1D1IA

Mutated shiga-like toxin b subunit (w34a) complexed with receptor gb3 analogue
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
69
structure length
69
Chain Sequence
TPDCVTGKVEYTKYNDDDTFTVKVGDKELFTNRANLQSLLLSAQITGMTVTIKTNACHNGGGFSEVIFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Toxin
molecule keywords SHIGA TOXIN B-CHAIN
publication title Mutated Shiga-like Toxin B Subunit (W34A) Complexed with Receptor Gb3 Analogue
rcsb
source organism Escherichia coli
total genus 16
structure length 69
sequence length 69
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 1999-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.70 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1d1iA00
1QNUA 4P2CB 2BOSA 1D1KA 1CQFA 2XSCA 1DM0B 1CZWA 1R4QB 4ULLA 1CZGA 1D1IA 1C48A 1R4PB 1QOHA 2GA4B 4M1UB 3MXGA 1C4QA 2C5CA 1BOSA
chains in the Genus database with same CATH superfamily
1LTID 2PCFB 3TN2A 5EBDA 5D3DA 5JAVA 4AYBE 1IBLQ 2Z4HA 4L8JA 1Y69U 3O13A 1WVLA 4LFCL 3M4YA 3L2PA 3J80i 1R4QB 3GTPB 4JI7Q 4DR5L 3JC66 1E3PA 3PMFA 3ONAB 1YJNA 1HFNA 5HGQA 3IRBA 4DR2Q 2HIXA 4YWMA 4BA1I 3G6JB 1NR2A 4ALPA 1VQ7A 4K0KQ 4OX9L 1B3QA 2K5NA 2B8GA 5IGCA 2QW7A 3MXNA 1FGUA 1JJCB 1TWGH 3FEWX 4UP8A 2JA5G 2EYHA 1KHIA 5IYBG 3P20A 4CHTB 1AP0A 4JC0A 2EJFC 4B3RL 4WFN3 3EIVA 1BBWA 1BCPD 4ZUIA 2B2WA 1JMCA 2V1CC 3KDFB 5IP9H 4KLKA 2BDOA 2UXDL 1PRTC 2JA5B 2C5CA 2PNHA 3T56B 3VYRA 4LF4Q 1HUMA 1AW7A 4DV4Q 1G2SA 2FMCA 5M3FH 5EKLA 2R93B 3MTSA 1A6XA 2HUGA 2HD3A 4CJ2C 1D8LA 4FVMA 5C5LA 4IUUA 2KCMA 2F0OA 1FR3A 2G9HD 2VXWA 3GP7A 1F77A 2VS1A 1EFWA 4QCLA 1X3PA 3G48A 3PQIA 1TQOA 1VQAA 3OWFA 5AFWA 3UDFA 3GTOB 3KLWA 1ENCA 1BBUA 4PMBA 1QVFA 1Y1WB 2NN6G 5CR3A 1G51A 3AQQA 1O78A 3TP6A 2E75C 3HOUH 2LY7A 3IL8A 3RZOH 5FJ8G 2OTLA 1N34L 3RNUA 2F0MA 3SDZA 1N8RC 2G9DA 4S3SA 4K5WA 5C5MA 1HHVA 3IFDA 4U673 1QE6A 3K7AH 3GTKH 3I90A 1HJPA 3JAMi 5C0XH 1C9OA 4MN3A 1SNPA 3CRKC 5GAGC 4HMJA 1DOKA 4A3EG 3MAQA 1FYCA 5GADC 1LYLA 1VQCA 3OW7A 3CQZH 2N8NA 1XMQQ 1HXYD 4OWXB 1EYAA 1SFOH 2MPMA 2KJXA 1RCVD 1VQHA 4KKSA 2MO1A 4I7ZC 2Q8IB 1W3SA 1EY8A 3RZDB 1HA5A 4IUQA 2EXZA 4YIJA 1I4RA 4DF7A 3PIO3 4A3EB 1AEXA 1EWCA 3T13A 3NEMA 4BA2I 2Z4IA 5M3FB 4JI0Q 2TMPA 4OGQC 1UE6A 4DV2L 1TXYA 4X3UA 2Q8RE 2D62A 4BY1G 4G7HC 5CV9A 4DV3L 1WFQA 1HR0L 4EQ5A 1CKOA 4R9WA 2F0VA 3N52A 1NJIC 1SSOA 4JI2Q 1JT8A 1B2TA 2L1BA 5JPMC 1TWAH 3CKIB 4N8FA 4A3IH 1JJGA 2CW0D 4DKAC 1UUPA 1IHZA 1CKNA 2K5QA 4MZ9A 3T51B 4A3FH 1CSPA 5L37A 1AE2A 4JVZA 1UEBA 4A3LG 2EYPA 4JI3Q 4YCUA 3A5UA 2NZOA 1SJED 1S3OA 1BBXC 2IHEA 3J81c 1I50B 3HOUB 1Q81C 1X56A 4HIDA 3RZOB 3R3OA 4AH6A 3CCSA 2K04A 2OF1A 2NVXH 2KQ3A 3S17H 1I4PA 1TWFH 4B3ML 1VQ6A 4H7BA 4RA8A 4DV1L 4LF7Q 2YTVA 3IFTA 2RVLA 1JE4A 4GLAC 3J7YW 2KCTA 2OCEA 3K7AB 1EYGA 1ZYRC 1X3EA 1EY4A 1H9SB 1JCKB 1V8QA 3K80C 3K5NA 4OO1G 4LFBQ 1I94Q 1F9QA 2EOTA 1A3VA 1JWMD 4DV6L 3CQZB 2EY6A 3PIPA 4LJZC 2K03A 1SFOB 2B2UC 2F0QA 4XQQA 4DR7Q 2IW3A 5M5YH 3CW2C 4HSPA 2ZTDA 3UDGA 4DV7L 1I6HH 4KKTA 4FXDA 5M9OA 3RN2A 1G8ZD 3J80L 1XNRL 3S16B 4EGVA 1VQPA 2JQOA 2ZTCA 1RJTA 2Z1CA 2PMZB 2JA7H 1O80A 4F87A 4ZK9B 2YYZA 1TWHH 3K58A 3T1HQ 1DGSA 4DK3C 5KNBA 4LW1A 2K05A 4K5VA 2EYFA 3PIP3 3S1NH 1TIID 4A3JH 1QB5D 1RF2D 3GD7A 3OMGA 3MFYA 2R7FA 3VR6A 2IX1A 2ALYB 1B7YB 1PFSA 2EJMA 1YZ6A 5LMNW 3L7ZC 4HTHA 4X64Q 2FFKB 1CA6A 3MXPA 2VUMG 2RCFA 4KHPQ 1C4QA 1Q46A 2Z6BA 1FD7D 2M9VA 1K83B 3OIPA 4WORA 5EBCA 2EY5A 1N32L 4O1NA 1H9JA 1SNCA 4CJ1B 1C8CA 2OT2A 3T16A 4JI6L 1PZKD 1EQTA 4GN5A 1HA6A 1EFID 5CV7A 2VUMB 2R92H 1PYSB 1BCPF 4GOPC 1AZQA 4L6TB 1BUVT 1MSGA 4QUCA 4JBKA 5BR8Q 1TWFB 5FLMH 1PH9A 4POGA 5IYDH 1F2ZA 4K14A 3BDLA 3E0EA 3DEPA 2VW9A 3GTJH 4GKKQ 4NPSA 4JI5Q 5FLXc 1JOOA 4ZQ3A 3F2DA 2DY8A 4RAUC 2VQFQ 4A3KH 1EWHA 2AKWB 2IX0A 2L9HA 1GKHA 2R7ZG 1I6HB 2VQEQ 3K8AA 1PVOA 2RSNA 4ME3A 4OIJA 2N55A 4QMGA 2NVYH 1Q1BA 2QF7A 4K8JA 1HH2P 1RD9D 4I7AA 2UUCQ 3Q6SA 3M9BA 3PUVA 2YU9B 1L0YB 2LMCB 4L63B 1TWHB 1KDCA 1FJGL 4A3CH 2VB2X 2BA0A 3JAML 2F0GA 1MKHA 1QUQB 5I2YA 1IW7C 1LT6D 4A3JB 3BZDB 5GROA 1VQKA 3CC2A 4RCNA 4C1NK 5IE8A 1PZID 2A6ED 2EYOA 4BBRG 2A6HC 2R61A 2F0NA 3DM3A 1QG7A 2WP8J 1CQVA 4GLVB 2PZUA 5E7NA 3NBIA 1ENAA 3RMHA 3CCEA 1XTCD 2IPKD 4IPGA 2J0TD 4HR7B 5IWAL 3KK7A 4BBRB 1QZHA 3D4WA 3GTMH 2MGSA 2PYKA 4IQZA 4PZ8A 5CMDA 2EPBA 2R92B 2SEBD 1HTLD 2UUAQ 5DM73 4GKJL 3BJUA 1PMRA 3HOZH 3OW2A 3QIAA 1J6QA 2NZHA 3RN5A 1KXLA 4BXXH 3U4ZA 1ZEQX 3QOLA 1JB7A 3C2PA 1HNWQ 3T4AC 2K75A 4J8QA 2F0FA 3KBXA 2K52A 2F03A 1GXDC 5C4XH 3QWNA 4HIOA 3J7ZC 3E9IA 3TS2A 5IODA 2I5HA 2F4VL 2B63H 4QIWB 5D3IB 4A3KB 1T9HA 1I3QH 3W1BA 1FNVA 3PF5A 1LTBD 5GAEC 1Q86C 1YHAA 1V9PA 5KEEA 4LF9Q 1KDAA 4RHRA 3HOVG 3DM1A 1JOKA 2KOLA 2K1BA 2PMZE 3NWTA 4LAAA 3SXHA 2F0DA 3EBEA 2NVYB 1LM0A 3A8KE 4MTNA 3Q8DA 1ZYRD 1V1QA 4DAYB 4YHHL 3FKIH 2UUBL 1NUCA 2K28A 2O2LD 5KIXA 5C3WA 4L5RC 5FO7B 3W3AA 3HOVB 5IGBA 4UP7A 1B8AA 2B2YA 1EIYB 3PO3G 1SN8A 1DYQA 1YITA 3NTKA 3NK9A 3MWYW 1A0IA 1PTOB 3TSSA 4B3RQ 5KNDA 5IP7G 1NY4A 2IWHA 4DR3Q 4K8IA 3H6MA 4ZAIA 3UDIA 3PO2H 5FLXE 1HNXQ 1EZ8A 2IL8A 3K0YA 5M5XB 3S15H 4YWKA 1CFMA 1VDZA 5I6YA 3GTMB 1YI2A 4OELB 3C1EA 1TR5A 4DGZA 1WTRA 3OPOA 3HOZB 5C0XI 1GUGA 4DNRB 3A7LA 1HZBA 4JV5Q 3DLLA 5IGFA 2N49A 3FRPB 3NQIA 3P7JA 2JA8G 3H3VH 3TS0A 1KD1C 2GA4B 2KCNA 4R4TA 1NTGA 4M8AA 1O7IA 5BN4A 2TSSA 1PV4A 3TDQA 3EJIA 1KAWA 3K7UC 1QUQA 1T5XD 5I4DA 3G4SA 3D8GA 1PYWD 2BOSA 4YY3L 2B2TC 2XRSD 4TKOB 3BZKA 5DLQE 4AIMA 2HHHQ 4KY7A 4QB4A 3X3MA 2PI2A 4O42A 2JA8B 5F2DA 2RCNA 3DXJC 4A93G 4IJHA 1P16A 2NB0A 1MSHA 1K9MC 4N9PA 4GLXA 3Q24A 1PRTF 1BO0A 1SROA 1MD2D 1X9NA 1SMXA 3PUXA 2VB3X 5H1SE 1YBYA 1PFBA 2FXQA 3A74A 1DJRD 1U4PA 4KV6A 1Y1VH 2QCPX 3PO2G 1LLRD 3PF4A 2PI2E 1W2BA 2JA6G 1EZ6A 1STBA 4LFAL 1KL9A 3U50C 1J5EQ 3M4QA 4GNXB 5AJ3L 4ZUJA 2IY5B 1BXTA 5T1GA 2JEBI 4NMZA 3D3RA 1ESFA 1STGA 3E9HA 3OTOL 3TRZA 3CRLC 1IBML 3IAYA 4GS3A 3HKSA 4Y7NH 3PO2B 2ZM6L 4DAMA 1WTHA 4BY7G 5LL6X 1V1PA 2RA4A 5A2QE 2JA6B 4MIUA 5LMUQ 3CU7A 2VL6A 5HURA 1B9NA 1EUJA 4IPCA 1CA5A 2YTXA 3E3XA 3V96A 5JJKA 1CI3M 4A3BH 3P1HA 2A6HD 2PNRC 2Y0SB 3I91A 1II3A 3NSWA 4U68A 3KFUA 5KGUA 1VQGA 4XYQA 4XXEA 4DV3Q 4UY8C 3NXWA 2ICIA 2K32A 5EPLA 3DWPA 5JEAH 1KNAA 4KTAA 4NXNQ 1DZ1A 1EY0A 1WD0A 2PQAB 4H0LC 4YCVA 2NTTA 4ULLA 1YNJC 1B4OA 1XWEA 1CTMA 4B3SL 1EQQA 4K2KA 1UE7A 4DR4Q 1VQLA 1STHA 3H09A 3CCQA 4FYDA 1HCZA 4IOAA 4C3HH 5C4ZA 1YJ9A 4P72A 4IALA 5IYCH 2L12A 4FF2A 1N9WA 5IT9E 2PW5A 4B3TQ 3T1YQ 4AQYL 3F2BA 4DUYQ 1SJHD 4JI8Q 2R93G 4QQBX 4LF6L 1JQYD 3MC0B 4DR1L 2F3IA 2K01A 1STAA 3D31A 3PV0A 4L5QA 5NUCA 2KHIA 1ENFA 1KLUD 2VZAA 1VCIA 2KHJA 2EE1A 4LF5Q 1IYUA 5EQ0A 1NNXA 4JI1L 1I4QA 2WINB 5LMNL 1VQBA 4WRDA 5T1IA 1IBKL 3MZ5A 3UE0A 2C35B 2CQOA 4Y7NB 1L1OB 1UWVA 3A0JA 2AWNA 2UXCQ 1Y1WG 2HDLA 2XWJB 3CCJA 4P74A 4X66Q 4RWSC 1JWUD 1A3TA 4OWTB 5BN3A 1X6OA 4L5TA 4ID6A 3NP8A 1K3RA 5IGGA 1F2LA 2L11A 5C3EH 1EIGA 4RG1A 1K8GA 3NTHA 2XIWA 4UAIA 1KC8C 3AMUA 3H94A 2I46A 4UDUC 3S1RH 3C3LA 4XDXA 2F0WA 3S1QH 1WCMH 1M1KC 3WOFA 3KOJA 4UHVA 2IHFA 2FJ2A 4IUVA 1JORA 3QOJA 2DN8A 1HZ9A 4ME5A 4GNXA 3KF8B 1TU2B 1FVIA 2LFNA 3L9AX 3PSIA 4DV5L 1I4HA 3PUZA 1YEZA 4KJOA 1EQRA 2Q8TA 3D6CA 5IP9G 3TREA 3MEHA 2K5WA 4R4OA 1TWGB 2EVBA 2J7ZA 1CK1A 3BYTB 2OWOA 2A19A 4XT1B 3CPFA 2UU9Q 3CHBD 4A3GH 3PCOB 1BNZA 5M3FG 1O7ZA 3GV6A 4JI4L 3OYYA 3M4PA 4IJLA 2Z0SA 1I4XA 2EIFA 3NENA 2AUKA 2A6EC 1GM5A 2B2TA 3GTGH 1L0WA 3ND8A 2J4XA 1LABA 1WTPA 2QEJC 3CCVA 4LF8Q 1PRTB 4QGUA 4DU9A 4HJ8A 3FMCA 2X6LA 4IFDI 4X65L 1KRTA 4DXFA 1E2ZA 2RDGA 1QWYA 1IXRA 1CHPD 3MFGA 1BQQT 3WOEA 4X3SA 3WDNA 1A15A 1RIPA 5DNFA 1XJVA 3TZUA 2F52A 4JYAL 2EYMA 3HOUG 1EOTA 1SE3A 5C3EB 1BDOA 2ENBA 2L15A 2EXDA 1K0SA 1A3UA 3KJOA 3K0XA 3SK6A 3S1RB 4JOIA 1E1TA 1VMPA 2CCZA 1GUTA 2Q2TA 3S1QB 2XVSA 1EY6A 1IKMA 3KDFA 5KYLA 1X3QA 2ZXOA 2CQAA 1IBLL 5C0XG 1EIFA 3NELA 1F9RA 1EU3A 5EPJA 5I9PA 3CPWA 5EKKA 5K5PA 4PNYA 3C1FA 4JI7L 1BKBA 2CWPA 1Y8PB 4M1UB 1L1OA 2QA4A 1B44D 1SE2A 4IUTA 3CMEA 3BS1A 3CMAA 4DR2L 1K8OA 4LWCA 5FO9B 3GTKB 4K0KL 4ZKCB 2F0EA 1EYCA 3LGJA 3RR5A 1PHJA 4R8NA 4DK1A 5JVG3 2B2YC 5CV6A 4A4IA 4DNIA 2EDGA 2K5HA 4A3GB 4KY5A 4GN4B 1NCVA 2E76C 1N36Q 3I4OA 3S14H 1BVSA 1YNJD 4N9TA 3DHQA 3EA6A 2N88A 3MA2B 3J80c 3OHXC 1TKWB 4H13C 3DWQA 1E2WA 3I56A 4IO9A 3U9SA 4PV1C 1SYFA 1CHQD 1K3BC 3NWSA 3GQBA 4HCSA 4Q5VA 4DV4L 1TT2A 2PZWA 4A3IG 2CKZB 4C1NI 4HIKA 1OO9B 4A3FG 4KD3A 4KN7C 1EY9A 2JYOA 1XXGA 3KYHC 3H3VI 4DK6C 1KIXA 4I65A 2JEAI 1RL2A 2RQXA 4KKUA 2X69A 1VQ9A 5D14A 2GVAA 1W6JA 1L2FA 4KN4C 1CUKA 1TWAB 3TP8A 3ER0A 3VYSA 4A3IB 4X62Q 1AFPA 3HOYH 1TWCH 1PXUA 4WJ4A 2I07B 4A3FB 5COYA 1KNEA 1NSNS 2I5MX 4HEDA 1D2BA 2NUCA 1MJCA 1X32A 4P71A 1WJJA 1K73C 1S4ZA 4JG2A 4R8IA 4A76A 2F0SA 2AMCB 5IGEA 3P75A 2PZTA 1LTLA 2CWAA 5K36H 3BVZA 1B3AA 4PMCA 2KVMA 4DFAA 2NVXB 3S17B 1LTGD 1DOLA 3EVQA 5C0XJ 4JW0A 1CSQA 4A3DH 4XTCS 4NXMQ 2RKSA 4LUVA 4DR6Q 1KAAA 2ZT9C 4ABNA 1XNQQ 2BCOA 5E1FA 1LTTD 1IL8A 4RGMA 1WTQA 2ATWA 4PQXA 3NBHB 2JA7G 4EX5A 4A75A 2L55A 2XNAC 5CV8A 3HOXH 2EZVA 3FDTA 1E0BA 4POFA 5M5YB 1E7ZA 4MHEA 5C44H 1NMFA 4KK7A 3CCUA 1HNZQ 3A54A 4A3JG 2O5IC 2MO0A 4RKLA 1IZ6A 1SNMA 2JA7B 3J81E 2I5LX 3JAMc 1LV9A 1JE5A 5E3FA 1SE4A 1FGBD 2L0CA 1OXTA 1IYVA 1Q1EA 2ASBA 3S1NB 1H95A 2RDHA 3OWEB 4JBMA 3VR3A 2OTJA 4KHZA 5TSSA 2UXBQ 2EYLA 5EAYA 1A2TA 1PYBA 1Q90A 4DV0Q 3M4OH 1XTDA 2K7VA 2CFMA 2R92G 4JI2L 1H9SA 1TWCB 2HDMA 2NWGA 1TY0A 3TBIB 1XMOQ 2F0UA 5FLMG 3KLSA 2A73B 1PTOC 5IYDG 1GJXA 3H15A 2ICEC 2MNAA 4FO2A 2A69D 2E2HH 3J80E 4IFDH 2D5DA 1HQRD 4OXPA 2ZM6Q 3VR4A 1SYCA 3H0GH 4V0BA 4PG3A 5J1ZA 3R2TA 3KLSX 1YNNC 4A3KG 1S72A 1SNDA 1A63A 4HJ9A 3I4MH 3VYTA 4QJFA 5FKAC 4DUZQ 3ICEA 1NBWA 4LF7L 2HQEA 2NN6I 3X3NA 3S1MH 2H1EA 3ITPA 5FOBB 1D1IA 2ZXRA 3F8TA 3MXGA 2B39A 5J39A 3GTJB 4ZCKA 2SDFA 2KEDA 4BWGB 4LFBL 1I94L 3M3YH 3BVMA 1STNA 1EY5A 4C3JH 1U0LA 2HCIA 3E5SA 4A3CG 4DR7L 4LFCQ 1HZCA 1N33L 2E5LL 1RODA 3I8ZA 4JPBW 2VY3A 3CCMA 2EY2A 3RUZA 5M3MH 1C48A 2I0QA 4DR5Q 4PZ7A 3F2UA 4JBJA 2A1AA 2LS01 1EU4A 3QG1A 2WAQB 5A2QL 4OX9Q 3ULJA 1A8VA 2HT1A 3T1HL 4CKEA 1VQ4A 1C7YA 2H5XA 1TY2A 1WTXA 1XPUA 3DEOA 3M4OB 4AQYQ 3RLNA 4IFDG 4BBSH 2RHQB 4RCOA 5JPNC 3H0GG 4FF3A 4X64L 3HOZG 3HG9A 2NVTH 1MIUA 4KHPL 1UAPA 1LTAD 4BXXG 2UXDQ 3NBHA 4WJ3M 4GNXC 2E8GA 1D5ZC 1UE1A 4CDFC 1JICA 1SYDA 2AQ1B 3CCRA 1VMCA 2E2HB 3OSOA 3K59A 5C4XG 1EL0A 3N6RA 3H0GB 3M7NA 1STYA 1K0RA 2B63G 1SEBD 4TSSA 1KABA 5BR8L 3I4MB 3MXNB 2WB1B 3QO2A 1YJWA 2AWOA 2MP1A 3I55A 3J7AF 5KYIA 3AEVA 1R9TH 3S1MB 2OQKA 5ELCA 1GVPA 1RTNA 2F0JA 3CP0A 2GVBA 5C4XB 4RGNA 3PGZA 4RGTA 2B63B 2LXKA 5IT9L 1E2VA 3J81j 1VQJA 1G291 4JI5L 2AQ3B 3A56A 1I3QB 1HTPA 3FKIG 1BCPB 2F3VA 2VQFL 1PH3A 3KBGA 4LUOA 2XTIA 4C3IH 1R4PB 2G5DA 3W2DA 1D7QA 5JOBA 2BA1A 3CXCA 2XN9C 3TP7A 2A74C 2VQEL 1A62A 1CKMA 3NHHA 1S5ED 3RLFA 1K8MA 1Q3LA 1QNKA 2RHSB 2PPBC 3I4NH 1JR0D 3HOWH 1N34Q 1JWSD 2F0KA 4ZLTF 1ILPA 1Q8KA 2NBFA 3FKIB 4KMUC 1GOZA 3GTPH 1G6PA 4CKCA 2UUCL 3BG3A 1CQFA 1DM0B 2M00A 5C3XA 1B53A 1WTOA 4IPDA 1WTWA 4YCWA 3BZCA 4EVOA 1F9PA 2MHVA 1KTKA 4JOIC 1OTCA 3K81C 1A2UA 3STBC 1ICFB 4BBSB 5CV5A 1HZAA 2CHBD 3NQTA 2Y0SG 3F1ZA 3MVVA 5I9OA 4IFDJ 3EN2A 1EWIA 3S15B 3VA7A 3HGBA 4J6HA 3VA5A 5CYUA 1OXVA 1YNXA 1PZJD 1LT3D 1VQFA 5IYBH 1L1OC 1NE3A 1S5DD 2Z6KA 4HJ5A 1F2YA 2GN5A 2DJGC 4DV2Q 2UUAL 1E1OA 1SBBB 5EGTA 1UEAB 4HCEA 4Q0FA 4DAPA 4K6DA 3J81i 1CT1D 4DAYA 1HR0Q 3K57A 2L4NA 1R9TB 4QIWE 4JYAQ 1LACA 2D0PA 1PTOD 3LWUA 3CCLA 1GUWA 4H02A 4XT3B 1XPOA 1SMYC 3I4NG 3TQYA 2E74C 1E22A 3ZJYC 2AUJD 2OEOA 1Y1VG 1PH4A 1M90C 1YNND 3FPPA 4C3IB 1F2MA 3BDCA 4R1JA 1YVCA 4F8MA 4LF9L 4J15A 1X65A 3M85A 2Q2IA 4RFBA 3BDOA 3I4NB 4KI0A 3WWVA 2YV5A 4QF4A 2QDLA 2WAQE 3W5OA 3HOWB 5KRUA 4B3MQ 4DV1Q 2K4KA 1VF7A 1PH2A 2X6GA 1Y1VB 1ILQA 1AN8A 1VQEA 2NN6H 2SOBA 4EQOA 2H4OA 3TMEA 4A3MH 4QL5A 2F1MA 4TRDA 3QR8A 1EEID 2E2IH 3ERQA 1SNQA 4F88A 3DWAA 1D1KA 4R4QA 1CKNB 3H91A 3TZDA 4DV6Q 1YHBA 5FJ8H 5KNCA 1BF4A 4X3KA 3NTIA 5J22A 4A3BG 4DR3L 3NE5B 4DV7Q 4UP9A 3S24A 1HNXL 1LTSD 2KUMA 4JBWA 4FNFA 2CVRA 4IURA 1XNRQ 4PZ6A 3VYUA 5C6AA 2VNUD 5D65A 3RZDH 3D4RA 5EKIA 5JEAG 1Z9FA 5LHY1 4A3EH 3SR1A 3I72A 2QEXA 1JOQA 1DCZA 1TS3A 1VQ8A 1FNWA 1V1OA 4IPHA 5CC4A 2WB1E 4HMIA 4A3BB 1AH9A 3DMUA 3EROA 4NDXA 3AB9A 1SXTA 1JC7A 1L0XB 4JV5L 3GDEA 3F2CA 4GZYC 4XYOA 3KUPA 4X3TA 3AFPA 2NVQH 2FMMA 1NR4A 1GO3E 1GUNA 2Q2UA 2N3SA 4C3HG 5C4JH 3J7AV 5IYCG 1MHWC 5M5WH 4FXKC 2HHHL 1N32Q 2JXMB 4FDBA 4HN7A 1VQIA 2HIVA 1VQOA 4BY1H 1T5EA 3I70A 3MXUA 3K5LA 3UI2A 4JI6Q 4B9WA 2B2VA 4A3MG 4C3HB 3HS0C 1XPRA 1M8AA 3MEFA 2BDNA 1I50H 1OXSC 2QILA 4H44C 2ZXPA 4C2MH 1Y8NB 4RH6A 1WOCA 1EQVA 4FF1A 2L5TA 5ELFA 2IJ0A 2NYZD 4DN4M 5A35A 4IN3A 1PLFA 1DD2A 1STEA 5CGKA 4XQJA 2FINB 1GHJA 4A3LH 1AE3A 3PIOA 2DGYA 3AFQA 4A3MB 1D5MC 3I2ZA 5DAUA 2DNEA 1PH7A 3K5OA 2KECA 2E2IB 3QB3A 3EQLC 4Z9CB 3L0OA 3E0JA 3S9WA 1J5EL 1QVGA 2LXJA 2NZ1D 2MQHA 1VQMA 2PQAA 3CD6A 5C3EG 1UNSA 5ELEA 2A5HA 5ELOA 1PFNA 1M4VA 4P75A 2A69C 1S5FD 2LKVA 1K28A 5LMUL 4ILWA 4OO1H 3Q0AA 2D9UA 2Y0SE 3R93A 5IIFA 1RDPD 1WCMG 5GQOA 4CKBA 3S16H 1LT4D 2JJQA 4FF4A 2MFIA 1J8IA 1QJOA 2SNSA 1TS4A 3BYYB 4EQNA 3STBD 3HRZC 5JEAJ 4LMQD 1FJGQ 3SHLA 4JCVE 2KENA 1B9MA 2B29A 4KHVA 1V43A 3SK8A 2A8VA 1ASZA 2NVQB 1VQDA 3UE1A 1WCMB 1B70B 2F0IA 2RF4A 1ASYA 3S2HH 4NXNL 4L5SA 1Y8OB 5C4JB 5M5WB 4A3GG 5IY0A 5DEHA 1K83H 1B1ZA 2Z9HA 5CORA 1VQ5A 4BY1B 5IWAQ 2R6GA 2QGQA 3ULPA 4DR4L 5GAHC 2ES2A 3S2DH 1HUNA 1O7YA 4GKJQ 1ONLA 4NKLA 2VUMH 3KF6B 4C56C 3CAMA 1Q7YC 1W6KA 4C2MB 4CGYB 2WKDA 3J81L 3LWEA 3ERSX 5JJZA 1SMYD 1D5XC 2P5ZX 4NW2A 4TQUS 5IGDA 2ZJPA 4B3TL 3T1YL 4DUYL 2KEEA 4JI8L 3J7A5 2ZTEA 1PH8A 3A8JE 3I3CA 2IX3A 3GTGB 5G3LD 4JK1C 2MJ8A 2F4VQ 2JA9A 3LX0A 1RHPA 2HCCA 4B08A 4LF5L 4KY6A 3ULLA 1MGSA 4LF4L 5DM63 2F0PA 4Y52H 1UE5A 3D0FA 3NPPA 1PH5A 1G91A 2E2JH 1QILA 1N33Q 2UXCL 2F0LA 2E5LQ 1PTOF 3KF8A 1GUSA 4G4KA 3SK4A 2NTSA 2F0HA 3NUCA 4HJAA 1KQSA 5ELNA 4X66L 4YHHQ 2UUBQ 1Z7TA 3LNNA 1WTVA 2YU9H 4HSVA 3IKJA 3C46A 1EEFD 4APVA 2EYJA 1X3GA 2K14A 1H9MA 5IOCA 1DONA 2R7ZH 2PO4A 1OXUA 1X55A 2KBNA 5FK9C 4GN3B 5ISRA 2F3WA 1JB3A 3KLRA 4K2LA 5FO8B 2YTYA 3S2HB 1LT5D 2B3GA 1PRTD 5EJWA 3OOCA 4OONA 3AYHB 2ZJQA 3SE0A 1QZGA 4DXGA 2XRQD 3Q22A 1JJ2A 3HKZG 1Q82C 3V05A 3FPUB 3T53B 4E6IA 4DK0A 3I73A 4O2DA 4MNOA 3CF5A 1GHKA 1NAPA 2K5VA 3S2DB 4BBRH 1SR3A 3HFZB 2CH4A 1GUOA 1EOVA 1ICWA 1HPCA 1SYGA 4R4IA 4NP5A 2EJGC 2AQ2B 3HKZB 3R2IA 3VR5A 4P73A 2UU9L 3S14B 1XX8A 2JN4A 3U4VA 1XMQL 4KD4A 4UPAA 3GV3A 1MI2A 3A5ZB 4K5XA 4YY3Q 3U9OA 1H9RA 2KCCA 5HGTA 2D2CC 1B50A 2Q2HA 3OMCA 3CC4A 5FLXL 5BN5A 4LF8L 1PFMA 2BH2A 3HOYG 4JI0L 2Z6KC 3G71A 2E2JB 4IUPA 1HQMC 3URYA 3SK5A 4DA2A 4LUZA 3FP9A 3TP5A 5JJIA 1D6EC 2LSSA 2K5DA 2JE6I 5K36G 4HAEA 1E24A 1SAPA 2F0TA 4OIKA 3HOYB 3KF6A 4NB3A 1K8AC 3UDXA 4PMWA 4LFAQ 2R7ZB 2RDFA 3HOVH 4YWLA 1CZGA 1OXXK 5EPKA 1IL2A 2A68C 4A3DG 1H9KA 5C4HA 5AJ3Q 4IZ8A 4OHJA 3BVGA 2BE5C 3OTOQ 5I6WA 1IYJB 2KHSA 3U58A 1IBMQ 5LL6S 1PTOH 4RKBA 1U4RA 4JI3L 3DUZA 1ET9A 2O4XA 4P2CB 1U9RA 4OEMB 4MTKA 4ZKBB 3FHWA 4KJNA 3GTLH 2JSOA 4GOPB 4G7OC 2KA7A 2WACA 5M5XH 3HOXG 2XGTA 4A3DB 4HIMA 1S40A 2QDBA 4RHSA 1SE8A 3ZYYX 1HR0W 3PO3H 3OIQA 5C44G 1QOHA 4B9XA 1SYBA 5IP7H 1WYDA 3EFXD 1SLJA 1XYIA 4AYBG 1S5BD 5CBEE 1VF5C 2WIIB 4IOCA 3HOXB 4CBVA 5E4WC 2PQEA 2WAQG 1N36L 4R4CA 2R3ZA 1TS2A 5C44B 2PW7A 2B2WC 4HJ7A 2M2LA 3HEJA 2WV6D 4X6AH 3M7GA 3L3OC 1RTOA 3GTQH 1V1PB 2CH4W 4F7XA 1BCPC 4B3SQ 4AYBB 1O7LA 2N78A 2OQ0A 2SNMA 4LK1C 4TVAB 3D4DA 2JA8H 2WFWA 2DY7A 2OXPA 3I7FA 1PA6A 1SRUA 4QY7A 3HP3A 2F4IA 1NMGA 2EQSA 1P8LA 2HQLA 3QJYA 4O0AA 1ET6A 1CM9A 2K33A 4LF6Q 1Y14B 1VQNA 4J1MA 4A93H 4DR1Q 4DAVA 4V190 4X62L 3ND9A 4CDEC 1C0AA 3I4MG 1QNUA 2WB1G 3I4LA 4XIGS 2FHTA 4JI1Q 1X3FA 1FNUA 5LMNQ 3G7LA 5JJLA 3TEHB 3PUYA 1U5KA 2K6AA 1IBKQ 1X54A 1ESRA 2K50A 2B2UA 2B2VC 2WKCA 3SVMA 1DOMA 2AHOB 3GTLB 3A55A 1RKNA 3A8IE 1VS0A 4DPGA 1Q8IA 2JA6H 1KDBA 5G3LF 5HY6A 5J3BA 3RD4A 4C3JG 3JAME 3AU7A 2JP1A 2MUYA 4BS9A 1Z47A 3PO3B 3KJPA 1ZKOA 4WJWA 1WI5A 3HKZE 5IT9c 4DNTB 4NXML 1F9SA 3W1GA 4DR6L 5M3MG 1PH6A 2D0OA 3H3VC 4GKKL 1XNQL 2DUDA 3BU2A 4EQPA 1QVCA 4BY7H 3M3YB 4K6LA 1YHQA 1LO5D 1QCBD 4C3JB 1U4MA 4G7ZC 1MJEA 1HRJA 3MHBA 2IT1A 1U4LA 1J9OA 1Q12A 3A7AB 1KRSA 4ZRZA 1HNZL 1BOSA 5M3MB 4FP5D 3GTQB 2EY1A 2R7DA 4IUNA 4OO1I 3SEBA 5I2XA 4RMFA 4BBSG 5ELBA 2RSOA 1WD1A 2DNCA 4DV5Q 1LUZA 4OWWB 1ML0D 2E2DC 2XWBB 4GOPA 4LNQA 2UXBL 4N8X1 2BH8A 2DJFC 2V4DA 1FL0A 4DV0L 2O5JC 2Z8LA 4RGOS 1IKLA 3V2TA 3GO5A 3D6WA 4JI4Q 2NVTB 1I4GA 1EYDA 1I6VC 2ZJRA 4A93B 1SDFA 2B8FA 5E4XA 1TVXA 3FVQA 4FXGC 1SNOA 1CZWA 1TS5A 1I5FA 3K6OA 1XMOL 2RBMA 4QUFA 2JA5H 3CC7A 5CV4A 3SGIA 4CDDC 1MBYA 3PUWA 2CW0C 4X65Q 1AZPA 3R8BA 1EY7A 4ZYSA 2R93H 1PDQA 1KLGD 5ELDA 5CBAE 1DXMA 3B6YA 1YIJA 3VDYA 4OL7A 3VR2A 4CDCC 4CJ0B 4G57A 1S5CD 3K5MA 1G6ZA 3G6EA 1SYEA 3RLOA 4C3IG 2XSCA 2QKIC 4DUZL 1HNWL 1IW7D 1EIHA 1G2TA 2A68D 1LTRD 2C9OA 4ODGA 4XQNA 1HFGA 1BR9A 1ZXTA 2ID0A 2BE5D 2JK8A 5JVH3 3GTOH 3HOWG 4BY7B 3HZXA 1Y1WH 1GD7A 3E6ZX 3Q23A 1Z6HA 1PH1A
chains in the Genus database with same CATH topology
1LTID 2PCFB 3TN2A 5EBDA 5D3DA 5JAVA 2Z4HA 4L8JA 1Y69U 3O13A 1WVLA 3M4YA 1R4QB 3GTPB 3PMFA 3ONAB 1HFNA 4BA1I 3G6JB 1NR2A 2B8GA 5IGCA 3MXNA 3FEWX 2EYHA 3P20A 4CHTB 1AP0A 2EJFC 4WFN3 1BCPD 4ZUIA 2B2WA 2BDOA 1PRTC 2JA5B 2C5CA 3T56B 3VYRA 1HUMA 1AW7A 1G2SA 2FMCA 5EKLA 2R93B 3MTSA 1A6XA 2HUGA 4CJ2C 4FVMA 5C5LA 4IUUA 2F0OA 1FR3A 2G9HD 2VXWA 3GP7A 1F77A 4QCLA 1X3PA 1TQOA 3OWFA 5AFWA 3GTOB 1ENCA 4PMBA 1Y1WB 2NN6G 5CR3A 1O78A 3TP6A 2E75C 2LY7A 3IL8A 2F0MA 3SDZA 2G9DA 4S3SA 4K5WA 5C5MA 1HHVA 3IFDA 4U673 1QE6A 3I90A 5C0XH 4MN3A 1SNPA 3CRKC 4HMJA 1DOKA 3MAQA 1FYCA 3OW7A 1HXYD 1EYAA 2MPMA 2KJXA 1RCVD 4KKSA 4I7ZC 2Q8IB 1EY8A 3RZDB 1HA5A 4IUQA 2EXZA 4YIJA 1I4RA 4DF7A 3PIO3 4A3EB 1AEXA 1EWCA 3T13A 4BA2I 2Z4IA 5M3FB 2TMPA 4OGQC 4X3UA 2Q8RE 2D62A 4G7HC 5CV9A 4R9WA 2F0VA 3N52A 1SSOA 1B2TA 2L1BA 5JPMC 3CKIB 2CW0D 1UUPA 1IHZA 2K5QA 3T51B 2EYPA 1SJED 1BBXC 1I50B 3HOUB 3RZOB 3R3OA 2K04A 2OF1A 2KQ3A 1I4PA 4H7BA 4RA8A 3IFTA 2RVLA 1JE4A 3J7YW 3K7AB 1ZYRC 1EY4A 1H9SB 1JCKB 1V8QA 3K5NA 4OO1G 1F9QA 2EOTA 1A3VA 1JWMD 3CQZB 2EY6A 4LJZC 2K03A 1SFOB 2B2UC 2F0QA 4XQQA 2IW3A 4HSPA 4KKTA 4FXDA 5M9OA 1G8ZD 3J80L 3S16B 4EGVA 1RJTA 2Z1CA 2PMZB 1O80A 4F87A 4ZK9B 2YYZA 3K58A 5KNBA 2K05A 4K5VA 2EYFA 3PIP3 1TIID 1QB5D 1RF2D 3GD7A 3OMGA 3MFYA 3VR6A 2IX1A 2EJMA 3L7ZC 4HTHA 2FFKB 1CA6A 3MXPA 1C4QA 1FD7D 2M9VA 1K83B 3OIPA 4WORA 5EBCA 2EY5A 4O1NA 1H9JA 1SNCA 4CJ1B 1C8CA 2OT2A 3T16A 1PZKD 1EQTA 1HA6A 1EFID 5CV7A 2VUMB 1BCPF 1AZQA 4L6TB 1BUVT 1MSGA 4QUCA 1TWFB 1F2ZA 4K14A 3BDLA 3DEPA 1JOOA 4ZQ3A 2DY8A 4RAUC 1EWHA 2IX0A 2L9HA 1I6HB 2RSNA 4OIJA 2N55A 4QMGA 1Q1BA 2QF7A 4K8JA 1RD9D 3Q6SA 2YU9B 3PUVA 1L0YB 2LMCB 4L63B 1TWHB 1KDCA 2VB2X 2BA0A 3JAML 2F0GA 5I2YA 1IW7C 1LT6D 4A3JB 3BZDB 4RCNA 4C1NK 1PZID 2A6ED 2EYOA 2A6HC 2R61A 2F0NA 1QG7A 2WP8J 1CQVA 2PZUA 3NBIA 1ENAA 3RMHA 1XTCD 2IPKD 2J0TD 4HR7B 3KK7A 4BBRB 3D4WA 2MGSA 2PYKA 4IQZA 5CMDA 2EPBA 2R92B 2SEBD 1HTLD 5DM73 1PMRA 3QIAA 1ZEQX 3QOLA 3C2PA 3T4AC 4J8QA 2F0FA 3KBXA 2F03A 1GXDC 3QWNA 5IODA 4QIWB 5D3IB 4A3KB 1FNVA 1LTBD 5KEEA 1KDAA 4RHRA 3DM1A 1JOKA 2KOLA 2K1BA 3NWTA 4LAAA 3SXHA 2F0DA 2NVYB 3A8KE 1ZYRD 1NUCA 2K28A 2O2LD 5KIXA 5C3WA 5FO7B 3W3AA 3HOVB 5IGBA 2B2YA 1DYQA 3NTKA 3NK9A 3MWYW 1PTOB 3TSSA 5KNDA 2IWHA 4K8IA 3H6MA 4ZAIA 5FLXE 1EZ8A 2IL8A 3K0YA 5M5XB 1CFMA 1VDZA 5I6YA 3GTMB 3C1EA 1TR5A 4DGZA 1WTRA 3OPOA 3HOZB 5C0XI 1GUGA 4DNRB 3A7LA 5IGFA 3FRPB 3NQIA 3P7JA 2GA4B 2KCNA 4M8AA 5BN4A 2TSSA 3TDQA 3EJIA 1T5XD 5I4DA 3D8GA 1PYWD 2BOSA 2B2TC 2XRSD 4TKOB 4KY7A 4QB4A 3X3MA 4O42A 2JA8B 5F2DA 3DXJC 2NB0A 1MSHA 4N9PA 3Q24A 1PRTF 1BO0A 1MD2D 3PUXA 2VB3X 1PFBA 1DJRD 1U4PA 4KV6A 2QCPX 1LLRD 1EZ6A 1STBA 4ZUJA 1BXTA 5T1GA 2JEBI 4NMZA 3D3RA 1ESFA 1STGA 3CRLC 3IAYA 3PO2B 5LL6X 1V1PA 2RA4A 5A2QE 2JA6B 4MIUA 3CU7A 5HURA 1B9NA 1CA5A 3V96A 1CI3M 3P1HA 2A6HD 2PNRC 2Y0SB 3I91A 1II3A 3NSWA 4U68A 5KGUA 4XYQA 4XXEA 3NXWA 2ICIA 2K32A 5EPLA 3DWPA 5JEAH 1KNAA 4KTAA 1DZ1A 1EY0A 1WD0A 4H0LC 2NTTA 4ULLA 1YNJC 1B4OA 1XWEA 1CTMA 4K2KA 1STHA 3H09A 4FYDA 1HCZA 5C4ZA 4IALA 2L12A 4FF2A 5IT9E 2PW5A 1SJHD 1JQYD 3MC0B 2K01A 1STAA 3D31A 3PV0A 5NUCA 1ENFA 1KLUD 1VCIA 2EE1A 1IYUA 5EQ0A 1I4QA 2WINB 4WRDA 5T1IA 3MZ5A 4Y7NB 2AWNA 2HDLA 2XWJB 4RWSC 1JWUD 1A3TA 5BN3A 4ID6A 3NP8A 5IGGA 1F2LA 2L11A 1EIGA 3NTHA 2XIWA 4UAIA 3AMUA 3H94A 2I46A 4UDUC 3C3LA 4XDXA 2F0WA 3WOFA 2FJ2A 4IUVA 1JORA 3QOJA 2DN8A 4ME5A 1TU2B 2LFNA 3L9AX 1I4HA 3PUZA 4KJOA 2Q8TA 3D6CA 3MEHA 2K5WA 1TWGB 2EVBA 2J7ZA 1CK1A 3BYTB 4XT1B 3CHBD 1BNZA 1O7ZA 3GV6A 1I4XA 2AUKA 2A6EC 2B2TA 2J4XA 1LABA 3ND8A 1WTPA 2QEJC 1PRTB 4DU9A 3FMCA 2X6LA 4IFDI 4DXFA 1E2ZA 2RDGA 1QWYA 1CHPD 3MFGA 1BQQT 3WOEA 4X3SA 3WDNA 1A15A 5DNFA 3TZUA 2EYMA 1EOTA 1SE3A 5C3EB 1BDOA 2ENBA 1A3UA 3SK6A 3S1RB 1VMPA 1GUTA 3S1QB 2XVSA 1EY6A 1IKMA 5KYLA 1X3QA 2ZXOA 2CQAA 5C0XG 1F9RA 1EU3A 5EPJA 5I9PA 5EKKA 5K5PA 4PNYA 3C1FA 1Y8PB 4M1UB 1B44D 1SE2A 4IUTA 3BS1A 1K8OA 5FO9B 3GTKB 4ZKCB 2F0EA 1EYCA 4R8NA 4DK1A 5JVG3 2B2YC 5CV6A 2EDGA 4A3GB 4KY5A 1NCVA 2E76C 1YNJD 4N9TA 3DHQA 3EA6A 2N88A 3MA2B 3OHXC 1TKWB 4H13C 3DWQA 1E2WA 3U9SA 4PV1C 1SYFA 1CHQD 3NWSA 3GQBA 4HCSA 4Q5VA 1TT2A 2PZWA 4C1NI 1OO9B 4KD3A 4KN7C 1EY9A 2JYOA 1XXGA 2JEAI 4I65A 2RQXA 4KKUA 2X69A 5D14A 1W6JA 4KN4C 1TWAB 3TP8A 3VYSA 4A3IB 1AFPA 1PXUA 2I07B 4A3FB 5COYA 1KNEA 1NSNS 1D2BA 4HEDA 2NUCA 1X32A 1S4ZA 4R8IA 2F0SA 5IGEA 3P75A 2PZTA 5K36H 3BVZA 1B3AA 4PMCA 2KVMA 4DFAA 2NVXB 3S17B 1LTGD 1DOLA 3EVQA 5C0XJ 4XTCS 2RKSA 1KAAA 2ZT9C 4ABNA 2BCOA 5E1FA 1LTTD 1IL8A 4RGMA 1WTQA 4PQXA 2L55A 2XNAC 5CV8A 2EZVA 3FDTA 1E0BA 5M5YB 4MHEA 4KK7A 3A54A 2O5IC 4RKLA 1SNMA 2JA7B 3J81E 1LV9A 5E3FA 1SE4A 1FGBD 2L0CA 1OXTA 1IYVA 1Q1EA 3S1NB 2RDHA 3OWEB 3VR3A 4KHZA 5TSSA 2EYLA 1A2TA 1Q90A 2K7VA 1H9SA 1TWCB 2HDMA 2NWGA 1TY0A 3TBIB 2F0UA 3KLSA 2A73B 1PTOC 1GJXA 2ICEC 4FO2A 2A69D 3J80E 4IFDH 2D5DA 1HQRD 3VR4A 1SYCA 4V0BA 5J1ZA 3R2TA 3KLSX 1YNNC 1SNDA 3VYTA 5FKAC 2HQEA 2NN6I 3X3NA 2H1EA 3ITPA 5FOBB 1D1IA 2ZXRA 3MXGA 2B39A 5J39A 3GTJB 2SDFA 2KEDA 4BWGB 3BVMA 1STNA 1EY5A 2HCIA 3E5SA 1RODA 3I8ZA 2EY2A 3RUZA 1C48A 3F2UA 2LS01 1EU4A 3QG1A 2WAQB 5A2QL 4CKEA 1TY2A 1WTXA 3DEOA 3M4OB 4IFDG 4RCOA 5JPNC 4FF3A 3HG9A 1UAPA 1LTAD 3NBHA 1D5ZC 1JICA 1SYDA 2AQ1B 1VMCA 2E2HB 3OSOA 3K59A 1EL0A 3N6RA 3H0GB 3M7NA 1STYA 1SEBD 4TSSA 1KABA 3I4MB 3QO2A 2WB1B 2AWOA 2MP1A 3J7AF 5KYIA 3S1MB 5ELCA 1RTNA 2F0JA 5C4XB 4RGNA 4RGTA 2B63B 5IT9L 1E2VA 1G291 2AQ3B 3A56A 1I3QB 1HTPA 1BCPB 2F3VA 3KBGA 1R4PB 3W2DA 5JOBA 2BA1A 2XN9C 3TP7A 2A74C 3RLFA 3NHHA 1S5ED 1K8MA 1QNKA 1Q3LA 2PPBC 1JR0D 1JWSD 2F0KA 4ZLTF 1ILPA 2NBFA 3FKIB 4KMUC 1GOZA 4CKCA 3BG3A 1CQFA 1DM0B 2M00A 5C3XA 1B53A 1WTOA 1WTWA 4EVOA 1F9PA 2MHVA 1KTKA 1A2UA 4BBSB 5CV5A 2CHBD 3NQTA 3MVVA 5I9OA 4IFDJ 3S15B 3VA7A 3HGBA 4J6HA 3VA5A 5CYUA 1OXVA 1PZJD 1LT3D 1S5DD 1F2YA 1SBBB 5EGTA 1UEAB 4HCEA 4Q0FA 4DAPA 4K6DA 1CT1D 4DAYA 3K57A 2L4NA 1R9TB 1LACA 1PTOD 3LWUA 1GUWA 4XT3B 1SMYC 2E74C 2AUJD 2OEOA 1YNND 3FPPA 4C3IB 1F2MA 3BDCA 4F8MA 3M85A 4RFBA 3BDOA 3I4NB 4KI0A 4QF4A 3HOWB 5KRUA 1VF7A 2X6GA 1Y1VB 1ILQA 1AN8A 2NN6H 2SOBA 4EQOA 2H4OA 3TMEA 2F1MA 4TRDA 1EEID 3ERQA 1SNQA 4F88A 3DWAA 1D1KA 3H91A 3TZDA 5KNCA 1BF4A 4X3KA 3NTIA 5J22A 3NE5B 1LTSD 2KUMA 4JBWA 4FNFA 2CVRA 4IURA 2VNUD 3VYUA 5C6AA 5D65A 3D4RA 5EKIA 5JEAG 5LHY1 3SR1A 3I72A 1JOQA 1DCZA 1TS3A 1FNWA 1V1OA 5CC4A 4HMIA 4A3BB 3DMUA 3EROA 4NDXA 3AB9A 1SXTA 1JC7A 1L0XB 4GZYC 4XYOA 3KUPA 4X3TA 2FMMA 1NR4A 1GUNA 4C3HG 3J7AV 4FXKC 2JXMB 4HN7A 1T5EA 3I70A 3MXUA 3K5LA 3UI2A 4B9WA 2B2VA 4C3HB 3HS0C 1M8AA 2BDNA 1OXSC 2QILA 4H44C 2ZXPA 1Y8NB 4RH6A 1EQVA 4FF1A 2L5TA 5ELFA 2IJ0A 2NYZD 4DN4M 5A35A 4IN3A 1PLFA 1DD2A 1STEA 5CGKA 4XQJA 2FINB 1GHJA 4A3MB 1D5MC 5DAUA 2DNEA 2KECA 3K5OA 2E2IB 3QB3A 3EQLC 4Z9CB 3E0JA 3S9WA 2NZ1D 1UNSA 5ELEA 2A5HA 1PFNA 1M4VA 2A69C 1S5FD 2LKVA 4ILWA 4OO1H 3Q0AA 2D9UA 3R93A 5IIFA 1RDPD 4CKBA 1LT4D 4FF4A 1J8IA 1QJOA 2SNSA 1TS4A 3BYYB 4EQNA 3HRZC 5JEAJ 4LMQD 3SHLA 1B9MA 4KHVA 1V43A 3SK8A 2NVQB 1WCMB 2F0IA 1Y8OB 5C4JB 5M5WB 5DEHA 1B1ZA 5CORA 4BY1B 2R6GA 1HUNA 1O7YA 1ONLA 4NKLA 4C56C 1W6KA 4C2MB 4CGYB 2WKDA 3J81L 3LWEA 5JJZA 1SMYD 1D5XC 4NW2A 4TQUS 5IGDA 2KEEA 3A8JE 3I3CA 2IX3A 3GTGB 5G3LD 4JK1C 2MJ8A 3LX0A 1RHPA 2HCCA 4B08A 4KY6A 1MGSA 5DM63 2F0PA 3NPPA 1G91A 1QILA 2F0LA 1PTOF 3KF8A 1GUSA 4G4KA 3SK4A 2NTSA 2F0HA 3NUCA 1Z7TA 3LNNA 1WTVA 4HSVA 3IKJA 3C46A 1EEFD 2EYJA 1H9MA 5IOCA 1DONA 2PO4A 1OXUA 5FK9C 5ISRA 2F3WA 1JB3A 3KLRA 4K2LA 5FO8B 3S2HB 1LT5D 1PRTD 5EJWA 3OOCA 3SE0A 4DXGA 2XRQD 3Q22A 3V05A 3FPUB 3T53B 4E6IA 4DK0A 3I73A 1GHKA 1NAPA 3S2DB 1GUOA 1ICWA 1HPCA 1SYGA 4NP5A 2EJGC 2AQ2B 3HKZB 3R2IA 3VR5A 3S14B 1XX8A 4KD4A 3GV3A 1MI2A 4K5XA 3U9OA 1H9RA 2KCCA 5HGTA 2D2CC 1B50A 3OMCA 5FLXL 5BN5A 1PFMA 2E2JB 4IUPA 1HQMC 3URYA 3SK5A 4DA2A 3TP5A 1D6EC 2K5DA 2JE6I 5K36G 4HAEA 1SAPA 2F0TA 4OIKA 3HOYB 4PMWA 2R7ZB 2RDFA 1CZGA 1OXXK 5EPKA 2A68C 1H9KA 5C4HA 4IZ8A 4OHJA 3BVGA 2BE5C 5I6WA 2KHSA 5LL6S 1PTOH 4RKBA 1U4RA 3DUZA 1ET9A 2O4XA 4P2CB 1U9RA 4ZKBB 4KJNA 2JSOA 4G7OC 2KA7A 2WACA 4A3DB 2QDBA 4RHSA 3ZYYX 3OIQA 1QOHA 4B9XA 1SYBA 3EFXD 1XYIA 1S5BD 5CBEE 1VF5C 2WIIB 3HOXB 4CBVA 5E4WC 2PQEA 2R3ZA 1TS2A 5C44B 2PW7A 2B2WC 2M2LA 3HEJA 2WV6D 3M7GA 3L3OC 1RTOA 1V1PB 4F7XA 1BCPC 4AYBB 1O7LA 2SNMA 4LK1C 3D4DA 2DY7A 2OXPA 3HP3A 2F4IA 3QJYA 1ET6A 1CM9A 2K33A 4J1MA 4DAVA 4V190 3ND9A 1QNUA 3I4LA 4XIGS 2FHTA 1FNUA 3G7LA 3PUYA 2K6AA 1ESRA 2B2UA 2B2VC 2WKCA 3SVMA 1DOMA 3GTLB 3A55A 1RKNA 3A8IE 1Q8IA 1KDBA 5G3LF 3RD4A 3JAME 4C3JG 3AU7A 2JP1A 2MUYA 4BS9A 1Z47A 3PO3B 1ZKOA 4WJWA 4DNTB 1F9SA 3H3VC 4EQPA 3M3YB 4K6LA 1LO5D 1QCBD 4C3JB 1U4MA 4G7ZC 1HRJA 3MHBA 2IT1A 1U4LA 1J9OA 1Q12A 3A7AB 4ZRZA 1BOSA 5M3MB 4FP5D 3GTQB 2EY1A 4IUNA 4OO1I 3SEBA 5I2XA 5ELBA 2RSOA 1WD1A 2DNCA 1ML0D 2E2DC 2XWBB 2V4DA 2O5JC 2Z8LA 4RGOS 1IKLA 3V2TA 3GO5A 3D6WA 2NVTB 1I4GA 1EYDA 1I6VC 4A93B 1SDFA 2B8FA 5E4XA 1TVXA 3FVQA 4FXGC 1SNOA 1CZWA 1TS5A 3K6OA 2RBMA 4QUFA 5CV4A 1MBYA 3PUWA 2CW0C 1AZPA 3R8BA 1EY7A 4ZYSA 1PDQA 1KLGD 5ELDA 5CBAE 1DXMA 4OL7A 3VR2A 4CJ0B 4G57A 1S5CD 3K5MA 1G6ZA 1SYEA 4C3IG 2XSCA 2QKIC 1IW7D 1EIHA 1G2TA 2A68D 1LTRD 2C9OA 4ODGA 4XQNA 1HFGA 1BR9A 1ZXTA 2ID0A 2BE5D 5JVH3 4BY7B 3HZXA 3E6ZX 3Q23A 1Z6HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QNU A;  4P2C B;  2BOS A;  1D1K A;  1CQF A;  2XSC A;  1DM0 B;  1CZW A;  1R4Q B;  4ULL A;  1CZG A;  1D1I A;  1C48 A;  1R4P B;  1QOH A;  2GA4 B;  4M1U B;  3MXG A;  1C4Q A;  2C5C A;  1BOS A; 
#chains in the Genus database with same CATH topology
 1LTI D;  2PCF B;  3TN2 A;  5EBD A;  5D3D A;  5JAV A;  4AYB E;  1IBL Q;  2Z4H A;  4L8J A;  1Y69 U;  3O13 A;  1WVL A;  4LFC L;  3M4Y A;  3L2P A;  3J80 i;  1R4Q B;  3GTP B;  4JI7 Q;  4DR5 L;  3JC6 6;  1E3P A;  3PMF A;  3ONA B;  1YJN A;  1HFN A;  5HGQ A;  3IRB A;  4DR2 Q;  2HIX A;  4YWM A;  4BA1 I;  3G6J B;  1NR2 A;  4ALP A;  1VQ7 A;  4K0K Q;  4OX9 L;  1B3Q A;  2K5N A;  2B8G A;  5IGC A;  2QW7 A;  3MXN A;  1FGU A;  1JJC B;  1TWG H;  3FEW X;  4UP8 A;  2JA5 G;  2EYH A;  1KHI A;  5IYB G;  3P20 A;  4CHT B;  1AP0 A;  4JC0 A;  2EJF C;  4B3R L;  4WFN 3;  3EIV A;  1BBW A;  1BCP D;  4ZUI A;  2B2W A;  1JMC A;  2V1C C;  3KDF B;  5IP9 H;  4KLK A;  2BDO A;  2UXD L;  1PRT C;  2JA5 B;  2C5C A;  2PNH A;  3T56 B;  3VYR A;  4LF4 Q;  1HUM A;  1AW7 A;  4DV4 Q;  1G2S A;  2FMC A;  5M3F H;  5EKL A;  2R93 B;  3MTS A;  1A6X A;  2HUG A;  2HD3 A;  4CJ2 C;  1D8L A;  4FVM A;  5C5L A;  4IUU A;  2KCM A;  2F0O A;  1FR3 A;  2G9H D;  2VXW A;  3GP7 A;  1F77 A;  2VS1 A;  1EFW A;  4QCL A;  1X3P A;  3G48 A;  3PQI A;  1TQO A;  1VQA A;  3OWF A;  5AFW A;  3UDF A;  3GTO B;  3KLW A;  1ENC A;  1BBU A;  4PMB A;  1QVF A;  1Y1W B;  2NN6 G;  5CR3 A;  1G51 A;  3AQQ A;  1O78 A;  3TP6 A;  2E75 C;  3HOU H;  2LY7 A;  3IL8 A;  3RZO H;  5FJ8 G;  2OTL A;  1N34 L;  3RNU A;  2F0M A;  3SDZ A;  1N8R C;  2G9D A;  4S3S A;  4K5W A;  5C5M A;  1HHV A;  3IFD A;  4U67 3;  1QE6 A;  3K7A H;  3GTK H;  3I90 A;  1HJP A;  3JAM i;  5C0X H;  1C9O A;  4MN3 A;  1SNP A;  3CRK C;  5GAG C;  4HMJ A;  1DOK A;  4A3E G;  3MAQ A;  1FYC A;  5GAD C;  1LYL A;  1VQC A;  3OW7 A;  3CQZ H;  2N8N A;  1XMQ Q;  1HXY D;  4OWX B;  1EYA A;  1SFO H;  2MPM A;  2KJX A;  1RCV D;  1VQH A;  4KKS A;  2MO1 A;  4I7Z C;  2Q8I B;  1W3S A;  1EY8 A;  3RZD B;  1HA5 A;  4IUQ A;  2EXZ A;  4YIJ A;  1I4R A;  4DF7 A;  3PIO 3;  4A3E B;  1AEX A;  1EWC A;  3T13 A;  3NEM A;  4BA2 I;  2Z4I A;  5M3F B;  4JI0 Q;  2TMP A;  4OGQ C;  1UE6 A;  4DV2 L;  1TXY A;  4X3U A;  2Q8R E;  2D62 A;  4BY1 G;  4G7H C;  5CV9 A;  4DV3 L;  1WFQ A;  1HR0 L;  4EQ5 A;  1CKO A;  4R9W A;  2F0V A;  3N52 A;  1NJI C;  1SSO A;  4JI2 Q;  1JT8 A;  1B2T A;  2L1B A;  5JPM C;  1TWA H;  3CKI B;  4N8F A;  4A3I H;  1JJG A;  2CW0 D;  4DKA C;  1UUP A;  1IHZ A;  1CKN A;  2K5Q A;  4MZ9 A;  3T51 B;  4A3F H;  1CSP A;  5L37 A;  1AE2 A;  4JVZ A;  1UEB A;  4A3L G;  2EYP A;  4JI3 Q;  4YCU A;  3A5U A;  2NZO A;  1SJE D;  1S3O A;  1BBX C;  2IHE A;  3J81 c;  1I50 B;  3HOU B;  1Q81 C;  1X56 A;  4HID A;  3RZO B;  3R3O A;  4AH6 A;  3CCS A;  2K04 A;  2OF1 A;  2NVX H;  2KQ3 A;  3S17 H;  1I4P A;  1TWF H;  4B3M L;  1VQ6 A;  4H7B A;  4RA8 A;  4DV1 L;  4LF7 Q;  2YTV A;  3IFT A;  2RVL A;  1JE4 A;  4GLA C;  3J7Y W;  2KCT A;  2OCE A;  3K7A B;  1EYG A;  1ZYR C;  1X3E A;  1EY4 A;  1H9S B;  1JCK B;  1V8Q A;  3K80 C;  3K5N A;  4OO1 G;  4LFB Q;  1I94 Q;  1F9Q A;  2EOT A;  1A3V A;  1JWM D;  4DV6 L;  3CQZ B;  2EY6 A;  3PIP A;  4LJZ C;  2K03 A;  1SFO B;  2B2U C;  2F0Q A;  4XQQ A;  4DR7 Q;  2IW3 A;  5M5Y H;  3CW2 C;  4HSP A;  2ZTD A;  3UDG A;  4DV7 L;  1I6H H;  4KKT A;  4FXD A;  5M9O A;  3RN2 A;  1G8Z D;  3J80 L;  1XNR L;  3S16 B;  4EGV A;  1VQP A;  2JQO A;  2ZTC A;  1RJT A;  2Z1C A;  2PMZ B;  2JA7 H;  1O80 A;  4F87 A;  4ZK9 B;  2YYZ A;  1TWH H;  3K58 A;  3T1H Q;  1DGS A;  4DK3 C;  5KNB A;  4LW1 A;  2K05 A;  4K5V A;  2EYF A;  3PIP 3;  3S1N H;  1TII D;  4A3J H;  1QB5 D;  1RF2 D;  3GD7 A;  3OMG A;  3MFY A;  2R7F A;  3VR6 A;  2IX1 A;  2ALY B;  1B7Y B;  1PFS A;  2EJM A;  1YZ6 A;  5LMN W;  3L7Z C;  4HTH A;  4X64 Q;  2FFK B;  1CA6 A;  3MXP A;  2VUM G;  2RCF A;  4KHP Q;  1C4Q A;  1Q46 A;  2Z6B A;  1FD7 D;  2M9V A;  1K83 B;  3OIP A;  4WOR A;  5EBC A;  2EY5 A;  1N32 L;  4O1N A;  1H9J A;  1SNC A;  4CJ1 B;  1C8C A;  2OT2 A;  3T16 A;  4JI6 L;  1PZK D;  1EQT A;  4GN5 A;  1HA6 A;  1EFI D;  5CV7 A;  2VUM B;  2R92 H;  1PYS B;  1BCP F;  4GOP C;  1AZQ A;  4L6T B;  1BUV T;  1MSG A;  4QUC A;  4JBK A;  5BR8 Q;  1TWF B;  5FLM H;  1PH9 A;  4POG A;  5IYD H;  1F2Z A;  4K14 A;  3BDL A;  3E0E A;  3DEP A;  2VW9 A;  3GTJ H;  4GKK Q;  4NPS A;  4JI5 Q;  5FLX c;  1JOO A;  4ZQ3 A;  3F2D A;  2DY8 A;  4RAU C;  2VQF Q;  4A3K H;  1EWH A;  2AKW B;  2IX0 A;  2L9H A;  1GKH A;  2R7Z G;  1I6H B;  2VQE Q;  3K8A A;  1PVO A;  2RSN A;  4ME3 A;  4OIJ A;  2N55 A;  4QMG A;  2NVY H;  1Q1B A;  2QF7 A;  4K8J A;  1HH2 P;  1RD9 D;  4I7A A;  2UUC Q;  3Q6S A;  3M9B A;  3PUV A;  2YU9 B;  1L0Y B;  2LMC B;  4L63 B;  1TWH B;  1KDC A;  1FJG L;  4A3C H;  2VB2 X;  2BA0 A;  3JAM L;  2F0G A;  1MKH A;  1QUQ B;  5I2Y A;  1IW7 C;  1LT6 D;  4A3J B;  3BZD B;  5GRO A;  1VQK A;  3CC2 A;  4RCN A;  4C1N K;  5IE8 A;  1PZI D;  2A6E D;  2EYO A;  4BBR G;  2A6H C;  2R61 A;  2F0N A;  3DM3 A;  1QG7 A;  2WP8 J;  1CQV A;  4GLV B;  2PZU A;  5E7N A;  3NBI A;  1ENA A;  3RMH A;  3CCE A;  1XTC D;  2IPK D;  4IPG A;  2J0T D;  4HR7 B;  5IWA L;  3KK7 A;  4BBR B;  1QZH A;  3D4W A;  3GTM H;  2MGS A;  2PYK A;  4IQZ A;  4PZ8 A;  5CMD A;  2EPB A;  2R92 B;  2SEB D;  1HTL D;  2UUA Q;  5DM7 3;  4GKJ L;  3BJU A;  1PMR A;  3HOZ H;  3OW2 A;  3QIA A;  1J6Q A;  2NZH A;  3RN5 A;  1KXL A;  4BXX H;  3U4Z A;  1ZEQ X;  3QOL A;  1JB7 A;  3C2P A;  1HNW Q;  3T4A C;  2K75 A;  4J8Q A;  2F0F A;  3KBX A;  2K52 A;  2F03 A;  1GXD C;  5C4X H;  3QWN A;  4HIO A;  3J7Z C;  3E9I A;  3TS2 A;  5IOD A;  2I5H A;  2F4V L;  2B63 H;  4QIW B;  5D3I B;  4A3K B;  1T9H A;  1I3Q H;  3W1B A;  1FNV A;  3PF5 A;  1LTB D;  5GAE C;  1Q86 C;  1YHA A;  1V9P A;  5KEE A;  4LF9 Q;  1KDA A;  4RHR A;  3HOV G;  3DM1 A;  1JOK A;  2KOL A;  2K1B A;  2PMZ E;  3NWT A;  4LAA A;  3SXH A;  2F0D A;  3EBE A;  2NVY B;  1LM0 A;  3A8K E;  4MTN A;  3Q8D A;  1ZYR D;  1V1Q A;  4DAY B;  4YHH L;  3FKI H;  2UUB L;  1NUC A;  2K28 A;  2O2L D;  5KIX A;  5C3W A;  4L5R C;  5FO7 B;  3W3A A;  3HOV B;  5IGB A;  4UP7 A;  1B8A A;  2B2Y A;  1EIY B;  3PO3 G;  1SN8 A;  1DYQ A;  1YIT A;  3NTK A;  3NK9 A;  3MWY W;  1A0I A;  1PTO B;  3TSS A;  4B3R Q;  5KND A;  5IP7 G;  1NY4 A;  2IWH A;  4DR3 Q;  4K8I A;  3H6M A;  4ZAI A;  3UDI A;  3PO2 H;  5FLX E;  1HNX Q;  1EZ8 A;  2IL8 A;  3K0Y A;  5M5X B;  3S15 H;  4YWK A;  1CFM A;  1VDZ A;  5I6Y A;  3GTM B;  1YI2 A;  4OEL B;  3C1E A;  1TR5 A;  4DGZ A;  1WTR A;  3OPO A;  3HOZ B;  5C0X I;  1GUG A;  4DNR B;  3A7L A;  1HZB A;  4JV5 Q;  3DLL A;  5IGF A;  2N49 A;  3FRP B;  3NQI A;  3P7J A;  2JA8 G;  3H3V H;  3TS0 A;  1KD1 C;  2GA4 B;  2KCN A;  4R4T A;  1NTG A;  4M8A A;  1O7I A;  5BN4 A;  2TSS A;  1PV4 A;  3TDQ A;  3EJI A;  1KAW A;  3K7U C;  1QUQ A;  1T5X D;  5I4D A;  3G4S A;  3D8G A;  1PYW D;  2BOS A;  4YY3 L;  2B2T C;  2XRS D;  4TKO B;  3BZK A;  5DLQ E;  4AIM A;  2HHH Q;  4KY7 A;  4QB4 A;  3X3M A;  2PI2 A;  4O42 A;  2JA8 B;  5F2D A;  2RCN A;  3DXJ C;  4A93 G;  4IJH A;  1P16 A;  2NB0 A;  1MSH A;  1K9M C;  4N9P A;  4GLX A;  3Q24 A;  1PRT F;  1BO0 A;  1SRO A;  1MD2 D;  1X9N A;  1SMX A;  3PUX A;  2VB3 X;  5H1S E;  1YBY A;  1PFB A;  2FXQ A;  3A74 A;  1DJR D;  1U4P A;  4KV6 A;  1Y1V H;  2QCP X;  3PO2 G;  1LLR D;  3PF4 A;  2PI2 E;  1W2B A;  2JA6 G;  1EZ6 A;  1STB A;  4LFA L;  1KL9 A;  3U50 C;  1J5E Q;  3M4Q A;  4GNX B;  5AJ3 L;  4ZUJ A;  2IY5 B;  1BXT A;  5T1G A;  2JEB I;  4NMZ A;  3D3R A;  1ESF A;  1STG A;  3E9H A;  3OTO L;  3TRZ A;  3CRL C;  1IBM L;  3IAY A;  4GS3 A;  3HKS A;  4Y7N H;  3PO2 B;  2ZM6 L;  4DAM A;  1WTH A;  4BY7 G;  5LL6 X;  1V1P A;  2RA4 A;  5A2Q E;  2JA6 B;  4MIU A;  5LMU Q;  3CU7 A;  2VL6 A;  5HUR A;  1B9N A;  1EUJ A;  4IPC A;  1CA5 A;  2YTX A;  3E3X A;  3V96 A;  5JJK A;  1CI3 M;  4A3B H;  3P1H A;  2A6H D;  2PNR C;  2Y0S B;  3I91 A;  1II3 A;  3NSW A;  4U68 A;  3KFU A;  5KGU A;  1VQG A;  4XYQ A;  4XXE A;  4DV3 Q;  4UY8 C;  3NXW A;  2ICI A;  2K32 A;  5EPL A;  3DWP A;  5JEA H;  1KNA A;  4KTA A;  4NXN Q;  1DZ1 A;  1EY0 A;  1WD0 A;  2PQA B;  4H0L C;  4YCV A;  2NTT A;  4ULL A;  1YNJ C;  1B4O A;  1XWE A;  1CTM A;  4B3S L;  1EQQ A;  4K2K A;  1UE7 A;  4DR4 Q;  1VQL A;  1STH A;  3H09 A;  3CCQ A;  4FYD A;  1HCZ A;  4IOA A;  4C3H H;  5C4Z A;  1YJ9 A;  4P72 A;  4IAL A;  5IYC H;  2L12 A;  4FF2 A;  1N9W A;  5IT9 E;  2PW5 A;  4B3T Q;  3T1Y Q;  4AQY L;  3F2B A;  4DUY Q;  1SJH D;  4JI8 Q;  2R93 G;  4QQB X;  4LF6 L;  1JQY D;  3MC0 B;  4DR1 L;  2F3I A;  2K01 A;  1STA A;  3D31 A;  3PV0 A;  4L5Q A;  5NUC A;  2KHI A;  1ENF A;  1KLU D;  2VZA A;  1VCI A;  2KHJ A;  2EE1 A;  4LF5 Q;  1IYU A;  5EQ0 A;  1NNX A;  4JI1 L;  1I4Q A;  2WIN B;  5LMN L;  1VQB A;  4WRD A;  5T1I A;  1IBK L;  3MZ5 A;  3UE0 A;  2C35 B;  2CQO A;  4Y7N B;  1L1O B;  1UWV A;  3A0J A;  2AWN A;  2UXC Q;  1Y1W G;  2HDL A;  2XWJ B;  3CCJ A;  4P74 A;  4X66 Q;  4RWS C;  1JWU D;  1A3T A;  4OWT B;  5BN3 A;  1X6O A;  4L5T A;  4ID6 A;  3NP8 A;  1K3R A;  5IGG A;  1F2L A;  2L11 A;  5C3E H;  1EIG A;  4RG1 A;  1K8G A;  3NTH A;  2XIW A;  4UAI A;  1KC8 C;  3AMU A;  3H94 A;  2I46 A;  4UDU C;  3S1R H;  3C3L A;  4XDX A;  2F0W A;  3S1Q H;  1WCM H;  1M1K C;  3WOF A;  3KOJ A;  4UHV A;  2IHF A;  2FJ2 A;  4IUV A;  1JOR A;  3QOJ A;  2DN8 A;  1HZ9 A;  4ME5 A;  4GNX A;  3KF8 B;  1TU2 B;  1FVI A;  2LFN A;  3L9A X;  3PSI A;  4DV5 L;  1I4H A;  3PUZ A;  1YEZ A;  4KJO A;  1EQR A;  2Q8T A;  3D6C A;  5IP9 G;  3TRE A;  3MEH A;  2K5W A;  4R4O A;  1TWG B;  2EVB A;  2J7Z A;  1CK1 A;  3BYT B;  2OWO A;  2A19 A;  4XT1 B;  3CPF A;  2UU9 Q;  3CHB D;  4A3G H;  3PCO B;  1BNZ A;  5M3F G;  1O7Z A;  3GV6 A;  4JI4 L;  3OYY A;  3M4P A;  4IJL A;  2Z0S A;  1I4X A;  2EIF A;  3NEN A;  2AUK A;  2A6E C;  1GM5 A;  2B2T A;  3GTG H;  1L0W A;  3ND8 A;  2J4X A;  1LAB A;  1WTP A;  2QEJ C;  3CCV A;  4LF8 Q;  1PRT B;  4QGU A;  4DU9 A;  4HJ8 A;  3FMC A;  2X6L A;  4IFD I;  4X65 L;  1KRT A;  4DXF A;  1E2Z A;  2RDG A;  1QWY A;  1IXR A;  1CHP D;  3MFG A;  1BQQ T;  3WOE A;  4X3S A;  3WDN A;  1A15 A;  1RIP A;  5DNF A;  1XJV A;  3TZU A;  2F52 A;  4JYA L;  2EYM A;  3HOU G;  1EOT A;  1SE3 A;  5C3E B;  1BDO A;  2ENB A;  2L15 A;  2EXD A;  1K0S A;  1A3U A;  3KJO A;  3K0X A;  3SK6 A;  3S1R B;  4JOI A;  1E1T A;  1VMP A;  2CCZ A;  1GUT A;  2Q2T A;  3S1Q B;  2XVS A;  1EY6 A;  1IKM A;  3KDF A;  5KYL A;  1X3Q A;  2ZXO A;  2CQA A;  1IBL L;  5C0X G;  1EIF A;  3NEL A;  1F9R A;  1EU3 A;  5EPJ A;  5I9P A;  3CPW A;  5EKK A;  5K5P A;  4PNY A;  3C1F A;  4JI7 L;  1BKB A;  2CWP A;  1Y8P B;  4M1U B;  1L1O A;  2QA4 A;  1B44 D;  1SE2 A;  4IUT A;  3CME A;  3BS1 A;  3CMA A;  4DR2 L;  1K8O A;  4LWC A;  5FO9 B;  3GTK B;  4K0K L;  4ZKC B;  2F0E A;  1EYC A;  3LGJ A;  3RR5 A;  1PHJ A;  4R8N A;  4DK1 A;  5JVG 3;  2B2Y C;  5CV6 A;  4A4I A;  4DNI A;  2EDG A;  2K5H A;  4A3G B;  4KY5 A;  4GN4 B;  1NCV A;  2E76 C;  1N36 Q;  3I4O A;  3S14 H;  1BVS A;  1YNJ D;  4N9T A;  3DHQ A;  3EA6 A;  2N88 A;  3MA2 B;  3J80 c;  3OHX C;  1TKW B;  4H13 C;  3DWQ A;  1E2W A;  3I56 A;  4IO9 A;  3U9S A;  4PV1 C;  1SYF A;  1CHQ D;  1K3B C;  3NWS A;  3GQB A;  4HCS A;  4Q5V A;  4DV4 L;  1TT2 A;  2PZW A;  4A3I G;  2CKZ B;  4C1N I;  4HIK A;  1OO9 B;  4A3F G;  4KD3 A;  4KN7 C;  1EY9 A;  2JYO A;  1XXG A;  3KYH C;  3H3V I;  4DK6 C;  1KIX A;  4I65 A;  2JEA I;  1RL2 A;  2RQX A;  4KKU A;  2X69 A;  1VQ9 A;  5D14 A;  2GVA A;  1W6J A;  1L2F A;  4KN4 C;  1CUK A;  1TWA B;  3TP8 A;  3ER0 A;  3VYS A;  4A3I B;  4X62 Q;  1AFP A;  3HOY H;  1TWC H;  1PXU A;  4WJ4 A;  2I07 B;  4A3F B;  5COY A;  1KNE A;  1NSN S;  2I5M X;  4HED A;  1D2B A;  2NUC A;  1MJC A;  1X32 A;  4P71 A;  1WJJ A;  1K73 C;  1S4Z A;  4JG2 A;  4R8I A;  4A76 A;  2F0S A;  2AMC B;  5IGE A;  3P75 A;  2PZT A;  1LTL A;  2CWA A;  5K36 H;  3BVZ A;  1B3A A;  4PMC A;  2KVM A;  4DFA A;  2NVX B;  3S17 B;  1LTG D;  1DOL A;  3EVQ A;  5C0X J;  4JW0 A;  1CSQ A;  4A3D H;  4XTC S;  4NXM Q;  2RKS A;  4LUV A;  4DR6 Q;  1KAA A;  2ZT9 C;  4ABN A;  1XNQ Q;  2BCO A;  5E1F A;  1LTT D;  1IL8 A;  4RGM A;  1WTQ A;  2ATW A;  4PQX A;  3NBH B;  2JA7 G;  4EX5 A;  4A75 A;  2L55 A;  2XNA C;  5CV8 A;  3HOX H;  2EZV A;  3FDT A;  1E0B A;  4POF A;  5M5Y B;  1E7Z A;  4MHE A;  5C44 H;  1NMF A;  4KK7 A;  3CCU A;  1HNZ Q;  3A54 A;  4A3J G;  2O5I C;  2MO0 A;  4RKL A;  1IZ6 A;  1SNM A;  2JA7 B;  3J81 E;  2I5L X;  3JAM c;  1LV9 A;  1JE5 A;  5E3F A;  1SE4 A;  1FGB D;  2L0C A;  1OXT A;  1IYV A;  1Q1E A;  2ASB A;  3S1N B;  1H95 A;  2RDH A;  3OWE B;  4JBM A;  3VR3 A;  2OTJ A;  4KHZ A;  5TSS A;  2UXB Q;  2EYL A;  5EAY A;  1A2T A;  1PYB A;  1Q90 A;  4DV0 Q;  3M4O H;  1XTD A;  2K7V A;  2CFM A;  2R92 G;  4JI2 L;  1H9S A;  1TWC B;  2HDM A;  2NWG A;  1TY0 A;  3TBI B;  1XMO Q;  2F0U A;  5FLM G;  3KLS A;  2A73 B;  1PTO C;  5IYD G;  1GJX A;  3H15 A;  2ICE C;  2MNA A;  4FO2 A;  2A69 D;  2E2H H;  3J80 E;  4IFD H;  2D5D A;  1HQR D;  4OXP A;  2ZM6 Q;  3VR4 A;  1SYC A;  3H0G H;  4V0B A;  4PG3 A;  5J1Z A;  3R2T A;  3KLS X;  1YNN C;  4A3K G;  1S72 A;  1SND A;  1A63 A;  4HJ9 A;  3I4M H;  3VYT A;  4QJF A;  5FKA C;  4DUZ Q;  3ICE A;  1NBW A;  4LF7 L;  2HQE A;  2NN6 I;  3X3N A;  3S1M H;  2H1E A;  3ITP A;  5FOB B;  1D1I A;  2ZXR A;  3F8T A;  3MXG A;  2B39 A;  5J39 A;  3GTJ B;  4ZCK A;  2SDF A;  2KED A;  4BWG B;  4LFB L;  1I94 L;  3M3Y H;  3BVM A;  1STN A;  1EY5 A;  4C3J H;  1U0L A;  2HCI A;  3E5S A;  4A3C G;  4DR7 L;  4LFC Q;  1HZC A;  1N33 L;  2E5L L;  1ROD A;  3I8Z A;  4JPB W;  2VY3 A;  3CCM A;  2EY2 A;  3RUZ A;  5M3M H;  1C48 A;  2I0Q A;  4DR5 Q;  4PZ7 A;  3F2U A;  4JBJ A;  2A1A A;  2LS0 1;  1EU4 A;  3QG1 A;  2WAQ B;  5A2Q L;  4OX9 Q;  3ULJ A;  1A8V A;  2HT1 A;  3T1H L;  4CKE A;  1VQ4 A;  1C7Y A;  2H5X A;  1TY2 A;  1WTX A;  1XPU A;  3DEO A;  3M4O B;  4AQY Q;  3RLN A;  4IFD G;  4BBS H;  2RHQ B;  4RCO A;  5JPN C;  3H0G G;  4FF3 A;  4X64 L;  3HOZ G;  3HG9 A;  2NVT H;  1MIU A;  4KHP L;  1UAP A;  1LTA D;  4BXX G;  2UXD Q;  3NBH A;  4WJ3 M;  4GNX C;  2E8G A;  1D5Z C;  1UE1 A;  4CDF C;  1JIC A;  1SYD A;  2AQ1 B;  3CCR A;  1VMC A;  2E2H B;  3OSO A;  3K59 A;  5C4X G;  1EL0 A;  3N6R A;  3H0G B;  3M7N A;  1STY A;  1K0R A;  2B63 G;  1SEB D;  4TSS A;  1KAB A;  5BR8 L;  3I4M B;  3MXN B;  2WB1 B;  3QO2 A;  1YJW A;  2AWO A;  2MP1 A;  3I55 A;  3J7A F;  5KYI A;  3AEV A;  1R9T H;  3S1M B;  2OQK A;  5ELC A;  1GVP A;  1RTN A;  2F0J A;  3CP0 A;  2GVB A;  5C4X B;  4RGN A;  3PGZ A;  4RGT A;  2B63 B;  2LXK A;  5IT9 L;  1E2V A;  3J81 j;  1VQJ A;  1G29 1;  4JI5 L;  2AQ3 B;  3A56 A;  1I3Q B;  1HTP A;  3FKI G;  1BCP B;  2F3V A;  2VQF L;  1PH3 A;  3KBG A;  4LUO A;  2XTI A;  4C3I H;  1R4P B;  2G5D A;  3W2D A;  1D7Q A;  5JOB A;  2BA1 A;  3CXC A;  2XN9 C;  3TP7 A;  2A74 C;  2VQE L;  1A62 A;  1CKM A;  3NHH A;  1S5E D;  3RLF A;  1K8M A;  1Q3L A;  1QNK A;  2RHS B;  2PPB C;  3I4N H;  1JR0 D;  3HOW H;  1N34 Q;  1JWS D;  2F0K A;  4ZLT F;  1ILP A;  1Q8K A;  2NBF A;  3FKI B;  4KMU C;  1GOZ A;  3GTP H;  1G6P A;  4CKC A;  2UUC L;  3BG3 A;  1CQF A;  1DM0 B;  2M00 A;  5C3X A;  1B53 A;  1WTO A;  4IPD A;  1WTW A;  4YCW A;  3BZC A;  4EVO A;  1F9P A;  2MHV A;  1KTK A;  4JOI C;  1OTC A;  3K81 C;  1A2U A;  3STB C;  1ICF B;  4BBS B;  5CV5 A;  1HZA A;  2CHB D;  3NQT A;  2Y0S G;  3F1Z A;  3MVV A;  5I9O A;  4IFD J;  3EN2 A;  1EWI A;  3S15 B;  3VA7 A;  3HGB A;  4J6H A;  3VA5 A;  5CYU A;  1OXV A;  1YNX A;  1PZJ D;  1LT3 D;  1VQF A;  5IYB H;  1L1O C;  1NE3 A;  1S5D D;  2Z6K A;  4HJ5 A;  1F2Y A;  2GN5 A;  2DJG C;  4DV2 Q;  2UUA L;  1E1O A;  1SBB B;  5EGT A;  1UEA B;  4HCE A;  4Q0F A;  4DAP A;  4K6D A;  3J81 i;  1CT1 D;  4DAY A;  1HR0 Q;  3K57 A;  2L4N A;  1R9T B;  4QIW E;  4JYA Q;  1LAC A;  2D0P A;  1PTO D;  3LWU A;  3CCL A;  1GUW A;  4H02 A;  4XT3 B;  1XPO A;  1SMY C;  3I4N G;  3TQY A;  2E74 C;  1E22 A;  3ZJY C;  2AUJ D;  2OEO A;  1Y1V G;  1PH4 A;  1M90 C;  1YNN D;  3FPP A;  4C3I B;  1F2M A;  3BDC A;  4R1J A;  1YVC A;  4F8M A;  4LF9 L;  4J15 A;  1X65 A;  3M85 A;  2Q2I A;  4RFB A;  3BDO A;  3I4N B;  4KI0 A;  3WWV A;  2YV5 A;  4QF4 A;  2QDL A;  2WAQ E;  3W5O A;  3HOW B;  5KRU A;  4B3M Q;  4DV1 Q;  2K4K A;  1VF7 A;  1PH2 A;  2X6G A;  1Y1V B;  1ILQ A;  1AN8 A;  1VQE A;  2NN6 H;  2SOB A;  4EQO A;  2H4O A;  3TME A;  4A3M H;  4QL5 A;  2F1M A;  4TRD A;  3QR8 A;  1EEI D;  2E2I H;  3ERQ A;  1SNQ A;  4F88 A;  3DWA A;  1D1K A;  4R4Q A;  1CKN B;  3H91 A;  3TZD A;  4DV6 Q;  1YHB A;  5FJ8 H;  5KNC A;  1BF4 A;  4X3K A;  3NTI A;  5J22 A;  4A3B G;  4DR3 L;  3NE5 B;  4DV7 Q;  4UP9 A;  3S24 A;  1HNX L;  1LTS D;  2KUM A;  4JBW A;  4FNF A;  2CVR A;  4IUR A;  1XNR Q;  4PZ6 A;  3VYU A;  5C6A A;  2VNU D;  5D65 A;  3RZD H;  3D4R A;  5EKI A;  5JEA G;  1Z9F A;  5LHY 1;  4A3E H;  3SR1 A;  3I72 A;  2QEX A;  1JOQ A;  1DCZ A;  1TS3 A;  1VQ8 A;  1FNW A;  1V1O A;  4IPH A;  5CC4 A;  2WB1 E;  4HMI A;  4A3B B;  1AH9 A;  3DMU A;  3ERO A;  4NDX A;  3AB9 A;  1SXT A;  1JC7 A;  1L0X B;  4JV5 L;  3GDE A;  3F2C A;  4GZY C;  4XYO A;  3KUP A;  4X3T A;  3AFP A;  2NVQ H;  2FMM A;  1NR4 A;  1GO3 E;  1GUN A;  2Q2U A;  2N3S A;  4C3H G;  5C4J H;  3J7A V;  5IYC G;  1MHW C;  5M5W H;  4FXK C;  2HHH L;  1N32 Q;  2JXM B;  4FDB A;  4HN7 A;  1VQI A;  2HIV A;  1VQO A;  4BY1 H;  1T5E A;  3I70 A;  3MXU A;  3K5L A;  3UI2 A;  4JI6 Q;  4B9W A;  2B2V A;  4A3M G;  4C3H B;  3HS0 C;  1XPR A;  1M8A A;  3MEF A;  2BDN A;  1I50 H;  1OXS C;  2QIL A;  4H44 C;  2ZXP A;  4C2M H;  1Y8N B;  4RH6 A;  1WOC A;  1EQV A;  4FF1 A;  2L5T A;  5ELF A;  2IJ0 A;  2NYZ D;  4DN4 M;  5A35 A;  4IN3 A;  1PLF A;  1DD2 A;  1STE A;  5CGK A;  4XQJ A;  2FIN B;  1GHJ A;  4A3L H;  1AE3 A;  3PIO A;  2DGY A;  3AFQ A;  4A3M B;  1D5M C;  3I2Z A;  5DAU A;  2DNE A;  1PH7 A;  3K5O A;  2KEC A;  2E2I B;  3QB3 A;  3EQL C;  4Z9C B;  3L0O A;  3E0J A;  3S9W A;  1J5E L;  1QVG A;  2LXJ A;  2NZ1 D;  2MQH A;  1VQM A;  2PQA A;  3CD6 A;  5C3E G;  1UNS A;  5ELE A;  2A5H A;  5ELO A;  1PFN A;  1M4V A;  4P75 A;  2A69 C;  1S5F D;  2LKV A;  1K28 A;  5LMU L;  4ILW A;  4OO1 H;  3Q0A A;  2D9U A;  2Y0S E;  3R93 A;  5IIF A;  1RDP D;  1WCM G;  5GQO A;  4CKB A;  3S16 H;  1LT4 D;  2JJQ A;  4FF4 A;  2MFI A;  1J8I A;  1QJO A;  2SNS A;  1TS4 A;  3BYY B;  4EQN A;  3STB D;  3HRZ C;  5JEA J;  4LMQ D;  1FJG Q;  3SHL A;  4JCV E;  2KEN A;  1B9M A;  2B29 A;  4KHV A;  1V43 A;  3SK8 A;  2A8V A;  1ASZ A;  2NVQ B;  1VQD A;  3UE1 A;  1WCM B;  1B70 B;  2F0I A;  2RF4 A;  1ASY A;  3S2H H;  4NXN L;  4L5S A;  1Y8O B;  5C4J B;  5M5W B;  4A3G G;  5IY0 A;  5DEH A;  1K83 H;  1B1Z A;  2Z9H A;  5COR A;  1VQ5 A;  4BY1 B;  5IWA Q;  2R6G A;  2QGQ A;  3ULP A;  4DR4 L;  5GAH C;  2ES2 A;  3S2D H;  1HUN A;  1O7Y A;  4GKJ Q;  1ONL A;  4NKL A;  2VUM H;  3KF6 B;  4C56 C;  3CAM A;  1Q7Y C;  1W6K A;  4C2M B;  4CGY B;  2WKD A;  3J81 L;  3LWE A;  3ERS X;  5JJZ A;  1SMY D;  1D5X C;  2P5Z X;  4NW2 A;  4TQU S;  5IGD A;  2ZJP A;  4B3T L;  3T1Y L;  4DUY L;  2KEE A;  4JI8 L;  3J7A 5;  2ZTE A;  1PH8 A;  3A8J E;  3I3C A;  2IX3 A;  3GTG B;  5G3L D;  4JK1 C;  2MJ8 A;  2F4V Q;  2JA9 A;  3LX0 A;  1RHP A;  2HCC A;  4B08 A;  4LF5 L;  4KY6 A;  3ULL A;  1MGS A;  4LF4 L;  5DM6 3;  2F0P A;  4Y52 H;  1UE5 A;  3D0F A;  3NPP A;  1PH5 A;  1G91 A;  2E2J H;  1QIL A;  1N33 Q;  2UXC L;  2F0L A;  2E5L Q;  1PTO F;  3KF8 A;  1GUS A;  4G4K A;  3SK4 A;  2NTS A;  2F0H A;  3NUC A;  4HJA A;  1KQS A;  5ELN A;  4X66 L;  4YHH Q;  2UUB Q;  1Z7T A;  3LNN A;  1WTV A;  2YU9 H;  4HSV A;  3IKJ A;  3C46 A;  1EEF D;  4APV A;  2EYJ A;  1X3G A;  2K14 A;  1H9M A;  5IOC A;  1DON A;  2R7Z H;  2PO4 A;  1OXU A;  1X55 A;  2KBN A;  5FK9 C;  4GN3 B;  5ISR A;  2F3W A;  1JB3 A;  3KLR A;  4K2L A;  5FO8 B;  2YTY A;  3S2H B;  1LT5 D;  2B3G A;  1PRT D;  5EJW A;  3OOC A;  4OON A;  3AYH B;  2ZJQ A;  3SE0 A;  1QZG A;  4DXG A;  2XRQ D;  3Q22 A;  1JJ2 A;  3HKZ G;  1Q82 C;  3V05 A;  3FPU B;  3T53 B;  4E6I A;  4DK0 A;  3I73 A;  4O2D A;  4MNO A;  3CF5 A;  1GHK A;  1NAP A;  2K5V A;  3S2D B;  4BBR H;  1SR3 A;  3HFZ B;  2CH4 A;  1GUO A;  1EOV A;  1ICW A;  1HPC A;  1SYG A;  4R4I A;  4NP5 A;  2EJG C;  2AQ2 B;  3HKZ B;  3R2I A;  3VR5 A;  4P73 A;  2UU9 L;  3S14 B;  1XX8 A;  2JN4 A;  3U4V A;  1XMQ L;  4KD4 A;  4UPA A;  3GV3 A;  1MI2 A;  3A5Z B;  4K5X A;  4YY3 Q;  3U9O A;  1H9R A;  2KCC A;  5HGT A;  2D2C C;  1B50 A;  2Q2H A;  3OMC A;  3CC4 A;  5FLX L;  5BN5 A;  4LF8 L;  1PFM A;  2BH2 A;  3HOY G;  4JI0 L;  2Z6K C;  3G71 A;  2E2J B;  4IUP A;  1HQM C;  3URY A;  3SK5 A;  4DA2 A;  4LUZ A;  3FP9 A;  3TP5 A;  5JJI A;  1D6E C;  2LSS A;  2K5D A;  2JE6 I;  5K36 G;  4HAE A;  1E24 A;  1SAP A;  2F0T A;  4OIK A;  3HOY B;  3KF6 A;  4NB3 A;  1K8A C;  3UDX A;  4PMW A;  4LFA Q;  2R7Z B;  2RDF A;  3HOV H;  4YWL A;  1CZG A;  1OXX K;  5EPK A;  1IL2 A;  2A68 C;  4A3D G;  1H9K A;  5C4H A;  5AJ3 Q;  4IZ8 A;  4OHJ A;  3BVG A;  2BE5 C;  3OTO Q;  5I6W A;  1IYJ B;  2KHS A;  3U58 A;  1IBM Q;  5LL6 S;  1PTO H;  4RKB A;  1U4R A;  4JI3 L;  3DUZ A;  1ET9 A;  2O4X A;  4P2C B;  1U9R A;  4OEM B;  4MTK A;  4ZKB B;  3FHW A;  4KJN A;  3GTL H;  2JSO A;  4GOP B;  4G7O C;  2KA7 A;  2WAC A;  5M5X H;  3HOX G;  2XGT A;  4A3D B;  4HIM A;  1S40 A;  2QDB A;  4RHS A;  1SE8 A;  3ZYY X;  1HR0 W;  3PO3 H;  3OIQ A;  5C44 G;  1QOH A;  4B9X A;  1SYB A;  5IP7 H;  1WYD A;  3EFX D;  1SLJ A;  1XYI A;  4AYB G;  1S5B D;  5CBE E;  1VF5 C;  2WII B;  4IOC A;  3HOX B;  4CBV A;  5E4W C;  2PQE A;  2WAQ G;  1N36 L;  4R4C A;  2R3Z A;  1TS2 A;  5C44 B;  2PW7 A;  2B2W C;  4HJ7 A;  2M2L A;  3HEJ A;  2WV6 D;  4X6A H;  3M7G A;  3L3O C;  1RTO A;  3GTQ H;  1V1P B;  2CH4 W;  4F7X A;  1BCP C;  4B3S Q;  4AYB B;  1O7L A;  2N78 A;  2OQ0 A;  2SNM A;  4LK1 C;  4TVA B;  3D4D A;  2JA8 H;  2WFW A;  2DY7 A;  2OXP A;  3I7F A;  1PA6 A;  1SRU A;  4QY7 A;  3HP3 A;  2F4I A;  1NMG A;  2EQS A;  1P8L A;  2HQL A;  3QJY A;  4O0A A;  1ET6 A;  1CM9 A;  2K33 A;  4LF6 Q;  1Y14 B;  1VQN A;  4J1M A;  4A93 H;  4DR1 Q;  4DAV A;  4V19 0;  4X62 L;  3ND9 A;  4CDE C;  1C0A A;  3I4M G;  1QNU A;  2WB1 G;  3I4L A;  4XIG S;  2FHT A;  4JI1 Q;  1X3F A;  1FNU A;  5LMN Q;  3G7L A;  5JJL A;  3TEH B;  3PUY A;  1U5K A;  2K6A A;  1IBK Q;  1X54 A;  1ESR A;  2K50 A;  2B2U A;  2B2V C;  2WKC A;  3SVM A;  1DOM A;  2AHO B;  3GTL B;  3A55 A;  1RKN A;  3A8I E;  1VS0 A;  4DPG A;  1Q8I A;  2JA6 H;  1KDB A;  5G3L F;  5HY6 A;  5J3B A;  3RD4 A;  4C3J G;  3JAM E;  3AU7 A;  2JP1 A;  2MUY A;  4BS9 A;  1Z47 A;  3PO3 B;  3KJP A;  1ZKO A;  4WJW A;  1WI5 A;  3HKZ E;  5IT9 c;  4DNT B;  4NXM L;  1F9S A;  3W1G A;  4DR6 L;  5M3M G;  1PH6 A;  2D0O A;  3H3V C;  4GKK L;  1XNQ L;  2DUD A;  3BU2 A;  4EQP A;  1QVC A;  4BY7 H;  3M3Y B;  4K6L A;  1YHQ A;  1LO5 D;  1QCB D;  4C3J B;  1U4M A;  4G7Z C;  1MJE A;  1HRJ A;  3MHB A;  2IT1 A;  1U4L A;  1J9O A;  1Q12 A;  3A7A B;  1KRS A;  4ZRZ A;  1HNZ L;  1BOS A;  5M3M B;  4FP5 D;  3GTQ B;  2EY1 A;  2R7D A;  4IUN A;  4OO1 I;  3SEB A;  5I2X A;  4RMF A;  4BBS G;  5ELB A;  2RSO A;  1WD1 A;  2DNC A;  4DV5 Q;  1LUZ A;  4OWW B;  1ML0 D;  2E2D C;  2XWB B;  4GOP A;  4LNQ A;  2UXB L;  4N8X 1;  2BH8 A;  2DJF C;  2V4D A;  1FL0 A;  4DV0 L;  2O5J C;  2Z8L A;  4RGO S;  1IKL A;  3V2T A;  3GO5 A;  3D6W A;  4JI4 Q;  2NVT B;  1I4G A;  1EYD A;  1I6V C;  2ZJR A;  4A93 B;  1SDF A;  2B8F A;  5E4X A;  1TVX A;  3FVQ A;  4FXG C;  1SNO A;  1CZW A;  1TS5 A;  1I5F A;  3K6O A;  1XMO L;  2RBM A;  4QUF A;  2JA5 H;  3CC7 A;  5CV4 A;  3SGI A;  4CDD C;  1MBY A;  3PUW A;  2CW0 C;  4X65 Q;  1AZP A;  3R8B A;  1EY7 A;  4ZYS A;  2R93 H;  1PDQ A;  1KLG D;  5ELD A;  5CBA E;  1DXM A;  3B6Y A;  1YIJ A;  3VDY A;  4OL7 A;  3VR2 A;  4CDC C;  4CJ0 B;  4G57 A;  1S5C D;  3K5M A;  1G6Z A;  3G6E A;  1SYE A;  3RLO A;  4C3I G;  2XSC A;  2QKI C;  4DUZ L;  1HNW L;  1IW7 D;  1EIH A;  1G2T A;  2A68 D;  1LTR D;  2C9O A;  4ODG A;  4XQN A;  1HFG A;  1BR9 A;  1ZXT A;  2ID0 A;  2BE5 D;  2JK8 A;  5JVH 3;  3GTO H;  3HOW G;  4BY7 B;  3HZX A;  1Y1W H;  1GD7 A;  3E6Z X;  3Q23 A;  1Z6H A;  1PH1 A; 
#chains in the Genus database with same CATH homology
 1LTI D;  2PCF B;  3TN2 A;  5EBD A;  5D3D A;  5JAV A;  2Z4H A;  4L8J A;  1Y69 U;  3O13 A;  1WVL A;  3M4Y A;  1R4Q B;  3GTP B;  3PMF A;  3ONA B;  1HFN A;  4BA1 I;  3G6J B;  1NR2 A;  2B8G A;  5IGC A;  3MXN A;  3FEW X;  2EYH A;  3P20 A;  4CHT B;  1AP0 A;  2EJF C;  4WFN 3;  1BCP D;  4ZUI A;  2B2W A;  2BDO A;  1PRT C;  2JA5 B;  2C5C A;  3T56 B;  3VYR A;  1HUM A;  1AW7 A;  1G2S A;  2FMC A;  5EKL A;  2R93 B;  3MTS A;  1A6X A;  2HUG A;  4CJ2 C;  4FVM A;  5C5L A;  4IUU A;  2F0O A;  1FR3 A;  2G9H D;  2VXW A;  3GP7 A;  1F77 A;  4QCL A;  1X3P A;  1TQO A;  3OWF A;  5AFW A;  3GTO B;  1ENC A;  4PMB A;  1Y1W B;  2NN6 G;  5CR3 A;  1O78 A;  3TP6 A;  2E75 C;  2LY7 A;  3IL8 A;  2F0M A;  3SDZ A;  2G9D A;  4S3S A;  4K5W A;  5C5M A;  1HHV A;  3IFD A;  4U67 3;  1QE6 A;  3I90 A;  5C0X H;  4MN3 A;  1SNP A;  3CRK C;  4HMJ A;  1DOK A;  3MAQ A;  1FYC A;  3OW7 A;  1HXY D;  1EYA A;  2MPM A;  2KJX A;  1RCV D;  4KKS A;  4I7Z C;  2Q8I B;  1EY8 A;  3RZD B;  1HA5 A;  4IUQ A;  2EXZ A;  4YIJ A;  1I4R A;  4DF7 A;  3PIO 3;  4A3E B;  1AEX A;  1EWC A;  3T13 A;  4BA2 I;  2Z4I A;  5M3F B;  2TMP A;  4OGQ C;  4X3U A;  2Q8R E;  2D62 A;  4G7H C;  5CV9 A;  4R9W A;  2F0V A;  3N52 A;  1SSO A;  1B2T A;  2L1B A;  5JPM C;  3CKI B;  2CW0 D;  1UUP A;  1IHZ A;  2K5Q A;  3T51 B;  2EYP A;  1SJE D;  1BBX C;  1I50 B;  3HOU B;  3RZO B;  3R3O A;  2K04 A;  2OF1 A;  2KQ3 A;  1I4P A;  4H7B A;  4RA8 A;  3IFT A;  2RVL A;  1JE4 A;  3J7Y W;  3K7A B;  1ZYR C;  1EY4 A;  1H9S B;  1JCK B;  1V8Q A;  3K5N A;  4OO1 G;  1F9Q A;  2EOT A;  1A3V A;  1JWM D;  3CQZ B;  2EY6 A;  4LJZ C;  2K03 A;  1SFO B;  2B2U C;  2F0Q A;  4XQQ A;  2IW3 A;  4HSP A;  4KKT A;  4FXD A;  5M9O A;  1G8Z D;  3J80 L;  3S16 B;  4EGV A;  1RJT A;  2Z1C A;  2PMZ B;  1O80 A;  4F87 A;  4ZK9 B;  2YYZ A;  3K58 A;  5KNB A;  2K05 A;  4K5V A;  2EYF A;  3PIP 3;  1TII D;  1QB5 D;  1RF2 D;  3GD7 A;  3OMG A;  3MFY A;  3VR6 A;  2IX1 A;  2EJM A;  3L7Z C;  4HTH A;  2FFK B;  1CA6 A;  3MXP A;  1C4Q A;  1FD7 D;  2M9V A;  1K83 B;  3OIP A;  4WOR A;  5EBC A;  2EY5 A;  4O1N A;  1H9J A;  1SNC A;  4CJ1 B;  1C8C A;  2OT2 A;  3T16 A;  1PZK D;  1EQT A;  1HA6 A;  1EFI D;  5CV7 A;  2VUM B;  1BCP F;  1AZQ A;  4L6T B;  1BUV T;  1MSG A;  4QUC A;  1TWF B;  1F2Z A;  4K14 A;  3BDL A;  3DEP A;  1JOO A;  4ZQ3 A;  2DY8 A;  4RAU C;  1EWH A;  2IX0 A;  2L9H A;  1I6H B;  2RSN A;  4OIJ A;  2N55 A;  4QMG A;  1Q1B A;  2QF7 A;  4K8J A;  1RD9 D;  3Q6S A;  2YU9 B;  3PUV A;  1L0Y B;  2LMC B;  4L63 B;  1TWH B;  1KDC A;  2VB2 X;  2BA0 A;  3JAM L;  2F0G A;  5I2Y A;  1IW7 C;  1LT6 D;  4A3J B;  3BZD B;  4RCN A;  4C1N K;  1PZI D;  2A6E D;  2EYO A;  2A6H C;  2R61 A;  2F0N A;  1QG7 A;  2WP8 J;  1CQV A;  2PZU A;  3NBI A;  1ENA A;  3RMH A;  1XTC D;  2IPK D;  2J0T D;  4HR7 B;  3KK7 A;  4BBR B;  3D4W A;  2MGS A;  2PYK A;  4IQZ A;  5CMD A;  2EPB A;  2R92 B;  2SEB D;  1HTL D;  5DM7 3;  1PMR A;  3QIA A;  1ZEQ X;  3QOL A;  3C2P A;  3T4A C;  4J8Q A;  2F0F A;  3KBX A;  2F03 A;  1GXD C;  3QWN A;  5IOD A;  4QIW B;  5D3I B;  4A3K B;  1FNV A;  1LTB D;  5KEE A;  1KDA A;  4RHR A;  3DM1 A;  1JOK A;  2KOL A;  2K1B A;  3NWT A;  4LAA A;  3SXH A;  2F0D A;  2NVY B;  3A8K E;  1ZYR D;  1NUC A;  2K28 A;  2O2L D;  5KIX A;  5C3W A;  5FO7 B;  3W3A A;  3HOV B;  5IGB A;  2B2Y A;  1DYQ A;  3NTK A;  3NK9 A;  3MWY W;  1PTO B;  3TSS A;  5KND A;  2IWH A;  4K8I A;  3H6M A;  4ZAI A;  5FLX E;  1EZ8 A;  2IL8 A;  3K0Y A;  5M5X B;  1CFM A;  1VDZ A;  5I6Y A;  3GTM B;  3C1E A;  1TR5 A;  4DGZ A;  1WTR A;  3OPO A;  3HOZ B;  5C0X I;  1GUG A;  4DNR B;  3A7L A;  5IGF A;  3FRP B;  3NQI A;  3P7J A;  2GA4 B;  2KCN A;  4M8A A;  5BN4 A;  2TSS A;  3TDQ A;  3EJI A;  1T5X D;  5I4D A;  3D8G A;  1PYW D;  2BOS A;  2B2T C;  2XRS D;  4TKO B;  4KY7 A;  4QB4 A;  3X3M A;  4O42 A;  2JA8 B;  5F2D A;  3DXJ C;  2NB0 A;  1MSH A;  4N9P A;  3Q24 A;  1PRT F;  1BO0 A;  1MD2 D;  3PUX A;  2VB3 X;  1PFB A;  1DJR D;  1U4P A;  4KV6 A;  2QCP X;  1LLR D;  1EZ6 A;  1STB A;  4ZUJ A;  1BXT A;  5T1G A;  2JEB I;  4NMZ A;  3D3R A;  1ESF A;  1STG A;  3CRL C;  3IAY A;  3PO2 B;  5LL6 X;  1V1P A;  2RA4 A;  5A2Q E;  2JA6 B;  4MIU A;  3CU7 A;  5HUR A;  1B9N A;  1CA5 A;  3V96 A;  1CI3 M;  3P1H A;  2A6H D;  2PNR C;  2Y0S B;  3I91 A;  1II3 A;  3NSW A;  4U68 A;  5KGU A;  4XYQ A;  4XXE A;  3NXW A;  2ICI A;  2K32 A;  5EPL A;  3DWP A;  5JEA H;  1KNA A;  4KTA A;  1DZ1 A;  1EY0 A;  1WD0 A;  4H0L C;  2NTT A;  4ULL A;  1YNJ C;  1B4O A;  1XWE A;  1CTM A;  4K2K A;  1STH A;  3H09 A;  4FYD A;  1HCZ A;  5C4Z A;  4IAL A;  2L12 A;  4FF2 A;  5IT9 E;  2PW5 A;  1SJH D;  1JQY D;  3MC0 B;  2K01 A;  1STA A;  3D31 A;  3PV0 A;  5NUC A;  1ENF A;  1KLU D;  1VCI A;  2EE1 A;  1IYU A;  5EQ0 A;  1I4Q A;  2WIN B;  4WRD A;  5T1I A;  3MZ5 A;  4Y7N B;  2AWN A;  2HDL A;  2XWJ B;  4RWS C;  1JWU D;  1A3T A;  5BN3 A;  4ID6 A;  3NP8 A;  5IGG A;  1F2L A;  2L11 A;  1EIG A;  3NTH A;  2XIW A;  4UAI A;  3AMU A;  3H94 A;  2I46 A;  4UDU C;  3C3L A;  4XDX A;  2F0W A;  3WOF A;  2FJ2 A;  4IUV A;  1JOR A;  3QOJ A;  2DN8 A;  4ME5 A;  1TU2 B;  2LFN A;  3L9A X;  1I4H A;  3PUZ A;  4KJO A;  2Q8T A;  3D6C A;  3MEH A;  2K5W A;  1TWG B;  2EVB A;  2J7Z A;  1CK1 A;  3BYT B;  4XT1 B;  3CHB D;  1BNZ A;  1O7Z A;  3GV6 A;  1I4X A;  2AUK A;  2A6E C;  2B2T A;  2J4X A;  1LAB A;  3ND8 A;  1WTP A;  2QEJ C;  1PRT B;  4DU9 A;  3FMC A;  2X6L A;  4IFD I;  4DXF A;  1E2Z A;  2RDG A;  1QWY A;  1CHP D;  3MFG A;  1BQQ T;  3WOE A;  4X3S A;  3WDN A;  1A15 A;  5DNF A;  3TZU A;  2EYM A;  1EOT A;  1SE3 A;  5C3E B;  1BDO A;  2ENB A;  1A3U A;  3SK6 A;  3S1R B;  1VMP A;  1GUT A;  3S1Q B;  2XVS A;  1EY6 A;  1IKM A;  5KYL A;  1X3Q A;  2ZXO A;  2CQA A;  5C0X G;  1F9R A;  1EU3 A;  5EPJ A;  5I9P A;  5EKK A;  5K5P A;  4PNY A;  3C1F A;  1Y8P B;  4M1U B;  1B44 D;  1SE2 A;  4IUT A;  3BS1 A;  1K8O A;  5FO9 B;  3GTK B;  4ZKC B;  2F0E A;  1EYC A;  4R8N A;  4DK1 A;  5JVG 3;  2B2Y C;  5CV6 A;  2EDG A;  4A3G B;  4KY5 A;  1NCV A;  2E76 C;  1YNJ D;  4N9T A;  3DHQ A;  3EA6 A;  2N88 A;  3MA2 B;  3OHX C;  1TKW B;  4H13 C;  3DWQ A;  1E2W A;  3U9S A;  4PV1 C;  1SYF A;  1CHQ D;  3NWS A;  3GQB A;  4HCS A;  4Q5V A;  1TT2 A;  2PZW A;  4C1N I;  1OO9 B;  4KD3 A;  4KN7 C;  1EY9 A;  2JYO A;  1XXG A;  2JEA I;  4I65 A;  2RQX A;  4KKU A;  2X69 A;  5D14 A;  1W6J A;  4KN4 C;  1TWA B;  3TP8 A;  3VYS A;  4A3I B;  1AFP A;  1PXU A;  2I07 B;  4A3F B;  5COY A;  1KNE A;  1NSN S;  1D2B A;  4HED A;  2NUC A;  1X32 A;  1S4Z A;  4R8I A;  2F0S A;  5IGE A;  3P75 A;  2PZT A;  5K36 H;  3BVZ A;  1B3A A;  4PMC A;  2KVM A;  4DFA A;  2NVX B;  3S17 B;  1LTG D;  1DOL A;  3EVQ A;  5C0X J;  4XTC S;  2RKS A;  1KAA A;  2ZT9 C;  4ABN A;  2BCO A;  5E1F A;  1LTT D;  1IL8 A;  4RGM A;  1WTQ A;  4PQX A;  2L55 A;  2XNA C;  5CV8 A;  2EZV A;  3FDT A;  1E0B A;  5M5Y B;  4MHE A;  4KK7 A;  3A54 A;  2O5I C;  4RKL A;  1SNM A;  2JA7 B;  3J81 E;  1LV9 A;  5E3F A;  1SE4 A;  1FGB D;  2L0C A;  1OXT A;  1IYV A;  1Q1E A;  3S1N B;  2RDH A;  3OWE B;  3VR3 A;  4KHZ A;  5TSS A;  2EYL A;  1A2T A;  1Q90 A;  2K7V A;  1H9S A;  1TWC B;  2HDM A;  2NWG A;  1TY0 A;  3TBI B;  2F0U A;  3KLS A;  2A73 B;  1PTO C;  1GJX A;  2ICE C;  4FO2 A;  2A69 D;  3J80 E;  4IFD H;  2D5D A;  1HQR D;  3VR4 A;  1SYC A;  4V0B A;  5J1Z A;  3R2T A;  3KLS X;  1YNN C;  1SND A;  3VYT A;  5FKA C;  2HQE A;  2NN6 I;  3X3N A;  2H1E A;  3ITP A;  5FOB B;  1D1I A;  2ZXR A;  3MXG A;  2B39 A;  5J39 A;  3GTJ B;  2SDF A;  2KED A;  4BWG B;  3BVM A;  1STN A;  1EY5 A;  2HCI A;  3E5S A;  1ROD A;  3I8Z A;  2EY2 A;  3RUZ A;  1C48 A;  3F2U A;  2LS0 1;  1EU4 A;  3QG1 A;  2WAQ B;  5A2Q L;  4CKE A;  1TY2 A;  1WTX A;  3DEO A;  3M4O B;  4IFD G;  4RCO A;  5JPN C;  4FF3 A;  3HG9 A;  1UAP A;  1LTA D;  3NBH A;  1D5Z C;  1JIC A;  1SYD A;  2AQ1 B;  1VMC A;  2E2H B;  3OSO A;  3K59 A;  1EL0 A;  3N6R A;  3H0G B;  3M7N A;  1STY A;  1SEB D;  4TSS A;  1KAB A;  3I4M B;  3QO2 A;  2WB1 B;  2AWO A;  2MP1 A;  3J7A F;  5KYI A;  3S1M B;  5ELC A;  1RTN A;  2F0J A;  5C4X B;  4RGN A;  4RGT A;  2B63 B;  5IT9 L;  1E2V A;  1G29 1;  2AQ3 B;  3A56 A;  1I3Q B;  1HTP A;  1BCP B;  2F3V A;  3KBG A;  1R4P B;  3W2D A;  5JOB A;  2BA1 A;  2XN9 C;  3TP7 A;  2A74 C;  3RLF A;  3NHH A;  1S5E D;  1K8M A;  1QNK A;  1Q3L A;  2PPB C;  1JR0 D;  1JWS D;  2F0K A;  4ZLT F;  1ILP A;  2NBF A;  3FKI B;  4KMU C;  1GOZ A;  4CKC A;  3BG3 A;  1CQF A;  1DM0 B;  2M00 A;  5C3X A;  1B53 A;  1WTO A;  1WTW A;  4EVO A;  1F9P A;  2MHV A;  1KTK A;  1A2U A;  4BBS B;  5CV5 A;  2CHB D;  3NQT A;  3MVV A;  5I9O A;  4IFD J;  3S15 B;  3VA7 A;  3HGB A;  4J6H A;  3VA5 A;  5CYU A;  1OXV A;  1PZJ D;  1LT3 D;  1S5D D;  1F2Y A;  1SBB B;  5EGT A;  1UEA B;  4HCE A;  4Q0F A;  4DAP A;  4K6D A;  1CT1 D;  4DAY A;  3K57 A;  2L4N A;  1R9T B;  1LAC A;  1PTO D;  3LWU A;  1GUW A;  4XT3 B;  1SMY C;  2E74 C;  2AUJ D;  2OEO A;  1YNN D;  3FPP A;  4C3I B;  1F2M A;  3BDC A;  4F8M A;  3M85 A;  4RFB A;  3BDO A;  3I4N B;  4KI0 A;  4QF4 A;  3HOW B;  5KRU A;  1VF7 A;  2X6G A;  1Y1V B;  1ILQ A;  1AN8 A;  2NN6 H;  2SOB A;  4EQO A;  2H4O A;  3TME A;  2F1M A;  4TRD A;  1EEI D;  3ERQ A;  1SNQ A;  4F88 A;  3DWA A;  1D1K A;  3H91 A;  3TZD A;  5KNC A;  1BF4 A;  4X3K A;  3NTI A;  5J22 A;  3NE5 B;  1LTS D;  2KUM A;  4JBW A;  4FNF A;  2CVR A;  4IUR A;  2VNU D;  3VYU A;  5C6A A;  5D65 A;  3D4R A;  5EKI A;  5JEA G;  5LHY 1;  3SR1 A;  3I72 A;  1JOQ A;  1DCZ A;  1TS3 A;  1FNW A;  1V1O A;  5CC4 A;  4HMI A;  4A3B B;  3DMU A;  3ERO A;  4NDX A;  3AB9 A;  1SXT A;  1JC7 A;  1L0X B;  4GZY C;  4XYO A;  3KUP A;  4X3T A;  2FMM A;  1NR4 A;  1GUN A;  4C3H G;  3J7A V;  4FXK C;  2JXM B;  4HN7 A;  1T5E A;  3I70 A;  3MXU A;  3K5L A;  3UI2 A;  4B9W A;  2B2V A;  4C3H B;  3HS0 C;  1M8A A;  2BDN A;  1OXS C;  2QIL A;  4H44 C;  2ZXP A;  1Y8N B;  4RH6 A;  1EQV A;  4FF1 A;  2L5T A;  5ELF A;  2IJ0 A;  2NYZ D;  4DN4 M;  5A35 A;  4IN3 A;  1PLF A;  1DD2 A;  1STE A;  5CGK A;  4XQJ A;  2FIN B;  1GHJ A;  4A3M B;  1D5M C;  5DAU A;  2DNE A;  2KEC A;  3K5O A;  2E2I B;  3QB3 A;  3EQL C;  4Z9C B;  3E0J A;  3S9W A;  2NZ1 D;  1UNS A;  5ELE A;  2A5H A;  1PFN A;  1M4V A;  2A69 C;  1S5F D;  2LKV A;  4ILW A;  4OO1 H;  3Q0A A;  2D9U A;  3R93 A;  5IIF A;  1RDP D;  4CKB A;  1LT4 D;  4FF4 A;  1J8I A;  1QJO A;  2SNS A;  1TS4 A;  3BYY B;  4EQN A;  3HRZ C;  5JEA J;  4LMQ D;  3SHL A;  1B9M A;  4KHV A;  1V43 A;  3SK8 A;  2NVQ B;  1WCM B;  2F0I A;  1Y8O B;  5C4J B;  5M5W B;  5DEH A;  1B1Z A;  5COR A;  4BY1 B;  2R6G A;  1HUN A;  1O7Y A;  1ONL A;  4NKL A;  4C56 C;  1W6K A;  4C2M B;  4CGY B;  2WKD A;  3J81 L;  3LWE A;  5JJZ A;  1SMY D;  1D5X C;  4NW2 A;  4TQU S;  5IGD A;  2KEE A;  3A8J E;  3I3C A;  2IX3 A;  3GTG B;  5G3L D;  4JK1 C;  2MJ8 A;  3LX0 A;  1RHP A;  2HCC A;  4B08 A;  4KY6 A;  1MGS A;  5DM6 3;  2F0P A;  3NPP A;  1G91 A;  1QIL A;  2F0L A;  1PTO F;  3KF8 A;  1GUS A;  4G4K A;  3SK4 A;  2NTS A;  2F0H A;  3NUC A;  1Z7T A;  3LNN A;  1WTV A;  4HSV A;  3IKJ A;  3C46 A;  1EEF D;  2EYJ A;  1H9M A;  5IOC A;  1DON A;  2PO4 A;  1OXU A;  5FK9 C;  5ISR A;  2F3W A;  1JB3 A;  3KLR A;  4K2L A;  5FO8 B;  3S2H B;  1LT5 D;  1PRT D;  5EJW A;  3OOC A;  3SE0 A;  4DXG A;  2XRQ D;  3Q22 A;  3V05 A;  3FPU B;  3T53 B;  4E6I A;  4DK0 A;  3I73 A;  1GHK A;  1NAP A;  3S2D B;  1GUO A;  1ICW A;  1HPC A;  1SYG A;  4NP5 A;  2EJG C;  2AQ2 B;  3HKZ B;  3R2I A;  3VR5 A;  3S14 B;  1XX8 A;  4KD4 A;  3GV3 A;  1MI2 A;  4K5X A;  3U9O A;  1H9R A;  2KCC A;  5HGT A;  2D2C C;  1B50 A;  3OMC A;  5FLX L;  5BN5 A;  1PFM A;  2E2J B;  4IUP A;  1HQM C;  3URY A;  3SK5 A;  4DA2 A;  3TP5 A;  1D6E C;  2K5D A;  2JE6 I;  5K36 G;  4HAE A;  1SAP A;  2F0T A;  4OIK A;  3HOY B;  4PMW A;  2R7Z B;  2RDF A;  1CZG A;  1OXX K;  5EPK A;  2A68 C;  1H9K A;  5C4H A;  4IZ8 A;  4OHJ A;  3BVG A;  2BE5 C;  5I6W A;  2KHS A;  5LL6 S;  1PTO H;  4RKB A;  1U4R A;  3DUZ A;  1ET9 A;  2O4X A;  4P2C B;  1U9R A;  4ZKB B;  4KJN A;  2JSO A;  4G7O C;  2KA7 A;  2WAC A;  4A3D B;  2QDB A;  4RHS A;  3ZYY X;  3OIQ A;  1QOH A;  4B9X A;  1SYB A;  3EFX D;  1XYI A;  1S5B D;  5CBE E;  1VF5 C;  2WII B;  3HOX B;  4CBV A;  5E4W C;  2PQE A;  2R3Z A;  1TS2 A;  5C44 B;  2PW7 A;  2B2W C;  2M2L A;  3HEJ A;  2WV6 D;  3M7G A;  3L3O C;  1RTO A;  1V1P B;  4F7X A;  1BCP C;  4AYB B;  1O7L A;  2SNM A;  4LK1 C;  3D4D A;  2DY7 A;  2OXP A;  3HP3 A;  2F4I A;  3QJY A;  1ET6 A;  1CM9 A;  2K33 A;  4J1M A;  4DAV A;  4V19 0;  3ND9 A;  1QNU A;  3I4L A;  4XIG S;  2FHT A;  1FNU A;  3G7L A;  3PUY A;  2K6A A;  1ESR A;  2B2U A;  2B2V C;  2WKC A;  3SVM A;  1DOM A;  3GTL B;  3A55 A;  1RKN A;  3A8I E;  1Q8I A;  1KDB A;  5G3L F;  3RD4 A;  3JAM E;  4C3J G;  3AU7 A;  2JP1 A;  2MUY A;  4BS9 A;  1Z47 A;  3PO3 B;  1ZKO A;  4WJW A;  4DNT B;  1F9S A;  3H3V C;  4EQP A;  3M3Y B;  4K6L A;  1LO5 D;  1QCB D;  4C3J B;  1U4M A;  4G7Z C;  1HRJ A;  3MHB A;  2IT1 A;  1U4L A;  1J9O A;  1Q12 A;  3A7A B;  4ZRZ A;  1BOS A;  5M3M B;  4FP5 D;  3GTQ B;  2EY1 A;  4IUN A;  4OO1 I;  3SEB A;  5I2X A;  5ELB A;  2RSO A;  1WD1 A;  2DNC A;  1ML0 D;  2E2D C;  2XWB B;  2V4D A;  2O5J C;  2Z8L A;  4RGO S;  1IKL A;  3V2T A;  3GO5 A;  3D6W A;  2NVT B;  1I4G A;  1EYD A;  1I6V C;  4A93 B;  1SDF A;  2B8F A;  5E4X A;  1TVX A;  3FVQ A;  4FXG C;  1SNO A;  1CZW A;  1TS5 A;  3K6O A;  2RBM A;  4QUF A;  5CV4 A;  1MBY A;  3PUW A;  2CW0 C;  1AZP A;  3R8B A;  1EY7 A;  4ZYS A;  1PDQ A;  1KLG D;  5ELD A;  5CBA E;  1DXM A;  4OL7 A;  3VR2 A;  4CJ0 B;  4G57 A;  1S5C D;  3K5M A;  1G6Z A;  1SYE A;  4C3I G;  2XSC A;  2QKI C;  1IW7 D;  1EIH A;  1G2T A;  2A68 D;  1LTR D;  2C9O A;  4ODG A;  4XQN A;  1HFG A;  1BR9 A;  1ZXT A;  2ID0 A;  2BE5 D;  5JVH 3;  4BY7 B;  3HZX A;  3E6Z X;  3Q23 A;  1Z6H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...