4GKJL

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human mitochondrial anticodon stem loop (asl) of transfer rna methionine (trnamet) bound to an mrna with an aug-codon in the a-site and paromomycin.
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Expanded use of sense codons is regulated by modified cytidines in tRNA.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 15
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2012-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4gkjL00
3HOUH 4AQYL 1QUQA 2EXDA 1KAWA 1L2FA 1Y1VH 3I2ZA 5IYCH 1XNQQ 2YYZA 4GNXC 2I0QA 3S16H 3H15A 4JCVE 2PNHA 4DUZQ 1FGUA 1K0RA 1SR3A 1X54A 2RCNA 4DKAC 2BH2A 4YWKA 4DV2L 4JOIA 3M9BA 2R7ZG 5BR8L 3G6EA 2RF4A 4A93H 3S1NH 3FKIG 3L0OA 4DPGA 3PUWA 4BY1H 5GQOA 3A74A 5BR8Q 4MTNA 1VQFA 2VY3A 5JEAG 4LF4L 1E24A 4DV3L 1SRUA 3GD7A 3KF8B 5C44G 4JI7L 3UDGA 4LF5Q 5EAYA 1HZCA 4DK3C 2OWOA 2JA6G 2JA8G 2JQOA 2N3SA 4PG3A 1HR0Q 2UUAQ 4A3CH 2OTJA 4NXML 4WJ4A 3CW2C 4A3DH 2IY5B 1HNXQ 3Q8DA 3BZCA 5FLMH 2OQKA 2DUDA 1ASZA 1X3GA 2Z0SA 4C3IH 4QJFA 3JAMi 3I7FA 3PIPA 1G51A 1I3QH 3NELA 1HNZQ 3ULPA 3I55A 4P72A 4MZ9A 1MJEA 3LGJA 5IYBG 5IT9c 2R93H 3HKSA 1DGSA 2ZTCA 3K8AA 3CCMA 4K0KQ 1YEZA 2JE6I 1B7YB 3BU2A 3K7UC 3KLWA 5IP9H 5IP7G 1ASYA 3CCJA 1TXYA 1OXUA 1EQQA 4H02A 3RLNA 2UU9Q 2KHIA 4OONA 2R7ZH 3H3VH 3KOJA 4BA2I 1MKHA 1C9OA 5GADC 4DR1L 4RMFA 2AMCB 1EIYB 4KHPL 1TWCH 1S3OA 2OTLA 1VQNA 4A3FH 4TQUS 3T1HQ 1KRTA 1CUKA 3D0FA 2K4KA 1VQAA 2CWPA 1XPRA 2NVQH 4X62L 3A0JA 4DV7L 4GLXA 2R92H 4IO9A 3NENA 3S24A 1WCMG 1QZGA 4BBSH 1LYLA 4A3BH 2UXDL 2GN5A 1FJGQ 4DV7Q 1VQ5A 1B8AA 1P8LA 3CCVA 1IBLL 5JJKA 4JI5L 4JBKA 1BBWA 1R9TH 4LUVA 2HIXA 1CSPA 5C44H 1XPOA 3S2HH 4A3GG 3UE0A 3F2DA 3ULJA 2PMZE 2MQHA 3F2CA 1YITA 2UXBQ 5GROA 1JJ2A 5GAHC 1XNRQ 5HGQA 1M1KC 2HHHQ 2D0OA 2YTXA 4GOPC 4B3RL 4JI7Q 2KHJA 4ALPA 2WP8J 5IWAL 3PCOB 4QIWE 1NJIC 3PO2H 1WJJA 4DV5Q 1U5KA 2I5LX 3HOVH 4HJAA 3K0XA 2H5XA 3CQZH 5IYCG 1PFSA 1SROA 3D31A 4NPSA 2UXCQ 1OXTA 2PI2E 1I94Q 2UUCL 1GD7A 2K5NA 2F4VL 3M7NA 4A3GH 1GO3E 2NZHA 4BXXG 3OYYA 3PF5A 1QUQB 1X56A 1BBUA 1VQOA 4JI2L 1VQPA 3H3VI 4OXPA 4JV5L 3W1BA 1WI5A 3HFZB 2B29A 1EWIA 1VQCA 4OWTB 3STBD 3KF6B 4DUYL 2ZJPA 4POGA 2JEAI 1WFQA 2K50A 4LFCQ 4NB3A 3B6YA 5GAGC 3SGIA 1I5FA 4RG1A 4LFBQ 1JE5A 1SLJA 5IE8A 3J81c 3CC7A 4OO1I 1KC8C 1HNXL 1K3RA 4JI5Q 2CCZA 3K7AH 3J80c 2E2HH 3PO2G 4LFBL 4Y7NH 5LMUL 4A3MG 1YJ9A 4DR3L 2K14A 4LF6L 3HOWH 3KYHC 4UP9A 4JV5Q 1J5EL 1RIPA 1Z47A 1L1OA 1OTCA 3I4MH 2HIVA 3T1HL 1SMXA 5M3FH 4LF7L 3ERSX 3M4OH 4DV5L 1Y1WH 5H1SE 3DM3A 1KQSA 3GTGH 5IYBH 3M4PA 5J3BA 3PV0A 1G6PA 2E8GA 5IY0A 1PH3A 1NBWA 2F4VQ 4JC0A 4YHHL 4IOAA 5C3EH 4BY7H 4OO1G 4HJ5A 3VDYA 3CP0A 4A3EG 4LUOA 1VQJA 3HKZE 1OXVA 3T1YL 3PO3H 4IJLA 4P71A 2R7DA 1IBMQ 3RZOH 5LMNL 4KHZA 4WJ3M 4LFAQ 3CC4A 2A19A 5C4JH 2ZJQA 2N8NA 4A3JG 4PZ6A 4YWLA 4DAYB 2I5HA 3GO5A 4DAMA 1TWAH 1CSQA 1PH5A 4LFAL 3HOYG 3CC2A 1V43A 2ZTEA 3JC66 4BY1G 5FJ8G 3A5UA 3H0GH 4DV1Q 3U58A 1PH9A 4BA1I 3PF4A 4LF6Q 3M3YH 4B3MQ 2CFMA 5DLQE 4DV4Q 3GTQH 1Y1VG 3JAMc 1VQDA 2E2IH 2WFWA 4X66Q 4A76A 2VZAA 1YHAA 4JG2A 3DLLA 2JEBI 2R6GA 1A8VA 3I4OA 3OW2A 2NVXH 2CQOA 2D62A 3ER0A 2I5MX 2OQ0A 3CCRA 1PH7A 1B70B 2UU9L 1A63A 3OTOL 1HNWQ 2BA0A 2VUMH 2LXKA 4DR7Q 3K80C 4LF7Q 1NE3A 1TWHH 1HZ9A 4DUYQ 3GTKH 3HOZG 3E9IA 2Y0SE 1VQEA 3PIOA 4DR5L 2AWNA 4XTCS 1PH4A 1M90C 4L5TA 1W3SA 1FVIA 5C4XG 2YU9H 3AEVA 1N32Q 4LUZA 5M5YH 3CPFA 1Y1WG 1EQRA 2MNAA 1RL2A 1L1OB 1J5EQ 1HZAA 2BA1A 2NZOA 2K5HA 3PGZA 1PHJA 1IBKQ 4Y52H 4GN5A 4O2DA 3S14H 3RN5A 2DGYA 3CCUA 4A3KH 1YNXA 3OTOQ 2LSSA 3E9HA 4JI8Q 1I50H 3KJOA 1Q81C 1YZ6A 3HKZG 1YJWA 3PSIA 3NEMA 3UDXA 2RHQB 3ULLA 3F2BA 2K52A 5C0XJ 5LMNW 1VQ8A 2HT1A 4HJ8A 5M5WH 4NXNQ 1UE1A 3W5OA 2YTYA 4A4IA 5FLMG 4B3SL 4IPCA 1PYBA 1UE7A 1EIFA 1KRSA 4DV6L 1Q12A 2E2JH 4IFDG 2Z6KC 4JI2Q 1MJCA 2ZTDA 1AE3A 3EN2A 4ME3A 4R1JA 1K8AC 1EYGA 2JA5H 1VQBA 2ZM6L 2UUCQ 4DR4Q 2JK8A 1JMCA 4A3DG 1NMGA 4JI3Q 1CKNB 1X3EA 3MXNB 3UDIA 3ZJYC 5M5XH 1IBML 1YJNA 3GTJH 2PQAA 4L5RC 3PUXA 3CXCA 4DR2Q 3T1YQ 1V1QA 4GS3A 3HOXG 1YI2A 3S1QH 4P73A 2AHOB 1SN8A 1VQ9A 1JJGA 2UXBL 4APVA 1YVCA 4AYBE 2B63G 2HHHL 1HJPA 1IYJB 2JJQA 3FHWA 4IFDI 1EFWA 2A8VA 2LXJA 2IHEA 3W1GA 1IXRA 3EIVA 4YCVA 5C0XG 3J81i 3CPWA 1Z9FA 4LF8Q 1FJGL 1N34L 4OX9Q 4JBWA 1WCMH 1N36Q 4LF9L 3KFUA 2YTVA 2R92G 3AFPA 5HY6A 2NN6G 1G291 1WOCA 3PUZA 1N36L 4JI1Q 3PUYA 4OWXB 3F8TA 4IPHA 1LUZA 4P74A 1AE2A 1Q82C 4J15A 4LWCA 4AH6A 1OXXK 2HQLA 3CF5A 4YHHQ 1TWFH 2MO0A 2AWOA 1HNWL 1OXSC 3H0GG 4JI3L 5M3FG 4QY7A 4XIGS 4LF5L 5K36G 2EIFA 3FKIH 4JI6Q 1UWVA 2Q2TA 4DV0L 1XMOL 4LNQA 3U4VA 4HIDA 4JI4L 2UUBL 4GN3B 3HOZH 1E3PA 2GVAA 4YCWA 4GLAC 4B3ML 4GKJQ 1L0WA 3WWVA 1NMFA 5C4XH 1YHQA 4R4OA 4DV6Q 2JA5G 1P16A 4HIOA 4A3BG 3KF6A 1A62A 1PYSB 1AH9A 3EBEA 4JYAL 2ES2A 4NXNL 5C3EG 2JA9A 3A5ZB 4BY7G 1X65A 3M4QA 4X65L 1HH2P 1N9WA 3KDFA 4DR1Q 4GKKQ 1PVOA 4JBMA 2JA6H 2JA8H 3TS0A 1N33Q 2Q2IA 3CMEA 4GOPA 2B63H 4GN4B 4X65Q 3I4NH 1EUJA 3RR5A 3BJUA 3RZDH 2Z6KA 1MIUA 4UP8A 3HOVG 1HZBA 4YCUA 3F1ZA 1D8LA 2WAQE 4R4TA 3TQYA 2UXDQ 1X6OA 2YV5A 2K75A 2K5VA 4LFCL 4HJ9A 1PH6A 1PH8A 2ZM6Q 4LF4Q 3J81j 5JJLA 2QGQA 3L7ZC 2KBNA 4GLVB 2PI2A 3AYHB 4DR5Q 1CKNA 4DUZL 4A3LH 2UXCL 4JOIC 3GTOH 4PZ7A 1N32L 2VNUD 2BH8A 2IHFA 1N33L 3S1MH 2MO1A 2XGTA 1N8RC 4DR3Q 5AJ3Q 2MFIA 1BVSA 4B3RQ 3TEHB 1QZHA 3PUVA 4X66L 2ASBA 2ZJRA 4YWMA 3CAMA 4AQYQ 4DV4L 4JI8L 3RLOA 1KXLA 1SE8A 1XNRL 4UY8C 2EQSA 4GKJL 2AKWB 4GKKL 4OX9L 2NVTH 4IPGA 2CKZB 1NY4A 1K73C 1JB7A 4DK6C 4X64L 3RLFA 1JJCB 4JYAQ 2KCTA 4L5QA 3I4MG 1K83H 2R7FA 1Y14B 2RHSB 5ELOA 5FJ8H 1U0LA 4PMWA 4EX5A 4YY3L 4A3MH 3HOYH 4AYBG 1I94L 1NTGA 2IX0A 2R93G 3L2PA 3S2DH 4GNXB 1LTLA 3BZKA 1I6HH 1PV4A 5IP9G 3NBHB 1VQHA 5IP7H 2PQAB 4A3IH 5IYDH 4O0AA 5E7NA 3CCQA 2UUAL 3CCLA 1VQGA 4R4CA 1VQMA 3GTLH 1EOVA 2QEXA 4DR2L 4JI6L 3CCEA 4GOPB 3PO3G 1E1TA 4BBSG 4JI0Q 1V9PA 1KIXA 4HIKA 3K81C 1QVGA 3KDFB 4YY3Q 2VQFQ 2KENA 4C2MH 4IOCA 4KI0A 2Y0SG 1VQ6A 1VCIA 1IBLQ 2VL6A 2ALYB 2WAQG 3U50C 2XTIA 1QVFA 1XTDA 4BBRH 2NN6I 1X55A 2WB1G 1FL0A 3TREA 1N34Q 5M3MH 3S15H 4IJHA 4X62Q 4DR6Q 5C0XI 2IX1A 4OWWB 5IYDG 1WYDA 3RNUA 1HR0W 4KHPQ 3HOWG 4GNXA 1BKBA 1HR0L 1VQLA 4DNIA 4NXMQ 1IZ6A 2WB1E 3U4ZA 4DV3Q 4C3HH 3E0EA 4R4QA 4IPDA 4A93G 1KHIA 1YIJA 1UE5A 3GTPH 2OCEA 2N49A 1VQ4A 3TRZA 1IBKL 3AQQA 1KD1C 1VS0A 1A0IA 2FXQA 3M85A 3AFQA 2IT1A 1PH2A 3RN2A 4KLKA 2ATWA 3J7A5 1UEBA 4AIMA 1XNQL 1HNZL 1E1OA 1CKMA 1O7IA 3TS2A 1Q1EA 4A3FG 2ID0A 2F52A 1D7QA 2JA7H 3KJPA 5IWAQ 4EQ5A 5LMUQ 4QL5A 4LW1A 4A3IG 1E22A 3G48A 1E7ZA 3HOXH 4HIMA 3GDEA 3S1RH 4DR7L 1Q8KA 1Q46A 2L15A 1X3FA 2E5LQ 5JJIA 1KL9A 2NVYH 2Q2UA 1Q1BA 1GVPA 4L5SA 4LF9Q 4R4IA 3UE1A 2VQEL 2CWAA 4HJ7A 1S40A 4DV1L 4A3JH 3CD6A 3G71A 4QQBX 1XPUA 2D0PA 4BBRG 2A1AA 1LM0A 4DR6L 4FDBA 4PZ8A 2VQFL 2V1CC 1CKOA 1VQIA 2VS1A 5M3MG 1YHBA 1UE6A 4JBJA 1X9NA 1Q86C 4A75A 1XMQL 1PH1A 4JI4Q 4P75A 2UUBQ 1QVCA 4UP7A 4DV2Q 1C7YA 2VUMG 1TWGH 4UPAA 4C3JH 3G4SA 4JI0L 4B3TL 2QA4A 4BXXH 3CCSA 1W2BA 4DV0Q 1XMOQ 1PA6A 1SFOH 4JI1L 5GAEC 4B3TQ 2C35B 3GTMH 2KCMA 1L1OC 3MEFA 1VQ7A 4TVAB 3UDFA 4A3LG 4X6AH 1T9HA 1Q7YC 2Q2HA 3IRBA 5FLXc 1GM5A 1XJVA 4DR4L 1XMQQ 4A3KG 1K8GA 1VQKA 4B3SQ 1S72A 2VW9A 4MNOA 3STBC 4X64Q 3HOUG 4LF8L 4IFDJ 1YBYA 3ICEA 3I4NG 3FP9A 2VQEQ 1C0AA 3J80i 1GKHA 1J6QA 1IL2A 4QGUA 2JA7G 2E5LL 3J7ZC 5LMNQ 2GVBA 4POFA 3S17H 3I56A 5ELNA 5AJ3L 3CMAA 4A3EH 5JEAJ 2N78A 2F3IA 4K0KL 1H95A 1K9MC 4A3CG 2B3GA 1JT8A
chains in the Genus database with same CATH superfamily
1QUQA 1L2FA 5CV4A 1PFBA 1MBYA 4JCVE 2PNHA 4QUCA 4C3HG 2KECA 3M9BA 4JOIA 3A8KE 2I46A 3J7AV 3S1NH 3Q0AA 3FKIG 2K32A 3L3OC 3A74A 5I2YA 3NP8A 4MTNA 3Q22A 1GUNA 5ELEA 4JI7L 3UDGA 1FYCA 1KDBA 1HUMA 4DK3C 2OWOA 3CKIB 3J7AF 2K6AA 4KJOA 4WJ4A 1AEXA 3RZOB 1I6VC 3Q8DA 1XTCD 1I4PA 2F0EA 2Z0SA 1WTWA 2PZTA 1ZKOA 3I7FA 1I3QH 2K28A 4MZ9A 2NVYB 2ZT9C 3GTGB 1L0YB 3K5LA 1A2UA 1WTRA 5T1IA 1DCZA 3HS0C 1H9SB 1YEZA 3K7UC 2RVLA 5FOBB 3MTSA 2KHIA 2MUYA 3H3VH 3KOJA 4BA2I 4DR1L 4PMCA 2J4XA 4K6DA 1MSHA 3DWAA 3A0JA 1SDFA 4IO9A 3VYRA 4DN4M 3NENA 3S24A 3JAML 4RGOS 2UXDL 2B2UC 1AN8A 1VQ5A 1IBLL 5JJKA 4KN7C 4RGMA 5EBCA 1BBWA 4JI5L 2HIXA 1CSPA 2A74C 3IKJA 1UNSA 1YITA 1JJ2A 3CQZB 3NK9A 3TBIB 4B3RL 1S5DD 4ALPA 4DNRB 1U5KA 5CV8A 3K0XA 1B3QA 2AQ1B 3A55A 3TZUA 5HGTA 3D31A 2UXCQ 4QCLA 1OXTA 2QEJC 3A56A 1GO3E 1QUQB 1BBUA 1CQVA 4JI2L 2B2WA 1JQYD 4DUYL 3HFZB 4OWTB 4U673 3KF6B 4POGA 2ZJPA 1WFQA 5DM63 5J22A 3B6YA 5GAGC 1I5FA 4CKEA 3BDLA 2L1BA 2F0IA 1HHVA 4A3FB 4DK0A 4N8FA 1R4QB 4JI5Q 2CCZA 3K7AH 2F0FA 3OHXC 1NNXA 1IHZA 3I4LA 5AFWA 3HOWH 3BDCA 1HRJA 4HSVA 2HIVA 4DA2A 4LF7L 4DV5L 1Z7TA 2PW7A 5J3BA 1SJED 2OEOA 4UDUC 2WB1B 1G6PA 1NBWA 4IOAA 1GUSA 2CQAA 2XIWA 5C3EH 5G3LF 2PMZB 3VDYA 4A3EG 2F03A 1X3QA 4LUOA 3T1YL 3PO3H 5BN3A 5BN4A 2KQ3A 5ISRA 3C1FA 1Q90A 4KHZA 2K33A 2F0PA 3MXGA 5E4WC 2ZJQA 4KV6A 3NBIA 4DAYB 3J81E 2HCCA 5C4HA 4LFAL 1B2TA 2O4XA 4DAMA 3ZYYX 5JVG3 1V43A 2ZTEA 4BY1G 1MJEA 2EJGC 3PF4A 3U58A 4B3MQ 3DXJC 2CFMA 5DLQE 1Y1VG 1WCMB 2VZAA 4JG2A 5C3XA 2AUKA 2JEBI 3I4OA 3OW2A 4PMBA 4ZCKA 3I90A 1B70B 4AYBB 1A63A 3K57A 1Y8OB 3SXHA 1TWHH 3GTKH 3GQBA 1SYFA 3NTKA 3HOZG 2Y0SE 1VQEA 5I9OA 4XTCS 1O7YA 1CHQD 1FVIA 2K04A 4RGNA 5C4XG 3CPFA 1EQRA 1RL2A 1HA6A 4H13C 1IBKQ 1PHJA 4KY5A 1FNWA 3S14H 3KLRA 2EOTA 1EU3A 1YNXA 2LSSA 3E9HA 4JI8Q 3KJOA 1U4MA 1C48A 2PQEA 3NEMA 2QCPX 5LMNW 4NXNQ 4JK1C 2BE5C 4CHTB 1SNDA 4DXFA 5IT9E 4IPCA 1UUPA 4IFDG 4XT3B 5CC4A 1MJCA 3A7LA 4ME3A 1LTAD 1JOOA 2ZM6L 3VR6A 3GV3A 1CKNB 4B9WA 3MXNB 3S1QB 1YJNA 3GTJH 2K5QA 4L5RC 4XQJA 2XN9C 3NSWA 1V1QA 4GS3A 3CRKC 4P73A 1A6XA 1G2SA 1PZJD 2HHHL 1LABA 1IYJB 3FHWA 3QOLA 1PTOD 4IFDI 2A8VA 4L63B 1IXRA 3EIVA 4LF8Q 1LV9A 1Z9FA 3J80E 4JBWA 4KKSA 1WCMH 2L0CA 1N36Q 3KFUA 1F2MA 2EJFC 5JPMC 5IGFA 4JI1Q 4OWXB 2B8GA 1IW7C 4IPHA 4RCNA 1DM0B 1LUZA 4P74A 1Q82C 4LWCA 4AH6A 1OXXK 4A3KB 4KD4A 4YHHQ 1TWFH 1OXSC 3QJYA 4QY7A 2Z1CA 3PO3B 2KCCA 4DV0L 1XMOL 2QILA 2EY6A 1MSGA 1ILQA 1B53A 4R4OA 4CDFC 4CDCC 4A3BG 1EQTA 2L55A 2ENBA 1X65A 3VA7A 1N9WA 1PVOA 3H91A 3TS0A 3GTQB 3I3CA 1NR4A 4XT1B 3M3YB 3I4NH 5IIFA 4HN7A 3BJUA 1MIUA 1WTQA 1HZBA 4YCUA 2WAQE 4R4TA 3SR1A 4E6IA 1X6OA 2YV5A 2K75A 3M7GA 1PH6A 4K14A 1PH8A 1SYCA 3J81j 1LT3D 4GLVB 2M2LA 3MXPA 1EYAA 2UXCL 2QKIC 1B9NA 4LK1C 1YNJC 4PZ7A 3GTOH 4U68A 5AJ3Q 4BY7B 3TEHB 1QZHA 3R2IA 4X66L 2ICIA 2RDHA 4AQYQ 1EWHA 5FKAC 1RF2D 3FPPA 1AP0A 1XNRL 1EY6A 2AKWB 2EY1A 4OX9L 2NVTH 4RFBA 1NY4A 4DK6C 4C2MB 3ONAB 2A68D 4PMWA 3HOYH 2IX0A 4KMUC 4GNXB 3BZKA 3MC0B 1O78A 3WOFA 4FYDA 1T5XD 1S5CD 5E7NA 4TSSA 4ILWA 2UUAL 4R4CA 4M1UB 4EQPA 3SK8A 3GTLH 1PRTB 2QEXA 3CCEA 3ITPA 3OMCA 4JI0Q 1V9PA 3K81C 3NTIA 1AW7A 3VR4A 1FNUA 2F0LA 1VCIA 1VF7A 4FNFA 2WAQG 2ALYB 3U50C 4BBRH 4B08A 1X55A 3PO2B 5M3MH 1TY2A 4DR6Q 3AU7A 4N9TA 2JP1A 1I3QB 2Q8IB 1WYDA 4OWWB 4NXMQ 5DAUA 4DV3Q 3T16A 1K8MA 5I4DA 4A3DB 5D3DA 1YIJA 3TN2A 2OCEA 1VQ4A 3SE0A 1IL8A 2K1BA 1PH2A 4KLKA 5G3LD 1D5XC 1UEBA 2F0MA 1O7IA 1F9QA 3MAQA 3MWYW 1E2ZA 1I4GA 1L0XB 3NWTA 3KJPA 5IWAQ 4DU9A 5LMUQ 4QL5A 4LW1A 1E22A 3HOXH 4HIMA 1C8CA 1Q8KA 5FK9C 3HOUB 2MGSA 1X3FA 5C4XB 4G7HC 3HOZB 1GHJA 4A3JH 1PXUA 2RSNA 2Q8TA 1XPUA 1M8AA 4DR6L 4FDBA 1CKOA 5M3MG 1UE6A 5A2QE 4JI4Q 1QVCA 2JA5B 4UPAA 4FF3A 2TMPA 3LNNA 5EKKA 5EKLA 1MGSA 3CCSA 1PA6A 4DV0Q 1XMOQ 1JE4A 3T13A 4B3TQ 2C35B 2FINB 4FP5D 3H94A 1L1OC 3UDFA 2PW5A 1SFOB 4X6AH 1T9HA 1Q7YC 2Q2HA 3IRBA 2EYOA 1K8GA 1NR2A 4B3SQ 3S16B 2B2VA 1S72A 3NUCA 3STBC 3BDOA 5C3WA 1SYEA 5DM73 2K03A 3BYYB 3FP9A 5KIXA 2VQEQ 1O80A 3J80i 4MTKA 1GKHA 1IL2A 2JA7G 3I56A 1D5MC 3GTKB 1PRTC 4UHVA 4HAEA 2A69D 1GUTA 5JEAJ 1XYIA 1H95A 4A3CG 4LUZA 2EXZA 3D6WA 1XNQQ 5CGKA 2JXMB 3P75A 4EVOA 3H15A 1FGUA 1K0RA 3CRLC 2R7ZG 2RCNA 1FR3A 1SJHD 3FDTA 4A93H 2FFKB 2H1EA 2KOLA 1BCPC 4Q0FA 3U9SA 3KBGA 4LF4L 1E24A 3MXNA 1DJRD 3KF8B 4LF5Q 2DY7A 5EAYA 3DWQA 1V1OA 2VB3X 3GTPB 2N3SA 4CDDC 2OTJA 2EE1A 2NN6H 4C3HB 2YU9B 2ICEC 1X3GA 4X3SA 1RCVD 4KY7A 4QJFA 1RJTA 1G2TA 1G51A 3NELA 2AQ2B 2NUCA 1LLRD 4P72A 2G9DA 3KLSA 1STHA 3NBHA 5IT9c 2R93H 1NCVA 3HKSA 5EKIA 1S5ED 2F0WA 2JE6I 2OXPA 2QW7A 5IP9H 5IP7G 4KKTA 3RLNA 2E2IB 4OONA 1LTBD 1C9OA 5GADC 2AMCB 1EIYB 5EGTA 1W6JA 1VQNA 4A3FH 4TQUS 3URYA 4C3IG 1KRTA 2MHVA 1CUKA 3T1HQ 2K4KA 1XPRA 4DV7L 2NWGA 4GLXA 2X6LA 2ZXOA 2R92H 5I9PA 3S2DB 4BBSH 4A3BH 1YNJD 4DV7Q 1B8AA 3BVZA 3CCVA 4LUVA 1CZWA 2MP1A 4KKUA 1XPOA 4RKBA 3S2HH 3E5SA 3ULJA 2PMZE 2MQHA 1V1PA 2UXBQ 5GAHC 3IL8A 2HHHQ 4RAUC 2YTXA 4JI7Q 1JWSD 5M3MB 1WJJA 2H5XA 3BG3A 1BR9A 1EYDA 5C5LA 2PO4A 3CU7A 2UUCL 1GD7A 1PTOC 3M7NA 1CT1D 5C44B 3RD4A 1VQPA 1LO5D 4OXPA 4Y7NB 1I4XA 3W1BA 1WI5A 2O5JC 1EWIA 1VQCA 3TP8A 4C3JG 4LFCQ 4NB3A 4OO1I 3CC7A 1HNXL 2B2VC 1J9OA 3PO2G 1S5BD 5DEHA 1RKNA 4Y7NH 4A3MG 4DR3L 1QE6A 1CM9A 4UP9A 1QWYA 2Y0SB 4DF7A 4JV5Q 2EYJA 1L1OA 4NMZA 3T1HL 1SMXA 3SDZA 3R2TA 3DM3A 3GTGH 3M4PA 1B4OA 1BXTA 1WTVA 1GUGA 2NTSA 4K5WA 4DGZA 1PH3A 5KNCA 4JC0A 2Z8LA 4BY7H 4RHRA 3S2HB 4HJ5A 1VQJA 1CI3M 1DXMA 4IJLA 2DNEA 4P71A 1S4ZA 4WJ3M 2K7VA 2L12A 5IGBA 3IFDA 1TS5A 5C4JH 1D2BA 4A3JG 4PZ6A 4CJ2C 3EJIA 2I5HA 1SE2A 3GO5A 1TWAH 1PH5A 3HOYG 3JC66 3A5UA 4DV1Q 3I4NB 1Q3LA 1PH9A 1PFNA 1PRTF 1II3A 5C4ZA 1SYGA 2WFWA 4X66Q 3EQLC 5FO7B 1SMYD 3DUZA 3S17H 1A8VA 2A6HD 3R3OA 2I5MX 2OQ0A 1PH7A 2NZ1D 2N88A 2PZUA 1HNWQ 2BA0A 2LXKA 4IQZA 1GUOA 3K80C 2EDGA 1NE3A 1QNUA 4DUYQ 4XQQA 3E9IA 3PIOA 2F3VA 2AWNA 1PH4A 1W3SA 3FMCA 1N32Q 1Y1WG 2MNAA 3OWFA 1L1OB 2F0SA 2NBFA 4Y52H 1ENCA 4O2DA 2DGYA 1LTSD 1A3TA 1JR0D 3MFYA 3FRPB 1F2ZA 1BQQT 1ML0D 1BDOA 1Q81C 2A73B 1IKMA 3HKZG 3UDXA 3F2BA 1VQ8A 1QILA 2MJ8A 2F0JA 4ZRZA 3NPPA 4G7OC 4L8JA 2NTTA 2YTYA 4HEDA 5FLMG 2M9VA 4OO1H 1EIFA 1KRSA 2E2JH 4IUTA 2ZTDA 4ZK9B 2RQXA 1J8IA 2N55A 5F2DA 1VQBA 2UUCQ 2JK8A 1NMGA 1ONLA 4JI3Q 4NP5A 2HUGA 2FMMA 3L9AX 2KEDA 1JORA 2PQAA 3OPOA 3PUXA 3QR8A 2EYHA 3S1QH 1VQ9A 3TMEA 2FJ2A 3J81L 4NW2A 4B9XA 1EFWA 1HTPA 2EYPA 3TSSA 1JOKA 4J6HA 1VMCA 1N34L 4OX9Q 3K5NA 4LF9L 3E3XA 1ZYRD 2WV6D 2R61A 2Q8RE 5HY6A 5M5WB 2NN6G 5E3FA 1I4HA 3PUZA 1N36L 4RWSC 4GZYC 1ESRA 3PUYA 1NUCA 3F8TA 4CKBA 4X3UA 5M9OA 2HQLA 3KK7A 5E1FA 4CJ0B 1D5ZC 1HNWL 1STYA 3H0GG 4IURA 5K36G 4K6LA 2Z6BA 4JI6Q 4WORA 1K3BC 2RBMA 2UUBL 2CW0C 1TY0A 3HOZH 2GVAA 4OGQC 4YCWA 4GLAC 4WFN3 2K01A 1L0WA 3WWVA 1SBBB 5C4XH 2VUMB 2JA5G 1IW7D 3S15B 3EA6A 2ES2A 4X65L 1HH2P 3KDFA 4DR1Q 3SEBA 1EOTA 2E76C 1BNZA 1JT8A 3N6RA 4X65Q 3NE5B 2CW0D 3VYUA 1HTLD 1D8LA 2F0HA 3TQYA 4CGYB 4ZLTF 2UXDQ 5JJLA 4G57A 2QGQA 3L7ZC 2PI2A 1CKNA 1S5FD 4DUZL 1DYQA 2HDMA 3F2UA 2A68C 3HZXA 3RMHA 5BN5A 5FLXE 1N33L 1N8RC 2XGTA 4A3GB 5IGEA 1LTID 3PUVA 3SHLA 2AQ3B 3SK6A 1EYCA 4YWMA 2HCIA 2O2LD 4JI8L 1PRTD 1Y1WB 3C1EA 1SE8A 4UY8C 3VA5A 3M4OB 1Y8NB 2B2WC 4HR7B 4IPGA 1JB7A 2XRQD 1JJCB 4BS9A 2KCTA 4L5QA 1JOQA 1K83H 5C5MA 2RHSB 5ELOA 4HSPA 3HRZC 1VDZA 4YY3L 1QNKA 3KLSX 2FHTA 2A6EC 2IL8A 1NTGA 1CFMA 2E2HB 5KEEA 3QG1A 3T51B 3S2DH 2M00A 3LWUA 2R92B 5IP9G 4K5XA 3NBHB 5IP7H 2PCFB 1SNPA 4A3IH 3CCLA 1BBXC 1VQGA 1VQMA 4JI6L 4GOPB 4XDXA 2XRSD 1E1TA 4C56C 2XNAC 2B2YA 4KI0A 2Y0SG 1EWCA 2D5DA 1IBLQ 1KNAA 3GP7A 2WB1G 3S15H 1WVLA 2F0OA 5L37A 3RNUA 4KHPQ 4GNXA 1HR0L 1NSNS 4DNIA 3EROA 3U4ZA 3C2PA 2NB0A 4C3HH 4R4QA 3GTOB 2DN8A 3IFTA 4IPDA 3FKIB 4ZYSA 4A93G 2KA7A 3VYTA 2EVBA 4WJWA 2ZXRA 4I7ZC 4RCOA 2IT1A 3MFGA 3J7A5 4AIMA 3N52A 5CBEE 1CKMA 3TS2A 1B44D 4A3FG 2JA7H 4HMIA 4A3IG 4FVMA 2SDFA 4C1NK 2L15A 3P7JA 2NVYH 4KJNA 4O42A 4L5SA 3HKZB 4HJ7A 3CD6A 2CWAA 4DV1L 3J7YW 1VF5C 2A1AA 1TVXA 1VQIA 2CH4A 4JBJA 1BF4A 1C7YA 2VUMG 4JI0L 1H9JA 4X3TA 2E2JB 4HCEA 4F7XA 2HQEA 4A3LG 1VQ7A 4TVAB 1QB5D 1XJVA 4DR4L 4A3KG 1VQKA 3E0JA 4JPBW 1AZQA 3HOUG 4IFDJ 3ICEA 3BYTB 3I4NG 2GA4B 1ZYRC 4QGUA 2E5LL 3J7ZC 2GVBA 4POFA 4A3JB 3GTJB 4A3EH 2N78A 1K9MC 5J1ZA 3OOCA 3HOUH 2EXDA 3I2ZA 5IYCH 2YYZA 4GNXC 2I0QA 3LWEA 4DKAC 4DV2L 4V190 5BR8L 1D1IA 4EQNA 2B8FA 1HQRD 5BR8Q 1VQFA 5KRUA 5JEAG 2F0KA 2J0TD 1W6KA 4FXGC 1KDAA 1HZCA 4EGVA 4C3JB 4IUQA 2JQOA 1EY0A 2Z9HA 4PG3A 5KGUA 4NXML 4A3DH 5KNDA 1HNXQ 5FLMH 1ASZA 4C3IH 1RD9D 3JAMi 1HNZQ 1KDCA 5D65A 3I55A 3D6CA 4QIWB 5LL6X 5IYBG 4G4KA 1DGSA 2ZTCA 4K0KQ 4CDEC 2E2DC 2DJFC 3KLWA 3V2TA 1EY7A 3WDNA 1OXUA 1EQQA 4H02A 4RH6A 2UU9Q 4OIJA 5D3IB 3P1HA 1MKHA 1JWMD 3D8GA 4RMFA 2B2TA 4XYOA 4KHPL 2OTLA 2B2UA 2C5CA 1VQAA 2NVQH 2DNCA 1CQFA 1QZGA 1WCMG 1LYLA 1FJGQ 3WOEA 5A2QL 3TZDA 1STGA 4JBKA 1R9TH 5C44H 4RHSA 1CA5A 3UE0A 3D4DA 3FPUB 3F2DA 4A3GG 3F2CA 1WTXA 5CBAE 5GROA 4ID6A 3C3LA 1EEID 5HGQA 2D0OA 4GOPC 1PYWD 2SOBA 3SVMA 3U9OA 5IWAL 3PCOB 3NQIA 3W2DA 3UI2A 4HJAA 5IYCG 3ERQA 2D9UA 3PMFA 1PFSA 1SROA 4IZ8A 4NPSA 2PI2E 1I94Q 4M8AA 2F4VL 2K5NA 3K5MA 3PF5A 1X56A 3I8ZA 5EPLA 3H3VI 1EIHA 2EYMA 2B29A 1ENAA 2K50A 3T4AC 3SGIA 4LFBQ 1SLJA 5IE8A 3J81c 1EU4A 1KC8C 2E2HH 3J80c 2XVSA 4LFBL 1GUWA 1YJ9A 1K83B 1G8ZD 2R7ZB 4LF6L 3H3VC 3KYHC 1RTOA 1J5EL 1RIPA 3I4MH 1OTCA 3M4OH 2BDNA 4DNTB 1Y1WH 1G91A 5IODA 2KUMA 2E8GA 3DMUA 5IY0A 2VXWA 1R4PB 4TRDA 2EPBA 1SXTA 4J1MA 3CP0A 1R9TB 1SAPA 1X3PA 1Z6HA 4FO2A 3S9WA 3AB9A 1EL0A 2R7DA 1IBMQ 1C4QA 4YIJA 5JVH3 3FVQA 2A19A 5JEAH 2N8NA 2NVQB 2JN4A 3OIQA 4YWLA 2IJ0A 1CSQA 4XYQA 5FJ8G 5IGCA 2TSSA 4BA1I 3C46A 4DV4Q 3JAMc 1VQDA 4QB4A 5CV7A 4A76A 4R8IA 1U4PA 1YHAA 3DLLA 2R6GA 2NVXH 1JB3A 2CQOA 2D62A 2QF7A 3ER0A 1O7LA 2UU9L 3OTOL 1Y69U 4XQNA 4I65A 2VUMH 4DR7Q 1KAAA 4HCSA 1IYVA 1SE3A 4L5TA 3AEVA 5M5YH 4MHEA 1J5EQ 2F3WA 4IN3A 3A54A 2BA1A 3PGZA 2B2TC 3SK5A 1Q8IA 4FXDA 1ESFA 1JC7A 1EZ6A 1I50H 1TS3A 3RUZA 3DWPA 3Q24A 1M4VA 2HT1A 2RHQB 5M5WH 4A4IA 2IX3A 3HGBA 2IWHA 1I50B 3T56B 1FNVA 1UE7A 2F4IA 4DV6L 4JI2Q 3OIPA 1AE3A 3EN2A 2Z4IA 2C9OA 3S14B 1EYGA 2JA5H 4A3DG 1T5EA 1JMCA 1E2VA 3X3MA 3ZJYC 5M5XH 4IUVA 3CXCA 1O7ZA 3HOXG 1SN8A 5NUCA 1YVCA 1RDPD 1PFMA 5EBDA 2NVXB 5E4XA 2IHEA 4KTAA 4YCVA 3VR2A 3J81i 1FJGL 2R3ZA 5KNBA 2L4NA 2YTVA 1K0SA 3AFPA 1YNND 1G291 1WOCA 2SNMA 1ET9A 1PZID 2DY8A 4J15A 1GJXA 3BVMA 3CF5A 5CV9A 2MO0A 4JI3L 2EYFA 4LF5L 1DD2A 1UWVA 1A15A 4LMQD 2Q2TA 1KLGD 4GN3B 3MHBA 1PMRA 4B3ML 1NMFA 1PZKD 4DV6Q 3KF6A 3S1RB 5CMDA 4JYAL 1K8OA 3JAME 3S17B 2KEEA 4NXNL 5C3EG 3I4MB 4KHVA 1ICWA 2JSOA 2XWJB 4PNYA 4GN4B 1EUJA 2B2YC 3K58A 2Z6KA 1TWAB 3ND8A 3QOJA 4L6TB 4UP8A 3HOVG 4QF4A 5IT9L 1F77A 4HJ9A 4LFCL 4LF4Q 1ILPA 5FLXL 1JWUD 3AYHB 4LAAA 4A3LH 3I91A 1WTOA 3V96A 4JOIC 2BCOA 1U4LA 1SNMA 1N32L 2K5DA 2BH8A 2IHFA 2MO1A 4DR3Q 3DM1A 1TU2B 4B3RQ 5DNFA 4ZQ3A 2EJMA 2EY2A 2QDBA 2ZJRA 3R8BA 3CAMA 2LY7A 5ELCA 5M3FB 4KK7A 3KBXA 3MVVA 2F0NA 3EVQA 3RLFA 4X64L 1SYDA 4JYAQ 3I4MG 1F2LA 4EX5A 1U0LA 4A3MH 4IALA 4ULLA 5C6AA 3L2PA 1ICFB 4WRDA 2EY5A 2PQAB 2WAQB 1EOVA 4S3SA 1EY9A 1STBA 2RCFA 1QVGA 1STEA 3KDFB 4IUNA 5CV5A 1VQ6A 3OSOA 2VL6A 1QVFA 2A6ED 3D4WA 4NDXA 3MZ5A 3TREA 2I07B 5EQ0A 1N34Q 4IJHA 4X62Q 5C0XI 2LFNA 5IYDG 1BKBA 1VQLA 3K5OA 3PIO3 1IZ6A 3S1MB 2WB1E 3VYSA 3E0EA 1TS2A 4X3KA 3TP6A 1UE5A 5JJZA 5EPJA 4Z9CB 2BOSA 3TP5A 2F0TA 1TWFB 3TRZA 2JYOA 1IBKL 3AQQA 1KD1C 1VS0A 1A0IA 2FXQA 3M85A 1U9RA 3SK4A 3RN2A 4H0LC 1TWCB 1XNQL 1E1OA 3S1NB 2ID0A 2F52A 1A2TA 1D7QA 3TP7A 4EQ5A 5HURA 2E5LQ 4KD3A 4O1NA 3QWNA 2Q2UA 1Q1BA 3QIAA 4LF9Q 3UE1A 3MEHA 4PV1C 3D3RA 4QQBX 2D0PA 5M5XB 1LM0A 4ZUJA 2P5ZX 1MI2A 1HUNA 1G6ZA 1YHBA 4DAPA 4A75A 1XMQL 1PH1A 2UUBQ 1CK1A 2KVMA 4UP7A 2Z4HA 4DV2Q 1TWGH 4R8NA 4CKCA 4ZAIA 4BXXH 1W2BA 4JI1L 5GAEC 3OMGA 4K5VA 5K5PA 4BY1B 1V8QA 2XSCA 3A8JE 3D4RA 3GTMH 3MEFA 4ZKCB 4OHJA 4OIKA 2AUJD 5FO8B 2WKDA 5CYUA 1AZPA 3TDQA 4EQOA 1Y1VB 4MNOA 3K59A 2OF1A 3W3AA 1C0AA 5M5YB 1J6QA 4V0BA 1EY8A 5LMNQ 3E6ZX 1HXYD 5AJ3L 5ELBA 1K28A 4RKLA 3DEOA 4K0KL 4ABNA 2L5TA 2KHSA 4AQYL 1KAWA 1Y1VH 3S16H 4RA8A 4DUZQ 1X54A 1PTOB 1SR3A 3MXUA 4CBVA 2BH2A 4YWKA 3G6EA 2RF4A 1X32A 3L0OA 5I6YA 4DPGA 3PUWA 4BY1H 1KTKA 5GQOA 1EY5A 2VY3A 1TQOA 1V1PB 4DXGA 4DV3L 1RODA 1SRUA 3GD7A 4HTHA 5C44G 2KJXA 2EYLA 1B3AA 1VMPA 2JA6G 1JCKB 2UUAQ 2JA8G 4A3CH 1HR0Q 2O5IC 3CW2C 2IY5B 3H09A 4IUPA 3BZCA 4R9WA 2OQKA 4HMJA 2DUDA 3V05A 3G7LA 2VB2X 3PIPA 2MPMA 3ULPA 2F0UA 1IKLA 3LGJA 2WINB 1TS4A 1KLUD 2FMCA 3K8AA 1EFID 3CCMA 1WD0A 1B7YB 3BU2A 1SSOA 1EQVA 1ASYA 3CCJA 1TXYA 4ME5A 1H9SA 2R7ZH 1CZGA 2A6HC 2F0GA 1TWCH 1S3OA 3NXWA 1XXGA 3D0FA 3NTHA 2CWPA 4F88A 4X62L 3BVGA 5C4JB 1F9SA 4KY6A 4I7AA 3K0YA 4DFAA 1I6HB 1BCPF 2GN5A 3HP3A 3IAYA 1P8LA 2G5DA 1DOMA 1OO9B 3T53B 3KF8A 5IOCA 4J8QA 1HQMC 3I70A 1XNRQ 3NQTA 1M1KC 1DOLA 1B50A 2KHJA 2LMCB 2WP8J 1H9RA 4QIWE 4QUFA 1NJIC 1BCPB 3PO2H 1F2YA 4DV5Q 3HOVH 2I5LX 4BBRB 3CQZH 1D1KA 4LJZC 4A3GH 2NZHA 4BXXG 3OYYA 1JICA 3VR5A 1VQOA 2F1MA 4JV5L 3STBD 2JEAI 3GTLB 1TT2A 2RKSA 2H4OA 2A5HA 2L9HA 4RG1A 1JE5A 2SNSA 2F0VA 1K3RA 3PQIA 4K2KA 3RZDB 2A69C 4A3MB 5LMUL 4DAVA 5K36H 3X3NA 2K14A 2JA6B 2JA8B 5ELFA 1SNOA 4P2CB 2NVTB 1Z47A 5M3FH 3ERSX 2K05A 5H1SE 1KQSA 5IYBH 1KABA 1NAPA 3PV0A 5COYA 4YHHL 2F4VQ 1F9RA 4OO1G 4IFDH 2PNRC 3BZDB 3HKZE 1MD2D 4XXEA 1OXVA 3H6MA 5T1GA 3RZOH 5LMNL 4BBSB 2SEBD 2J7ZA 4LFAQ 3CC4A 1PTOF 1UEAB 2F0DA 2PYKA 5LHY1 4C1NI 1F9PA 3CC2A 3M4YA 4DAYA 3H0GH 3DHQA 3M3YH 1XX8A 4LF6Q 3Q6SA 1QG7A 1WTPA 3GTQH 3QB3A 2E2IH 3NHHA 3QO2A 2F0QA 3CCRA 1TKWB 1B9MA 2K5WA 2HDLA 4LF7Q 1HZ9A 5C0XH 1SYBA 4DR5L 1M90C 4TKOB 1LTTD 2YU9H 5EJWA 2D2CC 1HZAA 2NZOA 2K5HA 4GN5A 1PDQA 3ND9A 3Q23A 3BS1A 3RN5A 3CCUA 4A3KH 3KUPA 3OTOQ 3R93A 1HFGA 1YZ6A 1YJWA 3PSIA 3ULLA 1MHWC 2K52A 5C0XJ 4HJ8A 1UE1A 3W5OA 4A93B 1TIID 2ZXPA 3P20A 4B3SL 1PYBA 1PTOH 1Q12A 2Z6KC 5D14A 4ZKBB 4R1JA 1K8AC 5EPKA 2B39A 4DR4Q 1DONA 2RDGA 2RSOA 1X3EA 3UDIA 1IBML 4DR2Q 3T1YQ 1YI2A 1IYUA 2AHOB 1QJOA 1JJGA 5CR3A 2UXBL 4APVA 4AYBE 2B63G 1HJPA 2JJQA 2LXJA 3W1GA 3OW7A 1EIGA 5C0XG 3CPWA 4MIUA 2JA7B 1GHKA 1YNNC 5JOBA 4Q5VA 2R92G 1BCPD 1LT6D 1CHPD 3GTMB 3H0GB 1BOSA 2HD3A 1BO0A 5CORA 1STNA 1SEBD 2EZVA 1LTRD 1LACA 5I2XA 1WD1A 1AE2A 1EZ8A 2X6GA 5ELDA 4CJ1B 4NKLA 1HPCA 1TWGB 2AWOA 5M3FG 4XIGS 2EIFA 3FKIH 4QMGA 1DOKA 4LNQA 3I72A 3U4VA 4HIDA 1I4RA 4JI4L 1BUVT 3GV6A 1E3PA 1TWHB 2PZWA 4MN3A 2RA4A 2IPKD 2OT2A 5KYLA 1YHQA 4GKJQ 2QDLA 1DZ1A 2WACA 4KN4C 1P16A 4HIOA 1A62A 1PYSB 1AH9A 3EBEA 3HOXB 2WKCA 4OL7A 4BY7G 2JA9A 3A5ZB 3M4QA 5JAVA 4GKKQ 4JBMA 2JA6H 2JA8H 1N33Q 3LX0A 2Q2IA 3CMEA 4GOPA 1LT5D 2B63H 4PQXA 3RR5A 3RZDH 1U4RA 3F1ZA 4OEMB 4A3IB 2K5VA 4FF4A 2ZM6Q 2KBNA 4DR5Q 1Y8PB 1A3VA 2VNUD 1HFNA 4F87A 5A35A 3S1MH 2MFIA 1BVSA 5C3EB 4K8IA 4UAIA 2ASBA 4H7BA 3HOVB 2G9HD 4DV4L 1KXLA 3RLOA 1I4QA 2EQSA 4GKJL 2CVRA 4GKKL 2CKZB 1K73C 3HOWB 2R7FA 1Y14B 5FJ8H 4K2LA 4AYBG 1I94L 1RHPA 3K7AB 4A3BB 3CHBD 2R93G 1I6HH 1LTLA 3A7AB 1H9MA 1PV4A 3DEPA 1VQHA 2IW3A 5IYDH 4O0AA 2E74C 3CCQA 3J80L 3PIP3 2CH4W 4JW0A 5FO9B 4DR2L 2BE5D 3PO3G 3I73A 3VR3A 4BBSG 1GXDC 3HOYB 1LT4D 2DJGC 1E2WA 1KIXA 2B63B 4HIKA 4OELB 4ODGA 3K6OA 4YY3Q 2VQFQ 2KENA 4C2MH 4IOCA 4ZUIA 4N8X1 2XTIA 4N9PA 1SNQA 3FEWX 1XTDA 2NN6I 1FL0A 4FF2A 2R93B 1PLFA 2L11A 2NYZD 4FXKC 3HEJA 2IX1A 1HR0W 3HOWG 3MA2B 2V4DA 1KHIA 5J39A 3GTPH 2N49A 4DK1A 4BWGB 2XWBB 5TSSA 1KNEA 3AFQA 1ET6A 2PPBC 2ATWA 1H9KA 1RTNA 2BDOA 2X69A 2WIIB 1HNZL 5CV6A 1Q1EA 3OWEB 2RDFA 2CHBD 1FGBD 2KCNA 1TR5A 3G48A 4JVZA 1E7ZA 2LKVA 1SMYC 3S1RH 3GDEA 1CA6A 4DR7L 4RGTA 1SE4A 1Q46A 5JJIA 1KL9A 1GVPA 4R4IA 2VQEL 1S40A 1QOHA 3G71A 4C3IB 4BBRG 4FF1A 4PZ8A 2VQFL 2V1CC 2VS1A 1XWEA 1Q86C 1X9NA 3HG9A 4P75A 1D6EC 3A8IE 1FD7D 1E0BA 4G7ZC 4C3JH 3G4SA 5IGGA 5LL6S 4B3TL 2QA4A 1EEFD 1SFOH 4K8JA 5KYIA 4F8MA 2KCMA 1LTGD 1ENFA 1ZXTA 3O13A 1UAPA 1GM5A 1B1ZA 5FLXc 1XMQQ 1STAA 3EFXD 4H44C 5IGDA 1GOZA 1CTMA 2VW9A 4IUUA 4X64Q 4LF8L 1YBYA 1HA5A 1HCZA 5I6WA 4A3EB 1AFPA 1WTHA 1A3UA 3NWSA 1EY4A 1SNCA 5ELNA 1ZEQX 3CMAA 1QCBD 2F3IA 2E75C 2LS01 3G6JB 5JPNC 2B3GA 3AMUA
chains in the Genus database with same CATH topology
3HOUH 4AQYL 1QUQA 2EXDA 1KAWA 1L2FA 1Y1VH 3I2ZA 5IYCH 1XNQQ 2YYZA 4GNXC 2I0QA 3S16H 3H15A 4JCVE 2PNHA 4DUZQ 1FGUA 1K0RA 1SR3A 1X54A 2RCNA 4DKAC 2BH2A 4YWKA 4DV2L 4JOIA 3M9BA 2R7ZG 5BR8L 3G6EA 2RF4A 4A93H 3S1NH 3FKIG 3L0OA 4DPGA 3PUWA 4BY1H 5GQOA 3A74A 5BR8Q 4MTNA 1VQFA 2VY3A 5JEAG 4LF4L 1E24A 4DV3L 1SRUA 3GD7A 3KF8B 5C44G 4JI7L 3UDGA 4LF5Q 5EAYA 1HZCA 4DK3C 2OWOA 2JA6G 2JA8G 2JQOA 2N3SA 4PG3A 1HR0Q 2UUAQ 4A3CH 2OTJA 4NXML 4WJ4A 3CW2C 4A3DH 2IY5B 1HNXQ 3Q8DA 3BZCA 5FLMH 2OQKA 2DUDA 1ASZA 1X3GA 2Z0SA 4C3IH 4QJFA 3JAMi 3I7FA 3PIPA 1G51A 1I3QH 3NELA 1HNZQ 3ULPA 3I55A 4P72A 4MZ9A 1MJEA 3LGJA 5IYBG 5IT9c 2R93H 3HKSA 1DGSA 2ZTCA 3K8AA 3CCMA 4K0KQ 1YEZA 2JE6I 1B7YB 3BU2A 3K7UC 3KLWA 5IP9H 5IP7G 1ASYA 3CCJA 1TXYA 1OXUA 1EQQA 4H02A 3RLNA 2UU9Q 2KHIA 4OONA 2R7ZH 3H3VH 3KOJA 4BA2I 1MKHA 1C9OA 5GADC 4DR1L 4RMFA 2AMCB 1EIYB 4KHPL 1TWCH 1S3OA 2OTLA 1VQNA 4A3FH 4TQUS 3T1HQ 1KRTA 1CUKA 3D0FA 2K4KA 1VQAA 2CWPA 1XPRA 2NVQH 4X62L 3A0JA 4DV7L 4GLXA 2R92H 4IO9A 3NENA 3S24A 1WCMG 1QZGA 4BBSH 1LYLA 4A3BH 2UXDL 2GN5A 1FJGQ 4DV7Q 1VQ5A 1B8AA 1P8LA 3CCVA 1IBLL 5JJKA 4JI5L 4JBKA 1BBWA 1R9TH 4LUVA 2HIXA 1CSPA 5C44H 1XPOA 3S2HH 4A3GG 3UE0A 3F2DA 3ULJA 2PMZE 2MQHA 3F2CA 1YITA 2UXBQ 5GROA 1JJ2A 5GAHC 1XNRQ 5HGQA 1M1KC 2HHHQ 2D0OA 2YTXA 4GOPC 4B3RL 4JI7Q 2KHJA 4ALPA 2WP8J 5IWAL 3PCOB 4QIWE 1NJIC 3PO2H 1WJJA 4DV5Q 1U5KA 2I5LX 3HOVH 4HJAA 3K0XA 2H5XA 3CQZH 5IYCG 1PFSA 1SROA 3D31A 4NPSA 2UXCQ 1OXTA 2PI2E 1I94Q 2UUCL 1GD7A 2K5NA 2F4VL 3M7NA 4A3GH 1GO3E 2NZHA 4BXXG 3OYYA 3PF5A 1QUQB 1X56A 1BBUA 1VQOA 4JI2L 1VQPA 3H3VI 4OXPA 4JV5L 3W1BA 1WI5A 3HFZB 2B29A 1EWIA 1VQCA 4OWTB 3STBD 3KF6B 4DUYL 2ZJPA 4POGA 2JEAI 1WFQA 2K50A 4LFCQ 4NB3A 3B6YA 5GAGC 3SGIA 1I5FA 4RG1A 4LFBQ 1JE5A 1SLJA 5IE8A 3J81c 3CC7A 4OO1I 1KC8C 1HNXL 1K3RA 4JI5Q 2CCZA 3K7AH 3J80c 2E2HH 3PO2G 4LFBL 4Y7NH 5LMUL 4A3MG 1YJ9A 4DR3L 2K14A 4LF6L 3HOWH 3KYHC 4UP9A 4JV5Q 1J5EL 1RIPA 1Z47A 1L1OA 1OTCA 3I4MH 2HIVA 3T1HL 1SMXA 5M3FH 4LF7L 3ERSX 3M4OH 4DV5L 1Y1WH 5H1SE 3DM3A 1KQSA 3GTGH 5IYBH 3M4PA 5J3BA 3PV0A 1G6PA 2E8GA 5IY0A 1PH3A 1NBWA 2F4VQ 4JC0A 4YHHL 4IOAA 5C3EH 4BY7H 4OO1G 4HJ5A 3VDYA 3CP0A 4A3EG 4LUOA 1VQJA 3HKZE 1OXVA 3T1YL 3PO3H 4IJLA 4P71A 2R7DA 1IBMQ 3RZOH 5LMNL 4KHZA 4WJ3M 4LFAQ 3CC4A 2A19A 5C4JH 2ZJQA 2N8NA 4A3JG 4PZ6A 4YWLA 4DAYB 2I5HA 3GO5A 4DAMA 1TWAH 1CSQA 1PH5A 4LFAL 3HOYG 3CC2A 1V43A 2ZTEA 3JC66 4BY1G 5FJ8G 3A5UA 3H0GH 4DV1Q 3U58A 1PH9A 4BA1I 3PF4A 4LF6Q 3M3YH 4B3MQ 2CFMA 5DLQE 4DV4Q 3GTQH 1Y1VG 3JAMc 1VQDA 2E2IH 2WFWA 4X66Q 4A76A 2VZAA 1YHAA 4JG2A 3DLLA 2JEBI 2R6GA 1A8VA 3I4OA 3OW2A 2NVXH 2CQOA 2D62A 3ER0A 2I5MX 2OQ0A 3CCRA 1PH7A 1B70B 2UU9L 1A63A 3OTOL 1HNWQ 2BA0A 2VUMH 2LXKA 4DR7Q 3K80C 4LF7Q 1NE3A 1TWHH 1HZ9A 4DUYQ 3GTKH 3HOZG 3E9IA 2Y0SE 1VQEA 3PIOA 4DR5L 2AWNA 4XTCS 1PH4A 1M90C 4L5TA 1W3SA 1FVIA 5C4XG 2YU9H 3AEVA 1N32Q 4LUZA 5M5YH 3CPFA 1Y1WG 1EQRA 2MNAA 1RL2A 1L1OB 1J5EQ 1HZAA 2BA1A 2NZOA 2K5HA 3PGZA 1PHJA 1IBKQ 4Y52H 4GN5A 4O2DA 3S14H 3RN5A 2DGYA 3CCUA 4A3KH 1YNXA 3OTOQ 2LSSA 3E9HA 4JI8Q 1I50H 3KJOA 1Q81C 1YZ6A 3HKZG 1YJWA 3PSIA 3NEMA 3UDXA 2RHQB 3ULLA 3F2BA 2K52A 5C0XJ 5LMNW 1VQ8A 2HT1A 4HJ8A 5M5WH 4NXNQ 1UE1A 3W5OA 2YTYA 4A4IA 5FLMG 4B3SL 4IPCA 1PYBA 1UE7A 1EIFA 1KRSA 4DV6L 1Q12A 2E2JH 4IFDG 2Z6KC 4JI2Q 1MJCA 2ZTDA 1AE3A 3EN2A 4ME3A 4R1JA 1K8AC 1EYGA 2JA5H 1VQBA 2ZM6L 2UUCQ 4DR4Q 2JK8A 1JMCA 4A3DG 1NMGA 4JI3Q 1CKNB 1X3EA 3MXNB 3UDIA 3ZJYC 5M5XH 1IBML 1YJNA 3GTJH 2PQAA 4L5RC 3PUXA 3CXCA 4DR2Q 3T1YQ 1V1QA 4GS3A 3HOXG 1YI2A 3S1QH 4P73A 2AHOB 1SN8A 1VQ9A 1JJGA 2UXBL 4APVA 1YVCA 4AYBE 2B63G 2HHHL 1HJPA 1IYJB 2JJQA 3FHWA 4IFDI 1EFWA 2A8VA 2LXJA 2IHEA 3W1GA 1IXRA 3EIVA 4YCVA 5C0XG 3J81i 3CPWA 1Z9FA 4LF8Q 1FJGL 1N34L 4OX9Q 4JBWA 1WCMH 1N36Q 4LF9L 3KFUA 2YTVA 2R92G 3AFPA 5HY6A 2NN6G 1G291 1WOCA 3PUZA 1N36L 4JI1Q 3PUYA 4OWXB 3F8TA 4IPHA 1LUZA 4P74A 1AE2A 1Q82C 4J15A 4LWCA 4AH6A 1OXXK 2HQLA 3CF5A 4YHHQ 1TWFH 2MO0A 2AWOA 1HNWL 1OXSC 3H0GG 4JI3L 5M3FG 4QY7A 4XIGS 4LF5L 5K36G 2EIFA 3FKIH 4JI6Q 1UWVA 2Q2TA 4DV0L 1XMOL 4LNQA 3U4VA 4HIDA 4JI4L 2UUBL 4GN3B 3HOZH 1E3PA 2GVAA 4YCWA 4GLAC 4B3ML 4GKJQ 1L0WA 3WWVA 1NMFA 5C4XH 1YHQA 4R4OA 4DV6Q 2JA5G 1P16A 4HIOA 4A3BG 3KF6A 1A62A 1PYSB 1AH9A 3EBEA 4JYAL 2ES2A 4NXNL 5C3EG 2JA9A 3A5ZB 4BY7G 1X65A 3M4QA 4X65L 1HH2P 1N9WA 3KDFA 4DR1Q 4GKKQ 1PVOA 4JBMA 2JA6H 2JA8H 3TS0A 1N33Q 2Q2IA 3CMEA 4GOPA 2B63H 4GN4B 4X65Q 3I4NH 1EUJA 3RR5A 3BJUA 3RZDH 2Z6KA 1MIUA 4UP8A 3HOVG 1HZBA 4YCUA 3F1ZA 1D8LA 2WAQE 4R4TA 3TQYA 2UXDQ 1X6OA 2YV5A 2K75A 2K5VA 4LFCL 4HJ9A 1PH6A 1PH8A 2ZM6Q 4LF4Q 3J81j 5JJLA 2QGQA 3L7ZC 2KBNA 4GLVB 2PI2A 3AYHB 4DR5Q 1CKNA 4DUZL 4A3LH 2UXCL 4JOIC 3GTOH 4PZ7A 1N32L 2VNUD 2BH8A 2IHFA 1N33L 3S1MH 2MO1A 2XGTA 1N8RC 4DR3Q 5AJ3Q 2MFIA 1BVSA 4B3RQ 3TEHB 1QZHA 3PUVA 4X66L 2ASBA 2ZJRA 4YWMA 3CAMA 4AQYQ 4DV4L 4JI8L 3RLOA 1KXLA 1SE8A 1XNRL 4UY8C 2EQSA 4GKJL 2AKWB 4GKKL 4OX9L 2NVTH 4IPGA 2CKZB 1NY4A 1K73C 1JB7A 4DK6C 4X64L 3RLFA 1JJCB 4JYAQ 2KCTA 4L5QA 3I4MG 1K83H 2R7FA 1Y14B 2RHSB 5ELOA 5FJ8H 1U0LA 4PMWA 4EX5A 4YY3L 4A3MH 3HOYH 4AYBG 1I94L 1NTGA 2IX0A 2R93G 3L2PA 3S2DH 4GNXB 1LTLA 3BZKA 1I6HH 1PV4A 5IP9G 3NBHB 1VQHA 5IP7H 2PQAB 4A3IH 5IYDH 4O0AA 5E7NA 3CCQA 2UUAL 3CCLA 1VQGA 4R4CA 1VQMA 3GTLH 1EOVA 2QEXA 4DR2L 4JI6L 3CCEA 4GOPB 3PO3G 1E1TA 4BBSG 4JI0Q 1V9PA 1KIXA 4HIKA 3K81C 1QVGA 3KDFB 4YY3Q 2VQFQ 2KENA 4C2MH 4IOCA 4KI0A 2Y0SG 1VQ6A 1VCIA 1IBLQ 2VL6A 2ALYB 2WAQG 3U50C 2XTIA 1QVFA 1XTDA 4BBRH 2NN6I 1X55A 2WB1G 1FL0A 3TREA 1N34Q 5M3MH 3S15H 4IJHA 4X62Q 4DR6Q 5C0XI 2IX1A 4OWWB 5IYDG 1WYDA 3RNUA 1HR0W 4KHPQ 3HOWG 4GNXA 1BKBA 1HR0L 1VQLA 4DNIA 4NXMQ 1IZ6A 2WB1E 3U4ZA 4DV3Q 4C3HH 3E0EA 4R4QA 4IPDA 4A93G 1KHIA 1YIJA 1UE5A 3GTPH 2OCEA 2N49A 1VQ4A 3TRZA 1IBKL 3AQQA 1KD1C 1VS0A 1A0IA 2FXQA 3M85A 3AFQA 2IT1A 1PH2A 3RN2A 4KLKA 2ATWA 3J7A5 1UEBA 4AIMA 1XNQL 1HNZL 1E1OA 1CKMA 1O7IA 3TS2A 1Q1EA 4A3FG 2ID0A 2F52A 1D7QA 2JA7H 3KJPA 5IWAQ 4EQ5A 5LMUQ 4QL5A 4LW1A 4A3IG 1E22A 3G48A 1E7ZA 3HOXH 4HIMA 3GDEA 3S1RH 4DR7L 1Q8KA 1Q46A 2L15A 1X3FA 2E5LQ 5JJIA 1KL9A 2NVYH 2Q2UA 1Q1BA 1GVPA 4L5SA 4LF9Q 4R4IA 3UE1A 2VQEL 2CWAA 4HJ7A 1S40A 4DV1L 4A3JH 3CD6A 3G71A 4QQBX 1XPUA 2D0PA 4BBRG 2A1AA 1LM0A 4DR6L 4FDBA 4PZ8A 2VQFL 2V1CC 1CKOA 1VQIA 2VS1A 5M3MG 1YHBA 1UE6A 4JBJA 1X9NA 1Q86C 4A75A 1XMQL 1PH1A 4JI4Q 4P75A 2UUBQ 1QVCA 4UP7A 4DV2Q 1C7YA 2VUMG 1TWGH 4UPAA 4C3JH 3G4SA 4JI0L 4B3TL 2QA4A 4BXXH 3CCSA 1W2BA 4DV0Q 1XMOQ 1PA6A 1SFOH 4JI1L 5GAEC 4B3TQ 2C35B 3GTMH 2KCMA 1L1OC 3MEFA 1VQ7A 4TVAB 3UDFA 4A3LG 4X6AH 1T9HA 1Q7YC 2Q2HA 3IRBA 5FLXc 1GM5A 1XJVA 4DR4L 1XMQQ 4A3KG 1K8GA 1VQKA 4B3SQ 1S72A 2VW9A 4MNOA 3STBC 4X64Q 3HOUG 4LF8L 4IFDJ 1YBYA 3ICEA 3I4NG 3FP9A 2VQEQ 1C0AA 3J80i 1GKHA 1J6QA 1IL2A 4QGUA 2JA7G 2E5LL 3J7ZC 5LMNQ 2GVBA 4POFA 3S17H 3I56A 5ELNA 5AJ3L 3CMAA 4A3EH 5JEAJ 2N78A 2F3IA 4K0KL 1H95A 1K9MC 4A3CG 2B3GA 1JT8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HOU H;  4AQY L;  1QUQ A;  2EXD A;  1KAW A;  1L2F A;  1Y1V H;  3I2Z A;  5IYC H;  1XNQ Q;  2YYZ A;  4GNX C;  2I0Q A;  3S16 H;  3H15 A;  4JCV E;  2PNH A;  4DUZ Q;  1FGU A;  1K0R A;  1SR3 A;  1X54 A;  2RCN A;  4DKA C;  2BH2 A;  4YWK A;  4DV2 L;  4JOI A;  3M9B A;  2R7Z G;  5BR8 L;  3G6E A;  2RF4 A;  4A93 H;  3S1N H;  3FKI G;  3L0O A;  4DPG A;  3PUW A;  4BY1 H;  5GQO A;  3A74 A;  5BR8 Q;  4MTN A;  1VQF A;  2VY3 A;  5JEA G;  4LF4 L;  1E24 A;  4DV3 L;  1SRU A;  3GD7 A;  3KF8 B;  5C44 G;  4JI7 L;  3UDG A;  4LF5 Q;  5EAY A;  1HZC A;  4DK3 C;  2OWO A;  2JA6 G;  2JA8 G;  2JQO A;  2N3S A;  4PG3 A;  1HR0 Q;  2UUA Q;  4A3C H;  2OTJ A;  4NXM L;  4WJ4 A;  3CW2 C;  4A3D H;  2IY5 B;  1HNX Q;  3Q8D A;  3BZC A;  5FLM H;  2OQK A;  2DUD A;  1ASZ A;  1X3G A;  2Z0S A;  4C3I H;  4QJF A;  3JAM i;  3I7F A;  3PIP A;  1G51 A;  1I3Q H;  3NEL A;  1HNZ Q;  3ULP A;  3I55 A;  4P72 A;  4MZ9 A;  1MJE A;  3LGJ A;  5IYB G;  5IT9 c;  2R93 H;  3HKS A;  1DGS A;  2ZTC A;  3K8A A;  3CCM A;  4K0K Q;  1YEZ A;  2JE6 I;  1B7Y B;  3BU2 A;  3K7U C;  3KLW A;  5IP9 H;  5IP7 G;  1ASY A;  3CCJ A;  1TXY A;  1OXU A;  1EQQ A;  4H02 A;  3RLN A;  2UU9 Q;  2KHI A;  4OON A;  2R7Z H;  3H3V H;  3KOJ A;  4BA2 I;  1MKH A;  1C9O A;  5GAD C;  4DR1 L;  4RMF A;  2AMC B;  1EIY B;  4KHP L;  1TWC H;  1S3O A;  2OTL A;  1VQN A;  4A3F H;  4TQU S;  3T1H Q;  1KRT A;  1CUK A;  3D0F A;  2K4K A;  1VQA A;  2CWP A;  1XPR A;  2NVQ H;  4X62 L;  3A0J A;  4DV7 L;  4GLX A;  2R92 H;  4IO9 A;  3NEN A;  3S24 A;  1WCM G;  1QZG A;  4BBS H;  1LYL A;  4A3B H;  2UXD L;  2GN5 A;  1FJG Q;  4DV7 Q;  1VQ5 A;  1B8A A;  1P8L A;  3CCV A;  1IBL L;  5JJK A;  4JI5 L;  4JBK A;  1BBW A;  1R9T H;  4LUV A;  2HIX A;  1CSP A;  5C44 H;  1XPO A;  3S2H H;  4A3G G;  3UE0 A;  3F2D A;  3ULJ A;  2PMZ E;  2MQH A;  3F2C A;  1YIT A;  2UXB Q;  5GRO A;  1JJ2 A;  5GAH C;  1XNR Q;  5HGQ A;  1M1K C;  2HHH Q;  2D0O A;  2YTX A;  4GOP C;  4B3R L;  4JI7 Q;  2KHJ A;  4ALP A;  2WP8 J;  5IWA L;  3PCO B;  4QIW E;  1NJI C;  3PO2 H;  1WJJ A;  4DV5 Q;  1U5K A;  2I5L X;  3HOV H;  4HJA A;  3K0X A;  2H5X A;  3CQZ H;  5IYC G;  1PFS A;  1SRO A;  3D31 A;  4NPS A;  2UXC Q;  1OXT A;  2PI2 E;  1I94 Q;  2UUC L;  1GD7 A;  2K5N A;  2F4V L;  3M7N A;  4A3G H;  1GO3 E;  2NZH A;  4BXX G;  3OYY A;  3PF5 A;  1QUQ B;  1X56 A;  1BBU A;  1VQO A;  4JI2 L;  1VQP A;  3H3V I;  4OXP A;  4JV5 L;  3W1B A;  1WI5 A;  3HFZ B;  2B29 A;  1EWI A;  1VQC A;  4OWT B;  3STB D;  3KF6 B;  4DUY L;  2ZJP A;  4POG A;  2JEA I;  1WFQ A;  2K50 A;  4LFC Q;  4NB3 A;  3B6Y A;  5GAG C;  3SGI A;  1I5F A;  4RG1 A;  4LFB Q;  1JE5 A;  1SLJ A;  5IE8 A;  3J81 c;  3CC7 A;  4OO1 I;  1KC8 C;  1HNX L;  1K3R A;  4JI5 Q;  2CCZ A;  3K7A H;  3J80 c;  2E2H H;  3PO2 G;  4LFB L;  4Y7N H;  5LMU L;  4A3M G;  1YJ9 A;  4DR3 L;  2K14 A;  4LF6 L;  3HOW H;  3KYH C;  4UP9 A;  4JV5 Q;  1J5E L;  1RIP A;  1Z47 A;  1L1O A;  1OTC A;  3I4M H;  2HIV A;  3T1H L;  1SMX A;  5M3F H;  4LF7 L;  3ERS X;  3M4O H;  4DV5 L;  1Y1W H;  5H1S E;  3DM3 A;  1KQS A;  3GTG H;  5IYB H;  3M4P A;  5J3B A;  3PV0 A;  1G6P A;  2E8G A;  5IY0 A;  1PH3 A;  1NBW A;  2F4V Q;  4JC0 A;  4YHH L;  4IOA A;  5C3E H;  4BY7 H;  4OO1 G;  4HJ5 A;  3VDY A;  3CP0 A;  4A3E G;  4LUO A;  1VQJ A;  3HKZ E;  1OXV A;  3T1Y L;  3PO3 H;  4IJL A;  4P71 A;  2R7D A;  1IBM Q;  3RZO H;  5LMN L;  4KHZ A;  4WJ3 M;  4LFA Q;  3CC4 A;  2A19 A;  5C4J H;  2ZJQ A;  2N8N A;  4A3J G;  4PZ6 A;  4YWL A;  4DAY B;  2I5H A;  3GO5 A;  4DAM A;  1TWA H;  1CSQ A;  1PH5 A;  4LFA L;  3HOY G;  3CC2 A;  1V43 A;  2ZTE A;  3JC6 6;  4BY1 G;  5FJ8 G;  3A5U A;  3H0G H;  4DV1 Q;  3U58 A;  1PH9 A;  4BA1 I;  3PF4 A;  4LF6 Q;  3M3Y H;  4B3M Q;  2CFM A;  5DLQ E;  4DV4 Q;  3GTQ H;  1Y1V G;  3JAM c;  1VQD A;  2E2I H;  2WFW A;  4X66 Q;  4A76 A;  2VZA A;  1YHA A;  4JG2 A;  3DLL A;  2JEB I;  2R6G A;  1A8V A;  3I4O A;  3OW2 A;  2NVX H;  2CQO A;  2D62 A;  3ER0 A;  2I5M X;  2OQ0 A;  3CCR A;  1PH7 A;  1B70 B;  2UU9 L;  1A63 A;  3OTO L;  1HNW Q;  2BA0 A;  2VUM H;  2LXK A;  4DR7 Q;  3K80 C;  4LF7 Q;  1NE3 A;  1TWH H;  1HZ9 A;  4DUY Q;  3GTK H;  3HOZ G;  3E9I A;  2Y0S E;  1VQE A;  3PIO A;  4DR5 L;  2AWN A;  4XTC S;  1PH4 A;  1M90 C;  4L5T A;  1W3S A;  1FVI A;  5C4X G;  2YU9 H;  3AEV A;  1N32 Q;  4LUZ A;  5M5Y H;  3CPF A;  1Y1W G;  1EQR A;  2MNA A;  1RL2 A;  1L1O B;  1J5E Q;  1HZA A;  2BA1 A;  2NZO A;  2K5H A;  3PGZ A;  1PHJ A;  1IBK Q;  4Y52 H;  4GN5 A;  4O2D A;  3S14 H;  3RN5 A;  2DGY A;  3CCU A;  4A3K H;  1YNX A;  3OTO Q;  2LSS A;  3E9H A;  4JI8 Q;  1I50 H;  3KJO A;  1Q81 C;  1YZ6 A;  3HKZ G;  1YJW A;  3PSI A;  3NEM A;  3UDX A;  2RHQ B;  3ULL A;  3F2B A;  2K52 A;  5C0X J;  5LMN W;  1VQ8 A;  2HT1 A;  4HJ8 A;  5M5W H;  4NXN Q;  1UE1 A;  3W5O A;  2YTY A;  4A4I A;  5FLM G;  4B3S L;  4IPC A;  1PYB A;  1UE7 A;  1EIF A;  1KRS A;  4DV6 L;  1Q12 A;  2E2J H;  4IFD G;  2Z6K C;  4JI2 Q;  1MJC A;  2ZTD A;  1AE3 A;  3EN2 A;  4ME3 A;  4R1J A;  1K8A C;  1EYG A;  2JA5 H;  1VQB A;  2ZM6 L;  2UUC Q;  4DR4 Q;  2JK8 A;  1JMC A;  4A3D G;  1NMG A;  4JI3 Q;  1CKN B;  1X3E A;  3MXN B;  3UDI A;  3ZJY C;  5M5X H;  1IBM L;  1YJN A;  3GTJ H;  2PQA A;  4L5R C;  3PUX A;  3CXC A;  4DR2 Q;  3T1Y Q;  1V1Q A;  4GS3 A;  3HOX G;  1YI2 A;  3S1Q H;  4P73 A;  2AHO B;  1SN8 A;  1VQ9 A;  1JJG A;  2UXB L;  4APV A;  1YVC A;  4AYB E;  2B63 G;  2HHH L;  1HJP A;  1IYJ B;  2JJQ A;  3FHW A;  4IFD I;  1EFW A;  2A8V A;  2LXJ A;  2IHE A;  3W1G A;  1IXR A;  3EIV A;  4YCV A;  5C0X G;  3J81 i;  3CPW A;  1Z9F A;  4LF8 Q;  1FJG L;  1N34 L;  4OX9 Q;  4JBW A;  1WCM H;  1N36 Q;  4LF9 L;  3KFU A;  2YTV A;  2R92 G;  3AFP A;  5HY6 A;  2NN6 G;  1G29 1;  1WOC A;  3PUZ A;  1N36 L;  4JI1 Q;  3PUY A;  4OWX B;  3F8T A;  4IPH A;  1LUZ A;  4P74 A;  1AE2 A;  1Q82 C;  4J15 A;  4LWC A;  4AH6 A;  1OXX K;  2HQL A;  3CF5 A;  4YHH Q;  1TWF H;  2MO0 A;  2AWO A;  1HNW L;  1OXS C;  3H0G G;  4JI3 L;  5M3F G;  4QY7 A;  4XIG S;  4LF5 L;  5K36 G;  2EIF A;  3FKI H;  4JI6 Q;  1UWV A;  2Q2T A;  4DV0 L;  1XMO L;  4LNQ A;  3U4V A;  4HID A;  4JI4 L;  2UUB L;  4GN3 B;  3HOZ H;  1E3P A;  2GVA A;  4YCW A;  4GLA C;  4B3M L;  4GKJ Q;  1L0W A;  3WWV A;  1NMF A;  5C4X H;  1YHQ A;  4R4O A;  4DV6 Q;  2JA5 G;  1P16 A;  4HIO A;  4A3B G;  3KF6 A;  1A62 A;  1PYS B;  1AH9 A;  3EBE A;  4JYA L;  2ES2 A;  4NXN L;  5C3E G;  2JA9 A;  3A5Z B;  4BY7 G;  1X65 A;  3M4Q A;  4X65 L;  1HH2 P;  1N9W A;  3KDF A;  4DR1 Q;  4GKK Q;  1PVO A;  4JBM A;  2JA6 H;  2JA8 H;  3TS0 A;  1N33 Q;  2Q2I A;  3CME A;  4GOP A;  2B63 H;  4GN4 B;  4X65 Q;  3I4N H;  1EUJ A;  3RR5 A;  3BJU A;  3RZD H;  2Z6K A;  1MIU A;  4UP8 A;  3HOV G;  1HZB A;  4YCU A;  3F1Z A;  1D8L A;  2WAQ E;  4R4T A;  3TQY A;  2UXD Q;  1X6O A;  2YV5 A;  2K75 A;  2K5V A;  4LFC L;  4HJ9 A;  1PH6 A;  1PH8 A;  2ZM6 Q;  4LF4 Q;  3J81 j;  5JJL A;  2QGQ A;  3L7Z C;  2KBN A;  4GLV B;  2PI2 A;  3AYH B;  4DR5 Q;  1CKN A;  4DUZ L;  4A3L H;  2UXC L;  4JOI C;  3GTO H;  4PZ7 A;  1N32 L;  2VNU D;  2BH8 A;  2IHF A;  1N33 L;  3S1M H;  2MO1 A;  2XGT A;  1N8R C;  4DR3 Q;  5AJ3 Q;  2MFI A;  1BVS A;  4B3R Q;  3TEH B;  1QZH A;  3PUV A;  4X66 L;  2ASB A;  2ZJR A;  4YWM A;  3CAM A;  4AQY Q;  4DV4 L;  4JI8 L;  3RLO A;  1KXL A;  1SE8 A;  1XNR L;  4UY8 C;  2EQS A;  4GKJ L;  2AKW B;  4GKK L;  4OX9 L;  2NVT H;  4IPG A;  2CKZ B;  1NY4 A;  1K73 C;  1JB7 A;  4DK6 C;  4X64 L;  3RLF A;  1JJC B;  4JYA Q;  2KCT A;  4L5Q A;  3I4M G;  1K83 H;  2R7F A;  1Y14 B;  2RHS B;  5ELO A;  5FJ8 H;  1U0L A;  4PMW A;  4EX5 A;  4YY3 L;  4A3M H;  3HOY H;  4AYB G;  1I94 L;  1NTG A;  2IX0 A;  2R93 G;  3L2P A;  3S2D H;  4GNX B;  1LTL A;  3BZK A;  1I6H H;  1PV4 A;  5IP9 G;  3NBH B;  1VQH A;  5IP7 H;  2PQA B;  4A3I H;  5IYD H;  4O0A A;  5E7N A;  3CCQ A;  2UUA L;  3CCL A;  1VQG A;  4R4C A;  1VQM A;  3GTL H;  1EOV A;  2QEX A;  4DR2 L;  4JI6 L;  3CCE A;  4GOP B;  3PO3 G;  1E1T A;  4BBS G;  4JI0 Q;  1V9P A;  1KIX A;  4HIK A;  3K81 C;  1QVG A;  3KDF B;  4YY3 Q;  2VQF Q;  2KEN A;  4C2M H;  4IOC A;  4KI0 A;  2Y0S G;  1VQ6 A;  1VCI A;  1IBL Q;  2VL6 A;  2ALY B;  2WAQ G;  3U50 C;  2XTI A;  1QVF A;  1XTD A;  4BBR H;  2NN6 I;  1X55 A;  2WB1 G;  1FL0 A;  3TRE A;  1N34 Q;  5M3M H;  3S15 H;  4IJH A;  4X62 Q;  4DR6 Q;  5C0X I;  2IX1 A;  4OWW B;  5IYD G;  1WYD A;  3RNU A;  1HR0 W;  4KHP Q;  3HOW G;  4GNX A;  1BKB A;  1HR0 L;  1VQL A;  4DNI A;  4NXM Q;  1IZ6 A;  2WB1 E;  3U4Z A;  4DV3 Q;  4C3H H;  3E0E A;  4R4Q A;  4IPD A;  4A93 G;  1KHI A;  1YIJ A;  1UE5 A;  3GTP H;  2OCE A;  2N49 A;  1VQ4 A;  3TRZ A;  1IBK L;  3AQQ A;  1KD1 C;  1VS0 A;  1A0I A;  2FXQ A;  3M85 A;  3AFQ A;  2IT1 A;  1PH2 A;  3RN2 A;  4KLK A;  2ATW A;  3J7A 5;  1UEB A;  4AIM A;  1XNQ L;  1HNZ L;  1E1O A;  1CKM A;  1O7I A;  3TS2 A;  1Q1E A;  4A3F G;  2ID0 A;  2F52 A;  1D7Q A;  2JA7 H;  3KJP A;  5IWA Q;  4EQ5 A;  5LMU Q;  4QL5 A;  4LW1 A;  4A3I G;  1E22 A;  3G48 A;  1E7Z A;  3HOX H;  4HIM A;  3GDE A;  3S1R H;  4DR7 L;  1Q8K A;  1Q46 A;  2L15 A;  1X3F A;  2E5L Q;  5JJI A;  1KL9 A;  2NVY H;  2Q2U A;  1Q1B A;  1GVP A;  4L5S A;  4LF9 Q;  4R4I A;  3UE1 A;  2VQE L;  2CWA A;  4HJ7 A;  1S40 A;  4DV1 L;  4A3J H;  3CD6 A;  3G71 A;  4QQB X;  1XPU A;  2D0P A;  4BBR G;  2A1A A;  1LM0 A;  4DR6 L;  4FDB A;  4PZ8 A;  2VQF L;  2V1C C;  1CKO A;  1VQI A;  2VS1 A;  5M3M G;  1YHB A;  1UE6 A;  4JBJ A;  1X9N A;  1Q86 C;  4A75 A;  1XMQ L;  1PH1 A;  4JI4 Q;  4P75 A;  2UUB Q;  1QVC A;  4UP7 A;  4DV2 Q;  1C7Y A;  2VUM G;  1TWG H;  4UPA A;  4C3J H;  3G4S A;  4JI0 L;  4B3T L;  2QA4 A;  4BXX H;  3CCS A;  1W2B A;  4DV0 Q;  1XMO Q;  1PA6 A;  1SFO H;  4JI1 L;  5GAE C;  4B3T Q;  2C35 B;  3GTM H;  2KCM A;  1L1O C;  3MEF A;  1VQ7 A;  4TVA B;  3UDF A;  4A3L G;  4X6A H;  1T9H A;  1Q7Y C;  2Q2H A;  3IRB A;  5FLX c;  1GM5 A;  1XJV A;  4DR4 L;  1XMQ Q;  4A3K G;  1K8G A;  1VQK A;  4B3S Q;  1S72 A;  2VW9 A;  4MNO A;  3STB C;  4X64 Q;  3HOU G;  4LF8 L;  4IFD J;  1YBY A;  3ICE A;  3I4N G;  3FP9 A;  2VQE Q;  1C0A A;  3J80 i;  1GKH A;  1J6Q A;  1IL2 A;  4QGU A;  2JA7 G;  2E5L L;  3J7Z C;  5LMN Q;  2GVB A;  4POF A;  3S17 H;  3I56 A;  5ELN A;  5AJ3 L;  3CMA A;  4A3E H;  5JEA J;  2N78 A;  2F3I A;  4K0K L;  1H95 A;  1K9M C;  4A3C G;  2B3G A;  1JT8 A; 
#chains in the Genus database with same CATH topology
 1QUQ A;  1L2F A;  5CV4 A;  1PFB A;  1MBY A;  4JCV E;  2PNH A;  4QUC A;  4C3H G;  2KEC A;  3M9B A;  4JOI A;  3A8K E;  2I46 A;  3J7A V;  3S1N H;  3Q0A A;  3FKI G;  2K32 A;  3L3O C;  3A74 A;  5I2Y A;  3NP8 A;  4MTN A;  3Q22 A;  1GUN A;  5ELE A;  4JI7 L;  3UDG A;  1FYC A;  1KDB A;  1HUM A;  4DK3 C;  2OWO A;  3CKI B;  3J7A F;  2K6A A;  4KJO A;  4WJ4 A;  1AEX A;  3RZO B;  1I6V C;  3Q8D A;  1XTC D;  1I4P A;  2F0E A;  2Z0S A;  1WTW A;  2PZT A;  1ZKO A;  3I7F A;  1I3Q H;  2K28 A;  4MZ9 A;  2NVY B;  2ZT9 C;  3GTG B;  1L0Y B;  3K5L A;  1A2U A;  1WTR A;  5T1I A;  1DCZ A;  3HS0 C;  1H9S B;  1YEZ A;  3K7U C;  2RVL A;  5FOB B;  3MTS A;  2KHI A;  2MUY A;  3H3V H;  3KOJ A;  4BA2 I;  4DR1 L;  4PMC A;  2J4X A;  4K6D A;  1MSH A;  3DWA A;  3A0J A;  1SDF A;  4IO9 A;  3VYR A;  4DN4 M;  3NEN A;  3S24 A;  3JAM L;  4RGO S;  2UXD L;  2B2U C;  1AN8 A;  1VQ5 A;  1IBL L;  5JJK A;  4KN7 C;  4RGM A;  5EBC A;  1BBW A;  4JI5 L;  2HIX A;  1CSP A;  2A74 C;  3IKJ A;  1UNS A;  1YIT A;  1JJ2 A;  3CQZ B;  3NK9 A;  3TBI B;  4B3R L;  1S5D D;  4ALP A;  4DNR B;  1U5K A;  5CV8 A;  3K0X A;  1B3Q A;  2AQ1 B;  3A55 A;  3TZU A;  5HGT A;  3D31 A;  2UXC Q;  4QCL A;  1OXT A;  2QEJ C;  3A56 A;  1GO3 E;  1QUQ B;  1BBU A;  1CQV A;  4JI2 L;  2B2W A;  1JQY D;  4DUY L;  3HFZ B;  4OWT B;  4U67 3;  3KF6 B;  4POG A;  2ZJP A;  1WFQ A;  5DM6 3;  5J22 A;  3B6Y A;  5GAG C;  1I5F A;  4CKE A;  3BDL A;  2L1B A;  2F0I A;  1HHV A;  4A3F B;  4DK0 A;  4N8F A;  1R4Q B;  4JI5 Q;  2CCZ A;  3K7A H;  2F0F A;  3OHX C;  1NNX A;  1IHZ A;  3I4L A;  5AFW A;  3HOW H;  3BDC A;  1HRJ A;  4HSV A;  2HIV A;  4DA2 A;  4LF7 L;  4DV5 L;  1Z7T A;  2PW7 A;  5J3B A;  1SJE D;  2OEO A;  4UDU C;  2WB1 B;  1G6P A;  1NBW A;  4IOA A;  1GUS A;  2CQA A;  2XIW A;  5C3E H;  5G3L F;  2PMZ B;  3VDY A;  4A3E G;  2F03 A;  1X3Q A;  4LUO A;  3T1Y L;  3PO3 H;  5BN3 A;  5BN4 A;  2KQ3 A;  5ISR A;  3C1F A;  1Q90 A;  4KHZ A;  2K33 A;  2F0P A;  3MXG A;  5E4W C;  2ZJQ A;  4KV6 A;  3NBI A;  4DAY B;  3J81 E;  2HCC A;  5C4H A;  4LFA L;  1B2T A;  2O4X A;  4DAM A;  3ZYY X;  5JVG 3;  1V43 A;  2ZTE A;  4BY1 G;  1MJE A;  2EJG C;  3PF4 A;  3U58 A;  4B3M Q;  3DXJ C;  2CFM A;  5DLQ E;  1Y1V G;  1WCM B;  2VZA A;  4JG2 A;  5C3X A;  2AUK A;  2JEB I;  3I4O A;  3OW2 A;  4PMB A;  4ZCK A;  3I90 A;  1B70 B;  4AYB B;  1A63 A;  3K57 A;  1Y8O B;  3SXH A;  1TWH H;  3GTK H;  3GQB A;  1SYF A;  3NTK A;  3HOZ G;  2Y0S E;  1VQE A;  5I9O A;  4XTC S;  1O7Y A;  1CHQ D;  1FVI A;  2K04 A;  4RGN A;  5C4X G;  3CPF A;  1EQR A;  1RL2 A;  1HA6 A;  4H13 C;  1IBK Q;  1PHJ A;  4KY5 A;  1FNW A;  3S14 H;  3KLR A;  2EOT A;  1EU3 A;  1YNX A;  2LSS A;  3E9H A;  4JI8 Q;  3KJO A;  1U4M A;  1C48 A;  2PQE A;  3NEM A;  2QCP X;  5LMN W;  4NXN Q;  4JK1 C;  2BE5 C;  4CHT B;  1SND A;  4DXF A;  5IT9 E;  4IPC A;  1UUP A;  4IFD G;  4XT3 B;  5CC4 A;  1MJC A;  3A7L A;  4ME3 A;  1LTA D;  1JOO A;  2ZM6 L;  3VR6 A;  3GV3 A;  1CKN B;  4B9W A;  3MXN B;  3S1Q B;  1YJN A;  3GTJ H;  2K5Q A;  4L5R C;  4XQJ A;  2XN9 C;  3NSW A;  1V1Q A;  4GS3 A;  3CRK C;  4P73 A;  1A6X A;  1G2S A;  1PZJ D;  2HHH L;  1LAB A;  1IYJ B;  3FHW A;  3QOL A;  1PTO D;  4IFD I;  2A8V A;  4L63 B;  1IXR A;  3EIV A;  4LF8 Q;  1LV9 A;  1Z9F A;  3J80 E;  4JBW A;  4KKS A;  1WCM H;  2L0C A;  1N36 Q;  3KFU A;  1F2M A;  2EJF C;  5JPM C;  5IGF A;  4JI1 Q;  4OWX B;  2B8G A;  1IW7 C;  4IPH A;  4RCN A;  1DM0 B;  1LUZ A;  4P74 A;  1Q82 C;  4LWC A;  4AH6 A;  1OXX K;  4A3K B;  4KD4 A;  4YHH Q;  1TWF H;  1OXS C;  3QJY A;  4QY7 A;  2Z1C A;  3PO3 B;  2KCC A;  4DV0 L;  1XMO L;  2QIL A;  2EY6 A;  1MSG A;  1ILQ A;  1B53 A;  4R4O A;  4CDF C;  4CDC C;  4A3B G;  1EQT A;  2L55 A;  2ENB A;  1X65 A;  3VA7 A;  1N9W A;  1PVO A;  3H91 A;  3TS0 A;  3GTQ B;  3I3C A;  1NR4 A;  4XT1 B;  3M3Y B;  3I4N H;  5IIF A;  4HN7 A;  3BJU A;  1MIU A;  1WTQ A;  1HZB A;  4YCU A;  2WAQ E;  4R4T A;  3SR1 A;  4E6I A;  1X6O A;  2YV5 A;  2K75 A;  3M7G A;  1PH6 A;  4K14 A;  1PH8 A;  1SYC A;  3J81 j;  1LT3 D;  4GLV B;  2M2L A;  3MXP A;  1EYA A;  2UXC L;  2QKI C;  1B9N A;  4LK1 C;  1YNJ C;  4PZ7 A;  3GTO H;  4U68 A;  5AJ3 Q;  4BY7 B;  3TEH B;  1QZH A;  3R2I A;  4X66 L;  2ICI A;  2RDH A;  4AQY Q;  1EWH A;  5FKA C;  1RF2 D;  3FPP A;  1AP0 A;  1XNR L;  1EY6 A;  2AKW B;  2EY1 A;  4OX9 L;  2NVT H;  4RFB A;  1NY4 A;  4DK6 C;  4C2M B;  3ONA B;  2A68 D;  4PMW A;  3HOY H;  2IX0 A;  4KMU C;  4GNX B;  3BZK A;  3MC0 B;  1O78 A;  3WOF A;  4FYD A;  1T5X D;  1S5C D;  5E7N A;  4TSS A;  4ILW A;  2UUA L;  4R4C A;  4M1U B;  4EQP A;  3SK8 A;  3GTL H;  1PRT B;  2QEX A;  3CCE A;  3ITP A;  3OMC A;  4JI0 Q;  1V9P A;  3K81 C;  3NTI A;  1AW7 A;  3VR4 A;  1FNU A;  2F0L A;  1VCI A;  1VF7 A;  4FNF A;  2WAQ G;  2ALY B;  3U50 C;  4BBR H;  4B08 A;  1X55 A;  3PO2 B;  5M3M H;  1TY2 A;  4DR6 Q;  3AU7 A;  4N9T A;  2JP1 A;  1I3Q B;  2Q8I B;  1WYD A;  4OWW B;  4NXM Q;  5DAU A;  4DV3 Q;  3T16 A;  1K8M A;  5I4D A;  4A3D B;  5D3D A;  1YIJ A;  3TN2 A;  2OCE A;  1VQ4 A;  3SE0 A;  1IL8 A;  2K1B A;  1PH2 A;  4KLK A;  5G3L D;  1D5X C;  1UEB A;  2F0M A;  1O7I A;  1F9Q A;  3MAQ A;  3MWY W;  1E2Z A;  1I4G A;  1L0X B;  3NWT A;  3KJP A;  5IWA Q;  4DU9 A;  5LMU Q;  4QL5 A;  4LW1 A;  1E22 A;  3HOX H;  4HIM A;  1C8C A;  1Q8K A;  5FK9 C;  3HOU B;  2MGS A;  1X3F A;  5C4X B;  4G7H C;  3HOZ B;  1GHJ A;  4A3J H;  1PXU A;  2RSN A;  2Q8T A;  1XPU A;  1M8A A;  4DR6 L;  4FDB A;  1CKO A;  5M3M G;  1UE6 A;  5A2Q E;  4JI4 Q;  1QVC A;  2JA5 B;  4UPA A;  4FF3 A;  2TMP A;  3LNN A;  5EKK A;  5EKL A;  1MGS A;  3CCS A;  1PA6 A;  4DV0 Q;  1XMO Q;  1JE4 A;  3T13 A;  4B3T Q;  2C35 B;  2FIN B;  4FP5 D;  3H94 A;  1L1O C;  3UDF A;  2PW5 A;  1SFO B;  4X6A H;  1T9H A;  1Q7Y C;  2Q2H A;  3IRB A;  2EYO A;  1K8G A;  1NR2 A;  4B3S Q;  3S16 B;  2B2V A;  1S72 A;  3NUC A;  3STB C;  3BDO A;  5C3W A;  1SYE A;  5DM7 3;  2K03 A;  3BYY B;  3FP9 A;  5KIX A;  2VQE Q;  1O80 A;  3J80 i;  4MTK A;  1GKH A;  1IL2 A;  2JA7 G;  3I56 A;  1D5M C;  3GTK B;  1PRT C;  4UHV A;  4HAE A;  2A69 D;  1GUT A;  5JEA J;  1XYI A;  1H95 A;  4A3C G;  4LUZ A;  2EXZ A;  3D6W A;  1XNQ Q;  5CGK A;  2JXM B;  3P75 A;  4EVO A;  3H15 A;  1FGU A;  1K0R A;  3CRL C;  2R7Z G;  2RCN A;  1FR3 A;  1SJH D;  3FDT A;  4A93 H;  2FFK B;  2H1E A;  2KOL A;  1BCP C;  4Q0F A;  3U9S A;  3KBG A;  4LF4 L;  1E24 A;  3MXN A;  1DJR D;  3KF8 B;  4LF5 Q;  2DY7 A;  5EAY A;  3DWQ A;  1V1O A;  2VB3 X;  3GTP B;  2N3S A;  4CDD C;  2OTJ A;  2EE1 A;  2NN6 H;  4C3H B;  2YU9 B;  2ICE C;  1X3G A;  4X3S A;  1RCV D;  4KY7 A;  4QJF A;  1RJT A;  1G2T A;  1G51 A;  3NEL A;  2AQ2 B;  2NUC A;  1LLR D;  4P72 A;  2G9D A;  3KLS A;  1STH A;  3NBH A;  5IT9 c;  2R93 H;  1NCV A;  3HKS A;  5EKI A;  1S5E D;  2F0W A;  2JE6 I;  2OXP A;  2QW7 A;  5IP9 H;  5IP7 G;  4KKT A;  3RLN A;  2E2I B;  4OON A;  1LTB D;  1C9O A;  5GAD C;  2AMC B;  1EIY B;  5EGT A;  1W6J A;  1VQN A;  4A3F H;  4TQU S;  3URY A;  4C3I G;  1KRT A;  2MHV A;  1CUK A;  3T1H Q;  2K4K A;  1XPR A;  4DV7 L;  2NWG A;  4GLX A;  2X6L A;  2ZXO A;  2R92 H;  5I9P A;  3S2D B;  4BBS H;  4A3B H;  1YNJ D;  4DV7 Q;  1B8A A;  3BVZ A;  3CCV A;  4LUV A;  1CZW A;  2MP1 A;  4KKU A;  1XPO A;  4RKB A;  3S2H H;  3E5S A;  3ULJ A;  2PMZ E;  2MQH A;  1V1P A;  2UXB Q;  5GAH C;  3IL8 A;  2HHH Q;  4RAU C;  2YTX A;  4JI7 Q;  1JWS D;  5M3M B;  1WJJ A;  2H5X A;  3BG3 A;  1BR9 A;  1EYD A;  5C5L A;  2PO4 A;  3CU7 A;  2UUC L;  1GD7 A;  1PTO C;  3M7N A;  1CT1 D;  5C44 B;  3RD4 A;  1VQP A;  1LO5 D;  4OXP A;  4Y7N B;  1I4X A;  3W1B A;  1WI5 A;  2O5J C;  1EWI A;  1VQC A;  3TP8 A;  4C3J G;  4LFC Q;  4NB3 A;  4OO1 I;  3CC7 A;  1HNX L;  2B2V C;  1J9O A;  3PO2 G;  1S5B D;  5DEH A;  1RKN A;  4Y7N H;  4A3M G;  4DR3 L;  1QE6 A;  1CM9 A;  4UP9 A;  1QWY A;  2Y0S B;  4DF7 A;  4JV5 Q;  2EYJ A;  1L1O A;  4NMZ A;  3T1H L;  1SMX A;  3SDZ A;  3R2T A;  3DM3 A;  3GTG H;  3M4P A;  1B4O A;  1BXT A;  1WTV A;  1GUG A;  2NTS A;  4K5W A;  4DGZ A;  1PH3 A;  5KNC A;  4JC0 A;  2Z8L A;  4BY7 H;  4RHR A;  3S2H B;  4HJ5 A;  1VQJ A;  1CI3 M;  1DXM A;  4IJL A;  2DNE A;  4P71 A;  1S4Z A;  4WJ3 M;  2K7V A;  2L12 A;  5IGB A;  3IFD A;  1TS5 A;  5C4J H;  1D2B A;  4A3J G;  4PZ6 A;  4CJ2 C;  3EJI A;  2I5H A;  1SE2 A;  3GO5 A;  1TWA H;  1PH5 A;  3HOY G;  3JC6 6;  3A5U A;  4DV1 Q;  3I4N B;  1Q3L A;  1PH9 A;  1PFN A;  1PRT F;  1II3 A;  5C4Z A;  1SYG A;  2WFW A;  4X66 Q;  3EQL C;  5FO7 B;  1SMY D;  3DUZ A;  3S17 H;  1A8V A;  2A6H D;  3R3O A;  2I5M X;  2OQ0 A;  1PH7 A;  2NZ1 D;  2N88 A;  2PZU A;  1HNW Q;  2BA0 A;  2LXK A;  4IQZ A;  1GUO A;  3K80 C;  2EDG A;  1NE3 A;  1QNU A;  4DUY Q;  4XQQ A;  3E9I A;  3PIO A;  2F3V A;  2AWN A;  1PH4 A;  1W3S A;  3FMC A;  1N32 Q;  1Y1W G;  2MNA A;  3OWF A;  1L1O B;  2F0S A;  2NBF A;  4Y52 H;  1ENC A;  4O2D A;  2DGY A;  1LTS D;  1A3T A;  1JR0 D;  3MFY A;  3FRP B;  1F2Z A;  1BQQ T;  1ML0 D;  1BDO A;  1Q81 C;  2A73 B;  1IKM A;  3HKZ G;  3UDX A;  3F2B A;  1VQ8 A;  1QIL A;  2MJ8 A;  2F0J A;  4ZRZ A;  3NPP A;  4G7O C;  4L8J A;  2NTT A;  2YTY A;  4HED A;  5FLM G;  2M9V A;  4OO1 H;  1EIF A;  1KRS A;  2E2J H;  4IUT A;  2ZTD A;  4ZK9 B;  2RQX A;  1J8I A;  2N55 A;  5F2D A;  1VQB A;  2UUC Q;  2JK8 A;  1NMG A;  1ONL A;  4JI3 Q;  4NP5 A;  2HUG A;  2FMM A;  3L9A X;  2KED A;  1JOR A;  2PQA A;  3OPO A;  3PUX A;  3QR8 A;  2EYH A;  3S1Q H;  1VQ9 A;  3TME A;  2FJ2 A;  3J81 L;  4NW2 A;  4B9X A;  1EFW A;  1HTP A;  2EYP A;  3TSS A;  1JOK A;  4J6H A;  1VMC A;  1N34 L;  4OX9 Q;  3K5N A;  4LF9 L;  3E3X A;  1ZYR D;  2WV6 D;  2R61 A;  2Q8R E;  5HY6 A;  5M5W B;  2NN6 G;  5E3F A;  1I4H A;  3PUZ A;  1N36 L;  4RWS C;  4GZY C;  1ESR A;  3PUY A;  1NUC A;  3F8T A;  4CKB A;  4X3U A;  5M9O A;  2HQL A;  3KK7 A;  5E1F A;  4CJ0 B;  1D5Z C;  1HNW L;  1STY A;  3H0G G;  4IUR A;  5K36 G;  4K6L A;  2Z6B A;  4JI6 Q;  4WOR A;  1K3B C;  2RBM A;  2UUB L;  2CW0 C;  1TY0 A;  3HOZ H;  2GVA A;  4OGQ C;  4YCW A;  4GLA C;  4WFN 3;  2K01 A;  1L0W A;  3WWV A;  1SBB B;  5C4X H;  2VUM B;  2JA5 G;  1IW7 D;  3S15 B;  3EA6 A;  2ES2 A;  4X65 L;  1HH2 P;  3KDF A;  4DR1 Q;  3SEB A;  1EOT A;  2E76 C;  1BNZ A;  1JT8 A;  3N6R A;  4X65 Q;  3NE5 B;  2CW0 D;  3VYU A;  1HTL D;  1D8L A;  2F0H A;  3TQY A;  4CGY B;  4ZLT F;  2UXD Q;  5JJL A;  4G57 A;  2QGQ A;  3L7Z C;  2PI2 A;  1CKN A;  1S5F D;  4DUZ L;  1DYQ A;  2HDM A;  3F2U A;  2A68 C;  3HZX A;  3RMH A;  5BN5 A;  5FLX E;  1N33 L;  1N8R C;  2XGT A;  4A3G B;  5IGE A;  1LTI D;  3PUV A;  3SHL A;  2AQ3 B;  3SK6 A;  1EYC A;  4YWM A;  2HCI A;  2O2L D;  4JI8 L;  1PRT D;  1Y1W B;  3C1E A;  1SE8 A;  4UY8 C;  3VA5 A;  3M4O B;  1Y8N B;  2B2W C;  4HR7 B;  4IPG A;  1JB7 A;  2XRQ D;  1JJC B;  4BS9 A;  2KCT A;  4L5Q A;  1JOQ A;  1K83 H;  5C5M A;  2RHS B;  5ELO A;  4HSP A;  3HRZ C;  1VDZ A;  4YY3 L;  1QNK A;  3KLS X;  2FHT A;  2A6E C;  2IL8 A;  1NTG A;  1CFM A;  2E2H B;  5KEE A;  3QG1 A;  3T51 B;  3S2D H;  2M00 A;  3LWU A;  2R92 B;  5IP9 G;  4K5X A;  3NBH B;  5IP7 H;  2PCF B;  1SNP A;  4A3I H;  3CCL A;  1BBX C;  1VQG A;  1VQM A;  4JI6 L;  4GOP B;  4XDX A;  2XRS D;  1E1T A;  4C56 C;  2XNA C;  2B2Y A;  4KI0 A;  2Y0S G;  1EWC A;  2D5D A;  1IBL Q;  1KNA A;  3GP7 A;  2WB1 G;  3S15 H;  1WVL A;  2F0O A;  5L37 A;  3RNU A;  4KHP Q;  4GNX A;  1HR0 L;  1NSN S;  4DNI A;  3ERO A;  3U4Z A;  3C2P A;  2NB0 A;  4C3H H;  4R4Q A;  3GTO B;  2DN8 A;  3IFT A;  4IPD A;  3FKI B;  4ZYS A;  4A93 G;  2KA7 A;  3VYT A;  2EVB A;  4WJW A;  2ZXR A;  4I7Z C;  4RCO A;  2IT1 A;  3MFG A;  3J7A 5;  4AIM A;  3N52 A;  5CBE E;  1CKM A;  3TS2 A;  1B44 D;  4A3F G;  2JA7 H;  4HMI A;  4A3I G;  4FVM A;  2SDF A;  4C1N K;  2L15 A;  3P7J A;  2NVY H;  4KJN A;  4O42 A;  4L5S A;  3HKZ B;  4HJ7 A;  3CD6 A;  2CWA A;  4DV1 L;  3J7Y W;  1VF5 C;  2A1A A;  1TVX A;  1VQI A;  2CH4 A;  4JBJ A;  1BF4 A;  1C7Y A;  2VUM G;  4JI0 L;  1H9J A;  4X3T A;  2E2J B;  4HCE A;  4F7X A;  2HQE A;  4A3L G;  1VQ7 A;  4TVA B;  1QB5 D;  1XJV A;  4DR4 L;  4A3K G;  1VQK A;  3E0J A;  4JPB W;  1AZQ A;  3HOU G;  4IFD J;  3ICE A;  3BYT B;  3I4N G;  2GA4 B;  1ZYR C;  4QGU A;  2E5L L;  3J7Z C;  2GVB A;  4POF A;  4A3J B;  3GTJ B;  4A3E H;  2N78 A;  1K9M C;  5J1Z A;  3OOC A;  3HOU H;  2EXD A;  3I2Z A;  5IYC H;  2YYZ A;  4GNX C;  2I0Q A;  3LWE A;  4DKA C;  4DV2 L;  4V19 0;  5BR8 L;  1D1I A;  4EQN A;  2B8F A;  1HQR D;  5BR8 Q;  1VQF A;  5KRU A;  5JEA G;  2F0K A;  2J0T D;  1W6K A;  4FXG C;  1KDA A;  1HZC A;  4EGV A;  4C3J B;  4IUQ A;  2JQO A;  1EY0 A;  2Z9H A;  4PG3 A;  5KGU A;  4NXM L;  4A3D H;  5KND A;  1HNX Q;  5FLM H;  1ASZ A;  4C3I H;  1RD9 D;  3JAM i;  1HNZ Q;  1KDC A;  5D65 A;  3I55 A;  3D6C A;  4QIW B;  5LL6 X;  5IYB G;  4G4K A;  1DGS A;  2ZTC A;  4K0K Q;  4CDE C;  2E2D C;  2DJF C;  3KLW A;  3V2T A;  1EY7 A;  3WDN A;  1OXU A;  1EQQ A;  4H02 A;  4RH6 A;  2UU9 Q;  4OIJ A;  5D3I B;  3P1H A;  1MKH A;  1JWM D;  3D8G A;  4RMF A;  2B2T A;  4XYO A;  4KHP L;  2OTL A;  2B2U A;  2C5C A;  1VQA A;  2NVQ H;  2DNC A;  1CQF A;  1QZG A;  1WCM G;  1LYL A;  1FJG Q;  3WOE A;  5A2Q L;  3TZD A;  1STG A;  4JBK A;  1R9T H;  5C44 H;  4RHS A;  1CA5 A;  3UE0 A;  3D4D A;  3FPU B;  3F2D A;  4A3G G;  3F2C A;  1WTX A;  5CBA E;  5GRO A;  4ID6 A;  3C3L A;  1EEI D;  5HGQ A;  2D0O A;  4GOP C;  1PYW D;  2SOB A;  3SVM A;  3U9O A;  5IWA L;  3PCO B;  3NQI A;  3W2D A;  3UI2 A;  4HJA A;  5IYC G;  3ERQ A;  2D9U A;  3PMF A;  1PFS A;  1SRO A;  4IZ8 A;  4NPS A;  2PI2 E;  1I94 Q;  4M8A A;  2F4V L;  2K5N A;  3K5M A;  3PF5 A;  1X56 A;  3I8Z A;  5EPL A;  3H3V I;  1EIH A;  2EYM A;  2B29 A;  1ENA A;  2K50 A;  3T4A C;  3SGI A;  4LFB Q;  1SLJ A;  5IE8 A;  3J81 c;  1EU4 A;  1KC8 C;  2E2H H;  3J80 c;  2XVS A;  4LFB L;  1GUW A;  1YJ9 A;  1K83 B;  1G8Z D;  2R7Z B;  4LF6 L;  3H3V C;  3KYH C;  1RTO A;  1J5E L;  1RIP A;  3I4M H;  1OTC A;  3M4O H;  2BDN A;  4DNT B;  1Y1W H;  1G91 A;  5IOD A;  2KUM A;  2E8G A;  3DMU A;  5IY0 A;  2VXW A;  1R4P B;  4TRD A;  2EPB A;  1SXT A;  4J1M A;  3CP0 A;  1R9T B;  1SAP A;  1X3P A;  1Z6H A;  4FO2 A;  3S9W A;  3AB9 A;  1EL0 A;  2R7D A;  1IBM Q;  1C4Q A;  4YIJ A;  5JVH 3;  3FVQ A;  2A19 A;  5JEA H;  2N8N A;  2NVQ B;  2JN4 A;  3OIQ A;  4YWL A;  2IJ0 A;  1CSQ A;  4XYQ A;  5FJ8 G;  5IGC A;  2TSS A;  4BA1 I;  3C46 A;  4DV4 Q;  3JAM c;  1VQD A;  4QB4 A;  5CV7 A;  4A76 A;  4R8I A;  1U4P A;  1YHA A;  3DLL A;  2R6G A;  2NVX H;  1JB3 A;  2CQO A;  2D62 A;  2QF7 A;  3ER0 A;  1O7L A;  2UU9 L;  3OTO L;  1Y69 U;  4XQN A;  4I65 A;  2VUM H;  4DR7 Q;  1KAA A;  4HCS A;  1IYV A;  1SE3 A;  4L5T A;  3AEV A;  5M5Y H;  4MHE A;  1J5E Q;  2F3W A;  4IN3 A;  3A54 A;  2BA1 A;  3PGZ A;  2B2T C;  3SK5 A;  1Q8I A;  4FXD A;  1ESF A;  1JC7 A;  1EZ6 A;  1I50 H;  1TS3 A;  3RUZ A;  3DWP A;  3Q24 A;  1M4V A;  2HT1 A;  2RHQ B;  5M5W H;  4A4I A;  2IX3 A;  3HGB A;  2IWH A;  1I50 B;  3T56 B;  1FNV A;  1UE7 A;  2F4I A;  4DV6 L;  4JI2 Q;  3OIP A;  1AE3 A;  3EN2 A;  2Z4I A;  2C9O A;  3S14 B;  1EYG A;  2JA5 H;  4A3D G;  1T5E A;  1JMC A;  1E2V A;  3X3M A;  3ZJY C;  5M5X H;  4IUV A;  3CXC A;  1O7Z A;  3HOX G;  1SN8 A;  5NUC A;  1YVC A;  1RDP D;  1PFM A;  5EBD A;  2NVX B;  5E4X A;  2IHE A;  4KTA A;  4YCV A;  3VR2 A;  3J81 i;  1FJG L;  2R3Z A;  5KNB A;  2L4N A;  2YTV A;  1K0S A;  3AFP A;  1YNN D;  1G29 1;  1WOC A;  2SNM A;  1ET9 A;  1PZI D;  2DY8 A;  4J15 A;  1GJX A;  3BVM A;  3CF5 A;  5CV9 A;  2MO0 A;  4JI3 L;  2EYF A;  4LF5 L;  1DD2 A;  1UWV A;  1A15 A;  4LMQ D;  2Q2T A;  1KLG D;  4GN3 B;  3MHB A;  1PMR A;  4B3M L;  1NMF A;  1PZK D;  4DV6 Q;  3KF6 A;  3S1R B;  5CMD A;  4JYA L;  1K8O A;  3JAM E;  3S17 B;  2KEE A;  4NXN L;  5C3E G;  3I4M B;  4KHV A;  1ICW A;  2JSO A;  2XWJ B;  4PNY A;  4GN4 B;  1EUJ A;  2B2Y C;  3K58 A;  2Z6K A;  1TWA B;  3ND8 A;  3QOJ A;  4L6T B;  4UP8 A;  3HOV G;  4QF4 A;  5IT9 L;  1F77 A;  4HJ9 A;  4LFC L;  4LF4 Q;  1ILP A;  5FLX L;  1JWU D;  3AYH B;  4LAA A;  4A3L H;  3I91 A;  1WTO A;  3V96 A;  4JOI C;  2BCO A;  1U4L A;  1SNM A;  1N32 L;  2K5D A;  2BH8 A;  2IHF A;  2MO1 A;  4DR3 Q;  3DM1 A;  1TU2 B;  4B3R Q;  5DNF A;  4ZQ3 A;  2EJM A;  2EY2 A;  2QDB A;  2ZJR A;  3R8B A;  3CAM A;  2LY7 A;  5ELC A;  5M3F B;  4KK7 A;  3KBX A;  3MVV A;  2F0N A;  3EVQ A;  3RLF A;  4X64 L;  1SYD A;  4JYA Q;  3I4M G;  1F2L A;  4EX5 A;  1U0L A;  4A3M H;  4IAL A;  4ULL A;  5C6A A;  3L2P A;  1ICF B;  4WRD A;  2EY5 A;  2PQA B;  2WAQ B;  1EOV A;  4S3S A;  1EY9 A;  1STB A;  2RCF A;  1QVG A;  1STE A;  3KDF B;  4IUN A;  5CV5 A;  1VQ6 A;  3OSO A;  2VL6 A;  1QVF A;  2A6E D;  3D4W A;  4NDX A;  3MZ5 A;  3TRE A;  2I07 B;  5EQ0 A;  1N34 Q;  4IJH A;  4X62 Q;  5C0X I;  2LFN A;  5IYD G;  1BKB A;  1VQL A;  3K5O A;  3PIO 3;  1IZ6 A;  3S1M B;  2WB1 E;  3VYS A;  3E0E A;  1TS2 A;  4X3K A;  3TP6 A;  1UE5 A;  5JJZ A;  5EPJ A;  4Z9C B;  2BOS A;  3TP5 A;  2F0T A;  1TWF B;  3TRZ A;  2JYO A;  1IBK L;  3AQQ A;  1KD1 C;  1VS0 A;  1A0I A;  2FXQ A;  3M85 A;  1U9R A;  3SK4 A;  3RN2 A;  4H0L C;  1TWC B;  1XNQ L;  1E1O A;  3S1N B;  2ID0 A;  2F52 A;  1A2T A;  1D7Q A;  3TP7 A;  4EQ5 A;  5HUR A;  2E5L Q;  4KD3 A;  4O1N A;  3QWN A;  2Q2U A;  1Q1B A;  3QIA A;  4LF9 Q;  3UE1 A;  3MEH A;  4PV1 C;  3D3R A;  4QQB X;  2D0P A;  5M5X B;  1LM0 A;  4ZUJ A;  2P5Z X;  1MI2 A;  1HUN A;  1G6Z A;  1YHB A;  4DAP A;  4A75 A;  1XMQ L;  1PH1 A;  2UUB Q;  1CK1 A;  2KVM A;  4UP7 A;  2Z4H A;  4DV2 Q;  1TWG H;  4R8N A;  4CKC A;  4ZAI A;  4BXX H;  1W2B A;  4JI1 L;  5GAE C;  3OMG A;  4K5V A;  5K5P A;  4BY1 B;  1V8Q A;  2XSC A;  3A8J E;  3D4R A;  3GTM H;  3MEF A;  4ZKC B;  4OHJ A;  4OIK A;  2AUJ D;  5FO8 B;  2WKD A;  5CYU A;  1AZP A;  3TDQ A;  4EQO A;  1Y1V B;  4MNO A;  3K59 A;  2OF1 A;  3W3A A;  1C0A A;  5M5Y B;  1J6Q A;  4V0B A;  1EY8 A;  5LMN Q;  3E6Z X;  1HXY D;  5AJ3 L;  5ELB A;  1K28 A;  4RKL A;  3DEO A;  4K0K L;  4ABN A;  2L5T A;  2KHS A;  4AQY L;  1KAW A;  1Y1V H;  3S16 H;  4RA8 A;  4DUZ Q;  1X54 A;  1PTO B;  1SR3 A;  3MXU A;  4CBV A;  2BH2 A;  4YWK A;  3G6E A;  2RF4 A;  1X32 A;  3L0O A;  5I6Y A;  4DPG A;  3PUW A;  4BY1 H;  1KTK A;  5GQO A;  1EY5 A;  2VY3 A;  1TQO A;  1V1P B;  4DXG A;  4DV3 L;  1ROD A;  1SRU A;  3GD7 A;  4HTH A;  5C44 G;  2KJX A;  2EYL A;  1B3A A;  1VMP A;  2JA6 G;  1JCK B;  2UUA Q;  2JA8 G;  4A3C H;  1HR0 Q;  2O5I C;  3CW2 C;  2IY5 B;  3H09 A;  4IUP A;  3BZC A;  4R9W A;  2OQK A;  4HMJ A;  2DUD A;  3V05 A;  3G7L A;  2VB2 X;  3PIP A;  2MPM A;  3ULP A;  2F0U A;  1IKL A;  3LGJ A;  2WIN B;  1TS4 A;  1KLU D;  2FMC A;  3K8A A;  1EFI D;  3CCM A;  1WD0 A;  1B7Y B;  3BU2 A;  1SSO A;  1EQV A;  1ASY A;  3CCJ A;  1TXY A;  4ME5 A;  1H9S A;  2R7Z H;  1CZG A;  2A6H C;  2F0G A;  1TWC H;  1S3O A;  3NXW A;  1XXG A;  3D0F A;  3NTH A;  2CWP A;  4F88 A;  4X62 L;  3BVG A;  5C4J B;  1F9S A;  4KY6 A;  4I7A A;  3K0Y A;  4DFA A;  1I6H B;  1BCP F;  2GN5 A;  3HP3 A;  3IAY A;  1P8L A;  2G5D A;  1DOM A;  1OO9 B;  3T53 B;  3KF8 A;  5IOC A;  4J8Q A;  1HQM C;  3I70 A;  1XNR Q;  3NQT A;  1M1K C;  1DOL A;  1B50 A;  2KHJ A;  2LMC B;  2WP8 J;  1H9R A;  4QIW E;  4QUF A;  1NJI C;  1BCP B;  3PO2 H;  1F2Y A;  4DV5 Q;  3HOV H;  2I5L X;  4BBR B;  3CQZ H;  1D1K A;  4LJZ C;  4A3G H;  2NZH A;  4BXX G;  3OYY A;  1JIC A;  3VR5 A;  1VQO A;  2F1M A;  4JV5 L;  3STB D;  2JEA I;  3GTL B;  1TT2 A;  2RKS A;  2H4O A;  2A5H A;  2L9H A;  4RG1 A;  1JE5 A;  2SNS A;  2F0V A;  1K3R A;  3PQI A;  4K2K A;  3RZD B;  2A69 C;  4A3M B;  5LMU L;  4DAV A;  5K36 H;  3X3N A;  2K14 A;  2JA6 B;  2JA8 B;  5ELF A;  1SNO A;  4P2C B;  2NVT B;  1Z47 A;  5M3F H;  3ERS X;  2K05 A;  5H1S E;  1KQS A;  5IYB H;  1KAB A;  1NAP A;  3PV0 A;  5COY A;  4YHH L;  2F4V Q;  1F9R A;  4OO1 G;  4IFD H;  2PNR C;  3BZD B;  3HKZ E;  1MD2 D;  4XXE A;  1OXV A;  3H6M A;  5T1G A;  3RZO H;  5LMN L;  4BBS B;  2SEB D;  2J7Z A;  4LFA Q;  3CC4 A;  1PTO F;  1UEA B;  2F0D A;  2PYK A;  5LHY 1;  4C1N I;  1F9P A;  3CC2 A;  3M4Y A;  4DAY A;  3H0G H;  3DHQ A;  3M3Y H;  1XX8 A;  4LF6 Q;  3Q6S A;  1QG7 A;  1WTP A;  3GTQ H;  3QB3 A;  2E2I H;  3NHH A;  3QO2 A;  2F0Q A;  3CCR A;  1TKW B;  1B9M A;  2K5W A;  2HDL A;  4LF7 Q;  1HZ9 A;  5C0X H;  1SYB A;  4DR5 L;  1M90 C;  4TKO B;  1LTT D;  2YU9 H;  5EJW A;  2D2C C;  1HZA A;  2NZO A;  2K5H A;  4GN5 A;  1PDQ A;  3ND9 A;  3Q23 A;  3BS1 A;  3RN5 A;  3CCU A;  4A3K H;  3KUP A;  3OTO Q;  3R93 A;  1HFG A;  1YZ6 A;  1YJW A;  3PSI A;  3ULL A;  1MHW C;  2K52 A;  5C0X J;  4HJ8 A;  1UE1 A;  3W5O A;  4A93 B;  1TII D;  2ZXP A;  3P20 A;  4B3S L;  1PYB A;  1PTO H;  1Q12 A;  2Z6K C;  5D14 A;  4ZKB B;  4R1J A;  1K8A C;  5EPK A;  2B39 A;  4DR4 Q;  1DON A;  2RDG A;  2RSO A;  1X3E A;  3UDI A;  1IBM L;  4DR2 Q;  3T1Y Q;  1YI2 A;  1IYU A;  2AHO B;  1QJO A;  1JJG A;  5CR3 A;  2UXB L;  4APV A;  4AYB E;  2B63 G;  1HJP A;  2JJQ A;  2LXJ A;  3W1G A;  3OW7 A;  1EIG A;  5C0X G;  3CPW A;  4MIU A;  2JA7 B;  1GHK A;  1YNN C;  5JOB A;  4Q5V A;  2R92 G;  1BCP D;  1LT6 D;  1CHP D;  3GTM B;  3H0G B;  1BOS A;  2HD3 A;  1BO0 A;  5COR A;  1STN A;  1SEB D;  2EZV A;  1LTR D;  1LAC A;  5I2X A;  1WD1 A;  1AE2 A;  1EZ8 A;  2X6G A;  5ELD A;  4CJ1 B;  4NKL A;  1HPC A;  1TWG B;  2AWO A;  5M3F G;  4XIG S;  2EIF A;  3FKI H;  4QMG A;  1DOK A;  4LNQ A;  3I72 A;  3U4V A;  4HID A;  1I4R A;  4JI4 L;  1BUV T;  3GV6 A;  1E3P A;  1TWH B;  2PZW A;  4MN3 A;  2RA4 A;  2IPK D;  2OT2 A;  5KYL A;  1YHQ A;  4GKJ Q;  2QDL A;  1DZ1 A;  2WAC A;  4KN4 C;  1P16 A;  4HIO A;  1A62 A;  1PYS B;  1AH9 A;  3EBE A;  3HOX B;  2WKC A;  4OL7 A;  4BY7 G;  2JA9 A;  3A5Z B;  3M4Q A;  5JAV A;  4GKK Q;  4JBM A;  2JA6 H;  2JA8 H;  1N33 Q;  3LX0 A;  2Q2I A;  3CME A;  4GOP A;  1LT5 D;  2B63 H;  4PQX A;  3RR5 A;  3RZD H;  1U4R A;  3F1Z A;  4OEM B;  4A3I B;  2K5V A;  4FF4 A;  2ZM6 Q;  2KBN A;  4DR5 Q;  1Y8P B;  1A3V A;  2VNU D;  1HFN A;  4F87 A;  5A35 A;  3S1M H;  2MFI A;  1BVS A;  5C3E B;  4K8I A;  4UAI A;  2ASB A;  4H7B A;  3HOV B;  2G9H D;  4DV4 L;  1KXL A;  3RLO A;  1I4Q A;  2EQS A;  4GKJ L;  2CVR A;  4GKK L;  2CKZ B;  1K73 C;  3HOW B;  2R7F A;  1Y14 B;  5FJ8 H;  4K2L A;  4AYB G;  1I94 L;  1RHP A;  3K7A B;  4A3B B;  3CHB D;  2R93 G;  1I6H H;  1LTL A;  3A7A B;  1H9M A;  1PV4 A;  3DEP A;  1VQH A;  2IW3 A;  5IYD H;  4O0A A;  2E74 C;  3CCQ A;  3J80 L;  3PIP 3;  2CH4 W;  4JW0 A;  5FO9 B;  4DR2 L;  2BE5 D;  3PO3 G;  3I73 A;  3VR3 A;  4BBS G;  1GXD C;  3HOY B;  1LT4 D;  2DJG C;  1E2W A;  1KIX A;  2B63 B;  4HIK A;  4OEL B;  4ODG A;  3K6O A;  4YY3 Q;  2VQF Q;  2KEN A;  4C2M H;  4IOC A;  4ZUI A;  4N8X 1;  2XTI A;  4N9P A;  1SNQ A;  3FEW X;  1XTD A;  2NN6 I;  1FL0 A;  4FF2 A;  2R93 B;  1PLF A;  2L11 A;  2NYZ D;  4FXK C;  3HEJ A;  2IX1 A;  1HR0 W;  3HOW G;  3MA2 B;  2V4D A;  1KHI A;  5J39 A;  3GTP H;  2N49 A;  4DK1 A;  4BWG B;  2XWB B;  5TSS A;  1KNE A;  3AFQ A;  1ET6 A;  2PPB C;  2ATW A;  1H9K A;  1RTN A;  2BDO A;  2X69 A;  2WII B;  1HNZ L;  5CV6 A;  1Q1E A;  3OWE B;  2RDF A;  2CHB D;  1FGB D;  2KCN A;  1TR5 A;  3G48 A;  4JVZ A;  1E7Z A;  2LKV A;  1SMY C;  3S1R H;  3GDE A;  1CA6 A;  4DR7 L;  4RGT A;  1SE4 A;  1Q46 A;  5JJI A;  1KL9 A;  1GVP A;  4R4I A;  2VQE L;  1S40 A;  1QOH A;  3G71 A;  4C3I B;  4BBR G;  4FF1 A;  4PZ8 A;  2VQF L;  2V1C C;  2VS1 A;  1XWE A;  1Q86 C;  1X9N A;  3HG9 A;  4P75 A;  1D6E C;  3A8I E;  1FD7 D;  1E0B A;  4G7Z C;  4C3J H;  3G4S A;  5IGG A;  5LL6 S;  4B3T L;  2QA4 A;  1EEF D;  1SFO H;  4K8J A;  5KYI A;  4F8M A;  2KCM A;  1LTG D;  1ENF A;  1ZXT A;  3O13 A;  1UAP A;  1GM5 A;  1B1Z A;  5FLX c;  1XMQ Q;  1STA A;  3EFX D;  4H44 C;  5IGD A;  1GOZ A;  1CTM A;  2VW9 A;  4IUU A;  4X64 Q;  4LF8 L;  1YBY A;  1HA5 A;  1HCZ A;  5I6W A;  4A3E B;  1AFP A;  1WTH A;  1A3U A;  3NWS A;  1EY4 A;  1SNC A;  5ELN A;  1ZEQ X;  3CMA A;  1QCB D;  2F3I A;  2E75 C;  2LS0 1;  3G6J B;  5JPN C;  2B3G A;  3AMU A; 
#chains in the Genus database with same CATH homology
 3HOU H;  4AQY L;  1QUQ A;  2EXD A;  1KAW A;  1L2F A;  1Y1V H;  3I2Z A;  5IYC H;  1XNQ Q;  2YYZ A;  4GNX C;  2I0Q A;  3S16 H;  3H15 A;  4JCV E;  2PNH A;  4DUZ Q;  1FGU A;  1K0R A;  1SR3 A;  1X54 A;  2RCN A;  4DKA C;  2BH2 A;  4YWK A;  4DV2 L;  4JOI A;  3M9B A;  2R7Z G;  5BR8 L;  3G6E A;  2RF4 A;  4A93 H;  3S1N H;  3FKI G;  3L0O A;  4DPG A;  3PUW A;  4BY1 H;  5GQO A;  3A74 A;  5BR8 Q;  4MTN A;  1VQF A;  2VY3 A;  5JEA G;  4LF4 L;  1E24 A;  4DV3 L;  1SRU A;  3GD7 A;  3KF8 B;  5C44 G;  4JI7 L;  3UDG A;  4LF5 Q;  5EAY A;  1HZC A;  4DK3 C;  2OWO A;  2JA6 G;  2JA8 G;  2JQO A;  2N3S A;  4PG3 A;  1HR0 Q;  2UUA Q;  4A3C H;  2OTJ A;  4NXM L;  4WJ4 A;  3CW2 C;  4A3D H;  2IY5 B;  1HNX Q;  3Q8D A;  3BZC A;  5FLM H;  2OQK A;  2DUD A;  1ASZ A;  1X3G A;  2Z0S A;  4C3I H;  4QJF A;  3JAM i;  3I7F A;  3PIP A;  1G51 A;  1I3Q H;  3NEL A;  1HNZ Q;  3ULP A;  3I55 A;  4P72 A;  4MZ9 A;  1MJE A;  3LGJ A;  5IYB G;  5IT9 c;  2R93 H;  3HKS A;  1DGS A;  2ZTC A;  3K8A A;  3CCM A;  4K0K Q;  1YEZ A;  2JE6 I;  1B7Y B;  3BU2 A;  3K7U C;  3KLW A;  5IP9 H;  5IP7 G;  1ASY A;  3CCJ A;  1TXY A;  1OXU A;  1EQQ A;  4H02 A;  3RLN A;  2UU9 Q;  2KHI A;  4OON A;  2R7Z H;  3H3V H;  3KOJ A;  4BA2 I;  1MKH A;  1C9O A;  5GAD C;  4DR1 L;  4RMF A;  2AMC B;  1EIY B;  4KHP L;  1TWC H;  1S3O A;  2OTL A;  1VQN A;  4A3F H;  4TQU S;  3T1H Q;  1KRT A;  1CUK A;  3D0F A;  2K4K A;  1VQA A;  2CWP A;  1XPR A;  2NVQ H;  4X62 L;  3A0J A;  4DV7 L;  4GLX A;  2R92 H;  4IO9 A;  3NEN A;  3S24 A;  1WCM G;  1QZG A;  4BBS H;  1LYL A;  4A3B H;  2UXD L;  2GN5 A;  1FJG Q;  4DV7 Q;  1VQ5 A;  1B8A A;  1P8L A;  3CCV A;  1IBL L;  5JJK A;  4JI5 L;  4JBK A;  1BBW A;  1R9T H;  4LUV A;  2HIX A;  1CSP A;  5C44 H;  1XPO A;  3S2H H;  4A3G G;  3UE0 A;  3F2D A;  3ULJ A;  2PMZ E;  2MQH A;  3F2C A;  1YIT A;  2UXB Q;  5GRO A;  1JJ2 A;  5GAH C;  1XNR Q;  5HGQ A;  1M1K C;  2HHH Q;  2D0O A;  2YTX A;  4GOP C;  4B3R L;  4JI7 Q;  2KHJ A;  4ALP A;  2WP8 J;  5IWA L;  3PCO B;  4QIW E;  1NJI C;  3PO2 H;  1WJJ A;  4DV5 Q;  1U5K A;  2I5L X;  3HOV H;  4HJA A;  3K0X A;  2H5X A;  3CQZ H;  5IYC G;  1PFS A;  1SRO A;  3D31 A;  4NPS A;  2UXC Q;  1OXT A;  2PI2 E;  1I94 Q;  2UUC L;  1GD7 A;  2K5N A;  2F4V L;  3M7N A;  4A3G H;  1GO3 E;  2NZH A;  4BXX G;  3OYY A;  3PF5 A;  1QUQ B;  1X56 A;  1BBU A;  1VQO A;  4JI2 L;  1VQP A;  3H3V I;  4OXP A;  4JV5 L;  3W1B A;  1WI5 A;  3HFZ B;  2B29 A;  1EWI A;  1VQC A;  4OWT B;  3STB D;  3KF6 B;  4DUY L;  2ZJP A;  4POG A;  2JEA I;  1WFQ A;  2K50 A;  4LFC Q;  4NB3 A;  3B6Y A;  5GAG C;  3SGI A;  1I5F A;  4RG1 A;  4LFB Q;  1JE5 A;  1SLJ A;  5IE8 A;  3J81 c;  3CC7 A;  4OO1 I;  1KC8 C;  1HNX L;  1K3R A;  4JI5 Q;  2CCZ A;  3K7A H;  3J80 c;  2E2H H;  3PO2 G;  4LFB L;  4Y7N H;  5LMU L;  4A3M G;  1YJ9 A;  4DR3 L;  2K14 A;  4LF6 L;  3HOW H;  3KYH C;  4UP9 A;  4JV5 Q;  1J5E L;  1RIP A;  1Z47 A;  1L1O A;  1OTC A;  3I4M H;  2HIV A;  3T1H L;  1SMX A;  5M3F H;  4LF7 L;  3ERS X;  3M4O H;  4DV5 L;  1Y1W H;  5H1S E;  3DM3 A;  1KQS A;  3GTG H;  5IYB H;  3M4P A;  5J3B A;  3PV0 A;  1G6P A;  2E8G A;  5IY0 A;  1PH3 A;  1NBW A;  2F4V Q;  4JC0 A;  4YHH L;  4IOA A;  5C3E H;  4BY7 H;  4OO1 G;  4HJ5 A;  3VDY A;  3CP0 A;  4A3E G;  4LUO A;  1VQJ A;  3HKZ E;  1OXV A;  3T1Y L;  3PO3 H;  4IJL A;  4P71 A;  2R7D A;  1IBM Q;  3RZO H;  5LMN L;  4KHZ A;  4WJ3 M;  4LFA Q;  3CC4 A;  2A19 A;  5C4J H;  2ZJQ A;  2N8N A;  4A3J G;  4PZ6 A;  4YWL A;  4DAY B;  2I5H A;  3GO5 A;  4DAM A;  1TWA H;  1CSQ A;  1PH5 A;  4LFA L;  3HOY G;  3CC2 A;  1V43 A;  2ZTE A;  3JC6 6;  4BY1 G;  5FJ8 G;  3A5U A;  3H0G H;  4DV1 Q;  3U58 A;  1PH9 A;  4BA1 I;  3PF4 A;  4LF6 Q;  3M3Y H;  4B3M Q;  2CFM A;  5DLQ E;  4DV4 Q;  3GTQ H;  1Y1V G;  3JAM c;  1VQD A;  2E2I H;  2WFW A;  4X66 Q;  4A76 A;  2VZA A;  1YHA A;  4JG2 A;  3DLL A;  2JEB I;  2R6G A;  1A8V A;  3I4O A;  3OW2 A;  2NVX H;  2CQO A;  2D62 A;  3ER0 A;  2I5M X;  2OQ0 A;  3CCR A;  1PH7 A;  1B70 B;  2UU9 L;  1A63 A;  3OTO L;  1HNW Q;  2BA0 A;  2VUM H;  2LXK A;  4DR7 Q;  3K80 C;  4LF7 Q;  1NE3 A;  1TWH H;  1HZ9 A;  4DUY Q;  3GTK H;  3HOZ G;  3E9I A;  2Y0S E;  1VQE A;  3PIO A;  4DR5 L;  2AWN A;  4XTC S;  1PH4 A;  1M90 C;  4L5T A;  1W3S A;  1FVI A;  5C4X G;  2YU9 H;  3AEV A;  1N32 Q;  4LUZ A;  5M5Y H;  3CPF A;  1Y1W G;  1EQR A;  2MNA A;  1RL2 A;  1L1O B;  1J5E Q;  1HZA A;  2BA1 A;  2NZO A;  2K5H A;  3PGZ A;  1PHJ A;  1IBK Q;  4Y52 H;  4GN5 A;  4O2D A;  3S14 H;  3RN5 A;  2DGY A;  3CCU A;  4A3K H;  1YNX A;  3OTO Q;  2LSS A;  3E9H A;  4JI8 Q;  1I50 H;  3KJO A;  1Q81 C;  1YZ6 A;  3HKZ G;  1YJW A;  3PSI A;  3NEM A;  3UDX A;  2RHQ B;  3ULL A;  3F2B A;  2K52 A;  5C0X J;  5LMN W;  1VQ8 A;  2HT1 A;  4HJ8 A;  5M5W H;  4NXN Q;  1UE1 A;  3W5O A;  2YTY A;  4A4I A;  5FLM G;  4B3S L;  4IPC A;  1PYB A;  1UE7 A;  1EIF A;  1KRS A;  4DV6 L;  1Q12 A;  2E2J H;  4IFD G;  2Z6K C;  4JI2 Q;  1MJC A;  2ZTD A;  1AE3 A;  3EN2 A;  4ME3 A;  4R1J A;  1K8A C;  1EYG A;  2JA5 H;  1VQB A;  2ZM6 L;  2UUC Q;  4DR4 Q;  2JK8 A;  1JMC A;  4A3D G;  1NMG A;  4JI3 Q;  1CKN B;  1X3E A;  3MXN B;  3UDI A;  3ZJY C;  5M5X H;  1IBM L;  1YJN A;  3GTJ H;  2PQA A;  4L5R C;  3PUX A;  3CXC A;  4DR2 Q;  3T1Y Q;  1V1Q A;  4GS3 A;  3HOX G;  1YI2 A;  3S1Q H;  4P73 A;  2AHO B;  1SN8 A;  1VQ9 A;  1JJG A;  2UXB L;  4APV A;  1YVC A;  4AYB E;  2B63 G;  2HHH L;  1HJP A;  1IYJ B;  2JJQ A;  3FHW A;  4IFD I;  1EFW A;  2A8V A;  2LXJ A;  2IHE A;  3W1G A;  1IXR A;  3EIV A;  4YCV A;  5C0X G;  3J81 i;  3CPW A;  1Z9F A;  4LF8 Q;  1FJG L;  1N34 L;  4OX9 Q;  4JBW A;  1WCM H;  1N36 Q;  4LF9 L;  3KFU A;  2YTV A;  2R92 G;  3AFP A;  5HY6 A;  2NN6 G;  1G29 1;  1WOC A;  3PUZ A;  1N36 L;  4JI1 Q;  3PUY A;  4OWX B;  3F8T A;  4IPH A;  1LUZ A;  4P74 A;  1AE2 A;  1Q82 C;  4J15 A;  4LWC A;  4AH6 A;  1OXX K;  2HQL A;  3CF5 A;  4YHH Q;  1TWF H;  2MO0 A;  2AWO A;  1HNW L;  1OXS C;  3H0G G;  4JI3 L;  5M3F G;  4QY7 A;  4XIG S;  4LF5 L;  5K36 G;  2EIF A;  3FKI H;  4JI6 Q;  1UWV A;  2Q2T A;  4DV0 L;  1XMO L;  4LNQ A;  3U4V A;  4HID A;  4JI4 L;  2UUB L;  4GN3 B;  3HOZ H;  1E3P A;  2GVA A;  4YCW A;  4GLA C;  4B3M L;  4GKJ Q;  1L0W A;  3WWV A;  1NMF A;  5C4X H;  1YHQ A;  4R4O A;  4DV6 Q;  2JA5 G;  1P16 A;  4HIO A;  4A3B G;  3KF6 A;  1A62 A;  1PYS B;  1AH9 A;  3EBE A;  4JYA L;  2ES2 A;  4NXN L;  5C3E G;  2JA9 A;  3A5Z B;  4BY7 G;  1X65 A;  3M4Q A;  4X65 L;  1HH2 P;  1N9W A;  3KDF A;  4DR1 Q;  4GKK Q;  1PVO A;  4JBM A;  2JA6 H;  2JA8 H;  3TS0 A;  1N33 Q;  2Q2I A;  3CME A;  4GOP A;  2B63 H;  4GN4 B;  4X65 Q;  3I4N H;  1EUJ A;  3RR5 A;  3BJU A;  3RZD H;  2Z6K A;  1MIU A;  4UP8 A;  3HOV G;  1HZB A;  4YCU A;  3F1Z A;  1D8L A;  2WAQ E;  4R4T A;  3TQY A;  2UXD Q;  1X6O A;  2YV5 A;  2K75 A;  2K5V A;  4LFC L;  4HJ9 A;  1PH6 A;  1PH8 A;  2ZM6 Q;  4LF4 Q;  3J81 j;  5JJL A;  2QGQ A;  3L7Z C;  2KBN A;  4GLV B;  2PI2 A;  3AYH B;  4DR5 Q;  1CKN A;  4DUZ L;  4A3L H;  2UXC L;  4JOI C;  3GTO H;  4PZ7 A;  1N32 L;  2VNU D;  2BH8 A;  2IHF A;  1N33 L;  3S1M H;  2MO1 A;  2XGT A;  1N8R C;  4DR3 Q;  5AJ3 Q;  2MFI A;  1BVS A;  4B3R Q;  3TEH B;  1QZH A;  3PUV A;  4X66 L;  2ASB A;  2ZJR A;  4YWM A;  3CAM A;  4AQY Q;  4DV4 L;  4JI8 L;  3RLO A;  1KXL A;  1SE8 A;  1XNR L;  4UY8 C;  2EQS A;  4GKJ L;  2AKW B;  4GKK L;  4OX9 L;  2NVT H;  4IPG A;  2CKZ B;  1NY4 A;  1K73 C;  1JB7 A;  4DK6 C;  4X64 L;  3RLF A;  1JJC B;  4JYA Q;  2KCT A;  4L5Q A;  3I4M G;  1K83 H;  2R7F A;  1Y14 B;  2RHS B;  5ELO A;  5FJ8 H;  1U0L A;  4PMW A;  4EX5 A;  4YY3 L;  4A3M H;  3HOY H;  4AYB G;  1I94 L;  1NTG A;  2IX0 A;  2R93 G;  3L2P A;  3S2D H;  4GNX B;  1LTL A;  3BZK A;  1I6H H;  1PV4 A;  5IP9 G;  3NBH B;  1VQH A;  5IP7 H;  2PQA B;  4A3I H;  5IYD H;  4O0A A;  5E7N A;  3CCQ A;  2UUA L;  3CCL A;  1VQG A;  4R4C A;  1VQM A;  3GTL H;  1EOV A;  2QEX A;  4DR2 L;  4JI6 L;  3CCE A;  4GOP B;  3PO3 G;  1E1T A;  4BBS G;  4JI0 Q;  1V9P A;  1KIX A;  4HIK A;  3K81 C;  1QVG A;  3KDF B;  4YY3 Q;  2VQF Q;  2KEN A;  4C2M H;  4IOC A;  4KI0 A;  2Y0S G;  1VQ6 A;  1VCI A;  1IBL Q;  2VL6 A;  2ALY B;  2WAQ G;  3U50 C;  2XTI A;  1QVF A;  1XTD A;  4BBR H;  2NN6 I;  1X55 A;  2WB1 G;  1FL0 A;  3TRE A;  1N34 Q;  5M3M H;  3S15 H;  4IJH A;  4X62 Q;  4DR6 Q;  5C0X I;  2IX1 A;  4OWW B;  5IYD G;  1WYD A;  3RNU A;  1HR0 W;  4KHP Q;  3HOW G;  4GNX A;  1BKB A;  1HR0 L;  1VQL A;  4DNI A;  4NXM Q;  1IZ6 A;  2WB1 E;  3U4Z A;  4DV3 Q;  4C3H H;  3E0E A;  4R4Q A;  4IPD A;  4A93 G;  1KHI A;  1YIJ A;  1UE5 A;  3GTP H;  2OCE A;  2N49 A;  1VQ4 A;  3TRZ A;  1IBK L;  3AQQ A;  1KD1 C;  1VS0 A;  1A0I A;  2FXQ A;  3M85 A;  3AFQ A;  2IT1 A;  1PH2 A;  3RN2 A;  4KLK A;  2ATW A;  3J7A 5;  1UEB A;  4AIM A;  1XNQ L;  1HNZ L;  1E1O A;  1CKM A;  1O7I A;  3TS2 A;  1Q1E A;  4A3F G;  2ID0 A;  2F52 A;  1D7Q A;  2JA7 H;  3KJP A;  5IWA Q;  4EQ5 A;  5LMU Q;  4QL5 A;  4LW1 A;  4A3I G;  1E22 A;  3G48 A;  1E7Z A;  3HOX H;  4HIM A;  3GDE A;  3S1R H;  4DR7 L;  1Q8K A;  1Q46 A;  2L15 A;  1X3F A;  2E5L Q;  5JJI A;  1KL9 A;  2NVY H;  2Q2U A;  1Q1B A;  1GVP A;  4L5S A;  4LF9 Q;  4R4I A;  3UE1 A;  2VQE L;  2CWA A;  4HJ7 A;  1S40 A;  4DV1 L;  4A3J H;  3CD6 A;  3G71 A;  4QQB X;  1XPU A;  2D0P A;  4BBR G;  2A1A A;  1LM0 A;  4DR6 L;  4FDB A;  4PZ8 A;  2VQF L;  2V1C C;  1CKO A;  1VQI A;  2VS1 A;  5M3M G;  1YHB A;  1UE6 A;  4JBJ A;  1X9N A;  1Q86 C;  4A75 A;  1XMQ L;  1PH1 A;  4JI4 Q;  4P75 A;  2UUB Q;  1QVC A;  4UP7 A;  4DV2 Q;  1C7Y A;  2VUM G;  1TWG H;  4UPA A;  4C3J H;  3G4S A;  4JI0 L;  4B3T L;  2QA4 A;  4BXX H;  3CCS A;  1W2B A;  4DV0 Q;  1XMO Q;  1PA6 A;  1SFO H;  4JI1 L;  5GAE C;  4B3T Q;  2C35 B;  3GTM H;  2KCM A;  1L1O C;  3MEF A;  1VQ7 A;  4TVA B;  3UDF A;  4A3L G;  4X6A H;  1T9H A;  1Q7Y C;  2Q2H A;  3IRB A;  5FLX c;  1GM5 A;  1XJV A;  4DR4 L;  1XMQ Q;  4A3K G;  1K8G A;  1VQK A;  4B3S Q;  1S72 A;  2VW9 A;  4MNO A;  3STB C;  4X64 Q;  3HOU G;  4LF8 L;  4IFD J;  1YBY A;  3ICE A;  3I4N G;  3FP9 A;  2VQE Q;  1C0A A;  3J80 i;  1GKH A;  1J6Q A;  1IL2 A;  4QGU A;  2JA7 G;  2E5L L;  3J7Z C;  5LMN Q;  2GVB A;  4POF A;  3S17 H;  3I56 A;  5ELN A;  5AJ3 L;  3CMA A;  4A3E H;  5JEA J;  2N78 A;  2F3I A;  4K0K L;  1H95 A;  1K9M C;  4A3C G;  2B3G A;  1JT8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...