4IFDH

Crystal structure of an 11-subunit eukaryotic exosome complex bound to rna
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
356
structure length
295
Chain Sequence
b'SEVITITKRNGAFQNSSDSQIVTPGELVTDDPIWMRGHGTYFLDNMTYSSVAGTVSRVNRLLSVIPLKGRYAPETGDHVVGRIAEVGNKRWKVDIGGKQHAVLMLGSVNLPGGILRRKSESDELQMRSFLKEGDLLNAEVQSLFQDGSASLHTRSLKYGKLRNGMFCQVPSSLIVRAKNHTHNLPGNITVVLGVNGYIWLRKTSQMDLARDTESSWQIYSDENDPSISNNIRQAICRYANVIKALAFCEIGITQQRIVSAYEASMVYSNVGELIEKNVMESIGSDILTAEKMRGN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exosome complex component RRP45
publication title Crystal structure of an RNA-bound 11-subunit eukaryotic exosome complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/rna
total genus 79
structure length 295
sequence length 356
ec nomenclature
pdb deposition date 2012-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF14382 ECR1_N Exosome complex exonuclease RRP4 N-terminal region
H PF15985 KH_6 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4ifdH01
2KCCA 5KNCA 1GUTA 3A7LA 3GD7A 4BA1I 1H9SA 2E74C 2PCFB 3EQLC 2K33A 4GZYC 1G291 2NN6G 3MXUA 3NE5B 2AUKA 3M7NA 3L7ZC 1VDZA 1H9RA 2BE5D 3FPPA 2IT1A 1DXMA 3A8JE 3A7AB 2E75C 1TKWB 3P20A 2R6GA 4KKSA 1DCZA 1HTPA 3I72A 1GHJA 3PUZA 1B9NA 5JEAG 2NN6I 1OXTA 1K8OA 1GHKA 4KN7C 1ZKOA 3ND9A 1E2VA 5A35A 3VA7A 5K36G 4LK1C 2JXMB 2YYZA 3DXJC 2BA1A 1QJOA 4DK1A 1BDOA 1Y8OB 1GUNA 1Z6HA 1GUSA 2F1MA 3PV0A 1CTMA 2QF7A 2D2CC 1O78A 3RLFA 5BN5A 2A6ED 1GUOA 1DD2A 2B8FA 2DNCA 3H94A 3VR3A 1VF7A 1Q1EA 2EVBA 4DNRB 3LWUA 3VR2A 4G7OC 2DN8A 4KHZA 1YNJC 1VCIA 3OPOA 5KNBA 3A8KE 1YNNC 4H44C 4IFDH 4OGQC 4KKTA 4OO1H 1Q12A 2PNRC 1Z7TA 3U9SA 2AWOA 1B9MA 1IW7C 1T5EA 3BDOA 2E76C 4DNTB 1SMYC 2A6HC 3A8IE 4HR7B 3VR5A 5C0XH 4G7ZC 1E2WA 3AB9A 1FYCA 1Q90A 2CW0C 2KA7A 1IYVA 2PPBC 2LMCB 3PUYA 3PUVA 2NN6H 1LABA 4H0LC 4LJZC 3M85A 2JE6I 2V4DA 3I73A 4H13C 4IQZA 1FR3A 1OXXK 1A6XA 1Q1BA 5BN3A 1CFMA 4L8JA 1I6VC 2D5DA 3OOCA 3TZUA 4KKUA 3T56B 3HGBA 3D4RA 3M4YA 3W3AA 1K8MA 4OO1G 2D62A 4PV1C 1OXSC 3CRLC 2AUJD 3SE0A 3KLRA 3LNNA 1HPCA 3D31A 2B8GA 1Y69U 3IKJA 1LACA 1Y8NB 3QG1A 1IYUA 3VR6A 2O5IC 1Y8PB 1E2ZA 4G7HC 5KNDA 4BA2I 4I7ZC 2K32A 2L5TA 3FMCA 2A68C 1ZYRC 1IW7D 3ND8A 2EDGA 2Q8IB 2A6HD 3SDZA 1O7LA 1HQMC 3OW7A 4RCNA 2BE5C 3VR4A 1H9KA 1H9JA 1H9MA 3BG3A 3IFTA 2BDOA 2A68D 4JBWA 4TQUS 1H9SB 4XIGS 2ZT9C 1OXUA 3WDNA 3I4LA 1GUGA 3T51B 1PMRA 2A69C 4KN4C 1OXVA 3T53B 3PUWA 4DK0A 4JK1C 3GQBA 1CI3M 4TKOB 2K7VA 4XTCS 4IFDG 2BA0A 2DNEA 4KMUC 5JEAH 3MFYA 1EWHA 1HCZA 1VF5C 2A69D 3CRKC 1V8QA 3N6RA 1V43A 2EJGC 5K36H 2JEBI 2O5JC 2A6EC 2JEAI 1ONLA 3QIAA 5C0XG 2EJFC 1GJXA 2EJMA 3PUXA 5BN4A 4KI0A 1TU2B 3QJYA
chains in the Genus database with same CATH superfamily
1G2SA 1XWEA 5C0XJ 2LXKA 1H9SA 1C4QA 1D2BA 1YIJA 4DR1Q 3ZYYX 3Q6SA 4I65A 4OONA 2GA4B 4RGNA 4LF7L 1HUNA 2IT1A 4P72A 3AFQA 3T1YL 2VB2X 2NTTA 2B2VA 3S15B 5J1ZA 1IKMA 1EYAA 2TSSA 5M5WH 3V2TA 2JXMB 1ENAA 1EQTA 3P1HA 2ZXPA 4V0BA 3C3LA 2QF7A 1SE8A 5BN5A 3D4WA 1TWFB 2B8FA 4KV6A 5IGGA 5EJWA 1WTVA 3EIVA 2FINB 3SXHA 1PH8A 5LMUL 2MO0A 1B50A 3MXGA 3W1BA 2UU9L 4YCUA 4FXGC 1YBYA 1PLFA 3I56A 1WVLA 1Z7TA 4GNXB 5CV9A 3K5LA 4MNOA 2HIXA 1T5EA 4CHTB 4OHJA 3KLSX 4A3DH 4Z9CB 2VB3X 2ZXOA 2FMMA 3CQZH 3N52A 2JE6I 3I73A 4LFCQ 3NTKA 3HOWH 3S2HH 2UXDQ 4ME5A 4LF9Q 2RHSB 3D4RA 3M4YA 5D14A 1QNKA 3UE1A 3MHBA 3KLRA 1T9HA 2TMPA 1NBWA 2WAQB 4HMIA 4JOIC 1L0XB 3Q22A 4FYDA 2NVXB 5HGQA 3PIPA 5J3BA 3SDZA 2BE5C 5IP9H 2KCNA 4JBWA 4A93H 2L0CA 2EXZA 2XNAC 4A3KG 3I4NG 4GS3A 4JI3L 2L15A 1HR0Q 4JV5L 1EWHA 1PTOC 4X66Q 1I94Q 5DM63 1F2LA 2A6EC 1JJGA 1SNDA 3K0YA 5IGBA 1IBMQ 3H0GG 1UE7A 1WTPA 4OO1I 1GUTA 4A3GB 3TEHB 2PQAB 3GTLB 4DK3C 2WKDA 1HR0W 1NR4A 2OCEA 3CCJA 4H02A 2YTYA 4QCLA 3K6OA 1VQ8A 4A3LG 4KKSA 4DR3Q 4HIKA 1Z9FA 3B6YA 4ME3A 1S3OA 2PZWA 1YHBA 3E9HA 4J15A 1Y1VH 4PZ7A 1VF7A 1PDQA 4DNRB 2A8VA 4DUZQ 1XMQL 5C44H 1QNUA 4GNXC 3KF6A 1YNJD 3K59A 4AYBE 2RDGA 1J5EL 2XRSD 4A3BH 2Q8RE 1SMYC 3OMCA 1AP0A 2KVMA 1W3SA 5GAHC 4DV5L 3JAMi 1A3VA 1UE5A 4ZK9B 1CHQD 4O42A 2VUMG 1LABA 1JB7A 5CV6A 4H13C 2B63G 3I3CA 1YITA 1HNXL 2SNMA 2R7ZG 2RDHA 5I2YA 5BN3A 2F0OA 4DAYA 3D8GA 5G3LF 3ER0A 4LFAQ 5C3EB 2AHOB 4DUYQ 3SE0A 4LWCA 4BBSB 2R93G 4OX9Q 3L2PA 3URYA 5HURA 2O5IC 4B3SL 5IGFA 5IYBG 2K14A 1I6HB 3RNUA 4CJ1B 4F8MA 5IOCA 3D4DA 4RGOS 4JBKA 4OWWB 3S14H 4DV0L 2Z4IA 5IGCA 4A3JH 3VYRA 3I4MB 3NPPA 4PQXA 1WI5A 3HOYG 4A76A 4RAUC 2VNUD 2O2LD 2IWHA 2O4XA 1FGBD 3CKIB 2R7DA 3VDYA 1AE2A 3CW2C 1KDCA 1O7YA 1IZ6A 3CPFA 2PYKA 1JWMD 2B2YA 3A7LA 3OWEB 3CCSA 3KLWA 2F0UA 1A0IA 1C9OA 1WTHA 1N32Q 4A3MB 4E6IA 3NQTA 2IX1A 2YTXA 4G4KA 2KHSA 1E3PA 2LSSA 1ICWA 4M1UB 4GKJQ 5I9OA 4AYBB 1HNXQ 2JA8G 1PH3A 3OIPA 1IXRA 2F0NA 1GUSA 2F0JA 1CM9A 1Q3LA 1LTRD 5LMNQ 4YIJA 2MPMA 3FHWA 5ELDA 1HNWL 4QIWE 3DEPA 1HA6A 4BY7B 5K5PA 5ELOA 3TDQA 1MD2D 3VYSA 5GAGC 2EY1A 2Q2IA 3NBIA 4ZRZA 1PV4A 3DUZA 4DV3L 3RUZA 2AKWB 1AH9A 3K7AB 1I4GA 2XSCA 3PIO3 4HR7B 1PYBA 3M9BA 3OHXC 3D3RA 3GTJB 1EY9A 1KRTA 3CF5A 4EX5A 4C1NK 1AN8A 2NN6H 2CW0D 2V4DA 3KJOA 3KLSA 3G48A 1MSHA 3EJIA 1KAAA 4HSVA 2ZM6L 4WJ3M 2WIIB 2B2WA 2D5DA 3UDXA 4EVOA 2J4XA 3M3YH 1LV9A 1PFMA 1QE6A 2PNHA 1WTQA 2B2VC 2F0GA 2AUJD 2D0PA 3LNNA 5M3MH 3D31A 3M4OH 3H3VC 1XNQL 3VR6A 4AH6A 2EYLA 2K5VA 3NWTA 5IE8A 1V9PA 1IW7D 2OQ0A 3BU2A 2EDGA 3K5NA 1PZID 1TWCB 1HQMC 1K0RA 1RHPA 3FKIG 2UUAL 2EQSA 3F2BA 4K6DA 1NY4A 1EWIA 3TSSA 1RD9D 1LYLA 5DAUA 3HOUB 3KF6B 4X3KA 3KDFA 3CCEA 4GLVB 1ET6A 1NJIC 1TWGB 2EZVA 4KTAA 2JA6H 3R93A 5C0XG 1N34Q 4K0KQ 1SYGA 5BN4A 1S72A 1J6QA 4XYQA 3A56A 1G6PA 3GTGH 1EYDA 2PCFB 1SYEA 4PMCA 4RHRA 5FO9B 4U68A 1L1OA 2AUKA 2K50A 3QR8A 1BO0A 1I50H 4BBRH 4DR7Q 3U4VA 3TZDA 4X65L 4DAYB 1R4PB 4NXMQ 1OO9B 1GHJA 1B9NA 1A2UA 3AU7A 4PMWA 3TP5A 4JI4L 4A3KB 5IYDG 3K58A 2NVYH 3I4NB 1MIUA 4KLKA 2EY5A 4HJ7A 5C4HA 1UEAB 1VQ6A 4N8FA 2JSOA 3WWVA 1SJED 4XYOA 3IAYA 1STYA 3J7A5 1D6EC 1SYCA 3NSWA 4DV2Q 1VQAA 4XQJA 1A3TA 5IP7H 2OWOA 1Q8IA 1YNNC 1AE3A 5T1GA 3NP8A 4X64L 2M2LA 1KIXA 4IO9A 5E4XA 1MJCA 2HQEA 1VQGA 2A6HC 2L55A 1JC7A 5C4XG 3KUPA 4LW1A 4POFA 4IUPA 4K6LA 3PUYA 2HD3A 1K3RA 1PRTD 3MEFA 1STNA 3M85A 3CC4A 1PXUA 4XT3B 1BCPB 3NENA 2F3IA 5ELCA 4L8JA 1VQ5A 2I07B 4CKBA 4KKUA 4DV7Q 2E2JB 2F0KA 3GTMH 1OXSC 2ZTCA 4HN7A 3GTKH 4A3DG 2KCMA 3S2DH 2WV6D 1X56A 4RG1A 2PI2A 3CCLA 3AMUA 1K8GA 3SK5A 2RSNA 4OIKA 4TQUS 1OXUA 4DAMA 1KXLA 1GUGA 3FPUB 4YY3L 1FL0A 1SYFA 2HCIA 2VUMB 2F0LA 2F4VQ 4LFBL 2B63B 2R92G 3GQBA 2Q2UA 2QW7A 2R7ZB 3KOJA 1VF5C 2JA5H 3N6RA 4IFDJ 2K5WA 2HUGA 2VQEL 3MAQA 3QIAA 5I6YA 4QQBX 1CQFA 1TU2B 2E2DC 5JAVA 3NHHA 5M3FH 4LNQA 2HHHL 5LL6X 4A93G 3I8ZA 5AJ3Q 2OTLA 4V190 4DKAC 3A7AB 3BZCA 2VL6A 1YJ9A 1TWAH 2UXBQ 3HOYB 1B3QA 1I3QB 1MSGA 4HTHA 4CDFC 3G6EA 4DNIA 1XJVA 1XMOQ 1ILPA 5JPNC 1DOLA 1MBYA 4JI6L 1VQ9A 2XRQD 5JVG3 4JYAL 3ULPA 5GADC 1VCIA 1GUWA 4H44C 5E3FA 1N33L 4O2DA 2X6GA 4WRDA 3GTOB 3C2PA 3KDFB 5E4WC 2FMCA 2ZJQA 2RA4A 3Q8DA 3BVMA 2NUCA 1HXYD 4G7ZC 2RSOA 3AEVA 1EIHA 1F9RA 4GKKL 1PH7A 3O13A 2B2YC 2ICEC 1STGA 1JOKA 3NUCA 1BCPC 1L0YB 1Y1VG 3KK7A 3J81L 1EYGA 4DA2A 4XDXA 3ERQA 1L1OB 2ZTEA 5C44G 1KNEA 4A3EH 4ZUIA 1Y1WH 2A1AA 3J7ZC 1SRUA 3Q23A 3L9AX 2MJ8A 1K83H 1K8MA 4RKBA 4DR4Q 5JVH3 1PH2A 4CKEA 4A3BG 1LACA 1VMPA 4NW2A 4DR1L 2K4KA 1U5KA 3F2CA 5FK9C 5HGTA 1LLRD 2NWGA 1V1QA 2F0QA 4BXXH 2QGQA 1P8LA 1I4QA 1K0SA 3BS1A 3S17B 2B3GA 3KBXA 4HJAA 2EIFA 2NVQB 3GTPB 4IJHA 1BBWA 4MTNA 1KC8C 3CCQA 1EQRA 2H1EA 3SGIA 4FXKC 4DPGA 5IWAQ 1UE6A 4C3HG 1HFGA 1VQFA 4CDEC 1BXTA 4LF8Q 4C1NI 5NUCA 2CFMA 4JPBW 1LTAD 1X3EA 3GD7A 4ID6A 4JI8Q 2B39A 3HOXH 1G291 1S4ZA 4A3JG 3S16H 2B2WC 2PZTA 3BVZA 3CCVA 2CWPA 3RN5A 1YHQA 2BH2A 1PTOH 1A63A 3FKIB 2R3ZA 4FO2A 3UI2A 1WTWA 1DYQA 1HTPA 4LAAA 4JI2Q 2EXDA 1BF4A 4CJ0B 1STHA 1K8OA 4DR5Q 3CCRA 4LFCL 3VA7A 2UXDL 5FO8B 1Z6HA 1WCMB 2AQ3B 4LF9L 1QOHA 3TN2A 1R9TH 2DN8A 2IL8A 4HIDA 1SBBB 5FLMH 2GN5A 4OO1H 1X9NA 2E2IB 4O1NA 1TWFH 4JI5Q 2BCOA 2AQ1B 1DOKA 3E0EA 1SEBD 4YHHQ 3J80E 4NPSA 3Q24A 2LMCB 4XQQA 1EUJA 2IX3A 4H0LC 1UEBA 1L1OC 1HR0L 5M5XH 1JMCA 4X66L 2JK8A 1PFSA 3PO3H 1K28A 1I94L 1J8IA 5C3XA 1OXXK 2IY5B 3W1GA 2Z4HA 4R4OA 3A54A 1IBML 2JP1A 3OOCA 5KGUA 1EFWA 3HFZB 1V1PA 2LXJA 1C0AA 1JORA 3RLNA 5D65A 4GN5A 4IPHA 1E2ZA 5CBEE 1VQKA 2CWAA 2L5TA 1SE3A 2A68C 4UP7A 2K01A 1I5FA 1B53A 4K8IA 5C4XB 4JC0A 1O7LA 4DR3L 5M5WB 1VQHA 5CR3A 3NQIA 1LTSD 1TS3A 2WB1B 3TP7A 1Q8KA 1F2YA 4ZCKA 2HT1A 2NVXH 1N9WA 5C4JH 2SNSA 1PRTF 1B70B 5M3MG 4DUZL 2LKVA 4P2CB 2L9HA 3GV3A 1WD0A 3T1HQ 2JA7H 2C9OA 5JJZA 2I5MX 2UUCQ 2RVLA 1QB5D 3WOFA 5D3DA 5EPKA 1I4XA 4BA1I 1JE5A 1ZEQX 2OXPA 3TMEA 5C0XI 2RKSA 5C3WA 1NMGA 5EQ0A 1DONA 2VXWA 2L1BA 3K81C 5I2XA 2EY6A 3S2HB 4A3GH 3GDEA 1RDPD 2I5HA 4JI0Q 1F9SA 3ND9A 4RGTA 2WFWA 2R92B 1N8RC 3K0XA 1S5BD 2YYZA 1XPOA 4IALA 1BDOA 2JA6G 1GUNA 1H95A 4LFAL 1GUOA 4RKLA 5IY0A 4DUYL 3UDFA 4OX9L 4C3IH 1AZQA 1TIID 1EIFA 2CH4A 5KNBA 2QA4A 4L63B 2K28A 4BBRG 3CC7A 3PSIA 1S40A 1EOTA 1SJHD 3T4AC 4XXEA 3L0OA 2YU9H 1Q12A 3BZKA 1U4PA 4R4IA 1PH6A 5E1FA 2EYMA 1V1OA 4Q5VA 3K8AA 4UP8A 5KEEA 2GVAA 2DY7A 2PPBC 3M7GA 3A5ZB 4DV4Q 3PUVA 4ZLTF 1QWYA 4OWTB 2SOBA 1SN8A 5IP7G 3K7UC 5IODA 1L2FA 5EPJA 2B2UA 4IUQA 1ESFA 1PH9A 1NSNS 4L5QA 2Z9HA 1EU3A 1N32L 2K52A 2DY8A 3J81j 2JJQA 4BA2I 4WJ4A 1CUKA 4CJ2C 1JT8A 2MQHA 3ND8A 2F0FA 3ERSX 4GKJL 1XXGA 5C3EH 1D1IA 4R4QA 1H9SB 1B3AA 3J80c 2A69C 4QJFA 2CQOA 4KN4C 4BY1B 1Y1VB 4DK0A 5BR8Q 4A3IH 5LMNL 4IFDG 4KMUC 2F3WA 1IL8A 2WINB 2EJGC 1RODA 2G9HD 1EQQA 3U50C 5DM73 1PTOD 3I4MH 3CU7A 2X69A 2EJFC 1GJXA 3D0FA 1GHKA 5J39A 1SNPA 4A3BB 1LTID 1LT3D 5HY6A 4QUCA 1X55A 3MVVA 3HKZG 4GZYC 1Y14B 4P75A 5EKLA 1ZYRD 4A3CG 1EY7A 4YCVA 2KJXA 1RL2A 1HA5A 2PMZE 2JA5G 1Q7YC 1HJPA 1V1PB 5J22A 3AFPA 1WFQA 4IUVA 1D1KA 3NBHA 3F2DA 4R8NA 1E0BA 2D2CC 3RLFA 1B8AA 1KRSA 4C3HB 3P75A 1BVSA 3VR3A 5M3FG 2KHJA 3EBEA 1KTKA 1JICA 3I55A 1TR5A 2Z0SA 1FVIA 4OGQC 4KKTA 5M5YB 1PH1A 1D5ZC 4NDXA 1FNWA 1IW7C 1NR2A 2BDNA 2IPKD 3PO2H 2E76C 5ELNA 4DNTB 3A8IE 3IL8A 5KRUA 3H15A 4CDCC 2MP1A 3S1NB 1ENCA 1SMYD 3JAML 1TS2A 2IHFA 4UPAA 1TXYA 4R1JA 3CPWA 1YNXA 3FP9A 2C35B 5FOBB 2NTSA 3HKSA 1OTCA 4A3FH 4GLAC 1EL0A 1SMXA 1JCKB 1JE4A 1N34L 3SK4A 4K0KL 1D7QA 3T56B 3TS2A 1GO3E 3GTJH 2PZUA 4H7BA 3GTQH 2ALYB 5LMNW 1EU4A 3VA5A 4DR7L 4I7ZC 1G6ZA 2ICIA 3H3VI 4NXML 1VQBA 1SFOH 1H9KA 3H09A 4LF4Q 3HRZC 1JB3A 4ULLA 2G9DA 1RTOA 4A3EG 1SNMA 1OXVA 4JK1C 5IT9L 2K7VA 2Z1CA 3RZOH 1N36Q 1C7YA 4PZ6A 1NE3A 1V8QA 1AFPA 1V43A 1TWCH 4DV2L 5K36H 3SR1A 5KYLA 4N9PA 1EQVA 2Y0SG 4FP5D 3NELA 1II3A 3HOUH 1X3FA 4JI1Q 1CK1A 3K5OA 4BXXG 3H91A 5FKAC 3G7LA 1BBXC 1VQCA 2EPBA 3E6ZX 5CV7A 5FLXL 1TWGH 4C3JG 1DXMA 1DCZA 1ZXTA 1SROA 2H5XA 1KHIA 1PH5A 4IUNA 1XPRA 2VY3A 3SK8A 3FEWX 3M3YB 4DK1A 3KJPA 4NXNQ 1CHPD 1MHWC 3UE0A 1PFBA 2EOTA 5M3MB 4DV7L 5IYCG 1DD2A 4NP5A 1B1ZA 4G7OC 2JN4A 4KHZA 3ZJYC 3HOXG 3I4NH 2CVRA 2I46A 4QIWB 2YTVA 1KDBA 5ELEA 1LT6D 1Q46A 3BJUA 3SHLA 4P71A 2QKIC 3BDOA 4FXDA 4KK7A 5EKKA 1GOZA 3DEOA 1STAA 2KA7A 2F4VL 1G91A 1SNOA 3MTSA 4HAEA 1VS0A 1YHAA 1ESRA 2JYOA 2JA6B 1O80A 1JWSD 2CKZB 2SEBD 1BBUA 3H0GB 3HKZE 4L5SA 1T5XD 1E7ZA 2EY2A 4FF3A 1PZKD 2R61A 4Y7NB 3GTGB 2J7ZA 5FLMG 1QVFA 3ULLA 4IUUA 3FRPB 4OO1G 4BBRB 1RIPA 4MTKA 1STEA 4G7HC 2E2HH 5AJ3L 2QEXA 5CORA 3K80C 5D3IB 3NBHB 4P73A 1J9OA 1B4OA 4ALPA 2Q8IB 2E8GA 4HJ9A 3X3NA 1EWCA 4PG3A 3VR4A 2E2JH 2UXBL 1H9MA 3BG3A 1A3UA 4XIGS 3PO3G 2FHTA 2F0TA 4KJOA 1D5MC 1HZCA 1XMOL 3T51B 1XTCD 5JOBA 1RKNA 4GOPC 1VQPA 1X32A 3QO2A 4KY7A 1JJCB 1HCZA 3HOVH 2EYHA 1VQEA 4KD3A 2KUMA 3OMGA 2O5JC 4DV1L 4PNYA 3PGZA 2EYJA 5EAYA 5CYUA 1F2ZA 1SXTA 3HEJA 4L6TB 2MO1A 2VUMH 5KNCA 5KYIA 3RZDB 4B3RQ 2E74C 4IZ8A 2R7ZH 3MWYW 3NE5B 3J7YW 2CCZA 4LUZA 2IW3A 4X3TA 3HOWG 1KNAA 1X6OA 2M00A 2F0HA 3A8JE 4RCOA 2WAQG 1K73C 2B2UC 3RD4A 1ENFA 1X3PA 2R6GA 1EEFD 3I72A 3QOJA 5DNFA 2Q8TA 2EYPA 1E2VA 1UWVA 3J80i 4F88A 4C2MB 4JI7Q 5IYBH 4DXFA 5ELBA 2N78A 3GTMB 2WACA 2JA7G 1CTMA 2R93B 2A5HA 4ZKCB 1KDAA 3S1MB 4DR4L 3H94A 4LF5Q 3M4QA 3HOYH 4R4TA 1I3QH 5IP9G 4C56C 1QG7A 5IIFA 1PTOF 2F0EA 1WJJA 1EEID 4B9XA 5A2QL 4FF1A 1VQ4A 4A3GG 3S1RB 4KHVA 2NVTH 1Q86C 1E2WA 1LTBD 2A74C 4B3TQ 1U4LA 2QDBA 4CDDC 2F52A 2Y0SE 2AQ2B 3KF8A 4O0AA 4X3SA 1WTXA 1EYCA 4HIMA 3G6JB 2KHIA 3GTOH 1CA6A 4DV1Q 1FR3A 1FJGQ 4C3IG 5IWAL 1CFMA 5M3FB 3TZUA 4LF8L 3GV6A 4L5RC 1NCVA 2F0IA 1HPCA 4JI8L 2B8GA 2G5DA 3RLOA 3U9OA 2L11A 2P5ZX 2UXCQ 1CSQA 4DF7A 4JI2L 5I4DA 2JA8B 3EA6A 2WKCA 4DR5L 2MUYA 3WDNA 4JW0A 3MEHA 4DK6C 1CKNA 1SSOA 5AFWA 3RN2A 2Q2TA 4KHPQ 4OIJA 1CI3M 1M4VA 2EYOA 2VS1A 1S5FD 3HOZH 4X6AH 3FVQA 5CV5A 1VQNA 4K8JA 5C5MA 1ONLA 4I7AA 4IFDI 2QILA 1EIGA 3F8TA 4KI0A 1PFNA 2DNCA 3QJYA 1EIYB 1ICFB 2NZOA 2JA9A 3VYUA 4FNFA 4JI5L 3OTOQ 3QWNA 1VDZA 4YHHL 1IBLQ 1CT1D 1GXDC 1X54A 2HIVA 3P20A 4X62Q 4A3IG 1QZHA 3PUZA 1W6KA 5JJKA 1NNXA 3S1QB 3NK9A 4LUOA 2HCCA 4LMQD 4WORA 4BS9A 3MXNA 1Z47A 3PV0A 3I4MG 1LO5D 5IT9c 3EVQA 1YVCA 1JJ2A 3NTIA 5CC4A 4B3MQ 1W6JA 3EFXD 4RGMA 1DOMA 4A4IA 4APVA 3BYYB 5EGTA 1FNVA 4JG2A 4DR2Q 1TS4A 1QUQA 4QF4A 1PYWD 2F0DA 1HZAA 1WCMH 3RMHA 4MN3A 1HFNA 1SAPA 3LGJA 4C3JB 3MXPA 2J0TD 5FJ8H 5C0XH 1M1KC 2N88A 1TWHB 3AB9A 1Q90A 1W2BA 3W2DA 3SVMA 2KOLA 4R4CA 1VQJA 4R8IA 2E2IH 1BNZA 1HZBA 1S5ED 4DV6Q 1Q82C 3MA2B 3S15H 4IPDA 3T1HL 1G51A 2N8NA 3DMUA 3HGBA 3W3AA 3HOXB 2UUCL 1I4RA 2WAQE 4QL5A 4DR6Q 1EOVA 2FFKB 2FJ2A 1CZWA 2UUBQ 3QG1A 1IYUA 2SDFA 2D0OA 1SE4A 3PO2G 4FVMA 1RTNA 4MZ9A 4HCSA 5DEHA 2A73B 2KEDA 5T1IA 2K32A 3A5UA 3QB3A 4JBJA 4ABNA 1IBKQ 2RQXA 1YJWA 1JR0D 4JI0L 2ZT9C 4LF6Q 3J81E 4B08A 4A3FG 3I90A 2K03A 1KD1C 4TKOB 1EZ6A 4XTCS 1R9TB 5JEAH 5KIXA 4AQYQ 3I91A 5C4XH 4DFAA 3OWFA 1XNRQ 4ZQ3A 3V96A 4JBMA 2K5HA 4IUTA 3DWAA 2RF4A 2KCCA 2E5LQ 3KF8B 4UP9A 1SR3A 2NN6G 1QCBD 3STBD 1EZ8A 1H9RA 1HNZQ 1E1TA 1UNSA 5M5XB 4OWXB 3PO3B 4QB4A 1BQQT 2VQFQ 2ATWA 2VZAA 4DV4L 3DWQA 3E5SA 3CHBD 4KN7C 1S5CD 5K36G 1KABA 2GVBA 5JEAJ 1MGSA 1QJOA 1BR9A 1QILA 1PYSB 4Q0FA 3RR5A 4DN4M 1FD7D 1O78A 2OEOA 3CP0A 3CCMA 2KBNA 4N8X1 4HMJA 1CKMA 2LFNA 5GQOA 4FF2A 3HOUG 4EGVA 4A3DB 1YNJC 1IYJB 2R92H 1CKNB 4IOCA 3CQZB 2I5LX 2NBFA 3ITPA 3HOWB 1XX8A 3ULJA 1SE2A 2XTIA 1P16A 4LF7Q 1SLJA 2Z6KA 3GP7A 1FNUA 3GTLH 5C4JB 1M8AA 2PW7A 3P7JA 3X3MA 5BR8L 3T1YQ 4LJZC 1IKLA 4UDUC 3C46A 1GKHA 2JA7B 1CKOA 4MIUA 3BYTB 1WOCA 4QMGA 1I6VC 1KLUD 2LY7A 4K5XA 1CA5A 3VYTA 1X65A 2D62A 4PV1C 1XTDA 3CMEA 4A93B 5FO7B 4DGZA 4GOPA 1Q81C 5LMUQ 4YWLA 3PCOB 4J8QA 2UU9Q 4LUVA 2IX0A 4K2KA 3CC2A 1DZ1A 3MXNB 1YZ6A 1ZYRC 2ID0A 2N49A 4ILWA 1PVOA 5CMDA 1VQ7A 1A15A 2K5QA 2KCTA 3CMAA 1LUZA 2A68D 3TS0A 1VQDA 3LX0A 1UAPA 1SYDA 2MHVA 3T53B 1QUQB 5LL6S 4NKLA 2DNEA 3NWSA 3MFYA 3CRKC 4KJNA 4C3IB 3I4OA 1U0LA 2NZ1D 2WP8J 3ICEA 1DJRD 2JEAI 4L5TA 2YU9B 1EY0A 1E1OA 4K5VA 3TQYA 3LWEA 4BY1H 2F0PA 1UUPA 4FDBA 4FF4A 1VQLA 3EQLC 1MKHA 1VQOA 5F2DA 3NTHA 1I4PA 2AMCB 3M7NA 4BBSH 2BE5D 2RHQB 2C5CA 3TRZA 3H3VH 1IHZA 2KENA 5C44B 1MI2A 3KYHC 2VW9A 1ASZA 4MHEA 1I6HH 3HOVG 1QZGA 4QGUA 3J81c 5A35A 1AZPA 4LK1C 4OELB 2B2TA 4DXGA 5COYA 2BA1A 1LM0A 3H6MA 4JI3Q 3W5OA 4YWKA 2A6ED 3V05A 4JV5Q 2EVBA 3LWUA 3J7AV 3R2IA 3HG9A 2CH4W 3JC66 2OTJA 4HEDA 3A8KE 1U4MA 1HUMA 1HQRD 2PNRC 3U9SA 4UAIA 5IGDA 2AWOA 1NMFA 1B9MA 4LF4L 1BUVT 4C3HH 2EE1A 1K3BC 2ENBA 3D6CA 1TT2A 4A3IB 1A62A 2CW0C 4YCWA 4A3MH 1PRTB 2IJ0A 1U9RA 2L12A 1N36L 5M5YH 3BDLA 3R2TA 2XIWA 4IQZA 4IURA 4CKCA 3QOLA 1A2TA 3U58A 1A6XA 3BZDB 3S9WA 1DGSA 2RCFA 4UHVA 4TRDA 3S1NH 3S14B 4A3JB 1XMQQ 4CGYB 4PMBA 1EY6A 3T13A 4JI1L 1Y69U 1Y8NB 4U673 3OSOA 3R8BA 4YWMA 4BY7H 3DWPA 3DM1A 2DJFC 2V1CC 3HP3A 1A8VA 4RCNA 1J5EQ 3OW7A 3EN2A 3E3XA 2ZTDA 4F7XA 3L3OC 5TSSA 3K7AH 3PQIA 4DV5Q 4NXNL 1WTOA 2A69D 2XWJB 2Q2HA 3Q0AA 4QUFA 1HTLD 4WJWA 2EJMA 2N55A 5EKIA 1M90C 1BCPF 1SYBA 1LT4D 3PO2B 2K33A 3CAMA 4P74A 1ILQA 4TSSA 4B9WA 5LHY1 1FGUA 4B3SQ 4RMFA 3CD6A 1UE1A 2B29A 3IRBA 1Y1WG 1BOSA 4DV0Q 4A3FB 4GOPB 3HOZG 3EROA 5H1SE 3K5MA 3DXJC 5ISRA 2PMZB 4ZYSA 2F1MA 1KL9A 1CSPA 3GTQB 4X3UA 1G2TA 1JWUD 1Q1EA 1GM5A 3CCUA 3M4PA 2K5NA 1EY5A 3OPOA 2HDLA 1NAPA 1SFOB 4KY5A 2F4IA 1KAWA 5EBDA 3KBGA 1HRJA 1B44D 1SNCA 2H4OA 3J7AF 4OXPA 2NB0A 2MNAA 3NEMA 2QCPX 1EY4A 3DHQA 5DLQE 1PRTC 3RZOB 3F1ZA 4GN3B 1JOOA 1K9MC 3TBIB 2ZJRA 2R7FA 3M4OB 3C1EA 2CHBD 1PH4A 4F87A 1TS5A 4A3KH 1PZJD 4RFBA 3OIQA 1HNWQ 2ASBA 3SEBA 1WCMG 2I0QA 4XT1B 4B3RL 3IKJA 4TVAB 3G4SA 4IPCA 1AEXA 4ZAIA 3H0GH 5FJ8G 3S24A 3E9IA 3FMCA 4S3SA 2EYFA 2QEJC 3E0JA 4OEMB 4DV3Q 1IL2A 4N9TA 4Y7NH 1TY0A 5JPMC 4RWSC 3IFDA 3JAME 4AIMA 2BDOA 3OW2A 1YI2A 3PF5A 3CXCA 4JI7L 1HZ9A 2RDFA 1QVCA 4A3LH 1X3QA 2JQOA 1F2MA 2K04A 4LF5L 3KFUA 1I50B 2Z6KC 2ZM6Q 2MGSA 2KEEA 2OT2A 3DLLA 5CBAE 2FXQA 1E22A 2NVYB 2ZJPA 4IPGA 1XNQQ 1WTRA 2PO4A 3MXUA 1R4QB 2NZHA 1U4RA 3GO5A 4GLXA 2KECA 3L7ZC 4A75A 3FPPA 4B3TL 1QVGA 3PIP3 4GN4B 5IT9E 5M9OA 4EQNA 2NN6I 5JEAG 1KLGD 1OXTA 1DM0B 3RZDH 2UUAQ 1BKBA 1X3GA 1GD7A 1E24A 4HCEA 3AQQA 1FJGL 4K2LA 1Y8OB 1B2TA 4HJ8A 2WB1G 4JOIA 4J6HA 3I2ZA 4ZKBB 2B63H 5JJLA 3VR2A 2CQAA 2E2HB 1EY8A 2XWBB 4IFDH 4C2MH 2PW5A 5FLXE 2KQ3A 2UXCL 2R93H 4IOAA 3S1MH 3I70A 1SDFA 3VR5A 3UDGA 1CQVA 4R9WA 4EQ5A 5C4ZA 4X65Q 5L37A 3HOVB 4KHPL 1IYVA 1B7YB 2BOSA 2MFIA 5I6WA 4JI4Q 1GVPA 2HDMA 3J81i 4A3CH 3C1FA 3GTKB 3OYYA 4OL7A 3S2DB 1RCVD 3MZ5A 1Q1BA 3S1RH 2DJGC 3UDIA 3HKZB 5EBCA 1LTGD 4IN3A 1ASYA 2F0MA 5E7NA 2F0WA 3WOEA 4POGA 1YNND 1EFID 2B2TC 1RJTA 1L0WA 1LT5D 3OTOL 5C6AA 3MFGA 5KNDA 1D8LA 1IBLL 2JA5B 4JVZA 2AWNA 3MC0B 1I4HA 1XPUA 4X64Q 1C48A 2A6HD 4X62L 2K75A 4KD4A 4Y52H 4KY6A 2HQLA 3IFTA 5CV8A 4IJLA 2L4NA 1PMRA 3T16A 1PA6A 3PMFA 3NXWA 3PUWA 2RCNA 2YV5A 4GNXA 1S5DD 2XVSA 4B3ML 1ML0D 2JA8H 4DR2L 1MJEA 1TWAB 2A19A 1CZGA 4HJ5A 4JCVE 1O7IA 2NVTB 4PZ8A 5EPLA 1JOQA 1VMCA 4DU9A 2QDLA 4NMZA 4K14A 1RF2D 1TKWB 2E75C 4DAPA 2OQKA 3HZXA 4BWGB 4CBVA 3JAMc 4ODGA 4J1MA 4DAVA 1ZKOA 4YY3Q 1YJNA 4EQOA 3J80L 4DV6L 2PI2E 5G3LD 1K8AC 4LFBQ 2K6AA 2OF1A 1AW7A 4BY1G 2Z6BA 3S17H 4QY7A 4DR6L 2NVQH 3GTPH 3BVGA 1NTGA 1XYIA 2UUBL 2VQEQ 3S1QH 5C3EG 2F0VA 3TP8A 4K5WA 4BBSG 1ET9A 1HH2P 1O7ZA 3A74A 4WFN3 3I7FA 4UY8C 5C5LA 1IBKL 2HHHQ 1F9PA 3FDTA 1STBA 3A0JA 4A3EB 4HSPA 2DGYA 1PHJA 1Y1WB 4LF6L 1F77A 4RH6A 1FYCA 5GROA 4EQPA 3U4ZA 1K83B 4XQNA 1C8CA 3HOZB 2IHEA 2K1BA 3G71A 3FKIH 4G57A 5CV4A 2F0SA 2PQAA 4AQYL 2Y0SB 5IGEA 1NUCA 3PF4A 1F9QA 1VQIA 4C3JH 1XNRL 1D5XC 4JI6Q 1TVXA 1TWHH 3K57A 5GAEC 2E5LL 3AYHB 5JJIA 4JYAQ 2F3VA 3CRLC 2BH8A 3D6WA 2LS01 1VQMA 1WD1A 4RHSA 1KQSA 1SNQA 3DM3A 5A2QE 1Y8PB 2X6LA 2DUDA 4RA8A 3F2UA 3ONAB 1N33Q 1HNZL 5IYCH 5FLXc 1HHVA 1LTLA 5I9PA 2D9UA 2PQEA 2XN9C 2Z8LA 4A3MG 2XGTA 2F03A 2WB1E 2K5DA 3STBC 2VQFL 1TQOA 3HS0C 1H9JA 3PIOA 3I4LA 1WYDA 2ZXRA 1YEZA 3TP6A 4GKKQ 1G8ZD 1BCPD 2M9VA 2NYZD 1JQYD 4AYBG 2BA0A 3SK6A 2RBMA 5CGKA 5IYDH 4M8AA 3S16B 4ZUJA 4NB3A 2JEBI 3TREA 3R3OA 4HIOA 1PTOB 3BDCA 1LTTD 2K05A 5ELFA 1TY2A 2N3SA 4BY7G 2ES2A 3PUXA 3A55A
chains in the Genus database with same CATH topology
1G2SA 1XWEA 5C0XJ 1H9SA 1C4QA 1D2BA 3ZYYX 3Q6SA 4I65A 4RGNA 2GA4B 1HUNA 2IT1A 2VB2X 2NTTA 2B2VA 3S15B 5J1ZA 1IKMA 1EYAA 2TSSA 3V2TA 2JXMB 1ENAA 1EQTA 3P1HA 2ZXPA 4V0BA 3C3LA 2QF7A 5BN5A 3D4WA 1TWFB 2B8FA 4KV6A 5IGGA 5EJWA 1WTVA 2FINB 3SXHA 1B50A 3MXGA 4FXGC 1PLFA 1WVLA 1Z7TA 5CV9A 3K5LA 1T5EA 4CHTB 4OHJA 3KLSX 4Z9CB 2VB3X 2ZXOA 2FMMA 3N52A 2JE6I 3I73A 3NTKA 4ME5A 3D4RA 3M4YA 5D14A 1QNKA 3MHBA 3KLRA 2TMPA 2WAQB 4HMIA 1L0XB 3Q22A 4FYDA 2NVXB 3SDZA 2BE5C 2KCNA 4JBWA 2L0CA 2EXZA 2XNAC 1EWHA 1PTOC 5DM63 1F2LA 2A6EC 1SNDA 3K0YA 5IGBA 1WTPA 4OO1I 1GUTA 4A3GB 3GTLB 2WKDA 1NR4A 4QCLA 3K6OA 4KKSA 2PZWA 1VF7A 1PDQA 4DNRB 1QNUA 1YNJD 3K59A 2RDGA 2XRSD 2Q8RE 1SMYC 3OMCA 1AP0A 2KVMA 1A3VA 4ZK9B 1CHQD 4O42A 1LABA 5CV6A 4H13C 3I3CA 2SNMA 2RDHA 5I2YA 5BN3A 2F0OA 4DAYA 3D8GA 5G3LF 5C3EB 3SE0A 4BBSB 3URYA 5HURA 2O5IC 5IGFA 1I6HB 4CJ1B 4F8MA 5IOCA 3D4DA 4RGOS 2Z4IA 5IGCA 3VYRA 3I4MB 3NPPA 4PQXA 4RAUC 2VNUD 2O2LD 2IWHA 2O4XA 1FGBD 3CKIB 1KDCA 1O7YA 2PYKA 1JWMD 2B2YA 3A7LA 3OWEB 2F0UA 4A3MB 4E6IA 3NQTA 2IX1A 4G4KA 2KHSA 1ICWA 4M1UB 5I9OA 4AYBB 3OIPA 2F0NA 1GUSA 2F0JA 1CM9A 1Q3LA 1LTRD 4YIJA 2MPMA 5ELDA 3DEPA 1HA6A 4BY7B 5K5PA 3TDQA 1MD2D 3VYSA 2EY1A 3NBIA 4ZRZA 3DUZA 3RUZA 3K7AB 1I4GA 2XSCA 3PIO3 4HR7B 3OHXC 3D3RA 3GTJB 1EY9A 4C1NK 1AN8A 2NN6H 2CW0D 2V4DA 3KLSA 1MSHA 3EJIA 1KAAA 4HSVA 2WIIB 2B2WA 2D5DA 4EVOA 2J4XA 1LV9A 1PFMA 1QE6A 1WTQA 2B2VC 2F0GA 2AUJD 3LNNA 3D31A 3H3VC 3VR6A 2EYLA 3NWTA 1IW7D 2EDGA 3K5NA 1PZID 1TWCB 1HQMC 1RHPA 4K6DA 3TSSA 1RD9D 5DAUA 3HOUB 4X3KA 1ET6A 1TWGB 2EZVA 4KTAA 3R93A 5C0XG 1SYGA 5BN4A 4XYQA 3A56A 1EYDA 2PCFB 1SYEA 4PMCA 4RHRA 5FO9B 4U68A 2AUKA 1BO0A 3TZDA 1R4PB 1OO9B 1GHJA 1B9NA 1A2UA 3AU7A 4PMWA 3TP5A 4A3KB 3K58A 3I4NB 2EY5A 5C4HA 1UEAB 2JSOA 1SJED 4XYOA 3IAYA 1STYA 1D6EC 1SYCA 3NSWA 4XQJA 1A3TA 1Q8IA 1YNNC 5T1GA 3NP8A 2M2LA 5E4XA 2HQEA 2A6HC 2L55A 1JC7A 3KUPA 4IUPA 4K6LA 3PUYA 1PRTD 1STNA 3M85A 1PXUA 4XT3B 1BCPB 5ELCA 4L8JA 2I07B 4CKBA 4KKUA 2E2JB 2F0KA 1OXSC 4HN7A 2WV6D 3AMUA 3SK5A 2RSNA 4OIKA 4TQUS 1OXUA 1GUGA 3FPUB 1SYFA 2HCIA 2VUMB 2F0LA 2B63B 3GQBA 2R7ZB 1VF5C 3N6RA 4IFDJ 2K5WA 2HUGA 3MAQA 3QIAA 5I6YA 1CQFA 1TU2B 2E2DC 5JAVA 3NHHA 5LL6X 3I8ZA 4V190 3A7AB 3HOYB 1I3QB 1MSGA 4HTHA 1ILPA 5JPNC 1DOLA 1MBYA 2XRQD 5JVG3 1VCIA 1GUWA 4H44C 5E3FA 2X6GA 4WRDA 3GTOB 3C2PA 5E4WC 2FMCA 2RA4A 3BVMA 2NUCA 1HXYD 4G7ZC 2RSOA 1EIHA 1F9RA 3O13A 2B2YC 2ICEC 1STGA 1JOKA 3NUCA 1BCPC 1L0YB 3KK7A 3J81L 4DA2A 4XDXA 3ERQA 1KNEA 4ZUIA 3Q23A 3L9AX 2MJ8A 4RKBA 1K8MA 5JVH3 4CKEA 1LACA 1VMPA 4NW2A 5FK9C 5HGTA 1LLRD 2NWGA 2F0QA 1I4QA 3BS1A 3S17B 3KBXA 2NVQB 3GTPB 2H1EA 4FXKC 4C3HG 1HFGA 1BXTA 4C1NI 5NUCA 1LTAD 3GD7A 4ID6A 2B39A 1G291 1S4ZA 2B2WC 2PZTA 3BVZA 1PTOH 3FKIB 2R3ZA 3UI2A 4FO2A 1WTWA 1DYQA 1HTPA 4LAAA 1BF4A 4CJ0B 1STHA 1K8OA 3VA7A 5FO8B 1Z6HA 1WCMB 2AQ3B 1QOHA 3TN2A 2DN8A 2IL8A 1SBBB 4OO1H 2E2IB 4O1NA 2BCOA 2AQ1B 1DOKA 1SEBD 3J80E 3Q24A 2LMCB 4XQQA 2IX3A 4H0LC 1J8IA 5C3XA 1OXXK 2Z4HA 3A54A 2JP1A 3OOCA 5KGUA 1V1PA 1JORA 5D65A 1E2ZA 5CBEE 2L5TA 1SE3A 2A68C 2K01A 1B53A 4K8IA 5C4XB 1O7LA 5M5WB 5CR3A 3NQIA 1LTSD 1TS3A 2WB1B 3TP7A 1F2YA 2SNSA 1PRTF 2LKVA 4P2CB 2L9HA 3GV3A 1WD0A 2C9OA 5JJZA 2RVLA 1QB5D 3WOFA 5D3DA 5EPKA 1I4XA 4BA1I 1ZEQX 2OXPA 3TMEA 5C0XI 2RKSA 5C3WA 5EQ0A 1DONA 2VXWA 2L1BA 5I2XA 2EY6A 3S2HB 1RDPD 1F9SA 3ND9A 4RGTA 2R92B 1S5BD 2YYZA 4IALA 1BDOA 1GUNA 1GUOA 4RKLA 1AZQA 1TIID 5KNBA 4L63B 2K28A 1EOTA 1SJHD 3T4AC 4XXEA 1Q12A 1U4PA 5E1FA 2EYMA 1V1OA 4Q5VA 5KEEA 2DY7A 2PPBC 3M7GA 3PUVA 4ZLTF 1QWYA 2SOBA 5IODA 5EPJA 2B2UA 4IUQA 1ESFA 1NSNS 1EU3A 2DY8A 4BA2I 4CJ2C 3ND8A 2F0FA 1XXGA 1D1IA 1H9SB 1B3AA 2A69C 4KN4C 4BY1B 1Y1VB 4DK0A 4IFDG 4KMUC 2F3WA 1IL8A 2WINB 2EJGC 1RODA 2G9HD 5DM73 1PTOD 3CU7A 2X69A 2EJFC 1GJXA 1GHKA 5J39A 1SNPA 4A3BB 1LTID 1LT3D 4QUCA 3MVVA 4GZYC 5EKLA 1ZYRD 1EY7A 2KJXA 1HA5A 1V1PB 5J22A 4IUVA 1D1KA 3NBHA 4R8NA 1E0BA 2D2CC 3RLFA 4C3HB 3P75A 3VR3A 1KTKA 1JICA 1TR5A 4OGQC 4KKTA 5M5YB 1D5ZC 4NDXA 1FNWA 1IW7C 1NR2A 2BDNA 2IPKD 2E76C 4DNTB 5KRUA 3A8IE 3IL8A 2MP1A 3S1NB 1ENCA 1SMYD 3JAML 1TS2A 5FOBB 2NTSA 1EL0A 1JCKB 1JE4A 3SK4A 3T56B 2PZUA 4H7BA 1EU4A 3VA5A 4I7ZC 1G6ZA 2ICIA 1H9KA 3H09A 3HRZC 1JB3A 4ULLA 2G9DA 1RTOA 1SNMA 1OXVA 4JK1C 5IT9L 2K7VA 2Z1CA 1V8QA 1AFPA 1V43A 5K36H 3SR1A 5KYLA 4N9PA 1EQVA 4FP5D 1II3A 1CK1A 3K5OA 3H91A 5FKAC 3G7LA 1BBXC 3E6ZX 2EPBA 5CV7A 5FLXL 4C3JG 1DXMA 1DCZA 1ZXTA 4IUNA 3SK8A 3FEWX 3M3YB 4DK1A 1CHPD 1PFBA 2EOTA 5M3MB 1DD2A 4NP5A 1B1ZA 4G7OC 4KHZA 2CVRA 2I46A 4QIWB 1KDBA 5ELEA 1LT6D 3SHLA 2QKIC 3BDOA 4FXDA 4KK7A 5EKKA 1GOZA 3DEOA 1STAA 2KA7A 1G91A 1SNOA 3MTSA 4HAEA 1ESRA 2JYOA 2JA6B 1O80A 1JWSD 2SEBD 3H0GB 1T5XD 2EY2A 4FF3A 1PZKD 2R61A 4Y7NB 3GTGB 2J7ZA 4IUUA 3FRPB 4OO1G 4BBRB 1STEA 4G7HC 5CORA 5D3IB 1J9OA 1B4OA 2Q8IB 3X3NA 1EWCA 3VR4A 1H9MA 3BG3A 1A3UA 4XIGS 2FHTA 2F0TA 4KJOA 1D5MC 3T51B 1XTCD 5JOBA 1RKNA 1X32A 3QO2A 4KY7A 1HCZA 2EYHA 4KD3A 2KUMA 3OMGA 2O5JC 4PNYA 2EYJA 5CYUA 1F2ZA 1SXTA 3HEJA 4L6TB 5KNCA 5KYIA 3RZDB 2E74C 4IZ8A 3MWYW 3NE5B 3J7YW 2IW3A 4X3TA 1KNAA 2M00A 2F0HA 3A8JE 4RCOA 2B2UC 3RD4A 1ENFA 1X3PA 2R6GA 1EEFD 3I72A 3QOJA 5DNFA 2Q8TA 2EYPA 1E2VA 4F88A 4C2MB 4DXFA 5ELBA 3GTMB 2WACA 1CTMA 2R93B 2A5HA 4ZKCB 1KDAA 3S1MB 3H94A 4C56C 1QG7A 5IIFA 1PTOF 2F0EA 1EEID 4B9XA 5A2QL 4FF1A 3S1RB 4KHVA 1E2WA 1LTBD 2A74C 1U4LA 2QDBA 2AQ2B 3KF8A 4X3SA 1WTXA 1EYCA 3G6JB 1CA6A 1FR3A 4C3IG 1CFMA 5M3FB 3TZUA 3GV6A 1NCVA 2F0IA 1HPCA 2B8GA 3U9OA 2L11A 4DF7A 5I4DA 2JA8B 3EA6A 2WKCA 2MUYA 3WDNA 3MEHA 1SSOA 5AFWA 4OIJA 1CI3M 1M4VA 2EYOA 1S5FD 3FVQA 5CV5A 4K8JA 5C5MA 1ONLA 4IFDI 2QILA 1EIGA 4KI0A 1PFNA 2DNCA 3QJYA 3VYUA 4FNFA 3QWNA 1VDZA 1CT1D 1GXDC 3P20A 3PUZA 1W6KA 3S1QB 3NK9A 2HCCA 4LMQD 4WORA 4BS9A 3MXNA 1Z47A 3PV0A 1LO5D 3EVQA 3NTIA 5CC4A 1W6JA 3EFXD 4RGMA 1DOMA 3BYYB 5EGTA 1FNVA 1TS4A 4QF4A 1PYWD 2F0DA 3RMHA 4MN3A 1HFNA 1SAPA 4C3JB 3MXPA 2J0TD 5C0XH 2N88A 1TWHB 3AB9A 1Q90A 3W2DA 3SVMA 2KOLA 4R8IA 1BNZA 1S5ED 3MA2B 3DMUA 3HGBA 3W3AA 3HOXB 1I4RA 2FFKB 2FJ2A 1CZWA 3QG1A 1IYUA 2SDFA 1SE4A 4FVMA 1RTNA 4HCSA 5DEHA 2A73B 2KEDA 5T1IA 2K32A 3QB3A 4ABNA 2RQXA 1JR0D 2ZT9C 3J81E 4B08A 3I90A 2K03A 4TKOB 1EZ6A 4XTCS 1R9TB 5JEAH 5KIXA 3I91A 4DFAA 3OWFA 4ZQ3A 3V96A 4IUTA 3DWAA 2KCCA 2NN6G 1QCBD 1EZ8A 1H9RA 1UNSA 5M5XB 3PO3B 4QB4A 1BQQT 3DWQA 3E5SA 3CHBD 4KN7C 1S5CD 5K36G 1KABA 5JEAJ 1MGSA 1QJOA 1BR9A 1QILA 4Q0FA 4DN4M 1FD7D 1O78A 2OEOA 4HMJA 2LFNA 4FF2A 4A3DB 4EGVA 1YNJC 3CQZB 2NBFA 3ITPA 3HOWB 1XX8A 1SE2A 3GP7A 1FNUA 5C4JB 1M8AA 2PW7A 3P7JA 3X3MA 4LJZC 1IKLA 4UDUC 3C46A 2JA7B 4MIUA 3BYTB 4QMGA 1I6VC 1KLUD 2LY7A 4K5XA 1CA5A 3VYTA 2D62A 4PV1C 4A93B 5FO7B 4DGZA 4J8QA 2IX0A 4K2KA 1DZ1A 1ZYRC 2ID0A 4ILWA 5CMDA 1A15A 2K5QA 2A68D 3LX0A 1UAPA 1SYDA 2MHVA 3T53B 5LL6S 4NKLA 2DNEA 3NWSA 3MFYA 3CRKC 4KJNA 4C3IB 2NZ1D 2WP8J 1DJRD 2JEAI 2YU9B 1EY0A 4K5VA 3LWEA 2F0PA 1UUPA 4FF4A 3EQLC 5F2DA 3NTHA 1I4PA 3M7NA 2BE5D 2C5CA 1IHZA 5C44B 1MI2A 4MHEA 5A35A 1AZPA 4LK1C 2B2TA 4DXGA 5COYA 2BA1A 3H6MA 2A6ED 3V05A 2EVBA 3LWUA 3J7AV 3R2IA 3HG9A 4HEDA 3A8KE 1U4MA 1HUMA 1HQRD 2PNRC 3U9SA 4UAIA 5IGDA 2AWOA 1B9MA 1BUVT 2EE1A 2ENBA 3D6CA 1TT2A 4A3IB 2CW0C 1PRTB 2IJ0A 1U9RA 2L12A 3BDLA 3R2TA 2XIWA 4IQZA 4IURA 4CKCA 3QOLA 1A2TA 1A6XA 3BZDB 3S9WA 4TRDA 3S14B 4A3JB 4CGYB 4PMBA 1EY6A 3T13A 1Y69U 1Y8NB 4U673 3OSOA 3R8BA 3DWPA 3DM1A 3HP3A 4RCNA 3OW7A 4F7XA 3L3OC 5TSSA 1WTOA 2A69D 2XWJB 3Q0AA 4QUFA 1HTLD 4WJWA 2EJMA 2N55A 5EKIA 1BCPF 1SYBA 1LT4D 3PO2B 2K33A 1ILQA 4TSSA 4B9WA 5LHY1 1BOSA 4A3FB 3EROA 3K5MA 3DXJC 5ISRA 2PMZB 4ZYSA 2F1MA 3GTQB 4X3UA 1G2TA 1JWUD 1Q1EA 1EY5A 3OPOA 2HDLA 1NAPA 1SFOB 4KY5A 2F4IA 5EBDA 3KBGA 1HRJA 1B44D 1SNCA 2H4OA 3J7AF 2NB0A 2QCPX 1EY4A 3DHQA 1PRTC 3RZOB 1JOOA 3TBIB 3M4OB 3C1EA 2CHBD 4F87A 1TS5A 1PZJD 4RFBA 3OIQA 3SEBA 4XT1B 3IKJA 1AEXA 4ZAIA 3FMCA 4S3SA 2EYFA 2QEJC 3E0JA 4N9TA 1TY0A 5JPMC 4RWSC 3IFDA 3JAME 2BDOA 2RDFA 1X3QA 1F2MA 2K04A 1I50B 2MGSA 2KEEA 2OT2A 5CBAE 2NVYB 1WTRA 2PO4A 3MXUA 1R4QB 1U4RA 3GO5A 2KECA 3L7ZC 3FPPA 3PIP3 5IT9E 5M9OA 4EQNA 2NN6I 5JEAG 1KLGD 1OXTA 1DM0B 4HCEA 4K2LA 1Y8OB 1B2TA 4J6HA 4ZKBB 3VR2A 2CQAA 2E2HB 1EY8A 2XWBB 4IFDH 2PW5A 5FLXE 2KQ3A 3I70A 1SDFA 3VR5A 1CQVA 4R9WA 5C4ZA 3HOVB 1IYVA 2BOSA 5I6WA 2HDMA 3C1FA 3GTKB 4OL7A 3S2DB 1RCVD 3MZ5A 1Q1BA 3HKZB 5EBCA 1LTGD 4IN3A 2F0MA 2F0WA 3WOEA 1YNND 1EFID 2B2TC 1RJTA 1LT5D 5C6AA 3MFGA 5KNDA 2JA5B 2AWNA 1I4HA 3MC0B 1C48A 2A6HD 4KD4A 4KY6A 3IFTA 5CV8A 2L4NA 1PMRA 3T16A 3PMFA 3NXWA 3PUWA 1S5DD 2XVSA 1ML0D 1TWAB 1CZGA 2NVTB 5EPLA 1JOQA 1VMCA 4DU9A 4NMZA 4K14A 1RF2D 1TKWB 2E75C 4DAPA 3HZXA 4BWGB 4CBVA 4ODGA 4J1MA 4DAVA 1ZKOA 4EQOA 3J80L 5G3LD 2K6AA 2OF1A 1AW7A 3BVGA 1XYIA 2F0VA 3TP8A 4K5WA 1ET9A 1O7ZA 4WFN3 5C5LA 1F9PA 3FDTA 1STBA 4A3EB 4HSPA 1Y1WB 1F77A 4RH6A 1FYCA 4EQPA 1K83B 4XQNA 1C8CA 3HOZB 2K1BA 4G57A 5CV4A 2F0SA 2Y0SB 5IGEA 1NUCA 1F9QA 1D5XC 1TVXA 3K57A 2F3VA 3CRLC 3D6WA 2LS01 1WD1A 4RHSA 1SNQA 5A2QE 1Y8PB 2X6LA 4RA8A 3F2UA 3ONAB 1HHVA 5I9PA 2D9UA 2PQEA 2XN9C 2Z8LA 2F03A 2K5DA 1TQOA 3HS0C 1H9JA 3I4LA 2ZXRA 3TP6A 1G8ZD 1BCPD 2M9VA 2NYZD 1JQYD 2BA0A 3SK6A 2RBMA 5CGKA 4M8AA 3S16B 4ZUJA 2JEBI 3R3OA 1PTOB 3BDCA 1LTTD 2K05A 5ELFA 1TY2A 3PUXA 3A55A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KCC A;  5KNC A;  1GUT A;  3A7L A;  3GD7 A;  4BA1 I;  1H9S A;  2E74 C;  2PCF B;  3EQL C;  2K33 A;  4GZY C;  1G29 1;  2NN6 G;  3MXU A;  3NE5 B;  2AUK A;  3M7N A;  3L7Z C;  1VDZ A;  1H9R A;  2BE5 D;  3FPP A;  2IT1 A;  1DXM A;  3A8J E;  3A7A B;  2E75 C;  1TKW B;  3P20 A;  2R6G A;  4KKS A;  1DCZ A;  1HTP A;  3I72 A;  1GHJ A;  3PUZ A;  1B9N A;  5JEA G;  2NN6 I;  1OXT A;  1K8O A;  1GHK A;  4KN7 C;  1ZKO A;  3ND9 A;  1E2V A;  5A35 A;  3VA7 A;  5K36 G;  4LK1 C;  2JXM B;  2YYZ A;  3DXJ C;  2BA1 A;  1QJO A;  4DK1 A;  1BDO A;  1Y8O B;  1GUN A;  1Z6H A;  1GUS A;  2F1M A;  3PV0 A;  1CTM A;  2QF7 A;  2D2C C;  1O78 A;  3RLF A;  5BN5 A;  2A6E D;  1GUO A;  1DD2 A;  2B8F A;  2DNC A;  3H94 A;  3VR3 A;  1VF7 A;  1Q1E A;  2EVB A;  4DNR B;  3LWU A;  3VR2 A;  4G7O C;  2DN8 A;  4KHZ A;  1YNJ C;  1VCI A;  3OPO A;  5KNB A;  3A8K E;  1YNN C;  4H44 C;  4IFD H;  4OGQ C;  4KKT A;  4OO1 H;  1Q12 A;  2PNR C;  1Z7T A;  3U9S A;  2AWO A;  1B9M A;  1IW7 C;  1T5E A;  3BDO A;  2E76 C;  4DNT B;  1SMY C;  2A6H C;  3A8I E;  4HR7 B;  3VR5 A;  5C0X H;  4G7Z C;  1E2W A;  3AB9 A;  1FYC A;  1Q90 A;  2CW0 C;  2KA7 A;  1IYV A;  2PPB C;  2LMC B;  3PUY A;  3PUV A;  2NN6 H;  1LAB A;  4H0L C;  4LJZ C;  3M85 A;  2JE6 I;  2V4D A;  3I73 A;  4H13 C;  4IQZ A;  1FR3 A;  1OXX K;  1A6X A;  1Q1B A;  5BN3 A;  1CFM A;  4L8J A;  1I6V C;  2D5D A;  3OOC A;  3TZU A;  4KKU A;  3T56 B;  3HGB A;  3D4R A;  3M4Y A;  3W3A A;  1K8M A;  4OO1 G;  2D62 A;  4PV1 C;  1OXS C;  3CRL C;  2AUJ D;  3SE0 A;  3KLR A;  3LNN A;  1HPC A;  3D31 A;  2B8G A;  1Y69 U;  3IKJ A;  1LAC A;  1Y8N B;  3QG1 A;  1IYU A;  3VR6 A;  2O5I C;  1Y8P B;  1E2Z A;  4G7H C;  5KND A;  4BA2 I;  4I7Z C;  2K32 A;  2L5T A;  3FMC A;  2A68 C;  1ZYR C;  1IW7 D;  3ND8 A;  2EDG A;  2Q8I B;  2A6H D;  3SDZ A;  1O7L A;  1HQM C;  3OW7 A;  4RCN A;  2BE5 C;  3VR4 A;  1H9K A;  1H9J A;  1H9M A;  3BG3 A;  3IFT A;  2BDO A;  2A68 D;  4JBW A;  4TQU S;  1H9S B;  4XIG S;  2ZT9 C;  1OXU A;  3WDN A;  3I4L A;  1GUG A;  3T51 B;  1PMR A;  2A69 C;  4KN4 C;  1OXV A;  3T53 B;  3PUW A;  4DK0 A;  4JK1 C;  3GQB A;  1CI3 M;  4TKO B;  2K7V A;  4XTC S;  4IFD G;  2BA0 A;  2DNE A;  4KMU C;  5JEA H;  3MFY A;  1EWH A;  1HCZ A;  1VF5 C;  2A69 D;  3CRK C;  1V8Q A;  3N6R A;  1V43 A;  2EJG C;  5K36 H;  2JEB I;  2O5J C;  2A6E C;  2JEA I;  1ONL A;  3QIA A;  5C0X G;  2EJF C;  1GJX A;  2EJM A;  3PUX A;  5BN4 A;  4KI0 A;  1TU2 B;  3QJY A; 
#chains in the Genus database with same CATH topology
 1G2S A;  1XWE A;  5C0X J;  2LXK A;  1H9S A;  1C4Q A;  1D2B A;  1YIJ A;  4DR1 Q;  3ZYY X;  3Q6S A;  4I65 A;  4OON A;  2GA4 B;  4RGN A;  4LF7 L;  1HUN A;  2IT1 A;  4P72 A;  3AFQ A;  3T1Y L;  2VB2 X;  2NTT A;  2B2V A;  3S15 B;  5J1Z A;  1IKM A;  1EYA A;  2TSS A;  5M5W H;  3V2T A;  2JXM B;  1ENA A;  1EQT A;  3P1H A;  2ZXP A;  4V0B A;  3C3L A;  2QF7 A;  1SE8 A;  5BN5 A;  3D4W A;  1TWF B;  2B8F A;  4KV6 A;  5IGG A;  5EJW A;  1WTV A;  3EIV A;  2FIN B;  3SXH A;  1PH8 A;  5LMU L;  2MO0 A;  1B50 A;  3MXG A;  3W1B A;  2UU9 L;  4YCU A;  4FXG C;  1YBY A;  1PLF A;  3I56 A;  1WVL A;  1Z7T A;  4GNX B;  5CV9 A;  3K5L A;  4MNO A;  2HIX A;  1T5E A;  4CHT B;  4OHJ A;  3KLS X;  4A3D H;  4Z9C B;  2VB3 X;  2ZXO A;  2FMM A;  3CQZ H;  3N52 A;  2JE6 I;  3I73 A;  4LFC Q;  3NTK A;  3HOW H;  3S2H H;  2UXD Q;  4ME5 A;  4LF9 Q;  2RHS B;  3D4R A;  3M4Y A;  5D14 A;  1QNK A;  3UE1 A;  3MHB A;  3KLR A;  1T9H A;  2TMP A;  1NBW A;  2WAQ B;  4HMI A;  4JOI C;  1L0X B;  3Q22 A;  4FYD A;  2NVX B;  5HGQ A;  3PIP A;  5J3B A;  3SDZ A;  2BE5 C;  5IP9 H;  2KCN A;  4JBW A;  4A93 H;  2L0C A;  2EXZ A;  2XNA C;  4A3K G;  3I4N G;  4GS3 A;  4JI3 L;  2L15 A;  1HR0 Q;  4JV5 L;  1EWH A;  1PTO C;  4X66 Q;  1I94 Q;  5DM6 3;  1F2L A;  2A6E C;  1JJG A;  1SND A;  3K0Y A;  5IGB A;  1IBM Q;  3H0G G;  1UE7 A;  1WTP A;  4OO1 I;  1GUT A;  4A3G B;  3TEH B;  2PQA B;  3GTL B;  4DK3 C;  2WKD A;  1HR0 W;  1NR4 A;  2OCE A;  3CCJ A;  4H02 A;  2YTY A;  4QCL A;  3K6O A;  1VQ8 A;  4A3L G;  4KKS A;  4DR3 Q;  4HIK A;  1Z9F A;  3B6Y A;  4ME3 A;  1S3O A;  2PZW A;  1YHB A;  3E9H A;  4J15 A;  1Y1V H;  4PZ7 A;  1VF7 A;  1PDQ A;  4DNR B;  2A8V A;  4DUZ Q;  1XMQ L;  5C44 H;  1QNU A;  4GNX C;  3KF6 A;  1YNJ D;  3K59 A;  4AYB E;  2RDG A;  1J5E L;  2XRS D;  4A3B H;  2Q8R E;  1SMY C;  3OMC A;  1AP0 A;  2KVM A;  1W3S A;  5GAH C;  4DV5 L;  3JAM i;  1A3V A;  1UE5 A;  4ZK9 B;  1CHQ D;  4O42 A;  2VUM G;  1LAB A;  1JB7 A;  5CV6 A;  4H13 C;  2B63 G;  3I3C A;  1YIT A;  1HNX L;  2SNM A;  2R7Z G;  2RDH A;  5I2Y A;  5BN3 A;  2F0O A;  4DAY A;  3D8G A;  5G3L F;  3ER0 A;  4LFA Q;  5C3E B;  2AHO B;  4DUY Q;  3SE0 A;  4LWC A;  4BBS B;  2R93 G;  4OX9 Q;  3L2P A;  3URY A;  5HUR A;  2O5I C;  4B3S L;  5IGF A;  5IYB G;  2K14 A;  1I6H B;  3RNU A;  4CJ1 B;  4F8M A;  5IOC A;  3D4D A;  4RGO S;  4JBK A;  4OWW B;  3S14 H;  4DV0 L;  2Z4I A;  5IGC A;  4A3J H;  3VYR A;  3I4M B;  3NPP A;  4PQX A;  1WI5 A;  3HOY G;  4A76 A;  4RAU C;  2VNU D;  2O2L D;  2IWH A;  2O4X A;  1FGB D;  3CKI B;  2R7D A;  3VDY A;  1AE2 A;  3CW2 C;  1KDC A;  1O7Y A;  1IZ6 A;  3CPF A;  2PYK A;  1JWM D;  2B2Y A;  3A7L A;  3OWE B;  3CCS A;  3KLW A;  2F0U A;  1A0I A;  1C9O A;  1WTH A;  1N32 Q;  4A3M B;  4E6I A;  3NQT A;  2IX1 A;  2YTX A;  4G4K A;  2KHS A;  1E3P A;  2LSS A;  1ICW A;  4M1U B;  4GKJ Q;  5I9O A;  4AYB B;  1HNX Q;  2JA8 G;  1PH3 A;  3OIP A;  1IXR A;  2F0N A;  1GUS A;  2F0J A;  1CM9 A;  1Q3L A;  1LTR D;  5LMN Q;  4YIJ A;  2MPM A;  3FHW A;  5ELD A;  1HNW L;  4QIW E;  3DEP A;  1HA6 A;  4BY7 B;  5K5P A;  5ELO A;  3TDQ A;  1MD2 D;  3VYS A;  5GAG C;  2EY1 A;  2Q2I A;  3NBI A;  4ZRZ A;  1PV4 A;  3DUZ A;  4DV3 L;  3RUZ A;  2AKW B;  1AH9 A;  3K7A B;  1I4G A;  2XSC A;  3PIO 3;  4HR7 B;  1PYB A;  3M9B A;  3OHX C;  3D3R A;  3GTJ B;  1EY9 A;  1KRT A;  3CF5 A;  4EX5 A;  4C1N K;  1AN8 A;  2NN6 H;  2CW0 D;  2V4D A;  3KJO A;  3KLS A;  3G48 A;  1MSH A;  3EJI A;  1KAA A;  4HSV A;  2ZM6 L;  4WJ3 M;  2WII B;  2B2W A;  2D5D A;  3UDX A;  4EVO A;  2J4X A;  3M3Y H;  1LV9 A;  1PFM A;  1QE6 A;  2PNH A;  1WTQ A;  2B2V C;  2F0G A;  2AUJ D;  2D0P A;  3LNN A;  5M3M H;  3D31 A;  3M4O H;  3H3V C;  1XNQ L;  3VR6 A;  4AH6 A;  2EYL A;  2K5V A;  3NWT A;  5IE8 A;  1V9P A;  1IW7 D;  2OQ0 A;  3BU2 A;  2EDG A;  3K5N A;  1PZI D;  1TWC B;  1HQM C;  1K0R A;  1RHP A;  3FKI G;  2UUA L;  2EQS A;  3F2B A;  4K6D A;  1NY4 A;  1EWI A;  3TSS A;  1RD9 D;  1LYL A;  5DAU A;  3HOU B;  3KF6 B;  4X3K A;  3KDF A;  3CCE A;  4GLV B;  1ET6 A;  1NJI C;  1TWG B;  2EZV A;  4KTA A;  2JA6 H;  3R93 A;  5C0X G;  1N34 Q;  4K0K Q;  1SYG A;  5BN4 A;  1S72 A;  1J6Q A;  4XYQ A;  3A56 A;  1G6P A;  3GTG H;  1EYD A;  2PCF B;  1SYE A;  4PMC A;  4RHR A;  5FO9 B;  4U68 A;  1L1O A;  2AUK A;  2K50 A;  3QR8 A;  1BO0 A;  1I50 H;  4BBR H;  4DR7 Q;  3U4V A;  3TZD A;  4X65 L;  4DAY B;  1R4P B;  4NXM Q;  1OO9 B;  1GHJ A;  1B9N A;  1A2U A;  3AU7 A;  4PMW A;  3TP5 A;  4JI4 L;  4A3K B;  5IYD G;  3K58 A;  2NVY H;  3I4N B;  1MIU A;  4KLK A;  2EY5 A;  4HJ7 A;  5C4H A;  1UEA B;  1VQ6 A;  4N8F A;  2JSO A;  3WWV A;  1SJE D;  4XYO A;  3IAY A;  1STY A;  3J7A 5;  1D6E C;  1SYC A;  3NSW A;  4DV2 Q;  1VQA A;  4XQJ A;  1A3T A;  5IP7 H;  2OWO A;  1Q8I A;  1YNN C;  1AE3 A;  5T1G A;  3NP8 A;  4X64 L;  2M2L A;  1KIX A;  4IO9 A;  5E4X A;  1MJC A;  2HQE A;  1VQG A;  2A6H C;  2L55 A;  1JC7 A;  5C4X G;  3KUP A;  4LW1 A;  4POF A;  4IUP A;  4K6L A;  3PUY A;  2HD3 A;  1K3R A;  1PRT D;  3MEF A;  1STN A;  3M85 A;  3CC4 A;  1PXU A;  4XT3 B;  1BCP B;  3NEN A;  2F3I A;  5ELC A;  4L8J A;  1VQ5 A;  2I07 B;  4CKB A;  4KKU A;  4DV7 Q;  2E2J B;  2F0K A;  3GTM H;  1OXS C;  2ZTC A;  4HN7 A;  3GTK H;  4A3D G;  2KCM A;  3S2D H;  2WV6 D;  1X56 A;  4RG1 A;  2PI2 A;  3CCL A;  3AMU A;  1K8G A;  3SK5 A;  2RSN A;  4OIK A;  4TQU S;  1OXU A;  4DAM A;  1KXL A;  1GUG A;  3FPU B;  4YY3 L;  1FL0 A;  1SYF A;  2HCI A;  2VUM B;  2F0L A;  2F4V Q;  4LFB L;  2B63 B;  2R92 G;  3GQB A;  2Q2U A;  2QW7 A;  2R7Z B;  3KOJ A;  1VF5 C;  2JA5 H;  3N6R A;  4IFD J;  2K5W A;  2HUG A;  2VQE L;  3MAQ A;  3QIA A;  5I6Y A;  4QQB X;  1CQF A;  1TU2 B;  2E2D C;  5JAV A;  3NHH A;  5M3F H;  4LNQ A;  2HHH L;  5LL6 X;  4A93 G;  3I8Z A;  5AJ3 Q;  2OTL A;  4V19 0;  4DKA C;  3A7A B;  3BZC A;  2VL6 A;  1YJ9 A;  1TWA H;  2UXB Q;  3HOY B;  1B3Q A;  1I3Q B;  1MSG A;  4HTH A;  4CDF C;  3G6E A;  4DNI A;  1XJV A;  1XMO Q;  1ILP A;  5JPN C;  1DOL A;  1MBY A;  4JI6 L;  1VQ9 A;  2XRQ D;  5JVG 3;  4JYA L;  3ULP A;  5GAD C;  1VCI A;  1GUW A;  4H44 C;  5E3F A;  1N33 L;  4O2D A;  2X6G A;  4WRD A;  3GTO B;  3C2P A;  3KDF B;  5E4W C;  2FMC A;  2ZJQ A;  2RA4 A;  3Q8D A;  3BVM A;  2NUC A;  1HXY D;  4G7Z C;  2RSO A;  3AEV A;  1EIH A;  1F9R A;  4GKK L;  1PH7 A;  3O13 A;  2B2Y C;  2ICE C;  1STG A;  1JOK A;  3NUC A;  1BCP C;  1L0Y B;  1Y1V G;  3KK7 A;  3J81 L;  1EYG A;  4DA2 A;  4XDX A;  3ERQ A;  1L1O B;  2ZTE A;  5C44 G;  1KNE A;  4A3E H;  4ZUI A;  1Y1W H;  2A1A A;  3J7Z C;  1SRU A;  3Q23 A;  3L9A X;  2MJ8 A;  1K83 H;  1K8M A;  4RKB A;  4DR4 Q;  5JVH 3;  1PH2 A;  4CKE A;  4A3B G;  1LAC A;  1VMP A;  4NW2 A;  4DR1 L;  2K4K A;  1U5K A;  3F2C A;  5FK9 C;  5HGT A;  1LLR D;  2NWG A;  1V1Q A;  2F0Q A;  4BXX H;  2QGQ A;  1P8L A;  1I4Q A;  1K0S A;  3BS1 A;  3S17 B;  2B3G A;  3KBX A;  4HJA A;  2EIF A;  2NVQ B;  3GTP B;  4IJH A;  1BBW A;  4MTN A;  1KC8 C;  3CCQ A;  1EQR A;  2H1E A;  3SGI A;  4FXK C;  4DPG A;  5IWA Q;  1UE6 A;  4C3H G;  1HFG A;  1VQF A;  4CDE C;  1BXT A;  4LF8 Q;  4C1N I;  5NUC A;  2CFM A;  4JPB W;  1LTA D;  1X3E A;  3GD7 A;  4ID6 A;  4JI8 Q;  2B39 A;  3HOX H;  1G29 1;  1S4Z A;  4A3J G;  3S16 H;  2B2W C;  2PZT A;  3BVZ A;  3CCV A;  2CWP A;  3RN5 A;  1YHQ A;  2BH2 A;  1PTO H;  1A63 A;  3FKI B;  2R3Z A;  4FO2 A;  3UI2 A;  1WTW A;  1DYQ A;  1HTP A;  4LAA A;  4JI2 Q;  2EXD A;  1BF4 A;  4CJ0 B;  1STH A;  1K8O A;  4DR5 Q;  3CCR A;  4LFC L;  3VA7 A;  2UXD L;  5FO8 B;  1Z6H A;  1WCM B;  2AQ3 B;  4LF9 L;  1QOH A;  3TN2 A;  1R9T H;  2DN8 A;  2IL8 A;  4HID A;  1SBB B;  5FLM H;  2GN5 A;  4OO1 H;  1X9N A;  2E2I B;  4O1N A;  1TWF H;  4JI5 Q;  2BCO A;  2AQ1 B;  1DOK A;  3E0E A;  1SEB D;  4YHH Q;  3J80 E;  4NPS A;  3Q24 A;  2LMC B;  4XQQ A;  1EUJ A;  2IX3 A;  4H0L C;  1UEB A;  1L1O C;  1HR0 L;  5M5X H;  1JMC A;  4X66 L;  2JK8 A;  1PFS A;  3PO3 H;  1K28 A;  1I94 L;  1J8I A;  5C3X A;  1OXX K;  2IY5 B;  3W1G A;  2Z4H A;  4R4O A;  3A54 A;  1IBM L;  2JP1 A;  3OOC A;  5KGU A;  1EFW A;  3HFZ B;  1V1P A;  2LXJ A;  1C0A A;  1JOR A;  3RLN A;  5D65 A;  4GN5 A;  4IPH A;  1E2Z A;  5CBE E;  1VQK A;  2CWA A;  2L5T A;  1SE3 A;  2A68 C;  4UP7 A;  2K01 A;  1I5F A;  1B53 A;  4K8I A;  5C4X B;  4JC0 A;  1O7L A;  4DR3 L;  5M5W B;  1VQH A;  5CR3 A;  3NQI A;  1LTS D;  1TS3 A;  2WB1 B;  3TP7 A;  1Q8K A;  1F2Y A;  4ZCK A;  2HT1 A;  2NVX H;  1N9W A;  5C4J H;  2SNS A;  1PRT F;  1B70 B;  5M3M G;  4DUZ L;  2LKV A;  4P2C B;  2L9H A;  3GV3 A;  1WD0 A;  3T1H Q;  2JA7 H;  2C9O A;  5JJZ A;  2I5M X;  2UUC Q;  2RVL A;  1QB5 D;  3WOF A;  5D3D A;  5EPK A;  1I4X A;  4BA1 I;  1JE5 A;  1ZEQ X;  2OXP A;  3TME A;  5C0X I;  2RKS A;  5C3W A;  1NMG A;  5EQ0 A;  1DON A;  2VXW A;  2L1B A;  3K81 C;  5I2X A;  2EY6 A;  3S2H B;  4A3G H;  3GDE A;  1RDP D;  2I5H A;  4JI0 Q;  1F9S A;  3ND9 A;  4RGT A;  2WFW A;  2R92 B;  1N8R C;  3K0X A;  1S5B D;  2YYZ A;  1XPO A;  4IAL A;  1BDO A;  2JA6 G;  1GUN A;  1H95 A;  4LFA L;  1GUO A;  4RKL A;  5IY0 A;  4DUY L;  3UDF A;  4OX9 L;  4C3I H;  1AZQ A;  1TII D;  1EIF A;  2CH4 A;  5KNB A;  2QA4 A;  4L63 B;  2K28 A;  4BBR G;  3CC7 A;  3PSI A;  1S40 A;  1EOT A;  1SJH D;  3T4A C;  4XXE A;  3L0O A;  2YU9 H;  1Q12 A;  3BZK A;  1U4P A;  4R4I A;  1PH6 A;  5E1F A;  2EYM A;  1V1O A;  4Q5V A;  3K8A A;  4UP8 A;  5KEE A;  2GVA A;  2DY7 A;  2PPB C;  3M7G A;  3A5Z B;  4DV4 Q;  3PUV A;  4ZLT F;  1QWY A;  4OWT B;  2SOB A;  1SN8 A;  5IP7 G;  3K7U C;  5IOD A;  1L2F A;  5EPJ A;  2B2U A;  4IUQ A;  1ESF A;  1PH9 A;  1NSN S;  4L5Q A;  2Z9H A;  1EU3 A;  1N32 L;  2K52 A;  2DY8 A;  3J81 j;  2JJQ A;  4BA2 I;  4WJ4 A;  1CUK A;  4CJ2 C;  1JT8 A;  2MQH A;  3ND8 A;  2F0F A;  3ERS X;  4GKJ L;  1XXG A;  5C3E H;  1D1I A;  4R4Q A;  1H9S B;  1B3A A;  3J80 c;  2A69 C;  4QJF A;  2CQO A;  4KN4 C;  4BY1 B;  1Y1V B;  4DK0 A;  5BR8 Q;  4A3I H;  5LMN L;  4IFD G;  4KMU C;  2F3W A;  1IL8 A;  2WIN B;  2EJG C;  1ROD A;  2G9H D;  1EQQ A;  3U50 C;  5DM7 3;  1PTO D;  3I4M H;  3CU7 A;  2X69 A;  2EJF C;  1GJX A;  3D0F A;  1GHK A;  5J39 A;  1SNP A;  4A3B B;  1LTI D;  1LT3 D;  5HY6 A;  4QUC A;  1X55 A;  3MVV A;  3HKZ G;  4GZY C;  1Y14 B;  4P75 A;  5EKL A;  1ZYR D;  4A3C G;  1EY7 A;  4YCV A;  2KJX A;  1RL2 A;  1HA5 A;  2PMZ E;  2JA5 G;  1Q7Y C;  1HJP A;  1V1P B;  5J22 A;  3AFP A;  1WFQ A;  4IUV A;  1D1K A;  3NBH A;  3F2D A;  4R8N A;  1E0B A;  2D2C C;  3RLF A;  1B8A A;  1KRS A;  4C3H B;  3P75 A;  1BVS A;  3VR3 A;  5M3F G;  2KHJ A;  3EBE A;  1KTK A;  1JIC A;  3I55 A;  1TR5 A;  2Z0S A;  1FVI A;  4OGQ C;  4KKT A;  5M5Y B;  1PH1 A;  1D5Z C;  4NDX A;  1FNW A;  1IW7 C;  1NR2 A;  2BDN A;  2IPK D;  3PO2 H;  2E76 C;  5ELN A;  4DNT B;  3A8I E;  3IL8 A;  5KRU A;  3H15 A;  4CDC C;  2MP1 A;  3S1N B;  1ENC A;  1SMY D;  3JAM L;  1TS2 A;  2IHF A;  4UPA A;  1TXY A;  4R1J A;  3CPW A;  1YNX A;  3FP9 A;  2C35 B;  5FOB B;  2NTS A;  3HKS A;  1OTC A;  4A3F H;  4GLA C;  1EL0 A;  1SMX A;  1JCK B;  1JE4 A;  1N34 L;  3SK4 A;  4K0K L;  1D7Q A;  3T56 B;  3TS2 A;  1GO3 E;  3GTJ H;  2PZU A;  4H7B A;  3GTQ H;  2ALY B;  5LMN W;  1EU4 A;  3VA5 A;  4DR7 L;  4I7Z C;  1G6Z A;  2ICI A;  3H3V I;  4NXM L;  1VQB A;  1SFO H;  1H9K A;  3H09 A;  4LF4 Q;  3HRZ C;  1JB3 A;  4ULL A;  2G9D A;  1RTO A;  4A3E G;  1SNM A;  1OXV A;  4JK1 C;  5IT9 L;  2K7V A;  2Z1C A;  3RZO H;  1N36 Q;  1C7Y A;  4PZ6 A;  1NE3 A;  1V8Q A;  1AFP A;  1V43 A;  1TWC H;  4DV2 L;  5K36 H;  3SR1 A;  5KYL A;  4N9P A;  1EQV A;  2Y0S G;  4FP5 D;  3NEL A;  1II3 A;  3HOU H;  1X3F A;  4JI1 Q;  1CK1 A;  3K5O A;  4BXX G;  3H91 A;  5FKA C;  3G7L A;  1BBX C;  1VQC A;  2EPB A;  3E6Z X;  5CV7 A;  5FLX L;  1TWG H;  4C3J G;  1DXM A;  1DCZ A;  1ZXT A;  1SRO A;  2H5X A;  1KHI A;  1PH5 A;  4IUN A;  1XPR A;  2VY3 A;  3SK8 A;  3FEW X;  3M3Y B;  4DK1 A;  3KJP A;  4NXN Q;  1CHP D;  1MHW C;  3UE0 A;  1PFB A;  2EOT A;  5M3M B;  4DV7 L;  5IYC G;  1DD2 A;  4NP5 A;  1B1Z A;  4G7O C;  2JN4 A;  4KHZ A;  3ZJY C;  3HOX G;  3I4N H;  2CVR A;  2I46 A;  4QIW B;  2YTV A;  1KDB A;  5ELE A;  1LT6 D;  1Q46 A;  3BJU A;  3SHL A;  4P71 A;  2QKI C;  3BDO A;  4FXD A;  4KK7 A;  5EKK A;  1GOZ A;  3DEO A;  1STA A;  2KA7 A;  2F4V L;  1G91 A;  1SNO A;  3MTS A;  4HAE A;  1VS0 A;  1YHA A;  1ESR A;  2JYO A;  2JA6 B;  1O80 A;  1JWS D;  2CKZ B;  2SEB D;  1BBU A;  3H0G B;  3HKZ E;  4L5S A;  1T5X D;  1E7Z A;  2EY2 A;  4FF3 A;  1PZK D;  2R61 A;  4Y7N B;  3GTG B;  2J7Z A;  5FLM G;  1QVF A;  3ULL A;  4IUU A;  3FRP B;  4OO1 G;  4BBR B;  1RIP A;  4MTK A;  1STE A;  4G7H C;  2E2H H;  5AJ3 L;  2QEX A;  5COR A;  3K80 C;  5D3I B;  3NBH B;  4P73 A;  1J9O A;  1B4O A;  4ALP A;  2Q8I B;  2E8G A;  4HJ9 A;  3X3N A;  1EWC A;  4PG3 A;  3VR4 A;  2E2J H;  2UXB L;  1H9M A;  3BG3 A;  1A3U A;  4XIG S;  3PO3 G;  2FHT A;  2F0T A;  4KJO A;  1D5M C;  1HZC A;  1XMO L;  3T51 B;  1XTC D;  5JOB A;  1RKN A;  4GOP C;  1VQP A;  1X32 A;  3QO2 A;  4KY7 A;  1JJC B;  1HCZ A;  3HOV H;  2EYH A;  1VQE A;  4KD3 A;  2KUM A;  3OMG A;  2O5J C;  4DV1 L;  4PNY A;  3PGZ A;  2EYJ A;  5EAY A;  5CYU A;  1F2Z A;  1SXT A;  3HEJ A;  4L6T B;  2MO1 A;  2VUM H;  5KNC A;  5KYI A;  3RZD B;  4B3R Q;  2E74 C;  4IZ8 A;  2R7Z H;  3MWY W;  3NE5 B;  3J7Y W;  2CCZ A;  4LUZ A;  2IW3 A;  4X3T A;  3HOW G;  1KNA A;  1X6O A;  2M00 A;  2F0H A;  3A8J E;  4RCO A;  2WAQ G;  1K73 C;  2B2U C;  3RD4 A;  1ENF A;  1X3P A;  2R6G A;  1EEF D;  3I72 A;  3QOJ A;  5DNF A;  2Q8T A;  2EYP A;  1E2V A;  1UWV A;  3J80 i;  4F88 A;  4C2M B;  4JI7 Q;  5IYB H;  4DXF A;  5ELB A;  2N78 A;  3GTM B;  2WAC A;  2JA7 G;  1CTM A;  2R93 B;  2A5H A;  4ZKC B;  1KDA A;  3S1M B;  4DR4 L;  3H94 A;  4LF5 Q;  3M4Q A;  3HOY H;  4R4T A;  1I3Q H;  5IP9 G;  4C56 C;  1QG7 A;  5IIF A;  1PTO F;  2F0E A;  1WJJ A;  1EEI D;  4B9X A;  5A2Q L;  4FF1 A;  1VQ4 A;  4A3G G;  3S1R B;  4KHV A;  2NVT H;  1Q86 C;  1E2W A;  1LTB D;  2A74 C;  4B3T Q;  1U4L A;  2QDB A;  4CDD C;  2F52 A;  2Y0S E;  2AQ2 B;  3KF8 A;  4O0A A;  4X3S A;  1WTX A;  1EYC A;  4HIM A;  3G6J B;  2KHI A;  3GTO H;  1CA6 A;  4DV1 Q;  1FR3 A;  1FJG Q;  4C3I G;  5IWA L;  1CFM A;  5M3F B;  3TZU A;  4LF8 L;  3GV6 A;  4L5R C;  1NCV A;  2F0I A;  1HPC A;  4JI8 L;  2B8G A;  2G5D A;  3RLO A;  3U9O A;  2L11 A;  2P5Z X;  2UXC Q;  1CSQ A;  4DF7 A;  4JI2 L;  5I4D A;  2JA8 B;  3EA6 A;  2WKC A;  4DR5 L;  2MUY A;  3WDN A;  4JW0 A;  3MEH A;  4DK6 C;  1CKN A;  1SSO A;  5AFW A;  3RN2 A;  2Q2T A;  4KHP Q;  4OIJ A;  1CI3 M;  1M4V A;  2EYO A;  2VS1 A;  1S5F D;  3HOZ H;  4X6A H;  3FVQ A;  5CV5 A;  1VQN A;  4K8J A;  5C5M A;  1ONL A;  4I7A A;  4IFD I;  2QIL A;  1EIG A;  3F8T A;  4KI0 A;  1PFN A;  2DNC A;  3QJY A;  1EIY B;  1ICF B;  2NZO A;  2JA9 A;  3VYU A;  4FNF A;  4JI5 L;  3OTO Q;  3QWN A;  1VDZ A;  4YHH L;  1IBL Q;  1CT1 D;  1GXD C;  1X54 A;  2HIV A;  3P20 A;  4X62 Q;  4A3I G;  1QZH A;  3PUZ A;  1W6K A;  5JJK A;  1NNX A;  3S1Q B;  3NK9 A;  4LUO A;  2HCC A;  4LMQ D;  4WOR A;  4BS9 A;  3MXN A;  1Z47 A;  3PV0 A;  3I4M G;  1LO5 D;  5IT9 c;  3EVQ A;  1YVC A;  1JJ2 A;  3NTI A;  5CC4 A;  4B3M Q;  1W6J A;  3EFX D;  4RGM A;  1DOM A;  4A4I A;  4APV A;  3BYY B;  5EGT A;  1FNV A;  4JG2 A;  4DR2 Q;  1TS4 A;  1QUQ A;  4QF4 A;  1PYW D;  2F0D A;  1HZA A;  1WCM H;  3RMH A;  4MN3 A;  1HFN A;  1SAP A;  3LGJ A;  4C3J B;  3MXP A;  2J0T D;  5FJ8 H;  5C0X H;  1M1K C;  2N88 A;  1TWH B;  3AB9 A;  1Q90 A;  1W2B A;  3W2D A;  3SVM A;  2KOL A;  4R4C A;  1VQJ A;  4R8I A;  2E2I H;  1BNZ A;  1HZB A;  1S5E D;  4DV6 Q;  1Q82 C;  3MA2 B;  3S15 H;  4IPD A;  3T1H L;  1G51 A;  2N8N A;  3DMU A;  3HGB A;  3W3A A;  3HOX B;  2UUC L;  1I4R A;  2WAQ E;  4QL5 A;  4DR6 Q;  1EOV A;  2FFK B;  2FJ2 A;  1CZW A;  2UUB Q;  3QG1 A;  1IYU A;  2SDF A;  2D0O A;  1SE4 A;  3PO2 G;  4FVM A;  1RTN A;  4MZ9 A;  4HCS A;  5DEH A;  2A73 B;  2KED A;  5T1I A;  2K32 A;  3A5U A;  3QB3 A;  4JBJ A;  4ABN A;  1IBK Q;  2RQX A;  1YJW A;  1JR0 D;  4JI0 L;  2ZT9 C;  4LF6 Q;  3J81 E;  4B08 A;  4A3F G;  3I90 A;  2K03 A;  1KD1 C;  4TKO B;  1EZ6 A;  4XTC S;  1R9T B;  5JEA H;  5KIX A;  4AQY Q;  3I91 A;  5C4X H;  4DFA A;  3OWF A;  1XNR Q;  4ZQ3 A;  3V96 A;  4JBM A;  2K5H A;  4IUT A;  3DWA A;  2RF4 A;  2KCC A;  2E5L Q;  3KF8 B;  4UP9 A;  1SR3 A;  2NN6 G;  1QCB D;  3STB D;  1EZ8 A;  1H9R A;  1HNZ Q;  1E1T A;  1UNS A;  5M5X B;  4OWX B;  3PO3 B;  4QB4 A;  1BQQ T;  2VQF Q;  2ATW A;  2VZA A;  4DV4 L;  3DWQ A;  3E5S A;  3CHB D;  4KN7 C;  1S5C D;  5K36 G;  1KAB A;  2GVB A;  5JEA J;  1MGS A;  1QJO A;  1BR9 A;  1QIL A;  1PYS B;  4Q0F A;  3RR5 A;  4DN4 M;  1FD7 D;  1O78 A;  2OEO A;  3CP0 A;  3CCM A;  2KBN A;  4N8X 1;  4HMJ A;  1CKM A;  2LFN A;  5GQO A;  4FF2 A;  3HOU G;  4EGV A;  4A3D B;  1YNJ C;  1IYJ B;  2R92 H;  1CKN B;  4IOC A;  3CQZ B;  2I5L X;  2NBF A;  3ITP A;  3HOW B;  1XX8 A;  3ULJ A;  1SE2 A;  2XTI A;  1P16 A;  4LF7 Q;  1SLJ A;  2Z6K A;  3GP7 A;  1FNU A;  3GTL H;  5C4J B;  1M8A A;  2PW7 A;  3P7J A;  3X3M A;  5BR8 L;  3T1Y Q;  4LJZ C;  1IKL A;  4UDU C;  3C46 A;  1GKH A;  2JA7 B;  1CKO A;  4MIU A;  3BYT B;  1WOC A;  4QMG A;  1I6V C;  1KLU D;  2LY7 A;  4K5X A;  1CA5 A;  3VYT A;  1X65 A;  2D62 A;  4PV1 C;  1XTD A;  3CME A;  4A93 B;  5FO7 B;  4DGZ A;  4GOP A;  1Q81 C;  5LMU Q;  4YWL A;  3PCO B;  4J8Q A;  2UU9 Q;  4LUV A;  2IX0 A;  4K2K A;  3CC2 A;  1DZ1 A;  3MXN B;  1YZ6 A;  1ZYR C;  2ID0 A;  2N49 A;  4ILW A;  1PVO A;  5CMD A;  1VQ7 A;  1A15 A;  2K5Q A;  2KCT A;  3CMA A;  1LUZ A;  2A68 D;  3TS0 A;  1VQD A;  3LX0 A;  1UAP A;  1SYD A;  2MHV A;  3T53 B;  1QUQ B;  5LL6 S;  4NKL A;  2DNE A;  3NWS A;  3MFY A;  3CRK C;  4KJN A;  4C3I B;  3I4O A;  1U0L A;  2NZ1 D;  2WP8 J;  3ICE A;  1DJR D;  2JEA I;  4L5T A;  2YU9 B;  1EY0 A;  1E1O A;  4K5V A;  3TQY A;  3LWE A;  4BY1 H;  2F0P A;  1UUP A;  4FDB A;  4FF4 A;  1VQL A;  3EQL C;  1MKH A;  1VQO A;  5F2D A;  3NTH A;  1I4P A;  2AMC B;  3M7N A;  4BBS H;  2BE5 D;  2RHQ B;  2C5C A;  3TRZ A;  3H3V H;  1IHZ A;  2KEN A;  5C44 B;  1MI2 A;  3KYH C;  2VW9 A;  1ASZ A;  4MHE A;  1I6H H;  3HOV G;  1QZG A;  4QGU A;  3J81 c;  5A35 A;  1AZP A;  4LK1 C;  4OEL B;  2B2T A;  4DXG A;  5COY A;  2BA1 A;  1LM0 A;  3H6M A;  4JI3 Q;  3W5O A;  4YWK A;  2A6E D;  3V05 A;  4JV5 Q;  2EVB A;  3LWU A;  3J7A V;  3R2I A;  3HG9 A;  2CH4 W;  3JC6 6;  2OTJ A;  4HED A;  3A8K E;  1U4M A;  1HUM A;  1HQR D;  2PNR C;  3U9S A;  4UAI A;  5IGD A;  2AWO A;  1NMF A;  1B9M A;  4LF4 L;  1BUV T;  4C3H H;  2EE1 A;  1K3B C;  2ENB A;  3D6C A;  1TT2 A;  4A3I B;  1A62 A;  2CW0 C;  4YCW A;  4A3M H;  1PRT B;  2IJ0 A;  1U9R A;  2L12 A;  1N36 L;  5M5Y H;  3BDL A;  3R2T A;  2XIW A;  4IQZ A;  4IUR A;  4CKC A;  3QOL A;  1A2T A;  3U58 A;  1A6X A;  3BZD B;  3S9W A;  1DGS A;  2RCF A;  4UHV A;  4TRD A;  3S1N H;  3S14 B;  4A3J B;  1XMQ Q;  4CGY B;  4PMB A;  1EY6 A;  3T13 A;  4JI1 L;  1Y69 U;  1Y8N B;  4U67 3;  3OSO A;  3R8B A;  4YWM A;  4BY7 H;  3DWP A;  3DM1 A;  2DJF C;  2V1C C;  3HP3 A;  1A8V A;  4RCN A;  1J5E Q;  3OW7 A;  3EN2 A;  3E3X A;  2ZTD A;  4F7X A;  3L3O C;  5TSS A;  3K7A H;  3PQI A;  4DV5 Q;  4NXN L;  1WTO A;  2A69 D;  2XWJ B;  2Q2H A;  3Q0A A;  4QUF A;  1HTL D;  4WJW A;  2EJM A;  2N55 A;  5EKI A;  1M90 C;  1BCP F;  1SYB A;  1LT4 D;  3PO2 B;  2K33 A;  3CAM A;  4P74 A;  1ILQ A;  4TSS A;  4B9W A;  5LHY 1;  1FGU A;  4B3S Q;  4RMF A;  3CD6 A;  1UE1 A;  2B29 A;  3IRB A;  1Y1W G;  1BOS A;  4DV0 Q;  4A3F B;  4GOP B;  3HOZ G;  3ERO A;  5H1S E;  3K5M A;  3DXJ C;  5ISR A;  2PMZ B;  4ZYS A;  2F1M A;  1KL9 A;  1CSP A;  3GTQ B;  4X3U A;  1G2T A;  1JWU D;  1Q1E A;  1GM5 A;  3CCU A;  3M4P A;  2K5N A;  1EY5 A;  3OPO A;  2HDL A;  1NAP A;  1SFO B;  4KY5 A;  2F4I A;  1KAW A;  5EBD A;  3KBG A;  1HRJ A;  1B44 D;  1SNC A;  2H4O A;  3J7A F;  4OXP A;  2NB0 A;  2MNA A;  3NEM A;  2QCP X;  1EY4 A;  3DHQ A;  5DLQ E;  1PRT C;  3RZO B;  3F1Z A;  4GN3 B;  1JOO A;  1K9M C;  3TBI B;  2ZJR A;  2R7F A;  3M4O B;  3C1E A;  2CHB D;  1PH4 A;  4F87 A;  1TS5 A;  4A3K H;  1PZJ D;  4RFB A;  3OIQ A;  1HNW Q;  2ASB A;  3SEB A;  1WCM G;  2I0Q A;  4XT1 B;  4B3R L;  3IKJ A;  4TVA B;  3G4S A;  4IPC A;  1AEX A;  4ZAI A;  3H0G H;  5FJ8 G;  3S24 A;  3E9I A;  3FMC A;  4S3S A;  2EYF A;  2QEJ C;  3E0J A;  4OEM B;  4DV3 Q;  1IL2 A;  4N9T A;  4Y7N H;  1TY0 A;  5JPM C;  4RWS C;  3IFD A;  3JAM E;  4AIM A;  2BDO A;  3OW2 A;  1YI2 A;  3PF5 A;  3CXC A;  4JI7 L;  1HZ9 A;  2RDF A;  1QVC A;  4A3L H;  1X3Q A;  2JQO A;  1F2M A;  2K04 A;  4LF5 L;  3KFU A;  1I50 B;  2Z6K C;  2ZM6 Q;  2MGS A;  2KEE A;  2OT2 A;  3DLL A;  5CBA E;  2FXQ A;  1E22 A;  2NVY B;  2ZJP A;  4IPG A;  1XNQ Q;  1WTR A;  2PO4 A;  3MXU A;  1R4Q B;  2NZH A;  1U4R A;  3GO5 A;  4GLX A;  2KEC A;  3L7Z C;  4A75 A;  3FPP A;  4B3T L;  1QVG A;  3PIP 3;  4GN4 B;  5IT9 E;  5M9O A;  4EQN A;  2NN6 I;  5JEA G;  1KLG D;  1OXT A;  1DM0 B;  3RZD H;  2UUA Q;  1BKB A;  1X3G A;  1GD7 A;  1E24 A;  4HCE A;  3AQQ A;  1FJG L;  4K2L A;  1Y8O B;  1B2T A;  4HJ8 A;  2WB1 G;  4JOI A;  4J6H A;  3I2Z A;  4ZKB B;  2B63 H;  5JJL A;  3VR2 A;  2CQA A;  2E2H B;  1EY8 A;  2XWB B;  4IFD H;  4C2M H;  2PW5 A;  5FLX E;  2KQ3 A;  2UXC L;  2R93 H;  4IOA A;  3S1M H;  3I70 A;  1SDF A;  3VR5 A;  3UDG A;  1CQV A;  4R9W A;  4EQ5 A;  5C4Z A;  4X65 Q;  5L37 A;  3HOV B;  4KHP L;  1IYV A;  1B7Y B;  2BOS A;  2MFI A;  5I6W A;  4JI4 Q;  1GVP A;  2HDM A;  3J81 i;  4A3C H;  3C1F A;  3GTK B;  3OYY A;  4OL7 A;  3S2D B;  1RCV D;  3MZ5 A;  1Q1B A;  3S1R H;  2DJG C;  3UDI A;  3HKZ B;  5EBC A;  1LTG D;  4IN3 A;  1ASY A;  2F0M A;  5E7N A;  2F0W A;  3WOE A;  4POG A;  1YNN D;  1EFI D;  2B2T C;  1RJT A;  1L0W A;  1LT5 D;  3OTO L;  5C6A A;  3MFG A;  5KND A;  1D8L A;  1IBL L;  2JA5 B;  4JVZ A;  2AWN A;  3MC0 B;  1I4H A;  1XPU A;  4X64 Q;  1C48 A;  2A6H D;  4X62 L;  2K75 A;  4KD4 A;  4Y52 H;  4KY6 A;  2HQL A;  3IFT A;  5CV8 A;  4IJL A;  2L4N A;  1PMR A;  3T16 A;  1PA6 A;  3PMF A;  3NXW A;  3PUW A;  2RCN A;  2YV5 A;  4GNX A;  1S5D D;  2XVS A;  4B3M L;  1ML0 D;  2JA8 H;  4DR2 L;  1MJE A;  1TWA B;  2A19 A;  1CZG A;  4HJ5 A;  4JCV E;  1O7I A;  2NVT B;  4PZ8 A;  5EPL A;  1JOQ A;  1VMC A;  4DU9 A;  2QDL A;  4NMZ A;  4K14 A;  1RF2 D;  1TKW B;  2E75 C;  4DAP A;  2OQK A;  3HZX A;  4BWG B;  4CBV A;  3JAM c;  4ODG A;  4J1M A;  4DAV A;  1ZKO A;  4YY3 Q;  1YJN A;  4EQO A;  3J80 L;  4DV6 L;  2PI2 E;  5G3L D;  1K8A C;  4LFB Q;  2K6A A;  2OF1 A;  1AW7 A;  4BY1 G;  2Z6B A;  3S17 H;  4QY7 A;  4DR6 L;  2NVQ H;  3GTP H;  3BVG A;  1NTG A;  1XYI A;  2UUB L;  2VQE Q;  3S1Q H;  5C3E G;  2F0V A;  3TP8 A;  4K5W A;  4BBS G;  1ET9 A;  1HH2 P;  1O7Z A;  3A74 A;  4WFN 3;  3I7F A;  4UY8 C;  5C5L A;  1IBK L;  2HHH Q;  1F9P A;  3FDT A;  1STB A;  3A0J A;  4A3E B;  4HSP A;  2DGY A;  1PHJ A;  1Y1W B;  4LF6 L;  1F77 A;  4RH6 A;  1FYC A;  5GRO A;  4EQP A;  3U4Z A;  1K83 B;  4XQN A;  1C8C A;  3HOZ B;  2IHE A;  2K1B A;  3G71 A;  3FKI H;  4G57 A;  5CV4 A;  2F0S A;  2PQA A;  4AQY L;  2Y0S B;  5IGE A;  1NUC A;  3PF4 A;  1F9Q A;  1VQI A;  4C3J H;  1XNR L;  1D5X C;  4JI6 Q;  1TVX A;  1TWH H;  3K57 A;  5GAE C;  2E5L L;  3AYH B;  5JJI A;  4JYA Q;  2F3V A;  3CRL C;  2BH8 A;  3D6W A;  2LS0 1;  1VQM A;  1WD1 A;  4RHS A;  1KQS A;  1SNQ A;  3DM3 A;  5A2Q E;  1Y8P B;  2X6L A;  2DUD A;  4RA8 A;  3F2U A;  3ONA B;  1N33 Q;  1HNZ L;  5IYC H;  5FLX c;  1HHV A;  1LTL A;  5I9P A;  2D9U A;  2PQE A;  2XN9 C;  2Z8L A;  4A3M G;  2XGT A;  2F03 A;  2WB1 E;  2K5D A;  3STB C;  2VQF L;  1TQO A;  3HS0 C;  1H9J A;  3PIO A;  3I4L A;  1WYD A;  2ZXR A;  1YEZ A;  3TP6 A;  4GKK Q;  1G8Z D;  1BCP D;  2M9V A;  2NYZ D;  1JQY D;  4AYB G;  2BA0 A;  3SK6 A;  2RBM A;  5CGK A;  5IYD H;  4M8A A;  3S16 B;  4ZUJ A;  4NB3 A;  2JEB I;  3TRE A;  3R3O A;  4HIO A;  1PTO B;  3BDC A;  1LTT D;  2K05 A;  5ELF A;  1TY2 A;  2N3S A;  4BY7 G;  2ES2 A;  3PUX A;  3A55 A; 
#chains in the Genus database with same CATH homology
 1G2S A;  1XWE A;  5C0X J;  1H9S A;  1C4Q A;  1D2B A;  3ZYY X;  3Q6S A;  4I65 A;  4RGN A;  2GA4 B;  1HUN A;  2IT1 A;  2VB2 X;  2NTT A;  2B2V A;  3S15 B;  5J1Z A;  1IKM A;  1EYA A;  2TSS A;  3V2T A;  2JXM B;  1ENA A;  1EQT A;  3P1H A;  2ZXP A;  4V0B A;  3C3L A;  2QF7 A;  5BN5 A;  3D4W A;  1TWF B;  2B8F A;  4KV6 A;  5IGG A;  5EJW A;  1WTV A;  2FIN B;  3SXH A;  1B50 A;  3MXG A;  4FXG C;  1PLF A;  1WVL A;  1Z7T A;  5CV9 A;  3K5L A;  1T5E A;  4CHT B;  4OHJ A;  3KLS X;  4Z9C B;  2VB3 X;  2ZXO A;  2FMM A;  3N52 A;  2JE6 I;  3I73 A;  3NTK A;  4ME5 A;  3D4R A;  3M4Y A;  5D14 A;  1QNK A;  3MHB A;  3KLR A;  2TMP A;  2WAQ B;  4HMI A;  1L0X B;  3Q22 A;  4FYD A;  2NVX B;  3SDZ A;  2BE5 C;  2KCN A;  4JBW A;  2L0C A;  2EXZ A;  2XNA C;  1EWH A;  1PTO C;  5DM6 3;  1F2L A;  2A6E C;  1SND A;  3K0Y A;  5IGB A;  1WTP A;  4OO1 I;  1GUT A;  4A3G B;  3GTL B;  2WKD A;  1NR4 A;  4QCL A;  3K6O A;  4KKS A;  2PZW A;  1VF7 A;  1PDQ A;  4DNR B;  1QNU A;  1YNJ D;  3K59 A;  2RDG A;  2XRS D;  2Q8R E;  1SMY C;  3OMC A;  1AP0 A;  2KVM A;  1A3V A;  4ZK9 B;  1CHQ D;  4O42 A;  1LAB A;  5CV6 A;  4H13 C;  3I3C A;  2SNM A;  2RDH A;  5I2Y A;  5BN3 A;  2F0O A;  4DAY A;  3D8G A;  5G3L F;  5C3E B;  3SE0 A;  4BBS B;  3URY A;  5HUR A;  2O5I C;  5IGF A;  1I6H B;  4CJ1 B;  4F8M A;  5IOC A;  3D4D A;  4RGO S;  2Z4I A;  5IGC A;  3VYR A;  3I4M B;  3NPP A;  4PQX A;  4RAU C;  2VNU D;  2O2L D;  2IWH A;  2O4X A;  1FGB D;  3CKI B;  1KDC A;  1O7Y A;  2PYK A;  1JWM D;  2B2Y A;  3A7L A;  3OWE B;  2F0U A;  4A3M B;  4E6I A;  3NQT A;  2IX1 A;  4G4K A;  2KHS A;  1ICW A;  4M1U B;  5I9O A;  4AYB B;  3OIP A;  2F0N A;  1GUS A;  2F0J A;  1CM9 A;  1Q3L A;  1LTR D;  4YIJ A;  2MPM A;  5ELD A;  3DEP A;  1HA6 A;  4BY7 B;  5K5P A;  3TDQ A;  1MD2 D;  3VYS A;  2EY1 A;  3NBI A;  4ZRZ A;  3DUZ A;  3RUZ A;  3K7A B;  1I4G A;  2XSC A;  3PIO 3;  4HR7 B;  3OHX C;  3D3R A;  3GTJ B;  1EY9 A;  4C1N K;  1AN8 A;  2NN6 H;  2CW0 D;  2V4D A;  3KLS A;  1MSH A;  3EJI A;  1KAA A;  4HSV A;  2WII B;  2B2W A;  2D5D A;  4EVO A;  2J4X A;  1LV9 A;  1PFM A;  1QE6 A;  1WTQ A;  2B2V C;  2F0G A;  2AUJ D;  3LNN A;  3D31 A;  3H3V C;  3VR6 A;  2EYL A;  3NWT A;  1IW7 D;  2EDG A;  3K5N A;  1PZI D;  1TWC B;  1HQM C;  1RHP A;  4K6D A;  3TSS A;  1RD9 D;  5DAU A;  3HOU B;  4X3K A;  1ET6 A;  1TWG B;  2EZV A;  4KTA A;  3R93 A;  5C0X G;  1SYG A;  5BN4 A;  4XYQ A;  3A56 A;  1EYD A;  2PCF B;  1SYE A;  4PMC A;  4RHR A;  5FO9 B;  4U68 A;  2AUK A;  1BO0 A;  3TZD A;  1R4P B;  1OO9 B;  1GHJ A;  1B9N A;  1A2U A;  3AU7 A;  4PMW A;  3TP5 A;  4A3K B;  3K58 A;  3I4N B;  2EY5 A;  5C4H A;  1UEA B;  2JSO A;  1SJE D;  4XYO A;  3IAY A;  1STY A;  1D6E C;  1SYC A;  3NSW A;  4XQJ A;  1A3T A;  1Q8I A;  1YNN C;  5T1G A;  3NP8 A;  2M2L A;  5E4X A;  2HQE A;  2A6H C;  2L55 A;  1JC7 A;  3KUP A;  4IUP A;  4K6L A;  3PUY A;  1PRT D;  1STN A;  3M85 A;  1PXU A;  4XT3 B;  1BCP B;  5ELC A;  4L8J A;  2I07 B;  4CKB A;  4KKU A;  2E2J B;  2F0K A;  1OXS C;  4HN7 A;  2WV6 D;  3AMU A;  3SK5 A;  2RSN A;  4OIK A;  4TQU S;  1OXU A;  1GUG A;  3FPU B;  1SYF A;  2HCI A;  2VUM B;  2F0L A;  2B63 B;  3GQB A;  2R7Z B;  1VF5 C;  3N6R A;  4IFD J;  2K5W A;  2HUG A;  3MAQ A;  3QIA A;  5I6Y A;  1CQF A;  1TU2 B;  2E2D C;  5JAV A;  3NHH A;  5LL6 X;  3I8Z A;  4V19 0;  3A7A B;  3HOY B;  1I3Q B;  1MSG A;  4HTH A;  1ILP A;  5JPN C;  1DOL A;  1MBY A;  2XRQ D;  5JVG 3;  1VCI A;  1GUW A;  4H44 C;  5E3F A;  2X6G A;  4WRD A;  3GTO B;  3C2P A;  5E4W C;  2FMC A;  2RA4 A;  3BVM A;  2NUC A;  1HXY D;  4G7Z C;  2RSO A;  1EIH A;  1F9R A;  3O13 A;  2B2Y C;  2ICE C;  1STG A;  1JOK A;  3NUC A;  1BCP C;  1L0Y B;  3KK7 A;  3J81 L;  4DA2 A;  4XDX A;  3ERQ A;  1KNE A;  4ZUI A;  3Q23 A;  3L9A X;  2MJ8 A;  4RKB A;  1K8M A;  5JVH 3;  4CKE A;  1LAC A;  1VMP A;  4NW2 A;  5FK9 C;  5HGT A;  1LLR D;  2NWG A;  2F0Q A;  1I4Q A;  3BS1 A;  3S17 B;  3KBX A;  2NVQ B;  3GTP B;  2H1E A;  4FXK C;  4C3H G;  1HFG A;  1BXT A;  4C1N I;  5NUC A;  1LTA D;  3GD7 A;  4ID6 A;  2B39 A;  1G29 1;  1S4Z A;  2B2W C;  2PZT A;  3BVZ A;  1PTO H;  3FKI B;  2R3Z A;  3UI2 A;  4FO2 A;  1WTW A;  1DYQ A;  1HTP A;  4LAA A;  1BF4 A;  4CJ0 B;  1STH A;  1K8O A;  3VA7 A;  5FO8 B;  1Z6H A;  1WCM B;  2AQ3 B;  1QOH A;  3TN2 A;  2DN8 A;  2IL8 A;  1SBB B;  4OO1 H;  2E2I B;  4O1N A;  2BCO A;  2AQ1 B;  1DOK A;  1SEB D;  3J80 E;  3Q24 A;  2LMC B;  4XQQ A;  2IX3 A;  4H0L C;  1J8I A;  5C3X A;  1OXX K;  2Z4H A;  3A54 A;  2JP1 A;  3OOC A;  5KGU A;  1V1P A;  1JOR A;  5D65 A;  1E2Z A;  5CBE E;  2L5T A;  1SE3 A;  2A68 C;  2K01 A;  1B53 A;  4K8I A;  5C4X B;  1O7L A;  5M5W B;  5CR3 A;  3NQI A;  1LTS D;  1TS3 A;  2WB1 B;  3TP7 A;  1F2Y A;  2SNS A;  1PRT F;  2LKV A;  4P2C B;  2L9H A;  3GV3 A;  1WD0 A;  2C9O A;  5JJZ A;  2RVL A;  1QB5 D;  3WOF A;  5D3D A;  5EPK A;  1I4X A;  4BA1 I;  1ZEQ X;  2OXP A;  3TME A;  5C0X I;  2RKS A;  5C3W A;  5EQ0 A;  1DON A;  2VXW A;  2L1B A;  5I2X A;  2EY6 A;  3S2H B;  1RDP D;  1F9S A;  3ND9 A;  4RGT A;  2R92 B;  1S5B D;  2YYZ A;  4IAL A;  1BDO A;  1GUN A;  1GUO A;  4RKL A;  1AZQ A;  1TII D;  5KNB A;  4L63 B;  2K28 A;  1EOT A;  1SJH D;  3T4A C;  4XXE A;  1Q12 A;  1U4P A;  5E1F A;  2EYM A;  1V1O A;  4Q5V A;  5KEE A;  2DY7 A;  2PPB C;  3M7G A;  3PUV A;  4ZLT F;  1QWY A;  2SOB A;  5IOD A;  5EPJ A;  2B2U A;  4IUQ A;  1ESF A;  1NSN S;  1EU3 A;  2DY8 A;  4BA2 I;  4CJ2 C;  3ND8 A;  2F0F A;  1XXG A;  1D1I A;  1H9S B;  1B3A A;  2A69 C;  4KN4 C;  4BY1 B;  1Y1V B;  4DK0 A;  4IFD G;  4KMU C;  2F3W A;  1IL8 A;  2WIN B;  2EJG C;  1ROD A;  2G9H D;  5DM7 3;  1PTO D;  3CU7 A;  2X69 A;  2EJF C;  1GJX A;  1GHK A;  5J39 A;  1SNP A;  4A3B B;  1LTI D;  1LT3 D;  4QUC A;  3MVV A;  4GZY C;  5EKL A;  1ZYR D;  1EY7 A;  2KJX A;  1HA5 A;  1V1P B;  5J22 A;  4IUV A;  1D1K A;  3NBH A;  4R8N A;  1E0B A;  2D2C C;  3RLF A;  4C3H B;  3P75 A;  3VR3 A;  1KTK A;  1JIC A;  1TR5 A;  4OGQ C;  4KKT A;  5M5Y B;  1D5Z C;  4NDX A;  1FNW A;  1IW7 C;  1NR2 A;  2BDN A;  2IPK D;  2E76 C;  4DNT B;  5KRU A;  3A8I E;  3IL8 A;  2MP1 A;  3S1N B;  1ENC A;  1SMY D;  3JAM L;  1TS2 A;  5FOB B;  2NTS A;  1EL0 A;  1JCK B;  1JE4 A;  3SK4 A;  3T56 B;  2PZU A;  4H7B A;  1EU4 A;  3VA5 A;  4I7Z C;  1G6Z A;  2ICI A;  1H9K A;  3H09 A;  3HRZ C;  1JB3 A;  4ULL A;  2G9D A;  1RTO A;  1SNM A;  1OXV A;  4JK1 C;  5IT9 L;  2K7V A;  2Z1C A;  1V8Q A;  1AFP A;  1V43 A;  5K36 H;  3SR1 A;  5KYL A;  4N9P A;  1EQV A;  4FP5 D;  1II3 A;  1CK1 A;  3K5O A;  3H91 A;  5FKA C;  3G7L A;  1BBX C;  3E6Z X;  2EPB A;  5CV7 A;  5FLX L;  4C3J G;  1DXM A;  1DCZ A;  1ZXT A;  4IUN A;  3SK8 A;  3FEW X;  3M3Y B;  4DK1 A;  1CHP D;  1PFB A;  2EOT A;  5M3M B;  1DD2 A;  4NP5 A;  1B1Z A;  4G7O C;  4KHZ A;  2CVR A;  2I46 A;  4QIW B;  1KDB A;  5ELE A;  1LT6 D;  3SHL A;  2QKI C;  3BDO A;  4FXD A;  4KK7 A;  5EKK A;  1GOZ A;  3DEO A;  1STA A;  2KA7 A;  1G91 A;  1SNO A;  3MTS A;  4HAE A;  1ESR A;  2JYO A;  2JA6 B;  1O80 A;  1JWS D;  2SEB D;  3H0G B;  1T5X D;  2EY2 A;  4FF3 A;  1PZK D;  2R61 A;  4Y7N B;  3GTG B;  2J7Z A;  4IUU A;  3FRP B;  4OO1 G;  4BBR B;  1STE A;  4G7H C;  5COR A;  5D3I B;  1J9O A;  1B4O A;  2Q8I B;  3X3N A;  1EWC A;  3VR4 A;  1H9M A;  3BG3 A;  1A3U A;  4XIG S;  2FHT A;  2F0T A;  4KJO A;  1D5M C;  3T51 B;  1XTC D;  5JOB A;  1RKN A;  1X32 A;  3QO2 A;  4KY7 A;  1HCZ A;  2EYH A;  4KD3 A;  2KUM A;  3OMG A;  2O5J C;  4PNY A;  2EYJ A;  5CYU A;  1F2Z A;  1SXT A;  3HEJ A;  4L6T B;  5KNC A;  5KYI A;  3RZD B;  2E74 C;  4IZ8 A;  3MWY W;  3NE5 B;  3J7Y W;  2IW3 A;  4X3T A;  1KNA A;  2M00 A;  2F0H A;  3A8J E;  4RCO A;  2B2U C;  3RD4 A;  1ENF A;  1X3P A;  2R6G A;  1EEF D;  3I72 A;  3QOJ A;  5DNF A;  2Q8T A;  2EYP A;  1E2V A;  4F88 A;  4C2M B;  4DXF A;  5ELB A;  3GTM B;  2WAC A;  1CTM A;  2R93 B;  2A5H A;  4ZKC B;  1KDA A;  3S1M B;  3H94 A;  4C56 C;  1QG7 A;  5IIF A;  1PTO F;  2F0E A;  1EEI D;  4B9X A;  5A2Q L;  4FF1 A;  3S1R B;  4KHV A;  1E2W A;  1LTB D;  2A74 C;  1U4L A;  2QDB A;  2AQ2 B;  3KF8 A;  4X3S A;  1WTX A;  1EYC A;  3G6J B;  1CA6 A;  1FR3 A;  4C3I G;  1CFM A;  5M3F B;  3TZU A;  3GV6 A;  1NCV A;  2F0I A;  1HPC A;  2B8G A;  3U9O A;  2L11 A;  4DF7 A;  5I4D A;  2JA8 B;  3EA6 A;  2WKC A;  2MUY A;  3WDN A;  3MEH A;  1SSO A;  5AFW A;  4OIJ A;  1CI3 M;  1M4V A;  2EYO A;  1S5F D;  3FVQ A;  5CV5 A;  4K8J A;  5C5M A;  1ONL A;  4IFD I;  2QIL A;  1EIG A;  4KI0 A;  1PFN A;  2DNC A;  3QJY A;  3VYU A;  4FNF A;  3QWN A;  1VDZ A;  1CT1 D;  1GXD C;  3P20 A;  3PUZ A;  1W6K A;  3S1Q B;  3NK9 A;  2HCC A;  4LMQ D;  4WOR A;  4BS9 A;  3MXN A;  1Z47 A;  3PV0 A;  1LO5 D;  3EVQ A;  3NTI A;  5CC4 A;  1W6J A;  3EFX D;  4RGM A;  1DOM A;  3BYY B;  5EGT A;  1FNV A;  1TS4 A;  4QF4 A;  1PYW D;  2F0D A;  3RMH A;  4MN3 A;  1HFN A;  1SAP A;  4C3J B;  3MXP A;  2J0T D;  5C0X H;  2N88 A;  1TWH B;  3AB9 A;  1Q90 A;  3W2D A;  3SVM A;  2KOL A;  4R8I A;  1BNZ A;  1S5E D;  3MA2 B;  3DMU A;  3HGB A;  3W3A A;  3HOX B;  1I4R A;  2FFK B;  2FJ2 A;  1CZW A;  3QG1 A;  1IYU A;  2SDF A;  1SE4 A;  4FVM A;  1RTN A;  4HCS A;  5DEH A;  2A73 B;  2KED A;  5T1I A;  2K32 A;  3QB3 A;  4ABN A;  2RQX A;  1JR0 D;  2ZT9 C;  3J81 E;  4B08 A;  3I90 A;  2K03 A;  4TKO B;  1EZ6 A;  4XTC S;  1R9T B;  5JEA H;  5KIX A;  3I91 A;  4DFA A;  3OWF A;  4ZQ3 A;  3V96 A;  4IUT A;  3DWA A;  2KCC A;  2NN6 G;  1QCB D;  1EZ8 A;  1H9R A;  1UNS A;  5M5X B;  3PO3 B;  4QB4 A;  1BQQ T;  3DWQ A;  3E5S A;  3CHB D;  4KN7 C;  1S5C D;  5K36 G;  1KAB A;  5JEA J;  1MGS A;  1QJO A;  1BR9 A;  1QIL A;  4Q0F A;  4DN4 M;  1FD7 D;  1O78 A;  2OEO A;  4HMJ A;  2LFN A;  4FF2 A;  4A3D B;  4EGV A;  1YNJ C;  3CQZ B;  2NBF A;  3ITP A;  3HOW B;  1XX8 A;  1SE2 A;  3GP7 A;  1FNU A;  5C4J B;  1M8A A;  2PW7 A;  3P7J A;  3X3M A;  4LJZ C;  1IKL A;  4UDU C;  3C46 A;  2JA7 B;  4MIU A;  3BYT B;  4QMG A;  1I6V C;  1KLU D;  2LY7 A;  4K5X A;  1CA5 A;  3VYT A;  2D62 A;  4PV1 C;  4A93 B;  5FO7 B;  4DGZ A;  4J8Q A;  2IX0 A;  4K2K A;  1DZ1 A;  1ZYR C;  2ID0 A;  4ILW A;  5CMD A;  1A15 A;  2K5Q A;  2A68 D;  3LX0 A;  1UAP A;  1SYD A;  2MHV A;  3T53 B;  5LL6 S;  4NKL A;  2DNE A;  3NWS A;  3MFY A;  3CRK C;  4KJN A;  4C3I B;  2NZ1 D;  2WP8 J;  1DJR D;  2JEA I;  2YU9 B;  1EY0 A;  4K5V A;  3LWE A;  2F0P A;  1UUP A;  4FF4 A;  3EQL C;  5F2D A;  3NTH A;  1I4P A;  3M7N A;  2BE5 D;  2C5C A;  1IHZ A;  5C44 B;  1MI2 A;  4MHE A;  5A35 A;  1AZP A;  4LK1 C;  2B2T A;  4DXG A;  5COY A;  2BA1 A;  3H6M A;  2A6E D;  3V05 A;  2EVB A;  3LWU A;  3J7A V;  3R2I A;  3HG9 A;  4HED A;  3A8K E;  1U4M A;  1HUM A;  1HQR D;  2PNR C;  3U9S A;  4UAI A;  5IGD A;  2AWO A;  1B9M A;  1BUV T;  2EE1 A;  2ENB A;  3D6C A;  1TT2 A;  4A3I B;  2CW0 C;  1PRT B;  2IJ0 A;  1U9R A;  2L12 A;  3BDL A;  3R2T A;  2XIW A;  4IQZ A;  4IUR A;  4CKC A;  3QOL A;  1A2T A;  1A6X A;  3BZD B;  3S9W A;  4TRD A;  3S14 B;  4A3J B;  4CGY B;  4PMB A;  1EY6 A;  3T13 A;  1Y69 U;  1Y8N B;  4U67 3;  3OSO A;  3R8B A;  3DWP A;  3DM1 A;  3HP3 A;  4RCN A;  3OW7 A;  4F7X A;  3L3O C;  5TSS A;  1WTO A;  2A69 D;  2XWJ B;  3Q0A A;  4QUF A;  1HTL D;  4WJW A;  2EJM A;  2N55 A;  5EKI A;  1BCP F;  1SYB A;  1LT4 D;  3PO2 B;  2K33 A;  1ILQ A;  4TSS A;  4B9W A;  5LHY 1;  1BOS A;  4A3F B;  3ERO A;  3K5M A;  3DXJ C;  5ISR A;  2PMZ B;  4ZYS A;  2F1M A;  3GTQ B;  4X3U A;  1G2T A;  1JWU D;  1Q1E A;  1EY5 A;  3OPO A;  2HDL A;  1NAP A;  1SFO B;  4KY5 A;  2F4I A;  5EBD A;  3KBG A;  1HRJ A;  1B44 D;  1SNC A;  2H4O A;  3J7A F;  2NB0 A;  2QCP X;  1EY4 A;  3DHQ A;  1PRT C;  3RZO B;  1JOO A;  3TBI B;  3M4O B;  3C1E A;  2CHB D;  4F87 A;  1TS5 A;  1PZJ D;  4RFB A;  3OIQ A;  3SEB A;  4XT1 B;  3IKJ A;  1AEX A;  4ZAI A;  3FMC A;  4S3S A;  2EYF A;  2QEJ C;  3E0J A;  4N9T A;  1TY0 A;  5JPM C;  4RWS C;  3IFD A;  3JAM E;  2BDO A;  2RDF A;  1X3Q A;  1F2M A;  2K04 A;  1I50 B;  2MGS A;  2KEE A;  2OT2 A;  5CBA E;  2NVY B;  1WTR A;  2PO4 A;  3MXU A;  1R4Q B;  1U4R A;  3GO5 A;  2KEC A;  3L7Z C;  3FPP A;  3PIP 3;  5IT9 E;  5M9O A;  4EQN A;  2NN6 I;  5JEA G;  1KLG D;  1OXT A;  1DM0 B;  4HCE A;  4K2L A;  1Y8O B;  1B2T A;  4J6H A;  4ZKB B;  3VR2 A;  2CQA A;  2E2H B;  1EY8 A;  2XWB B;  4IFD H;  2PW5 A;  5FLX E;  2KQ3 A;  3I70 A;  1SDF A;  3VR5 A;  1CQV A;  4R9W A;  5C4Z A;  3HOV B;  1IYV A;  2BOS A;  5I6W A;  2HDM A;  3C1F A;  3GTK B;  4OL7 A;  3S2D B;  1RCV D;  3MZ5 A;  1Q1B A;  3HKZ B;  5EBC A;  1LTG D;  4IN3 A;  2F0M A;  2F0W A;  3WOE A;  1YNN D;  1EFI D;  2B2T C;  1RJT A;  1LT5 D;  5C6A A;  3MFG A;  5KND A;  2JA5 B;  2AWN A;  1I4H A;  3MC0 B;  1C48 A;  2A6H D;  4KD4 A;  4KY6 A;  3IFT A;  5CV8 A;  2L4N A;  1PMR A;  3T16 A;  3PMF A;  3NXW A;  3PUW A;  1S5D D;  2XVS A;  1ML0 D;  1TWA B;  1CZG A;  2NVT B;  5EPL A;  1JOQ A;  1VMC A;  4DU9 A;  4NMZ A;  4K14 A;  1RF2 D;  1TKW B;  2E75 C;  4DAP A;  3HZX A;  4BWG B;  4CBV A;  4ODG A;  4J1M A;  4DAV A;  1ZKO A;  4EQO A;  3J80 L;  5G3L D;  2K6A A;  2OF1 A;  1AW7 A;  3BVG A;  1XYI A;  2F0V A;  3TP8 A;  4K5W A;  1ET9 A;  1O7Z A;  4WFN 3;  5C5L A;  1F9P A;  3FDT A;  1STB A;  4A3E B;  4HSP A;  1Y1W B;  1F77 A;  4RH6 A;  1FYC A;  4EQP A;  1K83 B;  4XQN A;  1C8C A;  3HOZ B;  2K1B A;  4G57 A;  5CV4 A;  2F0S A;  2Y0S B;  5IGE A;  1NUC A;  1F9Q A;  1D5X C;  1TVX A;  3K57 A;  2F3V A;  3CRL C;  3D6W A;  2LS0 1;  1WD1 A;  4RHS A;  1SNQ A;  5A2Q E;  1Y8P B;  2X6L A;  4RA8 A;  3F2U A;  3ONA B;  1HHV A;  5I9P A;  2D9U A;  2PQE A;  2XN9 C;  2Z8L A;  2F03 A;  2K5D A;  1TQO A;  3HS0 C;  1H9J A;  3I4L A;  2ZXR A;  3TP6 A;  1G8Z D;  1BCP D;  2M9V A;  2NYZ D;  1JQY D;  2BA0 A;  3SK6 A;  2RBM A;  5CGK A;  4M8A A;  3S16 B;  4ZUJ A;  2JEB I;  3R3O A;  1PTO B;  3BDC A;  1LTT D;  2K05 A;  5ELF A;  1TY2 A;  3PUX A;  3A55 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...