4GKJL

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human mitochondrial anticodon stem loop (asl) of transfer rna methionine (trnamet) bound to an mrna with an aug-codon in the a-site and paromomycin.
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Expanded use of sense codons is regulated by modified cytidines in tRNA.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 15
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2012-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4gkjL00
1EUJA 2PMZE 4JV5Q 4HJ5A 3PF5A 4LF8Q 2KHIA 1X3EA 2CWPA 1GO3E 4GN4B 1HNXL 3G71A 4DR7Q 3TRZA 3NENA 2JEBI 3NBHB 3U4VA 3T1HL 5DLQE 4GOPC 3CC4A 4X62L 1L1OC 3HKZE 4AQYQ 1X9NA 5M3MG 4DR6L 2ZJQA 3GTKH 4LFAQ 2K5NA 2Q2UA 1OXUA 1YJNA 2XGTA 2HHHL 4BBRH 2F4VQ 1HNZQ 1GD7A 1EYGA 1X3GA 3AQQA 4LF5L 2NZHA 4AH6A 2VUMG 5HGQA 4A3EG 1XJVA 1K3RA 3PO2G 4JI8Q 1PH6A 4LNQA 1NTGA 4HJ8A 1VQ6A 2GVBA 4Y7NH 1HJPA 4LF6L 5LMNL 3S17H 2WAQE 1Z9FA 4B3SQ 5C4XG 1Q12A 1KL9A 1EQQA 3RLNA 3TREA 1PH9A 4A3GH 3L2PA 3FHWA 1QZGA 3OYYA 4X66L 1VQIA 4OWTB 4A3MG 4YCVA 4HIDA 2VS1A 2I5HA 4DV2Q 1X6OA 3S15H 1Q82C 4X64L 4A3DG 4A3JG 1YHBA 4LF8L 3EN2A 2YTXA 5IP7H 2BH8A 3M85A 5M3FH 1LUZA 1Q7YC 1L1OA 3HOYG 3M3YH 1EQRA 1XNRQ 3PGZA 2VL6A 3KLWA 3UDFA 1X65A 3AYHB 4A3KH 2YTVA 3F1ZA 2AKWB 2IY5B 1I94L 4OXPA 3BZKA 3I4MH 4GS3A 5M3MH 3J81j 1Z47A 4XIGS 2R7ZH 1I3QH 5ELNA 3M9BA 5M5WH 4DR2Q 1C9OA 1PA6A 5LMUL 2IX0A 2JA7G 2Q2IA 1N32Q 4DK3C 4DV2L 4R4IA 4DR1Q 2A19A 3K80C 4JI1Q 1VQMA 4WJ4A 5C0XG 3KF6A 1ASZA 4DV5Q 4DUYQ 3TS0A 3PIOA 4DV1L 4L5RC 4KHZA 2QGQA 4GNXA 4B3SL 1YITA 1JMCA 2E5LQ 3SGIA 4A3IH 1S40A 3CW2C 2MQHA 3RLOA 4R4QA 5FJ8G 5C4JH 3A74A 1LM0A 4C2MH 2MO0A 4UP7A 3G6EA 1MJEA 4DR4L 4JI2L 2AWNA 3PUWA 1R9TH 1VQPA 3BJUA 1C0AA 2K5HA 2UUBQ 1IXRA 4DR5L 4LF9Q 1K83H 2UXCQ 4DR6Q 4LF9L 1CKNA 5AJ3Q 3FP9A 2R6GA 5GAEC 3GTMH 1SE8A 3K8AA 1PH4A 1CKMA 1N33L 4IFDI 5JJLA 3HKSA 4C3IH 2L15A 1E1TA 4DR4Q 5IYDG 4O2DA 3S2HH 3MEFA 4LUOA 1E1OA 1YI2A 3HOZG 5FLXc 1Q81C 5IWAL 3I4MG 4DR7L 2OTJA 4QQBX 3H3VH 1QVGA 3F2DA 3CCSA 1HZ9A 1YZ6A 2IT1A 3Q8DA 3J80c 3KF8B 4DV5L 2CCZA 1I6HH 4YWLA 5C44G 1XNQL 3GTLH 1A63A 1YHQA 3G4SA 4JI1L 1CUKA 1PYSB 2K75A 4IJHA 3PUXA 4YHHQ 4A3LG 4DR1L 4A3CG 2GN5A 3M4PA 2KHJA 2YYZA 3H3VI 3VDYA 4DV3L 2UUCQ 1OXTA 3CAMA 4KLKA 4A3DH 4A3JH 1NJIC 2JA5H 1WCMH 4BA2I 3CCVA 3DLLA 1LTLA 4GOPA 4GOPB 4R4TA 3T1YQ 4PZ7A 1TXYA 4JI8L 3I4NG 1UEBA 3AEVA 1EOVA 5GAGC 1N33Q 3K7UC 4LW1A 3GTJH 3HOUH 1WI5A 1PYBA 5AJ3L 1UE6A 4A3BH 1UE7A 1KRTA 2PQAB 3K0XA 3RLFA 5M5YH 3E0EA 3CXCA 3IRBA 3LGJA 4AQYL 4Y52H 1IZ6A 3GDEA 3KDFA 4X66Q 1RIPA 3T1HQ 2UXBQ 3GTGH 4NXNL 2RHQB 1HZBA 2RF4A 4B3RL 2ZJRA 2ZJPA 2N78A 4OWWB 4LF7L 4IO9A 3A5UA 3H0GH 2K50A 4OO1G 4H02A 1GVPA 1VQCA 1L1OB 2RHSB 4A3IG 4BBSH 4JV5L 4XTCS 1XPRA 2K4KA 2VQFQ 1XMQQ 1UE5A 3G48A 4B3MQ 5LMNW 1VQBA 3CD6A 4P71A 4KHPQ 5C3EH 5M5XH 4A3CH 2KCTA 2E8GA 4JI3L 4DV0L 2UUAL 2UU9L 1NBWA 4DV7Q 2BH2A 4ALPA 1N32L 2OCEA 2CWAA 3ER0A 4DR2L 1XPUA 3CF5A 2VUMH 3HFZB 3MXNB 4GN3B 4HJ9A 2Q2TA 1XMOL 5IY0A 4C3HH 3I4NH 4RMFA 1Q1BA 3CP0A 3TQYA 3CPWA 4LF4L 4JYAL 5C4XH 3F2BA 4JBWA 1KQSA 2I0QA 1SMXA 1X56A 2R7FA 2ASBA 2IX1A 3CCRA 1G291 4GLXA 3CCLA 1FGUA 3HOZH 2YU9H 4LUVA 3S1RH 4JBMA 3PO3H 4EQ5A 4IOCA 1Q46A 3ICEA 4IPGA 3RZOH 2YTYA 5J3BA 1IBML 2D0PA 2RCNA 3GD7A 2F52A 1EIYB 1D7QA 1X3FA 4L5TA 5IP7G 3GTOH 4X6AH 3HOWH 2I5LX 3AFPA 1FJGL 2BA0A 2D62A 3J7ZC 2N49A 1I5FA 5BR8Q 3S24A 3CMEA 4DR3L 4A4IA 3RN5A 2HQLA 2KENA 4OONA 2JA9A 4JOIC 3AFQA 4IJLA 5JEAJ 4R4OA 3KOJA 4LF5Q 4K0KL 1HNWL 2CFMA 2JA6G 4HIMA 3EBEA 1CSPA 2HHHQ 1VCIA 4JI6Q 4LFAL 3S1NH 4WJ3M 2C35B 1K73C 1JJ2A 4OX9Q 3M4OH 2R93G 1EWIA 4X62Q 1JJGA 3E9IA 1OXSC 1IBLL 3ULLA 1N36Q 1UWVA 5H1SE 5FJ8H 3U4ZA 1VQ9A 2UXDL 4JOIA 2E2JH 4GN5A 4PZ6A 1B7YB 1O7IA 1Y1WH 1FL0A 4P75A 1HNXQ 1ASYA 3PO3G 2DUDA 2HIXA 3M4QA 4GKJL 3K81C 1SR3A 1Y1VH 5IE8A 3ZJYC 1YBYA 4JG2A 1Q86C 3GO5A 4L5QA 4YY3Q 5ELOA 2VZAA 4YWMA 3F2CA 1IBKQ 4LFCQ 2JA8G 3FKIH 4C3JH 1N36L 3TS2A 3M7NA 3PIPA 1X54A 1V43A 4TVAB 1M1KC 4JI0L 1J5EL 4R4CA 2VQEQ 2LXJA 5GADC 5IYDH 4DK6C 1IYJB 3EIVA 1YNXA 4BY1G 3KDFB 4A76A 1Y14B 3I2ZA 3J81i 2K14A 4GNXC 1VQ4A 1JB7A 3CC7A 3KYHC 2UUAQ 1DGSA 2HIVA 2LXKA 4YY3L 1OXXK 4OWXB 2NVTH 2PQAA 4UPAA 2VQFL 2IHFA 2WP8J 3W5OA 4DUZL 3W1GA 2ZM6L 1SROA 4IPCA 1N34Q 3CC2A 2ATWA 4BY7H 4A3LH 1MJCA 3PUVA 1S72A 1JE5A 2ZTDA 4LUZA 2XTIA 4LF7Q 3PUZA 4DV6L 5IP9G 3E9HA 4JBJA 1QZHA 2ALYB 1MKHA 2A8VA 3PCOB 4DV6Q 2K5VA 5FLMG 5IYCG 2I5MX 1HR0L 1Y1WG 3HOVH 2UXBL 1NY4A 1PH7A 1IBMQ 4QIWE 1G6PA 4BA1I 4JI6L 4HJ7A 4JI7L 1M90C 3CPFA 4PG3A 1U0LA 2QEXA 1JJCB 1XTDA 4JI5L 5JJIA 2DGYA 2R7DA 4DPGA 4X65Q 4DV4L 2R7ZG 2MFIA 2EXDA 3PUYA 4HIKA 4LF4Q 4POGA 2Y0SG 4BXXH 1AH9A 4YCUA 3STBD 2VQEL 3PV0A 3BU2A 4A3EH 1VQLA 3PO2H 4JI0Q 1PFSA 1A8VA 2OQKA 1IL2A 4BY1H 3S14H 4P74A 2UU9Q 2E2HH 4LFBL 4B3TQ 1QUQA 4GKKL 1PH1A 4LFCL 1VQKA 5HY6A 4HJAA 4BBSG 1RL2A 3GTQH 4LFBQ 4B3ML 3W1BA 1P8LA 1AE2A 5GQOA 1W2BA 2CQOA 2ZTCA 1WJJA 4LWCA 3JAMc 2KCMA 2E2IH 4P72A 1VQNA 4A93H 4A3MH 1UE1A 1Y1VG 4MTNA 2AHOB 2NN6I 5C0XJ 1NE3A 1BVSA 3S1QH 1YEZA 2VW9A 3H15A 4NXNQ 5FLMH 1X55A 1QVCA 1V9PA 3GTPH 1VQOA 1XMOQ 4DNIA 4GNXB 5IT9c 4GLAC 1E24A 1KD1C 4A3KG 3D0FA 1VQHA 1BKBA 1S3OA 2FXQA 3K7AH 3KF6B 3UE0A 4DR5Q 4NXMQ 2UXCL 4JI3Q 1D8LA 1HNWQ 4A3FH 1V1QA 2JA7H 1MIUA 2WAQG 3CCMA 1XMQL 1YJWA 1WFQA 2R92G 4IPHA 1I50H 1NMGA 3ERSX 4AYBG 4DR3Q 2Z0SA 2GVAA 3J7A5 3CCQA 4DV3Q 3I56A 3L0OA 1CSQA 3UDGA 5IP9H 2ES2A 4B3RQ 5JJKA 1CKNB 2EIFA 1VQ8A 3DM3A 3I7FA 4GKKQ 1G51A 2MO1A 3B6YA 2PI2A 5IYCH 4NXML 4DAYB 5IYBG 1TWHH 4PZ8A 3CCJA 1U5KA 1E3PA 1SFOH 4UY8C 1PH3A 2VNUD 2MNAA 2D0OA 1W3SA 3NELA 2Z6KC 2JA6H 3S16H 3KJPA 1KRSA 4R1JA 5IWAQ 2A1AA 3WWVA 3S1MH 1PV4A 4RG1A 5JEAG 4X65L 4JYAQ 3J80i 3I55A 4JI5Q 1PHJA 1WOCA 1HZAA 3T1YL 3CCEA 1YJ9A 4BXXG 1KAWA 1C7YA 2NVXH 3UE1A 2JK8A 4MZ9A 1PVOA 1VQ7A 4QJFA 2KBNA 1GKHA 3U58A 3CCUA 4X64Q 3UDXA 1HR0Q 4YHHL 2NN6G 1H95A 1VQEA 1VQGA 3RNUA 2K52A 2Z6KA 3H0GG 4B3TL 1XNQQ 2VY3A 4JI2Q 3RR5A 2V1CC 4FDBA 3J81c 2B29A 1IBLQ 1N8RC 2OTLA 1HH2P 1A62A 1TWFH 4QGUA 3I4OA 2E5LL 4A3GG 1K0RA 1SRUA 2WFWA 4MNOA 5C3EG 5LMNQ 2LSSA 4HIOA 4EX5A 3HOXG 4IPDA 1XPOA 1JT8A 4DUYL 4DV4Q 3PSIA 4DAMA 4YCWA 1BBWA 1SLJA 1P16A 1B8AA 5M3FG 4QY7A 5IYBH 1AE3A 2F4VL 5LMUQ 1K9MC 4OO1I 3HOUG 4UP8A 3CMAA 1QVFA 3A5ZB 2N3SA 2H5XA 2ID0A 1I94Q 2NVYH 4AYBE 1L0WA 4ME3A 1B70B 3ULJA 4P73A 1PH2A 1IBKL 1XNRL 4IFDJ 2JEAI 3CQZH 2R92H 2IHEA 1WYDA 3U50C 1GM5A 4GKJQ 3UDIA 1Q8KA 1FVIA 4DUZQ 1N34L 1OTCA 1EFWA 2N8NA 4J15A 4JC0A 2UUCL 1KIXA 2UXDQ 4APVA 3F8TA 3OW2A 3RZDH 4PMWA 4O0AA 1PH8A 3HKZG 1E7ZA 2OWOA 1NMFA 5GROA 4JI4Q 2B63G 2JQOA 4OX9L 3TEHB 1J5EQ 1VQ5A 3KJOA 3HOXH 1VS0A 4IOAA 2ZTEA 1K8GA 3NEMA 4DV7L 4A75A 3JAMi 4YWKA 3ULPA 4K0KQ 5C0XI 2R93H 4DKAC 5K36G 4KI0A 3OTOQ 2WB1E 1QUQB 4JI7Q 1EIFA 1YVCA 1CKOA 1TWAH 3S2DH 3L7ZC 2QA4A 2UUBL 1PH5A 3HOVG 1HZCA 1YHAA 1YIJA 2EQSA 1N9WA 3KFUA 2B3GA 1KXLA 2HT1A 4A93G 1KHIA 1SN8A 5GAHC 1LYLA 2PI2E 2Y0SE 1KC8C 2NVQH 1E22A 1VQFA 4NPSA 1Q1EA 3STBC 5C44H 4LF6Q 2PNHA 3HOWG 2NZOA 2JA8H 2ZM6Q 1BBUA 3A0JA 2BA1A 1TWGH 3FKIG 4DV1Q 3HOYH 4IFDG 5E7NA 4BBRG 3OTOL 4JCVE 2CKZB 4QL5A 2JA5G 1WCMG 1T9HA 2AWOA 3D31A 1VQJA 2AMCB 5EAYA 1OXVA 1HNZL 1VQAA 1J6QA 2JE6I 2B63H 4JBKA 2OQ0A 1L2FA 4TQUS 4A3FG 3BZCA 1K8AC 4GLVB 4AIMA 3RN2A 4L5SA 4POFA 5BR8L 3PF4A 1VQDA 4JI4L 4NB3A 3JC66 1FJGQ 4DV0Q 4A3BG 2JJQA 1HR0W 4BY7G 1A0IA 2F3IA 4UP9A 4KHPL 2YV5A 2WB1G 1TWCH 2Q2HA
chains in the Genus database with same CATH superfamily
1EUJA 3PF5A 1TIID 2CWPA 1S4ZA 3I91A 1DONA 1HNXL 1Y8PB 4FNFA 2JEBI 3NBHB 3VYRA 1X9NA 3MFGA 2F0TA 1LT6D 1HTPA 1YJNA 4IFDH 2BCOA 1EYGA 3C2PA 1X3GA 2K32A 2NZHA 4AH6A 1RF2D 4A3EG 1K3RA 5ELBA 1VQ6A 3PO3B 4Y7NH 1Y8NB 5C44B 1GHJA 4BBRB 4A3GH 3CHBD 4A3MG 2I5HA 3S15H 1A3UA 1LT3D 1YHBA 5JPNC 5BN4A 3QJYA 4DF7A 3M85A 1AP0A 4OIJA 2A6HC 2O2LD 1SNQA 3PGZA 4PMCA 4AYBB 1E2VA 3MAQA 1X65A 2YTVA 3F1ZA 3V96A 1LLRD 3SK4A 4OXPA 3BZKA 1PXUA 3J81j 4KN7C 1JWMD 5JVG3 4DR2Q 2I46A 1N32Q 1JICA 2Q2IA 4DK3C 5C0XG 3TS0A 3PIOA 2RDGA 1WVLA 3P7JA 4B3SL 2QF7A 4F88A 1STBA 2E5LQ 3SGIA 2KUMA 1BCPF 2MQHA 4R4QA 4C2MH 2XVSA 4JI2L 2KCCA 4QUFA 1PRTD 2HUGA 2SNSA 3LX0A 3H91A 4HCEA 4LF9L 4MIUA 1CKNA 3FP9A 1CKMA 4IFDI 2K28A 4C3IH 1DOMA 3QO2A 2B2TC 3MEFA 5FK9C 5FLXc 4DR7L 4KKSA 3H3VH 5AFWA 1HZ9A 5C4XB 3G4SA 4A3LG 1PYSB 2B2UC 1H9JA 2K75A 2DN8A 3PUXA 1S5FD 4A3CG 3M4PA 2F0WA 3DWAA 4A3JH 2JA5H 2KQ3A 1F9QA 4GOPA 4GOPB 1S5CD 5M5WB 4PZ7A 3I4NB 1TXYA 1B53A 4JI8L 4C2MB 4WRDA 2RDHA 4QUCA 5AJ3L 1UE7A 2PYKA 3K0XA 4CDEC 4BY1B 3CXCA 4AQYL 4Y52H 3KDFA 3T1HQ 1EYAA 1BBXC 3GTGH 3OMCA 1O7YA 4RGNA 2ZJPA 4ZK9B 4WJWA 4LF7L 2E2IB 4IO9A 2HD3A 2PCFB 1QNUA 2K50A 1SYFA 4XTCS 4R9WA 3Q24A 1XMQQ 1UE5A 1VQBA 2B2WC 4P71A 5M5XH 2I07B 3J81L 2UUAL 4DV0L 3MXUA 4DV7Q 1NNXA 2CWAA 4KMUC 1EU3A 5FLXL 4HJ9A 2KEEA 3I4NH 2QILA 3CP0A 1DD2A 1Q90A 3TQYA 4JYAL 2R7FA 5CORA 1S5BD 2ASBA 1G291 4GLXA 4LUVA 3TP5A 3PO3H 3RD4A 4IOCA 4IPGA 2YTYA 1QE6A 2D0PA 2F52A 3SK8A 5CMDA 2F3VA 5JVH3 1HCZA 1FNWA 5BR8Q 2GA4B 3CMEA 1LTGD 1E0BA 1K28A 4DR3L 4U68A 4A4IA 4RGOS 5I6WA 4F87A 3NSWA 4JOIC 5CGKA 4CJ2C 5JEAJ 3OIQA 4R4OA 4K0KL 2EY6A 2QDBA 4HMJA 4I65A 1HNWL 3EJIA 2NVTB 2D5DA 4LFAL 1EFID 2B2TA 2R93G 1EWIA 4OHJA 4X62Q 2PQEA 2CHBD 2RCFA 1HPCA 2VB2X 1UWVA 5FJ8H 2F0MA 4JOIA 2E2JH 1B7YB 1O7IA 3C46A 2KECA 1SR3A 2WKCA 1ZYRC 3ZJYC 1CA6A 3DMUA 2JA8G 1N36L 1DOKA 1X54A 1J5EL 1VDZA 4L6TB 4R4CA 2LXJA 1STAA 2B2UA 1IYJB 1YNXA 3KDFB 5TSSA 3UI2A 5D65A 3NPPA 4YY3L 1OXXK 1WD0A 3ZYYX 4DUZL 3CC2A 3W1GA 4A3LH 3NHHA 5I9PA 1MJCA 3H94A 4OELB 2ZTDA 3K57A 4DV6L 3E9HA 1QZHA 4RCNA 2A8VA 3PCOB 2I5MX 1Y1WG 1NY4A 1PH7A 1IBMQ 1F77A 2EDGA 2WACA 1K0SA 1GJXA 3QOJA 2QEXA 1JJCB 3K5LA 5JJIA 2R7DA 3FKIB 4X65Q 4C1NI 2R7ZG 1EY9A 3PUYA 2VXWA 4POGA 2Y0SG 4BXXH 3ITPA 1AH9A 2JSOA 1E2WA 2VQEL 1HA5A 1FNUA 1H9KA 3M7GA 1VQLA 4JI0Q 1PFSA 1AZPA 2BE5D 2K7VA 4BY1H 2A68C 4LFBL 4HJAA 3W1BA 1P8LA 1A2TA 1AE2A 4HAEA 1GUWA 2X69A 3V2TA 2NN6I 2EYJA 1KDCA 2QCPX 1VQOA 2B63B 1XMOQ 2M00A 4GLAC 1K83B 2J0TD 4OEMB 2F0DA 3T13A 4C3IG 1Y1VB 2ENBA 4NXMQ 4JI3Q 1D8LA 3NQIA 4OGQC 1V1QA 5KNCA 2JA7H 1MIUA 4JK1C 4F8MA 1T5EA 2R92G 1NUCA 1F9RA 4XXEA 3OMGA 2AQ3B 2A6EC 3CCQA 4Z9CB 3NP8A 5IGBA 2OXPA 1LTAD 2NWGA 3I72A 2EIFA 1W6KA 3DM3A 3D4DA 2MO1A 2PI2A 3A55A 4PZ8A 1SFOH 1E3PA 5M3FB 1AN8A 2IPKD 2Z6KC 2CW0C 5EKKA 3CRLC 3K6OA 1PV4A 4EQOA 5J1ZA 1WOCA 3F2UA 3CCEA 4BXXG 2VUMB 1EY6A 1LO5D 2WIIB 1TY2A 1SJED 1VQ7A 4QJFA 2KBNA 4X64Q 3D8GA 1D5MC 3UDXA 1SYEA 2QDLA 3DWQA 5C4HA 4YHHL 1NR2A 1VQGA 2Z6KA 1XNQQ 3RR5A 3R2TA 2F0PA 1V8QA 2PMZB 4OIKA 4RH6A 1K0RA 2LSSA 5CV5A 4EX5A 3NBHA 1ML0D 3QIAA 4YIJA 3DM1A 4RCOA 3PSIA 1I4XA 5CV4A 4DAYA 1SLJA 4RAUC 5IYBH 5K36H 2F4VL 4OO1I 3CMAA 4K2KA 1SYGA 4QMGA 1QVFA 2N3SA 2F0EA 3KBGA 5ELCA 1M4VA 4ME3A 1L0WA 3ULJA 5EJWA 1HFNA 2QEJC 3EQLC 3KUPA 1XNRL 2JEAI 1PDQA 2IHEA 3U50C 1OTCA 2N8NA 3NBIA 1HTLD 4APVA 4O0AA 1PH8A 1LTRD 1E7ZA 4JI4Q 3MZ5A 2B63G 3MFYA 1VQ5A 4Q0FA 4IOAA 1K8GA 3ULPA 1D6EC 3JAMi 4ILWA 2R93H 4DKAC 4HCSA 1F2LA 1SE3A 4JI7Q 1YVCA 4HEDA 3S2DH 1BCPB 2QA4A 2UUBL 1BDOA 2L0CA 4JPBW 1YIJA 1N9WA 3KFUA 2B3GA 1KXLA 4TSSA 1DXMA 4F7XA 4A3JB 1KC8C 2Z6BA 1VQFA 3STBC 4TKOB 3HOWG 2JA8H 1H9RA 1PFNA 2EYHA 2JYOA 3A0JA 3FKIG 2ZM6Q 4DV1Q 5E7NA 4BBRG 1BXTA 2CKZB 4QL5A 3W2DA 1CHQD 3SHLA 4FP5D 2AWOA 1VQJA 5EAYA 5FOBB 1UEAB 4PV1C 2E76C 4A3FG 1L2FA 5M5YB 2B39A 2YU9B 1TQOA 2FHTA 3RN2A 4A3EB 4FO2A 5KNBA 1FJGQ 2EJMA 2JJQA 1I4GA 5M3MB 4HJ5A 4G7OC 2XRQD 1GO3E 1KABA 1SBBB 3NENA 1EWCA 1BOSA 1AW7A 5LL6S 4OO1H 4LK1C 3T1HL 3U9SA 5HGTA 1IKMA 4AQYQ 2M9VA 2WB1B 4DR6L 2K5NA 2EOTA 2N55A 1GHKA 2HHHL 1BNZA 2F4VQ 2PZUA 1HNZQ 2K05A 1EY8A 4LF5L 1XJVA 1EY0A 1A15A 1NTGA 2ZXPA 2GVBA 1EEID 3SE0A 3K7AB 3S17H 2LY7A 5J39A 2RKSA 3M4YA 1LTBD 1ET6A 3TMEA 1SJHD 3GQBA 3RLNA 1EQQA 2A68D 1QCBD 2RBMA 3FHWA 1ESRA 1VQIA 1X3QA 4Q5VA 3HOZB 4X64L 2EY1A 3SK6A 4C1NK 3M3YH 5IGGA 1XNRQ 2N88A 3KLWA 1R4PB 1TS5A 1YNJD 1RDPD 5KNDA 3NUCA 5M3MH 1SFOB 1I3QH 1EYCA 5ELNA 3M9BA 1PA6A 2IX0A 2LKVA 4DR1Q 2KVMA 4WJ4A 1ASZA 1Y8OB 1QNKA 4DV1L 1PTOC 4L5RC 4MHEA 1NAPA 3ONAB 1JMCA 2PZWA 2XN9C 1S40A 3S16B 2JP1A 1B1ZA 3RLOA 3G6EA 1BF4A 2AWNA 5E3FA 1CQVA 2K5HA 2UUBQ 1K83H 1CQFA 5IODA 1Q3LA 1DM0B 5GAEC 3K8AA 4IUTA 1PH4A 1N33L 1C48A 1M8AA 1NCVA 4DR4Q 4O2DA 3S2HH 3HOUB 3HOZG 2OTJA 4QQBX 5C4JB 1QVGA 1H9SA 3F2DA 3J80c 1CHPD 2IT1A 2CCZA 1I6HH 3LNNA 1A63A 1D5ZC 2G9DA 3I70A 1PTOF 1CUKA 1PZKD 2LS01 3KLSX 5BN3A 4ME5A 3VDYA 3E6ZX 4RKLA 2FJ2A 2NVXB 3CCVA 3H0GB 1EY7A 1LTLA 3DLLA 1PZID 3T1YQ 1JORA 3I4NG 1HHVA 1EOVA 1RD9D 1N33Q 1I4RA 1PYBA 4M8AA 5EGTA 1UE6A 5KRUA 1B4OA 4ZYSA 4A3BH 3KK7A 2PQAB 1HRJA 5M5YH 3RLFA 1TWGB 3E0EA 3J7AF 3IRBA 1MGSA 3CKIB 4X66Q 1RIPA 1VF5C 2D9UA 2F0LA 2RHQB 4B3RL 1DJRD 3SEBA 3I4MB 2FMCA 3K0YA 4A3BB 1VQCA 4A3IG 4BBSH 5D3DA 2K4KA 3N6RA 2TSSA 5LMNW 5C3EH 4A3FB 1CI3M 1F9PA 2E8GA 4ALPA 3H09A 1D1IA 1XPUA 4IURA 5I9OA 1DYQA 5CBAE 4GN3B 1VMPA 4CDCC 1RKNA 3CPWA 1SMYD 4LF4L 1MSGA 1ENAA 1F9SA 1X56A 3CCRA 3HOZH 1CFMA 3S1RH 2EYPA 3ICEA 4J6HA 1IBML 2LFNA 1ESFA 1EIYB 1X3FA 3HOWH 3AFPA 2BA0A 5CC4A 1TWFB 4FVMA 2ICEC 2F0SA 5KGUA 4J1MA 3AFQA 4IJLA 5IOCA 4LF5Q 3BDLA 4CGYB 3GTOB 2X6GA 4HIMA 3X3NA 2HHHQ 4UHVA 4QIWB 5G3LF 4A3DB 4WFN3 4JI6Q 3Q6SA 4XYOA 1K73C 2A5HA 1FD7D 1F2YA 1RCVD 4CHTB 3E9IA 1OXSC 3MXGA 3ULLA 1N36Q 4K14A 5H1SE 1VQ9A 1CA5A 4PZ6A 1Y1WH 1PLFA 1FL0A 1EY4A 2C9OA 2HIXA 3M4QA 2O4XA 4J8QA 4JG2A 3GO5A 1SAPA 4OL7A 1XYIA 2K03A 5ELOA 4YWMA 2UXDQ 3T51B 4C3JH 1QJOA 3NQTA 1V43A 2NVQB 4TVAB 3HRZC 5IYDH 3G6JB 4DK6C 2SDFA 3EIVA 2K01A 3I2ZA 3I4LA 1JB7A 2UUAQ 3CC7A 4OWXB 1N34Q 2WP8J 3MVVA 3IAYA 2ZM6L 2ATWA 1S72A 3GTKB 3KLRA 4HMIA 3S1QB 5IP9G 4RGMA 4JBJA 1D5XC 2ALYB 2CVRA 2KJXA 3MXNA 4DV6Q 2K5VA 5FLMG 4BA1I 4NP5A 1MI2A 4JI7L 1IYUA 1B50A 3PMFA 3CPFA 2F0KA 3K5MA 1U0LA 4DPGA 4DV4L 4LJZC 4DU9A 4YCUA 5M9OA 2JA6B 3E0JA 3PO2H 4P74A 1PH1A 1VQKA 2NTTA 3DWPA 4JVZA 3TN2A 4BBSG 4LFBQ 1V1PB 1WTPA 2F0GA 5IGCA 2CQOA 2E2IH 4LWCA 1VQNA 2KEDA 4P72A 3TBIB 4A93H 1UE1A 1S5ED 4MTNA 3MTSA 4RHSA 3BS1A 3AMUA 2AHOB 2MGSA 5C0XJ 1YEZA 4O1NA 1X55A 1QVCA 1V9PA 5E4WC 2NYZD 1SDFA 5IGEA 5IT9c 1VQHA 3K7AH 3S17B 4X3KA 2WAQG 1YJWA 2Z1CA 3ERSX 4AYBG 2Z0SA 3GTMB 3J7A5 3OIPA 1UUPA 5EPKA 5IP9H 4B3RQ 2Z8LA 3I7FA 2Y0SB 1EU4A 1PH3A 4UDUC 3NELA 1QWYA 2BDNA 5KIXA 4I7ZC 2PNRC 4DK1A 3KJPA 4R1JA 4CJ1B 3WWVA 5EKIA 5EPLA 2F1MA 4RG1A 5JEAG 4X65L 5C3EB 1ZXTA 2M2LA 3FVQA 1KAWA 1Q8IA 1PVOA 3NWTA 3U58A 1GKHA 1U4PA 2CW0D 5IT9E 3LWEA 2O5JC 3VYTA 3M3YB 1GUSA 2B8FA 2K52A 4B3TL 4JI2Q 4FDBA 3J81c 2OTLA 3WOFA 4Y7NB 2E5LL 1SRUA 4HIOA 2KCNA 4IPDA 1XPOA 4DV4Q 4DAMA 4YCWA 3J7AV 5CYUA 1BBWA 5KEEA 1P16A 4G4KA 4QY7A 2P5ZX 1O7LA 4UP8A 1ZYRD 2E2DC 1ILQA 3TDQA 4AYBE 1PH2A 2PO4A 1MHWC 1WCMB 2F03A 1KLGD 1T5XD 1B9MA 2AUKA 2DNEA 1Q8KA 4J15A 3MC0B 4NMZA 4EQPA 4K5VA 3DUZA 2HCCA 3RZDH 2V4DA 2WKDA 2OWOA 1NMFA 5GROA 3NWSA 5D3IB 2JQOA 3M4OB 1DOLA 5JOBA 4K0KQ 5C0XI 3I3CA 5K36G 4QB4A 2WB1E 1QUQB 1CKOA 1TWAH 3BDCA 1CK1A 2L11A 1PH5A 4K8JA 2A73B 3ND8A 5M5XB 4A93G 3GP7A 2DNCA 1WTHA 2Y0SE 2ICIA 4DNTB 3PIO3 3L3OC 4C56C 1Q1EA 3OW7A 3J7YW 2Q8IB 1D2BA 2IX3A 1STHA 1WCMG 4K8IA 1RJTA 2HDMA 5HURA 1VQAA 3QG1A 4KN4C 3NK9A 4JBKA 1FR3A 1SXTA 1K8AC 4AIMA 4L5SA 2WV6D 4POFA 1GUGA 4JI4L 4NB3A 1K8MA 5JAVA 4DV0Q 1YNND 1JCKB 3J80L 4RA8A 1A0IA 4ZUJA 4C3JB 2YV5A 2O5IC 3P20A 4H0LC 5ISRA 1PZJD 2KHIA 5EKLA 3H3VC 4EQNA 3D6WA 3G71A 3HOXB 2E2HB 4XYQA 3TRZA 3U4VA 4GOPC 2NBFA 4X62L 1L1OC 3HKZE 3CC4A 5KYIA 5M3MG 4LFAQ 1CM9A 4ZAIA 2Q2UA 2A6ED 4BBRH 4M1UB 2EY2A 2F0NA 2SNMA 3PO2G 1A6XA 4JI8Q 1HJPA 5LMNL 5C4XG 1Z9FA 4B3SQ 1Q12A 4CDFC 1A3VA 1SE2A 1VMCA 2B2YC 3RUZA 1PH9A 5DM63 2J4XA 3L2PA 1QZGA 2MP1A 4OWTB 5C5MA 4YCVA 4HIDA 1JOKA 4A3DG 5E1FA 4A3JG 4NW2A 2K5DA 1BUVT 3EN2A 2BH8A 1AFPA 1Q7YC 1LUZA 1L1OA 4N8FA 2VL6A 3UDFA 3IFDA 3AYHB 4A3KH 4K6LA 2KHSA 3MWYW 1I94L 1PTOD 4GS3A 1Z47A 1C4QA 2R7ZH 1FGBD 3D6CA 2EE1A 5LMUL 2B8GA 3JAML 4ZQ3A 4R4IA 1HUMA 3K80C 4JI1Q 3CRKC 5A2QL 3KF6A 1FYCA 4DV5Q 4KHZA 2QGQA 4GNXA 5C4ZA 4FXDA 3CW2C 5FJ8G 5C4JH 2XNAC 4XQQA 3A74A 1LM0A 3T53B 2MO0A 4UP7A 3C3LA 4DA2A 2A69C 4BS9A 1IXRA 4DR5L 3MHBA 2UXCQ 2QKIC 4PNYA 3KF8A 2H4OA 4DR6Q 3KLSA 5AJ3Q 2R6GA 1SE8A 5JJLA 4LUOA 3U9OA 1RTNA 3I4MG 5IWAL 1ZEQX 5EPJA 1ENFA 2RQXA 3GV3A 3Q8DA 1ILPA 2XWJB 4DV5L 4P2CB 5C44G 2SOBA 1XNQL 3GTJB 3GTLH 4JI1L 1EOTA 4IJHA 5DNFA 3K5NA 4YHHQ 4DR1L 5G3LD 3H3VI 4DV3L 1OXTA 4KLKA 4A3DH 2EXZA 1WCMH 4BA2I 1U9RA 1XXGA 2HCIA 4DN4M 3HOUH 1RTOA 3K7UC 4KJOA 1WI5A 3GTQB 3T56B 1PMRA 3NTIA 1EYDA 1IKLA 4FYDA 1BCPD 1LABA 4HSVA 1IZ6A 3GDEA 4NXNL 2RF4A 1I6VC 4OWWB 2K1BA 4BY7B 2PW7A 1JB3A 4H02A 3T4AC 2OF1A 4JV5L 1XPRA 2VQFQ 4B3MQ 5IGDA 4KHPQ 4LMQD 3GTPB 1TKWB 2KCTA 4JI3L 2UU9L 2R92B 1N32L 3ER0A 4DR2L 3HFZB 5T1IA 3MXNB 2EPBA 2Q2TA 5IY0A 4C3HH 1E2ZA 2L9HA 1Q1BA 5A35A 5C4XH 2I0QA 2IW3A 1SMXA 3T16A 2IX1A 3CCLA 1FGUA 2YU9H 4K2LA 4JBMA 2VB3X 4EQ5A 2RSOA 3RZOH 3ERQA 2RCNA 3GD7A 1SMYC 2PPBC 4L5TA 3GTOH 4X6AH 1D7QA 2JA7B 1IHZA 1GUOA 2D62A 1WTQA 4IALA 1MSHA 2E2JB 3S24A 2XSCA 5J22A 2HQLA 4HN7A 1HFGA 2KENA 4GZYC 3KOJA 1KDAA 1HQMC 3C1FA 1CSPA 4ID6A 1VCIA 4G57A 3S1NH 4WJ3M 3LWUA 1JJ2A 5I4DA 3OWEB 1XTCD 2E74C 3TSSA 1JJGA 1Y69U 2EJGC 1TVXA 4NDXA 4DAPA 1EQVA 4S3SA 4P75A 2DUDA 5C3XA 2NN6H 4GKJL 3L9AX 1Q86C 5IE8A 1YBYA 1D1KA 4A3IB 2B2VA 4L5QA 4IUPA 2VZAA 1SE4A 3F2CA 3VA5A 1IBKQ 3FKIH 3TS2A 2NTSA 3M7NA 3PIPA 1EL0A 4DXFA 4JI0L 3OPOA 1TR5A 2VQEQ 5GADC 3ND9A 3RZOB 2K5QA 4C3HG 1VQ4A 2K14A 4A3GB 3Q0AA 3KYHC 1DGSA 2FINB 2HIVA 2LXKA 1O78A 2FMMA 2IHFA 3W5OA 1LT5D 4E6IA 3PUVA 1JE5A 4LUZA 2F0HA 2XTIA 5FKAC 4LF7Q 5IYCG 1HR0L 3HOVH 2K6AA 4QIWE 4JI6L 2IL8A 4IUNA 1KNAA 1M90C 3URYA 2R93B 1XWEA 4KY5A 2EXDA 2MFIA 4DGZA 4HIKA 1TY0A 2G9HD 3QB3A 1IL2A 1A8VA 2UU9Q 2E2HH 4B3TQ 1QUQA 4GKKL 4LFCL 5HY6A 1PRTF 2K33A 3GTQH 1ICFB 3QR8A 1EIHA 1W2BA 2ZTCA 1CZGA 3JAMc 2KCMA 5T1GA 2DJGC 2XWBB 1NE3A 1BVSA 3FRPB 3H15A 4NXNQ 2A69D 5FLMH 4DNIA 4GNXB 1EZ8A 1SNPA 1HA6A 3KF6B 2FXQA 3UE0A 2EY5A 1TU2B 3A54A 1PFBA 1HNWQ 3WDNA 2F0FA 4A3FH 4ZLTF 3A7AB 2XRSD 2IWHA 1XMQL 3J80E 1K3BC 2K5WA 3EVQA 3FPUB 4IPHA 1I50H 1NMGA 3AB9A 3SVMA 1J9OA 4KKTA 4DR3Q 1G6ZA 2F0OA 2GVAA 3IFTA 3HOYB 5LL6X 3I56A 4MN3A 3NTKA 1CSQA 2ES2A 5JJKA 3CU7A 1VQ8A 1G2TA 4GKKQ 2B2VC 1EEFD 5IYCH 4NXML 3HOVG 3CCJA 1U5KA 2VNUD 4N8X1 5KYLA 2D0OA 3EROA 3A8JE 1LTID 5IWAQ 3S1MH 3DXJC 4HSPA 3A7LA 4XT1B 4JYAQ 2HDLA 3J80i 3I55A 4JI5Q 5NUCA 3HS0C 2ZXOA 1HZAA 1SYBA 4KTAA 3T1YL 4HR7B 1YJ9A 1C7YA 2NVXH 5A2QE 3UE1A 3R93A 1HR0Q 2NN6G 1VQEA 4JW0A 5FO8B 3G7LA 3O13A 3WOEA 1IBLQ 2B29A 3MXPA 1N8RC 1STGA 1A62A 4B08A 4QGUA 2KA7A 4TRDA 2WFWA 1NSNS 4EGVA 4CDDC 4DUYL 4IQZA 1JT8A 1CTMA 2CQAA 1K8OA 5M3FG 1B8AA 1MBYA 1MD2D 5LMUQ 1K9MC 1I50B 1EWHA 3A5ZB 3OOCA 2H5XA 2C5CA 2ID0A 1I94Q 2NVYH 1B70B 4KKUA 4R8IA 4P73A 3N52A 4CBVA 4ZUIA 4IFDJ 4ABNA 3MEHA 2R92H 3GV6A 3BVZA 4GKJQ 3UDIA 1N34L 3R2IA 1EFWA 2UUCL 1S5DD 1TT2A 1JQYD 4C3IB 3F8TA 3OW2A 4PMWA 3K58A 4CKBA 4OX9L 3TEHB 5I2XA 1J5EQ 3HOXH 1VS0A 3EA6A 1AEXA 2RVLA 2SEBD 4DV7L 4A75A 4YWKA 3I90A 2J7ZA 3BDOA 5CV8A 2D2CC 2MUYA 4KI0A 4X3SA 3OTOQ 5IT9L 1EIFA 1I6HB 1L0YB 4CKEA 1J8IA 4RKBA 1HZCA 1YHAA 1F2MA 2JN4A 1SEBD 1SN8A 2HT1A 1LYLA 5I2YA 2PI2E 3A56A 2NVQH 1E22A 4HTHA 5COYA 4NPSA 5JJZA 1KLUD 2PNHA 5C5LA 2NZOA 1BBUA 3HOYH 4FF1A 2A6HD 4IFDG 2CH4W 3OTOL 2F0IA 4JCVE 1JWSD 4H7BA 3IKJA 1T9HA 2AMCB 4ZRZA 5K5PA 1HNZL 2JE6I 1VF7A 4UAIA 2OQ0A 4TQUS 1AZQA 3PO2B 3V05A 1VQDA 2R61A 4N9TA 3EFXD 3JC66 4A3BG 4QF4A 1UAPA 1HR0W 4KHPL 3SR1A 2Q2HA 3SK5A 2MHVA 2PMZE 4JV5Q 1SNOA 1QB5D 4LF8Q 5FO7B 1X3EA 4GN4B 2OEOA 5DM73 4ZKBB 5ELFA 4C3HB 4DR7Q 2NVYB 2Z4IA 5DLQE 3NTHA 2H1EA 2MPMA 4C3JG 2ZJQA 3GTKH 4QCLA 1OXUA 2XGTA 1GD7A 1LTSD 1U4LA 2EVBA 2MJ8A 3AQQA 4WORA 3NXWA 2VUMG 5HGQA 1PH6A 4LNQA 4HJ8A 1HXYD 3MA2B 4LF6L 2WAQE 3DEPA 3VR4A 1KL9A 3PQIA 3Q22A 3TREA 4KHVA 1R9TB 2XIWA 3FMCA 3OYYA 1KDBA 4X66L 5CR3A 4DAVA 3HOVB 5D14A 2VS1A 4DV2Q 1X6OA 1IW7D 1Q82C 3KBXA 3BYYB 4LF8L 2F0JA 2YTXA 5IP7H 5M3FH 3VR5A 2AUJD 3SXHA 3HOYG 1EQRA 4CKCA 4IZ8A 2AKWB 2IY5B 2F0UA 3I4MH 3HP3A 4XIGS 1BQQT 3I8ZA 5M5WH 2JA7G 1C9OA 4DV2L 1YNNC 2A19A 1VQMA 4DUYQ 1WTOA 1TWHB 3FDTA 1YITA 4KD4A 4A3IH 1OO9B 3S9WA 2Z4HA 4DR4L 1MJEA 1DZ1A 4IUQA 3PUWA 1R9TH 1VQPA 3BJUA 1C0AA 3HZXA 2RSNA 2EYOA 4LF9Q 4DFAA 5IGFA 1V1PA 5F2DA 2B2WA 2CH4A 1JOOA 2Z9HA 3GTMH 1TS3A 3C1EA 3HKSA 1FNVA 2L15A 3QOLA 1E1TA 4KD3A 1SNMA 5IYDG 1H9MA 4U673 1E1OA 1YI2A 1Q81C 2WINB 4RFBA 1O7ZA 2LMCB 2ZT9C 1BO0A 4LAAA 3CCSA 1YZ6A 3KF8B 1BR9A 4YWLA 1Z7TA 2DY7A 1YHQA 1STYA 2A74C 1Y1WB 2GN5A 2KHJA 2YYZA 1HUNA 2UUCQ 3CAMA 5CV9A 1G91A 1NJIC 5EBDA 4IUUA 1A2UA 1I4HA 4R4TA 3S14B 1UEBA 3AEVA 4IN3A 5GAGC 4LW1A 2AQ2B 3GTJH 1ENCA 1SNCA 1WD1A 5EQ0A 3TP6A 3VYUA 5JEAH 1KRTA 4XT3B 3JAME 4L63B 2KOLA 1QG7A 3LGJA 2UXBQ 5DAUA 1HZBA 2ZJRA 2N78A 3AU7A 3A5UA 3H0GH 4H44C 4OO1G 3RMHA 1GVPA 1B9NA 1L1OB 2RHSB 1TWAB 1BCPC 4K5XA 3G48A 3P1HA 3CD6A 4A3CH 1NBWA 1STEA 1PRTC 2BH2A 2PW5A 1KTKA 2OCEA 4ZKCB 3CF5A 2VUMH 1R4QB 4CJ0B 2WAQB 1XMOL 4RMFA 1WTVA 5C6AA 3HOWB 4FXGC 3F2BA 1KQSA 4JBWA 3RZDB 3BZDB 3TZDA 1I4PA 2HQEA 3E3XA 3VR6A 1Q46A 5J3BA 1PTOB 2EYLA 4NKLA 2L12A 5IP7G 2NZ1D 1TWCB 2I5LX 4KY6A 4K5WA 1FJGL 5ELDA 3W3AA 2N49A 3J7ZC 4G7ZC 1I5FA 3S1NB 2OT2A 5JPMC 3RN5A 3VYSA 4OONA 4R8NA 4X3UA 3DEOA 2JA9A 4BWGB 5DEHA 2CFMA 2JA6G 2E75C 3EBEA 2L4NA 2Q8TA 4A3MB 2C35B 3E5SA 3M4OH 4OX9Q 4FF2A 1QOHA 1EZ6A 1IBLL 3U4ZA 2UXDL 4GN5A 5ELEA 1ASYA 1HNXQ 2EYMA 3PO3G 1B44D 3K81C 1Y1VH 1RODA 1TS4A 1PTOH 1L0XB 4YY3Q 4KY7A 4LFCQ 1NR4A 3HEJA 2ZXRA 1M1KC 3CQZB 1ONLA 2F3WA 5L37A 1GXDC 5CV7A 4FF3A 4A76A 4BY1G 1Y14B 4MTKA 3J81i 4GNXC 4N9PA 2RA4A 2K04A 3GTGB 3SDZA 2NVTH 2PQAA 4UPAA 2VQFL 1SROA 2QW7A 4IPCA 4BY7H 5FO9B 4KJNA 5EBCA 1UNSA 3PUZA 1B3QA 1MKHA 3BVGA 3VR3A 4ULLA 2UXBL 1LACA 4FF4A 1G6PA 1JE4A 1I4QA 4HJ7A 2JA5B 4K6DA 4PG3A 1LTTD 1XTDA 4JI5L 1C8CA 2PZTA 2DGYA 1H9SB 2DJFC 4LF4Q 3I73A 2NB0A 4RGTA 3STBD 5IIFA 1JWUD 3PV0A 3S15B 3BU2A 4A3EH 2OQKA 3NE5B 3S14H 1IL8A 3GTLB 1LV9A 1II3A 1RL2A 3BYTB 5I6YA 4B3ML 1B2TA 5GQOA 2BDOA 1I3QB 1WJJA 1GOZA 3X3MA 4A3MH 1PRTB 1Y1VG 2F0VA 3S1QH 2VW9A 2NUCA 3GTPH 4ODGA 2Q8RE 1EQTA 3HKZB 1E24A 1KD1C 4A3KG 3D0FA 2EZVA 1W6JA 3S2DB 1BKBA 1S3OA 2UXCL 4DR5Q 3D4RA 3VR2A 1SNDA 1SYDA 1JR0D 4B9WA 1F2ZA 1U4MA 2TMPA 4DK0A 3CCMA 3S2HB 4B9XA 1WFQA 2JXMB 5C0XH 1XX8A 1RHPA 1A3TA 1O80A 2BOSA 5FLXE 4XQJA 3HGBA 3IL8A 4DV3Q 2L55A 3L0OA 1LT4D 3UDGA 2DY8A 1CKNB 4EVOA 1JOQA 1G51A 3B6YA 3A8KE 4DAYB 5IYBG 1TWHH 2R7ZB 4UY8C 2G5DA 3BG3A 2MNAA 1W3SA 3QWNA 3TZUA 3FPPA 1GUTA 2JA6H 1EIGA 3S16H 1X3PA 1KRSA 3TP8A 2A1AA 3D4WA 5E4XA 1WTWA 3D3RA 4V190 1IYVA 2B2YA 1PHJA 1IW7C 2JK8A 4MZ9A 2F0QA 3Q23A 2BE5C 4KV6A 3CCUA 4H13C 3TP7A 1H95A 3OHXC 3RNUA 3H0GG 1G8ZD 1YNJC 2VY3A 5C3WA 1WTXA 2V1CC 1TS2A 1STNA 2X6LA 1HH2P 4X3TA 1TWFH 3K5OA 3I4OA 4XQNA 1ET9A 4A3GG 4MNOA 5C3EG 5LMNQ 1CT1D 3A8IE 3HOXG 3R8BA 2L5TA 1DCZA 4RHRA 1KAAA 4O42A 1AE3A 3S1RB 1PYWD 1PFMA 2JA8B 1JC7A 3HOUG 3OWFA 1EY5A 2R3ZA 4RWSC 4FXKC 1IBKL 1G2SA 3CQZH 1WYDA 1GM5A 1HQRD 1FVIA 4DUZQ 1QILA 4JC0A 1KIXA 2EYFA 4DXGA 1SSOA 3S1MB 3P75A 2FFKB 4A3KB 5BN5A 1V1OA 3HKZG 4A93B 2IJ0A 3KJOA 3OSOA 2ZTEA 2L1BA 3NEMA 4DNRB 3HG9A 4IUVA 1CZWA 2F4IA 3R3OA 3PIP3 4L8JA 2AQ1B 4PMBA 1B3AA 3H6MA 5LHY1 4BBSB 3L7ZC 3DHQA 2EQSA 1GUNA 2EJFC 1ZKOA 1KHIA 5GAHC 3VA7A 1KNEA 3FEWX 5C44H 4LF6Q 2BA1A 1TWGH 4ZCKA 4I7AA 3J81E 4V0BA 1SYCA 3BVMA 2JA5G 3D31A 1OXVA 1U4RA 1X32A 1J6QA 2RDFA 5CBEE 3K59A 2B63H 4KK7A 3BZCA 4GLVB 5CV6A 3PF4A 5BR8L 1ICWA 1WTRA 4XDXA 4G7HC 4BY7G 2F3IA 1Z6HA 4PQXA 4UP9A 2WB1G 1TWCH
chains in the Genus database with same CATH topology
1EUJA 2PMZE 4JV5Q 4HJ5A 3PF5A 4LF8Q 2KHIA 1X3EA 2CWPA 1GO3E 4GN4B 1HNXL 3G71A 4DR7Q 3TRZA 3NENA 2JEBI 3NBHB 3U4VA 3T1HL 5DLQE 4GOPC 3CC4A 4X62L 1L1OC 3HKZE 4AQYQ 1X9NA 5M3MG 4DR6L 2ZJQA 3GTKH 4LFAQ 2K5NA 2Q2UA 1OXUA 1YJNA 2XGTA 2HHHL 4BBRH 2F4VQ 1HNZQ 1GD7A 1EYGA 1X3GA 3AQQA 4LF5L 2NZHA 4AH6A 2VUMG 5HGQA 4A3EG 1XJVA 1K3RA 3PO2G 4JI8Q 1PH6A 4LNQA 1NTGA 4HJ8A 1VQ6A 2GVBA 4Y7NH 1HJPA 4LF6L 5LMNL 3S17H 2WAQE 1Z9FA 4B3SQ 5C4XG 1Q12A 1KL9A 1EQQA 3RLNA 3TREA 1PH9A 4A3GH 3L2PA 3FHWA 1QZGA 3OYYA 4X66L 1VQIA 4OWTB 4A3MG 4YCVA 4HIDA 2VS1A 2I5HA 4DV2Q 1X6OA 3S15H 1Q82C 4X64L 4A3DG 4A3JG 1YHBA 4LF8L 3EN2A 2YTXA 5IP7H 2BH8A 3M85A 5M3FH 1LUZA 1Q7YC 1L1OA 3HOYG 3M3YH 1EQRA 1XNRQ 3PGZA 2VL6A 3KLWA 3UDFA 1X65A 3AYHB 4A3KH 2YTVA 3F1ZA 2AKWB 2IY5B 1I94L 4OXPA 3BZKA 3I4MH 4GS3A 5M3MH 3J81j 1Z47A 4XIGS 2R7ZH 1I3QH 5ELNA 3M9BA 5M5WH 4DR2Q 1C9OA 1PA6A 5LMUL 2IX0A 2JA7G 2Q2IA 1N32Q 4DK3C 4DV2L 4R4IA 4DR1Q 2A19A 3K80C 4JI1Q 1VQMA 4WJ4A 5C0XG 3KF6A 1ASZA 4DV5Q 4DUYQ 3TS0A 3PIOA 4DV1L 4L5RC 4KHZA 2QGQA 4GNXA 4B3SL 1YITA 1JMCA 2E5LQ 3SGIA 4A3IH 1S40A 3CW2C 2MQHA 3RLOA 4R4QA 5FJ8G 5C4JH 3A74A 1LM0A 4C2MH 2MO0A 4UP7A 3G6EA 1MJEA 4DR4L 4JI2L 2AWNA 3PUWA 1R9TH 1VQPA 3BJUA 1C0AA 2K5HA 2UUBQ 1IXRA 4DR5L 4LF9Q 1K83H 2UXCQ 4DR6Q 4LF9L 1CKNA 5AJ3Q 3FP9A 2R6GA 5GAEC 3GTMH 1SE8A 3K8AA 1PH4A 1CKMA 1N33L 4IFDI 5JJLA 3HKSA 4C3IH 2L15A 1E1TA 4DR4Q 5IYDG 4O2DA 3S2HH 3MEFA 4LUOA 1E1OA 1YI2A 3HOZG 5FLXc 1Q81C 5IWAL 3I4MG 4DR7L 2OTJA 4QQBX 3H3VH 1QVGA 3F2DA 3CCSA 1HZ9A 1YZ6A 2IT1A 3Q8DA 3J80c 3KF8B 4DV5L 2CCZA 1I6HH 4YWLA 5C44G 1XNQL 3GTLH 1A63A 1YHQA 3G4SA 4JI1L 1CUKA 1PYSB 2K75A 4IJHA 3PUXA 4YHHQ 4A3LG 4DR1L 4A3CG 2GN5A 3M4PA 2KHJA 2YYZA 3H3VI 3VDYA 4DV3L 2UUCQ 1OXTA 3CAMA 4KLKA 4A3DH 4A3JH 1NJIC 2JA5H 1WCMH 4BA2I 3CCVA 3DLLA 1LTLA 4GOPA 4GOPB 4R4TA 3T1YQ 4PZ7A 1TXYA 4JI8L 3I4NG 1UEBA 3AEVA 1EOVA 5GAGC 1N33Q 3K7UC 4LW1A 3GTJH 3HOUH 1WI5A 1PYBA 5AJ3L 1UE6A 4A3BH 1UE7A 1KRTA 2PQAB 3K0XA 3RLFA 5M5YH 3E0EA 3CXCA 3IRBA 3LGJA 4AQYL 4Y52H 1IZ6A 3GDEA 3KDFA 4X66Q 1RIPA 3T1HQ 2UXBQ 3GTGH 4NXNL 2RHQB 1HZBA 2RF4A 4B3RL 2ZJRA 2ZJPA 2N78A 4OWWB 4LF7L 4IO9A 3A5UA 3H0GH 2K50A 4OO1G 4H02A 1GVPA 1VQCA 1L1OB 2RHSB 4A3IG 4BBSH 4JV5L 4XTCS 1XPRA 2K4KA 2VQFQ 1XMQQ 1UE5A 3G48A 4B3MQ 5LMNW 1VQBA 3CD6A 4P71A 4KHPQ 5C3EH 5M5XH 4A3CH 2KCTA 2E8GA 4JI3L 4DV0L 2UUAL 2UU9L 1NBWA 4DV7Q 2BH2A 4ALPA 1N32L 2OCEA 2CWAA 3ER0A 4DR2L 1XPUA 3CF5A 2VUMH 3HFZB 3MXNB 4GN3B 4HJ9A 2Q2TA 1XMOL 5IY0A 4C3HH 3I4NH 4RMFA 1Q1BA 3CP0A 3TQYA 3CPWA 4LF4L 4JYAL 5C4XH 3F2BA 4JBWA 1KQSA 2I0QA 1SMXA 1X56A 2R7FA 2ASBA 2IX1A 3CCRA 1G291 4GLXA 3CCLA 1FGUA 3HOZH 2YU9H 4LUVA 3S1RH 4JBMA 3PO3H 4EQ5A 4IOCA 1Q46A 3ICEA 4IPGA 3RZOH 2YTYA 5J3BA 1IBML 2D0PA 2RCNA 3GD7A 2F52A 1EIYB 1D7QA 1X3FA 4L5TA 5IP7G 3GTOH 4X6AH 3HOWH 2I5LX 3AFPA 1FJGL 2BA0A 2D62A 3J7ZC 2N49A 1I5FA 5BR8Q 3S24A 3CMEA 4DR3L 4A4IA 3RN5A 2HQLA 2KENA 4OONA 2JA9A 4JOIC 3AFQA 4IJLA 5JEAJ 4R4OA 3KOJA 4LF5Q 4K0KL 1HNWL 2CFMA 2JA6G 4HIMA 3EBEA 1CSPA 2HHHQ 1VCIA 4JI6Q 4LFAL 3S1NH 4WJ3M 2C35B 1K73C 1JJ2A 4OX9Q 3M4OH 2R93G 1EWIA 4X62Q 1JJGA 3E9IA 1OXSC 1IBLL 3ULLA 1N36Q 1UWVA 5H1SE 5FJ8H 3U4ZA 1VQ9A 2UXDL 4JOIA 2E2JH 4GN5A 4PZ6A 1B7YB 1O7IA 1Y1WH 1FL0A 4P75A 1HNXQ 1ASYA 3PO3G 2DUDA 2HIXA 3M4QA 4GKJL 3K81C 1SR3A 1Y1VH 5IE8A 3ZJYC 1YBYA 4JG2A 1Q86C 3GO5A 4L5QA 4YY3Q 5ELOA 2VZAA 4YWMA 3F2CA 1IBKQ 4LFCQ 2JA8G 3FKIH 4C3JH 1N36L 3TS2A 3M7NA 3PIPA 1X54A 1V43A 4TVAB 1M1KC 4JI0L 1J5EL 4R4CA 2VQEQ 2LXJA 5GADC 5IYDH 4DK6C 1IYJB 3EIVA 1YNXA 4BY1G 3KDFB 4A76A 1Y14B 3I2ZA 3J81i 2K14A 4GNXC 1VQ4A 1JB7A 3CC7A 3KYHC 2UUAQ 1DGSA 2HIVA 2LXKA 4YY3L 1OXXK 4OWXB 2NVTH 2PQAA 4UPAA 2VQFL 2IHFA 2WP8J 3W5OA 4DUZL 3W1GA 2ZM6L 1SROA 4IPCA 1N34Q 3CC2A 2ATWA 4BY7H 4A3LH 1MJCA 3PUVA 1S72A 1JE5A 2ZTDA 4LUZA 2XTIA 4LF7Q 3PUZA 4DV6L 5IP9G 3E9HA 4JBJA 1QZHA 2ALYB 1MKHA 2A8VA 3PCOB 4DV6Q 2K5VA 5FLMG 5IYCG 2I5MX 1HR0L 1Y1WG 3HOVH 2UXBL 1NY4A 1PH7A 1IBMQ 4QIWE 1G6PA 4BA1I 4JI6L 4HJ7A 4JI7L 1M90C 3CPFA 4PG3A 1U0LA 2QEXA 1JJCB 1XTDA 4JI5L 5JJIA 2DGYA 2R7DA 4DPGA 4X65Q 4DV4L 2R7ZG 2MFIA 2EXDA 3PUYA 4HIKA 4LF4Q 4POGA 2Y0SG 4BXXH 1AH9A 4YCUA 3STBD 2VQEL 3PV0A 3BU2A 4A3EH 1VQLA 3PO2H 4JI0Q 1PFSA 1A8VA 2OQKA 1IL2A 4BY1H 3S14H 4P74A 2UU9Q 2E2HH 4LFBL 4B3TQ 1QUQA 4GKKL 1PH1A 4LFCL 1VQKA 5HY6A 4HJAA 4BBSG 1RL2A 3GTQH 4LFBQ 4B3ML 3W1BA 1P8LA 1AE2A 5GQOA 1W2BA 2CQOA 2ZTCA 1WJJA 4LWCA 3JAMc 2KCMA 2E2IH 4P72A 1VQNA 4A93H 4A3MH 1UE1A 1Y1VG 4MTNA 2AHOB 2NN6I 5C0XJ 1NE3A 1BVSA 3S1QH 1YEZA 2VW9A 3H15A 4NXNQ 5FLMH 1X55A 1QVCA 1V9PA 3GTPH 1VQOA 1XMOQ 4DNIA 4GNXB 5IT9c 4GLAC 1E24A 1KD1C 4A3KG 3D0FA 1VQHA 1BKBA 1S3OA 2FXQA 3K7AH 3KF6B 3UE0A 4DR5Q 4NXMQ 2UXCL 4JI3Q 1D8LA 1HNWQ 4A3FH 1V1QA 2JA7H 1MIUA 2WAQG 3CCMA 1XMQL 1YJWA 1WFQA 2R92G 4IPHA 1I50H 1NMGA 3ERSX 4AYBG 4DR3Q 2Z0SA 2GVAA 3J7A5 3CCQA 4DV3Q 3I56A 3L0OA 1CSQA 3UDGA 5IP9H 2ES2A 4B3RQ 5JJKA 1CKNB 2EIFA 1VQ8A 3DM3A 3I7FA 4GKKQ 1G51A 2MO1A 3B6YA 2PI2A 5IYCH 4NXML 4DAYB 5IYBG 1TWHH 4PZ8A 3CCJA 1U5KA 1E3PA 1SFOH 4UY8C 1PH3A 2VNUD 2MNAA 2D0OA 1W3SA 3NELA 2Z6KC 2JA6H 3S16H 3KJPA 1KRSA 4R1JA 5IWAQ 2A1AA 3WWVA 3S1MH 1PV4A 4RG1A 5JEAG 4X65L 4JYAQ 3J80i 3I55A 4JI5Q 1PHJA 1WOCA 1HZAA 3T1YL 3CCEA 1YJ9A 4BXXG 1KAWA 1C7YA 2NVXH 3UE1A 2JK8A 4MZ9A 1PVOA 1VQ7A 4QJFA 2KBNA 1GKHA 3U58A 3CCUA 4X64Q 3UDXA 1HR0Q 4YHHL 2NN6G 1H95A 1VQEA 1VQGA 3RNUA 2K52A 2Z6KA 3H0GG 4B3TL 1XNQQ 2VY3A 4JI2Q 3RR5A 2V1CC 4FDBA 3J81c 2B29A 1IBLQ 1N8RC 2OTLA 1HH2P 1A62A 1TWFH 4QGUA 3I4OA 2E5LL 4A3GG 1K0RA 1SRUA 2WFWA 4MNOA 5C3EG 5LMNQ 2LSSA 4HIOA 4EX5A 3HOXG 4IPDA 1XPOA 1JT8A 4DUYL 4DV4Q 3PSIA 4DAMA 4YCWA 1BBWA 1SLJA 1P16A 1B8AA 5M3FG 4QY7A 5IYBH 1AE3A 2F4VL 5LMUQ 1K9MC 4OO1I 3HOUG 4UP8A 3CMAA 1QVFA 3A5ZB 2N3SA 2H5XA 2ID0A 1I94Q 2NVYH 4AYBE 1L0WA 4ME3A 1B70B 3ULJA 4P73A 1PH2A 1IBKL 1XNRL 4IFDJ 2JEAI 3CQZH 2R92H 2IHEA 1WYDA 3U50C 1GM5A 4GKJQ 3UDIA 1Q8KA 1FVIA 4DUZQ 1N34L 1OTCA 1EFWA 2N8NA 4J15A 4JC0A 2UUCL 1KIXA 2UXDQ 4APVA 3F8TA 3OW2A 3RZDH 4PMWA 4O0AA 1PH8A 3HKZG 1E7ZA 2OWOA 1NMFA 5GROA 4JI4Q 2B63G 2JQOA 4OX9L 3TEHB 1J5EQ 1VQ5A 3KJOA 3HOXH 1VS0A 4IOAA 2ZTEA 1K8GA 3NEMA 4DV7L 4A75A 3JAMi 4YWKA 3ULPA 4K0KQ 5C0XI 2R93H 4DKAC 5K36G 4KI0A 3OTOQ 2WB1E 1QUQB 4JI7Q 1EIFA 1YVCA 1CKOA 1TWAH 3S2DH 3L7ZC 2QA4A 2UUBL 1PH5A 3HOVG 1HZCA 1YHAA 1YIJA 2EQSA 1N9WA 3KFUA 2B3GA 1KXLA 2HT1A 4A93G 1KHIA 1SN8A 5GAHC 1LYLA 2PI2E 2Y0SE 1KC8C 2NVQH 1E22A 1VQFA 4NPSA 1Q1EA 3STBC 5C44H 4LF6Q 2PNHA 3HOWG 2NZOA 2JA8H 2ZM6Q 1BBUA 3A0JA 2BA1A 1TWGH 3FKIG 4DV1Q 3HOYH 4IFDG 5E7NA 4BBRG 3OTOL 4JCVE 2CKZB 4QL5A 2JA5G 1WCMG 1T9HA 2AWOA 3D31A 1VQJA 2AMCB 5EAYA 1OXVA 1HNZL 1VQAA 1J6QA 2JE6I 2B63H 4JBKA 2OQ0A 1L2FA 4TQUS 4A3FG 3BZCA 1K8AC 4GLVB 4AIMA 3RN2A 4L5SA 4POFA 5BR8L 3PF4A 1VQDA 4JI4L 4NB3A 3JC66 1FJGQ 4DV0Q 4A3BG 2JJQA 1HR0W 4BY7G 1A0IA 2F3IA 4UP9A 4KHPL 2YV5A 2WB1G 1TWCH 2Q2HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EUJ A;  2PMZ E;  4JV5 Q;  4HJ5 A;  3PF5 A;  4LF8 Q;  2KHI A;  1X3E A;  2CWP A;  1GO3 E;  4GN4 B;  1HNX L;  3G71 A;  4DR7 Q;  3TRZ A;  3NEN A;  2JEB I;  3NBH B;  3U4V A;  3T1H L;  5DLQ E;  4GOP C;  3CC4 A;  4X62 L;  1L1O C;  3HKZ E;  4AQY Q;  1X9N A;  5M3M G;  4DR6 L;  2ZJQ A;  3GTK H;  4LFA Q;  2K5N A;  2Q2U A;  1OXU A;  1YJN A;  2XGT A;  2HHH L;  4BBR H;  2F4V Q;  1HNZ Q;  1GD7 A;  1EYG A;  1X3G A;  3AQQ A;  4LF5 L;  2NZH A;  4AH6 A;  2VUM G;  5HGQ A;  4A3E G;  1XJV A;  1K3R A;  3PO2 G;  4JI8 Q;  1PH6 A;  4LNQ A;  1NTG A;  4HJ8 A;  1VQ6 A;  2GVB A;  4Y7N H;  1HJP A;  4LF6 L;  5LMN L;  3S17 H;  2WAQ E;  1Z9F A;  4B3S Q;  5C4X G;  1Q12 A;  1KL9 A;  1EQQ A;  3RLN A;  3TRE A;  1PH9 A;  4A3G H;  3L2P A;  3FHW A;  1QZG A;  3OYY A;  4X66 L;  1VQI A;  4OWT B;  4A3M G;  4YCV A;  4HID A;  2VS1 A;  2I5H A;  4DV2 Q;  1X6O A;  3S15 H;  1Q82 C;  4X64 L;  4A3D G;  4A3J G;  1YHB A;  4LF8 L;  3EN2 A;  2YTX A;  5IP7 H;  2BH8 A;  3M85 A;  5M3F H;  1LUZ A;  1Q7Y C;  1L1O A;  3HOY G;  3M3Y H;  1EQR A;  1XNR Q;  3PGZ A;  2VL6 A;  3KLW A;  3UDF A;  1X65 A;  3AYH B;  4A3K H;  2YTV A;  3F1Z A;  2AKW B;  2IY5 B;  1I94 L;  4OXP A;  3BZK A;  3I4M H;  4GS3 A;  5M3M H;  3J81 j;  1Z47 A;  4XIG S;  2R7Z H;  1I3Q H;  5ELN A;  3M9B A;  5M5W H;  4DR2 Q;  1C9O A;  1PA6 A;  5LMU L;  2IX0 A;  2JA7 G;  2Q2I A;  1N32 Q;  4DK3 C;  4DV2 L;  4R4I A;  4DR1 Q;  2A19 A;  3K80 C;  4JI1 Q;  1VQM A;  4WJ4 A;  5C0X G;  3KF6 A;  1ASZ A;  4DV5 Q;  4DUY Q;  3TS0 A;  3PIO A;  4DV1 L;  4L5R C;  4KHZ A;  2QGQ A;  4GNX A;  4B3S L;  1YIT A;  1JMC A;  2E5L Q;  3SGI A;  4A3I H;  1S40 A;  3CW2 C;  2MQH A;  3RLO A;  4R4Q A;  5FJ8 G;  5C4J H;  3A74 A;  1LM0 A;  4C2M H;  2MO0 A;  4UP7 A;  3G6E A;  1MJE A;  4DR4 L;  4JI2 L;  2AWN A;  3PUW A;  1R9T H;  1VQP A;  3BJU A;  1C0A A;  2K5H A;  2UUB Q;  1IXR A;  4DR5 L;  4LF9 Q;  1K83 H;  2UXC Q;  4DR6 Q;  4LF9 L;  1CKN A;  5AJ3 Q;  3FP9 A;  2R6G A;  5GAE C;  3GTM H;  1SE8 A;  3K8A A;  1PH4 A;  1CKM A;  1N33 L;  4IFD I;  5JJL A;  3HKS A;  4C3I H;  2L15 A;  1E1T A;  4DR4 Q;  5IYD G;  4O2D A;  3S2H H;  3MEF A;  4LUO A;  1E1O A;  1YI2 A;  3HOZ G;  5FLX c;  1Q81 C;  5IWA L;  3I4M G;  4DR7 L;  2OTJ A;  4QQB X;  3H3V H;  1QVG A;  3F2D A;  3CCS A;  1HZ9 A;  1YZ6 A;  2IT1 A;  3Q8D A;  3J80 c;  3KF8 B;  4DV5 L;  2CCZ A;  1I6H H;  4YWL A;  5C44 G;  1XNQ L;  3GTL H;  1A63 A;  1YHQ A;  3G4S A;  4JI1 L;  1CUK A;  1PYS B;  2K75 A;  4IJH A;  3PUX A;  4YHH Q;  4A3L G;  4DR1 L;  4A3C G;  2GN5 A;  3M4P A;  2KHJ A;  2YYZ A;  3H3V I;  3VDY A;  4DV3 L;  2UUC Q;  1OXT A;  3CAM A;  4KLK A;  4A3D H;  4A3J H;  1NJI C;  2JA5 H;  1WCM H;  4BA2 I;  3CCV A;  3DLL A;  1LTL A;  4GOP A;  4GOP B;  4R4T A;  3T1Y Q;  4PZ7 A;  1TXY A;  4JI8 L;  3I4N G;  1UEB A;  3AEV A;  1EOV A;  5GAG C;  1N33 Q;  3K7U C;  4LW1 A;  3GTJ H;  3HOU H;  1WI5 A;  1PYB A;  5AJ3 L;  1UE6 A;  4A3B H;  1UE7 A;  1KRT A;  2PQA B;  3K0X A;  3RLF A;  5M5Y H;  3E0E A;  3CXC A;  3IRB A;  3LGJ A;  4AQY L;  4Y52 H;  1IZ6 A;  3GDE A;  3KDF A;  4X66 Q;  1RIP A;  3T1H Q;  2UXB Q;  3GTG H;  4NXN L;  2RHQ B;  1HZB A;  2RF4 A;  4B3R L;  2ZJR A;  2ZJP A;  2N78 A;  4OWW B;  4LF7 L;  4IO9 A;  3A5U A;  3H0G H;  2K50 A;  4OO1 G;  4H02 A;  1GVP A;  1VQC A;  1L1O B;  2RHS B;  4A3I G;  4BBS H;  4JV5 L;  4XTC S;  1XPR A;  2K4K A;  2VQF Q;  1XMQ Q;  1UE5 A;  3G48 A;  4B3M Q;  5LMN W;  1VQB A;  3CD6 A;  4P71 A;  4KHP Q;  5C3E H;  5M5X H;  4A3C H;  2KCT A;  2E8G A;  4JI3 L;  4DV0 L;  2UUA L;  2UU9 L;  1NBW A;  4DV7 Q;  2BH2 A;  4ALP A;  1N32 L;  2OCE A;  2CWA A;  3ER0 A;  4DR2 L;  1XPU A;  3CF5 A;  2VUM H;  3HFZ B;  3MXN B;  4GN3 B;  4HJ9 A;  2Q2T A;  1XMO L;  5IY0 A;  4C3H H;  3I4N H;  4RMF A;  1Q1B A;  3CP0 A;  3TQY A;  3CPW A;  4LF4 L;  4JYA L;  5C4X H;  3F2B A;  4JBW A;  1KQS A;  2I0Q A;  1SMX A;  1X56 A;  2R7F A;  2ASB A;  2IX1 A;  3CCR A;  1G29 1;  4GLX A;  3CCL A;  1FGU A;  3HOZ H;  2YU9 H;  4LUV A;  3S1R H;  4JBM A;  3PO3 H;  4EQ5 A;  4IOC A;  1Q46 A;  3ICE A;  4IPG A;  3RZO H;  2YTY A;  5J3B A;  1IBM L;  2D0P A;  2RCN A;  3GD7 A;  2F52 A;  1EIY B;  1D7Q A;  1X3F A;  4L5T A;  5IP7 G;  3GTO H;  4X6A H;  3HOW H;  2I5L X;  3AFP A;  1FJG L;  2BA0 A;  2D62 A;  3J7Z C;  2N49 A;  1I5F A;  5BR8 Q;  3S24 A;  3CME A;  4DR3 L;  4A4I A;  3RN5 A;  2HQL A;  2KEN A;  4OON A;  2JA9 A;  4JOI C;  3AFQ A;  4IJL A;  5JEA J;  4R4O A;  3KOJ A;  4LF5 Q;  4K0K L;  1HNW L;  2CFM A;  2JA6 G;  4HIM A;  3EBE A;  1CSP A;  2HHH Q;  1VCI A;  4JI6 Q;  4LFA L;  3S1N H;  4WJ3 M;  2C35 B;  1K73 C;  1JJ2 A;  4OX9 Q;  3M4O H;  2R93 G;  1EWI A;  4X62 Q;  1JJG A;  3E9I A;  1OXS C;  1IBL L;  3ULL A;  1N36 Q;  1UWV A;  5H1S E;  5FJ8 H;  3U4Z A;  1VQ9 A;  2UXD L;  4JOI A;  2E2J H;  4GN5 A;  4PZ6 A;  1B7Y B;  1O7I A;  1Y1W H;  1FL0 A;  4P75 A;  1HNX Q;  1ASY A;  3PO3 G;  2DUD A;  2HIX A;  3M4Q A;  4GKJ L;  3K81 C;  1SR3 A;  1Y1V H;  5IE8 A;  3ZJY C;  1YBY A;  4JG2 A;  1Q86 C;  3GO5 A;  4L5Q A;  4YY3 Q;  5ELO A;  2VZA A;  4YWM A;  3F2C A;  1IBK Q;  4LFC Q;  2JA8 G;  3FKI H;  4C3J H;  1N36 L;  3TS2 A;  3M7N A;  3PIP A;  1X54 A;  1V43 A;  4TVA B;  1M1K C;  4JI0 L;  1J5E L;  4R4C A;  2VQE Q;  2LXJ A;  5GAD C;  5IYD H;  4DK6 C;  1IYJ B;  3EIV A;  1YNX A;  4BY1 G;  3KDF B;  4A76 A;  1Y14 B;  3I2Z A;  3J81 i;  2K14 A;  4GNX C;  1VQ4 A;  1JB7 A;  3CC7 A;  3KYH C;  2UUA Q;  1DGS A;  2HIV A;  2LXK A;  4YY3 L;  1OXX K;  4OWX B;  2NVT H;  2PQA A;  4UPA A;  2VQF L;  2IHF A;  2WP8 J;  3W5O A;  4DUZ L;  3W1G A;  2ZM6 L;  1SRO A;  4IPC A;  1N34 Q;  3CC2 A;  2ATW A;  4BY7 H;  4A3L H;  1MJC A;  3PUV A;  1S72 A;  1JE5 A;  2ZTD A;  4LUZ A;  2XTI A;  4LF7 Q;  3PUZ A;  4DV6 L;  5IP9 G;  3E9H A;  4JBJ A;  1QZH A;  2ALY B;  1MKH A;  2A8V A;  3PCO B;  4DV6 Q;  2K5V A;  5FLM G;  5IYC G;  2I5M X;  1HR0 L;  1Y1W G;  3HOV H;  2UXB L;  1NY4 A;  1PH7 A;  1IBM Q;  4QIW E;  1G6P A;  4BA1 I;  4JI6 L;  4HJ7 A;  4JI7 L;  1M90 C;  3CPF A;  4PG3 A;  1U0L A;  2QEX A;  1JJC B;  1XTD A;  4JI5 L;  5JJI A;  2DGY A;  2R7D A;  4DPG A;  4X65 Q;  4DV4 L;  2R7Z G;  2MFI A;  2EXD A;  3PUY A;  4HIK A;  4LF4 Q;  4POG A;  2Y0S G;  4BXX H;  1AH9 A;  4YCU A;  3STB D;  2VQE L;  3PV0 A;  3BU2 A;  4A3E H;  1VQL A;  3PO2 H;  4JI0 Q;  1PFS A;  1A8V A;  2OQK A;  1IL2 A;  4BY1 H;  3S14 H;  4P74 A;  2UU9 Q;  2E2H H;  4LFB L;  4B3T Q;  1QUQ A;  4GKK L;  1PH1 A;  4LFC L;  1VQK A;  5HY6 A;  4HJA A;  4BBS G;  1RL2 A;  3GTQ H;  4LFB Q;  4B3M L;  3W1B A;  1P8L A;  1AE2 A;  5GQO A;  1W2B A;  2CQO A;  2ZTC A;  1WJJ A;  4LWC A;  3JAM c;  2KCM A;  2E2I H;  4P72 A;  1VQN A;  4A93 H;  4A3M H;  1UE1 A;  1Y1V G;  4MTN A;  2AHO B;  2NN6 I;  5C0X J;  1NE3 A;  1BVS A;  3S1Q H;  1YEZ A;  2VW9 A;  3H15 A;  4NXN Q;  5FLM H;  1X55 A;  1QVC A;  1V9P A;  3GTP H;  1VQO A;  1XMO Q;  4DNI A;  4GNX B;  5IT9 c;  4GLA C;  1E24 A;  1KD1 C;  4A3K G;  3D0F A;  1VQH A;  1BKB A;  1S3O A;  2FXQ A;  3K7A H;  3KF6 B;  3UE0 A;  4DR5 Q;  4NXM Q;  2UXC L;  4JI3 Q;  1D8L A;  1HNW Q;  4A3F H;  1V1Q A;  2JA7 H;  1MIU A;  2WAQ G;  3CCM A;  1XMQ L;  1YJW A;  1WFQ A;  2R92 G;  4IPH A;  1I50 H;  1NMG A;  3ERS X;  4AYB G;  4DR3 Q;  2Z0S A;  2GVA A;  3J7A 5;  3CCQ A;  4DV3 Q;  3I56 A;  3L0O A;  1CSQ A;  3UDG A;  5IP9 H;  2ES2 A;  4B3R Q;  5JJK A;  1CKN B;  2EIF A;  1VQ8 A;  3DM3 A;  3I7F A;  4GKK Q;  1G51 A;  2MO1 A;  3B6Y A;  2PI2 A;  5IYC H;  4NXM L;  4DAY B;  5IYB G;  1TWH H;  4PZ8 A;  3CCJ A;  1U5K A;  1E3P A;  1SFO H;  4UY8 C;  1PH3 A;  2VNU D;  2MNA A;  2D0O A;  1W3S A;  3NEL A;  2Z6K C;  2JA6 H;  3S16 H;  3KJP A;  1KRS A;  4R1J A;  5IWA Q;  2A1A A;  3WWV A;  3S1M H;  1PV4 A;  4RG1 A;  5JEA G;  4X65 L;  4JYA Q;  3J80 i;  3I55 A;  4JI5 Q;  1PHJ A;  1WOC A;  1HZA A;  3T1Y L;  3CCE A;  1YJ9 A;  4BXX G;  1KAW A;  1C7Y A;  2NVX H;  3UE1 A;  2JK8 A;  4MZ9 A;  1PVO A;  1VQ7 A;  4QJF A;  2KBN A;  1GKH A;  3U58 A;  3CCU A;  4X64 Q;  3UDX A;  1HR0 Q;  4YHH L;  2NN6 G;  1H95 A;  1VQE A;  1VQG A;  3RNU A;  2K52 A;  2Z6K A;  3H0G G;  4B3T L;  1XNQ Q;  2VY3 A;  4JI2 Q;  3RR5 A;  2V1C C;  4FDB A;  3J81 c;  2B29 A;  1IBL Q;  1N8R C;  2OTL A;  1HH2 P;  1A62 A;  1TWF H;  4QGU A;  3I4O A;  2E5L L;  4A3G G;  1K0R A;  1SRU A;  2WFW A;  4MNO A;  5C3E G;  5LMN Q;  2LSS A;  4HIO A;  4EX5 A;  3HOX G;  4IPD A;  1XPO A;  1JT8 A;  4DUY L;  4DV4 Q;  3PSI A;  4DAM A;  4YCW A;  1BBW A;  1SLJ A;  1P16 A;  1B8A A;  5M3F G;  4QY7 A;  5IYB H;  1AE3 A;  2F4V L;  5LMU Q;  1K9M C;  4OO1 I;  3HOU G;  4UP8 A;  3CMA A;  1QVF A;  3A5Z B;  2N3S A;  2H5X A;  2ID0 A;  1I94 Q;  2NVY H;  4AYB E;  1L0W A;  4ME3 A;  1B70 B;  3ULJ A;  4P73 A;  1PH2 A;  1IBK L;  1XNR L;  4IFD J;  2JEA I;  3CQZ H;  2R92 H;  2IHE A;  1WYD A;  3U50 C;  1GM5 A;  4GKJ Q;  3UDI A;  1Q8K A;  1FVI A;  4DUZ Q;  1N34 L;  1OTC A;  1EFW A;  2N8N A;  4J15 A;  4JC0 A;  2UUC L;  1KIX A;  2UXD Q;  4APV A;  3F8T A;  3OW2 A;  3RZD H;  4PMW A;  4O0A A;  1PH8 A;  3HKZ G;  1E7Z A;  2OWO A;  1NMF A;  5GRO A;  4JI4 Q;  2B63 G;  2JQO A;  4OX9 L;  3TEH B;  1J5E Q;  1VQ5 A;  3KJO A;  3HOX H;  1VS0 A;  4IOA A;  2ZTE A;  1K8G A;  3NEM A;  4DV7 L;  4A75 A;  3JAM i;  4YWK A;  3ULP A;  4K0K Q;  5C0X I;  2R93 H;  4DKA C;  5K36 G;  4KI0 A;  3OTO Q;  2WB1 E;  1QUQ B;  4JI7 Q;  1EIF A;  1YVC A;  1CKO A;  1TWA H;  3S2D H;  3L7Z C;  2QA4 A;  2UUB L;  1PH5 A;  3HOV G;  1HZC A;  1YHA A;  1YIJ A;  2EQS A;  1N9W A;  3KFU A;  2B3G A;  1KXL A;  2HT1 A;  4A93 G;  1KHI A;  1SN8 A;  5GAH C;  1LYL A;  2PI2 E;  2Y0S E;  1KC8 C;  2NVQ H;  1E22 A;  1VQF A;  4NPS A;  1Q1E A;  3STB C;  5C44 H;  4LF6 Q;  2PNH A;  3HOW G;  2NZO A;  2JA8 H;  2ZM6 Q;  1BBU A;  3A0J A;  2BA1 A;  1TWG H;  3FKI G;  4DV1 Q;  3HOY H;  4IFD G;  5E7N A;  4BBR G;  3OTO L;  4JCV E;  2CKZ B;  4QL5 A;  2JA5 G;  1WCM G;  1T9H A;  2AWO A;  3D31 A;  1VQJ A;  2AMC B;  5EAY A;  1OXV A;  1HNZ L;  1VQA A;  1J6Q A;  2JE6 I;  2B63 H;  4JBK A;  2OQ0 A;  1L2F A;  4TQU S;  4A3F G;  3BZC A;  1K8A C;  4GLV B;  4AIM A;  3RN2 A;  4L5S A;  4POF A;  5BR8 L;  3PF4 A;  1VQD A;  4JI4 L;  4NB3 A;  3JC6 6;  1FJG Q;  4DV0 Q;  4A3B G;  2JJQ A;  1HR0 W;  4BY7 G;  1A0I A;  2F3I A;  4UP9 A;  4KHP L;  2YV5 A;  2WB1 G;  1TWC H;  2Q2H A; 
#chains in the Genus database with same CATH topology
 1EUJ A;  3PF5 A;  1TII D;  2CWP A;  1S4Z A;  3I91 A;  1DON A;  1HNX L;  1Y8P B;  4FNF A;  2JEB I;  3NBH B;  3VYR A;  1X9N A;  3MFG A;  2F0T A;  1LT6 D;  1HTP A;  1YJN A;  4IFD H;  2BCO A;  1EYG A;  3C2P A;  1X3G A;  2K32 A;  2NZH A;  4AH6 A;  1RF2 D;  4A3E G;  1K3R A;  5ELB A;  1VQ6 A;  3PO3 B;  4Y7N H;  1Y8N B;  5C44 B;  1GHJ A;  4BBR B;  4A3G H;  3CHB D;  4A3M G;  2I5H A;  3S15 H;  1A3U A;  1LT3 D;  1YHB A;  5JPN C;  5BN4 A;  3QJY A;  4DF7 A;  3M85 A;  1AP0 A;  4OIJ A;  2A6H C;  2O2L D;  1SNQ A;  3PGZ A;  4PMC A;  4AYB B;  1E2V A;  3MAQ A;  1X65 A;  2YTV A;  3F1Z A;  3V96 A;  1LLR D;  3SK4 A;  4OXP A;  3BZK A;  1PXU A;  3J81 j;  4KN7 C;  1JWM D;  5JVG 3;  4DR2 Q;  2I46 A;  1N32 Q;  1JIC A;  2Q2I A;  4DK3 C;  5C0X G;  3TS0 A;  3PIO A;  2RDG A;  1WVL A;  3P7J A;  4B3S L;  2QF7 A;  4F88 A;  1STB A;  2E5L Q;  3SGI A;  2KUM A;  1BCP F;  2MQH A;  4R4Q A;  4C2M H;  2XVS A;  4JI2 L;  2KCC A;  4QUF A;  1PRT D;  2HUG A;  2SNS A;  3LX0 A;  3H91 A;  4HCE A;  4LF9 L;  4MIU A;  1CKN A;  3FP9 A;  1CKM A;  4IFD I;  2K28 A;  4C3I H;  1DOM A;  3QO2 A;  2B2T C;  3MEF A;  5FK9 C;  5FLX c;  4DR7 L;  4KKS A;  3H3V H;  5AFW A;  1HZ9 A;  5C4X B;  3G4S A;  4A3L G;  1PYS B;  2B2U C;  1H9J A;  2K75 A;  2DN8 A;  3PUX A;  1S5F D;  4A3C G;  3M4P A;  2F0W A;  3DWA A;  4A3J H;  2JA5 H;  2KQ3 A;  1F9Q A;  4GOP A;  4GOP B;  1S5C D;  5M5W B;  4PZ7 A;  3I4N B;  1TXY A;  1B53 A;  4JI8 L;  4C2M B;  4WRD A;  2RDH A;  4QUC A;  5AJ3 L;  1UE7 A;  2PYK A;  3K0X A;  4CDE C;  4BY1 B;  3CXC A;  4AQY L;  4Y52 H;  3KDF A;  3T1H Q;  1EYA A;  1BBX C;  3GTG H;  3OMC A;  1O7Y A;  4RGN A;  2ZJP A;  4ZK9 B;  4WJW A;  4LF7 L;  2E2I B;  4IO9 A;  2HD3 A;  2PCF B;  1QNU A;  2K50 A;  1SYF A;  4XTC S;  4R9W A;  3Q24 A;  1XMQ Q;  1UE5 A;  1VQB A;  2B2W C;  4P71 A;  5M5X H;  2I07 B;  3J81 L;  2UUA L;  4DV0 L;  3MXU A;  4DV7 Q;  1NNX A;  2CWA A;  4KMU C;  1EU3 A;  5FLX L;  4HJ9 A;  2KEE A;  3I4N H;  2QIL A;  3CP0 A;  1DD2 A;  1Q90 A;  3TQY A;  4JYA L;  2R7F A;  5COR A;  1S5B D;  2ASB A;  1G29 1;  4GLX A;  4LUV A;  3TP5 A;  3PO3 H;  3RD4 A;  4IOC A;  4IPG A;  2YTY A;  1QE6 A;  2D0P A;  2F52 A;  3SK8 A;  5CMD A;  2F3V A;  5JVH 3;  1HCZ A;  1FNW A;  5BR8 Q;  2GA4 B;  3CME A;  1LTG D;  1E0B A;  1K28 A;  4DR3 L;  4U68 A;  4A4I A;  4RGO S;  5I6W A;  4F87 A;  3NSW A;  4JOI C;  5CGK A;  4CJ2 C;  5JEA J;  3OIQ A;  4R4O A;  4K0K L;  2EY6 A;  2QDB A;  4HMJ A;  4I65 A;  1HNW L;  3EJI A;  2NVT B;  2D5D A;  4LFA L;  1EFI D;  2B2T A;  2R93 G;  1EWI A;  4OHJ A;  4X62 Q;  2PQE A;  2CHB D;  2RCF A;  1HPC A;  2VB2 X;  1UWV A;  5FJ8 H;  2F0M A;  4JOI A;  2E2J H;  1B7Y B;  1O7I A;  3C46 A;  2KEC A;  1SR3 A;  2WKC A;  1ZYR C;  3ZJY C;  1CA6 A;  3DMU A;  2JA8 G;  1N36 L;  1DOK A;  1X54 A;  1J5E L;  1VDZ A;  4L6T B;  4R4C A;  2LXJ A;  1STA A;  2B2U A;  1IYJ B;  1YNX A;  3KDF B;  5TSS A;  3UI2 A;  5D65 A;  3NPP A;  4YY3 L;  1OXX K;  1WD0 A;  3ZYY X;  4DUZ L;  3CC2 A;  3W1G A;  4A3L H;  3NHH A;  5I9P A;  1MJC A;  3H94 A;  4OEL B;  2ZTD A;  3K57 A;  4DV6 L;  3E9H A;  1QZH A;  4RCN A;  2A8V A;  3PCO B;  2I5M X;  1Y1W G;  1NY4 A;  1PH7 A;  1IBM Q;  1F77 A;  2EDG A;  2WAC A;  1K0S A;  1GJX A;  3QOJ A;  2QEX A;  1JJC B;  3K5L A;  5JJI A;  2R7D A;  3FKI B;  4X65 Q;  4C1N I;  2R7Z G;  1EY9 A;  3PUY A;  2VXW A;  4POG A;  2Y0S G;  4BXX H;  3ITP A;  1AH9 A;  2JSO A;  1E2W A;  2VQE L;  1HA5 A;  1FNU A;  1H9K A;  3M7G A;  1VQL A;  4JI0 Q;  1PFS A;  1AZP A;  2BE5 D;  2K7V A;  4BY1 H;  2A68 C;  4LFB L;  4HJA A;  3W1B A;  1P8L A;  1A2T A;  1AE2 A;  4HAE A;  1GUW A;  2X69 A;  3V2T A;  2NN6 I;  2EYJ A;  1KDC A;  2QCP X;  1VQO A;  2B63 B;  1XMO Q;  2M00 A;  4GLA C;  1K83 B;  2J0T D;  4OEM B;  2F0D A;  3T13 A;  4C3I G;  1Y1V B;  2ENB A;  4NXM Q;  4JI3 Q;  1D8L A;  3NQI A;  4OGQ C;  1V1Q A;  5KNC A;  2JA7 H;  1MIU A;  4JK1 C;  4F8M A;  1T5E A;  2R92 G;  1NUC A;  1F9R A;  4XXE A;  3OMG A;  2AQ3 B;  2A6E C;  3CCQ A;  4Z9C B;  3NP8 A;  5IGB A;  2OXP A;  1LTA D;  2NWG A;  3I72 A;  2EIF A;  1W6K A;  3DM3 A;  3D4D A;  2MO1 A;  2PI2 A;  3A55 A;  4PZ8 A;  1SFO H;  1E3P A;  5M3F B;  1AN8 A;  2IPK D;  2Z6K C;  2CW0 C;  5EKK A;  3CRL C;  3K6O A;  1PV4 A;  4EQO A;  5J1Z A;  1WOC A;  3F2U A;  3CCE A;  4BXX G;  2VUM B;  1EY6 A;  1LO5 D;  2WII B;  1TY2 A;  1SJE D;  1VQ7 A;  4QJF A;  2KBN A;  4X64 Q;  3D8G A;  1D5M C;  3UDX A;  1SYE A;  2QDL A;  3DWQ A;  5C4H A;  4YHH L;  1NR2 A;  1VQG A;  2Z6K A;  1XNQ Q;  3RR5 A;  3R2T A;  2F0P A;  1V8Q A;  2PMZ B;  4OIK A;  4RH6 A;  1K0R A;  2LSS A;  5CV5 A;  4EX5 A;  3NBH A;  1ML0 D;  3QIA A;  4YIJ A;  3DM1 A;  4RCO A;  3PSI A;  1I4X A;  5CV4 A;  4DAY A;  1SLJ A;  4RAU C;  5IYB H;  5K36 H;  2F4V L;  4OO1 I;  3CMA A;  4K2K A;  1SYG A;  4QMG A;  1QVF A;  2N3S A;  2F0E A;  3KBG A;  5ELC A;  1M4V A;  4ME3 A;  1L0W A;  3ULJ A;  5EJW A;  1HFN A;  2QEJ C;  3EQL C;  3KUP A;  1XNR L;  2JEA I;  1PDQ A;  2IHE A;  3U50 C;  1OTC A;  2N8N A;  3NBI A;  1HTL D;  4APV A;  4O0A A;  1PH8 A;  1LTR D;  1E7Z A;  4JI4 Q;  3MZ5 A;  2B63 G;  3MFY A;  1VQ5 A;  4Q0F A;  4IOA A;  1K8G A;  3ULP A;  1D6E C;  3JAM i;  4ILW A;  2R93 H;  4DKA C;  4HCS A;  1F2L A;  1SE3 A;  4JI7 Q;  1YVC A;  4HED A;  3S2D H;  1BCP B;  2QA4 A;  2UUB L;  1BDO A;  2L0C A;  4JPB W;  1YIJ A;  1N9W A;  3KFU A;  2B3G A;  1KXL A;  4TSS A;  1DXM A;  4F7X A;  4A3J B;  1KC8 C;  2Z6B A;  1VQF A;  3STB C;  4TKO B;  3HOW G;  2JA8 H;  1H9R A;  1PFN A;  2EYH A;  2JYO A;  3A0J A;  3FKI G;  2ZM6 Q;  4DV1 Q;  5E7N A;  4BBR G;  1BXT A;  2CKZ B;  4QL5 A;  3W2D A;  1CHQ D;  3SHL A;  4FP5 D;  2AWO A;  1VQJ A;  5EAY A;  5FOB B;  1UEA B;  4PV1 C;  2E76 C;  4A3F G;  1L2F A;  5M5Y B;  2B39 A;  2YU9 B;  1TQO A;  2FHT A;  3RN2 A;  4A3E B;  4FO2 A;  5KNB A;  1FJG Q;  2EJM A;  2JJQ A;  1I4G A;  5M3M B;  4HJ5 A;  4G7O C;  2XRQ D;  1GO3 E;  1KAB A;  1SBB B;  3NEN A;  1EWC A;  1BOS A;  1AW7 A;  5LL6 S;  4OO1 H;  4LK1 C;  3T1H L;  3U9S A;  5HGT A;  1IKM A;  4AQY Q;  2M9V A;  2WB1 B;  4DR6 L;  2K5N A;  2EOT A;  2N55 A;  1GHK A;  2HHH L;  1BNZ A;  2F4V Q;  2PZU A;  1HNZ Q;  2K05 A;  1EY8 A;  4LF5 L;  1XJV A;  1EY0 A;  1A15 A;  1NTG A;  2ZXP A;  2GVB A;  1EEI D;  3SE0 A;  3K7A B;  3S17 H;  2LY7 A;  5J39 A;  2RKS A;  3M4Y A;  1LTB D;  1ET6 A;  3TME A;  1SJH D;  3GQB A;  3RLN A;  1EQQ A;  2A68 D;  1QCB D;  2RBM A;  3FHW A;  1ESR A;  1VQI A;  1X3Q A;  4Q5V A;  3HOZ B;  4X64 L;  2EY1 A;  3SK6 A;  4C1N K;  3M3Y H;  5IGG A;  1XNR Q;  2N88 A;  3KLW A;  1R4P B;  1TS5 A;  1YNJ D;  1RDP D;  5KND A;  3NUC A;  5M3M H;  1SFO B;  1I3Q H;  1EYC A;  5ELN A;  3M9B A;  1PA6 A;  2IX0 A;  2LKV A;  4DR1 Q;  2KVM A;  4WJ4 A;  1ASZ A;  1Y8O B;  1QNK A;  4DV1 L;  1PTO C;  4L5R C;  4MHE A;  1NAP A;  3ONA B;  1JMC A;  2PZW A;  2XN9 C;  1S40 A;  3S16 B;  2JP1 A;  1B1Z A;  3RLO A;  3G6E A;  1BF4 A;  2AWN A;  5E3F A;  1CQV A;  2K5H A;  2UUB Q;  1K83 H;  1CQF A;  5IOD A;  1Q3L A;  1DM0 B;  5GAE C;  3K8A A;  4IUT A;  1PH4 A;  1N33 L;  1C48 A;  1M8A A;  1NCV A;  4DR4 Q;  4O2D A;  3S2H H;  3HOU B;  3HOZ G;  2OTJ A;  4QQB X;  5C4J B;  1QVG A;  1H9S A;  3F2D A;  3J80 c;  1CHP D;  2IT1 A;  2CCZ A;  1I6H H;  3LNN A;  1A63 A;  1D5Z C;  2G9D A;  3I70 A;  1PTO F;  1CUK A;  1PZK D;  2LS0 1;  3KLS X;  5BN3 A;  4ME5 A;  3VDY A;  3E6Z X;  4RKL A;  2FJ2 A;  2NVX B;  3CCV A;  3H0G B;  1EY7 A;  1LTL A;  3DLL A;  1PZI D;  3T1Y Q;  1JOR A;  3I4N G;  1HHV A;  1EOV A;  1RD9 D;  1N33 Q;  1I4R A;  1PYB A;  4M8A A;  5EGT A;  1UE6 A;  5KRU A;  1B4O A;  4ZYS A;  4A3B H;  3KK7 A;  2PQA B;  1HRJ A;  5M5Y H;  3RLF A;  1TWG B;  3E0E A;  3J7A F;  3IRB A;  1MGS A;  3CKI B;  4X66 Q;  1RIP A;  1VF5 C;  2D9U A;  2F0L A;  2RHQ B;  4B3R L;  1DJR D;  3SEB A;  3I4M B;  2FMC A;  3K0Y A;  4A3B B;  1VQC A;  4A3I G;  4BBS H;  5D3D A;  2K4K A;  3N6R A;  2TSS A;  5LMN W;  5C3E H;  4A3F B;  1CI3 M;  1F9P A;  2E8G A;  4ALP A;  3H09 A;  1D1I A;  1XPU A;  4IUR A;  5I9O A;  1DYQ A;  5CBA E;  4GN3 B;  1VMP A;  4CDC C;  1RKN A;  3CPW A;  1SMY D;  4LF4 L;  1MSG A;  1ENA A;  1F9S A;  1X56 A;  3CCR A;  3HOZ H;  1CFM A;  3S1R H;  2EYP A;  3ICE A;  4J6H A;  1IBM L;  2LFN A;  1ESF A;  1EIY B;  1X3F A;  3HOW H;  3AFP A;  2BA0 A;  5CC4 A;  1TWF B;  4FVM A;  2ICE C;  2F0S A;  5KGU A;  4J1M A;  3AFQ A;  4IJL A;  5IOC A;  4LF5 Q;  3BDL A;  4CGY B;  3GTO B;  2X6G A;  4HIM A;  3X3N A;  2HHH Q;  4UHV A;  4QIW B;  5G3L F;  4A3D B;  4WFN 3;  4JI6 Q;  3Q6S A;  4XYO A;  1K73 C;  2A5H A;  1FD7 D;  1F2Y A;  1RCV D;  4CHT B;  3E9I A;  1OXS C;  3MXG A;  3ULL A;  1N36 Q;  4K14 A;  5H1S E;  1VQ9 A;  1CA5 A;  4PZ6 A;  1Y1W H;  1PLF A;  1FL0 A;  1EY4 A;  2C9O A;  2HIX A;  3M4Q A;  2O4X A;  4J8Q A;  4JG2 A;  3GO5 A;  1SAP A;  4OL7 A;  1XYI A;  2K03 A;  5ELO A;  4YWM A;  2UXD Q;  3T51 B;  4C3J H;  1QJO A;  3NQT A;  1V43 A;  2NVQ B;  4TVA B;  3HRZ C;  5IYD H;  3G6J B;  4DK6 C;  2SDF A;  3EIV A;  2K01 A;  3I2Z A;  3I4L A;  1JB7 A;  2UUA Q;  3CC7 A;  4OWX B;  1N34 Q;  2WP8 J;  3MVV A;  3IAY A;  2ZM6 L;  2ATW A;  1S72 A;  3GTK B;  3KLR A;  4HMI A;  3S1Q B;  5IP9 G;  4RGM A;  4JBJ A;  1D5X C;  2ALY B;  2CVR A;  2KJX A;  3MXN A;  4DV6 Q;  2K5V A;  5FLM G;  4BA1 I;  4NP5 A;  1MI2 A;  4JI7 L;  1IYU A;  1B50 A;  3PMF A;  3CPF A;  2F0K A;  3K5M A;  1U0L A;  4DPG A;  4DV4 L;  4LJZ C;  4DU9 A;  4YCU A;  5M9O A;  2JA6 B;  3E0J A;  3PO2 H;  4P74 A;  1PH1 A;  1VQK A;  2NTT A;  3DWP A;  4JVZ A;  3TN2 A;  4BBS G;  4LFB Q;  1V1P B;  1WTP A;  2F0G A;  5IGC A;  2CQO A;  2E2I H;  4LWC A;  1VQN A;  2KED A;  4P72 A;  3TBI B;  4A93 H;  1UE1 A;  1S5E D;  4MTN A;  3MTS A;  4RHS A;  3BS1 A;  3AMU A;  2AHO B;  2MGS A;  5C0X J;  1YEZ A;  4O1N A;  1X55 A;  1QVC A;  1V9P A;  5E4W C;  2NYZ D;  1SDF A;  5IGE A;  5IT9 c;  1VQH A;  3K7A H;  3S17 B;  4X3K A;  2WAQ G;  1YJW A;  2Z1C A;  3ERS X;  4AYB G;  2Z0S A;  3GTM B;  3J7A 5;  3OIP A;  1UUP A;  5EPK A;  5IP9 H;  4B3R Q;  2Z8L A;  3I7F A;  2Y0S B;  1EU4 A;  1PH3 A;  4UDU C;  3NEL A;  1QWY A;  2BDN A;  5KIX A;  4I7Z C;  2PNR C;  4DK1 A;  3KJP A;  4R1J A;  4CJ1 B;  3WWV A;  5EKI A;  5EPL A;  2F1M A;  4RG1 A;  5JEA G;  4X65 L;  5C3E B;  1ZXT A;  2M2L A;  3FVQ A;  1KAW A;  1Q8I A;  1PVO A;  3NWT A;  3U58 A;  1GKH A;  1U4P A;  2CW0 D;  5IT9 E;  3LWE A;  2O5J C;  3VYT A;  3M3Y B;  1GUS A;  2B8F A;  2K52 A;  4B3T L;  4JI2 Q;  4FDB A;  3J81 c;  2OTL A;  3WOF A;  4Y7N B;  2E5L L;  1SRU A;  4HIO A;  2KCN A;  4IPD A;  1XPO A;  4DV4 Q;  4DAM A;  4YCW A;  3J7A V;  5CYU A;  1BBW A;  5KEE A;  1P16 A;  4G4K A;  4QY7 A;  2P5Z X;  1O7L A;  4UP8 A;  1ZYR D;  2E2D C;  1ILQ A;  3TDQ A;  4AYB E;  1PH2 A;  2PO4 A;  1MHW C;  1WCM B;  2F03 A;  1KLG D;  1T5X D;  1B9M A;  2AUK A;  2DNE A;  1Q8K A;  4J15 A;  3MC0 B;  4NMZ A;  4EQP A;  4K5V A;  3DUZ A;  2HCC A;  3RZD H;  2V4D A;  2WKD A;  2OWO A;  1NMF A;  5GRO A;  3NWS A;  5D3I B;  2JQO A;  3M4O B;  1DOL A;  5JOB A;  4K0K Q;  5C0X I;  3I3C A;  5K36 G;  4QB4 A;  2WB1 E;  1QUQ B;  1CKO A;  1TWA H;  3BDC A;  1CK1 A;  2L11 A;  1PH5 A;  4K8J A;  2A73 B;  3ND8 A;  5M5X B;  4A93 G;  3GP7 A;  2DNC A;  1WTH A;  2Y0S E;  2ICI A;  4DNT B;  3PIO 3;  3L3O C;  4C56 C;  1Q1E A;  3OW7 A;  3J7Y W;  2Q8I B;  1D2B A;  2IX3 A;  1STH A;  1WCM G;  4K8I A;  1RJT A;  2HDM A;  5HUR A;  1VQA A;  3QG1 A;  4KN4 C;  3NK9 A;  4JBK A;  1FR3 A;  1SXT A;  1K8A C;  4AIM A;  4L5S A;  2WV6 D;  4POF A;  1GUG A;  4JI4 L;  4NB3 A;  1K8M A;  5JAV A;  4DV0 Q;  1YNN D;  1JCK B;  3J80 L;  4RA8 A;  1A0I A;  4ZUJ A;  4C3J B;  2YV5 A;  2O5I C;  3P20 A;  4H0L C;  5ISR A;  1PZJ D;  2KHI A;  5EKL A;  3H3V C;  4EQN A;  3D6W A;  3G71 A;  3HOX B;  2E2H B;  4XYQ A;  3TRZ A;  3U4V A;  4GOP C;  2NBF A;  4X62 L;  1L1O C;  3HKZ E;  3CC4 A;  5KYI A;  5M3M G;  4LFA Q;  1CM9 A;  4ZAI A;  2Q2U A;  2A6E D;  4BBR H;  4M1U B;  2EY2 A;  2F0N A;  2SNM A;  3PO2 G;  1A6X A;  4JI8 Q;  1HJP A;  5LMN L;  5C4X G;  1Z9F A;  4B3S Q;  1Q12 A;  4CDF C;  1A3V A;  1SE2 A;  1VMC A;  2B2Y C;  3RUZ A;  1PH9 A;  5DM6 3;  2J4X A;  3L2P A;  1QZG A;  2MP1 A;  4OWT B;  5C5M A;  4YCV A;  4HID A;  1JOK A;  4A3D G;  5E1F A;  4A3J G;  4NW2 A;  2K5D A;  1BUV T;  3EN2 A;  2BH8 A;  1AFP A;  1Q7Y C;  1LUZ A;  1L1O A;  4N8F A;  2VL6 A;  3UDF A;  3IFD A;  3AYH B;  4A3K H;  4K6L A;  2KHS A;  3MWY W;  1I94 L;  1PTO D;  4GS3 A;  1Z47 A;  1C4Q A;  2R7Z H;  1FGB D;  3D6C A;  2EE1 A;  5LMU L;  2B8G A;  3JAM L;  4ZQ3 A;  4R4I A;  1HUM A;  3K80 C;  4JI1 Q;  3CRK C;  5A2Q L;  3KF6 A;  1FYC A;  4DV5 Q;  4KHZ A;  2QGQ A;  4GNX A;  5C4Z A;  4FXD A;  3CW2 C;  5FJ8 G;  5C4J H;  2XNA C;  4XQQ A;  3A74 A;  1LM0 A;  3T53 B;  2MO0 A;  4UP7 A;  3C3L A;  4DA2 A;  2A69 C;  4BS9 A;  1IXR A;  4DR5 L;  3MHB A;  2UXC Q;  2QKI C;  4PNY A;  3KF8 A;  2H4O A;  4DR6 Q;  3KLS A;  5AJ3 Q;  2R6G A;  1SE8 A;  5JJL A;  4LUO A;  3U9O A;  1RTN A;  3I4M G;  5IWA L;  1ZEQ X;  5EPJ A;  1ENF A;  2RQX A;  3GV3 A;  3Q8D A;  1ILP A;  2XWJ B;  4DV5 L;  4P2C B;  5C44 G;  2SOB A;  1XNQ L;  3GTJ B;  3GTL H;  4JI1 L;  1EOT A;  4IJH A;  5DNF A;  3K5N A;  4YHH Q;  4DR1 L;  5G3L D;  3H3V I;  4DV3 L;  1OXT A;  4KLK A;  4A3D H;  2EXZ A;  1WCM H;  4BA2 I;  1U9R A;  1XXG A;  2HCI A;  4DN4 M;  3HOU H;  1RTO A;  3K7U C;  4KJO A;  1WI5 A;  3GTQ B;  3T56 B;  1PMR A;  3NTI A;  1EYD A;  1IKL A;  4FYD A;  1BCP D;  1LAB A;  4HSV A;  1IZ6 A;  3GDE A;  4NXN L;  2RF4 A;  1I6V C;  4OWW B;  2K1B A;  4BY7 B;  2PW7 A;  1JB3 A;  4H02 A;  3T4A C;  2OF1 A;  4JV5 L;  1XPR A;  2VQF Q;  4B3M Q;  5IGD A;  4KHP Q;  4LMQ D;  3GTP B;  1TKW B;  2KCT A;  4JI3 L;  2UU9 L;  2R92 B;  1N32 L;  3ER0 A;  4DR2 L;  3HFZ B;  5T1I A;  3MXN B;  2EPB A;  2Q2T A;  5IY0 A;  4C3H H;  1E2Z A;  2L9H A;  1Q1B A;  5A35 A;  5C4X H;  2I0Q A;  2IW3 A;  1SMX A;  3T16 A;  2IX1 A;  3CCL A;  1FGU A;  2YU9 H;  4K2L A;  4JBM A;  2VB3 X;  4EQ5 A;  2RSO A;  3RZO H;  3ERQ A;  2RCN A;  3GD7 A;  1SMY C;  2PPB C;  4L5T A;  3GTO H;  4X6A H;  1D7Q A;  2JA7 B;  1IHZ A;  1GUO A;  2D62 A;  1WTQ A;  4IAL A;  1MSH A;  2E2J B;  3S24 A;  2XSC A;  5J22 A;  2HQL A;  4HN7 A;  1HFG A;  2KEN A;  4GZY C;  3KOJ A;  1KDA A;  1HQM C;  3C1F A;  1CSP A;  4ID6 A;  1VCI A;  4G57 A;  3S1N H;  4WJ3 M;  3LWU A;  1JJ2 A;  5I4D A;  3OWE B;  1XTC D;  2E74 C;  3TSS A;  1JJG A;  1Y69 U;  2EJG C;  1TVX A;  4NDX A;  4DAP A;  1EQV A;  4S3S A;  4P75 A;  2DUD A;  5C3X A;  2NN6 H;  4GKJ L;  3L9A X;  1Q86 C;  5IE8 A;  1YBY A;  1D1K A;  4A3I B;  2B2V A;  4L5Q A;  4IUP A;  2VZA A;  1SE4 A;  3F2C A;  3VA5 A;  1IBK Q;  3FKI H;  3TS2 A;  2NTS A;  3M7N A;  3PIP A;  1EL0 A;  4DXF A;  4JI0 L;  3OPO A;  1TR5 A;  2VQE Q;  5GAD C;  3ND9 A;  3RZO B;  2K5Q A;  4C3H G;  1VQ4 A;  2K14 A;  4A3G B;  3Q0A A;  3KYH C;  1DGS A;  2FIN B;  2HIV A;  2LXK A;  1O78 A;  2FMM A;  2IHF A;  3W5O A;  1LT5 D;  4E6I A;  3PUV A;  1JE5 A;  4LUZ A;  2F0H A;  2XTI A;  5FKA C;  4LF7 Q;  5IYC G;  1HR0 L;  3HOV H;  2K6A A;  4QIW E;  4JI6 L;  2IL8 A;  4IUN A;  1KNA A;  1M90 C;  3URY A;  2R93 B;  1XWE A;  4KY5 A;  2EXD A;  2MFI A;  4DGZ A;  4HIK A;  1TY0 A;  2G9H D;  3QB3 A;  1IL2 A;  1A8V A;  2UU9 Q;  2E2H H;  4B3T Q;  1QUQ A;  4GKK L;  4LFC L;  5HY6 A;  1PRT F;  2K33 A;  3GTQ H;  1ICF B;  3QR8 A;  1EIH A;  1W2B A;  2ZTC A;  1CZG A;  3JAM c;  2KCM A;  5T1G A;  2DJG C;  2XWB B;  1NE3 A;  1BVS A;  3FRP B;  3H15 A;  4NXN Q;  2A69 D;  5FLM H;  4DNI A;  4GNX B;  1EZ8 A;  1SNP A;  1HA6 A;  3KF6 B;  2FXQ A;  3UE0 A;  2EY5 A;  1TU2 B;  3A54 A;  1PFB A;  1HNW Q;  3WDN A;  2F0F A;  4A3F H;  4ZLT F;  3A7A B;  2XRS D;  2IWH A;  1XMQ L;  3J80 E;  1K3B C;  2K5W A;  3EVQ A;  3FPU B;  4IPH A;  1I50 H;  1NMG A;  3AB9 A;  3SVM A;  1J9O A;  4KKT A;  4DR3 Q;  1G6Z A;  2F0O A;  2GVA A;  3IFT A;  3HOY B;  5LL6 X;  3I56 A;  4MN3 A;  3NTK A;  1CSQ A;  2ES2 A;  5JJK A;  3CU7 A;  1VQ8 A;  1G2T A;  4GKK Q;  2B2V C;  1EEF D;  5IYC H;  4NXM L;  3HOV G;  3CCJ A;  1U5K A;  2VNU D;  4N8X 1;  5KYL A;  2D0O A;  3ERO A;  3A8J E;  1LTI D;  5IWA Q;  3S1M H;  3DXJ C;  4HSP A;  3A7L A;  4XT1 B;  4JYA Q;  2HDL A;  3J80 i;  3I55 A;  4JI5 Q;  5NUC A;  3HS0 C;  2ZXO A;  1HZA A;  1SYB A;  4KTA A;  3T1Y L;  4HR7 B;  1YJ9 A;  1C7Y A;  2NVX H;  5A2Q E;  3UE1 A;  3R93 A;  1HR0 Q;  2NN6 G;  1VQE A;  4JW0 A;  5FO8 B;  3G7L A;  3O13 A;  3WOE A;  1IBL Q;  2B29 A;  3MXP A;  1N8R C;  1STG A;  1A62 A;  4B08 A;  4QGU A;  2KA7 A;  4TRD A;  2WFW A;  1NSN S;  4EGV A;  4CDD C;  4DUY L;  4IQZ A;  1JT8 A;  1CTM A;  2CQA A;  1K8O A;  5M3F G;  1B8A A;  1MBY A;  1MD2 D;  5LMU Q;  1K9M C;  1I50 B;  1EWH A;  3A5Z B;  3OOC A;  2H5X A;  2C5C A;  2ID0 A;  1I94 Q;  2NVY H;  1B70 B;  4KKU A;  4R8I A;  4P73 A;  3N52 A;  4CBV A;  4ZUI A;  4IFD J;  4ABN A;  3MEH A;  2R92 H;  3GV6 A;  3BVZ A;  4GKJ Q;  3UDI A;  1N34 L;  3R2I A;  1EFW A;  2UUC L;  1S5D D;  1TT2 A;  1JQY D;  4C3I B;  3F8T A;  3OW2 A;  4PMW A;  3K58 A;  4CKB A;  4OX9 L;  3TEH B;  5I2X A;  1J5E Q;  3HOX H;  1VS0 A;  3EA6 A;  1AEX A;  2RVL A;  2SEB D;  4DV7 L;  4A75 A;  4YWK A;  3I90 A;  2J7Z A;  3BDO A;  5CV8 A;  2D2C C;  2MUY A;  4KI0 A;  4X3S A;  3OTO Q;  5IT9 L;  1EIF A;  1I6H B;  1L0Y B;  4CKE A;  1J8I A;  4RKB A;  1HZC A;  1YHA A;  1F2M A;  2JN4 A;  1SEB D;  1SN8 A;  2HT1 A;  1LYL A;  5I2Y A;  2PI2 E;  3A56 A;  2NVQ H;  1E22 A;  4HTH A;  5COY A;  4NPS A;  5JJZ A;  1KLU D;  2PNH A;  5C5L A;  2NZO A;  1BBU A;  3HOY H;  4FF1 A;  2A6H D;  4IFD G;  2CH4 W;  3OTO L;  2F0I A;  4JCV E;  1JWS D;  4H7B A;  3IKJ A;  1T9H A;  2AMC B;  4ZRZ A;  5K5P A;  1HNZ L;  2JE6 I;  1VF7 A;  4UAI A;  2OQ0 A;  4TQU S;  1AZQ A;  3PO2 B;  3V05 A;  1VQD A;  2R61 A;  4N9T A;  3EFX D;  3JC6 6;  4A3B G;  4QF4 A;  1UAP A;  1HR0 W;  4KHP L;  3SR1 A;  2Q2H A;  3SK5 A;  2MHV A;  2PMZ E;  4JV5 Q;  1SNO A;  1QB5 D;  4LF8 Q;  5FO7 B;  1X3E A;  4GN4 B;  2OEO A;  5DM7 3;  4ZKB B;  5ELF A;  4C3H B;  4DR7 Q;  2NVY B;  2Z4I A;  5DLQ E;  3NTH A;  2H1E A;  2MPM A;  4C3J G;  2ZJQ A;  3GTK H;  4QCL A;  1OXU A;  2XGT A;  1GD7 A;  1LTS D;  1U4L A;  2EVB A;  2MJ8 A;  3AQQ A;  4WOR A;  3NXW A;  2VUM G;  5HGQ A;  1PH6 A;  4LNQ A;  4HJ8 A;  1HXY D;  3MA2 B;  4LF6 L;  2WAQ E;  3DEP A;  3VR4 A;  1KL9 A;  3PQI A;  3Q22 A;  3TRE A;  4KHV A;  1R9T B;  2XIW A;  3FMC A;  3OYY A;  1KDB A;  4X66 L;  5CR3 A;  4DAV A;  3HOV B;  5D14 A;  2VS1 A;  4DV2 Q;  1X6O A;  1IW7 D;  1Q82 C;  3KBX A;  3BYY B;  4LF8 L;  2F0J A;  2YTX A;  5IP7 H;  5M3F H;  3VR5 A;  2AUJ D;  3SXH A;  3HOY G;  1EQR A;  4CKC A;  4IZ8 A;  2AKW B;  2IY5 B;  2F0U A;  3I4M H;  3HP3 A;  4XIG S;  1BQQ T;  3I8Z A;  5M5W H;  2JA7 G;  1C9O A;  4DV2 L;  1YNN C;  2A19 A;  1VQM A;  4DUY Q;  1WTO A;  1TWH B;  3FDT A;  1YIT A;  4KD4 A;  4A3I H;  1OO9 B;  3S9W A;  2Z4H A;  4DR4 L;  1MJE A;  1DZ1 A;  4IUQ A;  3PUW A;  1R9T H;  1VQP A;  3BJU A;  1C0A A;  3HZX A;  2RSN A;  2EYO A;  4LF9 Q;  4DFA A;  5IGF A;  1V1P A;  5F2D A;  2B2W A;  2CH4 A;  1JOO A;  2Z9H A;  3GTM H;  1TS3 A;  3C1E A;  3HKS A;  1FNV A;  2L15 A;  3QOL A;  1E1T A;  4KD3 A;  1SNM A;  5IYD G;  1H9M A;  4U67 3;  1E1O A;  1YI2 A;  1Q81 C;  2WIN B;  4RFB A;  1O7Z A;  2LMC B;  2ZT9 C;  1BO0 A;  4LAA A;  3CCS A;  1YZ6 A;  3KF8 B;  1BR9 A;  4YWL A;  1Z7T A;  2DY7 A;  1YHQ A;  1STY A;  2A74 C;  1Y1W B;  2GN5 A;  2KHJ A;  2YYZ A;  1HUN A;  2UUC Q;  3CAM A;  5CV9 A;  1G91 A;  1NJI C;  5EBD A;  4IUU A;  1A2U A;  1I4H A;  4R4T A;  3S14 B;  1UEB A;  3AEV A;  4IN3 A;  5GAG C;  4LW1 A;  2AQ2 B;  3GTJ H;  1ENC A;  1SNC A;  1WD1 A;  5EQ0 A;  3TP6 A;  3VYU A;  5JEA H;  1KRT A;  4XT3 B;  3JAM E;  4L63 B;  2KOL A;  1QG7 A;  3LGJ A;  2UXB Q;  5DAU A;  1HZB A;  2ZJR A;  2N78 A;  3AU7 A;  3A5U A;  3H0G H;  4H44 C;  4OO1 G;  3RMH A;  1GVP A;  1B9N A;  1L1O B;  2RHS B;  1TWA B;  1BCP C;  4K5X A;  3G48 A;  3P1H A;  3CD6 A;  4A3C H;  1NBW A;  1STE A;  1PRT C;  2BH2 A;  2PW5 A;  1KTK A;  2OCE A;  4ZKC B;  3CF5 A;  2VUM H;  1R4Q B;  4CJ0 B;  2WAQ B;  1XMO L;  4RMF A;  1WTV A;  5C6A A;  3HOW B;  4FXG C;  3F2B A;  1KQS A;  4JBW A;  3RZD B;  3BZD B;  3TZD A;  1I4P A;  2HQE A;  3E3X A;  3VR6 A;  1Q46 A;  5J3B A;  1PTO B;  2EYL A;  4NKL A;  2L12 A;  5IP7 G;  2NZ1 D;  1TWC B;  2I5L X;  4KY6 A;  4K5W A;  1FJG L;  5ELD A;  3W3A A;  2N49 A;  3J7Z C;  4G7Z C;  1I5F A;  3S1N B;  2OT2 A;  5JPM C;  3RN5 A;  3VYS A;  4OON A;  4R8N A;  4X3U A;  3DEO A;  2JA9 A;  4BWG B;  5DEH A;  2CFM A;  2JA6 G;  2E75 C;  3EBE A;  2L4N A;  2Q8T A;  4A3M B;  2C35 B;  3E5S A;  3M4O H;  4OX9 Q;  4FF2 A;  1QOH A;  1EZ6 A;  1IBL L;  3U4Z A;  2UXD L;  4GN5 A;  5ELE A;  1ASY A;  1HNX Q;  2EYM A;  3PO3 G;  1B44 D;  3K81 C;  1Y1V H;  1ROD A;  1TS4 A;  1PTO H;  1L0X B;  4YY3 Q;  4KY7 A;  4LFC Q;  1NR4 A;  3HEJ A;  2ZXR A;  1M1K C;  3CQZ B;  1ONL A;  2F3W A;  5L37 A;  1GXD C;  5CV7 A;  4FF3 A;  4A76 A;  4BY1 G;  1Y14 B;  4MTK A;  3J81 i;  4GNX C;  4N9P A;  2RA4 A;  2K04 A;  3GTG B;  3SDZ A;  2NVT H;  2PQA A;  4UPA A;  2VQF L;  1SRO A;  2QW7 A;  4IPC A;  4BY7 H;  5FO9 B;  4KJN A;  5EBC A;  1UNS A;  3PUZ A;  1B3Q A;  1MKH A;  3BVG A;  3VR3 A;  4ULL A;  2UXB L;  1LAC A;  4FF4 A;  1G6P A;  1JE4 A;  1I4Q A;  4HJ7 A;  2JA5 B;  4K6D A;  4PG3 A;  1LTT D;  1XTD A;  4JI5 L;  1C8C A;  2PZT A;  2DGY A;  1H9S B;  2DJF C;  4LF4 Q;  3I73 A;  2NB0 A;  4RGT A;  3STB D;  5IIF A;  1JWU D;  3PV0 A;  3S15 B;  3BU2 A;  4A3E H;  2OQK A;  3NE5 B;  3S14 H;  1IL8 A;  3GTL B;  1LV9 A;  1II3 A;  1RL2 A;  3BYT B;  5I6Y A;  4B3M L;  1B2T A;  5GQO A;  2BDO A;  1I3Q B;  1WJJ A;  1GOZ A;  3X3M A;  4A3M H;  1PRT B;  1Y1V G;  2F0V A;  3S1Q H;  2VW9 A;  2NUC A;  3GTP H;  4ODG A;  2Q8R E;  1EQT A;  3HKZ B;  1E24 A;  1KD1 C;  4A3K G;  3D0F A;  2EZV A;  1W6J A;  3S2D B;  1BKB A;  1S3O A;  2UXC L;  4DR5 Q;  3D4R A;  3VR2 A;  1SND A;  1SYD A;  1JR0 D;  4B9W A;  1F2Z A;  1U4M A;  2TMP A;  4DK0 A;  3CCM A;  3S2H B;  4B9X A;  1WFQ A;  2JXM B;  5C0X H;  1XX8 A;  1RHP A;  1A3T A;  1O80 A;  2BOS A;  5FLX E;  4XQJ A;  3HGB A;  3IL8 A;  4DV3 Q;  2L55 A;  3L0O A;  1LT4 D;  3UDG A;  2DY8 A;  1CKN B;  4EVO A;  1JOQ A;  1G51 A;  3B6Y A;  3A8K E;  4DAY B;  5IYB G;  1TWH H;  2R7Z B;  4UY8 C;  2G5D A;  3BG3 A;  2MNA A;  1W3S A;  3QWN A;  3TZU A;  3FPP A;  1GUT A;  2JA6 H;  1EIG A;  3S16 H;  1X3P A;  1KRS A;  3TP8 A;  2A1A A;  3D4W A;  5E4X A;  1WTW A;  3D3R A;  4V19 0;  1IYV A;  2B2Y A;  1PHJ A;  1IW7 C;  2JK8 A;  4MZ9 A;  2F0Q A;  3Q23 A;  2BE5 C;  4KV6 A;  3CCU A;  4H13 C;  3TP7 A;  1H95 A;  3OHX C;  3RNU A;  3H0G G;  1G8Z D;  1YNJ C;  2VY3 A;  5C3W A;  1WTX A;  2V1C C;  1TS2 A;  1STN A;  2X6L A;  1HH2 P;  4X3T A;  1TWF H;  3K5O A;  3I4O A;  4XQN A;  1ET9 A;  4A3G G;  4MNO A;  5C3E G;  5LMN Q;  1CT1 D;  3A8I E;  3HOX G;  3R8B A;  2L5T A;  1DCZ A;  4RHR A;  1KAA A;  4O42 A;  1AE3 A;  3S1R B;  1PYW D;  1PFM A;  2JA8 B;  1JC7 A;  3HOU G;  3OWF A;  1EY5 A;  2R3Z A;  4RWS C;  4FXK C;  1IBK L;  1G2S A;  3CQZ H;  1WYD A;  1GM5 A;  1HQR D;  1FVI A;  4DUZ Q;  1QIL A;  4JC0 A;  1KIX A;  2EYF A;  4DXG A;  1SSO A;  3S1M B;  3P75 A;  2FFK B;  4A3K B;  5BN5 A;  1V1O A;  3HKZ G;  4A93 B;  2IJ0 A;  3KJO A;  3OSO A;  2ZTE A;  2L1B A;  3NEM A;  4DNR B;  3HG9 A;  4IUV A;  1CZW A;  2F4I A;  3R3O A;  3PIP 3;  4L8J A;  2AQ1 B;  4PMB A;  1B3A A;  3H6M A;  5LHY 1;  4BBS B;  3L7Z C;  3DHQ A;  2EQS A;  1GUN A;  2EJF C;  1ZKO A;  1KHI A;  5GAH C;  3VA7 A;  1KNE A;  3FEW X;  5C44 H;  4LF6 Q;  2BA1 A;  1TWG H;  4ZCK A;  4I7A A;  3J81 E;  4V0B A;  1SYC A;  3BVM A;  2JA5 G;  3D31 A;  1OXV A;  1U4R A;  1X32 A;  1J6Q A;  2RDF A;  5CBE E;  3K59 A;  2B63 H;  4KK7 A;  3BZC A;  4GLV B;  5CV6 A;  3PF4 A;  5BR8 L;  1ICW A;  1WTR A;  4XDX A;  4G7H C;  4BY7 G;  2F3I A;  1Z6H A;  4PQX A;  4UP9 A;  2WB1 G;  1TWC H; 
#chains in the Genus database with same CATH homology
 1EUJ A;  2PMZ E;  4JV5 Q;  4HJ5 A;  3PF5 A;  4LF8 Q;  2KHI A;  1X3E A;  2CWP A;  1GO3 E;  4GN4 B;  1HNX L;  3G71 A;  4DR7 Q;  3TRZ A;  3NEN A;  2JEB I;  3NBH B;  3U4V A;  3T1H L;  5DLQ E;  4GOP C;  3CC4 A;  4X62 L;  1L1O C;  3HKZ E;  4AQY Q;  1X9N A;  5M3M G;  4DR6 L;  2ZJQ A;  3GTK H;  4LFA Q;  2K5N A;  2Q2U A;  1OXU A;  1YJN A;  2XGT A;  2HHH L;  4BBR H;  2F4V Q;  1HNZ Q;  1GD7 A;  1EYG A;  1X3G A;  3AQQ A;  4LF5 L;  2NZH A;  4AH6 A;  2VUM G;  5HGQ A;  4A3E G;  1XJV A;  1K3R A;  3PO2 G;  4JI8 Q;  1PH6 A;  4LNQ A;  1NTG A;  4HJ8 A;  1VQ6 A;  2GVB A;  4Y7N H;  1HJP A;  4LF6 L;  5LMN L;  3S17 H;  2WAQ E;  1Z9F A;  4B3S Q;  5C4X G;  1Q12 A;  1KL9 A;  1EQQ A;  3RLN A;  3TRE A;  1PH9 A;  4A3G H;  3L2P A;  3FHW A;  1QZG A;  3OYY A;  4X66 L;  1VQI A;  4OWT B;  4A3M G;  4YCV A;  4HID A;  2VS1 A;  2I5H A;  4DV2 Q;  1X6O A;  3S15 H;  1Q82 C;  4X64 L;  4A3D G;  4A3J G;  1YHB A;  4LF8 L;  3EN2 A;  2YTX A;  5IP7 H;  2BH8 A;  3M85 A;  5M3F H;  1LUZ A;  1Q7Y C;  1L1O A;  3HOY G;  3M3Y H;  1EQR A;  1XNR Q;  3PGZ A;  2VL6 A;  3KLW A;  3UDF A;  1X65 A;  3AYH B;  4A3K H;  2YTV A;  3F1Z A;  2AKW B;  2IY5 B;  1I94 L;  4OXP A;  3BZK A;  3I4M H;  4GS3 A;  5M3M H;  3J81 j;  1Z47 A;  4XIG S;  2R7Z H;  1I3Q H;  5ELN A;  3M9B A;  5M5W H;  4DR2 Q;  1C9O A;  1PA6 A;  5LMU L;  2IX0 A;  2JA7 G;  2Q2I A;  1N32 Q;  4DK3 C;  4DV2 L;  4R4I A;  4DR1 Q;  2A19 A;  3K80 C;  4JI1 Q;  1VQM A;  4WJ4 A;  5C0X G;  3KF6 A;  1ASZ A;  4DV5 Q;  4DUY Q;  3TS0 A;  3PIO A;  4DV1 L;  4L5R C;  4KHZ A;  2QGQ A;  4GNX A;  4B3S L;  1YIT A;  1JMC A;  2E5L Q;  3SGI A;  4A3I H;  1S40 A;  3CW2 C;  2MQH A;  3RLO A;  4R4Q A;  5FJ8 G;  5C4J H;  3A74 A;  1LM0 A;  4C2M H;  2MO0 A;  4UP7 A;  3G6E A;  1MJE A;  4DR4 L;  4JI2 L;  2AWN A;  3PUW A;  1R9T H;  1VQP A;  3BJU A;  1C0A A;  2K5H A;  2UUB Q;  1IXR A;  4DR5 L;  4LF9 Q;  1K83 H;  2UXC Q;  4DR6 Q;  4LF9 L;  1CKN A;  5AJ3 Q;  3FP9 A;  2R6G A;  5GAE C;  3GTM H;  1SE8 A;  3K8A A;  1PH4 A;  1CKM A;  1N33 L;  4IFD I;  5JJL A;  3HKS A;  4C3I H;  2L15 A;  1E1T A;  4DR4 Q;  5IYD G;  4O2D A;  3S2H H;  3MEF A;  4LUO A;  1E1O A;  1YI2 A;  3HOZ G;  5FLX c;  1Q81 C;  5IWA L;  3I4M G;  4DR7 L;  2OTJ A;  4QQB X;  3H3V H;  1QVG A;  3F2D A;  3CCS A;  1HZ9 A;  1YZ6 A;  2IT1 A;  3Q8D A;  3J80 c;  3KF8 B;  4DV5 L;  2CCZ A;  1I6H H;  4YWL A;  5C44 G;  1XNQ L;  3GTL H;  1A63 A;  1YHQ A;  3G4S A;  4JI1 L;  1CUK A;  1PYS B;  2K75 A;  4IJH A;  3PUX A;  4YHH Q;  4A3L G;  4DR1 L;  4A3C G;  2GN5 A;  3M4P A;  2KHJ A;  2YYZ A;  3H3V I;  3VDY A;  4DV3 L;  2UUC Q;  1OXT A;  3CAM A;  4KLK A;  4A3D H;  4A3J H;  1NJI C;  2JA5 H;  1WCM H;  4BA2 I;  3CCV A;  3DLL A;  1LTL A;  4GOP A;  4GOP B;  4R4T A;  3T1Y Q;  4PZ7 A;  1TXY A;  4JI8 L;  3I4N G;  1UEB A;  3AEV A;  1EOV A;  5GAG C;  1N33 Q;  3K7U C;  4LW1 A;  3GTJ H;  3HOU H;  1WI5 A;  1PYB A;  5AJ3 L;  1UE6 A;  4A3B H;  1UE7 A;  1KRT A;  2PQA B;  3K0X A;  3RLF A;  5M5Y H;  3E0E A;  3CXC A;  3IRB A;  3LGJ A;  4AQY L;  4Y52 H;  1IZ6 A;  3GDE A;  3KDF A;  4X66 Q;  1RIP A;  3T1H Q;  2UXB Q;  3GTG H;  4NXN L;  2RHQ B;  1HZB A;  2RF4 A;  4B3R L;  2ZJR A;  2ZJP A;  2N78 A;  4OWW B;  4LF7 L;  4IO9 A;  3A5U A;  3H0G H;  2K50 A;  4OO1 G;  4H02 A;  1GVP A;  1VQC A;  1L1O B;  2RHS B;  4A3I G;  4BBS H;  4JV5 L;  4XTC S;  1XPR A;  2K4K A;  2VQF Q;  1XMQ Q;  1UE5 A;  3G48 A;  4B3M Q;  5LMN W;  1VQB A;  3CD6 A;  4P71 A;  4KHP Q;  5C3E H;  5M5X H;  4A3C H;  2KCT A;  2E8G A;  4JI3 L;  4DV0 L;  2UUA L;  2UU9 L;  1NBW A;  4DV7 Q;  2BH2 A;  4ALP A;  1N32 L;  2OCE A;  2CWA A;  3ER0 A;  4DR2 L;  1XPU A;  3CF5 A;  2VUM H;  3HFZ B;  3MXN B;  4GN3 B;  4HJ9 A;  2Q2T A;  1XMO L;  5IY0 A;  4C3H H;  3I4N H;  4RMF A;  1Q1B A;  3CP0 A;  3TQY A;  3CPW A;  4LF4 L;  4JYA L;  5C4X H;  3F2B A;  4JBW A;  1KQS A;  2I0Q A;  1SMX A;  1X56 A;  2R7F A;  2ASB A;  2IX1 A;  3CCR A;  1G29 1;  4GLX A;  3CCL A;  1FGU A;  3HOZ H;  2YU9 H;  4LUV A;  3S1R H;  4JBM A;  3PO3 H;  4EQ5 A;  4IOC A;  1Q46 A;  3ICE A;  4IPG A;  3RZO H;  2YTY A;  5J3B A;  1IBM L;  2D0P A;  2RCN A;  3GD7 A;  2F52 A;  1EIY B;  1D7Q A;  1X3F A;  4L5T A;  5IP7 G;  3GTO H;  4X6A H;  3HOW H;  2I5L X;  3AFP A;  1FJG L;  2BA0 A;  2D62 A;  3J7Z C;  2N49 A;  1I5F A;  5BR8 Q;  3S24 A;  3CME A;  4DR3 L;  4A4I A;  3RN5 A;  2HQL A;  2KEN A;  4OON A;  2JA9 A;  4JOI C;  3AFQ A;  4IJL A;  5JEA J;  4R4O A;  3KOJ A;  4LF5 Q;  4K0K L;  1HNW L;  2CFM A;  2JA6 G;  4HIM A;  3EBE A;  1CSP A;  2HHH Q;  1VCI A;  4JI6 Q;  4LFA L;  3S1N H;  4WJ3 M;  2C35 B;  1K73 C;  1JJ2 A;  4OX9 Q;  3M4O H;  2R93 G;  1EWI A;  4X62 Q;  1JJG A;  3E9I A;  1OXS C;  1IBL L;  3ULL A;  1N36 Q;  1UWV A;  5H1S E;  5FJ8 H;  3U4Z A;  1VQ9 A;  2UXD L;  4JOI A;  2E2J H;  4GN5 A;  4PZ6 A;  1B7Y B;  1O7I A;  1Y1W H;  1FL0 A;  4P75 A;  1HNX Q;  1ASY A;  3PO3 G;  2DUD A;  2HIX A;  3M4Q A;  4GKJ L;  3K81 C;  1SR3 A;  1Y1V H;  5IE8 A;  3ZJY C;  1YBY A;  4JG2 A;  1Q86 C;  3GO5 A;  4L5Q A;  4YY3 Q;  5ELO A;  2VZA A;  4YWM A;  3F2C A;  1IBK Q;  4LFC Q;  2JA8 G;  3FKI H;  4C3J H;  1N36 L;  3TS2 A;  3M7N A;  3PIP A;  1X54 A;  1V43 A;  4TVA B;  1M1K C;  4JI0 L;  1J5E L;  4R4C A;  2VQE Q;  2LXJ A;  5GAD C;  5IYD H;  4DK6 C;  1IYJ B;  3EIV A;  1YNX A;  4BY1 G;  3KDF B;  4A76 A;  1Y14 B;  3I2Z A;  3J81 i;  2K14 A;  4GNX C;  1VQ4 A;  1JB7 A;  3CC7 A;  3KYH C;  2UUA Q;  1DGS A;  2HIV A;  2LXK A;  4YY3 L;  1OXX K;  4OWX B;  2NVT H;  2PQA A;  4UPA A;  2VQF L;  2IHF A;  2WP8 J;  3W5O A;  4DUZ L;  3W1G A;  2ZM6 L;  1SRO A;  4IPC A;  1N34 Q;  3CC2 A;  2ATW A;  4BY7 H;  4A3L H;  1MJC A;  3PUV A;  1S72 A;  1JE5 A;  2ZTD A;  4LUZ A;  2XTI A;  4LF7 Q;  3PUZ A;  4DV6 L;  5IP9 G;  3E9H A;  4JBJ A;  1QZH A;  2ALY B;  1MKH A;  2A8V A;  3PCO B;  4DV6 Q;  2K5V A;  5FLM G;  5IYC G;  2I5M X;  1HR0 L;  1Y1W G;  3HOV H;  2UXB L;  1NY4 A;  1PH7 A;  1IBM Q;  4QIW E;  1G6P A;  4BA1 I;  4JI6 L;  4HJ7 A;  4JI7 L;  1M90 C;  3CPF A;  4PG3 A;  1U0L A;  2QEX A;  1JJC B;  1XTD A;  4JI5 L;  5JJI A;  2DGY A;  2R7D A;  4DPG A;  4X65 Q;  4DV4 L;  2R7Z G;  2MFI A;  2EXD A;  3PUY A;  4HIK A;  4LF4 Q;  4POG A;  2Y0S G;  4BXX H;  1AH9 A;  4YCU A;  3STB D;  2VQE L;  3PV0 A;  3BU2 A;  4A3E H;  1VQL A;  3PO2 H;  4JI0 Q;  1PFS A;  1A8V A;  2OQK A;  1IL2 A;  4BY1 H;  3S14 H;  4P74 A;  2UU9 Q;  2E2H H;  4LFB L;  4B3T Q;  1QUQ A;  4GKK L;  1PH1 A;  4LFC L;  1VQK A;  5HY6 A;  4HJA A;  4BBS G;  1RL2 A;  3GTQ H;  4LFB Q;  4B3M L;  3W1B A;  1P8L A;  1AE2 A;  5GQO A;  1W2B A;  2CQO A;  2ZTC A;  1WJJ A;  4LWC A;  3JAM c;  2KCM A;  2E2I H;  4P72 A;  1VQN A;  4A93 H;  4A3M H;  1UE1 A;  1Y1V G;  4MTN A;  2AHO B;  2NN6 I;  5C0X J;  1NE3 A;  1BVS A;  3S1Q H;  1YEZ A;  2VW9 A;  3H15 A;  4NXN Q;  5FLM H;  1X55 A;  1QVC A;  1V9P A;  3GTP H;  1VQO A;  1XMO Q;  4DNI A;  4GNX B;  5IT9 c;  4GLA C;  1E24 A;  1KD1 C;  4A3K G;  3D0F A;  1VQH A;  1BKB A;  1S3O A;  2FXQ A;  3K7A H;  3KF6 B;  3UE0 A;  4DR5 Q;  4NXM Q;  2UXC L;  4JI3 Q;  1D8L A;  1HNW Q;  4A3F H;  1V1Q A;  2JA7 H;  1MIU A;  2WAQ G;  3CCM A;  1XMQ L;  1YJW A;  1WFQ A;  2R92 G;  4IPH A;  1I50 H;  1NMG A;  3ERS X;  4AYB G;  4DR3 Q;  2Z0S A;  2GVA A;  3J7A 5;  3CCQ A;  4DV3 Q;  3I56 A;  3L0O A;  1CSQ A;  3UDG A;  5IP9 H;  2ES2 A;  4B3R Q;  5JJK A;  1CKN B;  2EIF A;  1VQ8 A;  3DM3 A;  3I7F A;  4GKK Q;  1G51 A;  2MO1 A;  3B6Y A;  2PI2 A;  5IYC H;  4NXM L;  4DAY B;  5IYB G;  1TWH H;  4PZ8 A;  3CCJ A;  1U5K A;  1E3P A;  1SFO H;  4UY8 C;  1PH3 A;  2VNU D;  2MNA A;  2D0O A;  1W3S A;  3NEL A;  2Z6K C;  2JA6 H;  3S16 H;  3KJP A;  1KRS A;  4R1J A;  5IWA Q;  2A1A A;  3WWV A;  3S1M H;  1PV4 A;  4RG1 A;  5JEA G;  4X65 L;  4JYA Q;  3J80 i;  3I55 A;  4JI5 Q;  1PHJ A;  1WOC A;  1HZA A;  3T1Y L;  3CCE A;  1YJ9 A;  4BXX G;  1KAW A;  1C7Y A;  2NVX H;  3UE1 A;  2JK8 A;  4MZ9 A;  1PVO A;  1VQ7 A;  4QJF A;  2KBN A;  1GKH A;  3U58 A;  3CCU A;  4X64 Q;  3UDX A;  1HR0 Q;  4YHH L;  2NN6 G;  1H95 A;  1VQE A;  1VQG A;  3RNU A;  2K52 A;  2Z6K A;  3H0G G;  4B3T L;  1XNQ Q;  2VY3 A;  4JI2 Q;  3RR5 A;  2V1C C;  4FDB A;  3J81 c;  2B29 A;  1IBL Q;  1N8R C;  2OTL A;  1HH2 P;  1A62 A;  1TWF H;  4QGU A;  3I4O A;  2E5L L;  4A3G G;  1K0R A;  1SRU A;  2WFW A;  4MNO A;  5C3E G;  5LMN Q;  2LSS A;  4HIO A;  4EX5 A;  3HOX G;  4IPD A;  1XPO A;  1JT8 A;  4DUY L;  4DV4 Q;  3PSI A;  4DAM A;  4YCW A;  1BBW A;  1SLJ A;  1P16 A;  1B8A A;  5M3F G;  4QY7 A;  5IYB H;  1AE3 A;  2F4V L;  5LMU Q;  1K9M C;  4OO1 I;  3HOU G;  4UP8 A;  3CMA A;  1QVF A;  3A5Z B;  2N3S A;  2H5X A;  2ID0 A;  1I94 Q;  2NVY H;  4AYB E;  1L0W A;  4ME3 A;  1B70 B;  3ULJ A;  4P73 A;  1PH2 A;  1IBK L;  1XNR L;  4IFD J;  2JEA I;  3CQZ H;  2R92 H;  2IHE A;  1WYD A;  3U50 C;  1GM5 A;  4GKJ Q;  3UDI A;  1Q8K A;  1FVI A;  4DUZ Q;  1N34 L;  1OTC A;  1EFW A;  2N8N A;  4J15 A;  4JC0 A;  2UUC L;  1KIX A;  2UXD Q;  4APV A;  3F8T A;  3OW2 A;  3RZD H;  4PMW A;  4O0A A;  1PH8 A;  3HKZ G;  1E7Z A;  2OWO A;  1NMF A;  5GRO A;  4JI4 Q;  2B63 G;  2JQO A;  4OX9 L;  3TEH B;  1J5E Q;  1VQ5 A;  3KJO A;  3HOX H;  1VS0 A;  4IOA A;  2ZTE A;  1K8G A;  3NEM A;  4DV7 L;  4A75 A;  3JAM i;  4YWK A;  3ULP A;  4K0K Q;  5C0X I;  2R93 H;  4DKA C;  5K36 G;  4KI0 A;  3OTO Q;  2WB1 E;  1QUQ B;  4JI7 Q;  1EIF A;  1YVC A;  1CKO A;  1TWA H;  3S2D H;  3L7Z C;  2QA4 A;  2UUB L;  1PH5 A;  3HOV G;  1HZC A;  1YHA A;  1YIJ A;  2EQS A;  1N9W A;  3KFU A;  2B3G A;  1KXL A;  2HT1 A;  4A93 G;  1KHI A;  1SN8 A;  5GAH C;  1LYL A;  2PI2 E;  2Y0S E;  1KC8 C;  2NVQ H;  1E22 A;  1VQF A;  4NPS A;  1Q1E A;  3STB C;  5C44 H;  4LF6 Q;  2PNH A;  3HOW G;  2NZO A;  2JA8 H;  2ZM6 Q;  1BBU A;  3A0J A;  2BA1 A;  1TWG H;  3FKI G;  4DV1 Q;  3HOY H;  4IFD G;  5E7N A;  4BBR G;  3OTO L;  4JCV E;  2CKZ B;  4QL5 A;  2JA5 G;  1WCM G;  1T9H A;  2AWO A;  3D31 A;  1VQJ A;  2AMC B;  5EAY A;  1OXV A;  1HNZ L;  1VQA A;  1J6Q A;  2JE6 I;  2B63 H;  4JBK A;  2OQ0 A;  1L2F A;  4TQU S;  4A3F G;  3BZC A;  1K8A C;  4GLV B;  4AIM A;  3RN2 A;  4L5S A;  4POF A;  5BR8 L;  3PF4 A;  1VQD A;  4JI4 L;  4NB3 A;  3JC6 6;  1FJG Q;  4DV0 Q;  4A3B G;  2JJQ A;  1HR0 W;  4BY7 G;  1A0I A;  2F3I A;  4UP9 A;  4KHP L;  2YV5 A;  2WB1 G;  1TWC H;  2Q2H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...