1B3AA

Total chemical synthesis and high-resolution crystal structure of the potent anti-hiv protein aop-rantes
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
67
structure length
67
Chain Sequence
PYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (RANTES)
publication title Total chemical synthesis and high-resolution crystal structure of the potent anti-HIV protein AOP-RANTES.
pubmed doi rcsb
molecule tags Anti-hiv protein
total genus 14
structure length 67
sequence length 67
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1b3aA00
2NZ1D 4OIJA 2N55A 3Q6SA 2B2YC 2JP1A 3HP3A 5D65A 2M2LA 1MI2A 1ESRA 2L11A 1J9OA 2L12A 2MGSA 3TZDA 5CMDA 5EPJA 1DONA 3TN2A 1X3QA 1PLFA 1XX8A 2RSOA 5EQ0A 1HRJA 2RA4A 1B2TA 2HCIA 2HDLA 3R93A 3G7LA 2MP1A 1WD1A 3DM1A 1EQTA 3GV6A 5EPLA 4IURA 1PFMA 3DEOA 2DY7A 1IL8A 2K1BA 1CA5A 1RHPA 2K28A 4U68A 2JYOA 3IL8A 5AFWA 5JJZA 2EE1A 2RVLA 1BO0A 2HDMA 4MN3A 1GUWA 1IKMA 1F9RA 5COYA 1VMCA 1X3PA 1Q3LA 1KNEA 2IL8A 2KEEA 1M8AA 1J8IA 1G6ZA 4R9WA 1DOLA 1RTNA 2FMMA 1VMPA 1O80A 3H91A 4HEDA 4LMQD 5E4XA 1B3AA 2SDFA 1U4LA 2FINB 4ZKBB 1WVLA 1BBXC 1BF4A 3N52A 1RTOA 1MSGA 1U4RA 1G2SA 1E0BA 1B53A 1EOTA 2KVMA 4XDXA 5CBAE 2EOTA 4CJ2C 2FFKB 1EL0A 2CVRA 5D14A 4RWSC 1WTWA 1QE6A 2K05A 1PDQA 2H1EA 4RAUC 2VXWA 1O7ZA 3ONAB 3QO2A 2J7ZA 2X69A 2L9HA 2RSNA 2L4NA 2HUGA 4X3SA 1ILPA 3KBXA 5DNFA 1U4MA 4DN4M 1A15A 4CJ1B 1QNKA 2NYZD 3I8ZA 1WTVA 4ZKCB 1WTPA 1AZQA 1HA6A 1HHVA 1HUNA 4IUVA 4IUPA 5EJWA 1C8CA 4QUFA 5T1IA 2L1BA 4ZLTF 2R3ZA 4CJ0B 2FHTA 4XT3B 2X6GA 3I91A 1JICA 2Q8RE 3MWYW 3LWEA 4HAEA 2B2WA 1JE4A 1F9QA 4HSVA 4OIKA 2K01A 1B50A 4RA8A 1KNAA 2B2WC 4UAIA 1WTOA 3FDTA 1BNZA 3UI2A 3IFDA 1HFNA 1DZ1A 1AP0A 1MSHA 4MHEA 3F2UA 1NR2A 3KUPA 1G91A 3I90A 1WTQA 1ILQA 1NR4A 1DOKA 3FPUB 4O42A 5CORA 3SVMA 3I3CA 3D6WA 1RODA 2EPBA 1B4OA 1MGSA 1NAPA 1DOMA 4IUQA 1IKLA 1G2TA 1X32A 5E4WC 1SSOA 2MPMA 2KOLA 3P7JA 2B2VA 1HFGA 4HCSA 2KEDA 3GV3A 2FJ2A 4ZK9B 4X3TA 1ICWA 1ML0D 1SDFA 2B2VC 1F9SA 4IUTA 1EIHA 2K03A 4XT1B 1TVXA 4X3UA 1PFNA 2K04A 1F9PA 2Q8TA 1U4PA 4NW2A 1PFBA 1WTXA 3MTSA 2B2TA 5CBEE 1RJTA 4QUCA 4ZAIA 2BDNA 2N88A 1WD0A 1CM9A 1XYIA 1EIGA 1HUMA 1LV9A 2B2TC 1O7YA 2D9UA 2X6LA 4X3KA 5EKIA 1WTRA 1AZPA 2KUMA 3DEPA 2HCCA 4R8IA 5T1GA 1F2LA 2MJ8A 1SAPA 2DY8A 2XIWA 5EPKA 1QG7A 2B2UA 2KECA 1CA6A 2NWGA 1S4ZA 1ZXTA 2B2UC 1NCVA 2B2YA 4IUUA
chains in the Genus database with same CATH superfamily
3NHHA 1VS0A 2ZTEA 4LJZC 5D65A 4BA2I 4K0KL 1II3A 4AIMA 2J4XA 1GUTA 2EJFC 3RUZA 5K5PA 3JAMi 3UDFA 1ASYA 4A3KG 5JEAH 2BH8A 1LYLA 1VQJA 2VL6A 3K7AB 3A55A 4A3BB 1CT1D 3TP7A 4KY5A 4IN3A 4X64L 3U9SA 1FNVA 4A3FG 2ZXOA 3OIQA 3CQZB 2WIIB 2N8NA 1BKBA 1J5EQ 2F0FA 3CCEA 1O7IA 1FL0A 1YJWA 1S5DD 3H91A 2DJGC 1YHAA 4XIGS 1VDZA 3F1ZA 1RTOA 1K8AC 4RCNA 3W1BA 2K5WA 2JA5G 1T5XD 4BBSG 3T1HQ 4N9TA 1WFQA 1D2BA 5C44B 1C7YA 4A3FH 4LUZA 5I9PA 3K8AA 2H4OA 1YHBA 1A62A 3GTGB 3B6YA 2JXMB 5I9OA 1TS3A 4GNXB 4DV4Q 1YVCA 1L1OB 4DA2A 4IUVA 4BBSH 4A3DG 2R3ZA 1Q46A 1UE1A 1YNJD 4H44C 4JI2Q 3EIVA 3PO3H 1PTOC 3HZXA 4DAPA 1GD7A 5IE8A 1B50A 2RF4A 1EEID 3ZJYC 2LXKA 1VF5C 1GJXA 3J81c 2D0PA 4PG3A 1ILQA 3EBEA 2DNCA 5H1SE 4DNTB 3PO2G 1HH2P 2ICEC 1AEXA 5I2XA 3I4MB 1M4VA 4A3DH 2B63B 3GTKH 3TZUA 2F4VL 1SDFA 1ML0D 4IZ8A 4A93G 1B44D 3KFUA 5M3MG 4DV7Q 1MBYA 4A4IA 3M4YA 5BN4A 2JA9A 2JEBI 1EIGA 1C0AA 4U673 2EY5A 2MHVA 4ME3A 1WYDA 2B2UA 4IUNA 2ALYB 4OWXB 3PO2H 1NMGA 1TWCB 4CDFC 4LF9Q 5IYBG 3M4OH 4MTKA 2JP1A 4UP8A 5CGKA 1UAPA 1R9TB 4A93H 3S1NB 4S3SA 4DGZA 3E0JA 1SRUA 1QUQA 5EPJA 5M3MH 1PH9A 3HKSA 5KGUA 5EQ0A 4MNOA 5IGBA 3CCRA 1B9MA 3A54A 3HFZB 3Q23A 2DY7A 2F0OA 1V8QA 1A63A 4AQYQ 5GROA 3OWEB 1BO0A 1L2FA 5IYBH 4A3EB 4E6IA 1HNZL 2JJQA 1Q3LA 3QOJA 3I4NB 1TXYA 2F0KA 2V1CC 2A73B 4A3IH 1VQCA 5TSSA 3CU7A 4X62L 1ZEQX 1JOOA 4B3ML 3MXNB 2O2LD 4QGUA 3K58A 2K6AA 2E2IB 1PRTC 3W5OA 3KJPA 1BCPD 1J6QA 3QG1A 1G6PA 4MTNA 1EYDA 4DV0Q 2F0WA 3AMUA 1UWVA 3GTMB 1VQFA 4R8NA 5AJ3Q 3D8GA 1U0LA 2L9HA 3S14H 4KTAA 2YYZA 4X3SA 1BCPF 3GO5A 2EZVA 2ZXPA 2PQAA 2CKZB 1WTVA 2HD3A 3D3RA 1A3TA 1IBKQ 3BVMA 3HOUB 4BA1I 1SNQA 1SYGA 3NBHA 1A8VA 2D2CC 5G3LD 4NXML 2EJMA 1WI5A 5JPNC 3M3YH 3C46A 2AWNA 4GLXA 2OWOA 3J7YW 4EGVA 3HOWH 3I3CA 2KHIA 4A3CH 4R4TA 1SN8A 2B63G 4C2MH 3P7JA 5DM63 3Q8DA 4FXKC 4M1UB 1S5ED 3M4QA 1F9PA 1Q1BA 2HQLA 1OTCA 5CBEE 3STBC 1UE7A 4KKUA 1XYIA 1N8RC 2D9UA 4YCVA 3EVQA 1ENFA 1YJNA 1BQQT 1F2LA 4R4IA 4RH6A 4DV2Q 1D5XC 1CA6A 2B2UC 2WINB 1EY8A 4WJWA 3UE0A 2WKCA 1RL2A 1AE2A 2M2LA 1SYBA 4LUVA 3BZDB 1SNMA 1HQMC 4FXGC 4H02A 1SR3A 4RGNA 2SOBA 2HDLA 1FNWA 5LL6X 4BY1G 2DUDA 2VS1A 3L2PA 3FPPA 1X3EA 5IGGA 2A68D 1E1TA 2JN4A 5M3FB 4A3EG 1PH6A 1GUWA 1IKMA 4A3GB 4HMIA 3V2TA 2GVAA 1J8IA 1YHQA 1PZID 1Y14B 5M5XH 2CH4A 4PMWA 3CRLC 1O80A 4HEDA 1VQMA 4GOPB 2FINB 1H9KA 3CXCA 4IPDA 4C3HB 4JV5Q 3MXUA 1G2SA 1SE2A 4HTHA 5C4HA 2EYHA 1JMCA 4DR6L 1XMQL 3P20A 4DR3Q 3K81C 4LW1A 1X9NA 1QWYA 1PZKD 1GKHA 5ELNA 3K59A 2K5VA 2VXWA 3GTPH 3SK6A 4BBRH 3S1MH 2YTXA 1BXTA 2J7ZA 2Q2HA 1R4PB 1HZ9A 1U9RA 1NNXA 3J80L 1KDAA 1SE4A 4OONA 2NUCA 3L7ZC 3A8KE 1AZQA 4TQUS 2ZJPA 2WB1B 3HOUG 1AN8A 2F0LA 4ZLTF 1I4QA 2PMZE 1TWGH 2B3GA 3WOEA 4GKJQ 5J1ZA 1FVIA 5M5WB 1PV4A 4UPAA 1NSNS 4FF4A 4GLVB 1X56A 5I6YA 5GAHC 3KF6A 5KYLA 5IYCG 4B9XA 1EQVA 4HIKA 1BUVT 3A8IE 4ZCKA 1J5EL 3FPUB 5IGFA 1C48A 1MGSA 3BZCA 1K0RA 3VR2A 1CHPD 1V9PA 1MJEA 2E2JB 1IYVA 3BYYB 3T1HL 4OXPA 2VW9A 1QNUA 1TIID 1AFPA 5ELOA 2K75A 3KF8B 4OGQC 4G7ZC 2EQSA 2L55A 2PNHA 1YNND 1HA6A 1O7YA 4X3KA 3R2TA 4L5RC 4F88A 4X64Q 4FP5D 1WJJA 2XGTA 1GUSA 2PZTA 4FNFA 4DK1A 1HJPA 2F0PA 2WV6D 4TRDA 2NZ1D 4PMCA 2I5LX 3J7AV 4CGYB 1G51A 3I4LA 5FLMG 2F4IA 4DAVA 4NMZA 5C4XB 1X3QA 1Z9FA 1XNQQ 2HCIA 4JI2L 3RMHA 1VQKA 1IHZA 5CV9A 3GV6A 5A35A 1K8OA 4A76A 4BXXG 3S15B 4PZ6A 2F0NA 1K9MC 1B3QA 4A3GG 4FO2A 2A69C 1SE3A 2B39A 3CF5A 4LF4Q 3AB9A 1PH5A 1SYDA 2EIFA 3C3LA 1B3AA 1V1PB 4HIOA 5EBDA 4C3JH 3G6EA 4G7HC 3EA6A 3CPFA 3KDFB 1MHWC 2OTJA 2R92B 1LT6D 2A74C 1SMYD 5D14A 5DLQE 3S17B 2BCOA 3NQTA 2NB0A 2VB3X 3MHBA 3UDIA 1TS2A 5JVH3 4LF9L 1ILPA 5DNFA 3HOXB 4NDXA 4CJ1B 3I8ZA 1HUNA 3IFTA 2E2DC 2EXZA 4GLAC 4H0LC 4I7AA 5DEHA 3MXGA 4RMFA 1H9SB 1DGSA 3DLLA 2R93B 1PH3A 3LWEA 3RLOA 1GHKA 4GN3B 2LFNA 3C1EA 4AQYL 4P72A 2PZWA 1I4GA 2GN5A 1I3QH 4JOIA 4KMUC 3F2UA 3KUPA 3J81i 3K80C 3AFQA 1NAPA 3UE1A 4B08A 5JJKA 1Q12A 2KCCA 4JI8Q 4IFDG 4IPGA 1HR0L 1XNRQ 1Z6HA 1XMOL 2JA7G 5C3EH 4F8MA 1PTOB 4KD4A 3ZYYX 1F2YA 1DM0B 1PFNA 1C4QA 2QDLA 1RJTA 5JOBA 2C9OA 2N88A 5IT9L 3H3VI 4JI5Q 1KLUD 4R8IA 5AJ3L 3I56A 2EYMA 2WAQE 2E8GA 3GTOB 2UU9Q 3FVQA 2UUCQ 3TP8A 2Z1CA 2JA7H 3CD6A 1LTID 1E2VA 2KCTA 2R7ZG 1IBKL 2XN9C 3MEHA 1CHQD 1W6JA 1SE8A 1TQOA 1WOCA 2R61A 4KLKA 3G48A 2I0QA 1XTDA 3IL8A 1QCBD 2PPBC 1JB3A 2KCNA 1SNCA 4XXEA 1K3BC 2R7ZH 1PZJD 3MFGA 5FLXL 3R8BA 2JA8B 2J0TD 4LAAA 1I50B 4G57A 2F3IA 3VR3A 1EUJA 4HJAA 3Q0AA 4YCWA 4A3MB 4DUYQ 1F77A 1ICFB 1KC8C 2JE6I 1TKWB 4DU9A 4OO1I 2VQEQ 1T5EA 4DV2L 1PH8A 2YU9H 1BVSA 3HOXG 2EYFA 5JAVA 1EZ6A 1LO5D 5J39A 2YTVA 3CC2A 3DHQA 4JC0A 3IRBA 1EQQA 2RKSA 5I2YA 1PRTB 3BU2A 2KBNA 3GQBA 1OO9B 1KTKA 1A2TA 2R93G 2X6GA 1D1IA 2PI2A 3L0OA 3MFYA 1XPRA 4A3JH 1YEZA 3S1QH 1KNAA 3VYRA 4KHPQ 4P2CB 4DR1Q 4DV3Q 5IY0A 4Y52H 3S2HB 4JOIC 4IJHA 1XPOA 4FVMA 3X3MA 1SJHD 1WCMB 1SSOA 5IGEA 5FKAC 3LWUA 2A19A 1KRTA 4JV5L 4BWGB 1STAA 4DR3L 2MQHA 3I72A 3E9IA 2RDFA 4APVA 3RZDH 1VQPA 3CCSA 3UDXA 4JI7Q 1JWMD 2ENBA 1HNWQ 2MJ8A 1Q1EA 2VZAA 3TRZA 5IYDG 4K8JA 1CK1A 1GUNA 1Q90A 1NTGA 2F03A 4B3SQ 1EY5A 2A6ED 5ELFA 3QOLA 4ULLA 3TN2A 3PUVA 1NJIC 3A8JE 1STGA 2GA4B 1CZGA 2VQFQ 1XWEA 3G7LA 4GKJL 3DM1A 3WOFA 2IX0A 2JYOA 3SE0A 5FOBB 5M5YB 3QR8A 2RVLA 1EY9A 3OYYA 1EY4A 3BS1A 1EFID 1F9RA 3WWVA 2IY5B 3S2DH 1VMCA 1V1OA 2KA7A 2JA8G 1OXUA 3G71A 1QUQB 3NPPA 3A5UA 3ER0A 4RHSA 1HA5A 1YI2A 5CV4A 2VNUD 4A3MG 4JI4Q 1Y1VB 4DV1L 1YIJA 3OTOQ 2PW7A 4K5WA 2A6HD 1PDQA 3L9AX 3U58A 3NTHA 4C3IH 2O5IC 4KN7C 1SNOA 3HG9A 2O4XA 3BZKA 3CPWA 1LUZA 4K2LA 1YNJC 2XWBB 4JYAQ 3HOVB 4DNIA 2RQXA 1LACA 4BY7G 3HOZG 4A3IB 5EBCA 4TVAB 4A3KH 1H9JA 1XNQL 3ULJA 3S24A 1RCVD 2Q8RE 1X6OA 3MWYW 2Q2UA 1XPUA 3OOCA 1PH4A 4JW0A 5ELBA 5IOCA 1WTOA 1HFNA 1I94Q 2EJGC 1FGBD 1LABA 3J80E 4FYDA 3I90A 3GDEA 4O42A 1CFMA 2PQAB 1WCMG 4IFDI 4BY7H 2KENA 5A2QL 1OXVA 1H9MA 4LF4L 3HOZH 2FMCA 2F3WA 2WAQG 3HOYB 4J15A 2QKIC 4I7ZC 4EX5A 2XTIA 4M8AA 4DXFA 5FJ8G 1EOVA 2PZUA 3NBHB 3BDLA 2JA5H 2QEJC 1Y1WB 1ZYRD 1TVXA 5CR3A 1SROA 1VQBA 1BBUA 1VQ6A 4ZAIA 2BDNA 1CM9A 2X6LA 1KABA 1HQRD 3NTKA 1GVPA 1D1KA 2PW5A 1PHJA 4XQQA 4JVZA 4ZUJA 4JPBW 3M3YB 2EY6A 3QIAA 2E2HB 1FGUA 5FJ8H 5GADC 5LL6S 2F0GA 1QVGA 3T13A 2JA6G 1PXUA 2NN6I 2MGSA 1N34Q 3R2IA 1CI3M 2R7FA 1N36Q 2NVTB 5F2DA 2Y0SE 1PYWD 2EDGA 2RDGA 3M4PA 4ID6A 1D5MC 4UHVA 2P5ZX 2C5CA 4MIUA 4WJ3M 5EKKA 2K14A 1A3UA 1HCZA 1WTHA 1FJGQ 5COYA 2D5DA 4Z9CB 1V43A 1BCPC 2Z0SA 4JI8L 1VMPA 3SHLA 1SNPA 1XNRL 2JK8A 2GVBA 1Y1VG 5CYUA 5JPMC 1B53A 1EWHA 1SBBB 3OW7A 1KHIA 3ND9A 4CJ2C 1KXLA 2FFKB 4A3BG 3E5SA 4JI5L 4OX9Q 5ELEA 4LFBL 2K52A 3OWFA 3GTQH 3NWSA 2PQEA 2L5TA 2UU9L 3QO2A 3K7UC 1SEBD 3HEJA 2UUCL 4FF2A 4CKEA 3HOVG 2KCMA 4DAMA 3SEBA 4QY7A 1NY4A 4RFBA 2ZM6Q 3VYTA 5ISRA 1HHVA 4OEMB 1YNXA 1EY6A 3K7AH 1HR0Q 3NSWA 1XMOQ 4A3BH 4OL7A 5C44G 3T56B 5KNDA 3JAME 4HAEA 3KLWA 3SXHA 4JI1Q 4GKKQ 1IL2A 2UXBQ 1G91A 3GTPB 2UXCQ 3HOYG 3MC0B 1VQ9A 1LTAD 2AQ3B 1S3OA 4JBJA 3I55A 5C44H 2N78A 1EIHA 4XT1B 4HSPA 4LFCQ 4DUYL 3GTGH 2B2TA 1CZWA 3BG3A 1PH2A 4DK3C 1WD0A 1KL9A 1U5KA 1LV9A 4X6AH 2NTTA 2KUMA 4H13C 2HCCA 4AYBE 2VQEL 2Y0SB 5EPKA 1IBMQ 2WB1E 3Q22A 5M9OA 5GAEC 5KNCA 3I4MG 2H5XA 2E76C 1ONLA 1STYA 4XQJA 4LFAQ 5G3LF 2A68C 3A0JA 2AHOB 3J81L 2L0CA 4YWMA 1GM5A 3J81j 2QILA 2RA4A 3CRKC 5IT9E 5IP9G 1VQ5A 1TWHB 4DR2L 4R4QA 1K28A 4KHPL 4DR1L 1GUOA 4DV3L 4JBMA 3CCMA 2EE1A 1NUCA 2F0VA 4DV6L 1TWFB 4JG2A 2AUKA 2B63H 4X66L 3F2BA 1X3PA 2LKVA 1B1ZA 2XWJB 1DOLA 1NE3A 1KD1C 4HIDA 1CSPA 2VUMB 4DAYB 2NZHA 3NELA 4XDXA 1XXGA 3RZOB 4JI7L 3CCJA 3W1GA 3TS0A 1EU4A 4IALA 2H1EA 1HNWL 1TWCH 3M85A 3DM3A 3CMAA 1EFWA 3AFPA 1RD9D 3PIO3 2Z6KA 2X69A 1R9TH 5FLXE 2L4NA 3D4DA 3I4NG 1D7QA 1VQIA 3OHXC 1EQRA 2PO4A 4EVOA 4B3SL 1QNKA 4KY7A 3ULLA 4IUPA 4KD3A 3ICEA 1Q81C 2VQFL 1YITA 4C3JB 2HHHL 4BY1H 1TY2A 1F9QA 4A3EH 2UUAQ 1D6EC 3RNUA 2NBFA 2Q2TA 5HGQA 1NR2A 4L6TB 3STBD 1WTQA 4O1NA 4OO1G 4WJ4A 3TS2A 2ICIA 3OMGA 4V190 1JORA 2PCFB 3V05A 4AYBB 4IJLA 2KOLA 1YNNC 3RR5A 1PYSB 4ZK9B 4JI4L 3MXNA 1PA6A 3GTJB 5J22A 1WTXA 4ME5A 3OTOL 3T1YL 3GTMH 3E6ZX 4F7XA 1CQFA 1R4QB 5IP7G 2B2TC 1G6ZA 5EKIA 2Y0SG 4K6LA 5T1GA 1FNUA 4PV1C 1KIXA 3NEMA 3K5MA 3CCLA 1A3VA 2OT2A 1I3QB 1W2BA 4JYAL 4OWTB 3VA7A 3HOUH 1D5ZC 1IW7D 4DXGA 2C35B 4PNYA 2QW7A 1SFOH 3E9HA 1XX8A 1KLGD 3M7GA 5C3EB 5IP7H 2BE5D 2NZOA 3HKZE 3R93A 3TMEA 4DUZQ 4DV1Q 1I94L 1IL8A 4WRDA 5IYCH 2CQOA 2MFIA 2K33A 3H15A 3OW2A 1JOKA 1Q8IA 1TT2A 3AU7A 1KRSA 1SMYC 4DFAA 2FMMA 1LTGD 3VYSA 4C56C 2SDFA 2QEXA 4QF4A 2LMCB 4POGA 1U4RA 1JJCB 4DR4Q 1IYUA 2NVYH 1EOTA 4ILWA 4ALPA 2KVMA 2EOTA 4HCEA 3PIP3 4JCVE 5M3FG 1YJ9A 5FO8B 1OXSC 2F0QA 4A3LG 3TP5A 5BN5A 3A74A 4B9WA 2Z6KC 3S16B 4HJ5A 1EYGA 4QIWB 5FLMH 4CKCA 1N34L 2F0DA 3I7FA 1HXYD 1AE3A 1L0WA 1LT3D 4KKTA 4C3HG 1N36L 4QUFA 3K5NA 2ZXRA 1CTMA 2XSCA 2OTLA 1SNDA 4YWKA 4BXXH 2NVQB 5M3FH 4OIKA 4X65Q 4A3GH 4ZQ3A 3JAML 1MSHA 1FJGL 4YIJA 2AQ1B 4K2KA 4AYBG 1E24A 3D31A 3ITPA 4PZ7A 2WB1G 3DUZA 1KDBA 2CWPA 1ICWA 1I4RA 5I4DA 3FKIB 1PFBA 2BA1A 4OX9L 3TDQA 3OPOA 3C2PA 3LGJA 2TSSA 5BN3A 1HUMA 5LHY1 2B8GA 4RG1A 1E7ZA 2Z9HA 2EYOA 3D6CA 5A2QE 3G6JB 5K36G 3HKZB 4KJOA 2IHEA 5IWAQ 2F3VA 2ZM6L 2K5DA 3NP8A 1MI2A 1ESRA 4G4KA 1ESFA 4YHHQ 4R1JA 4HN7A 1HRJA 3KBGA 5M5WH 3W2DA 4YWLA 3NQIA 1WD1A 3P1HA 3H0GB 4EQPA 5KNBA 1N32Q 4JI1L 3FP9A 1P8LA 4GKKL 4N8FA 4QQBX 4LFBQ 3QB3A 2UXBL 3PCOB 2CW0D 4CKBA 3GTLB 1JOQA 2UXCL 2EY2A 4IFDH 3TSSA 2CHBD 1PVOA 1BOSA 4B3RQ 2AUJD 1VQLA 4KHZA 1BF4A 1EYCA 1FYCA 5C4XG 2FXQA 1DD2A 4LFCL 1FR3A 2NN6G 4B3TQ 1HZAA 2DGYA 1EL0A 1JWUD 1Y8PB 3PUWA 3J7AF 3KF8A 5C4JH 5GAGC 3M7NA 3I70A 3ERSX 1N33L 2K50A 1IBML 1K83H 1BCPB 1D8LA 1X54A 1HNXQ 3E0EA 2HUGA 3T51B 1X3FA 2IJ0A 3K6OA 4DN4M 1A15A 4LFAL 1TR5A 5C4XH 2G9DA 4ZKCB 5DAUA 2AQ2B 2E74C 2NN6H 1CKMA 1GXDC 1QZHA 4CJ0B 4XT3B 1QVCA 2R92G 1I4XA 4KI0A 2ZTDA 2OXPA 1JE4A 2K01A 3CMEA 2KJXA 1UE6A 3IFDA 3P75A 3NXWA 4J6HA 4C3IB 1NR4A 3ND8A 3NBIA 1PMRA 3ULPA 4DKAC 1TS4A 1X32A 5E4WC 2Z8LA 2WACA 3HS0C 3MEFA 3K5LA 3CCUA 1B8AA 3TREA 4P75A 3S17H 4IUTA 5IIFA 2IPKD 4C1NK 2QA4A 1DCZA 1SMXA 2K04A 4R4CA 2UXDL 4G7OC 1CKNA 1V1QA 4DR2Q 3U50C 4QB4A 1BR9A 2A6EC 4DV5Q 4A3FB 3HKZG 3J7ZC 3HOXH 1QG7A 4NP5A 5J3BA 3OMCA 1SYFA 3M9BA 4DV6Q 2SNSA 2CH4W 4X66Q 4KV6A 4CBVA 2WKDA 2A5HA 3TBIB 1BBWA 4CHTB 2R93H 2F0IA 4IO9A 4RHRA 5KYIA 3PV0A 3CC4A 3BYTB 2K5QA 2JA5B 4BBSB 3H0GG 2N3SA 3DWPA 2K28A 2UUAL 5AFWA 4LWCA 2MO0A 1M1KC 3PO3B 4Y7NH 4LF5Q 2BA0A 1GUGA 3CC7A 2KEEA 1M8AA 1VQNA 1IYJB 1PTOH 1W6KA 2RHSB 3J81E 1I4HA 5E4XA 1STNA 3H94A 4LNQA 2A6HC 1X3GA 3QJYA 2Z4HA 4A3DB 3PSIA 4HR7B 4ODGA 3GTKB 4DR5L 3PIOA 2HHHQ 1EWCA 2IX3A 2ZTCA 5NUCA 3T16A 5IYDH 2TMPA 3ERQA 4QCLA 3DWAA 4DR7L 4PZ8A 4EQNA 3PO2B 1P16A 5KRUA 5C0XJ 4QJFA 3M4OB 2ATWA 3I91A 1G8ZD 4L5QA 4A93B 1B70B 4DUZL 5M3MB 2NVXH 4JI0Q 4L5SA 4DPGA 4HJ8A 3T1YQ 3A7LA 1W3SA 1Y69U 3T4AC 3D4RA 1QVFA 3GTQB 1A0IA 3S1RH 2JA8H 3V96A 1ZYRC 1I50H 1ZKOA 1B4OA 4GN4B 3F2CA 2F0SA 3PUZA 2UUBQ 1QJOA 1HFGA 4DNRB 3L3OC 5KEEA 5L37A 4A3MH 4DR4L 5C5MA 3SR1A 4X3UA 1VCIA 1ASZA 5LMNQ 4QUCA 4FF1A 1Q7YC 2JEAI 3DEPA 2NTSA 2Z6BA 4RGMA 3NWTA 1S4ZA 1CKOA 4XYQA 2N55A 4MZ9A 1N9WA 1RKNA 3S14B 4KN4C 1VQ8A 1OXXK 1TWAH 1UEBA 3FRPB 4Q0FA 3S9WA 5JEAJ 3CAMA 1JC7A 3F8TA 4JBKA 1G291 3S2HH 1PFMA 3DEOA 4X65L 2R6GA 4P73A 3PO3G 1H9RA 4ZRZA 2IHFA 1WCMH 4EQOA 1RTNA 1UNSA 4LMQD 1XJVA 4YY3Q 2SNMA 2I5HA 1BBXC 1U4LA 3HOWB 1AH9A 3BDOA 1JB7A 4J1MA 2XVSA 4Q5VA 2AWOA 1E0BA 4C2MB 3PIPA 4K8IA 1O7LA 4KK7A 1HR0W 3FHWA 2RDHA 2E75C 2K4KA 2EYLA 3MVVA 5C4ZA 4UP7A 1RIPA 2CFMA 3RN2A 2Q8IB 3ONAB 1I6HH 2LS01 3OIPA 5IWAL 1RDPD 2BDOA 2E5LQ 1U4MA 4OELB 2JA6H 1HTPA 3NE5B 3T53B 4YHHL 3MAQA 2AKWB 4RKLA 3TEHB 3TQYA 1YZ6A 1IBLQ 3MZ5A 4JBWA 1LT4D 1I4PA 5M5YH 4K14A 1DJRD 1LTBD 4JI6Q 4HSVA 3N6RA 1N32L 1E2ZA 3KLSA 3FDTA 3UI2A 4NB3A 1PFSA 1DOKA 1PTOD 5FO9B 1A2UA 4IUQA 2I46A 3JC66 3K0XA 4A3IG 2HIXA 4B3RL 2V4DA 4RCOA 1Y1VH 2B2VA 4HCSA 2L15A 4BS9A 5M5XB 3PUYA 1MD2D 4B3TL 4ZUIA 1IXRA 2F0HA 1PTOF 3I4OA 1PYBA 5JVG3 3CQZH 4KJNA 4CDCC 4BY1B 1K0SA 2F0EA 5BR8Q 2XIWA 2N49A 1HNXL 2BOSA 2CCZA 2O5JC 3HOVH 4FF3A 1MIUA 3LNNA 4BBRB 1AW7A 3S1MB 4OIJA 1HZBA 3RLFA 4DF7A 2DNEA 5C0XI 1VQHA 2L11A 1K3RA 4UP9A 1Y1WG 1PLFA 3J7A5 1B2TA 3J80c 5EPLA 4IURA 1QILA 3KYHC 1CA5A 1ENAA 4U68A 3KK7A 1TWGB 4RGOS 3KF6B 3KOJA 2ZJRA 1N33Q 1LTTD 3PMFA 2LSSA 3HOYH 1B7YB 3U9OA 1KNEA 3UDGA 1VQOA 3HOWG 4A3CG 1Y1WH 1LT5D 4GNXA 1ET9A 1L1OA 4TSSA 4LK1C 4IOAA 4IPHA 1SFOB 3NK9A 4KKSA 3SK5A 1F2ZA 5E3FA 5JJLA 3VYUA 4NPSA 4DV5L 2OEOA 4C1NI 4JI3Q 2LXJA 1PRTD 4RKBA 2E2HH 3SDZA 1NBWA 2RSNA 5CV5A 3I4MH 2XRQD 4WORA 2NVTH 3FEWX 1STEA 2F0TA 2YTYA 5IP9H 4IOCA 3BJUA 1PRTF 3G4SA 1IZ6A 2PNRC 3CHBD 4CDDC 2NVYB 2UXDQ 3KLSX 4UAIA 2EXDA 3H3VH 1KAAA 2K5NA 4LF7Q 2ZT9C 1SLJA 1SYCA 4MHEA 4LF5L 4LF6Q 4RGTA 2IW3A 5IGCA 1JT8A 3SVMA 1DXMA 2EPBA 3HRZC 4EQ5A 3A7AB 3S1NH 1EY7A 5HY6A 5CC4A 1A6XA 2RBMA 4LF8Q 1LM0A 2IT1A 2CQAA 1PH1A 1UEAB 4PMBA 3GV3A 2B2VC 3URYA 4QMGA 2EY1A 4NW2A 1ET6A 1VQDA 2MO1A 2K7VA 3VDYA 2RCFA 2M9VA 4QIWE 1IW7C 2DJFC 1VQAA 3I4NH 4BBRG 1E1OA 5C6AA 4FDBA 2BE5C 3VR5A 4FXDA 3Q6SA 5HGTA 3HP3A 3D4WA 3R3OA 2L12A 3TZDA 2E2IH 3JAMc 5EGTA 1OXTA 4GS3A 5CV7A 3D0FA 3C1FA 1LLRD 2RSOA 4JI0L 2CWAA 3AQQA 4DR5Q 1FD7D 2KQ3A 2K1BA 1VQ7A 4GZYC 1F2MA 1DYQA 4POFA 2HDMA 3VA5A 4OO1H 5I6WA 1JCKB 2PI2E 4GN5A 4R9WA 3TP6A 4ZYSA 4DR7Q 2AMCB 1B9NA 4ZKBB 2UUBL 1Y8OB 5C5LA 3OSOA 3SGIA 3CCQA 4NXNQ 4H7BA 1HTLD 4GNXC 1L1OC 4AH6A 5LMNL 1S72A 1Q86C 2B8FA 1JJGA 2CVRA 2K05A 1O7ZA 1VQEA 1C9OA 1GO3E 1X65A 2Q2IA 4HMJA 5LMUQ 2JSOA 2G9HD 3H6MA 2I5MX 1S5BD 4J8QA 5IT9c 2Z4IA 2XRSD 2VUMG 4K0KQ 1E3PA 1TWHH 2JA7B 2L1BA 4N8X1 5HURA 1EIYB 1JICA 1RF2D 4V0BA 4K5XA 1TWFH 1MKHA 5ELCA 4RA8A 1Q82C 1AP0A 5C4JB 5CORA 1K83B 1RODA 4DV4L 2VUMH 4YCUA 4L5TA 3H3VC 4YY3L 1EU3A 2MPMA 4XQNA 1EZ8A 1S40A 4OHJA 1QZGA 2R7ZB 4L8JA 3RZOH 2OQKA 1QOHA 1YBYA 3H09A 2QGQA 3RD4A 1F9SA 3AYHB 1KDCA 2YV5A 2K03A 2JQOA 4C3JG 4DAYA 1H95A 1NMFA 2MNAA 5FLXc 5CV8A 1TU2B 4K6DA 4A3LH 3NENA 2DY8A 1VQGA 1EIFA 1LTSD 1L0YB 1NCVA 1SXTA 2B2YA 3PUXA 2E5LL 2YU9B 1E2WA 2F1MA 5FO7B 4C3HH 4KY6A 1UUPA 2I07B 4A75A 4GOPA 3LX0A 4DV7L 1IBLL 4OWWB 3VR6A 2EYJA 2F0JA 2CW0C 1CKNB 1BDOA 4JI6L 1CUKA 1EQTA 1QB5D 3CP0A 1HPCA 5KIXA 1RHPA 1KQSA 4JK1C 5JJZA 4MN3A 4A3JB 2F0MA 2PMZB 3S1QB 4WFN3 2ZJQA 2EVBA 2IL8A 2ID0A 1LTRD 2D62A 3GD7A 5IODA 3NUCA 3GTJH 5DM73 3A5ZB 1MSGA 2F4VQ 1EEFD 3EJIA 5C3EG 4XYOA 3BDCA 4IQZA 5CBAE 1JE5A 2A69D 3CW2C 3EQLC 3EROA 3DWQA 4UDUC 1WTWA 2EYPA 5BR8L 1O78A 4RAUC 3RZDB 5CV6A 5K36H 5E7NA 1I5FA 3K0YA 1S5FD 4L63B 2BH2A 4O0AA 4Y7NB 4KHVA 1Q8KA 3K57A 3DMUA 3O13A 4K5VA 1WTPA 2E2JH 5EAYA 4CDEC 4HJ7A 1K73C 2R7DA 3MA2B 2K32A 2FHTA 1ENCA 2QF7A 1EWIA 3GP7A 2B2WA 4DK6C 3W3AA 4DV0L 2QCPX 2VB2X 4TKOB 5D3DA 1SYEA 4PQXA 1K8MA 1TS5A 1HZCA 2F52A 3KJOA 1HNZQ 3D6WA 2M00A 2OF1A 1DOMA 2KHJA 4I65A 1G2TA 5GQOA 3S2DB 2B29A 2F0UA 3SK4A 2IX1A 4X62Q 4X3TA 3FMCA 4B3MQ 1I6VC 2Q8TA 3S15H 3PF5A 1CSQA 1VF7A 2NVXB 1JQYD 1KAWA 3RLNA 5C3XA 4JI3L 2PYKA 3S16H 2D0OA 1SAPA 4O2DA 2KECA 1PH7A 2NWGA 1ZXTA 4QL5A 4IFDJ 4XTCS 4DK0A 5ELDA 3DXJC 1STHA 1E22A 2B2YC 3S1RB 3F2DA 2K5HA 3E3XA 1MJCA 4N9PA 1J9OA 3KLRA 5CMDA 1DONA 2R92H 2NVQH 1V1PA 3FKIG 4GOPC 1GOZA 3EN2A 2MP1A 3KDFA 4A3KB 3SK8A 3J80i 1XTCD 2DN8A 3HGBA 2SEBD 2A8VA 4NXMQ 4A3JG 2OQ0A 4LF7L 1VQ4A 4LF6L 2ASBA 1LTLA 2MUYA 3RN5A 2ES2A 4LF8L 1EYAA 3NTIA 3FKIH 1WVLA 3IAYA 4BY7B 3N52A 3HOZB 3EFXD 2IWHA 5C0XG 4UY8C 3BVGA 1Z7TA 1H9SA 1TWAB 4RWSC 2HT1A 5EKLA 2A1AA 3AEVA 1QE6A 1T9HA 3MXPA 4ABNA 2XNAC 5FK9C 1Z47A 3X3NA 5D3IB 1EY0A 3I2ZA 1JJ2A 3BVZA 3KBXA 1JWSD 1UE5A 4F87A 2WFWA 2NYZD 2QDBA 4P71A 2WAQB 3CKIB 4NKLA 5C0XH 2RCNA 2G5DA 5EJWA 1C8CA 2HQEA 5T1IA 1SJED 3QWNA 2OCEA 1K8GA 3H0GH 4P74A 1JR0D 3IKJA 3I73A 3GTLH 3PF4A 1M90C 2B2WC 1BNZA 3K5OA 2HIVA 3GTOH 2KHSA 1CQVA 1DZ1A 5LMNW 1X55A 4LUOA 2LY7A 1TY0A 5E1FA 1I6HB 1IKLA 5IGDA 4NXNL 2JA6B 2KEDA 2FJ2A 3U4VA 3VR4A 4IPCA 4DR6Q 1XMQQ 1U4PA 2WP8J 3MTSA 3U4ZA 5JEAG 3A56A 5JJIA 1AZPA 4R4OA 1GHJA 1S5CD 1WTRA 2VY3A 4HJ9A 1L0XB 1STBA 3WDNA 2RHQB 3PGZA 3CCVA 4C3IG 5C3WA 3Q24A 3PQIA 5LMUL 1Y8NB 4HIMA 4IUUA
chains in the Genus database with same CATH topology
3NHHA 4LJZC 5D65A 4BA2I 1II3A 2J4XA 1GUTA 2EJFC 3RUZA 5K5PA 5JEAH 3K7AB 3A55A 4A3BB 1CT1D 3TP7A 4KY5A 4IN3A 3U9SA 1FNVA 2ZXOA 3OIQA 3CQZB 2WIIB 2F0FA 1S5DD 3H91A 4XIGS 1VDZA 1RTOA 4RCNA 2K5WA 1T5XD 4N9TA 1D2BA 5C44B 5I9PA 2H4OA 3GTGB 5I9OA 2JXMB 1TS3A 4DA2A 4IUVA 2R3ZA 1YNJD 4H44C 1PTOC 3HZXA 4DAPA 1B50A 1EEID 1VF5C 1GJXA 1ILQA 2DNCA 4DNTB 2ICEC 1AEXA 5I2XA 3I4MB 1M4VA 2B63B 3TZUA 1SDFA 1ML0D 4IZ8A 1B44D 1MBYA 3M4YA 5BN4A 2JEBI 1EIGA 4U673 2EY5A 2MHVA 2B2UA 4IUNA 1TWCB 2JP1A 5CGKA 1R9TB 1UAPA 3S1NB 4S3SA 4DGZA 3E0JA 5EPJA 5KGUA 5EQ0A 5IGBA 1B9MA 3A54A 3Q23A 2DY7A 2F0OA 1V8QA 3OWEB 1BO0A 4A3EB 4E6IA 1Q3LA 3QOJA 3I4NB 2F0KA 2A73B 5TSSA 3CU7A 1ZEQX 1JOOA 2O2LD 3K58A 2K6AA 2E2IB 1PRTC 1BCPD 3QG1A 1EYDA 2F0WA 3AMUA 3GTMB 4R8NA 3D8GA 2L9HA 4KTAA 2YYZA 4X3SA 1BCPF 3GO5A 2EZVA 2ZXPA 1WTVA 3D3RA 1A3TA 3BVMA 3HOUB 4BA1I 1SNQA 1SYGA 3NBHA 2D2CC 5G3LD 2EJMA 5JPNC 3C46A 2AWNA 3J7YW 4EGVA 3I3CA 3P7JA 5DM63 4FXKC 4M1UB 1S5ED 1F9PA 1Q1BA 5CBEE 4KKUA 1XYIA 2D9UA 3EVQA 1ENFA 1BQQT 1F2LA 4RH6A 1CA6A 1D5XC 2B2UC 2WINB 1EY8A 4WJWA 2WKCA 2M2LA 1SYBA 3BZDB 1SNMA 1HQMC 4FXGC 4RGNA 2SOBA 2HDLA 1FNWA 5LL6X 3FPPA 5IGGA 2A68D 5M3FB 1GUWA 1IKMA 4A3GB 4HMIA 3V2TA 1J8IA 1PZID 4PMWA 3CRLC 1O80A 4HEDA 2FINB 1H9KA 4C3HB 3MXUA 5C4HA 1G2SA 1SE2A 4HTHA 2EYHA 3P20A 1QWYA 1PZKD 3K59A 2VXWA 3SK6A 1BXTA 2J7ZA 1R4PB 1U9RA 3J80L 1KDAA 1SE4A 2NUCA 3L7ZC 3A8KE 1AZQA 4TQUS 2WB1B 1AN8A 2F0LA 4ZLTF 1I4QA 3WOEA 5J1ZA 5M5WB 1NSNS 4FF4A 5I6YA 5KYLA 4B9XA 1EQVA 1BUVT 3A8IE 3FPUB 5IGFA 1C48A 1MGSA 3VR2A 1CHPD 2E2JB 1IYVA 3BYYB 1QNUA 1TIID 1AFPA 4OGQC 4G7ZC 1HA6A 2L55A 1YNND 1O7YA 4X3KA 3R2TA 4F88A 4FP5D 1GUSA 2PZTA 4FNFA 4DK1A 2F0PA 2WV6D 4TRDA 2NZ1D 4PMCA 3J7AV 4CGYB 3I4LA 2F4IA 4DAVA 4NMZA 5C4XB 1X3QA 2HCIA 3RMHA 1IHZA 5CV9A 3GV6A 5A35A 1K8OA 3S15B 2F0NA 4FO2A 2A69C 1SE3A 2B39A 3AB9A 1SYDA 3C3LA 1B3AA 1V1PB 5EBDA 4G7HC 3EA6A 2R92B 1LT6D 2A74C 1SMYD 5D14A 3S17B 2BCOA 3NQTA 2NB0A 2VB3X 3MHBA 1TS2A 5JVH3 1ILPA 5DNFA 3HOXB 4NDXA 4CJ1B 3I8ZA 1HUNA 3IFTA 2E2DC 2EXZA 4H0LC 5DEHA 3MXGA 1H9SB 2R93B 3LWEA 1GHKA 2LFNA 3C1EA 2PZWA 1I4GA 4KMUC 3F2UA 3KUPA 1NAPA 4B08A 1Q12A 2KCCA 4IFDG 1Z6HA 4F8MA 1PTOB 4KD4A 3ZYYX 1F2YA 1DM0B 1PFNA 1C4QA 1RJTA 5JOBA 2C9OA 2N88A 5IT9L 1KLUD 4R8IA 2EYMA 3GTOB 3FVQA 3TP8A 2Z1CA 1LTID 1E2VA 2XN9C 3MEHA 1CHQD 1W6JA 1TQOA 2R61A 3IL8A 1QCBD 2PPBC 1JB3A 2KCNA 1SNCA 4XXEA 1PZJD 3MFGA 5FLXL 3R8BA 2JA8B 2J0TD 4LAAA 1I50B 4G57A 3VR3A 3Q0AA 4A3MB 1F77A 2JE6I 1TKWB 4DU9A 4OO1I 1T5EA 2EYFA 5JAVA 1EZ6A 1LO5D 5J39A 3DHQA 2RKSA 5I2YA 1PRTB 3GQBA 1OO9B 1KTKA 1A2TA 2X6GA 1D1IA 3MFYA 1KNAA 3VYRA 4P2CB 3S2HB 4FVMA 3X3MA 1SJHD 1WCMB 1SSOA 5IGEA 5FKAC 3LWUA 4BWGB 1STAA 3I72A 2RDFA 1JWMD 2ENBA 2MJ8A 1Q1EA 4K8JA 1CK1A 1GUNA 1Q90A 2F03A 1EY5A 2A6ED 5ELFA 3QOLA 4ULLA 3TN2A 3PUVA 3A8JE 1STGA 2GA4B 1CZGA 1XWEA 3G7LA 3DM1A 3WOFA 2IX0A 2JYOA 3SE0A 5FOBB 5M5YB 2RVLA 1EY9A 1EY4A 3BS1A 1EFID 1F9RA 1VMCA 1V1OA 2KA7A 1OXUA 3NPPA 4RHSA 1HA5A 5CV4A 2VNUD 1Y1VB 2PW7A 4K5WA 2A6HD 1PDQA 3L9AX 3NTHA 2O5IC 4KN7C 1SNOA 3HG9A 2O4XA 4K2LA 1YNJC 2XWBB 3HOVB 2RQXA 1LACA 4A3IB 5EBCA 1H9JA 1RCVD 2Q8RE 3MWYW 3OOCA 5ELBA 5IOCA 1WTOA 1HFNA 2EJGC 1FGBD 1LABA 3J80E 4FYDA 3I90A 4O42A 1CFMA 4IFDI 5A2QL 1OXVA 1H9MA 2FMCA 2F3WA 3HOYB 2QKIC 4I7ZC 4DXFA 4M8AA 2PZUA 3BDLA 2QEJC 1Y1WB 1ZYRD 1TVXA 5CR3A 4ZAIA 2BDNA 1CM9A 2X6LA 1KABA 1HQRD 3NTKA 1D1KA 2PW5A 4XQQA 4ZUJA 3M3YB 2EY6A 3QIAA 2E2HB 5LL6S 2F0GA 3T13A 1PXUA 2NN6I 2MGSA 3R2IA 1CI3M 2NVTB 5F2DA 1PYWD 2EDGA 2RDGA 4ID6A 1D5MC 2C5CA 4MIUA 5EKKA 1A3UA 1HCZA 5COYA 2D5DA 4Z9CB 1V43A 1BCPC 1VMPA 3SHLA 1SNPA 5JPMC 5CYUA 1B53A 1EWHA 1SBBB 3OW7A 3ND9A 4CJ2C 2FFKB 3E5SA 5ELEA 3OWFA 3NWSA 2PQEA 2L5TA 3QO2A 1SEBD 3HEJA 4FF2A 4CKEA 3SEBA 4RFBA 3VYTA 5ISRA 1HHVA 1EY6A 3NSWA 4OL7A 3T56B 5KNDA 3JAME 4HAEA 3SXHA 1G91A 3GTPB 3MC0B 1LTAD 2AQ3B 1EIHA 4XT1B 4HSPA 2B2TA 1CZWA 3BG3A 1WD0A 1LV9A 2NTTA 2KUMA 4H13C 2HCCA 2Y0SB 5EPKA 3Q22A 5M9OA 5KNCA 2E76C 1ONLA 1STYA 4XQJA 5G3LF 2A68C 3J81L 2L0CA 2QILA 2RA4A 3CRKC 5IT9E 1TWHB 1GUOA 2EE1A 1NUCA 2F0VA 1TWFB 2AUKA 1X3PA 2LKVA 1B1ZA 2XWJB 1DOLA 2VUMB 4XDXA 1XXGA 3RZOB 1EU4A 4IALA 2H1EA 3M85A 1RD9D 3PIO3 2X69A 5FLXE 2L4NA 3D4DA 3OHXC 2PO4A 4EVOA 1QNKA 4KY7A 4IUPA 4KD3A 4C3JB 1TY2A 1F9QA 1D6EC 2NBFA 1NR2A 4L6TB 1WTQA 4O1NA 4OO1G 2ICIA 3OMGA 4V190 1JORA 2PCFB 3V05A 4AYBB 2KOLA 1YNNC 4ZK9B 3MXNA 3GTJB 5J22A 1WTXA 4ME5A 3E6ZX 4F7XA 1CQFA 1R4QB 2B2TC 1G6ZA 5EKIA 4K6LA 5T1GA 1FNUA 4PV1C 3K5MA 1A3VA 2OT2A 1I3QB 3VA7A 1D5ZC 1IW7D 4DXGA 4PNYA 1XX8A 1KLGD 3M7GA 5C3EB 2BE5D 3R93A 3TMEA 1IL8A 4WRDA 2K33A 1JOKA 1Q8IA 1TT2A 3AU7A 1SMYC 4DFAA 2FMMA 1LTGD 3VYSA 4C56C 2SDFA 4QF4A 2LMCB 1U4RA 1IYUA 1EOTA 4ILWA 2KVMA 2EOTA 4HCEA 3PIP3 5FO8B 1OXSC 2F0QA 3TP5A 5BN5A 4B9WA 3S16B 4QIWB 4CKCA 2F0DA 1HXYD 1LT3D 4KKTA 4C3HG 4QUFA 3K5NA 2ZXRA 1CTMA 2XSCA 1SNDA 2NVQB 4OIKA 4ZQ3A 3JAML 1MSHA 4YIJA 2AQ1B 4K2KA 3D31A 3ITPA 3DUZA 1KDBA 1ICWA 1I4RA 5I4DA 3FKIB 1PFBA 2BA1A 3TDQA 3OPOA 3C2PA 2TSSA 5BN3A 1HUMA 5LHY1 2B8GA 2EYOA 3D6CA 5A2QE 3G6JB 5K36G 3HKZB 4KJOA 2F3VA 2K5DA 3NP8A 1MI2A 1ESRA 4G4KA 1ESFA 4HN7A 1HRJA 3KBGA 3W2DA 3NQIA 1WD1A 3P1HA 3H0GB 4EQPA 5KNBA 3QB3A 2CW0D 4CKBA 3GTLB 1JOQA 2EY2A 4IFDH 3TSSA 2CHBD 1BOSA 2AUJD 4KHZA 1BF4A 1EYCA 1FYCA 1DD2A 1FR3A 2NN6G 1EL0A 1JWUD 1Y8PB 3PUWA 3J7AF 3KF8A 3M7NA 3I70A 1BCPB 2HUGA 3T51B 2IJ0A 3K6OA 4DN4M 1A15A 1TR5A 2G9DA 4ZKCB 5DAUA 2AQ2B 2E74C 2NN6H 1GXDC 4CJ0B 4XT3B 1I4XA 4KI0A 2OXPA 1JE4A 2K01A 2KJXA 3IFDA 3P75A 3NXWA 4J6HA 4C3IB 1NR4A 3ND8A 3NBIA 1PMRA 1TS4A 1X32A 5E4WC 2Z8LA 2WACA 3HS0C 3K5LA 4IUTA 5IIFA 2IPKD 4C1NK 1DCZA 2K04A 4G7OC 4QB4A 1BR9A 2A6EC 4A3FB 1QG7A 4NP5A 3OMCA 1SYFA 2SNSA 4KV6A 4CBVA 3TBIB 2WKDA 2A5HA 4CHTB 2F0IA 4RHRA 5KYIA 3PV0A 3BYTB 2K5QA 2JA5B 4BBSB 3DWPA 2K28A 5AFWA 3PO3B 2BA0A 1GUGA 2KEEA 1M8AA 1PTOH 1W6KA 3J81E 1I4HA 5E4XA 1STNA 3H94A 2A6HC 3QJYA 2Z4HA 4A3DB 4HR7B 4ODGA 3GTKB 1EWCA 2IX3A 5NUCA 3T16A 2TMPA 3ERQA 4QCLA 3DWAA 4EQNA 3PO2B 5KRUA 5C0XJ 3M4OB 3I91A 1G8ZD 4A93B 5M3MB 3A7LA 1Y69U 3T4AC 3D4RA 3GTQB 3V96A 1ZYRC 1ZKOA 1B4OA 2F0SA 3PUZA 1QJOA 1HFGA 4DNRB 3L3OC 5KEEA 5C5MA 3SR1A 4X3UA 1VCIA 4QUCA 4FF1A 2JEAI 3DEPA 2NTSA 4RGMA 3NWTA 1S4ZA 4XYQA 2N55A 3S14B 1RKNA 4KN4C 1OXXK 3FRPB 4Q0FA 3S9WA 5JEAJ 1JC7A 1G291 1PFMA 3DEOA 2R6GA 1H9RA 4ZRZA 4EQOA 1RTNA 1UNSA 4LMQD 2SNMA 3HOWB 1BBXC 1U4LA 3BDOA 4J1MA 2XVSA 4Q5VA 2AWOA 1E0BA 4C2MB 4K8IA 1O7LA 4KK7A 2RDHA 2E75C 2EYLA 3MVVA 5C4ZA 2Q8IB 3ONAB 2LS01 3OIPA 1RDPD 2BDOA 1U4MA 1HTPA 3NE5B 3T53B 3MAQA 4RKLA 3MZ5A 4JBWA 1LT4D 1I4PA 4K14A 1DJRD 1LTBD 4HSVA 3N6RA 1E2ZA 3KLSA 3FDTA 3UI2A 1DOKA 1PTOD 5FO9B 1A2UA 4IUQA 2I46A 2V4DA 4RCOA 2B2VA 4HCSA 4BS9A 5M5XB 3PUYA 1MD2D 4ZUIA 2F0HA 1PTOF 5JVG3 4KJNA 4BY1B 2F0EA 2XIWA 2BOSA 2O5JC 4FF3A 3LNNA 4BBRB 1AW7A 3S1MB 4OIJA 3RLFA 4DF7A 2DNEA 5C0XI 2L11A 1PLFA 1B2TA 5EPLA 4IURA 1QILA 1CA5A 1ENAA 4U68A 3KK7A 1TWGB 4RGOS 1LTTD 3PMFA 3U9OA 1KNEA 1LT5D 1ET9A 4TSSA 4LK1C 1SFOB 3NK9A 4KKSA 3SK5A 1F2ZA 5E3FA 3VYUA 2OEOA 4C1NI 1PRTD 4RKBA 3SDZA 2RSNA 5CV5A 2XRQD 4WORA 3FEWX 1STEA 2F0TA 1PRTF 2PNRC 3CHBD 2NVYB 3KLSX 4UAIA 1KAAA 2ZT9C 1SYCA 4MHEA 4RGTA 2IW3A 5IGCA 3SVMA 1DXMA 2EPBA 3HRZC 3A7AB 1EY7A 5CC4A 1A6XA 2RBMA 2IT1A 2CQAA 1UEAB 4PMBA 3GV3A 2B2VC 3URYA 4QMGA 2EY1A 4NW2A 1ET6A 2K7VA 2M9VA 1IW7C 5C6AA 2BE5C 3VR5A 4FXDA 3Q6SA 5HGTA 3HP3A 3D4WA 3R3OA 2L12A 3TZDA 5EGTA 1OXTA 5CV7A 3C1FA 1LLRD 2RSOA 1FD7D 2KQ3A 2K1BA 4GZYC 1F2MA 1DYQA 2HDMA 3VA5A 4OO1H 5I6WA 1JCKB 4R9WA 3TP6A 4ZYSA 1B9NA 4ZKBB 1Y8OB 5C5LA 3OSOA 4H7BA 1HTLD 2B8FA 2CVRA 2K05A 1O7ZA 4HMJA 2JSOA 2G9HD 3H6MA 1S5BD 4J8QA 2Z4IA 2XRSD 2JA7B 2L1BA 5HURA 1JICA 1RF2D 4V0BA 4K5XA 5ELCA 4RA8A 1AP0A 5C4JB 5CORA 1K83B 1RODA 3H3VC 1EU3A 2MPMA 4XQNA 1EZ8A 4OHJA 2R7ZB 4L8JA 1QOHA 3H09A 3RD4A 1F9SA 4C3JG 1KDCA 2K03A 4DAYA 5CV8A 1TU2B 4K6DA 2DY8A 1LTSD 1L0YB 1NCVA 1SXTA 2B2YA 3PUXA 2YU9B 1E2WA 2F1MA 5FO7B 4KY6A 1UUPA 2I07B 3LX0A 3VR6A 2EYJA 2F0JA 2CW0C 1BDOA 1EQTA 1QB5D 1HPCA 5KIXA 1RHPA 4JK1C 5JJZA 4MN3A 4A3JB 2F0MA 2PMZB 3S1QB 4WFN3 2EVBA 2IL8A 2ID0A 1LTRD 2D62A 3GD7A 5IODA 3NUCA 5DM73 1MSGA 1EEFD 3EJIA 4XYOA 3BDCA 4IQZA 5CBAE 2A69D 3EQLC 3EROA 3DWQA 4UDUC 1WTWA 2EYPA 1O78A 4RAUC 3RZDB 5CV6A 5K36H 3K0YA 1S5FD 4L63B 4Y7NB 4KHVA 3K57A 3DMUA 3O13A 4K5VA 1WTPA 3MA2B 2K32A 2FHTA 1ENCA 2QF7A 3GP7A 2B2WA 3W3AA 2QCPX 2VB2X 4TKOB 5D3DA 1SYEA 4PQXA 1K8MA 1TS5A 3D6WA 2M00A 2OF1A 1DOMA 4I65A 1G2TA 3S2DB 2F0UA 3SK4A 2IX1A 4X3TA 3FMCA 1I6VC 2Q8TA 1VF7A 2NVXB 1JQYD 5C3XA 2PYKA 1SAPA 2KECA 2NWGA 1ZXTA 4IFDJ 4XTCS 4DK0A 5ELDA 3DXJC 1STHA 2B2YC 3S1RB 4N9PA 1J9OA 3KLRA 5CMDA 1DONA 1V1PA 1GOZA 2MP1A 4A3KB 3SK8A 1XTCD 2DN8A 3HGBA 2SEBD 2MUYA 1EYAA 3NTIA 1WVLA 3IAYA 4BY7B 3N52A 3HOZB 3EFXD 2IWHA 5C0XG 3BVGA 1Z7TA 1H9SA 1TWAB 4RWSC 5EKLA 1QE6A 3MXPA 4ABNA 2XNAC 5FK9C 1Z47A 3X3NA 5D3IB 1EY0A 3BVZA 3KBXA 1JWSD 4F87A 2NYZD 2QDBA 2WAQB 3CKIB 4NKLA 5C0XH 1C8CA 5EJWA 2HQEA 5T1IA 1SJED 3QWNA 1JR0D 3IKJA 3I73A 2B2WC 1BNZA 3K5OA 2KHSA 1CQVA 1DZ1A 2LY7A 1TY0A 5E1FA 1I6HB 1IKLA 5IGDA 2JA6B 2KEDA 2FJ2A 3VR4A 1U4PA 2WP8J 3MTSA 5JEAG 3A56A 1AZPA 1GHJA 1S5CD 1WTRA 1L0XB 1STBA 3WDNA 4C3IG 5C3WA 3Q24A 1Y8NB 4IUUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NZ1 D;  4OIJ A;  2N55 A;  3Q6S A;  2B2Y C;  2JP1 A;  3HP3 A;  5D65 A;  2M2L A;  1MI2 A;  1ESR A;  2L11 A;  1J9O A;  2L12 A;  2MGS A;  3TZD A;  5CMD A;  5EPJ A;  1DON A;  3TN2 A;  1X3Q A;  1PLF A;  1XX8 A;  2RSO A;  5EQ0 A;  1HRJ A;  2RA4 A;  1B2T A;  2HCI A;  2HDL A;  3R93 A;  3G7L A;  2MP1 A;  1WD1 A;  3DM1 A;  1EQT A;  3GV6 A;  5EPL A;  4IUR A;  1PFM A;  3DEO A;  2DY7 A;  1IL8 A;  2K1B A;  1CA5 A;  1RHP A;  2K28 A;  4U68 A;  2JYO A;  3IL8 A;  5AFW A;  5JJZ A;  2EE1 A;  2RVL A;  1BO0 A;  2HDM A;  4MN3 A;  1GUW A;  1IKM A;  1F9R A;  5COY A;  1VMC A;  1X3P A;  1Q3L A;  1KNE A;  2IL8 A;  2KEE A;  1M8A A;  1J8I A;  1G6Z A;  4R9W A;  1DOL A;  1RTN A;  2FMM A;  1VMP A;  1O80 A;  3H91 A;  4HED A;  4LMQ D;  5E4X A;  1B3A A;  2SDF A;  1U4L A;  2FIN B;  4ZKB B;  1WVL A;  1BBX C;  1BF4 A;  3N52 A;  1RTO A;  1MSG A;  1U4R A;  1G2S A;  1E0B A;  1B53 A;  1EOT A;  2KVM A;  4XDX A;  5CBA E;  2EOT A;  4CJ2 C;  2FFK B;  1EL0 A;  2CVR A;  5D14 A;  4RWS C;  1WTW A;  1QE6 A;  2K05 A;  1PDQ A;  2H1E A;  4RAU C;  2VXW A;  1O7Z A;  3ONA B;  3QO2 A;  2J7Z A;  2X69 A;  2L9H A;  2RSN A;  2L4N A;  2HUG A;  4X3S A;  1ILP A;  3KBX A;  5DNF A;  1U4M A;  4DN4 M;  1A15 A;  4CJ1 B;  1QNK A;  2NYZ D;  3I8Z A;  1WTV A;  4ZKC B;  1WTP A;  1AZQ A;  1HA6 A;  1HHV A;  1HUN A;  4IUV A;  4IUP A;  5EJW A;  1C8C A;  4QUF A;  5T1I A;  2L1B A;  4ZLT F;  2R3Z A;  4CJ0 B;  2FHT A;  4XT3 B;  2X6G A;  3I91 A;  1JIC A;  2Q8R E;  3MWY W;  3LWE A;  4HAE A;  2B2W A;  1JE4 A;  1F9Q A;  4HSV A;  4OIK A;  2K01 A;  1B50 A;  4RA8 A;  1KNA A;  2B2W C;  4UAI A;  1WTO A;  3FDT A;  1BNZ A;  3UI2 A;  3IFD A;  1HFN A;  1DZ1 A;  1AP0 A;  1MSH A;  4MHE A;  3F2U A;  1NR2 A;  3KUP A;  1G91 A;  3I90 A;  1WTQ A;  1ILQ A;  1NR4 A;  1DOK A;  3FPU B;  4O42 A;  5COR A;  3SVM A;  3I3C A;  3D6W A;  1ROD A;  2EPB A;  1B4O A;  1MGS A;  1NAP A;  1DOM A;  4IUQ A;  1IKL A;  1G2T A;  1X32 A;  5E4W C;  1SSO A;  2MPM A;  2KOL A;  3P7J A;  2B2V A;  1HFG A;  4HCS A;  2KED A;  3GV3 A;  2FJ2 A;  4ZK9 B;  4X3T A;  1ICW A;  1ML0 D;  1SDF A;  2B2V C;  1F9S A;  4IUT A;  1EIH A;  2K03 A;  4XT1 B;  1TVX A;  4X3U A;  1PFN A;  2K04 A;  1F9P A;  2Q8T A;  1U4P A;  4NW2 A;  1PFB A;  1WTX A;  3MTS A;  2B2T A;  5CBE E;  1RJT A;  4QUC A;  4ZAI A;  2BDN A;  2N88 A;  1WD0 A;  1CM9 A;  1XYI A;  1EIG A;  1HUM A;  1LV9 A;  2B2T C;  1O7Y A;  2D9U A;  2X6L A;  4X3K A;  5EKI A;  1WTR A;  1AZP A;  2KUM A;  3DEP A;  2HCC A;  4R8I A;  5T1G A;  1F2L A;  2MJ8 A;  1SAP A;  2DY8 A;  2XIW A;  5EPK A;  1QG7 A;  2B2U A;  2KEC A;  1CA6 A;  2NWG A;  1S4Z A;  1ZXT A;  2B2U C;  1NCV A;  2B2Y A;  4IUU A; 
#chains in the Genus database with same CATH topology
 3NHH A;  1VS0 A;  2ZTE A;  4LJZ C;  5D65 A;  4BA2 I;  4K0K L;  1II3 A;  4AIM A;  2J4X A;  1GUT A;  2EJF C;  3RUZ A;  5K5P A;  3JAM i;  3UDF A;  1ASY A;  4A3K G;  5JEA H;  2BH8 A;  1LYL A;  1VQJ A;  2VL6 A;  3K7A B;  3A55 A;  4A3B B;  1CT1 D;  3TP7 A;  4KY5 A;  4IN3 A;  4X64 L;  3U9S A;  1FNV A;  4A3F G;  2ZXO A;  3OIQ A;  3CQZ B;  2WII B;  2N8N A;  1BKB A;  1J5E Q;  2F0F A;  3CCE A;  1O7I A;  1FL0 A;  1YJW A;  1S5D D;  3H91 A;  2DJG C;  1YHA A;  4XIG S;  1VDZ A;  3F1Z A;  1RTO A;  1K8A C;  4RCN A;  3W1B A;  2K5W A;  2JA5 G;  1T5X D;  4BBS G;  3T1H Q;  4N9T A;  1WFQ A;  1D2B A;  5C44 B;  1C7Y A;  4A3F H;  4LUZ A;  5I9P A;  3K8A A;  2H4O A;  1YHB A;  1A62 A;  3GTG B;  3B6Y A;  2JXM B;  5I9O A;  1TS3 A;  4GNX B;  4DV4 Q;  1YVC A;  1L1O B;  4DA2 A;  4IUV A;  4BBS H;  4A3D G;  2R3Z A;  1Q46 A;  1UE1 A;  1YNJ D;  4H44 C;  4JI2 Q;  3EIV A;  3PO3 H;  1PTO C;  3HZX A;  4DAP A;  1GD7 A;  5IE8 A;  1B50 A;  2RF4 A;  1EEI D;  3ZJY C;  2LXK A;  1VF5 C;  1GJX A;  3J81 c;  2D0P A;  4PG3 A;  1ILQ A;  3EBE A;  2DNC A;  5H1S E;  4DNT B;  3PO2 G;  1HH2 P;  2ICE C;  1AEX A;  5I2X A;  3I4M B;  1M4V A;  4A3D H;  2B63 B;  3GTK H;  3TZU A;  2F4V L;  1SDF A;  1ML0 D;  4IZ8 A;  4A93 G;  1B44 D;  3KFU A;  5M3M G;  4DV7 Q;  1MBY A;  4A4I A;  3M4Y A;  5BN4 A;  2JA9 A;  2JEB I;  1EIG A;  1C0A A;  4U67 3;  2EY5 A;  2MHV A;  4ME3 A;  1WYD A;  2B2U A;  4IUN A;  2ALY B;  4OWX B;  3PO2 H;  1NMG A;  1TWC B;  4CDF C;  4LF9 Q;  5IYB G;  3M4O H;  4MTK A;  2JP1 A;  4UP8 A;  5CGK A;  1UAP A;  1R9T B;  4A93 H;  3S1N B;  4S3S A;  4DGZ A;  3E0J A;  1SRU A;  1QUQ A;  5EPJ A;  5M3M H;  1PH9 A;  3HKS A;  5KGU A;  5EQ0 A;  4MNO A;  5IGB A;  3CCR A;  1B9M A;  3A54 A;  3HFZ B;  3Q23 A;  2DY7 A;  2F0O A;  1V8Q A;  1A63 A;  4AQY Q;  5GRO A;  3OWE B;  1BO0 A;  1L2F A;  5IYB H;  4A3E B;  4E6I A;  1HNZ L;  2JJQ A;  1Q3L A;  3QOJ A;  3I4N B;  1TXY A;  2F0K A;  2V1C C;  2A73 B;  4A3I H;  1VQC A;  5TSS A;  3CU7 A;  4X62 L;  1ZEQ X;  1JOO A;  4B3M L;  3MXN B;  2O2L D;  4QGU A;  3K58 A;  2K6A A;  2E2I B;  1PRT C;  3W5O A;  3KJP A;  1BCP D;  1J6Q A;  3QG1 A;  1G6P A;  4MTN A;  1EYD A;  4DV0 Q;  2F0W A;  3AMU A;  1UWV A;  3GTM B;  1VQF A;  4R8N A;  5AJ3 Q;  3D8G A;  1U0L A;  2L9H A;  3S14 H;  4KTA A;  2YYZ A;  4X3S A;  1BCP F;  3GO5 A;  2EZV A;  2ZXP A;  2PQA A;  2CKZ B;  1WTV A;  2HD3 A;  3D3R A;  1A3T A;  1IBK Q;  3BVM A;  3HOU B;  4BA1 I;  1SNQ A;  1SYG A;  3NBH A;  1A8V A;  2D2C C;  5G3L D;  4NXM L;  2EJM A;  1WI5 A;  5JPN C;  3M3Y H;  3C46 A;  2AWN A;  4GLX A;  2OWO A;  3J7Y W;  4EGV A;  3HOW H;  3I3C A;  2KHI A;  4A3C H;  4R4T A;  1SN8 A;  2B63 G;  4C2M H;  3P7J A;  5DM6 3;  3Q8D A;  4FXK C;  4M1U B;  1S5E D;  3M4Q A;  1F9P A;  1Q1B A;  2HQL A;  1OTC A;  5CBE E;  3STB C;  1UE7 A;  4KKU A;  1XYI A;  1N8R C;  2D9U A;  4YCV A;  3EVQ A;  1ENF A;  1YJN A;  1BQQ T;  1F2L A;  4R4I A;  4RH6 A;  4DV2 Q;  1D5X C;  1CA6 A;  2B2U C;  2WIN B;  1EY8 A;  4WJW A;  3UE0 A;  2WKC A;  1RL2 A;  1AE2 A;  2M2L A;  1SYB A;  4LUV A;  3BZD B;  1SNM A;  1HQM C;  4FXG C;  4H02 A;  1SR3 A;  4RGN A;  2SOB A;  2HDL A;  1FNW A;  5LL6 X;  4BY1 G;  2DUD A;  2VS1 A;  3L2P A;  3FPP A;  1X3E A;  5IGG A;  2A68 D;  1E1T A;  2JN4 A;  5M3F B;  4A3E G;  1PH6 A;  1GUW A;  1IKM A;  4A3G B;  4HMI A;  3V2T A;  2GVA A;  1J8I A;  1YHQ A;  1PZI D;  1Y14 B;  5M5X H;  2CH4 A;  4PMW A;  3CRL C;  1O80 A;  4HED A;  1VQM A;  4GOP B;  2FIN B;  1H9K A;  3CXC A;  4IPD A;  4C3H B;  4JV5 Q;  3MXU A;  1G2S A;  1SE2 A;  4HTH A;  5C4H A;  2EYH A;  1JMC A;  4DR6 L;  1XMQ L;  3P20 A;  4DR3 Q;  3K81 C;  4LW1 A;  1X9N A;  1QWY A;  1PZK D;  1GKH A;  5ELN A;  3K59 A;  2K5V A;  2VXW A;  3GTP H;  3SK6 A;  4BBR H;  3S1M H;  2YTX A;  1BXT A;  2J7Z A;  2Q2H A;  1R4P B;  1HZ9 A;  1U9R A;  1NNX A;  3J80 L;  1KDA A;  1SE4 A;  4OON A;  2NUC A;  3L7Z C;  3A8K E;  1AZQ A;  4TQU S;  2ZJP A;  2WB1 B;  3HOU G;  1AN8 A;  2F0L A;  4ZLT F;  1I4Q A;  2PMZ E;  1TWG H;  2B3G A;  3WOE A;  4GKJ Q;  5J1Z A;  1FVI A;  5M5W B;  1PV4 A;  4UPA A;  1NSN S;  4FF4 A;  4GLV B;  1X56 A;  5I6Y A;  5GAH C;  3KF6 A;  5KYL A;  5IYC G;  4B9X A;  1EQV A;  4HIK A;  1BUV T;  3A8I E;  4ZCK A;  1J5E L;  3FPU B;  5IGF A;  1C48 A;  1MGS A;  3BZC A;  1K0R A;  3VR2 A;  1CHP D;  1V9P A;  1MJE A;  2E2J B;  1IYV A;  3BYY B;  3T1H L;  4OXP A;  2VW9 A;  1QNU A;  1TII D;  1AFP A;  5ELO A;  2K75 A;  3KF8 B;  4OGQ C;  4G7Z C;  2EQS A;  2L55 A;  2PNH A;  1YNN D;  1HA6 A;  1O7Y A;  4X3K A;  3R2T A;  4L5R C;  4F88 A;  4X64 Q;  4FP5 D;  1WJJ A;  2XGT A;  1GUS A;  2PZT A;  4FNF A;  4DK1 A;  1HJP A;  2F0P A;  2WV6 D;  4TRD A;  2NZ1 D;  4PMC A;  2I5L X;  3J7A V;  4CGY B;  1G51 A;  3I4L A;  5FLM G;  2F4I A;  4DAV A;  4NMZ A;  5C4X B;  1X3Q A;  1Z9F A;  1XNQ Q;  2HCI A;  4JI2 L;  3RMH A;  1VQK A;  1IHZ A;  5CV9 A;  3GV6 A;  5A35 A;  1K8O A;  4A76 A;  4BXX G;  3S15 B;  4PZ6 A;  2F0N A;  1K9M C;  1B3Q A;  4A3G G;  4FO2 A;  2A69 C;  1SE3 A;  2B39 A;  3CF5 A;  4LF4 Q;  3AB9 A;  1PH5 A;  1SYD A;  2EIF A;  3C3L A;  1B3A A;  1V1P B;  4HIO A;  5EBD A;  4C3J H;  3G6E A;  4G7H C;  3EA6 A;  3CPF A;  3KDF B;  1MHW C;  2OTJ A;  2R92 B;  1LT6 D;  2A74 C;  1SMY D;  5D14 A;  5DLQ E;  3S17 B;  2BCO A;  3NQT A;  2NB0 A;  2VB3 X;  3MHB A;  3UDI A;  1TS2 A;  5JVH 3;  4LF9 L;  1ILP A;  5DNF A;  3HOX B;  4NDX A;  4CJ1 B;  3I8Z A;  1HUN A;  3IFT A;  2E2D C;  2EXZ A;  4GLA C;  4H0L C;  4I7A A;  5DEH A;  3MXG A;  4RMF A;  1H9S B;  1DGS A;  3DLL A;  2R93 B;  1PH3 A;  3LWE A;  3RLO A;  1GHK A;  4GN3 B;  2LFN A;  3C1E A;  4AQY L;  4P72 A;  2PZW A;  1I4G A;  2GN5 A;  1I3Q H;  4JOI A;  4KMU C;  3F2U A;  3KUP A;  3J81 i;  3K80 C;  3AFQ A;  1NAP A;  3UE1 A;  4B08 A;  5JJK A;  1Q12 A;  2KCC A;  4JI8 Q;  4IFD G;  4IPG A;  1HR0 L;  1XNR Q;  1Z6H A;  1XMO L;  2JA7 G;  5C3E H;  4F8M A;  1PTO B;  4KD4 A;  3ZYY X;  1F2Y A;  1DM0 B;  1PFN A;  1C4Q A;  2QDL A;  1RJT A;  5JOB A;  2C9O A;  2N88 A;  5IT9 L;  3H3V I;  4JI5 Q;  1KLU D;  4R8I A;  5AJ3 L;  3I56 A;  2EYM A;  2WAQ E;  2E8G A;  3GTO B;  2UU9 Q;  3FVQ A;  2UUC Q;  3TP8 A;  2Z1C A;  2JA7 H;  3CD6 A;  1LTI D;  1E2V A;  2KCT A;  2R7Z G;  1IBK L;  2XN9 C;  3MEH A;  1CHQ D;  1W6J A;  1SE8 A;  1TQO A;  1WOC A;  2R61 A;  4KLK A;  3G48 A;  2I0Q A;  1XTD A;  3IL8 A;  1QCB D;  2PPB C;  1JB3 A;  2KCN A;  1SNC A;  4XXE A;  1K3B C;  2R7Z H;  1PZJ D;  3MFG A;  5FLX L;  3R8B A;  2JA8 B;  2J0T D;  4LAA A;  1I50 B;  4G57 A;  2F3I A;  3VR3 A;  1EUJ A;  4HJA A;  3Q0A A;  4YCW A;  4A3M B;  4DUY Q;  1F77 A;  1ICF B;  1KC8 C;  2JE6 I;  1TKW B;  4DU9 A;  4OO1 I;  2VQE Q;  1T5E A;  4DV2 L;  1PH8 A;  2YU9 H;  1BVS A;  3HOX G;  2EYF A;  5JAV A;  1EZ6 A;  1LO5 D;  5J39 A;  2YTV A;  3CC2 A;  3DHQ A;  4JC0 A;  3IRB A;  1EQQ A;  2RKS A;  5I2Y A;  1PRT B;  3BU2 A;  2KBN A;  3GQB A;  1OO9 B;  1KTK A;  1A2T A;  2R93 G;  2X6G A;  1D1I A;  2PI2 A;  3L0O A;  3MFY A;  1XPR A;  4A3J H;  1YEZ A;  3S1Q H;  1KNA A;  3VYR A;  4KHP Q;  4P2C B;  4DR1 Q;  4DV3 Q;  5IY0 A;  4Y52 H;  3S2H B;  4JOI C;  4IJH A;  1XPO A;  4FVM A;  3X3M A;  1SJH D;  1WCM B;  1SSO A;  5IGE A;  5FKA C;  3LWU A;  2A19 A;  1KRT A;  4JV5 L;  4BWG B;  1STA A;  4DR3 L;  2MQH A;  3I72 A;  3E9I A;  2RDF A;  4APV A;  3RZD H;  1VQP A;  3CCS A;  3UDX A;  4JI7 Q;  1JWM D;  2ENB A;  1HNW Q;  2MJ8 A;  1Q1E A;  2VZA A;  3TRZ A;  5IYD G;  4K8J A;  1CK1 A;  1GUN A;  1Q90 A;  1NTG A;  2F03 A;  4B3S Q;  1EY5 A;  2A6E D;  5ELF A;  3QOL A;  4ULL A;  3TN2 A;  3PUV A;  1NJI C;  3A8J E;  1STG A;  2GA4 B;  1CZG A;  2VQF Q;  1XWE A;  3G7L A;  4GKJ L;  3DM1 A;  3WOF A;  2IX0 A;  2JYO A;  3SE0 A;  5FOB B;  5M5Y B;  3QR8 A;  2RVL A;  1EY9 A;  3OYY A;  1EY4 A;  3BS1 A;  1EFI D;  1F9R A;  3WWV A;  2IY5 B;  3S2D H;  1VMC A;  1V1O A;  2KA7 A;  2JA8 G;  1OXU A;  3G71 A;  1QUQ B;  3NPP A;  3A5U A;  3ER0 A;  4RHS A;  1HA5 A;  1YI2 A;  5CV4 A;  2VNU D;  4A3M G;  4JI4 Q;  1Y1V B;  4DV1 L;  1YIJ A;  3OTO Q;  2PW7 A;  4K5W A;  2A6H D;  1PDQ A;  3L9A X;  3U58 A;  3NTH A;  4C3I H;  2O5I C;  4KN7 C;  1SNO A;  3HG9 A;  2O4X A;  3BZK A;  3CPW A;  1LUZ A;  4K2L A;  1YNJ C;  2XWB B;  4JYA Q;  3HOV B;  4DNI A;  2RQX A;  1LAC A;  4BY7 G;  3HOZ G;  4A3I B;  5EBC A;  4TVA B;  4A3K H;  1H9J A;  1XNQ L;  3ULJ A;  3S24 A;  1RCV D;  2Q8R E;  1X6O A;  3MWY W;  2Q2U A;  1XPU A;  3OOC A;  1PH4 A;  4JW0 A;  5ELB A;  5IOC A;  1WTO A;  1HFN A;  1I94 Q;  2EJG C;  1FGB D;  1LAB A;  3J80 E;  4FYD A;  3I90 A;  3GDE A;  4O42 A;  1CFM A;  2PQA B;  1WCM G;  4IFD I;  4BY7 H;  2KEN A;  5A2Q L;  1OXV A;  1H9M A;  4LF4 L;  3HOZ H;  2FMC A;  2F3W A;  2WAQ G;  3HOY B;  4J15 A;  2QKI C;  4I7Z C;  4EX5 A;  2XTI A;  4M8A A;  4DXF A;  5FJ8 G;  1EOV A;  2PZU A;  3NBH B;  3BDL A;  2JA5 H;  2QEJ C;  1Y1W B;  1ZYR D;  1TVX A;  5CR3 A;  1SRO A;  1VQB A;  1BBU A;  1VQ6 A;  4ZAI A;  2BDN A;  1CM9 A;  2X6L A;  1KAB A;  1HQR D;  3NTK A;  1GVP A;  1D1K A;  2PW5 A;  1PHJ A;  4XQQ A;  4JVZ A;  4ZUJ A;  4JPB W;  3M3Y B;  2EY6 A;  3QIA A;  2E2H B;  1FGU A;  5FJ8 H;  5GAD C;  5LL6 S;  2F0G A;  1QVG A;  3T13 A;  2JA6 G;  1PXU A;  2NN6 I;  2MGS A;  1N34 Q;  3R2I A;  1CI3 M;  2R7F A;  1N36 Q;  2NVT B;  5F2D A;  2Y0S E;  1PYW D;  2EDG A;  2RDG A;  3M4P A;  4ID6 A;  1D5M C;  4UHV A;  2P5Z X;  2C5C A;  4MIU A;  4WJ3 M;  5EKK A;  2K14 A;  1A3U A;  1HCZ A;  1WTH A;  1FJG Q;  5COY A;  2D5D A;  4Z9C B;  1V43 A;  1BCP C;  2Z0S A;  4JI8 L;  1VMP A;  3SHL A;  1SNP A;  1XNR L;  2JK8 A;  2GVB A;  1Y1V G;  5CYU A;  5JPM C;  1B53 A;  1EWH A;  1SBB B;  3OW7 A;  1KHI A;  3ND9 A;  4CJ2 C;  1KXL A;  2FFK B;  4A3B G;  3E5S A;  4JI5 L;  4OX9 Q;  5ELE A;  4LFB L;  2K52 A;  3OWF A;  3GTQ H;  3NWS A;  2PQE A;  2L5T A;  2UU9 L;  3QO2 A;  3K7U C;  1SEB D;  3HEJ A;  2UUC L;  4FF2 A;  4CKE A;  3HOV G;  2KCM A;  4DAM A;  3SEB A;  4QY7 A;  1NY4 A;  4RFB A;  2ZM6 Q;  3VYT A;  5ISR A;  1HHV A;  4OEM B;  1YNX A;  1EY6 A;  3K7A H;  1HR0 Q;  3NSW A;  1XMO Q;  4A3B H;  4OL7 A;  5C44 G;  3T56 B;  5KND A;  3JAM E;  4HAE A;  3KLW A;  3SXH A;  4JI1 Q;  4GKK Q;  1IL2 A;  2UXB Q;  1G91 A;  3GTP B;  2UXC Q;  3HOY G;  3MC0 B;  1VQ9 A;  1LTA D;  2AQ3 B;  1S3O A;  4JBJ A;  3I55 A;  5C44 H;  2N78 A;  1EIH A;  4XT1 B;  4HSP A;  4LFC Q;  4DUY L;  3GTG H;  2B2T A;  1CZW A;  3BG3 A;  1PH2 A;  4DK3 C;  1WD0 A;  1KL9 A;  1U5K A;  1LV9 A;  4X6A H;  2NTT A;  2KUM A;  4H13 C;  2HCC A;  4AYB E;  2VQE L;  2Y0S B;  5EPK A;  1IBM Q;  2WB1 E;  3Q22 A;  5M9O A;  5GAE C;  5KNC A;  3I4M G;  2H5X A;  2E76 C;  1ONL A;  1STY A;  4XQJ A;  4LFA Q;  5G3L F;  2A68 C;  3A0J A;  2AHO B;  3J81 L;  2L0C A;  4YWM A;  1GM5 A;  3J81 j;  2QIL A;  2RA4 A;  3CRK C;  5IT9 E;  5IP9 G;  1VQ5 A;  1TWH B;  4DR2 L;  4R4Q A;  1K28 A;  4KHP L;  4DR1 L;  1GUO A;  4DV3 L;  4JBM A;  3CCM A;  2EE1 A;  1NUC A;  2F0V A;  4DV6 L;  1TWF B;  4JG2 A;  2AUK A;  2B63 H;  4X66 L;  3F2B A;  1X3P A;  2LKV A;  1B1Z A;  2XWJ B;  1DOL A;  1NE3 A;  1KD1 C;  4HID A;  1CSP A;  2VUM B;  4DAY B;  2NZH A;  3NEL A;  4XDX A;  1XXG A;  3RZO B;  4JI7 L;  3CCJ A;  3W1G A;  3TS0 A;  1EU4 A;  4IAL A;  2H1E A;  1HNW L;  1TWC H;  3M85 A;  3DM3 A;  3CMA A;  1EFW A;  3AFP A;  1RD9 D;  3PIO 3;  2Z6K A;  2X69 A;  1R9T H;  5FLX E;  2L4N A;  3D4D A;  3I4N G;  1D7Q A;  1VQI A;  3OHX C;  1EQR A;  2PO4 A;  4EVO A;  4B3S L;  1QNK A;  4KY7 A;  3ULL A;  4IUP A;  4KD3 A;  3ICE A;  1Q81 C;  2VQF L;  1YIT A;  4C3J B;  2HHH L;  4BY1 H;  1TY2 A;  1F9Q A;  4A3E H;  2UUA Q;  1D6E C;  3RNU A;  2NBF A;  2Q2T A;  5HGQ A;  1NR2 A;  4L6T B;  3STB D;  1WTQ A;  4O1N A;  4OO1 G;  4WJ4 A;  3TS2 A;  2ICI A;  3OMG A;  4V19 0;  1JOR A;  2PCF B;  3V05 A;  4AYB B;  4IJL A;  2KOL A;  1YNN C;  3RR5 A;  1PYS B;  4ZK9 B;  4JI4 L;  3MXN A;  1PA6 A;  3GTJ B;  5J22 A;  1WTX A;  4ME5 A;  3OTO L;  3T1Y L;  3GTM H;  3E6Z X;  4F7X A;  1CQF A;  1R4Q B;  5IP7 G;  2B2T C;  1G6Z A;  5EKI A;  2Y0S G;  4K6L A;  5T1G A;  1FNU A;  4PV1 C;  1KIX A;  3NEM A;  3K5M A;  3CCL A;  1A3V A;  2OT2 A;  1I3Q B;  1W2B A;  4JYA L;  4OWT B;  3VA7 A;  3HOU H;  1D5Z C;  1IW7 D;  4DXG A;  2C35 B;  4PNY A;  2QW7 A;  1SFO H;  3E9H A;  1XX8 A;  1KLG D;  3M7G A;  5C3E B;  5IP7 H;  2BE5 D;  2NZO A;  3HKZ E;  3R93 A;  3TME A;  4DUZ Q;  4DV1 Q;  1I94 L;  1IL8 A;  4WRD A;  5IYC H;  2CQO A;  2MFI A;  2K33 A;  3H15 A;  3OW2 A;  1JOK A;  1Q8I A;  1TT2 A;  3AU7 A;  1KRS A;  1SMY C;  4DFA A;  2FMM A;  1LTG D;  3VYS A;  4C56 C;  2SDF A;  2QEX A;  4QF4 A;  2LMC B;  4POG A;  1U4R A;  1JJC B;  4DR4 Q;  1IYU A;  2NVY H;  1EOT A;  4ILW A;  4ALP A;  2KVM A;  2EOT A;  4HCE A;  3PIP 3;  4JCV E;  5M3F G;  1YJ9 A;  5FO8 B;  1OXS C;  2F0Q A;  4A3L G;  3TP5 A;  5BN5 A;  3A74 A;  4B9W A;  2Z6K C;  3S16 B;  4HJ5 A;  1EYG A;  4QIW B;  5FLM H;  4CKC A;  1N34 L;  2F0D A;  3I7F A;  1HXY D;  1AE3 A;  1L0W A;  1LT3 D;  4KKT A;  4C3H G;  1N36 L;  4QUF A;  3K5N A;  2ZXR A;  1CTM A;  2XSC A;  2OTL A;  1SND A;  4YWK A;  4BXX H;  2NVQ B;  5M3F H;  4OIK A;  4X65 Q;  4A3G H;  4ZQ3 A;  3JAM L;  1MSH A;  1FJG L;  4YIJ A;  2AQ1 B;  4K2K A;  4AYB G;  1E24 A;  3D31 A;  3ITP A;  4PZ7 A;  2WB1 G;  3DUZ A;  1KDB A;  2CWP A;  1ICW A;  1I4R A;  5I4D A;  3FKI B;  1PFB A;  2BA1 A;  4OX9 L;  3TDQ A;  3OPO A;  3C2P A;  3LGJ A;  2TSS A;  5BN3 A;  1HUM A;  5LHY 1;  2B8G A;  4RG1 A;  1E7Z A;  2Z9H A;  2EYO A;  3D6C A;  5A2Q E;  3G6J B;  5K36 G;  3HKZ B;  4KJO A;  2IHE A;  5IWA Q;  2F3V A;  2ZM6 L;  2K5D A;  3NP8 A;  1MI2 A;  1ESR A;  4G4K A;  1ESF A;  4YHH Q;  4R1J A;  4HN7 A;  1HRJ A;  3KBG A;  5M5W H;  3W2D A;  4YWL A;  3NQI A;  1WD1 A;  3P1H A;  3H0G B;  4EQP A;  5KNB A;  1N32 Q;  4JI1 L;  3FP9 A;  1P8L A;  4GKK L;  4N8F A;  4QQB X;  4LFB Q;  3QB3 A;  2UXB L;  3PCO B;  2CW0 D;  4CKB A;  3GTL B;  1JOQ A;  2UXC L;  2EY2 A;  4IFD H;  3TSS A;  2CHB D;  1PVO A;  1BOS A;  4B3R Q;  2AUJ D;  1VQL A;  4KHZ A;  1BF4 A;  1EYC A;  1FYC A;  5C4X G;  2FXQ A;  1DD2 A;  4LFC L;  1FR3 A;  2NN6 G;  4B3T Q;  1HZA A;  2DGY A;  1EL0 A;  1JWU D;  1Y8P B;  3PUW A;  3J7A F;  3KF8 A;  5C4J H;  5GAG C;  3M7N A;  3I70 A;  3ERS X;  1N33 L;  2K50 A;  1IBM L;  1K83 H;  1BCP B;  1D8L A;  1X54 A;  1HNX Q;  3E0E A;  2HUG A;  3T51 B;  1X3F A;  2IJ0 A;  3K6O A;  4DN4 M;  1A15 A;  4LFA L;  1TR5 A;  5C4X H;  2G9D A;  4ZKC B;  5DAU A;  2AQ2 B;  2E74 C;  2NN6 H;  1CKM A;  1GXD C;  1QZH A;  4CJ0 B;  4XT3 B;  1QVC A;  2R92 G;  1I4X A;  4KI0 A;  2ZTD A;  2OXP A;  1JE4 A;  2K01 A;  3CME A;  2KJX A;  1UE6 A;  3IFD A;  3P75 A;  3NXW A;  4J6H A;  4C3I B;  1NR4 A;  3ND8 A;  3NBI A;  1PMR A;  3ULP A;  4DKA C;  1TS4 A;  1X32 A;  5E4W C;  2Z8L A;  2WAC A;  3HS0 C;  3MEF A;  3K5L A;  3CCU A;  1B8A A;  3TRE A;  4P75 A;  3S17 H;  4IUT A;  5IIF A;  2IPK D;  4C1N K;  2QA4 A;  1DCZ A;  1SMX A;  2K04 A;  4R4C A;  2UXD L;  4G7O C;  1CKN A;  1V1Q A;  4DR2 Q;  3U50 C;  4QB4 A;  1BR9 A;  2A6E C;  4DV5 Q;  4A3F B;  3HKZ G;  3J7Z C;  3HOX H;  1QG7 A;  4NP5 A;  5J3B A;  3OMC A;  1SYF A;  3M9B A;  4DV6 Q;  2SNS A;  2CH4 W;  4X66 Q;  4KV6 A;  4CBV A;  2WKD A;  2A5H A;  3TBI B;  1BBW A;  4CHT B;  2R93 H;  2F0I A;  4IO9 A;  4RHR A;  5KYI A;  3PV0 A;  3CC4 A;  3BYT B;  2K5Q A;  2JA5 B;  4BBS B;  3H0G G;  2N3S A;  3DWP A;  2K28 A;  2UUA L;  5AFW A;  4LWC A;  2MO0 A;  1M1K C;  3PO3 B;  4Y7N H;  4LF5 Q;  2BA0 A;  1GUG A;  3CC7 A;  2KEE A;  1M8A A;  1VQN A;  1IYJ B;  1PTO H;  1W6K A;  2RHS B;  3J81 E;  1I4H A;  5E4X A;  1STN A;  3H94 A;  4LNQ A;  2A6H C;  1X3G A;  3QJY A;  2Z4H A;  4A3D B;  3PSI A;  4HR7 B;  4ODG A;  3GTK B;  4DR5 L;  3PIO A;  2HHH Q;  1EWC A;  2IX3 A;  2ZTC A;  5NUC A;  3T16 A;  5IYD H;  2TMP A;  3ERQ A;  4QCL A;  3DWA A;  4DR7 L;  4PZ8 A;  4EQN A;  3PO2 B;  1P16 A;  5KRU A;  5C0X J;  4QJF A;  3M4O B;  2ATW A;  3I91 A;  1G8Z D;  4L5Q A;  4A93 B;  1B70 B;  4DUZ L;  5M3M B;  2NVX H;  4JI0 Q;  4L5S A;  4DPG A;  4HJ8 A;  3T1Y Q;  3A7L A;  1W3S A;  1Y69 U;  3T4A C;  3D4R A;  1QVF A;  3GTQ B;  1A0I A;  3S1R H;  2JA8 H;  3V96 A;  1ZYR C;  1I50 H;  1ZKO A;  1B4O A;  4GN4 B;  3F2C A;  2F0S A;  3PUZ A;  2UUB Q;  1QJO A;  1HFG A;  4DNR B;  3L3O C;  5KEE A;  5L37 A;  4A3M H;  4DR4 L;  5C5M A;  3SR1 A;  4X3U A;  1VCI A;  1ASZ A;  5LMN Q;  4QUC A;  4FF1 A;  1Q7Y C;  2JEA I;  3DEP A;  2NTS A;  2Z6B A;  4RGM A;  3NWT A;  1S4Z A;  1CKO A;  4XYQ A;  2N55 A;  4MZ9 A;  1N9W A;  1RKN A;  3S14 B;  4KN4 C;  1VQ8 A;  1OXX K;  1TWA H;  1UEB A;  3FRP B;  4Q0F A;  3S9W A;  5JEA J;  3CAM A;  1JC7 A;  3F8T A;  4JBK A;  1G29 1;  3S2H H;  1PFM A;  3DEO A;  4X65 L;  2R6G A;  4P73 A;  3PO3 G;  1H9R A;  4ZRZ A;  2IHF A;  1WCM H;  4EQO A;  1RTN A;  1UNS A;  4LMQ D;  1XJV A;  4YY3 Q;  2SNM A;  2I5H A;  1BBX C;  1U4L A;  3HOW B;  1AH9 A;  3BDO A;  1JB7 A;  4J1M A;  2XVS A;  4Q5V A;  2AWO A;  1E0B A;  4C2M B;  3PIP A;  4K8I A;  1O7L A;  4KK7 A;  1HR0 W;  3FHW A;  2RDH A;  2E75 C;  2K4K A;  2EYL A;  3MVV A;  5C4Z A;  4UP7 A;  1RIP A;  2CFM A;  3RN2 A;  2Q8I B;  3ONA B;  1I6H H;  2LS0 1;  3OIP A;  5IWA L;  1RDP D;  2BDO A;  2E5L Q;  1U4M A;  4OEL B;  2JA6 H;  1HTP A;  3NE5 B;  3T53 B;  4YHH L;  3MAQ A;  2AKW B;  4RKL A;  3TEH B;  3TQY A;  1YZ6 A;  1IBL Q;  3MZ5 A;  4JBW A;  1LT4 D;  1I4P A;  5M5Y H;  4K14 A;  1DJR D;  1LTB D;  4JI6 Q;  4HSV A;  3N6R A;  1N32 L;  1E2Z A;  3KLS A;  3FDT A;  3UI2 A;  4NB3 A;  1PFS A;  1DOK A;  1PTO D;  5FO9 B;  1A2U A;  4IUQ A;  2I46 A;  3JC6 6;  3K0X A;  4A3I G;  2HIX A;  4B3R L;  2V4D A;  4RCO A;  1Y1V H;  2B2V A;  4HCS A;  2L15 A;  4BS9 A;  5M5X B;  3PUY A;  1MD2 D;  4B3T L;  4ZUI A;  1IXR A;  2F0H A;  1PTO F;  3I4O A;  1PYB A;  5JVG 3;  3CQZ H;  4KJN A;  4CDC C;  4BY1 B;  1K0S A;  2F0E A;  5BR8 Q;  2XIW A;  2N49 A;  1HNX L;  2BOS A;  2CCZ A;  2O5J C;  3HOV H;  4FF3 A;  1MIU A;  3LNN A;  4BBR B;  1AW7 A;  3S1M B;  4OIJ A;  1HZB A;  3RLF A;  4DF7 A;  2DNE A;  5C0X I;  1VQH A;  2L11 A;  1K3R A;  4UP9 A;  1Y1W G;  1PLF A;  3J7A 5;  1B2T A;  3J80 c;  5EPL A;  4IUR A;  1QIL A;  3KYH C;  1CA5 A;  1ENA A;  4U68 A;  3KK7 A;  1TWG B;  4RGO S;  3KF6 B;  3KOJ A;  2ZJR A;  1N33 Q;  1LTT D;  3PMF A;  2LSS A;  3HOY H;  1B7Y B;  3U9O A;  1KNE A;  3UDG A;  1VQO A;  3HOW G;  4A3C G;  1Y1W H;  1LT5 D;  4GNX A;  1ET9 A;  1L1O A;  4TSS A;  4LK1 C;  4IOA A;  4IPH A;  1SFO B;  3NK9 A;  4KKS A;  3SK5 A;  1F2Z A;  5E3F A;  5JJL A;  3VYU A;  4NPS A;  4DV5 L;  2OEO A;  4C1N I;  4JI3 Q;  2LXJ A;  1PRT D;  4RKB A;  2E2H H;  3SDZ A;  1NBW A;  2RSN A;  5CV5 A;  3I4M H;  2XRQ D;  4WOR A;  2NVT H;  3FEW X;  1STE A;  2F0T A;  2YTY A;  5IP9 H;  4IOC A;  3BJU A;  1PRT F;  3G4S A;  1IZ6 A;  2PNR C;  3CHB D;  4CDD C;  2NVY B;  2UXD Q;  3KLS X;  4UAI A;  2EXD A;  3H3V H;  1KAA A;  2K5N A;  4LF7 Q;  2ZT9 C;  1SLJ A;  1SYC A;  4MHE A;  4LF5 L;  4LF6 Q;  4RGT A;  2IW3 A;  5IGC A;  1JT8 A;  3SVM A;  1DXM A;  2EPB A;  3HRZ C;  4EQ5 A;  3A7A B;  3S1N H;  1EY7 A;  5HY6 A;  5CC4 A;  1A6X A;  2RBM A;  4LF8 Q;  1LM0 A;  2IT1 A;  2CQA A;  1PH1 A;  1UEA B;  4PMB A;  3GV3 A;  2B2V C;  3URY A;  4QMG A;  2EY1 A;  4NW2 A;  1ET6 A;  1VQD A;  2MO1 A;  2K7V A;  3VDY A;  2RCF A;  2M9V A;  4QIW E;  1IW7 C;  2DJF C;  1VQA A;  3I4N H;  4BBR G;  1E1O A;  5C6A A;  4FDB A;  2BE5 C;  3VR5 A;  4FXD A;  3Q6S A;  5HGT A;  3HP3 A;  3D4W A;  3R3O A;  2L12 A;  3TZD A;  2E2I H;  3JAM c;  5EGT A;  1OXT A;  4GS3 A;  5CV7 A;  3D0F A;  3C1F A;  1LLR D;  2RSO A;  4JI0 L;  2CWA A;  3AQQ A;  4DR5 Q;  1FD7 D;  2KQ3 A;  2K1B A;  1VQ7 A;  4GZY C;  1F2M A;  1DYQ A;  4POF A;  2HDM A;  3VA5 A;  4OO1 H;  5I6W A;  1JCK B;  2PI2 E;  4GN5 A;  4R9W A;  3TP6 A;  4ZYS A;  4DR7 Q;  2AMC B;  1B9N A;  4ZKB B;  2UUB L;  1Y8O B;  5C5L A;  3OSO A;  3SGI A;  3CCQ A;  4NXN Q;  4H7B A;  1HTL D;  4GNX C;  1L1O C;  4AH6 A;  5LMN L;  1S72 A;  1Q86 C;  2B8F A;  1JJG A;  2CVR A;  2K05 A;  1O7Z A;  1VQE A;  1C9O A;  1GO3 E;  1X65 A;  2Q2I A;  4HMJ A;  5LMU Q;  2JSO A;  2G9H D;  3H6M A;  2I5M X;  1S5B D;  4J8Q A;  5IT9 c;  2Z4I A;  2XRS D;  2VUM G;  4K0K Q;  1E3P A;  1TWH H;  2JA7 B;  2L1B A;  4N8X 1;  5HUR A;  1EIY B;  1JIC A;  1RF2 D;  4V0B A;  4K5X A;  1TWF H;  1MKH A;  5ELC A;  4RA8 A;  1Q82 C;  1AP0 A;  5C4J B;  5COR A;  1K83 B;  1ROD A;  4DV4 L;  2VUM H;  4YCU A;  4L5T A;  3H3V C;  4YY3 L;  1EU3 A;  2MPM A;  4XQN A;  1EZ8 A;  1S40 A;  4OHJ A;  1QZG A;  2R7Z B;  4L8J A;  3RZO H;  2OQK A;  1QOH A;  1YBY A;  3H09 A;  2QGQ A;  3RD4 A;  1F9S A;  3AYH B;  1KDC A;  2YV5 A;  2K03 A;  2JQO A;  4C3J G;  4DAY A;  1H95 A;  1NMF A;  2MNA A;  5FLX c;  5CV8 A;  1TU2 B;  4K6D A;  4A3L H;  3NEN A;  2DY8 A;  1VQG A;  1EIF A;  1LTS D;  1L0Y B;  1NCV A;  1SXT A;  2B2Y A;  3PUX A;  2E5L L;  2YU9 B;  1E2W A;  2F1M A;  5FO7 B;  4C3H H;  4KY6 A;  1UUP A;  2I07 B;  4A75 A;  4GOP A;  3LX0 A;  4DV7 L;  1IBL L;  4OWW B;  3VR6 A;  2EYJ A;  2F0J A;  2CW0 C;  1CKN B;  1BDO A;  4JI6 L;  1CUK A;  1EQT A;  1QB5 D;  3CP0 A;  1HPC A;  5KIX A;  1RHP A;  1KQS A;  4JK1 C;  5JJZ A;  4MN3 A;  4A3J B;  2F0M A;  2PMZ B;  3S1Q B;  4WFN 3;  2ZJQ A;  2EVB A;  2IL8 A;  2ID0 A;  1LTR D;  2D62 A;  3GD7 A;  5IOD A;  3NUC A;  3GTJ H;  5DM7 3;  3A5Z B;  1MSG A;  2F4V Q;  1EEF D;  3EJI A;  5C3E G;  4XYO A;  3BDC A;  4IQZ A;  5CBA E;  1JE5 A;  2A69 D;  3CW2 C;  3EQL C;  3ERO A;  3DWQ A;  4UDU C;  1WTW A;  2EYP A;  5BR8 L;  1O78 A;  4RAU C;  3RZD B;  5CV6 A;  5K36 H;  5E7N A;  1I5F A;  3K0Y A;  1S5F D;  4L63 B;  2BH2 A;  4O0A A;  4Y7N B;  4KHV A;  1Q8K A;  3K57 A;  3DMU A;  3O13 A;  4K5V A;  1WTP A;  2E2J H;  5EAY A;  4CDE C;  4HJ7 A;  1K73 C;  2R7D A;  3MA2 B;  2K32 A;  2FHT A;  1ENC A;  2QF7 A;  1EWI A;  3GP7 A;  2B2W A;  4DK6 C;  3W3A A;  4DV0 L;  2QCP X;  2VB2 X;  4TKO B;  5D3D A;  1SYE A;  4PQX A;  1K8M A;  1TS5 A;  1HZC A;  2F52 A;  3KJO A;  1HNZ Q;  3D6W A;  2M00 A;  2OF1 A;  1DOM A;  2KHJ A;  4I65 A;  1G2T A;  5GQO A;  3S2D B;  2B29 A;  2F0U A;  3SK4 A;  2IX1 A;  4X62 Q;  4X3T A;  3FMC A;  4B3M Q;  1I6V C;  2Q8T A;  3S15 H;  3PF5 A;  1CSQ A;  1VF7 A;  2NVX B;  1JQY D;  1KAW A;  3RLN A;  5C3X A;  4JI3 L;  2PYK A;  3S16 H;  2D0O A;  1SAP A;  4O2D A;  2KEC A;  1PH7 A;  2NWG A;  1ZXT A;  4QL5 A;  4IFD J;  4XTC S;  4DK0 A;  5ELD A;  3DXJ C;  1STH A;  1E22 A;  2B2Y C;  3S1R B;  3F2D A;  2K5H A;  3E3X A;  1MJC A;  4N9P A;  1J9O A;  3KLR A;  5CMD A;  1DON A;  2R92 H;  2NVQ H;  1V1P A;  3FKI G;  4GOP C;  1GOZ A;  3EN2 A;  2MP1 A;  3KDF A;  4A3K B;  3SK8 A;  3J80 i;  1XTC D;  2DN8 A;  3HGB A;  2SEB D;  2A8V A;  4NXM Q;  4A3J G;  2OQ0 A;  4LF7 L;  1VQ4 A;  4LF6 L;  2ASB A;  1LTL A;  2MUY A;  3RN5 A;  2ES2 A;  4LF8 L;  1EYA A;  3NTI A;  3FKI H;  1WVL A;  3IAY A;  4BY7 B;  3N52 A;  3HOZ B;  3EFX D;  2IWH A;  5C0X G;  4UY8 C;  3BVG A;  1Z7T A;  1H9S A;  1TWA B;  4RWS C;  2HT1 A;  5EKL A;  2A1A A;  3AEV A;  1QE6 A;  1T9H A;  3MXP A;  4ABN A;  2XNA C;  5FK9 C;  1Z47 A;  3X3N A;  5D3I B;  1EY0 A;  3I2Z A;  1JJ2 A;  3BVZ A;  3KBX A;  1JWS D;  1UE5 A;  4F87 A;  2WFW A;  2NYZ D;  2QDB A;  4P71 A;  2WAQ B;  3CKI B;  4NKL A;  5C0X H;  2RCN A;  2G5D A;  5EJW A;  1C8C A;  2HQE A;  5T1I A;  1SJE D;  3QWN A;  2OCE A;  1K8G A;  3H0G H;  4P74 A;  1JR0 D;  3IKJ A;  3I73 A;  3GTL H;  3PF4 A;  1M90 C;  2B2W C;  1BNZ A;  3K5O A;  2HIV A;  3GTO H;  2KHS A;  1CQV A;  1DZ1 A;  5LMN W;  1X55 A;  4LUO A;  2LY7 A;  1TY0 A;  5E1F A;  1I6H B;  1IKL A;  5IGD A;  4NXN L;  2JA6 B;  2KED A;  2FJ2 A;  3U4V A;  3VR4 A;  4IPC A;  4DR6 Q;  1XMQ Q;  1U4P A;  2WP8 J;  3MTS A;  3U4Z A;  5JEA G;  3A56 A;  5JJI A;  1AZP A;  4R4O A;  1GHJ A;  1S5C D;  1WTR A;  2VY3 A;  4HJ9 A;  1L0X B;  1STB A;  3WDN A;  2RHQ B;  3PGZ A;  3CCV A;  4C3I G;  5C3W A;  3Q24 A;  3PQI A;  5LMU L;  1Y8N B;  4HIM A;  4IUU A; 
#chains in the Genus database with same CATH homology
 3NHH A;  4LJZ C;  5D65 A;  4BA2 I;  1II3 A;  2J4X A;  1GUT A;  2EJF C;  3RUZ A;  5K5P A;  5JEA H;  3K7A B;  3A55 A;  4A3B B;  1CT1 D;  3TP7 A;  4KY5 A;  4IN3 A;  3U9S A;  1FNV A;  2ZXO A;  3OIQ A;  3CQZ B;  2WII B;  2F0F A;  1S5D D;  3H91 A;  4XIG S;  1VDZ A;  1RTO A;  4RCN A;  2K5W A;  1T5X D;  4N9T A;  1D2B A;  5C44 B;  5I9P A;  2H4O A;  3GTG B;  5I9O A;  2JXM B;  1TS3 A;  4DA2 A;  4IUV A;  2R3Z A;  1YNJ D;  4H44 C;  1PTO C;  3HZX A;  4DAP A;  1B50 A;  1EEI D;  1VF5 C;  1GJX A;  1ILQ A;  2DNC A;  4DNT B;  2ICE C;  1AEX A;  5I2X A;  3I4M B;  1M4V A;  2B63 B;  3TZU A;  1SDF A;  1ML0 D;  4IZ8 A;  1B44 D;  1MBY A;  3M4Y A;  5BN4 A;  2JEB I;  1EIG A;  4U67 3;  2EY5 A;  2MHV A;  2B2U A;  4IUN A;  1TWC B;  2JP1 A;  5CGK A;  1R9T B;  1UAP A;  3S1N B;  4S3S A;  4DGZ A;  3E0J A;  5EPJ A;  5KGU A;  5EQ0 A;  5IGB A;  1B9M A;  3A54 A;  3Q23 A;  2DY7 A;  2F0O A;  1V8Q A;  3OWE B;  1BO0 A;  4A3E B;  4E6I A;  1Q3L A;  3QOJ A;  3I4N B;  2F0K A;  2A73 B;  5TSS A;  3CU7 A;  1ZEQ X;  1JOO A;  2O2L D;  3K58 A;  2K6A A;  2E2I B;  1PRT C;  1BCP D;  3QG1 A;  1EYD A;  2F0W A;  3AMU A;  3GTM B;  4R8N A;  3D8G A;  2L9H A;  4KTA A;  2YYZ A;  4X3S A;  1BCP F;  3GO5 A;  2EZV A;  2ZXP A;  1WTV A;  3D3R A;  1A3T A;  3BVM A;  3HOU B;  4BA1 I;  1SNQ A;  1SYG A;  3NBH A;  2D2C C;  5G3L D;  2EJM A;  5JPN C;  3C46 A;  2AWN A;  3J7Y W;  4EGV A;  3I3C A;  3P7J A;  5DM6 3;  4FXK C;  4M1U B;  1S5E D;  1F9P A;  1Q1B A;  5CBE E;  4KKU A;  1XYI A;  2D9U A;  3EVQ A;  1ENF A;  1BQQ T;  1F2L A;  4RH6 A;  1CA6 A;  1D5X C;  2B2U C;  2WIN B;  1EY8 A;  4WJW A;  2WKC A;  2M2L A;  1SYB A;  3BZD B;  1SNM A;  1HQM C;  4FXG C;  4RGN A;  2SOB A;  2HDL A;  1FNW A;  5LL6 X;  3FPP A;  5IGG A;  2A68 D;  5M3F B;  1GUW A;  1IKM A;  4A3G B;  4HMI A;  3V2T A;  1J8I A;  1PZI D;  4PMW A;  3CRL C;  1O80 A;  4HED A;  2FIN B;  1H9K A;  4C3H B;  3MXU A;  5C4H A;  1G2S A;  1SE2 A;  4HTH A;  2EYH A;  3P20 A;  1QWY A;  1PZK D;  3K59 A;  2VXW A;  3SK6 A;  1BXT A;  2J7Z A;  1R4P B;  1U9R A;  3J80 L;  1KDA A;  1SE4 A;  2NUC A;  3L7Z C;  3A8K E;  1AZQ A;  4TQU S;  2WB1 B;  1AN8 A;  2F0L A;  4ZLT F;  1I4Q A;  3WOE A;  5J1Z A;  5M5W B;  1NSN S;  4FF4 A;  5I6Y A;  5KYL A;  4B9X A;  1EQV A;  1BUV T;  3A8I E;  3FPU B;  5IGF A;  1C48 A;  1MGS A;  3VR2 A;  1CHP D;  2E2J B;  1IYV A;  3BYY B;  1QNU A;  1TII D;  1AFP A;  4OGQ C;  4G7Z C;  1HA6 A;  2L55 A;  1YNN D;  1O7Y A;  4X3K A;  3R2T A;  4F88 A;  4FP5 D;  1GUS A;  2PZT A;  4FNF A;  4DK1 A;  2F0P A;  2WV6 D;  4TRD A;  2NZ1 D;  4PMC A;  3J7A V;  4CGY B;  3I4L A;  2F4I A;  4DAV A;  4NMZ A;  5C4X B;  1X3Q A;  2HCI A;  3RMH A;  1IHZ A;  5CV9 A;  3GV6 A;  5A35 A;  1K8O A;  3S15 B;  2F0N A;  4FO2 A;  2A69 C;  1SE3 A;  2B39 A;  3AB9 A;  1SYD A;  3C3L A;  1B3A A;  1V1P B;  5EBD A;  4G7H C;  3EA6 A;  2R92 B;  1LT6 D;  2A74 C;  1SMY D;  5D14 A;  3S17 B;  2BCO A;  3NQT A;  2NB0 A;  2VB3 X;  3MHB A;  1TS2 A;  5JVH 3;  1ILP A;  5DNF A;  3HOX B;  4NDX A;  4CJ1 B;  3I8Z A;  1HUN A;  3IFT A;  2E2D C;  2EXZ A;  4H0L C;  5DEH A;  3MXG A;  1H9S B;  2R93 B;  3LWE A;  1GHK A;  2LFN A;  3C1E A;  2PZW A;  1I4G A;  4KMU C;  3F2U A;  3KUP A;  1NAP A;  4B08 A;  1Q12 A;  2KCC A;  4IFD G;  1Z6H A;  4F8M A;  1PTO B;  4KD4 A;  3ZYY X;  1F2Y A;  1DM0 B;  1PFN A;  1C4Q A;  1RJT A;  5JOB A;  2C9O A;  2N88 A;  5IT9 L;  1KLU D;  4R8I A;  2EYM A;  3GTO B;  3FVQ A;  3TP8 A;  2Z1C A;  1LTI D;  1E2V A;  2XN9 C;  3MEH A;  1CHQ D;  1W6J A;  1TQO A;  2R61 A;  3IL8 A;  1QCB D;  2PPB C;  1JB3 A;  2KCN A;  1SNC A;  4XXE A;  1PZJ D;  3MFG A;  5FLX L;  3R8B A;  2JA8 B;  2J0T D;  4LAA A;  1I50 B;  4G57 A;  3VR3 A;  3Q0A A;  4A3M B;  1F77 A;  2JE6 I;  1TKW B;  4DU9 A;  4OO1 I;  1T5E A;  2EYF A;  5JAV A;  1EZ6 A;  1LO5 D;  5J39 A;  3DHQ A;  2RKS A;  5I2Y A;  1PRT B;  3GQB A;  1OO9 B;  1KTK A;  1A2T A;  2X6G A;  1D1I A;  3MFY A;  1KNA A;  3VYR A;  4P2C B;  3S2H B;  4FVM A;  3X3M A;  1SJH D;  1WCM B;  1SSO A;  5IGE A;  5FKA C;  3LWU A;  4BWG B;  1STA A;  3I72 A;  2RDF A;  1JWM D;  2ENB A;  2MJ8 A;  1Q1E A;  4K8J A;  1CK1 A;  1GUN A;  1Q90 A;  2F03 A;  1EY5 A;  2A6E D;  5ELF A;  3QOL A;  4ULL A;  3TN2 A;  3PUV A;  3A8J E;  1STG A;  2GA4 B;  1CZG A;  1XWE A;  3G7L A;  3DM1 A;  3WOF A;  2IX0 A;  2JYO A;  3SE0 A;  5FOB B;  5M5Y B;  2RVL A;  1EY9 A;  1EY4 A;  3BS1 A;  1EFI D;  1F9R A;  1VMC A;  1V1O A;  2KA7 A;  1OXU A;  3NPP A;  4RHS A;  1HA5 A;  5CV4 A;  2VNU D;  1Y1V B;  2PW7 A;  4K5W A;  2A6H D;  1PDQ A;  3L9A X;  3NTH A;  2O5I C;  4KN7 C;  1SNO A;  3HG9 A;  2O4X A;  4K2L A;  1YNJ C;  2XWB B;  3HOV B;  2RQX A;  1LAC A;  4A3I B;  5EBC A;  1H9J A;  1RCV D;  2Q8R E;  3MWY W;  3OOC A;  5ELB A;  5IOC A;  1WTO A;  1HFN A;  2EJG C;  1FGB D;  1LAB A;  3J80 E;  4FYD A;  3I90 A;  4O42 A;  1CFM A;  4IFD I;  5A2Q L;  1OXV A;  1H9M A;  2FMC A;  2F3W A;  3HOY B;  2QKI C;  4I7Z C;  4DXF A;  4M8A A;  2PZU A;  3BDL A;  2QEJ C;  1Y1W B;  1ZYR D;  1TVX A;  5CR3 A;  4ZAI A;  2BDN A;  1CM9 A;  2X6L A;  1KAB A;  1HQR D;  3NTK A;  1D1K A;  2PW5 A;  4XQQ A;  4ZUJ A;  3M3Y B;  2EY6 A;  3QIA A;  2E2H B;  5LL6 S;  2F0G A;  3T13 A;  1PXU A;  2NN6 I;  2MGS A;  3R2I A;  1CI3 M;  2NVT B;  5F2D A;  1PYW D;  2EDG A;  2RDG A;  4ID6 A;  1D5M C;  2C5C A;  4MIU A;  5EKK A;  1A3U A;  1HCZ A;  5COY A;  2D5D A;  4Z9C B;  1V43 A;  1BCP C;  1VMP A;  3SHL A;  1SNP A;  5JPM C;  5CYU A;  1B53 A;  1EWH A;  1SBB B;  3OW7 A;  3ND9 A;  4CJ2 C;  2FFK B;  3E5S A;  5ELE A;  3OWF A;  3NWS A;  2PQE A;  2L5T A;  3QO2 A;  1SEB D;  3HEJ A;  4FF2 A;  4CKE A;  3SEB A;  4RFB A;  3VYT A;  5ISR A;  1HHV A;  1EY6 A;  3NSW A;  4OL7 A;  3T56 B;  5KND A;  3JAM E;  4HAE A;  3SXH A;  1G91 A;  3GTP B;  3MC0 B;  1LTA D;  2AQ3 B;  1EIH A;  4XT1 B;  4HSP A;  2B2T A;  1CZW A;  3BG3 A;  1WD0 A;  1LV9 A;  2NTT A;  2KUM A;  4H13 C;  2HCC A;  2Y0S B;  5EPK A;  3Q22 A;  5M9O A;  5KNC A;  2E76 C;  1ONL A;  1STY A;  4XQJ A;  5G3L F;  2A68 C;  3J81 L;  2L0C A;  2QIL A;  2RA4 A;  3CRK C;  5IT9 E;  1TWH B;  1GUO A;  2EE1 A;  1NUC A;  2F0V A;  1TWF B;  2AUK A;  1X3P A;  2LKV A;  1B1Z A;  2XWJ B;  1DOL A;  2VUM B;  4XDX A;  1XXG A;  3RZO B;  1EU4 A;  4IAL A;  2H1E A;  3M85 A;  1RD9 D;  3PIO 3;  2X69 A;  5FLX E;  2L4N A;  3D4D A;  3OHX C;  2PO4 A;  4EVO A;  1QNK A;  4KY7 A;  4IUP A;  4KD3 A;  4C3J B;  1TY2 A;  1F9Q A;  1D6E C;  2NBF A;  1NR2 A;  4L6T B;  1WTQ A;  4O1N A;  4OO1 G;  2ICI A;  3OMG A;  4V19 0;  1JOR A;  2PCF B;  3V05 A;  4AYB B;  2KOL A;  1YNN C;  4ZK9 B;  3MXN A;  3GTJ B;  5J22 A;  1WTX A;  4ME5 A;  3E6Z X;  4F7X A;  1CQF A;  1R4Q B;  2B2T C;  1G6Z A;  5EKI A;  4K6L A;  5T1G A;  1FNU A;  4PV1 C;  3K5M A;  1A3V A;  2OT2 A;  1I3Q B;  3VA7 A;  1D5Z C;  1IW7 D;  4DXG A;  4PNY A;  1XX8 A;  1KLG D;  3M7G A;  5C3E B;  2BE5 D;  3R93 A;  3TME A;  1IL8 A;  4WRD A;  2K33 A;  1JOK A;  1Q8I A;  1TT2 A;  3AU7 A;  1SMY C;  4DFA A;  2FMM A;  1LTG D;  3VYS A;  4C56 C;  2SDF A;  4QF4 A;  2LMC B;  1U4R A;  1IYU A;  1EOT A;  4ILW A;  2KVM A;  2EOT A;  4HCE A;  3PIP 3;  5FO8 B;  1OXS C;  2F0Q A;  3TP5 A;  5BN5 A;  4B9W A;  3S16 B;  4QIW B;  4CKC A;  2F0D A;  1HXY D;  1LT3 D;  4KKT A;  4C3H G;  4QUF A;  3K5N A;  2ZXR A;  1CTM A;  2XSC A;  1SND A;  2NVQ B;  4OIK A;  4ZQ3 A;  3JAM L;  1MSH A;  4YIJ A;  2AQ1 B;  4K2K A;  3D31 A;  3ITP A;  3DUZ A;  1KDB A;  1ICW A;  1I4R A;  5I4D A;  3FKI B;  1PFB A;  2BA1 A;  3TDQ A;  3OPO A;  3C2P A;  2TSS A;  5BN3 A;  1HUM A;  5LHY 1;  2B8G A;  2EYO A;  3D6C A;  5A2Q E;  3G6J B;  5K36 G;  3HKZ B;  4KJO A;  2F3V A;  2K5D A;  3NP8 A;  1MI2 A;  1ESR A;  4G4K A;  1ESF A;  4HN7 A;  1HRJ A;  3KBG A;  3W2D A;  3NQI A;  1WD1 A;  3P1H A;  3H0G B;  4EQP A;  5KNB A;  3QB3 A;  2CW0 D;  4CKB A;  3GTL B;  1JOQ A;  2EY2 A;  4IFD H;  3TSS A;  2CHB D;  1BOS A;  2AUJ D;  4KHZ A;  1BF4 A;  1EYC A;  1FYC A;  1DD2 A;  1FR3 A;  2NN6 G;  1EL0 A;  1JWU D;  1Y8P B;  3PUW A;  3J7A F;  3KF8 A;  3M7N A;  3I70 A;  1BCP B;  2HUG A;  3T51 B;  2IJ0 A;  3K6O A;  4DN4 M;  1A15 A;  1TR5 A;  2G9D A;  4ZKC B;  5DAU A;  2AQ2 B;  2E74 C;  2NN6 H;  1GXD C;  4CJ0 B;  4XT3 B;  1I4X A;  4KI0 A;  2OXP A;  1JE4 A;  2K01 A;  2KJX A;  3IFD A;  3P75 A;  3NXW A;  4J6H A;  4C3I B;  1NR4 A;  3ND8 A;  3NBI A;  1PMR A;  1TS4 A;  1X32 A;  5E4W C;  2Z8L A;  2WAC A;  3HS0 C;  3K5L A;  4IUT A;  5IIF A;  2IPK D;  4C1N K;  1DCZ A;  2K04 A;  4G7O C;  4QB4 A;  1BR9 A;  2A6E C;  4A3F B;  1QG7 A;  4NP5 A;  3OMC A;  1SYF A;  2SNS A;  4KV6 A;  4CBV A;  3TBI B;  2WKD A;  2A5H A;  4CHT B;  2F0I A;  4RHR A;  5KYI A;  3PV0 A;  3BYT B;  2K5Q A;  2JA5 B;  4BBS B;  3DWP A;  2K28 A;  5AFW A;  3PO3 B;  2BA0 A;  1GUG A;  2KEE A;  1M8A A;  1PTO H;  1W6K A;  3J81 E;  1I4H A;  5E4X A;  1STN A;  3H94 A;  2A6H C;  3QJY A;  2Z4H A;  4A3D B;  4HR7 B;  4ODG A;  3GTK B;  1EWC A;  2IX3 A;  5NUC A;  3T16 A;  2TMP A;  3ERQ A;  4QCL A;  3DWA A;  4EQN A;  3PO2 B;  5KRU A;  5C0X J;  3M4O B;  3I91 A;  1G8Z D;  4A93 B;  5M3M B;  3A7L A;  1Y69 U;  3T4A C;  3D4R A;  3GTQ B;  3V96 A;  1ZYR C;  1ZKO A;  1B4O A;  2F0S A;  3PUZ A;  1QJO A;  1HFG A;  4DNR B;  3L3O C;  5KEE A;  5C5M A;  3SR1 A;  4X3U A;  1VCI A;  4QUC A;  4FF1 A;  2JEA I;  3DEP A;  2NTS A;  4RGM A;  3NWT A;  1S4Z A;  4XYQ A;  2N55 A;  3S14 B;  1RKN A;  4KN4 C;  1OXX K;  3FRP B;  4Q0F A;  3S9W A;  5JEA J;  1JC7 A;  1G29 1;  1PFM A;  3DEO A;  2R6G A;  1H9R A;  4ZRZ A;  4EQO A;  1RTN A;  1UNS A;  4LMQ D;  2SNM A;  3HOW B;  1BBX C;  1U4L A;  3BDO A;  4J1M A;  2XVS A;  4Q5V A;  2AWO A;  1E0B A;  4C2M B;  4K8I A;  1O7L A;  4KK7 A;  2RDH A;  2E75 C;  2EYL A;  3MVV A;  5C4Z A;  2Q8I B;  3ONA B;  2LS0 1;  3OIP A;  1RDP D;  2BDO A;  1U4M A;  1HTP A;  3NE5 B;  3T53 B;  3MAQ A;  4RKL A;  3MZ5 A;  4JBW A;  1LT4 D;  1I4P A;  4K14 A;  1DJR D;  1LTB D;  4HSV A;  3N6R A;  1E2Z A;  3KLS A;  3FDT A;  3UI2 A;  1DOK A;  1PTO D;  5FO9 B;  1A2U A;  4IUQ A;  2I46 A;  2V4D A;  4RCO A;  2B2V A;  4HCS A;  4BS9 A;  5M5X B;  3PUY A;  1MD2 D;  4ZUI A;  2F0H A;  1PTO F;  5JVG 3;  4KJN A;  4BY1 B;  2F0E A;  2XIW A;  2BOS A;  2O5J C;  4FF3 A;  3LNN A;  4BBR B;  1AW7 A;  3S1M B;  4OIJ A;  3RLF A;  4DF7 A;  2DNE A;  5C0X I;  2L11 A;  1PLF A;  1B2T A;  5EPL A;  4IUR A;  1QIL A;  1CA5 A;  1ENA A;  4U68 A;  3KK7 A;  1TWG B;  4RGO S;  1LTT D;  3PMF A;  3U9O A;  1KNE A;  1LT5 D;  1ET9 A;  4TSS A;  4LK1 C;  1SFO B;  3NK9 A;  4KKS A;  3SK5 A;  1F2Z A;  5E3F A;  3VYU A;  2OEO A;  4C1N I;  1PRT D;  4RKB A;  3SDZ A;  2RSN A;  5CV5 A;  2XRQ D;  4WOR A;  3FEW X;  1STE A;  2F0T A;  1PRT F;  2PNR C;  3CHB D;  2NVY B;  3KLS X;  4UAI A;  1KAA A;  2ZT9 C;  1SYC A;  4MHE A;  4RGT A;  2IW3 A;  5IGC A;  3SVM A;  1DXM A;  2EPB A;  3HRZ C;  3A7A B;  1EY7 A;  5CC4 A;  1A6X A;  2RBM A;  2IT1 A;  2CQA A;  1UEA B;  4PMB A;  3GV3 A;  2B2V C;  3URY A;  4QMG A;  2EY1 A;  4NW2 A;  1ET6 A;  2K7V A;  2M9V A;  1IW7 C;  5C6A A;  2BE5 C;  3VR5 A;  4FXD A;  3Q6S A;  5HGT A;  3HP3 A;  3D4W A;  3R3O A;  2L12 A;  3TZD A;  5EGT A;  1OXT A;  5CV7 A;  3C1F A;  1LLR D;  2RSO A;  1FD7 D;  2KQ3 A;  2K1B A;  4GZY C;  1F2M A;  1DYQ A;  2HDM A;  3VA5 A;  4OO1 H;  5I6W A;  1JCK B;  4R9W A;  3TP6 A;  4ZYS A;  1B9N A;  4ZKB B;  1Y8O B;  5C5L A;  3OSO A;  4H7B A;  1HTL D;  2B8F A;  2CVR A;  2K05 A;  1O7Z A;  4HMJ A;  2JSO A;  2G9H D;  3H6M A;  1S5B D;  4J8Q A;  2Z4I A;  2XRS D;  2JA7 B;  2L1B A;  5HUR A;  1JIC A;  1RF2 D;  4V0B A;  4K5X A;  5ELC A;  4RA8 A;  1AP0 A;  5C4J B;  5COR A;  1K83 B;  1ROD A;  3H3V C;  1EU3 A;  2MPM A;  4XQN A;  1EZ8 A;  4OHJ A;  2R7Z B;  4L8J A;  1QOH A;  3H09 A;  3RD4 A;  1F9S A;  4C3J G;  1KDC A;  2K03 A;  4DAY A;  5CV8 A;  1TU2 B;  4K6D A;  2DY8 A;  1LTS D;  1L0Y B;  1NCV A;  1SXT A;  2B2Y A;  3PUX A;  2YU9 B;  1E2W A;  2F1M A;  5FO7 B;  4KY6 A;  1UUP A;  2I07 B;  3LX0 A;  3VR6 A;  2EYJ A;  2F0J A;  2CW0 C;  1BDO A;  1EQT A;  1QB5 D;  1HPC A;  5KIX A;  1RHP A;  4JK1 C;  5JJZ A;  4MN3 A;  4A3J B;  2F0M A;  2PMZ B;  3S1Q B;  4WFN 3;  2EVB A;  2IL8 A;  2ID0 A;  1LTR D;  2D62 A;  3GD7 A;  5IOD A;  3NUC A;  5DM7 3;  1MSG A;  1EEF D;  3EJI A;  4XYO A;  3BDC A;  4IQZ A;  5CBA E;  2A69 D;  3EQL C;  3ERO A;  3DWQ A;  4UDU C;  1WTW A;  2EYP A;  1O78 A;  4RAU C;  3RZD B;  5CV6 A;  5K36 H;  3K0Y A;  1S5F D;  4L63 B;  4Y7N B;  4KHV A;  3K57 A;  3DMU A;  3O13 A;  4K5V A;  1WTP A;  3MA2 B;  2K32 A;  2FHT A;  1ENC A;  2QF7 A;  3GP7 A;  2B2W A;  3W3A A;  2QCP X;  2VB2 X;  4TKO B;  5D3D A;  1SYE A;  4PQX A;  1K8M A;  1TS5 A;  3D6W A;  2M00 A;  2OF1 A;  1DOM A;  4I65 A;  1G2T A;  3S2D B;  2F0U A;  3SK4 A;  2IX1 A;  4X3T A;  3FMC A;  1I6V C;  2Q8T A;  1VF7 A;  2NVX B;  1JQY D;  5C3X A;  2PYK A;  1SAP A;  2KEC A;  2NWG A;  1ZXT A;  4IFD J;  4XTC S;  4DK0 A;  5ELD A;  3DXJ C;  1STH A;  2B2Y C;  3S1R B;  4N9P A;  1J9O A;  3KLR A;  5CMD A;  1DON A;  1V1P A;  1GOZ A;  2MP1 A;  4A3K B;  3SK8 A;  1XTC D;  2DN8 A;  3HGB A;  2SEB D;  2MUY A;  1EYA A;  3NTI A;  1WVL A;  3IAY A;  4BY7 B;  3N52 A;  3HOZ B;  3EFX D;  2IWH A;  5C0X G;  3BVG A;  1Z7T A;  1H9S A;  1TWA B;  4RWS C;  5EKL A;  1QE6 A;  3MXP A;  4ABN A;  2XNA C;  5FK9 C;  1Z47 A;  3X3N A;  5D3I B;  1EY0 A;  3BVZ A;  3KBX A;  1JWS D;  4F87 A;  2NYZ D;  2QDB A;  2WAQ B;  3CKI B;  4NKL A;  5C0X H;  1C8C A;  5EJW A;  2HQE A;  5T1I A;  1SJE D;  3QWN A;  1JR0 D;  3IKJ A;  3I73 A;  2B2W C;  1BNZ A;  3K5O A;  2KHS A;  1CQV A;  1DZ1 A;  2LY7 A;  1TY0 A;  5E1F A;  1I6H B;  1IKL A;  5IGD A;  2JA6 B;  2KED A;  2FJ2 A;  3VR4 A;  1U4P A;  2WP8 J;  3MTS A;  5JEA G;  3A56 A;  1AZP A;  1GHJ A;  1S5C D;  1WTR A;  1L0X B;  1STB A;  3WDN A;  4C3I G;  5C3W A;  3Q24 A;  1Y8N B;  4IUU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...