1B3AA

Total chemical synthesis and high-resolution crystal structure of the potent anti-hiv protein aop-rantes
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
67
structure length
67
Chain Sequence
b'PYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (RANTES)
publication title Total chemical synthesis and high-resolution crystal structure of the potent anti-HIV protein AOP-RANTES.
pubmed doi rcsb
molecule tags Anti-hiv protein
total genus 14
structure length 67
sequence length 67
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1b3aA00
3R93A 1WTVA 3HP3A 2HUGA 1O7ZA 1O80A 2KUMA 1QE6A 2K01A 1MI2A 2FHTA 3DEOA 2MJ8A 3F2UA 4HAEA 1PDQA 3QO2A 2D9UA 1WTRA 2RVLA 1HUNA 2N88A 1U4LA 3ONAB 1RTOA 1PLFA 2R3ZA 1SDFA 1VMCA 2FINB 1ZXTA 2XIWA 2KECA 3KBXA 5COYA 2SDFA 1RHPA 3P7JA 5EQ0A 2VXWA 4ZLTF 2KOLA 1IKMA 1AP0A 1DOKA 2B2WA 2EPBA 2K04A 1AZQA 1B50A 4ZKBB 3I3CA 1LV9A 2L1BA 4UAIA 4IUTA 1TVXA 1S4ZA 1X3QA 1ILQA 2HCIA 1WD0A 1BF4A 2B2VC 1G2TA 3GV6A 1HUMA 3G7LA 4HSVA 4U68A 4XT3B 2HDMA 5EJWA 5T1IA 3TZDA 1B53A 2B2TA 1PFNA 1U4PA 3I8ZA 3I90A 2X6GA 1BNZA 4X3SA 3UI2A 4HCSA 1EQTA 2NYZD 4IUPA 4RA8A 5JJZA 1ILPA 2FFKB 2FJ2A 4QUCA 1HA6A 1CM9A 1F9RA 3GV3A 1AZPA 3IL8A 2K05A 1ESRA 2DY7A 1F9SA 4X3KA 5AFWA 2B2YC 1QNKA 2RSNA 2X6LA 2N55A 2MPMA 2RSOA 3FPUB 1HRJA 1RODA 1NCVA 1SSOA 1B2TA 3N52A 2HDLA 1B3AA 4IUUA 1IL8A 2HCCA 4MN3A 4OIJA 5E4XA 2KEDA 2MP1A 4DN4M 1MSGA 1J8IA 2B2VA 3H91A 1JE4A 2EE1A 1ML0D 1PFMA 2K28A 2EOTA 5EKIA 1HFNA 4OIKA 1RTNA 2KVMA 1DOLA 3D6WA 1Q3LA 2B2UC 4CJ1B 2JYOA 1WVLA 1HHVA 1C8CA 4ZKCB 1MGSA 1CA5A 2KEEA 1BO0A 1PFBA 1U4RA 2M2LA 4LMQD 1DONA 2CVRA 4X3UA 5D14A 4MHEA 1KNAA 2J7ZA 1X3PA 1HFGA 3KUPA 4IUVA 5EPJA 2B2YA 1XYIA 1O7YA 3MWYW 4XDXA 5E4WC 1EL0A 1WTOA 2BDNA 3SVMA 5D65A 3Q6SA 1E0BA 2X69A 1NAPA 2DY8A 1BBXC 1G6ZA 1F9PA 4ZK9B 1F9QA 1F2LA 1CA6A 1WTWA 2L9HA 4XT1B 2MGSA 1WTXA 1XX8A 2H1EA 1WTPA 1RJTA 3IFDA 4RAUC 4HEDA 5CBAE 1SAPA 1QG7A 4RWSC 4CJ0B 5CMDA 4R9WA 4CJ2C 3I91A 4QUFA 1WD1A 1G91A 3DM1A 5CBEE 1WTQA 3TN2A 2JP1A 4IURA 1DZ1A 1ICWA 2L12A 2B2WC 2NWGA 3MTSA 4O42A 5EPLA 2Q8RE 4NW2A 1NR4A 5EPKA 1DOMA 1KNEA 2NZ1D 3DEPA 2K03A 2L11A 2B2UA 1B4OA 5DNFA 4X3TA 1VMPA 2FMMA 3FDTA 2B2TC 2RA4A 2K1BA 4ZAIA 4R8IA 1A15A 1X32A 2Q8TA 2L4NA 4IUQA 1IKLA 1JICA 2IL8A 3LWEA 1EOTA 1M8AA 5T1GA 1GUWA 1EIGA 1EIHA 5CORA 1J9OA 1G2SA 1U4MA 1MSHA 1NR2A
chains in the Genus database with same CATH superfamily
4JI0Q 3I7FA 1GD7A 2K32A 3A8KE 4UPAA 2D9UA 1STYA 1VQEA 2HQLA 2UUAQ 4JK1C 3G71A 4IZ8A 3SDZA 1AP0A 2JXMB 2EPBA 3BJUA 3TS2A 4DAPA 1BCPB 2LY7A 4CKBA 3NBIA 4N8X1 3OWFA 3TZDA 2ENBA 4C3JH 3H6MA 1YNJC 1XPRA 1XJVA 1HQRD 4TRDA 1FNWA 1XNRQ 3I90A 4PMWA 4X3SA 3J7AV 2MNAA 1M90C 3DMUA 1HNZQ 4DV1L 2LSSA 4GKKL 1Y8NB 1ICFB 2PZTA 3MEFA 1VQGA 1K83B 2X6LA 2N55A 1HTPA 2YU9B 2CW0D 1WFQA 1K83H 2NVQB 1HR0W 5JEAG 1B2TA 5GAHC 1JC7A 2NVTB 4EX5A 1J8IA 1T5XD 3PO2B 4BA2I 1FL0A 2V4DA 4IOAA 3WOFA 4M1UB 2IHFA 2KHIA 1JWUD 3H0GG 3PO2H 5FK9C 1EY7A 1PH8A 2PZUA 3OMCA 1Q1BA 2IWHA 1LT6D 4JI1Q 1PH3A 2PMZE 4EGVA 5FLXE 4C1NK 2B3GA 4PV1C 3T53B 4LJZC 2YTXA 5LMNL 3I4OA 1K0RA 1EU3A 1K8GA 5C5LA 2F0IA 4P72A 1TWAB 2LKVA 5IGCA 3HFZB 1FR3A 2A19A 3U58A 1GUSA 1H9RA 2MGSA 5GADC 1IBKL 1XX8A 4YCWA 3L2PA 3I4MG 4HEDA 4CJ2C 3A54A 4ZUJA 1Z7TA 2E5LQ 3ULPA 1C4QA 4N9PA 4O42A 5G3LD 1J5EQ 1O7LA 3F8TA 4RHSA 4POFA 3KDFA 1EWHA 3K7AB 3C46A 2WAQB 1SNMA 3K7AH 1EZ6A 1IL2A 5D3IB 2K7VA 3HOWB 1Y1WG 4GKJL 1LUZA 1Z47A 5CV7A 1O7ZA 1O80A 1D6EC 3QO2A 3TRZA 3JAML 4AIMA 4OELB 1RTOA 5D3DA 4XQNA 4DAVA 3DWAA 1QVCA 1ZKOA 3V05A 1HZBA 1X3QA 5DAUA 3OTOQ 4GOPA 2EJGC 2B2TA 2KBNA 2NB0A 1Q81C 1SE8A 2I07B 4ZUIA 2ZJQA 1CM9A 2EQSA 3K0XA 2DY7A 4ME5A 2F52A 1K8AC 4X3KA 4P75A 2B2YC 2F0EA 2K5HA 2LMCB 4ULLA 2R7ZB 1VQMA 3HEJA 4TVAB 2QDLA 2R7ZH 1RODA 1SSOA 4JCVE 1PRTC 2F0FA 4JG2A 1WTHA 2KEDA 2MP1A 3PO3H 4DR6L 4LFBL 2B2VA 2Z6KC 3QJYA 1XMOL 3MVVA 1X9NA 1G51A 3KBGA 3S9WA 3HOZH 4DK0A 2MFIA 4KLKA 3J7A5 4C3HH 4JPBW 4IPCA 1ASZA 1KC8C 5GAGC 4K2LA 2J7ZA 3HRZC 1A62A 1V43A 2A6HC 1UE7A 4APVA 1E0BA 1F9PA 5LHY1 1WTWA 3HOXG 1STAA 1I6VC 3NP8A 4DV6L 2PI2E 1JB3A 1Q8IA 3OIPA 4GKJQ 5FLMG 3S15B 4XIGS 4K0KL 1ENCA 1II3A 2Y0SG 2D0PA 4DV7L 4IN3A 3VR3A 1BXTA 3OYYA 2NZOA 2Q8TA 4IUQA 4ILWA 1AE2A 4HJAA 4XYQA 3FEWX 3VYUA 1YZ6A 1LYLA 4K6LA 4K8JA 2Q2IA 4JC0A 2F0KA 4RH6A 3JAMc 1N36L 3CU7A 1BCPD 5M5WB 2IX3A 1F2ZA 4A3IB 2AQ3B 1JORA 1VMCA 1X6OA 3TQYA 5DM73 1EIFA 2L5TA 5M5WH 4OO1I 1DOKA 1QZHA 5BR8L 1TY2A 1BR9A 4ZKBB 1LV9A 3Q8DA 4MIUA 1NJIC 2HCIA 4U68A 2O5IC 2QW7A 1KLGD 3EFXD 3BYYB 3PCOB 3L0OA 3S1MB 1YNND 1HJPA 4KY7A 1JQYD 5IP7H 1W2BA 1BNZA 3PV0A 3W1GA 3ITPA 2Z9HA 3S1MH 4FF3A 2QKIC 1PH2A 5FLXL 4LFBQ 4DR6Q 5EBDA 1OXVA 4XQJA 4OWXB 2PO4A 1HQMC 1Q12A 1N9WA 2HIVA 5IIFA 2HCCA 1H9MA 2QILA 3TP8A 3PO2G 1PYWD 1PHJA 3G6JB 3SHLA 3CCQA 4DUYQ 3I4NH 4HMJA 2CW0C 1EY8A 4B9XA 2XWJB 1PFMA 3T13A 1HFNA 1RTNA 1CT1D 5CV9A 4P71A 1UE5A 3NBHB 1YHAA 3HOVH 1MGSA 1AFPA 2CFMA 3NPPA 2NUCA 3V2TA 1N32L 2R92B 1KAAA 4LF9L 3NSWA 4DV6Q 1Q86C 2PMZB 4LF8Q 1Q90A 3RZDH 2BH8A 5IGDA 3SK4A 4PMCA 3D4RA 2A68C 5FO9B 1EQVA 4A3KH 1SNQA 2AWNA 4QJFA 1G91A 1Z6HA 1LTID 1E1OA 5EPLA 2K5WA 5JJKA 1LTSD 2NZ1D 2O4XA 3CD6A 3QIAA 1X56A 1KTKA 2WAQG 2WINB 3J81j 1L1OC 1E22A 1NBWA 1Y14B 2NBFA 3NHHA 4BBRG 4GN5A 3PUYA 5IGFA 3HOWG 4WORA 1EEFD 4L6TB 5E3FA 4MTKA 3D6WA 3R93A 2OTJA 2TSSA 5GQOA 2E76C 3T1YL 3M4PA 2DJFC 3Q24A 2UXBQ 1XWEA 2HD3A 2N8NA 3C2PA 1IYUA 4QF4A 5JEAJ 2O5JC 2KOLA 1EY4A 2K04A 4ABNA 1VQBA 4XYOA 4J15A 1C48A 2EY5A 1M1KC 3BS1A 1IBLL 1BBWA 4XT3B 5T1IA 1EY6A 1CSQA 2HDMA 1EU4A 3J7AF 1K8MA 1RD9D 1SR3A 3FMCA 5FKAC 2X6GA 3HKZE 2NYZD 3VDYA 3G48A 3KK7A 5ELBA 3VA5A 1GM5A 3DHQA 1Y69U 3T1HL 2VUMB 3CC4A 1D5MC 3AB9A 4UP7A 5FLXc 1C7YA 2R7ZG 4F8MA 4Y52H 3CPFA 2NTSA 4KN4C 5EBCA 4L5RC 3JAMi 2JA6B 1HRJA 4KTAA 2I5MX 4PMBA 4A3FB 1VQKA 4HTHA 1A2UA 3A7AB 3S1RH 1R4QB 5IGGA 4JOIA 2C5CA 2EDGA 1K73C 4QMGA 4LF9Q 1CKMA 1MD2D 4K5XA 2ZXOA 4DR1Q 1A6XA 1TXYA 1A3TA 4R4TA 4LMQD 2L15A 4JI5Q 4IUVA 3CCJA 1DD2A 2SEBD 2F3VA 2WKCA 4NKLA 1B9MA 1LO5D 1WCMH 3S16B 1BBXC 3GTJB 2RHSB 4JBMA 3J81E 3PF4A 1ZEQX 5FOBB 1V1PB 1TS3A 4AH6A 3MEHA 1SE2A 1SAPA 4X64Q 5CMDA 2O2LD 3S2HB 2EYFA 5CBEE 1WTQA 3S1QH 3TN2A 1ICWA 3CPWA 3EVQA 1WJJA 1NUCA 4NW2A 3S2HH 4G7ZC 4POGA 1FJGQ 1N33L 1N34L 2RA4A 4A76A 2K1BA 4ZAIA 3H3VC 3CW2C 1CHPD 3CCSA 3LX0A 3ULLA 2MO0A 5L37A 1SYFA 1U4MA 2UUBL 4WRDA 4A3BB 2JA7H 4A3IG 2CWAA 4LAAA 2PNRC 2E8GA 3KFUA 2JK8A 5IP9G 5KNDA 2R93H 1QUQB 2VXWA 1RCVD 5M5XH 2I0QA 2VW9A 3DLLA 2M00A 1DYQA 3T1HQ 3MHBA 3NBHA 4KHVA 4UP8A 2QEJC 5ELEA 2YTYA 1PH9A 3LNNA 1LTGD 3NQIA 1TKWB 5EKLA 1VQPA 1W6KA 4B3SQ 4LF4L 4BY1H 4R4IA 4LF6Q 1GHKA 2FFKB 3QR8A 4C2MH 1HZCA 2IHEA 1HNWQ 4WJWA 2VQFL 4HIMA 3IL8A 3PIO3 3BZDB 1YNNC 3BG3A 1W3SA 3TP5A 5LL6X 4J1MA 5C3EB 1BVSA 5C3EH 1K3RA 1QNUA 1LTTD 4L5TA 3MC0B 4FNFA 1KLUD 1S5FD 2NN6I 3KDFB 4R4CA 1JE5A 3E9HA 3KF8B 4P74A 3KLRA 1HZ9A 2R92G 3W5OA 1ET6A 4YIJA 4LUVA 1HCZA 1UAPA 3E3XA 5IYCG 1PH4A 2ZTCA 1ZYRD 2H1EA 4G57A 3VYTA 1N34Q 3IFDA 1CHQD 4JI2L 4DR4L 1TS4A 4QUFA 2EZVA 4X6AH 4OONA 3HG9A 5M9OA 1GUOA 5K36H 2JA5B 1YHBA 2MO1A 2YTVA 1SFOB 2ICIA 3STBD 1HNXQ 3CCMA 4YY3L 2JA5H 3S14B 4RCOA 3UDIA 3GTKH 2VY3A 4NDXA 3I56A 5KIXA 4JW0A 4OO1G 2F4IA 1CKOA 1V1QA 1PZKD 4EQPA 1DXMA 2Z4IA 3CCLA 3RNUA 3NXWA 2L0CA 2PZWA 4LF4Q 4B3ML 3GTPH 3MFGA 4RFBA 4XQQA 2SDFA 5I9OA 2ZXRA 5I9PA 3IFTA 2F4VL 4DXFA 4A3CH 2VQFQ 1WD0A 2OTLA 5C3WA 3ERSX 4JYAL 4A93B 2PW7A 3GV6A 4A75A 1L0XB 3GP7A 5I6YA 1UEBA 4X65Q 1VQJA 4GN4B 3NK9A 4RA8A 4BBSB 2VUMG 1S72A 1AE3A 3MXUA 1GUGA 3PUZA 4BBSH 5IT9E 2A74C 1KL9A 5C4XB 3NWSA 1F9RA 2A69C 1J6QA 3K80C 3HKZB 1V1PA 3GTOH 5C4XH 1ET9A 2MPMA 4X62L 2CWPA 2JA6G 2RSOA 2EJMA 2EXZA 4A3FG 1I6HH 3V96A 1EYCA 4M8AA 4LF7Q 4C3JB 2KJXA 1JJCB 4NPSA 2YV5A 4MN3A 4GNXC 2K5VA 3J81L 5E4XA 3CRKC 2PI2A 1CTMA 1MSGA 4BY7H 5AJ3Q 1IW7D 5IYBG 2NN6H 2RKSA 1MHWC 1JE4A 1FNVA 1LABA 1SYEA 1EIYB 4A3GH 3A0JA 4TSSA 3S24A 1U5KA 4RGTA 4L63B 1XMQL 1Q3LA 2F0JA 1S5CD 1C8CA 5KRUA 2M2LA 4IFDI 4JI4Q 4X3UA 4DV4L 3GTLH 3I72A 1X65A 1HFGA 4JI2Q 4DV3Q 4DR4Q 2ID0A 2ZM6L 5IWAQ 1YVCA 1EL0A 1LACA 3H15A 5C0XH 5M5YB 4NXMQ 4EQNA 1QUQA 1CSPA 1PTOF 2H5XA 5ISRA 3ZJYC 2TMPA 5M5YH 1Q46A 1G8ZD 1B7YB 4YY3Q 1HXYD 2R6GA 1GUNA 1Y1VH 1CUKA 2E74C 4IURA 1F2YA 4HMIA 1JCKB 3QOJA 1LTLA 4OWTB 4X3TA 1VMPA 2N49A 4JOIC 4R8IA 1O78A 1IKLA 1U9RA 5EGTA 1EY0A 4B3MQ 2ASBA 3H09A 1SRUA 3T56B 1GO3E 1B1ZA 1G2SA 3AYHB 4ZCKA 4IPHA 2UU9L 1KABA 4A3BG 1LTRD 2KUMA 1NTGA 1LT3D 3M4YA 2A8VA 1OXXK 3BVGA 1PTOH 1LT5D 1A0IA 2QEXA 3KF8A 2B2WA 1QCBD 1FGBD 1E24A 1TVXA 1STGA 1EYGA 5M3MH 2WIIB 1GVPA 1K9MC 4L5SA 2KCCA 3D6CA 1VQAA 4XTCS 4HCSA 4IUPA 1KHIA 3PIPA 2G9DA 5FJ8G 4CDFC 2KHSA 5CV6A 4JBWA 3BZCA 2ZTEA 3A8IE 1L2FA 4B3RL 1JWMD 3AQQA 3IRBA 3S2DB 5C3EG 3M7GA 3FPUB 1E2ZA 4DV1Q 1XMQQ 2HDLA 3S2DH 4GKKQ 2ZXPA 1VF5C 3J81c 4JBKA 2G5DA 2F0WA 4FXKC 1BBUA 2LS01 4FXGC 3OW2A 4IFDH 3BDLA 2RCNA 4QIWE 1QWYA 5D14A 3OOCA 4DPGA 3KUPA 4AYBE 4HIKA 3CC7A 2ALYB 5E4WC 1SNOA 4FVMA 1NMFA 3I55A 1VQ9A 3BDCA 3PO3B 4Q0FA 2Q2UA 1I5FA 3Q0AA 2K14A 2R7DA 1DGSA 1I50H 5LMNQ 5C3XA 3HOZB 3ER0A 4GZYC 5K36G 5HY6A 1VF7A 4QB4A 3DM1A 2AKWB 2EYJA 4C3HB 1JWSD 1CK1A 3CP0A 2NWGA 2DN8A 4HN7A 2GVAA 1Z9FA 2K5DA 2UU9Q 1TWCB 3BVZA 1IBKQ 4N8FA 2XN9C 4RKLA 2B2UA 1B4OA 2LXKA 4PZ6A 1TWCH 1SLJA 1B70B 4IUNA 5JAVA 3K5MA 4N9TA 3K81C 1X3FA 1O7IA 1WTVA 1F77A 5JVH3 3URYA 4UDUC 2E75C 5IT9L 3R3OA 1WTRA 1YHQA 2BE5D 4LW1A 3MA2B 3M9BA 2XWBB 1SNPA 4KJOA 3A8JE 2GVBA 3A5ZB 2E2HH 1RKNA 1VQLA 4A93G 1K8OA 3CMEA 3G4SA 2OQKA 1P8LA 3SE0A 5C44B 1KDAA 4G4KA 4BBSG 1VCIA 1BUVT 5BN4A 3EQLC 3J80i 5C44H 2FJ2A 3J7ZC 3QWNA 3HKZG 1PA6A 4H7BA 4RCNA 1ESRA 3RZOH 3QOLA 4ZQ3A 5AFWA 1N8RC 2RDGA 2PQEA 2FMCA 3R8BA 3M3YH 4C3JG 4PNYA 3UDGA 5GROA 3GD7A 2NN6G 3N52A 2JA8H 5TSSA 2RDFA 4OIJA 3HS0C 1VQ4A 4A3MH 3RUZA 3H91A 5BN5A 2OXPA 1SE4A 2F0QA 3MFYA 4YWKA 4CHTB 2OEOA 1UE6A 3EN2A 4LF5L 1B44D 3F1ZA 4LNQA 4DR2L 1IW7C 2F3IA 1Y8OB 1XMOQ 5C5MA 4QGUA 1GUTA 1SJHD 2UUCL 1F2LA 3I4NB 3VYRA 2KQ3A 2NVYH 2QA4A 2K50A 4HIDA 4DR5L 4A3DH 1WD1A 3HOVB 1PRTF 3J81i 1I4QA 4BXXH 1U0LA 2VB3X 4HJ9A 2KCTA 1PMRA 2CH4A 3DEPA 3A7LA 1STNA 3BVMA 3UE0A 2QGQA 3RZDB 3FDTA 4YCVA 2JEBI 5KNCA 1A3VA 1HPCA 1SBBB 5T1GA 3HOUH 3TSSA 1MSHA 4Z9CB 4A3KB 4K0KQ 1E1TA 1VQNA 4DV7Q 5IT9c 4ZYSA 2OCEA 5LMNW 1VQ8A 3GTMH 2RF4A 2FINB 4DXGA 3D8GA 5A2QE 5HURA 2UXCL 1UEAB 2EXDA 3E0EA 2EY1A 1V9PA 1PRTB 1PXUA 3SGIA 4IUTA 4C3IH 4HJ7A 4WFN3 1S4ZA 1N36Q 4JVZA 1CA6A 1D8LA 5KGUA 1B53A 1CKNB 3I8ZA 3AU7A 2DUDA 5BR8Q 3U9SA 1VQIA 3CHBD 1HA6A 4DR7L 2KCNA 3DWPA 2CQAA 2I5HA 2EJFC 2FXQA 1QNKA 2WB1E 2LXJA 4K8IA 4Y7NB 1VQHA 1G291 4LK1C 4GN3B 3TBIB 5JPNC 1NCVA 4LF5Q 3J80E 1B3AA 4Y7NH 4IFDG 1EY9A 2PYKA 2KCMA 3NE5B 3W3AA 1AN8A 2KVMA 3RLOA 3FRPB 1I3QB 2UUCQ 4FO2A 4H44C 2JYOA 1X54A 1TWHH 1CZWA 1I3QH 1PFBA 3SXHA 1LLRD 4C56C 3A74A 1TQOA 1R4PB 2HQEA 2A73B 1H9JA 4GLVB 1SYBA 4IJHA 3PO3G 1O7YA 4U673 4HIOA 3GTQH 3S1RB 1TT2A 1WYDA 2BDNA 4BS9A 4QIWB 5C4JH 1RF2D 3SVMA 3Q6SA 1NAPA 4IO9A 3I73A 1KXLA 1QVGA 1F9QA 3S1NB 4AYBB 1N32Q 1B3QA 3HOZG 3KJOA 2Z1CA 5LMUL 3S1NH 5CV8A 2C35B 4HJ8A 4C3HG 4R9WA 4RKBA 3GTGH 1YJ9A 4KHZA 1JJ2A 5CV4A 3MTSA 2F03A 2KENA 4LFCL 4R4OA 2ES2A 5CYUA 4CDCC 1YJNA 3TMEA 4GOPC 2VNUD 1JT8A 2B2TC 1JOQA 1WCMB 2ATWA 3TP7A 1X32A 1EQQA 1YBYA 2IL8A 2VL6A 4Q5VA 3L3OC 1A3UA 1HR0L 1GHJA 1X3GA 2Q2HA 2R7FA 2UXCQ 4J8QA 2CQOA 3TZUA 4X66L 4FP5D 3S1QB 1XXGA 3RMHA 1CFMA 1KRSA 3A5UA 1SYCA 2WKDA 3M4OH 4LWCA 1K3BC 2SNMA 5COYA 5IOCA 4ZLTF 1ENFA 3T4AC 1I94L 1B50A 2L1BA 3DM3A 3T1YQ 5C44G 3SK6A 2B2VC 3DWQA 1D5ZC 3SEBA 1Q1EA 2I5LX 5JEAH 3ICEA 5IGEA 4LFAL 3IAYA 2AQ1B 1KRTA 2JA7B 4TKOB 3RR5A 4CDDC 4B08A 1IBLQ 1VS0A 1UNSA 1B8AA 1AZPA 1XPUA 5G3LF 5J39A 2R93B 4DV0L 2WACA 5M5XB 3H0GH 3ULJA 2D62A 1R9TH 5EAYA 2PCFB 1PH7A 1PH1A 2BA1A 5GAEC 1T9HA 1IYVA 1JR0D 5IP7G 1BCPC 3QG1A 1H95A 4BY1B 3QB3A 2OWOA 3KYHC 1HTLD 4JI8L 1FNUA 4C2MB 1X55A 3A55A 3VR4A 2MUYA 1XPOA 4L5QA 4ODGA 3I4MB 3IKJA 5KYLA 3VYSA 2Z4HA 1EOVA 4DU9A 3H94A 3C1FA 3I4MH 1JMCA 1CA5A 1VQOA 2IW3A 5LMUQ 1L1OB 4KMUC 1MJEA 1KNAA 1V1OA 2B2YA 1CQVA 1SXTA 3MWYW 1NE3A 1C9OA 5E1FA 5D65A 3I4NG 4LFCQ 1EYAA 2F0HA 4BXXG 2I46A 1RJTA 3DUZA 4RAUC 3HOVG 1Y1WH 2F0GA 1JOKA 2E2JH 3K58A 1CKNA 1DZ1A 2Z6KA 1FYCA 4KN7C 3TREA 1KD1C 1WI5A 2IX1A 1NR4A 3CC2A 2GN5A 2L11A 3NENA 4C1NI 2BOSA 1VQ6A 1UUPA 1SEBD 2XSCA 4LUOA 1PH6A 1LTAD 3WDNA 3CF5A 3EA6A 1V8QA 4HSPA 4KKTA 4A3KG 5JPMC 2CKZB 1SNCA 5E7NA 1KAWA 5C0XI 1I94Q 2Z0SA 4K5VA 1N33Q 2K01A 3K5OA 4H02A 2EY2A 3R2TA 5IYDH 4LFAQ 3KBXA 3PGZA 1IHZA 1TY0A 2UUBQ 1IKMA 4F88A 3J80L 2K75A 1HNZL 5HGQA 1I4GA 3GTKB 3G7LA 4R8NA 4DV0Q 2ICEC 1STEA 4MNOA 2K52A 1U4PA 3CRLC 1ILPA 5JJZA 3U50C 2F0DA 2EYLA 4JBJA 1EWCA 1E7ZA 1I4XA 4O1NA 3GTPB 1OXUA 1MIUA 1K0SA 1A8VA 2F0TA 5K5PA 5KNBA 2B63B 1EZ8A 4H0LC 2RSNA 4YWLA 5JJLA 4DAYB 1CZGA 4IQZA 2B63H 3EROA 4DGZA 1EQRA 1PV4A 1Q7YC 5BN3A 2WB1B 4JI1L 1DM0B 2HHHL 3UE1A 4AQYL 3CKIB 4RGMA 1PYBA 1PFSA 2K28A 3NTKA 3HOXH 4OL7A 4EQ5A 1BCPF 2IX0A 3GTOB 3CQZH 3EJIA 4HJ5A 1U4RA 1I6HB 4UY8C 1HH2P 1EFID 1X3PA 5FLMH 2A6ED 4TQUS 2E5LL 3H3VH 1EEID 4B9WA 4BY7B 2DY8A 4AYBG 2D0OA 2L9HA 4XT1B 4A3GB 3FHWA 1E3PA 2D2CC 4KKUA 4FXDA 2RQXA 2H4OA 4V0BA 4DK1A 2L12A 1QB5D 3KOJA 1NSNS 3KLSA 5J1ZA 3RLNA 2NZHA 2Z6BA 3GTLB 4RHRA 4GLXA 2JJQA 2K5NA 1WCMG 2UXDL 3W2DA 3MXNB 3WOEA 4NB3A 3RN2A 1IXRA 4DAMA 1K28A 2OQ0A 3NTIA 3M7NA 4R4QA 1ENAA 1Y1VB 1VQCA 4HR7B 3LWUA 3FKIB 2WV6D 2N88A 3OTOL 2B39A 1JB7A 5IODA 3U9OA 3PIP3 3FKIH 3AEVA 1SNDA 3WWVA 4EVOA 4JV5L 3J80c 2YU9H 1QOHA 1G2TA 2IJ0A 4IFDJ 4G7OC 2NVQH 1L1OA 3M85A 1A2TA 1FGUA 1STBA 2YYZA 2JA7G 2NVTH 3NUCA 3CCVA 4DK6C 1RIPA 2F4VQ 1OXSC 4JYAQ 2R93G 3DXJC 2F0OA 1PTOB 3GV3A 2HHHQ 1D1KA 3A56A 4AQYQ 2A68D 1YIJA 3VR6A 5KYIA 3AFQA 4BY1G 5M3MB 2OT2A 5DLQE 3FP9A 4F7XA 1TWAH 5I6WA 3KLWA 2PQAB 1L0WA 2SNSA 4X62Q 3PUXA 5ELOA 3W1BA 5EKIA 2KHJA 3PF5A 1TU2B 2CCZA 5CR3A 4CJ1B 3C3LA 4ZKCB 3GDEA 1EFWA 5JJIA 1IYJB 3X3NA 5ELNA 1WTOA 4NP5A 4BBRB 4K14A 4OHJA 3E5SA 4QCLA 2NVXB 4KD3A 4OGQC 4K5WA 4BBRH 1E2VA 4O2DA 3HOWH 2UXDQ 2NVXH 4DV4Q 1WTPA 4P73A 5CBAE 2ZM6Q 4RWSC 3UDXA 4QQBX 3ZYYX 1NMGA 2JP1A 2XRSD 3PUVA 5CGKA 2EIFA 5C6AA 3OSOA 3EBEA 2K4KA 4IOCA 4S3SA 1KNEA 2JSOA 5JOBA 2K03A 4V190 2L55A 3Q22A 3BYTB 2L4NA 3K59A 3LWEA 4DAYA 1I50B 1EIGA 2PNHA 2EYPA 3OIQA 3I2ZA 3HP3A 3GQBA 3DEOA 5IYDG 5CORA 4JV5Q 1MI2A 2FHTA 3F2UA 4A3EB 4B3TL 1SYGA 1S5ED 1MBYA 3F2CA 4A3EH 2MQHA 4KD4A 5F2DA 1YEZA 3GO5A 2JA5G 1ZYRC 2G9HD 2JN4A 5EQ0A 3NEMA 1VQ5A 1S5DD 1TR5A 5I2XA 4GNXB 2K5QA 4GLAC 2JA9A 2J4XA 1HUMA 1ONLA 1OTCA 3E9IA 2LFNA 4IPGA 2F1MA 2ZTDA 4OX9L 4DR3L 1PYSB 3STBC 1Y8PB 4PG3A 1L0YB 4FYDA 2B63G 4A3CG 2E2HB 4DUYL 1LT4D 3O13A 1D1IA 3CCUA 4CKCA 2WB1G 4DFAA 3D4WA 3JC66 1YNXA 3RLFA 3SK8A 3D4DA 3AMUA 4J6HA 3FVQA 4QL5A 4B3RQ 2EYHA 4EQOA 1TS5A 1Q8KA 2BCOA 3MXNA 3TEHB 4ID6A 3OMGA 2AQ2B 5C4XG 4JI3L 4LF8L 3RZOB 2IY5B 3SR1A 1HHVA 5J22A 3PUWA 2K33A 3R2IA 3M3YB 1DONA 3ERQA 3TP6A 2CVRA 1SYDA 4MHEA 5EPJA 2JA8B 1Q82C 3S15H 3VA7A 4BY7G 4XDXA 3KJPA 2PW5A 4A3MB 1SROA 4A3GG 3CAMA 1XTCD 4YWMA 4DV2L 4RMFA 4ALPA 3P75A 2A6EC 1QG7A 3PQIA 2N3SA 2F0PA 2DGYA 2ZJRA 2Q8RE 3I70A 1SMYD 2F0NA 3NWTA 4A3IH 4RGOS 5C0XG 1HZAA 3SK5A 4B3TQ 2FMMA 5IP9H 4DA2A 1H9SB 3OHXC 2UXBL 4DUZL 1TS2A 2NVYB 3CXCA 4P2CB 1Y1VG 2F0SA 4A3DB 1BDOA 3X3MA 4PQXA 4HAEA 4A3LH 1QE6A 2AHOB 2IT1A 3FKIG 1A63A 2PQAA 1U4LA 3K7UC 4RG1A 4O0AA 4OX9Q 1RHPA 3P7JA 4DR3Q 1DJRD 1KDCA 5ELCA 1UE1A 1M4VA 1WOCA 3HZXA 3HOUB 5EJWA 1PTOD 5EKKA 4OEMB 4FF1A 4IPDA 4PZ7A 5I4DA 2JQOA 1CQFA 2SOBA 5NUCA 2RHQB 5A35A 3GTMB 5ELDA 5H1SE 1G6PA 3ND8A 2ZJPA 1SN8A 1I4HA 3HOYB 1SE3A 2CH4W 4C3IB 4JI7L 2F0VA 4NXNL 5M3MG 2R92H 2BDOA 3HOYH 4JI3Q 4DR1L 4WJ3M 1IL8A 3BZKA 1JJGA 1SMXA 1TIID 1NR2A 5IYCH 4JI5L 2WP8J 1DOLA 3L7ZC 3F2BA 4FDBA 3VR5A 4DV2Q 1C0AA 1OXTA 1X3EA 1YJWA 3T16A 3LGJA 4X64L 5FO8B 1G6ZA 4HCEA 4I7AA 2K6AA 4DR2Q 1FVIA 1PZJD 4GNXA 1BQQT 1T5EA 2GA4B 4DF7A 4A3JB 5M3FB 1FJGL 1I4RA 4CJ0B 1GKHA 1TWHB 2RBMA 4A3JH 5M3FH 4DUZQ 1JOOA 4YHHL 4OO1H 4R1JA 2B2WC 4E6IA 3K57A 2Y0SE 3TDQA 1QJOA 1DOMA 3PMFA 5DNFA 3GTQB 4DR5Q 5C4JB 2P5ZX 1ASYA 5C4HA 1D7QA 2KA7A 1FD7D 2A69D 1S5BD 4OXPA 3D3RA 1EOTA 4MTNA 5JVG3 3HGBA 3CCEA 4WJ4A 3MXGA 1GUWA 1EIHA 1S40A 1J9OA 5FO7B 2R61A 4A3EG 3BDOA 3GTGB 4IALA 1IBML 2MJ8A 1PDQA 3OW7A 2DNCA 2RVLA 3OPOA 4UP9A 3AFPA 2VUMH 1PLFA 1MJCA 1SDFA 2R3ZA 1YNJD 2MHVA 1KIXA 2BH2A 4B3SL 2XIWA 2KECA 1STHA 4LF6L 3U4ZA 4ZRZA 4PZ8A 1YI2A 3J7YW 1BKBA 1ESFA 4KI0A 1HNWL 1BF4A 2JA6H 3RD4A 4RGNA 4KKSA 2OF1A 4HSVA 3NQTA 3G6EA 4A4IA 4DV5L 4A3FH 2PPBC 3TS0A 1PFNA 3K5LA 5IY0A 2D5DA 2B29A 3HKSA 4JI7Q 3MXPA 4NXNQ 1EQTA 1PZID 1RDPD 1H9KA 2QF7A 3KF6B 4YCUA 4QUCA 5CC4A 1PVOA 2XNAC 4KY5A 5IYBH 2QDBA 3M4QA 3M4OB 4FF4A 3D31A 1QVFA 3K0YA 1F9SA 3C1EA 4BWGB 3K6OA 4I7ZC 4ME3A 3VR2A 1DCZA 1OO9B 1RL2A 3P20A 5J3BA 1KQSA 4DR7Q 4MZ9A 2BE5C 4IUUA 4I65A 1AEXA 2VQEL 4K2KA 2DNEA 2F0MA 2VB2X 3S16H 3L9AX 3GTJH 1QZGA 1TWFB 2ZT9C 1H9SA 1XNQL 1ML0D 1EY5A 3S17B 4OIKA 2C9OA 1TWFH 2BA0A 2F0UA 3H0GB 4DNIA 2B2UC 1R9TB 1WVLA 3S17H 2XRQD 1GJXA 2JA8G 2QCPX 3KLSX 4A3MG 4YHHQ 3OWEB 1D5XC 2X69A 1BOSA 1NY4A 1XTDA 2JEAI 2HT1A 4F87A 4L8JA 1EWIA 2HIXA 5DM63 1HNXL 4JI6L 4DNRB 2EVBA 3T51B 1S3OA 4A3BH 1B9NA 2WAQE 2Q8IB 1D2BA 5EPKA 2VS1A 2VZAA 1IBMQ 2E2IB 3P1HA 4KHPL 1MKHA 2AUKA 3U4VA 3K5NA 1A15A 2RDHA 2E2IH 1VQ7A 3RN5A 4A3LG 5IGBA 5CV5A 2DJGC 4A3DG 1M8AA 5IE8A 2XTIA 1SMYC 2V1CC 3N6RA 3F2DA 1Y1WB 5HGTA 3H3VI 2HUGA 1AW7A 2AWOA 2E2JB 1EYDA 2JE6I 4GS3A 5DEHA 1VDZA 1HUNA 1YITA 1VQDA 4DV5Q 3ONAB 2J0TD 1F2MA 5FJ8H 4CGYB 4K6DA 1HR0Q 1ZXTA 4X65L 2EYOA 5A2QL 2F0LA 1QILA 2Z8LA 1P16A 1W6JA 3EIVA 4H13C 4X66Q 1AZQA 4JI0L 3I3CA 4UAIA 3HOUG 3B6YA 1ILQA 2AMCB 4NMZA 4IJLA 2N78A 2UUAL 4QY7A 3UI2A 4CKEA 1TWGB 2XGTA 5I2YA 4LF7L 4BA1I 1VQFA 5ELFA 2Q2TA 1TWGH 3JAME 1PRTD 2VQEQ 4FF2A 2K05A 1PTOC 3HOYG 4UHVA 4G7HC 4C3IG 5AJ3L 2E2DC 2XVSA 3NTHA 1XNQQ 1XNRL 2A1AA 3UDFA 2M9VA 3MAQA 1HA5A 4DN4M 4DNTB 3PIOA 1CI3M 4KJNA 4LUZA 4JI4L 2EE1A 1PH5A 1UWVA 2EYMA 4DV3L 2EOTA 3MZ5A 1LTBD 5IWAL 2A6HD 5C0XJ 4NXML 2KEEA 1BO0A 4JI8Q 4GOPB 4JI6Q 2NTTA 3CCRA 3Q23A 1NNXA 1XYIA 1KDBA 2F3WA 1SFOH 2CHBD 4XXEA 3FPPA 5KEEA 3S14H 5LL6S 4OWWB 4ZK9B 2B8FA 4KK7A 2WFWA 4A3JG 5M3FG 1WTXA 3PSIA 3ND9A 3HOXB 4KHPQ 2EY6A 3BU2A 1GOZA 3CMAA 3I91A 2AUJD 1SJED 3CQZB 4CBVA 4DK3C 2RCFA 1GXDC 4DKAC 3KF6A 2IPKD 1LM0A 3D0FA 1IZ6A 3NELA 4KV6A 2A5HA 3E0JA 3I4LA 3E6ZX 2Y0SB 4KY6A 4CDEC 1JICA 1AH9A 4A93H 3K8AA 5C4ZA 1J5EL 1EUJA 1E2WA 1I4PA 2B8GA
chains in the Genus database with same CATH topology
2K32A 3A8KE 2D9UA 1STYA 4JK1C 4IZ8A 3SDZA 1AP0A 2JXMB 2EPBA 4DAPA 1BCPB 2LY7A 4CKBA 3NBIA 3OWFA 3TZDA 2ENBA 3H6MA 1YNJC 1HQRD 4TRDA 1FNWA 3I90A 4PMWA 4X3SA 3J7AV 3DMUA 1Y8NB 2PZTA 1K83B 2X6LA 2N55A 1HTPA 2YU9B 2CW0D 2NVQB 5JEAG 1B2TA 1JC7A 2NVTB 1J8IA 1T5XD 3PO2B 4BA2I 2V4DA 3WOFA 4M1UB 1JWUD 5FK9C 1EY7A 2PZUA 3OMCA 1Q1BA 2IWHA 1LT6D 4EGVA 5FLXE 4C1NK 4PV1C 3T53B 4LJZC 1EU3A 5C5LA 2F0IA 1TWAB 2LKVA 5IGCA 1FR3A 1GUSA 1H9RA 2MGSA 1XX8A 4HEDA 4CJ2C 3A54A 4ZUJA 1Z7TA 1C4QA 4N9PA 4O42A 5G3LD 1O7LA 4RHSA 1EWHA 3K7AB 3C46A 2WAQB 1SNMA 1EZ6A 5D3IB 2K7VA 3HOWB 1Z47A 5CV7A 1O7ZA 1O80A 1D6EC 3QO2A 3JAML 1RTOA 5D3DA 4XQNA 4DAVA 3DWAA 1ZKOA 3V05A 1X3QA 5DAUA 2EJGC 2B2TA 2NB0A 2I07B 4ZUIA 1CM9A 2DY7A 4ME5A 4X3KA 2B2YC 2F0EA 2LMCB 4ULLA 2R7ZB 3HEJA 1RODA 1SSOA 1PRTC 2F0FA 2KEDA 2MP1A 2B2VA 3QJYA 3MVVA 3KBGA 3S9WA 4DK0A 4K2LA 2J7ZA 3HRZC 2A6HC 1V43A 1E0BA 1F9PA 5LHY1 1WTWA 1STAA 1I6VC 3NP8A 1JB3A 1Q8IA 3OIPA 3S15B 4XIGS 1ENCA 1II3A 4IN3A 3VR3A 1BXTA 2Q8TA 4IUQA 4ILWA 4XYQA 3FEWX 3VYUA 4K6LA 4K8JA 2F0KA 4RH6A 3CU7A 1BCPD 5M5WB 2IX3A 1F2ZA 4A3IB 2AQ3B 1JORA 1VMCA 5DM73 2L5TA 4OO1I 1DOKA 1TY2A 1BR9A 4ZKBB 1LV9A 4MIUA 2HCIA 4U68A 2O5IC 1KLGD 3EFXD 3BYYB 3S1MB 1YNND 4KY7A 1JQYD 1BNZA 3PV0A 3ITPA 4FF3A 2QKIC 5FLXL 5EBDA 1OXVA 4XQJA 2PO4A 1HQMC 1Q12A 5IIFA 2HCCA 1H9MA 2QILA 3TP8A 1PYWD 3G6JB 3SHLA 4HMJA 2CW0C 1EY8A 4B9XA 2XWJB 1PFMA 3T13A 1HFNA 1RTNA 1CT1D 5CV9A 1MGSA 1AFPA 3NPPA 2NUCA 3V2TA 2R92B 1KAAA 3NSWA 2PMZB 1Q90A 5IGDA 3SK4A 4PMCA 3D4RA 2A68C 5FO9B 1EQVA 1SNQA 2AWNA 1G91A 1Z6HA 1LTID 5EPLA 2K5WA 1LTSD 2NZ1D 2O4XA 3QIAA 2WINB 1KTKA 2NBFA 3NHHA 3PUYA 5IGFA 4WORA 1EEFD 4L6TB 5E3FA 3D6WA 3R93A 2TSSA 2E76C 3Q24A 1XWEA 3C2PA 1IYUA 4QF4A 5JEAJ 2O5JC 2KOLA 1EY4A 2K04A 4ABNA 4XYOA 1C48A 2EY5A 3BS1A 4XT3B 5T1IA 1EY6A 2HDMA 1EU4A 3J7AF 1K8MA 1RD9D 3FMCA 5FKAC 2X6GA 2NYZD 3KK7A 5ELBA 3VA5A 3DHQA 1Y69U 2VUMB 1D5MC 3AB9A 4F8MA 2NTSA 4KN4C 5EBCA 2JA6B 1HRJA 4KTAA 4PMBA 4A3FB 4HTHA 1A2UA 3A7AB 1R4QB 5IGGA 2C5CA 2EDGA 4QMGA 1MD2D 4K5XA 2ZXOA 1A6XA 1A3TA 4LMQD 4IUVA 1DD2A 2SEBD 2F3VA 2WKCA 4NKLA 1B9MA 1LO5D 3S16B 1BBXC 3GTJB 3J81E 1ZEQX 5FOBB 1V1PB 1TS3A 3MEHA 1SE2A 1SAPA 5CMDA 2O2LD 3S2HB 2EYFA 5CBEE 1WTQA 3TN2A 1ICWA 3EVQA 1NUCA 4NW2A 4G7ZC 2RA4A 2K1BA 4ZAIA 3H3VC 1CHPD 3LX0A 1SYFA 1U4MA 4WRDA 4A3BB 4LAAA 2PNRC 5KNDA 2VXWA 1RCVD 2M00A 1DYQA 3MHBA 3NBHA 4KHVA 2QEJC 5ELEA 3LNNA 1LTGD 3NQIA 1TKWB 5EKLA 1W6KA 1GHKA 2FFKB 4WJWA 3IL8A 3PIO3 3BZDB 1YNNC 3BG3A 3TP5A 5LL6X 4J1MA 5C3EB 1QNUA 1LTTD 3MC0B 4FNFA 1KLUD 1S5FD 2NN6I 3KLRA 1ET6A 4YIJA 1HCZA 1UAPA 1ZYRD 2H1EA 4G57A 3VYTA 3IFDA 1CHQD 1TS4A 4QUFA 2EZVA 3HG9A 5M9OA 1GUOA 5K36H 2JA5B 1SFOB 2ICIA 3S14B 4RCOA 4NDXA 5KIXA 4OO1G 2F4IA 1PZKD 4EQPA 1DXMA 2Z4IA 3NXWA 2L0CA 2PZWA 3MFGA 4RFBA 4XQQA 2SDFA 5I9OA 2ZXRA 5I9PA 3IFTA 4DXFA 1WD0A 4A93B 5C3WA 2PW7A 3GV6A 1L0XB 3GP7A 5I6YA 3NK9A 4RA8A 4BBSB 3MXUA 1GUGA 3PUZA 5IT9E 2A74C 5C4XB 1F9RA 3NWSA 2A69C 3HKZB 1V1PA 1ET9A 2MPMA 2RSOA 2EJMA 2EXZA 3V96A 1EYCA 4M8AA 4C3JB 2KJXA 4MN3A 3J81L 5E4XA 3CRKC 1CTMA 1MSGA 1IW7D 2NN6H 2RKSA 1JE4A 1FNVA 1LABA 1SYEA 4TSSA 4RGTA 4L63B 1Q3LA 2F0JA 1S5CD 1C8CA 5KRUA 2M2LA 4IFDI 4X3UA 3I72A 1HFGA 2ID0A 1EL0A 1LACA 5C0XH 5M5YB 4EQNA 1PTOF 5ISRA 2TMPA 1G8ZD 1HXYD 2R6GA 1GUNA 2E74C 4IURA 1F2YA 4HMIA 1JCKB 3QOJA 4X3TA 1VMPA 4R8IA 1O78A 1IKLA 1U9RA 5EGTA 1EY0A 3H09A 3T56B 1B1ZA 1G2SA 1KABA 1LTRD 2KUMA 1LT3D 3M4YA 1OXXK 3BVGA 1PTOH 1LT5D 3KF8A 2B2WA 1QCBD 1FGBD 1TVXA 1STGA 2WIIB 2KCCA 3D6CA 4XTCS 4HCSA 4IUPA 2G9DA 2KHSA 5CV6A 4JBWA 3A8IE 1JWMD 3S2DB 3M7GA 3FPUB 1E2ZA 2HDLA 2ZXPA 1VF5C 2F0WA 4FXKC 2LS01 4FXGC 4IFDH 3BDLA 1QWYA 5D14A 3OOCA 3KUPA 5E4WC 1SNOA 4FVMA 3PO3B 3BDCA 4Q0FA 3Q0AA 5C3XA 3HOZB 4GZYC 5K36G 1VF7A 4QB4A 3DM1A 2EYJA 4C3HB 1JWSD 1CK1A 2NWGA 2DN8A 4HN7A 2K5DA 1TWCB 3BVZA 2XN9C 4RKLA 2B2UA 1B4OA 4IUNA 5JAVA 3K5MA 4N9TA 1WTVA 1F77A 5JVH3 3URYA 4UDUC 2E75C 5IT9L 3R3OA 1WTRA 2BE5D 3MA2B 2XWBB 1SNPA 4KJOA 3A8JE 1RKNA 1K8OA 3SE0A 5C44B 1KDAA 4G4KA 1VCIA 1BUVT 5BN4A 3EQLC 2FJ2A 3QWNA 4H7BA 4RCNA 1ESRA 3QOLA 4ZQ3A 5AFWA 2RDGA 2PQEA 2FMCA 3R8BA 4C3JG 4PNYA 3GD7A 2NN6G 3N52A 5TSSA 2RDFA 4OIJA 3HS0C 3RUZA 3H91A 5BN5A 2OXPA 1SE4A 2F0QA 3MFYA 4CHTB 2OEOA 1B44D 1IW7C 1Y8OB 5C5MA 1GUTA 1SJHD 1F2LA 3I4NB 3VYRA 2KQ3A 1WD1A 3HOVB 1PRTF 1I4QA 2VB3X 1PMRA 3DEPA 3A7LA 1STNA 3BVMA 3RZDB 3FDTA 2JEBI 5KNCA 1A3VA 1HPCA 1SBBB 5T1GA 3TSSA 4Z9CB 1MSHA 4A3KB 4ZYSA 2FINB 4DXGA 3D8GA 5A2QE 5HURA 1UEAB 2EY1A 1PRTB 1PXUA 4IUTA 4WFN3 1S4ZA 1CA6A 5KGUA 1B53A 3I8ZA 3AU7A 3U9SA 3CHBD 1HA6A 2KCNA 3DWPA 2CQAA 2EJFC 1QNKA 4K8IA 4Y7NB 1G291 4LK1C 3TBIB 5JPNC 1NCVA 3J80E 1B3AA 4IFDG 1EY9A 2PYKA 3NE5B 3W3AA 1AN8A 2KVMA 3FRPB 1I3QB 4FO2A 4H44C 2JYOA 1CZWA 1PFBA 3SXHA 1LLRD 4C56C 1TQOA 1R4PB 2HQEA 2A73B 1H9JA 1SYBA 1O7YA 4U673 3S1RB 1TT2A 2BDNA 4BS9A 4QIWB 1RF2D 3SVMA 3Q6SA 1NAPA 3I73A 1F9QA 3S1NB 4AYBB 2Z1CA 5CV8A 4C3HG 4R9WA 4RKBA 4KHZA 5CV4A 3MTSA 2F03A 5CYUA 3TMEA 2VNUD 2B2TC 1JOQA 1WCMB 3TP7A 1X32A 2IL8A 4Q5VA 3L3OC 1A3UA 1GHJA 4J8QA 3TZUA 4FP5D 3S1QB 1XXGA 3RMHA 1CFMA 1SYCA 2WKDA 2SNMA 5COYA 5IOCA 4ZLTF 1ENFA 3T4AC 1B50A 2L1BA 3SK6A 2B2VC 3DWQA 1D5ZC 3SEBA 1Q1EA 5JEAH 5IGEA 3IAYA 2AQ1B 2JA7B 4TKOB 4B08A 1UNSA 1AZPA 5G3LF 5J39A 2R93B 2WACA 5M5XB 2D62A 2PCFB 2BA1A 1IYVA 1JR0D 1BCPC 3QG1A 4BY1B 3QB3A 1HTLD 1FNUA 4C2MB 3A55A 3VR4A 2MUYA 4ODGA 3I4MB 3IKJA 5KYLA 3VYSA 2Z4HA 4DU9A 3H94A 3C1FA 1CA5A 2IW3A 4KMUC 1KNAA 1V1OA 2B2YA 1CQVA 1SXTA 3MWYW 5E1FA 5D65A 1EYAA 2F0HA 2I46A 1RJTA 3DUZA 4RAUC 2F0GA 1JOKA 3K58A 1DZ1A 1FYCA 4KN7C 2IX1A 1NR4A 2L11A 4C1NI 2BOSA 1UUPA 1SEBD 2XSCA 1LTAD 3WDNA 3EA6A 1V8QA 4HSPA 4KKTA 5JPMC 1SNCA 5C0XI 4K5VA 2K01A 3K5OA 2EY2A 3R2TA 3KBXA 1IHZA 1TY0A 1IKMA 4F88A 3J80L 1I4GA 3GTKB 3G7LA 4R8NA 2ICEC 1STEA 1U4PA 3CRLC 1ILPA 5JJZA 2F0DA 2EYLA 1EWCA 1I4XA 4O1NA 3GTPB 1OXUA 2F0TA 5K5PA 5KNBA 2B63B 1EZ8A 4H0LC 2RSNA 1CZGA 4IQZA 3EROA 4DGZA 5BN3A 2WB1B 1DM0B 3CKIB 4RGMA 2K28A 3NTKA 4OL7A 1BCPF 2IX0A 3GTOB 3EJIA 1U4RA 1I6HB 1EFID 1X3PA 2A6ED 4TQUS 1EEID 4B9WA 4BY7B 2DY8A 2L9HA 4XT1B 4A3GB 2D2CC 4KKUA 4FXDA 2RQXA 2H4OA 4V0BA 4DK1A 2L12A 1QB5D 1NSNS 3KLSA 5J1ZA 3GTLB 4RHRA 3W2DA 3WOEA 3NTIA 3M7NA 1ENAA 1Y1VB 4HR7B 3LWUA 3FKIB 2WV6D 2N88A 2B39A 5IODA 3U9OA 3PIP3 1SNDA 4EVOA 1QOHA 1G2TA 2IJ0A 4IFDJ 4G7OC 3M85A 1A2TA 1STBA 2YYZA 3NUCA 1OXSC 3DXJC 2F0OA 1PTOB 3GV3A 1D1KA 3A56A 2A68D 3VR6A 5KYIA 5M3MB 2OT2A 4F7XA 5I6WA 2SNSA 3PUXA 5EKIA 1TU2B 5CR3A 4CJ1B 3C3LA 4ZKCB 3X3NA 1WTOA 4NP5A 4BBRB 4K14A 4OHJA 3E5SA 4QCLA 2NVXB 4KD3A 4OGQC 4K5WA 1E2VA 1WTPA 5CBAE 4RWSC 3ZYYX 2JP1A 2XRSD 3PUVA 5CGKA 5C6AA 3OSOA 4S3SA 1KNEA 2JSOA 5JOBA 2K03A 4V190 2L55A 3Q22A 3BYTB 2L4NA 3K59A 3LWEA 4DAYA 1I50B 1EIGA 2EYPA 3OIQA 3HP3A 3GQBA 3DEOA 5CORA 1MI2A 2FHTA 3F2UA 4A3EB 1SYGA 1S5ED 1MBYA 4KD4A 5F2DA 3GO5A 1ZYRC 2G9HD 5EQ0A 1S5DD 1TR5A 5I2XA 2K5QA 2J4XA 1HUMA 1ONLA 2LFNA 2F1MA 1Y8PB 1L0YB 4FYDA 2E2HB 1LT4D 3O13A 1D1IA 4CKCA 4DFAA 3D4WA 3RLFA 3SK8A 3D4DA 3AMUA 4J6HA 3FVQA 2EYHA 4EQOA 1TS5A 2BCOA 3MXNA 4ID6A 3OMGA 2AQ2B 3RZOB 3SR1A 1HHVA 5J22A 3PUWA 2K33A 3R2IA 3M3YB 1DONA 3ERQA 3TP6A 2CVRA 1SYDA 4MHEA 5EPJA 2JA8B 3VA7A 4XDXA 2PW5A 4A3MB 1XTCD 3P75A 2A6EC 1QG7A 2F0PA 2Q8RE 3I70A 1SMYD 2F0NA 3NWTA 4RGOS 5C0XG 3SK5A 2FMMA 4DA2A 1H9SB 3OHXC 1TS2A 2NVYB 4P2CB 2F0SA 4A3DB 1BDOA 3X3MA 4PQXA 4HAEA 1QE6A 2IT1A 1U4LA 1RHPA 3P7JA 1DJRD 1KDCA 5ELCA 1M4VA 3HZXA 3HOUB 5EJWA 1PTOD 5EKKA 4FF1A 5I4DA 1CQFA 2SOBA 5NUCA 5A35A 3GTMB 5ELDA 3ND8A 1I4HA 3HOYB 1SE3A 4C3IB 2F0VA 2BDOA 1IL8A 1TIID 1NR2A 2WP8J 1DOLA 3L7ZC 3VR5A 1OXTA 3T16A 5FO8B 1G6ZA 4HCEA 2K6AA 1PZJD 1BQQT 1T5EA 2GA4B 4DF7A 4A3JB 5M3FB 1I4RA 4CJ0B 1TWHB 2RBMA 1JOOA 4OO1H 2B2WC 4E6IA 3K57A 3TDQA 1QJOA 1DOMA 3PMFA 5DNFA 3GTQB 5C4JB 5C4HA 2KA7A 1FD7D 2A69D 1S5BD 3D3RA 1EOTA 5JVG3 3HGBA 3MXGA 1GUWA 1EIHA 1J9OA 5FO7B 2R61A 3BDOA 3GTGB 4IALA 2MJ8A 1PDQA 3OW7A 2DNCA 2RVLA 3OPOA 1PLFA 2R3ZA 1SDFA 1YNJD 2MHVA 2XIWA 2KECA 1STHA 4ZRZA 3J7YW 4KI0A 1ESFA 1BF4A 3RD4A 4RGNA 4KKSA 2OF1A 4HSVA 3NQTA 2PPBC 1PFNA 3K5LA 2D5DA 3MXPA 1EQTA 1PZID 1RDPD 1H9KA 2QF7A 4QUCA 5CC4A 2XNAC 4KY5A 2QDBA 3M4OB 4FF4A 3D31A 3K0YA 1F9SA 3C1EA 4BWGB 3K6OA 4I7ZC 3VR2A 1DCZA 1OO9B 3P20A 2BE5C 4IUUA 4I65A 1AEXA 4K2KA 2DNEA 2F0MA 2VB2X 3L9AX 1TWFB 1H9SA 2ZT9C 1ML0D 1EY5A 3S17B 4OIKA 2C9OA 2BA0A 2F0UA 3H0GB 1R9TB 2B2UC 1WVLA 2XRQD 1GJXA 2QCPX 3KLSX 3OWEB 1D5XC 2X69A 1BOSA 2JEAI 4F87A 4L8JA 5DM63 4DNRB 2EVBA 3T51B 1B9NA 2Q8IB 1D2BA 5EPKA 2E2IB 3P1HA 2AUKA 3K5NA 1A15A 2RDHA 5IGBA 5CV5A 1M8AA 1SMYC 3N6RA 1Y1WB 5HGTA 2HUGA 1AW7A 2AWOA 2E2JB 1EYDA 2JE6I 5DEHA 1VDZA 1HUNA 3ONAB 2J0TD 1F2MA 4CGYB 4K6DA 1ZXTA 2EYOA 5A2QL 2F0LA 1QILA 2Z8LA 1W6JA 4H13C 1AZQA 3I3CA 4UAIA 1ILQA 4NMZA 3UI2A 4CKEA 1TWGB 5I2YA 4BA1I 5ELFA 3JAME 1PRTD 4FF2A 2K05A 1PTOC 4G7HC 4C3IG 2E2DC 2XVSA 3NTHA 2M9VA 3MAQA 1HA5A 4DN4M 4DNTB 1CI3M 4KJNA 2EE1A 2EYMA 2EOTA 3MZ5A 1LTBD 2A6HD 5C0XJ 2KEEA 1BO0A 2NTTA 3Q23A 1XYIA 1KDBA 2F3WA 2CHBD 4XXEA 3FPPA 5KEEA 5LL6S 4ZK9B 2B8FA 4KK7A 1WTXA 3ND9A 3HOXB 2EY6A 1GOZA 3I91A 2AUJD 1SJED 4CBVA 3CQZB 1GXDC 2IPKD 4KV6A 2A5HA 3E0JA 3I4LA 3E6ZX 2Y0SB 4KY6A 1JICA 5C4ZA 1E2WA 1I4PA 2B8GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R93 A;  1WTV A;  3HP3 A;  2HUG A;  1O7Z A;  1O80 A;  2KUM A;  1QE6 A;  2K01 A;  1MI2 A;  2FHT A;  3DEO A;  2MJ8 A;  3F2U A;  4HAE A;  1PDQ A;  3QO2 A;  2D9U A;  1WTR A;  2RVL A;  1HUN A;  2N88 A;  1U4L A;  3ONA B;  1RTO A;  1PLF A;  2R3Z A;  1SDF A;  1VMC A;  2FIN B;  1ZXT A;  2XIW A;  2KEC A;  3KBX A;  5COY A;  2SDF A;  1RHP A;  3P7J A;  5EQ0 A;  2VXW A;  4ZLT F;  2KOL A;  1IKM A;  1AP0 A;  1DOK A;  2B2W A;  2EPB A;  2K04 A;  1AZQ A;  1B50 A;  4ZKB B;  3I3C A;  1LV9 A;  2L1B A;  4UAI A;  4IUT A;  1TVX A;  1S4Z A;  1X3Q A;  1ILQ A;  2HCI A;  1WD0 A;  1BF4 A;  2B2V C;  1G2T A;  3GV6 A;  1HUM A;  3G7L A;  4HSV A;  4U68 A;  4XT3 B;  2HDM A;  5EJW A;  5T1I A;  3TZD A;  1B53 A;  2B2T A;  1PFN A;  1U4P A;  3I8Z A;  3I90 A;  2X6G A;  1BNZ A;  4X3S A;  3UI2 A;  4HCS A;  1EQT A;  2NYZ D;  4IUP A;  4RA8 A;  5JJZ A;  1ILP A;  2FFK B;  2FJ2 A;  4QUC A;  1HA6 A;  1CM9 A;  1F9R A;  3GV3 A;  1AZP A;  3IL8 A;  2K05 A;  1ESR A;  2DY7 A;  1F9S A;  4X3K A;  5AFW A;  2B2Y C;  1QNK A;  2RSN A;  2X6L A;  2N55 A;  2MPM A;  2RSO A;  3FPU B;  1HRJ A;  1ROD A;  1NCV A;  1SSO A;  1B2T A;  3N52 A;  2HDL A;  1B3A A;  4IUU A;  1IL8 A;  2HCC A;  4MN3 A;  4OIJ A;  5E4X A;  2KED A;  2MP1 A;  4DN4 M;  1MSG A;  1J8I A;  2B2V A;  3H91 A;  1JE4 A;  2EE1 A;  1ML0 D;  1PFM A;  2K28 A;  2EOT A;  5EKI A;  1HFN A;  4OIK A;  1RTN A;  2KVM A;  1DOL A;  3D6W A;  1Q3L A;  2B2U C;  4CJ1 B;  2JYO A;  1WVL A;  1HHV A;  1C8C A;  4ZKC B;  1MGS A;  1CA5 A;  2KEE A;  1BO0 A;  1PFB A;  1U4R A;  2M2L A;  4LMQ D;  1DON A;  2CVR A;  4X3U A;  5D14 A;  4MHE A;  1KNA A;  2J7Z A;  1X3P A;  1HFG A;  3KUP A;  4IUV A;  5EPJ A;  2B2Y A;  1XYI A;  1O7Y A;  3MWY W;  4XDX A;  5E4W C;  1EL0 A;  1WTO A;  2BDN A;  3SVM A;  5D65 A;  3Q6S A;  1E0B A;  2X69 A;  1NAP A;  2DY8 A;  1BBX C;  1G6Z A;  1F9P A;  4ZK9 B;  1F9Q A;  1F2L A;  1CA6 A;  1WTW A;  2L9H A;  4XT1 B;  2MGS A;  1WTX A;  1XX8 A;  2H1E A;  1WTP A;  1RJT A;  3IFD A;  4RAU C;  4HED A;  5CBA E;  1SAP A;  1QG7 A;  4RWS C;  4CJ0 B;  5CMD A;  4R9W A;  4CJ2 C;  3I91 A;  4QUF A;  1WD1 A;  1G91 A;  3DM1 A;  5CBE E;  1WTQ A;  3TN2 A;  2JP1 A;  4IUR A;  1DZ1 A;  1ICW A;  2L12 A;  2B2W C;  2NWG A;  3MTS A;  4O42 A;  5EPL A;  2Q8R E;  4NW2 A;  1NR4 A;  5EPK A;  1DOM A;  1KNE A;  2NZ1 D;  3DEP A;  2K03 A;  2L11 A;  2B2U A;  1B4O A;  5DNF A;  4X3T A;  1VMP A;  2FMM A;  3FDT A;  2B2T C;  2RA4 A;  2K1B A;  4ZAI A;  4R8I A;  1A15 A;  1X32 A;  2Q8T A;  2L4N A;  4IUQ A;  1IKL A;  1JIC A;  2IL8 A;  3LWE A;  1EOT A;  1M8A A;  5T1G A;  1GUW A;  1EIG A;  1EIH A;  5COR A;  1J9O A;  1G2S A;  1U4M A;  1MSH A;  1NR2 A; 
#chains in the Genus database with same CATH topology
 4JI0 Q;  3I7F A;  1GD7 A;  2K32 A;  3A8K E;  4UPA A;  2D9U A;  1STY A;  1VQE A;  2HQL A;  2UUA Q;  4JK1 C;  3G71 A;  4IZ8 A;  3SDZ A;  1AP0 A;  2JXM B;  2EPB A;  3BJU A;  3TS2 A;  4DAP A;  1BCP B;  2LY7 A;  4CKB A;  3NBI A;  4N8X 1;  3OWF A;  3TZD A;  2ENB A;  4C3J H;  3H6M A;  1YNJ C;  1XPR A;  1XJV A;  1HQR D;  4TRD A;  1FNW A;  1XNR Q;  3I90 A;  4PMW A;  4X3S A;  3J7A V;  2MNA A;  1M90 C;  3DMU A;  1HNZ Q;  4DV1 L;  2LSS A;  4GKK L;  1Y8N B;  1ICF B;  2PZT A;  3MEF A;  1VQG A;  1K83 B;  2X6L A;  2N55 A;  1HTP A;  2YU9 B;  2CW0 D;  1WFQ A;  1K83 H;  2NVQ B;  1HR0 W;  5JEA G;  1B2T A;  5GAH C;  1JC7 A;  2NVT B;  4EX5 A;  1J8I A;  1T5X D;  3PO2 B;  4BA2 I;  1FL0 A;  2V4D A;  4IOA A;  3WOF A;  4M1U B;  2IHF A;  2KHI A;  1JWU D;  3H0G G;  3PO2 H;  5FK9 C;  1EY7 A;  1PH8 A;  2PZU A;  3OMC A;  1Q1B A;  2IWH A;  1LT6 D;  4JI1 Q;  1PH3 A;  2PMZ E;  4EGV A;  5FLX E;  4C1N K;  2B3G A;  4PV1 C;  3T53 B;  4LJZ C;  2YTX A;  5LMN L;  3I4O A;  1K0R A;  1EU3 A;  1K8G A;  5C5L A;  2F0I A;  4P72 A;  1TWA B;  2LKV A;  5IGC A;  3HFZ B;  1FR3 A;  2A19 A;  3U58 A;  1GUS A;  1H9R A;  2MGS A;  5GAD C;  1IBK L;  1XX8 A;  4YCW A;  3L2P A;  3I4M G;  4HED A;  4CJ2 C;  3A54 A;  4ZUJ A;  1Z7T A;  2E5L Q;  3ULP A;  1C4Q A;  4N9P A;  4O42 A;  5G3L D;  1J5E Q;  1O7L A;  3F8T A;  4RHS A;  4POF A;  3KDF A;  1EWH A;  3K7A B;  3C46 A;  2WAQ B;  1SNM A;  3K7A H;  1EZ6 A;  1IL2 A;  5D3I B;  2K7V A;  3HOW B;  1Y1W G;  4GKJ L;  1LUZ A;  1Z47 A;  5CV7 A;  1O7Z A;  1O80 A;  1D6E C;  3QO2 A;  3TRZ A;  3JAM L;  4AIM A;  4OEL B;  1RTO A;  5D3D A;  4XQN A;  4DAV A;  3DWA A;  1QVC A;  1ZKO A;  3V05 A;  1HZB A;  1X3Q A;  5DAU A;  3OTO Q;  4GOP A;  2EJG C;  2B2T A;  2KBN A;  2NB0 A;  1Q81 C;  1SE8 A;  2I07 B;  4ZUI A;  2ZJQ A;  1CM9 A;  2EQS A;  3K0X A;  2DY7 A;  4ME5 A;  2F52 A;  1K8A C;  4X3K A;  4P75 A;  2B2Y C;  2F0E A;  2K5H A;  2LMC B;  4ULL A;  2R7Z B;  1VQM A;  3HEJ A;  4TVA B;  2QDL A;  2R7Z H;  1ROD A;  1SSO A;  4JCV E;  1PRT C;  2F0F A;  4JG2 A;  1WTH A;  2KED A;  2MP1 A;  3PO3 H;  4DR6 L;  4LFB L;  2B2V A;  2Z6K C;  3QJY A;  1XMO L;  3MVV A;  1X9N A;  1G51 A;  3KBG A;  3S9W A;  3HOZ H;  4DK0 A;  2MFI A;  4KLK A;  3J7A 5;  4C3H H;  4JPB W;  4IPC A;  1ASZ A;  1KC8 C;  5GAG C;  4K2L A;  2J7Z A;  3HRZ C;  1A62 A;  1V43 A;  2A6H C;  1UE7 A;  4APV A;  1E0B A;  1F9P A;  5LHY 1;  1WTW A;  3HOX G;  1STA A;  1I6V C;  3NP8 A;  4DV6 L;  2PI2 E;  1JB3 A;  1Q8I A;  3OIP A;  4GKJ Q;  5FLM G;  3S15 B;  4XIG S;  4K0K L;  1ENC A;  1II3 A;  2Y0S G;  2D0P A;  4DV7 L;  4IN3 A;  3VR3 A;  1BXT A;  3OYY A;  2NZO A;  2Q8T A;  4IUQ A;  4ILW A;  1AE2 A;  4HJA A;  4XYQ A;  3FEW X;  3VYU A;  1YZ6 A;  1LYL A;  4K6L A;  4K8J A;  2Q2I A;  4JC0 A;  2F0K A;  4RH6 A;  3JAM c;  1N36 L;  3CU7 A;  1BCP D;  5M5W B;  2IX3 A;  1F2Z A;  4A3I B;  2AQ3 B;  1JOR A;  1VMC A;  1X6O A;  3TQY A;  5DM7 3;  1EIF A;  2L5T A;  5M5W H;  4OO1 I;  1DOK A;  1QZH A;  5BR8 L;  1TY2 A;  1BR9 A;  4ZKB B;  1LV9 A;  3Q8D A;  4MIU A;  1NJI C;  2HCI A;  4U68 A;  2O5I C;  2QW7 A;  1KLG D;  3EFX D;  3BYY B;  3PCO B;  3L0O A;  3S1M B;  1YNN D;  1HJP A;  4KY7 A;  1JQY D;  5IP7 H;  1W2B A;  1BNZ A;  3PV0 A;  3W1G A;  3ITP A;  2Z9H A;  3S1M H;  4FF3 A;  2QKI C;  1PH2 A;  5FLX L;  4LFB Q;  4DR6 Q;  5EBD A;  1OXV A;  4XQJ A;  4OWX B;  2PO4 A;  1HQM C;  1Q12 A;  1N9W A;  2HIV A;  5IIF A;  2HCC A;  1H9M A;  2QIL A;  3TP8 A;  3PO2 G;  1PYW D;  1PHJ A;  3G6J B;  3SHL A;  3CCQ A;  4DUY Q;  3I4N H;  4HMJ A;  2CW0 C;  1EY8 A;  4B9X A;  2XWJ B;  1PFM A;  3T13 A;  1HFN A;  1RTN A;  1CT1 D;  5CV9 A;  4P71 A;  1UE5 A;  3NBH B;  1YHA A;  3HOV H;  1MGS A;  1AFP A;  2CFM A;  3NPP A;  2NUC A;  3V2T A;  1N32 L;  2R92 B;  1KAA A;  4LF9 L;  3NSW A;  4DV6 Q;  1Q86 C;  2PMZ B;  4LF8 Q;  1Q90 A;  3RZD H;  2BH8 A;  5IGD A;  3SK4 A;  4PMC A;  3D4R A;  2A68 C;  5FO9 B;  1EQV A;  4A3K H;  1SNQ A;  2AWN A;  4QJF A;  1G91 A;  1Z6H A;  1LTI D;  1E1O A;  5EPL A;  2K5W A;  5JJK A;  1LTS D;  2NZ1 D;  2O4X A;  3CD6 A;  3QIA A;  1X56 A;  1KTK A;  2WAQ G;  2WIN B;  3J81 j;  1L1O C;  1E22 A;  1NBW A;  1Y14 B;  2NBF A;  3NHH A;  4BBR G;  4GN5 A;  3PUY A;  5IGF A;  3HOW G;  4WOR A;  1EEF D;  4L6T B;  5E3F A;  4MTK A;  3D6W A;  3R93 A;  2OTJ A;  2TSS A;  5GQO A;  2E76 C;  3T1Y L;  3M4P A;  2DJF C;  3Q24 A;  2UXB Q;  1XWE A;  2HD3 A;  2N8N A;  3C2P A;  1IYU A;  4QF4 A;  5JEA J;  2O5J C;  2KOL A;  1EY4 A;  2K04 A;  4ABN A;  1VQB A;  4XYO A;  4J15 A;  1C48 A;  2EY5 A;  1M1K C;  3BS1 A;  1IBL L;  1BBW A;  4XT3 B;  5T1I A;  1EY6 A;  1CSQ A;  2HDM A;  1EU4 A;  3J7A F;  1K8M A;  1RD9 D;  1SR3 A;  3FMC A;  5FKA C;  2X6G A;  3HKZ E;  2NYZ D;  3VDY A;  3G48 A;  3KK7 A;  5ELB A;  3VA5 A;  1GM5 A;  3DHQ A;  1Y69 U;  3T1H L;  2VUM B;  3CC4 A;  1D5M C;  3AB9 A;  4UP7 A;  5FLX c;  1C7Y A;  2R7Z G;  4F8M A;  4Y52 H;  3CPF A;  2NTS A;  4KN4 C;  5EBC A;  4L5R C;  3JAM i;  2JA6 B;  1HRJ A;  4KTA A;  2I5M X;  4PMB A;  4A3F B;  1VQK A;  4HTH A;  1A2U A;  3A7A B;  3S1R H;  1R4Q B;  5IGG A;  4JOI A;  2C5C A;  2EDG A;  1K73 C;  4QMG A;  4LF9 Q;  1CKM A;  1MD2 D;  4K5X A;  2ZXO A;  4DR1 Q;  1A6X A;  1TXY A;  1A3T A;  4R4T A;  4LMQ D;  2L15 A;  4JI5 Q;  4IUV A;  3CCJ A;  1DD2 A;  2SEB D;  2F3V A;  2WKC A;  4NKL A;  1B9M A;  1LO5 D;  1WCM H;  3S16 B;  1BBX C;  3GTJ B;  2RHS B;  4JBM A;  3J81 E;  3PF4 A;  1ZEQ X;  5FOB B;  1V1P B;  1TS3 A;  4AH6 A;  3MEH A;  1SE2 A;  1SAP A;  4X64 Q;  5CMD A;  2O2L D;  3S2H B;  2EYF A;  5CBE E;  1WTQ A;  3S1Q H;  3TN2 A;  1ICW A;  3CPW A;  3EVQ A;  1WJJ A;  1NUC A;  4NW2 A;  3S2H H;  4G7Z C;  4POG A;  1FJG Q;  1N33 L;  1N34 L;  2RA4 A;  4A76 A;  2K1B A;  4ZAI A;  3H3V C;  3CW2 C;  1CHP D;  3CCS A;  3LX0 A;  3ULL A;  2MO0 A;  5L37 A;  1SYF A;  1U4M A;  2UUB L;  4WRD A;  4A3B B;  2JA7 H;  4A3I G;  2CWA A;  4LAA A;  2PNR C;  2E8G A;  3KFU A;  2JK8 A;  5IP9 G;  5KND A;  2R93 H;  1QUQ B;  2VXW A;  1RCV D;  5M5X H;  2I0Q A;  2VW9 A;  3DLL A;  2M00 A;  1DYQ A;  3T1H Q;  3MHB A;  3NBH A;  4KHV A;  4UP8 A;  2QEJ C;  5ELE A;  2YTY A;  1PH9 A;  3LNN A;  1LTG D;  3NQI A;  1TKW B;  5EKL A;  1VQP A;  1W6K A;  4B3S Q;  4LF4 L;  4BY1 H;  4R4I A;  4LF6 Q;  1GHK A;  2FFK B;  3QR8 A;  4C2M H;  1HZC A;  2IHE A;  1HNW Q;  4WJW A;  2VQF L;  4HIM A;  3IL8 A;  3PIO 3;  3BZD B;  1YNN C;  3BG3 A;  1W3S A;  3TP5 A;  5LL6 X;  4J1M A;  5C3E B;  1BVS A;  5C3E H;  1K3R A;  1QNU A;  1LTT D;  4L5T A;  3MC0 B;  4FNF A;  1KLU D;  1S5F D;  2NN6 I;  3KDF B;  4R4C A;  1JE5 A;  3E9H A;  3KF8 B;  4P74 A;  3KLR A;  1HZ9 A;  2R92 G;  3W5O A;  1ET6 A;  4YIJ A;  4LUV A;  1HCZ A;  1UAP A;  3E3X A;  5IYC G;  1PH4 A;  2ZTC A;  1ZYR D;  2H1E A;  4G57 A;  3VYT A;  1N34 Q;  3IFD A;  1CHQ D;  4JI2 L;  4DR4 L;  1TS4 A;  4QUF A;  2EZV A;  4X6A H;  4OON A;  3HG9 A;  5M9O A;  1GUO A;  5K36 H;  2JA5 B;  1YHB A;  2MO1 A;  2YTV A;  1SFO B;  2ICI A;  3STB D;  1HNX Q;  3CCM A;  4YY3 L;  2JA5 H;  3S14 B;  4RCO A;  3UDI A;  3GTK H;  2VY3 A;  4NDX A;  3I56 A;  5KIX A;  4JW0 A;  4OO1 G;  2F4I A;  1CKO A;  1V1Q A;  1PZK D;  4EQP A;  1DXM A;  2Z4I A;  3CCL A;  3RNU A;  3NXW A;  2L0C A;  2PZW A;  4LF4 Q;  4B3M L;  3GTP H;  3MFG A;  4RFB A;  4XQQ A;  2SDF A;  5I9O A;  2ZXR A;  5I9P A;  3IFT A;  2F4V L;  4DXF A;  4A3C H;  2VQF Q;  1WD0 A;  2OTL A;  5C3W A;  3ERS X;  4JYA L;  4A93 B;  2PW7 A;  3GV6 A;  4A75 A;  1L0X B;  3GP7 A;  5I6Y A;  1UEB A;  4X65 Q;  1VQJ A;  4GN4 B;  3NK9 A;  4RA8 A;  4BBS B;  2VUM G;  1S72 A;  1AE3 A;  3MXU A;  1GUG A;  3PUZ A;  4BBS H;  5IT9 E;  2A74 C;  1KL9 A;  5C4X B;  3NWS A;  1F9R A;  2A69 C;  1J6Q A;  3K80 C;  3HKZ B;  1V1P A;  3GTO H;  5C4X H;  1ET9 A;  2MPM A;  4X62 L;  2CWP A;  2JA6 G;  2RSO A;  2EJM A;  2EXZ A;  4A3F G;  1I6H H;  3V96 A;  1EYC A;  4M8A A;  4LF7 Q;  4C3J B;  2KJX A;  1JJC B;  4NPS A;  2YV5 A;  4MN3 A;  4GNX C;  2K5V A;  3J81 L;  5E4X A;  3CRK C;  2PI2 A;  1CTM A;  1MSG A;  4BY7 H;  5AJ3 Q;  1IW7 D;  5IYB G;  2NN6 H;  2RKS A;  1MHW C;  1JE4 A;  1FNV A;  1LAB A;  1SYE A;  1EIY B;  4A3G H;  3A0J A;  4TSS A;  3S24 A;  1U5K A;  4RGT A;  4L63 B;  1XMQ L;  1Q3L A;  2F0J A;  1S5C D;  1C8C A;  5KRU A;  2M2L A;  4IFD I;  4JI4 Q;  4X3U A;  4DV4 L;  3GTL H;  3I72 A;  1X65 A;  1HFG A;  4JI2 Q;  4DV3 Q;  4DR4 Q;  2ID0 A;  2ZM6 L;  5IWA Q;  1YVC A;  1EL0 A;  1LAC A;  3H15 A;  5C0X H;  5M5Y B;  4NXM Q;  4EQN A;  1QUQ A;  1CSP A;  1PTO F;  2H5X A;  5ISR A;  3ZJY C;  2TMP A;  5M5Y H;  1Q46 A;  1G8Z D;  1B7Y B;  4YY3 Q;  1HXY D;  2R6G A;  1GUN A;  1Y1V H;  1CUK A;  2E74 C;  4IUR A;  1F2Y A;  4HMI A;  1JCK B;  3QOJ A;  1LTL A;  4OWT B;  4X3T A;  1VMP A;  2N49 A;  4JOI C;  4R8I A;  1O78 A;  1IKL A;  1U9R A;  5EGT A;  1EY0 A;  4B3M Q;  2ASB A;  3H09 A;  1SRU A;  3T56 B;  1GO3 E;  1B1Z A;  1G2S A;  3AYH B;  4ZCK A;  4IPH A;  2UU9 L;  1KAB A;  4A3B G;  1LTR D;  2KUM A;  1NTG A;  1LT3 D;  3M4Y A;  2A8V A;  1OXX K;  3BVG A;  1PTO H;  1LT5 D;  1A0I A;  2QEX A;  3KF8 A;  2B2W A;  1QCB D;  1FGB D;  1E24 A;  1TVX A;  1STG A;  1EYG A;  5M3M H;  2WII B;  1GVP A;  1K9M C;  4L5S A;  2KCC A;  3D6C A;  1VQA A;  4XTC S;  4HCS A;  4IUP A;  1KHI A;  3PIP A;  2G9D A;  5FJ8 G;  4CDF C;  2KHS A;  5CV6 A;  4JBW A;  3BZC A;  2ZTE A;  3A8I E;  1L2F A;  4B3R L;  1JWM D;  3AQQ A;  3IRB A;  3S2D B;  5C3E G;  3M7G A;  3FPU B;  1E2Z A;  4DV1 Q;  1XMQ Q;  2HDL A;  3S2D H;  4GKK Q;  2ZXP A;  1VF5 C;  3J81 c;  4JBK A;  2G5D A;  2F0W A;  4FXK C;  1BBU A;  2LS0 1;  4FXG C;  3OW2 A;  4IFD H;  3BDL A;  2RCN A;  4QIW E;  1QWY A;  5D14 A;  3OOC A;  4DPG A;  3KUP A;  4AYB E;  4HIK A;  3CC7 A;  2ALY B;  5E4W C;  1SNO A;  4FVM A;  1NMF A;  3I55 A;  1VQ9 A;  3BDC A;  3PO3 B;  4Q0F A;  2Q2U A;  1I5F A;  3Q0A A;  2K14 A;  2R7D A;  1DGS A;  1I50 H;  5LMN Q;  5C3X A;  3HOZ B;  3ER0 A;  4GZY C;  5K36 G;  5HY6 A;  1VF7 A;  4QB4 A;  3DM1 A;  2AKW B;  2EYJ A;  4C3H B;  1JWS D;  1CK1 A;  3CP0 A;  2NWG A;  2DN8 A;  4HN7 A;  2GVA A;  1Z9F A;  2K5D A;  2UU9 Q;  1TWC B;  3BVZ A;  1IBK Q;  4N8F A;  2XN9 C;  4RKL A;  2B2U A;  1B4O A;  2LXK A;  4PZ6 A;  1TWC H;  1SLJ A;  1B70 B;  4IUN A;  5JAV A;  3K5M A;  4N9T A;  3K81 C;  1X3F A;  1O7I A;  1WTV A;  1F77 A;  5JVH 3;  3URY A;  4UDU C;  2E75 C;  5IT9 L;  3R3O A;  1WTR A;  1YHQ A;  2BE5 D;  4LW1 A;  3MA2 B;  3M9B A;  2XWB B;  1SNP A;  4KJO A;  3A8J E;  2GVB A;  3A5Z B;  2E2H H;  1RKN A;  1VQL A;  4A93 G;  1K8O A;  3CME A;  3G4S A;  2OQK A;  1P8L A;  3SE0 A;  5C44 B;  1KDA A;  4G4K A;  4BBS G;  1VCI A;  1BUV T;  5BN4 A;  3EQL C;  3J80 i;  5C44 H;  2FJ2 A;  3J7Z C;  3QWN A;  3HKZ G;  1PA6 A;  4H7B A;  4RCN A;  1ESR A;  3RZO H;  3QOL A;  4ZQ3 A;  5AFW A;  1N8R C;  2RDG A;  2PQE A;  2FMC A;  3R8B A;  3M3Y H;  4C3J G;  4PNY A;  3UDG A;  5GRO A;  3GD7 A;  2NN6 G;  3N52 A;  2JA8 H;  5TSS A;  2RDF A;  4OIJ A;  3HS0 C;  1VQ4 A;  4A3M H;  3RUZ A;  3H91 A;  5BN5 A;  2OXP A;  1SE4 A;  2F0Q A;  3MFY A;  4YWK A;  4CHT B;  2OEO A;  1UE6 A;  3EN2 A;  4LF5 L;  1B44 D;  3F1Z A;  4LNQ A;  4DR2 L;  1IW7 C;  2F3I A;  1Y8O B;  1XMO Q;  5C5M A;  4QGU A;  1GUT A;  1SJH D;  2UUC L;  1F2L A;  3I4N B;  3VYR A;  2KQ3 A;  2NVY H;  2QA4 A;  2K50 A;  4HID A;  4DR5 L;  4A3D H;  1WD1 A;  3HOV B;  1PRT F;  3J81 i;  1I4Q A;  4BXX H;  1U0L A;  2VB3 X;  4HJ9 A;  2KCT A;  1PMR A;  2CH4 A;  3DEP A;  3A7L A;  1STN A;  3BVM A;  3UE0 A;  2QGQ A;  3RZD B;  3FDT A;  4YCV A;  2JEB I;  5KNC A;  1A3V A;  1HPC A;  1SBB B;  5T1G A;  3HOU H;  3TSS A;  1MSH A;  4Z9C B;  4A3K B;  4K0K Q;  1E1T A;  1VQN A;  4DV7 Q;  5IT9 c;  4ZYS A;  2OCE A;  5LMN W;  1VQ8 A;  3GTM H;  2RF4 A;  2FIN B;  4DXG A;  3D8G A;  5A2Q E;  5HUR A;  2UXC L;  1UEA B;  2EXD A;  3E0E A;  2EY1 A;  1V9P A;  1PRT B;  1PXU A;  3SGI A;  4IUT A;  4C3I H;  4HJ7 A;  4WFN 3;  1S4Z A;  1N36 Q;  4JVZ A;  1CA6 A;  1D8L A;  5KGU A;  1B53 A;  1CKN B;  3I8Z A;  3AU7 A;  2DUD A;  5BR8 Q;  3U9S A;  1VQI A;  3CHB D;  1HA6 A;  4DR7 L;  2KCN A;  3DWP A;  2CQA A;  2I5H A;  2EJF C;  2FXQ A;  1QNK A;  2WB1 E;  2LXJ A;  4K8I A;  4Y7N B;  1VQH A;  1G29 1;  4LK1 C;  4GN3 B;  3TBI B;  5JPN C;  1NCV A;  4LF5 Q;  3J80 E;  1B3A A;  4Y7N H;  4IFD G;  1EY9 A;  2PYK A;  2KCM A;  3NE5 B;  3W3A A;  1AN8 A;  2KVM A;  3RLO A;  3FRP B;  1I3Q B;  2UUC Q;  4FO2 A;  4H44 C;  2JYO A;  1X54 A;  1TWH H;  1CZW A;  1I3Q H;  1PFB A;  3SXH A;  1LLR D;  4C56 C;  3A74 A;  1TQO A;  1R4P B;  2HQE A;  2A73 B;  1H9J A;  4GLV B;  1SYB A;  4IJH A;  3PO3 G;  1O7Y A;  4U67 3;  4HIO A;  3GTQ H;  3S1R B;  1TT2 A;  1WYD A;  2BDN A;  4BS9 A;  4QIW B;  5C4J H;  1RF2 D;  3SVM A;  3Q6S A;  1NAP A;  4IO9 A;  3I73 A;  1KXL A;  1QVG A;  1F9Q A;  3S1N B;  4AYB B;  1N32 Q;  1B3Q A;  3HOZ G;  3KJO A;  2Z1C A;  5LMU L;  3S1N H;  5CV8 A;  2C35 B;  4HJ8 A;  4C3H G;  4R9W A;  4RKB A;  3GTG H;  1YJ9 A;  4KHZ A;  1JJ2 A;  5CV4 A;  3MTS A;  2F03 A;  2KEN A;  4LFC L;  4R4O A;  2ES2 A;  5CYU A;  4CDC C;  1YJN A;  3TME A;  4GOP C;  2VNU D;  1JT8 A;  2B2T C;  1JOQ A;  1WCM B;  2ATW A;  3TP7 A;  1X32 A;  1EQQ A;  1YBY A;  2IL8 A;  2VL6 A;  4Q5V A;  3L3O C;  1A3U A;  1HR0 L;  1GHJ A;  1X3G A;  2Q2H A;  2R7F A;  2UXC Q;  4J8Q A;  2CQO A;  3TZU A;  4X66 L;  4FP5 D;  3S1Q B;  1XXG A;  3RMH A;  1CFM A;  1KRS A;  3A5U A;  1SYC A;  2WKD A;  3M4O H;  4LWC A;  1K3B C;  2SNM A;  5COY A;  5IOC A;  4ZLT F;  1ENF A;  3T4A C;  1I94 L;  1B50 A;  2L1B A;  3DM3 A;  3T1Y Q;  5C44 G;  3SK6 A;  2B2V C;  3DWQ A;  1D5Z C;  3SEB A;  1Q1E A;  2I5L X;  5JEA H;  3ICE A;  5IGE A;  4LFA L;  3IAY A;  2AQ1 B;  1KRT A;  2JA7 B;  4TKO B;  3RR5 A;  4CDD C;  4B08 A;  1IBL Q;  1VS0 A;  1UNS A;  1B8A A;  1AZP A;  1XPU A;  5G3L F;  5J39 A;  2R93 B;  4DV0 L;  2WAC A;  5M5X B;  3H0G H;  3ULJ A;  2D62 A;  1R9T H;  5EAY A;  2PCF B;  1PH7 A;  1PH1 A;  2BA1 A;  5GAE C;  1T9H A;  1IYV A;  1JR0 D;  5IP7 G;  1BCP C;  3QG1 A;  1H95 A;  4BY1 B;  3QB3 A;  2OWO A;  3KYH C;  1HTL D;  4JI8 L;  1FNU A;  4C2M B;  1X55 A;  3A55 A;  3VR4 A;  2MUY A;  1XPO A;  4L5Q A;  4ODG A;  3I4M B;  3IKJ A;  5KYL A;  3VYS A;  2Z4H A;  1EOV A;  4DU9 A;  3H94 A;  3C1F A;  3I4M H;  1JMC A;  1CA5 A;  1VQO A;  2IW3 A;  5LMU Q;  1L1O B;  4KMU C;  1MJE A;  1KNA A;  1V1O A;  2B2Y A;  1CQV A;  1SXT A;  3MWY W;  1NE3 A;  1C9O A;  5E1F A;  5D65 A;  3I4N G;  4LFC Q;  1EYA A;  2F0H A;  4BXX G;  2I46 A;  1RJT A;  3DUZ A;  4RAU C;  3HOV G;  1Y1W H;  2F0G A;  1JOK A;  2E2J H;  3K58 A;  1CKN A;  1DZ1 A;  2Z6K A;  1FYC A;  4KN7 C;  3TRE A;  1KD1 C;  1WI5 A;  2IX1 A;  1NR4 A;  3CC2 A;  2GN5 A;  2L11 A;  3NEN A;  4C1N I;  2BOS A;  1VQ6 A;  1UUP A;  1SEB D;  2XSC A;  4LUO A;  1PH6 A;  1LTA D;  3WDN A;  3CF5 A;  3EA6 A;  1V8Q A;  4HSP A;  4KKT A;  4A3K G;  5JPM C;  2CKZ B;  1SNC A;  5E7N A;  1KAW A;  5C0X I;  1I94 Q;  2Z0S A;  4K5V A;  1N33 Q;  2K01 A;  3K5O A;  4H02 A;  2EY2 A;  3R2T A;  5IYD H;  4LFA Q;  3KBX A;  3PGZ A;  1IHZ A;  1TY0 A;  2UUB Q;  1IKM A;  4F88 A;  3J80 L;  2K75 A;  1HNZ L;  5HGQ A;  1I4G A;  3GTK B;  3G7L A;  4R8N A;  4DV0 Q;  2ICE C;  1STE A;  4MNO A;  2K52 A;  1U4P A;  3CRL C;  1ILP A;  5JJZ A;  3U50 C;  2F0D A;  2EYL A;  4JBJ A;  1EWC A;  1E7Z A;  1I4X A;  4O1N A;  3GTP B;  1OXU A;  1MIU A;  1K0S A;  1A8V A;  2F0T A;  5K5P A;  5KNB A;  2B63 B;  1EZ8 A;  4H0L C;  2RSN A;  4YWL A;  5JJL A;  4DAY B;  1CZG A;  4IQZ A;  2B63 H;  3ERO A;  4DGZ A;  1EQR A;  1PV4 A;  1Q7Y C;  5BN3 A;  2WB1 B;  4JI1 L;  1DM0 B;  2HHH L;  3UE1 A;  4AQY L;  3CKI B;  4RGM A;  1PYB A;  1PFS A;  2K28 A;  3NTK A;  3HOX H;  4OL7 A;  4EQ5 A;  1BCP F;  2IX0 A;  3GTO B;  3CQZ H;  3EJI A;  4HJ5 A;  1U4R A;  1I6H B;  4UY8 C;  1HH2 P;  1EFI D;  1X3P A;  5FLM H;  2A6E D;  4TQU S;  2E5L L;  3H3V H;  1EEI D;  4B9W A;  4BY7 B;  2DY8 A;  4AYB G;  2D0O A;  2L9H A;  4XT1 B;  4A3G B;  3FHW A;  1E3P A;  2D2C C;  4KKU A;  4FXD A;  2RQX A;  2H4O A;  4V0B A;  4DK1 A;  2L12 A;  1QB5 D;  3KOJ A;  1NSN S;  3KLS A;  5J1Z A;  3RLN A;  2NZH A;  2Z6B A;  3GTL B;  4RHR A;  4GLX A;  2JJQ A;  2K5N A;  1WCM G;  2UXD L;  3W2D A;  3MXN B;  3WOE A;  4NB3 A;  3RN2 A;  1IXR A;  4DAM A;  1K28 A;  2OQ0 A;  3NTI A;  3M7N A;  4R4Q A;  1ENA A;  1Y1V B;  1VQC A;  4HR7 B;  3LWU A;  3FKI B;  2WV6 D;  2N88 A;  3OTO L;  2B39 A;  1JB7 A;  5IOD A;  3U9O A;  3PIP 3;  3FKI H;  3AEV A;  1SND A;  3WWV A;  4EVO A;  4JV5 L;  3J80 c;  2YU9 H;  1QOH A;  1G2T A;  2IJ0 A;  4IFD J;  4G7O C;  2NVQ H;  1L1O A;  3M85 A;  1A2T A;  1FGU A;  1STB A;  2YYZ A;  2JA7 G;  2NVT H;  3NUC A;  3CCV A;  4DK6 C;  1RIP A;  2F4V Q;  1OXS C;  4JYA Q;  2R93 G;  3DXJ C;  2F0O A;  1PTO B;  3GV3 A;  2HHH Q;  1D1K A;  3A56 A;  4AQY Q;  2A68 D;  1YIJ A;  3VR6 A;  5KYI A;  3AFQ A;  4BY1 G;  5M3M B;  2OT2 A;  5DLQ E;  3FP9 A;  4F7X A;  1TWA H;  5I6W A;  3KLW A;  2PQA B;  1L0W A;  2SNS A;  4X62 Q;  3PUX A;  5ELO A;  3W1B A;  5EKI A;  2KHJ A;  3PF5 A;  1TU2 B;  2CCZ A;  5CR3 A;  4CJ1 B;  3C3L A;  4ZKC B;  3GDE A;  1EFW A;  5JJI A;  1IYJ B;  3X3N A;  5ELN A;  1WTO A;  4NP5 A;  4BBR B;  4K14 A;  4OHJ A;  3E5S A;  4QCL A;  2NVX B;  4KD3 A;  4OGQ C;  4K5W A;  4BBR H;  1E2V A;  4O2D A;  3HOW H;  2UXD Q;  2NVX H;  4DV4 Q;  1WTP A;  4P73 A;  5CBA E;  2ZM6 Q;  4RWS C;  3UDX A;  4QQB X;  3ZYY X;  1NMG A;  2JP1 A;  2XRS D;  3PUV A;  5CGK A;  2EIF A;  5C6A A;  3OSO A;  3EBE A;  2K4K A;  4IOC A;  4S3S A;  1KNE A;  2JSO A;  5JOB A;  2K03 A;  4V19 0;  2L55 A;  3Q22 A;  3BYT B;  2L4N A;  3K59 A;  3LWE A;  4DAY A;  1I50 B;  1EIG A;  2PNH A;  2EYP A;  3OIQ A;  3I2Z A;  3HP3 A;  3GQB A;  3DEO A;  5IYD G;  5COR A;  4JV5 Q;  1MI2 A;  2FHT A;  3F2U A;  4A3E B;  4B3T L;  1SYG A;  1S5E D;  1MBY A;  3F2C A;  4A3E H;  2MQH A;  4KD4 A;  5F2D A;  1YEZ A;  3GO5 A;  2JA5 G;  1ZYR C;  2G9H D;  2JN4 A;  5EQ0 A;  3NEM A;  1VQ5 A;  1S5D D;  1TR5 A;  5I2X A;  4GNX B;  2K5Q A;  4GLA C;  2JA9 A;  2J4X A;  1HUM A;  1ONL A;  1OTC A;  3E9I A;  2LFN A;  4IPG A;  2F1M A;  2ZTD A;  4OX9 L;  4DR3 L;  1PYS B;  3STB C;  1Y8P B;  4PG3 A;  1L0Y B;  4FYD A;  2B63 G;  4A3C G;  2E2H B;  4DUY L;  1LT4 D;  3O13 A;  1D1I A;  3CCU A;  4CKC A;  2WB1 G;  4DFA A;  3D4W A;  3JC6 6;  1YNX A;  3RLF A;  3SK8 A;  3D4D A;  3AMU A;  4J6H A;  3FVQ A;  4QL5 A;  4B3R Q;  2EYH A;  4EQO A;  1TS5 A;  1Q8K A;  2BCO A;  3MXN A;  3TEH B;  4ID6 A;  3OMG A;  2AQ2 B;  5C4X G;  4JI3 L;  4LF8 L;  3RZO B;  2IY5 B;  3SR1 A;  1HHV A;  5J22 A;  3PUW A;  2K33 A;  3R2I A;  3M3Y B;  1DON A;  3ERQ A;  3TP6 A;  2CVR A;  1SYD A;  4MHE A;  5EPJ A;  2JA8 B;  1Q82 C;  3S15 H;  3VA7 A;  4BY7 G;  4XDX A;  3KJP A;  2PW5 A;  4A3M B;  1SRO A;  4A3G G;  3CAM A;  1XTC D;  4YWM A;  4DV2 L;  4RMF A;  4ALP A;  3P75 A;  2A6E C;  1QG7 A;  3PQI A;  2N3S A;  2F0P A;  2DGY A;  2ZJR A;  2Q8R E;  3I70 A;  1SMY D;  2F0N A;  3NWT A;  4A3I H;  4RGO S;  5C0X G;  1HZA A;  3SK5 A;  4B3T Q;  2FMM A;  5IP9 H;  4DA2 A;  1H9S B;  3OHX C;  2UXB L;  4DUZ L;  1TS2 A;  2NVY B;  3CXC A;  4P2C B;  1Y1V G;  2F0S A;  4A3D B;  1BDO A;  3X3M A;  4PQX A;  4HAE A;  4A3L H;  1QE6 A;  2AHO B;  2IT1 A;  3FKI G;  1A63 A;  2PQA A;  1U4L A;  3K7U C;  4RG1 A;  4O0A A;  4OX9 Q;  1RHP A;  3P7J A;  4DR3 Q;  1DJR D;  1KDC A;  5ELC A;  1UE1 A;  1M4V A;  1WOC A;  3HZX A;  3HOU B;  5EJW A;  1PTO D;  5EKK A;  4OEM B;  4FF1 A;  4IPD A;  4PZ7 A;  5I4D A;  2JQO A;  1CQF A;  2SOB A;  5NUC A;  2RHQ B;  5A35 A;  3GTM B;  5ELD A;  5H1S E;  1G6P A;  3ND8 A;  2ZJP A;  1SN8 A;  1I4H A;  3HOY B;  1SE3 A;  2CH4 W;  4C3I B;  4JI7 L;  2F0V A;  4NXN L;  5M3M G;  2R92 H;  2BDO A;  3HOY H;  4JI3 Q;  4DR1 L;  4WJ3 M;  1IL8 A;  3BZK A;  1JJG A;  1SMX A;  1TII D;  1NR2 A;  5IYC H;  4JI5 L;  2WP8 J;  1DOL A;  3L7Z C;  3F2B A;  4FDB A;  3VR5 A;  4DV2 Q;  1C0A A;  1OXT A;  1X3E A;  1YJW A;  3T16 A;  3LGJ A;  4X64 L;  5FO8 B;  1G6Z A;  4HCE A;  4I7A A;  2K6A A;  4DR2 Q;  1FVI A;  1PZJ D;  4GNX A;  1BQQ T;  1T5E A;  2GA4 B;  4DF7 A;  4A3J B;  5M3F B;  1FJG L;  1I4R A;  4CJ0 B;  1GKH A;  1TWH B;  2RBM A;  4A3J H;  5M3F H;  4DUZ Q;  1JOO A;  4YHH L;  4OO1 H;  4R1J A;  2B2W C;  4E6I A;  3K57 A;  2Y0S E;  3TDQ A;  1QJO A;  1DOM A;  3PMF A;  5DNF A;  3GTQ B;  4DR5 Q;  5C4J B;  2P5Z X;  1ASY A;  5C4H A;  1D7Q A;  2KA7 A;  1FD7 D;  2A69 D;  1S5B D;  4OXP A;  3D3R A;  1EOT A;  4MTN A;  5JVG 3;  3HGB A;  3CCE A;  4WJ4 A;  3MXG A;  1GUW A;  1EIH A;  1S40 A;  1J9O A;  5FO7 B;  2R61 A;  4A3E G;  3BDO A;  3GTG B;  4IAL A;  1IBM L;  2MJ8 A;  1PDQ A;  3OW7 A;  2DNC A;  2RVL A;  3OPO A;  4UP9 A;  3AFP A;  2VUM H;  1PLF A;  1MJC A;  1SDF A;  2R3Z A;  1YNJ D;  2MHV A;  1KIX A;  2BH2 A;  4B3S L;  2XIW A;  2KEC A;  1STH A;  4LF6 L;  3U4Z A;  4ZRZ A;  4PZ8 A;  1YI2 A;  3J7Y W;  1BKB A;  1ESF A;  4KI0 A;  1HNW L;  1BF4 A;  2JA6 H;  3RD4 A;  4RGN A;  4KKS A;  2OF1 A;  4HSV A;  3NQT A;  3G6E A;  4A4I A;  4DV5 L;  4A3F H;  2PPB C;  3TS0 A;  1PFN A;  3K5L A;  5IY0 A;  2D5D A;  2B29 A;  3HKS A;  4JI7 Q;  3MXP A;  4NXN Q;  1EQT A;  1PZI D;  1RDP D;  1H9K A;  2QF7 A;  3KF6 B;  4YCU A;  4QUC A;  5CC4 A;  1PVO A;  2XNA C;  4KY5 A;  5IYB H;  2QDB A;  3M4Q A;  3M4O B;  4FF4 A;  3D31 A;  1QVF A;  3K0Y A;  1F9S A;  3C1E A;  4BWG B;  3K6O A;  4I7Z C;  4ME3 A;  3VR2 A;  1DCZ A;  1OO9 B;  1RL2 A;  3P20 A;  5J3B A;  1KQS A;  4DR7 Q;  4MZ9 A;  2BE5 C;  4IUU A;  4I65 A;  1AEX A;  2VQE L;  4K2K A;  2DNE A;  2F0M A;  2VB2 X;  3S16 H;  3L9A X;  3GTJ H;  1QZG A;  1TWF B;  2ZT9 C;  1H9S A;  1XNQ L;  1ML0 D;  1EY5 A;  3S17 B;  4OIK A;  2C9O A;  1TWF H;  2BA0 A;  2F0U A;  3H0G B;  4DNI A;  2B2U C;  1R9T B;  1WVL A;  3S17 H;  2XRQ D;  1GJX A;  2JA8 G;  2QCP X;  3KLS X;  4A3M G;  4YHH Q;  3OWE B;  1D5X C;  2X69 A;  1BOS A;  1NY4 A;  1XTD A;  2JEA I;  2HT1 A;  4F87 A;  4L8J A;  1EWI A;  2HIX A;  5DM6 3;  1HNX L;  4JI6 L;  4DNR B;  2EVB A;  3T51 B;  1S3O A;  4A3B H;  1B9N A;  2WAQ E;  2Q8I B;  1D2B A;  5EPK A;  2VS1 A;  2VZA A;  1IBM Q;  2E2I B;  3P1H A;  4KHP L;  1MKH A;  2AUK A;  3U4V A;  3K5N A;  1A15 A;  2RDH A;  2E2I H;  1VQ7 A;  3RN5 A;  4A3L G;  5IGB A;  5CV5 A;  2DJG C;  4A3D G;  1M8A A;  5IE8 A;  2XTI A;  1SMY C;  2V1C C;  3N6R A;  3F2D A;  1Y1W B;  5HGT A;  3H3V I;  2HUG A;  1AW7 A;  2AWO A;  2E2J B;  1EYD A;  2JE6 I;  4GS3 A;  5DEH A;  1VDZ A;  1HUN A;  1YIT A;  1VQD A;  4DV5 Q;  3ONA B;  2J0T D;  1F2M A;  5FJ8 H;  4CGY B;  4K6D A;  1HR0 Q;  1ZXT A;  4X65 L;  2EYO A;  5A2Q L;  2F0L A;  1QIL A;  2Z8L A;  1P16 A;  1W6J A;  3EIV A;  4H13 C;  4X66 Q;  1AZQ A;  4JI0 L;  3I3C A;  4UAI A;  3HOU G;  3B6Y A;  1ILQ A;  2AMC B;  4NMZ A;  4IJL A;  2N78 A;  2UUA L;  4QY7 A;  3UI2 A;  4CKE A;  1TWG B;  2XGT A;  5I2Y A;  4LF7 L;  4BA1 I;  1VQF A;  5ELF A;  2Q2T A;  1TWG H;  3JAM E;  1PRT D;  2VQE Q;  4FF2 A;  2K05 A;  1PTO C;  3HOY G;  4UHV A;  4G7H C;  4C3I G;  5AJ3 L;  2E2D C;  2XVS A;  3NTH A;  1XNQ Q;  1XNR L;  2A1A A;  3UDF A;  2M9V A;  3MAQ A;  1HA5 A;  4DN4 M;  4DNT B;  3PIO A;  1CI3 M;  4KJN A;  4LUZ A;  4JI4 L;  2EE1 A;  1PH5 A;  1UWV A;  2EYM A;  4DV3 L;  2EOT A;  3MZ5 A;  1LTB D;  5IWA L;  2A6H D;  5C0X J;  4NXM L;  2KEE A;  1BO0 A;  4JI8 Q;  4GOP B;  4JI6 Q;  2NTT A;  3CCR A;  3Q23 A;  1NNX A;  1XYI A;  1KDB A;  2F3W A;  1SFO H;  2CHB D;  4XXE A;  3FPP A;  5KEE A;  3S14 H;  5LL6 S;  4OWW B;  4ZK9 B;  2B8F A;  4KK7 A;  2WFW A;  4A3J G;  5M3F G;  1WTX A;  3PSI A;  3ND9 A;  3HOX B;  4KHP Q;  2EY6 A;  3BU2 A;  1GOZ A;  3CMA A;  3I91 A;  2AUJ D;  1SJE D;  3CQZ B;  4CBV A;  4DK3 C;  2RCF A;  1GXD C;  4DKA C;  3KF6 A;  2IPK D;  1LM0 A;  3D0F A;  1IZ6 A;  3NEL A;  4KV6 A;  2A5H A;  3E0J A;  3I4L A;  3E6Z X;  2Y0S B;  4KY6 A;  4CDE C;  1JIC A;  1AH9 A;  4A93 H;  3K8A A;  5C4Z A;  1J5E L;  1EUJ A;  1E2W A;  1I4P A;  2B8G A; 
#chains in the Genus database with same CATH homology
 2K32 A;  3A8K E;  2D9U A;  1STY A;  4JK1 C;  4IZ8 A;  3SDZ A;  1AP0 A;  2JXM B;  2EPB A;  4DAP A;  1BCP B;  2LY7 A;  4CKB A;  3NBI A;  3OWF A;  3TZD A;  2ENB A;  3H6M A;  1YNJ C;  1HQR D;  4TRD A;  1FNW A;  3I90 A;  4PMW A;  4X3S A;  3J7A V;  3DMU A;  1Y8N B;  2PZT A;  1K83 B;  2X6L A;  2N55 A;  1HTP A;  2YU9 B;  2CW0 D;  2NVQ B;  5JEA G;  1B2T A;  1JC7 A;  2NVT B;  1J8I A;  1T5X D;  3PO2 B;  4BA2 I;  2V4D A;  3WOF A;  4M1U B;  1JWU D;  5FK9 C;  1EY7 A;  2PZU A;  3OMC A;  1Q1B A;  2IWH A;  1LT6 D;  4EGV A;  5FLX E;  4C1N K;  4PV1 C;  3T53 B;  4LJZ C;  1EU3 A;  5C5L A;  2F0I A;  1TWA B;  2LKV A;  5IGC A;  1FR3 A;  1GUS A;  1H9R A;  2MGS A;  1XX8 A;  4HED A;  4CJ2 C;  3A54 A;  4ZUJ A;  1Z7T A;  1C4Q A;  4N9P A;  4O42 A;  5G3L D;  1O7L A;  4RHS A;  1EWH A;  3K7A B;  3C46 A;  2WAQ B;  1SNM A;  1EZ6 A;  5D3I B;  2K7V A;  3HOW B;  1Z47 A;  5CV7 A;  1O7Z A;  1O80 A;  1D6E C;  3QO2 A;  3JAM L;  1RTO A;  5D3D A;  4XQN A;  4DAV A;  3DWA A;  1ZKO A;  3V05 A;  1X3Q A;  5DAU A;  2EJG C;  2B2T A;  2NB0 A;  2I07 B;  4ZUI A;  1CM9 A;  2DY7 A;  4ME5 A;  4X3K A;  2B2Y C;  2F0E A;  2LMC B;  4ULL A;  2R7Z B;  3HEJ A;  1ROD A;  1SSO A;  1PRT C;  2F0F A;  2KED A;  2MP1 A;  2B2V A;  3QJY A;  3MVV A;  3KBG A;  3S9W A;  4DK0 A;  4K2L A;  2J7Z A;  3HRZ C;  2A6H C;  1V43 A;  1E0B A;  1F9P A;  5LHY 1;  1WTW A;  1STA A;  1I6V C;  3NP8 A;  1JB3 A;  1Q8I A;  3OIP A;  3S15 B;  4XIG S;  1ENC A;  1II3 A;  4IN3 A;  3VR3 A;  1BXT A;  2Q8T A;  4IUQ A;  4ILW A;  4XYQ A;  3FEW X;  3VYU A;  4K6L A;  4K8J A;  2F0K A;  4RH6 A;  3CU7 A;  1BCP D;  5M5W B;  2IX3 A;  1F2Z A;  4A3I B;  2AQ3 B;  1JOR A;  1VMC A;  5DM7 3;  2L5T A;  4OO1 I;  1DOK A;  1TY2 A;  1BR9 A;  4ZKB B;  1LV9 A;  4MIU A;  2HCI A;  4U68 A;  2O5I C;  1KLG D;  3EFX D;  3BYY B;  3S1M B;  1YNN D;  4KY7 A;  1JQY D;  1BNZ A;  3PV0 A;  3ITP A;  4FF3 A;  2QKI C;  5FLX L;  5EBD A;  1OXV A;  4XQJ A;  2PO4 A;  1HQM C;  1Q12 A;  5IIF A;  2HCC A;  1H9M A;  2QIL A;  3TP8 A;  1PYW D;  3G6J B;  3SHL A;  4HMJ A;  2CW0 C;  1EY8 A;  4B9X A;  2XWJ B;  1PFM A;  3T13 A;  1HFN A;  1RTN A;  1CT1 D;  5CV9 A;  1MGS A;  1AFP A;  3NPP A;  2NUC A;  3V2T A;  2R92 B;  1KAA A;  3NSW A;  2PMZ B;  1Q90 A;  5IGD A;  3SK4 A;  4PMC A;  3D4R A;  2A68 C;  5FO9 B;  1EQV A;  1SNQ A;  2AWN A;  1G91 A;  1Z6H A;  1LTI D;  5EPL A;  2K5W A;  1LTS D;  2NZ1 D;  2O4X A;  3QIA A;  2WIN B;  1KTK A;  2NBF A;  3NHH A;  3PUY A;  5IGF A;  4WOR A;  1EEF D;  4L6T B;  5E3F A;  3D6W A;  3R93 A;  2TSS A;  2E76 C;  3Q24 A;  1XWE A;  3C2P A;  1IYU A;  4QF4 A;  5JEA J;  2O5J C;  2KOL A;  1EY4 A;  2K04 A;  4ABN A;  4XYO A;  1C48 A;  2EY5 A;  3BS1 A;  4XT3 B;  5T1I A;  1EY6 A;  2HDM A;  1EU4 A;  3J7A F;  1K8M A;  1RD9 D;  3FMC A;  5FKA C;  2X6G A;  2NYZ D;  3KK7 A;  5ELB A;  3VA5 A;  3DHQ A;  1Y69 U;  2VUM B;  1D5M C;  3AB9 A;  4F8M A;  2NTS A;  4KN4 C;  5EBC A;  2JA6 B;  1HRJ A;  4KTA A;  4PMB A;  4A3F B;  4HTH A;  1A2U A;  3A7A B;  1R4Q B;  5IGG A;  2C5C A;  2EDG A;  4QMG A;  1MD2 D;  4K5X A;  2ZXO A;  1A6X A;  1A3T A;  4LMQ D;  4IUV A;  1DD2 A;  2SEB D;  2F3V A;  2WKC A;  4NKL A;  1B9M A;  1LO5 D;  3S16 B;  1BBX C;  3GTJ B;  3J81 E;  1ZEQ X;  5FOB B;  1V1P B;  1TS3 A;  3MEH A;  1SE2 A;  1SAP A;  5CMD A;  2O2L D;  3S2H B;  2EYF A;  5CBE E;  1WTQ A;  3TN2 A;  1ICW A;  3EVQ A;  1NUC A;  4NW2 A;  4G7Z C;  2RA4 A;  2K1B A;  4ZAI A;  3H3V C;  1CHP D;  3LX0 A;  1SYF A;  1U4M A;  4WRD A;  4A3B B;  4LAA A;  2PNR C;  5KND A;  2VXW A;  1RCV D;  2M00 A;  1DYQ A;  3MHB A;  3NBH A;  4KHV A;  2QEJ C;  5ELE A;  3LNN A;  1LTG D;  3NQI A;  1TKW B;  5EKL A;  1W6K A;  1GHK A;  2FFK B;  4WJW A;  3IL8 A;  3PIO 3;  3BZD B;  1YNN C;  3BG3 A;  3TP5 A;  5LL6 X;  4J1M A;  5C3E B;  1QNU A;  1LTT D;  3MC0 B;  4FNF A;  1KLU D;  1S5F D;  2NN6 I;  3KLR A;  1ET6 A;  4YIJ A;  1HCZ A;  1UAP A;  1ZYR D;  2H1E A;  4G57 A;  3VYT A;  3IFD A;  1CHQ D;  1TS4 A;  4QUF A;  2EZV A;  3HG9 A;  5M9O A;  1GUO A;  5K36 H;  2JA5 B;  1SFO B;  2ICI A;  3S14 B;  4RCO A;  4NDX A;  5KIX A;  4OO1 G;  2F4I A;  1PZK D;  4EQP A;  1DXM A;  2Z4I A;  3NXW A;  2L0C A;  2PZW A;  3MFG A;  4RFB A;  4XQQ A;  2SDF A;  5I9O A;  2ZXR A;  5I9P A;  3IFT A;  4DXF A;  1WD0 A;  4A93 B;  5C3W A;  2PW7 A;  3GV6 A;  1L0X B;  3GP7 A;  5I6Y A;  3NK9 A;  4RA8 A;  4BBS B;  3MXU A;  1GUG A;  3PUZ A;  5IT9 E;  2A74 C;  5C4X B;  1F9R A;  3NWS A;  2A69 C;  3HKZ B;  1V1P A;  1ET9 A;  2MPM A;  2RSO A;  2EJM A;  2EXZ A;  3V96 A;  1EYC A;  4M8A A;  4C3J B;  2KJX A;  4MN3 A;  3J81 L;  5E4X A;  3CRK C;  1CTM A;  1MSG A;  1IW7 D;  2NN6 H;  2RKS A;  1JE4 A;  1FNV A;  1LAB A;  1SYE A;  4TSS A;  4RGT A;  4L63 B;  1Q3L A;  2F0J A;  1S5C D;  1C8C A;  5KRU A;  2M2L A;  4IFD I;  4X3U A;  3I72 A;  1HFG A;  2ID0 A;  1EL0 A;  1LAC A;  5C0X H;  5M5Y B;  4EQN A;  1PTO F;  5ISR A;  2TMP A;  1G8Z D;  1HXY D;  2R6G A;  1GUN A;  2E74 C;  4IUR A;  1F2Y A;  4HMI A;  1JCK B;  3QOJ A;  4X3T A;  1VMP A;  4R8I A;  1O78 A;  1IKL A;  1U9R A;  5EGT A;  1EY0 A;  3H09 A;  3T56 B;  1B1Z A;  1G2S A;  1KAB A;  1LTR D;  2KUM A;  1LT3 D;  3M4Y A;  1OXX K;  3BVG A;  1PTO H;  1LT5 D;  3KF8 A;  2B2W A;  1QCB D;  1FGB D;  1TVX A;  1STG A;  2WII B;  2KCC A;  3D6C A;  4XTC S;  4HCS A;  4IUP A;  2G9D A;  2KHS A;  5CV6 A;  4JBW A;  3A8I E;  1JWM D;  3S2D B;  3M7G A;  3FPU B;  1E2Z A;  2HDL A;  2ZXP A;  1VF5 C;  2F0W A;  4FXK C;  2LS0 1;  4FXG C;  4IFD H;  3BDL A;  1QWY A;  5D14 A;  3OOC A;  3KUP A;  5E4W C;  1SNO A;  4FVM A;  3PO3 B;  3BDC A;  4Q0F A;  3Q0A A;  5C3X A;  3HOZ B;  4GZY C;  5K36 G;  1VF7 A;  4QB4 A;  3DM1 A;  2EYJ A;  4C3H B;  1JWS D;  1CK1 A;  2NWG A;  2DN8 A;  4HN7 A;  2K5D A;  1TWC B;  3BVZ A;  2XN9 C;  4RKL A;  2B2U A;  1B4O A;  4IUN A;  5JAV A;  3K5M A;  4N9T A;  1WTV A;  1F77 A;  5JVH 3;  3URY A;  4UDU C;  2E75 C;  5IT9 L;  3R3O A;  1WTR A;  2BE5 D;  3MA2 B;  2XWB B;  1SNP A;  4KJO A;  3A8J E;  1RKN A;  1K8O A;  3SE0 A;  5C44 B;  1KDA A;  4G4K A;  1VCI A;  1BUV T;  5BN4 A;  3EQL C;  2FJ2 A;  3QWN A;  4H7B A;  4RCN A;  1ESR A;  3QOL A;  4ZQ3 A;  5AFW A;  2RDG A;  2PQE A;  2FMC A;  3R8B A;  4C3J G;  4PNY A;  3GD7 A;  2NN6 G;  3N52 A;  5TSS A;  2RDF A;  4OIJ A;  3HS0 C;  3RUZ A;  3H91 A;  5BN5 A;  2OXP A;  1SE4 A;  2F0Q A;  3MFY A;  4CHT B;  2OEO A;  1B44 D;  1IW7 C;  1Y8O B;  5C5M A;  1GUT A;  1SJH D;  1F2L A;  3I4N B;  3VYR A;  2KQ3 A;  1WD1 A;  3HOV B;  1PRT F;  1I4Q A;  2VB3 X;  1PMR A;  3DEP A;  3A7L A;  1STN A;  3BVM A;  3RZD B;  3FDT A;  2JEB I;  5KNC A;  1A3V A;  1HPC A;  1SBB B;  5T1G A;  3TSS A;  4Z9C B;  1MSH A;  4A3K B;  4ZYS A;  2FIN B;  4DXG A;  3D8G A;  5A2Q E;  5HUR A;  1UEA B;  2EY1 A;  1PRT B;  1PXU A;  4IUT A;  4WFN 3;  1S4Z A;  1CA6 A;  5KGU A;  1B53 A;  3I8Z A;  3AU7 A;  3U9S A;  3CHB D;  1HA6 A;  2KCN A;  3DWP A;  2CQA A;  2EJF C;  1QNK A;  4K8I A;  4Y7N B;  1G29 1;  4LK1 C;  3TBI B;  5JPN C;  1NCV A;  3J80 E;  1B3A A;  4IFD G;  1EY9 A;  2PYK A;  3NE5 B;  3W3A A;  1AN8 A;  2KVM A;  3FRP B;  1I3Q B;  4FO2 A;  4H44 C;  2JYO A;  1CZW A;  1PFB A;  3SXH A;  1LLR D;  4C56 C;  1TQO A;  1R4P B;  2HQE A;  2A73 B;  1H9J A;  1SYB A;  1O7Y A;  4U67 3;  3S1R B;  1TT2 A;  2BDN A;  4BS9 A;  4QIW B;  1RF2 D;  3SVM A;  3Q6S A;  1NAP A;  3I73 A;  1F9Q A;  3S1N B;  4AYB B;  2Z1C A;  5CV8 A;  4C3H G;  4R9W A;  4RKB A;  4KHZ A;  5CV4 A;  3MTS A;  2F03 A;  5CYU A;  3TME A;  2VNU D;  2B2T C;  1JOQ A;  1WCM B;  3TP7 A;  1X32 A;  2IL8 A;  4Q5V A;  3L3O C;  1A3U A;  1GHJ A;  4J8Q A;  3TZU A;  4FP5 D;  3S1Q B;  1XXG A;  3RMH A;  1CFM A;  1SYC A;  2WKD A;  2SNM A;  5COY A;  5IOC A;  4ZLT F;  1ENF A;  3T4A C;  1B50 A;  2L1B A;  3SK6 A;  2B2V C;  3DWQ A;  1D5Z C;  3SEB A;  1Q1E A;  5JEA H;  5IGE A;  3IAY A;  2AQ1 B;  2JA7 B;  4TKO B;  4B08 A;  1UNS A;  1AZP A;  5G3L F;  5J39 A;  2R93 B;  2WAC A;  5M5X B;  2D62 A;  2PCF B;  2BA1 A;  1IYV A;  1JR0 D;  1BCP C;  3QG1 A;  4BY1 B;  3QB3 A;  1HTL D;  1FNU A;  4C2M B;  3A55 A;  3VR4 A;  2MUY A;  4ODG A;  3I4M B;  3IKJ A;  5KYL A;  3VYS A;  2Z4H A;  4DU9 A;  3H94 A;  3C1F A;  1CA5 A;  2IW3 A;  4KMU C;  1KNA A;  1V1O A;  2B2Y A;  1CQV A;  1SXT A;  3MWY W;  5E1F A;  5D65 A;  1EYA A;  2F0H A;  2I46 A;  1RJT A;  3DUZ A;  4RAU C;  2F0G A;  1JOK A;  3K58 A;  1DZ1 A;  1FYC A;  4KN7 C;  2IX1 A;  1NR4 A;  2L11 A;  4C1N I;  2BOS A;  1UUP A;  1SEB D;  2XSC A;  1LTA D;  3WDN A;  3EA6 A;  1V8Q A;  4HSP A;  4KKT A;  5JPM C;  1SNC A;  5C0X I;  4K5V A;  2K01 A;  3K5O A;  2EY2 A;  3R2T A;  3KBX A;  1IHZ A;  1TY0 A;  1IKM A;  4F88 A;  3J80 L;  1I4G A;  3GTK B;  3G7L A;  4R8N A;  2ICE C;  1STE A;  1U4P A;  3CRL C;  1ILP A;  5JJZ A;  2F0D A;  2EYL A;  1EWC A;  1I4X A;  4O1N A;  3GTP B;  1OXU A;  2F0T A;  5K5P A;  5KNB A;  2B63 B;  1EZ8 A;  4H0L C;  2RSN A;  1CZG A;  4IQZ A;  3ERO A;  4DGZ A;  5BN3 A;  2WB1 B;  1DM0 B;  3CKI B;  4RGM A;  2K28 A;  3NTK A;  4OL7 A;  1BCP F;  2IX0 A;  3GTO B;  3EJI A;  1U4R A;  1I6H B;  1EFI D;  1X3P A;  2A6E D;  4TQU S;  1EEI D;  4B9W A;  4BY7 B;  2DY8 A;  2L9H A;  4XT1 B;  4A3G B;  2D2C C;  4KKU A;  4FXD A;  2RQX A;  2H4O A;  4V0B A;  4DK1 A;  2L12 A;  1QB5 D;  1NSN S;  3KLS A;  5J1Z A;  3GTL B;  4RHR A;  3W2D A;  3WOE A;  3NTI A;  3M7N A;  1ENA A;  1Y1V B;  4HR7 B;  3LWU A;  3FKI B;  2WV6 D;  2N88 A;  2B39 A;  5IOD A;  3U9O A;  3PIP 3;  1SND A;  4EVO A;  1QOH A;  1G2T A;  2IJ0 A;  4IFD J;  4G7O C;  3M85 A;  1A2T A;  1STB A;  2YYZ A;  3NUC A;  1OXS C;  3DXJ C;  2F0O A;  1PTO B;  3GV3 A;  1D1K A;  3A56 A;  2A68 D;  3VR6 A;  5KYI A;  5M3M B;  2OT2 A;  4F7X A;  5I6W A;  2SNS A;  3PUX A;  5EKI A;  1TU2 B;  5CR3 A;  4CJ1 B;  3C3L A;  4ZKC B;  3X3N A;  1WTO A;  4NP5 A;  4BBR B;  4K14 A;  4OHJ A;  3E5S A;  4QCL A;  2NVX B;  4KD3 A;  4OGQ C;  4K5W A;  1E2V A;  1WTP A;  5CBA E;  4RWS C;  3ZYY X;  2JP1 A;  2XRS D;  3PUV A;  5CGK A;  5C6A A;  3OSO A;  4S3S A;  1KNE A;  2JSO A;  5JOB A;  2K03 A;  4V19 0;  2L55 A;  3Q22 A;  3BYT B;  2L4N A;  3K59 A;  3LWE A;  4DAY A;  1I50 B;  1EIG A;  2EYP A;  3OIQ A;  3HP3 A;  3GQB A;  3DEO A;  5COR A;  1MI2 A;  2FHT A;  3F2U A;  4A3E B;  1SYG A;  1S5E D;  1MBY A;  4KD4 A;  5F2D A;  3GO5 A;  1ZYR C;  2G9H D;  5EQ0 A;  1S5D D;  1TR5 A;  5I2X A;  2K5Q A;  2J4X A;  1HUM A;  1ONL A;  2LFN A;  2F1M A;  1Y8P B;  1L0Y B;  4FYD A;  2E2H B;  1LT4 D;  3O13 A;  1D1I A;  4CKC A;  4DFA A;  3D4W A;  3RLF A;  3SK8 A;  3D4D A;  3AMU A;  4J6H A;  3FVQ A;  2EYH A;  4EQO A;  1TS5 A;  2BCO A;  3MXN A;  4ID6 A;  3OMG A;  2AQ2 B;  3RZO B;  3SR1 A;  1HHV A;  5J22 A;  3PUW A;  2K33 A;  3R2I A;  3M3Y B;  1DON A;  3ERQ A;  3TP6 A;  2CVR A;  1SYD A;  4MHE A;  5EPJ A;  2JA8 B;  3VA7 A;  4XDX A;  2PW5 A;  4A3M B;  1XTC D;  3P75 A;  2A6E C;  1QG7 A;  2F0P A;  2Q8R E;  3I70 A;  1SMY D;  2F0N A;  3NWT A;  4RGO S;  5C0X G;  3SK5 A;  2FMM A;  4DA2 A;  1H9S B;  3OHX C;  1TS2 A;  2NVY B;  4P2C B;  2F0S A;  4A3D B;  1BDO A;  3X3M A;  4PQX A;  4HAE A;  1QE6 A;  2IT1 A;  1U4L A;  1RHP A;  3P7J A;  1DJR D;  1KDC A;  5ELC A;  1M4V A;  3HZX A;  3HOU B;  5EJW A;  1PTO D;  5EKK A;  4FF1 A;  5I4D A;  1CQF A;  2SOB A;  5NUC A;  5A35 A;  3GTM B;  5ELD A;  3ND8 A;  1I4H A;  3HOY B;  1SE3 A;  4C3I B;  2F0V A;  2BDO A;  1IL8 A;  1TII D;  1NR2 A;  2WP8 J;  1DOL A;  3L7Z C;  3VR5 A;  1OXT A;  3T16 A;  5FO8 B;  1G6Z A;  4HCE A;  2K6A A;  1PZJ D;  1BQQ T;  1T5E A;  2GA4 B;  4DF7 A;  4A3J B;  5M3F B;  1I4R A;  4CJ0 B;  1TWH B;  2RBM A;  1JOO A;  4OO1 H;  2B2W C;  4E6I A;  3K57 A;  3TDQ A;  1QJO A;  1DOM A;  3PMF A;  5DNF A;  3GTQ B;  5C4J B;  5C4H A;  2KA7 A;  1FD7 D;  2A69 D;  1S5B D;  3D3R A;  1EOT A;  5JVG 3;  3HGB A;  3MXG A;  1GUW A;  1EIH A;  1J9O A;  5FO7 B;  2R61 A;  3BDO A;  3GTG B;  4IAL A;  2MJ8 A;  1PDQ A;  3OW7 A;  2DNC A;  2RVL A;  3OPO A;  1PLF A;  2R3Z A;  1SDF A;  1YNJ D;  2MHV A;  2XIW A;  2KEC A;  1STH A;  4ZRZ A;  3J7Y W;  4KI0 A;  1ESF A;  1BF4 A;  3RD4 A;  4RGN A;  4KKS A;  2OF1 A;  4HSV A;  3NQT A;  2PPB C;  1PFN A;  3K5L A;  2D5D A;  3MXP A;  1EQT A;  1PZI D;  1RDP D;  1H9K A;  2QF7 A;  4QUC A;  5CC4 A;  2XNA C;  4KY5 A;  2QDB A;  3M4O B;  4FF4 A;  3D31 A;  3K0Y A;  1F9S A;  3C1E A;  4BWG B;  3K6O A;  4I7Z C;  3VR2 A;  1DCZ A;  1OO9 B;  3P20 A;  2BE5 C;  4IUU A;  4I65 A;  1AEX A;  4K2K A;  2DNE A;  2F0M A;  2VB2 X;  3L9A X;  1TWF B;  1H9S A;  2ZT9 C;  1ML0 D;  1EY5 A;  3S17 B;  4OIK A;  2C9O A;  2BA0 A;  2F0U A;  3H0G B;  1R9T B;  2B2U C;  1WVL A;  2XRQ D;  1GJX A;  2QCP X;  3KLS X;  3OWE B;  1D5X C;  2X69 A;  1BOS A;  2JEA I;  4F87 A;  4L8J A;  5DM6 3;  4DNR B;  2EVB A;  3T51 B;  1B9N A;  2Q8I B;  1D2B A;  5EPK A;  2E2I B;  3P1H A;  2AUK A;  3K5N A;  1A15 A;  2RDH A;  5IGB A;  5CV5 A;  1M8A A;  1SMY C;  3N6R A;  1Y1W B;  5HGT A;  2HUG A;  1AW7 A;  2AWO A;  2E2J B;  1EYD A;  2JE6 I;  5DEH A;  1VDZ A;  1HUN A;  3ONA B;  2J0T D;  1F2M A;  4CGY B;  4K6D A;  1ZXT A;  2EYO A;  5A2Q L;  2F0L A;  1QIL A;  2Z8L A;  1W6J A;  4H13 C;  1AZQ A;  3I3C A;  4UAI A;  1ILQ A;  4NMZ A;  3UI2 A;  4CKE A;  1TWG B;  5I2Y A;  4BA1 I;  5ELF A;  3JAM E;  1PRT D;  4FF2 A;  2K05 A;  1PTO C;  4G7H C;  4C3I G;  2E2D C;  2XVS A;  3NTH A;  2M9V A;  3MAQ A;  1HA5 A;  4DN4 M;  4DNT B;  1CI3 M;  4KJN A;  2EE1 A;  2EYM A;  2EOT A;  3MZ5 A;  1LTB D;  2A6H D;  5C0X J;  2KEE A;  1BO0 A;  2NTT A;  3Q23 A;  1XYI A;  1KDB A;  2F3W A;  2CHB D;  4XXE A;  3FPP A;  5KEE A;  5LL6 S;  4ZK9 B;  2B8F A;  4KK7 A;  1WTX A;  3ND9 A;  3HOX B;  2EY6 A;  1GOZ A;  3I91 A;  2AUJ D;  1SJE D;  4CBV A;  3CQZ B;  1GXD C;  2IPK D;  4KV6 A;  2A5H A;  3E0J A;  3I4L A;  3E6Z X;  2Y0S B;  4KY6 A;  1JIC A;  5C4Z A;  1E2W A;  1I4P A;  2B8G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...