1D1IA

Mutated shiga-like toxin b subunit (w34a) complexed with receptor gb3 analogue
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
69
structure length
69
Chain Sequence
TPDCVTGKVEYTKYNDDDTFTVKVGDKELFTNRANLQSLLLSAQITGMTVTIKTNACHNGGGFSEVIFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Mutated Shiga-like Toxin B Subunit (W34A) Complexed with Receptor Gb3 Analogue
rcsb
source organism Escherichia coli
molecule tags Toxin
molecule keywords SHIGA TOXIN B-CHAIN
total genus 16
structure length 69
sequence length 69
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 1999-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.70 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1d1iA00
2XSCA 1DM0B 2GA4B 1CZWA 4P2CB 3MXGA 1QNUA 1D1KA 4M1UB 1BOSA 1C4QA 1QOHA 1R4PB 1R4QB 1C48A 2BOSA 2C5CA 1CQFA 1D1IA 1CZGA 4ULLA
chains in the Genus database with same CATH superfamily
1B9NA 4X6AH 3DEPA 4S3SA 5C0XI 4A3EG 1HFNA 5ELNA 3GTOH 1QVGA 4DAYB 1DM0B 1CHQD 2OXPA 4KI0A 2CW0D 5NUCA 2IX0A 3AFPA 3IFTA 2KQ3A 5C4XB 3CQZB 4CJ0B 4EQNA 1A63A 4ID6A 4CBVA 2F0DA 1IBKL 2UU9L 4A3FG 2D0PA 2K14A 4BBSH 4KY5A 4KY6A 4EQ5A 3CXCA 1II3A 1KRTA 4JBKA 2YV5A 3D6WA 5A35A 2V4DA 2ALYB 4DK0A 1G8ZD 1ML0D 4V190 3MAQA 4IURA 4DAVA 4DF7A 3F2BA 4HAEA 3OW2A 4UP7A 1SYFA 1TWAB 4DXFA 4HCEA 4X62Q 1U9RA 1CKOA 2KBNA 1O80A 1J5EQ 1HZ9A 3MC0B 2X6GA 1XXGA 2CHBD 2J7ZA 1VF5C 4L5TA 3TP7A 1EEFD 2NZ1D 4J8QA 1N34Q 3QG1A 1BBWA 2K5VA 2R93B 4DUYL 5C6AA 3MXGA 1JE5A 3HKZE 1E22A 1TQOA 2UXDQ 2JJQA 1QE6A 2LMCB 1Y1VH 3DM1A 4HJ5A 1SNOA 5FLMH 4XIGS 1KNAA 5M5WH 3PIPA 1DGSA 3BVGA 2K5NA 2A74C 1E2WA 1K8GA 3HZXA 1SSOA 2PQAB 2PO4A 2JYOA 2DNEA 1XYIA 1EY5A 5JJZA 1Q1BA 2ID0A 2K32A 3HOYG 2PMZE 4AYBG 2K05A 3PO2H 3A5UA 3I90A 2NN6H 2IX3A 1N33L 5F2DA 1FVIA 1K83B 3HOVG 4ULLA 1BCPB 4P75A 2WP8J 4JVZA 5IOCA 1E24A 3LWEA 3SGIA 2F3VA 1SE2A 5LMNQ 1LLRD 5FO7B 2NVTB 2VL6A 3KK7A 1SE3A 1JICA 4DV6L 2B3GA 4BA1I 1K9MC 2R93H 2SDFA 4ZUIA 5KGUA 3IRBA 4HN7A 1X3EA 3D3RA 3E6ZX 2VQEL 1Z47A 1YEZA 3RN2A 2KCTA 1HUNA 2F0LA 4QB4A 2HQEA 4C3JH 1PTOD 1YNJC 4FXKC 1PH9A 4GN4B 4QJFA 4TKOB 2JQOA 4RGOS 1B2TA 1KXLA 2MFIA 3PQIA 1RJTA 4IN3A 4HR7B 4G4KA 1UE6A 2HUGA 4JI6Q 3HFZB 2EE1A 4OL7A 1M90C 4Y52H 3VA5A 5IGGA 1BCPD 3UDIA 1TVXA 3TMEA 2F1MA 1VQBA 1JJGA 1U0LA 3DWQA 3CW2C 1VDZA 4A3KH 1XPRA 2IHEA 1FNUA 3JAMc 1PH6A 1GKHA 1MGSA 4BY1H 3HOXG 2OTLA 1TWHH 1FL0A 1VQCA 3I4MG 3U4ZA 4PV1C 1XWEA 1WTWA 2KENA 4A3KB 2F0FA 1UE1A 2B2WC 3OOCA 1DONA 2RBMA 4IJHA 3IKJA 1ZXTA 4KTAA 2CKZB 3KYHC 1GUOA 4BY7B 1G6ZA 2B2VC 3OWEB 4GNXB 1HPCA 5ISRA 4KD3A 3CAMA 3S16B 2XRQD 1Y8OB 3GTQB 4GOPA 1BO0A 3T51B 3PIP3 3HOWH 4C3HB 4LF4L 3DWAA 4DR3Q 5M3FB 4DGZA 4CDCC 4HJAA 1CM9A 2EYOA 4DR3L 5JJKA 4ZUJA 4P2CB 4JC0A 5IY0A 3GTLB 4ZLTF 2NB0A 5M5WB 1ONLA 4IPHA 2E2DC 1UEBA 1EU4A 1ZYRD 4QIWB 3ZYYX 2PNRC 3GTMH 3FKIB 1WCMH 4JI1Q 4HMJA 3NE5B 4WFN3 1PYBA 1CA6A 1QJOA 4EX5A 3BDCA 1EQQA 3TEHB 1LT3D 4R1JA 4YWKA 4K2LA 1RF2D 2JE6I 3TS2A 1LUZA 3H0GB 3KDFB 4QL5A 1ZYRC 1TWHB 1SMYC 4BY1G 4RHRA 4F87A 4HIKA 5CV6A 3BS1A 3E0EA 4LFAQ 4A3GG 1LT6D 1PFSA 2K5DA 2JA5G 2BDNA 1YHBA 2JP1A 3A56A 3SK6A 3C46A 4DR6Q 2WV6D 4YWMA 1VQ8A 1SE4A 2QCPX 3R2IA 5DM63 3CCQA 4DN4M 1RIPA 1PXUA 5LMNW 1EFWA 1X65A 2E74C 1SLJA 5G3LF 3S24A 1EIYB 2XWBB 2GN5A 4C3IG 2IY5B 2VQFL 1A3TA 3QOJA 4BBSB 1IBML 3SDZA 4APVA 3BG3A 1Y69U 4DV3Q 4CHTB 2J4XA 1OXXK 4JV5Q 4DAYA 1B70B 4CKEA 3V96A 5IT9L 2YTXA 5EQ0A 4A3GH 4LAAA 1GJXA 4K5XA 2F0PA 1U5KA 4A3IH 4JPBW 5CV9A 3C2PA 3FKIG 3V2TA 1NCVA 1IL8A 1I50B 1LV9A 4A3JG 1DOLA 2EY1A 1T5EA 3NBHB 2J0TD 4TQUS 3Q24A 3HP3A 4JBWA 1N32L 2B2VA 5J1ZA 5IODA 2ICIA 2NN6G 5EPLA 3ULJA 1HUMA 1S5ED 3I4OA 2YTVA 3CF5A 4HIMA 2XGTA 3I91A 2ENBA 1NAPA 1I6HH 2UXBL 3K81C 1OXUA 2JA7H 3KFUA 1XMOQ 4UY8C 1PYSB 2LY7A 4F8MA 1Q86C 1HNZQ 1U4RA 5FLMG 3K59A 1M1KC 1VMCA 5EKIA 2BE5C 2JA7G 1VQOA 1WTXA 1Q46A 1TWFH 3TBIB 1PTOC 1EQRA 3OIPA 1PVOA 2C5CA 3PSIA 4OWTB 2F52A 4B3RQ 2KOLA 1Y8PB 4R4TA 2R92H 2IPKD 3MTSA 4LJZC 1AN8A 3AB9A 1EY8A 2JA6B 4H0LC 1QZHA 2WB1E 4YHHL 3MEHA 4L5RC 1G2TA 2IJ0A 2R3ZA 2RCFA 2E2HH 5IGFA 2B63G 3PO3G 2WIIB 4RCNA 1EOVA 4K0KQ 3I4NH 1XNQQ 3VR5A 1TWAH 3D0FA 3S1QB 5EPKA 3S1NB 1UNSA 5K5PA 3GP7A 3BZKA 3OMCA 4JI1L 4DR4L 1X3FA 2M9VA 3KLSX 1F9QA 1I6VC 3CC7A 2IT1A 2FXQA 3PV0A 2K33A 2ICEC 1P16A 1IBLL 2QDBA 1L1OC 1H9SB 5C4JB 3Q8DA 1JJCB 4BBRB 5FK9C 4JI0L 1CHPD 4YWLA 5C4ZA 5M5XB 3OHXC 4LF7L 4HMIA 1TWCH 2K50A 1X9NA 2PW5A 4LF7Q 1SYCA 2F0EA 1N32Q 3HEJA 3PUYA 3RNUA 4K14A 4P73A 1V9PA 3R3OA 1PZID 5EAYA 3Q23A 1T9HA 2NWGA 4BS9A 4NPSA 2R7ZG 3S1RH 1QZGA 5KNDA 4XDXA 2Z6BA 3T13A 3I55A 2PQEA 1EWCA 4UP9A 3W2DA 3GV3A 3HOZH 4YY3Q 2VB3X 2QILA 4HSPA 1XPOA 4K8JA 1JWMD 1EY6A 2BH8A 1NR2A 2AQ2B 5ELCA 2F0SA 1ENFA 2IWHA 3SHLA 2DJGC 1XMQQ 2B2YA 2A19A 2JA8B 2B63B 3PO3B 3NXWA 1PZKD 4XQNA 5IYBG 3HOUG 4X3SA 4OXPA 2WFWA 3T56B 4M1UB 2E75C 3NBHA 1R9TH 1C8CA 3A0JA 4POFA 3CMEA 1LTSD 4B3TL 3D4DA 5IT9E 1R4PB 3RR5A 3GTJH 3M4PA 4G7OC 5JEAH 2RVLA 2B2UC 1IBLQ 1Y1VG 2AUJD 4OO1G 1JJ2A 4B9XA 5M9OA 3SK8A 1KHIA 4A3IG 1G291 4BBRG 3MXUA 2NVXB 4A3DB 4FYDA 2HDMA 4OGQC 4UHVA 1Y8NB 1RDPD 5C0XJ 4A3MG 1SJED 3K57A 2B2WA 2MJ8A 4RHSA 1MKHA 1CKNB 2F0JA 4XT1B 4AIMA 2RQXA 4QGUA 1IKMA 5IGBA 1IYVA 4CJ2C 3HKZG 3MXNB 1R4QB 4A3FB 3G4SA 1JT8A 2NZHA 3ERQA 4G57A 4POGA 5CORA 1X3GA 2A6HD 3UE0A 2AKWB 3L3OC 3RZDH 4LF4Q 2RA4A 3HS0C 5ELDA 5I2XA 4X65Q 4IUQA 1HQRD 1X3PA 2NUCA 3P1HA 4ZQ3A 1LO5D 2F3WA 3IL8A 1WTVA 3H3VH 4YHHQ 3FPPA 4R8IA 2UXCQ 3CCLA 1I6HB 5J22A 4DUZQ 3OYYA 3M3YH 3UDXA 1LYLA 2JA6H 2AWOA 2QGQA 1KDAA 2C9OA 3P20A 4LNQA 2HCCA 5C0XH 1WTPA 1CSPA 1S5CD 4RGTA 2K75A 2I5LX 3D6CA 1EYDA 5DEHA 5I9PA 4A3IB 4N9PA 4FF1A 5CV4A 5IIFA 1Y14B 4A3DG 5CV7A 4DNTB 1PH4A 4OX9Q 2BOSA 5KIXA 2AWNA 5IWAQ 2L11A 3OMGA 1V1PA 2FMMA 4K5WA 5C3EH 3HKZB 3RD4A 1YNXA 3PO2G 5K36H 2HIXA 4YCUA 4C3HH 3CCJA 1NE3A 2JEAI 4CDDC 4AYBB 2K03A 5HGTA 1O7YA 1JORA 2O4XA 1IBKQ 4QMGA 1VCIA 1OTCA 4IPGA 2VUMG 3H91A 3C3LA 4PZ7A 3TDQA 1SN8A 2NVQH 1PRTF 2EJFC 1K3BC 3FRPB 3J80E 4Z9CB 1AE2A 3M85A 1LT4D 4GKJL 1BF4A 2N88A 3M7NA 1UWVA 2I46A 2JA9A 4JOIC 3CCMA 4JK1C 1HZAA 2QDLA 3DMUA 1LTGD 1KLUD 3H0GH 1SNDA 4DV7Q 4RMFA 1K0RA 4QIWE 1VQMA 1Q12A 2F0GA 2L55A 2ZT9C 3M4OB 3WOFA 5CV8A 3NWTA 4AH6A 5E7NA 3HRZC 1E3PA 2A68C 3NSWA 3CMAA 4DK3C 2DY8A 4C3JB 1D1KA 1CKNA 4KV6A 2OWOA 3SR1A 3BDLA 1BCPF 2HD3A 2Y0SE 1DD2A 2TMPA 2F0KA 4H44C 2EJGC 4O2DA 1YJNA 1VQFA 1IXRA 3TN2A 1CQFA 4QUCA 5COYA 3KJPA 1RL2A 1TWGH 2EY2A 3GTKH 2V1CC 1C9OA 1AE3A 2OEOA 3TQYA 1KAAA 1VQIA 3FVQA 2Q8TA 3BYYB 1EY0A 1L2FA 1PH7A 1U4LA 3OIQA 1X56A 4DA2A 4MZ9A 1DOKA 4YCVA 4DV4L 1HH2P 4A3JB 5CV5A 3OTOQ 2PPBC 1QOHA 3P75A 3VYSA 1I5FA 2RDFA 3GTPB 1KRSA 1AZQA 2JN4A 1STEA 1EEID 2VXWA 1MJCA 3KF6A 3I4LA 2EJMA 1Q8IA 4KKUA 3U4VA 4A3CH 2NVYB 3I8ZA 2YU9H 1N36L 1LT5D 5TSSA 2K04A 1GXDC 1DJRD 1YHAA 4HJ9A 2N78A 4NDXA 1HNXQ 2OQ0A 4DNIA 3SVMA 1ILPA 1Q90A 5BN3A 4A3BB 3A55A 2AQ1B 4XXEA 4A93G 2A6HC 2LFNA 2B2TA 4WJ3M 2XTIA 2KUMA 4IZ8A 4X66Q 5FLXL 1GUSA 1WFQA 4J6HA 2DY7A 4O1NA 1GD7A 2JA6G 5JVG3 4R8NA 2Z4HA 1IYUA 4BY1B 3VR4A 2PNHA 2E76C 2LS01 1UEAB 2MPMA 4U673 3K6OA 4DR7Q 3OWFA 5J39A 1XMQL 4LFCL 2Y0SB 3AMUA 3PUWA 4A3LH 4DUZL 2F0NA 2B8FA 3J81j 4AQYL 4AYBE 3I56A 3D31A 3SXHA 4C3IH 3SK5A 2E5LL 2O5JC 1STYA 1I4QA 1O7ZA 3NQTA 4U68A 4LUZA 1K28A 3J81c 4V0BA 4DV6Q 1EZ8A 4X3TA 3WWVA 4GKKQ 1O7LA 1C48A 3S14B 3PCOB 5KRUA 2JA5H 1NSNS 1SDFA 1I4HA 4OWWB 4FF3A 2NYZD 3I73A 5ELEA 1WD1A 5I9OA 3TP8A 3TZUA 3B6YA 4BA2I 4QQBX 4OO1H 1HCZA 1ZKOA 3GTOB 1LTTD 5CC4A 3M4YA 1WYDA 3MVVA 4BBRH 4KN7C 2A69C 1VQ5A 5LMNL 1GOZA 2F4VQ 1O7IA 3U9OA 1UAPA 2CVRA 1IKLA 4LF8Q 2UUCQ 2E8GA 1WCMG 1PMRA 3GD7A 3PUVA 5LMUL 2VUMH 1F9PA 1EIHA 4RGMA 3E9HA 1GUNA 2NTTA 1OXSC 3HOUH 1WI5A 1B53A 1CTMA 3S15H 1PRTC 1PHJA 4DR7L 1WTQA 4IUVA 3VR2A 4JI6L 4DV7L 1U4MA 2KEDA 4WJWA 2MGSA 4DR6L 3H6MA 3UDGA 3HOVB 1AEXA 1W6JA 2XSCA 2WB1B 4LFAL 5IGDA 3G6JB 1KLGD 2UXDL 2MQHA 5DLQE 2IX1A 2I5MX 4LMQD 2KJXA 5EKLA 1KD1C 3U50C 2OCEA 2F0UA 3ONAB 1FGBD 4JCVE 5GQOA 2B29A 5C44H 4B3MQ 4LF9L 3S2DH 1Z9FA 4ALPA 3J7ZC 1PH8A 3A8IE 3F2UA 2PI2A 3PF5A 2VB2X 1NR4A 3HOXH 4I7ZC 1TY2A 1LTAD 3UDFA 1YJ9A 3DWPA 3MZ5A 5IGEA 1C7YA 4IFDH 4WRDA 2VY3A 1AZPA 1HXYD 2MHVA 3MA2B 1STBA 1RCVD 1KQSA 1KAWA 3Q0AA 4UP8A 2FMCA 1FGUA 2SNSA 1K73C 1GHJA 3NWSA 5AJ3L 1FYCA 2PZWA 2K52A 1BKBA 2B63H 2GVBA 3NHHA 5KYLA 3TREA 1NNXA 3ER0A 4IFDG 4KHZA 2K1BA 2QF7A 1EWHA 1ENCA 1KC8C 3CQZH 1I50H 4NMZA 1L0YB 2B39A 2E2IH 4JI0Q 4JI5Q 4EQOA 3DHQA 4KK7A 3S9WA 4XQJA 3HOZB 5D3IB 5A2QL 4UAIA 2R93G 2XN9C 3S1MB 1ET6A 1GM5A 1DXMA 1EIFA 3MXPA 1XTDA 5J3BA 3KLRA 2I0QA 1SFOB 4GS3A 2FJ2A 3CU7A 1I3QH 2EPBA 4DR1Q 1YNNC 2OT2A 4FP5D 3RZOH 4YIJA 3KLWA 4DUYQ 4C3IB 2HIVA 2AUKA 2XNAC 3J7AV 1ASZA 1VQDA 4LK1C 1I94Q 1YJWA 4GNXA 4HEDA 5C5LA 1SYEA 3HOYB 2XRSD 3PUXA 4OELB 3RLFA 2QEJC 4K8IA 5IYCG 1X6OA 3K7UC 2YU9B 1QUQB 3EA6A 3C1EA 1IHZA 4IOAA 2F0OA 2RDGA 1J9OA 3I3CA 4FDBA 3K7AH 3CPFA 4IUPA 3NQIA 3DXJC 4J15A 1S3OA 2KCCA 1GUGA 1CT1D 1LTID 1D7QA 4HIOA 1VQNA 4PQXA 4PZ8A 4PMWA 4LFBL 4KKSA 2SNMA 4IPDA 3OSOA 2WAQG 2E2JB 4A3JH 3CCRA 1ICFB 3VR3A 1XNQL 4K5VA 1YHQA 1VMPA 4R4CA 1PH5A 4PMCA 1VQHA 1ENAA 3GQBA 4MTKA 5G3LD 3UI2A 4C1NI 2GVAA 1KIXA 1IBMQ 3KDFA 1FNVA 1EOTA 4IQZA 5C4HA 4FF4A 2TSSA 2EYHA 2PCFB 3FPUB 3S2HH 1I4GA 1JCKB 5JOBA 2ZXOA 2FFKB 3QIAA 2EY6A 4DV4Q 4GN5A 2BH2A 2G9HD 4JI7L 1O78A 1QG7A 3L9AX 1SJHD 2ZTCA 4QF4A 5BN4A 3CKIB 2EXZA 1B8AA 3BZDB 1STHA 1JOQA 1QUQA 1IYJB 5DNFA 1TKWB 3I4MB 4EVOA 1WOCA 1CSQA 2H1EA 1ILQA 2Q8RE 3QOLA 1A3VA 2A5HA 4N9TA 2ZTDA 1SNCA 4KHPL 1OXTA 4KLKA 1B3QA 1WVLA 2CQOA 1VQ6A 3ND8A 1VQAA 2OTJA 3KBGA 1L1OB 4QY7A 2D9UA 3JAMi 1HNZL 2EVBA 1EZ6A 2Z9HA 3GO5A 1KL9A 2WAQB 3BDOA 5AJ3Q 2Z4IA 4A3EH 2C35B 2A1AA 2PQAA 2VNUD 5E4WC 3G48A 1JMCA 2EYFA 4XT3B 1F9RA 3TSSA 1CKMA 4ME5A 4NP5A 3E5SA 1Q81C 2L5TA 3KBXA 1I4XA 2N3SA 1G91A 4I65A 3D4WA 2F0MA 5JJIA 3CCSA 4PMBA 2XWJB 1SNMA 5C3EB 3NBIA 2L15A 3DM3A 3K58A 2MO0A 2Q2TA 2K6AA 3QO2A 3KF8A 2IHFA 1RODA 3NEMA 2RHSB 1B3AA 3A8JE 4HIDA 3X3MA 2ZXPA 3VYRA 2B8GA 2L9HA 1MJEA 2UUAL 1JQYD 2XIWA 3MXNA 1PTOB 5CYUA 2K4KA 4JI5L 3S17H 4RAUC 4GN3B 3F2DA 4B3SL 5JPNC 1SBBB 5E1FA 3GTKB 2R61A 3SE0A 2F3IA 2BCOA 4KJNA 3H94A 3OW7A 5IP9G 1HFGA 1AFPA 4BY7G 3TP5A 1FJGQ 2H4OA 3E3XA 4CKBA 2JSOA 2X6LA 1E0BA 5FO9B 4RKLA 4IUTA 4C3JG 4MNOA 1SAPA 2F4VL 4A3LG 1Y1VB 1PZJD 1Q7YC 3WDNA 3GTGB 3FEWX 1SROA 5M3FG 1YIJA 2HHHQ 4ZKCB 3EVQA 3M4OH 2EIFA 3EQLC 1TR5A 5I2YA 4HSVA 4OIJA 3L2PA 1BR9A 3H09A 4TRDA 3S17B 4DR2Q 4RA8A 2PW7A 2AHOB 4RFBA 1E1OA 3J81E 3KF8B 4KKTA 2ZJQA 3CCEA 3F2CA 4MHEA 1V43A 2F0TA 1EY4A 2JEBI 4JV5L 1X32A 4OWXB 2E2JH 1BOSA 3M9BA 1ET9A 1LTRD 2NVQB 2K5HA 1SRUA 2ZJPA 4PG3A 5IYBH 2SEBD 4GKKL 2Q2UA 1LM0A 1X55A 2L4NA 1YZ6A 5KYIA 3KOJA 3STBD 1R9TB 2AQ3B 2ZM6L 1HA6A 4JBMA 3RLNA 4JBJA 1OO9B 1EQVA 1MHWC 3T1YQ 2CWAA 4A3BG 4YY3L 3F8TA 1QILA 3HOZG 3BU2A 1K8MA 1PH1A 4L6TB 4Q0FA 3G71A 5C4XH 1TIID 4X62L 4A3DH 4A3EB 3UE1A 1AP0A 3EN2A 3VA7A 4X3KA 2Z0SA 3AQQA 2AMCB 5JPMC 4DV2Q 3W5OA 4B08A 1ESRA 3S1RB 1ASYA 1EYCA 4NKLA 1MSGA 2VS1A 1SYGA 3URYA 5I6YA 4DR2L 1RTOA 4X3UA 2DGYA 1TT2A 5M5YB 1BDOA 3MFGA 1EUJA 4CJ1B 2DN8A 5LMUQ 4IOCA 4A76A 4JYAQ 3CP0A 1EL0A 5IP7G 4DV0L 3I4MH 4LF5Q 1MIUA 1IW7C 2Y0SG 2UXBQ 4Y7NB 1K8AC 4L63B 1JE4A 5CMDA 5BR8Q 3TS0A 1DOMA 2SOBA 1XPUA 5C4JH 4HTHA 1E2VA 1JB3A 2PMZB 1X54A 4O0AA 4DAMA 1E1TA 4JOIA 2Z6KA 5FOBB 3S2HB 1I4PA 1UE5A 2PI2E 5IP9H 5EBDA 5C3WA 1HZCA 4XYOA 3K7AB 1PRTB 4LFBQ 5DAUA 1HZBA 4ZYSA 3V05A 3H0GG 2MUYA 4B3SQ 1FNWA 4LWCA 3F1ZA 1Z6HA 3H3VI 5KNCA 4XYQA 3BZCA 3A7AB 4ABNA 4FXDA 1LTLA 2O5IC 4P71A 3CC2A 1DYQA 1Y1WB 4X64L 4A3MH 1QCBD 3RZOB 3E9IA 2R7ZB 3KF6B 5LHY1 3NTKA 1VQLA 3VYUA 2G9DA 3IAYA 1J6QA 3Q22A 1PFBA 2RF4A 4LF8L 5C5MA 1BQQT 1SR3A 4DR5Q 1B7YB 3DLLA 3T16A 4R4QA 2OF1A 1MI2A 2NBFA 1HJPA 1Q3LA 4WORA 3A7LA 4P72A 4A4IA 3S1NH 3S1QH 1SNPA 3A8KE 1HA5A 2ATWA 2A6EC 4CDEC 3GDEA 3NPPA 1X3QA 1IL2A 4TVAB 3BVMA 1S40A 4KHVA 3JAML 3VR6A 4DK1A 4RGNA 4B3RL 1HR0Q 4OHJA 1TS4A 5GAGC 4FO2A 2EYMA 2UXCL 4DKAC 5ELBA 2ASBA 2BA1A 3G7LA 1FD7D 4NXML 4LW1A 3ULPA 1HNWQ 2RSNA 2QEXA 3O13A 4DV0Q 1WTOA 1PTOF 5C3XA 2CFMA 2F0VA 5FKAC 3R93A 5HGQA 4GLXA 4KJOA 4JW0A 1JC7A 5EJWA 2A8VA 3BJUA 1I4RA 4DV5L 1C4QA 1VQGA 1Z7TA 5KEEA 2JA8H 4A3GB 3S2DB 1H9JA 3HG9A 4DK6C 2N55A 1G51A 4FNFA 2WAQE 1RHPA 3MFYA 4RCOA 1TY0A 4DV1Q 3HKSA 1H9RA 1ICWA 1HHVA 1EIGA 3EROA 3LNNA 1I3QB 5ELOA 4DAPA 4C2MB 4B3TQ 4LF6L 1ZEQX 1GVPA 1WJJA 3T1YL 4JI3Q 2FINB 1E7ZA 3MWYW 1F2LA 3S1MH 3CRKC 1QNKA 2JA8G 2D2CC 2WACA 2ZJRA 2EQSA 2OQKA 4X64Q 1CZGA 3HOUB 1A62A 2MP1A 4E6IA 3AFQA 1PLFA 2E2HB 3NELA 1TS5A 4KN4C 3J80i 4L8JA 1B1ZA 3P7JA 4GNXC 5A2QE 3RN5A 4G7ZC 4L5SA 4H7BA 1JWSD 5JEAG 1KDBA 2D5DA 1JOOA 1F2MA 4RKBA 1HNXL 2R92G 4H13C 4LF5L 2EDGA 1LACA 1ESFA 3T1HL 4IFDJ 4A3MB 4H02A 1D2BA 3HOYH 4OO1I 2A69D 3U9SA 3S15B 5T1IA 1TWFB 1NUCA 2KECA 1GHKA 1GUWA 1SEBD 2IW3A 4A3BH 1K0SA 4J1MA 3I2ZA 2F0WA 4ZAIA 4OEMB 2EOTA 1GUTA 2LXKA 3ERSX 2L0CA 1IW7D 1EWIA 2A68D 4A3CG 2NVYH 1LTBD 1N34L 2VUMB 1Q1EA 4IUNA 2CH4W 2RDHA 4JI8L 4RWSC 5IT9c 3JAME 1PRTD 4ZKBB 1VQKA 1EY9A 2LSSA 1HRJA 5JAVA 3AU7A 1S5FD 1SYDA 4C1NK 3W3AA 3OTOL 1OXVA 1A2UA 1TU2B 3ND9A 1N8RC 3CRLC 3CD6A 1PFMA 1YI2A 4KD4A 2E2IB 1WCMB 1UE7A 3GTMB 3S14H 4I7AA 1A0IA 1TXYA 4TSSA 2HDLA 3GTLH 2ZM6Q 2D62A 1D5XC 4ZCKA 1B4OA 3DEOA 3HGBA 1M8AA 1BCPC 1CQVA 1L1OA 2WKDA 3IFDA 4IALA 3W1GA 1CZWA 2M00A 3PIO3 1F2YA 4G7HC 5AFWA 3QR8A 3BVZA 2A73B 2NTSA 3I4NG 1SMXA 4Y7NH 2ES2A 3FMCA 2DUDA 5IP7H 1FR3A 2NZOA 1DCZA 1XMOL 1MSHA 3RLOA 4JI4Q 1KNEA 2Z6KC 4RH6A 5C44G 3FDTA 4XTCS 3PMFA 2Q2HA 2JXMB 1HNWL 1BBXC 1VQ4A 4N8X1 2YTYA 2KCNA 1VS0A 4DR5L 3J7YW 4ME3A 3NENA 1STAA 4K6LA 4GLAC 5GADC 1Y1WH 5CBAE 2BA0A 1CA5A 1N9WA 4OX9L 1HR0W 1RD9D 5EPJA 2EYPA 3NTHA 3CC4A 5IWAL 3R8BA 2BDOA 5LL6X 4DR4Q 2UU9Q 1S5BD 2HT1A 5EKKA 2DJFC 1L0XB 4NXNQ 1H95A 4FF2A 1Q8KA 2B2YC 1B44D 2KA7A 1CK1A 5IE8A 1QNUA 1W3SA 1EYGA 5K36G 3D8GA 5IGCA 4DU9A 5C3EG 1A6XA 1AH9A 4QCLA 2R6GA 2VZAA 3HOWB 1VF7A 2R7ZH 5D65A 4IPCA 1W2BA 2NVTH 1VQEA 4K0KL 3AEVA 5HY6A 3S16H 3STBC 1T5XD 3ICEA 1V1OA 4R9WA 3FKIH 1S5DD 2KVMA 5D14A 2I07B 5D3DA 1VQ9A 4GKJQ 1NMGA 3OPOA 2K7VA 3NK9A 2MNAA 1MBYA 1BNZA 2UUCL 2UUAQ 1K83H 1JWUD 4B9WA 4K6DA 4DFAA 4M8AA 1KABA 3PIOA 2KEEA 2KHIA 3PO2B 5M3FH 1A2TA 2Q2IA 1JR0D 3GTGH 3M7GA 2R7DA 3N6RA 1N36Q 1LABA 1YBYA 5T1GA 3WOEA 3GTQH 1SYBA 3VDYA 1H9MA 3GV6A 1STGA 3GTPH 3NP8A 5I4DA 1G2SA 4PZ6A 5L37A 1EFID 2XVSA 4YCWA 3CPWA 4DV2L 1QWYA 4BY7H 4BWGB 3CHBD 5BN5A 3Q6SA 2EYLA 3RUZA 2F0IA 1M4VA 1PDQA 3K8AA 4HCSA 1WD0A 3TRZA 3RZDB 1P8LA 3KJOA 5M5YH 5GROA 3BYTB 4K2KA 5LL6S 3CCVA 5JJLA 5GAEC 1XJVA 1PTOH 2WINB 3ULLA 3D4RA 3A54A 2GA4B 4AQYQ 4BXXG 1KDCA 5CBEE 1QVFA 3K5LA 3PF4A 1WTHA 2K01A 4DNRB 1MD2D 2UUBL 2CWPA 3I70A 2ZTEA 3EBEA 1CUKA 4LUVA 3K5NA 3LGJA 5C4XG 3NTIA 4P74A 2VW9A 1VQ7A 1C0AA 1NMFA 3EFXD 3RMHA 3SK4A 2VQFQ 2L1BA 3J7AF 3N52A 3ITPA 2EY5A 4LF6Q 3H15A 5H1SE 3W1BA 1K8OA 4LUOA 2EZVA 3FHWA 3C1FA 5IYDH 3QB3A 4JI4L 3MEFA 1QB5D 1RTNA 1A3UA 3T53B 4NW2A 3SEBA 4GOPC 3M4QA 2KHJA 1XNRL 2X69A 3VYTA 2NN6I 2RSOA 2VQEQ 4GOPB 1XNRQ 1A8VA 2B2UA 1IZ6A 2H5XA 1RKNA 1PH3A 1NTGA 1KTKA 1TWGB 1A15A 4Q5VA 4NXNL 4N8FA 1JOKA 5FJ8H 4LFCQ 1PFNA 4JI2Q 1J8IA 5CGKA 1PV4A 2RKSA 2N8NA 4MN3A 1TS3A 5BR8L 4A75A 1GO3E 4IJLA 2EYJA 4O42A 3K0XA 4MTNA 1V1QA 1STNA 4ILWA 4DV5Q 4EQPA 1U4PA 3EJIA 5EGTA 4A93B 2MO1A 4PNYA 4XQQA 4WJ4A 2EXDA 2JK8A 1PA6A 2E5LQ 4DPGA 2CW0C 2PZTA 2F4IA 3MHBA 1AW7A 2KCMA 5FJ8G 1E2ZA 2I5HA 4OONA 2QKIC 3PO3H 5KNBA 1N33Q 3J80c 1SMYD 1D5ZC 4KMUC 3T4AC 1F77A 1HQMC 3U58A 1H9KA 3K5MA 1V1PB 1D6EC 1K3RA 5E4XA 2WB1G 1J5EL 3FP9A 1L0WA 2YYZA 5IYDG 2RCNA 1F2ZA 4DV1L 2F0HA 1EQTA 1JB7A 2HQLA 5IYCH 2CH4A 4C2MH 3GTJB 2K5WA 4C3HG 2QW7A 1G6PA 2RHQB 4ZK9B 1UUPA 1D8LA 1VQJA 2CQAA 4JG2A 2K28A 2B2TC 1TWCB 1HTPA 3JC66 2Z1CA 3G6EA 4FXGC 5M5XH 5EBCA 2Q8IB 4IFDI 1TS2A 4RG1A 4JI2L 4KY7A 4ODGA 2F0QA 3I72A 4IO9A 4QUFA 2JA7B 2NVXH 3QWNA 5JVH3 5FLXc 2DNCA 1D1IA 1SFOH 1H9SA 1SNQA 3CCUA 2G5DA 3T1HQ 1PH2A 1BBUA 2N49A 4JI7Q 3K5OA 1Q82C 1EYAA 4BXXH 4OIKA 1FJGL 1CFMA 2FHTA 5C0XG 4GZYC 1SE8A 1NY4A 4DXGA 3EIVA 3HOXB 3A74A 4F7XA 2F03A 2Z8LA 3M3YB 4NB3A 3L0OA 4L5QA 2QA4A 4ZRZA 4A3KG 2K5QA 2PYKA 1BXTA 3J81L 1WTRA 5ELFA 3K80C 2R7FA 4EGVA 2LKVA 2PZUA 3LX0A 3I7FA 4FVMA 3R2TA 3KUPA 3NUCA 2BE5D 5M3MB 1YITA 1D5MC 1S4ZA 2D0OA 4X66L 4JI3L 3K0YA 1NBWA 5E3FA 3J80L 3J81i 5FO8B 3DUZA 3I4NB 4A3FH 3ZJYC 4BBSG 1S72A 2UUBQ 2CCZA 1XX8A 4CKCA 1BUVT 5I6WA 4UDUC 3TP6A 1BVSA 4X65L 4HJ8A 5C44B 5JEAJ 5DM73 1QVCA 2IL8A 3QJYA 3PGZA 3AYHB 4F88A 3LWUA 1DZ1A 3A5ZB 1XTCD 3E0JA 1YVCA 1SXTA 5GAHC 4C56C 5HURA 2WKCA 1NJIC 5CR3A 3HOVH 1EY7A 1W6KA 3TZDA 1HR0L 2L12A 3J7A5 2R92B 5M3MH 3KLSA 4R4OA 4KHPQ 3X3NA 4B3ML 4LF9Q 2KHSA 4DR1L 2LXJA 2O2LD 1CI3M 4A93H 2M2LA 1YNND 4CDFC 1B50A 2HHHL 4JYAL 2ZXRA 5FLXE 2JA5B 2P5ZX 4IUUA 1EU3A 1F9SA 4R4IA 1I94L 4NXMQ 4CGYB 1PYWD 4JI8Q 1VQPA 1V8QA 1HTLD 1B9MA 2HCIA 5M3MG 4GLVB 1YNJD 3HOWG 4DV3L 4MIUA 3PUZA 4HJ7A 2A6ED 3L7ZC 4UPAA 1Y1WG 3H3VC
chains in the Genus database with same CATH topology
1B9NA 3DEPA 4S3SA 5C0XI 1HFNA 1DM0B 1CHQD 2OXPA 4KI0A 2CW0D 5NUCA 2IX0A 3IFTA 2KQ3A 5C4XB 3CQZB 4CJ0B 4EQNA 4ID6A 4CBVA 2F0DA 4KY5A 4KY6A 1II3A 3D6WA 5A35A 2V4DA 4DK0A 1G8ZD 1ML0D 4V190 3MAQA 4IURA 4DAVA 4DF7A 4HAEA 1SYFA 1TWAB 4DXFA 4HCEA 1U9RA 1O80A 3MC0B 2X6GA 1XXGA 2CHBD 2J7ZA 1VF5C 3TP7A 1EEFD 2NZ1D 4J8QA 3QG1A 2R93B 5C6AA 3MXGA 1TQOA 1QE6A 2LMCB 3DM1A 1SNOA 4XIGS 1KNAA 3BVGA 2A74C 1E2WA 3HZXA 1SSOA 2PO4A 2JYOA 2DNEA 1XYIA 1EY5A 5JJZA 1Q1BA 2ID0A 2K32A 2K05A 3I90A 2NN6H 2IX3A 5F2DA 1K83B 4ULLA 1BCPB 2WP8J 5IOCA 3LWEA 2F3VA 1SE2A 1LLRD 5FO7B 2NVTB 3KK7A 1SE3A 1JICA 4BA1I 2SDFA 4ZUIA 5KGUA 4HN7A 3D3RA 3E6ZX 1Z47A 1HUNA 2F0LA 4QB4A 2HQEA 1PTOD 1YNJC 4FXKC 1B2TA 4TKOB 4RGOS 1RJTA 4IN3A 4HR7B 4G4KA 2HUGA 2EE1A 4OL7A 3VA5A 5IGGA 1BCPD 1TVXA 3TMEA 2F1MA 3DWQA 1VDZA 1FNUA 1MGSA 4PV1C 1XWEA 1WTWA 4A3KB 2F0FA 2B2WC 3OOCA 1DONA 2RBMA 3IKJA 1ZXTA 4KTAA 4BY7B 1G6ZA 1GUOA 2B2VC 3OWEB 1HPCA 5ISRA 4KD3A 3S16B 2XRQD 1Y8OB 3GTQB 1BO0A 3T51B 3PIP3 4C3HB 3DWAA 5M3FB 4DGZA 1CM9A 2EYOA 4ZUJA 4P2CB 3GTLB 4ZLTF 2NB0A 5M5WB 1ONLA 2E2DC 1EU4A 1ZYRD 4QIWB 3ZYYX 2PNRC 3FKIB 4HMJA 3NE5B 4WFN3 1CA6A 1QJOA 3BDCA 1LT3D 4K2LA 1RF2D 2JE6I 3H0GB 1ZYRC 1TWHB 1SMYC 4RHRA 4F87A 5CV6A 3BS1A 1LT6D 2K5DA 2BDNA 2JP1A 3A56A 3SK6A 3C46A 2WV6D 1SE4A 2QCPX 3R2IA 5DM63 4DN4M 1PXUA 2E74C 5G3LF 2XWBB 4C3IG 1A3TA 3QOJA 4BBSB 3SDZA 3BG3A 1Y69U 4CHTB 2J4XA 1OXXK 4DAYA 4CKEA 3V96A 5IT9L 5EQ0A 4LAAA 1GJXA 4K5XA 2F0PA 5CV9A 3C2PA 3V2TA 1NCVA 1IL8A 1I50B 1LV9A 1DOLA 2EY1A 1T5EA 2J0TD 4TQUS 3Q24A 3HP3A 4JBWA 2B2VA 5J1ZA 5IODA 2ICIA 2NN6G 5EPLA 1HUMA 1S5ED 3I91A 2ENBA 1NAPA 1OXUA 2LY7A 4F8MA 1U4RA 3K59A 1VMCA 5EKIA 2BE5C 1WTXA 3TBIB 1PTOC 3OIPA 2C5CA 2KOLA 1Y8PB 2IPKD 3MTSA 4LJZC 1AN8A 3AB9A 1EY8A 2JA6B 4H0LC 3MEHA 1G2TA 2IJ0A 2R3ZA 5IGFA 2WIIB 4RCNA 3VR5A 3S1QB 3S1NB 5EPKA 1UNSA 5K5PA 3GP7A 3OMCA 2M9VA 1F9QA 1I6VC 3KLSX 2IT1A 3PV0A 2K33A 2ICEC 2QDBA 1H9SB 5C4JB 4BBRB 5FK9C 1CHPD 5C4ZA 5M5XB 3OHXC 4HMIA 2PW5A 1SYCA 2F0EA 3HEJA 3PUYA 4K14A 3R3OA 1PZID 3Q23A 2NWGA 4BS9A 5KNDA 4XDXA 3T13A 2PQEA 1EWCA 3W2DA 3GV3A 2VB3X 2QILA 4HSPA 4K8JA 1JWMD 1EY6A 1NR2A 2AQ2B 5ELCA 2F0SA 1ENFA 2IWHA 3SHLA 2B2YA 2JA8B 2B63B 3PO3B 3NXWA 1PZKD 4XQNA 4X3SA 3T56B 4M1UB 2E75C 3NBHA 1C8CA 1LTSD 3D4DA 5IT9E 1R4PB 4G7OC 5JEAH 2RVLA 2B2UC 2AUJD 4OO1G 4B9XA 5M9OA 3SK8A 1G291 3MXUA 2NVXB 4A3DB 4FYDA 2HDMA 4OGQC 1Y8NB 1RDPD 5C0XJ 1SJED 3K57A 2B2WA 2MJ8A 4RHSA 1IKMA 2F0JA 4XT1B 2RQXA 5IGBA 1IYVA 4CJ2C 1R4QB 4A3FB 3ERQA 4G57A 5CORA 2A6HD 3L3OC 2RA4A 3HS0C 5ELDA 5I2XA 4IUQA 1HQRD 1X3PA 2NUCA 3P1HA 4ZQ3A 1LO5D 2F3WA 3IL8A 1WTVA 3FPPA 4R8IA 1I6HB 5J22A 2AWOA 1KDAA 2C9OA 3P20A 2HCCA 5C0XH 1WTPA 1S5CD 4RGTA 3D6CA 1EYDA 5DEHA 5I9PA 4A3IB 4N9PA 4FF1A 5CV4A 5IIFA 5CV7A 4DNTB 2BOSA 5KIXA 2AWNA 2L11A 3OMGA 1V1PA 2FMMA 4K5WA 3HKZB 3RD4A 5K36H 2JEAI 4AYBB 2K03A 5HGTA 1O7YA 1JORA 2O4XA 4QMGA 1VCIA 3H91A 3C3LA 3TDQA 1PRTF 2EJFC 3FRPB 3J80E 4Z9CB 3M85A 1LT4D 1BF4A 2N88A 3M7NA 2I46A 4JK1C 3DMUA 1LTGD 1KLUD 1SNDA 1Q12A 2F0GA 2L55A 2ZT9C 3M4OB 3WOFA 5CV8A 3NWTA 3HRZC 2A68C 3NSWA 2DY8A 4C3JB 1D1KA 4KV6A 3SR1A 3BDLA 1BCPF 1DD2A 2TMPA 2F0KA 4H44C 2EJGC 3TN2A 1CQFA 4QUCA 5COYA 2EY2A 2OEOA 1KAAA 3FVQA 2Q8TA 3BYYB 1EY0A 1U4LA 3OIQA 4DA2A 1DOKA 4A3JB 5CV5A 2PPBC 1QOHA 3P75A 3VYSA 2RDFA 3GTPB 1AZQA 1STEA 1EEID 2VXWA 3I4LA 2EJMA 1Q8IA 4KKUA 2NVYB 3I8ZA 1LT5D 5TSSA 2K04A 1GXDC 1DJRD 4NDXA 3SVMA 1ILPA 1Q90A 5BN3A 4A3BB 3A55A 2AQ1B 4XXEA 2A6HC 2LFNA 2B2TA 2KUMA 4IZ8A 5FLXL 1GUSA 4J6HA 2DY7A 4O1NA 5JVG3 4R8NA 2Z4HA 1IYUA 4BY1B 3VR4A 2E76C 2LS01 1UEAB 2MPMA 4U673 3K6OA 3OWFA 5J39A 3AMUA 2Y0SB 3PUWA 2F0NA 2B8FA 3D31A 3SXHA 3SK5A 2O5JC 1STYA 1I4QA 1O7ZA 3NQTA 4U68A 4V0BA 1EZ8A 4X3TA 1O7LA 1C48A 3S14B 5KRUA 1NSNS 4FF3A 1SDFA 1I4HA 2NYZD 3I73A 5ELEA 1WD1A 5I9OA 3TP8A 3TZUA 4BA2I 4OO1H 1HCZA 1ZKOA 3GTOB 1LTTD 5CC4A 3M4YA 3MVVA 4KN7C 2A69C 1GOZA 3U9OA 1UAPA 2CVRA 1IKLA 1PMRA 3GD7A 3PUVA 1F9PA 1EIHA 4RGMA 1GUNA 2NTTA 1OXSC 1B53A 1CTMA 1PRTC 1WTQA 4IUVA 3VR2A 1U4MA 2KEDA 4WJWA 2MGSA 3H6MA 3HOVB 1AEXA 1W6JA 2XSCA 2WB1B 5IGDA 3G6JB 1KLGD 2IX1A 4LMQD 5EKLA 2KJXA 2F0UA 3ONAB 1FGBD 3A8IE 3F2UA 2VB2X 1NR4A 4I7ZC 1TY2A 1LTAD 3DWPA 5IGEA 3MZ5A 4IFDH 4WRDA 1AZPA 1HXYD 2MHVA 3MA2B 1STBA 1RCVD 3Q0AA 2FMCA 2SNSA 1GHJA 3NWSA 1FYCA 2PZWA 3NHHA 5KYLA 4IFDG 4KHZA 2K1BA 2QF7A 1EWHA 1ENCA 4NMZA 1L0YB 2B39A 4EQOA 3DHQA 4KK7A 3S9WA 4XQJA 3HOZB 5D3IB 5A2QL 4UAIA 2XN9C 3S1MB 1ET6A 1DXMA 3MXPA 3KLRA 1SFOB 2FJ2A 3CU7A 2EPBA 1YNNC 2OT2A 4FP5D 4YIJA 4C3IB 2AUKA 2XNAC 3J7AV 4LK1C 4HEDA 5C5LA 1SYEA 3HOYB 2XRSD 3PUXA 3RLFA 2QEJC 4K8IA 2YU9B 3EA6A 3C1EA 1IHZA 2F0OA 2RDGA 1J9OA 3I3CA 4IUPA 3NQIA 3DXJC 2KCCA 1GUGA 1CT1D 1LTID 4PQXA 4PMWA 4KKSA 2SNMA 3OSOA 2E2JB 3VR3A 4K5VA 1VMPA 4PMCA 1ENAA 3GQBA 5G3LD 3UI2A 4C1NI 1FNVA 1EOTA 4IQZA 5C4HA 4FF4A 2TSSA 2EYHA 2PCFB 3FPUB 1I4GA 1JCKB 5JOBA 2ZXOA 2FFKB 3QIAA 2EY6A 2G9HD 1O78A 1QG7A 3L9AX 1SJHD 4QF4A 5BN4A 3CKIB 2EXZA 3BZDB 1STHA 1JOQA 5DNFA 3I4MB 1TKWB 4EVOA 2H1EA 1ILQA 2Q8RE 3QOLA 1A3VA 2A5HA 4N9TA 1SNCA 1OXTA 1WVLA 3ND8A 3KBGA 2D9UA 2EVBA 1EZ6A 3GO5A 2WAQB 3BDOA 2Z4IA 2VNUD 5E4WC 2EYFA 4XT3B 1F9RA 3TSSA 4ME5A 4NP5A 3E5SA 2L5TA 3KBXA 1I4XA 1G91A 4I65A 3D4WA 2F0MA 4PMBA 2XWJB 1SNMA 5C3EB 3NBIA 3K58A 2K6AA 3QO2A 3KF8A 1RODA 1B3AA 3A8JE 3X3MA 2ZXPA 3VYRA 2B8GA 2L9HA 1JQYD 2XIWA 3MXNA 1PTOB 5CYUA 4RAUC 5JPNC 1SBBB 5E1FA 3GTKB 2R61A 3SE0A 2BCOA 4KJNA 3H94A 3OW7A 1HFGA 1AFPA 3TP5A 2H4OA 4CKBA 2JSOA 2X6LA 1E0BA 5FO9B 4RKLA 4IUTA 4C3JG 1SAPA 1Y1VB 1PZJD 3WDNA 3GTGB 3FEWX 4ZKCB 3EVQA 3EQLC 1TR5A 5I2YA 4HSVA 4OIJA 1BR9A 3H09A 4TRDA 3S17B 4RA8A 2PW7A 4RFBA 3J81E 4KKTA 4MHEA 1V43A 2F0TA 1EY4A 2JEBI 1X32A 1BOSA 1ET9A 1LTRD 2NVQB 2SEBD 2L4NA 5KYIA 1R9TB 1HA6A 2AQ3B 1OO9B 1EQVA 1QILA 1K8MA 4L6TB 4Q0FA 1TIID 4A3EB 1AP0A 3VA7A 4X3KA 5JPMC 4B08A 1ESRA 3S1RB 1EYCA 4NKLA 1MSGA 5I6YA 1SYGA 3URYA 1RTOA 4X3UA 1TT2A 5M5YB 1BDOA 3MFGA 4CJ1B 2DN8A 1EL0A 1IW7C 4Y7NB 4L63B 1JE4A 5CMDA 1DOMA 2SOBA 4HTHA 1E2VA 1JB3A 2PMZB 5FOBB 3S2HB 1I4PA 5EBDA 5C3WA 4XYOA 3K7AB 1PRTB 5DAUA 4ZYSA 3V05A 2MUYA 1FNWA 1Z6HA 5KNCA 4XYQA 3A7AB 4ABNA 4FXDA 2O5IC 1DYQA 1Y1WB 1QCBD 3RZOB 2R7ZB 5LHY1 3NTKA 3VYUA 3IAYA 2G9DA 3Q22A 1PFBA 5C5MA 1BQQT 3T16A 2OF1A 1MI2A 2NBFA 1Q3LA 4WORA 3A7LA 1SNPA 3A8KE 1HA5A 2A6EC 3NPPA 1X3QA 3BVMA 4KHVA 3JAML 3VR6A 4DK1A 4RGNA 4OHJA 1TS4A 4FO2A 2EYMA 5ELBA 2BA1A 3G7LA 1FD7D 2RSNA 3O13A 1WTOA 1PTOF 5C3XA 2F0VA 5FKAC 3R93A 4KJOA 1JC7A 5EJWA 1I4RA 1C4QA 1Z7TA 5KEEA 4A3GB 3S2DB 1H9JA 3HG9A 2N55A 4FNFA 1RHPA 3MFYA 4RCOA 1TY0A 1H9RA 1ICWA 1HHVA 1EIGA 3EROA 3LNNA 1I3QB 4DAPA 4C2MB 1ZEQX 2FINB 3MWYW 1F2LA 3CRKC 1QNKA 2D2CC 2WACA 1CZGA 3HOUB 2MP1A 4E6IA 1PLFA 2E2HB 1TS5A 4KN4C 4L8JA 1B1ZA 3P7JA 5A2QE 4G7ZC 4H7BA 1JWSD 5JEAG 1KDBA 2D5DA 1JOOA 1F2MA 4RKBA 4H13C 2EDGA 1LACA 1ESFA 4IFDJ 4A3MB 1D2BA 4OO1I 2A69D 3U9SA 3S15B 5T1IA 1TWFB 1NUCA 2KECA 1GHKA 1GUWA 1SEBD 2IW3A 4J1MA 4ZAIA 2F0WA 2EOTA 1GUTA 2L0CA 1IW7D 2A68D 1LTBD 2VUMB 1Q1EA 4IUNA 2RDHA 3JAME 4RWSC 1PRTD 4ZKBB 1EY9A 1HRJA 5JAVA 3AU7A 1S5FD 1SYDA 4C1NK 3W3AA 1OXVA 1A2UA 1TU2B 3ND9A 3CRLC 1PFMA 4KD4A 2E2IB 1WCMB 3GTMB 4TSSA 2HDLA 2D62A 1D5XC 1B4OA 3DEOA 3HGBA 1M8AA 1BCPC 1CQVA 2WKDA 3IFDA 4IALA 1CZWA 2M00A 3PIO3 1F2YA 4G7HC 5AFWA 3BVZA 2A73B 2NTSA 3FMCA 1FR3A 1DCZA 1MSHA 1KNEA 4RH6A 3FDTA 4XTCS 3PMFA 2JXMB 1BBXC 2KCNA 3J7YW 1STAA 4K6LA 5CBAE 2BA0A 1CA5A 1RD9D 5EPJA 2EYPA 3NTHA 3R8BA 2BDOA 5LL6X 1S5BD 5EKKA 1L0XB 4FF2A 2B2YC 1B44D 2KA7A 1CK1A 1QNUA 5K36G 3D8GA 5IGCA 4DU9A 1A6XA 4QCLA 2R6GA 3HOWB 1VF7A 5D65A 1T5XD 1V1OA 4R9WA 1S5DD 2KVMA 5D14A 2I07B 5D3DA 3OPOA 2K7VA 3NK9A 1MBYA 1BNZA 1JWUD 4B9WA 4K6DA 4DFAA 4M8AA 1KABA 2KEEA 3PO2B 1A2TA 1JR0D 3M7GA 3N6RA 1LABA 5T1GA 3WOEA 1SYBA 1H9MA 3GV6A 1STGA 3NP8A 5I4DA 1G2SA 1EFID 2XVSA 1QWYA 4BWGB 3CHBD 5BN5A 3Q6SA 2EYLA 3RUZA 2F0IA 1M4VA 1PDQA 4HCSA 1WD0A 3RZDB 3BYTB 4K2KA 5LL6S 1PTOH 2WINB 3D4RA 3A54A 2GA4B 1KDCA 5CBEE 3K5LA 2K01A 4DNRB 1MD2D 3I70A 3K5NA 3NTIA 3SK4A 3EFXD 3RMHA 2L1BA 3J7AF 3N52A 3ITPA 2EY5A 1K8OA 2EZVA 3C1FA 3QB3A 1QB5D 1RTNA 1A3UA 3T53B 4NW2A 3SEBA 2X69A 3VYTA 2NN6I 2RSOA 2B2UA 1RKNA 1KTKA 1TWGB 1A15A 4Q5VA 1JOKA 1PFNA 1J8IA 5CGKA 2RKSA 4MN3A 1TS3A 2EYJA 4O42A 1STNA 4ILWA 4EQPA 1U4PA 3EJIA 5EGTA 4A93B 4PNYA 4XQQA 2CW0C 2PZTA 2F4IA 3MHBA 1AW7A 1E2ZA 2QKIC 5KNBA 1SMYD 1D5ZC 4KMUC 3T4AC 1F77A 1HQMC 1H9KA 3K5MA 1V1PB 1D6EC 5E4XA 2YYZA 1F2ZA 2F0HA 1EQTA 3GTJB 2K5WA 4C3HG 4ZK9B 1UUPA 2CQAA 2K28A 2B2TC 1TWCB 1HTPA 2Z1CA 4FXGC 5EBCA 2Q8IB 4IFDI 1TS2A 4KY7A 4ODGA 2F0QA 3I72A 4QUFA 2JA7B 3QWNA 5JVH3 2DNCA 1D1IA 1H9SA 1SNQA 3K5OA 1EYAA 4OIKA 1CFMA 2FHTA 5C0XG 4GZYC 4DXGA 3HOXB 4F7XA 2F03A 2Z8LA 3M3YB 4ZRZA 2K5QA 2PYKA 1BXTA 3J81L 1WTRA 5ELFA 4EGVA 2LKVA 2PZUA 3LX0A 4FVMA 3R2TA 3KUPA 3NUCA 2BE5D 5M3MB 1D5MC 1S4ZA 3K0YA 5E3FA 3J80L 5FO8B 3DUZA 3I4NB 1XX8A 4CKCA 1BUVT 5I6WA 4UDUC 3TP6A 5C44B 5JEAJ 5DM73 2IL8A 3QJYA 4F88A 3LWUA 1DZ1A 1XTCD 3E0JA 1SXTA 4C56C 5HURA 2WKCA 5CR3A 1EY7A 1W6KA 3TZDA 2L12A 2R92B 3KLSA 3X3NA 2KHSA 2O2LD 1CI3M 2M2LA 1YNND 1B50A 2ZXRA 5FLXE 2JA5B 4IUUA 1EU3A 1F9SA 4CGYB 1PYWD 1V8QA 1HTLD 1B9MA 2HCIA 1YNJD 4MIUA 3PUZA 2A6ED 3L7ZC 3H3VC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XSC A;  1DM0 B;  2GA4 B;  1CZW A;  4P2C B;  3MXG A;  1QNU A;  1D1K A;  4M1U B;  1BOS A;  1C4Q A;  1QOH A;  1R4P B;  1R4Q B;  1C48 A;  2BOS A;  2C5C A;  1CQF A;  1D1I A;  1CZG A;  4ULL A; 
#chains in the Genus database with same CATH topology
 1B9N A;  4X6A H;  3DEP A;  4S3S A;  5C0X I;  4A3E G;  1HFN A;  5ELN A;  3GTO H;  1QVG A;  4DAY B;  1DM0 B;  1CHQ D;  2OXP A;  4KI0 A;  2CW0 D;  5NUC A;  2IX0 A;  3AFP A;  3IFT A;  2KQ3 A;  5C4X B;  3CQZ B;  4CJ0 B;  4EQN A;  1A63 A;  4ID6 A;  4CBV A;  2F0D A;  1IBK L;  2UU9 L;  4A3F G;  2D0P A;  2K14 A;  4BBS H;  4KY5 A;  4KY6 A;  4EQ5 A;  3CXC A;  1II3 A;  1KRT A;  4JBK A;  2YV5 A;  3D6W A;  5A35 A;  2V4D A;  2ALY B;  4DK0 A;  1G8Z D;  1ML0 D;  4V19 0;  3MAQ A;  4IUR A;  4DAV A;  4DF7 A;  3F2B A;  4HAE A;  3OW2 A;  4UP7 A;  1SYF A;  1TWA B;  4DXF A;  4HCE A;  4X62 Q;  1U9R A;  1CKO A;  2KBN A;  1O80 A;  1J5E Q;  1HZ9 A;  3MC0 B;  2X6G A;  1XXG A;  2CHB D;  2J7Z A;  1VF5 C;  4L5T A;  3TP7 A;  1EEF D;  2NZ1 D;  4J8Q A;  1N34 Q;  3QG1 A;  1BBW A;  2K5V A;  2R93 B;  4DUY L;  5C6A A;  3MXG A;  1JE5 A;  3HKZ E;  1E22 A;  1TQO A;  2UXD Q;  2JJQ A;  1QE6 A;  2LMC B;  1Y1V H;  3DM1 A;  4HJ5 A;  1SNO A;  5FLM H;  4XIG S;  1KNA A;  5M5W H;  3PIP A;  1DGS A;  3BVG A;  2K5N A;  2A74 C;  1E2W A;  1K8G A;  3HZX A;  1SSO A;  2PQA B;  2PO4 A;  2JYO A;  2DNE A;  1XYI A;  1EY5 A;  5JJZ A;  1Q1B A;  2ID0 A;  2K32 A;  3HOY G;  2PMZ E;  4AYB G;  2K05 A;  3PO2 H;  3A5U A;  3I90 A;  2NN6 H;  2IX3 A;  1N33 L;  5F2D A;  1FVI A;  1K83 B;  3HOV G;  4ULL A;  1BCP B;  4P75 A;  2WP8 J;  4JVZ A;  5IOC A;  1E24 A;  3LWE A;  3SGI A;  2F3V A;  1SE2 A;  5LMN Q;  1LLR D;  5FO7 B;  2NVT B;  2VL6 A;  3KK7 A;  1SE3 A;  1JIC A;  4DV6 L;  2B3G A;  4BA1 I;  1K9M C;  2R93 H;  2SDF A;  4ZUI A;  5KGU A;  3IRB A;  4HN7 A;  1X3E A;  3D3R A;  3E6Z X;  2VQE L;  1Z47 A;  1YEZ A;  3RN2 A;  2KCT A;  1HUN A;  2F0L A;  4QB4 A;  2HQE A;  4C3J H;  1PTO D;  1YNJ C;  4FXK C;  1PH9 A;  4GN4 B;  4QJF A;  4TKO B;  2JQO A;  4RGO S;  1B2T A;  1KXL A;  2MFI A;  3PQI A;  1RJT A;  4IN3 A;  4HR7 B;  4G4K A;  1UE6 A;  2HUG A;  4JI6 Q;  3HFZ B;  2EE1 A;  4OL7 A;  1M90 C;  4Y52 H;  3VA5 A;  5IGG A;  1BCP D;  3UDI A;  1TVX A;  3TME A;  2F1M A;  1VQB A;  1JJG A;  1U0L A;  3DWQ A;  3CW2 C;  1VDZ A;  4A3K H;  1XPR A;  2IHE A;  1FNU A;  3JAM c;  1PH6 A;  1GKH A;  1MGS A;  4BY1 H;  3HOX G;  2OTL A;  1TWH H;  1FL0 A;  1VQC A;  3I4M G;  3U4Z A;  4PV1 C;  1XWE A;  1WTW A;  2KEN A;  4A3K B;  2F0F A;  1UE1 A;  2B2W C;  3OOC A;  1DON A;  2RBM A;  4IJH A;  3IKJ A;  1ZXT A;  4KTA A;  2CKZ B;  3KYH C;  1GUO A;  4BY7 B;  1G6Z A;  2B2V C;  3OWE B;  4GNX B;  1HPC A;  5ISR A;  4KD3 A;  3CAM A;  3S16 B;  2XRQ D;  1Y8O B;  3GTQ B;  4GOP A;  1BO0 A;  3T51 B;  3PIP 3;  3HOW H;  4C3H B;  4LF4 L;  3DWA A;  4DR3 Q;  5M3F B;  4DGZ A;  4CDC C;  4HJA A;  1CM9 A;  2EYO A;  4DR3 L;  5JJK A;  4ZUJ A;  4P2C B;  4JC0 A;  5IY0 A;  3GTL B;  4ZLT F;  2NB0 A;  5M5W B;  1ONL A;  4IPH A;  2E2D C;  1UEB A;  1EU4 A;  1ZYR D;  4QIW B;  3ZYY X;  2PNR C;  3GTM H;  3FKI B;  1WCM H;  4JI1 Q;  4HMJ A;  3NE5 B;  4WFN 3;  1PYB A;  1CA6 A;  1QJO A;  4EX5 A;  3BDC A;  1EQQ A;  3TEH B;  1LT3 D;  4R1J A;  4YWK A;  4K2L A;  1RF2 D;  2JE6 I;  3TS2 A;  1LUZ A;  3H0G B;  3KDF B;  4QL5 A;  1ZYR C;  1TWH B;  1SMY C;  4BY1 G;  4RHR A;  4F87 A;  4HIK A;  5CV6 A;  3BS1 A;  3E0E A;  4LFA Q;  4A3G G;  1LT6 D;  1PFS A;  2K5D A;  2JA5 G;  2BDN A;  1YHB A;  2JP1 A;  3A56 A;  3SK6 A;  3C46 A;  4DR6 Q;  2WV6 D;  4YWM A;  1VQ8 A;  1SE4 A;  2QCP X;  3R2I A;  5DM6 3;  3CCQ A;  4DN4 M;  1RIP A;  1PXU A;  5LMN W;  1EFW A;  1X65 A;  2E74 C;  1SLJ A;  5G3L F;  3S24 A;  1EIY B;  2XWB B;  2GN5 A;  4C3I G;  2IY5 B;  2VQF L;  1A3T A;  3QOJ A;  4BBS B;  1IBM L;  3SDZ A;  4APV A;  3BG3 A;  1Y69 U;  4DV3 Q;  4CHT B;  2J4X A;  1OXX K;  4JV5 Q;  4DAY A;  1B70 B;  4CKE A;  3V96 A;  5IT9 L;  2YTX A;  5EQ0 A;  4A3G H;  4LAA A;  1GJX A;  4K5X A;  2F0P A;  1U5K A;  4A3I H;  4JPB W;  5CV9 A;  3C2P A;  3FKI G;  3V2T A;  1NCV A;  1IL8 A;  1I50 B;  1LV9 A;  4A3J G;  1DOL A;  2EY1 A;  1T5E A;  3NBH B;  2J0T D;  4TQU S;  3Q24 A;  3HP3 A;  4JBW A;  1N32 L;  2B2V A;  5J1Z A;  5IOD A;  2ICI A;  2NN6 G;  5EPL A;  3ULJ A;  1HUM A;  1S5E D;  3I4O A;  2YTV A;  3CF5 A;  4HIM A;  2XGT A;  3I91 A;  2ENB A;  1NAP A;  1I6H H;  2UXB L;  3K81 C;  1OXU A;  2JA7 H;  3KFU A;  1XMO Q;  4UY8 C;  1PYS B;  2LY7 A;  4F8M A;  1Q86 C;  1HNZ Q;  1U4R A;  5FLM G;  3K59 A;  1M1K C;  1VMC A;  5EKI A;  2BE5 C;  2JA7 G;  1VQO A;  1WTX A;  1Q46 A;  1TWF H;  3TBI B;  1PTO C;  1EQR A;  3OIP A;  1PVO A;  2C5C A;  3PSI A;  4OWT B;  2F52 A;  4B3R Q;  2KOL A;  1Y8P B;  4R4T A;  2R92 H;  2IPK D;  3MTS A;  4LJZ C;  1AN8 A;  3AB9 A;  1EY8 A;  2JA6 B;  4H0L C;  1QZH A;  2WB1 E;  4YHH L;  3MEH A;  4L5R C;  1G2T A;  2IJ0 A;  2R3Z A;  2RCF A;  2E2H H;  5IGF A;  2B63 G;  3PO3 G;  2WII B;  4RCN A;  1EOV A;  4K0K Q;  3I4N H;  1XNQ Q;  3VR5 A;  1TWA H;  3D0F A;  3S1Q B;  5EPK A;  3S1N B;  1UNS A;  5K5P A;  3GP7 A;  3BZK A;  3OMC A;  4JI1 L;  4DR4 L;  1X3F A;  2M9V A;  3KLS X;  1F9Q A;  1I6V C;  3CC7 A;  2IT1 A;  2FXQ A;  3PV0 A;  2K33 A;  2ICE C;  1P16 A;  1IBL L;  2QDB A;  1L1O C;  1H9S B;  5C4J B;  3Q8D A;  1JJC B;  4BBR B;  5FK9 C;  4JI0 L;  1CHP D;  4YWL A;  5C4Z A;  5M5X B;  3OHX C;  4LF7 L;  4HMI A;  1TWC H;  2K50 A;  1X9N A;  2PW5 A;  4LF7 Q;  1SYC A;  2F0E A;  1N32 Q;  3HEJ A;  3PUY A;  3RNU A;  4K14 A;  4P73 A;  1V9P A;  3R3O A;  1PZI D;  5EAY A;  3Q23 A;  1T9H A;  2NWG A;  4BS9 A;  4NPS A;  2R7Z G;  3S1R H;  1QZG A;  5KND A;  4XDX A;  2Z6B A;  3T13 A;  3I55 A;  2PQE A;  1EWC A;  4UP9 A;  3W2D A;  3GV3 A;  3HOZ H;  4YY3 Q;  2VB3 X;  2QIL A;  4HSP A;  1XPO A;  4K8J A;  1JWM D;  1EY6 A;  2BH8 A;  1NR2 A;  2AQ2 B;  5ELC A;  2F0S A;  1ENF A;  2IWH A;  3SHL A;  2DJG C;  1XMQ Q;  2B2Y A;  2A19 A;  2JA8 B;  2B63 B;  3PO3 B;  3NXW A;  1PZK D;  4XQN A;  5IYB G;  3HOU G;  4X3S A;  4OXP A;  2WFW A;  3T56 B;  4M1U B;  2E75 C;  3NBH A;  1R9T H;  1C8C A;  3A0J A;  4POF A;  3CME A;  1LTS D;  4B3T L;  3D4D A;  5IT9 E;  1R4P B;  3RR5 A;  3GTJ H;  3M4P A;  4G7O C;  5JEA H;  2RVL A;  2B2U C;  1IBL Q;  1Y1V G;  2AUJ D;  4OO1 G;  1JJ2 A;  4B9X A;  5M9O A;  3SK8 A;  1KHI A;  4A3I G;  1G29 1;  4BBR G;  3MXU A;  2NVX B;  4A3D B;  4FYD A;  2HDM A;  4OGQ C;  4UHV A;  1Y8N B;  1RDP D;  5C0X J;  4A3M G;  1SJE D;  3K57 A;  2B2W A;  2MJ8 A;  4RHS A;  1MKH A;  1CKN B;  2F0J A;  4XT1 B;  4AIM A;  2RQX A;  4QGU A;  1IKM A;  5IGB A;  1IYV A;  4CJ2 C;  3HKZ G;  3MXN B;  1R4Q B;  4A3F B;  3G4S A;  1JT8 A;  2NZH A;  3ERQ A;  4G57 A;  4POG A;  5COR A;  1X3G A;  2A6H D;  3UE0 A;  2AKW B;  3L3O C;  3RZD H;  4LF4 Q;  2RA4 A;  3HS0 C;  5ELD A;  5I2X A;  4X65 Q;  4IUQ A;  1HQR D;  1X3P A;  2NUC A;  3P1H A;  4ZQ3 A;  1LO5 D;  2F3W A;  3IL8 A;  1WTV A;  3H3V H;  4YHH Q;  3FPP A;  4R8I A;  2UXC Q;  3CCL A;  1I6H B;  5J22 A;  4DUZ Q;  3OYY A;  3M3Y H;  3UDX A;  1LYL A;  2JA6 H;  2AWO A;  2QGQ A;  1KDA A;  2C9O A;  3P20 A;  4LNQ A;  2HCC A;  5C0X H;  1WTP A;  1CSP A;  1S5C D;  4RGT A;  2K75 A;  2I5L X;  3D6C A;  1EYD A;  5DEH A;  5I9P A;  4A3I B;  4N9P A;  4FF1 A;  5CV4 A;  5IIF A;  1Y14 B;  4A3D G;  5CV7 A;  4DNT B;  1PH4 A;  4OX9 Q;  2BOS A;  5KIX A;  2AWN A;  5IWA Q;  2L11 A;  3OMG A;  1V1P A;  2FMM A;  4K5W A;  5C3E H;  3HKZ B;  3RD4 A;  1YNX A;  3PO2 G;  5K36 H;  2HIX A;  4YCU A;  4C3H H;  3CCJ A;  1NE3 A;  2JEA I;  4CDD C;  4AYB B;  2K03 A;  5HGT A;  1O7Y A;  1JOR A;  2O4X A;  1IBK Q;  4QMG A;  1VCI A;  1OTC A;  4IPG A;  2VUM G;  3H91 A;  3C3L A;  4PZ7 A;  3TDQ A;  1SN8 A;  2NVQ H;  1PRT F;  2EJF C;  1K3B C;  3FRP B;  3J80 E;  4Z9C B;  1AE2 A;  3M85 A;  1LT4 D;  4GKJ L;  1BF4 A;  2N88 A;  3M7N A;  1UWV A;  2I46 A;  2JA9 A;  4JOI C;  3CCM A;  4JK1 C;  1HZA A;  2QDL A;  3DMU A;  1LTG D;  1KLU D;  3H0G H;  1SND A;  4DV7 Q;  4RMF A;  1K0R A;  4QIW E;  1VQM A;  1Q12 A;  2F0G A;  2L55 A;  2ZT9 C;  3M4O B;  3WOF A;  5CV8 A;  3NWT A;  4AH6 A;  5E7N A;  3HRZ C;  1E3P A;  2A68 C;  3NSW A;  3CMA A;  4DK3 C;  2DY8 A;  4C3J B;  1D1K A;  1CKN A;  4KV6 A;  2OWO A;  3SR1 A;  3BDL A;  1BCP F;  2HD3 A;  2Y0S E;  1DD2 A;  2TMP A;  2F0K A;  4H44 C;  2EJG C;  4O2D A;  1YJN A;  1VQF A;  1IXR A;  3TN2 A;  1CQF A;  4QUC A;  5COY A;  3KJP A;  1RL2 A;  1TWG H;  2EY2 A;  3GTK H;  2V1C C;  1C9O A;  1AE3 A;  2OEO A;  3TQY A;  1KAA A;  1VQI A;  3FVQ A;  2Q8T A;  3BYY B;  1EY0 A;  1L2F A;  1PH7 A;  1U4L A;  3OIQ A;  1X56 A;  4DA2 A;  4MZ9 A;  1DOK A;  4YCV A;  4DV4 L;  1HH2 P;  4A3J B;  5CV5 A;  3OTO Q;  2PPB C;  1QOH A;  3P75 A;  3VYS A;  1I5F A;  2RDF A;  3GTP B;  1KRS A;  1AZQ A;  2JN4 A;  1STE A;  1EEI D;  2VXW A;  1MJC A;  3KF6 A;  3I4L A;  2EJM A;  1Q8I A;  4KKU A;  3U4V A;  4A3C H;  2NVY B;  3I8Z A;  2YU9 H;  1N36 L;  1LT5 D;  5TSS A;  2K04 A;  1GXD C;  1DJR D;  1YHA A;  4HJ9 A;  2N78 A;  4NDX A;  1HNX Q;  2OQ0 A;  4DNI A;  3SVM A;  1ILP A;  1Q90 A;  5BN3 A;  4A3B B;  3A55 A;  2AQ1 B;  4XXE A;  4A93 G;  2A6H C;  2LFN A;  2B2T A;  4WJ3 M;  2XTI A;  2KUM A;  4IZ8 A;  4X66 Q;  5FLX L;  1GUS A;  1WFQ A;  4J6H A;  2DY7 A;  4O1N A;  1GD7 A;  2JA6 G;  5JVG 3;  4R8N A;  2Z4H A;  1IYU A;  4BY1 B;  3VR4 A;  2PNH A;  2E76 C;  2LS0 1;  1UEA B;  2MPM A;  4U67 3;  3K6O A;  4DR7 Q;  3OWF A;  5J39 A;  1XMQ L;  4LFC L;  2Y0S B;  3AMU A;  3PUW A;  4A3L H;  4DUZ L;  2F0N A;  2B8F A;  3J81 j;  4AQY L;  4AYB E;  3I56 A;  3D31 A;  3SXH A;  4C3I H;  3SK5 A;  2E5L L;  2O5J C;  1STY A;  1I4Q A;  1O7Z A;  3NQT A;  4U68 A;  4LUZ A;  1K28 A;  3J81 c;  4V0B A;  4DV6 Q;  1EZ8 A;  4X3T A;  3WWV A;  4GKK Q;  1O7L A;  1C48 A;  3S14 B;  3PCO B;  5KRU A;  2JA5 H;  1NSN S;  1SDF A;  1I4H A;  4OWW B;  4FF3 A;  2NYZ D;  3I73 A;  5ELE A;  1WD1 A;  5I9O A;  3TP8 A;  3TZU A;  3B6Y A;  4BA2 I;  4QQB X;  4OO1 H;  1HCZ A;  1ZKO A;  3GTO B;  1LTT D;  5CC4 A;  3M4Y A;  1WYD A;  3MVV A;  4BBR H;  4KN7 C;  2A69 C;  1VQ5 A;  5LMN L;  1GOZ A;  2F4V Q;  1O7I A;  3U9O A;  1UAP A;  2CVR A;  1IKL A;  4LF8 Q;  2UUC Q;  2E8G A;  1WCM G;  1PMR A;  3GD7 A;  3PUV A;  5LMU L;  2VUM H;  1F9P A;  1EIH A;  4RGM A;  3E9H A;  1GUN A;  2NTT A;  1OXS C;  3HOU H;  1WI5 A;  1B53 A;  1CTM A;  3S15 H;  1PRT C;  1PHJ A;  4DR7 L;  1WTQ A;  4IUV A;  3VR2 A;  4JI6 L;  4DV7 L;  1U4M A;  2KED A;  4WJW A;  2MGS A;  4DR6 L;  3H6M A;  3UDG A;  3HOV B;  1AEX A;  1W6J A;  2XSC A;  2WB1 B;  4LFA L;  5IGD A;  3G6J B;  1KLG D;  2UXD L;  2MQH A;  5DLQ E;  2IX1 A;  2I5M X;  4LMQ D;  2KJX A;  5EKL A;  1KD1 C;  3U50 C;  2OCE A;  2F0U A;  3ONA B;  1FGB D;  4JCV E;  5GQO A;  2B29 A;  5C44 H;  4B3M Q;  4LF9 L;  3S2D H;  1Z9F A;  4ALP A;  3J7Z C;  1PH8 A;  3A8I E;  3F2U A;  2PI2 A;  3PF5 A;  2VB2 X;  1NR4 A;  3HOX H;  4I7Z C;  1TY2 A;  1LTA D;  3UDF A;  1YJ9 A;  3DWP A;  3MZ5 A;  5IGE A;  1C7Y A;  4IFD H;  4WRD A;  2VY3 A;  1AZP A;  1HXY D;  2MHV A;  3MA2 B;  1STB A;  1RCV D;  1KQS A;  1KAW A;  3Q0A A;  4UP8 A;  2FMC A;  1FGU A;  2SNS A;  1K73 C;  1GHJ A;  3NWS A;  5AJ3 L;  1FYC A;  2PZW A;  2K52 A;  1BKB A;  2B63 H;  2GVB A;  3NHH A;  5KYL A;  3TRE A;  1NNX A;  3ER0 A;  4IFD G;  4KHZ A;  2K1B A;  2QF7 A;  1EWH A;  1ENC A;  1KC8 C;  3CQZ H;  1I50 H;  4NMZ A;  1L0Y B;  2B39 A;  2E2I H;  4JI0 Q;  4JI5 Q;  4EQO A;  3DHQ A;  4KK7 A;  3S9W A;  4XQJ A;  3HOZ B;  5D3I B;  5A2Q L;  4UAI A;  2R93 G;  2XN9 C;  3S1M B;  1ET6 A;  1GM5 A;  1DXM A;  1EIF A;  3MXP A;  1XTD A;  5J3B A;  3KLR A;  2I0Q A;  1SFO B;  4GS3 A;  2FJ2 A;  3CU7 A;  1I3Q H;  2EPB A;  4DR1 Q;  1YNN C;  2OT2 A;  4FP5 D;  3RZO H;  4YIJ A;  3KLW A;  4DUY Q;  4C3I B;  2HIV A;  2AUK A;  2XNA C;  3J7A V;  1ASZ A;  1VQD A;  4LK1 C;  1I94 Q;  1YJW A;  4GNX A;  4HED A;  5C5L A;  1SYE A;  3HOY B;  2XRS D;  3PUX A;  4OEL B;  3RLF A;  2QEJ C;  4K8I A;  5IYC G;  1X6O A;  3K7U C;  2YU9 B;  1QUQ B;  3EA6 A;  3C1E A;  1IHZ A;  4IOA A;  2F0O A;  2RDG A;  1J9O A;  3I3C A;  4FDB A;  3K7A H;  3CPF A;  4IUP A;  3NQI A;  3DXJ C;  4J15 A;  1S3O A;  2KCC A;  1GUG A;  1CT1 D;  1LTI D;  1D7Q A;  4HIO A;  1VQN A;  4PQX A;  4PZ8 A;  4PMW A;  4LFB L;  4KKS A;  2SNM A;  4IPD A;  3OSO A;  2WAQ G;  2E2J B;  4A3J H;  3CCR A;  1ICF B;  3VR3 A;  1XNQ L;  4K5V A;  1YHQ A;  1VMP A;  4R4C A;  1PH5 A;  4PMC A;  1VQH A;  1ENA A;  3GQB A;  4MTK A;  5G3L D;  3UI2 A;  4C1N I;  2GVA A;  1KIX A;  1IBM Q;  3KDF A;  1FNV A;  1EOT A;  4IQZ A;  5C4H A;  4FF4 A;  2TSS A;  2EYH A;  2PCF B;  3FPU B;  3S2H H;  1I4G A;  1JCK B;  5JOB A;  2ZXO A;  2FFK B;  3QIA A;  2EY6 A;  4DV4 Q;  4GN5 A;  2BH2 A;  2G9H D;  4JI7 L;  1O78 A;  1QG7 A;  3L9A X;  1SJH D;  2ZTC A;  4QF4 A;  5BN4 A;  3CKI B;  2EXZ A;  1B8A A;  3BZD B;  1STH A;  1JOQ A;  1QUQ A;  1IYJ B;  5DNF A;  1TKW B;  3I4M B;  4EVO A;  1WOC A;  1CSQ A;  2H1E A;  1ILQ A;  2Q8R E;  3QOL A;  1A3V A;  2A5H A;  4N9T A;  2ZTD A;  1SNC A;  4KHP L;  1OXT A;  4KLK A;  1B3Q A;  1WVL A;  2CQO A;  1VQ6 A;  3ND8 A;  1VQA A;  2OTJ A;  3KBG A;  1L1O B;  4QY7 A;  2D9U A;  3JAM i;  1HNZ L;  2EVB A;  1EZ6 A;  2Z9H A;  3GO5 A;  1KL9 A;  2WAQ B;  3BDO A;  5AJ3 Q;  2Z4I A;  4A3E H;  2C35 B;  2A1A A;  2PQA A;  2VNU D;  5E4W C;  3G48 A;  1JMC A;  2EYF A;  4XT3 B;  1F9R A;  3TSS A;  1CKM A;  4ME5 A;  4NP5 A;  3E5S A;  1Q81 C;  2L5T A;  3KBX A;  1I4X A;  2N3S A;  1G91 A;  4I65 A;  3D4W A;  2F0M A;  5JJI A;  3CCS A;  4PMB A;  2XWJ B;  1SNM A;  5C3E B;  3NBI A;  2L15 A;  3DM3 A;  3K58 A;  2MO0 A;  2Q2T A;  2K6A A;  3QO2 A;  3KF8 A;  2IHF A;  1ROD A;  3NEM A;  2RHS B;  1B3A A;  3A8J E;  4HID A;  3X3M A;  2ZXP A;  3VYR A;  2B8G A;  2L9H A;  1MJE A;  2UUA L;  1JQY D;  2XIW A;  3MXN A;  1PTO B;  5CYU A;  2K4K A;  4JI5 L;  3S17 H;  4RAU C;  4GN3 B;  3F2D A;  4B3S L;  5JPN C;  1SBB B;  5E1F A;  3GTK B;  2R61 A;  3SE0 A;  2F3I A;  2BCO A;  4KJN A;  3H94 A;  3OW7 A;  5IP9 G;  1HFG A;  1AFP A;  4BY7 G;  3TP5 A;  1FJG Q;  2H4O A;  3E3X A;  4CKB A;  2JSO A;  2X6L A;  1E0B A;  5FO9 B;  4RKL A;  4IUT A;  4C3J G;  4MNO A;  1SAP A;  2F4V L;  4A3L G;  1Y1V B;  1PZJ D;  1Q7Y C;  3WDN A;  3GTG B;  3FEW X;  1SRO A;  5M3F G;  1YIJ A;  2HHH Q;  4ZKC B;  3EVQ A;  3M4O H;  2EIF A;  3EQL C;  1TR5 A;  5I2Y A;  4HSV A;  4OIJ A;  3L2P A;  1BR9 A;  3H09 A;  4TRD A;  3S17 B;  4DR2 Q;  4RA8 A;  2PW7 A;  2AHO B;  4RFB A;  1E1O A;  3J81 E;  3KF8 B;  4KKT A;  2ZJQ A;  3CCE A;  3F2C A;  4MHE A;  1V43 A;  2F0T A;  1EY4 A;  2JEB I;  4JV5 L;  1X32 A;  4OWX B;  2E2J H;  1BOS A;  3M9B A;  1ET9 A;  1LTR D;  2NVQ B;  2K5H A;  1SRU A;  2ZJP A;  4PG3 A;  5IYB H;  2SEB D;  4GKK L;  2Q2U A;  1LM0 A;  1X55 A;  2L4N A;  1YZ6 A;  5KYI A;  3KOJ A;  3STB D;  1R9T B;  2AQ3 B;  2ZM6 L;  1HA6 A;  4JBM A;  3RLN A;  4JBJ A;  1OO9 B;  1EQV A;  1MHW C;  3T1Y Q;  2CWA A;  4A3B G;  4YY3 L;  3F8T A;  1QIL A;  3HOZ G;  3BU2 A;  1K8M A;  1PH1 A;  4L6T B;  4Q0F A;  3G71 A;  5C4X H;  1TII D;  4X62 L;  4A3D H;  4A3E B;  3UE1 A;  1AP0 A;  3EN2 A;  3VA7 A;  4X3K A;  2Z0S A;  3AQQ A;  2AMC B;  5JPM C;  4DV2 Q;  3W5O A;  4B08 A;  1ESR A;  3S1R B;  1ASY A;  1EYC A;  4NKL A;  1MSG A;  2VS1 A;  1SYG A;  3URY A;  5I6Y A;  4DR2 L;  1RTO A;  4X3U A;  2DGY A;  1TT2 A;  5M5Y B;  1BDO A;  3MFG A;  1EUJ A;  4CJ1 B;  2DN8 A;  5LMU Q;  4IOC A;  4A76 A;  4JYA Q;  3CP0 A;  1EL0 A;  5IP7 G;  4DV0 L;  3I4M H;  4LF5 Q;  1MIU A;  1IW7 C;  2Y0S G;  2UXB Q;  4Y7N B;  1K8A C;  4L63 B;  1JE4 A;  5CMD A;  5BR8 Q;  3TS0 A;  1DOM A;  2SOB A;  1XPU A;  5C4J H;  4HTH A;  1E2V A;  1JB3 A;  2PMZ B;  1X54 A;  4O0A A;  4DAM A;  1E1T A;  4JOI A;  2Z6K A;  5FOB B;  3S2H B;  1I4P A;  1UE5 A;  2PI2 E;  5IP9 H;  5EBD A;  5C3W A;  1HZC A;  4XYO A;  3K7A B;  1PRT B;  4LFB Q;  5DAU A;  1HZB A;  4ZYS A;  3V05 A;  3H0G G;  2MUY A;  4B3S Q;  1FNW A;  4LWC A;  3F1Z A;  1Z6H A;  3H3V I;  5KNC A;  4XYQ A;  3BZC A;  3A7A B;  4ABN A;  4FXD A;  1LTL A;  2O5I C;  4P71 A;  3CC2 A;  1DYQ A;  1Y1W B;  4X64 L;  4A3M H;  1QCB D;  3RZO B;  3E9I A;  2R7Z B;  3KF6 B;  5LHY 1;  3NTK A;  1VQL A;  3VYU A;  2G9D A;  3IAY A;  1J6Q A;  3Q22 A;  1PFB A;  2RF4 A;  4LF8 L;  5C5M A;  1BQQ T;  1SR3 A;  4DR5 Q;  1B7Y B;  3DLL A;  3T16 A;  4R4Q A;  2OF1 A;  1MI2 A;  2NBF A;  1HJP A;  1Q3L A;  4WOR A;  3A7L A;  4P72 A;  4A4I A;  3S1N H;  3S1Q H;  1SNP A;  3A8K E;  1HA5 A;  2ATW A;  2A6E C;  4CDE C;  3GDE A;  3NPP A;  1X3Q A;  1IL2 A;  4TVA B;  3BVM A;  1S40 A;  4KHV A;  3JAM L;  3VR6 A;  4DK1 A;  4RGN A;  4B3R L;  1HR0 Q;  4OHJ A;  1TS4 A;  5GAG C;  4FO2 A;  2EYM A;  2UXC L;  4DKA C;  5ELB A;  2ASB A;  2BA1 A;  3G7L A;  1FD7 D;  4NXM L;  4LW1 A;  3ULP A;  1HNW Q;  2RSN A;  2QEX A;  3O13 A;  4DV0 Q;  1WTO A;  1PTO F;  5C3X A;  2CFM A;  2F0V A;  5FKA C;  3R93 A;  5HGQ A;  4GLX A;  4KJO A;  4JW0 A;  1JC7 A;  5EJW A;  2A8V A;  3BJU A;  1I4R A;  4DV5 L;  1C4Q A;  1VQG A;  1Z7T A;  5KEE A;  2JA8 H;  4A3G B;  3S2D B;  1H9J A;  3HG9 A;  4DK6 C;  2N55 A;  1G51 A;  4FNF A;  2WAQ E;  1RHP A;  3MFY A;  4RCO A;  1TY0 A;  4DV1 Q;  3HKS A;  1H9R A;  1ICW A;  1HHV A;  1EIG A;  3ERO A;  3LNN A;  1I3Q B;  5ELO A;  4DAP A;  4C2M B;  4B3T Q;  4LF6 L;  1ZEQ X;  1GVP A;  1WJJ A;  3T1Y L;  4JI3 Q;  2FIN B;  1E7Z A;  3MWY W;  1F2L A;  3S1M H;  3CRK C;  1QNK A;  2JA8 G;  2D2C C;  2WAC A;  2ZJR A;  2EQS A;  2OQK A;  4X64 Q;  1CZG A;  3HOU B;  1A62 A;  2MP1 A;  4E6I A;  3AFQ A;  1PLF A;  2E2H B;  3NEL A;  1TS5 A;  4KN4 C;  3J80 i;  4L8J A;  1B1Z A;  3P7J A;  4GNX C;  5A2Q E;  3RN5 A;  4G7Z C;  4L5S A;  4H7B A;  1JWS D;  5JEA G;  1KDB A;  2D5D A;  1JOO A;  1F2M A;  4RKB A;  1HNX L;  2R92 G;  4H13 C;  4LF5 L;  2EDG A;  1LAC A;  1ESF A;  3T1H L;  4IFD J;  4A3M B;  4H02 A;  1D2B A;  3HOY H;  4OO1 I;  2A69 D;  3U9S A;  3S15 B;  5T1I A;  1TWF B;  1NUC A;  2KEC A;  1GHK A;  1GUW A;  1SEB D;  2IW3 A;  4A3B H;  1K0S A;  4J1M A;  3I2Z A;  2F0W A;  4ZAI A;  4OEM B;  2EOT A;  1GUT A;  2LXK A;  3ERS X;  2L0C A;  1IW7 D;  1EWI A;  2A68 D;  4A3C G;  2NVY H;  1LTB D;  1N34 L;  2VUM B;  1Q1E A;  4IUN A;  2CH4 W;  2RDH A;  4JI8 L;  4RWS C;  5IT9 c;  3JAM E;  1PRT D;  4ZKB B;  1VQK A;  1EY9 A;  2LSS A;  1HRJ A;  5JAV A;  3AU7 A;  1S5F D;  1SYD A;  4C1N K;  3W3A A;  3OTO L;  1OXV A;  1A2U A;  1TU2 B;  3ND9 A;  1N8R C;  3CRL C;  3CD6 A;  1PFM A;  1YI2 A;  4KD4 A;  2E2I B;  1WCM B;  1UE7 A;  3GTM B;  3S14 H;  4I7A A;  1A0I A;  1TXY A;  4TSS A;  2HDL A;  3GTL H;  2ZM6 Q;  2D62 A;  1D5X C;  4ZCK A;  1B4O A;  3DEO A;  3HGB A;  1M8A A;  1BCP C;  1CQV A;  1L1O A;  2WKD A;  3IFD A;  4IAL A;  3W1G A;  1CZW A;  2M00 A;  3PIO 3;  1F2Y A;  4G7H C;  5AFW A;  3QR8 A;  3BVZ A;  2A73 B;  2NTS A;  3I4N G;  1SMX A;  4Y7N H;  2ES2 A;  3FMC A;  2DUD A;  5IP7 H;  1FR3 A;  2NZO A;  1DCZ A;  1XMO L;  1MSH A;  3RLO A;  4JI4 Q;  1KNE A;  2Z6K C;  4RH6 A;  5C44 G;  3FDT A;  4XTC S;  3PMF A;  2Q2H A;  2JXM B;  1HNW L;  1BBX C;  1VQ4 A;  4N8X 1;  2YTY A;  2KCN A;  1VS0 A;  4DR5 L;  3J7Y W;  4ME3 A;  3NEN A;  1STA A;  4K6L A;  4GLA C;  5GAD C;  1Y1W H;  5CBA E;  2BA0 A;  1CA5 A;  1N9W A;  4OX9 L;  1HR0 W;  1RD9 D;  5EPJ A;  2EYP A;  3NTH A;  3CC4 A;  5IWA L;  3R8B A;  2BDO A;  5LL6 X;  4DR4 Q;  2UU9 Q;  1S5B D;  2HT1 A;  5EKK A;  2DJF C;  1L0X B;  4NXN Q;  1H95 A;  4FF2 A;  1Q8K A;  2B2Y C;  1B44 D;  2KA7 A;  1CK1 A;  5IE8 A;  1QNU A;  1W3S A;  1EYG A;  5K36 G;  3D8G A;  5IGC A;  4DU9 A;  5C3E G;  1A6X A;  1AH9 A;  4QCL A;  2R6G A;  2VZA A;  3HOW B;  1VF7 A;  2R7Z H;  5D65 A;  4IPC A;  1W2B A;  2NVT H;  1VQE A;  4K0K L;  3AEV A;  5HY6 A;  3S16 H;  3STB C;  1T5X D;  3ICE A;  1V1O A;  4R9W A;  3FKI H;  1S5D D;  2KVM A;  5D14 A;  2I07 B;  5D3D A;  1VQ9 A;  4GKJ Q;  1NMG A;  3OPO A;  2K7V A;  3NK9 A;  2MNA A;  1MBY A;  1BNZ A;  2UUC L;  2UUA Q;  1K83 H;  1JWU D;  4B9W A;  4K6D A;  4DFA A;  4M8A A;  1KAB A;  3PIO A;  2KEE A;  2KHI A;  3PO2 B;  5M3F H;  1A2T A;  2Q2I A;  1JR0 D;  3GTG H;  3M7G A;  2R7D A;  3N6R A;  1N36 Q;  1LAB A;  1YBY A;  5T1G A;  3WOE A;  3GTQ H;  1SYB A;  3VDY A;  1H9M A;  3GV6 A;  1STG A;  3GTP H;  3NP8 A;  5I4D A;  1G2S A;  4PZ6 A;  5L37 A;  1EFI D;  2XVS A;  4YCW A;  3CPW A;  4DV2 L;  1QWY A;  4BY7 H;  4BWG B;  3CHB D;  5BN5 A;  3Q6S A;  2EYL A;  3RUZ A;  2F0I A;  1M4V A;  1PDQ A;  3K8A A;  4HCS A;  1WD0 A;  3TRZ A;  3RZD B;  1P8L A;  3KJO A;  5M5Y H;  5GRO A;  3BYT B;  4K2K A;  5LL6 S;  3CCV A;  5JJL A;  5GAE C;  1XJV A;  1PTO H;  2WIN B;  3ULL A;  3D4R A;  3A54 A;  2GA4 B;  4AQY Q;  4BXX G;  1KDC A;  5CBE E;  1QVF A;  3K5L A;  3PF4 A;  1WTH A;  2K01 A;  4DNR B;  1MD2 D;  2UUB L;  2CWP A;  3I70 A;  2ZTE A;  3EBE A;  1CUK A;  4LUV A;  3K5N A;  3LGJ A;  5C4X G;  3NTI A;  4P74 A;  2VW9 A;  1VQ7 A;  1C0A A;  1NMF A;  3EFX D;  3RMH A;  3SK4 A;  2VQF Q;  2L1B A;  3J7A F;  3N52 A;  3ITP A;  2EY5 A;  4LF6 Q;  3H15 A;  5H1S E;  3W1B A;  1K8O A;  4LUO A;  2EZV A;  3FHW A;  3C1F A;  5IYD H;  3QB3 A;  4JI4 L;  3MEF A;  1QB5 D;  1RTN A;  1A3U A;  3T53 B;  4NW2 A;  3SEB A;  4GOP C;  3M4Q A;  2KHJ A;  1XNR L;  2X69 A;  3VYT A;  2NN6 I;  2RSO A;  2VQE Q;  4GOP B;  1XNR Q;  1A8V A;  2B2U A;  1IZ6 A;  2H5X A;  1RKN A;  1PH3 A;  1NTG A;  1KTK A;  1TWG B;  1A15 A;  4Q5V A;  4NXN L;  4N8F A;  1JOK A;  5FJ8 H;  4LFC Q;  1PFN A;  4JI2 Q;  1J8I A;  5CGK A;  1PV4 A;  2RKS A;  2N8N A;  4MN3 A;  1TS3 A;  5BR8 L;  4A75 A;  1GO3 E;  4IJL A;  2EYJ A;  4O42 A;  3K0X A;  4MTN A;  1V1Q A;  1STN A;  4ILW A;  4DV5 Q;  4EQP A;  1U4P A;  3EJI A;  5EGT A;  4A93 B;  2MO1 A;  4PNY A;  4XQQ A;  4WJ4 A;  2EXD A;  2JK8 A;  1PA6 A;  2E5L Q;  4DPG A;  2CW0 C;  2PZT A;  2F4I A;  3MHB A;  1AW7 A;  2KCM A;  5FJ8 G;  1E2Z A;  2I5H A;  4OON A;  2QKI C;  3PO3 H;  5KNB A;  1N33 Q;  3J80 c;  1SMY D;  1D5Z C;  4KMU C;  3T4A C;  1F77 A;  1HQM C;  3U58 A;  1H9K A;  3K5M A;  1V1P B;  1D6E C;  1K3R A;  5E4X A;  2WB1 G;  1J5E L;  3FP9 A;  1L0W A;  2YYZ A;  5IYD G;  2RCN A;  1F2Z A;  4DV1 L;  2F0H A;  1EQT A;  1JB7 A;  2HQL A;  5IYC H;  2CH4 A;  4C2M H;  3GTJ B;  2K5W A;  4C3H G;  2QW7 A;  1G6P A;  2RHQ B;  4ZK9 B;  1UUP A;  1D8L A;  1VQJ A;  2CQA A;  4JG2 A;  2K28 A;  2B2T C;  1TWC B;  1HTP A;  3JC6 6;  2Z1C A;  3G6E A;  4FXG C;  5M5X H;  5EBC A;  2Q8I B;  4IFD I;  1TS2 A;  4RG1 A;  4JI2 L;  4KY7 A;  4ODG A;  2F0Q A;  3I72 A;  4IO9 A;  4QUF A;  2JA7 B;  2NVX H;  3QWN A;  5JVH 3;  5FLX c;  2DNC A;  1D1I A;  1SFO H;  1H9S A;  1SNQ A;  3CCU A;  2G5D A;  3T1H Q;  1PH2 A;  1BBU A;  2N49 A;  4JI7 Q;  3K5O A;  1Q82 C;  1EYA A;  4BXX H;  4OIK A;  1FJG L;  1CFM A;  2FHT A;  5C0X G;  4GZY C;  1SE8 A;  1NY4 A;  4DXG A;  3EIV A;  3HOX B;  3A74 A;  4F7X A;  2F03 A;  2Z8L A;  3M3Y B;  4NB3 A;  3L0O A;  4L5Q A;  2QA4 A;  4ZRZ A;  4A3K G;  2K5Q A;  2PYK A;  1BXT A;  3J81 L;  1WTR A;  5ELF A;  3K80 C;  2R7F A;  4EGV A;  2LKV A;  2PZU A;  3LX0 A;  3I7F A;  4FVM A;  3R2T A;  3KUP A;  3NUC A;  2BE5 D;  5M3M B;  1YIT A;  1D5M C;  1S4Z A;  2D0O A;  4X66 L;  4JI3 L;  3K0Y A;  1NBW A;  5E3F A;  3J80 L;  3J81 i;  5FO8 B;  3DUZ A;  3I4N B;  4A3F H;  3ZJY C;  4BBS G;  1S72 A;  2UUB Q;  2CCZ A;  1XX8 A;  4CKC A;  1BUV T;  5I6W A;  4UDU C;  3TP6 A;  1BVS A;  4X65 L;  4HJ8 A;  5C44 B;  5JEA J;  5DM7 3;  1QVC A;  2IL8 A;  3QJY A;  3PGZ A;  3AYH B;  4F88 A;  3LWU A;  1DZ1 A;  3A5Z B;  1XTC D;  3E0J A;  1YVC A;  1SXT A;  5GAH C;  4C56 C;  5HUR A;  2WKC A;  1NJI C;  5CR3 A;  3HOV H;  1EY7 A;  1W6K A;  3TZD A;  1HR0 L;  2L12 A;  3J7A 5;  2R92 B;  5M3M H;  3KLS A;  4R4O A;  4KHP Q;  3X3N A;  4B3M L;  4LF9 Q;  2KHS A;  4DR1 L;  2LXJ A;  2O2L D;  1CI3 M;  4A93 H;  2M2L A;  1YNN D;  4CDF C;  1B50 A;  2HHH L;  4JYA L;  2ZXR A;  5FLX E;  2JA5 B;  2P5Z X;  4IUU A;  1EU3 A;  1F9S A;  4R4I A;  1I94 L;  4NXM Q;  4CGY B;  1PYW D;  4JI8 Q;  1VQP A;  1V8Q A;  1HTL D;  1B9M A;  2HCI A;  5M3M G;  4GLV B;  1YNJ D;  3HOW G;  4DV3 L;  4MIU A;  3PUZ A;  4HJ7 A;  2A6E D;  3L7Z C;  4UPA A;  1Y1W G;  3H3V C; 
#chains in the Genus database with same CATH homology
 1B9N A;  3DEP A;  4S3S A;  5C0X I;  1HFN A;  1DM0 B;  1CHQ D;  2OXP A;  4KI0 A;  2CW0 D;  5NUC A;  2IX0 A;  3IFT A;  2KQ3 A;  5C4X B;  3CQZ B;  4CJ0 B;  4EQN A;  4ID6 A;  4CBV A;  2F0D A;  4KY5 A;  4KY6 A;  1II3 A;  3D6W A;  5A35 A;  2V4D A;  4DK0 A;  1G8Z D;  1ML0 D;  4V19 0;  3MAQ A;  4IUR A;  4DAV A;  4DF7 A;  4HAE A;  1SYF A;  1TWA B;  4DXF A;  4HCE A;  1U9R A;  1O80 A;  3MC0 B;  2X6G A;  1XXG A;  2CHB D;  2J7Z A;  1VF5 C;  3TP7 A;  1EEF D;  2NZ1 D;  4J8Q A;  3QG1 A;  2R93 B;  5C6A A;  3MXG A;  1TQO A;  1QE6 A;  2LMC B;  3DM1 A;  1SNO A;  4XIG S;  1KNA A;  3BVG A;  2A74 C;  1E2W A;  3HZX A;  1SSO A;  2PO4 A;  2JYO A;  2DNE A;  1XYI A;  1EY5 A;  5JJZ A;  1Q1B A;  2ID0 A;  2K32 A;  2K05 A;  3I90 A;  2NN6 H;  2IX3 A;  5F2D A;  1K83 B;  4ULL A;  1BCP B;  2WP8 J;  5IOC A;  3LWE A;  2F3V A;  1SE2 A;  1LLR D;  5FO7 B;  2NVT B;  3KK7 A;  1SE3 A;  1JIC A;  4BA1 I;  2SDF A;  4ZUI A;  5KGU A;  4HN7 A;  3D3R A;  3E6Z X;  1Z47 A;  1HUN A;  2F0L A;  4QB4 A;  2HQE A;  1PTO D;  1YNJ C;  4FXK C;  1B2T A;  4TKO B;  4RGO S;  1RJT A;  4IN3 A;  4HR7 B;  4G4K A;  2HUG A;  2EE1 A;  4OL7 A;  3VA5 A;  5IGG A;  1BCP D;  1TVX A;  3TME A;  2F1M A;  3DWQ A;  1VDZ A;  1FNU A;  1MGS A;  4PV1 C;  1XWE A;  1WTW A;  4A3K B;  2F0F A;  2B2W C;  3OOC A;  1DON A;  2RBM A;  3IKJ A;  1ZXT A;  4KTA A;  4BY7 B;  1G6Z A;  1GUO A;  2B2V C;  3OWE B;  1HPC A;  5ISR A;  4KD3 A;  3S16 B;  2XRQ D;  1Y8O B;  3GTQ B;  1BO0 A;  3T51 B;  3PIP 3;  4C3H B;  3DWA A;  5M3F B;  4DGZ A;  1CM9 A;  2EYO A;  4ZUJ A;  4P2C B;  3GTL B;  4ZLT F;  2NB0 A;  5M5W B;  1ONL A;  2E2D C;  1EU4 A;  1ZYR D;  4QIW B;  3ZYY X;  2PNR C;  3FKI B;  4HMJ A;  3NE5 B;  4WFN 3;  1CA6 A;  1QJO A;  3BDC A;  1LT3 D;  4K2L A;  1RF2 D;  2JE6 I;  3H0G B;  1ZYR C;  1TWH B;  1SMY C;  4RHR A;  4F87 A;  5CV6 A;  3BS1 A;  1LT6 D;  2K5D A;  2BDN A;  2JP1 A;  3A56 A;  3SK6 A;  3C46 A;  2WV6 D;  1SE4 A;  2QCP X;  3R2I A;  5DM6 3;  4DN4 M;  1PXU A;  2E74 C;  5G3L F;  2XWB B;  4C3I G;  1A3T A;  3QOJ A;  4BBS B;  3SDZ A;  3BG3 A;  1Y69 U;  4CHT B;  2J4X A;  1OXX K;  4DAY A;  4CKE A;  3V96 A;  5IT9 L;  5EQ0 A;  4LAA A;  1GJX A;  4K5X A;  2F0P A;  5CV9 A;  3C2P A;  3V2T A;  1NCV A;  1IL8 A;  1I50 B;  1LV9 A;  1DOL A;  2EY1 A;  1T5E A;  2J0T D;  4TQU S;  3Q24 A;  3HP3 A;  4JBW A;  2B2V A;  5J1Z A;  5IOD A;  2ICI A;  2NN6 G;  5EPL A;  1HUM A;  1S5E D;  3I91 A;  2ENB A;  1NAP A;  1OXU A;  2LY7 A;  4F8M A;  1U4R A;  3K59 A;  1VMC A;  5EKI A;  2BE5 C;  1WTX A;  3TBI B;  1PTO C;  3OIP A;  2C5C A;  2KOL A;  1Y8P B;  2IPK D;  3MTS A;  4LJZ C;  1AN8 A;  3AB9 A;  1EY8 A;  2JA6 B;  4H0L C;  3MEH A;  1G2T A;  2IJ0 A;  2R3Z A;  5IGF A;  2WII B;  4RCN A;  3VR5 A;  3S1Q B;  3S1N B;  5EPK A;  1UNS A;  5K5P A;  3GP7 A;  3OMC A;  2M9V A;  1F9Q A;  1I6V C;  3KLS X;  2IT1 A;  3PV0 A;  2K33 A;  2ICE C;  2QDB A;  1H9S B;  5C4J B;  4BBR B;  5FK9 C;  1CHP D;  5C4Z A;  5M5X B;  3OHX C;  4HMI A;  2PW5 A;  1SYC A;  2F0E A;  3HEJ A;  3PUY A;  4K14 A;  3R3O A;  1PZI D;  3Q23 A;  2NWG A;  4BS9 A;  5KND A;  4XDX A;  3T13 A;  2PQE A;  1EWC A;  3W2D A;  3GV3 A;  2VB3 X;  2QIL A;  4HSP A;  4K8J A;  1JWM D;  1EY6 A;  1NR2 A;  2AQ2 B;  5ELC A;  2F0S A;  1ENF A;  2IWH A;  3SHL A;  2B2Y A;  2JA8 B;  2B63 B;  3PO3 B;  3NXW A;  1PZK D;  4XQN A;  4X3S A;  3T56 B;  4M1U B;  2E75 C;  3NBH A;  1C8C A;  1LTS D;  3D4D A;  5IT9 E;  1R4P B;  4G7O C;  5JEA H;  2RVL A;  2B2U C;  2AUJ D;  4OO1 G;  4B9X A;  5M9O A;  3SK8 A;  1G29 1;  3MXU A;  2NVX B;  4A3D B;  4FYD A;  2HDM A;  4OGQ C;  1Y8N B;  1RDP D;  5C0X J;  1SJE D;  3K57 A;  2B2W A;  2MJ8 A;  4RHS A;  1IKM A;  2F0J A;  4XT1 B;  2RQX A;  5IGB A;  1IYV A;  4CJ2 C;  1R4Q B;  4A3F B;  3ERQ A;  4G57 A;  5COR A;  2A6H D;  3L3O C;  2RA4 A;  3HS0 C;  5ELD A;  5I2X A;  4IUQ A;  1HQR D;  1X3P A;  2NUC A;  3P1H A;  4ZQ3 A;  1LO5 D;  2F3W A;  3IL8 A;  1WTV A;  3FPP A;  4R8I A;  1I6H B;  5J22 A;  2AWO A;  1KDA A;  2C9O A;  3P20 A;  2HCC A;  5C0X H;  1WTP A;  1S5C D;  4RGT A;  3D6C A;  1EYD A;  5DEH A;  5I9P A;  4A3I B;  4N9P A;  4FF1 A;  5CV4 A;  5IIF A;  5CV7 A;  4DNT B;  2BOS A;  5KIX A;  2AWN A;  2L11 A;  3OMG A;  1V1P A;  2FMM A;  4K5W A;  3HKZ B;  3RD4 A;  5K36 H;  2JEA I;  4AYB B;  2K03 A;  5HGT A;  1O7Y A;  1JOR A;  2O4X A;  4QMG A;  1VCI A;  3H91 A;  3C3L A;  3TDQ A;  1PRT F;  2EJF C;  3FRP B;  3J80 E;  4Z9C B;  3M85 A;  1LT4 D;  1BF4 A;  2N88 A;  3M7N A;  2I46 A;  4JK1 C;  3DMU A;  1LTG D;  1KLU D;  1SND A;  1Q12 A;  2F0G A;  2L55 A;  2ZT9 C;  3M4O B;  3WOF A;  5CV8 A;  3NWT A;  3HRZ C;  2A68 C;  3NSW A;  2DY8 A;  4C3J B;  1D1K A;  4KV6 A;  3SR1 A;  3BDL A;  1BCP F;  1DD2 A;  2TMP A;  2F0K A;  4H44 C;  2EJG C;  3TN2 A;  1CQF A;  4QUC A;  5COY A;  2EY2 A;  2OEO A;  1KAA A;  3FVQ A;  2Q8T A;  3BYY B;  1EY0 A;  1U4L A;  3OIQ A;  4DA2 A;  1DOK A;  4A3J B;  5CV5 A;  2PPB C;  1QOH A;  3P75 A;  3VYS A;  2RDF A;  3GTP B;  1AZQ A;  1STE A;  1EEI D;  2VXW A;  3I4L A;  2EJM A;  1Q8I A;  4KKU A;  2NVY B;  3I8Z A;  1LT5 D;  5TSS A;  2K04 A;  1GXD C;  1DJR D;  4NDX A;  3SVM A;  1ILP A;  1Q90 A;  5BN3 A;  4A3B B;  3A55 A;  2AQ1 B;  4XXE A;  2A6H C;  2LFN A;  2B2T A;  2KUM A;  4IZ8 A;  5FLX L;  1GUS A;  4J6H A;  2DY7 A;  4O1N A;  5JVG 3;  4R8N A;  2Z4H A;  1IYU A;  4BY1 B;  3VR4 A;  2E76 C;  2LS0 1;  1UEA B;  2MPM A;  4U67 3;  3K6O A;  3OWF A;  5J39 A;  3AMU A;  2Y0S B;  3PUW A;  2F0N A;  2B8F A;  3D31 A;  3SXH A;  3SK5 A;  2O5J C;  1STY A;  1I4Q A;  1O7Z A;  3NQT A;  4U68 A;  4V0B A;  1EZ8 A;  4X3T A;  1O7L A;  1C48 A;  3S14 B;  5KRU A;  1NSN S;  4FF3 A;  1SDF A;  1I4H A;  2NYZ D;  3I73 A;  5ELE A;  1WD1 A;  5I9O A;  3TP8 A;  3TZU A;  4BA2 I;  4OO1 H;  1HCZ A;  1ZKO A;  3GTO B;  1LTT D;  5CC4 A;  3M4Y A;  3MVV A;  4KN7 C;  2A69 C;  1GOZ A;  3U9O A;  1UAP A;  2CVR A;  1IKL A;  1PMR A;  3GD7 A;  3PUV A;  1F9P A;  1EIH A;  4RGM A;  1GUN A;  2NTT A;  1OXS C;  1B53 A;  1CTM A;  1PRT C;  1WTQ A;  4IUV A;  3VR2 A;  1U4M A;  2KED A;  4WJW A;  2MGS A;  3H6M A;  3HOV B;  1AEX A;  1W6J A;  2XSC A;  2WB1 B;  5IGD A;  3G6J B;  1KLG D;  2IX1 A;  4LMQ D;  5EKL A;  2KJX A;  2F0U A;  3ONA B;  1FGB D;  3A8I E;  3F2U A;  2VB2 X;  1NR4 A;  4I7Z C;  1TY2 A;  1LTA D;  3DWP A;  5IGE A;  3MZ5 A;  4IFD H;  4WRD A;  1AZP A;  1HXY D;  2MHV A;  3MA2 B;  1STB A;  1RCV D;  3Q0A A;  2FMC A;  2SNS A;  1GHJ A;  3NWS A;  1FYC A;  2PZW A;  3NHH A;  5KYL A;  4IFD G;  4KHZ A;  2K1B A;  2QF7 A;  1EWH A;  1ENC A;  4NMZ A;  1L0Y B;  2B39 A;  4EQO A;  3DHQ A;  4KK7 A;  3S9W A;  4XQJ A;  3HOZ B;  5D3I B;  5A2Q L;  4UAI A;  2XN9 C;  3S1M B;  1ET6 A;  1DXM A;  3MXP A;  3KLR A;  1SFO B;  2FJ2 A;  3CU7 A;  2EPB A;  1YNN C;  2OT2 A;  4FP5 D;  4YIJ A;  4C3I B;  2AUK A;  2XNA C;  3J7A V;  4LK1 C;  4HED A;  5C5L A;  1SYE A;  3HOY B;  2XRS D;  3PUX A;  3RLF A;  2QEJ C;  4K8I A;  2YU9 B;  3EA6 A;  3C1E A;  1IHZ A;  2F0O A;  2RDG A;  1J9O A;  3I3C A;  4IUP A;  3NQI A;  3DXJ C;  2KCC A;  1GUG A;  1CT1 D;  1LTI D;  4PQX A;  4PMW A;  4KKS A;  2SNM A;  3OSO A;  2E2J B;  3VR3 A;  4K5V A;  1VMP A;  4PMC A;  1ENA A;  3GQB A;  5G3L D;  3UI2 A;  4C1N I;  1FNV A;  1EOT A;  4IQZ A;  5C4H A;  4FF4 A;  2TSS A;  2EYH A;  2PCF B;  3FPU B;  1I4G A;  1JCK B;  5JOB A;  2ZXO A;  2FFK B;  3QIA A;  2EY6 A;  2G9H D;  1O78 A;  1QG7 A;  3L9A X;  1SJH D;  4QF4 A;  5BN4 A;  3CKI B;  2EXZ A;  3BZD B;  1STH A;  1JOQ A;  5DNF A;  3I4M B;  1TKW B;  4EVO A;  2H1E A;  1ILQ A;  2Q8R E;  3QOL A;  1A3V A;  2A5H A;  4N9T A;  1SNC A;  1OXT A;  1WVL A;  3ND8 A;  3KBG A;  2D9U A;  2EVB A;  1EZ6 A;  3GO5 A;  2WAQ B;  3BDO A;  2Z4I A;  2VNU D;  5E4W C;  2EYF A;  4XT3 B;  1F9R A;  3TSS A;  4ME5 A;  4NP5 A;  3E5S A;  2L5T A;  3KBX A;  1I4X A;  1G91 A;  4I65 A;  3D4W A;  2F0M A;  4PMB A;  2XWJ B;  1SNM A;  5C3E B;  3NBI A;  3K58 A;  2K6A A;  3QO2 A;  3KF8 A;  1ROD A;  1B3A A;  3A8J E;  3X3M A;  2ZXP A;  3VYR A;  2B8G A;  2L9H A;  1JQY D;  2XIW A;  3MXN A;  1PTO B;  5CYU A;  4RAU C;  5JPN C;  1SBB B;  5E1F A;  3GTK B;  2R61 A;  3SE0 A;  2BCO A;  4KJN A;  3H94 A;  3OW7 A;  1HFG A;  1AFP A;  3TP5 A;  2H4O A;  4CKB A;  2JSO A;  2X6L A;  1E0B A;  5FO9 B;  4RKL A;  4IUT A;  4C3J G;  1SAP A;  1Y1V B;  1PZJ D;  3WDN A;  3GTG B;  3FEW X;  4ZKC B;  3EVQ A;  3EQL C;  1TR5 A;  5I2Y A;  4HSV A;  4OIJ A;  1BR9 A;  3H09 A;  4TRD A;  3S17 B;  4RA8 A;  2PW7 A;  4RFB A;  3J81 E;  4KKT A;  4MHE A;  1V43 A;  2F0T A;  1EY4 A;  2JEB I;  1X32 A;  1BOS A;  1ET9 A;  1LTR D;  2NVQ B;  2SEB D;  2L4N A;  5KYI A;  1R9T B;  1HA6 A;  2AQ3 B;  1OO9 B;  1EQV A;  1QIL A;  1K8M A;  4L6T B;  4Q0F A;  1TII D;  4A3E B;  1AP0 A;  3VA7 A;  4X3K A;  5JPM C;  4B08 A;  1ESR A;  3S1R B;  1EYC A;  4NKL A;  1MSG A;  5I6Y A;  1SYG A;  3URY A;  1RTO A;  4X3U A;  1TT2 A;  5M5Y B;  1BDO A;  3MFG A;  4CJ1 B;  2DN8 A;  1EL0 A;  1IW7 C;  4Y7N B;  4L63 B;  1JE4 A;  5CMD A;  1DOM A;  2SOB A;  4HTH A;  1E2V A;  1JB3 A;  2PMZ B;  5FOB B;  3S2H B;  1I4P A;  5EBD A;  5C3W A;  4XYO A;  3K7A B;  1PRT B;  5DAU A;  4ZYS A;  3V05 A;  2MUY A;  1FNW A;  1Z6H A;  5KNC A;  4XYQ A;  3A7A B;  4ABN A;  4FXD A;  2O5I C;  1DYQ A;  1Y1W B;  1QCB D;  3RZO B;  2R7Z B;  5LHY 1;  3NTK A;  3VYU A;  3IAY A;  2G9D A;  3Q22 A;  1PFB A;  5C5M A;  1BQQ T;  3T16 A;  2OF1 A;  1MI2 A;  2NBF A;  1Q3L A;  4WOR A;  3A7L A;  1SNP A;  3A8K E;  1HA5 A;  2A6E C;  3NPP A;  1X3Q A;  3BVM A;  4KHV A;  3JAM L;  3VR6 A;  4DK1 A;  4RGN A;  4OHJ A;  1TS4 A;  4FO2 A;  2EYM A;  5ELB A;  2BA1 A;  3G7L A;  1FD7 D;  2RSN A;  3O13 A;  1WTO A;  1PTO F;  5C3X A;  2F0V A;  5FKA C;  3R93 A;  4KJO A;  1JC7 A;  5EJW A;  1I4R A;  1C4Q A;  1Z7T A;  5KEE A;  4A3G B;  3S2D B;  1H9J A;  3HG9 A;  2N55 A;  4FNF A;  1RHP A;  3MFY A;  4RCO A;  1TY0 A;  1H9R A;  1ICW A;  1HHV A;  1EIG A;  3ERO A;  3LNN A;  1I3Q B;  4DAP A;  4C2M B;  1ZEQ X;  2FIN B;  3MWY W;  1F2L A;  3CRK C;  1QNK A;  2D2C C;  2WAC A;  1CZG A;  3HOU B;  2MP1 A;  4E6I A;  1PLF A;  2E2H B;  1TS5 A;  4KN4 C;  4L8J A;  1B1Z A;  3P7J A;  5A2Q E;  4G7Z C;  4H7B A;  1JWS D;  5JEA G;  1KDB A;  2D5D A;  1JOO A;  1F2M A;  4RKB A;  4H13 C;  2EDG A;  1LAC A;  1ESF A;  4IFD J;  4A3M B;  1D2B A;  4OO1 I;  2A69 D;  3U9S A;  3S15 B;  5T1I A;  1TWF B;  1NUC A;  2KEC A;  1GHK A;  1GUW A;  1SEB D;  2IW3 A;  4J1M A;  4ZAI A;  2F0W A;  2EOT A;  1GUT A;  2L0C A;  1IW7 D;  2A68 D;  1LTB D;  2VUM B;  1Q1E A;  4IUN A;  2RDH A;  3JAM E;  4RWS C;  1PRT D;  4ZKB B;  1EY9 A;  1HRJ A;  5JAV A;  3AU7 A;  1S5F D;  1SYD A;  4C1N K;  3W3A A;  1OXV A;  1A2U A;  1TU2 B;  3ND9 A;  3CRL C;  1PFM A;  4KD4 A;  2E2I B;  1WCM B;  3GTM B;  4TSS A;  2HDL A;  2D62 A;  1D5X C;  1B4O A;  3DEO A;  3HGB A;  1M8A A;  1BCP C;  1CQV A;  2WKD A;  3IFD A;  4IAL A;  1CZW A;  2M00 A;  3PIO 3;  1F2Y A;  4G7H C;  5AFW A;  3BVZ A;  2A73 B;  2NTS A;  3FMC A;  1FR3 A;  1DCZ A;  1MSH A;  1KNE A;  4RH6 A;  3FDT A;  4XTC S;  3PMF A;  2JXM B;  1BBX C;  2KCN A;  3J7Y W;  1STA A;  4K6L A;  5CBA E;  2BA0 A;  1CA5 A;  1RD9 D;  5EPJ A;  2EYP A;  3NTH A;  3R8B A;  2BDO A;  5LL6 X;  1S5B D;  5EKK A;  1L0X B;  4FF2 A;  2B2Y C;  1B44 D;  2KA7 A;  1CK1 A;  1QNU A;  5K36 G;  3D8G A;  5IGC A;  4DU9 A;  1A6X A;  4QCL A;  2R6G A;  3HOW B;  1VF7 A;  5D65 A;  1T5X D;  1V1O A;  4R9W A;  1S5D D;  2KVM A;  5D14 A;  2I07 B;  5D3D A;  3OPO A;  2K7V A;  3NK9 A;  1MBY A;  1BNZ A;  1JWU D;  4B9W A;  4K6D A;  4DFA A;  4M8A A;  1KAB A;  2KEE A;  3PO2 B;  1A2T A;  1JR0 D;  3M7G A;  3N6R A;  1LAB A;  5T1G A;  3WOE A;  1SYB A;  1H9M A;  3GV6 A;  1STG A;  3NP8 A;  5I4D A;  1G2S A;  1EFI D;  2XVS A;  1QWY A;  4BWG B;  3CHB D;  5BN5 A;  3Q6S A;  2EYL A;  3RUZ A;  2F0I A;  1M4V A;  1PDQ A;  4HCS A;  1WD0 A;  3RZD B;  3BYT B;  4K2K A;  5LL6 S;  1PTO H;  2WIN B;  3D4R A;  3A54 A;  2GA4 B;  1KDC A;  5CBE E;  3K5L A;  2K01 A;  4DNR B;  1MD2 D;  3I70 A;  3K5N A;  3NTI A;  3SK4 A;  3EFX D;  3RMH A;  2L1B A;  3J7A F;  3N52 A;  3ITP A;  2EY5 A;  1K8O A;  2EZV A;  3C1F A;  3QB3 A;  1QB5 D;  1RTN A;  1A3U A;  3T53 B;  4NW2 A;  3SEB A;  2X69 A;  3VYT A;  2NN6 I;  2RSO A;  2B2U A;  1RKN A;  1KTK A;  1TWG B;  1A15 A;  4Q5V A;  1JOK A;  1PFN A;  1J8I A;  5CGK A;  2RKS A;  4MN3 A;  1TS3 A;  2EYJ A;  4O42 A;  1STN A;  4ILW A;  4EQP A;  1U4P A;  3EJI A;  5EGT A;  4A93 B;  4PNY A;  4XQQ A;  2CW0 C;  2PZT A;  2F4I A;  3MHB A;  1AW7 A;  1E2Z A;  2QKI C;  5KNB A;  1SMY D;  1D5Z C;  4KMU C;  3T4A C;  1F77 A;  1HQM C;  1H9K A;  3K5M A;  1V1P B;  1D6E C;  5E4X A;  2YYZ A;  1F2Z A;  2F0H A;  1EQT A;  3GTJ B;  2K5W A;  4C3H G;  4ZK9 B;  1UUP A;  2CQA A;  2K28 A;  2B2T C;  1TWC B;  1HTP A;  2Z1C A;  4FXG C;  5EBC A;  2Q8I B;  4IFD I;  1TS2 A;  4KY7 A;  4ODG A;  2F0Q A;  3I72 A;  4QUF A;  2JA7 B;  3QWN A;  5JVH 3;  2DNC A;  1D1I A;  1H9S A;  1SNQ A;  3K5O A;  1EYA A;  4OIK A;  1CFM A;  2FHT A;  5C0X G;  4GZY C;  4DXG A;  3HOX B;  4F7X A;  2F03 A;  2Z8L A;  3M3Y B;  4ZRZ A;  2K5Q A;  2PYK A;  1BXT A;  3J81 L;  1WTR A;  5ELF A;  4EGV A;  2LKV A;  2PZU A;  3LX0 A;  4FVM A;  3R2T A;  3KUP A;  3NUC A;  2BE5 D;  5M3M B;  1D5M C;  1S4Z A;  3K0Y A;  5E3F A;  3J80 L;  5FO8 B;  3DUZ A;  3I4N B;  1XX8 A;  4CKC A;  1BUV T;  5I6W A;  4UDU C;  3TP6 A;  5C44 B;  5JEA J;  5DM7 3;  2IL8 A;  3QJY A;  4F88 A;  3LWU A;  1DZ1 A;  1XTC D;  3E0J A;  1SXT A;  4C56 C;  5HUR A;  2WKC A;  5CR3 A;  1EY7 A;  1W6K A;  3TZD A;  2L12 A;  2R92 B;  3KLS A;  3X3N A;  2KHS A;  2O2L D;  1CI3 M;  2M2L A;  1YNN D;  1B50 A;  2ZXR A;  5FLX E;  2JA5 B;  4IUU A;  1EU3 A;  1F9S A;  4CGY B;  1PYW D;  1V8Q A;  1HTL D;  1B9M A;  2HCI A;  1YNJ D;  4MIU A;  3PUZ A;  2A6E D;  3L7Z C;  3H3V C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...