4GKJL

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human mitochondrial anticodon stem loop (asl) of transfer rna methionine (trnamet) bound to an mrna with an aug-codon in the a-site and paromomycin.
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
124
structure length
124
Chain Sequence
b'PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Expanded use of sense codons is regulated by modified cytidines in tRNA.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 15
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2012-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4gkjL00
4JBJA 1VQPA 1YZ6A 5IWAL 1KRSA 1PFSA 2EXDA 3F2CA 4BY7H 3D0FA 1DGSA 3J7ZC 1KL9A 3CC7A 1PH2A 1KRTA 2NVXH 2AWNA 3HOYH 2UUCL 4DAMA 4XIGS 2JE6I 4GLVB 1TXYA 5ELOA 1R9TH 4BBSG 1Q12A 4B3RQ 2K5HA 3NBHB 1BBWA 1YVCA 4A3IG 1PV4A 3RN5A 4O2DA 1IZ6A 4R4IA 5FLMH 1YJWA 2JA6G 3UDXA 3PO2H 3CC4A 2LXKA 5C3EH 1QUQA 1YNXA 2YTYA 4PZ6A 3PUXA 3OW2A 1LM0A 4JI7Q 4LFAL 2LXJA 3I55A 1X6OA 2BH8A 4X62L 3ERSX 2Y0SG 1PYBA 3PUWA 5C4XG 2F4VQ 1XJVA 3AYHB 2NN6I 2ZJRA 1N33Q 1A8VA 1I3QH 1QVCA 1VQFA 4L5SA 1N32Q 4QY7A 3KDFA 4OXPA 4DPGA 1QVFA 4GN3B 4GOPC 1VQHA 3EBEA 3U4VA 1PH7A 1JMCA 1GVPA 1Z9FA 4IPGA 1PH1A 1I6HH 3L2PA 2D0PA 2N49A 1JB7A 4JBWA 2ZJPA 2BA1A 2Y0SE 1E24A 2I5MX 4YWMA 3SGIA 4IFDJ 1OXXK 1U0LA 4IPHA 4B3RL 3K8AA 2OTLA 2VNUD 5C0XJ 3F2BA 1P8LA 4POFA 3PO3G 1PH5A 2YTXA 1CUKA 1E3PA 1P16A 2CFMA 2L15A 4RG1A 4DR3Q 2R7ZH 3I4NH 4R4QA 1XPOA 2K50A 4DUYQ 1KD1C 5JEAG 4JI7L 1V43A 1FJGQ 2YTVA 3S16H 4A3CH 1TWGH 1X3GA 2JEBI 4HIMA 4IOCA 2F4VL 4DR7Q 1N33L 1SLJA 1A62A 4DKAC 1L0WA 1N32L 1K8GA 1VS0A 1YIJA 1WJJA 3S1QH 4PMWA 3ER0A 4JG2A 3F2DA 2JA8G 3I4NG 2R7ZG 1KC8C 4X66Q 3CMEA 4GN5A 2MO0A 3JAMi 2MNAA 2F52A 4LFBQ 3TS2A 3UDFA 2QA4A 1PH6A 2KHIA 4P73A 4BA1I 2E5LQ 1FJGL 3HOVG 4R4CA 3CW2C 1RIPA 4JI0Q 3S2DH 3UDIA 4GOPA 1EUJA 4XTCS 1Q1EA 2RHQB 2VY3A 1HR0W 2OCEA 4A3MH 4JYAQ 4BY1G 2AHOB 2I5HA 3RLFA 4A3JH 4DR3L 2KENA 1FL0A 1QVGA 4GKKQ 4QIWE 3GTLH 4LF4Q 3KDFB 5M3FG 1YI2A 4BXXH 4UP7A 4DUYL 3F1ZA 1UE5A 1VQAA 3BJUA 4YCVA 5EAYA 3G71A 1Y1WG 4OX9Q 3A74A 1K3RA 4DR7L 4A3DG 3S1MH 1IYJB 1E7ZA 4OWWB 2CCZA 5IP9H 5IYBG 4LWCA 4AYBG 4A3JG 4A3GH 1WCMG 2R6GA 3OTOQ 3G4SA 4X66L 4RMFA 2JA7H 4DV5Q 4LFBL 2E2IH 5JJLA 4DR4Q 4DK6C 2E2HH 2E5LL 1JE5A 5K36G 3H0GG 1G51A 3GTQH 2RF4A 4JI5Q 1XPUA 1N36Q 1UWVA 1UE1A 4DUZQ 1BBUA 3CCUA 3W5OA 4WJ4A 5IYDH 1L1OB 3S17H 3E9HA 1EFWA 4YCUA 4AYBE 4JYAL 2B63G 3GTMH 3I56A 3I7FA 1Q8KA 4AQYQ 2CQOA 2Q2HA 5LMNQ 1IBMQ 1AE2A 2I0QA 4GKKL 1OXVA 2I5LX 4LF4L 1G291 3D31A 1OXSC 5M5WH 1K83H 5IT9c 3H3VI 4OO1G 3FP9A 4OX9L 3M7NA 2Z0SA 3FKIG 1YJNA 2JJQA 5IYDG 3PF4A 5DLQE 1NTGA 1VQ5A 3J7A5 4QL5A 3NEMA 3HOWH 1A63A 1YJ9A 4LF7Q 1YBYA 1HJPA 5M5XH 5IY0A 4GNXC 3J81i 1GKHA 3OTOL 3BU2A 1J5EQ 4GS3A 1PVOA 2UXDQ 4DV5L 2IHFA 1S3OA 2K5VA 2WP8J 4GLXA 4DR4L 3M85A 4A3KG 3LGJA 4IPCA 4DV3Q 3PIPA 1WOCA 4BBRH 4JI5L 4A3FG 4LF8Q 4R1JA 1N36L 2NZHA 4DUZL 3NENA 3UE1A 2JK8A 3ICEA 3RZOH 1C0AA 3AFQA 2ZTEA 1KHIA 2HQLA 2V1CC 1IBML 1CKNB 1CSPA 5LMNL 3CCJA 1Z47A 1L1OC 4HJ5A 2JQOA 3OYYA 1VQGA 1W2BA 2R93H 1GO3E 3M3YH 2R7DA 2KBNA 4JI8Q 1N34Q 4BY7G 3PV0A 4BBRG 2ES2A 4H02A 4TQUS 1SFOH 4A3LH 3HOYG 1Q7YC 4APVA 1HZBA 4X65Q 1EIFA 4X64Q 4ME3A 1TWAH 4A4IA 1XTDA 3T1HQ 4LF7L 1TWHH 1K0RA 3W1GA 2VUMH 2RHSB 5FLMG 1J5EL 1IBKQ 2UXDL 3GTGH 1I5FA 3GDEA 2UXCQ 3KYHC 1I94Q 3PO2G 4DV3L 5C3EG 5FJ8H 1VQ6A 4LF8L 4GNXA 2KCMA 1FVIA 4X6AH 3HKZG 4OONA 3TEHB 3KJPA 4OWXB 4DV4Q 3STBD 5GAGC 1OXTA 3TS0A 4C2MH 1X3FA 4OWTB 2UUAQ 2IX1A 2B29A 4IFDG 5HY6A 5E7NA 4A3EH 3TREA 1HNXQ 4WJ3M 1CSQA 4JI8L 2WAQG 1N34L 5FJ8G 1VQIA 5C0XG 3VDYA 1SMXA 2XGTA 4JV5Q 4GKJQ 3HKZE 5GQOA 1L1OA 4X65L 4B3MQ 4X64L 2D0OA 1MJCA 1HZ9A 3T1HL 1CKOA 1FGUA 3JAMc 2BA0A 1XMQQ 1VQ4A 2VQFQ 1IBKL 2AMCB 3ZJYC 1A0IA 2WAQE 2UXCL 1YHBA 3CCEA 3UDGA 1I94L 4PZ8A 3AEVA 3TQYA 2EQSA 2ATWA 1XPRA 3ULJA 3S14H 1TWFH 2WFWA 2YU9H 2BH2A 4R4OA 4A3CG 1HNWQ 3G6EA 4DV4L 4KHPQ 1L2FA 2NVQH 1K8AC 1B7YB 4QJFA 4UP8A 2UUAL 4LF9Q 4LUVA 4NPSA 3S2HH 1PHJA 4GLAC 1HNXL 2PQAB 4POGA 1VCIA 3HOXH 1JJGA 1E1TA 2E2JH 2D62A 3GO5A 1JJCB 4IJLA 4P72A 1JJ2A 2K4KA 3TRZA 1Y1VH 3E9IA 4MNOA 4GKJL 4JV5L 2Q2IA 2FXQA 1SRUA 4DR1Q 2F3IA 5IYCH 1KIXA 4B3ML 1H95A 2H5XA 4C3IH 1VQ9A 4GNXB 5GADC 4PG3A 1CKNA 5HGQA 4A3MG 1YHAA 1XMQL 5BR8Q 3S1NH 4YY3Q 2VQFL 2GVBA 1IBLQ 3HOXG 4KLKA 1D8LA 2N3SA 4JBKA 2PI2E 2RCNA 4HJ9A 1Y14B 3K80C 3GTOH 4BXXG 2ID0A 4LF5Q 1VQNA 1QZGA 2PI2A 1S40A 3HKSA 3HOUH 1X56A 3BZCA 1HNZQ 1HNWL 4JCVE 2N78A 2CWAA 4B3TQ 4JI0L 4JI3Q 4KHPL 4LF9L 3KF6B 3BZKA 5IP9G 4JI1Q 4FDBA 3CQZH 5IP7H 1O7IA 1K9MC 1PH9A 2NVTH 4A3GG 3JC66 1M1KC 1WYDA 5IE8A 2JA7G 4JOIC 4UP9A 2QEXA 1VQBA 3H3VH 3A5ZB 4QQBX 5FLXc 2AKWB 3CAMA 4BA2I 3J80i 4DNIA 4A93H 2VQEQ 1YITA 1X54A 1X9NA 1NJIC 4DR1L 3IRBA 1N8RC 3J81c 2AWOA 4UY8C 2JA9A 3E0EA 3M9BA 4PZ7A 1N9WA 1XNRQ 2NZOA 3GD7A 4P75A 5GAHC 5BR8L 3I4MH 4YY3L 4Y52H 1IBLL 5C44H 4OO1I 2ZTCA 1B70B 3KFUA 1EQQA 4J15A 3RN2A 1I50H 1OXUA 4LF5L 3L7ZC 4AH6A 1BKBA 1IL2A 1GD7A 3B6YA 4L5QA 1PH3A 2JA5H 4JI3L 4B3TL 3RR5A 2JEAI 1HR0Q 1NE3A 3KJOA 5J3BA 3HOWG 4AIMA 4JI1L 2VS1A 5C44G 3FHWA 4Y7NH 4AQYL 2K5NA 2DGYA 3M4QA 1VQJA 1X65A 1XMOQ 1VQLA 3A5UA 1HZCA 3CXCA 2VQEL 4HIOA 1VQOA 4YWKA 4BBSH 5ELNA 2IT1A 2CWPA 4A3IH 4JI4Q 3CPFA 1TWCH 4JOIA 4DK3C 3A0JA 1KAWA 3CP0A 1XNRL 2JA6H 1G6PA 3U50C 4LUZA 2LSSA 1LYLA 3S24A 4K0KQ 1RL2A 2E8GA 2PQAA 4L5RC 4DV2Q 1AH9A 3CPWA 3PUVA 2IY5B 1J6QA 2R93G 2IHEA 4UPAA 4DAYB 3CMAA 3GTKH 2ZM6Q 2YYZA 1PH8A 2KHJA 5C4XH 3CF5A 1YEZA 3I2ZA 4P71A 1PH4A 3ULPA 4A3LG 1EOVA 2K52A 1ASYA 2CKZB 1HR0L 1B8AA 2NN6G 5LMUQ 2OWOA 4LW1A 3K7AH 4IPDA 1NY4A 2A1AA 4DV0Q 3M4PA 3W1BA 2VUMG 2YV5A 4MTNA 2N8NA 1MJEA 2Z6KC 2GN5A 2ALYB 1XMOL 3PCOB 1MIUA 3CCLA 4LNQA 1VQ7A 4YHHQ 1UE6A 4JI4L 3J81j 5GAEC 4DV6Q 4IFDI 3KF6A 1PA6A 3S15H 3Q8DA 3PO3H 4K0KL 1CKMA 1LUZA 2C35B 4LUOA 4QGUA 1KQSA 2OQ0A 4DV2L 3PGZA 4A76A 4A3EG 4DV1Q 4IOAA 4DV7Q 1HH2P 5C0XI 1Q81C 1Q86C 4NB3A 3T1YQ 4A3BH 2ZM6L 2ZTDA 2MFIA 4LFCQ 1XNQQ 5C4JH 3K7UC 4NXMQ 2UXBQ 5AJ3Q 1SE8A 4NXNQ 1X3EA 1UE7A 1S72A 2NVYH 3DM3A 1VQDA 5LMUL 3UE0A 4GN4B 2JA8H 4C3JH 5LMNW 5JEAJ 3KF8B 3DLLA 4DV0L 4B3SQ 4DR2Q 1SN8A 3HOVH 3CCSA 4KHZA 4EQ5A 4A3BG 5JJKA 1VQMA 3WWVA 2K14A 1QZHA 1D7QA 1V9PA 2HIVA 4C3HH 1C9OA 3PSIA 3U4ZA 4TVAB 1VQEA 1WFQA 4YHHL 3GTJH 4DV6L 1Q46A 1SR3A 2XTIA 2Q2UA 4BY1H 2Z6KA 1U5KA 1Q82C 4JI2Q 3CC2A 3KLWA 5M5YH 1E1OA 3L0OA 3PIOA 5M3FH 4DV1L 4DV7L 3U58A 2UU9Q 4EX5A 4P74A 4HIKA 3T1YL 1Y1WH 1IXRA 4LFCL 1XNQL 1QUQB 4IO9A 1NMFA 3AQQA 1T9HA 2A19A 3K0XA 4DR5Q 2A8VA 1Y1VG 3EN2A 4NXML 2HT1A 5AJ3L 4DR6Q 4A3DH 2UXBL 5IYBH 2VW9A 4NXNL 3CD6A 2HHHQ 2R92H 2R7FA 5IYCG 1WCMH 3MEFA 1EWIA 2WB1G 4ALPA 4B3SL 3MXNB 1AE3A 1V1QA 2EIFA 3K81C 1HZAA 1WI5A 4DR2L 1PYSB 3J80c 1EQRA 1EIYB 3RZDH 2ASBA 3H0GH 3PUYA 4IJHA 3ULLA 2IX0A 3CCVA 1BVSA 1VQKA 2K75A 4KI0A 2VZAA 1KXLA 3HFZB 4LF6Q 1K73C 5M3MH 2PNHA 2B63H 2R92G 3PF5A 2ZJQA 3HOUG 1Q1BA 4HIDA 1MKHA 4JI2L 2WB1E 4JI6Q 3EIVA 2UUBQ 2QGQA 2Q2TA 5IWAQ 4L5TA 1M90C 5IP7G 5H1SE 2UU9L 2DUDA 4HJ7A 1NMGA 4HJ8A 3GTPH 1ASZA 2B3GA 3M4OH 3CCRA 1SROA 2OTJA 3FKIH 2MQHA 3CCQA 2UUCQ 4R4TA 4JC0A 4DR5L 4DR6L 4A75A 1JT8A 2VL6A 3S1RH 3HOZH 1NBWA 5M3MG 4A93G 2HIXA 2PMZE 2HHHL 3RNUA 3STBC 1HNZL 3RLOA 1GM5A 3KOJA 3RLNA 4A3KH 3I4MG 4MZ9A 1EYGA 4YWLA 1YHQA 5GROA 4A3FH 3PUZA 2GVAA 2KCTA 1OTCA 3F8TA 1VQ8A 4O0AA 4LFAQ 1LTLA 3G48A 3HOZG 4X62Q 3CCMA 4JBMA 3NELA 1VQCA 3AFPA 4LF6L 4GOPB 2MO1A 1UEBA 4YCWA 3H15A 1X55A 2JA5G 4HJAA 1C7YA 5JJIA 3I4OA 1E22A 4JI6L 1W3SA 2OQKA 2UUBL
chains in the Genus database with same CATH superfamily
1RTNA 1F2YA 4RGNA 1PFSA 2PCFB 1KRTA 2NVXH 2AWNA 3HOYH 2UUCL 4DAMA 3DWPA 2JE6I 1R9TH 3TN2A 3BYTB 4B3RQ 1TY0A 3R8BA 4A3IG 3RN5A 4C3HB 3UDXA 4BY1B 5C3EH 1LM0A 1HCZA 2X69A 2LXJA 2K05A 2Y0SG 1PYBA 5C4XG 2F4VQ 4EGVA 1WTPA 4IFDH 3S17B 2I46A 1PRTB 4IURA 1DOLA 3SR1A 3QB3A 2R92B 3U4VA 5C0XH 1PH1A 1SYDA 1I6HH 4KN7C 2D5DA 1CT1D 2I5MX 3SGIA 3RZDB 3H0GB 1FNWA 3K8AA 2VNUD 4ZLTF 4E6IA 1P16A 2L15A 2A73B 2R7ZH 4FO2A 4JI7L 5FLXE 1UAPA 4A3CH 1TWGH 1FYCA 3QO2A 1A62A 1SEBD 1GUWA 5FO7B 1YIJA 3S1RB 3HOZB 1RODA 3F2DA 1ZKOA 2R7ZG 4OELB 4C3JG 1ZYRC 4X66Q 2MNAA 2F52A 2EYJA 1PRTC 5I6WA 3KBGA 2QA4A 2E5LQ 2NTTA 4R4CA 4X3SA 1I4QA 3UDIA 4GOPA 1TVXA 2JSOA 4KY6A 2B8FA 1Q1EA 4J1MA 2VY3A 4XXEA 2AHOB 4CJ0B 4A3JH 2KENA 1QVGA 3GTLH 4IUVA 3KDFB 4FF1A 4BXXH 2CVRA 3MC0B 1EEFD 1ESFA 4DUYL 4OX9Q 1SAPA 1UE5A 1Y1WG 1A3VA 5EAYA 1FJGL 1D1KA 2XN9C 4DR7L 5I6YA 2PYKA 3S1MH 1QJOA 2BCOA 4LWCA 4AYBG 4A3JG 1LT6D 2M9VA 5KRUA 1CQVA 4IUTA 3G4SA 4RMFA 2JA7H 4DV5Q 5JJLA 1JE5A 5K36G 1G51A 3PO2B 4JI5Q 1S5ED 3BYYB 3CCUA 3W5OA 1L1OB 1V1PB 2NTSA 4DAPA 1JWUD 1EFWA 1WVLA 1PTOC 3I7FA 1ENCA 4AQYQ 1IBMQ 4DN4M 2PZWA 5JOBA 1CTMA 4LF4L 1G291 5M5WH 1OXSC 5IT9c 1K83H 3X3MA 4RKBA 4F88A 1YJNA 2JJQA 3AMUA 1NTGA 2MHVA 1BCPF 3URYA 2AUKA 1YBYA 5EKKA 2EJMA 2B39A 1GKHA 1Z6HA 4GS3A 2UXDQ 2K5VA 3JAME 4A3KG 5ELCA 1U4LA 3I4NB 4RGMA 1N36L 3K5LA 2NZHA 1HXYD 2EY5A 3P75A 1BUVT 3ICEA 2J0TD 1L0YB 3RZOH 3T56B 1HQMC 1C0AA 3LWUA 1JOOA 2HQLA 4OIJA 1L1OC 2QDLA 2JQOA 1GO3E 2KBNA 3D6CA 4N8FA 1YNJC 4BY7G 3PV0A 3TMEA 4C1NI 1Q7YC 4JPBW 1U4PA 2NN6H 3K5MA 2F0NA 4LF7L 1AW7A 1TWHH 2VUMH 3R93A 3GDEA 3KYHC 1I94Q 4DV3L 3T16A 4GNXA 2KCMA 3CU7A 3HKZG 4OONA 1R4PB 1MHWC 2PNRC 2JP1A 4A3EH 5E7NA 3C1FA 2N55A 4WFN3 2B2WC 2K04A 4C56C 1HQRD 1VQIA 5IOCA 2PPBC 2E2IB 3P20A 2RVLA 1LV9A 4N9PA 1RDPD 4X64L 1NUCA 3GTQB 3T1HL 2BA0A 1AFPA 5JPMC 2OF1A 3J81E 1VQ4A 2AMCB 1A0IA 3GTMB 3CCEA 4ZKBB 2EQSA 2H4OA 2V4DA 1XPRA 3ULJA 1SE3A 2F3VA 1HNWQ 1EY4A 4DV4L 2NVQH 1K8AC 4QJFA 5EKLA 1HNXL 2VB2X 5M5XB 2D62A 1B50A 4IJLA 3VR5A 5D3DA 5COYA 4Q5VA 5IYCH 1WTXA 4B3ML 1H95A 2H5XA 1BOSA 1YHAA 5BR8Q 2GVBA 1Y14B 3M3YB 3QG1A 2CQAA 1ENAA 3BZCA 4CHTB 2RDHA 4JI0L 4KHPL 1E2ZA 5CC4A 1F77A 3MZ5A 2B2YA 5IGEA 1XXGA 4DAYA 4FDBA 3CQZH 1PH9A 1MGSA 2DNEA 1J9OA 4QB4A 3G6JB 2AKWB 4BA2I 3J80i 1U4RA 5CV5A 1X9NA 1NJIC 2JA9A 3E0EA 4KV6A 4PZ7A 3TZUA 1CM9A 5GAHC 1K28A 2SEBD 4Y52H 2DJFC 2ZTCA 4HAEA 3KFUA 1EQQA 1VDZA 3RN2A 4LF5L 4K14A 4L5QA 5ISRA 4IUUA 4JI3L 3RR5A 1HR0Q 2MGSA 4AIMA 1EFID 3S16B 3D4RA 1K8OA 2G9DA 1VQJA 3A5UA 1HZCA 5LHY1 2CWPA 2DY7A 1BQQT 4JI4Q 3HG9A 1XNRL 3CP0A 5F2DA 2L5TA 1G6PA 4K0KQ 1RL2A 4L5RC 1AH9A 4DV2Q 1UUPA 4L6TB 2R93G 1EYDA 1EOTA 3H6MA 4HR7B 1PH8A 2D9UA 3I2ZA 1PH4A 2Z4IA 2O5JC 2E2JB 1FR3A 2F0LA 2K52A 1ASYA 2XWJB 1NAPA 2SOBA 3IKJA 2A1AA 4V190 3W1BA 4MTNA 3KBXA 1QG7A 1MIUA 3CCLA 4H13C 4YHHQ 3E3XA 3J81j 4DV6Q 4IFDI 1AZQA 1RF2D 1CKMA 3FRPB 2B2TA 3HOUB 2OQ0A 1PZID 1Q81C 5C0XI 1Q86C 4UAIA 2ZTDA 5C5LA 2K01A 5T1IA 2K1BA 4XT1B 3DM3A 1VQDA 5LMUL 2JA8H 4V0BA 1J8IA 4DV0L 2F0SA 1IYVA 1JB3A 1UNSA 3CCSA 5JJKA 1BCPB 1VQMA 3CRKC 2IL8A 4G7ZC 1C9OA 2A6ED 3U4ZA 4TVAB 1D1IA 1VQEA 3CHBD 1I50B 1SYBA 3KLWA 4HMJA 5CV9A 3PIOA 5M3FH 1IXRA 1XNQL 4IO9A 3AQQA 2A8VA 2L9HA 1CK1A 3D4DA 1Y1VG 3EN2A 4NXML 2K5WA 2VW9A 5ELEA 2HHHQ 1ONLA 4DXFA 1WCMH 1CI3M 1K3BC 4M8AA 5KNDA 3N6RA 4A3IB 3H3VC 2A6HD 5M9OA 2EIFA 1HZAA 2EDGA 2F0DA 3PUYA 3ULLA 1VQKA 1BVSA 4ZUIA 3HFZB 1BCPC 2B63H 3A8JE 2ZJQA 1Q1BA 5C4XB 4JI2L 2WB1E 2Z1CA 2UUBQ 4K5XA 4S3SA 5G3LD 5IWAQ 2F0GA 2F0UA 4HJ7A 2OTJA 3M4OH 1ASZA 2B3GA 3K7AB 3AB9A 3A56A 1WD0A 4DR6L 4A75A 1JT8A 2VL6A 4A93G 1TR5A 4F7XA 4KKTA 3QR8A 5FLXL 3KOJA 3EFXD 3DEPA 1EYGA 4G7OC 4YWLA 1YHQA 5GROA 3F8TA 4LFAQ 5IGFA 1LTLA 4K8JA 4BWGB 4X62Q 3NELA 3CKIB 3AFPA 4LF6L 3FEWX 5J1ZA 1UEBA 1X55A 3ZYYX 3QIAA 1KRSA 3F2CA 1DGSA 4HCEA 1KL9A 2A5HA 3MHBA 3MWYW 2XNAC 4GLVB 1TXYA 4C1NK 4J6HA 4KHVA 4BBSG 3NBHB 1DD2A 5FLMH 2JA6G 1IKLA 3GTJB 3CC4A 2LXKA 1KLGD 1IHZA 1QUQA 1RHPA 1YNXA 4H44C 4PZ6A 3I55A 2XRQD 3I72A 3IFDA 1A6XA 3NWTA 3VYRA 1Y1WB 2NN6I 2ZJRA 2L55A 1N33Q 1VQFA 3M7GA 4L5SA 1N32Q 5CMDA 3KDFA 4OXPA 4DPGA 1D2BA 3MXNA 1QVFA 1VQHA 4AYBB 2ICEC 3EA6A 4IN3A 1JMCA 1Z9FA 2B2UA 4IPGA 4NW2A 2FHTA 2D0PA 4XYQA 3L2PA 4JBWA 2ZJPA 4U673 4IFDJ 4CKEA 1OXXK 1QNUA 4RHRA 4IPHA 4B3RL 1QILA 2OTLA 1S5CD 5C0XJ 3F2BA 4POFA 3PO3G 1D5ZC 1PH5A 2YTXA 1E3PA 1NSNS 3T53B 3SK8A 1EY7A 3S16H 1V43A 4ZQ3A 2EY6A 4IOCA 2F4VL 3GTPB 3JAML 1SYGA 2IX3A 1K8GA 1WJJA 4PMWA 4JG2A 2O5IC 3FVQA 1KC8C 4LFBQ 3K59A 2LKVA 3UDFA 3HOVG 3SK6A 2LMCB 4A3KB 3S2DH 1G6ZA 4A3MH 4JYAQ 1STAA 2ICIA 4MHEA 2I5HA 5D3IB 1I4GA 4GKKQ 1R4QB 1F2ZA 2FJ2A 4L8JA 4YCVA 1SNDA 3BDOA 4BY7B 4A3DG 1EZ6A 4JVZA 4OWWB 1NNXA 2CCZA 5IP9H 3A55A 5IYBG 1EIHA 3OWEB 1LT4D 4A3GH 4X66L 4EVOA 2HDMA 4DR4Q 2F0EA 4DK6C 1MSGA 2E5LL 3KUPA 2IW3A 4X3KA 2PW5A 4ZUJA 2QILA 5IYDH 3J80L 1SNQA 1STHA 5LMNQ 1AE2A 1I3QB 1OXVA 2I5LX 2J7ZA 4OX9L 3M7NA 3FKIG 4ZCKA 1IW7D 5IYDG 4X3UA 5DLQE 3PF4A 3OMGA 3NEMA 3HOWH 1Q3LA 2B2VA 1HJPA 1NR2A 4K2LA 3TP6A 3BU2A 3MXUA 1J5EQ 4DV5L 2IHFA 2WP8J 4IUNA 4IZ8A 4JI5L 4A3FG 1EU4A 4MTKA 3NENA 1O7ZA 5JVH3 1VF5C 1IBML 1CKNB 1CSPA 1Z47A 3OYYA 3WOEA 2L0CA 1EY5A 2Z4HA 1N34Q 3J7YW 1EY9A 3BVMA 3S1QB 2ES2A 4H02A 4A3LH 3HOYG 1DOMA 4APVA 1HZBA 2DN8A 4CDEC 1O7LA 1TWAH 1XTDA 4FYDA 5CGKA 2RHSB 3J7AF 2UXDL 3KK7A 3R2TA 1JWSD 4RH6A 3EROA 3WOFA 5C3EG 2RDFA 3I91A 1VQ6A 3QOJA 2Q8TA 1FVIA 4X6AH 1WTWA 2KVMA 3STBD 1HTLD 3TS0A 4C2MH 4OWTB 2UUAQ 4IFDG 5HY6A 3OW7A 4LK1C 1DOKA 4QCLA 1STEA 2WAQG 5C0XG 2XGTA 5ELDA 2E2HB 1STYA 1MJCA 1HZ9A 3QJYA 3DXJC 1G2SA 1X3QA 1F9PA 2EY2A 4PQXA 1DJRD 4YIJA 1I94L 3UDGA 2KHSA 3TQYA 2ATWA 2NB0A 2RBMA 3MA2B 2J4XA 3NTIA 1KNEA 1STNA 1TIID 4R4OA 4A3CG 1PTOB 4PV1C 1L2FA 1T5EA 3SDZA 4LUVA 1AEXA 1H9KA 4GLAC 1PHJA 3S2HH 1F2LA 3HOXH 1E1TA 1JJ2A 3TRZA 2FXQA 1SRUA 1KIXA 4C3IH 3TSSA 3LWEA 4BBRB 5C3WA 1VQ9A 3MFYA 3MFGA 2A74C 2PZTA 2E2DC 4YY3Q 3HOXG 1EYCA 4FF2A 4HMIA 1D8LA 5A2QE 2KA7A 2PI2E 3W2DA 4BXXG 3NQIA 2R93B 3SK5A 1HNWL 1HNZQ 2N78A 2CWAA 4B3TQ 4K5WA 3PQIA 5IIFA 2EVBA 2JA7G 4JOIC 2QEXA 1VQBA 3C1EA 3CAMA 5IGDA 3GTGB 2VQEQ 3K5OA 1EY6A 1X32A 1N8RC 3IRBA 4J8QA 2NZOA 1GJXA 2OEOA 1CZWA 2KCCA 5BR8L 3I4MH 1F2MA 5C44H 2DJGC 1B70B 5D65A 3D3RA 1TKWB 3L7ZC 4AH6A 1BKBA 1IL2A 1GD7A 1PH3A 2JA5H 4G7HC 3MXGA 1HPCA 1O80A 4WRDA 5J22A 5DM73 1NE3A 5FKAC 1CQFA 2HCCA 4ID6A 5J3BA 2VS1A 5C44G 1W6JA 5CV7A 4Y7NH 1CFMA 3I8ZA 2OT2A 1WTQA 2LFNA 2PZUA 3M4QA 2L11A 2RA4A 3CXCA 4YWKA 2PO4A 5ELNA 3UI2A 1ILQA 5I2XA 3FDTA 1KLUD 2JYOA 4R8IA 1TWCH 4DK3C 1TWFB 2E76C 2YU9B 2G9HD 1WTOA 2PQAA 4XDXA 3PUVA 4UPAA 3NP8A 2O2LD 3CMAA 2RSNA 2ZM6Q 3I3CA 5EPLA 2YYZA 4P71A 3NPPA 1HUMA 1Y1VB 1HR0L 1B8AA 2NN6G 2HD3A 5K5PA 2OWOA 5DNFA 4FVMA 4LW1A 4IPDA 1NY4A 5C5MA 2VUMG 2MUYA 3E0JA 1MJEA 2TMPA 2GN5A 2Z6KC 1XX8A 2ALYB 3S1NB 3GP7A 3J80E 4LNQA 2ZXOA 4JI4L 3GTOB 5KNBA 3KF6A 1PA6A 4K0KL 1LTRD 1LUZA 4QGUA 1KQSA 4DV2L 3PGZA 4A3EG 4DV1Q 3PMFA 4DV7Q 2WKDA 3T1YQ 5JEAH 4A3BH 2MFIA 4KK7A 5C4JH 2NVTB 3HEJA 2PQEA 1SE8A 4NXNQ 4A93B 3UE0A 1B1ZA 1Z7TA 2E74C 4B3SQ 2QF7A 4KHZA 4A3BG 5BN3A 3GV6A 2I07B 3TZDA 1I4RA 4XT3B 2HIVA 1LTGD 2N88A 4C3HH 4YHHL 2F0MA 4BY1H 4IUQA 4DV6L 1Q46A 2NWGA 3VR6A 3I70A 2QKIC 4G4KA 3U58A 1VMPA 1EL0A 5G3LF 1SJHD 1T9HA 3K0XA 4DR5Q 3S17H 4I65A 2R92H 4QUCA 5IYCG 4BBSB 4KKUA 3MEFA 4ALPA 3I73A 3ONAB 3PIO3 5CBAE 1AE3A 1V1QA 4RGOS 1D5MC 1WI5A 5JJZA 1EIYB 1PYSB 3AU7A 2JA6B 3RZDH 2ASBA 3H0GH 4RCOA 3W3AA 3SEBA 2VZAA 2EJGC 1IL8A 1KXLA 4NMZA 2EOTA 2HCIA 2X6LA 1K73C 3GTKB 1K0SA 2PNHA 2R92G 1CHQD 4HSPA 4HIDA 1S5FD 2F0QA 2Q2TA 4OO1H 1M90C 2DUDA 1NMGA 1QE6A 2WIIB 3Q23A 1ZEQX 4JC0A 5LL6S 2KJXA 4XYOA 2SDFA 3S1RH 3HOZH 1ML0D 2HIXA 2PMZE 2HHHL 2C5CA 1KAAA 3RNUA 4X3TA 2XVSA 1G91A 1GM5A 1MBYA 1ESRA 3PO3B 4TKOB 5KIXA 1TQOA 1H9SA 3HOZG 2L12A 1FNVA 4JBMA 4FXGC 1VQCA 1JE4A 4GOPB 1II3A 5JJIA 1LO5D 3KF8A 2EZVA 2UUBL 4JBJA 3HGBA 5C4ZA 5IWAL 3S14B 2NVYB 3CC7A 3I90A 3J7ZC 4XIGS 1I4HA 1TY2A 3HOVB 5ELOA 3TP7A 2L4NA 1Q12A 1JOKA 3HZXA 4B9WA 1BBWA 1YVCA 1PV4A 1YJWA 1JCKB 5HURA 5IGGA 5E1FA 1ICWA 3PO2H 2BE5D 4CDFC 2YTYA 4FF3A 3EVQA 4LFAL 1LT3D 2CW0C 1X6OA 3VR3A 3VA5A 4X62L 5CBEE 3AYHB 1ENFA 1PMRA 1AP0A 1A8VA 3KLSX 1QVCA 4A3DB 4QY7A 1BDOA 1E2WA 2F3WA 4GOPC 3EBEA 1GVPA 2PMZB 1SNMA 2N49A 1LACA 4K8IA 1JB7A 2Y0SE 1E24A 4YWMA 2ZT9C 3K6OA 1U0LA 4L63B 4DK1A 2A69C 1A2TA 2KEEA 2XSCA 5M3MB 4DR3Q 2CFMA 4RG1A 3I4NH 5NUCA 2EYHA 1KD1C 2YTVA 1JORA 3HRZC 5E4WC 3V05A 4HIMA 5IT9E 1N33L 3FKIB 1SLJA 1OO9B 4DKAC 1Y8NB 1L0WA 1N32L 1VS0A 3ER0A 2JA8G 3I4NG 5JVG3 3MXPA 2F0TA 3CMEA 4GN5A 1PH6A 2KHIA 3K57A 3Q24A 3FPPA 4JI0Q 2KCNA 3RMHA 5LL6X 1EUJA 4A3FB 4XTCS 1HR0W 1STGA 1U9RA 4KKSA 4QIWE 1KDBA 1QB5D 1SNCA 5M3FG 1CA5A 4UP7A 3F1ZA 1VQAA 3D6WA 3HP3A 1K3RA 5IODA 3VR2A 3HOYB 3C3LA 1K8MA 3M4YA 4CBVA 3U9SA 1R9TB 1WCMG 2Y0SB 2R6GA 3OTOQ 4LFBL 4HEDA 2E2IH 2IPKD 3GTQH 2RF4A 2F0PA 5C3EB 1UE1A 4DUZQ 3NXWA 4YCUA 4AYBE 1MD2D 4O1NA 2B63G 3GTMH 4JYAL 4HTHA 1Q8KA 2CQOA 2I0QA 4GKKL 1S5BD 3D31A 4XQJA 2HUGA 2VB3X 2WAQB 3X3NA 1I6HB 2AUJD 4QL5A 3L3OC 4PMBA 5M5XH 4GNXC 1WTHA 5EJWA 1PVOA 2RDGA 5T1GA 1S3OA 2RCFA 2FFKB 3A8IE 4DR4L 3LGJA 4IPCA 5KEEA 3PIPA 1WOCA 4P2CB 4LF8Q 2R7ZB 4C3JB 1WTRA 2LS01 2CH4A 2JN4A 4QIWB 5IGCA 1SNOA 4DNTB 1V1OA 2A68D 3C2PA 1PXUA 1KHIA 2V1CC 1TWGB 2SNSA 5LMNL 1W2BA 2KECA 3M3YH 2R7DA 4JI8Q 4RAUC 1X3PA 3NBIA 3NWSA 1FNUA 1EYAA 1S5DD 2XIWA 5C3XA 4X65Q 1Y69U 3I4LA 1XTCD 5A2QL 4ME3A 4JW0A 3W1GA 5ELBA 5FLMG 1J5EL 1IBKQ 1I5FA 2ZXPA 5CV4A 2UXCQ 2D2CC 2EE1A 1AN8A 1EWCA 2BDNA 4A3JB 4LJZC 3GTLB 2GA4B 1O7YA 3TEHB 3KJPA 4OWXB 2WKCA 2IX1A 4HN7A 1PYWD 3S1MB 5EGTA 3TREA 2A6HC 1CSQA 1Y8PB 1N34L 1SMXA 2JA7B 4JV5Q 4GKJQ 3HKZE 5GQOA 1L1OA 1V1PA 1SYCA 2D0OA 1CKOA 1FGUA 3JAMc 1JOQA 1XMQQ 4KN4C 2LY7A 2VQFQ 3OPOA 4IALA 3ZJYC 1H9MA 3E5SA 3AEVA 1MI2A 2B2YC 1A3UA 1B9NA 4ZKCB 2ZXRA 1L0XB 3O13A 4TSSA 3S14H 5M5WB 1K83B 2FMMA 3TP5A 4UP8A 2UUAL 4LF9Q 4NPSA 1ZXTA 5C4HA 5CV6A 1GHKA 1Q90A 2E2JH 3GO5A 4P72A 1V8QA 4QMGA 3E9IA 4MNOA 4PNYA 4B9XA 1JICA 5FOBB 2F3IA 3A8KE 4DR1Q 2B2WA 4PG3A 5HGQA 4A3MG 4ZAIA 1IBLQ 2RSOA 3RZOB 3ERQA 1DYQA 4HJ9A 2ID0A 1QZGA 2PI2A 2KOLA 2K03A 3HKSA 3HOUH 1X56A 5L37A 3ITPA 4JCVE 4XQQA 1I6VC 2OXPA 2HQEA 3BZKA 3N52A 5IP9G 1SE4A 4JI1Q 4FF4A 5IP7H 1O7IA 1K9MC 3HKZB 4A3GG 3JC66 1WYDA 5IE8A 5EPJA 4UP9A 1TWHB 3H3VH 4ABNA 3A5ZB 4QQBX 2VUMB 5ELFA 2XRSD 4DNIA 1NCVA 2E75C 5AFWA 2QW7A 3J81c 4UY8C 2CH4W 1N9WA 2K5DA 4DGZA 1B53A 1QNKA 1PFBA 1ZYRD 4YY3L 4OO1I 1PRTD 5I2YA 4A3EB 4M1UB 1I50H 1TU2B 3MVVA 4B3TL 5JAVA 1WTVA 4TRDA 4O42A 4KD3A 3HOWG 1DZ1A 3NQTA 3V96A 4DK0A 3FHWA 4AQYL 2K5NA 2DGYA 2Z8LA 4OIKA 1X65A 2X6GA 1XMOQ 4FP5D 1VQLA 2B2TC 2VQEL 1Y8OB 4HIOA 2IT1A 2NUCA 4A3IH 2CHBD 2G5DA 4LAAA 3U50C 1LYLA 3VYTA 2E8GA 1EWHA 1LTBD 4MIUA 1Q8IA 3CPWA 2IY5B 1J6QA 2NVQB 1LTAD 1SMYC 2IHEA 3NE5B 5C4XH 3CF5A 1YEZA 1XWEA 3ULPA 4A3LG 1QCBD 2FMCA 1PTOD 4CJ2C 3T4AC 3K7AH 4CJ1B 1LTSD 3M4PA 3OIQA 2N8NA 1UEAB 3PCOB 4RHSA 1QOHA 3NHHA 1VQ7A 1SBBB 5A35A 2C35B 4NP5A 4R9WA 1DCZA 5BN5A 1EIGA 1HH2P 3BDLA 2EYPA 2ZM6L 4LFCQ 3CQZB 2WINB 2P5ZX 4RWSC 1RKNA 3K7UC 2UXBQ 2SNMA 5AJ3Q 1GUOA 2Q8IB 1X3EA 1UE7A 1EY8A 2O4XA 3DHQA 1SNPA 4C3JH 5LMNW 5JEAJ 3C46A 1SYEA 2F4IA 4DR2Q 1YNJD 1M4VA 1SE2A 5DM63 1KTKA 3SE0A 4FXDA 1IW7C 1WFQA 2Q2UA 3GTJH 1SR3A 1YNNC 2XTIA 2B8GA 1BBXC 1Q82C 4DA2A 3RD4A 3NSWA 3L0OA 2F0WA 4DV1L 4DV7L 2UU9Q 4P74A 3T1YL 1Y1WH 3BVGA 1QUQB 2NBFA 4KTAA 3IL8A 1B2TA 2HT1A 2EYFA 3BDCA 4NXNL 4ZK9B 2R3ZA 2R7FA 4C3IG 2WB1G 2EYOA 1SFOB 4CDCC 4B3SL 1KDAA 3MXNB 1EQRA 5K36H 3F2UA 4IJHA 2M2LA 2F0JA 2IX0A 3CCVA 5DAUA 1T5XD 4DF7A 3PF5A 1MKHA 4IQZA 4JI6Q 2K28A 3P1HA 4KJNA 3BVZA 4KY7A 4L5TA 2K33A 2EYMA 4HJ8A 3GTPH 1O78A 2MJ8A 2UUCQ 4DR5L 1NBWA 4DXGA 1PFNA 2NZ1D 3STBC 5IT9L 4A3KH 3I4MG 2GVAA 2KCTA 1RJTA 1FGBD 1VQ8A 3SK4A 4CKCA 3DEOA 2JXMB 2B2UC 1IYUA 2MO1A 4YCWA 3TDQA 3H15A 2JA5G 2HDLA 2BDOA 3I4OA 1PFMA 1W3SA 2KUMA 1VQPA 1YZ6A 2EXDA 1HUNA 4BY7H 2L1BA 3D0FA 3BZDB 5I4DA 2JA8B 1PH2A 4H0LC 3NUCA 3FPUB 2EJFC 1LTID 2K5HA 4BS9A 4O2DA 1IZ6A 4R4IA 2F0VA 5KGUA 3Q6SA 4EQPA 2Q8RE 3PUXA 4LMQD 3OW2A 4JI7Q 5M3FB 2BH8A 1EU3A 3ERSX 3PUWA 1XJVA 2NYZD 1PZJD 5EKIA 1I3QH 4RKLA 1C8CA 4GN3B 1A3TA 3OIPA 5C6AA 1PH7A 1WCMB 1LT5D 4NKLA 3V2TA 2BA1A 3ND9A 3TBIB 4OHJA 1JQYD 3BS1A 1P8LA 1DONA 2B63B 1CUKA 2F0HA 4ODGA 2PW7A 4R4QA 4ULLA 1XPOA 2K50A 2RKSA 2EY1A 4DUYQ 1FJGQ 5JEAG 2C9OA 1GOZA 5TSSA 1X3GA 4DR7Q 2JEBI 3M4OB 1HFNA 1M8AA 1HTPA 3S1QH 1BXTA 2EXZA 2MO0A 3JAMi 3TS2A 4P73A 4BA1I 3CW2C 1RIPA 3RUZA 1EQVA 1A15A 2RHQB 3R3OA 4C3HG 3OHXC 2OCEA 4BY1G 3OSOA 3RLFA 4DR3L 1FL0A 3HS0C 3SXHA 2CW0D 1B4OA 4LF4Q 1YI2A 5KYIA 2B2VC 1JC7A 1EEID 1JJGA 3BJUA 1ET6A 3G71A 3A74A 1U4MA 3NBHA 1IYJB 1E7ZA 1XYIA 4K2KA 1LABA 4N9TA 1B3QA 1GUTA 1DM0B 2M00A 2E2HH 3H0GG 4CGYB 3GQBA 1XPUA 1N36Q 1UWVA 1TS2A 2A69D 1BBUA 4WJ4A 3SVMA 1G2TA 3E9HA 2ENBA 1EZ8A 3I56A 1BF4A 2Q2HA 4NDXA 4QF4A 4KD4A 4OO1G 3H3VI 3FP9A 1PTOH 3S15B 1KABA 2Z0SA 2AQ2B 1F9RA 1VQ5A 3J7A5 3A7AB 1YJ9A 1A63A 4LF7Q 1TS5A 5IY0A 3J81i 3OTOL 2TSSA 3VA7A 4GLXA 3M85A 4DV3Q 1JR0D 1HFGA 4BBRH 3QWNA 4R1JA 5FK9C 4DUZL 3UE1A 4EQOA 2JK8A 1SYFA 3KLRA 4K6DA 3AFQA 2ZTEA 1D5XC 5E3FA 3CCJA 4HJ5A 2R93H 1VQGA 1E2VA 3VYUA 3PIP3 4BBRG 4UDUC 3FMCA 4TQUS 5EQ0A 1SFOH 5M5YB 1B3AA 1BCPD 3J7AV 4H7BA 1EIFA 4X64Q 4A4IA 4KMUC 1EY0A 3T1HQ 3S2DB 1K0RA 3IFTA 3NTKA 1CHPD 3E6ZX 3GTGH 4A3MB 3PO2G 2FINB 1SXTA 3H94A 1H9JA 5FJ8H 1BO0A 4OEMB 3LX0A 5DEHA 4LF8L 4CKBA 4DV4Q 5GAGC 1OXTA 4KY5A 1WD1A 4CDDC 1X3FA 1ICFB 2B29A 1PLFA 1HNXQ 3S9WA 3G7LA 1C4QA 4WJ3M 2Z6BA 2Z9HA 5EBDA 4JI8L 3T51B 5FJ8G 4DU9A 3VDYA 4A3GB 3CRLC 3P7JA 2AQ3B 1HHVA 1AZPA 4X65L 1A2UA 4B3MQ 3IAYA 3DM1A 1EQTA 4HCSA 4U68A 1IBKL 3OWFA 4EQNA 3MAQA 2RQXA 5KNCA 2WAQE 2UXCL 1LLRD 1NR4A 1YHBA 1RD9D 3VYSA 4PZ8A 3H09A 1KNAA 1TWFH 2WFWA 3DWAA 2YU9H 2BH2A 3G6EA 4KHPQ 3SHLA 1B7YB 2KEDA 2EPBA 1CZGA 2PQAB 3HOWB 4POGA 1VCIA 2R61A 1JJCB 2XWBB 2K4KA 1Y1VH 4GKJL 4JV5L 3BG3A 2Q2IA 4GNXB 5GADC 1B44D 1CKNA 2NVXB 3S1NH 1XMQL 4ZYSA 1MSHA 2VQFL 2F03A 1D6EC 4KLKA 4ME5A 2N3SA 1TT2A 4JBKA 1PRTF 3OOCA 2RCNA 1F9QA 4F87A 3K80C 3GTOH 1VQNA 4LF5Q 4B08A 5CR3A 1S40A 2H1EA 4JI3Q 4LF9L 3KF6B 2QEJC 2NVTH 1TWAB 1M1KC 2BE5C 5JPNC 5KYLA 5FLXc 4A93H 3Q22A 1YITA 4PMCA 1X54A 2MP1A 4JK1C 4FNFA 4DR1L 2AWOA 3M9BA 4Q0FA 2KQ3A 2F0IA 3GD7A 1XNRQ 3D8GA 4HSVA 2K5QA 4P75A 2F0FA 1H9RA 1GHJA 1QWYA 1IBLL 4C2MB 4F8MA 3VR4A 4J15A 2DNCA 1ET9A 1OXUA 4UHVA 3B6YA 5EBCA 1F9SA 2AQ1B 2JEAI 4WORA 5I9PA 3KJOA 1PTOF 4JI1L 1FD7D 3U9OA 1GXDC 2F0KA 1BR9A 3K0YA 2F1MA 3WDNA 4BBSH 1VQOA 1TS4A 3LNNA 3CPFA 1TS3A 4JOIA 1BNZA 3A0JA 1KAWA 2JA6H 4LUZA 2LSSA 3S24A 2A6EC 3GV3A 5D14A 1C48A 3D4WA 2IWHA 4DAYB 3GTKH 4XQNA 3S2HB 1GUNA 5EPKA 5HGTA 2KHJA 3HOXB 1GUSA 1EOVA 5FO9B 2CKZB 4OGQC 4DFAA 3H91A 5LMUQ 1JWMD 3R2IA 4RFBA 4DV0Q 1DXMA 2EYLA 4C3IB 1PZKD 2WB1B 2YV5A 4RCNA 1XMOL 1I4XA 3EQLC 3KLSA 1RCVD 2MPMA 1ILPA 1LTTD 1S4ZA 1SDFA 2WACA 1UE6A 3EJIA 1I4PA 5GAEC 3S15H 1PDQA 3Q8DA 2BOSA 4I7AA 3PO3H 4LUOA 3DUZA 4A76A 4IOAA 2WV6D 3A54A 3K5NA 4NB3A 1XNQQ 3Q0AA 4FXKC 1H9SB 5J39A 2F0OA 4NXMQ 3DWQA 4ZRZA 1RTOA 1S72A 2NVYH 1HA6A 4GN4B 4N8X1 3A7LA 3KF8B 4DAVA 3DLLA 5I9OA 1SN8A 4K5VA 3HOVH 4EQ5A 1B9MA 1VF7A 3WWVA 2K14A 3I4MB 1IKMA 1QZHA 1D7QA 1V9PA 5C44B 3NTHA 3OMCA 2VXWA 3PSIA 4MN3A 4Z9CB 2Z6KA 1U5KA 3QOLA 4QUFA 4JI2Q 3CC2A 1SMYD 5M5YH 1E1OA 2JA5B 4R8NA 1SSOA 4G57A 4EX5A 4HIKA 2QDBA 4LFCL 2IJ0A 4RA8A 1NMFA 1STBA 2K7VA 4Y7NB 2A19A 3TP8A 4DR6Q 4A3DH 2UXBL 5AJ3L 2K6AA 5IYBH 3CD6A 5FO8B 2A68C 1EWIA 3MEHA 3ND8A 4WJWA 5CYUA 4DR2L 3K81C 1TWCB 5CV8A 3J80c 3L9AX 2K75A 4RGTA 4KI0A 4KJOA 4LF6Q 5M3MH 1VMCA 3HOUG 4GZYC 1E0BA 3EIVA 1W6KA 2QGQA 5CORA 5H1SE 5IP7G 5BN4A 2UU9L 1GUGA 2QCPX 3CCRA 1SROA 3DMUA 3FKIH 2MQHA 4I7ZC 3CCQA 4R4TA 1HA5A 1HRJA 3T13A 5M3MG 4DNRB 4OL7A 3K58A 1KDCA 1CA6A 1HNZL 5IGBA 3RLOA 2DY8A 3RLNA 3NK9A 2K32A 4MZ9A 5E4XA 3J81L 4A3FH 3PUZA 1OTCA 1YNND 4O0AA 3G48A 3CCMA 4IUPA 3MTSA 4A3BB 5C4JB 1G8ZD 4HJAA 1C7YA 1E22A 4JI6L 4ILWA 1SJED 4K6LA 2OQKA
chains in the Genus database with same CATH topology
4JBJA 1VQPA 1YZ6A 5IWAL 1KRSA 1PFSA 2EXDA 3F2CA 4BY7H 3D0FA 1DGSA 3J7ZC 1KL9A 3CC7A 1PH2A 1KRTA 2NVXH 2AWNA 3HOYH 2UUCL 4DAMA 4XIGS 2JE6I 4GLVB 1TXYA 5ELOA 1R9TH 4BBSG 1Q12A 4B3RQ 2K5HA 3NBHB 1BBWA 1YVCA 4A3IG 1PV4A 3RN5A 4O2DA 1IZ6A 4R4IA 5FLMH 1YJWA 2JA6G 3UDXA 3PO2H 3CC4A 2LXKA 5C3EH 1QUQA 1YNXA 2YTYA 4PZ6A 3PUXA 3OW2A 1LM0A 4JI7Q 4LFAL 2LXJA 3I55A 1X6OA 2BH8A 4X62L 3ERSX 2Y0SG 1PYBA 3PUWA 5C4XG 2F4VQ 1XJVA 3AYHB 2NN6I 2ZJRA 1N33Q 1A8VA 1I3QH 1QVCA 1VQFA 4L5SA 1N32Q 4QY7A 3KDFA 4OXPA 4DPGA 1QVFA 4GN3B 4GOPC 1VQHA 3EBEA 3U4VA 1PH7A 1JMCA 1GVPA 1Z9FA 4IPGA 1PH1A 1I6HH 3L2PA 2D0PA 2N49A 1JB7A 4JBWA 2ZJPA 2BA1A 2Y0SE 1E24A 2I5MX 4YWMA 3SGIA 4IFDJ 1OXXK 1U0LA 4IPHA 4B3RL 3K8AA 2OTLA 2VNUD 5C0XJ 3F2BA 1P8LA 4POFA 3PO3G 1PH5A 2YTXA 1CUKA 1E3PA 1P16A 2CFMA 2L15A 4RG1A 4DR3Q 2R7ZH 3I4NH 4R4QA 1XPOA 2K50A 4DUYQ 1KD1C 5JEAG 4JI7L 1V43A 1FJGQ 2YTVA 3S16H 4A3CH 1TWGH 1X3GA 2JEBI 4HIMA 4IOCA 2F4VL 4DR7Q 1N33L 1SLJA 1A62A 4DKAC 1L0WA 1N32L 1K8GA 1VS0A 1YIJA 1WJJA 3S1QH 4PMWA 3ER0A 4JG2A 3F2DA 2JA8G 3I4NG 2R7ZG 1KC8C 4X66Q 3CMEA 4GN5A 2MO0A 3JAMi 2MNAA 2F52A 4LFBQ 3TS2A 3UDFA 2QA4A 1PH6A 2KHIA 4P73A 4BA1I 2E5LQ 1FJGL 3HOVG 4R4CA 3CW2C 1RIPA 4JI0Q 3S2DH 3UDIA 4GOPA 1EUJA 4XTCS 1Q1EA 2RHQB 2VY3A 1HR0W 2OCEA 4A3MH 4JYAQ 4BY1G 2AHOB 2I5HA 3RLFA 4A3JH 4DR3L 2KENA 1FL0A 1QVGA 4GKKQ 4QIWE 3GTLH 4LF4Q 3KDFB 5M3FG 1YI2A 4BXXH 4UP7A 4DUYL 3F1ZA 1UE5A 1VQAA 3BJUA 4YCVA 5EAYA 3G71A 1Y1WG 4OX9Q 3A74A 1K3RA 4DR7L 4A3DG 3S1MH 1IYJB 1E7ZA 4OWWB 2CCZA 5IP9H 5IYBG 4LWCA 4AYBG 4A3JG 4A3GH 1WCMG 2R6GA 3OTOQ 3G4SA 4X66L 4RMFA 2JA7H 4DV5Q 4LFBL 2E2IH 5JJLA 4DR4Q 4DK6C 2E2HH 2E5LL 1JE5A 5K36G 3H0GG 1G51A 3GTQH 2RF4A 4JI5Q 1XPUA 1N36Q 1UWVA 1UE1A 4DUZQ 1BBUA 3CCUA 3W5OA 4WJ4A 5IYDH 1L1OB 3S17H 3E9HA 1EFWA 4YCUA 4AYBE 4JYAL 2B63G 3GTMH 3I56A 3I7FA 1Q8KA 4AQYQ 2CQOA 2Q2HA 5LMNQ 1IBMQ 1AE2A 2I0QA 4GKKL 1OXVA 2I5LX 4LF4L 1G291 3D31A 1OXSC 5M5WH 1K83H 5IT9c 3H3VI 4OO1G 3FP9A 4OX9L 3M7NA 2Z0SA 3FKIG 1YJNA 2JJQA 5IYDG 3PF4A 5DLQE 1NTGA 1VQ5A 3J7A5 4QL5A 3NEMA 3HOWH 1A63A 1YJ9A 4LF7Q 1YBYA 1HJPA 5M5XH 5IY0A 4GNXC 3J81i 1GKHA 3OTOL 3BU2A 1J5EQ 4GS3A 1PVOA 2UXDQ 4DV5L 2IHFA 1S3OA 2K5VA 2WP8J 4GLXA 4DR4L 3M85A 4A3KG 3LGJA 4IPCA 4DV3Q 3PIPA 1WOCA 4BBRH 4JI5L 4A3FG 4LF8Q 4R1JA 1N36L 2NZHA 4DUZL 3NENA 3UE1A 2JK8A 3ICEA 3RZOH 1C0AA 3AFQA 2ZTEA 1KHIA 2HQLA 2V1CC 1IBML 1CKNB 1CSPA 5LMNL 3CCJA 1Z47A 1L1OC 4HJ5A 2JQOA 3OYYA 1VQGA 1W2BA 2R93H 1GO3E 3M3YH 2R7DA 2KBNA 4JI8Q 1N34Q 4BY7G 3PV0A 4BBRG 2ES2A 4H02A 4TQUS 1SFOH 4A3LH 3HOYG 1Q7YC 4APVA 1HZBA 4X65Q 1EIFA 4X64Q 4ME3A 1TWAH 4A4IA 1XTDA 3T1HQ 4LF7L 1TWHH 1K0RA 3W1GA 2VUMH 2RHSB 5FLMG 1J5EL 1IBKQ 2UXDL 3GTGH 1I5FA 3GDEA 2UXCQ 3KYHC 1I94Q 3PO2G 4DV3L 5C3EG 5FJ8H 1VQ6A 4LF8L 4GNXA 2KCMA 1FVIA 4X6AH 3HKZG 4OONA 3TEHB 3KJPA 4OWXB 4DV4Q 3STBD 5GAGC 1OXTA 3TS0A 4C2MH 1X3FA 4OWTB 2UUAQ 2IX1A 2B29A 4IFDG 5HY6A 5E7NA 4A3EH 3TREA 1HNXQ 4WJ3M 1CSQA 4JI8L 2WAQG 1N34L 5FJ8G 1VQIA 5C0XG 3VDYA 1SMXA 2XGTA 4JV5Q 4GKJQ 3HKZE 5GQOA 1L1OA 4X65L 4B3MQ 4X64L 2D0OA 1MJCA 1HZ9A 3T1HL 1CKOA 1FGUA 3JAMc 2BA0A 1XMQQ 1VQ4A 2VQFQ 1IBKL 2AMCB 3ZJYC 1A0IA 2WAQE 2UXCL 1YHBA 3CCEA 3UDGA 1I94L 4PZ8A 3AEVA 3TQYA 2EQSA 2ATWA 1XPRA 3ULJA 3S14H 1TWFH 2WFWA 2YU9H 2BH2A 4R4OA 4A3CG 1HNWQ 3G6EA 4DV4L 4KHPQ 1L2FA 2NVQH 1K8AC 1B7YB 4QJFA 4UP8A 2UUAL 4LF9Q 4LUVA 4NPSA 3S2HH 1PHJA 4GLAC 1HNXL 2PQAB 4POGA 1VCIA 3HOXH 1JJGA 1E1TA 2E2JH 2D62A 3GO5A 1JJCB 4IJLA 4P72A 1JJ2A 2K4KA 3TRZA 1Y1VH 3E9IA 4MNOA 4GKJL 4JV5L 2Q2IA 2FXQA 1SRUA 4DR1Q 2F3IA 5IYCH 1KIXA 4B3ML 1H95A 2H5XA 4C3IH 1VQ9A 4GNXB 5GADC 4PG3A 1CKNA 5HGQA 4A3MG 1YHAA 1XMQL 5BR8Q 3S1NH 4YY3Q 2VQFL 2GVBA 1IBLQ 3HOXG 4KLKA 1D8LA 2N3SA 4JBKA 2PI2E 2RCNA 4HJ9A 1Y14B 3K80C 3GTOH 4BXXG 2ID0A 4LF5Q 1VQNA 1QZGA 2PI2A 1S40A 3HKSA 3HOUH 1X56A 3BZCA 1HNZQ 1HNWL 4JCVE 2N78A 2CWAA 4B3TQ 4JI0L 4JI3Q 4KHPL 4LF9L 3KF6B 3BZKA 5IP9G 4JI1Q 4FDBA 3CQZH 5IP7H 1O7IA 1K9MC 1PH9A 2NVTH 4A3GG 3JC66 1M1KC 1WYDA 5IE8A 2JA7G 4JOIC 4UP9A 2QEXA 1VQBA 3H3VH 3A5ZB 4QQBX 5FLXc 2AKWB 3CAMA 4BA2I 3J80i 4DNIA 4A93H 2VQEQ 1YITA 1X54A 1X9NA 1NJIC 4DR1L 3IRBA 1N8RC 3J81c 2AWOA 4UY8C 2JA9A 3E0EA 3M9BA 4PZ7A 1N9WA 1XNRQ 2NZOA 3GD7A 4P75A 5GAHC 5BR8L 3I4MH 4YY3L 4Y52H 1IBLL 5C44H 4OO1I 2ZTCA 1B70B 3KFUA 1EQQA 4J15A 3RN2A 1I50H 1OXUA 4LF5L 3L7ZC 4AH6A 1BKBA 1IL2A 1GD7A 3B6YA 4L5QA 1PH3A 2JA5H 4JI3L 4B3TL 3RR5A 2JEAI 1HR0Q 1NE3A 3KJOA 5J3BA 3HOWG 4AIMA 4JI1L 2VS1A 5C44G 3FHWA 4Y7NH 4AQYL 2K5NA 2DGYA 3M4QA 1VQJA 1X65A 1XMOQ 1VQLA 3A5UA 1HZCA 3CXCA 2VQEL 4HIOA 1VQOA 4YWKA 4BBSH 5ELNA 2IT1A 2CWPA 4A3IH 4JI4Q 3CPFA 1TWCH 4JOIA 4DK3C 3A0JA 1KAWA 3CP0A 1XNRL 2JA6H 1G6PA 3U50C 4LUZA 2LSSA 1LYLA 3S24A 4K0KQ 1RL2A 2E8GA 2PQAA 4L5RC 4DV2Q 1AH9A 3CPWA 3PUVA 2IY5B 1J6QA 2R93G 2IHEA 4UPAA 4DAYB 3CMAA 3GTKH 2ZM6Q 2YYZA 1PH8A 2KHJA 5C4XH 3CF5A 1YEZA 3I2ZA 4P71A 1PH4A 3ULPA 4A3LG 1EOVA 2K52A 1ASYA 2CKZB 1HR0L 1B8AA 2NN6G 5LMUQ 2OWOA 4LW1A 3K7AH 4IPDA 1NY4A 2A1AA 4DV0Q 3M4PA 3W1BA 2VUMG 2YV5A 4MTNA 2N8NA 1MJEA 2Z6KC 2GN5A 2ALYB 1XMOL 3PCOB 1MIUA 3CCLA 4LNQA 1VQ7A 4YHHQ 1UE6A 4JI4L 3J81j 5GAEC 4DV6Q 4IFDI 3KF6A 1PA6A 3S15H 3Q8DA 3PO3H 4K0KL 1CKMA 1LUZA 2C35B 4LUOA 4QGUA 1KQSA 2OQ0A 4DV2L 3PGZA 4A76A 4A3EG 4DV1Q 4IOAA 4DV7Q 1HH2P 5C0XI 1Q81C 1Q86C 4NB3A 3T1YQ 4A3BH 2ZM6L 2ZTDA 2MFIA 4LFCQ 1XNQQ 5C4JH 3K7UC 4NXMQ 2UXBQ 5AJ3Q 1SE8A 4NXNQ 1X3EA 1UE7A 1S72A 2NVYH 3DM3A 1VQDA 5LMUL 3UE0A 4GN4B 2JA8H 4C3JH 5LMNW 5JEAJ 3KF8B 3DLLA 4DV0L 4B3SQ 4DR2Q 1SN8A 3HOVH 3CCSA 4KHZA 4EQ5A 4A3BG 5JJKA 1VQMA 3WWVA 2K14A 1QZHA 1D7QA 1V9PA 2HIVA 4C3HH 1C9OA 3PSIA 3U4ZA 4TVAB 1VQEA 1WFQA 4YHHL 3GTJH 4DV6L 1Q46A 1SR3A 2XTIA 2Q2UA 4BY1H 2Z6KA 1U5KA 1Q82C 4JI2Q 3CC2A 3KLWA 5M5YH 1E1OA 3L0OA 3PIOA 5M3FH 4DV1L 4DV7L 3U58A 2UU9Q 4EX5A 4P74A 4HIKA 3T1YL 1Y1WH 1IXRA 4LFCL 1XNQL 1QUQB 4IO9A 1NMFA 3AQQA 1T9HA 2A19A 3K0XA 4DR5Q 2A8VA 1Y1VG 3EN2A 4NXML 2HT1A 5AJ3L 4DR6Q 4A3DH 2UXBL 5IYBH 2VW9A 4NXNL 3CD6A 2HHHQ 2R92H 2R7FA 5IYCG 1WCMH 3MEFA 1EWIA 2WB1G 4ALPA 4B3SL 3MXNB 1AE3A 1V1QA 2EIFA 3K81C 1HZAA 1WI5A 4DR2L 1PYSB 3J80c 1EQRA 1EIYB 3RZDH 2ASBA 3H0GH 3PUYA 4IJHA 3ULLA 2IX0A 3CCVA 1BVSA 1VQKA 2K75A 4KI0A 2VZAA 1KXLA 3HFZB 4LF6Q 1K73C 5M3MH 2PNHA 2B63H 2R92G 3PF5A 2ZJQA 3HOUG 1Q1BA 4HIDA 1MKHA 4JI2L 2WB1E 4JI6Q 3EIVA 2UUBQ 2QGQA 2Q2TA 5IWAQ 4L5TA 1M90C 5IP7G 5H1SE 2UU9L 2DUDA 4HJ7A 1NMGA 4HJ8A 3GTPH 1ASZA 2B3GA 3M4OH 3CCRA 1SROA 2OTJA 3FKIH 2MQHA 3CCQA 2UUCQ 4R4TA 4JC0A 4DR5L 4DR6L 4A75A 1JT8A 2VL6A 3S1RH 3HOZH 1NBWA 5M3MG 4A93G 2HIXA 2PMZE 2HHHL 3RNUA 3STBC 1HNZL 3RLOA 1GM5A 3KOJA 3RLNA 4A3KH 3I4MG 4MZ9A 1EYGA 4YWLA 1YHQA 5GROA 4A3FH 3PUZA 2GVAA 2KCTA 1OTCA 3F8TA 1VQ8A 4O0AA 4LFAQ 1LTLA 3G48A 3HOZG 4X62Q 3CCMA 4JBMA 3NELA 1VQCA 3AFPA 4LF6L 4GOPB 2MO1A 1UEBA 4YCWA 3H15A 1X55A 2JA5G 4HJAA 1C7YA 5JJIA 3I4OA 1E22A 4JI6L 1W3SA 2OQKA 2UUBL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JBJ A;  1VQP A;  1YZ6 A;  5IWA L;  1KRS A;  1PFS A;  2EXD A;  3F2C A;  4BY7 H;  3D0F A;  1DGS A;  3J7Z C;  1KL9 A;  3CC7 A;  1PH2 A;  1KRT A;  2NVX H;  2AWN A;  3HOY H;  2UUC L;  4DAM A;  4XIG S;  2JE6 I;  4GLV B;  1TXY A;  5ELO A;  1R9T H;  4BBS G;  1Q12 A;  4B3R Q;  2K5H A;  3NBH B;  1BBW A;  1YVC A;  4A3I G;  1PV4 A;  3RN5 A;  4O2D A;  1IZ6 A;  4R4I A;  5FLM H;  1YJW A;  2JA6 G;  3UDX A;  3PO2 H;  3CC4 A;  2LXK A;  5C3E H;  1QUQ A;  1YNX A;  2YTY A;  4PZ6 A;  3PUX A;  3OW2 A;  1LM0 A;  4JI7 Q;  4LFA L;  2LXJ A;  3I55 A;  1X6O A;  2BH8 A;  4X62 L;  3ERS X;  2Y0S G;  1PYB A;  3PUW A;  5C4X G;  2F4V Q;  1XJV A;  3AYH B;  2NN6 I;  2ZJR A;  1N33 Q;  1A8V A;  1I3Q H;  1QVC A;  1VQF A;  4L5S A;  1N32 Q;  4QY7 A;  3KDF A;  4OXP A;  4DPG A;  1QVF A;  4GN3 B;  4GOP C;  1VQH A;  3EBE A;  3U4V A;  1PH7 A;  1JMC A;  1GVP A;  1Z9F A;  4IPG A;  1PH1 A;  1I6H H;  3L2P A;  2D0P A;  2N49 A;  1JB7 A;  4JBW A;  2ZJP A;  2BA1 A;  2Y0S E;  1E24 A;  2I5M X;  4YWM A;  3SGI A;  4IFD J;  1OXX K;  1U0L A;  4IPH A;  4B3R L;  3K8A A;  2OTL A;  2VNU D;  5C0X J;  3F2B A;  1P8L A;  4POF A;  3PO3 G;  1PH5 A;  2YTX A;  1CUK A;  1E3P A;  1P16 A;  2CFM A;  2L15 A;  4RG1 A;  4DR3 Q;  2R7Z H;  3I4N H;  4R4Q A;  1XPO A;  2K50 A;  4DUY Q;  1KD1 C;  5JEA G;  4JI7 L;  1V43 A;  1FJG Q;  2YTV A;  3S16 H;  4A3C H;  1TWG H;  1X3G A;  2JEB I;  4HIM A;  4IOC A;  2F4V L;  4DR7 Q;  1N33 L;  1SLJ A;  1A62 A;  4DKA C;  1L0W A;  1N32 L;  1K8G A;  1VS0 A;  1YIJ A;  1WJJ A;  3S1Q H;  4PMW A;  3ER0 A;  4JG2 A;  3F2D A;  2JA8 G;  3I4N G;  2R7Z G;  1KC8 C;  4X66 Q;  3CME A;  4GN5 A;  2MO0 A;  3JAM i;  2MNA A;  2F52 A;  4LFB Q;  3TS2 A;  3UDF A;  2QA4 A;  1PH6 A;  2KHI A;  4P73 A;  4BA1 I;  2E5L Q;  1FJG L;  3HOV G;  4R4C A;  3CW2 C;  1RIP A;  4JI0 Q;  3S2D H;  3UDI A;  4GOP A;  1EUJ A;  4XTC S;  1Q1E A;  2RHQ B;  2VY3 A;  1HR0 W;  2OCE A;  4A3M H;  4JYA Q;  4BY1 G;  2AHO B;  2I5H A;  3RLF A;  4A3J H;  4DR3 L;  2KEN A;  1FL0 A;  1QVG A;  4GKK Q;  4QIW E;  3GTL H;  4LF4 Q;  3KDF B;  5M3F G;  1YI2 A;  4BXX H;  4UP7 A;  4DUY L;  3F1Z A;  1UE5 A;  1VQA A;  3BJU A;  4YCV A;  5EAY A;  3G71 A;  1Y1W G;  4OX9 Q;  3A74 A;  1K3R A;  4DR7 L;  4A3D G;  3S1M H;  1IYJ B;  1E7Z A;  4OWW B;  2CCZ A;  5IP9 H;  5IYB G;  4LWC A;  4AYB G;  4A3J G;  4A3G H;  1WCM G;  2R6G A;  3OTO Q;  3G4S A;  4X66 L;  4RMF A;  2JA7 H;  4DV5 Q;  4LFB L;  2E2I H;  5JJL A;  4DR4 Q;  4DK6 C;  2E2H H;  2E5L L;  1JE5 A;  5K36 G;  3H0G G;  1G51 A;  3GTQ H;  2RF4 A;  4JI5 Q;  1XPU A;  1N36 Q;  1UWV A;  1UE1 A;  4DUZ Q;  1BBU A;  3CCU A;  3W5O A;  4WJ4 A;  5IYD H;  1L1O B;  3S17 H;  3E9H A;  1EFW A;  4YCU A;  4AYB E;  4JYA L;  2B63 G;  3GTM H;  3I56 A;  3I7F A;  1Q8K A;  4AQY Q;  2CQO A;  2Q2H A;  5LMN Q;  1IBM Q;  1AE2 A;  2I0Q A;  4GKK L;  1OXV A;  2I5L X;  4LF4 L;  1G29 1;  3D31 A;  1OXS C;  5M5W H;  1K83 H;  5IT9 c;  3H3V I;  4OO1 G;  3FP9 A;  4OX9 L;  3M7N A;  2Z0S A;  3FKI G;  1YJN A;  2JJQ A;  5IYD G;  3PF4 A;  5DLQ E;  1NTG A;  1VQ5 A;  3J7A 5;  4QL5 A;  3NEM A;  3HOW H;  1A63 A;  1YJ9 A;  4LF7 Q;  1YBY A;  1HJP A;  5M5X H;  5IY0 A;  4GNX C;  3J81 i;  1GKH A;  3OTO L;  3BU2 A;  1J5E Q;  4GS3 A;  1PVO A;  2UXD Q;  4DV5 L;  2IHF A;  1S3O A;  2K5V A;  2WP8 J;  4GLX A;  4DR4 L;  3M85 A;  4A3K G;  3LGJ A;  4IPC A;  4DV3 Q;  3PIP A;  1WOC A;  4BBR H;  4JI5 L;  4A3F G;  4LF8 Q;  4R1J A;  1N36 L;  2NZH A;  4DUZ L;  3NEN A;  3UE1 A;  2JK8 A;  3ICE A;  3RZO H;  1C0A A;  3AFQ A;  2ZTE A;  1KHI A;  2HQL A;  2V1C C;  1IBM L;  1CKN B;  1CSP A;  5LMN L;  3CCJ A;  1Z47 A;  1L1O C;  4HJ5 A;  2JQO A;  3OYY A;  1VQG A;  1W2B A;  2R93 H;  1GO3 E;  3M3Y H;  2R7D A;  2KBN A;  4JI8 Q;  1N34 Q;  4BY7 G;  3PV0 A;  4BBR G;  2ES2 A;  4H02 A;  4TQU S;  1SFO H;  4A3L H;  3HOY G;  1Q7Y C;  4APV A;  1HZB A;  4X65 Q;  1EIF A;  4X64 Q;  4ME3 A;  1TWA H;  4A4I A;  1XTD A;  3T1H Q;  4LF7 L;  1TWH H;  1K0R A;  3W1G A;  2VUM H;  2RHS B;  5FLM G;  1J5E L;  1IBK Q;  2UXD L;  3GTG H;  1I5F A;  3GDE A;  2UXC Q;  3KYH C;  1I94 Q;  3PO2 G;  4DV3 L;  5C3E G;  5FJ8 H;  1VQ6 A;  4LF8 L;  4GNX A;  2KCM A;  1FVI A;  4X6A H;  3HKZ G;  4OON A;  3TEH B;  3KJP A;  4OWX B;  4DV4 Q;  3STB D;  5GAG C;  1OXT A;  3TS0 A;  4C2M H;  1X3F A;  4OWT B;  2UUA Q;  2IX1 A;  2B29 A;  4IFD G;  5HY6 A;  5E7N A;  4A3E H;  3TRE A;  1HNX Q;  4WJ3 M;  1CSQ A;  4JI8 L;  2WAQ G;  1N34 L;  5FJ8 G;  1VQI A;  5C0X G;  3VDY A;  1SMX A;  2XGT A;  4JV5 Q;  4GKJ Q;  3HKZ E;  5GQO A;  1L1O A;  4X65 L;  4B3M Q;  4X64 L;  2D0O A;  1MJC A;  1HZ9 A;  3T1H L;  1CKO A;  1FGU A;  3JAM c;  2BA0 A;  1XMQ Q;  1VQ4 A;  2VQF Q;  1IBK L;  2AMC B;  3ZJY C;  1A0I A;  2WAQ E;  2UXC L;  1YHB A;  3CCE A;  3UDG A;  1I94 L;  4PZ8 A;  3AEV A;  3TQY A;  2EQS A;  2ATW A;  1XPR A;  3ULJ A;  3S14 H;  1TWF H;  2WFW A;  2YU9 H;  2BH2 A;  4R4O A;  4A3C G;  1HNW Q;  3G6E A;  4DV4 L;  4KHP Q;  1L2F A;  2NVQ H;  1K8A C;  1B7Y B;  4QJF A;  4UP8 A;  2UUA L;  4LF9 Q;  4LUV A;  4NPS A;  3S2H H;  1PHJ A;  4GLA C;  1HNX L;  2PQA B;  4POG A;  1VCI A;  3HOX H;  1JJG A;  1E1T A;  2E2J H;  2D62 A;  3GO5 A;  1JJC B;  4IJL A;  4P72 A;  1JJ2 A;  2K4K A;  3TRZ A;  1Y1V H;  3E9I A;  4MNO A;  4GKJ L;  4JV5 L;  2Q2I A;  2FXQ A;  1SRU A;  4DR1 Q;  2F3I A;  5IYC H;  1KIX A;  4B3M L;  1H95 A;  2H5X A;  4C3I H;  1VQ9 A;  4GNX B;  5GAD C;  4PG3 A;  1CKN A;  5HGQ A;  4A3M G;  1YHA A;  1XMQ L;  5BR8 Q;  3S1N H;  4YY3 Q;  2VQF L;  2GVB A;  1IBL Q;  3HOX G;  4KLK A;  1D8L A;  2N3S A;  4JBK A;  2PI2 E;  2RCN A;  4HJ9 A;  1Y14 B;  3K80 C;  3GTO H;  4BXX G;  2ID0 A;  4LF5 Q;  1VQN A;  1QZG A;  2PI2 A;  1S40 A;  3HKS A;  3HOU H;  1X56 A;  3BZC A;  1HNZ Q;  1HNW L;  4JCV E;  2N78 A;  2CWA A;  4B3T Q;  4JI0 L;  4JI3 Q;  4KHP L;  4LF9 L;  3KF6 B;  3BZK A;  5IP9 G;  4JI1 Q;  4FDB A;  3CQZ H;  5IP7 H;  1O7I A;  1K9M C;  1PH9 A;  2NVT H;  4A3G G;  3JC6 6;  1M1K C;  1WYD A;  5IE8 A;  2JA7 G;  4JOI C;  4UP9 A;  2QEX A;  1VQB A;  3H3V H;  3A5Z B;  4QQB X;  5FLX c;  2AKW B;  3CAM A;  4BA2 I;  3J80 i;  4DNI A;  4A93 H;  2VQE Q;  1YIT A;  1X54 A;  1X9N A;  1NJI C;  4DR1 L;  3IRB A;  1N8R C;  3J81 c;  2AWO A;  4UY8 C;  2JA9 A;  3E0E A;  3M9B A;  4PZ7 A;  1N9W A;  1XNR Q;  2NZO A;  3GD7 A;  4P75 A;  5GAH C;  5BR8 L;  3I4M H;  4YY3 L;  4Y52 H;  1IBL L;  5C44 H;  4OO1 I;  2ZTC A;  1B70 B;  3KFU A;  1EQQ A;  4J15 A;  3RN2 A;  1I50 H;  1OXU A;  4LF5 L;  3L7Z C;  4AH6 A;  1BKB A;  1IL2 A;  1GD7 A;  3B6Y A;  4L5Q A;  1PH3 A;  2JA5 H;  4JI3 L;  4B3T L;  3RR5 A;  2JEA I;  1HR0 Q;  1NE3 A;  3KJO A;  5J3B A;  3HOW G;  4AIM A;  4JI1 L;  2VS1 A;  5C44 G;  3FHW A;  4Y7N H;  4AQY L;  2K5N A;  2DGY A;  3M4Q A;  1VQJ A;  1X65 A;  1XMO Q;  1VQL A;  3A5U A;  1HZC A;  3CXC A;  2VQE L;  4HIO A;  1VQO A;  4YWK A;  4BBS H;  5ELN A;  2IT1 A;  2CWP A;  4A3I H;  4JI4 Q;  3CPF A;  1TWC H;  4JOI A;  4DK3 C;  3A0J A;  1KAW A;  3CP0 A;  1XNR L;  2JA6 H;  1G6P A;  3U50 C;  4LUZ A;  2LSS A;  1LYL A;  3S24 A;  4K0K Q;  1RL2 A;  2E8G A;  2PQA A;  4L5R C;  4DV2 Q;  1AH9 A;  3CPW A;  3PUV A;  2IY5 B;  1J6Q A;  2R93 G;  2IHE A;  4UPA A;  4DAY B;  3CMA A;  3GTK H;  2ZM6 Q;  2YYZ A;  1PH8 A;  2KHJ A;  5C4X H;  3CF5 A;  1YEZ A;  3I2Z A;  4P71 A;  1PH4 A;  3ULP A;  4A3L G;  1EOV A;  2K52 A;  1ASY A;  2CKZ B;  1HR0 L;  1B8A A;  2NN6 G;  5LMU Q;  2OWO A;  4LW1 A;  3K7A H;  4IPD A;  1NY4 A;  2A1A A;  4DV0 Q;  3M4P A;  3W1B A;  2VUM G;  2YV5 A;  4MTN A;  2N8N A;  1MJE A;  2Z6K C;  2GN5 A;  2ALY B;  1XMO L;  3PCO B;  1MIU A;  3CCL A;  4LNQ A;  1VQ7 A;  4YHH Q;  1UE6 A;  4JI4 L;  3J81 j;  5GAE C;  4DV6 Q;  4IFD I;  3KF6 A;  1PA6 A;  3S15 H;  3Q8D A;  3PO3 H;  4K0K L;  1CKM A;  1LUZ A;  2C35 B;  4LUO A;  4QGU A;  1KQS A;  2OQ0 A;  4DV2 L;  3PGZ A;  4A76 A;  4A3E G;  4DV1 Q;  4IOA A;  4DV7 Q;  1HH2 P;  5C0X I;  1Q81 C;  1Q86 C;  4NB3 A;  3T1Y Q;  4A3B H;  2ZM6 L;  2ZTD A;  2MFI A;  4LFC Q;  1XNQ Q;  5C4J H;  3K7U C;  4NXM Q;  2UXB Q;  5AJ3 Q;  1SE8 A;  4NXN Q;  1X3E A;  1UE7 A;  1S72 A;  2NVY H;  3DM3 A;  1VQD A;  5LMU L;  3UE0 A;  4GN4 B;  2JA8 H;  4C3J H;  5LMN W;  5JEA J;  3KF8 B;  3DLL A;  4DV0 L;  4B3S Q;  4DR2 Q;  1SN8 A;  3HOV H;  3CCS A;  4KHZ A;  4EQ5 A;  4A3B G;  5JJK A;  1VQM A;  3WWV A;  2K14 A;  1QZH A;  1D7Q A;  1V9P A;  2HIV A;  4C3H H;  1C9O A;  3PSI A;  3U4Z A;  4TVA B;  1VQE A;  1WFQ A;  4YHH L;  3GTJ H;  4DV6 L;  1Q46 A;  1SR3 A;  2XTI A;  2Q2U A;  4BY1 H;  2Z6K A;  1U5K A;  1Q82 C;  4JI2 Q;  3CC2 A;  3KLW A;  5M5Y H;  1E1O A;  3L0O A;  3PIO A;  5M3F H;  4DV1 L;  4DV7 L;  3U58 A;  2UU9 Q;  4EX5 A;  4P74 A;  4HIK A;  3T1Y L;  1Y1W H;  1IXR A;  4LFC L;  1XNQ L;  1QUQ B;  4IO9 A;  1NMF A;  3AQQ A;  1T9H A;  2A19 A;  3K0X A;  4DR5 Q;  2A8V A;  1Y1V G;  3EN2 A;  4NXM L;  2HT1 A;  5AJ3 L;  4DR6 Q;  4A3D H;  2UXB L;  5IYB H;  2VW9 A;  4NXN L;  3CD6 A;  2HHH Q;  2R92 H;  2R7F A;  5IYC G;  1WCM H;  3MEF A;  1EWI A;  2WB1 G;  4ALP A;  4B3S L;  3MXN B;  1AE3 A;  1V1Q A;  2EIF A;  3K81 C;  1HZA A;  1WI5 A;  4DR2 L;  1PYS B;  3J80 c;  1EQR A;  1EIY B;  3RZD H;  2ASB A;  3H0G H;  3PUY A;  4IJH A;  3ULL A;  2IX0 A;  3CCV A;  1BVS A;  1VQK A;  2K75 A;  4KI0 A;  2VZA A;  1KXL A;  3HFZ B;  4LF6 Q;  1K73 C;  5M3M H;  2PNH A;  2B63 H;  2R92 G;  3PF5 A;  2ZJQ A;  3HOU G;  1Q1B A;  4HID A;  1MKH A;  4JI2 L;  2WB1 E;  4JI6 Q;  3EIV A;  2UUB Q;  2QGQ A;  2Q2T A;  5IWA Q;  4L5T A;  1M90 C;  5IP7 G;  5H1S E;  2UU9 L;  2DUD A;  4HJ7 A;  1NMG A;  4HJ8 A;  3GTP H;  1ASZ A;  2B3G A;  3M4O H;  3CCR A;  1SRO A;  2OTJ A;  3FKI H;  2MQH A;  3CCQ A;  2UUC Q;  4R4T A;  4JC0 A;  4DR5 L;  4DR6 L;  4A75 A;  1JT8 A;  2VL6 A;  3S1R H;  3HOZ H;  1NBW A;  5M3M G;  4A93 G;  2HIX A;  2PMZ E;  2HHH L;  3RNU A;  3STB C;  1HNZ L;  3RLO A;  1GM5 A;  3KOJ A;  3RLN A;  4A3K H;  3I4M G;  4MZ9 A;  1EYG A;  4YWL A;  1YHQ A;  5GRO A;  4A3F H;  3PUZ A;  2GVA A;  2KCT A;  1OTC A;  3F8T A;  1VQ8 A;  4O0A A;  4LFA Q;  1LTL A;  3G48 A;  3HOZ G;  4X62 Q;  3CCM A;  4JBM A;  3NEL A;  1VQC A;  3AFP A;  4LF6 L;  4GOP B;  2MO1 A;  1UEB A;  4YCW A;  3H15 A;  1X55 A;  2JA5 G;  4HJA A;  1C7Y A;  5JJI A;  3I4O A;  1E22 A;  4JI6 L;  1W3S A;  2OQK A;  2UUB L; 
#chains in the Genus database with same CATH topology
 1RTN A;  1F2Y A;  4RGN A;  1PFS A;  2PCF B;  1KRT A;  2NVX H;  2AWN A;  3HOY H;  2UUC L;  4DAM A;  3DWP A;  2JE6 I;  1R9T H;  3TN2 A;  3BYT B;  4B3R Q;  1TY0 A;  3R8B A;  4A3I G;  3RN5 A;  4C3H B;  3UDX A;  4BY1 B;  5C3E H;  1LM0 A;  1HCZ A;  2X69 A;  2LXJ A;  2K05 A;  2Y0S G;  1PYB A;  5C4X G;  2F4V Q;  4EGV A;  1WTP A;  4IFD H;  3S17 B;  2I46 A;  1PRT B;  4IUR A;  1DOL A;  3SR1 A;  3QB3 A;  2R92 B;  3U4V A;  5C0X H;  1PH1 A;  1SYD A;  1I6H H;  4KN7 C;  2D5D A;  1CT1 D;  2I5M X;  3SGI A;  3RZD B;  3H0G B;  1FNW A;  3K8A A;  2VNU D;  4ZLT F;  4E6I A;  1P16 A;  2L15 A;  2A73 B;  2R7Z H;  4FO2 A;  4JI7 L;  5FLX E;  1UAP A;  4A3C H;  1TWG H;  1FYC A;  3QO2 A;  1A62 A;  1SEB D;  1GUW A;  5FO7 B;  1YIJ A;  3S1R B;  3HOZ B;  1ROD A;  3F2D A;  1ZKO A;  2R7Z G;  4OEL B;  4C3J G;  1ZYR C;  4X66 Q;  2MNA A;  2F52 A;  2EYJ A;  1PRT C;  5I6W A;  3KBG A;  2QA4 A;  2E5L Q;  2NTT A;  4R4C A;  4X3S A;  1I4Q A;  3UDI A;  4GOP A;  1TVX A;  2JSO A;  4KY6 A;  2B8F A;  1Q1E A;  4J1M A;  2VY3 A;  4XXE A;  2AHO B;  4CJ0 B;  4A3J H;  2KEN A;  1QVG A;  3GTL H;  4IUV A;  3KDF B;  4FF1 A;  4BXX H;  2CVR A;  3MC0 B;  1EEF D;  1ESF A;  4DUY L;  4OX9 Q;  1SAP A;  1UE5 A;  1Y1W G;  1A3V A;  5EAY A;  1FJG L;  1D1K A;  2XN9 C;  4DR7 L;  5I6Y A;  2PYK A;  3S1M H;  1QJO A;  2BCO A;  4LWC A;  4AYB G;  4A3J G;  1LT6 D;  2M9V A;  5KRU A;  1CQV A;  4IUT A;  3G4S A;  4RMF A;  2JA7 H;  4DV5 Q;  5JJL A;  1JE5 A;  5K36 G;  1G51 A;  3PO2 B;  4JI5 Q;  1S5E D;  3BYY B;  3CCU A;  3W5O A;  1L1O B;  1V1P B;  2NTS A;  4DAP A;  1JWU D;  1EFW A;  1WVL A;  1PTO C;  3I7F A;  1ENC A;  4AQY Q;  1IBM Q;  4DN4 M;  2PZW A;  5JOB A;  1CTM A;  4LF4 L;  1G29 1;  5M5W H;  1OXS C;  5IT9 c;  1K83 H;  3X3M A;  4RKB A;  4F88 A;  1YJN A;  2JJQ A;  3AMU A;  1NTG A;  2MHV A;  1BCP F;  3URY A;  2AUK A;  1YBY A;  5EKK A;  2EJM A;  2B39 A;  1GKH A;  1Z6H A;  4GS3 A;  2UXD Q;  2K5V A;  3JAM E;  4A3K G;  5ELC A;  1U4L A;  3I4N B;  4RGM A;  1N36 L;  3K5L A;  2NZH A;  1HXY D;  2EY5 A;  3P75 A;  1BUV T;  3ICE A;  2J0T D;  1L0Y B;  3RZO H;  3T56 B;  1HQM C;  1C0A A;  3LWU A;  1JOO A;  2HQL A;  4OIJ A;  1L1O C;  2QDL A;  2JQO A;  1GO3 E;  2KBN A;  3D6C A;  4N8F A;  1YNJ C;  4BY7 G;  3PV0 A;  3TME A;  4C1N I;  1Q7Y C;  4JPB W;  1U4P A;  2NN6 H;  3K5M A;  2F0N A;  4LF7 L;  1AW7 A;  1TWH H;  2VUM H;  3R93 A;  3GDE A;  3KYH C;  1I94 Q;  4DV3 L;  3T16 A;  4GNX A;  2KCM A;  3CU7 A;  3HKZ G;  4OON A;  1R4P B;  1MHW C;  2PNR C;  2JP1 A;  4A3E H;  5E7N A;  3C1F A;  2N55 A;  4WFN 3;  2B2W C;  2K04 A;  4C56 C;  1HQR D;  1VQI A;  5IOC A;  2PPB C;  2E2I B;  3P20 A;  2RVL A;  1LV9 A;  4N9P A;  1RDP D;  4X64 L;  1NUC A;  3GTQ B;  3T1H L;  2BA0 A;  1AFP A;  5JPM C;  2OF1 A;  3J81 E;  1VQ4 A;  2AMC B;  1A0I A;  3GTM B;  3CCE A;  4ZKB B;  2EQS A;  2H4O A;  2V4D A;  1XPR A;  3ULJ A;  1SE3 A;  2F3V A;  1HNW Q;  1EY4 A;  4DV4 L;  2NVQ H;  1K8A C;  4QJF A;  5EKL A;  1HNX L;  2VB2 X;  5M5X B;  2D62 A;  1B50 A;  4IJL A;  3VR5 A;  5D3D A;  5COY A;  4Q5V A;  5IYC H;  1WTX A;  4B3M L;  1H95 A;  2H5X A;  1BOS A;  1YHA A;  5BR8 Q;  2GVB A;  1Y14 B;  3M3Y B;  3QG1 A;  2CQA A;  1ENA A;  3BZC A;  4CHT B;  2RDH A;  4JI0 L;  4KHP L;  1E2Z A;  5CC4 A;  1F77 A;  3MZ5 A;  2B2Y A;  5IGE A;  1XXG A;  4DAY A;  4FDB A;  3CQZ H;  1PH9 A;  1MGS A;  2DNE A;  1J9O A;  4QB4 A;  3G6J B;  2AKW B;  4BA2 I;  3J80 i;  1U4R A;  5CV5 A;  1X9N A;  1NJI C;  2JA9 A;  3E0E A;  4KV6 A;  4PZ7 A;  3TZU A;  1CM9 A;  5GAH C;  1K28 A;  2SEB D;  4Y52 H;  2DJF C;  2ZTC A;  4HAE A;  3KFU A;  1EQQ A;  1VDZ A;  3RN2 A;  4LF5 L;  4K14 A;  4L5Q A;  5ISR A;  4IUU A;  4JI3 L;  3RR5 A;  1HR0 Q;  2MGS A;  4AIM A;  1EFI D;  3S16 B;  3D4R A;  1K8O A;  2G9D A;  1VQJ A;  3A5U A;  1HZC A;  5LHY 1;  2CWP A;  2DY7 A;  1BQQ T;  4JI4 Q;  3HG9 A;  1XNR L;  3CP0 A;  5F2D A;  2L5T A;  1G6P A;  4K0K Q;  1RL2 A;  4L5R C;  1AH9 A;  4DV2 Q;  1UUP A;  4L6T B;  2R93 G;  1EYD A;  1EOT A;  3H6M A;  4HR7 B;  1PH8 A;  2D9U A;  3I2Z A;  1PH4 A;  2Z4I A;  2O5J C;  2E2J B;  1FR3 A;  2F0L A;  2K52 A;  1ASY A;  2XWJ B;  1NAP A;  2SOB A;  3IKJ A;  2A1A A;  4V19 0;  3W1B A;  4MTN A;  3KBX A;  1QG7 A;  1MIU A;  3CCL A;  4H13 C;  4YHH Q;  3E3X A;  3J81 j;  4DV6 Q;  4IFD I;  1AZQ A;  1RF2 D;  1CKM A;  3FRP B;  2B2T A;  3HOU B;  2OQ0 A;  1PZI D;  1Q81 C;  5C0X I;  1Q86 C;  4UAI A;  2ZTD A;  5C5L A;  2K01 A;  5T1I A;  2K1B A;  4XT1 B;  3DM3 A;  1VQD A;  5LMU L;  2JA8 H;  4V0B A;  1J8I A;  4DV0 L;  2F0S A;  1IYV A;  1JB3 A;  1UNS A;  3CCS A;  5JJK A;  1BCP B;  1VQM A;  3CRK C;  2IL8 A;  4G7Z C;  1C9O A;  2A6E D;  3U4Z A;  4TVA B;  1D1I A;  1VQE A;  3CHB D;  1I50 B;  1SYB A;  3KLW A;  4HMJ A;  5CV9 A;  3PIO A;  5M3F H;  1IXR A;  1XNQ L;  4IO9 A;  3AQQ A;  2A8V A;  2L9H A;  1CK1 A;  3D4D A;  1Y1V G;  3EN2 A;  4NXM L;  2K5W A;  2VW9 A;  5ELE A;  2HHH Q;  1ONL A;  4DXF A;  1WCM H;  1CI3 M;  1K3B C;  4M8A A;  5KND A;  3N6R A;  4A3I B;  3H3V C;  2A6H D;  5M9O A;  2EIF A;  1HZA A;  2EDG A;  2F0D A;  3PUY A;  3ULL A;  1VQK A;  1BVS A;  4ZUI A;  3HFZ B;  1BCP C;  2B63 H;  3A8J E;  2ZJQ A;  1Q1B A;  5C4X B;  4JI2 L;  2WB1 E;  2Z1C A;  2UUB Q;  4K5X A;  4S3S A;  5G3L D;  5IWA Q;  2F0G A;  2F0U A;  4HJ7 A;  2OTJ A;  3M4O H;  1ASZ A;  2B3G A;  3K7A B;  3AB9 A;  3A56 A;  1WD0 A;  4DR6 L;  4A75 A;  1JT8 A;  2VL6 A;  4A93 G;  1TR5 A;  4F7X A;  4KKT A;  3QR8 A;  5FLX L;  3KOJ A;  3EFX D;  3DEP A;  1EYG A;  4G7O C;  4YWL A;  1YHQ A;  5GRO A;  3F8T A;  4LFA Q;  5IGF A;  1LTL A;  4K8J A;  4BWG B;  4X62 Q;  3NEL A;  3CKI B;  3AFP A;  4LF6 L;  3FEW X;  5J1Z A;  1UEB A;  1X55 A;  3ZYY X;  3QIA A;  1KRS A;  3F2C A;  1DGS A;  4HCE A;  1KL9 A;  2A5H A;  3MHB A;  3MWY W;  2XNA C;  4GLV B;  1TXY A;  4C1N K;  4J6H A;  4KHV A;  4BBS G;  3NBH B;  1DD2 A;  5FLM H;  2JA6 G;  1IKL A;  3GTJ B;  3CC4 A;  2LXK A;  1KLG D;  1IHZ A;  1QUQ A;  1RHP A;  1YNX A;  4H44 C;  4PZ6 A;  3I55 A;  2XRQ D;  3I72 A;  3IFD A;  1A6X A;  3NWT A;  3VYR A;  1Y1W B;  2NN6 I;  2ZJR A;  2L55 A;  1N33 Q;  1VQF A;  3M7G A;  4L5S A;  1N32 Q;  5CMD A;  3KDF A;  4OXP A;  4DPG A;  1D2B A;  3MXN A;  1QVF A;  1VQH A;  4AYB B;  2ICE C;  3EA6 A;  4IN3 A;  1JMC A;  1Z9F A;  2B2U A;  4IPG A;  4NW2 A;  2FHT A;  2D0P A;  4XYQ A;  3L2P A;  4JBW A;  2ZJP A;  4U67 3;  4IFD J;  4CKE A;  1OXX K;  1QNU A;  4RHR A;  4IPH A;  4B3R L;  1QIL A;  2OTL A;  1S5C D;  5C0X J;  3F2B A;  4POF A;  3PO3 G;  1D5Z C;  1PH5 A;  2YTX A;  1E3P A;  1NSN S;  3T53 B;  3SK8 A;  1EY7 A;  3S16 H;  1V43 A;  4ZQ3 A;  2EY6 A;  4IOC A;  2F4V L;  3GTP B;  3JAM L;  1SYG A;  2IX3 A;  1K8G A;  1WJJ A;  4PMW A;  4JG2 A;  2O5I C;  3FVQ A;  1KC8 C;  4LFB Q;  3K59 A;  2LKV A;  3UDF A;  3HOV G;  3SK6 A;  2LMC B;  4A3K B;  3S2D H;  1G6Z A;  4A3M H;  4JYA Q;  1STA A;  2ICI A;  4MHE A;  2I5H A;  5D3I B;  1I4G A;  4GKK Q;  1R4Q B;  1F2Z A;  2FJ2 A;  4L8J A;  4YCV A;  1SND A;  3BDO A;  4BY7 B;  4A3D G;  1EZ6 A;  4JVZ A;  4OWW B;  1NNX A;  2CCZ A;  5IP9 H;  3A55 A;  5IYB G;  1EIH A;  3OWE B;  1LT4 D;  4A3G H;  4X66 L;  4EVO A;  2HDM A;  4DR4 Q;  2F0E A;  4DK6 C;  1MSG A;  2E5L L;  3KUP A;  2IW3 A;  4X3K A;  2PW5 A;  4ZUJ A;  2QIL A;  5IYD H;  3J80 L;  1SNQ A;  1STH A;  5LMN Q;  1AE2 A;  1I3Q B;  1OXV A;  2I5L X;  2J7Z A;  4OX9 L;  3M7N A;  3FKI G;  4ZCK A;  1IW7 D;  5IYD G;  4X3U A;  5DLQ E;  3PF4 A;  3OMG A;  3NEM A;  3HOW H;  1Q3L A;  2B2V A;  1HJP A;  1NR2 A;  4K2L A;  3TP6 A;  3BU2 A;  3MXU A;  1J5E Q;  4DV5 L;  2IHF A;  2WP8 J;  4IUN A;  4IZ8 A;  4JI5 L;  4A3F G;  1EU4 A;  4MTK A;  3NEN A;  1O7Z A;  5JVH 3;  1VF5 C;  1IBM L;  1CKN B;  1CSP A;  1Z47 A;  3OYY A;  3WOE A;  2L0C A;  1EY5 A;  2Z4H A;  1N34 Q;  3J7Y W;  1EY9 A;  3BVM A;  3S1Q B;  2ES2 A;  4H02 A;  4A3L H;  3HOY G;  1DOM A;  4APV A;  1HZB A;  2DN8 A;  4CDE C;  1O7L A;  1TWA H;  1XTD A;  4FYD A;  5CGK A;  2RHS B;  3J7A F;  2UXD L;  3KK7 A;  3R2T A;  1JWS D;  4RH6 A;  3ERO A;  3WOF A;  5C3E G;  2RDF A;  3I91 A;  1VQ6 A;  3QOJ A;  2Q8T A;  1FVI A;  4X6A H;  1WTW A;  2KVM A;  3STB D;  1HTL D;  3TS0 A;  4C2M H;  4OWT B;  2UUA Q;  4IFD G;  5HY6 A;  3OW7 A;  4LK1 C;  1DOK A;  4QCL A;  1STE A;  2WAQ G;  5C0X G;  2XGT A;  5ELD A;  2E2H B;  1STY A;  1MJC A;  1HZ9 A;  3QJY A;  3DXJ C;  1G2S A;  1X3Q A;  1F9P A;  2EY2 A;  4PQX A;  1DJR D;  4YIJ A;  1I94 L;  3UDG A;  2KHS A;  3TQY A;  2ATW A;  2NB0 A;  2RBM A;  3MA2 B;  2J4X A;  3NTI A;  1KNE A;  1STN A;  1TII D;  4R4O A;  4A3C G;  1PTO B;  4PV1 C;  1L2F A;  1T5E A;  3SDZ A;  4LUV A;  1AEX A;  1H9K A;  4GLA C;  1PHJ A;  3S2H H;  1F2L A;  3HOX H;  1E1T A;  1JJ2 A;  3TRZ A;  2FXQ A;  1SRU A;  1KIX A;  4C3I H;  3TSS A;  3LWE A;  4BBR B;  5C3W A;  1VQ9 A;  3MFY A;  3MFG A;  2A74 C;  2PZT A;  2E2D C;  4YY3 Q;  3HOX G;  1EYC A;  4FF2 A;  4HMI A;  1D8L A;  5A2Q E;  2KA7 A;  2PI2 E;  3W2D A;  4BXX G;  3NQI A;  2R93 B;  3SK5 A;  1HNW L;  1HNZ Q;  2N78 A;  2CWA A;  4B3T Q;  4K5W A;  3PQI A;  5IIF A;  2EVB A;  2JA7 G;  4JOI C;  2QEX A;  1VQB A;  3C1E A;  3CAM A;  5IGD A;  3GTG B;  2VQE Q;  3K5O A;  1EY6 A;  1X32 A;  1N8R C;  3IRB A;  4J8Q A;  2NZO A;  1GJX A;  2OEO A;  1CZW A;  2KCC A;  5BR8 L;  3I4M H;  1F2M A;  5C44 H;  2DJG C;  1B70 B;  5D65 A;  3D3R A;  1TKW B;  3L7Z C;  4AH6 A;  1BKB A;  1IL2 A;  1GD7 A;  1PH3 A;  2JA5 H;  4G7H C;  3MXG A;  1HPC A;  1O80 A;  4WRD A;  5J22 A;  5DM7 3;  1NE3 A;  5FKA C;  1CQF A;  2HCC A;  4ID6 A;  5J3B A;  2VS1 A;  5C44 G;  1W6J A;  5CV7 A;  4Y7N H;  1CFM A;  3I8Z A;  2OT2 A;  1WTQ A;  2LFN A;  2PZU A;  3M4Q A;  2L11 A;  2RA4 A;  3CXC A;  4YWK A;  2PO4 A;  5ELN A;  3UI2 A;  1ILQ A;  5I2X A;  3FDT A;  1KLU D;  2JYO A;  4R8I A;  1TWC H;  4DK3 C;  1TWF B;  2E76 C;  2YU9 B;  2G9H D;  1WTO A;  2PQA A;  4XDX A;  3PUV A;  4UPA A;  3NP8 A;  2O2L D;  3CMA A;  2RSN A;  2ZM6 Q;  3I3C A;  5EPL A;  2YYZ A;  4P71 A;  3NPP A;  1HUM A;  1Y1V B;  1HR0 L;  1B8A A;  2NN6 G;  2HD3 A;  5K5P A;  2OWO A;  5DNF A;  4FVM A;  4LW1 A;  4IPD A;  1NY4 A;  5C5M A;  2VUM G;  2MUY A;  3E0J A;  1MJE A;  2TMP A;  2GN5 A;  2Z6K C;  1XX8 A;  2ALY B;  3S1N B;  3GP7 A;  3J80 E;  4LNQ A;  2ZXO A;  4JI4 L;  3GTO B;  5KNB A;  3KF6 A;  1PA6 A;  4K0K L;  1LTR D;  1LUZ A;  4QGU A;  1KQS A;  4DV2 L;  3PGZ A;  4A3E G;  4DV1 Q;  3PMF A;  4DV7 Q;  2WKD A;  3T1Y Q;  5JEA H;  4A3B H;  2MFI A;  4KK7 A;  5C4J H;  2NVT B;  3HEJ A;  2PQE A;  1SE8 A;  4NXN Q;  4A93 B;  3UE0 A;  1B1Z A;  1Z7T A;  2E74 C;  4B3S Q;  2QF7 A;  4KHZ A;  4A3B G;  5BN3 A;  3GV6 A;  2I07 B;  3TZD A;  1I4R A;  4XT3 B;  2HIV A;  1LTG D;  2N88 A;  4C3H H;  4YHH L;  2F0M A;  4BY1 H;  4IUQ A;  4DV6 L;  1Q46 A;  2NWG A;  3VR6 A;  3I70 A;  2QKI C;  4G4K A;  3U58 A;  1VMP A;  1EL0 A;  5G3L F;  1SJH D;  1T9H A;  3K0X A;  4DR5 Q;  3S17 H;  4I65 A;  2R92 H;  4QUC A;  5IYC G;  4BBS B;  4KKU A;  3MEF A;  4ALP A;  3I73 A;  3ONA B;  3PIO 3;  5CBA E;  1AE3 A;  1V1Q A;  4RGO S;  1D5M C;  1WI5 A;  5JJZ A;  1EIY B;  1PYS B;  3AU7 A;  2JA6 B;  3RZD H;  2ASB A;  3H0G H;  4RCO A;  3W3A A;  3SEB A;  2VZA A;  2EJG C;  1IL8 A;  1KXL A;  4NMZ A;  2EOT A;  2HCI A;  2X6L A;  1K73 C;  3GTK B;  1K0S A;  2PNH A;  2R92 G;  1CHQ D;  4HSP A;  4HID A;  1S5F D;  2F0Q A;  2Q2T A;  4OO1 H;  1M90 C;  2DUD A;  1NMG A;  1QE6 A;  2WII B;  3Q23 A;  1ZEQ X;  4JC0 A;  5LL6 S;  2KJX A;  4XYO A;  2SDF A;  3S1R H;  3HOZ H;  1ML0 D;  2HIX A;  2PMZ E;  2HHH L;  2C5C A;  1KAA A;  3RNU A;  4X3T A;  2XVS A;  1G91 A;  1GM5 A;  1MBY A;  1ESR A;  3PO3 B;  4TKO B;  5KIX A;  1TQO A;  1H9S A;  3HOZ G;  2L12 A;  1FNV A;  4JBM A;  4FXG C;  1VQC A;  1JE4 A;  4GOP B;  1II3 A;  5JJI A;  1LO5 D;  3KF8 A;  2EZV A;  2UUB L;  4JBJ A;  3HGB A;  5C4Z A;  5IWA L;  3S14 B;  2NVY B;  3CC7 A;  3I90 A;  3J7Z C;  4XIG S;  1I4H A;  1TY2 A;  3HOV B;  5ELO A;  3TP7 A;  2L4N A;  1Q12 A;  1JOK A;  3HZX A;  4B9W A;  1BBW A;  1YVC A;  1PV4 A;  1YJW A;  1JCK B;  5HUR A;  5IGG A;  5E1F A;  1ICW A;  3PO2 H;  2BE5 D;  4CDF C;  2YTY A;  4FF3 A;  3EVQ A;  4LFA L;  1LT3 D;  2CW0 C;  1X6O A;  3VR3 A;  3VA5 A;  4X62 L;  5CBE E;  3AYH B;  1ENF A;  1PMR A;  1AP0 A;  1A8V A;  3KLS X;  1QVC A;  4A3D B;  4QY7 A;  1BDO A;  1E2W A;  2F3W A;  4GOP C;  3EBE A;  1GVP A;  2PMZ B;  1SNM A;  2N49 A;  1LAC A;  4K8I A;  1JB7 A;  2Y0S E;  1E24 A;  4YWM A;  2ZT9 C;  3K6O A;  1U0L A;  4L63 B;  4DK1 A;  2A69 C;  1A2T A;  2KEE A;  2XSC A;  5M3M B;  4DR3 Q;  2CFM A;  4RG1 A;  3I4N H;  5NUC A;  2EYH A;  1KD1 C;  2YTV A;  1JOR A;  3HRZ C;  5E4W C;  3V05 A;  4HIM A;  5IT9 E;  1N33 L;  3FKI B;  1SLJ A;  1OO9 B;  4DKA C;  1Y8N B;  1L0W A;  1N32 L;  1VS0 A;  3ER0 A;  2JA8 G;  3I4N G;  5JVG 3;  3MXP A;  2F0T A;  3CME A;  4GN5 A;  1PH6 A;  2KHI A;  3K57 A;  3Q24 A;  3FPP A;  4JI0 Q;  2KCN A;  3RMH A;  5LL6 X;  1EUJ A;  4A3F B;  4XTC S;  1HR0 W;  1STG A;  1U9R A;  4KKS A;  4QIW E;  1KDB A;  1QB5 D;  1SNC A;  5M3F G;  1CA5 A;  4UP7 A;  3F1Z A;  1VQA A;  3D6W A;  3HP3 A;  1K3R A;  5IOD A;  3VR2 A;  3HOY B;  3C3L A;  1K8M A;  3M4Y A;  4CBV A;  3U9S A;  1R9T B;  1WCM G;  2Y0S B;  2R6G A;  3OTO Q;  4LFB L;  4HED A;  2E2I H;  2IPK D;  3GTQ H;  2RF4 A;  2F0P A;  5C3E B;  1UE1 A;  4DUZ Q;  3NXW A;  4YCU A;  4AYB E;  1MD2 D;  4O1N A;  2B63 G;  3GTM H;  4JYA L;  4HTH A;  1Q8K A;  2CQO A;  2I0Q A;  4GKK L;  1S5B D;  3D31 A;  4XQJ A;  2HUG A;  2VB3 X;  2WAQ B;  3X3N A;  1I6H B;  2AUJ D;  4QL5 A;  3L3O C;  4PMB A;  5M5X H;  4GNX C;  1WTH A;  5EJW A;  1PVO A;  2RDG A;  5T1G A;  1S3O A;  2RCF A;  2FFK B;  3A8I E;  4DR4 L;  3LGJ A;  4IPC A;  5KEE A;  3PIP A;  1WOC A;  4P2C B;  4LF8 Q;  2R7Z B;  4C3J B;  1WTR A;  2LS0 1;  2CH4 A;  2JN4 A;  4QIW B;  5IGC A;  1SNO A;  4DNT B;  1V1O A;  2A68 D;  3C2P A;  1PXU A;  1KHI A;  2V1C C;  1TWG B;  2SNS A;  5LMN L;  1W2B A;  2KEC A;  3M3Y H;  2R7D A;  4JI8 Q;  4RAU C;  1X3P A;  3NBI A;  3NWS A;  1FNU A;  1EYA A;  1S5D D;  2XIW A;  5C3X A;  4X65 Q;  1Y69 U;  3I4L A;  1XTC D;  5A2Q L;  4ME3 A;  4JW0 A;  3W1G A;  5ELB A;  5FLM G;  1J5E L;  1IBK Q;  1I5F A;  2ZXP A;  5CV4 A;  2UXC Q;  2D2C C;  2EE1 A;  1AN8 A;  1EWC A;  2BDN A;  4A3J B;  4LJZ C;  3GTL B;  2GA4 B;  1O7Y A;  3TEH B;  3KJP A;  4OWX B;  2WKC A;  2IX1 A;  4HN7 A;  1PYW D;  3S1M B;  5EGT A;  3TRE A;  2A6H C;  1CSQ A;  1Y8P B;  1N34 L;  1SMX A;  2JA7 B;  4JV5 Q;  4GKJ Q;  3HKZ E;  5GQO A;  1L1O A;  1V1P A;  1SYC A;  2D0O A;  1CKO A;  1FGU A;  3JAM c;  1JOQ A;  1XMQ Q;  4KN4 C;  2LY7 A;  2VQF Q;  3OPO A;  4IAL A;  3ZJY C;  1H9M A;  3E5S A;  3AEV A;  1MI2 A;  2B2Y C;  1A3U A;  1B9N A;  4ZKC B;  2ZXR A;  1L0X B;  3O13 A;  4TSS A;  3S14 H;  5M5W B;  1K83 B;  2FMM A;  3TP5 A;  4UP8 A;  2UUA L;  4LF9 Q;  4NPS A;  1ZXT A;  5C4H A;  5CV6 A;  1GHK A;  1Q90 A;  2E2J H;  3GO5 A;  4P72 A;  1V8Q A;  4QMG A;  3E9I A;  4MNO A;  4PNY A;  4B9X A;  1JIC A;  5FOB B;  2F3I A;  3A8K E;  4DR1 Q;  2B2W A;  4PG3 A;  5HGQ A;  4A3M G;  4ZAI A;  1IBL Q;  2RSO A;  3RZO B;  3ERQ A;  1DYQ A;  4HJ9 A;  2ID0 A;  1QZG A;  2PI2 A;  2KOL A;  2K03 A;  3HKS A;  3HOU H;  1X56 A;  5L37 A;  3ITP A;  4JCV E;  4XQQ A;  1I6V C;  2OXP A;  2HQE A;  3BZK A;  3N52 A;  5IP9 G;  1SE4 A;  4JI1 Q;  4FF4 A;  5IP7 H;  1O7I A;  1K9M C;  3HKZ B;  4A3G G;  3JC6 6;  1WYD A;  5IE8 A;  5EPJ A;  4UP9 A;  1TWH B;  3H3V H;  4ABN A;  3A5Z B;  4QQB X;  2VUM B;  5ELF A;  2XRS D;  4DNI A;  1NCV A;  2E75 C;  5AFW A;  2QW7 A;  3J81 c;  4UY8 C;  2CH4 W;  1N9W A;  2K5D A;  4DGZ A;  1B53 A;  1QNK A;  1PFB A;  1ZYR D;  4YY3 L;  4OO1 I;  1PRT D;  5I2Y A;  4A3E B;  4M1U B;  1I50 H;  1TU2 B;  3MVV A;  4B3T L;  5JAV A;  1WTV A;  4TRD A;  4O42 A;  4KD3 A;  3HOW G;  1DZ1 A;  3NQT A;  3V96 A;  4DK0 A;  3FHW A;  4AQY L;  2K5N A;  2DGY A;  2Z8L A;  4OIK A;  1X65 A;  2X6G A;  1XMO Q;  4FP5 D;  1VQL A;  2B2T C;  2VQE L;  1Y8O B;  4HIO A;  2IT1 A;  2NUC A;  4A3I H;  2CHB D;  2G5D A;  4LAA A;  3U50 C;  1LYL A;  3VYT A;  2E8G A;  1EWH A;  1LTB D;  4MIU A;  1Q8I A;  3CPW A;  2IY5 B;  1J6Q A;  2NVQ B;  1LTA D;  1SMY C;  2IHE A;  3NE5 B;  5C4X H;  3CF5 A;  1YEZ A;  1XWE A;  3ULP A;  4A3L G;  1QCB D;  2FMC A;  1PTO D;  4CJ2 C;  3T4A C;  3K7A H;  4CJ1 B;  1LTS D;  3M4P A;  3OIQ A;  2N8N A;  1UEA B;  3PCO B;  4RHS A;  1QOH A;  3NHH A;  1VQ7 A;  1SBB B;  5A35 A;  2C35 B;  4NP5 A;  4R9W A;  1DCZ A;  5BN5 A;  1EIG A;  1HH2 P;  3BDL A;  2EYP A;  2ZM6 L;  4LFC Q;  3CQZ B;  2WIN B;  2P5Z X;  4RWS C;  1RKN A;  3K7U C;  2UXB Q;  2SNM A;  5AJ3 Q;  1GUO A;  2Q8I B;  1X3E A;  1UE7 A;  1EY8 A;  2O4X A;  3DHQ A;  1SNP A;  4C3J H;  5LMN W;  5JEA J;  3C46 A;  1SYE A;  2F4I A;  4DR2 Q;  1YNJ D;  1M4V A;  1SE2 A;  5DM6 3;  1KTK A;  3SE0 A;  4FXD A;  1IW7 C;  1WFQ A;  2Q2U A;  3GTJ H;  1SR3 A;  1YNN C;  2XTI A;  2B8G A;  1BBX C;  1Q82 C;  4DA2 A;  3RD4 A;  3NSW A;  3L0O A;  2F0W A;  4DV1 L;  4DV7 L;  2UU9 Q;  4P74 A;  3T1Y L;  1Y1W H;  3BVG A;  1QUQ B;  2NBF A;  4KTA A;  3IL8 A;  1B2T A;  2HT1 A;  2EYF A;  3BDC A;  4NXN L;  4ZK9 B;  2R3Z A;  2R7F A;  4C3I G;  2WB1 G;  2EYO A;  1SFO B;  4CDC C;  4B3S L;  1KDA A;  3MXN B;  1EQR A;  5K36 H;  3F2U A;  4IJH A;  2M2L A;  2F0J A;  2IX0 A;  3CCV A;  5DAU A;  1T5X D;  4DF7 A;  3PF5 A;  1MKH A;  4IQZ A;  4JI6 Q;  2K28 A;  3P1H A;  4KJN A;  3BVZ A;  4KY7 A;  4L5T A;  2K33 A;  2EYM A;  4HJ8 A;  3GTP H;  1O78 A;  2MJ8 A;  2UUC Q;  4DR5 L;  1NBW A;  4DXG A;  1PFN A;  2NZ1 D;  3STB C;  5IT9 L;  4A3K H;  3I4M G;  2GVA A;  2KCT A;  1RJT A;  1FGB D;  1VQ8 A;  3SK4 A;  4CKC A;  3DEO A;  2JXM B;  2B2U C;  1IYU A;  2MO1 A;  4YCW A;  3TDQ A;  3H15 A;  2JA5 G;  2HDL A;  2BDO A;  3I4O A;  1PFM A;  1W3S A;  2KUM A;  1VQP A;  1YZ6 A;  2EXD A;  1HUN A;  4BY7 H;  2L1B A;  3D0F A;  3BZD B;  5I4D A;  2JA8 B;  1PH2 A;  4H0L C;  3NUC A;  3FPU B;  2EJF C;  1LTI D;  2K5H A;  4BS9 A;  4O2D A;  1IZ6 A;  4R4I A;  2F0V A;  5KGU A;  3Q6S A;  4EQP A;  2Q8R E;  3PUX A;  4LMQ D;  3OW2 A;  4JI7 Q;  5M3F B;  2BH8 A;  1EU3 A;  3ERS X;  3PUW A;  1XJV A;  2NYZ D;  1PZJ D;  5EKI A;  1I3Q H;  4RKL A;  1C8C A;  4GN3 B;  1A3T A;  3OIP A;  5C6A A;  1PH7 A;  1WCM B;  1LT5 D;  4NKL A;  3V2T A;  2BA1 A;  3ND9 A;  3TBI B;  4OHJ A;  1JQY D;  3BS1 A;  1P8L A;  1DON A;  2B63 B;  1CUK A;  2F0H A;  4ODG A;  2PW7 A;  4R4Q A;  4ULL A;  1XPO A;  2K50 A;  2RKS A;  2EY1 A;  4DUY Q;  1FJG Q;  5JEA G;  2C9O A;  1GOZ A;  5TSS A;  1X3G A;  4DR7 Q;  2JEB I;  3M4O B;  1HFN A;  1M8A A;  1HTP A;  3S1Q H;  1BXT A;  2EXZ A;  2MO0 A;  3JAM i;  3TS2 A;  4P73 A;  4BA1 I;  3CW2 C;  1RIP A;  3RUZ A;  1EQV A;  1A15 A;  2RHQ B;  3R3O A;  4C3H G;  3OHX C;  2OCE A;  4BY1 G;  3OSO A;  3RLF A;  4DR3 L;  1FL0 A;  3HS0 C;  3SXH A;  2CW0 D;  1B4O A;  4LF4 Q;  1YI2 A;  5KYI A;  2B2V C;  1JC7 A;  1EEI D;  1JJG A;  3BJU A;  1ET6 A;  3G71 A;  3A74 A;  1U4M A;  3NBH A;  1IYJ B;  1E7Z A;  1XYI A;  4K2K A;  1LAB A;  4N9T A;  1B3Q A;  1GUT A;  1DM0 B;  2M00 A;  2E2H H;  3H0G G;  4CGY B;  3GQB A;  1XPU A;  1N36 Q;  1UWV A;  1TS2 A;  2A69 D;  1BBU A;  4WJ4 A;  3SVM A;  1G2T A;  3E9H A;  2ENB A;  1EZ8 A;  3I56 A;  1BF4 A;  2Q2H A;  4NDX A;  4QF4 A;  4KD4 A;  4OO1 G;  3H3V I;  3FP9 A;  1PTO H;  3S15 B;  1KAB A;  2Z0S A;  2AQ2 B;  1F9R A;  1VQ5 A;  3J7A 5;  3A7A B;  1YJ9 A;  1A63 A;  4LF7 Q;  1TS5 A;  5IY0 A;  3J81 i;  3OTO L;  2TSS A;  3VA7 A;  4GLX A;  3M85 A;  4DV3 Q;  1JR0 D;  1HFG A;  4BBR H;  3QWN A;  4R1J A;  5FK9 C;  4DUZ L;  3UE1 A;  4EQO A;  2JK8 A;  1SYF A;  3KLR A;  4K6D A;  3AFQ A;  2ZTE A;  1D5X C;  5E3F A;  3CCJ A;  4HJ5 A;  2R93 H;  1VQG A;  1E2V A;  3VYU A;  3PIP 3;  4BBR G;  4UDU C;  3FMC A;  4TQU S;  5EQ0 A;  1SFO H;  5M5Y B;  1B3A A;  1BCP D;  3J7A V;  4H7B A;  1EIF A;  4X64 Q;  4A4I A;  4KMU C;  1EY0 A;  3T1H Q;  3S2D B;  1K0R A;  3IFT A;  3NTK A;  1CHP D;  3E6Z X;  3GTG H;  4A3M B;  3PO2 G;  2FIN B;  1SXT A;  3H94 A;  1H9J A;  5FJ8 H;  1BO0 A;  4OEM B;  3LX0 A;  5DEH A;  4LF8 L;  4CKB A;  4DV4 Q;  5GAG C;  1OXT A;  4KY5 A;  1WD1 A;  4CDD C;  1X3F A;  1ICF B;  2B29 A;  1PLF A;  1HNX Q;  3S9W A;  3G7L A;  1C4Q A;  4WJ3 M;  2Z6B A;  2Z9H A;  5EBD A;  4JI8 L;  3T51 B;  5FJ8 G;  4DU9 A;  3VDY A;  4A3G B;  3CRL C;  3P7J A;  2AQ3 B;  1HHV A;  1AZP A;  4X65 L;  1A2U A;  4B3M Q;  3IAY A;  3DM1 A;  1EQT A;  4HCS A;  4U68 A;  1IBK L;  3OWF A;  4EQN A;  3MAQ A;  2RQX A;  5KNC A;  2WAQ E;  2UXC L;  1LLR D;  1NR4 A;  1YHB A;  1RD9 D;  3VYS A;  4PZ8 A;  3H09 A;  1KNA A;  1TWF H;  2WFW A;  3DWA A;  2YU9 H;  2BH2 A;  3G6E A;  4KHP Q;  3SHL A;  1B7Y B;  2KED A;  2EPB A;  1CZG A;  2PQA B;  3HOW B;  4POG A;  1VCI A;  2R61 A;  1JJC B;  2XWB B;  2K4K A;  1Y1V H;  4GKJ L;  4JV5 L;  3BG3 A;  2Q2I A;  4GNX B;  5GAD C;  1B44 D;  1CKN A;  2NVX B;  3S1N H;  1XMQ L;  4ZYS A;  1MSH A;  2VQF L;  2F03 A;  1D6E C;  4KLK A;  4ME5 A;  2N3S A;  1TT2 A;  4JBK A;  1PRT F;  3OOC A;  2RCN A;  1F9Q A;  4F87 A;  3K80 C;  3GTO H;  1VQN A;  4LF5 Q;  4B08 A;  5CR3 A;  1S40 A;  2H1E A;  4JI3 Q;  4LF9 L;  3KF6 B;  2QEJ C;  2NVT H;  1TWA B;  1M1K C;  2BE5 C;  5JPN C;  5KYL A;  5FLX c;  4A93 H;  3Q22 A;  1YIT A;  4PMC A;  1X54 A;  2MP1 A;  4JK1 C;  4FNF A;  4DR1 L;  2AWO A;  3M9B A;  4Q0F A;  2KQ3 A;  2F0I A;  3GD7 A;  1XNR Q;  3D8G A;  4HSV A;  2K5Q A;  4P75 A;  2F0F A;  1H9R A;  1GHJ A;  1QWY A;  1IBL L;  4C2M B;  4F8M A;  3VR4 A;  4J15 A;  2DNC A;  1ET9 A;  1OXU A;  4UHV A;  3B6Y A;  5EBC A;  1F9S A;  2AQ1 B;  2JEA I;  4WOR A;  5I9P A;  3KJO A;  1PTO F;  4JI1 L;  1FD7 D;  3U9O A;  1GXD C;  2F0K A;  1BR9 A;  3K0Y A;  2F1M A;  3WDN A;  4BBS H;  1VQO A;  1TS4 A;  3LNN A;  3CPF A;  1TS3 A;  4JOI A;  1BNZ A;  3A0J A;  1KAW A;  2JA6 H;  4LUZ A;  2LSS A;  3S24 A;  2A6E C;  3GV3 A;  5D14 A;  1C48 A;  3D4W A;  2IWH A;  4DAY B;  3GTK H;  4XQN A;  3S2H B;  1GUN A;  5EPK A;  5HGT A;  2KHJ A;  3HOX B;  1GUS A;  1EOV A;  5FO9 B;  2CKZ B;  4OGQ C;  4DFA A;  3H91 A;  5LMU Q;  1JWM D;  3R2I A;  4RFB A;  4DV0 Q;  1DXM A;  2EYL A;  4C3I B;  1PZK D;  2WB1 B;  2YV5 A;  4RCN A;  1XMO L;  1I4X A;  3EQL C;  3KLS A;  1RCV D;  2MPM A;  1ILP A;  1LTT D;  1S4Z A;  1SDF A;  2WAC A;  1UE6 A;  3EJI A;  1I4P A;  5GAE C;  3S15 H;  1PDQ A;  3Q8D A;  2BOS A;  4I7A A;  3PO3 H;  4LUO A;  3DUZ A;  4A76 A;  4IOA A;  2WV6 D;  3A54 A;  3K5N A;  4NB3 A;  1XNQ Q;  3Q0A A;  4FXK C;  1H9S B;  5J39 A;  2F0O A;  4NXM Q;  3DWQ A;  4ZRZ A;  1RTO A;  1S72 A;  2NVY H;  1HA6 A;  4GN4 B;  4N8X 1;  3A7L A;  3KF8 B;  4DAV A;  3DLL A;  5I9O A;  1SN8 A;  4K5V A;  3HOV H;  4EQ5 A;  1B9M A;  1VF7 A;  3WWV A;  2K14 A;  3I4M B;  1IKM A;  1QZH A;  1D7Q A;  1V9P A;  5C44 B;  3NTH A;  3OMC A;  2VXW A;  3PSI A;  4MN3 A;  4Z9C B;  2Z6K A;  1U5K A;  3QOL A;  4QUF A;  4JI2 Q;  3CC2 A;  1SMY D;  5M5Y H;  1E1O A;  2JA5 B;  4R8N A;  1SSO A;  4G57 A;  4EX5 A;  4HIK A;  2QDB A;  4LFC L;  2IJ0 A;  4RA8 A;  1NMF A;  1STB A;  2K7V A;  4Y7N B;  2A19 A;  3TP8 A;  4DR6 Q;  4A3D H;  2UXB L;  5AJ3 L;  2K6A A;  5IYB H;  3CD6 A;  5FO8 B;  2A68 C;  1EWI A;  3MEH A;  3ND8 A;  4WJW A;  5CYU A;  4DR2 L;  3K81 C;  1TWC B;  5CV8 A;  3J80 c;  3L9A X;  2K75 A;  4RGT A;  4KI0 A;  4KJO A;  4LF6 Q;  5M3M H;  1VMC A;  3HOU G;  4GZY C;  1E0B A;  3EIV A;  1W6K A;  2QGQ A;  5COR A;  5H1S E;  5IP7 G;  5BN4 A;  2UU9 L;  1GUG A;  2QCP X;  3CCR A;  1SRO A;  3DMU A;  3FKI H;  2MQH A;  4I7Z C;  3CCQ A;  4R4T A;  1HA5 A;  1HRJ A;  3T13 A;  5M3M G;  4DNR B;  4OL7 A;  3K58 A;  1KDC A;  1CA6 A;  1HNZ L;  5IGB A;  3RLO A;  2DY8 A;  3RLN A;  3NK9 A;  2K32 A;  4MZ9 A;  5E4X A;  3J81 L;  4A3F H;  3PUZ A;  1OTC A;  1YNN D;  4O0A A;  3G48 A;  3CCM A;  4IUP A;  3MTS A;  4A3B B;  5C4J B;  1G8Z D;  4HJA A;  1C7Y A;  1E22 A;  4JI6 L;  4ILW A;  1SJE D;  4K6L A;  2OQK A; 
#chains in the Genus database with same CATH homology
 4JBJ A;  1VQP A;  1YZ6 A;  5IWA L;  1KRS A;  1PFS A;  2EXD A;  3F2C A;  4BY7 H;  3D0F A;  1DGS A;  3J7Z C;  1KL9 A;  3CC7 A;  1PH2 A;  1KRT A;  2NVX H;  2AWN A;  3HOY H;  2UUC L;  4DAM A;  4XIG S;  2JE6 I;  4GLV B;  1TXY A;  5ELO A;  1R9T H;  4BBS G;  1Q12 A;  4B3R Q;  2K5H A;  3NBH B;  1BBW A;  1YVC A;  4A3I G;  1PV4 A;  3RN5 A;  4O2D A;  1IZ6 A;  4R4I A;  5FLM H;  1YJW A;  2JA6 G;  3UDX A;  3PO2 H;  3CC4 A;  2LXK A;  5C3E H;  1QUQ A;  1YNX A;  2YTY A;  4PZ6 A;  3PUX A;  3OW2 A;  1LM0 A;  4JI7 Q;  4LFA L;  2LXJ A;  3I55 A;  1X6O A;  2BH8 A;  4X62 L;  3ERS X;  2Y0S G;  1PYB A;  3PUW A;  5C4X G;  2F4V Q;  1XJV A;  3AYH B;  2NN6 I;  2ZJR A;  1N33 Q;  1A8V A;  1I3Q H;  1QVC A;  1VQF A;  4L5S A;  1N32 Q;  4QY7 A;  3KDF A;  4OXP A;  4DPG A;  1QVF A;  4GN3 B;  4GOP C;  1VQH A;  3EBE A;  3U4V A;  1PH7 A;  1JMC A;  1GVP A;  1Z9F A;  4IPG A;  1PH1 A;  1I6H H;  3L2P A;  2D0P A;  2N49 A;  1JB7 A;  4JBW A;  2ZJP A;  2BA1 A;  2Y0S E;  1E24 A;  2I5M X;  4YWM A;  3SGI A;  4IFD J;  1OXX K;  1U0L A;  4IPH A;  4B3R L;  3K8A A;  2OTL A;  2VNU D;  5C0X J;  3F2B A;  1P8L A;  4POF A;  3PO3 G;  1PH5 A;  2YTX A;  1CUK A;  1E3P A;  1P16 A;  2CFM A;  2L15 A;  4RG1 A;  4DR3 Q;  2R7Z H;  3I4N H;  4R4Q A;  1XPO A;  2K50 A;  4DUY Q;  1KD1 C;  5JEA G;  4JI7 L;  1V43 A;  1FJG Q;  2YTV A;  3S16 H;  4A3C H;  1TWG H;  1X3G A;  2JEB I;  4HIM A;  4IOC A;  2F4V L;  4DR7 Q;  1N33 L;  1SLJ A;  1A62 A;  4DKA C;  1L0W A;  1N32 L;  1K8G A;  1VS0 A;  1YIJ A;  1WJJ A;  3S1Q H;  4PMW A;  3ER0 A;  4JG2 A;  3F2D A;  2JA8 G;  3I4N G;  2R7Z G;  1KC8 C;  4X66 Q;  3CME A;  4GN5 A;  2MO0 A;  3JAM i;  2MNA A;  2F52 A;  4LFB Q;  3TS2 A;  3UDF A;  2QA4 A;  1PH6 A;  2KHI A;  4P73 A;  4BA1 I;  2E5L Q;  1FJG L;  3HOV G;  4R4C A;  3CW2 C;  1RIP A;  4JI0 Q;  3S2D H;  3UDI A;  4GOP A;  1EUJ A;  4XTC S;  1Q1E A;  2RHQ B;  2VY3 A;  1HR0 W;  2OCE A;  4A3M H;  4JYA Q;  4BY1 G;  2AHO B;  2I5H A;  3RLF A;  4A3J H;  4DR3 L;  2KEN A;  1FL0 A;  1QVG A;  4GKK Q;  4QIW E;  3GTL H;  4LF4 Q;  3KDF B;  5M3F G;  1YI2 A;  4BXX H;  4UP7 A;  4DUY L;  3F1Z A;  1UE5 A;  1VQA A;  3BJU A;  4YCV A;  5EAY A;  3G71 A;  1Y1W G;  4OX9 Q;  3A74 A;  1K3R A;  4DR7 L;  4A3D G;  3S1M H;  1IYJ B;  1E7Z A;  4OWW B;  2CCZ A;  5IP9 H;  5IYB G;  4LWC A;  4AYB G;  4A3J G;  4A3G H;  1WCM G;  2R6G A;  3OTO Q;  3G4S A;  4X66 L;  4RMF A;  2JA7 H;  4DV5 Q;  4LFB L;  2E2I H;  5JJL A;  4DR4 Q;  4DK6 C;  2E2H H;  2E5L L;  1JE5 A;  5K36 G;  3H0G G;  1G51 A;  3GTQ H;  2RF4 A;  4JI5 Q;  1XPU A;  1N36 Q;  1UWV A;  1UE1 A;  4DUZ Q;  1BBU A;  3CCU A;  3W5O A;  4WJ4 A;  5IYD H;  1L1O B;  3S17 H;  3E9H A;  1EFW A;  4YCU A;  4AYB E;  4JYA L;  2B63 G;  3GTM H;  3I56 A;  3I7F A;  1Q8K A;  4AQY Q;  2CQO A;  2Q2H A;  5LMN Q;  1IBM Q;  1AE2 A;  2I0Q A;  4GKK L;  1OXV A;  2I5L X;  4LF4 L;  1G29 1;  3D31 A;  1OXS C;  5M5W H;  1K83 H;  5IT9 c;  3H3V I;  4OO1 G;  3FP9 A;  4OX9 L;  3M7N A;  2Z0S A;  3FKI G;  1YJN A;  2JJQ A;  5IYD G;  3PF4 A;  5DLQ E;  1NTG A;  1VQ5 A;  3J7A 5;  4QL5 A;  3NEM A;  3HOW H;  1A63 A;  1YJ9 A;  4LF7 Q;  1YBY A;  1HJP A;  5M5X H;  5IY0 A;  4GNX C;  3J81 i;  1GKH A;  3OTO L;  3BU2 A;  1J5E Q;  4GS3 A;  1PVO A;  2UXD Q;  4DV5 L;  2IHF A;  1S3O A;  2K5V A;  2WP8 J;  4GLX A;  4DR4 L;  3M85 A;  4A3K G;  3LGJ A;  4IPC A;  4DV3 Q;  3PIP A;  1WOC A;  4BBR H;  4JI5 L;  4A3F G;  4LF8 Q;  4R1J A;  1N36 L;  2NZH A;  4DUZ L;  3NEN A;  3UE1 A;  2JK8 A;  3ICE A;  3RZO H;  1C0A A;  3AFQ A;  2ZTE A;  1KHI A;  2HQL A;  2V1C C;  1IBM L;  1CKN B;  1CSP A;  5LMN L;  3CCJ A;  1Z47 A;  1L1O C;  4HJ5 A;  2JQO A;  3OYY A;  1VQG A;  1W2B A;  2R93 H;  1GO3 E;  3M3Y H;  2R7D A;  2KBN A;  4JI8 Q;  1N34 Q;  4BY7 G;  3PV0 A;  4BBR G;  2ES2 A;  4H02 A;  4TQU S;  1SFO H;  4A3L H;  3HOY G;  1Q7Y C;  4APV A;  1HZB A;  4X65 Q;  1EIF A;  4X64 Q;  4ME3 A;  1TWA H;  4A4I A;  1XTD A;  3T1H Q;  4LF7 L;  1TWH H;  1K0R A;  3W1G A;  2VUM H;  2RHS B;  5FLM G;  1J5E L;  1IBK Q;  2UXD L;  3GTG H;  1I5F A;  3GDE A;  2UXC Q;  3KYH C;  1I94 Q;  3PO2 G;  4DV3 L;  5C3E G;  5FJ8 H;  1VQ6 A;  4LF8 L;  4GNX A;  2KCM A;  1FVI A;  4X6A H;  3HKZ G;  4OON A;  3TEH B;  3KJP A;  4OWX B;  4DV4 Q;  3STB D;  5GAG C;  1OXT A;  3TS0 A;  4C2M H;  1X3F A;  4OWT B;  2UUA Q;  2IX1 A;  2B29 A;  4IFD G;  5HY6 A;  5E7N A;  4A3E H;  3TRE A;  1HNX Q;  4WJ3 M;  1CSQ A;  4JI8 L;  2WAQ G;  1N34 L;  5FJ8 G;  1VQI A;  5C0X G;  3VDY A;  1SMX A;  2XGT A;  4JV5 Q;  4GKJ Q;  3HKZ E;  5GQO A;  1L1O A;  4X65 L;  4B3M Q;  4X64 L;  2D0O A;  1MJC A;  1HZ9 A;  3T1H L;  1CKO A;  1FGU A;  3JAM c;  2BA0 A;  1XMQ Q;  1VQ4 A;  2VQF Q;  1IBK L;  2AMC B;  3ZJY C;  1A0I A;  2WAQ E;  2UXC L;  1YHB A;  3CCE A;  3UDG A;  1I94 L;  4PZ8 A;  3AEV A;  3TQY A;  2EQS A;  2ATW A;  1XPR A;  3ULJ A;  3S14 H;  1TWF H;  2WFW A;  2YU9 H;  2BH2 A;  4R4O A;  4A3C G;  1HNW Q;  3G6E A;  4DV4 L;  4KHP Q;  1L2F A;  2NVQ H;  1K8A C;  1B7Y B;  4QJF A;  4UP8 A;  2UUA L;  4LF9 Q;  4LUV A;  4NPS A;  3S2H H;  1PHJ A;  4GLA C;  1HNX L;  2PQA B;  4POG A;  1VCI A;  3HOX H;  1JJG A;  1E1T A;  2E2J H;  2D62 A;  3GO5 A;  1JJC B;  4IJL A;  4P72 A;  1JJ2 A;  2K4K A;  3TRZ A;  1Y1V H;  3E9I A;  4MNO A;  4GKJ L;  4JV5 L;  2Q2I A;  2FXQ A;  1SRU A;  4DR1 Q;  2F3I A;  5IYC H;  1KIX A;  4B3M L;  1H95 A;  2H5X A;  4C3I H;  1VQ9 A;  4GNX B;  5GAD C;  4PG3 A;  1CKN A;  5HGQ A;  4A3M G;  1YHA A;  1XMQ L;  5BR8 Q;  3S1N H;  4YY3 Q;  2VQF L;  2GVB A;  1IBL Q;  3HOX G;  4KLK A;  1D8L A;  2N3S A;  4JBK A;  2PI2 E;  2RCN A;  4HJ9 A;  1Y14 B;  3K80 C;  3GTO H;  4BXX G;  2ID0 A;  4LF5 Q;  1VQN A;  1QZG A;  2PI2 A;  1S40 A;  3HKS A;  3HOU H;  1X56 A;  3BZC A;  1HNZ Q;  1HNW L;  4JCV E;  2N78 A;  2CWA A;  4B3T Q;  4JI0 L;  4JI3 Q;  4KHP L;  4LF9 L;  3KF6 B;  3BZK A;  5IP9 G;  4JI1 Q;  4FDB A;  3CQZ H;  5IP7 H;  1O7I A;  1K9M C;  1PH9 A;  2NVT H;  4A3G G;  3JC6 6;  1M1K C;  1WYD A;  5IE8 A;  2JA7 G;  4JOI C;  4UP9 A;  2QEX A;  1VQB A;  3H3V H;  3A5Z B;  4QQB X;  5FLX c;  2AKW B;  3CAM A;  4BA2 I;  3J80 i;  4DNI A;  4A93 H;  2VQE Q;  1YIT A;  1X54 A;  1X9N A;  1NJI C;  4DR1 L;  3IRB A;  1N8R C;  3J81 c;  2AWO A;  4UY8 C;  2JA9 A;  3E0E A;  3M9B A;  4PZ7 A;  1N9W A;  1XNR Q;  2NZO A;  3GD7 A;  4P75 A;  5GAH C;  5BR8 L;  3I4M H;  4YY3 L;  4Y52 H;  1IBL L;  5C44 H;  4OO1 I;  2ZTC A;  1B70 B;  3KFU A;  1EQQ A;  4J15 A;  3RN2 A;  1I50 H;  1OXU A;  4LF5 L;  3L7Z C;  4AH6 A;  1BKB A;  1IL2 A;  1GD7 A;  3B6Y A;  4L5Q A;  1PH3 A;  2JA5 H;  4JI3 L;  4B3T L;  3RR5 A;  2JEA I;  1HR0 Q;  1NE3 A;  3KJO A;  5J3B A;  3HOW G;  4AIM A;  4JI1 L;  2VS1 A;  5C44 G;  3FHW A;  4Y7N H;  4AQY L;  2K5N A;  2DGY A;  3M4Q A;  1VQJ A;  1X65 A;  1XMO Q;  1VQL A;  3A5U A;  1HZC A;  3CXC A;  2VQE L;  4HIO A;  1VQO A;  4YWK A;  4BBS H;  5ELN A;  2IT1 A;  2CWP A;  4A3I H;  4JI4 Q;  3CPF A;  1TWC H;  4JOI A;  4DK3 C;  3A0J A;  1KAW A;  3CP0 A;  1XNR L;  2JA6 H;  1G6P A;  3U50 C;  4LUZ A;  2LSS A;  1LYL A;  3S24 A;  4K0K Q;  1RL2 A;  2E8G A;  2PQA A;  4L5R C;  4DV2 Q;  1AH9 A;  3CPW A;  3PUV A;  2IY5 B;  1J6Q A;  2R93 G;  2IHE A;  4UPA A;  4DAY B;  3CMA A;  3GTK H;  2ZM6 Q;  2YYZ A;  1PH8 A;  2KHJ A;  5C4X H;  3CF5 A;  1YEZ A;  3I2Z A;  4P71 A;  1PH4 A;  3ULP A;  4A3L G;  1EOV A;  2K52 A;  1ASY A;  2CKZ B;  1HR0 L;  1B8A A;  2NN6 G;  5LMU Q;  2OWO A;  4LW1 A;  3K7A H;  4IPD A;  1NY4 A;  2A1A A;  4DV0 Q;  3M4P A;  3W1B A;  2VUM G;  2YV5 A;  4MTN A;  2N8N A;  1MJE A;  2Z6K C;  2GN5 A;  2ALY B;  1XMO L;  3PCO B;  1MIU A;  3CCL A;  4LNQ A;  1VQ7 A;  4YHH Q;  1UE6 A;  4JI4 L;  3J81 j;  5GAE C;  4DV6 Q;  4IFD I;  3KF6 A;  1PA6 A;  3S15 H;  3Q8D A;  3PO3 H;  4K0K L;  1CKM A;  1LUZ A;  2C35 B;  4LUO A;  4QGU A;  1KQS A;  2OQ0 A;  4DV2 L;  3PGZ A;  4A76 A;  4A3E G;  4DV1 Q;  4IOA A;  4DV7 Q;  1HH2 P;  5C0X I;  1Q81 C;  1Q86 C;  4NB3 A;  3T1Y Q;  4A3B H;  2ZM6 L;  2ZTD A;  2MFI A;  4LFC Q;  1XNQ Q;  5C4J H;  3K7U C;  4NXM Q;  2UXB Q;  5AJ3 Q;  1SE8 A;  4NXN Q;  1X3E A;  1UE7 A;  1S72 A;  2NVY H;  3DM3 A;  1VQD A;  5LMU L;  3UE0 A;  4GN4 B;  2JA8 H;  4C3J H;  5LMN W;  5JEA J;  3KF8 B;  3DLL A;  4DV0 L;  4B3S Q;  4DR2 Q;  1SN8 A;  3HOV H;  3CCS A;  4KHZ A;  4EQ5 A;  4A3B G;  5JJK A;  1VQM A;  3WWV A;  2K14 A;  1QZH A;  1D7Q A;  1V9P A;  2HIV A;  4C3H H;  1C9O A;  3PSI A;  3U4Z A;  4TVA B;  1VQE A;  1WFQ A;  4YHH L;  3GTJ H;  4DV6 L;  1Q46 A;  1SR3 A;  2XTI A;  2Q2U A;  4BY1 H;  2Z6K A;  1U5K A;  1Q82 C;  4JI2 Q;  3CC2 A;  3KLW A;  5M5Y H;  1E1O A;  3L0O A;  3PIO A;  5M3F H;  4DV1 L;  4DV7 L;  3U58 A;  2UU9 Q;  4EX5 A;  4P74 A;  4HIK A;  3T1Y L;  1Y1W H;  1IXR A;  4LFC L;  1XNQ L;  1QUQ B;  4IO9 A;  1NMF A;  3AQQ A;  1T9H A;  2A19 A;  3K0X A;  4DR5 Q;  2A8V A;  1Y1V G;  3EN2 A;  4NXM L;  2HT1 A;  5AJ3 L;  4DR6 Q;  4A3D H;  2UXB L;  5IYB H;  2VW9 A;  4NXN L;  3CD6 A;  2HHH Q;  2R92 H;  2R7F A;  5IYC G;  1WCM H;  3MEF A;  1EWI A;  2WB1 G;  4ALP A;  4B3S L;  3MXN B;  1AE3 A;  1V1Q A;  2EIF A;  3K81 C;  1HZA A;  1WI5 A;  4DR2 L;  1PYS B;  3J80 c;  1EQR A;  1EIY B;  3RZD H;  2ASB A;  3H0G H;  3PUY A;  4IJH A;  3ULL A;  2IX0 A;  3CCV A;  1BVS A;  1VQK A;  2K75 A;  4KI0 A;  2VZA A;  1KXL A;  3HFZ B;  4LF6 Q;  1K73 C;  5M3M H;  2PNH A;  2B63 H;  2R92 G;  3PF5 A;  2ZJQ A;  3HOU G;  1Q1B A;  4HID A;  1MKH A;  4JI2 L;  2WB1 E;  4JI6 Q;  3EIV A;  2UUB Q;  2QGQ A;  2Q2T A;  5IWA Q;  4L5T A;  1M90 C;  5IP7 G;  5H1S E;  2UU9 L;  2DUD A;  4HJ7 A;  1NMG A;  4HJ8 A;  3GTP H;  1ASZ A;  2B3G A;  3M4O H;  3CCR A;  1SRO A;  2OTJ A;  3FKI H;  2MQH A;  3CCQ A;  2UUC Q;  4R4T A;  4JC0 A;  4DR5 L;  4DR6 L;  4A75 A;  1JT8 A;  2VL6 A;  3S1R H;  3HOZ H;  1NBW A;  5M3M G;  4A93 G;  2HIX A;  2PMZ E;  2HHH L;  3RNU A;  3STB C;  1HNZ L;  3RLO A;  1GM5 A;  3KOJ A;  3RLN A;  4A3K H;  3I4M G;  4MZ9 A;  1EYG A;  4YWL A;  1YHQ A;  5GRO A;  4A3F H;  3PUZ A;  2GVA A;  2KCT A;  1OTC A;  3F8T A;  1VQ8 A;  4O0A A;  4LFA Q;  1LTL A;  3G48 A;  3HOZ G;  4X62 Q;  3CCM A;  4JBM A;  3NEL A;  1VQC A;  3AFP A;  4LF6 L;  4GOP B;  2MO1 A;  1UEB A;  4YCW A;  3H15 A;  1X55 A;  2JA5 G;  4HJA A;  1C7Y A;  5JJI A;  3I4O A;  1E22 A;  4JI6 L;  1W3S A;  2OQK A;  2UUB L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...