4GKJL

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human mitochondrial anticodon stem loop (asl) of transfer rna methionine (trnamet) bound to an mrna with an aug-codon in the a-site and paromomycin.
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title Expanded use of sense codons is regulated by modified cytidines in tRNA.
pubmed doi rcsb
total genus 15
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2012-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4gkjL00
4LFAQ 1C0AA 4UY8C 1HJPA 3E9IA 3MEFA 4A3EH 3A74A 3W1GA 1C7YA 1VQJA 4JI4L 2ZTEA 4GKKL 3HKZE 1OXSC 1OTCA 3PGZA 4A3GH 3KLWA 4RG1A 4X6AH 4B3ML 4JI0Q 1Y14B 1YNXA 4DNIA 1G51A 5ELNA 4QGUA 2PQAA 1EIFA 4LF9Q 5FJ8H 3T1HQ 1X54A 2JA8H 4DV7L 2E2HH 4A3BG 4QL5A 3J81c 2LXJA 3GTJH 1VQHA 2NN6G 3ZJYC 1XNRQ 4YWMA 1RIPA 4JI3L 3H3VI 4O2DA 1CKNA 3Q8DA 1H95A 2WAQE 2ZTCA 1K73C 4NPSA 1A62A 2E5LQ 2R7FA 1PH3A 4YHHQ 3KYHC 4TVAB 2WB1E 1N33L 4BY7G 2UXBQ 1IBML 1WJJA 2KCMA 3EBEA 3CC7A 1JJ2A 1WOCA 1NMFA 4DV1L 4GNXB 4LF6Q 2HT1A 3CQZH 1PH7A 2R7DA 2RF4A 1BBWA 4JI2L 1SN8A 3PUYA 1BKBA 1AE3A 2K75A 1FGUA 1Q7YC 1XNQQ 3KJPA 2JA6H 2UXCL 1UE7A 3HOVG 2RHSB 3E9HA 4B3SL 3HOUG 3S2HH 2UXDQ 4L5QA 1IBLL 3PO2G 2Q2HA 2K52A 4HJ5A 3ICEA 5LMNW 3RN5A 4JV5L 4IFDJ 1EIYB 3K81C 2PNHA 3S1RH 1X65A 1XMQQ 5GROA 3HKZG 2MNAA 2HHHQ 1TWFH 3HOXH 4APVA 1E24A 4JBMA 1YBYA 3CCUA 3RR5A 4HIKA 4A3FH 1VQNA 1VQBA 2ATWA 4DV5Q 5IYCH 3S1NH 4KHZA 1W2BA 1X55A 3TS2A 1CSQA 3I4NH 1PYBA 4A3CG 5EAYA 2IX1A 1N34Q 3OTOQ 1J5EL 4DR1Q 3ULPA 5JJKA 3BU2A 5C0XI 4R4OA 3K80C 4LUZA 2RCNA 3CCEA 2VQEL 1TWHH 3U4ZA 4IPGA 1MJCA 2BA0A 2ZM6Q 1N36Q 2WAQG 4BBRG 1QZGA 3RLOA 1Z47A 2Q2IA 5LMUQ 4QY7A 1N32Q 2WB1G 4FDBA 3H15A 5C44H 2R7ZH 2DGYA 4DUZQ 4AQYL 1XPRA 3J80i 4LF5L 1V9PA 3BZKA 1Y1VH 4LF7Q 2JQOA 2OCEA 2AMCB 4P75A 2CKZB 3HKSA 1OXVA 5LMNL 1HZ9A 1WI5A 3PUXA 2I5HA 4DAMA 3G71A 3CF5A 1Q86C 2B63H 1ASYA 2UUCQ 2YTYA 3I55A 4DR6L 4GLAC 2E2IH 3OYYA 5K36G 3PUVA 5AJ3L 1XTDA 3L7ZC 1WFQA 4RMFA 4YCVA 4LF4Q 4JI1L 4P71A 3E0EA 4DR7L 2BH2A 1A8VA 1EQQA 1FJGQ 1BVSA 4A3IG 4GN5A 1SLJA 2RHQB 1V43A 1IBKL 1CKOA 3PF4A 4JC0A 2LSSA 1IZ6A 3DLLA 4BY7H 3S14H 1TXYA 4X64L 1PVOA 4DV0L 2IHFA 1PH4A 3SGIA 3KDFB 4O0AA 2JJQA 2MFIA 2I5LX 2OQKA 3KF6B 4PZ7A 4IPHA 1VQDA 1E3PA 2K50A 4NB3A 4C3HH 4YY3Q 3GTLH 2AWNA 4XTCS 3U4VA 3CC4A 1E1OA 1QVFA 4MZ9A 2Q2UA 3PO2H 4OO1G 3H0GG 2VY3A 4EX5A 3PUWA 3M4QA 1YHAA 4DR3Q 1Z9FA 3A5UA 1OXXK 2UUAL 3HFZB 1GKHA 4R1JA 5JEAJ 4Y52H 2AWOA 3S1MH 1D7QA 1T9HA 1IL2A 3ULJA 4A3DH 3K8AA 4GKJL 4JI6Q 1YITA 1MIUA 4LUVA 2ID0A 1U0LA 5GAHC 4H02A 4JI4Q 3CAMA 1HH2P 4A3CH 2N3SA 3PV0A 4UPAA 5H1SE 2ZJPA 3W1BA 1VS0A 4BA1I 1S72A 4IO9A 5M5YH 5M5WH 4P73A 3PIPA 4B3TL 1Y1VG 5BR8L 3RN2A 4JBJA 1NE3A 3J7A5 1UEBA 3AFQA 4OO1I 1XMOL 1PH8A 1HR0L 4GNXA 2NVQH 1I50H 1U5KA 4DV7Q 2JA9A 4BBRH 1VQ7A 2B63G 2CCZA 4P72A 4OONA 4GOPC 2CFMA 1Q12A 1MJEA 5IY0A 1SFOH 4LNQA 4LFCQ 4JI3Q 5JJLA 5GAEC 5ELOA 4DV3L 4DV4Q 3M85A 3M3YH 5IT9c 4PMWA 4KHPQ 3DM3A 3GTMH 3HOWG 3PO3H 5HY6A 2JE6I 2EXDA 3CCJA 2KHJA 4R4CA 2FXQA 1KQSA 4DV1Q 1PHJA 2VQFL 2ZJQA 3F1ZA 2VUMG 1E22A 1NJIC 4JI2Q 3STBC 1Q46A 2HIVA 3JAMi 1KRTA 1JB7A 5HGQA 2Y0SE 4LFAL 3S17H 4DR4L 1VQ6A 1KXLA 2QEXA 4GOPA 1EWIA 4OX9Q 1LYLA 3FKIG 2UXCQ 3S24A 4AYBG 1B7YB 1Y1WG 2IX0A 1N9WA 3G48A 3CCSA 3GO5A 4A3IH 4P74A 3L2PA 1HNZL 1IBLQ 2WP8J 4GS3A 5C0XG 1VQOA 4JV5Q 1VQPA 4HIMA 2N78A 2QGQA 1VQLA 4UP9A 1X9NA 3T1HL 5FLMG 3WWVA 4AH6A 2CWAA 2A19A 3KOJA 3NBHB 2ALYB 2D0PA 5FLXc 3CCLA 2HQLA 1HNWQ 3NEMA 3NELA 4JI7L 1AE2A 4A3DG 4IPCA 1KD1C 4A3KG 3GTKH 1I94Q 4X62L 1PV4A 3VDYA 1X3EA 4EQ5A 4DR5L 1KL9A 3AQQA 3H0GH 2VQEQ 4HJ7A 4DV6L 2UXBL 1K83H 1QVCA 1BBUA 2K5HA 2JA5G 2NVXH 4LF6L 2JK8A 2YTVA 3CCQA 1VQMA 1QUQB 4YWKA 4X66L 3F2CA 1EUJA 3B6YA 2MQHA 2OTLA 5IWAL 1D8LA 4AQYQ 2K5VA 5GQOA 3RZDH 4BXXG 1UE6A 4IFDI 2NVYH 2UUBL 4K0KQ 3W5OA 2XGTA 4DAYB 2MO1A 3H3VH 1L1OB 2K14A 3J81i 1SE8A 1XMQL 3PIOA 1EFWA 2F4VQ 4B3RQ 1KRSA 2HHHL 1IXRA 4IJLA 1G6PA 1FL0A 1SROA 4PG3A 1M1KC 1VQFA 1HZCA 3T1YL 4JYAL 2VNUD 5AJ3Q 3CPFA 3KDFA 4XIGS 1CSPA 2YYZA 4A76A 3PO3G 3CMAA 2E8GA 3J81j 3AFPA 3KF6A 4C3JH 5M3FG 2F52A 2VS1A 2A1AA 3OTOL 4QJFA 1YJ9A 4DR7Q 2YU9H 1PH5A 4KI0A 1LUZA 1L0WA 1VQ8A 1K9MC 1X56A 1GD7A 2GN5A 1VQKA 1O7IA 2L15A 5IP9G 1GO3E 5IP7G 1S40A 3GTPH 4X65Q 1PFSA 3HOWH 2CWPA 4DV0Q 4JG2A 4JI5L 4DR2L 3I56A 1Q1EA 2N8NA 4YWLA 2VUMH 1N32L 5JJIA 3F8TA 4DUZL 2F3IA 3HOYH 3CW2C 4LF7L 4DK6C 4DV2L 2NVTH 4PZ6A 3FKIH 4NXML 1YHBA 1X3GA 3CCVA 1Y1WH 4R4QA 1A63A 1K8AC 1PH1A 2NZHA 4NXNQ 3KF8B 1K8GA 2UU9Q 2R7ZG 2DUDA 4LUOA 1YVCA 1JT8A 2UUAQ 3M7NA 1R9TH 5FLMH 2HIXA 1VQGA 4GNXC 5IE8A 3K7UC 4L5SA 1XPUA 1HNXL 3GTGH 1DGSA 1YEZA 2I5MX 1V1QA 1FJGL 4LF8Q 1YIJA 4C2MH 4DUYL 4A3KH 2ASBA 1M90C 2EQSA 3CXCA 4HJ8A 1TWAH 4BA2I 1JE5A 3ER0A 1VQEA 2KCTA 5BR8Q 4AIMA 4JCVE 4B3TQ 4A3MH 2R92G 3I4MG 3TRZA 4GKKQ 3GDEA 1HR0Q 4POGA 2IHEA 2JA5H 3CMEA 3CC2A 2XTIA 4LWCA 2IY5B 4B3MQ 3CCMA 4L5TA 4BBSG 4WJ3M 3L0OA 4GN4B 4A3JH 2K5NA 2D0OA 2K4KA 1QZHA 2N49A 2OQ0A 4HIDA 4JI8L 4YY3L 3OW2A 3G6EA 3GTOH 2R93G 2QA4A 5C4XG 4DK3C 1WCMG 1PH9A 4OWWB 3PSIA 2JA7H 5M3MG 4DV3Q 3AEVA 1YJWA 4QQBX 2Z6KC 4A75A 4GLVB 1YZ6A 5GADC 4DR3L 3NENA 2H5XA 1J6QA 1NMGA 4JBWA 4YCWA 4JOIC 1XJVA 1E7ZA 5IYBG 1N33Q 4ME3A 1Q8KA 1TWCH 2WFWA 4LFBL 1IBMQ 4JI6L 4DR4Q 4QIWE 2KHIA 5C3EH 4GN3B 1QVGA 1HZAA 1YJNA 5M3FH 4J15A 3GD7A 4OWXB 1EYGA 3UDIA 1L1OC 2KBNA 3UE1A 1UE1A 3CCRA 3HOYG 1HNZQ 1NY4A 2B29A 2KENA 2ZTDA 2PI2A 1JJCB 4A3LG 3TS0A 1AH9A 5IP7H 5IP9H 4B3SQ 2Z6KA 3MXNB 3F2DA 1VQCA 1QUQA 4JI0L 3J80c 1LM0A 4HJ9A 4WJ4A 4JOIA 1N8RC 4A93G 1CUKA 3KJOA 1ASZA 4LF9L 4JI7Q 4MNOA 4LFCL 3HOZG 2PI2E 1RL2A 4DV4L 4IFDG 4X62Q 3GTQH 1L1OA 4KHPL 3EIVA 1XPOA 4DR5Q 2OWOA 1XNRL 5GAGC 4R4TA 4DV6Q 3RLNA 1YI2A 3EN2A 2V1CC 1J5EQ 1YHQA 1C9OA 1WYDA 1X6OA 2BA1A 2MO0A 2E5LL 4YHHL 1Q81C 4X66Q 4A3MG 3ERSX 1X3FA 2NZOA 5C0XJ 1PH2A 1KHIA 2BH8A 2LXKA 2PQAB 1OXUA 5IWAQ 3UE0A 4LW1A 4OX9L 3TEHB 1UE5A 2UUBQ 2NN6I 3UDXA 1PH6A 5IYDH 4A3JG 4L5RC 1VQ5A 1XNQL 2E2JH 4LF5Q 1CKMA 1G291 3I4MH 2R92H 4R4IA 4HJAA 1VQ4A 2VZAA 4DKAC 1CKNB 4BXXH 3RZOH 2YV5A 2UXDL 2ES2A 2AKWB 3BZCA 2B3GA 1FVIA 5LMNQ 3T1YQ 2Y0SG 1GM5A 4JYAQ 1VQIA 4BY1G 1HNWL 4BBSH 2GVBA 2ZJRA 4DR6Q 4IOAA 4IOCA 4GOPB 3RNUA 2JEBI 2R93H 1B8AA 1HZBA 5C4XH 1I94L 3M4OH 1KIXA 1WCMH 4DV5L 3TQYA 5C3EG 5M3MH 2D62A 4JI1Q 4A3EG 2YTXA 4OWTB 3D31A 3S16H 1N34L 4DR1L 1VCIA 1K0RA 3JC66 3TREA 4A3GG 4JI5Q 3IRBA 5IYBH 1B70B 4DR2Q 1IBKQ 1P16A 2CQOA 1E1TA 1Q82C 3J7ZC 3G4SA 2ZM6L 5FJ8G 4X64Q 1N36L 2JA8G 1K3RA 3KFUA 1GVPA 1A0IA 5LMUL 4DV2Q 2I0QA 3I4OA 4K0KL 4POFA 4MTNA 4NXMQ 4YCUA 1NBWA 1I3QH 3PF5A 3A5ZB 1SMXA 3S1QH 1I6HH 2F4VL 4B3RL 2GVAA 2Z0SA 4A3LH 3K7AH 5M5XH 5E7NA 1IYJB 1W3SA 4HIOA 2JA7G 4UP7A 1Q1BA 1EQRA 4GLXA 1TWGH 3K0XA 3CD6A 3F2BA 3M9BA 4A3BH 2UUCL 4IJHA 3CPWA 1HNXQ 4A93H 3RLFA 1P8LA 3HOZH 4UP8A 4OXPA 4DPGA 5DLQE 1PYSB 4DUYQ 3I2ZA 4LF4L 4GKJQ 1JMCA 3M4PA 1UWVA 2Q2TA 3PUZA 2JA6G 3D0FA 4KLKA 3U58A 4X65L 4C3IH 5JEAG 5IYDG 2OTJA 4TQUS 1OXTA 3JAMc 3S15H 1HR0W 2VW9A 2A8VA 2PMZE 3CP0A 2C35B 3UDGA 2VL6A 1I5FA 3HOXG 4A4IA 1S3OA 1XMOQ 3FP9A 1KAWA 2R6GA 5J3BA 1EOVA 4JI8Q 4ALPA 4A3FG 1PA6A 2JEAI 1L2FA 2EIFA 1KC8C 3HOUH 3HOVH 4PZ8A 3UDFA 5IYCG 3LGJA 3ULLA 4IPDA 3I4NG 4NXNL 2UU9L 1VQAA 3FHWA 1MKHA 1NTGA 2IT1A 3I7FA 1LTLA 3AYHB 5C4JH 1SRUA 4AYBE 4LFBQ 1VQ9A 4BY1H 3S2DH 2AHOB 3STBD 3PCOB 4Y7NH 1JJGA 1SR3A 3U50C 4LF8L 2VQFQ 4JBKA 3A0JA 3BJUA 5C44G
chains in the Genus database with same CATH superfamily
3MWYW 3NE5B 3MEFA 3FKIB 3A74A 3BYYB 3W1GA 4CKBA 4A3EH 1Y1WB 1HQMC 1F77A 1BUVT 3R2TA 2K1BA 3PGZA 4RG1A 4X6AH 1X3QA 2DY7A 3VR4A 4JI0Q 3D6CA 2QILA 5IT9L 2F0MA 4RA8A 4NP5A 1W6KA 4K8JA 2PQAA 4LF9Q 2AUJD 2F0HA 2E2HH 1F2ZA 1CFMA 1SE3A 4RAUC 2NN6G 4A3DB 4YWMA 2TSSA 4A3KB 3MVVA 3Q8DA 1H95A 3BS1A 1N33L 1IBML 2KCMA 1AP0A 1JJ2A 2M9VA 4GNXB 4DV1L 3D4DA 3NTIA 1JWUD 1G6ZA 1BBWA 1FGUA 3A54A 2HDLA 3KJPA 2A68D 2UXCL 2RHSB 3S2HH 2ENBA 1Z7TA 3PO2G 4HJ5A 2XIWA 3OMGA 5LMNW 4JV5L 4ZKCB 1X65A 2K6AA 2MNAA 1XWEA 1CA5A 1TWFH 2RQXA 1D5MC 1YBYA 4WJWA 2B2TC 4DV5Q 5IYCH 2DY8A 3H3VC 5EAYA 4MIUA 1N34Q 4RKBA 5C0XI 4KMUC 3K80C 2EYOA 2RCNA 3CCEA 1EYDA 2EY6A 1D5XC 1MJCA 2EOTA 1K0SA 4BBRG 3RLOA 5LMUQ 2Q2IA 4I65A 5C44H 4DUZQ 4AQYL 1EEFD 3C46A 2B2TA 2AMCB 1CQVA 1HXYD 5BN5A 2I5HA 3G71A 2B63H 5EPJA 4DGZA 1PYWD 3MTSA 4ZYSA 4G4KA 1ICWA 3H0GB 1XTDA 2NYZD 2PZTA 1WFQA 4YCVA 4LF4Q 3FVQA 4DR7L 5LL6S 4QUCA 5J22A 4FF4A 2KECA 1SLJA 1TR5A 2RHQB 3QOJA 1KAAA 2R92B 1TIID 2LSSA 1IZ6A 3S14H 3MXPA 1X32A 4XQNA 5I6WA 1PRTB 2IHFA 4EGVA 3IFDA 4FVMA 4KD4A 4O0AA 1HCZA 1K8MA 1STNA 3QJYA 4U68A 1NSNS 2OQKA 4NB3A 1VQDA 5T1GA 4CHTB 1AW7A 3M4OB 2AWNA 4MZ9A 4C1NI 4CJ1B 3JAME 2M00A 5I6YA 3M4QA 4DR3Q 1JC7A 5DM63 3PQIA 4KHVA 1D7QA 1DOLA 2A6HC 3K8AA 1LTRD 1MIUA 4LUVA 2RSOA 3CAMA 4A3CH 1F9RA 4WFN3 3RN2A 2TMPA 3J7A5 1NE3A 3K7AB 3VR5A 3NUCA 3AFQA 1XMOL 1HR0L 5C4HA 1TWGB 4DV7Q 2JA9A 5CV7A 2M2LA 1EY6A 1BCPD 2Z8LA 4FF3A 5GAEC 1B4OA 3SR1A 4DV4Q 2F0GA 1BO0A 1ESFA 1HTPA 2E74C 3SK5A 3M85A 3M3YH 4KHPQ 1YNJC 5HURA 1PTOC 5ELFA 2EXDA 3VR2A 4R4CA 3CCJA 3CHBD 3EQLC 2VUMG 2ZJQA 3STBC 4LFAL 3JAMi 1ZEQX 2QEXA 1AN8A 3A8IE 5IGBA 1LYLA 3FKIG 3S24A 2PO4A 5CC4A 1Y1WG 2OT2A 1N9WA 4A3IH 2X69A 1EY7A 4QIWB 1HNZL 4GS3A 5C0XG 5FK9C 1NCVA 5C4JB 1X9NA 2F0TA 3SEBA 1RTOA 2CWAA 4BY1B 2L5TA 3KOJA 1CHPD 3CCLA 3ONAB 1VDZA 2HQLA 1HNWQ 3Q22A 4A3DG 3GV6A 1KD1C 4A3KG 3GTKH 5C3EB 1Q90A 4HR7B 4X62L 1PV4A 2UXBL 4OO1H 4HJ7A 2IJ0A 2VQEQ 1K83H 1QVCA 4PMBA 4FXDA 4TRDA 4LF6L 2F0EA 3F2CA 2QEJC 1EUJA 1TS3A 5L37A 2JA8B 2K5VA 5GQOA 2NVYH 4OIJA 1CQFA 3W5OA 1PXUA 3GTJB 1TS5A 1T5XD 3H3VH 4LMQD 5I2XA 2K14A 2MGSA 2F4VQ 1IXRA 2JA7B 3IAYA 3P20A 4K14A 4JYAL 4CKCA 5AJ3Q 1GUGA 3CMAA 2J7ZA 2F52A 3OTOL 4QJFA 5BN3A 1SBBB 1U9RA 1I6VC 3J7AV 1VQ8A 1H9MA 2DJFC 1BCPB 5IP9G 5IP7G 3GTPH 4OHJA 4X65Q 2CWPA 2KQ3A 4DR2L 2N8NA 4OIKA 1N32L 5JJIA 3F8TA 5FO9B 2F3IA 5ELEA 2Q8IB 2HCIA 4A3FB 1H9SB 4PZ6A 1YHBA 5D3DA 2L0CA 1FNVA 1PH1A 3KF8B 2UU9Q 1F2MA 4LUOA 1BBXC 2UUAQ 2HIXA 1LTID 1VQGA 5ISRA 1HNXL 1DGSA 1BCPF 1YIJA 1RODA 4NKLA 4C2MH 2ASBA 5CR3A 3CXCA 1TWAH 1WTRA 3BVMA 1XX8A 4B3TQ 2R92G 2LMCB 4A3MH 4POGA 4LWCA 3CCMA 4FXGC 3L0OA 2L11A 3MFYA 1CI3M 2N49A 4YY3L 1J9OA 1BOSA 1EY9A 4DK3C 4N8FA 1YJWA 4X3KA 4GLVB 5GADC 4JOIC 4RCNA 1SYDA 4BY7B 1N33Q 4ME3A 4ULLA 1IBMQ 4R9WA 4QIWE 2KHIA 2PZWA 2WV6D 4IZ8A 5ELDA 5M3FH 4OWXB 2K7VA 1DCZA 4RFBA 1L1OC 2KUMA 4F87A 1EQVA 2F0DA 5E4WC 1UE1A 3UE1A 3OOCA 1SNQA 1NY4A 5NUCA 3GTLB 1QWYA 2PI2A 3HOVB 4CDEC 5KNBA 1VQCA 4ODGA 4JI0L 1LM0A 4RGTA 4JOIA 1N8RC 1PTOH 1CHQD 1CUKA 3TMEA 3S1MB 4LF9L 2QF7A 4LFCL 3BDOA 3D4RA 4M8AA 4KN4C 2B2WC 1SYGA 4Y7NB 3GTQH 1L1OA 4HCSA 1GUNA 3MAQA 4DR5Q 4XT3B 4R4TA 3EN2A 5DNFA 1C9OA 2BA1A 5CV8A 1EIHA 1Q81C 5C0XJ 1PH2A 2NZOA 2NVQB 1KHIA 2AQ1B 2LXKA 1OXUA 1XXGA 1FNUA 1UE5A 1WTHA 2FFKB 2L12A 4IUUA 1I4GA 1G291 2B2WA 1VQ4A 2VZAA 3RZOH 2RKSA 2ES2A 2AKWB 3I8ZA 4KN7C 4CJ0B 4BY1G 5A2QL 3K6OA 4BBSH 1GHJA 4DNTB 2JEBI 1O78A 2R93H 3FPPA 3S17B 1I94L 1SDFA 2X6LA 3HS0C 4DV5L 3TQYA 5C3EG 1B53A 2D62A 3PIO3 4NMZA 3S16H 4OWTB 5IGGA 1N34L 1KDAA 1VCIA 1K0RA 3JC66 4G7OC 3E5SA 5IYBH 2EYJA 2CQOA 3J7ZC 5FJ8G 2JA8G 2BE5C 5LMUL 3L3OC 4K0KL 4NXMQ 2F0OA 1SAPA 1I3QH 2PPBC 3NP8A 3PF5A 2G9DA 3S1QH 2GVAA 3NQTA 1TQOA 2G9HD 3S1NB 5E7NA 1W3SA 3K5MA 5ELCA 2JA7G 4B08A 1D2BA 3M9BA 1IKMA 3CPWA 1S5CD 4R8NA 3HOZH 1TWHB 3TZUA 5IOCA 2EVBA 4LF4L 4IFDH 1UWVA 4HAEA 3D0FA 1S5FD 4TSSA 4C3IH 2OTJA 4TQUS 1HR0W 3CP0A 1PZKD 1V1OA 2C35B 3UDGA 3SK6A 4XQQA 1XMOQ 4RGMA 1KAWA 4JI8Q 4ALPA 4A3FG 2KJXA 2EIFA 1NTGA 2IT1A 2PMZB 3AYHB 2VXWA 1GOZA 4AYBE 4LFBQ 1CK1A 1S5BD 3VR3A 4PMCA 4LF8L 1PLFA 4JBKA 3A0JA 3ERSX 2B2VC 1QNUA 4LFAQ 3G7LA 4QUFA 2HCCA 2NVTB 4GKKL 2ZTEA 1HRJA 1OTCA 4A3GH 4B3ML 2LY7A 1Y14B 1YNXA 4DNIA 4QGUA 1EIFA 2RDFA 2PZUA 5KEEA 4DV7L 1TVXA 1L0XB 3GTGB 3J81c 1A15A 5I9OA 2B2VA 1RIPA 1LV9A 1CKNA 1B2TA 1LTAD 1S5ED 1K73C 2E5LQ 2FINB 2R7FA 1PH3A 1KLGD 2XNAC 2UXBQ 4BY7G 1WJJA 1OO9B 2JA5B 2D2CC 4LF6Q 4NDXA 2HT1A 3CQZH 1PH7A 1SN8A 3NQIA 5FLXL 1I50B 3GTOB 2N55A 2JA6H 1UE7A 3V2TA 5CV4A 3HOVG 5JEAH 4L5QA 4K2KA 3ICEA 1B3QA 3K5OA 3S1RH 4DNRB 5GROA 1E0BA 1TWCB 4APVA 1K8OA 1PDQA 3AU7A 1YNNC 1VQNA 4FF1A 3TS2A 4CKEA 3I4NH 1PYBA 4UAIA 3OTOQ 1J5EL 3ULPA 1MGSA 4XYOA 5DAUA 4LUZA 4X3TA 2VQEL 4EQPA 3U4ZA 4IUPA 2GA4B 1QZGA 4ZUIA 4NW2A 3SK8A 1N32Q 2R7ZH 5IGCA 3H15A 4WRDA 3T53B 3BZKA 2JQOA 2CQAA 4P75A 3HKSA 1OXVA 3WDNA 1ILPA 1WI5A 3OHXC 3CF5A 2E2IH 3OYYA 1STGA 5AJ3L 5D3IB 1SNPA 2A69D 3TN2A 2DJGC 4P71A 1HTLD 3E0EA 1A8VA 1EQQA 4OL7A 1O7ZA 1WD0A 1IBKL 3PF4A 3I4MB 1HA5A 5J1ZA 1I4QA 2VB2X 1PH4A 3BDCA 2SNMA 3K57A 1LABA 3KDFB 4FP5D 3A56A 1TKWB 1BNZA 3KF6B 4PZ7A 4C3HH 4YY3Q 4RCOA 1WCMB 4XTCS 3GV3A 1E1OA 3R3OA 4EX5A 1WTVA 4FNFA 1SSOA 1Z9FA 3F2UA 3MXNA 2UUAL 3HFZB 1SE2A 1STBA 1T9HA 4A3DH 3RD4A 2L4NA 4XT1B 4GKJL 3EVQA 2EJMA 1YITA 5IGDA 2FHTA 4JI4Q 1ENFA 4UPAA 1VS0A 5I2YA 3PIPA 1I6HB 2E2DC 4KTAA 4PQXA 4B3TL 2F3WA 1UEBA 2P5ZX 2WIIB 3M4YA 4HCEA 4A93B 1D1KA 1Q12A 1MJEA 2JSOA 1U4LA 1SFOH 1STHA 4LFCQ 3RUZA 2MUYA 5COYA 2XSCA 1LO5D 3U9OA 4PMWA 5IT9c 3DM3A 1CT1D 2AUKA 1XTCD 4Q5VA 1PRTD 3S15B 2JE6I 3CKIB 1KQSA 1PHJA 5K36H 1E22A 3DEOA 4JI2Q 3J80L 2HIVA 2PYKA 1KRTA 5HGQA 2Y0SE 1DOMA 5CORA 3J81E 1B7YB 1R4QB 1PZJD 1VQOA 1VQPA 4EQOA 4HIMA 1VQLA 5DEHA 5FLMG 3WWVA 2IWHA 4AH6A 4C1NK 3T1HL 3S2DB 1A3VA 1V1PA 3NEMA 3A8JE 3NELA 1B9MA 1KDCA 4ZAIA 1AE2A 5JPNC 5EKKA 2PQEA 3I72A 1I94Q 3VDYA 4A3EB 5KYLA 4DR5L 1H9RA 3H0GH 1WTWA 1NR2A 4GZYC 2JA5G 2YTVA 5EBCA 3PMFA 3B6YA 2MQHA 4G7HC 4PNYA 5C3WA 3RZDH 2E2HB 2ICEC 5CBAE 4K0KQ 2XGTA 4HEDA 3A8KE 3GP7A 3J81i 1SE8A 1UEAB 1XMQL 1EFWA 1B9NA 1HPCA 1J8IA 2JXMB 2FMMA 3NTKA 3CPFA 4KKTA 2E8GA 3AFPA 4C3JH 1PFMA 5JVH3 3I73A 1RD9D 2F1MA 1K9MC 1X56A 4KKSA 3S2HB 1O7IA 2F0LA 3HOWH 2LS01 3BG3A 4YWLA 3C1EA 1DXMA 1TWFB 1EZ8A 4LF7L 4HMIA 3C1FA 1GXDC 4NXML 2SDFA 3QWNA 1X3GA 3CCVA 4R4QA 3I3CA 1K8AC 2NZHA 3VYUA 1JT8A 1PZID 3DMUA 1R9TH 3AMUA 2A6EC 3V05A 4L5SA 1DYQA 3ND8A 1NUCA 1B3AA 1JICA 3KK7A 1EWHA 3T4AC 1SMYC 4LF8Q 3QR8A 5C44B 2KCCA 1KTKA 4PV1C 3OSOA 1GHKA 2WACA 3ER0A 2KCTA 4AIMA 3I4MG 4GKKQ 4O42A 1PRTF 3CMEA 2R3ZA 4B3MQ 4G7ZC 4WJ3M 5KNCA 4GN4B 1QZHA 2OQ0A 3CRKC 4JI8L 4HIDA 2H1EA 1WCMG 3E0JA 4OWWB 3PSIA 4A75A 1YZ6A 2LKVA 4IUVA 3NENA 1TS2A 1NMGA 4JBWA 2K32A 1XJVA 3S14B 4LFBL 3NWSA 4JI6L 5J39A 2Z6BA 4DR4Q 5C3EH 1QVGA 1YJNA 3GD7A 1I4HA 3K5NA 2KBNA 4JK1C 2B29A 1JJCB 3NSWA 3HOUB 1GUSA 5IT9E 3OWEB 3MXNB 2F0QA 3F2DA 1QUQA 3V96A 1RF2D 2F0IA 3HKZB 4A93G 1F2LA 4JI7Q 5I4DA 1XPOA 1YI2A 1F9QA 1WTOA 1J5EQ 2E5LL 2K5QA 4RH6A 5F2DA 1LTBD 4X66Q 1X3FA 5LL6X 2PQAB 5IWAQ 4OGQC 4LW1A 4ILWA 2WB1B 2UUBQ 1DJRD 2JP1A 4ZRZA 4K6LA 2K28A 2VB3X 3U9SA 2Z9HA 2E2JH 1CKMA 4BXXH 3SHLA 1Y8OB 3T1YQ 4ZQ3A 1VQIA 2GVBA 2YU9B 3K0YA 3EJIA 4IOAA 3BYTB 1CM9A 1ONLA 4MN3A 5C4XH 2D9UA 3A7LA 1QCBD 5M3MH 4A3EG 1SYFA 3MA2B 2F0WA 1C8CA 4A3IB 3TREA 4JI5Q 1IW7C 4RHRA 1IBKQ 1GJXA 1P16A 1E2ZA 4HSPA 1K3RA 2F0NA 5JJZA 4YCUA 2V4DA 5E3FA 2EXZA 4B3RL 1SJED 2Z0SA 4A3LH 2EY2A 5M5XH 4HIOA 3X3NA 1Q1BA 4GLXA 2JN4A 1K83B 3VYTA 3K0XA 3CD6A 3F2BA 2A6HD 3DWAA 1PMRA 3RLFA 1P8LA 3NXWA 5G3LD 3D3RA 5KGUA 1PYSB 3X3MA 4DUYQ 3I2ZA 1A3UA 4GKJQ 3PUZA 4KLKA 4U673 3U58A 3I70A 5CMDA 2EYFA 1Y1VB 4JVZA 1ENCA 2X6GA 2A8VA 4B9WA 2KHSA 4FYDA 1AZQA 4E6IA 3OW7A 1I5FA 4A4IA 1NNXA 3LX0A 1DD2A 1G2SA 4KV6A 2JEAI 5J3BA 3HOVH 1L2FA 2F03A 5IGFA 5IYCG 3UDFA 3ULLA 4NXNL 1MKHA 4MTKA 4H7BA 1YNJD 1PTOD 3NBIA 4ABNA 2B39A 3GTPB 1VQ9A 2DNCA 2AHOB 3STBD 1JOOA 3PCOB 4Y7NH 1MI2A 4KY7A 3U50C 1EWCA 3BJUA 5C44G 2D5DA 1HJPA 3E9IA 2KA7A 4JI4L 1C7YA 1VQJA 4AYBB 3HKZE 2NB0A 3HRZC 1OXSC 4R8IA 3KLWA 3N52A 1STAA 1A2UA 3T1HQ 5EKIA 4XYQA 2BDNA 1LACA 2LXJA 4N9PA 3HZXA 1M4VA 3H3VI 4C2MB 4O2DA 2CW0C 1FD7D 1G8ZD 3R2IA 4MHEA 1TWAB 4DAYA 2KEEA 4L63B 4NPSA 3P1HA 2WB1E 4TVAB 4IALA 3EBEA 2EYMA 2XWJB 2F0UA 5CV5A 2RF4A 4JI2L 3PUYA 2QW7A 2K75A 3C3LA 4K5WA 1Q7YC 1XNQQ 1ZYRC 4B3SL 3HOUG 3ITPA 2UXDQ 3MXUA 3R93A 2CVRA 2K52A 3D4WA 3RN5A 5CV9A 1XMQQ 3HKZG 3HOXH 3EA6A 1VMCA 3CCUA 1UAPA 3PO3B 1QB5D 2ATWA 3S1NH 5M3FB 4KHZA 1W2BA 5T1IA 1CSQA 4A3CG 3H91A 2IX1A 5JJKA 4DR1Q 1G91A 2IW3A 1TWHH 4IPGA 1FGBD 4DA2A 1PTOB 4QY7A 2WB1G 4FXKC 5G3LF 2DGYA 1HUMA 4LF5L 2EZVA 1V9PA 4IUTA 5JVG3 4LF7Q 1DOKA 2XVSA 2OCEA 4RKLA 2KVMA 3GTQB 5LMNL 1HZ9A 3IL8A 4DAMA 1JE4A 1RJTA 2UUCQ 4DR6L 3L7ZC 1I4XA 1Z6HA 4RMFA 4KJOA 2F0JA 2L1BA 2NN6H 4HMJA 2CH4W 4A3IG 1CKOA 1PTOF 4RGOS 3RZOB 3DLLA 5A35A 2IPKD 1PVOA 1TS4A 5M9OA 3SGIA 1PFBA 1A6XA 4BBSB 2DNEA 2JJQA 2MFIA 3NK9A 2R93B 4IPHA 2K50A 4DXGA 4H13C 3CC4A 1QVFA 3S16B 2Q2UA 3PO2H 2QCPX 4OO1G 2VY3A 3PUWA 3A5UA 1Y69U 1OXXK 5FOBB 4R1JA 1ENAA 4Y52H 3MEHA 1IL2A 1EFID 1QJOA 2MP1A 4JI6Q 2NBFA 1BXTA 2F0VA 2ID0A 3HP3A 2EE1A 3BVZA 2N3SA 1I3QB 2ZJPA 3HOYB 4BA1I 1S72A 1RTNA 4FO2A 5M5YH 4IO9A 5M5WH 1Y1VG 5CBEE 1PH8A 1SNMA 4GNXA 1I50H 1U5KA 4BBRH 1LT4D 1EIGA 2NTSA 4OONA 2CFMA 4P72A 4GOPC 4IUQA 5IY0A 3HOZB 1AZPA 1D6EC 4S3SA 4JI3Q 5JJLA 4J8QA 5ELOA 1CZWA 2MJ8A 1EU4A 4C3IB 3GTMH 1JCKB 5HY6A 2FXQA 1XYIA 3F1ZA 3QG1A 4K5VA 4DR4L 1KXLA 2WINB 3A7AB 1EWIA 4GOPA 4QCLA 1Y8PB 1WTXA 4AYBG 4A3JB 2IX0A 3CCSA 1IBLQ 3GO5A 3L2PA 3D8GA 4EVOA 1EEID 2KCNA 1K28A 2Y0SB 4ZLTF 2ALYB 2D0PA 5FLXc 3I90A 4DN4M 1B50A 1MSGA 4JI7L 1SJHD 5CYUA 1JB3A 4IPCA 1SYCA 2JYOA 1X3EA 4L8JA 2K5HA 3UI2A 4A3GB 3T16A 2NVXH 1UNSA 1RHPA 1VQMA 4YWKA 2BE5D 4X66L 3BDLA 5JOBA 3SVMA 5IWAL 1D8LA 4IFDI 2UUBL 1ML0D 4DAYB 3P7JA 1L1OB 2A68C 1QG7A 1SNDA 3PIOA 4B3RQ 5A2QE 1KRSA 2HHHL 1R4PB 1VQFA 3T1YL 4V190 2K03A 1O7LA 4DK0A 3PO3G 3KLRA 4KK7A 3CQZB 3NPPA 5BN4A 3Q24A 5M3FG 1FYCA 4KKUA 4KI0A 4DU9A 2JA6B 1EY5A 1GD7A 2L15A 1GO3E 4LAAA 1QILA 2I07B 4DV0Q 4JG2A 4JI5L 4H0LC 3N6RA 2VUMH 4G57A 4UDUC 3CW2C 5KYIA 2F3VA 3QB3A 1L0YB 3FKIH 1WVLA 1Y1WH 3I4NB 1QOHA 5EJWA 5C0XH 4ME5A 2BDOA 3VA7A 4NXNQ 1K8GA 5C3XA 3FMCA 1JR0D 1SNOA 3JAML 4IQZA 4B9XA 3ERQA 2I5MX 1V1QA 1FJGL 2R7ZB 4DUYL 4A3KH 4HJ8A 1I4RA 4BA2I 1JE5A 5BR8Q 2Q8RE 3TP8A 3GDEA 3R8BA 3OWFA 2XTIA 5E1FA 4BBSG 1TY0A 2E2IB 2EYPA 2K5NA 1NR4A 2D0OA 3MFGA 3OW2A 2Q8TA 4A3BB 2R93G 3G6EA 1B1ZA 4DV3Q 1AEXA 3KBXA 3H94A 4QQBX 1VMPA 2Z1CA 5EPKA 2SEBD 1J6QA 1E7ZA 3CRLC 5IYBG 1LTTD 1Q8KA 1M8AA 1ET6A 1NAPA 3HOYG 3KLSA 4C3HB 2ZTDA 2RA4A 3TS0A 5IP7H 5IP9H 4B3SQ 3SE0A 3J80c 1FR3A 5TSSA 4ZKBB 4CJ2C 2EDGA 1YNND 1ASZA 4MNOA 3HOZG 2PI2E 3T51B 1MBYA 1CA6A 1BCPC 4IFDG 2XRSD 1LT5D 5GAGC 2ICIA 4DV6Q 4C3IG 2E76C 3ND9A 1YHQA 1WYDA 1X6OA 3URYA 3L9AX 5FLXE 2WAQB 4N9TA 3UE0A 4OX9L 3TEHB 4Z9CB 2IX3A 1SFOB 4A3JG 3OPOA 1XNQL 2B2YC 4LF5Q 1V8QA 3J7AF 3FDTA 2R92H 4HJAA 1EY4A 4DKAC 1CKNB 2UXDL 1KNAA 3T56B 3BZCA 2B3GA 5LMNQ 2Y0SG 3Q0AA 1GM5A 2L55A 2XWBB 2ZJRA 4FF2A 4DR6Q 2RSNA 4IOCA 4GOPB 3RNUA 1F9SA 1H9SA 1HZBA 3M4OH 1KIXA 1LTGD 4J6HA 2YTXA 1GUWA 3D31A 3KF8A 1TY2A 4DR1L 2B2YA 4A3GG 1K3BC 2E75C 2R61A 3HG9A 3IRBA 5FO7B 1DZ1A 1Q82C 1STEA 5C4ZA 1GVPA 4I7ZC 1A0IA 2I0QA 4DV2Q 4XXEA 2MPMA 2K5DA 3DWQA 3A5ZB 1Q8IA 3K5LA 3DWPA 1ILQA 3K7AH 1IYJB 3MZ5A 4UP7A 1TWGH 3NHHA 3G6JB 4CGYB 2Z4HA 2UUCL 4IJHA 2PW5A 1Y8NB 5CGKA 1JWSD 1JWMD 3TP6A 1VF5C 3RZDB 2HD3A 2JA6G 5DM73 2XRQD 5JEAG 5IYDG 2VW9A 4F88A 3DHQA 4Q0FA 3I4LA 2AQ2B 2B63B 1EOVA 1PA6A 2A74C 3WOFA 3HOUH 4PZ8A 1WD1A 4C3JB 1RCVD 3LGJA 5LHY1 3FPUB 3I4NG 2NTTA 3FHWA 3NTHA 3I7FA 1VQAA 1II3A 5JAVA 5C4JH 2Z4IA 2LFNA 4BY1H 3HOWB 2OEOA 1HFGA 1SR3A 4M1UB 4J1MA 2RBMA 1W6JA 3NBHA 2R7ZG 3QO2A 1C0AA 4UY8C 3TZDA 4KJNA 1HA6A 3K58A 4V0BA 2F0SA 1SYEA 1G51A 4QF4A 5ELNA 1R9TB 5FJ8H 2JA8H 1X54A 3I91A 1G2TA 4A3BG 4QL5A 3GQBA 1SXTA 1E2VA 1U4RA 3GTJH 1VQHA 3QOLA 3ZJYC 1XNRQ 4JI3L 4F8MA 3CU7A 2WAQE 2ZTCA 2YU9H 2JA7H 1A62A 4YHHQ 3KYHC 3K59A 5C6AA 3J80E 3CC7A 2EYLA 1WOCA 1NMFA 4TKOB 3Q6SA 2F0FA 2R7DA 2OXPA 1BKBA 1AE3A 3DUZA 2MHVA 4C3HG 3E9HA 1IBLL 1LT3D 2Q2HA 4IFDJ 1EIYB 3K81C 2PNHA 1DONA 1QE6A 3OMCA 1C4QA 2K01A 1KLUD 2HHHQ 3M3YB 1E24A 4P2CB 4JBMA 3RR5A 4HIKA 4A3FH 1VQBA 1S5DD 1X55A 3IFTA 1TU2B 1LTSD 2PNRC 3BU2A 4R4OA 2DN8A 4F7XA 2BA0A 2B8GA 1F9PA 2ZM6Q 1N36Q 2WAQG 2ZXOA 1Z47A 4FDBA 1V1PB 1A3TA 2HUGA 1XPRA 3J80i 1Y1VH 4K8IA 4HTHA 3FEWX 1F2YA 2CKZB 3PUXA 1Q86C 4ID6A 3GTKB 1ASYA 2A6ED 2YTYA 3I55A 1SYBA 4GLAC 5K36G 3PUVA 3SDZA 1SMYD 5ELBA 4O1NA 1T5EA 1CTMA 4JI1L 2ZT9C 2BH2A 2QDBA 3TSSA 1FJGQ 1BVSA 3C2PA 2E2JB 4GN5A 1D1IA 1V43A 2NVYB 2L9HA 4JC0A 3MXGA 4BY7H 1TXYA 4JW0A 4X64L 4DV0L 4UHVA 3DXJC 3OIPA 2I5LX 5EBDA 1E3PA 4ZCKA 5C4XB 1GUTA 3GTLH 3U4VA 5M3MB 5EQ0A 2A5HA 4DAVA 1BQQT 4ZUJA 3H0GG 1ICFB 2IL8A 1YHAA 2F0PA 5IODA 2AQ3B 1GKHA 2B8FA 5JEAJ 2AWOA 3S1MH 2WKDA 3ULJA 1D5ZC 1TT2A 1U0LA 4N8X1 5GAHC 3VYRA 4H02A 1HH2P 3PV0A 5H1SE 3W1BA 1EYCA 4P73A 2B2UC 1E2WA 3BZDB 5EPLA 5BR8L 4JBJA 1RKNA 5M5XB 2CHBD 2SNSA 4OO1I 3H6MA 2NVQH 3WOEA 3D6WA 2B63G 1VQ7A 2CCZA 1BF4A 5EKLA 2EYHA 3TBIB 5IGEA 2FJ2A 4C3JG 4LNQA 1MHWC 4DV3L 1Q3LA 3KBGA 2RCFA 3HOWG 2F0KA 3PO3H 2B2UA 1JQYD 2KHJA 3LWUA 4DV1Q 2VQFL 4A3MB 1NJIC 1CZGA 3M7GA 1Q46A 1IKLA 2K5WA 1IYVA 1JB7A 3S17H 2A73B 2RDGA 1VQ6A 1O80A 2PW7A 3W2DA 3E3XA 4OX9Q 2UXCQ 2G5DA 3G48A 2ZXRA 5AFWA 1MSHA 4P74A 4I7AA 2WP8J 5CV6A 4JV5Q 3TDQA 1EQTA 1LT6D 2N78A 2QGQA 4UP9A 2F4IA 2OF1A 2SOBA 2A19A 1EY8A 3NBHB 2N88A 2O4XA 3SXHA 2NZ1D 4ZK9B 1C48A 4XQJA 2ZXPA 1IYUA 1U4PA 2EY1A 4LJZC 1HHVA 4CDFC 1EZ6A 1B44D 3VA5A 1KL9A 3AQQA 4EQ5A 1IW7D 4DV6L 1BBUA 4H44C 1MD2D 2JK8A 3CCQA 1QUQB 3OIQA 2RDHA 2OTLA 4X3SA 3MC0B 3MHBA 4AQYQ 4IURA 1UE6A 3VR6A 4QMGA 2EY5A 2MO1A 2HDMA 1RDPD 3HEJA 1AFPA 1PFNA 2C9OA 4IJLA 1G6PA 1FL0A 1SROA 4HSVA 2K04A 4PG3A 1BR9A 1HZCA 1M1KC 1SEBD 2VNUD 3E6ZX 1SE4A 3KDFA 4XIGS 1CSPA 2YYZA 4A76A 4LK1C 3J81j 3KF6A 3W3AA 2VS1A 1JOKA 2A1AA 4QB4A 1YJ9A 4DR7Q 3QIAA 1PH5A 1LUZA 1L0WA 5EGTA 5C5MA 3AB9A 4K6DA 2GN5A 5E4XA 1VQKA 1S40A 3FRPB 1O7YA 4HN7A 1PFSA 1X3PA 1FNWA 4EQNA 3I56A 1Q1EA 2EJGC 4RGNA 4OEMB 4L6TB 3HOXB 4DUZL 3HOYH 1VF7A 2RVLA 1EL0A 3TP5A 3A55A 4DK6C 4DV2L 2NVTH 1STYA 2J0TD 1A63A 3DM1A 5C5LA 4BS9A 4CDCC 2O2LD 3ZYYX 4KY6A 1KDBA 2DUDA 1YVCA 4XDXA 3M7NA 1U4MA 5FLMH 1ET9A 2KOLA 1WTQA 4GNXC 1IL8A 5IE8A 3K7UC 3VYSA 1XPUA 3Q23A 3GTGH 1EOTA 1I4PA 1JOQA 1HUNA 1YEZA 2A69C 2EJFC 1M90C 2EQSA 1VQEA 4BXXG 1KNEA 2QDLA 4JCVE 4C56C 3TRZA 1HR0Q 2IHEA 2JA5H 3CC2A 3S1QB 2IY5B 1HFNA 4L5TA 2HQEA 5IIFA 4A3JH 1BDOA 2K4KA 3GTOH 2QA4A 5C4XG 3PIP3 2BCOA 1PH9A 2CW0D 3AEVA 5M3MG 3EROA 5KRUA 5KNDA 2Z6KC 4KD3A 1LLRD 5I9PA 4K2LA 5HGTA 3SK4A 1DM0B 3S9WA 4DR3L 3EFXD 1UUPA 2H5XA 1A2TA 4YCWA 1TWCH 2WFWA 4BWGB 1EY0A 4GN3B 1HZAA 4J15A 1EYGA 3UDIA 1S4ZA 2O5JC 1ZYRD 3CCRA 3J81L 1HNZQ 2KENA 3H09A 4A3LG 5KIXA 1AH9A 1SNCA 3PO2B 2XN9C 2Z6KA 1EU3A 3DEPA 4JPBW 4HJ9A 4WJ4A 3KJOA 1HQRD 2O5IC 4DV4L 4X62Q 2I46A 3TP7A 4KHPL 1IHZA 3EIVA 1XNRL 2BOSA 2OWOA 4KY5A 3RLNA 2V1CC 5M5YB 2MO0A 5M5WB 2C5CA 4YHHL 1PRTC 4A3MG 2BH8A 3J7YW 4DFAA 4BBRB 2NN6I 3UDXA 1PH6A 5IYDH 5D65A 3O13A 4L5RC 1VQ5A 3I4MH 4R4IA 2K05A 2YV5A 2QKIC 1FVIA 2PCFB 4K5XA 3T13A 3GTMB 4JYAQ 4CDDC 1HNWL 1GUOA 1B8AA 1ZKOA 2K33A 1WCMH 4DXFA 3HGBA 4JI1Q 5JPMC 1WTPA 4IN3A 2NUCA 4WORA 1B70B 4DR2Q 1E1TA 3G4SA 3NWTA 2ZM6L 1N36L 4X64Q 2J4XA 3KFUA 3KLSX 1H9JA 3I4OA 4POFA 4MTNA 3S1RB 1NBWA 3BVGA 5D14A 4OELB 1ZXTA 1SMXA 3KUPA 1I6HH 2F4VL 2KEDA 1EYAA 1EQRA 1JORA 1H9KA 4A3BH 2NWGA 1HNXQ 2NVXB 4A93H 5FO8B 4X3UA 4CBVA 2FMCA 4UP8A 2WKCA 3P75A 4OXPA 3RMHA 4DPGA 5DLQE 4DK1A 1JMCA 3M4PA 2Q2TA 3LWEA 1QNKA 5K5PA 4IUNA 4X65L 1OXTA 3JAMc 3S15H 2PMZE 2VL6A 3HOXG 1S3OA 3FP9A 2R6GA 1KC8C 1KABA 4DAPA 4IPDA 4DF7A 2UU9L 4RWSC 2H4OA 2CH4A 1LTLA 4RHSA 1SRUA 4YIJA 3IKJA 5FKAC 3S2DH 2VUMB 1JJGA 2VQFQ 1ESRA 3LNNA 1RL2A 2EPBA
chains in the Genus database with same CATH topology
4LFAQ 1C0AA 4UY8C 1HJPA 3E9IA 3MEFA 4A3EH 3A74A 3W1GA 1C7YA 1VQJA 4JI4L 2ZTEA 4GKKL 3HKZE 1OXSC 1OTCA 3PGZA 4A3GH 3KLWA 4RG1A 4X6AH 4B3ML 4JI0Q 1Y14B 1YNXA 4DNIA 1G51A 5ELNA 4QGUA 2PQAA 1EIFA 4LF9Q 5FJ8H 3T1HQ 1X54A 2JA8H 4DV7L 2E2HH 4A3BG 4QL5A 3J81c 2LXJA 3GTJH 1VQHA 2NN6G 3ZJYC 1XNRQ 4YWMA 1RIPA 4JI3L 3H3VI 4O2DA 1CKNA 3Q8DA 1H95A 2WAQE 2ZTCA 1K73C 4NPSA 1A62A 2E5LQ 2R7FA 1PH3A 4YHHQ 3KYHC 4TVAB 2WB1E 1N33L 4BY7G 2UXBQ 1IBML 1WJJA 2KCMA 3EBEA 3CC7A 1JJ2A 1WOCA 1NMFA 4DV1L 4GNXB 4LF6Q 2HT1A 3CQZH 1PH7A 2R7DA 2RF4A 1BBWA 4JI2L 1SN8A 3PUYA 1BKBA 1AE3A 2K75A 1FGUA 1Q7YC 1XNQQ 3KJPA 2JA6H 2UXCL 1UE7A 3HOVG 2RHSB 3E9HA 4B3SL 3HOUG 3S2HH 2UXDQ 4L5QA 1IBLL 3PO2G 2Q2HA 2K52A 4HJ5A 3ICEA 5LMNW 3RN5A 4JV5L 4IFDJ 1EIYB 3K81C 2PNHA 3S1RH 1X65A 1XMQQ 5GROA 3HKZG 2MNAA 2HHHQ 1TWFH 3HOXH 4APVA 1E24A 4JBMA 1YBYA 3CCUA 3RR5A 4HIKA 4A3FH 1VQNA 1VQBA 2ATWA 4DV5Q 5IYCH 3S1NH 4KHZA 1W2BA 1X55A 3TS2A 1CSQA 3I4NH 1PYBA 4A3CG 5EAYA 2IX1A 1N34Q 3OTOQ 1J5EL 4DR1Q 3ULPA 5JJKA 3BU2A 5C0XI 4R4OA 3K80C 4LUZA 2RCNA 3CCEA 2VQEL 1TWHH 3U4ZA 4IPGA 1MJCA 2BA0A 2ZM6Q 1N36Q 2WAQG 4BBRG 1QZGA 3RLOA 1Z47A 2Q2IA 5LMUQ 4QY7A 1N32Q 2WB1G 4FDBA 3H15A 5C44H 2R7ZH 2DGYA 4DUZQ 4AQYL 1XPRA 3J80i 4LF5L 1V9PA 3BZKA 1Y1VH 4LF7Q 2JQOA 2OCEA 2AMCB 4P75A 2CKZB 3HKSA 1OXVA 5LMNL 1HZ9A 1WI5A 3PUXA 2I5HA 4DAMA 3G71A 3CF5A 1Q86C 2B63H 1ASYA 2UUCQ 2YTYA 3I55A 4DR6L 4GLAC 2E2IH 3OYYA 5K36G 3PUVA 5AJ3L 1XTDA 3L7ZC 1WFQA 4RMFA 4YCVA 4LF4Q 4JI1L 4P71A 3E0EA 4DR7L 2BH2A 1A8VA 1EQQA 1FJGQ 1BVSA 4A3IG 4GN5A 1SLJA 2RHQB 1V43A 1IBKL 1CKOA 3PF4A 4JC0A 2LSSA 1IZ6A 3DLLA 4BY7H 3S14H 1TXYA 4X64L 1PVOA 4DV0L 2IHFA 1PH4A 3SGIA 3KDFB 4O0AA 2JJQA 2MFIA 2I5LX 2OQKA 3KF6B 4PZ7A 4IPHA 1VQDA 1E3PA 2K50A 4NB3A 4C3HH 4YY3Q 3GTLH 2AWNA 4XTCS 3U4VA 3CC4A 1E1OA 1QVFA 4MZ9A 2Q2UA 3PO2H 4OO1G 3H0GG 2VY3A 4EX5A 3PUWA 3M4QA 1YHAA 4DR3Q 1Z9FA 3A5UA 1OXXK 2UUAL 3HFZB 1GKHA 4R1JA 5JEAJ 4Y52H 2AWOA 3S1MH 1D7QA 1T9HA 1IL2A 3ULJA 4A3DH 3K8AA 4GKJL 4JI6Q 1YITA 1MIUA 4LUVA 2ID0A 1U0LA 5GAHC 4H02A 4JI4Q 3CAMA 1HH2P 4A3CH 2N3SA 3PV0A 4UPAA 5H1SE 2ZJPA 3W1BA 1VS0A 4BA1I 1S72A 4IO9A 5M5YH 5M5WH 4P73A 3PIPA 4B3TL 1Y1VG 5BR8L 3RN2A 4JBJA 1NE3A 3J7A5 1UEBA 3AFQA 4OO1I 1XMOL 1PH8A 1HR0L 4GNXA 2NVQH 1I50H 1U5KA 4DV7Q 2JA9A 4BBRH 1VQ7A 2B63G 2CCZA 4P72A 4OONA 4GOPC 2CFMA 1Q12A 1MJEA 5IY0A 1SFOH 4LNQA 4LFCQ 4JI3Q 5JJLA 5GAEC 5ELOA 4DV3L 4DV4Q 3M85A 3M3YH 5IT9c 4PMWA 4KHPQ 3DM3A 3GTMH 3HOWG 3PO3H 5HY6A 2JE6I 2EXDA 3CCJA 2KHJA 4R4CA 2FXQA 1KQSA 4DV1Q 1PHJA 2VQFL 2ZJQA 3F1ZA 2VUMG 1E22A 1NJIC 4JI2Q 3STBC 1Q46A 2HIVA 3JAMi 1KRTA 1JB7A 5HGQA 2Y0SE 4LFAL 3S17H 4DR4L 1VQ6A 1KXLA 2QEXA 4GOPA 1EWIA 4OX9Q 1LYLA 3FKIG 2UXCQ 3S24A 4AYBG 1B7YB 1Y1WG 2IX0A 1N9WA 3G48A 3CCSA 3GO5A 4A3IH 4P74A 3L2PA 1HNZL 1IBLQ 2WP8J 4GS3A 5C0XG 1VQOA 4JV5Q 1VQPA 4HIMA 2N78A 2QGQA 1VQLA 4UP9A 1X9NA 3T1HL 5FLMG 3WWVA 4AH6A 2CWAA 2A19A 3KOJA 3NBHB 2ALYB 2D0PA 5FLXc 3CCLA 2HQLA 1HNWQ 3NEMA 3NELA 4JI7L 1AE2A 4A3DG 4IPCA 1KD1C 4A3KG 3GTKH 1I94Q 4X62L 1PV4A 3VDYA 1X3EA 4EQ5A 4DR5L 1KL9A 3AQQA 3H0GH 2VQEQ 4HJ7A 4DV6L 2UXBL 1K83H 1QVCA 1BBUA 2K5HA 2JA5G 2NVXH 4LF6L 2JK8A 2YTVA 3CCQA 1VQMA 1QUQB 4YWKA 4X66L 3F2CA 1EUJA 3B6YA 2MQHA 2OTLA 5IWAL 1D8LA 4AQYQ 2K5VA 5GQOA 3RZDH 4BXXG 1UE6A 4IFDI 2NVYH 2UUBL 4K0KQ 3W5OA 2XGTA 4DAYB 2MO1A 3H3VH 1L1OB 2K14A 3J81i 1SE8A 1XMQL 3PIOA 1EFWA 2F4VQ 4B3RQ 1KRSA 2HHHL 1IXRA 4IJLA 1G6PA 1FL0A 1SROA 4PG3A 1M1KC 1VQFA 1HZCA 3T1YL 4JYAL 2VNUD 5AJ3Q 3CPFA 3KDFA 4XIGS 1CSPA 2YYZA 4A76A 3PO3G 3CMAA 2E8GA 3J81j 3AFPA 3KF6A 4C3JH 5M3FG 2F52A 2VS1A 2A1AA 3OTOL 4QJFA 1YJ9A 4DR7Q 2YU9H 1PH5A 4KI0A 1LUZA 1L0WA 1VQ8A 1K9MC 1X56A 1GD7A 2GN5A 1VQKA 1O7IA 2L15A 5IP9G 1GO3E 5IP7G 1S40A 3GTPH 4X65Q 1PFSA 3HOWH 2CWPA 4DV0Q 4JG2A 4JI5L 4DR2L 3I56A 1Q1EA 2N8NA 4YWLA 2VUMH 1N32L 5JJIA 3F8TA 4DUZL 2F3IA 3HOYH 3CW2C 4LF7L 4DK6C 4DV2L 2NVTH 4PZ6A 3FKIH 4NXML 1YHBA 1X3GA 3CCVA 1Y1WH 4R4QA 1A63A 1K8AC 1PH1A 2NZHA 4NXNQ 3KF8B 1K8GA 2UU9Q 2R7ZG 2DUDA 4LUOA 1YVCA 1JT8A 2UUAQ 3M7NA 1R9TH 5FLMH 2HIXA 1VQGA 4GNXC 5IE8A 3K7UC 4L5SA 1XPUA 1HNXL 3GTGH 1DGSA 1YEZA 2I5MX 1V1QA 1FJGL 4LF8Q 1YIJA 4C2MH 4DUYL 4A3KH 2ASBA 1M90C 2EQSA 3CXCA 4HJ8A 1TWAH 4BA2I 1JE5A 3ER0A 1VQEA 2KCTA 5BR8Q 4AIMA 4JCVE 4B3TQ 4A3MH 2R92G 3I4MG 3TRZA 4GKKQ 3GDEA 1HR0Q 4POGA 2IHEA 2JA5H 3CMEA 3CC2A 2XTIA 4LWCA 2IY5B 4B3MQ 3CCMA 4L5TA 4BBSG 4WJ3M 3L0OA 4GN4B 4A3JH 2K5NA 2D0OA 2K4KA 1QZHA 2N49A 2OQ0A 4HIDA 4JI8L 4YY3L 3OW2A 3G6EA 3GTOH 2R93G 2QA4A 5C4XG 4DK3C 1WCMG 1PH9A 4OWWB 3PSIA 2JA7H 5M3MG 4DV3Q 3AEVA 1YJWA 4QQBX 2Z6KC 4A75A 4GLVB 1YZ6A 5GADC 4DR3L 3NENA 2H5XA 1J6QA 1NMGA 4JBWA 4YCWA 4JOIC 1XJVA 1E7ZA 5IYBG 1N33Q 4ME3A 1Q8KA 1TWCH 2WFWA 4LFBL 1IBMQ 4JI6L 4DR4Q 4QIWE 2KHIA 5C3EH 4GN3B 1QVGA 1HZAA 1YJNA 5M3FH 4J15A 3GD7A 4OWXB 1EYGA 3UDIA 1L1OC 2KBNA 3UE1A 1UE1A 3CCRA 3HOYG 1HNZQ 1NY4A 2B29A 2KENA 2ZTDA 2PI2A 1JJCB 4A3LG 3TS0A 1AH9A 5IP7H 5IP9H 4B3SQ 2Z6KA 3MXNB 3F2DA 1VQCA 1QUQA 4JI0L 3J80c 1LM0A 4HJ9A 4WJ4A 4JOIA 1N8RC 4A93G 1CUKA 3KJOA 1ASZA 4LF9L 4JI7Q 4MNOA 4LFCL 3HOZG 2PI2E 1RL2A 4DV4L 4IFDG 4X62Q 3GTQH 1L1OA 4KHPL 3EIVA 1XPOA 4DR5Q 2OWOA 1XNRL 5GAGC 4R4TA 4DV6Q 3RLNA 1YI2A 3EN2A 2V1CC 1J5EQ 1YHQA 1C9OA 1WYDA 1X6OA 2BA1A 2MO0A 2E5LL 4YHHL 1Q81C 4X66Q 4A3MG 3ERSX 1X3FA 2NZOA 5C0XJ 1PH2A 1KHIA 2BH8A 2LXKA 2PQAB 1OXUA 5IWAQ 3UE0A 4LW1A 4OX9L 3TEHB 1UE5A 2UUBQ 2NN6I 3UDXA 1PH6A 5IYDH 4A3JG 4L5RC 1VQ5A 1XNQL 2E2JH 4LF5Q 1CKMA 1G291 3I4MH 2R92H 4R4IA 4HJAA 1VQ4A 2VZAA 4DKAC 1CKNB 4BXXH 3RZOH 2YV5A 2UXDL 2ES2A 2AKWB 3BZCA 2B3GA 1FVIA 5LMNQ 3T1YQ 2Y0SG 1GM5A 4JYAQ 1VQIA 4BY1G 1HNWL 4BBSH 2GVBA 2ZJRA 4DR6Q 4IOAA 4IOCA 4GOPB 3RNUA 2JEBI 2R93H 1B8AA 1HZBA 5C4XH 1I94L 3M4OH 1KIXA 1WCMH 4DV5L 3TQYA 5C3EG 5M3MH 2D62A 4JI1Q 4A3EG 2YTXA 4OWTB 3D31A 3S16H 1N34L 4DR1L 1VCIA 1K0RA 3JC66 3TREA 4A3GG 4JI5Q 3IRBA 5IYBH 1B70B 4DR2Q 1IBKQ 1P16A 2CQOA 1E1TA 1Q82C 3J7ZC 3G4SA 2ZM6L 5FJ8G 4X64Q 1N36L 2JA8G 1K3RA 3KFUA 1GVPA 1A0IA 5LMUL 4DV2Q 2I0QA 3I4OA 4K0KL 4POFA 4MTNA 4NXMQ 4YCUA 1NBWA 1I3QH 3PF5A 3A5ZB 1SMXA 3S1QH 1I6HH 2F4VL 4B3RL 2GVAA 2Z0SA 4A3LH 3K7AH 5M5XH 5E7NA 1IYJB 1W3SA 4HIOA 2JA7G 4UP7A 1Q1BA 1EQRA 4GLXA 1TWGH 3K0XA 3CD6A 3F2BA 3M9BA 4A3BH 2UUCL 4IJHA 3CPWA 1HNXQ 4A93H 3RLFA 1P8LA 3HOZH 4UP8A 4OXPA 4DPGA 5DLQE 1PYSB 4DUYQ 3I2ZA 4LF4L 4GKJQ 1JMCA 3M4PA 1UWVA 2Q2TA 3PUZA 2JA6G 3D0FA 4KLKA 3U58A 4X65L 4C3IH 5JEAG 5IYDG 2OTJA 4TQUS 1OXTA 3JAMc 3S15H 1HR0W 2VW9A 2A8VA 2PMZE 3CP0A 2C35B 3UDGA 2VL6A 1I5FA 3HOXG 4A4IA 1S3OA 1XMOQ 3FP9A 1KAWA 2R6GA 5J3BA 1EOVA 4JI8Q 4ALPA 4A3FG 1PA6A 2JEAI 1L2FA 2EIFA 1KC8C 3HOUH 3HOVH 4PZ8A 3UDFA 5IYCG 3LGJA 3ULLA 4IPDA 3I4NG 4NXNL 2UU9L 1VQAA 3FHWA 1MKHA 1NTGA 2IT1A 3I7FA 1LTLA 3AYHB 5C4JH 1SRUA 4AYBE 4LFBQ 1VQ9A 4BY1H 3S2DH 2AHOB 3STBD 3PCOB 4Y7NH 1JJGA 1SR3A 3U50C 4LF8L 2VQFQ 4JBKA 3A0JA 3BJUA 5C44G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LFA Q;  1C0A A;  4UY8 C;  1HJP A;  3E9I A;  3MEF A;  4A3E H;  3A74 A;  3W1G A;  1C7Y A;  1VQJ A;  4JI4 L;  2ZTE A;  4GKK L;  3HKZ E;  1OXS C;  1OTC A;  3PGZ A;  4A3G H;  3KLW A;  4RG1 A;  4X6A H;  4B3M L;  4JI0 Q;  1Y14 B;  1YNX A;  4DNI A;  1G51 A;  5ELN A;  4QGU A;  2PQA A;  1EIF A;  4LF9 Q;  5FJ8 H;  3T1H Q;  1X54 A;  2JA8 H;  4DV7 L;  2E2H H;  4A3B G;  4QL5 A;  3J81 c;  2LXJ A;  3GTJ H;  1VQH A;  2NN6 G;  3ZJY C;  1XNR Q;  4YWM A;  1RIP A;  4JI3 L;  3H3V I;  4O2D A;  1CKN A;  3Q8D A;  1H95 A;  2WAQ E;  2ZTC A;  1K73 C;  4NPS A;  1A62 A;  2E5L Q;  2R7F A;  1PH3 A;  4YHH Q;  3KYH C;  4TVA B;  2WB1 E;  1N33 L;  4BY7 G;  2UXB Q;  1IBM L;  1WJJ A;  2KCM A;  3EBE A;  3CC7 A;  1JJ2 A;  1WOC A;  1NMF A;  4DV1 L;  4GNX B;  4LF6 Q;  2HT1 A;  3CQZ H;  1PH7 A;  2R7D A;  2RF4 A;  1BBW A;  4JI2 L;  1SN8 A;  3PUY A;  1BKB A;  1AE3 A;  2K75 A;  1FGU A;  1Q7Y C;  1XNQ Q;  3KJP A;  2JA6 H;  2UXC L;  1UE7 A;  3HOV G;  2RHS B;  3E9H A;  4B3S L;  3HOU G;  3S2H H;  2UXD Q;  4L5Q A;  1IBL L;  3PO2 G;  2Q2H A;  2K52 A;  4HJ5 A;  3ICE A;  5LMN W;  3RN5 A;  4JV5 L;  4IFD J;  1EIY B;  3K81 C;  2PNH A;  3S1R H;  1X65 A;  1XMQ Q;  5GRO A;  3HKZ G;  2MNA A;  2HHH Q;  1TWF H;  3HOX H;  4APV A;  1E24 A;  4JBM A;  1YBY A;  3CCU A;  3RR5 A;  4HIK A;  4A3F H;  1VQN A;  1VQB A;  2ATW A;  4DV5 Q;  5IYC H;  3S1N H;  4KHZ A;  1W2B A;  1X55 A;  3TS2 A;  1CSQ A;  3I4N H;  1PYB A;  4A3C G;  5EAY A;  2IX1 A;  1N34 Q;  3OTO Q;  1J5E L;  4DR1 Q;  3ULP A;  5JJK A;  3BU2 A;  5C0X I;  4R4O A;  3K80 C;  4LUZ A;  2RCN A;  3CCE A;  2VQE L;  1TWH H;  3U4Z A;  4IPG A;  1MJC A;  2BA0 A;  2ZM6 Q;  1N36 Q;  2WAQ G;  4BBR G;  1QZG A;  3RLO A;  1Z47 A;  2Q2I A;  5LMU Q;  4QY7 A;  1N32 Q;  2WB1 G;  4FDB A;  3H15 A;  5C44 H;  2R7Z H;  2DGY A;  4DUZ Q;  4AQY L;  1XPR A;  3J80 i;  4LF5 L;  1V9P A;  3BZK A;  1Y1V H;  4LF7 Q;  2JQO A;  2OCE A;  2AMC B;  4P75 A;  2CKZ B;  3HKS A;  1OXV A;  5LMN L;  1HZ9 A;  1WI5 A;  3PUX A;  2I5H A;  4DAM A;  3G71 A;  3CF5 A;  1Q86 C;  2B63 H;  1ASY A;  2UUC Q;  2YTY A;  3I55 A;  4DR6 L;  4GLA C;  2E2I H;  3OYY A;  5K36 G;  3PUV A;  5AJ3 L;  1XTD A;  3L7Z C;  1WFQ A;  4RMF A;  4YCV A;  4LF4 Q;  4JI1 L;  4P71 A;  3E0E A;  4DR7 L;  2BH2 A;  1A8V A;  1EQQ A;  1FJG Q;  1BVS A;  4A3I G;  4GN5 A;  1SLJ A;  2RHQ B;  1V43 A;  1IBK L;  1CKO A;  3PF4 A;  4JC0 A;  2LSS A;  1IZ6 A;  3DLL A;  4BY7 H;  3S14 H;  1TXY A;  4X64 L;  1PVO A;  4DV0 L;  2IHF A;  1PH4 A;  3SGI A;  3KDF B;  4O0A A;  2JJQ A;  2MFI A;  2I5L X;  2OQK A;  3KF6 B;  4PZ7 A;  4IPH A;  1VQD A;  1E3P A;  2K50 A;  4NB3 A;  4C3H H;  4YY3 Q;  3GTL H;  2AWN A;  4XTC S;  3U4V A;  3CC4 A;  1E1O A;  1QVF A;  4MZ9 A;  2Q2U A;  3PO2 H;  4OO1 G;  3H0G G;  2VY3 A;  4EX5 A;  3PUW A;  3M4Q A;  1YHA A;  4DR3 Q;  1Z9F A;  3A5U A;  1OXX K;  2UUA L;  3HFZ B;  1GKH A;  4R1J A;  5JEA J;  4Y52 H;  2AWO A;  3S1M H;  1D7Q A;  1T9H A;  1IL2 A;  3ULJ A;  4A3D H;  3K8A A;  4GKJ L;  4JI6 Q;  1YIT A;  1MIU A;  4LUV A;  2ID0 A;  1U0L A;  5GAH C;  4H02 A;  4JI4 Q;  3CAM A;  1HH2 P;  4A3C H;  2N3S A;  3PV0 A;  4UPA A;  5H1S E;  2ZJP A;  3W1B A;  1VS0 A;  4BA1 I;  1S72 A;  4IO9 A;  5M5Y H;  5M5W H;  4P73 A;  3PIP A;  4B3T L;  1Y1V G;  5BR8 L;  3RN2 A;  4JBJ A;  1NE3 A;  3J7A 5;  1UEB A;  3AFQ A;  4OO1 I;  1XMO L;  1PH8 A;  1HR0 L;  4GNX A;  2NVQ H;  1I50 H;  1U5K A;  4DV7 Q;  2JA9 A;  4BBR H;  1VQ7 A;  2B63 G;  2CCZ A;  4P72 A;  4OON A;  4GOP C;  2CFM A;  1Q12 A;  1MJE A;  5IY0 A;  1SFO H;  4LNQ A;  4LFC Q;  4JI3 Q;  5JJL A;  5GAE C;  5ELO A;  4DV3 L;  4DV4 Q;  3M85 A;  3M3Y H;  5IT9 c;  4PMW A;  4KHP Q;  3DM3 A;  3GTM H;  3HOW G;  3PO3 H;  5HY6 A;  2JE6 I;  2EXD A;  3CCJ A;  2KHJ A;  4R4C A;  2FXQ A;  1KQS A;  4DV1 Q;  1PHJ A;  2VQF L;  2ZJQ A;  3F1Z A;  2VUM G;  1E22 A;  1NJI C;  4JI2 Q;  3STB C;  1Q46 A;  2HIV A;  3JAM i;  1KRT A;  1JB7 A;  5HGQ A;  2Y0S E;  4LFA L;  3S17 H;  4DR4 L;  1VQ6 A;  1KXL A;  2QEX A;  4GOP A;  1EWI A;  4OX9 Q;  1LYL A;  3FKI G;  2UXC Q;  3S24 A;  4AYB G;  1B7Y B;  1Y1W G;  2IX0 A;  1N9W A;  3G48 A;  3CCS A;  3GO5 A;  4A3I H;  4P74 A;  3L2P A;  1HNZ L;  1IBL Q;  2WP8 J;  4GS3 A;  5C0X G;  1VQO A;  4JV5 Q;  1VQP A;  4HIM A;  2N78 A;  2QGQ A;  1VQL A;  4UP9 A;  1X9N A;  3T1H L;  5FLM G;  3WWV A;  4AH6 A;  2CWA A;  2A19 A;  3KOJ A;  3NBH B;  2ALY B;  2D0P A;  5FLX c;  3CCL A;  2HQL A;  1HNW Q;  3NEM A;  3NEL A;  4JI7 L;  1AE2 A;  4A3D G;  4IPC A;  1KD1 C;  4A3K G;  3GTK H;  1I94 Q;  4X62 L;  1PV4 A;  3VDY A;  1X3E A;  4EQ5 A;  4DR5 L;  1KL9 A;  3AQQ A;  3H0G H;  2VQE Q;  4HJ7 A;  4DV6 L;  2UXB L;  1K83 H;  1QVC A;  1BBU A;  2K5H A;  2JA5 G;  2NVX H;  4LF6 L;  2JK8 A;  2YTV A;  3CCQ A;  1VQM A;  1QUQ B;  4YWK A;  4X66 L;  3F2C A;  1EUJ A;  3B6Y A;  2MQH A;  2OTL A;  5IWA L;  1D8L A;  4AQY Q;  2K5V A;  5GQO A;  3RZD H;  4BXX G;  1UE6 A;  4IFD I;  2NVY H;  2UUB L;  4K0K Q;  3W5O A;  2XGT A;  4DAY B;  2MO1 A;  3H3V H;  1L1O B;  2K14 A;  3J81 i;  1SE8 A;  1XMQ L;  3PIO A;  1EFW A;  2F4V Q;  4B3R Q;  1KRS A;  2HHH L;  1IXR A;  4IJL A;  1G6P A;  1FL0 A;  1SRO A;  4PG3 A;  1M1K C;  1VQF A;  1HZC A;  3T1Y L;  4JYA L;  2VNU D;  5AJ3 Q;  3CPF A;  3KDF A;  4XIG S;  1CSP A;  2YYZ A;  4A76 A;  3PO3 G;  3CMA A;  2E8G A;  3J81 j;  3AFP A;  3KF6 A;  4C3J H;  5M3F G;  2F52 A;  2VS1 A;  2A1A A;  3OTO L;  4QJF A;  1YJ9 A;  4DR7 Q;  2YU9 H;  1PH5 A;  4KI0 A;  1LUZ A;  1L0W A;  1VQ8 A;  1K9M C;  1X56 A;  1GD7 A;  2GN5 A;  1VQK A;  1O7I A;  2L15 A;  5IP9 G;  1GO3 E;  5IP7 G;  1S40 A;  3GTP H;  4X65 Q;  1PFS A;  3HOW H;  2CWP A;  4DV0 Q;  4JG2 A;  4JI5 L;  4DR2 L;  3I56 A;  1Q1E A;  2N8N A;  4YWL A;  2VUM H;  1N32 L;  5JJI A;  3F8T A;  4DUZ L;  2F3I A;  3HOY H;  3CW2 C;  4LF7 L;  4DK6 C;  4DV2 L;  2NVT H;  4PZ6 A;  3FKI H;  4NXM L;  1YHB A;  1X3G A;  3CCV A;  1Y1W H;  4R4Q A;  1A63 A;  1K8A C;  1PH1 A;  2NZH A;  4NXN Q;  3KF8 B;  1K8G A;  2UU9 Q;  2R7Z G;  2DUD A;  4LUO A;  1YVC A;  1JT8 A;  2UUA Q;  3M7N A;  1R9T H;  5FLM H;  2HIX A;  1VQG A;  4GNX C;  5IE8 A;  3K7U C;  4L5S A;  1XPU A;  1HNX L;  3GTG H;  1DGS A;  1YEZ A;  2I5M X;  1V1Q A;  1FJG L;  4LF8 Q;  1YIJ A;  4C2M H;  4DUY L;  4A3K H;  2ASB A;  1M90 C;  2EQS A;  3CXC A;  4HJ8 A;  1TWA H;  4BA2 I;  1JE5 A;  3ER0 A;  1VQE A;  2KCT A;  5BR8 Q;  4AIM A;  4JCV E;  4B3T Q;  4A3M H;  2R92 G;  3I4M G;  3TRZ A;  4GKK Q;  3GDE A;  1HR0 Q;  4POG A;  2IHE A;  2JA5 H;  3CME A;  3CC2 A;  2XTI A;  4LWC A;  2IY5 B;  4B3M Q;  3CCM A;  4L5T A;  4BBS G;  4WJ3 M;  3L0O A;  4GN4 B;  4A3J H;  2K5N A;  2D0O A;  2K4K A;  1QZH A;  2N49 A;  2OQ0 A;  4HID A;  4JI8 L;  4YY3 L;  3OW2 A;  3G6E A;  3GTO H;  2R93 G;  2QA4 A;  5C4X G;  4DK3 C;  1WCM G;  1PH9 A;  4OWW B;  3PSI A;  2JA7 H;  5M3M G;  4DV3 Q;  3AEV A;  1YJW A;  4QQB X;  2Z6K C;  4A75 A;  4GLV B;  1YZ6 A;  5GAD C;  4DR3 L;  3NEN A;  2H5X A;  1J6Q A;  1NMG A;  4JBW A;  4YCW A;  4JOI C;  1XJV A;  1E7Z A;  5IYB G;  1N33 Q;  4ME3 A;  1Q8K A;  1TWC H;  2WFW A;  4LFB L;  1IBM Q;  4JI6 L;  4DR4 Q;  4QIW E;  2KHI A;  5C3E H;  4GN3 B;  1QVG A;  1HZA A;  1YJN A;  5M3F H;  4J15 A;  3GD7 A;  4OWX B;  1EYG A;  3UDI A;  1L1O C;  2KBN A;  3UE1 A;  1UE1 A;  3CCR A;  3HOY G;  1HNZ Q;  1NY4 A;  2B29 A;  2KEN A;  2ZTD A;  2PI2 A;  1JJC B;  4A3L G;  3TS0 A;  1AH9 A;  5IP7 H;  5IP9 H;  4B3S Q;  2Z6K A;  3MXN B;  3F2D A;  1VQC A;  1QUQ A;  4JI0 L;  3J80 c;  1LM0 A;  4HJ9 A;  4WJ4 A;  4JOI A;  1N8R C;  4A93 G;  1CUK A;  3KJO A;  1ASZ A;  4LF9 L;  4JI7 Q;  4MNO A;  4LFC L;  3HOZ G;  2PI2 E;  1RL2 A;  4DV4 L;  4IFD G;  4X62 Q;  3GTQ H;  1L1O A;  4KHP L;  3EIV A;  1XPO A;  4DR5 Q;  2OWO A;  1XNR L;  5GAG C;  4R4T A;  4DV6 Q;  3RLN A;  1YI2 A;  3EN2 A;  2V1C C;  1J5E Q;  1YHQ A;  1C9O A;  1WYD A;  1X6O A;  2BA1 A;  2MO0 A;  2E5L L;  4YHH L;  1Q81 C;  4X66 Q;  4A3M G;  3ERS X;  1X3F A;  2NZO A;  5C0X J;  1PH2 A;  1KHI A;  2BH8 A;  2LXK A;  2PQA B;  1OXU A;  5IWA Q;  3UE0 A;  4LW1 A;  4OX9 L;  3TEH B;  1UE5 A;  2UUB Q;  2NN6 I;  3UDX A;  1PH6 A;  5IYD H;  4A3J G;  4L5R C;  1VQ5 A;  1XNQ L;  2E2J H;  4LF5 Q;  1CKM A;  1G29 1;  3I4M H;  2R92 H;  4R4I A;  4HJA A;  1VQ4 A;  2VZA A;  4DKA C;  1CKN B;  4BXX H;  3RZO H;  2YV5 A;  2UXD L;  2ES2 A;  2AKW B;  3BZC A;  2B3G A;  1FVI A;  5LMN Q;  3T1Y Q;  2Y0S G;  1GM5 A;  4JYA Q;  1VQI A;  4BY1 G;  1HNW L;  4BBS H;  2GVB A;  2ZJR A;  4DR6 Q;  4IOA A;  4IOC A;  4GOP B;  3RNU A;  2JEB I;  2R93 H;  1B8A A;  1HZB A;  5C4X H;  1I94 L;  3M4O H;  1KIX A;  1WCM H;  4DV5 L;  3TQY A;  5C3E G;  5M3M H;  2D62 A;  4JI1 Q;  4A3E G;  2YTX A;  4OWT B;  3D31 A;  3S16 H;  1N34 L;  4DR1 L;  1VCI A;  1K0R A;  3JC6 6;  3TRE A;  4A3G G;  4JI5 Q;  3IRB A;  5IYB H;  1B70 B;  4DR2 Q;  1IBK Q;  1P16 A;  2CQO A;  1E1T A;  1Q82 C;  3J7Z C;  3G4S A;  2ZM6 L;  5FJ8 G;  4X64 Q;  1N36 L;  2JA8 G;  1K3R A;  3KFU A;  1GVP A;  1A0I A;  5LMU L;  4DV2 Q;  2I0Q A;  3I4O A;  4K0K L;  4POF A;  4MTN A;  4NXM Q;  4YCU A;  1NBW A;  1I3Q H;  3PF5 A;  3A5Z B;  1SMX A;  3S1Q H;  1I6H H;  2F4V L;  4B3R L;  2GVA A;  2Z0S A;  4A3L H;  3K7A H;  5M5X H;  5E7N A;  1IYJ B;  1W3S A;  4HIO A;  2JA7 G;  4UP7 A;  1Q1B A;  1EQR A;  4GLX A;  1TWG H;  3K0X A;  3CD6 A;  3F2B A;  3M9B A;  4A3B H;  2UUC L;  4IJH A;  3CPW A;  1HNX Q;  4A93 H;  3RLF A;  1P8L A;  3HOZ H;  4UP8 A;  4OXP A;  4DPG A;  5DLQ E;  1PYS B;  4DUY Q;  3I2Z A;  4LF4 L;  4GKJ Q;  1JMC A;  3M4P A;  1UWV A;  2Q2T A;  3PUZ A;  2JA6 G;  3D0F A;  4KLK A;  3U58 A;  4X65 L;  4C3I H;  5JEA G;  5IYD G;  2OTJ A;  4TQU S;  1OXT A;  3JAM c;  3S15 H;  1HR0 W;  2VW9 A;  2A8V A;  2PMZ E;  3CP0 A;  2C35 B;  3UDG A;  2VL6 A;  1I5F A;  3HOX G;  4A4I A;  1S3O A;  1XMO Q;  3FP9 A;  1KAW A;  2R6G A;  5J3B A;  1EOV A;  4JI8 Q;  4ALP A;  4A3F G;  1PA6 A;  2JEA I;  1L2F A;  2EIF A;  1KC8 C;  3HOU H;  3HOV H;  4PZ8 A;  3UDF A;  5IYC G;  3LGJ A;  3ULL A;  4IPD A;  3I4N G;  4NXN L;  2UU9 L;  1VQA A;  3FHW A;  1MKH A;  1NTG A;  2IT1 A;  3I7F A;  1LTL A;  3AYH B;  5C4J H;  1SRU A;  4AYB E;  4LFB Q;  1VQ9 A;  4BY1 H;  3S2D H;  2AHO B;  3STB D;  3PCO B;  4Y7N H;  1JJG A;  1SR3 A;  3U50 C;  4LF8 L;  2VQF Q;  4JBK A;  3A0J A;  3BJU A;  5C44 G; 
#chains in the Genus database with same CATH topology
 3MWY W;  3NE5 B;  3MEF A;  3FKI B;  3A74 A;  3BYY B;  3W1G A;  4CKB A;  4A3E H;  1Y1W B;  1HQM C;  1F77 A;  1BUV T;  3R2T A;  2K1B A;  3PGZ A;  4RG1 A;  4X6A H;  1X3Q A;  2DY7 A;  3VR4 A;  4JI0 Q;  3D6C A;  2QIL A;  5IT9 L;  2F0M A;  4RA8 A;  4NP5 A;  1W6K A;  4K8J A;  2PQA A;  4LF9 Q;  2AUJ D;  2F0H A;  2E2H H;  1F2Z A;  1CFM A;  1SE3 A;  4RAU C;  2NN6 G;  4A3D B;  4YWM A;  2TSS A;  4A3K B;  3MVV A;  3Q8D A;  1H95 A;  3BS1 A;  1N33 L;  1IBM L;  2KCM A;  1AP0 A;  1JJ2 A;  2M9V A;  4GNX B;  4DV1 L;  3D4D A;  3NTI A;  1JWU D;  1G6Z A;  1BBW A;  1FGU A;  3A54 A;  2HDL A;  3KJP A;  2A68 D;  2UXC L;  2RHS B;  3S2H H;  2ENB A;  1Z7T A;  3PO2 G;  4HJ5 A;  2XIW A;  3OMG A;  5LMN W;  4JV5 L;  4ZKC B;  1X65 A;  2K6A A;  2MNA A;  1XWE A;  1CA5 A;  1TWF H;  2RQX A;  1D5M C;  1YBY A;  4WJW A;  2B2T C;  4DV5 Q;  5IYC H;  2DY8 A;  3H3V C;  5EAY A;  4MIU A;  1N34 Q;  4RKB A;  5C0X I;  4KMU C;  3K80 C;  2EYO A;  2RCN A;  3CCE A;  1EYD A;  2EY6 A;  1D5X C;  1MJC A;  2EOT A;  1K0S A;  4BBR G;  3RLO A;  5LMU Q;  2Q2I A;  4I65 A;  5C44 H;  4DUZ Q;  4AQY L;  1EEF D;  3C46 A;  2B2T A;  2AMC B;  1CQV A;  1HXY D;  5BN5 A;  2I5H A;  3G71 A;  2B63 H;  5EPJ A;  4DGZ A;  1PYW D;  3MTS A;  4ZYS A;  4G4K A;  1ICW A;  3H0G B;  1XTD A;  2NYZ D;  2PZT A;  1WFQ A;  4YCV A;  4LF4 Q;  3FVQ A;  4DR7 L;  5LL6 S;  4QUC A;  5J22 A;  4FF4 A;  2KEC A;  1SLJ A;  1TR5 A;  2RHQ B;  3QOJ A;  1KAA A;  2R92 B;  1TII D;  2LSS A;  1IZ6 A;  3S14 H;  3MXP A;  1X32 A;  4XQN A;  5I6W A;  1PRT B;  2IHF A;  4EGV A;  3IFD A;  4FVM A;  4KD4 A;  4O0A A;  1HCZ A;  1K8M A;  1STN A;  3QJY A;  4U68 A;  1NSN S;  2OQK A;  4NB3 A;  1VQD A;  5T1G A;  4CHT B;  1AW7 A;  3M4O B;  2AWN A;  4MZ9 A;  4C1N I;  4CJ1 B;  3JAM E;  2M00 A;  5I6Y A;  3M4Q A;  4DR3 Q;  1JC7 A;  5DM6 3;  3PQI A;  4KHV A;  1D7Q A;  1DOL A;  2A6H C;  3K8A A;  1LTR D;  1MIU A;  4LUV A;  2RSO A;  3CAM A;  4A3C H;  1F9R A;  4WFN 3;  3RN2 A;  2TMP A;  3J7A 5;  1NE3 A;  3K7A B;  3VR5 A;  3NUC A;  3AFQ A;  1XMO L;  1HR0 L;  5C4H A;  1TWG B;  4DV7 Q;  2JA9 A;  5CV7 A;  2M2L A;  1EY6 A;  1BCP D;  2Z8L A;  4FF3 A;  5GAE C;  1B4O A;  3SR1 A;  4DV4 Q;  2F0G A;  1BO0 A;  1ESF A;  1HTP A;  2E74 C;  3SK5 A;  3M85 A;  3M3Y H;  4KHP Q;  1YNJ C;  5HUR A;  1PTO C;  5ELF A;  2EXD A;  3VR2 A;  4R4C A;  3CCJ A;  3CHB D;  3EQL C;  2VUM G;  2ZJQ A;  3STB C;  4LFA L;  3JAM i;  1ZEQ X;  2QEX A;  1AN8 A;  3A8I E;  5IGB A;  1LYL A;  3FKI G;  3S24 A;  2PO4 A;  5CC4 A;  1Y1W G;  2OT2 A;  1N9W A;  4A3I H;  2X69 A;  1EY7 A;  4QIW B;  1HNZ L;  4GS3 A;  5C0X G;  5FK9 C;  1NCV A;  5C4J B;  1X9N A;  2F0T A;  3SEB A;  1RTO A;  2CWA A;  4BY1 B;  2L5T A;  3KOJ A;  1CHP D;  3CCL A;  3ONA B;  1VDZ A;  2HQL A;  1HNW Q;  3Q22 A;  4A3D G;  3GV6 A;  1KD1 C;  4A3K G;  3GTK H;  5C3E B;  1Q90 A;  4HR7 B;  4X62 L;  1PV4 A;  2UXB L;  4OO1 H;  4HJ7 A;  2IJ0 A;  2VQE Q;  1K83 H;  1QVC A;  4PMB A;  4FXD A;  4TRD A;  4LF6 L;  2F0E A;  3F2C A;  2QEJ C;  1EUJ A;  1TS3 A;  5L37 A;  2JA8 B;  2K5V A;  5GQO A;  2NVY H;  4OIJ A;  1CQF A;  3W5O A;  1PXU A;  3GTJ B;  1TS5 A;  1T5X D;  3H3V H;  4LMQ D;  5I2X A;  2K14 A;  2MGS A;  2F4V Q;  1IXR A;  2JA7 B;  3IAY A;  3P20 A;  4K14 A;  4JYA L;  4CKC A;  5AJ3 Q;  1GUG A;  3CMA A;  2J7Z A;  2F52 A;  3OTO L;  4QJF A;  5BN3 A;  1SBB B;  1U9R A;  1I6V C;  3J7A V;  1VQ8 A;  1H9M A;  2DJF C;  1BCP B;  5IP9 G;  5IP7 G;  3GTP H;  4OHJ A;  4X65 Q;  2CWP A;  2KQ3 A;  4DR2 L;  2N8N A;  4OIK A;  1N32 L;  5JJI A;  3F8T A;  5FO9 B;  2F3I A;  5ELE A;  2Q8I B;  2HCI A;  4A3F B;  1H9S B;  4PZ6 A;  1YHB A;  5D3D A;  2L0C A;  1FNV A;  1PH1 A;  3KF8 B;  2UU9 Q;  1F2M A;  4LUO A;  1BBX C;  2UUA Q;  2HIX A;  1LTI D;  1VQG A;  5ISR A;  1HNX L;  1DGS A;  1BCP F;  1YIJ A;  1ROD A;  4NKL A;  4C2M H;  2ASB A;  5CR3 A;  3CXC A;  1TWA H;  1WTR A;  3BVM A;  1XX8 A;  4B3T Q;  2R92 G;  2LMC B;  4A3M H;  4POG A;  4LWC A;  3CCM A;  4FXG C;  3L0O A;  2L11 A;  3MFY A;  1CI3 M;  2N49 A;  4YY3 L;  1J9O A;  1BOS A;  1EY9 A;  4DK3 C;  4N8F A;  1YJW A;  4X3K A;  4GLV B;  5GAD C;  4JOI C;  4RCN A;  1SYD A;  4BY7 B;  1N33 Q;  4ME3 A;  4ULL A;  1IBM Q;  4R9W A;  4QIW E;  2KHI A;  2PZW A;  2WV6 D;  4IZ8 A;  5ELD A;  5M3F H;  4OWX B;  2K7V A;  1DCZ A;  4RFB A;  1L1O C;  2KUM A;  4F87 A;  1EQV A;  2F0D A;  5E4W C;  1UE1 A;  3UE1 A;  3OOC A;  1SNQ A;  1NY4 A;  5NUC A;  3GTL B;  1QWY A;  2PI2 A;  3HOV B;  4CDE C;  5KNB A;  1VQC A;  4ODG A;  4JI0 L;  1LM0 A;  4RGT A;  4JOI A;  1N8R C;  1PTO H;  1CHQ D;  1CUK A;  3TME A;  3S1M B;  4LF9 L;  2QF7 A;  4LFC L;  3BDO A;  3D4R A;  4M8A A;  4KN4 C;  2B2W C;  1SYG A;  4Y7N B;  3GTQ H;  1L1O A;  4HCS A;  1GUN A;  3MAQ A;  4DR5 Q;  4XT3 B;  4R4T A;  3EN2 A;  5DNF A;  1C9O A;  2BA1 A;  5CV8 A;  1EIH A;  1Q81 C;  5C0X J;  1PH2 A;  2NZO A;  2NVQ B;  1KHI A;  2AQ1 B;  2LXK A;  1OXU A;  1XXG A;  1FNU A;  1UE5 A;  1WTH A;  2FFK B;  2L12 A;  4IUU A;  1I4G A;  1G29 1;  2B2W A;  1VQ4 A;  2VZA A;  3RZO H;  2RKS A;  2ES2 A;  2AKW B;  3I8Z A;  4KN7 C;  4CJ0 B;  4BY1 G;  5A2Q L;  3K6O A;  4BBS H;  1GHJ A;  4DNT B;  2JEB I;  1O78 A;  2R93 H;  3FPP A;  3S17 B;  1I94 L;  1SDF A;  2X6L A;  3HS0 C;  4DV5 L;  3TQY A;  5C3E G;  1B53 A;  2D62 A;  3PIO 3;  4NMZ A;  3S16 H;  4OWT B;  5IGG A;  1N34 L;  1KDA A;  1VCI A;  1K0R A;  3JC6 6;  4G7O C;  3E5S A;  5IYB H;  2EYJ A;  2CQO A;  3J7Z C;  5FJ8 G;  2JA8 G;  2BE5 C;  5LMU L;  3L3O C;  4K0K L;  4NXM Q;  2F0O A;  1SAP A;  1I3Q H;  2PPB C;  3NP8 A;  3PF5 A;  2G9D A;  3S1Q H;  2GVA A;  3NQT A;  1TQO A;  2G9H D;  3S1N B;  5E7N A;  1W3S A;  3K5M A;  5ELC A;  2JA7 G;  4B08 A;  1D2B A;  3M9B A;  1IKM A;  3CPW A;  1S5C D;  4R8N A;  3HOZ H;  1TWH B;  3TZU A;  5IOC A;  2EVB A;  4LF4 L;  4IFD H;  1UWV A;  4HAE A;  3D0F A;  1S5F D;  4TSS A;  4C3I H;  2OTJ A;  4TQU S;  1HR0 W;  3CP0 A;  1PZK D;  1V1O A;  2C35 B;  3UDG A;  3SK6 A;  4XQQ A;  1XMO Q;  4RGM A;  1KAW A;  4JI8 Q;  4ALP A;  4A3F G;  2KJX A;  2EIF A;  1NTG A;  2IT1 A;  2PMZ B;  3AYH B;  2VXW A;  1GOZ A;  4AYB E;  4LFB Q;  1CK1 A;  1S5B D;  3VR3 A;  4PMC A;  4LF8 L;  1PLF A;  4JBK A;  3A0J A;  3ERS X;  2B2V C;  1QNU A;  4LFA Q;  3G7L A;  4QUF A;  2HCC A;  2NVT B;  4GKK L;  2ZTE A;  1HRJ A;  1OTC A;  4A3G H;  4B3M L;  2LY7 A;  1Y14 B;  1YNX A;  4DNI A;  4QGU A;  1EIF A;  2RDF A;  2PZU A;  5KEE A;  4DV7 L;  1TVX A;  1L0X B;  3GTG B;  3J81 c;  1A15 A;  5I9O A;  2B2V A;  1RIP A;  1LV9 A;  1CKN A;  1B2T A;  1LTA D;  1S5E D;  1K73 C;  2E5L Q;  2FIN B;  2R7F A;  1PH3 A;  1KLG D;  2XNA C;  2UXB Q;  4BY7 G;  1WJJ A;  1OO9 B;  2JA5 B;  2D2C C;  4LF6 Q;  4NDX A;  2HT1 A;  3CQZ H;  1PH7 A;  1SN8 A;  3NQI A;  5FLX L;  1I50 B;  3GTO B;  2N55 A;  2JA6 H;  1UE7 A;  3V2T A;  5CV4 A;  3HOV G;  5JEA H;  4L5Q A;  4K2K A;  3ICE A;  1B3Q A;  3K5O A;  3S1R H;  4DNR B;  5GRO A;  1E0B A;  1TWC B;  4APV A;  1K8O A;  1PDQ A;  3AU7 A;  1YNN C;  1VQN A;  4FF1 A;  3TS2 A;  4CKE A;  3I4N H;  1PYB A;  4UAI A;  3OTO Q;  1J5E L;  3ULP A;  1MGS A;  4XYO A;  5DAU A;  4LUZ A;  4X3T A;  2VQE L;  4EQP A;  3U4Z A;  4IUP A;  2GA4 B;  1QZG A;  4ZUI A;  4NW2 A;  3SK8 A;  1N32 Q;  2R7Z H;  5IGC A;  3H15 A;  4WRD A;  3T53 B;  3BZK A;  2JQO A;  2CQA A;  4P75 A;  3HKS A;  1OXV A;  3WDN A;  1ILP A;  1WI5 A;  3OHX C;  3CF5 A;  2E2I H;  3OYY A;  1STG A;  5AJ3 L;  5D3I B;  1SNP A;  2A69 D;  3TN2 A;  2DJG C;  4P71 A;  1HTL D;  3E0E A;  1A8V A;  1EQQ A;  4OL7 A;  1O7Z A;  1WD0 A;  1IBK L;  3PF4 A;  3I4M B;  1HA5 A;  5J1Z A;  1I4Q A;  2VB2 X;  1PH4 A;  3BDC A;  2SNM A;  3K57 A;  1LAB A;  3KDF B;  4FP5 D;  3A56 A;  1TKW B;  1BNZ A;  3KF6 B;  4PZ7 A;  4C3H H;  4YY3 Q;  4RCO A;  1WCM B;  4XTC S;  3GV3 A;  1E1O A;  3R3O A;  4EX5 A;  1WTV A;  4FNF A;  1SSO A;  1Z9F A;  3F2U A;  3MXN A;  2UUA L;  3HFZ B;  1SE2 A;  1STB A;  1T9H A;  4A3D H;  3RD4 A;  2L4N A;  4XT1 B;  4GKJ L;  3EVQ A;  2EJM A;  1YIT A;  5IGD A;  2FHT A;  4JI4 Q;  1ENF A;  4UPA A;  1VS0 A;  5I2Y A;  3PIP A;  1I6H B;  2E2D C;  4KTA A;  4PQX A;  4B3T L;  2F3W A;  1UEB A;  2P5Z X;  2WII B;  3M4Y A;  4HCE A;  4A93 B;  1D1K A;  1Q12 A;  1MJE A;  2JSO A;  1U4L A;  1SFO H;  1STH A;  4LFC Q;  3RUZ A;  2MUY A;  5COY A;  2XSC A;  1LO5 D;  3U9O A;  4PMW A;  5IT9 c;  3DM3 A;  1CT1 D;  2AUK A;  1XTC D;  4Q5V A;  1PRT D;  3S15 B;  2JE6 I;  3CKI B;  1KQS A;  1PHJ A;  5K36 H;  1E22 A;  3DEO A;  4JI2 Q;  3J80 L;  2HIV A;  2PYK A;  1KRT A;  5HGQ A;  2Y0S E;  1DOM A;  5COR A;  3J81 E;  1B7Y B;  1R4Q B;  1PZJ D;  1VQO A;  1VQP A;  4EQO A;  4HIM A;  1VQL A;  5DEH A;  5FLM G;  3WWV A;  2IWH A;  4AH6 A;  4C1N K;  3T1H L;  3S2D B;  1A3V A;  1V1P A;  3NEM A;  3A8J E;  3NEL A;  1B9M A;  1KDC A;  4ZAI A;  1AE2 A;  5JPN C;  5EKK A;  2PQE A;  3I72 A;  1I94 Q;  3VDY A;  4A3E B;  5KYL A;  4DR5 L;  1H9R A;  3H0G H;  1WTW A;  1NR2 A;  4GZY C;  2JA5 G;  2YTV A;  5EBC A;  3PMF A;  3B6Y A;  2MQH A;  4G7H C;  4PNY A;  5C3W A;  3RZD H;  2E2H B;  2ICE C;  5CBA E;  4K0K Q;  2XGT A;  4HED A;  3A8K E;  3GP7 A;  3J81 i;  1SE8 A;  1UEA B;  1XMQ L;  1EFW A;  1B9N A;  1HPC A;  1J8I A;  2JXM B;  2FMM A;  3NTK A;  3CPF A;  4KKT A;  2E8G A;  3AFP A;  4C3J H;  1PFM A;  5JVH 3;  3I73 A;  1RD9 D;  2F1M A;  1K9M C;  1X56 A;  4KKS A;  3S2H B;  1O7I A;  2F0L A;  3HOW H;  2LS0 1;  3BG3 A;  4YWL A;  3C1E A;  1DXM A;  1TWF B;  1EZ8 A;  4LF7 L;  4HMI A;  3C1F A;  1GXD C;  4NXM L;  2SDF A;  3QWN A;  1X3G A;  3CCV A;  4R4Q A;  3I3C A;  1K8A C;  2NZH A;  3VYU A;  1JT8 A;  1PZI D;  3DMU A;  1R9T H;  3AMU A;  2A6E C;  3V05 A;  4L5S A;  1DYQ A;  3ND8 A;  1NUC A;  1B3A A;  1JIC A;  3KK7 A;  1EWH A;  3T4A C;  1SMY C;  4LF8 Q;  3QR8 A;  5C44 B;  2KCC A;  1KTK A;  4PV1 C;  3OSO A;  1GHK A;  2WAC A;  3ER0 A;  2KCT A;  4AIM A;  3I4M G;  4GKK Q;  4O42 A;  1PRT F;  3CME A;  2R3Z A;  4B3M Q;  4G7Z C;  4WJ3 M;  5KNC A;  4GN4 B;  1QZH A;  2OQ0 A;  3CRK C;  4JI8 L;  4HID A;  2H1E A;  1WCM G;  3E0J A;  4OWW B;  3PSI A;  4A75 A;  1YZ6 A;  2LKV A;  4IUV A;  3NEN A;  1TS2 A;  1NMG A;  4JBW A;  2K32 A;  1XJV A;  3S14 B;  4LFB L;  3NWS A;  4JI6 L;  5J39 A;  2Z6B A;  4DR4 Q;  5C3E H;  1QVG A;  1YJN A;  3GD7 A;  1I4H A;  3K5N A;  2KBN A;  4JK1 C;  2B29 A;  1JJC B;  3NSW A;  3HOU B;  1GUS A;  5IT9 E;  3OWE B;  3MXN B;  2F0Q A;  3F2D A;  1QUQ A;  3V96 A;  1RF2 D;  2F0I A;  3HKZ B;  4A93 G;  1F2L A;  4JI7 Q;  5I4D A;  1XPO A;  1YI2 A;  1F9Q A;  1WTO A;  1J5E Q;  2E5L L;  2K5Q A;  4RH6 A;  5F2D A;  1LTB D;  4X66 Q;  1X3F A;  5LL6 X;  2PQA B;  5IWA Q;  4OGQ C;  4LW1 A;  4ILW A;  2WB1 B;  2UUB Q;  1DJR D;  2JP1 A;  4ZRZ A;  4K6L A;  2K28 A;  2VB3 X;  3U9S A;  2Z9H A;  2E2J H;  1CKM A;  4BXX H;  3SHL A;  1Y8O B;  3T1Y Q;  4ZQ3 A;  1VQI A;  2GVB A;  2YU9 B;  3K0Y A;  3EJI A;  4IOA A;  3BYT B;  1CM9 A;  1ONL A;  4MN3 A;  5C4X H;  2D9U A;  3A7L A;  1QCB D;  5M3M H;  4A3E G;  1SYF A;  3MA2 B;  2F0W A;  1C8C A;  4A3I B;  3TRE A;  4JI5 Q;  1IW7 C;  4RHR A;  1IBK Q;  1GJX A;  1P16 A;  1E2Z A;  4HSP A;  1K3R A;  2F0N A;  5JJZ A;  4YCU A;  2V4D A;  5E3F A;  2EXZ A;  4B3R L;  1SJE D;  2Z0S A;  4A3L H;  2EY2 A;  5M5X H;  4HIO A;  3X3N A;  1Q1B A;  4GLX A;  2JN4 A;  1K83 B;  3VYT A;  3K0X A;  3CD6 A;  3F2B A;  2A6H D;  3DWA A;  1PMR A;  3RLF A;  1P8L A;  3NXW A;  5G3L D;  3D3R A;  5KGU A;  1PYS B;  3X3M A;  4DUY Q;  3I2Z A;  1A3U A;  4GKJ Q;  3PUZ A;  4KLK A;  4U67 3;  3U58 A;  3I70 A;  5CMD A;  2EYF A;  1Y1V B;  4JVZ A;  1ENC A;  2X6G A;  2A8V A;  4B9W A;  2KHS A;  4FYD A;  1AZQ A;  4E6I A;  3OW7 A;  1I5F A;  4A4I A;  1NNX A;  3LX0 A;  1DD2 A;  1G2S A;  4KV6 A;  2JEA I;  5J3B A;  3HOV H;  1L2F A;  2F03 A;  5IGF A;  5IYC G;  3UDF A;  3ULL A;  4NXN L;  1MKH A;  4MTK A;  4H7B A;  1YNJ D;  1PTO D;  3NBI A;  4ABN A;  2B39 A;  3GTP B;  1VQ9 A;  2DNC A;  2AHO B;  3STB D;  1JOO A;  3PCO B;  4Y7N H;  1MI2 A;  4KY7 A;  3U50 C;  1EWC A;  3BJU A;  5C44 G;  2D5D A;  1HJP A;  3E9I A;  2KA7 A;  4JI4 L;  1C7Y A;  1VQJ A;  4AYB B;  3HKZ E;  2NB0 A;  3HRZ C;  1OXS C;  4R8I A;  3KLW A;  3N52 A;  1STA A;  1A2U A;  3T1H Q;  5EKI A;  4XYQ A;  2BDN A;  1LAC A;  2LXJ A;  4N9P A;  3HZX A;  1M4V A;  3H3V I;  4C2M B;  4O2D A;  2CW0 C;  1FD7 D;  1G8Z D;  3R2I A;  4MHE A;  1TWA B;  4DAY A;  2KEE A;  4L63 B;  4NPS A;  3P1H A;  2WB1 E;  4TVA B;  4IAL A;  3EBE A;  2EYM A;  2XWJ B;  2F0U A;  5CV5 A;  2RF4 A;  4JI2 L;  3PUY A;  2QW7 A;  2K75 A;  3C3L A;  4K5W A;  1Q7Y C;  1XNQ Q;  1ZYR C;  4B3S L;  3HOU G;  3ITP A;  2UXD Q;  3MXU A;  3R93 A;  2CVR A;  2K52 A;  3D4W A;  3RN5 A;  5CV9 A;  1XMQ Q;  3HKZ G;  3HOX H;  3EA6 A;  1VMC A;  3CCU A;  1UAP A;  3PO3 B;  1QB5 D;  2ATW A;  3S1N H;  5M3F B;  4KHZ A;  1W2B A;  5T1I A;  1CSQ A;  4A3C G;  3H91 A;  2IX1 A;  5JJK A;  4DR1 Q;  1G91 A;  2IW3 A;  1TWH H;  4IPG A;  1FGB D;  4DA2 A;  1PTO B;  4QY7 A;  2WB1 G;  4FXK C;  5G3L F;  2DGY A;  1HUM A;  4LF5 L;  2EZV A;  1V9P A;  4IUT A;  5JVG 3;  4LF7 Q;  1DOK A;  2XVS A;  2OCE A;  4RKL A;  2KVM A;  3GTQ B;  5LMN L;  1HZ9 A;  3IL8 A;  4DAM A;  1JE4 A;  1RJT A;  2UUC Q;  4DR6 L;  3L7Z C;  1I4X A;  1Z6H A;  4RMF A;  4KJO A;  2F0J A;  2L1B A;  2NN6 H;  4HMJ A;  2CH4 W;  4A3I G;  1CKO A;  1PTO F;  4RGO S;  3RZO B;  3DLL A;  5A35 A;  2IPK D;  1PVO A;  1TS4 A;  5M9O A;  3SGI A;  1PFB A;  1A6X A;  4BBS B;  2DNE A;  2JJQ A;  2MFI A;  3NK9 A;  2R93 B;  4IPH A;  2K50 A;  4DXG A;  4H13 C;  3CC4 A;  1QVF A;  3S16 B;  2Q2U A;  3PO2 H;  2QCP X;  4OO1 G;  2VY3 A;  3PUW A;  3A5U A;  1Y69 U;  1OXX K;  5FOB B;  4R1J A;  1ENA A;  4Y52 H;  3MEH A;  1IL2 A;  1EFI D;  1QJO A;  2MP1 A;  4JI6 Q;  2NBF A;  1BXT A;  2F0V A;  2ID0 A;  3HP3 A;  2EE1 A;  3BVZ A;  2N3S A;  1I3Q B;  2ZJP A;  3HOY B;  4BA1 I;  1S72 A;  1RTN A;  4FO2 A;  5M5Y H;  4IO9 A;  5M5W H;  1Y1V G;  5CBE E;  1PH8 A;  1SNM A;  4GNX A;  1I50 H;  1U5K A;  4BBR H;  1LT4 D;  1EIG A;  2NTS A;  4OON A;  2CFM A;  4P72 A;  4GOP C;  4IUQ A;  5IY0 A;  3HOZ B;  1AZP A;  1D6E C;  4S3S A;  4JI3 Q;  5JJL A;  4J8Q A;  5ELO A;  1CZW A;  2MJ8 A;  1EU4 A;  4C3I B;  3GTM H;  1JCK B;  5HY6 A;  2FXQ A;  1XYI A;  3F1Z A;  3QG1 A;  4K5V A;  4DR4 L;  1KXL A;  2WIN B;  3A7A B;  1EWI A;  4GOP A;  4QCL A;  1Y8P B;  1WTX A;  4AYB G;  4A3J B;  2IX0 A;  3CCS A;  1IBL Q;  3GO5 A;  3L2P A;  3D8G A;  4EVO A;  1EEI D;  2KCN A;  1K28 A;  2Y0S B;  4ZLT F;  2ALY B;  2D0P A;  5FLX c;  3I90 A;  4DN4 M;  1B50 A;  1MSG A;  4JI7 L;  1SJH D;  5CYU A;  1JB3 A;  4IPC A;  1SYC A;  2JYO A;  1X3E A;  4L8J A;  2K5H A;  3UI2 A;  4A3G B;  3T16 A;  2NVX H;  1UNS A;  1RHP A;  1VQM A;  4YWK A;  2BE5 D;  4X66 L;  3BDL A;  5JOB A;  3SVM A;  5IWA L;  1D8L A;  4IFD I;  2UUB L;  1ML0 D;  4DAY B;  3P7J A;  1L1O B;  2A68 C;  1QG7 A;  1SND A;  3PIO A;  4B3R Q;  5A2Q E;  1KRS A;  2HHH L;  1R4P B;  1VQF A;  3T1Y L;  4V19 0;  2K03 A;  1O7L A;  4DK0 A;  3PO3 G;  3KLR A;  4KK7 A;  3CQZ B;  3NPP A;  5BN4 A;  3Q24 A;  5M3F G;  1FYC A;  4KKU A;  4KI0 A;  4DU9 A;  2JA6 B;  1EY5 A;  1GD7 A;  2L15 A;  1GO3 E;  4LAA A;  1QIL A;  2I07 B;  4DV0 Q;  4JG2 A;  4JI5 L;  4H0L C;  3N6R A;  2VUM H;  4G57 A;  4UDU C;  3CW2 C;  5KYI A;  2F3V A;  3QB3 A;  1L0Y B;  3FKI H;  1WVL A;  1Y1W H;  3I4N B;  1QOH A;  5EJW A;  5C0X H;  4ME5 A;  2BDO A;  3VA7 A;  4NXN Q;  1K8G A;  5C3X A;  3FMC A;  1JR0 D;  1SNO A;  3JAM L;  4IQZ A;  4B9X A;  3ERQ A;  2I5M X;  1V1Q A;  1FJG L;  2R7Z B;  4DUY L;  4A3K H;  4HJ8 A;  1I4R A;  4BA2 I;  1JE5 A;  5BR8 Q;  2Q8R E;  3TP8 A;  3GDE A;  3R8B A;  3OWF A;  2XTI A;  5E1F A;  4BBS G;  1TY0 A;  2E2I B;  2EYP A;  2K5N A;  1NR4 A;  2D0O A;  3MFG A;  3OW2 A;  2Q8T A;  4A3B B;  2R93 G;  3G6E A;  1B1Z A;  4DV3 Q;  1AEX A;  3KBX A;  3H94 A;  4QQB X;  1VMP A;  2Z1C A;  5EPK A;  2SEB D;  1J6Q A;  1E7Z A;  3CRL C;  5IYB G;  1LTT D;  1Q8K A;  1M8A A;  1ET6 A;  1NAP A;  3HOY G;  3KLS A;  4C3H B;  2ZTD A;  2RA4 A;  3TS0 A;  5IP7 H;  5IP9 H;  4B3S Q;  3SE0 A;  3J80 c;  1FR3 A;  5TSS A;  4ZKB B;  4CJ2 C;  2EDG A;  1YNN D;  1ASZ A;  4MNO A;  3HOZ G;  2PI2 E;  3T51 B;  1MBY A;  1CA6 A;  1BCP C;  4IFD G;  2XRS D;  1LT5 D;  5GAG C;  2ICI A;  4DV6 Q;  4C3I G;  2E76 C;  3ND9 A;  1YHQ A;  1WYD A;  1X6O A;  3URY A;  3L9A X;  5FLX E;  2WAQ B;  4N9T A;  3UE0 A;  4OX9 L;  3TEH B;  4Z9C B;  2IX3 A;  1SFO B;  4A3J G;  3OPO A;  1XNQ L;  2B2Y C;  4LF5 Q;  1V8Q A;  3J7A F;  3FDT A;  2R92 H;  4HJA A;  1EY4 A;  4DKA C;  1CKN B;  2UXD L;  1KNA A;  3T56 B;  3BZC A;  2B3G A;  5LMN Q;  2Y0S G;  3Q0A A;  1GM5 A;  2L55 A;  2XWB B;  2ZJR A;  4FF2 A;  4DR6 Q;  2RSN A;  4IOC A;  4GOP B;  3RNU A;  1F9S A;  1H9S A;  1HZB A;  3M4O H;  1KIX A;  1LTG D;  4J6H A;  2YTX A;  1GUW A;  3D31 A;  3KF8 A;  1TY2 A;  4DR1 L;  2B2Y A;  4A3G G;  1K3B C;  2E75 C;  2R61 A;  3HG9 A;  3IRB A;  5FO7 B;  1DZ1 A;  1Q82 C;  1STE A;  5C4Z A;  1GVP A;  4I7Z C;  1A0I A;  2I0Q A;  4DV2 Q;  4XXE A;  2MPM A;  2K5D A;  3DWQ A;  3A5Z B;  1Q8I A;  3K5L A;  3DWP A;  1ILQ A;  3K7A H;  1IYJ B;  3MZ5 A;  4UP7 A;  1TWG H;  3NHH A;  3G6J B;  4CGY B;  2Z4H A;  2UUC L;  4IJH A;  2PW5 A;  1Y8N B;  5CGK A;  1JWS D;  1JWM D;  3TP6 A;  1VF5 C;  3RZD B;  2HD3 A;  2JA6 G;  5DM7 3;  2XRQ D;  5JEA G;  5IYD G;  2VW9 A;  4F88 A;  3DHQ A;  4Q0F A;  3I4L A;  2AQ2 B;  2B63 B;  1EOV A;  1PA6 A;  2A74 C;  3WOF A;  3HOU H;  4PZ8 A;  1WD1 A;  4C3J B;  1RCV D;  3LGJ A;  5LHY 1;  3FPU B;  3I4N G;  2NTT A;  3FHW A;  3NTH A;  3I7F A;  1VQA A;  1II3 A;  5JAV A;  5C4J H;  2Z4I A;  2LFN A;  4BY1 H;  3HOW B;  2OEO A;  1HFG A;  1SR3 A;  4M1U B;  4J1M A;  2RBM A;  1W6J A;  3NBH A;  2R7Z G;  3QO2 A;  1C0A A;  4UY8 C;  3TZD A;  4KJN A;  1HA6 A;  3K58 A;  4V0B A;  2F0S A;  1SYE A;  1G51 A;  4QF4 A;  5ELN A;  1R9T B;  5FJ8 H;  2JA8 H;  1X54 A;  3I91 A;  1G2T A;  4A3B G;  4QL5 A;  3GQB A;  1SXT A;  1E2V A;  1U4R A;  3GTJ H;  1VQH A;  3QOL A;  3ZJY C;  1XNR Q;  4JI3 L;  4F8M A;  3CU7 A;  2WAQ E;  2ZTC A;  2YU9 H;  2JA7 H;  1A62 A;  4YHH Q;  3KYH C;  3K59 A;  5C6A A;  3J80 E;  3CC7 A;  2EYL A;  1WOC A;  1NMF A;  4TKO B;  3Q6S A;  2F0F A;  2R7D A;  2OXP A;  1BKB A;  1AE3 A;  3DUZ A;  2MHV A;  4C3H G;  3E9H A;  1IBL L;  1LT3 D;  2Q2H A;  4IFD J;  1EIY B;  3K81 C;  2PNH A;  1DON A;  1QE6 A;  3OMC A;  1C4Q A;  2K01 A;  1KLU D;  2HHH Q;  3M3Y B;  1E24 A;  4P2C B;  4JBM A;  3RR5 A;  4HIK A;  4A3F H;  1VQB A;  1S5D D;  1X55 A;  3IFT A;  1TU2 B;  1LTS D;  2PNR C;  3BU2 A;  4R4O A;  2DN8 A;  4F7X A;  2BA0 A;  2B8G A;  1F9P A;  2ZM6 Q;  1N36 Q;  2WAQ G;  2ZXO A;  1Z47 A;  4FDB A;  1V1P B;  1A3T A;  2HUG A;  1XPR A;  3J80 i;  1Y1V H;  4K8I A;  4HTH A;  3FEW X;  1F2Y A;  2CKZ B;  3PUX A;  1Q86 C;  4ID6 A;  3GTK B;  1ASY A;  2A6E D;  2YTY A;  3I55 A;  1SYB A;  4GLA C;  5K36 G;  3PUV A;  3SDZ A;  1SMY D;  5ELB A;  4O1N A;  1T5E A;  1CTM A;  4JI1 L;  2ZT9 C;  2BH2 A;  2QDB A;  3TSS A;  1FJG Q;  1BVS A;  3C2P A;  2E2J B;  4GN5 A;  1D1I A;  1V43 A;  2NVY B;  2L9H A;  4JC0 A;  3MXG A;  4BY7 H;  1TXY A;  4JW0 A;  4X64 L;  4DV0 L;  4UHV A;  3DXJ C;  3OIP A;  2I5L X;  5EBD A;  1E3P A;  4ZCK A;  5C4X B;  1GUT A;  3GTL H;  3U4V A;  5M3M B;  5EQ0 A;  2A5H A;  4DAV A;  1BQQ T;  4ZUJ A;  3H0G G;  1ICF B;  2IL8 A;  1YHA A;  2F0P A;  5IOD A;  2AQ3 B;  1GKH A;  2B8F A;  5JEA J;  2AWO A;  3S1M H;  2WKD A;  3ULJ A;  1D5Z C;  1TT2 A;  1U0L A;  4N8X 1;  5GAH C;  3VYR A;  4H02 A;  1HH2 P;  3PV0 A;  5H1S E;  3W1B A;  1EYC A;  4P73 A;  2B2U C;  1E2W A;  3BZD B;  5EPL A;  5BR8 L;  4JBJ A;  1RKN A;  5M5X B;  2CHB D;  2SNS A;  4OO1 I;  3H6M A;  2NVQ H;  3WOE A;  3D6W A;  2B63 G;  1VQ7 A;  2CCZ A;  1BF4 A;  5EKL A;  2EYH A;  3TBI B;  5IGE A;  2FJ2 A;  4C3J G;  4LNQ A;  1MHW C;  4DV3 L;  1Q3L A;  3KBG A;  2RCF A;  3HOW G;  2F0K A;  3PO3 H;  2B2U A;  1JQY D;  2KHJ A;  3LWU A;  4DV1 Q;  2VQF L;  4A3M B;  1NJI C;  1CZG A;  3M7G A;  1Q46 A;  1IKL A;  2K5W A;  1IYV A;  1JB7 A;  3S17 H;  2A73 B;  2RDG A;  1VQ6 A;  1O80 A;  2PW7 A;  3W2D A;  3E3X A;  4OX9 Q;  2UXC Q;  2G5D A;  3G48 A;  2ZXR A;  5AFW A;  1MSH A;  4P74 A;  4I7A A;  2WP8 J;  5CV6 A;  4JV5 Q;  3TDQ A;  1EQT A;  1LT6 D;  2N78 A;  2QGQ A;  4UP9 A;  2F4I A;  2OF1 A;  2SOB A;  2A19 A;  1EY8 A;  3NBH B;  2N88 A;  2O4X A;  3SXH A;  2NZ1 D;  4ZK9 B;  1C48 A;  4XQJ A;  2ZXP A;  1IYU A;  1U4P A;  2EY1 A;  4LJZ C;  1HHV A;  4CDF C;  1EZ6 A;  1B44 D;  3VA5 A;  1KL9 A;  3AQQ A;  4EQ5 A;  1IW7 D;  4DV6 L;  1BBU A;  4H44 C;  1MD2 D;  2JK8 A;  3CCQ A;  1QUQ B;  3OIQ A;  2RDH A;  2OTL A;  4X3S A;  3MC0 B;  3MHB A;  4AQY Q;  4IUR A;  1UE6 A;  3VR6 A;  4QMG A;  2EY5 A;  2MO1 A;  2HDM A;  1RDP D;  3HEJ A;  1AFP A;  1PFN A;  2C9O A;  4IJL A;  1G6P A;  1FL0 A;  1SRO A;  4HSV A;  2K04 A;  4PG3 A;  1BR9 A;  1HZC A;  1M1K C;  1SEB D;  2VNU D;  3E6Z X;  1SE4 A;  3KDF A;  4XIG S;  1CSP A;  2YYZ A;  4A76 A;  4LK1 C;  3J81 j;  3KF6 A;  3W3A A;  2VS1 A;  1JOK A;  2A1A A;  4QB4 A;  1YJ9 A;  4DR7 Q;  3QIA A;  1PH5 A;  1LUZ A;  1L0W A;  5EGT A;  5C5M A;  3AB9 A;  4K6D A;  2GN5 A;  5E4X A;  1VQK A;  1S40 A;  3FRP B;  1O7Y A;  4HN7 A;  1PFS A;  1X3P A;  1FNW A;  4EQN A;  3I56 A;  1Q1E A;  2EJG C;  4RGN A;  4OEM B;  4L6T B;  3HOX B;  4DUZ L;  3HOY H;  1VF7 A;  2RVL A;  1EL0 A;  3TP5 A;  3A55 A;  4DK6 C;  4DV2 L;  2NVT H;  1STY A;  2J0T D;  1A63 A;  3DM1 A;  5C5L A;  4BS9 A;  4CDC C;  2O2L D;  3ZYY X;  4KY6 A;  1KDB A;  2DUD A;  1YVC A;  4XDX A;  3M7N A;  1U4M A;  5FLM H;  1ET9 A;  2KOL A;  1WTQ A;  4GNX C;  1IL8 A;  5IE8 A;  3K7U C;  3VYS A;  1XPU A;  3Q23 A;  3GTG H;  1EOT A;  1I4P A;  1JOQ A;  1HUN A;  1YEZ A;  2A69 C;  2EJF C;  1M90 C;  2EQS A;  1VQE A;  4BXX G;  1KNE A;  2QDL A;  4JCV E;  4C56 C;  3TRZ A;  1HR0 Q;  2IHE A;  2JA5 H;  3CC2 A;  3S1Q B;  2IY5 B;  1HFN A;  4L5T A;  2HQE A;  5IIF A;  4A3J H;  1BDO A;  2K4K A;  3GTO H;  2QA4 A;  5C4X G;  3PIP 3;  2BCO A;  1PH9 A;  2CW0 D;  3AEV A;  5M3M G;  3ERO A;  5KRU A;  5KND A;  2Z6K C;  4KD3 A;  1LLR D;  5I9P A;  4K2L A;  5HGT A;  3SK4 A;  1DM0 B;  3S9W A;  4DR3 L;  3EFX D;  1UUP A;  2H5X A;  1A2T A;  4YCW A;  1TWC H;  2WFW A;  4BWG B;  1EY0 A;  4GN3 B;  1HZA A;  4J15 A;  1EYG A;  3UDI A;  1S4Z A;  2O5J C;  1ZYR D;  3CCR A;  3J81 L;  1HNZ Q;  2KEN A;  3H09 A;  4A3L G;  5KIX A;  1AH9 A;  1SNC A;  3PO2 B;  2XN9 C;  2Z6K A;  1EU3 A;  3DEP A;  4JPB W;  4HJ9 A;  4WJ4 A;  3KJO A;  1HQR D;  2O5I C;  4DV4 L;  4X62 Q;  2I46 A;  3TP7 A;  4KHP L;  1IHZ A;  3EIV A;  1XNR L;  2BOS A;  2OWO A;  4KY5 A;  3RLN A;  2V1C C;  5M5Y B;  2MO0 A;  5M5W B;  2C5C A;  4YHH L;  1PRT C;  4A3M G;  2BH8 A;  3J7Y W;  4DFA A;  4BBR B;  2NN6 I;  3UDX A;  1PH6 A;  5IYD H;  5D65 A;  3O13 A;  4L5R C;  1VQ5 A;  3I4M H;  4R4I A;  2K05 A;  2YV5 A;  2QKI C;  1FVI A;  2PCF B;  4K5X A;  3T13 A;  3GTM B;  4JYA Q;  4CDD C;  1HNW L;  1GUO A;  1B8A A;  1ZKO A;  2K33 A;  1WCM H;  4DXF A;  3HGB A;  4JI1 Q;  5JPM C;  1WTP A;  4IN3 A;  2NUC A;  4WOR A;  1B70 B;  4DR2 Q;  1E1T A;  3G4S A;  3NWT A;  2ZM6 L;  1N36 L;  4X64 Q;  2J4X A;  3KFU A;  3KLS X;  1H9J A;  3I4O A;  4POF A;  4MTN A;  3S1R B;  1NBW A;  3BVG A;  5D14 A;  4OEL B;  1ZXT A;  1SMX A;  3KUP A;  1I6H H;  2F4V L;  2KED A;  1EYA A;  1EQR A;  1JOR A;  1H9K A;  4A3B H;  2NWG A;  1HNX Q;  2NVX B;  4A93 H;  5FO8 B;  4X3U A;  4CBV A;  2FMC A;  4UP8 A;  2WKC A;  3P75 A;  4OXP A;  3RMH A;  4DPG A;  5DLQ E;  4DK1 A;  1JMC A;  3M4P A;  2Q2T A;  3LWE A;  1QNK A;  5K5P A;  4IUN A;  4X65 L;  1OXT A;  3JAM c;  3S15 H;  2PMZ E;  2VL6 A;  3HOX G;  1S3O A;  3FP9 A;  2R6G A;  1KC8 C;  1KAB A;  4DAP A;  4IPD A;  4DF7 A;  2UU9 L;  4RWS C;  2H4O A;  2CH4 A;  1LTL A;  4RHS A;  1SRU A;  4YIJ A;  3IKJ A;  5FKA C;  3S2D H;  2VUM B;  1JJG A;  2VQF Q;  1ESR A;  3LNN A;  1RL2 A;  2EPB A; 
#chains in the Genus database with same CATH homology
 4LFA Q;  1C0A A;  4UY8 C;  1HJP A;  3E9I A;  3MEF A;  4A3E H;  3A74 A;  3W1G A;  1C7Y A;  1VQJ A;  4JI4 L;  2ZTE A;  4GKK L;  3HKZ E;  1OXS C;  1OTC A;  3PGZ A;  4A3G H;  3KLW A;  4RG1 A;  4X6A H;  4B3M L;  4JI0 Q;  1Y14 B;  1YNX A;  4DNI A;  1G51 A;  5ELN A;  4QGU A;  2PQA A;  1EIF A;  4LF9 Q;  5FJ8 H;  3T1H Q;  1X54 A;  2JA8 H;  4DV7 L;  2E2H H;  4A3B G;  4QL5 A;  3J81 c;  2LXJ A;  3GTJ H;  1VQH A;  2NN6 G;  3ZJY C;  1XNR Q;  4YWM A;  1RIP A;  4JI3 L;  3H3V I;  4O2D A;  1CKN A;  3Q8D A;  1H95 A;  2WAQ E;  2ZTC A;  1K73 C;  4NPS A;  1A62 A;  2E5L Q;  2R7F A;  1PH3 A;  4YHH Q;  3KYH C;  4TVA B;  2WB1 E;  1N33 L;  4BY7 G;  2UXB Q;  1IBM L;  1WJJ A;  2KCM A;  3EBE A;  3CC7 A;  1JJ2 A;  1WOC A;  1NMF A;  4DV1 L;  4GNX B;  4LF6 Q;  2HT1 A;  3CQZ H;  1PH7 A;  2R7D A;  2RF4 A;  1BBW A;  4JI2 L;  1SN8 A;  3PUY A;  1BKB A;  1AE3 A;  2K75 A;  1FGU A;  1Q7Y C;  1XNQ Q;  3KJP A;  2JA6 H;  2UXC L;  1UE7 A;  3HOV G;  2RHS B;  3E9H A;  4B3S L;  3HOU G;  3S2H H;  2UXD Q;  4L5Q A;  1IBL L;  3PO2 G;  2Q2H A;  2K52 A;  4HJ5 A;  3ICE A;  5LMN W;  3RN5 A;  4JV5 L;  4IFD J;  1EIY B;  3K81 C;  2PNH A;  3S1R H;  1X65 A;  1XMQ Q;  5GRO A;  3HKZ G;  2MNA A;  2HHH Q;  1TWF H;  3HOX H;  4APV A;  1E24 A;  4JBM A;  1YBY A;  3CCU A;  3RR5 A;  4HIK A;  4A3F H;  1VQN A;  1VQB A;  2ATW A;  4DV5 Q;  5IYC H;  3S1N H;  4KHZ A;  1W2B A;  1X55 A;  3TS2 A;  1CSQ A;  3I4N H;  1PYB A;  4A3C G;  5EAY A;  2IX1 A;  1N34 Q;  3OTO Q;  1J5E L;  4DR1 Q;  3ULP A;  5JJK A;  3BU2 A;  5C0X I;  4R4O A;  3K80 C;  4LUZ A;  2RCN A;  3CCE A;  2VQE L;  1TWH H;  3U4Z A;  4IPG A;  1MJC A;  2BA0 A;  2ZM6 Q;  1N36 Q;  2WAQ G;  4BBR G;  1QZG A;  3RLO A;  1Z47 A;  2Q2I A;  5LMU Q;  4QY7 A;  1N32 Q;  2WB1 G;  4FDB A;  3H15 A;  5C44 H;  2R7Z H;  2DGY A;  4DUZ Q;  4AQY L;  1XPR A;  3J80 i;  4LF5 L;  1V9P A;  3BZK A;  1Y1V H;  4LF7 Q;  2JQO A;  2OCE A;  2AMC B;  4P75 A;  2CKZ B;  3HKS A;  1OXV A;  5LMN L;  1HZ9 A;  1WI5 A;  3PUX A;  2I5H A;  4DAM A;  3G71 A;  3CF5 A;  1Q86 C;  2B63 H;  1ASY A;  2UUC Q;  2YTY A;  3I55 A;  4DR6 L;  4GLA C;  2E2I H;  3OYY A;  5K36 G;  3PUV A;  5AJ3 L;  1XTD A;  3L7Z C;  1WFQ A;  4RMF A;  4YCV A;  4LF4 Q;  4JI1 L;  4P71 A;  3E0E A;  4DR7 L;  2BH2 A;  1A8V A;  1EQQ A;  1FJG Q;  1BVS A;  4A3I G;  4GN5 A;  1SLJ A;  2RHQ B;  1V43 A;  1IBK L;  1CKO A;  3PF4 A;  4JC0 A;  2LSS A;  1IZ6 A;  3DLL A;  4BY7 H;  3S14 H;  1TXY A;  4X64 L;  1PVO A;  4DV0 L;  2IHF A;  1PH4 A;  3SGI A;  3KDF B;  4O0A A;  2JJQ A;  2MFI A;  2I5L X;  2OQK A;  3KF6 B;  4PZ7 A;  4IPH A;  1VQD A;  1E3P A;  2K50 A;  4NB3 A;  4C3H H;  4YY3 Q;  3GTL H;  2AWN A;  4XTC S;  3U4V A;  3CC4 A;  1E1O A;  1QVF A;  4MZ9 A;  2Q2U A;  3PO2 H;  4OO1 G;  3H0G G;  2VY3 A;  4EX5 A;  3PUW A;  3M4Q A;  1YHA A;  4DR3 Q;  1Z9F A;  3A5U A;  1OXX K;  2UUA L;  3HFZ B;  1GKH A;  4R1J A;  5JEA J;  4Y52 H;  2AWO A;  3S1M H;  1D7Q A;  1T9H A;  1IL2 A;  3ULJ A;  4A3D H;  3K8A A;  4GKJ L;  4JI6 Q;  1YIT A;  1MIU A;  4LUV A;  2ID0 A;  1U0L A;  5GAH C;  4H02 A;  4JI4 Q;  3CAM A;  1HH2 P;  4A3C H;  2N3S A;  3PV0 A;  4UPA A;  5H1S E;  2ZJP A;  3W1B A;  1VS0 A;  4BA1 I;  1S72 A;  4IO9 A;  5M5Y H;  5M5W H;  4P73 A;  3PIP A;  4B3T L;  1Y1V G;  5BR8 L;  3RN2 A;  4JBJ A;  1NE3 A;  3J7A 5;  1UEB A;  3AFQ A;  4OO1 I;  1XMO L;  1PH8 A;  1HR0 L;  4GNX A;  2NVQ H;  1I50 H;  1U5K A;  4DV7 Q;  2JA9 A;  4BBR H;  1VQ7 A;  2B63 G;  2CCZ A;  4P72 A;  4OON A;  4GOP C;  2CFM A;  1Q12 A;  1MJE A;  5IY0 A;  1SFO H;  4LNQ A;  4LFC Q;  4JI3 Q;  5JJL A;  5GAE C;  5ELO A;  4DV3 L;  4DV4 Q;  3M85 A;  3M3Y H;  5IT9 c;  4PMW A;  4KHP Q;  3DM3 A;  3GTM H;  3HOW G;  3PO3 H;  5HY6 A;  2JE6 I;  2EXD A;  3CCJ A;  2KHJ A;  4R4C A;  2FXQ A;  1KQS A;  4DV1 Q;  1PHJ A;  2VQF L;  2ZJQ A;  3F1Z A;  2VUM G;  1E22 A;  1NJI C;  4JI2 Q;  3STB C;  1Q46 A;  2HIV A;  3JAM i;  1KRT A;  1JB7 A;  5HGQ A;  2Y0S E;  4LFA L;  3S17 H;  4DR4 L;  1VQ6 A;  1KXL A;  2QEX A;  4GOP A;  1EWI A;  4OX9 Q;  1LYL A;  3FKI G;  2UXC Q;  3S24 A;  4AYB G;  1B7Y B;  1Y1W G;  2IX0 A;  1N9W A;  3G48 A;  3CCS A;  3GO5 A;  4A3I H;  4P74 A;  3L2P A;  1HNZ L;  1IBL Q;  2WP8 J;  4GS3 A;  5C0X G;  1VQO A;  4JV5 Q;  1VQP A;  4HIM A;  2N78 A;  2QGQ A;  1VQL A;  4UP9 A;  1X9N A;  3T1H L;  5FLM G;  3WWV A;  4AH6 A;  2CWA A;  2A19 A;  3KOJ A;  3NBH B;  2ALY B;  2D0P A;  5FLX c;  3CCL A;  2HQL A;  1HNW Q;  3NEM A;  3NEL A;  4JI7 L;  1AE2 A;  4A3D G;  4IPC A;  1KD1 C;  4A3K G;  3GTK H;  1I94 Q;  4X62 L;  1PV4 A;  3VDY A;  1X3E A;  4EQ5 A;  4DR5 L;  1KL9 A;  3AQQ A;  3H0G H;  2VQE Q;  4HJ7 A;  4DV6 L;  2UXB L;  1K83 H;  1QVC A;  1BBU A;  2K5H A;  2JA5 G;  2NVX H;  4LF6 L;  2JK8 A;  2YTV A;  3CCQ A;  1VQM A;  1QUQ B;  4YWK A;  4X66 L;  3F2C A;  1EUJ A;  3B6Y A;  2MQH A;  2OTL A;  5IWA L;  1D8L A;  4AQY Q;  2K5V A;  5GQO A;  3RZD H;  4BXX G;  1UE6 A;  4IFD I;  2NVY H;  2UUB L;  4K0K Q;  3W5O A;  2XGT A;  4DAY B;  2MO1 A;  3H3V H;  1L1O B;  2K14 A;  3J81 i;  1SE8 A;  1XMQ L;  3PIO A;  1EFW A;  2F4V Q;  4B3R Q;  1KRS A;  2HHH L;  1IXR A;  4IJL A;  1G6P A;  1FL0 A;  1SRO A;  4PG3 A;  1M1K C;  1VQF A;  1HZC A;  3T1Y L;  4JYA L;  2VNU D;  5AJ3 Q;  3CPF A;  3KDF A;  4XIG S;  1CSP A;  2YYZ A;  4A76 A;  3PO3 G;  3CMA A;  2E8G A;  3J81 j;  3AFP A;  3KF6 A;  4C3J H;  5M3F G;  2F52 A;  2VS1 A;  2A1A A;  3OTO L;  4QJF A;  1YJ9 A;  4DR7 Q;  2YU9 H;  1PH5 A;  4KI0 A;  1LUZ A;  1L0W A;  1VQ8 A;  1K9M C;  1X56 A;  1GD7 A;  2GN5 A;  1VQK A;  1O7I A;  2L15 A;  5IP9 G;  1GO3 E;  5IP7 G;  1S40 A;  3GTP H;  4X65 Q;  1PFS A;  3HOW H;  2CWP A;  4DV0 Q;  4JG2 A;  4JI5 L;  4DR2 L;  3I56 A;  1Q1E A;  2N8N A;  4YWL A;  2VUM H;  1N32 L;  5JJI A;  3F8T A;  4DUZ L;  2F3I A;  3HOY H;  3CW2 C;  4LF7 L;  4DK6 C;  4DV2 L;  2NVT H;  4PZ6 A;  3FKI H;  4NXM L;  1YHB A;  1X3G A;  3CCV A;  1Y1W H;  4R4Q A;  1A63 A;  1K8A C;  1PH1 A;  2NZH A;  4NXN Q;  3KF8 B;  1K8G A;  2UU9 Q;  2R7Z G;  2DUD A;  4LUO A;  1YVC A;  1JT8 A;  2UUA Q;  3M7N A;  1R9T H;  5FLM H;  2HIX A;  1VQG A;  4GNX C;  5IE8 A;  3K7U C;  4L5S A;  1XPU A;  1HNX L;  3GTG H;  1DGS A;  1YEZ A;  2I5M X;  1V1Q A;  1FJG L;  4LF8 Q;  1YIJ A;  4C2M H;  4DUY L;  4A3K H;  2ASB A;  1M90 C;  2EQS A;  3CXC A;  4HJ8 A;  1TWA H;  4BA2 I;  1JE5 A;  3ER0 A;  1VQE A;  2KCT A;  5BR8 Q;  4AIM A;  4JCV E;  4B3T Q;  4A3M H;  2R92 G;  3I4M G;  3TRZ A;  4GKK Q;  3GDE A;  1HR0 Q;  4POG A;  2IHE A;  2JA5 H;  3CME A;  3CC2 A;  2XTI A;  4LWC A;  2IY5 B;  4B3M Q;  3CCM A;  4L5T A;  4BBS G;  4WJ3 M;  3L0O A;  4GN4 B;  4A3J H;  2K5N A;  2D0O A;  2K4K A;  1QZH A;  2N49 A;  2OQ0 A;  4HID A;  4JI8 L;  4YY3 L;  3OW2 A;  3G6E A;  3GTO H;  2R93 G;  2QA4 A;  5C4X G;  4DK3 C;  1WCM G;  1PH9 A;  4OWW B;  3PSI A;  2JA7 H;  5M3M G;  4DV3 Q;  3AEV A;  1YJW A;  4QQB X;  2Z6K C;  4A75 A;  4GLV B;  1YZ6 A;  5GAD C;  4DR3 L;  3NEN A;  2H5X A;  1J6Q A;  1NMG A;  4JBW A;  4YCW A;  4JOI C;  1XJV A;  1E7Z A;  5IYB G;  1N33 Q;  4ME3 A;  1Q8K A;  1TWC H;  2WFW A;  4LFB L;  1IBM Q;  4JI6 L;  4DR4 Q;  4QIW E;  2KHI A;  5C3E H;  4GN3 B;  1QVG A;  1HZA A;  1YJN A;  5M3F H;  4J15 A;  3GD7 A;  4OWX B;  1EYG A;  3UDI A;  1L1O C;  2KBN A;  3UE1 A;  1UE1 A;  3CCR A;  3HOY G;  1HNZ Q;  1NY4 A;  2B29 A;  2KEN A;  2ZTD A;  2PI2 A;  1JJC B;  4A3L G;  3TS0 A;  1AH9 A;  5IP7 H;  5IP9 H;  4B3S Q;  2Z6K A;  3MXN B;  3F2D A;  1VQC A;  1QUQ A;  4JI0 L;  3J80 c;  1LM0 A;  4HJ9 A;  4WJ4 A;  4JOI A;  1N8R C;  4A93 G;  1CUK A;  3KJO A;  1ASZ A;  4LF9 L;  4JI7 Q;  4MNO A;  4LFC L;  3HOZ G;  2PI2 E;  1RL2 A;  4DV4 L;  4IFD G;  4X62 Q;  3GTQ H;  1L1O A;  4KHP L;  3EIV A;  1XPO A;  4DR5 Q;  2OWO A;  1XNR L;  5GAG C;  4R4T A;  4DV6 Q;  3RLN A;  1YI2 A;  3EN2 A;  2V1C C;  1J5E Q;  1YHQ A;  1C9O A;  1WYD A;  1X6O A;  2BA1 A;  2MO0 A;  2E5L L;  4YHH L;  1Q81 C;  4X66 Q;  4A3M G;  3ERS X;  1X3F A;  2NZO A;  5C0X J;  1PH2 A;  1KHI A;  2BH8 A;  2LXK A;  2PQA B;  1OXU A;  5IWA Q;  3UE0 A;  4LW1 A;  4OX9 L;  3TEH B;  1UE5 A;  2UUB Q;  2NN6 I;  3UDX A;  1PH6 A;  5IYD H;  4A3J G;  4L5R C;  1VQ5 A;  1XNQ L;  2E2J H;  4LF5 Q;  1CKM A;  1G29 1;  3I4M H;  2R92 H;  4R4I A;  4HJA A;  1VQ4 A;  2VZA A;  4DKA C;  1CKN B;  4BXX H;  3RZO H;  2YV5 A;  2UXD L;  2ES2 A;  2AKW B;  3BZC A;  2B3G A;  1FVI A;  5LMN Q;  3T1Y Q;  2Y0S G;  1GM5 A;  4JYA Q;  1VQI A;  4BY1 G;  1HNW L;  4BBS H;  2GVB A;  2ZJR A;  4DR6 Q;  4IOA A;  4IOC A;  4GOP B;  3RNU A;  2JEB I;  2R93 H;  1B8A A;  1HZB A;  5C4X H;  1I94 L;  3M4O H;  1KIX A;  1WCM H;  4DV5 L;  3TQY A;  5C3E G;  5M3M H;  2D62 A;  4JI1 Q;  4A3E G;  2YTX A;  4OWT B;  3D31 A;  3S16 H;  1N34 L;  4DR1 L;  1VCI A;  1K0R A;  3JC6 6;  3TRE A;  4A3G G;  4JI5 Q;  3IRB A;  5IYB H;  1B70 B;  4DR2 Q;  1IBK Q;  1P16 A;  2CQO A;  1E1T A;  1Q82 C;  3J7Z C;  3G4S A;  2ZM6 L;  5FJ8 G;  4X64 Q;  1N36 L;  2JA8 G;  1K3R A;  3KFU A;  1GVP A;  1A0I A;  5LMU L;  4DV2 Q;  2I0Q A;  3I4O A;  4K0K L;  4POF A;  4MTN A;  4NXM Q;  4YCU A;  1NBW A;  1I3Q H;  3PF5 A;  3A5Z B;  1SMX A;  3S1Q H;  1I6H H;  2F4V L;  4B3R L;  2GVA A;  2Z0S A;  4A3L H;  3K7A H;  5M5X H;  5E7N A;  1IYJ B;  1W3S A;  4HIO A;  2JA7 G;  4UP7 A;  1Q1B A;  1EQR A;  4GLX A;  1TWG H;  3K0X A;  3CD6 A;  3F2B A;  3M9B A;  4A3B H;  2UUC L;  4IJH A;  3CPW A;  1HNX Q;  4A93 H;  3RLF A;  1P8L A;  3HOZ H;  4UP8 A;  4OXP A;  4DPG A;  5DLQ E;  1PYS B;  4DUY Q;  3I2Z A;  4LF4 L;  4GKJ Q;  1JMC A;  3M4P A;  1UWV A;  2Q2T A;  3PUZ A;  2JA6 G;  3D0F A;  4KLK A;  3U58 A;  4X65 L;  4C3I H;  5JEA G;  5IYD G;  2OTJ A;  4TQU S;  1OXT A;  3JAM c;  3S15 H;  1HR0 W;  2VW9 A;  2A8V A;  2PMZ E;  3CP0 A;  2C35 B;  3UDG A;  2VL6 A;  1I5F A;  3HOX G;  4A4I A;  1S3O A;  1XMO Q;  3FP9 A;  1KAW A;  2R6G A;  5J3B A;  1EOV A;  4JI8 Q;  4ALP A;  4A3F G;  1PA6 A;  2JEA I;  1L2F A;  2EIF A;  1KC8 C;  3HOU H;  3HOV H;  4PZ8 A;  3UDF A;  5IYC G;  3LGJ A;  3ULL A;  4IPD A;  3I4N G;  4NXN L;  2UU9 L;  1VQA A;  3FHW A;  1MKH A;  1NTG A;  2IT1 A;  3I7F A;  1LTL A;  3AYH B;  5C4J H;  1SRU A;  4AYB E;  4LFB Q;  1VQ9 A;  4BY1 H;  3S2D H;  2AHO B;  3STB D;  3PCO B;  4Y7N H;  1JJG A;  1SR3 A;  3U50 C;  4LF8 L;  2VQF Q;  4JBK A;  3A0J A;  3BJU A;  5C44 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...