1B3AA

Total chemical synthesis and high-resolution crystal structure of the potent anti-hiv protein aop-rantes
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
67
structure length
67
Chain Sequence
PYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Anti-hiv protein
molecule keywords PROTEIN (RANTES)
publication title Total chemical synthesis and high-resolution crystal structure of the potent anti-HIV protein AOP-RANTES.
pubmed doi rcsb
total genus 14
structure length 67
sequence length 67
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1b3aA00
2K28A 1PFBA 2FINB 3KUPA 4ZLTF 1EL0A 4HSVA 2IL8A 3DEPA 1DOKA 2K1BA 2B2WC 5D14A 2Q8TA 1NR4A 1RHPA 2MP1A 4IUUA 1HUNA 5T1IA 4IURA 1B50A 2HCIA 3D6WA 5EQ0A 3HP3A 3QO2A 2JYOA 2MGSA 1VMPA 4X3UA 1IKLA 4XT1B 1RTOA 2RSOA 1WTXA 1KNEA 1XYIA 5AFWA 3I90A 1QG7A 1HUMA 5E4WC 5DNFA 1JE4A 1U4PA 3DM1A 4DN4M 4U68A 1SDFA 3MWYW 1ICWA 1DOMA 5CBEE 2RA4A 1WD1A 4CJ1B 1X3QA 1AZQA 4ZK9B 4HCSA 1A15A 1PFNA 2L1BA 3R93A 1B53A 1J9OA 2L12A 1J8IA 1DONA 4OIJA 1RODA 4IUTA 2KECA 1U4MA 2L11A 5E4XA 1CA6A 4R8IA 1HA6A 1MGSA 2DY8A 3TZDA 2M2LA 1O80A 2DY7A 3G7LA 2N88A 1E0BA 5CBAE 2B2WA 1G91A 5EPKA 4HEDA 2MPMA 4MHEA 1M8AA 2KEDA 1X32A 4CJ0B 2MJ8A 3KBXA 1G2TA 2B2YA 1ILQA 2RSNA 4IUQA 3I91A 5D65A 1B2TA 1GUWA 1MI2A 1RJTA 2XIWA 1ML0D 1PFMA 2K04A 3H91A 2EPBA 1EIGA 2Q8RE 1WTQA 2RVLA 1Q3LA 5EPJA 3FPUB 4X3SA 3ONAB 2K03A 2X6GA 4LMQD 1HFNA 1NCVA 2L4NA 4QUCA 3GV3A 3I8ZA 1XX8A 1QNKA 2B2VC 1B3AA 1F9QA 1G2SA 2VXWA 4R9WA 2D9UA 4O42A 2X69A 1PLFA 1X3PA 5CORA 1S4ZA 3MTSA 1WVLA 1BO0A 4XDXA 1EQTA 3Q6SA 4XT3B 1NAPA 3I3CA 1WTRA 3DEOA 1DZ1A 2KVMA 3UI2A 4ZKCB 1JICA 4OIKA 2CVRA 2HCCA 2NWGA 1DOLA 2HDLA 3F2UA 1F9PA 4IUPA 3TN2A 2SDFA 4ZKBB 5T1GA 1WD0A 1TVXA 2FJ2A 2NYZD 3FDTA 1ESRA 1MSHA 5CMDA 3SVMA 1HHVA 1HRJA 1O7ZA 1WTOA 5EKIA 1BNZA 2R3ZA 4NW2A 4MN3A 1EIHA 2FFKB 2B2TC 1EOTA 2EE1A 2H1EA 2J7ZA 4ZAIA 2NZ1D 1WTPA 2B2VA 1B4OA 2FMMA 4CJ2C 3LWEA 3IFDA 5JJZA 1C8CA 5COYA 1IKMA 5EPLA 1WTVA 2B2UC 5EJWA 1BBXC 1F9SA 4HAEA 3GV6A 2X6LA 1CM9A 2K05A 2KUMA 2EOTA 2N55A 2B2YC 2FHTA 4X3TA 1RTNA 2JP1A 2K01A 1AP0A 1U4LA 1O7YA 3IL8A 1BF4A 3P7JA 4RWSC 2KEEA 1QE6A 1F2LA 1CA5A 1PDQA 1SSOA 4X3KA 2HUGA 4RA8A 2L9HA 1ILPA 3N52A 1WTWA 2B2TA 4IUVA 1NR2A 1G6ZA 4UAIA 1MSGA 1U4RA 1VMCA 1HFGA 4RAUC 2BDNA 1SAPA 2HDMA 1IL8A 1LV9A 2KOLA 1ZXTA 1KNAA 1F9RA 1AZPA 4QUFA 2B2UA
chains in the Genus database with same CATH superfamily
2UUBL 1EL0A 3KUPA 2VL6A 2IHFA 1RHPA 4B3ML 4GNXA 1NTGA 2H4OA 1GUWA 2JYOA 4IPGA 4X3UA 3VYRA 4K5WA 1EIFA 1JC7A 3H3VH 3NQIA 1VQ5A 1Y1VB 3D3RA 4A3GG 4IALA 3TP6A 4K5XA 2F0MA 3I56A 1YVCA 3GTPB 2ZTEA 1J8IA 4F7XA 1DONA 1HTLD 1PA6A 4A3FH 2PQAB 4JI5Q 4JVZA 5C4JH 1HR0Q 2QA4A 1O80A 3BZKA 1VQEA 5FLXE 5EPKA 4KN7C 3EN2A 4HMIA 4DAPA 3A5ZB 4BBRG 1PTOB 2B63G 3SGIA 1PHJA 3ND9A 1GO3E 4K6DA 1HQMC 1IW7C 1Z7TA 2K04A 4JPBW 4KHPL 1TWAH 3X3MA 3CW2C 3H3VC 4JYAL 2E2IB 3VDYA 2F0FA 2C9OA 4QUCA 3GV3A 1EU4A 5JEAG 2JA5G 1L0XB 3S1QB 2K5NA 4A3MB 4Q0FA 1P16A 2PPBC 4XT3B 4DNRB 2UUBQ 2BA1A 3O13A 4KJOA 5C4XB 3F2UA 3WOEA 4B3MQ 2LY7A 4R4CA 1EWCA 2ZTCA 3VA5A 2EE1A 1P8LA 4QJFA 4Y7NH 1PXUA 1CK1A 2B2VA 2KA7A 1CKNA 1KL9A 3U58A 5JJZA 1LTSD 3OW2A 3I4MB 5LL6X 1M90C 1QJOA 4JOIC 2F0TA 1AE2A 4RCOA 4DV0L 2N55A 1N8RC 1E2WA 3E6ZX 1U4LA 3CXCA 2F52A 1BF4A 4APVA 3UDGA 2D2CC 2K32A 4X66L 1KXLA 1OXVA 3T51B 1OXUA 2DNCA 3CRKC 4JYAQ 3CMAA 2VUMG 4KY6A 5M5WB 1IL8A 1GUTA 1KDAA 1WCMG 1ASYA 4RCNA 2K28A 2IL8A 1LLRD 4FP5D 1STEA 4DV7L 4LWCA 1BCPF 4L5TA 1D1KA 1CSPA 4DR3L 4I7ZC 1D7QA 3BVZA 1SNPA 3HP3A 3J7AF 4OO1I 4A3IG 1TS3A 2WAQB 2ZXOA 4LF8L 3UDFA 5C0XG 1TR5A 2EYFA 4DUZL 4NB3A 5JJLA 3U50C 1SJED 5CV4A 4O0AA 4JI0L 1B53A 1B70B 5E4XA 4A93G 2I5HA 1L1OA 1SYCA 1X3GA 3TMEA 4EGVA 3K57A 3K7AB 2N88A 3UE1A 3W1BA 4N9TA 1EEID 4DV0Q 1MKHA 1A0IA 3HKSA 1Q86C 3FP9A 4BY7B 1IYVA 4AIMA 4QL5A 5EPJA 3MA2B 3HKZB 4X66Q 1B8AA 1NNXA 2X6GA 5C4ZA 1HZCA 1FR3A 2A6ED 3S1RB 3OOCA 1G2SA 2NBFA 3JAME 2EYHA 4JW0A 4IN3A 1O7IA 1I4PA 4JBMA 4GLXA 3MVVA 4KKUA 5K36H 2NN6H 3TS2A 2PZWA 4OIKA 4DV7Q 2IT1A 3OIPA 2VB3X 4DR3Q 3J81E 2G5DA 3GTLH 3BYYB 2QILA 4LF8Q 2H5XA 2EY1A 2KBNA 5IY0A 4C3IB 1PZKD 3F2CA 1VQDA 2E2JB 4DUZQ 2H1EA 3SK8A 3J80i 3KF6B 2AQ1B 4JI0Q 2CKZB 3MEHA 3P20A 2JEAI 4DR7L 1QVCA 1Q8KA 1IXRA 1JB3A 1LYLA 1SNMA 4L5QA 2JA6G 3GV6A 1SNQA 2FHTA 3CCRA 3L0OA 1Y1VH 3A8IE 3MXPA 3NQTA 4IFDG 4UPAA 2I5MX 1WJJA 1CA5A 2RF4A 1S5ED 1STNA 3TZUA 1GJXA 4J6HA 3PUWA 3E0EA 5ELNA 1RF2D 1LV9A 3I7FA 1AZPA 1XPOA 4HSVA 1K3BC 3E3XA 1HUNA 1ASZA 5CC4A 5IGFA 2R7ZG 1YNXA 3S1MB 3MXNA 5E3FA 4DR2L 3QOJA 1N33L 1HNZL 1HUMA 3M3YB 2J4XA 3FMCA 4U68A 1SDFA 1D5ZC 2XNAC 1WD1A 1U0LA 5L37A 3TSSA 1I4GA 1X9NA 2AKWB 5CR3A 1VQ7A 3S1QH 4A3MH 3DMUA 1RODA 1JE5A 2KECA 5I2XA 3V96A 3S1NH 2UUCL 3RZDB 3SHLA 2D62A 1K8OA 4DR7Q 3VR5A 3TP5A 1VQ4A 4J8QA 4B3TQ 1UEAB 3PUYA 5C3EH 3K0YA 2EYOA 1A6XA 1K83B 3PUZA 1RJTA 2XIWA 4XXEA 2B39A 2EPBA 3NBIA 3I73A 3J81j 2RVLA 5LMUL 4JC0A 3CCJA 4C3HB 2PW7A 4Q5VA 3M85A 1H9SB 1PLFA 2IJ0A 5A2QE 1BO0A 1SE3A 4XDXA 3I4NH 4FYDA 3PO2B 3FHWA 4PZ7A 3I3CA 4NDXA 2KVMA 1E22A 2QDLA 4IUPA 5LHY1 1S5BD 3TP8A 1KHIA 3G4SA 2JK8A 3K0XA 2DJGC 1AH9A 2R93G 2BE5D 1YZ6A 2RBMA 3FDTA 4DR2Q 3A56A 3HOWB 1VQ6A 4OX9L 1HNZQ 1EZ8A 1SLJA 4Z9CB 4BXXH 1TWHH 2N3SA 2R6GA 4BBSB 3ITPA 3D4WA 4CJ2C 2ENBA 2HIVA 2B8FA 3NHHA 1WOCA 3KDFA 3BS1A 3S16B 1DCZA 2RKSA 2UUCQ 5IP7G 1JOQA 1QOHA 4OL7A 5I9PA 3OIQA 3Q22A 2KUMA 3M4QA 3TQYA 2WIIB 2CW0D 5ELBA 2YTVA 2XVSA 5IODA 2K50A 4HTHA 4YIJA 2ZXRA 3BDOA 2N78A 1R4QB 1D5MC 2JXMB 3E0JA 4IUVA 3GTMH 1E1TA 1VCIA 1B9NA 4BA1I 2EZVA 1HFGA 3BG3A 1PTOF 3K58A 5CV7A 1GUOA 2WAQE 3HOVG 2AWNA 2L5TA 4HJ5A 1PRTB 3A55A 5IT9L 2JA7H 3HOUH 3N6RA 2A74C 1NY4A 1SMYC 3J7ZC 2F0EA 2PI2E 2R92G 1I3QB 2EDGA 4OX9Q 2CHBD 3KF8A 1NMGA 3S1RH 1JMCA 4KV6A 5JVG3 1AZQA 4BY1H 1CHQD 2EY5A 1LO5D 2EYPA 4LF9L 4DV5L 1UUPA 4EVOA 3PIP3 3HKZE 4MHEA 1JOOA 4DXFA 4CDCC 2MJ8A 1Y14B 1FYCA 1Q8IA 3V2TA 1D8LA 2F0SA 1XTDA 1HCZA 2RCFA 3H3VI 3NSWA 4DF7A 3AFQA 3EVQA 1X65A 5CV8A 1B3AA 1UNSA 2JA8G 3T1YQ 1V9PA 1YIJA 4JI2L 2XTIA 2K5HA 1V43A 1HTPA 3M7NA 2NVXB 2CVRA 2Y0SB 4KKSA 5T1GA 3GTJH 4JI6L 2V4DA 4A3CG 2KCMA 2EQSA 4CKCA 4KK7A 3AYHB 2ZJRA 2R3ZA 5IYBH 1TIID 5GAHC 2B2TC 2ATWA 2R7FA 4A3KG 5M3FH 4DK6C 1C8CA 2B2UC 4PZ8A 1QCBD 4LF9Q 4DV5Q 3MFGA 4A3FB 5EAYA 5C4JB 1A2UA 3A5UA 2K01A 2D0PA 3S15H 4FF3A 5C4XG 2JJQA 5C5LA 4CKEA 4XYOA 5IGBA 1TWAB 4DXGA 1G6ZA 2CQOA 3WDNA 2AQ3B 4RAUC 3RZDH 1SAPA 1I4XA 4JI4L 4A3GH 4H0LC 3F8TA 4AYBG 3Q8DA 5IIFA 2RQXA 1DOKA 2F3IA 1FGUA 2K1BA 4JI2Q 5CV6A 3I4MG 2Q8TA 1SE2A 1E7ZA 3A8KE 4IUUA 2PZTA 2Z8LA 4KY5A 3D6WA 4QCLA 1AEXA 5JPNC 1D2BA 4UDUC 4XTCS 4JI6Q 1DGSA 1RTOA 1SXTA 5D3DA 2ASBA 1B44D 3ER0A 3ULLA 5CBEE 1STGA 4YHHL 1HJPA 4CDDC 3CU7A 2VY3A 3NP8A 1RD9D 1KRSA 1PH1A 1PFNA 2L1BA 4CDEC 2L12A 4BBRH 3F2BA 4MTKA 3JAMc 4Y7NB 1V1PB 3S17H 5FLMG 1HNWL 3GDEA 3J80E 1OTCA 3UE0A 2JE6I 4HEDA 2MPMA 2E74C 4LAAA 1SYBA 3E5SA 1YJWA 4IUQA 2JA5H 1H9MA 1EIGA 5M3MG 3FKIG 3T4AC 3HOZB 2F0QA 4BBSH 3AFPA 1NCVA 1V8QA 3D4RA 2XSCA 3QB3A 1LT3D 5FO7B 2VXWA 5GADC 2NVTH 2DJFC 5CORA 3MTSA 4JI4Q 1S5CD 1Z9FA 4POGA 2K5DA 1HPCA 2Z6KA 4GKJL 4ZKCB 1PH5A 3TN2A 1TVXA 1EY5A 4U673 2NUCA 2GVBA 1GUGA 1I4QA 4JG2A 1L0YB 4PQXA 2PMZB 2KJXA 4DNIA 4B3RL 1KRTA 1Y8PB 1J5EL 2F0KA 1FNVA 1WTPA 2NZ1D 4FNFA 4A3JG 2FMMA 4HIKA 5J3BA 2IHEA 1HNWQ 4IPHA 4DV1L 3DWQA 1CM9A 2KHSA 1D6EC 1JR0D 4A3BG 5IYDG 4JCVE 4DR1L 1TU2B 5BN4A 1I4RA 1K8GA 2VUMH 2NN6I 1XPRA 3P7JA 4C1NK 2VS1A 4KMUC 1RL2A 1QE6A 2Q2IA 1VS0A 1IHZA 2SNSA 3HZXA 1LTID 1YNJD 2XWJB 1ILPA 1HH2P 2N49A 4C3IG 4MTNA 1E24A 1PH6A 2HDMA 4A3IH 3EJIA 1IYJB 1KNAA 1N9WA 4DV6L 4OGQC 5F2DA 1JJGA 1CTMA 3M4YA 1NR4A 1TWCB 4GKJQ 4K14A 4LJZC 2YU9B 1KTKA 4A93H 1EFID 1EQRA 3SEBA 1Y1WB 1I94L 5E4WC 3GTLB 3PO3H 2RA4A 3G6EA 1TKWB 4B3RQ 4A76A 1J5EQ 1VQ9A 5G3LF 1PH4A 2OQKA 2QDBA 3EA6A 3JC66 1SMYD 1VF7A 5FLXL 4R8IA 3BVMA 2M9VA 1QUQA 2NVXH 1MGSA 2F0GA 4GS3A 2AMCB 4DV1Q 1Q1EA 4KKTA 1X32A 4B08A 5M5YH 1GOZA 1Q46A 2E2DC 1JWSD 4CGYB 3NELA 2VB2X 4WRDA 1JORA 2RDHA 4DU9A 4RGOS 4J1MA 4P74A 3S24A 2Y0SE 1HZBA 2NTSA 3W3AA 3ZYYX 4RKLA 4M8AA 3M4OH 4DV6Q 1VQBA 4QF4A 3K59A 1NAPA 3ZJYC 1WTRA 1VQMA 1IBLQ 4JBJA 2SDFA 2MO1A 1UE5A 2IW3A 1SE8A 2FMCA 1I94Q 1CFMA 4KY7A 3NBHA 4RKBA 2JA6H 1TXYA 3CRLC 4DUYQ 1PRTF 4QIWB 3BZCA 1G51A 1GVPA 5IP9G 4KI0A 1YHBA 3I2ZA 1N36L 4IFDH 1ZEQX 5COYA 3VA7A 2BE5C 1F2YA 5DM63 2KCNA 1CT1D 5HGQA 3S1NB 2PYKA 5IGEA 1EYDA 3ULJA 1V1QA 2PW5A 3EROA 4YCVA 5FO8B 2KCTA 4GOPA 1PVOA 2JQOA 5C3EB 3HOXG 2A5HA 3I4LA 3TEHB 4X3KA 1LTGD 3K80C 3HOWG 3HEJA 1MSGA 1FVIA 4R8NA 2CW0C 2BH2A 1SN8A 2R7ZH 3TS0A 2K5QA 2C35B 3CCQA 3NTHA 3CPWA 4K5VA 1VQOA 1R9TH 3M4PA 2WKCA 4DAMA 3I4NB 2RHQB 3CKIB 4OHJA 4DR6L 2RSOA 5C44G 3U9OA 2VW9A 5DNFA 1U4PA 3HOZH 5IT9c 1YI2A 4KHPQ 3CC4A 1DJRD 1KLUD 3H0GG 4UY8C 3SXHA 3J7YW 3GTOH 3R93A 1TWHB 2EXDA 1HA6A 1N36Q 4LFBL 4P73A 3TZDA 2WKDA 1SBBB 4EQ5A 2KHJA 3KLSA 2KEDA 3GQBA 1K8MA 3I91A 3S9WA 5JPMC 2EJGC 1VQCA 5ELEA 2UXCL 1S5DD 4KD3A 4X3SA 4BWGB 3JAML 3SE0A 1EY7A 4A3DG 5FJ8G 4LK1C 2NB0A 3I8ZA 1UE7A 4ME5A 1QNKA 2F1MA 3B6YA 1PV4A 1IBKL 2X69A 1EYGA 3GTMB 3QJYA 1S72A 3J81L 2PMZE 4TQUS 3EIVA 4ME3A 2Q2UA 2NWGA 3H94A 4LFAL 4BA2I 2NYZD 2WB1B 4DR6Q 2JA7B 3HOUB 2K52A 2XRSD 5EKKA 5IE8A 2O5JC 2QEXA 2E76C 4PZ6A 5J39A 1LT5D 3K5NA 1Q12A 3C3LA 2RHSB 1BQQT 4YCWA 1EU3A 1TT2A 1K73C 3GTGH 1LTAD 3RLFA 4JI1L 4DAYB 3D4DA 2F0WA 3RMHA 4BY1B 1YNND 4V190 2MQHA 4ILWA 4LFBQ 1TWCH 4GNXB 4HJ9A 2YU9H 2K05A 1SYEA 4LUVA 4X3TA 2OF1A 4G4KA 5IGCA 1Y1WH 2RDGA 3DWAA 1M1KC 2ES2A 1YJNA 1XNRL 1BBWA 4RHSA 2RCNA 4H44C 2AQ2B 3VYTA 3HOVH 3I4OA 4WJ4A 3R2TA 2UXCQ 1N34L 4S3SA 2XWBB 3CC2A 4I65A 2Q2HA 1XMQL 2ICEC 1SROA 4HJ8A 1IBKQ 2R92H 1I6VC 1I5FA 2B2WC 5ELOA 1KDBA 4FVMA 2HT1A 2NVQB 1C4QA 1HZAA 4O1NA 4K0KL 4LFAQ 2R61A 4A3FG 3HOYG 1VQLA 4JBKA 3GTJB 1PYBA 4DN4M 1KQSA 2PNRC 5H1SE 3CPFA 4X64L 3ULPA 2GVAA 3MHBA 1JJCB 2VQFL 4DR4L 4JI1Q 4OELB 1A2TA 1VQNA 5M3FB 2MUYA 3CAMA 5ELDA 3DXJC 1PZJD 2PQEA 3CHBD 3P1HA 3KBXA 5JJKA 2IWHA 2JA8H 3MEFA 4ZUIA 1AW7A 5IYCG 2F3WA 4BS9A 1XNRQ 5C6AA 4G7HC 2LFNA 3S15B 5AJ3L 3ONAB 5A2QL 1N34Q 1JWMD 3PMFA 1A62A 5EKLA 1X3FA 1EQQA 2EY6A 1BBUA 1XMQQ 2D9UA 1GUSA 1NUCA 3SK6A 1EQTA 5FO9B 4H13C 4A3GB 3BVGA 2HCCA 4ZKBB 2HDLA 1YHAA 4JI8L 2K5WA 4QIWE 4UP7A 4A3EG 4A3KH 2QGQA 4K0KQ 4FDBA 3K5MA 1AFPA 1IBML 3K81C 1WI5A 2A8VA 1ZYRD 4L63B 4TSSA 4XQQA 4F88A 2WINB 4X64Q 3IKJA 2MFIA 2VQFQ 5DLQE 4DK0A 4DR4Q 5LL6S 4DKAC 3M7GA 5C4HA 1IKMA 1NMFA 1NBWA 4BBRB 1LT6D 2B63B 5EJWA 1XXGA 1D1IA 1PH2A 1SJHD 3S17B 2A68D 4NXML 2MO0A 4FXKC 1WTHA 4RWSC 3CC7A 2KEEA 1N33Q 1CHPD 3GTKB 2JA5B 3TP7A 2L9HA 3VR6A 5AJ3Q 2UUAL 3L9AX 3V05A 3D6CA 1L1OB 2YTYA 3DWPA 4RMFA 3SR1A 3E9HA 2IX1A 4YWKA 1BCPD 2NVTB 4RH6A 1YNJC 3ND8A 2Z0SA 1B50A 4JI8Q 3QO2A 4YCUA 2OCEA 5IGDA 3KBGA 1OXTA 2G9DA 3P75A 5I2YA 3NXWA 3SK5A 1IBMQ 2Z1CA 2GA4B 4EQPA 5LMUQ 3OPOA 4K6LA 5KIXA 3OTOL 4FF1A 1EY9A 3A74A 1LTLA 1VQ8A 1ET6A 5M3MH 1O78A 5CV9A 3NPPA 2EIFA 5EBDA 5DAUA 1W3SA 5FLXc 1B2TA 3MZ5A 2QF7A 1A3TA 1K0SA 5C0XI 1MHWC 1NJIC 2VUMB 1XWEA 3W1GA 4IJLA 1WCMB 2ICIA 4C3JG 2UUAQ 4DK1A 2EYMA 4PV1C 1S4ZA 2WB1E 2L55A 3BDCA 2OXPA 3Q6SA 3U9SA 5C5MA 1BDOA 3S2HH 1Z47A 4A3IB 4L8JA 1GHKA 4LUOA 1JICA 3EQLC 3R2IA 3Q0AA 4HIDA 5BN3A 4A3JH 2VNUD 5CMDA 1CI3M 2BCOA 3A7LA 4P72A 4A93B 4IPDA 3CP0A 5EBCA 1VQGA 1E2VA 1EQVA 2FFKB 1Y1VG 3G6JB 3MFYA 3PGZA 3PO3B 4A3BH 2JN4A 4F8MA 5IYDH 3OTOQ 3LWEA 5CGKA 1C7YA 5GAGC 1HZ9A 2NVQH 4L6TB 2OWOA 3LX0A 3R8BA 2EOTA 4GNXC 1PMRA 4HIOA 4PNYA 4NP5A 1ZKOA 3IL8A 3BJUA 4QB4A 1TWGH 1B1ZA 1YEZA 5M5YB 3I70A 1TS2A 1EOVA 1PDQA 2HUGA 4KLKA 4RA8A 1YITA 2ZJPA 2UXBL 1F2ZA 3NWTA 4ZUJA 1PH7A 2ZM6L 3TBIB 3KLSX 3HRZC 2EY2A 2HQEA 3QOLA 1Q81C 2CFMA 2K14A 3RLOA 4E6IA 1K28A 4K2LA 3M4OB 4IFDI 4DV3L 5KYLA 3PIO3 4A3MG 4XQJA 4IURA 3G71A 1WTXA 1IKLA 3OMGA 2DNEA 2QEJC 4CKBA 1L2FA 1VF5C 2NVYH 2C5CA 1STYA 1F2MA 3L3OC 2JA9A 1IL2A 4HCSA 1VQFA 4TKOB 3J80L 4GKKL 5KNBA 2JA6B 4FXGC 5M5XH 3MXUA 5JOBA 2DY8A 4ODGA 1SFOB 1VQPA 1XTCD 2NTTA 3GO5A 4C56C 1J6QA 1FL0A 1UEBA 3D8GA 4GOPC 4IPCA 1ML0D 3I72A 1EIYB 1XPUA 2I5LX 3FEWX 5J1ZA 1EWHA 1SR3A 3U4VA 5ISRA 1ENCA 3KJPA 1BUVT 2B2VC 2ZM6Q 2B63H 4O42A 3H09A 4BXXG 5K5PA 2AUKA 2IX3A 2M00A 2PQAA 2R7ZB 4G7ZC 2WP8J 1I6HH 2IPKD 4DV3Q 1JCKB 1R9TB 1SYFA 5IP9H 2FJ2A 3J81c 4G57A 5JEAH 3GTKH 3PIPA 3GTQH 4GN5A 3RN5A 1WTOA 3S14H 3JAMi 3GP7A 3PV0A 1ENAA 4MN3A 2OTJA 1EIHA 2F3VA 2WAQG 5CYUA 1EOTA 4ZAIA 5CV5A 2LXJA 1CKMA 2PNHA 2F4VL 4IZ8A 2VQEL 3GTOB 3STBD 2EJMA 1X6OA 1KDCA 2E5LL 1TY2A 2RDFA 2X6LA 4HJAA 2A19A 1NE3A 3KF8B 4P75A 4G7OC 1SRUA 2KHIA 2F0OA 4OO1G 1YNNC 5C3XA 4BY7G 4I7AA 1EZ6A 3FPPA 4PG3A 4IQZA 3URYA 1PTOD 4RGTA 4YHHQ 3CD6A 2Z9HA 2GN5A 2Z4HA 3HKZG 1L1OC 3CCLA 5C44H 3KOJA 3E9IA 4IOAA 1PYSB 1FNUA 4ZRZA 4A3LG 1Q1BA 2R93B 2UU9L 4BY1G 3H0GH 2CWPA 1VMPA 2SEBD 1XYIA 3IAYA 5AFWA 5I6WA 4HSPA 3VYUA 1RIPA 1JE4A 1WCMH 3MWYW 1JOKA 4QY7A 1VQKA 1J9OA 3DLLA 2K75A 5HY6A 2L11A 1CA6A 4QQBX 3GTGB 2VQEQ 1E2ZA 2M2LA 4XIGS 2NZOA 2E5LQ 1SNDA 5C0XH 4X6AH 2ID0A 1EY8A 3ERSX 4A4IA 1OXXK 1M8AA 4K8JA 2BOSA 2DGYA 1NSNS 4UHVA 2E2HH 2O5IC 3OMCA 1RDPD 2OEOA 4C1NI 2LXKA 1STAA 3AB9A 3KYHC 4AQYL 4LMQD 4R1JA 1M4VA 3HOVB 1KAWA 1XX8A 1BOSA 4JI5L 2MNAA 4HN7A 1QNUA 2SOBA 4NXNL 3CQZH 2HHHL 5IYBG 3KJOA 2PI2A 3W5OA 1N32L 3CCEA 1JB7A 1ONLA 2F0DA 5DM73 1BR9A 3UI2A 1GXDC 5E7NA 3T1HL 2UU9Q 2R92B 4JI3L 2BDOA 2IX0A 1A8VA 1I4HA 1HHVA 4DR1Q 3NTKA 1BNZA 3J7A5 3PUXA 1R4PB 4DNTB 4RFBA 5HURA 1A3UA 5KYIA 3RR5A 1B4OA 2ZXPA 1Y69U 5M9OA 2QW7A 4IOCA 1WTVA 4YY3L 1SYDA 1ZYRC 2F0HA 1QWYA 2Z6BA 1K3RA 4EQOA 3EBEA 4JK1C 4L5RC 1QVFA 2JA8B 3PCOB 1Q90A 1TWFH 2EXZA 2LS01 5KGUA 3N52A 2B2TA 4AQYQ 4UAIA 2LMCB 4PMWA 5JVH3 2A68C 1SFOH 3KF6A 3K8AA 1STBA 3HOYH 4C3HG 1AN8A 4IUNA 4QUFA 2B2UA 2CQAA 1KIXA 4ZLTF 4NXNQ 1BKBA 2HHHQ 2EYJA 2F0IA 2R7DA 1HNXL 2IY5B 1H9RA 1II3A 1N32Q 3NEMA 3Q24A 5GQOA 3T1HQ 2B29A 2HCIA 4OONA 5GROA 3H15A 1MJEA 3PO2G 4JI3Q 1KNEA 1GUNA 2TMPA 2O2LD 3DM1A 4WORA 4A3KB 1ICWA 1DOMA 1A3VA 1BCPC 3BDLA 2O4XA 1QZGA 1XNQL 4ZK9B 3HS0C 4X65L 2HD3A 3CCVA 3PF4A 4OIJA 2EYLA 4C2MH 2F4IA 5IYCH 4JBWA 3PSIA 4BBSG 4JV5L 4YY3Q 2G9HD 1ICFB 1HA5A 4CJ0B 1VQIA 2B2YA 2Z4IA 1GHJA 2A6HD 1WTQA 4N8X1 3T13A 1SNCA 3CCSA 3BU2A 4AYBB 5E1FA 4A3EH 2EJFC 1RKNA 3NUCA 4WJWA 1PH3A 1DYQA 3RN2A 1HQRD 3RLNA 1H9KA 4UP9A 1QB5D 1HNXQ 3WOFA 3S2DH 4N9PA 3DUZA 1B3QA 3K5OA 3C1EA 3K7UC 4OXPA 4ZYSA 4DK3C 1XNQQ 2PO4A 3H6MA 4X65Q 3QWNA 4H7BA 3CF5A 1CSQA 3KLWA 4UP8A 1TS4A 2R93H 5BR8L 3RZOH 1H9SA 5KRUA 4ZQ3A 2F0VA 4JV5Q 1LTRD 4MNOA 1LM0A 5M3MB 2CH4W 3FKIB 1KLGD 4M1UB 4HCEA 4EX5A 3VYSA 3T56B 1JT8A 3F2DA 1SSOA 5IP7H 5FK9C 2YYZA 3ERQA 1NR2A 1S5FD 2E8GA 3KLRA 1QUQB 2BDNA 1Q82C 4FF2A 3PO3G 1PFBA 1Y8OB 1Z6HA 2DN8A 1IYUA 2K6AA 2TSSA 4GLAC 3S2HB 2MGSA 2L15A 4XT1B 2MHVA 4PMCA 4A3JB 2Y0SG 3TDQA 1DD2A 5G3LD 4V0BA 3J7AV 2CCZA 3L2PA 5FKAC 1U4MA 1UWVA 4DGZA 1VQJA 2K4KA 4DV2L 1X54A 4A3BB 5BR8Q 3C46A 2DY7A 5HGTA 1T9HA 3PQIA 5CBAE 3J80c 4GN4B 4C3JH 3AMUA 2KCCA 1ILQA 5D65A 1MI2A 3NBHB 3M9BA 3IFTA 2CH4A 1YHQA 4PMBA 1HR0W 1UE6A 3C2PA 2JSOA 4EQNA 4GZYC 2KENA 1TWGB 4GLVB 3OW7A 1EYCA 3GD7A 1Q7YC 4R9WA 2A69D 2KQ3A 2BH8A 3BYTB 4B3TL 2FXQA 3PF5A 5I9OA 4GOPB 1LT4D 1WD0A 1LUZA 1MSHA 1HRJA 1O7ZA 3WWVA 4NKLA 5EKIA 3GTPH 1T5EA 1OXSC 1S40A 1PRTD 3AEVA 5A35A 4P71A 3KK7A 1CZWA 1CKNB 2NVYB 4H02A 3TREA 1C9OA 4A3CH 1B9MA 1EY0A 1GM5A 1MBYA 3W2DA 5EPLA 1BBXC 1UE1A 4DV2Q 1PTOH 5M5XB 3PUVA 3F1ZA 4TVAB 4HJ7A 1KC8C 3HG9A 1X56A 1MJCA 4LF4L 3EFXD 1VQHA 3NWSA 3SDZA 2E2IH 3STBC 4MZ9A 1LACA 1HXYD 3K6OA 4OEMB 1I50B 1UAPA 3IRBA 1ET9A 2OQ0A 4R4OA 1W6KA 3HOZG 4NMZA 5C4XH 1SMXA 2P5ZX 5D3IB 2WV6D 5C3WA 3DEPA 2E75C 4AH6A 5T1IA 1KAAA 3A8JE 1PTOC 2I0QA 3NENA 4F87A 4OWTB 1U9RA 1QG7A 4FXDA 1FGBD 1I6HB 4RG1A 4RGMA 4LFCL 4B9XA 1XMOL 2L0CA 3HFZB 1STHA 3GTQB 1X3QA 2D0OA 4P2CB 1G291 1W2BA 3S14B 3I4MH 1JJ2A 4IUTA 1BXTA 5LMNL 1IW7D 4J15A 1EWIA 4NPSA 4Y52H 3UDIA 3G7LA 4JOIA 4YWLA 3VR2A 2Z6KC 5KNDA 1FNWA 1PZID 3HOXB 2AHOB 1S3OA 4POFA 3K5LA 4AYBE 3CCUA 1E3PA 1PFMA 3H91A 4LF4Q 4ABNA 4ULLA 5FLMH 1EY6A 3FPUB 5M5WH 5J22A 2LKVA 3NE5B 2L4NA 4QGUA 1JQYD 1QILA 1SE4A 1X3PA 1WVLA 3C1FA 1KD1C 1V1PA 5C44B 1DZ1A 3FKIH 1DOLA 3QG1A 4NXMQ 3H0GB 4LF6L 3SVMA 5TSSA 2F03A 1SYGA 2J0TD 4RGNA 4L5SA 4LFCQ 5K36G 4NW2A 1CQVA 2NN6G 1XMOQ 4R4IA 2A73B 1Y1WG 2J7ZA 3T1YL 4K2KA 1QZHA 3K7AH 1FD7D 3IFDA 5LMNQ 5IOCA 1ENFA 1LTTD 3A0JA 4OO1H 1LABA 3VR4A 4LNQA 3HGBA 4BY7H 2Q8IB 1LTBD 2JP1A 4DR5L 1PH8A 2HIXA 4MIUA 1A63A 5IGGA 1O7YA 3OYYA 4DV4L 4A3DB 3SK4A 4CDFC 1TQOA 5I4DA 4ZCKA 2XN9C 4A3LH 1D5XC 2I07B 2E2HB 3A54A 1QVGA 2V1CC 5GAEC 1SNOA 3OWFA 4HMJA 2EVBA 3FVQA 1VQAA 3A7AB 4DPGA 4A75A 4DAVA 2Q8RE 4R4TA 5EGTA 4X62L 2OTLA 5ELFA 2FINB 1B7YB 4FO2A 3Q23A 4OWXB 1H9JA 1U5KA 5ELCA 1W6JA 3CQZB 1EY4A 3LNNA 2MP1A 2NZHA 2B8GA 3CCMA 3MXNB 1EEFD 5EQ0A 2XRQD 1H95A 4C3IH 2ALYB 5IT9E 3I90A 4LF6Q 2E2JH 3D0FA 3L7ZC 1X3EA 1WYDA 4R4QA 3QR8A 2XGTA 4ID6A 1GKHA 2YV5A 3LWUA 3RD4A 5I6YA 1FJGL 2F0JA 2B2WA 1SEBD 2RSNA 4DR5Q 1MIUA 4DV4Q 3LGJA 3T53B 4LF7L 1Q3LA 1BCPB 5KEEA 1JWUD 2K03A 5JEAJ 2AUJD 5C3EG 5JAVA 4LUZA 1F9QA 1TWFB 1X55A 2PZUA 2A6HC 1C48A 4B3SL 4DA2A 3CMEA 4X62Q 4LF5L 3KFUA 3HOYB 3S1MH 2N8NA 2A1AA 3M3YH 4WFN3 4KJNA 4KN4C 1PH9A 4XYQA 4QMGA 1ESRA 5NUCA 3I4NG 2QKIC 1I50H 4B9WA 5DEHA 2UXBQ 1L0WA 1V1OA 3KDFB 4KHZA 3X3NA 1KABA 4FF4A 2K7VA 4C2MB 1FJGQ 4N8FA 1F9SA 1EFWA 3MC0B 1K83H 3UDXA 1CUKA 1DM0B 2B2YC 1ESFA 1AP0A 1K9MC 4HIMA 4DFAA 4WJ3M 4C3HH 1Y8NB 1IZ6A 2AWOA 2PCFB 4LF7Q 4JI7L 1CQFA 2SNMA 3I55A 1U4RA 2ZJQA 1VMCA 3PO2H 3AQQA 4GKKQ 3DHQA 1F9RA 1AE3A 3J81i 4B3SQ 3G48A 5IWAL 4A3EB 3HOXH 1K0RA 4LF5Q 1GD7A 5D14A 1PFSA 3OWEB 3MAQA 3HOWH 2QCPX 2F0NA 2UXDL 2CWAA 4KHVA 2YTXA 5C0XJ 3S2DB 1MD2D 3T16A 5LMNW 1EUJA 3MXGA 4LW1A 4CJ1B 2WB1G 2JA7G 4ALPA 2ZT9C 1PYWD 3HOUG 1A15A 3S16H 4RHRA 1VDZA 1O7LA 2OT2A 3BZDB 1F77A 2F0LA 3OSOA 1DXMA 1C0AA 1E0BA 1G91A 3ICEA 2DUDA 3RZOB 2A6EC 1G2TA 1E1OA 3TRZA 5FOBB 4CBVA 4XQNA 2D5DA 3PIOA 5BN5A 4IO9A 4KD4A 1HFNA 3U4ZA 4JI7Q 5KNCA 2Q2TA 4K8IA 4OWWB 2F4VQ 2WACA 1T5XD 5JJIA 5IWAQ 3FRPB 3AU7A 3DEOA 3NTIA 1CKOA 2B3GA 1F9PA 4A3DH 2ZTDA 5FJ8H 1RCVD 4KTAA 1I3QH 2F0PA 2UXDQ 3R3OA 2WFWA 2HQLA 4GN3B 3RNUA 2A69C 3DM3A 2F0UA 2BA0A 3RUZA 1TS5A 2JEBI 1TY0A 1G8ZD 1YJ9A 1HR0L 3OHXC 3D31A 3VR3A 1G6PA 1CZGA 4HAEA 1IBLL 1PRTC 2I46A 1OO9B 4IFDJ 1XJVA 1RTNA 4CHTB 2VZAA 1YBYA 5M3FG 1BVSA 1K8AC 4C3JB 4IJHA 4DUYL 1F2LA 4YWMA 1WFQA 4O2DA 1WTWA 2K33A 2K5VA 4TRDA 1EYAA 3QIAA 2LSSA 2KOLA 1ZXTA 3NK9A 4DAYA 4HR7B
chains in the Genus database with same CATH topology
1EL0A 3KUPA 1RHPA 2H4OA 1GUWA 2JYOA 4X3UA 3VYRA 4K5WA 1JC7A 3NQIA 1Y1VB 3D3RA 4IALA 3TP6A 4K5XA 2F0MA 3GTPB 1J8IA 4F7XA 1DONA 1HTLD 1O80A 5FLXE 5EPKA 4KN7C 4HMIA 4DAPA 1PTOB 3ND9A 4K6DA 1HQMC 1IW7C 1Z7TA 2K04A 3X3MA 3H3VC 2E2IB 2F0FA 2C9OA 4QUCA 3GV3A 1EU4A 5JEAG 1L0XB 3S1QB 4A3MB 4Q0FA 2PPBC 4XT3B 4DNRB 2BA1A 3O13A 4KJOA 5C4XB 3F2UA 3WOEA 2LY7A 1EWCA 3VA5A 2EE1A 1PXUA 1CK1A 2B2VA 2KA7A 5JJZA 1LTSD 3I4MB 5LL6X 1QJOA 2F0TA 4RCOA 2N55A 1E2WA 3E6ZX 1U4LA 1BF4A 2D2CC 2K32A 1OXVA 3T51B 1OXUA 2DNCA 3CRKC 4KY6A 5M5WB 1IL8A 1GUTA 1KDAA 4RCNA 2K28A 2IL8A 1LLRD 4FP5D 1STEA 1BCPF 1D1KA 4I7ZC 3BVZA 1SNPA 3HP3A 3J7AF 4OO1I 1TS3A 2WAQB 2ZXOA 5C0XG 1TR5A 2EYFA 1SJED 5CV4A 1B53A 5E4XA 1SYCA 3TMEA 4EGVA 3K57A 3K7AB 2N88A 4N9TA 1EEID 4BY7B 1IYVA 5EPJA 3MA2B 3HKZB 2X6GA 5C4ZA 3S1RB 1FR3A 2A6ED 3OOCA 1G2SA 2NBFA 3JAME 2EYHA 4IN3A 1I4PA 3MVVA 4KKUA 5K36H 2NN6H 2PZWA 4OIKA 2IT1A 3OIPA 2VB3X 3J81E 3BYYB 2QILA 2EY1A 4C3IB 1PZKD 2E2JB 2H1EA 3SK8A 2AQ1B 3MEHA 3P20A 2JEAI 1SNMA 1JB3A 3GV6A 1SNQA 2FHTA 3A8IE 3MXPA 3NQTA 4IFDG 1CA5A 1S5ED 1STNA 3TZUA 1GJXA 4J6HA 3PUWA 1RF2D 1LV9A 1AZPA 4HSVA 1HUNA 5CC4A 5IGFA 3S1MB 3MXNA 5E3FA 3QOJA 1HUMA 3M3YB 2J4XA 3FMCA 4U68A 1SDFA 1D5ZC 2XNAC 1WD1A 3TSSA 1I4GA 5CR3A 3DMUA 1RODA 2KECA 5I2XA 3V96A 3RZDB 3SHLA 2D62A 1K8OA 3VR5A 3TP5A 4J8QA 1UEAB 3PUYA 3K0YA 2EYOA 1A6XA 1K83B 3PUZA 1RJTA 2XIWA 4XXEA 2B39A 2EPBA 3NBIA 3I73A 2RVLA 4C3HB 2PW7A 4Q5VA 3M85A 1H9SB 1PLFA 2IJ0A 5A2QE 1BO0A 1SE3A 4XDXA 4FYDA 3PO2B 3I3CA 4NDXA 2KVMA 4IUPA 5LHY1 1S5BD 3TP8A 2BE5D 3FDTA 2RBMA 3A56A 3HOWB 1EZ8A 4Z9CB 2R6GA 4BBSB 3ITPA 3D4WA 4CJ2C 2ENBA 2B8FA 3NHHA 3BS1A 3S16B 1DCZA 2RKSA 1JOQA 1QOHA 4OL7A 5I9PA 3OIQA 3Q22A 2KUMA 2WIIB 2CW0D 5ELBA 2XVSA 5IODA 4HTHA 4YIJA 2ZXRA 3BDOA 1R4QB 1D5MC 2JXMB 3E0JA 4IUVA 1VCIA 1B9NA 4BA1I 2EZVA 1HFGA 3BG3A 1PTOF 3K58A 5CV7A 1GUOA 2AWNA 2L5TA 1PRTB 3A55A 5IT9L 3N6RA 2A74C 1SMYC 2F0EA 1I3QB 2EDGA 2CHBD 3KF8A 4KV6A 5JVG3 1AZQA 1CHQD 2EY5A 1LO5D 2EYPA 1UUPA 4EVOA 3PIP3 4MHEA 1JOOA 4DXFA 2MJ8A 1FYCA 1Q8IA 3V2TA 2F0SA 1HCZA 3NSWA 4DF7A 3EVQA 5CV8A 1B3AA 1UNSA 2NVXB 3M7NA 1V43A 1HTPA 2CVRA 2Y0SB 4KKSA 5T1GA 2V4DA 4CKCA 4KK7A 2R3ZA 1TIID 2B2TC 1C8CA 2B2UC 1QCBD 3MFGA 4A3FB 5C4JB 1A2UA 2K01A 4FF3A 5C5LA 4CKEA 4XYOA 5IGBA 1TWAB 4DXGA 1G6ZA 3WDNA 2AQ3B 4RAUC 1SAPA 1I4XA 4H0LC 5IIFA 2RQXA 1DOKA 2K1BA 5CV6A 2Q8TA 1SE2A 4IUUA 3A8KE 2PZTA 2Z8LA 4KY5A 3D6WA 4QCLA 1AEXA 5JPNC 1D2BA 4UDUC 4XTCS 1RTOA 1SXTA 5D3DA 1B44D 5CBEE 1STGA 3CU7A 3NP8A 1RD9D 1PFNA 2L1BA 2L12A 4Y7NB 1V1PB 3J80E 2JE6I 4HEDA 2MPMA 2E74C 4LAAA 1SYBA 3E5SA 4IUQA 1H9MA 1EIGA 3T4AC 3HOZB 2F0QA 1NCVA 1V8QA 3D4RA 2XSCA 3QB3A 1LT3D 5FO7B 2VXWA 5CORA 3MTSA 1S5CD 2K5DA 1HPCA 4ZKCB 3TN2A 1TVXA 1EY5A 4U673 2NUCA 1GUGA 1I4QA 1L0YB 4PQXA 2PMZB 2KJXA 1Y8PB 2F0KA 1FNVA 1WTPA 2NZ1D 4FNFA 2FMMA 3DWQA 1CM9A 2KHSA 1D6EC 1JR0D 1TU2B 5BN4A 1I4RA 2NN6I 3P7JA 4C1NK 4KMUC 1QE6A 1IHZA 2SNSA 3HZXA 1LTID 1YNJD 2XWJB 1ILPA 4C3IG 2HDMA 3EJIA 1KNAA 4OGQC 5F2DA 1CTMA 3M4YA 1NR4A 1TWCB 4K14A 4LJZC 2YU9B 1KTKA 1EFID 1Y1WB 3SEBA 5E4WC 3GTLB 2RA4A 1TKWB 5G3LF 2QDBA 3EA6A 1SMYD 1VF7A 5FLXL 4R8IA 3BVMA 2M9VA 1MGSA 2F0GA 1Q1EA 4KKTA 1X32A 4B08A 1GOZA 2E2DC 1JWSD 4CGYB 2VB2X 4WRDA 1JORA 2RDHA 4DU9A 4RGOS 4J1MA 2NTSA 3W3AA 3ZYYX 4RKLA 4M8AA 4QF4A 3K59A 1NAPA 1WTRA 2SDFA 2IW3A 2FMCA 1CFMA 4KY7A 3NBHA 4RKBA 3CRLC 1PRTF 4QIWB 4KI0A 4IFDH 1ZEQX 5COYA 3VA7A 2BE5C 1F2YA 5DM63 2KCNA 1CT1D 3S1NB 2PYKA 5IGEA 1EYDA 2PW5A 3EROA 5FO8B 5C3EB 2A5HA 3I4LA 4X3KA 1LTGD 3HEJA 1MSGA 4R8NA 2CW0C 2K5QA 3NTHA 4K5VA 2WKCA 3I4NB 3CKIB 4OHJA 2RSOA 3U9OA 5DNFA 1U4PA 1DJRD 1KLUD 3SXHA 3J7YW 3R93A 1TWHB 1HA6A 3TZDA 2WKDA 1SBBB 3KLSA 2KEDA 3GQBA 1K8MA 3I91A 3S9WA 5JPMC 2EJGC 5ELEA 1S5DD 4KD3A 4X3SA 4BWGB 3JAML 3SE0A 1EY7A 4LK1C 2NB0A 3I8ZA 4ME5A 1QNKA 2F1MA 2X69A 3GTMB 3QJYA 3J81L 4TQUS 2NWGA 3H94A 4BA2I 2NYZD 2WB1B 2JA7B 3HOUB 5EKKA 2XRSD 2O5JC 2E76C 3C3LA 5J39A 1LT5D 3K5NA 1Q12A 1BQQT 1EU3A 1TT2A 1LTAD 3RLFA 3D4DA 2F0WA 3RMHA 4BY1B 1YNND 4V190 4ILWA 2K05A 1SYEA 4X3TA 2OF1A 4G4KA 5IGCA 2RDGA 3DWAA 4RHSA 4H44C 2AQ2B 3VYTA 3R2TA 4S3SA 2XWBB 4I65A 2ICEC 1I6VC 2B2WC 1KDBA 4FVMA 2NVQB 1C4QA 4O1NA 2R61A 3GTJB 4DN4M 2PNRC 3MHBA 1A2TA 5M3FB 2MUYA 5ELDA 3DXJC 1PZJD 2PQEA 3CHBD 3P1HA 3KBXA 2IWHA 4ZUIA 1AW7A 2F3WA 4BS9A 5C6AA 4G7HC 2LFNA 3S15B 3ONAB 5A2QL 1JWMD 3PMFA 5EKLA 2EY6A 2D9UA 1GUSA 1NUCA 3SK6A 1EQTA 5FO9B 4H13C 4A3GB 3BVGA 2HCCA 4ZKBB 2HDLA 2K5WA 3K5MA 1AFPA 1ZYRD 4L63B 4TSSA 4XQQA 4F88A 2WINB 3IKJA 4DK0A 5LL6S 5C4HA 3M7GA 1IKMA 4BBRB 1LT6D 2B63B 5EJWA 1XXGA 1D1IA 1SJHD 3S17B 2A68D 4FXKC 4RWSC 2KEEA 1CHPD 3GTKB 2JA5B 3TP7A 2L9HA 3VR6A 3L9AX 3V05A 3D6CA 3DWPA 3SR1A 2IX1A 1BCPD 2NVTB 4RH6A 1YNJC 3ND8A 1B50A 3QO2A 5IGDA 3KBGA 1OXTA 2G9DA 3P75A 5I2YA 3NXWA 3SK5A 2Z1CA 2GA4B 4EQPA 3OPOA 4K6LA 5KIXA 4FF1A 1EY9A 1ET6A 1O78A 5CV9A 3NPPA 5EBDA 5DAUA 1B2TA 3MZ5A 2QF7A 1A3TA 5C0XI 2VUMB 1XWEA 1WCMB 2ICIA 4C3JG 4DK1A 2EYMA 4PV1C 1S4ZA 2L55A 3BDCA 2OXPA 3Q6SA 3U9SA 5C5MA 1BDOA 1Z47A 4A3IB 4L8JA 1GHKA 1JICA 3EQLC 3R2IA 3Q0AA 5BN3A 2VNUD 5CMDA 1CI3M 2BCOA 3A7LA 4A93B 5EBCA 1E2VA 1EQVA 2FFKB 3G6JB 3MFYA 3PO3B 4F8MA 3LWEA 5CGKA 4L6TB 3LX0A 3R8BA 2EOTA 1PMRA 4PNYA 4NP5A 1ZKOA 3IL8A 4QB4A 1B1ZA 5M5YB 3I70A 1TS2A 1PDQA 2HUGA 4RA8A 1F2ZA 3NWTA 4ZUJA 3TBIB 3KLSX 3HRZC 2EY2A 2HQEA 3QOLA 4E6IA 4K2LA 3M4OB 4IFDI 5KYLA 3PIO3 4XQJA 4IURA 1WTXA 1IKLA 3OMGA 2DNEA 2QEJC 4CKBA 1VF5C 2C5CA 1STYA 1F2MA 3L3OC 4HCSA 4TKOB 3J80L 5KNBA 2JA6B 4FXGC 3MXUA 5JOBA 2DY8A 4ODGA 1SFOB 1XTCD 2NTTA 3GO5A 4C56C 3D8GA 1ML0D 3I72A 3FEWX 5J1ZA 1EWHA 5ISRA 1ENCA 1BUVT 2B2VC 4O42A 3H09A 5K5PA 2AUKA 2IX3A 2M00A 2R7ZB 4G7ZC 2WP8J 2IPKD 1JCKB 1R9TB 1SYFA 2FJ2A 4G57A 5JEAH 1WTOA 3GP7A 3PV0A 1ENAA 4MN3A 1EIHA 2F3VA 5CYUA 1EOTA 4ZAIA 5CV5A 4IZ8A 3GTOB 2EJMA 1KDCA 1TY2A 2RDFA 2X6LA 4G7OC 2F0OA 4OO1G 1YNNC 5C3XA 1EZ6A 3FPPA 3URYA 4IQZA 1PTOD 4RGTA 2Z4HA 1FNUA 4ZRZA 1Q1BA 2R93B 1VMPA 2SEBD 1XYIA 3IAYA 5AFWA 5I6WA 4HSPA 3VYUA 1JE4A 3MWYW 1JOKA 1J9OA 2L11A 1CA6A 3GTGB 1E2ZA 2M2LA 4XIGS 1SNDA 5C0XH 2ID0A 1EY8A 1OXXK 1M8AA 4K8JA 2BOSA 1NSNS 2O5IC 3OMCA 1RDPD 2OEOA 4C1NI 1STAA 3AB9A 4LMQD 1M4VA 3HOVB 1XX8A 1BOSA 4HN7A 1QNUA 2SOBA 1ONLA 2F0DA 5DM73 1BR9A 3UI2A 1GXDC 2R92B 2BDOA 2IX0A 1I4HA 1HHVA 3NTKA 1BNZA 3PUXA 1R4PB 4DNTB 4RFBA 5HURA 1A3UA 5KYIA 1B4OA 2ZXPA 1Y69U 5M9OA 1WTVA 1SYDA 1ZYRC 2F0HA 1QWYA 4EQOA 4JK1C 2JA8B 1Q90A 2EXZA 2LS01 5KGUA 3N52A 2B2TA 4UAIA 2LMCB 4PMWA 5JVH3 2A68C 1STBA 4C3HG 1AN8A 4IUNA 4QUFA 2B2UA 2CQAA 4ZLTF 2EYJA 2F0IA 1H9RA 1II3A 3Q24A 2HCIA 1KNEA 1GUNA 2TMPA 2O2LD 3DM1A 4WORA 4A3KB 1ICWA 1DOMA 1A3VA 1BCPC 3BDLA 2O4XA 4ZK9B 3HS0C 4OIJA 2EYLA 2F4IA 4JBWA 2G9HD 1HA5A 4CJ0B 2Z4IA 2B2YA 1GHJA 2A6HD 1WTQA 3T13A 1SNCA 4AYBB 5E1FA 2EJFC 1RKNA 3NUCA 4WJWA 1DYQA 1HQRD 1H9KA 1QB5D 3WOFA 4N9PA 3DUZA 3K5OA 3C1EA 4ZYSA 2PO4A 3H6MA 3QWNA 4H7BA 1TS4A 1H9SA 5KRUA 4ZQ3A 2F0VA 1LTRD 5M3MB 3FKIB 1KLGD 4M1UB 4HCEA 3VYSA 3T56B 1SSOA 5FK9C 2YYZA 3ERQA 1NR2A 1S5FD 3KLRA 2BDNA 4FF2A 1PFBA 1Y8OB 1Z6HA 2DN8A 1IYUA 2K6AA 2TSSA 3S2HB 2MGSA 4XT1B 2MHVA 4PMCA 4A3JB 3TDQA 1DD2A 5G3LD 4V0BA 3J7AV 5FKAC 1U4MA 4DGZA 4A3BB 3C46A 2DY7A 5HGTA 5CBAE 3AMUA 2KCCA 1ILQA 5D65A 1MI2A 3IFTA 4PMBA 3C2PA 2JSOA 4EQNA 4GZYC 1TWGB 3OW7A 1EYCA 3GD7A 4R9WA 2A69D 2KQ3A 3BYTB 5I9OA 1LT4D 1WD0A 1MSHA 1HRJA 1O7ZA 4NKLA 5EKIA 1T5EA 1OXSC 1PRTD 5A35A 3KK7A 1CZWA 2NVYB 1B9MA 1EY0A 1MBYA 3W2DA 5EPLA 1BBXC 1PTOH 5M5XB 3PUVA 3HG9A 3EFXD 3NWSA 3SDZA 1LACA 1HXYD 3K6OA 1I50B 1UAPA 1ET9A 1W6KA 4NMZA 5D3IB 2WV6D 5C3WA 3DEPA 2E75C 5T1IA 1KAAA 3A8JE 1PTOC 4FXDA 1I6HB 4F87A 1U9RA 1QG7A 1FGBD 4RGMA 4B9XA 2L0CA 1STHA 3GTQB 1X3QA 4P2CB 1G291 3S14B 4IUTA 1BXTA 1IW7D 3G7LA 3VR2A 5KNDA 1FNWA 1PZID 3HOXB 3K5LA 1PFMA 3H91A 4ABNA 4ULLA 1EY6A 3FPUB 5J22A 2LKVA 3NE5B 2L4NA 1JQYD 1QILA 1SE4A 1X3PA 1WVLA 3C1FA 1V1PA 5C44B 1DZ1A 1DOLA 3QG1A 3H0GB 3SVMA 5TSSA 2F03A 1SYGA 2J0TD 4RGNA 5K36G 4NW2A 1CQVA 2NN6G 2A73B 2J7ZA 4K2KA 1FD7D 3IFDA 5IOCA 1ENFA 1LTTD 4OO1H 1LABA 3VR4A 3HGBA 2Q8IB 1LTBD 2JP1A 4MIUA 5IGGA 1O7YA 4A3DB 3SK4A 5I4DA 1TQOA 2XN9C 2E2HB 1D5XC 2I07B 3A54A 1SNOA 3OWFA 4HMJA 2EVBA 3FVQA 3A7AB 4DAVA 2Q8RE 5EGTA 5ELFA 2FINB 4FO2A 3Q23A 1H9JA 5ELCA 1W6JA 3CQZB 1EY4A 3LNNA 2MP1A 2B8GA 1EEFD 5EQ0A 2XRQD 5IT9E 3I90A 3L7ZC 4ID6A 3LWUA 3RD4A 5I6YA 2F0JA 2B2WA 1SEBD 2RSNA 3T53B 1Q3LA 1BCPB 5KEEA 1JWUD 2K03A 5JEAJ 2AUJD 5JAVA 1F9QA 1TWFB 2PZUA 2A6HC 1C48A 4DA2A 3HOYB 4WFN3 4KJNA 4KN4C 4XYQA 4QMGA 1ESRA 5NUCA 2QKIC 4B9WA 5DEHA 1V1OA 4KHZA 3X3NA 1KABA 4FF4A 2K7VA 4C2MB 1F9SA 3MC0B 1DM0B 2B2YC 1ESFA 1AP0A 4DFAA 1Y8NB 2AWOA 2PCFB 1CQFA 2SNMA 1U4RA 1VMCA 3DHQA 1F9RA 4A3EB 5D14A 3OWEB 3MAQA 2QCPX 2F0NA 4KHVA 5C0XJ 3S2DB 1MD2D 3T16A 3MXGA 4CJ1B 2ZT9C 1PYWD 1A15A 4RHRA 1VDZA 1O7LA 2OT2A 3BZDB 1F77A 2F0LA 3OSOA 1DXMA 1E0BA 1G91A 3RZOB 2A6EC 1G2TA 5FOBB 4CBVA 4XQNA 2D5DA 5BN5A 4KD4A 1HFNA 5KNCA 4K8IA 2WACA 1T5XD 3FRPB 3AU7A 3DEOA 3NTIA 1F9PA 1RCVD 4KTAA 2F0PA 3R3OA 2A69C 2F0UA 2BA0A 3RUZA 1TS5A 2JEBI 1TY0A 1G8ZD 3OHXC 3D31A 3VR3A 1CZGA 4HAEA 1PRTC 2I46A 1OO9B 4IFDJ 1RTNA 4CHTB 4C3JB 1F2LA 1WTWA 2K33A 4TRDA 1EYAA 3QIAA 2KOLA 1ZXTA 3NK9A 4DAYA 4HR7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K28 A;  1PFB A;  2FIN B;  3KUP A;  4ZLT F;  1EL0 A;  4HSV A;  2IL8 A;  3DEP A;  1DOK A;  2K1B A;  2B2W C;  5D14 A;  2Q8T A;  1NR4 A;  1RHP A;  2MP1 A;  4IUU A;  1HUN A;  5T1I A;  4IUR A;  1B50 A;  2HCI A;  3D6W A;  5EQ0 A;  3HP3 A;  3QO2 A;  2JYO A;  2MGS A;  1VMP A;  4X3U A;  1IKL A;  4XT1 B;  1RTO A;  2RSO A;  1WTX A;  1KNE A;  1XYI A;  5AFW A;  3I90 A;  1QG7 A;  1HUM A;  5E4W C;  5DNF A;  1JE4 A;  1U4P A;  3DM1 A;  4DN4 M;  4U68 A;  1SDF A;  3MWY W;  1ICW A;  1DOM A;  5CBE E;  2RA4 A;  1WD1 A;  4CJ1 B;  1X3Q A;  1AZQ A;  4ZK9 B;  4HCS A;  1A15 A;  1PFN A;  2L1B A;  3R93 A;  1B53 A;  1J9O A;  2L12 A;  1J8I A;  1DON A;  4OIJ A;  1ROD A;  4IUT A;  2KEC A;  1U4M A;  2L11 A;  5E4X A;  1CA6 A;  4R8I A;  1HA6 A;  1MGS A;  2DY8 A;  3TZD A;  2M2L A;  1O80 A;  2DY7 A;  3G7L A;  2N88 A;  1E0B A;  5CBA E;  2B2W A;  1G91 A;  5EPK A;  4HED A;  2MPM A;  4MHE A;  1M8A A;  2KED A;  1X32 A;  4CJ0 B;  2MJ8 A;  3KBX A;  1G2T A;  2B2Y A;  1ILQ A;  2RSN A;  4IUQ A;  3I91 A;  5D65 A;  1B2T A;  1GUW A;  1MI2 A;  1RJT A;  2XIW A;  1ML0 D;  1PFM A;  2K04 A;  3H91 A;  2EPB A;  1EIG A;  2Q8R E;  1WTQ A;  2RVL A;  1Q3L A;  5EPJ A;  3FPU B;  4X3S A;  3ONA B;  2K03 A;  2X6G A;  4LMQ D;  1HFN A;  1NCV A;  2L4N A;  4QUC A;  3GV3 A;  3I8Z A;  1XX8 A;  1QNK A;  2B2V C;  1B3A A;  1F9Q A;  1G2S A;  2VXW A;  4R9W A;  2D9U A;  4O42 A;  2X69 A;  1PLF A;  1X3P A;  5COR A;  1S4Z A;  3MTS A;  1WVL A;  1BO0 A;  4XDX A;  1EQT A;  3Q6S A;  4XT3 B;  1NAP A;  3I3C A;  1WTR A;  3DEO A;  1DZ1 A;  2KVM A;  3UI2 A;  4ZKC B;  1JIC A;  4OIK A;  2CVR A;  2HCC A;  2NWG A;  1DOL A;  2HDL A;  3F2U A;  1F9P A;  4IUP A;  3TN2 A;  2SDF A;  4ZKB B;  5T1G A;  1WD0 A;  1TVX A;  2FJ2 A;  2NYZ D;  3FDT A;  1ESR A;  1MSH A;  5CMD A;  3SVM A;  1HHV A;  1HRJ A;  1O7Z A;  1WTO A;  5EKI A;  1BNZ A;  2R3Z A;  4NW2 A;  4MN3 A;  1EIH A;  2FFK B;  2B2T C;  1EOT A;  2EE1 A;  2H1E A;  2J7Z A;  4ZAI A;  2NZ1 D;  1WTP A;  2B2V A;  1B4O A;  2FMM A;  4CJ2 C;  3LWE A;  3IFD A;  5JJZ A;  1C8C A;  5COY A;  1IKM A;  5EPL A;  1WTV A;  2B2U C;  5EJW A;  1BBX C;  1F9S A;  4HAE A;  3GV6 A;  2X6L A;  1CM9 A;  2K05 A;  2KUM A;  2EOT A;  2N55 A;  2B2Y C;  2FHT A;  4X3T A;  1RTN A;  2JP1 A;  2K01 A;  1AP0 A;  1U4L A;  1O7Y A;  3IL8 A;  1BF4 A;  3P7J A;  4RWS C;  2KEE A;  1QE6 A;  1F2L A;  1CA5 A;  1PDQ A;  1SSO A;  4X3K A;  2HUG A;  4RA8 A;  2L9H A;  1ILP A;  3N52 A;  1WTW A;  2B2T A;  4IUV A;  1NR2 A;  1G6Z A;  4UAI A;  1MSG A;  1U4R A;  1VMC A;  1HFG A;  4RAU C;  2BDN A;  1SAP A;  2HDM A;  1IL8 A;  1LV9 A;  2KOL A;  1ZXT A;  1KNA A;  1F9R A;  1AZP A;  4QUF A;  2B2U A; 
#chains in the Genus database with same CATH topology
 2UUB L;  1EL0 A;  3KUP A;  2VL6 A;  2IHF A;  1RHP A;  4B3M L;  4GNX A;  1NTG A;  2H4O A;  1GUW A;  2JYO A;  4IPG A;  4X3U A;  3VYR A;  4K5W A;  1EIF A;  1JC7 A;  3H3V H;  3NQI A;  1VQ5 A;  1Y1V B;  3D3R A;  4A3G G;  4IAL A;  3TP6 A;  4K5X A;  2F0M A;  3I56 A;  1YVC A;  3GTP B;  2ZTE A;  1J8I A;  4F7X A;  1DON A;  1HTL D;  1PA6 A;  4A3F H;  2PQA B;  4JI5 Q;  4JVZ A;  5C4J H;  1HR0 Q;  2QA4 A;  1O80 A;  3BZK A;  1VQE A;  5FLX E;  5EPK A;  4KN7 C;  3EN2 A;  4HMI A;  4DAP A;  3A5Z B;  4BBR G;  1PTO B;  2B63 G;  3SGI A;  1PHJ A;  3ND9 A;  1GO3 E;  4K6D A;  1HQM C;  1IW7 C;  1Z7T A;  2K04 A;  4JPB W;  4KHP L;  1TWA H;  3X3M A;  3CW2 C;  3H3V C;  4JYA L;  2E2I B;  3VDY A;  2F0F A;  2C9O A;  4QUC A;  3GV3 A;  1EU4 A;  5JEA G;  2JA5 G;  1L0X B;  3S1Q B;  2K5N A;  4A3M B;  4Q0F A;  1P16 A;  2PPB C;  4XT3 B;  4DNR B;  2UUB Q;  2BA1 A;  3O13 A;  4KJO A;  5C4X B;  3F2U A;  3WOE A;  4B3M Q;  2LY7 A;  4R4C A;  1EWC A;  2ZTC A;  3VA5 A;  2EE1 A;  1P8L A;  4QJF A;  4Y7N H;  1PXU A;  1CK1 A;  2B2V A;  2KA7 A;  1CKN A;  1KL9 A;  3U58 A;  5JJZ A;  1LTS D;  3OW2 A;  3I4M B;  5LL6 X;  1M90 C;  1QJO A;  4JOI C;  2F0T A;  1AE2 A;  4RCO A;  4DV0 L;  2N55 A;  1N8R C;  1E2W A;  3E6Z X;  1U4L A;  3CXC A;  2F52 A;  1BF4 A;  4APV A;  3UDG A;  2D2C C;  2K32 A;  4X66 L;  1KXL A;  1OXV A;  3T51 B;  1OXU A;  2DNC A;  3CRK C;  4JYA Q;  3CMA A;  2VUM G;  4KY6 A;  5M5W B;  1IL8 A;  1GUT A;  1KDA A;  1WCM G;  1ASY A;  4RCN A;  2K28 A;  2IL8 A;  1LLR D;  4FP5 D;  1STE A;  4DV7 L;  4LWC A;  1BCP F;  4L5T A;  1D1K A;  1CSP A;  4DR3 L;  4I7Z C;  1D7Q A;  3BVZ A;  1SNP A;  3HP3 A;  3J7A F;  4OO1 I;  4A3I G;  1TS3 A;  2WAQ B;  2ZXO A;  4LF8 L;  3UDF A;  5C0X G;  1TR5 A;  2EYF A;  4DUZ L;  4NB3 A;  5JJL A;  3U50 C;  1SJE D;  5CV4 A;  4O0A A;  4JI0 L;  1B53 A;  1B70 B;  5E4X A;  4A93 G;  2I5H A;  1L1O A;  1SYC A;  1X3G A;  3TME A;  4EGV A;  3K57 A;  3K7A B;  2N88 A;  3UE1 A;  3W1B A;  4N9T A;  1EEI D;  4DV0 Q;  1MKH A;  1A0I A;  3HKS A;  1Q86 C;  3FP9 A;  4BY7 B;  1IYV A;  4AIM A;  4QL5 A;  5EPJ A;  3MA2 B;  3HKZ B;  4X66 Q;  1B8A A;  1NNX A;  2X6G A;  5C4Z A;  1HZC A;  1FR3 A;  2A6E D;  3S1R B;  3OOC A;  1G2S A;  2NBF A;  3JAM E;  2EYH A;  4JW0 A;  4IN3 A;  1O7I A;  1I4P A;  4JBM A;  4GLX A;  3MVV A;  4KKU A;  5K36 H;  2NN6 H;  3TS2 A;  2PZW A;  4OIK A;  4DV7 Q;  2IT1 A;  3OIP A;  2VB3 X;  4DR3 Q;  3J81 E;  2G5D A;  3GTL H;  3BYY B;  2QIL A;  4LF8 Q;  2H5X A;  2EY1 A;  2KBN A;  5IY0 A;  4C3I B;  1PZK D;  3F2C A;  1VQD A;  2E2J B;  4DUZ Q;  2H1E A;  3SK8 A;  3J80 i;  3KF6 B;  2AQ1 B;  4JI0 Q;  2CKZ B;  3MEH A;  3P20 A;  2JEA I;  4DR7 L;  1QVC A;  1Q8K A;  1IXR A;  1JB3 A;  1LYL A;  1SNM A;  4L5Q A;  2JA6 G;  3GV6 A;  1SNQ A;  2FHT A;  3CCR A;  3L0O A;  1Y1V H;  3A8I E;  3MXP A;  3NQT A;  4IFD G;  4UPA A;  2I5M X;  1WJJ A;  1CA5 A;  2RF4 A;  1S5E D;  1STN A;  3TZU A;  1GJX A;  4J6H A;  3PUW A;  3E0E A;  5ELN A;  1RF2 D;  1LV9 A;  3I7F A;  1AZP A;  1XPO A;  4HSV A;  1K3B C;  3E3X A;  1HUN A;  1ASZ A;  5CC4 A;  5IGF A;  2R7Z G;  1YNX A;  3S1M B;  3MXN A;  5E3F A;  4DR2 L;  3QOJ A;  1N33 L;  1HNZ L;  1HUM A;  3M3Y B;  2J4X A;  3FMC A;  4U68 A;  1SDF A;  1D5Z C;  2XNA C;  1WD1 A;  1U0L A;  5L37 A;  3TSS A;  1I4G A;  1X9N A;  2AKW B;  5CR3 A;  1VQ7 A;  3S1Q H;  4A3M H;  3DMU A;  1ROD A;  1JE5 A;  2KEC A;  5I2X A;  3V96 A;  3S1N H;  2UUC L;  3RZD B;  3SHL A;  2D62 A;  1K8O A;  4DR7 Q;  3VR5 A;  3TP5 A;  1VQ4 A;  4J8Q A;  4B3T Q;  1UEA B;  3PUY A;  5C3E H;  3K0Y A;  2EYO A;  1A6X A;  1K83 B;  3PUZ A;  1RJT A;  2XIW A;  4XXE A;  2B39 A;  2EPB A;  3NBI A;  3I73 A;  3J81 j;  2RVL A;  5LMU L;  4JC0 A;  3CCJ A;  4C3H B;  2PW7 A;  4Q5V A;  3M85 A;  1H9S B;  1PLF A;  2IJ0 A;  5A2Q E;  1BO0 A;  1SE3 A;  4XDX A;  3I4N H;  4FYD A;  3PO2 B;  3FHW A;  4PZ7 A;  3I3C A;  4NDX A;  2KVM A;  1E22 A;  2QDL A;  4IUP A;  5LHY 1;  1S5B D;  3TP8 A;  1KHI A;  3G4S A;  2JK8 A;  3K0X A;  2DJG C;  1AH9 A;  2R93 G;  2BE5 D;  1YZ6 A;  2RBM A;  3FDT A;  4DR2 Q;  3A56 A;  3HOW B;  1VQ6 A;  4OX9 L;  1HNZ Q;  1EZ8 A;  1SLJ A;  4Z9C B;  4BXX H;  1TWH H;  2N3S A;  2R6G A;  4BBS B;  3ITP A;  3D4W A;  4CJ2 C;  2ENB A;  2HIV A;  2B8F A;  3NHH A;  1WOC A;  3KDF A;  3BS1 A;  3S16 B;  1DCZ A;  2RKS A;  2UUC Q;  5IP7 G;  1JOQ A;  1QOH A;  4OL7 A;  5I9P A;  3OIQ A;  3Q22 A;  2KUM A;  3M4Q A;  3TQY A;  2WII B;  2CW0 D;  5ELB A;  2YTV A;  2XVS A;  5IOD A;  2K50 A;  4HTH A;  4YIJ A;  2ZXR A;  3BDO A;  2N78 A;  1R4Q B;  1D5M C;  2JXM B;  3E0J A;  4IUV A;  3GTM H;  1E1T A;  1VCI A;  1B9N A;  4BA1 I;  2EZV A;  1HFG A;  3BG3 A;  1PTO F;  3K58 A;  5CV7 A;  1GUO A;  2WAQ E;  3HOV G;  2AWN A;  2L5T A;  4HJ5 A;  1PRT B;  3A55 A;  5IT9 L;  2JA7 H;  3HOU H;  3N6R A;  2A74 C;  1NY4 A;  1SMY C;  3J7Z C;  2F0E A;  2PI2 E;  2R92 G;  1I3Q B;  2EDG A;  4OX9 Q;  2CHB D;  3KF8 A;  1NMG A;  3S1R H;  1JMC A;  4KV6 A;  5JVG 3;  1AZQ A;  4BY1 H;  1CHQ D;  2EY5 A;  1LO5 D;  2EYP A;  4LF9 L;  4DV5 L;  1UUP A;  4EVO A;  3PIP 3;  3HKZ E;  4MHE A;  1JOO A;  4DXF A;  4CDC C;  2MJ8 A;  1Y14 B;  1FYC A;  1Q8I A;  3V2T A;  1D8L A;  2F0S A;  1XTD A;  1HCZ A;  2RCF A;  3H3V I;  3NSW A;  4DF7 A;  3AFQ A;  3EVQ A;  1X65 A;  5CV8 A;  1B3A A;  1UNS A;  2JA8 G;  3T1Y Q;  1V9P A;  1YIJ A;  4JI2 L;  2XTI A;  2K5H A;  1V43 A;  1HTP A;  3M7N A;  2NVX B;  2CVR A;  2Y0S B;  4KKS A;  5T1G A;  3GTJ H;  4JI6 L;  2V4D A;  4A3C G;  2KCM A;  2EQS A;  4CKC A;  4KK7 A;  3AYH B;  2ZJR A;  2R3Z A;  5IYB H;  1TII D;  5GAH C;  2B2T C;  2ATW A;  2R7F A;  4A3K G;  5M3F H;  4DK6 C;  1C8C A;  2B2U C;  4PZ8 A;  1QCB D;  4LF9 Q;  4DV5 Q;  3MFG A;  4A3F B;  5EAY A;  5C4J B;  1A2U A;  3A5U A;  2K01 A;  2D0P A;  3S15 H;  4FF3 A;  5C4X G;  2JJQ A;  5C5L A;  4CKE A;  4XYO A;  5IGB A;  1TWA B;  4DXG A;  1G6Z A;  2CQO A;  3WDN A;  2AQ3 B;  4RAU C;  3RZD H;  1SAP A;  1I4X A;  4JI4 L;  4A3G H;  4H0L C;  3F8T A;  4AYB G;  3Q8D A;  5IIF A;  2RQX A;  1DOK A;  2F3I A;  1FGU A;  2K1B A;  4JI2 Q;  5CV6 A;  3I4M G;  2Q8T A;  1SE2 A;  1E7Z A;  3A8K E;  4IUU A;  2PZT A;  2Z8L A;  4KY5 A;  3D6W A;  4QCL A;  1AEX A;  5JPN C;  1D2B A;  4UDU C;  4XTC S;  4JI6 Q;  1DGS A;  1RTO A;  1SXT A;  5D3D A;  2ASB A;  1B44 D;  3ER0 A;  3ULL A;  5CBE E;  1STG A;  4YHH L;  1HJP A;  4CDD C;  3CU7 A;  2VY3 A;  3NP8 A;  1RD9 D;  1KRS A;  1PH1 A;  1PFN A;  2L1B A;  4CDE C;  2L12 A;  4BBR H;  3F2B A;  4MTK A;  3JAM c;  4Y7N B;  1V1P B;  3S17 H;  5FLM G;  1HNW L;  3GDE A;  3J80 E;  1OTC A;  3UE0 A;  2JE6 I;  4HED A;  2MPM A;  2E74 C;  4LAA A;  1SYB A;  3E5S A;  1YJW A;  4IUQ A;  2JA5 H;  1H9M A;  1EIG A;  5M3M G;  3FKI G;  3T4A C;  3HOZ B;  2F0Q A;  4BBS H;  3AFP A;  1NCV A;  1V8Q A;  3D4R A;  2XSC A;  3QB3 A;  1LT3 D;  5FO7 B;  2VXW A;  5GAD C;  2NVT H;  2DJF C;  5COR A;  3MTS A;  4JI4 Q;  1S5C D;  1Z9F A;  4POG A;  2K5D A;  1HPC A;  2Z6K A;  4GKJ L;  4ZKC B;  1PH5 A;  3TN2 A;  1TVX A;  1EY5 A;  4U67 3;  2NUC A;  2GVB A;  1GUG A;  1I4Q A;  4JG2 A;  1L0Y B;  4PQX A;  2PMZ B;  2KJX A;  4DNI A;  4B3R L;  1KRT A;  1Y8P B;  1J5E L;  2F0K A;  1FNV A;  1WTP A;  2NZ1 D;  4FNF A;  4A3J G;  2FMM A;  4HIK A;  5J3B A;  2IHE A;  1HNW Q;  4IPH A;  4DV1 L;  3DWQ A;  1CM9 A;  2KHS A;  1D6E C;  1JR0 D;  4A3B G;  5IYD G;  4JCV E;  4DR1 L;  1TU2 B;  5BN4 A;  1I4R A;  1K8G A;  2VUM H;  2NN6 I;  1XPR A;  3P7J A;  4C1N K;  2VS1 A;  4KMU C;  1RL2 A;  1QE6 A;  2Q2I A;  1VS0 A;  1IHZ A;  2SNS A;  3HZX A;  1LTI D;  1YNJ D;  2XWJ B;  1ILP A;  1HH2 P;  2N49 A;  4C3I G;  4MTN A;  1E24 A;  1PH6 A;  2HDM A;  4A3I H;  3EJI A;  1IYJ B;  1KNA A;  1N9W A;  4DV6 L;  4OGQ C;  5F2D A;  1JJG A;  1CTM A;  3M4Y A;  1NR4 A;  1TWC B;  4GKJ Q;  4K14 A;  4LJZ C;  2YU9 B;  1KTK A;  4A93 H;  1EFI D;  1EQR A;  3SEB A;  1Y1W B;  1I94 L;  5E4W C;  3GTL B;  3PO3 H;  2RA4 A;  3G6E A;  1TKW B;  4B3R Q;  4A76 A;  1J5E Q;  1VQ9 A;  5G3L F;  1PH4 A;  2OQK A;  2QDB A;  3EA6 A;  3JC6 6;  1SMY D;  1VF7 A;  5FLX L;  4R8I A;  3BVM A;  2M9V A;  1QUQ A;  2NVX H;  1MGS A;  2F0G A;  4GS3 A;  2AMC B;  4DV1 Q;  1Q1E A;  4KKT A;  1X32 A;  4B08 A;  5M5Y H;  1GOZ A;  1Q46 A;  2E2D C;  1JWS D;  4CGY B;  3NEL A;  2VB2 X;  4WRD A;  1JOR A;  2RDH A;  4DU9 A;  4RGO S;  4J1M A;  4P74 A;  3S24 A;  2Y0S E;  1HZB A;  2NTS A;  3W3A A;  3ZYY X;  4RKL A;  4M8A A;  3M4O H;  4DV6 Q;  1VQB A;  4QF4 A;  3K59 A;  1NAP A;  3ZJY C;  1WTR A;  1VQM A;  1IBL Q;  4JBJ A;  2SDF A;  2MO1 A;  1UE5 A;  2IW3 A;  1SE8 A;  2FMC A;  1I94 Q;  1CFM A;  4KY7 A;  3NBH A;  4RKB A;  2JA6 H;  1TXY A;  3CRL C;  4DUY Q;  1PRT F;  4QIW B;  3BZC A;  1G51 A;  1GVP A;  5IP9 G;  4KI0 A;  1YHB A;  3I2Z A;  1N36 L;  4IFD H;  1ZEQ X;  5COY A;  3VA7 A;  2BE5 C;  1F2Y A;  5DM6 3;  2KCN A;  1CT1 D;  5HGQ A;  3S1N B;  2PYK A;  5IGE A;  1EYD A;  3ULJ A;  1V1Q A;  2PW5 A;  3ERO A;  4YCV A;  5FO8 B;  2KCT A;  4GOP A;  1PVO A;  2JQO A;  5C3E B;  3HOX G;  2A5H A;  3I4L A;  3TEH B;  4X3K A;  1LTG D;  3K80 C;  3HOW G;  3HEJ A;  1MSG A;  1FVI A;  4R8N A;  2CW0 C;  2BH2 A;  1SN8 A;  2R7Z H;  3TS0 A;  2K5Q A;  2C35 B;  3CCQ A;  3NTH A;  3CPW A;  4K5V A;  1VQO A;  1R9T H;  3M4P A;  2WKC A;  4DAM A;  3I4N B;  2RHQ B;  3CKI B;  4OHJ A;  4DR6 L;  2RSO A;  5C44 G;  3U9O A;  2VW9 A;  5DNF A;  1U4P A;  3HOZ H;  5IT9 c;  1YI2 A;  4KHP Q;  3CC4 A;  1DJR D;  1KLU D;  3H0G G;  4UY8 C;  3SXH A;  3J7Y W;  3GTO H;  3R93 A;  1TWH B;  2EXD A;  1HA6 A;  1N36 Q;  4LFB L;  4P73 A;  3TZD A;  2WKD A;  1SBB B;  4EQ5 A;  2KHJ A;  3KLS A;  2KED A;  3GQB A;  1K8M A;  3I91 A;  3S9W A;  5JPM C;  2EJG C;  1VQC A;  5ELE A;  2UXC L;  1S5D D;  4KD3 A;  4X3S A;  4BWG B;  3JAM L;  3SE0 A;  1EY7 A;  4A3D G;  5FJ8 G;  4LK1 C;  2NB0 A;  3I8Z A;  1UE7 A;  4ME5 A;  1QNK A;  2F1M A;  3B6Y A;  1PV4 A;  1IBK L;  2X69 A;  1EYG A;  3GTM B;  3QJY A;  1S72 A;  3J81 L;  2PMZ E;  4TQU S;  3EIV A;  4ME3 A;  2Q2U A;  2NWG A;  3H94 A;  4LFA L;  4BA2 I;  2NYZ D;  2WB1 B;  4DR6 Q;  2JA7 B;  3HOU B;  2K52 A;  2XRS D;  5EKK A;  5IE8 A;  2O5J C;  2QEX A;  2E76 C;  4PZ6 A;  5J39 A;  1LT5 D;  3K5N A;  1Q12 A;  3C3L A;  2RHS B;  1BQQ T;  4YCW A;  1EU3 A;  1TT2 A;  1K73 C;  3GTG H;  1LTA D;  3RLF A;  4JI1 L;  4DAY B;  3D4D A;  2F0W A;  3RMH A;  4BY1 B;  1YNN D;  4V19 0;  2MQH A;  4ILW A;  4LFB Q;  1TWC H;  4GNX B;  4HJ9 A;  2YU9 H;  2K05 A;  1SYE A;  4LUV A;  4X3T A;  2OF1 A;  4G4K A;  5IGC A;  1Y1W H;  2RDG A;  3DWA A;  1M1K C;  2ES2 A;  1YJN A;  1XNR L;  1BBW A;  4RHS A;  2RCN A;  4H44 C;  2AQ2 B;  3VYT A;  3HOV H;  3I4O A;  4WJ4 A;  3R2T A;  2UXC Q;  1N34 L;  4S3S A;  2XWB B;  3CC2 A;  4I65 A;  2Q2H A;  1XMQ L;  2ICE C;  1SRO A;  4HJ8 A;  1IBK Q;  2R92 H;  1I6V C;  1I5F A;  2B2W C;  5ELO A;  1KDB A;  4FVM A;  2HT1 A;  2NVQ B;  1C4Q A;  1HZA A;  4O1N A;  4K0K L;  4LFA Q;  2R61 A;  4A3F G;  3HOY G;  1VQL A;  4JBK A;  3GTJ B;  1PYB A;  4DN4 M;  1KQS A;  2PNR C;  5H1S E;  3CPF A;  4X64 L;  3ULP A;  2GVA A;  3MHB A;  1JJC B;  2VQF L;  4DR4 L;  4JI1 Q;  4OEL B;  1A2T A;  1VQN A;  5M3F B;  2MUY A;  3CAM A;  5ELD A;  3DXJ C;  1PZJ D;  2PQE A;  3CHB D;  3P1H A;  3KBX A;  5JJK A;  2IWH A;  2JA8 H;  3MEF A;  4ZUI A;  1AW7 A;  5IYC G;  2F3W A;  4BS9 A;  1XNR Q;  5C6A A;  4G7H C;  2LFN A;  3S15 B;  5AJ3 L;  3ONA B;  5A2Q L;  1N34 Q;  1JWM D;  3PMF A;  1A62 A;  5EKL A;  1X3F A;  1EQQ A;  2EY6 A;  1BBU A;  1XMQ Q;  2D9U A;  1GUS A;  1NUC A;  3SK6 A;  1EQT A;  5FO9 B;  4H13 C;  4A3G B;  3BVG A;  2HCC A;  4ZKB B;  2HDL A;  1YHA A;  4JI8 L;  2K5W A;  4QIW E;  4UP7 A;  4A3E G;  4A3K H;  2QGQ A;  4K0K Q;  4FDB A;  3K5M A;  1AFP A;  1IBM L;  3K81 C;  1WI5 A;  2A8V A;  1ZYR D;  4L63 B;  4TSS A;  4XQQ A;  4F88 A;  2WIN B;  4X64 Q;  3IKJ A;  2MFI A;  2VQF Q;  5DLQ E;  4DK0 A;  4DR4 Q;  5LL6 S;  4DKA C;  3M7G A;  5C4H A;  1IKM A;  1NMF A;  1NBW A;  4BBR B;  1LT6 D;  2B63 B;  5EJW A;  1XXG A;  1D1I A;  1PH2 A;  1SJH D;  3S17 B;  2A68 D;  4NXM L;  2MO0 A;  4FXK C;  1WTH A;  4RWS C;  3CC7 A;  2KEE A;  1N33 Q;  1CHP D;  3GTK B;  2JA5 B;  3TP7 A;  2L9H A;  3VR6 A;  5AJ3 Q;  2UUA L;  3L9A X;  3V05 A;  3D6C A;  1L1O B;  2YTY A;  3DWP A;  4RMF A;  3SR1 A;  3E9H A;  2IX1 A;  4YWK A;  1BCP D;  2NVT B;  4RH6 A;  1YNJ C;  3ND8 A;  2Z0S A;  1B50 A;  4JI8 Q;  3QO2 A;  4YCU A;  2OCE A;  5IGD A;  3KBG A;  1OXT A;  2G9D A;  3P75 A;  5I2Y A;  3NXW A;  3SK5 A;  1IBM Q;  2Z1C A;  2GA4 B;  4EQP A;  5LMU Q;  3OPO A;  4K6L A;  5KIX A;  3OTO L;  4FF1 A;  1EY9 A;  3A74 A;  1LTL A;  1VQ8 A;  1ET6 A;  5M3M H;  1O78 A;  5CV9 A;  3NPP A;  2EIF A;  5EBD A;  5DAU A;  1W3S A;  5FLX c;  1B2T A;  3MZ5 A;  2QF7 A;  1A3T A;  1K0S A;  5C0X I;  1MHW C;  1NJI C;  2VUM B;  1XWE A;  3W1G A;  4IJL A;  1WCM B;  2ICI A;  4C3J G;  2UUA Q;  4DK1 A;  2EYM A;  4PV1 C;  1S4Z A;  2WB1 E;  2L55 A;  3BDC A;  2OXP A;  3Q6S A;  3U9S A;  5C5M A;  1BDO A;  3S2H H;  1Z47 A;  4A3I B;  4L8J A;  1GHK A;  4LUO A;  1JIC A;  3EQL C;  3R2I A;  3Q0A A;  4HID A;  5BN3 A;  4A3J H;  2VNU D;  5CMD A;  1CI3 M;  2BCO A;  3A7L A;  4P72 A;  4A93 B;  4IPD A;  3CP0 A;  5EBC A;  1VQG A;  1E2V A;  1EQV A;  2FFK B;  1Y1V G;  3G6J B;  3MFY A;  3PGZ A;  3PO3 B;  4A3B H;  2JN4 A;  4F8M A;  5IYD H;  3OTO Q;  3LWE A;  5CGK A;  1C7Y A;  5GAG C;  1HZ9 A;  2NVQ H;  4L6T B;  2OWO A;  3LX0 A;  3R8B A;  2EOT A;  4GNX C;  1PMR A;  4HIO A;  4PNY A;  4NP5 A;  1ZKO A;  3IL8 A;  3BJU A;  4QB4 A;  1TWG H;  1B1Z A;  1YEZ A;  5M5Y B;  3I70 A;  1TS2 A;  1EOV A;  1PDQ A;  2HUG A;  4KLK A;  4RA8 A;  1YIT A;  2ZJP A;  2UXB L;  1F2Z A;  3NWT A;  4ZUJ A;  1PH7 A;  2ZM6 L;  3TBI B;  3KLS X;  3HRZ C;  2EY2 A;  2HQE A;  3QOL A;  1Q81 C;  2CFM A;  2K14 A;  3RLO A;  4E6I A;  1K28 A;  4K2L A;  3M4O B;  4IFD I;  4DV3 L;  5KYL A;  3PIO 3;  4A3M G;  4XQJ A;  4IUR A;  3G71 A;  1WTX A;  1IKL A;  3OMG A;  2DNE A;  2QEJ C;  4CKB A;  1L2F A;  1VF5 C;  2NVY H;  2C5C A;  1STY A;  1F2M A;  3L3O C;  2JA9 A;  1IL2 A;  4HCS A;  1VQF A;  4TKO B;  3J80 L;  4GKK L;  5KNB A;  2JA6 B;  4FXG C;  5M5X H;  3MXU A;  5JOB A;  2DY8 A;  4ODG A;  1SFO B;  1VQP A;  1XTC D;  2NTT A;  3GO5 A;  4C56 C;  1J6Q A;  1FL0 A;  1UEB A;  3D8G A;  4GOP C;  4IPC A;  1ML0 D;  3I72 A;  1EIY B;  1XPU A;  2I5L X;  3FEW X;  5J1Z A;  1EWH A;  1SR3 A;  3U4V A;  5ISR A;  1ENC A;  3KJP A;  1BUV T;  2B2V C;  2ZM6 Q;  2B63 H;  4O42 A;  3H09 A;  4BXX G;  5K5P A;  2AUK A;  2IX3 A;  2M00 A;  2PQA A;  2R7Z B;  4G7Z C;  2WP8 J;  1I6H H;  2IPK D;  4DV3 Q;  1JCK B;  1R9T B;  1SYF A;  5IP9 H;  2FJ2 A;  3J81 c;  4G57 A;  5JEA H;  3GTK H;  3PIP A;  3GTQ H;  4GN5 A;  3RN5 A;  1WTO A;  3S14 H;  3JAM i;  3GP7 A;  3PV0 A;  1ENA A;  4MN3 A;  2OTJ A;  1EIH A;  2F3V A;  2WAQ G;  5CYU A;  1EOT A;  4ZAI A;  5CV5 A;  2LXJ A;  1CKM A;  2PNH A;  2F4V L;  4IZ8 A;  2VQE L;  3GTO B;  3STB D;  2EJM A;  1X6O A;  1KDC A;  2E5L L;  1TY2 A;  2RDF A;  2X6L A;  4HJA A;  2A19 A;  1NE3 A;  3KF8 B;  4P75 A;  4G7O C;  1SRU A;  2KHI A;  2F0O A;  4OO1 G;  1YNN C;  5C3X A;  4BY7 G;  4I7A A;  1EZ6 A;  3FPP A;  4PG3 A;  4IQZ A;  3URY A;  1PTO D;  4RGT A;  4YHH Q;  3CD6 A;  2Z9H A;  2GN5 A;  2Z4H A;  3HKZ G;  1L1O C;  3CCL A;  5C44 H;  3KOJ A;  3E9I A;  4IOA A;  1PYS B;  1FNU A;  4ZRZ A;  4A3L G;  1Q1B A;  2R93 B;  2UU9 L;  4BY1 G;  3H0G H;  2CWP A;  1VMP A;  2SEB D;  1XYI A;  3IAY A;  5AFW A;  5I6W A;  4HSP A;  3VYU A;  1RIP A;  1JE4 A;  1WCM H;  3MWY W;  1JOK A;  4QY7 A;  1VQK A;  1J9O A;  3DLL A;  2K75 A;  5HY6 A;  2L11 A;  1CA6 A;  4QQB X;  3GTG B;  2VQE Q;  1E2Z A;  2M2L A;  4XIG S;  2NZO A;  2E5L Q;  1SND A;  5C0X H;  4X6A H;  2ID0 A;  1EY8 A;  3ERS X;  4A4I A;  1OXX K;  1M8A A;  4K8J A;  2BOS A;  2DGY A;  1NSN S;  4UHV A;  2E2H H;  2O5I C;  3OMC A;  1RDP D;  2OEO A;  4C1N I;  2LXK A;  1STA A;  3AB9 A;  3KYH C;  4AQY L;  4LMQ D;  4R1J A;  1M4V A;  3HOV B;  1KAW A;  1XX8 A;  1BOS A;  4JI5 L;  2MNA A;  4HN7 A;  1QNU A;  2SOB A;  4NXN L;  3CQZ H;  2HHH L;  5IYB G;  3KJO A;  2PI2 A;  3W5O A;  1N32 L;  3CCE A;  1JB7 A;  1ONL A;  2F0D A;  5DM7 3;  1BR9 A;  3UI2 A;  1GXD C;  5E7N A;  3T1H L;  2UU9 Q;  2R92 B;  4JI3 L;  2BDO A;  2IX0 A;  1A8V A;  1I4H A;  1HHV A;  4DR1 Q;  3NTK A;  1BNZ A;  3J7A 5;  3PUX A;  1R4P B;  4DNT B;  4RFB A;  5HUR A;  1A3U A;  5KYI A;  3RR5 A;  1B4O A;  2ZXP A;  1Y69 U;  5M9O A;  2QW7 A;  4IOC A;  1WTV A;  4YY3 L;  1SYD A;  1ZYR C;  2F0H A;  1QWY A;  2Z6B A;  1K3R A;  4EQO A;  3EBE A;  4JK1 C;  4L5R C;  1QVF A;  2JA8 B;  3PCO B;  1Q90 A;  1TWF H;  2EXZ A;  2LS0 1;  5KGU A;  3N52 A;  2B2T A;  4AQY Q;  4UAI A;  2LMC B;  4PMW A;  5JVH 3;  2A68 C;  1SFO H;  3KF6 A;  3K8A A;  1STB A;  3HOY H;  4C3H G;  1AN8 A;  4IUN A;  4QUF A;  2B2U A;  2CQA A;  1KIX A;  4ZLT F;  4NXN Q;  1BKB A;  2HHH Q;  2EYJ A;  2F0I A;  2R7D A;  1HNX L;  2IY5 B;  1H9R A;  1II3 A;  1N32 Q;  3NEM A;  3Q24 A;  5GQO A;  3T1H Q;  2B29 A;  2HCI A;  4OON A;  5GRO A;  3H15 A;  1MJE A;  3PO2 G;  4JI3 Q;  1KNE A;  1GUN A;  2TMP A;  2O2L D;  3DM1 A;  4WOR A;  4A3K B;  1ICW A;  1DOM A;  1A3V A;  1BCP C;  3BDL A;  2O4X A;  1QZG A;  1XNQ L;  4ZK9 B;  3HS0 C;  4X65 L;  2HD3 A;  3CCV A;  3PF4 A;  4OIJ A;  2EYL A;  4C2M H;  2F4I A;  5IYC H;  4JBW A;  3PSI A;  4BBS G;  4JV5 L;  4YY3 Q;  2G9H D;  1ICF B;  1HA5 A;  4CJ0 B;  1VQI A;  2B2Y A;  2Z4I A;  1GHJ A;  2A6H D;  1WTQ A;  4N8X 1;  3T13 A;  1SNC A;  3CCS A;  3BU2 A;  4AYB B;  5E1F A;  4A3E H;  2EJF C;  1RKN A;  3NUC A;  4WJW A;  1PH3 A;  1DYQ A;  3RN2 A;  1HQR D;  3RLN A;  1H9K A;  4UP9 A;  1QB5 D;  1HNX Q;  3WOF A;  3S2D H;  4N9P A;  3DUZ A;  1B3Q A;  3K5O A;  3C1E A;  3K7U C;  4OXP A;  4ZYS A;  4DK3 C;  1XNQ Q;  2PO4 A;  3H6M A;  4X65 Q;  3QWN A;  4H7B A;  3CF5 A;  1CSQ A;  3KLW A;  4UP8 A;  1TS4 A;  2R93 H;  5BR8 L;  3RZO H;  1H9S A;  5KRU A;  4ZQ3 A;  2F0V A;  4JV5 Q;  1LTR D;  4MNO A;  1LM0 A;  5M3M B;  2CH4 W;  3FKI B;  1KLG D;  4M1U B;  4HCE A;  4EX5 A;  3VYS A;  3T56 B;  1JT8 A;  3F2D A;  1SSO A;  5IP7 H;  5FK9 C;  2YYZ A;  3ERQ A;  1NR2 A;  1S5F D;  2E8G A;  3KLR A;  1QUQ B;  2BDN A;  1Q82 C;  4FF2 A;  3PO3 G;  1PFB A;  1Y8O B;  1Z6H A;  2DN8 A;  1IYU A;  2K6A A;  2TSS A;  4GLA C;  3S2H B;  2MGS A;  2L15 A;  4XT1 B;  2MHV A;  4PMC A;  4A3J B;  2Y0S G;  3TDQ A;  1DD2 A;  5G3L D;  4V0B A;  3J7A V;  2CCZ A;  3L2P A;  5FKA C;  1U4M A;  1UWV A;  4DGZ A;  1VQJ A;  2K4K A;  4DV2 L;  1X54 A;  4A3B B;  5BR8 Q;  3C46 A;  2DY7 A;  5HGT A;  1T9H A;  3PQI A;  5CBA E;  3J80 c;  4GN4 B;  4C3J H;  3AMU A;  2KCC A;  1ILQ A;  5D65 A;  1MI2 A;  3NBH B;  3M9B A;  3IFT A;  2CH4 A;  1YHQ A;  4PMB A;  1HR0 W;  1UE6 A;  3C2P A;  2JSO A;  4EQN A;  4GZY C;  2KEN A;  1TWG B;  4GLV B;  3OW7 A;  1EYC A;  3GD7 A;  1Q7Y C;  4R9W A;  2A69 D;  2KQ3 A;  2BH8 A;  3BYT B;  4B3T L;  2FXQ A;  3PF5 A;  5I9O A;  4GOP B;  1LT4 D;  1WD0 A;  1LUZ A;  1MSH A;  1HRJ A;  1O7Z A;  3WWV A;  4NKL A;  5EKI A;  3GTP H;  1T5E A;  1OXS C;  1S40 A;  1PRT D;  3AEV A;  5A35 A;  4P71 A;  3KK7 A;  1CZW A;  1CKN B;  2NVY B;  4H02 A;  3TRE A;  1C9O A;  4A3C H;  1B9M A;  1EY0 A;  1GM5 A;  1MBY A;  3W2D A;  5EPL A;  1BBX C;  1UE1 A;  4DV2 Q;  1PTO H;  5M5X B;  3PUV A;  3F1Z A;  4TVA B;  4HJ7 A;  1KC8 C;  3HG9 A;  1X56 A;  1MJC A;  4LF4 L;  3EFX D;  1VQH A;  3NWS A;  3SDZ A;  2E2I H;  3STB C;  4MZ9 A;  1LAC A;  1HXY D;  3K6O A;  4OEM B;  1I50 B;  1UAP A;  3IRB A;  1ET9 A;  2OQ0 A;  4R4O A;  1W6K A;  3HOZ G;  4NMZ A;  5C4X H;  1SMX A;  2P5Z X;  5D3I B;  2WV6 D;  5C3W A;  3DEP A;  2E75 C;  4AH6 A;  5T1I A;  1KAA A;  3A8J E;  1PTO C;  2I0Q A;  3NEN A;  4F87 A;  4OWT B;  1U9R A;  1QG7 A;  4FXD A;  1FGB D;  1I6H B;  4RG1 A;  4RGM A;  4LFC L;  4B9X A;  1XMO L;  2L0C A;  3HFZ B;  1STH A;  3GTQ B;  1X3Q A;  2D0O A;  4P2C B;  1G29 1;  1W2B A;  3S14 B;  3I4M H;  1JJ2 A;  4IUT A;  1BXT A;  5LMN L;  1IW7 D;  4J15 A;  1EWI A;  4NPS A;  4Y52 H;  3UDI A;  3G7L A;  4JOI A;  4YWL A;  3VR2 A;  2Z6K C;  5KND A;  1FNW A;  1PZI D;  3HOX B;  2AHO B;  1S3O A;  4POF A;  3K5L A;  4AYB E;  3CCU A;  1E3P A;  1PFM A;  3H91 A;  4LF4 Q;  4ABN A;  4ULL A;  5FLM H;  1EY6 A;  3FPU B;  5M5W H;  5J22 A;  2LKV A;  3NE5 B;  2L4N A;  4QGU A;  1JQY D;  1QIL A;  1SE4 A;  1X3P A;  1WVL A;  3C1F A;  1KD1 C;  1V1P A;  5C44 B;  1DZ1 A;  3FKI H;  1DOL A;  3QG1 A;  4NXM Q;  3H0G B;  4LF6 L;  3SVM A;  5TSS A;  2F03 A;  1SYG A;  2J0T D;  4RGN A;  4L5S A;  4LFC Q;  5K36 G;  4NW2 A;  1CQV A;  2NN6 G;  1XMO Q;  4R4I A;  2A73 B;  1Y1W G;  2J7Z A;  3T1Y L;  4K2K A;  1QZH A;  3K7A H;  1FD7 D;  3IFD A;  5LMN Q;  5IOC A;  1ENF A;  1LTT D;  3A0J A;  4OO1 H;  1LAB A;  3VR4 A;  4LNQ A;  3HGB A;  4BY7 H;  2Q8I B;  1LTB D;  2JP1 A;  4DR5 L;  1PH8 A;  2HIX A;  4MIU A;  1A63 A;  5IGG A;  1O7Y A;  3OYY A;  4DV4 L;  4A3D B;  3SK4 A;  4CDF C;  1TQO A;  5I4D A;  4ZCK A;  2XN9 C;  4A3L H;  1D5X C;  2I07 B;  2E2H B;  3A54 A;  1QVG A;  2V1C C;  5GAE C;  1SNO A;  3OWF A;  4HMJ A;  2EVB A;  3FVQ A;  1VQA A;  3A7A B;  4DPG A;  4A75 A;  4DAV A;  2Q8R E;  4R4T A;  5EGT A;  4X62 L;  2OTL A;  5ELF A;  2FIN B;  1B7Y B;  4FO2 A;  3Q23 A;  4OWX B;  1H9J A;  1U5K A;  5ELC A;  1W6J A;  3CQZ B;  1EY4 A;  3LNN A;  2MP1 A;  2NZH A;  2B8G A;  3CCM A;  3MXN B;  1EEF D;  5EQ0 A;  2XRQ D;  1H95 A;  4C3I H;  2ALY B;  5IT9 E;  3I90 A;  4LF6 Q;  2E2J H;  3D0F A;  3L7Z C;  1X3E A;  1WYD A;  4R4Q A;  3QR8 A;  2XGT A;  4ID6 A;  1GKH A;  2YV5 A;  3LWU A;  3RD4 A;  5I6Y A;  1FJG L;  2F0J A;  2B2W A;  1SEB D;  2RSN A;  4DR5 Q;  1MIU A;  4DV4 Q;  3LGJ A;  3T53 B;  4LF7 L;  1Q3L A;  1BCP B;  5KEE A;  1JWU D;  2K03 A;  5JEA J;  2AUJ D;  5C3E G;  5JAV A;  4LUZ A;  1F9Q A;  1TWF B;  1X55 A;  2PZU A;  2A6H C;  1C48 A;  4B3S L;  4DA2 A;  3CME A;  4X62 Q;  4LF5 L;  3KFU A;  3HOY B;  3S1M H;  2N8N A;  2A1A A;  3M3Y H;  4WFN 3;  4KJN A;  4KN4 C;  1PH9 A;  4XYQ A;  4QMG A;  1ESR A;  5NUC A;  3I4N G;  2QKI C;  1I50 H;  4B9W A;  5DEH A;  2UXB Q;  1L0W A;  1V1O A;  3KDF B;  4KHZ A;  3X3N A;  1KAB A;  4FF4 A;  2K7V A;  4C2M B;  1FJG Q;  4N8F A;  1F9S A;  1EFW A;  3MC0 B;  1K83 H;  3UDX A;  1CUK A;  1DM0 B;  2B2Y C;  1ESF A;  1AP0 A;  1K9M C;  4HIM A;  4DFA A;  4WJ3 M;  4C3H H;  1Y8N B;  1IZ6 A;  2AWO A;  2PCF B;  4LF7 Q;  4JI7 L;  1CQF A;  2SNM A;  3I55 A;  1U4R A;  2ZJQ A;  1VMC A;  3PO2 H;  3AQQ A;  4GKK Q;  3DHQ A;  1F9R A;  1AE3 A;  3J81 i;  4B3S Q;  3G48 A;  5IWA L;  4A3E B;  3HOX H;  1K0R A;  4LF5 Q;  1GD7 A;  5D14 A;  1PFS A;  3OWE B;  3MAQ A;  3HOW H;  2QCP X;  2F0N A;  2UXD L;  2CWA A;  4KHV A;  2YTX A;  5C0X J;  3S2D B;  1MD2 D;  3T16 A;  5LMN W;  1EUJ A;  3MXG A;  4LW1 A;  4CJ1 B;  2WB1 G;  2JA7 G;  4ALP A;  2ZT9 C;  1PYW D;  3HOU G;  1A15 A;  3S16 H;  4RHR A;  1VDZ A;  1O7L A;  2OT2 A;  3BZD B;  1F77 A;  2F0L A;  3OSO A;  1DXM A;  1C0A A;  1E0B A;  1G91 A;  3ICE A;  2DUD A;  3RZO B;  2A6E C;  1G2T A;  1E1O A;  3TRZ A;  5FOB B;  4CBV A;  4XQN A;  2D5D A;  3PIO A;  5BN5 A;  4IO9 A;  4KD4 A;  1HFN A;  3U4Z A;  4JI7 Q;  5KNC A;  2Q2T A;  4K8I A;  4OWW B;  2F4V Q;  2WAC A;  1T5X D;  5JJI A;  5IWA Q;  3FRP B;  3AU7 A;  3DEO A;  3NTI A;  1CKO A;  2B3G A;  1F9P A;  4A3D H;  2ZTD A;  5FJ8 H;  1RCV D;  4KTA A;  1I3Q H;  2F0P A;  2UXD Q;  3R3O A;  2WFW A;  2HQL A;  4GN3 B;  3RNU A;  2A69 C;  3DM3 A;  2F0U A;  2BA0 A;  3RUZ A;  1TS5 A;  2JEB I;  1TY0 A;  1G8Z D;  1YJ9 A;  1HR0 L;  3OHX C;  3D31 A;  3VR3 A;  1G6P A;  1CZG A;  4HAE A;  1IBL L;  1PRT C;  2I46 A;  1OO9 B;  4IFD J;  1XJV A;  1RTN A;  4CHT B;  2VZA A;  1YBY A;  5M3F G;  1BVS A;  1K8A C;  4C3J B;  4IJH A;  4DUY L;  1F2L A;  4YWM A;  1WFQ A;  4O2D A;  1WTW A;  2K33 A;  2K5V A;  4TRD A;  1EYA A;  3QIA A;  2LSS A;  2KOL A;  1ZXT A;  3NK9 A;  4DAY A;  4HR7 B; 
#chains in the Genus database with same CATH homology
 1EL0 A;  3KUP A;  1RHP A;  2H4O A;  1GUW A;  2JYO A;  4X3U A;  3VYR A;  4K5W A;  1JC7 A;  3NQI A;  1Y1V B;  3D3R A;  4IAL A;  3TP6 A;  4K5X A;  2F0M A;  3GTP B;  1J8I A;  4F7X A;  1DON A;  1HTL D;  1O80 A;  5FLX E;  5EPK A;  4KN7 C;  4HMI A;  4DAP A;  1PTO B;  3ND9 A;  4K6D A;  1HQM C;  1IW7 C;  1Z7T A;  2K04 A;  3X3M A;  3H3V C;  2E2I B;  2F0F A;  2C9O A;  4QUC A;  3GV3 A;  1EU4 A;  5JEA G;  1L0X B;  3S1Q B;  4A3M B;  4Q0F A;  2PPB C;  4XT3 B;  4DNR B;  2BA1 A;  3O13 A;  4KJO A;  5C4X B;  3F2U A;  3WOE A;  2LY7 A;  1EWC A;  3VA5 A;  2EE1 A;  1PXU A;  1CK1 A;  2B2V A;  2KA7 A;  5JJZ A;  1LTS D;  3I4M B;  5LL6 X;  1QJO A;  2F0T A;  4RCO A;  2N55 A;  1E2W A;  3E6Z X;  1U4L A;  1BF4 A;  2D2C C;  2K32 A;  1OXV A;  3T51 B;  1OXU A;  2DNC A;  3CRK C;  4KY6 A;  5M5W B;  1IL8 A;  1GUT A;  1KDA A;  4RCN A;  2K28 A;  2IL8 A;  1LLR D;  4FP5 D;  1STE A;  1BCP F;  1D1K A;  4I7Z C;  3BVZ A;  1SNP A;  3HP3 A;  3J7A F;  4OO1 I;  1TS3 A;  2WAQ B;  2ZXO A;  5C0X G;  1TR5 A;  2EYF A;  1SJE D;  5CV4 A;  1B53 A;  5E4X A;  1SYC A;  3TME A;  4EGV A;  3K57 A;  3K7A B;  2N88 A;  4N9T A;  1EEI D;  4BY7 B;  1IYV A;  5EPJ A;  3MA2 B;  3HKZ B;  2X6G A;  5C4Z A;  3S1R B;  1FR3 A;  2A6E D;  3OOC A;  1G2S A;  2NBF A;  3JAM E;  2EYH A;  4IN3 A;  1I4P A;  3MVV A;  4KKU A;  5K36 H;  2NN6 H;  2PZW A;  4OIK A;  2IT1 A;  3OIP A;  2VB3 X;  3J81 E;  3BYY B;  2QIL A;  2EY1 A;  4C3I B;  1PZK D;  2E2J B;  2H1E A;  3SK8 A;  2AQ1 B;  3MEH A;  3P20 A;  2JEA I;  1SNM A;  1JB3 A;  3GV6 A;  1SNQ A;  2FHT A;  3A8I E;  3MXP A;  3NQT A;  4IFD G;  1CA5 A;  1S5E D;  1STN A;  3TZU A;  1GJX A;  4J6H A;  3PUW A;  1RF2 D;  1LV9 A;  1AZP A;  4HSV A;  1HUN A;  5CC4 A;  5IGF A;  3S1M B;  3MXN A;  5E3F A;  3QOJ A;  1HUM A;  3M3Y B;  2J4X A;  3FMC A;  4U68 A;  1SDF A;  1D5Z C;  2XNA C;  1WD1 A;  3TSS A;  1I4G A;  5CR3 A;  3DMU A;  1ROD A;  2KEC A;  5I2X A;  3V96 A;  3RZD B;  3SHL A;  2D62 A;  1K8O A;  3VR5 A;  3TP5 A;  4J8Q A;  1UEA B;  3PUY A;  3K0Y A;  2EYO A;  1A6X A;  1K83 B;  3PUZ A;  1RJT A;  2XIW A;  4XXE A;  2B39 A;  2EPB A;  3NBI A;  3I73 A;  2RVL A;  4C3H B;  2PW7 A;  4Q5V A;  3M85 A;  1H9S B;  1PLF A;  2IJ0 A;  5A2Q E;  1BO0 A;  1SE3 A;  4XDX A;  4FYD A;  3PO2 B;  3I3C A;  4NDX A;  2KVM A;  4IUP A;  5LHY 1;  1S5B D;  3TP8 A;  2BE5 D;  3FDT A;  2RBM A;  3A56 A;  3HOW B;  1EZ8 A;  4Z9C B;  2R6G A;  4BBS B;  3ITP A;  3D4W A;  4CJ2 C;  2ENB A;  2B8F A;  3NHH A;  3BS1 A;  3S16 B;  1DCZ A;  2RKS A;  1JOQ A;  1QOH A;  4OL7 A;  5I9P A;  3OIQ A;  3Q22 A;  2KUM A;  2WII B;  2CW0 D;  5ELB A;  2XVS A;  5IOD A;  4HTH A;  4YIJ A;  2ZXR A;  3BDO A;  1R4Q B;  1D5M C;  2JXM B;  3E0J A;  4IUV A;  1VCI A;  1B9N A;  4BA1 I;  2EZV A;  1HFG A;  3BG3 A;  1PTO F;  3K58 A;  5CV7 A;  1GUO A;  2AWN A;  2L5T A;  1PRT B;  3A55 A;  5IT9 L;  3N6R A;  2A74 C;  1SMY C;  2F0E A;  1I3Q B;  2EDG A;  2CHB D;  3KF8 A;  4KV6 A;  5JVG 3;  1AZQ A;  1CHQ D;  2EY5 A;  1LO5 D;  2EYP A;  1UUP A;  4EVO A;  3PIP 3;  4MHE A;  1JOO A;  4DXF A;  2MJ8 A;  1FYC A;  1Q8I A;  3V2T A;  2F0S A;  1HCZ A;  3NSW A;  4DF7 A;  3EVQ A;  5CV8 A;  1B3A A;  1UNS A;  2NVX B;  3M7N A;  1V43 A;  1HTP A;  2CVR A;  2Y0S B;  4KKS A;  5T1G A;  2V4D A;  4CKC A;  4KK7 A;  2R3Z A;  1TII D;  2B2T C;  1C8C A;  2B2U C;  1QCB D;  3MFG A;  4A3F B;  5C4J B;  1A2U A;  2K01 A;  4FF3 A;  5C5L A;  4CKE A;  4XYO A;  5IGB A;  1TWA B;  4DXG A;  1G6Z A;  3WDN A;  2AQ3 B;  4RAU C;  1SAP A;  1I4X A;  4H0L C;  5IIF A;  2RQX A;  1DOK A;  2K1B A;  5CV6 A;  2Q8T A;  1SE2 A;  4IUU A;  3A8K E;  2PZT A;  2Z8L A;  4KY5 A;  3D6W A;  4QCL A;  1AEX A;  5JPN C;  1D2B A;  4UDU C;  4XTC S;  1RTO A;  1SXT A;  5D3D A;  1B44 D;  5CBE E;  1STG A;  3CU7 A;  3NP8 A;  1RD9 D;  1PFN A;  2L1B A;  2L12 A;  4Y7N B;  1V1P B;  3J80 E;  2JE6 I;  4HED A;  2MPM A;  2E74 C;  4LAA A;  1SYB A;  3E5S A;  4IUQ A;  1H9M A;  1EIG A;  3T4A C;  3HOZ B;  2F0Q A;  1NCV A;  1V8Q A;  3D4R A;  2XSC A;  3QB3 A;  1LT3 D;  5FO7 B;  2VXW A;  5COR A;  3MTS A;  1S5C D;  2K5D A;  1HPC A;  4ZKC B;  3TN2 A;  1TVX A;  1EY5 A;  4U67 3;  2NUC A;  1GUG A;  1I4Q A;  1L0Y B;  4PQX A;  2PMZ B;  2KJX A;  1Y8P B;  2F0K A;  1FNV A;  1WTP A;  2NZ1 D;  4FNF A;  2FMM A;  3DWQ A;  1CM9 A;  2KHS A;  1D6E C;  1JR0 D;  1TU2 B;  5BN4 A;  1I4R A;  2NN6 I;  3P7J A;  4C1N K;  4KMU C;  1QE6 A;  1IHZ A;  2SNS A;  3HZX A;  1LTI D;  1YNJ D;  2XWJ B;  1ILP A;  4C3I G;  2HDM A;  3EJI A;  1KNA A;  4OGQ C;  5F2D A;  1CTM A;  3M4Y A;  1NR4 A;  1TWC B;  4K14 A;  4LJZ C;  2YU9 B;  1KTK A;  1EFI D;  1Y1W B;  3SEB A;  5E4W C;  3GTL B;  2RA4 A;  1TKW B;  5G3L F;  2QDB A;  3EA6 A;  1SMY D;  1VF7 A;  5FLX L;  4R8I A;  3BVM A;  2M9V A;  1MGS A;  2F0G A;  1Q1E A;  4KKT A;  1X32 A;  4B08 A;  1GOZ A;  2E2D C;  1JWS D;  4CGY B;  2VB2 X;  4WRD A;  1JOR A;  2RDH A;  4DU9 A;  4RGO S;  4J1M A;  2NTS A;  3W3A A;  3ZYY X;  4RKL A;  4M8A A;  4QF4 A;  3K59 A;  1NAP A;  1WTR A;  2SDF A;  2IW3 A;  2FMC A;  1CFM A;  4KY7 A;  3NBH A;  4RKB A;  3CRL C;  1PRT F;  4QIW B;  4KI0 A;  4IFD H;  1ZEQ X;  5COY A;  3VA7 A;  2BE5 C;  1F2Y A;  5DM6 3;  2KCN A;  1CT1 D;  3S1N B;  2PYK A;  5IGE A;  1EYD A;  2PW5 A;  3ERO A;  5FO8 B;  5C3E B;  2A5H A;  3I4L A;  4X3K A;  1LTG D;  3HEJ A;  1MSG A;  4R8N A;  2CW0 C;  2K5Q A;  3NTH A;  4K5V A;  2WKC A;  3I4N B;  3CKI B;  4OHJ A;  2RSO A;  3U9O A;  5DNF A;  1U4P A;  1DJR D;  1KLU D;  3SXH A;  3J7Y W;  3R93 A;  1TWH B;  1HA6 A;  3TZD A;  2WKD A;  1SBB B;  3KLS A;  2KED A;  3GQB A;  1K8M A;  3I91 A;  3S9W A;  5JPM C;  2EJG C;  5ELE A;  1S5D D;  4KD3 A;  4X3S A;  4BWG B;  3JAM L;  3SE0 A;  1EY7 A;  4LK1 C;  2NB0 A;  3I8Z A;  4ME5 A;  1QNK A;  2F1M A;  2X69 A;  3GTM B;  3QJY A;  3J81 L;  4TQU S;  2NWG A;  3H94 A;  4BA2 I;  2NYZ D;  2WB1 B;  2JA7 B;  3HOU B;  5EKK A;  2XRS D;  2O5J C;  2E76 C;  3C3L A;  5J39 A;  1LT5 D;  3K5N A;  1Q12 A;  1BQQ T;  1EU3 A;  1TT2 A;  1LTA D;  3RLF A;  3D4D A;  2F0W A;  3RMH A;  4BY1 B;  1YNN D;  4V19 0;  4ILW A;  2K05 A;  1SYE A;  4X3T A;  2OF1 A;  4G4K A;  5IGC A;  2RDG A;  3DWA A;  4RHS A;  4H44 C;  2AQ2 B;  3VYT A;  3R2T A;  4S3S A;  2XWB B;  4I65 A;  2ICE C;  1I6V C;  2B2W C;  1KDB A;  4FVM A;  2NVQ B;  1C4Q A;  4O1N A;  2R61 A;  3GTJ B;  4DN4 M;  2PNR C;  3MHB A;  1A2T A;  5M3F B;  2MUY A;  5ELD A;  3DXJ C;  1PZJ D;  2PQE A;  3CHB D;  3P1H A;  3KBX A;  2IWH A;  4ZUI A;  1AW7 A;  2F3W A;  4BS9 A;  5C6A A;  4G7H C;  2LFN A;  3S15 B;  3ONA B;  5A2Q L;  1JWM D;  3PMF A;  5EKL A;  2EY6 A;  2D9U A;  1GUS A;  1NUC A;  3SK6 A;  1EQT A;  5FO9 B;  4H13 C;  4A3G B;  3BVG A;  2HCC A;  4ZKB B;  2HDL A;  2K5W A;  3K5M A;  1AFP A;  1ZYR D;  4L63 B;  4TSS A;  4XQQ A;  4F88 A;  2WIN B;  3IKJ A;  4DK0 A;  5LL6 S;  5C4H A;  3M7G A;  1IKM A;  4BBR B;  1LT6 D;  2B63 B;  5EJW A;  1XXG A;  1D1I A;  1SJH D;  3S17 B;  2A68 D;  4FXK C;  4RWS C;  2KEE A;  1CHP D;  3GTK B;  2JA5 B;  3TP7 A;  2L9H A;  3VR6 A;  3L9A X;  3V05 A;  3D6C A;  3DWP A;  3SR1 A;  2IX1 A;  1BCP D;  2NVT B;  4RH6 A;  1YNJ C;  3ND8 A;  1B50 A;  3QO2 A;  5IGD A;  3KBG A;  1OXT A;  2G9D A;  3P75 A;  5I2Y A;  3NXW A;  3SK5 A;  2Z1C A;  2GA4 B;  4EQP A;  3OPO A;  4K6L A;  5KIX A;  4FF1 A;  1EY9 A;  1ET6 A;  1O78 A;  5CV9 A;  3NPP A;  5EBD A;  5DAU A;  1B2T A;  3MZ5 A;  2QF7 A;  1A3T A;  5C0X I;  2VUM B;  1XWE A;  1WCM B;  2ICI A;  4C3J G;  4DK1 A;  2EYM A;  4PV1 C;  1S4Z A;  2L55 A;  3BDC A;  2OXP A;  3Q6S A;  3U9S A;  5C5M A;  1BDO A;  1Z47 A;  4A3I B;  4L8J A;  1GHK A;  1JIC A;  3EQL C;  3R2I A;  3Q0A A;  5BN3 A;  2VNU D;  5CMD A;  1CI3 M;  2BCO A;  3A7L A;  4A93 B;  5EBC A;  1E2V A;  1EQV A;  2FFK B;  3G6J B;  3MFY A;  3PO3 B;  4F8M A;  3LWE A;  5CGK A;  4L6T B;  3LX0 A;  3R8B A;  2EOT A;  1PMR A;  4PNY A;  4NP5 A;  1ZKO A;  3IL8 A;  4QB4 A;  1B1Z A;  5M5Y B;  3I70 A;  1TS2 A;  1PDQ A;  2HUG A;  4RA8 A;  1F2Z A;  3NWT A;  4ZUJ A;  3TBI B;  3KLS X;  3HRZ C;  2EY2 A;  2HQE A;  3QOL A;  4E6I A;  4K2L A;  3M4O B;  4IFD I;  5KYL A;  3PIO 3;  4XQJ A;  4IUR A;  1WTX A;  1IKL A;  3OMG A;  2DNE A;  2QEJ C;  4CKB A;  1VF5 C;  2C5C A;  1STY A;  1F2M A;  3L3O C;  4HCS A;  4TKO B;  3J80 L;  5KNB A;  2JA6 B;  4FXG C;  3MXU A;  5JOB A;  2DY8 A;  4ODG A;  1SFO B;  1XTC D;  2NTT A;  3GO5 A;  4C56 C;  3D8G A;  1ML0 D;  3I72 A;  3FEW X;  5J1Z A;  1EWH A;  5ISR A;  1ENC A;  1BUV T;  2B2V C;  4O42 A;  3H09 A;  5K5P A;  2AUK A;  2IX3 A;  2M00 A;  2R7Z B;  4G7Z C;  2WP8 J;  2IPK D;  1JCK B;  1R9T B;  1SYF A;  2FJ2 A;  4G57 A;  5JEA H;  1WTO A;  3GP7 A;  3PV0 A;  1ENA A;  4MN3 A;  1EIH A;  2F3V A;  5CYU A;  1EOT A;  4ZAI A;  5CV5 A;  4IZ8 A;  3GTO B;  2EJM A;  1KDC A;  1TY2 A;  2RDF A;  2X6L A;  4G7O C;  2F0O A;  4OO1 G;  1YNN C;  5C3X A;  1EZ6 A;  3FPP A;  3URY A;  4IQZ A;  1PTO D;  4RGT A;  2Z4H A;  1FNU A;  4ZRZ A;  1Q1B A;  2R93 B;  1VMP A;  2SEB D;  1XYI A;  3IAY A;  5AFW A;  5I6W A;  4HSP A;  3VYU A;  1JE4 A;  3MWY W;  1JOK A;  1J9O A;  2L11 A;  1CA6 A;  3GTG B;  1E2Z A;  2M2L A;  4XIG S;  1SND A;  5C0X H;  2ID0 A;  1EY8 A;  1OXX K;  1M8A A;  4K8J A;  2BOS A;  1NSN S;  2O5I C;  3OMC A;  1RDP D;  2OEO A;  4C1N I;  1STA A;  3AB9 A;  4LMQ D;  1M4V A;  3HOV B;  1XX8 A;  1BOS A;  4HN7 A;  1QNU A;  2SOB A;  1ONL A;  2F0D A;  5DM7 3;  1BR9 A;  3UI2 A;  1GXD C;  2R92 B;  2BDO A;  2IX0 A;  1I4H A;  1HHV A;  3NTK A;  1BNZ A;  3PUX A;  1R4P B;  4DNT B;  4RFB A;  5HUR A;  1A3U A;  5KYI A;  1B4O A;  2ZXP A;  1Y69 U;  5M9O A;  1WTV A;  1SYD A;  1ZYR C;  2F0H A;  1QWY A;  4EQO A;  4JK1 C;  2JA8 B;  1Q90 A;  2EXZ A;  2LS0 1;  5KGU A;  3N52 A;  2B2T A;  4UAI A;  2LMC B;  4PMW A;  5JVH 3;  2A68 C;  1STB A;  4C3H G;  1AN8 A;  4IUN A;  4QUF A;  2B2U A;  2CQA A;  4ZLT F;  2EYJ A;  2F0I A;  1H9R A;  1II3 A;  3Q24 A;  2HCI A;  1KNE A;  1GUN A;  2TMP A;  2O2L D;  3DM1 A;  4WOR A;  4A3K B;  1ICW A;  1DOM A;  1A3V A;  1BCP C;  3BDL A;  2O4X A;  4ZK9 B;  3HS0 C;  4OIJ A;  2EYL A;  2F4I A;  4JBW A;  2G9H D;  1HA5 A;  4CJ0 B;  2Z4I A;  2B2Y A;  1GHJ A;  2A6H D;  1WTQ A;  3T13 A;  1SNC A;  4AYB B;  5E1F A;  2EJF C;  1RKN A;  3NUC A;  4WJW A;  1DYQ A;  1HQR D;  1H9K A;  1QB5 D;  3WOF A;  4N9P A;  3DUZ A;  3K5O A;  3C1E A;  4ZYS A;  2PO4 A;  3H6M A;  3QWN A;  4H7B A;  1TS4 A;  1H9S A;  5KRU A;  4ZQ3 A;  2F0V A;  1LTR D;  5M3M B;  3FKI B;  1KLG D;  4M1U B;  4HCE A;  3VYS A;  3T56 B;  1SSO A;  5FK9 C;  2YYZ A;  3ERQ A;  1NR2 A;  1S5F D;  3KLR A;  2BDN A;  4FF2 A;  1PFB A;  1Y8O B;  1Z6H A;  2DN8 A;  1IYU A;  2K6A A;  2TSS A;  3S2H B;  2MGS A;  4XT1 B;  2MHV A;  4PMC A;  4A3J B;  3TDQ A;  1DD2 A;  5G3L D;  4V0B A;  3J7A V;  5FKA C;  1U4M A;  4DGZ A;  4A3B B;  3C46 A;  2DY7 A;  5HGT A;  5CBA E;  3AMU A;  2KCC A;  1ILQ A;  5D65 A;  1MI2 A;  3IFT A;  4PMB A;  3C2P A;  2JSO A;  4EQN A;  4GZY C;  1TWG B;  3OW7 A;  1EYC A;  3GD7 A;  4R9W A;  2A69 D;  2KQ3 A;  3BYT B;  5I9O A;  1LT4 D;  1WD0 A;  1MSH A;  1HRJ A;  1O7Z A;  4NKL A;  5EKI A;  1T5E A;  1OXS C;  1PRT D;  5A35 A;  3KK7 A;  1CZW A;  2NVY B;  1B9M A;  1EY0 A;  1MBY A;  3W2D A;  5EPL A;  1BBX C;  1PTO H;  5M5X B;  3PUV A;  3HG9 A;  3EFX D;  3NWS A;  3SDZ A;  1LAC A;  1HXY D;  3K6O A;  1I50 B;  1UAP A;  1ET9 A;  1W6K A;  4NMZ A;  5D3I B;  2WV6 D;  5C3W A;  3DEP A;  2E75 C;  5T1I A;  1KAA A;  3A8J E;  1PTO C;  4FXD A;  1I6H B;  4F87 A;  1U9R A;  1QG7 A;  1FGB D;  4RGM A;  4B9X A;  2L0C A;  1STH A;  3GTQ B;  1X3Q A;  4P2C B;  1G29 1;  3S14 B;  4IUT A;  1BXT A;  1IW7 D;  3G7L A;  3VR2 A;  5KND A;  1FNW A;  1PZI D;  3HOX B;  3K5L A;  1PFM A;  3H91 A;  4ABN A;  4ULL A;  1EY6 A;  3FPU B;  5J22 A;  2LKV A;  3NE5 B;  2L4N A;  1JQY D;  1QIL A;  1SE4 A;  1X3P A;  1WVL A;  3C1F A;  1V1P A;  5C44 B;  1DZ1 A;  1DOL A;  3QG1 A;  3H0G B;  3SVM A;  5TSS A;  2F03 A;  1SYG A;  2J0T D;  4RGN A;  5K36 G;  4NW2 A;  1CQV A;  2NN6 G;  2A73 B;  2J7Z A;  4K2K A;  1FD7 D;  3IFD A;  5IOC A;  1ENF A;  1LTT D;  4OO1 H;  1LAB A;  3VR4 A;  3HGB A;  2Q8I B;  1LTB D;  2JP1 A;  4MIU A;  5IGG A;  1O7Y A;  4A3D B;  3SK4 A;  5I4D A;  1TQO A;  2XN9 C;  2E2H B;  1D5X C;  2I07 B;  3A54 A;  1SNO A;  3OWF A;  4HMJ A;  2EVB A;  3FVQ A;  3A7A B;  4DAV A;  2Q8R E;  5EGT A;  5ELF A;  2FIN B;  4FO2 A;  3Q23 A;  1H9J A;  5ELC A;  1W6J A;  3CQZ B;  1EY4 A;  3LNN A;  2MP1 A;  2B8G A;  1EEF D;  5EQ0 A;  2XRQ D;  5IT9 E;  3I90 A;  3L7Z C;  4ID6 A;  3LWU A;  3RD4 A;  5I6Y A;  2F0J A;  2B2W A;  1SEB D;  2RSN A;  3T53 B;  1Q3L A;  1BCP B;  5KEE A;  1JWU D;  2K03 A;  5JEA J;  2AUJ D;  5JAV A;  1F9Q A;  1TWF B;  2PZU A;  2A6H C;  1C48 A;  4DA2 A;  3HOY B;  4WFN 3;  4KJN A;  4KN4 C;  4XYQ A;  4QMG A;  1ESR A;  5NUC A;  2QKI C;  4B9W A;  5DEH A;  1V1O A;  4KHZ A;  3X3N A;  1KAB A;  4FF4 A;  2K7V A;  4C2M B;  1F9S A;  3MC0 B;  1DM0 B;  2B2Y C;  1ESF A;  1AP0 A;  4DFA A;  1Y8N B;  2AWO A;  2PCF B;  1CQF A;  2SNM A;  1U4R A;  1VMC A;  3DHQ A;  1F9R A;  4A3E B;  5D14 A;  3OWE B;  3MAQ A;  2QCP X;  2F0N A;  4KHV A;  5C0X J;  3S2D B;  1MD2 D;  3T16 A;  3MXG A;  4CJ1 B;  2ZT9 C;  1PYW D;  1A15 A;  4RHR A;  1VDZ A;  1O7L A;  2OT2 A;  3BZD B;  1F77 A;  2F0L A;  3OSO A;  1DXM A;  1E0B A;  1G91 A;  3RZO B;  2A6E C;  1G2T A;  5FOB B;  4CBV A;  4XQN A;  2D5D A;  5BN5 A;  4KD4 A;  1HFN A;  5KNC A;  4K8I A;  2WAC A;  1T5X D;  3FRP B;  3AU7 A;  3DEO A;  3NTI A;  1F9P A;  1RCV D;  4KTA A;  2F0P A;  3R3O A;  2A69 C;  2F0U A;  2BA0 A;  3RUZ A;  1TS5 A;  2JEB I;  1TY0 A;  1G8Z D;  3OHX C;  3D31 A;  3VR3 A;  1CZG A;  4HAE A;  1PRT C;  2I46 A;  1OO9 B;  4IFD J;  1RTN A;  4CHT B;  4C3J B;  1F2L A;  1WTW A;  2K33 A;  4TRD A;  1EYA A;  3QIA A;  2KOL A;  1ZXT A;  3NK9 A;  4DAY A;  4HR7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...