1D1IA

Mutated shiga-like toxin b subunit (w34a) complexed with receptor gb3 analogue
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
69
structure length
69
Chain Sequence
TPDCVTGKVEYTKYNDDDTFTVKVGDKELFTNRANLQSLLLSAQITGMTVTIKTNACHNGGGFSEVIFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SHIGA TOXIN B-CHAIN
publication title Mutated Shiga-like Toxin B Subunit (W34A) Complexed with Receptor Gb3 Analogue
rcsb
source organism Escherichia coli
molecule tags Toxin
total genus 16
structure length 69
sequence length 69
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 1999-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.70 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1d1iA00
1CZGA 1DM0B 4M1UB 1R4PB 1D1KA 1R4QB 1QNUA 1CZWA 2XSCA 1C4QA 2GA4B 2C5CA 1CQFA 4ULLA 4P2CB 1QOHA 1C48A 1D1IA 2BOSA 3MXGA 1BOSA
chains in the Genus database with same CATH superfamily
1SLJA 4HIOA 4JW0A 3PUXA 3PQIA 2JA7G 4UDUC 1PMRA 1KC8C 4NXML 1I6VC 3MC0B 2K14A 2SEBD 3L7ZC 1WFQA 1N32L 5T1GA 2F3VA 3A8IE 4ODGA 1IL8A 1SNOA 1JORA 4MN3A 3L9AX 1Q90A 4IPGA 3TDQA 1HZBA 1HXYD 2B3GA 1N33Q 3NBHB 2F52A 1PH4A 1T9HA 4KY5A 2UXBL 1HZ9A 5I6YA 2UUAL 4HJ7A 4O1NA 3A0JA 3QB3A 3MEFA 2QEXA 3RD4A 2HQLA 4C3HH 4B9WA 1B53A 1K83B 3I4NB 2Z4HA 4OHJA 4BY1G 3BVZA 2ZXRA 1SDFA 4XT1B 1LTAD 5FK9C 3HKZE 4ULLA 2HD3A 4C2MH 2JSOA 1QOHA 1NMFA 4DV0L 2FXQA 3G6EA 4YWLA 5FJ8G 4R8NA 1W3SA 1Q1BA 2K1BA 3A8KE 1GOZA 1TVXA 3M3YH 5EQ0A 4NMZA 4DV1L 5D3DA 5M5YH 1X3FA 1KNAA 4OWTB 4OX9Q 1TU2B 1EQRA 1HR0Q 1XWEA 4CJ0B 3L2PA 3BDLA 3GTLB 1CI3M 3A55A 5IOCA 3J81L 2FMCA 4DR4L 2HIXA 1IW7C 4CHTB 1ESFA 1ENFA 2WAQE 4DV4Q 4NW2A 1T5XD 5I9OA 4LNQA 1VQMA 4IUVA 3K5OA 2EVBA 1F2ZA 5GAHC 1X3EA 1JWSD 4JBWA 2B39A 1TWFH 5I9PA 1OTCA 1H95A 2LXJA 3FKIH 2IL8A 5CV9A 4F7XA 2A19A 3S17H 1MD2D 1TY2A 3I91A 1JJ2A 5KYLA 4DV6Q 2B63G 1QILA 2NN6I 3MAQA 1KLUD 4O2DA 2F4VL 1QB5D 3TSSA 5AJ3L 1CQVA 1SEBD 3D3RA 2LMCB 3KBGA 5K36G 3AB9A 1NR4A 4K8JA 5IYCG 2IY5B 5KGUA 3AYHB 5JOBA 3TBIB 5HGQA 3S9WA 3E5SA 5D65A 1AE2A 3V96A 3HOVH 1KDBA 5G3LD 5IP7H 4CJ1B 1ILPA 2CVRA 1TWAH 3E9IA 2RHQB 1ASYA 3DEPA 1STYA 2PI2A 4ZUJA 3PO2G 2K5VA 3KLRA 4R4TA 4U673 2E5LQ 3I72A 2A6HD 2BE5D 3OW7A 4A3FH 3NXWA 3PIOA 1JWUD 1IYUA 2B2UA 5DLQE 1IKMA 5E4XA 4G7ZC 1STGA 4C3HB 5C4ZA 1EY9A 5JEAJ 2QW7A 4FXGC 4XYQA 5KYIA 1D5XC 1H9KA 1DOLA 3JC66 2F03A 5LMUL 2JN4A 4HSPA 3CCJA 4JV5L 1I4GA 4C2MB 1WCMG 4KHVA 1A0IA 3EQLC 4IJHA 4WJWA 2YTVA 2DY7A 2JP1A 3EIVA 4KTAA 2F0PA 1TT2A 4JG2A 3S1MH 1STEA 4OWWB 1TWHB 2QGQA 3M3YB 3UE0A 4C56C 5M5YB 1O7YA 5HURA 1QVGA 4B3TL 2F0EA 3CC4A 2RCFA 3J80E 3O13A 4XT3B 3NQTA 3IL8A 3GTKH 1B9MA 4H7BA 4XQJA 2CH4W 2IT1A 4LF8Q 3PUWA 4AYBE 4QCLA 2B2VC 2Z6KA 3FPPA 1VQ4A 3DUZA 4XQNA 4LAAA 3RLFA 2EY2A 4CDCC 1UAPA 4XTCS 5LMNQ 2NVTH 1Y8OB 2RDGA 3ER0A 1VQ9A 4A3GH 1TWFB 3I2ZA 1PZJD 2SDFA 3FKIB 3CCLA 3S17B 5C44G 1H9RA 2MGSA 1AEXA 1I6HH 4A3JG 5TSSA 1IBKQ 4CGYB 5I4DA 5FLXc 4IFDH 3N52A 3PIO3 4X66L 3M85A 1U4MA 5ELNA 5JPNC 4JI6L 1TWCH 2EYHA 4LK1C 2CQOA 1L0WA 2QA4A 2CWPA 5IWAQ 4HCEA 4RAUC 4XDXA 1I4QA 1PRTC 1LM0A 3PCOB 3FEWX 3SK4A 4LFCQ 3HOVB 4HTHA 4NKLA 2V1CC 4KJOA 1EYCA 2XSCA 2VW9A 1TWAB 3FMCA 1SYGA 1GM5A 2EY5A 1WTXA 3S24A 3FPUB 2K01A 1SE3A 1CSQA 4DFAA 1PH2A 3A7AB 4A3FB 2A1AA 5BR8Q 3PIPA 1GHJA 4RCOA 4TRDA 3MFYA 5C0XI 3URYA 4I65A 2DJGC 1GVPA 4DPGA 3I3CA 1PXUA 1NMGA 4A3BH 3WOEA 1JT8A 3HEJA 1BR9A 1LYLA 2RDFA 3NWSA 1EIYB 4OONA 2HHHL 1IBLQ 5IT9E 2LFNA 1Y1VH 2KQ3A 2KVMA 4IZ8A 2B8FA 4L5QA 2F0GA 3EJIA 1K73C 1TWGB 5FLMH 3S1MB 1IHZA 2E74C 4A3DG 1HPCA 4FF4A 1CZGA 3CPFA 4MNOA 4B3RQ 3H94A 1V9PA 4ALPA 1Y1WH 2IHFA 1MJCA 1GUTA 4NXNQ 4Y7NH 3KJPA 4BBRH 1I4XA 4JI4Q 3GTKB 2IJ0A 1HQMC 4DV3L 1SE4A 4N9TA 5IGDA 2F0QA 3TRZA 2YU9H 1N34L 1QJOA 2B2YA 4B3MQ 3ND9A 3J81i 1VQPA 1SBBB 4A3GB 1VQLA 1Y69U 4RKBA 2NVQH 5EAYA 1EQQA 3EA6A 4DR2L 3A54A 1Z9FA 2QKIC 1HZCA 3STBD 1I6HB 4HIMA 1BUVT 3E3XA 2I5HA 1K3RA 4LF7Q 1EEID 3HKZB 1SE8A 4QGUA 4LF5L 3C2PA 2OXPA 1L1OC 2UUCQ 3PIP3 1ZYRD 1TWCB 4JPBW 5M3FH 1SMYD 2KHSA 3JAML 2E2IH 1YBYA 3T51B 3CQZH 1UE6A 2MUYA 3J7AF 3S2HH 3CKIB 4LW1A 5CMDA 1J8IA 2D0PA 2RSOA 1PH5A 1HUNA 4N8X1 2K32A 1S40A 4ZLTF 1ET6A 4TKOB 4PMCA 1D8LA 2XWBB 4NB3A 1YNNC 3DXJC 1V1QA 4BY7B 1FVIA 3BZKA 3TQYA 4HSVA 4EQNA 1WTRA 2IX0A 5COYA 4GN3B 3A74A 2JQOA 3BG3A 2F0DA 3Q24A 4HIDA 1W6KA 4A3BB 1KIXA 3CRLC 3P75A 2K5QA 1RHPA 2NZ1D 2CWAA 4P73A 1NJIC 4PNYA 2VQFQ 2EJFC 4YHHL 1Q1EA 1Y1VB 2JA6H 1IXRA 1YEZA 4QF4A 1TS5A 3D6WA 2VNUD 4R4IA 4JI5L 1VQIA 4KKSA 5BN5A 4FO2A 5ELOA 1ZEQX 2F0JA 4DNIA 2AQ2B 4L5RC 1E1OA 1GKHA 3RZDH 1Y1WB 4V0BA 4X3UA 4K0KQ 1XPUA 1S5CD 3I4MH 4DU9A 4Y7NB 1KQSA 4BBRB 3K7UC 2IPKD 5EPKA 1A63A 2A74C 1X3GA 5C4XG 2HQEA 1SYEA 1X3QA 2JA7H 5KEEA 1HRJA 2K5NA 3STBC 2UU9Q 2YU9B 4C3IH 1YITA 4JI1Q 2HDLA 3G4SA 4LFBQ 3CMAA 1YHQA 2DGYA 1B70B 1XMOL 2MHVA 1SYBA 1LTID 3F2CA 2NVYH 1A8VA 2K52A 2NVQB 1AE3A 2E2HH 3Q0AA 3U58A 4DF7A 3NENA 1BCPB 3EN2A 5KNBA 5BN3A 4IALA 3ERQA 2UUBQ 1FGUA 4FF3A 3KLSA 4C3JH 1VCIA 2F0SA 1UE5A 2N55A 3F2DA 3GDEA 4EQPA 1KD1C 2EYJA 2ZTEA 3K8AA 1FL0A 3GV6A 3Q22A 5M3FB 1C0AA 2ATWA 2E2IB 1UWVA 1P16A 2IHEA 2K4KA 3HOWB 2WB1B 3OWFA 5J22A 4OIJA 3CQZB 1LTLA 3MXGA 3S2HB 2SNSA 2EYLA 2MJ8A 1SR3A 3AU7A 4ZRZA 3NWTA 4GKKL 5ISRA 1FD7D 5M3MH 2VZAA 5KNCA 2NYZD 2KOLA 5C3EH 2ALYB 4A93H 4GZYC 3D6CA 4NXMQ 1H9JA 5EBDA 1N9WA 1EYAA 1K0RA 2F0IA 4POGA 2ZXOA 1HTLD 1N32Q 1NAPA 4AIMA 4IOAA 3OTOL 1KDCA 4KN7C 3IKJA 1CUKA 2A5HA 3H0GH 4A75A 4A76A 2JA6B 3GTMH 2H4OA 2F0HA 2BCOA 2SOBA 4JI8L 4JK1C 1SXTA 1RCVD 2Z9HA 4KY7A 1TQOA 3R2IA 1NY4A 2PYKA 4YWKA 4DKAC 1JJGA 1HNWQ 4KV6A 1A2UA 1IYVA 1CTMA 4WRDA 3RZDB 1GO3E 2MO1A 2VUMB 5IY0A 3I4MB 1XMQL 1I3QH 2RVLA 3NBIA 2B63H 2EE1A 3HGBA 2EDGA 3DEOA 2Q8TA 4JYAQ 1XNRL 1E3PA 1FNVA 1GUSA 4Q0FA 3D0FA 3PUYA 4PZ8A 3SHLA 2F0NA 1WI5A 2ZT9C 1SYDA 4YCVA 5K36H 1K3BC 4C3IB 1VQ5A 5FO8B 5IYCH 4DN4M 1S5DD 1Q8IA 1P8LA 3RMHA 2G9HD 2NVYB 4DV2L 2F0TA 4QIWB 4GS3A 4DV1Q 1XXGA 5ELCA 3PO2H 4JI2L 3IFDA 5CBEE 4JBMA 4C3JB 4JI3Q 3V2TA 3DWPA 3OIPA 2E8GA 3H3VH 5ELBA 1BQQT 5I2XA 1PZKD 4K6DA 1G6PA 1YHAA 4PMBA 2Q2UA 1JJCB 2LXKA 4P72A 2D9UA 3VYUA 3MHBA 3J81E 3I73A 1E0BA 4A3IG 5E4WC 2X69A 4X64Q 1KABA 4GLAC 4FF2A 4RWSC 1A6XA 1WCMH 3GTGB 1Y8NB 1MIUA 1R4PB 4IUQA 4PV1C 5M5WB 5E1FA 1YI2A 3UDFA 2MPMA 5M3MB 3JAMi 3S1RH 1RF2D 3RLOA 3UE1A 3CMEA 5C3EB 2L4NA 4NP5A 4KJNA 4A93B 3G48A 4R4OA 4QUFA 1TS4A 2PMZE 1WTPA 5FLXE 2G5DA 1SMXA 2SNMA 1LT6D 1D5MC 3KDFA 4KKTA 1C48A 3VYTA 1SROA 1MGSA 1S4ZA 1F9SA 4NPSA 2WINB 3HFZB 4MIUA 3H0GB 1AFPA 4Q5VA 3GTMB 4C1NK 1PTOC 4RFBA 4DUZL 1LV9A 4XQQA 3ULJA 1STBA 3ERSX 2I5MX 4KK7A 3TP7A 1F2LA 1B2TA 2NUCA 4R8IA 4A3JH 3NEMA 4O0AA 1I3QB 4DR3L 4X6AH 3G71A 3N6RA 5CBAE 2N3SA 1ENAA 2R7ZG 1EYGA 4HEDA 4XYOA 3MXNA 1C9OA 4OEMB 5JJLA 3RN2A 2GN5A 4JV5Q 3QWNA 1KRTA 4DR1Q 3BS1A 1ASZA 1M1KC 5DNFA 1PTOF 4DR7Q 2ZTCA 2I0QA 2PZUA 2F3IA 5IYBG 1CA6A 2NB0A 3NSWA 3AFPA 1F2YA 3PO2B 3PO3G 4RG1A 3S16H 1XTCD 4N9PA 4P75A 1X56A 4ME5A 2XTIA 4FNFA 4EVOA 2OT2A 2PNHA 1K9MC 1B8AA 3KK7A 1ONLA 2ICIA 4R1JA 1PH7A 1VQNA 2EJGC 3KFUA 2B2WA 5IGFA 1N8RC 4I7ZC 2TMPA 2HT1A 4HN7A 4IUUA 4O42A 1WCMB 3BU2A 1D5ZC 3UDIA 5DM73 5C5MA 3TEHB 2DNCA 1JOQA 1HA6A 4OWXB 2IWHA 4AQYQ 3T1HL 3S1RB 3LX0A 4X3SA 1K8AC 1FGBD 2A69D 3SK8A 5KIXA 3CPWA 3CCMA 4HJ5A 4HMIA 4JI0Q 2BA1A 3IRBA 1KAAA 2P5ZX 1LT4D 2JA8G 4A3MG 2NN6G 1SAPA 4FXDA 1XJVA 3A7LA 1H9SA 2N78A 4X62L 1GUGA 5FLXL 2A6ED 2WIIB 1HH2P 3BZCA 3OSOA 1CT1D 1VF7A 2KCCA 1CHQD 4GLXA 4WFN3 3QOJA 3HP3A 3TMEA 2XRSD 1K28A 4K2LA 4FXKC 4CKBA 3KDFB 1PFMA 1Q7YC 1XNQQ 2R93H 1TS2A 4ZYSA 1Z6HA 5E7NA 4A3JB 2F0FA 3AFQA 4PG3A 3SR1A 3MXPA 3FHWA 4IPCA 3CRKC 3RUZA 5KRUA 4LF4L 3K59A 4P71A 2K05A 1GUWA 3HS0C 5JJZA 2L11A 3DLLA 5GROA 2NZHA 2HHHQ 2K28A 1G8ZD 1PLFA 2L15A 1Q82C 2K5HA 2QCPX 1SE2A 2KECA 4JOIA 2JA5G 1FNWA 3T53B 3U4VA 1CKMA 5C3WA 4E6IA 3MXNB 1ET9A 1LO5D 2MFIA 3J7YW 1ICWA 3S16B 1I4RA 1MHWC 3CHBD 4XXEA 2XRQD 1Z7TA 1ML0D 4LFAQ 3PGZA 5IYDG 4RGMA 2RDHA 1NE3A 5LHY1 4C1NI 4GNXA 3AMUA 4UY8C 1VDZA 1GHKA 3H15A 2ZJQA 1HA5A 2UXDL 3WDNA 5CV6A 3P1HA 2R61A 3EVQA 2EIFA 3G6JB 3FVQA 1BF4A 4LF5Q 2ENBA 2MP1A 3KYHC 1D6EC 3EROA 1L0XB 1X9NA 5J39A 1E7ZA 3MTSA 1OXTA 2H5XA 2K7VA 3U4ZA 3F1ZA 4DGZA 4DUYQ 1BO0A 3SEBA 1BBXC 4KMUC 3C1EA 1HNZL 3T1YL 3JAME 1PHJA 1PH9A 4TSSA 2VQEL 1I94L 2NTTA 2D0OA 1CM9A 4OX9L 2ZXPA 1HR0L 4R9WA 4AH6A 1TY0A 2A6HC 1A3VA 2RF4A 5IP9G 4YY3Q 3CC7A 2BH2A 2BE5C 1K8GA 1FJGL 1H9SB 2R93B 3E0EA 1MI2A 1QUQA 3SK5A 4DV4L 4IN3A 1GJXA 1QNUA 5JEAG 1BNZA 3KOJA 3S15H 1BKBA 3HRZC 4LMQD 5C0XG 4B3SQ 2EPBA 4B9XA 4MTKA 3K5MA 3BVGA 4EQ5A 3MXUA 1G2SA 4OIKA 1VQHA 3GTQH 1MBYA 1EY0A 2F3WA 4I7AA 3M4PA 3LNNA 1PRTF 2PMZB 3S14H 1XPOA 2JJQA 5C3XA 5GAEC 3UDGA 1ENCA 3ICEA 1EFWA 4JI7Q 2IW3A 1G291 2R92H 3A5UA 1RODA 1PYSB 4DAMA 1WD0A 3GTPH 3M9BA 2HCCA 4A4IA 2PZWA 3TREA 5EPLA 2Z1CA 4CKEA 2E5LL 2WKDA 2D62A 4GKJQ 3D4WA 1PH8A 2AQ3B 4H44C 2AHOB 3WWVA 4OGQC 1QNKA 2B2TA 1WVLA 5CYUA 4LJZC 4K5WA 4ZKCB 2XN9C 2VB3X 4F87A 2X6LA 4XIGS 1YHBA 4R4CA 4GNXB 2L12A 2UXCL 1OXXK 4J1MA 2O4XA 2PNRC 1QWYA 1HNXQ 2ID0A 2NVTB 4N8FA 4UP8A 1HFGA 4HJ9A 5DAUA 4JVZA 4HCSA 4PQXA 1YVCA 1G6ZA 4DNTB 1JQYD 4BXXG 1WTHA 1IBMQ 2CW0D 1IKLA 2R7FA 4DV5Q 1QCBD 1E2WA 3GV3A 5GAGC 2CCZA 4ZQ3A 1EOTA 3UDXA 3LGJA 1PFNA 4IUTA 1AN8A 4LF8L 1N36L 1DM0B 1F77A 2C35B 4KD3A 1W2BA 1NR2A 4IFDJ 1EU3A 1UE7A 3S15B 2ZM6Q 1MJEA 1CKNA 5LMNL 2AQ1B 1YNJD 4RGTA 3CCVA 4LF6Q 3PMFA 4LUZA 3HOXG 1STAA 4EX5A 2WAQB 4A3FG 1WYDA 2B8GA 2K5WA 2B2UC 3KLWA 3J7A5 3CC2A 1QUQB 4BBSG 1EQTA 4ZAIA 4A3IH 3HOZG 1IBKL 1HR0W 1WOCA 4HR7B 5CV4A 3S1NH 1ILQA 1MKHA 2B29A 1WTQA 1HFNA 4G57A 3GTJH 3NTHA 1EUJA 3S14B 5IWAL 3PUVA 1O7ZA 1XMQQ 3R2TA 1B7YB 1ICFB 1O78A 4DK3C 2EOTA 2L0CA 2WP8J 4LFCL 1J5EL 3M4YA 2R92B 3F2BA 3GTPB 1VQFA 1XPRA 1SSOA 3HKSA 3I55A 4A3EH 4APVA 3MEHA 1U0LA 2QDLA 4K14A 2ASBA 2A68D 4QUCA 4GOPA 1LTGD 4DR6L 1JCKB 3ULLA 5BR8L 3U50C 1VQ6A 3HG9A 2Z6KC 4MTNA 1FYCA 2WFWA 4X3TA 3E9HA 4Z9CB 4KD4A 4LF9L 1EIHA 4ZK9B 3F2UA 1L0YB 1DONA 3H91A 1ZYRC 3MA2B 4X65L 1VQKA 2F4IA 4A3GG 1EU4A 3PUZA 1RTOA 1SMYC 3QO2A 1BCPD 5IGBA 5CV5A 2R7ZH 1B4OA 3J80c 1XTDA 4TVAB 1VQAA 1BVSA 1YJ9A 4B3RL 1S5FD 1KRSA 1W6JA 1Y8PB 4IFDI 2M2LA 1M8AA 4JI4L 2KHJA 3MFGA 4BY1H 1JE5A 2EXDA 2KHIA 3K7AH 2OTJA 4KI0A 3Q8DA 3CXCA 3OW2A 1JMCA 3D4RA 1GD7A 2OQ0A 4JCVE 1KTKA 4U68A 4J15A 1EL0A 1K0SA 5FJ8H 2M9VA 1Q8KA 4B3ML 1YZ6A 5FO9B 2EJMA 4AYBB 4CKCA 2IX3A 5A2QL 4BY7G 3RN5A 3HOYG 4A3CG 4A3IB 1JOOA 4KKUA 4QL5A 4DUZQ 3S1NB 1UE1A 4LF7L 2K33A 4RGNA 1CKNB 5EPJA 1B3QA 1QVCA 2UUCL 3GTJB 2LS01 3RNUA 3M7GA 4RA8A 3J7AV 3X3NA 4DXFA 4FYDA 1EY7A 3I56A 2A68C 4CDDC 5A35A 1STNA 3KF6A 2WACA 4L63B 1L2FA 2Y0SG 4H02A 5E3FA 5LMNW 4KY6A 5CV7A 1R9TH 2JEAI 1O7IA 5FLMG 5DEHA 2UXBQ 4ME3A 4IOCA 4JBKA 1EY8A 2RSNA 2UUAQ 1TKWB 3BYTB 3D8GA 2JA8H 3UI2A 1KL9A 2NN6H 2K03A 3VR6A 2ES2A 4A3EB 2OEOA 3CU7A 1ESRA 1OXVA 3K5NA 2QILA 4KHPL 4P74A 1DGSA 4RHRA 2JA7B 3D4DA 2I46A 3ZJYC 5IT9c 4DK1A 4DV0Q 1EZ6A 4IUPA 1JICA 1SNMA 2B2YC 1II3A 4GOPB 1D7QA 2VQFL 1CQFA 4G7HC 2Q8IB 1EWCA 2J7ZA 1EOVA 4LUVA 4UP9A 2OCEA 3HOUG 1RTNA 2OF1A 2E2HB 2R7ZB 4QMGA 1LTSD 1NTGA 2WV6D 1O80A 2E2JH 3SGIA 4DR4Q 1YIJA 1U4RA 3C3LA 4RH6A 2EYOA 5J1ZA 4K0KL 3QIAA 1WTWA 2JA5H 2PQAB 1B44D 3T1HQ 4PZ7A 4BY1B 1D2BA 3HOWG 1EEFD 2WB1G 2QDBA 3K7AB 1RIPA 2UU9L 1JB7A 3CW2C 3U9SA 4JI1L 4LFBL 1K8OA 1VMPA 1CHPD 2EYPA 3R8BA 3OYYA 1NUCA 3OMCA 3A56A 4PZ6A 1A62A 1MSHA 5IYDH 1E2ZA 1EY4A 4EQOA 3TS2A 2F4VQ 2FFKB 5AJ3Q 2VL6A 3M4OH 4R4QA 2Z4IA 4UAIA 5K5PA 1EWHA 3EBEA 5GADC 2BOSA 3QOLA 2B2VA 3PV0A 3A5ZB 1SJED 2XWJB 1UUPA 4K5VA 3OPOA 3R3OA 2Q2HA 4A3KG 3BDOA 1IW7D 4IUNA 4DNRB 3C1FA 2JA8B 1X3PA 5C44H 1FNUA 5ELDA 4K2KA 3CF5A 2VUMG 5H1SE 2AKWB 3I4MG 3DM3A 1T5EA 2B63B 3KF6B 3K57A 5LMUQ 4OXPA 3W5OA 5EBCA 1I4HA 4C3IG 5IP9H 1X65A 1LT5D 2TSSA 1F9RA 2HUGA 3W1GA 2YTYA 5M9OA 1RJTA 1SYFA 5JEAH 4Y52H 4A3LG 3T4AC 2NTSA 4P2CB 1UNSA 2OWOA 4B3TQ 1S3OA 5C0XH 3NTIA 2E2JB 2K5DA 1EFID 2XVSA 2R6GA 4C3JG 2KCMA 3E6ZX 2UXDQ 1HNWL 1ZKOA 2XNAC 3KLSX 1AZPA 2JA5B 3G7LA 2RHSB 3S2DH 2NZOA 1EYDA 4JYAL 1EZ8A 3AEVA 1VQOA 5J3BA 4UHVA 3RZOH 4OO1G 4HJAA 2JK8A 3CP0A 3A8JE 2XIWA 4CJ2C 2CH4A 3B6YA 1AP0A 4S3SA 1DOKA 3ULPA 1G2TA 4OO1I 5M3MG 3NUCA 2EZVA 3DWQA 1JE4A 2JXMB 1TWHH 2KBNA 4A3DH 1HNZQ 3T1YQ 3E0JA 2CHBD 5C3EG 4X66Q 2VQEQ 4JI6Q 2X6GA 4A93G 4F8MA 1I94Q 1ZXTA 3M4OB 2O5JC 4DAVA 1M4VA 2EY6A 4JI3L 1PH1A 1FJGQ 2RA4A 3FDTA 5DM63 1F2MA 5NUCA 4DR5L 2VB2X 3H0GG 3KBXA 3GO5A 1A15A 4X64L 1HUMA 2H1EA 4YCUA 5T1IA 1JC7A 5JVH3 1DCZA 2F0OA 2D5DA 5C44B 1EY5A 2A73B 2CQAA 3TP5A 1EQVA 1NCVA 3NPPA 5I6WA 4L8JA 3U9OA 4BXXH 4DV7L 4BS9A 2E76C 2Y0SE 1A3UA 2Q2IA 1I5FA 3GD7A 5IODA 2R3ZA 1L1OA 5HGTA 2RQXA 2D2CC 1VQJA 2CKZB 5ELEA 2Q2TA 1XX8A 1A3TA 1V1PA 1Q86C 4M1UB 3Q23A 2KUMA 3H3VC 3TP6A 3I4NG 1PDQA 3CCEA 1YJNA 3PF4A 5C4HA 4H0LC 4WORA 4IQZA 5EKLA 1UEBA 1STHA 2L55A 1PH6A 1B9NA 3K5LA 3HOXH 3RLNA 3CCRA 1PRTD 4QQBX 2FINB 3DM1A 4RHSA 1PRTB 1CKOA 2BDOA 4HMJA 4BBSH 4DV3Q 1DXMA 1F9PA 2J4XA 3HOZH 4F88A 5D14A 4CDFC 3S2DB 3H3VI 4IO9A 1N34Q 2UXCQ 2A69C 3SXHA 1N33L 3I90A 2VS1A 1X54A 3BJUA 4JC0A 3RZOB 2JA9A 5C0XJ 4DR1L 2O5IC 3H09A 4K6LA 1VQ8A 1OO9B 5CR3A 1X6OA 3T16A 4DR2Q 4DR7L 2RCNA 2HDMA 1TWGH 1NNXA 4IURA 4A3DB 1HHVA 2WB1E 2A6EC 1CFMA 4GLVB 3K58A 5I2YA 3EFXD 3KUPA 5D3IB 1I50H 4X3KA 2F0KA 4POFA 3J81c 2JE6I 3IFTA 1TIID 3BVMA 5GQOA 5C4XH 2AMCB 2EYMA 4RKLA 1N36Q 2NVXH 4PMWA 5IGEA 4UPAA 5JJKA 1F9QA 1HZAA 1S5BD 1C8CA 4G7OC 5FKAC 2GVAA 1G91A 2PCFB 4LUOA 2L5TA 1MSGA 4RGOS 3X3MA 4MZ9A 4DA2A 1U4PA 3T56B 1VQ7A 3MVVA 3P20A 2F0VA 4AQYL 2N49A 4WJ4A 4RMFA 3SE0A 1YJWA 4M8AA 2MNAA 3I4LA 1CA5A 4JI0L 5CGKA 1AZQA 2LY7A 1H9MA 1X55A 1DD2A 4YHHQ 2V4DA 5G3LF 4DK0A 1BDOA 3NHHA 5JJIA 3J7ZC 1E24A 4DV6L 4C3HG 1J5EQ 3M7NA 5CORA 4ZCKA 1Q3LA 4DAPA 3J81j 4JI5Q 2K6AA 4ZKBB 1L1OB 1DZ1A 3BZDB 1DOMA 3L0OA 1EIGA 3VYRA 2GA4B 3HOXB 1V1PB 1QG7A 3QJYA 3VYSA 4HIKA 4V190 4DR6Q 4YCWA 1JWMD 3W2DA 1XNQL 4BY7H 1DYQA 1WTVA 3HOYH 1BXTA 4A3CH 4BBSB 3HOZB 1JB3A 2JYOA 5JPMC 4QIWE 2B2WC 5C4JH 1BBUA 1KNEA 4LF9Q 1PV4A 3RR5A 4CDEC 1RDPD 3QG1A 1XMOQ 3CCQA 1G51A 1YNND 4H13C 4X65Q 4NDXA 5IGGA 2R7DA 1IYJB 2HIVA 1QE6A 3K6OA 5IE8A 3MWYW 2C5CA 5JAVA 1S72A 3VA5A 3K0XA 5EKKA 1GXDC 1NBWA 2O2LD 1SNDA 3D31A 4DAYA 2N88A 1KLGD 1RL2A 4LWCA 4HJ8A 2KCTA 3NQIA 3Q6SA 1I50B 2AUJD 3FKIG 3L3OC 1JOKA 5C4XB 4JBJA 2J0TD 3W1BA 3FRPB 4QY7A 4LFAL 2NVXB 4G4KA 3ITPA 3J80L 1AW7A 1V43A 2PPBC 2EY1A 1TR5A 2Q8RE 4ID6A 5IIFA 1U4LA 2XGTA 2G9DA 5LL6X 5CV8A 4GKKQ 3VA7A 4ZUIA 1WJJA 1OXSC 5M5XH 2MQHA 1J9OA 2ZJPA 3CCUA 1V1OA 3HOUH 1DJRD 4FVMA 3SK6A 2R93G 3P7JA 3R93A 3HOVG 2KEEA 5IP7G 4FP5D 2PZTA 1PZID 2OTLA 1PVOA 3KF8A 1QZHA 5A2QE 3GQBA 1B3AA 1RD9D 3F8TA 5FO7B 1KDAA 3OTOQ 4J6HA 2AWNA 2PW7A 1HCZA 2Z0SA 2EQSA 4J8QA 3I4OA 1VQCA 3GTQB 1VMCA 3I70A 3HOWH 4DUYL 3VR2A 2HCIA 2LKVA 4GN5A 4JOIC 2KEDA 4JI8Q 5BN4A 2LSSA 3V05A 4CBVA 1SN8A 1KHIA 2EYFA 2BDNA 2OQKA 4YY3L 4KN4C 1GUNA 1PYBA 4KHPQ 1XNRQ 2YTXA 3HOYB 1VF5C 5CC4A 1E22A 2CFMA 2N8NA 3AQQA 5C4JB 3K81C 2KA7A 4GNXC 1WD1A 1BOSA 4TQUS 5FOBB 3CD6A 4WJ3M 3NK9A 1VQBA 2A8VA 1GUOA 4B3SL 1A2TA 4DV2Q 3TP8A 1CSPA 2L1BA 2RBMA 2Y0SB 3NP8A 3S1QH 3ND8A 1HJPA 4JI2Q 5IT9L 1M90C 2YV5A 4A3KH 1O7LA 1IL2A 3GTOH 5C5LA 1LT3D 1S5ED 4L6TB 2GVBA 1SJHD 1Q12A 2CW0C 2VUMH 5L37A 2DUDA 1IBLL 4JI7L 2PQAA 3BYYB 5KNDA 3K80C 1PFBA 1PTOH 2DNEA 2ICEC 4HAEA 4RCNA 1VQEA 4DAYB 1NSNS 3HKZG 1LABA 2BH8A 2ZJRA 4IFDG 3NE5B 4KHZA 4GKJL 5EKIA 3WOFA 4NXNL 1YNJC 4DXGA 3T13A 1VS0A 2Z8LA 5M5XB 1SNQA 5IYBH 3KJOA 3HOUB 4A3LH 3PSIA 1Q46A 4B08A 3NTKA 1LTRD 3PO3H 1UEAB 1YNXA 2L9HA 3GP7A 2FMMA 1SNPA 1TXYA 1SNCA 5HY6A 1D1KA 3NELA 3ONAB 3TZUA 1HNXL 1CZWA 2BA0A 2KJXA 1PFSA 1J6QA 4MHEA 2WAQG 5AFWA 3JAMc 4BWGB 4UP7A 3DWAA 1I4PA 2E2DC 4K8IA 1LACA 1B50A 2PQEA 3VR3A 2F0MA 1D1IA 4OO1H 4A3BG 5JVG3 1XYIA 3KF8B 4OL7A 3TN2A 4BA1I 1QVFA 3GTGH 2K50A 5M5WH 1IBML 2QEJC 1SFOH 1KAWA 5ELFA 4IPDA 4DV5L 1FR3A 4YWMA 4DR3Q 4L5SA 1Y1VG 1E2VA 3MZ5A 4BA2I 1C4QA 2R92G 3VR5A 1EWIA 2K75A 1C7YA 3K0YA 3CAMA 1VQGA 4A3MH 3CCSA 1SYCA 3OWEB 2ZM6L 3H6MA 4L5TA 1Y1WG 3M4QA 4LF6L 3BDCA 4GN4B 4BBRG 4ABNA 1BBWA 1EY6A 2B2TC 1Y14B 2F0LA 1WTOA 1E1TA 1V8QA 3C46A 1Q81C 1BCPC 2C9OA 3HZXA 2Z6BA 3S1QB 3NBHA 3I8ZA 5IGCA 4A3KB 1IZ6A 1K8MA 3TS0A 1PH3A 3GTOB 2NWGA 2KENA 2AWOA 2K04A 5EJWA 1PTOD 3I7FA 1PTOB 1RKNA 2DY8A 2ZTDA 4FF1A 1LUZA 1PYWD 4KLKA 4QB4A 4EGVA 2FHTA 1R4QB 1HTPA 1LTBD 1BCPF 5M3FG 2M00A 3OMGA 1K83H 3I4NH 3DMUA 4QJFA 2F1MA 4OELB 3VR4A 2YYZA 3OIQA 1U5KA 3VDYA 3J80i 2VY3A 3PO3B 3OHXC 5EGTA 1QZGA 2EXZA 2WKCA 1B1ZA 4DR5Q 2PO4A 2AUKA 2I07B 4X62Q 1JR0D 4AYBG 1TS3A 3IAYA 4IPHA 1KXLA 1VQDA 2IX1A 2RKSA 2DJFC 2UUBL 2F0WA 2QF7A 3TZDA 3GTLH 4FDBA 2PW5A 3DHQA 5LL6S 1U9RA 2NBFA 4DK6C 1SFOB 1SRUA 2I5LX 2JEBI 1HQRD 4ILWA 3OOCA 4IJLA 2F0UA 3LWUA 4K5XA 4DV7Q 2JA6G 4YIJA 2KCNA 2DN8A 1LTTD 1LLRD 1R9TB 1CK1A 3W3AA 3FP9A 5F2DA 4LF4Q 3SVMA 1X32A 2PI2E 3ZYYX 1PA6A 1EIFA 4A3MB 5C6AA 4A3EG 3PF5A 3SDZA 4GOPC 2FJ2A 1AH9A 1OXUA 2VXWA 3QR8A 2MO0A 3LWEA 2E75C 1Z47A
chains in the Genus database with same CATH topology
3PUXA 4UDUC 1PMRA 1I6VC 3MC0B 2SEBD 3L7ZC 5T1GA 2F3VA 3A8IE 4ODGA 1IL8A 1SNOA 1JORA 4MN3A 3L9AX 1Q90A 3TDQA 1HXYD 4KY5A 5I6YA 4O1NA 3QB3A 3RD4A 4B9WA 1B53A 1K83B 3I4NB 2Z4HA 4OHJA 3BVZA 2ZXRA 1SDFA 4XT1B 1LTAD 5FK9C 4ULLA 2JSOA 1QOHA 4R8NA 1Q1BA 2K1BA 3A8KE 1GOZA 1TVXA 5EQ0A 4NMZA 5D3DA 1KNAA 1TU2B 1XWEA 4CJ0B 3BDLA 3GTLB 1CI3M 3A55A 5IOCA 3J81L 2FMCA 1IW7C 4CHTB 1ESFA 1ENFA 4NW2A 1T5XD 5I9OA 4IUVA 3K5OA 2EVBA 1F2ZA 1JWSD 4JBWA 2B39A 5I9PA 4F7XA 2IL8A 5CV9A 1MD2D 1TY2A 3I91A 5KYLA 1QILA 2NN6I 3MAQA 1KLUD 1QB5D 3TSSA 1CQVA 1SEBD 3D3RA 2LMCB 3KBGA 5K36G 3AB9A 1NR4A 4K8JA 5KGUA 3TBIB 5JOBA 3S9WA 3E5SA 5D65A 3V96A 1KDBA 5G3LD 4CJ1B 1ILPA 2CVRA 3DEPA 1STYA 4ZUJA 3KLRA 4U673 3I72A 2A6HD 2BE5D 3OW7A 3NXWA 1JWUD 1IYUA 2B2UA 1IKMA 5E4XA 4G7ZC 1STGA 4C3HB 5C4ZA 1EY9A 5JEAJ 4FXGC 4XYQA 5KYIA 1D5XC 1H9KA 1DOLA 2F03A 4HSPA 1I4GA 4C2MB 4KHVA 3EQLC 4WJWA 1Z47A 2DY7A 2JP1A 4KTAA 2F0PA 1TT2A 1STEA 1TWHB 3M3YB 4C56C 5M5YB 1O7YA 5HURA 2F0EA 3J80E 3O13A 4XT3B 3NQTA 3IL8A 1B9MA 4H7BA 4XQJA 2IT1A 3PUWA 4QCLA 2B2VC 3FPPA 3DUZA 4XQNA 4LAAA 3RLFA 2EY2A 1UAPA 4XTCS 1Y8OB 2RDGA 1TWFB 1PZJD 2SDFA 3FKIB 3S17B 1H9RA 2MGSA 1AEXA 5TSSA 4CGYB 5I4DA 4IFDH 3N52A 3PIO3 3M85A 1U4MA 5JPNC 2EYHA 4LK1C 4HCEA 4RAUC 4XDXA 1I4QA 1PRTC 3FEWX 3SK4A 3HOVB 4HTHA 4NKLA 4KJOA 1EYCA 2XSCA 1TWAB 3FMCA 1SYGA 2EY5A 1WTXA 3FPUB 2K01A 1SE3A 4DFAA 3A7AB 4A3FB 1GHJA 4RCOA 4TRDA 3MFYA 5C0XI 3URYA 4I65A 3I3CA 1PXUA 3WOEA 3HEJA 1BR9A 2RDFA 3NWSA 5IT9E 2LFNA 2KQ3A 2KVMA 4IZ8A 2B8FA 2F0GA 3EJIA 1TWGB 3S1MB 1IHZA 2E74C 1HPCA 4FF4A 1CZGA 3H94A 1GUTA 1I4XA 3GTKB 2IJ0A 1HQMC 1SE4A 4N9TA 5IGDA 2F0QA 1QJOA 2B2YA 3ND9A 1SBBB 4A3GB 1Y69U 4RKBA 3EA6A 3A54A 2QKIC 1I6HB 1BUVT 1EEID 3HKZB 3C2PA 2OXPA 3PIP3 1ZYRD 1TWCB 1SMYD 2KHSA 3JAML 3T51B 3J7AF 2MUYA 3CKIB 5CMDA 1J8IA 2RSOA 1HUNA 2K32A 4ZLTF 1ET6A 4TKOB 4PMCA 2XWBB 1YNNC 3DXJC 4BY7B 4EQNA 4HSVA 1WTRA 2IX0A 5COYA 3BG3A 2F0DA 3Q24A 1W6KA 4A3BB 3CRLC 3P75A 2K5QA 1RHPA 2NZ1D 4PNYA 2EJFC 1Q1EA 1Y1VB 4QF4A 1TS5A 3D6WA 2VNUD 4KKSA 5BN5A 4FO2A 1ZEQX 2F0JA 2AQ2B 1Y1WB 4V0BA 4X3UA 1S5CD 4DU9A 4Y7NB 4BBRB 2IPKD 5EPKA 2A74C 2HQEA 1SYEA 1X3QA 5KEEA 1HRJA 2YU9B 2HDLA 2MHVA 1SYBA 1LTID 2NVQB 3Q0AA 4DF7A 1BCPB 5KNBA 5BN3A 4IALA 3ERQA 4FF3A 3KLSA 1VCIA 2F0SA 2N55A 4EQPA 2EYJA 3GV6A 3Q22A 5M3FB 2E2IB 3HOWB 2WB1B 3OWFA 5J22A 4OIJA 3CQZB 3MXGA 3S2HB 2SNSA 2EYLA 2MJ8A 3AU7A 4ZRZA 3NWTA 5ISRA 1FD7D 5KNCA 2NYZD 2KOLA 4GZYC 3D6CA 1H9JA 5EBDA 1EYAA 2F0IA 2ZXOA 1HTLD 1NAPA 1KDCA 4KN7C 3IKJA 2A5HA 2JA6B 2H4OA 2F0HA 2BCOA 2SOBA 4JK1C 1SXTA 1RCVD 4KY7A 1TQOA 3R2IA 2PYKA 4KV6A 1A2UA 1IYVA 1CTMA 4WRDA 3RZDB 2VUMB 3I4MB 2RVLA 3NBIA 2EE1A 3HGBA 2EDGA 3DEOA 2Q8TA 1FNVA 1GUSA 4Q0FA 3PUYA 3SHLA 2F0NA 2ZT9C 1SYDA 5K36H 4C3IB 5FO8B 4DN4M 1S5DD 1Q8IA 3RMHA 2G9HD 2NVYB 2F0TA 4QIWB 1XXGA 5ELCA 3IFDA 5CBEE 4C3JB 3V2TA 3DWPA 3OIPA 5ELBA 1BQQT 5I2XA 1PZKD 4K6DA 4PMBA 2D9UA 3VYUA 3MHBA 3J81E 3I73A 1E0BA 5E4WC 2X69A 1KABA 4FF2A 4RWSC 1A6XA 3GTGB 1Y8NB 1R4PB 4PV1C 4IUQA 5M5WB 5E1FA 2MPMA 5M3MB 1RF2D 5C3EB 2L4NA 4NP5A 4KJNA 4A93B 4QUFA 1TS4A 1WTPA 5FLXE 2SNMA 1LT6D 1D5MC 4KKTA 1C48A 3VYTA 1MGSA 1S4ZA 1F9SA 2WINB 4MIUA 3H0GB 1AFPA 4Q5VA 3GTMB 4C1NK 1PTOC 4RFBA 1LV9A 4XQQA 1STBA 4KK7A 3TP7A 1F2LA 1B2TA 2NUCA 4R8IA 1I3QB 3N6RA 5CBAE 1ENAA 4HEDA 4XYOA 3MXNA 3QWNA 3BS1A 5DNFA 1PTOF 2PZUA 1CA6A 2NB0A 3NSWA 1F2YA 3PO2B 1XTCD 4N9PA 4ME5A 4FNFA 4EVOA 2OT2A 3KK7A 1ONLA 2ICIA 2EJGC 2B2WA 5IGFA 4I7ZC 2TMPA 4HN7A 4IUUA 4O42A 1WCMB 1D5ZC 5DM73 5C5MA 2DNCA 1JOQA 1HA6A 2IWHA 3S1RB 3LX0A 4X3SA 1FGBD 2A69D 3SK8A 5KIXA 4HMIA 2BA1A 1KAAA 1LT4D 2NN6G 1SAPA 4FXDA 3A7LA 1H9SA 1GUGA 5FLXL 2A6ED 2WIIB 3OSOA 1CT1D 1VF7A 2KCCA 1CHQD 4WFN3 3QOJA 3HP3A 3TMEA 2XRSD 4K2LA 4FXKC 4CKBA 1PFMA 1TS2A 4ZYSA 1Z6HA 4A3JB 2F0FA 3SR1A 3MXPA 3CRKC 3RUZA 5KRUA 3K59A 2K05A 1GUWA 3HS0C 5JJZA 2L11A 2K28A 1G8ZD 1PLFA 2QCPX 1SE2A 2KECA 1FNWA 3T53B 5C3WA 4E6IA 1ET9A 1LO5D 3J7YW 1ICWA 3S16B 1I4RA 3CHBD 4XXEA 2XRQD 1Z7TA 1ML0D 4RGMA 2RDHA 5LHY1 4C1NI 3AMUA 1VDZA 1GHKA 1HA5A 3WDNA 5CV6A 3P1HA 2R61A 3G6JB 3FVQA 1BF4A 2ENBA 2MP1A 1D6EC 3EROA 1L0XB 5J39A 3MTSA 1OXTA 2K7VA 4DGZA 1BO0A 3SEBA 1BBXC 4KMUC 3C1EA 3JAME 4TSSA 2NTTA 1CM9A 2ZXPA 4R9WA 1TY0A 2A6HC 1A3VA 2BE5C 1H9SB 2R93B 1MI2A 3SK5A 4IN3A 1GJXA 1QNUA 5JEAG 1BNZA 3HRZC 4LMQD 5C0XG 2EPBA 4B9XA 3K5MA 3BVGA 3MXUA 1G2SA 4OIKA 1MBYA 1EY0A 2F3WA 3LNNA 1PRTF 2PMZB 5C3XA 1ENCA 2IW3A 1G291 1RODA 1WD0A 2HCCA 2PZWA 5EPLA 2Z1CA 4CKEA 2WKDA 2D62A 3D4WA 2AQ3B 4H44C 4OGQC 1QNKA 2B2TA 1WVLA 5CYUA 4LJZC 4K5WA 4ZKCB 2XN9C 2VB3X 4F87A 2X6LA 4XIGS 2L12A 1OXXK 4J1MA 2O4XA 2PNRC 1QWYA 2ID0A 2NVTB 1HFGA 5DAUA 4HCSA 4PQXA 1G6ZA 4DNTB 1JQYD 2CW0D 1IKLA 1QCBD 1E2WA 3GV3A 4ZQ3A 1EOTA 1PFNA 4IUTA 1AN8A 1DM0B 1F77A 4KD3A 1NR2A 4IFDJ 1EU3A 3S15B 2AQ1B 1YNJD 4RGTA 3PMFA 1STAA 2WAQB 2B8GA 2K5WA 2B2UC 1EQTA 4ZAIA 4HR7B 5CV4A 1ILQA 1WTQA 1HFNA 4G57A 3NTHA 3S14B 3PUVA 1O7ZA 3R2TA 1O78A 2EOTA 2L0CA 2WP8J 3M4YA 2R92B 3GTPB 1SSOA 3MEHA 4K14A 2A68D 4QUCA 1LTGD 1JCKB 3HG9A 1FYCA 4X3TA 4Z9CB 4KD4A 1EIHA 4ZK9B 3F2UA 1L0YB 1DONA 3H91A 1ZYRC 3MA2B 2F4IA 1EU4A 3PUZA 1RTOA 1SMYC 3QO2A 1BCPD 5IGBA 5CV5A 1B4OA 1S5FD 1W6JA 1Y8PB 4IFDI 2M2LA 1M8AA 3MFGA 4KI0A 3D4RA 1KTKA 4U68A 1EL0A 2M9VA 5FO9B 2EJMA 4AYBB 4CKCA 2IX3A 5A2QL 4A3IB 1JOOA 4KKUA 3S1NB 2K33A 4RGNA 5EPJA 3GTJB 2LS01 3M7GA 4RA8A 3J7AV 3X3NA 4DXFA 4FYDA 1EY7A 2A68C 5A35A 1STNA 2WACA 4L63B 5E3FA 4KY6A 5CV7A 2JEAI 5DEHA 1EY8A 2RSNA 1TKWB 3BYTB 3D8GA 3UI2A 2NN6H 2K03A 3VR6A 4A3EB 2OEOA 3CU7A 1ESRA 1OXVA 3K5NA 2QILA 4RHRA 2JA7B 3D4DA 2I46A 4DK1A 1EZ6A 4IUPA 1JICA 1SNMA 2B2YC 1II3A 1CQFA 4G7HC 2Q8IB 1EWCA 2J7ZA 1RTNA 2OF1A 2E2HB 2R7ZB 4QMGA 1LTSD 2WV6D 1O80A 1U4RA 3C3LA 4RH6A 2EYOA 5J1ZA 3QIAA 1WTWA 1B44D 4BY1B 1D2BA 1EEFD 2QDBA 3K7AB 3U9SA 1K8OA 1VMPA 1CHPD 2EYPA 3R8BA 1NUCA 3OMCA 3A56A 1MSHA 1E2ZA 1EY4A 4EQOA 2FFKB 2Z4IA 4UAIA 5K5PA 1EWHA 2BOSA 3QOLA 2B2VA 3PV0A 1SJED 2XWJB 1UUPA 4K5VA 3OPOA 3R3OA 3BDOA 1IW7D 4IUNA 4DNRB 3C1FA 2JA8B 1X3PA 1FNUA 5ELDA 4K2KA 1T5EA 2B63B 3K57A 5EBCA 1I4HA 4C3IG 1LT5D 2TSSA 1F9RA 2HUGA 5M9OA 1RJTA 1SYFA 5JEAH 3T4AC 2NTSA 4P2CB 1UNSA 5C0XH 3NTIA 2E2JB 2K5DA 1EFID 2XVSA 2R6GA 4C3JG 3E6ZX 1ZKOA 2XNAC 3KLSX 1AZPA 2JA5B 3G7LA 1EYDA 1EZ8A 4OO1G 3A8JE 2XIWA 4CJ2C 1AP0A 4S3SA 1DOKA 1G2TA 4OO1I 3NUCA 2EZVA 3DWQA 1JE4A 2JXMB 3E0JA 2CHBD 2O5JC 2X6GA 4F8MA 3M4OB 1ZXTA 4DAVA 1M4VA 2EY6A 2RA4A 3FDTA 5DM63 1F2MA 5NUCA 2VB2X 3KBXA 3GO5A 1A15A 1HUMA 2H1EA 5T1IA 1JC7A 5JVH3 1DCZA 2F0OA 2D5DA 5C44B 1EY5A 2A73B 2CQAA 3TP5A 1EQVA 1NCVA 3NPPA 5I6WA 4L8JA 3U9OA 4BS9A 2E76C 1A3UA 3GD7A 5IODA 2R3ZA 5HGTA 2RQXA 2D2CC 5ELEA 1XX8A 1A3TA 1V1PA 4M1UB 3Q23A 2KUMA 3H3VC 3TP6A 1PDQA 5C4HA 4H0LC 4WORA 4IQZA 5EKLA 1STHA 2L55A 1B9NA 3K5LA 1PRTD 2FINB 3DM1A 4RHSA 1PRTB 2BDOA 4HMJA 1DXMA 1F9PA 2J4XA 4F88A 5D14A 3S2DB 2A69C 3SXHA 3I90A 3RZOB 5C0XJ 2O5IC 3H09A 4K6LA 1OO9B 5CR3A 3T16A 2HDMA 4IURA 4A3DB 1HHVA 2A6EC 1CFMA 3K58A 5I2YA 3EFXD 3KUPA 5D3IB 4X3KA 2F0KA 2JE6I 3IFTA 1TIID 3BVMA 2EYMA 4RKLA 4PMWA 5IGEA 4G7OC 1F9QA 1S5BD 1C8CA 5FKAC 1G91A 2PCFB 2L5TA 1MSGA 4RGOS 3X3MA 4DA2A 1U4PA 3T56B 3MVVA 3P20A 2F0VA 3SE0A 4M8AA 3I4LA 1CA5A 5CGKA 1AZQA 2LY7A 1H9MA 1DD2A 2V4DA 5G3LF 4DK0A 1BDOA 3NHHA 4C3HG 3M7NA 5CORA 1Q3LA 4DAPA 2K6AA 4ZKBB 1DZ1A 3BZDB 1DOMA 1EIGA 3VYRA 2GA4B 3HOXB 1V1PB 1QG7A 3QJYA 3VYSA 4V190 1JWMD 3W2DA 1DYQA 1WTVA 4BBSB 1BXTA 3HOZB 1JB3A 2JYOA 5JPMC 2B2WC 1KNEA 1RDPD 3QG1A 1YNND 4H13C 4NDXA 5IGGA 1QE6A 3K6OA 3MWYW 2C5CA 5JAVA 3VA5A 5EKKA 1GXDC 2O2LD 1SNDA 3D31A 4DAYA 2N88A 1KLGD 3NQIA 3Q6SA 1I50B 2AUJD 3L3OC 1JOKA 5C4XB 2J0TD 3FRPB 2NVXB 4G4KA 3ITPA 3J80L 1AW7A 1V43A 2PPBC 2EY1A 1TR5A 2Q8RE 4ID6A 5IIFA 1U4LA 5LL6X 2G9DA 5CV8A 3VA7A 4ZUIA 1OXSC 1J9OA 1V1OA 1DJRD 4FVMA 3SK6A 3P7JA 3R93A 2KEEA 4FP5D 2PZTA 1PZID 3KF8A 5A2QE 3GQBA 1B3AA 1RD9D 5FO7B 1KDAA 4J6HA 2AWNA 2PW7A 1HCZA 4J8QA 3GTQB 1VMCA 3I70A 3VR2A 2HCIA 2LKVA 2KEDA 5BN4A 3V05A 4CBVA 2EYFA 2BDNA 4KN4C 1GUNA 3HOYB 1VF5C 5CC4A 5C4JB 2KA7A 1WD1A 1BOSA 4TQUS 5FOBB 3NK9A 1GUOA 1A2TA 3TP8A 2L1BA 2RBMA 2Y0SB 3NP8A 3ND8A 5IT9L 1O7LA 5C5LA 1LT3D 1S5ED 4L6TB 1SJHD 1Q12A 2CW0C 3BYYB 5KNDA 1PFBA 1PTOH 2DNEA 2ICEC 4HAEA 4RCNA 1NSNS 1LABA 4IFDG 3NE5B 4KHZA 5EKIA 3WOFA 4DXGA 1YNJC 3T13A 2Z8LA 5M5XB 1SNQA 3HOUB 4B08A 3NTKA 1LTRD 1UEAB 2L9HA 3GP7A 2FMMA 1SNPA 1SNCA 1D1KA 3ONAB 3TZUA 1CZWA 2BA0A 2KJXA 4MHEA 5AFWA 4BWGB 3DWAA 1I4PA 2E2DC 4K8IA 1LACA 1B50A 2PQEA 3VR3A 2F0MA 1D1IA 4OO1H 5JVG3 1XYIA 4OL7A 3TN2A 4BA1I 2QEJC 5ELFA 1FR3A 1E2VA 3MZ5A 4BA2I 1C4QA 3VR5A 3K0YA 1SYCA 3OWEB 3H6MA 3BDCA 4ABNA 1EY6A 2B2TC 2F0LA 1WTOA 1V8QA 3C46A 1BCPC 2C9OA 3HZXA 3S1QB 3NBHA 3I8ZA 5IGCA 4A3KB 1K8MA 3GTOB 2NWGA 2AWOA 2K04A 5EJWA 1PTOD 1PTOB 1RKNA 2DY8A 4FF1A 1PYWD 4QB4A 4EGVA 2FHTA 1R4QB 1HTPA 1LTBD 1BCPF 2M00A 3OMGA 3DMUA 2F1MA 3VR4A 2YYZA 3OIQA 3PO3B 3OHXC 5EGTA 2EXZA 2WKCA 1B1ZA 2PO4A 2AUKA 2I07B 1JR0D 1TS3A 3IAYA 2IX1A 2RKSA 2F0WA 2QF7A 3TZDA 2PW5A 3DHQA 5LL6S 1U9RA 2NBFA 1SFOB 2JEBI 1HQRD 4ILWA 3OOCA 2F0UA 3LWUA 4K5XA 4YIJA 2KCNA 2DN8A 1LTTD 1LLRD 1R9TB 1CK1A 3W3AA 5F2DA 3SVMA 1X32A 3ZYYX 4A3MB 5C6AA 3SDZA 2FJ2A 1OXUA 2VXWA 3LWEA 2E75C 3EVQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CZG A;  1DM0 B;  4M1U B;  1R4P B;  1D1K A;  1R4Q B;  1QNU A;  1CZW A;  2XSC A;  1C4Q A;  2GA4 B;  2C5C A;  1CQF A;  4ULL A;  4P2C B;  1QOH A;  1C48 A;  1D1I A;  2BOS A;  3MXG A;  1BOS A; 
#chains in the Genus database with same CATH topology
 1SLJ A;  4HIO A;  4JW0 A;  3PUX A;  3PQI A;  2JA7 G;  4UDU C;  1PMR A;  1KC8 C;  4NXM L;  1I6V C;  3MC0 B;  2K14 A;  2SEB D;  3L7Z C;  1WFQ A;  1N32 L;  5T1G A;  2F3V A;  3A8I E;  4ODG A;  1IL8 A;  1SNO A;  1JOR A;  4MN3 A;  3L9A X;  1Q90 A;  4IPG A;  3TDQ A;  1HZB A;  1HXY D;  2B3G A;  1N33 Q;  3NBH B;  2F52 A;  1PH4 A;  1T9H A;  4KY5 A;  2UXB L;  1HZ9 A;  5I6Y A;  2UUA L;  4HJ7 A;  4O1N A;  3A0J A;  3QB3 A;  3MEF A;  2QEX A;  3RD4 A;  2HQL A;  4C3H H;  4B9W A;  1B53 A;  1K83 B;  3I4N B;  2Z4H A;  4OHJ A;  4BY1 G;  3BVZ A;  2ZXR A;  1SDF A;  4XT1 B;  1LTA D;  5FK9 C;  3HKZ E;  4ULL A;  2HD3 A;  4C2M H;  2JSO A;  1QOH A;  1NMF A;  4DV0 L;  2FXQ A;  3G6E A;  4YWL A;  5FJ8 G;  4R8N A;  1W3S A;  1Q1B A;  2K1B A;  3A8K E;  1GOZ A;  1TVX A;  3M3Y H;  5EQ0 A;  4NMZ A;  4DV1 L;  5D3D A;  5M5Y H;  1X3F A;  1KNA A;  4OWT B;  4OX9 Q;  1TU2 B;  1EQR A;  1HR0 Q;  1XWE A;  4CJ0 B;  3L2P A;  3BDL A;  3GTL B;  1CI3 M;  3A55 A;  5IOC A;  3J81 L;  2FMC A;  4DR4 L;  2HIX A;  1IW7 C;  4CHT B;  1ESF A;  1ENF A;  2WAQ E;  4DV4 Q;  4NW2 A;  1T5X D;  5I9O A;  4LNQ A;  1VQM A;  4IUV A;  3K5O A;  2EVB A;  1F2Z A;  5GAH C;  1X3E A;  1JWS D;  4JBW A;  2B39 A;  1TWF H;  5I9P A;  1OTC A;  1H95 A;  2LXJ A;  3FKI H;  2IL8 A;  5CV9 A;  4F7X A;  2A19 A;  3S17 H;  1MD2 D;  1TY2 A;  3I91 A;  1JJ2 A;  5KYL A;  4DV6 Q;  2B63 G;  1QIL A;  2NN6 I;  3MAQ A;  1KLU D;  4O2D A;  2F4V L;  1QB5 D;  3TSS A;  5AJ3 L;  1CQV A;  1SEB D;  3D3R A;  2LMC B;  3KBG A;  5K36 G;  3AB9 A;  1NR4 A;  4K8J A;  5IYC G;  2IY5 B;  5KGU A;  3AYH B;  5JOB A;  3TBI B;  5HGQ A;  3S9W A;  3E5S A;  5D65 A;  1AE2 A;  3V96 A;  3HOV H;  1KDB A;  5G3L D;  5IP7 H;  4CJ1 B;  1ILP A;  2CVR A;  1TWA H;  3E9I A;  2RHQ B;  1ASY A;  3DEP A;  1STY A;  2PI2 A;  4ZUJ A;  3PO2 G;  2K5V A;  3KLR A;  4R4T A;  4U67 3;  2E5L Q;  3I72 A;  2A6H D;  2BE5 D;  3OW7 A;  4A3F H;  3NXW A;  3PIO A;  1JWU D;  1IYU A;  2B2U A;  5DLQ E;  1IKM A;  5E4X A;  4G7Z C;  1STG A;  4C3H B;  5C4Z A;  1EY9 A;  5JEA J;  2QW7 A;  4FXG C;  4XYQ A;  5KYI A;  1D5X C;  1H9K A;  1DOL A;  3JC6 6;  2F03 A;  5LMU L;  2JN4 A;  4HSP A;  3CCJ A;  4JV5 L;  1I4G A;  4C2M B;  1WCM G;  4KHV A;  1A0I A;  3EQL C;  4IJH A;  4WJW A;  2YTV A;  2DY7 A;  2JP1 A;  3EIV A;  4KTA A;  2F0P A;  1TT2 A;  4JG2 A;  3S1M H;  1STE A;  4OWW B;  1TWH B;  2QGQ A;  3M3Y B;  3UE0 A;  4C56 C;  5M5Y B;  1O7Y A;  5HUR A;  1QVG A;  4B3T L;  2F0E A;  3CC4 A;  2RCF A;  3J80 E;  3O13 A;  4XT3 B;  3NQT A;  3IL8 A;  3GTK H;  1B9M A;  4H7B A;  4XQJ A;  2CH4 W;  2IT1 A;  4LF8 Q;  3PUW A;  4AYB E;  4QCL A;  2B2V C;  2Z6K A;  3FPP A;  1VQ4 A;  3DUZ A;  4XQN A;  4LAA A;  3RLF A;  2EY2 A;  4CDC C;  1UAP A;  4XTC S;  5LMN Q;  2NVT H;  1Y8O B;  2RDG A;  3ER0 A;  1VQ9 A;  4A3G H;  1TWF B;  3I2Z A;  1PZJ D;  2SDF A;  3FKI B;  3CCL A;  3S17 B;  5C44 G;  1H9R A;  2MGS A;  1AEX A;  1I6H H;  4A3J G;  5TSS A;  1IBK Q;  4CGY B;  5I4D A;  5FLX c;  4IFD H;  3N52 A;  3PIO 3;  4X66 L;  3M85 A;  1U4M A;  5ELN A;  5JPN C;  4JI6 L;  1TWC H;  2EYH A;  4LK1 C;  2CQO A;  1L0W A;  2QA4 A;  2CWP A;  5IWA Q;  4HCE A;  4RAU C;  4XDX A;  1I4Q A;  1PRT C;  1LM0 A;  3PCO B;  3FEW X;  3SK4 A;  4LFC Q;  3HOV B;  4HTH A;  4NKL A;  2V1C C;  4KJO A;  1EYC A;  2XSC A;  2VW9 A;  1TWA B;  3FMC A;  1SYG A;  1GM5 A;  2EY5 A;  1WTX A;  3S24 A;  3FPU B;  2K01 A;  1SE3 A;  1CSQ A;  4DFA A;  1PH2 A;  3A7A B;  4A3F B;  2A1A A;  5BR8 Q;  3PIP A;  1GHJ A;  4RCO A;  4TRD A;  3MFY A;  5C0X I;  3URY A;  4I65 A;  2DJG C;  1GVP A;  4DPG A;  3I3C A;  1PXU A;  1NMG A;  4A3B H;  3WOE A;  1JT8 A;  3HEJ A;  1BR9 A;  1LYL A;  2RDF A;  3NWS A;  1EIY B;  4OON A;  2HHH L;  1IBL Q;  5IT9 E;  2LFN A;  1Y1V H;  2KQ3 A;  2KVM A;  4IZ8 A;  2B8F A;  4L5Q A;  2F0G A;  3EJI A;  1K73 C;  1TWG B;  5FLM H;  3S1M B;  1IHZ A;  2E74 C;  4A3D G;  1HPC A;  4FF4 A;  1CZG A;  3CPF A;  4MNO A;  4B3R Q;  3H94 A;  1V9P A;  4ALP A;  1Y1W H;  2IHF A;  1MJC A;  1GUT A;  4NXN Q;  4Y7N H;  3KJP A;  4BBR H;  1I4X A;  4JI4 Q;  3GTK B;  2IJ0 A;  1HQM C;  4DV3 L;  1SE4 A;  4N9T A;  5IGD A;  2F0Q A;  3TRZ A;  2YU9 H;  1N34 L;  1QJO A;  2B2Y A;  4B3M Q;  3ND9 A;  3J81 i;  1VQP A;  1SBB B;  4A3G B;  1VQL A;  1Y69 U;  4RKB A;  2NVQ H;  5EAY A;  1EQQ A;  3EA6 A;  4DR2 L;  3A54 A;  1Z9F A;  2QKI C;  1HZC A;  3STB D;  1I6H B;  4HIM A;  1BUV T;  3E3X A;  2I5H A;  1K3R A;  4LF7 Q;  1EEI D;  3HKZ B;  1SE8 A;  4QGU A;  4LF5 L;  3C2P A;  2OXP A;  1L1O C;  2UUC Q;  3PIP 3;  1ZYR D;  1TWC B;  4JPB W;  5M3F H;  1SMY D;  2KHS A;  3JAM L;  2E2I H;  1YBY A;  3T51 B;  3CQZ H;  1UE6 A;  2MUY A;  3J7A F;  3S2H H;  3CKI B;  4LW1 A;  5CMD A;  1J8I A;  2D0P A;  2RSO A;  1PH5 A;  1HUN A;  4N8X 1;  2K32 A;  1S40 A;  4ZLT F;  1ET6 A;  4TKO B;  4PMC A;  1D8L A;  2XWB B;  4NB3 A;  1YNN C;  3DXJ C;  1V1Q A;  4BY7 B;  1FVI A;  3BZK A;  3TQY A;  4HSV A;  4EQN A;  1WTR A;  2IX0 A;  5COY A;  4GN3 B;  3A74 A;  2JQO A;  3BG3 A;  2F0D A;  3Q24 A;  4HID A;  1W6K A;  4A3B B;  1KIX A;  3CRL C;  3P75 A;  2K5Q A;  1RHP A;  2NZ1 D;  2CWA A;  4P73 A;  1NJI C;  4PNY A;  2VQF Q;  2EJF C;  4YHH L;  1Q1E A;  1Y1V B;  2JA6 H;  1IXR A;  1YEZ A;  4QF4 A;  1TS5 A;  3D6W A;  2VNU D;  4R4I A;  4JI5 L;  1VQI A;  4KKS A;  5BN5 A;  4FO2 A;  5ELO A;  1ZEQ X;  2F0J A;  4DNI A;  2AQ2 B;  4L5R C;  1E1O A;  1GKH A;  3RZD H;  1Y1W B;  4V0B A;  4X3U A;  4K0K Q;  1XPU A;  1S5C D;  3I4M H;  4DU9 A;  4Y7N B;  1KQS A;  4BBR B;  3K7U C;  2IPK D;  5EPK A;  1A63 A;  2A74 C;  1X3G A;  5C4X G;  2HQE A;  1SYE A;  1X3Q A;  2JA7 H;  5KEE A;  1HRJ A;  2K5N A;  3STB C;  2UU9 Q;  2YU9 B;  4C3I H;  1YIT A;  4JI1 Q;  2HDL A;  3G4S A;  4LFB Q;  3CMA A;  1YHQ A;  2DGY A;  1B70 B;  1XMO L;  2MHV A;  1SYB A;  1LTI D;  3F2C A;  2NVY H;  1A8V A;  2K52 A;  2NVQ B;  1AE3 A;  2E2H H;  3Q0A A;  3U58 A;  4DF7 A;  3NEN A;  1BCP B;  3EN2 A;  5KNB A;  5BN3 A;  4IAL A;  3ERQ A;  2UUB Q;  1FGU A;  4FF3 A;  3KLS A;  4C3J H;  1VCI A;  2F0S A;  1UE5 A;  2N55 A;  3F2D A;  3GDE A;  4EQP A;  1KD1 C;  2EYJ A;  2ZTE A;  3K8A A;  1FL0 A;  3GV6 A;  3Q22 A;  5M3F B;  1C0A A;  2ATW A;  2E2I B;  1UWV A;  1P16 A;  2IHE A;  2K4K A;  3HOW B;  2WB1 B;  3OWF A;  5J22 A;  4OIJ A;  3CQZ B;  1LTL A;  3MXG A;  3S2H B;  2SNS A;  2EYL A;  2MJ8 A;  1SR3 A;  3AU7 A;  4ZRZ A;  3NWT A;  4GKK L;  5ISR A;  1FD7 D;  5M3M H;  2VZA A;  5KNC A;  2NYZ D;  2KOL A;  5C3E H;  2ALY B;  4A93 H;  4GZY C;  3D6C A;  4NXM Q;  1H9J A;  5EBD A;  1N9W A;  1EYA A;  1K0R A;  2F0I A;  4POG A;  2ZXO A;  1HTL D;  1N32 Q;  1NAP A;  4AIM A;  4IOA A;  3OTO L;  1KDC A;  4KN7 C;  3IKJ A;  1CUK A;  2A5H A;  3H0G H;  4A75 A;  4A76 A;  2JA6 B;  3GTM H;  2H4O A;  2F0H A;  2BCO A;  2SOB A;  4JI8 L;  4JK1 C;  1SXT A;  1RCV D;  2Z9H A;  4KY7 A;  1TQO A;  3R2I A;  1NY4 A;  2PYK A;  4YWK A;  4DKA C;  1JJG A;  1HNW Q;  4KV6 A;  1A2U A;  1IYV A;  1CTM A;  4WRD A;  3RZD B;  1GO3 E;  2MO1 A;  2VUM B;  5IY0 A;  3I4M B;  1XMQ L;  1I3Q H;  2RVL A;  3NBI A;  2B63 H;  2EE1 A;  3HGB A;  2EDG A;  3DEO A;  2Q8T A;  4JYA Q;  1XNR L;  1E3P A;  1FNV A;  1GUS A;  4Q0F A;  3D0F A;  3PUY A;  4PZ8 A;  3SHL A;  2F0N A;  1WI5 A;  2ZT9 C;  1SYD A;  4YCV A;  5K36 H;  1K3B C;  4C3I B;  1VQ5 A;  5FO8 B;  5IYC H;  4DN4 M;  1S5D D;  1Q8I A;  1P8L A;  3RMH A;  2G9H D;  2NVY B;  4DV2 L;  2F0T A;  4QIW B;  4GS3 A;  4DV1 Q;  1XXG A;  5ELC A;  3PO2 H;  4JI2 L;  3IFD A;  5CBE E;  4JBM A;  4C3J B;  4JI3 Q;  3V2T A;  3DWP A;  3OIP A;  2E8G A;  3H3V H;  5ELB A;  1BQQ T;  5I2X A;  1PZK D;  4K6D A;  1G6P A;  1YHA A;  4PMB A;  2Q2U A;  1JJC B;  2LXK A;  4P72 A;  2D9U A;  3VYU A;  3MHB A;  3J81 E;  3I73 A;  1E0B A;  4A3I G;  5E4W C;  2X69 A;  4X64 Q;  1KAB A;  4GLA C;  4FF2 A;  4RWS C;  1A6X A;  1WCM H;  3GTG B;  1Y8N B;  1MIU A;  1R4P B;  4IUQ A;  4PV1 C;  5M5W B;  5E1F A;  1YI2 A;  3UDF A;  2MPM A;  5M3M B;  3JAM i;  3S1R H;  1RF2 D;  3RLO A;  3UE1 A;  3CME A;  5C3E B;  2L4N A;  4NP5 A;  4KJN A;  4A93 B;  3G48 A;  4R4O A;  4QUF A;  1TS4 A;  2PMZ E;  1WTP A;  5FLX E;  2G5D A;  1SMX A;  2SNM A;  1LT6 D;  1D5M C;  3KDF A;  4KKT A;  1C48 A;  3VYT A;  1SRO A;  1MGS A;  1S4Z A;  1F9S A;  4NPS A;  2WIN B;  3HFZ B;  4MIU A;  3H0G B;  1AFP A;  4Q5V A;  3GTM B;  4C1N K;  1PTO C;  4RFB A;  4DUZ L;  1LV9 A;  4XQQ A;  3ULJ A;  1STB A;  3ERS X;  2I5M X;  4KK7 A;  3TP7 A;  1F2L A;  1B2T A;  2NUC A;  4R8I A;  4A3J H;  3NEM A;  4O0A A;  1I3Q B;  4DR3 L;  4X6A H;  3G71 A;  3N6R A;  5CBA E;  2N3S A;  1ENA A;  2R7Z G;  1EYG A;  4HED A;  4XYO A;  3MXN A;  1C9O A;  4OEM B;  5JJL A;  3RN2 A;  2GN5 A;  4JV5 Q;  3QWN A;  1KRT A;  4DR1 Q;  3BS1 A;  1ASZ A;  1M1K C;  5DNF A;  1PTO F;  4DR7 Q;  2ZTC A;  2I0Q A;  2PZU A;  2F3I A;  5IYB G;  1CA6 A;  2NB0 A;  3NSW A;  3AFP A;  1F2Y A;  3PO2 B;  3PO3 G;  4RG1 A;  3S16 H;  1XTC D;  4N9P A;  4P75 A;  1X56 A;  4ME5 A;  2XTI A;  4FNF A;  4EVO A;  2OT2 A;  2PNH A;  1K9M C;  1B8A A;  3KK7 A;  1ONL A;  2ICI A;  4R1J A;  1PH7 A;  1VQN A;  2EJG C;  3KFU A;  2B2W A;  5IGF A;  1N8R C;  4I7Z C;  2TMP A;  2HT1 A;  4HN7 A;  4IUU A;  4O42 A;  1WCM B;  3BU2 A;  1D5Z C;  3UDI A;  5DM7 3;  5C5M A;  3TEH B;  2DNC A;  1JOQ A;  1HA6 A;  4OWX B;  2IWH A;  4AQY Q;  3T1H L;  3S1R B;  3LX0 A;  4X3S A;  1K8A C;  1FGB D;  2A69 D;  3SK8 A;  5KIX A;  3CPW A;  3CCM A;  4HJ5 A;  4HMI A;  4JI0 Q;  2BA1 A;  3IRB A;  1KAA A;  2P5Z X;  1LT4 D;  2JA8 G;  4A3M G;  2NN6 G;  1SAP A;  4FXD A;  1XJV A;  3A7L A;  1H9S A;  2N78 A;  4X62 L;  1GUG A;  5FLX L;  2A6E D;  2WII B;  1HH2 P;  3BZC A;  3OSO A;  1CT1 D;  1VF7 A;  2KCC A;  1CHQ D;  4GLX A;  4WFN 3;  3QOJ A;  3HP3 A;  3TME A;  2XRS D;  1K28 A;  4K2L A;  4FXK C;  4CKB A;  3KDF B;  1PFM A;  1Q7Y C;  1XNQ Q;  2R93 H;  1TS2 A;  4ZYS A;  1Z6H A;  5E7N A;  4A3J B;  2F0F A;  3AFQ A;  4PG3 A;  3SR1 A;  3MXP A;  3FHW A;  4IPC A;  3CRK C;  3RUZ A;  5KRU A;  4LF4 L;  3K59 A;  4P71 A;  2K05 A;  1GUW A;  3HS0 C;  5JJZ A;  2L11 A;  3DLL A;  5GRO A;  2NZH A;  2HHH Q;  2K28 A;  1G8Z D;  1PLF A;  2L15 A;  1Q82 C;  2K5H A;  2QCP X;  1SE2 A;  2KEC A;  4JOI A;  2JA5 G;  1FNW A;  3T53 B;  3U4V A;  1CKM A;  5C3W A;  4E6I A;  3MXN B;  1ET9 A;  1LO5 D;  2MFI A;  3J7Y W;  1ICW A;  3S16 B;  1I4R A;  1MHW C;  3CHB D;  4XXE A;  2XRQ D;  1Z7T A;  1ML0 D;  4LFA Q;  3PGZ A;  5IYD G;  4RGM A;  2RDH A;  1NE3 A;  5LHY 1;  4C1N I;  4GNX A;  3AMU A;  4UY8 C;  1VDZ A;  1GHK A;  3H15 A;  2ZJQ A;  1HA5 A;  2UXD L;  3WDN A;  5CV6 A;  3P1H A;  2R61 A;  3EVQ A;  2EIF A;  3G6J B;  3FVQ A;  1BF4 A;  4LF5 Q;  2ENB A;  2MP1 A;  3KYH C;  1D6E C;  3ERO A;  1L0X B;  1X9N A;  5J39 A;  1E7Z A;  3MTS A;  1OXT A;  2H5X A;  2K7V A;  3U4Z A;  3F1Z A;  4DGZ A;  4DUY Q;  1BO0 A;  3SEB A;  1BBX C;  4KMU C;  3C1E A;  1HNZ L;  3T1Y L;  3JAM E;  1PHJ A;  1PH9 A;  4TSS A;  2VQE L;  1I94 L;  2NTT A;  2D0O A;  1CM9 A;  4OX9 L;  2ZXP A;  1HR0 L;  4R9W A;  4AH6 A;  1TY0 A;  2A6H C;  1A3V A;  2RF4 A;  5IP9 G;  4YY3 Q;  3CC7 A;  2BH2 A;  2BE5 C;  1K8G A;  1FJG L;  1H9S B;  2R93 B;  3E0E A;  1MI2 A;  1QUQ A;  3SK5 A;  4DV4 L;  4IN3 A;  1GJX A;  1QNU A;  5JEA G;  1BNZ A;  3KOJ A;  3S15 H;  1BKB A;  3HRZ C;  4LMQ D;  5C0X G;  4B3S Q;  2EPB A;  4B9X A;  4MTK A;  3K5M A;  3BVG A;  4EQ5 A;  3MXU A;  1G2S A;  4OIK A;  1VQH A;  3GTQ H;  1MBY A;  1EY0 A;  2F3W A;  4I7A A;  3M4P A;  3LNN A;  1PRT F;  2PMZ B;  3S14 H;  1XPO A;  2JJQ A;  5C3X A;  5GAE C;  3UDG A;  1ENC A;  3ICE A;  1EFW A;  4JI7 Q;  2IW3 A;  1G29 1;  2R92 H;  3A5U A;  1ROD A;  1PYS B;  4DAM A;  1WD0 A;  3GTP H;  3M9B A;  2HCC A;  4A4I A;  2PZW A;  3TRE A;  5EPL A;  2Z1C A;  4CKE A;  2E5L L;  2WKD A;  2D62 A;  4GKJ Q;  3D4W A;  1PH8 A;  2AQ3 B;  4H44 C;  2AHO B;  3WWV A;  4OGQ C;  1QNK A;  2B2T A;  1WVL A;  5CYU A;  4LJZ C;  4K5W A;  4ZKC B;  2XN9 C;  2VB3 X;  4F87 A;  2X6L A;  4XIG S;  1YHB A;  4R4C A;  4GNX B;  2L12 A;  2UXC L;  1OXX K;  4J1M A;  2O4X A;  2PNR C;  1QWY A;  1HNX Q;  2ID0 A;  2NVT B;  4N8F A;  4UP8 A;  1HFG A;  4HJ9 A;  5DAU A;  4JVZ A;  4HCS A;  4PQX A;  1YVC A;  1G6Z A;  4DNT B;  1JQY D;  4BXX G;  1WTH A;  1IBM Q;  2CW0 D;  1IKL A;  2R7F A;  4DV5 Q;  1QCB D;  1E2W A;  3GV3 A;  5GAG C;  2CCZ A;  4ZQ3 A;  1EOT A;  3UDX A;  3LGJ A;  1PFN A;  4IUT A;  1AN8 A;  4LF8 L;  1N36 L;  1DM0 B;  1F77 A;  2C35 B;  4KD3 A;  1W2B A;  1NR2 A;  4IFD J;  1EU3 A;  1UE7 A;  3S15 B;  2ZM6 Q;  1MJE A;  1CKN A;  5LMN L;  2AQ1 B;  1YNJ D;  4RGT A;  3CCV A;  4LF6 Q;  3PMF A;  4LUZ A;  3HOX G;  1STA A;  4EX5 A;  2WAQ B;  4A3F G;  1WYD A;  2B8G A;  2K5W A;  2B2U C;  3KLW A;  3J7A 5;  3CC2 A;  1QUQ B;  4BBS G;  1EQT A;  4ZAI A;  4A3I H;  3HOZ G;  1IBK L;  1HR0 W;  1WOC A;  4HR7 B;  5CV4 A;  3S1N H;  1ILQ A;  1MKH A;  2B29 A;  1WTQ A;  1HFN A;  4G57 A;  3GTJ H;  3NTH A;  1EUJ A;  3S14 B;  5IWA L;  3PUV A;  1O7Z A;  1XMQ Q;  3R2T A;  1B7Y B;  1ICF B;  1O78 A;  4DK3 C;  2EOT A;  2L0C A;  2WP8 J;  4LFC L;  1J5E L;  3M4Y A;  2R92 B;  3F2B A;  3GTP B;  1VQF A;  1XPR A;  1SSO A;  3HKS A;  3I55 A;  4A3E H;  4APV A;  3MEH A;  1U0L A;  2QDL A;  4K14 A;  2ASB A;  2A68 D;  4QUC A;  4GOP A;  1LTG D;  4DR6 L;  1JCK B;  3ULL A;  5BR8 L;  3U50 C;  1VQ6 A;  3HG9 A;  2Z6K C;  4MTN A;  1FYC A;  2WFW A;  4X3T A;  3E9H A;  4Z9C B;  4KD4 A;  4LF9 L;  1EIH A;  4ZK9 B;  3F2U A;  1L0Y B;  1DON A;  3H91 A;  1ZYR C;  3MA2 B;  4X65 L;  1VQK A;  2F4I A;  4A3G G;  1EU4 A;  3PUZ A;  1RTO A;  1SMY C;  3QO2 A;  1BCP D;  5IGB A;  5CV5 A;  2R7Z H;  1B4O A;  3J80 c;  1XTD A;  4TVA B;  1VQA A;  1BVS A;  1YJ9 A;  4B3R L;  1S5F D;  1KRS A;  1W6J A;  1Y8P B;  4IFD I;  2M2L A;  1M8A A;  4JI4 L;  2KHJ A;  3MFG A;  4BY1 H;  1JE5 A;  2EXD A;  2KHI A;  3K7A H;  2OTJ A;  4KI0 A;  3Q8D A;  3CXC A;  3OW2 A;  1JMC A;  3D4R A;  1GD7 A;  2OQ0 A;  4JCV E;  1KTK A;  4U68 A;  4J15 A;  1EL0 A;  1K0S A;  5FJ8 H;  2M9V A;  1Q8K A;  4B3M L;  1YZ6 A;  5FO9 B;  2EJM A;  4AYB B;  4CKC A;  2IX3 A;  5A2Q L;  4BY7 G;  3RN5 A;  3HOY G;  4A3C G;  4A3I B;  1JOO A;  4KKU A;  4QL5 A;  4DUZ Q;  3S1N B;  1UE1 A;  4LF7 L;  2K33 A;  4RGN A;  1CKN B;  5EPJ A;  1B3Q A;  1QVC A;  2UUC L;  3GTJ B;  2LS0 1;  3RNU A;  3M7G A;  4RA8 A;  3J7A V;  3X3N A;  4DXF A;  4FYD A;  1EY7 A;  3I56 A;  2A68 C;  4CDD C;  5A35 A;  1STN A;  3KF6 A;  2WAC A;  4L63 B;  1L2F A;  2Y0S G;  4H02 A;  5E3F A;  5LMN W;  4KY6 A;  5CV7 A;  1R9T H;  2JEA I;  1O7I A;  5FLM G;  5DEH A;  2UXB Q;  4ME3 A;  4IOC A;  4JBK A;  1EY8 A;  2RSN A;  2UUA Q;  1TKW B;  3BYT B;  3D8G A;  2JA8 H;  3UI2 A;  1KL9 A;  2NN6 H;  2K03 A;  3VR6 A;  2ES2 A;  4A3E B;  2OEO A;  3CU7 A;  1ESR A;  1OXV A;  3K5N A;  2QIL A;  4KHP L;  4P74 A;  1DGS A;  4RHR A;  2JA7 B;  3D4D A;  2I46 A;  3ZJY C;  5IT9 c;  4DK1 A;  4DV0 Q;  1EZ6 A;  4IUP A;  1JIC A;  1SNM A;  2B2Y C;  1II3 A;  4GOP B;  1D7Q A;  2VQF L;  1CQF A;  4G7H C;  2Q8I B;  1EWC A;  2J7Z A;  1EOV A;  4LUV A;  4UP9 A;  2OCE A;  3HOU G;  1RTN A;  2OF1 A;  2E2H B;  2R7Z B;  4QMG A;  1LTS D;  1NTG A;  2WV6 D;  1O80 A;  2E2J H;  3SGI A;  4DR4 Q;  1YIJ A;  1U4R A;  3C3L A;  4RH6 A;  2EYO A;  5J1Z A;  4K0K L;  3QIA A;  1WTW A;  2JA5 H;  2PQA B;  1B44 D;  3T1H Q;  4PZ7 A;  4BY1 B;  1D2B A;  3HOW G;  1EEF D;  2WB1 G;  2QDB A;  3K7A B;  1RIP A;  2UU9 L;  1JB7 A;  3CW2 C;  3U9S A;  4JI1 L;  4LFB L;  1K8O A;  1VMP A;  1CHP D;  2EYP A;  3R8B A;  3OYY A;  1NUC A;  3OMC A;  3A56 A;  4PZ6 A;  1A62 A;  1MSH A;  5IYD H;  1E2Z A;  1EY4 A;  4EQO A;  3TS2 A;  2F4V Q;  2FFK B;  5AJ3 Q;  2VL6 A;  3M4O H;  4R4Q A;  2Z4I A;  4UAI A;  5K5P A;  1EWH A;  3EBE A;  5GAD C;  2BOS A;  3QOL A;  2B2V A;  3PV0 A;  3A5Z B;  1SJE D;  2XWJ B;  1UUP A;  4K5V A;  3OPO A;  3R3O A;  2Q2H A;  4A3K G;  3BDO A;  1IW7 D;  4IUN A;  4DNR B;  3C1F A;  2JA8 B;  1X3P A;  5C44 H;  1FNU A;  5ELD A;  4K2K A;  3CF5 A;  2VUM G;  5H1S E;  2AKW B;  3I4M G;  3DM3 A;  1T5E A;  2B63 B;  3KF6 B;  3K57 A;  5LMU Q;  4OXP A;  3W5O A;  5EBC A;  1I4H A;  4C3I G;  5IP9 H;  1X65 A;  1LT5 D;  2TSS A;  1F9R A;  2HUG A;  3W1G A;  2YTY A;  5M9O A;  1RJT A;  1SYF A;  5JEA H;  4Y52 H;  4A3L G;  3T4A C;  2NTS A;  4P2C B;  1UNS A;  2OWO A;  4B3T Q;  1S3O A;  5C0X H;  3NTI A;  2E2J B;  2K5D A;  1EFI D;  2XVS A;  2R6G A;  4C3J G;  2KCM A;  3E6Z X;  2UXD Q;  1HNW L;  1ZKO A;  2XNA C;  3KLS X;  1AZP A;  2JA5 B;  3G7L A;  2RHS B;  3S2D H;  2NZO A;  1EYD A;  4JYA L;  1EZ8 A;  3AEV A;  1VQO A;  5J3B A;  4UHV A;  3RZO H;  4OO1 G;  4HJA A;  2JK8 A;  3CP0 A;  3A8J E;  2XIW A;  4CJ2 C;  2CH4 A;  3B6Y A;  1AP0 A;  4S3S A;  1DOK A;  3ULP A;  1G2T A;  4OO1 I;  5M3M G;  3NUC A;  2EZV A;  3DWQ A;  1JE4 A;  2JXM B;  1TWH H;  2KBN A;  4A3D H;  1HNZ Q;  3T1Y Q;  3E0J A;  2CHB D;  5C3E G;  4X66 Q;  2VQE Q;  4JI6 Q;  2X6G A;  4A93 G;  4F8M A;  1I94 Q;  1ZXT A;  3M4O B;  2O5J C;  4DAV A;  1M4V A;  2EY6 A;  4JI3 L;  1PH1 A;  1FJG Q;  2RA4 A;  3FDT A;  5DM6 3;  1F2M A;  5NUC A;  4DR5 L;  2VB2 X;  3H0G G;  3KBX A;  3GO5 A;  1A15 A;  4X64 L;  1HUM A;  2H1E A;  4YCU A;  5T1I A;  1JC7 A;  5JVH 3;  1DCZ A;  2F0O A;  2D5D A;  5C44 B;  1EY5 A;  2A73 B;  2CQA A;  3TP5 A;  1EQV A;  1NCV A;  3NPP A;  5I6W A;  4L8J A;  3U9O A;  4BXX H;  4DV7 L;  4BS9 A;  2E76 C;  2Y0S E;  1A3U A;  2Q2I A;  1I5F A;  3GD7 A;  5IOD A;  2R3Z A;  1L1O A;  5HGT A;  2RQX A;  2D2C C;  1VQJ A;  2CKZ B;  5ELE A;  2Q2T A;  1XX8 A;  1A3T A;  1V1P A;  1Q86 C;  4M1U B;  3Q23 A;  2KUM A;  3H3V C;  3TP6 A;  3I4N G;  1PDQ A;  3CCE A;  1YJN A;  3PF4 A;  5C4H A;  4H0L C;  4WOR A;  4IQZ A;  5EKL A;  1UEB A;  1STH A;  2L55 A;  1PH6 A;  1B9N A;  3K5L A;  3HOX H;  3RLN A;  3CCR A;  1PRT D;  4QQB X;  2FIN B;  3DM1 A;  4RHS A;  1PRT B;  1CKO A;  2BDO A;  4HMJ A;  4BBS H;  4DV3 Q;  1DXM A;  1F9P A;  2J4X A;  3HOZ H;  4F88 A;  5D14 A;  4CDF C;  3S2D B;  3H3V I;  4IO9 A;  1N34 Q;  2UXC Q;  2A69 C;  3SXH A;  1N33 L;  3I90 A;  2VS1 A;  1X54 A;  3BJU A;  4JC0 A;  3RZO B;  2JA9 A;  5C0X J;  4DR1 L;  2O5I C;  3H09 A;  4K6L A;  1VQ8 A;  1OO9 B;  5CR3 A;  1X6O A;  3T16 A;  4DR2 Q;  4DR7 L;  2RCN A;  2HDM A;  1TWG H;  1NNX A;  4IUR A;  4A3D B;  1HHV A;  2WB1 E;  2A6E C;  1CFM A;  4GLV B;  3K58 A;  5I2Y A;  3EFX D;  3KUP A;  5D3I B;  1I50 H;  4X3K A;  2F0K A;  4POF A;  3J81 c;  2JE6 I;  3IFT A;  1TII D;  3BVM A;  5GQO A;  5C4X H;  2AMC B;  2EYM A;  4RKL A;  1N36 Q;  2NVX H;  4PMW A;  5IGE A;  4UPA A;  5JJK A;  1F9Q A;  1HZA A;  1S5B D;  1C8C A;  4G7O C;  5FKA C;  2GVA A;  1G91 A;  2PCF B;  4LUO A;  2L5T A;  1MSG A;  4RGO S;  3X3M A;  4MZ9 A;  4DA2 A;  1U4P A;  3T56 B;  1VQ7 A;  3MVV A;  3P20 A;  2F0V A;  4AQY L;  2N49 A;  4WJ4 A;  4RMF A;  3SE0 A;  1YJW A;  4M8A A;  2MNA A;  3I4L A;  1CA5 A;  4JI0 L;  5CGK A;  1AZQ A;  2LY7 A;  1H9M A;  1X55 A;  1DD2 A;  4YHH Q;  2V4D A;  5G3L F;  4DK0 A;  1BDO A;  3NHH A;  5JJI A;  3J7Z C;  1E24 A;  4DV6 L;  4C3H G;  1J5E Q;  3M7N A;  5COR A;  4ZCK A;  1Q3L A;  4DAP A;  3J81 j;  4JI5 Q;  2K6A A;  4ZKB B;  1L1O B;  1DZ1 A;  3BZD B;  1DOM A;  3L0O A;  1EIG A;  3VYR A;  2GA4 B;  3HOX B;  1V1P B;  1QG7 A;  3QJY A;  3VYS A;  4HIK A;  4V19 0;  4DR6 Q;  4YCW A;  1JWM D;  3W2D A;  1XNQ L;  4BY7 H;  1DYQ A;  1WTV A;  3HOY H;  1BXT A;  4A3C H;  4BBS B;  3HOZ B;  1JB3 A;  2JYO A;  5JPM C;  4QIW E;  2B2W C;  5C4J H;  1BBU A;  1KNE A;  4LF9 Q;  1PV4 A;  3RR5 A;  4CDE C;  1RDP D;  3QG1 A;  1XMO Q;  3CCQ A;  1G51 A;  1YNN D;  4H13 C;  4X65 Q;  4NDX A;  5IGG A;  2R7D A;  1IYJ B;  2HIV A;  1QE6 A;  3K6O A;  5IE8 A;  3MWY W;  2C5C A;  5JAV A;  1S72 A;  3VA5 A;  3K0X A;  5EKK A;  1GXD C;  1NBW A;  2O2L D;  1SND A;  3D31 A;  4DAY A;  2N88 A;  1KLG D;  1RL2 A;  4LWC A;  4HJ8 A;  2KCT A;  3NQI A;  3Q6S A;  1I50 B;  2AUJ D;  3FKI G;  3L3O C;  1JOK A;  5C4X B;  4JBJ A;  2J0T D;  3W1B A;  3FRP B;  4QY7 A;  4LFA L;  2NVX B;  4G4K A;  3ITP A;  3J80 L;  1AW7 A;  1V43 A;  2PPB C;  2EY1 A;  1TR5 A;  2Q8R E;  4ID6 A;  5IIF A;  1U4L A;  2XGT A;  2G9D A;  5LL6 X;  5CV8 A;  4GKK Q;  3VA7 A;  4ZUI A;  1WJJ A;  1OXS C;  5M5X H;  2MQH A;  1J9O A;  2ZJP A;  3CCU A;  1V1O A;  3HOU H;  1DJR D;  4FVM A;  3SK6 A;  2R93 G;  3P7J A;  3R93 A;  3HOV G;  2KEE A;  5IP7 G;  4FP5 D;  2PZT A;  1PZI D;  2OTL A;  1PVO A;  3KF8 A;  1QZH A;  5A2Q E;  3GQB A;  1B3A A;  1RD9 D;  3F8T A;  5FO7 B;  1KDA A;  3OTO Q;  4J6H A;  2AWN A;  2PW7 A;  1HCZ A;  2Z0S A;  2EQS A;  4J8Q A;  3I4O A;  1VQC A;  3GTQ B;  1VMC A;  3I70 A;  3HOW H;  4DUY L;  3VR2 A;  2HCI A;  2LKV A;  4GN5 A;  4JOI C;  2KED A;  4JI8 Q;  5BN4 A;  2LSS A;  3V05 A;  4CBV A;  1SN8 A;  1KHI A;  2EYF A;  2BDN A;  2OQK A;  4YY3 L;  4KN4 C;  1GUN A;  1PYB A;  4KHP Q;  1XNR Q;  2YTX A;  3HOY B;  1VF5 C;  5CC4 A;  1E22 A;  2CFM A;  2N8N A;  3AQQ A;  5C4J B;  3K81 C;  2KA7 A;  4GNX C;  1WD1 A;  1BOS A;  4TQU S;  5FOB B;  3CD6 A;  4WJ3 M;  3NK9 A;  1VQB A;  2A8V A;  1GUO A;  4B3S L;  1A2T A;  4DV2 Q;  3TP8 A;  1CSP A;  2L1B A;  2RBM A;  2Y0S B;  3NP8 A;  3S1Q H;  3ND8 A;  1HJP A;  4JI2 Q;  5IT9 L;  1M90 C;  2YV5 A;  4A3K H;  1O7L A;  1IL2 A;  3GTO H;  5C5L A;  1LT3 D;  1S5E D;  4L6T B;  2GVB A;  1SJH D;  1Q12 A;  2CW0 C;  2VUM H;  5L37 A;  2DUD A;  1IBL L;  4JI7 L;  2PQA A;  3BYY B;  5KND A;  3K80 C;  1PFB A;  1PTO H;  2DNE A;  2ICE C;  4HAE A;  4RCN A;  1VQE A;  4DAY B;  1NSN S;  3HKZ G;  1LAB A;  2BH8 A;  2ZJR A;  4IFD G;  3NE5 B;  4KHZ A;  4GKJ L;  5EKI A;  3WOF A;  4NXN L;  1YNJ C;  4DXG A;  3T13 A;  1VS0 A;  2Z8L A;  5M5X B;  1SNQ A;  5IYB H;  3KJO A;  3HOU B;  4A3L H;  3PSI A;  1Q46 A;  4B08 A;  3NTK A;  1LTR D;  3PO3 H;  1UEA B;  1YNX A;  2L9H A;  3GP7 A;  2FMM A;  1SNP A;  1TXY A;  1SNC A;  5HY6 A;  1D1K A;  3NEL A;  3ONA B;  3TZU A;  1HNX L;  1CZW A;  2BA0 A;  2KJX A;  1PFS A;  1J6Q A;  4MHE A;  2WAQ G;  5AFW A;  3JAM c;  4BWG B;  4UP7 A;  3DWA A;  1I4P A;  2E2D C;  4K8I A;  1LAC A;  1B50 A;  2PQE A;  3VR3 A;  2F0M A;  1D1I A;  4OO1 H;  4A3B G;  5JVG 3;  1XYI A;  3KF8 B;  4OL7 A;  3TN2 A;  4BA1 I;  1QVF A;  3GTG H;  2K50 A;  5M5W H;  1IBM L;  2QEJ C;  1SFO H;  1KAW A;  5ELF A;  4IPD A;  4DV5 L;  1FR3 A;  4YWM A;  4DR3 Q;  4L5S A;  1Y1V G;  1E2V A;  3MZ5 A;  4BA2 I;  1C4Q A;  2R92 G;  3VR5 A;  1EWI A;  2K75 A;  1C7Y A;  3K0Y A;  3CAM A;  1VQG A;  4A3M H;  3CCS A;  1SYC A;  3OWE B;  2ZM6 L;  3H6M A;  4L5T A;  1Y1W G;  3M4Q A;  4LF6 L;  3BDC A;  4GN4 B;  4BBR G;  4ABN A;  1BBW A;  1EY6 A;  2B2T C;  1Y14 B;  2F0L A;  1WTO A;  1E1T A;  1V8Q A;  3C46 A;  1Q81 C;  1BCP C;  2C9O A;  3HZX A;  2Z6B A;  3S1Q B;  3NBH A;  3I8Z A;  5IGC A;  4A3K B;  1IZ6 A;  1K8M A;  3TS0 A;  1PH3 A;  3GTO B;  2NWG A;  2KEN A;  2AWO A;  2K04 A;  5EJW A;  1PTO D;  3I7F A;  1PTO B;  1RKN A;  2DY8 A;  2ZTD A;  4FF1 A;  1LUZ A;  1PYW D;  4KLK A;  4QB4 A;  4EGV A;  2FHT A;  1R4Q B;  1HTP A;  1LTB D;  1BCP F;  5M3F G;  2M00 A;  3OMG A;  1K83 H;  3I4N H;  3DMU A;  4QJF A;  2F1M A;  4OEL B;  3VR4 A;  2YYZ A;  3OIQ A;  1U5K A;  3VDY A;  3J80 i;  2VY3 A;  3PO3 B;  3OHX C;  5EGT A;  1QZG A;  2EXZ A;  2WKC A;  1B1Z A;  4DR5 Q;  2PO4 A;  2AUK A;  2I07 B;  4X62 Q;  1JR0 D;  4AYB G;  1TS3 A;  3IAY A;  4IPH A;  1KXL A;  1VQD A;  2IX1 A;  2RKS A;  2DJF C;  2UUB L;  2F0W A;  2QF7 A;  3TZD A;  3GTL H;  4FDB A;  2PW5 A;  3DHQ A;  5LL6 S;  1U9R A;  2NBF A;  4DK6 C;  1SFO B;  1SRU A;  2I5L X;  2JEB I;  1HQR D;  4ILW A;  3OOC A;  4IJL A;  2F0U A;  3LWU A;  4K5X A;  4DV7 Q;  2JA6 G;  4YIJ A;  2KCN A;  2DN8 A;  1LTT D;  1LLR D;  1R9T B;  1CK1 A;  3W3A A;  3FP9 A;  5F2D A;  4LF4 Q;  3SVM A;  1X32 A;  2PI2 E;  3ZYY X;  1PA6 A;  1EIF A;  4A3M B;  5C6A A;  4A3E G;  3PF5 A;  3SDZ A;  4GOP C;  2FJ2 A;  1AH9 A;  1OXU A;  2VXW A;  3QR8 A;  2MO0 A;  3LWE A;  2E75 C;  1Z47 A; 
#chains in the Genus database with same CATH homology
 3PUX A;  4UDU C;  1PMR A;  1I6V C;  3MC0 B;  2SEB D;  3L7Z C;  5T1G A;  2F3V A;  3A8I E;  4ODG A;  1IL8 A;  1SNO A;  1JOR A;  4MN3 A;  3L9A X;  1Q90 A;  3TDQ A;  1HXY D;  4KY5 A;  5I6Y A;  4O1N A;  3QB3 A;  3RD4 A;  4B9W A;  1B53 A;  1K83 B;  3I4N B;  2Z4H A;  4OHJ A;  3BVZ A;  2ZXR A;  1SDF A;  4XT1 B;  1LTA D;  5FK9 C;  4ULL A;  2JSO A;  1QOH A;  4R8N A;  1Q1B A;  2K1B A;  3A8K E;  1GOZ A;  1TVX A;  5EQ0 A;  4NMZ A;  5D3D A;  1KNA A;  1TU2 B;  1XWE A;  4CJ0 B;  3BDL A;  3GTL B;  1CI3 M;  3A55 A;  5IOC A;  3J81 L;  2FMC A;  1IW7 C;  4CHT B;  1ESF A;  1ENF A;  4NW2 A;  1T5X D;  5I9O A;  4IUV A;  3K5O A;  2EVB A;  1F2Z A;  1JWS D;  4JBW A;  2B39 A;  5I9P A;  4F7X A;  2IL8 A;  5CV9 A;  1MD2 D;  1TY2 A;  3I91 A;  5KYL A;  1QIL A;  2NN6 I;  3MAQ A;  1KLU D;  1QB5 D;  3TSS A;  1CQV A;  1SEB D;  3D3R A;  2LMC B;  3KBG A;  5K36 G;  3AB9 A;  1NR4 A;  4K8J A;  5KGU A;  3TBI B;  5JOB A;  3S9W A;  3E5S A;  5D65 A;  3V96 A;  1KDB A;  5G3L D;  4CJ1 B;  1ILP A;  2CVR A;  3DEP A;  1STY A;  4ZUJ A;  3KLR A;  4U67 3;  3I72 A;  2A6H D;  2BE5 D;  3OW7 A;  3NXW A;  1JWU D;  1IYU A;  2B2U A;  1IKM A;  5E4X A;  4G7Z C;  1STG A;  4C3H B;  5C4Z A;  1EY9 A;  5JEA J;  4FXG C;  4XYQ A;  5KYI A;  1D5X C;  1H9K A;  1DOL A;  2F03 A;  4HSP A;  1I4G A;  4C2M B;  4KHV A;  3EQL C;  4WJW A;  1Z47 A;  2DY7 A;  2JP1 A;  4KTA A;  2F0P A;  1TT2 A;  1STE A;  1TWH B;  3M3Y B;  4C56 C;  5M5Y B;  1O7Y A;  5HUR A;  2F0E A;  3J80 E;  3O13 A;  4XT3 B;  3NQT A;  3IL8 A;  1B9M A;  4H7B A;  4XQJ A;  2IT1 A;  3PUW A;  4QCL A;  2B2V C;  3FPP A;  3DUZ A;  4XQN A;  4LAA A;  3RLF A;  2EY2 A;  1UAP A;  4XTC S;  1Y8O B;  2RDG A;  1TWF B;  1PZJ D;  2SDF A;  3FKI B;  3S17 B;  1H9R A;  2MGS A;  1AEX A;  5TSS A;  4CGY B;  5I4D A;  4IFD H;  3N52 A;  3PIO 3;  3M85 A;  1U4M A;  5JPN C;  2EYH A;  4LK1 C;  4HCE A;  4RAU C;  4XDX A;  1I4Q A;  1PRT C;  3FEW X;  3SK4 A;  3HOV B;  4HTH A;  4NKL A;  4KJO A;  1EYC A;  2XSC A;  1TWA B;  3FMC A;  1SYG A;  2EY5 A;  1WTX A;  3FPU B;  2K01 A;  1SE3 A;  4DFA A;  3A7A B;  4A3F B;  1GHJ A;  4RCO A;  4TRD A;  3MFY A;  5C0X I;  3URY A;  4I65 A;  3I3C A;  1PXU A;  3WOE A;  3HEJ A;  1BR9 A;  2RDF A;  3NWS A;  5IT9 E;  2LFN A;  2KQ3 A;  2KVM A;  4IZ8 A;  2B8F A;  2F0G A;  3EJI A;  1TWG B;  3S1M B;  1IHZ A;  2E74 C;  1HPC A;  4FF4 A;  1CZG A;  3H94 A;  1GUT A;  1I4X A;  3GTK B;  2IJ0 A;  1HQM C;  1SE4 A;  4N9T A;  5IGD A;  2F0Q A;  1QJO A;  2B2Y A;  3ND9 A;  1SBB B;  4A3G B;  1Y69 U;  4RKB A;  3EA6 A;  3A54 A;  2QKI C;  1I6H B;  1BUV T;  1EEI D;  3HKZ B;  3C2P A;  2OXP A;  3PIP 3;  1ZYR D;  1TWC B;  1SMY D;  2KHS A;  3JAM L;  3T51 B;  3J7A F;  2MUY A;  3CKI B;  5CMD A;  1J8I A;  2RSO A;  1HUN A;  2K32 A;  4ZLT F;  1ET6 A;  4TKO B;  4PMC A;  2XWB B;  1YNN C;  3DXJ C;  4BY7 B;  4EQN A;  4HSV A;  1WTR A;  2IX0 A;  5COY A;  3BG3 A;  2F0D A;  3Q24 A;  1W6K A;  4A3B B;  3CRL C;  3P75 A;  2K5Q A;  1RHP A;  2NZ1 D;  4PNY A;  2EJF C;  1Q1E A;  1Y1V B;  4QF4 A;  1TS5 A;  3D6W A;  2VNU D;  4KKS A;  5BN5 A;  4FO2 A;  1ZEQ X;  2F0J A;  2AQ2 B;  1Y1W B;  4V0B A;  4X3U A;  1S5C D;  4DU9 A;  4Y7N B;  4BBR B;  2IPK D;  5EPK A;  2A74 C;  2HQE A;  1SYE A;  1X3Q A;  5KEE A;  1HRJ A;  2YU9 B;  2HDL A;  2MHV A;  1SYB A;  1LTI D;  2NVQ B;  3Q0A A;  4DF7 A;  1BCP B;  5KNB A;  5BN3 A;  4IAL A;  3ERQ A;  4FF3 A;  3KLS A;  1VCI A;  2F0S A;  2N55 A;  4EQP A;  2EYJ A;  3GV6 A;  3Q22 A;  5M3F B;  2E2I B;  3HOW B;  2WB1 B;  3OWF A;  5J22 A;  4OIJ A;  3CQZ B;  3MXG A;  3S2H B;  2SNS A;  2EYL A;  2MJ8 A;  3AU7 A;  4ZRZ A;  3NWT A;  5ISR A;  1FD7 D;  5KNC A;  2NYZ D;  2KOL A;  4GZY C;  3D6C A;  1H9J A;  5EBD A;  1EYA A;  2F0I A;  2ZXO A;  1HTL D;  1NAP A;  1KDC A;  4KN7 C;  3IKJ A;  2A5H A;  2JA6 B;  2H4O A;  2F0H A;  2BCO A;  2SOB A;  4JK1 C;  1SXT A;  1RCV D;  4KY7 A;  1TQO A;  3R2I A;  2PYK A;  4KV6 A;  1A2U A;  1IYV A;  1CTM A;  4WRD A;  3RZD B;  2VUM B;  3I4M B;  2RVL A;  3NBI A;  2EE1 A;  3HGB A;  2EDG A;  3DEO A;  2Q8T A;  1FNV A;  1GUS A;  4Q0F A;  3PUY A;  3SHL A;  2F0N A;  2ZT9 C;  1SYD A;  5K36 H;  4C3I B;  5FO8 B;  4DN4 M;  1S5D D;  1Q8I A;  3RMH A;  2G9H D;  2NVY B;  2F0T A;  4QIW B;  1XXG A;  5ELC A;  3IFD A;  5CBE E;  4C3J B;  3V2T A;  3DWP A;  3OIP A;  5ELB A;  1BQQ T;  5I2X A;  1PZK D;  4K6D A;  4PMB A;  2D9U A;  3VYU A;  3MHB A;  3J81 E;  3I73 A;  1E0B A;  5E4W C;  2X69 A;  1KAB A;  4FF2 A;  4RWS C;  1A6X A;  3GTG B;  1Y8N B;  1R4P B;  4PV1 C;  4IUQ A;  5M5W B;  5E1F A;  2MPM A;  5M3M B;  1RF2 D;  5C3E B;  2L4N A;  4NP5 A;  4KJN A;  4A93 B;  4QUF A;  1TS4 A;  1WTP A;  5FLX E;  2SNM A;  1LT6 D;  1D5M C;  4KKT A;  1C48 A;  3VYT A;  1MGS A;  1S4Z A;  1F9S A;  2WIN B;  4MIU A;  3H0G B;  1AFP A;  4Q5V A;  3GTM B;  4C1N K;  1PTO C;  4RFB A;  1LV9 A;  4XQQ A;  1STB A;  4KK7 A;  3TP7 A;  1F2L A;  1B2T A;  2NUC A;  4R8I A;  1I3Q B;  3N6R A;  5CBA E;  1ENA A;  4HED A;  4XYO A;  3MXN A;  3QWN A;  3BS1 A;  5DNF A;  1PTO F;  2PZU A;  1CA6 A;  2NB0 A;  3NSW A;  1F2Y A;  3PO2 B;  1XTC D;  4N9P A;  4ME5 A;  4FNF A;  4EVO A;  2OT2 A;  3KK7 A;  1ONL A;  2ICI A;  2EJG C;  2B2W A;  5IGF A;  4I7Z C;  2TMP A;  4HN7 A;  4IUU A;  4O42 A;  1WCM B;  1D5Z C;  5DM7 3;  5C5M A;  2DNC A;  1JOQ A;  1HA6 A;  2IWH A;  3S1R B;  3LX0 A;  4X3S A;  1FGB D;  2A69 D;  3SK8 A;  5KIX A;  4HMI A;  2BA1 A;  1KAA A;  1LT4 D;  2NN6 G;  1SAP A;  4FXD A;  3A7L A;  1H9S A;  1GUG A;  5FLX L;  2A6E D;  2WII B;  3OSO A;  1CT1 D;  1VF7 A;  2KCC A;  1CHQ D;  4WFN 3;  3QOJ A;  3HP3 A;  3TME A;  2XRS D;  4K2L A;  4FXK C;  4CKB A;  1PFM A;  1TS2 A;  4ZYS A;  1Z6H A;  4A3J B;  2F0F A;  3SR1 A;  3MXP A;  3CRK C;  3RUZ A;  5KRU A;  3K59 A;  2K05 A;  1GUW A;  3HS0 C;  5JJZ A;  2L11 A;  2K28 A;  1G8Z D;  1PLF A;  2QCP X;  1SE2 A;  2KEC A;  1FNW A;  3T53 B;  5C3W A;  4E6I A;  1ET9 A;  1LO5 D;  3J7Y W;  1ICW A;  3S16 B;  1I4R A;  3CHB D;  4XXE A;  2XRQ D;  1Z7T A;  1ML0 D;  4RGM A;  2RDH A;  5LHY 1;  4C1N I;  3AMU A;  1VDZ A;  1GHK A;  1HA5 A;  3WDN A;  5CV6 A;  3P1H A;  2R61 A;  3G6J B;  3FVQ A;  1BF4 A;  2ENB A;  2MP1 A;  1D6E C;  3ERO A;  1L0X B;  5J39 A;  3MTS A;  1OXT A;  2K7V A;  4DGZ A;  1BO0 A;  3SEB A;  1BBX C;  4KMU C;  3C1E A;  3JAM E;  4TSS A;  2NTT A;  1CM9 A;  2ZXP A;  4R9W A;  1TY0 A;  2A6H C;  1A3V A;  2BE5 C;  1H9S B;  2R93 B;  1MI2 A;  3SK5 A;  4IN3 A;  1GJX A;  1QNU A;  5JEA G;  1BNZ A;  3HRZ C;  4LMQ D;  5C0X G;  2EPB A;  4B9X A;  3K5M A;  3BVG A;  3MXU A;  1G2S A;  4OIK A;  1MBY A;  1EY0 A;  2F3W A;  3LNN A;  1PRT F;  2PMZ B;  5C3X A;  1ENC A;  2IW3 A;  1G29 1;  1ROD A;  1WD0 A;  2HCC A;  2PZW A;  5EPL A;  2Z1C A;  4CKE A;  2WKD A;  2D62 A;  3D4W A;  2AQ3 B;  4H44 C;  4OGQ C;  1QNK A;  2B2T A;  1WVL A;  5CYU A;  4LJZ C;  4K5W A;  4ZKC B;  2XN9 C;  2VB3 X;  4F87 A;  2X6L A;  4XIG S;  2L12 A;  1OXX K;  4J1M A;  2O4X A;  2PNR C;  1QWY A;  2ID0 A;  2NVT B;  1HFG A;  5DAU A;  4HCS A;  4PQX A;  1G6Z A;  4DNT B;  1JQY D;  2CW0 D;  1IKL A;  1QCB D;  1E2W A;  3GV3 A;  4ZQ3 A;  1EOT A;  1PFN A;  4IUT A;  1AN8 A;  1DM0 B;  1F77 A;  4KD3 A;  1NR2 A;  4IFD J;  1EU3 A;  3S15 B;  2AQ1 B;  1YNJ D;  4RGT A;  3PMF A;  1STA A;  2WAQ B;  2B8G A;  2K5W A;  2B2U C;  1EQT A;  4ZAI A;  4HR7 B;  5CV4 A;  1ILQ A;  1WTQ A;  1HFN A;  4G57 A;  3NTH A;  3S14 B;  3PUV A;  1O7Z A;  3R2T A;  1O78 A;  2EOT A;  2L0C A;  2WP8 J;  3M4Y A;  2R92 B;  3GTP B;  1SSO A;  3MEH A;  4K14 A;  2A68 D;  4QUC A;  1LTG D;  1JCK B;  3HG9 A;  1FYC A;  4X3T A;  4Z9C B;  4KD4 A;  1EIH A;  4ZK9 B;  3F2U A;  1L0Y B;  1DON A;  3H91 A;  1ZYR C;  3MA2 B;  2F4I A;  1EU4 A;  3PUZ A;  1RTO A;  1SMY C;  3QO2 A;  1BCP D;  5IGB A;  5CV5 A;  1B4O A;  1S5F D;  1W6J A;  1Y8P B;  4IFD I;  2M2L A;  1M8A A;  3MFG A;  4KI0 A;  3D4R A;  1KTK A;  4U68 A;  1EL0 A;  2M9V A;  5FO9 B;  2EJM A;  4AYB B;  4CKC A;  2IX3 A;  5A2Q L;  4A3I B;  1JOO A;  4KKU A;  3S1N B;  2K33 A;  4RGN A;  5EPJ A;  3GTJ B;  2LS0 1;  3M7G A;  4RA8 A;  3J7A V;  3X3N A;  4DXF A;  4FYD A;  1EY7 A;  2A68 C;  5A35 A;  1STN A;  2WAC A;  4L63 B;  5E3F A;  4KY6 A;  5CV7 A;  2JEA I;  5DEH A;  1EY8 A;  2RSN A;  1TKW B;  3BYT B;  3D8G A;  3UI2 A;  2NN6 H;  2K03 A;  3VR6 A;  4A3E B;  2OEO A;  3CU7 A;  1ESR A;  1OXV A;  3K5N A;  2QIL A;  4RHR A;  2JA7 B;  3D4D A;  2I46 A;  4DK1 A;  1EZ6 A;  4IUP A;  1JIC A;  1SNM A;  2B2Y C;  1II3 A;  1CQF A;  4G7H C;  2Q8I B;  1EWC A;  2J7Z A;  1RTN A;  2OF1 A;  2E2H B;  2R7Z B;  4QMG A;  1LTS D;  2WV6 D;  1O80 A;  1U4R A;  3C3L A;  4RH6 A;  2EYO A;  5J1Z A;  3QIA A;  1WTW A;  1B44 D;  4BY1 B;  1D2B A;  1EEF D;  2QDB A;  3K7A B;  3U9S A;  1K8O A;  1VMP A;  1CHP D;  2EYP A;  3R8B A;  1NUC A;  3OMC A;  3A56 A;  1MSH A;  1E2Z A;  1EY4 A;  4EQO A;  2FFK B;  2Z4I A;  4UAI A;  5K5P A;  1EWH A;  2BOS A;  3QOL A;  2B2V A;  3PV0 A;  1SJE D;  2XWJ B;  1UUP A;  4K5V A;  3OPO A;  3R3O A;  3BDO A;  1IW7 D;  4IUN A;  4DNR B;  3C1F A;  2JA8 B;  1X3P A;  1FNU A;  5ELD A;  4K2K A;  1T5E A;  2B63 B;  3K57 A;  5EBC A;  1I4H A;  4C3I G;  1LT5 D;  2TSS A;  1F9R A;  2HUG A;  5M9O A;  1RJT A;  1SYF A;  5JEA H;  3T4A C;  2NTS A;  4P2C B;  1UNS A;  5C0X H;  3NTI A;  2E2J B;  2K5D A;  1EFI D;  2XVS A;  2R6G A;  4C3J G;  3E6Z X;  1ZKO A;  2XNA C;  3KLS X;  1AZP A;  2JA5 B;  3G7L A;  1EYD A;  1EZ8 A;  4OO1 G;  3A8J E;  2XIW A;  4CJ2 C;  1AP0 A;  4S3S A;  1DOK A;  1G2T A;  4OO1 I;  3NUC A;  2EZV A;  3DWQ A;  1JE4 A;  2JXM B;  3E0J A;  2CHB D;  2O5J C;  2X6G A;  4F8M A;  3M4O B;  1ZXT A;  4DAV A;  1M4V A;  2EY6 A;  2RA4 A;  3FDT A;  5DM6 3;  1F2M A;  5NUC A;  2VB2 X;  3KBX A;  3GO5 A;  1A15 A;  1HUM A;  2H1E A;  5T1I A;  1JC7 A;  5JVH 3;  1DCZ A;  2F0O A;  2D5D A;  5C44 B;  1EY5 A;  2A73 B;  2CQA A;  3TP5 A;  1EQV A;  1NCV A;  3NPP A;  5I6W A;  4L8J A;  3U9O A;  4BS9 A;  2E76 C;  1A3U A;  3GD7 A;  5IOD A;  2R3Z A;  5HGT A;  2RQX A;  2D2C C;  5ELE A;  1XX8 A;  1A3T A;  1V1P A;  4M1U B;  3Q23 A;  2KUM A;  3H3V C;  3TP6 A;  1PDQ A;  5C4H A;  4H0L C;  4WOR A;  4IQZ A;  5EKL A;  1STH A;  2L55 A;  1B9N A;  3K5L A;  1PRT D;  2FIN B;  3DM1 A;  4RHS A;  1PRT B;  2BDO A;  4HMJ A;  1DXM A;  1F9P A;  2J4X A;  4F88 A;  5D14 A;  3S2D B;  2A69 C;  3SXH A;  3I90 A;  3RZO B;  5C0X J;  2O5I C;  3H09 A;  4K6L A;  1OO9 B;  5CR3 A;  3T16 A;  2HDM A;  4IUR A;  4A3D B;  1HHV A;  2A6E C;  1CFM A;  3K58 A;  5I2Y A;  3EFX D;  3KUP A;  5D3I B;  4X3K A;  2F0K A;  2JE6 I;  3IFT A;  1TII D;  3BVM A;  2EYM A;  4RKL A;  4PMW A;  5IGE A;  4G7O C;  1F9Q A;  1S5B D;  1C8C A;  5FKA C;  1G91 A;  2PCF B;  2L5T A;  1MSG A;  4RGO S;  3X3M A;  4DA2 A;  1U4P A;  3T56 B;  3MVV A;  3P20 A;  2F0V A;  3SE0 A;  4M8A A;  3I4L A;  1CA5 A;  5CGK A;  1AZQ A;  2LY7 A;  1H9M A;  1DD2 A;  2V4D A;  5G3L F;  4DK0 A;  1BDO A;  3NHH A;  4C3H G;  3M7N A;  5COR A;  1Q3L A;  4DAP A;  2K6A A;  4ZKB B;  1DZ1 A;  3BZD B;  1DOM A;  1EIG A;  3VYR A;  2GA4 B;  3HOX B;  1V1P B;  1QG7 A;  3QJY A;  3VYS A;  4V19 0;  1JWM D;  3W2D A;  1DYQ A;  1WTV A;  4BBS B;  1BXT A;  3HOZ B;  1JB3 A;  2JYO A;  5JPM C;  2B2W C;  1KNE A;  1RDP D;  3QG1 A;  1YNN D;  4H13 C;  4NDX A;  5IGG A;  1QE6 A;  3K6O A;  3MWY W;  2C5C A;  5JAV A;  3VA5 A;  5EKK A;  1GXD C;  2O2L D;  1SND A;  3D31 A;  4DAY A;  2N88 A;  1KLG D;  3NQI A;  3Q6S A;  1I50 B;  2AUJ D;  3L3O C;  1JOK A;  5C4X B;  2J0T D;  3FRP B;  2NVX B;  4G4K A;  3ITP A;  3J80 L;  1AW7 A;  1V43 A;  2PPB C;  2EY1 A;  1TR5 A;  2Q8R E;  4ID6 A;  5IIF A;  1U4L A;  5LL6 X;  2G9D A;  5CV8 A;  3VA7 A;  4ZUI A;  1OXS C;  1J9O A;  1V1O A;  1DJR D;  4FVM A;  3SK6 A;  3P7J A;  3R93 A;  2KEE A;  4FP5 D;  2PZT A;  1PZI D;  3KF8 A;  5A2Q E;  3GQB A;  1B3A A;  1RD9 D;  5FO7 B;  1KDA A;  4J6H A;  2AWN A;  2PW7 A;  1HCZ A;  4J8Q A;  3GTQ B;  1VMC A;  3I70 A;  3VR2 A;  2HCI A;  2LKV A;  2KED A;  5BN4 A;  3V05 A;  4CBV A;  2EYF A;  2BDN A;  4KN4 C;  1GUN A;  3HOY B;  1VF5 C;  5CC4 A;  5C4J B;  2KA7 A;  1WD1 A;  1BOS A;  4TQU S;  5FOB B;  3NK9 A;  1GUO A;  1A2T A;  3TP8 A;  2L1B A;  2RBM A;  2Y0S B;  3NP8 A;  3ND8 A;  5IT9 L;  1O7L A;  5C5L A;  1LT3 D;  1S5E D;  4L6T B;  1SJH D;  1Q12 A;  2CW0 C;  3BYY B;  5KND A;  1PFB A;  1PTO H;  2DNE A;  2ICE C;  4HAE A;  4RCN A;  1NSN S;  1LAB A;  4IFD G;  3NE5 B;  4KHZ A;  5EKI A;  3WOF A;  4DXG A;  1YNJ C;  3T13 A;  2Z8L A;  5M5X B;  1SNQ A;  3HOU B;  4B08 A;  3NTK A;  1LTR D;  1UEA B;  2L9H A;  3GP7 A;  2FMM A;  1SNP A;  1SNC A;  1D1K A;  3ONA B;  3TZU A;  1CZW A;  2BA0 A;  2KJX A;  4MHE A;  5AFW A;  4BWG B;  3DWA A;  1I4P A;  2E2D C;  4K8I A;  1LAC A;  1B50 A;  2PQE A;  3VR3 A;  2F0M A;  1D1I A;  4OO1 H;  5JVG 3;  1XYI A;  4OL7 A;  3TN2 A;  4BA1 I;  2QEJ C;  5ELF A;  1FR3 A;  1E2V A;  3MZ5 A;  4BA2 I;  1C4Q A;  3VR5 A;  3K0Y A;  1SYC A;  3OWE B;  3H6M A;  3BDC A;  4ABN A;  1EY6 A;  2B2T C;  2F0L A;  1WTO A;  1V8Q A;  3C46 A;  1BCP C;  2C9O A;  3HZX A;  3S1Q B;  3NBH A;  3I8Z A;  5IGC A;  4A3K B;  1K8M A;  3GTO B;  2NWG A;  2AWO A;  2K04 A;  5EJW A;  1PTO D;  1PTO B;  1RKN A;  2DY8 A;  4FF1 A;  1PYW D;  4QB4 A;  4EGV A;  2FHT A;  1R4Q B;  1HTP A;  1LTB D;  1BCP F;  2M00 A;  3OMG A;  3DMU A;  2F1M A;  3VR4 A;  2YYZ A;  3OIQ A;  3PO3 B;  3OHX C;  5EGT A;  2EXZ A;  2WKC A;  1B1Z A;  2PO4 A;  2AUK A;  2I07 B;  1JR0 D;  1TS3 A;  3IAY A;  2IX1 A;  2RKS A;  2F0W A;  2QF7 A;  3TZD A;  2PW5 A;  3DHQ A;  5LL6 S;  1U9R A;  2NBF A;  1SFO B;  2JEB I;  1HQR D;  4ILW A;  3OOC A;  2F0U A;  3LWU A;  4K5X A;  4YIJ A;  2KCN A;  2DN8 A;  1LTT D;  1LLR D;  1R9T B;  1CK1 A;  3W3A A;  5F2D A;  3SVM A;  1X32 A;  3ZYY X;  4A3M B;  5C6A A;  3SDZ A;  2FJ2 A;  1OXU A;  2VXW A;  3LWE A;  2E75 C;  3EVQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...