2IHEA

Crystal structure of wild-type single-stranded dna binding protein from thermus aquaticus
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
238
structure length
206
Chain Sequence
ARGLNQVFLIGTLTARPDMRYTPGGLAILDLNLAGQDAFTDESGQEREVPWYHRVRLLGRQAEMWGDLLEKGQLIFVEGRLEYRQWEKDGEKKSEVQVRAEFIDPLEGRGALNQVILMGNLTRDPDLRYTPQGTAVVRLGLAVNERTHFLEVQAWRELAEWASELRKGDGLLVIGRLVNDRFQTRVEALRLERPTRGPAQAGGSRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Single-stranded DNA-binding protein
publication title 3D structure of Thermus aquaticus single-stranded DNA-binding protein gives insight into the functioning of SSB proteins.
pubmed doi rcsb
source organism Thermus aquaticus
molecule tags Dna binding protein
total genus 35
structure length 206
sequence length 238
ec nomenclature
pdb deposition date 2006-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2iheA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2iheA02
3BZKA 2YU9H 3HOUH 4BBRG 1HZBA 1VQBA 2PNHA 2MO0A 4X62Q 5C3EG 1SE8A 5ELNA 4HIDA 2JA5H 3S1MH 4IOAA 4JV5Q 1TWCH 4DR3L 5ELOA 4A3GG 1HZAA 5IYDH 3FKIH 1S3OA 3PSIA 4JI3Q 4IJLA 5C4XG 1Z9FA 2OCEA 2YV5A 1ASYA 4QL5A 1I94L 1KIXA 3W1BA 2Z6KC 3ER0A 3K81C 3F2CA 1Y1WG 1QVFA 3STBC 3STBD 4JI4L 2IX1A 4AH6A 2NVQH 1WCMH 3J80i 1Q86C 2A8VA 1HNWL 1MJEA 2FXQA 3PV0A 2YTVA 2BA1A 2OQKA 1WJJA 2B29A 4QIWE 4A3FG 2JEAI 3LGJA 2NVXH 3I4NH 1Q46A 3M4OH 1EFWA 2NVTH 2VUMH 2JK8A 4GN3B 3S17H 2MFIA 4LF9Q 3RR5A 3D31A 3PF4A 1N32L 1NY4A 4DV1L 2HIVA 4NPSA 1XMQQ 4BXXH 4DV4Q 4LUVA 3GTJH 4K0KQ 2UUAL 2KBNA 3E0EA 4BY1G 1W2BA 1VQEA 1L0WA 4HJ5A 4GKKQ 1XJVA 4A75A 2VZAA 4JI7L 1IXRA 1C9OA 1PH2A 4GLVB 1N36Q 1SROA 5C0XI 4X6AH 3MEFA 3CPWA 3G71A 4BBSH 3VDYA 3ULJA 4DR6Q 2PI2A 5IP7H 1TWHH 1ASZA 1AH9A 1HNZQ 1PYSB 1OXVA 3CF5A 1PH3A 2EXDA 1V43A 4GN5A 4BY7H 5LMNL 1V1QA 1A62A 3TRZA 4X64Q 4UP9A 4P74A 1QZGA 5IE8A 2RHQB 2RCNA 1VQAA 2IHEA 3UDXA 2NVYH 2WP8J 4YY3L 4OWWB 5FJ8H 4WJ3M 3A0JA 1KXLA 3RN5A 2KHIA 3RZOH 4A3BG 3CCJA 3UDIA 2IY5B 1Q1EA 4X65Q 3GTPH 1J6QA 1OXUA 3GD7A 4DAYB 2IT1A 1XNRQ 5IYBG 3RN2A 4A3MH 4XTCS 4A3CH 3JC66 1I50H 4R4OA 4JI6Q 1H95A 4IPHA 4C3IH 2EIFA 1PH5A 3I4MH 4X66L 1N34Q 4DR4L 3PUVA 3E9IA 1BBUA 5C44G 3GTKH 4DV7L 2VS1A 1C0AA 2JQOA 1J5EL 1IBMQ 1XPRA 4OXPA 3HOYG 4DV2L 3NEMA 1E1TA 1OXSC 4GS3A 2JA9A 2QGQA 2K52A 2V1CC 4B3RL 5HGQA 3T1YL 3KDFB 2Z6KA 2KENA 3W1GA 2LSSA 5BR8L 5M3FH 4OX9L 3S2DH 3M4QA 3HOZH 2R93G 1YHBA 4B3SL 2I5HA 4LF8L 2R92G 4A93H 4DR7L 1QUQA 3CMAA 3M3YH 1VCIA 4LF7L 1S72A 1RL2A 3HOVG 4B3TQ 3RZDH 3PGZA 3CCVA 1C7YA 2F52A 3GTLH 3AEVA 4PZ6A 3RLNA 3H15A 3NELA 1KRTA 1MIUA 4DK3C 4P73A 2UUBQ 1AE2A 1JB7A 2UXCL 4HIOA 1L1OC 2EQSA 2N8NA 3CQZH 3CCQA 1FL0A 5M3MG 5AJ3Q 3PIPA 1YJ9A 3WWVA 2E2IH 5IP9H 1VQLA 2DUDA 4P75A 2VW9A 3TS0A 2UU9L 4A3IG 2XGTA 4Y52H 3KOJA 1E22A 2NN6I 3A74A 4GN4B 4AYBG 2F4VQ 2VNUD 3K8AA 2H5XA 2ZJPA 3NENA 1SR3A 4X62L 1K8AC 3PUWA 2XTIA 4IPCA 3I55A 4DR2Q 1YITA 4JV5L 1KAWA 1M1KC 1VQHA 4B3MQ 1B8AA 4L5RC 1VQPA 4IPDA 1EWIA 1KL9A 4JI3L 3AYHB 4A3EG 4Y7NH 3NBHB 2A19A 4P72A 3U4VA 4YCWA 3J81i 4DV0Q 4JI5Q 2B63G 3RNUA 2OTLA 3BU2A 1HZCA 1EQRA 1XTDA 3CCLA 1Y1VH 3U50C 4DV6Q 3GO5A 4QY7A 4AQYQ 3F2DA 3TQYA 5LMNW 1BBWA 1GVPA 4JOIC 3S16H 3PO3H 1YI2A 1G51A 3AFQA 4DV3Q 2ZTDA 2PMZE 3U4ZA 4GNXC 4LF5Q 1D7QA 3TEHB 1XMOL 2UXBQ 2ZJQA 3GTMH 3PUYA 1Q8KA 2GVBA 4LF9L 1VQ9A 4AYBE 2UXDQ 2K5HA 4DV5Q 4NXMQ 1CUKA 2AHOB 1O7IA 1XMQL 2HIXA 1GKHA 4DV4L 4K0KL 2R7ZH 1N8RC 4GKKL 1JMCA 1XMOQ 2CWAA 4POFA 1NMFA 5FLMH 4JBJA 1XNQL 5JJIA 4GOPC 4YCUA 3DM3A 2K14A 1K0RA 4LWCA 3K7AH 1HJPA 3S24A 3ZJYC 4BA1I 4DUYQ 3T1HL 1EQQA 1N36L 1PYBA 2VQFQ 1V9PA 3BZCA 3EN2A 3CD6A 4KLKA 4DR6L 2KCMA 2ATWA 1X65A 1Z47A 3HOXG 1HNZL 3L2PA 4H02A 4IPGA 1HR0Q 1XNQQ 1G6PA 4ALPA 4JI2Q 3CC7A 1CKOA 2KCTA 4MZ9A 1KQSA 1SFOH 4LFCQ 4B3RQ 4JYAQ 4GLAC 3T1HQ 4C3HH 3UE0A 4X64L 3GTOH 4A3KH 1VQ6A 2BH2A 4O2DA 5GQOA 2I5MX 2GN5A 4NB3A 2CCZA 5GADC 4KHPQ 1X3EA 4HJAA 2JA8G 3UDFA 3K7UC 1Q7YC 2JA6G 5IYCG 4X65L 2B3GA 1L1OA 4MNOA 2D0PA 5GAHC 4HIMA 4A3JH 2F3IA 1Q81C 2JA7G 3PO2H 3CC4A 1IL2A 5IT9c 3M85A 1XNRL 3HOUG 4LFBQ 2YTXA 3KJPA 2JA5G 4R4TA 4DUZQ 3FP9A 1N33Q 4JI6L 2CFMA 1HNXQ 1FJGQ 3RLOA 1HZ9A 2UUCQ 1IBKQ 1UE1A 5E7NA 1PH9A 4A3DH 3AQQA 1N34L 5IYDG 3FKIG 2MNAA 4TVAB 3RLFA 2VQEQ 3HOVH 1NE3A 4YWKA 4JG2A 2K5NA 4DK6C 1IBML 2K75A 4L5SA 4A3LH 1YHAA 1KHIA 3ERSX 3CW2C 1WOCA 3M4PA 1WCMG 1IBLQ 2NZOA 3G4SA 3B6YA 4LFAQ 3F8TA 3S2HH 4XIGS 3TREA 4OO1G 1I3QH 3HFZB 4EQ5A 3I2ZA 4JBKA 1VQIA 3I4NG 1K3RA 4RG1A 4GLXA 4ME3A 2VUMG 1JJ2A 4O0AA 1QUQB 4A4IA 4YHHQ 3JAMc 4DR1Q 4DR5Q 2K50A 3FHWA 4C3JH 1EOVA 4B3TL 1BVSA 3H0GH 4BXXG 1IZ6A 3S15H 1BKBA 3PUXA 4POGA 1YEZA 2UUBL 3OYYA 2NZHA 1Q82C 1M90C 2WB1G 3HOWH 5AJ3L 4NXNQ 2PQAA 4PZ7A 4JBMA 4L5TA 4LF6Q 2BH8A 1VQCA 1VQ8A 4IOCA 2IX0A 4BBSG 4BBRH 3KJOA 5C3EH 1IYJB 3F2BA 2ZJRA 3CCUA 1JT8A 1G291 5IP7G 5HY6A 1PH6A 1VQMA 4GOPA 3W5OA 2Z0SA 1PHJA 4AIMA 4IFDJ 4IFDG 2RF4A 5J3BA 2F4VL 4A3GH 2JJQA 2MO1A 2Q2UA 3EIVA 4BY7G 2Q2IA 5C4XH 4DR2L 1HR0W 3KF8B 1X55A 4B3ML 2QA4A 3I7FA 1U5KA 2CKZB 5FJ8G 1VQ4A 1FVIA 4JI8L 2WFWA 1Y1WH 2BA0A 1VQJA 2MQHA 5GAEC 2KHJA 1EYGA 5EAYA 1EIYB 4JI5L 1HH2P 4DV0L 1JE5A 4OONA 5GROA 2E2JH 1YVCA 1PH8A 1YJNA 1YBYA 1E24A 4A3FH 4UPAA 4QGUA 3UE1A 3OTOQ 1PFSA 4A3MG 3L0OA 2WB1E 4DV6L 1PV4A 1VQ5A 3J7A5 4AQYL 4A3CG 2K5VA 2QEXA 2N3SA 4JI8Q 2AKWB 4HJ9A 1NMGA 3I4MG 1PH1A 1UE7A 1MKHA 4PZ8A 1TWFH 2L15A 4L5QA 4DV3L 4LF5L 4OWTB 3CP0A 3D0FA 4YWMA 2Q2HA 2UXBL 5K36G 2ZM6Q 4BY1H 2ZTEA 2UXDL 3S1NH 1B7YB 4DV5L 4QJFA 2E5LQ 4NXML 2OTJA 1K83H 5LMUQ 1KC8C 1W3SA 2DGYA 1TWAH 3J81j 4GKJQ 4EX5A 3EBEA 1I5FA 1Q1BA 3TS2A 1PVOA 3CPFA 5IWAQ 4KI0A 1TWGH 1VQFA 1S40A 1SRUA 1CSPA 4JI1Q 4UY8C 3ULLA 3BJUA 1NBWA 2JE6I 1JJGA 4DUYL 1OXTA 3HOZG 4JI0Q 2Q2TA 2HT1A 2VQFL 3J7ZC 2R7FA 3S1RH 4A93G 3A5UA 5IY0A 4R4IA 3J80c 2WAQG 4A76A 4DAMA 5H1SE 1HR0L 4LF4Q 4IO9A 4JI2L 1YZ6A 3KLWA 4LFCL 1PH4A 5C0XJ 3Q8DA 5M5YH 3AFPA 5C0XG 3I4OA 2HHHQ 4A3BH 4JYAL 3CC2A 3UDGA 1CKMA 1E7ZA 4DNIA 1T9HA 4QQBX 1WFQA 4P71A 1X3FA 5IP9G 4KHPL 1SLJA 3KF6A 1QVCA 5IYBH 4DKAC 1YHQA 1LYLA 1XPUA 1L1OB 1OXXK 1SN8A 4DR3Q 1I6HH 1UE6A 5JEAJ 2LXJA 5JEAG 4LFBL 4WJ4A 5C44H 4LNQA 3CXCA 4DUZL 1N33L 2HQLA 1A63A 1HNXL 1FJGL 1I94Q 2UUCL 1IBKL 3CAMA 3HOYH 4UP8A 1CSQA 2ZTCA 1PA6A 4JI4Q 1HNWQ 4R1JA 2WAQE 2VQEL 2D62A 4LW1A 4OWXB 3KFUA 4JC0A 1K8GA 2ALYB 2R6GA 1XPOA 1Y1VG 1Y14B 3A5ZB 2Y0SG 3F1ZA 1LUZA 4DPGA 1IBLL 2R93H 1GO3E 2R92H 1N32Q 3PO3G 4LFAL 1QVGA 5M5XH 4DV1Q 1DGSA 2I0QA 2PI2E 1A0IA 2AMCB 2UUAQ 5C4JH 4R4CA 2N78A 4DR1L 4DR5L 4YHHL 4JI7Q 3H3VI 3L7ZC 1X9NA 4PMWA 3ULPA 1K73C 3ICEA 4GNXB 5M3MH 1R9TH 1K9MC 4TQUS 3PIOA 2R7ZG 4LUZA 5FLMG 1TXYA 1N9WA 4A3IH 4YCVA 1YJWA 3S14H 2C35B 3K80C 4NXNL 1UE5A 1A8VA 2PQAB 4JOIA 2I5LX 4KHZA 2AWOA 1YIJA 4LF6L 2CQOA 1X3GA 2CWPA 4YWLA 1OTCA 4GNXA 5LMNQ 2ASBA 4FDBA 3U58A 1VQKA 4GOPB 2JEBI 2Y0SE 3M7NA 4YY3Q 3K0XA 1QZHA 3GTGH 4JCVE 1E1OA 4MTNA 1EUJA 4A3EH 1GD7A 4A3KG 3SGIA 2B63H 3KYHC 4JBWA 1LTLA 5GAGC 1L2FA 2VL6A 2NN6G 1X6OA 3CCRA 1PH7A 3JAMi 2AWNA 2LXKA 1JJCB 1P16A 4A3JG 1VQOA 2D0OA 2ES2A 1MJCA 3PO2G 4X66Q 3HKSA 4DR4Q 1VQGA 4UP7A 1VQNA 3OTOL 2E2HH 1CKNB 3CCMA 3G48A 4DV7Q 5FLXc 1J5EQ 2OQ0A 4OO1I 1AE3A 3HKZG 1LM0A 4DV2Q 4A3DG 3DLLA 1X54A 3I56A 3M9BA 1Q12A 1X56A 4PG3A 5M5WH 3MXNB 2YYZA 4R4QA 2ZM6L 4HIKA 4HJ8A 2OWOA 1VQDA 4A3LG 1NTGA 3T1YQ 1CKNA 2ID0A 3KDFA 4LUOA 5BR8Q 2E5LL 4OX9Q 1UWVA 1UEBA 4RMFA 5LMUL 4BA2I 1FGUA 4GKJL 1U0LA 1VS0A 4B3SQ 4LF8Q 4DR7Q 3GTQH 2A1AA 1KRSA 5IWAL 4LF7Q 4C2MH 4JI1L 4IJHA 1GM5A 2N49A 3HOXH 3G6EA 3OW2A 3H3VH 3J81c 4JI0L 1WYDA 3E9HA 2RHSB 2K4KA 3IRBA 3PF5A 1VQ7A 3CMEA 2UXCQ 4APVA 1E3PA 1NJIC 1RIPA 4J15A 2YTYA 2R7DA 1KD1C 4IFDI 1WI5A 3H0GG 2VY3A 1B70B 2GVAA 3CCSA 3CCEA 4LF4L 3S1QH 3HKZE 2IHFA 2JA8H 1P8LA 1SMXA 5M3FG 1D8LA 3GDEA 3PUZA 2HHHL 4HJ7A 5DLQE 5IYCH 2UU9Q 1YNXA 2JA6H 3HOWG 5JJKA 1EIFA 5JJLA 2JA7H 2E8GA 3KF6B 3PCOB
chains in the Genus database with same CATH superfamily
5C3XA 2YU9H 3F2UA 4HIDA 1SE8A 5ELNA 4IOAA 1EOTA 1B9MA 3I91A 4CGYB 4RFBA 1TWCH 4DR3L 1LTAD 1HZAA 4OEMB 4XQQA 4RKLA 1Z9FA 5FLXL 1I94L 2Z6KC 1JR0D 3SE0A 2NVQH 3QOJA 1XYIA 1WJJA 2B29A 3OW7A 5M9OA 2NVXH 3I4NH 1E2ZA 1F9PA 5CV4A 2AQ2B 2A69C 1SBBB 2A69D 2MFIA 3U9SA 4LF9Q 3RR5A 3D31A 5EPJA 4C2MB 3S17H 1LTBD 3TP7A 3DWAA 5BN4A 4NPSA 4K2LA 2OEOA 4DV4Q 3VYRA 3TSSA 1XX8A 1L0WA 4K5VA 2M00A 4A75A 1IXRA 1Q3LA 1SROA 5C0XI 4X6AH 3G71A 4BBSH 1OO9B 2PI2A 4DR6Q 3NQIA 1AH9A 3R93A 3CF5A 3R2IA 2CHBD 4GN5A 2ZXOA 1V1QA 1Y8PB 4K8IA 2E75C 3TRZA 1QJOA 4DXGA 4WJWA 4YY3L 4OWWB 1JOOA 3FKIB 1KXLA 4K8JA 2ICEC 2IY5B 5IODA 4KHVA 1ILQA 2XVSA 3IAYA 4FVMA 5E3FA 3GTPH 1OXUA 3GD7A 2H1EA 4XTCS 4S3SA 5EPKA 1G8ZD 3JC66 4FYDA 5I9OA 4JI6Q 2EJFC 1PH5A 1DCZA 1N34Q 2ZT9C 1ENCA 1GUNA 1H9SA 4FP5D 1O7ZA 3K7AB 2A6HC 2VS1A 2A6HD 3MXGA 4KKUA 2EPBA 1E1TA 2JA9A 2PNRC 2K52A 5DNFA 2H4OA 2V1CC 4PV1C 3O13A 4ZUIA 2TSSA 4OX9L 4B3SL 1VCIA 1MI2A 2WINB 3HOVG 1NSNS 2F52A 2K1BA 4DK3C 3CQZH 5ELDA 3RZOB 4RHSA 4A3DB 3HZXA 2RCFA 2UU9L 4Y52H 2DJFC 4FF1A 3HS0C 4ABNA 1FNUA 1KLUD 2VNUD 5JEAH 1BCPF 5LL6X 5T1IA 2L55A 4JV5L 1PRTC 3H3VC 1PRTD 4PMCA 4IQZA 4B3MQ 4L5RC 1IKMA 2LS01 1VQPA 3IKJA 1KL9A 4JI3L 3AYHB 4A3EG 3MTSA 3PQIA 4JI5Q 1WTQA 2KVMA 1WTXA 4AQYQ 5FOBB 5AFWA 2B8GA 2G9HD 1YI2A 1JORA 1CTMA 1RCVD 5JPMC 1EU4A 1FD7D 5ELCA 5M3FB 1D7QA 5CYUA 4ID6A 1FR3A 3GTMH 1Q8KA 4A93B 3M3YB 2R61A 2VB2X 1EIHA 4NXMQ 4KD4A 2SOBA 4K0KL 1SNOA 2CWAA 4POFA 5FLMH 1XMOQ 4GOPC 3DM3A 1EQQA 1DJRD 3K7AH 1N36L 3T1HL 2HDMA 3EROA 4IUUA 3J81E 3BZCA 5DM63 1G91A 4KLKA 2KECA 1Z47A 3GQBA 1U4MA 2RSNA 4IPGA 3L2PA 1CA5A 1XNQQ 1G6PA 4JI2Q 4LFCQ 4B3RQ 2PQEA 3EVQA 1STEA 4GLAC 1H9RA 1LV9A 2BH2A 5GQOA 3LNNA 4NB3A 1X3EA 1KTKA 1Q7YC 4Y7NB 2JA6G 1DXMA 2JA7G 1TS3A 2M9VA 4HR7B 4ZUJA 5IT9c 1XNRL 4LFBQ 1CI3M 2RSOA 4CDDC 3FP9A 1FJGQ 1TWAB 2HCCA 4A3DH 3FKIG 5J39A 2AUJD 3E6ZX 4DK6C 1IBML 2F4IA 4DNTB 1MD2D 1S4ZA 1YHAA 4EGVA 1LTGD 1RODA 1WOCA 1RDPD 1KNAA 3P7JA 4FF2A 3G4SA 2EY1A 3TREA 4OO1G 3I2ZA 1BUVT 1K3RA 4RG1A 2JXMB 3S9WA 1SNQA 1Z7TA 4NDXA 2A73B 1UEAB 1LTID 2F0MA 3S15H 1V1PB 4RWSC 4POGA 1YEZA 3CU7A 4C3HB 2UUBL 3OYYA 1M90C 5C6AA 4L63B 5FO8B 5C44B 4L5TA 2IX0A 1IYJB 1JT8A 4A3JB 1ZEQX 5HY6A 5KEEA 1VQMA 1PH6A 1K8MA 2Z0SA 4ZCKA 2EYOA 1SXTA 2MO1A 2Q2UA 3EIVA 3K59A 4DR2L 1SYEA 2NWGA 1HR0W 3I7FA 1UAPA 1VQ4A 1A15A 2R92B 4JI8L 1H9MA 5EBDA 5EKLA 5EAYA 1B3AA 1ENAA 1HH2P 4DV0L 2NTSA 4OONA 2E2JH 1YBYA 1E24A 4CJ1B 4ZKCB 4QGUA 1B53A 3L0OA 3FRPB 3J7A5 1K0SA 4FNFA 2K5VA 2QEXA 1WTHA 2AKWB 1O80A 4HJ9A 1PH1A 1UE7A 4PZ8A 5JAVA 4L5QA 1ESRA 1TVXA 4YWMA 2UXBL 1B3QA 1WTOA 2E5LQ 2OTJA 2NUCA 1TWAH 2QDBA 5FLXE 3CPFA 2BOSA 5T1GA 4JI1Q 1PFMA 4DK1A 2JE6I 4DUYL 2Q2TA 3OWEB 3J7ZC 3S1RH 4A93G 2QILA 3K57A 3A5UA 2EZVA 4R4IA 5D3IB 3H6MA 3NE5B 4LF4Q 4IO9A 1HFNA 4RKBA 3OMGA 1PH4A 3TZDA 1ZYRC 2HHHQ 3QJYA 1ZYRD 1U4LA 2RVLA 2G5DA 2PO4A 1NAPA 1AP0A 1WFQA 1BOSA 1XPUA 3L9AX 1L1OB 4RAUC 1RTNA 4HMIA 5JEAJ 2Z9HA 2A5HA 5C44H 4DUZL 2HQLA 1IBKL 3I8ZA 3GTQB 2ZTCA 1Q90A 2WIIB 4R1JA 2WAQE 2VQEL 1F9QA 2SEBD 2KEEA 1DOKA 1XPOA 3A5ZB 2Y0SG 3F1ZA 3IFTA 4DPGA 2D5DA 1GO3E 2R92H 1N32Q 2O2LD 4DV1Q 1L0YB 2PI2E 1A0IA 2AMCB 2LFNA 2UUAQ 5C4JH 3BG3A 5ELFA 4DR5L 2Q8RE 1S5BD 1A6XA 3S1MB 1W6KA 3T4AC 2R7ZG 4LUZA 3EJIA 5EPLA 4CJ0B 5M5YB 1BCPC 1BCPD 5LHY1 4YCVA 2C35B 3K80C 5KYLA 5E1FA 2I5LX 2QEJC 2CWPA 1OTCA 3U58A 1VQKA 3M7NA 1WCMB 2NBFA 3I90A 5JPNC 3K0XA 1BBXC 1EUJA 4C3HG 3SGIA 1AN8A 2NVTB 4QUFA 1L2FA 2VL6A 2NN6G 1RHPA 2LXKA 1ZXTA 1P16A 4FXGC 4A3JG 3OIPA 1VQNA 4KY6A 5COYA 2R93B 2CW0C 1EY5A 1HTPA 2CW0D 3G48A 4OO1I 1IL8A 4XT3B 3HKZG 1LM0A 4DAPA 4DV2Q 1SYCA 1LABA 2B2VA 4G7HC 3M9BA 4C1NK 4PG3A 2PCFB 1LACA 4HIKA 1VQDA 4A3LG 1GHKA 3T1YQ 4BY7B 4C3IG 5C0XH 5LMUL 4BA2I 4GKJL 1VS0A 1TU2B 5CMDA 4LF8Q 4DR7Q 3C46A 3GTQH 5IWAL 4LF7Q 1GM5A 2N49A 1UNSA 3J81c 3D4RA 3D6CA 2IPKD 3FMCA 3PF5A 3K58A 1I4HA 4KN7C 4APVA 1RIPA 3QWNA 1I50B 3H0GG 2F0HA 1B70B 4UDUC 1BDOA 3I4MB 3NPPA 3SDZA 2EYJA 1SMXA 3GDEA 3PUZA 5IYCH 1EIFA 3KF6B 3PCOB 3QOLA 4BBRG 3S1MH 4ZKBB 1SDFA 4B9WA 2VXWA 2FMMA 1H9KA 3PSIA 1GUTA 2OCEA 4DK0A 1PXUA 3A8IE 1NNXA 1QOHA 3P1HA 1QVFA 2IX1A 4PMBA 4AH6A 1HNWL 1WCMH 4RGOS 2RQXA 1Q86C 2A8VA 1HRJA 1MJEA 3U9OA 2OQKA 1Q46A 5I6WA 1EFWA 2NVTH 2VUMH 1JWUD 1EQVA 2B2YC 3MFYA 4HEDA 1C8CA 2ZXRA 2HIVA 1JE4A 5J1ZA 4BY1G 1VQEA 1QNUA 2VZAA 4BWGB 1C9OA 1PH2A 4GLVB 3S1QB 3NWSA 3CPWA 3VR2A 3VDYA 5IP7H 3CRKC 1ASZA 3DEOA 1HNZQ 1OXVA 5EBCA 4IFDH 2YU9B 1G2TA 2EXDA 1XTCD 4BY7H 5LMNL 1A62A 1Y1VB 2K7VA 1TWCB 2RCNA 1VQAA 5FJ8H 4A3BG 3DUZA 3UDIA 4X65Q 2MP1A 5KRUA 1J6QA 2Q8TA 1PLFA 3Q23A 5IYBG 3RN2A 4A3MH 2NVQB 1I50H 1SNPA 2K04A 3MA2B 3I4MH 4X66L 2NVXB 4DR4L 1BBUA 4DV7L 1C0AA 3ND9A 2SNSA 2PYKA 3HOYG 2DN8A 2JSOA 5BN3A 2F0WA 3K5NA 1G2SA 2WB1B 3KDFB 1SE4A 1EQTA 5BR8L 3S2DH 3M4QA 2R93G 1YHBA 4X3KA 4V190 4BBSB 1GHJA 1QUQA 4B3TQ 3RZDH 1JCKB 3CCVA 4XQNA 3GTLH 2F0EA 2UXCL 1B44D 1Z6HA 2K05A 4HIOA 1WTVA 3CCQA 2EQSA 2N8NA 3CCLA 1FL0A 5M3MG 1A3TA 5L37A 5AJ3Q 3WWVA 3MXPA 3SK4A 5IP9H 1B50A 2VW9A 2J7ZA 3GTPB 2WACA 3KLSA 5CGKA 2NN6I 5JVG3 4AYBG 2F4VQ 2K5QA 3BVZA 1LT5D 2RDHA 2H5XA 2J4XA 4X62L 3PUWA 2XTIA 5ISRA 4CDEC 1J9OA 3ITPA 3VR5A 1R4QB 4EQNA 1EWIA 3P20A 4YCWA 2XWBB 2OTLA 1F2MA 3BU2A 1HZCA 1EQRA 1CQFA 1XTDA 1Y1VH 2IX3A 2F0LA 4DV6Q 2CVRA 3A56A 3CRLC 3GO5A 4O1NA 4QY7A 3F2DA 5LMNW 4JOIC 1GVPA 3S16H 1GUWA 3PO3H 1G51A 3AFQA 3BYYB 4LF5Q 3U4ZA 1WTWA 1XMOL 3I4LA 3HOWB 2WKDA 2IWHA 4TRDA 4DV5Q 5KYIA 1CUKA 1TT2A 3DHQA 1TS5A 1XMQL 2HIXA 1UUPA 1D5ZC 1N8RC 4GKKL 4A3GB 1NMFA 1XNQL 3CQZB 4YCUA 4ZLTF 2K14A 4B3RL 4LWCA 3ZJYC 4LAAA 3M4YA 1FYCA 1Y1WB 2KCMA 1X65A 2DY7A 1CKOA 2KCTA 1BQQT 2Z4HA 4JVZA 4JYAQ 4X64L 2SDFA 5LL6S 4KHPQ 2CCZA 5C5LA 4HJAA 1TWFB 3UDFA 1Q81C 2D0PA 5FO7B 3CC4A 1IL2A 3OPOA 4FO2A 3M85A 3KJPA 3RD4A 1N33Q 2QCPX 2EYMA 3TBIB 2CFMA 1HNXQ 3RLOA 1HZ9A 3IL8A 3DM1A 4OIKA 2KCNA 2F0FA 4IURA 1LO5D 5EJWA 4TSSA 3GTMB 3HOVH 1BO0A 1EY6A 4L5SA 2K75A 2BCOA 3ERSX 3CW2C 3OHXC 1IBLQ 1HPCA 1TS2A 1EWCA 5FK9C 4LFAQ 1RD9D 3TMEA 3K5MA 1I3QH 4EQ5A 3I4NG 2V4DA 1RTOA 4ME3A 3Q22A 3HG9A 3FHWA 1EOVA 3T13A 1EY7A 1BVSA 4M1UB 1IZ6A 1BKBA 1JOKA 2NZHA 2RDFA 2WB1G 3HOWH 4J6HA 2BH8A 1VQCA 4BBSG 4PQXA 5C3EH 3CCUA 2F0TA 4CJ2C 2L5TA 3T16A 1JWSD 2OF1A 4AIMA 1PHJA 4R8NA 2B2YA 3MFGA 2A68D 1SYDA 4IFDJ 2RF4A 4A3GH 4WRDA 2L4NA 4FF4A 5C4XH 1PTOF 1AZPA 4ZK9B 2QA4A 4MN3A 4DU9A 1Y1WH 3MEHA 2AQ3B 2WV6D 5M5XB 4XYOA 1KABA 2PZWA 1EIYB 1JE5A 3HGBA 4A3FH 4RHRA 1PFSA 1VQ5A 4KD3A 1JICA 1Y8NB 2LY7A 3KF8A 1T5XD 1TWFH 4DV3L 4OWTB 3R3OA 3I3CA 3S14B 3MXNA 2ZM6Q 3J7AV 2ZTEA 2UXDL 4QJFA 2B2UA 5C4HA 3P75A 4Q0FA 2DGYA 3S15B 3J81j 2LKVA 3EBEA 2F3VA 5C3WA 1TWGH 1VDZA 3GTGB 4UY8C 1SRUA 3BJUA 2F0DA 2VQFL 2R7FA 5IY0A 4DAMA 5DEHA 1HR0L 1YZ6A 3KLWA 1SJHD 2KQ3A 3Q8DA 3CC2A 3UDGA 1AW7A 5I6YA 4QQBX 3DEPA 1SLJA 1QE6A 2F0IA 4ULLA 3FVQA 2J0TD 4C56C 1PYWD 1LTRD 1A3VA 2E2JB 5M5WB 1X3PA 4DR3Q 4QCLA 2B2VC 2LXJA 5JEAG 2K5WA 2BDOA 1TIID 4IZ8A 4LNQA 2EY2A 1I94Q 2UUCL 3CAMA 1D1KA 4UP8A 1CSQA 1EYDA 1KDAA 1PRTB 1F9SA 4LW1A 2EYHA 2EDGA 3G6JB 4JC0A 4H44C 1DM0B 2OT2A 4IUPA 1DD2A 4LMQD 4X3SA 1O7YA 3A7AB 4CKCA 2JA8B 1TY2A 2L11A 5M5XH 1DGSA 1PFNA 2EY6A 1FNVA 5A35A 3S1RB 4HCSA 3CHBD 3MHBA 4DR1L 4YHHL 2F0UA 3DXJC 1IYUA 2AUKA 1R9TH 1DZ1A 5FLMG 1H9JA 1N9WA 4A3IH 3S14H 2A6EC 2A6ED 4NXNL 1HFGA 2PQAB 4JOIA 2AWOA 4DF7A 2DNEA 1HXYD 2CQOA 1X3GA 4LF6L 4YWLA 4GOPB 4YY3Q 1PZJD 5CV5A 3C2PA 3GTGH 4CHTB 1GD7A 2B63H 2XSCA 3K5LA 4JBWA 2FFKB 5GAGC 1XXGA 1PH7A 1TS4A 3JAMi 1D1IA 2ES2A 1MJCA 3QG1A 1VQGA 3D4DA 4RCOA 4PNYA 3OTOL 1F9RA 2E2HH 4K5XA 2O4XA 2OQ0A 4R8IA 4A3DG 1HA6A 5HGTA 2FMCA 4L8JA 3I56A 1Q12A 1SYGA 1SMYC 1SMYD 5M5WH 5C4JB 1CT1D 4HJ8A 2OWOA 1HA5A 4ILWA 4OX9Q 1UWVA 1Y8OB 2HDLA 4B3SQ 3KUPA 2F3WA 4F87A 4IJHA 4E6IA 3OW2A 3HOXH 3H3VH 1W6JA 3FDTA 3NUCA 4JI0L 2X69A 2XRQD 1S5DD 4IUVA 1GJXA 1E3PA 4J15A 2YTYA 2R7DA 1ENFA 3CCEA 2JA8H 5M3FG 1GUOA 2UU9Q 1D8LA 1YNXA 1ESFA 4J1MA 3GTKB 1QB5D 3BZKA 3HOUH 1HZBA 1VQBA 2MO0A 2JA5H 4JV5Q 4Z9CB 3D3RA 5ELOA 5IYDH 2K5DA 1S3OA 3LX0A 4JI3Q 4IJLA 2YV5A 3CKIB 3HOZB 1AEXA 1HTLD 2GA4B 4QL5A 3W1BA 1ILPA 3ER0A 3F2CA 1KDBA 5IOCA 1II3A 4JI4L 4RGTA 3J80i 4G57A 2FXQA 3PV0A 1IHZA 2BA1A 1F2ZA 3EQLC 2JEAI 2MPMA 3LGJA 3M4OH 2JK8A 1LTSD 1SNCA 2KEDA 4P2CB 2X6GA 2K6AA 2QDLA 1QCBD 4CKEA 4BXXH 1MSGA 5CV7A 4K0KQ 3GTJH 2PZTA 1STAA 3E0EA 1W2BA 4HJ5A 2D9UA 1XJVA 4JI7L 3BDLA 4DA2A 1KAAA 1N36Q 4OELB 4KKTA 3ULJA 1TWHH 1PTOC 5F2DA 1PTOD 3TP5A 3K5OA 3GV3A 1PH3A 1STHA 4OHJA 2C5CA 4P74A 5IE8A 3H91A 4IUNA 5NUCA 4BS9A 4KKSA 3A0JA 1K8OA 2CH4A 2KHIA 3CCJA 1LT4D 3VYUA 1Q1EA 2NZ1D 4CDCC 4L6TB 1ICFB 1EZ8A 1LLRD 1XNRQ 4KY7A 3DWPA 5ELBA 4I7ZC 1JQYD 4A3CH 3QR8A 4R4OA 4C3IH 2EIFA 3PUVA 2L0CA 2VUMB 5I4DA 5C44G 4DAYA 3FPUB 3GTKH 2JQOA 3SK8A 1J5EL 3AB9A 1MHWC 4OXPA 1IBMQ 3NEMA 4R9WA 3X3NA 2QGQA 4G7OC 3N6RA 3W1GA 2XRSD 3HOZH 3GTOB 4A3KB 2I5HA 3PMFA 2R92G 3ZYYX 3CMAA 1DOMA 5CV6A 1S72A 2SNMA 1RL2A 3PGZA 5IGBA 1C7YA 3PO2B 4PZ6A 3RLNA 2IW3A 3NBIA 2FHTA 3NELA 1KRTA 1V1PA 2UUBQ 3NK9A 1JB7A 2DNCA 1IW7C 1IW7D 1JWMD 3PIPA 1YJ9A 4LK1C 2D2CC 4LJZC 1PDQA 1V1OA 2DUDA 3EFXD 4MTKA 4P75A 3TS0A 1I4PA 3SEBA 4RH6A 2XGTA 5JVH3 3VA7A 3KLSX 2F0KA 4GN4B 4A3MB 3NENA 2RDGA 1BCPB 4IPCA 4DR2Q 3R2TA 3L3OC 3NWTA 1M1KC 3H09A 1VQHA 1B8AA 2EOTA 4HAEA 2F0SA 3S2HB 3K6OA 5EKKA 3KK7A 3V96A 3U4VA 2A19A 4DV0Q 3VYSA 3RNUA 1CHPD 1C48A 3IFDA 4C3JB 3JAML 1BR9A 4KK7A 1QG7A 1EIGA 3S2DB 3NQTA 4GNXC 5CV8A 3NBHA 2UXBQ 1SJED 2ZJQA 3ERQA 3PUYA 5IGCA 4LF9L 1VQ9A 4U673 2WAQB 2F03A 3RZDB 1STBA 2AHOB 5D3DA 3UI2A 1SNDA 3GTLB 1ICWA 4DV4L 1CA6A 4DXFA 1JMCA 1EU3A 2NB0A 1S5ED 4JBJA 1EYAA 5JJIA 2EYPA 3NP8A 3T56B 4XXEA 4DUYQ 3S24A 1HJPA 3AEVA 1PYBA 5KNDA 1LTTD 1V9PA 3EN2A 3CD6A 2XN9C 4NMZA 4DR6L 4JW0A 2ATWA 1DYQA 1HQRD 1S5FD 4ALPA 4HSPA 5I9PA 1KQSA 2K03A 2B39A 3GTOH 2F0OA 4A3KH 1VQ6A 4O2DA 2GN5A 4NP5A 5GADC 1F2YA 3K7UC 5IYCG 1L1OA 4MNOA 4HIMA 3PO2H 1AFPA 1RF2D 3S1NB 3BDCA 2YTXA 3BS1A 2PW7A 4R4TA 4DUZQ 4JI6L 3S16B 3PO3B 1IBKQ 1PTOH 2R3ZA 5E7NA 1PH9A 3AQQA 1STYA 1N34L 2B2UC 3LWEA 2K01A 2MNAA 1MSHA 4TVAB 1U9RA 5IGGA 2VQEQ 1H9SB 4JG2A 1A2UA 2K5NA 2KJXA 2X6LA 4G7ZC 5E4XA 1WCMG 4HSVA 3J80L 1Q8IA 1M4VA 1RKNA 3B6YA 3F8TA 2RA4A 3S2HH 4XIGS 3HFZB 3TZUA 4JBKA 3D6WA 2VUMG 2IJ0A 4DGZA 2P5ZX 4DR5Q 4QF4A 2K50A 4C3JH 3VA5A 5FKAC 5A2QL 2KOLA 5TSSA 4CDFC 4WFN3 2NTTA 3SXHA 5K5PA 2HQEA 1WD0A 2MUYA 4PZ7A 2FJ2A 5CBEE 1VQ8A 3URYA 4NKLA 5IP7G 3E3XA 3W5OA 3ONAB 4IFDG 2ICIA 2EVBA 4BY7G 1CM9A 1D5MC 5EQ0A 3KF8B 4B3ML 2EY5A 5FJ8G 1FVIA 1RJTA 2KA7A 2WFWA 2BA0A 5CORA 3HOVB 3MXUA 2KHJA 5E4WC 4JI5L 1YVCA 1PH8A 3GP7A 2B2TC 4UPAA 4A3MG 3UE1A 4FF3A 1EYCA 4AQYL 2N3SA 3I4MG 1MKHA 3NTIA 1I3QB 3CP0A 3W3AA 5K36G 3S1NH 4UAIA 4NXML 2G9DA 1K83H 5LMUQ 2F0QA 1V8QA 1KC8C 4GKJQ 4EX5A 5KNBA 5IWAQ 4KI0A 3OSOA 1SE2A 4Q5VA 3ULLA 3SHLA 3DMUA 4A3EB 3N52A 1WTPA 2HT1A 4UHVA 5C3EB 1ET6A 3WOEA 5FO9B 4X3UA 2WAQG 4A76A 4WORA 4F7XA 1U4RA 5H1SE 2RBMA 4JI2L 4LFCL 3BZDB 5C0XJ 5C4XB 2WKCA 4DFAA 2KCCA 5KGUA 1CKMA 2TMPA 4DNIA 1T9HA 5IP9G 3KF6A 1QVCA 1E0BA 3QIAA 3E5SA 4DKAC 1YHQA 1OXXK 4RA8A 4ZQ3A 1B2TA 1SN8A 2F0NA 2XIWA 4DN4M 4A3FB 4LFBL 4WJ4A 3CXCA 1A63A 1FJGL 4OL7A 4HMJA 1F2LA 4N8FA 1WD1A 1HNWQ 4N9PA 2F0PA 4OWXB 1T5EA 1Y1VG 1Y14B 2MHVA 3ND8A 2EXZA 1TWGB 3PO3G 1PZKD 3Q24A 1QVGA 1ML0D 2I0QA 2JA6B 1DOLA 2JA7B 4R4CA 2N78A 1IKLA 3L7ZC 3ULPA 3ICEA 1U4PA 4TQUS 3PIOA 3RMHA 1I4QA 3BVGA 4C1NI 1TXYA 1A2TA 1NR4A 1VMCA 1YJWA 1UE5A 4H7BA 5IIFA 1HQMC 3WDNA 5LMNQ 4GNXA 1F77A 4FDBA 2JEBI 2Y0SE 3HP3A 1GUGA 1QZHA 1E1OA 2OXPA 4MTNA 4A3EH 3G7LA 2F0VA 3DWQA 2EYFA 1LTLA 1PMRA 1BXTA 5CV9A 3MVVA 2AWNA 4KMUC 2A68C 1VQOA 1I4RA 4X66Q 3HKSA 4DR4Q 4UP7A 2Z4IA 2CQAA 3CCMA 4DV7Q 1AE3A 3I72A 1SAPA 3A7LA 4N9TA 1X54A 3TP8A 5IGDA 1X56A 3D4WA 1E2WA 4R4QA 1Y69U 1CKNA 2ID0A 3KDFA 1R9TB 5BR8Q 2E5LL 4CKBA 1FGUA 3VR6A 1U0LA 4FXDA 2NVYB 2A1AA 1KRSA 4C2MH 4A3IB 4KV6A 4JI1L 3JAME 1DONA 3G6EA 2E76C 2Q8IB 3IRBA 2RHSB 2K4KA 4DAVA 4O42A 1VQ7A 2UXCQ 1BF4A 1PZID 1KD1C 4IFDI 3NXWA 1WI5A 1I4GA 3I73A 2VY3A 2GVAA 1K3BC 1GUSA 5KNCA 4LF4L 3T53B 3HKZE 1P8LA 2HHHL 1SE3A 4HJ7A 2JA6H 3HOWG 2B63B 4F8MA 2JA7H 5JOBA 2B2WA 4I7AA 2PNHA 3W2DA 4X62Q 5C3EG 2E74C 2A74C 4CBVA 1TQOA 4RGNA 2PW5A 4A3GG 3BVMA 3FKIH 2E2HB 5C4XG 2K33A 1ASYA 2DY8A 1KIXA 1EL0A 4OIJA 1EY9A 5IGFA 3K81C 1Y1WG 4H13C 3STBC 3STBD 2HCIA 4K14A 5KIXA 1QNKA 2YTVA 4QIWE 4A3FG 4OO1H 4N8X1 1B1ZA 4NW2A 4GN3B 2E2IB 1KDCA 3PF4A 1N32L 3FEWX 1EY4A 3HOXB 1NY4A 4ME5A 4DV1L 2XWJB 1XMQQ 1STNA 4LUVA 5I2YA 2UUAL 2KBNA 4GKKQ 1X3QA 3BYTB 3FPPA 3MEFA 2B2TA 1PYSB 3J80E 2BE5C 1D5XC 2BE5D 1V43A 3HOUB 1O78A 2JA5B 3RUZA 3PIP3 5J22A 5EKIA 3QB3A 4X64Q 4UP9A 2Y0SB 1QZGA 2RHQB 2IHEA 3UDXA 2NVYH 2WP8J 4WJ3M 3RN5A 3RZOH 5A2QE 1CFMA 4DAYB 1EEID 2IT1A 3TN2A 4YIJA 1H95A 4IPHA 3A54A 2XNAC 2R7ZB 2F0GA 1SYFA 3M4OB 3E9IA 3A8KE 4ZAIA 4XDXA 1XPRA 4EVOA 1EY8A 1SYBA 4DV2L 1NUCA 1OXSC 4GS3A 3GTJB 3OWFA 2KUMA 1O7LA 1M8AA 5HGQA 3T1YL 1SFOB 2Z6KA 2KENA 2LSSA 5M3FH 1E2VA 4LF8L 4DR7L 1L0XB 4A93H 3M3YH 1TWHB 4LF7L 1KNEA 1A3UA 1VF5C 3H15A 3J7AF 4M8AA 1MIUA 4P73A 1AE2A 1LT3D 1JOQA 1L1OC 3V2TA 1J8IA 5IT9L 2F1MA 2JP1A 2E2IH 3R8BA 1VQLA 1CZWA 2MJ8A 3HKZB 1HUNA 4A3IG 3KOJA 1E22A 3A74A 3K8AA 2ZJPA 1STGA 1SR3A 1K8AC 3I55A 4C3IB 1YITA 1S5CD 1KAWA 2Z6BA 2I46A 4IPDA 4Y7NH 3NBHB 4P72A 3J81i 2B63G 2N55A 2QF7A 3U50C 1NR2A 1GOZA 2RKSA 5EGTA 2DJGC 3TQYA 3H0GB 1BBWA 2MGSA 2QKIC 5DAUA 4DV3Q 2ZTDA 1CZGA 2PMZE 4QIWB 3TEHB 2M2LA 5BN5A 2PPBC 1FNWA 3VR4A 2EYLA 2GVBA 2UXDQ 1ET9A 1VF7A 2K5HA 4KN4C 4AYBE 3WOFA 4BBRB 1YNNC 1YNND 1O7IA 3V05A 1GKHA 4EQPA 2QW7A 2R7ZH 1B4OA 4HN7A 1IYVA 1K0RA 4BA1I 3OOCA 2VQFQ 2ENBA 4KY5A 3HRZC 3HOXG 1HNZL 4HTHA 3MC0B 4H02A 1HR0Q 3CC7A 4MZ9A 3VYTA 2E2DC 4J8QA 1SFOH 1ZKOA 3T1HQ 4C3HH 3UE0A 4JK1C 2I5MX 5G3LF 2NN6H 5D65A 2PZUA 2JA8G 3AU7A 2N88A 4X65L 2B3GA 5GAHC 4A3JH 2F3IA 4ZRZA 4BY1B 2L9HA 3HOUG 1ONLA 4V0BA 2JA5G 3Q0AA 2BDNA 2UUCQ 2JN4A 1UE1A 4G4KA 5IYDG 3GV6A 3RLFA 1NE3A 4JPBW 4YWKA 3NSWA 2I07B 4A3LH 1KHIA 3M4PA 5CC4A 2NZOA 2B8FA 4QUCA 1SNMA 4A3BB 4IN3A 1VQIA 4GLXA 4X3TA 1JJ2A 4U68A 4O0AA 1QUQB 2NYZD 4A4IA 3JAMc 4YHHQ 4I65A 4DR1Q 1SSOA 4B3TL 3H0GH 4BXXG 4EQOA 1YNJC 1YNJD 1EFID 3MWYW 3PUXA 1I6HB 1Q82C 2VB3X 1X32A 5I2XA 5AJ3L 4NXNQ 5HURA 2PQAA 4JBMA 4LF6Q 3H94A 4IOCA 3HOYB 2EJMA 3E0JA 4BBRH 3KJOA 3F2BA 3SVMA 2ZJRA 1G291 1G6ZA 4GOPA 3KBGA 3AMUA 1VMPA 1SEBD 3X3MA 5J3BA 5C4ZA 1JC7A 2F4VL 2JJQA 3VR3A 2Q2IA 1PTOB 4H0LC 1EY0A 1X55A 1TY0A 1AZQA 1U5KA 2CKZB 3C1FA 1VQJA 1CHQD 2MQHA 3T51B 5GAEC 1FGBD 3A8JE 1EYGA 1NCVA 5GROA 3J7YW 1BNZA 1YJNA 3A55A 1PV4A 3OTOQ 4DV6L 2WB1E 4A3CG 4IALA 5M3MB 4JI8Q 1NMGA 1HHVA 2L15A 1C4QA 4LF5L 2L1BA 2PMZB 5CR3A 3D0FA 5JJZA 2Q2HA 3K0YA 4BY1H 4AYBB 1B7YB 4K5WA 4DV5L 1CQVA 1W3SA 1I5FA 1Q1BA 3TS2A 1PVOA 5CBAE 1EZ6A 4RCNA 3HEJA 1VQFA 1S40A 1CSPA 1JJGA 1NBWA 3HOZG 1OXTA 4JI0Q 1QWYA 4RGMA 1GXDC 2EJGC 3KLRA 5DM73 3J80c 3PIO3 5IGEA 2O5IC 4XT1B 4K6LA 5C0XG 5M5YH 3AFPA 4A3BH 3I4OA 4MIUA 4JYAL 3NTHA 4XYQA 1E7ZA 2EE1A 4P71A 1X3FA 4DNRB 4KHPL 1K28A 5IYBH 5C5MA 1R4PB 1XWEA 1LYLA 2CH4W 2IL8A 1I6HH 1EWHA 1UE6A 2HUGA 1N33L 5ELEA 1HNXL 3MAQA 3C3LA 1MGSA 3HOYH 3TDQA 1PA6A 4QMGA 4JI4Q 1PRTF 4ZYSA 2D62A 4K6DA 3KFUA 2Z1CA 3Q6SA 1K8GA 3J81L 2ALYB 4B08A 2R6GA 1K83B 2R93H 1LUZA 1IBLL 3LWUA 1HCZA 1CK1A 4LFAL 3I70A 1EEFD 3OIQA 1B9NA 1LT6D 1KLGD 4F88A 1I6VC 2ZXPA 4JI7Q 3H3VI 1X9NA 4PMWA 2L12A 1K73C 4GNXB 5M3MH 1K9MC 2B2WC 2FINB 3MZ5A 4IUTA 4GZYC 1I4XA 4HCEA 1A8VA 4KHZA 4ODGA 2F0JA 3SK6A 1YIJA 2O5JC 2ASBA 4K2KA 4FXKC 4JCVE 3I4NB 4A3KG 3KYHC 5K36H 3S17B 1X6OA 3CCRA 2LMCB 5D14A 5IT9E 1JJCB 2D0OA 4OGQC 3PO2G 1QILA 3D8GA 3NTKA 3NHHA 1D6EC 2K28A 3OMCA 3SK5A 1CKNB 1WVLA 5FLXc 1J5EQ 3SR1A 1D2BA 3DLLA 4KJOA 4B9XA 4QB4A 4TKOB 3MXNB 3M7GA 2Z8LA 2YYZA 2ZM6L 3C1EA 4KJNA 1NTGA 3QO2A 4XQJA 4LUOA 1TKWB 1UEBA 4RMFA 1PFBA 3KBXA 3EA6A 3BDOA 1JB3A 2HD3A 1WYDA 1HUMA 3E9HA 5G3LD 3TP6A 2AQ1B 4KTAA 3CMEA 1WTRA 2C9OA 2JYOA 4C3JG 1NJIC 2KHSA 4IUQA 3CCSA 3S1QH 2IHFA 4MHEA 5DLQE 5JJKA 1TR5A 5JJLA 2E8GA 2K32A 1MBYA
chains in the Genus database with same CATH topology
3BZKA 2YU9H 3HOUH 4BBRG 1HZBA 1VQBA 2PNHA 2MO0A 4X62Q 5C3EG 1SE8A 5ELNA 4HIDA 2JA5H 3S1MH 4IOAA 4JV5Q 1TWCH 4DR3L 5ELOA 4A3GG 1HZAA 5IYDH 3FKIH 1S3OA 3PSIA 4JI3Q 4IJLA 5C4XG 1Z9FA 2OCEA 2YV5A 1ASYA 4QL5A 1I94L 1KIXA 3W1BA 2Z6KC 3ER0A 3K81C 3F2CA 1Y1WG 1QVFA 3STBC 3STBD 4JI4L 2IX1A 4AH6A 2NVQH 1WCMH 3J80i 1Q86C 2A8VA 1HNWL 1MJEA 2FXQA 3PV0A 2YTVA 2BA1A 2OQKA 1WJJA 2B29A 4QIWE 4A3FG 2JEAI 3LGJA 2NVXH 3I4NH 1Q46A 3M4OH 1EFWA 2NVTH 2VUMH 2JK8A 4GN3B 3S17H 2MFIA 4LF9Q 3RR5A 3D31A 3PF4A 1N32L 1NY4A 4DV1L 2HIVA 4NPSA 1XMQQ 4BXXH 4DV4Q 4LUVA 3GTJH 4K0KQ 2UUAL 2KBNA 3E0EA 4BY1G 1W2BA 1VQEA 1L0WA 4HJ5A 4GKKQ 1XJVA 4A75A 2VZAA 4JI7L 1IXRA 1C9OA 1PH2A 4GLVB 1N36Q 1SROA 5C0XI 4X6AH 3MEFA 3CPWA 3G71A 4BBSH 3VDYA 3ULJA 4DR6Q 2PI2A 5IP7H 1TWHH 1ASZA 1AH9A 1HNZQ 1PYSB 1OXVA 3CF5A 1PH3A 2EXDA 1V43A 4GN5A 4BY7H 5LMNL 1V1QA 1A62A 3TRZA 4X64Q 4UP9A 4P74A 1QZGA 5IE8A 2RHQB 2RCNA 1VQAA 2IHEA 3UDXA 2NVYH 2WP8J 4YY3L 4OWWB 5FJ8H 4WJ3M 3A0JA 1KXLA 3RN5A 2KHIA 3RZOH 4A3BG 3CCJA 3UDIA 2IY5B 1Q1EA 4X65Q 3GTPH 1J6QA 1OXUA 3GD7A 4DAYB 2IT1A 1XNRQ 5IYBG 3RN2A 4A3MH 4XTCS 4A3CH 3JC66 1I50H 4R4OA 4JI6Q 1H95A 4IPHA 4C3IH 2EIFA 1PH5A 3I4MH 4X66L 1N34Q 4DR4L 3PUVA 3E9IA 1BBUA 5C44G 3GTKH 4DV7L 2VS1A 1C0AA 2JQOA 1J5EL 1IBMQ 1XPRA 4OXPA 3HOYG 4DV2L 3NEMA 1E1TA 1OXSC 4GS3A 2JA9A 2QGQA 2K52A 2V1CC 4B3RL 5HGQA 3T1YL 3KDFB 2Z6KA 2KENA 3W1GA 2LSSA 5BR8L 5M3FH 4OX9L 3S2DH 3M4QA 3HOZH 2R93G 1YHBA 4B3SL 2I5HA 4LF8L 2R92G 4A93H 4DR7L 1QUQA 3CMAA 3M3YH 1VCIA 4LF7L 1S72A 1RL2A 3HOVG 4B3TQ 3RZDH 3PGZA 3CCVA 1C7YA 2F52A 3GTLH 3AEVA 4PZ6A 3RLNA 3H15A 3NELA 1KRTA 1MIUA 4DK3C 4P73A 2UUBQ 1AE2A 1JB7A 2UXCL 4HIOA 1L1OC 2EQSA 2N8NA 3CQZH 3CCQA 1FL0A 5M3MG 5AJ3Q 3PIPA 1YJ9A 3WWVA 2E2IH 5IP9H 1VQLA 2DUDA 4P75A 2VW9A 3TS0A 2UU9L 4A3IG 2XGTA 4Y52H 3KOJA 1E22A 2NN6I 3A74A 4GN4B 4AYBG 2F4VQ 2VNUD 3K8AA 2H5XA 2ZJPA 3NENA 1SR3A 4X62L 1K8AC 3PUWA 2XTIA 4IPCA 3I55A 4DR2Q 1YITA 4JV5L 1KAWA 1M1KC 1VQHA 4B3MQ 1B8AA 4L5RC 1VQPA 4IPDA 1EWIA 1KL9A 4JI3L 3AYHB 4A3EG 4Y7NH 3NBHB 2A19A 4P72A 3U4VA 4YCWA 3J81i 4DV0Q 4JI5Q 2B63G 3RNUA 2OTLA 3BU2A 1HZCA 1EQRA 1XTDA 3CCLA 1Y1VH 3U50C 4DV6Q 3GO5A 4QY7A 4AQYQ 3F2DA 3TQYA 5LMNW 1BBWA 1GVPA 4JOIC 3S16H 3PO3H 1YI2A 1G51A 3AFQA 4DV3Q 2ZTDA 2PMZE 3U4ZA 4GNXC 4LF5Q 1D7QA 3TEHB 1XMOL 2UXBQ 2ZJQA 3GTMH 3PUYA 1Q8KA 2GVBA 4LF9L 1VQ9A 4AYBE 2UXDQ 2K5HA 4DV5Q 4NXMQ 1CUKA 2AHOB 1O7IA 1XMQL 2HIXA 1GKHA 4DV4L 4K0KL 2R7ZH 1N8RC 4GKKL 1JMCA 1XMOQ 2CWAA 4POFA 1NMFA 5FLMH 4JBJA 1XNQL 5JJIA 4GOPC 4YCUA 3DM3A 2K14A 1K0RA 4LWCA 3K7AH 1HJPA 3S24A 3ZJYC 4BA1I 4DUYQ 3T1HL 1EQQA 1N36L 1PYBA 2VQFQ 1V9PA 3BZCA 3EN2A 3CD6A 4KLKA 4DR6L 2KCMA 2ATWA 1X65A 1Z47A 3HOXG 1HNZL 3L2PA 4H02A 4IPGA 1HR0Q 1XNQQ 1G6PA 4ALPA 4JI2Q 3CC7A 1CKOA 2KCTA 4MZ9A 1KQSA 1SFOH 4LFCQ 4B3RQ 4JYAQ 4GLAC 3T1HQ 4C3HH 3UE0A 4X64L 3GTOH 4A3KH 1VQ6A 2BH2A 4O2DA 5GQOA 2I5MX 2GN5A 4NB3A 2CCZA 5GADC 4KHPQ 1X3EA 4HJAA 2JA8G 3UDFA 3K7UC 1Q7YC 2JA6G 5IYCG 4X65L 2B3GA 1L1OA 4MNOA 2D0PA 5GAHC 4HIMA 4A3JH 2F3IA 1Q81C 2JA7G 3PO2H 3CC4A 1IL2A 5IT9c 3M85A 1XNRL 3HOUG 4LFBQ 2YTXA 3KJPA 2JA5G 4R4TA 4DUZQ 3FP9A 1N33Q 4JI6L 2CFMA 1HNXQ 1FJGQ 3RLOA 1HZ9A 2UUCQ 1IBKQ 1UE1A 5E7NA 1PH9A 4A3DH 3AQQA 1N34L 5IYDG 3FKIG 2MNAA 4TVAB 3RLFA 2VQEQ 3HOVH 1NE3A 4YWKA 4JG2A 2K5NA 4DK6C 1IBML 2K75A 4L5SA 4A3LH 1YHAA 1KHIA 3ERSX 3CW2C 1WOCA 3M4PA 1WCMG 1IBLQ 2NZOA 3G4SA 3B6YA 4LFAQ 3F8TA 3S2HH 4XIGS 3TREA 4OO1G 1I3QH 3HFZB 4EQ5A 3I2ZA 4JBKA 1VQIA 3I4NG 1K3RA 4RG1A 4GLXA 4ME3A 2VUMG 1JJ2A 4O0AA 1QUQB 4A4IA 4YHHQ 3JAMc 4DR1Q 4DR5Q 2K50A 3FHWA 4C3JH 1EOVA 4B3TL 1BVSA 3H0GH 4BXXG 1IZ6A 3S15H 1BKBA 3PUXA 4POGA 1YEZA 2UUBL 3OYYA 2NZHA 1Q82C 1M90C 2WB1G 3HOWH 5AJ3L 4NXNQ 2PQAA 4PZ7A 4JBMA 4L5TA 4LF6Q 2BH8A 1VQCA 1VQ8A 4IOCA 2IX0A 4BBSG 4BBRH 3KJOA 5C3EH 1IYJB 3F2BA 2ZJRA 3CCUA 1JT8A 1G291 5IP7G 5HY6A 1PH6A 1VQMA 4GOPA 3W5OA 2Z0SA 1PHJA 4AIMA 4IFDJ 4IFDG 2RF4A 5J3BA 2F4VL 4A3GH 2JJQA 2MO1A 2Q2UA 3EIVA 4BY7G 2Q2IA 5C4XH 4DR2L 1HR0W 3KF8B 1X55A 4B3ML 2QA4A 3I7FA 1U5KA 2CKZB 5FJ8G 1VQ4A 1FVIA 4JI8L 2WFWA 1Y1WH 2BA0A 1VQJA 2MQHA 5GAEC 2KHJA 1EYGA 5EAYA 1EIYB 4JI5L 1HH2P 4DV0L 1JE5A 4OONA 5GROA 2E2JH 1YVCA 1PH8A 1YJNA 1YBYA 1E24A 4A3FH 4UPAA 4QGUA 3UE1A 3OTOQ 1PFSA 4A3MG 3L0OA 2WB1E 4DV6L 1PV4A 1VQ5A 3J7A5 4AQYL 4A3CG 2K5VA 2QEXA 2N3SA 4JI8Q 2AKWB 4HJ9A 1NMGA 3I4MG 1PH1A 1UE7A 1MKHA 4PZ8A 1TWFH 2L15A 4L5QA 4DV3L 4LF5L 4OWTB 3CP0A 3D0FA 4YWMA 2Q2HA 2UXBL 5K36G 2ZM6Q 4BY1H 2ZTEA 2UXDL 3S1NH 1B7YB 4DV5L 4QJFA 2E5LQ 4NXML 2OTJA 1K83H 5LMUQ 1KC8C 1W3SA 2DGYA 1TWAH 3J81j 4GKJQ 4EX5A 3EBEA 1I5FA 1Q1BA 3TS2A 1PVOA 3CPFA 5IWAQ 4KI0A 1TWGH 1VQFA 1S40A 1SRUA 1CSPA 4JI1Q 4UY8C 3ULLA 3BJUA 1NBWA 2JE6I 1JJGA 4DUYL 1OXTA 3HOZG 4JI0Q 2Q2TA 2HT1A 2VQFL 3J7ZC 2R7FA 3S1RH 4A93G 3A5UA 5IY0A 4R4IA 3J80c 2WAQG 4A76A 4DAMA 5H1SE 1HR0L 4LF4Q 4IO9A 4JI2L 1YZ6A 3KLWA 4LFCL 1PH4A 5C0XJ 3Q8DA 5M5YH 3AFPA 5C0XG 3I4OA 2HHHQ 4A3BH 4JYAL 3CC2A 3UDGA 1CKMA 1E7ZA 4DNIA 1T9HA 4QQBX 1WFQA 4P71A 1X3FA 5IP9G 4KHPL 1SLJA 3KF6A 1QVCA 5IYBH 4DKAC 1YHQA 1LYLA 1XPUA 1L1OB 1OXXK 1SN8A 4DR3Q 1I6HH 1UE6A 5JEAJ 2LXJA 5JEAG 4LFBL 4WJ4A 5C44H 4LNQA 3CXCA 4DUZL 1N33L 2HQLA 1A63A 1HNXL 1FJGL 1I94Q 2UUCL 1IBKL 3CAMA 3HOYH 4UP8A 1CSQA 2ZTCA 1PA6A 4JI4Q 1HNWQ 4R1JA 2WAQE 2VQEL 2D62A 4LW1A 4OWXB 3KFUA 4JC0A 1K8GA 2ALYB 2R6GA 1XPOA 1Y1VG 1Y14B 3A5ZB 2Y0SG 3F1ZA 1LUZA 4DPGA 1IBLL 2R93H 1GO3E 2R92H 1N32Q 3PO3G 4LFAL 1QVGA 5M5XH 4DV1Q 1DGSA 2I0QA 2PI2E 1A0IA 2AMCB 2UUAQ 5C4JH 4R4CA 2N78A 4DR1L 4DR5L 4YHHL 4JI7Q 3H3VI 3L7ZC 1X9NA 4PMWA 3ULPA 1K73C 3ICEA 4GNXB 5M3MH 1R9TH 1K9MC 4TQUS 3PIOA 2R7ZG 4LUZA 5FLMG 1TXYA 1N9WA 4A3IH 4YCVA 1YJWA 3S14H 2C35B 3K80C 4NXNL 1UE5A 1A8VA 2PQAB 4JOIA 2I5LX 4KHZA 2AWOA 1YIJA 4LF6L 2CQOA 1X3GA 2CWPA 4YWLA 1OTCA 4GNXA 5LMNQ 2ASBA 4FDBA 3U58A 1VQKA 4GOPB 2JEBI 2Y0SE 3M7NA 4YY3Q 3K0XA 1QZHA 3GTGH 4JCVE 1E1OA 4MTNA 1EUJA 4A3EH 1GD7A 4A3KG 3SGIA 2B63H 3KYHC 4JBWA 1LTLA 5GAGC 1L2FA 2VL6A 2NN6G 1X6OA 3CCRA 1PH7A 3JAMi 2AWNA 2LXKA 1JJCB 1P16A 4A3JG 1VQOA 2D0OA 2ES2A 1MJCA 3PO2G 4X66Q 3HKSA 4DR4Q 1VQGA 4UP7A 1VQNA 3OTOL 2E2HH 1CKNB 3CCMA 3G48A 4DV7Q 5FLXc 1J5EQ 2OQ0A 4OO1I 1AE3A 3HKZG 1LM0A 4DV2Q 4A3DG 3DLLA 1X54A 3I56A 3M9BA 1Q12A 1X56A 4PG3A 5M5WH 3MXNB 2YYZA 4R4QA 2ZM6L 4HIKA 4HJ8A 2OWOA 1VQDA 4A3LG 1NTGA 3T1YQ 1CKNA 2ID0A 3KDFA 4LUOA 5BR8Q 2E5LL 4OX9Q 1UWVA 1UEBA 4RMFA 5LMUL 4BA2I 1FGUA 4GKJL 1U0LA 1VS0A 4B3SQ 4LF8Q 4DR7Q 3GTQH 2A1AA 1KRSA 5IWAL 4LF7Q 4C2MH 4JI1L 4IJHA 1GM5A 2N49A 3HOXH 3G6EA 3OW2A 3H3VH 3J81c 4JI0L 1WYDA 3E9HA 2RHSB 2K4KA 3IRBA 3PF5A 1VQ7A 3CMEA 2UXCQ 4APVA 1E3PA 1NJIC 1RIPA 4J15A 2YTYA 2R7DA 1KD1C 4IFDI 1WI5A 3H0GG 2VY3A 1B70B 2GVAA 3CCSA 3CCEA 4LF4L 3S1QH 3HKZE 2IHFA 2JA8H 1P8LA 1SMXA 5M3FG 1D8LA 3GDEA 3PUZA 2HHHL 4HJ7A 5DLQE 5IYCH 2UU9Q 1YNXA 2JA6H 3HOWG 5JJKA 1EIFA 5JJLA 2JA7H 2E8GA 3KF6B 3PCOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BZK A;  2YU9 H;  3HOU H;  4BBR G;  1HZB A;  1VQB A;  2PNH A;  2MO0 A;  4X62 Q;  5C3E G;  1SE8 A;  5ELN A;  4HID A;  2JA5 H;  3S1M H;  4IOA A;  4JV5 Q;  1TWC H;  4DR3 L;  5ELO A;  4A3G G;  1HZA A;  5IYD H;  3FKI H;  1S3O A;  3PSI A;  4JI3 Q;  4IJL A;  5C4X G;  1Z9F A;  2OCE A;  2YV5 A;  1ASY A;  4QL5 A;  1I94 L;  1KIX A;  3W1B A;  2Z6K C;  3ER0 A;  3K81 C;  3F2C A;  1Y1W G;  1QVF A;  3STB C;  3STB D;  4JI4 L;  2IX1 A;  4AH6 A;  2NVQ H;  1WCM H;  3J80 i;  1Q86 C;  2A8V A;  1HNW L;  1MJE A;  2FXQ A;  3PV0 A;  2YTV A;  2BA1 A;  2OQK A;  1WJJ A;  2B29 A;  4QIW E;  4A3F G;  2JEA I;  3LGJ A;  2NVX H;  3I4N H;  1Q46 A;  3M4O H;  1EFW A;  2NVT H;  2VUM H;  2JK8 A;  4GN3 B;  3S17 H;  2MFI A;  4LF9 Q;  3RR5 A;  3D31 A;  3PF4 A;  1N32 L;  1NY4 A;  4DV1 L;  2HIV A;  4NPS A;  1XMQ Q;  4BXX H;  4DV4 Q;  4LUV A;  3GTJ H;  4K0K Q;  2UUA L;  2KBN A;  3E0E A;  4BY1 G;  1W2B A;  1VQE A;  1L0W A;  4HJ5 A;  4GKK Q;  1XJV A;  4A75 A;  2VZA A;  4JI7 L;  1IXR A;  1C9O A;  1PH2 A;  4GLV B;  1N36 Q;  1SRO A;  5C0X I;  4X6A H;  3MEF A;  3CPW A;  3G71 A;  4BBS H;  3VDY A;  3ULJ A;  4DR6 Q;  2PI2 A;  5IP7 H;  1TWH H;  1ASZ A;  1AH9 A;  1HNZ Q;  1PYS B;  1OXV A;  3CF5 A;  1PH3 A;  2EXD A;  1V43 A;  4GN5 A;  4BY7 H;  5LMN L;  1V1Q A;  1A62 A;  3TRZ A;  4X64 Q;  4UP9 A;  4P74 A;  1QZG A;  5IE8 A;  2RHQ B;  2RCN A;  1VQA A;  2IHE A;  3UDX A;  2NVY H;  2WP8 J;  4YY3 L;  4OWW B;  5FJ8 H;  4WJ3 M;  3A0J A;  1KXL A;  3RN5 A;  2KHI A;  3RZO H;  4A3B G;  3CCJ A;  3UDI A;  2IY5 B;  1Q1E A;  4X65 Q;  3GTP H;  1J6Q A;  1OXU A;  3GD7 A;  4DAY B;  2IT1 A;  1XNR Q;  5IYB G;  3RN2 A;  4A3M H;  4XTC S;  4A3C H;  3JC6 6;  1I50 H;  4R4O A;  4JI6 Q;  1H95 A;  4IPH A;  4C3I H;  2EIF A;  1PH5 A;  3I4M H;  4X66 L;  1N34 Q;  4DR4 L;  3PUV A;  3E9I A;  1BBU A;  5C44 G;  3GTK H;  4DV7 L;  2VS1 A;  1C0A A;  2JQO A;  1J5E L;  1IBM Q;  1XPR A;  4OXP A;  3HOY G;  4DV2 L;  3NEM A;  1E1T A;  1OXS C;  4GS3 A;  2JA9 A;  2QGQ A;  2K52 A;  2V1C C;  4B3R L;  5HGQ A;  3T1Y L;  3KDF B;  2Z6K A;  2KEN A;  3W1G A;  2LSS A;  5BR8 L;  5M3F H;  4OX9 L;  3S2D H;  3M4Q A;  3HOZ H;  2R93 G;  1YHB A;  4B3S L;  2I5H A;  4LF8 L;  2R92 G;  4A93 H;  4DR7 L;  1QUQ A;  3CMA A;  3M3Y H;  1VCI A;  4LF7 L;  1S72 A;  1RL2 A;  3HOV G;  4B3T Q;  3RZD H;  3PGZ A;  3CCV A;  1C7Y A;  2F52 A;  3GTL H;  3AEV A;  4PZ6 A;  3RLN A;  3H15 A;  3NEL A;  1KRT A;  1MIU A;  4DK3 C;  4P73 A;  2UUB Q;  1AE2 A;  1JB7 A;  2UXC L;  4HIO A;  1L1O C;  2EQS A;  2N8N A;  3CQZ H;  3CCQ A;  1FL0 A;  5M3M G;  5AJ3 Q;  3PIP A;  1YJ9 A;  3WWV A;  2E2I H;  5IP9 H;  1VQL A;  2DUD A;  4P75 A;  2VW9 A;  3TS0 A;  2UU9 L;  4A3I G;  2XGT A;  4Y52 H;  3KOJ A;  1E22 A;  2NN6 I;  3A74 A;  4GN4 B;  4AYB G;  2F4V Q;  2VNU D;  3K8A A;  2H5X A;  2ZJP A;  3NEN A;  1SR3 A;  4X62 L;  1K8A C;  3PUW A;  2XTI A;  4IPC A;  3I55 A;  4DR2 Q;  1YIT A;  4JV5 L;  1KAW A;  1M1K C;  1VQH A;  4B3M Q;  1B8A A;  4L5R C;  1VQP A;  4IPD A;  1EWI A;  1KL9 A;  4JI3 L;  3AYH B;  4A3E G;  4Y7N H;  3NBH B;  2A19 A;  4P72 A;  3U4V A;  4YCW A;  3J81 i;  4DV0 Q;  4JI5 Q;  2B63 G;  3RNU A;  2OTL A;  3BU2 A;  1HZC A;  1EQR A;  1XTD A;  3CCL A;  1Y1V H;  3U50 C;  4DV6 Q;  3GO5 A;  4QY7 A;  4AQY Q;  3F2D A;  3TQY A;  5LMN W;  1BBW A;  1GVP A;  4JOI C;  3S16 H;  3PO3 H;  1YI2 A;  1G51 A;  3AFQ A;  4DV3 Q;  2ZTD A;  2PMZ E;  3U4Z A;  4GNX C;  4LF5 Q;  1D7Q A;  3TEH B;  1XMO L;  2UXB Q;  2ZJQ A;  3GTM H;  3PUY A;  1Q8K A;  2GVB A;  4LF9 L;  1VQ9 A;  4AYB E;  2UXD Q;  2K5H A;  4DV5 Q;  4NXM Q;  1CUK A;  2AHO B;  1O7I A;  1XMQ L;  2HIX A;  1GKH A;  4DV4 L;  4K0K L;  2R7Z H;  1N8R C;  4GKK L;  1JMC A;  1XMO Q;  2CWA A;  4POF A;  1NMF A;  5FLM H;  4JBJ A;  1XNQ L;  5JJI A;  4GOP C;  4YCU A;  3DM3 A;  2K14 A;  1K0R A;  4LWC A;  3K7A H;  1HJP A;  3S24 A;  3ZJY C;  4BA1 I;  4DUY Q;  3T1H L;  1EQQ A;  1N36 L;  1PYB A;  2VQF Q;  1V9P A;  3BZC A;  3EN2 A;  3CD6 A;  4KLK A;  4DR6 L;  2KCM A;  2ATW A;  1X65 A;  1Z47 A;  3HOX G;  1HNZ L;  3L2P A;  4H02 A;  4IPG A;  1HR0 Q;  1XNQ Q;  1G6P A;  4ALP A;  4JI2 Q;  3CC7 A;  1CKO A;  2KCT A;  4MZ9 A;  1KQS A;  1SFO H;  4LFC Q;  4B3R Q;  4JYA Q;  4GLA C;  3T1H Q;  4C3H H;  3UE0 A;  4X64 L;  3GTO H;  4A3K H;  1VQ6 A;  2BH2 A;  4O2D A;  5GQO A;  2I5M X;  2GN5 A;  4NB3 A;  2CCZ A;  5GAD C;  4KHP Q;  1X3E A;  4HJA A;  2JA8 G;  3UDF A;  3K7U C;  1Q7Y C;  2JA6 G;  5IYC G;  4X65 L;  2B3G A;  1L1O A;  4MNO A;  2D0P A;  5GAH C;  4HIM A;  4A3J H;  2F3I A;  1Q81 C;  2JA7 G;  3PO2 H;  3CC4 A;  1IL2 A;  5IT9 c;  3M85 A;  1XNR L;  3HOU G;  4LFB Q;  2YTX A;  3KJP A;  2JA5 G;  4R4T A;  4DUZ Q;  3FP9 A;  1N33 Q;  4JI6 L;  2CFM A;  1HNX Q;  1FJG Q;  3RLO A;  1HZ9 A;  2UUC Q;  1IBK Q;  1UE1 A;  5E7N A;  1PH9 A;  4A3D H;  3AQQ A;  1N34 L;  5IYD G;  3FKI G;  2MNA A;  4TVA B;  3RLF A;  2VQE Q;  3HOV H;  1NE3 A;  4YWK A;  4JG2 A;  2K5N A;  4DK6 C;  1IBM L;  2K75 A;  4L5S A;  4A3L H;  1YHA A;  1KHI A;  3ERS X;  3CW2 C;  1WOC A;  3M4P A;  1WCM G;  1IBL Q;  2NZO A;  3G4S A;  3B6Y A;  4LFA Q;  3F8T A;  3S2H H;  4XIG S;  3TRE A;  4OO1 G;  1I3Q H;  3HFZ B;  4EQ5 A;  3I2Z A;  4JBK A;  1VQI A;  3I4N G;  1K3R A;  4RG1 A;  4GLX A;  4ME3 A;  2VUM G;  1JJ2 A;  4O0A A;  1QUQ B;  4A4I A;  4YHH Q;  3JAM c;  4DR1 Q;  4DR5 Q;  2K50 A;  3FHW A;  4C3J H;  1EOV A;  4B3T L;  1BVS A;  3H0G H;  4BXX G;  1IZ6 A;  3S15 H;  1BKB A;  3PUX A;  4POG A;  1YEZ A;  2UUB L;  3OYY A;  2NZH A;  1Q82 C;  1M90 C;  2WB1 G;  3HOW H;  5AJ3 L;  4NXN Q;  2PQA A;  4PZ7 A;  4JBM A;  4L5T A;  4LF6 Q;  2BH8 A;  1VQC A;  1VQ8 A;  4IOC A;  2IX0 A;  4BBS G;  4BBR H;  3KJO A;  5C3E H;  1IYJ B;  3F2B A;  2ZJR A;  3CCU A;  1JT8 A;  1G29 1;  5IP7 G;  5HY6 A;  1PH6 A;  1VQM A;  4GOP A;  3W5O A;  2Z0S A;  1PHJ A;  4AIM A;  4IFD J;  4IFD G;  2RF4 A;  5J3B A;  2F4V L;  4A3G H;  2JJQ A;  2MO1 A;  2Q2U A;  3EIV A;  4BY7 G;  2Q2I A;  5C4X H;  4DR2 L;  1HR0 W;  3KF8 B;  1X55 A;  4B3M L;  2QA4 A;  3I7F A;  1U5K A;  2CKZ B;  5FJ8 G;  1VQ4 A;  1FVI A;  4JI8 L;  2WFW A;  1Y1W H;  2BA0 A;  1VQJ A;  2MQH A;  5GAE C;  2KHJ A;  1EYG A;  5EAY A;  1EIY B;  4JI5 L;  1HH2 P;  4DV0 L;  1JE5 A;  4OON A;  5GRO A;  2E2J H;  1YVC A;  1PH8 A;  1YJN A;  1YBY A;  1E24 A;  4A3F H;  4UPA A;  4QGU A;  3UE1 A;  3OTO Q;  1PFS A;  4A3M G;  3L0O A;  2WB1 E;  4DV6 L;  1PV4 A;  1VQ5 A;  3J7A 5;  4AQY L;  4A3C G;  2K5V A;  2QEX A;  2N3S A;  4JI8 Q;  2AKW B;  4HJ9 A;  1NMG A;  3I4M G;  1PH1 A;  1UE7 A;  1MKH A;  4PZ8 A;  1TWF H;  2L15 A;  4L5Q A;  4DV3 L;  4LF5 L;  4OWT B;  3CP0 A;  3D0F A;  4YWM A;  2Q2H A;  2UXB L;  5K36 G;  2ZM6 Q;  4BY1 H;  2ZTE A;  2UXD L;  3S1N H;  1B7Y B;  4DV5 L;  4QJF A;  2E5L Q;  4NXM L;  2OTJ A;  1K83 H;  5LMU Q;  1KC8 C;  1W3S A;  2DGY A;  1TWA H;  3J81 j;  4GKJ Q;  4EX5 A;  3EBE A;  1I5F A;  1Q1B A;  3TS2 A;  1PVO A;  3CPF A;  5IWA Q;  4KI0 A;  1TWG H;  1VQF A;  1S40 A;  1SRU A;  1CSP A;  4JI1 Q;  4UY8 C;  3ULL A;  3BJU A;  1NBW A;  2JE6 I;  1JJG A;  4DUY L;  1OXT A;  3HOZ G;  4JI0 Q;  2Q2T A;  2HT1 A;  2VQF L;  3J7Z C;  2R7F A;  3S1R H;  4A93 G;  3A5U A;  5IY0 A;  4R4I A;  3J80 c;  2WAQ G;  4A76 A;  4DAM A;  5H1S E;  1HR0 L;  4LF4 Q;  4IO9 A;  4JI2 L;  1YZ6 A;  3KLW A;  4LFC L;  1PH4 A;  5C0X J;  3Q8D A;  5M5Y H;  3AFP A;  5C0X G;  3I4O A;  2HHH Q;  4A3B H;  4JYA L;  3CC2 A;  3UDG A;  1CKM A;  1E7Z A;  4DNI A;  1T9H A;  4QQB X;  1WFQ A;  4P71 A;  1X3F A;  5IP9 G;  4KHP L;  1SLJ A;  3KF6 A;  1QVC A;  5IYB H;  4DKA C;  1YHQ A;  1LYL A;  1XPU A;  1L1O B;  1OXX K;  1SN8 A;  4DR3 Q;  1I6H H;  1UE6 A;  5JEA J;  2LXJ A;  5JEA G;  4LFB L;  4WJ4 A;  5C44 H;  4LNQ A;  3CXC A;  4DUZ L;  1N33 L;  2HQL A;  1A63 A;  1HNX L;  1FJG L;  1I94 Q;  2UUC L;  1IBK L;  3CAM A;  3HOY H;  4UP8 A;  1CSQ A;  2ZTC A;  1PA6 A;  4JI4 Q;  1HNW Q;  4R1J A;  2WAQ E;  2VQE L;  2D62 A;  4LW1 A;  4OWX B;  3KFU A;  4JC0 A;  1K8G A;  2ALY B;  2R6G A;  1XPO A;  1Y1V G;  1Y14 B;  3A5Z B;  2Y0S G;  3F1Z A;  1LUZ A;  4DPG A;  1IBL L;  2R93 H;  1GO3 E;  2R92 H;  1N32 Q;  3PO3 G;  4LFA L;  1QVG A;  5M5X H;  4DV1 Q;  1DGS A;  2I0Q A;  2PI2 E;  1A0I A;  2AMC B;  2UUA Q;  5C4J H;  4R4C A;  2N78 A;  4DR1 L;  4DR5 L;  4YHH L;  4JI7 Q;  3H3V I;  3L7Z C;  1X9N A;  4PMW A;  3ULP A;  1K73 C;  3ICE A;  4GNX B;  5M3M H;  1R9T H;  1K9M C;  4TQU S;  3PIO A;  2R7Z G;  4LUZ A;  5FLM G;  1TXY A;  1N9W A;  4A3I H;  4YCV A;  1YJW A;  3S14 H;  2C35 B;  3K80 C;  4NXN L;  1UE5 A;  1A8V A;  2PQA B;  4JOI A;  2I5L X;  4KHZ A;  2AWO A;  1YIJ A;  4LF6 L;  2CQO A;  1X3G A;  2CWP A;  4YWL A;  1OTC A;  4GNX A;  5LMN Q;  2ASB A;  4FDB A;  3U58 A;  1VQK A;  4GOP B;  2JEB I;  2Y0S E;  3M7N A;  4YY3 Q;  3K0X A;  1QZH A;  3GTG H;  4JCV E;  1E1O A;  4MTN A;  1EUJ A;  4A3E H;  1GD7 A;  4A3K G;  3SGI A;  2B63 H;  3KYH C;  4JBW A;  1LTL A;  5GAG C;  1L2F A;  2VL6 A;  2NN6 G;  1X6O A;  3CCR A;  1PH7 A;  3JAM i;  2AWN A;  2LXK A;  1JJC B;  1P16 A;  4A3J G;  1VQO A;  2D0O A;  2ES2 A;  1MJC A;  3PO2 G;  4X66 Q;  3HKS A;  4DR4 Q;  1VQG A;  4UP7 A;  1VQN A;  3OTO L;  2E2H H;  1CKN B;  3CCM A;  3G48 A;  4DV7 Q;  5FLX c;  1J5E Q;  2OQ0 A;  4OO1 I;  1AE3 A;  3HKZ G;  1LM0 A;  4DV2 Q;  4A3D G;  3DLL A;  1X54 A;  3I56 A;  3M9B A;  1Q12 A;  1X56 A;  4PG3 A;  5M5W H;  3MXN B;  2YYZ A;  4R4Q A;  2ZM6 L;  4HIK A;  4HJ8 A;  2OWO A;  1VQD A;  4A3L G;  1NTG A;  3T1Y Q;  1CKN A;  2ID0 A;  3KDF A;  4LUO A;  5BR8 Q;  2E5L L;  4OX9 Q;  1UWV A;  1UEB A;  4RMF A;  5LMU L;  4BA2 I;  1FGU A;  4GKJ L;  1U0L A;  1VS0 A;  4B3S Q;  4LF8 Q;  4DR7 Q;  3GTQ H;  2A1A A;  1KRS A;  5IWA L;  4LF7 Q;  4C2M H;  4JI1 L;  4IJH A;  1GM5 A;  2N49 A;  3HOX H;  3G6E A;  3OW2 A;  3H3V H;  3J81 c;  4JI0 L;  1WYD A;  3E9H A;  2RHS B;  2K4K A;  3IRB A;  3PF5 A;  1VQ7 A;  3CME A;  2UXC Q;  4APV A;  1E3P A;  1NJI C;  1RIP A;  4J15 A;  2YTY A;  2R7D A;  1KD1 C;  4IFD I;  1WI5 A;  3H0G G;  2VY3 A;  1B70 B;  2GVA A;  3CCS A;  3CCE A;  4LF4 L;  3S1Q H;  3HKZ E;  2IHF A;  2JA8 H;  1P8L A;  1SMX A;  5M3F G;  1D8L A;  3GDE A;  3PUZ A;  2HHH L;  4HJ7 A;  5DLQ E;  5IYC H;  2UU9 Q;  1YNX A;  2JA6 H;  3HOW G;  5JJK A;  1EIF A;  5JJL A;  2JA7 H;  2E8G A;  3KF6 B;  3PCO B; 
#chains in the Genus database with same CATH topology
 5C3X A;  2YU9 H;  3F2U A;  4HID A;  1SE8 A;  5ELN A;  4IOA A;  1EOT A;  1B9M A;  3I91 A;  4CGY B;  4RFB A;  1TWC H;  4DR3 L;  1LTA D;  1HZA A;  4OEM B;  4XQQ A;  4RKL A;  1Z9F A;  5FLX L;  1I94 L;  2Z6K C;  1JR0 D;  3SE0 A;  2NVQ H;  3QOJ A;  1XYI A;  1WJJ A;  2B29 A;  3OW7 A;  5M9O A;  2NVX H;  3I4N H;  1E2Z A;  1F9P A;  5CV4 A;  2AQ2 B;  2A69 C;  1SBB B;  2A69 D;  2MFI A;  3U9S A;  4LF9 Q;  3RR5 A;  3D31 A;  5EPJ A;  4C2M B;  3S17 H;  1LTB D;  3TP7 A;  3DWA A;  5BN4 A;  4NPS A;  4K2L A;  2OEO A;  4DV4 Q;  3VYR A;  3TSS A;  1XX8 A;  1L0W A;  4K5V A;  2M00 A;  4A75 A;  1IXR A;  1Q3L A;  1SRO A;  5C0X I;  4X6A H;  3G71 A;  4BBS H;  1OO9 B;  2PI2 A;  4DR6 Q;  3NQI A;  1AH9 A;  3R93 A;  3CF5 A;  3R2I A;  2CHB D;  4GN5 A;  2ZXO A;  1V1Q A;  1Y8P B;  4K8I A;  2E75 C;  3TRZ A;  1QJO A;  4DXG A;  4WJW A;  4YY3 L;  4OWW B;  1JOO A;  3FKI B;  1KXL A;  4K8J A;  2ICE C;  2IY5 B;  5IOD A;  4KHV A;  1ILQ A;  2XVS A;  3IAY A;  4FVM A;  5E3F A;  3GTP H;  1OXU A;  3GD7 A;  2H1E A;  4XTC S;  4S3S A;  5EPK A;  1G8Z D;  3JC6 6;  4FYD A;  5I9O A;  4JI6 Q;  2EJF C;  1PH5 A;  1DCZ A;  1N34 Q;  2ZT9 C;  1ENC A;  1GUN A;  1H9S A;  4FP5 D;  1O7Z A;  3K7A B;  2A6H C;  2VS1 A;  2A6H D;  3MXG A;  4KKU A;  2EPB A;  1E1T A;  2JA9 A;  2PNR C;  2K52 A;  5DNF A;  2H4O A;  2V1C C;  4PV1 C;  3O13 A;  4ZUI A;  2TSS A;  4OX9 L;  4B3S L;  1VCI A;  1MI2 A;  2WIN B;  3HOV G;  1NSN S;  2F52 A;  2K1B A;  4DK3 C;  3CQZ H;  5ELD A;  3RZO B;  4RHS A;  4A3D B;  3HZX A;  2RCF A;  2UU9 L;  4Y52 H;  2DJF C;  4FF1 A;  3HS0 C;  4ABN A;  1FNU A;  1KLU D;  2VNU D;  5JEA H;  1BCP F;  5LL6 X;  5T1I A;  2L55 A;  4JV5 L;  1PRT C;  3H3V C;  1PRT D;  4PMC A;  4IQZ A;  4B3M Q;  4L5R C;  1IKM A;  2LS0 1;  1VQP A;  3IKJ A;  1KL9 A;  4JI3 L;  3AYH B;  4A3E G;  3MTS A;  3PQI A;  4JI5 Q;  1WTQ A;  2KVM A;  1WTX A;  4AQY Q;  5FOB B;  5AFW A;  2B8G A;  2G9H D;  1YI2 A;  1JOR A;  1CTM A;  1RCV D;  5JPM C;  1EU4 A;  1FD7 D;  5ELC A;  5M3F B;  1D7Q A;  5CYU A;  4ID6 A;  1FR3 A;  3GTM H;  1Q8K A;  4A93 B;  3M3Y B;  2R61 A;  2VB2 X;  1EIH A;  4NXM Q;  4KD4 A;  2SOB A;  4K0K L;  1SNO A;  2CWA A;  4POF A;  5FLM H;  1XMO Q;  4GOP C;  3DM3 A;  1EQQ A;  1DJR D;  3K7A H;  1N36 L;  3T1H L;  2HDM A;  3ERO A;  4IUU A;  3J81 E;  3BZC A;  5DM6 3;  1G91 A;  4KLK A;  2KEC A;  1Z47 A;  3GQB A;  1U4M A;  2RSN A;  4IPG A;  3L2P A;  1CA5 A;  1XNQ Q;  1G6P A;  4JI2 Q;  4LFC Q;  4B3R Q;  2PQE A;  3EVQ A;  1STE A;  4GLA C;  1H9R A;  1LV9 A;  2BH2 A;  5GQO A;  3LNN A;  4NB3 A;  1X3E A;  1KTK A;  1Q7Y C;  4Y7N B;  2JA6 G;  1DXM A;  2JA7 G;  1TS3 A;  2M9V A;  4HR7 B;  4ZUJ A;  5IT9 c;  1XNR L;  4LFB Q;  1CI3 M;  2RSO A;  4CDD C;  3FP9 A;  1FJG Q;  1TWA B;  2HCC A;  4A3D H;  3FKI G;  5J39 A;  2AUJ D;  3E6Z X;  4DK6 C;  1IBM L;  2F4I A;  4DNT B;  1MD2 D;  1S4Z A;  1YHA A;  4EGV A;  1LTG D;  1ROD A;  1WOC A;  1RDP D;  1KNA A;  3P7J A;  4FF2 A;  3G4S A;  2EY1 A;  3TRE A;  4OO1 G;  3I2Z A;  1BUV T;  1K3R A;  4RG1 A;  2JXM B;  3S9W A;  1SNQ A;  1Z7T A;  4NDX A;  2A73 B;  1UEA B;  1LTI D;  2F0M A;  3S15 H;  1V1P B;  4RWS C;  4POG A;  1YEZ A;  3CU7 A;  4C3H B;  2UUB L;  3OYY A;  1M90 C;  5C6A A;  4L63 B;  5FO8 B;  5C44 B;  4L5T A;  2IX0 A;  1IYJ B;  1JT8 A;  4A3J B;  1ZEQ X;  5HY6 A;  5KEE A;  1VQM A;  1PH6 A;  1K8M A;  2Z0S A;  4ZCK A;  2EYO A;  1SXT A;  2MO1 A;  2Q2U A;  3EIV A;  3K59 A;  4DR2 L;  1SYE A;  2NWG A;  1HR0 W;  3I7F A;  1UAP A;  1VQ4 A;  1A15 A;  2R92 B;  4JI8 L;  1H9M A;  5EBD A;  5EKL A;  5EAY A;  1B3A A;  1ENA A;  1HH2 P;  4DV0 L;  2NTS A;  4OON A;  2E2J H;  1YBY A;  1E24 A;  4CJ1 B;  4ZKC B;  4QGU A;  1B53 A;  3L0O A;  3FRP B;  3J7A 5;  1K0S A;  4FNF A;  2K5V A;  2QEX A;  1WTH A;  2AKW B;  1O80 A;  4HJ9 A;  1PH1 A;  1UE7 A;  4PZ8 A;  5JAV A;  4L5Q A;  1ESR A;  1TVX A;  4YWM A;  2UXB L;  1B3Q A;  1WTO A;  2E5L Q;  2OTJ A;  2NUC A;  1TWA H;  2QDB A;  5FLX E;  3CPF A;  2BOS A;  5T1G A;  4JI1 Q;  1PFM A;  4DK1 A;  2JE6 I;  4DUY L;  2Q2T A;  3OWE B;  3J7Z C;  3S1R H;  4A93 G;  2QIL A;  3K57 A;  3A5U A;  2EZV A;  4R4I A;  5D3I B;  3H6M A;  3NE5 B;  4LF4 Q;  4IO9 A;  1HFN A;  4RKB A;  3OMG A;  1PH4 A;  3TZD A;  1ZYR C;  2HHH Q;  3QJY A;  1ZYR D;  1U4L A;  2RVL A;  2G5D A;  2PO4 A;  1NAP A;  1AP0 A;  1WFQ A;  1BOS A;  1XPU A;  3L9A X;  1L1O B;  4RAU C;  1RTN A;  4HMI A;  5JEA J;  2Z9H A;  2A5H A;  5C44 H;  4DUZ L;  2HQL A;  1IBK L;  3I8Z A;  3GTQ B;  2ZTC A;  1Q90 A;  2WII B;  4R1J A;  2WAQ E;  2VQE L;  1F9Q A;  2SEB D;  2KEE A;  1DOK A;  1XPO A;  3A5Z B;  2Y0S G;  3F1Z A;  3IFT A;  4DPG A;  2D5D A;  1GO3 E;  2R92 H;  1N32 Q;  2O2L D;  4DV1 Q;  1L0Y B;  2PI2 E;  1A0I A;  2AMC B;  2LFN A;  2UUA Q;  5C4J H;  3BG3 A;  5ELF A;  4DR5 L;  2Q8R E;  1S5B D;  1A6X A;  3S1M B;  1W6K A;  3T4A C;  2R7Z G;  4LUZ A;  3EJI A;  5EPL A;  4CJ0 B;  5M5Y B;  1BCP C;  1BCP D;  5LHY 1;  4YCV A;  2C35 B;  3K80 C;  5KYL A;  5E1F A;  2I5L X;  2QEJ C;  2CWP A;  1OTC A;  3U58 A;  1VQK A;  3M7N A;  1WCM B;  2NBF A;  3I90 A;  5JPN C;  3K0X A;  1BBX C;  1EUJ A;  4C3H G;  3SGI A;  1AN8 A;  2NVT B;  4QUF A;  1L2F A;  2VL6 A;  2NN6 G;  1RHP A;  2LXK A;  1ZXT A;  1P16 A;  4FXG C;  4A3J G;  3OIP A;  1VQN A;  4KY6 A;  5COY A;  2R93 B;  2CW0 C;  1EY5 A;  1HTP A;  2CW0 D;  3G48 A;  4OO1 I;  1IL8 A;  4XT3 B;  3HKZ G;  1LM0 A;  4DAP A;  4DV2 Q;  1SYC A;  1LAB A;  2B2V A;  4G7H C;  3M9B A;  4C1N K;  4PG3 A;  2PCF B;  1LAC A;  4HIK A;  1VQD A;  4A3L G;  1GHK A;  3T1Y Q;  4BY7 B;  4C3I G;  5C0X H;  5LMU L;  4BA2 I;  4GKJ L;  1VS0 A;  1TU2 B;  5CMD A;  4LF8 Q;  4DR7 Q;  3C46 A;  3GTQ H;  5IWA L;  4LF7 Q;  1GM5 A;  2N49 A;  1UNS A;  3J81 c;  3D4R A;  3D6C A;  2IPK D;  3FMC A;  3PF5 A;  3K58 A;  1I4H A;  4KN7 C;  4APV A;  1RIP A;  3QWN A;  1I50 B;  3H0G G;  2F0H A;  1B70 B;  4UDU C;  1BDO A;  3I4M B;  3NPP A;  3SDZ A;  2EYJ A;  1SMX A;  3GDE A;  3PUZ A;  5IYC H;  1EIF A;  3KF6 B;  3PCO B;  3QOL A;  4BBR G;  3S1M H;  4ZKB B;  1SDF A;  4B9W A;  2VXW A;  2FMM A;  1H9K A;  3PSI A;  1GUT A;  2OCE A;  4DK0 A;  1PXU A;  3A8I E;  1NNX A;  1QOH A;  3P1H A;  1QVF A;  2IX1 A;  4PMB A;  4AH6 A;  1HNW L;  1WCM H;  4RGO S;  2RQX A;  1Q86 C;  2A8V A;  1HRJ A;  1MJE A;  3U9O A;  2OQK A;  1Q46 A;  5I6W A;  1EFW A;  2NVT H;  2VUM H;  1JWU D;  1EQV A;  2B2Y C;  3MFY A;  4HED A;  1C8C A;  2ZXR A;  2HIV A;  1JE4 A;  5J1Z A;  4BY1 G;  1VQE A;  1QNU A;  2VZA A;  4BWG B;  1C9O A;  1PH2 A;  4GLV B;  3S1Q B;  3NWS A;  3CPW A;  3VR2 A;  3VDY A;  5IP7 H;  3CRK C;  1ASZ A;  3DEO A;  1HNZ Q;  1OXV A;  5EBC A;  4IFD H;  2YU9 B;  1G2T A;  2EXD A;  1XTC D;  4BY7 H;  5LMN L;  1A62 A;  1Y1V B;  2K7V A;  1TWC B;  2RCN A;  1VQA A;  5FJ8 H;  4A3B G;  3DUZ A;  3UDI A;  4X65 Q;  2MP1 A;  5KRU A;  1J6Q A;  2Q8T A;  1PLF A;  3Q23 A;  5IYB G;  3RN2 A;  4A3M H;  2NVQ B;  1I50 H;  1SNP A;  2K04 A;  3MA2 B;  3I4M H;  4X66 L;  2NVX B;  4DR4 L;  1BBU A;  4DV7 L;  1C0A A;  3ND9 A;  2SNS A;  2PYK A;  3HOY G;  2DN8 A;  2JSO A;  5BN3 A;  2F0W A;  3K5N A;  1G2S A;  2WB1 B;  3KDF B;  1SE4 A;  1EQT A;  5BR8 L;  3S2D H;  3M4Q A;  2R93 G;  1YHB A;  4X3K A;  4V19 0;  4BBS B;  1GHJ A;  1QUQ A;  4B3T Q;  3RZD H;  1JCK B;  3CCV A;  4XQN A;  3GTL H;  2F0E A;  2UXC L;  1B44 D;  1Z6H A;  2K05 A;  4HIO A;  1WTV A;  3CCQ A;  2EQS A;  2N8N A;  3CCL A;  1FL0 A;  5M3M G;  1A3T A;  5L37 A;  5AJ3 Q;  3WWV A;  3MXP A;  3SK4 A;  5IP9 H;  1B50 A;  2VW9 A;  2J7Z A;  3GTP B;  2WAC A;  3KLS A;  5CGK A;  2NN6 I;  5JVG 3;  4AYB G;  2F4V Q;  2K5Q A;  3BVZ A;  1LT5 D;  2RDH A;  2H5X A;  2J4X A;  4X62 L;  3PUW A;  2XTI A;  5ISR A;  4CDE C;  1J9O A;  3ITP A;  3VR5 A;  1R4Q B;  4EQN A;  1EWI A;  3P20 A;  4YCW A;  2XWB B;  2OTL A;  1F2M A;  3BU2 A;  1HZC A;  1EQR A;  1CQF A;  1XTD A;  1Y1V H;  2IX3 A;  2F0L A;  4DV6 Q;  2CVR A;  3A56 A;  3CRL C;  3GO5 A;  4O1N A;  4QY7 A;  3F2D A;  5LMN W;  4JOI C;  1GVP A;  3S16 H;  1GUW A;  3PO3 H;  1G51 A;  3AFQ A;  3BYY B;  4LF5 Q;  3U4Z A;  1WTW A;  1XMO L;  3I4L A;  3HOW B;  2WKD A;  2IWH A;  4TRD A;  4DV5 Q;  5KYI A;  1CUK A;  1TT2 A;  3DHQ A;  1TS5 A;  1XMQ L;  2HIX A;  1UUP A;  1D5Z C;  1N8R C;  4GKK L;  4A3G B;  1NMF A;  1XNQ L;  3CQZ B;  4YCU A;  4ZLT F;  2K14 A;  4B3R L;  4LWC A;  3ZJY C;  4LAA A;  3M4Y A;  1FYC A;  1Y1W B;  2KCM A;  1X65 A;  2DY7 A;  1CKO A;  2KCT A;  1BQQ T;  2Z4H A;  4JVZ A;  4JYA Q;  4X64 L;  2SDF A;  5LL6 S;  4KHP Q;  2CCZ A;  5C5L A;  4HJA A;  1TWF B;  3UDF A;  1Q81 C;  2D0P A;  5FO7 B;  3CC4 A;  1IL2 A;  3OPO A;  4FO2 A;  3M85 A;  3KJP A;  3RD4 A;  1N33 Q;  2QCP X;  2EYM A;  3TBI B;  2CFM A;  1HNX Q;  3RLO A;  1HZ9 A;  3IL8 A;  3DM1 A;  4OIK A;  2KCN A;  2F0F A;  4IUR A;  1LO5 D;  5EJW A;  4TSS A;  3GTM B;  3HOV H;  1BO0 A;  1EY6 A;  4L5S A;  2K75 A;  2BCO A;  3ERS X;  3CW2 C;  3OHX C;  1IBL Q;  1HPC A;  1TS2 A;  1EWC A;  5FK9 C;  4LFA Q;  1RD9 D;  3TME A;  3K5M A;  1I3Q H;  4EQ5 A;  3I4N G;  2V4D A;  1RTO A;  4ME3 A;  3Q22 A;  3HG9 A;  3FHW A;  1EOV A;  3T13 A;  1EY7 A;  1BVS A;  4M1U B;  1IZ6 A;  1BKB A;  1JOK A;  2NZH A;  2RDF A;  2WB1 G;  3HOW H;  4J6H A;  2BH8 A;  1VQC A;  4BBS G;  4PQX A;  5C3E H;  3CCU A;  2F0T A;  4CJ2 C;  2L5T A;  3T16 A;  1JWS D;  2OF1 A;  4AIM A;  1PHJ A;  4R8N A;  2B2Y A;  3MFG A;  2A68 D;  1SYD A;  4IFD J;  2RF4 A;  4A3G H;  4WRD A;  2L4N A;  4FF4 A;  5C4X H;  1PTO F;  1AZP A;  4ZK9 B;  2QA4 A;  4MN3 A;  4DU9 A;  1Y1W H;  3MEH A;  2AQ3 B;  2WV6 D;  5M5X B;  4XYO A;  1KAB A;  2PZW A;  1EIY B;  1JE5 A;  3HGB A;  4A3F H;  4RHR A;  1PFS A;  1VQ5 A;  4KD3 A;  1JIC A;  1Y8N B;  2LY7 A;  3KF8 A;  1T5X D;  1TWF H;  4DV3 L;  4OWT B;  3R3O A;  3I3C A;  3S14 B;  3MXN A;  2ZM6 Q;  3J7A V;  2ZTE A;  2UXD L;  4QJF A;  2B2U A;  5C4H A;  3P75 A;  4Q0F A;  2DGY A;  3S15 B;  3J81 j;  2LKV A;  3EBE A;  2F3V A;  5C3W A;  1TWG H;  1VDZ A;  3GTG B;  4UY8 C;  1SRU A;  3BJU A;  2F0D A;  2VQF L;  2R7F A;  5IY0 A;  4DAM A;  5DEH A;  1HR0 L;  1YZ6 A;  3KLW A;  1SJH D;  2KQ3 A;  3Q8D A;  3CC2 A;  3UDG A;  1AW7 A;  5I6Y A;  4QQB X;  3DEP A;  1SLJ A;  1QE6 A;  2F0I A;  4ULL A;  3FVQ A;  2J0T D;  4C56 C;  1PYW D;  1LTR D;  1A3V A;  2E2J B;  5M5W B;  1X3P A;  4DR3 Q;  4QCL A;  2B2V C;  2LXJ A;  5JEA G;  2K5W A;  2BDO A;  1TII D;  4IZ8 A;  4LNQ A;  2EY2 A;  1I94 Q;  2UUC L;  3CAM A;  1D1K A;  4UP8 A;  1CSQ A;  1EYD A;  1KDA A;  1PRT B;  1F9S A;  4LW1 A;  2EYH A;  2EDG A;  3G6J B;  4JC0 A;  4H44 C;  1DM0 B;  2OT2 A;  4IUP A;  1DD2 A;  4LMQ D;  4X3S A;  1O7Y A;  3A7A B;  4CKC A;  2JA8 B;  1TY2 A;  2L11 A;  5M5X H;  1DGS A;  1PFN A;  2EY6 A;  1FNV A;  5A35 A;  3S1R B;  4HCS A;  3CHB D;  3MHB A;  4DR1 L;  4YHH L;  2F0U A;  3DXJ C;  1IYU A;  2AUK A;  1R9T H;  1DZ1 A;  5FLM G;  1H9J A;  1N9W A;  4A3I H;  3S14 H;  2A6E C;  2A6E D;  4NXN L;  1HFG A;  2PQA B;  4JOI A;  2AWO A;  4DF7 A;  2DNE A;  1HXY D;  2CQO A;  1X3G A;  4LF6 L;  4YWL A;  4GOP B;  4YY3 Q;  1PZJ D;  5CV5 A;  3C2P A;  3GTG H;  4CHT B;  1GD7 A;  2B63 H;  2XSC A;  3K5L A;  4JBW A;  2FFK B;  5GAG C;  1XXG A;  1PH7 A;  1TS4 A;  3JAM i;  1D1I A;  2ES2 A;  1MJC A;  3QG1 A;  1VQG A;  3D4D A;  4RCO A;  4PNY A;  3OTO L;  1F9R A;  2E2H H;  4K5X A;  2O4X A;  2OQ0 A;  4R8I A;  4A3D G;  1HA6 A;  5HGT A;  2FMC A;  4L8J A;  3I56 A;  1Q12 A;  1SYG A;  1SMY C;  1SMY D;  5M5W H;  5C4J B;  1CT1 D;  4HJ8 A;  2OWO A;  1HA5 A;  4ILW A;  4OX9 Q;  1UWV A;  1Y8O B;  2HDL A;  4B3S Q;  3KUP A;  2F3W A;  4F87 A;  4IJH A;  4E6I A;  3OW2 A;  3HOX H;  3H3V H;  1W6J A;  3FDT A;  3NUC A;  4JI0 L;  2X69 A;  2XRQ D;  1S5D D;  4IUV A;  1GJX A;  1E3P A;  4J15 A;  2YTY A;  2R7D A;  1ENF A;  3CCE A;  2JA8 H;  5M3F G;  1GUO A;  2UU9 Q;  1D8L A;  1YNX A;  1ESF A;  4J1M A;  3GTK B;  1QB5 D;  3BZK A;  3HOU H;  1HZB A;  1VQB A;  2MO0 A;  2JA5 H;  4JV5 Q;  4Z9C B;  3D3R A;  5ELO A;  5IYD H;  2K5D A;  1S3O A;  3LX0 A;  4JI3 Q;  4IJL A;  2YV5 A;  3CKI B;  3HOZ B;  1AEX A;  1HTL D;  2GA4 B;  4QL5 A;  3W1B A;  1ILP A;  3ER0 A;  3F2C A;  1KDB A;  5IOC A;  1II3 A;  4JI4 L;  4RGT A;  3J80 i;  4G57 A;  2FXQ A;  3PV0 A;  1IHZ A;  2BA1 A;  1F2Z A;  3EQL C;  2JEA I;  2MPM A;  3LGJ A;  3M4O H;  2JK8 A;  1LTS D;  1SNC A;  2KED A;  4P2C B;  2X6G A;  2K6A A;  2QDL A;  1QCB D;  4CKE A;  4BXX H;  1MSG A;  5CV7 A;  4K0K Q;  3GTJ H;  2PZT A;  1STA A;  3E0E A;  1W2B A;  4HJ5 A;  2D9U A;  1XJV A;  4JI7 L;  3BDL A;  4DA2 A;  1KAA A;  1N36 Q;  4OEL B;  4KKT A;  3ULJ A;  1TWH H;  1PTO C;  5F2D A;  1PTO D;  3TP5 A;  3K5O A;  3GV3 A;  1PH3 A;  1STH A;  4OHJ A;  2C5C A;  4P74 A;  5IE8 A;  3H91 A;  4IUN A;  5NUC A;  4BS9 A;  4KKS A;  3A0J A;  1K8O A;  2CH4 A;  2KHI A;  3CCJ A;  1LT4 D;  3VYU A;  1Q1E A;  2NZ1 D;  4CDC C;  4L6T B;  1ICF B;  1EZ8 A;  1LLR D;  1XNR Q;  4KY7 A;  3DWP A;  5ELB A;  4I7Z C;  1JQY D;  4A3C H;  3QR8 A;  4R4O A;  4C3I H;  2EIF A;  3PUV A;  2L0C A;  2VUM B;  5I4D A;  5C44 G;  4DAY A;  3FPU B;  3GTK H;  2JQO A;  3SK8 A;  1J5E L;  3AB9 A;  1MHW C;  4OXP A;  1IBM Q;  3NEM A;  4R9W A;  3X3N A;  2QGQ A;  4G7O C;  3N6R A;  3W1G A;  2XRS D;  3HOZ H;  3GTO B;  4A3K B;  2I5H A;  3PMF A;  2R92 G;  3ZYY X;  3CMA A;  1DOM A;  5CV6 A;  1S72 A;  2SNM A;  1RL2 A;  3PGZ A;  5IGB A;  1C7Y A;  3PO2 B;  4PZ6 A;  3RLN A;  2IW3 A;  3NBI A;  2FHT A;  3NEL A;  1KRT A;  1V1P A;  2UUB Q;  3NK9 A;  1JB7 A;  2DNC A;  1IW7 C;  1IW7 D;  1JWM D;  3PIP A;  1YJ9 A;  4LK1 C;  2D2C C;  4LJZ C;  1PDQ A;  1V1O A;  2DUD A;  3EFX D;  4MTK A;  4P75 A;  3TS0 A;  1I4P A;  3SEB A;  4RH6 A;  2XGT A;  5JVH 3;  3VA7 A;  3KLS X;  2F0K A;  4GN4 B;  4A3M B;  3NEN A;  2RDG A;  1BCP B;  4IPC A;  4DR2 Q;  3R2T A;  3L3O C;  3NWT A;  1M1K C;  3H09 A;  1VQH A;  1B8A A;  2EOT A;  4HAE A;  2F0S A;  3S2H B;  3K6O A;  5EKK A;  3KK7 A;  3V96 A;  3U4V A;  2A19 A;  4DV0 Q;  3VYS A;  3RNU A;  1CHP D;  1C48 A;  3IFD A;  4C3J B;  3JAM L;  1BR9 A;  4KK7 A;  1QG7 A;  1EIG A;  3S2D B;  3NQT A;  4GNX C;  5CV8 A;  3NBH A;  2UXB Q;  1SJE D;  2ZJQ A;  3ERQ A;  3PUY A;  5IGC A;  4LF9 L;  1VQ9 A;  4U67 3;  2WAQ B;  2F03 A;  3RZD B;  1STB A;  2AHO B;  5D3D A;  3UI2 A;  1SND A;  3GTL B;  1ICW A;  4DV4 L;  1CA6 A;  4DXF A;  1JMC A;  1EU3 A;  2NB0 A;  1S5E D;  4JBJ A;  1EYA A;  5JJI A;  2EYP A;  3NP8 A;  3T56 B;  4XXE A;  4DUY Q;  3S24 A;  1HJP A;  3AEV A;  1PYB A;  5KND A;  1LTT D;  1V9P A;  3EN2 A;  3CD6 A;  2XN9 C;  4NMZ A;  4DR6 L;  4JW0 A;  2ATW A;  1DYQ A;  1HQR D;  1S5F D;  4ALP A;  4HSP A;  5I9P A;  1KQS A;  2K03 A;  2B39 A;  3GTO H;  2F0O A;  4A3K H;  1VQ6 A;  4O2D A;  2GN5 A;  4NP5 A;  5GAD C;  1F2Y A;  3K7U C;  5IYC G;  1L1O A;  4MNO A;  4HIM A;  3PO2 H;  1AFP A;  1RF2 D;  3S1N B;  3BDC A;  2YTX A;  3BS1 A;  2PW7 A;  4R4T A;  4DUZ Q;  4JI6 L;  3S16 B;  3PO3 B;  1IBK Q;  1PTO H;  2R3Z A;  5E7N A;  1PH9 A;  3AQQ A;  1STY A;  1N34 L;  2B2U C;  3LWE A;  2K01 A;  2MNA A;  1MSH A;  4TVA B;  1U9R A;  5IGG A;  2VQE Q;  1H9S B;  4JG2 A;  1A2U A;  2K5N A;  2KJX A;  2X6L A;  4G7Z C;  5E4X A;  1WCM G;  4HSV A;  3J80 L;  1Q8I A;  1M4V A;  1RKN A;  3B6Y A;  3F8T A;  2RA4 A;  3S2H H;  4XIG S;  3HFZ B;  3TZU A;  4JBK A;  3D6W A;  2VUM G;  2IJ0 A;  4DGZ A;  2P5Z X;  4DR5 Q;  4QF4 A;  2K50 A;  4C3J H;  3VA5 A;  5FKA C;  5A2Q L;  2KOL A;  5TSS A;  4CDF C;  4WFN 3;  2NTT A;  3SXH A;  5K5P A;  2HQE A;  1WD0 A;  2MUY A;  4PZ7 A;  2FJ2 A;  5CBE E;  1VQ8 A;  3URY A;  4NKL A;  5IP7 G;  3E3X A;  3W5O A;  3ONA B;  4IFD G;  2ICI A;  2EVB A;  4BY7 G;  1CM9 A;  1D5M C;  5EQ0 A;  3KF8 B;  4B3M L;  2EY5 A;  5FJ8 G;  1FVI A;  1RJT A;  2KA7 A;  2WFW A;  2BA0 A;  5COR A;  3HOV B;  3MXU A;  2KHJ A;  5E4W C;  4JI5 L;  1YVC A;  1PH8 A;  3GP7 A;  2B2T C;  4UPA A;  4A3M G;  3UE1 A;  4FF3 A;  1EYC A;  4AQY L;  2N3S A;  3I4M G;  1MKH A;  3NTI A;  1I3Q B;  3CP0 A;  3W3A A;  5K36 G;  3S1N H;  4UAI A;  4NXM L;  2G9D A;  1K83 H;  5LMU Q;  2F0Q A;  1V8Q A;  1KC8 C;  4GKJ Q;  4EX5 A;  5KNB A;  5IWA Q;  4KI0 A;  3OSO A;  1SE2 A;  4Q5V A;  3ULL A;  3SHL A;  3DMU A;  4A3E B;  3N52 A;  1WTP A;  2HT1 A;  4UHV A;  5C3E B;  1ET6 A;  3WOE A;  5FO9 B;  4X3U A;  2WAQ G;  4A76 A;  4WOR A;  4F7X A;  1U4R A;  5H1S E;  2RBM A;  4JI2 L;  4LFC L;  3BZD B;  5C0X J;  5C4X B;  2WKC A;  4DFA A;  2KCC A;  5KGU A;  1CKM A;  2TMP A;  4DNI A;  1T9H A;  5IP9 G;  3KF6 A;  1QVC A;  1E0B A;  3QIA A;  3E5S A;  4DKA C;  1YHQ A;  1OXX K;  4RA8 A;  4ZQ3 A;  1B2T A;  1SN8 A;  2F0N A;  2XIW A;  4DN4 M;  4A3F B;  4LFB L;  4WJ4 A;  3CXC A;  1A63 A;  1FJG L;  4OL7 A;  4HMJ A;  1F2L A;  4N8F A;  1WD1 A;  1HNW Q;  4N9P A;  2F0P A;  4OWX B;  1T5E A;  1Y1V G;  1Y14 B;  2MHV A;  3ND8 A;  2EXZ A;  1TWG B;  3PO3 G;  1PZK D;  3Q24 A;  1QVG A;  1ML0 D;  2I0Q A;  2JA6 B;  1DOL A;  2JA7 B;  4R4C A;  2N78 A;  1IKL A;  3L7Z C;  3ULP A;  3ICE A;  1U4P A;  4TQU S;  3PIO A;  3RMH A;  1I4Q A;  3BVG A;  4C1N I;  1TXY A;  1A2T A;  1NR4 A;  1VMC A;  1YJW A;  1UE5 A;  4H7B A;  5IIF A;  1HQM C;  3WDN A;  5LMN Q;  4GNX A;  1F77 A;  4FDB A;  2JEB I;  2Y0S E;  3HP3 A;  1GUG A;  1QZH A;  1E1O A;  2OXP A;  4MTN A;  4A3E H;  3G7L A;  2F0V A;  3DWQ A;  2EYF A;  1LTL A;  1PMR A;  1BXT A;  5CV9 A;  3MVV A;  2AWN A;  4KMU C;  2A68 C;  1VQO A;  1I4R A;  4X66 Q;  3HKS A;  4DR4 Q;  4UP7 A;  2Z4I A;  2CQA A;  3CCM A;  4DV7 Q;  1AE3 A;  3I72 A;  1SAP A;  3A7L A;  4N9T A;  1X54 A;  3TP8 A;  5IGD A;  1X56 A;  3D4W A;  1E2W A;  4R4Q A;  1Y69 U;  1CKN A;  2ID0 A;  3KDF A;  1R9T B;  5BR8 Q;  2E5L L;  4CKB A;  1FGU A;  3VR6 A;  1U0L A;  4FXD A;  2NVY B;  2A1A A;  1KRS A;  4C2M H;  4A3I B;  4KV6 A;  4JI1 L;  3JAM E;  1DON A;  3G6E A;  2E76 C;  2Q8I B;  3IRB A;  2RHS B;  2K4K A;  4DAV A;  4O42 A;  1VQ7 A;  2UXC Q;  1BF4 A;  1PZI D;  1KD1 C;  4IFD I;  3NXW A;  1WI5 A;  1I4G A;  3I73 A;  2VY3 A;  2GVA A;  1K3B C;  1GUS A;  5KNC A;  4LF4 L;  3T53 B;  3HKZ E;  1P8L A;  2HHH L;  1SE3 A;  4HJ7 A;  2JA6 H;  3HOW G;  2B63 B;  4F8M A;  2JA7 H;  5JOB A;  2B2W A;  4I7A A;  2PNH A;  3W2D A;  4X62 Q;  5C3E G;  2E74 C;  2A74 C;  4CBV A;  1TQO A;  4RGN A;  2PW5 A;  4A3G G;  3BVM A;  3FKI H;  2E2H B;  5C4X G;  2K33 A;  1ASY A;  2DY8 A;  1KIX A;  1EL0 A;  4OIJ A;  1EY9 A;  5IGF A;  3K81 C;  1Y1W G;  4H13 C;  3STB C;  3STB D;  2HCI A;  4K14 A;  5KIX A;  1QNK A;  2YTV A;  4QIW E;  4A3F G;  4OO1 H;  4N8X 1;  1B1Z A;  4NW2 A;  4GN3 B;  2E2I B;  1KDC A;  3PF4 A;  1N32 L;  3FEW X;  1EY4 A;  3HOX B;  1NY4 A;  4ME5 A;  4DV1 L;  2XWJ B;  1XMQ Q;  1STN A;  4LUV A;  5I2Y A;  2UUA L;  2KBN A;  4GKK Q;  1X3Q A;  3BYT B;  3FPP A;  3MEF A;  2B2T A;  1PYS B;  3J80 E;  2BE5 C;  1D5X C;  2BE5 D;  1V43 A;  3HOU B;  1O78 A;  2JA5 B;  3RUZ A;  3PIP 3;  5J22 A;  5EKI A;  3QB3 A;  4X64 Q;  4UP9 A;  2Y0S B;  1QZG A;  2RHQ B;  2IHE A;  3UDX A;  2NVY H;  2WP8 J;  4WJ3 M;  3RN5 A;  3RZO H;  5A2Q E;  1CFM A;  4DAY B;  1EEI D;  2IT1 A;  3TN2 A;  4YIJ A;  1H95 A;  4IPH A;  3A54 A;  2XNA C;  2R7Z B;  2F0G A;  1SYF A;  3M4O B;  3E9I A;  3A8K E;  4ZAI A;  4XDX A;  1XPR A;  4EVO A;  1EY8 A;  1SYB A;  4DV2 L;  1NUC A;  1OXS C;  4GS3 A;  3GTJ B;  3OWF A;  2KUM A;  1O7L A;  1M8A A;  5HGQ A;  3T1Y L;  1SFO B;  2Z6K A;  2KEN A;  2LSS A;  5M3F H;  1E2V A;  4LF8 L;  4DR7 L;  1L0X B;  4A93 H;  3M3Y H;  1TWH B;  4LF7 L;  1KNE A;  1A3U A;  1VF5 C;  3H15 A;  3J7A F;  4M8A A;  1MIU A;  4P73 A;  1AE2 A;  1LT3 D;  1JOQ A;  1L1O C;  3V2T A;  1J8I A;  5IT9 L;  2F1M A;  2JP1 A;  2E2I H;  3R8B A;  1VQL A;  1CZW A;  2MJ8 A;  3HKZ B;  1HUN A;  4A3I G;  3KOJ A;  1E22 A;  3A74 A;  3K8A A;  2ZJP A;  1STG A;  1SR3 A;  1K8A C;  3I55 A;  4C3I B;  1YIT A;  1S5C D;  1KAW A;  2Z6B A;  2I46 A;  4IPD A;  4Y7N H;  3NBH B;  4P72 A;  3J81 i;  2B63 G;  2N55 A;  2QF7 A;  3U50 C;  1NR2 A;  1GOZ A;  2RKS A;  5EGT A;  2DJG C;  3TQY A;  3H0G B;  1BBW A;  2MGS A;  2QKI C;  5DAU A;  4DV3 Q;  2ZTD A;  1CZG A;  2PMZ E;  4QIW B;  3TEH B;  2M2L A;  5BN5 A;  2PPB C;  1FNW A;  3VR4 A;  2EYL A;  2GVB A;  2UXD Q;  1ET9 A;  1VF7 A;  2K5H A;  4KN4 C;  4AYB E;  3WOF A;  4BBR B;  1YNN C;  1YNN D;  1O7I A;  3V05 A;  1GKH A;  4EQP A;  2QW7 A;  2R7Z H;  1B4O A;  4HN7 A;  1IYV A;  1K0R A;  4BA1 I;  3OOC A;  2VQF Q;  2ENB A;  4KY5 A;  3HRZ C;  3HOX G;  1HNZ L;  4HTH A;  3MC0 B;  4H02 A;  1HR0 Q;  3CC7 A;  4MZ9 A;  3VYT A;  2E2D C;  4J8Q A;  1SFO H;  1ZKO A;  3T1H Q;  4C3H H;  3UE0 A;  4JK1 C;  2I5M X;  5G3L F;  2NN6 H;  5D65 A;  2PZU A;  2JA8 G;  3AU7 A;  2N88 A;  4X65 L;  2B3G A;  5GAH C;  4A3J H;  2F3I A;  4ZRZ A;  4BY1 B;  2L9H A;  3HOU G;  1ONL A;  4V0B A;  2JA5 G;  3Q0A A;  2BDN A;  2UUC Q;  2JN4 A;  1UE1 A;  4G4K A;  5IYD G;  3GV6 A;  3RLF A;  1NE3 A;  4JPB W;  4YWK A;  3NSW A;  2I07 B;  4A3L H;  1KHI A;  3M4P A;  5CC4 A;  2NZO A;  2B8F A;  4QUC A;  1SNM A;  4A3B B;  4IN3 A;  1VQI A;  4GLX A;  4X3T A;  1JJ2 A;  4U68 A;  4O0A A;  1QUQ B;  2NYZ D;  4A4I A;  3JAM c;  4YHH Q;  4I65 A;  4DR1 Q;  1SSO A;  4B3T L;  3H0G H;  4BXX G;  4EQO A;  1YNJ C;  1YNJ D;  1EFI D;  3MWY W;  3PUX A;  1I6H B;  1Q82 C;  2VB3 X;  1X32 A;  5I2X A;  5AJ3 L;  4NXN Q;  5HUR A;  2PQA A;  4JBM A;  4LF6 Q;  3H94 A;  4IOC A;  3HOY B;  2EJM A;  3E0J A;  4BBR H;  3KJO A;  3F2B A;  3SVM A;  2ZJR A;  1G29 1;  1G6Z A;  4GOP A;  3KBG A;  3AMU A;  1VMP A;  1SEB D;  3X3M A;  5J3B A;  5C4Z A;  1JC7 A;  2F4V L;  2JJQ A;  3VR3 A;  2Q2I A;  1PTO B;  4H0L C;  1EY0 A;  1X55 A;  1TY0 A;  1AZQ A;  1U5K A;  2CKZ B;  3C1F A;  1VQJ A;  1CHQ D;  2MQH A;  3T51 B;  5GAE C;  1FGB D;  3A8J E;  1EYG A;  1NCV A;  5GRO A;  3J7Y W;  1BNZ A;  1YJN A;  3A55 A;  1PV4 A;  3OTO Q;  4DV6 L;  2WB1 E;  4A3C G;  4IAL A;  5M3M B;  4JI8 Q;  1NMG A;  1HHV A;  2L15 A;  1C4Q A;  4LF5 L;  2L1B A;  2PMZ B;  5CR3 A;  3D0F A;  5JJZ A;  2Q2H A;  3K0Y A;  4BY1 H;  4AYB B;  1B7Y B;  4K5W A;  4DV5 L;  1CQV A;  1W3S A;  1I5F A;  1Q1B A;  3TS2 A;  1PVO A;  5CBA E;  1EZ6 A;  4RCN A;  3HEJ A;  1VQF A;  1S40 A;  1CSP A;  1JJG A;  1NBW A;  3HOZ G;  1OXT A;  4JI0 Q;  1QWY A;  4RGM A;  1GXD C;  2EJG C;  3KLR A;  5DM7 3;  3J80 c;  3PIO 3;  5IGE A;  2O5I C;  4XT1 B;  4K6L A;  5C0X G;  5M5Y H;  3AFP A;  4A3B H;  3I4O A;  4MIU A;  4JYA L;  3NTH A;  4XYQ A;  1E7Z A;  2EE1 A;  4P71 A;  1X3F A;  4DNR B;  4KHP L;  1K28 A;  5IYB H;  5C5M A;  1R4P B;  1XWE A;  1LYL A;  2CH4 W;  2IL8 A;  1I6H H;  1EWH A;  1UE6 A;  2HUG A;  1N33 L;  5ELE A;  1HNX L;  3MAQ A;  3C3L A;  1MGS A;  3HOY H;  3TDQ A;  1PA6 A;  4QMG A;  4JI4 Q;  1PRT F;  4ZYS A;  2D62 A;  4K6D A;  3KFU A;  2Z1C A;  3Q6S A;  1K8G A;  3J81 L;  2ALY B;  4B08 A;  2R6G A;  1K83 B;  2R93 H;  1LUZ A;  1IBL L;  3LWU A;  1HCZ A;  1CK1 A;  4LFA L;  3I70 A;  1EEF D;  3OIQ A;  1B9N A;  1LT6 D;  1KLG D;  4F88 A;  1I6V C;  2ZXP A;  4JI7 Q;  3H3V I;  1X9N A;  4PMW A;  2L12 A;  1K73 C;  4GNX B;  5M3M H;  1K9M C;  2B2W C;  2FIN B;  3MZ5 A;  4IUT A;  4GZY C;  1I4X A;  4HCE A;  1A8V A;  4KHZ A;  4ODG A;  2F0J A;  3SK6 A;  1YIJ A;  2O5J C;  2ASB A;  4K2K A;  4FXK C;  4JCV E;  3I4N B;  4A3K G;  3KYH C;  5K36 H;  3S17 B;  1X6O A;  3CCR A;  2LMC B;  5D14 A;  5IT9 E;  1JJC B;  2D0O A;  4OGQ C;  3PO2 G;  1QIL A;  3D8G A;  3NTK A;  3NHH A;  1D6E C;  2K28 A;  3OMC A;  3SK5 A;  1CKN B;  1WVL A;  5FLX c;  1J5E Q;  3SR1 A;  1D2B A;  3DLL A;  4KJO A;  4B9X A;  4QB4 A;  4TKO B;  3MXN B;  3M7G A;  2Z8L A;  2YYZ A;  2ZM6 L;  3C1E A;  4KJN A;  1NTG A;  3QO2 A;  4XQJ A;  4LUO A;  1TKW B;  1UEB A;  4RMF A;  1PFB A;  3KBX A;  3EA6 A;  3BDO A;  1JB3 A;  2HD3 A;  1WYD A;  1HUM A;  3E9H A;  5G3L D;  3TP6 A;  2AQ1 B;  4KTA A;  3CME A;  1WTR A;  2C9O A;  2JYO A;  4C3J G;  1NJI C;  2KHS A;  4IUQ A;  3CCS A;  3S1Q H;  2IHF A;  4MHE A;  5DLQ E;  5JJK A;  1TR5 A;  5JJL A;  2E8G A;  2K32 A;  1MBY A; 
#chains in the Genus database with same CATH homology
 3BZK A;  2YU9 H;  3HOU H;  4BBR G;  1HZB A;  1VQB A;  2PNH A;  2MO0 A;  4X62 Q;  5C3E G;  1SE8 A;  5ELN A;  4HID A;  2JA5 H;  3S1M H;  4IOA A;  4JV5 Q;  1TWC H;  4DR3 L;  5ELO A;  4A3G G;  1HZA A;  5IYD H;  3FKI H;  1S3O A;  3PSI A;  4JI3 Q;  4IJL A;  5C4X G;  1Z9F A;  2OCE A;  2YV5 A;  1ASY A;  4QL5 A;  1I94 L;  1KIX A;  3W1B A;  2Z6K C;  3ER0 A;  3K81 C;  3F2C A;  1Y1W G;  1QVF A;  3STB C;  3STB D;  4JI4 L;  2IX1 A;  4AH6 A;  2NVQ H;  1WCM H;  3J80 i;  1Q86 C;  2A8V A;  1HNW L;  1MJE A;  2FXQ A;  3PV0 A;  2YTV A;  2BA1 A;  2OQK A;  1WJJ A;  2B29 A;  4QIW E;  4A3F G;  2JEA I;  3LGJ A;  2NVX H;  3I4N H;  1Q46 A;  3M4O H;  1EFW A;  2NVT H;  2VUM H;  2JK8 A;  4GN3 B;  3S17 H;  2MFI A;  4LF9 Q;  3RR5 A;  3D31 A;  3PF4 A;  1N32 L;  1NY4 A;  4DV1 L;  2HIV A;  4NPS A;  1XMQ Q;  4BXX H;  4DV4 Q;  4LUV A;  3GTJ H;  4K0K Q;  2UUA L;  2KBN A;  3E0E A;  4BY1 G;  1W2B A;  1VQE A;  1L0W A;  4HJ5 A;  4GKK Q;  1XJV A;  4A75 A;  2VZA A;  4JI7 L;  1IXR A;  1C9O A;  1PH2 A;  4GLV B;  1N36 Q;  1SRO A;  5C0X I;  4X6A H;  3MEF A;  3CPW A;  3G71 A;  4BBS H;  3VDY A;  3ULJ A;  4DR6 Q;  2PI2 A;  5IP7 H;  1TWH H;  1ASZ A;  1AH9 A;  1HNZ Q;  1PYS B;  1OXV A;  3CF5 A;  1PH3 A;  2EXD A;  1V43 A;  4GN5 A;  4BY7 H;  5LMN L;  1V1Q A;  1A62 A;  3TRZ A;  4X64 Q;  4UP9 A;  4P74 A;  1QZG A;  5IE8 A;  2RHQ B;  2RCN A;  1VQA A;  2IHE A;  3UDX A;  2NVY H;  2WP8 J;  4YY3 L;  4OWW B;  5FJ8 H;  4WJ3 M;  3A0J A;  1KXL A;  3RN5 A;  2KHI A;  3RZO H;  4A3B G;  3CCJ A;  3UDI A;  2IY5 B;  1Q1E A;  4X65 Q;  3GTP H;  1J6Q A;  1OXU A;  3GD7 A;  4DAY B;  2IT1 A;  1XNR Q;  5IYB G;  3RN2 A;  4A3M H;  4XTC S;  4A3C H;  3JC6 6;  1I50 H;  4R4O A;  4JI6 Q;  1H95 A;  4IPH A;  4C3I H;  2EIF A;  1PH5 A;  3I4M H;  4X66 L;  1N34 Q;  4DR4 L;  3PUV A;  3E9I A;  1BBU A;  5C44 G;  3GTK H;  4DV7 L;  2VS1 A;  1C0A A;  2JQO A;  1J5E L;  1IBM Q;  1XPR A;  4OXP A;  3HOY G;  4DV2 L;  3NEM A;  1E1T A;  1OXS C;  4GS3 A;  2JA9 A;  2QGQ A;  2K52 A;  2V1C C;  4B3R L;  5HGQ A;  3T1Y L;  3KDF B;  2Z6K A;  2KEN A;  3W1G A;  2LSS A;  5BR8 L;  5M3F H;  4OX9 L;  3S2D H;  3M4Q A;  3HOZ H;  2R93 G;  1YHB A;  4B3S L;  2I5H A;  4LF8 L;  2R92 G;  4A93 H;  4DR7 L;  1QUQ A;  3CMA A;  3M3Y H;  1VCI A;  4LF7 L;  1S72 A;  1RL2 A;  3HOV G;  4B3T Q;  3RZD H;  3PGZ A;  3CCV A;  1C7Y A;  2F52 A;  3GTL H;  3AEV A;  4PZ6 A;  3RLN A;  3H15 A;  3NEL A;  1KRT A;  1MIU A;  4DK3 C;  4P73 A;  2UUB Q;  1AE2 A;  1JB7 A;  2UXC L;  4HIO A;  1L1O C;  2EQS A;  2N8N A;  3CQZ H;  3CCQ A;  1FL0 A;  5M3M G;  5AJ3 Q;  3PIP A;  1YJ9 A;  3WWV A;  2E2I H;  5IP9 H;  1VQL A;  2DUD A;  4P75 A;  2VW9 A;  3TS0 A;  2UU9 L;  4A3I G;  2XGT A;  4Y52 H;  3KOJ A;  1E22 A;  2NN6 I;  3A74 A;  4GN4 B;  4AYB G;  2F4V Q;  2VNU D;  3K8A A;  2H5X A;  2ZJP A;  3NEN A;  1SR3 A;  4X62 L;  1K8A C;  3PUW A;  2XTI A;  4IPC A;  3I55 A;  4DR2 Q;  1YIT A;  4JV5 L;  1KAW A;  1M1K C;  1VQH A;  4B3M Q;  1B8A A;  4L5R C;  1VQP A;  4IPD A;  1EWI A;  1KL9 A;  4JI3 L;  3AYH B;  4A3E G;  4Y7N H;  3NBH B;  2A19 A;  4P72 A;  3U4V A;  4YCW A;  3J81 i;  4DV0 Q;  4JI5 Q;  2B63 G;  3RNU A;  2OTL A;  3BU2 A;  1HZC A;  1EQR A;  1XTD A;  3CCL A;  1Y1V H;  3U50 C;  4DV6 Q;  3GO5 A;  4QY7 A;  4AQY Q;  3F2D A;  3TQY A;  5LMN W;  1BBW A;  1GVP A;  4JOI C;  3S16 H;  3PO3 H;  1YI2 A;  1G51 A;  3AFQ A;  4DV3 Q;  2ZTD A;  2PMZ E;  3U4Z A;  4GNX C;  4LF5 Q;  1D7Q A;  3TEH B;  1XMO L;  2UXB Q;  2ZJQ A;  3GTM H;  3PUY A;  1Q8K A;  2GVB A;  4LF9 L;  1VQ9 A;  4AYB E;  2UXD Q;  2K5H A;  4DV5 Q;  4NXM Q;  1CUK A;  2AHO B;  1O7I A;  1XMQ L;  2HIX A;  1GKH A;  4DV4 L;  4K0K L;  2R7Z H;  1N8R C;  4GKK L;  1JMC A;  1XMO Q;  2CWA A;  4POF A;  1NMF A;  5FLM H;  4JBJ A;  1XNQ L;  5JJI A;  4GOP C;  4YCU A;  3DM3 A;  2K14 A;  1K0R A;  4LWC A;  3K7A H;  1HJP A;  3S24 A;  3ZJY C;  4BA1 I;  4DUY Q;  3T1H L;  1EQQ A;  1N36 L;  1PYB A;  2VQF Q;  1V9P A;  3BZC A;  3EN2 A;  3CD6 A;  4KLK A;  4DR6 L;  2KCM A;  2ATW A;  1X65 A;  1Z47 A;  3HOX G;  1HNZ L;  3L2P A;  4H02 A;  4IPG A;  1HR0 Q;  1XNQ Q;  1G6P A;  4ALP A;  4JI2 Q;  3CC7 A;  1CKO A;  2KCT A;  4MZ9 A;  1KQS A;  1SFO H;  4LFC Q;  4B3R Q;  4JYA Q;  4GLA C;  3T1H Q;  4C3H H;  3UE0 A;  4X64 L;  3GTO H;  4A3K H;  1VQ6 A;  2BH2 A;  4O2D A;  5GQO A;  2I5M X;  2GN5 A;  4NB3 A;  2CCZ A;  5GAD C;  4KHP Q;  1X3E A;  4HJA A;  2JA8 G;  3UDF A;  3K7U C;  1Q7Y C;  2JA6 G;  5IYC G;  4X65 L;  2B3G A;  1L1O A;  4MNO A;  2D0P A;  5GAH C;  4HIM A;  4A3J H;  2F3I A;  1Q81 C;  2JA7 G;  3PO2 H;  3CC4 A;  1IL2 A;  5IT9 c;  3M85 A;  1XNR L;  3HOU G;  4LFB Q;  2YTX A;  3KJP A;  2JA5 G;  4R4T A;  4DUZ Q;  3FP9 A;  1N33 Q;  4JI6 L;  2CFM A;  1HNX Q;  1FJG Q;  3RLO A;  1HZ9 A;  2UUC Q;  1IBK Q;  1UE1 A;  5E7N A;  1PH9 A;  4A3D H;  3AQQ A;  1N34 L;  5IYD G;  3FKI G;  2MNA A;  4TVA B;  3RLF A;  2VQE Q;  3HOV H;  1NE3 A;  4YWK A;  4JG2 A;  2K5N A;  4DK6 C;  1IBM L;  2K75 A;  4L5S A;  4A3L H;  1YHA A;  1KHI A;  3ERS X;  3CW2 C;  1WOC A;  3M4P A;  1WCM G;  1IBL Q;  2NZO A;  3G4S A;  3B6Y A;  4LFA Q;  3F8T A;  3S2H H;  4XIG S;  3TRE A;  4OO1 G;  1I3Q H;  3HFZ B;  4EQ5 A;  3I2Z A;  4JBK A;  1VQI A;  3I4N G;  1K3R A;  4RG1 A;  4GLX A;  4ME3 A;  2VUM G;  1JJ2 A;  4O0A A;  1QUQ B;  4A4I A;  4YHH Q;  3JAM c;  4DR1 Q;  4DR5 Q;  2K50 A;  3FHW A;  4C3J H;  1EOV A;  4B3T L;  1BVS A;  3H0G H;  4BXX G;  1IZ6 A;  3S15 H;  1BKB A;  3PUX A;  4POG A;  1YEZ A;  2UUB L;  3OYY A;  2NZH A;  1Q82 C;  1M90 C;  2WB1 G;  3HOW H;  5AJ3 L;  4NXN Q;  2PQA A;  4PZ7 A;  4JBM A;  4L5T A;  4LF6 Q;  2BH8 A;  1VQC A;  1VQ8 A;  4IOC A;  2IX0 A;  4BBS G;  4BBR H;  3KJO A;  5C3E H;  1IYJ B;  3F2B A;  2ZJR A;  3CCU A;  1JT8 A;  1G29 1;  5IP7 G;  5HY6 A;  1PH6 A;  1VQM A;  4GOP A;  3W5O A;  2Z0S A;  1PHJ A;  4AIM A;  4IFD J;  4IFD G;  2RF4 A;  5J3B A;  2F4V L;  4A3G H;  2JJQ A;  2MO1 A;  2Q2U A;  3EIV A;  4BY7 G;  2Q2I A;  5C4X H;  4DR2 L;  1HR0 W;  3KF8 B;  1X55 A;  4B3M L;  2QA4 A;  3I7F A;  1U5K A;  2CKZ B;  5FJ8 G;  1VQ4 A;  1FVI A;  4JI8 L;  2WFW A;  1Y1W H;  2BA0 A;  1VQJ A;  2MQH A;  5GAE C;  2KHJ A;  1EYG A;  5EAY A;  1EIY B;  4JI5 L;  1HH2 P;  4DV0 L;  1JE5 A;  4OON A;  5GRO A;  2E2J H;  1YVC A;  1PH8 A;  1YJN A;  1YBY A;  1E24 A;  4A3F H;  4UPA A;  4QGU A;  3UE1 A;  3OTO Q;  1PFS A;  4A3M G;  3L0O A;  2WB1 E;  4DV6 L;  1PV4 A;  1VQ5 A;  3J7A 5;  4AQY L;  4A3C G;  2K5V A;  2QEX A;  2N3S A;  4JI8 Q;  2AKW B;  4HJ9 A;  1NMG A;  3I4M G;  1PH1 A;  1UE7 A;  1MKH A;  4PZ8 A;  1TWF H;  2L15 A;  4L5Q A;  4DV3 L;  4LF5 L;  4OWT B;  3CP0 A;  3D0F A;  4YWM A;  2Q2H A;  2UXB L;  5K36 G;  2ZM6 Q;  4BY1 H;  2ZTE A;  2UXD L;  3S1N H;  1B7Y B;  4DV5 L;  4QJF A;  2E5L Q;  4NXM L;  2OTJ A;  1K83 H;  5LMU Q;  1KC8 C;  1W3S A;  2DGY A;  1TWA H;  3J81 j;  4GKJ Q;  4EX5 A;  3EBE A;  1I5F A;  1Q1B A;  3TS2 A;  1PVO A;  3CPF A;  5IWA Q;  4KI0 A;  1TWG H;  1VQF A;  1S40 A;  1SRU A;  1CSP A;  4JI1 Q;  4UY8 C;  3ULL A;  3BJU A;  1NBW A;  2JE6 I;  1JJG A;  4DUY L;  1OXT A;  3HOZ G;  4JI0 Q;  2Q2T A;  2HT1 A;  2VQF L;  3J7Z C;  2R7F A;  3S1R H;  4A93 G;  3A5U A;  5IY0 A;  4R4I A;  3J80 c;  2WAQ G;  4A76 A;  4DAM A;  5H1S E;  1HR0 L;  4LF4 Q;  4IO9 A;  4JI2 L;  1YZ6 A;  3KLW A;  4LFC L;  1PH4 A;  5C0X J;  3Q8D A;  5M5Y H;  3AFP A;  5C0X G;  3I4O A;  2HHH Q;  4A3B H;  4JYA L;  3CC2 A;  3UDG A;  1CKM A;  1E7Z A;  4DNI A;  1T9H A;  4QQB X;  1WFQ A;  4P71 A;  1X3F A;  5IP9 G;  4KHP L;  1SLJ A;  3KF6 A;  1QVC A;  5IYB H;  4DKA C;  1YHQ A;  1LYL A;  1XPU A;  1L1O B;  1OXX K;  1SN8 A;  4DR3 Q;  1I6H H;  1UE6 A;  5JEA J;  2LXJ A;  5JEA G;  4LFB L;  4WJ4 A;  5C44 H;  4LNQ A;  3CXC A;  4DUZ L;  1N33 L;  2HQL A;  1A63 A;  1HNX L;  1FJG L;  1I94 Q;  2UUC L;  1IBK L;  3CAM A;  3HOY H;  4UP8 A;  1CSQ A;  2ZTC A;  1PA6 A;  4JI4 Q;  1HNW Q;  4R1J A;  2WAQ E;  2VQE L;  2D62 A;  4LW1 A;  4OWX B;  3KFU A;  4JC0 A;  1K8G A;  2ALY B;  2R6G A;  1XPO A;  1Y1V G;  1Y14 B;  3A5Z B;  2Y0S G;  3F1Z A;  1LUZ A;  4DPG A;  1IBL L;  2R93 H;  1GO3 E;  2R92 H;  1N32 Q;  3PO3 G;  4LFA L;  1QVG A;  5M5X H;  4DV1 Q;  1DGS A;  2I0Q A;  2PI2 E;  1A0I A;  2AMC B;  2UUA Q;  5C4J H;  4R4C A;  2N78 A;  4DR1 L;  4DR5 L;  4YHH L;  4JI7 Q;  3H3V I;  3L7Z C;  1X9N A;  4PMW A;  3ULP A;  1K73 C;  3ICE A;  4GNX B;  5M3M H;  1R9T H;  1K9M C;  4TQU S;  3PIO A;  2R7Z G;  4LUZ A;  5FLM G;  1TXY A;  1N9W A;  4A3I H;  4YCV A;  1YJW A;  3S14 H;  2C35 B;  3K80 C;  4NXN L;  1UE5 A;  1A8V A;  2PQA B;  4JOI A;  2I5L X;  4KHZ A;  2AWO A;  1YIJ A;  4LF6 L;  2CQO A;  1X3G A;  2CWP A;  4YWL A;  1OTC A;  4GNX A;  5LMN Q;  2ASB A;  4FDB A;  3U58 A;  1VQK A;  4GOP B;  2JEB I;  2Y0S E;  3M7N A;  4YY3 Q;  3K0X A;  1QZH A;  3GTG H;  4JCV E;  1E1O A;  4MTN A;  1EUJ A;  4A3E H;  1GD7 A;  4A3K G;  3SGI A;  2B63 H;  3KYH C;  4JBW A;  1LTL A;  5GAG C;  1L2F A;  2VL6 A;  2NN6 G;  1X6O A;  3CCR A;  1PH7 A;  3JAM i;  2AWN A;  2LXK A;  1JJC B;  1P16 A;  4A3J G;  1VQO A;  2D0O A;  2ES2 A;  1MJC A;  3PO2 G;  4X66 Q;  3HKS A;  4DR4 Q;  1VQG A;  4UP7 A;  1VQN A;  3OTO L;  2E2H H;  1CKN B;  3CCM A;  3G48 A;  4DV7 Q;  5FLX c;  1J5E Q;  2OQ0 A;  4OO1 I;  1AE3 A;  3HKZ G;  1LM0 A;  4DV2 Q;  4A3D G;  3DLL A;  1X54 A;  3I56 A;  3M9B A;  1Q12 A;  1X56 A;  4PG3 A;  5M5W H;  3MXN B;  2YYZ A;  4R4Q A;  2ZM6 L;  4HIK A;  4HJ8 A;  2OWO A;  1VQD A;  4A3L G;  1NTG A;  3T1Y Q;  1CKN A;  2ID0 A;  3KDF A;  4LUO A;  5BR8 Q;  2E5L L;  4OX9 Q;  1UWV A;  1UEB A;  4RMF A;  5LMU L;  4BA2 I;  1FGU A;  4GKJ L;  1U0L A;  1VS0 A;  4B3S Q;  4LF8 Q;  4DR7 Q;  3GTQ H;  2A1A A;  1KRS A;  5IWA L;  4LF7 Q;  4C2M H;  4JI1 L;  4IJH A;  1GM5 A;  2N49 A;  3HOX H;  3G6E A;  3OW2 A;  3H3V H;  3J81 c;  4JI0 L;  1WYD A;  3E9H A;  2RHS B;  2K4K A;  3IRB A;  3PF5 A;  1VQ7 A;  3CME A;  2UXC Q;  4APV A;  1E3P A;  1NJI C;  1RIP A;  4J15 A;  2YTY A;  2R7D A;  1KD1 C;  4IFD I;  1WI5 A;  3H0G G;  2VY3 A;  1B70 B;  2GVA A;  3CCS A;  3CCE A;  4LF4 L;  3S1Q H;  3HKZ E;  2IHF A;  2JA8 H;  1P8L A;  1SMX A;  5M3F G;  1D8L A;  3GDE A;  3PUZ A;  2HHH L;  4HJ7 A;  5DLQ E;  5IYC H;  2UU9 Q;  1YNX A;  2JA6 H;  3HOW G;  5JJK A;  1EIF A;  5JJL A;  2JA7 H;  2E8G A;  3KF6 B;  3PCO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...