1H9JA

Two crystal structures of the cytoplasmic molybdate-binding protein modg suggest a novel cooperative binding mechanism and provide insights into ligand-binding specificity. phosphate-grown form with molybdate and phosphate bound
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
145
structure length
145
Chain Sequence
GSHMKISARNVFKGTVSALKEGAVNAEVDILLGGGDKLAAVVTLESARSLQLAAGKEVVAVVKAPWVLLMTDSSGYRLSARNILTGTVKTIETGAVNAEVTLALQGGTEITSMVTKEAVAELGLKPGASASAVIKASNVILGVPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two Crystal Structures of the Cytoplasmic Molybdate-Binding Protein Modg Suggest a Novel Cooperative Binding Mechanism and Provide Insights Into Ligand-Binding Specificity
pubmed doi rcsb
source organism Azotobacter vinelandii
molecule tags Binding protein
molecule keywords MOLYBDENUM-BINDING-PROTEIN
total genus 27
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2001-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03459 TOBE TOBE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1h9jA02
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1h9jA01
2DNCA 3CRKC 4BA2I 3A8JE 1Q1EA 2JXMB 1Y8NB 1CTMA 3A7LA 1Y8PB 3LWUA 4GZYC 1Y69U 1GHJA 2D2CC 1Q90A 1O7LA 3QG1A 4LK1C 4IFDH 1G291 1LACA 1VF5C 3M4YA 3A8IE 4BA1I 2F1MA 2A68C 2BE5C 2KCCA 3OPOA 5C0XH 1ONLA 2BA1A 3QJYA 3FMCA 3M85A 4XIGS 1E2VA 1OXSC 2A69C 3L7ZC 2KA7A 2K7VA 4DK0A 3ND9A 4L8JA 2JEAI 1T5EA 2D5DA 4KKUA 1V8QA 1GUSA 1H9JA 3HGBA 3VR2A 5BN4A 4KMUC 1TU2B 1H9SA 3D31A 1H9SB 2PCFB 3VR6A 4G7HC 4IFDG 3ND8A 4KN7C 4OGQC 3AB9A 2IT1A 4JK1C 1GJXA 1IYUA 2O5IC 1VDZA 2L5TA 2O5JC 1H9MA 1PMRA 1QJOA 1Y8OB 4RCNA 1YNJC 5KNBA 5BN3A 4G7ZC 2A69D 1E2ZA 1HQMC 2R6GA 1V43A 1B9NA 3TZUA 5JEAH 1H9RA 1HCZA 1DXMA 1HPCA 5JEAG 1LABA 3OW7A 1ZYRC 2NN6G 3GQBA 5KNCA 3W3AA 2K33A 2A6ED 3A7AB 3NE5B 3VR5A 3M7NA 2Q8IB 4XTCS 4DNTB 1Q1BA 1ZKOA 1VF7A 3I4LA 3EQLC 2JEBI 2EDGA 2A6HC 4LJZC 5KNDA 4H13C 2A68D 2BE5D 3SDZA 4HR7B 4H44C 1OXUA 2BDOA 2E76C 1GHKA 3DXJC 1OXTA 3VR4A 1O78A 2CW0C 1EWHA 2D62A 1K8OA 3MXUA 2BA0A 4KI0A 3PUVA 3PUXA 3H94A 1DCZA 2NN6H 3KLRA 3BG3A 1GUOA 4I7ZC 4PV1C 2B8FA 4TKOB 1BDOA 1Z6HA 2A6EC 3I73A 1HTPA 3MFYA 2EJMA 3FPPA 2AWOA 2EJFC 3I72A 2AUJD 1B9MA 1OXXK 4JBWA 3SE0A 3U9SA 1FYCA 1OXVA 2E74C 1IYVA 4KN4C 1E2WA 3IFTA 2JE6I 1A6XA 3D4RA 3LNNA 4DK1A 3PUWA 1GUNA 5A35A 1Q12A 2EVBA 3PUZA 2E75C 4KHZA 3VA7A 4IQZA 4OO1H 5K36G 3WDNA 1VCIA 3T56B 3T53B 2B8GA 3QIAA 4OO1G 2PPBC 1CI3M 1H9KA 3N6RA 3CRLC 2NN6I 3PUYA 4TQUS 2ZT9C 4G7OC 2PNRC 4KKTA 3A8KE 3OOCA 1GUGA 2QF7A 4H0LC 5BN5A 1K8MA 3IKJA 2A6HD 1YNNC 2AUKA 3GD7A 1TKWB 3P20A 1IW7C 1I6VC 1DD2A 1SMYC 2K32A 1IW7D 2V4DA 3BDOA 3RLFA 3VR3A 4DNRB 4KKSA 3T51B 5C0XG 3PV0A 1CFMA 2EJGC 2DNEA 2DN8A 1GUTA 5K36H 1Z7TA 2YYZA 1FR3A 2LMCB
chains in the Genus database with same CATH superfamily
4IN3A 4RH6A 1CTMA 4OX9Q 3KLSA 1G51A 1UEBA 4N8X1 2HUGA 1J9OA 2CH4W 1MHWC 3D3RA 3JC66 1YNND 3M4YA 4IPGA 4BA1I 2BE5C 3L3OC 2DJGC 2CHBD 4ZUJA 3J7A5 1X3GA 1K83B 2FJ2A 1OXSC 4LUOA 4QUCA 2GN5A 3C3LA 3FVQA 3HOUB 2D5DA 4GS3A 4KKUA 2E2HB 3HGBA 1C8CA 1SFOH 1ZXTA 3OMGA 1IBMQ 2B63B 4GKKL 3GTKH 2KEDA 4IFDG 2IT1A 4ZCKA 2O5IC 2R7ZH 5FO7B 4GKJQ 3PO2H 1I4XA 1EZ6A 1G8ZD 4A76A 3K5MA 5J39A 4BBRH 1H9RA 1DXMA 1S4ZA 1PTOF 1GD7A 4A3LH 4LF4L 3W3AA 5C5LA 4B3RL 1Y1VH 1Q1BA 1LTTD 4FP5D 1PLFA 1DOKA 1I4QA 4ZQ3A 4H13C 2UUBQ 1STGA 1I4HA 3VYTA 5I9PA 2ZXRA 4APVA 3GTGB 1K73C 4KI0A 2B3GA 4XT1B 5AJ3L 1GUOA 4ID6A 1C7YA 2B8FA 3RN5A 4BY1B 3DWAA 1ASZA 1PH8A 1B9MA 4H02A 4LF5L 3LGJA 4BXXG 1X3QA 3E0JA 4DV2L 1D1IA 3K59A 3SR1A 1VQ9A 1WCMG 2B2TA 1SJHD 4IJHA 4JYAL 3FKIG 5CV5A 3CRLC 3PIPA 1SE8A 1KLGD 2VQEQ 2BH2A 1CSQA 1TS2A 4AQYL 4R8NA 2I07B 1C0AA 3NBHA 4DR3L 1ILPA 1PTOD 3DWQA 3I55A 3GD7A 4DXFA 5M3MG 1EFWA 1PH6A 1F9RA 4JI0L 1EIHA 2EY2A 1VQMA 4KKSA 2ATWA 1ENFA 4FXKC 3KLSX 1Z47A 1WCMB 2YU9H 2G5DA 1XNQL 1M90C 5HGTA 1O7ZA 4O2DA 4LK1C 2IWHA 4IPCA 3GO5A 3SK5A 2E2JH 2WFWA 2PI2E 4A3CG 2PW7A 1VQ5A 3W1BA 2R92H 3S2DH 1RODA 3UDGA 3FMCA 2B2YA 1TWGH 2HDMA 3E6ZX 5ISRA 2Q8RE 3K5LA 3WOEA 3DWPA 3NPPA 3H15A 4R4OA 2I0QA 1B44D 2EOTA 3MWYW 3M3YH 2YTVA 1ILQA 3A55A 5C5MA 2QEXA 4C1NI 4HJ9A 1BXTA 1FVIA 2JA9A 2P5ZX 1IYUA 1A3VA 5T1IA 2K5DA 5KNBA 4X64L 1WVLA 2PZTA 1N8RC 1K28A 2L1BA 3KK7A 1EOVA 1SMYD 3GTPB 4ZK9B 4GN5A 1V1OA 4GOPA 4GOPC 4BBSB 4K2LA 1VQ4A 2Q8TA 1EOTA 2A6ED 3NE5B 2R7ZB 4ZUIA 5M5YB 1W2BA 4C1NK 4DV0Q 4K5XA 1SBBB 4U673 2A68D 2X69A 2J7ZA 3H6MA 3HOUH 1HH2P 4JI4L 2F0SA 2OT2A 2VUMG 3PUVA 5D3DA 3CCRA 1SJED 3CC4A 3QB3A 2MP1A 4A3MB 1V9PA 3EIVA 3NEMA 3ZYYX 5CV8A 1BDOA 4A3GB 5IT9L 4DR1L 1HR0L 3TREA 4A3JG 3HOVB 3A5UA 3RZDB 3GTQB 5IGGA 1NMGA 5CV4A 1HUNA 3LNNA 4KHPQ 2VQFQ 2XRSD 3CU7A 5A35A 4NPSA 3H09A 1KTKA 3NSWA 4NDXA 1V1QA 1EQQA 4HEDA 3QIAA 5HGQA 4A3GG 3N6RA 4TQUS 2NN6I 1V1PB 4KKTA 4IZ8A 1X55A 3A8KE 2EY5A 3I70A 1HJPA 3GTLH 5CBEE 1CKNA 4NMZA 1I6VC 5C4XG 2F0OA 1JT8A 5IP7G 1EYCA 5JPNC 3T1YL 3SGIA 2VW9A 2YYZA 1XXGA 3CRKC 1EZ8A 4BA2I 4IUUA 4A93H 1NSNS 3S1NH 2ZM6Q 1VQAA 2ZXOA 1TQOA 4RHRA 5FO9B 1ESRA 4X62Q 3JAMc 4ZYSA 2OTLA 3IRBA 3SK4A 3ONAB 1QZHA 1A2UA 3CCEA 1KAAA 5C3EH 3BYTB 4IUNA 3S16H 4JV5L 1FNUA 2EPBA 2JEAI 1SNMA 2PQEA 3GTPH 2E8GA 1TY0A 1G91A 3STBD 1HXYD 3NWSA 4YWLA 1NJIC 2HDLA 3R8BA 4LWCA 5IP9H 3I3CA 5CV6A 3E9HA 5CGKA 1FGBD 3SK6A 3U50C 1K3BC 1AEXA 2A1AA 4A3JB 5E4XA 1IBKL 3J7AF 1SE3A 2KQ3A 1MD2D 2Q2TA 2M9VA 2NVYH 1A3UA 1AE3A 1XPRA 4A3MG 1ZKOA 1YJ9A 4JI8L 5KNDA 1TWFB 4MTNA 2BE5D 2XSCA 2E76C 3HFZB 2CVRA 3W1GA 4HIKA 1B1ZA 4G4KA 3PO3H 3FP9A 1O7YA 3GV3A 1NCVA 4IURA 4TKOB 1Z6HA 3CPFA 1B53A 1XWEA 1HTPA 3VA5A 2M2LA 1NE3A 3KDFB 2A8VA 3GTJB 1OXXK 4ALPA 5CR3A 1TS3A 1SROA 2AMCB 1MKHA 3BDCA 1E1OA 4IUQA 4NP5A 4DV7L 3S15H 4HN7A 4YHHL 1ZYRD 1CI3M 1LTID 1X3PA 4QF4A 2IHEA 5C44H 5L37A 5C0XI 4G7OC 3S1RH 1VQOA 2R7DA 2EYHA 3RLNA 4DF7A 1IW7C 4OONA 2PI2A 2A5HA 1YI2A 1GOZA 4NKLA 1Z7TA 3KF6B 5KYLA 4AIMA 4A3IG 1EYDA 2JA7H 1BUVT 3I90A 2AQ3B 4M8AA 1RDPD 1TWCB 1XTDA 4OO1I 1I4RA 2AWNA 4DR7Q 2L11A 3L9AX 2F0IA 5IODA 3AYHB 4DV5L 3S1RB 3OPOA 1LT4D 4L5QA 3MXNB 5BR8Q 1EQVA 3HS0C 3K5NA 3ND9A 4ZLTF 1TWAH 4DUZQ 1E7ZA 1B8AA 1FJGL 3RZDH 1QNUA 3VR6A 1YJWA 4G7HC 1VQJA 1VQLA 1AW7A 3LX0A 4OGQC 3STBC 2PNHA 1QVGA 1ENAA 1WTOA 1AP0A 1YNXA 1S3OA 4C3JB 5LMNL 2PQAA 3DLLA 1Y1WG 3I4MH 3F8TA 2EY1A 4RHSA 3J81E 1BBWA 1WTVA 3GTKB 4IPHA 1JOOA 1OO9B 1PRTF 3NTIA 3H0GH 2JA5B 2K52A 2C5CA 3NWTA 2GVBA 3CC2A 2MGSA 1SNQA 1UE1A 3K81C 5CMDA 2JEBI 5IGCA 2OWOA 4H44C 1OXUA 2BDOA 5J1ZA 4DR2L 3NENA 5LMUL 1TS4A 2BA0A 3BYYB 1SN8A 3DHQA 3OYYA 4PMBA 1PRTC 4PV1C 3E0EA 4JI5Q 3F2DA 5M5WB 3J80i 2A6EC 3ERQA 2EJFC 4X62L 3U9SA 3JAMi 2R92G 1OXVA 4A3IB 1QILA 3DUZA 1KXLA 1CUKA 2K5QA 2QGQA 2ZTDA 3S15B 1MGSA 1NNXA 1BKBA 2UXCQ 1VS0A 2EYOA 2R93H 1VQGA 5TSSA 3T53B 3FDTA 1SYGA 5DNFA 1R4QB 1ZEQX 3TEHB 1JQYD 5JAVA 3KF6A 4C3IH 3BJUA 2N3SA 3T51B 1EWIA 5GAHC 1N33L 2MPMA 1A15A 4JW0A 4R4IA 1CKOA 2FFKB 3K0YA 3TP6A 3CMAA 1Y8NB 1SMXA 3SVMA 1TWFH 4LMQD 4A3KH 4RA8A 2JK8A 2C9OA 3CCSA 4Y7NH 1U4LA 3CCVA 4KTAA 1JICA 5JJZA 1EL0A 3F2UA 2KCCA 1R9TH 1MSGA 2BA1A 3RUZA 2VQEL 3R2TA 1CA5A 1HNZQ 3M4OH 2CKZB 2F0FA 2EZVA 2LKVA 3PIO3 1SNOA 3R2IA 1TU2B 1B2TA 1I4PA 4A3JH 4GNXC 1MBYA 5CV9A 2F0QA 1F9QA 3VYUA 1E2ZA 3BZKA 1HNWQ 4P74A 4DU9A 1SDFA 4QMGA 4EGVA 2JA7B 3T16A 2EE1A 1IYJB 1FD7D 4A3KB 2JJQA 2D0OA 1TWHH 1ZYRC 1IL2A 1D5XC 4HSVA 1XMQQ 4B3SL 1PXUA 1JR0D 4K5VA 4GN4B 3HKZE 3Q24A 1SR3A 3MEFA 2DUDA 1LT6D 2UUBL 4LF9L 1VQEA 3PO2G 2KJXA 3ERSX 1VQ7A 4V190 2JA8B 1TXYA 3NQIA 4QQBX 3CCLA 4A3BG 3CCMA 2Z6KA 2RSOA 1KDCA 3FEWX 1NMFA 1PVOA 4LF6Q 1DCZA 1AZQA 3BG3A 4JCVE 4LF7Q 3MTSA 1N34Q 5M3FG 4C3JG 4DR1Q 1QOHA 3PIP3 1BCPB 3D6CA 2L55A 3H91A 1K8GA 2LY7A 3K58A 3DM3A 2F0JA 3HOXH 1IBML 4GKKQ 1F77A 4P72A 3GTLB 5JJLA 2I5HA 4HSPA 2E2DC 3AEVA 1YJNA 4IALA 1AN8A 2IL8A 4DV4Q 3N52A 2B2WA 1XPOA 4AYBE 3M4PA 1SEBD 5T1GA 5I4DA 3VYRA 1VQNA 2LS01 4IOAA 1R9TB 1A8VA 1DYQA 1N34L 4X3TA 1NR2A 1BVSA 3TRZA 1SMYC 2K5HA 2EYPA 3KLWA 3TMEA 1V1PA 4QB4A 5E1FA 2R92B 1HTLD 5C3XA 3OMCA 3LWUA 3PIOA 3PF4A 3Q22A 1WOCA 1I3QH 1AE2A 2QDLA 4HTHA 2O4XA 3KOJA 1JOQA 4ZRZA 1SYBA 1L0WA 3A0JA 4PMWA 2A74C 1GUWA 2JA6G 5EKLA 1V8QA 3MVVA 3QOLA 2F0KA 1SLJA 2RVLA 5ELBA 1SYDA 1XTCD 4IJLA 1CM9A 1Y8OB 4N9PA 1VQ8A 1D6EC 1S72A 1CKNB 2K75A 3J80L 5JJKA 1TVXA 3M3YB 2F3VA 2MQHA 4A93B 1Q81C 3ULJA 3I4MG 3OW7A 3I4NH 1NY4A 1HZBA 5KNCA 2VZAA 4MIUA 2HD3A 1KRSA 5C44G 2B29A 4BWGB 1HHVA 2E2JB 1EY9A 4LUZA 4LFCL 2IJ0A 4A3FH 2ZTCA 3Q0AA 2ASBA 2A6HC 4QIWE 3TP5A 4YY3L 1YHQA 1BNZA 3MAQA 5HY6A 2F52A 4R8IA 1SYCA 1S5DD 4F88A 4FDBA 4DUZL 1HZ9A 2HIVA 4GLXA 2VY3A 4JI6Q 5C44B 2WB1E 3H94A 4I65A 3KLRA 2KEEA 3OIQA 3I4MB 1PH4A 1I94L 3U58A 5EKIA 5EPKA 3S17B 3OW2A 3IL8A 3WOFA 2AWOA 2UUAQ 3GP7A 3SEBA 5IT9c 1JE4A 1KDBA 4A3BB 1HZCA 4WFN3 3TS0A 3G6EA 2JA8G 4DK1A 3PUWA 1GO3E 4N9TA 1EY6A 3ER0A 3C2PA 1XPUA 4NB3A 5GAEC 2OQ0A 2F4VL 3L2PA 1UE7A 3KJPA 3OHXC 4JI2Q 1K8MA 4MN3A 3GTMH 2HCIA 4C56C 4HIOA 4JBMA 2KHIA 4F8MA 3I91A 2B2UA 1I6HB 3OSOA 5C0XG 4DNRB 4PQXA 3PV0A 1QUQB 2EJGC 4LFAQ 2DN8A 1A3TA 1L0YB 1BR9A 1PFNA 1Y8PB 1UWVA 3CQZH 2KOLA 2NB0A 1O7LA 2R93B 2WACA 5M5XB 2F0UA 1W3SA 4A3DH 3HKSA 3AMUA 1HRJA 2K03A 4R4TA 5FKAC 4QGUA 3BDLA 4PMCA 1LT5D 2MFIA 1U0LA 5C6AA 1S5BD 2A69C 3EFXD 4L5SA 1T5EA 1WTRA 3PF5A 1DJRD 1TS5A 2WV6D 2OQKA 1Q46A 5IWAL 4KJNA 2BH8A 1VDZA 4NXNL 5IWAQ 3S16B 5LL6S 3P7JA 4KK7A 5BN3A 4HCEA 1ESFA 5IYDG 5ELDA 2J4XA 3K7AB 4RWSC 1GVPA 2MO1A 3UDFA 3KDFA 2K04A 3GTMB 1PDQA 1S5ED 2R3ZA 1PYWD 2XWJB 1YHBA 2JYOA 3IAYA 2NN6G 3T4AC 2LXJA 3I7FA 1RTOA 2FINB 2B63G 5COYA 1SE4A 1W6KA 3KJOA 4K0KQ 4S3SA 1K83H 3Q6SA 4CDDC 3LWEA 2D62A 2XWBB 3P1HA 3G4SA 4A3KG 1K0RA 3I2ZA 1QWYA 1KD1C 4KV6A 4JBKA 1GXDC 2EYJA 4ZAIA 1X3EA 1D8LA 3A5ZB 1KNEA 3TBIB 3I4OA 1ML0D 4H7BA 4YHHQ 2WKDA 3TP7A 5C4XB 3I4NB 1XX8A 4ZKCB 2RDGA 1B4OA 4WORA 3JAML 3T56B 4DV1Q 4E6IA 2PPBC 2MUYA 1PH2A 2UUAL 1L1OC 2KENA 4HJ5A 4B3TL 1GUGA 1RIPA 2QEJC 4JI7Q 1IBKQ 2AUKA 3AFPA 1I6HH 5ELFA 4HJ7A 3BDOA 1JORA 3HRZC 2BOSA 1LV9A 4XYOA 1LTGD 3S2HH 5M5YH 2H4OA 2DNCA 1T5XD 5FJ8G 1SE2A 2OF1A 3A8JE 1LTBD 2Z6KC 5H1SE 1Y69U 1I4GA 3TQYA 3TS2A 3F1ZA 1CZGA 1G291 4EQNA 3NXWA 1HQRD 5M3MB 4DK6C 4HJ8A 1BOSA 1WTPA 4Z9CB 3QJYA 3M85A 3UE0A 4CDFC 1VQ6A 5IYBH 1JB7A 1IXRA 3S17H 1K8AC 4JI1Q 1WJJA 1Q82C 1ET6A 3PO3B 1H9SA 2YTXA 1H9SB 1WTHA 2FHTA 3D31A 4KD4A 5E7NA 2B2WC 4A4IA 1N32Q 4FF3A 4GNXA 5JJIA 2AHOB 4DPGA 3AU7A 2ZXPA 3J81c 4BY1G 2NBFA 3CMEA 4LUVA 3HP3A 2IX0A 4AH6A 1P8LA 3K0XA 4K5WA 3A7AB 4X64Q 4UY8C 4BY7H 4OIJA 3I4LA 1I5FA 1YEZA 3EQLC 4A3MH 2EDGA 1WFQA 4LJZC 1IBLQ 1XNRQ 1EY7A 3CP0A 3CCUA 2QILA 5K5PA 3DEPA 5M3MH 1XMQL 4UPAA 3T1YQ 3GV6A 4R4CA 3URYA 3NK9A 3HEJA 2FXQA 4F7XA 4DV3Q 3NP8A 1SSOA 2K5NA 1MJCA 5D65A 4PZ8A 3J81j 1E24A 1VMPA 1X9NA 2AUJD 4XXEA 5CORA 1FYCA 1F9SA 4X3UA 4DK3C 4XQJA 3GTJH 4DV4L 4JC0A 1YITA 3MXNA 4DV6L 3T13A 1BQQT 1CT1D 3D4RA 1HA5A 3VA7A 2WKCA 1N33Q 4DV0L 1B3AA 1D2BA 2WIIB 4JI0Q 3UI2A 2PZWA 2EXZA 2NUCA 4LF8L 4H0LC 1STYA 2N8NA 4BXXH 4KY7A 1PH1A 3MFGA 3RLFA 2RA4A 2AKWB 2RDHA 3S2DB 1Y1VB 1WCMH 2YU9B 3ULLA 4X65Q 1RHPA 3BU2A 2R7FA 3CCQA 2HCCA 3Q8DA 4KY5A 2MNAA 4LFBQ 4X6AH 1QCBD 3PMFA 4J15A 5M9OA 5D14A 4CDCC 2IY5B 2GVAA 1NUCA 4B3SQ 2F0PA 3A8IE 2VL6A 2NVQH 3TSSA 2F0WA 4JI5L 4XIGS 3M7GA 4RAUC 1CA6A 1WD1A 1IKLA 2H5XA 1VQBA 3MC0B 4O42A 2G9HD 3SXHA 4OWTB 5IOCA 1GM5A 4XQNA 1N32L 2CCZA 3ND8A 4ULLA 3G7LA 1PFMA 1HFNA 2L5TA 1XNQQ 3J7AV 1PMRA 5IP7H 4A3CH 4F87A 3EBEA 4NXML 3BVMA 1HNXQ 5F2DA 5JEAH 3OWEB 4QCLA 5IY0A 4X3SA 5LMUQ 3S1QH 4FVMA 2K01A 4P2CB 1XYIA 5CV7A 4AQYQ 2VB3X 4DR4Q 1D5ZC 1JB3A 1UUPA 4ABNA 3CCJA 4J6HA 1NAPA 4PZ7A 3RR5A 5C3EG 2KCTA 1FJGQ 1R4PB 1OXTA 3B6YA 4U68A 4DV2Q 3OWFA 4AYBB 2H1EA 5FLXE 1FNWA 4BBSG 1ET9A 3K6OA 1SRUA 1I50H 3RZOB 3CC7A 3BZDB 2F0DA 3HOVH 4KLKA 3SE0A 3GTOB 1G6ZA 4RGTA 3T1HQ 3BVZA 5EPLA 2UU9L 4UP8A 3H3VI 1VMCA 4OX9L 4XYQA 2KVMA 2E2IH 2K5VA 2PW5A 2K4KA 4POFA 4EVOA 2E75C 5K36G 3PO2B 1AH9A 2B8GA 3FRPB 1CQVA 2R93G 3CXCA 3HOWG 5KIXA 4R4QA 5ELOA 1C9OA 3TN2A 2UXDQ 5JOBA 3DMUA 2IPKD 2QA4A 3P20A 4PG3A 1U4RA 4DAVA 1M4VA 4HAEA 2NVXH 3CF5A 1X32A 1WD0A 4JI3L 1QVFA 2RBMA 2CQOA 3I56A 1LTSD 4BBSH 1QG7A 2HQEA 2A73B 2D2CC 1MSHA 1LYLA 2VS1A 2SNSA 1RJTA 3GTOH 2NVQB 2OEOA 1PH9A 5FLXL 1WTWA 2R7ZG 1PTOC 2A68C 2UXDL 2F4VQ 3L7ZC 3UDIA 1BCPF 1VQDA 4CJ2C 2CH4A 4A93G 4A3DB 3NQTA 4KN7C 2EYFA 2DY8A 1J5EL 1LLRD 3CQZB 3HOZB 5IIFA 5C3EB 1L1OA 4DAMA 4TSSA 2XTIA 2SNMA 3NUCA 1D1KA 1STEA 2K6AA 4JOIC 1V43A 3NTHA 2CWPA 5IE8A 2IX1A 4O1NA 4JG2A 3GDEA 3GQBA 1PTOB 2OCEA 3I8ZA 1PZID 1DOLA 4LAAA 4JI8Q 1FGUA 4GNXB 3K80C 2EIFA 4R1JA 2PMZE 4LFCQ 4IFDI 2L0CA 5IGEA 4JI3Q 3DXJC 1O78A 1EWHA 2MJ8A 1QE6A 4A3BH 5IYCG 3ICEA 4EQPA 3FKIH 4JI2L 2IW3A 3C46A 3MFYA 2B2VC 2JP1A 1I3QB 4L5TA 2L12A 1EQRA 4BBRG 2ZM6L 1YHAA 4DAYA 4FF4A 4BY7B 3AFQA 1E2WA 3EROA 2Q2HA 4K8IA 2JE6I 3D8GA 5EPJA 1NBWA 4KHZA 1Q12A 2EVBA 2VXWA 2CFMA 5EBCA 2HQLA 3S1MH 2C35B 1Y1VG 3C1FA 5EAYA 2ZTEA 1WTQA 1RF2D 4P71A 1F2LA 5C4ZA 3IFDA 2EYLA 2D9UA 3EA6A 1BCPC 5J22A 5BN5A 4WJ4A 3PCOB 4MNOA 3H0GB 1B7YB 5D3IB 3G6JB 3KFUA 1SYEA 2CW0D 5IGBA 5EJWA 1GUTA 1PHJA 2TSSA 2F0MA 3ZJYC 4CHTB 4NXNQ 3D6WA 2F0TA 4B9XA 5AFWA 4BY7G 3X3NA 1AFPA 1Q8IA 4RGOS 2L4NA 1CHQD 3S2HB 1SYFA 5C0XH 1ONLA 5JVG3 2KA7A 2VNUD 2O2LD 4A3IH 2JA7G 5LHY1 3VR2A 2RDFA 2K1BA 3MHBA 1BBXC 4FYDA 1PYSB 3G71A 3SK8A 3S1MB 4UHVA 4HCSA 4RCNA 1YNJC 3HZXA 3KBGA 5GAGC 3OIPA 4KY6A 3CAMA 4K8JA 1KLUD 3HOUG 3D0FA 4JV5Q 1HCZA 2MHVA 4DV3L 4DGZA 5KYIA 1HPCA 5C4JB 1WTXA 3ITPA 2NTSA 3R3OA 5DM63 1N9WA 4X66L 2UXBL 4I7AA 2UUCL 4XTCS 1F9PA 1DZ1A 2JA6B 1JWUD 4WJWA 1S40A 1JJCB 1EY5A 1QUQA 4X66Q 3VR4A 4GLAC 4C3IG 5I6WA 1K0SA 1Y1WH 2UU9Q 1PFBA 2PYKA 2BCOA 2XIWA 2NN6H 3H0GG 3MEHA 1U5KA 2Z9HA 2WP8J 3J80c 1Q86C 1SNPA 3FPPA 2XNAC 4YIJA 1VQKA 2NVXB 5FLXc 4OWWB 3KYHC 4X65L 1GUNA 2DGYA 2JA8H 4KHPL 1XJVA 4IQZA 3WDNA 1VCIA 1WI5A 2K50A 3F2CA 4CKCA 3EJIA 3PUYA 4R9WA 4CDEC 2PNRC 2OXPA 5ELEA 3HOWH 1PYBA 5IGDA 3IKJA 4AYBG 4MHEA 2WAQE 4HMIA 1IHZA 5GROA 1HNXL 2CQAA 2NVTH 2LMCB 3S14B 1KRTA 3KUPA 3QOJA 5M5WH 1U9RA 4IUPA 4JPBW 4A3EG 4G57A 4LF9Q 5A2QE 4DNIA 3M4QA 4O0AA 4WRDA 4JI7L 4Y7NB 5CC4A 1RTNA 1VQFA 2F1MA 4QIWB 3M4OB 3EN2A 1JJGA 1VQCA 4JYAQ 4A3GH 4C3HG 2Z4IA 2G9DA 2RCFA 1G2SA 3CHBD 5BN4A 2VUMH 4KMUC 4A75A 2PCFB 3KF8A 1BF4A 4C3IB 3H3VH 2X6GA 3PSIA 1SNDA 3PQIA 1PRTB 1STNA 2B2TC 2JA5H 4FO2A 2F03A 5J3BA 1YNJD 2A69D 1Z9FA 4OELB 5CYUA 1AZPA 1DGSA 2VB2X 4DAPA 5I2XA 1PRTD 2EY6A 5LMNW 2K33A 1KIXA 1ICFB 1N36L 2F3WA 2KHSA 4XQQA 3CW2C 3DEOA 4KHVA 2JA6H 2PZUA 3TP8A 4JI1L 5I9OA 5HURA 2YTYA 1WYDA 2CW0C 4DV6Q 1P16A 5M5XH 2R61A 3K57A 3HKZB 1T9HA 1KL9A 4C3HH 1CKMA 1EIFA 1A63A 1HA6A 1O7IA 1EEFD 4QUFA 5IP9G 4MTKA 3HOZH 4IO9A 4EX5A 3S9WA 2PQAB 2ZJPA 4LF7L 3L0OA 2QCPX 1TWCH 4JBWA 5LL6X 2K14A 3RMHA 5CBAE 2FMMA 1II3A 2JA5G 3V2TA 1YIJA 2PMZB 2F0VA 5DAUA 4OO1H 2NZ1D 4C3JH 1QVCA 2UUCQ 1LUZA 2ZT9C 1LTRD 4J8QA 3OTOL 2QF7A 1SXTA 4XDXA 2J0TD 1UE5A 2B2YC 2N88A 2V4DA 4ODGA 2ALYB 3RNUA 3A74A 4DV1L 2E2HH 5E4WC 1JJ2A 1JOKA 3BVGA 4XT3B 4RFBA 2QW7A 1GHJA 4LFAL 2E5LQ 4GLVB 2NZOA 3QG1A 1UNSA 4CGYB 1LO5D 3K5OA 4IFDH 3HOZG 1LACA 1UAPA 4DUYL 1Y1WB 1EFID 4DN4M 1EU4A 1TT2A 2D0PA 2AQ1B 4GOPB 1Q8KA 1E2VA 5C4JH 1E3PA 5IYCH 1F2ZA 3MZ5A 1XMOQ 3D4DA 2ENBA 1EIGA 5IYBG 3JAME 4PZ6A 2F4IA 4A3LG 1PH5A 1GKHA 2F0NA 1M1KC 2Z6BA 2DY7A 4IOCA 3W2DA 3AB9A 4RGNA 4JK1C 1GJXA 5DM73 3T1HL 5EGTA 1QJOA 5FLMH 1CSPA 2OTJA 1BO0A 5JVH3 3SHLA 2R6GA 1UE6A 4K6LA 1EYAA 4B3ML 2SOBA 2XRQD 1PZJD 4IFDJ 5KEEA 4Q0FA 4A3DG 1PZKD 2JSOA 4EQ5A 3M7NA 5G3LD 4DNTB 1VF7A 3FKIB 4YY3Q 5C0XJ 2MO0A 3HOWB 1KQSA 1DM0B 3KF8B 1GHKA 4OIKA 1EEID 3DM1A 1FNVA 4YCVA 5EQ0A 1LTLA 2JQOA 1K8OA 3MXUA 3J81L 4ZKBB 4JVZA 1SFOB 2N49A 3MXGA 1D7QA 2RSNA 4OL7A 3I73A 4NXMQ 2EJMA 5IYDH 4HIDA 2KCNA 2E74C 5JEAJ 3J81i 1Q3LA 1A62A 4DV7Q 4K6DA 3W5OA 1TWHB 1PH3A 2RQXA 1X56A 4NW2A 1O80A 3HOYG 2HHHQ 1CK1A 4L6TB 1EY8A 1VQIA 5A2QL 2QDBA 1PH7A 5C4XH 1B3QA 3E9IA 1YNNC 4RKBA 4QY7A 1STAA 3VR3A 1DOMA 1KDAA 4EQOA 1RD9D 4RGMA 2L9HA 2Z4HA 3J7ZC 5K36H 1ASYA 1D5MC 1E22A 4HIMA 4BBRB 1Q1EA 4GZYC 2Z0SA 2ICEC 4CKBA 4DFAA 4KD3A 4L5RC 1Q90A 5GQOA 4DXGA 2DJFC 4X3KA 2KECA 2B63H 4M1UB 4ME5A 5FOBB 3K7UC 4Q5VA 3HOYB 4BS9A 4JI6L 4KJOA 3MA2B 1PFSA 4DV5Q 4OHJA 2LXKA 3K8AA 1GUSA 1H9JA 1KAWA 1FL0A 2F3IA 2Z8LA 4YWKA 5I6YA 3HOYH 1EUJA 1YZ6A 2EXDA 2FMCA 2TMPA 1S5FD 2WAQB 1H9MA 4K2KA 1N36Q 4DR4L 3K7AH 4HJAA 4RCOA 2NZHA 2Q2IA 4TVAB 1EWCA 3D4WA 2Y0SE 3FPUB 3U9OA 5JEAG 3H3VC 1TR5A 3U4VA 1KABA 2WAQG 1PA6A 2RHQB 1I50B 3RZOH 3TZDA 2E5LL 4P73A 1U4MA 1E1TA 1EQTA 3G48A 3HOXG 1KNAA 1ENCA 1M8AA 1IZ6A 3A56A 4YCUA 4QL5A 4MZ9A 4RMFA 1PV4A 2B39A 4TRDA 1VQHA 4A3EH 1LTAD 4I7ZC 3P75A 5FJ8H 1JE5A 3OTOQ 3S24A 2KBNA 3S1QB 3I72A 3E3XA 1QB5D 2IHFA 2KCMA 2ES2A 1Y14B 1YBYA 4DAYB 2X6LA 3J7YW 4KN4C 4CJ1B 3IFTA 4P75A 2XVSA 5I2YA 1IKMA 2M00A 5DLQE 1B70B 2E2IB 4RG1A 2LSSA 1X3FA 4GN3B 4OO1G 1HNZL 4DR6Q 1HR0Q 2VUMB 4IUVA 1CQFA 1JCKB 2ZJRA 2A6HD 1W6JA 1H95A 2I46A 1JWMD 4DKAC 4CKEA 5FO8B 4LF6L 2K32A 3CKIB 3QWNA 2DNEA 4JI4Q 3NTKA 5M3FH 3V96A 4BY1H 2HT1A 4OXPA 1SAPA 2JXMB 5IGFA 1F2YA 1QZGA 4LNQA 1TWGB 1G2TA 3R93A 2AQ2B 4OEMB 3VDYA 3HG9A 2Z1CA 1X6OA 1HFGA 3ULPA 1J8IA 5FK9C 4DR6L 3S14H 2NVTB 2WB1G 4N8FA 5JPMC 5E3FA 3NBHB 2L15A 4DR5L 4ILWA 1LM0A 3E5SA 2F0HA 1HR0W 3UDXA 3BZCA 5C3WA 1MIUA 1C48A 4IUTA 2SEBD 4YCWA 3A54A 4LFBL 3NBIA 4A3FG 2XGTA 4WJ3M 4G7ZC 1HUMA 4Y52H 1HQMC 5FLMG 4DR5Q 1C4QA 2N78A 3HKZG 1UEAB 1LABA 3PO3G 4LF8Q 1LT3D 1HNWL 4CJ0B 1K9MC 1TWAB 1X54A 4PNYA 2WB1B 3VYSA 3SDZA 1CZWA 4B3RQ 2NYZD 1L1OB 4UP7A 3FHWA 2VQFL 1STHA 4LW1A 1JWSD 1L2FA 2K05A 3PUXA 3J80E 1CHPD 4FXGC 5ELCA 4FXDA 4A3FB 1EY4A 3UE1A 4DR3Q 2IX3A 3QO2A 4B9WA 4GKJL 2N55A 1MJEA 2PO4A 1JC7A 1IYVA 1IL8A 2JN4A 2SDFA 3MXPA 1KHIA 1IBLL 1XNRL 2GA4B 1KC8C 4IPDA 4JOIA 5KGUA 5KRUA 5M3FB 1B50A 3TDQA 4B08A 2I5LX 4QJFA 4C2MH 1VQPA 2UXBQ 1G6PA 1OTCA 1YVCA 2F0EA 4DR7L 1TIID 5EKKA 4YWMA 1QNKA 1TKWB 5AJ3Q 1NTGA 2ID0A 1CFMA 1MI2A 2WINB 4DR2Q 4K14A 1J6QA 3A7LA 4L63B 4RKLA 3HOVG 1BCPD 5EBDA 3S1NB 3I4NG 2ICIA 1VF5C 3F2BA 3RN2A 2CWAA 2I5MX 2F0LA 3AQQA 3X3MA 2F0GA 2HHHL 2B2VA 2B2UC 3M9BA 2K7VA 3CD6A 4DK0A 4L8JA 2NVYB 2BDNA 3C1EA 1RCVD 3BS1A 1EYGA 1HZAA 4A3EB 4OWXB 1EU3A 4POGA 1F2MA 3WWVA 4JBJA 2O5JC 1L0XB 2EQSA 3QR8A 1I94Q 5ELNA 2RKSA 3TZUA 1B9NA 2XN9C 3GTQH 3HOXB 4B3MQ 1EIYB 2Q2UA 3EVQA 5BR8L 2RHSB 5LMNQ 1A2TA 2KUMA 3KBXA 4B3TQ 3VR5A 3RD4A 2Q8IB 2K5WA 1J5EQ 1A0IA 4FNFA 2UXCL 4HR7B 2RF4A 1S5CD 1U4PA 1PTOH 5G3LF 1E0BA 4LF5Q 5NUCA 2ZJQA 1DONA 2NWGA 2K28A 4UP9A 1ICWA 5DEHA 4V0BA 2YV5A 4UAIA 4J1MA 3PGZA 1EY0A 2Y0SB 4FF1A 1A6XA 3RLOA 1RKNA 4CBVA 1JMCA 4FF2A 3PUZA 1Q7YC 3CPWA 3GTGH 1STBA 4K0KL 1XMOL 4DA2A 1H9KA 5IT9E 4C3HB 2HIXA 2A19A 2KHJA 2LFNA 1RL2A 4LF4Q 4C2MB 3OOCA 3O13A 5C4HA 1NR4A 2EYMA 1K3RA 3U4ZA 1SNCA 1TY2A 2Y0SG 3Q23A 4DUYQ 4HMJA 1DD2A 2QKIC 1BBUA 4UDUC 1IW7D 3V05A 2RCNA 3NELA 5GADC 4ME3A 1X65A 2NTTA 2V1CC 1FR3A 3NHHA
chains in the Genus database with same CATH topology
4IN3A 4RH6A 1CTMA 3KLSA 2HUGA 1J9OA 3D3RA 1YNND 3M4YA 4BA1I 2BE5C 3L3OC 2CHBD 4ZUJA 1K83B 2FJ2A 1OXSC 4QUCA 3C3LA 3FVQA 3HOUB 2D5DA 4KKUA 2E2HB 3HGBA 1C8CA 1ZXTA 3OMGA 2B63B 4IFDG 2KEDA 2IT1A 2O5IC 5FO7B 1I4XA 1EZ6A 1G8ZD 3K5MA 5J39A 1H9RA 1DXMA 1S4ZA 1PTOF 3W3AA 5C5LA 1Q1BA 1LTTD 4FP5D 1PLFA 1DOKA 1I4QA 4ZQ3A 4H13C 1STGA 1I4HA 3VYTA 5I9PA 2ZXRA 3GTGB 4KI0A 4XT1B 1GUOA 4ID6A 2B8FA 4BY1B 3DWAA 1B9MA 1X3QA 3E0JA 1D1IA 3K59A 3SR1A 2B2TA 1SJHD 5CV5A 3CRLC 1KLGD 1TS2A 4R8NA 2I07B 3NBHA 1ILPA 1PTOD 3DWQA 3GD7A 4DXFA 1F9RA 1EIHA 2EY2A 4KKSA 1ENFA 4FXKC 3KLSX 1Z47A 1WCMB 5HGTA 1O7ZA 4LK1C 2IWHA 3GO5A 3SK5A 2PW7A 1RODA 3FMCA 2B2YA 2HDMA 3E6ZX 5ISRA 2Q8RE 3K5LA 3WOEA 3DWPA 3NPPA 1B44D 2EOTA 3MWYW 5C5MA 1ILQA 3A55A 4C1NI 1BXTA 1IYUA 1A3VA 5T1IA 2K5DA 5KNBA 1WVLA 2PZTA 2L1BA 3KK7A 1SMYD 3GTPB 4ZK9B 1V1OA 4BBSB 4K2LA 2Q8TA 1EOTA 2A6ED 3NE5B 2R7ZB 4ZUIA 5M5YB 4C1NK 4K5XA 1SBBB 4U673 2A68D 2X69A 2J7ZA 3H6MA 2F0SA 2OT2A 3PUVA 5D3DA 1SJED 3QB3A 2MP1A 4A3MB 3ZYYX 5CV8A 1BDOA 4A3GB 5IT9L 3HOVB 3RZDB 3GTQB 5IGGA 5CV4A 1HUNA 3LNNA 2XRSD 3CU7A 5A35A 3H09A 1KTKA 3NSWA 4NDXA 4HEDA 3QIAA 3N6RA 4TQUS 2NN6I 1V1PB 4KKTA 4IZ8A 3A8KE 2EY5A 3I70A 5CBEE 4NMZA 1I6VC 2F0OA 1EYCA 5JPNC 2YYZA 1XXGA 3CRKC 1EZ8A 4BA2I 4IUUA 1NSNS 2ZXOA 5FO9B 1TQOA 4RHRA 1ESRA 4ZYSA 3SK4A 3ONAB 1A2UA 1KAAA 3BYTB 4IUNA 1FNUA 2EPBA 2JEAI 1SNMA 2PQEA 1TY0A 1G91A 1HXYD 3NWSA 2HDLA 3R8BA 3I3CA 5CV6A 5CGKA 1FGBD 3SK6A 1AEXA 4A3JB 5E4XA 3J7AF 1SE3A 2KQ3A 1MD2D 2M9VA 1A3UA 1ZKOA 5KNDA 1TWFB 2BE5D 2XSCA 2E76C 2CVRA 1B1ZA 4G4KA 1O7YA 3GV3A 1NCVA 4IURA 4TKOB 1Z6HA 1B53A 1XWEA 1HTPA 3VA5A 2M2LA 3GTJB 1OXXK 5CR3A 1TS3A 3BDCA 4NP5A 4IUQA 4HN7A 1ZYRD 1CI3M 1LTID 1X3PA 4QF4A 5C0XI 4G7OC 2EYHA 4DF7A 1IW7C 2A5HA 1GOZA 4NKLA 1Z7TA 5KYLA 1EYDA 1BUVT 3I90A 2AQ3B 4M8AA 1RDPD 1TWCB 4OO1I 1I4RA 2AWNA 2L11A 3L9AX 2F0IA 5IODA 3S1RB 3OPOA 1LT4D 1EQVA 3HS0C 3K5NA 3ND9A 4ZLTF 1QNUA 3VR6A 4G7HC 1AW7A 3LX0A 4OGQC 1ENAA 1WTOA 1AP0A 4C3JB 2EY1A 4RHSA 3J81E 3GTKB 1WTVA 1JOOA 1OO9B 1PRTF 3NTIA 2JA5B 2C5CA 3NWTA 2MGSA 1SNQA 5CMDA 2JEBI 5IGCA 4H44C 1OXUA 2BDOA 5J1ZA 1TS4A 2BA0A 3BYYB 3DHQA 4PMBA 1PRTC 4PV1C 5M5WB 2A6EC 3ERQA 2EJFC 3U9SA 1OXVA 4A3IB 1QILA 3DUZA 2K5QA 3S15B 1MGSA 2EYOA 5TSSA 3T53B 3FDTA 1SYGA 5DNFA 1R4QB 1ZEQX 1JQYD 5JAVA 3T51B 2MPMA 1A15A 3TP6A 2FFKB 3K0YA 1Y8NB 3SVMA 4LMQD 4RA8A 2C9OA 1U4LA 4KTAA 1JICA 5JJZA 1EL0A 3F2UA 2KCCA 1MSGA 2BA1A 3RUZA 3R2TA 1CA5A 2F0FA 2EZVA 2LKVA 3PIO3 1SNOA 3R2IA 1TU2B 1B2TA 1I4PA 1MBYA 5CV9A 2F0QA 1F9QA 3VYUA 1E2ZA 4DU9A 1SDFA 4QMGA 4EGVA 2JA7B 3T16A 2EE1A 1FD7D 4A3KB 1ZYRC 1D5XC 4HSVA 1PXUA 1JR0D 4K5VA 3Q24A 1LT6D 2KJXA 4V190 2JA8B 3NQIA 2RSOA 1KDCA 3FEWX 1DCZA 1AZQA 3BG3A 3MTSA 4C3JG 1QOHA 3PIP3 1BCPB 3D6CA 2L55A 3H91A 2LY7A 3K58A 2F0JA 1F77A 3GTLB 4HSPA 2E2DC 4IALA 1AN8A 2IL8A 3N52A 2B2WA 1SEBD 5T1GA 5I4DA 3VYRA 2LS01 1R9TB 1DYQA 4X3TA 1NR2A 1SMYC 2EYPA 3TMEA 1V1PA 4QB4A 5E1FA 2R92B 1HTLD 5C3XA 3OMCA 3LWUA 3Q22A 4HTHA 2O4XA 1JOQA 4ZRZA 1SYBA 4PMWA 2A74C 1GUWA 5EKLA 1V8QA 3MVVA 3QOLA 2F0KA 2RVLA 5ELBA 1SYDA 1XTCD 1CM9A 1Y8OB 4N9PA 1D6EC 3J80L 1TVXA 3M3YB 2F3VA 4A93B 3OW7A 5KNCA 4MIUA 4BWGB 1HHVA 2E2JB 1EY9A 2IJ0A 3Q0AA 2A6HC 3TP5A 1BNZA 3MAQA 4R8IA 1SYCA 1S5DD 4F88A 5C44B 3H94A 4I65A 3KLRA 2KEEA 3OIQA 3I4MB 5EKIA 5EPKA 3S17B 3IL8A 3WOFA 2AWOA 3GP7A 3SEBA 1JE4A 1KDBA 4A3BB 4WFN3 4DK1A 3PUWA 4N9TA 1EY6A 3C2PA 3OHXC 1K8MA 4MN3A 2HCIA 4C56C 4F8MA 3I91A 2B2UA 1I6HB 3OSOA 5C0XG 4DNRB 4PQXA 3PV0A 2EJGC 2DN8A 1A3TA 1L0YB 1BR9A 1PFNA 1Y8PB 2KOLA 2NB0A 1O7LA 2R93B 2WACA 5M5XB 2F0UA 3AMUA 1HRJA 2K03A 5FKAC 3BDLA 4PMCA 1LT5D 5C6AA 1S5BD 2A69C 3EFXD 1T5EA 1WTRA 1DJRD 1TS5A 2WV6D 4KJNA 1VDZA 3S16B 5LL6S 3P7JA 4KK7A 5BN3A 4HCEA 1ESFA 5ELDA 2J4XA 3K7AB 4RWSC 2K04A 3GTMB 1PDQA 1S5ED 2R3ZA 1PYWD 2XWJB 2JYOA 3IAYA 2NN6G 3T4AC 1RTOA 2FINB 5COYA 1SE4A 1W6KA 4S3SA 3Q6SA 3LWEA 2D62A 2XWBB 3P1HA 1QWYA 4KV6A 1GXDC 2EYJA 4ZAIA 1KNEA 3TBIB 1ML0D 4H7BA 2WKDA 3TP7A 5C4XB 3I4NB 1XX8A 4ZKCB 2RDGA 1B4OA 4WORA 3JAML 3T56B 4E6IA 2PPBC 2MUYA 1GUGA 2QEJC 2AUKA 5ELFA 3BDOA 1JORA 3HRZC 2BOSA 1LV9A 4XYOA 1LTGD 2H4OA 2DNCA 1T5XD 1SE2A 2OF1A 3A8JE 1LTBD 1Y69U 1I4GA 1CZGA 1G291 4EQNA 3NXWA 1HQRD 5M3MB 1BOSA 1WTPA 4Z9CB 3QJYA 3M85A 1ET6A 3PO3B 1H9SA 3D31A 1H9SB 2FHTA 4KD4A 2B2WC 4FF3A 3AU7A 2ZXPA 2NBFA 3HP3A 2IX0A 4K5WA 3A7AB 3I4LA 4OIJA 3EQLC 2EDGA 4LJZC 1EY7A 2QILA 5K5PA 3DEPA 3GV6A 3URYA 3NK9A 3HEJA 4F7XA 3NP8A 1SSOA 5D65A 1VMPA 2AUJD 4XXEA 5CORA 1FYCA 1F9SA 4X3UA 4XQJA 3MXNA 3T13A 1BQQT 1CT1D 3D4RA 1HA5A 3VA7A 2WKCA 1B3AA 1D2BA 2WIIB 3UI2A 2PZWA 2EXZA 2NUCA 4H0LC 1STYA 4KY7A 3MFGA 3RLFA 2RA4A 2RDHA 3S2DB 1Y1VB 2YU9B 1RHPA 2HCCA 4KY5A 1QCBD 3PMFA 5M9OA 5D14A 1NUCA 2F0PA 3A8IE 3TSSA 2F0WA 4XIGS 3M7GA 4RAUC 1CA6A 1WD1A 1IKLA 3MC0B 4O42A 2G9HD 3SXHA 5IOCA 4XQNA 3ND8A 4ULLA 3G7LA 1PFMA 1HFNA 2L5TA 3J7AV 1PMRA 4F87A 3BVMA 5F2DA 5JEAH 3OWEB 4QCLA 4X3SA 4FVMA 2K01A 4P2CB 1XYIA 5CV7A 2VB3X 1D5ZC 1JB3A 1UUPA 4ABNA 4J6HA 1NAPA 1R4PB 1OXTA 4U68A 3OWFA 4AYBB 2H1EA 5FLXE 1FNWA 1ET9A 3K6OA 3RZOB 3BZDB 2F0DA 3SE0A 3GTOB 1G6ZA 4RGTA 3BVZA 5EPLA 1VMCA 4XYQA 2KVMA 2PW5A 4EVOA 2E75C 5K36G 3PO2B 2B8GA 3FRPB 1CQVA 5KIXA 3TN2A 5JOBA 3DMUA 2IPKD 3P20A 1U4RA 4DAVA 1M4VA 4HAEA 1X32A 1WD0A 2RBMA 1LTSD 1QG7A 2HQEA 2A73B 2D2CC 1MSHA 2SNSA 1RJTA 2NVQB 2OEOA 5FLXL 1WTWA 1PTOC 2A68C 3L7ZC 1BCPF 4CJ2C 4A3DB 3NQTA 2EYFA 2DY8A 4KN7C 1LLRD 3CQZB 3HOZB 5IIFA 5C3EB 4TSSA 3NUCA 2SNMA 1D1KA 1STEA 2K6AA 1V43A 3NTHA 2IX1A 4O1NA 3GQBA 1PTOB 3I8ZA 1PZID 1DOLA 4LAAA 4IFDI 2L0CA 5IGEA 3DXJC 1O78A 1EWHA 2MJ8A 1QE6A 4EQPA 2IW3A 3C46A 3MFYA 2B2VC 2JP1A 1I3QB 2L12A 4FF4A 4DAYA 4BY7B 1E2WA 3EROA 4K8IA 2JE6I 3D8GA 5EPJA 1Q12A 2EVBA 2VXWA 4KHZA 5EBCA 3C1FA 1WTQA 1RF2D 1F2LA 5C4ZA 3IFDA 2EYLA 2D9UA 3EA6A 1BCPC 5J22A 5BN5A 3H0GB 5D3IB 3G6JB 1SYEA 2CW0D 5IGBA 5EJWA 1GUTA 2TSSA 2F0MA 4CHTB 3D6WA 2F0TA 4B9XA 5AFWA 3X3NA 1AFPA 1Q8IA 4RGOS 2L4NA 1CHQD 3S2HB 1SYFA 5C0XH 1ONLA 5JVG3 2KA7A 2VNUD 2O2LD 5LHY1 3VR2A 2RDFA 2K1BA 3MHBA 1BBXC 4FYDA 3SK8A 3S1MB 4HCSA 4RCNA 1YNJC 3HZXA 3KBGA 3OIPA 4KY6A 4K8JA 1KLUD 1HCZA 2MHVA 4DGZA 5KYIA 1HPCA 5C4JB 1WTXA 3ITPA 2NTSA 3R3OA 5DM63 4XTCS 1F9PA 1DZ1A 2JA6B 1JWUD 4WJWA 1EY5A 3VR4A 4C3IG 5I6WA 1PFBA 2PYKA 2BCOA 2XIWA 2NN6H 3MEHA 2WP8J 1SNPA 3FPPA 2XNAC 4YIJA 2NVXB 1GUNA 4IQZA 3WDNA 1VCIA 4CKCA 3EJIA 3PUYA 4R9WA 2PNRC 2OXPA 5ELEA 5IGDA 3IKJA 4MHEA 4HMIA 1IHZA 2CQAA 3S14B 2LMCB 3KUPA 3QOJA 1U9RA 4IUPA 4G57A 5A2QE 4WRDA 4Y7NB 5CC4A 1RTNA 2F1MA 4QIWB 3M4OB 4C3HG 2Z4IA 2G9DA 1G2SA 3CHBD 5BN4A 4KMUC 2PCFB 3KF8A 1BF4A 4C3IB 2X6GA 1SNDA 1PRTB 1STNA 2B2TC 4FO2A 2F03A 1YNJD 2A69D 5CYUA 1AZPA 2VB2X 4DAPA 5I2XA 1PRTD 2EY6A 2K33A 2F3WA 2KHSA 4XQQA 3DEOA 4KHVA 2PZUA 3TP8A 5I9OA 5HURA 2CW0C 2R61A 3K57A 3HKZB 1HA6A 1EEFD 4QUFA 3S9WA 4JBWA 2QCPX 5LL6X 3RMHA 5CBAE 2FMMA 1II3A 3V2TA 2PMZB 2F0VA 5DAUA 4OO1H 2NZ1D 2ZT9C 1LTRD 4J8QA 2QF7A 1SXTA 4XDXA 2J0TD 2B2YC 2N88A 2V4DA 4ODGA 5E4WC 1JOKA 3BVGA 4XT3B 4RFBA 1GHJA 3QG1A 1UNSA 4CGYB 1LO5D 3K5OA 4IFDH 1LACA 1UAPA 1Y1WB 1EFID 4DN4M 1EU4A 1TT2A 2AQ1B 1E2VA 1F2ZA 3MZ5A 3D4DA 2ENBA 1EIGA 3JAME 2F4IA 2F0NA 2DY7A 3W2DA 3AB9A 4RGNA 4JK1C 1GJXA 5DM73 5EGTA 1QJOA 1BO0A 5JVH3 3SHLA 2R6GA 4K6LA 1EYAA 2SOBA 2XRQD 1PZJD 4IFDJ 5KEEA 4Q0FA 1PZKD 2JSOA 3M7NA 5G3LD 4DNTB 1VF7A 3FKIB 5C0XJ 3HOWB 1DM0B 1GHKA 4OIKA 1EEID 3DM1A 1FNVA 5EQ0A 1K8OA 3MXUA 3J81L 4ZKBB 1SFOB 3MXGA 2RSNA 4OL7A 3I73A 2EJMA 2KCNA 2E74C 5JEAJ 1Q3LA 4K6DA 1TWHB 2RQXA 4NW2A 1O80A 1CK1A 4L6TB 1EY8A 5A2QL 2QDBA 4RKBA 1YNNC 1STAA 3VR3A 1DOMA 1KDAA 4EQOA 1RD9D 4RGMA 2L9HA 2Z4HA 5K36H 1D5MC 4BBRB 1Q1EA 4GZYC 2ICEC 4CKBA 4DFAA 4KD3A 1Q90A 4DXGA 4X3KA 2KECA 4M1UB 4ME5A 5FOBB 4Q5VA 3HOYB 4BS9A 4KJOA 3MA2B 4OHJA 1GUSA 1H9JA 2Z8LA 5I6YA 2FMCA 2TMPA 1S5FD 2WAQB 1H9MA 4K2KA 4RCOA 1EWCA 3D4WA 3FPUB 3U9OA 5JEAG 3H3VC 1TR5A 1KABA 1I50B 3TZDA 1U4MA 1EQTA 1KNAA 1ENCA 1M8AA 3A56A 2B39A 4TRDA 1LTAD 4I7ZC 3P75A 3S1QB 3I72A 1QB5D 2X6LA 3J7YW 4KN4C 4CJ1B 3IFTA 2XVSA 5I2YA 1IKMA 2M00A 2E2IB 4OO1G 2VUMB 4IUVA 1CQFA 1JCKB 2A6HD 1W6JA 2I46A 1JWMD 4CKEA 5FO8B 2K32A 3CKIB 3QWNA 2DNEA 3NTKA 3V96A 5IGFA 1SAPA 2JXMB 1F2YA 1TWGB 1G2TA 3R93A 2AQ2B 3HG9A 2Z1CA 1HFGA 1J8IA 5FK9C 2NVTB 5JPMC 5E3FA 4ILWA 3E5SA 2F0HA 5C3WA 1C48A 4IUTA 2SEBD 3A54A 3NBIA 4G7ZC 1HUMA 1HQMC 1C4QA 1UEAB 1LABA 1LT3D 4CJ0B 1TWAB 4PNYA 2WB1B 3VYSA 3SDZA 1CZWA 2NYZD 1STHA 1JWSD 2K05A 3PUXA 3J80E 1CHPD 4FXGC 5ELCA 4FXDA 4A3FB 1EY4A 2IX3A 3QO2A 4B9WA 2N55A 2PO4A 1JC7A 1IYVA 1IL8A 2SDFA 3MXPA 2GA4B 5KRUA 5KGUA 5M3FB 1B50A 3TDQA 4B08A 2F0EA 1TIID 5EKKA 1QNKA 1TKWB 2ID0A 1CFMA 1MI2A 2WINB 4K14A 3A7LA 4L63B 4RKLA 1BCPD 5EBDA 3S1NB 2ICIA 1VF5C 2F0LA 3X3MA 2F0GA 2B2VA 2B2UC 2K7VA 4DK0A 4L8JA 2NVYB 2BDNA 3C1EA 1RCVD 3BS1A 4A3EB 1EU3A 1F2MA 2O5JC 1L0XB 2RKSA 3TZUA 1B9NA 2XN9C 3HOXB 3EVQA 1A2TA 2KUMA 3KBXA 3VR5A 3RD4A 2Q8IB 2K5WA 4FNFA 4HR7B 1S5CD 1U4PA 1PTOH 5G3LF 1E0BA 5NUCA 1DONA 2NWGA 2K28A 1ICWA 5DEHA 4V0BA 4UAIA 4J1MA 1EY0A 2Y0SB 4FF1A 1A6XA 1RKNA 4CBVA 4FF2A 3PUZA 1STBA 4DA2A 1H9KA 5IT9E 4C3HB 2LFNA 4C2MB 3OOCA 3O13A 5C4HA 1NR4A 2EYMA 1SNCA 1TY2A 3Q23A 4HMJA 1DD2A 2QKIC 4UDUC 1IW7D 3V05A 2NTTA 1FR3A 3NHHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DNC A;  3CRK C;  4BA2 I;  3A8J E;  1Q1E A;  2JXM B;  1Y8N B;  1CTM A;  3A7L A;  1Y8P B;  3LWU A;  4GZY C;  1Y69 U;  1GHJ A;  2D2C C;  1Q90 A;  1O7L A;  3QG1 A;  4LK1 C;  4IFD H;  1G29 1;  1LAC A;  1VF5 C;  3M4Y A;  3A8I E;  4BA1 I;  2F1M A;  2A68 C;  2BE5 C;  2KCC A;  3OPO A;  5C0X H;  1ONL A;  2BA1 A;  3QJY A;  3FMC A;  3M85 A;  4XIG S;  1E2V A;  1OXS C;  2A69 C;  3L7Z C;  2KA7 A;  2K7V A;  4DK0 A;  3ND9 A;  4L8J A;  2JEA I;  1T5E A;  2D5D A;  4KKU A;  1V8Q A;  1GUS A;  1H9J A;  3HGB A;  3VR2 A;  5BN4 A;  4KMU C;  1TU2 B;  1H9S A;  3D31 A;  1H9S B;  2PCF B;  3VR6 A;  4G7H C;  4IFD G;  3ND8 A;  4KN7 C;  4OGQ C;  3AB9 A;  2IT1 A;  4JK1 C;  1GJX A;  1IYU A;  2O5I C;  1VDZ A;  2L5T A;  2O5J C;  1H9M A;  1PMR A;  1QJO A;  1Y8O B;  4RCN A;  1YNJ C;  5KNB A;  5BN3 A;  4G7Z C;  2A69 D;  1E2Z A;  1HQM C;  2R6G A;  1V43 A;  1B9N A;  3TZU A;  5JEA H;  1H9R A;  1HCZ A;  1DXM A;  1HPC A;  5JEA G;  1LAB A;  3OW7 A;  1ZYR C;  2NN6 G;  3GQB A;  5KNC A;  3W3A A;  2K33 A;  2A6E D;  3A7A B;  3NE5 B;  3VR5 A;  3M7N A;  2Q8I B;  4XTC S;  4DNT B;  1Q1B A;  1ZKO A;  1VF7 A;  3I4L A;  3EQL C;  2JEB I;  2EDG A;  2A6H C;  4LJZ C;  5KND A;  4H13 C;  2A68 D;  2BE5 D;  3SDZ A;  4HR7 B;  4H44 C;  1OXU A;  2BDO A;  2E76 C;  1GHK A;  3DXJ C;  1OXT A;  3VR4 A;  1O78 A;  2CW0 C;  1EWH A;  2D62 A;  1K8O A;  3MXU A;  2BA0 A;  4KI0 A;  3PUV A;  3PUX A;  3H94 A;  1DCZ A;  2NN6 H;  3KLR A;  3BG3 A;  1GUO A;  4I7Z C;  4PV1 C;  2B8F A;  4TKO B;  1BDO A;  1Z6H A;  2A6E C;  3I73 A;  1HTP A;  3MFY A;  2EJM A;  3FPP A;  2AWO A;  2EJF C;  3I72 A;  2AUJ D;  1B9M A;  1OXX K;  4JBW A;  3SE0 A;  3U9S A;  1FYC A;  1OXV A;  2E74 C;  1IYV A;  4KN4 C;  1E2W A;  3IFT A;  2JE6 I;  1A6X A;  3D4R A;  3LNN A;  4DK1 A;  3PUW A;  1GUN A;  5A35 A;  1Q12 A;  2EVB A;  3PUZ A;  2E75 C;  4KHZ A;  3VA7 A;  4IQZ A;  4OO1 H;  5K36 G;  3WDN A;  1VCI A;  3T56 B;  3T53 B;  2B8G A;  3QIA A;  4OO1 G;  2PPB C;  1CI3 M;  1H9K A;  3N6R A;  3CRL C;  2NN6 I;  3PUY A;  4TQU S;  2ZT9 C;  4G7O C;  2PNR C;  4KKT A;  3A8K E;  3OOC A;  1GUG A;  2QF7 A;  4H0L C;  5BN5 A;  1K8M A;  3IKJ A;  2A6H D;  1YNN C;  2AUK A;  3GD7 A;  1TKW B;  3P20 A;  1IW7 C;  1I6V C;  1DD2 A;  1SMY C;  2K32 A;  1IW7 D;  2V4D A;  3BDO A;  3RLF A;  3VR3 A;  4DNR B;  4KKS A;  3T51 B;  5C0X G;  3PV0 A;  1CFM A;  2EJG C;  2DNE A;  2DN8 A;  1GUT A;  5K36 H;  1Z7T A;  2YYZ A;  1FR3 A;  2LMC B; 
#chains in the Genus database with same CATH topology
 4IN3 A;  4RH6 A;  1CTM A;  4OX9 Q;  3KLS A;  1G51 A;  1UEB A;  4N8X 1;  2HUG A;  1J9O A;  2CH4 W;  1MHW C;  3D3R A;  3JC6 6;  1YNN D;  3M4Y A;  4IPG A;  4BA1 I;  2BE5 C;  3L3O C;  2DJG C;  2CHB D;  4ZUJ A;  3J7A 5;  1X3G A;  1K83 B;  2FJ2 A;  1OXS C;  4LUO A;  4QUC A;  2GN5 A;  3C3L A;  3FVQ A;  3HOU B;  2D5D A;  4GS3 A;  4KKU A;  2E2H B;  3HGB A;  1C8C A;  1SFO H;  1ZXT A;  3OMG A;  1IBM Q;  2B63 B;  4GKK L;  3GTK H;  2KED A;  4IFD G;  2IT1 A;  4ZCK A;  2O5I C;  2R7Z H;  5FO7 B;  4GKJ Q;  3PO2 H;  1I4X A;  1EZ6 A;  1G8Z D;  4A76 A;  3K5M A;  5J39 A;  4BBR H;  1H9R A;  1DXM A;  1S4Z A;  1PTO F;  1GD7 A;  4A3L H;  4LF4 L;  3W3A A;  5C5L A;  4B3R L;  1Y1V H;  1Q1B A;  1LTT D;  4FP5 D;  1PLF A;  1DOK A;  1I4Q A;  4ZQ3 A;  4H13 C;  2UUB Q;  1STG A;  1I4H A;  3VYT A;  5I9P A;  2ZXR A;  4APV A;  3GTG B;  1K73 C;  4KI0 A;  2B3G A;  4XT1 B;  5AJ3 L;  1GUO A;  4ID6 A;  1C7Y A;  2B8F A;  3RN5 A;  4BY1 B;  3DWA A;  1ASZ A;  1PH8 A;  1B9M A;  4H02 A;  4LF5 L;  3LGJ A;  4BXX G;  1X3Q A;  3E0J A;  4DV2 L;  1D1I A;  3K59 A;  3SR1 A;  1VQ9 A;  1WCM G;  2B2T A;  1SJH D;  4IJH A;  4JYA L;  3FKI G;  5CV5 A;  3CRL C;  3PIP A;  1SE8 A;  1KLG D;  2VQE Q;  2BH2 A;  1CSQ A;  1TS2 A;  4AQY L;  4R8N A;  2I07 B;  1C0A A;  3NBH A;  4DR3 L;  1ILP A;  1PTO D;  3DWQ A;  3I55 A;  3GD7 A;  4DXF A;  5M3M G;  1EFW A;  1PH6 A;  1F9R A;  4JI0 L;  1EIH A;  2EY2 A;  1VQM A;  4KKS A;  2ATW A;  1ENF A;  4FXK C;  3KLS X;  1Z47 A;  1WCM B;  2YU9 H;  2G5D A;  1XNQ L;  1M90 C;  5HGT A;  1O7Z A;  4O2D A;  4LK1 C;  2IWH A;  4IPC A;  3GO5 A;  3SK5 A;  2E2J H;  2WFW A;  2PI2 E;  4A3C G;  2PW7 A;  1VQ5 A;  3W1B A;  2R92 H;  3S2D H;  1ROD A;  3UDG A;  3FMC A;  2B2Y A;  1TWG H;  2HDM A;  3E6Z X;  5ISR A;  2Q8R E;  3K5L A;  3WOE A;  3DWP A;  3NPP A;  3H15 A;  4R4O A;  2I0Q A;  1B44 D;  2EOT A;  3MWY W;  3M3Y H;  2YTV A;  1ILQ A;  3A55 A;  5C5M A;  2QEX A;  4C1N I;  4HJ9 A;  1BXT A;  1FVI A;  2JA9 A;  2P5Z X;  1IYU A;  1A3V A;  5T1I A;  2K5D A;  5KNB A;  4X64 L;  1WVL A;  2PZT A;  1N8R C;  1K28 A;  2L1B A;  3KK7 A;  1EOV A;  1SMY D;  3GTP B;  4ZK9 B;  4GN5 A;  1V1O A;  4GOP A;  4GOP C;  4BBS B;  4K2L A;  1VQ4 A;  2Q8T A;  1EOT A;  2A6E D;  3NE5 B;  2R7Z B;  4ZUI A;  5M5Y B;  1W2B A;  4C1N K;  4DV0 Q;  4K5X A;  1SBB B;  4U67 3;  2A68 D;  2X69 A;  2J7Z A;  3H6M A;  3HOU H;  1HH2 P;  4JI4 L;  2F0S A;  2OT2 A;  2VUM G;  3PUV A;  5D3D A;  3CCR A;  1SJE D;  3CC4 A;  3QB3 A;  2MP1 A;  4A3M B;  1V9P A;  3EIV A;  3NEM A;  3ZYY X;  5CV8 A;  1BDO A;  4A3G B;  5IT9 L;  4DR1 L;  1HR0 L;  3TRE A;  4A3J G;  3HOV B;  3A5U A;  3RZD B;  3GTQ B;  5IGG A;  1NMG A;  5CV4 A;  1HUN A;  3LNN A;  4KHP Q;  2VQF Q;  2XRS D;  3CU7 A;  5A35 A;  4NPS A;  3H09 A;  1KTK A;  3NSW A;  4NDX A;  1V1Q A;  1EQQ A;  4HED A;  3QIA A;  5HGQ A;  4A3G G;  3N6R A;  4TQU S;  2NN6 I;  1V1P B;  4KKT A;  4IZ8 A;  1X55 A;  3A8K E;  2EY5 A;  3I70 A;  1HJP A;  3GTL H;  5CBE E;  1CKN A;  4NMZ A;  1I6V C;  5C4X G;  2F0O A;  1JT8 A;  5IP7 G;  1EYC A;  5JPN C;  3T1Y L;  3SGI A;  2VW9 A;  2YYZ A;  1XXG A;  3CRK C;  1EZ8 A;  4BA2 I;  4IUU A;  4A93 H;  1NSN S;  3S1N H;  2ZM6 Q;  1VQA A;  2ZXO A;  1TQO A;  4RHR A;  5FO9 B;  1ESR A;  4X62 Q;  3JAM c;  4ZYS A;  2OTL A;  3IRB A;  3SK4 A;  3ONA B;  1QZH A;  1A2U A;  3CCE A;  1KAA A;  5C3E H;  3BYT B;  4IUN A;  3S16 H;  4JV5 L;  1FNU A;  2EPB A;  2JEA I;  1SNM A;  2PQE A;  3GTP H;  2E8G A;  1TY0 A;  1G91 A;  3STB D;  1HXY D;  3NWS A;  4YWL A;  1NJI C;  2HDL A;  3R8B A;  4LWC A;  5IP9 H;  3I3C A;  5CV6 A;  3E9H A;  5CGK A;  1FGB D;  3SK6 A;  3U50 C;  1K3B C;  1AEX A;  2A1A A;  4A3J B;  5E4X A;  1IBK L;  3J7A F;  1SE3 A;  2KQ3 A;  1MD2 D;  2Q2T A;  2M9V A;  2NVY H;  1A3U A;  1AE3 A;  1XPR A;  4A3M G;  1ZKO A;  1YJ9 A;  4JI8 L;  5KND A;  1TWF B;  4MTN A;  2BE5 D;  2XSC A;  2E76 C;  3HFZ B;  2CVR A;  3W1G A;  4HIK A;  1B1Z A;  4G4K A;  3PO3 H;  3FP9 A;  1O7Y A;  3GV3 A;  1NCV A;  4IUR A;  4TKO B;  1Z6H A;  3CPF A;  1B53 A;  1XWE A;  1HTP A;  3VA5 A;  2M2L A;  1NE3 A;  3KDF B;  2A8V A;  3GTJ B;  1OXX K;  4ALP A;  5CR3 A;  1TS3 A;  1SRO A;  2AMC B;  1MKH A;  3BDC A;  1E1O A;  4IUQ A;  4NP5 A;  4DV7 L;  3S15 H;  4HN7 A;  4YHH L;  1ZYR D;  1CI3 M;  1LTI D;  1X3P A;  4QF4 A;  2IHE A;  5C44 H;  5L37 A;  5C0X I;  4G7O C;  3S1R H;  1VQO A;  2R7D A;  2EYH A;  3RLN A;  4DF7 A;  1IW7 C;  4OON A;  2PI2 A;  2A5H A;  1YI2 A;  1GOZ A;  4NKL A;  1Z7T A;  3KF6 B;  5KYL A;  4AIM A;  4A3I G;  1EYD A;  2JA7 H;  1BUV T;  3I90 A;  2AQ3 B;  4M8A A;  1RDP D;  1TWC B;  1XTD A;  4OO1 I;  1I4R A;  2AWN A;  4DR7 Q;  2L11 A;  3L9A X;  2F0I A;  5IOD A;  3AYH B;  4DV5 L;  3S1R B;  3OPO A;  1LT4 D;  4L5Q A;  3MXN B;  5BR8 Q;  1EQV A;  3HS0 C;  3K5N A;  3ND9 A;  4ZLT F;  1TWA H;  4DUZ Q;  1E7Z A;  1B8A A;  1FJG L;  3RZD H;  1QNU A;  3VR6 A;  1YJW A;  4G7H C;  1VQJ A;  1VQL A;  1AW7 A;  3LX0 A;  4OGQ C;  3STB C;  2PNH A;  1QVG A;  1ENA A;  1WTO A;  1AP0 A;  1YNX A;  1S3O A;  4C3J B;  5LMN L;  2PQA A;  3DLL A;  1Y1W G;  3I4M H;  3F8T A;  2EY1 A;  4RHS A;  3J81 E;  1BBW A;  1WTV A;  3GTK B;  4IPH A;  1JOO A;  1OO9 B;  1PRT F;  3NTI A;  3H0G H;  2JA5 B;  2K52 A;  2C5C A;  3NWT A;  2GVB A;  3CC2 A;  2MGS A;  1SNQ A;  1UE1 A;  3K81 C;  5CMD A;  2JEB I;  5IGC A;  2OWO A;  4H44 C;  1OXU A;  2BDO A;  5J1Z A;  4DR2 L;  3NEN A;  5LMU L;  1TS4 A;  2BA0 A;  3BYY B;  1SN8 A;  3DHQ A;  3OYY A;  4PMB A;  1PRT C;  4PV1 C;  3E0E A;  4JI5 Q;  3F2D A;  5M5W B;  3J80 i;  2A6E C;  3ERQ A;  2EJF C;  4X62 L;  3U9S A;  3JAM i;  2R92 G;  1OXV A;  4A3I B;  1QIL A;  3DUZ A;  1KXL A;  1CUK A;  2K5Q A;  2QGQ A;  2ZTD A;  3S15 B;  1MGS A;  1NNX A;  1BKB A;  2UXC Q;  1VS0 A;  2EYO A;  2R93 H;  1VQG A;  5TSS A;  3T53 B;  3FDT A;  1SYG A;  5DNF A;  1R4Q B;  1ZEQ X;  3TEH B;  1JQY D;  5JAV A;  3KF6 A;  4C3I H;  3BJU A;  2N3S A;  3T51 B;  1EWI A;  5GAH C;  1N33 L;  2MPM A;  1A15 A;  4JW0 A;  4R4I A;  1CKO A;  2FFK B;  3K0Y A;  3TP6 A;  3CMA A;  1Y8N B;  1SMX A;  3SVM A;  1TWF H;  4LMQ D;  4A3K H;  4RA8 A;  2JK8 A;  2C9O A;  3CCS A;  4Y7N H;  1U4L A;  3CCV A;  4KTA A;  1JIC A;  5JJZ A;  1EL0 A;  3F2U A;  2KCC A;  1R9T H;  1MSG A;  2BA1 A;  3RUZ A;  2VQE L;  3R2T A;  1CA5 A;  1HNZ Q;  3M4O H;  2CKZ B;  2F0F A;  2EZV A;  2LKV A;  3PIO 3;  1SNO A;  3R2I A;  1TU2 B;  1B2T A;  1I4P A;  4A3J H;  4GNX C;  1MBY A;  5CV9 A;  2F0Q A;  1F9Q A;  3VYU A;  1E2Z A;  3BZK A;  1HNW Q;  4P74 A;  4DU9 A;  1SDF A;  4QMG A;  4EGV A;  2JA7 B;  3T16 A;  2EE1 A;  1IYJ B;  1FD7 D;  4A3K B;  2JJQ A;  2D0O A;  1TWH H;  1ZYR C;  1IL2 A;  1D5X C;  4HSV A;  1XMQ Q;  4B3S L;  1PXU A;  1JR0 D;  4K5V A;  4GN4 B;  3HKZ E;  3Q24 A;  1SR3 A;  3MEF A;  2DUD A;  1LT6 D;  2UUB L;  4LF9 L;  1VQE A;  3PO2 G;  2KJX A;  3ERS X;  1VQ7 A;  4V19 0;  2JA8 B;  1TXY A;  3NQI A;  4QQB X;  3CCL A;  4A3B G;  3CCM A;  2Z6K A;  2RSO A;  1KDC A;  3FEW X;  1NMF A;  1PVO A;  4LF6 Q;  1DCZ A;  1AZQ A;  3BG3 A;  4JCV E;  4LF7 Q;  3MTS A;  1N34 Q;  5M3F G;  4C3J G;  4DR1 Q;  1QOH A;  3PIP 3;  1BCP B;  3D6C A;  2L55 A;  3H91 A;  1K8G A;  2LY7 A;  3K58 A;  3DM3 A;  2F0J A;  3HOX H;  1IBM L;  4GKK Q;  1F77 A;  4P72 A;  3GTL B;  5JJL A;  2I5H A;  4HSP A;  2E2D C;  3AEV A;  1YJN A;  4IAL A;  1AN8 A;  2IL8 A;  4DV4 Q;  3N52 A;  2B2W A;  1XPO A;  4AYB E;  3M4P A;  1SEB D;  5T1G A;  5I4D A;  3VYR A;  1VQN A;  2LS0 1;  4IOA A;  1R9T B;  1A8V A;  1DYQ A;  1N34 L;  4X3T A;  1NR2 A;  1BVS A;  3TRZ A;  1SMY C;  2K5H A;  2EYP A;  3KLW A;  3TME A;  1V1P A;  4QB4 A;  5E1F A;  2R92 B;  1HTL D;  5C3X A;  3OMC A;  3LWU A;  3PIO A;  3PF4 A;  3Q22 A;  1WOC A;  1I3Q H;  1AE2 A;  2QDL A;  4HTH A;  2O4X A;  3KOJ A;  1JOQ A;  4ZRZ A;  1SYB A;  1L0W A;  3A0J A;  4PMW A;  2A74 C;  1GUW A;  2JA6 G;  5EKL A;  1V8Q A;  3MVV A;  3QOL A;  2F0K A;  1SLJ A;  2RVL A;  5ELB A;  1SYD A;  1XTC D;  4IJL A;  1CM9 A;  1Y8O B;  4N9P A;  1VQ8 A;  1D6E C;  1S72 A;  1CKN B;  2K75 A;  3J80 L;  5JJK A;  1TVX A;  3M3Y B;  2F3V A;  2MQH A;  4A93 B;  1Q81 C;  3ULJ A;  3I4M G;  3OW7 A;  3I4N H;  1NY4 A;  1HZB A;  5KNC A;  2VZA A;  4MIU A;  2HD3 A;  1KRS A;  5C44 G;  2B29 A;  4BWG B;  1HHV A;  2E2J B;  1EY9 A;  4LUZ A;  4LFC L;  2IJ0 A;  4A3F H;  2ZTC A;  3Q0A A;  2ASB A;  2A6H C;  4QIW E;  3TP5 A;  4YY3 L;  1YHQ A;  1BNZ A;  3MAQ A;  5HY6 A;  2F52 A;  4R8I A;  1SYC A;  1S5D D;  4F88 A;  4FDB A;  4DUZ L;  1HZ9 A;  2HIV A;  4GLX A;  2VY3 A;  4JI6 Q;  5C44 B;  2WB1 E;  3H94 A;  4I65 A;  3KLR A;  2KEE A;  3OIQ A;  3I4M B;  1PH4 A;  1I94 L;  3U58 A;  5EKI A;  5EPK A;  3S17 B;  3OW2 A;  3IL8 A;  3WOF A;  2AWO A;  2UUA Q;  3GP7 A;  3SEB A;  5IT9 c;  1JE4 A;  1KDB A;  4A3B B;  1HZC A;  4WFN 3;  3TS0 A;  3G6E A;  2JA8 G;  4DK1 A;  3PUW A;  1GO3 E;  4N9T A;  1EY6 A;  3ER0 A;  3C2P A;  1XPU A;  4NB3 A;  5GAE C;  2OQ0 A;  2F4V L;  3L2P A;  1UE7 A;  3KJP A;  3OHX C;  4JI2 Q;  1K8M A;  4MN3 A;  3GTM H;  2HCI A;  4C56 C;  4HIO A;  4JBM A;  2KHI A;  4F8M A;  3I91 A;  2B2U A;  1I6H B;  3OSO A;  5C0X G;  4DNR B;  4PQX A;  3PV0 A;  1QUQ B;  2EJG C;  4LFA Q;  2DN8 A;  1A3T A;  1L0Y B;  1BR9 A;  1PFN A;  1Y8P B;  1UWV A;  3CQZ H;  2KOL A;  2NB0 A;  1O7L A;  2R93 B;  2WAC A;  5M5X B;  2F0U A;  1W3S A;  4A3D H;  3HKS A;  3AMU A;  1HRJ A;  2K03 A;  4R4T A;  5FKA C;  4QGU A;  3BDL A;  4PMC A;  1LT5 D;  2MFI A;  1U0L A;  5C6A A;  1S5B D;  2A69 C;  3EFX D;  4L5S A;  1T5E A;  1WTR A;  3PF5 A;  1DJR D;  1TS5 A;  2WV6 D;  2OQK A;  1Q46 A;  5IWA L;  4KJN A;  2BH8 A;  1VDZ A;  4NXN L;  5IWA Q;  3S16 B;  5LL6 S;  3P7J A;  4KK7 A;  5BN3 A;  4HCE A;  1ESF A;  5IYD G;  5ELD A;  2J4X A;  3K7A B;  4RWS C;  1GVP A;  2MO1 A;  3UDF A;  3KDF A;  2K04 A;  3GTM B;  1PDQ A;  1S5E D;  2R3Z A;  1PYW D;  2XWJ B;  1YHB A;  2JYO A;  3IAY A;  2NN6 G;  3T4A C;  2LXJ A;  3I7F A;  1RTO A;  2FIN B;  2B63 G;  5COY A;  1SE4 A;  1W6K A;  3KJO A;  4K0K Q;  4S3S A;  1K83 H;  3Q6S A;  4CDD C;  3LWE A;  2D62 A;  2XWB B;  3P1H A;  3G4S A;  4A3K G;  1K0R A;  3I2Z A;  1QWY A;  1KD1 C;  4KV6 A;  4JBK A;  1GXD C;  2EYJ A;  4ZAI A;  1X3E A;  1D8L A;  3A5Z B;  1KNE A;  3TBI B;  3I4O A;  1ML0 D;  4H7B A;  4YHH Q;  2WKD A;  3TP7 A;  5C4X B;  3I4N B;  1XX8 A;  4ZKC B;  2RDG A;  1B4O A;  4WOR A;  3JAM L;  3T56 B;  4DV1 Q;  4E6I A;  2PPB C;  2MUY A;  1PH2 A;  2UUA L;  1L1O C;  2KEN A;  4HJ5 A;  4B3T L;  1GUG A;  1RIP A;  2QEJ C;  4JI7 Q;  1IBK Q;  2AUK A;  3AFP A;  1I6H H;  5ELF A;  4HJ7 A;  3BDO A;  1JOR A;  3HRZ C;  2BOS A;  1LV9 A;  4XYO A;  1LTG D;  3S2H H;  5M5Y H;  2H4O A;  2DNC A;  1T5X D;  5FJ8 G;  1SE2 A;  2OF1 A;  3A8J E;  1LTB D;  2Z6K C;  5H1S E;  1Y69 U;  1I4G A;  3TQY A;  3TS2 A;  3F1Z A;  1CZG A;  1G29 1;  4EQN A;  3NXW A;  1HQR D;  5M3M B;  4DK6 C;  4HJ8 A;  1BOS A;  1WTP A;  4Z9C B;  3QJY A;  3M85 A;  3UE0 A;  4CDF C;  1VQ6 A;  5IYB H;  1JB7 A;  1IXR A;  3S17 H;  1K8A C;  4JI1 Q;  1WJJ A;  1Q82 C;  1ET6 A;  3PO3 B;  1H9S A;  2YTX A;  1H9S B;  1WTH A;  2FHT A;  3D31 A;  4KD4 A;  5E7N A;  2B2W C;  4A4I A;  1N32 Q;  4FF3 A;  4GNX A;  5JJI A;  2AHO B;  4DPG A;  3AU7 A;  2ZXP A;  3J81 c;  4BY1 G;  2NBF A;  3CME A;  4LUV A;  3HP3 A;  2IX0 A;  4AH6 A;  1P8L A;  3K0X A;  4K5W A;  3A7A B;  4X64 Q;  4UY8 C;  4BY7 H;  4OIJ A;  3I4L A;  1I5F A;  1YEZ A;  3EQL C;  4A3M H;  2EDG A;  1WFQ A;  4LJZ C;  1IBL Q;  1XNR Q;  1EY7 A;  3CP0 A;  3CCU A;  2QIL A;  5K5P A;  3DEP A;  5M3M H;  1XMQ L;  4UPA A;  3T1Y Q;  3GV6 A;  4R4C A;  3URY A;  3NK9 A;  3HEJ A;  2FXQ A;  4F7X A;  4DV3 Q;  3NP8 A;  1SSO A;  2K5N A;  1MJC A;  5D65 A;  4PZ8 A;  3J81 j;  1E24 A;  1VMP A;  1X9N A;  2AUJ D;  4XXE A;  5COR A;  1FYC A;  1F9S A;  4X3U A;  4DK3 C;  4XQJ A;  3GTJ H;  4DV4 L;  4JC0 A;  1YIT A;  3MXN A;  4DV6 L;  3T13 A;  1BQQ T;  1CT1 D;  3D4R A;  1HA5 A;  3VA7 A;  2WKC A;  1N33 Q;  4DV0 L;  1B3A A;  1D2B A;  2WII B;  4JI0 Q;  3UI2 A;  2PZW A;  2EXZ A;  2NUC A;  4LF8 L;  4H0L C;  1STY A;  2N8N A;  4BXX H;  4KY7 A;  1PH1 A;  3MFG A;  3RLF A;  2RA4 A;  2AKW B;  2RDH A;  3S2D B;  1Y1V B;  1WCM H;  2YU9 B;  3ULL A;  4X65 Q;  1RHP A;  3BU2 A;  2R7F A;  3CCQ A;  2HCC A;  3Q8D A;  4KY5 A;  2MNA A;  4LFB Q;  4X6A H;  1QCB D;  3PMF A;  4J15 A;  5M9O A;  5D14 A;  4CDC C;  2IY5 B;  2GVA A;  1NUC A;  4B3S Q;  2F0P A;  3A8I E;  2VL6 A;  2NVQ H;  3TSS A;  2F0W A;  4JI5 L;  4XIG S;  3M7G A;  4RAU C;  1CA6 A;  1WD1 A;  1IKL A;  2H5X A;  1VQB A;  3MC0 B;  4O42 A;  2G9H D;  3SXH A;  4OWT B;  5IOC A;  1GM5 A;  4XQN A;  1N32 L;  2CCZ A;  3ND8 A;  4ULL A;  3G7L A;  1PFM A;  1HFN A;  2L5T A;  1XNQ Q;  3J7A V;  1PMR A;  5IP7 H;  4A3C H;  4F87 A;  3EBE A;  4NXM L;  3BVM A;  1HNX Q;  5F2D A;  5JEA H;  3OWE B;  4QCL A;  5IY0 A;  4X3S A;  5LMU Q;  3S1Q H;  4FVM A;  2K01 A;  4P2C B;  1XYI A;  5CV7 A;  4AQY Q;  2VB3 X;  4DR4 Q;  1D5Z C;  1JB3 A;  1UUP A;  4ABN A;  3CCJ A;  4J6H A;  1NAP A;  4PZ7 A;  3RR5 A;  5C3E G;  2KCT A;  1FJG Q;  1R4P B;  1OXT A;  3B6Y A;  4U68 A;  4DV2 Q;  3OWF A;  4AYB B;  2H1E A;  5FLX E;  1FNW A;  4BBS G;  1ET9 A;  3K6O A;  1SRU A;  1I50 H;  3RZO B;  3CC7 A;  3BZD B;  2F0D A;  3HOV H;  4KLK A;  3SE0 A;  3GTO B;  1G6Z A;  4RGT A;  3T1H Q;  3BVZ A;  5EPL A;  2UU9 L;  4UP8 A;  3H3V I;  1VMC A;  4OX9 L;  4XYQ A;  2KVM A;  2E2I H;  2K5V A;  2PW5 A;  2K4K A;  4POF A;  4EVO A;  2E75 C;  5K36 G;  3PO2 B;  1AH9 A;  2B8G A;  3FRP B;  1CQV A;  2R93 G;  3CXC A;  3HOW G;  5KIX A;  4R4Q A;  5ELO A;  1C9O A;  3TN2 A;  2UXD Q;  5JOB A;  3DMU A;  2IPK D;  2QA4 A;  3P20 A;  4PG3 A;  1U4R A;  4DAV A;  1M4V A;  4HAE A;  2NVX H;  3CF5 A;  1X32 A;  1WD0 A;  4JI3 L;  1QVF A;  2RBM A;  2CQO A;  3I56 A;  1LTS D;  4BBS H;  1QG7 A;  2HQE A;  2A73 B;  2D2C C;  1MSH A;  1LYL A;  2VS1 A;  2SNS A;  1RJT A;  3GTO H;  2NVQ B;  2OEO A;  1PH9 A;  5FLX L;  1WTW A;  2R7Z G;  1PTO C;  2A68 C;  2UXD L;  2F4V Q;  3L7Z C;  3UDI A;  1BCP F;  1VQD A;  4CJ2 C;  2CH4 A;  4A93 G;  4A3D B;  3NQT A;  4KN7 C;  2EYF A;  2DY8 A;  1J5E L;  1LLR D;  3CQZ B;  3HOZ B;  5IIF A;  5C3E B;  1L1O A;  4DAM A;  4TSS A;  2XTI A;  2SNM A;  3NUC A;  1D1K A;  1STE A;  2K6A A;  4JOI C;  1V43 A;  3NTH A;  2CWP A;  5IE8 A;  2IX1 A;  4O1N A;  4JG2 A;  3GDE A;  3GQB A;  1PTO B;  2OCE A;  3I8Z A;  1PZI D;  1DOL A;  4LAA A;  4JI8 Q;  1FGU A;  4GNX B;  3K80 C;  2EIF A;  4R1J A;  2PMZ E;  4LFC Q;  4IFD I;  2L0C A;  5IGE A;  4JI3 Q;  3DXJ C;  1O78 A;  1EWH A;  2MJ8 A;  1QE6 A;  4A3B H;  5IYC G;  3ICE A;  4EQP A;  3FKI H;  4JI2 L;  2IW3 A;  3C46 A;  3MFY A;  2B2V C;  2JP1 A;  1I3Q B;  4L5T A;  2L12 A;  1EQR A;  4BBR G;  2ZM6 L;  1YHA A;  4DAY A;  4FF4 A;  4BY7 B;  3AFQ A;  1E2W A;  3ERO A;  2Q2H A;  4K8I A;  2JE6 I;  3D8G A;  5EPJ A;  1NBW A;  4KHZ A;  1Q12 A;  2EVB A;  2VXW A;  2CFM A;  5EBC A;  2HQL A;  3S1M H;  2C35 B;  1Y1V G;  3C1F A;  5EAY A;  2ZTE A;  1WTQ A;  1RF2 D;  4P71 A;  1F2L A;  5C4Z A;  3IFD A;  2EYL A;  2D9U A;  3EA6 A;  1BCP C;  5J22 A;  5BN5 A;  4WJ4 A;  3PCO B;  4MNO A;  3H0G B;  1B7Y B;  5D3I B;  3G6J B;  3KFU A;  1SYE A;  2CW0 D;  5IGB A;  5EJW A;  1GUT A;  1PHJ A;  2TSS A;  2F0M A;  3ZJY C;  4CHT B;  4NXN Q;  3D6W A;  2F0T A;  4B9X A;  5AFW A;  4BY7 G;  3X3N A;  1AFP A;  1Q8I A;  4RGO S;  2L4N A;  1CHQ D;  3S2H B;  1SYF A;  5C0X H;  1ONL A;  5JVG 3;  2KA7 A;  2VNU D;  2O2L D;  4A3I H;  2JA7 G;  5LHY 1;  3VR2 A;  2RDF A;  2K1B A;  3MHB A;  1BBX C;  4FYD A;  1PYS B;  3G71 A;  3SK8 A;  3S1M B;  4UHV A;  4HCS A;  4RCN A;  1YNJ C;  3HZX A;  3KBG A;  5GAG C;  3OIP A;  4KY6 A;  3CAM A;  4K8J A;  1KLU D;  3HOU G;  3D0F A;  4JV5 Q;  1HCZ A;  2MHV A;  4DV3 L;  4DGZ A;  5KYI A;  1HPC A;  5C4J B;  1WTX A;  3ITP A;  2NTS A;  3R3O A;  5DM6 3;  1N9W A;  4X66 L;  2UXB L;  4I7A A;  2UUC L;  4XTC S;  1F9P A;  1DZ1 A;  2JA6 B;  1JWU D;  4WJW A;  1S40 A;  1JJC B;  1EY5 A;  1QUQ A;  4X66 Q;  3VR4 A;  4GLA C;  4C3I G;  5I6W A;  1K0S A;  1Y1W H;  2UU9 Q;  1PFB A;  2PYK A;  2BCO A;  2XIW A;  2NN6 H;  3H0G G;  3MEH A;  1U5K A;  2Z9H A;  2WP8 J;  3J80 c;  1Q86 C;  1SNP A;  3FPP A;  2XNA C;  4YIJ A;  1VQK A;  2NVX B;  5FLX c;  4OWW B;  3KYH C;  4X65 L;  1GUN A;  2DGY A;  2JA8 H;  4KHP L;  1XJV A;  4IQZ A;  3WDN A;  1VCI A;  1WI5 A;  2K50 A;  3F2C A;  4CKC A;  3EJI A;  3PUY A;  4R9W A;  4CDE C;  2PNR C;  2OXP A;  5ELE A;  3HOW H;  1PYB A;  5IGD A;  3IKJ A;  4AYB G;  4MHE A;  2WAQ E;  4HMI A;  1IHZ A;  5GRO A;  1HNX L;  2CQA A;  2NVT H;  2LMC B;  3S14 B;  1KRT A;  3KUP A;  3QOJ A;  5M5W H;  1U9R A;  4IUP A;  4JPB W;  4A3E G;  4G57 A;  4LF9 Q;  5A2Q E;  4DNI A;  3M4Q A;  4O0A A;  4WRD A;  4JI7 L;  4Y7N B;  5CC4 A;  1RTN A;  1VQF A;  2F1M A;  4QIW B;  3M4O B;  3EN2 A;  1JJG A;  1VQC A;  4JYA Q;  4A3G H;  4C3H G;  2Z4I A;  2G9D A;  2RCF A;  1G2S A;  3CHB D;  5BN4 A;  2VUM H;  4KMU C;  4A75 A;  2PCF B;  3KF8 A;  1BF4 A;  4C3I B;  3H3V H;  2X6G A;  3PSI A;  1SND A;  3PQI A;  1PRT B;  1STN A;  2B2T C;  2JA5 H;  4FO2 A;  2F03 A;  5J3B A;  1YNJ D;  2A69 D;  1Z9F A;  4OEL B;  5CYU A;  1AZP A;  1DGS A;  2VB2 X;  4DAP A;  5I2X A;  1PRT D;  2EY6 A;  5LMN W;  2K33 A;  1KIX A;  1ICF B;  1N36 L;  2F3W A;  2KHS A;  4XQQ A;  3CW2 C;  3DEO A;  4KHV A;  2JA6 H;  2PZU A;  3TP8 A;  4JI1 L;  5I9O A;  5HUR A;  2YTY A;  1WYD A;  2CW0 C;  4DV6 Q;  1P16 A;  5M5X H;  2R61 A;  3K57 A;  3HKZ B;  1T9H A;  1KL9 A;  4C3H H;  1CKM A;  1EIF A;  1A63 A;  1HA6 A;  1O7I A;  1EEF D;  4QUF A;  5IP9 G;  4MTK A;  3HOZ H;  4IO9 A;  4EX5 A;  3S9W A;  2PQA B;  2ZJP A;  4LF7 L;  3L0O A;  2QCP X;  1TWC H;  4JBW A;  5LL6 X;  2K14 A;  3RMH A;  5CBA E;  2FMM A;  1II3 A;  2JA5 G;  3V2T A;  1YIJ A;  2PMZ B;  2F0V A;  5DAU A;  4OO1 H;  2NZ1 D;  4C3J H;  1QVC A;  2UUC Q;  1LUZ A;  2ZT9 C;  1LTR D;  4J8Q A;  3OTO L;  2QF7 A;  1SXT A;  4XDX A;  2J0T D;  1UE5 A;  2B2Y C;  2N88 A;  2V4D A;  4ODG A;  2ALY B;  3RNU A;  3A74 A;  4DV1 L;  2E2H H;  5E4W C;  1JJ2 A;  1JOK A;  3BVG A;  4XT3 B;  4RFB A;  2QW7 A;  1GHJ A;  4LFA L;  2E5L Q;  4GLV B;  2NZO A;  3QG1 A;  1UNS A;  4CGY B;  1LO5 D;  3K5O A;  4IFD H;  3HOZ G;  1LAC A;  1UAP A;  4DUY L;  1Y1W B;  1EFI D;  4DN4 M;  1EU4 A;  1TT2 A;  2D0P A;  2AQ1 B;  4GOP B;  1Q8K A;  1E2V A;  5C4J H;  1E3P A;  5IYC H;  1F2Z A;  3MZ5 A;  1XMO Q;  3D4D A;  2ENB A;  1EIG A;  5IYB G;  3JAM E;  4PZ6 A;  2F4I A;  4A3L G;  1PH5 A;  1GKH A;  2F0N A;  1M1K C;  2Z6B A;  2DY7 A;  4IOC A;  3W2D A;  3AB9 A;  4RGN A;  4JK1 C;  1GJX A;  5DM7 3;  3T1H L;  5EGT A;  1QJO A;  5FLM H;  1CSP A;  2OTJ A;  1BO0 A;  5JVH 3;  3SHL A;  2R6G A;  1UE6 A;  4K6L A;  1EYA A;  4B3M L;  2SOB A;  2XRQ D;  1PZJ D;  4IFD J;  5KEE A;  4Q0F A;  4A3D G;  1PZK D;  2JSO A;  4EQ5 A;  3M7N A;  5G3L D;  4DNT B;  1VF7 A;  3FKI B;  4YY3 Q;  5C0X J;  2MO0 A;  3HOW B;  1KQS A;  1DM0 B;  3KF8 B;  1GHK A;  4OIK A;  1EEI D;  3DM1 A;  1FNV A;  4YCV A;  5EQ0 A;  1LTL A;  2JQO A;  1K8O A;  3MXU A;  3J81 L;  4ZKB B;  4JVZ A;  1SFO B;  2N49 A;  3MXG A;  1D7Q A;  2RSN A;  4OL7 A;  3I73 A;  4NXM Q;  2EJM A;  5IYD H;  4HID A;  2KCN A;  2E74 C;  5JEA J;  3J81 i;  1Q3L A;  1A62 A;  4DV7 Q;  4K6D A;  3W5O A;  1TWH B;  1PH3 A;  2RQX A;  1X56 A;  4NW2 A;  1O80 A;  3HOY G;  2HHH Q;  1CK1 A;  4L6T B;  1EY8 A;  1VQI A;  5A2Q L;  2QDB A;  1PH7 A;  5C4X H;  1B3Q A;  3E9I A;  1YNN C;  4RKB A;  4QY7 A;  1STA A;  3VR3 A;  1DOM A;  1KDA A;  4EQO A;  1RD9 D;  4RGM A;  2L9H A;  2Z4H A;  3J7Z C;  5K36 H;  1ASY A;  1D5M C;  1E22 A;  4HIM A;  4BBR B;  1Q1E A;  4GZY C;  2Z0S A;  2ICE C;  4CKB A;  4DFA A;  4KD3 A;  4L5R C;  1Q90 A;  5GQO A;  4DXG A;  2DJF C;  4X3K A;  2KEC A;  2B63 H;  4M1U B;  4ME5 A;  5FOB B;  3K7U C;  4Q5V A;  3HOY B;  4BS9 A;  4JI6 L;  4KJO A;  3MA2 B;  1PFS A;  4DV5 Q;  4OHJ A;  2LXK A;  3K8A A;  1GUS A;  1H9J A;  1KAW A;  1FL0 A;  2F3I A;  2Z8L A;  4YWK A;  5I6Y A;  3HOY H;  1EUJ A;  1YZ6 A;  2EXD A;  2FMC A;  2TMP A;  1S5F D;  2WAQ B;  1H9M A;  4K2K A;  1N36 Q;  4DR4 L;  3K7A H;  4HJA A;  4RCO A;  2NZH A;  2Q2I A;  4TVA B;  1EWC A;  3D4W A;  2Y0S E;  3FPU B;  3U9O A;  5JEA G;  3H3V C;  1TR5 A;  3U4V A;  1KAB A;  2WAQ G;  1PA6 A;  2RHQ B;  1I50 B;  3RZO H;  3TZD A;  2E5L L;  4P73 A;  1U4M A;  1E1T A;  1EQT A;  3G48 A;  3HOX G;  1KNA A;  1ENC A;  1M8A A;  1IZ6 A;  3A56 A;  4YCU A;  4QL5 A;  4MZ9 A;  4RMF A;  1PV4 A;  2B39 A;  4TRD A;  1VQH A;  4A3E H;  1LTA D;  4I7Z C;  3P75 A;  5FJ8 H;  1JE5 A;  3OTO Q;  3S24 A;  2KBN A;  3S1Q B;  3I72 A;  3E3X A;  1QB5 D;  2IHF A;  2KCM A;  2ES2 A;  1Y14 B;  1YBY A;  4DAY B;  2X6L A;  3J7Y W;  4KN4 C;  4CJ1 B;  3IFT A;  4P75 A;  2XVS A;  5I2Y A;  1IKM A;  2M00 A;  5DLQ E;  1B70 B;  2E2I B;  4RG1 A;  2LSS A;  1X3F A;  4GN3 B;  4OO1 G;  1HNZ L;  4DR6 Q;  1HR0 Q;  2VUM B;  4IUV A;  1CQF A;  1JCK B;  2ZJR A;  2A6H D;  1W6J A;  1H95 A;  2I46 A;  1JWM D;  4DKA C;  4CKE A;  5FO8 B;  4LF6 L;  2K32 A;  3CKI B;  3QWN A;  2DNE A;  4JI4 Q;  3NTK A;  5M3F H;  3V96 A;  4BY1 H;  2HT1 A;  4OXP A;  1SAP A;  2JXM B;  5IGF A;  1F2Y A;  1QZG A;  4LNQ A;  1TWG B;  1G2T A;  3R93 A;  2AQ2 B;  4OEM B;  3VDY A;  3HG9 A;  2Z1C A;  1X6O A;  1HFG A;  3ULP A;  1J8I A;  5FK9 C;  4DR6 L;  3S14 H;  2NVT B;  2WB1 G;  4N8F A;  5JPM C;  5E3F A;  3NBH B;  2L15 A;  4DR5 L;  4ILW A;  1LM0 A;  3E5S A;  2F0H A;  1HR0 W;  3UDX A;  3BZC A;  5C3W A;  1MIU A;  1C48 A;  4IUT A;  2SEB D;  4YCW A;  3A54 A;  4LFB L;  3NBI A;  4A3F G;  2XGT A;  4WJ3 M;  4G7Z C;  1HUM A;  4Y52 H;  1HQM C;  5FLM G;  4DR5 Q;  1C4Q A;  2N78 A;  3HKZ G;  1UEA B;  1LAB A;  3PO3 G;  4LF8 Q;  1LT3 D;  1HNW L;  4CJ0 B;  1K9M C;  1TWA B;  1X54 A;  4PNY A;  2WB1 B;  3VYS A;  3SDZ A;  1CZW A;  4B3R Q;  2NYZ D;  1L1O B;  4UP7 A;  3FHW A;  2VQF L;  1STH A;  4LW1 A;  1JWS D;  1L2F A;  2K05 A;  3PUX A;  3J80 E;  1CHP D;  4FXG C;  5ELC A;  4FXD A;  4A3F B;  1EY4 A;  3UE1 A;  4DR3 Q;  2IX3 A;  3QO2 A;  4B9W A;  4GKJ L;  2N55 A;  1MJE A;  2PO4 A;  1JC7 A;  1IYV A;  1IL8 A;  2JN4 A;  2SDF A;  3MXP A;  1KHI A;  1IBL L;  1XNR L;  2GA4 B;  1KC8 C;  4IPD A;  4JOI A;  5KGU A;  5KRU A;  5M3F B;  1B50 A;  3TDQ A;  4B08 A;  2I5L X;  4QJF A;  4C2M H;  1VQP A;  2UXB Q;  1G6P A;  1OTC A;  1YVC A;  2F0E A;  4DR7 L;  1TII D;  5EKK A;  4YWM A;  1QNK A;  1TKW B;  5AJ3 Q;  1NTG A;  2ID0 A;  1CFM A;  1MI2 A;  2WIN B;  4DR2 Q;  4K14 A;  1J6Q A;  3A7L A;  4L63 B;  4RKL A;  3HOV G;  1BCP D;  5EBD A;  3S1N B;  3I4N G;  2ICI A;  1VF5 C;  3F2B A;  3RN2 A;  2CWA A;  2I5M X;  2F0L A;  3AQQ A;  3X3M A;  2F0G A;  2HHH L;  2B2V A;  2B2U C;  3M9B A;  2K7V A;  3CD6 A;  4DK0 A;  4L8J A;  2NVY B;  2BDN A;  3C1E A;  1RCV D;  3BS1 A;  1EYG A;  1HZA A;  4A3E B;  4OWX B;  1EU3 A;  4POG A;  1F2M A;  3WWV A;  4JBJ A;  2O5J C;  1L0X B;  2EQS A;  3QR8 A;  1I94 Q;  5ELN A;  2RKS A;  3TZU A;  1B9N A;  2XN9 C;  3GTQ H;  3HOX B;  4B3M Q;  1EIY B;  2Q2U A;  3EVQ A;  5BR8 L;  2RHS B;  5LMN Q;  1A2T A;  2KUM A;  3KBX A;  4B3T Q;  3VR5 A;  3RD4 A;  2Q8I B;  2K5W A;  1J5E Q;  1A0I A;  4FNF A;  2UXC L;  4HR7 B;  2RF4 A;  1S5C D;  1U4P A;  1PTO H;  5G3L F;  1E0B A;  4LF5 Q;  5NUC A;  2ZJQ A;  1DON A;  2NWG A;  2K28 A;  4UP9 A;  1ICW A;  5DEH A;  4V0B A;  2YV5 A;  4UAI A;  4J1M A;  3PGZ A;  1EY0 A;  2Y0S B;  4FF1 A;  1A6X A;  3RLO A;  1RKN A;  4CBV A;  1JMC A;  4FF2 A;  3PUZ A;  1Q7Y C;  3CPW A;  3GTG H;  1STB A;  4K0K L;  1XMO L;  4DA2 A;  1H9K A;  5IT9 E;  4C3H B;  2HIX A;  2A19 A;  2KHJ A;  2LFN A;  1RL2 A;  4LF4 Q;  4C2M B;  3OOC A;  3O13 A;  5C4H A;  1NR4 A;  2EYM A;  1K3R A;  3U4Z A;  1SNC A;  1TY2 A;  2Y0S G;  3Q23 A;  4DUY Q;  4HMJ A;  1DD2 A;  2QKI C;  1BBU A;  4UDU C;  1IW7 D;  3V05 A;  2RCN A;  3NEL A;  5GAD C;  4ME3 A;  1X65 A;  2NTT A;  2V1C C;  1FR3 A;  3NHH A; 
#chains in the Genus database with same CATH homology
 4IN3 A;  4RH6 A;  1CTM A;  3KLS A;  2HUG A;  1J9O A;  3D3R A;  1YNN D;  3M4Y A;  4BA1 I;  2BE5 C;  3L3O C;  2CHB D;  4ZUJ A;  1K83 B;  2FJ2 A;  1OXS C;  4QUC A;  3C3L A;  3FVQ A;  3HOU B;  2D5D A;  4KKU A;  2E2H B;  3HGB A;  1C8C A;  1ZXT A;  3OMG A;  2B63 B;  4IFD G;  2KED A;  2IT1 A;  2O5I C;  5FO7 B;  1I4X A;  1EZ6 A;  1G8Z D;  3K5M A;  5J39 A;  1H9R A;  1DXM A;  1S4Z A;  1PTO F;  3W3A A;  5C5L A;  1Q1B A;  1LTT D;  4FP5 D;  1PLF A;  1DOK A;  1I4Q A;  4ZQ3 A;  4H13 C;  1STG A;  1I4H A;  3VYT A;  5I9P A;  2ZXR A;  3GTG B;  4KI0 A;  4XT1 B;  1GUO A;  4ID6 A;  2B8F A;  4BY1 B;  3DWA A;  1B9M A;  1X3Q A;  3E0J A;  1D1I A;  3K59 A;  3SR1 A;  2B2T A;  1SJH D;  5CV5 A;  3CRL C;  1KLG D;  1TS2 A;  4R8N A;  2I07 B;  3NBH A;  1ILP A;  1PTO D;  3DWQ A;  3GD7 A;  4DXF A;  1F9R A;  1EIH A;  2EY2 A;  4KKS A;  1ENF A;  4FXK C;  3KLS X;  1Z47 A;  1WCM B;  5HGT A;  1O7Z A;  4LK1 C;  2IWH A;  3GO5 A;  3SK5 A;  2PW7 A;  1ROD A;  3FMC A;  2B2Y A;  2HDM A;  3E6Z X;  5ISR A;  2Q8R E;  3K5L A;  3WOE A;  3DWP A;  3NPP A;  1B44 D;  2EOT A;  3MWY W;  5C5M A;  1ILQ A;  3A55 A;  4C1N I;  1BXT A;  1IYU A;  1A3V A;  5T1I A;  2K5D A;  5KNB A;  1WVL A;  2PZT A;  2L1B A;  3KK7 A;  1SMY D;  3GTP B;  4ZK9 B;  1V1O A;  4BBS B;  4K2L A;  2Q8T A;  1EOT A;  2A6E D;  3NE5 B;  2R7Z B;  4ZUI A;  5M5Y B;  4C1N K;  4K5X A;  1SBB B;  4U67 3;  2A68 D;  2X69 A;  2J7Z A;  3H6M A;  2F0S A;  2OT2 A;  3PUV A;  5D3D A;  1SJE D;  3QB3 A;  2MP1 A;  4A3M B;  3ZYY X;  5CV8 A;  1BDO A;  4A3G B;  5IT9 L;  3HOV B;  3RZD B;  3GTQ B;  5IGG A;  5CV4 A;  1HUN A;  3LNN A;  2XRS D;  3CU7 A;  5A35 A;  3H09 A;  1KTK A;  3NSW A;  4NDX A;  4HED A;  3QIA A;  3N6R A;  4TQU S;  2NN6 I;  1V1P B;  4KKT A;  4IZ8 A;  3A8K E;  2EY5 A;  3I70 A;  5CBE E;  4NMZ A;  1I6V C;  2F0O A;  1EYC A;  5JPN C;  2YYZ A;  1XXG A;  3CRK C;  1EZ8 A;  4BA2 I;  4IUU A;  1NSN S;  2ZXO A;  5FO9 B;  1TQO A;  4RHR A;  1ESR A;  4ZYS A;  3SK4 A;  3ONA B;  1A2U A;  1KAA A;  3BYT B;  4IUN A;  1FNU A;  2EPB A;  2JEA I;  1SNM A;  2PQE A;  1TY0 A;  1G91 A;  1HXY D;  3NWS A;  2HDL A;  3R8B A;  3I3C A;  5CV6 A;  5CGK A;  1FGB D;  3SK6 A;  1AEX A;  4A3J B;  5E4X A;  3J7A F;  1SE3 A;  2KQ3 A;  1MD2 D;  2M9V A;  1A3U A;  1ZKO A;  5KND A;  1TWF B;  2BE5 D;  2XSC A;  2E76 C;  2CVR A;  1B1Z A;  4G4K A;  1O7Y A;  3GV3 A;  1NCV A;  4IUR A;  4TKO B;  1Z6H A;  1B53 A;  1XWE A;  1HTP A;  3VA5 A;  2M2L A;  3GTJ B;  1OXX K;  5CR3 A;  1TS3 A;  3BDC A;  4NP5 A;  4IUQ A;  4HN7 A;  1ZYR D;  1CI3 M;  1LTI D;  1X3P A;  4QF4 A;  5C0X I;  4G7O C;  2EYH A;  4DF7 A;  1IW7 C;  2A5H A;  1GOZ A;  4NKL A;  1Z7T A;  5KYL A;  1EYD A;  1BUV T;  3I90 A;  2AQ3 B;  4M8A A;  1RDP D;  1TWC B;  4OO1 I;  1I4R A;  2AWN A;  2L11 A;  3L9A X;  2F0I A;  5IOD A;  3S1R B;  3OPO A;  1LT4 D;  1EQV A;  3HS0 C;  3K5N A;  3ND9 A;  4ZLT F;  1QNU A;  3VR6 A;  4G7H C;  1AW7 A;  3LX0 A;  4OGQ C;  1ENA A;  1WTO A;  1AP0 A;  4C3J B;  2EY1 A;  4RHS A;  3J81 E;  3GTK B;  1WTV A;  1JOO A;  1OO9 B;  1PRT F;  3NTI A;  2JA5 B;  2C5C A;  3NWT A;  2MGS A;  1SNQ A;  5CMD A;  2JEB I;  5IGC A;  4H44 C;  1OXU A;  2BDO A;  5J1Z A;  1TS4 A;  2BA0 A;  3BYY B;  3DHQ A;  4PMB A;  1PRT C;  4PV1 C;  5M5W B;  2A6E C;  3ERQ A;  2EJF C;  3U9S A;  1OXV A;  4A3I B;  1QIL A;  3DUZ A;  2K5Q A;  3S15 B;  1MGS A;  2EYO A;  5TSS A;  3T53 B;  3FDT A;  1SYG A;  5DNF A;  1R4Q B;  1ZEQ X;  1JQY D;  5JAV A;  3T51 B;  2MPM A;  1A15 A;  3TP6 A;  2FFK B;  3K0Y A;  1Y8N B;  3SVM A;  4LMQ D;  4RA8 A;  2C9O A;  1U4L A;  4KTA A;  1JIC A;  5JJZ A;  1EL0 A;  3F2U A;  2KCC A;  1MSG A;  2BA1 A;  3RUZ A;  3R2T A;  1CA5 A;  2F0F A;  2EZV A;  2LKV A;  3PIO 3;  1SNO A;  3R2I A;  1TU2 B;  1B2T A;  1I4P A;  1MBY A;  5CV9 A;  2F0Q A;  1F9Q A;  3VYU A;  1E2Z A;  4DU9 A;  1SDF A;  4QMG A;  4EGV A;  2JA7 B;  3T16 A;  2EE1 A;  1FD7 D;  4A3K B;  1ZYR C;  1D5X C;  4HSV A;  1PXU A;  1JR0 D;  4K5V A;  3Q24 A;  1LT6 D;  2KJX A;  4V19 0;  2JA8 B;  3NQI A;  2RSO A;  1KDC A;  3FEW X;  1DCZ A;  1AZQ A;  3BG3 A;  3MTS A;  4C3J G;  1QOH A;  3PIP 3;  1BCP B;  3D6C A;  2L55 A;  3H91 A;  2LY7 A;  3K58 A;  2F0J A;  1F77 A;  3GTL B;  4HSP A;  2E2D C;  4IAL A;  1AN8 A;  2IL8 A;  3N52 A;  2B2W A;  1SEB D;  5T1G A;  5I4D A;  3VYR A;  2LS0 1;  1R9T B;  1DYQ A;  4X3T A;  1NR2 A;  1SMY C;  2EYP A;  3TME A;  1V1P A;  4QB4 A;  5E1F A;  2R92 B;  1HTL D;  5C3X A;  3OMC A;  3LWU A;  3Q22 A;  4HTH A;  2O4X A;  1JOQ A;  4ZRZ A;  1SYB A;  4PMW A;  2A74 C;  1GUW A;  5EKL A;  1V8Q A;  3MVV A;  3QOL A;  2F0K A;  2RVL A;  5ELB A;  1SYD A;  1XTC D;  1CM9 A;  1Y8O B;  4N9P A;  1D6E C;  3J80 L;  1TVX A;  3M3Y B;  2F3V A;  4A93 B;  3OW7 A;  5KNC A;  4MIU A;  4BWG B;  1HHV A;  2E2J B;  1EY9 A;  2IJ0 A;  3Q0A A;  2A6H C;  3TP5 A;  1BNZ A;  3MAQ A;  4R8I A;  1SYC A;  1S5D D;  4F88 A;  5C44 B;  3H94 A;  4I65 A;  3KLR A;  2KEE A;  3OIQ A;  3I4M B;  5EKI A;  5EPK A;  3S17 B;  3IL8 A;  3WOF A;  2AWO A;  3GP7 A;  3SEB A;  1JE4 A;  1KDB A;  4A3B B;  4WFN 3;  4DK1 A;  3PUW A;  4N9T A;  1EY6 A;  3C2P A;  3OHX C;  1K8M A;  4MN3 A;  2HCI A;  4C56 C;  4F8M A;  3I91 A;  2B2U A;  1I6H B;  3OSO A;  5C0X G;  4DNR B;  4PQX A;  3PV0 A;  2EJG C;  2DN8 A;  1A3T A;  1L0Y B;  1BR9 A;  1PFN A;  1Y8P B;  2KOL A;  2NB0 A;  1O7L A;  2R93 B;  2WAC A;  5M5X B;  2F0U A;  3AMU A;  1HRJ A;  2K03 A;  5FKA C;  3BDL A;  4PMC A;  1LT5 D;  5C6A A;  1S5B D;  2A69 C;  3EFX D;  1T5E A;  1WTR A;  1DJR D;  1TS5 A;  2WV6 D;  4KJN A;  1VDZ A;  3S16 B;  5LL6 S;  3P7J A;  4KK7 A;  5BN3 A;  4HCE A;  1ESF A;  5ELD A;  2J4X A;  3K7A B;  4RWS C;  2K04 A;  3GTM B;  1PDQ A;  1S5E D;  2R3Z A;  1PYW D;  2XWJ B;  2JYO A;  3IAY A;  2NN6 G;  3T4A C;  1RTO A;  2FIN B;  5COY A;  1SE4 A;  1W6K A;  4S3S A;  3Q6S A;  3LWE A;  2D62 A;  2XWB B;  3P1H A;  1QWY A;  4KV6 A;  1GXD C;  2EYJ A;  4ZAI A;  1KNE A;  3TBI B;  1ML0 D;  4H7B A;  2WKD A;  3TP7 A;  5C4X B;  3I4N B;  1XX8 A;  4ZKC B;  2RDG A;  1B4O A;  4WOR A;  3JAM L;  3T56 B;  4E6I A;  2PPB C;  2MUY A;  1GUG A;  2QEJ C;  2AUK A;  5ELF A;  3BDO A;  1JOR A;  3HRZ C;  2BOS A;  1LV9 A;  4XYO A;  1LTG D;  2H4O A;  2DNC A;  1T5X D;  1SE2 A;  2OF1 A;  3A8J E;  1LTB D;  1Y69 U;  1I4G A;  1CZG A;  1G29 1;  4EQN A;  3NXW A;  1HQR D;  5M3M B;  1BOS A;  1WTP A;  4Z9C B;  3QJY A;  3M85 A;  1ET6 A;  3PO3 B;  1H9S A;  3D31 A;  1H9S B;  2FHT A;  4KD4 A;  2B2W C;  4FF3 A;  3AU7 A;  2ZXP A;  2NBF A;  3HP3 A;  2IX0 A;  4K5W A;  3A7A B;  3I4L A;  4OIJ A;  3EQL C;  2EDG A;  4LJZ C;  1EY7 A;  2QIL A;  5K5P A;  3DEP A;  3GV6 A;  3URY A;  3NK9 A;  3HEJ A;  4F7X A;  3NP8 A;  1SSO A;  5D65 A;  1VMP A;  2AUJ D;  4XXE A;  5COR A;  1FYC A;  1F9S A;  4X3U A;  4XQJ A;  3MXN A;  3T13 A;  1BQQ T;  1CT1 D;  3D4R A;  1HA5 A;  3VA7 A;  2WKC A;  1B3A A;  1D2B A;  2WII B;  3UI2 A;  2PZW A;  2EXZ A;  2NUC A;  4H0L C;  1STY A;  4KY7 A;  3MFG A;  3RLF A;  2RA4 A;  2RDH A;  3S2D B;  1Y1V B;  2YU9 B;  1RHP A;  2HCC A;  4KY5 A;  1QCB D;  3PMF A;  5M9O A;  5D14 A;  1NUC A;  2F0P A;  3A8I E;  3TSS A;  2F0W A;  4XIG S;  3M7G A;  4RAU C;  1CA6 A;  1WD1 A;  1IKL A;  3MC0 B;  4O42 A;  2G9H D;  3SXH A;  5IOC A;  4XQN A;  3ND8 A;  4ULL A;  3G7L A;  1PFM A;  1HFN A;  2L5T A;  3J7A V;  1PMR A;  4F87 A;  3BVM A;  5F2D A;  5JEA H;  3OWE B;  4QCL A;  4X3S A;  4FVM A;  2K01 A;  4P2C B;  1XYI A;  5CV7 A;  2VB3 X;  1D5Z C;  1JB3 A;  1UUP A;  4ABN A;  4J6H A;  1NAP A;  1R4P B;  1OXT A;  4U68 A;  3OWF A;  4AYB B;  2H1E A;  5FLX E;  1FNW A;  1ET9 A;  3K6O A;  3RZO B;  3BZD B;  2F0D A;  3SE0 A;  3GTO B;  1G6Z A;  4RGT A;  3BVZ A;  5EPL A;  1VMC A;  4XYQ A;  2KVM A;  2PW5 A;  4EVO A;  2E75 C;  5K36 G;  3PO2 B;  2B8G A;  3FRP B;  1CQV A;  5KIX A;  3TN2 A;  5JOB A;  3DMU A;  2IPK D;  3P20 A;  1U4R A;  4DAV A;  1M4V A;  4HAE A;  1X32 A;  1WD0 A;  2RBM A;  1LTS D;  1QG7 A;  2HQE A;  2A73 B;  2D2C C;  1MSH A;  2SNS A;  1RJT A;  2NVQ B;  2OEO A;  5FLX L;  1WTW A;  1PTO C;  2A68 C;  3L7Z C;  1BCP F;  4CJ2 C;  4A3D B;  3NQT A;  2EYF A;  2DY8 A;  4KN7 C;  1LLR D;  3CQZ B;  3HOZ B;  5IIF A;  5C3E B;  4TSS A;  3NUC A;  2SNM A;  1D1K A;  1STE A;  2K6A A;  1V43 A;  3NTH A;  2IX1 A;  4O1N A;  3GQB A;  1PTO B;  3I8Z A;  1PZI D;  1DOL A;  4LAA A;  4IFD I;  2L0C A;  5IGE A;  3DXJ C;  1O78 A;  1EWH A;  2MJ8 A;  1QE6 A;  4EQP A;  2IW3 A;  3C46 A;  3MFY A;  2B2V C;  2JP1 A;  1I3Q B;  2L12 A;  4FF4 A;  4DAY A;  4BY7 B;  1E2W A;  3ERO A;  4K8I A;  2JE6 I;  3D8G A;  5EPJ A;  1Q12 A;  2EVB A;  2VXW A;  4KHZ A;  5EBC A;  3C1F A;  1WTQ A;  1RF2 D;  1F2L A;  5C4Z A;  3IFD A;  2EYL A;  2D9U A;  3EA6 A;  1BCP C;  5J22 A;  5BN5 A;  3H0G B;  5D3I B;  3G6J B;  1SYE A;  2CW0 D;  5IGB A;  5EJW A;  1GUT A;  2TSS A;  2F0M A;  4CHT B;  3D6W A;  2F0T A;  4B9X A;  5AFW A;  3X3N A;  1AFP A;  1Q8I A;  4RGO S;  2L4N A;  1CHQ D;  3S2H B;  1SYF A;  5C0X H;  1ONL A;  5JVG 3;  2KA7 A;  2VNU D;  2O2L D;  5LHY 1;  3VR2 A;  2RDF A;  2K1B A;  3MHB A;  1BBX C;  4FYD A;  3SK8 A;  3S1M B;  4HCS A;  4RCN A;  1YNJ C;  3HZX A;  3KBG A;  3OIP A;  4KY6 A;  4K8J A;  1KLU D;  1HCZ A;  2MHV A;  4DGZ A;  5KYI A;  1HPC A;  5C4J B;  1WTX A;  3ITP A;  2NTS A;  3R3O A;  5DM6 3;  4XTC S;  1F9P A;  1DZ1 A;  2JA6 B;  1JWU D;  4WJW A;  1EY5 A;  3VR4 A;  4C3I G;  5I6W A;  1PFB A;  2PYK A;  2BCO A;  2XIW A;  2NN6 H;  3MEH A;  2WP8 J;  1SNP A;  3FPP A;  2XNA C;  4YIJ A;  2NVX B;  1GUN A;  4IQZ A;  3WDN A;  1VCI A;  4CKC A;  3EJI A;  3PUY A;  4R9W A;  2PNR C;  2OXP A;  5ELE A;  5IGD A;  3IKJ A;  4MHE A;  4HMI A;  1IHZ A;  2CQA A;  3S14 B;  2LMC B;  3KUP A;  3QOJ A;  1U9R A;  4IUP A;  4G57 A;  5A2Q E;  4WRD A;  4Y7N B;  5CC4 A;  1RTN A;  2F1M A;  4QIW B;  3M4O B;  4C3H G;  2Z4I A;  2G9D A;  1G2S A;  3CHB D;  5BN4 A;  4KMU C;  2PCF B;  3KF8 A;  1BF4 A;  4C3I B;  2X6G A;  1SND A;  1PRT B;  1STN A;  2B2T C;  4FO2 A;  2F03 A;  1YNJ D;  2A69 D;  5CYU A;  1AZP A;  2VB2 X;  4DAP A;  5I2X A;  1PRT D;  2EY6 A;  2K33 A;  2F3W A;  2KHS A;  4XQQ A;  3DEO A;  4KHV A;  2PZU A;  3TP8 A;  5I9O A;  5HUR A;  2CW0 C;  2R61 A;  3K57 A;  3HKZ B;  1HA6 A;  1EEF D;  4QUF A;  3S9W A;  4JBW A;  2QCP X;  5LL6 X;  3RMH A;  5CBA E;  2FMM A;  1II3 A;  3V2T A;  2PMZ B;  2F0V A;  5DAU A;  4OO1 H;  2NZ1 D;  2ZT9 C;  1LTR D;  4J8Q A;  2QF7 A;  1SXT A;  4XDX A;  2J0T D;  2B2Y C;  2N88 A;  2V4D A;  4ODG A;  5E4W C;  1JOK A;  3BVG A;  4XT3 B;  4RFB A;  1GHJ A;  3QG1 A;  1UNS A;  4CGY B;  1LO5 D;  3K5O A;  4IFD H;  1LAC A;  1UAP A;  1Y1W B;  1EFI D;  4DN4 M;  1EU4 A;  1TT2 A;  2AQ1 B;  1E2V A;  1F2Z A;  3MZ5 A;  3D4D A;  2ENB A;  1EIG A;  3JAM E;  2F4I A;  2F0N A;  2DY7 A;  3W2D A;  3AB9 A;  4RGN A;  4JK1 C;  1GJX A;  5DM7 3;  5EGT A;  1QJO A;  1BO0 A;  5JVH 3;  3SHL A;  2R6G A;  4K6L A;  1EYA A;  2SOB A;  2XRQ D;  1PZJ D;  4IFD J;  5KEE A;  4Q0F A;  1PZK D;  2JSO A;  3M7N A;  5G3L D;  4DNT B;  1VF7 A;  3FKI B;  5C0X J;  3HOW B;  1DM0 B;  1GHK A;  4OIK A;  1EEI D;  3DM1 A;  1FNV A;  5EQ0 A;  1K8O A;  3MXU A;  3J81 L;  4ZKB B;  1SFO B;  3MXG A;  2RSN A;  4OL7 A;  3I73 A;  2EJM A;  2KCN A;  2E74 C;  5JEA J;  1Q3L A;  4K6D A;  1TWH B;  2RQX A;  4NW2 A;  1O80 A;  1CK1 A;  4L6T B;  1EY8 A;  5A2Q L;  2QDB A;  4RKB A;  1YNN C;  1STA A;  3VR3 A;  1DOM A;  1KDA A;  4EQO A;  1RD9 D;  4RGM A;  2L9H A;  2Z4H A;  5K36 H;  1D5M C;  4BBR B;  1Q1E A;  4GZY C;  2ICE C;  4CKB A;  4DFA A;  4KD3 A;  1Q90 A;  4DXG A;  4X3K A;  2KEC A;  4M1U B;  4ME5 A;  5FOB B;  4Q5V A;  3HOY B;  4BS9 A;  4KJO A;  3MA2 B;  4OHJ A;  1GUS A;  1H9J A;  2Z8L A;  5I6Y A;  2FMC A;  2TMP A;  1S5F D;  2WAQ B;  1H9M A;  4K2K A;  4RCO A;  1EWC A;  3D4W A;  3FPU B;  3U9O A;  5JEA G;  3H3V C;  1TR5 A;  1KAB A;  1I50 B;  3TZD A;  1U4M A;  1EQT A;  1KNA A;  1ENC A;  1M8A A;  3A56 A;  2B39 A;  4TRD A;  1LTA D;  4I7Z C;  3P75 A;  3S1Q B;  3I72 A;  1QB5 D;  2X6L A;  3J7Y W;  4KN4 C;  4CJ1 B;  3IFT A;  2XVS A;  5I2Y A;  1IKM A;  2M00 A;  2E2I B;  4OO1 G;  2VUM B;  4IUV A;  1CQF A;  1JCK B;  2A6H D;  1W6J A;  2I46 A;  1JWM D;  4CKE A;  5FO8 B;  2K32 A;  3CKI B;  3QWN A;  2DNE A;  3NTK A;  3V96 A;  5IGF A;  1SAP A;  2JXM B;  1F2Y A;  1TWG B;  1G2T A;  3R93 A;  2AQ2 B;  3HG9 A;  2Z1C A;  1HFG A;  1J8I A;  5FK9 C;  2NVT B;  5JPM C;  5E3F A;  4ILW A;  3E5S A;  2F0H A;  5C3W A;  1C48 A;  4IUT A;  2SEB D;  3A54 A;  3NBI A;  4G7Z C;  1HUM A;  1HQM C;  1C4Q A;  1UEA B;  1LAB A;  1LT3 D;  4CJ0 B;  1TWA B;  4PNY A;  2WB1 B;  3VYS A;  3SDZ A;  1CZW A;  2NYZ D;  1STH A;  1JWS D;  2K05 A;  3PUX A;  3J80 E;  1CHP D;  4FXG C;  5ELC A;  4FXD A;  4A3F B;  1EY4 A;  2IX3 A;  3QO2 A;  4B9W A;  2N55 A;  2PO4 A;  1JC7 A;  1IYV A;  1IL8 A;  2SDF A;  3MXP A;  2GA4 B;  5KRU A;  5KGU A;  5M3F B;  1B50 A;  3TDQ A;  4B08 A;  2F0E A;  1TII D;  5EKK A;  1QNK A;  1TKW B;  2ID0 A;  1CFM A;  1MI2 A;  2WIN B;  4K14 A;  3A7L A;  4L63 B;  4RKL A;  1BCP D;  5EBD A;  3S1N B;  2ICI A;  1VF5 C;  2F0L A;  3X3M A;  2F0G A;  2B2V A;  2B2U C;  2K7V A;  4DK0 A;  4L8J A;  2NVY B;  2BDN A;  3C1E A;  1RCV D;  3BS1 A;  4A3E B;  1EU3 A;  1F2M A;  2O5J C;  1L0X B;  2RKS A;  3TZU A;  1B9N A;  2XN9 C;  3HOX B;  3EVQ A;  1A2T A;  2KUM A;  3KBX A;  3VR5 A;  3RD4 A;  2Q8I B;  2K5W A;  4FNF A;  4HR7 B;  1S5C D;  1U4P A;  1PTO H;  5G3L F;  1E0B A;  5NUC A;  1DON A;  2NWG A;  2K28 A;  1ICW A;  5DEH A;  4V0B A;  4UAI A;  4J1M A;  1EY0 A;  2Y0S B;  4FF1 A;  1A6X A;  1RKN A;  4CBV A;  4FF2 A;  3PUZ A;  1STB A;  4DA2 A;  1H9K A;  5IT9 E;  4C3H B;  2LFN A;  4C2M B;  3OOC A;  3O13 A;  5C4H A;  1NR4 A;  2EYM A;  1SNC A;  1TY2 A;  3Q23 A;  4HMJ A;  1DD2 A;  2QKI C;  4UDU C;  1IW7 D;  3V05 A;  2NTT A;  1FR3 A;  3NHH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...