1H9JA

Two crystal structures of the cytoplasmic molybdate-binding protein modg suggest a novel cooperative binding mechanism and provide insights into ligand-binding specificity. phosphate-grown form with molybdate and phosphate bound
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
145
structure length
145
Chain Sequence
GSHMKISARNVFKGTVSALKEGAVNAEVDILLGGGDKLAAVVTLESARSLQLAAGKEVVAVVKAPWVLLMTDSSGYRLSARNILTGTVKTIETGAVNAEVTLALQGGTEITSMVTKEAVAELGLKPGASASAVIKASNVILGVPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Binding protein
molecule keywords MOLYBDENUM-BINDING-PROTEIN
publication title Two Crystal Structures of the Cytoplasmic Molybdate-Binding Protein Modg Suggest a Novel Cooperative Binding Mechanism and Provide Insights Into Ligand-Binding Specificity
pubmed doi rcsb
source organism Azotobacter vinelandii
total genus 27
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2001-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03459 TOBE TOBE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1h9jA02
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1h9jA01
1Y8PB 1H9MA 2QF7A 2B8FA 3ND8A 3HGBA 1HQMC 3SE0A 3M85A 3KLRA 1GUOA 1G291 4KHZA 4PV1C 5C0XG 1A6XA 2A6EC 3PUWA 3CRKC 2O5JC 2NN6G 2CW0C 3VA7A 4KI0A 3SDZA 1DD2A 3VR6A 3ND9A 4DNRB 5KNDA 4IFDH 2K33A 2DNEA 3VR3A 2NN6I 1IW7D 4H44C 1SMYC 1Y8OB 3GQBA 4GZYC 1GUTA 4H0LC 1YNJC 2K32A 4I7ZC 1K8OA 1VF7A 5BN3A 1B9MA 3QG1A 4KN7C 4TQUS 4OO1G 1H9SA 2E76C 1I6VC 2JEBI 3DXJC 3IFTA 4OGQC 2JXMB 1FR3A 2O5IC 1CFMA 1Y69U 5KNCA 3RLFA 5BN4A 3WDNA 2DNCA 1GJXA 1V43A 1H9RA 4G7ZC 5A35A 3W3AA 2A6HC 3I73A 1TKWB 2ZT9C 2A68C 4BA2I 2E75C 2KA7A 1LACA 3PUXA 5BN5A 1Z7TA 4DNTB 2A69C 3FPPA 4KKSA 4XTCS 4DK1A 4KKUA 3PUZA 3PUVA 4XIGS 1Y8NB 1VDZA 2BA0A 3BG3A 1VCIA 4KMUC 2AWOA 2EJMA 3LWUA 4G7OC 1IYVA 1Q1BA 2F1MA 2R6GA 3A8IE 3D31A 1OXTA 2A6ED 4KKTA 1ONLA 4H13C 2EDGA 4JBWA 3T56B 5K36H 1GHJA 1O78A 1H9JA 1CI3M 3AB9A 3MXUA 3OOCA 4HR7B 5JEAH 3PV0A 3LNNA 3EQLC 4DK0A 2BE5C 1OXSC 1EWHA 1BDOA 1GUNA 3D4RA 2DN8A 1E2WA 3NE5B 2JE6I 2E74C 3VR4A 1PMRA 1E2VA 2D5DA 3I4LA 4IQZA 5C0XH 2EJGC 1GUGA 1T5EA 2BA1A 3QIAA 2NN6H 1ZYRC 3T51B 2EJFC 3A7AB 2PNRC 1E2ZA 2LMCB 2JEAI 3I72A 4LK1C 1HPCA 1ZKOA 2B8GA 2BDOA 3BDOA 4LJZC 1OXXK 2V4DA 2K7VA 3FMCA 3VR2A 1IYUA 1YNNC 2A6HD 3VR5A 1QJOA 1TU2B 2Q8IB 2A68D 4OO1H 3L7ZC 1Z6HA 4L8JA 4BA1I 2EVBA 1IW7C 2L5TA 3OW7A 3GD7A 1B9NA 2A69D 3IKJA 4JK1C 1DXMA 1OXUA 3M7NA 2D62A 3M4YA 1HTPA 3A8KE 3OPOA 1K8MA 2IT1A 4KN4C 2AUJD 4G7HC 1GUSA 1H9KA 1FYCA 1LABA 2YYZA 2AUKA 3A7LA 1GHKA 4IFDG 3CRLC 1V8QA 1Q1EA 2KCCA 3P20A 3MFYA 1CTMA 3H94A 2PPBC 3TZUA 1HCZA 2D2CC 2BE5D 3PUYA 3QJYA 4RCNA 3T53B 5K36G 3U9SA 1H9SB 1Q12A 1DCZA 2PCFB 1O7LA 1OXVA 3N6RA 4TKOB 5JEAG 5KNBA 1VF5C 1Q90A 3A8JE
chains in the Genus database with same CATH superfamily
1MKHA 1Y8PB 1AP0A 4JV5L 1CQVA 4PV1C 5C0XG 2IX0A 3CAMA 1D5MC 3J7ZC 1JWSD 1B70B 3I7FA 5FJ8G 2Z6BA 3ND9A 2KQ3A 4LF9L 3HOUG 2UXDQ 1K8AC 1I94L 1QILA 3DXJC 5CC4A 4OGQC 5JPMC 1VQOA 4CKBA 3JAME 3KDFA 1HR0L 3S17H 1F2YA 5BN4A 4LFCL 1IYJB 1KQSA 4DN4M 2K5QA 4V0BA 4IALA 2TMPA 1TR5A 2R7ZG 2NZOA 1RIPA 1M90C 2GVAA 2E5LL 2UXBL 1EY6A 1ENFA 1STYA 3FEWX 4HJ8A 3A56A 4DUYL 2KUMA 1GVPA 4OHJA 3K0YA 4EQNA 4H13C 1M1KC 3MXUA 3GTQH 5ELOA 1V1PB 4RHRA 1GKHA 1WCMG 5ELCA 3BZDB 1GOZA 1UEBA 1E2WA 2JE6I 2JA5B 4A3BH 2IHEA 4EGVA 4ALPA 1PTOH 2UUAL 4NXML 2XWBB 3FRPB 2RVLA 3KJOA 4OONA 2D0OA 2CH4A 2ZXOA 3BDOA 4PZ8A 2H4OA 4ZCKA 2XVSA 4AQYL 3PO2B 1SROA 1P16A 4IFDJ 1TWHB 1K9MC 5ELEA 3V2TA 4OIKA 1PYWD 5CYUA 1OO9B 1LTID 4RGMA 4G7HC 3WWVA 1HA6A 3RZDB 3UDXA 3CRLC 5C3EB 3DHQA 2L15A 1JE4A 3UDIA 2HDLA 1BO0A 2D2CC 1AN8A 2ASBA 1L0XB 1YJNA 4JI8L 1O7LA 4OWXB 5DLQE 1W3SA 1VF5C 1JJ2A 4X64Q 2B2UA 1JMCA 4I7AA 1TT2A 2KECA 3O13A 1JJCB 5EPLA 5M5WH 3BVMA 1E7ZA 1G291 1G2TA 1BBUA 3F2DA 4GKJQ 2IW3A 4AYBB 1S3OA 4HMIA 1A62A 4FF2A 3E9IA 2HD3A 4O1NA 3J81c 1GUTA 5JJZA 5EQ0A 2B2WA 3K5MA 1WOCA 1PA6A 1XX8A 4A3DG 1FR3A 3TS0A 3BVZA 1PH3A 4B9WA 2YV5A 4KHPQ 1N36Q 4A3EH 3PO3B 1NSNS 4B3RL 4JI5L 5FO9B 2EYMA 4NMZA 1R4PB 2F52A 2A68C 4N9PA 1FL0A 4MTNA 4DR4L 2K04A 2A69C 2JA9A 3TMEA 3PUZA 4P75A 3Q0AA 3VYSA 3NPPA 2EJMA 3LWUA 4O42A 5CBEE 1Q1BA 3HOYB 4ME3A 1FD7D 1C48A 4P2CB 1I4PA 1KDBA 3BS1A 1VQCA 2F3IA 1G6ZA 2I5MX 1VQFA 3SHLA 1K0SA 4PZ7A 3U4ZA 4YWKA 2N8NA 3FPUB 2DN8A 3SK6A 4R9WA 3I4NB 2I5HA 4IQZA 5NUCA 1GUGA 1L0WA 2WAQB 4L6TB 1AW7A 1X32A 4RG1A 2JEAI 1BQQT 2QW7A 1IYUA 1NY4A 3X3MA 3GTLH 2Y0SE 3TZDA 3EIVA 2B2YC 4WJ4A 1HJPA 1FJGQ 1L2FA 3L9AX 3OW7A 4QL5A 4X66Q 1N34Q 1I4XA 1CSPA 1HTPA 1EZ6A 3J80i 2DGYA 2JA7G 1FGUA 1K8MA 4B3ML 4JI0L 1MSHA 4OWTB 2VQEQ 2NZ1D 4JI3L 5FLXE 5LMNL 1D8LA 1I4GA 2VNUD 3LGJA 3H94A 4DR1L 3H0GG 3PUYA 5IT9c 2R7FA 4JI4L 2NVTH 2ZJPA 2KEDA 1EIFA 1CKNA 3AU7A 1J5EQ 3C1FA 4DXGA 2JA6H 2B2VC 3K57A 1IHZA 3I4MB 1LTRD 4R8IA 1KABA 4UPAA 1O7IA 1BOSA 2EXZA 3PUWA 2Z1CA 1EEID 3HRZC 4BY1B 1VQNA 4F7XA 4QUFA 1SDFA 4LFAL 3HOZG 2B63B 2HDMA 1EUJA 3J80L 5CR3A 3K58A 3HOWH 5IOCA 1SNPA 4DUZQ 2NN6I 5AJ3L 1PTOD 3K59A 1A0IA 5J3BA 1EYDA 1ML0D 1I6VC 3L3OC 3S14B 2O5IC 3PIP3 5HGTA 4BBSB 1CK1A 5C4XB 4LF5L 4B08A 3JAMi 4GLXA 1H95A 1YIJA 1A2TA 2KA7A 3G71A 1QZGA 4QCLA 4DV3Q 4MN3A 2NWGA 3DM1A 2QA4A 2VQFQ 4KMUC 1EY7A 2OT2A 1ZEQX 1R9TB 2X6GA 3C1EA 4GNXC 5C44B 3M4OH 2R92H 3F2UA 1TWCH 4XQNA 4DR7L 3V96A 4RGTA 1MSGA 3SK8A 1KDAA 1QZHA 4LF6L 1GUNA 3HS0C 2AKWB 3CMEA 1Q86C 2B2TA 4K6LA 1F2MA 3NENA 5D65A 2F0QA 3S17B 1N8RC 2BH2A 1A3VA 3JAML 1VMPA 4JW0A 4X3TA 2K05A 1OXXK 1TS3A 1TU2B 4IURA 2H5XA 4DR3L 3M7NA 1B9NA 1E0BA 1BCPC 1PH2A 1KD1C 3A8KE 1MI2A 2LKVA 2IT1A 5DM63 2AUJD 4K0KL 1LABA 1EYAA 3A7LA 4A3JH 1X3EA 5ISRA 1RHPA 4O2DA 4BY7H 4IOAA 3HKZG 4HAEA 1HZCA 2V1CC 4ZK9B 2ZTCA 5EKIA 4C3IH 4A3BB 4KJNA 1PTOB 3N6RA 5KNBA 1JICA 3A8JE 1IBLL 3K80C 5KEEA 1ZYRD 2PZUA 2K01A 2Q2IA 3IFDA 1IBMQ 1VQ8A 1PXUA 1HQMC 1I4RA 4B3SQ 1W6KA 2EZVA 4DK3C 2F4IA 5IYBH 3BDCA 4XQQA 4CKCA 4DNRB 1B50A 1A63A 2L4NA 3BYYB 1QE6A 1JOQA 4Q5VA 5IGGA 5M3FB 1Y1VB 2VXWA 2XIWA 3RN2A 4U673 1Y69U 4QIWE 4A3KH 3CMAA 1UE6A 3E0EA 2A5HA 2PQAB 1V43A 1FNUA 2RHSB 4G7ZC 3MA2B 4DR5Q 4YY3Q 1TIID 2F0NA 1SN8A 3FKIB 4MNOA 1SYDA 2GA4B 3FPPA 3P75A 1B1ZA 2DJGC 1EWCA 4RH6A 2Z4HA 2HHHL 1KC8C 4ILWA 1U5KA 1IBKL 4CJ0B 3SVMA 2F0LA 4JCVE 1ONLA 2EDGA 3MZ5A 2WINB 5J39A 2PMZE 5JVG3 2G9HD 4PMBA 2JJQA 2N88A 2IPKD 3KF8B 4CJ1B 4TSSA 4A3MG 1CHPD 2E74C 1X55A 1SNDA 4B3TL 4FF4A 3QIAA 2G9DA 2NN6H 3D6WA 4DV5Q 1LO5D 3K7AH 2ENBA 3KLSX 1PHJA 3J81E 3U9OA 4NXNQ 3PCOB 3VR2A 2Z6KC 5IWAQ 1FNVA 2EOTA 3EROA 1K83B 1PH5A 1TWGH 2CFMA 4HCEA 4C3JG 1XMQL 1Q3LA 4RKLA 1MIUA 3M4YA 1HZ9A 4H02A 2K5WA 1D5XC 2ZXRA 5IYCH 1QG7A 1EY8A 4IN3A 5IE8A 3MAQA 2AUKA 2IJ0A 3I3CA 2F03A 1WFQA 1ESRA 4OWWB 3S1QB 1G6PA 3S2DH 1WD0A 3OIQA 4TVAB 2CH4W 1O80A 3VA5A 2F0VA 3RR5A 2CQOA 2WFWA 2CWAA 5FLMH 1BBXC 2PYKA 2RA4A 5AFWA 2JA8G 4IOCA 2Z9HA 2R93G 1L1OB 1H9MA 2QF7A 2PQEA 4GKKL 3KLRA 1TWFH 2K50A 1NMFA 4LUOA 1NNXA 3GV6A 3R93A 4CHTB 2YU9H 1RL2A 4YCUA 2HCIA 2SNMA 1YNJC 3KLSA 1Y1WH 4KN7C 4WRDA 2XWJB 1Y14B 2F0GA 5FLXL 2CWPA 1LV9A 2Q2TA 3CCSA 2NVTB 2PW5A 3EN2A 3HZXA 4HN7A 1R4QB 3DUZA 4BA2I 5IP7H 4NB3A 1DGSA 1Z7TA 1PVOA 1JOOA 2F0KA 5FJ8H 2QEXA 4FDBA 1QUQA 4DR2L 3MTSA 1MHWC 4LAAA 4LF8L 3KFUA 3A54A 5IT9E 1LTSD 2L55A 3D31A 2WP8J 1SE4A 3MVVA 5K36H 1NMGA 2CW0D 3NBHB 3SR1A 3LNNA 2D9UA 3PIPA 3P7JA 3G7LA 1SMYD 3QR8A 3PQIA 3TBIB 4JI6L 4P72A 1B4OA 4CDDC 1SRUA 2R7ZH 2F0PA 1KL9A 5EGTA 1HNWL 2WV6D 3HOXH 2F0OA 1DZ1A 3HKSA 5M5YB 1HFNA 1BUVT 2E2DC 1BVSA 4A75A 1ZKOA 2B8GA 2JA5G 2OTJA 1WJJA 3FMCA 4XXEA 4K6DA 3VR5A 2B29A 3R2IA 5IGBA 1NBWA 3L7ZC 5I2XA 1IW7C 4BXXG 2WB1B 1GXDC 4GLAC 4RGOS 4BS9A 1WCMH 4A3LH 3PO2G 1GUWA 3T13A 4C3HH 2LFNA 3CD6A 4ULLA 2R92B 1BCPF 1D5ZC 1EQQA 3P20A 2PI2A 1IXRA 1SJED 2H1EA 3FDTA 5KRUA 1STBA 2K03A 3T53B 2O4XA 3AFPA 2EYHA 5JPNC 4Y7NB 5C3EG 3ICEA 1EEFD 1SMXA 1S40A 3AMUA 3ND8A 4QQBX 3S1NB 4HCSA 5J1ZA 1UWVA 5ELNA 5L37A 2DY7A 3TN2A 2DNEA 2N55A 3SK4A 3GQBA 2K32A 5M5XB 1EOTA 1F2LA 1SE8A 4TQUS 4AYBG 2E76C 5E4WC 3KOJA 2JN4A 4BY7B 1UAPA 3GTPH 1T9HA 1ENAA 3OSOA 4FXGC 4RFBA 4GLVB 3S1MH 1EQRA 1I3QH 1YITA 5BR8L 3OW2A 1PFBA 1AE3A 2F0IA 4N8FA 1HNZQ 2X6LA 3PUXA 4J6HA 2UU9L 3PSIA 3PO3G 3BG3A 5I6WA 1XYIA 3B6YA 4J8QA 1KXLA 1HTLD 1QUQB 3UI2A 1QNUA 3TSSA 3R3OA 3DEPA 3AB9A 1J9OA 3MWYW 1VQIA 4DK0A 3Q22A 3HOYG 3OTOL 4Z9CB 2XNAC 3RNUA 4DV0Q 1P8LA 4A3IB 2PNHA 4G4KA 2E5LQ 2K28A 2UXBQ 4O0AA 2UXDL 2EJFC 2E2HH 3CP0A 3EA6A 3KF6B 2KHIA 2BDOA 3GTOH 3I4NG 5GAEC 3T1YL 1I6HB 1MGSA 5C4HA 1YNNC 4S3SA 1QJOA 2WAQG 3CU7A 3MEHA 1FNWA 2A19A 3J81i 3CHBD 5HY6A 4QUCA 1PZID 1DXMA 1SEBD 5LL6S 3NSWA 1SFOH 4KN4C 1T5XD 1FYCA 2UUAQ 2RSNA 1Q1EA 1PFNA 4JI1L 2A1AA 4DV4L 4NXMQ 2Q2UA 4K8IA 1C7YA 4HJ7A 2ZTEA 2NUCA 4LFBQ 4LUVA 1D1IA 2LXJA 3C3LA 3K7AB 1AFPA 2B8FA 1B7YB 2WKDA 3M85A 4A3GH 4A3FB 4KHZA 1VQAA 1X54A 2A6EC 2JA7H 3J81L 2FFKB 4EQ5A 4HMJA 3I4MG 2KHSA 4JI7L 4FF3A 1ET9A 1ILQA 1U4LA 3H0GH 3MXGA 3N52A 1PFSA 1K8OA 5BN3A 3TP8A 3NWSA 2B63G 4JI8Q 2JEBI 3CQZB 5T1IA 3I56A 1U4MA 4OO1I 3RLFA 2LSSA 4POGA 2NVYH 1SYGA 2HUGA 3W3AA 1XJVA 1YHAA 1TKWB 3GDEA 4BBRH 2EXDA 2CQAA 4BBSG 4AH6A 3SK5A 2N3SA 5C4XG 1TWAB 1VCIA 2RCFA 5IGDA 2L9HA 1RTNA 1OXTA 1WTXA 4KKTA 3KYHC 4RMFA 4IUNA 4E6IA 5K5PA 2CVRA 5A2QL 4XQJA 2YU9B 2KCTA 1NR2A 2LY7A 4DV1Q 1EIGA 1X65A 2AQ1B 3NUCA 2UXCL 5C44G 1Y1WB 2K6AA 4JI5Q 4NPSA 3CF5A 1PMRA 4V190 4R4OA 4DR4Q 3UE0A 1B3QA 3QOLA 4A93B 3CCUA 3A7AB 2LMCB 2K1BA 4XT3B 2F0UA 3TS2A 3S15B 1SYFA 1X3FA 2V4DA 4JI2L 3DLLA 1LTTD 1BXTA 1C0AA 4YHHL 2A68D 2B2WC 4ODGA 2A69D 3F1ZA 1OXUA 4WORA 2HIXA 1GUSA 3K81C 1NE3A 1IKLA 2HCCA 2MJ8A 3KBGA 4RAUC 3E6ZX 3EFXD 2JK8A 2PPBC 2NB0A 2EY5A 1I50H 2O2LD 3MXNA 1EQTA 5CV6A 1K3BC 3GTKH 4X3KA 1S4ZA 3HOXB 3T1HQ 1A15A 1VQJA 3ER0A 2HQLA 1STNA 5LHY1 5LMNW 1D7QA 4A3BG 1X6OA 2Y0SB 1GUOA 4B3MQ 4JC0A 3LX0A 4JI3Q 5LMNQ 5T1GA 2E2IH 1CZGA 4IUUA 3K5LA 1RCVD 3OHXC 4ZQ3A 4DR1Q 1XTDA 1VF7A 1HH2P 1SE2A 2EYLA 2KHJA 4DV7L 4C3HB 2MHVA 2E2JB 1K8GA 5FK9C 1N34L 2NVXH 1X3QA 4LF7L 1CKOA 4DAVA 4APVA 4ZLTF 5M3FG 1Y1VG 1JB7A 3L2PA 4ZYSA 3NBIA 1LT5D 5A35A 2A6HC 4R4CA 4DR6Q 4LFAQ 1KDCA 4XTCS 5CGKA 1PLFA 4A3CG 3D4WA 2MQHA 5FOBB 2F1MA 4ZUIA 3FKIG 1S5FD 2AQ3B 2K5HA 4KY6A 4JBWA 3STBC 2F3VA 5EBDA 3ZJYC 3EQLC 3BJUA 4KLKA 1ASZA 4J1MA 2PQAA 5CV8A 2VUMB 1F77A 1WI5A 1I4QA 4DV6L 4DUZL 4HIDA 4QJFA 2R7DA 4EX5A 2BDNA 1N32Q 3GTPB 3I72A 4LK1C 1BNZA 2L11A 3S1MB 4JYAQ 2IWHA 4X62Q 4OO1H 4QMGA 3DM3A 1C8CA 3EBEA 3H3VI 1NAPA 5M3MH 4DR7Q 2D62A 3A55A 5KYIA 3A0JA 1S72A 2ID0A 4DKAC 3KF8A 4LF6Q 2PO4A 4C1NK 4A3MH 1EU3A 2FINB 5ELBA 5KYLA 1F9RA 4PNYA 4DV3L 5D3DA 3K7UC 1VQ9A 4IFDG 1WTVA 2MUYA 4WFN3 2VQFL 1JWMD 2R61A 2KVMA 3MEFA 3MXNB 4L5TA 4RCNA 4RHSA 3VYUA 4MHEA 1UUPA 1JCKB 2GVBA 1CHQD 2WIIB 1MBYA 2MFIA 1N33L 2UUCQ 1Q90A 1YEZA 1QB5D 3D6CA 1JOKA 4DR3Q 2E2HB 5KGUA 5I2YA 5HGQA 3GTOB 5E4XA 4G57A 2QEJC 3OWEB 4DAMA 5JJIA 4K0KQ 3E3XA 4ZAIA 3VA7A 3DWQA 4YCVA 1A8VA 5C0XI 3J7A5 3GTQB 3F2BA 1CA6A 2JP1A 1EQVA 5CV4A 2B2TC 4LF4L 1I4HA 1BCPD 3NQIA 4H0LC 4M8AA 1SFOB 2DUDA 3CXCA 2MNAA 1RKNA 4C1NI 1TS5A 2VW9A 3CC7A 2IHFA 1IBLQ 2JA8H 2AWNA 5IIFA 1L1OA 2R93H 1EFWA 4IPGA 3NELA 4XT1B 1I5FA 4OXPA 1HHVA 1EY0A 1XNRQ 3Q6SA 1CQFA 2F0SA 4CGYB 3MFGA 4JVZA 3GTGH 1SYBA 3K5OA 4A3GB 1PZKD 4IPHA 4C2MH 2ZM6L 1PRTC 1QNKA 4N9TA 4LMQD 1GHJA 1GO3E 3WOFA 1HZAA 1RODA 1F9QA 1VQLA 1SAPA 2BE5C 4B3SL 2N78A 2P5ZX 4PMCA 1HRJA 1XNQQ 3W1GA 1E2VA 4QIWB 1XXGA 3E9HA 3E0JA 4GNXB 2BH8A 2OTLA 1E1TA 3J81j 4FF1A 1G2SA 2NVYB 2HHHQ 5M5WB 3A74A 4JBJA 3RN5A 2EE1A 4BBRB 4BA1I 3HOVH 2EVBA 4Y52H 3NBHA 1D6EC 4ZKBB 2QDLA 3ULPA 1MJEA 2PMZB 2YYZA 4IUTA 1M4VA 2KCMA 4KY5A 3TDQA 2WB1G 3VYRA 4I65A 3MFYA 4B3TQ 3M3YH 2PZTA 5JEAJ 1HUMA 1GM5A 1EIHA 4A3EB 3KLWA 1W6JA 1WTRA 4QB4A 1H9SB 3U9SA 1DCZA 1BCPB 2Z0SA 2JA5H 2R92G 2ZXPA 5HURA 2J4XA 4F8MA 5C0XJ 1EYGA 3PIO3 2I07B 1XMQQ 5JJLA 1E22A 1HXYD 1Q46A 3CPWA 4KD3A 3P1HA 3SE0A 2Z4IA 3AYHB 5C3XA 2O5JC 1JR0D 3PO2H 4R4TA 4KI0A 5GAHC 3VR6A 1O7ZA 4IZ8A 2NZHA 1TWHH 2AQ2B 3H6MA 1AZPA 5IP9H 3KJPA 2M9VA 3RZDH 1STGA 3H3VH 2VY3A 2UUBL 4K5WA 3M4PA 2OWOA 1PZJD 3D3RA 1MJCA 2OF1A 2YTVA 2RDHA 3QOJA 2NTTA 4GKKQ 4KK7A 1VQBA 5TSSA 4BY7G 1AH9A 5C4ZA 3GTLB 1AEXA 2EQSA 1LLRD 1QWYA 1PH9A 4XIGS 4XYOA 5G3LF 1Y8NB 1HUNA 3S16H 1VQKA 1RD9D 1DYQA 4G7OC 1IYVA 1ET6A 1HNXL 3HKZE 3AQQA 4GS3A 1H9JA 2SDFA 3K8AA 4JG2A 5JEAH 4XDXA 5LMUL 3LWEA 1KAAA 1NR4A 3E5SA 1BDOA 2RDFA 3D4RA 5IYBG 1YNJD 1II3A 1DOLA 4K5XA 2K5DA 4LNQA 5C0XH 1RJTA 3IL8A 4NDXA 4OEMB 5FO7B 2BA1A 1QVFA 2GN5A 2D0PA 4DGZA 2JA6B 1XPUA 3IAYA 4A3IG 3PO3H 3PGZA 4LF8Q 3HOUH 1WTHA 2QGQA 2SOBA 1UE7A 3TQYA 2EY1A 4PQXA 5IY0A 2ICEC 3HOWB 5EAYA 1PH7A 4LUZA 2I46A 4TRDA 3I8ZA 2F0FA 1A3UA 4Q0FA 1DOMA 4GOPA 1V1QA 2MGSA 4HSPA 4JI6Q 1VQGA 1AZQA 4YCWA 4QF4A 3HEJA 3TZUA 4L5RC 2CKZB 5I4DA 2FXQA 2F0EA 1EYCA 3KF6A 1EZ8A 2XRSD 2IY5B 2PCFB 2F4VQ 1OXVA 5I6YA 3I4NH 3D0FA 5DM73 4IJLA 4BWGB 1SJHD 2YTYA 1ENCA 4WJWA 3HGBA 5JJKA 1ASYA 4DU9A 5FLXc 1A6XA 2PW7A 1TS2A 2NN6G 4R1JA 2RSOA 3M4OB 1TWCB 5M3MB 1IW7D 4H44C 1JT8A 4A3FG 3M9BA 1M8AA 3J7AF 3I70A 4JOIA 3PMFA 4QY7A 4X3SA 4HEDA 5GAGC 1XMOL 5D14A 1VQ5A 1U4RA 1NUCA 4OX9L 4IUQA 1JB3A 3I73A 3W5OA 1JWUD 1OTCA 3PF4A 1C4QA 2RHQB 3DEOA 3Q24A 1HQRD 2DJFC 1VDZA 2VZAA 3ERSX 1TS4A 4KTAA 3I4MH 3S1RH 3A5ZB 4DV2L 4A76A 5FLMG 1S5DD 2HIVA 1U4PA 3WOEA 3GTMH 2B63H 2F3WA 2WACA 3A5UA 4A3JB 1CZWA 1QVCA 4K8JA 1ILPA 2EYFA 4X65L 2RF4A 1OXSC 4XYQA 1E1OA 4JV5Q 1PRTF 4FP5D 2AMCB 5CV5A 3SEBA 4C3IB 1YBYA 5BR8Q 1LT4D 2UU9Q 4BBSH 3FP9A 2NBFA 4IFDI 4R8NA 4K5VA 3NQTA 2BOSA 4LF9Q 1CUKA 1I94Q 2K7VA 4C56C 4DNIA 3HG9A 4DF7A 1HR0W 3H3VC 1X9NA 5C6AA 3OMCA 4A93G 1Z6HA 4F87A 1VQ4A 3GTGB 5I9PA 4UAIA 4DPGA 1HR0Q 4A3DH 3OTOQ 4EQOA 4LFCQ 1R9TH 1RDPD 2ATWA 3F8TA 4C2MB 5IP7G 4GOPB 5C44H 1H9KA 1HNZL 2NVQH 3NTKA 1CKMA 5EPKA 1GHKA 3VDYA 4FXKC 4DAYB 3IRBA 4UP8A 1VQ6A 1NJIC 1PH6A 4A3KB 3NHHA 3KBXA 3S2HH 3HP3A 3I91A 1SSOA 4GN4B 5K36G 3T1YQ 3UDFA 1JC7A 1EFID 4DUYQ 4MZ9A 4NKLA 3G6JB 1SNCA 1F9SA 3OMGA 3CCVA 1CSQA 4DV0L 2F0MA 4IPCA 4JPBW 5IODA 4DAPA 1EY9A 3HOXG 2M2LA 1LT3D 1YNND 5DEHA 5EPJA 4KV6A 1PYBA 3HOVB 3BVGA 1B8AA 2Y0SG 4JI1Q 4DV4Q 4ME5A 3NWTA 4A4IA 3CW2C 1PFMA 2VB3X 4P74A 1A3TA 4AQYQ 5EJWA 3M3YB 2FHTA 5KNCA 3PIOA 4A3LG 3WDNA 2PI2E 2N49A 3JC66 4C3HG 4H7BA 1EY5A 1QCBD 4CKEA 2RDGA 3T4AC 2X69A 3I2ZA 1NTGA 5CV9A 3NTHA 1STEA 1TWGB 2I5LX 4DK1A 4ZRZA 4JI7Q 1VMCA 3H91A 1UE5A 2OEOA 4BY1G 1PDQA 2A6ED 4LFBL 4YWLA 1O78A 1YZ6A 1X56A 3OOCA 4PMWA 2ALYB 2EYPA 1V1OA 1TQOA 3S2DB 3DMUA 1Q82C 1EWHA 5J22A 5M3FH 1Y1VH 2NYZD 1KRTA 1UE1A 3NE5B 3TRZA 1JE5A 2OQKA 2D5DA 3RMHA 1XPOA 4FYDA 1Q8KA 3CCMA 3HOZH 5E3FA 3OYYA 5IYDG 1HPCA 4A3CH 4K2KA 2VUMG 2AHOB 3F2CA 1TWFB 2F0TA 1G51A 1SYCA 1PH8A 1BKBA 3FKIH 5JOBA 2JSOA 2Z8LA 3R8BA 4KY7A 4X64L 2EYOA 3GD7A 4JK1C 3G6EA 1TY2A 3S16B 4AYBE 5GQOA 3NEMA 2UXCQ 1VS0A 4GKJL 4B3RQ 4CJ2C 1A2UA 2R3ZA 2B2UC 3KUPA 1DOKA 1SNQA 4CDCC 4CDFC 4M1UB 3J7YW 4X6AH 4JI2Q 4EQPA 3KDFB 1YI2A 3BU2A 4YHHQ 1ICFB 4L5QA 4KHPL 4DV1L 1N36L 2MO1A 3RZOH 4NP5A 2C5CA 2EPBA 3HOUB 2A74C 1DM0B 4RA8A 5E7NA 4ABNA 2QKIC 1K83H 1ESFA 5IT9L 1Q7YC 5KNDA 4IFDH 1G91A 4OELB 1Y8OB 4KHVA 1KLGD 2B2YA 2XTIA 3G4SA 3M4QA 1B9MA 1BBWA 3GTJH 1WTWA 2ZJRA 5C4JH 1IZ6A 1SBBB 4ZKCB 2R7ZB 3S1QH 4RKBA 1VQHA 2KENA 5IGFA 2SEBD 3NTIA 2WAQE 3G48A 3C46A 1RTOA 4JI0Q 2K14A 1KRSA 1EL0A 3RD4A 4DNTB 1ICWA 1LYLA 4KJOA 4HIMA 3ITPA 3D8GA 5EBCA 4DK6C 1S5BD 5CV7A 4J15A 1WCMB 4DV7Q 1STAA 2B2VA 4JI4Q 3T1HL 1FJGL 4X66L 4B9XA 2IX1A 4QGUA 4A3GG 2MO0A 5C5MA 4DA2A 4LF7Q 1KLUD 2I0QA 1LTBD 4RCOA 4MTKA 1VQ7A 5GROA 4HIOA 1JORA 5JAVA 2VQEL 3S24A 1NCVA 2EJGC 4HJAA 2FMCA 2EIFA 1SYEA 4IUVA 3TP6A 2KOLA 4HSVA 4UY8C 5AJ3Q 4IPDA 4MIUA 4LJZC 1CA5A 5G3LD 1LTLA 4DXFA 2A6HD 4ZUJA 2VS1A 1J5EL 3CC4A 1GD7A 4L8JA 2J0TD 4RGNA 3S1RB 1PTOC 2MPMA 4BBRG 1SLJA 3OPOA 4LF5Q 4DR6L 2FJ2A 5E1FA 5EKLA 3T16A 3GTMB 1YJ9A 4DV6Q 3STBD 1V8QA 1PH4A 1V9PA 4GNXA 4UP7A 1S5ED 4F88A 1HCZA 1ZXTA 2M00A 3QJYA 1J6QA 5IGCA 2F0HA 1Q12A 4UHVA 3CCJA 4EVOA 1I3QB 4TKOB 2C35B 5M5YH 4FNFA 4IJHA 4A3EG 2K52A 2JQOA 3CKIB 3C2PA 1XPRA 1XWEA 1WD1A 1QOHA 2B39A 2Q2HA 4CBVA 1N32L 4GN3B 3H09A 4UP9A 2CCZA 3VR3A 2WKCA 4A3DB 4GZYC 1DONA 2XGTA 2LXKA 4JYAL 1TVXA 4I7ZC 2A73B 3J80c 2NVQB 4X62L 1H9SA 3IFTA 1EIYB 3EJIA 5EKKA 2JXMB 1N33Q 5M9OA 3Q8DA 1DJRD 1YHQA 1SXTA 4IUPA 5DNFA 2B3GA 1TXYA 1PH1A 2Q8RE 2OCEA 3S2HB 4C3JH 1GJXA 4HTHA 3QWNA 1H9RA 2A8VA 2QDBA 1VQPA 1C9OA 1LTAD 4Y7NH 3TEHB 2RKSA 1LACA 1U0LA 5BN5A 1Z47A 4KKSA 3I55A 2BA0A 5D3IB 4AIMA 4LF4Q 3S1NH 5CMDA 3RUZA 3FVQA 3DWPA 2UUCL 3KK7A 3T56B 1YJWA 2F0WA 1CI3M 1WYDA 4HIKA 3UDGA 1W2BA 3I90A 3ZYYX 3BZKA 2KJXA 1KNEA 4R4IA 3CCEA 4X3UA 5M5XH 3GP7A 1J8IA 4R4QA 4P71A 1ZYRC 4K14A 1SR3A 3T51B 2PNRC 1E2ZA 2ZJQA 3H15A 1YHBA 1CKNB 1YNXA 2ZM6Q 3JAMc 2EY2A 2JA7B 2Q8IB 2FMMA 2JA6G 2PZWA 3OIPA 1IBML 1X3PA 3MHBA 1BF4A 2ICIA 1XNRL 3H0GB 3UE1A 5H1SE 1FVIA 1L1OC 3HOWG 1PRTD 1B2TA 1KTKA 2XN9C 3BZCA 1CTMA 5DAUA 1B53A 2BE5D 3GV3A 1LM0A 4UDUC 4A3IH 2BCOA 1AE2A 4K2LA 1S5CD 5KIXA 3S9WA 1KNAA 4OIJA 3URYA 1IBKQ 3U58A 3CC2A 2F0DA 3HOZB 1XNQL 3EVQA 1X3GA 1EY4A 1TY0A 4N8X1 3D4DA 4DR5L 1I6HH 1FGBD 5LL6X 4YY3L 3CRKC 3I4OA 4FO2A 3W2DA 5GADC 2K5VA 3DWAA 4LW1A 5C5LA 3SDZA 5ELFA 2K33A 2G5DA 3OWFA 2HQEA 2Z6KA 3Q23A 4P73A 4OO1G 2SNSA 5M3MG 2K4KA 1CFMA 1MD2D 1JJGA 3K0XA 1VQEA 2IX3A 2NTSA 2DNCA 2C9OA 4PZ6A 4FVMA 2Q8TA 1B3AA 4BXXH 1PYSB 1G8ZD 2ZT9C 1K0RA 4NW2A 4RWSC 2KBNA 1EU4A 2OQ0A 1K28A 2RCNA 1CT1D 3SGIA 4DV5L 3RZOB 2L1BA 5C3WA 4NXNL 2CHBD 4A3FH 4OL7A 3U4VA 2L0CA 5IWAL 1HA5A 3K6OA 1IL8A 3PV0A 1BR9A 1U9RA 5C3EH 2UUBQ 1I50B 4YIJA 3GTJB 1EOVA 4A3JG 3VR4A 2EYJA 3GTKB 5C4JB 3RLOA 3CQZH 1PV4A 1K3RA 1LTGD 2F0JA 2RBMA 3CCQA 2HT1A 1PRTB 4KD4A 5COYA 4C3IG 1L0YB 1EWIA 1SNMA 3MXPA 3TP7A 1HNXQ 3K5NA 2E2IB 1Q81C 1RF2D 3ULJA 2L5TA 3IKJA 1KAWA 1TWAH 3ONAB 5I9OA 5LMUQ 1WTPA 3AEVA 3HKZB 2MP1A 3M7GA 2L12A 4JBMA 5A2QE 1PTOF 2NVXB 4YWMA 3X3NA 2ZTDA 1F9PA 1Q8IA 3HFZB 4DR2Q 1JQYD 2E8GA 1LT6D 2XSCA 3NXWA 4GN5A 3V05A 4PG3A 4A3KG 3TREA 5CORA 4A93H 5FO8B 2KEEA 4HJ5A 3S15H 3HOYH 4WJ3M 4FXDA 1N9WA 1KIXA 3ERQA 2CW0C 3R2TA 3TP5A 1IL2A 1DD2A 3CCRA 3J7AV 1HZBA 4DAYA 5FKAC 1K73C 1HNWQ 1SMYC 3BYTB 3QB3A 1QVGA 1B44D 4LWCA 3QG1A 1WTQA 3HOVG 5JVH3 2DY8A 1E3PA 2KCNA 3FHWA 2QILA 3MC0B 3RLNA 2E75C 4GOPC 3SXHA 4KKUA 3PUVA 1D1KA 1E24A 2AWOA 2F4VL 2QCPX 4HJ9A 3NP8A 1SE3A 1XTCD 2IL8A 2JYOA 2R6GA 2WB1E 3A8IE 4A3MB 4HR7B 1WTOA 1XMOQ 2OXPA 1V1PA 2XRQD 4L63B 5IYCG 1IKMA 3BDLA 3W1BA 1LUZA 4U68A 4OX9Q 5IGEA 4JBKA 3VYTA 1UNSA 1SNOA 2E2JH 2LS01 2YTXA 1STHA 3I4LA 4ID6A 3AFQA 1F2ZA 1T5EA 1HFGA 3PF5A 5IP9G 3L0OA 4C3JB 3CCLA 2RQXA 4DV2Q 2VL6A 3GO5A 5ELDA 3J80E 4BY1H 1WVLA 5CBAE 2K75A 4JOIC 4X65Q 4DFAA 2ES2A 1D2BA 2EY6A 5F2DA 3QO2A 1VQMA 4POFA 2TSSA 2VB2X 3S14H 1UEAB 2KCCA 1VQDA 3CPFA 2JA8B 3ULLA 2K5NA 1Y1WG 2R93B 1YVCA 4CDEC 5C4XH 4L5SA 1CM9A 1O7YA 4IO9A 5IYDH 1KHIA 3U50C 2VUMH 5JEAG 1Z9FA 2J7ZA 3NK9A
chains in the Genus database with same CATH topology
1Y8PB 1AP0A 1CQVA 4PV1C 5C0XG 2IX0A 1D5MC 1JWSD 3ND9A 2KQ3A 1QILA 3DXJC 5CC4A 4OGQC 5JPMC 4CKBA 3JAME 1F2YA 5BN4A 4DN4M 2K5QA 4V0BA 4IALA 2TMPA 1TR5A 1EY6A 1ENFA 1STYA 3FEWX 3A56A 2KUMA 4OHJA 3K0YA 4EQNA 4H13C 3MXUA 1V1PB 4RHRA 5ELCA 3BZDB 1GOZA 1E2WA 2JE6I 2JA5B 4EGVA 1PTOH 2XWBB 3FRPB 2RVLA 2ZXOA 3BDOA 2H4OA 2XVSA 3PO2B 4IFDJ 1TWHB 5ELEA 3V2TA 4OIKA 1PYWD 5CYUA 1OO9B 1LTID 4RGMA 4G7HC 1HA6A 3RZDB 3CRLC 5C3EB 3DHQA 1JE4A 2HDLA 1BO0A 2D2CC 1AN8A 1L0XB 1O7LA 1VF5C 2B2UA 1TT2A 2KECA 3O13A 5EPLA 3BVMA 1G291 1G2TA 2IW3A 4AYBB 4HMIA 4FF2A 4O1NA 1GUTA 5JJZA 5EQ0A 2B2WA 3K5MA 1XX8A 1FR3A 3BVZA 4B9WA 3PO3B 1NSNS 5FO9B 2EYMA 4NMZA 1R4PB 2A68C 4N9PA 2K04A 2A69C 3TMEA 3PUZA 3Q0AA 3VYSA 3NPPA 2EJMA 3LWUA 4O42A 5CBEE 1Q1BA 3HOYB 1FD7D 1C48A 4P2CB 1I4PA 1KDBA 3BS1A 1G6ZA 3SHLA 3FPUB 2DN8A 3SK6A 4R9WA 3I4NB 4IQZA 5NUCA 1GUGA 2WAQB 4L6TB 1AW7A 1X32A 2JEAI 1BQQT 1IYUA 3X3MA 3TZDA 2B2YC 3L9AX 3OW7A 1I4XA 1HTPA 1EZ6A 1K8MA 1MSHA 2NZ1D 5FLXE 1I4GA 2VNUD 3H94A 3PUYA 2KEDA 3AU7A 3C1FA 4DXGA 2B2VC 3K57A 1IHZA 3I4MB 1LTRD 4R8IA 1KABA 1BOSA 2EXZA 3PUWA 2Z1CA 1EEID 3HRZC 4BY1B 4F7XA 4QUFA 1SDFA 2B63B 2HDMA 3J80L 5CR3A 3K58A 5IOCA 1SNPA 2NN6I 1PTOD 3K59A 1EYDA 1ML0D 1I6VC 3L3OC 3S14B 2O5IC 3PIP3 5HGTA 4BBSB 1CK1A 5C4XB 4B08A 1A2TA 2KA7A 4QCLA 4MN3A 2NWGA 3DM1A 4KMUC 1EY7A 2OT2A 1ZEQX 1R9TB 2X6GA 3C1EA 5C44B 3F2UA 4XQNA 3V96A 4RGTA 1MSGA 3SK8A 1KDAA 1GUNA 3HS0C 2B2TA 4K6LA 1F2MA 5D65A 2F0QA 3S17B 1A3VA 3JAML 1VMPA 4X3TA 2K05A 1OXXK 1TS3A 1TU2B 4IURA 3M7NA 1B9NA 1E0BA 1BCPC 3A8KE 1MI2A 2LKVA 2IT1A 5DM63 2AUJD 1LABA 1EYAA 3A7LA 5ISRA 1RHPA 4HAEA 4ZK9B 5EKIA 4A3BB 4KJNA 1PTOB 3N6RA 5KNBA 1JICA 3A8JE 5KEEA 1ZYRD 2PZUA 2K01A 3IFDA 1PXUA 1HQMC 1I4RA 1W6KA 2EZVA 2F4IA 3BDCA 4XQQA 4CKCA 4DNRB 1B50A 2L4NA 3BYYB 1QE6A 1JOQA 4Q5VA 5IGGA 5M3FB 1Y1VB 2VXWA 2XIWA 4U673 1Y69U 2A5HA 1V43A 1FNUA 4G7ZC 3MA2B 1TIID 2F0NA 3FKIB 1SYDA 2GA4B 3FPPA 3P75A 1B1ZA 1EWCA 4RH6A 2Z4HA 4ILWA 4CJ0B 3SVMA 2F0LA 1ONLA 2EDGA 3MZ5A 2WINB 5J39A 5JVG3 2G9HD 4PMBA 2N88A 2IPKD 4CJ1B 4TSSA 1CHPD 2E74C 1SNDA 4FF4A 3QIAA 2G9DA 2NN6H 3D6WA 1LO5D 2ENBA 3KLSX 3J81E 3U9OA 3VR2A 1FNVA 2EOTA 3EROA 1K83B 4HCEA 4C3JG 1Q3LA 4RKLA 3M4YA 2K5WA 1D5XC 2ZXRA 1QG7A 1EY8A 4IN3A 3MAQA 2AUKA 2IJ0A 3I3CA 2F03A 1ESRA 3S1QB 1WD0A 3OIQA 1O80A 3VA5A 2F0VA 1BBXC 2PYKA 2RA4A 5AFWA 1H9MA 2QF7A 2PQEA 3KLRA 3GV6A 3R93A 4CHTB 2HCIA 2SNMA 1YNJC 3KLSA 4KN7C 4WRDA 2XWJB 2F0GA 5FLXL 1LV9A 2NVTB 2PW5A 3HZXA 4HN7A 1R4QB 3DUZA 4BA2I 1Z7TA 1JOOA 2F0KA 3MTSA 4LAAA 3A54A 5IT9E 1LTSD 2L55A 3D31A 2WP8J 1SE4A 3MVVA 5K36H 2CW0D 3SR1A 3LNNA 2D9UA 3P7JA 3G7LA 1SMYD 3TBIB 1B4OA 2F0PA 5EGTA 2WV6D 2F0OA 1DZ1A 5M5YB 1HFNA 1BUVT 2E2DC 1ZKOA 2B8GA 3FMCA 4XXEA 4K6DA 3VR5A 3R2IA 5IGBA 3L7ZC 5I2XA 1IW7C 2WB1B 1GXDC 4RGOS 4BS9A 1GUWA 3T13A 2LFNA 4ULLA 2R92B 1BCPF 1D5ZC 3P20A 1SJED 2H1EA 5KRUA 3FDTA 1STBA 2K03A 3T53B 2O4XA 2EYHA 5JPNC 4Y7NB 1EEFD 3AMUA 3ND8A 3S1NB 4HCSA 5J1ZA 2DY7A 3TN2A 2DNEA 2N55A 3SK4A 3GQBA 2K32A 5M5XB 1EOTA 1F2LA 4TQUS 2E76C 5E4WC 4BY7B 1UAPA 1ENAA 3OSOA 4FXGC 4RFBA 1PFBA 2F0IA 2X6LA 3PUXA 4J6HA 3BG3A 5I6WA 1XYIA 4J8QA 1HTLD 3UI2A 1QNUA 3TSSA 3R3OA 3DEPA 3AB9A 1J9OA 3MWYW 4DK0A 3Q22A 4Z9CB 2XNAC 4A3IB 4G4KA 2K28A 2EJFC 3EA6A 2BDOA 1I6HB 1MGSA 5C4HA 1YNNC 4S3SA 1QJOA 3CU7A 3MEHA 1FNWA 3CHBD 4QUCA 1PZID 1DXMA 1SEBD 5LL6S 3NSWA 4KN4C 1T5XD 1FYCA 2RSNA 1Q1EA 1PFNA 4K8IA 2NUCA 1D1IA 3C3LA 3K7AB 1AFPA 2B8FA 2WKDA 3M85A 4A3FB 4KHZA 2A6EC 3J81L 2FFKB 4HMJA 2KHSA 4FF3A 1ET9A 1ILQA 1U4LA 3MXGA 3N52A 1K8OA 5BN3A 3TP8A 3NWSA 2JEBI 3CQZB 5T1IA 1U4MA 4OO1I 3RLFA 1SYGA 2HUGA 3W3AA 1TKWB 2CQAA 3SK5A 1TWAB 1VCIA 5IGDA 2L9HA 1RTNA 1OXTA 1WTXA 4KKTA 4IUNA 4E6IA 5K5PA 2CVRA 5A2QL 4XQJA 2YU9B 1NR2A 2LY7A 1EIGA 2AQ1B 3NUCA 1Y1WB 2K6AA 1PMRA 4V190 3QOLA 4A93B 3A7AB 2LMCB 2K1BA 4XT3B 2F0UA 3S15B 1SYFA 2V4DA 1LTTD 1BXTA 2A68D 2B2WC 4ODGA 2A69D 1OXUA 4WORA 1GUSA 1IKLA 2HCCA 2MJ8A 3KBGA 4RAUC 3E6ZX 3EFXD 2PPBC 2NB0A 2EY5A 2O2LD 3MXNA 1EQTA 5CV6A 4X3KA 1S4ZA 3HOXB 1A15A 1STNA 5LHY1 2Y0SB 1GUOA 3LX0A 5T1GA 1CZGA 4IUUA 3K5LA 1RCVD 3OHXC 4ZQ3A 1VF7A 2EYLA 1SE2A 4C3HB 2MHVA 2E2JB 5FK9C 1X3QA 4DAVA 4ZLTF 4ZYSA 3NBIA 1LT5D 5A35A 2A6HC 1KDCA 4XTCS 5CGKA 1PLFA 3D4WA 5FOBB 2F1MA 4ZUIA 1S5FD 2AQ3B 4KY6A 4JBWA 2F3VA 5EBDA 3EQLC 4J1MA 5CV8A 2VUMB 1F77A 1I4QA 2BDNA 3GTPB 3I72A 4LK1C 1BNZA 2L11A 3S1MB 2IWHA 4OO1H 4QMGA 1C8CA 1NAPA 2D62A 3A55A 5KYIA 2ID0A 3KF8A 2PO4A 4C1NK 1EU3A 2FINB 5ELBA 5KYLA 1F9RA 4PNYA 4IFDG 5D3DA 1WTVA 2MUYA 4WFN3 1JWMD 2R61A 2KVMA 4RCNA 4RHSA 3VYUA 4MHEA 1UUPA 1JCKB 1CHQD 2WIIB 1MBYA 1Q90A 1QB5D 3D6CA 1JOKA 2E2HB 5KGUA 5I2YA 3GTOB 5E4XA 4G57A 2QEJC 3OWEB 4ZAIA 3VA7A 3DWQA 5C0XI 3GTQB 1CA6A 2JP1A 1EQVA 5CV4A 2B2TC 1I4HA 1BCPD 3NQIA 4H0LC 4M8AA 1SFOB 1RKNA 4C1NI 1TS5A 2AWNA 5IIFA 4XT1B 1HHVA 1EY0A 3Q6SA 1CQFA 2F0SA 4CGYB 3MFGA 1SYBA 3K5OA 4A3GB 1PZKD 1PRTC 1QNKA 4N9TA 4LMQD 1GHJA 3WOFA 1RODA 1F9QA 1SAPA 2BE5C 4PMCA 1HRJA 1E2VA 4QIWB 1XXGA 3E0JA 4FF1A 1G2SA 2NVYB 5M5WB 2EE1A 4BBRB 4BA1I 2EVBA 3NBHA 1D6EC 4ZKBB 2PMZB 2YYZA 4IUTA 1M4VA 4KY5A 3TDQA 3VYRA 4I65A 3MFYA 2PZTA 5JEAJ 1HUMA 1EIHA 4A3EB 1W6JA 1WTRA 4QB4A 1H9SB 3U9SA 1DCZA 1BCPB 2ZXPA 5HURA 2J4XA 4F8MA 5C0XJ 3PIO3 2I07B 1HXYD 4KD3A 3P1HA 3SE0A 2Z4IA 5C3XA 2O5JC 1JR0D 4KI0A 3VR6A 1O7ZA 4IZ8A 2AQ2B 3H6MA 1AZPA 2M9VA 1STGA 4K5WA 1PZJD 3D3RA 2OF1A 2RDHA 3QOJA 2NTTA 4KK7A 5TSSA 5C4ZA 3GTLB 1AEXA 1LLRD 1QWYA 4XIGS 4XYOA 5G3LF 1Y8NB 1HUNA 1RD9D 1DYQA 4G7OC 1IYVA 1ET6A 1H9JA 2SDFA 5JEAH 4XDXA 3LWEA 1KAAA 1NR4A 3E5SA 1BDOA 2RDFA 3D4RA 1YNJD 1II3A 1DOLA 4K5XA 2K5DA 5C0XH 1RJTA 3IL8A 4NDXA 5FO7B 2BA1A 4DGZA 2JA6B 3IAYA 2SOBA 2EY1A 4PQXA 2ICEC 3HOWB 2I46A 4TRDA 3I8ZA 2F0FA 1A3UA 4Q0FA 1DOMA 2MGSA 4HSPA 1AZQA 4QF4A 3HEJA 3TZUA 5I4DA 2F0EA 1EYCA 1EZ8A 2XRSD 2PCFB 1OXVA 5I6YA 5DM73 4BWGB 1SJHD 1ENCA 4WJWA 3HGBA 4DU9A 1A6XA 2PW7A 1TS2A 2NN6G 2RSOA 3M4OB 1TWCB 5M3MB 1IW7D 4H44C 1M8AA 3J7AF 3I70A 3PMFA 4X3SA 4HEDA 5D14A 1U4RA 1NUCA 4IUQA 1JB3A 3I73A 1JWUD 1C4QA 3DEOA 3Q24A 1HQRD 1VDZA 4KTAA 1TS4A 1S5DD 1U4PA 3WOEA 2F3WA 2WACA 4A3JB 1CZWA 4K8JA 1ILPA 2EYFA 1OXSC 4XYQA 1PRTF 4FP5D 5CV5A 3SEBA 4C3IB 1LT4D 2NBFA 4IFDI 4R8NA 4K5VA 3NQTA 2BOSA 2K7VA 4C56C 3HG9A 4DF7A 3H3VC 5C6AA 3OMCA 1Z6HA 4F87A 3GTGB 5I9PA 4UAIA 4EQOA 1RDPD 4C2MB 1H9KA 3NTKA 5EPKA 1GHKA 4FXKC 4A3KB 3NHHA 3KBXA 3HP3A 3I91A 1SSOA 5K36G 1JC7A 1EFID 4NKLA 3G6JB 1SNCA 1F9SA 3OMGA 2F0MA 5IODA 4DAPA 1EY9A 2M2LA 1LT3D 1YNND 5DEHA 5EPJA 4KV6A 3HOVB 3BVGA 4ME5A 3NWTA 1PFMA 2VB3X 1A3TA 5EJWA 3M3YB 2FHTA 5KNCA 3WDNA 4C3HG 4H7BA 1EY5A 1QCBD 4CKEA 2RDGA 3T4AC 2X69A 5CV9A 3NTHA 1STEA 1TWGB 4DK1A 4ZRZA 1VMCA 3H91A 2OEOA 1PDQA 2A6ED 1O78A 3OOCA 4PMWA 2EYPA 1V1OA 1TQOA 3S2DB 3DMUA 1EWHA 5J22A 2NYZD 3NE5B 2D5DA 3RMHA 4FYDA 5E3FA 1HPCA 4K2KA 1TWFB 2F0TA 1SYCA 5JOBA 2JSOA 2Z8LA 3R8BA 4KY7A 2EYOA 3GD7A 4JK1C 1TY2A 3S16B 4CJ2C 1A2UA 2R3ZA 2B2UC 3KUPA 1DOKA 1SNQA 4M1UB 3J7YW 4EQPA 4NP5A 2C5CA 2EPBA 3HOUB 2A74C 1DM0B 4RA8A 4ABNA 2QKIC 1ESFA 5IT9L 5KNDA 4IFDH 1G91A 1Y8OB 4KHVA 1KLGD 2B2YA 1B9MA 1WTWA 1SBBB 4ZKCB 2R7ZB 4RKBA 5IGFA 2SEBD 3NTIA 3C46A 1RTOA 1EL0A 3RD4A 4DNTB 1ICWA 4KJOA 3ITPA 3D8GA 5EBCA 1S5BD 5CV7A 1WCMB 1STAA 2B2VA 4B9XA 2IX1A 5C5MA 4DA2A 1KLUD 1LTBD 4RCOA 1JORA 5JAVA 1NCVA 2EJGC 2FMCA 1SYEA 4IUVA 3TP6A 2KOLA 4HSVA 4MIUA 4LJZC 1CA5A 5G3LD 4DXFA 2A6HD 4ZUJA 4L8JA 2J0TD 4RGNA 3S1RB 1PTOC 2MPMA 3OPOA 2FJ2A 5E1FA 5EKLA 3T16A 3GTMB 1V8QA 4F88A 1S5ED 1HCZA 1ZXTA 2M00A 3QJYA 5IGCA 2F0HA 1Q12A 4EVOA 1I3QB 4TKOB 4FNFA 3CKIB 3C2PA 1XWEA 1WD1A 1QOHA 2B39A 4CBVA 3H09A 3VR3A 2WKCA 4A3DB 4GZYC 1DONA 1TVXA 4I7ZC 2A73B 2NVQB 1H9SA 3IFTA 3EJIA 5EKKA 2JXMB 5M9OA 1DJRD 1SXTA 4IUPA 5DNFA 2Q8RE 3S2HB 1GJXA 4HTHA 3QWNA 1H9RA 2QDBA 1LTAD 2RKSA 1LACA 5BN5A 1Z47A 4KKSA 2BA0A 5D3IB 5CMDA 3RUZA 3FVQA 3DWPA 3KK7A 3T56B 2F0WA 1CI3M 3I90A 3ZYYX 2KJXA 1KNEA 4X3UA 3GP7A 1J8IA 1ZYRC 4K14A 3T51B 2PNRC 1E2ZA 2JA7B 2EY2A 2Q8IB 2FMMA 2PZWA 3OIPA 1X3PA 3MHBA 1BF4A 2ICIA 3H0GB 1PRTD 1B2TA 1KTKA 2XN9C 1CTMA 5DAUA 1B53A 2BE5D 3GV3A 4UDUC 2BCOA 4K2LA 1S5CD 5KIXA 3S9WA 1KNAA 4OIJA 3URYA 2F0DA 3HOZB 3EVQA 1EY4A 1TY0A 3D4DA 1FGBD 5LL6X 3CRKC 4FO2A 3W2DA 3DWAA 5C5LA 3SDZA 5ELFA 2K33A 3OWFA 2HQEA 3Q23A 4OO1G 2SNSA 1CFMA 1MD2D 2IX3A 2NTSA 2DNCA 2C9OA 4FVMA 2Q8TA 1B3AA 1G8ZD 2ZT9C 4NW2A 4RWSC 1EU4A 1CT1D 3RZOB 2L1BA 5C3WA 2CHBD 4OL7A 2L0CA 1HA5A 3K6OA 1IL8A 3PV0A 1BR9A 1U9RA 1I50B 4YIJA 3GTJB 3VR4A 2EYJA 3GTKB 5C4JB 1LTGD 2F0JA 2RBMA 1PRTB 4KD4A 5COYA 4C3IG 1L0YB 1SNMA 3MXPA 3TP7A 3K5NA 2E2IB 1RF2D 2L5TA 3IKJA 3ONAB 5I9OA 1WTPA 3HKZB 2MP1A 3M7GA 2L12A 5A2QE 1PTOF 2NVXB 3X3NA 1F9PA 1Q8IA 1JQYD 1LT6D 2XSCA 3NXWA 3V05A 5CORA 5FO8B 2KEEA 4FXDA 3ERQA 2CW0C 3R2TA 3TP5A 1DD2A 3J7AV 4DAYA 5FKAC 1SMYC 3BYTB 3QB3A 1B44D 3QG1A 1WTQA 5JVH3 2DY8A 2KCNA 2QILA 3MC0B 2E75C 3SXHA 4KKUA 3PUVA 1D1KA 2AWOA 2QCPX 3NP8A 1SE3A 1XTCD 2IL8A 2JYOA 2R6GA 3A8IE 4A3MB 4HR7B 1WTOA 2OXPA 1V1PA 2XRQD 4L63B 1IKMA 3BDLA 4U68A 5IGEA 3VYTA 1UNSA 1SNOA 2LS01 1STHA 3I4LA 4ID6A 1F2ZA 1T5EA 1HFGA 4C3JB 2RQXA 3GO5A 5ELDA 3J80E 1WVLA 5CBAE 4DFAA 1D2BA 2EY6A 5F2DA 3QO2A 2TSSA 2VB2X 1UEAB 2KCCA 2JA8B 2R93B 1CM9A 1O7YA 5JEAG 2J7ZA 3NK9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y8P B;  1H9M A;  2QF7 A;  2B8F A;  3ND8 A;  3HGB A;  1HQM C;  3SE0 A;  3M85 A;  3KLR A;  1GUO A;  1G29 1;  4KHZ A;  4PV1 C;  5C0X G;  1A6X A;  2A6E C;  3PUW A;  3CRK C;  2O5J C;  2NN6 G;  2CW0 C;  3VA7 A;  4KI0 A;  3SDZ A;  1DD2 A;  3VR6 A;  3ND9 A;  4DNR B;  5KND A;  4IFD H;  2K33 A;  2DNE A;  3VR3 A;  2NN6 I;  1IW7 D;  4H44 C;  1SMY C;  1Y8O B;  3GQB A;  4GZY C;  1GUT A;  4H0L C;  1YNJ C;  2K32 A;  4I7Z C;  1K8O A;  1VF7 A;  5BN3 A;  1B9M A;  3QG1 A;  4KN7 C;  4TQU S;  4OO1 G;  1H9S A;  2E76 C;  1I6V C;  2JEB I;  3DXJ C;  3IFT A;  4OGQ C;  2JXM B;  1FR3 A;  2O5I C;  1CFM A;  1Y69 U;  5KNC A;  3RLF A;  5BN4 A;  3WDN A;  2DNC A;  1GJX A;  1V43 A;  1H9R A;  4G7Z C;  5A35 A;  3W3A A;  2A6H C;  3I73 A;  1TKW B;  2ZT9 C;  2A68 C;  4BA2 I;  2E75 C;  2KA7 A;  1LAC A;  3PUX A;  5BN5 A;  1Z7T A;  4DNT B;  2A69 C;  3FPP A;  4KKS A;  4XTC S;  4DK1 A;  4KKU A;  3PUZ A;  3PUV A;  4XIG S;  1Y8N B;  1VDZ A;  2BA0 A;  3BG3 A;  1VCI A;  4KMU C;  2AWO A;  2EJM A;  3LWU A;  4G7O C;  1IYV A;  1Q1B A;  2F1M A;  2R6G A;  3A8I E;  3D31 A;  1OXT A;  2A6E D;  4KKT A;  1ONL A;  4H13 C;  2EDG A;  4JBW A;  3T56 B;  5K36 H;  1GHJ A;  1O78 A;  1H9J A;  1CI3 M;  3AB9 A;  3MXU A;  3OOC A;  4HR7 B;  5JEA H;  3PV0 A;  3LNN A;  3EQL C;  4DK0 A;  2BE5 C;  1OXS C;  1EWH A;  1BDO A;  1GUN A;  3D4R A;  2DN8 A;  1E2W A;  3NE5 B;  2JE6 I;  2E74 C;  3VR4 A;  1PMR A;  1E2V A;  2D5D A;  3I4L A;  4IQZ A;  5C0X H;  2EJG C;  1GUG A;  1T5E A;  2BA1 A;  3QIA A;  2NN6 H;  1ZYR C;  3T51 B;  2EJF C;  3A7A B;  2PNR C;  1E2Z A;  2LMC B;  2JEA I;  3I72 A;  4LK1 C;  1HPC A;  1ZKO A;  2B8G A;  2BDO A;  3BDO A;  4LJZ C;  1OXX K;  2V4D A;  2K7V A;  3FMC A;  3VR2 A;  1IYU A;  1YNN C;  2A6H D;  3VR5 A;  1QJO A;  1TU2 B;  2Q8I B;  2A68 D;  4OO1 H;  3L7Z C;  1Z6H A;  4L8J A;  4BA1 I;  2EVB A;  1IW7 C;  2L5T A;  3OW7 A;  3GD7 A;  1B9N A;  2A69 D;  3IKJ A;  4JK1 C;  1DXM A;  1OXU A;  3M7N A;  2D62 A;  3M4Y A;  1HTP A;  3A8K E;  3OPO A;  1K8M A;  2IT1 A;  4KN4 C;  2AUJ D;  4G7H C;  1GUS A;  1H9K A;  1FYC A;  1LAB A;  2YYZ A;  2AUK A;  3A7L A;  1GHK A;  4IFD G;  3CRL C;  1V8Q A;  1Q1E A;  2KCC A;  3P20 A;  3MFY A;  1CTM A;  3H94 A;  2PPB C;  3TZU A;  1HCZ A;  2D2C C;  2BE5 D;  3PUY A;  3QJY A;  4RCN A;  3T53 B;  5K36 G;  3U9S A;  1H9S B;  1Q12 A;  1DCZ A;  2PCF B;  1O7L A;  1OXV A;  3N6R A;  4TKO B;  5JEA G;  5KNB A;  1VF5 C;  1Q90 A;  3A8J E; 
#chains in the Genus database with same CATH topology
 1MKH A;  1Y8P B;  1AP0 A;  4JV5 L;  1CQV A;  4PV1 C;  5C0X G;  2IX0 A;  3CAM A;  1D5M C;  3J7Z C;  1JWS D;  1B70 B;  3I7F A;  5FJ8 G;  2Z6B A;  3ND9 A;  2KQ3 A;  4LF9 L;  3HOU G;  2UXD Q;  1K8A C;  1I94 L;  1QIL A;  3DXJ C;  5CC4 A;  4OGQ C;  5JPM C;  1VQO A;  4CKB A;  3JAM E;  3KDF A;  1HR0 L;  3S17 H;  1F2Y A;  5BN4 A;  4LFC L;  1IYJ B;  1KQS A;  4DN4 M;  2K5Q A;  4V0B A;  4IAL A;  2TMP A;  1TR5 A;  2R7Z G;  2NZO A;  1RIP A;  1M90 C;  2GVA A;  2E5L L;  2UXB L;  1EY6 A;  1ENF A;  1STY A;  3FEW X;  4HJ8 A;  3A56 A;  4DUY L;  2KUM A;  1GVP A;  4OHJ A;  3K0Y A;  4EQN A;  4H13 C;  1M1K C;  3MXU A;  3GTQ H;  5ELO A;  1V1P B;  4RHR A;  1GKH A;  1WCM G;  5ELC A;  3BZD B;  1GOZ A;  1UEB A;  1E2W A;  2JE6 I;  2JA5 B;  4A3B H;  2IHE A;  4EGV A;  4ALP A;  1PTO H;  2UUA L;  4NXM L;  2XWB B;  3FRP B;  2RVL A;  3KJO A;  4OON A;  2D0O A;  2CH4 A;  2ZXO A;  3BDO A;  4PZ8 A;  2H4O A;  4ZCK A;  2XVS A;  4AQY L;  3PO2 B;  1SRO A;  1P16 A;  4IFD J;  1TWH B;  1K9M C;  5ELE A;  3V2T A;  4OIK A;  1PYW D;  5CYU A;  1OO9 B;  1LTI D;  4RGM A;  4G7H C;  3WWV A;  1HA6 A;  3RZD B;  3UDX A;  3CRL C;  5C3E B;  3DHQ A;  2L15 A;  1JE4 A;  3UDI A;  2HDL A;  1BO0 A;  2D2C C;  1AN8 A;  2ASB A;  1L0X B;  1YJN A;  4JI8 L;  1O7L A;  4OWX B;  5DLQ E;  1W3S A;  1VF5 C;  1JJ2 A;  4X64 Q;  2B2U A;  1JMC A;  4I7A A;  1TT2 A;  2KEC A;  3O13 A;  1JJC B;  5EPL A;  5M5W H;  3BVM A;  1E7Z A;  1G29 1;  1G2T A;  1BBU A;  3F2D A;  4GKJ Q;  2IW3 A;  4AYB B;  1S3O A;  4HMI A;  1A62 A;  4FF2 A;  3E9I A;  2HD3 A;  4O1N A;  3J81 c;  1GUT A;  5JJZ A;  5EQ0 A;  2B2W A;  3K5M A;  1WOC A;  1PA6 A;  1XX8 A;  4A3D G;  1FR3 A;  3TS0 A;  3BVZ A;  1PH3 A;  4B9W A;  2YV5 A;  4KHP Q;  1N36 Q;  4A3E H;  3PO3 B;  1NSN S;  4B3R L;  4JI5 L;  5FO9 B;  2EYM A;  4NMZ A;  1R4P B;  2F52 A;  2A68 C;  4N9P A;  1FL0 A;  4MTN A;  4DR4 L;  2K04 A;  2A69 C;  2JA9 A;  3TME A;  3PUZ A;  4P75 A;  3Q0A A;  3VYS A;  3NPP A;  2EJM A;  3LWU A;  4O42 A;  5CBE E;  1Q1B A;  3HOY B;  4ME3 A;  1FD7 D;  1C48 A;  4P2C B;  1I4P A;  1KDB A;  3BS1 A;  1VQC A;  2F3I A;  1G6Z A;  2I5M X;  1VQF A;  3SHL A;  1K0S A;  4PZ7 A;  3U4Z A;  4YWK A;  2N8N A;  3FPU B;  2DN8 A;  3SK6 A;  4R9W A;  3I4N B;  2I5H A;  4IQZ A;  5NUC A;  1GUG A;  1L0W A;  2WAQ B;  4L6T B;  1AW7 A;  1X32 A;  4RG1 A;  2JEA I;  1BQQ T;  2QW7 A;  1IYU A;  1NY4 A;  3X3M A;  3GTL H;  2Y0S E;  3TZD A;  3EIV A;  2B2Y C;  4WJ4 A;  1HJP A;  1FJG Q;  1L2F A;  3L9A X;  3OW7 A;  4QL5 A;  4X66 Q;  1N34 Q;  1I4X A;  1CSP A;  1HTP A;  1EZ6 A;  3J80 i;  2DGY A;  2JA7 G;  1FGU A;  1K8M A;  4B3M L;  4JI0 L;  1MSH A;  4OWT B;  2VQE Q;  2NZ1 D;  4JI3 L;  5FLX E;  5LMN L;  1D8L A;  1I4G A;  2VNU D;  3LGJ A;  3H94 A;  4DR1 L;  3H0G G;  3PUY A;  5IT9 c;  2R7F A;  4JI4 L;  2NVT H;  2ZJP A;  2KED A;  1EIF A;  1CKN A;  3AU7 A;  1J5E Q;  3C1F A;  4DXG A;  2JA6 H;  2B2V C;  3K57 A;  1IHZ A;  3I4M B;  1LTR D;  4R8I A;  1KAB A;  4UPA A;  1O7I A;  1BOS A;  2EXZ A;  3PUW A;  2Z1C A;  1EEI D;  3HRZ C;  4BY1 B;  1VQN A;  4F7X A;  4QUF A;  1SDF A;  4LFA L;  3HOZ G;  2B63 B;  2HDM A;  1EUJ A;  3J80 L;  5CR3 A;  3K58 A;  3HOW H;  5IOC A;  1SNP A;  4DUZ Q;  2NN6 I;  5AJ3 L;  1PTO D;  3K59 A;  1A0I A;  5J3B A;  1EYD A;  1ML0 D;  1I6V C;  3L3O C;  3S14 B;  2O5I C;  3PIP 3;  5HGT A;  4BBS B;  1CK1 A;  5C4X B;  4LF5 L;  4B08 A;  3JAM i;  4GLX A;  1H95 A;  1YIJ A;  1A2T A;  2KA7 A;  3G71 A;  1QZG A;  4QCL A;  4DV3 Q;  4MN3 A;  2NWG A;  3DM1 A;  2QA4 A;  2VQF Q;  4KMU C;  1EY7 A;  2OT2 A;  1ZEQ X;  1R9T B;  2X6G A;  3C1E A;  4GNX C;  5C44 B;  3M4O H;  2R92 H;  3F2U A;  1TWC H;  4XQN A;  4DR7 L;  3V96 A;  4RGT A;  1MSG A;  3SK8 A;  1KDA A;  1QZH A;  4LF6 L;  1GUN A;  3HS0 C;  2AKW B;  3CME A;  1Q86 C;  2B2T A;  4K6L A;  1F2M A;  3NEN A;  5D65 A;  2F0Q A;  3S17 B;  1N8R C;  2BH2 A;  1A3V A;  3JAM L;  1VMP A;  4JW0 A;  4X3T A;  2K05 A;  1OXX K;  1TS3 A;  1TU2 B;  4IUR A;  2H5X A;  4DR3 L;  3M7N A;  1B9N A;  1E0B A;  1BCP C;  1PH2 A;  1KD1 C;  3A8K E;  1MI2 A;  2LKV A;  2IT1 A;  5DM6 3;  2AUJ D;  4K0K L;  1LAB A;  1EYA A;  3A7L A;  4A3J H;  1X3E A;  5ISR A;  1RHP A;  4O2D A;  4BY7 H;  4IOA A;  3HKZ G;  4HAE A;  1HZC A;  2V1C C;  4ZK9 B;  2ZTC A;  5EKI A;  4C3I H;  4A3B B;  4KJN A;  1PTO B;  3N6R A;  5KNB A;  1JIC A;  3A8J E;  1IBL L;  3K80 C;  5KEE A;  1ZYR D;  2PZU A;  2K01 A;  2Q2I A;  3IFD A;  1IBM Q;  1VQ8 A;  1PXU A;  1HQM C;  1I4R A;  4B3S Q;  1W6K A;  2EZV A;  4DK3 C;  2F4I A;  5IYB H;  3BDC A;  4XQQ A;  4CKC A;  4DNR B;  1B50 A;  1A63 A;  2L4N A;  3BYY B;  1QE6 A;  1JOQ A;  4Q5V A;  5IGG A;  5M3F B;  1Y1V B;  2VXW A;  2XIW A;  3RN2 A;  4U67 3;  1Y69 U;  4QIW E;  4A3K H;  3CMA A;  1UE6 A;  3E0E A;  2A5H A;  2PQA B;  1V43 A;  1FNU A;  2RHS B;  4G7Z C;  3MA2 B;  4DR5 Q;  4YY3 Q;  1TII D;  2F0N A;  1SN8 A;  3FKI B;  4MNO A;  1SYD A;  2GA4 B;  3FPP A;  3P75 A;  1B1Z A;  2DJG C;  1EWC A;  4RH6 A;  2Z4H A;  2HHH L;  1KC8 C;  4ILW A;  1U5K A;  1IBK L;  4CJ0 B;  3SVM A;  2F0L A;  4JCV E;  1ONL A;  2EDG A;  3MZ5 A;  2WIN B;  5J39 A;  2PMZ E;  5JVG 3;  2G9H D;  4PMB A;  2JJQ A;  2N88 A;  2IPK D;  3KF8 B;  4CJ1 B;  4TSS A;  4A3M G;  1CHP D;  2E74 C;  1X55 A;  1SND A;  4B3T L;  4FF4 A;  3QIA A;  2G9D A;  2NN6 H;  3D6W A;  4DV5 Q;  1LO5 D;  3K7A H;  2ENB A;  3KLS X;  1PHJ A;  3J81 E;  3U9O A;  4NXN Q;  3PCO B;  3VR2 A;  2Z6K C;  5IWA Q;  1FNV A;  2EOT A;  3ERO A;  1K83 B;  1PH5 A;  1TWG H;  2CFM A;  4HCE A;  4C3J G;  1XMQ L;  1Q3L A;  4RKL A;  1MIU A;  3M4Y A;  1HZ9 A;  4H02 A;  2K5W A;  1D5X C;  2ZXR A;  5IYC H;  1QG7 A;  1EY8 A;  4IN3 A;  5IE8 A;  3MAQ A;  2AUK A;  2IJ0 A;  3I3C A;  2F03 A;  1WFQ A;  1ESR A;  4OWW B;  3S1Q B;  1G6P A;  3S2D H;  1WD0 A;  3OIQ A;  4TVA B;  2CH4 W;  1O80 A;  3VA5 A;  2F0V A;  3RR5 A;  2CQO A;  2WFW A;  2CWA A;  5FLM H;  1BBX C;  2PYK A;  2RA4 A;  5AFW A;  2JA8 G;  4IOC A;  2Z9H A;  2R93 G;  1L1O B;  1H9M A;  2QF7 A;  2PQE A;  4GKK L;  3KLR A;  1TWF H;  2K50 A;  1NMF A;  4LUO A;  1NNX A;  3GV6 A;  3R93 A;  4CHT B;  2YU9 H;  1RL2 A;  4YCU A;  2HCI A;  2SNM A;  1YNJ C;  3KLS A;  1Y1W H;  4KN7 C;  4WRD A;  2XWJ B;  1Y14 B;  2F0G A;  5FLX L;  2CWP A;  1LV9 A;  2Q2T A;  3CCS A;  2NVT B;  2PW5 A;  3EN2 A;  3HZX A;  4HN7 A;  1R4Q B;  3DUZ A;  4BA2 I;  5IP7 H;  4NB3 A;  1DGS A;  1Z7T A;  1PVO A;  1JOO A;  2F0K A;  5FJ8 H;  2QEX A;  4FDB A;  1QUQ A;  4DR2 L;  3MTS A;  1MHW C;  4LAA A;  4LF8 L;  3KFU A;  3A54 A;  5IT9 E;  1LTS D;  2L55 A;  3D31 A;  2WP8 J;  1SE4 A;  3MVV A;  5K36 H;  1NMG A;  2CW0 D;  3NBH B;  3SR1 A;  3LNN A;  2D9U A;  3PIP A;  3P7J A;  3G7L A;  1SMY D;  3QR8 A;  3PQI A;  3TBI B;  4JI6 L;  4P72 A;  1B4O A;  4CDD C;  1SRU A;  2R7Z H;  2F0P A;  1KL9 A;  5EGT A;  1HNW L;  2WV6 D;  3HOX H;  2F0O A;  1DZ1 A;  3HKS A;  5M5Y B;  1HFN A;  1BUV T;  2E2D C;  1BVS A;  4A75 A;  1ZKO A;  2B8G A;  2JA5 G;  2OTJ A;  1WJJ A;  3FMC A;  4XXE A;  4K6D A;  3VR5 A;  2B29 A;  3R2I A;  5IGB A;  1NBW A;  3L7Z C;  5I2X A;  1IW7 C;  4BXX G;  2WB1 B;  1GXD C;  4GLA C;  4RGO S;  4BS9 A;  1WCM H;  4A3L H;  3PO2 G;  1GUW A;  3T13 A;  4C3H H;  2LFN A;  3CD6 A;  4ULL A;  2R92 B;  1BCP F;  1D5Z C;  1EQQ A;  3P20 A;  2PI2 A;  1IXR A;  1SJE D;  2H1E A;  3FDT A;  5KRU A;  1STB A;  2K03 A;  3T53 B;  2O4X A;  3AFP A;  2EYH A;  5JPN C;  4Y7N B;  5C3E G;  3ICE A;  1EEF D;  1SMX A;  1S40 A;  3AMU A;  3ND8 A;  4QQB X;  3S1N B;  4HCS A;  5J1Z A;  1UWV A;  5ELN A;  5L37 A;  2DY7 A;  3TN2 A;  2DNE A;  2N55 A;  3SK4 A;  3GQB A;  2K32 A;  5M5X B;  1EOT A;  1F2L A;  1SE8 A;  4TQU S;  4AYB G;  2E76 C;  5E4W C;  3KOJ A;  2JN4 A;  4BY7 B;  1UAP A;  3GTP H;  1T9H A;  1ENA A;  3OSO A;  4FXG C;  4RFB A;  4GLV B;  3S1M H;  1EQR A;  1I3Q H;  1YIT A;  5BR8 L;  3OW2 A;  1PFB A;  1AE3 A;  2F0I A;  4N8F A;  1HNZ Q;  2X6L A;  3PUX A;  4J6H A;  2UU9 L;  3PSI A;  3PO3 G;  3BG3 A;  5I6W A;  1XYI A;  3B6Y A;  4J8Q A;  1KXL A;  1HTL D;  1QUQ B;  3UI2 A;  1QNU A;  3TSS A;  3R3O A;  3DEP A;  3AB9 A;  1J9O A;  3MWY W;  1VQI A;  4DK0 A;  3Q22 A;  3HOY G;  3OTO L;  4Z9C B;  2XNA C;  3RNU A;  4DV0 Q;  1P8L A;  4A3I B;  2PNH A;  4G4K A;  2E5L Q;  2K28 A;  2UXB Q;  4O0A A;  2UXD L;  2EJF C;  2E2H H;  3CP0 A;  3EA6 A;  3KF6 B;  2KHI A;  2BDO A;  3GTO H;  3I4N G;  5GAE C;  3T1Y L;  1I6H B;  1MGS A;  5C4H A;  1YNN C;  4S3S A;  1QJO A;  2WAQ G;  3CU7 A;  3MEH A;  1FNW A;  2A19 A;  3J81 i;  3CHB D;  5HY6 A;  4QUC A;  1PZI D;  1DXM A;  1SEB D;  5LL6 S;  3NSW A;  1SFO H;  4KN4 C;  1T5X D;  1FYC A;  2UUA Q;  2RSN A;  1Q1E A;  1PFN A;  4JI1 L;  2A1A A;  4DV4 L;  4NXM Q;  2Q2U A;  4K8I A;  1C7Y A;  4HJ7 A;  2ZTE A;  2NUC A;  4LFB Q;  4LUV A;  1D1I A;  2LXJ A;  3C3L A;  3K7A B;  1AFP A;  2B8F A;  1B7Y B;  2WKD A;  3M85 A;  4A3G H;  4A3F B;  4KHZ A;  1VQA A;  1X54 A;  2A6E C;  2JA7 H;  3J81 L;  2FFK B;  4EQ5 A;  4HMJ A;  3I4M G;  2KHS A;  4JI7 L;  4FF3 A;  1ET9 A;  1ILQ A;  1U4L A;  3H0G H;  3MXG A;  3N52 A;  1PFS A;  1K8O A;  5BN3 A;  3TP8 A;  3NWS A;  2B63 G;  4JI8 Q;  2JEB I;  3CQZ B;  5T1I A;  3I56 A;  1U4M A;  4OO1 I;  3RLF A;  2LSS A;  4POG A;  2NVY H;  1SYG A;  2HUG A;  3W3A A;  1XJV A;  1YHA A;  1TKW B;  3GDE A;  4BBR H;  2EXD A;  2CQA A;  4BBS G;  4AH6 A;  3SK5 A;  2N3S A;  5C4X G;  1TWA B;  1VCI A;  2RCF A;  5IGD A;  2L9H A;  1RTN A;  1OXT A;  1WTX A;  4KKT A;  3KYH C;  4RMF A;  4IUN A;  4E6I A;  5K5P A;  2CVR A;  5A2Q L;  4XQJ A;  2YU9 B;  2KCT A;  1NR2 A;  2LY7 A;  4DV1 Q;  1EIG A;  1X65 A;  2AQ1 B;  3NUC A;  2UXC L;  5C44 G;  1Y1W B;  2K6A A;  4JI5 Q;  4NPS A;  3CF5 A;  1PMR A;  4V19 0;  4R4O A;  4DR4 Q;  3UE0 A;  1B3Q A;  3QOL A;  4A93 B;  3CCU A;  3A7A B;  2LMC B;  2K1B A;  4XT3 B;  2F0U A;  3TS2 A;  3S15 B;  1SYF A;  1X3F A;  2V4D A;  4JI2 L;  3DLL A;  1LTT D;  1BXT A;  1C0A A;  4YHH L;  2A68 D;  2B2W C;  4ODG A;  2A69 D;  3F1Z A;  1OXU A;  4WOR A;  2HIX A;  1GUS A;  3K81 C;  1NE3 A;  1IKL A;  2HCC A;  2MJ8 A;  3KBG A;  4RAU C;  3E6Z X;  3EFX D;  2JK8 A;  2PPB C;  2NB0 A;  2EY5 A;  1I50 H;  2O2L D;  3MXN A;  1EQT A;  5CV6 A;  1K3B C;  3GTK H;  4X3K A;  1S4Z A;  3HOX B;  3T1H Q;  1A15 A;  1VQJ A;  3ER0 A;  2HQL A;  1STN A;  5LHY 1;  5LMN W;  1D7Q A;  4A3B G;  1X6O A;  2Y0S B;  1GUO A;  4B3M Q;  4JC0 A;  3LX0 A;  4JI3 Q;  5LMN Q;  5T1G A;  2E2I H;  1CZG A;  4IUU A;  3K5L A;  1RCV D;  3OHX C;  4ZQ3 A;  4DR1 Q;  1XTD A;  1VF7 A;  1HH2 P;  1SE2 A;  2EYL A;  2KHJ A;  4DV7 L;  4C3H B;  2MHV A;  2E2J B;  1K8G A;  5FK9 C;  1N34 L;  2NVX H;  1X3Q A;  4LF7 L;  1CKO A;  4DAV A;  4APV A;  4ZLT F;  5M3F G;  1Y1V G;  1JB7 A;  3L2P A;  4ZYS A;  3NBI A;  1LT5 D;  5A35 A;  2A6H C;  4R4C A;  4DR6 Q;  4LFA Q;  1KDC A;  4XTC S;  5CGK A;  1PLF A;  4A3C G;  3D4W A;  2MQH A;  5FOB B;  2F1M A;  4ZUI A;  3FKI G;  1S5F D;  2AQ3 B;  2K5H A;  4KY6 A;  4JBW A;  3STB C;  2F3V A;  5EBD A;  3ZJY C;  3EQL C;  3BJU A;  4KLK A;  1ASZ A;  4J1M A;  2PQA A;  5CV8 A;  2VUM B;  1F77 A;  1WI5 A;  1I4Q A;  4DV6 L;  4DUZ L;  4HID A;  4QJF A;  2R7D A;  4EX5 A;  2BDN A;  1N32 Q;  3GTP B;  3I72 A;  4LK1 C;  1BNZ A;  2L11 A;  3S1M B;  4JYA Q;  2IWH A;  4X62 Q;  4OO1 H;  4QMG A;  3DM3 A;  1C8C A;  3EBE A;  3H3V I;  1NAP A;  5M3M H;  4DR7 Q;  2D62 A;  3A55 A;  5KYI A;  3A0J A;  1S72 A;  2ID0 A;  4DKA C;  3KF8 A;  4LF6 Q;  2PO4 A;  4C1N K;  4A3M H;  1EU3 A;  2FIN B;  5ELB A;  5KYL A;  1F9R A;  4PNY A;  4DV3 L;  5D3D A;  3K7U C;  1VQ9 A;  4IFD G;  1WTV A;  2MUY A;  4WFN 3;  2VQF L;  1JWM D;  2R61 A;  2KVM A;  3MEF A;  3MXN B;  4L5T A;  4RCN A;  4RHS A;  3VYU A;  4MHE A;  1UUP A;  1JCK B;  2GVB A;  1CHQ D;  2WII B;  1MBY A;  2MFI A;  1N33 L;  2UUC Q;  1Q90 A;  1YEZ A;  1QB5 D;  3D6C A;  1JOK A;  4DR3 Q;  2E2H B;  5KGU A;  5I2Y A;  5HGQ A;  3GTO B;  5E4X A;  4G57 A;  2QEJ C;  3OWE B;  4DAM A;  5JJI A;  4K0K Q;  3E3X A;  4ZAI A;  3VA7 A;  3DWQ A;  4YCV A;  1A8V A;  5C0X I;  3J7A 5;  3GTQ B;  3F2B A;  1CA6 A;  2JP1 A;  1EQV A;  5CV4 A;  2B2T C;  4LF4 L;  1I4H A;  1BCP D;  3NQI A;  4H0L C;  4M8A A;  1SFO B;  2DUD A;  3CXC A;  2MNA A;  1RKN A;  4C1N I;  1TS5 A;  2VW9 A;  3CC7 A;  2IHF A;  1IBL Q;  2JA8 H;  2AWN A;  5IIF A;  1L1O A;  2R93 H;  1EFW A;  4IPG A;  3NEL A;  4XT1 B;  1I5F A;  4OXP A;  1HHV A;  1EY0 A;  1XNR Q;  3Q6S A;  1CQF A;  2F0S A;  4CGY B;  3MFG A;  4JVZ A;  3GTG H;  1SYB A;  3K5O A;  4A3G B;  1PZK D;  4IPH A;  4C2M H;  2ZM6 L;  1PRT C;  1QNK A;  4N9T A;  4LMQ D;  1GHJ A;  1GO3 E;  3WOF A;  1HZA A;  1ROD A;  1F9Q A;  1VQL A;  1SAP A;  2BE5 C;  4B3S L;  2N78 A;  2P5Z X;  4PMC A;  1HRJ A;  1XNQ Q;  3W1G A;  1E2V A;  4QIW B;  1XXG A;  3E9H A;  3E0J A;  4GNX B;  2BH8 A;  2OTL A;  1E1T A;  3J81 j;  4FF1 A;  1G2S A;  2NVY B;  2HHH Q;  5M5W B;  3A74 A;  4JBJ A;  3RN5 A;  2EE1 A;  4BBR B;  4BA1 I;  3HOV H;  2EVB A;  4Y52 H;  3NBH A;  1D6E C;  4ZKB B;  2QDL A;  3ULP A;  1MJE A;  2PMZ B;  2YYZ A;  4IUT A;  1M4V A;  2KCM A;  4KY5 A;  3TDQ A;  2WB1 G;  3VYR A;  4I65 A;  3MFY A;  4B3T Q;  3M3Y H;  2PZT A;  5JEA J;  1HUM A;  1GM5 A;  1EIH A;  4A3E B;  3KLW A;  1W6J A;  1WTR A;  4QB4 A;  1H9S B;  3U9S A;  1DCZ A;  1BCP B;  2Z0S A;  2JA5 H;  2R92 G;  2ZXP A;  5HUR A;  2J4X A;  4F8M A;  5C0X J;  1EYG A;  3PIO 3;  2I07 B;  1XMQ Q;  5JJL A;  1E22 A;  1HXY D;  1Q46 A;  3CPW A;  4KD3 A;  3P1H A;  3SE0 A;  2Z4I A;  3AYH B;  5C3X A;  2O5J C;  1JR0 D;  3PO2 H;  4R4T A;  4KI0 A;  5GAH C;  3VR6 A;  1O7Z A;  4IZ8 A;  2NZH A;  1TWH H;  2AQ2 B;  3H6M A;  1AZP A;  5IP9 H;  3KJP A;  2M9V A;  3RZD H;  1STG A;  3H3V H;  2VY3 A;  2UUB L;  4K5W A;  3M4P A;  2OWO A;  1PZJ D;  3D3R A;  1MJC A;  2OF1 A;  2YTV A;  2RDH A;  3QOJ A;  2NTT A;  4GKK Q;  4KK7 A;  1VQB A;  5TSS A;  4BY7 G;  1AH9 A;  5C4Z A;  3GTL B;  1AEX A;  2EQS A;  1LLR D;  1QWY A;  1PH9 A;  4XIG S;  4XYO A;  5G3L F;  1Y8N B;  1HUN A;  3S16 H;  1VQK A;  1RD9 D;  1DYQ A;  4G7O C;  1IYV A;  1ET6 A;  1HNX L;  3HKZ E;  3AQQ A;  4GS3 A;  1H9J A;  2SDF A;  3K8A A;  4JG2 A;  5JEA H;  4XDX A;  5LMU L;  3LWE A;  1KAA A;  1NR4 A;  3E5S A;  1BDO A;  2RDF A;  3D4R A;  5IYB G;  1YNJ D;  1II3 A;  1DOL A;  4K5X A;  2K5D A;  4LNQ A;  5C0X H;  1RJT A;  3IL8 A;  4NDX A;  4OEM B;  5FO7 B;  2BA1 A;  1QVF A;  2GN5 A;  2D0P A;  4DGZ A;  2JA6 B;  1XPU A;  3IAY A;  4A3I G;  3PO3 H;  3PGZ A;  4LF8 Q;  3HOU H;  1WTH A;  2QGQ A;  2SOB A;  1UE7 A;  3TQY A;  2EY1 A;  4PQX A;  5IY0 A;  2ICE C;  3HOW B;  5EAY A;  1PH7 A;  4LUZ A;  2I46 A;  4TRD A;  3I8Z A;  2F0F A;  1A3U A;  4Q0F A;  1DOM A;  4GOP A;  1V1Q A;  2MGS A;  4HSP A;  4JI6 Q;  1VQG A;  1AZQ A;  4YCW A;  4QF4 A;  3HEJ A;  3TZU A;  4L5R C;  2CKZ B;  5I4D A;  2FXQ A;  2F0E A;  1EYC A;  3KF6 A;  1EZ8 A;  2XRS D;  2IY5 B;  2PCF B;  2F4V Q;  1OXV A;  5I6Y A;  3I4N H;  3D0F A;  5DM7 3;  4IJL A;  4BWG B;  1SJH D;  2YTY A;  1ENC A;  4WJW A;  3HGB A;  5JJK A;  1ASY A;  4DU9 A;  5FLX c;  1A6X A;  2PW7 A;  1TS2 A;  2NN6 G;  4R1J A;  2RSO A;  3M4O B;  1TWC B;  5M3M B;  1IW7 D;  4H44 C;  1JT8 A;  4A3F G;  3M9B A;  1M8A A;  3J7A F;  3I70 A;  4JOI A;  3PMF A;  4QY7 A;  4X3S A;  4HED A;  5GAG C;  1XMO L;  5D14 A;  1VQ5 A;  1U4R A;  1NUC A;  4OX9 L;  4IUQ A;  1JB3 A;  3I73 A;  3W5O A;  1JWU D;  1OTC A;  3PF4 A;  1C4Q A;  2RHQ B;  3DEO A;  3Q24 A;  1HQR D;  2DJF C;  1VDZ A;  2VZA A;  3ERS X;  1TS4 A;  4KTA A;  3I4M H;  3S1R H;  3A5Z B;  4DV2 L;  4A76 A;  5FLM G;  1S5D D;  2HIV A;  1U4P A;  3WOE A;  3GTM H;  2B63 H;  2F3W A;  2WAC A;  3A5U A;  4A3J B;  1CZW A;  1QVC A;  4K8J A;  1ILP A;  2EYF A;  4X65 L;  2RF4 A;  1OXS C;  4XYQ A;  1E1O A;  4JV5 Q;  1PRT F;  4FP5 D;  2AMC B;  5CV5 A;  3SEB A;  4C3I B;  1YBY A;  5BR8 Q;  1LT4 D;  2UU9 Q;  4BBS H;  3FP9 A;  2NBF A;  4IFD I;  4R8N A;  4K5V A;  3NQT A;  2BOS A;  4LF9 Q;  1CUK A;  1I94 Q;  2K7V A;  4C56 C;  4DNI A;  3HG9 A;  4DF7 A;  1HR0 W;  3H3V C;  1X9N A;  5C6A A;  3OMC A;  4A93 G;  1Z6H A;  4F87 A;  1VQ4 A;  3GTG B;  5I9P A;  4UAI A;  4DPG A;  1HR0 Q;  4A3D H;  3OTO Q;  4EQO A;  4LFC Q;  1R9T H;  1RDP D;  2ATW A;  3F8T A;  4C2M B;  5IP7 G;  4GOP B;  5C44 H;  1H9K A;  1HNZ L;  2NVQ H;  3NTK A;  1CKM A;  5EPK A;  1GHK A;  3VDY A;  4FXK C;  4DAY B;  3IRB A;  4UP8 A;  1VQ6 A;  1NJI C;  1PH6 A;  4A3K B;  3NHH A;  3KBX A;  3S2H H;  3HP3 A;  3I91 A;  1SSO A;  4GN4 B;  5K36 G;  3T1Y Q;  3UDF A;  1JC7 A;  1EFI D;  4DUY Q;  4MZ9 A;  4NKL A;  3G6J B;  1SNC A;  1F9S A;  3OMG A;  3CCV A;  1CSQ A;  4DV0 L;  2F0M A;  4IPC A;  4JPB W;  5IOD A;  4DAP A;  1EY9 A;  3HOX G;  2M2L A;  1LT3 D;  1YNN D;  5DEH A;  5EPJ A;  4KV6 A;  1PYB A;  3HOV B;  3BVG A;  1B8A A;  2Y0S G;  4JI1 Q;  4DV4 Q;  4ME5 A;  3NWT A;  4A4I A;  3CW2 C;  1PFM A;  2VB3 X;  4P74 A;  1A3T A;  4AQY Q;  5EJW A;  3M3Y B;  2FHT A;  5KNC A;  3PIO A;  4A3L G;  3WDN A;  2PI2 E;  2N49 A;  3JC6 6;  4C3H G;  4H7B A;  1EY5 A;  1QCB D;  4CKE A;  2RDG A;  3T4A C;  2X69 A;  3I2Z A;  1NTG A;  5CV9 A;  3NTH A;  1STE A;  1TWG B;  2I5L X;  4DK1 A;  4ZRZ A;  4JI7 Q;  1VMC A;  3H91 A;  1UE5 A;  2OEO A;  4BY1 G;  1PDQ A;  2A6E D;  4LFB L;  4YWL A;  1O78 A;  1YZ6 A;  1X56 A;  3OOC A;  4PMW A;  2ALY B;  2EYP A;  1V1O A;  1TQO A;  3S2D B;  3DMU A;  1Q82 C;  1EWH A;  5J22 A;  5M3F H;  1Y1V H;  2NYZ D;  1KRT A;  1UE1 A;  3NE5 B;  3TRZ A;  1JE5 A;  2OQK A;  2D5D A;  3RMH A;  1XPO A;  4FYD A;  1Q8K A;  3CCM A;  3HOZ H;  5E3F A;  3OYY A;  5IYD G;  1HPC A;  4A3C H;  4K2K A;  2VUM G;  2AHO B;  3F2C A;  1TWF B;  2F0T A;  1G51 A;  1SYC A;  1PH8 A;  1BKB A;  3FKI H;  5JOB A;  2JSO A;  2Z8L A;  3R8B A;  4KY7 A;  4X64 L;  2EYO A;  3GD7 A;  4JK1 C;  3G6E A;  1TY2 A;  3S16 B;  4AYB E;  5GQO A;  3NEM A;  2UXC Q;  1VS0 A;  4GKJ L;  4B3R Q;  4CJ2 C;  1A2U A;  2R3Z A;  2B2U C;  3KUP A;  1DOK A;  1SNQ A;  4CDC C;  4CDF C;  4M1U B;  3J7Y W;  4X6A H;  4JI2 Q;  4EQP A;  3KDF B;  1YI2 A;  3BU2 A;  4YHH Q;  1ICF B;  4L5Q A;  4KHP L;  4DV1 L;  1N36 L;  2MO1 A;  3RZO H;  4NP5 A;  2C5C A;  2EPB A;  3HOU B;  2A74 C;  1DM0 B;  4RA8 A;  5E7N A;  4ABN A;  2QKI C;  1K83 H;  1ESF A;  5IT9 L;  1Q7Y C;  5KND A;  4IFD H;  1G91 A;  4OEL B;  1Y8O B;  4KHV A;  1KLG D;  2B2Y A;  2XTI A;  3G4S A;  3M4Q A;  1B9M A;  1BBW A;  3GTJ H;  1WTW A;  2ZJR A;  5C4J H;  1IZ6 A;  1SBB B;  4ZKC B;  2R7Z B;  3S1Q H;  4RKB A;  1VQH A;  2KEN A;  5IGF A;  2SEB D;  3NTI A;  2WAQ E;  3G48 A;  3C46 A;  1RTO A;  4JI0 Q;  2K14 A;  1KRS A;  1EL0 A;  3RD4 A;  4DNT B;  1ICW A;  1LYL A;  4KJO A;  4HIM A;  3ITP A;  3D8G A;  5EBC A;  4DK6 C;  1S5B D;  5CV7 A;  4J15 A;  1WCM B;  4DV7 Q;  1STA A;  2B2V A;  4JI4 Q;  3T1H L;  1FJG L;  4X66 L;  4B9X A;  2IX1 A;  4QGU A;  4A3G G;  2MO0 A;  5C5M A;  4DA2 A;  4LF7 Q;  1KLU D;  2I0Q A;  1LTB D;  4RCO A;  4MTK A;  1VQ7 A;  5GRO A;  4HIO A;  1JOR A;  5JAV A;  2VQE L;  3S24 A;  1NCV A;  2EJG C;  4HJA A;  2FMC A;  2EIF A;  1SYE A;  4IUV A;  3TP6 A;  2KOL A;  4HSV A;  4UY8 C;  5AJ3 Q;  4IPD A;  4MIU A;  4LJZ C;  1CA5 A;  5G3L D;  1LTL A;  4DXF A;  2A6H D;  4ZUJ A;  2VS1 A;  1J5E L;  3CC4 A;  1GD7 A;  4L8J A;  2J0T D;  4RGN A;  3S1R B;  1PTO C;  2MPM A;  4BBR G;  1SLJ A;  3OPO A;  4LF5 Q;  4DR6 L;  2FJ2 A;  5E1F A;  5EKL A;  3T16 A;  3GTM B;  1YJ9 A;  4DV6 Q;  3STB D;  1V8Q A;  1PH4 A;  1V9P A;  4GNX A;  4UP7 A;  1S5E D;  4F88 A;  1HCZ A;  1ZXT A;  2M00 A;  3QJY A;  1J6Q A;  5IGC A;  2F0H A;  1Q12 A;  4UHV A;  3CCJ A;  4EVO A;  1I3Q B;  4TKO B;  2C35 B;  5M5Y H;  4FNF A;  4IJH A;  4A3E G;  2K52 A;  2JQO A;  3CKI B;  3C2P A;  1XPR A;  1XWE A;  1WD1 A;  1QOH A;  2B39 A;  2Q2H A;  4CBV A;  1N32 L;  4GN3 B;  3H09 A;  4UP9 A;  2CCZ A;  3VR3 A;  2WKC A;  4A3D B;  4GZY C;  1DON A;  2XGT A;  2LXK A;  4JYA L;  1TVX A;  4I7Z C;  2A73 B;  3J80 c;  2NVQ B;  4X62 L;  1H9S A;  3IFT A;  1EIY B;  3EJI A;  5EKK A;  2JXM B;  1N33 Q;  5M9O A;  3Q8D A;  1DJR D;  1YHQ A;  1SXT A;  4IUP A;  5DNF A;  2B3G A;  1TXY A;  1PH1 A;  2Q8R E;  2OCE A;  3S2H B;  4C3J H;  1GJX A;  4HTH A;  3QWN A;  1H9R A;  2A8V A;  2QDB A;  1VQP A;  1C9O A;  1LTA D;  4Y7N H;  3TEH B;  2RKS A;  1LAC A;  1U0L A;  5BN5 A;  1Z47 A;  4KKS A;  3I55 A;  2BA0 A;  5D3I B;  4AIM A;  4LF4 Q;  3S1N H;  5CMD A;  3RUZ A;  3FVQ A;  3DWP A;  2UUC L;  3KK7 A;  3T56 B;  1YJW A;  2F0W A;  1CI3 M;  1WYD A;  4HIK A;  3UDG A;  1W2B A;  3I90 A;  3ZYY X;  3BZK A;  2KJX A;  1KNE A;  4R4I A;  3CCE A;  4X3U A;  5M5X H;  3GP7 A;  1J8I A;  4R4Q A;  4P71 A;  1ZYR C;  4K14 A;  1SR3 A;  3T51 B;  2PNR C;  1E2Z A;  2ZJQ A;  3H15 A;  1YHB A;  1CKN B;  1YNX A;  2ZM6 Q;  3JAM c;  2EY2 A;  2JA7 B;  2Q8I B;  2FMM A;  2JA6 G;  2PZW A;  3OIP A;  1IBM L;  1X3P A;  3MHB A;  1BF4 A;  2ICI A;  1XNR L;  3H0G B;  3UE1 A;  5H1S E;  1FVI A;  1L1O C;  3HOW G;  1PRT D;  1B2T A;  1KTK A;  2XN9 C;  3BZC A;  1CTM A;  5DAU A;  1B53 A;  2BE5 D;  3GV3 A;  1LM0 A;  4UDU C;  4A3I H;  2BCO A;  1AE2 A;  4K2L A;  1S5C D;  5KIX A;  3S9W A;  1KNA A;  4OIJ A;  3URY A;  1IBK Q;  3U58 A;  3CC2 A;  2F0D A;  3HOZ B;  1XNQ L;  3EVQ A;  1X3G A;  1EY4 A;  1TY0 A;  4N8X 1;  3D4D A;  4DR5 L;  1I6H H;  1FGB D;  5LL6 X;  4YY3 L;  3CRK C;  3I4O A;  4FO2 A;  3W2D A;  5GAD C;  2K5V A;  3DWA A;  4LW1 A;  5C5L A;  3SDZ A;  5ELF A;  2K33 A;  2G5D A;  3OWF A;  2HQE A;  2Z6K A;  3Q23 A;  4P73 A;  4OO1 G;  2SNS A;  5M3M G;  2K4K A;  1CFM A;  1MD2 D;  1JJG A;  3K0X A;  1VQE A;  2IX3 A;  2NTS A;  2DNC A;  2C9O A;  4PZ6 A;  4FVM A;  2Q8T A;  1B3A A;  4BXX H;  1PYS B;  1G8Z D;  2ZT9 C;  1K0R A;  4NW2 A;  4RWS C;  2KBN A;  1EU4 A;  2OQ0 A;  1K28 A;  2RCN A;  1CT1 D;  3SGI A;  4DV5 L;  3RZO B;  2L1B A;  5C3W A;  4NXN L;  2CHB D;  4A3F H;  4OL7 A;  3U4V A;  2L0C A;  5IWA L;  1HA5 A;  3K6O A;  1IL8 A;  3PV0 A;  1BR9 A;  1U9R A;  5C3E H;  2UUB Q;  1I50 B;  4YIJ A;  3GTJ B;  1EOV A;  4A3J G;  3VR4 A;  2EYJ A;  3GTK B;  5C4J B;  3RLO A;  3CQZ H;  1PV4 A;  1K3R A;  1LTG D;  2F0J A;  2RBM A;  3CCQ A;  2HT1 A;  1PRT B;  4KD4 A;  5COY A;  4C3I G;  1L0Y B;  1EWI A;  1SNM A;  3MXP A;  3TP7 A;  1HNX Q;  3K5N A;  2E2I B;  1Q81 C;  1RF2 D;  3ULJ A;  2L5T A;  3IKJ A;  1KAW A;  1TWA H;  3ONA B;  5I9O A;  5LMU Q;  1WTP A;  3AEV A;  3HKZ B;  2MP1 A;  3M7G A;  2L12 A;  4JBM A;  5A2Q E;  1PTO F;  2NVX B;  4YWM A;  3X3N A;  2ZTD A;  1F9P A;  1Q8I A;  3HFZ B;  4DR2 Q;  1JQY D;  2E8G A;  1LT6 D;  2XSC A;  3NXW A;  4GN5 A;  3V05 A;  4PG3 A;  4A3K G;  3TRE A;  5COR A;  4A93 H;  5FO8 B;  2KEE A;  4HJ5 A;  3S15 H;  3HOY H;  4WJ3 M;  4FXD A;  1N9W A;  1KIX A;  3ERQ A;  2CW0 C;  3R2T A;  3TP5 A;  1IL2 A;  1DD2 A;  3CCR A;  3J7A V;  1HZB A;  4DAY A;  5FKA C;  1K73 C;  1HNW Q;  1SMY C;  3BYT B;  3QB3 A;  1QVG A;  1B44 D;  4LWC A;  3QG1 A;  1WTQ A;  3HOV G;  5JVH 3;  2DY8 A;  1E3P A;  2KCN A;  3FHW A;  2QIL A;  3MC0 B;  3RLN A;  2E75 C;  4GOP C;  3SXH A;  4KKU A;  3PUV A;  1D1K A;  1E24 A;  2AWO A;  2F4V L;  2QCP X;  4HJ9 A;  3NP8 A;  1SE3 A;  1XTC D;  2IL8 A;  2JYO A;  2R6G A;  2WB1 E;  3A8I E;  4A3M B;  4HR7 B;  1WTO A;  1XMO Q;  2OXP A;  1V1P A;  2XRQ D;  4L63 B;  5IYC G;  1IKM A;  3BDL A;  3W1B A;  1LUZ A;  4U68 A;  4OX9 Q;  5IGE A;  4JBK A;  3VYT A;  1UNS A;  1SNO A;  2E2J H;  2LS0 1;  2YTX A;  1STH A;  3I4L A;  4ID6 A;  3AFQ A;  1F2Z A;  1T5E A;  1HFG A;  3PF5 A;  5IP9 G;  3L0O A;  4C3J B;  3CCL A;  2RQX A;  4DV2 Q;  2VL6 A;  3GO5 A;  5ELD A;  3J80 E;  4BY1 H;  1WVL A;  5CBA E;  2K75 A;  4JOI C;  4X65 Q;  4DFA A;  2ES2 A;  1D2B A;  2EY6 A;  5F2D A;  3QO2 A;  1VQM A;  4POF A;  2TSS A;  2VB2 X;  3S14 H;  1UEA B;  2KCC A;  1VQD A;  3CPF A;  2JA8 B;  3ULL A;  2K5N A;  1Y1W G;  2R93 B;  1YVC A;  4CDE C;  5C4X H;  4L5S A;  1CM9 A;  1O7Y A;  4IO9 A;  5IYD H;  1KHI A;  3U50 C;  2VUM H;  5JEA G;  1Z9F A;  2J7Z A;  3NK9 A; 
#chains in the Genus database with same CATH homology
 1Y8P B;  1AP0 A;  1CQV A;  4PV1 C;  5C0X G;  2IX0 A;  1D5M C;  1JWS D;  3ND9 A;  2KQ3 A;  1QIL A;  3DXJ C;  5CC4 A;  4OGQ C;  5JPM C;  4CKB A;  3JAM E;  1F2Y A;  5BN4 A;  4DN4 M;  2K5Q A;  4V0B A;  4IAL A;  2TMP A;  1TR5 A;  1EY6 A;  1ENF A;  1STY A;  3FEW X;  3A56 A;  2KUM A;  4OHJ A;  3K0Y A;  4EQN A;  4H13 C;  3MXU A;  1V1P B;  4RHR A;  5ELC A;  3BZD B;  1GOZ A;  1E2W A;  2JE6 I;  2JA5 B;  4EGV A;  1PTO H;  2XWB B;  3FRP B;  2RVL A;  2ZXO A;  3BDO A;  2H4O A;  2XVS A;  3PO2 B;  4IFD J;  1TWH B;  5ELE A;  3V2T A;  4OIK A;  1PYW D;  5CYU A;  1OO9 B;  1LTI D;  4RGM A;  4G7H C;  1HA6 A;  3RZD B;  3CRL C;  5C3E B;  3DHQ A;  1JE4 A;  2HDL A;  1BO0 A;  2D2C C;  1AN8 A;  1L0X B;  1O7L A;  1VF5 C;  2B2U A;  1TT2 A;  2KEC A;  3O13 A;  5EPL A;  3BVM A;  1G29 1;  1G2T A;  2IW3 A;  4AYB B;  4HMI A;  4FF2 A;  4O1N A;  1GUT A;  5JJZ A;  5EQ0 A;  2B2W A;  3K5M A;  1XX8 A;  1FR3 A;  3BVZ A;  4B9W A;  3PO3 B;  1NSN S;  5FO9 B;  2EYM A;  4NMZ A;  1R4P B;  2A68 C;  4N9P A;  2K04 A;  2A69 C;  3TME A;  3PUZ A;  3Q0A A;  3VYS A;  3NPP A;  2EJM A;  3LWU A;  4O42 A;  5CBE E;  1Q1B A;  3HOY B;  1FD7 D;  1C48 A;  4P2C B;  1I4P A;  1KDB A;  3BS1 A;  1G6Z A;  3SHL A;  3FPU B;  2DN8 A;  3SK6 A;  4R9W A;  3I4N B;  4IQZ A;  5NUC A;  1GUG A;  2WAQ B;  4L6T B;  1AW7 A;  1X32 A;  2JEA I;  1BQQ T;  1IYU A;  3X3M A;  3TZD A;  2B2Y C;  3L9A X;  3OW7 A;  1I4X A;  1HTP A;  1EZ6 A;  1K8M A;  1MSH A;  2NZ1 D;  5FLX E;  1I4G A;  2VNU D;  3H94 A;  3PUY A;  2KED A;  3AU7 A;  3C1F A;  4DXG A;  2B2V C;  3K57 A;  1IHZ A;  3I4M B;  1LTR D;  4R8I A;  1KAB A;  1BOS A;  2EXZ A;  3PUW A;  2Z1C A;  1EEI D;  3HRZ C;  4BY1 B;  4F7X A;  4QUF A;  1SDF A;  2B63 B;  2HDM A;  3J80 L;  5CR3 A;  3K58 A;  5IOC A;  1SNP A;  2NN6 I;  1PTO D;  3K59 A;  1EYD A;  1ML0 D;  1I6V C;  3L3O C;  3S14 B;  2O5I C;  3PIP 3;  5HGT A;  4BBS B;  1CK1 A;  5C4X B;  4B08 A;  1A2T A;  2KA7 A;  4QCL A;  4MN3 A;  2NWG A;  3DM1 A;  4KMU C;  1EY7 A;  2OT2 A;  1ZEQ X;  1R9T B;  2X6G A;  3C1E A;  5C44 B;  3F2U A;  4XQN A;  3V96 A;  4RGT A;  1MSG A;  3SK8 A;  1KDA A;  1GUN A;  3HS0 C;  2B2T A;  4K6L A;  1F2M A;  5D65 A;  2F0Q A;  3S17 B;  1A3V A;  3JAM L;  1VMP A;  4X3T A;  2K05 A;  1OXX K;  1TS3 A;  1TU2 B;  4IUR A;  3M7N A;  1B9N A;  1E0B A;  1BCP C;  3A8K E;  1MI2 A;  2LKV A;  2IT1 A;  5DM6 3;  2AUJ D;  1LAB A;  1EYA A;  3A7L A;  5ISR A;  1RHP A;  4HAE A;  4ZK9 B;  5EKI A;  4A3B B;  4KJN A;  1PTO B;  3N6R A;  5KNB A;  1JIC A;  3A8J E;  5KEE A;  1ZYR D;  2PZU A;  2K01 A;  3IFD A;  1PXU A;  1HQM C;  1I4R A;  1W6K A;  2EZV A;  2F4I A;  3BDC A;  4XQQ A;  4CKC A;  4DNR B;  1B50 A;  2L4N A;  3BYY B;  1QE6 A;  1JOQ A;  4Q5V A;  5IGG A;  5M3F B;  1Y1V B;  2VXW A;  2XIW A;  4U67 3;  1Y69 U;  2A5H A;  1V43 A;  1FNU A;  4G7Z C;  3MA2 B;  1TII D;  2F0N A;  3FKI B;  1SYD A;  2GA4 B;  3FPP A;  3P75 A;  1B1Z A;  1EWC A;  4RH6 A;  2Z4H A;  4ILW A;  4CJ0 B;  3SVM A;  2F0L A;  1ONL A;  2EDG A;  3MZ5 A;  2WIN B;  5J39 A;  5JVG 3;  2G9H D;  4PMB A;  2N88 A;  2IPK D;  4CJ1 B;  4TSS A;  1CHP D;  2E74 C;  1SND A;  4FF4 A;  3QIA A;  2G9D A;  2NN6 H;  3D6W A;  1LO5 D;  2ENB A;  3KLS X;  3J81 E;  3U9O A;  3VR2 A;  1FNV A;  2EOT A;  3ERO A;  1K83 B;  4HCE A;  4C3J G;  1Q3L A;  4RKL A;  3M4Y A;  2K5W A;  1D5X C;  2ZXR A;  1QG7 A;  1EY8 A;  4IN3 A;  3MAQ A;  2AUK A;  2IJ0 A;  3I3C A;  2F03 A;  1ESR A;  3S1Q B;  1WD0 A;  3OIQ A;  1O80 A;  3VA5 A;  2F0V A;  1BBX C;  2PYK A;  2RA4 A;  5AFW A;  1H9M A;  2QF7 A;  2PQE A;  3KLR A;  3GV6 A;  3R93 A;  4CHT B;  2HCI A;  2SNM A;  1YNJ C;  3KLS A;  4KN7 C;  4WRD A;  2XWJ B;  2F0G A;  5FLX L;  1LV9 A;  2NVT B;  2PW5 A;  3HZX A;  4HN7 A;  1R4Q B;  3DUZ A;  4BA2 I;  1Z7T A;  1JOO A;  2F0K A;  3MTS A;  4LAA A;  3A54 A;  5IT9 E;  1LTS D;  2L55 A;  3D31 A;  2WP8 J;  1SE4 A;  3MVV A;  5K36 H;  2CW0 D;  3SR1 A;  3LNN A;  2D9U A;  3P7J A;  3G7L A;  1SMY D;  3TBI B;  1B4O A;  2F0P A;  5EGT A;  2WV6 D;  2F0O A;  1DZ1 A;  5M5Y B;  1HFN A;  1BUV T;  2E2D C;  1ZKO A;  2B8G A;  3FMC A;  4XXE A;  4K6D A;  3VR5 A;  3R2I A;  5IGB A;  3L7Z C;  5I2X A;  1IW7 C;  2WB1 B;  1GXD C;  4RGO S;  4BS9 A;  1GUW A;  3T13 A;  2LFN A;  4ULL A;  2R92 B;  1BCP F;  1D5Z C;  3P20 A;  1SJE D;  2H1E A;  5KRU A;  3FDT A;  1STB A;  2K03 A;  3T53 B;  2O4X A;  2EYH A;  5JPN C;  4Y7N B;  1EEF D;  3AMU A;  3ND8 A;  3S1N B;  4HCS A;  5J1Z A;  2DY7 A;  3TN2 A;  2DNE A;  2N55 A;  3SK4 A;  3GQB A;  2K32 A;  5M5X B;  1EOT A;  1F2L A;  4TQU S;  2E76 C;  5E4W C;  4BY7 B;  1UAP A;  1ENA A;  3OSO A;  4FXG C;  4RFB A;  1PFB A;  2F0I A;  2X6L A;  3PUX A;  4J6H A;  3BG3 A;  5I6W A;  1XYI A;  4J8Q A;  1HTL D;  3UI2 A;  1QNU A;  3TSS A;  3R3O A;  3DEP A;  3AB9 A;  1J9O A;  3MWY W;  4DK0 A;  3Q22 A;  4Z9C B;  2XNA C;  4A3I B;  4G4K A;  2K28 A;  2EJF C;  3EA6 A;  2BDO A;  1I6H B;  1MGS A;  5C4H A;  1YNN C;  4S3S A;  1QJO A;  3CU7 A;  3MEH A;  1FNW A;  3CHB D;  4QUC A;  1PZI D;  1DXM A;  1SEB D;  5LL6 S;  3NSW A;  4KN4 C;  1T5X D;  1FYC A;  2RSN A;  1Q1E A;  1PFN A;  4K8I A;  2NUC A;  1D1I A;  3C3L A;  3K7A B;  1AFP A;  2B8F A;  2WKD A;  3M85 A;  4A3F B;  4KHZ A;  2A6E C;  3J81 L;  2FFK B;  4HMJ A;  2KHS A;  4FF3 A;  1ET9 A;  1ILQ A;  1U4L A;  3MXG A;  3N52 A;  1K8O A;  5BN3 A;  3TP8 A;  3NWS A;  2JEB I;  3CQZ B;  5T1I A;  1U4M A;  4OO1 I;  3RLF A;  1SYG A;  2HUG A;  3W3A A;  1TKW B;  2CQA A;  3SK5 A;  1TWA B;  1VCI A;  5IGD A;  2L9H A;  1RTN A;  1OXT A;  1WTX A;  4KKT A;  4IUN A;  4E6I A;  5K5P A;  2CVR A;  5A2Q L;  4XQJ A;  2YU9 B;  1NR2 A;  2LY7 A;  1EIG A;  2AQ1 B;  3NUC A;  1Y1W B;  2K6A A;  1PMR A;  4V19 0;  3QOL A;  4A93 B;  3A7A B;  2LMC B;  2K1B A;  4XT3 B;  2F0U A;  3S15 B;  1SYF A;  2V4D A;  1LTT D;  1BXT A;  2A68 D;  2B2W C;  4ODG A;  2A69 D;  1OXU A;  4WOR A;  1GUS A;  1IKL A;  2HCC A;  2MJ8 A;  3KBG A;  4RAU C;  3E6Z X;  3EFX D;  2PPB C;  2NB0 A;  2EY5 A;  2O2L D;  3MXN A;  1EQT A;  5CV6 A;  4X3K A;  1S4Z A;  3HOX B;  1A15 A;  1STN A;  5LHY 1;  2Y0S B;  1GUO A;  3LX0 A;  5T1G A;  1CZG A;  4IUU A;  3K5L A;  1RCV D;  3OHX C;  4ZQ3 A;  1VF7 A;  2EYL A;  1SE2 A;  4C3H B;  2MHV A;  2E2J B;  5FK9 C;  1X3Q A;  4DAV A;  4ZLT F;  4ZYS A;  3NBI A;  1LT5 D;  5A35 A;  2A6H C;  1KDC A;  4XTC S;  5CGK A;  1PLF A;  3D4W A;  5FOB B;  2F1M A;  4ZUI A;  1S5F D;  2AQ3 B;  4KY6 A;  4JBW A;  2F3V A;  5EBD A;  3EQL C;  4J1M A;  5CV8 A;  2VUM B;  1F77 A;  1I4Q A;  2BDN A;  3GTP B;  3I72 A;  4LK1 C;  1BNZ A;  2L11 A;  3S1M B;  2IWH A;  4OO1 H;  4QMG A;  1C8C A;  1NAP A;  2D62 A;  3A55 A;  5KYI A;  2ID0 A;  3KF8 A;  2PO4 A;  4C1N K;  1EU3 A;  2FIN B;  5ELB A;  5KYL A;  1F9R A;  4PNY A;  4IFD G;  5D3D A;  1WTV A;  2MUY A;  4WFN 3;  1JWM D;  2R61 A;  2KVM A;  4RCN A;  4RHS A;  3VYU A;  4MHE A;  1UUP A;  1JCK B;  1CHQ D;  2WII B;  1MBY A;  1Q90 A;  1QB5 D;  3D6C A;  1JOK A;  2E2H B;  5KGU A;  5I2Y A;  3GTO B;  5E4X A;  4G57 A;  2QEJ C;  3OWE B;  4ZAI A;  3VA7 A;  3DWQ A;  5C0X I;  3GTQ B;  1CA6 A;  2JP1 A;  1EQV A;  5CV4 A;  2B2T C;  1I4H A;  1BCP D;  3NQI A;  4H0L C;  4M8A A;  1SFO B;  1RKN A;  4C1N I;  1TS5 A;  2AWN A;  5IIF A;  4XT1 B;  1HHV A;  1EY0 A;  3Q6S A;  1CQF A;  2F0S A;  4CGY B;  3MFG A;  1SYB A;  3K5O A;  4A3G B;  1PZK D;  1PRT C;  1QNK A;  4N9T A;  4LMQ D;  1GHJ A;  3WOF A;  1ROD A;  1F9Q A;  1SAP A;  2BE5 C;  4PMC A;  1HRJ A;  1E2V A;  4QIW B;  1XXG A;  3E0J A;  4FF1 A;  1G2S A;  2NVY B;  5M5W B;  2EE1 A;  4BBR B;  4BA1 I;  2EVB A;  3NBH A;  1D6E C;  4ZKB B;  2PMZ B;  2YYZ A;  4IUT A;  1M4V A;  4KY5 A;  3TDQ A;  3VYR A;  4I65 A;  3MFY A;  2PZT A;  5JEA J;  1HUM A;  1EIH A;  4A3E B;  1W6J A;  1WTR A;  4QB4 A;  1H9S B;  3U9S A;  1DCZ A;  1BCP B;  2ZXP A;  5HUR A;  2J4X A;  4F8M A;  5C0X J;  3PIO 3;  2I07 B;  1HXY D;  4KD3 A;  3P1H A;  3SE0 A;  2Z4I A;  5C3X A;  2O5J C;  1JR0 D;  4KI0 A;  3VR6 A;  1O7Z A;  4IZ8 A;  2AQ2 B;  3H6M A;  1AZP A;  2M9V A;  1STG A;  4K5W A;  1PZJ D;  3D3R A;  2OF1 A;  2RDH A;  3QOJ A;  2NTT A;  4KK7 A;  5TSS A;  5C4Z A;  3GTL B;  1AEX A;  1LLR D;  1QWY A;  4XIG S;  4XYO A;  5G3L F;  1Y8N B;  1HUN A;  1RD9 D;  1DYQ A;  4G7O C;  1IYV A;  1ET6 A;  1H9J A;  2SDF A;  5JEA H;  4XDX A;  3LWE A;  1KAA A;  1NR4 A;  3E5S A;  1BDO A;  2RDF A;  3D4R A;  1YNJ D;  1II3 A;  1DOL A;  4K5X A;  2K5D A;  5C0X H;  1RJT A;  3IL8 A;  4NDX A;  5FO7 B;  2BA1 A;  4DGZ A;  2JA6 B;  3IAY A;  2SOB A;  2EY1 A;  4PQX A;  2ICE C;  3HOW B;  2I46 A;  4TRD A;  3I8Z A;  2F0F A;  1A3U A;  4Q0F A;  1DOM A;  2MGS A;  4HSP A;  1AZQ A;  4QF4 A;  3HEJ A;  3TZU A;  5I4D A;  2F0E A;  1EYC A;  1EZ8 A;  2XRS D;  2PCF B;  1OXV A;  5I6Y A;  5DM7 3;  4BWG B;  1SJH D;  1ENC A;  4WJW A;  3HGB A;  4DU9 A;  1A6X A;  2PW7 A;  1TS2 A;  2NN6 G;  2RSO A;  3M4O B;  1TWC B;  5M3M B;  1IW7 D;  4H44 C;  1M8A A;  3J7A F;  3I70 A;  3PMF A;  4X3S A;  4HED A;  5D14 A;  1U4R A;  1NUC A;  4IUQ A;  1JB3 A;  3I73 A;  1JWU D;  1C4Q A;  3DEO A;  3Q24 A;  1HQR D;  1VDZ A;  4KTA A;  1TS4 A;  1S5D D;  1U4P A;  3WOE A;  2F3W A;  2WAC A;  4A3J B;  1CZW A;  4K8J A;  1ILP A;  2EYF A;  1OXS C;  4XYQ A;  1PRT F;  4FP5 D;  5CV5 A;  3SEB A;  4C3I B;  1LT4 D;  2NBF A;  4IFD I;  4R8N A;  4K5V A;  3NQT A;  2BOS A;  2K7V A;  4C56 C;  3HG9 A;  4DF7 A;  3H3V C;  5C6A A;  3OMC A;  1Z6H A;  4F87 A;  3GTG B;  5I9P A;  4UAI A;  4EQO A;  1RDP D;  4C2M B;  1H9K A;  3NTK A;  5EPK A;  1GHK A;  4FXK C;  4A3K B;  3NHH A;  3KBX A;  3HP3 A;  3I91 A;  1SSO A;  5K36 G;  1JC7 A;  1EFI D;  4NKL A;  3G6J B;  1SNC A;  1F9S A;  3OMG A;  2F0M A;  5IOD A;  4DAP A;  1EY9 A;  2M2L A;  1LT3 D;  1YNN D;  5DEH A;  5EPJ A;  4KV6 A;  3HOV B;  3BVG A;  4ME5 A;  3NWT A;  1PFM A;  2VB3 X;  1A3T A;  5EJW A;  3M3Y B;  2FHT A;  5KNC A;  3WDN A;  4C3H G;  4H7B A;  1EY5 A;  1QCB D;  4CKE A;  2RDG A;  3T4A C;  2X69 A;  5CV9 A;  3NTH A;  1STE A;  1TWG B;  4DK1 A;  4ZRZ A;  1VMC A;  3H91 A;  2OEO A;  1PDQ A;  2A6E D;  1O78 A;  3OOC A;  4PMW A;  2EYP A;  1V1O A;  1TQO A;  3S2D B;  3DMU A;  1EWH A;  5J22 A;  2NYZ D;  3NE5 B;  2D5D A;  3RMH A;  4FYD A;  5E3F A;  1HPC A;  4K2K A;  1TWF B;  2F0T A;  1SYC A;  5JOB A;  2JSO A;  2Z8L A;  3R8B A;  4KY7 A;  2EYO A;  3GD7 A;  4JK1 C;  1TY2 A;  3S16 B;  4CJ2 C;  1A2U A;  2R3Z A;  2B2U C;  3KUP A;  1DOK A;  1SNQ A;  4M1U B;  3J7Y W;  4EQP A;  4NP5 A;  2C5C A;  2EPB A;  3HOU B;  2A74 C;  1DM0 B;  4RA8 A;  4ABN A;  2QKI C;  1ESF A;  5IT9 L;  5KND A;  4IFD H;  1G91 A;  1Y8O B;  4KHV A;  1KLG D;  2B2Y A;  1B9M A;  1WTW A;  1SBB B;  4ZKC B;  2R7Z B;  4RKB A;  5IGF A;  2SEB D;  3NTI A;  3C46 A;  1RTO A;  1EL0 A;  3RD4 A;  4DNT B;  1ICW A;  4KJO A;  3ITP A;  3D8G A;  5EBC A;  1S5B D;  5CV7 A;  1WCM B;  1STA A;  2B2V A;  4B9X A;  2IX1 A;  5C5M A;  4DA2 A;  1KLU D;  1LTB D;  4RCO A;  1JOR A;  5JAV A;  1NCV A;  2EJG C;  2FMC A;  1SYE A;  4IUV A;  3TP6 A;  2KOL A;  4HSV A;  4MIU A;  4LJZ C;  1CA5 A;  5G3L D;  4DXF A;  2A6H D;  4ZUJ A;  4L8J A;  2J0T D;  4RGN A;  3S1R B;  1PTO C;  2MPM A;  3OPO A;  2FJ2 A;  5E1F A;  5EKL A;  3T16 A;  3GTM B;  1V8Q A;  4F88 A;  1S5E D;  1HCZ A;  1ZXT A;  2M00 A;  3QJY A;  5IGC A;  2F0H A;  1Q12 A;  4EVO A;  1I3Q B;  4TKO B;  4FNF A;  3CKI B;  3C2P A;  1XWE A;  1WD1 A;  1QOH A;  2B39 A;  4CBV A;  3H09 A;  3VR3 A;  2WKC A;  4A3D B;  4GZY C;  1DON A;  1TVX A;  4I7Z C;  2A73 B;  2NVQ B;  1H9S A;  3IFT A;  3EJI A;  5EKK A;  2JXM B;  5M9O A;  1DJR D;  1SXT A;  4IUP A;  5DNF A;  2Q8R E;  3S2H B;  1GJX A;  4HTH A;  3QWN A;  1H9R A;  2QDB A;  1LTA D;  2RKS A;  1LAC A;  5BN5 A;  1Z47 A;  4KKS A;  2BA0 A;  5D3I B;  5CMD A;  3RUZ A;  3FVQ A;  3DWP A;  3KK7 A;  3T56 B;  2F0W A;  1CI3 M;  3I90 A;  3ZYY X;  2KJX A;  1KNE A;  4X3U A;  3GP7 A;  1J8I A;  1ZYR C;  4K14 A;  3T51 B;  2PNR C;  1E2Z A;  2JA7 B;  2EY2 A;  2Q8I B;  2FMM A;  2PZW A;  3OIP A;  1X3P A;  3MHB A;  1BF4 A;  2ICI A;  3H0G B;  1PRT D;  1B2T A;  1KTK A;  2XN9 C;  1CTM A;  5DAU A;  1B53 A;  2BE5 D;  3GV3 A;  4UDU C;  2BCO A;  4K2L A;  1S5C D;  5KIX A;  3S9W A;  1KNA A;  4OIJ A;  3URY A;  2F0D A;  3HOZ B;  3EVQ A;  1EY4 A;  1TY0 A;  3D4D A;  1FGB D;  5LL6 X;  3CRK C;  4FO2 A;  3W2D A;  3DWA A;  5C5L A;  3SDZ A;  5ELF A;  2K33 A;  3OWF A;  2HQE A;  3Q23 A;  4OO1 G;  2SNS A;  1CFM A;  1MD2 D;  2IX3 A;  2NTS A;  2DNC A;  2C9O A;  4FVM A;  2Q8T A;  1B3A A;  1G8Z D;  2ZT9 C;  4NW2 A;  4RWS C;  1EU4 A;  1CT1 D;  3RZO B;  2L1B A;  5C3W A;  2CHB D;  4OL7 A;  2L0C A;  1HA5 A;  3K6O A;  1IL8 A;  3PV0 A;  1BR9 A;  1U9R A;  1I50 B;  4YIJ A;  3GTJ B;  3VR4 A;  2EYJ A;  3GTK B;  5C4J B;  1LTG D;  2F0J A;  2RBM A;  1PRT B;  4KD4 A;  5COY A;  4C3I G;  1L0Y B;  1SNM A;  3MXP A;  3TP7 A;  3K5N A;  2E2I B;  1RF2 D;  2L5T A;  3IKJ A;  3ONA B;  5I9O A;  1WTP A;  3HKZ B;  2MP1 A;  3M7G A;  2L12 A;  5A2Q E;  1PTO F;  2NVX B;  3X3N A;  1F9P A;  1Q8I A;  1JQY D;  1LT6 D;  2XSC A;  3NXW A;  3V05 A;  5COR A;  5FO8 B;  2KEE A;  4FXD A;  3ERQ A;  2CW0 C;  3R2T A;  3TP5 A;  1DD2 A;  3J7A V;  4DAY A;  5FKA C;  1SMY C;  3BYT B;  3QB3 A;  1B44 D;  3QG1 A;  1WTQ A;  5JVH 3;  2DY8 A;  2KCN A;  2QIL A;  3MC0 B;  2E75 C;  3SXH A;  4KKU A;  3PUV A;  1D1K A;  2AWO A;  2QCP X;  3NP8 A;  1SE3 A;  1XTC D;  2IL8 A;  2JYO A;  2R6G A;  3A8I E;  4A3M B;  4HR7 B;  1WTO A;  2OXP A;  1V1P A;  2XRQ D;  4L63 B;  1IKM A;  3BDL A;  4U68 A;  5IGE A;  3VYT A;  1UNS A;  1SNO A;  2LS0 1;  1STH A;  3I4L A;  4ID6 A;  1F2Z A;  1T5E A;  1HFG A;  4C3J B;  2RQX A;  3GO5 A;  5ELD A;  3J80 E;  1WVL A;  5CBA E;  4DFA A;  1D2B A;  2EY6 A;  5F2D A;  3QO2 A;  2TSS A;  2VB2 X;  1UEA B;  2KCC A;  2JA8 B;  2R93 B;  1CM9 A;  1O7Y A;  5JEA G;  2J7Z A;  3NK9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...