2IHEA

Crystal structure of wild-type single-stranded dna binding protein from thermus aquaticus
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
238
structure length
206
Chain Sequence
ARGLNQVFLIGTLTARPDMRYTPGGLAILDLNLAGQDAFTDESGQEREVPWYHRVRLLGRQAEMWGDLLEKGQLIFVEGRLEYRQWEKDGEKKSEVQVRAEFIDPLEGRGALNQVILMGNLTRDPDLRYTPQGTAVVRLGLAVNERTHFLEVQAWRELAEWASELRKGDGLLVIGRLVNDRFQTRVEALRLERPTRGPAQAGGSRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Single-stranded DNA-binding protein
publication title 3D structure of Thermus aquaticus single-stranded DNA-binding protein gives insight into the functioning of SSB proteins.
pubmed doi rcsb
source organism Thermus aquaticus
total genus 35
structure length 206
sequence length 238
ec nomenclature
pdb deposition date 2006-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2iheA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2iheA02
3HKSA 4A3LH 1CSQA 2UU9L 3PF4A 2UXBL 1FJGL 1NBWA 3KOJA 5JEAJ 1XTDA 4GKJL 2N78A 1C7YA 4BBSH 4JI6Q 2BH8A 2IHEA 1G291 1CKOA 2KENA 3STBD 2MNAA 2LSSA 3RZDH 1HZCA 1PH8A 2NVTH 3FKIH 1L1OA 4IFDJ 5AJ3Q 4C3IH 1X3GA 3CMAA 3S16H 1PH3A 1A8VA 4QQBX 1N36L 4TQUS 5IP7H 3S1QH 1YBYA 2C35B 2CWAA 3CPWA 2VQEL 4GN4B 4DR3L 1B8AA 2L15A 2VS1A 1NMGA 4A3IG 2UUBQ 3I4OA 3AFQA 3U4VA 4DR6Q 3FP9A 3AFPA 4UP8A 1J5EL 2JQOA 1VQOA 4YCWA 1EQRA 5IP9H 2IHFA 2NVQH 1JB7A 3MEFA 3OYYA 2AWOA 4IO9A 2UXDL 4X66Q 3T1HQ 1N32Q 1ASYA 3G48A 4QIWE 1I94Q 3CF5A 5GAHC 2BA1A 3HOYG 4DR4Q 4HJAA 4OWTB 4DK3C 3CW2C 1Q1BA 1VQEA 1UWVA 2MQHA 1N9WA 4AH6A 1EQQA 2E5LQ 1IL2A 5IT9c 2DGYA 5FLMG 4JI5Q 1JJCB 3CPFA 4A3GG 4DV0Q 4NB3A 5M3MH 3RN5A 4LFAL 4X64Q 1YJWA 4X65Q 1VQ8A 4GKKQ 3S24A 1VQMA 4L5QA 1Q46A 1MIUA 1U0LA 3HOWG 2EIFA 1NTGA 1X54A 1Q86C 1SLJA 1FVIA 4L5TA 2CKZB 2WB1G 4TVAB 2N3SA 5C3EG 4HIDA 2AKWB 1XMOQ 1HNXL 1VQ7A 2B63H 1JJ2A 4B3TQ 4P71A 4BXXH 2JA8H 4QY7A 3PUXA 4JV5Q 4UP7A 1VQPA 5IY0A 1QVGA 2VNUD 4LF8Q 4LF5Q 3G6EA 4A3KG 3MXNB 4DR1Q 3TQYA 3KJPA 4HJ8A 4IJLA 2CCZA 4IFDI 2OCEA 4IPGA 4JI7L 4JYAQ 1RIPA 1VQ5A 4OWWB 4GNXB 1Y14B 2R92G 2KHJA 1Q82C 3KDFA 2MO1A 5FLXc 3UDGA 4JI1L 1IBML 3PF5A 2UUAQ 3F8TA 3BU2A 4OONA 1SROA 4DV2Q 3FHWA 3CMEA 1KHIA 3GTMH 4DUZQ 2R93H 1VQKA 4LF5L 4RG1A 4DV4L 1R9TH 4DAMA 1PFSA 4C2MH 3F2DA 4PMWA 1XNQL 2CWPA 2D0OA 1N34L 2F52A 1N33L 4IFDG 1D8LA 2HIXA 3L2PA 3S14H 3FKIG 4LF6L 2JEAI 3PO3G 1B70B 1BBUA 3AEVA 4OXPA 3CCRA 3F2CA 1L1OB 3PUWA 3IRBA 2K75A 1TXYA 3E0EA 1NY4A 4DUYQ 4DR2L 2NVXH 4BY7H 2UXCL 1O7IA 4X62Q 4JG2A 5BR8Q 1XNRL 3NELA 2EXDA 4GLVB 2HHHL 2UUCL 3M4OH 1WFQA 3ER0A 5HY6A 1XPUA 3TEHB 1Y1WH 3W1BA 1S40A 3H3VH 4K0KL 1HZAA 3PO2G 1Q8KA 1C9OA 3OTOL 1M1KC 2Q2HA 1N8RC 1TWFH 4GLXA 2GVAA 3EBEA 1E22A 4YHHL 5K36G 2JA5H 2E2IH 1XPOA 4WJ3M 5JJKA 2WAQE 1WJJA 3I4NG 3PUZA 2WP8J 2RHSB 1S3OA 1EYGA 1EWIA 3KYHC 1HR0Q 4POGA 1JT8A 5C4XH 4DV7Q 2VL6A 1SRUA 4DV1Q 4NXNQ 1KRTA 1L2FA 4R4TA 1HNWQ 5J3BA 1Y1VH 2EQSA 2LXKA 4JC0A 1PH2A 2AMCB 4BA1I 2Z6KC 5E7NA 3CCVA 4P73A 1VQFA 2AWNA 1X3FA 3JC66 5AJ3L 1K8GA 4AYBG 4LF9Q 3PSIA 5C44G 4A3DH 3DM3A 3PUVA 4A75A 3DLLA 3CP0A 2WAQG 2HT1A 2I5HA 4NPSA 1HH2P 3KLWA 4KLKA 4JBMA 2JA7G 2YTVA 2OQKA 2ATWA 1NMFA 3EIVA 3GTPH 2R7ZG 3H0GH 4LW1A 5C0XJ 3KJOA 1IBLQ 3M4PA 5LMNQ 1E7ZA 4A3JH 4B3SQ 3NENA 3HOZH 4HIOA 4AQYQ 1UE7A 4DR6L 5JJLA 4Y52H 3HOXH 4A93H 2Q2UA 4WJ4A 1X56A 4A76A 1X9NA 1K73C 5HGQA 5GADC 4UY8C 5ELNA 1XMQQ 1PHJA 4QJFA 2NZHA 4X66L 4J15A 4DV6Q 1N32L 2KCTA 4A3BH 3KDFB 2JJQA 4DR4L 1I50H 1JMCA 4JI0Q 3ZJYC 4A3EG 3H3VI 1PYBA 1OXTA 3PIOA 2E5LL 1EOVA 4JI5L 1J6QA 2IX0A 1WCMH 1SFOH 1NE3A 2IT1A 4DV0L 1HZ9A 4X64L 2N49A 4GKKL 4JI3L 3UDXA 1VQ4A 3J7A5 2VUMH 4BBSG 3G4SA 1KC8C 2WB1E 1JE5A 3RZOH 1KD1C 3PIPA 2IX1A 1XMOL 3E9HA 4RMFA 2ZM6Q 4BY7G 3TRZA 4DV3L 4B3TL 5JJIA 3A5ZB 1P16A 5IYDH 4JI8L 4X6AH 4XIGS 4JV5L 1S72A 2ZTDA 4APVA 1Y1WG 3PUYA 1L0WA 4GKJQ 5IE8A 4A3MG 2JE6I 2ALYB 2GVBA 4LUVA 4DV5Q 4DR1L 2ZJPA 1CKMA 1EUJA 4JYAL 4LWCA 3ERSX 1Q7YC 4A3CH 3S17H 2KHIA 3E9IA 2ZJRA 4PG3A 5GAEC 4IPHA 1SE8A 3TREA 2UUAL 1YITA 4O0AA 4YWMA 2D0PA 3I4MG 4BA2I 4DV2L 2H5XA 4UP9A 4Y7NH 1XPRA 2K5VA 3RNUA 4OO1I 4LF4L 3K7UC 4BBRG 4R1JA 5C0XI 3M7NA 2YTXA 1VQGA 3CD6A 5C4XG 2QGQA 1C0AA 2XTIA 4A3FG 5IYBH 5IYCH 1IXRA 3RR5A 1AH9A 1IZ6A 4ME3A 5FJ8H 3K8AA 3M4QA 2YTYA 4BY1H 3J81c 4L5SA 5IWAQ 1QVCA 1YHBA 2PI2E 1AE2A 2R7DA 4GOPC 3CC2A 4JCVE 1GVPA 2Z0SA 2OQ0A 2PQAA 4DUYL 1E1TA 1M90C 3S1RH 1V1QA 3T1YQ 2OTJA 3ULLA 1UEBA 4LNQA 4X62L 2JA8G 2RF4A 3A5UA 1PH5A 4JI4Q 3GTOH 3H15A 4A3LG 3A74A 4OO1G 1X55A 3GTLH 1CKNA 3RLFA 3TS2A 5JEAG 3J81j 3GTGH 2E2JH 2XGTA 1IBKQ 1QZGA 1KXLA 1G51A 1HJPA 3M85A 4A3JG 5M5XH 3HOZG 2JA9A 3HOVH 4DR7Q 1VQCA 1OXXK 1YJ9A 4OWXB 2HIVA 3GD7A 3J80c 3U58A 4L5RC 4MTNA 3CCJA 3PGZA 3K0XA 1VS0A 3A0JA 1HR0L 4DV7L 4O2DA 2B29A 3KF6A 4NXNL 5IP7G 4DV1L 1KRSA 2K50A 2MO0A 3D31A 4A3IH 3RLOA 2F4VQ 4EQ5A 1K0RA 4HJ9A 2VZAA 1VQ9A 3CCEA 3VDYA 1Q81C 3HOUH 4AYBE 4HJ5A 1W3SA 3I2ZA 2JA6H 2VW9A 4LF9L 4NXML 4HJ7A 4LUOA 5IP9G 2I0QA 2I5MX 3F1ZA 2N8NA 1AE3A 1Q1EA 2PI2A 3CCLA 1PH7A 4C3HH 1IBLL 1YEZA 5FLMH 4B3SL 1I6HH 5M3FH 1U5KA 4AQYL 3AQQA 4JI6L 4A3GH 1HR0W 1TWGH 3U4ZA 3JAMc 1SN8A 1YIJA 1PH1A 5C4JH 4PZ7A 4B3RQ 2Z6KA 5M3MG 5H1SE 2LXJA 4JBKA 1Q12A 3AYHB 4LF7Q 4OX9Q 2YYZA 2CFMA 5GROA 3SGIA 3ULPA 1XMQL 1YZ6A 4MZ9A 1KIXA 1VQ6A 5C3EH 1X6OA 4DV6L 4LFBQ 1VCIA 1K9MC 1VQDA 2B63G 3NBHB 1OXUA 5LMUQ 1CSPA 1VQHA 1QZHA 2VQFQ 3CCMA 4JI0L 3S2DH 4BXXG 2UUBL 1SMXA 1K83H 4GS3A 4IJHA 4K0KQ 2PMZE 5IYBG 4YCUA 4XTCS 2IY5B 1E1OA 2ZTCA 3K7AH 4PZ8A 2R6GA 4A3KH 4YHHQ 1LM0A 2MFIA 5LMNW 4R4IA 4DK6C 2R92H 3BJUA 4QL5A 4DR5Q 4YWKA 4YY3Q 3T1HL 1G6PA 2K5HA 2ZM6L 1I94L 1UE5A 3W1GA 2PQAB 1H95A 1T9HA 3S1MH 2R93G 1LYLA 4GLAC 4IOAA 2KCMA 3PCOB 4LUZA 3UDFA 1KQSA 2A1AA 1A63A 2D62A 3I55A 4YCVA 1YHQA 1VQBA 3I7FA 2ID0A 1QUQA 3PV0A 1EFWA 3KFUA 1L1OC 2AHOB 4JI2Q 1EIFA 1CKNB 5GAGC 4DV5L 2OTLA 4X65L 1W2BA 4LFCQ 1E3PA 3HOVG 1X3EA 1TWCH 4R4CA 3RN2A 3PO3H 4KHPQ 3ULJA 4LF8L 3L7ZC 1HNZQ 3OW2A 3M3YH 1YI2A 1MJCA 2OWOA 2NN6I 4DKAC 4B3MQ 1A0IA 4IPCA 1WYDA 2A19A 5DLQE 3S2HH 4DPGA 1K8AC 2UU9Q 3PO2H 1HZBA 2UXBQ 1FJGQ 3KF6B 3HKZE 5IWAL 2R7FA 1VQJA 3KF8B 3UE0A 4KI0A 2JA5G 3HOUG 2K52A 4UPAA 4P72A 3UE1A 2ES2A 2JA6G 3I4NH 2ASBA 1TWAH 3T1YL 3J7ZC 1N36Q 1BBWA 3CCUA 2QA4A 4DUZL 1B7YB 1A62A 1LTLA 2NN6G 4IOCA 4HIMA 1MJEA 4JI4L 2VQEQ 4R4OA 2NVYH 4DR3Q 1PH9A 2YU9H 2BH2A 2FXQA 2QEXA 3B6YA 2K5NA 1YVCA 1Y1VG 3L0OA 2BA0A 1IBKL 5M3FG 1P8LA 3NEMA 3HKZG 1J5EQ 4DR7L 1V43A 4FDBA 3J81i 1YHAA 1YNXA 3Q8DA 1D7QA 4DAYB 5GQOA 1GD7A 3GO5A 5ELOA 4JI3Q 5C44H 4GOPA 2HQLA 3GTJH 2ZTEA 3TS0A 4A3DG 2UXDQ 4GN3B 5BR8L 1TWHH 2JA7H 3ICEA 2F3IA 2R7ZH 3CCSA 1BVSA 1MKHA 4DV3Q 5C0XG 1IYJB 1OXSC 1WI5A 3H0GG 3G71A 4A4IA 1RL2A 4JI8Q 5M5YH 1OTCA 2I5LX 2F4VL 1Z47A 3BZKA 4IPDA 3LGJA 3RLNA 3HOXG 4A93G 2Y0SE 2E2HH 2NZOA 4LFAQ 1GM5A 4P74A 1EIYB 1Z9FA 2VY3A 1WOCA 3K81C 3J80i 4HIKA 3S15H 1UE6A 2KBNA 4GN5A 4JBJA 1FL0A 3CAMA 4DNIA 2RHQB 5M5WH 1PH4A 3UDIA 1HNXQ 2JK8A 4A3BG 1HNWL 4A3EH 4LF4Q 3W5OA 1X65A 1UE1A 1VQAA 3GDEA 4H02A 1WCMG 4MNOA 4QGUA 1PV4A 3CC4A 2B3GA 4B3RL 3BZCA 3M9BA 1JJGA 1I5FA 1GO3E 1QUQB 2Y0SG 3EN2A 2YV5A 4JI7Q 4LF7L 4OX9L 2VUMG 3CCQA 4KHZA 4R4QA 4LFBL 1KAWA 3D0FA 2WFWA 4JI1Q 1IBMQ 1CUKA 5LMUL 3HOYH 3I56A 1KL9A 2VQFL 1GKHA 5LMNL 1XJVA 3S1NH 5IYDG 2RCNA 1NJIC 4DV4Q 3F2BA 2CQOA 4YWLA 4A3MH 1XNQQ 1V9PA 3JAMi 2ZJQA 1N34Q 1PYSB 3CQZH 3GTKH 1PVOA 2V1CC 1N33Q 1K3RA 4AIMA 1BKBA 1FGUA 4DR5L 4YY3L 3HOWH 4A3CG 4LF6Q 2A8VA 1PA6A 2JEBI 4EX5A 4POFA 4ALPA 1DGSA 1VQLA 3I4MH 3WWVA 2UXCQ 4DR2Q 4JBWA 4BBRH 1PH6A 3STBC 2Q2TA 1XNRQ 1SR3A 2HHHQ 2UUCQ 4A3FH 4P75A 5EAYA 4C3JH 1YJNA 4GNXC 3GTQH 5IYCG 1ASZA 1VQNA 2DUDA 5FJ8G 3OTOQ 4JI2L 1LUZA 4BY1G 4LFCL 3U50C 3CC7A 4GNXA 1QVFA 4JOIC 2PNHA 1E24A 3K80C 2K4KA 4PZ6A 2E8GA 4KHPL 1I3QH 1OXVA 4JOIA 1HNZL 4NXMQ 3CXCA 2K14A 1VQIA 2GN5A 3HFZB 4B3ML 2Q2IA 4GOPB
chains in the Genus database with same CATH superfamily
4CDEC 3HKSA 3OW7A 3L9AX 5JEAH 1D1IA 1WD0A 1NBWA 4QB4A 4GKJL 3HZXA 1CA6A 3STBD 1PH7A 1D2BA 3SXHA 1PH8A 3I4MB 4TKOB 1RD9D 3CMAA 1PH3A 1A8VA 4QQBX 3I90A 1E2VA 3MFGA 1KNAA 2C35B 2CWAA 1F9QA 4DR3L 1B8AA 1NMGA 1DOLA 4IQZA 4G4KA 4K2LA 4DR6Q 2DJGC 3EFXD 2EYMA 3OSOA 4LAAA 2QKIC 2UXDL 3T1HQ 3H0GB 4K14A 1ASYA 3A56A 4A3JB 2MHVA 3HOYG 4OWTB 3I73A 2NVTB 2MQHA 1IL2A 3Q22A 1JJCB 1QOHA 2CH4W 3CPFA 5CV4A 5E4WC 4DNRB 3RN5A 5JPNC 2F3VA 1XYIA 1FGBD 4X65Q 1VQMA 2EYOA 1SSOA 2CQAA 4A3BB 3K5LA 3HOWG 1C48A 1Q86C 1SLJA 5JJZA 1XMOQ 1K0SA 2QCPX 1DOMA 3TBIB 2AKWB 1NSNS 2B2TA 1ET9A 4ODGA 4HAEA 1VQPA 2XRSD 1QVGA 1SXTA 4M8AA 3GP7A 2Q8TA 3MXNB 4RHSA 3KJPA 2CCZA 2IW3A 2OCEA 2E74C 4JI7L 1Y8NB 4H0LC 1Y14B 1R4QB 5FLXc 1IBML 3PF5A 4HR7B 1I4HA 3VYSA 4QUFA 2CH4A 2L4NA 4FVMA 1TS2A 1O7YA 4RWSC 4B9XA 4PV1C 4DAMA 4C2MH 3NQTA 3OIQA 1HTPA 2CWPA 3OOCA 4K5XA 2F52A 4IFDG 3L2PA 4LF6L 2JEAI 1LT4D 2PNRC 4O42A 3F2CA 4IN3A 2UXCL 2BE5C 2F0NA 5IGDA 4X62Q 1XNRL 3ER0A 5HY6A 1PRTB 3W1BA 1HZAA 1Q8KA 1M1KC 1PZKD 4YHHL 5K36G 2JA5H 2VB2X 1CQVA 1XPOA 2WAQE 4F88A 1WJJA 2E2DC 2ENBA 2WP8J 2KVMA 1A6XA 2NTTA 5C4XH 5J3BA 2F4IA 3J81L 1WTQA 2WACA 1PH2A 2Z6KC 4P73A 4G7HC 4XT3B 1LTGD 3JC66 5AJ3L 1K8GA 1VF7A 5J39A 3PSIA 4A3DH 3M4OB 3DLLA 2WAQG 4RKLA 3D3RA 1HH2P 3KLWA 4QMGA 1EY6A 1SNMA 3KJOA 2IL8A 4K5VA 1I4RA 1X3PA 2KCNA 1E7ZA 1XTCD 3BDLA 4FF4A 3HOZH 4Y52H 3HOXH 4WJ4A 2RDFA 1X56A 3T53B 5HGQA 1SBBB 4UY8C 3SK4A 1XMQQ 2NZHA 4J15A 3BVZA 1N32L 4KJNA 5ISRA 1TWGB 1V1PB 4H13C 5C4JB 4JI5L 2IX0A 1SFOH 2IPKD 2IT1A 1TU2B 3EA6A 3J7A5 2VUMH 3V96A 2F0IA 3HS0C 3G4SA 1RCVD 1JE5A 5JJIA 4R8NA 1P16A 4A93B 3K7AB 2PQEA 2MP1A 4JV5L 1S72A 2ZTDA 1F77A 2GVBA 1TR5A 2OXPA 4LWCA 2DJFC 5I6WA 4PG3A 1SE8A 2UUAL 4DV2L 1XPRA 4OO1I 4BBRG 1WCMB 2YTXA 3CD6A 5C4XG 2QGQA 4ILWA 5IYCH 2EY1A 3RR5A 4ME3A 3K8AA 2Z4IA 3PO3B 1LT6D 1YHBA 1AE2A 2K05A 1B3AA 1UAPA 2L5TA 3OIPA 1ZKOA 4LMQD 3ULLA 4TRDA 1O78A 3TP7A 4A3LG 1GUTA 1QB5D 5I9OA 5FOBB 3J81j 5JPMC 1HJPA 4PMBA 3HOZG 3I4NB 2JA9A 3HOVH 1EWCA 3KLSA 1YJ9A 4FXKC 2C5CA 1SEBD 4MTNA 3CCJA 1IW7C 3I70A 4DV7L 4O2DA 5IP7G 4DV1L 2K50A 3URYA 3KF8A 2NTSA 2NBFA 4HJ9A 3D4DA 3DXJC 3E6ZX 3CCEA 3S1RB 4RKBA 4NXML 3F1ZA 3IL8A 4UHVA 1HHVA 3C3LA 2JP1A 3GTGB 1FYCA 3R2TA 2XWBB 4C3HH 3A55A 2FINB 3I8ZA 2F0EA 1YIJA 3DHQA 1EIGA 4NW2A 4HCSA 1LTTD 2Z6KA 1Q12A 2F0UA 5GROA 3SGIA 3ULPA 1KIXA 4DV6L 1VCIA 2EYLA 2PO4A 1K9MC 1BCPD 2B63G 3NBHB 2Q8RE 1QZHA 2ICIA 2VQFQ 4JI0L 4IJHA 2F0MA 3Q23A 1DJRD 2XWJB 2I07B 4XTCS 2ZTCA 2R6GA 1STGA 3I4LA 3VYTA 5M9OA 2MFIA 1JOKA 5LMNW 4IALA 4N9PA 3HOYB 4WORA 3S9WA 3T1HL 4RGMA 2K5HA 4ID6A 2PQAB 1H95A 3S1MH 2R93G 1LYLA 5C5LA 4LUZA 2A1AA 4JVZA 2D62A 3I55A 1YHQA 1VQBA 2F0FA 3CQZB 3KFUA 2AHOB 4JI2Q 4DV5L 2OTLA 1CKNB 5EBCA 1PTOD 3HOWB 4X65L 1E3PA 1Y8OB 3HOVG 1X3EA 4L63B 3T56B 4DK1A 4B3MQ 2RVLA 4C3JB 3R2IA 3TN2A 1G91A 2K01A 2O2LD 3PO2H 1HZBA 1TS5A 2A6EC 1HFNA 3FPUB 4G57A 3IKJA 2N55A 2R7FA 1I3QB 5IGFA 1EL0A 1L0XB 3VA5A 3BYYB 1VMCA 2K52A 2B2VA 4ZAIA 2ASBA 3T1YL 2G5DA 1BBWA 2K28A 3CCUA 5C6AA 1JR0D 2NN6G 4JI4L 4HIMA 2EYPA 3MWYW 4DR3Q 2YU9H 4C3HG 1Y1VG 3OMGA 3P75A 1P8LA 1E2ZA 1YHAA 3Q8DA 4DAYB 5GQOA 3GO5A 5C44H 3QO2A 2UXDQ 4BWGB 2JA7H 4X3UA 3ICEA 2F3IA 2B2WC 3BYTB 1MGSA 4B9WA 5KYIA 1BVSA 1MKHA 1V1OA 4DV3Q 1OXSC 1WI5A 3H0GG 1GJXA 4X3KA 1U4PA 4JI8Q 2I5LX 2AUJD 3NTKA 4KKUA 2F0LA 4IPDA 3LGJA 2FHTA 1STYA 3NWSA 4P74A 1Z9FA 4H44C 5JOBA 1SMYC 1YNNC 3S15H 4GN5A 1AFPA 2WKCA 3CAMA 1PH4A 2G9DA 3DUZA 4A3BG 2K04A 3VA7A 1BQQT 2I46A 1EY9A 2KA7A 5A2QE 3FVQA 4H02A 4B3RL 3K57A 2B3GA 4JPBW 4OX9L 4JI7Q 3EN2A 5J22A 4LFBL 1IBMQ 3QR8A 1TKWB 1BF4A 5IYDG 2KCCA 2E2HB 3V2TA 3WOEA 2CQOA 4YWLA 4XQQA 5I9PA 2PCFB 2ZJQA 2AQ1B 2HDMA 1MSHA 4A3CG 4YY3L 4LF6Q 5BN4A 2JEBI 3DWAA 3HGBA 4QUCA 4IUVA 3WWVA 2F3WA 2UXCQ 1SYDA 3DWPA 1PH6A 2Q2TA 1XNRQ 2PMZB 4A3FH 2H4OA 4CJ0B 4GNXC 3Q0AA 3GTQH 1VQNA 2DUDA 2BE5D 4LFCL 1D5MC 3CC7A 4QF4A 3K80C 1Y8PB 4PZ6A 4IUQA 1EEID 1TVXA 1VQIA 2JA8H 2K7VA 4F87A 2LY7A 2UU9L 3PF4A 1FJGL 2PZUA 1XTDA 2N78A 1EY7A 1GUGA 1C7YA 1HRJA 2BH8A 2IHEA 1G291 5CGKA 2MNAA 2LSSA 4FYDA 3FKIH 5AJ3Q 1LTAD 4BBRB 5C4XB 4YIJA 3UI2A 4XDXA 4TQUS 1RKNA 1YBYA 2HQEA 3CPWA 3HKZB 3J80E 3TP6A 2VS1A 3DWQA 2UUBQ 2MUYA 4C56C 1STEA 2JQOA 1PFMA 1VQOA 4A3DB 4YCWA 5EPJA 5IODA 1LO5D 1EQRA 2F0GA 5IP9H 2IHFA 2Z4HA 1JB7A 1DM0B 2N88A 1N32Q 3DEPA 3G48A 1I94Q 5GAHC 3HOZB 2V4DA 4HJAA 3HOXB 1Q1BA 2DGYA 5FLMG 4OHJA 4JI5Q 3S16B 1MI2A 2X6LA 4LFAL 4NKLA 5NUCA 4BS9A 2EIFA 1FVIA 2B2TC 2WB1G 2N3SA 1PFNA 4BXXH 1SFOB 5CYUA 3PUXA 4JV5Q 4I65A 2Y0SB 5IY0A 2VUMB 2VNUD 2NVQB 2X69A 2CW0C 3G6EA 4IFDI 3TQYA 1PTOB 1VQ5A 2R92G 1Q82C 2B2YA 3H91A 3KDFA 5KGUA 3VYUA 3PIO3 3UDGA 2UUAQ 4OONA 5C5MA 4DV2Q 3CMEA 3ND9A 1SE2A 5LL6X 1VF5C 4DUZQ 4ZQ3A 4RFBA 2RDHA 2D0OA 1N34L 2K5QA 1N33L 3S14H 4DU9A 3FKIG 4KV6A 3PO3G 1B70B 3C1FA 1HCZA 3AEVA 1L1OB 2K75A 1H9SA 3NTIA 4RGNA 1HFGA 1WFQA 2K32A 4CDDC 1EY0A 5CV9A 1EEFD 1C9OA 4DGZA 3OTOL 1I4GA 1TWFH 4GLXA 1E22A 2TMPA 1K8OA 2EY5A 2E2IH 2HD3A 3I4NG 3F2UA 3PUZA 1EYGA 1E0BA 3KYHC 5BN3A 4DV7Q 2Z1CA 4DV1Q 1KRTA 3E3XA 1ICFB 4FF3A 1TY2A 3HOVB 1JB3A 1BXTA 1IW7D 4JC0A 2AMCB 5DM73 3CCVA 2NVXB 3FMCA 2EZVA 5IT9E 1BNZA 1SNCA 5C0XH 3GTPH 3MVVA 1Y69U 2EPBA 3M4PA 5LMNQ 1Q3LA 5JJLA 4HIOA 1UE7A 1XWEA 2Q2UA 4XQJA 4A76A 3W3AA 3OMCA 3LWEA 5ELNA 2M9VA 1PHJA 3J7YW 4C3HB 4DV6Q 1Y1VB 4DR4L 1I50H 4JI0Q 4A3EG 4DN4M 1PYBA 3H09A 1J6QA 4HMIA 4OGQC 3TP8A 1NE3A 1HZ9A 2EDGA 4X64L 2N49A 3UDXA 1AW7A 4KD4A 1T5XD 1GOZA 1Q90A 3PIPA 2IX1A 4HTHA 2MGSA 3E9HA 1PRTF 2HDLA 3K5OA 1ESRA 1RTNA 1V8QA 3TRZA 4OELB 4DV3L 4L8JA 4JI8L 4X6AH 1TT2A 2EVBA 1EU4A 2B8GA 3PUYA 1GUSA 4LF5L 4DV5Q 1BR9A 1EUJA 2EJFC 1KDCA 4CGYB 3S17H 2EOTA 4IPHA 2L11A 5D3DA 4O0AA 4BA2I 5ELFA 2H5XA 3AU7A 4Y7NH 1HA6A 3RNUA 1WTVA 3SK5A 3CKIB 1LABA 3LWUA 5IYBH 4ZCKA 4C3JG 2K03A 2RSOA 3M4QA 4BY1H 5L37A 3E5SA 1IHZA 2A6ED 2OQ0A 3FEWX 5KEEA 4OIJA 1MHWC 4F8MA 5KIXA 1M90C 1MBYA 3T1YQ 1UEBA 3PO2B 3A5UA 5IOCA 1PH5A 4JI4Q 2A5HA 3A74A 1KABA 1DZ1A 3GTLH 2EYHA 5JEAG 2QDBA 2XGTA 1HXYD 3PIP3 5M5XH 1STAA 4OWXB 2HIVA 3ND8A 3R8BA 3GD7A 3J80c 3U58A 4L5RC 3T16A 3PGZA 1L0YB 5A35A 3A0JA 1C8CA 1SYGA 5KNCA 3G7LA 4A3IH 3RLOA 3K0YA 1H9MA 1OO9B 4HSVA 2PW7A 5C44B 4RAUC 1Q81C 3HOUH 1W3SA 5KYLA 2JA6H 3NE5B 2JA7B 1CZGA 2I5MX 2I0QA 2NZ1D 1CTMA 1ZYRD 3QOLA 1KAAA 1U4LA 3WDNA 2JN4A 5KNDA 1R4PB 1ICWA 1YEZA 2RCFA 1B53A 4NDXA 1SMYD 3SK8A 4AQYL 4A3GH 4KD3A 3N6RA 3JAMc 1ET6A 4PZ7A 4B3RQ 3M4YA 4UDUC 3D4RA 2NUCA 5H1SE 4JBKA 3AYHB 3S15B 4X3SA 4OX9Q 5C3EH 4LFBQ 1VQHA 3CCMA 3ZYYX 3S2DH 1JCKB 2UUBL 2H1EA 1K83H 4K0KQ 2XN9C 2PMZE 5IYBG 1TIID 2A69C 4A3KH 4PZ8A 1MSGA 4QCLA 1JOQA 1QWYA 4DK6C 1JQYD 4YWKA 4YY3Q 4IUUA 1G6PA 1I94L 1UE5A 3W1GA 1T9HA 4GLAC 4IOAA 2KCMA 3PCOB 1KQSA 3BDCA 3EROA 4YCVA 3D6CA 1QUQA 1EFWA 4CKCA 4LFCQ 5I4DA 2WB1B 4P2CB 4R4CA 1RDPD 3OW2A 1YI2A 2OWOA 4HEDA 4A3FB 2NN6I 4DKAC 4FXDA 4MTKA 3GTQB 2KQ3A 4RCNA 4KN4C 4EQNA 5DLQE 4DPGA 2UU9Q 2KJXA 1FJGQ 3KF6B 3HKZE 2R92B 5IWAL 2A68D 2B2VC 3UE0A 1H9JA 2CVRA 2PZWA 2JA5G 3HOUG 1X32A 2A6HD 2JA8B 4UPAA 4P72A 2JA6G 1TWAH 4KY6A 3CHBD 3OWEB 1XXGA 3EQLC 1PZID 4WJWA 1B7YB 4DUZL 4IOCA 2NVYH 4DAVA 1GUNA 2QEXA 2K5NA 1IBKL 3FKIB 2BA0A 4UAIA 3FPPA 4ABNA 3NXWA 3HKZG 3H3VC 4DR7L 1V43A 4U673 1D7QA 4K8IA 5ELOA 4JI3Q 2F0SA 2HQLA 2ZTEA 1F2LA 4A3DG 1HQMC 1EOTA 2X6GA 1TS4A 1TWHH 2XIWA 2EY6A 4ZUIA 3H6MA 3I91A 3CCSA 2R7ZH 3GV6A 3CRKC 1JWSD 2EYJA 4KHVA 4K2KA 1RL2A 4A4IA 4XT1B 2DNCA 3MZ5A 1KNEA 1Z47A 2R3ZA 3HOXG 2Y0SE 1LT3D 2NZOA 4FO2A 4LFAQ 1QNKA 1NCVA 5CV8A 2Q8IB 1EIYB 4FXGC 1F9PA 4FP5D 1FNVA 3J80i 1EYCA 4HIKA 1ILQA 1TS3A 4OEMB 4DNIA 1FL0A 2RHQB 2EJGC 3A8KE 4LF4Q 3J7AF 1UEAB 3C46A 3GDEA 1D6EC 2EJMA 4MNOA 3CC4A 2Y0SG 4LF7L 4BBSH 2VUMG 1SDFA 4CJ1B 1TQOA 3CCQA 4KHZA 1KAWA 2CW0D 5M5YB 5LMUL 3I56A 1KL9A 3SK6A 1GKHA 5LMNL 5LHY1 2RCNA 1ENFA 2BDNA 4A3MH 1PLFA 2ZXRA 1F9RA 5D3IB 3JAMi 1RODA 2XSCA 1PYSB 4K6DA 1N34Q 3GTKH 2VXWA 1N33Q 4AIMA 1BKBA 1FGUA 1IYVA 3KK7A 4A3EB 3I4MH 2QILA 1G2SA 4JBWA 4EQOA 3STBC 1ENCA 5EAYA 3MXNA 1SAPA 5IYCG 2DNEA 4KN7C 4CDFC 3S14B 3OTOQ 1LUZA 3U50C 3W2DA 1QVFA 1II3A 2DY8A 3ERQA 5EPKA 2K4KA 2F03A 2E8GA 5FLXL 4KHPL 1HNZL 3MC0B 3J81E 3CXCA 1BBXC 4C1NI 4GOPB 1CSQA 1MD2D 2SEBD 4OO1H 1STHA 2L12A 3HP3A 1TWFB 2OF1A 2UXBL 3KOJA 5JEAJ 1DYQA 4JI6Q 2KENA 1CKOA 4KJOA 2NVTH 1HZCA 2QF7A 4IFDJ 4K8JA 2PW5A 3MXGA 1A3UA 1X3GA 2SNSA 3HG9A 2XNAC 1CZWA 2EY2A 3S1QH 3D8GA 4GN4B 2AQ2B 5CV5A 2L15A 3CRLC 2NB0A 4OIKA 3I4OA 1EYAA 3U4VA 5G3LD 3QJYA 4MIUA 4V0BA 4KMUC 5E4XA 2AWOA 5IGEA 3OWFA 3D6WA 4QIWE 5IGBA 3CF5A 3I72A 2BA1A 4DR4Q 5C4HA 1EQQA 1VQEA 1UWVA 2ATWA 1LTRD 2K5WA 2C9OA 1Z6HA 4NB3A 4S3SA 5M3MH 4X64Q 2B8FA 1YJWA 5FK9C 5BN5A 5FO7B 1JWUD 2PYKA 1MIUA 3E0JA 4HN7A 1JORA 4J6HA 1I50B 4TVAB 4L5TA 2CKZB 2K33A 4HIDA 1EQTA 4P71A 3SHLA 1AEXA 3WOFA 1B50A 1EIHA 4I7AA 4UP7A 5JAVA 5K5PA 1LTBD 4Q5VA 4LF5Q 4HJ8A 4IJLA 1DXMA 2B2YC 4IPGA 1B2TA 4OWWB 4L6TB 2A74C 4GNXB 3BVGA 2KHJA 2EYFA 3MFYA 4U68A 4JI1L 1S4ZA 1SROA 1V1PA 3FHWA 5EJWA 5I2YA 3GTMH 3D4WA 1VQKA 2MJ8A 5CORA 4CKBA 1D1KA 3MXPA 3TMEA 2QEJC 3S17B 4PMWA 2DY7A 3TZDA 1D8LA 1SNQA 1I4XA 4R9WA 4Y7NB 3KBGA 4HMJA 4OXPA 3CCRA 3IRBA 1TXYA 3E0EA 1O7IA 1O7ZA 3VR5A 4GLVB 3M4OH 4CJ2C 1RJTA 3H3VH 3TEHB 1Y1WH 4K0KL 4RGTA 5KNBA 3PO2G 2B2UA 3T4AC 5ELCA 3EBEA 3OPOA 4I7ZC 2MPMA 1B9NA 3TSSA 2BCOA 2TSSA 2A73B 4ZKBB 1UUPA 4DXFA 1BCPF 4PMCA 4WJ3M 5JJKA 2LFNA 2D5DA 2HUGA 3P1HA 2RHSB 1FD7D 1EWIA 3GTLB 4C2MB 1SRUA 4R4TA 1CA5A 2NYZD 1ESFA 3NPPA 3C1EA 4BA1I 4CHTB 1VQFA 2AWNA 4FF2A 1X3FA 4AYBG 5C44G 1AN8A 3DM3A 3PUVA 4A75A 3CP0A 2HT1A 4A3IB 4NPSA 2JA7G 3K59A 1PZJD 2OQKA 3EIVA 5C4ZA 2D2CC 2B39A 1SNPA 2JA5B 1PTOF 3HOUB 4AQYQ 1F2YA 2JA6B 4A93H 3NBIA 2AUKA 2RDGA 1X9NA 3X3MA 1K73C 3LNNA 5HURA 4X66L 4ZYSA 2KCTA 1PXUA 2JJQA 5EKIA 4A3GB 3PIOA 1OXTA 5JVH3 2E5LL 1U9RA 1EOVA 1WCMH 1GHKA 4DV0L 1H9RA 1TY0A 4GKKL 4JI3L 2Z6BA 1BDOA 1S5ED 3AB9A 3J7AV 3P7JA 2WB1E 3RZOH 2A69D 1KD1C 4ME5A 1HUMA 4RMFA 1K83B 4B3TL 2O5IC 3A5ZB 3X3NA 4A3KB 4XIGS 1Y1WG 1L0WA 5IE8A 4LF8L 2JE6I 2ALYB 4LUVA 4DR1L 2ZJPA 4JYAL 2KHIA 3E9IA 5GAEC 2FFKB 3NBHA 3TREA 1LT5D 4YWMA 2D0PA 5CV6A 2K5VA 4N8FA 1M8AA 4DFAA 3K7UC 3PMFA 4R1JA 4LF4L 5C0XI 3M7NA 1VQGA 2L9HA 4EGVA 4A3FG 4FF1A 1AH9A 5FJ8H 2YTYA 3J81c 1DD2A 5IWAQ 1NR4A 2PI2E 2R7DA 4JCVE 2Z0SA 1ZEQX 2PQAA 4DUYL 1E1TA 1H9KA 2KEEA 3S1RH 1V1QA 2OTJA 1O80A 2JA8G 2ZT9C 3GTOH 4NP5A 1X55A 3TS2A 1CKNA 3RLFA 2G9HD 3GTGH 3NSWA 1IBKQ 2E2JH 1KXLA 1G51A 2F0PA 4DR7Q 4G7OC 1YNJC 1EY5A 1TWAB 1OXXK 1STBA 5DEHA 1W6JA 3K0XA 2NVYB 1HR0L 2B29A 4NXNL 3A7AB 5CR3A 1KRSA 1JE4A 3D31A 1KLUD 5FO8B 2RSNA 1KLGD 5DM63 2VZAA 3NK9A 3TP5A 1VQ9A 4HJ5A 1BCPC 1I4PA 4KY5A 4LF9L 5IP9G 2R7ZB 2ZXOA 1AZPA 3KBXA 1AE3A 1Q1EA 3DM1A 4Z9CB 3CCLA 4EVOA 1IBLL 4B3SL 1BOSA 5M3FH 1CM9A 3V05A 1S5DD 4DAYA 4JI6L 1HR0W 1I6HH 1FNWA 4EQPA 2LXJA 4LF7Q 2YYZA 1YZ6A 4MZ9A 2CHBD 2EXZA 5COYA 1OXUA 5LMUQ 1CSPA 1M4VA 4BXXG 1HPCA 1PYWD 4GS3A 2IY5B 1E1OA 4RGOS 4R4IA 3BJUA 4QL5A 1SYFA 1DCZA 3VR2A 1GUOA 1HQRD 2JXMB 2SNMA 2ZM6L 2KECA 1DOKA 3BS1A 3OHXC 4A3MB 1SYEA 5D14A 3I7FA 1FR3A 2ID0A 3DEOA 3PV0A 3GTKB 1L1OC 5T1GA 1EIFA 2L0CA 1SYCA 1W2BA 4IFDH 1WTOA 4IUTA 1TWCH 5IIFA 4KHPQ 5EBDA 4QIWB 1HNZQ 3M3YH 1HTLD 1MJCA 1A2UA 3MAQA 3C2PA 4IPCA 1QILA 3TDQA 3S2HH 2UXBQ 1HA5A 3NWTA 5J1ZA 3U9SA 3SE0A 3A7LA 1CT1D 5K36H 3KF8B 4KI0A 1NAPA 3VYRA 1A3TA 3UE1A 3VR3A 2LS01 5KRUA 2ES2A 3S1MB 2E76C 2QA4A 1A62A 1LTLA 3FRPB 3KLSX 5E1FA 5T1IA 4R4OA 1PH9A 3A54A 5M3FG 3NEMA 4XYOA 3J81i 4CKEA 1GD7A 1ML0D 3GTJH 3S1QB 4PNYA 1F2ZA 1JICA 4E6IA 5C0XG 2F4VL 2XVSA 1PDQA 2KOLA 3SVMA 4HSPA 4ZLTF 3SDZA 1G6ZA 1PMRA 3BZKA 1CHPD 1FNUA 2E2HH 1GM5A 2VY3A 1JWMD 2FMMA 3K81C 1WTPA 2YU9B 4XYQA 1WTRA 1UE6A 2KBNA 5M5WH 1CFMA 2JK8A 3EJIA 1D5XC 2Z9HA 2ZXPA 5M3MB 4FNFA 1ONLA 4AYBB 1I6VC 1A15A 1KDAA 4GZYC 4QGUA 1PV4A 1G8ZD 1JJGA 1I5FA 1GO3E 2F0OA 2YV5A 4R8IA 2WFWA 4JI1Q 1K3BC 1XX8A 2OT2A 1F9SA 3S1NH 1NJIC 1YNND 2SDFA 4TSSA 3KUPA 1STNA 2K6AA 1E2WA 1EFID 1K3RA 4DR5L 1B4OA 3GTMB 2A8VA 4ALPA 1A2TA 1IKLA 1S5FD 1CQFA 4BBRH 4P75A 2KUMA 4BY1G 3BZDB 4JK1C 4JOIA 4IURA 1GUWA 5TSSA 1EZ6A 5I6YA 3HFZB 2WINB 1Y1WB 2LKVA 4A3LH 3CU7A 3RZDH 1L1OA 4C3IH 1PRTC 3S16H 1LACA 1N36L 1ILPA 4KK7A 5IP7H 1EYDA 1BO0A 3GV3A 2VQEL 3QIAA 2J7ZA 1A3VA 4A3IG 2F0DA 2GA4B 3AFQA 3FP9A 1SNDA 3AFPA 4UP8A 4PQXA 2M00A 1J5EL 2F1MA 1RF2D 2NVQH 3IFTA 3MEFA 3OYYA 1ENAA 4IO9A 1PTOH 1I4QA 4X66Q 2BOSA 1CI3M 5EPLA 1KTKA 4DK3C 3CW2C 4K5WA 4AH6A 2E5LQ 1N9WA 5IT9c 3K6OA 4A3GG 1LLRD 4MHEA 4DV0Q 4GKKQ 1VQ8A 3S24A 4L5QA 1J8IA 1Q46A 1U4RA 1U0LA 5IGCA 1NTGA 1X54A 5C3EG 2B63H 3GQBA 1HNXL 1VQ7A 5F2DA 1JJ2A 4ZRZA 4B3TQ 4QY7A 3QOJA 4LF8Q 4A3KG 5AFWA 4DR1Q 3RZOB 3K5MA 1NUCA 2VB3X 4JYAQ 4RA8A 1RIPA 3L3OC 2WIIB 4CDCC 5A2QL 1K28A 3P20A 2MO1A 3KLRA 3F8TA 3BU2A 3G6JB 5CBAE 2R61A 1KHIA 2R93H 5ELEA 4RG1A 1QE6A 4DV4L 2J0TD 1R9TH 1JC7A 1WTXA 1KDBA 1PFSA 4IUNA 3F2DA 1XNQL 3T51B 2HIXA 3RD4A 4C3IG 1BBUA 3N52A 1B44D 4DUYQ 1A63A 3PUWA 2NVXH 4BY7H 4DR2L 1NY4A 1DONA 2LMCB 4JG2A 5BR8Q 5CMDA 3NELA 2EXDA 2HHHL 2UUCL 5LL6S 2B2UC 1XPUA 1S40A 3H94A 2F0KA 2Q2HA 2SOBA 1WD1A 1N8RC 1PFBA 2GVAA 5FO9B 2P5ZX 4G7ZC 2IX3A 3A8IE 1WTHA 1W6KA 3HEJA 2F0HA 3GTOB 1RTOA 3EVQA 1S3OA 1YNJD 2NN6H 1HR0Q 4POGA 1JT8A 2VL6A 4NXNQ 2K1BA 3I3CA 2E2JB 1L2FA 1HNWQ 2Z8LA 1Y1VH 2RQXA 2EQSA 2LXKA 4B08A 4RCOA 2F0WA 4DXGA 4J1MA 5E7NA 1LTID 2RBMA 1HUNA 4LF9Q 5CBEE 1EWHA 4IUPA 4Q0FA 5CV7A 2I5HA 2KEDA 4KLKA 4JBMA 2YTVA 2NWGA 1NMFA 2R7ZG 3H0GH 4LW1A 5C0XJ 1IBLQ 4J8QA 4HCEA 4A3JH 4B3SQ 3NENA 4DR6L 2PPBC 2E2IB 3HRZC 2F0JA 3J80L 5DAUA 4O1NA 5GADC 4QJFA 3BG3A 4X3TA 4A3BH 2IWHA 4V190 1I6HB 3KDFB 4ZK9B 5M3FB 5IGGA 1F2MA 1JMCA 3ZJYC 3H3VI 4XXEA 3NUCA 5FKAC 4LJZC 4H7BA 1VQ4A 2QW7A 4BBSG 3RMHA 1KC8C 1SE4A 1B3QA 2KHSA 2L55A 3GTPB 1XMOL 4CBVA 1QCBD 2ZM6Q 1EY8A 4BY7G 1AZQA 5IYDH 2RA4A 3JAML 1H9SB 4APVA 1SE3A 4GKJQ 4LNQA 4A3MG 4DF7A 1AP0A 1B1ZA 1CKMA 5ELDA 1Q7YC 3ERSX 4A3CH 2ZJRA 3U9OA 4WRDA 1YITA 1QG7A 3I4MG 3AMUA 4UP9A 2EE1A 1C0AA 2XTIA 1IXRA 1IZ6A 1TWCB 4L5SA 1QVCA 4IZ8A 4RHRA 4GOPC 3CC2A 3M3YB 4OL7A 1GVPA 1GXDC 1NR2A 5EKKA 3S2HB 4X62L 2RF4A 3H15A 2DN8A 3Q24A 4OO1G 4KKTA 3R3OA 1QZGA 3M85A 4A3JG 1ZXTA 1VQCA 2XRQD 4N9TA 1ZYRC 4JW0A 3O13A 3QWNA 2ICEC 1U4MA 2QDLA 1O7LA 1VS0A 4MN3A 3LX0A 2HCIA 3KF6A 4BY1B 3MEHA 3Q6SA 2MO0A 4C1NK 4DAPA 2F4VQ 3MHBA 4EQ5A 2F0QA 1K0RA 2JSOA 3GTJB 3NHHA 3VDYA 2WAQB 4AYBE 4N8X1 2FMCA 3I2ZA 3QB3A 4RH6A 2VW9A 4HJ7A 4LUOA 1CK1A 4NMZA 5EQ0A 4KY7A 1CHQD 2N8NA 3FDTA 4DNTB 5ELBA 2PI2A 5M5XB 1GHJA 5IT9L 5FLMH 1U5KA 3AQQA 1TWGH 1EQVA 2F0TA 1SN8A 3U4ZA 3VR6A 1PH1A 5C4JH 3NP8A 5M3MG 1XMQL 2CFMA 1UNSA 1RHPA 5M5WB 1VQ6A 3IAYA 4KTAA 1X6OA 1VQDA 3RUZA 1D5ZC 2BDOA 1SMXA 4ULLA 1T5EA 4XQNA 4YCUA 3K7AH 3NTHA 4YHHQ 1LM0A 2R92H 4DR5Q 1B9MA 4LK1C 3S1NB 1LV9A 1QJOA 2A68C 5I2XA 3UDFA 5G3LF 5FLXE 1EU3A 1LTSD 2A6HC 5GAGC 5C3WA 5C3EB 5EKLA 3M7GA 3PO3H 3RN2A 2F0VA 2O5JC 3ULJA 2WV6D 3L7ZC 3S2DB 1A0IA 2O4XA 5CC4A 1WYDA 2A19A 1K8AC 5EGTA 2J4XA 1VQJA 3ITPA 1K8MA 3QG1A 3I4NH 1EZ8A 3MXUA 3T13A 4ZKCB 3J7ZC 1N36Q 4F7XA 1BCPB 1MJEA 3TZUA 2VQEQ 1PRTD 3R93A 1SNOA 3RZDB 3VR4A 3IFDA 1BUVT 2FXQA 2BH2A 3B6YA 2M2LA 1YVCA 3L0OA 4DK0A 4C3IB 1J5EQ 2FJ2A 4FDBA 1YNXA 1Q8IA 4WFN3 2OEOA 4GOPA 3TS0A 3JAME 4GN3B 5BR8L 2JYOA 5E3FA 1J9OA 3DMUA 1IYJB 1OTCA 2B2WA 3G71A 5M5YH 3RLNA 4A93G 4ZUJA 1JOOA 1SJED 1WOCA 2E75C 5JVG3 5C3XA 1EY4A 1X3QA 4JBJA 3ONAB 5HGTA 1HNXQ 3UDIA 3PQIA 1HNWL 4DA2A 4A3EH 1VMPA 3W5OA 1X65A 1UE1A 2L1BA 3BVMA 1VQAA 3MTSA 2AQ3B 1WCMG 3K5NA 1IYUA 3BZCA 3M9BA 1QUQB 1TWHB 1SJHD 2B63B 2RKSA 4R4QA 3NQIA 3D0FA 1S5BD 1CUKA 3BDOA 3HOYH 2VQFL 3K58A 1SYBA 1Z7TA 1XJVA 1WTWA 4DV4Q 1VDZA 1C4QA 2D9UA 3F2BA 3A8JE 5D65A 1XNQQ 1V9PA 3SEBA 2K5DA 3CQZH 1PVOA 2V1CC 3HOWH 1IL8A 2R93B 1PA6A 4EX5A 4POFA 3SR1A 1DGSA 1VQLA 1S5CD 4DR2Q 2PZTA 1R9TB 1WVLA 1PTOC 1SR3A 2HHHQ 2UUCQ 4C3JH 1YJNA 2HCCA 1ASZA 4BBSB 5FJ8G 4JI2L 4GNXA 4JOIC 2PNHA 1E24A 4K6LA 4BY7B 2IJ0A 5DNFA 1I3QH 1OXVA 3MA2B 1IKMA 2WKDA 4NXMQ 4M1UB 2K14A 2GN5A 4KKSA 1NNXA 4B3ML 2Q2IA 1QNUA 1G2TA
chains in the Genus database with same CATH topology
3HKSA 4A3LH 1CSQA 2UU9L 3PF4A 2UXBL 1FJGL 1NBWA 3KOJA 5JEAJ 1XTDA 4GKJL 2N78A 1C7YA 4BBSH 4JI6Q 2BH8A 2IHEA 1G291 1CKOA 2KENA 3STBD 2MNAA 2LSSA 3RZDH 1HZCA 1PH8A 2NVTH 3FKIH 1L1OA 4IFDJ 5AJ3Q 4C3IH 1X3GA 3CMAA 3S16H 1PH3A 1A8VA 4QQBX 1N36L 4TQUS 5IP7H 3S1QH 1YBYA 2C35B 2CWAA 3CPWA 2VQEL 4GN4B 4DR3L 1B8AA 2L15A 2VS1A 1NMGA 4A3IG 2UUBQ 3I4OA 3AFQA 3U4VA 4DR6Q 3FP9A 3AFPA 4UP8A 1J5EL 2JQOA 1VQOA 4YCWA 1EQRA 5IP9H 2IHFA 2NVQH 1JB7A 3MEFA 3OYYA 2AWOA 4IO9A 2UXDL 4X66Q 3T1HQ 1N32Q 1ASYA 3G48A 4QIWE 1I94Q 3CF5A 5GAHC 2BA1A 3HOYG 4DR4Q 4HJAA 4OWTB 4DK3C 3CW2C 1Q1BA 1VQEA 1UWVA 2MQHA 1N9WA 4AH6A 1EQQA 2E5LQ 1IL2A 5IT9c 2DGYA 5FLMG 4JI5Q 1JJCB 3CPFA 4A3GG 4DV0Q 4NB3A 5M3MH 3RN5A 4LFAL 4X64Q 1YJWA 4X65Q 1VQ8A 4GKKQ 3S24A 1VQMA 4L5QA 1Q46A 1MIUA 1U0LA 3HOWG 2EIFA 1NTGA 1X54A 1Q86C 1SLJA 1FVIA 4L5TA 2CKZB 2WB1G 4TVAB 2N3SA 5C3EG 4HIDA 2AKWB 1XMOQ 1HNXL 1VQ7A 2B63H 1JJ2A 4B3TQ 4P71A 4BXXH 2JA8H 4QY7A 3PUXA 4JV5Q 4UP7A 1VQPA 5IY0A 1QVGA 2VNUD 4LF8Q 4LF5Q 3G6EA 4A3KG 3MXNB 4DR1Q 3TQYA 3KJPA 4HJ8A 4IJLA 2CCZA 4IFDI 2OCEA 4IPGA 4JI7L 4JYAQ 1RIPA 1VQ5A 4OWWB 4GNXB 1Y14B 2R92G 2KHJA 1Q82C 3KDFA 2MO1A 5FLXc 3UDGA 4JI1L 1IBML 3PF5A 2UUAQ 3F8TA 3BU2A 4OONA 1SROA 4DV2Q 3FHWA 3CMEA 1KHIA 3GTMH 4DUZQ 2R93H 1VQKA 4LF5L 4RG1A 4DV4L 1R9TH 4DAMA 1PFSA 4C2MH 3F2DA 4PMWA 1XNQL 2CWPA 2D0OA 1N34L 2F52A 1N33L 4IFDG 1D8LA 2HIXA 3L2PA 3S14H 3FKIG 4LF6L 2JEAI 3PO3G 1B70B 1BBUA 3AEVA 4OXPA 3CCRA 3F2CA 1L1OB 3PUWA 3IRBA 2K75A 1TXYA 3E0EA 1NY4A 4DUYQ 4DR2L 2NVXH 4BY7H 2UXCL 1O7IA 4X62Q 4JG2A 5BR8Q 1XNRL 3NELA 2EXDA 4GLVB 2HHHL 2UUCL 3M4OH 1WFQA 3ER0A 5HY6A 1XPUA 3TEHB 1Y1WH 3W1BA 1S40A 3H3VH 4K0KL 1HZAA 3PO2G 1Q8KA 1C9OA 3OTOL 1M1KC 2Q2HA 1N8RC 1TWFH 4GLXA 2GVAA 3EBEA 1E22A 4YHHL 5K36G 2JA5H 2E2IH 1XPOA 4WJ3M 5JJKA 2WAQE 1WJJA 3I4NG 3PUZA 2WP8J 2RHSB 1S3OA 1EYGA 1EWIA 3KYHC 1HR0Q 4POGA 1JT8A 5C4XH 4DV7Q 2VL6A 1SRUA 4DV1Q 4NXNQ 1KRTA 1L2FA 4R4TA 1HNWQ 5J3BA 1Y1VH 2EQSA 2LXKA 4JC0A 1PH2A 2AMCB 4BA1I 2Z6KC 5E7NA 3CCVA 4P73A 1VQFA 2AWNA 1X3FA 3JC66 5AJ3L 1K8GA 4AYBG 4LF9Q 3PSIA 5C44G 4A3DH 3DM3A 3PUVA 4A75A 3DLLA 3CP0A 2WAQG 2HT1A 2I5HA 4NPSA 1HH2P 3KLWA 4KLKA 4JBMA 2JA7G 2YTVA 2OQKA 2ATWA 1NMFA 3EIVA 3GTPH 2R7ZG 3H0GH 4LW1A 5C0XJ 3KJOA 1IBLQ 3M4PA 5LMNQ 1E7ZA 4A3JH 4B3SQ 3NENA 3HOZH 4HIOA 4AQYQ 1UE7A 4DR6L 5JJLA 4Y52H 3HOXH 4A93H 2Q2UA 4WJ4A 1X56A 4A76A 1X9NA 1K73C 5HGQA 5GADC 4UY8C 5ELNA 1XMQQ 1PHJA 4QJFA 2NZHA 4X66L 4J15A 4DV6Q 1N32L 2KCTA 4A3BH 3KDFB 2JJQA 4DR4L 1I50H 1JMCA 4JI0Q 3ZJYC 4A3EG 3H3VI 1PYBA 1OXTA 3PIOA 2E5LL 1EOVA 4JI5L 1J6QA 2IX0A 1WCMH 1SFOH 1NE3A 2IT1A 4DV0L 1HZ9A 4X64L 2N49A 4GKKL 4JI3L 3UDXA 1VQ4A 3J7A5 2VUMH 4BBSG 3G4SA 1KC8C 2WB1E 1JE5A 3RZOH 1KD1C 3PIPA 2IX1A 1XMOL 3E9HA 4RMFA 2ZM6Q 4BY7G 3TRZA 4DV3L 4B3TL 5JJIA 3A5ZB 1P16A 5IYDH 4JI8L 4X6AH 4XIGS 4JV5L 1S72A 2ZTDA 4APVA 1Y1WG 3PUYA 1L0WA 4GKJQ 5IE8A 4A3MG 2JE6I 2ALYB 2GVBA 4LUVA 4DV5Q 4DR1L 2ZJPA 1CKMA 1EUJA 4JYAL 4LWCA 3ERSX 1Q7YC 4A3CH 3S17H 2KHIA 3E9IA 2ZJRA 4PG3A 5GAEC 4IPHA 1SE8A 3TREA 2UUAL 1YITA 4O0AA 4YWMA 2D0PA 3I4MG 4BA2I 4DV2L 2H5XA 4UP9A 4Y7NH 1XPRA 2K5VA 3RNUA 4OO1I 4LF4L 3K7UC 4BBRG 4R1JA 5C0XI 3M7NA 2YTXA 1VQGA 3CD6A 5C4XG 2QGQA 1C0AA 2XTIA 4A3FG 5IYBH 5IYCH 1IXRA 3RR5A 1AH9A 1IZ6A 4ME3A 5FJ8H 3K8AA 3M4QA 2YTYA 4BY1H 3J81c 4L5SA 5IWAQ 1QVCA 1YHBA 2PI2E 1AE2A 2R7DA 4GOPC 3CC2A 4JCVE 1GVPA 2Z0SA 2OQ0A 2PQAA 4DUYL 1E1TA 1M90C 3S1RH 1V1QA 3T1YQ 2OTJA 3ULLA 1UEBA 4LNQA 4X62L 2JA8G 2RF4A 3A5UA 1PH5A 4JI4Q 3GTOH 3H15A 4A3LG 3A74A 4OO1G 1X55A 3GTLH 1CKNA 3RLFA 3TS2A 5JEAG 3J81j 3GTGH 2E2JH 2XGTA 1IBKQ 1QZGA 1KXLA 1G51A 1HJPA 3M85A 4A3JG 5M5XH 3HOZG 2JA9A 3HOVH 4DR7Q 1VQCA 1OXXK 1YJ9A 4OWXB 2HIVA 3GD7A 3J80c 3U58A 4L5RC 4MTNA 3CCJA 3PGZA 3K0XA 1VS0A 3A0JA 1HR0L 4DV7L 4O2DA 2B29A 3KF6A 4NXNL 5IP7G 4DV1L 1KRSA 2K50A 2MO0A 3D31A 4A3IH 3RLOA 2F4VQ 4EQ5A 1K0RA 4HJ9A 2VZAA 1VQ9A 3CCEA 3VDYA 1Q81C 3HOUH 4AYBE 4HJ5A 1W3SA 3I2ZA 2JA6H 2VW9A 4LF9L 4NXML 4HJ7A 4LUOA 5IP9G 2I0QA 2I5MX 3F1ZA 2N8NA 1AE3A 1Q1EA 2PI2A 3CCLA 1PH7A 4C3HH 1IBLL 1YEZA 5FLMH 4B3SL 1I6HH 5M3FH 1U5KA 4AQYL 3AQQA 4JI6L 4A3GH 1HR0W 1TWGH 3U4ZA 3JAMc 1SN8A 1YIJA 1PH1A 5C4JH 4PZ7A 4B3RQ 2Z6KA 5M3MG 5H1SE 2LXJA 4JBKA 1Q12A 3AYHB 4LF7Q 4OX9Q 2YYZA 2CFMA 5GROA 3SGIA 3ULPA 1XMQL 1YZ6A 4MZ9A 1KIXA 1VQ6A 5C3EH 1X6OA 4DV6L 4LFBQ 1VCIA 1K9MC 1VQDA 2B63G 3NBHB 1OXUA 5LMUQ 1CSPA 1VQHA 1QZHA 2VQFQ 3CCMA 4JI0L 3S2DH 4BXXG 2UUBL 1SMXA 1K83H 4GS3A 4IJHA 4K0KQ 2PMZE 5IYBG 4YCUA 4XTCS 2IY5B 1E1OA 2ZTCA 3K7AH 4PZ8A 2R6GA 4A3KH 4YHHQ 1LM0A 2MFIA 5LMNW 4R4IA 4DK6C 2R92H 3BJUA 4QL5A 4DR5Q 4YWKA 4YY3Q 3T1HL 1G6PA 2K5HA 2ZM6L 1I94L 1UE5A 3W1GA 2PQAB 1H95A 1T9HA 3S1MH 2R93G 1LYLA 4GLAC 4IOAA 2KCMA 3PCOB 4LUZA 3UDFA 1KQSA 2A1AA 1A63A 2D62A 3I55A 4YCVA 1YHQA 1VQBA 3I7FA 2ID0A 1QUQA 3PV0A 1EFWA 3KFUA 1L1OC 2AHOB 4JI2Q 1EIFA 1CKNB 5GAGC 4DV5L 2OTLA 4X65L 1W2BA 4LFCQ 1E3PA 3HOVG 1X3EA 1TWCH 4R4CA 3RN2A 3PO3H 4KHPQ 3ULJA 4LF8L 3L7ZC 1HNZQ 3OW2A 3M3YH 1YI2A 1MJCA 2OWOA 2NN6I 4DKAC 4B3MQ 1A0IA 4IPCA 1WYDA 2A19A 5DLQE 3S2HH 4DPGA 1K8AC 2UU9Q 3PO2H 1HZBA 2UXBQ 1FJGQ 3KF6B 3HKZE 5IWAL 2R7FA 1VQJA 3KF8B 3UE0A 4KI0A 2JA5G 3HOUG 2K52A 4UPAA 4P72A 3UE1A 2ES2A 2JA6G 3I4NH 2ASBA 1TWAH 3T1YL 3J7ZC 1N36Q 1BBWA 3CCUA 2QA4A 4DUZL 1B7YB 1A62A 1LTLA 2NN6G 4IOCA 4HIMA 1MJEA 4JI4L 2VQEQ 4R4OA 2NVYH 4DR3Q 1PH9A 2YU9H 2BH2A 2FXQA 2QEXA 3B6YA 2K5NA 1YVCA 1Y1VG 3L0OA 2BA0A 1IBKL 5M3FG 1P8LA 3NEMA 3HKZG 1J5EQ 4DR7L 1V43A 4FDBA 3J81i 1YHAA 1YNXA 3Q8DA 1D7QA 4DAYB 5GQOA 1GD7A 3GO5A 5ELOA 4JI3Q 5C44H 4GOPA 2HQLA 3GTJH 2ZTEA 3TS0A 4A3DG 2UXDQ 4GN3B 5BR8L 1TWHH 2JA7H 3ICEA 2F3IA 2R7ZH 3CCSA 1BVSA 1MKHA 4DV3Q 5C0XG 1IYJB 1OXSC 1WI5A 3H0GG 3G71A 4A4IA 1RL2A 4JI8Q 5M5YH 1OTCA 2I5LX 2F4VL 1Z47A 3BZKA 4IPDA 3LGJA 3RLNA 3HOXG 4A93G 2Y0SE 2E2HH 2NZOA 4LFAQ 1GM5A 4P74A 1EIYB 1Z9FA 2VY3A 1WOCA 3K81C 3J80i 4HIKA 3S15H 1UE6A 2KBNA 4GN5A 4JBJA 1FL0A 3CAMA 4DNIA 2RHQB 5M5WH 1PH4A 3UDIA 1HNXQ 2JK8A 4A3BG 1HNWL 4A3EH 4LF4Q 3W5OA 1X65A 1UE1A 1VQAA 3GDEA 4H02A 1WCMG 4MNOA 4QGUA 1PV4A 3CC4A 2B3GA 4B3RL 3BZCA 3M9BA 1JJGA 1I5FA 1GO3E 1QUQB 2Y0SG 3EN2A 2YV5A 4JI7Q 4LF7L 4OX9L 2VUMG 3CCQA 4KHZA 4R4QA 4LFBL 1KAWA 3D0FA 2WFWA 4JI1Q 1IBMQ 1CUKA 5LMUL 3HOYH 3I56A 1KL9A 2VQFL 1GKHA 5LMNL 1XJVA 3S1NH 5IYDG 2RCNA 1NJIC 4DV4Q 3F2BA 2CQOA 4YWLA 4A3MH 1XNQQ 1V9PA 3JAMi 2ZJQA 1N34Q 1PYSB 3CQZH 3GTKH 1PVOA 2V1CC 1N33Q 1K3RA 4AIMA 1BKBA 1FGUA 4DR5L 4YY3L 3HOWH 4A3CG 4LF6Q 2A8VA 1PA6A 2JEBI 4EX5A 4POFA 4ALPA 1DGSA 1VQLA 3I4MH 3WWVA 2UXCQ 4DR2Q 4JBWA 4BBRH 1PH6A 3STBC 2Q2TA 1XNRQ 1SR3A 2HHHQ 2UUCQ 4A3FH 4P75A 5EAYA 4C3JH 1YJNA 4GNXC 3GTQH 5IYCG 1ASZA 1VQNA 2DUDA 5FJ8G 3OTOQ 4JI2L 1LUZA 4BY1G 4LFCL 3U50C 3CC7A 4GNXA 1QVFA 4JOIC 2PNHA 1E24A 3K80C 2K4KA 4PZ6A 2E8GA 4KHPL 1I3QH 1OXVA 4JOIA 1HNZL 4NXMQ 3CXCA 2K14A 1VQIA 2GN5A 3HFZB 4B3ML 2Q2IA 4GOPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HKS A;  4A3L H;  1CSQ A;  2UU9 L;  3PF4 A;  2UXB L;  1FJG L;  1NBW A;  3KOJ A;  5JEA J;  1XTD A;  4GKJ L;  2N78 A;  1C7Y A;  4BBS H;  4JI6 Q;  2BH8 A;  2IHE A;  1G29 1;  1CKO A;  2KEN A;  3STB D;  2MNA A;  2LSS A;  3RZD H;  1HZC A;  1PH8 A;  2NVT H;  3FKI H;  1L1O A;  4IFD J;  5AJ3 Q;  4C3I H;  1X3G A;  3CMA A;  3S16 H;  1PH3 A;  1A8V A;  4QQB X;  1N36 L;  4TQU S;  5IP7 H;  3S1Q H;  1YBY A;  2C35 B;  2CWA A;  3CPW A;  2VQE L;  4GN4 B;  4DR3 L;  1B8A A;  2L15 A;  2VS1 A;  1NMG A;  4A3I G;  2UUB Q;  3I4O A;  3AFQ A;  3U4V A;  4DR6 Q;  3FP9 A;  3AFP A;  4UP8 A;  1J5E L;  2JQO A;  1VQO A;  4YCW A;  1EQR A;  5IP9 H;  2IHF A;  2NVQ H;  1JB7 A;  3MEF A;  3OYY A;  2AWO A;  4IO9 A;  2UXD L;  4X66 Q;  3T1H Q;  1N32 Q;  1ASY A;  3G48 A;  4QIW E;  1I94 Q;  3CF5 A;  5GAH C;  2BA1 A;  3HOY G;  4DR4 Q;  4HJA A;  4OWT B;  4DK3 C;  3CW2 C;  1Q1B A;  1VQE A;  1UWV A;  2MQH A;  1N9W A;  4AH6 A;  1EQQ A;  2E5L Q;  1IL2 A;  5IT9 c;  2DGY A;  5FLM G;  4JI5 Q;  1JJC B;  3CPF A;  4A3G G;  4DV0 Q;  4NB3 A;  5M3M H;  3RN5 A;  4LFA L;  4X64 Q;  1YJW A;  4X65 Q;  1VQ8 A;  4GKK Q;  3S24 A;  1VQM A;  4L5Q A;  1Q46 A;  1MIU A;  1U0L A;  3HOW G;  2EIF A;  1NTG A;  1X54 A;  1Q86 C;  1SLJ A;  1FVI A;  4L5T A;  2CKZ B;  2WB1 G;  4TVA B;  2N3S A;  5C3E G;  4HID A;  2AKW B;  1XMO Q;  1HNX L;  1VQ7 A;  2B63 H;  1JJ2 A;  4B3T Q;  4P71 A;  4BXX H;  2JA8 H;  4QY7 A;  3PUX A;  4JV5 Q;  4UP7 A;  1VQP A;  5IY0 A;  1QVG A;  2VNU D;  4LF8 Q;  4LF5 Q;  3G6E A;  4A3K G;  3MXN B;  4DR1 Q;  3TQY A;  3KJP A;  4HJ8 A;  4IJL A;  2CCZ A;  4IFD I;  2OCE A;  4IPG A;  4JI7 L;  4JYA Q;  1RIP A;  1VQ5 A;  4OWW B;  4GNX B;  1Y14 B;  2R92 G;  2KHJ A;  1Q82 C;  3KDF A;  2MO1 A;  5FLX c;  3UDG A;  4JI1 L;  1IBM L;  3PF5 A;  2UUA Q;  3F8T A;  3BU2 A;  4OON A;  1SRO A;  4DV2 Q;  3FHW A;  3CME A;  1KHI A;  3GTM H;  4DUZ Q;  2R93 H;  1VQK A;  4LF5 L;  4RG1 A;  4DV4 L;  1R9T H;  4DAM A;  1PFS A;  4C2M H;  3F2D A;  4PMW A;  1XNQ L;  2CWP A;  2D0O A;  1N34 L;  2F52 A;  1N33 L;  4IFD G;  1D8L A;  2HIX A;  3L2P A;  3S14 H;  3FKI G;  4LF6 L;  2JEA I;  3PO3 G;  1B70 B;  1BBU A;  3AEV A;  4OXP A;  3CCR A;  3F2C A;  1L1O B;  3PUW A;  3IRB A;  2K75 A;  1TXY A;  3E0E A;  1NY4 A;  4DUY Q;  4DR2 L;  2NVX H;  4BY7 H;  2UXC L;  1O7I A;  4X62 Q;  4JG2 A;  5BR8 Q;  1XNR L;  3NEL A;  2EXD A;  4GLV B;  2HHH L;  2UUC L;  3M4O H;  1WFQ A;  3ER0 A;  5HY6 A;  1XPU A;  3TEH B;  1Y1W H;  3W1B A;  1S40 A;  3H3V H;  4K0K L;  1HZA A;  3PO2 G;  1Q8K A;  1C9O A;  3OTO L;  1M1K C;  2Q2H A;  1N8R C;  1TWF H;  4GLX A;  2GVA A;  3EBE A;  1E22 A;  4YHH L;  5K36 G;  2JA5 H;  2E2I H;  1XPO A;  4WJ3 M;  5JJK A;  2WAQ E;  1WJJ A;  3I4N G;  3PUZ A;  2WP8 J;  2RHS B;  1S3O A;  1EYG A;  1EWI A;  3KYH C;  1HR0 Q;  4POG A;  1JT8 A;  5C4X H;  4DV7 Q;  2VL6 A;  1SRU A;  4DV1 Q;  4NXN Q;  1KRT A;  1L2F A;  4R4T A;  1HNW Q;  5J3B A;  1Y1V H;  2EQS A;  2LXK A;  4JC0 A;  1PH2 A;  2AMC B;  4BA1 I;  2Z6K C;  5E7N A;  3CCV A;  4P73 A;  1VQF A;  2AWN A;  1X3F A;  3JC6 6;  5AJ3 L;  1K8G A;  4AYB G;  4LF9 Q;  3PSI A;  5C44 G;  4A3D H;  3DM3 A;  3PUV A;  4A75 A;  3DLL A;  3CP0 A;  2WAQ G;  2HT1 A;  2I5H A;  4NPS A;  1HH2 P;  3KLW A;  4KLK A;  4JBM A;  2JA7 G;  2YTV A;  2OQK A;  2ATW A;  1NMF A;  3EIV A;  3GTP H;  2R7Z G;  3H0G H;  4LW1 A;  5C0X J;  3KJO A;  1IBL Q;  3M4P A;  5LMN Q;  1E7Z A;  4A3J H;  4B3S Q;  3NEN A;  3HOZ H;  4HIO A;  4AQY Q;  1UE7 A;  4DR6 L;  5JJL A;  4Y52 H;  3HOX H;  4A93 H;  2Q2U A;  4WJ4 A;  1X56 A;  4A76 A;  1X9N A;  1K73 C;  5HGQ A;  5GAD C;  4UY8 C;  5ELN A;  1XMQ Q;  1PHJ A;  4QJF A;  2NZH A;  4X66 L;  4J15 A;  4DV6 Q;  1N32 L;  2KCT A;  4A3B H;  3KDF B;  2JJQ A;  4DR4 L;  1I50 H;  1JMC A;  4JI0 Q;  3ZJY C;  4A3E G;  3H3V I;  1PYB A;  1OXT A;  3PIO A;  2E5L L;  1EOV A;  4JI5 L;  1J6Q A;  2IX0 A;  1WCM H;  1SFO H;  1NE3 A;  2IT1 A;  4DV0 L;  1HZ9 A;  4X64 L;  2N49 A;  4GKK L;  4JI3 L;  3UDX A;  1VQ4 A;  3J7A 5;  2VUM H;  4BBS G;  3G4S A;  1KC8 C;  2WB1 E;  1JE5 A;  3RZO H;  1KD1 C;  3PIP A;  2IX1 A;  1XMO L;  3E9H A;  4RMF A;  2ZM6 Q;  4BY7 G;  3TRZ A;  4DV3 L;  4B3T L;  5JJI A;  3A5Z B;  1P16 A;  5IYD H;  4JI8 L;  4X6A H;  4XIG S;  4JV5 L;  1S72 A;  2ZTD A;  4APV A;  1Y1W G;  3PUY A;  1L0W A;  4GKJ Q;  5IE8 A;  4A3M G;  2JE6 I;  2ALY B;  2GVB A;  4LUV A;  4DV5 Q;  4DR1 L;  2ZJP A;  1CKM A;  1EUJ A;  4JYA L;  4LWC A;  3ERS X;  1Q7Y C;  4A3C H;  3S17 H;  2KHI A;  3E9I A;  2ZJR A;  4PG3 A;  5GAE C;  4IPH A;  1SE8 A;  3TRE A;  2UUA L;  1YIT A;  4O0A A;  4YWM A;  2D0P A;  3I4M G;  4BA2 I;  4DV2 L;  2H5X A;  4UP9 A;  4Y7N H;  1XPR A;  2K5V A;  3RNU A;  4OO1 I;  4LF4 L;  3K7U C;  4BBR G;  4R1J A;  5C0X I;  3M7N A;  2YTX A;  1VQG A;  3CD6 A;  5C4X G;  2QGQ A;  1C0A A;  2XTI A;  4A3F G;  5IYB H;  5IYC H;  1IXR A;  3RR5 A;  1AH9 A;  1IZ6 A;  4ME3 A;  5FJ8 H;  3K8A A;  3M4Q A;  2YTY A;  4BY1 H;  3J81 c;  4L5S A;  5IWA Q;  1QVC A;  1YHB A;  2PI2 E;  1AE2 A;  2R7D A;  4GOP C;  3CC2 A;  4JCV E;  1GVP A;  2Z0S A;  2OQ0 A;  2PQA A;  4DUY L;  1E1T A;  1M90 C;  3S1R H;  1V1Q A;  3T1Y Q;  2OTJ A;  3ULL A;  1UEB A;  4LNQ A;  4X62 L;  2JA8 G;  2RF4 A;  3A5U A;  1PH5 A;  4JI4 Q;  3GTO H;  3H15 A;  4A3L G;  3A74 A;  4OO1 G;  1X55 A;  3GTL H;  1CKN A;  3RLF A;  3TS2 A;  5JEA G;  3J81 j;  3GTG H;  2E2J H;  2XGT A;  1IBK Q;  1QZG A;  1KXL A;  1G51 A;  1HJP A;  3M85 A;  4A3J G;  5M5X H;  3HOZ G;  2JA9 A;  3HOV H;  4DR7 Q;  1VQC A;  1OXX K;  1YJ9 A;  4OWX B;  2HIV A;  3GD7 A;  3J80 c;  3U58 A;  4L5R C;  4MTN A;  3CCJ A;  3PGZ A;  3K0X A;  1VS0 A;  3A0J A;  1HR0 L;  4DV7 L;  4O2D A;  2B29 A;  3KF6 A;  4NXN L;  5IP7 G;  4DV1 L;  1KRS A;  2K50 A;  2MO0 A;  3D31 A;  4A3I H;  3RLO A;  2F4V Q;  4EQ5 A;  1K0R A;  4HJ9 A;  2VZA A;  1VQ9 A;  3CCE A;  3VDY A;  1Q81 C;  3HOU H;  4AYB E;  4HJ5 A;  1W3S A;  3I2Z A;  2JA6 H;  2VW9 A;  4LF9 L;  4NXM L;  4HJ7 A;  4LUO A;  5IP9 G;  2I0Q A;  2I5M X;  3F1Z A;  2N8N A;  1AE3 A;  1Q1E A;  2PI2 A;  3CCL A;  1PH7 A;  4C3H H;  1IBL L;  1YEZ A;  5FLM H;  4B3S L;  1I6H H;  5M3F H;  1U5K A;  4AQY L;  3AQQ A;  4JI6 L;  4A3G H;  1HR0 W;  1TWG H;  3U4Z A;  3JAM c;  1SN8 A;  1YIJ A;  1PH1 A;  5C4J H;  4PZ7 A;  4B3R Q;  2Z6K A;  5M3M G;  5H1S E;  2LXJ A;  4JBK A;  1Q12 A;  3AYH B;  4LF7 Q;  4OX9 Q;  2YYZ A;  2CFM A;  5GRO A;  3SGI A;  3ULP A;  1XMQ L;  1YZ6 A;  4MZ9 A;  1KIX A;  1VQ6 A;  5C3E H;  1X6O A;  4DV6 L;  4LFB Q;  1VCI A;  1K9M C;  1VQD A;  2B63 G;  3NBH B;  1OXU A;  5LMU Q;  1CSP A;  1VQH A;  1QZH A;  2VQF Q;  3CCM A;  4JI0 L;  3S2D H;  4BXX G;  2UUB L;  1SMX A;  1K83 H;  4GS3 A;  4IJH A;  4K0K Q;  2PMZ E;  5IYB G;  4YCU A;  4XTC S;  2IY5 B;  1E1O A;  2ZTC A;  3K7A H;  4PZ8 A;  2R6G A;  4A3K H;  4YHH Q;  1LM0 A;  2MFI A;  5LMN W;  4R4I A;  4DK6 C;  2R92 H;  3BJU A;  4QL5 A;  4DR5 Q;  4YWK A;  4YY3 Q;  3T1H L;  1G6P A;  2K5H A;  2ZM6 L;  1I94 L;  1UE5 A;  3W1G A;  2PQA B;  1H95 A;  1T9H A;  3S1M H;  2R93 G;  1LYL A;  4GLA C;  4IOA A;  2KCM A;  3PCO B;  4LUZ A;  3UDF A;  1KQS A;  2A1A A;  1A63 A;  2D62 A;  3I55 A;  4YCV A;  1YHQ A;  1VQB A;  3I7F A;  2ID0 A;  1QUQ A;  3PV0 A;  1EFW A;  3KFU A;  1L1O C;  2AHO B;  4JI2 Q;  1EIF A;  1CKN B;  5GAG C;  4DV5 L;  2OTL A;  4X65 L;  1W2B A;  4LFC Q;  1E3P A;  3HOV G;  1X3E A;  1TWC H;  4R4C A;  3RN2 A;  3PO3 H;  4KHP Q;  3ULJ A;  4LF8 L;  3L7Z C;  1HNZ Q;  3OW2 A;  3M3Y H;  1YI2 A;  1MJC A;  2OWO A;  2NN6 I;  4DKA C;  4B3M Q;  1A0I A;  4IPC A;  1WYD A;  2A19 A;  5DLQ E;  3S2H H;  4DPG A;  1K8A C;  2UU9 Q;  3PO2 H;  1HZB A;  2UXB Q;  1FJG Q;  3KF6 B;  3HKZ E;  5IWA L;  2R7F A;  1VQJ A;  3KF8 B;  3UE0 A;  4KI0 A;  2JA5 G;  3HOU G;  2K52 A;  4UPA A;  4P72 A;  3UE1 A;  2ES2 A;  2JA6 G;  3I4N H;  2ASB A;  1TWA H;  3T1Y L;  3J7Z C;  1N36 Q;  1BBW A;  3CCU A;  2QA4 A;  4DUZ L;  1B7Y B;  1A62 A;  1LTL A;  2NN6 G;  4IOC A;  4HIM A;  1MJE A;  4JI4 L;  2VQE Q;  4R4O A;  2NVY H;  4DR3 Q;  1PH9 A;  2YU9 H;  2BH2 A;  2FXQ A;  2QEX A;  3B6Y A;  2K5N A;  1YVC A;  1Y1V G;  3L0O A;  2BA0 A;  1IBK L;  5M3F G;  1P8L A;  3NEM A;  3HKZ G;  1J5E Q;  4DR7 L;  1V43 A;  4FDB A;  3J81 i;  1YHA A;  1YNX A;  3Q8D A;  1D7Q A;  4DAY B;  5GQO A;  1GD7 A;  3GO5 A;  5ELO A;  4JI3 Q;  5C44 H;  4GOP A;  2HQL A;  3GTJ H;  2ZTE A;  3TS0 A;  4A3D G;  2UXD Q;  4GN3 B;  5BR8 L;  1TWH H;  2JA7 H;  3ICE A;  2F3I A;  2R7Z H;  3CCS A;  1BVS A;  1MKH A;  4DV3 Q;  5C0X G;  1IYJ B;  1OXS C;  1WI5 A;  3H0G G;  3G71 A;  4A4I A;  1RL2 A;  4JI8 Q;  5M5Y H;  1OTC A;  2I5L X;  2F4V L;  1Z47 A;  3BZK A;  4IPD A;  3LGJ A;  3RLN A;  3HOX G;  4A93 G;  2Y0S E;  2E2H H;  2NZO A;  4LFA Q;  1GM5 A;  4P74 A;  1EIY B;  1Z9F A;  2VY3 A;  1WOC A;  3K81 C;  3J80 i;  4HIK A;  3S15 H;  1UE6 A;  2KBN A;  4GN5 A;  4JBJ A;  1FL0 A;  3CAM A;  4DNI A;  2RHQ B;  5M5W H;  1PH4 A;  3UDI A;  1HNX Q;  2JK8 A;  4A3B G;  1HNW L;  4A3E H;  4LF4 Q;  3W5O A;  1X65 A;  1UE1 A;  1VQA A;  3GDE A;  4H02 A;  1WCM G;  4MNO A;  4QGU A;  1PV4 A;  3CC4 A;  2B3G A;  4B3R L;  3BZC A;  3M9B A;  1JJG A;  1I5F A;  1GO3 E;  1QUQ B;  2Y0S G;  3EN2 A;  2YV5 A;  4JI7 Q;  4LF7 L;  4OX9 L;  2VUM G;  3CCQ A;  4KHZ A;  4R4Q A;  4LFB L;  1KAW A;  3D0F A;  2WFW A;  4JI1 Q;  1IBM Q;  1CUK A;  5LMU L;  3HOY H;  3I56 A;  1KL9 A;  2VQF L;  1GKH A;  5LMN L;  1XJV A;  3S1N H;  5IYD G;  2RCN A;  1NJI C;  4DV4 Q;  3F2B A;  2CQO A;  4YWL A;  4A3M H;  1XNQ Q;  1V9P A;  3JAM i;  2ZJQ A;  1N34 Q;  1PYS B;  3CQZ H;  3GTK H;  1PVO A;  2V1C C;  1N33 Q;  1K3R A;  4AIM A;  1BKB A;  1FGU A;  4DR5 L;  4YY3 L;  3HOW H;  4A3C G;  4LF6 Q;  2A8V A;  1PA6 A;  2JEB I;  4EX5 A;  4POF A;  4ALP A;  1DGS A;  1VQL A;  3I4M H;  3WWV A;  2UXC Q;  4DR2 Q;  4JBW A;  4BBR H;  1PH6 A;  3STB C;  2Q2T A;  1XNR Q;  1SR3 A;  2HHH Q;  2UUC Q;  4A3F H;  4P75 A;  5EAY A;  4C3J H;  1YJN A;  4GNX C;  3GTQ H;  5IYC G;  1ASZ A;  1VQN A;  2DUD A;  5FJ8 G;  3OTO Q;  4JI2 L;  1LUZ A;  4BY1 G;  4LFC L;  3U50 C;  3CC7 A;  4GNX A;  1QVF A;  4JOI C;  2PNH A;  1E24 A;  3K80 C;  2K4K A;  4PZ6 A;  2E8G A;  4KHP L;  1I3Q H;  1OXV A;  4JOI A;  1HNZ L;  4NXM Q;  3CXC A;  2K14 A;  1VQI A;  2GN5 A;  3HFZ B;  4B3M L;  2Q2I A;  4GOP B; 
#chains in the Genus database with same CATH topology
 4CDE C;  3HKS A;  3OW7 A;  3L9A X;  5JEA H;  1D1I A;  1WD0 A;  1NBW A;  4QB4 A;  4GKJ L;  3HZX A;  1CA6 A;  3STB D;  1PH7 A;  1D2B A;  3SXH A;  1PH8 A;  3I4M B;  4TKO B;  1RD9 D;  3CMA A;  1PH3 A;  1A8V A;  4QQB X;  3I90 A;  1E2V A;  3MFG A;  1KNA A;  2C35 B;  2CWA A;  1F9Q A;  4DR3 L;  1B8A A;  1NMG A;  1DOL A;  4IQZ A;  4G4K A;  4K2L A;  4DR6 Q;  2DJG C;  3EFX D;  2EYM A;  3OSO A;  4LAA A;  2QKI C;  2UXD L;  3T1H Q;  3H0G B;  4K14 A;  1ASY A;  3A56 A;  4A3J B;  2MHV A;  3HOY G;  4OWT B;  3I73 A;  2NVT B;  2MQH A;  1IL2 A;  3Q22 A;  1JJC B;  1QOH A;  2CH4 W;  3CPF A;  5CV4 A;  5E4W C;  4DNR B;  3RN5 A;  5JPN C;  2F3V A;  1XYI A;  1FGB D;  4X65 Q;  1VQM A;  2EYO A;  1SSO A;  2CQA A;  4A3B B;  3K5L A;  3HOW G;  1C48 A;  1Q86 C;  1SLJ A;  5JJZ A;  1XMO Q;  1K0S A;  2QCP X;  1DOM A;  3TBI B;  2AKW B;  1NSN S;  2B2T A;  1ET9 A;  4ODG A;  4HAE A;  1VQP A;  2XRS D;  1QVG A;  1SXT A;  4M8A A;  3GP7 A;  2Q8T A;  3MXN B;  4RHS A;  3KJP A;  2CCZ A;  2IW3 A;  2OCE A;  2E74 C;  4JI7 L;  1Y8N B;  4H0L C;  1Y14 B;  1R4Q B;  5FLX c;  1IBM L;  3PF5 A;  4HR7 B;  1I4H A;  3VYS A;  4QUF A;  2CH4 A;  2L4N A;  4FVM A;  1TS2 A;  1O7Y A;  4RWS C;  4B9X A;  4PV1 C;  4DAM A;  4C2M H;  3NQT A;  3OIQ A;  1HTP A;  2CWP A;  3OOC A;  4K5X A;  2F52 A;  4IFD G;  3L2P A;  4LF6 L;  2JEA I;  1LT4 D;  2PNR C;  4O42 A;  3F2C A;  4IN3 A;  2UXC L;  2BE5 C;  2F0N A;  5IGD A;  4X62 Q;  1XNR L;  3ER0 A;  5HY6 A;  1PRT B;  3W1B A;  1HZA A;  1Q8K A;  1M1K C;  1PZK D;  4YHH L;  5K36 G;  2JA5 H;  2VB2 X;  1CQV A;  1XPO A;  2WAQ E;  4F88 A;  1WJJ A;  2E2D C;  2ENB A;  2WP8 J;  2KVM A;  1A6X A;  2NTT A;  5C4X H;  5J3B A;  2F4I A;  3J81 L;  1WTQ A;  2WAC A;  1PH2 A;  2Z6K C;  4P73 A;  4G7H C;  4XT3 B;  1LTG D;  3JC6 6;  5AJ3 L;  1K8G A;  1VF7 A;  5J39 A;  3PSI A;  4A3D H;  3M4O B;  3DLL A;  2WAQ G;  4RKL A;  3D3R A;  1HH2 P;  3KLW A;  4QMG A;  1EY6 A;  1SNM A;  3KJO A;  2IL8 A;  4K5V A;  1I4R A;  1X3P A;  2KCN A;  1E7Z A;  1XTC D;  3BDL A;  4FF4 A;  3HOZ H;  4Y52 H;  3HOX H;  4WJ4 A;  2RDF A;  1X56 A;  3T53 B;  5HGQ A;  1SBB B;  4UY8 C;  3SK4 A;  1XMQ Q;  2NZH A;  4J15 A;  3BVZ A;  1N32 L;  4KJN A;  5ISR A;  1TWG B;  1V1P B;  4H13 C;  5C4J B;  4JI5 L;  2IX0 A;  1SFO H;  2IPK D;  2IT1 A;  1TU2 B;  3EA6 A;  3J7A 5;  2VUM H;  3V96 A;  2F0I A;  3HS0 C;  3G4S A;  1RCV D;  1JE5 A;  5JJI A;  4R8N A;  1P16 A;  4A93 B;  3K7A B;  2PQE A;  2MP1 A;  4JV5 L;  1S72 A;  2ZTD A;  1F77 A;  2GVB A;  1TR5 A;  2OXP A;  4LWC A;  2DJF C;  5I6W A;  4PG3 A;  1SE8 A;  2UUA L;  4DV2 L;  1XPR A;  4OO1 I;  4BBR G;  1WCM B;  2YTX A;  3CD6 A;  5C4X G;  2QGQ A;  4ILW A;  5IYC H;  2EY1 A;  3RR5 A;  4ME3 A;  3K8A A;  2Z4I A;  3PO3 B;  1LT6 D;  1YHB A;  1AE2 A;  2K05 A;  1B3A A;  1UAP A;  2L5T A;  3OIP A;  1ZKO A;  4LMQ D;  3ULL A;  4TRD A;  1O78 A;  3TP7 A;  4A3L G;  1GUT A;  1QB5 D;  5I9O A;  5FOB B;  3J81 j;  5JPM C;  1HJP A;  4PMB A;  3HOZ G;  3I4N B;  2JA9 A;  3HOV H;  1EWC A;  3KLS A;  1YJ9 A;  4FXK C;  2C5C A;  1SEB D;  4MTN A;  3CCJ A;  1IW7 C;  3I70 A;  4DV7 L;  4O2D A;  5IP7 G;  4DV1 L;  2K50 A;  3URY A;  3KF8 A;  2NTS A;  2NBF A;  4HJ9 A;  3D4D A;  3DXJ C;  3E6Z X;  3CCE A;  3S1R B;  4RKB A;  4NXM L;  3F1Z A;  3IL8 A;  4UHV A;  1HHV A;  3C3L A;  2JP1 A;  3GTG B;  1FYC A;  3R2T A;  2XWB B;  4C3H H;  3A55 A;  2FIN B;  3I8Z A;  2F0E A;  1YIJ A;  3DHQ A;  1EIG A;  4NW2 A;  4HCS A;  1LTT D;  2Z6K A;  1Q12 A;  2F0U A;  5GRO A;  3SGI A;  3ULP A;  1KIX A;  4DV6 L;  1VCI A;  2EYL A;  2PO4 A;  1K9M C;  1BCP D;  2B63 G;  3NBH B;  2Q8R E;  1QZH A;  2ICI A;  2VQF Q;  4JI0 L;  4IJH A;  2F0M A;  3Q23 A;  1DJR D;  2XWJ B;  2I07 B;  4XTC S;  2ZTC A;  2R6G A;  1STG A;  3I4L A;  3VYT A;  5M9O A;  2MFI A;  1JOK A;  5LMN W;  4IAL A;  4N9P A;  3HOY B;  4WOR A;  3S9W A;  3T1H L;  4RGM A;  2K5H A;  4ID6 A;  2PQA B;  1H95 A;  3S1M H;  2R93 G;  1LYL A;  5C5L A;  4LUZ A;  2A1A A;  4JVZ A;  2D62 A;  3I55 A;  1YHQ A;  1VQB A;  2F0F A;  3CQZ B;  3KFU A;  2AHO B;  4JI2 Q;  4DV5 L;  2OTL A;  1CKN B;  5EBC A;  1PTO D;  3HOW B;  4X65 L;  1E3P A;  1Y8O B;  3HOV G;  1X3E A;  4L63 B;  3T56 B;  4DK1 A;  4B3M Q;  2RVL A;  4C3J B;  3R2I A;  3TN2 A;  1G91 A;  2K01 A;  2O2L D;  3PO2 H;  1HZB A;  1TS5 A;  2A6E C;  1HFN A;  3FPU B;  4G57 A;  3IKJ A;  2N55 A;  2R7F A;  1I3Q B;  5IGF A;  1EL0 A;  1L0X B;  3VA5 A;  3BYY B;  1VMC A;  2K52 A;  2B2V A;  4ZAI A;  2ASB A;  3T1Y L;  2G5D A;  1BBW A;  2K28 A;  3CCU A;  5C6A A;  1JR0 D;  2NN6 G;  4JI4 L;  4HIM A;  2EYP A;  3MWY W;  4DR3 Q;  2YU9 H;  4C3H G;  1Y1V G;  3OMG A;  3P75 A;  1P8L A;  1E2Z A;  1YHA A;  3Q8D A;  4DAY B;  5GQO A;  3GO5 A;  5C44 H;  3QO2 A;  2UXD Q;  4BWG B;  2JA7 H;  4X3U A;  3ICE A;  2F3I A;  2B2W C;  3BYT B;  1MGS A;  4B9W A;  5KYI A;  1BVS A;  1MKH A;  1V1O A;  4DV3 Q;  1OXS C;  1WI5 A;  3H0G G;  1GJX A;  4X3K A;  1U4P A;  4JI8 Q;  2I5L X;  2AUJ D;  3NTK A;  4KKU A;  2F0L A;  4IPD A;  3LGJ A;  2FHT A;  1STY A;  3NWS A;  4P74 A;  1Z9F A;  4H44 C;  5JOB A;  1SMY C;  1YNN C;  3S15 H;  4GN5 A;  1AFP A;  2WKC A;  3CAM A;  1PH4 A;  2G9D A;  3DUZ A;  4A3B G;  2K04 A;  3VA7 A;  1BQQ T;  2I46 A;  1EY9 A;  2KA7 A;  5A2Q E;  3FVQ A;  4H02 A;  4B3R L;  3K57 A;  2B3G A;  4JPB W;  4OX9 L;  4JI7 Q;  3EN2 A;  5J22 A;  4LFB L;  1IBM Q;  3QR8 A;  1TKW B;  1BF4 A;  5IYD G;  2KCC A;  2E2H B;  3V2T A;  3WOE A;  2CQO A;  4YWL A;  4XQQ A;  5I9P A;  2PCF B;  2ZJQ A;  2AQ1 B;  2HDM A;  1MSH A;  4A3C G;  4YY3 L;  4LF6 Q;  5BN4 A;  2JEB I;  3DWA A;  3HGB A;  4QUC A;  4IUV A;  3WWV A;  2F3W A;  2UXC Q;  1SYD A;  3DWP A;  1PH6 A;  2Q2T A;  1XNR Q;  2PMZ B;  4A3F H;  2H4O A;  4CJ0 B;  4GNX C;  3Q0A A;  3GTQ H;  1VQN A;  2DUD A;  2BE5 D;  4LFC L;  1D5M C;  3CC7 A;  4QF4 A;  3K80 C;  1Y8P B;  4PZ6 A;  4IUQ A;  1EEI D;  1TVX A;  1VQI A;  2JA8 H;  2K7V A;  4F87 A;  2LY7 A;  2UU9 L;  3PF4 A;  1FJG L;  2PZU A;  1XTD A;  2N78 A;  1EY7 A;  1GUG A;  1C7Y A;  1HRJ A;  2BH8 A;  2IHE A;  1G29 1;  5CGK A;  2MNA A;  2LSS A;  4FYD A;  3FKI H;  5AJ3 Q;  1LTA D;  4BBR B;  5C4X B;  4YIJ A;  3UI2 A;  4XDX A;  4TQU S;  1RKN A;  1YBY A;  2HQE A;  3CPW A;  3HKZ B;  3J80 E;  3TP6 A;  2VS1 A;  3DWQ A;  2UUB Q;  2MUY A;  4C56 C;  1STE A;  2JQO A;  1PFM A;  1VQO A;  4A3D B;  4YCW A;  5EPJ A;  5IOD A;  1LO5 D;  1EQR A;  2F0G A;  5IP9 H;  2IHF A;  2Z4H A;  1JB7 A;  1DM0 B;  2N88 A;  1N32 Q;  3DEP A;  3G48 A;  1I94 Q;  5GAH C;  3HOZ B;  2V4D A;  4HJA A;  3HOX B;  1Q1B A;  2DGY A;  5FLM G;  4OHJ A;  4JI5 Q;  3S16 B;  1MI2 A;  2X6L A;  4LFA L;  4NKL A;  5NUC A;  4BS9 A;  2EIF A;  1FVI A;  2B2T C;  2WB1 G;  2N3S A;  1PFN A;  4BXX H;  1SFO B;  5CYU A;  3PUX A;  4JV5 Q;  4I65 A;  2Y0S B;  5IY0 A;  2VUM B;  2VNU D;  2NVQ B;  2X69 A;  2CW0 C;  3G6E A;  4IFD I;  3TQY A;  1PTO B;  1VQ5 A;  2R92 G;  1Q82 C;  2B2Y A;  3H91 A;  3KDF A;  5KGU A;  3VYU A;  3PIO 3;  3UDG A;  2UUA Q;  4OON A;  5C5M A;  4DV2 Q;  3CME A;  3ND9 A;  1SE2 A;  5LL6 X;  1VF5 C;  4DUZ Q;  4ZQ3 A;  4RFB A;  2RDH A;  2D0O A;  1N34 L;  2K5Q A;  1N33 L;  3S14 H;  4DU9 A;  3FKI G;  4KV6 A;  3PO3 G;  1B70 B;  3C1F A;  1HCZ A;  3AEV A;  1L1O B;  2K75 A;  1H9S A;  3NTI A;  4RGN A;  1HFG A;  1WFQ A;  2K32 A;  4CDD C;  1EY0 A;  5CV9 A;  1EEF D;  1C9O A;  4DGZ A;  3OTO L;  1I4G A;  1TWF H;  4GLX A;  1E22 A;  2TMP A;  1K8O A;  2EY5 A;  2E2I H;  2HD3 A;  3I4N G;  3F2U A;  3PUZ A;  1EYG A;  1E0B A;  3KYH C;  5BN3 A;  4DV7 Q;  2Z1C A;  4DV1 Q;  1KRT A;  3E3X A;  1ICF B;  4FF3 A;  1TY2 A;  3HOV B;  1JB3 A;  1BXT A;  1IW7 D;  4JC0 A;  2AMC B;  5DM7 3;  3CCV A;  2NVX B;  3FMC A;  2EZV A;  5IT9 E;  1BNZ A;  1SNC A;  5C0X H;  3GTP H;  3MVV A;  1Y69 U;  2EPB A;  3M4P A;  5LMN Q;  1Q3L A;  5JJL A;  4HIO A;  1UE7 A;  1XWE A;  2Q2U A;  4XQJ A;  4A76 A;  3W3A A;  3OMC A;  3LWE A;  5ELN A;  2M9V A;  1PHJ A;  3J7Y W;  4C3H B;  4DV6 Q;  1Y1V B;  4DR4 L;  1I50 H;  4JI0 Q;  4A3E G;  4DN4 M;  1PYB A;  3H09 A;  1J6Q A;  4HMI A;  4OGQ C;  3TP8 A;  1NE3 A;  1HZ9 A;  2EDG A;  4X64 L;  2N49 A;  3UDX A;  1AW7 A;  4KD4 A;  1T5X D;  1GOZ A;  1Q90 A;  3PIP A;  2IX1 A;  4HTH A;  2MGS A;  3E9H A;  1PRT F;  2HDL A;  3K5O A;  1ESR A;  1RTN A;  1V8Q A;  3TRZ A;  4OEL B;  4DV3 L;  4L8J A;  4JI8 L;  4X6A H;  1TT2 A;  2EVB A;  1EU4 A;  2B8G A;  3PUY A;  1GUS A;  4LF5 L;  4DV5 Q;  1BR9 A;  1EUJ A;  2EJF C;  1KDC A;  4CGY B;  3S17 H;  2EOT A;  4IPH A;  2L11 A;  5D3D A;  4O0A A;  4BA2 I;  5ELF A;  2H5X A;  3AU7 A;  4Y7N H;  1HA6 A;  3RNU A;  1WTV A;  3SK5 A;  3CKI B;  1LAB A;  3LWU A;  5IYB H;  4ZCK A;  4C3J G;  2K03 A;  2RSO A;  3M4Q A;  4BY1 H;  5L37 A;  3E5S A;  1IHZ A;  2A6E D;  2OQ0 A;  3FEW X;  5KEE A;  4OIJ A;  1MHW C;  4F8M A;  5KIX A;  1M90 C;  1MBY A;  3T1Y Q;  1UEB A;  3PO2 B;  3A5U A;  5IOC A;  1PH5 A;  4JI4 Q;  2A5H A;  3A74 A;  1KAB A;  1DZ1 A;  3GTL H;  2EYH A;  5JEA G;  2QDB A;  2XGT A;  1HXY D;  3PIP 3;  5M5X H;  1STA A;  4OWX B;  2HIV A;  3ND8 A;  3R8B A;  3GD7 A;  3J80 c;  3U58 A;  4L5R C;  3T16 A;  3PGZ A;  1L0Y B;  5A35 A;  3A0J A;  1C8C A;  1SYG A;  5KNC A;  3G7L A;  4A3I H;  3RLO A;  3K0Y A;  1H9M A;  1OO9 B;  4HSV A;  2PW7 A;  5C44 B;  4RAU C;  1Q81 C;  3HOU H;  1W3S A;  5KYL A;  2JA6 H;  3NE5 B;  2JA7 B;  1CZG A;  2I5M X;  2I0Q A;  2NZ1 D;  1CTM A;  1ZYR D;  3QOL A;  1KAA A;  1U4L A;  3WDN A;  2JN4 A;  5KND A;  1R4P B;  1ICW A;  1YEZ A;  2RCF A;  1B53 A;  4NDX A;  1SMY D;  3SK8 A;  4AQY L;  4A3G H;  4KD3 A;  3N6R A;  3JAM c;  1ET6 A;  4PZ7 A;  4B3R Q;  3M4Y A;  4UDU C;  3D4R A;  2NUC A;  5H1S E;  4JBK A;  3AYH B;  3S15 B;  4X3S A;  4OX9 Q;  5C3E H;  4LFB Q;  1VQH A;  3CCM A;  3ZYY X;  3S2D H;  1JCK B;  2UUB L;  2H1E A;  1K83 H;  4K0K Q;  2XN9 C;  2PMZ E;  5IYB G;  1TII D;  2A69 C;  4A3K H;  4PZ8 A;  1MSG A;  4QCL A;  1JOQ A;  1QWY A;  4DK6 C;  1JQY D;  4YWK A;  4YY3 Q;  4IUU A;  1G6P A;  1I94 L;  1UE5 A;  3W1G A;  1T9H A;  4GLA C;  4IOA A;  2KCM A;  3PCO B;  1KQS A;  3BDC A;  3ERO A;  4YCV A;  3D6C A;  1QUQ A;  1EFW A;  4CKC A;  4LFC Q;  5I4D A;  2WB1 B;  4P2C B;  4R4C A;  1RDP D;  3OW2 A;  1YI2 A;  2OWO A;  4HED A;  4A3F B;  2NN6 I;  4DKA C;  4FXD A;  4MTK A;  3GTQ B;  2KQ3 A;  4RCN A;  4KN4 C;  4EQN A;  5DLQ E;  4DPG A;  2UU9 Q;  2KJX A;  1FJG Q;  3KF6 B;  3HKZ E;  2R92 B;  5IWA L;  2A68 D;  2B2V C;  3UE0 A;  1H9J A;  2CVR A;  2PZW A;  2JA5 G;  3HOU G;  1X32 A;  2A6H D;  2JA8 B;  4UPA A;  4P72 A;  2JA6 G;  1TWA H;  4KY6 A;  3CHB D;  3OWE B;  1XXG A;  3EQL C;  1PZI D;  4WJW A;  1B7Y B;  4DUZ L;  4IOC A;  2NVY H;  4DAV A;  1GUN A;  2QEX A;  2K5N A;  1IBK L;  3FKI B;  2BA0 A;  4UAI A;  3FPP A;  4ABN A;  3NXW A;  3HKZ G;  3H3V C;  4DR7 L;  1V43 A;  4U67 3;  1D7Q A;  4K8I A;  5ELO A;  4JI3 Q;  2F0S A;  2HQL A;  2ZTE A;  1F2L A;  4A3D G;  1HQM C;  1EOT A;  2X6G A;  1TS4 A;  1TWH H;  2XIW A;  2EY6 A;  4ZUI A;  3H6M A;  3I91 A;  3CCS A;  2R7Z H;  3GV6 A;  3CRK C;  1JWS D;  2EYJ A;  4KHV A;  4K2K A;  1RL2 A;  4A4I A;  4XT1 B;  2DNC A;  3MZ5 A;  1KNE A;  1Z47 A;  2R3Z A;  3HOX G;  2Y0S E;  1LT3 D;  2NZO A;  4FO2 A;  4LFA Q;  1QNK A;  1NCV A;  5CV8 A;  2Q8I B;  1EIY B;  4FXG C;  1F9P A;  4FP5 D;  1FNV A;  3J80 i;  1EYC A;  4HIK A;  1ILQ A;  1TS3 A;  4OEM B;  4DNI A;  1FL0 A;  2RHQ B;  2EJG C;  3A8K E;  4LF4 Q;  3J7A F;  1UEA B;  3C46 A;  3GDE A;  1D6E C;  2EJM A;  4MNO A;  3CC4 A;  2Y0S G;  4LF7 L;  4BBS H;  2VUM G;  1SDF A;  4CJ1 B;  1TQO A;  3CCQ A;  4KHZ A;  1KAW A;  2CW0 D;  5M5Y B;  5LMU L;  3I56 A;  1KL9 A;  3SK6 A;  1GKH A;  5LMN L;  5LHY 1;  2RCN A;  1ENF A;  2BDN A;  4A3M H;  1PLF A;  2ZXR A;  1F9R A;  5D3I B;  3JAM i;  1ROD A;  2XSC A;  1PYS B;  4K6D A;  1N34 Q;  3GTK H;  2VXW A;  1N33 Q;  4AIM A;  1BKB A;  1FGU A;  1IYV A;  3KK7 A;  4A3E B;  3I4M H;  2QIL A;  1G2S A;  4JBW A;  4EQO A;  3STB C;  1ENC A;  5EAY A;  3MXN A;  1SAP A;  5IYC G;  2DNE A;  4KN7 C;  4CDF C;  3S14 B;  3OTO Q;  1LUZ A;  3U50 C;  3W2D A;  1QVF A;  1II3 A;  2DY8 A;  3ERQ A;  5EPK A;  2K4K A;  2F03 A;  2E8G A;  5FLX L;  4KHP L;  1HNZ L;  3MC0 B;  3J81 E;  3CXC A;  1BBX C;  4C1N I;  4GOP B;  1CSQ A;  1MD2 D;  2SEB D;  4OO1 H;  1STH A;  2L12 A;  3HP3 A;  1TWF B;  2OF1 A;  2UXB L;  3KOJ A;  5JEA J;  1DYQ A;  4JI6 Q;  2KEN A;  1CKO A;  4KJO A;  2NVT H;  1HZC A;  2QF7 A;  4IFD J;  4K8J A;  2PW5 A;  3MXG A;  1A3U A;  1X3G A;  2SNS A;  3HG9 A;  2XNA C;  1CZW A;  2EY2 A;  3S1Q H;  3D8G A;  4GN4 B;  2AQ2 B;  5CV5 A;  2L15 A;  3CRL C;  2NB0 A;  4OIK A;  3I4O A;  1EYA A;  3U4V A;  5G3L D;  3QJY A;  4MIU A;  4V0B A;  4KMU C;  5E4X A;  2AWO A;  5IGE A;  3OWF A;  3D6W A;  4QIW E;  5IGB A;  3CF5 A;  3I72 A;  2BA1 A;  4DR4 Q;  5C4H A;  1EQQ A;  1VQE A;  1UWV A;  2ATW A;  1LTR D;  2K5W A;  2C9O A;  1Z6H A;  4NB3 A;  4S3S A;  5M3M H;  4X64 Q;  2B8F A;  1YJW A;  5FK9 C;  5BN5 A;  5FO7 B;  1JWU D;  2PYK A;  1MIU A;  3E0J A;  4HN7 A;  1JOR A;  4J6H A;  1I50 B;  4TVA B;  4L5T A;  2CKZ B;  2K33 A;  4HID A;  1EQT A;  4P71 A;  3SHL A;  1AEX A;  3WOF A;  1B50 A;  1EIH A;  4I7A A;  4UP7 A;  5JAV A;  5K5P A;  1LTB D;  4Q5V A;  4LF5 Q;  4HJ8 A;  4IJL A;  1DXM A;  2B2Y C;  4IPG A;  1B2T A;  4OWW B;  4L6T B;  2A74 C;  4GNX B;  3BVG A;  2KHJ A;  2EYF A;  3MFY A;  4U68 A;  4JI1 L;  1S4Z A;  1SRO A;  1V1P A;  3FHW A;  5EJW A;  5I2Y A;  3GTM H;  3D4W A;  1VQK A;  2MJ8 A;  5COR A;  4CKB A;  1D1K A;  3MXP A;  3TME A;  2QEJ C;  3S17 B;  4PMW A;  2DY7 A;  3TZD A;  1D8L A;  1SNQ A;  1I4X A;  4R9W A;  4Y7N B;  3KBG A;  4HMJ A;  4OXP A;  3CCR A;  3IRB A;  1TXY A;  3E0E A;  1O7I A;  1O7Z A;  3VR5 A;  4GLV B;  3M4O H;  4CJ2 C;  1RJT A;  3H3V H;  3TEH B;  1Y1W H;  4K0K L;  4RGT A;  5KNB A;  3PO2 G;  2B2U A;  3T4A C;  5ELC A;  3EBE A;  3OPO A;  4I7Z C;  2MPM A;  1B9N A;  3TSS A;  2BCO A;  2TSS A;  2A73 B;  4ZKB B;  1UUP A;  4DXF A;  1BCP F;  4PMC A;  4WJ3 M;  5JJK A;  2LFN A;  2D5D A;  2HUG A;  3P1H A;  2RHS B;  1FD7 D;  1EWI A;  3GTL B;  4C2M B;  1SRU A;  4R4T A;  1CA5 A;  2NYZ D;  1ESF A;  3NPP A;  3C1E A;  4BA1 I;  4CHT B;  1VQF A;  2AWN A;  4FF2 A;  1X3F A;  4AYB G;  5C44 G;  1AN8 A;  3DM3 A;  3PUV A;  4A75 A;  3CP0 A;  2HT1 A;  4A3I B;  4NPS A;  2JA7 G;  3K59 A;  1PZJ D;  2OQK A;  3EIV A;  5C4Z A;  2D2C C;  2B39 A;  1SNP A;  2JA5 B;  1PTO F;  3HOU B;  4AQY Q;  1F2Y A;  2JA6 B;  4A93 H;  3NBI A;  2AUK A;  2RDG A;  1X9N A;  3X3M A;  1K73 C;  3LNN A;  5HUR A;  4X66 L;  4ZYS A;  2KCT A;  1PXU A;  2JJQ A;  5EKI A;  4A3G B;  3PIO A;  1OXT A;  5JVH 3;  2E5L L;  1U9R A;  1EOV A;  1WCM H;  1GHK A;  4DV0 L;  1H9R A;  1TY0 A;  4GKK L;  4JI3 L;  2Z6B A;  1BDO A;  1S5E D;  3AB9 A;  3J7A V;  3P7J A;  2WB1 E;  3RZO H;  2A69 D;  1KD1 C;  4ME5 A;  1HUM A;  4RMF A;  1K83 B;  4B3T L;  2O5I C;  3A5Z B;  3X3N A;  4A3K B;  4XIG S;  1Y1W G;  1L0W A;  5IE8 A;  4LF8 L;  2JE6 I;  2ALY B;  4LUV A;  4DR1 L;  2ZJP A;  4JYA L;  2KHI A;  3E9I A;  5GAE C;  2FFK B;  3NBH A;  3TRE A;  1LT5 D;  4YWM A;  2D0P A;  5CV6 A;  2K5V A;  4N8F A;  1M8A A;  4DFA A;  3K7U C;  3PMF A;  4R1J A;  4LF4 L;  5C0X I;  3M7N A;  1VQG A;  2L9H A;  4EGV A;  4A3F G;  4FF1 A;  1AH9 A;  5FJ8 H;  2YTY A;  3J81 c;  1DD2 A;  5IWA Q;  1NR4 A;  2PI2 E;  2R7D A;  4JCV E;  2Z0S A;  1ZEQ X;  2PQA A;  4DUY L;  1E1T A;  1H9K A;  2KEE A;  3S1R H;  1V1Q A;  2OTJ A;  1O80 A;  2JA8 G;  2ZT9 C;  3GTO H;  4NP5 A;  1X55 A;  3TS2 A;  1CKN A;  3RLF A;  2G9H D;  3GTG H;  3NSW A;  1IBK Q;  2E2J H;  1KXL A;  1G51 A;  2F0P A;  4DR7 Q;  4G7O C;  1YNJ C;  1EY5 A;  1TWA B;  1OXX K;  1STB A;  5DEH A;  1W6J A;  3K0X A;  2NVY B;  1HR0 L;  2B29 A;  4NXN L;  3A7A B;  5CR3 A;  1KRS A;  1JE4 A;  3D31 A;  1KLU D;  5FO8 B;  2RSN A;  1KLG D;  5DM6 3;  2VZA A;  3NK9 A;  3TP5 A;  1VQ9 A;  4HJ5 A;  1BCP C;  1I4P A;  4KY5 A;  4LF9 L;  5IP9 G;  2R7Z B;  2ZXO A;  1AZP A;  3KBX A;  1AE3 A;  1Q1E A;  3DM1 A;  4Z9C B;  3CCL A;  4EVO A;  1IBL L;  4B3S L;  1BOS A;  5M3F H;  1CM9 A;  3V05 A;  1S5D D;  4DAY A;  4JI6 L;  1HR0 W;  1I6H H;  1FNW A;  4EQP A;  2LXJ A;  4LF7 Q;  2YYZ A;  1YZ6 A;  4MZ9 A;  2CHB D;  2EXZ A;  5COY A;  1OXU A;  5LMU Q;  1CSP A;  1M4V A;  4BXX G;  1HPC A;  1PYW D;  4GS3 A;  2IY5 B;  1E1O A;  4RGO S;  4R4I A;  3BJU A;  4QL5 A;  1SYF A;  1DCZ A;  3VR2 A;  1GUO A;  1HQR D;  2JXM B;  2SNM A;  2ZM6 L;  2KEC A;  1DOK A;  3BS1 A;  3OHX C;  4A3M B;  1SYE A;  5D14 A;  3I7F A;  1FR3 A;  2ID0 A;  3DEO A;  3PV0 A;  3GTK B;  1L1O C;  5T1G A;  1EIF A;  2L0C A;  1SYC A;  1W2B A;  4IFD H;  1WTO A;  4IUT A;  1TWC H;  5IIF A;  4KHP Q;  5EBD A;  4QIW B;  1HNZ Q;  3M3Y H;  1HTL D;  1MJC A;  1A2U A;  3MAQ A;  3C2P A;  4IPC A;  1QIL A;  3TDQ A;  3S2H H;  2UXB Q;  1HA5 A;  3NWT A;  5J1Z A;  3U9S A;  3SE0 A;  3A7L A;  1CT1 D;  5K36 H;  3KF8 B;  4KI0 A;  1NAP A;  3VYR A;  1A3T A;  3UE1 A;  3VR3 A;  2LS0 1;  5KRU A;  2ES2 A;  3S1M B;  2E76 C;  2QA4 A;  1A62 A;  1LTL A;  3FRP B;  3KLS X;  5E1F A;  5T1I A;  4R4O A;  1PH9 A;  3A54 A;  5M3F G;  3NEM A;  4XYO A;  3J81 i;  4CKE A;  1GD7 A;  1ML0 D;  3GTJ H;  3S1Q B;  4PNY A;  1F2Z A;  1JIC A;  4E6I A;  5C0X G;  2F4V L;  2XVS A;  1PDQ A;  2KOL A;  3SVM A;  4HSP A;  4ZLT F;  3SDZ A;  1G6Z A;  1PMR A;  3BZK A;  1CHP D;  1FNU A;  2E2H H;  1GM5 A;  2VY3 A;  1JWM D;  2FMM A;  3K81 C;  1WTP A;  2YU9 B;  4XYQ A;  1WTR A;  1UE6 A;  2KBN A;  5M5W H;  1CFM A;  2JK8 A;  3EJI A;  1D5X C;  2Z9H A;  2ZXP A;  5M3M B;  4FNF A;  1ONL A;  4AYB B;  1I6V C;  1A15 A;  1KDA A;  4GZY C;  4QGU A;  1PV4 A;  1G8Z D;  1JJG A;  1I5F A;  1GO3 E;  2F0O A;  2YV5 A;  4R8I A;  2WFW A;  4JI1 Q;  1K3B C;  1XX8 A;  2OT2 A;  1F9S A;  3S1N H;  1NJI C;  1YNN D;  2SDF A;  4TSS A;  3KUP A;  1STN A;  2K6A A;  1E2W A;  1EFI D;  1K3R A;  4DR5 L;  1B4O A;  3GTM B;  2A8V A;  4ALP A;  1A2T A;  1IKL A;  1S5F D;  1CQF A;  4BBR H;  4P75 A;  2KUM A;  4BY1 G;  3BZD B;  4JK1 C;  4JOI A;  4IUR A;  1GUW A;  5TSS A;  1EZ6 A;  5I6Y A;  3HFZ B;  2WIN B;  1Y1W B;  2LKV A;  4A3L H;  3CU7 A;  3RZD H;  1L1O A;  4C3I H;  1PRT C;  3S16 H;  1LAC A;  1N36 L;  1ILP A;  4KK7 A;  5IP7 H;  1EYD A;  1BO0 A;  3GV3 A;  2VQE L;  3QIA A;  2J7Z A;  1A3V A;  4A3I G;  2F0D A;  2GA4 B;  3AFQ A;  3FP9 A;  1SND A;  3AFP A;  4UP8 A;  4PQX A;  2M00 A;  1J5E L;  2F1M A;  1RF2 D;  2NVQ H;  3IFT A;  3MEF A;  3OYY A;  1ENA A;  4IO9 A;  1PTO H;  1I4Q A;  4X66 Q;  2BOS A;  1CI3 M;  5EPL A;  1KTK A;  4DK3 C;  3CW2 C;  4K5W A;  4AH6 A;  2E5L Q;  1N9W A;  5IT9 c;  3K6O A;  4A3G G;  1LLR D;  4MHE A;  4DV0 Q;  4GKK Q;  1VQ8 A;  3S24 A;  4L5Q A;  1J8I A;  1Q46 A;  1U4R A;  1U0L A;  5IGC A;  1NTG A;  1X54 A;  5C3E G;  2B63 H;  3GQB A;  1HNX L;  1VQ7 A;  5F2D A;  1JJ2 A;  4ZRZ A;  4B3T Q;  4QY7 A;  3QOJ A;  4LF8 Q;  4A3K G;  5AFW A;  4DR1 Q;  3RZO B;  3K5M A;  1NUC A;  2VB3 X;  4JYA Q;  4RA8 A;  1RIP A;  3L3O C;  2WII B;  4CDC C;  5A2Q L;  1K28 A;  3P20 A;  2MO1 A;  3KLR A;  3F8T A;  3BU2 A;  3G6J B;  5CBA E;  2R61 A;  1KHI A;  2R93 H;  5ELE A;  4RG1 A;  1QE6 A;  4DV4 L;  2J0T D;  1R9T H;  1JC7 A;  1WTX A;  1KDB A;  1PFS A;  4IUN A;  3F2D A;  1XNQ L;  3T51 B;  2HIX A;  3RD4 A;  4C3I G;  1BBU A;  3N52 A;  1B44 D;  4DUY Q;  1A63 A;  3PUW A;  2NVX H;  4BY7 H;  4DR2 L;  1NY4 A;  1DON A;  2LMC B;  4JG2 A;  5BR8 Q;  5CMD A;  3NEL A;  2EXD A;  2HHH L;  2UUC L;  5LL6 S;  2B2U C;  1XPU A;  1S40 A;  3H94 A;  2F0K A;  2Q2H A;  2SOB A;  1WD1 A;  1N8R C;  1PFB A;  2GVA A;  5FO9 B;  2P5Z X;  4G7Z C;  2IX3 A;  3A8I E;  1WTH A;  1W6K A;  3HEJ A;  2F0H A;  3GTO B;  1RTO A;  3EVQ A;  1S3O A;  1YNJ D;  2NN6 H;  1HR0 Q;  4POG A;  1JT8 A;  2VL6 A;  4NXN Q;  2K1B A;  3I3C A;  2E2J B;  1L2F A;  1HNW Q;  2Z8L A;  1Y1V H;  2RQX A;  2EQS A;  2LXK A;  4B08 A;  4RCO A;  2F0W A;  4DXG A;  4J1M A;  5E7N A;  1LTI D;  2RBM A;  1HUN A;  4LF9 Q;  5CBE E;  1EWH A;  4IUP A;  4Q0F A;  5CV7 A;  2I5H A;  2KED A;  4KLK A;  4JBM A;  2YTV A;  2NWG A;  1NMF A;  2R7Z G;  3H0G H;  4LW1 A;  5C0X J;  1IBL Q;  4J8Q A;  4HCE A;  4A3J H;  4B3S Q;  3NEN A;  4DR6 L;  2PPB C;  2E2I B;  3HRZ C;  2F0J A;  3J80 L;  5DAU A;  4O1N A;  5GAD C;  4QJF A;  3BG3 A;  4X3T A;  4A3B H;  2IWH A;  4V19 0;  1I6H B;  3KDF B;  4ZK9 B;  5M3F B;  5IGG A;  1F2M A;  1JMC A;  3ZJY C;  3H3V I;  4XXE A;  3NUC A;  5FKA C;  4LJZ C;  4H7B A;  1VQ4 A;  2QW7 A;  4BBS G;  3RMH A;  1KC8 C;  1SE4 A;  1B3Q A;  2KHS A;  2L55 A;  3GTP B;  1XMO L;  4CBV A;  1QCB D;  2ZM6 Q;  1EY8 A;  4BY7 G;  1AZQ A;  5IYD H;  2RA4 A;  3JAM L;  1H9S B;  4APV A;  1SE3 A;  4GKJ Q;  4LNQ A;  4A3M G;  4DF7 A;  1AP0 A;  1B1Z A;  1CKM A;  5ELD A;  1Q7Y C;  3ERS X;  4A3C H;  2ZJR A;  3U9O A;  4WRD A;  1YIT A;  1QG7 A;  3I4M G;  3AMU A;  4UP9 A;  2EE1 A;  1C0A A;  2XTI A;  1IXR A;  1IZ6 A;  1TWC B;  4L5S A;  1QVC A;  4IZ8 A;  4RHR A;  4GOP C;  3CC2 A;  3M3Y B;  4OL7 A;  1GVP A;  1GXD C;  1NR2 A;  5EKK A;  3S2H B;  4X62 L;  2RF4 A;  3H15 A;  2DN8 A;  3Q24 A;  4OO1 G;  4KKT A;  3R3O A;  1QZG A;  3M85 A;  4A3J G;  1ZXT A;  1VQC A;  2XRQ D;  4N9T A;  1ZYR C;  4JW0 A;  3O13 A;  3QWN A;  2ICE C;  1U4M A;  2QDL A;  1O7L A;  1VS0 A;  4MN3 A;  3LX0 A;  2HCI A;  3KF6 A;  4BY1 B;  3MEH A;  3Q6S A;  2MO0 A;  4C1N K;  4DAP A;  2F4V Q;  3MHB A;  4EQ5 A;  2F0Q A;  1K0R A;  2JSO A;  3GTJ B;  3NHH A;  3VDY A;  2WAQ B;  4AYB E;  4N8X 1;  2FMC A;  3I2Z A;  3QB3 A;  4RH6 A;  2VW9 A;  4HJ7 A;  4LUO A;  1CK1 A;  4NMZ A;  5EQ0 A;  4KY7 A;  1CHQ D;  2N8N A;  3FDT A;  4DNT B;  5ELB A;  2PI2 A;  5M5X B;  1GHJ A;  5IT9 L;  5FLM H;  1U5K A;  3AQQ A;  1TWG H;  1EQV A;  2F0T A;  1SN8 A;  3U4Z A;  3VR6 A;  1PH1 A;  5C4J H;  3NP8 A;  5M3M G;  1XMQ L;  2CFM A;  1UNS A;  1RHP A;  5M5W B;  1VQ6 A;  3IAY A;  4KTA A;  1X6O A;  1VQD A;  3RUZ A;  1D5Z C;  2BDO A;  1SMX A;  4ULL A;  1T5E A;  4XQN A;  4YCU A;  3K7A H;  3NTH A;  4YHH Q;  1LM0 A;  2R92 H;  4DR5 Q;  1B9M A;  4LK1 C;  3S1N B;  1LV9 A;  1QJO A;  2A68 C;  5I2X A;  3UDF A;  5G3L F;  5FLX E;  1EU3 A;  1LTS D;  2A6H C;  5GAG C;  5C3W A;  5C3E B;  5EKL A;  3M7G A;  3PO3 H;  3RN2 A;  2F0V A;  2O5J C;  3ULJ A;  2WV6 D;  3L7Z C;  3S2D B;  1A0I A;  2O4X A;  5CC4 A;  1WYD A;  2A19 A;  1K8A C;  5EGT A;  2J4X A;  1VQJ A;  3ITP A;  1K8M A;  3QG1 A;  3I4N H;  1EZ8 A;  3MXU A;  3T13 A;  4ZKC B;  3J7Z C;  1N36 Q;  4F7X A;  1BCP B;  1MJE A;  3TZU A;  2VQE Q;  1PRT D;  3R93 A;  1SNO A;  3RZD B;  3VR4 A;  3IFD A;  1BUV T;  2FXQ A;  2BH2 A;  3B6Y A;  2M2L A;  1YVC A;  3L0O A;  4DK0 A;  4C3I B;  1J5E Q;  2FJ2 A;  4FDB A;  1YNX A;  1Q8I A;  4WFN 3;  2OEO A;  4GOP A;  3TS0 A;  3JAM E;  4GN3 B;  5BR8 L;  2JYO A;  5E3F A;  1J9O A;  3DMU A;  1IYJ B;  1OTC A;  2B2W A;  3G71 A;  5M5Y H;  3RLN A;  4A93 G;  4ZUJ A;  1JOO A;  1SJE D;  1WOC A;  2E75 C;  5JVG 3;  5C3X A;  1EY4 A;  1X3Q A;  4JBJ A;  3ONA B;  5HGT A;  1HNX Q;  3UDI A;  3PQI A;  1HNW L;  4DA2 A;  4A3E H;  1VMP A;  3W5O A;  1X65 A;  1UE1 A;  2L1B A;  3BVM A;  1VQA A;  3MTS A;  2AQ3 B;  1WCM G;  3K5N A;  1IYU A;  3BZC A;  3M9B A;  1QUQ B;  1TWH B;  1SJH D;  2B63 B;  2RKS A;  4R4Q A;  3NQI A;  3D0F A;  1S5B D;  1CUK A;  3BDO A;  3HOY H;  2VQF L;  3K58 A;  1SYB A;  1Z7T A;  1XJV A;  1WTW A;  4DV4 Q;  1VDZ A;  1C4Q A;  2D9U A;  3F2B A;  3A8J E;  5D65 A;  1XNQ Q;  1V9P A;  3SEB A;  2K5D A;  3CQZ H;  1PVO A;  2V1C C;  3HOW H;  1IL8 A;  2R93 B;  1PA6 A;  4EX5 A;  4POF A;  3SR1 A;  1DGS A;  1VQL A;  1S5C D;  4DR2 Q;  2PZT A;  1R9T B;  1WVL A;  1PTO C;  1SR3 A;  2HHH Q;  2UUC Q;  4C3J H;  1YJN A;  2HCC A;  1ASZ A;  4BBS B;  5FJ8 G;  4JI2 L;  4GNX A;  4JOI C;  2PNH A;  1E24 A;  4K6L A;  4BY7 B;  2IJ0 A;  5DNF A;  1I3Q H;  1OXV A;  3MA2 B;  1IKM A;  2WKD A;  4NXM Q;  4M1U B;  2K14 A;  2GN5 A;  4KKS A;  1NNX A;  4B3M L;  2Q2I A;  1QNU A;  1G2T A; 
#chains in the Genus database with same CATH homology
 3HKS A;  4A3L H;  1CSQ A;  2UU9 L;  3PF4 A;  2UXB L;  1FJG L;  1NBW A;  3KOJ A;  5JEA J;  1XTD A;  4GKJ L;  2N78 A;  1C7Y A;  4BBS H;  4JI6 Q;  2BH8 A;  2IHE A;  1G29 1;  1CKO A;  2KEN A;  3STB D;  2MNA A;  2LSS A;  3RZD H;  1HZC A;  1PH8 A;  2NVT H;  3FKI H;  1L1O A;  4IFD J;  5AJ3 Q;  4C3I H;  1X3G A;  3CMA A;  3S16 H;  1PH3 A;  1A8V A;  4QQB X;  1N36 L;  4TQU S;  5IP7 H;  3S1Q H;  1YBY A;  2C35 B;  2CWA A;  3CPW A;  2VQE L;  4GN4 B;  4DR3 L;  1B8A A;  2L15 A;  2VS1 A;  1NMG A;  4A3I G;  2UUB Q;  3I4O A;  3AFQ A;  3U4V A;  4DR6 Q;  3FP9 A;  3AFP A;  4UP8 A;  1J5E L;  2JQO A;  1VQO A;  4YCW A;  1EQR A;  5IP9 H;  2IHF A;  2NVQ H;  1JB7 A;  3MEF A;  3OYY A;  2AWO A;  4IO9 A;  2UXD L;  4X66 Q;  3T1H Q;  1N32 Q;  1ASY A;  3G48 A;  4QIW E;  1I94 Q;  3CF5 A;  5GAH C;  2BA1 A;  3HOY G;  4DR4 Q;  4HJA A;  4OWT B;  4DK3 C;  3CW2 C;  1Q1B A;  1VQE A;  1UWV A;  2MQH A;  1N9W A;  4AH6 A;  1EQQ A;  2E5L Q;  1IL2 A;  5IT9 c;  2DGY A;  5FLM G;  4JI5 Q;  1JJC B;  3CPF A;  4A3G G;  4DV0 Q;  4NB3 A;  5M3M H;  3RN5 A;  4LFA L;  4X64 Q;  1YJW A;  4X65 Q;  1VQ8 A;  4GKK Q;  3S24 A;  1VQM A;  4L5Q A;  1Q46 A;  1MIU A;  1U0L A;  3HOW G;  2EIF A;  1NTG A;  1X54 A;  1Q86 C;  1SLJ A;  1FVI A;  4L5T A;  2CKZ B;  2WB1 G;  4TVA B;  2N3S A;  5C3E G;  4HID A;  2AKW B;  1XMO Q;  1HNX L;  1VQ7 A;  2B63 H;  1JJ2 A;  4B3T Q;  4P71 A;  4BXX H;  2JA8 H;  4QY7 A;  3PUX A;  4JV5 Q;  4UP7 A;  1VQP A;  5IY0 A;  1QVG A;  2VNU D;  4LF8 Q;  4LF5 Q;  3G6E A;  4A3K G;  3MXN B;  4DR1 Q;  3TQY A;  3KJP A;  4HJ8 A;  4IJL A;  2CCZ A;  4IFD I;  2OCE A;  4IPG A;  4JI7 L;  4JYA Q;  1RIP A;  1VQ5 A;  4OWW B;  4GNX B;  1Y14 B;  2R92 G;  2KHJ A;  1Q82 C;  3KDF A;  2MO1 A;  5FLX c;  3UDG A;  4JI1 L;  1IBM L;  3PF5 A;  2UUA Q;  3F8T A;  3BU2 A;  4OON A;  1SRO A;  4DV2 Q;  3FHW A;  3CME A;  1KHI A;  3GTM H;  4DUZ Q;  2R93 H;  1VQK A;  4LF5 L;  4RG1 A;  4DV4 L;  1R9T H;  4DAM A;  1PFS A;  4C2M H;  3F2D A;  4PMW A;  1XNQ L;  2CWP A;  2D0O A;  1N34 L;  2F52 A;  1N33 L;  4IFD G;  1D8L A;  2HIX A;  3L2P A;  3S14 H;  3FKI G;  4LF6 L;  2JEA I;  3PO3 G;  1B70 B;  1BBU A;  3AEV A;  4OXP A;  3CCR A;  3F2C A;  1L1O B;  3PUW A;  3IRB A;  2K75 A;  1TXY A;  3E0E A;  1NY4 A;  4DUY Q;  4DR2 L;  2NVX H;  4BY7 H;  2UXC L;  1O7I A;  4X62 Q;  4JG2 A;  5BR8 Q;  1XNR L;  3NEL A;  2EXD A;  4GLV B;  2HHH L;  2UUC L;  3M4O H;  1WFQ A;  3ER0 A;  5HY6 A;  1XPU A;  3TEH B;  1Y1W H;  3W1B A;  1S40 A;  3H3V H;  4K0K L;  1HZA A;  3PO2 G;  1Q8K A;  1C9O A;  3OTO L;  1M1K C;  2Q2H A;  1N8R C;  1TWF H;  4GLX A;  2GVA A;  3EBE A;  1E22 A;  4YHH L;  5K36 G;  2JA5 H;  2E2I H;  1XPO A;  4WJ3 M;  5JJK A;  2WAQ E;  1WJJ A;  3I4N G;  3PUZ A;  2WP8 J;  2RHS B;  1S3O A;  1EYG A;  1EWI A;  3KYH C;  1HR0 Q;  4POG A;  1JT8 A;  5C4X H;  4DV7 Q;  2VL6 A;  1SRU A;  4DV1 Q;  4NXN Q;  1KRT A;  1L2F A;  4R4T A;  1HNW Q;  5J3B A;  1Y1V H;  2EQS A;  2LXK A;  4JC0 A;  1PH2 A;  2AMC B;  4BA1 I;  2Z6K C;  5E7N A;  3CCV A;  4P73 A;  1VQF A;  2AWN A;  1X3F A;  3JC6 6;  5AJ3 L;  1K8G A;  4AYB G;  4LF9 Q;  3PSI A;  5C44 G;  4A3D H;  3DM3 A;  3PUV A;  4A75 A;  3DLL A;  3CP0 A;  2WAQ G;  2HT1 A;  2I5H A;  4NPS A;  1HH2 P;  3KLW A;  4KLK A;  4JBM A;  2JA7 G;  2YTV A;  2OQK A;  2ATW A;  1NMF A;  3EIV A;  3GTP H;  2R7Z G;  3H0G H;  4LW1 A;  5C0X J;  3KJO A;  1IBL Q;  3M4P A;  5LMN Q;  1E7Z A;  4A3J H;  4B3S Q;  3NEN A;  3HOZ H;  4HIO A;  4AQY Q;  1UE7 A;  4DR6 L;  5JJL A;  4Y52 H;  3HOX H;  4A93 H;  2Q2U A;  4WJ4 A;  1X56 A;  4A76 A;  1X9N A;  1K73 C;  5HGQ A;  5GAD C;  4UY8 C;  5ELN A;  1XMQ Q;  1PHJ A;  4QJF A;  2NZH A;  4X66 L;  4J15 A;  4DV6 Q;  1N32 L;  2KCT A;  4A3B H;  3KDF B;  2JJQ A;  4DR4 L;  1I50 H;  1JMC A;  4JI0 Q;  3ZJY C;  4A3E G;  3H3V I;  1PYB A;  1OXT A;  3PIO A;  2E5L L;  1EOV A;  4JI5 L;  1J6Q A;  2IX0 A;  1WCM H;  1SFO H;  1NE3 A;  2IT1 A;  4DV0 L;  1HZ9 A;  4X64 L;  2N49 A;  4GKK L;  4JI3 L;  3UDX A;  1VQ4 A;  3J7A 5;  2VUM H;  4BBS G;  3G4S A;  1KC8 C;  2WB1 E;  1JE5 A;  3RZO H;  1KD1 C;  3PIP A;  2IX1 A;  1XMO L;  3E9H A;  4RMF A;  2ZM6 Q;  4BY7 G;  3TRZ A;  4DV3 L;  4B3T L;  5JJI A;  3A5Z B;  1P16 A;  5IYD H;  4JI8 L;  4X6A H;  4XIG S;  4JV5 L;  1S72 A;  2ZTD A;  4APV A;  1Y1W G;  3PUY A;  1L0W A;  4GKJ Q;  5IE8 A;  4A3M G;  2JE6 I;  2ALY B;  2GVB A;  4LUV A;  4DV5 Q;  4DR1 L;  2ZJP A;  1CKM A;  1EUJ A;  4JYA L;  4LWC A;  3ERS X;  1Q7Y C;  4A3C H;  3S17 H;  2KHI A;  3E9I A;  2ZJR A;  4PG3 A;  5GAE C;  4IPH A;  1SE8 A;  3TRE A;  2UUA L;  1YIT A;  4O0A A;  4YWM A;  2D0P A;  3I4M G;  4BA2 I;  4DV2 L;  2H5X A;  4UP9 A;  4Y7N H;  1XPR A;  2K5V A;  3RNU A;  4OO1 I;  4LF4 L;  3K7U C;  4BBR G;  4R1J A;  5C0X I;  3M7N A;  2YTX A;  1VQG A;  3CD6 A;  5C4X G;  2QGQ A;  1C0A A;  2XTI A;  4A3F G;  5IYB H;  5IYC H;  1IXR A;  3RR5 A;  1AH9 A;  1IZ6 A;  4ME3 A;  5FJ8 H;  3K8A A;  3M4Q A;  2YTY A;  4BY1 H;  3J81 c;  4L5S A;  5IWA Q;  1QVC A;  1YHB A;  2PI2 E;  1AE2 A;  2R7D A;  4GOP C;  3CC2 A;  4JCV E;  1GVP A;  2Z0S A;  2OQ0 A;  2PQA A;  4DUY L;  1E1T A;  1M90 C;  3S1R H;  1V1Q A;  3T1Y Q;  2OTJ A;  3ULL A;  1UEB A;  4LNQ A;  4X62 L;  2JA8 G;  2RF4 A;  3A5U A;  1PH5 A;  4JI4 Q;  3GTO H;  3H15 A;  4A3L G;  3A74 A;  4OO1 G;  1X55 A;  3GTL H;  1CKN A;  3RLF A;  3TS2 A;  5JEA G;  3J81 j;  3GTG H;  2E2J H;  2XGT A;  1IBK Q;  1QZG A;  1KXL A;  1G51 A;  1HJP A;  3M85 A;  4A3J G;  5M5X H;  3HOZ G;  2JA9 A;  3HOV H;  4DR7 Q;  1VQC A;  1OXX K;  1YJ9 A;  4OWX B;  2HIV A;  3GD7 A;  3J80 c;  3U58 A;  4L5R C;  4MTN A;  3CCJ A;  3PGZ A;  3K0X A;  1VS0 A;  3A0J A;  1HR0 L;  4DV7 L;  4O2D A;  2B29 A;  3KF6 A;  4NXN L;  5IP7 G;  4DV1 L;  1KRS A;  2K50 A;  2MO0 A;  3D31 A;  4A3I H;  3RLO A;  2F4V Q;  4EQ5 A;  1K0R A;  4HJ9 A;  2VZA A;  1VQ9 A;  3CCE A;  3VDY A;  1Q81 C;  3HOU H;  4AYB E;  4HJ5 A;  1W3S A;  3I2Z A;  2JA6 H;  2VW9 A;  4LF9 L;  4NXM L;  4HJ7 A;  4LUO A;  5IP9 G;  2I0Q A;  2I5M X;  3F1Z A;  2N8N A;  1AE3 A;  1Q1E A;  2PI2 A;  3CCL A;  1PH7 A;  4C3H H;  1IBL L;  1YEZ A;  5FLM H;  4B3S L;  1I6H H;  5M3F H;  1U5K A;  4AQY L;  3AQQ A;  4JI6 L;  4A3G H;  1HR0 W;  1TWG H;  3U4Z A;  3JAM c;  1SN8 A;  1YIJ A;  1PH1 A;  5C4J H;  4PZ7 A;  4B3R Q;  2Z6K A;  5M3M G;  5H1S E;  2LXJ A;  4JBK A;  1Q12 A;  3AYH B;  4LF7 Q;  4OX9 Q;  2YYZ A;  2CFM A;  5GRO A;  3SGI A;  3ULP A;  1XMQ L;  1YZ6 A;  4MZ9 A;  1KIX A;  1VQ6 A;  5C3E H;  1X6O A;  4DV6 L;  4LFB Q;  1VCI A;  1K9M C;  1VQD A;  2B63 G;  3NBH B;  1OXU A;  5LMU Q;  1CSP A;  1VQH A;  1QZH A;  2VQF Q;  3CCM A;  4JI0 L;  3S2D H;  4BXX G;  2UUB L;  1SMX A;  1K83 H;  4GS3 A;  4IJH A;  4K0K Q;  2PMZ E;  5IYB G;  4YCU A;  4XTC S;  2IY5 B;  1E1O A;  2ZTC A;  3K7A H;  4PZ8 A;  2R6G A;  4A3K H;  4YHH Q;  1LM0 A;  2MFI A;  5LMN W;  4R4I A;  4DK6 C;  2R92 H;  3BJU A;  4QL5 A;  4DR5 Q;  4YWK A;  4YY3 Q;  3T1H L;  1G6P A;  2K5H A;  2ZM6 L;  1I94 L;  1UE5 A;  3W1G A;  2PQA B;  1H95 A;  1T9H A;  3S1M H;  2R93 G;  1LYL A;  4GLA C;  4IOA A;  2KCM A;  3PCO B;  4LUZ A;  3UDF A;  1KQS A;  2A1A A;  1A63 A;  2D62 A;  3I55 A;  4YCV A;  1YHQ A;  1VQB A;  3I7F A;  2ID0 A;  1QUQ A;  3PV0 A;  1EFW A;  3KFU A;  1L1O C;  2AHO B;  4JI2 Q;  1EIF A;  1CKN B;  5GAG C;  4DV5 L;  2OTL A;  4X65 L;  1W2B A;  4LFC Q;  1E3P A;  3HOV G;  1X3E A;  1TWC H;  4R4C A;  3RN2 A;  3PO3 H;  4KHP Q;  3ULJ A;  4LF8 L;  3L7Z C;  1HNZ Q;  3OW2 A;  3M3Y H;  1YI2 A;  1MJC A;  2OWO A;  2NN6 I;  4DKA C;  4B3M Q;  1A0I A;  4IPC A;  1WYD A;  2A19 A;  5DLQ E;  3S2H H;  4DPG A;  1K8A C;  2UU9 Q;  3PO2 H;  1HZB A;  2UXB Q;  1FJG Q;  3KF6 B;  3HKZ E;  5IWA L;  2R7F A;  1VQJ A;  3KF8 B;  3UE0 A;  4KI0 A;  2JA5 G;  3HOU G;  2K52 A;  4UPA A;  4P72 A;  3UE1 A;  2ES2 A;  2JA6 G;  3I4N H;  2ASB A;  1TWA H;  3T1Y L;  3J7Z C;  1N36 Q;  1BBW A;  3CCU A;  2QA4 A;  4DUZ L;  1B7Y B;  1A62 A;  1LTL A;  2NN6 G;  4IOC A;  4HIM A;  1MJE A;  4JI4 L;  2VQE Q;  4R4O A;  2NVY H;  4DR3 Q;  1PH9 A;  2YU9 H;  2BH2 A;  2FXQ A;  2QEX A;  3B6Y A;  2K5N A;  1YVC A;  1Y1V G;  3L0O A;  2BA0 A;  1IBK L;  5M3F G;  1P8L A;  3NEM A;  3HKZ G;  1J5E Q;  4DR7 L;  1V43 A;  4FDB A;  3J81 i;  1YHA A;  1YNX A;  3Q8D A;  1D7Q A;  4DAY B;  5GQO A;  1GD7 A;  3GO5 A;  5ELO A;  4JI3 Q;  5C44 H;  4GOP A;  2HQL A;  3GTJ H;  2ZTE A;  3TS0 A;  4A3D G;  2UXD Q;  4GN3 B;  5BR8 L;  1TWH H;  2JA7 H;  3ICE A;  2F3I A;  2R7Z H;  3CCS A;  1BVS A;  1MKH A;  4DV3 Q;  5C0X G;  1IYJ B;  1OXS C;  1WI5 A;  3H0G G;  3G71 A;  4A4I A;  1RL2 A;  4JI8 Q;  5M5Y H;  1OTC A;  2I5L X;  2F4V L;  1Z47 A;  3BZK A;  4IPD A;  3LGJ A;  3RLN A;  3HOX G;  4A93 G;  2Y0S E;  2E2H H;  2NZO A;  4LFA Q;  1GM5 A;  4P74 A;  1EIY B;  1Z9F A;  2VY3 A;  1WOC A;  3K81 C;  3J80 i;  4HIK A;  3S15 H;  1UE6 A;  2KBN A;  4GN5 A;  4JBJ A;  1FL0 A;  3CAM A;  4DNI A;  2RHQ B;  5M5W H;  1PH4 A;  3UDI A;  1HNX Q;  2JK8 A;  4A3B G;  1HNW L;  4A3E H;  4LF4 Q;  3W5O A;  1X65 A;  1UE1 A;  1VQA A;  3GDE A;  4H02 A;  1WCM G;  4MNO A;  4QGU A;  1PV4 A;  3CC4 A;  2B3G A;  4B3R L;  3BZC A;  3M9B A;  1JJG A;  1I5F A;  1GO3 E;  1QUQ B;  2Y0S G;  3EN2 A;  2YV5 A;  4JI7 Q;  4LF7 L;  4OX9 L;  2VUM G;  3CCQ A;  4KHZ A;  4R4Q A;  4LFB L;  1KAW A;  3D0F A;  2WFW A;  4JI1 Q;  1IBM Q;  1CUK A;  5LMU L;  3HOY H;  3I56 A;  1KL9 A;  2VQF L;  1GKH A;  5LMN L;  1XJV A;  3S1N H;  5IYD G;  2RCN A;  1NJI C;  4DV4 Q;  3F2B A;  2CQO A;  4YWL A;  4A3M H;  1XNQ Q;  1V9P A;  3JAM i;  2ZJQ A;  1N34 Q;  1PYS B;  3CQZ H;  3GTK H;  1PVO A;  2V1C C;  1N33 Q;  1K3R A;  4AIM A;  1BKB A;  1FGU A;  4DR5 L;  4YY3 L;  3HOW H;  4A3C G;  4LF6 Q;  2A8V A;  1PA6 A;  2JEB I;  4EX5 A;  4POF A;  4ALP A;  1DGS A;  1VQL A;  3I4M H;  3WWV A;  2UXC Q;  4DR2 Q;  4JBW A;  4BBR H;  1PH6 A;  3STB C;  2Q2T A;  1XNR Q;  1SR3 A;  2HHH Q;  2UUC Q;  4A3F H;  4P75 A;  5EAY A;  4C3J H;  1YJN A;  4GNX C;  3GTQ H;  5IYC G;  1ASZ A;  1VQN A;  2DUD A;  5FJ8 G;  3OTO Q;  4JI2 L;  1LUZ A;  4BY1 G;  4LFC L;  3U50 C;  3CC7 A;  4GNX A;  1QVF A;  4JOI C;  2PNH A;  1E24 A;  3K80 C;  2K4K A;  4PZ6 A;  2E8G A;  4KHP L;  1I3Q H;  1OXV A;  4JOI A;  1HNZ L;  4NXM Q;  3CXC A;  2K14 A;  1VQI A;  2GN5 A;  3HFZ B;  4B3M L;  2Q2I A;  4GOP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...