4IFDH

Crystal structure of an 11-subunit eukaryotic exosome complex bound to rna
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
356
structure length
295
Chain Sequence
SEVITITKRNGAFQNSSDSQIVTPGELVTDDPIWMRGHGTYFLDNMTYSSVAGTVSRVNRLLSVIPLKGRYAPETGDHVVGRIAEVGNKRWKVDIGGKQHAVLMLGSVNLPGGILRRKSESDELQMRSFLKEGDLLNAEVQSLFQDGSASLHTRSLKYGKLRNGMFCQVPSSLIVRAKNHTHNLPGNITVVLGVNGYIWLRKTSQMDLARDTESSWQIYSDENDPSISNNIRQAICRYANVIKALAFCEIGITQQRIVSAYEASMVYSNVGELIEKNVMESIGSDILTAEKMRGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an RNA-bound 11-subunit eukaryotic exosome complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/rna
molecule keywords Exosome complex component RRP45
total genus 79
structure length 295
sequence length 356
ec nomenclature
pdb deposition date 2012-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF14382 ECR1_N Exosome complex exonuclease RRP4 N-terminal region
H PF15985 KH_6 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4ifdH01
1Y8NB 1Z6HA 4I7ZC 3M7NA 2O5JC 2A6ED 5BN3A 3VR4A 3I4LA 2PCFB 5KNDA 3AB9A 2A68D 4IQZA 3TZUA 1CI3M 2JEAI 2E75C 3BDOA 3VR2A 3MFYA 5JEAH 1EWHA 2AUKA 1ONLA 2EJGC 2EVBA 2ZT9C 3FPPA 2DN8A 2Q8IB 3CRLC 1K8OA 1H9KA 1T5EA 4JK1C 3I73A 3EQLC 1GJXA 2D62A 2F1MA 1FR3A 1I6VC 1Y69U 2A6EC 3IKJA 1VCIA 3MXUA 2L5TA 5K36H 3VR6A 1HCZA 1GHJA 3A7AB 1VF7A 2KCCA 3A8JE 2A69D 1IW7D 2IT1A 5A35A 2AWOA 2B8FA 2DNEA 4BA1I 1OXUA 3ND9A 3WDNA 1IYVA 3T51B 1Q1BA 1GUSA 4DK0A 1LACA 2KA7A 1YNNC 3L7ZC 4L8JA 4G7OC 4KHZA 1H9JA 3PV0A 1SMYC 3A8IE 4KI0A 1A6XA 1HQMC 1V43A 4GZYC 2E76C 2QF7A 2K32A 3BG3A 3PUVA 4XTCS 4PV1C 4XIGS 2NN6I 1GUGA 4KKSA 2PPBC 4KN7C 1H9SA 1IW7C 2A69C 2BA0A 1V8QA 3FMCA 2B8GA 2A6HD 2LMCB 4G7HC 3KLRA 3OOCA 4LK1C 3M85A 1DD2A 3PUYA 3SE0A 1CFMA 2AUJD 1Y8PB 1O78A 1VDZA 1FYCA 1Y8OB 3H94A 3P20A 1OXXK 2K7VA 1Z7TA 2D2CC 1H9MA 1HPCA 3VR3A 3D4RA 5C0XH 1DXMA 1E2WA 3W3AA 3HGBA 2EJFC 4H0LC 1Q90A 4BA2I 1Q12A 2BE5C 3I72A 1IYUA 4DNTB 1OXVA 3PUZA 2D5DA 1CTMA 1LABA 3LWUA 1K8MA 2E74C 2K33A 4KN4C 3DXJC 2A6HC 1DCZA 5BN5A 2NN6H 1GUNA 2JEBI 1B9MA 5C0XG 3IFTA 1H9RA 3NE5B 1OXTA 3A7LA 1TKWB 1O7LA 3OW7A 3A8KE 1ZYRC 4IFDG 1VF5C 2EDGA 2DNCA 3QG1A 1GHKA 1GUTA 2JE6I 3GQBA 1GUOA 3LNNA 3T53B 3VA7A 1E2ZA 3U9SA 1YNJC 1G291 1QJOA 2NN6G 3PUWA 4H13C 3CRKC 2BA1A 3VR5A 4KMUC 3SDZA 2BE5D 4DK1A 4G7ZC 4OGQC 5BN4A 1H9SB 3ND8A 4LJZC 2PNRC 3QIAA 3T56B 4OO1G 3GD7A 1E2VA 1BDOA 1TU2B 5JEAG 3PUXA 1Q1EA 4OO1H 1ZKOA 1HTPA 2A68C 2R6GA 4TQUS 4HR7B 2EJMA 4KKTA 1B9NA 2BDOA 4KKUA 4RCNA 2V4DA 1PMRA 4H44C 2CW0C 3M4YA 4JBWA 5K36G 3QJYA 2O5IC 3D31A 3RLFA 5KNCA 4TKOB 5KNBA 4DNRB 3N6RA 2YYZA 1OXSC 2JXMB 3OPOA 4IFDH
chains in the Genus database with same CATH superfamily
4DR7L 2KHSA 2AMCB 2VQFL 1OO9B 2AQ2B 4LFAL 2XN9C 3HFZB 3MWYW 1CT1D 4QF4A 5IT9c 1XTDA 3EBEA 1II3A 2KBNA 2WKDA 1WCMG 3NXWA 2ICEC 4Q5VA 2L5TA 1YHAA 5CORA 1RHPA 2O2LD 2L12A 1BOSA 3J7A5 3K58A 4K6LA 4JI6Q 2F0QA 1R9TH 3NSWA 3FVQA 5IGGA 4B3TL 1WTXA 3NTIA 1S72A 5EPJA 1MHWC 4CJ0B 2OCEA 3GV3A 2M2LA 4N8FA 4OX9L 3SE0A 3J81j 4RA8A 1VQMA 1PLFA 4QMGA 2K28A 3MEHA 1HPCA 1BUVT 1STGA 3QB3A 1PFBA 3MXNB 4A3MG 4LF8Q 4OX9Q 5EBDA 5C0XJ 5E4XA 5C3XA 2VNUD 2F0GA 3NENA 3GTJB 1J5EQ 3OHXC 2JEBI 1GOZA 4FDBA 3I8ZA 2YTXA 3HOYG 1LT3D 5LMNQ 2K14A 1A2UA 3LNNA 2NN6G 5C4XB 2RBMA 3SDZA 1ASZA 2BE5D 1HUNA 4JI8L 2X6LA 3GD7A 5FO7B 3PUXA 3UDGA 1L0YB 1E1TA 3T1YL 4ABNA 4LWCA 5M5YB 1XNRL 2KENA 4FP5D 3D8GA 1K73C 1DJRD 5D14A 3P1HA 2CQAA 4IJHA 5IODA 3GTOH 4A3LH 1IKMA 3CAMA 5EAYA 1OXSC 4KD4A 2Z1CA 3KF6A 3MXPA 2NVXB 3TREA 1BBWA 3K7AB 1QOHA 1KABA 2RCFA 3C1EA 5NUCA 2AUKA 2YV5A 4DK3C 1PRTB 4Z9CB 2AWNA 1SE4A 4UHVA 2FFKB 3X3MA 2MGSA 3I73A 5G3LF 4HEDA 4B3MQ 1CM9A 4HCSA 2PZTA 2QA4A 1JC7A 2XGTA 2V1CC 1HH2P 3MXUA 5IYDG 2F4VL 1SNCA 2F0VA 3CCRA 1LT6D 3E0JA 2NVYB 1IW7D 2NZOA 2IT1A 3RN2A 2D0OA 2B8FA 1W6JA 4IALA 2LY7A 1LACA 4CKBA 3R3OA 1HR0Q 2ID0A 3GTQB 1SFOH 5M3FH 2X6GA 3FKIH 2HT1A 2HCCA 1TS4A 1HR0W 3PF4A 4DV7L 2VB2X 3LGJA 2A69C 2MO1A 4CDEC 2CH4W 5KGUA 3TBIB 2E2JB 1S5FD 1E24A 2AUJD 2K05A 4ME5A 5FK9C 2YU9B 3HS0C 1KLGD 2IX1A 3W2DA 5FLMG 1XYIA 4L6TB 3HGBA 1I4PA 1Q90A 2K50A 3FHWA 3T13A 3RN5A 2C5CA 3H6MA 1MKHA 2XSCA 4OIKA 3KDFA 4IFDJ 2OTLA 2VQEL 2WACA 3DHQA 1PVOA 1CHPD 2PQEA 2I5MX 3NE5B 4A3CH 5L37A 5IYBH 3E9HA 4R4IA 2XNAC 4DNIA 1LTID 3NEMA 5FKAC 4OWTB 3U50C 1XWEA 3AU7A 1NR4A 4DN4M 4B3SL 1A63A 1SNPA 4ZCKA 3S14H 4NXNL 2RDHA 1PXUA 3SVMA 4P75A 4KD3A 2EJMA 4DK6C 1WTWA 4KY7A 2V4DA 3GO5A 4UY8C 3K0XA 4QB4A 3SXHA 2LXJA 1MSGA 4U68A 4DR4Q 4RKLA 1AE3A 3VYUA 4EVOA 2Z6BA 2L0CA 2IW3A 3N6RA 1STHA 3SK8A 2CCZA 2UUBL 1EIFA 4ID6A 4DV4L 4MN3A 1Z6HA 2F0OA 1N33Q 4DR6Q 2NVQH 3AB9A 3TZUA 4JG2A 3KFUA 2WB1G 4PNYA 3PF5A 4X3TA 2C9OA 1X54A 1EFID 1RF2D 1PH6A 3MEFA 5IT9L 4R4TA 3I4MB 4CKCA 4WJ3M 4FXKC 4DV3L 3WOFA 4PMWA 4OIJA 1H9KA 2K5WA 1EU4A 1LLRD 1SAPA 4CDDC 3HOVG 4ZRZA 2N78A 3MAQA 3MXNA 1NJIC 5EKIA 3PO3B 4A3LG 3R2TA 3A8JE 2KCCA 5C44B 2K5HA 1UAPA 3K8AA 2N49A 2HIXA 4LFAQ 2HD3A 1S5DD 1TIID 4JI0Q 4QJFA 2NVTB 2ZXOA 4GKJL 4C2MB 3KUPA 2SEBD 1JOQA 1SE8A 2A6HD 2RCNA 3EVQA 4LK1C 1KTKA 1IBLL 1YHQA 1MJEA 3MHBA 2JA8G 3MA2B 2B63B 4X3KA 2E2IH 3D6WA 2Q8RE 2K4KA 1STAA 4ZYSA 2X69A 4A3JG 4BXXH 1XTCD 3LWUA 2XRSD 2ALYB 2K33A 2K5QA 1ET9A 1DCZA 2NN6H 1NSNS 1B9MA 1C4QA 4C3HH 2XRQD 1IZ6A 5JVG3 2WIIB 2MQHA 1TQOA 4A76A 3OYYA 1LV9A 5M3MG 5I9OA 2M9VA 1VQFA 1N34Q 2VB3X 3TQYA 1K83B 3T53B 3I56A 1I6HH 2QDLA 2B2VC 1HRJA 2ZTCA 1SMYD 2RDFA 1RTOA 2IL8A 2JA7B 1MI2A 3PO2B 2PNRC 3T56B 1CSPA 1E2VA 3K7AH 4C3IG 1LUZA 4JOIA 4RHSA 2AKWB 2A68C 5GADC 4DV4Q 3QWNA 2F0LA 4HIMA 1PMRA 4IJLA 3PIO3 3T4AC 3TN2A 4GS3A 4FO2A 1ENAA 1PV4A 2XWJB 1F77A 5JOBA 4HMJA 1B4OA 4X66Q 1U4RA 1VQ4A 3PIOA 3DUZA 2IHFA 3E3XA 3I2ZA 4JW0A 3S24A 4LF7Q 1HA5A 2Z4HA 3FPPA 3RMHA 4ZQ3A 1K8OA 4OELB 1PH1A 2EY5A 4DR1Q 1B70B 4DUYQ 1G6PA 1JR0D 1YVCA 3IKJA 5FLXL 4K0KQ 4POGA 5K36H 2EIFA 3K81C 4DR2Q 2R3ZA 1D6EC 1HZ9A 4V0BA 1VQ6A 4B3ML 5DM73 1CHQD 3T51B 1WCMH 4UPAA 1Q1BA 2QEJC 4KJNA 1D8LA 4I7AA 2R7FA 3HZXA 4C3JB 1UE1A 5EPKA 4XQJA 3AEVA 3A8IE 3MZ5A 1VQCA 1IBMQ 1V43A 2K32A 4A3IG 1QZHA 2NN6I 1GUGA 4KKSA 4DF7A 3D6CA 4DR5Q 1VQHA 2PQAB 2AHOB 1UE6A 1SJED 1ET6A 3MXGA 3Q22A 1BXTA 1TWFB 1LYLA 1TXYA 1DXMA 1X3EA 4IOCA 3URYA 4NXNQ 2MHVA 4LF7L 4LF9L 5M3FB 2R93H 1IYUA 1LABA 5FO8B 4KV6A 3HOVB 4A3BB 2KVMA 1YJWA 2EYMA 2EOTA 3CF5A 5JVH3 4A3FG 1IBKQ 4CKEA 1I50B 4X62Q 4PZ8A 2Q8TA 3KK7A 3L0OA 1LTSD 1TWHH 4DV6L 4UP7A 3Q24A 4AIMA 1NBWA 4QGUA 3TZDA 1CKMA 5IY0A 3KF8A 2JA7H 2B2WC 1IKLA 4QL5A 3A55A 4MZ9A 4RH6A 3FKIG 4A3JH 4IUVA 5IGEA 2NYZD 5M5YH 4LF6L 3RD4A 1PH4A 2LS01 4MHEA 3M4PA 4OL7A 3H91A 1JE5A 2KOLA 2CQOA 2QW7A 1Q81C 4LW1A 1HFGA 2WV6D 1UEAB 4IURA 1RKNA 4EQ5A 3OPOA 4WRDA 5E4WC 3M4OB 1KLUD 4P74A 4S3SA 3NWSA 3N52A 3JAML 1VMPA 4RGMA 4JI3L 4NXML 2HDMA 1IYJB 3EN2A 4EQNA 4JI6L 3CC7A 1HTLD 5ELDA 1EFWA 1ONLA 4ALPA 4DXFA 1T5EA 4IUQA 3C1FA 1SROA 4C1NK 3T16A 2ICIA 2EPBA 1SMXA 3J81L 1C0AA 1XPRA 2AWOA 2PZUA 1WYDA 3NBIA 1KC8C 1EY9A 5EQ0A 1GUWA 3W1GA 3S1QB 3E0EA 3ERSX 1I4QA 4JI3Q 1EYDA 4KHZA 1YBYA 2E2HB 4LUZA 1Q3LA 1Y1WB 1E0BA 2F3WA 3GP7A 4GNXC 4BBSH 3PUVA 4PV1C 1X3PA 4QIWE 3RUZA 2BA0A 3CKIB 1PRTD 1CZWA 2N55A 2JA6H 1VQPA 5JAVA 1TWAH 3S1MH 5EPLA 1KDAA 1Y8OB 2K7VA 3G4SA 2L55A 1L1OC 1TY0A 4ULLA 5CBAE 1TWFH 1B1ZA 3CCEA 3CCJA 1N8RC 1Y1WH 1R9TB 1J8IA 4DAVA 1CTMA 5I2YA 4RAUC 3HOVH 1JE4A 3R93A 2ZM6Q 4A3IH 5FLMH 1K8GA 4JYAL 1BCPC 2IHEA 2ENBA 4DPGA 5JPMC 2DGYA 5DM63 3AMUA 2WINB 5GROA 1VF5C 2EDGA 4POFA 2KCMA 5ELBA 1DYQA 2F0PA 2D9UA 1UNSA 3VA7A 1E2ZA 1SE2A 4HIKA 3SGIA 5IYBG 3I90A 1AW7A 4JI2L 1F2LA 1S3OA 4L5TA 3A56A 3HP3A 1ZKOA 4TQUS 2Z4IA 4F88A 3CXCA 2EE1A 5IGDA 1PRTC 4OWWB 2L15A 4KKUA 1HNZL 4DV2L 2VQFQ 3SHLA 3GTLH 1Q86C 2B2VA 1IBLQ 1QUQB 2G5DA 2B29A 4AYBG 3HOXG 1ASYA 2IY5B 2K5VA 2PW5A 3NP8A 4HSPA 1B7YB 4A3GG 1Y1VH 3FPUB 1JMCA 2WAQB 3JC66 2JA9A 3ICEA 1EQTA 3Q6SA 1RIPA 5CBEE 2ZTEA 4C3HG 2UXBL 1ZEQX 2K1BA 3TP5A 2FXQA 4JV5Q 3K6OA 3TP8A 4NKLA 5IE8A 3MVVA 5M3MB 1HCZA 4GN4B 5IP9H 3H3VC 1STEA 4X6AH 1EY4A 5LL6X 2OTJA 3ONAB 3S9WA 2WFWA 4YWMA 1WI5A 2H5XA 1SYDA 4L8JA 4C56C 3S1RH 5C6AA 2EY6A 4Y7NH 4YHHQ 2Q2HA 2HUGA 4A3CG 1SE3A 1MJCA 4FNFA 3F2CA 3KF8B 1HR0L 1F2MA 1I4GA 4YWLA 1EIGA 4WJ4A 4DV0Q 3HKSA 2IX0A 1FVIA 3GTGB 4B3TQ 4B3SQ 1TWCB 3S2HH 1IBKL 4C3JH 1KXLA 2F52A 3A5ZB 4J6HA 2UXCL 4YY3Q 2EYLA 2WB1E 3RZDB 4A3GH 3DXJC 1LTAD 2A6HC 4KK7A 1B3QA 4OEMB 2DY8A 2UU9L 3HOXH 1X3GA 1I5FA 3QG1A 5C3EG 2JE6I 2E8GA 3PMFA 3SR1A 4UDUC 3G71A 3K5LA 1CK1A 1W3SA 4NP5A 2K5NA 4LJZC 2L9HA 2PI2E 5D65A 4X65L 3M3YH 4OO1G 4KJOA 3HKZB 4RMFA 4A93B 1D7QA 4GLAC 1JJ2A 5KYIA 2R6GA 5M5XB 1CSQA 1NMGA 4JBMA 1AEXA 1XNQQ 3A74A 3V05A 4H02A 4DV1Q 1U5KA 3RLFA 2OXPA 5KNBA 4C3IH 5J39A 2I46A 1X32A 5H1SE 2O5JC 2JN4A 3K5OA 2EXDA 5JJLA 5CV8A 1Q7YC 2C35B 1EWCA 2I5HA 3HKZE 3VR2A 1BF4A 5JEAH 5C3WA 4GNXB 2GA4B 2F0MA 3S1NB 1MD2D 4LFCQ 4Q0FA 3L3OC 4CBVA 2CFMA 3RZDH 4A3GB 2B63G 2RDGA 1N32Q 4A3FB 2YTVA 1HFNA 4OONA 3VR6A 5M9OA 4R8IA 2E5LQ 1X3QA 4RWSC 5A35A 1WD0A 3HOUB 4KY6A 3CD6A 4X3UA 1ICFB 2EY2A 3VYRA 2BDNA 2LSSA 4BY1B 2ZTDA 1EOTA 4A3EG 3K5MA 5E7NA 4B3RL 5C4JB 2EXZA 2QF7A 3CCLA 4DXGA 1SR3A 3GTKB 2QKIC 3J81i 4FYDA 3I4NG 4N8X1 1DD2A 3AFPA 2E2JH 3D3RA 4C3IB 1VS0A 1PRTF 5CYUA 1EZ6A 2PYKA 1JCKB 1MIUA 3KJOA 1DGSA 1JJGA 4GOPC 1EIYB 1PYSB 5C4JH 5GAHC 4PMBA 2E74C 1A0IA 2KHJA 1VQBA 3D4WA 3WWVA 1H9RA 4JI2Q 4BBRB 1TKWB 1GHKA 1GUTA 4CHTB 1QCBD 4FXDA 3NQIA 4KMUC 1XX8A 3STBC 1QB5D 3QIAA 2CHBD 3VYSA 1K8AC 1KNAA 4UP8A 3I4MG 2OT2A 1BDOA 2OF1A 4R9WA 4X64Q 3TRZA 1UE5A 4OWXB 2AQ3B 5IGFA 2EY1A 2JP1A 4DA2A 4K2KA 3SK4A 4I65A 3J80L 4OHJA 1AZQA 4AQYL 1YJ9A 3SEBA 4J8QA 3NPPA 3H09A 3AQQA 1YNJD 3PO3G 1LT4D 2Z9HA 4V190 1PTOH 3MC0B 1PYWD 3TS0A 2JXMB 1Y14B 4K8IA 3M7NA 4AQYQ 2JSOA 1ESRA 2JEAI 1RJTA 4P2CB 3MFYA 5G3LD 3OWEB 3KLSA 2Q8IB 4BY7G 3BDLA 1L0WA 1PH7A 1HNXL 1WJJA 3V96A 2F1MA 1FR3A 1ILPA 2RA4A 1PFNA 3CCUA 4HTHA 2F0SA 4G4KA 3TSSA 2JJQA 1VF7A 3BYYB 5IWAL 2R7ZG 1K83H 1UEBA 2KEEA 4A3BG 4IUUA 1U4PA 4A3JB 3RR5A 2KCNA 3CCVA 3QO2A 3U58A 2VZAA 2XWBB 3X3NA 4TRDA 1HNXQ 1SYCA 5DAUA 1V8QA 4DUYL 4C2MH 3M85A 5I2XA 3PUYA 3SK5A 2K6AA 4UAIA 4JI0L 1SSOA 5HGTA 2JA7G 1RTNA 1J5EL 2YTYA 1LT5D 1STYA 2K04A 4K5XA 1C9OA 5IGBA 2ES2A 1IL2A 4A93H 2BE5C 4IUPA 3CMEA 3RLOA 4DV5Q 4XYOA 4XT3B 2WAQG 5J22A 3NELA 4CJ1B 4DUZQ 1A2TA 4IPHA 4JI7Q 3PIPA 3DWPA 1W6KA 5BR8L 3M4QA 1C7YA 4DK1A 4X62L 2PW7A 3KJPA 1XMQQ 4DR4L 2R92H 1UUPA 1VQEA 5FJ8G 4A3BH 2K5DA 4HR7B 3JAMi 1RD9D 3BZDB 5BR8Q 1EY5A 4JI4Q 1I50H 5CV9A 3EFXD 4NMZA 2PQAA 2Z6KA 4GKKQ 1NMFA 3OTOL 1J6QA 1OTCA 2IX3A 4N9PA 3UDFA 2JA5H 1JWMD 1D1KA 1EEFD 4HJ8A 1SYGA 3I4LA 4EQOA 4G57A 1V1PA 2J4XA 1S5CD 4IQZA 4DV2Q 1CI3M 4RCOA 2F0KA 5EBCA 1UE7A 2NTSA 3L2PA 5T1GA 4LF9Q 2JK8A 4GLVB 2ZT9C 2E2HH 2DN8A 4A3IB 1EQQA 1PTOF 2VY3A 4BBRG 1BKBA 1K3RA 2DJGC 1Q8IA 1QG7A 2K52A 1PTOC 2A6EC 1Y1VG 3A7AB 1VQKA 4BY7B 1PZID 1YHBA 2NVQB 1CKNA 1SEBD 3WDNA 2NUCA 3M9BA 2R61A 4JI1Q 1YEZA 3GTQH 1SMYC 3I4NH 4DR2L 3HKZG 4P72A 2QEXA 4PZ7A 1S4ZA 2OEOA 1EQRA 4KY5A 1S5ED 1D5XC 4O2DA 4MTNA 1WOCA 3DMUA 2OQKA 1FJGL 2KQ3A 1P16A 1N34L 3OIPA 3OSOA 3J80E 4KHPQ 3E9IA 3Q8DA 4QIWB 4HAEA 2FHTA 1TWCH 3D4RA 4M8AA 5FOBB 3W3AA 1TVXA 3CQZH 2IWHA 1YIJA 1SYFA 1SNQA 1D2BA 3HOWH 2B2TC 2RQXA 4DV3Q 1K8MA 1FNUA 4H7BA 2IJ0A 2F0EA 3PGZA 2RHSB 5IYCG 4AYBB 1OXTA 3HOXB 1HZCA 5M3FG 2F03A 1CKOA 3A8KE 3NTKA 3UDXA 1ENCA 3NBHB 1GO3E 1YNND 1HJPA 2RSNA 1YITA 1DM0B 1SDFA 4JI1L 1L1OB 1KIXA 1F2ZA 3J81c 3J7ZC 3RZOH 4LF4L 5E1FA 3CCQA 1CQFA 1E1OA 1B9NA 2TSSA 3NK9A 1G6ZA 4A3MB 2JQOA 1PHJA 4XDXA 4BWGB 4IPDA 1A3TA 1FNVA 1E22A 4ZK9B 3BS1A 1WFQA 1Y8NB 2JA6B 4RKBA 5LMUL 4O1NA 4P73A 1ZXTA 5D3IB 5IP7H 4WFN3 4DR1L 1EOVA 2UXCQ 1SYBA 3AYHB 1EZ8A 2EVBA 5EJWA 2CW0D 3A0JA 2B2UA 1L2FA 4EX5A 4A75A 5JJZA 4JK1C 1N9WA 4RG1A 1UWVA 4ZLTF 3NTHA 1WTVA 3PQIA 1XMOL 3S15H 1AE2A 1QNKA 1JB3A 5CV5A 4BBSG 1GUSA 1L1OA 4DK0A 3H0GG 4HJ7A 1IL8A 4IN3A 4JCVE 3S2HB 4BXXG 2F3VA 2KHIA 2F0JA 3IFDA 3DWAA 2VW9A 1KAWA 1EYGA 4DR3L 1B53A 3GTKH 1VMCA 4ZUJA 5M3MH 2LKVA 4XQNA 4TSSA 2O4XA 3OOCA 2RSOA 4A93G 5KYLA 5I4DA 4OO1H 1LTLA 1WD1A 2VQEQ 5C44G 1O7ZA 3I7FA 4JC0A 1B2TA 2CKZB 3RNUA 3S1RB 2I0QA 2A73B 1AH9A 1GKHA 4YCWA 2HQLA 4NPSA 1EQVA 1Z9FA 1E7ZA 1EYCA 4KN4C 3BVGA 5C0XG 2UXDL 2VL6A 2KUMA 4TVAB 3OW7A 4HCEA 4LFBQ 2UUBQ 1XMOQ 3D4DA 4EGVA 2A74C 1D5MC 5EKLA 4RGNA 2PMZE 3PUWA 4H13C 4IPGA 4NB3A 5IWAQ 4M1UB 1HNZQ 3DM3A 1H9SB 3PSIA 2K03A 4J15A 1SJHD 3C2PA 4B08A 1Q1EA 4LFCL 3H0GH 3CPWA 4CJ2C 4LMQD 2N8NA 3TEHB 3J81E 1KDBA 3KOJA 4ILWA 3KYHC 4JI8Q 4JBWA 3QJYA 2LXKA 1DOLA 1KL9A 5M5WB 4QQBX 1WTPA 1HZAA 3B6YA 1JB7A 1ML0D 1O7IA 3VR4A 4IUNA 1PDQA 3FDTA 4LF8L 4F8MA 2E75C 3G7LA 1VQOA 1KRSA 5GQOA 1EWHA 1QNUA 1I94Q 1ENFA 2B3GA 2PZWA 3CMAA 1A15A 1K0SA 5IT9E 1C8CA 4L5RC 5I6YA 1TWGB 2JA8B 3U4VA 1JOKA 1QVCA 2VXWA 2ASBA 1PFSA 5D3DA 2HHHQ 1BCPD 1VQJA 3S15B 4A3DG 1AN8A 2A19A 2JYOA 1TWAB 3S1MB 2UXBQ 3ND9A 2EYHA 4DV7Q 1N32L 4K6DA 1F2YA 1TS5A 2KA7A 3T1YQ 4KHPL 3QR8A 1A6XA 3GDEA 1X6OA 1NCVA 2L11A 3UE0A 4A3FH 1PYBA 4XIGS 3H0GB 5LHY1 3CP0A 3Q23A 3J7YW 1IW7C 4MNOA 2JA5G 3HOZB 1SXTA 1OXXK 2MJ8A 3S16B 2NZHA 5CV4A 1PH9A 2F0TA 2EQSA 2M00A 1I3QH 1JOOA 2B2UC 5ELEA 3KBGA 1LM0A 3PUZA 4GLXA 1BVSA 2SNSA 3NHHA 1S40A 1F9RA 4RHRA 2Q2IA 1K0RA 1BCPB 1ZYRC 4IFDG 1PA6A 2F4IA 4IO9A 5ELNA 3AFQA 3U9SA 3U4ZA 4FF4A 5IGCA 2ZM6L 3CRKC 4HIDA 2WB1B 3R2IA 2UU9Q 4LF5L 1A3VA 3HOUH 2PNHA 4MTKA 4LNQA 2RHQB 3U9OA 4EQPA 3HOWB 3CC4A 3C46A 2MNAA 2SOBA 4RCNA 1EYAA 4A3KG 2BOSA 3CCSA 2H4OA 2HCIA 2MFIA 3M4YA 2DUDA 4TKOB 1MBYA 1Q46A 2YYZA 1DZ1A 2NBFA 5TSSA 3NUCA 4I7ZC 5C4XH 1VQIA 1IXRA 5BN3A 1PH8A 3HOZH 5EGTA 5KNDA 1G91A 3S2DH 2UUAQ 3UI2A 2SDFA 1WCMB 2K75A 4A3EB 2VUMB 3I4MH 3IL8A 4FF3A 2KEDA 3K80C 4HJ9A 5IYCH 3PO2G 1M1KC 2XTIA 5FLXE 1NR2A 4KLKA 1QILA 3I4OA 2BH2A 3F1ZA 1PFMA 3BZCA 2RVLA 5AJ3Q 1QUQA 1I4HA 1R4QB 1LTRD 1IYVA 3I3CA 4PZ6A 4A3EH 1EUJA 4UP9A 4WJWA 3L7ZC 4G7OC 2KECA 5K5PA 5CMDA 4R4OA 4BY1H 3HOUG 2QDBA 5CV6A 4LF4Q 3UDIA 1WTOA 1X65A 2R93B 4GZYC 1EL0A 3FP9A 3PCOB 3BG3A 2B2WA 5JPNC 3DM1A 4R4QA 1CA5A 1A8VA 1CQVA 1BBXC 4MIUA 4K0KL 4YIJA 4F7XA 1O78A 3ULJA 4YCUA 1STBA 1Z7TA 1H9MA 4QUFA 2E2IB 1VQLA 3BVMA 1YJNA 2WKCA 3CC2A 2QILA 1SNDA 3S2DB 2A8VA 1R4PB 1B3AA 1Q12A 3WOEA 1OXVA 2D5DA 4HJ5A 2UUCL 3O13A 1GUNA 5FO9B 1D5ZC 3IFTA 1BCPF 2ZJRA 1T5XD 3J7AF 3ULPA 1O7LA 4K5VA 2B2YC 4A3DB 2N3SA 3KLSX 3KLWA 3W1BA 1PH3A 4FVMA 5IIFA 1G291 2FJ2A 2BA1A 1SN8A 2FMMA 3T1HL 1U9RA 1AFPA 3F2BA 4BBSB 4RGTA 3RZOB 4JBJA 1QZGA 4QUCA 2GN5A 3S1NH 4DV5L 4KKTA 3H3VI 2J0TD 3CCMA 1SNOA 1N33L 4H44C 2RF4A 1P8LA 1STNA 3D31A 4RFBA 5KNCA 5A2QE 1BBUA 3HOYB 1JT8A 1EY7A 3M7GA 1Y1WG 2MP1A 2OQ0A 2PCFB 2Y0SE 1EY8A 3JAMc 5C44H 1ESFA 2NVXH 1G8ZD 2A68D 3G6JB 4DAPA 1NAPA 2J7ZA 2Y0SB 5COYA 5M5XH 1LTBD 2NWGA 4DR7Q 5CGKA 1SYEA 2I07B 2R7ZH 3F2DA 4IPCA 3H15A 2VS1A 4ZKCB 2NVYH 1TWHB 4XT1B 1WTRA 1EWIA 3OW2A 2DNEA 3CW2C 2B63H 1TS3A 5I6WA 3S16H 4GOPB 3CU7A 4OXPA 3GTMH 5IYDH 2H1EA 4IZ8A 3J7AV 3STBD 2R7ZB 4NDXA 5C4HA 4OO1I 4JOIC 2ATWA 1GD7A 1J9OA 1HQMC 2KJXA 4RGOS 1VQAA 2JA8H 2HDLA 4C3HB 4AYBE 2PPBC 1DONA 3F2UA 1Z47A 2G9HD 1XPOA 3G6EA 3PO3H 3BZKA 4L63B 4DFAA 4KN7C 2D0PA 5F2DA 4X66L 1GVPA 4DR3Q 3E6ZX 2RKSA 3OMGA 2F0NA 2FINB 5E3FA 2LFNA 2EJFC 4QY7A 3LWEA 3K5NA 4BA2I 1IHZA 2L4NA 5KEEA 2B2TA 4DNTB 3TP6A 3ITPA 1CUKA 3H3VH 2CWAA 2NB0A 1KRTA 5LMNW 3GTPH 3A7LA 4ZUIA 1QVFA 3BJUA 2Z0SA 1KDCA 4PMCA 1PH2A 5JJKA 1PTOB 3GQBA 1B50A 2QGQA 5KRUA 1A62A 3F8TA 2E2DC 5DNFA 3S17H 4OGQC 1BR9A 3ND8A 4A3KH 1HXYD 2F0DA 2GVBA 2XVSA 4DAYA 1TU2B 1SBBB 5JEAG 4HIOA 1QVGA 4R4CA 3E5SA 1M8AA 1HTPA 2R93G 5C4ZA 2SNMA 4DAMA 1TR5A 2PO4A 3MFGA 5C5LA 3J80c 4Y52H 5LMUQ 1BO0A 3T1HQ 2A1AA 1V1OA 2L1BA 5HURA 3K7UC 5M5WH 5AFWA 5ELCA 3RLNA 1NTGA 1FNWA 2JA5B 3S17B 1RL2A 1PH5A 3K0YA 1F9QA 3BDCA 3OTOQ 4GOPA 3BDOA 1X56A 3Q0AA 1JICA 3JAME 1DOKA 2A5HA 4O0AA 2EJGC 3BVZA 3FEWX 2EYFA 2UUAL 5KIXA 4A4IA 5GAGC 3I70A 1SLJA 1NUCA 4HJAA 4LFBL 4DGZA 2B39A 3GTPB 5LMNL 4XYQA 4PQXA 1GHJA 4BY7H 2CWPA 4DKAC 4GNXA 4QCLA 2YU9H 4P71A 1Y1VB 4L5QA 1JORA 1H9JA 2F0HA 3PV0A 5IP7G 4HSVA 2R92G 5C3EB 2F0WA 2FMCA 4JI4L 2E76C 4XTCS 3EIVA 3UE1A 1JJCB 2QCPX 4U673 4R1JA 3FMCA 3GV6A 4X3SA 1NNXA 5ISRA 1KNEA 1WTHA 2F4VQ 1O80A 5LL6S 3W5OA 2DY7A 3KDFB 3GTOB 3NBHA 1G51A 1FYCA 3H94A 3P20A 3VR3A 5DLQE 3C3LA 1K3BC 1SFOB 1H95A 3I55A 1I3QB 3M3YB 4DUZL 4JBKA 4JVZA 1VQ7A 3GTJH 1U0LA 3QOJA 1N36Q 4ZKBB 2BH8A 2KCTA 4X65Q 3DEOA 3QOLA 3DWQA 1V1PB 2JA6G 1GUOA 1S5BD 1XXGA 3VYTA 1YNJC 1PTOD 3CPFA 1QJOA 2ZJPA 2UXDQ 2N88A 5BN4A 1YZ6A 1YNXA 5C5MA 4NXMQ 4GKKL 1VQDA 4BS9A 1VQ9A 2NVTH 4IUTA 1W2BA 4F87A 1ZYRD 5CV7A 2MUYA 5IP9G 4LF5Q 4FF1A 1GM5A 1TWGH 5FJ8H 1CKNB 2E5LL 4LAAA 2TMPA 3IAYA 1B8AA 3CHBD 4JI7L 4LF6Q 1KHIA 4KHVA 1K28A 3OMCA 4R8NA 5A2QL 1VQNA 3S1QH 1L0XB 2Z8LA 3GTMB 5JJIA 2IPKD 3KF6B 4GN3B 3I4NB 3OIQA 1HQRD 5J1ZA 3OWFA 3HOZG 1QWYA 1GJXA 2D62A 4ODGA 3TP7A 1EY0A 1I6VC 4L5SA 1EU3A 1Y69U 2R7DA 1I4XA 1VCIA 3HOYH 4CGYB 4NW2A 4C3JG 4C1NI 2A69D 3PO2H 1OXUA 1VQ8A 1GXDC 1LTTD 4JI5L 1LO5D 1KQSA 2EYOA 3SK6A 1YNNC 1MSHA 3CQZB 1FJGQ 1YI2A 1FGUA 3FRPB 3S14B 1LTGD 4FF2A 3LX0A 1X55A 4PG3A 1Q8KA 3TDQA 4DV1L 2EYJA 2B8GA 1WTQA 4G7HC 3KLRA 2G9DA 3IRBA 1Y8PB 2F0IA 1IBML 2HHHL 1VQGA 2DJFC 4AH6A 5I9PA 2D2CC 1TT2A 4GN5A 4DAYB 3ULLA 1C48A 1FL0A 5C0XH 2F0FA 4DR5L 1E2WA 1N36L 4A3KB 4CDFC 1JWUD 1TY2A 2CVRA 1HA6A 3I72A 2Y0SG 3A54A 1I94L 1CA6A 5HY6A 1EY6A 3P7JA 5JEAJ 2ZXRA 4K14A 4WORA 4XQQA 3MTSA 2P5ZX 4LUOA 2NTTA 1JWSD 3GTLB 1G2TA 1M90C 4YY3L 4ME3A 1HZBA 2VUMG 1V1QA 2MO0A 5HGQA 1T9HA 1JQYD 5C0XI 1Q82C 4G7ZC 4JI5Q 5J3BA 3TMEA 1SNMA 3VA5A 3VDYA 3ERQA 5GAEC 2BCOA 1NY4A 1KAAA 3I91A 4JPBW 1WVLA 2HIVA 2R92B 1BNZA 2Q2UA 4YHHL 1PZJD 4APVA 3DLLA 1HNWQ 4B3RQ 4BBRH 4DR6L 1E3PA 5T1IA 5K36G 2O5IC 1XMQL 5ELOA 1XJVA 1I6HB 1BQQT 2CH4A 1NE3A 2ZXPA 1XNQL 3J80i 4IFDH 1M4VA 5IOCA 4FXGC 2A6ED 3DEPA 1CZGA 1RCVD 4E6IA 1V9PA 2WAQE 4BY1G 3EA6A 4O42A 1EEID 4K8JA 4LUVA 4CDCC 4YCVA 4X64L 2AQ1B 5DEHA 2ZJQA 3D0FA 3FKIB 3CRLC 2OWOA 3ER0A 1EIHA 1HNWL 1RDPD 1PZKD 3EQLC 4A3DH 1XNRQ 1AP0A 1I4RA 1RODA 4DU9A 1FD7D 1QE6A 4DV6Q 3P75A 1ILQA 4IFDI 1F9PA 2Q2TA 4YWKA 4BA1I 2PI2A 5CC4A 5C4XG 4J1MA 2HQEA 2VUMH 4B9XA 3BYTB 3HEJA 1X3FA 1VQ5A 5EKKA 4KI0A 4B9WA 4IOAA 4DV0L 3K59A 4XXEA 3ZYYX 1U4MA 1H9SA 1F9SA 2LMCB 3ZJYC 3TS2A 3M4OH 1U4LA 1CFMA 1XPUA 2WP8J 1VDZA 1DOMA 1D1IA 3HG9A 5AJ3L 1HHVA 2UUCQ 2F3IA 4GKJQ 2NZ1D 4HMIA 4H0LC 3K57A 4K5WA 3EJIA 4K2LA 3NQTA 4Y7NB 5C3EH 2Z6KC 3EROA 4ZAIA 5BN5A 1MGSA 2GVAA 1KD1C 1A3UA 1ICWA 4KTAA 1X9NA 1K9MC 4JV5L 2DNCA 1O7YA 3VR5A 3GTGH 2K01A 1FGBD 4JYAQ 3NWTA 2F0UA 3V2TA 2EYPA 5CR3A 1B44D 2B2YA 3HRZC 3KBXA 3G48A 5ELFA 2EZVA 2MPMA 2XIWA 4A3MH 1HUMA 1SRUA 2BDOA 2I5LX 1AZPA 4N9TA 3R8BA 1G2SA 3PIP3 2CW0C 1TS2A 3HOWG 3BU2A 5FLXc 3A5UA 4HN7A 4DNRB 2PMZB 3L9AX
chains in the Genus database with same CATH topology
2KHSA 1OO9B 2AQ2B 2XN9C 3MWYW 1CT1D 4QF4A 1II3A 2WKDA 3NXWA 2ICEC 4Q5VA 2L5TA 5CORA 1RHPA 2O2LD 2L12A 1BOSA 3K58A 4K6LA 2F0QA 3NSWA 3FVQA 5IGGA 1WTXA 3NTIA 5EPJA 4CJ0B 3GV3A 2M2LA 3SE0A 4RA8A 1PLFA 4QMGA 2K28A 3MEHA 1HPCA 1BUVT 1STGA 3QB3A 1PFBA 5EBDA 5C0XJ 5E4XA 5C3XA 2VNUD 2F0GA 3GTJB 3OHXC 2JEBI 1GOZA 3I8ZA 1LT3D 1A2UA 3LNNA 2NN6G 5C4XB 2RBMA 3SDZA 2BE5D 1HUNA 2X6LA 3GD7A 5FO7B 3PUXA 1L0YB 4ABNA 5M5YB 4FP5D 3D8GA 1DJRD 5D14A 3P1HA 2CQAA 5IODA 1IKMA 1OXSC 4KD4A 2Z1CA 3MXPA 2NVXB 3K7AB 1QOHA 1KABA 3C1EA 5NUCA 2AUKA 1PRTB 4Z9CB 2AWNA 1SE4A 2FFKB 3X3MA 2MGSA 3I73A 5G3LF 4HEDA 1CM9A 4HCSA 2PZTA 1JC7A 3MXUA 1SNCA 2F0VA 1LT6D 3E0JA 2NVYB 1IW7D 2IT1A 2B8FA 1W6JA 4IALA 2LY7A 1LACA 4CKBA 3R3OA 2ID0A 3GTQB 2X6GA 2HCCA 1TS4A 2VB2X 2A69C 5KGUA 3TBIB 2E2JB 1S5FD 2AUJD 2K05A 4ME5A 5FK9C 2YU9B 3HS0C 1KLGD 2IX1A 3W2DA 1XYIA 4L6TB 3HGBA 1I4PA 1Q90A 3T13A 2C5CA 3H6MA 2XSCA 4OIKA 4IFDJ 2WACA 3DHQA 1CHPD 2PQEA 3NE5B 2XNAC 1LTID 5FKAC 1XWEA 3AU7A 1NR4A 4DN4M 1SNPA 2RDHA 1PXUA 3SVMA 4KD3A 2EJMA 1WTWA 4KY7A 2V4DA 3GO5A 4QB4A 3SXHA 1MSGA 4U68A 4RKLA 3VYUA 4EVOA 2L0CA 2IW3A 3N6RA 1STHA 3SK8A 4ID6A 4MN3A 1Z6HA 2F0OA 3AB9A 3TZUA 4PNYA 4X3TA 2C9OA 1EFID 1RF2D 5IT9L 3I4MB 4CKCA 4FXKC 3WOFA 4PMWA 4OIJA 1H9KA 2K5WA 1EU4A 1LLRD 1SAPA 4ZRZA 3MAQA 3MXNA 5EKIA 3PO3B 3R2TA 3A8JE 2KCCA 5C44B 1UAPA 1S5DD 1TIID 2NVTB 2ZXOA 4C2MB 3KUPA 2SEBD 1JOQA 2A6HD 3EVQA 4LK1C 1KTKA 3MHBA 3MA2B 2B63B 4X3KA 3D6WA 2Q8RE 1STAA 4ZYSA 2X69A 1XTCD 3LWUA 2XRSD 2K33A 2K5QA 1ET9A 1DCZA 2NN6H 1B9MA 1C4QA 1NSNS 2XRQD 5JVG3 2WIIB 1TQOA 1LV9A 5I9OA 2M9VA 2VB3X 1K83B 3T53B 2B2VC 1HRJA 1SMYD 2RDFA 1RTOA 2IL8A 2JA7B 1MI2A 3PO2B 2PNRC 3T56B 1E2VA 4C3IG 4RHSA 2A68C 3QWNA 2F0LA 1PMRA 3PIO3 3T4AC 3TN2A 4FO2A 1ENAA 2XWJB 1F77A 5JOBA 4HMJA 1B4OA 1U4RA 3DUZA 1HA5A 2Z4HA 3FPPA 3RMHA 4ZQ3A 1K8OA 2EY5A 1JR0D 3IKJA 5FLXL 5K36H 2R3ZA 1D6EC 4V0BA 5DM73 1CHQD 3T51B 1Q1BA 2QEJC 4KJNA 3HZXA 4C3JB 4XQJA 5EPKA 3A8IE 3MZ5A 1V43A 2K32A 2NN6I 1GUGA 4KKSA 4DF7A 3D6CA 1SJED 1ET6A 3MXGA 3Q22A 1BXTA 1TWFB 1DXMA 3URYA 2MHVA 5M3FB 1IYUA 1LABA 5FO8B 4KV6A 3HOVB 4A3BB 2KVMA 2EYMA 2EOTA 5JVH3 4CKEA 1I50B 2Q8TA 3KK7A 1LTSD 3Q24A 3TZDA 3KF8A 2B2WC 1IKLA 3A55A 4RH6A 4IUVA 5IGEA 2NYZD 3RD4A 2LS01 4MHEA 3H91A 4OL7A 2KOLA 1HFGA 2WV6D 1UEAB 4IURA 1RKNA 4WRDA 3OPOA 5E4WC 3M4OB 1KLUD 4S3SA 3NWSA 3N52A 3JAML 1VMPA 4RGMA 2HDMA 4EQNA 1HTLD 5ELDA 1ONLA 4DXFA 1T5EA 4IUQA 3C1FA 4C1NK 3T16A 2ICIA 2EPBA 3J81L 2AWOA 2PZUA 3NBIA 1EY9A 5EQ0A 1GUWA 3S1QB 1I4QA 1EYDA 4KHZA 2E2HB 1Q3LA 1Y1WB 1E0BA 2F3WA 3GP7A 3PUVA 4PV1C 1X3PA 3RUZA 2BA0A 3CKIB 1PRTD 1CZWA 2N55A 5JAVA 5EPLA 1KDAA 1Y8OB 2K7VA 2L55A 1TY0A 4ULLA 5CBAE 1B1ZA 1R9TB 1J8IA 4DAVA 1CTMA 5I2YA 4RAUC 1JE4A 3R93A 1BCPC 2ENBA 5JPMC 3AMUA 5DM63 2WINB 1VF5C 2EDGA 5ELBA 1DYQA 2F0PA 2D9UA 1UNSA 3VA7A 1E2ZA 1SE2A 3I90A 1AW7A 1F2LA 3A56A 3HP3A 1ZKOA 4TQUS 2Z4IA 4F88A 2EE1A 5IGDA 1PRTC 4KKUA 3SHLA 2B2VA 2PW5A 3NP8A 4HSPA 3FPUB 2WAQB 1EQTA 3Q6SA 5CBEE 4C3HG 1ZEQX 2K1BA 3TP5A 3K6OA 3TP8A 4NKLA 3MVVA 5M3MB 1HCZA 3H3VC 1STEA 1EY4A 5LL6X 3ONAB 3S9WA 1SYDA 4L8JA 4C56C 5C6AA 2EY6A 2HUGA 1SE3A 4FNFA 1F2MA 1I4GA 1EIGA 2IX0A 3GTGB 1TWCB 4J6HA 2EYLA 3RZDB 3DXJC 1LTAD 2A6HC 4KK7A 2DY8A 3QG1A 2JE6I 3PMFA 3SR1A 4UDUC 3K5LA 1CK1A 4NP5A 4LJZC 2L9HA 5D65A 4OO1G 4KJOA 3HKZB 4A93B 5KYIA 2R6GA 5M5XB 1AEXA 3V05A 3RLFA 2OXPA 5KNBA 5J39A 2I46A 1X32A 2O5JC 3K5OA 5CV8A 1EWCA 3VR2A 1BF4A 5JEAH 5C3WA 2GA4B 2F0MA 3S1NB 1MD2D 4Q0FA 3L3OC 4CBVA 4A3GB 2RDGA 4A3FB 1HFNA 3VR6A 5M9OA 4R8IA 1X3QA 4RWSC 5A35A 1WD0A 3HOUB 4KY6A 4X3UA 2EY2A 3VYRA 2BDNA 4BY1B 1EOTA 3K5MA 5C4JB 2EXZA 2QF7A 4DXGA 3GTKB 2QKIC 4FYDA 1DD2A 3D3RA 4C3IB 1PRTF 5CYUA 1EZ6A 2PYKA 1JCKB 4PMBA 2E74C 3D4WA 1H9RA 4BBRB 1TKWB 1GHKA 1GUTA 4CHTB 1QCBD 4FXDA 3NQIA 4KMUC 1XX8A 1QB5D 3QIAA 2CHBD 3VYSA 1KNAA 2OT2A 1BDOA 2OF1A 4R9WA 2AQ3B 5IGFA 2EY1A 2JP1A 4DA2A 4K2KA 3SK4A 4I65A 3J80L 4OHJA 1AZQA 3SEBA 4J8QA 3NPPA 3H09A 1YNJD 1LT4D 4V190 1PTOH 3MC0B 1PYWD 2JXMB 4K8IA 3M7NA 2JSOA 1ESRA 2JEAI 1RJTA 4P2CB 3MFYA 5G3LD 3OWEB 3KLSA 2Q8IB 3BDLA 3V96A 2F1MA 1FR3A 1ILPA 2RA4A 1PFNA 4HTHA 2F0SA 4G4KA 3TSSA 1VF7A 3BYYB 2KEEA 4IUUA 1U4PA 4A3JB 2KCNA 3QO2A 2XWBB 3X3NA 4TRDA 1SYCA 5DAUA 1V8QA 3M85A 5I2XA 3PUYA 3SK5A 2K6AA 4UAIA 1SSOA 5HGTA 1RTNA 1LT5D 1STYA 2K04A 4K5XA 5IGBA 2BE5C 4IUPA 4XYOA 4XT3B 5J22A 4CJ1B 1A2TA 3DWPA 1W6KA 4DK1A 2PW7A 1UUPA 2K5DA 4HR7B 1RD9D 3BZDB 1EY5A 5CV9A 3EFXD 4NMZA 2IX3A 4N9PA 1JWMD 1D1KA 1EEFD 1SYGA 3I4LA 4EQOA 4G57A 1V1PA 2J4XA 1S5CD 4IQZA 1CI3M 4RCOA 2F0KA 5EBCA 2NTSA 5T1GA 2ZT9C 2DN8A 4A3IB 1PTOF 1Q8IA 1QG7A 1PTOC 2A6EC 3A7AB 4BY7B 1PZID 2NVQB 1SEBD 3WDNA 2NUCA 2R61A 1SMYC 1S4ZA 2OEOA 4KY5A 1S5ED 1D5XC 3DMUA 2KQ3A 3OIPA 3OSOA 3J80E 4QIWB 4HAEA 2FHTA 3D4RA 4M8AA 5FOBB 3W3AA 1TVXA 2IWHA 1SYFA 1SNQA 1D2BA 2B2TC 2RQXA 1K8MA 1FNUA 4H7BA 2IJ0A 2F0EA 4AYBB 1OXTA 3HOXB 2F03A 3A8KE 3NTKA 1ENCA 1YNND 2RSNA 1DM0B 1SDFA 1F2ZA 5E1FA 1CQFA 1B9NA 2TSSA 3NK9A 1G6ZA 4A3MB 4XDXA 4BWGB 1A3TA 1FNVA 4ZK9B 3BS1A 1Y8NB 2JA6B 4RKBA 4O1NA 1ZXTA 5D3IB 4WFN3 1SYBA 1EZ8A 2EVBA 5EJWA 2CW0D 2B2UA 5JJZA 4JK1C 4ZLTF 3NTHA 1WTVA 1QNKA 1JB3A 5CV5A 1GUSA 4DK0A 1IL8A 4IN3A 3S2HB 2F3VA 2F0JA 3IFDA 3DWAA 1B53A 1VMCA 4ZUJA 2LKVA 4XQNA 4TSSA 2O4XA 3OOCA 2RSOA 5KYLA 5I4DA 4OO1H 1WD1A 1O7ZA 1B2TA 3S1RB 2A73B 1EQVA 1EYCA 4KN4C 3BVGA 5C0XG 2KUMA 3OW7A 4HCEA 3D4DA 4EGVA 2A74C 1D5MC 5EKLA 4RGNA 3PUWA 4H13C 4M1UB 1H9SB 2K03A 1SJHD 3C2PA 4B08A 1Q1EA 4CJ2C 4LMQD 3J81E 1KDBA 4ILWA 4JBWA 3QJYA 1DOLA 5M5WB 1WTPA 1ML0D 3VR4A 4IUNA 1PDQA 3FDTA 4F8MA 2E75C 3G7LA 1EWHA 1QNUA 1ENFA 2PZWA 1A15A 5IT9E 1C8CA 5I6YA 1TWGB 2JA8B 1JOKA 2VXWA 5D3DA 1BCPD 3S15B 1AN8A 2JYOA 1TWAB 3S1MB 3ND9A 2EYHA 4K6DA 1F2YA 1TS5A 2KA7A 1A6XA 1NCVA 2L11A 4XIGS 3H0GB 5LHY1 3Q23A 3J7YW 1IW7C 3HOZB 1SXTA 1OXXK 2MJ8A 3S16B 5CV4A 2F0TA 2M00A 1JOOA 2B2UC 5ELEA 3KBGA 3PUZA 2SNSA 3NHHA 1F9RA 4RHRA 1BCPB 1ZYRC 4IFDG 2F4IA 3U9SA 4FF4A 5IGCA 3CRKC 2WB1B 3R2IA 1A3VA 3U9OA 4EQPA 3HOWB 3C46A 2SOBA 4RCNA 1EYAA 2BOSA 2H4OA 2HCIA 3M4YA 4TKOB 1MBYA 2YYZA 1DZ1A 2NBFA 5TSSA 3NUCA 4I7ZC 5BN3A 5EGTA 5KNDA 1G91A 3UI2A 2SDFA 1WCMB 4A3EB 2VUMB 3IL8A 4FF3A 2KEDA 5FLXE 1NR2A 1QILA 1PFMA 2RVLA 1I4HA 1R4QB 1LTRD 1IYVA 3I3CA 4WJWA 3L7ZC 4G7OC 2KECA 5K5PA 5CMDA 2QDBA 5CV6A 1WTOA 2R93B 4GZYC 1EL0A 3BG3A 2B2WA 5JPNC 3DM1A 1CA5A 1CQVA 1BBXC 4MIUA 4YIJA 4F7XA 1O78A 1STBA 1Z7TA 1H9MA 4QUFA 2E2IB 3BVMA 2WKCA 2QILA 1SNDA 3S2DB 1R4PB 1B3AA 1Q12A 3WOEA 1OXVA 2D5DA 3O13A 1GUNA 5FO9B 1D5ZC 3IFTA 1BCPF 3J7AF 1T5XD 1O7LA 4K5VA 2B2YC 4A3DB 3KLSX 4FVMA 5IIFA 1G291 2FJ2A 2BA1A 2FMMA 1U9RA 1AFPA 4BBSB 4RGTA 3RZOB 4QUCA 4KKTA 2J0TD 1SNOA 4H44C 1STNA 3D31A 4RFBA 5KNCA 5A2QE 3HOYB 1EY7A 3M7GA 2MP1A 2PCFB 1EY8A 1ESFA 1G8ZD 2A68D 3G6JB 4DAPA 1NAPA 2J7ZA 2Y0SB 5COYA 1LTBD 2NWGA 5CGKA 1SYEA 2I07B 4ZKCB 1TWHB 4XT1B 1WTRA 2DNEA 1TS3A 5I6WA 3CU7A 2H1EA 4IZ8A 3J7AV 2R7ZB 4NDXA 5C4HA 4OO1I 4RGOS 1J9OA 1HQMC 2KJXA 2HDLA 4C3HB 2PPBC 1DONA 3F2UA 1Z47A 2G9HD 4L63B 4DFAA 4KN7C 5F2DA 3E6ZX 2RKSA 3OMGA 2F0NA 2FINB 5E3FA 2LFNA 2EJFC 3LWEA 3K5NA 4BA2I 1IHZA 2L4NA 5KEEA 2B2TA 4DNTB 3TP6A 3ITPA 2NB0A 3A7LA 4ZUIA 1KDCA 4PMCA 1PTOB 3GQBA 1B50A 5KRUA 2E2DC 5DNFA 4OGQC 1BR9A 3ND8A 1HXYD 2F0DA 2XVSA 4DAYA 1TU2B 1SBBB 5JEAG 3E5SA 1M8AA 1HTPA 5C4ZA 2SNMA 1TR5A 2PO4A 3MFGA 5C5LA 1BO0A 2L1BA 1V1OA 5HURA 5AFWA 5ELCA 1FNWA 2JA5B 3S17B 3K0YA 1F9QA 3BDCA 3BDOA 3Q0AA 1JICA 3JAME 1DOKA 2A5HA 3BVZA 2EJGC 3FEWX 2EYFA 5KIXA 3I70A 1NUCA 4DGZA 2B39A 3GTPB 4XYQA 4PQXA 1GHJA 4QCLA 1Y1VB 1JORA 1H9JA 2F0HA 3PV0A 4HSVA 5C3EB 2F0WA 2FMCA 2E76C 4XTCS 2QCPX 4U673 3FMCA 3GV6A 4X3SA 5ISRA 1KNEA 1O80A 5LL6S 2DY7A 3GTOB 3NBHA 1FYCA 3H94A 3P20A 3VR3A 3C3LA 1SFOB 1I3QB 3M3YB 3QOJA 4ZKBB 3DEOA 3QOLA 3DWQA 1V1PB 1GUOA 1S5BD 1XXGA 3VYTA 1YNJC 1PTOD 1QJOA 2N88A 5BN4A 5C5MA 4BS9A 4IUTA 4F87A 1ZYRD 5CV7A 2MUYA 4FF1A 4LAAA 2TMPA 3IAYA 3CHBD 4KHVA 3OMCA 4R8NA 5A2QL 1L0XB 2Z8LA 3GTMB 2IPKD 3I4NB 3OIQA 1HQRD 5J1ZA 3OWFA 1QWYA 1GJXA 2D62A 4ODGA 3TP7A 1EY0A 1I6VC 1EU3A 1Y69U 1I4XA 1VCIA 4CGYB 4NW2A 4C3JG 4C1NI 2A69D 1OXUA 1GXDC 1LTTD 1LO5D 2EYOA 3SK6A 1YNNC 1MSHA 3CQZB 3FRPB 3S14B 1LTGD 4FF2A 3LX0A 3TDQA 2EYJA 2B8GA 1WTQA 4G7HC 3KLRA 2G9DA 1Y8PB 2F0IA 5I9PA 2D2CC 1TT2A 5C0XH 1C48A 2F0FA 1E2WA 4A3KB 1JWUD 1TY2A 2CVRA 1HA6A 3I72A 3A54A 1CA6A 1EY6A 3P7JA 5JEAJ 2ZXRA 4K14A 4WORA 4XQQA 3MTSA 2NTTA 1JWSD 3GTLB 1G2TA 1JQYD 5C0XI 4G7ZC 3TMEA 1SNMA 3VA5A 3ERQA 2BCOA 3I91A 1KAAA 1WVLA 2R92B 1BNZA 1PZJD 5T1IA 5K36G 2O5IC 1I6HB 1BQQT 2ZXPA 4IFDH 1M4VA 5IOCA 4FXGC 2A6ED 3DEPA 1CZGA 1RCVD 4E6IA 3EA6A 4O42A 1EEID 4K8JA 2AQ1B 5DEHA 3FKIB 3CRLC 1EIHA 1RDPD 1PZKD 3EQLC 1AP0A 1I4RA 1RODA 4DU9A 1FD7D 1QE6A 3P75A 1ILQA 4IFDI 1F9PA 4BA1I 5CC4A 4J1MA 2HQEA 4B9XA 3BYTB 3HEJA 5EKKA 4KI0A 4B9WA 3K59A 4XXEA 3ZYYX 1U4MA 1H9SA 1F9SA 2LMCB 1U4LA 1CFMA 2WP8J 1VDZA 1DOMA 1D1IA 3HG9A 1HHVA 2NZ1D 4HMIA 4H0LC 3K57A 4K5WA 3EJIA 4K2LA 3NQTA 4Y7NB 3EROA 4ZAIA 5BN5A 1MGSA 1A3UA 1ICWA 4KTAA 2DNCA 1O7YA 3VR5A 2K01A 1FGBD 3NWTA 2F0UA 3V2TA 2EYPA 5CR3A 1B44D 2B2YA 3HRZC 3KBXA 5ELFA 2EZVA 2MPMA 2XIWA 1HUMA 2BDOA 1AZPA 4N9TA 3R8BA 1G2SA 3PIP3 2CW0C 1TS2A 4HN7A 4DNRB 2PMZB 3L9AX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y8N B;  1Z6H A;  4I7Z C;  3M7N A;  2O5J C;  2A6E D;  5BN3 A;  3VR4 A;  3I4L A;  2PCF B;  5KND A;  3AB9 A;  2A68 D;  4IQZ A;  3TZU A;  1CI3 M;  2JEA I;  2E75 C;  3BDO A;  3VR2 A;  3MFY A;  5JEA H;  1EWH A;  2AUK A;  1ONL A;  2EJG C;  2EVB A;  2ZT9 C;  3FPP A;  2DN8 A;  2Q8I B;  3CRL C;  1K8O A;  1H9K A;  1T5E A;  4JK1 C;  3I73 A;  3EQL C;  1GJX A;  2D62 A;  2F1M A;  1FR3 A;  1I6V C;  1Y69 U;  2A6E C;  3IKJ A;  1VCI A;  3MXU A;  2L5T A;  5K36 H;  3VR6 A;  1HCZ A;  1GHJ A;  3A7A B;  1VF7 A;  2KCC A;  3A8J E;  2A69 D;  1IW7 D;  2IT1 A;  5A35 A;  2AWO A;  2B8F A;  2DNE A;  4BA1 I;  1OXU A;  3ND9 A;  3WDN A;  1IYV A;  3T51 B;  1Q1B A;  1GUS A;  4DK0 A;  1LAC A;  2KA7 A;  1YNN C;  3L7Z C;  4L8J A;  4G7O C;  4KHZ A;  1H9J A;  3PV0 A;  1SMY C;  3A8I E;  4KI0 A;  1A6X A;  1HQM C;  1V43 A;  4GZY C;  2E76 C;  2QF7 A;  2K32 A;  3BG3 A;  3PUV A;  4XTC S;  4PV1 C;  4XIG S;  2NN6 I;  1GUG A;  4KKS A;  2PPB C;  4KN7 C;  1H9S A;  1IW7 C;  2A69 C;  2BA0 A;  1V8Q A;  3FMC A;  2B8G A;  2A6H D;  2LMC B;  4G7H C;  3KLR A;  3OOC A;  4LK1 C;  3M85 A;  1DD2 A;  3PUY A;  3SE0 A;  1CFM A;  2AUJ D;  1Y8P B;  1O78 A;  1VDZ A;  1FYC A;  1Y8O B;  3H94 A;  3P20 A;  1OXX K;  2K7V A;  1Z7T A;  2D2C C;  1H9M A;  1HPC A;  3VR3 A;  3D4R A;  5C0X H;  1DXM A;  1E2W A;  3W3A A;  3HGB A;  2EJF C;  4H0L C;  1Q90 A;  4BA2 I;  1Q12 A;  2BE5 C;  3I72 A;  1IYU A;  4DNT B;  1OXV A;  3PUZ A;  2D5D A;  1CTM A;  1LAB A;  3LWU A;  1K8M A;  2E74 C;  2K33 A;  4KN4 C;  3DXJ C;  2A6H C;  1DCZ A;  5BN5 A;  2NN6 H;  1GUN A;  2JEB I;  1B9M A;  5C0X G;  3IFT A;  1H9R A;  3NE5 B;  1OXT A;  3A7L A;  1TKW B;  1O7L A;  3OW7 A;  3A8K E;  1ZYR C;  4IFD G;  1VF5 C;  2EDG A;  2DNC A;  3QG1 A;  1GHK A;  1GUT A;  2JE6 I;  3GQB A;  1GUO A;  3LNN A;  3T53 B;  3VA7 A;  1E2Z A;  3U9S A;  1YNJ C;  1G29 1;  1QJO A;  2NN6 G;  3PUW A;  4H13 C;  3CRK C;  2BA1 A;  3VR5 A;  4KMU C;  3SDZ A;  2BE5 D;  4DK1 A;  4G7Z C;  4OGQ C;  5BN4 A;  1H9S B;  3ND8 A;  4LJZ C;  2PNR C;  3QIA A;  3T56 B;  4OO1 G;  3GD7 A;  1E2V A;  1BDO A;  1TU2 B;  5JEA G;  3PUX A;  1Q1E A;  4OO1 H;  1ZKO A;  1HTP A;  2A68 C;  2R6G A;  4TQU S;  4HR7 B;  2EJM A;  4KKT A;  1B9N A;  2BDO A;  4KKU A;  4RCN A;  2V4D A;  1PMR A;  4H44 C;  2CW0 C;  3M4Y A;  4JBW A;  5K36 G;  3QJY A;  2O5I C;  3D31 A;  3RLF A;  5KNC A;  4TKO B;  5KNB A;  4DNR B;  3N6R A;  2YYZ A;  1OXS C;  2JXM B;  3OPO A;  4IFD H; 
#chains in the Genus database with same CATH topology
 4DR7 L;  2KHS A;  2AMC B;  2VQF L;  1OO9 B;  2AQ2 B;  4LFA L;  2XN9 C;  3HFZ B;  3MWY W;  1CT1 D;  4QF4 A;  5IT9 c;  1XTD A;  3EBE A;  1II3 A;  2KBN A;  2WKD A;  1WCM G;  3NXW A;  2ICE C;  4Q5V A;  2L5T A;  1YHA A;  5COR A;  1RHP A;  2O2L D;  2L12 A;  1BOS A;  3J7A 5;  3K58 A;  4K6L A;  4JI6 Q;  2F0Q A;  1R9T H;  3NSW A;  3FVQ A;  5IGG A;  4B3T L;  1WTX A;  3NTI A;  1S72 A;  5EPJ A;  1MHW C;  4CJ0 B;  2OCE A;  3GV3 A;  2M2L A;  4N8F A;  4OX9 L;  3SE0 A;  3J81 j;  4RA8 A;  1VQM A;  1PLF A;  4QMG A;  2K28 A;  3MEH A;  1HPC A;  1BUV T;  1STG A;  3QB3 A;  1PFB A;  3MXN B;  4A3M G;  4LF8 Q;  4OX9 Q;  5EBD A;  5C0X J;  5E4X A;  5C3X A;  2VNU D;  2F0G A;  3NEN A;  3GTJ B;  1J5E Q;  3OHX C;  2JEB I;  1GOZ A;  4FDB A;  3I8Z A;  2YTX A;  3HOY G;  1LT3 D;  5LMN Q;  2K14 A;  1A2U A;  3LNN A;  2NN6 G;  5C4X B;  2RBM A;  3SDZ A;  1ASZ A;  2BE5 D;  1HUN A;  4JI8 L;  2X6L A;  3GD7 A;  5FO7 B;  3PUX A;  3UDG A;  1L0Y B;  1E1T A;  3T1Y L;  4ABN A;  4LWC A;  5M5Y B;  1XNR L;  2KEN A;  4FP5 D;  3D8G A;  1K73 C;  1DJR D;  5D14 A;  3P1H A;  2CQA A;  4IJH A;  5IOD A;  3GTO H;  4A3L H;  1IKM A;  3CAM A;  5EAY A;  1OXS C;  4KD4 A;  2Z1C A;  3KF6 A;  3MXP A;  2NVX B;  3TRE A;  1BBW A;  3K7A B;  1QOH A;  1KAB A;  2RCF A;  3C1E A;  5NUC A;  2AUK A;  2YV5 A;  4DK3 C;  1PRT B;  4Z9C B;  2AWN A;  1SE4 A;  4UHV A;  2FFK B;  3X3M A;  2MGS A;  3I73 A;  5G3L F;  4HED A;  4B3M Q;  1CM9 A;  4HCS A;  2PZT A;  2QA4 A;  1JC7 A;  2XGT A;  2V1C C;  1HH2 P;  3MXU A;  5IYD G;  2F4V L;  1SNC A;  2F0V A;  3CCR A;  1LT6 D;  3E0J A;  2NVY B;  1IW7 D;  2NZO A;  2IT1 A;  3RN2 A;  2D0O A;  2B8F A;  1W6J A;  4IAL A;  2LY7 A;  1LAC A;  4CKB A;  3R3O A;  1HR0 Q;  2ID0 A;  3GTQ B;  1SFO H;  5M3F H;  2X6G A;  3FKI H;  2HT1 A;  2HCC A;  1TS4 A;  1HR0 W;  3PF4 A;  4DV7 L;  2VB2 X;  3LGJ A;  2A69 C;  2MO1 A;  4CDE C;  2CH4 W;  5KGU A;  3TBI B;  2E2J B;  1S5F D;  1E24 A;  2AUJ D;  2K05 A;  4ME5 A;  5FK9 C;  2YU9 B;  3HS0 C;  1KLG D;  2IX1 A;  3W2D A;  5FLM G;  1XYI A;  4L6T B;  3HGB A;  1I4P A;  1Q90 A;  2K50 A;  3FHW A;  3T13 A;  3RN5 A;  2C5C A;  3H6M A;  1MKH A;  2XSC A;  4OIK A;  3KDF A;  4IFD J;  2OTL A;  2VQE L;  2WAC A;  3DHQ A;  1PVO A;  1CHP D;  2PQE A;  2I5M X;  3NE5 B;  4A3C H;  5L37 A;  5IYB H;  3E9H A;  4R4I A;  2XNA C;  4DNI A;  1LTI D;  3NEM A;  5FKA C;  4OWT B;  3U50 C;  1XWE A;  3AU7 A;  1NR4 A;  4DN4 M;  4B3S L;  1A63 A;  1SNP A;  4ZCK A;  3S14 H;  4NXN L;  2RDH A;  1PXU A;  3SVM A;  4P75 A;  4KD3 A;  2EJM A;  4DK6 C;  1WTW A;  4KY7 A;  2V4D A;  3GO5 A;  4UY8 C;  3K0X A;  4QB4 A;  3SXH A;  2LXJ A;  1MSG A;  4U68 A;  4DR4 Q;  4RKL A;  1AE3 A;  3VYU A;  4EVO A;  2Z6B A;  2L0C A;  2IW3 A;  3N6R A;  1STH A;  3SK8 A;  2CCZ A;  2UUB L;  1EIF A;  4ID6 A;  4DV4 L;  4MN3 A;  1Z6H A;  2F0O A;  1N33 Q;  4DR6 Q;  2NVQ H;  3AB9 A;  3TZU A;  4JG2 A;  3KFU A;  2WB1 G;  4PNY A;  3PF5 A;  4X3T A;  2C9O A;  1X54 A;  1EFI D;  1RF2 D;  1PH6 A;  3MEF A;  5IT9 L;  4R4T A;  3I4M B;  4CKC A;  4WJ3 M;  4FXK C;  4DV3 L;  3WOF A;  4PMW A;  4OIJ A;  1H9K A;  2K5W A;  1EU4 A;  1LLR D;  1SAP A;  4CDD C;  3HOV G;  4ZRZ A;  2N78 A;  3MAQ A;  3MXN A;  1NJI C;  5EKI A;  3PO3 B;  4A3L G;  3R2T A;  3A8J E;  2KCC A;  5C44 B;  2K5H A;  1UAP A;  3K8A A;  2N49 A;  2HIX A;  4LFA Q;  2HD3 A;  1S5D D;  1TII D;  4JI0 Q;  4QJF A;  2NVT B;  2ZXO A;  4GKJ L;  4C2M B;  3KUP A;  2SEB D;  1JOQ A;  1SE8 A;  2A6H D;  2RCN A;  3EVQ A;  4LK1 C;  1KTK A;  1IBL L;  1YHQ A;  1MJE A;  3MHB A;  2JA8 G;  3MA2 B;  2B63 B;  4X3K A;  2E2I H;  3D6W A;  2Q8R E;  2K4K A;  1STA A;  4ZYS A;  2X69 A;  4A3J G;  4BXX H;  1XTC D;  3LWU A;  2XRS D;  2ALY B;  2K33 A;  2K5Q A;  1ET9 A;  1DCZ A;  2NN6 H;  1NSN S;  1B9M A;  1C4Q A;  4C3H H;  2XRQ D;  1IZ6 A;  5JVG 3;  2WII B;  2MQH A;  1TQO A;  4A76 A;  3OYY A;  1LV9 A;  5M3M G;  5I9O A;  2M9V A;  1VQF A;  1N34 Q;  2VB3 X;  3TQY A;  1K83 B;  3T53 B;  3I56 A;  1I6H H;  2QDL A;  2B2V C;  1HRJ A;  2ZTC A;  1SMY D;  2RDF A;  1RTO A;  2IL8 A;  2JA7 B;  1MI2 A;  3PO2 B;  2PNR C;  3T56 B;  1CSP A;  1E2V A;  3K7A H;  4C3I G;  1LUZ A;  4JOI A;  4RHS A;  2AKW B;  2A68 C;  5GAD C;  4DV4 Q;  3QWN A;  2F0L A;  4HIM A;  1PMR A;  4IJL A;  3PIO 3;  3T4A C;  3TN2 A;  4GS3 A;  4FO2 A;  1ENA A;  1PV4 A;  2XWJ B;  1F77 A;  5JOB A;  4HMJ A;  1B4O A;  4X66 Q;  1U4R A;  1VQ4 A;  3PIO A;  3DUZ A;  2IHF A;  3E3X A;  3I2Z A;  4JW0 A;  3S24 A;  4LF7 Q;  1HA5 A;  2Z4H A;  3FPP A;  3RMH A;  4ZQ3 A;  1K8O A;  4OEL B;  1PH1 A;  2EY5 A;  4DR1 Q;  1B70 B;  4DUY Q;  1G6P A;  1JR0 D;  1YVC A;  3IKJ A;  5FLX L;  4K0K Q;  4POG A;  5K36 H;  2EIF A;  3K81 C;  4DR2 Q;  2R3Z A;  1D6E C;  1HZ9 A;  4V0B A;  1VQ6 A;  4B3M L;  5DM7 3;  1CHQ D;  3T51 B;  1WCM H;  4UPA A;  1Q1B A;  2QEJ C;  4KJN A;  1D8L A;  4I7A A;  2R7F A;  3HZX A;  4C3J B;  1UE1 A;  5EPK A;  4XQJ A;  3AEV A;  3A8I E;  3MZ5 A;  1VQC A;  1IBM Q;  1V43 A;  2K32 A;  4A3I G;  1QZH A;  2NN6 I;  1GUG A;  4KKS A;  4DF7 A;  3D6C A;  4DR5 Q;  1VQH A;  2PQA B;  2AHO B;  1UE6 A;  1SJE D;  1ET6 A;  3MXG A;  3Q22 A;  1BXT A;  1TWF B;  1LYL A;  1TXY A;  1DXM A;  1X3E A;  4IOC A;  3URY A;  4NXN Q;  2MHV A;  4LF7 L;  4LF9 L;  5M3F B;  2R93 H;  1IYU A;  1LAB A;  5FO8 B;  4KV6 A;  3HOV B;  4A3B B;  2KVM A;  1YJW A;  2EYM A;  2EOT A;  3CF5 A;  5JVH 3;  4A3F G;  1IBK Q;  4CKE A;  1I50 B;  4X62 Q;  4PZ8 A;  2Q8T A;  3KK7 A;  3L0O A;  1LTS D;  1TWH H;  4DV6 L;  4UP7 A;  3Q24 A;  4AIM A;  1NBW A;  4QGU A;  3TZD A;  1CKM A;  5IY0 A;  3KF8 A;  2JA7 H;  2B2W C;  1IKL A;  4QL5 A;  3A55 A;  4MZ9 A;  4RH6 A;  3FKI G;  4A3J H;  4IUV A;  5IGE A;  2NYZ D;  5M5Y H;  4LF6 L;  3RD4 A;  1PH4 A;  2LS0 1;  4MHE A;  3M4P A;  4OL7 A;  3H91 A;  1JE5 A;  2KOL A;  2CQO A;  2QW7 A;  1Q81 C;  4LW1 A;  1HFG A;  2WV6 D;  1UEA B;  4IUR A;  1RKN A;  4EQ5 A;  3OPO A;  4WRD A;  5E4W C;  3M4O B;  1KLU D;  4P74 A;  4S3S A;  3NWS A;  3N52 A;  3JAM L;  1VMP A;  4RGM A;  4JI3 L;  4NXM L;  2HDM A;  1IYJ B;  3EN2 A;  4EQN A;  4JI6 L;  3CC7 A;  1HTL D;  5ELD A;  1EFW A;  1ONL A;  4ALP A;  4DXF A;  1T5E A;  4IUQ A;  3C1F A;  1SRO A;  4C1N K;  3T16 A;  2ICI A;  2EPB A;  1SMX A;  3J81 L;  1C0A A;  1XPR A;  2AWO A;  2PZU A;  1WYD A;  3NBI A;  1KC8 C;  1EY9 A;  5EQ0 A;  1GUW A;  3W1G A;  3S1Q B;  3E0E A;  3ERS X;  1I4Q A;  4JI3 Q;  1EYD A;  4KHZ A;  1YBY A;  2E2H B;  4LUZ A;  1Q3L A;  1Y1W B;  1E0B A;  2F3W A;  3GP7 A;  4GNX C;  4BBS H;  3PUV A;  4PV1 C;  1X3P A;  4QIW E;  3RUZ A;  2BA0 A;  3CKI B;  1PRT D;  1CZW A;  2N55 A;  2JA6 H;  1VQP A;  5JAV A;  1TWA H;  3S1M H;  5EPL A;  1KDA A;  1Y8O B;  2K7V A;  3G4S A;  2L55 A;  1L1O C;  1TY0 A;  4ULL A;  5CBA E;  1TWF H;  1B1Z A;  3CCE A;  3CCJ A;  1N8R C;  1Y1W H;  1R9T B;  1J8I A;  4DAV A;  1CTM A;  5I2Y A;  4RAU C;  3HOV H;  1JE4 A;  3R93 A;  2ZM6 Q;  4A3I H;  5FLM H;  1K8G A;  4JYA L;  1BCP C;  2IHE A;  2ENB A;  4DPG A;  5JPM C;  2DGY A;  5DM6 3;  3AMU A;  2WIN B;  5GRO A;  1VF5 C;  2EDG A;  4POF A;  2KCM A;  5ELB A;  1DYQ A;  2F0P A;  2D9U A;  1UNS A;  3VA7 A;  1E2Z A;  1SE2 A;  4HIK A;  3SGI A;  5IYB G;  3I90 A;  1AW7 A;  4JI2 L;  1F2L A;  1S3O A;  4L5T A;  3A56 A;  3HP3 A;  1ZKO A;  4TQU S;  2Z4I A;  4F88 A;  3CXC A;  2EE1 A;  5IGD A;  1PRT C;  4OWW B;  2L15 A;  4KKU A;  1HNZ L;  4DV2 L;  2VQF Q;  3SHL A;  3GTL H;  1Q86 C;  2B2V A;  1IBL Q;  1QUQ B;  2G5D A;  2B29 A;  4AYB G;  3HOX G;  1ASY A;  2IY5 B;  2K5V A;  2PW5 A;  3NP8 A;  4HSP A;  1B7Y B;  4A3G G;  1Y1V H;  3FPU B;  1JMC A;  2WAQ B;  3JC6 6;  2JA9 A;  3ICE A;  1EQT A;  3Q6S A;  1RIP A;  5CBE E;  2ZTE A;  4C3H G;  2UXB L;  1ZEQ X;  2K1B A;  3TP5 A;  2FXQ A;  4JV5 Q;  3K6O A;  3TP8 A;  4NKL A;  5IE8 A;  3MVV A;  5M3M B;  1HCZ A;  4GN4 B;  5IP9 H;  3H3V C;  1STE A;  4X6A H;  1EY4 A;  5LL6 X;  2OTJ A;  3ONA B;  3S9W A;  2WFW A;  4YWM A;  1WI5 A;  2H5X A;  1SYD A;  4L8J A;  4C56 C;  3S1R H;  5C6A A;  2EY6 A;  4Y7N H;  4YHH Q;  2Q2H A;  2HUG A;  4A3C G;  1SE3 A;  1MJC A;  4FNF A;  3F2C A;  3KF8 B;  1HR0 L;  1F2M A;  1I4G A;  4YWL A;  1EIG A;  4WJ4 A;  4DV0 Q;  3HKS A;  2IX0 A;  1FVI A;  3GTG B;  4B3T Q;  4B3S Q;  1TWC B;  3S2H H;  1IBK L;  4C3J H;  1KXL A;  2F52 A;  3A5Z B;  4J6H A;  2UXC L;  4YY3 Q;  2EYL A;  2WB1 E;  3RZD B;  4A3G H;  3DXJ C;  1LTA D;  2A6H C;  4KK7 A;  1B3Q A;  4OEM B;  2DY8 A;  2UU9 L;  3HOX H;  1X3G A;  1I5F A;  3QG1 A;  5C3E G;  2JE6 I;  2E8G A;  3PMF A;  3SR1 A;  4UDU C;  3G71 A;  3K5L A;  1CK1 A;  1W3S A;  4NP5 A;  2K5N A;  4LJZ C;  2L9H A;  2PI2 E;  5D65 A;  4X65 L;  3M3Y H;  4OO1 G;  4KJO A;  3HKZ B;  4RMF A;  4A93 B;  1D7Q A;  4GLA C;  1JJ2 A;  5KYI A;  2R6G A;  5M5X B;  1CSQ A;  1NMG A;  4JBM A;  1AEX A;  1XNQ Q;  3A74 A;  3V05 A;  4H02 A;  4DV1 Q;  1U5K A;  3RLF A;  2OXP A;  5KNB A;  4C3I H;  5J39 A;  2I46 A;  1X32 A;  5H1S E;  2O5J C;  2JN4 A;  3K5O A;  2EXD A;  5JJL A;  5CV8 A;  1Q7Y C;  2C35 B;  1EWC A;  2I5H A;  3HKZ E;  3VR2 A;  1BF4 A;  5JEA H;  5C3W A;  4GNX B;  2GA4 B;  2F0M A;  3S1N B;  1MD2 D;  4LFC Q;  4Q0F A;  3L3O C;  4CBV A;  2CFM A;  3RZD H;  4A3G B;  2B63 G;  2RDG A;  1N32 Q;  4A3F B;  2YTV A;  1HFN A;  4OON A;  3VR6 A;  5M9O A;  4R8I A;  2E5L Q;  1X3Q A;  4RWS C;  5A35 A;  1WD0 A;  3HOU B;  4KY6 A;  3CD6 A;  4X3U A;  1ICF B;  2EY2 A;  3VYR A;  2BDN A;  2LSS A;  4BY1 B;  2ZTD A;  1EOT A;  4A3E G;  3K5M A;  5E7N A;  4B3R L;  5C4J B;  2EXZ A;  2QF7 A;  3CCL A;  4DXG A;  1SR3 A;  3GTK B;  2QKI C;  3J81 i;  4FYD A;  3I4N G;  4N8X 1;  1DD2 A;  3AFP A;  2E2J H;  3D3R A;  4C3I B;  1VS0 A;  1PRT F;  5CYU A;  1EZ6 A;  2PYK A;  1JCK B;  1MIU A;  3KJO A;  1DGS A;  1JJG A;  4GOP C;  1EIY B;  1PYS B;  5C4J H;  5GAH C;  4PMB A;  2E74 C;  1A0I A;  2KHJ A;  1VQB A;  3D4W A;  3WWV A;  1H9R A;  4JI2 Q;  4BBR B;  1TKW B;  1GHK A;  1GUT A;  4CHT B;  1QCB D;  4FXD A;  3NQI A;  4KMU C;  1XX8 A;  3STB C;  1QB5 D;  3QIA A;  2CHB D;  3VYS A;  1K8A C;  1KNA A;  4UP8 A;  3I4M G;  2OT2 A;  1BDO A;  2OF1 A;  4R9W A;  4X64 Q;  3TRZ A;  1UE5 A;  4OWX B;  2AQ3 B;  5IGF A;  2EY1 A;  2JP1 A;  4DA2 A;  4K2K A;  3SK4 A;  4I65 A;  3J80 L;  4OHJ A;  1AZQ A;  4AQY L;  1YJ9 A;  3SEB A;  4J8Q A;  3NPP A;  3H09 A;  3AQQ A;  1YNJ D;  3PO3 G;  1LT4 D;  2Z9H A;  4V19 0;  1PTO H;  3MC0 B;  1PYW D;  3TS0 A;  2JXM B;  1Y14 B;  4K8I A;  3M7N A;  4AQY Q;  2JSO A;  1ESR A;  2JEA I;  1RJT A;  4P2C B;  3MFY A;  5G3L D;  3OWE B;  3KLS A;  2Q8I B;  4BY7 G;  3BDL A;  1L0W A;  1PH7 A;  1HNX L;  1WJJ A;  3V96 A;  2F1M A;  1FR3 A;  1ILP A;  2RA4 A;  1PFN A;  3CCU A;  4HTH A;  2F0S A;  4G4K A;  3TSS A;  2JJQ A;  1VF7 A;  3BYY B;  5IWA L;  2R7Z G;  1K83 H;  1UEB A;  2KEE A;  4A3B G;  4IUU A;  1U4P A;  4A3J B;  3RR5 A;  2KCN A;  3CCV A;  3QO2 A;  3U58 A;  2VZA A;  2XWB B;  3X3N A;  4TRD A;  1HNX Q;  1SYC A;  5DAU A;  1V8Q A;  4DUY L;  4C2M H;  3M85 A;  5I2X A;  3PUY A;  3SK5 A;  2K6A A;  4UAI A;  4JI0 L;  1SSO A;  5HGT A;  2JA7 G;  1RTN A;  1J5E L;  2YTY A;  1LT5 D;  1STY A;  2K04 A;  4K5X A;  1C9O A;  5IGB A;  2ES2 A;  1IL2 A;  4A93 H;  2BE5 C;  4IUP A;  3CME A;  3RLO A;  4DV5 Q;  4XYO A;  4XT3 B;  2WAQ G;  5J22 A;  3NEL A;  4CJ1 B;  4DUZ Q;  1A2T A;  4IPH A;  4JI7 Q;  3PIP A;  3DWP A;  1W6K A;  5BR8 L;  3M4Q A;  1C7Y A;  4DK1 A;  4X62 L;  2PW7 A;  3KJP A;  1XMQ Q;  4DR4 L;  2R92 H;  1UUP A;  1VQE A;  5FJ8 G;  4A3B H;  2K5D A;  4HR7 B;  3JAM i;  1RD9 D;  3BZD B;  5BR8 Q;  1EY5 A;  4JI4 Q;  1I50 H;  5CV9 A;  3EFX D;  4NMZ A;  2PQA A;  2Z6K A;  4GKK Q;  1NMF A;  3OTO L;  1J6Q A;  1OTC A;  2IX3 A;  4N9P A;  3UDF A;  2JA5 H;  1JWM D;  1D1K A;  1EEF D;  4HJ8 A;  1SYG A;  3I4L A;  4EQO A;  4G57 A;  1V1P A;  2J4X A;  1S5C D;  4IQZ A;  4DV2 Q;  1CI3 M;  4RCO A;  2F0K A;  5EBC A;  1UE7 A;  2NTS A;  3L2P A;  5T1G A;  4LF9 Q;  2JK8 A;  4GLV B;  2ZT9 C;  2E2H H;  2DN8 A;  4A3I B;  1EQQ A;  1PTO F;  2VY3 A;  4BBR G;  1BKB A;  1K3R A;  2DJG C;  1Q8I A;  1QG7 A;  2K52 A;  1PTO C;  2A6E C;  1Y1V G;  3A7A B;  1VQK A;  4BY7 B;  1PZI D;  1YHB A;  2NVQ B;  1CKN A;  1SEB D;  3WDN A;  2NUC A;  3M9B A;  2R61 A;  4JI1 Q;  1YEZ A;  3GTQ H;  1SMY C;  3I4N H;  4DR2 L;  3HKZ G;  4P72 A;  2QEX A;  4PZ7 A;  1S4Z A;  2OEO A;  1EQR A;  4KY5 A;  1S5E D;  1D5X C;  4O2D A;  4MTN A;  1WOC A;  3DMU A;  2OQK A;  1FJG L;  2KQ3 A;  1P16 A;  1N34 L;  3OIP A;  3OSO A;  3J80 E;  4KHP Q;  3E9I A;  3Q8D A;  4QIW B;  4HAE A;  2FHT A;  1TWC H;  3D4R A;  4M8A A;  5FOB B;  3W3A A;  1TVX A;  3CQZ H;  2IWH A;  1YIJ A;  1SYF A;  1SNQ A;  1D2B A;  3HOW H;  2B2T C;  2RQX A;  4DV3 Q;  1K8M A;  1FNU A;  4H7B A;  2IJ0 A;  2F0E A;  3PGZ A;  2RHS B;  5IYC G;  4AYB B;  1OXT A;  3HOX B;  1HZC A;  5M3F G;  2F03 A;  1CKO A;  3A8K E;  3NTK A;  3UDX A;  1ENC A;  3NBH B;  1GO3 E;  1YNN D;  1HJP A;  2RSN A;  1YIT A;  1DM0 B;  1SDF A;  4JI1 L;  1L1O B;  1KIX A;  1F2Z A;  3J81 c;  3J7Z C;  3RZO H;  4LF4 L;  5E1F A;  3CCQ A;  1CQF A;  1E1O A;  1B9N A;  2TSS A;  3NK9 A;  1G6Z A;  4A3M B;  2JQO A;  1PHJ A;  4XDX A;  4BWG B;  4IPD A;  1A3T A;  1FNV A;  1E22 A;  4ZK9 B;  3BS1 A;  1WFQ A;  1Y8N B;  2JA6 B;  4RKB A;  5LMU L;  4O1N A;  4P73 A;  1ZXT A;  5D3I B;  5IP7 H;  4WFN 3;  4DR1 L;  1EOV A;  2UXC Q;  1SYB A;  3AYH B;  1EZ8 A;  2EVB A;  5EJW A;  2CW0 D;  3A0J A;  2B2U A;  1L2F A;  4EX5 A;  4A75 A;  5JJZ A;  4JK1 C;  1N9W A;  4RG1 A;  1UWV A;  4ZLT F;  3NTH A;  1WTV A;  3PQI A;  1XMO L;  3S15 H;  1AE2 A;  1QNK A;  1JB3 A;  5CV5 A;  4BBS G;  1GUS A;  1L1O A;  4DK0 A;  3H0G G;  4HJ7 A;  1IL8 A;  4IN3 A;  4JCV E;  3S2H B;  4BXX G;  2F3V A;  2KHI A;  2F0J A;  3IFD A;  3DWA A;  2VW9 A;  1KAW A;  1EYG A;  4DR3 L;  1B53 A;  3GTK H;  1VMC A;  4ZUJ A;  5M3M H;  2LKV A;  4XQN A;  4TSS A;  2O4X A;  3OOC A;  2RSO A;  4A93 G;  5KYL A;  5I4D A;  4OO1 H;  1LTL A;  1WD1 A;  2VQE Q;  5C44 G;  1O7Z A;  3I7F A;  4JC0 A;  1B2T A;  2CKZ B;  3RNU A;  3S1R B;  2I0Q A;  2A73 B;  1AH9 A;  1GKH A;  4YCW A;  2HQL A;  4NPS A;  1EQV A;  1Z9F A;  1E7Z A;  1EYC A;  4KN4 C;  3BVG A;  5C0X G;  2UXD L;  2VL6 A;  2KUM A;  4TVA B;  3OW7 A;  4HCE A;  4LFB Q;  2UUB Q;  1XMO Q;  3D4D A;  4EGV A;  2A74 C;  1D5M C;  5EKL A;  4RGN A;  2PMZ E;  3PUW A;  4H13 C;  4IPG A;  4NB3 A;  5IWA Q;  4M1U B;  1HNZ Q;  3DM3 A;  1H9S B;  3PSI A;  2K03 A;  4J15 A;  1SJH D;  3C2P A;  4B08 A;  1Q1E A;  4LFC L;  3H0G H;  3CPW A;  4CJ2 C;  4LMQ D;  2N8N A;  3TEH B;  3J81 E;  1KDB A;  3KOJ A;  4ILW A;  3KYH C;  4JI8 Q;  4JBW A;  3QJY A;  2LXK A;  1DOL A;  1KL9 A;  5M5W B;  4QQB X;  1WTP A;  1HZA A;  3B6Y A;  1JB7 A;  1ML0 D;  1O7I A;  3VR4 A;  4IUN A;  1PDQ A;  3FDT A;  4LF8 L;  4F8M A;  2E75 C;  3G7L A;  1VQO A;  1KRS A;  5GQO A;  1EWH A;  1QNU A;  1I94 Q;  1ENF A;  2B3G A;  2PZW A;  3CMA A;  1A15 A;  1K0S A;  5IT9 E;  1C8C A;  4L5R C;  5I6Y A;  1TWG B;  2JA8 B;  3U4V A;  1JOK A;  1QVC A;  2VXW A;  2ASB A;  1PFS A;  5D3D A;  2HHH Q;  1BCP D;  1VQJ A;  3S15 B;  4A3D G;  1AN8 A;  2A19 A;  2JYO A;  1TWA B;  3S1M B;  2UXB Q;  3ND9 A;  2EYH A;  4DV7 Q;  1N32 L;  4K6D A;  1F2Y A;  1TS5 A;  2KA7 A;  3T1Y Q;  4KHP L;  3QR8 A;  1A6X A;  3GDE A;  1X6O A;  1NCV A;  2L11 A;  3UE0 A;  4A3F H;  1PYB A;  4XIG S;  3H0G B;  5LHY 1;  3CP0 A;  3Q23 A;  3J7Y W;  1IW7 C;  4MNO A;  2JA5 G;  3HOZ B;  1SXT A;  1OXX K;  2MJ8 A;  3S16 B;  2NZH A;  5CV4 A;  1PH9 A;  2F0T A;  2EQS A;  2M00 A;  1I3Q H;  1JOO A;  2B2U C;  5ELE A;  3KBG A;  1LM0 A;  3PUZ A;  4GLX A;  1BVS A;  2SNS A;  3NHH A;  1S40 A;  1F9R A;  4RHR A;  2Q2I A;  1K0R A;  1BCP B;  1ZYR C;  4IFD G;  1PA6 A;  2F4I A;  4IO9 A;  5ELN A;  3AFQ A;  3U9S A;  3U4Z A;  4FF4 A;  5IGC A;  2ZM6 L;  3CRK C;  4HID A;  2WB1 B;  3R2I A;  2UU9 Q;  4LF5 L;  1A3V A;  3HOU H;  2PNH A;  4MTK A;  4LNQ A;  2RHQ B;  3U9O A;  4EQP A;  3HOW B;  3CC4 A;  3C46 A;  2MNA A;  2SOB A;  4RCN A;  1EYA A;  4A3K G;  2BOS A;  3CCS A;  2H4O A;  2HCI A;  2MFI A;  3M4Y A;  2DUD A;  4TKO B;  1MBY A;  1Q46 A;  2YYZ A;  1DZ1 A;  2NBF A;  5TSS A;  3NUC A;  4I7Z C;  5C4X H;  1VQI A;  1IXR A;  5BN3 A;  1PH8 A;  3HOZ H;  5EGT A;  5KND A;  1G91 A;  3S2D H;  2UUA Q;  3UI2 A;  2SDF A;  1WCM B;  2K75 A;  4A3E B;  2VUM B;  3I4M H;  3IL8 A;  4FF3 A;  2KED A;  3K80 C;  4HJ9 A;  5IYC H;  3PO2 G;  1M1K C;  2XTI A;  5FLX E;  1NR2 A;  4KLK A;  1QIL A;  3I4O A;  2BH2 A;  3F1Z A;  1PFM A;  3BZC A;  2RVL A;  5AJ3 Q;  1QUQ A;  1I4H A;  1R4Q B;  1LTR D;  1IYV A;  3I3C A;  4PZ6 A;  4A3E H;  1EUJ A;  4UP9 A;  4WJW A;  3L7Z C;  4G7O C;  2KEC A;  5K5P A;  5CMD A;  4R4O A;  4BY1 H;  3HOU G;  2QDB A;  5CV6 A;  4LF4 Q;  3UDI A;  1WTO A;  1X65 A;  2R93 B;  4GZY C;  1EL0 A;  3FP9 A;  3PCO B;  3BG3 A;  2B2W A;  5JPN C;  3DM1 A;  4R4Q A;  1CA5 A;  1A8V A;  1CQV A;  1BBX C;  4MIU A;  4K0K L;  4YIJ A;  4F7X A;  1O78 A;  3ULJ A;  4YCU A;  1STB A;  1Z7T A;  1H9M A;  4QUF A;  2E2I B;  1VQL A;  3BVM A;  1YJN A;  2WKC A;  3CC2 A;  2QIL A;  1SND A;  3S2D B;  2A8V A;  1R4P B;  1B3A A;  1Q12 A;  3WOE A;  1OXV A;  2D5D A;  4HJ5 A;  2UUC L;  3O13 A;  1GUN A;  5FO9 B;  1D5Z C;  3IFT A;  1BCP F;  2ZJR A;  1T5X D;  3J7A F;  3ULP A;  1O7L A;  4K5V A;  2B2Y C;  4A3D B;  2N3S A;  3KLS X;  3KLW A;  3W1B A;  1PH3 A;  4FVM A;  5IIF A;  1G29 1;  2FJ2 A;  2BA1 A;  1SN8 A;  2FMM A;  3T1H L;  1U9R A;  1AFP A;  3F2B A;  4BBS B;  4RGT A;  3RZO B;  4JBJ A;  1QZG A;  4QUC A;  2GN5 A;  3S1N H;  4DV5 L;  4KKT A;  3H3V I;  2J0T D;  3CCM A;  1SNO A;  1N33 L;  4H44 C;  2RF4 A;  1P8L A;  1STN A;  3D31 A;  4RFB A;  5KNC A;  5A2Q E;  1BBU A;  3HOY B;  1JT8 A;  1EY7 A;  3M7G A;  1Y1W G;  2MP1 A;  2OQ0 A;  2PCF B;  2Y0S E;  1EY8 A;  3JAM c;  5C44 H;  1ESF A;  2NVX H;  1G8Z D;  2A68 D;  3G6J B;  4DAP A;  1NAP A;  2J7Z A;  2Y0S B;  5COY A;  5M5X H;  1LTB D;  2NWG A;  4DR7 Q;  5CGK A;  1SYE A;  2I07 B;  2R7Z H;  3F2D A;  4IPC A;  3H15 A;  2VS1 A;  4ZKC B;  2NVY H;  1TWH B;  4XT1 B;  1WTR A;  1EWI A;  3OW2 A;  2DNE A;  3CW2 C;  2B63 H;  1TS3 A;  5I6W A;  3S16 H;  4GOP B;  3CU7 A;  4OXP A;  3GTM H;  5IYD H;  2H1E A;  4IZ8 A;  3J7A V;  3STB D;  2R7Z B;  4NDX A;  5C4H A;  4OO1 I;  4JOI C;  2ATW A;  1GD7 A;  1J9O A;  1HQM C;  2KJX A;  4RGO S;  1VQA A;  2JA8 H;  2HDL A;  4C3H B;  4AYB E;  2PPB C;  1DON A;  3F2U A;  1Z47 A;  2G9H D;  1XPO A;  3G6E A;  3PO3 H;  3BZK A;  4L63 B;  4DFA A;  4KN7 C;  2D0P A;  5F2D A;  4X66 L;  1GVP A;  4DR3 Q;  3E6Z X;  2RKS A;  3OMG A;  2F0N A;  2FIN B;  5E3F A;  2LFN A;  2EJF C;  4QY7 A;  3LWE A;  3K5N A;  4BA2 I;  1IHZ A;  2L4N A;  5KEE A;  2B2T A;  4DNT B;  3TP6 A;  3ITP A;  1CUK A;  3H3V H;  2CWA A;  2NB0 A;  1KRT A;  5LMN W;  3GTP H;  3A7L A;  4ZUI A;  1QVF A;  3BJU A;  2Z0S A;  1KDC A;  4PMC A;  1PH2 A;  5JJK A;  1PTO B;  3GQB A;  1B50 A;  2QGQ A;  5KRU A;  1A62 A;  3F8T A;  2E2D C;  5DNF A;  3S17 H;  4OGQ C;  1BR9 A;  3ND8 A;  4A3K H;  1HXY D;  2F0D A;  2GVB A;  2XVS A;  4DAY A;  1TU2 B;  1SBB B;  5JEA G;  4HIO A;  1QVG A;  4R4C A;  3E5S A;  1M8A A;  1HTP A;  2R93 G;  5C4Z A;  2SNM A;  4DAM A;  1TR5 A;  2PO4 A;  3MFG A;  5C5L A;  3J80 c;  4Y52 H;  5LMU Q;  1BO0 A;  3T1H Q;  2A1A A;  1V1O A;  2L1B A;  5HUR A;  3K7U C;  5M5W H;  5AFW A;  5ELC A;  3RLN A;  1NTG A;  1FNW A;  2JA5 B;  3S17 B;  1RL2 A;  1PH5 A;  3K0Y A;  1F9Q A;  3BDC A;  3OTO Q;  4GOP A;  3BDO A;  1X56 A;  3Q0A A;  1JIC A;  3JAM E;  1DOK A;  2A5H A;  4O0A A;  2EJG C;  3BVZ A;  3FEW X;  2EYF A;  2UUA L;  5KIX A;  4A4I A;  5GAG C;  3I70 A;  1SLJ A;  1NUC A;  4HJA A;  4LFB L;  4DGZ A;  2B39 A;  3GTP B;  5LMN L;  4XYQ A;  4PQX A;  1GHJ A;  4BY7 H;  2CWP A;  4DKA C;  4GNX A;  4QCL A;  2YU9 H;  4P71 A;  1Y1V B;  4L5Q A;  1JOR A;  1H9J A;  2F0H A;  3PV0 A;  5IP7 G;  4HSV A;  2R92 G;  5C3E B;  2F0W A;  2FMC A;  4JI4 L;  2E76 C;  4XTC S;  3EIV A;  3UE1 A;  1JJC B;  2QCP X;  4U67 3;  4R1J A;  3FMC A;  3GV6 A;  4X3S A;  1NNX A;  5ISR A;  1KNE A;  1WTH A;  2F4V Q;  1O80 A;  5LL6 S;  3W5O A;  2DY7 A;  3KDF B;  3GTO B;  3NBH A;  1G51 A;  1FYC A;  3H94 A;  3P20 A;  3VR3 A;  5DLQ E;  3C3L A;  1K3B C;  1SFO B;  1H95 A;  3I55 A;  1I3Q B;  3M3Y B;  4DUZ L;  4JBK A;  4JVZ A;  1VQ7 A;  3GTJ H;  1U0L A;  3QOJ A;  1N36 Q;  4ZKB B;  2BH8 A;  2KCT A;  4X65 Q;  3DEO A;  3QOL A;  3DWQ A;  1V1P B;  2JA6 G;  1GUO A;  1S5B D;  1XXG A;  3VYT A;  1YNJ C;  1PTO D;  3CPF A;  1QJO A;  2ZJP A;  2UXD Q;  2N88 A;  5BN4 A;  1YZ6 A;  1YNX A;  5C5M A;  4NXM Q;  4GKK L;  1VQD A;  4BS9 A;  1VQ9 A;  2NVT H;  4IUT A;  1W2B A;  4F87 A;  1ZYR D;  5CV7 A;  2MUY A;  5IP9 G;  4LF5 Q;  4FF1 A;  1GM5 A;  1TWG H;  5FJ8 H;  1CKN B;  2E5L L;  4LAA A;  2TMP A;  3IAY A;  1B8A A;  3CHB D;  4JI7 L;  4LF6 Q;  1KHI A;  4KHV A;  1K28 A;  3OMC A;  4R8N A;  5A2Q L;  1VQN A;  3S1Q H;  1L0X B;  2Z8L A;  3GTM B;  5JJI A;  2IPK D;  3KF6 B;  4GN3 B;  3I4N B;  3OIQ A;  1HQR D;  5J1Z A;  3OWF A;  3HOZ G;  1QWY A;  1GJX A;  2D62 A;  4ODG A;  3TP7 A;  1EY0 A;  1I6V C;  4L5S A;  1EU3 A;  1Y69 U;  2R7D A;  1I4X A;  1VCI A;  3HOY H;  4CGY B;  4NW2 A;  4C3J G;  4C1N I;  2A69 D;  3PO2 H;  1OXU A;  1VQ8 A;  1GXD C;  1LTT D;  4JI5 L;  1LO5 D;  1KQS A;  2EYO A;  3SK6 A;  1YNN C;  1MSH A;  3CQZ B;  1FJG Q;  1YI2 A;  1FGU A;  3FRP B;  3S14 B;  1LTG D;  4FF2 A;  3LX0 A;  1X55 A;  4PG3 A;  1Q8K A;  3TDQ A;  4DV1 L;  2EYJ A;  2B8G A;  1WTQ A;  4G7H C;  3KLR A;  2G9D A;  3IRB A;  1Y8P B;  2F0I A;  1IBM L;  2HHH L;  1VQG A;  2DJF C;  4AH6 A;  5I9P A;  2D2C C;  1TT2 A;  4GN5 A;  4DAY B;  3ULL A;  1C48 A;  1FL0 A;  5C0X H;  2F0F A;  4DR5 L;  1E2W A;  1N36 L;  4A3K B;  4CDF C;  1JWU D;  1TY2 A;  2CVR A;  1HA6 A;  3I72 A;  2Y0S G;  3A54 A;  1I94 L;  1CA6 A;  5HY6 A;  1EY6 A;  3P7J A;  5JEA J;  2ZXR A;  4K14 A;  4WOR A;  4XQQ A;  3MTS A;  2P5Z X;  4LUO A;  2NTT A;  1JWS D;  3GTL B;  1G2T A;  1M90 C;  4YY3 L;  4ME3 A;  1HZB A;  2VUM G;  1V1Q A;  2MO0 A;  5HGQ A;  1T9H A;  1JQY D;  5C0X I;  1Q82 C;  4G7Z C;  4JI5 Q;  5J3B A;  3TME A;  1SNM A;  3VA5 A;  3VDY A;  3ERQ A;  5GAE C;  2BCO A;  1NY4 A;  1KAA A;  3I91 A;  4JPB W;  1WVL A;  2HIV A;  2R92 B;  1BNZ A;  2Q2U A;  4YHH L;  1PZJ D;  4APV A;  3DLL A;  1HNW Q;  4B3R Q;  4BBR H;  4DR6 L;  1E3P A;  5T1I A;  5K36 G;  2O5I C;  1XMQ L;  5ELO A;  1XJV A;  1I6H B;  1BQQ T;  2CH4 A;  1NE3 A;  2ZXP A;  1XNQ L;  3J80 i;  4IFD H;  1M4V A;  5IOC A;  4FXG C;  2A6E D;  3DEP A;  1CZG A;  1RCV D;  4E6I A;  1V9P A;  2WAQ E;  4BY1 G;  3EA6 A;  4O42 A;  1EEI D;  4K8J A;  4LUV A;  4CDC C;  4YCV A;  4X64 L;  2AQ1 B;  5DEH A;  2ZJQ A;  3D0F A;  3FKI B;  3CRL C;  2OWO A;  3ER0 A;  1EIH A;  1HNW L;  1RDP D;  1PZK D;  3EQL C;  4A3D H;  1XNR Q;  1AP0 A;  1I4R A;  1ROD A;  4DU9 A;  1FD7 D;  1QE6 A;  4DV6 Q;  3P75 A;  1ILQ A;  4IFD I;  1F9P A;  2Q2T A;  4YWK A;  4BA1 I;  2PI2 A;  5CC4 A;  5C4X G;  4J1M A;  2HQE A;  2VUM H;  4B9X A;  3BYT B;  3HEJ A;  1X3F A;  1VQ5 A;  5EKK A;  4KI0 A;  4B9W A;  4IOA A;  4DV0 L;  3K59 A;  4XXE A;  3ZYY X;  1U4M A;  1H9S A;  1F9S A;  2LMC B;  3ZJY C;  3TS2 A;  3M4O H;  1U4L A;  1CFM A;  1XPU A;  2WP8 J;  1VDZ A;  1DOM A;  1D1I A;  3HG9 A;  5AJ3 L;  1HHV A;  2UUC Q;  2F3I A;  4GKJ Q;  2NZ1 D;  4HMI A;  4H0L C;  3K57 A;  4K5W A;  3EJI A;  4K2L A;  3NQT A;  4Y7N B;  5C3E H;  2Z6K C;  3ERO A;  4ZAI A;  5BN5 A;  1MGS A;  2GVA A;  1KD1 C;  1A3U A;  1ICW A;  4KTA A;  1X9N A;  1K9M C;  4JV5 L;  2DNC A;  1O7Y A;  3VR5 A;  3GTG H;  2K01 A;  1FGB D;  4JYA Q;  3NWT A;  2F0U A;  3V2T A;  2EYP A;  5CR3 A;  1B44 D;  2B2Y A;  3HRZ C;  3KBX A;  3G48 A;  5ELF A;  2EZV A;  2MPM A;  2XIW A;  4A3M H;  1HUM A;  1SRU A;  2BDO A;  2I5L X;  1AZP A;  4N9T A;  3R8B A;  1G2S A;  3PIP 3;  2CW0 C;  1TS2 A;  3HOW G;  3BU2 A;  5FLX c;  3A5U A;  4HN7 A;  4DNR B;  2PMZ B;  3L9A X; 
#chains in the Genus database with same CATH homology
 2KHS A;  1OO9 B;  2AQ2 B;  2XN9 C;  3MWY W;  1CT1 D;  4QF4 A;  1II3 A;  2WKD A;  3NXW A;  2ICE C;  4Q5V A;  2L5T A;  5COR A;  1RHP A;  2O2L D;  2L12 A;  1BOS A;  3K58 A;  4K6L A;  2F0Q A;  3NSW A;  3FVQ A;  5IGG A;  1WTX A;  3NTI A;  5EPJ A;  4CJ0 B;  3GV3 A;  2M2L A;  3SE0 A;  4RA8 A;  1PLF A;  4QMG A;  2K28 A;  3MEH A;  1HPC A;  1BUV T;  1STG A;  3QB3 A;  1PFB A;  5EBD A;  5C0X J;  5E4X A;  5C3X A;  2VNU D;  2F0G A;  3GTJ B;  3OHX C;  2JEB I;  1GOZ A;  3I8Z A;  1LT3 D;  1A2U A;  3LNN A;  2NN6 G;  5C4X B;  2RBM A;  3SDZ A;  2BE5 D;  1HUN A;  2X6L A;  3GD7 A;  5FO7 B;  3PUX A;  1L0Y B;  4ABN A;  5M5Y B;  4FP5 D;  3D8G A;  1DJR D;  5D14 A;  3P1H A;  2CQA A;  5IOD A;  1IKM A;  1OXS C;  4KD4 A;  2Z1C A;  3MXP A;  2NVX B;  3K7A B;  1QOH A;  1KAB A;  3C1E A;  5NUC A;  2AUK A;  1PRT B;  4Z9C B;  2AWN A;  1SE4 A;  2FFK B;  3X3M A;  2MGS A;  3I73 A;  5G3L F;  4HED A;  1CM9 A;  4HCS A;  2PZT A;  1JC7 A;  3MXU A;  1SNC A;  2F0V A;  1LT6 D;  3E0J A;  2NVY B;  1IW7 D;  2IT1 A;  2B8F A;  1W6J A;  4IAL A;  2LY7 A;  1LAC A;  4CKB A;  3R3O A;  2ID0 A;  3GTQ B;  2X6G A;  2HCC A;  1TS4 A;  2VB2 X;  2A69 C;  5KGU A;  3TBI B;  2E2J B;  1S5F D;  2AUJ D;  2K05 A;  4ME5 A;  5FK9 C;  2YU9 B;  3HS0 C;  1KLG D;  2IX1 A;  3W2D A;  1XYI A;  4L6T B;  3HGB A;  1I4P A;  1Q90 A;  3T13 A;  2C5C A;  3H6M A;  2XSC A;  4OIK A;  4IFD J;  2WAC A;  3DHQ A;  1CHP D;  2PQE A;  3NE5 B;  2XNA C;  1LTI D;  5FKA C;  1XWE A;  3AU7 A;  1NR4 A;  4DN4 M;  1SNP A;  2RDH A;  1PXU A;  3SVM A;  4KD3 A;  2EJM A;  1WTW A;  4KY7 A;  2V4D A;  3GO5 A;  4QB4 A;  3SXH A;  1MSG A;  4U68 A;  4RKL A;  3VYU A;  4EVO A;  2L0C A;  2IW3 A;  3N6R A;  1STH A;  3SK8 A;  4ID6 A;  4MN3 A;  1Z6H A;  2F0O A;  3AB9 A;  3TZU A;  4PNY A;  4X3T A;  2C9O A;  1EFI D;  1RF2 D;  5IT9 L;  3I4M B;  4CKC A;  4FXK C;  3WOF A;  4PMW A;  4OIJ A;  1H9K A;  2K5W A;  1EU4 A;  1LLR D;  1SAP A;  4ZRZ A;  3MAQ A;  3MXN A;  5EKI A;  3PO3 B;  3R2T A;  3A8J E;  2KCC A;  5C44 B;  1UAP A;  1S5D D;  1TII D;  2NVT B;  2ZXO A;  4C2M B;  3KUP A;  2SEB D;  1JOQ A;  2A6H D;  3EVQ A;  4LK1 C;  1KTK A;  3MHB A;  3MA2 B;  2B63 B;  4X3K A;  3D6W A;  2Q8R E;  1STA A;  4ZYS A;  2X69 A;  1XTC D;  3LWU A;  2XRS D;  2K33 A;  2K5Q A;  1ET9 A;  1DCZ A;  2NN6 H;  1B9M A;  1C4Q A;  1NSN S;  2XRQ D;  5JVG 3;  2WII B;  1TQO A;  1LV9 A;  5I9O A;  2M9V A;  2VB3 X;  1K83 B;  3T53 B;  2B2V C;  1HRJ A;  1SMY D;  2RDF A;  1RTO A;  2IL8 A;  2JA7 B;  1MI2 A;  3PO2 B;  2PNR C;  3T56 B;  1E2V A;  4C3I G;  4RHS A;  2A68 C;  3QWN A;  2F0L A;  1PMR A;  3PIO 3;  3T4A C;  3TN2 A;  4FO2 A;  1ENA A;  2XWJ B;  1F77 A;  5JOB A;  4HMJ A;  1B4O A;  1U4R A;  3DUZ A;  1HA5 A;  2Z4H A;  3FPP A;  3RMH A;  4ZQ3 A;  1K8O A;  2EY5 A;  1JR0 D;  3IKJ A;  5FLX L;  5K36 H;  2R3Z A;  1D6E C;  4V0B A;  5DM7 3;  1CHQ D;  3T51 B;  1Q1B A;  2QEJ C;  4KJN A;  3HZX A;  4C3J B;  4XQJ A;  5EPK A;  3A8I E;  3MZ5 A;  1V43 A;  2K32 A;  2NN6 I;  1GUG A;  4KKS A;  4DF7 A;  3D6C A;  1SJE D;  1ET6 A;  3MXG A;  3Q22 A;  1BXT A;  1TWF B;  1DXM A;  3URY A;  2MHV A;  5M3F B;  1IYU A;  1LAB A;  5FO8 B;  4KV6 A;  3HOV B;  4A3B B;  2KVM A;  2EYM A;  2EOT A;  5JVH 3;  4CKE A;  1I50 B;  2Q8T A;  3KK7 A;  1LTS D;  3Q24 A;  3TZD A;  3KF8 A;  2B2W C;  1IKL A;  3A55 A;  4RH6 A;  4IUV A;  5IGE A;  2NYZ D;  3RD4 A;  2LS0 1;  4MHE A;  3H91 A;  4OL7 A;  2KOL A;  1HFG A;  2WV6 D;  1UEA B;  4IUR A;  1RKN A;  4WRD A;  3OPO A;  5E4W C;  3M4O B;  1KLU D;  4S3S A;  3NWS A;  3N52 A;  3JAM L;  1VMP A;  4RGM A;  2HDM A;  4EQN A;  1HTL D;  5ELD A;  1ONL A;  4DXF A;  1T5E A;  4IUQ A;  3C1F A;  4C1N K;  3T16 A;  2ICI A;  2EPB A;  3J81 L;  2AWO A;  2PZU A;  3NBI A;  1EY9 A;  5EQ0 A;  1GUW A;  3S1Q B;  1I4Q A;  1EYD A;  4KHZ A;  2E2H B;  1Q3L A;  1Y1W B;  1E0B A;  2F3W A;  3GP7 A;  3PUV A;  4PV1 C;  1X3P A;  3RUZ A;  2BA0 A;  3CKI B;  1PRT D;  1CZW A;  2N55 A;  5JAV A;  5EPL A;  1KDA A;  1Y8O B;  2K7V A;  2L55 A;  1TY0 A;  4ULL A;  5CBA E;  1B1Z A;  1R9T B;  1J8I A;  4DAV A;  1CTM A;  5I2Y A;  4RAU C;  1JE4 A;  3R93 A;  1BCP C;  2ENB A;  5JPM C;  3AMU A;  5DM6 3;  2WIN B;  1VF5 C;  2EDG A;  5ELB A;  1DYQ A;  2F0P A;  2D9U A;  1UNS A;  3VA7 A;  1E2Z A;  1SE2 A;  3I90 A;  1AW7 A;  1F2L A;  3A56 A;  3HP3 A;  1ZKO A;  4TQU S;  2Z4I A;  4F88 A;  2EE1 A;  5IGD A;  1PRT C;  4KKU A;  3SHL A;  2B2V A;  2PW5 A;  3NP8 A;  4HSP A;  3FPU B;  2WAQ B;  1EQT A;  3Q6S A;  5CBE E;  4C3H G;  1ZEQ X;  2K1B A;  3TP5 A;  3K6O A;  3TP8 A;  4NKL A;  3MVV A;  5M3M B;  1HCZ A;  3H3V C;  1STE A;  1EY4 A;  5LL6 X;  3ONA B;  3S9W A;  1SYD A;  4L8J A;  4C56 C;  5C6A A;  2EY6 A;  2HUG A;  1SE3 A;  4FNF A;  1F2M A;  1I4G A;  1EIG A;  2IX0 A;  3GTG B;  1TWC B;  4J6H A;  2EYL A;  3RZD B;  3DXJ C;  1LTA D;  2A6H C;  4KK7 A;  2DY8 A;  3QG1 A;  2JE6 I;  3PMF A;  3SR1 A;  4UDU C;  3K5L A;  1CK1 A;  4NP5 A;  4LJZ C;  2L9H A;  5D65 A;  4OO1 G;  4KJO A;  3HKZ B;  4A93 B;  5KYI A;  2R6G A;  5M5X B;  1AEX A;  3V05 A;  3RLF A;  2OXP A;  5KNB A;  5J39 A;  2I46 A;  1X32 A;  2O5J C;  3K5O A;  5CV8 A;  1EWC A;  3VR2 A;  1BF4 A;  5JEA H;  5C3W A;  2GA4 B;  2F0M A;  3S1N B;  1MD2 D;  4Q0F A;  3L3O C;  4CBV A;  4A3G B;  2RDG A;  4A3F B;  1HFN A;  3VR6 A;  5M9O A;  4R8I A;  1X3Q A;  4RWS C;  5A35 A;  1WD0 A;  3HOU B;  4KY6 A;  4X3U A;  2EY2 A;  3VYR A;  2BDN A;  4BY1 B;  1EOT A;  3K5M A;  5C4J B;  2EXZ A;  2QF7 A;  4DXG A;  3GTK B;  2QKI C;  4FYD A;  1DD2 A;  3D3R A;  4C3I B;  1PRT F;  5CYU A;  1EZ6 A;  2PYK A;  1JCK B;  4PMB A;  2E74 C;  3D4W A;  1H9R A;  4BBR B;  1TKW B;  1GHK A;  1GUT A;  4CHT B;  1QCB D;  4FXD A;  3NQI A;  4KMU C;  1XX8 A;  1QB5 D;  3QIA A;  2CHB D;  3VYS A;  1KNA A;  2OT2 A;  1BDO A;  2OF1 A;  4R9W A;  2AQ3 B;  5IGF A;  2EY1 A;  2JP1 A;  4DA2 A;  4K2K A;  3SK4 A;  4I65 A;  3J80 L;  4OHJ A;  1AZQ A;  3SEB A;  4J8Q A;  3NPP A;  3H09 A;  1YNJ D;  1LT4 D;  4V19 0;  1PTO H;  3MC0 B;  1PYW D;  2JXM B;  4K8I A;  3M7N A;  2JSO A;  1ESR A;  2JEA I;  1RJT A;  4P2C B;  3MFY A;  5G3L D;  3OWE B;  3KLS A;  2Q8I B;  3BDL A;  3V96 A;  2F1M A;  1FR3 A;  1ILP A;  2RA4 A;  1PFN A;  4HTH A;  2F0S A;  4G4K A;  3TSS A;  1VF7 A;  3BYY B;  2KEE A;  4IUU A;  1U4P A;  4A3J B;  2KCN A;  3QO2 A;  2XWB B;  3X3N A;  4TRD A;  1SYC A;  5DAU A;  1V8Q A;  3M85 A;  5I2X A;  3PUY A;  3SK5 A;  2K6A A;  4UAI A;  1SSO A;  5HGT A;  1RTN A;  1LT5 D;  1STY A;  2K04 A;  4K5X A;  5IGB A;  2BE5 C;  4IUP A;  4XYO A;  4XT3 B;  5J22 A;  4CJ1 B;  1A2T A;  3DWP A;  1W6K A;  4DK1 A;  2PW7 A;  1UUP A;  2K5D A;  4HR7 B;  1RD9 D;  3BZD B;  1EY5 A;  5CV9 A;  3EFX D;  4NMZ A;  2IX3 A;  4N9P A;  1JWM D;  1D1K A;  1EEF D;  1SYG A;  3I4L A;  4EQO A;  4G57 A;  1V1P A;  2J4X A;  1S5C D;  4IQZ A;  1CI3 M;  4RCO A;  2F0K A;  5EBC A;  2NTS A;  5T1G A;  2ZT9 C;  2DN8 A;  4A3I B;  1PTO F;  1Q8I A;  1QG7 A;  1PTO C;  2A6E C;  3A7A B;  4BY7 B;  1PZI D;  2NVQ B;  1SEB D;  3WDN A;  2NUC A;  2R61 A;  1SMY C;  1S4Z A;  2OEO A;  4KY5 A;  1S5E D;  1D5X C;  3DMU A;  2KQ3 A;  3OIP A;  3OSO A;  3J80 E;  4QIW B;  4HAE A;  2FHT A;  3D4R A;  4M8A A;  5FOB B;  3W3A A;  1TVX A;  2IWH A;  1SYF A;  1SNQ A;  1D2B A;  2B2T C;  2RQX A;  1K8M A;  1FNU A;  4H7B A;  2IJ0 A;  2F0E A;  4AYB B;  1OXT A;  3HOX B;  2F03 A;  3A8K E;  3NTK A;  1ENC A;  1YNN D;  2RSN A;  1DM0 B;  1SDF A;  1F2Z A;  5E1F A;  1CQF A;  1B9N A;  2TSS A;  3NK9 A;  1G6Z A;  4A3M B;  4XDX A;  4BWG B;  1A3T A;  1FNV A;  4ZK9 B;  3BS1 A;  1Y8N B;  2JA6 B;  4RKB A;  4O1N A;  1ZXT A;  5D3I B;  4WFN 3;  1SYB A;  1EZ8 A;  2EVB A;  5EJW A;  2CW0 D;  2B2U A;  5JJZ A;  4JK1 C;  4ZLT F;  3NTH A;  1WTV A;  1QNK A;  1JB3 A;  5CV5 A;  1GUS A;  4DK0 A;  1IL8 A;  4IN3 A;  3S2H B;  2F3V A;  2F0J A;  3IFD A;  3DWA A;  1B53 A;  1VMC A;  4ZUJ A;  2LKV A;  4XQN A;  4TSS A;  2O4X A;  3OOC A;  2RSO A;  5KYL A;  5I4D A;  4OO1 H;  1WD1 A;  1O7Z A;  1B2T A;  3S1R B;  2A73 B;  1EQV A;  1EYC A;  4KN4 C;  3BVG A;  5C0X G;  2KUM A;  3OW7 A;  4HCE A;  3D4D A;  4EGV A;  2A74 C;  1D5M C;  5EKL A;  4RGN A;  3PUW A;  4H13 C;  4M1U B;  1H9S B;  2K03 A;  1SJH D;  3C2P A;  4B08 A;  1Q1E A;  4CJ2 C;  4LMQ D;  3J81 E;  1KDB A;  4ILW A;  4JBW A;  3QJY A;  1DOL A;  5M5W B;  1WTP A;  1ML0 D;  3VR4 A;  4IUN A;  1PDQ A;  3FDT A;  4F8M A;  2E75 C;  3G7L A;  1EWH A;  1QNU A;  1ENF A;  2PZW A;  1A15 A;  5IT9 E;  1C8C A;  5I6Y A;  1TWG B;  2JA8 B;  1JOK A;  2VXW A;  5D3D A;  1BCP D;  3S15 B;  1AN8 A;  2JYO A;  1TWA B;  3S1M B;  3ND9 A;  2EYH A;  4K6D A;  1F2Y A;  1TS5 A;  2KA7 A;  1A6X A;  1NCV A;  2L11 A;  4XIG S;  3H0G B;  5LHY 1;  3Q23 A;  3J7Y W;  1IW7 C;  3HOZ B;  1SXT A;  1OXX K;  2MJ8 A;  3S16 B;  5CV4 A;  2F0T A;  2M00 A;  1JOO A;  2B2U C;  5ELE A;  3KBG A;  3PUZ A;  2SNS A;  3NHH A;  1F9R A;  4RHR A;  1BCP B;  1ZYR C;  4IFD G;  2F4I A;  3U9S A;  4FF4 A;  5IGC A;  3CRK C;  2WB1 B;  3R2I A;  1A3V A;  3U9O A;  4EQP A;  3HOW B;  3C46 A;  2SOB A;  4RCN A;  1EYA A;  2BOS A;  2H4O A;  2HCI A;  3M4Y A;  4TKO B;  1MBY A;  2YYZ A;  1DZ1 A;  2NBF A;  5TSS A;  3NUC A;  4I7Z C;  5BN3 A;  5EGT A;  5KND A;  1G91 A;  3UI2 A;  2SDF A;  1WCM B;  4A3E B;  2VUM B;  3IL8 A;  4FF3 A;  2KED A;  5FLX E;  1NR2 A;  1QIL A;  1PFM A;  2RVL A;  1I4H A;  1R4Q B;  1LTR D;  1IYV A;  3I3C A;  4WJW A;  3L7Z C;  4G7O C;  2KEC A;  5K5P A;  5CMD A;  2QDB A;  5CV6 A;  1WTO A;  2R93 B;  4GZY C;  1EL0 A;  3BG3 A;  2B2W A;  5JPN C;  3DM1 A;  1CA5 A;  1CQV A;  1BBX C;  4MIU A;  4YIJ A;  4F7X A;  1O78 A;  1STB A;  1Z7T A;  1H9M A;  4QUF A;  2E2I B;  3BVM A;  2WKC A;  2QIL A;  1SND A;  3S2D B;  1R4P B;  1B3A A;  1Q12 A;  3WOE A;  1OXV A;  2D5D A;  3O13 A;  1GUN A;  5FO9 B;  1D5Z C;  3IFT A;  1BCP F;  3J7A F;  1T5X D;  1O7L A;  4K5V A;  2B2Y C;  4A3D B;  3KLS X;  4FVM A;  5IIF A;  1G29 1;  2FJ2 A;  2BA1 A;  2FMM A;  1U9R A;  1AFP A;  4BBS B;  4RGT A;  3RZO B;  4QUC A;  4KKT A;  2J0T D;  1SNO A;  4H44 C;  1STN A;  3D31 A;  4RFB A;  5KNC A;  5A2Q E;  3HOY B;  1EY7 A;  3M7G A;  2MP1 A;  2PCF B;  1EY8 A;  1ESF A;  1G8Z D;  2A68 D;  3G6J B;  4DAP A;  1NAP A;  2J7Z A;  2Y0S B;  5COY A;  1LTB D;  2NWG A;  5CGK A;  1SYE A;  2I07 B;  4ZKC B;  1TWH B;  4XT1 B;  1WTR A;  2DNE A;  1TS3 A;  5I6W A;  3CU7 A;  2H1E A;  4IZ8 A;  3J7A V;  2R7Z B;  4NDX A;  5C4H A;  4OO1 I;  4RGO S;  1J9O A;  1HQM C;  2KJX A;  2HDL A;  4C3H B;  2PPB C;  1DON A;  3F2U A;  1Z47 A;  2G9H D;  4L63 B;  4DFA A;  4KN7 C;  5F2D A;  3E6Z X;  2RKS A;  3OMG A;  2F0N A;  2FIN B;  5E3F A;  2LFN A;  2EJF C;  3LWE A;  3K5N A;  4BA2 I;  1IHZ A;  2L4N A;  5KEE A;  2B2T A;  4DNT B;  3TP6 A;  3ITP A;  2NB0 A;  3A7L A;  4ZUI A;  1KDC A;  4PMC A;  1PTO B;  3GQB A;  1B50 A;  5KRU A;  2E2D C;  5DNF A;  4OGQ C;  1BR9 A;  3ND8 A;  1HXY D;  2F0D A;  2XVS A;  4DAY A;  1TU2 B;  1SBB B;  5JEA G;  3E5S A;  1M8A A;  1HTP A;  5C4Z A;  2SNM A;  1TR5 A;  2PO4 A;  3MFG A;  5C5L A;  1BO0 A;  2L1B A;  1V1O A;  5HUR A;  5AFW A;  5ELC A;  1FNW A;  2JA5 B;  3S17 B;  3K0Y A;  1F9Q A;  3BDC A;  3BDO A;  3Q0A A;  1JIC A;  3JAM E;  1DOK A;  2A5H A;  3BVZ A;  2EJG C;  3FEW X;  2EYF A;  5KIX A;  3I70 A;  1NUC A;  4DGZ A;  2B39 A;  3GTP B;  4XYQ A;  4PQX A;  1GHJ A;  4QCL A;  1Y1V B;  1JOR A;  1H9J A;  2F0H A;  3PV0 A;  4HSV A;  5C3E B;  2F0W A;  2FMC A;  2E76 C;  4XTC S;  2QCP X;  4U67 3;  3FMC A;  3GV6 A;  4X3S A;  5ISR A;  1KNE A;  1O80 A;  5LL6 S;  2DY7 A;  3GTO B;  3NBH A;  1FYC A;  3H94 A;  3P20 A;  3VR3 A;  3C3L A;  1SFO B;  1I3Q B;  3M3Y B;  3QOJ A;  4ZKB B;  3DEO A;  3QOL A;  3DWQ A;  1V1P B;  1GUO A;  1S5B D;  1XXG A;  3VYT A;  1YNJ C;  1PTO D;  1QJO A;  2N88 A;  5BN4 A;  5C5M A;  4BS9 A;  4IUT A;  4F87 A;  1ZYR D;  5CV7 A;  2MUY A;  4FF1 A;  4LAA A;  2TMP A;  3IAY A;  3CHB D;  4KHV A;  3OMC A;  4R8N A;  5A2Q L;  1L0X B;  2Z8L A;  3GTM B;  2IPK D;  3I4N B;  3OIQ A;  1HQR D;  5J1Z A;  3OWF A;  1QWY A;  1GJX A;  2D62 A;  4ODG A;  3TP7 A;  1EY0 A;  1I6V C;  1EU3 A;  1Y69 U;  1I4X A;  1VCI A;  4CGY B;  4NW2 A;  4C3J G;  4C1N I;  2A69 D;  1OXU A;  1GXD C;  1LTT D;  1LO5 D;  2EYO A;  3SK6 A;  1YNN C;  1MSH A;  3CQZ B;  3FRP B;  3S14 B;  1LTG D;  4FF2 A;  3LX0 A;  3TDQ A;  2EYJ A;  2B8G A;  1WTQ A;  4G7H C;  3KLR A;  2G9D A;  1Y8P B;  2F0I A;  5I9P A;  2D2C C;  1TT2 A;  5C0X H;  1C48 A;  2F0F A;  1E2W A;  4A3K B;  1JWU D;  1TY2 A;  2CVR A;  1HA6 A;  3I72 A;  3A54 A;  1CA6 A;  1EY6 A;  3P7J A;  5JEA J;  2ZXR A;  4K14 A;  4WOR A;  4XQQ A;  3MTS A;  2NTT A;  1JWS D;  3GTL B;  1G2T A;  1JQY D;  5C0X I;  4G7Z C;  3TME A;  1SNM A;  3VA5 A;  3ERQ A;  2BCO A;  3I91 A;  1KAA A;  1WVL A;  2R92 B;  1BNZ A;  1PZJ D;  5T1I A;  5K36 G;  2O5I C;  1I6H B;  1BQQ T;  2ZXP A;  4IFD H;  1M4V A;  5IOC A;  4FXG C;  2A6E D;  3DEP A;  1CZG A;  1RCV D;  4E6I A;  3EA6 A;  4O42 A;  1EEI D;  4K8J A;  2AQ1 B;  5DEH A;  3FKI B;  3CRL C;  1EIH A;  1RDP D;  1PZK D;  3EQL C;  1AP0 A;  1I4R A;  1ROD A;  4DU9 A;  1FD7 D;  1QE6 A;  3P75 A;  1ILQ A;  4IFD I;  1F9P A;  4BA1 I;  5CC4 A;  4J1M A;  2HQE A;  4B9X A;  3BYT B;  3HEJ A;  5EKK A;  4KI0 A;  4B9W A;  3K59 A;  4XXE A;  3ZYY X;  1U4M A;  1H9S A;  1F9S A;  2LMC B;  1U4L A;  1CFM A;  2WP8 J;  1VDZ A;  1DOM A;  1D1I A;  3HG9 A;  1HHV A;  2NZ1 D;  4HMI A;  4H0L C;  3K57 A;  4K5W A;  3EJI A;  4K2L A;  3NQT A;  4Y7N B;  3ERO A;  4ZAI A;  5BN5 A;  1MGS A;  1A3U A;  1ICW A;  4KTA A;  2DNC A;  1O7Y A;  3VR5 A;  2K01 A;  1FGB D;  3NWT A;  2F0U A;  3V2T A;  2EYP A;  5CR3 A;  1B44 D;  2B2Y A;  3HRZ C;  3KBX A;  5ELF A;  2EZV A;  2MPM A;  2XIW A;  1HUM A;  2BDO A;  1AZP A;  4N9T A;  3R8B A;  1G2S A;  3PIP 3;  2CW0 C;  1TS2 A;  4HN7 A;  4DNR B;  2PMZ B;  3L9A X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...