1B3AA

Total chemical synthesis and high-resolution crystal structure of the potent anti-hiv protein aop-rantes
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
67
structure length
67
Chain Sequence
PYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Total chemical synthesis and high-resolution crystal structure of the potent anti-HIV protein AOP-RANTES.
pubmed doi rcsb
molecule tags Anti-hiv protein
molecule keywords PROTEIN (RANTES)
total genus 14
structure length 67
sequence length 67
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1b3aA00
4IUVA 2K04A 1F9SA 4XT1B 1A15A 1EL0A 1HUNA 1SAPA 2JP1A 1RJTA 1RTNA 1U4RA 2EOTA 2FFKB 4IUUA 3UI2A 1WD0A 4NW2A 5D14A 3KUPA 4ZAIA 4ZK9B 3N52A 1F9QA 5E4XA 1J9OA 1CM9A 1DOMA 1J8IA 1VMPA 2K05A 2N55A 4QUFA 1HFNA 1XYIA 1X32A 1O80A 5D65A 4XT3B 1WVLA 1WTVA 1SSOA 2Q8RE 5EKIA 1U4PA 1VMCA 1B50A 1JICA 3F2UA 1AZQA 3Q6SA 4MN3A 4UAIA 1O7ZA 1ESRA 4IURA 4RA8A 3TZDA 5EPJA 1PLFA 1KNEA 1BO0A 1MI2A 2RSNA 3FPUB 3MWYW 5EQ0A 1ICWA 2FHTA 5EJWA 2B2VC 1WTWA 1WTRA 1BNZA 1X3PA 1TVXA 3HP3A 3D6WA 1U4MA 2CVRA 2VXWA 4ZLTF 3IFDA 1C8CA 4X3SA 1G2TA 2EPBA 4ZKCB 1ILQA 2KEDA 1NR2A 4LMQD 2JYOA 5T1GA 2B2YA 4MHEA 5DNFA 3H91A 4RAUC 2HDMA 2M2LA 3I90A 2KOLA 2L9HA 2KECA 1IKLA 2H1EA 1IKMA 2B2UA 1HFGA 2HUGA 3QO2A 4HEDA 1DONA 1RHPA 1B53A 4X3UA 4RWSC 1B2TA 1GUWA 4DN4M 1Q3LA 3G7LA 4HAEA 4OIJA 4X3KA 4R8IA 2RA4A 4HSVA 5COYA 4R9WA 1AZPA 1PDQA 1X3QA 2FJ2A 5E4WC 2MPMA 2MGSA 4CJ1B 2DY7A 2RSOA 2EE1A 1SDFA 1KNAA 2FINB 1NR4A 2BDNA 2IL8A 3DEOA 1G6ZA 3GV3A 3R93A 4IUPA 1QNKA 2B2TC 4O42A 5CORA 1BF4A 5JJZA 2R3ZA 1MSGA 1ILPA 3I8ZA 1PFNA 1HRJA 2KEEA 2NZ1D 5T1IA 1F9PA 1DOLA 2B2TA 1EIHA 2K1BA 2XIWA 1JE4A 3IL8A 1EIGA 1WTPA 2B2WC 2J7ZA 1WTOA 1DOKA 3SVMA 4OIKA 2Q8TA 4X3TA 1MGSA 5EPKA 1QG7A 1CA6A 2RVLA 1U4LA 4QUCA 5CMDA 1LV9A 1RTOA 1NCVA 2B2WA 2K03A 3DM1A 3ONAB 2KVMA 2L1BA 3I3CA 2N88A 4XDXA 1HHVA 3GV6A 2SDFA 4IUQA 2NYZD 1G2SA 2X69A 1ZXTA 1XX8A 3LWEA 3MTSA 4ZKBB 1NAPA 5CBEE 1BBXC 4HCSA 5AFWA 1PFMA 2DY8A 1M8AA 1RODA 5EPLA 1G91A 3FDTA 1HUMA 2B2YC 2K01A 2MJ8A 1WD1A 3I91A 1DZ1A 1F9RA 1EQTA 2D9UA 2B2VA 4CJ0B 2L12A 1IL8A 2HDLA 1MSHA 1QE6A 2FMMA 2L11A 1CA5A 2L4NA 2HCIA 1S4ZA 4U68A 1WTXA 2B2UC 2X6LA 5CBAE 1HA6A 1PFBA 3TN2A 1B3AA 1ML0D 1F2LA 4IUTA 3KBXA 1AP0A 3DEPA 2K28A 4CJ2C 2X6GA 2NWGA 1E0BA 2MP1A 1WTQA 2HCCA 2KUMA 1EOTA 3P7JA 1O7YA 1B4OA
chains in the Genus database with same CATH superfamily
5M3FB 1F9SA 1OO9B 3VYRA 4OX9Q 4L5TA 5H1SE 3UI2A 4QIWB 1R9TB 2F0WA 4E6IA 4A3JH 1NMGA 2RHSB 5C3WA 2MNAA 3VDYA 5FKAC 3MEHA 1X3GA 1L2FA 2R92B 4A3DH 1FJGL 2CQAA 2JA7G 1DM0B 1I6HH 3GTMH 4KTAA 5FLMG 1WTRA 5EGTA 4KN7C 5LL6S 1PA6A 4FF3A 4LF4Q 3GTOB 3HOXH 5ELEA 2O4XA 5A2QL 5EBDA 1ILQA 3ERQA 1V43A 3KJPA 1I4QA 3I56A 2EXZA 1I50B 4YY3Q 4OIJA 4KJOA 3QOLA 5C4HA 1K9MC 3BZCA 2BDNA 5I2YA 4LF7Q 5M5XB 3GV3A 3D6CA 1E22A 3DWAA 1YEZA 2G9HD 3I8ZA 1EY8A 1MD2D 3R3OA 2F0UA 4JI4Q 1EFID 3G4SA 4QJFA 1PH6A 1V9PA 3K7AB 1JJCB 4A93G 5C4XH 2UUCQ 1EYDA 2WFWA 3I3CA 3X3MA 4KV6A 4K5WA 3AB9A 3R8BA 2EYMA 4GKKQ 4A3FB 3GTKB 1PYBA 3D4RA 2LFNA 1CUKA 3H0GG 1SYGA 3FVQA 2JA9A 2CH4A 4A3DG 2EYPA 4I7AA 2L11A 4BS9A 1FJGQ 2BH2A 4RMFA 5IYCG 2B2UC 3U50C 4O2DA 5JEAG 4DV5Q 1W6KA 4JK1C 1PH5A 4KHPL 1JC7A 3CRKC 4JOIC 1EU3A 1GM5A 4UP8A 2QILA 1HNZL 4KLKA 4XQJA 1H9SA 4JBWA 1TY2A 1SAPA 3SGIA 4C3IG 4QB4A 2GVAA 3HOWG 3F2CA 2F0TA 3RUZA 3SR1A 1CZWA 1PHJA 1JWSD 3OMGA 1DOMA 5I9PA 4QUFA 2D0PA 4DV4Q 4XIGS 4XT3B 2IX1A 1WTVA 4NKLA 2EY5A 4LF7L 3T1YQ 3GDEA 1SNOA 1O7ZA 4QIWE 3MXNB 2G5DA 2GA4B 1R4PB 3MXUA 4LF8Q 4K8JA 1LM0A 1T9HA 4O1NA 5EKKA 1I3QB 3HKSA 1JMCA 4BXXG 3S1NB 1I6HB 5C3XA 2JYOA 4CBVA 2B2YA 3D8GA 3K7UC 2KECA 1IKLA 1R9TH 1DGSA 1GO3E 4A3JB 1B2TA 3CKIB 3J7YW 4R8IA 2RA4A 2JA5B 5JPMC 4IPDA 5IGFA 3GP7A 2IT1A 5CC4A 1II3A 3J7AV 1XMQQ 2Z0SA 4PQXA 3L2PA 3S14H 3M7GA 2OTJA 3STBC 3E6ZX 3VYUA 4WJ3M 4Q5VA 4KN4C 3UE0A 5IGCA 1IW7C 1YHBA 2D0OA 2OCEA 4PZ6A 4OIKA 4EGVA 4LAAA 3TSSA 5CR3A 1H9KA 4Y7NH 1STGA 4CDFC 1ENAA 3URYA 5CV9A 1Q82C 2NVYH 1B7YB 1HR0Q 4NP5A 3I55A 3NP8A 3NELA 4LUZA 1WYDA 4J1MA 3M3YB 5C5MA 4K2KA 1B8AA 3T1HQ 3M4OH 4X62Q 2CQOA 4LFCL 2R7ZB 2EY1A 1EWHA 2VY3A 2F0EA 1EQRA 1F77A 5IP7H 4DV7L 1JB7A 2L4NA 5M9OA 4IPCA 4M1UB 4FXKC 2XRSD 3P20A 3VR3A 1PFSA 2EYLA 1QVGA 1OXTA 3KBXA 1SR3A 4CJ2C 3S16B 2NWGA 1CQFA 1N36L 1E0BA 1JOOA 1WTQA 1CFMA 2YYZA 3M4QA 4IUNA 1Y8NB 3D3RA 3ITPA 1C48A 1QZHA 3U4VA 1Q8KA 1GVPA 3G71A 3SK5A 2IY5B 3T56B 2K7VA 5M5WH 4A3DB 2JA7H 2F1MA 2WP8J 4IJHA 3Q23A 4HTHA 3M4OB 5JEAH 3NWTA 2RCFA 1X56A 5JJLA 2F0DA 3HOWB 1DYQA 1O80A 1LT4D 5IP7G 1DXMA 1SNDA 5C3EG 1AZQA 3Q6SA 4ZYSA 5DAUA 1BXTA 2RCNA 1FNWA 2LSSA 1UE1A 1MI2A 2YV5A 2ICEC 1KRSA 1JWMD 4JBMA 2B2VC 2ATWA 1BCPF 4H44C 4LK1C 4NXNL 2EPBA 2O2LD 5HY6A 2WAQB 3SK6A 4LMQD 3GTPB 2B8FA 2HDMA 1EOVA 2M2LA 3S1RB 5IWAL 2EZVA 2FMCA 1B9NA 5C0XJ 1VQJA 5FLXc 4DR2L 1N34L 2AUJD 2VW9A 4DR7L 4CGYB 1KDAA 4R9WA 5C4XG 2JA6H 1L1OB 4A3FH 2DY7A 1KNAA 3W1BA 5KYIA 3DUZA 4QGUA 2IWHA 4C56C 1Y1WH 4LFCQ 5CV8A 4BWGB 1KQSA 1PH8A 2NVQH 1AH9A 3MXNA 2RKSA 1BVSA 3K5NA 1JQYD 2NVTB 5C4ZA 2N78A 1TU2B 2O5JC 1CHPD 4KHVA 4CDEC 1K83H 5FOBB 1JE4A 2K4KA 4JG2A 1JOQA 2Z4HA 1K8GA 3PV0A 1LYLA 1SNPA 1RCVD 2EJMA 2QDBA 3MEFA 2WB1G 2EDGA 5JVG3 4QY7A 2F0MA 4ZRZA 3WWVA 4CDCC 5CBEE 1IYJB 1E1OA 3HOYB 1RODA 3D4DA 4HSPA 3K59A 5DEHA 1CI3M 1HNXQ 2R93H 1LTBD 5I6YA 2KA7A 2E74C 3HRZC 1EUJA 3M3YH 4LFAQ 2K5VA 2NVXB 1PFBA 1HA6A 4B3RL 4DUYL 3TS0A 2ES2A 1K73C 4K6LA 4X66Q 3CMEA 1L1OA 3LX0A 3GTJB 1H9SB 4Y7NB 1N32Q 4NXNQ 5KYLA 2CFMA 2P5ZX 4N9PA 4YIJA 4X64L 2LY7A 3OYYA 2HIXA 3FMCA 1PH2A 1LTID 3RLNA 2FFKB 1WD0A 4NW2A 4DR2Q 1N34Q 4ZAIA 1KLGD 1NTGA 4IPHA 4U673 4HJAA 3CP0A 4C2MB 2N55A 4JI3Q 3ZJYC 3L3OC 1STNA 3KF8B 1FVIA 1SMXA 3K8AA 2A6HD 4DXGA 4K5XA 2JSOA 4BY7G 2IW3A 3C46A 2JA8G 4IURA 1XNRQ 3PIOA 3MWYW 3E9HA 3HOUH 1TS4A 2F0QA 4HIDA 3AEVA 3K0YA 2MUYA 1X65A 2IHFA 1RDPD 4RCOA 3S15H 2KEDA 1VQOA 3UDIA 5TSSA 1D5MC 2ZT9C 4GLXA 1JB3A 5J1ZA 2L0CA 1ENCA 1FNUA 2BE5C 2NB0A 4KJNA 3V96A 1RHPA 3NQTA 3F1ZA 5JEAJ 3SK4A 2K50A 2WAQE 3K5OA 4NMZA 2QDLA 1A3UA 4DR4Q 1C7YA 3J81j 2EY6A 4LUVA 3K58A 2UXDQ 2R3ZA 3I4LA 2E76C 4B08A 4C3JG 5I2XA 3FKIH 1V8QA 4JI2L 2CH4W 1BKBA 2F3IA 1WCMG 2NZ1D 1DOLA 5KIXA 2ID0A 1YBYA 4B3ML 3HOZG 4DV1L 5GADC 1E2ZA 4A3GG 1DOKA 5JJIA 3EVQA 1S3OA 3MZ5A 4AYBE 1S72A 5F2DA 3RN2A 1TWCB 1BBUA 4TQUS 2V1CC 4X64Q 4GLAC 1I4HA 4ZCKA 1D8LA 4A3GB 2E2JB 3OWEB 4PMWA 4DFAA 1MIUA 2DY8A 5EPLA 1Y1WG 1G91A 4PV1C 5FK9C 3JC66 2K01A 2JA7B 3HKZG 2YTYA 5BN3A 2F0JA 1F9RA 3CCLA 2B2VA 2JA5G 3M7NA 1CSPA 1PRTB 3A8IE 2I5HA 1PTOC 1EY4A 1S4ZA 2EY2A 2SNMA 2E8GA 3TZUA 4UHVA 1BCPC 2F0NA 1Q90A 3W3AA 4G57A 4AYBB 1EEFD 1HZ9A 3PO3H 2LKVA 4ME5A 1YJWA 4K6DA 4XT1B 1I94L 3S2DB 4YCVA 2KHSA 3ND8A 5IP9H 2G9DA 1JCKB 4EX5A 4JI6L 2OXPA 2RQXA 2F0LA 1FNVA 2PYKA 1EEID 1SMYC 3PO2B 4DR4L 2GVBA 5IGEA 1SSOA 1SFOB 1X55A 2ZTDA 4DUZQ 1DD2A 3HOVH 4RA8A 2NVQB 2AQ2B 4AH6A 1BNZA 2KHIA 2Z1CA 2NVTH 2F0PA 3KYHC 1XNQL 4GOPA 1S5CD 4X3SA 5FO9B 4KY5A 3X3NA 3OIPA 4OO1I 3IKJA 3I90A 4K5VA 4RGMA 4CKCA 3HOXB 4IFDI 4A3KG 2AHOB 4HEDA 3OSOA 3NHHA 5JJKA 4FF2A 5IGDA 3CU7A 1EYCA 1O7IA 5KNCA 1PVOA 1QJOA 2Z6KC 1MHWC 4EQ5A 2DJGC 2RDGA 4DV6L 1PTOH 1QCBD 2R7ZH 1Y69U 1HRJA 2WINB 4BBSB 4DNRB 1IBLL 2PZUA 4ABNA 4HIKA 1KTKA 2EQSA 1EIHA 1P8LA 5BN4A 4A93H 2ZJQA 1SYFA 1TY0A 2F03A 2Y0SE 1O7LA 1CA6A 3RZDB 1I50H 4G7ZC 1S5DD 3NQIA 1EWCA 1E1TA 3VR4A 2A69D 2NYZD 2X69A 3K7AH 1QUQB 4HCSA 4A75A 3FHWA 2NBFA 2MQHA 3QWNA 1SYDA 5ELOA 1G8ZD 4MIUA 1WD1A 4JI6Q 1XPUA 2LS01 1OXSC 4LF5L 3GTGB 1PH4A 2AQ1B 1QE6A 3OHXC 5IYDG 4A93B 4K0KL 2ZTEA 2VUMH 2N49A 1KRTA 1B3AA 4YWMA 3IRBA 2PQAA 1AP0A 3UE1A 1QB5D 4AQYL 2X6GA 5M5WB 2F52A 1OTCA 1EY0A 4KKUA 1B4OA 3ULJA 1AEXA 4DV4L 4X65L 2MO1A 2Q2IA 4ZUIA 1X6OA 3J7AF 1VQ4A 2Z8LA 1ZYRD 2BE5D 1SJHD 4IJLA 1XYIA 5C0XH 1LT6D 1B50A 1B3QA 4APVA 5EPJA 3S17B 4LF6L 4L6TB 3EIVA 5JVH3 1IYUA 2IPKD 1IZ6A 4A3MB 3OTOL 2F4VQ 4FDBA 2MFIA 3KDFB 2A6HC 3PSIA 3NSWA 2CHBD 2DUDA 3H91A 2UXCL 1HJPA 1U0LA 3GTQB 1SNMA 1Z6HA 4LWCA 3RLOA 5M5XH 2R92G 4DV3Q 4DN4M 2I5MX 4N8X1 4JV5L 1XMQL 1GD7A 2RSOA 1E3PA 2FINB 3V2TA 2M9VA 3F8TA 3P1HA 3PMFA 1ILPA 1PYWD 1QILA 5IGBA 4DV0Q 3ZYYX 5LMNQ 1VQNA 4XYOA 4L63B 1Q7YC 1QVCA 1V1PA 1SE8A 5FLXL 1EWIA 3E3XA 4JW0A 2KENA 2NTSA 1PMRA 1T5XD 3MFYA 1U4LA 2R6GA 2VQEQ 2KCMA 3ONAB 3G6EA 4I65A 3TBIB 4FXGC 5IIFA 4HMJA 1CK1A 1CA5A 1XX8A 1Q1BA 5ELCA 3ULPA 3Q24A 1N33L 4DV7Q 4QQBX 3ERSX 2RDFA 5K36H 2D9UA 2C9OA 2F3VA 4YCUA 3OW2A 2O5IC 1AFPA 1EY6A 1IXRA 1AE3A 1NNXA 4F7XA 3PUWA 4FYDA 5HGQA 1A2TA 2KUMA 5ELNA 2CW0D 2K5NA 4GKKL 3ER0A 4ULLA 1V1PB 4C3IH 3KF6B 4G7HC 4DXFA 4ALPA 2F3WA 4KD4A 1F9QA 5FLMH 2EIFA 1Y1VB 2RDHA 5D65A 3CPFA 1D5ZC 4DR3L 1HNWL 4G7OC 3JAMc 4MN3A 4WJ4A 5NUCA 2VUMB 2NN6G 2QKIC 5IYBG 1W6JA 4DNTB 4F8MA 5LMNL 3S16H 2F0FA 2FHTA 5D3IB 1NJIC 1TR5A 5M3FG 5G3LF 2XSCA 3NPPA 1K28A 4DR7Q 3K81C 1AW7A 4GOPB 3E9IA 2H1EA 2KQ3A 1KDBA 3HS0C 1E7ZA 4EQNA 1Z7TA 1EZ6A 3VA7A 3TP7A 3FKIB 2B29A 4IFDJ 1STBA 2MGSA 4KY7A 1VF7A 3R2TA 4R1JA 4YY3L 1PRTC 4DR5Q 1MSGA 1YHAA 1PFNA 1LTRD 2EVBA 2DGYA 2QW7A 4BBRH 1VQMA 1I5FA 3TQYA 1A6XA 1BOSA 1HQMC 3I4MB 1Y1VG 3KFUA 1PZID 1K0SA 2J7ZA 1LTGD 3KLSX 1T5EA 3EFXD 2RHQB 5C6AA 1XTCD 1PRTF 1Q81C 2UUBL 2HQLA 1EYGA 1RIPA 1GUTA 1U9RA 1SROA 4PZ7A 2V4DA 3CRLC 4A3MG 3STBD 2YU9B 1KXLA 2AWOA 4A3CG 1VQBA 1ZXTA 3J7ZC 3J80E 1PFMA 1Q86C 4UY8C 3CC2A 1SYBA 1HXYD 3GO5A 5HURA 4GOPC 1EQTA 3D0FA 4UDUC 4LFAL 1TWFH 4BBRB 4RCNA 4CJ0B 3T53B 1WTXA 2X6LA 2UXBL 1L1OC 3TP5A 3PO3B 2VQFL 1J5EQ 1UE6A 1KAAA 2VNUD 1D1IA 1D1KA 2B3GA 5IOCA 3PF4A 2Z6KA 4EVOA 1VQAA 4OHJA 3PO2G 1BBWA 2HT1A 1SLJA 4X62L 2QEXA 2K05A 2F0HA 1HFNA 3A5ZB 1X32A 1K8AC 4JI7L 1UWVA 1F2ZA 1VMCA 5BN5A 3MVVA 2RSNA 3FPUB 5K5PA 4LF9Q 2JA8B 3QOJA 2A8VA 3J80L 2OTLA 3CCUA 5T1GA 2WACA 3TP8A 1YNNC 2DN8A 3A0JA 2LXKA 1IKMA 1GXDC 5CV5A 1S5BD 3TDQA 4N8FA 1FD7D 2VB3X 4P75A 1PTOB 4JC0A 3VYSA 4LNQA 2FJ2A 2K6AA 4JI2Q 1YJNA 2BDOA 2IL8A 3BYTB 4X6AH 5CORA 3C1EA 4KMUC 1BF4A 4ZQ3A 3K57A 2ENBA 4N9TA 1H9MA 4EQPA 4LFBQ 3DWPA 1C9OA 1Y8PB 2R7FA 4C1NK 3K5LA 4MTKA 3O13A 3OMCA 2GN5A 1J5EL 2FXQA 4OWTB 3OW7A 4FVMA 3RNUA 2OWOA 4CKEA 4IO9A 1NBWA 4IUQA 1TT2A 3GTGH 2TSSA 4HIOA 2DNEA 2B2YC 1TWCH 2CW0C 1QOHA 2MJ8A 3I4NB 4Y52H 1TWAB 4C3JH 4A3BB 4DGZA 3S1MB 4OWXB 3BVGA 4Z9CB 1C4QA 3HZXA 1B70B 3LGJA 1UEAB 2UUAL 4C3HH 2KJXA 3SE0A 1I94Q 1VQPA 4POFA 3NTIA 3NUCA 2VB2X 2PI2A 2A6EC 4B3TQ 5IT9E 1PH7A 2JP1A 2B63G 1LABA 2Q2TA 3KUPA 1HNXL 4ZK9B 3N52A 1E2VA 2JK8A 1J9OA 3CPWA 1SYCA 4IFDH 5GAEC 4RKLA 2F0IA 2AKWB 1EY9A 3IAYA 4PG3A 2VS1A 1Y1WB 4L5RC 1PLFA 3GTQH 2PO4A 1JT8A 2QF7A 3PUVA 4WRDA 2I46A 3R2IA 1MBYA 4JOIA 4ME3A 1XJVA 3EBEA 4QL5A 2RF4A 4L5SA 3HGBA 4OWWB 1NMFA 1VQIA 3BVZA 2B2UA 1DONA 3HOZB 2ZM6L 1BCPD 1UE7A 3HEJA 3RN5A 2YU9H 4IALA 1JORA 1L0XB 1YZ6A 4JI3L 5IWAQ 2MPMA 3AU7A 3PGZA 3NXWA 1Q1EA 3K0XA 2EYHA 3OOCA 3FEWX 4A3MH 3S2HH 2B2TA 4S3SA 2K1BA 4V190 1PRTD 4A3CH 4A3GH 1NY4A 4R4QA 4YWLA 5C5LA 1YNXA 1LACA 3CC4A 1NCVA 2K52A 2SOBA 4ILWA 4FO2A 5FLXE 5CGKA 5M3FH 3P75A 3LWEA 1FYCA 1NAPA 1VQ9A 5AFWA 4LF5Q 4BA2I 1Y8OB 5C4XB 2JEBI 3EN2A 1KABA 1FGUA 1HUMA 3NBHB 4JYAL 2MHVA 3A74A 3S1QH 4R4IA 4GNXC 4DPGA 2D2CC 1QUQA 4F87A 1LTLA 2F4IA 2ZXOA 1Q46A 1WTHA 2JA6G 4DV1Q 5KRUA 1P16A 2A74C 3DWQA 1E2WA 4X65Q 1IBML 2CWPA 3GV6A 2NVYB 1PTOD 2Y0SB 1L0WA 4DUYQ 2AUKA 2K04A 2XVSA 4XYQA 1N32L 1RTNA 1LUZA 3HFZB 1I4XA 1Y14B 2XNAC 1MKHA 3L0OA 4CKBA 3S1QB 3J81c 3H09A 4JI0L 4DAYB 3Q0AA 4LF6Q 2L15A 1A3TA 1JICA 4B3SL 2L5TA 1VQEA 5J22A 2R93G 1W3SA 3WOEA 5C44B 1ESRA 3TZDA 4NXMQ 1EU4A 4DR6Q 3OIQA 3AMUA 1AN8A 1ASZA 2ASBA 1D2BA 4PMBA 1SNCA 1CKOA 3H6MA 5M5YH 2K32A 5J3BA 1G2TA 3RZOB 1LTTD 3H3VC 3H3VI 5AJ3Q 3VR2A 4DNIA 1VQDA 4DAVA 5C0XI 3DXJC 2HIVA 3QO2A 1B53A 1GUGA 1Y1VH 3FRPB 2K75A 1PDQA 4P71A 4DV0L 5I6WA 1G291 1G6ZA 5HGTA 2AWNA 1QNKA 5C44H 4DUZL 3S17H 1D5XC 1DJRD 1XNQQ 3I4NG 4IOAA 1UAPA 4XTCS 4YHHQ 4KHZA 2XIWA 1PYSB 2QGQA 1WTOA 3SVMA 3CMAA 4JPBW 2RVLA 5CMDA 2L55A 2K03A 5ELFA 1EQQA 4BY1B 5ELBA 3EJIA 3NTKA 2ALYB 2Q2HA 5LL6X 1VQGA 4RGNA 5CYUA 2Q8IB 3JAME 4V0BA 3UDGA 4H02A 3QG1A 2JQOA 1HA5A 1KIXA 5JOBA 4WORA 1YNJD 2OQ0A 1ZYRC 4UPAA 2UU9Q 1VQKA 4GKJQ 3S2HB 2XN9C 4RH6A 1CT1D 2H5XA 2MO0A 4NXML 4DR6L 3C1FA 2F0KA 4OL7A 1SE3A 5EAYA 3TRZA 5D3DA 4OX9L 1VQCA 3TEHB 4BY1H 1G6PA 5I4DA 1K8MA 3D4WA 3DMUA 2HQEA 2K5HA 1UUPA 3HOWH 1A15A 4OGQC 4DR1Q 3BDOA 4DK6C 3I2ZA 4IUUA 2SEBD 4DR3Q 5E4XA 4P2CB 1TWFB 4GN3B 2A68C 3PIPA 1WJJA 4C3IB 1D6EC 3G48A 1CSQA 3M4YA 1I3QH 4HIMA 1SE2A 3T51B 1RD9D 1TS3A 5C4JB 1LT3D 4K0KQ 4TSSA 1PZJD 1ICWA 3D6WA 4BY1G 4YHHL 3QJYA 1NR2A 1VQ7A 4XXEA 3PCOB 3L9AX 3W2DA 1IHZA 3CD6A 1H9RA 3B6YA 5G3LD 1A63A 2NN6I 2QEJC 1HFGA 3M85A 1IW7D 4RWSC 1GUWA 5COYA 3RD4A 1HR0W 2VUMG 5E4WC 4YWKA 1WCMB 1H9JA 1L0YB 3A5UA 3DEOA 5E1FA 4JI4L 1M90C 2ZXPA 4GS3A 5JJZA 3SK8A 1A3VA 4RHSA 1WI5A 1A2UA 4GKJL 1BCPB 3ND9A 4BBRG 5LHY1 3CCMA 1AE2A 4WFN3 3CXCA 2UUBQ 3JAML 2E2HH 2F4VL 4AIMA 3E5SA 3IL8A 1EIGA 4WJWA 2CKZB 1GUNA 4A3IH 4MZ9A 5CV6A 5M3MB 2B2WA 1ICFB 4NDXA 4A3KB 3QIAA 5LMUL 4DV3L 1S5ED 1KAWA 4JV5Q 2EYOA 3N6RA 5C44G 3K80C 1SMYD 1KC8C 3K6OA 1STAA 3Q8DA 4XQNA 3MFGA 2VQFQ 2F0SA 1PH3A 2KHJA 3GTJH 4MNOA 2PMZE 3W1GA 1UE5A 3A54A 1CZGA 1HNZQ 4K14A 3VYTA 4RFBA 3M4PA 5KGUA 4NPSA 1I6VC 1V1QA 2VL6A 1X54A 1YNND 3NBHA 2MP1A 3DHQA 4JI8L 2QA4A 1EFWA 1SYEA 5IY0A 1PH9A 1W2BA 1O7YA 4HJ5A 3RZOH 3GTPH 2E2JH 2A6ED 1N33Q 4JI7Q 3T1YL 2KCCA 1VMPA 1SE4A 1FL0A 3FP9A 2NN6H 1VQFA 3BZDB 2E2IH 3MC0B 2B39A 5IT9L 1HH2P 4K2LA 1K3BC 1BUVT 4IN3A 1KNEA 1BO0A 1ONLA 3S1RH 2PW7A 5EJWA 5ISRA 2ZJRA 4DAYA 4QF4A 2PZTA 1K3RA 1TWGB 4GNXA 3Q22A 3IFDA 4ZKCB 4DKAC 3PQIA 4JBJA 1IBKQ 4LJZC 4IPGA 3HOVB 4RHRA 4DA2A 1K83B 4XQQA 4GN4B 2C5CA 2DNCA 3OPOA 2UUCL 4P72A 2OEOA 1TS2A 1I4RA 4H0LC 2UXCQ 1K8OA 5E7NA 1FGBD 1JOKA 4KD3A 4KY6A 3K5MA 4GNXB 1ESFA 1HNWQ 4O42A 4DAMA 1N9WA 3CF5A 2IX0A 2R93B 1JJGA 1CKMA 2KEEA 3NK9A 3HOYG 2K5DA 5CV7A 2CCZA 3HKZB 3VR5A 2R7DA 1PH1A 3G6JB 4J8QA 1HCZA 1YJ9A 4K8IA 3PIP3 1R4QB 5EPKA 1YI2A 4LW1A 5ELDA 1CKNA 4JI5L 1LTSD 3CCRA 4B9WA 3I7FA 3NBIA 1HQRD 5DM73 1JR0D 2M00A 5GAGC 1PTOF 2Y0SG 2IX3A 4ZKBB 2VQEL 2J4XA 3CCQA 5KNDA 3I72A 3CW2C 4M8AA 3LWUA 3J81E 4KKSA 1STEA 4DR5L 1DZ1A 3J80c 5JAVA 4BY7H 2WKDA 2WV6D 1X9NA 2B8GA 4F88A 3BDLA 3KLWA 5LMNW 1HTLD 2F0VA 5M3MH 4LF8L 3BDCA 3H3VH 4B3TL 5DM63 1SBBB 3HG9A 5DLQE 4HJ8A 1EIFA 2HCCA 1F2YA 2YTXA 3BYYB 1IYVA 3GQBA 5IYBH 5IP9G 1EL0A 3PF5A 4DU9A 1YVCA 3PO2H 5J39A 1S5FD 1O78A 4A3LH 1PV4A 1TWAH 1CM9A 2JXMB 4HR7B 5C3EB 4DV2L 4GLVB 2JA8H 3WDNA 2SNSA 1TIID 4A3JG 1U4PA 4A4IA 2ZXRA 2XWBB 3F2DA 1HZBA 1E24A 1TS5A 1WTWA 2WKCA 4FF4A 2J0TD 2VXWA 5K36G 1D7QA 4ZUJA 2IHEA 3V05A 3S9WA 1EY7A 3IFTA 4MHEA 2K14A 5DNFA 2BA0A 3BVMA 1Q8IA 4JI5Q 3TREA 2HUGA 2ZJPA 3MXGA 5FO7B 1KHIA 3A56A 1HR0L 4X3KA 1B9MA 3KBGA 1AZPA 3TS2A 1SN8A 1YITA 3I73A 4OONA 3FKIG 2R7ZG 2A5HA 3PIO3 5IGGA 2E2HB 1XTDA 2D62A 3C2PA 4JBKA 1LT5D 4LF9L 5T1IA 3T13A 1I4PA 5IE8A 4CHTB 3CCVA 3I4MG 4LUOA 4RG1A 2Q8TA 4X3TA 1MJEA 1N36Q 2WB1B 3MA2B 2F0GA 2E75C 4QUCA 1LV9A 1RTOA 2PQAB 2L1BA 2XTIA 4JYAQ 2N88A 3A7AB 1YIJA 1U5KA 3LNNA 4C1NI 3PUYA 4I7ZC 4AYBG 3BG3A 4PZ8A 1SXTA 5A35A 1HZAA 2JEAI 1M8AA 3FDTA 3HOUG 3J7A5 1K0RA 1RF2D 2DJFC 3I91A 4POGA 3NENA 4DV2Q 2A69C 2HDLA 2EJFC 1MSHA 1HTPA 3CC7A 4U68A 1IBMQ 4IQZA 4FNFA 3E0JA 3EROA 4FP5D 1Z9FA 4BY7B 4GZYC 1ML0D 1TWHH 3PUXA 1F2LA 2XGTA 3GTMB 2B63H 4UP9A 3C3LA 1CKNB 4BXXH 4GN5A 5E3FA 2UXBQ 1EOTA 2Z4IA 5FJ8G 4DV5L 3S1NH 1C0AA 1VQ5A 2WB1E 1KLUD 2LMCB 4IUVA 5KNBA 4KHPQ 4J6HA 4HMIA 1B1ZA 1HUNA 4JI0Q 3BZKA 1SFOH 1EYAA 4H13C 4DK0A 2BOSA 4OO1G 4JI1Q 2KCNA 4IFDG 1GKHA 5BR8L 3QR8A 1XNRL 3TMEA 1I4GA 3EA6A 5EKLA 2JE6I 4YCWA 2ICIA 3CQZH 5M3MG 5C0XG 1TXYA 1RL2A 3U9OA 3S14B 1X3FA 2PI2E 1X3PA 1EZ8A 1TVXA 3HP3A 5FJ8H 4HJ7A 4ZLTF 2LXJA 1NUCA 3SHLA 1WOCA 4JCVE 4TVAB 5GQOA 1CTMA 2VZAA 3KOJA 3J81L 2KOLA 4X3UA 3JAMi 2PW5A 4R4OA 1Q3LA 4HSVA 3L7ZC 1X3QA 3A8JE 4CJ1B 2EE1A 3HKZE 3CQZB 2KCTA 3CCJA 4ID6A 5I9OA 2B2TC 2AQ3B 4R4CA 1XPRA 3WOFA 2D5DA 1SRUA 4B3MQ 2WAQG 3I4NH 1WFQA 2TMPA 3RR5A 1KD1C 4A3FG 5A2QE 3RZDH 4RGTA 4B3RQ 2NUCA 4LFBL 2PPBC 4L5QA 4X66L 1XWEA 1MGSA 3CHBD 4B9XA 2A19A 1ENFA 3AFQA 2HHHL 3DM1A 3KF6A 2XWJB 1ZEQX 2KVMA 2ZM6Q 3AYHB 1VS0A 4H7BA 3UDXA 2CWAA 3MTSA 2OQKA 1GUOA 4OEMB 5GAHC 5JPNC 4JI1L 2Q2UA 4EQOA 5BR8Q 1IL8A 5C3EH 1M1KC 4UP7A 4C3HB 3KLRA 2FMMA 2IJ0A 3T1HL 2E2IB 4FF1A 3PUZA 5CBAE 2EYJA 4A3EB 2NZOA 4MTNA 3H15A 3QB3A 2K28A 4DR1L 2I5LX 3SDZA 4A3KH 1Z47A 3M9BA 2UUAQ 1S40A 3VA5A 2C35B 4DK3C 2PQEA 1U4RA 3FPPA 2EOTA 1OXVA 3HOXG 1XMOL 3J80i 3U4ZA 1EIYB 2BH8A 2A68D 1KL9A 1QVFA 4FXDA 4TKOB 2Q8RE 1BDOA 2ZTCA 1TWGH 4HCEA 4A3BG 4A76A 3BJUA 2OT2A 1ET6A 4O0AA 1A8VA 3I70A 5EQ0A 2B63B 3H0GB 3H94A 1QWYA 4A3LG 3RLFA 4QMGA 2QCPX 2PZWA 3S24A 1JE5A 2BA1A 4BBSG 2HHHQ 3MXPA 4R4TA 3GTLH 3G7LA 3AQQA 3I4OA 3MHBA 1WVLA 2E5LQ 3NE5B 1QZGA 5IYCH 3E0EA 1SDFA 1NR4A 3I4MH 3R93A 4IUPA 5C4JH 3ICEA 4B3SQ 5IYDH 2NTTA 2EXDA 2Z9HA 1X3EA 3T4AC 1F2MA 1CHQD 3GTOH 1WCMH 1F9PA 3AFPA 1M4VA 1YNJC 3NEMA 3KJOA 5LMUQ 1QNUA 2NVXH 1ASYA 1NSNS 1DCZA 4A3IG 1NE3A 3T16A 3D31A 4BBSH 2PNHA 2PCFB 3F2BA 1EQVA 3CCSA 4J15A 3KF8A 5CV4A 1SNQA 3U58A 1BBXC 2OF1A 1H95A 3RMHA 2K5WA 3EQLC 1VQ6A 2AMCB 1XMOQ 1OXUA 1A62A 4A3EG 3J81i 1G51A 4C2MH 2F0OA 4OELB 4DAPA 2HD3A 4CDDC 4AQYQ 1KDCA 2E2DC 2HCIA 4JI8Q 1LTAD 4A3IB 5EBCA 4C3JB 1IL2A 4IUTA 4G4KA 4OXPA 2I07B 3S1MH 1MJCA 2K5QA 3KK7A 5M5YB 3P7JA 3S15B 1BQQT 5GROA 4KI0A 1VQLA 3W5OA 3GTKH 2R61A 1RJTA 1STYA 5D14A 3OWFA 3PO3G 4P73A 1J6QA 1LO5D 1J8IA 1VF5C 2E5LL 3S2DH 4HN7A 1HZCA 1YHQA 1PZKD 3VR6A 1GJXA 4RKBA 5EKIA 4PMCA 3F2UA 1GHKA 4UAIA 4A3EH 2A73B 3A7LA 4DV6Q 5IT9c 1IBKL 4QCLA 4IOCA 1GUSA 1B44D 1STHA 3CAMA 1IBLQ 5KEEA 2PMZB 1U4MA 1UNSA 1UEBA 2CVRA 1VCIA 1C8CA 2EJGC 4IZ8A 3KLSA 3BS1A 3A8KE 4RAUC 3TP6A 1OXXK 2K33A 1JWUD 3SEBA 4P74A 1HPCA 2L9HA 4RGOS 1CQVA 2N3SA 4PNYA 5AJ3L 2NZHA 4C3HG 3CCEA 4DF7A 1Q12A 4HAEA 3UDFA 4R8NA 2WIIB 4KK7A 3A55A 1XPOA 3HOYH 1XXGA 3DM3A 1SJED 1TKWB 2Z6BA 2JN4A 3GTLB 2A1AA 4L8JA 1N8RC 2YTVA 2JA5H 1GHJA 3H0GH 4BA1I 3KDFA 4LF4L 4KKTA 5IODA 2UXDL 1ZKOA 4ODGA 1WTPA 4Q0FA 2B2WC 2I0QA 1GOZA 3NWSA 2JJQA 1TWHB 1QG7A 1VQ8A 3HOZH 3GD7A 4HJ9A 2H4OA 1V1OA 3NTHA 4XDXA 1JJ2A 1HHVA 2SDFA 2JA6B 4JVZA 1G2SA 5L37A 1FR3A 1EY5A 1LLRD 1RKNA 2N8NA 2XRQD 1SEBD 3SXHA 2KBNA 3BU2A 4NB3A 1VQHA 2L12A 3U9SA 5FO8B 3MAQA 1PXUA 2R92H 1BR9A 3HOVG 1ET9A 2RBMA 2UU9L 3TN2A 4OO1H 2PNRC 2BCOA 4A3BH 3HOUB 3DEPA 3DLLA 2EYFA 4TRDA 1VDZA 3OTOQ 1TQOA 4DK1A 3ULLA 1A0IA
chains in the Genus database with same CATH topology
5M3FB 1F9SA 1OO9B 3VYRA 3UI2A 4QIWB 1R9TB 2F0WA 4E6IA 5C3WA 5FKAC 3MEHA 2R92B 2CQAA 1DM0B 4KTAA 1WTRA 5EGTA 4KN7C 5LL6S 4FF3A 3GTOB 5ELEA 2O4XA 5A2QL 5EBDA 1ILQA 3ERQA 1V43A 1I4QA 2EXZA 1I50B 4OIJA 4KJOA 3QOLA 5C4HA 2BDNA 5I2YA 5M5XB 3GV3A 3D6CA 3DWAA 2G9HD 3I8ZA 1EY8A 1MD2D 3R3OA 2F0UA 1EFID 3K7AB 1EYDA 3I3CA 3X3MA 4KV6A 4K5WA 3AB9A 3R8BA 2EYMA 4A3FB 3GTKB 3D4RA 2LFNA 1SYGA 3FVQA 2EYPA 4BS9A 2L11A 2B2UC 5JEAG 1W6KA 4JK1C 1JC7A 3CRKC 1EU3A 2QILA 4XQJA 1H9SA 4JBWA 1TY2A 1SAPA 4C3IG 4QB4A 2F0TA 3RUZA 3SR1A 1CZWA 1JWSD 3OMGA 1DOMA 5I9PA 4QUFA 4XIGS 4XT3B 2IX1A 1WTVA 4NKLA 2EY5A 1SNOA 1O7ZA 2GA4B 1R4PB 3MXUA 4K8JA 4O1NA 5EKKA 1I3QB 3S1NB 1I6HB 5C3XA 2JYOA 4CBVA 2B2YA 3D8GA 2KECA 1IKLA 4A3JB 1B2TA 3CKIB 3J7YW 4R8IA 2RA4A 2JA5B 5JPMC 5IGFA 3GP7A 2IT1A 5CC4A 1II3A 3J7AV 4PQXA 3M7GA 3E6ZX 3VYUA 4Q5VA 4KN4C 5IGCA 1IW7C 4OIKA 4EGVA 3TSSA 4LAAA 5CR3A 1H9KA 1STGA 1ENAA 3URYA 5CV9A 4NP5A 3NP8A 4J1MA 3M3YB 5C5MA 4K2KA 2R7ZB 2EY1A 1EWHA 2F0EA 1F77A 2L4NA 5M9OA 4M1UB 4FXKC 2XRSD 3P20A 3VR3A 2EYLA 1OXTA 3KBXA 4CJ2C 3S16B 2NWGA 1CQFA 1E0BA 1JOOA 1WTQA 1CFMA 2YYZA 4IUNA 1Y8NB 3D3RA 3ITPA 1C48A 3SK5A 3T56B 2K7VA 4A3DB 2F1MA 2WP8J 3Q23A 4HTHA 3M4OB 5JEAH 3NWTA 2F0DA 3HOWB 1DYQA 1O80A 1LT4D 1DXMA 1SNDA 1AZQA 3Q6SA 4ZYSA 5DAUA 1BXTA 1FNWA 1MI2A 2ICEC 1JWMD 2B2VC 1BCPF 4H44C 4LK1C 2EPBA 2O2LD 2WAQB 3SK6A 4LMQD 3GTPB 2B8FA 2HDMA 2M2LA 3S1RB 2EZVA 2FMCA 1B9NA 5C0XJ 2AUJD 4CGYB 1KDAA 4R9WA 2DY7A 1KNAA 5KYIA 3DUZA 2IWHA 4C56C 5CV8A 4BWGB 3MXNA 2RKSA 3K5NA 1JQYD 2NVTB 5C4ZA 1TU2B 2O5JC 1CHPD 4KHVA 5FOBB 1JE4A 1JOQA 2Z4HA 3PV0A 1SNPA 1RCVD 2EJMA 2QDBA 2EDGA 5JVG3 2F0MA 4ZRZA 5CBEE 3HOYB 1RODA 3D4DA 4HSPA 3K59A 5DEHA 1CI3M 1LTBD 5I6YA 2KA7A 2E74C 3HRZC 1HA6A 2NVXB 1PFBA 4K6LA 3LX0A 3GTJB 1H9SB 4Y7NB 5KYLA 4N9PA 4YIJA 2LY7A 3FMCA 1LTID 2FFKB 1WD0A 4NW2A 4ZAIA 1KLGD 4U673 4C2MB 2N55A 3L3OC 1STNA 2A6HD 4DXGA 4K5XA 2JSOA 2IW3A 3C46A 4IURA 3MWYW 1TS4A 2F0QA 3K0YA 2MUYA 1RDPD 4RCOA 2KEDA 5TSSA 1D5MC 2ZT9C 1JB3A 5J1ZA 2L0CA 1ENCA 1FNUA 2BE5C 2NB0A 4KJNA 3V96A 1RHPA 3NQTA 5JEAJ 3SK4A 3K5OA 4NMZA 1A3UA 2EY6A 3K58A 2R3ZA 3I4LA 2E76C 4B08A 4C3JG 5I2XA 1V8QA 2NZ1D 1DOLA 5KIXA 2ID0A 1E2ZA 1DOKA 3EVQA 3MZ5A 5F2DA 1TWCB 4TQUS 1I4HA 4A3GB 2E2JB 3OWEB 4PMWA 4DFAA 2DY8A 5EPLA 1G91A 5FK9C 4PV1C 2K01A 2JA7B 5BN3A 2F0JA 1F9RA 3M7NA 2B2VA 1PRTB 3A8IE 1PTOC 1EY4A 1S4ZA 2EY2A 2SNMA 3TZUA 1BCPC 2F0NA 1Q90A 3W3AA 4G57A 1EEFD 2LKVA 4ME5A 4K6DA 4XT1B 3S2DB 2KHSA 3ND8A 2G9DA 1JCKB 2OXPA 2RQXA 2F0LA 1FNVA 2PYKA 1EEID 1SMYC 3PO2B 5IGEA 1SFOB 1SSOA 1DD2A 4RA8A 2NVQB 2AQ2B 1BNZA 2Z1CA 2F0PA 1S5CD 4X3SA 5FO9B 4KY5A 3X3NA 3OIPA 4OO1I 3IKJA 3I90A 4K5VA 4RGMA 4CKCA 3HOXB 4IFDI 4HEDA 3OSOA 3NHHA 4FF2A 5IGDA 3CU7A 1EYCA 5KNCA 1QJOA 2RDGA 1PTOH 1QCBD 1Y69U 1HRJA 2WINB 4BBSB 4DNRB 2PZUA 4ABNA 1KTKA 1EIHA 5BN4A 1SYFA 1TY0A 2F03A 1O7LA 1CA6A 3RZDB 4G7ZC 1S5DD 3NQIA 1EWCA 3VR4A 2A69D 2NYZD 2X69A 4HCSA 2NBFA 3QWNA 1SYDA 1G8ZD 4MIUA 1WD1A 2LS01 1OXSC 3GTGB 2AQ1B 1QE6A 3OHXC 4A93B 1B3AA 1AP0A 1QB5D 2X6GA 5M5WB 1EY0A 1B4OA 4KKUA 1AEXA 4ZUIA 3J7AF 2Z8LA 1ZYRD 2BE5D 1SJHD 1XYIA 5C0XH 1LT6D 1B50A 5EPJA 3S17B 4L6TB 5JVH3 1IYUA 2IPKD 4A3MB 2A6HC 2CHBD 3NSWA 3H91A 3GTQB 1SNMA 1Z6HA 4DN4M 2RSOA 2FINB 3V2TA 2M9VA 3P1HA 3PMFA 1ILPA 1PYWD 1QILA 5IGBA 3ZYYX 4XYOA 4L63B 1V1PA 5FLXL 2NTSA 1PMRA 1T5XD 3MFYA 1U4LA 2R6GA 3ONAB 4I65A 3TBIB 4FXGC 5IIFA 4HMJA 1CK1A 1CA5A 1XX8A 1Q1BA 5ELCA 3Q24A 2RDFA 5K36H 2D9UA 2C9OA 2F3VA 2O5IC 1AFPA 1EY6A 4F7XA 3PUWA 4FYDA 1A2TA 2KUMA 2CW0D 4ULLA 1V1PB 4G7HC 4DXFA 2F3WA 4KD4A 1F9QA 1Y1VB 2RDHA 5D65A 1D5ZC 4G7OC 4MN3A 5NUCA 2VUMB 2NN6G 2QKIC 1W6JA 4DNTB 4F8MA 2F0FA 2FHTA 5D3IB 1TR5A 5G3LF 2XSCA 3NPPA 1AW7A 2H1EA 2KQ3A 1KDBA 3HS0C 4EQNA 1Z7TA 1EZ6A 3VA7A 3TP7A 3FKIB 4IFDJ 1STBA 2MGSA 3R2TA 1VF7A 4KY7A 1PRTC 1MSGA 1PFNA 1LTRD 2EVBA 1A6XA 1BOSA 1HQMC 3I4MB 1PZID 2J7ZA 1LTGD 1T5EA 3EFXD 3KLSX 5C6AA 1XTCD 1PRTF 1GUTA 1U9RA 2YU9B 2V4DA 3CRLC 2AWOA 1ZXTA 3J80E 1PFMA 1SYBA 1HXYD 3GO5A 5HURA 1EQTA 4UDUC 4CJ0B 4BBRB 4RCNA 3T53B 1WTXA 2X6LA 3TP5A 3PO3B 1KAAA 2VNUD 1D1IA 1D1KA 5IOCA 4EVOA 4OHJA 2K05A 2F0HA 1HFNA 1X32A 1F2ZA 1VMCA 5BN5A 3MVVA 5K5PA 2RSNA 3FPUB 2JA8B 3QOJA 3J80L 5T1GA 2WACA 3TP8A 1YNNC 2DN8A 1IKMA 1GXDC 5CV5A 1S5BD 3TDQA 1FD7D 2VB3X 1PTOB 3VYSA 2FJ2A 2K6AA 2BDOA 2IL8A 3BYTB 5CORA 3C1EA 4KMUC 1BF4A 4ZQ3A 3K57A 2ENBA 4N9TA 1H9MA 4EQPA 3DWPA 1Y8PB 4C1NK 3K5LA 3O13A 3OMCA 3OW7A 4FVMA 4CKEA 4IUQA 1TT2A 2TSSA 2DNEA 2B2YC 2CW0C 1QOHA 2MJ8A 3I4NB 1TWAB 4A3BB 4DGZA 3S1MB 3BVGA 4Z9CB 1C4QA 3HZXA 1UEAB 2KJXA 3SE0A 3NTIA 3NUCA 2VB2X 2A6EC 5IT9E 2JP1A 1LABA 3KUPA 4ZK9B 3N52A 1E2VA 1J9OA 1SYCA 4IFDH 4RKLA 2F0IA 1EY9A 3IAYA 1Y1WB 1PLFA 2PO4A 2QF7A 3PUVA 4WRDA 2I46A 3R2IA 1MBYA 3HGBA 3BVZA 2B2UA 1DONA 3HOZB 1BCPD 3HEJA 4IALA 1JORA 1L0XB 2MPMA 3AU7A 3NXWA 1Q1EA 2EYHA 3OOCA 3FEWX 2B2TA 4S3SA 2K1BA 4V190 1PRTD 5C5LA 1LACA 1NCVA 2SOBA 4ILWA 4FO2A 5CGKA 5FLXE 3P75A 3LWEA 1FYCA 1NAPA 5AFWA 4BA2I 1Y8OB 5C4XB 2JEBI 1KABA 1HUMA 2MHVA 2D2CC 4F87A 2F4IA 2ZXOA 5KRUA 2A74C 3DWQA 1E2WA 3GV6A 2NVYB 1PTOD 2Y0SB 2AUKA 2K04A 2XVSA 4XYQA 1RTNA 1I4XA 2XNAC 4CKBA 3S1QB 3H09A 3Q0AA 1A3TA 1JICA 2L5TA 5J22A 3WOEA 5C44B 1ESRA 3TZDA 1EU4A 3OIQA 3AMUA 1AN8A 1D2BA 4PMBA 1SNCA 3H6MA 2K32A 1G2TA 3RZOB 1LTTD 3H3VC 3VR2A 4DAVA 5C0XI 3DXJC 3QO2A 1B53A 1GUGA 3FRPB 1PDQA 5I6WA 1G291 1G6ZA 5HGTA 2AWNA 1QNKA 1D5XC 1DJRD 1UAPA 4XTCS 4KHZA 2XIWA 1WTOA 3SVMA 2RVLA 5CMDA 2L55A 2K03A 5ELFA 4BY1B 5ELBA 3EJIA 3NTKA 5LL6X 4RGNA 5CYUA 2Q8IB 3JAME 4V0BA 3QG1A 1HA5A 5JOBA 4WORA 1YNJD 1ZYRC 3S2HB 2XN9C 4RH6A 1CT1D 3C1FA 2F0KA 4OL7A 1SE3A 5D3DA 5I4DA 1K8MA 3D4WA 3DMUA 2HQEA 1UUPA 1A15A 4OGQC 3BDOA 4IUUA 2SEBD 5E4XA 4P2CB 1TWFB 2A68C 4C3IB 1D6EC 3M4YA 1SE2A 3T51B 1RD9D 1TS3A 5C4JB 1LT3D 4TSSA 1PZJD 1ICWA 3D6WA 3QJYA 1NR2A 4XXEA 3L9AX 3W2DA 1IHZA 1H9RA 5G3LD 2NN6I 2QEJC 1HFGA 3M85A 1IW7D 4RWSC 1GUWA 5COYA 3RD4A 5E4WC 1WCMB 1H9JA 1L0YB 3DEOA 5E1FA 2ZXPA 5JJZA 3SK8A 1A3VA 4RHSA 1A2UA 1BCPB 3ND9A 5LHY1 4WFN3 3JAML 3E5SA 3IL8A 1EIGA 4WJWA 1GUNA 5CV6A 5M3MB 2B2WA 4NDXA 4A3KB 3QIAA 1S5ED 2EYOA 3N6RA 1SMYD 3K6OA 1STAA 4XQNA 3MFGA 2F0SA 3A54A 1CZGA 4K14A 3VYTA 4RFBA 5KGUA 1I6VC 1YNND 3NBHA 2MP1A 3DHQA 1SYEA 1O7YA 2A6ED 2KCCA 1VMPA 1SE4A 2NN6H 3BZDB 3MC0B 2B39A 5IT9L 4K2LA 4IN3A 1BUVT 1KNEA 1BO0A 1ONLA 2PW7A 5EJWA 5ISRA 4DAYA 4QF4A 2PZTA 1TWGB 3Q22A 3IFDA 4ZKCB 4LJZC 3HOVB 4RHRA 4DA2A 1K83B 4XQQA 2C5CA 2DNCA 3OPOA 2OEOA 1TS2A 1I4RA 4H0LC 1K8OA 1FGBD 1JOKA 4KD3A 4KY6A 3K5MA 1ESFA 4O42A 2IX0A 2R93B 2KEEA 3NK9A 2K5DA 5CV7A 3HKZB 3VR5A 3G6JB 4J8QA 1HCZA 4K8IA 3PIP3 1R4QB 5EPKA 5ELDA 1LTSD 4B9WA 3NBIA 1HQRD 5DM73 1JR0D 2M00A 1PTOF 2IX3A 4ZKBB 2J4XA 5KNDA 3I72A 4M8AA 3LWUA 3J81E 4KKSA 1STEA 1DZ1A 5JAVA 2WKDA 2WV6D 2B8GA 4F88A 3BDLA 1HTLD 2F0VA 3BDCA 5DM63 1SBBB 3HG9A 2HCCA 1F2YA 3BYYB 1IYVA 3GQBA 1EL0A 4DU9A 5J39A 1S5FD 1O78A 2JXMB 1CM9A 4HR7B 5C3EB 3WDNA 2SNSA 1TIID 1U4PA 2ZXRA 2XWBB 1TS5A 1WTWA 2WKCA 4FF4A 2J0TD 2VXWA 5K36G 4ZUJA 3V05A 3S9WA 1EY7A 3IFTA 4MHEA 5DNFA 2BA0A 3BVMA 1Q8IA 2HUGA 3MXGA 5FO7B 3A56A 4X3KA 1B9MA 3KBGA 1AZPA 3I73A 2A5HA 3PIO3 5IGGA 2E2HB 2D62A 3C2PA 1LT5D 5T1IA 3T13A 1I4PA 4CHTB 2Q8TA 4X3TA 2WB1B 3MA2B 2F0GA 2E75C 4QUCA 1LV9A 1RTOA 2L1BA 2N88A 3A7AB 3LNNA 4C1NI 3PUYA 4I7ZC 3BG3A 1SXTA 5A35A 2JEAI 1M8AA 3FDTA 1RF2D 3I91A 2A69C 2HDLA 2EJFC 1MSHA 1HTPA 4U68A 4IQZA 4FNFA 3E0JA 3EROA 4FP5D 4BY7B 4GZYC 1ML0D 3PUXA 1F2LA 3GTMB 3C3LA 5E3FA 1EOTA 2Z4IA 5KNBA 1KLUD 2LMCB 4IUVA 4J6HA 4HMIA 1B1ZA 1HUNA 1EYAA 4H13C 4DK0A 2BOSA 4OO1G 2KCNA 4IFDG 3TMEA 1I4GA 3EA6A 5EKLA 2JE6I 2ICIA 5C0XG 3U9OA 3S14B 1X3PA 1EZ8A 1TVXA 3HP3A 4ZLTF 1NUCA 3SHLA 1CTMA 3J81L 2KOLA 4X3UA 2PW5A 1Q3LA 4HSVA 3L7ZC 1X3QA 3A8JE 4CJ1B 2EE1A 3CQZB 4ID6A 5I9OA 2B2TC 2AQ3B 3WOFA 2D5DA 2TMPA 5A2QE 4RGTA 2NUCA 2PPBC 1XWEA 1MGSA 3CHBD 4B9XA 1ENFA 3DM1A 2XWJB 1ZEQX 2KVMA 4H7BA 3MTSA 1GUOA 5JPNC 4EQOA 1IL8A 4C3HB 3KLRA 2FMMA 2IJ0A 2E2IB 4FF1A 3PUZA 5CBAE 2EYJA 4A3EB 3QB3A 2K28A 3SDZA 1Z47A 3VA5A 2PQEA 1U4RA 3FPPA 2EOTA 1OXVA 2A68D 4FXDA 4TKOB 2Q8RE 1BDOA 4HCEA 2OT2A 1ET6A 2B63B 3I70A 5EQ0A 3H0GB 3H94A 1QWYA 3RLFA 4QMGA 2QCPX 2PZWA 2BA1A 3MXPA 3G7LA 3MHBA 1WVLA 3NE5B 1SDFA 1NR4A 3R93A 4IUPA 2NTTA 3T4AC 1F2MA 1CHQD 1F9PA 1M4VA 1YNJC 1QNUA 1NSNS 1DCZA 3T16A 3D31A 2PCFB 1EQVA 3KF8A 5CV4A 1SNQA 1BBXC 2OF1A 3RMHA 2K5WA 3EQLC 1OXUA 2F0OA 4DAPA 1KDCA 2E2DC 2HCIA 1LTAD 4A3IB 5EBCA 4C3JB 4G4KA 4IUTA 2I07B 2K5QA 3KK7A 5M5YB 3P7JA 3S15B 1BQQT 4KI0A 2R61A 1RJTA 1STYA 5D14A 3OWFA 1LO5D 1J8IA 1VF5C 4HN7A 1PZKD 3VR6A 1GJXA 4RKBA 5EKIA 4PMCA 3F2UA 1GHKA 4UAIA 2A73B 3A7LA 4QCLA 1GUSA 1B44D 1STHA 5KEEA 2PMZB 1U4MA 1C8CA 1UNSA 2CVRA 1VCIA 2EJGC 4IZ8A 3KLSA 3BS1A 3A8KE 4RAUC 3TP6A 1OXXK 2K33A 1JWUD 3SEBA 1HPCA 2L9HA 4RGOS 1CQVA 4PNYA 4C3HG 4DF7A 1Q12A 4HAEA 4R8NA 2WIIB 4KK7A 3A55A 1XXGA 1SJED 1TKWB 3GTLB 4L8JA 1GHJA 4BA1I 4KKTA 5IODA 1ZKOA 4ODGA 1WTPA 4Q0FA 2B2WC 1GOZA 3NWSA 1TWHB 1QG7A 3GD7A 2H4OA 1V1OA 3NTHA 4XDXA 1HHVA 2SDFA 2JA6B 1G2SA 1FR3A 1EY5A 1LLRD 1RKNA 2XRQD 1SEBD 3SXHA 2L12A 3U9SA 5FO8B 3MAQA 1PXUA 1BR9A 1ET9A 2RBMA 3TN2A 4OO1H 2PNRC 2BCOA 3HOUB 3DEPA 2EYFA 4TRDA 1VDZA 1TQOA 4DK1A 4AYBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IUV A;  2K04 A;  1F9S A;  4XT1 B;  1A15 A;  1EL0 A;  1HUN A;  1SAP A;  2JP1 A;  1RJT A;  1RTN A;  1U4R A;  2EOT A;  2FFK B;  4IUU A;  3UI2 A;  1WD0 A;  4NW2 A;  5D14 A;  3KUP A;  4ZAI A;  4ZK9 B;  3N52 A;  1F9Q A;  5E4X A;  1J9O A;  1CM9 A;  1DOM A;  1J8I A;  1VMP A;  2K05 A;  2N55 A;  4QUF A;  1HFN A;  1XYI A;  1X32 A;  1O80 A;  5D65 A;  4XT3 B;  1WVL A;  1WTV A;  1SSO A;  2Q8R E;  5EKI A;  1U4P A;  1VMC A;  1B50 A;  1JIC A;  3F2U A;  1AZQ A;  3Q6S A;  4MN3 A;  4UAI A;  1O7Z A;  1ESR A;  4IUR A;  4RA8 A;  3TZD A;  5EPJ A;  1PLF A;  1KNE A;  1BO0 A;  1MI2 A;  2RSN A;  3FPU B;  3MWY W;  5EQ0 A;  1ICW A;  2FHT A;  5EJW A;  2B2V C;  1WTW A;  1WTR A;  1BNZ A;  1X3P A;  1TVX A;  3HP3 A;  3D6W A;  1U4M A;  2CVR A;  2VXW A;  4ZLT F;  3IFD A;  1C8C A;  4X3S A;  1G2T A;  2EPB A;  4ZKC B;  1ILQ A;  2KED A;  1NR2 A;  4LMQ D;  2JYO A;  5T1G A;  2B2Y A;  4MHE A;  5DNF A;  3H91 A;  4RAU C;  2HDM A;  2M2L A;  3I90 A;  2KOL A;  2L9H A;  2KEC A;  1IKL A;  2H1E A;  1IKM A;  2B2U A;  1HFG A;  2HUG A;  3QO2 A;  4HED A;  1DON A;  1RHP A;  1B53 A;  4X3U A;  4RWS C;  1B2T A;  1GUW A;  4DN4 M;  1Q3L A;  3G7L A;  4HAE A;  4OIJ A;  4X3K A;  4R8I A;  2RA4 A;  4HSV A;  5COY A;  4R9W A;  1AZP A;  1PDQ A;  1X3Q A;  2FJ2 A;  5E4W C;  2MPM A;  2MGS A;  4CJ1 B;  2DY7 A;  2RSO A;  2EE1 A;  1SDF A;  1KNA A;  2FIN B;  1NR4 A;  2BDN A;  2IL8 A;  3DEO A;  1G6Z A;  3GV3 A;  3R93 A;  4IUP A;  1QNK A;  2B2T C;  4O42 A;  5COR A;  1BF4 A;  5JJZ A;  2R3Z A;  1MSG A;  1ILP A;  3I8Z A;  1PFN A;  1HRJ A;  2KEE A;  2NZ1 D;  5T1I A;  1F9P A;  1DOL A;  2B2T A;  1EIH A;  2K1B A;  2XIW A;  1JE4 A;  3IL8 A;  1EIG A;  1WTP A;  2B2W C;  2J7Z A;  1WTO A;  1DOK A;  3SVM A;  4OIK A;  2Q8T A;  4X3T A;  1MGS A;  5EPK A;  1QG7 A;  1CA6 A;  2RVL A;  1U4L A;  4QUC A;  5CMD A;  1LV9 A;  1RTO A;  1NCV A;  2B2W A;  2K03 A;  3DM1 A;  3ONA B;  2KVM A;  2L1B A;  3I3C A;  2N88 A;  4XDX A;  1HHV A;  3GV6 A;  2SDF A;  4IUQ A;  2NYZ D;  1G2S A;  2X69 A;  1ZXT A;  1XX8 A;  3LWE A;  3MTS A;  4ZKB B;  1NAP A;  5CBE E;  1BBX C;  4HCS A;  5AFW A;  1PFM A;  2DY8 A;  1M8A A;  1ROD A;  5EPL A;  1G91 A;  3FDT A;  1HUM A;  2B2Y C;  2K01 A;  2MJ8 A;  1WD1 A;  3I91 A;  1DZ1 A;  1F9R A;  1EQT A;  2D9U A;  2B2V A;  4CJ0 B;  2L12 A;  1IL8 A;  2HDL A;  1MSH A;  1QE6 A;  2FMM A;  2L11 A;  1CA5 A;  2L4N A;  2HCI A;  1S4Z A;  4U68 A;  1WTX A;  2B2U C;  2X6L A;  5CBA E;  1HA6 A;  1PFB A;  3TN2 A;  1B3A A;  1ML0 D;  1F2L A;  4IUT A;  3KBX A;  1AP0 A;  3DEP A;  2K28 A;  4CJ2 C;  2X6G A;  2NWG A;  1E0B A;  2MP1 A;  1WTQ A;  2HCC A;  2KUM A;  1EOT A;  3P7J A;  1O7Y A;  1B4O A; 
#chains in the Genus database with same CATH topology
 5M3F B;  1F9S A;  1OO9 B;  3VYR A;  4OX9 Q;  4L5T A;  5H1S E;  3UI2 A;  4QIW B;  1R9T B;  2F0W A;  4E6I A;  4A3J H;  1NMG A;  2RHS B;  5C3W A;  2MNA A;  3VDY A;  5FKA C;  3MEH A;  1X3G A;  1L2F A;  2R92 B;  4A3D H;  1FJG L;  2CQA A;  2JA7 G;  1DM0 B;  1I6H H;  3GTM H;  4KTA A;  5FLM G;  1WTR A;  5EGT A;  4KN7 C;  5LL6 S;  1PA6 A;  4FF3 A;  4LF4 Q;  3GTO B;  3HOX H;  5ELE A;  2O4X A;  5A2Q L;  5EBD A;  1ILQ A;  3ERQ A;  1V43 A;  3KJP A;  1I4Q A;  3I56 A;  2EXZ A;  1I50 B;  4YY3 Q;  4OIJ A;  4KJO A;  3QOL A;  5C4H A;  1K9M C;  3BZC A;  2BDN A;  5I2Y A;  4LF7 Q;  5M5X B;  3GV3 A;  3D6C A;  1E22 A;  3DWA A;  1YEZ A;  2G9H D;  3I8Z A;  1EY8 A;  1MD2 D;  3R3O A;  2F0U A;  4JI4 Q;  1EFI D;  3G4S A;  4QJF A;  1PH6 A;  1V9P A;  3K7A B;  1JJC B;  4A93 G;  5C4X H;  2UUC Q;  1EYD A;  2WFW A;  3I3C A;  3X3M A;  4KV6 A;  4K5W A;  3AB9 A;  3R8B A;  2EYM A;  4GKK Q;  4A3F B;  3GTK B;  1PYB A;  3D4R A;  2LFN A;  1CUK A;  3H0G G;  1SYG A;  3FVQ A;  2JA9 A;  2CH4 A;  4A3D G;  2EYP A;  4I7A A;  2L11 A;  4BS9 A;  1FJG Q;  2BH2 A;  4RMF A;  5IYC G;  2B2U C;  3U50 C;  4O2D A;  5JEA G;  4DV5 Q;  1W6K A;  4JK1 C;  1PH5 A;  4KHP L;  1JC7 A;  3CRK C;  4JOI C;  1EU3 A;  1GM5 A;  4UP8 A;  2QIL A;  1HNZ L;  4KLK A;  4XQJ A;  1H9S A;  4JBW A;  1TY2 A;  1SAP A;  3SGI A;  4C3I G;  4QB4 A;  2GVA A;  3HOW G;  3F2C A;  2F0T A;  3RUZ A;  3SR1 A;  1CZW A;  1PHJ A;  1JWS D;  3OMG A;  1DOM A;  5I9P A;  4QUF A;  2D0P A;  4DV4 Q;  4XIG S;  4XT3 B;  2IX1 A;  1WTV A;  4NKL A;  2EY5 A;  4LF7 L;  3T1Y Q;  3GDE A;  1SNO A;  1O7Z A;  4QIW E;  3MXN B;  2G5D A;  2GA4 B;  1R4P B;  3MXU A;  4LF8 Q;  4K8J A;  1LM0 A;  1T9H A;  4O1N A;  5EKK A;  1I3Q B;  3HKS A;  1JMC A;  4BXX G;  3S1N B;  1I6H B;  5C3X A;  2JYO A;  4CBV A;  2B2Y A;  3D8G A;  3K7U C;  2KEC A;  1IKL A;  1R9T H;  1DGS A;  1GO3 E;  4A3J B;  1B2T A;  3CKI B;  3J7Y W;  4R8I A;  2RA4 A;  2JA5 B;  5JPM C;  4IPD A;  5IGF A;  3GP7 A;  2IT1 A;  5CC4 A;  1II3 A;  3J7A V;  1XMQ Q;  2Z0S A;  4PQX A;  3L2P A;  3S14 H;  3M7G A;  2OTJ A;  3STB C;  3E6Z X;  3VYU A;  4WJ3 M;  4Q5V A;  4KN4 C;  3UE0 A;  5IGC A;  1IW7 C;  1YHB A;  2D0O A;  2OCE A;  4PZ6 A;  4OIK A;  4EGV A;  4LAA A;  3TSS A;  5CR3 A;  1H9K A;  4Y7N H;  1STG A;  4CDF C;  1ENA A;  3URY A;  5CV9 A;  1Q82 C;  2NVY H;  1B7Y B;  1HR0 Q;  4NP5 A;  3I55 A;  3NP8 A;  3NEL A;  4LUZ A;  1WYD A;  4J1M A;  3M3Y B;  5C5M A;  4K2K A;  1B8A A;  3T1H Q;  3M4O H;  4X62 Q;  2CQO A;  4LFC L;  2R7Z B;  2EY1 A;  1EWH A;  2VY3 A;  2F0E A;  1EQR A;  1F77 A;  5IP7 H;  4DV7 L;  1JB7 A;  2L4N A;  5M9O A;  4IPC A;  4M1U B;  4FXK C;  2XRS D;  3P20 A;  3VR3 A;  1PFS A;  2EYL A;  1QVG A;  1OXT A;  3KBX A;  1SR3 A;  4CJ2 C;  3S16 B;  2NWG A;  1CQF A;  1N36 L;  1E0B A;  1JOO A;  1WTQ A;  1CFM A;  2YYZ A;  3M4Q A;  4IUN A;  1Y8N B;  3D3R A;  3ITP A;  1C48 A;  1QZH A;  3U4V A;  1Q8K A;  1GVP A;  3G71 A;  3SK5 A;  2IY5 B;  3T56 B;  2K7V A;  5M5W H;  4A3D B;  2JA7 H;  2F1M A;  2WP8 J;  4IJH A;  3Q23 A;  4HTH A;  3M4O B;  5JEA H;  3NWT A;  2RCF A;  1X56 A;  5JJL A;  2F0D A;  3HOW B;  1DYQ A;  1O80 A;  1LT4 D;  5IP7 G;  1DXM A;  1SND A;  5C3E G;  1AZQ A;  3Q6S A;  4ZYS A;  5DAU A;  1BXT A;  2RCN A;  1FNW A;  2LSS A;  1UE1 A;  1MI2 A;  2YV5 A;  2ICE C;  1KRS A;  1JWM D;  4JBM A;  2B2V C;  2ATW A;  1BCP F;  4H44 C;  4LK1 C;  4NXN L;  2EPB A;  2O2L D;  5HY6 A;  2WAQ B;  3SK6 A;  4LMQ D;  3GTP B;  2B8F A;  2HDM A;  1EOV A;  2M2L A;  3S1R B;  5IWA L;  2EZV A;  2FMC A;  1B9N A;  5C0X J;  1VQJ A;  5FLX c;  4DR2 L;  1N34 L;  2AUJ D;  2VW9 A;  4DR7 L;  4CGY B;  1KDA A;  4R9W A;  5C4X G;  2JA6 H;  1L1O B;  4A3F H;  2DY7 A;  1KNA A;  3W1B A;  5KYI A;  3DUZ A;  4QGU A;  2IWH A;  4C56 C;  1Y1W H;  4LFC Q;  5CV8 A;  4BWG B;  1KQS A;  1PH8 A;  2NVQ H;  1AH9 A;  3MXN A;  2RKS A;  1BVS A;  3K5N A;  1JQY D;  2NVT B;  5C4Z A;  2N78 A;  1TU2 B;  2O5J C;  1CHP D;  4KHV A;  4CDE C;  1K83 H;  5FOB B;  1JE4 A;  2K4K A;  4JG2 A;  1JOQ A;  2Z4H A;  1K8G A;  3PV0 A;  1LYL A;  1SNP A;  1RCV D;  2EJM A;  2QDB A;  3MEF A;  2WB1 G;  2EDG A;  5JVG 3;  4QY7 A;  2F0M A;  4ZRZ A;  3WWV A;  4CDC C;  5CBE E;  1IYJ B;  1E1O A;  3HOY B;  1ROD A;  3D4D A;  4HSP A;  3K59 A;  5DEH A;  1CI3 M;  1HNX Q;  2R93 H;  1LTB D;  5I6Y A;  2KA7 A;  2E74 C;  3HRZ C;  1EUJ A;  3M3Y H;  4LFA Q;  2K5V A;  2NVX B;  1PFB A;  1HA6 A;  4B3R L;  4DUY L;  3TS0 A;  2ES2 A;  1K73 C;  4K6L A;  4X66 Q;  3CME A;  1L1O A;  3LX0 A;  3GTJ B;  1H9S B;  4Y7N B;  1N32 Q;  4NXN Q;  5KYL A;  2CFM A;  2P5Z X;  4N9P A;  4YIJ A;  4X64 L;  2LY7 A;  3OYY A;  2HIX A;  3FMC A;  1PH2 A;  1LTI D;  3RLN A;  2FFK B;  1WD0 A;  4NW2 A;  4DR2 Q;  1N34 Q;  4ZAI A;  1KLG D;  1NTG A;  4IPH A;  4U67 3;  4HJA A;  3CP0 A;  4C2M B;  2N55 A;  4JI3 Q;  3ZJY C;  3L3O C;  1STN A;  3KF8 B;  1FVI A;  1SMX A;  3K8A A;  2A6H D;  4DXG A;  4K5X A;  2JSO A;  4BY7 G;  2IW3 A;  3C46 A;  2JA8 G;  4IUR A;  1XNR Q;  3PIO A;  3MWY W;  3E9H A;  3HOU H;  1TS4 A;  2F0Q A;  4HID A;  3AEV A;  3K0Y A;  2MUY A;  1X65 A;  2IHF A;  1RDP D;  4RCO A;  3S15 H;  2KED A;  1VQO A;  3UDI A;  5TSS A;  1D5M C;  2ZT9 C;  4GLX A;  1JB3 A;  5J1Z A;  2L0C A;  1ENC A;  1FNU A;  2BE5 C;  2NB0 A;  4KJN A;  3V96 A;  1RHP A;  3NQT A;  3F1Z A;  5JEA J;  3SK4 A;  2K50 A;  2WAQ E;  3K5O A;  4NMZ A;  2QDL A;  1A3U A;  4DR4 Q;  1C7Y A;  3J81 j;  2EY6 A;  4LUV A;  3K58 A;  2UXD Q;  2R3Z A;  3I4L A;  2E76 C;  4B08 A;  4C3J G;  5I2X A;  3FKI H;  1V8Q A;  4JI2 L;  2CH4 W;  1BKB A;  2F3I A;  1WCM G;  2NZ1 D;  1DOL A;  5KIX A;  2ID0 A;  1YBY A;  4B3M L;  3HOZ G;  4DV1 L;  5GAD C;  1E2Z A;  4A3G G;  1DOK A;  5JJI A;  3EVQ A;  1S3O A;  3MZ5 A;  4AYB E;  1S72 A;  5F2D A;  3RN2 A;  1TWC B;  1BBU A;  4TQU S;  2V1C C;  4X64 Q;  4GLA C;  1I4H A;  4ZCK A;  1D8L A;  4A3G B;  2E2J B;  3OWE B;  4PMW A;  4DFA A;  1MIU A;  2DY8 A;  5EPL A;  1Y1W G;  1G91 A;  4PV1 C;  5FK9 C;  3JC6 6;  2K01 A;  2JA7 B;  3HKZ G;  2YTY A;  5BN3 A;  2F0J A;  1F9R A;  3CCL A;  2B2V A;  2JA5 G;  3M7N A;  1CSP A;  1PRT B;  3A8I E;  2I5H A;  1PTO C;  1EY4 A;  1S4Z A;  2EY2 A;  2SNM A;  2E8G A;  3TZU A;  4UHV A;  1BCP C;  2F0N A;  1Q90 A;  3W3A A;  4G57 A;  4AYB B;  1EEF D;  1HZ9 A;  3PO3 H;  2LKV A;  4ME5 A;  1YJW A;  4K6D A;  4XT1 B;  1I94 L;  3S2D B;  4YCV A;  2KHS A;  3ND8 A;  5IP9 H;  2G9D A;  1JCK B;  4EX5 A;  4JI6 L;  2OXP A;  2RQX A;  2F0L A;  1FNV A;  2PYK A;  1EEI D;  1SMY C;  3PO2 B;  4DR4 L;  2GVB A;  5IGE A;  1SSO A;  1SFO B;  1X55 A;  2ZTD A;  4DUZ Q;  1DD2 A;  3HOV H;  4RA8 A;  2NVQ B;  2AQ2 B;  4AH6 A;  1BNZ A;  2KHI A;  2Z1C A;  2NVT H;  2F0P A;  3KYH C;  1XNQ L;  4GOP A;  1S5C D;  4X3S A;  5FO9 B;  4KY5 A;  3X3N A;  3OIP A;  4OO1 I;  3IKJ A;  3I90 A;  4K5V A;  4RGM A;  4CKC A;  3HOX B;  4IFD I;  4A3K G;  2AHO B;  4HED A;  3OSO A;  3NHH A;  5JJK A;  4FF2 A;  5IGD A;  3CU7 A;  1EYC A;  1O7I A;  5KNC A;  1PVO A;  1QJO A;  2Z6K C;  1MHW C;  4EQ5 A;  2DJG C;  2RDG A;  4DV6 L;  1PTO H;  1QCB D;  2R7Z H;  1Y69 U;  1HRJ A;  2WIN B;  4BBS B;  4DNR B;  1IBL L;  2PZU A;  4ABN A;  4HIK A;  1KTK A;  2EQS A;  1EIH A;  1P8L A;  5BN4 A;  4A93 H;  2ZJQ A;  1SYF A;  1TY0 A;  2F03 A;  2Y0S E;  1O7L A;  1CA6 A;  3RZD B;  1I50 H;  4G7Z C;  1S5D D;  3NQI A;  1EWC A;  1E1T A;  3VR4 A;  2A69 D;  2NYZ D;  2X69 A;  3K7A H;  1QUQ B;  4HCS A;  4A75 A;  3FHW A;  2NBF A;  2MQH A;  3QWN A;  1SYD A;  5ELO A;  1G8Z D;  4MIU A;  1WD1 A;  4JI6 Q;  1XPU A;  2LS0 1;  1OXS C;  4LF5 L;  3GTG B;  1PH4 A;  2AQ1 B;  1QE6 A;  3OHX C;  5IYD G;  4A93 B;  4K0K L;  2ZTE A;  2VUM H;  2N49 A;  1KRT A;  1B3A A;  4YWM A;  3IRB A;  2PQA A;  1AP0 A;  3UE1 A;  1QB5 D;  4AQY L;  2X6G A;  5M5W B;  2F52 A;  1OTC A;  1EY0 A;  4KKU A;  1B4O A;  3ULJ A;  1AEX A;  4DV4 L;  4X65 L;  2MO1 A;  2Q2I A;  4ZUI A;  1X6O A;  3J7A F;  1VQ4 A;  2Z8L A;  1ZYR D;  2BE5 D;  1SJH D;  4IJL A;  1XYI A;  5C0X H;  1LT6 D;  1B50 A;  1B3Q A;  4APV A;  5EPJ A;  3S17 B;  4LF6 L;  4L6T B;  3EIV A;  5JVH 3;  1IYU A;  2IPK D;  1IZ6 A;  4A3M B;  3OTO L;  2F4V Q;  4FDB A;  2MFI A;  3KDF B;  2A6H C;  3PSI A;  3NSW A;  2CHB D;  2DUD A;  3H91 A;  2UXC L;  1HJP A;  1U0L A;  3GTQ B;  1SNM A;  1Z6H A;  4LWC A;  3RLO A;  5M5X H;  2R92 G;  4DV3 Q;  4DN4 M;  2I5M X;  4N8X 1;  4JV5 L;  1XMQ L;  1GD7 A;  2RSO A;  1E3P A;  2FIN B;  3V2T A;  2M9V A;  3F8T A;  3P1H A;  3PMF A;  1ILP A;  1PYW D;  1QIL A;  5IGB A;  4DV0 Q;  3ZYY X;  5LMN Q;  1VQN A;  4XYO A;  4L63 B;  1Q7Y C;  1QVC A;  1V1P A;  1SE8 A;  5FLX L;  1EWI A;  3E3X A;  4JW0 A;  2KEN A;  2NTS A;  1PMR A;  1T5X D;  3MFY A;  1U4L A;  2R6G A;  2VQE Q;  2KCM A;  3ONA B;  3G6E A;  4I65 A;  3TBI B;  4FXG C;  5IIF A;  4HMJ A;  1CK1 A;  1CA5 A;  1XX8 A;  1Q1B A;  5ELC A;  3ULP A;  3Q24 A;  1N33 L;  4DV7 Q;  4QQB X;  3ERS X;  2RDF A;  5K36 H;  2D9U A;  2C9O A;  2F3V A;  4YCU A;  3OW2 A;  2O5I C;  1AFP A;  1EY6 A;  1IXR A;  1AE3 A;  1NNX A;  4F7X A;  3PUW A;  4FYD A;  5HGQ A;  1A2T A;  2KUM A;  5ELN A;  2CW0 D;  2K5N A;  4GKK L;  3ER0 A;  4ULL A;  1V1P B;  4C3I H;  3KF6 B;  4G7H C;  4DXF A;  4ALP A;  2F3W A;  4KD4 A;  1F9Q A;  5FLM H;  2EIF A;  1Y1V B;  2RDH A;  5D65 A;  3CPF A;  1D5Z C;  4DR3 L;  1HNW L;  4G7O C;  3JAM c;  4MN3 A;  4WJ4 A;  5NUC A;  2VUM B;  2NN6 G;  2QKI C;  5IYB G;  1W6J A;  4DNT B;  4F8M A;  5LMN L;  3S16 H;  2F0F A;  2FHT A;  5D3I B;  1NJI C;  1TR5 A;  5M3F G;  5G3L F;  2XSC A;  3NPP A;  1K28 A;  4DR7 Q;  3K81 C;  1AW7 A;  4GOP B;  3E9I A;  2H1E A;  2KQ3 A;  1KDB A;  3HS0 C;  1E7Z A;  4EQN A;  1Z7T A;  1EZ6 A;  3VA7 A;  3TP7 A;  3FKI B;  2B29 A;  4IFD J;  1STB A;  2MGS A;  4KY7 A;  1VF7 A;  3R2T A;  4R1J A;  4YY3 L;  1PRT C;  4DR5 Q;  1MSG A;  1YHA A;  1PFN A;  1LTR D;  2EVB A;  2DGY A;  2QW7 A;  4BBR H;  1VQM A;  1I5F A;  3TQY A;  1A6X A;  1BOS A;  1HQM C;  3I4M B;  1Y1V G;  3KFU A;  1PZI D;  1K0S A;  2J7Z A;  1LTG D;  3KLS X;  1T5E A;  3EFX D;  2RHQ B;  5C6A A;  1XTC D;  1PRT F;  1Q81 C;  2UUB L;  2HQL A;  1EYG A;  1RIP A;  1GUT A;  1U9R A;  1SRO A;  4PZ7 A;  2V4D A;  3CRL C;  4A3M G;  3STB D;  2YU9 B;  1KXL A;  2AWO A;  4A3C G;  1VQB A;  1ZXT A;  3J7Z C;  3J80 E;  1PFM A;  1Q86 C;  4UY8 C;  3CC2 A;  1SYB A;  1HXY D;  3GO5 A;  5HUR A;  4GOP C;  1EQT A;  3D0F A;  4UDU C;  4LFA L;  1TWF H;  4BBR B;  4RCN A;  4CJ0 B;  3T53 B;  1WTX A;  2X6L A;  2UXB L;  1L1O C;  3TP5 A;  3PO3 B;  2VQF L;  1J5E Q;  1UE6 A;  1KAA A;  2VNU D;  1D1I A;  1D1K A;  2B3G A;  5IOC A;  3PF4 A;  2Z6K A;  4EVO A;  1VQA A;  4OHJ A;  3PO2 G;  1BBW A;  2HT1 A;  1SLJ A;  4X62 L;  2QEX A;  2K05 A;  2F0H A;  1HFN A;  3A5Z B;  1X32 A;  1K8A C;  4JI7 L;  1UWV A;  1F2Z A;  1VMC A;  5BN5 A;  3MVV A;  2RSN A;  3FPU B;  5K5P A;  4LF9 Q;  2JA8 B;  3QOJ A;  2A8V A;  3J80 L;  2OTL A;  3CCU A;  5T1G A;  2WAC A;  3TP8 A;  1YNN C;  2DN8 A;  3A0J A;  2LXK A;  1IKM A;  1GXD C;  5CV5 A;  1S5B D;  3TDQ A;  4N8F A;  1FD7 D;  2VB3 X;  4P75 A;  1PTO B;  4JC0 A;  3VYS A;  4LNQ A;  2FJ2 A;  2K6A A;  4JI2 Q;  1YJN A;  2BDO A;  2IL8 A;  3BYT B;  4X6A H;  5COR A;  3C1E A;  4KMU C;  1BF4 A;  4ZQ3 A;  3K57 A;  2ENB A;  4N9T A;  1H9M A;  4EQP A;  4LFB Q;  3DWP A;  1C9O A;  1Y8P B;  2R7F A;  4C1N K;  3K5L A;  4MTK A;  3O13 A;  3OMC A;  2GN5 A;  1J5E L;  2FXQ A;  4OWT B;  3OW7 A;  4FVM A;  3RNU A;  2OWO A;  4CKE A;  4IO9 A;  1NBW A;  4IUQ A;  1TT2 A;  3GTG H;  2TSS A;  4HIO A;  2DNE A;  2B2Y C;  1TWC H;  2CW0 C;  1QOH A;  2MJ8 A;  3I4N B;  4Y52 H;  1TWA B;  4C3J H;  4A3B B;  4DGZ A;  3S1M B;  4OWX B;  3BVG A;  4Z9C B;  1C4Q A;  3HZX A;  1B70 B;  3LGJ A;  1UEA B;  2UUA L;  4C3H H;  2KJX A;  3SE0 A;  1I94 Q;  1VQP A;  4POF A;  3NTI A;  3NUC A;  2VB2 X;  2PI2 A;  2A6E C;  4B3T Q;  5IT9 E;  1PH7 A;  2JP1 A;  2B63 G;  1LAB A;  2Q2T A;  3KUP A;  1HNX L;  4ZK9 B;  3N52 A;  1E2V A;  2JK8 A;  1J9O A;  3CPW A;  1SYC A;  4IFD H;  5GAE C;  4RKL A;  2F0I A;  2AKW B;  1EY9 A;  3IAY A;  4PG3 A;  2VS1 A;  1Y1W B;  4L5R C;  1PLF A;  3GTQ H;  2PO4 A;  1JT8 A;  2QF7 A;  3PUV A;  4WRD A;  2I46 A;  3R2I A;  1MBY A;  4JOI A;  4ME3 A;  1XJV A;  3EBE A;  4QL5 A;  2RF4 A;  4L5S A;  3HGB A;  4OWW B;  1NMF A;  1VQI A;  3BVZ A;  2B2U A;  1DON A;  3HOZ B;  2ZM6 L;  1BCP D;  1UE7 A;  3HEJ A;  3RN5 A;  2YU9 H;  4IAL A;  1JOR A;  1L0X B;  1YZ6 A;  4JI3 L;  5IWA Q;  2MPM A;  3AU7 A;  3PGZ A;  3NXW A;  1Q1E A;  3K0X A;  2EYH A;  3OOC A;  3FEW X;  4A3M H;  3S2H H;  2B2T A;  4S3S A;  2K1B A;  4V19 0;  1PRT D;  4A3C H;  4A3G H;  1NY4 A;  4R4Q A;  4YWL A;  5C5L A;  1YNX A;  1LAC A;  3CC4 A;  1NCV A;  2K52 A;  2SOB A;  4ILW A;  4FO2 A;  5FLX E;  5CGK A;  5M3F H;  3P75 A;  3LWE A;  1FYC A;  1NAP A;  1VQ9 A;  5AFW A;  4LF5 Q;  4BA2 I;  1Y8O B;  5C4X B;  2JEB I;  3EN2 A;  1KAB A;  1FGU A;  1HUM A;  3NBH B;  4JYA L;  2MHV A;  3A74 A;  3S1Q H;  4R4I A;  4GNX C;  4DPG A;  2D2C C;  1QUQ A;  4F87 A;  1LTL A;  2F4I A;  2ZXO A;  1Q46 A;  1WTH A;  2JA6 G;  4DV1 Q;  5KRU A;  1P16 A;  2A74 C;  3DWQ A;  1E2W A;  4X65 Q;  1IBM L;  2CWP A;  3GV6 A;  2NVY B;  1PTO D;  2Y0S B;  1L0W A;  4DUY Q;  2AUK A;  2K04 A;  2XVS A;  4XYQ A;  1N32 L;  1RTN A;  1LUZ A;  3HFZ B;  1I4X A;  1Y14 B;  2XNA C;  1MKH A;  3L0O A;  4CKB A;  3S1Q B;  3J81 c;  3H09 A;  4JI0 L;  4DAY B;  3Q0A A;  4LF6 Q;  2L15 A;  1A3T A;  1JIC A;  4B3S L;  2L5T A;  1VQE A;  5J22 A;  2R93 G;  1W3S A;  3WOE A;  5C44 B;  1ESR A;  3TZD A;  4NXM Q;  1EU4 A;  4DR6 Q;  3OIQ A;  3AMU A;  1AN8 A;  1ASZ A;  2ASB A;  1D2B A;  4PMB A;  1SNC A;  1CKO A;  3H6M A;  5M5Y H;  2K32 A;  5J3B A;  1G2T A;  3RZO B;  1LTT D;  3H3V C;  3H3V I;  5AJ3 Q;  3VR2 A;  4DNI A;  1VQD A;  4DAV A;  5C0X I;  3DXJ C;  2HIV A;  3QO2 A;  1B53 A;  1GUG A;  1Y1V H;  3FRP B;  2K75 A;  1PDQ A;  4P71 A;  4DV0 L;  5I6W A;  1G29 1;  1G6Z A;  5HGT A;  2AWN A;  1QNK A;  5C44 H;  4DUZ L;  3S17 H;  1D5X C;  1DJR D;  1XNQ Q;  3I4N G;  4IOA A;  1UAP A;  4XTC S;  4YHH Q;  4KHZ A;  2XIW A;  1PYS B;  2QGQ A;  1WTO A;  3SVM A;  3CMA A;  4JPB W;  2RVL A;  5CMD A;  2L55 A;  2K03 A;  5ELF A;  1EQQ A;  4BY1 B;  5ELB A;  3EJI A;  3NTK A;  2ALY B;  2Q2H A;  5LL6 X;  1VQG A;  4RGN A;  5CYU A;  2Q8I B;  3JAM E;  4V0B A;  3UDG A;  4H02 A;  3QG1 A;  2JQO A;  1HA5 A;  1KIX A;  5JOB A;  4WOR A;  1YNJ D;  2OQ0 A;  1ZYR C;  4UPA A;  2UU9 Q;  1VQK A;  4GKJ Q;  3S2H B;  2XN9 C;  4RH6 A;  1CT1 D;  2H5X A;  2MO0 A;  4NXM L;  4DR6 L;  3C1F A;  2F0K A;  4OL7 A;  1SE3 A;  5EAY A;  3TRZ A;  5D3D A;  4OX9 L;  1VQC A;  3TEH B;  4BY1 H;  1G6P A;  5I4D A;  1K8M A;  3D4W A;  3DMU A;  2HQE A;  2K5H A;  1UUP A;  3HOW H;  1A15 A;  4OGQ C;  4DR1 Q;  3BDO A;  4DK6 C;  3I2Z A;  4IUU A;  2SEB D;  4DR3 Q;  5E4X A;  4P2C B;  1TWF B;  4GN3 B;  2A68 C;  3PIP A;  1WJJ A;  4C3I B;  1D6E C;  3G48 A;  1CSQ A;  3M4Y A;  1I3Q H;  4HIM A;  1SE2 A;  3T51 B;  1RD9 D;  1TS3 A;  5C4J B;  1LT3 D;  4K0K Q;  4TSS A;  1PZJ D;  1ICW A;  3D6W A;  4BY1 G;  4YHH L;  3QJY A;  1NR2 A;  1VQ7 A;  4XXE A;  3PCO B;  3L9A X;  3W2D A;  1IHZ A;  3CD6 A;  1H9R A;  3B6Y A;  5G3L D;  1A63 A;  2NN6 I;  2QEJ C;  1HFG A;  3M85 A;  1IW7 D;  4RWS C;  1GUW A;  5COY A;  3RD4 A;  1HR0 W;  2VUM G;  5E4W C;  4YWK A;  1WCM B;  1H9J A;  1L0Y B;  3A5U A;  3DEO A;  5E1F A;  4JI4 L;  1M90 C;  2ZXP A;  4GS3 A;  5JJZ A;  3SK8 A;  1A3V A;  4RHS A;  1WI5 A;  1A2U A;  4GKJ L;  1BCP B;  3ND9 A;  4BBR G;  5LHY 1;  3CCM A;  1AE2 A;  4WFN 3;  3CXC A;  2UUB Q;  3JAM L;  2E2H H;  2F4V L;  4AIM A;  3E5S A;  3IL8 A;  1EIG A;  4WJW A;  2CKZ B;  1GUN A;  4A3I H;  4MZ9 A;  5CV6 A;  5M3M B;  2B2W A;  1ICF B;  4NDX A;  4A3K B;  3QIA A;  5LMU L;  4DV3 L;  1S5E D;  1KAW A;  4JV5 Q;  2EYO A;  3N6R A;  5C44 G;  3K80 C;  1SMY D;  1KC8 C;  3K6O A;  1STA A;  3Q8D A;  4XQN A;  3MFG A;  2VQF Q;  2F0S A;  1PH3 A;  2KHJ A;  3GTJ H;  4MNO A;  2PMZ E;  3W1G A;  1UE5 A;  3A54 A;  1CZG A;  1HNZ Q;  4K14 A;  3VYT A;  4RFB A;  3M4P A;  5KGU A;  4NPS A;  1I6V C;  1V1Q A;  2VL6 A;  1X54 A;  1YNN D;  3NBH A;  2MP1 A;  3DHQ A;  4JI8 L;  2QA4 A;  1EFW A;  1SYE A;  5IY0 A;  1PH9 A;  1W2B A;  1O7Y A;  4HJ5 A;  3RZO H;  3GTP H;  2E2J H;  2A6E D;  1N33 Q;  4JI7 Q;  3T1Y L;  2KCC A;  1VMP A;  1SE4 A;  1FL0 A;  3FP9 A;  2NN6 H;  1VQF A;  3BZD B;  2E2I H;  3MC0 B;  2B39 A;  5IT9 L;  1HH2 P;  4K2L A;  1K3B C;  1BUV T;  4IN3 A;  1KNE A;  1BO0 A;  1ONL A;  3S1R H;  2PW7 A;  5EJW A;  5ISR A;  2ZJR A;  4DAY A;  4QF4 A;  2PZT A;  1K3R A;  1TWG B;  4GNX A;  3Q22 A;  3IFD A;  4ZKC B;  4DKA C;  3PQI A;  4JBJ A;  1IBK Q;  4LJZ C;  4IPG A;  3HOV B;  4RHR A;  4DA2 A;  1K83 B;  4XQQ A;  4GN4 B;  2C5C A;  2DNC A;  3OPO A;  2UUC L;  4P72 A;  2OEO A;  1TS2 A;  1I4R A;  4H0L C;  2UXC Q;  1K8O A;  5E7N A;  1FGB D;  1JOK A;  4KD3 A;  4KY6 A;  3K5M A;  4GNX B;  1ESF A;  1HNW Q;  4O42 A;  4DAM A;  1N9W A;  3CF5 A;  2IX0 A;  2R93 B;  1JJG A;  1CKM A;  2KEE A;  3NK9 A;  3HOY G;  2K5D A;  5CV7 A;  2CCZ A;  3HKZ B;  3VR5 A;  2R7D A;  1PH1 A;  3G6J B;  4J8Q A;  1HCZ A;  1YJ9 A;  4K8I A;  3PIP 3;  1R4Q B;  5EPK A;  1YI2 A;  4LW1 A;  5ELD A;  1CKN A;  4JI5 L;  1LTS D;  3CCR A;  4B9W A;  3I7F A;  3NBI A;  1HQR D;  5DM7 3;  1JR0 D;  2M00 A;  5GAG C;  1PTO F;  2Y0S G;  2IX3 A;  4ZKB B;  2VQE L;  2J4X A;  3CCQ A;  5KND A;  3I72 A;  3CW2 C;  4M8A A;  3LWU A;  3J81 E;  4KKS A;  1STE A;  4DR5 L;  1DZ1 A;  3J80 c;  5JAV A;  4BY7 H;  2WKD A;  2WV6 D;  1X9N A;  2B8G A;  4F88 A;  3BDL A;  3KLW A;  5LMN W;  1HTL D;  2F0V A;  5M3M H;  4LF8 L;  3BDC A;  3H3V H;  4B3T L;  5DM6 3;  1SBB B;  3HG9 A;  5DLQ E;  4HJ8 A;  1EIF A;  2HCC A;  1F2Y A;  2YTX A;  3BYY B;  1IYV A;  3GQB A;  5IYB H;  5IP9 G;  1EL0 A;  3PF5 A;  4DU9 A;  1YVC A;  3PO2 H;  5J39 A;  1S5F D;  1O78 A;  4A3L H;  1PV4 A;  1TWA H;  1CM9 A;  2JXM B;  4HR7 B;  5C3E B;  4DV2 L;  4GLV B;  2JA8 H;  3WDN A;  2SNS A;  1TII D;  4A3J G;  1U4P A;  4A4I A;  2ZXR A;  2XWB B;  3F2D A;  1HZB A;  1E24 A;  1TS5 A;  1WTW A;  2WKC A;  4FF4 A;  2J0T D;  2VXW A;  5K36 G;  1D7Q A;  4ZUJ A;  2IHE A;  3V05 A;  3S9W A;  1EY7 A;  3IFT A;  4MHE A;  2K14 A;  5DNF A;  2BA0 A;  3BVM A;  1Q8I A;  4JI5 Q;  3TRE A;  2HUG A;  2ZJP A;  3MXG A;  5FO7 B;  1KHI A;  3A56 A;  1HR0 L;  4X3K A;  1B9M A;  3KBG A;  1AZP A;  3TS2 A;  1SN8 A;  1YIT A;  3I73 A;  4OON A;  3FKI G;  2R7Z G;  2A5H A;  3PIO 3;  5IGG A;  2E2H B;  1XTD A;  2D62 A;  3C2P A;  4JBK A;  1LT5 D;  4LF9 L;  5T1I A;  3T13 A;  1I4P A;  5IE8 A;  4CHT B;  3CCV A;  3I4M G;  4LUO A;  4RG1 A;  2Q8T A;  4X3T A;  1MJE A;  1N36 Q;  2WB1 B;  3MA2 B;  2F0G A;  2E75 C;  4QUC A;  1LV9 A;  1RTO A;  2PQA B;  2L1B A;  2XTI A;  4JYA Q;  2N88 A;  3A7A B;  1YIJ A;  1U5K A;  3LNN A;  4C1N I;  3PUY A;  4I7Z C;  4AYB G;  3BG3 A;  4PZ8 A;  1SXT A;  5A35 A;  1HZA A;  2JEA I;  1M8A A;  3FDT A;  3HOU G;  3J7A 5;  1K0R A;  1RF2 D;  2DJF C;  3I91 A;  4POG A;  3NEN A;  4DV2 Q;  2A69 C;  2HDL A;  2EJF C;  1MSH A;  1HTP A;  3CC7 A;  4U68 A;  1IBM Q;  4IQZ A;  4FNF A;  3E0J A;  3ERO A;  4FP5 D;  1Z9F A;  4BY7 B;  4GZY C;  1ML0 D;  1TWH H;  3PUX A;  1F2L A;  2XGT A;  3GTM B;  2B63 H;  4UP9 A;  3C3L A;  1CKN B;  4BXX H;  4GN5 A;  5E3F A;  2UXB Q;  1EOT A;  2Z4I A;  5FJ8 G;  4DV5 L;  3S1N H;  1C0A A;  1VQ5 A;  2WB1 E;  1KLU D;  2LMC B;  4IUV A;  5KNB A;  4KHP Q;  4J6H A;  4HMI A;  1B1Z A;  1HUN A;  4JI0 Q;  3BZK A;  1SFO H;  1EYA A;  4H13 C;  4DK0 A;  2BOS A;  4OO1 G;  4JI1 Q;  2KCN A;  4IFD G;  1GKH A;  5BR8 L;  3QR8 A;  1XNR L;  3TME A;  1I4G A;  3EA6 A;  5EKL A;  2JE6 I;  4YCW A;  2ICI A;  3CQZ H;  5M3M G;  5C0X G;  1TXY A;  1RL2 A;  3U9O A;  3S14 B;  1X3F A;  2PI2 E;  1X3P A;  1EZ8 A;  1TVX A;  3HP3 A;  5FJ8 H;  4HJ7 A;  4ZLT F;  2LXJ A;  1NUC A;  3SHL A;  1WOC A;  4JCV E;  4TVA B;  5GQO A;  1CTM A;  2VZA A;  3KOJ A;  3J81 L;  2KOL A;  4X3U A;  3JAM i;  2PW5 A;  4R4O A;  1Q3L A;  4HSV A;  3L7Z C;  1X3Q A;  3A8J E;  4CJ1 B;  2EE1 A;  3HKZ E;  3CQZ B;  2KCT A;  3CCJ A;  4ID6 A;  5I9O A;  2B2T C;  2AQ3 B;  4R4C A;  1XPR A;  3WOF A;  2D5D A;  1SRU A;  4B3M Q;  2WAQ G;  3I4N H;  1WFQ A;  2TMP A;  3RR5 A;  1KD1 C;  4A3F G;  5A2Q E;  3RZD H;  4RGT A;  4B3R Q;  2NUC A;  4LFB L;  2PPB C;  4L5Q A;  4X66 L;  1XWE A;  1MGS A;  3CHB D;  4B9X A;  2A19 A;  1ENF A;  3AFQ A;  2HHH L;  3DM1 A;  3KF6 A;  2XWJ B;  1ZEQ X;  2KVM A;  2ZM6 Q;  3AYH B;  1VS0 A;  4H7B A;  3UDX A;  2CWA A;  3MTS A;  2OQK A;  1GUO A;  4OEM B;  5GAH C;  5JPN C;  4JI1 L;  2Q2U A;  4EQO A;  5BR8 Q;  1IL8 A;  5C3E H;  1M1K C;  4UP7 A;  4C3H B;  3KLR A;  2FMM A;  2IJ0 A;  3T1H L;  2E2I B;  4FF1 A;  3PUZ A;  5CBA E;  2EYJ A;  4A3E B;  2NZO A;  4MTN A;  3H15 A;  3QB3 A;  2K28 A;  4DR1 L;  2I5L X;  3SDZ A;  4A3K H;  1Z47 A;  3M9B A;  2UUA Q;  1S40 A;  3VA5 A;  2C35 B;  4DK3 C;  2PQE A;  1U4R A;  3FPP A;  2EOT A;  1OXV A;  3HOX G;  1XMO L;  3J80 i;  3U4Z A;  1EIY B;  2BH8 A;  2A68 D;  1KL9 A;  1QVF A;  4FXD A;  4TKO B;  2Q8R E;  1BDO A;  2ZTC A;  1TWG H;  4HCE A;  4A3B G;  4A76 A;  3BJU A;  2OT2 A;  1ET6 A;  4O0A A;  1A8V A;  3I70 A;  5EQ0 A;  2B63 B;  3H0G B;  3H94 A;  1QWY A;  4A3L G;  3RLF A;  4QMG A;  2QCP X;  2PZW A;  3S24 A;  1JE5 A;  2BA1 A;  4BBS G;  2HHH Q;  3MXP A;  4R4T A;  3GTL H;  3G7L A;  3AQQ A;  3I4O A;  3MHB A;  1WVL A;  2E5L Q;  3NE5 B;  1QZG A;  5IYC H;  3E0E A;  1SDF A;  1NR4 A;  3I4M H;  3R93 A;  4IUP A;  5C4J H;  3ICE A;  4B3S Q;  5IYD H;  2NTT A;  2EXD A;  2Z9H A;  1X3E A;  3T4A C;  1F2M A;  1CHQ D;  3GTO H;  1WCM H;  1F9P A;  3AFP A;  1M4V A;  1YNJ C;  3NEM A;  3KJO A;  5LMU Q;  1QNU A;  2NVX H;  1ASY A;  1NSN S;  1DCZ A;  4A3I G;  1NE3 A;  3T16 A;  3D31 A;  4BBS H;  2PNH A;  2PCF B;  3F2B A;  1EQV A;  3CCS A;  4J15 A;  3KF8 A;  5CV4 A;  1SNQ A;  3U58 A;  1BBX C;  2OF1 A;  1H95 A;  3RMH A;  2K5W A;  3EQL C;  1VQ6 A;  2AMC B;  1XMO Q;  1OXU A;  1A62 A;  4A3E G;  3J81 i;  1G51 A;  4C2M H;  2F0O A;  4OEL B;  4DAP A;  2HD3 A;  4CDD C;  4AQY Q;  1KDC A;  2E2D C;  2HCI A;  4JI8 Q;  1LTA D;  4A3I B;  5EBC A;  4C3J B;  1IL2 A;  4IUT A;  4G4K A;  4OXP A;  2I07 B;  3S1M H;  1MJC A;  2K5Q A;  3KK7 A;  5M5Y B;  3P7J A;  3S15 B;  1BQQ T;  5GRO A;  4KI0 A;  1VQL A;  3W5O A;  3GTK H;  2R61 A;  1RJT A;  1STY A;  5D14 A;  3OWF A;  3PO3 G;  4P73 A;  1J6Q A;  1LO5 D;  1J8I A;  1VF5 C;  2E5L L;  3S2D H;  4HN7 A;  1HZC A;  1YHQ A;  1PZK D;  3VR6 A;  1GJX A;  4RKB A;  5EKI A;  4PMC A;  3F2U A;  1GHK A;  4UAI A;  4A3E H;  2A73 B;  3A7L A;  4DV6 Q;  5IT9 c;  1IBK L;  4QCL A;  4IOC A;  1GUS A;  1B44 D;  1STH A;  3CAM A;  1IBL Q;  5KEE A;  2PMZ B;  1U4M A;  1UNS A;  1UEB A;  2CVR A;  1VCI A;  1C8C A;  2EJG C;  4IZ8 A;  3KLS A;  3BS1 A;  3A8K E;  4RAU C;  3TP6 A;  1OXX K;  2K33 A;  1JWU D;  3SEB A;  4P74 A;  1HPC A;  2L9H A;  4RGO S;  1CQV A;  2N3S A;  4PNY A;  5AJ3 L;  2NZH A;  4C3H G;  3CCE A;  4DF7 A;  1Q12 A;  4HAE A;  3UDF A;  4R8N A;  2WII B;  4KK7 A;  3A55 A;  1XPO A;  3HOY H;  1XXG A;  3DM3 A;  1SJE D;  1TKW B;  2Z6B A;  2JN4 A;  3GTL B;  2A1A A;  4L8J A;  1N8R C;  2YTV A;  2JA5 H;  1GHJ A;  3H0G H;  4BA1 I;  3KDF A;  4LF4 L;  4KKT A;  5IOD A;  2UXD L;  1ZKO A;  4ODG A;  1WTP A;  4Q0F A;  2B2W C;  2I0Q A;  1GOZ A;  3NWS A;  2JJQ A;  1TWH B;  1QG7 A;  1VQ8 A;  3HOZ H;  3GD7 A;  4HJ9 A;  2H4O A;  1V1O A;  3NTH A;  4XDX A;  1JJ2 A;  1HHV A;  2SDF A;  2JA6 B;  4JVZ A;  1G2S A;  5L37 A;  1FR3 A;  1EY5 A;  1LLR D;  1RKN A;  2N8N A;  2XRQ D;  1SEB D;  3SXH A;  2KBN A;  3BU2 A;  4NB3 A;  1VQH A;  2L12 A;  3U9S A;  5FO8 B;  3MAQ A;  1PXU A;  2R92 H;  1BR9 A;  3HOV G;  1ET9 A;  2RBM A;  2UU9 L;  3TN2 A;  4OO1 H;  2PNR C;  2BCO A;  4A3B H;  3HOU B;  3DEP A;  3DLL A;  2EYF A;  4TRD A;  1VDZ A;  3OTO Q;  1TQO A;  4DK1 A;  3ULL A;  1A0I A; 
#chains in the Genus database with same CATH homology
 5M3F B;  1F9S A;  1OO9 B;  3VYR A;  3UI2 A;  4QIW B;  1R9T B;  2F0W A;  4E6I A;  5C3W A;  5FKA C;  3MEH A;  2R92 B;  2CQA A;  1DM0 B;  4KTA A;  1WTR A;  5EGT A;  4KN7 C;  5LL6 S;  4FF3 A;  3GTO B;  5ELE A;  2O4X A;  5A2Q L;  5EBD A;  1ILQ A;  3ERQ A;  1V43 A;  1I4Q A;  2EXZ A;  1I50 B;  4OIJ A;  4KJO A;  3QOL A;  5C4H A;  2BDN A;  5I2Y A;  5M5X B;  3GV3 A;  3D6C A;  3DWA A;  2G9H D;  3I8Z A;  1EY8 A;  1MD2 D;  3R3O A;  2F0U A;  1EFI D;  3K7A B;  1EYD A;  3I3C A;  3X3M A;  4KV6 A;  4K5W A;  3AB9 A;  3R8B A;  2EYM A;  4A3F B;  3GTK B;  3D4R A;  2LFN A;  1SYG A;  3FVQ A;  2EYP A;  4BS9 A;  2L11 A;  2B2U C;  5JEA G;  1W6K A;  4JK1 C;  1JC7 A;  3CRK C;  1EU3 A;  2QIL A;  4XQJ A;  1H9S A;  4JBW A;  1TY2 A;  1SAP A;  4C3I G;  4QB4 A;  2F0T A;  3RUZ A;  3SR1 A;  1CZW A;  1JWS D;  3OMG A;  1DOM A;  5I9P A;  4QUF A;  4XIG S;  4XT3 B;  2IX1 A;  1WTV A;  4NKL A;  2EY5 A;  1SNO A;  1O7Z A;  2GA4 B;  1R4P B;  3MXU A;  4K8J A;  4O1N A;  5EKK A;  1I3Q B;  3S1N B;  1I6H B;  5C3X A;  2JYO A;  4CBV A;  2B2Y A;  3D8G A;  2KEC A;  1IKL A;  4A3J B;  1B2T A;  3CKI B;  3J7Y W;  4R8I A;  2RA4 A;  2JA5 B;  5JPM C;  5IGF A;  3GP7 A;  2IT1 A;  5CC4 A;  1II3 A;  3J7A V;  4PQX A;  3M7G A;  3E6Z X;  3VYU A;  4Q5V A;  4KN4 C;  5IGC A;  1IW7 C;  4OIK A;  4EGV A;  3TSS A;  4LAA A;  5CR3 A;  1H9K A;  1STG A;  1ENA A;  3URY A;  5CV9 A;  4NP5 A;  3NP8 A;  4J1M A;  3M3Y B;  5C5M A;  4K2K A;  2R7Z B;  2EY1 A;  1EWH A;  2F0E A;  1F77 A;  2L4N A;  5M9O A;  4M1U B;  4FXK C;  2XRS D;  3P20 A;  3VR3 A;  2EYL A;  1OXT A;  3KBX A;  4CJ2 C;  3S16 B;  2NWG A;  1CQF A;  1E0B A;  1JOO A;  1WTQ A;  1CFM A;  2YYZ A;  4IUN A;  1Y8N B;  3D3R A;  3ITP A;  1C48 A;  3SK5 A;  3T56 B;  2K7V A;  4A3D B;  2F1M A;  2WP8 J;  3Q23 A;  4HTH A;  3M4O B;  5JEA H;  3NWT A;  2F0D A;  3HOW B;  1DYQ A;  1O80 A;  1LT4 D;  1DXM A;  1SND A;  1AZQ A;  3Q6S A;  4ZYS A;  5DAU A;  1BXT A;  1FNW A;  1MI2 A;  2ICE C;  1JWM D;  2B2V C;  1BCP F;  4H44 C;  4LK1 C;  2EPB A;  2O2L D;  2WAQ B;  3SK6 A;  4LMQ D;  3GTP B;  2B8F A;  2HDM A;  2M2L A;  3S1R B;  2EZV A;  2FMC A;  1B9N A;  5C0X J;  2AUJ D;  4CGY B;  1KDA A;  4R9W A;  2DY7 A;  1KNA A;  5KYI A;  3DUZ A;  2IWH A;  4C56 C;  5CV8 A;  4BWG B;  3MXN A;  2RKS A;  3K5N A;  1JQY D;  2NVT B;  5C4Z A;  1TU2 B;  2O5J C;  1CHP D;  4KHV A;  5FOB B;  1JE4 A;  1JOQ A;  2Z4H A;  3PV0 A;  1SNP A;  1RCV D;  2EJM A;  2QDB A;  2EDG A;  5JVG 3;  2F0M A;  4ZRZ A;  5CBE E;  3HOY B;  1ROD A;  3D4D A;  4HSP A;  3K59 A;  5DEH A;  1CI3 M;  1LTB D;  5I6Y A;  2KA7 A;  2E74 C;  3HRZ C;  1HA6 A;  2NVX B;  1PFB A;  4K6L A;  3LX0 A;  3GTJ B;  1H9S B;  4Y7N B;  5KYL A;  4N9P A;  4YIJ A;  2LY7 A;  3FMC A;  1LTI D;  2FFK B;  1WD0 A;  4NW2 A;  4ZAI A;  1KLG D;  4U67 3;  4C2M B;  2N55 A;  3L3O C;  1STN A;  2A6H D;  4DXG A;  4K5X A;  2JSO A;  2IW3 A;  3C46 A;  4IUR A;  3MWY W;  1TS4 A;  2F0Q A;  3K0Y A;  2MUY A;  1RDP D;  4RCO A;  2KED A;  5TSS A;  1D5M C;  2ZT9 C;  1JB3 A;  5J1Z A;  2L0C A;  1ENC A;  1FNU A;  2BE5 C;  2NB0 A;  4KJN A;  3V96 A;  1RHP A;  3NQT A;  5JEA J;  3SK4 A;  3K5O A;  4NMZ A;  1A3U A;  2EY6 A;  3K58 A;  2R3Z A;  3I4L A;  2E76 C;  4B08 A;  4C3J G;  5I2X A;  1V8Q A;  2NZ1 D;  1DOL A;  5KIX A;  2ID0 A;  1E2Z A;  1DOK A;  3EVQ A;  3MZ5 A;  5F2D A;  1TWC B;  4TQU S;  1I4H A;  4A3G B;  2E2J B;  3OWE B;  4PMW A;  4DFA A;  2DY8 A;  5EPL A;  1G91 A;  5FK9 C;  4PV1 C;  2K01 A;  2JA7 B;  5BN3 A;  2F0J A;  1F9R A;  3M7N A;  2B2V A;  1PRT B;  3A8I E;  1PTO C;  1EY4 A;  1S4Z A;  2EY2 A;  2SNM A;  3TZU A;  1BCP C;  2F0N A;  1Q90 A;  3W3A A;  4G57 A;  1EEF D;  2LKV A;  4ME5 A;  4K6D A;  4XT1 B;  3S2D B;  2KHS A;  3ND8 A;  2G9D A;  1JCK B;  2OXP A;  2RQX A;  2F0L A;  1FNV A;  2PYK A;  1EEI D;  1SMY C;  3PO2 B;  5IGE A;  1SFO B;  1SSO A;  1DD2 A;  4RA8 A;  2NVQ B;  2AQ2 B;  1BNZ A;  2Z1C A;  2F0P A;  1S5C D;  4X3S A;  5FO9 B;  4KY5 A;  3X3N A;  3OIP A;  4OO1 I;  3IKJ A;  3I90 A;  4K5V A;  4RGM A;  4CKC A;  3HOX B;  4IFD I;  4HED A;  3OSO A;  3NHH A;  4FF2 A;  5IGD A;  3CU7 A;  1EYC A;  5KNC A;  1QJO A;  2RDG A;  1PTO H;  1QCB D;  1Y69 U;  1HRJ A;  2WIN B;  4BBS B;  4DNR B;  2PZU A;  4ABN A;  1KTK A;  1EIH A;  5BN4 A;  1SYF A;  1TY0 A;  2F03 A;  1O7L A;  1CA6 A;  3RZD B;  4G7Z C;  1S5D D;  3NQI A;  1EWC A;  3VR4 A;  2A69 D;  2NYZ D;  2X69 A;  4HCS A;  2NBF A;  3QWN A;  1SYD A;  1G8Z D;  4MIU A;  1WD1 A;  2LS0 1;  1OXS C;  3GTG B;  2AQ1 B;  1QE6 A;  3OHX C;  4A93 B;  1B3A A;  1AP0 A;  1QB5 D;  2X6G A;  5M5W B;  1EY0 A;  1B4O A;  4KKU A;  1AEX A;  4ZUI A;  3J7A F;  2Z8L A;  1ZYR D;  2BE5 D;  1SJH D;  1XYI A;  5C0X H;  1LT6 D;  1B50 A;  5EPJ A;  3S17 B;  4L6T B;  5JVH 3;  1IYU A;  2IPK D;  4A3M B;  2A6H C;  2CHB D;  3NSW A;  3H91 A;  3GTQ B;  1SNM A;  1Z6H A;  4DN4 M;  2RSO A;  2FIN B;  3V2T A;  2M9V A;  3P1H A;  3PMF A;  1ILP A;  1PYW D;  1QIL A;  5IGB A;  3ZYY X;  4XYO A;  4L63 B;  1V1P A;  5FLX L;  2NTS A;  1PMR A;  1T5X D;  3MFY A;  1U4L A;  2R6G A;  3ONA B;  4I65 A;  3TBI B;  4FXG C;  5IIF A;  4HMJ A;  1CK1 A;  1CA5 A;  1XX8 A;  1Q1B A;  5ELC A;  3Q24 A;  2RDF A;  5K36 H;  2D9U A;  2C9O A;  2F3V A;  2O5I C;  1AFP A;  1EY6 A;  4F7X A;  3PUW A;  4FYD A;  1A2T A;  2KUM A;  2CW0 D;  4ULL A;  1V1P B;  4G7H C;  4DXF A;  2F3W A;  4KD4 A;  1F9Q A;  1Y1V B;  2RDH A;  5D65 A;  1D5Z C;  4G7O C;  4MN3 A;  5NUC A;  2VUM B;  2NN6 G;  2QKI C;  1W6J A;  4DNT B;  4F8M A;  2F0F A;  2FHT A;  5D3I B;  1TR5 A;  5G3L F;  2XSC A;  3NPP A;  1AW7 A;  2H1E A;  2KQ3 A;  1KDB A;  3HS0 C;  4EQN A;  1Z7T A;  1EZ6 A;  3VA7 A;  3TP7 A;  3FKI B;  4IFD J;  1STB A;  2MGS A;  3R2T A;  1VF7 A;  4KY7 A;  1PRT C;  1MSG A;  1PFN A;  1LTR D;  2EVB A;  1A6X A;  1BOS A;  1HQM C;  3I4M B;  1PZI D;  2J7Z A;  1LTG D;  1T5E A;  3EFX D;  3KLS X;  5C6A A;  1XTC D;  1PRT F;  1GUT A;  1U9R A;  2YU9 B;  2V4D A;  3CRL C;  2AWO A;  1ZXT A;  3J80 E;  1PFM A;  1SYB A;  1HXY D;  3GO5 A;  5HUR A;  1EQT A;  4UDU C;  4CJ0 B;  4BBR B;  4RCN A;  3T53 B;  1WTX A;  2X6L A;  3TP5 A;  3PO3 B;  1KAA A;  2VNU D;  1D1I A;  1D1K A;  5IOC A;  4EVO A;  4OHJ A;  2K05 A;  2F0H A;  1HFN A;  1X32 A;  1F2Z A;  1VMC A;  5BN5 A;  3MVV A;  5K5P A;  2RSN A;  3FPU B;  2JA8 B;  3QOJ A;  3J80 L;  5T1G A;  2WAC A;  3TP8 A;  1YNN C;  2DN8 A;  1IKM A;  1GXD C;  5CV5 A;  1S5B D;  3TDQ A;  1FD7 D;  2VB3 X;  1PTO B;  3VYS A;  2FJ2 A;  2K6A A;  2BDO A;  2IL8 A;  3BYT B;  5COR A;  3C1E A;  4KMU C;  1BF4 A;  4ZQ3 A;  3K57 A;  2ENB A;  4N9T A;  1H9M A;  4EQP A;  3DWP A;  1Y8P B;  4C1N K;  3K5L A;  3O13 A;  3OMC A;  3OW7 A;  4FVM A;  4CKE A;  4IUQ A;  1TT2 A;  2TSS A;  2DNE A;  2B2Y C;  2CW0 C;  1QOH A;  2MJ8 A;  3I4N B;  1TWA B;  4A3B B;  4DGZ A;  3S1M B;  3BVG A;  4Z9C B;  1C4Q A;  3HZX A;  1UEA B;  2KJX A;  3SE0 A;  3NTI A;  3NUC A;  2VB2 X;  2A6E C;  5IT9 E;  2JP1 A;  1LAB A;  3KUP A;  4ZK9 B;  3N52 A;  1E2V A;  1J9O A;  1SYC A;  4IFD H;  4RKL A;  2F0I A;  1EY9 A;  3IAY A;  1Y1W B;  1PLF A;  2PO4 A;  2QF7 A;  3PUV A;  4WRD A;  2I46 A;  3R2I A;  1MBY A;  3HGB A;  3BVZ A;  2B2U A;  1DON A;  3HOZ B;  1BCP D;  3HEJ A;  4IAL A;  1JOR A;  1L0X B;  2MPM A;  3AU7 A;  3NXW A;  1Q1E A;  2EYH A;  3OOC A;  3FEW X;  2B2T A;  4S3S A;  2K1B A;  4V19 0;  1PRT D;  5C5L A;  1LAC A;  1NCV A;  2SOB A;  4ILW A;  4FO2 A;  5CGK A;  5FLX E;  3P75 A;  3LWE A;  1FYC A;  1NAP A;  5AFW A;  4BA2 I;  1Y8O B;  5C4X B;  2JEB I;  1KAB A;  1HUM A;  2MHV A;  2D2C C;  4F87 A;  2F4I A;  2ZXO A;  5KRU A;  2A74 C;  3DWQ A;  1E2W A;  3GV6 A;  2NVY B;  1PTO D;  2Y0S B;  2AUK A;  2K04 A;  2XVS A;  4XYQ A;  1RTN A;  1I4X A;  2XNA C;  4CKB A;  3S1Q B;  3H09 A;  3Q0A A;  1A3T A;  1JIC A;  2L5T A;  5J22 A;  3WOE A;  5C44 B;  1ESR A;  3TZD A;  1EU4 A;  3OIQ A;  3AMU A;  1AN8 A;  1D2B A;  4PMB A;  1SNC A;  3H6M A;  2K32 A;  1G2T A;  3RZO B;  1LTT D;  3H3V C;  3VR2 A;  4DAV A;  5C0X I;  3DXJ C;  3QO2 A;  1B53 A;  1GUG A;  3FRP B;  1PDQ A;  5I6W A;  1G29 1;  1G6Z A;  5HGT A;  2AWN A;  1QNK A;  1D5X C;  1DJR D;  1UAP A;  4XTC S;  4KHZ A;  2XIW A;  1WTO A;  3SVM A;  2RVL A;  5CMD A;  2L55 A;  2K03 A;  5ELF A;  4BY1 B;  5ELB A;  3EJI A;  3NTK A;  5LL6 X;  4RGN A;  5CYU A;  2Q8I B;  3JAM E;  4V0B A;  3QG1 A;  1HA5 A;  5JOB A;  4WOR A;  1YNJ D;  1ZYR C;  3S2H B;  2XN9 C;  4RH6 A;  1CT1 D;  3C1F A;  2F0K A;  4OL7 A;  1SE3 A;  5D3D A;  5I4D A;  1K8M A;  3D4W A;  3DMU A;  2HQE A;  1UUP A;  1A15 A;  4OGQ C;  3BDO A;  4IUU A;  2SEB D;  5E4X A;  4P2C B;  1TWF B;  2A68 C;  4C3I B;  1D6E C;  3M4Y A;  1SE2 A;  3T51 B;  1RD9 D;  1TS3 A;  5C4J B;  1LT3 D;  4TSS A;  1PZJ D;  1ICW A;  3D6W A;  3QJY A;  1NR2 A;  4XXE A;  3L9A X;  3W2D A;  1IHZ A;  1H9R A;  5G3L D;  2NN6 I;  2QEJ C;  1HFG A;  3M85 A;  1IW7 D;  4RWS C;  1GUW A;  5COY A;  3RD4 A;  5E4W C;  1WCM B;  1H9J A;  1L0Y B;  3DEO A;  5E1F A;  2ZXP A;  5JJZ A;  3SK8 A;  1A3V A;  4RHS A;  1A2U A;  1BCP B;  3ND9 A;  5LHY 1;  4WFN 3;  3JAM L;  3E5S A;  3IL8 A;  1EIG A;  4WJW A;  1GUN A;  5CV6 A;  5M3M B;  2B2W A;  4NDX A;  4A3K B;  3QIA A;  1S5E D;  2EYO A;  3N6R A;  1SMY D;  3K6O A;  1STA A;  4XQN A;  3MFG A;  2F0S A;  3A54 A;  1CZG A;  4K14 A;  3VYT A;  4RFB A;  5KGU A;  1I6V C;  1YNN D;  3NBH A;  2MP1 A;  3DHQ A;  1SYE A;  1O7Y A;  2A6E D;  2KCC A;  1VMP A;  1SE4 A;  2NN6 H;  3BZD B;  3MC0 B;  2B39 A;  5IT9 L;  4K2L A;  4IN3 A;  1BUV T;  1KNE A;  1BO0 A;  1ONL A;  2PW7 A;  5EJW A;  5ISR A;  4DAY A;  4QF4 A;  2PZT A;  1TWG B;  3Q22 A;  3IFD A;  4ZKC B;  4LJZ C;  3HOV B;  4RHR A;  4DA2 A;  1K83 B;  4XQQ A;  2C5C A;  2DNC A;  3OPO A;  2OEO A;  1TS2 A;  1I4R A;  4H0L C;  1K8O A;  1FGB D;  1JOK A;  4KD3 A;  4KY6 A;  3K5M A;  1ESF A;  4O42 A;  2IX0 A;  2R93 B;  2KEE A;  3NK9 A;  2K5D A;  5CV7 A;  3HKZ B;  3VR5 A;  3G6J B;  4J8Q A;  1HCZ A;  4K8I A;  3PIP 3;  1R4Q B;  5EPK A;  5ELD A;  1LTS D;  4B9W A;  3NBI A;  1HQR D;  5DM7 3;  1JR0 D;  2M00 A;  1PTO F;  2IX3 A;  4ZKB B;  2J4X A;  5KND A;  3I72 A;  4M8A A;  3LWU A;  3J81 E;  4KKS A;  1STE A;  1DZ1 A;  5JAV A;  2WKD A;  2WV6 D;  2B8G A;  4F88 A;  3BDL A;  1HTL D;  2F0V A;  3BDC A;  5DM6 3;  1SBB B;  3HG9 A;  2HCC A;  1F2Y A;  3BYY B;  1IYV A;  3GQB A;  1EL0 A;  4DU9 A;  5J39 A;  1S5F D;  1O78 A;  2JXM B;  1CM9 A;  4HR7 B;  5C3E B;  3WDN A;  2SNS A;  1TII D;  1U4P A;  2ZXR A;  2XWB B;  1TS5 A;  1WTW A;  2WKC A;  4FF4 A;  2J0T D;  2VXW A;  5K36 G;  4ZUJ A;  3V05 A;  3S9W A;  1EY7 A;  3IFT A;  4MHE A;  5DNF A;  2BA0 A;  3BVM A;  1Q8I A;  2HUG A;  3MXG A;  5FO7 B;  3A56 A;  4X3K A;  1B9M A;  3KBG A;  1AZP A;  3I73 A;  2A5H A;  3PIO 3;  5IGG A;  2E2H B;  2D62 A;  3C2P A;  1LT5 D;  5T1I A;  3T13 A;  1I4P A;  4CHT B;  2Q8T A;  4X3T A;  2WB1 B;  3MA2 B;  2F0G A;  2E75 C;  4QUC A;  1LV9 A;  1RTO A;  2L1B A;  2N88 A;  3A7A B;  3LNN A;  4C1N I;  3PUY A;  4I7Z C;  3BG3 A;  1SXT A;  5A35 A;  2JEA I;  1M8A A;  3FDT A;  1RF2 D;  3I91 A;  2A69 C;  2HDL A;  2EJF C;  1MSH A;  1HTP A;  4U68 A;  4IQZ A;  4FNF A;  3E0J A;  3ERO A;  4FP5 D;  4BY7 B;  4GZY C;  1ML0 D;  3PUX A;  1F2L A;  3GTM B;  3C3L A;  5E3F A;  1EOT A;  2Z4I A;  5KNB A;  1KLU D;  2LMC B;  4IUV A;  4J6H A;  4HMI A;  1B1Z A;  1HUN A;  1EYA A;  4H13 C;  4DK0 A;  2BOS A;  4OO1 G;  2KCN A;  4IFD G;  3TME A;  1I4G A;  3EA6 A;  5EKL A;  2JE6 I;  2ICI A;  5C0X G;  3U9O A;  3S14 B;  1X3P A;  1EZ8 A;  1TVX A;  3HP3 A;  4ZLT F;  1NUC A;  3SHL A;  1CTM A;  3J81 L;  2KOL A;  4X3U A;  2PW5 A;  1Q3L A;  4HSV A;  3L7Z C;  1X3Q A;  3A8J E;  4CJ1 B;  2EE1 A;  3CQZ B;  4ID6 A;  5I9O A;  2B2T C;  2AQ3 B;  3WOF A;  2D5D A;  2TMP A;  5A2Q E;  4RGT A;  2NUC A;  2PPB C;  1XWE A;  1MGS A;  3CHB D;  4B9X A;  1ENF A;  3DM1 A;  2XWJ B;  1ZEQ X;  2KVM A;  4H7B A;  3MTS A;  1GUO A;  5JPN C;  4EQO A;  1IL8 A;  4C3H B;  3KLR A;  2FMM A;  2IJ0 A;  2E2I B;  4FF1 A;  3PUZ A;  5CBA E;  2EYJ A;  4A3E B;  3QB3 A;  2K28 A;  3SDZ A;  1Z47 A;  3VA5 A;  2PQE A;  1U4R A;  3FPP A;  2EOT A;  1OXV A;  2A68 D;  4FXD A;  4TKO B;  2Q8R E;  1BDO A;  4HCE A;  2OT2 A;  1ET6 A;  2B63 B;  3I70 A;  5EQ0 A;  3H0G B;  3H94 A;  1QWY A;  3RLF A;  4QMG A;  2QCP X;  2PZW A;  2BA1 A;  3MXP A;  3G7L A;  3MHB A;  1WVL A;  3NE5 B;  1SDF A;  1NR4 A;  3R93 A;  4IUP A;  2NTT A;  3T4A C;  1F2M A;  1CHQ D;  1F9P A;  1M4V A;  1YNJ C;  1QNU A;  1NSN S;  1DCZ A;  3T16 A;  3D31 A;  2PCF B;  1EQV A;  3KF8 A;  5CV4 A;  1SNQ A;  1BBX C;  2OF1 A;  3RMH A;  2K5W A;  3EQL C;  1OXU A;  2F0O A;  4DAP A;  1KDC A;  2E2D C;  2HCI A;  1LTA D;  4A3I B;  5EBC A;  4C3J B;  4G4K A;  4IUT A;  2I07 B;  2K5Q A;  3KK7 A;  5M5Y B;  3P7J A;  3S15 B;  1BQQ T;  4KI0 A;  2R61 A;  1RJT A;  1STY A;  5D14 A;  3OWF A;  1LO5 D;  1J8I A;  1VF5 C;  4HN7 A;  1PZK D;  3VR6 A;  1GJX A;  4RKB A;  5EKI A;  4PMC A;  3F2U A;  1GHK A;  4UAI A;  2A73 B;  3A7L A;  4QCL A;  1GUS A;  1B44 D;  1STH A;  5KEE A;  2PMZ B;  1U4M A;  1C8C A;  1UNS A;  2CVR A;  1VCI A;  2EJG C;  4IZ8 A;  3KLS A;  3BS1 A;  3A8K E;  4RAU C;  3TP6 A;  1OXX K;  2K33 A;  1JWU D;  3SEB A;  1HPC A;  2L9H A;  4RGO S;  1CQV A;  4PNY A;  4C3H G;  4DF7 A;  1Q12 A;  4HAE A;  4R8N A;  2WII B;  4KK7 A;  3A55 A;  1XXG A;  1SJE D;  1TKW B;  3GTL B;  4L8J A;  1GHJ A;  4BA1 I;  4KKT A;  5IOD A;  1ZKO A;  4ODG A;  1WTP A;  4Q0F A;  2B2W C;  1GOZ A;  3NWS A;  1TWH B;  1QG7 A;  3GD7 A;  2H4O A;  1V1O A;  3NTH A;  4XDX A;  1HHV A;  2SDF A;  2JA6 B;  1G2S A;  1FR3 A;  1EY5 A;  1LLR D;  1RKN A;  2XRQ D;  1SEB D;  3SXH A;  2L12 A;  3U9S A;  5FO8 B;  3MAQ A;  1PXU A;  1BR9 A;  1ET9 A;  2RBM A;  3TN2 A;  4OO1 H;  2PNR C;  2BCO A;  3HOU B;  3DEP A;  2EYF A;  4TRD A;  1VDZ A;  1TQO A;  4DK1 A;  4AYB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...