4IFDH

Crystal structure of an 11-subunit eukaryotic exosome complex bound to rna
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
356
structure length
295
Chain Sequence
SEVITITKRNGAFQNSSDSQIVTPGELVTDDPIWMRGHGTYFLDNMTYSSVAGTVSRVNRLLSVIPLKGRYAPETGDHVVGRIAEVGNKRWKVDIGGKQHAVLMLGSVNLPGGILRRKSESDELQMRSFLKEGDLLNAEVQSLFQDGSASLHTRSLKYGKLRNGMFCQVPSSLIVRAKNHTHNLPGNITVVLGVNGYIWLRKTSQMDLARDTESSWQIYSDENDPSISNNIRQAICRYANVIKALAFCEIGITQQRIVSAYEASMVYSNVGELIEKNVMESIGSDILTAEKMRGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/rna
molecule keywords Exosome complex component RRP45
publication title Crystal structure of an RNA-bound 11-subunit eukaryotic exosome complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 79
structure length 295
sequence length 356
ec nomenclature
pdb deposition date 2012-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF14382 ECR1_N Exosome complex exonuclease RRP4 N-terminal region
H PF15985 KH_6 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4ifdH01
1BDOA 1VF5C 1E2WA 2A6EC 2EJMA 1HCZA 2BA0A 2A6HD 2R6GA 1IW7C 3DXJC 4KN4C 2Q8IB 3RLFA 4G7OC 4RCNA 2PNRC 3OOCA 3M7NA 5KNCA 5BN3A 3KLRA 1K8OA 2B8GA 3PUYA 4L8JA 1ZYRC 3T56B 2O5IC 2YYZA 1H9MA 2DN8A 3VR2A 3VR6A 1G291 1GHJA 1PMRA 2LMCB 3CRLC 2DNCA 1CTMA 1OXTA 4JK1C 3QJYA 1OXXK 1VCIA 1SMYC 3PUZA 2V4DA 3VR3A 1DD2A 1GJXA 3L7ZC 3M85A 1IYVA 2E75C 1H9RA 4KI0A 2A6ED 3SDZA 3OPOA 1IW7D 1T5EA 3M4YA 1FR3A 1VF7A 2NN6H 3VR4A 3U9SA 2BA1A 2K33A 1FYCA 1LABA 2JEBI 4BA1I 1Y8OB 1A6XA 1GUTA 1E2VA 1Z6HA 2BE5C 1CFMA 3A8JE 3N6RA 4KN7C 1LACA 1Y8PB 3I72A 3WDNA 3BG3A 3A7LA 1B9MA 3PUXA 4H44C 2NN6G 4H0LC 4DNRB 5BN5A 3D31A 1GUOA 2IT1A 1H9JA 3TZUA 4TQUS 1Y69U 4LK1C 1O78A 3A8KE 4KKUA 1Y8NB 2B8FA 2AUKA 3ND9A 3PUWA 1H9KA 2L5TA 3T51B 2ZT9C 3H94A 3NE5B 1ONLA 1TKWB 5K36G 1V8QA 3OW7A 2K32A 4H13C 2O5JC 2A68D 3I73A 2JEAI 1H9SA 3VR5A 1Z7TA 5C0XH 1HQMC 5KNBA 2E76C 3HGBA 2JXMB 1HTPA 4KMUC 1V43A 2A68C 2F1MA 4OO1H 1EWHA 2BE5D 2D5DA 4KKSA 5JEAH 2DNEA 2PPBC 1E2ZA 4PV1C 3A8IE 1ZKOA 3GD7A 5KNDA 5A35A 2D2CC 1OXSC 1Q1BA 1GHKA 3MXUA 2EVBA 3ND8A 3T53B 5C0XG 2NN6I 3I4LA 5K36H 1HPCA 1VDZA 1DCZA 1Q12A 4OO1G 4KKTA 2AWOA 4XTCS 1GUGA 3SE0A 3FPPA 3LNNA 3MFYA 1DXMA 1OXVA 4IFDG 3PUVA 3CRKC 4GZYC 3IKJA 1GUNA 2AUJD 3IFTA 2E74C 3QG1A 1H9SB 2K7VA 4G7HC 4OGQC 4DK0A 2EJGC 1QJOA 2KCCA 1YNJC 2A69C 2JE6I 3LWUA 4XIGS 1O7LA 1YNNC 4IQZA 4G7ZC 4I7ZC 4DNTB 2BDOA 2A6HC 4BA2I 3BDOA 2PCFB 3FMCA 4KHZA 2KA7A 4DK1A 4IFDH 1CI3M 3D4RA 5JEAG 2EDGA 4TKOB 1I6VC 3VA7A 1K8MA 2QF7A 3W3AA 5BN4A 2CW0C 3GQBA 3AB9A 1GUSA 1Q90A 1B9NA 2EJFC 1IYUA 1Q1EA 4LJZC 3PV0A 1OXUA 3P20A 1TU2B 3A7AB 4JBWA 4HR7B 2A69D 2D62A 3EQLC 3QIAA
chains in the Genus database with same CATH superfamily
4NMZA 1PYBA 1CA5A 3T16A 1GVPA 4A3IB 2R92B 4DR5Q 1FJGQ 3M9BA 1RDPD 2Q2IA 1JR0D 1L0YB 3TEHB 3S17B 4WORA 5C4JH 3KDFA 4KD3A 3ITPA 2Q2UA 3HOUG 4N9PA 1EIFA 3ULJA 1Q7YC 3UI2A 4Z9CB 4K0KQ 1I4RA 3I70A 3H0GB 2PZTA 3M4OH 4KI0A 3M4YA 3KFUA 4DR7Q 2A74C 3CCSA 5JVG3 4DAYB 5I2YA 1LTSD 1K28A 4A3EH 4IOCA 1X3GA 3CAMA 4NKLA 2ZM6L 1ESRA 1BR9A 4XQNA 1I5FA 2A19A 1QB5D 3H91A 3U50C 2TSSA 4YY3Q 5C4HA 3J7AV 2Z9HA 2Z0SA 3DWAA 4TQUS 4DF7A 2ID0A 3ND9A 4DV7L 1SNMA 1AE2A 5LL6X 2O4XA 1HNZQ 5M9OA 2VUMH 3QO2A 1EQRA 1K8AC 3MEFA 4A75A 1JORA 1STGA 3T1YQ 1XNQQ 3CKIB 1HTPA 4C3JG 3L3OC 2Y0SE 4H02A 4JPBW 5M5XH 3B6YA 2K5QA 2K14A 1SJED 3TBIB 3TP7A 2RVLA 3PO3B 4A3MG 3U58A 1CQFA 5CBEE 5IGEA 4E6IA 1N34L 1SDFA 1KXLA 5CBAE 3MFGA 3D4DA 3J7ZC 4GOPA 1EYGA 4IPHA 1KDAA 3J80E 5IGFA 4UP8A 4C2MH 1BBWA 5FOBB 2PCFB 3FMCA 2KA7A 1BBXC 3H6MA 2OQKA 5JEAG 1A2TA 1F2YA 3ZJYC 4X62Q 3HFZB 2BH8A 1N9WA 1K83H 2VB2X 2ZXRA 1JB7A 3BVZA 3FRPB 1D7QA 4XT3B 2N88A 1PFBA 4RKBA 1HZ9A 5DEHA 4LUOA 1EFWA 1BDOA 5CMDA 1NMGA 2EJMA 4P72A 1L1OB 4RHSA 3I4NH 4MHEA 5FKAC 4XT1B 2PZUA 4A3IG 4QL5A 1I50H 4UHVA 3H3VC 3C3LA 3PF4A 2QCPX 4ZQ3A 3NBIA 2EXDA 3GO5A 3MA2B 3PUZA 5FLXL 3SR1A 3KLWA 4GN4B 3MXPA 1H9RA 1HZBA 1SFOH 2F0MA 2NTSA 4Y7NB 3FKIG 2BA1A 3OTOL 3U9OA 2G5DA 1PTOC 4B3SQ 2F0TA 1STNA 1Y8PB 1D8LA 2VQEL 2OCEA 1QNKA 1TXYA 4H0LC 1DONA 1W2BA 5C3EH 1EU4A 4A3DG 1HQRD 1U4LA 1WCMB 1U9RA 3NE5B 1VQGA 1VS0A 2WAQB 2I5LX 2DY7A 4GOPC 5IE8A 1CHPD 1UE1A 5DLQE 3SK4A 1PDQA 5KNBA 1B3AA 1SJHD 3KUPA 1STEA 5EBDA 4HJ5A 1I94L 2PPBC 2FMCA 5JPMC 3GV3A 2FFKB 3D8GA 4DV6L 4DV5L 2YV5A 1QVGA 3GTQH 2J0TD 4IJHA 4PNYA 5H1SE 3PO3G 2MO0A 2QEXA 2Z1CA 2E2HH 4G57A 1CA6A 1P16A 2K1BA 3G48A 1SE4A 2K7VA 2JA7B 2MUYA 2VL6A 1NAPA 3K7AB 1PH6A 3RZOB 4Q5VA 2ENBA 4G4KA 3R8BA 4QIWE 1NBWA 1YIJA 3BZKA 4KHZA 2K04A 5IT9c 1QILA 4RKLA 4GS3A 2KHSA 3QR8A 4JI1L 2WB1E 3HKZG 3S1NB 2QF7A 3K80C 3GQBA 4DR3Q 3S14H 4CDEC 2RF4A 2RCFA 5I6WA 1Q1EA 1PFSA 2RKSA 1WD1A 1LT4D 1NTGA 3E9HA 4KK7A 3TN2A 3M3YH 1W6KA 1STYA 3BYYB 2KENA 1EZ8A 3RLOA 4C3IG 1VQLA 2Q2TA 4K5XA 1SR3A 4JI2Q 5IYDG 1EYCA 1QWYA 3S24A 2I0QA 1UWVA 1VQFA 1SE2A 4RHRA 3S15H 1KD1C 1YHAA 3KDFB 5G3LD 1YZ6A 3RZDH 3R2TA 1JE5A 4IO9A 1A2UA 1UUPA 5C4JB 2A6ED 5CV5A 3E6ZX 3EROA 2AMCB 3M4OB 1LT5D 5KEEA 1EY6A 2EPBA 3HOUH 1A6XA 1N36Q 2OTLA 4FVMA 5D3IB 1FGBD 3KF6B 4F87A 3S1RH 2P5ZX 5ELCA 2IT1A 3RLNA 5CV6A 2RQXA 1H9KA 1WTHA 4KJNA 3I56A 1YI2A 1JE4A 4IN3A 5IGBA 2LS01 1K0SA 3SVMA 2HUGA 3X3NA 1TS3A 1TWAH 4ZAIA 1JWUD 2VUMB 4QCLA 2N49A 2WAQG 1LTTD 4LW1A 1S5DD 5GROA 1R9TH 1N33Q 5IP9H 2SNSA 2L55A 1E3PA 1GKHA 3K0YA 2QDLA 1E7ZA 3ND8A 1MSHA 5FO7B 5M5XB 2F0UA 1SNDA 2BOSA 2JP1A 1STAA 2UU9Q 4OO1G 4LF5Q 4B3TL 4IFDG 1B1ZA 2PYKA 1GUNA 4GOPB 4RMFA 4R4QA 3UE0A 1EUJA 1EQVA 4A3MH 1EWIA 2ZJQA 1CKOA 1G51A 4UPAA 1JJGA 2A6HC 1B7YB 1FGUA 3L0OA 1D2BA 3FVQA 5GAHC 1HA5A 3TREA 4C2MB 1HNXL 3U4VA 2OTJA 5JEAJ 1K8MA 2NWGA 3C46A 1DJRD 1U4RA 5GAGC 1K83B 3P20A 4XYQA 4HMJA 2G9DA 2F4VQ 5J1ZA 5JEAH 5E4WC 5BR8Q 2EY2A 3ONAB 2MFIA 4KN4C 4AQYL 1JWMD 4GKJQ 2OXPA 4RA8A 1C48A 1T5XD 3KLRA 2N8NA 3DM3A 2NVXH 2YU9H 4FO2A 3VR2A 1FNWA 5D65A 3BDCA 3C1FA 5K5PA 5J39A 1VMCA 3I4NB 1MJEA 5C44G 2R7DA 1I50B 4MN3A 4OWXB 3HG9A 2J7ZA 1AN8A 1D1KA 1W6JA 4IURA 4A3GH 3UDXA 1JMCA 1SFOB 1XNRL 4BA1I 4I65A 3TP5A 4N9TA 2NZ1D 3CCQA 1J9OA 1LYLA 4R4IA 4JI4Q 2KEEA 1HUMA 5M5WH 3D31A 4Y52H 1WTQA 2M00A 4KKUA 4A3EG 3FKIH 5IIFA 1A3VA 4A93G 2QILA 2F0IA 5C3EB 2Y0SG 2J4XA 3Q23A 1TS2A 2JXMB 5IGCA 5T1GA 1ICFB 3CU7A 5J22A 3PIPA 4A3BH 1X3EA 2JA6G 3OMGA 2SOBA 2MO1A 2WACA 1VQ7A 2VUMG 3QWNA 4B3RL 4A3DH 2I07B 2WKDA 2PNHA 3V2TA 2EVBA 2C5CA 4OX9L 1V1OA 1EIGA 5AFWA 4RGMA 2RA4A 1BKBA 2JYOA 4UAIA 1Q82C 4JI6Q 4XTCS 1WTVA 1JOOA 1Y1VB 1HRJA 5CGKA 3CRKC 3GTQB 4NDXA 4DAVA 2NUCA 2CWPA 1PV4A 4AIMA 4F7XA 1S5BD 2YTXA 2E2HB 2VW9A 3I55A 1VQBA 5HY6A 2UXBL 1C9OA 1KNEA 2F4IA 4UP9A 2JA9A 2H5XA 3C2PA 1SE3A 1XMOQ 4C3HH 5HGQA 3S1QH 4OO1I 4TKOB 3HKSA 1O80A 4GKJL 4X65L 2K75A 2EJFC 1EEID 4QMGA 1PH8A 4ZCKA 4FP5D 4LJZC 4O2DA 3S14B 1U5KA 4YCUA 4XXEA 3TZDA 1MGSA 2R6GA 3M3YB 2MPMA 1PFMA 2EY6A 4RCNA 3OOCA 2CCZA 4N8FA 1VQ8A 5FO9B 2YTVA 3PGZA 2RDGA 3CRLC 1NUCA 3PCOB 4DGZA 2B2UA 1X6OA 2HHHL 3OIPA 1YJWA 3S15B 2WKCA 1U4PA 4X66Q 1YHQA 4RCOA 2EZVA 5IYDH 2F0DA 3KBXA 2KEDA 1PRTF 5LMNW 4WJ4A 4X3SA 1SBBB 4CKEA 1E2VA 2BE5C 5JJIA 1ILQA 5EKLA 1U4MA 1ILPA 4FF2A 1B9MA 1KQSA 2HCCA 2MP1A 3HOUB 2UXCQ 3I3CA 1VQ6A 4R1JA 3NTHA 4CKBA 1TQOA 1X9NA 2I5MX 3CMEA 3KJPA 3S1RB 2NB0A 5JAVA 1N32L 4CBVA 3EIVA 1PZJD 3U4ZA 3EBEA 4NXML 3S2DH 4JI6L 4PZ6A 1V43A 4DAPA 3S16H 1TWAB 4ZLTF 1PTOD 4JI8Q 5EJWA 4DKAC 1C0AA 1BUVT 1BVSA 1EY5A 2NTTA 3TS0A 1R9TB 2ICIA 3FDTA 3K6OA 1HPCA 1WTWA 3N52A 1TWGB 2KJXA 3H3VI 1Q12A 2EY5A 2UUBL 1XMOL 4HIMA 1EU3A 3IKJA 1Y14B 3CPFA 1YNJD 2LY7A 5JPNC 5C3WA 4IFDJ 1EFID 3Q6SA 1IBLL 2IX0A 2ZM6Q 2EE1A 4K2KA 3HOZH 1STBA 1F2LA 1SNQA 1WTPA 1T9HA 1K0RA 3BDOA 4XYOA 1MSGA 5E4XA 4IFDH 1V1PA 2EYFA 2ZTCA 4A3MB 4DV7Q 3HOWG 2R7FA 5IWAQ 1NJIC 4A3LG 3G6EA 3GTPH 3VA7A 2B2VA 4DR6L 3NTKA 3HOXG 4ALPA 2Z6BA 1N8RC 1P8LA 1RTNA 4LUVA 1XYIA 3I91A 1F77A 3HOYG 1D5ZC 4JBWA 1J5EL 5D14A 3F2DA 3GTOH 3KK7A 3J80i 5C6AA 1IW7C 4BY7H 3HP3A 4APVA 1G2TA 1N34Q 4UDUC 4MTKA 3DLLA 3K5OA 4C1NK 2NVXB 2CH4A 1ML0D 4XDXA 4K14A 2YU9B 3UDIA 4RFBA 1SMYC 3K59A 5CV9A 2IHFA 5ELDA 2UXCL 2E75C 4GLXA 4L5SA 1MI2A 2GA4B 4JI5Q 1T5EA 4JG2A 2Z6KA 4P74A 5FJ8H 5CR3A 2F0EA 1X3PA 5C44H 4HTHA 3RUZA 4GNXA 3VYTA 4R8NA 3PO2H 4OHJA 4P73A 4PMWA 5C0XJ 3BVMA 4JI8L 1O78A 1EIYB 2F0NA 5M5WB 2KBNA 5CYUA 1HR0W 3NENA 1TKWB 5K36G 3MXNB 2RDHA 3FKIB 2JEAI 2JA5H 5C0XH 5FLMG 1E22A 2GVBA 4KHVA 1PRTD 2IL8A 3H3VH 3ERSX 2MNAA 1YEZA 1WI5A 3LWEA 4A93H 3NTIA 2KUMA 2QDBA 3HOVG 4YIJA 4A3DB 1JJ2A 2B2VC 2C35B 2RSOA 4BBSG 5IP9G 4MNOA 3AU7A 1SNPA 4GZYC 1IKMA 3OTOQ 2JA6H 2PZWA 2E74C 3QG1A 3G6JB 5IWAL 1H9SB 3IAYA 3Q8DA 2EY1A 1PTOH 4DXFA 1QUQB 2VQEQ 1H95A 3OMCA 5LL6S 3TQYA 3MXGA 1WFQA 4J6HA 1LTLA 3NSWA 5KGUA 4X64L 4HN7A 2DGYA 4DR1L 2A73B 1ASZA 2Z4IA 4HCEA 4M8AA 4C3HB 2ZTDA 3S1QB 4IUUA 4TSSA 1PZKD 5LMNL 1I94Q 1XPOA 4RGNA 1HNWL 1W3SA 1I6HH 1QE6A 4IZ8A 3QIAA 1E2WA 5DM63 1WTOA 4EX5A 2A6HD 2Z6KC 4DV6Q 1JB3A 1ZYRD 2NBFA 4DV5Q 4G7OC 2LKVA 5EKKA 1HFNA 5KNCA 1I3QB 4OIKA 1DZ1A 1KNAA 4KV6A 3HKZB 5E7NA 2O5IC 1II3A 1H9MA 1I4HA 4GNXC 2N3SA 4JI5L 2JA8H 1PMRA 1CKNA 1LUZA 2VQFL 2E2IH 3PSIA 2B63G 3K5NA 1GOZA 1PH5A 3GDEA 3WOFA 3HS0C 4C3IB 3F1ZA 3VR4A 4JI1Q 4BBRH 4HIKA 5FLXE 4O42A 1WVLA 4JBKA 4ZUIA 3A8JE 2XTIA 2X69A 4IJLA 4DNRB 3G7LA 5BN5A 4LF4L 3J80L 3CCRA 2XSCA 4A3GG 1BCPB 1PYWD 3A8KE 5LMUQ 1A3UA 2AHOB 1TR5A 1SNCA 1KAAA 3Q24A 3R3OA 3DWQA 4KLKA 2K32A 4M1UB 1MBYA 2DJGC 1JWSD 4P2CB 2PMZB 1HQMC 5J3BA 2QGQA 4B9WA 4WJWA 4OEMB 2D5DA 4QJFA 2LSSA 3S2DB 1CZGA 1UNSA 3S16B 1YNXA 1GHKA 2FINB 4DPGA 1WD0A 1X54A 5DNFA 1MD2D 1VQ5A 3NXWA 1IBKQ 4A3BG 3GTGB 3C1EA 3Q22A 1CSPA 3JAMc 3GTKH 2R3ZA 2IJ0A 2K4KA 1ESFA 4B08A 4OGQC 3UDFA 1LV9A 4DK0A 2EJGC 1YNJC 1UE5A 4LUZA 1V9PA 4IUTA 3AQQA 3HOZB 4HSVA 2HQEA 3I2ZA 2WV6D 1CQVA 3BJUA 1YHBA 5I9PA 3HRZC 4DV3L 3R93A 2PQAB 1TWCH 3GTPB 4C3HG 1I4QA 4OXPA 4DK6C 4HR7B 1VQIA 3HOWH 1X3FA 3K57A 4A3LH 3HOXH 3GTOB 2WFWA 3A55A 3M7NA 4KTAA 2D0OA 5BN3A 1G6PA 2F3IA 4B3TQ 4BY7B 1DYQA 4JOIA 3HOYH 2DNCA 3E0JA 1KDBA 1WOCA 1HR0L 4JV5Q 5EPJA 4BWGB 4EQ5A 2V4DA 1DD2A 5C5MA 1EZ6A 5LMUL 3KF8A 1HNXQ 3RN2A 4KHPQ 3OWFA 3U9SA 5CV7A 4A76A 4R4OA 4YCWA 2F0JA 2ICEC 1FYCA 2B39A 1RHPA 1Z6HA 1E1TA 1I4XA 1R4PB 4FDBA 3CHBD 5C44B 2L9HA 3PUXA 3HEJA 3J81E 3E9IA 1H9JA 2MGSA 1Y8NB 1OTCA 1D1IA 4AQYQ 4DV2L 1UEAB 2RHQB 1IBML 4LF9L 2F3WA 3W5OA 3NBHA 4IPCA 1IBKL 1SE8A 3AYHB 2G9HD 4AYBE 3CC7A 2JA5B 2BE5D 3BVGA 4TRDA 3BS1A 3F2BA 3GTJH 2F52A 2F0LA 1YJNA 1PRTC 1Q1BA 2A5HA 1AFPA 3MTSA 5K36H 4P71A 3SEBA 4YHHL 4A3EB 4JI7L 1LTRD 1FNVA 1LM0A 1DCZA 4A93B 5FLMH 5FO8B 3EN2A 4ZKBB 3S2HH 4KY6A 1FNUA 5FK9C 2HIXA 2Y0SB 1YBYA 3D4WA 5GQOA 1YNND 1XNRQ 1AW7A 1M8AA 2F0FA 4GKKQ 1DOLA 2A69C 4KY5A 2JA6B 3HOVH 2MHVA 2Z8LA 1AZPA 4POGA 4BBSH 1PTOB 1IZ6A 5KYIA 1EOVA 5CC4A 1RF2D 4JOIC 4MIUA 1K3BC 4HJ9A 1LLRD 3FPUB 5IODA 3RR5A 3HOZG 5JJLA 5GAEC 3QOLA 4LF6L 3AB9A 4FF4A 1Q90A 2FMMA 1JOKA 2BCOA 2RHSB 1SROA 3W2DA 1VQ9A 2JK8A 3RNUA 4I7AA 2B2WA 2V1CC 2UUAL 2UXDL 1MIUA 1BBUA 2XVSA 4B3RQ 3D0FA 1I4GA 3GV6A 4OX9Q 1TVXA 1QVCA 1SYBA 4X3KA 4JV5L 3CCVA 1I6HB 1PA6A 1X65A 2Q2HA 2H4OA 4HEDA 1JCKB 5E1FA 1S3OA 2JN4A 4L8JA 5IP7G 1ZYRC 4A3JG 4A3KG 4C56C 5ISRA 2LMCB 1CTMA 4KHPL 3ICEA 4BY7G 1IHZA 1ENFA 2JA8B 2UUCL 2C9OA 4P75A 1QVFA 5AJ3Q 2UXBQ 1A0IA 3UE1A 2E2IB 1S72A 3MWYW 2PI2A 2IHEA 1QZHA 1IW7D 3T1HL 5NUCA 2IW3A 5EPKA 2L0CA 1Q8KA 1Y1WH 1KABA 4CDCC 1O7ZA 2F0HA 2PI2E 4LFAL 4K6DA 4BBRB 4X65Q 4ME3A 2B63H 1FL0A 4H44C 5I2XA 4A3FG 1YITA 1SMYD 3TZUA 5FJ8G 1JJCB 3D3RA 3V96A 3JAMi 3NQIA 3PO2G 3NWSA 3HGBA 3J80c 1O7IA 2KVMA 2B3GA 5KRUA 1EQTA 1TY2A 1LTID 2EQSA 3GD7A 2HHHQ 5E3FA 4GKKL 4QGUA 2JA5G 2EYPA 5C0XG 4DV1L 4LMQD 5C4ZA 2PQEA 2HD3A 5M5YH 4HMIA 4KKTA 5COYA 4NB3A 4EGVA 3FEWX 4Q0FA 1DXMA 1OXVA 3OHXC 2F0SA 2CFMA 2AUJD 3W1GA 3IFTA 2B2WC 2EOTA 4G7HC 3A54A 4ZK9B 3GTKB 1EYDA 3LWUA 4XQJA 4K8IA 2KCMA 3A5ZB 1K3RA 2E2JH 5M3FG 1N32Q 2K5VA 4F88A 1KHIA 3G71A 1X55A 1STHA 2WP8J 4CHTB 4ULLA 4NXMQ 3I4MG 4NXNL 1C7YA 2TMPA 4DXGA 1OO9B 1DM0B 1OXUA 1G91A 1TWCB 5D3DA 5CV8A 1RD9D 1NNXA 1SYCA 2BA0A 1VQEA 4HIDA 2Z4HA 2Q8IB 5AJ3L 2NVYH 3HOWB 3P7JA 3KBGA 2UUBQ 1VQCA 4WJ3M 2R61A 3L9AX 3HOXB 2CH4W 2DY8A 1ZEQX 4GLAC 1IBLQ 4HSPA 1F9PA 3HOYB 1UEBA 4IFDI 1XTDA 2LFNA 3CW2C 3K0XA 4IPGA 5DAUA 1PYSB 3M85A 1GM5A 2JA8G 3SDZA 1GD7A 5IY0A 1Q8IA 2D9UA 2YTYA 5A2QL 3DHQA 3NQTA 3CCUA 4DR6Q 1DGSA 1LTGD 4CDDC 4QF4A 2B2TA 3VYSA 3A7LA 1J5EQ 4R8IA 4BBRG 3GP7A 5EGTA 1XMQL 1TT2A 1PLFA 2VY3A 1B50A 1XWEA 3NBHB 3RZDB 4YWKA 4HJAA 3I73A 5ELFA 4DU9A 5C4XG 1FVIA 2KHJA 4CDFC 3CQZH 2E5LL 1QCBD 3W1BA 4IOAA 1QG7A 1LT6D 1LTAD 4CGYB 4RGTA 4NW2A 1BNZA 4R4CA 3ULPA 3T53B 1YVCA 3GTJB 4EQPA 2AWNA 1HUNA 1TY0A 1AP0A 1GUGA 2K6AA 3HKZE 3SE0A 3CPWA 3MFYA 4DAMA 2CVRA 1TS5A 4K2LA 1QNUA 2OQ0A 3MEHA 3S2HB 2IX1A 1CM9A 1YNNC 2RDFA 4IQZA 3TP8A 1L1OA 2F0QA 1PVOA 2XRQD 2PO4A 3NWTA 3JAML 1PHJA 3HOVB 4YWLA 3D4RA 5C0XI 2EDGA 4DK3C 3A56A 4BBSB 4HAEA 5BN4A 1M1KC 2CW0C 1G6ZA 2F03A 4NPSA 5EQ0A 3CXCA 1B9NA 3EFXD 2KECA 1FD7D 3FP9A 3P1HA 4U673 2D62A 4LF7L 1XTCD 1ENCA 2WB1G 1U0LA 4S3SA 2N78A 4JVZA 3VR6A 2B2TC 5IT9E 4OIJA 3ERQA 4XQQA 2O2LD 1Q86C 4FNFA 3PIOA 4LF8L 1RCVD 4JK1C 4B3ML 1F9RA 1KDCA 3P75A 1VQOA 1LT3D 4H7BA 4DV0Q 1SYGA 2F0VA 2L11A 2XN9C 4A3JH 4A3KH 1JT8A 3ZYYX 5IP7H 4DR2L 3TSSA 1VQDA 3VA5A 4ODGA 1VF7A 1HXYD 1SXTA 2F0PA 4X64Q 4ZYSA 2X6LA 4DR1Q 2WAQE 2VS1A 1GUTA 1L0XB 4QUCA 1Y1WB 1LACA 2LXJA 5LMNQ 1HNWQ 2B63B 2JA7H 2WIIB 2B8FA 3PUWA 3CCMA 2N55A 2NVQH 4AYBG 3PF5A 3CCJA 3PQIA 2A68D 2XWBB 5EBCA 1G2SA 3VR5A 1UE7A 1HJPA 4A3FH 2Q8TA 3J7A5 4ZRZA 1L1OC 2R7ZH 4PZ8A 3A8IE 5KNDA 4IUNA 2VQFQ 4EQOA 3S1NH 2DJFC 4JI3L 1OXSC 4A3GB 5IYBG 5EPLA 4DR4L 4DUYL 1AE3A 4DUZL 1VDZA 1XJVA 1K8GA 1VQMA 4C1NI 1KL9A 5C3XA 5M5YB 4POFA 1KRTA 1NCVA 3CCLA 5IGGA 3BZDB 2JE6I 2BDNA 4XIGS 2K5DA 4JW0A 4G7ZC 4X3UA 4LF4Q 4L5TA 4BA2I 2VXWA 2L12A 4A4IA 3TP6A 3TRZA 4A3BB 3CCEA 4KJOA 1ICWA 1AEXA 1NR4A 1NY4A 2NYZD 2E2JB 4RH6A 2K03A 2SNMA 3E3XA 4N8X1 2K5HA 1Q81C 3PV0A 5JJZA 1IKLA 1ZXTA 1IYJB 2A69D 5M3FH 1HHVA 1HH2P 1WTXA 4JYAL 1DOMA 2F3VA 1Z47A 1IL8A 4DV0L 3STBD 2E2DC 2F0WA 5JOBA 3I4MH 1AH9A 3T56B 1Z9FA 4LAAA 2NVYB 1Q46A 4K6LA 3E5SA 2EYJA 3KF6A 4ID6A 4PG3A 3ULLA 1KTKA 1OXXK 1KRSA 1VCIA 3J7AF 4OWWB 4GLVB 1GJXA 1B3QA 1KC8C 2JQOA 4L6TB 1FR3A 2NN6H 4OONA 2M9VA 5JVH3 2K33A 4DV3Q 4JCVE 3K8AA 2ATWA 3RN5A 3WDNA 3K58A 4HJ7A 1A8VA 4RAUC 2ZXOA 4DFAA 1Y1WG 2VZAA 1NMFA 4LK1C 4R4TA 1A63A 3T51B 1SYFA 5ELOA 2NVTH 3SGIA 4F8MA 4RWSC 1EWCA 1E0BA 4O0AA 1Z7TA 2IY5B 3CMAA 2CHBD 2E76C 2XGTA 3BZCA 3URYA 2DNEA 4PV1C 3CQZB 5G3LF 1GO3E 1HR0Q 4DV4L 4QY7A 3MXUA 1JOQA 4WFN3 4BY1H 3J81i 3JC66 5C4XH 4OELB 4DR5L 2AWOA 3FPPA 3MHBA 1FJGL 1PH1A 4IUPA 4BXXG 2EYLA 4CKCA 3M4PA 1B53A 3D6WA 3J7YW 4EQNA 4ILWA 4I7ZC 4DNTB 4K0KL 5IYCG 1V1QA 4DK1A 2L15A 2B2YA 2R92G 4DR7L 2A8VA 4DV2Q 1CKMA 4LF9Q 1IBMQ 1K9MC 1VQNA 3I90A 4HIOA 1F9SA 4EVOA 2FJ2A 4ZKCB 4YY3L 2HQLA 2L1BA 2AQ2B 4JBMA 1EY8A 4X6AH 3F2UA 1VF5C 2ZXPA 3PMFA 5TSSA 3DMUA 3H0GG 1O7YA 3OYYA 3DXJC 3RLFA 4YHHQ 1WTRA 1HNZL 3GTLH 4JI7Q 1MHWC 1R4QB 2PNRC 3BDLA 1V1PB 3T1YL 1XNQL 4ABNA 2HCIA 1GHJA 1F9QA 2CQAA 4O1NA 4CJ1B 1CZWA 1KAWA 1A62A 3NHHA 1VQPA 3ER0A 1BOSA 4J1MA 1D6EC 3CD6A 1X3QA 4A3JB 4A3KB 2E8GA 2OEOA 1PFNA 5M3MH 1SSOA 4LF6Q 3KLSX 1CFMA 3A5UA 1CK1A 1Y1VH 1EL0A 3L2PA 2RCNA 1J6QA 2UUAQ 2UXDQ 1PXUA 2CKZB 1TWHH 4X3TA 2CQOA 1RJTA 3NP8A 3LX0A 4PQXA 4X62L 2AQ1B 3IFDA 1PH3A 1EY7A 3KOJA 4IALA 3E0EA 3K5MA 2NVQB 1EOTA 2EYOA 2K52A 2A68C 1EWHA 1DOKA 1E2ZA 2R93H 3AFPA 3CP0A 1BCPF 5A35A 4GNXB 2UUCQ 4A3FB 2B2YC 4LFBQ 1S5CD 1QOHA 2R7ZB 4A3CG 1EQQA 3T1HQ 1S4ZA 2GN5A 3PUVA 4OL7A 2FXQA 3PO2B 5HGTA 3T4AC 3K81C 4LFAQ 5KIXA 4FYDA 2IPKD 5IYBH 3M7GA 2KCNA 1M4VA 3KLSA 4FF3A 2XNAC 1B44D 3K7UC 4KY7A 2BDOA 2OWOA 1TS4A 4JI0Q 2M2LA 3WOEA 2KCTA 2K01A 3AMUA 4K8JA 1I6VC 1XXGA 3W3AA 5EKIA 4B3SL 4DA2A 2VB3X 4MTNA 1BXTA 1L0WA 5KYLA 3DEOA 4FXGC 1J8IA 1TU2B 3J81L 5GADC 1AZQA 4JC0A 4DV1Q 5M3FB 1E24A 1EY9A 2OT2A 1SEBD 4K5VA 1BQQT 3CC4A 3PUYA 1K8OA 2MQHA 4J8QA 4U68A 3F8TA 3STBC 4V190 3I4MB 2CW0D 3WWVA 1IXRA 1CSQA 1WYDA 2F0GA 2F0OA 1SN8A 2SEBD 5IOCA 1PZID 1WCMG 2ALYB 2X6GA 3OPOA 3CC2A 2D0PA 1SYDA 2PW7A 3SHLA 2EYMA 2ZJPA 4HJ8A 1LABA 1TWGH 1QZGA 1KIXA 4KN7C 4NXNQ 3S1MH 3BG3A 1CKNB 2MJ8A 1RL2A 4V0BA 1MJCA 3G4SA 1TWFH 4C3JH 3R2IA 3K5LA 1K73C 2RBMA 2EYHA 4LFBL 3H94A 1C8CA 3QOJA 1V8QA 1VQJA 3OWEB 4DR3L 2GVAA 4KMUC 2NVTB 3AFQA 2JA7G 2F1MA 5IGDA 2KHIA 3HZXA 3IL8A 1E1OA 2K05A 1CHQD 1A3TA 3I4LA 2ZTEA 4JI2L 4B9XA 3GTMH 4BY1B 2R7ZG 1UAPA 4MZ9A 1YJ9A 4JI0L 2XIWA 4JBJA 5C4XB 3SK8A 1S40A 5T1IA 4RG1A 2KCCA 4IUQA 1XPUA 5ELEA 1HZAA 1O7LA 1HFGA 1XMQQ 3DEPA 3VDYA 2FHTA 4BXXH 3VYUA 1BCPD 2HIVA 2K5WA 2Q8RE 3VYRA 1N36L 4IUVA 1M90C 4OWTB 2QW7A 2E5LQ 1PH4A 1BO0A 2CWAA 5IYCH 4PZ7A 3BU2A 1PTOF 3EQLC 1GXDC 2R92H 4A3IH 1HCZA 4DN4M 4PMCA 1SYEA 3EA6A 3MVVA 5DM73 5FLXc 1XX8A 2B8GA 1PRTB 1SLJA 2YYZA 3S17H 4L5QA 1HZCA 3GTLB 1G291 3EJIA 3PIP3 2ZJRA 1N33L 3I4OA 3H0GH 1XPRA 3VR3A 1S5ED 3SK6A 1X32A 3L7ZC 4QIWB 1IYVA 4K5WA 1S5FD 4NP5A 3MXNA 2UU9L 4LF5L 2QEJC 5C5LA 2PW5A 2WB1B 3SK5A 2BH2A 1L2FA 2JEBI 1Y8OB 4DAYA 1NSNS 3DM1A 1UE6A 3UDGA 4ZUJA 4FXKC 5I6YA 5M3MB 2NN6G 3TDQA 1F2ZA 1GUOA 1RODA 5A2QE 4LF7Q 3SXHA 5L37A 2H1EA 2QKIC 4UY8C 1ONLA 1TWHB 3OW7A 1LTBD 4RGOS 2A1AA 1H9SA 3KF8B 1KLGD 4YWMA 2ES2A 5LHY1 4CJ2C 1QUQA 4L63B 4L5RC 4LF8Q 3A0JA 3PO3H 2JSOA 1ZKOA 4B3MQ 2F4VL 3T13A 1D5XC 5BR8L 2NZHA 2R93B 3NPPA 4FF1A 1I4PA 4DR2Q 3OIQA 1PH7A 1ENAA 2KQ3A 4AYBB 5HURA 3LNNA 3I8ZA 3RD4A 3MC0B 1SNOA 4BY1G 1IL2A 4QUFA 1I3QH 1VQAA 1BF4A 1CUKA 2SDFA 2K50A 4A3CH 1PH2A 4PMBA 3NEMA 3D6CA 4TVAB 1CT1D 1SMXA 4J15A 4UP7A 4LFCQ 1CI3M 1LO5D 4DNIA 2K5NA 3I4NG 5I9OA 3IRBA 4FXDA 2NZOA 3FHWA 4C3IH 1G8ZD 3JAME 1B2TA 3TS2A 1IYUA 1JC7A 4QB4A 3J81j 4JI4L 3A7AB 3MAQA 1WJJA 4JI3Q 3S9WA 2A6EC 4DR4Q 4CJ0B 4DUYQ 4DUZQ 2WINB 3EVQA 4LWCA 1X56A 2DN8A 2K28A 1EIHA 3J81c 2IX3A 3OW2A 1OXTA 1NE3A 3DUZA 4WRDA 1C4QA 3QJYA 5ELBA 3LGJA 3F2CA 2IWHA 1RIPA 4BS9A 4Y7NH 1SRUA 5CORA 5JJKA 3A74A 2LXKA 5C3EG 4R9WA 2B29A 1ET9A 2I46A 3M4QA 4KD4A 2KOLA 3OSOA 3N6RA 2I5HA 1ET6A 4QQBX 1RKNA 3GTGH 2PMZE 3I72A 5F2DA 3KJOA 3CF5A 2ASBA 2AQ3B 1WCMH 3S1MB 1HTLD 2AKWB 1Y69U 2DUDA 1HA6A 4GN5A 4GN3B 4JYAQ 5M3MG 2AUKA 3AEVA 1MKHA 2F0KA 2L5TA 2ZT9C 3PIO3 4IPDA 1Y1VG 4H13C 2O5JC 1TWFB 3I7FA 4C3JB 1EEFD 3NELA 1EYAA 1RTOA 1VMPA 4YCVA 1EY4A 2OF1A 1B4OA 4OO1H 3Q0AA 4KKSA 1EY0A 4LNQA 1NR2A 3QB3A 2D2CC 3X3MA 2NN6I 4AH6A 2B2UC 2JJQA 2VNUD 3V05A 3TMEA 3NUCA 2R93G 2PQAA 4LFCL 2QA4A 1SAPA 2L4NA 3H09A 3MZ5A 3GTMB 2EXZA 1D5MC 3K7AH 3RZOH 5IT9L 1VQHA 3NK9A 2RSNA 1TIID 1QJOA 5EAYA 1JQYD 1A15A 1B70B 4X66L 2XWJB 1B8AA 1F2MA 1Q3LA 1KLUD 2HDMA 2HDLA 3KYHC 2HT1A 5CV4A 5I4DA 2XRSD 1ASYA 2EIFA 1GUWA 3RMHA 5ELNA 3DWPA 1VQ4A 1JICA 1GUSA 1BCPC 1VQKA 3BYTB 4ME5A 1PH9A 4HCSA 3H15A 3O13A 4DV4Q
chains in the Genus database with same CATH topology
4NMZA 1CA5A 3T16A 2R92B 4A3IB 1RDPD 1JR0D 1L0YB 3S17B 4WORA 4KD3A 3ITPA 4N9PA 3UI2A 4Z9CB 1I4RA 3I70A 3H0GB 2PZTA 4KI0A 3M4YA 2A74C 5JVG3 5I2YA 1LTSD 4NKLA 1ESRA 1BR9A 4XQNA 1QB5D 3H91A 2TSSA 5C4HA 3J7AV 3DWAA 4TQUS 4DF7A 2ID0A 3ND9A 1SNMA 5LL6X 2O4XA 5M9OA 3QO2A 1JORA 1STGA 3CKIB 1HTPA 4C3JG 3L3OC 2K5QA 1SJED 3TBIB 3TP7A 2RVLA 3PO3B 1CQFA 5CBEE 5IGEA 4E6IA 1SDFA 5CBAE 3MFGA 3D4DA 1KDAA 3J80E 5IGFA 5FOBB 2PCFB 3FMCA 2KA7A 1BBXC 3H6MA 5JEAG 1A2TA 1F2YA 2VB2X 2ZXRA 3BVZA 3FRPB 4XT3B 2N88A 1PFBA 4RKBA 5DEHA 1BDOA 5CMDA 2EJMA 4RHSA 4MHEA 5FKAC 4XT1B 2PZUA 3H3VC 3C3LA 2QCPX 4ZQ3A 3NBIA 3GO5A 3MA2B 3PUZA 5FLXL 3SR1A 3MXPA 1H9RA 2F0MA 2NTSA 4Y7NB 2BA1A 3U9OA 1PTOC 2F0TA 1STNA 1Y8PB 1QNKA 4H0LC 1DONA 1EU4A 1HQRD 1U4LA 1WCMB 1U9RA 3NE5B 2WAQB 2DY7A 1CHPD 3SK4A 5KNBA 1PDQA 1B3AA 1SJHD 3KUPA 1STEA 5EBDA 2PPBC 2FMCA 5JPMC 3GV3A 2FFKB 3D8GA 2J0TD 4PNYA 2Z1CA 4G57A 1CA6A 2K1BA 1SE4A 2K7VA 2JA7B 2MUYA 1NAPA 3K7AB 3RZOB 4Q5VA 2ENBA 4G4KA 3R8BA 4KHZA 2K04A 1QILA 4RKLA 2KHSA 3S1NB 2QF7A 3GQBA 5I6WA 1Q1EA 2RKSA 1WD1A 1LT4D 4KK7A 3TN2A 1W6KA 1STYA 3BYYB 1EZ8A 4C3IG 4K5XA 1EYCA 1QWYA 1SE2A 4RHRA 5G3LD 3R2TA 1A2UA 1UUPA 5C4JB 2A6ED 5CV5A 3E6ZX 3EROA 3M4OB 1LT5D 5KEEA 1EY6A 2EPBA 1A6XA 4FVMA 5D3IB 1FGBD 4F87A 5ELCA 2IT1A 5CV6A 2RQXA 1H9KA 4KJNA 4IN3A 5IGBA 1JE4A 2LS01 3SVMA 2HUGA 3X3NA 1TS3A 4ZAIA 1JWUD 2VUMB 4QCLA 1LTTD 1S5DD 2SNSA 2L55A 3K0YA 3ND8A 1MSHA 5FO7B 5M5XB 2F0UA 1SNDA 2BOSA 2JP1A 1STAA 4OO1G 4IFDG 1B1ZA 2PYKA 1GUNA 1EQVA 2A6HC 1D2BA 3FVQA 1HA5A 4C2MB 5JEAJ 1K8MA 2NWGA 3C46A 1DJRD 1U4RA 1K83B 3P20A 4XYQA 4HMJA 2G9DA 5J1ZA 5JEAH 5E4WC 2EY2A 3ONAB 4KN4C 1JWMD 2OXPA 4RA8A 1C48A 1T5XD 3KLRA 4FO2A 3VR2A 1FNWA 5D65A 3BDCA 3C1FA 5K5PA 5J39A 1VMCA 3I4NB 1I50B 4MN3A 3HG9A 2J7ZA 1AN8A 1D1KA 1W6JA 4IURA 1SFOB 4BA1I 4I65A 3TP5A 4N9TA 2NZ1D 1J9OA 2KEEA 1HUMA 3D31A 1WTQA 2M00A 4KKUA 5IIFA 1A3VA 2QILA 2F0IA 5C3EB 2J4XA 3Q23A 1TS2A 2JXMB 5IGCA 5T1GA 3CU7A 5J22A 3OMGA 2SOBA 2WACA 3QWNA 2I07B 2WKDA 3V2TA 2EVBA 2C5CA 1V1OA 1EIGA 5AFWA 4RGMA 2RA4A 4UAIA 2JYOA 4XTCS 1WTVA 1JOOA 1Y1VB 1HRJA 5CGKA 3CRKC 3GTQB 4NDXA 4DAVA 2NUCA 4F7XA 1S5BD 2E2HB 1KNEA 2F4IA 3C2PA 1SE3A 4OO1I 4TKOB 1O80A 2EJFC 1EEID 4QMGA 4FP5D 4LJZC 3S14B 4XXEA 3TZDA 1MGSA 2R6GA 3M3YB 2MPMA 1PFMA 2EY6A 4RCNA 3OOCA 5FO9B 2RDGA 3CRLC 1NUCA 4DGZA 2B2UA 3OIPA 3S15B 2WKCA 1U4PA 4RCOA 2EZVA 2F0DA 3KBXA 2KEDA 1PRTF 4X3SA 1SBBB 4CKEA 1E2VA 2BE5C 1ILQA 5EKLA 1U4MA 1ILPA 4FF2A 1B9MA 2HCCA 2MP1A 3HOUB 3I3CA 3NTHA 4CKBA 1TQOA 3S1RB 2NB0A 5JAVA 4CBVA 1PZJD 1V43A 4DAPA 1TWAB 4ZLTF 1PTOD 5EJWA 1BUVT 1EY5A 2NTTA 1R9TB 2ICIA 3FDTA 3K6OA 1HPCA 1WTWA 3N52A 1TWGB 2KJXA 1Q12A 2EY5A 1EU3A 3IKJA 1YNJD 2LY7A 5JPNC 5C3WA 4IFDJ 1EFID 3Q6SA 2IX0A 2EE1A 4K2KA 1STBA 1F2LA 1SNQA 1WTPA 3BDOA 4XYOA 1MSGA 5E4XA 4IFDH 1V1PA 2EYFA 4A3MB 3VA7A 2B2VA 3NTKA 1RTNA 1XYIA 3I91A 1F77A 1D5ZC 4JBWA 5D14A 3KK7A 5C6AA 1IW7C 3HP3A 1G2TA 4UDUC 3K5OA 4C1NK 2NVXB 1ML0D 4XDXA 4K14A 2YU9B 4RFBA 1SMYC 3K59A 5CV9A 5ELDA 2E75C 1MI2A 2GA4B 1T5EA 5CR3A 2F0EA 1X3PA 4HTHA 3RUZA 3VYTA 4R8NA 4OHJA 4PMWA 5C0XJ 3BVMA 1O78A 2F0NA 5M5WB 5CYUA 1TKWB 5K36G 2RDHA 3FKIB 2JEAI 5C0XH 4KHVA 1PRTD 2IL8A 3LWEA 3NTIA 2KUMA 2QDBA 4YIJA 4A3DB 2B2VC 2RSOA 3AU7A 1SNPA 4GZYC 1IKMA 2PZWA 2E74C 3QG1A 3G6JB 1H9SB 3IAYA 2EY1A 1PTOH 4DXFA 3OMCA 5LL6S 3MXGA 4J6HA 3NSWA 5KGUA 4HN7A 2A73B 2Z4IA 4HCEA 4M8AA 4C3HB 3S1QB 4IUUA 4TSSA 1PZKD 4RGNA 1QE6A 4IZ8A 3QIAA 1E2WA 5DM63 1WTOA 2A6HD 1JB3A 1ZYRD 2NBFA 4G7OC 2LKVA 5EKKA 1HFNA 5KNCA 1I3QB 4OIKA 1DZ1A 1KNAA 4KV6A 3HKZB 2O5IC 1II3A 1H9MA 1I4HA 1PMRA 3K5NA 1GOZA 3WOFA 3HS0C 4C3IB 3VR4A 5FLXE 4O42A 1WVLA 4ZUIA 3A8JE 2X69A 4DNRB 3G7LA 5BN5A 3J80L 2XSCA 1BCPB 1PYWD 3A8KE 1A3UA 1TR5A 1SNCA 1KAAA 3Q24A 3R3OA 3DWQA 2K32A 4M1UB 1MBYA 1JWSD 4P2CB 2PMZB 1HQMC 4B9WA 4WJWA 2D5DA 3S2DB 1CZGA 1UNSA 3S16B 1GHKA 2FINB 1WD0A 5DNFA 1MD2D 3NXWA 3GTGB 3C1EA 3Q22A 2R3ZA 2IJ0A 1ESFA 4B08A 4OGQC 1LV9A 4DK0A 2EJGC 1YNJC 4IUTA 3HOZB 4HSVA 2HQEA 2WV6D 1CQVA 5I9PA 3HRZC 3R93A 3GTPB 4C3HG 1I4QA 4HR7B 3K57A 3GTOB 3A55A 3M7NA 4KTAA 5BN3A 4BY7B 1DYQA 2DNCA 3E0JA 1KDBA 5EPJA 4BWGB 2V4DA 1DD2A 5C5MA 1EZ6A 3KF8A 3OWFA 3U9SA 5CV7A 2F0JA 2ICEC 1FYCA 2B39A 1RHPA 1Z6HA 1I4XA 1R4PB 3CHBD 5C44B 2L9HA 3PUXA 3HEJA 3J81E 1H9JA 2MGSA 1Y8NB 1D1IA 1UEAB 2F3WA 3NBHA 2G9HD 2JA5B 2BE5D 3BVGA 4TRDA 3BS1A 2F0LA 1AFPA 1PRTC 1Q1BA 2A5HA 3MTSA 5K36H 3SEBA 4A3EB 1LTRD 1FNVA 1DCZA 4A93B 5FO8B 4ZKBB 4KY6A 5FK9C 1FNUA 2Y0SB 3D4WA 1YNND 1AW7A 1M8AA 2F0FA 1DOLA 2A69C 4KY5A 2JA6B 2MHVA 2Z8LA 1AZPA 1PTOB 5KYIA 5CC4A 1RF2D 4MIUA 1LLRD 3FPUB 5IODA 3QOLA 3AB9A 4FF4A 1Q90A 2FMMA 1JOKA 2BCOA 3W2DA 2B2WA 2XVSA 1I4GA 3GV6A 1TVXA 1SYBA 4X3KA 1I6HB 2H4OA 4HEDA 1JCKB 5E1FA 4L8JA 1ZYRC 4C56C 5ISRA 2LMCB 1CTMA 1IHZA 1ENFA 2JA8B 2C9OA 2E2IB 3MWYW 1IW7D 5NUCA 2IW3A 5EPKA 2L0CA 1KABA 1O7ZA 2F0HA 4K6DA 4BBRB 4H44C 5I2XA 1SMYD 3TZUA 3D3RA 3V96A 3NQIA 3NWSA 3HGBA 2KVMA 5KRUA 1EQTA 1TY2A 1LTID 3GD7A 5E3FA 2EYPA 5C0XG 4LMQD 5C4ZA 2PQEA 4HMIA 4KKTA 5COYA 4EGVA 3FEWX 4Q0FA 1DXMA 1OXVA 3OHXC 2F0SA 2AUJD 3IFTA 2B2WC 2EOTA 4G7HC 3A54A 4ZK9B 3GTKB 1EYDA 3LWUA 4XQJA 4K8IA 4F88A 1STHA 2WP8J 4CHTB 4ULLA 2TMPA 4DXGA 1OO9B 1DM0B 1OXUA 1G91A 1TWCB 5D3DA 5CV8A 1RD9D 1SYCA 2BA0A 2Z4HA 2Q8IB 3HOWB 3P7JA 3KBGA 2R61A 3L9AX 3HOXB 2DY8A 1ZEQX 4HSPA 1F9PA 3HOYB 4IFDI 2LFNA 5DAUA 3M85A 3SDZA 1Q8IA 2D9UA 5A2QL 3DHQA 3NQTA 1LTGD 4QF4A 2B2TA 3VYSA 3A7LA 4R8IA 3GP7A 5EGTA 1TT2A 1PLFA 1B50A 1XWEA 3RZDB 3I73A 5ELFA 4DU9A 1QCBD 1QG7A 1LT6D 1LTAD 4CGYB 4RGTA 4NW2A 1BNZA 3T53B 3GTJB 4EQPA 2AWNA 1HUNA 1TY0A 1AP0A 1GUGA 2K6AA 3SE0A 3MFYA 2CVRA 1TS5A 4K2LA 1QNUA 3MEHA 3S2HB 2IX1A 1CM9A 1YNNC 2RDFA 4IQZA 3TP8A 2F0QA 2XRQD 2PO4A 3NWTA 3JAML 3HOVB 3D4RA 5C0XI 2EDGA 3A56A 4BBSB 4HAEA 5BN4A 2CW0C 1G6ZA 2F03A 5EQ0A 1B9NA 3EFXD 2KECA 1FD7D 3P1HA 4U673 2D62A 1XTCD 1ENCA 4S3SA 3VR6A 2B2TC 5IT9E 4OIJA 3ERQA 4XQQA 2O2LD 4FNFA 1RCVD 4JK1C 1F9RA 1KDCA 3P75A 1LT3D 4H7BA 1SYGA 2F0VA 2L11A 2XN9C 3ZYYX 3TSSA 3VA5A 4ODGA 1VF7A 1HXYD 1SXTA 2F0PA 4ZYSA 2X6LA 1GUTA 1L0XB 4QUCA 1Y1WB 1LACA 2B63B 2WIIB 2B8FA 3PUWA 2N55A 5EBCA 2A68D 2XWBB 1G2SA 3VR5A 2Q8TA 4ZRZA 3A8IE 5KNDA 4IUNA 4EQOA 1OXSC 4A3GB 5EPLA 1VDZA 4C1NI 5C3XA 5M5YB 1NCVA 5IGGA 3BZDB 2JE6I 2BDNA 4XIGS 2K5DA 4G7ZC 4X3UA 4BA2I 2VXWA 2L12A 3TP6A 4A3BB 4KJOA 1ICWA 1AEXA 1NR4A 2NYZD 2E2JB 4RH6A 2K03A 2SNMA 3PV0A 5JJZA 1IKLA 1ZXTA 2A69D 1HHVA 1WTXA 1DOMA 2F3VA 1Z47A 1IL8A 2E2DC 2F0WA 5JOBA 3T56B 4LAAA 2NVYB 4K6LA 3E5SA 2EYJA 4ID6A 1KTKA 1OXXK 1VCIA 3J7AF 1GJXA 4L6TB 1FR3A 2NN6H 2M9VA 5JVH3 2K33A 3WDNA 3K58A 4RAUC 2ZXOA 4DFAA 4LK1C 3T51B 1SYFA 4F8MA 4RWSC 1EWCA 1E0BA 1Z7TA 2CHBD 2E76C 3URYA 2DNEA 4PV1C 3CQZB 5G3LF 3MXUA 1JOQA 4WFN3 2AWOA 3FPPA 3MHBA 4IUPA 2EYLA 4CKCA 1B53A 3D6WA 3J7YW 4EQNA 4ILWA 4I7ZC 4DNTB 4DK1A 2B2YA 3I90A 1F9SA 4EVOA 2FJ2A 4ZKCB 2L1BA 2AQ2B 1EY8A 3F2UA 1VF5C 2ZXPA 3PMFA 5TSSA 3DMUA 1O7YA 3DXJC 3RLFA 1WTRA 2PNRC 1R4QB 3BDLA 1V1PB 4ABNA 2HCIA 1GHJA 1F9QA 2CQAA 4O1NA 4CJ1B 1CZWA 3NHHA 1BOSA 4J1MA 1D6EC 1X3QA 4A3JB 4A3KB 2OEOA 1PFNA 1SSOA 3KLSX 1CFMA 1CK1A 1EL0A 1PXUA 4X3TA 1RJTA 3NP8A 3LX0A 4PQXA 2AQ1B 3IFDA 1EY7A 4IALA 3K5MA 2NVQB 1EOTA 2EYOA 2A68C 1EWHA 1DOKA 1E2ZA 1BCPF 5A35A 4A3FB 2B2YC 1S5CD 1QOHA 2R7ZB 1S4ZA 3PUVA 4OL7A 3PO2B 5HGTA 3T4AC 5KIXA 4FYDA 2IPKD 3M7GA 2KCNA 1M4VA 3KLSA 4FF3A 2XNAC 1B44D 4KY7A 2BDOA 1TS4A 2M2LA 3WOEA 2K01A 3AMUA 4K8JA 1I6VC 1XXGA 3W3AA 5EKIA 4DA2A 2VB3X 1BXTA 5KYLA 3DEOA 4FXGC 1J8IA 1TU2B 3J81L 1AZQA 5M3FB 1EY9A 2OT2A 1SEBD 4K5VA 1BQQT 1K8OA 3PUYA 4J8QA 4U68A 4V190 3I4MB 2CW0D 2F0GA 2F0OA 2SEBD 5IOCA 1PZID 2X6GA 3OPOA 1SYDA 2PW7A 3SHLA 2EYMA 1LABA 4KN7C 3BG3A 2MJ8A 4V0BA 3R2IA 3K5LA 2RBMA 2EYHA 3H94A 1C8CA 3QOJA 1V8QA 3OWEB 4KMUC 2NVTB 2F1MA 5IGDA 3HZXA 3IL8A 2K05A 1CHQD 1A3TA 3I4LA 4B9XA 4BY1B 1UAPA 2XIWA 5C4XB 3SK8A 5T1IA 2KCCA 4IUQA 5ELEA 1O7LA 1HFGA 3DEPA 2FHTA 3VYUA 1BCPD 2K5WA 2Q8RE 3VYRA 4IUVA 1BO0A 1PTOF 3EQLC 1GXDC 1HCZA 4DN4M 4PMCA 1SYEA 3EA6A 3MVVA 5DM73 1XX8A 2B8GA 1PRTB 2YYZA 3GTLB 1G291 3EJIA 3PIP3 3VR3A 1S5ED 3SK6A 1X32A 3L7ZC 4QIWB 1IYVA 4K5WA 1S5FD 4NP5A 3MXNA 2QEJC 5C5LA 2PW5A 2WB1B 3SK5A 2JEBI 1Y8OB 4DAYA 1NSNS 3DM1A 4ZUJA 4FXKC 5I6YA 5M3MB 2NN6G 3TDQA 1F2ZA 1GUOA 1RODA 5A2QE 3SXHA 2H1EA 2QKIC 1ONLA 1TWHB 3OW7A 1LTBD 4RGOS 1H9SA 1KLGD 5LHY1 4CJ2C 4L63B 2JSOA 1ZKOA 3T13A 1D5XC 2R93B 3NPPA 4FF1A 1I4PA 3OIQA 1ENAA 2KQ3A 4AYBB 5HURA 3LNNA 3I8ZA 3RD4A 3MC0B 1SNOA 4QUFA 1BF4A 2SDFA 4PMBA 3D6CA 1CT1D 1CI3M 1LO5D 5I9OA 4FXDA 1G8ZD 3JAME 1B2TA 1IYUA 1JC7A 4QB4A 3A7AB 3MAQA 3S9WA 2A6EC 4CJ0B 2WINB 3EVQA 2DN8A 2K28A 1EIHA 2IX3A 1OXTA 3DUZA 4WRDA 1C4QA 3QJYA 5ELBA 2IWHA 4BS9A 5CORA 4R9WA 1ET9A 2I46A 4KD4A 2KOLA 3OSOA 3N6RA 1ET6A 1RKNA 3I72A 5F2DA 2AQ3B 3S1MB 1HTLD 1Y69U 1HA6A 2AUKA 2F0KA 2L5TA 2ZT9C 3PIO3 4H13C 2O5JC 1TWFB 4C3JB 1EEFD 1EYAA 1RTOA 1VMPA 1EY4A 2OF1A 1B4OA 4OO1H 3Q0AA 4KKSA 1EY0A 1NR2A 3QB3A 2D2CC 3X3MA 2NN6I 2B2UC 2VNUD 3V05A 3TMEA 3NUCA 1SAPA 2L4NA 3H09A 3MZ5A 3GTMB 2EXZA 1D5MC 5IT9L 3NK9A 2RSNA 1TIID 1QJOA 1JQYD 1A15A 2XWJB 1F2MA 1Q3LA 1KLUD 2HDMA 2HDLA 5CV4A 5I4DA 2XRSD 1GUWA 3RMHA 3DWPA 1JICA 1GUSA 1BCPC 3BYTB 4ME5A 4HCSA 3O13A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BDO A;  1VF5 C;  1E2W A;  2A6E C;  2EJM A;  1HCZ A;  2BA0 A;  2A6H D;  2R6G A;  1IW7 C;  3DXJ C;  4KN4 C;  2Q8I B;  3RLF A;  4G7O C;  4RCN A;  2PNR C;  3OOC A;  3M7N A;  5KNC A;  5BN3 A;  3KLR A;  1K8O A;  2B8G A;  3PUY A;  4L8J A;  1ZYR C;  3T56 B;  2O5I C;  2YYZ A;  1H9M A;  2DN8 A;  3VR2 A;  3VR6 A;  1G29 1;  1GHJ A;  1PMR A;  2LMC B;  3CRL C;  2DNC A;  1CTM A;  1OXT A;  4JK1 C;  3QJY A;  1OXX K;  1VCI A;  1SMY C;  3PUZ A;  2V4D A;  3VR3 A;  1DD2 A;  1GJX A;  3L7Z C;  3M85 A;  1IYV A;  2E75 C;  1H9R A;  4KI0 A;  2A6E D;  3SDZ A;  3OPO A;  1IW7 D;  1T5E A;  3M4Y A;  1FR3 A;  1VF7 A;  2NN6 H;  3VR4 A;  3U9S A;  2BA1 A;  2K33 A;  1FYC A;  1LAB A;  2JEB I;  4BA1 I;  1Y8O B;  1A6X A;  1GUT A;  1E2V A;  1Z6H A;  2BE5 C;  1CFM A;  3A8J E;  3N6R A;  4KN7 C;  1LAC A;  1Y8P B;  3I72 A;  3WDN A;  3BG3 A;  3A7L A;  1B9M A;  3PUX A;  4H44 C;  2NN6 G;  4H0L C;  4DNR B;  5BN5 A;  3D31 A;  1GUO A;  2IT1 A;  1H9J A;  3TZU A;  4TQU S;  1Y69 U;  4LK1 C;  1O78 A;  3A8K E;  4KKU A;  1Y8N B;  2B8F A;  2AUK A;  3ND9 A;  3PUW A;  1H9K A;  2L5T A;  3T51 B;  2ZT9 C;  3H94 A;  3NE5 B;  1ONL A;  1TKW B;  5K36 G;  1V8Q A;  3OW7 A;  2K32 A;  4H13 C;  2O5J C;  2A68 D;  3I73 A;  2JEA I;  1H9S A;  3VR5 A;  1Z7T A;  5C0X H;  1HQM C;  5KNB A;  2E76 C;  3HGB A;  2JXM B;  1HTP A;  4KMU C;  1V43 A;  2A68 C;  2F1M A;  4OO1 H;  1EWH A;  2BE5 D;  2D5D A;  4KKS A;  5JEA H;  2DNE A;  2PPB C;  1E2Z A;  4PV1 C;  3A8I E;  1ZKO A;  3GD7 A;  5KND A;  5A35 A;  2D2C C;  1OXS C;  1Q1B A;  1GHK A;  3MXU A;  2EVB A;  3ND8 A;  3T53 B;  5C0X G;  2NN6 I;  3I4L A;  5K36 H;  1HPC A;  1VDZ A;  1DCZ A;  1Q12 A;  4OO1 G;  4KKT A;  2AWO A;  4XTC S;  1GUG A;  3SE0 A;  3FPP A;  3LNN A;  3MFY A;  1DXM A;  1OXV A;  4IFD G;  3PUV A;  3CRK C;  4GZY C;  3IKJ A;  1GUN A;  2AUJ D;  3IFT A;  2E74 C;  3QG1 A;  1H9S B;  2K7V A;  4G7H C;  4OGQ C;  4DK0 A;  2EJG C;  1QJO A;  2KCC A;  1YNJ C;  2A69 C;  2JE6 I;  3LWU A;  4XIG S;  1O7L A;  1YNN C;  4IQZ A;  4G7Z C;  4I7Z C;  4DNT B;  2BDO A;  2A6H C;  4BA2 I;  3BDO A;  2PCF B;  3FMC A;  4KHZ A;  2KA7 A;  4DK1 A;  4IFD H;  1CI3 M;  3D4R A;  5JEA G;  2EDG A;  4TKO B;  1I6V C;  3VA7 A;  1K8M A;  2QF7 A;  3W3A A;  5BN4 A;  2CW0 C;  3GQB A;  3AB9 A;  1GUS A;  1Q90 A;  1B9N A;  2EJF C;  1IYU A;  1Q1E A;  4LJZ C;  3PV0 A;  1OXU A;  3P20 A;  1TU2 B;  3A7A B;  4JBW A;  4HR7 B;  2A69 D;  2D62 A;  3EQL C;  3QIA A; 
#chains in the Genus database with same CATH topology
 4NMZ A;  1PYB A;  1CA5 A;  3T16 A;  1GVP A;  4A3I B;  2R92 B;  4DR5 Q;  1FJG Q;  3M9B A;  1RDP D;  2Q2I A;  1JR0 D;  1L0Y B;  3TEH B;  3S17 B;  4WOR A;  5C4J H;  3KDF A;  4KD3 A;  3ITP A;  2Q2U A;  3HOU G;  4N9P A;  1EIF A;  3ULJ A;  1Q7Y C;  3UI2 A;  4Z9C B;  4K0K Q;  1I4R A;  3I70 A;  3H0G B;  2PZT A;  3M4O H;  4KI0 A;  3M4Y A;  3KFU A;  4DR7 Q;  2A74 C;  3CCS A;  5JVG 3;  4DAY B;  5I2Y A;  1LTS D;  1K28 A;  4A3E H;  4IOC A;  1X3G A;  3CAM A;  4NKL A;  2ZM6 L;  1ESR A;  1BR9 A;  4XQN A;  1I5F A;  2A19 A;  1QB5 D;  3H91 A;  3U50 C;  2TSS A;  4YY3 Q;  5C4H A;  3J7A V;  2Z9H A;  2Z0S A;  3DWA A;  4TQU S;  4DF7 A;  2ID0 A;  3ND9 A;  4DV7 L;  1SNM A;  1AE2 A;  5LL6 X;  2O4X A;  1HNZ Q;  5M9O A;  2VUM H;  3QO2 A;  1EQR A;  1K8A C;  3MEF A;  4A75 A;  1JOR A;  1STG A;  3T1Y Q;  1XNQ Q;  3CKI B;  1HTP A;  4C3J G;  3L3O C;  2Y0S E;  4H02 A;  4JPB W;  5M5X H;  3B6Y A;  2K5Q A;  2K14 A;  1SJE D;  3TBI B;  3TP7 A;  2RVL A;  3PO3 B;  4A3M G;  3U58 A;  1CQF A;  5CBE E;  5IGE A;  4E6I A;  1N34 L;  1SDF A;  1KXL A;  5CBA E;  3MFG A;  3D4D A;  3J7Z C;  4GOP A;  1EYG A;  4IPH A;  1KDA A;  3J80 E;  5IGF A;  4UP8 A;  4C2M H;  1BBW A;  5FOB B;  2PCF B;  3FMC A;  2KA7 A;  1BBX C;  3H6M A;  2OQK A;  5JEA G;  1A2T A;  1F2Y A;  3ZJY C;  4X62 Q;  3HFZ B;  2BH8 A;  1N9W A;  1K83 H;  2VB2 X;  2ZXR A;  1JB7 A;  3BVZ A;  3FRP B;  1D7Q A;  4XT3 B;  2N88 A;  1PFB A;  4RKB A;  1HZ9 A;  5DEH A;  4LUO A;  1EFW A;  1BDO A;  5CMD A;  1NMG A;  2EJM A;  4P72 A;  1L1O B;  4RHS A;  3I4N H;  4MHE A;  5FKA C;  4XT1 B;  2PZU A;  4A3I G;  4QL5 A;  1I50 H;  4UHV A;  3H3V C;  3C3L A;  3PF4 A;  2QCP X;  4ZQ3 A;  3NBI A;  2EXD A;  3GO5 A;  3MA2 B;  3PUZ A;  5FLX L;  3SR1 A;  3KLW A;  4GN4 B;  3MXP A;  1H9R A;  1HZB A;  1SFO H;  2F0M A;  2NTS A;  4Y7N B;  3FKI G;  2BA1 A;  3OTO L;  3U9O A;  2G5D A;  1PTO C;  4B3S Q;  2F0T A;  1STN A;  1Y8P B;  1D8L A;  2VQE L;  2OCE A;  1QNK A;  1TXY A;  4H0L C;  1DON A;  1W2B A;  5C3E H;  1EU4 A;  4A3D G;  1HQR D;  1U4L A;  1WCM B;  1U9R A;  3NE5 B;  1VQG A;  1VS0 A;  2WAQ B;  2I5L X;  2DY7 A;  4GOP C;  5IE8 A;  1CHP D;  1UE1 A;  5DLQ E;  3SK4 A;  1PDQ A;  5KNB A;  1B3A A;  1SJH D;  3KUP A;  1STE A;  5EBD A;  4HJ5 A;  1I94 L;  2PPB C;  2FMC A;  5JPM C;  3GV3 A;  2FFK B;  3D8G A;  4DV6 L;  4DV5 L;  2YV5 A;  1QVG A;  3GTQ H;  2J0T D;  4IJH A;  4PNY A;  5H1S E;  3PO3 G;  2MO0 A;  2QEX A;  2Z1C A;  2E2H H;  4G57 A;  1CA6 A;  1P16 A;  2K1B A;  3G48 A;  1SE4 A;  2K7V A;  2JA7 B;  2MUY A;  2VL6 A;  1NAP A;  3K7A B;  1PH6 A;  3RZO B;  4Q5V A;  2ENB A;  4G4K A;  3R8B A;  4QIW E;  1NBW A;  1YIJ A;  3BZK A;  4KHZ A;  2K04 A;  5IT9 c;  1QIL A;  4RKL A;  4GS3 A;  2KHS A;  3QR8 A;  4JI1 L;  2WB1 E;  3HKZ G;  3S1N B;  2QF7 A;  3K80 C;  3GQB A;  4DR3 Q;  3S14 H;  4CDE C;  2RF4 A;  2RCF A;  5I6W A;  1Q1E A;  1PFS A;  2RKS A;  1WD1 A;  1LT4 D;  1NTG A;  3E9H A;  4KK7 A;  3TN2 A;  3M3Y H;  1W6K A;  1STY A;  3BYY B;  2KEN A;  1EZ8 A;  3RLO A;  4C3I G;  1VQL A;  2Q2T A;  4K5X A;  1SR3 A;  4JI2 Q;  5IYD G;  1EYC A;  1QWY A;  3S24 A;  2I0Q A;  1UWV A;  1VQF A;  1SE2 A;  4RHR A;  3S15 H;  1KD1 C;  1YHA A;  3KDF B;  5G3L D;  1YZ6 A;  3RZD H;  3R2T A;  1JE5 A;  4IO9 A;  1A2U A;  1UUP A;  5C4J B;  2A6E D;  5CV5 A;  3E6Z X;  3ERO A;  2AMC B;  3M4O B;  1LT5 D;  5KEE A;  1EY6 A;  2EPB A;  3HOU H;  1A6X A;  1N36 Q;  2OTL A;  4FVM A;  5D3I B;  1FGB D;  3KF6 B;  4F87 A;  3S1R H;  2P5Z X;  5ELC A;  2IT1 A;  3RLN A;  5CV6 A;  2RQX A;  1H9K A;  1WTH A;  4KJN A;  3I56 A;  1YI2 A;  1JE4 A;  4IN3 A;  5IGB A;  2LS0 1;  1K0S A;  3SVM A;  2HUG A;  3X3N A;  1TS3 A;  1TWA H;  4ZAI A;  1JWU D;  2VUM B;  4QCL A;  2N49 A;  2WAQ G;  1LTT D;  4LW1 A;  1S5D D;  5GRO A;  1R9T H;  1N33 Q;  5IP9 H;  2SNS A;  2L55 A;  1E3P A;  1GKH A;  3K0Y A;  2QDL A;  1E7Z A;  3ND8 A;  1MSH A;  5FO7 B;  5M5X B;  2F0U A;  1SND A;  2BOS A;  2JP1 A;  1STA A;  2UU9 Q;  4OO1 G;  4LF5 Q;  4B3T L;  4IFD G;  1B1Z A;  2PYK A;  1GUN A;  4GOP B;  4RMF A;  4R4Q A;  3UE0 A;  1EUJ A;  1EQV A;  4A3M H;  1EWI A;  2ZJQ A;  1CKO A;  1G51 A;  4UPA A;  1JJG A;  2A6H C;  1B7Y B;  1FGU A;  3L0O A;  1D2B A;  3FVQ A;  5GAH C;  1HA5 A;  3TRE A;  4C2M B;  1HNX L;  3U4V A;  2OTJ A;  5JEA J;  1K8M A;  2NWG A;  3C46 A;  1DJR D;  1U4R A;  5GAG C;  1K83 B;  3P20 A;  4XYQ A;  4HMJ A;  2G9D A;  2F4V Q;  5J1Z A;  5JEA H;  5E4W C;  5BR8 Q;  2EY2 A;  3ONA B;  2MFI A;  4KN4 C;  4AQY L;  1JWM D;  4GKJ Q;  2OXP A;  4RA8 A;  1C48 A;  1T5X D;  3KLR A;  2N8N A;  3DM3 A;  2NVX H;  2YU9 H;  4FO2 A;  3VR2 A;  1FNW A;  5D65 A;  3BDC A;  3C1F A;  5K5P A;  5J39 A;  1VMC A;  3I4N B;  1MJE A;  5C44 G;  2R7D A;  1I50 B;  4MN3 A;  4OWX B;  3HG9 A;  2J7Z A;  1AN8 A;  1D1K A;  1W6J A;  4IUR A;  4A3G H;  3UDX A;  1JMC A;  1SFO B;  1XNR L;  4BA1 I;  4I65 A;  3TP5 A;  4N9T A;  2NZ1 D;  3CCQ A;  1J9O A;  1LYL A;  4R4I A;  4JI4 Q;  2KEE A;  1HUM A;  5M5W H;  3D31 A;  4Y52 H;  1WTQ A;  2M00 A;  4KKU A;  4A3E G;  3FKI H;  5IIF A;  1A3V A;  4A93 G;  2QIL A;  2F0I A;  5C3E B;  2Y0S G;  2J4X A;  3Q23 A;  1TS2 A;  2JXM B;  5IGC A;  5T1G A;  1ICF B;  3CU7 A;  5J22 A;  3PIP A;  4A3B H;  1X3E A;  2JA6 G;  3OMG A;  2SOB A;  2MO1 A;  2WAC A;  1VQ7 A;  2VUM G;  3QWN A;  4B3R L;  4A3D H;  2I07 B;  2WKD A;  2PNH A;  3V2T A;  2EVB A;  2C5C A;  4OX9 L;  1V1O A;  1EIG A;  5AFW A;  4RGM A;  2RA4 A;  1BKB A;  2JYO A;  4UAI A;  1Q82 C;  4JI6 Q;  4XTC S;  1WTV A;  1JOO A;  1Y1V B;  1HRJ A;  5CGK A;  3CRK C;  3GTQ B;  4NDX A;  4DAV A;  2NUC A;  2CWP A;  1PV4 A;  4AIM A;  4F7X A;  1S5B D;  2YTX A;  2E2H B;  2VW9 A;  3I55 A;  1VQB A;  5HY6 A;  2UXB L;  1C9O A;  1KNE A;  2F4I A;  4UP9 A;  2JA9 A;  2H5X A;  3C2P A;  1SE3 A;  1XMO Q;  4C3H H;  5HGQ A;  3S1Q H;  4OO1 I;  4TKO B;  3HKS A;  1O80 A;  4GKJ L;  4X65 L;  2K75 A;  2EJF C;  1EEI D;  4QMG A;  1PH8 A;  4ZCK A;  4FP5 D;  4LJZ C;  4O2D A;  3S14 B;  1U5K A;  4YCU A;  4XXE A;  3TZD A;  1MGS A;  2R6G A;  3M3Y B;  2MPM A;  1PFM A;  2EY6 A;  4RCN A;  3OOC A;  2CCZ A;  4N8F A;  1VQ8 A;  5FO9 B;  2YTV A;  3PGZ A;  2RDG A;  3CRL C;  1NUC A;  3PCO B;  4DGZ A;  2B2U A;  1X6O A;  2HHH L;  3OIP A;  1YJW A;  3S15 B;  2WKC A;  1U4P A;  4X66 Q;  1YHQ A;  4RCO A;  2EZV A;  5IYD H;  2F0D A;  3KBX A;  2KED A;  1PRT F;  5LMN W;  4WJ4 A;  4X3S A;  1SBB B;  4CKE A;  1E2V A;  2BE5 C;  5JJI A;  1ILQ A;  5EKL A;  1U4M A;  1ILP A;  4FF2 A;  1B9M A;  1KQS A;  2HCC A;  2MP1 A;  3HOU B;  2UXC Q;  3I3C A;  1VQ6 A;  4R1J A;  3NTH A;  4CKB A;  1TQO A;  1X9N A;  2I5M X;  3CME A;  3KJP A;  3S1R B;  2NB0 A;  5JAV A;  1N32 L;  4CBV A;  3EIV A;  1PZJ D;  3U4Z A;  3EBE A;  4NXM L;  3S2D H;  4JI6 L;  4PZ6 A;  1V43 A;  4DAP A;  3S16 H;  1TWA B;  4ZLT F;  1PTO D;  4JI8 Q;  5EJW A;  4DKA C;  1C0A A;  1BUV T;  1BVS A;  1EY5 A;  2NTT A;  3TS0 A;  1R9T B;  2ICI A;  3FDT A;  3K6O A;  1HPC A;  1WTW A;  3N52 A;  1TWG B;  2KJX A;  3H3V I;  1Q12 A;  2EY5 A;  2UUB L;  1XMO L;  4HIM A;  1EU3 A;  3IKJ A;  1Y14 B;  3CPF A;  1YNJ D;  2LY7 A;  5JPN C;  5C3W A;  4IFD J;  1EFI D;  3Q6S A;  1IBL L;  2IX0 A;  2ZM6 Q;  2EE1 A;  4K2K A;  3HOZ H;  1STB A;  1F2L A;  1SNQ A;  1WTP A;  1T9H A;  1K0R A;  3BDO A;  4XYO A;  1MSG A;  5E4X A;  4IFD H;  1V1P A;  2EYF A;  2ZTC A;  4A3M B;  4DV7 Q;  3HOW G;  2R7F A;  5IWA Q;  1NJI C;  4A3L G;  3G6E A;  3GTP H;  3VA7 A;  2B2V A;  4DR6 L;  3NTK A;  3HOX G;  4ALP A;  2Z6B A;  1N8R C;  1P8L A;  1RTN A;  4LUV A;  1XYI A;  3I91 A;  1F77 A;  3HOY G;  1D5Z C;  4JBW A;  1J5E L;  5D14 A;  3F2D A;  3GTO H;  3KK7 A;  3J80 i;  5C6A A;  1IW7 C;  4BY7 H;  3HP3 A;  4APV A;  1G2T A;  1N34 Q;  4UDU C;  4MTK A;  3DLL A;  3K5O A;  4C1N K;  2NVX B;  2CH4 A;  1ML0 D;  4XDX A;  4K14 A;  2YU9 B;  3UDI A;  4RFB A;  1SMY C;  3K59 A;  5CV9 A;  2IHF A;  5ELD A;  2UXC L;  2E75 C;  4GLX A;  4L5S A;  1MI2 A;  2GA4 B;  4JI5 Q;  1T5E A;  4JG2 A;  2Z6K A;  4P74 A;  5FJ8 H;  5CR3 A;  2F0E A;  1X3P A;  5C44 H;  4HTH A;  3RUZ A;  4GNX A;  3VYT A;  4R8N A;  3PO2 H;  4OHJ A;  4P73 A;  4PMW A;  5C0X J;  3BVM A;  4JI8 L;  1O78 A;  1EIY B;  2F0N A;  5M5W B;  2KBN A;  5CYU A;  1HR0 W;  3NEN A;  1TKW B;  5K36 G;  3MXN B;  2RDH A;  3FKI B;  2JEA I;  2JA5 H;  5C0X H;  5FLM G;  1E22 A;  2GVB A;  4KHV A;  1PRT D;  2IL8 A;  3H3V H;  3ERS X;  2MNA A;  1YEZ A;  1WI5 A;  3LWE A;  4A93 H;  3NTI A;  2KUM A;  2QDB A;  3HOV G;  4YIJ A;  4A3D B;  1JJ2 A;  2B2V C;  2C35 B;  2RSO A;  4BBS G;  5IP9 G;  4MNO A;  3AU7 A;  1SNP A;  4GZY C;  1IKM A;  3OTO Q;  2JA6 H;  2PZW A;  2E74 C;  3QG1 A;  3G6J B;  5IWA L;  1H9S B;  3IAY A;  3Q8D A;  2EY1 A;  1PTO H;  4DXF A;  1QUQ B;  2VQE Q;  1H95 A;  3OMC A;  5LL6 S;  3TQY A;  3MXG A;  1WFQ A;  4J6H A;  1LTL A;  3NSW A;  5KGU A;  4X64 L;  4HN7 A;  2DGY A;  4DR1 L;  2A73 B;  1ASZ A;  2Z4I A;  4HCE A;  4M8A A;  4C3H B;  2ZTD A;  3S1Q B;  4IUU A;  4TSS A;  1PZK D;  5LMN L;  1I94 Q;  1XPO A;  4RGN A;  1HNW L;  1W3S A;  1I6H H;  1QE6 A;  4IZ8 A;  3QIA A;  1E2W A;  5DM6 3;  1WTO A;  4EX5 A;  2A6H D;  2Z6K C;  4DV6 Q;  1JB3 A;  1ZYR D;  2NBF A;  4DV5 Q;  4G7O C;  2LKV A;  5EKK A;  1HFN A;  5KNC A;  1I3Q B;  4OIK A;  1DZ1 A;  1KNA A;  4KV6 A;  3HKZ B;  5E7N A;  2O5I C;  1II3 A;  1H9M A;  1I4H A;  4GNX C;  2N3S A;  4JI5 L;  2JA8 H;  1PMR A;  1CKN A;  1LUZ A;  2VQF L;  2E2I H;  3PSI A;  2B63 G;  3K5N A;  1GOZ A;  1PH5 A;  3GDE A;  3WOF A;  3HS0 C;  4C3I B;  3F1Z A;  3VR4 A;  4JI1 Q;  4BBR H;  4HIK A;  5FLX E;  4O42 A;  1WVL A;  4JBK A;  4ZUI A;  3A8J E;  2XTI A;  2X69 A;  4IJL A;  4DNR B;  3G7L A;  5BN5 A;  4LF4 L;  3J80 L;  3CCR A;  2XSC A;  4A3G G;  1BCP B;  1PYW D;  3A8K E;  5LMU Q;  1A3U A;  2AHO B;  1TR5 A;  1SNC A;  1KAA A;  3Q24 A;  3R3O A;  3DWQ A;  4KLK A;  2K32 A;  4M1U B;  1MBY A;  2DJG C;  1JWS D;  4P2C B;  2PMZ B;  1HQM C;  5J3B A;  2QGQ A;  4B9W A;  4WJW A;  4OEM B;  2D5D A;  4QJF A;  2LSS A;  3S2D B;  1CZG A;  1UNS A;  3S16 B;  1YNX A;  1GHK A;  2FIN B;  4DPG A;  1WD0 A;  1X54 A;  5DNF A;  1MD2 D;  1VQ5 A;  3NXW A;  1IBK Q;  4A3B G;  3GTG B;  3C1E A;  3Q22 A;  1CSP A;  3JAM c;  3GTK H;  2R3Z A;  2IJ0 A;  2K4K A;  1ESF A;  4B08 A;  4OGQ C;  3UDF A;  1LV9 A;  4DK0 A;  2EJG C;  1YNJ C;  1UE5 A;  4LUZ A;  1V9P A;  4IUT A;  3AQQ A;  3HOZ B;  4HSV A;  2HQE A;  3I2Z A;  2WV6 D;  1CQV A;  3BJU A;  1YHB A;  5I9P A;  3HRZ C;  4DV3 L;  3R93 A;  2PQA B;  1TWC H;  3GTP B;  4C3H G;  1I4Q A;  4OXP A;  4DK6 C;  4HR7 B;  1VQI A;  3HOW H;  1X3F A;  3K57 A;  4A3L H;  3HOX H;  3GTO B;  2WFW A;  3A55 A;  3M7N A;  4KTA A;  2D0O A;  5BN3 A;  1G6P A;  2F3I A;  4B3T Q;  4BY7 B;  1DYQ A;  4JOI A;  3HOY H;  2DNC A;  3E0J A;  1KDB A;  1WOC A;  1HR0 L;  4JV5 Q;  5EPJ A;  4BWG B;  4EQ5 A;  2V4D A;  1DD2 A;  5C5M A;  1EZ6 A;  5LMU L;  3KF8 A;  1HNX Q;  3RN2 A;  4KHP Q;  3OWF A;  3U9S A;  5CV7 A;  4A76 A;  4R4O A;  4YCW A;  2F0J A;  2ICE C;  1FYC A;  2B39 A;  1RHP A;  1Z6H A;  1E1T A;  1I4X A;  1R4P B;  4FDB A;  3CHB D;  5C44 B;  2L9H A;  3PUX A;  3HEJ A;  3J81 E;  3E9I A;  1H9J A;  2MGS A;  1Y8N B;  1OTC A;  1D1I A;  4AQY Q;  4DV2 L;  1UEA B;  2RHQ B;  1IBM L;  4LF9 L;  2F3W A;  3W5O A;  3NBH A;  4IPC A;  1IBK L;  1SE8 A;  3AYH B;  2G9H D;  4AYB E;  3CC7 A;  2JA5 B;  2BE5 D;  3BVG A;  4TRD A;  3BS1 A;  3F2B A;  3GTJ H;  2F52 A;  2F0L A;  1YJN A;  1PRT C;  1Q1B A;  2A5H A;  1AFP A;  3MTS A;  5K36 H;  4P71 A;  3SEB A;  4YHH L;  4A3E B;  4JI7 L;  1LTR D;  1FNV A;  1LM0 A;  1DCZ A;  4A93 B;  5FLM H;  5FO8 B;  3EN2 A;  4ZKB B;  3S2H H;  4KY6 A;  1FNU A;  5FK9 C;  2HIX A;  2Y0S B;  1YBY A;  3D4W A;  5GQO A;  1YNN D;  1XNR Q;  1AW7 A;  1M8A A;  2F0F A;  4GKK Q;  1DOL A;  2A69 C;  4KY5 A;  2JA6 B;  3HOV H;  2MHV A;  2Z8L A;  1AZP A;  4POG A;  4BBS H;  1PTO B;  1IZ6 A;  5KYI A;  1EOV A;  5CC4 A;  1RF2 D;  4JOI C;  4MIU A;  1K3B C;  4HJ9 A;  1LLR D;  3FPU B;  5IOD A;  3RR5 A;  3HOZ G;  5JJL A;  5GAE C;  3QOL A;  4LF6 L;  3AB9 A;  4FF4 A;  1Q90 A;  2FMM A;  1JOK A;  2BCO A;  2RHS B;  1SRO A;  3W2D A;  1VQ9 A;  2JK8 A;  3RNU A;  4I7A A;  2B2W A;  2V1C C;  2UUA L;  2UXD L;  1MIU A;  1BBU A;  2XVS A;  4B3R Q;  3D0F A;  1I4G A;  3GV6 A;  4OX9 Q;  1TVX A;  1QVC A;  1SYB A;  4X3K A;  4JV5 L;  3CCV A;  1I6H B;  1PA6 A;  1X65 A;  2Q2H A;  2H4O A;  4HED A;  1JCK B;  5E1F A;  1S3O A;  2JN4 A;  4L8J A;  5IP7 G;  1ZYR C;  4A3J G;  4A3K G;  4C56 C;  5ISR A;  2LMC B;  1CTM A;  4KHP L;  3ICE A;  4BY7 G;  1IHZ A;  1ENF A;  2JA8 B;  2UUC L;  2C9O A;  4P75 A;  1QVF A;  5AJ3 Q;  2UXB Q;  1A0I A;  3UE1 A;  2E2I B;  1S72 A;  3MWY W;  2PI2 A;  2IHE A;  1QZH A;  1IW7 D;  3T1H L;  5NUC A;  2IW3 A;  5EPK A;  2L0C A;  1Q8K A;  1Y1W H;  1KAB A;  4CDC C;  1O7Z A;  2F0H A;  2PI2 E;  4LFA L;  4K6D A;  4BBR B;  4X65 Q;  4ME3 A;  2B63 H;  1FL0 A;  4H44 C;  5I2X A;  4A3F G;  1YIT A;  1SMY D;  3TZU A;  5FJ8 G;  1JJC B;  3D3R A;  3V96 A;  3JAM i;  3NQI A;  3PO2 G;  3NWS A;  3HGB A;  3J80 c;  1O7I A;  2KVM A;  2B3G A;  5KRU A;  1EQT A;  1TY2 A;  1LTI D;  2EQS A;  3GD7 A;  2HHH Q;  5E3F A;  4GKK L;  4QGU A;  2JA5 G;  2EYP A;  5C0X G;  4DV1 L;  4LMQ D;  5C4Z A;  2PQE A;  2HD3 A;  5M5Y H;  4HMI A;  4KKT A;  5COY A;  4NB3 A;  4EGV A;  3FEW X;  4Q0F A;  1DXM A;  1OXV A;  3OHX C;  2F0S A;  2CFM A;  2AUJ D;  3W1G A;  3IFT A;  2B2W C;  2EOT A;  4G7H C;  3A54 A;  4ZK9 B;  3GTK B;  1EYD A;  3LWU A;  4XQJ A;  4K8I A;  2KCM A;  3A5Z B;  1K3R A;  2E2J H;  5M3F G;  1N32 Q;  2K5V A;  4F88 A;  1KHI A;  3G71 A;  1X55 A;  1STH A;  2WP8 J;  4CHT B;  4ULL A;  4NXM Q;  3I4M G;  4NXN L;  1C7Y A;  2TMP A;  4DXG A;  1OO9 B;  1DM0 B;  1OXU A;  1G91 A;  1TWC B;  5D3D A;  5CV8 A;  1RD9 D;  1NNX A;  1SYC A;  2BA0 A;  1VQE A;  4HID A;  2Z4H A;  2Q8I B;  5AJ3 L;  2NVY H;  3HOW B;  3P7J A;  3KBG A;  2UUB Q;  1VQC A;  4WJ3 M;  2R61 A;  3L9A X;  3HOX B;  2CH4 W;  2DY8 A;  1ZEQ X;  4GLA C;  1IBL Q;  4HSP A;  1F9P A;  3HOY B;  1UEB A;  4IFD I;  1XTD A;  2LFN A;  3CW2 C;  3K0X A;  4IPG A;  5DAU A;  1PYS B;  3M85 A;  1GM5 A;  2JA8 G;  3SDZ A;  1GD7 A;  5IY0 A;  1Q8I A;  2D9U A;  2YTY A;  5A2Q L;  3DHQ A;  3NQT A;  3CCU A;  4DR6 Q;  1DGS A;  1LTG D;  4CDD C;  4QF4 A;  2B2T A;  3VYS A;  3A7L A;  1J5E Q;  4R8I A;  4BBR G;  3GP7 A;  5EGT A;  1XMQ L;  1TT2 A;  1PLF A;  2VY3 A;  1B50 A;  1XWE A;  3NBH B;  3RZD B;  4YWK A;  4HJA A;  3I73 A;  5ELF A;  4DU9 A;  5C4X G;  1FVI A;  2KHJ A;  4CDF C;  3CQZ H;  2E5L L;  1QCB D;  3W1B A;  4IOA A;  1QG7 A;  1LT6 D;  1LTA D;  4CGY B;  4RGT A;  4NW2 A;  1BNZ A;  4R4C A;  3ULP A;  3T53 B;  1YVC A;  3GTJ B;  4EQP A;  2AWN A;  1HUN A;  1TY0 A;  1AP0 A;  1GUG A;  2K6A A;  3HKZ E;  3SE0 A;  3CPW A;  3MFY A;  4DAM A;  2CVR A;  1TS5 A;  4K2L A;  1QNU A;  2OQ0 A;  3MEH A;  3S2H B;  2IX1 A;  1CM9 A;  1YNN C;  2RDF A;  4IQZ A;  3TP8 A;  1L1O A;  2F0Q A;  1PVO A;  2XRQ D;  2PO4 A;  3NWT A;  3JAM L;  1PHJ A;  3HOV B;  4YWL A;  3D4R A;  5C0X I;  2EDG A;  4DK3 C;  3A56 A;  4BBS B;  4HAE A;  5BN4 A;  1M1K C;  2CW0 C;  1G6Z A;  2F03 A;  4NPS A;  5EQ0 A;  3CXC A;  1B9N A;  3EFX D;  2KEC A;  1FD7 D;  3FP9 A;  3P1H A;  4U67 3;  2D62 A;  4LF7 L;  1XTC D;  1ENC A;  2WB1 G;  1U0L A;  4S3S A;  2N78 A;  4JVZ A;  3VR6 A;  2B2T C;  5IT9 E;  4OIJ A;  3ERQ A;  4XQQ A;  2O2L D;  1Q86 C;  4FNF A;  3PIO A;  4LF8 L;  1RCV D;  4JK1 C;  4B3M L;  1F9R A;  1KDC A;  3P75 A;  1VQO A;  1LT3 D;  4H7B A;  4DV0 Q;  1SYG A;  2F0V A;  2L11 A;  2XN9 C;  4A3J H;  4A3K H;  1JT8 A;  3ZYY X;  5IP7 H;  4DR2 L;  3TSS A;  1VQD A;  3VA5 A;  4ODG A;  1VF7 A;  1HXY D;  1SXT A;  2F0P A;  4X64 Q;  4ZYS A;  2X6L A;  4DR1 Q;  2WAQ E;  2VS1 A;  1GUT A;  1L0X B;  4QUC A;  1Y1W B;  1LAC A;  2LXJ A;  5LMN Q;  1HNW Q;  2B63 B;  2JA7 H;  2WII B;  2B8F A;  3PUW A;  3CCM A;  2N55 A;  2NVQ H;  4AYB G;  3PF5 A;  3CCJ A;  3PQI A;  2A68 D;  2XWB B;  5EBC A;  1G2S A;  3VR5 A;  1UE7 A;  1HJP A;  4A3F H;  2Q8T A;  3J7A 5;  4ZRZ A;  1L1O C;  2R7Z H;  4PZ8 A;  3A8I E;  5KND A;  4IUN A;  2VQF Q;  4EQO A;  3S1N H;  2DJF C;  4JI3 L;  1OXS C;  4A3G B;  5IYB G;  5EPL A;  4DR4 L;  4DUY L;  1AE3 A;  4DUZ L;  1VDZ A;  1XJV A;  1K8G A;  1VQM A;  4C1N I;  1KL9 A;  5C3X A;  5M5Y B;  4POF A;  1KRT A;  1NCV A;  3CCL A;  5IGG A;  3BZD B;  2JE6 I;  2BDN A;  4XIG S;  2K5D A;  4JW0 A;  4G7Z C;  4X3U A;  4LF4 Q;  4L5T A;  4BA2 I;  2VXW A;  2L12 A;  4A4I A;  3TP6 A;  3TRZ A;  4A3B B;  3CCE A;  4KJO A;  1ICW A;  1AEX A;  1NR4 A;  1NY4 A;  2NYZ D;  2E2J B;  4RH6 A;  2K03 A;  2SNM A;  3E3X A;  4N8X 1;  2K5H A;  1Q81 C;  3PV0 A;  5JJZ A;  1IKL A;  1ZXT A;  1IYJ B;  2A69 D;  5M3F H;  1HHV A;  1HH2 P;  1WTX A;  4JYA L;  1DOM A;  2F3V A;  1Z47 A;  1IL8 A;  4DV0 L;  3STB D;  2E2D C;  2F0W A;  5JOB A;  3I4M H;  1AH9 A;  3T56 B;  1Z9F A;  4LAA A;  2NVY B;  1Q46 A;  4K6L A;  3E5S A;  2EYJ A;  3KF6 A;  4ID6 A;  4PG3 A;  3ULL A;  1KTK A;  1OXX K;  1KRS A;  1VCI A;  3J7A F;  4OWW B;  4GLV B;  1GJX A;  1B3Q A;  1KC8 C;  2JQO A;  4L6T B;  1FR3 A;  2NN6 H;  4OON A;  2M9V A;  5JVH 3;  2K33 A;  4DV3 Q;  4JCV E;  3K8A A;  2ATW A;  3RN5 A;  3WDN A;  3K58 A;  4HJ7 A;  1A8V A;  4RAU C;  2ZXO A;  4DFA A;  1Y1W G;  2VZA A;  1NMF A;  4LK1 C;  4R4T A;  1A63 A;  3T51 B;  1SYF A;  5ELO A;  2NVT H;  3SGI A;  4F8M A;  4RWS C;  1EWC A;  1E0B A;  4O0A A;  1Z7T A;  2IY5 B;  3CMA A;  2CHB D;  2E76 C;  2XGT A;  3BZC A;  3URY A;  2DNE A;  4PV1 C;  3CQZ B;  5G3L F;  1GO3 E;  1HR0 Q;  4DV4 L;  4QY7 A;  3MXU A;  1JOQ A;  4WFN 3;  4BY1 H;  3J81 i;  3JC6 6;  5C4X H;  4OEL B;  4DR5 L;  2AWO A;  3FPP A;  3MHB A;  1FJG L;  1PH1 A;  4IUP A;  4BXX G;  2EYL A;  4CKC A;  3M4P A;  1B53 A;  3D6W A;  3J7Y W;  4EQN A;  4ILW A;  4I7Z C;  4DNT B;  4K0K L;  5IYC G;  1V1Q A;  4DK1 A;  2L15 A;  2B2Y A;  2R92 G;  4DR7 L;  2A8V A;  4DV2 Q;  1CKM A;  4LF9 Q;  1IBM Q;  1K9M C;  1VQN A;  3I90 A;  4HIO A;  1F9S A;  4EVO A;  2FJ2 A;  4ZKC B;  4YY3 L;  2HQL A;  2L1B A;  2AQ2 B;  4JBM A;  1EY8 A;  4X6A H;  3F2U A;  1VF5 C;  2ZXP A;  3PMF A;  5TSS A;  3DMU A;  3H0G G;  1O7Y A;  3OYY A;  3DXJ C;  3RLF A;  4YHH Q;  1WTR A;  1HNZ L;  3GTL H;  4JI7 Q;  1MHW C;  1R4Q B;  2PNR C;  3BDL A;  1V1P B;  3T1Y L;  1XNQ L;  4ABN A;  2HCI A;  1GHJ A;  1F9Q A;  2CQA A;  4O1N A;  4CJ1 B;  1CZW A;  1KAW A;  1A62 A;  3NHH A;  1VQP A;  3ER0 A;  1BOS A;  4J1M A;  1D6E C;  3CD6 A;  1X3Q A;  4A3J B;  4A3K B;  2E8G A;  2OEO A;  1PFN A;  5M3M H;  1SSO A;  4LF6 Q;  3KLS X;  1CFM A;  3A5U A;  1CK1 A;  1Y1V H;  1EL0 A;  3L2P A;  2RCN A;  1J6Q A;  2UUA Q;  2UXD Q;  1PXU A;  2CKZ B;  1TWH H;  4X3T A;  2CQO A;  1RJT A;  3NP8 A;  3LX0 A;  4PQX A;  4X62 L;  2AQ1 B;  3IFD A;  1PH3 A;  1EY7 A;  3KOJ A;  4IAL A;  3E0E A;  3K5M A;  2NVQ B;  1EOT A;  2EYO A;  2K52 A;  2A68 C;  1EWH A;  1DOK A;  1E2Z A;  2R93 H;  3AFP A;  3CP0 A;  1BCP F;  5A35 A;  4GNX B;  2UUC Q;  4A3F B;  2B2Y C;  4LFB Q;  1S5C D;  1QOH A;  2R7Z B;  4A3C G;  1EQQ A;  3T1H Q;  1S4Z A;  2GN5 A;  3PUV A;  4OL7 A;  2FXQ A;  3PO2 B;  5HGT A;  3T4A C;  3K81 C;  4LFA Q;  5KIX A;  4FYD A;  2IPK D;  5IYB H;  3M7G A;  2KCN A;  1M4V A;  3KLS A;  4FF3 A;  2XNA C;  1B44 D;  3K7U C;  4KY7 A;  2BDO A;  2OWO A;  1TS4 A;  4JI0 Q;  2M2L A;  3WOE A;  2KCT A;  2K01 A;  3AMU A;  4K8J A;  1I6V C;  1XXG A;  3W3A A;  5EKI A;  4B3S L;  4DA2 A;  2VB3 X;  4MTN A;  1BXT A;  1L0W A;  5KYL A;  3DEO A;  4FXG C;  1J8I A;  1TU2 B;  3J81 L;  5GAD C;  1AZQ A;  4JC0 A;  4DV1 Q;  5M3F B;  1E24 A;  1EY9 A;  2OT2 A;  1SEB D;  4K5V A;  1BQQ T;  3CC4 A;  3PUY A;  1K8O A;  2MQH A;  4J8Q A;  4U68 A;  3F8T A;  3STB C;  4V19 0;  3I4M B;  2CW0 D;  3WWV A;  1IXR A;  1CSQ A;  1WYD A;  2F0G A;  2F0O A;  1SN8 A;  2SEB D;  5IOC A;  1PZI D;  1WCM G;  2ALY B;  2X6G A;  3OPO A;  3CC2 A;  2D0P A;  1SYD A;  2PW7 A;  3SHL A;  2EYM A;  2ZJP A;  4HJ8 A;  1LAB A;  1TWG H;  1QZG A;  1KIX A;  4KN7 C;  4NXN Q;  3S1M H;  3BG3 A;  1CKN B;  2MJ8 A;  1RL2 A;  4V0B A;  1MJC A;  3G4S A;  1TWF H;  4C3J H;  3R2I A;  3K5L A;  1K73 C;  2RBM A;  2EYH A;  4LFB L;  3H94 A;  1C8C A;  3QOJ A;  1V8Q A;  1VQJ A;  3OWE B;  4DR3 L;  2GVA A;  4KMU C;  2NVT B;  3AFQ A;  2JA7 G;  2F1M A;  5IGD A;  2KHI A;  3HZX A;  3IL8 A;  1E1O A;  2K05 A;  1CHQ D;  1A3T A;  3I4L A;  2ZTE A;  4JI2 L;  4B9X A;  3GTM H;  4BY1 B;  2R7Z G;  1UAP A;  4MZ9 A;  1YJ9 A;  4JI0 L;  2XIW A;  4JBJ A;  5C4X B;  3SK8 A;  1S40 A;  5T1I A;  4RG1 A;  2KCC A;  4IUQ A;  1XPU A;  5ELE A;  1HZA A;  1O7L A;  1HFG A;  1XMQ Q;  3DEP A;  3VDY A;  2FHT A;  4BXX H;  3VYU A;  1BCP D;  2HIV A;  2K5W A;  2Q8R E;  3VYR A;  1N36 L;  4IUV A;  1M90 C;  4OWT B;  2QW7 A;  2E5L Q;  1PH4 A;  1BO0 A;  2CWA A;  5IYC H;  4PZ7 A;  3BU2 A;  1PTO F;  3EQL C;  1GXD C;  2R92 H;  4A3I H;  1HCZ A;  4DN4 M;  4PMC A;  1SYE A;  3EA6 A;  3MVV A;  5DM7 3;  5FLX c;  1XX8 A;  2B8G A;  1PRT B;  1SLJ A;  2YYZ A;  3S17 H;  4L5Q A;  1HZC A;  3GTL B;  1G29 1;  3EJI A;  3PIP 3;  2ZJR A;  1N33 L;  3I4O A;  3H0G H;  1XPR A;  3VR3 A;  1S5E D;  3SK6 A;  1X32 A;  3L7Z C;  4QIW B;  1IYV A;  4K5W A;  1S5F D;  4NP5 A;  3MXN A;  2UU9 L;  4LF5 L;  2QEJ C;  5C5L A;  2PW5 A;  2WB1 B;  3SK5 A;  2BH2 A;  1L2F A;  2JEB I;  1Y8O B;  4DAY A;  1NSN S;  3DM1 A;  1UE6 A;  3UDG A;  4ZUJ A;  4FXK C;  5I6Y A;  5M3M B;  2NN6 G;  3TDQ A;  1F2Z A;  1GUO A;  1ROD A;  5A2Q E;  4LF7 Q;  3SXH A;  5L37 A;  2H1E A;  2QKI C;  4UY8 C;  1ONL A;  1TWH B;  3OW7 A;  1LTB D;  4RGO S;  2A1A A;  1H9S A;  3KF8 B;  1KLG D;  4YWM A;  2ES2 A;  5LHY 1;  4CJ2 C;  1QUQ A;  4L63 B;  4L5R C;  4LF8 Q;  3A0J A;  3PO3 H;  2JSO A;  1ZKO A;  4B3M Q;  2F4V L;  3T13 A;  1D5X C;  5BR8 L;  2NZH A;  2R93 B;  3NPP A;  4FF1 A;  1I4P A;  4DR2 Q;  3OIQ A;  1PH7 A;  1ENA A;  2KQ3 A;  4AYB B;  5HUR A;  3LNN A;  3I8Z A;  3RD4 A;  3MC0 B;  1SNO A;  4BY1 G;  1IL2 A;  4QUF A;  1I3Q H;  1VQA A;  1BF4 A;  1CUK A;  2SDF A;  2K50 A;  4A3C H;  1PH2 A;  4PMB A;  3NEM A;  3D6C A;  4TVA B;  1CT1 D;  1SMX A;  4J15 A;  4UP7 A;  4LFC Q;  1CI3 M;  1LO5 D;  4DNI A;  2K5N A;  3I4N G;  5I9O A;  3IRB A;  4FXD A;  2NZO A;  3FHW A;  4C3I H;  1G8Z D;  3JAM E;  1B2T A;  3TS2 A;  1IYU A;  1JC7 A;  4QB4 A;  3J81 j;  4JI4 L;  3A7A B;  3MAQ A;  1WJJ A;  4JI3 Q;  3S9W A;  2A6E C;  4DR4 Q;  4CJ0 B;  4DUY Q;  4DUZ Q;  2WIN B;  3EVQ A;  4LWC A;  1X56 A;  2DN8 A;  2K28 A;  1EIH A;  3J81 c;  2IX3 A;  3OW2 A;  1OXT A;  1NE3 A;  3DUZ A;  4WRD A;  1C4Q A;  3QJY A;  5ELB A;  3LGJ A;  3F2C A;  2IWH A;  1RIP A;  4BS9 A;  4Y7N H;  1SRU A;  5COR A;  5JJK A;  3A74 A;  2LXK A;  5C3E G;  4R9W A;  2B29 A;  1ET9 A;  2I46 A;  3M4Q A;  4KD4 A;  2KOL A;  3OSO A;  3N6R A;  2I5H A;  1ET6 A;  4QQB X;  1RKN A;  3GTG H;  2PMZ E;  3I72 A;  5F2D A;  3KJO A;  3CF5 A;  2ASB A;  2AQ3 B;  1WCM H;  3S1M B;  1HTL D;  2AKW B;  1Y69 U;  2DUD A;  1HA6 A;  4GN5 A;  4GN3 B;  4JYA Q;  5M3M G;  2AUK A;  3AEV A;  1MKH A;  2F0K A;  2L5T A;  2ZT9 C;  3PIO 3;  4IPD A;  1Y1V G;  4H13 C;  2O5J C;  1TWF B;  3I7F A;  4C3J B;  1EEF D;  3NEL A;  1EYA A;  1RTO A;  1VMP A;  4YCV A;  1EY4 A;  2OF1 A;  1B4O A;  4OO1 H;  3Q0A A;  4KKS A;  1EY0 A;  4LNQ A;  1NR2 A;  3QB3 A;  2D2C C;  3X3M A;  2NN6 I;  4AH6 A;  2B2U C;  2JJQ A;  2VNU D;  3V05 A;  3TME A;  3NUC A;  2R93 G;  2PQA A;  4LFC L;  2QA4 A;  1SAP A;  2L4N A;  3H09 A;  3MZ5 A;  3GTM B;  2EXZ A;  1D5M C;  3K7A H;  3RZO H;  5IT9 L;  1VQH A;  3NK9 A;  2RSN A;  1TII D;  1QJO A;  5EAY A;  1JQY D;  1A15 A;  1B70 B;  4X66 L;  2XWJ B;  1B8A A;  1F2M A;  1Q3L A;  1KLU D;  2HDM A;  2HDL A;  3KYH C;  2HT1 A;  5CV4 A;  5I4D A;  2XRS D;  1ASY A;  2EIF A;  1GUW A;  3RMH A;  5ELN A;  3DWP A;  1VQ4 A;  1JIC A;  1GUS A;  1BCP C;  1VQK A;  3BYT B;  4ME5 A;  1PH9 A;  4HCS A;  3H15 A;  3O13 A;  4DV4 Q; 
#chains in the Genus database with same CATH homology
 4NMZ A;  1CA5 A;  3T16 A;  2R92 B;  4A3I B;  1RDP D;  1JR0 D;  1L0Y B;  3S17 B;  4WOR A;  4KD3 A;  3ITP A;  4N9P A;  3UI2 A;  4Z9C B;  1I4R A;  3I70 A;  3H0G B;  2PZT A;  4KI0 A;  3M4Y A;  2A74 C;  5JVG 3;  5I2Y A;  1LTS D;  4NKL A;  1ESR A;  1BR9 A;  4XQN A;  1QB5 D;  3H91 A;  2TSS A;  5C4H A;  3J7A V;  3DWA A;  4TQU S;  4DF7 A;  2ID0 A;  3ND9 A;  1SNM A;  5LL6 X;  2O4X A;  5M9O A;  3QO2 A;  1JOR A;  1STG A;  3CKI B;  1HTP A;  4C3J G;  3L3O C;  2K5Q A;  1SJE D;  3TBI B;  3TP7 A;  2RVL A;  3PO3 B;  1CQF A;  5CBE E;  5IGE A;  4E6I A;  1SDF A;  5CBA E;  3MFG A;  3D4D A;  1KDA A;  3J80 E;  5IGF A;  5FOB B;  2PCF B;  3FMC A;  2KA7 A;  1BBX C;  3H6M A;  5JEA G;  1A2T A;  1F2Y A;  2VB2 X;  2ZXR A;  3BVZ A;  3FRP B;  4XT3 B;  2N88 A;  1PFB A;  4RKB A;  5DEH A;  1BDO A;  5CMD A;  2EJM A;  4RHS A;  4MHE A;  5FKA C;  4XT1 B;  2PZU A;  3H3V C;  3C3L A;  2QCP X;  4ZQ3 A;  3NBI A;  3GO5 A;  3MA2 B;  3PUZ A;  5FLX L;  3SR1 A;  3MXP A;  1H9R A;  2F0M A;  2NTS A;  4Y7N B;  2BA1 A;  3U9O A;  1PTO C;  2F0T A;  1STN A;  1Y8P B;  1QNK A;  4H0L C;  1DON A;  1EU4 A;  1HQR D;  1U4L A;  1WCM B;  1U9R A;  3NE5 B;  2WAQ B;  2DY7 A;  1CHP D;  3SK4 A;  5KNB A;  1PDQ A;  1B3A A;  1SJH D;  3KUP A;  1STE A;  5EBD A;  2PPB C;  2FMC A;  5JPM C;  3GV3 A;  2FFK B;  3D8G A;  2J0T D;  4PNY A;  2Z1C A;  4G57 A;  1CA6 A;  2K1B A;  1SE4 A;  2K7V A;  2JA7 B;  2MUY A;  1NAP A;  3K7A B;  3RZO B;  4Q5V A;  2ENB A;  4G4K A;  3R8B A;  4KHZ A;  2K04 A;  1QIL A;  4RKL A;  2KHS A;  3S1N B;  2QF7 A;  3GQB A;  5I6W A;  1Q1E A;  2RKS A;  1WD1 A;  1LT4 D;  4KK7 A;  3TN2 A;  1W6K A;  1STY A;  3BYY B;  1EZ8 A;  4C3I G;  4K5X A;  1EYC A;  1QWY A;  1SE2 A;  4RHR A;  5G3L D;  3R2T A;  1A2U A;  1UUP A;  5C4J B;  2A6E D;  5CV5 A;  3E6Z X;  3ERO A;  3M4O B;  1LT5 D;  5KEE A;  1EY6 A;  2EPB A;  1A6X A;  4FVM A;  5D3I B;  1FGB D;  4F87 A;  5ELC A;  2IT1 A;  5CV6 A;  2RQX A;  1H9K A;  4KJN A;  4IN3 A;  5IGB A;  1JE4 A;  2LS0 1;  3SVM A;  2HUG A;  3X3N A;  1TS3 A;  4ZAI A;  1JWU D;  2VUM B;  4QCL A;  1LTT D;  1S5D D;  2SNS A;  2L55 A;  3K0Y A;  3ND8 A;  1MSH A;  5FO7 B;  5M5X B;  2F0U A;  1SND A;  2BOS A;  2JP1 A;  1STA A;  4OO1 G;  4IFD G;  1B1Z A;  2PYK A;  1GUN A;  1EQV A;  2A6H C;  1D2B A;  3FVQ A;  1HA5 A;  4C2M B;  5JEA J;  1K8M A;  2NWG A;  3C46 A;  1DJR D;  1U4R A;  1K83 B;  3P20 A;  4XYQ A;  4HMJ A;  2G9D A;  5J1Z A;  5JEA H;  5E4W C;  2EY2 A;  3ONA B;  4KN4 C;  1JWM D;  2OXP A;  4RA8 A;  1C48 A;  1T5X D;  3KLR A;  4FO2 A;  3VR2 A;  1FNW A;  5D65 A;  3BDC A;  3C1F A;  5K5P A;  5J39 A;  1VMC A;  3I4N B;  1I50 B;  4MN3 A;  3HG9 A;  2J7Z A;  1AN8 A;  1D1K A;  1W6J A;  4IUR A;  1SFO B;  4BA1 I;  4I65 A;  3TP5 A;  4N9T A;  2NZ1 D;  1J9O A;  2KEE A;  1HUM A;  3D31 A;  1WTQ A;  2M00 A;  4KKU A;  5IIF A;  1A3V A;  2QIL A;  2F0I A;  5C3E B;  2J4X A;  3Q23 A;  1TS2 A;  2JXM B;  5IGC A;  5T1G A;  3CU7 A;  5J22 A;  3OMG A;  2SOB A;  2WAC A;  3QWN A;  2I07 B;  2WKD A;  3V2T A;  2EVB A;  2C5C A;  1V1O A;  1EIG A;  5AFW A;  4RGM A;  2RA4 A;  4UAI A;  2JYO A;  4XTC S;  1WTV A;  1JOO A;  1Y1V B;  1HRJ A;  5CGK A;  3CRK C;  3GTQ B;  4NDX A;  4DAV A;  2NUC A;  4F7X A;  1S5B D;  2E2H B;  1KNE A;  2F4I A;  3C2P A;  1SE3 A;  4OO1 I;  4TKO B;  1O80 A;  2EJF C;  1EEI D;  4QMG A;  4FP5 D;  4LJZ C;  3S14 B;  4XXE A;  3TZD A;  1MGS A;  2R6G A;  3M3Y B;  2MPM A;  1PFM A;  2EY6 A;  4RCN A;  3OOC A;  5FO9 B;  2RDG A;  3CRL C;  1NUC A;  4DGZ A;  2B2U A;  3OIP A;  3S15 B;  2WKC A;  1U4P A;  4RCO A;  2EZV A;  2F0D A;  3KBX A;  2KED A;  1PRT F;  4X3S A;  1SBB B;  4CKE A;  1E2V A;  2BE5 C;  1ILQ A;  5EKL A;  1U4M A;  1ILP A;  4FF2 A;  1B9M A;  2HCC A;  2MP1 A;  3HOU B;  3I3C A;  3NTH A;  4CKB A;  1TQO A;  3S1R B;  2NB0 A;  5JAV A;  4CBV A;  1PZJ D;  1V43 A;  4DAP A;  1TWA B;  4ZLT F;  1PTO D;  5EJW A;  1BUV T;  1EY5 A;  2NTT A;  1R9T B;  2ICI A;  3FDT A;  3K6O A;  1HPC A;  1WTW A;  3N52 A;  1TWG B;  2KJX A;  1Q12 A;  2EY5 A;  1EU3 A;  3IKJ A;  1YNJ D;  2LY7 A;  5JPN C;  5C3W A;  4IFD J;  1EFI D;  3Q6S A;  2IX0 A;  2EE1 A;  4K2K A;  1STB A;  1F2L A;  1SNQ A;  1WTP A;  3BDO A;  4XYO A;  1MSG A;  5E4X A;  4IFD H;  1V1P A;  2EYF A;  4A3M B;  3VA7 A;  2B2V A;  3NTK A;  1RTN A;  1XYI A;  3I91 A;  1F77 A;  1D5Z C;  4JBW A;  5D14 A;  3KK7 A;  5C6A A;  1IW7 C;  3HP3 A;  1G2T A;  4UDU C;  3K5O A;  4C1N K;  2NVX B;  1ML0 D;  4XDX A;  4K14 A;  2YU9 B;  4RFB A;  1SMY C;  3K59 A;  5CV9 A;  5ELD A;  2E75 C;  1MI2 A;  2GA4 B;  1T5E A;  5CR3 A;  2F0E A;  1X3P A;  4HTH A;  3RUZ A;  3VYT A;  4R8N A;  4OHJ A;  4PMW A;  5C0X J;  3BVM A;  1O78 A;  2F0N A;  5M5W B;  5CYU A;  1TKW B;  5K36 G;  2RDH A;  3FKI B;  2JEA I;  5C0X H;  4KHV A;  1PRT D;  2IL8 A;  3LWE A;  3NTI A;  2KUM A;  2QDB A;  4YIJ A;  4A3D B;  2B2V C;  2RSO A;  3AU7 A;  1SNP A;  4GZY C;  1IKM A;  2PZW A;  2E74 C;  3QG1 A;  3G6J B;  1H9S B;  3IAY A;  2EY1 A;  1PTO H;  4DXF A;  3OMC A;  5LL6 S;  3MXG A;  4J6H A;  3NSW A;  5KGU A;  4HN7 A;  2A73 B;  2Z4I A;  4HCE A;  4M8A A;  4C3H B;  3S1Q B;  4IUU A;  4TSS A;  1PZK D;  4RGN A;  1QE6 A;  4IZ8 A;  3QIA A;  1E2W A;  5DM6 3;  1WTO A;  2A6H D;  1JB3 A;  1ZYR D;  2NBF A;  4G7O C;  2LKV A;  5EKK A;  1HFN A;  5KNC A;  1I3Q B;  4OIK A;  1DZ1 A;  1KNA A;  4KV6 A;  3HKZ B;  2O5I C;  1II3 A;  1H9M A;  1I4H A;  1PMR A;  3K5N A;  1GOZ A;  3WOF A;  3HS0 C;  4C3I B;  3VR4 A;  5FLX E;  4O42 A;  1WVL A;  4ZUI A;  3A8J E;  2X69 A;  4DNR B;  3G7L A;  5BN5 A;  3J80 L;  2XSC A;  1BCP B;  1PYW D;  3A8K E;  1A3U A;  1TR5 A;  1SNC A;  1KAA A;  3Q24 A;  3R3O A;  3DWQ A;  2K32 A;  4M1U B;  1MBY A;  1JWS D;  4P2C B;  2PMZ B;  1HQM C;  4B9W A;  4WJW A;  2D5D A;  3S2D B;  1CZG A;  1UNS A;  3S16 B;  1GHK A;  2FIN B;  1WD0 A;  5DNF A;  1MD2 D;  3NXW A;  3GTG B;  3C1E A;  3Q22 A;  2R3Z A;  2IJ0 A;  1ESF A;  4B08 A;  4OGQ C;  1LV9 A;  4DK0 A;  2EJG C;  1YNJ C;  4IUT A;  3HOZ B;  4HSV A;  2HQE A;  2WV6 D;  1CQV A;  5I9P A;  3HRZ C;  3R93 A;  3GTP B;  4C3H G;  1I4Q A;  4HR7 B;  3K57 A;  3GTO B;  3A55 A;  3M7N A;  4KTA A;  5BN3 A;  4BY7 B;  1DYQ A;  2DNC A;  3E0J A;  1KDB A;  5EPJ A;  4BWG B;  2V4D A;  1DD2 A;  5C5M A;  1EZ6 A;  3KF8 A;  3OWF A;  3U9S A;  5CV7 A;  2F0J A;  2ICE C;  1FYC A;  2B39 A;  1RHP A;  1Z6H A;  1I4X A;  1R4P B;  3CHB D;  5C44 B;  2L9H A;  3PUX A;  3HEJ A;  3J81 E;  1H9J A;  2MGS A;  1Y8N B;  1D1I A;  1UEA B;  2F3W A;  3NBH A;  2G9H D;  2JA5 B;  2BE5 D;  3BVG A;  4TRD A;  3BS1 A;  2F0L A;  1AFP A;  1PRT C;  1Q1B A;  2A5H A;  3MTS A;  5K36 H;  3SEB A;  4A3E B;  1LTR D;  1FNV A;  1DCZ A;  4A93 B;  5FO8 B;  4ZKB B;  4KY6 A;  5FK9 C;  1FNU A;  2Y0S B;  3D4W A;  1YNN D;  1AW7 A;  1M8A A;  2F0F A;  1DOL A;  2A69 C;  4KY5 A;  2JA6 B;  2MHV A;  2Z8L A;  1AZP A;  1PTO B;  5KYI A;  5CC4 A;  1RF2 D;  4MIU A;  1LLR D;  3FPU B;  5IOD A;  3QOL A;  3AB9 A;  4FF4 A;  1Q90 A;  2FMM A;  1JOK A;  2BCO A;  3W2D A;  2B2W A;  2XVS A;  1I4G A;  3GV6 A;  1TVX A;  1SYB A;  4X3K A;  1I6H B;  2H4O A;  4HED A;  1JCK B;  5E1F A;  4L8J A;  1ZYR C;  4C56 C;  5ISR A;  2LMC B;  1CTM A;  1IHZ A;  1ENF A;  2JA8 B;  2C9O A;  2E2I B;  3MWY W;  1IW7 D;  5NUC A;  2IW3 A;  5EPK A;  2L0C A;  1KAB A;  1O7Z A;  2F0H A;  4K6D A;  4BBR B;  4H44 C;  5I2X A;  1SMY D;  3TZU A;  3D3R A;  3V96 A;  3NQI A;  3NWS A;  3HGB A;  2KVM A;  5KRU A;  1EQT A;  1TY2 A;  1LTI D;  3GD7 A;  5E3F A;  2EYP A;  5C0X G;  4LMQ D;  5C4Z A;  2PQE A;  4HMI A;  4KKT A;  5COY A;  4EGV A;  3FEW X;  4Q0F A;  1DXM A;  1OXV A;  3OHX C;  2F0S A;  2AUJ D;  3IFT A;  2B2W C;  2EOT A;  4G7H C;  3A54 A;  4ZK9 B;  3GTK B;  1EYD A;  3LWU A;  4XQJ A;  4K8I A;  4F88 A;  1STH A;  2WP8 J;  4CHT B;  4ULL A;  2TMP A;  4DXG A;  1OO9 B;  1DM0 B;  1OXU A;  1G91 A;  1TWC B;  5D3D A;  5CV8 A;  1RD9 D;  1SYC A;  2BA0 A;  2Z4H A;  2Q8I B;  3HOW B;  3P7J A;  3KBG A;  2R61 A;  3L9A X;  3HOX B;  2DY8 A;  1ZEQ X;  4HSP A;  1F9P A;  3HOY B;  4IFD I;  2LFN A;  5DAU A;  3M85 A;  3SDZ A;  1Q8I A;  2D9U A;  5A2Q L;  3DHQ A;  3NQT A;  1LTG D;  4QF4 A;  2B2T A;  3VYS A;  3A7L A;  4R8I A;  3GP7 A;  5EGT A;  1TT2 A;  1PLF A;  1B50 A;  1XWE A;  3RZD B;  3I73 A;  5ELF A;  4DU9 A;  1QCB D;  1QG7 A;  1LT6 D;  1LTA D;  4CGY B;  4RGT A;  4NW2 A;  1BNZ A;  3T53 B;  3GTJ B;  4EQP A;  2AWN A;  1HUN A;  1TY0 A;  1AP0 A;  1GUG A;  2K6A A;  3SE0 A;  3MFY A;  2CVR A;  1TS5 A;  4K2L A;  1QNU A;  3MEH A;  3S2H B;  2IX1 A;  1CM9 A;  1YNN C;  2RDF A;  4IQZ A;  3TP8 A;  2F0Q A;  2XRQ D;  2PO4 A;  3NWT A;  3JAM L;  3HOV B;  3D4R A;  5C0X I;  2EDG A;  3A56 A;  4BBS B;  4HAE A;  5BN4 A;  2CW0 C;  1G6Z A;  2F03 A;  5EQ0 A;  1B9N A;  3EFX D;  2KEC A;  1FD7 D;  3P1H A;  4U67 3;  2D62 A;  1XTC D;  1ENC A;  4S3S A;  3VR6 A;  2B2T C;  5IT9 E;  4OIJ A;  3ERQ A;  4XQQ A;  2O2L D;  4FNF A;  1RCV D;  4JK1 C;  1F9R A;  1KDC A;  3P75 A;  1LT3 D;  4H7B A;  1SYG A;  2F0V A;  2L11 A;  2XN9 C;  3ZYY X;  3TSS A;  3VA5 A;  4ODG A;  1VF7 A;  1HXY D;  1SXT A;  2F0P A;  4ZYS A;  2X6L A;  1GUT A;  1L0X B;  4QUC A;  1Y1W B;  1LAC A;  2B63 B;  2WII B;  2B8F A;  3PUW A;  2N55 A;  5EBC A;  2A68 D;  2XWB B;  1G2S A;  3VR5 A;  2Q8T A;  4ZRZ A;  3A8I E;  5KND A;  4IUN A;  4EQO A;  1OXS C;  4A3G B;  5EPL A;  1VDZ A;  4C1N I;  5C3X A;  5M5Y B;  1NCV A;  5IGG A;  3BZD B;  2JE6 I;  2BDN A;  4XIG S;  2K5D A;  4G7Z C;  4X3U A;  4BA2 I;  2VXW A;  2L12 A;  3TP6 A;  4A3B B;  4KJO A;  1ICW A;  1AEX A;  1NR4 A;  2NYZ D;  2E2J B;  4RH6 A;  2K03 A;  2SNM A;  3PV0 A;  5JJZ A;  1IKL A;  1ZXT A;  2A69 D;  1HHV A;  1WTX A;  1DOM A;  2F3V A;  1Z47 A;  1IL8 A;  2E2D C;  2F0W A;  5JOB A;  3T56 B;  4LAA A;  2NVY B;  4K6L A;  3E5S A;  2EYJ A;  4ID6 A;  1KTK A;  1OXX K;  1VCI A;  3J7A F;  1GJX A;  4L6T B;  1FR3 A;  2NN6 H;  2M9V A;  5JVH 3;  2K33 A;  3WDN A;  3K58 A;  4RAU C;  2ZXO A;  4DFA A;  4LK1 C;  3T51 B;  1SYF A;  4F8M A;  4RWS C;  1EWC A;  1E0B A;  1Z7T A;  2CHB D;  2E76 C;  3URY A;  2DNE A;  4PV1 C;  3CQZ B;  5G3L F;  3MXU A;  1JOQ A;  4WFN 3;  2AWO A;  3FPP A;  3MHB A;  4IUP A;  2EYL A;  4CKC A;  1B53 A;  3D6W A;  3J7Y W;  4EQN A;  4ILW A;  4I7Z C;  4DNT B;  4DK1 A;  2B2Y A;  3I90 A;  1F9S A;  4EVO A;  2FJ2 A;  4ZKC B;  2L1B A;  2AQ2 B;  1EY8 A;  3F2U A;  1VF5 C;  2ZXP A;  3PMF A;  5TSS A;  3DMU A;  1O7Y A;  3DXJ C;  3RLF A;  1WTR A;  2PNR C;  1R4Q B;  3BDL A;  1V1P B;  4ABN A;  2HCI A;  1GHJ A;  1F9Q A;  2CQA A;  4O1N A;  4CJ1 B;  1CZW A;  3NHH A;  1BOS A;  4J1M A;  1D6E C;  1X3Q A;  4A3J B;  4A3K B;  2OEO A;  1PFN A;  1SSO A;  3KLS X;  1CFM A;  1CK1 A;  1EL0 A;  1PXU A;  4X3T A;  1RJT A;  3NP8 A;  3LX0 A;  4PQX A;  2AQ1 B;  3IFD A;  1EY7 A;  4IAL A;  3K5M A;  2NVQ B;  1EOT A;  2EYO A;  2A68 C;  1EWH A;  1DOK A;  1E2Z A;  1BCP F;  5A35 A;  4A3F B;  2B2Y C;  1S5C D;  1QOH A;  2R7Z B;  1S4Z A;  3PUV A;  4OL7 A;  3PO2 B;  5HGT A;  3T4A C;  5KIX A;  4FYD A;  2IPK D;  3M7G A;  2KCN A;  1M4V A;  3KLS A;  4FF3 A;  2XNA C;  1B44 D;  4KY7 A;  2BDO A;  1TS4 A;  2M2L A;  3WOE A;  2K01 A;  3AMU A;  4K8J A;  1I6V C;  1XXG A;  3W3A A;  5EKI A;  4DA2 A;  2VB3 X;  1BXT A;  5KYL A;  3DEO A;  4FXG C;  1J8I A;  1TU2 B;  3J81 L;  1AZQ A;  5M3F B;  1EY9 A;  2OT2 A;  1SEB D;  4K5V A;  1BQQ T;  1K8O A;  3PUY A;  4J8Q A;  4U68 A;  4V19 0;  3I4M B;  2CW0 D;  2F0G A;  2F0O A;  2SEB D;  5IOC A;  1PZI D;  2X6G A;  3OPO A;  1SYD A;  2PW7 A;  3SHL A;  2EYM A;  1LAB A;  4KN7 C;  3BG3 A;  2MJ8 A;  4V0B A;  3R2I A;  3K5L A;  2RBM A;  2EYH A;  3H94 A;  1C8C A;  3QOJ A;  1V8Q A;  3OWE B;  4KMU C;  2NVT B;  2F1M A;  5IGD A;  3HZX A;  3IL8 A;  2K05 A;  1CHQ D;  1A3T A;  3I4L A;  4B9X A;  4BY1 B;  1UAP A;  2XIW A;  5C4X B;  3SK8 A;  5T1I A;  2KCC A;  4IUQ A;  5ELE A;  1O7L A;  1HFG A;  3DEP A;  2FHT A;  3VYU A;  1BCP D;  2K5W A;  2Q8R E;  3VYR A;  4IUV A;  1BO0 A;  1PTO F;  3EQL C;  1GXD C;  1HCZ A;  4DN4 M;  4PMC A;  1SYE A;  3EA6 A;  3MVV A;  5DM7 3;  1XX8 A;  2B8G A;  1PRT B;  2YYZ A;  3GTL B;  1G29 1;  3EJI A;  3PIP 3;  3VR3 A;  1S5E D;  3SK6 A;  1X32 A;  3L7Z C;  4QIW B;  1IYV A;  4K5W A;  1S5F D;  4NP5 A;  3MXN A;  2QEJ C;  5C5L A;  2PW5 A;  2WB1 B;  3SK5 A;  2JEB I;  1Y8O B;  4DAY A;  1NSN S;  3DM1 A;  4ZUJ A;  4FXK C;  5I6Y A;  5M3M B;  2NN6 G;  3TDQ A;  1F2Z A;  1GUO A;  1ROD A;  5A2Q E;  3SXH A;  2H1E A;  2QKI C;  1ONL A;  1TWH B;  3OW7 A;  1LTB D;  4RGO S;  1H9S A;  1KLG D;  5LHY 1;  4CJ2 C;  4L63 B;  2JSO A;  1ZKO A;  3T13 A;  1D5X C;  2R93 B;  3NPP A;  4FF1 A;  1I4P A;  3OIQ A;  1ENA A;  2KQ3 A;  4AYB B;  5HUR A;  3LNN A;  3I8Z A;  3RD4 A;  3MC0 B;  1SNO A;  4QUF A;  1BF4 A;  2SDF A;  4PMB A;  3D6C A;  1CT1 D;  1CI3 M;  1LO5 D;  5I9O A;  4FXD A;  1G8Z D;  3JAM E;  1B2T A;  1IYU A;  1JC7 A;  4QB4 A;  3A7A B;  3MAQ A;  3S9W A;  2A6E C;  4CJ0 B;  2WIN B;  3EVQ A;  2DN8 A;  2K28 A;  1EIH A;  2IX3 A;  1OXT A;  3DUZ A;  4WRD A;  1C4Q A;  3QJY A;  5ELB A;  2IWH A;  4BS9 A;  5COR A;  4R9W A;  1ET9 A;  2I46 A;  4KD4 A;  2KOL A;  3OSO A;  3N6R A;  1ET6 A;  1RKN A;  3I72 A;  5F2D A;  2AQ3 B;  3S1M B;  1HTL D;  1Y69 U;  1HA6 A;  2AUK A;  2F0K A;  2L5T A;  2ZT9 C;  3PIO 3;  4H13 C;  2O5J C;  1TWF B;  4C3J B;  1EEF D;  1EYA A;  1RTO A;  1VMP A;  1EY4 A;  2OF1 A;  1B4O A;  4OO1 H;  3Q0A A;  4KKS A;  1EY0 A;  1NR2 A;  3QB3 A;  2D2C C;  3X3M A;  2NN6 I;  2B2U C;  2VNU D;  3V05 A;  3TME A;  3NUC A;  1SAP A;  2L4N A;  3H09 A;  3MZ5 A;  3GTM B;  2EXZ A;  1D5M C;  5IT9 L;  3NK9 A;  2RSN A;  1TII D;  1QJO A;  1JQY D;  1A15 A;  2XWJ B;  1F2M A;  1Q3L A;  1KLU D;  2HDM A;  2HDL A;  5CV4 A;  5I4D A;  2XRS D;  1GUW A;  3RMH A;  3DWP A;  1JIC A;  1GUS A;  1BCP C;  3BYT B;  4ME5 A;  4HCS A;  3O13 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...