1B3AA

Total chemical synthesis and high-resolution crystal structure of the potent anti-hiv protein aop-rantes
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
67
structure length
67
Chain Sequence
PYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Total chemical synthesis and high-resolution crystal structure of the potent anti-HIV protein AOP-RANTES.
pubmed doi rcsb
molecule tags Anti-hiv protein
molecule keywords PROTEIN (RANTES)
total genus 14
structure length 67
sequence length 67
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1b3aA00
2K04A 1SDFA 2D9UA 3TZDA 1ICWA 1MI2A 2H1EA 2B2YC 3G7LA 1O7YA 1NCVA 1PFBA 2N55A 3I90A 3KUPA 1ILPA 3H91A 2FJ2A 1ILQA 1GUWA 2KEDA 2L1BA 4ZKBB 1BNZA 4QUCA 4IURA 5EKIA 4HAEA 2R3ZA 2DY7A 3N52A 2K03A 2B2TC 4OIKA 1E0BA 1NR4A 3R93A 2EOTA 1B50A 2BDNA 1F9SA 3HP3A 3I3CA 3MWYW 2K1BA 1WVLA 3SVMA 1XX8A 1A15A 1RJTA 4RA8A 2DY8A 3F2UA 1HRJA 1LV9A 4NW2A 1AZQA 2JYOA 4UAIA 4CJ2C 1G91A 3GV6A 1F9PA 1F9QA 1HUNA 1IKLA 5D65A 2HDLA 4MN3A 3GV3A 3FDTA 1DONA 2X69A 1U4LA 1BF4A 3IFDA 2B2UC 1U4MA 5EPLA 2Q8TA 3FPUB 4X3KA 3DEPA 5E4XA 3UI2A 1HA6A 1C8CA 3DEOA 1RODA 3LWEA 4XT1B 4IUTA 3P7JA 5CBEE 3I91A 1TVXA 4MHEA 4R9WA 1J8IA 1DOKA 2FINB 1DOLA 2XIWA 3QO2A 5T1GA 1DOMA 1QE6A 2B2WC 2N88A 5COYA 1WD1A 5CORA 1EOTA 1HFGA 5AFWA 2B2TA 4LMQD 2M2LA 4HCSA 4IUVA 4IUPA 4ZLTF 1AZPA 1BBXC 1HHVA 1X32A 2NYZD 1JE4A 1AP0A 2B2WA 1EQTA 1G2SA 3DM1A 4RAUC 5EQ0A 1PFNA 4XT3B 2L4NA 1B3AA 2HCIA 1HFNA 1PDQA 2K05A 1HUMA 3KBXA 4IUQA 4RWSC 1PFMA 2MJ8A 1B53A 2B2VA 1WD0A 1B4OA 2L12A 2VXWA 1MGSA 4DN4M 1B2TA 5T1IA 1F9RA 5JJZA 1G6ZA 2L11A 1KNEA 1SSOA 2KEEA 1DZ1A 1QNKA 1MSHA 2NWGA 2RVLA 4X3TA 1S4ZA 4ZK9B 4QUFA 2FFKB 1WTWA 2MP1A 1RTOA 2JP1A 2K28A 1CA5A 3I8ZA 1F2LA 2KVMA 4HEDA 2J7ZA 4X3SA 1ML0D 4X3UA 1NAPA 1U4PA 1EIGA 2KUMA 1X3QA 1KNAA 2CVRA 1VMCA 3D6WA 1EIHA 2HUGA 1VMPA 1J9OA 3IL8A 4R8IA 2K01A 1BO0A 1SAPA 1G2TA 1XYIA 4HSVA 2FHTA 4CJ1B 2EE1A 2HCCA 5EJWA 5CBAE 1IL8A 1QG7A 1WTRA 4IUUA 1CM9A 1WTVA 1U4RA 1PLFA 2SDFA 1M8AA 5EPJA 4XDXA 1Q3LA 2MPMA 3MTSA 1X3PA 2MGSA 2L9HA 4ZKCB 2RA4A 1RHPA 1MSGA 4ZAIA 1O7ZA 4OIJA 1NR2A 2KOLA 2X6GA 2B2YA 2IL8A 3ONAB 2KECA 2FMMA 2RSNA 5DNFA 1IKMA 1WTQA 1RTNA 2Q8RE 2RSOA 2B2UA 1EL0A 1CA6A 1O80A 2B2VC 5E4WC 1WTXA 2NZ1D 3Q6SA 1ZXTA 1ESRA 2X6LA 4U68A 2HDMA 4CJ0B 1JICA 1WTPA 5D14A 4O42A 3TN2A 5EPKA 5CMDA 2EPBA 1WTOA
chains in the Genus database with same CATH superfamily
2F0UA 2K04A 3M4PA 5M5YB 4F88A 4AYBB 1LTLA 4PZ6A 3PUYA 4X64L 2UXCQ 5A2QL 1NCVA 2Z6KC 2FJ2A 1ET9A 1V1OA 2PW7A 1GUWA 1PH4A 2K03A 4GZYC 1ENCA 3HP3A 4DV4Q 1EY6A 5IGGA 3E0JA 4DV0L 3J80E 3T53B 3KLRA 1RF2D 1OXSC 2A6EC 4JI1L 2M00A 5GAEC 4K2LA 1STGA 1L0YB 4DUZL 3E3XA 3HOZH 3SK4A 5GAHC 1Y8NB 5IWAL 1K8OA 2XWJB 4JOIC 4A3IG 3LGJA 2KA7A 3T56B 3PO2H 5I9PA 3I91A 3K6OA 2JA7H 1XNRQ 3QO2A 1NUCA 1QB5D 2B2WC 2D2CC 4L5SA 4LMQD 1FNWA 4IUVA 1SNPA 4L63B 3RR5A 3VYSA 1RIPA 3OWFA 1VCIA 4YHHL 3HOUH 1A2TA 2F0VA 1AE3A 2GVAA 3SK8A 1GVPA 3GD7A 4GNXA 1EY0A 4WORA 3J80L 3L2PA 4G7HC 1T5XD 3C46A 4DN4M 4NKLA 3HOWB 1IYJB 3H3VI 2L11A 1K8MA 2E5LQ 4LF8Q 2QEXA 5CV4A 2RVLA 3NQIA 1EUJA 1CTMA 1OO9B 5IGDA 2DJGC 2G9HD 2ES2A 2D62A 4XYOA 4KHPL 3QWNA 4BY7G 3HKZG 4R8IA 1SAPA 3AFPA 3R3OA 4HSVA 4IO9A 2FHTA 3SHLA 1PV4A 2K5WA 2N78A 4YWKA 1OTCA 4HMIA 2A1AA 3MFYA 3HOVB 2YTYA 4ZUJA 3J7AV 4HJ8A 1IZ6A 1TWAH 1KAWA 1CSPA 2A69D 4C3IB 2LSSA 3AEVA 2CWAA 5E7NA 3NBIA 3ONAB 2LXJA 2Y0SB 4IJHA 4GNXC 1PH5A 1EQQA 1SXTA 3NBHA 1SEBD 3S24A 4KTAA 4F87A 2B8FA 2XVSA 2D9UA 1GOZA 3D0FA 3G7LA 5I9OA 2BCOA 2RDHA 2NZOA 3G71A 1HCZA 4A3GB 3T51B 4ILWA 4BXXG 2AQ1B 2QCPX 1B50A 1GM5A 1CZGA 1F9SA 1Y1VG 3S17H 2AQ2B 3I4OA 1D5ZC 1A15A 4PZ8A 4IQZA 4HIKA 1C48A 4QJFA 5F2DA 3TMEA 1AZQA 2JYOA 3G6JB 2QDBA 1LTGD 3ZJYC 3S15H 1TS4A 4JBWA 4E6IA 4DAVA 2X69A 1U4LA 1LTAD 3N6RA 1AW7A 1BQQT 3DEOA 4FYDA 2B63B 3P7JA 5CBEE 1TVXA 1VQFA 1Q86C 2B63G 4KY5A 4HIMA 1A3TA 3KLSX 1DOMA 1N33Q 1PXUA 5C0XH 2WV6D 2GN5A 4HIDA 3PIPA 1VS0A 2WACA 4K5WA 2RQXA 5IGCA 1B3AA 5IE8A 4DV5L 2R92B 2EYOA 2RCNA 5HY6A 1FYCA 2QW7A 1ET6A 3W5OA 1F9RA 3TS2A 2EY1A 4LUOA 1A63A 4A75A 2F0TA 3KJPA 2KVMA 3MHBA 2E5LL 4LF8L 2TMPA 2K01A 3NTIA 3PV0A 1XYIA 3LWUA 4KHPQ 1QG7A 4OONA 4C3JB 2UXDQ 1XWEA 2SDFA 1EEID 1L1OC 1Z47A 4A3MH 1V9PA 4C3IG 1PH8A 1WCMB 2MPMA 4G4KA 5JJIA 1HNXL 1EYDA 1XTDA 3EIVA 2R92H 2K52A 3CCSA 4PV1C 2RSOA 2UUCQ 3H0GG 1E24A 1VQNA 3M4OH 1EL0A 5E4WC 5JVG3 1HNWL 4YY3L 5KNDA 4U68A 3V05A 4DR7Q 3I4MB 3RNUA 1W6KA 2R93H 2N8NA 1SE2A 5CV7A 3TZDA 1ICWA 4DV3Q 5AJ3L 3KUPA 3U4ZA 1ICFB 1QUQA 3UDXA 1KDBA 2Z6KA 3URYA 4OO1I 4ME5A 2B2TC 3AMUA 1GUOA 1HH2P 3A54A 3OW2A 4DK6C 4X6AH 2UUBQ 1CQFA 4JI3L 2K1BA 1YHBA 4A3MB 2PI2E 3NUCA 3K5MA 1WCMH 1H9KA 2CH4W 2ZXOA 1YEZA 1O78A 1SROA 1CT1D 4K5XA 4DPGA 4A3JG 2KBNA 5M5WB 2XN9C 1WI5A 1I4XA 5IYBG 1TT2A 3FVQA 5KIXA 1BBUA 3NWTA 4X64Q 1BCPF 4MHEA 2R93B 3NENA 1GKHA 1I4PA 3TEHB 3NBHB 4WJWA 2K50A 3W3AA 4N8FA 2B2WA 2Z4HA 3LNNA 2IX3A 5LMUL 1CKMA 4UP7A 3HKZE 2F0OA 1R4PB 3G6EA 1XNQQ 2A8VA 1Q90A 2K05A 1PFMA 1B4OA 2B8GA 4A3FB 2ZJQA 4LJZC 1WYDA 5C4XB 1N9WA 1H9RA 1SN8A 1VQAA 4GN4B 3A8JE 4O1NA 1HNZL 4RCOA 1K28A 2QEJC 1UNSA 5M5WH 3K58A 1KLUD 4RKBA 5CV8A 1XPRA 1Y1VB 1VQ8A 1ML0D 2FXQA 2Q2TA 4B3SQ 3UE0A 2BOSA 2CVRA 3K57A 1KIXA 3A5ZB 2NN6H 3BVZA 3A55A 4UP9A 4CKEA 1G2TA 2BDOA 2OT2A 3BYYB 3QJYA 4BY1B 5EJWA 1U0LA 2IW3A 2JA6H 3S1QH 3PF4A 4UDUC 1M8AA 3FRPB 3SXHA 5H1SE 1IW7D 4XDXA 1SNOA 5EAYA 1X3PA 2RHQB 4IFDI 4R4TA 4LF7L 5DAUA 3HKZB 1C4QA 1DXMA 3TRZA 1IKMA 4RH6A 3HOXB 3GQBA 4IPHA 1IBMQ 3CAMA 3PO3B 1LTSD 4DA2A 4KY6A 2K75A 3EBEA 2MFIA 4BS9A 5DLQE 2QGQA 4X66Q 3RN5A 2R7ZB 1EY4A 2AUJD 5C3EG 1GD7A 3GTPH 3HS0C 3HRZC 2A74C 1VQJA 3D3RA 5IYDG 1EFID 5FLMH 1DJRD 4RGTA 2DY7A 4ID6A 1TKWB 2EXDA 3OTOQ 4DR6Q 1TQOA 4A76A 1YHAA 2L0CA 2ALYB 3HG9A 1Y8PB 2F0KA 2YTVA 5JEAH 2F0SA 1VQPA 4KD3A 1UEAB 2DY8A 2EYFA 2I46A 1LV9A 5J22A 4UAIA 4UPAA 2B39A 2IWHA 1CKOA 4J8QA 3KF6B 4AYBE 4A3BG 1CK1A 3T1HL 5EGTA 4IFDG 2HIXA 1JCKB 3VA7A 3CCJA 3MEFA 4L5QA 1G8ZD 2XIWA 4POGA 1EOTA 1HFGA 2EYJA 1NMFA 4XQNA 3CPWA 4DR1Q 2VB2X 1V1PA 1D8LA 2HQEA 2EDGA 3STBD 1I50B 3Q22A 1EIFA 4JBKA 1HFNA 1EIYB 2MJ8A 2B2VA 2UXBQ 5LMUQ 1JOKA 4BXXH 5C0XG 2AKWB 2QDLA 1QNKA 2CKZB 2JSOA 1EWIA 2JP1A 3V2TA 1C0AA 2A68D 2I0QA 1Q8IA 4HEDA 3S14B 5LMNL 5BR8L 3OMCA 2F0LA 1PTOC 1VMPA 2VS1A 2WAQG 4NDXA 1BUVT 3TP8A 3K7AH 2EE1A 3C1EA 5CBAE 1ZYRD 1IL8A 2XRQD 4A3FG 1XMOL 3NP8A 2RDFA 1X3FA 3RZOH 1Q46A 5EPJA 3SGIA 5CV9A 4ABNA 3A5UA 2F4VQ 4ZAIA 4NXMQ 1NSNS 4KHVA 4A93G 2Z4IA 3E6ZX 3FMCA 1DM0B 2PNRC 2B2VC 4IPCA 5C3EH 1Z9FA 4I65A 1YITA 1JICA 4DV4L 5JAVA 5IYDH 2C5CA 1PTOH 1SDFA 3K7UC 1UE5A 2J4XA 1YNNC 4HCEA 3CRKC 2JA7G 1O7YA 3L7ZC 1N34L 2YU9H 4KK7A 2DN8A 3CRLC 5EKLA 1XXGA 4LFAQ 1OXTA 2EOTA 3VA5A 4HJ9A 3VDYA 1CZWA 3W1BA 1UWVA 1D1KA 1F77A 4CDCC 3RUZA 1XNRL 4A3BH 1TWHB 5JVH3 4DK3C 3GTJH 1KXLA 3NTHA 4YY3Q 2SOBA 4MN3A 3TS0A 3GV3A 4A3EH 1LACA 1JJGA 2MHVA 4ZRZA 3I4NB 5ELBA 1ASYA 2ZJRA 2NVTH 2ZJPA 2DGYA 4R9WA 5ELCA 1VDZA 1PTOB 4K2KA 4JI7Q 4EQOA 3NHHA 3KYHC 1O7LA 5M3MB 1BBXC 3AYHB 2KHSA 1VQKA 1HNXQ 5HGQA 1M4VA 1YIJA 4H13C 5IODA 2F03A 1S5ED 3SK6A 4JI3Q 1HTPA 1OXXK 1S5CD 1KABA 1XMQQ 1HUMA 1PZID 5IGBA 4FNFA 1B70B 3A7AB 4JG2A 4A3BB 1N32L 1FJGQ 2LFNA 5ELFA 1SSOA 3K8AA 4A3LG 1GHJA 4X3TA 2MP1A 3S15B 2UXBL 1PZJD 1LT4D 4X3SA 1X3QA 3SR1A 1VMCA 4HSPA 2NVXH 1HZCA 4DV7Q 3M4OB 3VR5A 1SMYC 1SJHD 4LK1C 2I5HA 5DEHA 1Q82C 3PUZA 4N9TA 3E9HA 3E9IA 4ZKCB 4DXFA 1JJ2A 4OIJA 1IHZA 3VR3A 2EVBA 5IIFA 5C5LA 1MBYA 4KHZA 4Y52H 4PNYA 2F4VL 1JOQA 2KCCA 4NXML 4WJ3M 4HR7B 1QILA 5D14A 2UU9Q 3ITPA 1A8VA 4GS3A 4HMJA 5D3IB 2BH2A 3STBC 1I94L 1VQ4A 2NVXB 3CCEA 2JEBI 2PZWA 4IURA 5EKIA 4XIGS 3MXNB 3N52A 1X9NA 4FF4A 5IGFA 2VB3X 3SVMA 4LF7Q 1N33L 3BG3A 4DGZA 2NBFA 3BU2A 5D65A 2IX0A 4DV1Q 1IBKQ 2B2UC 4IPGA 1K73C 3KDFB 1H95A 4UY8C 1JOOA 1XJVA 1SNQA 1GUTA 1UAPA 5FKAC 2F0GA 2VZAA 4X65L 1NJIC 1YI2A 5CORA 1GO3E 1XPUA 1WFQA 5C6AA 4JI8Q 1AP0A 4DR4Q 2JJQA 1PFNA 1UE1A 2L4NA 1GUNA 2F0HA 3R2TA 3I55A 4BBSB 1BVSA 3NELA 2DUDA 3J81i 3HEJA 1QJOA 5IP9H 1WTHA 4L5TA 1G6ZA 1LLRD 4IOCA 4R4QA 3KDFA 1JMCA 2MO0A 2ID0A 4JVZA 2EYHA 1JWMD 5G3LF 3F1ZA 1BR9A 1K0RA 4R4IA 4LF5L 1GHKA 2BA0A 2F0MA 1AEXA 1SE4A 1EIGA 1KC8C 1PH6A 4Y7NB 1STBA 2WB1E 1RDPD 3HOXH 2WAQE 1XTCD 3CCUA 5KGUA 1WTRA 1YNJD 2JN4A 3PQIA 3GTMH 2Z9HA 4DR7L 3BYTB 1WTVA 1PH2A 1FGBD 3I70A 3G48A 4GLXA 5I2YA 1BCPD 3MTSA 1K3BC 1JB3A 5HGTA 3GTLH 2RA4A 3T1HQ 4OWTB 4BBSH 5C4JH 4N9PA 5FK9C 3FKIG 3VR2A 3ULJA 4YHHQ 1II3A 3W2DA 2ZM6L 1NBWA 1Q1BA 1X65A 2Q2IA 3Q6SA 1ESRA 3SK5A 3NEMA 5TSSA 1FNVA 1HPCA 3EJIA 5C5MA 4LFBL 4DUYQ 3HKSA 2UUCL 1VQLA 1GJXA 3HOZB 4BY1H 1MKHA 2MNAA 3CXCA 3HOWG 3GO5A 2ZXRA 2ZTEA 2XWBB 2WFWA 2PNHA 2ASBA 4A3KB 5AJ3Q 3K5LA 2HQLA 3SE0A 1VQOA 5BR8Q 4CKCA 1KD1C 1I50H 2E2IH 1X6OA 4OELB 2R93G 2EJGC 1RODA 4PQXA 2LXKA 4LWCA 3CC7A 1SNDA 2FINB 5ELEA 3P75A 1EEFD 1PHJA 5JPMC 1HQRD 4DAMA 2CW0D 3FKIB 1D5XC 4TVAB 1I6VC 3DXJC 1SMXA 5E1FA 2IX1A 3BZCA 4KJOA 1H9SA 2M9VA 1B53A 1KRSA 1LT6D 1VQ6A 2VQEQ 1HR0W 3CP0A 1NE3A 1DZ1A 2ZTCA 2K28A 4DK1A 3GTOB 1F2LA 1R4QB 3H94A 1SYBA 3HGBA 3D6WA 1JJCB 3L0OA 4EVOA 1PTOD 2F0JA 2KENA 3D6CA 1S5BD 3I4NG 4QF4A 3QG1A 3OIQA 1TS2A 1U4RA 4B9XA 1HNZQ 1PLFA 1X54A 2VL6A 5FO9B 2G9DA 2NB0A 5EKKA 1S72A 3FKIH 1Q3LA 1EY5A 2JQOA 5FJ8G 4GKJL 4GKKQ 2AHOB 4DR2L 4A3GH 5EBDA 2N3SA 4WFN3 3OYYA 2JA9A 5IP7H 4IFDH 1MJEA 4P72A 1E22A 1WTPA 3HOYB 4A3DB 3TN2A 2A5HA 2ZXPA 3D31A 1E1OA 3A56A 3M7NA 3F2CA 3GTOH 1CQVA 1Q1EA 5M3FH 3SEBA 4P74A 2B2YC 3I90A 2TSSA 2KEDA 1BNZA 3KLWA 1RL2A 4C3HG 1IBML 3D8GA 3K7AB 3P1HA 3CCLA 2KHIA 4LFBQ 1S40A 3RZOB 4DUZQ 1SFOB 2A6ED 4RA8A 1B8AA 5ELOA 4JI6Q 3FEWX 4CJ2C 2GVBA 4KKTA 3TSSA 2NVQH 2F3WA 1KDCA 1TS3A 3PMFA 2F0NA 4XTCS 1QUQB 1LUZA 3K0XA 3RLNA 4DR6L 5C3EB 2VW9A 1C8CA 3CPFA 4NPSA 5IYCH 2R7ZG 5C44G 4WRDA 1S5DD 2RBMA 1LM0A 1DD2A 5M3FB 2JEAI 2UUAL 1VQ9A 1BCPB 2B2TA 1SJED 2JK8A 1PRTB 2F0IA 4TSSA 3MFGA 4JC0A 1V1PB 3J7A5 1Y8OB 4CDDC 3DWAA 3NPPA 1WD0A 1F2ZA 1D2BA 2L12A 2Z6BA 3ERSX 4A93B 3X3NA 2P5ZX 1YJ9A 3NWSA 1TWHH 1BOSA 3S1MB 2J0TD 3IAYA 3MEHA 1G291 1WTWA 2RHSB 2BE5C 3VYUA 2PZTA 1J5EQ 4B3TQ 4J1MA 3EQLC 3OMGA 3I4NH 1EIHA 1HA5A 2L55A 2NVTB 1SBBB 4AQYQ 1QVCA 2OTJA 4DV3L 1UE7A 2WB1G 4FF2A 4JI8L 3GP7A 2MO1A 5M3MH 4B3RQ 5IYBH 2RKSA 5DM63 1NR2A 1PH1A 3S2DH 3BDOA 1JE5A 2SNSA 2IJ0A 4DF7A 2E2HB 3PIOA 3IRBA 1O80A 4L6TB 2PMZE 3PSIA 1A3VA 4IPDA 4C3HB 3I4LA 2HDMA 3A8IE 4BBRG 4BBRB 3O13A 2MUYA 4BA2I 1WTOA 1P16A 3UDFA 2K5QA 2K4KA 4FP5D 4LFCL 3I73A 4U673 2WINB 4DNIA 1C7YA 4DV6L 2F0EA 2I07B 1UE6A 1EWHA 4GOPA 4A3JB 4JI0L 1IL2A 2NTTA 4PMWA 3F2BA 1YVCA 2CFMA 4RHRA 4K5VA 3I3CA 3P20A 5KNCA 4K14A 1SYGA 1V8QA 2WP8J 2AMCB 1I4QA 1CI3M 3EROA 1HRJA 3TP6A 2CHBD 4AH6A 1Y69U 1F9PA 1TXYA 1CKNA 4R1JA 1VF7A 2Z0SA 1IKLA 4A3LH 1E1TA 3C3LA 2EYMA 1K3RA 3KOJA 4BBSG 4F7XA 5G3LD 4A3IB 2R7DA 2LKVA 1JT8A 5LHY1 5JJKA 4OX9Q 4DUYL 5COYA 2N88A 4RGOS 3U9SA 1PYSB 1I5FA 3D4RA 2F1MA 1EFWA 3BDLA 2E76C 5EQ0A 1FVIA 4NP5A 2JE6I 2OCEA 1EY9A 3CCQA 2E2DC 4Y7NH 1IBLL 2NN6G 4HTHA 2PW5A 4Q0FA 1YJWA 4X62Q 4H7BA 2PZUA 1FGUA 4DR5Q 4LF4L 3GTMB 3M9BA 4ZK9B 4QMGA 1HZBA 1KLGD 1K8GA 2EYPA 3FP9A 4X3UA 4P73A 4JCVE 2Z8LA 1XMQL 3IL8A 3ULLA 4FF1A 5D3DA 3T1YQ 2NVYB 1PYWD 1E3PA 1EZ6A 1N32Q 4ZCKA 4BA1I 1D1IA 1SR3A 1YNJC 1K8AC 1JR0D 2IHFA 3M4QA 4EQPA 5C4ZA 1EQRA 1I4GA 4ULLA 4DR1L 3GTPB 4V0BA 2AUKA 2OEOA 4A3MG 2A69C 1KL9A 1KDAA 1RTNA 3M7GA 1AN8A 1G51A 4J15A 3M85A 4DV7L 3TP7A 2F0FA 4KI0A 1STHA 2OF1A 3PUWA 3AQQA 1D7QA 3EFXD 1L1OA 4G57A 2O5JC 2OXPA 1WOCA 3ER0A 2A6HD 1TWCH 4P71A 4A3KH 3IFTA 2IPKD 1LO5D 1NTGA 3RMHA 2H4OA 4OO1H 5DM73 2A68C 2C9OA 4J6HA 1NR4A 3J7YW 5K36H 1LABA 2E2JH 2XTIA 5IT9L 4C1NK 1Q12A 3W1GA 4DR2Q 4LNQA 5C4JB 1QOHA 4NB3A 1X55A 4RFBA 3SDZA 5EPLA 3UI2A 1LTTD 3I56A 4JK1C 4IUTA 1JB7A 1QE6A 3DWQA 2HIVA 3NK9A 1VQMA 4MNOA 3VYTA 3J81j 2CW0C 4B3MQ 1KTKA 1B9NA 1S5FD 2CQOA 4XT3B 3WOEA 1EYCA 4GKJQ 2GA4B 1VQDA 2OWOA 4GKKL 1IYVA 1YNND 1E2VA 4RWSC 1CUKA 1LT5D 5JEAJ 3B6YA 3U4VA 4B3SL 4NMZA 3BZDB 1GUSA 4A3CH 2B29A 1NNXA 4P75A 1PVOA 3PIO3 1CA5A 2HD3A 1PA6A 2E2IB 1I6HH 4JI5Q 2R61A 1YBYA 1Z6HA 4RKLA 4IJLA 3E0EA 4GLVB 1MHWC 3DUZA 4FXDA 3Q23A 4JI7L 1KHIA 1A0IA 4O0AA 1ONLA 1TWFH 4A3EG 1MSGA 1PRTC 4A4IA 1JWSD 4B9WA 1PH3A 3NTKA 5KYIA 3CC4A 2YU9B 1DYQA 5DNFA 3X3MA 4N8X1 1J6QA 1HZ9A 1Q8KA 1VF5C 3RN2A 3GTKB 4CJ0B 4PZ7A 5BN5A 3RD4A 1FJGL 4YCUA 1QZGA 1SE8A 3MXPA 3CQZB 2D5DA 1VQIA 2BE5D 5FLXL 1I6HB 3D4DA 3H91A 5C44B 1HQMC 1V43A 4A3EB 4OIKA 2R6GA 4P2CB 1JC7A 2PQAB 4B3RL 5C0XI 1WVLA 2K33A 4IUNA 3BVMA 4KKSA 5J3BA 3F2UA 2YTXA 2Q2HA 1F9QA 1L0WA 5BN3A 2PPBC 1N36L 2ICEC 1C9OA 3Q0AA 3JAME 4JI4L 1FD7D 2ZT9C 4YCWA 1STAA 3H6MA 2EQSA 4AQYL 1HR0L 4JYAL 3FPUB 4X3KA 1DCZA 3GTKH 4OL7A 4LFCQ 2NZHA 3HZXA 5C3XA 4RG1A 4HJ7A 2PQEA 1MIUA 1DOLA 2VQEL 1PYBA 4H0LC 2D0PA 4QGUA 2I5LX 4HCSA 4ZLTF 1X32A 1NMGA 2EYLA 2F0PA 2K5NA 3K0YA 2F0DA 4DR3L 4KY7A 5FO7B 1EWCA 4ZYSA 3PGZA 1PDQA 3PO2G 4LF6L 4JI1Q 2V1CC 3PO2B 4PMBA 2VXWA 4A3CG 1SFOH 1B7YB 5JJZA 1KNEA 3KJOA 4TQUS 3HOYG 4A3DG 4BWGB 5IWAQ 2UXCL 1R9TB 4GN5A 2NVQB 2PI2A 1WJJA 5IY0A 1TIID 3DMUA 4CHTB 2K6AA 1J9OA 4DV1L 4C2MH 4JV5Q 4S3SA 3CCVA 3NE5B 3H0GB 4C3HH 2LY7A 3OWEB 3TP5A 3JAMc 1I4HA 2KCTA 2R92G 2OQKA 5ISRA 1K83H 2L9HA 4ZQ3A 1IBLQ 4IOAA 4DR4L 2WKDA 2HHHL 4QCLA 4M1UB 5I6WA 1PMRA 4X62L 2FMMA 2Q8RE 4OEMB 4A93H 1ZXTA 4K6LA 1RCVD 3K80C 3KF8A 2RDGA 1DGSA 5CMDA 3GDEA 2ZTDA 3R2IA 1R9TH 1PH9A 3H3VH 2EJMA 3S16B 2IY5B 1TWGH 1Q81C 2VQFL 5CC4A 1G6PA 4AYBG 5C0XJ 3RLFA 4EX5A 1SYEA 5GQOA 3CMAA 3ND9A 1ILQA 3MVVA 1FL0A 4ZKBB 4QUCA 4ME3A 3DLLA 2NN6I 5M9OA 2R3ZA 5K5PA 1SNCA 4ZUIA 3IKJA 5C4HA 4K0KQ 3NSWA 2XGTA 3QOJA 5KRUA 1G91A 2D0OA 3S2DB 4KN4C 2CWPA 1EYAA 1DONA 4IALA 4XXEA 1U4MA 3T1YL 4QL5A 2Q8TA 1O7IA 3EA6A 5E4XA 3S1NH 4V190 2ZM6Q 2WAQB 4ODGA 3S16H 4HJAA 5T1GA 1EU4A 1TY2A 4DU9A 1TY0A 1L2FA 2M2LA 3L3OC 4DAPA 3GTGB 1EQTA 1BBWA 2K5HA 2IHEA 3R8BA 3VYRA 3JAMi 4OO1G 2B63H 2RCFA 3HOVG 1RKNA 5T1IA 1PTOF 1A2UA 3I2ZA 1CHQD 4ALPA 1MSHA 2F0WA 5LL6X 4K6DA 2FFKB 3TDQA 4YIJA 1BKBA 1STYA 2SEBD 3CHBD 3PCOB 1EU3A 3GTLB 1K9MC 3J81E 4DV2L 3VR4A 2EY2A 4CDFC 2JA6G 4B3ML 5A2QE 1E7ZA 2DNEA 4APVA 2WIIB 1U9RA 3GTGH 2JA5B 1IW7C 1LTBD 5IGEA 2DNCA 1QVGA 2PQAA 4DV6Q 2IL8A 1U5KA 2YYZA 3F8TA 3U50C 1KQSA 2Q8IB 3OIPA 2HHHQ 4C3JH 3H15A 1TS5A 4BY7B 3A74A 2JA8B 3S1RB 3NQTA 3Q24A 5M5XH 4X66L 4QY7A 2EZVA 2MQHA 2VQFQ 1LTRD 1E0BA 3GTQH 4G7OC 1I4RA 3ZYYX 3I4MH 2Y0SE 4KV6A 4UHVA 3CU7A 5E3FA 5I6YA 1CKNB 4NW2A 3JAML 3OTOL 2PO4A 4JI2L 1VQ7A 1HNWQ 2CQAA 5CV6A 1SLJA 5CGKA 1YNXA 4JI0Q 4LUVA 3TREA 3IFDA 3UE1A 1Y14B 3I7FA 3CCRA 2AQ3B 4BY7H 5JJLA 1HJPA 1TWCB 3S1RH 3A0JA 4XQQA 1D5MC 4JOIA 2EJFC 4DKAC 5KNBA 4GNXB 3MXGA 4LF4Q 1YZ6A 3EN2A 4GLAC 5FJ8H 4EQ5A 2EXZA 2CCZA 1SE3A 2UUBL 1BDOA 4A3GG 5IP7G 3OOCA 4IZ8A 4FDBA 2OTLA 3KBXA 2CH4A 2N49A 4LF5Q 3RZDH 4C56C 4OX9L 2EY5A 5M3FG 1N36Q 4JW0A 5NUCA 3A8KE 3HFZB 1UEBA 1S4ZA 3HOZG 4QUFA 4LF9L 4JI6L 4K8JA 3M4YA 5CR3A 1RTOA 4MTKA 1EY7A 3I72A 3UDIA 1FR3A 5M5YH 1S3OA 1TWFB 2JA8G 5IT9c 1D6EC 2KUMA 1BCPC 3DHQA 1KNAA 2NTSA 4K8IA 4OWXB 1STEA 1L0XB 4A3FH 4DFAA 1QWYA 4XQJA 2K14A 5FLXc 2KCNA 3F2DA 1Y1WB 5C4XH 4DAYA 4IUUA 3HOYH 4A3DH 1EQVA 2UUAQ 1Y1VH 3TZUA 3CQZH 4XYQA 1H9SB 3MZ5A 5IOCA 4FO2A 1O7ZA 3MA2B 4JI4Q 2ICIA 2HT1A 1HR0Q 5C44H 3RLOA 3OPOA 3RZDB 3OW7A 1CA6A 3KFUA 1IXRA 2X6LA 2OQ0A 3DM3A 4KKUA 3K81C 2JA6B 4TRDA 5EPKA 1OXUA 1IYUA 1MI2A 4HIOA 2N55A 3K5NA 4HJ5A 1FNUA 1P8LA 2L1BA 3DWPA 1XPOA 4R4OA 3AFQA 4HAEA 4IN3A 4G7ZC 3ICEA 2K5VA 3J80i 3R93A 3HOUB 1Y1WH 4NXNQ 1STNA 2BA1A 3QR8A 2Z1CA 5IYCG 2R7ZH 1XX8A 2A19A 3CMEA 2AWOA 4FVMA 3HOWH 5CYUA 2K32A 5ELDA 4KJNA 4OXPA 1LT3D 2VY3A 1CHPD 4QB4A 1HUNA 3H09A 5KEEA 3FDTA 5GAGC 4JV5L 2VUMG 5EBCA 5C3WA 4IFDJ 3K5OA 2L15A 1HA6A 4JI2Q 2F3IA 4XT1B 1J5EL 4B3TL 2QA4A 1T5EA 5M3MG 1VQ5A 1CFMA 1M90C 4YWMA 4RCNA 2O2LD 4GOPC 3PO3G 3S1MH 5JOBA 4IUPA 1QCBD 1ZEQX 3H3VC 1X3EA 1G2SA 2QF7A 2F0QA 4F8MA 5K36G 4C3IH 5JPNC 1B9MA 4JI5L 3U58A 1EYGA 4MTNA 4C2MB 4OHJA 2Q2UA 2JA7B 3L9AX 4I7ZC 3H0GH 1MJCA 1GUGA 5GROA 1VQEA 3T13A 3I8ZA 1RD9D 1K83B 1TR5A 4DNTB 3KF6A 2WB1B 4DAYB 4DV5Q 3J7AF 1F2YA 2E2HH 3BVGA 1X3GA 3OHXC 3UDGA 1SMYD 4PMCA 2Y0SG 1AH9A 4QQBX 4BBRH 3S17B 2NUCA 1TWGB 4POFA 3S14H 1HXYD 3CKIB 1LTID 4WJ4A 2KECA 2PCFB 4A3JH 2BH8A 2QILA 5FO8B 3PF5A 1W2BA 2F52A 5FOBB 2UXDL 3HOVH 1PH7A 1PRTF 1N8RC 4DR5L 2F3VA 5IT9E 4CDEC 1TWAB 2A73B 3ND8A 1ILPA 3CW2C 1X56A 1VQGA 1Z7TA 1MD2D 4RMFA 3J81L 3MAQA 2JXMB 3S1NB 2BDNA 1VQCA 1HZAA 4A3IH 1SRUA 3QB3A 1B3QA 3TQYA 1M1KC 4Q5VA 4NXNL 2KQ3A 2WKCA 3GV6A 1GXDC 3BJUA 5LMNQ 4R8NA 1AE2A 3MXNA 1JORA 3C2PA 4EQNA 3OSOA 2HDLA 3BZKA 2KCMA 3DEPA 3I4MG 3JC66 2K5DA 1DOKA 4FXKC 1N34Q 3ERQA 1WD1A 1KAAA 4KN7C 2ENBA 4YWLA 3BDCA 3GTJB 4O2DA 3TBIB 3PIP3 1SYCA 1AZPA 3A7LA 3U9OA 2NYZD 1JE4A 2K7VA 4RGMA 3MXUA 4RGNA 5FLXE 1YHQA 4LFAL 4RAUC 3FHWA 1ASZA 1VQBA 4JYAQ 3MC0B 4QIWE 5IP9G 4B08A 4OGQC 2XSCA 2NVYH 5A35A 3KK7A 1QZHA 4OWWB 1Q7YC 4KD4A 4H44C 2NWGA 3Q8DA 3CF5A 3G4SA 2H5XA 2YV5A 4YCVA 3AB9A 3S9WA 2JA5H 2J7ZA 2XNAC 1BXTA 1U4PA 3HOXG 4DNRB 2I5MX 2R7FA 1XNQL 3PUXA 1A62A 1SNMA 2HUGA 3V96A 2PMZB 1BO0A 4QIWB 4CBVA 4CJ1B 2LMCB 4DXGA 4CGYB 1E2ZA 1LYLA 2C35B 1PFSA 4AIMA 3EVQA 3M3YH 1CM9A 4FF3A 3NXWA 4CKBA 4HN7A 3FPPA 1ZKOA 2FMCA 5ELNA 2JA8H 2EY6A 2MGSA 5I4DA 4A3KG 3C1FA 5JEAG 2E74C 4MZ9A 3K59A 2KOLA 3E5SA 3AU7A 1WTQA 2B2UA 4LF9Q 2NZ1D 4LAAA 1H9MA 1QNUA 3BS1A 4M8AA 4O42A 1NY4A 3CD6A 2E2JB 2V4DA 4LUZA 2VNUD 1ENAA 2H1EA 1A3UA 4H02A 5BN4A 1ENFA 1EOVA 1PFBA 1F2MA 4BY1G 1JWUD 2L5TA 4EGVA 1W6JA 4DV0Q 1CSQA 4JPBW 2RF4A 4Z9CB 3J7ZC 3M3YB 1JQYD 4MIUA 3MWYW 5L37A 1SYDA 4RHSA 1RJTA 2XRSD 5C4XG 1PRTD 1QVFA 4PG3A 4C1NI 5GADC 2O5IC 1SYFA 3J81c 1K0SA 5KYLA 1VQHA 1BF4A 1W3SA 1I3QH 4KMUC 3QOLA 2DJFC 3LWEA 2EIFA 5CV5A 1J8IA 4K0KL 2VUMB 1I94Q 3J80c 4JBJA 5AFWA 5FLMG 4FXGC 4LW1A 4KLKA 1EZ8A 1YJNA 1HHVA 5M5XB 3S2HH 5J1ZA 3DM1A 2F4IA 3CCMA 3VR6A 1L1OB 2HCIA 3WWVA 1EY8A 4DV2Q 3GTQB 5LL6S 4IUQA 2A6HC 4JBMA 3WDNA 3ULPA 2ATWA 3HOUG 1MGSA 1B2TA 3PO3H 1A6XA 1Y1WG 2UU9L 1HTLD 2KJXA 2KEEA 2JA5G 4L8JA 2SNMA 2LS01 4GN3B 4C3JG 1B1ZA 2IT1A 1ESFA 1NAPA 1I3QB 4X65Q 1T9HA 1AFPA 3KBGA 3T4AC 4L5RC 4UP8A 1H9JA 1TU2B 2AWNA 2O4XA 2VUMH 1WCMG 5I2XA 2HCCA 1KRTA 2QKIC 1ZYRC 3S2HB 5HURA 1E2WA 4DK0A 2G5DA 3D4WA 1B44D 4TKOB 1RHPA 2E75C 2B3GA 2X6GA 3LX0A 2B2YA 3PUVA 1IBKL 3CC2A 2RSNA 1OXVA 4DR3Q 1V1QA 5J39A 4GOPB 2E8GA 4LF6Q 5LMNW 1WTXA 3KF8B 3T16A 1UUPA 2KHJA 4R4CA 2PYKA 3QIAA 4I7AA 1XMOQ 3WOFA 3S1QB 1PZKD 2EPBA 3KLSA
chains in the Genus database with same CATH topology
2F0UA 2K04A 5M5YB 4F88A 4AYBB 3PUYA 5A2QL 1NCVA 2FJ2A 1ET9A 1V1OA 2PW7A 1GUWA 2K03A 4GZYC 1ENCA 3HP3A 1EY6A 5IGGA 3E0JA 3J80E 3T53B 3KLRA 1RF2D 1OXSC 2A6EC 2M00A 4K2LA 1STGA 1L0YB 3SK4A 1Y8NB 1K8OA 2XWJB 2KA7A 3T56B 5I9PA 3I91A 3K6OA 3QO2A 1NUCA 1QB5D 2B2WC 2D2CC 4LMQD 1FNWA 4IUVA 1SNPA 4L63B 3VYSA 3OWFA 1VCIA 1A2TA 2F0VA 3SK8A 3GD7A 1EY0A 4WORA 3J80L 4G7HC 1T5XD 3C46A 4DN4M 4NKLA 3HOWB 2L11A 1K8MA 5CV4A 2RVLA 3NQIA 1CTMA 1OO9B 5IGDA 2G9HD 2D62A 4XYOA 3QWNA 4R8IA 1SAPA 3R3OA 4HSVA 2FHTA 3SHLA 2K5WA 4HMIA 3MFYA 3HOVB 4ZUJA 3J7AV 4C3IB 2A69D 3NBIA 3ONAB 2Y0SB 1SXTA 3NBHA 1SEBD 4KTAA 4F87A 2B8FA 2XVSA 2D9UA 1GOZA 3G7LA 5I9OA 2BCOA 2RDHA 1HCZA 4A3GB 3T51B 4ILWA 2AQ1B 2QCPX 1B50A 1CZGA 1F9SA 2AQ2B 1D5ZC 1A15A 4IQZA 1C48A 5F2DA 3TMEA 1AZQA 2JYOA 3G6JB 2QDBA 1LTGD 1TS4A 4JBWA 4E6IA 4DAVA 2X69A 1U4LA 1LTAD 3N6RA 1AW7A 1BQQT 3DEOA 4FYDA 2B63B 3P7JA 5CBEE 1TVXA 4KY5A 1A3TA 3KLSX 1DOMA 1PXUA 5C0XH 2WV6D 2WACA 4K5WA 2RQXA 5IGCA 1B3AA 2R92B 2EYOA 1FYCA 1ET6A 1F9RA 2EY1A 2F0TA 2KVMA 3MHBA 2TMPA 2K01A 3NTIA 3PV0A 1XYIA 3LWUA 1QG7A 4C3JB 1XWEA 2SDFA 1EEID 1Z47A 4C3IG 1WCMB 2MPMA 4G4KA 1EYDA 4PV1C 2RSOA 1EL0A 5E4WC 5JVG3 5KNDA 4U68A 3V05A 3I4MB 1W6KA 1SE2A 5CV7A 3TZDA 1ICWA 3KUPA 1KDBA 3URYA 4OO1I 4ME5A 2B2TC 3AMUA 1GUOA 3A54A 1CQFA 2K1BA 4A3MB 3NUCA 3K5MA 1H9KA 2ZXOA 1O78A 1CT1D 4K5XA 5M5WB 2XN9C 1I4XA 1TT2A 3FVQA 5KIXA 3NWTA 1BCPF 4MHEA 2R93B 1I4PA 4WJWA 3W3AA 2B2WA 2Z4HA 3LNNA 2IX3A 2F0OA 1R4PB 1Q90A 2K05A 1PFMA 1B4OA 2B8GA 4A3FB 4LJZC 5C4XB 1H9RA 3A8JE 4O1NA 4RCOA 2QEJC 1UNSA 3K58A 1KLUD 4RKBA 5CV8A 1Y1VB 1ML0D 3K57A 2BOSA 2CVRA 2NN6H 3BVZA 3A55A 4CKEA 1G2TA 2BDOA 2OT2A 3BYYB 3QJYA 4BY1B 5EJWA 2IW3A 4UDUC 3SXHA 1M8AA 3FRPB 1IW7D 4XDXA 1SNOA 1X3PA 4IFDI 5DAUA 3HKZB 1C4QA 1DXMA 1IKMA 4RH6A 3HOXB 3GQBA 3PO3B 1LTSD 4DA2A 4KY6A 4BS9A 2R7ZB 1EY4A 2AUJD 3HS0C 3HRZC 2A74C 3D3RA 1EFID 1DJRD 4RGTA 2DY7A 4ID6A 1TKWB 1TQOA 2L0CA 3HG9A 1Y8PB 2F0KA 5JEAH 2F0SA 4KD3A 1UEAB 2DY8A 2EYFA 2I46A 1LV9A 5J22A 4UAIA 2B39A 2IWHA 4J8QA 1CK1A 5EGTA 4IFDG 1JCKB 3VA7A 1G8ZD 2XIWA 1EOTA 1HFGA 2EYJA 4XQNA 2VB2X 1V1PA 2HQEA 2EDGA 1I50B 3Q22A 1HFNA 2MJ8A 2B2VA 1JOKA 5C0XG 1QNKA 2JSOA 2JP1A 3V2TA 2A68D 1Q8IA 4HEDA 3S14B 3OMCA 2F0LA 1PTOC 1VMPA 4NDXA 1BUVT 3TP8A 2EE1A 3C1EA 5CBAE 1ZYRD 1IL8A 2XRQD 3NP8A 2RDFA 5EPJA 5CV9A 4ABNA 4ZAIA 1NSNS 4KHVA 2Z4IA 3E6ZX 3FMCA 1DM0B 2PNRC 2B2VC 4I65A 1JICA 5JAVA 2C5CA 1PTOH 1SDFA 2J4XA 1YNNC 4HCEA 3CRKC 1O7YA 3L7ZC 4KK7A 2DN8A 3CRLC 5EKLA 1XXGA 1OXTA 2EOTA 3VA5A 1CZWA 1D1KA 1F77A 3RUZA 1TWHB 5JVH3 3NTHA 2SOBA 4MN3A 3GV3A 1LACA 2MHVA 4ZRZA 3I4NB 5ELBA 4R9WA 5ELCA 1VDZA 1PTOB 4K2KA 4EQOA 3NHHA 1O7LA 5M3MB 1BBXC 2KHSA 1M4VA 4H13C 5IODA 2F03A 1S5ED 3SK6A 1HTPA 1OXXK 1S5CD 1KABA 1HUMA 1PZID 5IGBA 4FNFA 3A7AB 4A3BB 2LFNA 5ELFA 1SSOA 1GHJA 4X3TA 2MP1A 3S15B 1PZJD 1LT4D 4X3SA 1X3QA 3SR1A 1VMCA 4HSPA 3M4OB 3VR5A 1SMYC 1SJHD 4LK1C 5DEHA 3PUZA 4N9TA 4ZKCB 4DXFA 4OIJA 1IHZA 3VR3A 2EVBA 5IIFA 5C5LA 1MBYA 4KHZA 4PNYA 1JOQA 2KCCA 4HR7B 1QILA 5D14A 3ITPA 4HMJA 5D3IB 2NVXB 2JEBI 2PZWA 4IURA 5EKIA 4XIGS 3N52A 4FF4A 5IGFA 2VB3X 3SVMA 3BG3A 4DGZA 2NBFA 5D65A 2IX0A 2B2UC 1JOOA 1SNQA 1GUTA 1UAPA 5FKAC 2F0GA 5CORA 5C6AA 1AP0A 1PFNA 2L4NA 1GUNA 2F0HA 3R2TA 4BBSB 3HEJA 1QJOA 1G6ZA 1LLRD 2ID0A 2EYHA 1JWMD 5G3LF 1BR9A 1GHKA 2BA0A 2F0MA 1AEXA 1SE4A 1EIGA 4Y7NB 1STBA 1RDPD 1XTCD 5KGUA 1WTRA 1YNJD 3BYTB 1WTVA 1FGBD 3I70A 5I2YA 1BCPD 3MTSA 1JB3A 5HGTA 2RA4A 4N9PA 5FK9C 3VR2A 1II3A 3W2DA 1Q1BA 3Q6SA 1ESRA 3SK5A 5TSSA 1FNVA 1HPCA 3EJIA 5C5MA 1GJXA 3HOZB 3GO5A 2ZXRA 2XWBB 4A3KB 3K5LA 3SE0A 4CKCA 2EJGC 1RODA 4PQXA 1SNDA 2FINB 5ELEA 3P75A 1EEFD 5JPMC 1HQRD 2CW0D 3FKIB 1D5XC 1I6VC 3DXJC 5E1FA 2IX1A 4KJOA 1H9SA 2M9VA 1B53A 1LT6D 1DZ1A 2K28A 4DK1A 3GTOB 1F2LA 1R4QB 3H94A 1SYBA 3HGBA 3D6WA 4EVOA 1PTOD 2F0JA 3D6CA 1S5BD 4QF4A 3QG1A 3OIQA 1TS2A 1U4RA 4B9XA 1PLFA 5FO9B 2G9DA 2NB0A 5EKKA 1Q3LA 1EY5A 5EBDA 4WFN3 4IFDH 1WTPA 3HOYB 4A3DB 3TN2A 2A5HA 2ZXPA 3D31A 3M7NA 3A56A 1CQVA 1Q1EA 3SEBA 2B2YC 3I90A 2TSSA 2KEDA 1BNZA 4C3HG 3D8GA 3K7AB 3P1HA 3RZOB 1SFOB 2A6ED 4RA8A 3FEWX 4CJ2C 4KKTA 3TSSA 2F3WA 1KDCA 1TS3A 3PMFA 2F0NA 4XTCS 5C3EB 1C8CA 4WRDA 1S5DD 2RBMA 1DD2A 5M3FB 2JEAI 1BCPB 2B2TA 1SJED 4TSSA 1PRTB 2F0IA 3MFGA 1V1PB 1Y8OB 3DWAA 3NPPA 1WD0A 1F2ZA 1D2BA 2L12A 4A93B 3X3NA 3NWSA 1BOSA 3S1MB 2J0TD 3IAYA 3MEHA 1G291 1WTWA 2BE5C 3VYUA 2PZTA 4J1MA 3EQLC 3OMGA 1EIHA 1HA5A 2L55A 2NVTB 1SBBB 4FF2A 3GP7A 2RKSA 5DM63 1NR2A 3BDOA 2SNSA 2IJ0A 4DF7A 2E2HB 1O80A 4L6TB 1A3VA 4C3HB 3I4LA 2HDMA 3A8IE 4BBRB 3O13A 2MUYA 4BA2I 1WTOA 2K5QA 4FP5D 3I73A 4U673 2WINB 2F0EA 2I07B 1EWHA 4A3JB 2NTTA 4PMWA 4RHRA 4K5VA 3I3CA 3P20A 5KNCA 4K14A 1SYGA 1V8QA 2WP8J 1I4QA 1CI3M 3EROA 1HRJA 3TP6A 2CHBD 1Y69U 1F9PA 1VF7A 1IKLA 3C3LA 2EYMA 4F7XA 5G3LD 4A3IB 2LKVA 5LHY1 5COYA 2N88A 4RGOS 3U9SA 3D4RA 2F1MA 3BDLA 2E76C 5EQ0A 4NP5A 2JE6I 1EY9A 2E2DC 2NN6G 4HTHA 2PW5A 4Q0FA 4H7BA 2PZUA 3GTMB 4ZK9B 4QMGA 1KLGD 2EYPA 4X3UA 2Z8LA 3IL8A 4FF1A 5D3DA 2NVYB 1PYWD 1EZ6A 4BA1I 1D1IA 1YNJC 1JR0D 4EQPA 5C4ZA 1I4GA 4ULLA 3GTPB 4V0BA 2AUKA 2OEOA 2A69C 1KDAA 1RTNA 3M7GA 1AN8A 3M85A 3TP7A 2F0FA 4KI0A 1STHA 2OF1A 3PUWA 3EFXD 4G57A 2O5JC 2OXPA 2A6HD 3IFTA 2IPKD 1LO5D 3RMHA 2H4OA 4OO1H 5DM73 2A68C 2C9OA 4J6HA 1NR4A 3J7YW 5K36H 1LABA 5IT9L 4C1NK 1Q12A 5C4JB 1QOHA 4RFBA 3SDZA 5EPLA 3UI2A 1LTTD 4JK1C 4IUTA 1QE6A 3DWQA 3NK9A 3VYTA 2CW0C 1KTKA 1B9NA 3WOEA 1S5FD 4XT3B 1EYCA 2GA4B 1IYVA 1YNND 1E2VA 4RWSC 1LT5D 5JEAJ 4NMZA 3BZDB 1GUSA 3PIO3 1CA5A 2E2IB 2R61A 1Z6HA 4RKLA 3DUZA 4FXDA 3Q23A 1ONLA 1MSGA 1PRTC 1JWSD 4B9WA 3NTKA 5KYIA 2YU9B 1DYQA 5DNFA 3X3MA 1VF5C 3GTKB 4CJ0B 5BN5A 3RD4A 3MXPA 3CQZB 2D5DA 2BE5D 5FLXL 1I6HB 3D4DA 3H91A 5C44B 1HQMC 1V43A 4A3EB 4OIKA 2R6GA 4P2CB 1JC7A 5C0XI 1WVLA 2K33A 4IUNA 3BVMA 4KKSA 3F2UA 1F9QA 5BN3A 2PPBC 2ICEC 3Q0AA 3JAME 1FD7D 2ZT9C 1STAA 3H6MA 3FPUB 4X3KA 1DCZA 4OL7A 3HZXA 5C3XA 2PQEA 1DOLA 4H0LC 4HCSA 4ZLTF 1X32A 2EYLA 2F0PA 3K0YA 2F0DA 4KY7A 5FO7B 1EWCA 4ZYSA 1PDQA 3PO2B 4PMBA 2VXWA 5JJZA 1KNEA 4TQUS 2NVQB 4BWGB 1R9TB 1TIID 4CHTB 3DMUA 2K6AA 1J9OA 4S3SA 3NE5B 3H0GB 2LY7A 3OWEB 3TP5A 1I4HA 5ISRA 2L9HA 4ZQ3A 2WKDA 4QCLA 4M1UB 5I6WA 1PMRA 2FMMA 2Q8RE 1ZXTA 4K6LA 1RCVD 3KF8A 2RDGA 5CMDA 3R2IA 2EJMA 3S16B 5CC4A 5C0XJ 3RLFA 1SYEA 3ND9A 1ILQA 3MVVA 4ZKBB 4QUCA 2NN6I 5M9OA 2R3ZA 5K5PA 1SNCA 4ZUIA 3IKJA 5C4HA 3NSWA 5KRUA 3QOJA 1G91A 3S2DB 4KN4C 1EYAA 1DONA 4IALA 4XXEA 1U4MA 2Q8TA 3EA6A 5E4XA 4V190 2WAQB 4ODGA 5T1GA 1EU4A 1TY2A 4DU9A 1TY0A 2M2LA 3L3OC 4DAPA 3GTGB 1EQTA 3R8BA 3VYRA 4OO1G 1RKNA 5T1IA 1PTOF 1A2UA 1CHQD 1MSHA 2F0WA 5LL6X 4K6DA 2FFKB 3TDQA 4YIJA 1STYA 2SEBD 3CHBD 1EU3A 3GTLB 3J81E 3VR4A 2EY2A 5A2QE 2DNEA 2WIIB 1U9RA 2JA5B 1IW7C 1LTBD 5IGEA 2DNCA 2IL8A 2YYZA 2Q8IB 3OIPA 1TS5A 4BY7B 2JA8B 3S1RB 3NQTA 3Q24A 2EZVA 1LTRD 1E0BA 4G7OC 1I4RA 3ZYYX 4KV6A 3CU7A 5E3FA 5I6YA 4NW2A 3JAML 2PO4A 2CQAA 5CV6A 5CGKA 3IFDA 2AQ3B 1TWCB 4XQQA 1D5MC 2EJFC 5KNBA 3MXGA 2EXZA 1SE3A 1BDOA 3OOCA 4IZ8A 3KBXA 4C56C 2EY5A 5NUCA 3A8KE 1S4ZA 4QUFA 4K8JA 3M4YA 5CR3A 1RTOA 1EY7A 3I72A 1FR3A 1TWFB 1D6EC 2KUMA 1BCPC 3DHQA 1KNAA 2NTSA 4K8IA 1STEA 1L0XB 4DFAA 1QWYA 4XQJA 2KCNA 1Y1WB 4DAYA 4IUUA 1EQVA 3TZUA 4XYQA 1H9SB 3MZ5A 5IOCA 4FO2A 1O7ZA 3MA2B 2ICIA 3OPOA 3RZDB 3OW7A 1CA6A 2X6LA 4KKUA 2JA6B 4TRDA 5EPKA 1OXUA 1IYUA 1MI2A 2N55A 3K5NA 1FNUA 2L1BA 3DWPA 4IN3A 4HAEA 4G7ZC 3R93A 3HOUB 1STNA 2BA1A 2Z1CA 1XX8A 2AWOA 4FVMA 5CYUA 2K32A 5ELDA 4KJNA 1LT3D 4QB4A 1CHPD 1HUNA 3H09A 5KEEA 3FDTA 5EBCA 5C3WA 4IFDJ 3K5OA 1HA6A 4XT1B 1T5EA 1CFMA 4RCNA 2O2LD 5JOBA 4IUPA 1QCBD 1ZEQX 3H3VC 1G2SA 2F0QA 2QF7A 4F8MA 5K36G 5JPNC 1B9MA 4C2MB 4OHJA 2JA7B 3L9AX 4I7ZC 1GUGA 3T13A 3I8ZA 1RD9D 1K83B 1TR5A 4DNTB 2WB1B 3J7AF 1F2YA 3BVGA 3OHXC 1SMYD 4PMCA 3S17B 2NUCA 1TWGB 1HXYD 3CKIB 1LTID 2KECA 2PCFB 2QILA 5FO8B 5FOBB 1PRTF 2F3VA 5IT9E 1TWAB 2A73B 3ND8A 1ILPA 1Z7TA 1MD2D 3J81L 3MAQA 2JXMB 3S1NB 2BDNA 3QB3A 4Q5VA 2KQ3A 2WKCA 3GV6A 1GXDC 4R8NA 3MXNA 1JORA 3C2PA 4EQNA 3OSOA 2HDLA 3DEPA 2K5DA 1DOKA 4FXKC 3ERQA 1WD1A 1KAAA 4KN7C 2ENBA 3BDCA 3GTJB 3TBIB 3PIP3 1SYCA 1AZPA 3A7LA 3U9OA 2NYZD 5FLXE 1JE4A 2K7VA 3MXUA 4RGNA 4RGMA 4RAUC 3MC0B 4B08A 4OGQC 2XSCA 5A35A 3KK7A 4H44C 4KD4A 2NWGA 3AB9A 3S9WA 2J7ZA 2XNAC 1U4PA 1BXTA 4DNRB 3PUXA 3V96A 1SNMA 2HUGA 2PMZB 1BO0A 4QIWB 4CBVA 4CJ1B 2LMCB 4DXGA 4CGYB 1E2ZA 3EVQA 1CM9A 4FF3A 3NXWA 4CKBA 4HN7A 3FPPA 1ZKOA 2FMCA 2EY6A 2MGSA 5I4DA 3C1FA 5JEAG 2E74C 3K59A 2KOLA 3E5SA 3AU7A 1WTQA 2B2UA 2NZ1D 4LAAA 1H9MA 1QNUA 3BS1A 4M8AA 4O42A 2E2JB 2V4DA 2VNUD 1ENAA 2H1EA 1A3UA 5BN4A 1ENFA 1PFBA 1F2MA 1JWUD 2L5TA 4EGVA 1W6JA 4Z9CB 3M3YB 1JQYD 4MIUA 3MWYW 1SYDA 4RHSA 1RJTA 2XRSD 1PRTD 4C1NI 2O5IC 1SYFA 5KYLA 1BF4A 4KMUC 3QOLA 3LWEA 5CV5A 1J8IA 2VUMB 5AFWA 4FXGC 1EZ8A 1HHVA 5M5XB 5J1ZA 3DM1A 2F4IA 3VR6A 2HCIA 1EY8A 3GTQB 5LL6S 4IUQA 2A6HC 3WDNA 1MGSA 1B2TA 1A6XA 1HTLD 2KJXA 2KEEA 4L8JA 2SNMA 2LS01 4C3JG 1B1ZA 2IT1A 1ESFA 1NAPA 1I3QB 1AFPA 3KBGA 3T4AC 1H9JA 1TU2B 2AWNA 2O4XA 5I2XA 2HCCA 2QKIC 1ZYRC 3S2HB 5HURA 1E2WA 4DK0A 3D4WA 1B44D 4TKOB 1RHPA 2E75C 2X6GA 2B2YA 3LX0A 3PUVA 2RSNA 1OXVA 5J39A 1WTXA 3T16A 1UUPA 2PYKA 3QIAA 3WOFA 3S1QB 1PZKD 2EPBA 3KLSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K04 A;  1SDF A;  2D9U A;  3TZD A;  1ICW A;  1MI2 A;  2H1E A;  2B2Y C;  3G7L A;  1O7Y A;  1NCV A;  1PFB A;  2N55 A;  3I90 A;  3KUP A;  1ILP A;  3H91 A;  2FJ2 A;  1ILQ A;  1GUW A;  2KED A;  2L1B A;  4ZKB B;  1BNZ A;  4QUC A;  4IUR A;  5EKI A;  4HAE A;  2R3Z A;  2DY7 A;  3N52 A;  2K03 A;  2B2T C;  4OIK A;  1E0B A;  1NR4 A;  3R93 A;  2EOT A;  1B50 A;  2BDN A;  1F9S A;  3HP3 A;  3I3C A;  3MWY W;  2K1B A;  1WVL A;  3SVM A;  1XX8 A;  1A15 A;  1RJT A;  4RA8 A;  2DY8 A;  3F2U A;  1HRJ A;  1LV9 A;  4NW2 A;  1AZQ A;  2JYO A;  4UAI A;  4CJ2 C;  1G91 A;  3GV6 A;  1F9P A;  1F9Q A;  1HUN A;  1IKL A;  5D65 A;  2HDL A;  4MN3 A;  3GV3 A;  3FDT A;  1DON A;  2X69 A;  1U4L A;  1BF4 A;  3IFD A;  2B2U C;  1U4M A;  5EPL A;  2Q8T A;  3FPU B;  4X3K A;  3DEP A;  5E4X A;  3UI2 A;  1HA6 A;  1C8C A;  3DEO A;  1ROD A;  3LWE A;  4XT1 B;  4IUT A;  3P7J A;  5CBE E;  3I91 A;  1TVX A;  4MHE A;  4R9W A;  1J8I A;  1DOK A;  2FIN B;  1DOL A;  2XIW A;  3QO2 A;  5T1G A;  1DOM A;  1QE6 A;  2B2W C;  2N88 A;  5COY A;  1WD1 A;  5COR A;  1EOT A;  1HFG A;  5AFW A;  2B2T A;  4LMQ D;  2M2L A;  4HCS A;  4IUV A;  4IUP A;  4ZLT F;  1AZP A;  1BBX C;  1HHV A;  1X32 A;  2NYZ D;  1JE4 A;  1AP0 A;  2B2W A;  1EQT A;  1G2S A;  3DM1 A;  4RAU C;  5EQ0 A;  1PFN A;  4XT3 B;  2L4N A;  1B3A A;  2HCI A;  1HFN A;  1PDQ A;  2K05 A;  1HUM A;  3KBX A;  4IUQ A;  4RWS C;  1PFM A;  2MJ8 A;  1B53 A;  2B2V A;  1WD0 A;  1B4O A;  2L12 A;  2VXW A;  1MGS A;  4DN4 M;  1B2T A;  5T1I A;  1F9R A;  5JJZ A;  1G6Z A;  2L11 A;  1KNE A;  1SSO A;  2KEE A;  1DZ1 A;  1QNK A;  1MSH A;  2NWG A;  2RVL A;  4X3T A;  1S4Z A;  4ZK9 B;  4QUF A;  2FFK B;  1WTW A;  2MP1 A;  1RTO A;  2JP1 A;  2K28 A;  1CA5 A;  3I8Z A;  1F2L A;  2KVM A;  4HED A;  2J7Z A;  4X3S A;  1ML0 D;  4X3U A;  1NAP A;  1U4P A;  1EIG A;  2KUM A;  1X3Q A;  1KNA A;  2CVR A;  1VMC A;  3D6W A;  1EIH A;  2HUG A;  1VMP A;  1J9O A;  3IL8 A;  4R8I A;  2K01 A;  1BO0 A;  1SAP A;  1G2T A;  1XYI A;  4HSV A;  2FHT A;  4CJ1 B;  2EE1 A;  2HCC A;  5EJW A;  5CBA E;  1IL8 A;  1QG7 A;  1WTR A;  4IUU A;  1CM9 A;  1WTV A;  1U4R A;  1PLF A;  2SDF A;  1M8A A;  5EPJ A;  4XDX A;  1Q3L A;  2MPM A;  3MTS A;  1X3P A;  2MGS A;  2L9H A;  4ZKC B;  2RA4 A;  1RHP A;  1MSG A;  4ZAI A;  1O7Z A;  4OIJ A;  1NR2 A;  2KOL A;  2X6G A;  2B2Y A;  2IL8 A;  3ONA B;  2KEC A;  2FMM A;  2RSN A;  5DNF A;  1IKM A;  1WTQ A;  1RTN A;  2Q8R E;  2RSO A;  2B2U A;  1EL0 A;  1CA6 A;  1O80 A;  2B2V C;  5E4W C;  1WTX A;  2NZ1 D;  3Q6S A;  1ZXT A;  1ESR A;  2X6L A;  4U68 A;  2HDM A;  4CJ0 B;  1JIC A;  1WTP A;  5D14 A;  4O42 A;  3TN2 A;  5EPK A;  5CMD A;  2EPB A;  1WTO A; 
#chains in the Genus database with same CATH topology
 2F0U A;  2K04 A;  3M4P A;  5M5Y B;  4F88 A;  4AYB B;  1LTL A;  4PZ6 A;  3PUY A;  4X64 L;  2UXC Q;  5A2Q L;  1NCV A;  2Z6K C;  2FJ2 A;  1ET9 A;  1V1O A;  2PW7 A;  1GUW A;  1PH4 A;  2K03 A;  4GZY C;  1ENC A;  3HP3 A;  4DV4 Q;  1EY6 A;  5IGG A;  3E0J A;  4DV0 L;  3J80 E;  3T53 B;  3KLR A;  1RF2 D;  1OXS C;  2A6E C;  4JI1 L;  2M00 A;  5GAE C;  4K2L A;  1STG A;  1L0Y B;  4DUZ L;  3E3X A;  3HOZ H;  3SK4 A;  5GAH C;  1Y8N B;  5IWA L;  1K8O A;  2XWJ B;  4JOI C;  4A3I G;  3LGJ A;  2KA7 A;  3T56 B;  3PO2 H;  5I9P A;  3I91 A;  3K6O A;  2JA7 H;  1XNR Q;  3QO2 A;  1NUC A;  1QB5 D;  2B2W C;  2D2C C;  4L5S A;  4LMQ D;  1FNW A;  4IUV A;  1SNP A;  4L63 B;  3RR5 A;  3VYS A;  1RIP A;  3OWF A;  1VCI A;  4YHH L;  3HOU H;  1A2T A;  2F0V A;  1AE3 A;  2GVA A;  3SK8 A;  1GVP A;  3GD7 A;  4GNX A;  1EY0 A;  4WOR A;  3J80 L;  3L2P A;  4G7H C;  1T5X D;  3C46 A;  4DN4 M;  4NKL A;  3HOW B;  1IYJ B;  3H3V I;  2L11 A;  1K8M A;  2E5L Q;  4LF8 Q;  2QEX A;  5CV4 A;  2RVL A;  3NQI A;  1EUJ A;  1CTM A;  1OO9 B;  5IGD A;  2DJG C;  2G9H D;  2ES2 A;  2D62 A;  4XYO A;  4KHP L;  3QWN A;  4BY7 G;  3HKZ G;  4R8I A;  1SAP A;  3AFP A;  3R3O A;  4HSV A;  4IO9 A;  2FHT A;  3SHL A;  1PV4 A;  2K5W A;  2N78 A;  4YWK A;  1OTC A;  4HMI A;  2A1A A;  3MFY A;  3HOV B;  2YTY A;  4ZUJ A;  3J7A V;  4HJ8 A;  1IZ6 A;  1TWA H;  1KAW A;  1CSP A;  2A69 D;  4C3I B;  2LSS A;  3AEV A;  2CWA A;  5E7N A;  3NBI A;  3ONA B;  2LXJ A;  2Y0S B;  4IJH A;  4GNX C;  1PH5 A;  1EQQ A;  1SXT A;  3NBH A;  1SEB D;  3S24 A;  4KTA A;  4F87 A;  2B8F A;  2XVS A;  2D9U A;  1GOZ A;  3D0F A;  3G7L A;  5I9O A;  2BCO A;  2RDH A;  2NZO A;  3G71 A;  1HCZ A;  4A3G B;  3T51 B;  4ILW A;  4BXX G;  2AQ1 B;  2QCP X;  1B50 A;  1GM5 A;  1CZG A;  1F9S A;  1Y1V G;  3S17 H;  2AQ2 B;  3I4O A;  1D5Z C;  1A15 A;  4PZ8 A;  4IQZ A;  4HIK A;  1C48 A;  4QJF A;  5F2D A;  3TME A;  1AZQ A;  2JYO A;  3G6J B;  2QDB A;  1LTG D;  3ZJY C;  3S15 H;  1TS4 A;  4JBW A;  4E6I A;  4DAV A;  2X69 A;  1U4L A;  1LTA D;  3N6R A;  1AW7 A;  1BQQ T;  3DEO A;  4FYD A;  2B63 B;  3P7J A;  5CBE E;  1TVX A;  1VQF A;  1Q86 C;  2B63 G;  4KY5 A;  4HIM A;  1A3T A;  3KLS X;  1DOM A;  1N33 Q;  1PXU A;  5C0X H;  2WV6 D;  2GN5 A;  4HID A;  3PIP A;  1VS0 A;  2WAC A;  4K5W A;  2RQX A;  5IGC A;  1B3A A;  5IE8 A;  4DV5 L;  2R92 B;  2EYO A;  2RCN A;  5HY6 A;  1FYC A;  2QW7 A;  1ET6 A;  3W5O A;  1F9R A;  3TS2 A;  2EY1 A;  4LUO A;  1A63 A;  4A75 A;  2F0T A;  3KJP A;  2KVM A;  3MHB A;  2E5L L;  4LF8 L;  2TMP A;  2K01 A;  3NTI A;  3PV0 A;  1XYI A;  3LWU A;  4KHP Q;  1QG7 A;  4OON A;  4C3J B;  2UXD Q;  1XWE A;  2SDF A;  1EEI D;  1L1O C;  1Z47 A;  4A3M H;  1V9P A;  4C3I G;  1PH8 A;  1WCM B;  2MPM A;  4G4K A;  5JJI A;  1HNX L;  1EYD A;  1XTD A;  3EIV A;  2R92 H;  2K52 A;  3CCS A;  4PV1 C;  2RSO A;  2UUC Q;  3H0G G;  1E24 A;  1VQN A;  3M4O H;  1EL0 A;  5E4W C;  5JVG 3;  1HNW L;  4YY3 L;  5KND A;  4U68 A;  3V05 A;  4DR7 Q;  3I4M B;  3RNU A;  1W6K A;  2R93 H;  2N8N A;  1SE2 A;  5CV7 A;  3TZD A;  1ICW A;  4DV3 Q;  5AJ3 L;  3KUP A;  3U4Z A;  1ICF B;  1QUQ A;  3UDX A;  1KDB A;  2Z6K A;  3URY A;  4OO1 I;  4ME5 A;  2B2T C;  3AMU A;  1GUO A;  1HH2 P;  3A54 A;  3OW2 A;  4DK6 C;  4X6A H;  2UUB Q;  1CQF A;  4JI3 L;  2K1B A;  1YHB A;  4A3M B;  2PI2 E;  3NUC A;  3K5M A;  1WCM H;  1H9K A;  2CH4 W;  2ZXO A;  1YEZ A;  1O78 A;  1SRO A;  1CT1 D;  4K5X A;  4DPG A;  4A3J G;  2KBN A;  5M5W B;  2XN9 C;  1WI5 A;  1I4X A;  5IYB G;  1TT2 A;  3FVQ A;  5KIX A;  1BBU A;  3NWT A;  4X64 Q;  1BCP F;  4MHE A;  2R93 B;  3NEN A;  1GKH A;  1I4P A;  3TEH B;  3NBH B;  4WJW A;  2K50 A;  3W3A A;  4N8F A;  2B2W A;  2Z4H A;  3LNN A;  2IX3 A;  5LMU L;  1CKM A;  4UP7 A;  3HKZ E;  2F0O A;  1R4P B;  3G6E A;  1XNQ Q;  2A8V A;  1Q90 A;  2K05 A;  1PFM A;  1B4O A;  2B8G A;  4A3F B;  2ZJQ A;  4LJZ C;  1WYD A;  5C4X B;  1N9W A;  1H9R A;  1SN8 A;  1VQA A;  4GN4 B;  3A8J E;  4O1N A;  1HNZ L;  4RCO A;  1K28 A;  2QEJ C;  1UNS A;  5M5W H;  3K58 A;  1KLU D;  4RKB A;  5CV8 A;  1XPR A;  1Y1V B;  1VQ8 A;  1ML0 D;  2FXQ A;  2Q2T A;  4B3S Q;  3UE0 A;  2BOS A;  2CVR A;  3K57 A;  1KIX A;  3A5Z B;  2NN6 H;  3BVZ A;  3A55 A;  4UP9 A;  4CKE A;  1G2T A;  2BDO A;  2OT2 A;  3BYY B;  3QJY A;  4BY1 B;  5EJW A;  1U0L A;  2IW3 A;  2JA6 H;  3S1Q H;  3PF4 A;  4UDU C;  1M8A A;  3FRP B;  3SXH A;  5H1S E;  1IW7 D;  4XDX A;  1SNO A;  5EAY A;  1X3P A;  2RHQ B;  4IFD I;  4R4T A;  4LF7 L;  5DAU A;  3HKZ B;  1C4Q A;  1DXM A;  3TRZ A;  1IKM A;  4RH6 A;  3HOX B;  3GQB A;  4IPH A;  1IBM Q;  3CAM A;  3PO3 B;  1LTS D;  4DA2 A;  4KY6 A;  2K75 A;  3EBE A;  2MFI A;  4BS9 A;  5DLQ E;  2QGQ A;  4X66 Q;  3RN5 A;  2R7Z B;  1EY4 A;  2AUJ D;  5C3E G;  1GD7 A;  3GTP H;  3HS0 C;  3HRZ C;  2A74 C;  1VQJ A;  3D3R A;  5IYD G;  1EFI D;  5FLM H;  1DJR D;  4RGT A;  2DY7 A;  4ID6 A;  1TKW B;  2EXD A;  3OTO Q;  4DR6 Q;  1TQO A;  4A76 A;  1YHA A;  2L0C A;  2ALY B;  3HG9 A;  1Y8P B;  2F0K A;  2YTV A;  5JEA H;  2F0S A;  1VQP A;  4KD3 A;  1UEA B;  2DY8 A;  2EYF A;  2I46 A;  1LV9 A;  5J22 A;  4UAI A;  4UPA A;  2B39 A;  2IWH A;  1CKO A;  4J8Q A;  3KF6 B;  4AYB E;  4A3B G;  1CK1 A;  3T1H L;  5EGT A;  4IFD G;  2HIX A;  1JCK B;  3VA7 A;  3CCJ A;  3MEF A;  4L5Q A;  1G8Z D;  2XIW A;  4POG A;  1EOT A;  1HFG A;  2EYJ A;  1NMF A;  4XQN A;  3CPW A;  4DR1 Q;  2VB2 X;  1V1P A;  1D8L A;  2HQE A;  2EDG A;  3STB D;  1I50 B;  3Q22 A;  1EIF A;  4JBK A;  1HFN A;  1EIY B;  2MJ8 A;  2B2V A;  2UXB Q;  5LMU Q;  1JOK A;  4BXX H;  5C0X G;  2AKW B;  2QDL A;  1QNK A;  2CKZ B;  2JSO A;  1EWI A;  2JP1 A;  3V2T A;  1C0A A;  2A68 D;  2I0Q A;  1Q8I A;  4HED A;  3S14 B;  5LMN L;  5BR8 L;  3OMC A;  2F0L A;  1PTO C;  1VMP A;  2VS1 A;  2WAQ G;  4NDX A;  1BUV T;  3TP8 A;  3K7A H;  2EE1 A;  3C1E A;  5CBA E;  1ZYR D;  1IL8 A;  2XRQ D;  4A3F G;  1XMO L;  3NP8 A;  2RDF A;  1X3F A;  3RZO H;  1Q46 A;  5EPJ A;  3SGI A;  5CV9 A;  4ABN A;  3A5U A;  2F4V Q;  4ZAI A;  4NXM Q;  1NSN S;  4KHV A;  4A93 G;  2Z4I A;  3E6Z X;  3FMC A;  1DM0 B;  2PNR C;  2B2V C;  4IPC A;  5C3E H;  1Z9F A;  4I65 A;  1YIT A;  1JIC A;  4DV4 L;  5JAV A;  5IYD H;  2C5C A;  1PTO H;  1SDF A;  3K7U C;  1UE5 A;  2J4X A;  1YNN C;  4HCE A;  3CRK C;  2JA7 G;  1O7Y A;  3L7Z C;  1N34 L;  2YU9 H;  4KK7 A;  2DN8 A;  3CRL C;  5EKL A;  1XXG A;  4LFA Q;  1OXT A;  2EOT A;  3VA5 A;  4HJ9 A;  3VDY A;  1CZW A;  3W1B A;  1UWV A;  1D1K A;  1F77 A;  4CDC C;  3RUZ A;  1XNR L;  4A3B H;  1TWH B;  5JVH 3;  4DK3 C;  3GTJ H;  1KXL A;  3NTH A;  4YY3 Q;  2SOB A;  4MN3 A;  3TS0 A;  3GV3 A;  4A3E H;  1LAC A;  1JJG A;  2MHV A;  4ZRZ A;  3I4N B;  5ELB A;  1ASY A;  2ZJR A;  2NVT H;  2ZJP A;  2DGY A;  4R9W A;  5ELC A;  1VDZ A;  1PTO B;  4K2K A;  4JI7 Q;  4EQO A;  3NHH A;  3KYH C;  1O7L A;  5M3M B;  1BBX C;  3AYH B;  2KHS A;  1VQK A;  1HNX Q;  5HGQ A;  1M4V A;  1YIJ A;  4H13 C;  5IOD A;  2F03 A;  1S5E D;  3SK6 A;  4JI3 Q;  1HTP A;  1OXX K;  1S5C D;  1KAB A;  1XMQ Q;  1HUM A;  1PZI D;  5IGB A;  4FNF A;  1B70 B;  3A7A B;  4JG2 A;  4A3B B;  1N32 L;  1FJG Q;  2LFN A;  5ELF A;  1SSO A;  3K8A A;  4A3L G;  1GHJ A;  4X3T A;  2MP1 A;  3S15 B;  2UXB L;  1PZJ D;  1LT4 D;  4X3S A;  1X3Q A;  3SR1 A;  1VMC A;  4HSP A;  2NVX H;  1HZC A;  4DV7 Q;  3M4O B;  3VR5 A;  1SMY C;  1SJH D;  4LK1 C;  2I5H A;  5DEH A;  1Q82 C;  3PUZ A;  4N9T A;  3E9H A;  3E9I A;  4ZKC B;  4DXF A;  1JJ2 A;  4OIJ A;  1IHZ A;  3VR3 A;  2EVB A;  5IIF A;  5C5L A;  1MBY A;  4KHZ A;  4Y52 H;  4PNY A;  2F4V L;  1JOQ A;  2KCC A;  4NXM L;  4WJ3 M;  4HR7 B;  1QIL A;  5D14 A;  2UU9 Q;  3ITP A;  1A8V A;  4GS3 A;  4HMJ A;  5D3I B;  2BH2 A;  3STB C;  1I94 L;  1VQ4 A;  2NVX B;  3CCE A;  2JEB I;  2PZW A;  4IUR A;  5EKI A;  4XIG S;  3MXN B;  3N52 A;  1X9N A;  4FF4 A;  5IGF A;  2VB3 X;  3SVM A;  4LF7 Q;  1N33 L;  3BG3 A;  4DGZ A;  2NBF A;  3BU2 A;  5D65 A;  2IX0 A;  4DV1 Q;  1IBK Q;  2B2U C;  4IPG A;  1K73 C;  3KDF B;  1H95 A;  4UY8 C;  1JOO A;  1XJV A;  1SNQ A;  1GUT A;  1UAP A;  5FKA C;  2F0G A;  2VZA A;  4X65 L;  1NJI C;  1YI2 A;  5COR A;  1GO3 E;  1XPU A;  1WFQ A;  5C6A A;  4JI8 Q;  1AP0 A;  4DR4 Q;  2JJQ A;  1PFN A;  1UE1 A;  2L4N A;  1GUN A;  2F0H A;  3R2T A;  3I55 A;  4BBS B;  1BVS A;  3NEL A;  2DUD A;  3J81 i;  3HEJ A;  1QJO A;  5IP9 H;  1WTH A;  4L5T A;  1G6Z A;  1LLR D;  4IOC A;  4R4Q A;  3KDF A;  1JMC A;  2MO0 A;  2ID0 A;  4JVZ A;  2EYH A;  1JWM D;  5G3L F;  3F1Z A;  1BR9 A;  1K0R A;  4R4I A;  4LF5 L;  1GHK A;  2BA0 A;  2F0M A;  1AEX A;  1SE4 A;  1EIG A;  1KC8 C;  1PH6 A;  4Y7N B;  1STB A;  2WB1 E;  1RDP D;  3HOX H;  2WAQ E;  1XTC D;  3CCU A;  5KGU A;  1WTR A;  1YNJ D;  2JN4 A;  3PQI A;  3GTM H;  2Z9H A;  4DR7 L;  3BYT B;  1WTV A;  1PH2 A;  1FGB D;  3I70 A;  3G48 A;  4GLX A;  5I2Y A;  1BCP D;  3MTS A;  1K3B C;  1JB3 A;  5HGT A;  3GTL H;  2RA4 A;  3T1H Q;  4OWT B;  4BBS H;  5C4J H;  4N9P A;  5FK9 C;  3FKI G;  3VR2 A;  3ULJ A;  4YHH Q;  1II3 A;  3W2D A;  2ZM6 L;  1NBW A;  1Q1B A;  1X65 A;  2Q2I A;  3Q6S A;  1ESR A;  3SK5 A;  3NEM A;  5TSS A;  1FNV A;  1HPC A;  3EJI A;  5C5M A;  4LFB L;  4DUY Q;  3HKS A;  2UUC L;  1VQL A;  1GJX A;  3HOZ B;  4BY1 H;  1MKH A;  2MNA A;  3CXC A;  3HOW G;  3GO5 A;  2ZXR A;  2ZTE A;  2XWB B;  2WFW A;  2PNH A;  2ASB A;  4A3K B;  5AJ3 Q;  3K5L A;  2HQL A;  3SE0 A;  1VQO A;  5BR8 Q;  4CKC A;  1KD1 C;  1I50 H;  2E2I H;  1X6O A;  4OEL B;  2R93 G;  2EJG C;  1ROD A;  4PQX A;  2LXK A;  4LWC A;  3CC7 A;  1SND A;  2FIN B;  5ELE A;  3P75 A;  1EEF D;  1PHJ A;  5JPM C;  1HQR D;  4DAM A;  2CW0 D;  3FKI B;  1D5X C;  4TVA B;  1I6V C;  3DXJ C;  1SMX A;  5E1F A;  2IX1 A;  3BZC A;  4KJO A;  1H9S A;  2M9V A;  1B53 A;  1KRS A;  1LT6 D;  1VQ6 A;  2VQE Q;  1HR0 W;  3CP0 A;  1NE3 A;  1DZ1 A;  2ZTC A;  2K28 A;  4DK1 A;  3GTO B;  1F2L A;  1R4Q B;  3H94 A;  1SYB A;  3HGB A;  3D6W A;  1JJC B;  3L0O A;  4EVO A;  1PTO D;  2F0J A;  2KEN A;  3D6C A;  1S5B D;  3I4N G;  4QF4 A;  3QG1 A;  3OIQ A;  1TS2 A;  1U4R A;  4B9X A;  1HNZ Q;  1PLF A;  1X54 A;  2VL6 A;  5FO9 B;  2G9D A;  2NB0 A;  5EKK A;  1S72 A;  3FKI H;  1Q3L A;  1EY5 A;  2JQO A;  5FJ8 G;  4GKJ L;  4GKK Q;  2AHO B;  4DR2 L;  4A3G H;  5EBD A;  2N3S A;  4WFN 3;  3OYY A;  2JA9 A;  5IP7 H;  4IFD H;  1MJE A;  4P72 A;  1E22 A;  1WTP A;  3HOY B;  4A3D B;  3TN2 A;  2A5H A;  2ZXP A;  3D31 A;  1E1O A;  3A56 A;  3M7N A;  3F2C A;  3GTO H;  1CQV A;  1Q1E A;  5M3F H;  3SEB A;  4P74 A;  2B2Y C;  3I90 A;  2TSS A;  2KED A;  1BNZ A;  3KLW A;  1RL2 A;  4C3H G;  1IBM L;  3D8G A;  3K7A B;  3P1H A;  3CCL A;  2KHI A;  4LFB Q;  1S40 A;  3RZO B;  4DUZ Q;  1SFO B;  2A6E D;  4RA8 A;  1B8A A;  5ELO A;  4JI6 Q;  3FEW X;  4CJ2 C;  2GVB A;  4KKT A;  3TSS A;  2NVQ H;  2F3W A;  1KDC A;  1TS3 A;  3PMF A;  2F0N A;  4XTC S;  1QUQ B;  1LUZ A;  3K0X A;  3RLN A;  4DR6 L;  5C3E B;  2VW9 A;  1C8C A;  3CPF A;  4NPS A;  5IYC H;  2R7Z G;  5C44 G;  4WRD A;  1S5D D;  2RBM A;  1LM0 A;  1DD2 A;  5M3F B;  2JEA I;  2UUA L;  1VQ9 A;  1BCP B;  2B2T A;  1SJE D;  2JK8 A;  1PRT B;  2F0I A;  4TSS A;  3MFG A;  4JC0 A;  1V1P B;  3J7A 5;  1Y8O B;  4CDD C;  3DWA A;  3NPP A;  1WD0 A;  1F2Z A;  1D2B A;  2L12 A;  2Z6B A;  3ERS X;  4A93 B;  3X3N A;  2P5Z X;  1YJ9 A;  3NWS A;  1TWH H;  1BOS A;  3S1M B;  2J0T D;  3IAY A;  3MEH A;  1G29 1;  1WTW A;  2RHS B;  2BE5 C;  3VYU A;  2PZT A;  1J5E Q;  4B3T Q;  4J1M A;  3EQL C;  3OMG A;  3I4N H;  1EIH A;  1HA5 A;  2L55 A;  2NVT B;  1SBB B;  4AQY Q;  1QVC A;  2OTJ A;  4DV3 L;  1UE7 A;  2WB1 G;  4FF2 A;  4JI8 L;  3GP7 A;  2MO1 A;  5M3M H;  4B3R Q;  5IYB H;  2RKS A;  5DM6 3;  1NR2 A;  1PH1 A;  3S2D H;  3BDO A;  1JE5 A;  2SNS A;  2IJ0 A;  4DF7 A;  2E2H B;  3PIO A;  3IRB A;  1O80 A;  4L6T B;  2PMZ E;  3PSI A;  1A3V A;  4IPD A;  4C3H B;  3I4L A;  2HDM A;  3A8I E;  4BBR G;  4BBR B;  3O13 A;  2MUY A;  4BA2 I;  1WTO A;  1P16 A;  3UDF A;  2K5Q A;  2K4K A;  4FP5 D;  4LFC L;  3I73 A;  4U67 3;  2WIN B;  4DNI A;  1C7Y A;  4DV6 L;  2F0E A;  2I07 B;  1UE6 A;  1EWH A;  4GOP A;  4A3J B;  4JI0 L;  1IL2 A;  2NTT A;  4PMW A;  3F2B A;  1YVC A;  2CFM A;  4RHR A;  4K5V A;  3I3C A;  3P20 A;  5KNC A;  4K14 A;  1SYG A;  1V8Q A;  2WP8 J;  2AMC B;  1I4Q A;  1CI3 M;  3ERO A;  1HRJ A;  3TP6 A;  2CHB D;  4AH6 A;  1Y69 U;  1F9P A;  1TXY A;  1CKN A;  4R1J A;  1VF7 A;  2Z0S A;  1IKL A;  4A3L H;  1E1T A;  3C3L A;  2EYM A;  1K3R A;  3KOJ A;  4BBS G;  4F7X A;  5G3L D;  4A3I B;  2R7D A;  2LKV A;  1JT8 A;  5LHY 1;  5JJK A;  4OX9 Q;  4DUY L;  5COY A;  2N88 A;  4RGO S;  3U9S A;  1PYS B;  1I5F A;  3D4R A;  2F1M A;  1EFW A;  3BDL A;  2E76 C;  5EQ0 A;  1FVI A;  4NP5 A;  2JE6 I;  2OCE A;  1EY9 A;  3CCQ A;  2E2D C;  4Y7N H;  1IBL L;  2NN6 G;  4HTH A;  2PW5 A;  4Q0F A;  1YJW A;  4X62 Q;  4H7B A;  2PZU A;  1FGU A;  4DR5 Q;  4LF4 L;  3GTM B;  3M9B A;  4ZK9 B;  4QMG A;  1HZB A;  1KLG D;  1K8G A;  2EYP A;  3FP9 A;  4X3U A;  4P73 A;  4JCV E;  2Z8L A;  1XMQ L;  3IL8 A;  3ULL A;  4FF1 A;  5D3D A;  3T1Y Q;  2NVY B;  1PYW D;  1E3P A;  1EZ6 A;  1N32 Q;  4ZCK A;  4BA1 I;  1D1I A;  1SR3 A;  1YNJ C;  1K8A C;  1JR0 D;  2IHF A;  3M4Q A;  4EQP A;  5C4Z A;  1EQR A;  1I4G A;  4ULL A;  4DR1 L;  3GTP B;  4V0B A;  2AUK A;  2OEO A;  4A3M G;  2A69 C;  1KL9 A;  1KDA A;  1RTN A;  3M7G A;  1AN8 A;  1G51 A;  4J15 A;  3M85 A;  4DV7 L;  3TP7 A;  2F0F A;  4KI0 A;  1STH A;  2OF1 A;  3PUW A;  3AQQ A;  1D7Q A;  3EFX D;  1L1O A;  4G57 A;  2O5J C;  2OXP A;  1WOC A;  3ER0 A;  2A6H D;  1TWC H;  4P71 A;  4A3K H;  3IFT A;  2IPK D;  1LO5 D;  1NTG A;  3RMH A;  2H4O A;  4OO1 H;  5DM7 3;  2A68 C;  2C9O A;  4J6H A;  1NR4 A;  3J7Y W;  5K36 H;  1LAB A;  2E2J H;  2XTI A;  5IT9 L;  4C1N K;  1Q12 A;  3W1G A;  4DR2 Q;  4LNQ A;  5C4J B;  1QOH A;  4NB3 A;  1X55 A;  4RFB A;  3SDZ A;  5EPL A;  3UI2 A;  1LTT D;  3I56 A;  4JK1 C;  4IUT A;  1JB7 A;  1QE6 A;  3DWQ A;  2HIV A;  3NK9 A;  1VQM A;  4MNO A;  3VYT A;  3J81 j;  2CW0 C;  4B3M Q;  1KTK A;  1B9N A;  1S5F D;  2CQO A;  4XT3 B;  3WOE A;  1EYC A;  4GKJ Q;  2GA4 B;  1VQD A;  2OWO A;  4GKK L;  1IYV A;  1YNN D;  1E2V A;  4RWS C;  1CUK A;  1LT5 D;  5JEA J;  3B6Y A;  3U4V A;  4B3S L;  4NMZ A;  3BZD B;  1GUS A;  4A3C H;  2B29 A;  1NNX A;  4P75 A;  1PVO A;  3PIO 3;  1CA5 A;  2HD3 A;  1PA6 A;  2E2I B;  1I6H H;  4JI5 Q;  2R61 A;  1YBY A;  1Z6H A;  4RKL A;  4IJL A;  3E0E A;  4GLV B;  1MHW C;  3DUZ A;  4FXD A;  3Q23 A;  4JI7 L;  1KHI A;  1A0I A;  4O0A A;  1ONL A;  1TWF H;  4A3E G;  1MSG A;  1PRT C;  4A4I A;  1JWS D;  4B9W A;  1PH3 A;  3NTK A;  5KYI A;  3CC4 A;  2YU9 B;  1DYQ A;  5DNF A;  3X3M A;  4N8X 1;  1J6Q A;  1HZ9 A;  1Q8K A;  1VF5 C;  3RN2 A;  3GTK B;  4CJ0 B;  4PZ7 A;  5BN5 A;  3RD4 A;  1FJG L;  4YCU A;  1QZG A;  1SE8 A;  3MXP A;  3CQZ B;  2D5D A;  1VQI A;  2BE5 D;  5FLX L;  1I6H B;  3D4D A;  3H91 A;  5C44 B;  1HQM C;  1V43 A;  4A3E B;  4OIK A;  2R6G A;  4P2C B;  1JC7 A;  2PQA B;  4B3R L;  5C0X I;  1WVL A;  2K33 A;  4IUN A;  3BVM A;  4KKS A;  5J3B A;  3F2U A;  2YTX A;  2Q2H A;  1F9Q A;  1L0W A;  5BN3 A;  2PPB C;  1N36 L;  2ICE C;  1C9O A;  3Q0A A;  3JAM E;  4JI4 L;  1FD7 D;  2ZT9 C;  4YCW A;  1STA A;  3H6M A;  2EQS A;  4AQY L;  1HR0 L;  4JYA L;  3FPU B;  4X3K A;  1DCZ A;  3GTK H;  4OL7 A;  4LFC Q;  2NZH A;  3HZX A;  5C3X A;  4RG1 A;  4HJ7 A;  2PQE A;  1MIU A;  1DOL A;  2VQE L;  1PYB A;  4H0L C;  2D0P A;  4QGU A;  2I5L X;  4HCS A;  4ZLT F;  1X32 A;  1NMG A;  2EYL A;  2F0P A;  2K5N A;  3K0Y A;  2F0D A;  4DR3 L;  4KY7 A;  5FO7 B;  1EWC A;  4ZYS A;  3PGZ A;  1PDQ A;  3PO2 G;  4LF6 L;  4JI1 Q;  2V1C C;  3PO2 B;  4PMB A;  2VXW A;  4A3C G;  1SFO H;  1B7Y B;  5JJZ A;  1KNE A;  3KJO A;  4TQU S;  3HOY G;  4A3D G;  4BWG B;  5IWA Q;  2UXC L;  1R9T B;  4GN5 A;  2NVQ B;  2PI2 A;  1WJJ A;  5IY0 A;  1TII D;  3DMU A;  4CHT B;  2K6A A;  1J9O A;  4DV1 L;  4C2M H;  4JV5 Q;  4S3S A;  3CCV A;  3NE5 B;  3H0G B;  4C3H H;  2LY7 A;  3OWE B;  3TP5 A;  3JAM c;  1I4H A;  2KCT A;  2R92 G;  2OQK A;  5ISR A;  1K83 H;  2L9H A;  4ZQ3 A;  1IBL Q;  4IOA A;  4DR4 L;  2WKD A;  2HHH L;  4QCL A;  4M1U B;  5I6W A;  1PMR A;  4X62 L;  2FMM A;  2Q8R E;  4OEM B;  4A93 H;  1ZXT A;  4K6L A;  1RCV D;  3K80 C;  3KF8 A;  2RDG A;  1DGS A;  5CMD A;  3GDE A;  2ZTD A;  3R2I A;  1R9T H;  1PH9 A;  3H3V H;  2EJM A;  3S16 B;  2IY5 B;  1TWG H;  1Q81 C;  2VQF L;  5CC4 A;  1G6P A;  4AYB G;  5C0X J;  3RLF A;  4EX5 A;  1SYE A;  5GQO A;  3CMA A;  3ND9 A;  1ILQ A;  3MVV A;  1FL0 A;  4ZKB B;  4QUC A;  4ME3 A;  3DLL A;  2NN6 I;  5M9O A;  2R3Z A;  5K5P A;  1SNC A;  4ZUI A;  3IKJ A;  5C4H A;  4K0K Q;  3NSW A;  2XGT A;  3QOJ A;  5KRU A;  1G91 A;  2D0O A;  3S2D B;  4KN4 C;  2CWP A;  1EYA A;  1DON A;  4IAL A;  4XXE A;  1U4M A;  3T1Y L;  4QL5 A;  2Q8T A;  1O7I A;  3EA6 A;  5E4X A;  3S1N H;  4V19 0;  2ZM6 Q;  2WAQ B;  4ODG A;  3S16 H;  4HJA A;  5T1G A;  1EU4 A;  1TY2 A;  4DU9 A;  1TY0 A;  1L2F A;  2M2L A;  3L3O C;  4DAP A;  3GTG B;  1EQT A;  1BBW A;  2K5H A;  2IHE A;  3R8B A;  3VYR A;  3JAM i;  4OO1 G;  2B63 H;  2RCF A;  3HOV G;  1RKN A;  5T1I A;  1PTO F;  1A2U A;  3I2Z A;  1CHQ D;  4ALP A;  1MSH A;  2F0W A;  5LL6 X;  4K6D A;  2FFK B;  3TDQ A;  4YIJ A;  1BKB A;  1STY A;  2SEB D;  3CHB D;  3PCO B;  1EU3 A;  3GTL B;  1K9M C;  3J81 E;  4DV2 L;  3VR4 A;  2EY2 A;  4CDF C;  2JA6 G;  4B3M L;  5A2Q E;  1E7Z A;  2DNE A;  4APV A;  2WII B;  1U9R A;  3GTG H;  2JA5 B;  1IW7 C;  1LTB D;  5IGE A;  2DNC A;  1QVG A;  2PQA A;  4DV6 Q;  2IL8 A;  1U5K A;  2YYZ A;  3F8T A;  3U50 C;  1KQS A;  2Q8I B;  3OIP A;  2HHH Q;  4C3J H;  3H15 A;  1TS5 A;  4BY7 B;  3A74 A;  2JA8 B;  3S1R B;  3NQT A;  3Q24 A;  5M5X H;  4X66 L;  4QY7 A;  2EZV A;  2MQH A;  2VQF Q;  1LTR D;  1E0B A;  3GTQ H;  4G7O C;  1I4R A;  3ZYY X;  3I4M H;  2Y0S E;  4KV6 A;  4UHV A;  3CU7 A;  5E3F A;  5I6Y A;  1CKN B;  4NW2 A;  3JAM L;  3OTO L;  2PO4 A;  4JI2 L;  1VQ7 A;  1HNW Q;  2CQA A;  5CV6 A;  1SLJ A;  5CGK A;  1YNX A;  4JI0 Q;  4LUV A;  3TRE A;  3IFD A;  3UE1 A;  1Y14 B;  3I7F A;  3CCR A;  2AQ3 B;  4BY7 H;  5JJL A;  1HJP A;  1TWC B;  3S1R H;  3A0J A;  4XQQ A;  1D5M C;  4JOI A;  2EJF C;  4DKA C;  5KNB A;  4GNX B;  3MXG A;  4LF4 Q;  1YZ6 A;  3EN2 A;  4GLA C;  5FJ8 H;  4EQ5 A;  2EXZ A;  2CCZ A;  1SE3 A;  2UUB L;  1BDO A;  4A3G G;  5IP7 G;  3OOC A;  4IZ8 A;  4FDB A;  2OTL A;  3KBX A;  2CH4 A;  2N49 A;  4LF5 Q;  3RZD H;  4C56 C;  4OX9 L;  2EY5 A;  5M3F G;  1N36 Q;  4JW0 A;  5NUC A;  3A8K E;  3HFZ B;  1UEB A;  1S4Z A;  3HOZ G;  4QUF A;  4LF9 L;  4JI6 L;  4K8J A;  3M4Y A;  5CR3 A;  1RTO A;  4MTK A;  1EY7 A;  3I72 A;  3UDI A;  1FR3 A;  5M5Y H;  1S3O A;  1TWF B;  2JA8 G;  5IT9 c;  1D6E C;  2KUM A;  1BCP C;  3DHQ A;  1KNA A;  2NTS A;  4K8I A;  4OWX B;  1STE A;  1L0X B;  4A3F H;  4DFA A;  1QWY A;  4XQJ A;  2K14 A;  5FLX c;  2KCN A;  3F2D A;  1Y1W B;  5C4X H;  4DAY A;  4IUU A;  3HOY H;  4A3D H;  1EQV A;  2UUA Q;  1Y1V H;  3TZU A;  3CQZ H;  4XYQ A;  1H9S B;  3MZ5 A;  5IOC A;  4FO2 A;  1O7Z A;  3MA2 B;  4JI4 Q;  2ICI A;  2HT1 A;  1HR0 Q;  5C44 H;  3RLO A;  3OPO A;  3RZD B;  3OW7 A;  1CA6 A;  3KFU A;  1IXR A;  2X6L A;  2OQ0 A;  3DM3 A;  4KKU A;  3K81 C;  2JA6 B;  4TRD A;  5EPK A;  1OXU A;  1IYU A;  1MI2 A;  4HIO A;  2N55 A;  3K5N A;  4HJ5 A;  1FNU A;  1P8L A;  2L1B A;  3DWP A;  1XPO A;  4R4O A;  3AFQ A;  4HAE A;  4IN3 A;  4G7Z C;  3ICE A;  2K5V A;  3J80 i;  3R93 A;  3HOU B;  1Y1W H;  4NXN Q;  1STN A;  2BA1 A;  3QR8 A;  2Z1C A;  5IYC G;  2R7Z H;  1XX8 A;  2A19 A;  3CME A;  2AWO A;  4FVM A;  3HOW H;  5CYU A;  2K32 A;  5ELD A;  4KJN A;  4OXP A;  1LT3 D;  2VY3 A;  1CHP D;  4QB4 A;  1HUN A;  3H09 A;  5KEE A;  3FDT A;  5GAG C;  4JV5 L;  2VUM G;  5EBC A;  5C3W A;  4IFD J;  3K5O A;  2L15 A;  1HA6 A;  4JI2 Q;  2F3I A;  4XT1 B;  1J5E L;  4B3T L;  2QA4 A;  1T5E A;  5M3M G;  1VQ5 A;  1CFM A;  1M90 C;  4YWM A;  4RCN A;  2O2L D;  4GOP C;  3PO3 G;  3S1M H;  5JOB A;  4IUP A;  1QCB D;  1ZEQ X;  3H3V C;  1X3E A;  1G2S A;  2QF7 A;  2F0Q A;  4F8M A;  5K36 G;  4C3I H;  5JPN C;  1B9M A;  4JI5 L;  3U58 A;  1EYG A;  4MTN A;  4C2M B;  4OHJ A;  2Q2U A;  2JA7 B;  3L9A X;  4I7Z C;  3H0G H;  1MJC A;  1GUG A;  5GRO A;  1VQE A;  3T13 A;  3I8Z A;  1RD9 D;  1K83 B;  1TR5 A;  4DNT B;  3KF6 A;  2WB1 B;  4DAY B;  4DV5 Q;  3J7A F;  1F2Y A;  2E2H H;  3BVG A;  1X3G A;  3OHX C;  3UDG A;  1SMY D;  4PMC A;  2Y0S G;  1AH9 A;  4QQB X;  4BBR H;  3S17 B;  2NUC A;  1TWG B;  4POF A;  3S14 H;  1HXY D;  3CKI B;  1LTI D;  4WJ4 A;  2KEC A;  2PCF B;  4A3J H;  2BH8 A;  2QIL A;  5FO8 B;  3PF5 A;  1W2B A;  2F52 A;  5FOB B;  2UXD L;  3HOV H;  1PH7 A;  1PRT F;  1N8R C;  4DR5 L;  2F3V A;  5IT9 E;  4CDE C;  1TWA B;  2A73 B;  3ND8 A;  1ILP A;  3CW2 C;  1X56 A;  1VQG A;  1Z7T A;  1MD2 D;  4RMF A;  3J81 L;  3MAQ A;  2JXM B;  3S1N B;  2BDN A;  1VQC A;  1HZA A;  4A3I H;  1SRU A;  3QB3 A;  1B3Q A;  3TQY A;  1M1K C;  4Q5V A;  4NXN L;  2KQ3 A;  2WKC A;  3GV6 A;  1GXD C;  3BJU A;  5LMN Q;  4R8N A;  1AE2 A;  3MXN A;  1JOR A;  3C2P A;  4EQN A;  3OSO A;  2HDL A;  3BZK A;  2KCM A;  3DEP A;  3I4M G;  3JC6 6;  2K5D A;  1DOK A;  4FXK C;  1N34 Q;  3ERQ A;  1WD1 A;  1KAA A;  4KN7 C;  2ENB A;  4YWL A;  3BDC A;  3GTJ B;  4O2D A;  3TBI B;  3PIP 3;  1SYC A;  1AZP A;  3A7L A;  3U9O A;  2NYZ D;  1JE4 A;  2K7V A;  4RGM A;  3MXU A;  4RGN A;  5FLX E;  1YHQ A;  4LFA L;  4RAU C;  3FHW A;  1ASZ A;  1VQB A;  4JYA Q;  3MC0 B;  4QIW E;  5IP9 G;  4B08 A;  4OGQ C;  2XSC A;  2NVY H;  5A35 A;  3KK7 A;  1QZH A;  4OWW B;  1Q7Y C;  4KD4 A;  4H44 C;  2NWG A;  3Q8D A;  3CF5 A;  3G4S A;  2H5X A;  2YV5 A;  4YCV A;  3AB9 A;  3S9W A;  2JA5 H;  2J7Z A;  2XNA C;  1BXT A;  1U4P A;  3HOX G;  4DNR B;  2I5M X;  2R7F A;  1XNQ L;  3PUX A;  1A62 A;  1SNM A;  2HUG A;  3V96 A;  2PMZ B;  1BO0 A;  4QIW B;  4CBV A;  4CJ1 B;  2LMC B;  4DXG A;  4CGY B;  1E2Z A;  1LYL A;  2C35 B;  1PFS A;  4AIM A;  3EVQ A;  3M3Y H;  1CM9 A;  4FF3 A;  3NXW A;  4CKB A;  4HN7 A;  3FPP A;  1ZKO A;  2FMC A;  5ELN A;  2JA8 H;  2EY6 A;  2MGS A;  5I4D A;  4A3K G;  3C1F A;  5JEA G;  2E74 C;  4MZ9 A;  3K59 A;  2KOL A;  3E5S A;  3AU7 A;  1WTQ A;  2B2U A;  4LF9 Q;  2NZ1 D;  4LAA A;  1H9M A;  1QNU A;  3BS1 A;  4M8A A;  4O42 A;  1NY4 A;  3CD6 A;  2E2J B;  2V4D A;  4LUZ A;  2VNU D;  1ENA A;  2H1E A;  1A3U A;  4H02 A;  5BN4 A;  1ENF A;  1EOV A;  1PFB A;  1F2M A;  4BY1 G;  1JWU D;  2L5T A;  4EGV A;  1W6J A;  4DV0 Q;  1CSQ A;  4JPB W;  2RF4 A;  4Z9C B;  3J7Z C;  3M3Y B;  1JQY D;  4MIU A;  3MWY W;  5L37 A;  1SYD A;  4RHS A;  1RJT A;  2XRS D;  5C4X G;  1PRT D;  1QVF A;  4PG3 A;  4C1N I;  5GAD C;  2O5I C;  1SYF A;  3J81 c;  1K0S A;  5KYL A;  1VQH A;  1BF4 A;  1W3S A;  1I3Q H;  4KMU C;  3QOL A;  2DJF C;  3LWE A;  2EIF A;  5CV5 A;  1J8I A;  4K0K L;  2VUM B;  1I94 Q;  3J80 c;  4JBJ A;  5AFW A;  5FLM G;  4FXG C;  4LW1 A;  4KLK A;  1EZ8 A;  1YJN A;  1HHV A;  5M5X B;  3S2H H;  5J1Z A;  3DM1 A;  2F4I A;  3CCM A;  3VR6 A;  1L1O B;  2HCI A;  3WWV A;  1EY8 A;  4DV2 Q;  3GTQ B;  5LL6 S;  4IUQ A;  2A6H C;  4JBM A;  3WDN A;  3ULP A;  2ATW A;  3HOU G;  1MGS A;  1B2T A;  3PO3 H;  1A6X A;  1Y1W G;  2UU9 L;  1HTL D;  2KJX A;  2KEE A;  2JA5 G;  4L8J A;  2SNM A;  2LS0 1;  4GN3 B;  4C3J G;  1B1Z A;  2IT1 A;  1ESF A;  1NAP A;  1I3Q B;  4X65 Q;  1T9H A;  1AFP A;  3KBG A;  3T4A C;  4L5R C;  4UP8 A;  1H9J A;  1TU2 B;  2AWN A;  2O4X A;  2VUM H;  1WCM G;  5I2X A;  2HCC A;  1KRT A;  2QKI C;  1ZYR C;  3S2H B;  5HUR A;  1E2W A;  4DK0 A;  2G5D A;  3D4W A;  1B44 D;  4TKO B;  1RHP A;  2E75 C;  2B3G A;  2X6G A;  3LX0 A;  2B2Y A;  3PUV A;  1IBK L;  3CC2 A;  2RSN A;  1OXV A;  4DR3 Q;  1V1Q A;  5J39 A;  4GOP B;  2E8G A;  4LF6 Q;  5LMN W;  1WTX A;  3KF8 B;  3T16 A;  1UUP A;  2KHJ A;  4R4C A;  2PYK A;  3QIA A;  4I7A A;  1XMO Q;  3WOF A;  3S1Q B;  1PZK D;  2EPB A;  3KLS A; 
#chains in the Genus database with same CATH homology
 2F0U A;  2K04 A;  5M5Y B;  4F88 A;  4AYB B;  3PUY A;  5A2Q L;  1NCV A;  2FJ2 A;  1ET9 A;  1V1O A;  2PW7 A;  1GUW A;  2K03 A;  4GZY C;  1ENC A;  3HP3 A;  1EY6 A;  5IGG A;  3E0J A;  3J80 E;  3T53 B;  3KLR A;  1RF2 D;  1OXS C;  2A6E C;  2M00 A;  4K2L A;  1STG A;  1L0Y B;  3SK4 A;  1Y8N B;  1K8O A;  2XWJ B;  2KA7 A;  3T56 B;  5I9P A;  3I91 A;  3K6O A;  3QO2 A;  1NUC A;  1QB5 D;  2B2W C;  2D2C C;  4LMQ D;  1FNW A;  4IUV A;  1SNP A;  4L63 B;  3VYS A;  3OWF A;  1VCI A;  1A2T A;  2F0V A;  3SK8 A;  3GD7 A;  1EY0 A;  4WOR A;  3J80 L;  4G7H C;  1T5X D;  3C46 A;  4DN4 M;  4NKL A;  3HOW B;  2L11 A;  1K8M A;  5CV4 A;  2RVL A;  3NQI A;  1CTM A;  1OO9 B;  5IGD A;  2G9H D;  2D62 A;  4XYO A;  3QWN A;  4R8I A;  1SAP A;  3R3O A;  4HSV A;  2FHT A;  3SHL A;  2K5W A;  4HMI A;  3MFY A;  3HOV B;  4ZUJ A;  3J7A V;  4C3I B;  2A69 D;  3NBI A;  3ONA B;  2Y0S B;  1SXT A;  3NBH A;  1SEB D;  4KTA A;  4F87 A;  2B8F A;  2XVS A;  2D9U A;  1GOZ A;  3G7L A;  5I9O A;  2BCO A;  2RDH A;  1HCZ A;  4A3G B;  3T51 B;  4ILW A;  2AQ1 B;  2QCP X;  1B50 A;  1CZG A;  1F9S A;  2AQ2 B;  1D5Z C;  1A15 A;  4IQZ A;  1C48 A;  5F2D A;  3TME A;  1AZQ A;  2JYO A;  3G6J B;  2QDB A;  1LTG D;  1TS4 A;  4JBW A;  4E6I A;  4DAV A;  2X69 A;  1U4L A;  1LTA D;  3N6R A;  1AW7 A;  1BQQ T;  3DEO A;  4FYD A;  2B63 B;  3P7J A;  5CBE E;  1TVX A;  4KY5 A;  1A3T A;  3KLS X;  1DOM A;  1PXU A;  5C0X H;  2WV6 D;  2WAC A;  4K5W A;  2RQX A;  5IGC A;  1B3A A;  2R92 B;  2EYO A;  1FYC A;  1ET6 A;  1F9R A;  2EY1 A;  2F0T A;  2KVM A;  3MHB A;  2TMP A;  2K01 A;  3NTI A;  3PV0 A;  1XYI A;  3LWU A;  1QG7 A;  4C3J B;  1XWE A;  2SDF A;  1EEI D;  1Z47 A;  4C3I G;  1WCM B;  2MPM A;  4G4K A;  1EYD A;  4PV1 C;  2RSO A;  1EL0 A;  5E4W C;  5JVG 3;  5KND A;  4U68 A;  3V05 A;  3I4M B;  1W6K A;  1SE2 A;  5CV7 A;  3TZD A;  1ICW A;  3KUP A;  1KDB A;  3URY A;  4OO1 I;  4ME5 A;  2B2T C;  3AMU A;  1GUO A;  3A54 A;  1CQF A;  2K1B A;  4A3M B;  3NUC A;  3K5M A;  1H9K A;  2ZXO A;  1O78 A;  1CT1 D;  4K5X A;  5M5W B;  2XN9 C;  1I4X A;  1TT2 A;  3FVQ A;  5KIX A;  3NWT A;  1BCP F;  4MHE A;  2R93 B;  1I4P A;  4WJW A;  3W3A A;  2B2W A;  2Z4H A;  3LNN A;  2IX3 A;  2F0O A;  1R4P B;  1Q90 A;  2K05 A;  1PFM A;  1B4O A;  2B8G A;  4A3F B;  4LJZ C;  5C4X B;  1H9R A;  3A8J E;  4O1N A;  4RCO A;  2QEJ C;  1UNS A;  3K58 A;  1KLU D;  4RKB A;  5CV8 A;  1Y1V B;  1ML0 D;  3K57 A;  2BOS A;  2CVR A;  2NN6 H;  3BVZ A;  3A55 A;  4CKE A;  1G2T A;  2BDO A;  2OT2 A;  3BYY B;  3QJY A;  4BY1 B;  5EJW A;  2IW3 A;  4UDU C;  3SXH A;  1M8A A;  3FRP B;  1IW7 D;  4XDX A;  1SNO A;  1X3P A;  4IFD I;  5DAU A;  3HKZ B;  1C4Q A;  1DXM A;  1IKM A;  4RH6 A;  3HOX B;  3GQB A;  3PO3 B;  1LTS D;  4DA2 A;  4KY6 A;  4BS9 A;  2R7Z B;  1EY4 A;  2AUJ D;  3HS0 C;  3HRZ C;  2A74 C;  3D3R A;  1EFI D;  1DJR D;  4RGT A;  2DY7 A;  4ID6 A;  1TKW B;  1TQO A;  2L0C A;  3HG9 A;  1Y8P B;  2F0K A;  5JEA H;  2F0S A;  4KD3 A;  1UEA B;  2DY8 A;  2EYF A;  2I46 A;  1LV9 A;  5J22 A;  4UAI A;  2B39 A;  2IWH A;  4J8Q A;  1CK1 A;  5EGT A;  4IFD G;  1JCK B;  3VA7 A;  1G8Z D;  2XIW A;  1EOT A;  1HFG A;  2EYJ A;  4XQN A;  2VB2 X;  1V1P A;  2HQE A;  2EDG A;  1I50 B;  3Q22 A;  1HFN A;  2MJ8 A;  2B2V A;  1JOK A;  5C0X G;  1QNK A;  2JSO A;  2JP1 A;  3V2T A;  2A68 D;  1Q8I A;  4HED A;  3S14 B;  3OMC A;  2F0L A;  1PTO C;  1VMP A;  4NDX A;  1BUV T;  3TP8 A;  2EE1 A;  3C1E A;  5CBA E;  1ZYR D;  1IL8 A;  2XRQ D;  3NP8 A;  2RDF A;  5EPJ A;  5CV9 A;  4ABN A;  4ZAI A;  1NSN S;  4KHV A;  2Z4I A;  3E6Z X;  3FMC A;  1DM0 B;  2PNR C;  2B2V C;  4I65 A;  1JIC A;  5JAV A;  2C5C A;  1PTO H;  1SDF A;  2J4X A;  1YNN C;  4HCE A;  3CRK C;  1O7Y A;  3L7Z C;  4KK7 A;  2DN8 A;  3CRL C;  5EKL A;  1XXG A;  1OXT A;  2EOT A;  3VA5 A;  1CZW A;  1D1K A;  1F77 A;  3RUZ A;  1TWH B;  5JVH 3;  3NTH A;  2SOB A;  4MN3 A;  3GV3 A;  1LAC A;  2MHV A;  4ZRZ A;  3I4N B;  5ELB A;  4R9W A;  5ELC A;  1VDZ A;  1PTO B;  4K2K A;  4EQO A;  3NHH A;  1O7L A;  5M3M B;  1BBX C;  2KHS A;  1M4V A;  4H13 C;  5IOD A;  2F03 A;  1S5E D;  3SK6 A;  1HTP A;  1OXX K;  1S5C D;  1KAB A;  1HUM A;  1PZI D;  5IGB A;  4FNF A;  3A7A B;  4A3B B;  2LFN A;  5ELF A;  1SSO A;  1GHJ A;  4X3T A;  2MP1 A;  3S15 B;  1PZJ D;  1LT4 D;  4X3S A;  1X3Q A;  3SR1 A;  1VMC A;  4HSP A;  3M4O B;  3VR5 A;  1SMY C;  1SJH D;  4LK1 C;  5DEH A;  3PUZ A;  4N9T A;  4ZKC B;  4DXF A;  4OIJ A;  1IHZ A;  3VR3 A;  2EVB A;  5IIF A;  5C5L A;  1MBY A;  4KHZ A;  4PNY A;  1JOQ A;  2KCC A;  4HR7 B;  1QIL A;  5D14 A;  3ITP A;  4HMJ A;  5D3I B;  2NVX B;  2JEB I;  2PZW A;  4IUR A;  5EKI A;  4XIG S;  3N52 A;  4FF4 A;  5IGF A;  2VB3 X;  3SVM A;  3BG3 A;  4DGZ A;  2NBF A;  5D65 A;  2IX0 A;  2B2U C;  1JOO A;  1SNQ A;  1GUT A;  1UAP A;  5FKA C;  2F0G A;  5COR A;  5C6A A;  1AP0 A;  1PFN A;  2L4N A;  1GUN A;  2F0H A;  3R2T A;  4BBS B;  3HEJ A;  1QJO A;  1G6Z A;  1LLR D;  2ID0 A;  2EYH A;  1JWM D;  5G3L F;  1BR9 A;  1GHK A;  2BA0 A;  2F0M A;  1AEX A;  1SE4 A;  1EIG A;  4Y7N B;  1STB A;  1RDP D;  1XTC D;  5KGU A;  1WTR A;  1YNJ D;  3BYT B;  1WTV A;  1FGB D;  3I70 A;  5I2Y A;  1BCP D;  3MTS A;  1JB3 A;  5HGT A;  2RA4 A;  4N9P A;  5FK9 C;  3VR2 A;  1II3 A;  3W2D A;  1Q1B A;  3Q6S A;  1ESR A;  3SK5 A;  5TSS A;  1FNV A;  1HPC A;  3EJI A;  5C5M A;  1GJX A;  3HOZ B;  3GO5 A;  2ZXR A;  2XWB B;  4A3K B;  3K5L A;  3SE0 A;  4CKC A;  2EJG C;  1ROD A;  4PQX A;  1SND A;  2FIN B;  5ELE A;  3P75 A;  1EEF D;  5JPM C;  1HQR D;  2CW0 D;  3FKI B;  1D5X C;  1I6V C;  3DXJ C;  5E1F A;  2IX1 A;  4KJO A;  1H9S A;  2M9V A;  1B53 A;  1LT6 D;  1DZ1 A;  2K28 A;  4DK1 A;  3GTO B;  1F2L A;  1R4Q B;  3H94 A;  1SYB A;  3HGB A;  3D6W A;  4EVO A;  1PTO D;  2F0J A;  3D6C A;  1S5B D;  4QF4 A;  3QG1 A;  3OIQ A;  1TS2 A;  1U4R A;  4B9X A;  1PLF A;  5FO9 B;  2G9D A;  2NB0 A;  5EKK A;  1Q3L A;  1EY5 A;  5EBD A;  4WFN 3;  4IFD H;  1WTP A;  3HOY B;  4A3D B;  3TN2 A;  2A5H A;  2ZXP A;  3D31 A;  3M7N A;  3A56 A;  1CQV A;  1Q1E A;  3SEB A;  2B2Y C;  3I90 A;  2TSS A;  2KED A;  1BNZ A;  4C3H G;  3D8G A;  3K7A B;  3P1H A;  3RZO B;  1SFO B;  2A6E D;  4RA8 A;  3FEW X;  4CJ2 C;  4KKT A;  3TSS A;  2F3W A;  1KDC A;  1TS3 A;  3PMF A;  2F0N A;  4XTC S;  5C3E B;  1C8C A;  4WRD A;  1S5D D;  2RBM A;  1DD2 A;  5M3F B;  2JEA I;  1BCP B;  2B2T A;  1SJE D;  4TSS A;  1PRT B;  2F0I A;  3MFG A;  1V1P B;  1Y8O B;  3DWA A;  3NPP A;  1WD0 A;  1F2Z A;  1D2B A;  2L12 A;  4A93 B;  3X3N A;  3NWS A;  1BOS A;  3S1M B;  2J0T D;  3IAY A;  3MEH A;  1G29 1;  1WTW A;  2BE5 C;  3VYU A;  2PZT A;  4J1M A;  3EQL C;  3OMG A;  1EIH A;  1HA5 A;  2L55 A;  2NVT B;  1SBB B;  4FF2 A;  3GP7 A;  2RKS A;  5DM6 3;  1NR2 A;  3BDO A;  2SNS A;  2IJ0 A;  4DF7 A;  2E2H B;  1O80 A;  4L6T B;  1A3V A;  4C3H B;  3I4L A;  2HDM A;  3A8I E;  4BBR B;  3O13 A;  2MUY A;  4BA2 I;  1WTO A;  2K5Q A;  4FP5 D;  3I73 A;  4U67 3;  2WIN B;  2F0E A;  2I07 B;  1EWH A;  4A3J B;  2NTT A;  4PMW A;  4RHR A;  4K5V A;  3I3C A;  3P20 A;  5KNC A;  4K14 A;  1SYG A;  1V8Q A;  2WP8 J;  1I4Q A;  1CI3 M;  3ERO A;  1HRJ A;  3TP6 A;  2CHB D;  1Y69 U;  1F9P A;  1VF7 A;  1IKL A;  3C3L A;  2EYM A;  4F7X A;  5G3L D;  4A3I B;  2LKV A;  5LHY 1;  5COY A;  2N88 A;  4RGO S;  3U9S A;  3D4R A;  2F1M A;  3BDL A;  2E76 C;  5EQ0 A;  4NP5 A;  2JE6 I;  1EY9 A;  2E2D C;  2NN6 G;  4HTH A;  2PW5 A;  4Q0F A;  4H7B A;  2PZU A;  3GTM B;  4ZK9 B;  4QMG A;  1KLG D;  2EYP A;  4X3U A;  2Z8L A;  3IL8 A;  4FF1 A;  5D3D A;  2NVY B;  1PYW D;  1EZ6 A;  4BA1 I;  1D1I A;  1YNJ C;  1JR0 D;  4EQP A;  5C4Z A;  1I4G A;  4ULL A;  3GTP B;  4V0B A;  2AUK A;  2OEO A;  2A69 C;  1KDA A;  1RTN A;  3M7G A;  1AN8 A;  3M85 A;  3TP7 A;  2F0F A;  4KI0 A;  1STH A;  2OF1 A;  3PUW A;  3EFX D;  4G57 A;  2O5J C;  2OXP A;  2A6H D;  3IFT A;  2IPK D;  1LO5 D;  3RMH A;  2H4O A;  4OO1 H;  5DM7 3;  2A68 C;  2C9O A;  4J6H A;  1NR4 A;  3J7Y W;  5K36 H;  1LAB A;  5IT9 L;  4C1N K;  1Q12 A;  5C4J B;  1QOH A;  4RFB A;  3SDZ A;  5EPL A;  3UI2 A;  1LTT D;  4JK1 C;  4IUT A;  1QE6 A;  3DWQ A;  3NK9 A;  3VYT A;  2CW0 C;  1KTK A;  1B9N A;  3WOE A;  1S5F D;  4XT3 B;  1EYC A;  2GA4 B;  1IYV A;  1YNN D;  1E2V A;  4RWS C;  1LT5 D;  5JEA J;  4NMZ A;  3BZD B;  1GUS A;  3PIO 3;  1CA5 A;  2E2I B;  2R61 A;  1Z6H A;  4RKL A;  3DUZ A;  4FXD A;  3Q23 A;  1ONL A;  1MSG A;  1PRT C;  1JWS D;  4B9W A;  3NTK A;  5KYI A;  2YU9 B;  1DYQ A;  5DNF A;  3X3M A;  1VF5 C;  3GTK B;  4CJ0 B;  5BN5 A;  3RD4 A;  3MXP A;  3CQZ B;  2D5D A;  2BE5 D;  5FLX L;  1I6H B;  3D4D A;  3H91 A;  5C44 B;  1HQM C;  1V43 A;  4A3E B;  4OIK A;  2R6G A;  4P2C B;  1JC7 A;  5C0X I;  1WVL A;  2K33 A;  4IUN A;  3BVM A;  4KKS A;  3F2U A;  1F9Q A;  5BN3 A;  2PPB C;  2ICE C;  3Q0A A;  3JAM E;  1FD7 D;  2ZT9 C;  1STA A;  3H6M A;  3FPU B;  4X3K A;  1DCZ A;  4OL7 A;  3HZX A;  5C3X A;  2PQE A;  1DOL A;  4H0L C;  4HCS A;  4ZLT F;  1X32 A;  2EYL A;  2F0P A;  3K0Y A;  2F0D A;  4KY7 A;  5FO7 B;  1EWC A;  4ZYS A;  1PDQ A;  3PO2 B;  4PMB A;  2VXW A;  5JJZ A;  1KNE A;  4TQU S;  2NVQ B;  4BWG B;  1R9T B;  1TII D;  4CHT B;  3DMU A;  2K6A A;  1J9O A;  4S3S A;  3NE5 B;  3H0G B;  2LY7 A;  3OWE B;  3TP5 A;  1I4H A;  5ISR A;  2L9H A;  4ZQ3 A;  2WKD A;  4QCL A;  4M1U B;  5I6W A;  1PMR A;  2FMM A;  2Q8R E;  1ZXT A;  4K6L A;  1RCV D;  3KF8 A;  2RDG A;  5CMD A;  3R2I A;  2EJM A;  3S16 B;  5CC4 A;  5C0X J;  3RLF A;  1SYE A;  3ND9 A;  1ILQ A;  3MVV A;  4ZKB B;  4QUC A;  2NN6 I;  5M9O A;  2R3Z A;  5K5P A;  1SNC A;  4ZUI A;  3IKJ A;  5C4H A;  3NSW A;  5KRU A;  3QOJ A;  1G91 A;  3S2D B;  4KN4 C;  1EYA A;  1DON A;  4IAL A;  4XXE A;  1U4M A;  2Q8T A;  3EA6 A;  5E4X A;  4V19 0;  2WAQ B;  4ODG A;  5T1G A;  1EU4 A;  1TY2 A;  4DU9 A;  1TY0 A;  2M2L A;  3L3O C;  4DAP A;  3GTG B;  1EQT A;  3R8B A;  3VYR A;  4OO1 G;  1RKN A;  5T1I A;  1PTO F;  1A2U A;  1CHQ D;  1MSH A;  2F0W A;  5LL6 X;  4K6D A;  2FFK B;  3TDQ A;  4YIJ A;  1STY A;  2SEB D;  3CHB D;  1EU3 A;  3GTL B;  3J81 E;  3VR4 A;  2EY2 A;  5A2Q E;  2DNE A;  2WII B;  1U9R A;  2JA5 B;  1IW7 C;  1LTB D;  5IGE A;  2DNC A;  2IL8 A;  2YYZ A;  2Q8I B;  3OIP A;  1TS5 A;  4BY7 B;  2JA8 B;  3S1R B;  3NQT A;  3Q24 A;  2EZV A;  1LTR D;  1E0B A;  4G7O C;  1I4R A;  3ZYY X;  4KV6 A;  3CU7 A;  5E3F A;  5I6Y A;  4NW2 A;  3JAM L;  2PO4 A;  2CQA A;  5CV6 A;  5CGK A;  3IFD A;  2AQ3 B;  1TWC B;  4XQQ A;  1D5M C;  2EJF C;  5KNB A;  3MXG A;  2EXZ A;  1SE3 A;  1BDO A;  3OOC A;  4IZ8 A;  3KBX A;  4C56 C;  2EY5 A;  5NUC A;  3A8K E;  1S4Z A;  4QUF A;  4K8J A;  3M4Y A;  5CR3 A;  1RTO A;  1EY7 A;  3I72 A;  1FR3 A;  1TWF B;  1D6E C;  2KUM A;  1BCP C;  3DHQ A;  1KNA A;  2NTS A;  4K8I A;  1STE A;  1L0X B;  4DFA A;  1QWY A;  4XQJ A;  2KCN A;  1Y1W B;  4DAY A;  4IUU A;  1EQV A;  3TZU A;  4XYQ A;  1H9S B;  3MZ5 A;  5IOC A;  4FO2 A;  1O7Z A;  3MA2 B;  2ICI A;  3OPO A;  3RZD B;  3OW7 A;  1CA6 A;  2X6L A;  4KKU A;  2JA6 B;  4TRD A;  5EPK A;  1OXU A;  1IYU A;  1MI2 A;  2N55 A;  3K5N A;  1FNU A;  2L1B A;  3DWP A;  4IN3 A;  4HAE A;  4G7Z C;  3R93 A;  3HOU B;  1STN A;  2BA1 A;  2Z1C A;  1XX8 A;  2AWO A;  4FVM A;  5CYU A;  2K32 A;  5ELD A;  4KJN A;  1LT3 D;  4QB4 A;  1CHP D;  1HUN A;  3H09 A;  5KEE A;  3FDT A;  5EBC A;  5C3W A;  4IFD J;  3K5O A;  1HA6 A;  4XT1 B;  1T5E A;  1CFM A;  4RCN A;  2O2L D;  5JOB A;  4IUP A;  1QCB D;  1ZEQ X;  3H3V C;  1G2S A;  2F0Q A;  2QF7 A;  4F8M A;  5K36 G;  5JPN C;  1B9M A;  4C2M B;  4OHJ A;  2JA7 B;  3L9A X;  4I7Z C;  1GUG A;  3T13 A;  3I8Z A;  1RD9 D;  1K83 B;  1TR5 A;  4DNT B;  2WB1 B;  3J7A F;  1F2Y A;  3BVG A;  3OHX C;  1SMY D;  4PMC A;  3S17 B;  2NUC A;  1TWG B;  1HXY D;  3CKI B;  1LTI D;  2KEC A;  2PCF B;  2QIL A;  5FO8 B;  5FOB B;  1PRT F;  2F3V A;  5IT9 E;  1TWA B;  2A73 B;  3ND8 A;  1ILP A;  1Z7T A;  1MD2 D;  3J81 L;  3MAQ A;  2JXM B;  3S1N B;  2BDN A;  3QB3 A;  4Q5V A;  2KQ3 A;  2WKC A;  3GV6 A;  1GXD C;  4R8N A;  3MXN A;  1JOR A;  3C2P A;  4EQN A;  3OSO A;  2HDL A;  3DEP A;  2K5D A;  1DOK A;  4FXK C;  3ERQ A;  1WD1 A;  1KAA A;  4KN7 C;  2ENB A;  3BDC A;  3GTJ B;  3TBI B;  3PIP 3;  1SYC A;  1AZP A;  3A7L A;  3U9O A;  2NYZ D;  5FLX E;  1JE4 A;  2K7V A;  3MXU A;  4RGN A;  4RGM A;  4RAU C;  3MC0 B;  4B08 A;  4OGQ C;  2XSC A;  5A35 A;  3KK7 A;  4H44 C;  4KD4 A;  2NWG A;  3AB9 A;  3S9W A;  2J7Z A;  2XNA C;  1U4P A;  1BXT A;  4DNR B;  3PUX A;  3V96 A;  1SNM A;  2HUG A;  2PMZ B;  1BO0 A;  4QIW B;  4CBV A;  4CJ1 B;  2LMC B;  4DXG A;  4CGY B;  1E2Z A;  3EVQ A;  1CM9 A;  4FF3 A;  3NXW A;  4CKB A;  4HN7 A;  3FPP A;  1ZKO A;  2FMC A;  2EY6 A;  2MGS A;  5I4D A;  3C1F A;  5JEA G;  2E74 C;  3K59 A;  2KOL A;  3E5S A;  3AU7 A;  1WTQ A;  2B2U A;  2NZ1 D;  4LAA A;  1H9M A;  1QNU A;  3BS1 A;  4M8A A;  4O42 A;  2E2J B;  2V4D A;  2VNU D;  1ENA A;  2H1E A;  1A3U A;  5BN4 A;  1ENF A;  1PFB A;  1F2M A;  1JWU D;  2L5T A;  4EGV A;  1W6J A;  4Z9C B;  3M3Y B;  1JQY D;  4MIU A;  3MWY W;  1SYD A;  4RHS A;  1RJT A;  2XRS D;  1PRT D;  4C1N I;  2O5I C;  1SYF A;  5KYL A;  1BF4 A;  4KMU C;  3QOL A;  3LWE A;  5CV5 A;  1J8I A;  2VUM B;  5AFW A;  4FXG C;  1EZ8 A;  1HHV A;  5M5X B;  5J1Z A;  3DM1 A;  2F4I A;  3VR6 A;  2HCI A;  1EY8 A;  3GTQ B;  5LL6 S;  4IUQ A;  2A6H C;  3WDN A;  1MGS A;  1B2T A;  1A6X A;  1HTL D;  2KJX A;  2KEE A;  4L8J A;  2SNM A;  2LS0 1;  4C3J G;  1B1Z A;  2IT1 A;  1ESF A;  1NAP A;  1I3Q B;  1AFP A;  3KBG A;  3T4A C;  1H9J A;  1TU2 B;  2AWN A;  2O4X A;  5I2X A;  2HCC A;  2QKI C;  1ZYR C;  3S2H B;  5HUR A;  1E2W A;  4DK0 A;  3D4W A;  1B44 D;  4TKO B;  1RHP A;  2E75 C;  2X6G A;  2B2Y A;  3LX0 A;  3PUV A;  2RSN A;  1OXV A;  5J39 A;  1WTX A;  3T16 A;  1UUP A;  2PYK A;  3QIA A;  3WOF A;  3S1Q B;  1PZK D;  2EPB A;  3KLS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...