2CH4 W;  3E5S A;  1TVX A;  4X66 L;  1VQO A;  1K8M A;  3S1N B;  4DR4 L;  1K28 A;  1CFM A;  1W3S A;  4OEM B;  2CH4 A;  3T4A C;  3W2D A;  1IBM L;  1VQE A;  2R92 B;  1SND A;  2JJQ A;  1L2F A;  1Q7Y C;  2KVM A;  1N33 Q;  4X6A H;  3UE0 A;  2B2V C;  3TN2 A;  3J81 j;  1AE2 A;  3GTQ B;  4JI2 Q;  4QQB X;  4DPG A;  5H1S E;  4HTH A;  1Y8O B;  1EYD A;  1H9J A;  1SNM A;  4JI6 Q;  3ULL A;  3U9S A;  2YTX A;  5LL6 X;  4HMI A;  1RTN A;  4ILW A;  2DUD A;  4C3I H;  5EPJ A;  2NB0 A;  1BF4 A;  1NAP A;  3VYU A;  4OHJ A;  1PZI D;  2IX3 A;  4ODG A;  5C44 B;  2WAQ G;  2UXC Q;  4QL5 A;  3E3X A;  3GTP B;  2M2L A;  2JP1 A;  4BXX H;  1EQQ A;  1TWG H;  5ELN A;  3GTK H;  1VMP A;  1L0X B;  1XNR Q;  2ZTE A;  1TS2 A;  2L55 A;  5C44 H;  1WTP A;  3MA2 B;  1XXG A;  1ICW A;  2EYF A;  1LO5 D;  2N49 A;  1H95 A;  5JOB A;  3A55 A;  4XQJ A;  2F0W A;  2K5N A;  1WCM H;  3NWT A;  4CGY B;  3CKI B;  1DZ1 A;  2ZM6 Q;  1STA A;  4BWG B;  1A2U A;  2E76 C;  3IAY A;  1PH9 A;  1RKN A;  1VQP A;  1VQ4 A;  2E75 C;  4O42 A;  2F1M A;  1VQB A;  3BG3 A;  3UE1 A;  4BY7 B;  4CKB A;  1TWF B;  5IT9 c;  3GTQ H;  1M4V A;  1EZ8 A;  1JMC A;  1ML0 D;  1WFQ A;  2CKZ B;  2EYH A;  5J39 A;  1PV4 A;  4QCL A;  4TVA B;  3RN5 A;  5CBE E;  1TU2 B;  1GVP A;  3GO5 A;  4GN4 B;  3BZK A;  4R9W A;  3LWU A;  1CSQ A;  2R92 H;  5NUC A;  3MXP A;  2K7V A;  3AQQ A;  4DGZ A;  5IE8 A;  5M5X B;  2F0J A;  4L5Q A;  4OWT B;  3G6J B;  3T56 B;  2LMC B;  2KEN A;  3DEP A;  4HN7 A;  2A69 D;  1I4P A;  4BBR H;  1J8I A;  3OWE B;  2RBM A;  2KJX A;  4DR3 Q;  3L9A X;  1EOV A;  2R93 B;  3RZO H;  1EYA A;  4C3J B;  4ME5 A;  1K83 H;  3I56 A;  1SMY D;  4V0B A;  5EQ0 A;  4YHH Q;  2JA7 B;  3SGI A;  4RHS A;  4Y52 H;  2ICE C;  5CV5 A;  1YIT A;  2LY7 A;  1PVO A;  5A2Q E;  3NTK A;  4POF A;  2VB2 X;  3E9I A;  3RUZ A;  3BVZ A;  4GKJ Q;  2EYP A;  1TY2 A;  3VYS A;  1LTS D;  1EY6 A;  3EFX D;  4DR2 Q;  1HNW L;  4L6T B;  4F7X A;  1SNP A;  2AMC B;  2EYM A;  1TT2 A;  4IUR A;  4IUU A;  1TXY A;  1LTB D;  1VF7 A;  4P72 A;  4JCV E;  3S1M H;  4JBJ A;  3S2H H;  1CKM A;  1EQT A;  3PUW A;  2DJG C;  4F88 A;  1D2B A;  3JAM i;  2KOL A;  2B2T C;  4YY3 Q;  2B63 H;  3TRE A;  2RDH A;  2ES2 A;  5JPM C;  2WP8 J;  2UU9 L;  4BY1 H;  4O2D A;  4C2M B;  1HNZ L;  3GTL B;  1AN8 A;  5E1F A;  2L11 A;  2EJG C;  2IJ0 A;  3T53 B;  1Q90 A;  2N78 A;  5CGK A;  1W2B A;  1PA6 A;  3GTO B;  1K8A C;  4NXN Q;  3RZO B;  3HOW B;  4NMZ A;  1Y1V G;  1L1O B;  1ROD A;  4QIW B;  4Y7N H;  3A54 A;  1B4O A;  4RAU C;  3OW7 A;  4RGO S;  2JA7 G;  3PO2 B;  4GLV B;  1DOM A;  1WOC A;  2IW3 A;  4RGM A;  4UPA A;  5AFW A;  3PGZ A;  2TSS A;  5IYB H;  2R93 G;  2K50 A;  1WTO A;  3M9B A;  5IT9 E;  2B2U C;  2KEC A;  1TWC B;  2K6A A;  2FJ2 A;  1PDQ A;  5C6A A;  2MP1 A;  4LK1 C;  1RTO A;  2JN4 A;  1SE4 A;  3QB3 A;  1Q8I A;  3KUP A;  4LFA Q;  1PH6 A;  2KBN A;  4X62 L;  1JT8 A;  3M4Y A;  2OQK A;  4LFB L;  2E2H B;  4BY7 H;  3NQT A;  2UXD Q;  1K0S A;  4N9T A;  2IX0 A;  1FGU A;  4LFC L;  1MIU A;  1OXT A;  3DEO A;  5GAH C;  4A3G H;  4FYD A;  3VYR A;  1I94 Q;  5FO9 B;  2E74 C;  5TSS A;  2F4V Q;  1NMG A;  4HJ7 A;  3S15 H;  4A3M H;  1XMQ Q;  2YTY A;  3N6R A;  2L4N A;  2QCP X;  3A8K E;  5IIF A;  4A3D G;  1GHJ A;  2JEA I;  4FNF A;  4A3K G;  3NEM A;  3S17 B;  1YI2 A;  2QF7 A;  1CHQ D;  4OO1 I;  3TP8 A;  3S1Q H;  2PZU A;  2LKV A;  1LTL A;  1S4Z A;  4YWK A;  2I46 A;  1SYB A;  1SN8 A;  5DEH A;  2UUA L;  5JJL A;  5IYC H;  4KKU A;  2F4I A;  1UUP A;  2UUB L;  4DR1 Q;  4CKC A;  1CKN B;  2WIN B;  5IYD G;  4HSV A;  2F0V A;  4DKA C;  4AQY L;  4C3I B;  1U4P A;  3EA6 A;  2N8N A;  2RQX A;  5C5L A;  3TSS A;  1KL9 A;  2EYL A;  5DM6 3;  3MAQ A;  2B39 A;  3S14 H;  3MXU A;  4DR2 L;  1HNW Q;  3VR6 A;  4A3C H;  2RHS B;  4IZ8 A;  1TS5 A;  3RR5 A;  1EY9 A;  1JJG A;  3A7A B;  1XTC D;  1E3P A;  3ULP A;  1PH8 A;  1G91 A;  4F8M A;  5LMN Q;  5I9P A;  3PUZ A;  3HOY B;  5COY A;  1II3 A;  4DV6 Q;  1K0R A;  2F0S A;  4OX9 L;  2DY8 A;  1I4X A;  3K5O A;  2MFI A;  5E4W C;  4L63 B;  1QVC A;  1E2W A;  3SK6 A;  4NB3 A;  2IX1 A;  1Y1V H;  3P1H A;  1B70 B;  1HA6 A;  1JWS D;  3OTO Q;  5GAG C;  2PW7 A;  1EYC A;  5HGT A;  4ZCK A;  4LF9 L;  2AWN A;  5ELF A;  1HZ9 A;  4IQZ A;  1QVF A;  1YIJ A;  2HIX A;  1UEA B;  1XYI A;  2PI2 E;  2V1C C;  4DAM A;  2Q2T A;  2PZT A;  3MXN A;  4P75 A;  4IOC A;  1PH7 A;  2K32 A;  2VQF Q;  4WOR A;  1CZW A;  3QOL A;  1RJT A;  2QEJ C;  4JPB W;  1GO3 E;  1HHV A;  4IFD G;  1KTK A;  1R9T B;  3HOU H;  2ZTD A;  3NXW A;  1S40 A;  2VZA A;  3PO2 H;  2KHJ A;  1HFN A;  3CHB D;  1AZQ A;  2EZV A;  4OWW B;  1HJP A;  4IPH A;  2BA0 A;  3LGJ A;  3HOX B;  2XGT A;  2I0Q A;  5JPN C;  1ZKO A;  3J81 i;  1EZ6 A;  2YU9 H;  4IO9 A;  4A3E G;  1D5Z C;  4R4T A;  4NXM L;  2F0G A;  1KNE A;  4XYQ A;  3ND8 A;  5K5P A;  3H3V I;  2H5X A;  3JC6 6;  3GD7 A;  3QIA A;  4C2M H;  5C0X G;  3PQI A;  3C46 A;  4UP7 A;  4JV5 Q;  4WJW A;  2ZXR A;  4I7A A;  3VR5 A;  1SRO A;  1XTD A;  3A8I E;  4JBK A;  1SNC A;  3S1M B;  4C56 C;  4GN5 A;  1VS0 A;  1ENC A;  4R1J A;  5J1Z A;  2NN6 I;  1L0W A;  3HOU B;  3HOY H;  2K05 A;  4ZYS A;  1X3F A;  5IYC G;  2IT1 A;  3STB C;  4ZKC B;  1V43 A;  2C35 B;  1HUM A;  4B3S Q;  4X65 L;  4B3S L;  2XN9 C;  2GA4 B;  1IBL L;  1TS4 A;  1HFG A;  5C4X B;  3QJY A;  1TWH H;  3AMU A;  1XPR A;  4PNY A;  3I4M B;  1GOZ A;  4GOP A;  4L5S A;  1FVI A;  1SLJ A;  2NZH A;  4B08 A;  1Q3L A;  1LT4 D;  3TEH B;  4LW1 A;  1BBX C;  1JE4 A;  1QG7 A;  4FP5 D;  1Q81 C;  5M3M B;  2DNC A;  4DNR B;  2PW5 A;  3ERO A;  3F8T A;  3S1Q B;  4JVZ A;  3H94 A;  3K5M A;  1GUS A;  5FJ8 H;  2A8V A;  2B2Y C;  1STN A;  2XRS D;  1X56 A;  3U4V A;  3CPW A;  2A69 C;  1YNX A;  2GVB A;  2DN8 A;  5C4H A;  3S1R H;  1YVC A;  4IJL A;  4LJZ C;  4DV0 Q;  2NTT A;  4A3M B;  1OXV A;  4LUZ A;  3KJP A;  1ASY A;  3KDF A;  4C3H H;  4A3B H;  2PYK A;  1QIL A;  3HGB A;  5IP7 H;  3RN2 A;  2BH2 A;  3QO2 A;  3A56 A;  1S5F D;  3C3L A;  2I07 B;  3HEJ A;  2K01 A;  3M3Y B;  1B9M A;  5LL6 S;  1WD1 A;  3MTS A;  4HED A;  4DU9 A;  1FJG Q;  4BA2 I;  1LT6 D;  3VR2 A;  3I4O A;  4FO2 A;  4JI3 L;  1Q1B A;  3MVV A;  1I50 B;  2XTI A;  4R8N A;  5BR8 L;  2MO0 A;  1F2Z A;  5DAU A;  1X55 A;  3C1E A;  3Q6S A;  1FNW A;  1W6J A;  2D62 A;  4CJ1 B;  1Y14 B;  4R4I A;  4QF4 A;  3KJO A;  2LS0 1;  1N8R C;  2R7Z H;  2F3W A;  3GTG H;  2MJ8 A;  2EOT A;  5M3M H;  3K8A A;  3OOC A;  1PFM A;  2Z1C A;  1Q86 C;  3OIP A;  4GLA C;  5BR8 Q;  2J4X A;  4XDX A;  1I3Q B;  1KDA A;  2JA9 A;  4JC0 A;  1FJG L;  1JOK A;  1ZXT A;  1ICF B;  3I55 A;  4POG A;  1SJE D;  4HJ8 A;  1EIG A;  5GQO A;  2VXW A;  1VQA A;  2G9H D;  4H0L C;  2PMZ E;  1JQY D;  4RGT A;  4DR6 L;  1VF5 C;  2F0M A;  1H9M A;  2JA8 G;  4BBS H;  4X3T A;  2UUA Q;  1UNS A;  4KHP Q;  4HAE A;  1DOL A;  2NN6 H;  2K5W A;  5M3F G;  4LF7 L;  1JOQ A;  4HSP A;  3H0G B;  2HDL A;  5T1G A;  3G48 A;  1D6E C;  1STB A;  2PNH A;  5FKA C;  3PO3 H;  5FLX c;  3MFG A;  4HID A;  2JYO A;  1I6H B;  5IGE A;  3MWY W;  2NZ1 D;  2CVR A;  3AU7 A;  1HZC A;  1XX8 A;  2VY3 A;  2PQA B;  1SMY C;  4KTA A;  3CXC A;  3G6E A;  4KD3 A;  1NNX A;  4IUP A;  5I6Y A;  4EX5 A;  1VQF A;  2AWO A;  2RDG A;  4DA2 A;  1BXT A;  1FL0 A;  4ZUJ A;  2L1B A;  2WFW A;  2LXJ A;  4MTN A;  5EJW A;  5I9O A;  1JOR A;  3U50 C;  4A3B G;  5CMD A;  3HFZ B;  2BOS A;  1IYJ B;  1ILP A;  2ZXO A;  4C3J H;  2KCC A;  2L9H A;  3RNU A;  5D3I B;  2F0F A;  3KDF B;  2B3G A;  1X65 A;  2E8G A;  3AFP A;  4KLK A;  1IBK L;  2N3S A;  1HCZ A;  4JI5 Q;  2VL6 A;  1WCM B;  4K2K A;  4AYB B;  3E9H A;  1KXL A;  3MC0 B;  2MO1 A;  3SDZ A;  2B63 G;  1EIY B;  4OIK A;  3J80 L;  2MUY A;  4EQ5 A;  1XWE A;  1CZG A;  3SK4 A;  4JI3 Q;  2AQ2 B;  2MGS A;  3S16 B;  3R93 A;  3GTG B;  1G51 A;  2UUC L;  2HCI A;  1TWG B;  2F0U A;  4LF6 L;  2L0C A;  2K5Q A;  3KF8 B;  3U58 A;  4KD4 A;  4B3M L;  2BCO A;  3Q8D A;  1OXU A;  2VB3 X;  1Z9F A;  4B3T L;  2HQE A;  1QNU A;  1RF2 D;  4K5W A;  4G7Z C;  3DUZ A;  3NHH A;  1PHJ A;  1OXX K;  4BBS G;  3K58 A;  3P7J A;  2FXQ A;  4LWC A;  1VQ9 A;  2I5H A;  2F3I A;  2RHQ B;  1P16 A;  1Q12 A;  1SE8 A;  3K5N A;  4HJA A;  1B2T A;  4CDD C;  1TY0 A;  3DMU A;  4RH6 A;  4O0A A;  4X3K A;  4PV1 C;  5JJZ A;  1QNK A;  4DV6 L;  2CCZ A;  2JK8 A;  4IAL A;  1BCP F;  1LUZ A;  3OW2 A;  1T5E A;  1X3P A;  1WTV A;  3ERQ A;  3KF8 A;  3PF4 A;  2KCM A;  1X3G A;  1VQM A;  2A74 C;  1Q8K A;  4A4I A;  2JA5 B;  4IUV A;  1MD2 D;  3AB9 A;  3HZX A;  4HMJ A;  4KKS A;  1PH5 A;  3HOV H;  5CV7 A;  1WJJ A;  3UI2 A;  1TWH B;  3W5O A;  2Q2H A;  4IFD I;  5A2Q L;  4K0K L;  4GNX B;  2CW0 C;  4OON A;  5FO7 B;  1E24 A;  4DUZ Q;  1H9S B;  5COR A;  5D3D A;  5GAE C;  4A3D B;  2F0H A;  4GN3 B;  5IYD H;  2PQA A;  5EPK A;  2ALY B;  1PFB A;  1VCI A;  4JV5 L;  2HCC A;  4HIK A;  2Q2I A;  3STB D;  5IP9 G;  2OEO A;  4JBW A;  4NXM Q;  1EOT A;  3H3V C;  1QWY A;  4QUF A;  2LFN A;  4L5T A;  5IWA Q;  1IW7 C;  2A68 D;  4UP8 A;  2HT1 A;  2F0I A;  2YU9 B;  1IXR A;  1RIP A;  2Q8R E;  4Q0F A;  3ZYY X;  4CDF C;  3GTL H;  3K7A H;  3OYY A;  4ZKB B;  5AJ3 Q;  2B63 B;  1CHP D;  4DF7 A;  2O5J C;  1I94 L;  2HIV A;  1I6H H;  4JI4 Q;  1PXU A;  1I5F A;  5FO8 B;  4GKK Q;  3H09 A;  1JOO A;  4EQO A;  4ZK9 B;  3PO3 B;  2F0E A;  4DUZ L;  1IL2 A;  3Q22 A;  1STY A;  1EY8 A;  2NBF A;  4A3J B;  2JEB I;  3UDG A;  1SRU A;  1BBU A;  5CV6 A;  5T1I A;  2G9D A;  4LF9 Q;  1P8L A;  2JA6 G;  3D4W A;  2ZT9 C;  4M8A A;  1X6O A;  3LWE A;  2YV5 A;  3ERS X;  1E1T A;  2JE6 I;  4DV5 L;  4NPS A;  2E2I B;  3HOU G;  4IUQ A;  4HR7 B;  5CYU A;  5GRO A;  5JJI A;  2N88 A;  4N8F A;  3Q24 A;  3Q0A A;  2ZJR A;  4DR5 Q;  1KAA A;  1HUN A;  1U0L A;  1GM5 A;  2HQL A;  1F9Q A;  3GV6 A;  4K14 A;  2K28 A;  1HNX L;  2K5H A;  3CCS A;  5D65 A;  4GZY C;  4C3I G;  1LAC A;  1LT5 D;  2FMC A;  2NVT H;  1B3Q A;  2JQO A;  3SVM A;  2RSN A;  3CD6 A;  1Q82 C;  2EDG A;  1EU4 A;  2LSS A;  1AE3 A;  2RF4 A;  3KK7 A;  4BXX G;  4RCO A;  2DY7 A;  1JJC B;  3J7A F;  3NBH B;  4LF8 L;  2EXZ A;  3EJI A;  4X64 L;  2XSC A;  2VUM G;  1CI3 M;  3CCL A;  4YHH L;  2KCN A;  1PYW D;  4XYO A;  5IOC A;  4DV4 L;  1KNA A;  1HNX Q;  4EVO A;  4DV7 L;  1VDZ A;  2ATW A;  1KD1 C;  3F1Z A;  3PIO A;  4DR5 L;  3TRZ A;  1BO0 A;  3PUV A;  2Z4I A;  3R2I A;  4YWM A;  3F2B A;  3S16 H;  4CDE C;  4A3G G;  1VQI A;  1J5E L;  4LFC Q;  2K03 A;  2PCF B;  3A5Z B;  5EAY A;  4DK3 C;  2I5L X;  3D4R A;  3PIP 3;  1N34 L;  1C0A A;  3HOZ G;  4DAP A;  2XIW A;  2B2Y A;  2AKW B;  3QOJ A;  4A3K H;  1B53 A;  3K7U C;  2HDM A;  4U67 3;  2R7F A;  4PQX A;  3D6W A;  3QG1 A;  1F9S A;  4MNO A;  4A3J G;  5IGF A;  4DR1 L;  1PZK D;  4LF4 Q;  3AEV A;  1ZYR D;  3A5U A;  1KLG D;  1NTG A;  1VQH A;  1N36 Q;  1MSG A;  4O1N A;  1HTP A;  5KND A;  1Q46 A;  3FKI B;  1UWV A;  2R61 A;  3PUY A;  1PRT F;  5C0X J;  1EU3 A;  4N8X 1;  1JJ2 A;  1HNZ Q;  4JYA L;  2I5M X;  1CKN A;  1G29 1;  4XT3 B;  5ELO A;  4B3M Q;  3NEN A;  1VQ8 A;  4QIW E;  2WKC A;  3KF6 B;  4OIJ A;  2K5D A;  4Y7N B;  3A8J E;  3PIO 3;  1X9N A;  3VA5 A;  3DXJ C;  3DWA A;  2R7Z G;  3F2D A;  2E5L L;  4KMU C;  1KQS A;  1NR4 A;  1A8V A;  1FNU A;  2WAQ B;  4LFB Q;  4YWL A;  5C4J B;  2D5D A;  2H1E A;  1U4R A;  2CW0 D;  3KLR A;  4ZLT F;  4X3U A;  1RDP D;  3I4M G;  3VYT A;  1LYL A;  1CT1 D;  4N9P A;  5E3F A;  4AYB E;  1BUV T;  1E1O A;  5DM7 3;  1XMO L;  1OTC A;  4GLX A;  4ALP A;  1Y1W H;  3BYY B;  3TBI B;  1NE3 A;  2QKI C;  2JA7 H;  3K81 C;  3H3V H;  4RG1 A;  4ULL A;  2BDN A;  3NBI A;  2KCT A;  4ME3 A;  2F03 A;  2D2C C;  2R93 H;  5EKL A;  2Y0S B;  1IBM Q;  1T5X D;  4DR7 Q;  4OO1 H;  3I73 A;  3GTM H;  4YIJ A;  5I2X A;  2K1B A;  4XQQ A;  4BBR B;  4JBM A;  3V2T A;  4A3I H;  2RCF A;  4G7O C;  1LV9 A;  3TDQ A;  2PQE A;  1UE5 A;  3OIQ A;  4BS9 A;  4V19 0;  1Y1V B;  4GKK L;  4DUY Q;  3R3O A;  1EFW A;  1YEZ A;  2WB1 B;  3I3C A;  5AJ3 L;  2E2D C;  2NUC A;  3QR8 A;  3U4Z A;  2VS1 A;  1HR0 Q;  2B2T A;  3OWF A;  1TQO A;  4G4K A;  2MQH A;  2BA1 A;  2VQF L;  4DV7 Q;  3A7L A;  1S5B D;  5LMN W;  2WAQ E;  2ZM6 L;  5E7N A;  4DV4 Q;  2TMP A;  1UE7 A;  3CC7 A;  5G3L D;  3BYT B;  3CRL C;  4H02 A;  1EUJ A;  4KN4 C;  4LF7 Q;  4LF6 Q;  1CA5 A;  1HZA A;  4R4O A;  1LTI D;  1W6K A;  3FEW X;  2JA5 H;  5DNF A;  1F9P A;  2F0Q A;  2HHH L;  5M5W H;  1PRT D;  1JIC A;  1YJ9 A;  2OF1 A;  3ER0 A;  3MFY A;  4RA8 A;  1R4Q B;  3I90 A;  4IOA A;  1EEI D;  1MJE A;  1KIX A;  4LNQ A;  4XT1 B;  4AIM A;  1U4L A;  5ISR A;  4ZRZ A;  4KY7 A;  4HIM A;  4A3C G;  1V1P B;  3T1Y Q;  1GXD C;  1LTA D;  3KOJ A;  2EY5 A;  2FMM A;  4GNX A;  3CQZ H;  2ZJQ A;  2DGY A;  4FF4 A;  3GP7 A;  4WRD A;  1VQL A;  1D7Q A;  1MBY A;  4LAA A;  2R7D A;  1STG A;  5HY6 A;  4L8J A;  5IGC A;  3J7Z C;  3I4M H;  1SEB D;  2A5H A;  4AH6 A;  2HHH Q;  1KAW A;  5I6W A;  4K5V A;  5C4X H;  4TSS A;  3S9W A;  1F2L A;  4EQN A;  1SMX A;  4FF1 A;  2EY6 A;  3OMG A;  2AUJ D;  2C9O A;  1GUT A;  1UE6 A;  3J80 E;  3WOF A;  2Y0S G;  3M7G A;  3F2C A;  3HKZ G;  4JOI A;  1NJI C;  3HRZ C;  4K6L A;  1WTW A;  1V1P A;  4JI4 L;  1YNN D;  2D0P A;  3SK8 A;  1EY0 A;  2Z4H A;  1XPO A;  1CSP A;  1DOK A;  1STH A;  2F3V A;  4A75 A;  4NP5 A;  2E2I H;  1H9K A;  2EE1 A;  5JEA G;  4DUY L;  1LTT D;  1JCK B;  4J1M A;  5KNC A;  2SDF A;  5EKI A;  4JYA Q;  1NMF A;  2EJF C;  3OSO A;  5A35 A;  3CCV A;  1PTO B;  4A3I B;  5BN4 A;  3I4N G;  3J81 L;  5E4X A;  4DAV A;  1GHK A;  1KC8 C;  5M9O A;  3H0G H;  4CHT B;  2IWH A;  2V4D A;  1Q1E A;  1PMR A;  1K73 C;  1G2T A;  1ENA A;  1PFN A;  3FRP B;  3RLO A;  4DR7 L;  1YNJ D;  1F77 A;  4KN7 C;  1JE5 A;  2FHT A;  3K6O A;  1U5K A;  1UE1 A;  3M4Q A;  5JAV A;  4CJ2 C;  3OTO L;  1A63 A;  4WFN 3;  4DR3 L;  1NCV A;  1D5X C;  1G8Z D;  2JA5 G;  2K33 A;  4UP9 A;  1S5C D;  2RDF A;  3PV0 A;  4H7B A;  1XMO Q;  4X65 Q;  1AH9 A;  2OQ0 A;  4DV1 Q;  5C5M A;  1SNQ A;  4P71 A;  1EWI A;  2JA6 B;  5D14 A;  4DK6 C;  2OTL A;  2KA7 A;  1H9R A;  1Z47 A;  3NEL A;  4JOI C;  5FLM H;  3M85 A;  2H4O A;  4GS3 A;  4UHV A;  3T1Y L;  4PMW A;  1CKO A;  5BN3 A;  1DON A;  2E5L Q;  1WD0 A;  2G5D A;  1I4R A;  1GUN A;  1HQM C;  2K4K A;  3A0J A;  3V96 A;  3PO3 G;  4DNT B;  3HOX G;  1C4Q A;  3MZ5 A;  4QB4 A;  2A6H D;  1QZH A;  5IWA L;  1VQ5 A;  4BBS B;  4CBV A;  1UAP A;  4HCS A;  4P2C B;  3VR4 A;  3BDC A;  4HJ5 A;  1F2M A;  2RVL A;  2YTV A;  1TS3 A;  3HOZ B;  4R4Q A;  5G3L F;  3BJU A;  1QJO A;  1HQR D;  1XPU A;  5FJ8 G;  2KQ3 A;  3KYH C;  3E6Z X;  4RGN A;  1VQN A;  4A3K B;  2JSO A;  3ND9 A;  3SR1 A;  2RA4 A;  3BVG A;  3D4D A;  1BBW A;  4LF4 L;  1C48 A;  1R4P B;  3TME A;  3M4P A;  1I3Q H;  1KRT A;  1A62 A;  4U68 A;  4B3T Q;  4FXK C;  1RHP A;  4C3H G;  5KIX A;  1BCP C;  1S5E D;  3O13 A;  2PZW A;  3BVM A;  1CA6 A;  3H6M A;  4EQP A;  5IOD A;  3W1G A;  2UUC Q;  3PMF A;  1QE6 A;  4H13 C;  3J81 E;  1C8C A;  1ILQ A;  1VQC A;  1WI5 A;  2QGQ A;  3RMH A;  3UDX A;  3WDN A;  4B9X A;  1N34 Q;  1Z7T A;  4DV2 Q;  4JI0 L;  2A6E D;  3J80 i;  1DGS A;  3CP0 A;  4RWS C;  5KYI A;  3HKZ B;  1MI2 A;  1J5E Q;  5HUR A;  2NVQ H;  4BA1 I;  4JI6 L;  4IPD A;  1PZJ D;  1DD2 A;  3PUX A;  4FVM A;  3GV3 A;  3EIV A;  2PNR C;  3ULJ A;  3S14 B;  2YYZ A;  3M3Y H;  4A93 B;  2B2W A;  4DV5 Q;  3AFQ A;  1WTX A;  4MN3 A;  1J9O A;  2SOB A;  3BDL A;  1IHZ A;  3BS1 A;  1QVG A;  4KHZ A;  3JAM L;  2CWA A;  3DM1 A;  1E22 A;  4JW0 A;  2PO4 A;  2VQE L;  1BNZ A;  5JEA J;  1FD7 D;  3CCU A;  4XQN A;  3FP9 A;  2NVY B;  4A3F H;  3CAM A;  2Q8I B;  3S1R B;  1V1Q A;  1VQ6 A;  2IY5 B;  1NSN S;  4H44 C;  2D0O A;  2CHB D;  2AQ1 B;  2OTJ A;  1IZ6 A;  1GUG A;  1HA5 A;  4NXN L;  1FGB D;  3I2Z A;  5K36 H;  1XNR L;  2UU9 Q;  1B9N A;  1AZP A;  1STE A;  1SYC A;  1B3A A;  2EY2 A;  2JA8 H;  3T1H Q;  4F87 A;  5ELE A;  3CF5 A;  1EEF D;  3RD4 A;  1YJN A;  5L37 A;  3S15 B;  1TII D;  3EN2 A;  1EYG A;  3FKI G;  3HOW H;  1SNO A;  4L5R C;  3K5L A;  3KLW A;  1YBY A;  4OGQ C;  3FMC A;  1CQV A;  3K57 A;  1TWA H;  5C3E H;  5I4D A;  1N9W A;  3HOX H;  2QW7 A;  1SSO A;  4KY5 A;  1E0B A;  1XMQ L;  4RMF A;  3RLF A;  1LT3 D;  1S3O A;  1CK1 A;  1I4H A;  2MPM A;  5IY0 A;  3S2D H;  4DXG A;  4ID6 A;  3HOV G;  1PLF A;  5KGU A;  1E2V A;  4APV A;  3X3N A;  3ONA B;  4BBR G;  4RHR A;  3PSI A;  1D1K A;  1G2S A;  2BE5 D;  3QWN A;  1BQQ T;  1GKH A;  2WV6 D;  1A15 A;  2K14 A;  4A3J H;  2L15 A;  2P5Z X;  1QUQ B;  1V1O A;  3C1F A;  3P20 A;  1XNQ Q;  3N52 A;  4RKL A;  3MXG A;  4ZAI A;  2F52 A;  4GOP B;  1HR0 W;  4A3L H;  5C4Z A;  1BR9 A;  4C1N K;  1K83 B;  5LHY 1;  3T51 B;  1WVL A;  4XTC S;  3IFT A;  1DJR D;  2R6G A;  5IGG A;  2XVS A;  5IP9 H;  1OO9 B;  3OPO A;  3BU2 A;  2SEB D;  4GOP C;  2OWO A;  2GN5 A;  1PRT C;  2M9V A;  1HTL D;  4IUN A;  2SNM A;  2NVX H;  3R2T A;  1U9R A;  3NSW A;  2Z6B A;  2B29 A;  4DV3 L;  1YNJ C;  1UEB A;  1PTO D;  4A3F B;  3L2P A;  1JWM D;  2IHF A;  4I65 A;  1I6V C;  4A93 G;  1CQF A;  4UAI A;  3DHQ A;  4ZQ3 A;  1HZB A;  4NKL A;  1VQD A;  2QEX A;  1Y1W G;  4R4C A;  2UXB L;  1B1Z A;  5C44 G;  3W1B A;  1VQG A;  4GKJ L;  1FNV A;  4DK1 A;  5IYB G;  1WTR A;  1NBW A;  2EYO A;  3U9O A;  3TS0 A;  1O78 A;  3CQZ B;  1GUW A;  2R7Z B;  2UXC L;  1IL8 A;  3BDO A;  3FVQ A;  4LUV A;  1BVS A;  1ET6 A;  1WTQ A;  2A1A A;  3T16 A;  4IPG A;  1JB3 A;  2J7Z A;  1C9O A;  1JC7 A;  3I70 A;  2A6H C;  2EIF A;  2DJF C;  5LMU Q;  4K8I A;  4NDX A;  1RL2 A;  2LXK A;  1QCB D;  3EBE A;  4PG3 A;  4RFB A;  5M5W B;  4OX9 Q;  5C3E G;  3VA7 A;  1NY4 A;  3TP5 A;  1D8L A;  2R92 G;  1EIH A;  2QA4 A;  1SAP A;  1ESR A;  2E2H H;  4A3B B;  3MEF A;  1K8O A;  3CC2 A;  1JB7 A;  1N33 L;  3SXH A;  4TQU S;  3URY A;  1ENF A;  1A2T A;  1B44 D;  1IBL Q;  1PH2 A;  1PYS B;  4Q5V A;  5KEE A;  5C0X I;  1HPC A;  3MHB A;  3NE5 B;  2HD3 A;  2CWP A;  3CCJ A;  3T1H L;  4HCE A;  2XWJ B;  3S17 H;  4A3L G;  3RZD H;  5JVG 3;  2OCE A;  2UUB Q;  2ASB A;  1V9P A;  4YY3 L;  5EKK A;  1SFO B;  2QDB A;  3J80 c;  2JXM B;  3GTP H;  1E7Z A;  3L3O C;  1K3B C;  1VQJ A;  2F0L A;  5CV9 A;  1SYE A;  4RKB A;  1EY7 A;  3KFU A;  3J81 c;  1VQK A;  2SNS A;  2M00 A;  3D0F A;  1ESF A;  4FDB A;  1D5M C;  4JI8 Q;  4JI5 L;  1QZG A;  3CRK C;  4NW2 A;  2HUG A;  3W3A A;  1IBK Q;  2CQO A;  3CC4 A;  1N36 L;  1D1I A;  3CCR A;  4BY1 G;  3HOZ H;  1SYD A;  4OL7 A;  4J8Q A;  4AYB G;  2K5V A;  3FPP A;  1HRJ A;  3SHL A;  3TZU A;  1L0Y B;  5FOB B;  3FHW A;  4JI0 Q;  3K0Y A;  2B8F A;  3HKZ E;  4K0K Q;  1YHQ A;  2X6G A;  1EFI D;  3HG9 A;  3PF5 A;  1AEX A;  4K2L A;  1WYD A;  3D31 A;  1PYB A;  4KV6 A;  1KDB A;  4X3S A;  3J7A V;  5IGD A;  5EBC A;  3IL8 A;  3R8B A;  5J22 A;  2JA6 H;  2B2V A;  4J15 A;  3OMC A;  4HIO A;  3M4O H;  4BY1 B;  1H9S A;  5F2D A;  2K52 A;  3M4O B;  3CU7 A;  3DWQ A;  3LNN A;  5FLX L;  1J6Q A;  5BN5 A;  4IFD H;  3HP3 A;  2NWG A;  1C7Y A;  3E0E A;  1M8A A;  3KBX A;  1ASZ A;  3H15 A;  3TP7 A;  1YHB A;  1R9T H;  1I4G A;  1PTO F;  4UDU C;  1M90 C;  4DR4 Q;  1PH4 A;  5JEA H;  3KF6 A;  4KI0 A;  2F0P A;  4QMG A;  2DNE A;  3VDY A;  3NTH A;  1L1O C;  1X54 A;  5ELB A;  3A74 A;  1GD7 A;  4A3E B;  3UDI A;  1EL0 A;  4IJH A;  3UDF A;  3K59 A;  3X3M A;  4KKT A;  5CR3 A;  1TWA B;  2J0T D;  5C3E B;  5C0X H;  4IPC A;  4A3D H;  1EWH A;  1TWF H;  5CV4 A;  4X64 Q;  5C4J H;  3PIP A;  3G71 A;  2FIN B;  3KLS A;  5FK9 C;  3WOE A;  2VNU D;  1K3R A;  2KHI A;  3RLN A;  1TKW B;  4FXG C;  1NR2 A;  2JA8 B;  1X32 A;  1LTG D;  2RSO A;  1SFO H;  3HOV B;  3IFD A;  1SE3 A;  5KNB A;  3CME A;  2IHE A;  4TRD A;  4OWX B;  2VUM H;  1VQ7 A;  3L0O A;  4S3S A;  2Z6K A;  3I72 A;  3GTJ H;  4R8I A;  1ZYR C;  5M5X H;  1YNN C;  2WAC A;  4JK1 C;  2Y0S E;  3RZD B;  2XWB B;  1A3T A;  3I91 A;  1DXM A;  1KAB A;  3NQI A; 
#chains in the Genus database with same CATH homology
 3JAM E;  2E2J B;  4KY6 A;  3Q23 A;  5JVH 3;  4K6D A;  2F0O A;  2IPK D;  3DWP A;  4TKO B;  2CQA A;  1QOH A;  1G6Z A;  2ICI A;  4C1N I;  2B2W C;  2MHV A;  4DN4 M;  3I8Z A;  1IYV A;  1ZEQ X;  2XNA C;  2F0N A;  1HXY D;  2A73 B;  4CJ0 B;  1SJH D;  2RKS A;  3KLS X;  4K5X A;  5EGT A;  2D9U A;  3MEH A;  2EYJ A;  3G7L A;  3NP8 A;  4KHV A;  1Y69 U;  1QB5 D;  3NPP A;  3LX0 A;  3C2P A;  1A3U A;  3KBG A;  5I2Y A;  2B2U A;  4FF2 A;  1LAB A;  2R3Z A;  2WKD A;  2O5I C;  3BZD B;  4PMB A;  5IT9 L;  4B9W A;  2KED A;  2EY1 A;  1SDF A;  4Z9C B;  1AP0 A;  4FXD A;  2F0D A;  5CBA E;  1SBB B;  2ENB A;  4ABN A;  4K8J A;  2NVX B;  1PTO C;  1S5D D;  1Y8N B;  2PPB C;  5C3W A;  5KYL A;  1AFP A;  4KJN A;  3S2H B;  2A6E C;  1V8Q A;  1CTM A;  4OO1 G;  4J6H A;  2WII B;  1BCP D;  5M5Y B;  4DFA A;  3S2D B;  5ELC A;  1IKL A;  1LLR D;  3P75 A;  2L5T A;  3IKJ A;  5FLX E;  2AQ3 B;  1AW7 A;  4M1U B;  4MIU A;  1PTO H;  1DM0 B;  3VR3 A;  1SE2 A;  3M7N A;  4XXE A;  2OXP A;  5M3F B;  3NTI A;  1IYU A;  2O4X A;  3E0J A;  3D6C A;  5CV8 A;  2AUK A;  1NUC A;  1KLU D;  1FR3 A;  2IL8 A;  1A6X A;  3FPU B;  3I4N B;  1VMC A;  1EY5 A;  1IKM A;  3GQB A;  2KHS A;  2ID0 A;  1IW7 D;  2A68 C;  3NBH A;  1RD9 D;  1BCP B;  2XRQ D;  1U4M A;  1F2Y A;  3TZD A;  2NYZ D;  4DAY A;  4E6I A;  1BDO A;  3V05 A;  2NVQ B;  2BE5 C;  4C3H B;  2EPB A;  5C3X A;  3TP6 A;  4KK7 A;  2FFK B;  1O7Z A;  2X69 A;  4XIG S;  3GTK B;  1ET9 A;  4EGV A;  1MGS A;  3EQL C;  1RCV D;  3GTJ B;  4CKE A;  3EVQ A;  3D8G A;  3T13 A;  1SYF A;  3NWS A;  2F0T A;  2EVB A;  1ONL A;  3F2U A;  3NK9 A;  4PMC A;  1X3Q A;  2X6L A;  2B8G A;  4QUC A;  2Q8T A;  1O7Y A;  3J7Y W;  1JR0 D;  2NN6 G;  1SYG A;  1TR5 A;  2OT2 A;  1BOS A;  4A3G B;  2L12 A;  2KUM A;  4LMQ D;  4IFD J;  5EBD A;  3FDT A;  5EPL A;  3SE0 A;  1KDC A;  2BDO A;  1EWC A;  3SK5 A;  2NVT B;  1O7L A;  4KJO A;  2K04 A;  3ITP A;  3I4L A;  5IGB A;  1F9R A;  2VUM B;  1GUO A;  2QIL A;  5ELD A;  3OHX C;  1MSH A;  2EJM A;  4IUT A;  1DYQ A;  1SXT A;  3K7A B;  3GTM B;  1B50 A;  1GJX A;  3SEB A;  1OXS C;  1O80 A;  4RCN A;  5K36 G;  2F0K A;  3D3R A;  1EY4 A;  4DXF A;  4IN3 A;  2O2L D;  3H91 A;  1JWU D;  2ZXP A;  4C3J G;  4I7Z C;  1Y1W B;  2KEE A;  1I4Q A;  2N55 A;  2PMZ B;  5CC4 A;  4G57 A;  2Z8L A;  1EQV A;  1E2Z A;  1Z6H A;  1LTR D;  1DCZ A;  1CM9 A;  1A3V A;  4FF3 A;  1FYC A;  2NTS A;  5KRU A;  4MHE A;  4DK0 A;  3HS0 C;  2C5C A;  1Y8P B;  4G7H C;  1PRT B;  3NUC A;  3L7Z C;  4ZUI A;  3E5S A;  1TVX A;  3S1N B;  1K8M A;  1CFM A;  3T4A C;  3W2D A;  2R92 B;  1SND A;  2KVM A;  2B2V C;  3TN2 A;  3GTQ B;  4HTH A;  1Y8O B;  1EYD A;  1H9J A;  1SNM A;  3U9S A;  5LL6 X;  4HMI A;  1RTN A;  4ILW A;  5EPJ A;  2NB0 A;  1BF4 A;  1NAP A;  3VYU A;  4OHJ A;  1PZI D;  2IX3 A;  4ODG A;  5C44 B;  3GTP B;  2M2L A;  2JP1 A;  1VMP A;  1L0X B;  1TS2 A;  2L55 A;  1WTP A;  3MA2 B;  1XXG A;  1ICW A;  2EYF A;  1LO5 D;  5JOB A;  3A55 A;  4XQJ A;  2F0W A;  3NWT A;  4CGY B;  3CKI B;  1DZ1 A;  1STA A;  4BWG B;  1A2U A;  2E76 C;  3IAY A;  1RKN A;  2E75 C;  4O42 A;  2F1M A;  3BG3 A;  4BY7 B;  4CKB A;  1TWF B;  1M4V A;  1EZ8 A;  1ML0 D;  2EYH A;  5J39 A;  4QCL A;  5CBE E;  1TU2 B;  3GO5 A;  4R9W A;  3LWU A;  5NUC A;  3MXP A;  2K7V A;  4DGZ A;  5M5X B;  2F0J A;  3G6J B;  3T56 B;  2LMC B;  3DEP A;  4HN7 A;  2A69 D;  1I4P A;  1J8I A;  3OWE B;  2KJX A;  2RBM A;  3L9A X;  2R93 B;  1EYA A;  4C3J B;  4ME5 A;  1SMY D;  4V0B A;  5EQ0 A;  2JA7 B;  4RHS A;  2ICE C;  5CV5 A;  2LY7 A;  5A2Q E;  3NTK A;  2VB2 X;  3RUZ A;  3BVZ A;  2EYP A;  1TY2 A;  3VYS A;  1LTS D;  1EY6 A;  3EFX D;  4L6T B;  4F7X A;  1SNP A;  2EYM A;  1TT2 A;  4IUR A;  4IUU A;  1LTB D;  1VF7 A;  1EQT A;  3PUW A;  4F88 A;  1D2B A;  2KOL A;  2B2T C;  2RDH A;  5JPM C;  2WP8 J;  3GTL B;  4C2M B;  1AN8 A;  3T53 B;  5E1F A;  2EJG C;  2IJ0 A;  2L11 A;  1Q90 A;  5CGK A;  3GTO B;  3RZO B;  3HOW B;  4NMZ A;  1ROD A;  4QIW B;  3A54 A;  1B4O A;  4RAU C;  3OW7 A;  4RGO S;  3PO2 B;  1DOM A;  2IW3 A;  4RGM A;  5AFW A;  2TSS A;  1WTO A;  5IT9 E;  2B2U C;  2KEC A;  1TWC B;  2K6A A;  2FJ2 A;  1PDQ A;  5C6A A;  2MP1 A;  4LK1 C;  1RTO A;  3QB3 A;  1SE4 A;  1Q8I A;  3KUP A;  3M4Y A;  2E2H B;  3NQT A;  2IX0 A;  4N9T A;  1OXT A;  3DEO A;  4FYD A;  3VYR A;  5FO9 B;  2E74 C;  5TSS A;  3N6R A;  2L4N A;  2QCP X;  3A8K E;  5IIF A;  1GHJ A;  2JEA I;  4FNF A;  3S17 B;  2QF7 A;  1CHQ D;  4OO1 I;  3TP8 A;  2PZU A;  2LKV A;  1S4Z A;  2I46 A;  1SYB A;  5DEH A;  4KKU A;  2F4I A;  1UUP A;  4CKC A;  2WIN B;  4HSV A;  2F0V A;  4C3I B;  1U4P A;  3EA6 A;  2RQX A;  5C5L A;  3TSS A;  2EYL A;  5DM6 3;  3MAQ A;  2B39 A;  3MXU A;  3VR6 A;  4IZ8 A;  1TS5 A;  1EY9 A;  3A7A B;  1XTC D;  1G91 A;  4F8M A;  5I9P A;  3PUZ A;  3HOY B;  5COY A;  1II3 A;  2F0S A;  2DY8 A;  1I4X A;  3K5O A;  5E4W C;  4L63 B;  1E2W A;  3SK6 A;  2IX1 A;  3P1H A;  1HA6 A;  1JWS D;  2PW7 A;  1EYC A;  5HGT A;  2AWN A;  5ELF A;  4IQZ A;  1UEA B;  1XYI A;  2PZT A;  3MXN A;  2K32 A;  4WOR A;  1CZW A;  3QOL A;  1RJT A;  2QEJ C;  1HHV A;  4IFD G;  1KTK A;  1R9T B;  3NXW A;  1HFN A;  3CHB D;  1AZQ A;  2EZV A;  2BA0 A;  3HOX B;  5JPN C;  1ZKO A;  1EZ6 A;  1D5Z C;  2F0G A;  1KNE A;  4XYQ A;  3ND8 A;  5K5P A;  3GD7 A;  3QIA A;  5C0X G;  3C46 A;  4WJW A;  2ZXR A;  3VR5 A;  3A8I E;  1SNC A;  3S1M B;  4C56 C;  1ENC A;  5J1Z A;  2NN6 I;  3HOU B;  2K05 A;  4ZYS A;  2IT1 A;  4ZKC B;  1V43 A;  1HUM A;  2XN9 C;  2GA4 B;  1TS4 A;  1HFG A;  5C4X B;  3QJY A;  3AMU A;  4PNY A;  3I4M B;  1GOZ A;  4B08 A;  1Q3L A;  1LT4 D;  1BBX C;  1JE4 A;  1QG7 A;  4FP5 D;  5M3M B;  2DNC A;  4DNR B;  2PW5 A;  3ERO A;  3S1Q B;  3H94 A;  3K5M A;  1GUS A;  2B2Y C;  1STN A;  2XRS D;  2A69 C;  2DN8 A;  5C4H A;  4LJZ C;  2NTT A;  4A3M B;  1OXV A;  2PYK A;  1QIL A;  3HGB A;  3QO2 A;  3A56 A;  1S5F D;  3C3L A;  2I07 B;  3HEJ A;  2K01 A;  3M3Y B;  1B9M A;  5LL6 S;  1WD1 A;  3MTS A;  4HED A;  4DU9 A;  4BA2 I;  1LT6 D;  3VR2 A;  4FO2 A;  1Q1B A;  3MVV A;  1I50 B;  4R8N A;  1F2Z A;  5DAU A;  3C1E A;  3Q6S A;  1FNW A;  1W6J A;  2D62 A;  4CJ1 B;  4QF4 A;  2LS0 1;  2F3W A;  2MJ8 A;  2EOT A;  3OOC A;  1PFM A;  2Z1C A;  3OIP A;  2J4X A;  4XDX A;  1I3Q B;  1KDA A;  1JOK A;  1ZXT A;  1SJE D;  1EIG A;  2VXW A;  2G9H D;  4H0L C;  1JQY D;  4RGT A;  1VF5 C;  2F0M A;  1H9M A;  4X3T A;  1UNS A;  4HAE A;  1DOL A;  2NN6 H;  2K5W A;  1JOQ A;  4HSP A;  3H0G B;  2HDL A;  5T1G A;  1D6E C;  1STB A;  5FKA C;  3MFG A;  2JYO A;  1I6H B;  5IGE A;  3MWY W;  2NZ1 D;  2CVR A;  3AU7 A;  1XX8 A;  4KTA A;  1SMY C;  4KD3 A;  4IUP A;  5I6Y A;  2AWO A;  2RDG A;  4DA2 A;  1BXT A;  4ZUJ A;  2L1B A;  5I9O A;  5EJW A;  1JOR A;  5CMD A;  2BOS A;  1ILP A;  2ZXO A;  2KCC A;  2L9H A;  5D3I B;  2F0F A;  1HCZ A;  1WCM B;  4K2K A;  4AYB B;  3MC0 B;  3SDZ A;  4OIK A;  3J80 L;  2MUY A;  3SK4 A;  1CZG A;  1XWE A;  2AQ2 B;  2MGS A;  3S16 B;  3R93 A;  3GTG B;  2HCI A;  1TWG B;  2F0U A;  2L0C A;  2K5Q A;  4KD4 A;  2BCO A;  1OXU A;  2VB3 X;  2HQE A;  1QNU A;  1RF2 D;  4K5W A;  4G7Z C;  3DUZ A;  3NHH A;  1OXX K;  3K58 A;  3P7J A;  1Q12 A;  3K5N A;  1B2T A;  1TY0 A;  3DMU A;  4RH6 A;  4X3K A;  4PV1 C;  5JJZ A;  1QNK A;  4IAL A;  1BCP F;  1T5E A;  1X3P A;  1WTV A;  3ERQ A;  3KF8 A;  2A74 C;  2JA5 B;  4IUV A;  1MD2 D;  3AB9 A;  3HZX A;  4HMJ A;  4KKS A;  5CV7 A;  3UI2 A;  1TWH B;  4IFD I;  5A2Q L;  2CW0 C;  5FO7 B;  1H9S B;  5COR A;  5D3D A;  4A3D B;  2F0H A;  5EPK A;  1PFB A;  1VCI A;  2HCC A;  2OEO A;  4JBW A;  1EOT A;  3H3V C;  1QWY A;  4QUF A;  2LFN A;  1IW7 C;  2A68 D;  2F0I A;  2YU9 B;  2Q8R E;  4Q0F A;  3ZYY X;  4ZKB B;  2B63 B;  1CHP D;  4DF7 A;  2O5J C;  1PXU A;  5FO8 B;  3H09 A;  1JOO A;  4EQO A;  4ZK9 B;  3PO3 B;  2F0E A;  3Q22 A;  1STY A;  1EY8 A;  2NBF A;  4A3J B;  2JEB I;  5CV6 A;  5T1I A;  2G9D A;  3D4W A;  2ZT9 C;  4M8A A;  3LWE A;  2JE6 I;  2E2I B;  4IUQ A;  4HR7 B;  5CYU A;  2N88 A;  3Q24 A;  3Q0A A;  1KAA A;  1HUN A;  1F9Q A;  3GV6 A;  4K14 A;  2K28 A;  5D65 A;  4GZY C;  4C3I G;  1LAC A;  1LT5 D;  2FMC A;  3SVM A;  2RSN A;  2EDG A;  1EU4 A;  3KK7 A;  4RCO A;  2DY7 A;  3J7A F;  2EXZ A;  3EJI A;  2XSC A;  1CI3 M;  2KCN A;  1PYW D;  4XYO A;  5IOC A;  1KNA A;  4EVO A;  1VDZ A;  1BO0 A;  3PUV A;  2Z4I A;  3R2I A;  2K03 A;  2PCF B;  3D4R A;  3PIP 3;  4DAP A;  2XIW A;  2B2Y A;  3QOJ A;  1B53 A;  2HDM A;  4U67 3;  4PQX A;  3D6W A;  3QG1 A;  1F9S A;  5IGF A;  1PZK D;  1ZYR D;  1KLG D;  1MSG A;  4O1N A;  1HTP A;  5KND A;  3FKI B;  2R61 A;  3PUY A;  1PRT F;  5C0X J;  1EU3 A;  4XT3 B;  1G29 1;  2WKC A;  4OIJ A;  2K5D A;  4Y7N B;  3A8J E;  3PIO 3;  3VA5 A;  3DXJ C;  3DWA A;  4KMU C;  1NR4 A;  2WAQ B;  1FNU A;  5C4J B;  2D5D A;  2H1E A;  1U4R A;  2CW0 D;  3KLR A;  4ZLT F;  4X3U A;  1RDP D;  3VYT A;  1CT1 D;  4N9P A;  5E3F A;  5DM7 3;  1BUV T;  3BYY B;  3TBI B;  2QKI C;  4ULL A;  2BDN A;  3NBI A;  2F03 A;  2D2C C;  5EKL A;  2Y0S B;  1T5X D;  4OO1 H;  3I73 A;  4YIJ A;  5I2X A;  2K1B A;  4XQQ A;  4BBR B;  3V2T A;  4G7O C;  1LV9 A;  3TDQ A;  2PQE A;  3OIQ A;  4BS9 A;  4V19 0;  1Y1V B;  3R3O A;  2WB1 B;  3I3C A;  2E2D C;  2NUC A;  2B2T A;  3OWF A;  1TQO A;  4G4K A;  2BA1 A;  3A7L A;  1S5B D;  2TMP A;  5G3L D;  3BYT B;  3CRL C;  4KN4 C;  1CA5 A;  1LTI D;  1W6K A;  3FEW X;  5DNF A;  1F9P A;  2F0Q A;  1PRT D;  1JIC A;  2OF1 A;  3MFY A;  4RA8 A;  1R4Q B;  3I90 A;  1EEI D;  4XT1 B;  1U4L A;  5ISR A;  4ZRZ A;  4KY7 A;  1V1P B;  1GXD C;  1LTA D;  2EY5 A;  2FMM A;  4FF4 A;  3GP7 A;  4WRD A;  1MBY A;  4LAA A;  1STG A;  4L8J A;  5IGC A;  1SEB D;  2A5H A;  5I6W A;  4K5V A;  4TSS A;  3S9W A;  1F2L A;  4EQN A;  4FF1 A;  2EY6 A;  3OMG A;  2AUJ D;  2C9O A;  1GUT A;  3J80 E;  3WOF A;  3M7G A;  3HRZ C;  4K6L A;  1WTW A;  1V1P A;  1YNN D;  3SK8 A;  1EY0 A;  2Z4H A;  1DOK A;  2F3V A;  1STH A;  4NP5 A;  1H9K A;  2EE1 A;  5JEA G;  1LTT D;  1JCK B;  4J1M A;  5KNC A;  2SDF A;  5EKI A;  4A3I B;  5A35 A;  2EJF C;  3OSO A;  1PTO B;  5BN4 A;  3J81 L;  5E4X A;  4DAV A;  1GHK A;  5M9O A;  4CHT B;  2IWH A;  2V4D A;  1Q1E A;  1PMR A;  1G2T A;  1ENA A;  1PFN A;  3FRP B;  1YNJ D;  1F77 A;  4KN7 C;  2FHT A;  3K6O A;  5JAV A;  4CJ2 C;  4WFN 3;  1NCV A;  1D5X C;  1G8Z D;  2K33 A;  1S5C D;  2RDF A;  3PV0 A;  4H7B A;  5C5M A;  1SNQ A;  2JA6 B;  5D14 A;  2KA7 A;  1H9R A;  1Z47 A;  3M85 A;  2H4O A;  4PMW A;  5BN3 A;  1DON A;  1WD0 A;  1I4R A;  1GUN A;  1HQM C;  3V96 A;  4DNT B;  1C4Q A;  3MZ5 A;  4QB4 A;  2A6H D;  4BBS B;  4CBV A;  1UAP A;  4HCS A;  4P2C B;  3VR4 A;  3BDC A;  1F2M A;  2RVL A;  1TS3 A;  3HOZ B;  5G3L F;  1QJO A;  1HQR D;  2KQ3 A;  3E6Z X;  4RGN A;  4A3K B;  2JSO A;  3ND9 A;  3SR1 A;  2RA4 A;  3BVG A;  3D4D A;  1C48 A;  1R4P B;  3TME A;  4U68 A;  4FXK C;  1RHP A;  4C3H G;  5KIX A;  1BCP C;  1S5E D;  3O13 A;  2PZW A;  3BVM A;  1CA6 A;  3H6M A;  4EQP A;  5IOD A;  3PMF A;  1QE6 A;  4H13 C;  3J81 E;  1C8C A;  1ILQ A;  4B9X A;  3RMH A;  3WDN A;  1Z7T A;  2A6E D;  4RWS C;  5KYI A;  3HKZ B;  1MI2 A;  5HUR A;  4BA1 I;  1PZJ D;  1DD2 A;  3PUX A;  4FVM A;  3GV3 A;  2PNR C;  3S14 B;  2YYZ A;  4A93 B;  2B2W A;  1WTX A;  4MN3 A;  1J9O A;  2SOB A;  3BDL A;  1IHZ A;  3BS1 A;  4KHZ A;  3JAM L;  3DM1 A;  2PO4 A;  1BNZ A;  5JEA J;  1FD7 D;  4XQN A;  2NVY B;  2Q8I B;  3S1R B;  1NSN S;  4H44 C;  2CHB D;  2AQ1 B;  1GUG A;  1HA5 A;  1FGB D;  5K36 H;  1B9N A;  1AZP A;  1STE A;  1SYC A;  1B3A A;  2EY2 A;  4F87 A;  5ELE A;  1EEF D;  3RD4 A;  3S15 B;  1TII D;  1SNO A;  3K5L A;  4OGQ C;  3FMC A;  1CQV A;  3K57 A;  5I4D A;  1SSO A;  4KY5 A;  1E0B A;  3RLF A;  1LT3 D;  1CK1 A;  1I4H A;  2MPM A;  4DXG A;  4ID6 A;  1PLF A;  5KGU A;  1E2V A;  3X3N A;  3ONA B;  4RHR A;  1D1K A;  1G2S A;  2BE5 D;  3QWN A;  1BQQ T;  2WV6 D;  1A15 A;  1V1O A;  3C1F A;  3P20 A;  3N52 A;  4RKL A;  3MXG A;  4ZAI A;  5C4Z A;  1BR9 A;  4C1N K;  1K83 B;  5LHY 1;  3T51 B;  1WVL A;  4XTC S;  3IFT A;  1DJR D;  2R6G A;  5IGG A;  2XVS A;  1OO9 B;  3OPO A;  2SEB D;  1PRT C;  2M9V A;  1HTL D;  2SNM A;  4IUN A;  3R2T A;  1U9R A;  3NSW A;  1YNJ C;  1PTO D;  4A3F B;  1JWM D;  4I65 A;  1I6V C;  1CQF A;  4UAI A;  3DHQ A;  4ZQ3 A;  4NKL A;  1B1Z A;  1FNV A;  4DK1 A;  1WTR A;  2EYO A;  3U9O A;  1O78 A;  3CQZ B;  1GUW A;  2R7Z B;  1IL8 A;  3BDO A;  3FVQ A;  1ET6 A;  1WTQ A;  3T16 A;  1JB3 A;  2J7Z A;  1JC7 A;  3I70 A;  2A6H C;  4K8I A;  4NDX A;  1QCB D;  4RFB A;  5M5W B;  3VA7 A;  3TP5 A;  1EIH A;  1SAP A;  1ESR A;  4A3B B;  1K8O A;  3SXH A;  4TQU S;  3URY A;  1ENF A;  1A2T A;  1B44 D;  4Q5V A;  5KEE A;  5C0X I;  1HPC A;  3MHB A;  3NE5 B;  4HCE A;  2XWJ B;  5JVG 3;  5EKK A;  1SFO B;  2QDB A;  2JXM B;  3L3O C;  2F0L A;  5CV9 A;  1SYE A;  4RKB A;  1EY7 A;  2SNS A;  2M00 A;  1ESF A;  1D5M C;  3CRK C;  4NW2 A;  2HUG A;  3W3A A;  1D1I A;  1SYD A;  4OL7 A;  4J8Q A;  3FPP A;  1HRJ A;  3SHL A;  3TZU A;  1L0Y B;  5FOB B;  3K0Y A;  2B8F A;  2X6G A;  1EFI D;  3HG9 A;  1AEX A;  4K2L A;  3D31 A;  4KV6 A;  1KDB A;  4X3S A;  3J7A V;  5IGD A;  5EBC A;  3IL8 A;  3R8B A;  5J22 A;  2B2V A;  3OMC A;  4BY1 B;  1H9S A;  5F2D A;  3M4O B;  3CU7 A;  3DWQ A;  5FLX L;  3LNN A;  5BN5 A;  4IFD H;  3HP3 A;  2NWG A;  1M8A A;  3KBX A;  3TP7 A;  1I4G A;  1PTO F;  4UDU C;  5JEA H;  4KI0 A;  2F0P A;  4QMG A;  2DNE A;  3NTH A;  5ELB A;  1EL0 A;  4A3E B;  3K59 A;  3X3M A;  4KKT A;  5CR3 A;  1TWA B;  2J0T D;  5C3E B;  5C0X H;  1EWH A;  5CV4 A;  2FIN B;  3KLS A;  5FK9 C;  3WOE A;  2VNU D;  1TKW B;  4FXG C;  1NR2 A;  2JA8 B;  1X32 A;  1LTG D;  2RSO A;  3HOV B;  3IFD A;  1SE3 A;  5KNB A;  4TRD A;  4S3S A;  3I72 A;  4R8I A;  1ZYR C;  1YNN C;  2WAC A;  4JK1 C;  3RZD B;  2XWB B;  1A3T A;  3I91 A;  1DXM A;  1KAB A;  3NQI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...