1H9JA

Two crystal structures of the cytoplasmic molybdate-binding protein modg suggest a novel cooperative binding mechanism and provide insights into ligand-binding specificity. phosphate-grown form with molybdate and phosphate bound
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
145
structure length
145
Chain Sequence
GSHMKISARNVFKGTVSALKEGAVNAEVDILLGGGDKLAAVVTLESARSLQLAAGKEVVAVVKAPWVLLMTDSSGYRLSARNILTGTVKTIETGAVNAEVTLALQGGTEITSMVTKEAVAELGLKPGASASAVIKASNVILGVPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two Crystal Structures of the Cytoplasmic Molybdate-Binding Protein Modg Suggest a Novel Cooperative Binding Mechanism and Provide Insights Into Ligand-Binding Specificity
pubmed doi rcsb
source organism Azotobacter vinelandii
molecule tags Binding protein
molecule keywords MOLYBDENUM-BINDING-PROTEIN
total genus 27
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2001-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03459 TOBE TOBE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1h9jA02
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1h9jA01
1H9RA 1IW7C 2A68C 3D31A 3OOCA 4RCNA 2PNRC 1H9SA 3ND8A 3T51B 5K36H 1YNJC 3GQBA 1CI3M 3T53B 1SMYC 3VR6A 2B8GA 2BA1A 4LK1C 3T56B 1CTMA 1ZKOA 3MXUA 2ZT9C 4G7HC 1HTPA 4KN4C 2BE5C 1HCZA 5KNBA 1GHJA 2NN6H 1IYUA 1LACA 2A69C 1LABA 2EJMA 4XTCS 4I7ZC 1GUNA 4XIGS 2R6GA 3M85A 2F1MA 2NN6G 5C0XH 1TKWB 2AUJD 3PUXA 4DNTB 1V8QA 5BN3A 3EQLC 2A68D 4DNRB 1PMRA 3OW7A 1HQMC 3LNNA 2B8FA 1Q1BA 1K8OA 1Q1EA 1Z6HA 5JEAG 4KMUC 3PUZA 1OXVA 2EJGC 3LWUA 4H13C 4BA1I 2DN8A 1E2ZA 3A7AB 3HGBA 2K7VA 1CFMA 2D2CC 2BDOA 1K8MA 3I72A 1BDOA 1E2VA 3W3AA 3RLFA 3DXJC 2V4DA 1VF7A 1DCZA 2AUKA 4PV1C 3VR2A 5JEAH 1QJOA 2IT1A 2Q8IB 2NN6I 4HR7B 2E74C 1B9MA 2K32A 3PV0A 2EJFC 1HPCA 2L5TA 2KA7A 3IFTA 2EDGA 3QIAA 3M7NA 4KKSA 1O78A 1OXUA 1Y8PB 2E76C 1V43A 2A6ED 2DNEA 3P20A 3QJYA 4GZYC 2D62A 4OO1H 2A6HC 3VA7A 3M4YA 3QG1A 3VR4A 1Y8NB 3SE0A 5C0XG 1I6VC 1H9MA 1Q12A 4KHZA 2EVBA 2BE5D 4BA2I 4TKOB 4KKUA 5KNCA 4DK1A 5K36G 2JEBI 1H9SB 2KCCA 5BN4A 3A8IE 2JXMB 3IKJA 3AB9A 2D5DA 3CRKC 1YNNC 3FMCA 1IW7D 4TQUS 1OXTA 4LJZC 4IFDH 1VF5C 1ZYRC 4JBWA 1GUSA 2E75C 3PUVA 4G7ZC 1Y69U 3VR3A 1GJXA 3SDZA 3D4RA 1FR3A 1B9NA 1A6XA 2AWOA 1TU2B 1GUOA 2DNCA 3A7LA 3PUYA 4KN7C 1G291 1ONLA 1H9JA 3GD7A 4DK0A 3KLRA 2A69D 2PCFB 3N6RA 1DD2A 5KNDA 2K33A 3A8KE 1GUGA 2O5JC 1IYVA 1FYCA 1O7LA 4IQZA 3WDNA 4KI0A 1OXSC 1DXMA 1OXXK 1Y8OB 3A8JE 2BA0A 1Z7TA 2JE6I 1E2WA 2LMCB 1EWHA 3PUWA 1VCIA 1GHKA 2A6EC 3BDOA 3ND9A 2YYZA 1H9KA 3VR5A 3FPPA 2CW0C 2QF7A 2A6HD 3CRLC 3NE5B 3L7ZC 4L8JA 5A35A 2JEAI 4OGQC 5BN5A 1T5EA 4G7OC 1Q90A 1GUTA 4H44C 4JK1C 3H94A 3TZUA 3I73A 3U9SA 3I4LA 4IFDG 4H0LC 4OO1G 1VDZA 3MFYA 2PPBC 4KKTA 2O5IC 3BG3A 3OPOA
chains in the Genus database with same CATH superfamily
4JI7Q 3SK6A 1EYCA 3IL8A 3NQTA 3QO2A 3T53B 2PQEA 1IBKQ 2UU9L 3CC4A 3D6WA 5D3IB 1D5MC 1UEBA 3GV3A 1KAAA 4A3JG 5IP9H 4HSPA 5M3MG 2K03A 1IL8A 2RCFA 1Z47A 2R92G 4I7ZC 2JA6G 5CR3A 2F1MA 5C0XH 2HHHQ 4P75A 3K57A 1AN8A 5FK9C 3GV6A 1LV9A 1K8OA 1KXLA 1A3TA 1AFPA 4EQPA 3UDGA 2EQSA 3PUZA 5AJ3L 2R61A 2K14A 1IYJB 4H13C 4DNIA 2F0LA 3RNUA 3K5NA 4Q5VA 4A3DH 4HMIA 2Z6KA 2RVLA 1X54A 1K8MA 5GQOA 3J7AF 3M3YH 4C3JH 1GO3E 2RKSA 1QJOA 2Q2IA 5T1IA 5J22A 1O80A 4O1NA 1HPCA 1UUPA 2IY5B 2NB0A 3P20A 3I91A 1PH6A 1SROA 4PMBA 1YNJD 4DV2Q 2L15A 5C0XG 1CK1A 1EQVA 1H9MA 1CSQA 4KHZA 2ZXOA 2J0TD 5IYBG 1LT6D 5I6YA 4K6LA 3S1MB 4JW0A 1YIJA 2B2UA 2D5DA 1B3AA 3K8AA 3G6EA 2NZOA 1HRJA 5EPKA 3S14H 2FINB 3J7A5 3BS1A 4P74A 4JCVE 1C8CA 5BR8Q 4YIJA 1QZHA 3M4OH 1I50B 4DK0A 1XMOL 3NELA 1SYDA 4NPSA 5AJ3Q 2BH2A 2WACA 5LMNL 3SHLA 1I50H 2CWPA 3A8JE 2K5DA 2HQLA 2A8VA 2KEEA 5M5XH 3TP7A 4ALPA 1SJED 1IBMQ 4LMQD 2XWJB 4P2CB 4BBRG 3HS0C 4LAAA 2H4OA 4YCUA 3PIP3 3TBIB 4DUYL 4YWKA 4LF8Q 3I73A 2JA8B 1N32L 3J80c 4OO1G 3MFYA 2ZTDA 2JSOA 1HA5A 2EYFA 1WTVA 3G71A 1VQLA 4L5TA 2K75A 2NVTB 1PFNA 1ZKOA 1Y1WG 3TEHB 4DK6C 4JI6L 1NTGA 3V05A 2A69C 5G3LD 5GAHC 1F2YA 4KD4A 3ZYYX 1GUNA 1UE5A 3K7AH 1PH9A 3CC2A 4BXXH 4DV3Q 5TSSA 1TKWB 3PUXA 3I56A 1VQMA 2IHFA 3EQLC 3MXNA 3AFQA 1CUKA 4IUUA 2YTVA 3FHWA 3KF6B 1WCMG 2F4VQ 1QVFA 4H7BA 3I4OA 5I2YA 1TWHH 2XRSD 4UDUC 2GN5A 3VYUA 3VDYA 2UUAQ 5FO9B 2AUKA 3FP9A 4FYDA 1BUVT 2XVSA 5HGQA 4N8FA 2NN6I 1KRTA 5C3WA 5IYBH 2TMPA 3IFTA 4LF8L 4B3MQ 1UAPA 2QW7A 4PZ8A 3K0XA 1PXUA 4DK3C 1T9HA 2ENBA 1EY6A 1KL9A 1QE6A 4IJHA 2HCIA 1A2TA 3CCQA 4DR1L 3HOUB 4RKBA 1TQOA 1EIGA 1U0LA 3BU2A 3NHHA 1VMCA 3SE0A 1I6VC 1LT3D 1D1IA 4DV4Q 4CDFC 5C3XA 1WD1A 1SBBB 4C1NK 1B53A 1B4OA 1PHJA 3TREA 4EGVA 2VUMG 2N49A 4IUQA 4DR4Q 1STAA 1MGSA 4LFCL 4NDXA 1EU3A 4FF2A 3VR3A 4DV3L 3MXPA 1NMFA 2F0VA 2JYOA 1VQDA 1X55A 3I4MH 2K05A 1BNZA 4J6HA 4KJOA 1LM0A 2A69D 3KLRA 2A74C 4IUVA 2OQKA 4E6IA 1PV4A 1PH4A 4B3RL 1B8AA 2BDNA 4Y52H 2DGYA 1UWVA 2OF1A 2MFIA 3C1EA 3Q22A 3PSIA 3WDNA 4A3KB 2Q2UA 1KIXA 1OXXK 3GO5A 3H3VI 1SN8A 1MI2A 1VCIA 3OMGA 4JI2Q 4APVA 4HIKA 4TVAB 5I4DA 1HUNA 1STGA 1PFBA 3GTOB 3S15B 3AYHB 3NEMA 3HKZB 2UXCQ 1RF2D 4KHPQ 4A3LH 1QZGA 4IFDG 1F9PA 2B2YC 3A56A 4GKJQ 1LO5D 2M9VA 4DV4L 3T4AC 3CPWA 3EN2A 2B2TA 3QOLA 1H9RA 1SJHD 2PNRC 4TSSA 2VUMB 2RA4A 2QGQA 1YNJC 3GQBA 5IP7H 1TWFB 5LMNW 2CH4W 4A3JH 2PQAA 5D14A 1K73C 2PMZE 3AQQA 2N8NA 1KDBA 5F2DA 1BF4A 4PNYA 4RGOS 2HIVA 2EYHA 3FVQA 5IYCH 3I8ZA 1WTXA 2UXDQ 2F0SA 3FKIG 2NVXB 3KJPA 3BDCA 5JPMC 4R8NA 2BDOA 1E2VA 3C2PA 1IXRA 4UPAA 5I2XA 1YJNA 5JEAH 1YHBA 4B9WA 4CKBA 1BCPD 4X6AH 1PH2A 1W6JA 4A3BH 3L2PA 4G4KA 5M3FH 4RHSA 1S5FD 1EQTA 1AW7A 2F0JA 4DGZA 4QIWB 3F2CA 3QG1A 5NUCA 3TS0A 4UP9A 1WVLA 1SMYD 3NBHA 3HOVG 4FF4A 1PRTB 4Y7NB 2WAQE 1Q86C 1KNEA 4LF6L 4LUVA 4KKUA 1MIUA 4DK1A 2JEBI 2KCCA 4FDBA 2Q2TA 2B63B 1KNAA 4TQUS 5IOCA 2LKVA 2OQ0A 4X64Q 2PZTA 3TMEA 3TSSA 4ULLA 1WTOA 1GUOA 2VQFQ 4BY7B 4HJ9A 3V2TA 1ONLA 4WJ4A 2YTYA 1R4QB 1I6HH 3A8KE 3FEWX 3U4ZA 5DLQE 4A3EB 3J81j 1Y8OB 3MEFA 1E1OA 1I6HB 1EYAA 2AQ1B 1EEID 4C3JG 4A3GG 1L0YB 1NE3A 2KVMA 1CKMA 5IGCA 1FNUA 4H44C 4DV2L 4GOPB 2F3VA 1B44D 5COYA 2DJFC 2A68C 3ERQA 4MN3A 4RCNA 4BY1H 4IURA 4A75A 1VQIA 3TP5A 3I4NB 1SDFA 4DXGA 4WFN3 2N55A 2O4XA 3S2DB 1ILPA 2K6AA 1S40A 3NBIA 1HTPA 4HMJA 1PFMA 1CA5A 1PDQA 1P8LA 1LT4D 1QUQB 1YITA 2LS01 3GTKB 2L55A 2N78A 3H0GG 1PTOD 4P71A 1A63A 2B2WC 3S1NH 1EQRA 5JEAG 1EOVA 3GTJB 4C3IG 4C3HB 5IGGA 4ODGA 4DF7A 1V1PA 2R92H 2OEOA 5GADC 4LW1A 1C7YA 5E1FA 1VQCA 2D2CC 5KGUA 1NAPA 2Z0SA 4X3SA 3S1NB 2IWHA 1Q46A 2AQ3B 2Z9HA 3QIAA 1OXUA 1Y8PB 2E2HB 1F9QA 1SNPA 2D62A 4OWXB 2A6HC 3VA7A 1IL2A 5IE8A 1I5FA 2F0IA 1FGBD 2GVBA 4LFAQ 2F0MA 1N9WA 1CM9A 2B2UC 5EBCA 3H6MA 1TWCH 4JI5L 1IBKL 1J5EQ 1WD0A 4RFBA 1RL2A 4CBVA 5IIFA 4IFDJ 1D8LA 1B9NA 1HNZQ 1YHQA 3BDLA 4GN3B 5I9PA 1G291 3A5UA 4A3GH 4O0AA 1TWAB 4IPCA 3RZOH 4A3FG 5HURA 2EYMA 2K4KA 1O7LA 3ER0A 3EROA 4RG1A 1NY4A 5KRUA 1L1OA 4C56C 2F3WA 3CXCA 1TWAH 3HOXG 1G2TA 2NVYB 4A76A 3SR1A 4GN4B 3S15H 4L5QA 1KABA 2F3IA 2XTIA 3CRLC 4DR5L 4N8X1 3NE5B 4L8JA 3HOWB 2JEAI 1VQ5A 2QDLA 3PMFA 4JVZA 3FDTA 4H0LC 1DONA 4OWWB 2D9UA 1L0WA 1HJPA 5FLXc 3RUZA 1HR0W 3BYYB 3KDFA 3TP6A 3I4MB 4J1MA 1TWCB 2I5HA 3VR6A 3TZDA 1I4XA 2BA1A 2V1CC 4GNXA 5JPNC 4G7HC 4KY5A 1K83B 2BE5C 5IYCG 1KQSA 1RTOA 2IX1A 2JA9A 5EBDA 3KF6A 4HSVA 1ESFA 4KHVA 3GTMB 3MXNB 4A3FB 1K83H 4OX9Q 4K0KQ 1OO9B 3OW7A 1Q1BA 2B63H 1ENAA 4GOPC 1J6QA 5G3LF 4EQ5A 5HGTA 1R4PB 2ZTCA 3K6OA 1IKMA 3HGBA 3M4QA 4F88A 3P75A 1XPOA 1RJTA 1VQKA 1AEXA 1M1KC 4I65A 4DR5Q 3CC7A 2YTXA 2FHTA 2K32A 2PI2E 3L0OA 3PV0A 1Q81C 1VQ7A 4ZKCB 2SEBD 1PRTD 4H02A 2FFKB 2WAQG 5CV7A 4GNXC 5EPLA 2NVQH 1AE2A 2F0EA 5M3FB 1WI5A 2X6LA 5CORA 2G9HD 1JQYD 2HQEA 3S2HB 1TIID 3RN5A 3KLWA 1H9SB 3IKJA 4LF5Q 3JAML 1F9SA 1BBXC 3OSOA 4DKAC 1LT5D 1EIHA 3R2IA 4IFDH 1STYA 4JI6Q 3Q23A 2E75C 2SNMA 2Z6BA 4X66Q 3E0JA 3T1YQ 4YWMA 1O7IA 4QUFA 2VQEL 4DV1L 2AWOA 1TU2B 4OX9L 3CCEA 4GLVB 3GD7A 4FNFA 1U4RA 2CVRA 5ELDA 3HOXB 1GUGA 1XWEA 2MQHA 3DM3A 4F87A 3M9BA 4R4OA 3OTOL 5E7NA 4MNOA 2SDFA 2BA0A 1ICWA 3BDOA 3VYSA 2JA8H 4NKLA 1H9KA 2JK8A 3OWFA 3TP8A 3HOXH 3CMEA 3L7ZC 4NMZA 5A35A 2E5LL 1K8AC 3BJUA 2F52A 4IALA 4CDEC 1AE3A 3EVQA 4HIDA 2MJ8A 2OWOA 1SR3A 3S1MH 1VQNA 1Y1VG 2I5MX 4IJLA 5I6WA 5IY0A 3GDEA 4DR4L 1PTOH 1U4PA 2C9OA 2RHSB 1E1TA 2XIWA 3E0EA 1N33Q 2R6GA 3MXGA 3CF5A 5FJ8H 4DV0L 4DR3L 2AUJD 4DNTB 1SEBD 1F2LA 1X9NA 3D8GA 3U58A 2CQAA 4O42A 2KOLA 2ZM6Q 1DZ1A 1JT8A 2VXWA 3PIPA 3D6CA 4QF4A 1XNRQ 4G57A 4LFBQ 1WCMH 2O2LD 2X6GA 1PZJD 3OYYA 4AYBE 4R4IA 2ASBA 1HQRD 5T1GA 4C2MH 3T1HL 3M7NA 1YZ6A 5GAEC 3MTSA 2JA6H 4F7XA 4CDCC 4GZYC 4MTKA 3VR4A 5IT9c 4HIOA 1JMCA 1TS5A 3CKIB 4K14A 4X65L 4OWTB 2CFMA 5FO8B 3DLLA 4ZUIA 4DU9A 2MGSA 2PW5A 3FMCA 5IODA 5C44H 4EVOA 1ZYRC 1EU4A 2EE1A 4JYAL 1BOSA 2Q2HA 5L37A 3SDZA 4DR3Q 3C46A 1ESRA 1S5ED 3K59A 5IGBA 1GOZA 3AU7A 4A3GB 2UXDL 2K5WA 3R2TA 2ZM6L 4JI7L 4FVMA 4JI3L 1XNRL 5C5LA 3IRBA 1HTLD 2UU9Q 4CKEA 3S16H 3I90A 2VZAA 5J39A 2XWBB 2JA6B 2UUCL 1TXYA 1VQHA 4OXPA 3DWQA 4A93G 2B63G 1G91A 1Y1VB 1VS0A 1LTSD 1QB5D 3S16B 2K28A 5CC4A 2ICIA 1JR0D 2EYPA 1A15A 5M5WH 3J81c 2SNSA 1HUMA 2NBFA 2PNHA 3BZKA 1PH3A 5K36H 4OEMB 1YVCA 2QILA 3RD4A 4DPGA 2NVXH 1NUCA 1PH5A 3L9AX 3NUCA 1LABA 2K50A 4XQJA 5BN3A 2VQFL 2HCCA 1Q7YC 2AQ2B 1PH1A 1GD7A 2QCPX 1JB3A 4DUZL 2NTSA 4IFDI 2K52A 1SNQA 2J4XA 1MBYA 2KECA 2MO0A 1IZ6A 3QWNA 1F2MA 5C0XI 1JWSD 3F2UA 3ERSX 5JEAJ 2WIIB 1KHIA 1VQFA 2KUMA 3CQZB 4POFA 1U4LA 4DXFA 2Y0SG 2KA7A 4HAEA 2XGTA 4UP7A 3UE1A 2EOTA 1XMOQ 1EFWA 4DAMA 2R7ZG 1PZKD 4N9PA 2A1AA 1NJIC 1EFID 1CKOA 2IHEA 1VQOA 1SXTA 1GKHA 4LF4L 4YCWA 1X3EA 3I4NH 1XX8A 3JC66 2A19A 2HDLA 3KYHC 3UDIA 1B1ZA 1PLFA 2EPBA 3A8IE 3CAMA 2K01A 1IW7D 1ML0D 2B2VC 2N3SA 1HZBA 3PIO3 1KLUD 1MKHA 1GM5A 2EY6A 2E2JB 1TWGB 4O2DA 4YHHQ 2K1BA 2PCFB 2B2TC 3FRPB 2LFNA 1T5XD 3WOFA 4PG3A 4LF7Q 2JE6I 3PO2B 3PUWA 3I55A 2YYZA 3KK7A 1EL0A 1CSPA 1XTDA 4DR7Q 3MVVA 2I0QA 4V0BA 3TDQA 1FJGQ 2VB3X 3H09A 3S24A 1BR9A 3G6JB 1WYDA 5BR8L 5C4XB 4RGNA 1EY0A 1RDPD 2IX3A 2O5IC 1TS3A 2FMMA 3GTQB 2ALYB 4LF4Q 4U673 1IW7C 1JOOA 2KHIA 3K5LA 5KYLA 3D4WA 3AMUA 2R7ZB 1H9SA 3U50C 2EYJA 1EWIA 1SYGA 1CI3M 2WP8J 1I3QH 2HDMA 1A8VA 3RZDH 2ZT9C 5GAGC 3UDFA 5FO7B 1UNSA 3EBEA 1LACA 1IBML 4DV5L 1QWYA 3A54A 4XIGS 4I7AA 2E2JH 2CQOA 1HNZL 4OL7A 1CQFA 1I4QA 4PZ7A 4TRDA 4UY8C 1AP0A 3B6YA 1PFSA 2EXZA 3HKZE 4LF7L 1L2FA 3S1QB 3D0FA 1SSOA 3LWUA 1WCMB 3G48A 1STNA 3NTIA 4F8MA 1QCBD 3K5MA 1CFMA 3M3YB 2AMCB 1BDOA 4LFCQ 2V4DA 4BBRB 4DFAA 2F03A 2KQ3A 2Q8IB 1E7ZA 5D65A 1FJGL 3HOWH 4C3HH 3BVMA 2EY1A 3RN2A 1PH8A 2YV5A 2A6ED 3S2HH 4B3RQ 2RDGA 4BBRH 1Y1WB 5DAUA 4RKLA 3KFUA 3JAME 5LMUQ 2JA5G 3CCJA 4U68A 3G4SA 1CQVA 5BN4A 2JXMB 3AB9A 1PVOA 3RZOB 2FJ2A 3QR8A 1D5XC 3S17H 1JJ2A 4LJZC 3SK4A 4QMGA 2H1EA 3MC0B 1HH2P 1MJEA 3PUVA 3TRZA 1V9PA 5C3EH 4FF3A 3D4RA 2WFWA 3UE0A 3DMUA 3PQIA 2PW7A 2PQAB 4X62L 3J80L 1K8GA 1VQEA 1QILA 4NXNL 2LXJA 2F0OA 2JA7B 1SLJA 3P1HA 1JB7A 1A0IA 4JI0L 4DR1Q 2VL6A 1C9OA 1YHAA 2JA5B 3BYTB 1QNUA 1XMQQ 2NUCA 4QIWE 4K8JA 4FP5D 3J7AV 1EQQA 1KDAA 1U9RA 2JA7H 3DEOA 2GA4B 1BCPB 1JOQA 4CJ1B 1Q90A 4HJAA 4R4QA 3I4LA 3ZJYC 3SK8A 3BG3A 5KIXA 1HZAA 3KLSA 2CHBD 1I94Q 1CKNA 2IX0A 4ILWA 2JN4A 1EY8A 4X3KA 1PYWD 3BVGA 1CTMA 2FMCA 4LF5L 1C0AA 3NSWA 2F0UA 1SFOH 3J7YW 1J8IA 2UUBL 3HZXA 2WB1E 5C3EB 1I4HA 2F4IA 4X62Q 1ZYRD 4DNRB 1D1KA 4K5WA 5C44B 2LXKA 2WB1G 3K0YA 4GKJL 3UI2A 2JA5H 3MA2B 1OXVA 2C5CA 4HN7A 1BO0A 1E2ZA 4ZRZA 3NP8A 2G5DA 1AZPA 3DXJC 3MZ5A 1QNKA 3STBD 1EEFD 3NTKA 5ELBA 2QKIC 2AWNA 3ONAB 5CV6A 2KBNA 2EDGA 2E76C 5M3MB 3K80C 3NTHA 4A3CG 2NYZD 1EY4A 4C3JB 4BS9A 2HT1A 4JI4Q 3CCUA 1QVCA 1YEZA 1E0BA 3PO3G 1I94L 3SXHA 3RZDB 5IT9L 4ME5A 1KLGD 2NVTH 1X32A 1Y1VH 3J81i 3J7ZC 4X3TA 3D3RA 4Q0FA 2D0OA 3JAMi 1OXTA 4B3SQ 4A93H 3MFGA 1W2BA 2XSCA 1JJGA 4B9XA 4KTAA 1CT1D 3H3VH 2A5HA 1VQ6A 4JI1L 3PUYA 4KN7C 1RIPA 1H9JA 3RLOA 3S2DH 4J15A 1K0SA 2H5XA 1AH9A 4R4TA 1STHA 2M00A 2EZVA 4GKKQ 3S14B 3EFXD 1HR0Q 1LTID 1DXMA 4GS3A 2CH4A 4LF6Q 4OONA 4JC0A 1GHKA 3DEPA 2NTTA 3QOJA 3VR5A 5IYDG 3GTOH 5KEEA 1CA6A 2A6HD 2EIFA 2MPMA 4C2MB 4JI4L 4FXDA 5C44G 1EY9A 4POGA 3CPFA 5M5WB 4A3BG 1S5BD 1SYFA 3E9IA 2HD3A 4A3MB 3SEBA 4MTNA 4X65Q 4AQYQ 1G2SA 3T56B 1V1OA 2L9HA 3GTGH 4LWCA 5KNBA 4XDXA 4EQOA 5LL6X 4JYAQ 5C4ZA 3S9WA 4DV6L 5EPJA 4KD3A 2ZXPA 2L12A 1X3QA 1PRTC 4K2LA 4RA8A 3LNNA 1MHWC 4GKKL 4JV5Q 4KY7A 1WTRA 2GVAA 2PYKA 3S1RH 4JI3Q 3ULJA 4C3HG 3GP7A 3A7AB 1ENFA 1J5EL 2K7VA 3OW2A 1DYQA 1VQJA 4PV1C 2IT1A 4RH6A 3KDFB 4XXEA 1D2BA 2K5QA 4KKSA 1XPRA 2B2WA 4R1JA 3QJYA 1U5KA 3HOZB 4K8IA 4MZ9A 1DGSA 5JOBA 3H15A 1STBA 1K3BC 4JOIC 2EVBA 5FLMH 1MD2D 2KCNA 1HFNA 4AQYL 4PMCA 3KBGA 4YY3L 3IAYA 4A3DG 2F0QA 5A2QE 5FLXL 2N88A 3J81E 1HFGA 1KD1C 4IPHA 1DOLA 3N6RA 4QL5A 1DD2A 4XT3B 3NK9A 4ZQ3A 1CKNB 3KBXA 1SE8A 4K6DA 4BBSB 1YNND 4KI0A 3AFPA 5C4JH 4EX5A 2PZWA 4B3TQ 3L3OC 2WKCA 5CV5A 4AIMA 1SE2A 1KC8C 4ZLTF 2ZJQA 1PH7A 4ME3A 4P72A 1AZQA 3SGIA 1GVPA 1PA6A 2HHHL 1CZGA 2CCZA 1TWFH 2MO1A 3F1ZA 4IPGA 4A3IH 1PTOF 2HIXA 5DM63 4YWLA 1I4PA 4NXMQ 3OPOA 2F0HA 1S3OA 5C4XH 2F0WA 3CCLA 4OIKA 2JA7G 5IT9E 3T51B 2MP1A 1CHQD 3W1GA 1JORA 1PYBA 1SMYC 3MHBA 1QVGA 5C0XJ 2NVQB 4LK1C 3CD6A 1HNWQ 5EQ0A 5IWAQ 4NB3A 3Q6SA 1HCZA 1NCVA 1N36L 1A62A 2ID0A 1O7ZA 2VS1A 4YCVA 4DR6Q 1L0XB 3HOVH 1V8QA 1TWGH 4YHHL 2R7FA 2XN9C 2CWAA 1QUQA 1K28A 3RLNA 1GXDC 4HCSA 3PGZA 1JC7A 3R8BA 1VF7A 1XXGA 3HOVB 4M8AA 4DR7L 1GUWA 4RGMA 2Z8LA 1R9TH 2R7DA 4OO1H 5LMNQ 1KAWA 1S5CD 1NNXA 2EYLA 5ELEA 4M1UB 1UE6A 1Y8NB 3SVMA 1M8AA 4AH6A 3HOUH 3W2DA 3CQZH 2IJ0A 3T16A 4ZUJA 2MUYA 1LTBD 3K7AB 1JE5A 4XYOA 1BKBA 1LYLA 2J7ZA 1N36Q 1E3PA 2E5LQ 4FXGC 4JBWA 1JJCB 3LX0A 1FL0A 1GJXA 4DR6L 2EYOA 1JE4A 1TWHB 3DWAA 1YJ9A 3A0JA 4ZK9B 2K5NA 4DN4M 4KJNA 4R4CA 1SNDA 1N34Q 4IQZA 3GTMH 4A3KH 2DJGC 1E22A 1LTAD 3NQIA 3FPPA 4GLXA 2B2VA 1N33L 2EXDA 2WAQB 3U4VA 1WFQA 2BH8A 2PZUA 3ICEA 1SAPA 3E6ZX 2B39A 1RD9D 4G7OC 2B2YA 2VNUD 1TT2A 1QOHA 3H94A 3T1YL 1YNXA 1Q82C 2VQEQ 1JOKA 1VDZA 1QG7A 1VQGA 2F4VL 4PMWA 5M5YH 2RCNA 4UAIA 1E24A 1FNWA 4LFBL 4NP5A 5DNFA 5LMUL 1G6PA 4RCOA 3OMCA 3ND8A 1LTGD 2Y0SB 5KYIA 3OTOQ 4QGUA 4GLAC 5A2QL 3HOZH 3MXUA 1DOKA 2RDFA 1IYUA 3C1FA 2L1BA 3KJOA 2XRQD 2NN6G 2QDBA 1HNXL 4DUYQ 1Q8IA 1SE3A 3WOEA 4B08A 4A93B 5K5PA 1HQMC 3PO2G 1Q1EA 1FVIA 1CHPD 1X6OA 1VQBA 3CCRA 1N34L 4R9WA 2WV6D 2Z4HA 5EAYA 4CKCA 1F9RA 2EJGC 4BA1I 3CCMA 4JI0Q 3Q0AA 3GTKH 3K81C 3RLFA 3JAMc 4QQBX 1ET9A 3FPUB 1XMQL 3H0GH 4IUPA 3S1QH 3FKIH 5ISRA 3R3OA 3E9HA 2OCEA 1B9MA 2PI2A 4PQXA 5C4HA 2EJFC 4QCLA 2L5TA 4L6TB 5JAVA 1HXYD 2L0CA 2MHVA 3DWPA 2VY3A 2NZ1D 3H0GB 5FKAC 1IBLL 5FJ8G 3K58A 1IKLA 3HOYH 4BA2I 1STEA 2R7ZH 5LHY1 5C6AA 1I3QB 3HKZG 4S3SA 4LF9Q 3H3VC 4KLKA 2VB2X 4IPDA 1D6EC 3A74A 3MAQA 4KHPL 3J81L 2RSNA 2UUAL 3EIVA 3URYA 3VYRA 4JBJA 1Y69U 4FF1A 3GTPH 3I4NG 2UUBQ 5FLXE 3E5SA 3CU7A 1SNCA 1NR4A 2Q8RE 3I3CA 2RF4A 4DAVA 3A7LA 1EZ8A 3NPPA 4B3ML 1UE7A 3GTJH 1RODA 2NVYH 1G8ZD 4XT1B 2O5JC 5C3EG 4XQNA 5ELFA 1YI2A 1B7YB 4K2KA 5CGKA 1ASYA 1NBWA 3X3MA 1TS4A 3N52A 3CW2C 1LLRD 2ZJRA 1X3GA 2I5LX 2PO4A 2QF7A 1P16A 4BXXG 5CBEE 3CCSA 1WTHA 2Y0SE 2ES2A 4OGQC 1F2ZA 1FGUA 3PF4A 2F0FA 2R3ZA 4DUZQ 1Y1WH 1A3UA 4IOCA 3KUPA 2TSSA 4RAUC 1PTOC 4BY7G 1SNMA 4C3IB 5FOBB 1M90C 5FLMG 4OO1I 4IOAA 3NWSA 1FNVA 4B3SL 1I4RA 5E4WC 3CMAA 3OIPA 5CV8A 4L5SA 2NWGA 4XTCS 4MIUA 4HTHA 1XNQQ 2UXBL 2F0DA 2A68D 4AYBG 1PMRA 4JI1Q 1EZ6A 2B8FA 1A2UA 4HJ5A 4ZAIA 5JJKA 1TY0A 1RTNA 3HOYG 4A3CH 2DN8A 1VMPA 5D3DA 1RHPA 4BBSG 3UDXA 1B3QA 1L1OC 2QA4A 1KDCA 1WTQA 1BBUA 3LWEA 1Y14B 4HR7B 3MWYW 4JBMA 2JJQA 2P5ZX 2L11A 1BBWA 2ZXRA 1NSNS 1EWCA 2CKZB 3SK5A 3E3XA 5AFWA 1WTWA 1JICA 1M4VA 1A3VA 2BCOA 4IN3A 4ZCKA 5JVG3 1EOTA 5KNCA 4LUZA 2MNAA 3DUZA 1XJVA 3M7GA 2Z6KC 1MJCA 4X3UA 1W3SA 1YNNC 1KTKA 1LTRD 2DY8A 3GTGB 3MEHA 3W1BA 1FR3A 1WJJA 5CV4A 1V1PB 2CW0D 1PRTF 2RHQB 4DV6Q 2B3GA 3H91A 4CJ0B 2IPKD 1D7QA 1DJRD 2LY7A 3RR5A 2AHOB 1ICFB 3KF8B 4JV5L 4A3DB 1HZ9A 2WINB 1X65A 1SYCA 4DV5Q 3NWTA 4A3IG 2K04A 3OHXC 4X64L 3IFDA 4JK1C 3R93A 2FXQA 3TZUA 1SRUA 2Z1CA 4ZKBB 2IL8A 1S72A 1WTPA 1U4MA 1Z9FA 2R93B 1FD7D 4KY6A 4GOPA 3D31A 3KF8A 1D5ZC 1ZEQX 2B8GA 1CZWA 1JWUD 2AKWB 4IZ8A 4CGYB 1X3PA 4YY3Q 2KJXA 4LUOA 2NN6H 1PZID 3RMHA 3KLSX 3PCOB 1VQAA 4C1NI 4RMFA 4RWSC 3HOZG 2BOSA 2RDHA 4KMUC 2K5VA 2JP1A 3HG9A 3LGJA 3O13A 2M2LA 1J9OA 3U9OA 2ZTEA 3J80E 4JI5Q 3QB3A 4L5RC 5JJLA 3PO3B 4DAYB 4OELB 3HP3A 4Z9CB 4B3TL 1LUZA 5M5YB 2X69A 1B50A 1HHVA 2E74C 3FKIB 4BY1B 4A3BB 3ULLA 2E2IH 3I4MG 3TN2A 4UHVA 2E2HH 2DNEA 1N32Q 4FO2A 2YU9H 2D0PA 3K7UC 1Q12A 4NXML 2RBMA 2VUMH 2WB1B 3NENA 2NZHA 4A3MH 2RSOA 3CRKC 3X3NA 5DEHA 3HFZB 1HZCA 1NMGA 1GUSA 1K3RA 3TS2A 5CV9A 3OIQA 3PF5A 1O7YA 1ZXTA 4GNXB 3I70A 1BXTA 4WJWA 5EKKA 3F2DA 5KNDA 2K33A 1VQ8A 2C35B 5IGDA 4LFAL 4J8QA 1BQQT 4HEDA 4A3IB 3S1RB 1OXSC 1C48A 1BCPC 1UE1A 3HOUG 2VW9A 2LMCB 4JG2A 2E2DC 4QB4A 1DM0B 3ND9A 5EKLA 3VA5A 3DHQA 4ABNA 4BBSH 2ATWA 3ULPA 1W6KA 2E8GA 1Q3LA 2E2IB 1B70B 4WORA 5E3FA 5JJZA 1EY5A 5EKIA 4WJ3M 1SYEA 1JWMD 3BZCA 4QUCA 2PPBC 5CYUA 3GTQH 5IYDH 4KKTA 2OXPA 4UP8A 1VQPA 1WOCA 2R93G 3OOCA 4NXNQ 5H1SE 1SNOA 5IGFA 3GTLH 4GN5A 5ELCA 2I46A 5J3BA 3M4OB 1PYSB 4KN4C 3HOYB 2KHSA 3KOJA 1GHJA 2EY2A 1SMXA 4XYQA 4BY7H 2OT2A 5IP9G 5GROA 4CHTB 1EUJA 2G9DA 3S17B 4JI8L 1V1QA 2A73B 2PMZB 3GTPB 3HKSA 1KRSA 2KENA 2B29A 1TR5A 3C3LA 5CMDA 4DAYA 1EIFA 4XQQA 3Q24A 4CJ2C 2QEJC 4HIMA 3I72A 4JI2L 3W3AA 2SOBA 2QEXA 3P7JA 1DCZA 4QY7A 3VR2A 1R9TB 2JA8G 2K5HA 1G6ZA 4Y7NH 2KEDA 2UXCL 3BVZA 1XYIA 3AEVA 2EY5A 2WKDA 3J80i 5M3MH 3D4DA 3M4YA 1SFOB 2F0GA 1DOMA 4AYBB 4K0KL 3GTLB 1ILQA 1G51A 2BE5D 4TKOB 2ICEC 1LTTD 4A3JB 2RQXA 3G7LA 1VQ9A 1VF5C 1F77A 1HA6A 5C5MA 1I4GA 1UEAB 1A6XA 2DNCA 1K0RA 4JI8Q 1HNXQ 3HRZC 2F0KA 1EYGA 3PO2H 1ENCA 1PTOB 4JOIA 4PZ6A 3TQYA 1FYCA 3M4PA 1H95A 4EQNA 1EIYB 5M5XB 1Z7TA 1EWHA 2A6EC 5HY6A 2DUDA 1SE4A 1X3FA 2OTJA 3ITPA 5IGEA 4IO9A 3F2BA 1II3A 4HJ7A 4V190 1BVSA 1T5EA 5I9OA 4X66L 1B2TA 4K5VA 1XPUA 4DV1Q 4OHJA 4CDDC 4DA2A 1EYDA 4IUNA 4DR2L 4RHRA 1IBLQ 2KCMA 1NR2A 3EA6A 1HR0L 4HJ8A 4LF9L 1JCKB 1VQ4A 2YU9B 3WWVA 2I07B 2DY7A 4MHEA 2EJMA 4P73A 3DM1A 4BY1G 5J1ZA 4JBKA 3OWEB 3F8TA 3M85A 1X56A 3CP0A 5LL6S 1Q8KA 2Z4IA 1LTLA 4N9TA 3A55A 1RCVD 2KCTA 3HEJA 4IUTA 1Z6HA 1YJWA 5JJIA 1BCPF 4DV7Q 3NBHB 1IHZA 4A3EG 4DAPA 3EJIA 4QJFA 2ZJPA 3PO3H 2HUGA 4HCEA 3V96A 1RKNA 1S4ZA 1TS2A 4FXKC 2OTLA 4A3KG 1TVXA 1XTCD 4L63B 4ID6A 5DM73 5E4XA 1O78A 2XNAC 1V43A 3CHBD 3Q8DA 2R92B 3BZDB 5M3FG 4DV0Q 3CCVA 5JVH3 4DR2Q 2F0TA 4A3MG 4KV6A 4ZYSA 5EJWA 3STBC 3PIOA 4BWGB 5K36G 5CBAE 2R93H 4RGTA 5ELOA 4WRDA 2UUCQ 3I7FA 2KHJA 1SYBA 4G7ZC 2IW3A 3W5OA 4R8IA 2L4NA 3A5ZB 4A3FH 2F0PA 3T1HQ 3HOWG 2F0NA 1XNQL 5M9OA 2UXBQ 1YBYA 1C4QA 1TY2A 1IYVA 4DV7L 3K5OA 1HNWL 4A3EH 1L1OB 5ELNA 1MSHA 5IWAL 5C4JB 1E2WA 4KK7A 4A4IA 4LNQA 3I2ZA 1MSGA 1K9MC 3T13A 3NXWA 2CW0C 1N8RC 1OTCA 2JQOA 5IP7G 5BN5A 1ET6A 1GUTA 2Q8TA 3U9SA 4C3IH 4K5XA 4JPBW 1ASZA 5C4XG 1EY7A 4A3LG 4OIJA 5EGTA 2LSSA 3VYTA 4NW2A 1S5DD
chains in the Genus database with same CATH topology
3SK6A 1EYCA 3IL8A 3NQTA 3QO2A 3T53B 2PQEA 3D6WA 5D3IB 1D5MC 3GV3A 1KAAA 4HSPA 2K03A 1IL8A 1Z47A 4I7ZC 5CR3A 2F1MA 5C0XH 3K57A 1AN8A 5FK9C 3GV6A 1LV9A 1K8OA 1A3TA 1AFPA 4EQPA 3PUZA 2R61A 4H13C 2F0LA 3K5NA 4Q5VA 4HMIA 2RVLA 1K8MA 3J7AF 2RKSA 1QJOA 5T1IA 5J22A 1O80A 4O1NA 1HPCA 1UUPA 2NB0A 3P20A 3I91A 4PMBA 1YNJD 5C0XG 1EQVA 1CK1A 1H9MA 4KHZA 2ZXOA 2J0TD 1LT6D 5I6YA 4K6LA 3S1MB 2B2UA 2D5DA 1B3AA 1HRJA 5EPKA 2FINB 3BS1A 1C8CA 4YIJA 1I50B 4DK0A 1SYDA 2WACA 3SHLA 3A8JE 2K5DA 2KEEA 3TP7A 1SJED 4LMQD 2XWJB 4P2CB 3HS0C 4LAAA 2H4OA 3PIP3 3TBIB 3I73A 2JA8B 4OO1G 3MFYA 2JSOA 1HA5A 2EYFA 1WTVA 2NVTB 1PFNA 1ZKOA 3V05A 2A69C 5G3LD 1F2YA 4KD4A 3ZYYX 1GUNA 5TSSA 1TKWB 3PUXA 3EQLC 3MXNA 4IUUA 4H7BA 5I2YA 2XRSD 4UDUC 3VYUA 5FO9B 2AUKA 4FYDA 1BUVT 2XVSA 2NN6I 5C3WA 2TMPA 3IFTA 1UAPA 1PXUA 2ENBA 1EY6A 1QE6A 2HCIA 1A2TA 3HOUB 4RKBA 1TQOA 1EIGA 3SE0A 3NHHA 5C4XB 1VMCA 1I6VC 1LT3D 1D1IA 5C3XA 1WD1A 1SBBB 4C1NK 1B53A 1B4OA 4EGVA 4IUQA 1STAA 1MGSA 4NDXA 1EU3A 4FF2A 3VR3A 2F0VA 3MXPA 2JYOA 2K05A 1BNZA 4J6HA 4KJOA 4E6IA 3KLRA 2A69D 2A74C 4IUVA 2BDNA 3C1EA 2OF1A 3Q22A 3WDNA 4A3KB 1OXXK 3GO5A 1MI2A 1VCIA 3OMGA 5I4DA 1HUNA 1STGA 1PFBA 3GTOB 3S15B 3HKZB 1RF2D 4IFDG 1F9PA 2B2YC 3A56A 1LO5D 2M9VA 3T4AC 2B2TA 3QOLA 1H9RA 1SJHD 2PNRC 4TSSA 2VUMB 2RA4A 1YNJC 3GQBA 1TWFB 5D14A 1KDBA 5F2DA 1BF4A 4PNYA 4RGOS 3FVQA 2EYHA 1WTXA 3I8ZA 2F0SA 2NVXB 3BDCA 5JPMC 4R8NA 2BDOA 1E2VA 3C2PA 5I2XA 5JEAH 4B9WA 4CKBA 1BCPD 1W6JA 4G4KA 4RHSA 1S5FD 1EQTA 1AW7A 2F0JA 4DGZA 4QIWB 3QG1A 5NUCA 1WVLA 1SMYD 3NBHA 4FF4A 1PRTB 4Y7NB 1KNEA 4KKUA 4DK1A 2JEBI 2KCCA 2B63B 1KNAA 4TQUS 5IOCA 2LKVA 2PZTA 3TMEA 3TSSA 4ULLA 1WTOA 1GUOA 4BY7B 3V2TA 1ONLA 1R4QB 3A8KE 3FEWX 4A3EB 1Y8OB 1I6HB 1EYAA 2AQ1B 1EEID 4C3JG 1L0YB 2KVMA 5IGCA 1FNUA 4H44C 2F3VA 1B44D 5COYA 2A68C 3ERQA 4MN3A 4RCNA 4IURA 3TP5A 3I4NB 1SDFA 4DXGA 4WFN3 2N55A 2O4XA 3S2DB 1ILPA 2K6AA 3NBIA 1HTPA 4HMJA 1PFMA 1CA5A 1PDQA 1LT4D 2LS01 3GTKB 2L55A 1PTOD 2B2WC 5JEAG 3GTJB 4C3IG 4C3HB 5IGGA 4ODGA 4DF7A 1V1PA 2OEOA 5E1FA 2D2CC 5KGUA 1NAPA 4X3SA 3S1NB 2IWHA 2AQ3B 3QIAA 1OXUA 1Y8PB 2E2HB 1F9QA 1SNPA 2D62A 2A6HC 3VA7A 2F0IA 1FGBD 2F0MA 1CM9A 2B2UC 5EBCA 3H6MA 1WD0A 4RFBA 5IIFA 4CBVA 4IFDJ 1B9NA 3BDLA 5I9PA 1G291 1TWAB 5HURA 2EYMA 1O7LA 3EROA 5KRUA 4C56C 2F3WA 1G2TA 2NVYB 3SR1A 1KABA 3CRLC 3NE5B 4L8JA 3HOWB 2JEAI 3PMFA 3FDTA 4H0LC 1DONA 2D9UA 3RUZA 3BYYB 3TP6A 3I4MB 4J1MA 1TWCB 3VR6A 3TZDA 1I4XA 2BA1A 5JPNC 4G7HC 4KY5A 1K83B 2BE5C 1RTOA 2IX1A 5EBDA 4HSVA 1ESFA 4KHVA 3GTMB 4A3FB 1OO9B 3OW7A 1Q1BA 1ENAA 5G3LF 5HGTA 1R4PB 3K6OA 1IKMA 3HGBA 4F88A 3P75A 1RJTA 1AEXA 4I65A 2FHTA 2K32A 3PV0A 4ZKCB 2SEBD 1PRTD 2FFKB 5CV7A 5EPLA 2F0EA 5M3FB 2X6LA 5CORA 2G9HD 1JQYD 2HQEA 3S2HB 1TIID 1H9SB 3IKJA 3JAML 1F9SA 1BBXC 3OSOA 1LT5D 1EIHA 3R2IA 4IFDH 1STYA 3Q23A 2E75C 2SNMA 3E0JA 4QUFA 2AWOA 1TU2B 3GD7A 4FNFA 1U4RA 2CVRA 5ELDA 3HOXB 1GUGA 1XWEA 4F87A 2SDFA 2BA0A 1ICWA 3BDOA 3VYSA 4NKLA 1H9KA 3OWFA 3TP8A 3L7ZC 4NMZA 5A35A 4IALA 3EVQA 2MJ8A 5I6WA 1PTOH 1U4PA 2C9OA 2XIWA 2R6GA 3MXGA 4DNTB 2AUJD 1SEBD 1F2LA 3D8GA 2CQAA 4O42A 2KOLA 1DZ1A 2VXWA 3D6CA 4QF4A 4G57A 2O2LD 2X6GA 1PZJD 1HQRD 5T1GA 3M7NA 3MTSA 4F7XA 4GZYC 3VR4A 1TS5A 3CKIB 4K14A 5FO8B 4ZUIA 4DU9A 2MGSA 2PW5A 3FMCA 5IODA 4EVOA 1ZYRC 1EU4A 2EE1A 1BOSA 3SDZA 3C46A 1ESRA 1S5ED 3K59A 5IGBA 1GOZA 3AU7A 4A3GB 2K5WA 3R2TA 4FVMA 5C5LA 1HTLD 4CKEA 3I90A 5J39A 2XWBB 2JA6B 3DWQA 1G91A 1Y1VB 1LTSD 1QB5D 3S16B 2K28A 5CC4A 2ICIA 1JR0D 2EYPA 1A15A 2SNSA 1HUMA 2NBFA 5K36H 2QILA 3RD4A 1NUCA 3L9AX 3NUCA 1LABA 4XQJA 5BN3A 2HCCA 2AQ2B 2QCPX 1JB3A 2NTSA 4IFDI 1SNQA 2J4XA 1MBYA 2KECA 3QWNA 1F2MA 5C0XI 1JWSD 3F2UA 5JEAJ 2WIIB 2KUMA 3CQZB 1U4LA 4DXFA 2KA7A 4HAEA 2EOTA 1PZKD 4N9PA 1EFID 1SXTA 1XX8A 4ZKBB 2HDLA 1B1ZA 1PLFA 2EPBA 3A8IE 2K01A 1IW7D 1ML0D 2B2VC 3PIO3 1KLUD 2EY6A 2E2JB 1TWGB 2K1BA 2PCFB 2B2TC 3FRPB 2LFNA 1T5XD 3WOFA 2JE6I 3PO2B 3PUWA 2YYZA 3KK7A 1EL0A 3MVVA 4V0BA 3TDQA 2VB3X 3H09A 1BR9A 3G6JB 4RGNA 1EY0A 1RDPD 2IX3A 2O5IC 1TS3A 2FMMA 3GTQB 4U673 3K5LA 1IW7C 1JOOA 2R7ZB 5KYLA 3AMUA 3D4WA 1H9SA 2EYJA 1SYGA 1CI3M 2WP8J 2HDMA 2ZT9C 5FO7B 1UNSA 1LACA 1QWYA 3A54A 4XIGS 4OL7A 1CQFA 1I4QA 4TRDA 1AP0A 2EXZA 3S1QB 1SSOA 3LWUA 1WCMB 3NTIA 1STNA 4F8MA 1QCBD 3K5MA 1CFMA 3M3YB 1BDOA 2V4DA 4BBRB 4DFAA 2F03A 2KQ3A 2Q8IB 5D65A 3BVMA 2EY1A 2A6ED 2RDGA 1Y1WB 5DAUA 4RKLA 3JAME 4U68A 1CQVA 5BN4A 2JXMB 3AB9A 3RZOB 2FJ2A 1D5XC 4LJZC 3SK4A 4QMGA 2H1EA 3MC0B 3PUVA 4FF3A 3D4RA 3DMUA 2PW7A 3J80L 1QILA 2F0OA 2JA7B 3P1HA 2JA5B 3BYTB 1QNUA 2NUCA 4K8JA 4FP5D 3J7AV 1KDAA 1U9RA 3DEOA 2GA4B 1BCPB 1JOQA 4CJ1B 1Q90A 3I4LA 3SK8A 3BG3A 5KIXA 3KLSA 2CHBD 2IX0A 4ILWA 1EY8A 4X3KA 1PYWD 3BVGA 1CTMA 2FMCA 3NSWA 2F0UA 1J8IA 3J7YW 3HZXA 5C3EB 1I4HA 2F4IA 1ZYRD 4DNRB 1D1KA 4K5WA 5C44B 3K0YA 3UI2A 3MA2B 1OXVA 2C5CA 4HN7A 1BO0A 1E2ZA 4ZRZA 3NP8A 1AZPA 3DXJC 3MZ5A 1QNKA 1EEFD 3NTKA 5ELBA 2QKIC 2AWNA 3ONAB 5CV6A 2EDGA 2E76C 5M3MB 3NTHA 2NYZD 1EY4A 4C3JB 4BS9A 1E0BA 3SXHA 3RZDB 5IT9L 4ME5A 1KLGD 1X32A 4X3TA 3D3RA 4Q0FA 1OXTA 3MFGA 2XSCA 4B9XA 4KTAA 1CT1D 2A5HA 3PUYA 4KN7C 1H9JA 1STHA 2M00A 2EZVA 3S14B 3EFXD 1LTID 1DXMA 1GHKA 3DEPA 2NTTA 3QOJA 3VR5A 5KEEA 1CA6A 2A6HD 2MPMA 4C2MB 4FXDA 1EY9A 5M5WB 1S5BD 1SYFA 4A3MB 3SEBA 1G2SA 3T56B 1V1OA 2L9HA 5KNBA 4XDXA 4EQOA 5LL6X 5C4ZA 3S9WA 5EPJA 4KD3A 2ZXPA 2L12A 1X3QA 1PRTC 4K2LA 4RA8A 3LNNA 4KY7A 1WTRA 2PYKA 4C3HG 3GP7A 3A7AB 1ENFA 2K7VA 1DYQA 4PV1C 2IT1A 4RH6A 4XXEA 1D2BA 2K5QA 4KKSA 2B2WA 3QJYA 3HOZB 4K8IA 5JOBA 1STBA 2EVBA 1MD2D 2KCNA 1HFNA 4PMCA 3KBGA 3IAYA 2F0QA 5A2QE 5FLXL 2N88A 3J81E 1HFGA 1DOLA 3N6RA 1DD2A 4XT3B 3NK9A 4ZQ3A 3KBXA 4K6DA 4BBSB 1YNND 4KI0A 2PZWA 3L3OC 2WKCA 5CV5A 1SE2A 4ZLTF 1AZQA 1CZGA 1PTOF 5DM63 1I4PA 3OPOA 2F0HA 2F0WA 4OIKA 5IT9E 3T51B 2MP1A 1CHQD 1JORA 1SMYC 3MHBA 2NVQB 5C0XJ 4LK1C 5EQ0A 3Q6SA 1HCZA 1NCVA 2ID0A 1O7ZA 1L0XB 1V8QA 2XN9C 1GXDC 4HCSA 1JC7A 3R8BA 3HOVB 1VF7A 1XXGA 4M8AA 1GUWA 4RGMA 2Z8LA 4OO1H 1S5CD 5ELEA 2EYLA 4M1UB 1Y8NB 3SVMA 1M8AA 3W2DA 2IJ0A 3T16A 4ZUJA 2MUYA 1LTBD 3K7AB 4XYOA 2J7ZA 4FXGC 4JBWA 3LX0A 1GJXA 2EYOA 1JE4A 1TWHB 3DWAA 4ZK9B 4DN4M 4KJNA 1SNDA 4IQZA 1LTAD 3NQIA 3FPPA 2B2VA 2WAQB 2PZUA 1SAPA 3E6ZX 2B39A 1RD9D 4G7OC 2B2YA 2VNUD 1TT2A 1QOHA 3H94A 1JOKA 1VDZA 1QG7A 4PMWA 4UAIA 1FNWA 4NP5A 5DNFA 4RCOA 3OMCA 3ND8A 1LTGD 2Y0SB 5KYIA 5A2QL 3MXUA 1DOKA 2RDFA 1IYUA 3C1FA 2L1BA 2XRQD 2NN6G 2QDBA 3WOEA 1Q8IA 1SE3A 4B08A 4A93B 5K5PA 1HQMC 1Q1EA 1CHPD 4R9WA 2WV6D 2Z4HA 4CKCA 1F9RA 2EJGC 4BA1I 3Q0AA 3RLFA 1ET9A 3FPUB 4IUPA 5ISRA 3R3OA 1B9MA 5C4HA 4PQXA 4QCLA 2EJFC 2L5TA 4L6TB 5JAVA 1HXYD 2L0CA 2MHVA 3DWPA 2NZ1D 3H0GB 5FKAC 3K58A 1IKLA 4BA2I 1STEA 5LHY1 5C6AA 1I3QB 4S3SA 3H3VC 2VB2X 1D6EC 3MAQA 3J81L 2RSNA 3URYA 3VYRA 1Y69U 4FF1A 5FLXE 3E5SA 3CU7A 1SNCA 1NR4A 2Q8RE 3I3CA 4DAVA 3A7LA 1EZ8A 3NPPA 1RODA 1G8ZD 4XT1B 2O5JC 4XQNA 5ELFA 4K2KA 5CGKA 3X3MA 1TS4A 3N52A 1LLRD 2PO4A 2QF7A 5CBEE 4OGQC 1F2ZA 2F0FA 2R3ZA 1A3UA 3KUPA 2TSSA 4RAUC 1PTOC 1SNMA 4C3IB 5FOBB 4OO1I 3NWSA 1FNVA 1I4RA 5E4WC 3OIPA 5CV8A 2NWGA 4XTCS 4MIUA 4HTHA 2F0DA 2A68D 1PMRA 1EZ6A 2B8FA 1A2UA 4ZAIA 1TY0A 1RTNA 2DN8A 1VMPA 5D3DA 1RHPA 1KDCA 1WTQA 3LWEA 4HR7B 3MWYW 2L11A 2ZXRA 1NSNS 1EWCA 3SK5A 5AFWA 1WTWA 1JICA 1M4VA 1A3VA 2BCOA 4IN3A 5JVG3 1EOTA 5KNCA 3DUZA 3M7GA 4X3UA 1YNNC 1KTKA 1LTRD 2DY8A 3GTGB 3MEHA 1FR3A 5CV4A 1V1PB 2CW0D 1PRTF 3H91A 4CJ0B 2IPKD 1DJRD 2LY7A 4A3DB 2WINB 1SYCA 3NWTA 2K04A 3OHXC 3IFDA 4JK1C 3R93A 3TZUA 2Z1CA 2IL8A 1WTPA 1U4MA 2R93B 1FD7D 4KY6A 3D31A 3KF8A 1D5ZC 1ZEQX 2B8GA 1CZWA 1JWUD 4CGYB 4IZ8A 1X3PA 2KJXA 2NN6H 1PZID 3RMHA 3KLSX 4C1NI 4RWSC 2BOSA 2RDHA 4KMUC 2JP1A 3HG9A 3O13A 2M2LA 1J9OA 3U9OA 3J80E 3QB3A 3PO3B 3HP3A 4Z9CB 5M5YB 2X69A 1B50A 1HHVA 2E74C 3FKIB 4BY1B 4A3BB 3TN2A 2DNEA 4FO2A 1Q12A 2RBMA 2WB1B 2RSOA 3CRKC 3X3NA 5DEHA 1GUSA 5CV9A 3OIQA 1O7YA 1ZXTA 3I70A 1BXTA 4WJWA 5EKKA 5KNDA 2K33A 5IGDA 4J8QA 1BQQT 4HEDA 4A3IB 3S1RB 1OXSC 1C48A 1BCPC 2LMCB 2E2DC 4QB4A 1DM0B 3ND9A 5EKLA 3VA5A 3DHQA 4ABNA 1W6KA 1Q3LA 2E2IB 4WORA 5E3FA 5JJZA 1EY5A 5EKIA 1SYEA 1JWMD 4QUCA 2PPBC 5CYUA 4KKTA 2OXPA 3OOCA 1SNOA 5IGFA 5ELCA 2I46A 3M4OB 4KN4C 3HOYB 2KHSA 1GHJA 2EY2A 4XYQA 2OT2A 4CHTB 2G9DA 3S17B 2A73B 2PMZB 3GTPB 3C3LA 1TR5A 5CMDA 4DAYA 4XQQA 3Q24A 4CJ2C 2QEJC 3I72A 3W3AA 2SOBA 3P7JA 1DCZA 1R9TB 3VR2A 1G6ZA 2KEDA 3BVZA 1XYIA 2EY5A 2WKDA 3D4DA 3M4YA 1SFOB 2F0GA 1DOMA 4AYBB 3GTLB 1ILQA 2BE5D 4TKOB 2ICEC 1LTTD 4A3JB 2RQXA 3G7LA 1VF5C 1F77A 1HA6A 5C5MA 1I4GA 1UEAB 1A6XA 2DNCA 3HRZC 2F0KA 1ENCA 1PTOB 1FYCA 4EQNA 5M5XB 1Z7TA 1EWHA 2A6EC 1SE4A 3ITPA 5IGEA 1II3A 4V190 1T5EA 5I9OA 1B2TA 4K5VA 4OHJA 4DA2A 1EYDA 4IUNA 4RHRA 1NR2A 3EA6A 1JCKB 2YU9B 2I07B 2DY7A 4MHEA 2EJMA 3DM1A 5J1ZA 3OWEB 3M85A 5LL6S 2Z4IA 4N9TA 3A55A 1RCVD 3HEJA 4IUTA 1Z6HA 1BCPF 1IHZA 4DAPA 3EJIA 2HUGA 4HCEA 3V96A 1RKNA 1S4ZA 1TS2A 4FXKC 1TVXA 1XTCD 4ID6A 4L63B 5DM73 5E4XA 1O78A 2XNAC 1V43A 3CHBD 2R92B 3BZDB 5JVH3 2F0TA 4KV6A 4ZYSA 5EJWA 4BWGB 5K36G 5CBAE 4RGTA 4WRDA 1SYBA 4G7ZC 2IW3A 4R8IA 2L4NA 2F0PA 2F0NA 5M9OA 1C4QA 1TY2A 1IYVA 3K5OA 1MSHA 5C4JB 1E2WA 4KK7A 1MSGA 3T13A 3NXWA 2CW0C 5BN5A 1ET6A 1GUTA 2Q8TA 3U9SA 4K5XA 1EY7A 4OIJA 5EGTA 3VYTA 4NW2A 1S5DD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H9R A;  1IW7 C;  2A68 C;  3D31 A;  3OOC A;  4RCN A;  2PNR C;  1H9S A;  3ND8 A;  3T51 B;  5K36 H;  1YNJ C;  3GQB A;  1CI3 M;  3T53 B;  1SMY C;  3VR6 A;  2B8G A;  2BA1 A;  4LK1 C;  3T56 B;  1CTM A;  1ZKO A;  3MXU A;  2ZT9 C;  4G7H C;  1HTP A;  4KN4 C;  2BE5 C;  1HCZ A;  5KNB A;  1GHJ A;  2NN6 H;  1IYU A;  1LAC A;  2A69 C;  1LAB A;  2EJM A;  4XTC S;  4I7Z C;  1GUN A;  4XIG S;  2R6G A;  3M85 A;  2F1M A;  2NN6 G;  5C0X H;  1TKW B;  2AUJ D;  3PUX A;  4DNT B;  1V8Q A;  5BN3 A;  3EQL C;  2A68 D;  4DNR B;  1PMR A;  3OW7 A;  1HQM C;  3LNN A;  2B8F A;  1Q1B A;  1K8O A;  1Q1E A;  1Z6H A;  5JEA G;  4KMU C;  3PUZ A;  1OXV A;  2EJG C;  3LWU A;  4H13 C;  4BA1 I;  2DN8 A;  1E2Z A;  3A7A B;  3HGB A;  2K7V A;  1CFM A;  2D2C C;  2BDO A;  1K8M A;  3I72 A;  1BDO A;  1E2V A;  3W3A A;  3RLF A;  3DXJ C;  2V4D A;  1VF7 A;  1DCZ A;  2AUK A;  4PV1 C;  3VR2 A;  5JEA H;  1QJO A;  2IT1 A;  2Q8I B;  2NN6 I;  4HR7 B;  2E74 C;  1B9M A;  2K32 A;  3PV0 A;  2EJF C;  1HPC A;  2L5T A;  2KA7 A;  3IFT A;  2EDG A;  3QIA A;  3M7N A;  4KKS A;  1O78 A;  1OXU A;  1Y8P B;  2E76 C;  1V43 A;  2A6E D;  2DNE A;  3P20 A;  3QJY A;  4GZY C;  2D62 A;  4OO1 H;  2A6H C;  3VA7 A;  3M4Y A;  3QG1 A;  3VR4 A;  1Y8N B;  3SE0 A;  5C0X G;  1I6V C;  1H9M A;  1Q12 A;  4KHZ A;  2EVB A;  2BE5 D;  4BA2 I;  4TKO B;  4KKU A;  5KNC A;  4DK1 A;  5K36 G;  2JEB I;  1H9S B;  2KCC A;  5BN4 A;  3A8I E;  2JXM B;  3IKJ A;  3AB9 A;  2D5D A;  3CRK C;  1YNN C;  3FMC A;  1IW7 D;  4TQU S;  1OXT A;  4LJZ C;  4IFD H;  1VF5 C;  1ZYR C;  4JBW A;  1GUS A;  2E75 C;  3PUV A;  4G7Z C;  1Y69 U;  3VR3 A;  1GJX A;  3SDZ A;  3D4R A;  1FR3 A;  1B9N A;  1A6X A;  2AWO A;  1TU2 B;  1GUO A;  2DNC A;  3A7L A;  3PUY A;  4KN7 C;  1G29 1;  1ONL A;  1H9J A;  3GD7 A;  4DK0 A;  3KLR A;  2A69 D;  2PCF B;  3N6R A;  1DD2 A;  5KND A;  2K33 A;  3A8K E;  1GUG A;  2O5J C;  1IYV A;  1FYC A;  1O7L A;  4IQZ A;  3WDN A;  4KI0 A;  1OXS C;  1DXM A;  1OXX K;  1Y8O B;  3A8J E;  2BA0 A;  1Z7T A;  2JE6 I;  1E2W A;  2LMC B;  1EWH A;  3PUW A;  1VCI A;  1GHK A;  2A6E C;  3BDO A;  3ND9 A;  2YYZ A;  1H9K A;  3VR5 A;  3FPP A;  2CW0 C;  2QF7 A;  2A6H D;  3CRL C;  3NE5 B;  3L7Z C;  4L8J A;  5A35 A;  2JEA I;  4OGQ C;  5BN5 A;  1T5E A;  4G7O C;  1Q90 A;  1GUT A;  4H44 C;  4JK1 C;  3H94 A;  3TZU A;  3I73 A;  3U9S A;  3I4L A;  4IFD G;  4H0L C;  4OO1 G;  1VDZ A;  3MFY A;  2PPB C;  4KKT A;  2O5I C;  3BG3 A;  3OPO A; 
#chains in the Genus database with same CATH topology
 4JI7 Q;  3SK6 A;  1EYC A;  3IL8 A;  3NQT A;  3QO2 A;  3T53 B;  2PQE A;  1IBK Q;  2UU9 L;  3CC4 A;  3D6W A;  5D3I B;  1D5M C;  1UEB A;  3GV3 A;  1KAA A;  4A3J G;  5IP9 H;  4HSP A;  5M3M G;  2K03 A;  1IL8 A;  2RCF A;  1Z47 A;  2R92 G;  4I7Z C;  2JA6 G;  5CR3 A;  2F1M A;  5C0X H;  2HHH Q;  4P75 A;  3K57 A;  1AN8 A;  5FK9 C;  3GV6 A;  1LV9 A;  1K8O A;  1KXL A;  1A3T A;  1AFP A;  4EQP A;  3UDG A;  2EQS A;  3PUZ A;  5AJ3 L;  2R61 A;  2K14 A;  1IYJ B;  4H13 C;  4DNI A;  2F0L A;  3RNU A;  3K5N A;  4Q5V A;  4A3D H;  4HMI A;  2Z6K A;  2RVL A;  1X54 A;  1K8M A;  5GQO A;  3J7A F;  3M3Y H;  4C3J H;  1GO3 E;  2RKS A;  1QJO A;  2Q2I A;  5T1I A;  5J22 A;  1O80 A;  4O1N A;  1HPC A;  1UUP A;  2IY5 B;  2NB0 A;  3P20 A;  3I91 A;  1PH6 A;  1SRO A;  4PMB A;  1YNJ D;  4DV2 Q;  2L15 A;  5C0X G;  1CK1 A;  1EQV A;  1H9M A;  1CSQ A;  4KHZ A;  2ZXO A;  2J0T D;  5IYB G;  1LT6 D;  5I6Y A;  4K6L A;  3S1M B;  4JW0 A;  1YIJ A;  2B2U A;  2D5D A;  1B3A A;  3K8A A;  3G6E A;  2NZO A;  1HRJ A;  5EPK A;  3S14 H;  2FIN B;  3J7A 5;  3BS1 A;  4P74 A;  4JCV E;  1C8C A;  5BR8 Q;  4YIJ A;  1QZH A;  3M4O H;  1I50 B;  4DK0 A;  1XMO L;  3NEL A;  1SYD A;  4NPS A;  5AJ3 Q;  2BH2 A;  2WAC A;  5LMN L;  3SHL A;  1I50 H;  2CWP A;  3A8J E;  2K5D A;  2HQL A;  2A8V A;  2KEE A;  5M5X H;  3TP7 A;  4ALP A;  1SJE D;  1IBM Q;  4LMQ D;  2XWJ B;  4P2C B;  4BBR G;  3HS0 C;  4LAA A;  2H4O A;  4YCU A;  3PIP 3;  3TBI B;  4DUY L;  4YWK A;  4LF8 Q;  3I73 A;  2JA8 B;  1N32 L;  3J80 c;  4OO1 G;  3MFY A;  2ZTD A;  2JSO A;  1HA5 A;  2EYF A;  1WTV A;  3G71 A;  1VQL A;  4L5T A;  2K75 A;  2NVT B;  1PFN A;  1ZKO A;  1Y1W G;  3TEH B;  4DK6 C;  4JI6 L;  1NTG A;  3V05 A;  2A69 C;  5G3L D;  5GAH C;  1F2Y A;  4KD4 A;  3ZYY X;  1GUN A;  1UE5 A;  3K7A H;  1PH9 A;  3CC2 A;  4BXX H;  4DV3 Q;  5TSS A;  1TKW B;  3PUX A;  3I56 A;  1VQM A;  2IHF A;  3EQL C;  3MXN A;  3AFQ A;  1CUK A;  4IUU A;  2YTV A;  3FHW A;  3KF6 B;  1WCM G;  2F4V Q;  1QVF A;  4H7B A;  3I4O A;  5I2Y A;  1TWH H;  2XRS D;  4UDU C;  2GN5 A;  3VYU A;  3VDY A;  2UUA Q;  5FO9 B;  2AUK A;  3FP9 A;  4FYD A;  1BUV T;  2XVS A;  5HGQ A;  4N8F A;  2NN6 I;  1KRT A;  5C3W A;  5IYB H;  2TMP A;  3IFT A;  4LF8 L;  4B3M Q;  1UAP A;  2QW7 A;  4PZ8 A;  3K0X A;  1PXU A;  4DK3 C;  1T9H A;  2ENB A;  1EY6 A;  1KL9 A;  1QE6 A;  4IJH A;  2HCI A;  1A2T A;  3CCQ A;  4DR1 L;  3HOU B;  4RKB A;  1TQO A;  1EIG A;  1U0L A;  3BU2 A;  3NHH A;  1VMC A;  3SE0 A;  1I6V C;  1LT3 D;  1D1I A;  4DV4 Q;  4CDF C;  5C3X A;  1WD1 A;  1SBB B;  4C1N K;  1B53 A;  1B4O A;  1PHJ A;  3TRE A;  4EGV A;  2VUM G;  2N49 A;  4IUQ A;  4DR4 Q;  1STA A;  1MGS A;  4LFC L;  4NDX A;  1EU3 A;  4FF2 A;  3VR3 A;  4DV3 L;  3MXP A;  1NMF A;  2F0V A;  2JYO A;  1VQD A;  1X55 A;  3I4M H;  2K05 A;  1BNZ A;  4J6H A;  4KJO A;  1LM0 A;  2A69 D;  3KLR A;  2A74 C;  4IUV A;  2OQK A;  4E6I A;  1PV4 A;  1PH4 A;  4B3R L;  1B8A A;  2BDN A;  4Y52 H;  2DGY A;  1UWV A;  2OF1 A;  2MFI A;  3C1E A;  3Q22 A;  3PSI A;  3WDN A;  4A3K B;  2Q2U A;  1KIX A;  1OXX K;  3GO5 A;  3H3V I;  1SN8 A;  1MI2 A;  1VCI A;  3OMG A;  4JI2 Q;  4APV A;  4HIK A;  4TVA B;  5I4D A;  1HUN A;  1STG A;  1PFB A;  3GTO B;  3S15 B;  3AYH B;  3NEM A;  3HKZ B;  2UXC Q;  1RF2 D;  4KHP Q;  4A3L H;  1QZG A;  4IFD G;  1F9P A;  2B2Y C;  3A56 A;  4GKJ Q;  1LO5 D;  2M9V A;  4DV4 L;  3T4A C;  3CPW A;  3EN2 A;  2B2T A;  3QOL A;  1H9R A;  1SJH D;  2PNR C;  4TSS A;  2VUM B;  2RA4 A;  2QGQ A;  1YNJ C;  3GQB A;  5IP7 H;  1TWF B;  5LMN W;  2CH4 W;  4A3J H;  2PQA A;  5D14 A;  1K73 C;  2PMZ E;  3AQQ A;  2N8N A;  1KDB A;  5F2D A;  1BF4 A;  4PNY A;  4RGO S;  2HIV A;  2EYH A;  3FVQ A;  5IYC H;  3I8Z A;  1WTX A;  2UXD Q;  2F0S A;  3FKI G;  2NVX B;  3KJP A;  3BDC A;  5JPM C;  4R8N A;  2BDO A;  1E2V A;  3C2P A;  1IXR A;  4UPA A;  5I2X A;  1YJN A;  5JEA H;  1YHB A;  4B9W A;  4CKB A;  1BCP D;  4X6A H;  1PH2 A;  1W6J A;  4A3B H;  3L2P A;  4G4K A;  5M3F H;  4RHS A;  1S5F D;  1EQT A;  1AW7 A;  2F0J A;  4DGZ A;  4QIW B;  3F2C A;  3QG1 A;  5NUC A;  3TS0 A;  4UP9 A;  1WVL A;  1SMY D;  3NBH A;  3HOV G;  4FF4 A;  1PRT B;  4Y7N B;  2WAQ E;  1Q86 C;  1KNE A;  4LF6 L;  4LUV A;  4KKU A;  1MIU A;  4DK1 A;  2JEB I;  2KCC A;  4FDB A;  2Q2T A;  2B63 B;  1KNA A;  4TQU S;  5IOC A;  2LKV A;  2OQ0 A;  4X64 Q;  2PZT A;  3TME A;  3TSS A;  4ULL A;  1WTO A;  1GUO A;  2VQF Q;  4BY7 B;  4HJ9 A;  3V2T A;  1ONL A;  4WJ4 A;  2YTY A;  1R4Q B;  1I6H H;  3A8K E;  3FEW X;  3U4Z A;  5DLQ E;  4A3E B;  3J81 j;  1Y8O B;  3MEF A;  1E1O A;  1I6H B;  1EYA A;  2AQ1 B;  1EEI D;  4C3J G;  4A3G G;  1L0Y B;  1NE3 A;  2KVM A;  1CKM A;  5IGC A;  1FNU A;  4H44 C;  4DV2 L;  4GOP B;  2F3V A;  1B44 D;  5COY A;  2DJF C;  2A68 C;  3ERQ A;  4MN3 A;  4RCN A;  4BY1 H;  4IUR A;  4A75 A;  1VQI A;  3TP5 A;  3I4N B;  1SDF A;  4DXG A;  4WFN 3;  2N55 A;  2O4X A;  3S2D B;  1ILP A;  2K6A A;  1S40 A;  3NBI A;  1HTP A;  4HMJ A;  1PFM A;  1CA5 A;  1PDQ A;  1P8L A;  1LT4 D;  1QUQ B;  1YIT A;  2LS0 1;  3GTK B;  2L55 A;  2N78 A;  3H0G G;  1PTO D;  4P71 A;  1A63 A;  2B2W C;  3S1N H;  1EQR A;  5JEA G;  1EOV A;  3GTJ B;  4C3I G;  4C3H B;  5IGG A;  4ODG A;  4DF7 A;  1V1P A;  2R92 H;  2OEO A;  5GAD C;  4LW1 A;  1C7Y A;  5E1F A;  1VQC A;  2D2C C;  5KGU A;  1NAP A;  2Z0S A;  4X3S A;  3S1N B;  2IWH A;  1Q46 A;  2AQ3 B;  2Z9H A;  3QIA A;  1OXU A;  1Y8P B;  2E2H B;  1F9Q A;  1SNP A;  2D62 A;  4OWX B;  2A6H C;  3VA7 A;  1IL2 A;  5IE8 A;  1I5F A;  2F0I A;  1FGB D;  2GVB A;  4LFA Q;  2F0M A;  1N9W A;  1CM9 A;  2B2U C;  5EBC A;  3H6M A;  1TWC H;  4JI5 L;  1IBK L;  1J5E Q;  1WD0 A;  4RFB A;  1RL2 A;  4CBV A;  5IIF A;  4IFD J;  1D8L A;  1B9N A;  1HNZ Q;  1YHQ A;  3BDL A;  4GN3 B;  5I9P A;  1G29 1;  3A5U A;  4A3G H;  4O0A A;  1TWA B;  4IPC A;  3RZO H;  4A3F G;  5HUR A;  2EYM A;  2K4K A;  1O7L A;  3ER0 A;  3ERO A;  4RG1 A;  1NY4 A;  5KRU A;  1L1O A;  4C56 C;  2F3W A;  3CXC A;  1TWA H;  3HOX G;  1G2T A;  2NVY B;  4A76 A;  3SR1 A;  4GN4 B;  3S15 H;  4L5Q A;  1KAB A;  2F3I A;  2XTI A;  3CRL C;  4DR5 L;  4N8X 1;  3NE5 B;  4L8J A;  3HOW B;  2JEA I;  1VQ5 A;  2QDL A;  3PMF A;  4JVZ A;  3FDT A;  4H0L C;  1DON A;  4OWW B;  2D9U A;  1L0W A;  1HJP A;  5FLX c;  3RUZ A;  1HR0 W;  3BYY B;  3KDF A;  3TP6 A;  3I4M B;  4J1M A;  1TWC B;  2I5H A;  3VR6 A;  3TZD A;  1I4X A;  2BA1 A;  2V1C C;  4GNX A;  5JPN C;  4G7H C;  4KY5 A;  1K83 B;  2BE5 C;  5IYC G;  1KQS A;  1RTO A;  2IX1 A;  2JA9 A;  5EBD A;  3KF6 A;  4HSV A;  1ESF A;  4KHV A;  3GTM B;  3MXN B;  4A3F B;  1K83 H;  4OX9 Q;  4K0K Q;  1OO9 B;  3OW7 A;  1Q1B A;  2B63 H;  1ENA A;  4GOP C;  1J6Q A;  5G3L F;  4EQ5 A;  5HGT A;  1R4P B;  2ZTC A;  3K6O A;  1IKM A;  3HGB A;  3M4Q A;  4F88 A;  3P75 A;  1XPO A;  1RJT A;  1VQK A;  1AEX A;  1M1K C;  4I65 A;  4DR5 Q;  3CC7 A;  2YTX A;  2FHT A;  2K32 A;  2PI2 E;  3L0O A;  3PV0 A;  1Q81 C;  1VQ7 A;  4ZKC B;  2SEB D;  1PRT D;  4H02 A;  2FFK B;  2WAQ G;  5CV7 A;  4GNX C;  5EPL A;  2NVQ H;  1AE2 A;  2F0E A;  5M3F B;  1WI5 A;  2X6L A;  5COR A;  2G9H D;  1JQY D;  2HQE A;  3S2H B;  1TII D;  3RN5 A;  3KLW A;  1H9S B;  3IKJ A;  4LF5 Q;  3JAM L;  1F9S A;  1BBX C;  3OSO A;  4DKA C;  1LT5 D;  1EIH A;  3R2I A;  4IFD H;  1STY A;  4JI6 Q;  3Q23 A;  2E75 C;  2SNM A;  2Z6B A;  4X66 Q;  3E0J A;  3T1Y Q;  4YWM A;  1O7I A;  4QUF A;  2VQE L;  4DV1 L;  2AWO A;  1TU2 B;  4OX9 L;  3CCE A;  4GLV B;  3GD7 A;  4FNF A;  1U4R A;  2CVR A;  5ELD A;  3HOX B;  1GUG A;  1XWE A;  2MQH A;  3DM3 A;  4F87 A;  3M9B A;  4R4O A;  3OTO L;  5E7N A;  4MNO A;  2SDF A;  2BA0 A;  1ICW A;  3BDO A;  3VYS A;  2JA8 H;  4NKL A;  1H9K A;  2JK8 A;  3OWF A;  3TP8 A;  3HOX H;  3CME A;  3L7Z C;  4NMZ A;  5A35 A;  2E5L L;  1K8A C;  3BJU A;  2F52 A;  4IAL A;  4CDE C;  1AE3 A;  3EVQ A;  4HID A;  2MJ8 A;  2OWO A;  1SR3 A;  3S1M H;  1VQN A;  1Y1V G;  2I5M X;  4IJL A;  5I6W A;  5IY0 A;  3GDE A;  4DR4 L;  1PTO H;  1U4P A;  2C9O A;  2RHS B;  1E1T A;  2XIW A;  3E0E A;  1N33 Q;  2R6G A;  3MXG A;  3CF5 A;  5FJ8 H;  4DV0 L;  4DR3 L;  2AUJ D;  4DNT B;  1SEB D;  1F2L A;  1X9N A;  3D8G A;  3U58 A;  2CQA A;  4O42 A;  2KOL A;  2ZM6 Q;  1DZ1 A;  1JT8 A;  2VXW A;  3PIP A;  3D6C A;  4QF4 A;  1XNR Q;  4G57 A;  4LFB Q;  1WCM H;  2O2L D;  2X6G A;  1PZJ D;  3OYY A;  4AYB E;  4R4I A;  2ASB A;  1HQR D;  5T1G A;  4C2M H;  3T1H L;  3M7N A;  1YZ6 A;  5GAE C;  3MTS A;  2JA6 H;  4F7X A;  4CDC C;  4GZY C;  4MTK A;  3VR4 A;  5IT9 c;  4HIO A;  1JMC A;  1TS5 A;  3CKI B;  4K14 A;  4X65 L;  4OWT B;  2CFM A;  5FO8 B;  3DLL A;  4ZUI A;  4DU9 A;  2MGS A;  2PW5 A;  3FMC A;  5IOD A;  5C44 H;  4EVO A;  1ZYR C;  1EU4 A;  2EE1 A;  4JYA L;  1BOS A;  2Q2H A;  5L37 A;  3SDZ A;  4DR3 Q;  3C46 A;  1ESR A;  1S5E D;  3K59 A;  5IGB A;  1GOZ A;  3AU7 A;  4A3G B;  2UXD L;  2K5W A;  3R2T A;  2ZM6 L;  4JI7 L;  4FVM A;  4JI3 L;  1XNR L;  5C5L A;  3IRB A;  1HTL D;  2UU9 Q;  4CKE A;  3S16 H;  3I90 A;  2VZA A;  5J39 A;  2XWB B;  2JA6 B;  2UUC L;  1TXY A;  1VQH A;  4OXP A;  3DWQ A;  4A93 G;  2B63 G;  1G91 A;  1Y1V B;  1VS0 A;  1LTS D;  1QB5 D;  3S16 B;  2K28 A;  5CC4 A;  2ICI A;  1JR0 D;  2EYP A;  1A15 A;  5M5W H;  3J81 c;  2SNS A;  1HUM A;  2NBF A;  2PNH A;  3BZK A;  1PH3 A;  5K36 H;  4OEM B;  1YVC A;  2QIL A;  3RD4 A;  4DPG A;  2NVX H;  1NUC A;  1PH5 A;  3L9A X;  3NUC A;  1LAB A;  2K50 A;  4XQJ A;  5BN3 A;  2VQF L;  2HCC A;  1Q7Y C;  2AQ2 B;  1PH1 A;  1GD7 A;  2QCP X;  1JB3 A;  4DUZ L;  2NTS A;  4IFD I;  2K52 A;  1SNQ A;  2J4X A;  1MBY A;  2KEC A;  2MO0 A;  1IZ6 A;  3QWN A;  1F2M A;  5C0X I;  1JWS D;  3F2U A;  3ERS X;  5JEA J;  2WII B;  1KHI A;  1VQF A;  2KUM A;  3CQZ B;  4POF A;  1U4L A;  4DXF A;  2Y0S G;  2KA7 A;  4HAE A;  2XGT A;  4UP7 A;  3UE1 A;  2EOT A;  1XMO Q;  1EFW A;  4DAM A;  2R7Z G;  1PZK D;  4N9P A;  2A1A A;  1NJI C;  1EFI D;  1CKO A;  2IHE A;  1VQO A;  1SXT A;  1GKH A;  4LF4 L;  4YCW A;  1X3E A;  3I4N H;  1XX8 A;  3JC6 6;  2A19 A;  2HDL A;  3KYH C;  3UDI A;  1B1Z A;  1PLF A;  2EPB A;  3A8I E;  3CAM A;  2K01 A;  1IW7 D;  1ML0 D;  2B2V C;  2N3S A;  1HZB A;  3PIO 3;  1KLU D;  1MKH A;  1GM5 A;  2EY6 A;  2E2J B;  1TWG B;  4O2D A;  4YHH Q;  2K1B A;  2PCF B;  2B2T C;  3FRP B;  2LFN A;  1T5X D;  3WOF A;  4PG3 A;  4LF7 Q;  2JE6 I;  3PO2 B;  3PUW A;  3I55 A;  2YYZ A;  3KK7 A;  1EL0 A;  1CSP A;  1XTD A;  4DR7 Q;  3MVV A;  2I0Q A;  4V0B A;  3TDQ A;  1FJG Q;  2VB3 X;  3H09 A;  3S24 A;  1BR9 A;  3G6J B;  1WYD A;  5BR8 L;  5C4X B;  4RGN A;  1EY0 A;  1RDP D;  2IX3 A;  2O5I C;  1TS3 A;  2FMM A;  3GTQ B;  2ALY B;  4LF4 Q;  4U67 3;  1IW7 C;  1JOO A;  2KHI A;  3K5L A;  5KYL A;  3D4W A;  3AMU A;  2R7Z B;  1H9S A;  3U50 C;  2EYJ A;  1EWI A;  1SYG A;  1CI3 M;  2WP8 J;  1I3Q H;  2HDM A;  1A8V A;  3RZD H;  2ZT9 C;  5GAG C;  3UDF A;  5FO7 B;  1UNS A;  3EBE A;  1LAC A;  1IBM L;  4DV5 L;  1QWY A;  3A54 A;  4XIG S;  4I7A A;  2E2J H;  2CQO A;  1HNZ L;  4OL7 A;  1CQF A;  1I4Q A;  4PZ7 A;  4TRD A;  4UY8 C;  1AP0 A;  3B6Y A;  1PFS A;  2EXZ A;  3HKZ E;  4LF7 L;  1L2F A;  3S1Q B;  3D0F A;  1SSO A;  3LWU A;  1WCM B;  3G48 A;  1STN A;  3NTI A;  4F8M A;  1QCB D;  3K5M A;  1CFM A;  3M3Y B;  2AMC B;  1BDO A;  4LFC Q;  2V4D A;  4BBR B;  4DFA A;  2F03 A;  2KQ3 A;  2Q8I B;  1E7Z A;  5D65 A;  1FJG L;  3HOW H;  4C3H H;  3BVM A;  2EY1 A;  3RN2 A;  1PH8 A;  2YV5 A;  2A6E D;  3S2H H;  4B3R Q;  2RDG A;  4BBR H;  1Y1W B;  5DAU A;  4RKL A;  3KFU A;  3JAM E;  5LMU Q;  2JA5 G;  3CCJ A;  4U68 A;  3G4S A;  1CQV A;  5BN4 A;  2JXM B;  3AB9 A;  1PVO A;  3RZO B;  2FJ2 A;  3QR8 A;  1D5X C;  3S17 H;  1JJ2 A;  4LJZ C;  3SK4 A;  4QMG A;  2H1E A;  3MC0 B;  1HH2 P;  1MJE A;  3PUV A;  3TRZ A;  1V9P A;  5C3E H;  4FF3 A;  3D4R A;  2WFW A;  3UE0 A;  3DMU A;  3PQI A;  2PW7 A;  2PQA B;  4X62 L;  3J80 L;  1K8G A;  1VQE A;  1QIL A;  4NXN L;  2LXJ A;  2F0O A;  2JA7 B;  1SLJ A;  3P1H A;  1JB7 A;  1A0I A;  4JI0 L;  4DR1 Q;  2VL6 A;  1C9O A;  1YHA A;  2JA5 B;  3BYT B;  1QNU A;  1XMQ Q;  2NUC A;  4QIW E;  4K8J A;  4FP5 D;  3J7A V;  1EQQ A;  1KDA A;  1U9R A;  2JA7 H;  3DEO A;  2GA4 B;  1BCP B;  1JOQ A;  4CJ1 B;  1Q90 A;  4HJA A;  4R4Q A;  3I4L A;  3ZJY C;  3SK8 A;  3BG3 A;  5KIX A;  1HZA A;  3KLS A;  2CHB D;  1I94 Q;  1CKN A;  2IX0 A;  4ILW A;  2JN4 A;  1EY8 A;  4X3K A;  1PYW D;  3BVG A;  1CTM A;  2FMC A;  4LF5 L;  1C0A A;  3NSW A;  2F0U A;  1SFO H;  3J7Y W;  1J8I A;  2UUB L;  3HZX A;  2WB1 E;  5C3E B;  1I4H A;  2F4I A;  4X62 Q;  1ZYR D;  4DNR B;  1D1K A;  4K5W A;  5C44 B;  2LXK A;  2WB1 G;  3K0Y A;  4GKJ L;  3UI2 A;  2JA5 H;  3MA2 B;  1OXV A;  2C5C A;  4HN7 A;  1BO0 A;  1E2Z A;  4ZRZ A;  3NP8 A;  2G5D A;  1AZP A;  3DXJ C;  3MZ5 A;  1QNK A;  3STB D;  1EEF D;  3NTK A;  5ELB A;  2QKI C;  2AWN A;  3ONA B;  5CV6 A;  2KBN A;  2EDG A;  2E76 C;  5M3M B;  3K80 C;  3NTH A;  4A3C G;  2NYZ D;  1EY4 A;  4C3J B;  4BS9 A;  2HT1 A;  4JI4 Q;  3CCU A;  1QVC A;  1YEZ A;  1E0B A;  3PO3 G;  1I94 L;  3SXH A;  3RZD B;  5IT9 L;  4ME5 A;  1KLG D;  2NVT H;  1X32 A;  1Y1V H;  3J81 i;  3J7Z C;  4X3T A;  3D3R A;  4Q0F A;  2D0O A;  3JAM i;  1OXT A;  4B3S Q;  4A93 H;  3MFG A;  1W2B A;  2XSC A;  1JJG A;  4B9X A;  4KTA A;  1CT1 D;  3H3V H;  2A5H A;  1VQ6 A;  4JI1 L;  3PUY A;  4KN7 C;  1RIP A;  1H9J A;  3RLO A;  3S2D H;  4J15 A;  1K0S A;  2H5X A;  1AH9 A;  4R4T A;  1STH A;  2M00 A;  2EZV A;  4GKK Q;  3S14 B;  3EFX D;  1HR0 Q;  1LTI D;  1DXM A;  4GS3 A;  2CH4 A;  4LF6 Q;  4OON A;  4JC0 A;  1GHK A;  3DEP A;  2NTT A;  3QOJ A;  3VR5 A;  5IYD G;  3GTO H;  5KEE A;  1CA6 A;  2A6H D;  2EIF A;  2MPM A;  4C2M B;  4JI4 L;  4FXD A;  5C44 G;  1EY9 A;  4POG A;  3CPF A;  5M5W B;  4A3B G;  1S5B D;  1SYF A;  3E9I A;  2HD3 A;  4A3M B;  3SEB A;  4MTN A;  4X65 Q;  4AQY Q;  1G2S A;  3T56 B;  1V1O A;  2L9H A;  3GTG H;  4LWC A;  5KNB A;  4XDX A;  4EQO A;  5LL6 X;  4JYA Q;  5C4Z A;  3S9W A;  4DV6 L;  5EPJ A;  4KD3 A;  2ZXP A;  2L12 A;  1X3Q A;  1PRT C;  4K2L A;  4RA8 A;  3LNN A;  1MHW C;  4GKK L;  4JV5 Q;  4KY7 A;  1WTR A;  2GVA A;  2PYK A;  3S1R H;  4JI3 Q;  3ULJ A;  4C3H G;  3GP7 A;  3A7A B;  1ENF A;  1J5E L;  2K7V A;  3OW2 A;  1DYQ A;  1VQJ A;  4PV1 C;  2IT1 A;  4RH6 A;  3KDF B;  4XXE A;  1D2B A;  2K5Q A;  4KKS A;  1XPR A;  2B2W A;  4R1J A;  3QJY A;  1U5K A;  3HOZ B;  4K8I A;  4MZ9 A;  1DGS A;  5JOB A;  3H15 A;  1STB A;  1K3B C;  4JOI C;  2EVB A;  5FLM H;  1MD2 D;  2KCN A;  1HFN A;  4AQY L;  4PMC A;  3KBG A;  4YY3 L;  3IAY A;  4A3D G;  2F0Q A;  5A2Q E;  5FLX L;  2N88 A;  3J81 E;  1HFG A;  1KD1 C;  4IPH A;  1DOL A;  3N6R A;  4QL5 A;  1DD2 A;  4XT3 B;  3NK9 A;  4ZQ3 A;  1CKN B;  3KBX A;  1SE8 A;  4K6D A;  4BBS B;  1YNN D;  4KI0 A;  3AFP A;  5C4J H;  4EX5 A;  2PZW A;  4B3T Q;  3L3O C;  2WKC A;  5CV5 A;  4AIM A;  1SE2 A;  1KC8 C;  4ZLT F;  2ZJQ A;  1PH7 A;  4ME3 A;  4P72 A;  1AZQ A;  3SGI A;  1GVP A;  1PA6 A;  2HHH L;  1CZG A;  2CCZ A;  1TWF H;  2MO1 A;  3F1Z A;  4IPG A;  4A3I H;  1PTO F;  2HIX A;  5DM6 3;  4YWL A;  1I4P A;  4NXM Q;  3OPO A;  2F0H A;  1S3O A;  5C4X H;  2F0W A;  3CCL A;  4OIK A;  2JA7 G;  5IT9 E;  3T51 B;  2MP1 A;  1CHQ D;  3W1G A;  1JOR A;  1PYB A;  1SMY C;  3MHB A;  1QVG A;  5C0X J;  2NVQ B;  4LK1 C;  3CD6 A;  1HNW Q;  5EQ0 A;  5IWA Q;  4NB3 A;  3Q6S A;  1HCZ A;  1NCV A;  1N36 L;  1A62 A;  2ID0 A;  1O7Z A;  2VS1 A;  4YCV A;  4DR6 Q;  1L0X B;  3HOV H;  1V8Q A;  1TWG H;  4YHH L;  2R7F A;  2XN9 C;  2CWA A;  1QUQ A;  1K28 A;  3RLN A;  1GXD C;  4HCS A;  3PGZ A;  1JC7 A;  3R8B A;  1VF7 A;  1XXG A;  3HOV B;  4M8A A;  4DR7 L;  1GUW A;  4RGM A;  2Z8L A;  1R9T H;  2R7D A;  4OO1 H;  5LMN Q;  1KAW A;  1S5C D;  1NNX A;  2EYL A;  5ELE A;  4M1U B;  1UE6 A;  1Y8N B;  3SVM A;  1M8A A;  4AH6 A;  3HOU H;  3W2D A;  3CQZ H;  2IJ0 A;  3T16 A;  4ZUJ A;  2MUY A;  1LTB D;  3K7A B;  1JE5 A;  4XYO A;  1BKB A;  1LYL A;  2J7Z A;  1N36 Q;  1E3P A;  2E5L Q;  4FXG C;  4JBW A;  1JJC B;  3LX0 A;  1FL0 A;  1GJX A;  4DR6 L;  2EYO A;  1JE4 A;  1TWH B;  3DWA A;  1YJ9 A;  3A0J A;  4ZK9 B;  2K5N A;  4DN4 M;  4KJN A;  4R4C A;  1SND A;  1N34 Q;  4IQZ A;  3GTM H;  4A3K H;  2DJG C;  1E22 A;  1LTA D;  3NQI A;  3FPP A;  4GLX A;  2B2V A;  1N33 L;  2EXD A;  2WAQ B;  3U4V A;  1WFQ A;  2BH8 A;  2PZU A;  3ICE A;  1SAP A;  3E6Z X;  2B39 A;  1RD9 D;  4G7O C;  2B2Y A;  2VNU D;  1TT2 A;  1QOH A;  3H94 A;  3T1Y L;  1YNX A;  1Q82 C;  2VQE Q;  1JOK A;  1VDZ A;  1QG7 A;  1VQG A;  2F4V L;  4PMW A;  5M5Y H;  2RCN A;  4UAI A;  1E24 A;  1FNW A;  4LFB L;  4NP5 A;  5DNF A;  5LMU L;  1G6P A;  4RCO A;  3OMC A;  3ND8 A;  1LTG D;  2Y0S B;  5KYI A;  3OTO Q;  4QGU A;  4GLA C;  5A2Q L;  3HOZ H;  3MXU A;  1DOK A;  2RDF A;  1IYU A;  3C1F A;  2L1B A;  3KJO A;  2XRQ D;  2NN6 G;  2QDB A;  1HNX L;  4DUY Q;  1Q8I A;  1SE3 A;  3WOE A;  4B08 A;  4A93 B;  5K5P A;  1HQM C;  3PO2 G;  1Q1E A;  1FVI A;  1CHP D;  1X6O A;  1VQB A;  3CCR A;  1N34 L;  4R9W A;  2WV6 D;  2Z4H A;  5EAY A;  4CKC A;  1F9R A;  2EJG C;  4BA1 I;  3CCM A;  4JI0 Q;  3Q0A A;  3GTK H;  3K81 C;  3RLF A;  3JAM c;  4QQB X;  1ET9 A;  3FPU B;  1XMQ L;  3H0G H;  4IUP A;  3S1Q H;  3FKI H;  5ISR A;  3R3O A;  3E9H A;  2OCE A;  1B9M A;  2PI2 A;  4PQX A;  5C4H A;  2EJF C;  4QCL A;  2L5T A;  4L6T B;  5JAV A;  1HXY D;  2L0C A;  2MHV A;  3DWP A;  2VY3 A;  2NZ1 D;  3H0G B;  5FKA C;  1IBL L;  5FJ8 G;  3K58 A;  1IKL A;  3HOY H;  4BA2 I;  1STE A;  2R7Z H;  5LHY 1;  5C6A A;  1I3Q B;  3HKZ G;  4S3S A;  4LF9 Q;  3H3V C;  4KLK A;  2VB2 X;  4IPD A;  1D6E C;  3A74 A;  3MAQ A;  4KHP L;  3J81 L;  2RSN A;  2UUA L;  3EIV A;  3URY A;  3VYR A;  4JBJ A;  1Y69 U;  4FF1 A;  3GTP H;  3I4N G;  2UUB Q;  5FLX E;  3E5S A;  3CU7 A;  1SNC A;  1NR4 A;  2Q8R E;  3I3C A;  2RF4 A;  4DAV A;  3A7L A;  1EZ8 A;  3NPP A;  4B3M L;  1UE7 A;  3GTJ H;  1ROD A;  2NVY H;  1G8Z D;  4XT1 B;  2O5J C;  5C3E G;  4XQN A;  5ELF A;  1YI2 A;  1B7Y B;  4K2K A;  5CGK A;  1ASY A;  1NBW A;  3X3M A;  1TS4 A;  3N52 A;  3CW2 C;  1LLR D;  2ZJR A;  1X3G A;  2I5L X;  2PO4 A;  2QF7 A;  1P16 A;  4BXX G;  5CBE E;  3CCS A;  1WTH A;  2Y0S E;  2ES2 A;  4OGQ C;  1F2Z A;  1FGU A;  3PF4 A;  2F0F A;  2R3Z A;  4DUZ Q;  1Y1W H;  1A3U A;  4IOC A;  3KUP A;  2TSS A;  4RAU C;  1PTO C;  4BY7 G;  1SNM A;  4C3I B;  5FOB B;  1M90 C;  5FLM G;  4OO1 I;  4IOA A;  3NWS A;  1FNV A;  4B3S L;  1I4R A;  5E4W C;  3CMA A;  3OIP A;  5CV8 A;  4L5S A;  2NWG A;  4XTC S;  4MIU A;  4HTH A;  1XNQ Q;  2UXB L;  2F0D A;  2A68 D;  4AYB G;  1PMR A;  4JI1 Q;  1EZ6 A;  2B8F A;  1A2U A;  4HJ5 A;  4ZAI A;  5JJK A;  1TY0 A;  1RTN A;  3HOY G;  4A3C H;  2DN8 A;  1VMP A;  5D3D A;  1RHP A;  4BBS G;  3UDX A;  1B3Q A;  1L1O C;  2QA4 A;  1KDC A;  1WTQ A;  1BBU A;  3LWE A;  1Y14 B;  4HR7 B;  3MWY W;  4JBM A;  2JJQ A;  2P5Z X;  2L11 A;  1BBW A;  2ZXR A;  1NSN S;  1EWC A;  2CKZ B;  3SK5 A;  3E3X A;  5AFW A;  1WTW A;  1JIC A;  1M4V A;  1A3V A;  2BCO A;  4IN3 A;  4ZCK A;  5JVG 3;  1EOT A;  5KNC A;  4LUZ A;  2MNA A;  3DUZ A;  1XJV A;  3M7G A;  2Z6K C;  1MJC A;  4X3U A;  1W3S A;  1YNN C;  1KTK A;  1LTR D;  2DY8 A;  3GTG B;  3MEH A;  3W1B A;  1FR3 A;  1WJJ A;  5CV4 A;  1V1P B;  2CW0 D;  1PRT F;  2RHQ B;  4DV6 Q;  2B3G A;  3H91 A;  4CJ0 B;  2IPK D;  1D7Q A;  1DJR D;  2LY7 A;  3RR5 A;  2AHO B;  1ICF B;  3KF8 B;  4JV5 L;  4A3D B;  1HZ9 A;  2WIN B;  1X65 A;  1SYC A;  4DV5 Q;  3NWT A;  4A3I G;  2K04 A;  3OHX C;  4X64 L;  3IFD A;  4JK1 C;  3R93 A;  2FXQ A;  3TZU A;  1SRU A;  2Z1C A;  4ZKB B;  2IL8 A;  1S72 A;  1WTP A;  1U4M A;  1Z9F A;  2R93 B;  1FD7 D;  4KY6 A;  4GOP A;  3D31 A;  3KF8 A;  1D5Z C;  1ZEQ X;  2B8G A;  1CZW A;  1JWU D;  2AKW B;  4IZ8 A;  4CGY B;  1X3P A;  4YY3 Q;  2KJX A;  4LUO A;  2NN6 H;  1PZI D;  3RMH A;  3KLS X;  3PCO B;  1VQA A;  4C1N I;  4RMF A;  4RWS C;  3HOZ G;  2BOS A;  2RDH A;  4KMU C;  2K5V A;  2JP1 A;  3HG9 A;  3LGJ A;  3O13 A;  2M2L A;  1J9O A;  3U9O A;  2ZTE A;  3J80 E;  4JI5 Q;  3QB3 A;  4L5R C;  5JJL A;  3PO3 B;  4DAY B;  4OEL B;  3HP3 A;  4Z9C B;  4B3T L;  1LUZ A;  5M5Y B;  2X69 A;  1B50 A;  1HHV A;  2E74 C;  3FKI B;  4BY1 B;  4A3B B;  3ULL A;  2E2I H;  3I4M G;  3TN2 A;  4UHV A;  2E2H H;  2DNE A;  1N32 Q;  4FO2 A;  2YU9 H;  2D0P A;  3K7U C;  1Q12 A;  4NXM L;  2RBM A;  2VUM H;  2WB1 B;  3NEN A;  2NZH A;  4A3M H;  2RSO A;  3CRK C;  3X3N A;  5DEH A;  3HFZ B;  1HZC A;  1NMG A;  1GUS A;  1K3R A;  3TS2 A;  5CV9 A;  3OIQ A;  3PF5 A;  1O7Y A;  1ZXT A;  4GNX B;  3I70 A;  1BXT A;  4WJW A;  5EKK A;  3F2D A;  5KND A;  2K33 A;  1VQ8 A;  2C35 B;  5IGD A;  4LFA L;  4J8Q A;  1BQQ T;  4HED A;  4A3I B;  3S1R B;  1OXS C;  1C48 A;  1BCP C;  1UE1 A;  3HOU G;  2VW9 A;  2LMC B;  4JG2 A;  2E2D C;  4QB4 A;  1DM0 B;  3ND9 A;  5EKL A;  3VA5 A;  3DHQ A;  4ABN A;  4BBS H;  2ATW A;  3ULP A;  1W6K A;  2E8G A;  1Q3L A;  2E2I B;  1B70 B;  4WOR A;  5E3F A;  5JJZ A;  1EY5 A;  5EKI A;  4WJ3 M;  1SYE A;  1JWM D;  3BZC A;  4QUC A;  2PPB C;  5CYU A;  3GTQ H;  5IYD H;  4KKT A;  2OXP A;  4UP8 A;  1VQP A;  1WOC A;  2R93 G;  3OOC A;  4NXN Q;  5H1S E;  1SNO A;  5IGF A;  3GTL H;  4GN5 A;  5ELC A;  2I46 A;  5J3B A;  3M4O B;  1PYS B;  4KN4 C;  3HOY B;  2KHS A;  3KOJ A;  1GHJ A;  2EY2 A;  1SMX A;  4XYQ A;  4BY7 H;  2OT2 A;  5IP9 G;  5GRO A;  4CHT B;  1EUJ A;  2G9D A;  3S17 B;  4JI8 L;  1V1Q A;  2A73 B;  2PMZ B;  3GTP B;  3HKS A;  1KRS A;  2KEN A;  2B29 A;  1TR5 A;  3C3L A;  5CMD A;  4DAY A;  1EIF A;  4XQQ A;  3Q24 A;  4CJ2 C;  2QEJ C;  4HIM A;  3I72 A;  4JI2 L;  3W3A A;  2SOB A;  2QEX A;  3P7J A;  1DCZ A;  4QY7 A;  3VR2 A;  1R9T B;  2JA8 G;  2K5H A;  1G6Z A;  4Y7N H;  2KED A;  2UXC L;  3BVZ A;  1XYI A;  3AEV A;  2EY5 A;  2WKD A;  3J80 i;  5M3M H;  3D4D A;  3M4Y A;  1SFO B;  2F0G A;  1DOM A;  4AYB B;  4K0K L;  3GTL B;  1ILQ A;  1G51 A;  2BE5 D;  4TKO B;  2ICE C;  1LTT D;  4A3J B;  2RQX A;  3G7L A;  1VQ9 A;  1VF5 C;  1F77 A;  1HA6 A;  5C5M A;  1I4G A;  1UEA B;  1A6X A;  2DNC A;  1K0R A;  4JI8 Q;  1HNX Q;  3HRZ C;  2F0K A;  1EYG A;  3PO2 H;  1ENC A;  1PTO B;  4JOI A;  4PZ6 A;  3TQY A;  1FYC A;  3M4P A;  1H95 A;  4EQN A;  1EIY B;  5M5X B;  1Z7T A;  1EWH A;  2A6E C;  5HY6 A;  2DUD A;  1SE4 A;  1X3F A;  2OTJ A;  3ITP A;  5IGE A;  4IO9 A;  3F2B A;  1II3 A;  4HJ7 A;  4V19 0;  1BVS A;  1T5E A;  5I9O A;  4X66 L;  1B2T A;  4K5V A;  1XPU A;  4DV1 Q;  4OHJ A;  4CDD C;  4DA2 A;  1EYD A;  4IUN A;  4DR2 L;  4RHR A;  1IBL Q;  2KCM A;  1NR2 A;  3EA6 A;  1HR0 L;  4HJ8 A;  4LF9 L;  1JCK B;  1VQ4 A;  2YU9 B;  3WWV A;  2I07 B;  2DY7 A;  4MHE A;  2EJM A;  4P73 A;  3DM1 A;  4BY1 G;  5J1Z A;  4JBK A;  3OWE B;  3F8T A;  3M85 A;  1X56 A;  3CP0 A;  5LL6 S;  1Q8K A;  2Z4I A;  1LTL A;  4N9T A;  3A55 A;  1RCV D;  2KCT A;  3HEJ A;  4IUT A;  1Z6H A;  1YJW A;  5JJI A;  1BCP F;  4DV7 Q;  3NBH B;  1IHZ A;  4A3E G;  4DAP A;  3EJI A;  4QJF A;  2ZJP A;  3PO3 H;  2HUG A;  4HCE A;  3V96 A;  1RKN A;  1S4Z A;  1TS2 A;  4FXK C;  2OTL A;  4A3K G;  1TVX A;  1XTC D;  4L63 B;  4ID6 A;  5DM7 3;  5E4X A;  1O78 A;  2XNA C;  1V43 A;  3CHB D;  3Q8D A;  2R92 B;  3BZD B;  5M3F G;  4DV0 Q;  3CCV A;  5JVH 3;  4DR2 Q;  2F0T A;  4A3M G;  4KV6 A;  4ZYS A;  5EJW A;  3STB C;  3PIO A;  4BWG B;  5K36 G;  5CBA E;  2R93 H;  4RGT A;  5ELO A;  4WRD A;  2UUC Q;  3I7F A;  2KHJ A;  1SYB A;  4G7Z C;  2IW3 A;  3W5O A;  4R8I A;  2L4N A;  3A5Z B;  4A3F H;  2F0P A;  3T1H Q;  3HOW G;  2F0N A;  1XNQ L;  5M9O A;  2UXB Q;  1YBY A;  1C4Q A;  1TY2 A;  1IYV A;  4DV7 L;  3K5O A;  1HNW L;  4A3E H;  1L1O B;  5ELN A;  1MSH A;  5IWA L;  5C4J B;  1E2W A;  4KK7 A;  4A4I A;  4LNQ A;  3I2Z A;  1MSG A;  1K9M C;  3T13 A;  3NXW A;  2CW0 C;  1N8R C;  1OTC A;  2JQO A;  5IP7 G;  5BN5 A;  1ET6 A;  1GUT A;  2Q8T A;  3U9S A;  4C3I H;  4K5X A;  4JPB W;  1ASZ A;  5C4X G;  1EY7 A;  4A3L G;  4OIJ A;  5EGT A;  2LSS A;  3VYT A;  4NW2 A;  1S5D D; 
#chains in the Genus database with same CATH homology
 3SK6 A;  1EYC A;  3IL8 A;  3NQT A;  3QO2 A;  3T53 B;  2PQE A;  3D6W A;  5D3I B;  1D5M C;  3GV3 A;  1KAA A;  4HSP A;  2K03 A;  1IL8 A;  1Z47 A;  4I7Z C;  5CR3 A;  2F1M A;  5C0X H;  3K57 A;  1AN8 A;  5FK9 C;  3GV6 A;  1LV9 A;  1K8O A;  1A3T A;  1AFP A;  4EQP A;  3PUZ A;  2R61 A;  4H13 C;  2F0L A;  3K5N A;  4Q5V A;  4HMI A;  2RVL A;  1K8M A;  3J7A F;  2RKS A;  1QJO A;  5T1I A;  5J22 A;  1O80 A;  4O1N A;  1HPC A;  1UUP A;  2NB0 A;  3P20 A;  3I91 A;  4PMB A;  1YNJ D;  5C0X G;  1EQV A;  1CK1 A;  1H9M A;  4KHZ A;  2ZXO A;  2J0T D;  1LT6 D;  5I6Y A;  4K6L A;  3S1M B;  2B2U A;  2D5D A;  1B3A A;  1HRJ A;  5EPK A;  2FIN B;  3BS1 A;  1C8C A;  4YIJ A;  1I50 B;  4DK0 A;  1SYD A;  2WAC A;  3SHL A;  3A8J E;  2K5D A;  2KEE A;  3TP7 A;  1SJE D;  4LMQ D;  2XWJ B;  4P2C B;  3HS0 C;  4LAA A;  2H4O A;  3PIP 3;  3TBI B;  3I73 A;  2JA8 B;  4OO1 G;  3MFY A;  2JSO A;  1HA5 A;  2EYF A;  1WTV A;  2NVT B;  1PFN A;  1ZKO A;  3V05 A;  2A69 C;  5G3L D;  1F2Y A;  4KD4 A;  3ZYY X;  1GUN A;  5TSS A;  1TKW B;  3PUX A;  3EQL C;  3MXN A;  4IUU A;  4H7B A;  5I2Y A;  2XRS D;  4UDU C;  3VYU A;  5FO9 B;  2AUK A;  4FYD A;  1BUV T;  2XVS A;  2NN6 I;  5C3W A;  2TMP A;  3IFT A;  1UAP A;  1PXU A;  2ENB A;  1EY6 A;  1QE6 A;  2HCI A;  1A2T A;  3HOU B;  4RKB A;  1TQO A;  1EIG A;  3SE0 A;  3NHH A;  5C4X B;  1VMC A;  1I6V C;  1LT3 D;  1D1I A;  5C3X A;  1WD1 A;  1SBB B;  4C1N K;  1B53 A;  1B4O A;  4EGV A;  4IUQ A;  1STA A;  1MGS A;  4NDX A;  1EU3 A;  4FF2 A;  3VR3 A;  2F0V A;  3MXP A;  2JYO A;  2K05 A;  1BNZ A;  4J6H A;  4KJO A;  4E6I A;  3KLR A;  2A69 D;  2A74 C;  4IUV A;  2BDN A;  3C1E A;  2OF1 A;  3Q22 A;  3WDN A;  4A3K B;  1OXX K;  3GO5 A;  1MI2 A;  1VCI A;  3OMG A;  5I4D A;  1HUN A;  1STG A;  1PFB A;  3GTO B;  3S15 B;  3HKZ B;  1RF2 D;  4IFD G;  1F9P A;  2B2Y C;  3A56 A;  1LO5 D;  2M9V A;  3T4A C;  2B2T A;  3QOL A;  1H9R A;  1SJH D;  2PNR C;  4TSS A;  2VUM B;  2RA4 A;  1YNJ C;  3GQB A;  1TWF B;  5D14 A;  1KDB A;  5F2D A;  1BF4 A;  4PNY A;  4RGO S;  3FVQ A;  2EYH A;  1WTX A;  3I8Z A;  2F0S A;  2NVX B;  3BDC A;  5JPM C;  4R8N A;  2BDO A;  1E2V A;  3C2P A;  5I2X A;  5JEA H;  4B9W A;  4CKB A;  1BCP D;  1W6J A;  4G4K A;  4RHS A;  1S5F D;  1EQT A;  1AW7 A;  2F0J A;  4DGZ A;  4QIW B;  3QG1 A;  5NUC A;  1WVL A;  1SMY D;  3NBH A;  4FF4 A;  1PRT B;  4Y7N B;  1KNE A;  4KKU A;  4DK1 A;  2JEB I;  2KCC A;  2B63 B;  1KNA A;  4TQU S;  5IOC A;  2LKV A;  2PZT A;  3TME A;  3TSS A;  4ULL A;  1WTO A;  1GUO A;  4BY7 B;  3V2T A;  1ONL A;  1R4Q B;  3A8K E;  3FEW X;  4A3E B;  1Y8O B;  1I6H B;  1EYA A;  2AQ1 B;  1EEI D;  4C3J G;  1L0Y B;  2KVM A;  5IGC A;  1FNU A;  4H44 C;  2F3V A;  1B44 D;  5COY A;  2A68 C;  3ERQ A;  4MN3 A;  4RCN A;  4IUR A;  3TP5 A;  3I4N B;  1SDF A;  4DXG A;  4WFN 3;  2N55 A;  2O4X A;  3S2D B;  1ILP A;  2K6A A;  3NBI A;  1HTP A;  4HMJ A;  1PFM A;  1CA5 A;  1PDQ A;  1LT4 D;  2LS0 1;  3GTK B;  2L55 A;  1PTO D;  2B2W C;  5JEA G;  3GTJ B;  4C3I G;  4C3H B;  5IGG A;  4ODG A;  4DF7 A;  1V1P A;  2OEO A;  5E1F A;  2D2C C;  5KGU A;  1NAP A;  4X3S A;  3S1N B;  2IWH A;  2AQ3 B;  3QIA A;  1OXU A;  1Y8P B;  2E2H B;  1F9Q A;  1SNP A;  2D62 A;  2A6H C;  3VA7 A;  2F0I A;  1FGB D;  2F0M A;  1CM9 A;  2B2U C;  5EBC A;  3H6M A;  1WD0 A;  4RFB A;  5IIF A;  4CBV A;  4IFD J;  1B9N A;  3BDL A;  5I9P A;  1G29 1;  1TWA B;  5HUR A;  2EYM A;  1O7L A;  3ERO A;  5KRU A;  4C56 C;  2F3W A;  1G2T A;  2NVY B;  3SR1 A;  1KAB A;  3CRL C;  3NE5 B;  4L8J A;  3HOW B;  2JEA I;  3PMF A;  3FDT A;  4H0L C;  1DON A;  2D9U A;  3RUZ A;  3BYY B;  3TP6 A;  3I4M B;  4J1M A;  1TWC B;  3VR6 A;  3TZD A;  1I4X A;  2BA1 A;  5JPN C;  4G7H C;  4KY5 A;  1K83 B;  2BE5 C;  1RTO A;  2IX1 A;  5EBD A;  4HSV A;  1ESF A;  4KHV A;  3GTM B;  4A3F B;  1OO9 B;  3OW7 A;  1Q1B A;  1ENA A;  5G3L F;  5HGT A;  1R4P B;  3K6O A;  1IKM A;  3HGB A;  4F88 A;  3P75 A;  1RJT A;  1AEX A;  4I65 A;  2FHT A;  2K32 A;  3PV0 A;  4ZKC B;  2SEB D;  1PRT D;  2FFK B;  5CV7 A;  5EPL A;  2F0E A;  5M3F B;  2X6L A;  5COR A;  2G9H D;  1JQY D;  2HQE A;  3S2H B;  1TII D;  1H9S B;  3IKJ A;  3JAM L;  1F9S A;  1BBX C;  3OSO A;  1LT5 D;  1EIH A;  3R2I A;  4IFD H;  1STY A;  3Q23 A;  2E75 C;  2SNM A;  3E0J A;  4QUF A;  2AWO A;  1TU2 B;  3GD7 A;  4FNF A;  1U4R A;  2CVR A;  5ELD A;  3HOX B;  1GUG A;  1XWE A;  4F87 A;  2SDF A;  2BA0 A;  1ICW A;  3BDO A;  3VYS A;  4NKL A;  1H9K A;  3OWF A;  3TP8 A;  3L7Z C;  4NMZ A;  5A35 A;  4IAL A;  3EVQ A;  2MJ8 A;  5I6W A;  1PTO H;  1U4P A;  2C9O A;  2XIW A;  2R6G A;  3MXG A;  4DNT B;  2AUJ D;  1SEB D;  1F2L A;  3D8G A;  2CQA A;  4O42 A;  2KOL A;  1DZ1 A;  2VXW A;  3D6C A;  4QF4 A;  4G57 A;  2O2L D;  2X6G A;  1PZJ D;  1HQR D;  5T1G A;  3M7N A;  3MTS A;  4F7X A;  4GZY C;  3VR4 A;  1TS5 A;  3CKI B;  4K14 A;  5FO8 B;  4ZUI A;  4DU9 A;  2MGS A;  2PW5 A;  3FMC A;  5IOD A;  4EVO A;  1ZYR C;  1EU4 A;  2EE1 A;  1BOS A;  3SDZ A;  3C46 A;  1ESR A;  1S5E D;  3K59 A;  5IGB A;  1GOZ A;  3AU7 A;  4A3G B;  2K5W A;  3R2T A;  4FVM A;  5C5L A;  1HTL D;  4CKE A;  3I90 A;  5J39 A;  2XWB B;  2JA6 B;  3DWQ A;  1G91 A;  1Y1V B;  1LTS D;  1QB5 D;  3S16 B;  2K28 A;  5CC4 A;  2ICI A;  1JR0 D;  2EYP A;  1A15 A;  2SNS A;  1HUM A;  2NBF A;  5K36 H;  2QIL A;  3RD4 A;  1NUC A;  3L9A X;  3NUC A;  1LAB A;  4XQJ A;  5BN3 A;  2HCC A;  2AQ2 B;  2QCP X;  1JB3 A;  2NTS A;  4IFD I;  1SNQ A;  2J4X A;  1MBY A;  2KEC A;  3QWN A;  1F2M A;  5C0X I;  1JWS D;  3F2U A;  5JEA J;  2WII B;  2KUM A;  3CQZ B;  1U4L A;  4DXF A;  2KA7 A;  4HAE A;  2EOT A;  1PZK D;  4N9P A;  1EFI D;  1SXT A;  1XX8 A;  4ZKB B;  2HDL A;  1B1Z A;  1PLF A;  2EPB A;  3A8I E;  2K01 A;  1IW7 D;  1ML0 D;  2B2V C;  3PIO 3;  1KLU D;  2EY6 A;  2E2J B;  1TWG B;  2K1B A;  2PCF B;  2B2T C;  3FRP B;  2LFN A;  1T5X D;  3WOF A;  2JE6 I;  3PO2 B;  3PUW A;  2YYZ A;  3KK7 A;  1EL0 A;  3MVV A;  4V0B A;  3TDQ A;  2VB3 X;  3H09 A;  1BR9 A;  3G6J B;  4RGN A;  1EY0 A;  1RDP D;  2IX3 A;  2O5I C;  1TS3 A;  2FMM A;  3GTQ B;  4U67 3;  3K5L A;  1IW7 C;  1JOO A;  2R7Z B;  5KYL A;  3AMU A;  3D4W A;  1H9S A;  2EYJ A;  1SYG A;  1CI3 M;  2WP8 J;  2HDM A;  2ZT9 C;  5FO7 B;  1UNS A;  1LAC A;  1QWY A;  3A54 A;  4XIG S;  4OL7 A;  1CQF A;  1I4Q A;  4TRD A;  1AP0 A;  2EXZ A;  3S1Q B;  1SSO A;  3LWU A;  1WCM B;  3NTI A;  1STN A;  4F8M A;  1QCB D;  3K5M A;  1CFM A;  3M3Y B;  1BDO A;  2V4D A;  4BBR B;  4DFA A;  2F03 A;  2KQ3 A;  2Q8I B;  5D65 A;  3BVM A;  2EY1 A;  2A6E D;  2RDG A;  1Y1W B;  5DAU A;  4RKL A;  3JAM E;  4U68 A;  1CQV A;  5BN4 A;  2JXM B;  3AB9 A;  3RZO B;  2FJ2 A;  1D5X C;  4LJZ C;  3SK4 A;  4QMG A;  2H1E A;  3MC0 B;  3PUV A;  4FF3 A;  3D4R A;  3DMU A;  2PW7 A;  3J80 L;  1QIL A;  2F0O A;  2JA7 B;  3P1H A;  2JA5 B;  3BYT B;  1QNU A;  2NUC A;  4K8J A;  4FP5 D;  3J7A V;  1KDA A;  1U9R A;  3DEO A;  2GA4 B;  1BCP B;  1JOQ A;  4CJ1 B;  1Q90 A;  3I4L A;  3SK8 A;  3BG3 A;  5KIX A;  3KLS A;  2CHB D;  2IX0 A;  4ILW A;  1EY8 A;  4X3K A;  1PYW D;  3BVG A;  1CTM A;  2FMC A;  3NSW A;  2F0U A;  1J8I A;  3J7Y W;  3HZX A;  5C3E B;  1I4H A;  2F4I A;  1ZYR D;  4DNR B;  1D1K A;  4K5W A;  5C44 B;  3K0Y A;  3UI2 A;  3MA2 B;  1OXV A;  2C5C A;  4HN7 A;  1BO0 A;  1E2Z A;  4ZRZ A;  3NP8 A;  1AZP A;  3DXJ C;  3MZ5 A;  1QNK A;  1EEF D;  3NTK A;  5ELB A;  2QKI C;  2AWN A;  3ONA B;  5CV6 A;  2EDG A;  2E76 C;  5M3M B;  3NTH A;  2NYZ D;  1EY4 A;  4C3J B;  4BS9 A;  1E0B A;  3SXH A;  3RZD B;  5IT9 L;  4ME5 A;  1KLG D;  1X32 A;  4X3T A;  3D3R A;  4Q0F A;  1OXT A;  3MFG A;  2XSC A;  4B9X A;  4KTA A;  1CT1 D;  2A5H A;  3PUY A;  4KN7 C;  1H9J A;  1STH A;  2M00 A;  2EZV A;  3S14 B;  3EFX D;  1LTI D;  1DXM A;  1GHK A;  3DEP A;  2NTT A;  3QOJ A;  3VR5 A;  5KEE A;  1CA6 A;  2A6H D;  2MPM A;  4C2M B;  4FXD A;  1EY9 A;  5M5W B;  1S5B D;  1SYF A;  4A3M B;  3SEB A;  1G2S A;  3T56 B;  1V1O A;  2L9H A;  5KNB A;  4XDX A;  4EQO A;  5LL6 X;  5C4Z A;  3S9W A;  5EPJ A;  4KD3 A;  2ZXP A;  2L12 A;  1X3Q A;  1PRT C;  4K2L A;  4RA8 A;  3LNN A;  4KY7 A;  1WTR A;  2PYK A;  4C3H G;  3GP7 A;  3A7A B;  1ENF A;  2K7V A;  1DYQ A;  4PV1 C;  2IT1 A;  4RH6 A;  4XXE A;  1D2B A;  2K5Q A;  4KKS A;  2B2W A;  3QJY A;  3HOZ B;  4K8I A;  5JOB A;  1STB A;  2EVB A;  1MD2 D;  2KCN A;  1HFN A;  4PMC A;  3KBG A;  3IAY A;  2F0Q A;  5A2Q E;  5FLX L;  2N88 A;  3J81 E;  1HFG A;  1DOL A;  3N6R A;  1DD2 A;  4XT3 B;  3NK9 A;  4ZQ3 A;  3KBX A;  4K6D A;  4BBS B;  1YNN D;  4KI0 A;  2PZW A;  3L3O C;  2WKC A;  5CV5 A;  1SE2 A;  4ZLT F;  1AZQ A;  1CZG A;  1PTO F;  5DM6 3;  1I4P A;  3OPO A;  2F0H A;  2F0W A;  4OIK A;  5IT9 E;  3T51 B;  2MP1 A;  1CHQ D;  1JOR A;  1SMY C;  3MHB A;  2NVQ B;  5C0X J;  4LK1 C;  5EQ0 A;  3Q6S A;  1HCZ A;  1NCV A;  2ID0 A;  1O7Z A;  1L0X B;  1V8Q A;  2XN9 C;  1GXD C;  4HCS A;  1JC7 A;  3R8B A;  3HOV B;  1VF7 A;  1XXG A;  4M8A A;  1GUW A;  4RGM A;  2Z8L A;  4OO1 H;  1S5C D;  5ELE A;  2EYL A;  4M1U B;  1Y8N B;  3SVM A;  1M8A A;  3W2D A;  2IJ0 A;  3T16 A;  4ZUJ A;  2MUY A;  1LTB D;  3K7A B;  4XYO A;  2J7Z A;  4FXG C;  4JBW A;  3LX0 A;  1GJX A;  2EYO A;  1JE4 A;  1TWH B;  3DWA A;  4ZK9 B;  4DN4 M;  4KJN A;  1SND A;  4IQZ A;  1LTA D;  3NQI A;  3FPP A;  2B2V A;  2WAQ B;  2PZU A;  1SAP A;  3E6Z X;  2B39 A;  1RD9 D;  4G7O C;  2B2Y A;  2VNU D;  1TT2 A;  1QOH A;  3H94 A;  1JOK A;  1VDZ A;  1QG7 A;  4PMW A;  4UAI A;  1FNW A;  4NP5 A;  5DNF A;  4RCO A;  3OMC A;  3ND8 A;  1LTG D;  2Y0S B;  5KYI A;  5A2Q L;  3MXU A;  1DOK A;  2RDF A;  1IYU A;  3C1F A;  2L1B A;  2XRQ D;  2NN6 G;  2QDB A;  3WOE A;  1Q8I A;  1SE3 A;  4B08 A;  4A93 B;  5K5P A;  1HQM C;  1Q1E A;  1CHP D;  4R9W A;  2WV6 D;  2Z4H A;  4CKC A;  1F9R A;  2EJG C;  4BA1 I;  3Q0A A;  3RLF A;  1ET9 A;  3FPU B;  4IUP A;  5ISR A;  3R3O A;  1B9M A;  5C4H A;  4PQX A;  4QCL A;  2EJF C;  2L5T A;  4L6T B;  5JAV A;  1HXY D;  2L0C A;  2MHV A;  3DWP A;  2NZ1 D;  3H0G B;  5FKA C;  3K58 A;  1IKL A;  4BA2 I;  1STE A;  5LHY 1;  5C6A A;  1I3Q B;  4S3S A;  3H3V C;  2VB2 X;  1D6E C;  3MAQ A;  3J81 L;  2RSN A;  3URY A;  3VYR A;  1Y69 U;  4FF1 A;  5FLX E;  3E5S A;  3CU7 A;  1SNC A;  1NR4 A;  2Q8R E;  3I3C A;  4DAV A;  3A7L A;  1EZ8 A;  3NPP A;  1ROD A;  1G8Z D;  4XT1 B;  2O5J C;  4XQN A;  5ELF A;  4K2K A;  5CGK A;  3X3M A;  1TS4 A;  3N52 A;  1LLR D;  2PO4 A;  2QF7 A;  5CBE E;  4OGQ C;  1F2Z A;  2F0F A;  2R3Z A;  1A3U A;  3KUP A;  2TSS A;  4RAU C;  1PTO C;  1SNM A;  4C3I B;  5FOB B;  4OO1 I;  3NWS A;  1FNV A;  1I4R A;  5E4W C;  3OIP A;  5CV8 A;  2NWG A;  4XTC S;  4MIU A;  4HTH A;  2F0D A;  2A68 D;  1PMR A;  1EZ6 A;  2B8F A;  1A2U A;  4ZAI A;  1TY0 A;  1RTN A;  2DN8 A;  1VMP A;  5D3D A;  1RHP A;  1KDC A;  1WTQ A;  3LWE A;  4HR7 B;  3MWY W;  2L11 A;  2ZXR A;  1NSN S;  1EWC A;  3SK5 A;  5AFW A;  1WTW A;  1JIC A;  1M4V A;  1A3V A;  2BCO A;  4IN3 A;  5JVG 3;  1EOT A;  5KNC A;  3DUZ A;  3M7G A;  4X3U A;  1YNN C;  1KTK A;  1LTR D;  2DY8 A;  3GTG B;  3MEH A;  1FR3 A;  5CV4 A;  1V1P B;  2CW0 D;  1PRT F;  3H91 A;  4CJ0 B;  2IPK D;  1DJR D;  2LY7 A;  4A3D B;  2WIN B;  1SYC A;  3NWT A;  2K04 A;  3OHX C;  3IFD A;  4JK1 C;  3R93 A;  3TZU A;  2Z1C A;  2IL8 A;  1WTP A;  1U4M A;  2R93 B;  1FD7 D;  4KY6 A;  3D31 A;  3KF8 A;  1D5Z C;  1ZEQ X;  2B8G A;  1CZW A;  1JWU D;  4CGY B;  4IZ8 A;  1X3P A;  2KJX A;  2NN6 H;  1PZI D;  3RMH A;  3KLS X;  4C1N I;  4RWS C;  2BOS A;  2RDH A;  4KMU C;  2JP1 A;  3HG9 A;  3O13 A;  2M2L A;  1J9O A;  3U9O A;  3J80 E;  3QB3 A;  3PO3 B;  3HP3 A;  4Z9C B;  5M5Y B;  2X69 A;  1B50 A;  1HHV A;  2E74 C;  3FKI B;  4BY1 B;  4A3B B;  3TN2 A;  2DNE A;  4FO2 A;  1Q12 A;  2RBM A;  2WB1 B;  2RSO A;  3CRK C;  3X3N A;  5DEH A;  1GUS A;  5CV9 A;  3OIQ A;  1O7Y A;  1ZXT A;  3I70 A;  1BXT A;  4WJW A;  5EKK A;  5KND A;  2K33 A;  5IGD A;  4J8Q A;  1BQQ T;  4HED A;  4A3I B;  3S1R B;  1OXS C;  1C48 A;  1BCP C;  2LMC B;  2E2D C;  4QB4 A;  1DM0 B;  3ND9 A;  5EKL A;  3VA5 A;  3DHQ A;  4ABN A;  1W6K A;  1Q3L A;  2E2I B;  4WOR A;  5E3F A;  5JJZ A;  1EY5 A;  5EKI A;  1SYE A;  1JWM D;  4QUC A;  2PPB C;  5CYU A;  4KKT A;  2OXP A;  3OOC A;  1SNO A;  5IGF A;  5ELC A;  2I46 A;  3M4O B;  4KN4 C;  3HOY B;  2KHS A;  1GHJ A;  2EY2 A;  4XYQ A;  2OT2 A;  4CHT B;  2G9D A;  3S17 B;  2A73 B;  2PMZ B;  3GTP B;  3C3L A;  1TR5 A;  5CMD A;  4DAY A;  4XQQ A;  3Q24 A;  4CJ2 C;  2QEJ C;  3I72 A;  3W3A A;  2SOB A;  3P7J A;  1DCZ A;  1R9T B;  3VR2 A;  1G6Z A;  2KED A;  3BVZ A;  1XYI A;  2EY5 A;  2WKD A;  3D4D A;  3M4Y A;  1SFO B;  2F0G A;  1DOM A;  4AYB B;  3GTL B;  1ILQ A;  2BE5 D;  4TKO B;  2ICE C;  1LTT D;  4A3J B;  2RQX A;  3G7L A;  1VF5 C;  1F77 A;  1HA6 A;  5C5M A;  1I4G A;  1UEA B;  1A6X A;  2DNC A;  3HRZ C;  2F0K A;  1ENC A;  1PTO B;  1FYC A;  4EQN A;  5M5X B;  1Z7T A;  1EWH A;  2A6E C;  1SE4 A;  3ITP A;  5IGE A;  1II3 A;  4V19 0;  1T5E A;  5I9O A;  1B2T A;  4K5V A;  4OHJ A;  4DA2 A;  1EYD A;  4IUN A;  4RHR A;  1NR2 A;  3EA6 A;  1JCK B;  2YU9 B;  2I07 B;  2DY7 A;  4MHE A;  2EJM A;  3DM1 A;  5J1Z A;  3OWE B;  3M85 A;  5LL6 S;  2Z4I A;  4N9T A;  3A55 A;  1RCV D;  3HEJ A;  4IUT A;  1Z6H A;  1BCP F;  1IHZ A;  4DAP A;  3EJI A;  2HUG A;  4HCE A;  3V96 A;  1RKN A;  1S4Z A;  1TS2 A;  4FXK C;  1TVX A;  1XTC D;  4ID6 A;  4L63 B;  5DM7 3;  5E4X A;  1O78 A;  2XNA C;  1V43 A;  3CHB D;  2R92 B;  3BZD B;  5JVH 3;  2F0T A;  4KV6 A;  4ZYS A;  5EJW A;  4BWG B;  5K36 G;  5CBA E;  4RGT A;  4WRD A;  1SYB A;  4G7Z C;  2IW3 A;  4R8I A;  2L4N A;  2F0P A;  2F0N A;  5M9O A;  1C4Q A;  1TY2 A;  1IYV A;  3K5O A;  1MSH A;  5C4J B;  1E2W A;  4KK7 A;  1MSG A;  3T13 A;  3NXW A;  2CW0 C;  5BN5 A;  1ET6 A;  1GUT A;  2Q8T A;  3U9S A;  4K5X A;  1EY7 A;  4OIJ A;  5EGT A;  3VYT A;  4NW2 A;  1S5D D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...