1D1IA

Mutated shiga-like toxin b subunit (w34a) complexed with receptor gb3 analogue
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
69
structure length
69
Chain Sequence
TPDCVTGKVEYTKYNDDDTFTVKVGDKELFTNRANLQSLLLSAQITGMTVTIKTNACHNGGGFSEVIFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SHIGA TOXIN B-CHAIN
publication title Mutated Shiga-like Toxin B Subunit (W34A) Complexed with Receptor Gb3 Analogue
rcsb
source organism Escherichia coli
molecule tags Toxin
total genus 16
structure length 69
sequence length 69
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 1999-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.70 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1d1iA00
1R4PB 2C5CA 2BOSA 1D1KA 1C4QA 1QOHA 4M1UB 2GA4B 1C48A 3MXGA 1QNUA 1CZGA 2XSCA 1D1IA 4ULLA 1DM0B 1BOSA 1CZWA 1CQFA 4P2CB 1R4QB
chains in the Genus database with same CATH superfamily
5D14A 3H3VI 3HS0C 3AEVA 1D1KA 1K3RA 2NVTB 1MIUA 2LY7A 2F0WA 1O7YA 2Q2HA 2UXCQ 1EY7A 5FO9B 1UE5A 3FHWA 1EY0A 3SR1A 2JA8B 1IBLL 3I4NG 5CBEE 1N36Q 4L5RC 2JEBI 1OXUA 1PZKD 3RZOB 4A3FH 5E7NA 2M00A 3NTIA 3E6ZX 3S2DB 4G7OC 4DR4L 1IKMA 5M3FB 4WJ3M 3PCOB 4FF3A 3M7NA 5CBAE 3QG1A 3A8KE 3AB9A 3I8ZA 4UDUC 3S1RH 2NVQH 4X3KA 3K81C 3NENA 2JXMB 1V8QA 4DV3Q 4JPBW 3I4OA 4JI8Q 2O5IC 1M8AA 3ULJA 4DV4L 4C3IG 5LL6X 4RCNA 5IGGA 2Y0SG 5C6AA 1GUWA 1V1QA 4XXEA 2UXDQ 2CW0D 5IT9c 1BCPD 5IGEA 1SRUA 2O5JC 3VR5A 1PTOH 2E2JH 2CHBD 4CJ0B 2F0JA 1Y1VB 2K05A 4P72A 2GVBA 1TVXA 1KDBA 4JC0A 3RMHA 3S15B 1EY9A 1SMYD 2Z8LA 4OELB 1AP0A 1MBYA 1S5BD 4LUOA 4RG1A 4KD3A 1VF7A 2B2TC 1PH8A 1D5XC 3K8AA 4ZKBB 3HRZC 1NR2A 1VQ8A 4A3LH 2AKWB 2L5TA 5DM63 4R4CA 3H3VH 1FGUA 3I7FA 4DUYL 3K0XA 1WD0A 1EWHA 3BZCA 3WOEA 1AE2A 2OT2A 3OIPA 3PUYA 4GLAC 3WDNA 1PV4A 2WINB 4A3FB 1TS2A 4HCEA 4KLKA 3NE5B 3D3RA 5IYDG 1CKMA 4BA1I 1XTDA 4ZUJA 1JMCA 4JG2A 1Q12A 4ZAIA 4U68A 2DY8A 2ZTDA 4XQJA 3A5UA 3S1RB 2NVQB 1ASYA 3G48A 1HA6A 4Q0FA 4A3CG 1SN8A 5I9OA 3DLLA 4DUZQ 3KLWA 3PUWA 5E4WC 1BO0A 3D8GA 4YY3L 2RHQB 1BCPF 1UEAB 3MXUA 1EQTA 1I4QA 2FXQA 2OQ0A 3C1EA 4A3MB 3N6RA 1PTOB 4RA8A 2E2JB 2X69A 2VL6A 1GJXA 2L15A 4DR2L 2I07B 4BBRG 1CM9A 2RQXA 4DAYB 4QMGA 3DEOA 2JA5H 3K80C 2RF4A 3W1GA 4KY7A 1F9SA 5IYBH 1E7ZA 1OXVA 1LO5D 2MUYA 4C3JG 5JPNC 4RH6A 5CV6A 5EGTA 4K14A 1UNSA 1SFOH 5M5YH 3TQYA 1S4ZA 2EYPA 4X62L 5C3EH 2B63H 3SK4A 4ILWA 2IT1A 1STGA 4DNIA 3Q22A 4DN4M 5I9PA 3M4PA 3K0YA 2F0EA 3A55A 4RFBA 2Y0SE 3Q24A 1YNJD 2VQFL 1TWHH 1YNXA 3FPUB 3HEJA 4R8IA 3BDLA 5AJ3L 3OTOQ 2N49A 4P75A 3S1NH 4X64L 4E6IA 1CKNA 3C2PA 4NXML 2BDOA 1PYSB 3J80c 3T53B 1S72A 3GO5A 3SDZA 2F0QA 1WTHA 1J5EQ 1K83B 2JA8G 1K0SA 1CZWA 1H9SA 1HNXQ 3LNNA 3CXCA 3CCLA 1A6XA 1A3VA 4OO1G 1B44D 4YIJA 2WACA 1L1OA 2R3ZA 1PH7A 4ZRZA 2H1EA 2IHFA 1N33Q 5K36H 2JA5B 1AEXA 4J6HA 5C44H 5CYUA 5JVH3 4IFDI 2R7FA 3LWUA 2AQ3B 4TKOB 1LTAD 4A76A 2Q2UA 3QWNA 4EX5A 1SROA 3BYYB 1Q82C 2QDLA 4DR7L 1E1TA 4JI7L 4P73A 1SFOB 5M5YB 2LXJA 1Q81C 1JWMD 1VMPA 2E5LL 5C3EB 4DR3L 2B63B 1RODA 4H44C 3GTPH 1PRTD 5JAVA 1Y1VG 3E0EA 3DUZA 2BDNA 1PRTB 5EKKA 2EJGC 3JC66 1EZ6A 3U58A 1I94L 1ZEQX 1TWHB 1D1IA 3JAML 4Y7NH 5IT9L 1LABA 4R4OA 3S1NB 2KEEA 2ZT9C 1OXXK 3ZJYC 1TY0A 4LAAA 1PZJD 2HIXA 1VQ9A 1RL2A 2B29A 5DM73 1D7QA 3KDFA 2PQAB 2F3IA 4DK6C 4HAEA 2F0TA 1EU3A 1SE2A 4QUCA 1JWUD 1BNZA 4G7ZC 3M7GA 1SMXA 1SSOA 3CCQA 4LF8Q 3PQIA 2NBFA 1KTKA 2MO0A 1EQVA 1XWEA 3P20A 3S9WA 1JQYD 3EJIA 2OF1A 1GHKA 4JVZA 1B3AA 1PH3A 1FR3A 1B8AA 1FYCA 1X3PA 2CH4W 2HHHL 4IFDH 4TRDA 4ODGA 5ELNA 4AIMA 1Q1EA 3HOVG 3X3NA 2R61A 5GADC 5IGDA 4PMBA 2H5XA 5KYLA 5EBDA 2KHJA 2I5HA 1PRTF 3GTPB 5IYCG 1SJHD 3AU7A 2HCCA 4TVAB 4UY8C 4R8NA 3NBHB 2ZJPA 2C5CA 4UP8A 1H9MA 1CHPD 4DV5L 3NQTA 1RJTA 4IUVA 2NYZD 4Y7NB 2WKDA 2EYLA 3NUCA 2PYKA 2QGQA 3K7AH 1I4PA 1MD2D 3MAQA 4DR5Q 3I4MG 4MTKA 4OX9L 1LLRD 3D6CA 2A8VA 4A3LG 1Q46A 5M5WH 1K28A 1NMGA 2V1CC 1NY4A 1X65A 4HJ8A 2ES2A 1OTCA 1RD9D 1DOMA 5KNBA 3OPOA 4FXGC 4FVMA 4JI3L 3PUXA 4AYBG 1K8OA 1PH6A 4A75A 3HOWH 5K5PA 2HQEA 5C4JH 1KXLA 2A6HC 4A3EH 2XNAC 2ATWA 2MP1A 4EQOA 4BBSH 3MXNA 3A8JE 2V4DA 2AMCB 2I5MX 3UDXA 3KBXA 5EPKA 4R9WA 3VR3A 1GUTA 2UU9Q 2QCPX 1MHWC 1U9RA 2HDMA 3STBD 3RLFA 4DFAA 2RKSA 1GVPA 3BVZA 2DN8A 2NN6H 1VQEA 4WJ4A 3BS1A 3A54A 1V1PB 1I50H 3CCVA 5C5MA 5A2QE 4UP9A 4RAUC 1Q1BA 1SDFA 1KAAA 2HQLA 2EYFA 4HJ7A 2XIWA 3RNUA 1EIGA 2JA5G 4LF4L 4FP5D 1KDCA 2A69C 2F03A 1GD7A 4IUNA 2R93H 1SE4A 5IYBG 4NXNL 5M5WB 3VDYA 3DMUA 1OO9B 1A2TA 1A8VA 2KBNA 1M1KC 3QOLA 5M3MH 4A3GB 3KLRA 3AQQA 1WTPA 2WB1B 2YV5A 5IP9H 5C3EG 1FL0A 3CCJA 2ICEC 2OTJA 4A3JB 1WVLA 4WFN3 3HOWB 4GN3B 4P71A 5C4JB 4L5TA 3I90A 2JA6H 4A3EB 1YJNA 4BBSB 4CDCC 3K5OA 3OW7A 1EIHA 3R2TA 3MFYA 2VQEL 2KUMA 2PZWA 1Y1WH 1VDZA 2UUCQ 1GM5A 4AH6A 5DAUA 3GTJH 3UDGA 1XMQQ 2JQOA 1A2UA 4LFAQ 3VYUA 1VF5C 5CV7A 2JEAI 3P1HA 1SYDA 3HKZE 4ULLA 1UE7A 4JI0Q 4ZQ3A 1I50B 3JAMi 3C1FA 3F1ZA 3Q8DA 4GS3A 3EFXD 1PZID 1B1ZA 3F2UA 3VA7A 1XMOL 2CFMA 5C0XH 5DNFA 1GXDC 1HNZQ 5EAYA 4HJ5A 1JOQA 3R3OA 1WOCA 1TKWB 3J80E 5C44G 1A15A 1QOHA 1FGBD 2B2YA 4KI0A 1KRTA 4JBWA 2R93B 3QJYA 3ULPA 2XSCA 2J7ZA 1N34Q 2B8GA 2D9UA 1XNRQ 4AYBE 4BY7H 3KJOA 3I72A 5IGCA 1XPOA 5M9OA 3TREA 2L9HA 2DNCA 5D65A 3FKIH 1BCPC 4IO9A 1X55A 1J8IA 2JA6B 1VQBA 4NKLA 1PFBA 5KGUA 1UUPA 1BXTA 2F0UA 1SMYC 2PMZB 1I6HH 2IPKD 1PA6A 3Q23A 4F8MA 4K0KQ 1Y1WB 1YBYA 4L63B 2Z4IA 2HD3A 2OCEA 4XQNA 1YVCA 3J81L 1GHJA 2EPBA 4CKEA 3GTJB 1GOZA 1WTQA 3CHBD 2BH2A 1B2TA 4ALPA 2VB2X 1ICFB 5LMUQ 1SAPA 2LFNA 2K28A 4GLVB 4F7XA 4AQYL 2P5ZX 3H6MA 4QIWE 2Z6KA 2PZUA 4DK1A 1O78A 3I3CA 3MXGA 1SNOA 1OXTA 3V2TA 2NZ1D 5FLXL 4P74A 2BH8A 2KCMA 4JYAL 2NVTH 1HPCA 1PYBA 4K8IA 3T4AC 4YWKA 2OWOA 3C3LA 1XNQL 2K01A 2R7ZH 4IFDG 2F4VL 3A74A 2YTXA 1HQRD 1EZ8A 4JOIC 5BN4A 1L0WA 4LFCL 4BY7B 1KABA 4GOPA 5JJIA 3TS0A 1PH4A 4GNXC 4JBKA 4RHSA 3FKIB 1LYLA 4C1NK 1CFMA 2N78A 3OIQA 3GQBA 4RGTA 3HOUH 1GUGA 1U4MA 2XRSD 1DZ1A 4JCVE 3I56A 3E9HA 4PNYA 1I6HB 1LT4D 1ILPA 3QOJA 2UXBQ 4GZYC 2M2LA 5G3LD 1STNA 1YIJA 5CGKA 1PXUA 4FXDA 4B3TQ 3OMCA 4XTCS 3KLSX 3MA2B 1YHAA 1PH9A 5I6WA 1VQ6A 2IX3A 2BA1A 4DV7Q 2WB1G 3G71A 4LF7Q 4KHPL 4ZK9B 2RDHA 2F3WA 4HSPA 5KIXA 2ZXRA 2KOLA 3KLSA 4BBSG 1X3GA 1Q8IA 2F0SA 2UXCL 2LXKA 3HOXH 3SK8A 1EU4A 1YNJC 3AFQA 2R7ZB 4HIKA 4A3BH 1N36L 3A0JA 5IODA 2SNSA 2Q8IB 3CF5A 1WTXA 3N52A 3OHXC 1WTWA 2WAQB 5NUCA 4IFDJ 1IL8A 4QUFA 4B3RQ 2NN6G 5EKIA 3C46A 3FDTA 4DV3L 4JV5Q 4JI8L 2A1AA 4DV1Q 3HOUB 1EQQA 3GTOB 1N9WA 1EWIA 4LFBQ 1EIFA 1F2LA 5G3LF 4XQQA 3U50C 4XIGS 2UXDL 1DJRD 2G5DA 3CU7A 4A3MH 4CGYB 5FO8B 1JT8A 3U4VA 1BCPB 3GP7A 1B3QA 1AE3A 3S14B 1XX8A 3HOYH 2F1MA 5JEAJ 1HQMC 3KFUA 2EY6A 1S5ED 3CRKC 1L1OB 1KHIA 2D0OA 2VW9A 2JN4A 5M3MG 3TEHB 1VQDA 2EQSA 4X65Q 1F9QA 4ZUIA 4KKSA 2K04A 5IP9G 5KEEA 3IKJA 4LF5L 1ZYRD 2L11A 2LSSA 1E3PA 1NNXA 3KF8A 1IL2A 3T1HQ 1VQPA 2KJXA 3UI2A 1PRTC 4R4IA 2JA6G 1DD2A 3SK5A 4GN4B 3KBGA 1CA6A 4CHTB 3HOXB 1RKNA 3SK6A 2B2UA 2G9HD 4B3ML 1IW7D 4A3BB 1Y1WG 1F2YA 3CPFA 1N8RC 4ABNA 4IPCA 1SNMA 2GA4B 3NTKA 1JWSD 1M4VA 2Q2IA 4K6DA 4YWLA 4TSSA 4DR1Q 2DJGC 1D2BA 2JK8A 3KF6A 2NUCA 5GROA 2PCFB 3U4ZA 1SNQA 4DUZL 3TRZA 5C0XG 1R4QB 3HOZH 3J81i 2EYHA 1IKLA 5ELCA 3KUPA 3GV3A 1K3BC 4GNXB 4CDDC 1SYBA 3EBEA 1K83H 4KK7A 4YWMA 3HOYB 3VYTA 2UUAQ 3M4YA 5C3WA 1PH5A 5LHY1 3NXWA 1SYEA 5FK9C 2MPMA 3U9OA 3R8BA 3FKIG 4EQ5A 3EIVA 2F0IA 1EEID 1JCKB 1MSHA 4QF4A 2B3GA 3T1YQ 1KL9A 1PFNA 1HTLD 4KTAA 4DGZA 1BVSA 3E0JA 4JI5Q 1K0RA 1A3TA 2AWNA 1YJWA 2AWOA 2EDGA 2KCCA 3LWEA 2FJ2A 2OQKA 2KA7A 3EVQA 4JI6Q 5D3IB 1X3EA 2G9DA 3BVGA 3DWAA 3H91A 3TP5A 3KJPA 2XGTA 1W6KA 4B3SQ 3S24A 4IPDA 2E76C 3NWTA 4ZCKA 3BZKA 1JB7A 3OTOL 5IWAQ 4PMCA 4CKBA 3HOZB 1A3UA 1EL0A 4JBJA 1BUVT 4GKJQ 1QJOA 4WJWA 4JI2Q 4R4QA 2EY2A 1E22A 4DXGA 5C0XJ 1EY5A 3FEWX 2RDFA 5GAHC 1J5EL 3W3AA 5F2DA 2R7ZG 3BDCA 1R4PB 1XPUA 1HFGA 1JJCB 1MGSA 1HNXL 1A62A 1T5EA 4DV0Q 4TQUS 1VS0A 3STBC 1N32Q 1B9MA 1IXRA 5M3FG 1RTOA 4L5SA 3L9AX 4K2LA 1N33L 1Z6HA 3T16A 2PMZE 3F2CA 2JJQA 2M9VA 4I65A 2JA9A 4EQNA 1KNEA 3HOUG 3K58A 3PSIA 3BVMA 1GUSA 1YNND 4X3TA 3MEHA 2RCFA 2QDBA 4ZKCB 1CQVA 3MVVA 1IBKQ 3E9IA 2D0PA 2HCIA 5JJKA 1F9RA 3TP8A 2RDGA 1Z9FA 5ELBA 3X3MA 3NSWA 2ZTCA 5C4XH 2K32A 1CKOA 1RIPA 1XTCD 4YCUA 3E5SA 4OWWB 2TMPA 2EY1A 1FVIA 1BR9A 2F0DA 1VQJA 2D2CC 2NB0A 3RR5A 5EPLA 4PQXA 3MHBA 1IBMQ 1Q86C 2FINB 4JI4Q 3F2DA 2HIVA 5C4HA 3NQIA 3OOCA 3RUZA 1PHJA 3HOXG 4BXXH 1JOOA 1NBWA 3RLOA 1FD7D 4APVA 2JP1A 4A3BG 2J0TD 4A3FG 3S1QH 2HDLA 1LTID 1NE3A 2JA7H 4QJFA 1G51A 4LF8L 1STHA 3QO2A 2RCNA 1BBXC 3RLNA 1BQQT 5DEHA 2CWAA 5FJ8H 1HXYD 1RCVD 5LMNQ 3HFZB 3HG9A 2VZAA 5ELDA 2KEDA 2EXDA 2MQHA 2AUKA 4DV2Q 1P8LA 1E2ZA 4NP5A 1QB5D 4KJOA 1X9NA 4HTHA 1EOTA 1SNDA 4A3MG 4YHHQ 2Q8TA 3BZDB 2D62A 1VQ4A 4DAYA 1EUJA 1DCZA 3HGBA 1PFMA 3HOYG 1V9PA 3L2PA 1X3FA 2KENA 2WP8J 4FO2A 4XT1B 5C4XB 4FNFA 5IOCA 1PH1A 1YZ6A 3CAMA 2K14A 5J1ZA 2Z6BA 4QY7A 5JEAH 2LMCB 1SJED 1RTNA 1U0LA 2IJ0A 4IJLA 3CP0A 1HFNA 1EOVA 1HTPA 2B2VA 2KHIA 3MC0B 4RWSC 4DR5L 5A35A 4NMZA 1TWGH 4N8X1 2I5LX 3TP6A 2B2WA 1HRJA 4LF6Q 4A3GH 1WJJA 3MTSA 5ISRA 4BY1H 4GKKQ 1TS3A 2L1BA 2N8NA 2B39A 1SNCA 3IAYA 2XWJB 3JAME 3PUVA 3SEBA 3S1QB 4A3JH 5L37A 1LTTD 2AQ2B 2JA7B 3PO3H 1EYAA 2X6LA 3CC7A 1KLGD 4KMUC 4XYOA 3F2BA 4KKUA 5IE8A 4FXKC 5M5XH 1SEBD 1TS4A 4YCVA 1II3A 1PDQA 1CA5A 4QL5A 1YITA 3ITPA 3SHLA 2AQ1B 2KHSA 2LKVA 3HOZG 3NTHA 2UU9L 1D5ZC 1D8LA 4QCLA 1K8GA 2YYZA 2NWGA 4KY6A 4O2DA 5C4ZA 5BR8Q 2EY5A 4HR7B 4DV6Q 3IL8A 3D6WA 4RCOA 1F77A 1G8ZD 3OYYA 2K1BA 2ID0A 1QVFA 1SNPA 2A6ED 2X6GA 1V43A 4J15A 3J80L 2QKIC 1ZKOA 4O0AA 2K5NA 3CRLC 1WFQA 2B2TA 1LT5D 1B53A 1TWGB 2C9OA 1HH2P 1HZ9A 1I5FA 1G91A 1F2MA 2OEOA 1QUQB 3FP9A 4QGUA 2ZM6Q 4BY1B 1FNVA 5HGQA 2PZTA 1FJGQ 4LF4Q 2B63G 3GTQH 3VYSA 1AZPA 1CT1D 4RKBA 1EFWA 4L5QA 4H7BA 4G7HC 4X3SA 2K6AA 1LUZA 2XN9C 3RD4A 3PO3B 4M8AA 2BE5C 3OW2A 1EYDA 2E74C 4IQZA 1D6EC 2CWPA 3CQZB 4L8JA 1BDOA 1I4XA 4R4TA 4IUQA 3M85A 2EVBA 5M5XB 4OWXB 2PQAA 3AYHB 4IOCA 4N8FA 2JYOA 3BYTB 1EEFD 3PIO3 1ICWA 1W3SA 2UUCL 4BS9A 1XMQL 4WORA 4LFAL 3CCSA 1E24A 5E3FA 4JI1Q 4X66Q 2ZTEA 4JI0L 4IOAA 4K5VA 4PG3A 4LNQA 1VMCA 3ERSX 2ASBA 3UDIA 1SYFA 2K5WA 2E2IH 3Q6SA 3UE1A 1HNZL 3KOJA 5K36G 2F52A 3MZ5A 3K6OA 5FOBB 4DXFA 5C5LA 1JOKA 2NZHA 1W2BA 2IX0A 1HNWQ 2EIFA 1HHVA 1X6OA 1ENCA 1N34L 1XNRL 2VS1A 4XDXA 2Y0SB 3HKSA 2UUBQ 1HA5A 2PW5A 5BN5A 3NBHA 1LTBD 4V0BA 2CW0C 1JJGA 3GTQB 3TZUA 1PFSA 2CQOA 2QEXA 1GKHA 1Y14B 4DKAC 5IGFA 1L1OC 3NHHA 5JVG3 3UE0A 1STEA 4OO1I 1HZAA 2XTIA 3IFDA 4HCSA 4KKTA 1Y69U 4KD4A 1LTSD 1DYQA 1O7LA 4C1NI 4BA2I 3PMFA 2R92H 4K0KL 1FNWA 3OWFA 4A3DH 1W6JA 2OTLA 5EQ0A 2EOTA 3VA5A 2VY3A 3CKIB 3EROA 3I2ZA 1UE6A 5CV5A 5LMUL 1G6ZA 1NUCA 4MNOA 3GTKB 4BXXG 2Q2TA 3GD7A 2IHEA 4FF1A 4UPAA 3D31A 1O7ZA 1RHPA 3I70A 4NW2A 3B6YA 2JA7G 1EY6A 1JJ2A 2K5QA 2E2IB 4HSVA 4EGVA 1EY4A 5T1GA 1QNKA 1J9OA 2CKZB 4UP7A 3BU2A 1HR0Q 4PV1C 1TXYA 1ENFA 4OHJA 1CSPA 2HUGA 1V1PA 4FYDA 2R7DA 3ICEA 1KRSA 1DOKA 3CCUA 2A19A 2IX1A 1F9PA 1X32A 3SXHA 3PGZA 1YHQA 3H0GH 4CDEC 4L6TB 4DR6Q 1L2FA 4DAPA 3GTOH 1PYWD 2QEJC 3Q0AA 3RZDH 3D0FA 4NDXA 1HUNA 5JEAG 3QB3A 1YEZA 2MGSA 3ZYYX 3RN5A 2H4OA 2FHTA 2R92B 1QVCA 3CC4A 2UXBL 2A68D 1BBWA 2SOBA 4IPGA 2EYOA 4A3DB 3S14H 4IUTA 1VQ5A 1QE6A 4HN7A 4IURA 5GAEC 3AMUA 4B3TL 1YI2A 5AFWA 3PIOA 3QIAA 4A3GG 2KCTA 4BY1G 3M3YH 2J4XA 2ZXOA 4DV7L 1QZGA 4IZ8A 3J80i 2BA0A 4LF7L 2F0MA 4UAIA 3ER0A 4U673 4A3IH 3A8IE 5EJWA 4KHZA 4KJNA 4A3JG 3HOWG 4A4IA 3PO3G 4LF9Q 4A3EG 3I4LA 2SDFA 4LWCA 3K5LA 1AFPA 2B8FA 1CZGA 3OMGA 1XXGA 3G4SA 4C3HH 3DWPA 5GQOA 5HGTA 2XVSA 3NP8A 3ND9A 3CCRA 5ELEA 1LTLA 1BOSA 4KN4C 4OEMB 1E1OA 4GN5A 3NBIA 4O1NA 1CQFA 5FLXE 2K5DA 1M90C 2BOSA 1G6PA 1WTRA 1JB3A 3J7A5 4B3RL 1DONA 1NSNS 1IBLQ 3H0GB 4V190 1VQMA 4JV5L 1LTGD 1SYCA 1CKNB 5DLQE 5KYIA 1JE5A 2QF7A 3TZDA 4RGMA 1UE1A 4I7ZC 4DV1L 3RZDB 1TWFH 4LFBL 4DR4Q 5KNCA 1QZHA 1JR0D 3CC2A 1V1OA 1H9SB 2R93G 1J6QA 3DXJC 2NZOA 2DNEA 3BJUA 4DV4Q 1P16A 3AFPA 3GTLH 1Y8PB 3PUZA 3I73A 2EZVA 3J7AV 4F88A 4S3SA 3HOVH 1YJ9A 3M3YB 2D5DA 4LUVA 4X65L 2WV6D 1YNNC 3JAMc 2I46A 3T56B 1VQOA 5FLMH 1SBBB 4A3IB 1DXMA 2L4NA 1B9NA 2PW7A 3T1HL 1XYIA 3M4OH 5KRUA 5IYCH 2YTYA 2F0VA 2VUMH 3A56A 3E3XA 3V05A 1NAPA 2ZJRA 4C3HB 1TQOA 1X56A 2IW3A 4RKLA 5C3XA 1Y8OB 2L12A 2MO1A 3IRBA 3H15A 4LF5Q 1TWCH 2DY7A 4ME5A 1CSQA 1C8CA 1Q90A 2VXWA 5I2YA 3OWEB 3I4MH 1HUMA 4DUYQ 4C56C 1H9JA 1TU2B 5J39A 1KQSA 4K5XA 1T5XD 3RN2A 2IL8A 1VQGA 1ASZA 4DR1L 1Z7TA 4RMFA 4B3MQ 2Q8RE 1GO3E 4IJHA 1I4HA 3DM1A 1TWFB 3KDFB 5J3BA 5EKLA 1SR3A 3H09A 4LMQD 3J7ZC 4CJ2C 2LS01 4Z9CB 1K73C 2WB1E 1X3QA 1YHBA 2QILA 1Q3LA 5I6YA 4IUPA 2WFWA 2UUAL 4HIMA 3GTLB 1L0YB 4XYQA 2Z4HA 1DOLA 4BY7G 4MTNA 4YY3Q 3HOVB 1OXSC 1CK1A 4ME3A 2EYJA 3P7JA 4PZ7A 1WI5A 1KLUD 1PTOD 1VQLA 2JE6I 1JC7A 3J7YW 3TMEA 2CQAA 1EY8A 1QWYA 3M4OB 2F0KA 4IPHA 3T1YL 1IYJB 2MFIA 2VUMB 3FVQA 2ZJQA 1WTOA 4DR2Q 3HKZB 4JI5L 1EFID 2B2YC 1ESFA 4DK3C 1BBUA 2IY5B 2R92G 1MSGA 1SE3A 1TWCB 4A3DG 4A93H 3I55A 5E1FA 2ZXPA 5IP7H 4CKCA 3I4MB 1AN8A 2VB3X 3TBIB 3KK7A 4PMWA 4JI6L 2HT1A 2PPBC 1CI3M 1PVOA 2K5VA 4B3SL 1NTGA 4X62Q 2K33A 2R6GA 3PO2H 1AZQA 5JOBA 5IWAL 1PH2A 1H95A 4AYBB 4OGQC 1KNAA 4GKJL 2F0HA 4HIDA 4JI2L 4WRDA 2Z9HA 2VQFQ 1VQNA 4LJZC 1CTMA 3TDQA 2K5HA 3TSSA 4A3KH 2NVYH 3R2IA 5H1SE 5AJ3Q 2RSNA 4X64Q 1XPRA 2WAQG 3O13A 4DV0L 4NXMQ 4QB4A 1N32L 3FPPA 3MXNB 1PTOF 1HZCA 2EE1A 4DU9A 2Z6KC 2F0FA 3CW2C 1QCBD 3H0GG 1VQHA 4KN7C 1U4PA 3A7AB 3BDOA 4MHEA 2E8GA 3DWQA 4DA2A 1FNUA 2F0PA 4PZ8A 1F2ZA 2A6EC 3KYHC 1TIID 2CH4A 2QA4A 1B50A 1UAPA 4HMJA 2FFKB 1JICA 4QIWB 2EXZA 4ID6A 3GV6A 1IBKL 1NMFA 4A93B 4KHVA 4O42A 1Y8NB 3W2DA 1AH9A 1WYDA 2MHVA 2SNMA 4I7AA 2WIIB 5CV4A 3VR2A 4DNTB 4GOPC 5CMDA 4CBVA 4DR7Q 5HY6A 1X54A 1NR4A 3HZXA 4JI7Q 2E5LQ 1S5FD 4Y52H 4DR3Q 4A3IG 3PO2B 4Q5VA 2QW7A 4JK1C 4CDFC 3SVMA 1IBML 1LV9A 3PV0A 4JI4L 4BWGB 1HCZA 3S2HH 2OXPA 4K2KA 1G2SA 3DM3A 1I94Q 1E0BA 1QNUA 4NPSA 1B7YB 4QQBX 4C3HG 1E2WA 4A3KB 2NVYB 2E75C 4DF7A 2N3SA 1EWCA 1U4RA 4CJ1B 3ERQA 3LGJA 1RF2D 5CORA 5IGBA 3NEMA 4JOIA 3H94A 1UWVA 4MZ9A 1U5KA 2XRQD 2L55A 1STBA 4OWTB 3TN2A 1C0AA 3W1BA 5LMNL 4GNXA 1MI2A 4KV6A 1U4LA 2PQEA 4H13C 2FMCA 1ML0D 1C48A 2ENBA 1C7YA 5LMNW 4DV2L 1O7IA 3S16H 3NPPA 1STYA 3NWSA 4MN3A 3NK9A 4JW0A 4YHHL 5C44B 4OXPA 3P75A 4P2CB 2HHHQ 2K03A 5A2QL 2I0QA 1D5MC 2YU9H 5JJLA 1PLFA 2Z1CA 2NN6I 5FLMG 3URYA 1SE8A 3GTGH 1IYUA 4HMIA 4XT3B 1VQAA 1UEBA 1R9TH 3J81c 1DM0B 1EQRA 1Q8KA 2RA4A 3L0OA 2VUMG 2E2HH 2YTVA 3S2HB 4LF6L 1SYGA 3HKZG 2WAQE 4OIJA 3A7LA 2A5HA 2MNAA 4DV5Q 2K52A 4GKKL 5KNDA 3CCMA 5JJZA 1ET9A 2PI2A 5IT9E 2RHSB 1IZ6A 4ZYSA 1I4GA 2PNHA 4N9TA 3CMEA 1KC8C 3D4DA 4OX9Q 1STAA 5FLXc 3LX0A 4FF2A 3ULLA 1ENAA 3CQZH 4IALA 4F87A 1WCMH 2EJMA 1E2VA 2CCZA 3T51B 4JI3Q 5I4DA 3WWVA 3S16B 3PF5A 3EN2A 4FF4A 1TWAH 3A5ZB 2B2UC 1G2TA 5BR8L 4DV6L 3U9SA 3WOFA 3I4NH 2PO4A 3OSOA 5D3DA 2PNRC 1VQFA 4IN3A 2XWBB 3W5OA 4HIOA 2YU9B 4HJAA 3BG3A 1H9RA 2IWHA 3K57A 2A74C 1IHZA 4DAMA 2O4XA 3GTGB 1KIXA 3G6JB 1R9TB 4X3UA 3D4RA 2NTTA 3HP3A 2GVAA 1A63A 4C3IH 3UDFA 4GOPB 1GUNA 4RGOS 2E2HB 5C0XI 3PF4A 2ZM6L 2F0GA 2DUDA 2E2DC 1MKHA 2Z0SA 3GTMH 3NELA 1TT2A 1H9KA 4DNRB 1FJGL 2DGYA 2EYMA 5FO7B 4A93G 3K7AB 1AW7A 1VCIA 5LL6S 2A68C 5ELFA 2K50A 5IP7G 3S17H 4NXNQ 3DEPA 2F0NA 3K7UC 1QILA 3PIP3 4C2MH 4J8QA 1HZBA 3DHQA 2JSOA 2VNUD 2K75A 1WCMB 1Z47A 2A73B 1EIYB 1G291 1ILQA 1L0XB 1QVGA 2FMMA 4IUUA 1BF4A 2KCNA 4H0LC 3PO2G 1I4RA 1ZXTA 2GN5A 3VR4A 4POFA 1KAWA 4G57A 4UHVA 1EYGA 3IFTA 4EVOA 1TWAB 3SGIA 3K5NA 3GTKH 4JI1L 4X66L 3G7LA 2NTSA 5IY0A 4A3KG 1K8MA 2VQEQ 3I4NB 4LK1C 3CPWA 1MJEA 1MJCA 2TSSA 4RHRA 4FDBA 5IYDH 3FRPB 1HJPA 1IYVA 5CC4A 4K8JA 1VQKA 1RDPD 1S40A 1WTVA 1K9MC 1LT6D 4A3CH 4HEDA 2AHOB 1HNWL 1O80A 3G6EA 1XMOQ 1K8AC 4C3IB 3T13A 1B70B 5JPMC 4R1JA 3TP7A 5EPJA 3CCEA 3GTMB 2UUBL 2NVXH 2K4KA 4PZ6A 1BKBA 5CV9A 1I3QH 2MJ8A 2PI2E 2N55A 4M1UB 3CMAA 3F8TA 2ICIA 3S17B 4N9PA 5C4XG 2F4IA 3ONAB 4C2MB 3M9BA 2KECA 2WKCA 5EBCA 4G4KA 1PMRA 5M3MB 5ELOA 1ET6A 4BBRH 2CVRA 5FKAC 3M4QA 1ZYRC 2F0LA 1CHQD 1TY2A 1KD1C 5BN3A 1VQCA 4LUZA 4NB3A 1TR5A 3ND8A 2EJFC 4LW1A 4C3JH 5CV8A 3J81j 3R93A 2KVMA 3MFGA 3KF8B 4DPGA 5I2XA 1IW7C 1ESRA 3S1MH 2A6HD 4RGNA 3K59A 4POGA 4ZLTF 5FJ8G 4KY5A 4MIUA 1LT3D 1XJVA 5T1IA 4AQYQ 2F0OA 3FMCA 1HR0L 5IIFA 1C4QA 5CR3A 1B4OA 4JYAQ 1HR0W 3EA6A 3EQLC 2SEBD 1T9HA 5COYA 4HJ9A 5GAGC 4EQPA 2NVXB 1S3OA 1XNQQ 1I3QB 3L7ZC 3KF6B 1LACA 1EYCA 3MXPA 2JA8H 2F4VQ 1JE4A 1VQ7A 1TS5A 2RBMA 4K6LA 4OL7A 1KDAA 3RZOH 3MEFA 4LFCQ 1S5DD 4DR6L 4OO1H 2C35B 4J1MA 5J22A 3VR6A 1NCVA 1SXTA 3S2DH 3K5MA 1ONLA 3I91A 1QUQA 1VQIA 3PIPA 3J7AF 4BBRB 1WD1A 3D4WA 3MWYW 1GUOA 3QR8A 5M3FH 1A0IA 1DGSA 2A69D 1PTOC 4H02A 2O2LD 2KQ3A 2L0CA 3CD6A 2ALYB 3TS2A 3VYRA 4DAVA 4B9XA 2RSOA 4OIKA 4OONA 4C3JB 2BCOA 4YCWA 2DJFC 5TSSA 1Q7YC 4B08A 4DK0A 4JBMA 1I6VC 2F3VA 3J81E 3H3VC 1QG7A 3S1MB 1Y1VH 2BE5D 1NJIC 4LF9L 1S5CD 1CUKA 3S15H 1SLJA 3SE0A 1C9OA 3L3OC 3V96A 1WCMG 4B9WA 1LM0A 4K5WA 2B2VC 5E4XA 1JORA 2N88A 3GDEA 4X6AH 4KHPQ 1LTRD 2K7VA 2RVLA 2B2WC 2AUJD 4GLXA 5HURA
chains in the Genus database with same CATH topology
5D14A 3HS0C 1D1KA 2NVTB 2LY7A 2F0WA 1O7YA 1EY7A 5FO9B 1EY0A 3SR1A 2JA8B 5CBEE 2JEBI 1OXUA 1PZKD 3RZOB 2M00A 3NTIA 3E6ZX 3S2DB 4G7OC 1IKMA 5M3FB 4FF3A 3M7NA 5CBAE 3QG1A 3A8KE 3AB9A 3I8ZA 4UDUC 4X3KA 2JXMB 1V8QA 2O5IC 1M8AA 4C3IG 5LL6X 4RCNA 5IGGA 5C6AA 1GUWA 4XXEA 2CW0D 1BCPD 5IGEA 2O5JC 3VR5A 1PTOH 2CHBD 4CJ0B 2F0JA 1Y1VB 2K05A 3RMHA 1TVXA 1KDBA 3S15B 1EY9A 1SMYD 2Z8LA 1AP0A 1MBYA 1S5BD 4KD3A 1VF7A 2B2TC 1D5XC 4ZKBB 3HRZC 1NR2A 2L5TA 5DM63 1WD0A 1EWHA 3WOEA 2OT2A 3OIPA 3PUYA 3WDNA 2WINB 4A3FB 1TS2A 4HCEA 3NE5B 3D3RA 4BA1I 4ZUJA 1Q12A 4ZAIA 4U68A 2DY8A 2NVQB 4XQJA 3S1RB 1HA6A 4Q0FA 5I9OA 3PUWA 5E4WC 1BO0A 3D8GA 1BCPF 1UEAB 3MXUA 1EQTA 1I4QA 3C1EA 4A3MB 3N6RA 1PTOB 4RA8A 2E2JB 2X69A 1GJXA 2I07B 1CM9A 2RQXA 4QMGA 3DEOA 4KY7A 1F9SA 1OXVA 1LO5D 2MUYA 4C3JG 5JPNC 4RH6A 5CV6A 5EGTA 4K14A 1UNSA 1S4ZA 2EYPA 3SK4A 4ILWA 2IT1A 1STGA 3Q22A 4DN4M 5I9PA 3K0YA 2F0EA 3A55A 4RFBA 3Q24A 1YNJD 3FPUB 3HEJA 4R8IA 3BDLA 4E6IA 3C2PA 2BDOA 3T53B 3GO5A 3SDZA 2F0QA 1K83B 1CZWA 1H9SA 3LNNA 1A6XA 1A3VA 4OO1G 1B44D 4YIJA 2WACA 2R3ZA 4ZRZA 2H1EA 5K36H 2JA5B 1AEXA 4J6HA 5CYUA 5JVH3 4IFDI 3LWUA 2AQ3B 4TKOB 1LTAD 3QWNA 3BYYB 1SFOB 5M5YB 1JWMD 1VMPA 5C3EB 2B63B 1RODA 4H44C 1PRTD 5JAVA 3DUZA 2BDNA 1PRTB 5EKKA 2EJGC 1EZ6A 1ZEQX 1TWHB 1D1IA 3JAML 5IT9L 1LABA 3S1NB 2KEEA 2ZT9C 1OXXK 1TY0A 4LAAA 1PZJD 5DM73 4HAEA 2F0TA 1EU3A 1SE2A 4QUCA 1JWUD 1BNZA 4G7ZC 3M7GA 1SSOA 2NBFA 1KTKA 1EQVA 1XWEA 3P20A 3S9WA 1JQYD 3EJIA 2OF1A 1GHKA 1B3AA 1FR3A 1FYCA 1X3PA 4IFDH 4TRDA 4ODGA 1Q1EA 3X3NA 2R61A 5IGDA 4PMBA 5KYLA 5EBDA 1PRTF 3GTPB 1SJHD 3AU7A 2HCCA 4R8NA 2C5CA 1H9MA 1CHPD 3NQTA 1RJTA 4IUVA 2NYZD 4Y7NB 2WKDA 2EYLA 3NUCA 2PYKA 1I4PA 1MD2D 3MAQA 1LLRD 3D6CA 1RD9D 1DOMA 5KNBA 3OPOA 4FXGC 4FVMA 3PUXA 1K8OA 5K5PA 2HQEA 2A6HC 2XNAC 2MP1A 4EQOA 3MXNA 3A8JE 2V4DA 3KBXA 5EPKA 4R9WA 3VR3A 1GUTA 2QCPX 1U9RA 2HDMA 3RLFA 4DFAA 2RKSA 3BVZA 2DN8A 2NN6H 3BS1A 3A54A 1V1PB 5C5MA 5A2QE 4RAUC 1Q1BA 1SDFA 1KAAA 2EYFA 2XIWA 1EIGA 4FP5D 1KDCA 2A69C 2F03A 4IUNA 1SE4A 5M5WB 3DMUA 1OO9B 1A2TA 3QOLA 4A3GB 3KLRA 1WTPA 2WB1B 2ICEC 4A3JB 1WVLA 4WFN3 3HOWB 5C4JB 3I90A 4A3EB 4BBSB 3K5OA 3OW7A 1EIHA 3R2TA 3MFYA 2KUMA 2PZWA 1VDZA 5DAUA 1A2UA 3VYUA 1VF5C 5CV7A 2JEAI 3P1HA 1SYDA 4ULLA 4ZQ3A 1I50B 3C1FA 3VA7A 1B1ZA 3EFXD 1PZID 3F2UA 5C0XH 5DNFA 1GXDC 1JOQA 3R3OA 1TKWB 3J80E 1A15A 1QOHA 1FGBD 2B2YA 4KI0A 4JBWA 2R93B 3QJYA 2XSCA 2J7ZA 2B8GA 2D9UA 3I72A 5IGCA 5M9OA 2L9HA 2DNCA 5D65A 1BCPC 1J8IA 2JA6B 4NKLA 1PFBA 5KGUA 1UUPA 1BXTA 2F0UA 1SMYC 2PMZB 2IPKD 3Q23A 4F8MA 1Y1WB 4L63B 2Z4IA 4XQNA 3J81L 1GHJA 2EPBA 4CKEA 3GTJB 1GOZA 1WTQA 3CHBD 1B2TA 2VB2X 1SAPA 2LFNA 2K28A 4F7XA 3H6MA 2PZUA 4DK1A 1O78A 3I3CA 3MXGA 1SNOA 1OXTA 3V2TA 2NZ1D 5FLXL 1HPCA 4K8IA 3T4AC 3C3LA 2K01A 4IFDG 1HQRD 1EZ8A 5BN4A 4BY7B 1KABA 4RHSA 3FKIB 4C1NK 1CFMA 3OIQA 3GQBA 4RGTA 1GUGA 1U4MA 2XRSD 1DZ1A 4PNYA 1I6HB 1LT4D 1ILPA 3QOJA 4GZYC 2M2LA 5G3LD 1STNA 5CGKA 1PXUA 4FXDA 3OMCA 4XTCS 3KLSX 3MA2B 5I6WA 2IX3A 2BA1A 4ZK9B 2RDHA 2F3WA 4HSPA 5KIXA 2ZXRA 2KOLA 3KLSA 1Q8IA 2F0SA 3SK8A 1EU4A 1YNJC 2R7ZB 5IODA 2SNSA 2Q8IB 1WTXA 3N52A 3OHXC 1WTWA 2WAQB 5NUCA 4IFDJ 1IL8A 4QUFA 2NN6G 5EKIA 3C46A 3FDTA 3HOUB 3GTOB 1F2LA 5G3LF 4XQQA 4XIGS 1DJRD 3CU7A 4CGYB 5FO8B 1BCPB 3GP7A 3S14B 1XX8A 2F1MA 5JEAJ 1HQMC 2EY6A 1S5ED 3CRKC 1F9QA 4ZUIA 4KKSA 2K04A 5KEEA 3IKJA 1ZYRD 2L11A 3KF8A 2KJXA 3UI2A 1PRTC 1DD2A 3SK5A 3KBGA 1CA6A 4CHTB 3HOXB 1RKNA 3SK6A 2B2UA 2G9HD 1IW7D 4A3BB 1F2YA 4ABNA 1SNMA 2GA4B 3NTKA 1JWSD 1M4VA 4K6DA 4TSSA 1D2BA 2NUCA 2PCFB 1SNQA 5C0XG 1R4QB 2EYHA 1IKLA 5ELCA 3KUPA 3GV3A 1SYBA 4KK7A 3HOYB 3VYTA 3M4YA 5C3WA 5LHY1 3NXWA 1SYEA 5FK9C 2MPMA 3U9OA 3R8BA 2F0IA 1EEID 1JCKB 1MSHA 4QF4A 1PFNA 1HTLD 4KTAA 4DGZA 3E0JA 1A3TA 2AWNA 2AWOA 2EDGA 2KCCA 3LWEA 2FJ2A 2KA7A 3EVQA 5D3IB 3DWAA 2G9DA 3BVGA 3H91A 3TP5A 1W6KA 2E76C 3NWTA 4PMCA 4CKBA 3HOZB 1A3UA 1EL0A 1BUVT 1QJOA 4WJWA 2EY2A 4DXGA 5C0XJ 1EY5A 3FEWX 2RDFA 3W3AA 5F2DA 3BDCA 1R4PB 1HFGA 1MGSA 1T5EA 4TQUS 1B9MA 1RTOA 3L9AX 4K2LA 1Z6HA 3T16A 2M9VA 4I65A 4EQNA 1KNEA 3K58A 3BVMA 1GUSA 1YNND 4X3TA 3MEHA 2QDBA 4ZKCB 1CQVA 3MVVA 2HCIA 1F9RA 3TP8A 2RDGA 5ELBA 3X3MA 3NSWA 2K32A 1XTCD 3E5SA 2TMPA 2EY1A 1BR9A 2F0DA 2D2CC 2NB0A 5EPLA 4PQXA 3MHBA 2FINB 5C4HA 3NQIA 3OOCA 3RUZA 1JOOA 1FD7D 2JP1A 2J0TD 2HDLA 1LTID 1STHA 3QO2A 1BBXC 1BQQT 5DEHA 1HXYD 1RCVD 3HG9A 5ELDA 2KEDA 2AUKA 1E2ZA 4NP5A 1QB5D 4KJOA 4HTHA 1EOTA 1SNDA 2Q8TA 3BZDB 2D62A 4DAYA 1DCZA 3HGBA 1PFMA 2WP8J 4XT1B 4FO2A 5C4XB 4FNFA 5IOCA 5J1ZA 5JEAH 2LMCB 1SJED 1RTNA 2IJ0A 1HFNA 1HTPA 2B2VA 3MC0B 4RWSC 5A35A 4NMZA 3TP6A 2B2WA 1HRJA 3MTSA 5ISRA 1TS3A 2L1BA 2B39A 1SNCA 3IAYA 2XWJB 3JAME 3PUVA 3SEBA 3S1QB 1LTTD 2AQ2B 2JA7B 1EYAA 2X6LA 1KLGD 4KMUC 4XYOA 4KKUA 4FXKC 1SEBD 1TS4A 1II3A 1PDQA 1CA5A 3ITPA 3SHLA 2AQ1B 2KHSA 2LKVA 3NTHA 1D5ZC 4QCLA 2YYZA 2NWGA 4KY6A 5C4ZA 2EY5A 4HR7B 3IL8A 3D6WA 4RCOA 1F77A 1G8ZD 2K1BA 2ID0A 1SNPA 2A6ED 2X6GA 1V43A 3J80L 2QKIC 1ZKOA 3CRLC 2B2TA 1LT5D 1B53A 1TWGB 2C9OA 1G91A 1F2MA 2OEOA 4BY1B 1FNVA 2PZTA 3VYSA 1AZPA 1CT1D 4RKBA 4H7BA 4G7HC 4X3SA 2K6AA 3RD4A 2XN9C 3PO3B 4M8AA 2BE5C 1EYDA 2E74C 4IQZA 1D6EC 3CQZB 4L8JA 1BDOA 1I4XA 4IUQA 3M85A 2EVBA 5M5XB 2JYOA 3BYTB 1EEFD 3PIO3 1ICWA 4BS9A 4WORA 5E3FA 4K5VA 1VMCA 1SYFA 2K5WA 3Q6SA 5K36G 3MZ5A 3K6OA 5FOBB 4DXFA 5C5LA 1JOKA 2IX0A 1HHVA 1ENCA 4XDXA 2Y0SB 1HA5A 2PW5A 5BN5A 3NBHA 1LTBD 4V0BA 2CW0C 3GTQB 3TZUA 5IGFA 3NHHA 5JVG3 1STEA 4OO1I 3IFDA 4HCSA 4KKTA 1Y69U 4KD4A 1LTSD 1DYQA 1O7LA 4C1NI 4BA2I 3PMFA 1FNWA 3OWFA 1W6JA 5EQ0A 2EOTA 3VA5A 3CKIB 3EROA 5CV5A 1G6ZA 1NUCA 3GTKB 3GD7A 4FF1A 3D31A 1O7ZA 1RHPA 3I70A 4NW2A 1EY6A 2K5QA 2E2IB 4HSVA 4EGVA 1EY4A 5T1GA 1QNKA 1J9OA 4PV1C 1ENFA 4OHJA 2HUGA 1V1PA 4FYDA 1DOKA 2IX1A 1F9PA 1X32A 3SXHA 4L6TB 4DAPA 1PYWD 2QEJC 3Q0AA 4NDXA 1HUNA 5JEAG 3QB3A 3ZYYX 2MGSA 2H4OA 2FHTA 2R92B 2A68D 2SOBA 2EYOA 4A3DB 4IUTA 1QE6A 4HN7A 4IURA 3AMUA 5AFWA 3QIAA 2J4XA 2ZXOA 4IZ8A 2BA0A 2F0MA 4UAIA 4U673 3A8IE 5EJWA 4KHZA 4KJNA 3I4LA 2SDFA 3K5LA 1AFPA 2B8FA 1CZGA 3OMGA 1XXGA 3DWPA 5HGTA 2XVSA 3NP8A 3ND9A 5ELEA 1BOSA 4KN4C 3NBIA 4O1NA 1CQFA 5FLXE 2K5DA 2BOSA 1WTRA 1JB3A 1DONA 1NSNS 3H0GB 4V190 1LTGD 1SYCA 5KYIA 2QF7A 3TZDA 4RGMA 4I7ZC 3RZDB 5KNCA 1JR0D 1V1OA 1H9SB 3DXJC 2DNEA 1Y8PB 3PUZA 3I73A 2EZVA 3J7AV 4F88A 4S3SA 3M3YB 2D5DA 2WV6D 1YNNC 2I46A 3T56B 1SBBB 4A3IB 1DXMA 2L4NA 1B9NA 2PW7A 1XYIA 5KRUA 2F0VA 3A56A 3V05A 1NAPA 4C3HB 1TQOA 2IW3A 4RKLA 5C3XA 1Y8OB 2L12A 2DY7A 4ME5A 1C8CA 1Q90A 2VXWA 5I2YA 3OWEB 1HUMA 4C56C 1H9JA 1TU2B 5J39A 4K5XA 1T5XD 2IL8A 1Z7TA 2Q8RE 1I4HA 3DM1A 1TWFB 5EKLA 3H09A 4LMQD 4CJ2C 2LS01 4Z9CB 1X3QA 2QILA 1Q3LA 5I6YA 4IUPA 3GTLB 1L0YB 4XYQA 2Z4HA 1DOLA 3HOVB 1OXSC 1CK1A 2EYJA 3P7JA 1KLUD 1PTOD 2JE6I 1JC7A 3J7YW 3TMEA 2CQAA 1EY8A 1QWYA 3M4OB 2F0KA 2VUMB 3FVQA 1WTOA 3HKZB 1EFID 2B2YC 1ESFA 1MSGA 1SE3A 1TWCB 5E1FA 2ZXPA 4CKCA 3I4MB 1AN8A 2VB3X 3TBIB 3KK7A 4PMWA 2PPBC 1CI3M 2K33A 2R6GA 1AZQA 5JOBA 4AYBB 4OGQC 1KNAA 2F0HA 4WRDA 4LJZC 1CTMA 3TDQA 3TSSA 3R2IA 2RSNA 3O13A 4QB4A 3FPPA 1PTOF 2EE1A 4DU9A 2F0FA 1QCBD 4KN7C 1U4PA 3A7AB 4MHEA 3BDOA 3DWQA 4DA2A 1FNUA 2F0PA 1F2ZA 2A6EC 1TIID 1B50A 1UAPA 4HMJA 2FFKB 1JICA 4QIWB 2EXZA 4ID6A 3GV6A 4A93B 4KHVA 4O42A 1Y8NB 3W2DA 2MHVA 2SNMA 5CV4A 2WIIB 3VR2A 4DNTB 5CMDA 4CBVA 1NR4A 3HZXA 1S5FD 3PO2B 4Q5VA 4JK1C 3SVMA 1LV9A 3PV0A 4BWGB 1HCZA 2OXPA 4K2KA 1G2SA 1E0BA 1QNUA 4C3HG 1E2WA 4A3KB 2NVYB 2E75C 4DF7A 1EWCA 1U4RA 4CJ1B 3ERQA 1RF2D 5CORA 5IGBA 3H94A 2XRQD 2L55A 1STBA 3TN2A 1MI2A 4KV6A 1U4LA 2PQEA 4H13C 2FMCA 1ML0D 1C48A 2ENBA 3NPPA 1STYA 3NWSA 4MN3A 3NK9A 5C44B 3P75A 4P2CB 2K03A 5A2QL 1D5MC 1PLFA 2Z1CA 2NN6I 3URYA 1IYUA 4HMIA 4XT3B 1DM0B 2RA4A 3S2HB 1SYGA 4OIJA 3A7LA 2A5HA 5KNDA 5JJZA 1ET9A 5IT9E 4ZYSA 1I4GA 4N9TA 3D4DA 1STAA 3LX0A 4FF2A 1ENAA 4IALA 4F87A 2EJMA 1E2VA 3T51B 5I4DA 3S16B 4FF4A 2B2UC 1G2TA 3U9SA 3WOFA 2PO4A 3OSOA 5D3DA 2PNRC 4IN3A 2XWBB 2YU9B 3BG3A 1H9RA 2IWHA 3K57A 2A74C 1IHZA 2O4XA 3GTGB 3G6JB 1R9TB 4X3UA 3D4RA 2NTTA 3HP3A 2E2HB 1GUNA 4RGOS 5C0XI 2F0GA 2E2DC 1TT2A 1H9KA 4DNRB 2EYMA 5FO7B 3K7AB 1AW7A 1VCIA 5LL6S 2A68C 5ELFA 3DEPA 2F0NA 1QILA 3PIP3 4J8QA 3DHQA 2JSOA 2VNUD 1WCMB 1Z47A 2A73B 1G291 1ILQA 1L0XB 2FMMA 4IUUA 1BF4A 2KCNA 4H0LC 1I4RA 1ZXTA 3VR4A 4G57A 3IFTA 4EVOA 1TWAB 3K5NA 2NTSA 3G7LA 1K8MA 3I4NB 4LK1C 2TSSA 4RHRA 3FRPB 1IYVA 5CC4A 4K8JA 1RDPD 1WTVA 1LT6D 4HEDA 1O80A 4C3IB 3T13A 5JPMC 3TP7A 5EPJA 3GTMB 5CV9A 2MJ8A 2N55A 4M1UB 2ICIA 3S17B 4N9PA 2F4IA 3ONAB 4C2MB 2KECA 2WKCA 5EBCA 4G4KA 1PMRA 5M3MB 1ET6A 2CVRA 5FKAC 1ZYRC 2F0LA 1CHQD 1TY2A 5BN3A 1TR5A 3ND8A 2EJFC 5CV8A 3R93A 2KVMA 3MFGA 5I2XA 1IW7C 1ESRA 2A6HD 4RGNA 3K59A 4ZLTF 4KY5A 4MIUA 1LT3D 5T1IA 2F0OA 3FMCA 5IIFA 1C4QA 5CR3A 1B4OA 3EA6A 3EQLC 2SEBD 5COYA 2NVXB 4EQPA 1I3QB 3L7ZC 1LACA 1EYCA 3MXPA 1JE4A 1TS5A 2RBMA 4K6LA 4OL7A 1KDAA 1S5DD 4OO1H 5J22A 4J1MA 3VR6A 1NCVA 1SXTA 3K5MA 1ONLA 3I91A 3J7AF 4BBRB 1WD1A 3D4WA 3MWYW 1GUOA 2A69D 1PTOC 2O2LD 2KQ3A 2L0CA 3VYRA 4DAVA 4B9XA 2RSOA 4OIKA 4C3JB 2BCOA 5TSSA 4B08A 4DK0A 1I6VC 2F3VA 3J81E 3H3VC 1QG7A 3S1MB 2BE5D 1S5CD 3SE0A 3L3OC 3V96A 4B9WA 4K5WA 2B2VC 5E4XA 1JORA 2N88A 1LTRD 2K7VA 2RVLA 2B2WC 2AUJD 5HURA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R4P B;  2C5C A;  2BOS A;  1D1K A;  1C4Q A;  1QOH A;  4M1U B;  2GA4 B;  1C48 A;  3MXG A;  1QNU A;  1CZG A;  2XSC A;  1D1I A;  4ULL A;  1DM0 B;  1BOS A;  1CZW A;  1CQF A;  4P2C B;  1R4Q B; 
#chains in the Genus database with same CATH topology
 5D14 A;  3H3V I;  3HS0 C;  3AEV A;  1D1K A;  1K3R A;  2NVT B;  1MIU A;  2LY7 A;  2F0W A;  1O7Y A;  2Q2H A;  2UXC Q;  1EY7 A;  5FO9 B;  1UE5 A;  3FHW A;  1EY0 A;  3SR1 A;  2JA8 B;  1IBL L;  3I4N G;  5CBE E;  1N36 Q;  4L5R C;  2JEB I;  1OXU A;  1PZK D;  3RZO B;  4A3F H;  5E7N A;  2M00 A;  3NTI A;  3E6Z X;  3S2D B;  4G7O C;  4DR4 L;  1IKM A;  5M3F B;  4WJ3 M;  3PCO B;  4FF3 A;  3M7N A;  5CBA E;  3QG1 A;  3A8K E;  3AB9 A;  3I8Z A;  4UDU C;  3S1R H;  2NVQ H;  4X3K A;  3K81 C;  3NEN A;  2JXM B;  1V8Q A;  4DV3 Q;  4JPB W;  3I4O A;  4JI8 Q;  2O5I C;  1M8A A;  3ULJ A;  4DV4 L;  4C3I G;  5LL6 X;  4RCN A;  5IGG A;  2Y0S G;  5C6A A;  1GUW A;  1V1Q A;  4XXE A;  2UXD Q;  2CW0 D;  5IT9 c;  1BCP D;  5IGE A;  1SRU A;  2O5J C;  3VR5 A;  1PTO H;  2E2J H;  2CHB D;  4CJ0 B;  2F0J A;  1Y1V B;  2K05 A;  4P72 A;  2GVB A;  1TVX A;  1KDB A;  4JC0 A;  3RMH A;  3S15 B;  1EY9 A;  1SMY D;  2Z8L A;  4OEL B;  1AP0 A;  1MBY A;  1S5B D;  4LUO A;  4RG1 A;  4KD3 A;  1VF7 A;  2B2T C;  1PH8 A;  1D5X C;  3K8A A;  4ZKB B;  3HRZ C;  1NR2 A;  1VQ8 A;  4A3L H;  2AKW B;  2L5T A;  5DM6 3;  4R4C A;  3H3V H;  1FGU A;  3I7F A;  4DUY L;  3K0X A;  1WD0 A;  1EWH A;  3BZC A;  3WOE A;  1AE2 A;  2OT2 A;  3OIP A;  3PUY A;  4GLA C;  3WDN A;  1PV4 A;  2WIN B;  4A3F B;  1TS2 A;  4HCE A;  4KLK A;  3NE5 B;  3D3R A;  5IYD G;  1CKM A;  4BA1 I;  1XTD A;  4ZUJ A;  1JMC A;  4JG2 A;  1Q12 A;  4ZAI A;  4U68 A;  2DY8 A;  2ZTD A;  4XQJ A;  3A5U A;  3S1R B;  2NVQ B;  1ASY A;  3G48 A;  1HA6 A;  4Q0F A;  4A3C G;  1SN8 A;  5I9O A;  3DLL A;  4DUZ Q;  3KLW A;  3PUW A;  5E4W C;  1BO0 A;  3D8G A;  4YY3 L;  2RHQ B;  1BCP F;  1UEA B;  3MXU A;  1EQT A;  1I4Q A;  2FXQ A;  2OQ0 A;  3C1E A;  4A3M B;  3N6R A;  1PTO B;  4RA8 A;  2E2J B;  2X69 A;  2VL6 A;  1GJX A;  2L15 A;  4DR2 L;  2I07 B;  4BBR G;  1CM9 A;  2RQX A;  4DAY B;  4QMG A;  3DEO A;  2JA5 H;  3K80 C;  2RF4 A;  3W1G A;  4KY7 A;  1F9S A;  5IYB H;  1E7Z A;  1OXV A;  1LO5 D;  2MUY A;  4C3J G;  5JPN C;  4RH6 A;  5CV6 A;  5EGT A;  4K14 A;  1UNS A;  1SFO H;  5M5Y H;  3TQY A;  1S4Z A;  2EYP A;  4X62 L;  5C3E H;  2B63 H;  3SK4 A;  4ILW A;  2IT1 A;  1STG A;  4DNI A;  3Q22 A;  4DN4 M;  5I9P A;  3M4P A;  3K0Y A;  2F0E A;  3A55 A;  4RFB A;  2Y0S E;  3Q24 A;  1YNJ D;  2VQF L;  1TWH H;  1YNX A;  3FPU B;  3HEJ A;  4R8I A;  3BDL A;  5AJ3 L;  3OTO Q;  2N49 A;  4P75 A;  3S1N H;  4X64 L;  4E6I A;  1CKN A;  3C2P A;  4NXM L;  2BDO A;  1PYS B;  3J80 c;  3T53 B;  1S72 A;  3GO5 A;  3SDZ A;  2F0Q A;  1WTH A;  1J5E Q;  1K83 B;  2JA8 G;  1K0S A;  1CZW A;  1H9S A;  1HNX Q;  3LNN A;  3CXC A;  3CCL A;  1A6X A;  1A3V A;  4OO1 G;  1B44 D;  4YIJ A;  2WAC A;  1L1O A;  2R3Z A;  1PH7 A;  4ZRZ A;  2H1E A;  2IHF A;  1N33 Q;  5K36 H;  2JA5 B;  1AEX A;  4J6H A;  5C44 H;  5CYU A;  5JVH 3;  4IFD I;  2R7F A;  3LWU A;  2AQ3 B;  4TKO B;  1LTA D;  4A76 A;  2Q2U A;  3QWN A;  4EX5 A;  1SRO A;  3BYY B;  1Q82 C;  2QDL A;  4DR7 L;  1E1T A;  4JI7 L;  4P73 A;  1SFO B;  5M5Y B;  2LXJ A;  1Q81 C;  1JWM D;  1VMP A;  2E5L L;  5C3E B;  4DR3 L;  2B63 B;  1ROD A;  4H44 C;  3GTP H;  1PRT D;  5JAV A;  1Y1V G;  3E0E A;  3DUZ A;  2BDN A;  1PRT B;  5EKK A;  2EJG C;  3JC6 6;  1EZ6 A;  3U58 A;  1I94 L;  1ZEQ X;  1TWH B;  1D1I A;  3JAM L;  4Y7N H;  5IT9 L;  1LAB A;  4R4O A;  3S1N B;  2KEE A;  2ZT9 C;  1OXX K;  3ZJY C;  1TY0 A;  4LAA A;  1PZJ D;  2HIX A;  1VQ9 A;  1RL2 A;  2B29 A;  5DM7 3;  1D7Q A;  3KDF A;  2PQA B;  2F3I A;  4DK6 C;  4HAE A;  2F0T A;  1EU3 A;  1SE2 A;  4QUC A;  1JWU D;  1BNZ A;  4G7Z C;  3M7G A;  1SMX A;  1SSO A;  3CCQ A;  4LF8 Q;  3PQI A;  2NBF A;  1KTK A;  2MO0 A;  1EQV A;  1XWE A;  3P20 A;  3S9W A;  1JQY D;  3EJI A;  2OF1 A;  1GHK A;  4JVZ A;  1B3A A;  1PH3 A;  1FR3 A;  1B8A A;  1FYC A;  1X3P A;  2CH4 W;  2HHH L;  4IFD H;  4TRD A;  4ODG A;  5ELN A;  4AIM A;  1Q1E A;  3HOV G;  3X3N A;  2R61 A;  5GAD C;  5IGD A;  4PMB A;  2H5X A;  5KYL A;  5EBD A;  2KHJ A;  2I5H A;  1PRT F;  3GTP B;  5IYC G;  1SJH D;  3AU7 A;  2HCC A;  4TVA B;  4UY8 C;  4R8N A;  3NBH B;  2ZJP A;  2C5C A;  4UP8 A;  1H9M A;  1CHP D;  4DV5 L;  3NQT A;  1RJT A;  4IUV A;  2NYZ D;  4Y7N B;  2WKD A;  2EYL A;  3NUC A;  2PYK A;  2QGQ A;  3K7A H;  1I4P A;  1MD2 D;  3MAQ A;  4DR5 Q;  3I4M G;  4MTK A;  4OX9 L;  1LLR D;  3D6C A;  2A8V A;  4A3L G;  1Q46 A;  5M5W H;  1K28 A;  1NMG A;  2V1C C;  1NY4 A;  1X65 A;  4HJ8 A;  2ES2 A;  1OTC A;  1RD9 D;  1DOM A;  5KNB A;  3OPO A;  4FXG C;  4FVM A;  4JI3 L;  3PUX A;  4AYB G;  1K8O A;  1PH6 A;  4A75 A;  3HOW H;  5K5P A;  2HQE A;  5C4J H;  1KXL A;  2A6H C;  4A3E H;  2XNA C;  2ATW A;  2MP1 A;  4EQO A;  4BBS H;  3MXN A;  3A8J E;  2V4D A;  2AMC B;  2I5M X;  3UDX A;  3KBX A;  5EPK A;  4R9W A;  3VR3 A;  1GUT A;  2UU9 Q;  2QCP X;  1MHW C;  1U9R A;  2HDM A;  3STB D;  3RLF A;  4DFA A;  2RKS A;  1GVP A;  3BVZ A;  2DN8 A;  2NN6 H;  1VQE A;  4WJ4 A;  3BS1 A;  3A54 A;  1V1P B;  1I50 H;  3CCV A;  5C5M A;  5A2Q E;  4UP9 A;  4RAU C;  1Q1B A;  1SDF A;  1KAA A;  2HQL A;  2EYF A;  4HJ7 A;  2XIW A;  3RNU A;  1EIG A;  2JA5 G;  4LF4 L;  4FP5 D;  1KDC A;  2A69 C;  2F03 A;  1GD7 A;  4IUN A;  2R93 H;  1SE4 A;  5IYB G;  4NXN L;  5M5W B;  3VDY A;  3DMU A;  1OO9 B;  1A2T A;  1A8V A;  2KBN A;  1M1K C;  3QOL A;  5M3M H;  4A3G B;  3KLR A;  3AQQ A;  1WTP A;  2WB1 B;  2YV5 A;  5IP9 H;  5C3E G;  1FL0 A;  3CCJ A;  2ICE C;  2OTJ A;  4A3J B;  1WVL A;  4WFN 3;  3HOW B;  4GN3 B;  4P71 A;  5C4J B;  4L5T A;  3I90 A;  2JA6 H;  4A3E B;  1YJN A;  4BBS B;  4CDC C;  3K5O A;  3OW7 A;  1EIH A;  3R2T A;  3MFY A;  2VQE L;  2KUM A;  2PZW A;  1Y1W H;  1VDZ A;  2UUC Q;  1GM5 A;  4AH6 A;  5DAU A;  3GTJ H;  3UDG A;  1XMQ Q;  2JQO A;  1A2U A;  4LFA Q;  3VYU A;  1VF5 C;  5CV7 A;  2JEA I;  3P1H A;  1SYD A;  3HKZ E;  4ULL A;  1UE7 A;  4JI0 Q;  4ZQ3 A;  1I50 B;  3JAM i;  3C1F A;  3F1Z A;  3Q8D A;  4GS3 A;  3EFX D;  1PZI D;  1B1Z A;  3F2U A;  3VA7 A;  1XMO L;  2CFM A;  5C0X H;  5DNF A;  1GXD C;  1HNZ Q;  5EAY A;  4HJ5 A;  1JOQ A;  3R3O A;  1WOC A;  1TKW B;  3J80 E;  5C44 G;  1A15 A;  1QOH A;  1FGB D;  2B2Y A;  4KI0 A;  1KRT A;  4JBW A;  2R93 B;  3QJY A;  3ULP A;  2XSC A;  2J7Z A;  1N34 Q;  2B8G A;  2D9U A;  1XNR Q;  4AYB E;  4BY7 H;  3KJO A;  3I72 A;  5IGC A;  1XPO A;  5M9O A;  3TRE A;  2L9H A;  2DNC A;  5D65 A;  3FKI H;  1BCP C;  4IO9 A;  1X55 A;  1J8I A;  2JA6 B;  1VQB A;  4NKL A;  1PFB A;  5KGU A;  1UUP A;  1BXT A;  2F0U A;  1SMY C;  2PMZ B;  1I6H H;  2IPK D;  1PA6 A;  3Q23 A;  4F8M A;  4K0K Q;  1Y1W B;  1YBY A;  4L63 B;  2Z4I A;  2HD3 A;  2OCE A;  4XQN A;  1YVC A;  3J81 L;  1GHJ A;  2EPB A;  4CKE A;  3GTJ B;  1GOZ A;  1WTQ A;  3CHB D;  2BH2 A;  1B2T A;  4ALP A;  2VB2 X;  1ICF B;  5LMU Q;  1SAP A;  2LFN A;  2K28 A;  4GLV B;  4F7X A;  4AQY L;  2P5Z X;  3H6M A;  4QIW E;  2Z6K A;  2PZU A;  4DK1 A;  1O78 A;  3I3C A;  3MXG A;  1SNO A;  1OXT A;  3V2T A;  2NZ1 D;  5FLX L;  4P74 A;  2BH8 A;  2KCM A;  4JYA L;  2NVT H;  1HPC A;  1PYB A;  4K8I A;  3T4A C;  4YWK A;  2OWO A;  3C3L A;  1XNQ L;  2K01 A;  2R7Z H;  4IFD G;  2F4V L;  3A74 A;  2YTX A;  1HQR D;  1EZ8 A;  4JOI C;  5BN4 A;  1L0W A;  4LFC L;  4BY7 B;  1KAB A;  4GOP A;  5JJI A;  3TS0 A;  1PH4 A;  4GNX C;  4JBK A;  4RHS A;  3FKI B;  1LYL A;  4C1N K;  1CFM A;  2N78 A;  3OIQ A;  3GQB A;  4RGT A;  3HOU H;  1GUG A;  1U4M A;  2XRS D;  1DZ1 A;  4JCV E;  3I56 A;  3E9H A;  4PNY A;  1I6H B;  1LT4 D;  1ILP A;  3QOJ A;  2UXB Q;  4GZY C;  2M2L A;  5G3L D;  1STN A;  1YIJ A;  5CGK A;  1PXU A;  4FXD A;  4B3T Q;  3OMC A;  4XTC S;  3KLS X;  3MA2 B;  1YHA A;  1PH9 A;  5I6W A;  1VQ6 A;  2IX3 A;  2BA1 A;  4DV7 Q;  2WB1 G;  3G71 A;  4LF7 Q;  4KHP L;  4ZK9 B;  2RDH A;  2F3W A;  4HSP A;  5KIX A;  2ZXR A;  2KOL A;  3KLS A;  4BBS G;  1X3G A;  1Q8I A;  2F0S A;  2UXC L;  2LXK A;  3HOX H;  3SK8 A;  1EU4 A;  1YNJ C;  3AFQ A;  2R7Z B;  4HIK A;  4A3B H;  1N36 L;  3A0J A;  5IOD A;  2SNS A;  2Q8I B;  3CF5 A;  1WTX A;  3N52 A;  3OHX C;  1WTW A;  2WAQ B;  5NUC A;  4IFD J;  1IL8 A;  4QUF A;  4B3R Q;  2NN6 G;  5EKI A;  3C46 A;  3FDT A;  4DV3 L;  4JV5 Q;  4JI8 L;  2A1A A;  4DV1 Q;  3HOU B;  1EQQ A;  3GTO B;  1N9W A;  1EWI A;  4LFB Q;  1EIF A;  1F2L A;  5G3L F;  4XQQ A;  3U50 C;  4XIG S;  2UXD L;  1DJR D;  2G5D A;  3CU7 A;  4A3M H;  4CGY B;  5FO8 B;  1JT8 A;  3U4V A;  1BCP B;  3GP7 A;  1B3Q A;  1AE3 A;  3S14 B;  1XX8 A;  3HOY H;  2F1M A;  5JEA J;  1HQM C;  3KFU A;  2EY6 A;  1S5E D;  3CRK C;  1L1O B;  1KHI A;  2D0O A;  2VW9 A;  2JN4 A;  5M3M G;  3TEH B;  1VQD A;  2EQS A;  4X65 Q;  1F9Q A;  4ZUI A;  4KKS A;  2K04 A;  5IP9 G;  5KEE A;  3IKJ A;  4LF5 L;  1ZYR D;  2L11 A;  2LSS A;  1E3P A;  1NNX A;  3KF8 A;  1IL2 A;  3T1H Q;  1VQP A;  2KJX A;  3UI2 A;  1PRT C;  4R4I A;  2JA6 G;  1DD2 A;  3SK5 A;  4GN4 B;  3KBG A;  1CA6 A;  4CHT B;  3HOX B;  1RKN A;  3SK6 A;  2B2U A;  2G9H D;  4B3M L;  1IW7 D;  4A3B B;  1Y1W G;  1F2Y A;  3CPF A;  1N8R C;  4ABN A;  4IPC A;  1SNM A;  2GA4 B;  3NTK A;  1JWS D;  1M4V A;  2Q2I A;  4K6D A;  4YWL A;  4TSS A;  4DR1 Q;  2DJG C;  1D2B A;  2JK8 A;  3KF6 A;  2NUC A;  5GRO A;  2PCF B;  3U4Z A;  1SNQ A;  4DUZ L;  3TRZ A;  5C0X G;  1R4Q B;  3HOZ H;  3J81 i;  2EYH A;  1IKL A;  5ELC A;  3KUP A;  3GV3 A;  1K3B C;  4GNX B;  4CDD C;  1SYB A;  3EBE A;  1K83 H;  4KK7 A;  4YWM A;  3HOY B;  3VYT A;  2UUA Q;  3M4Y A;  5C3W A;  1PH5 A;  5LHY 1;  3NXW A;  1SYE A;  5FK9 C;  2MPM A;  3U9O A;  3R8B A;  3FKI G;  4EQ5 A;  3EIV A;  2F0I A;  1EEI D;  1JCK B;  1MSH A;  4QF4 A;  2B3G A;  3T1Y Q;  1KL9 A;  1PFN A;  1HTL D;  4KTA A;  4DGZ A;  1BVS A;  3E0J A;  4JI5 Q;  1K0R A;  1A3T A;  2AWN A;  1YJW A;  2AWO A;  2EDG A;  2KCC A;  3LWE A;  2FJ2 A;  2OQK A;  2KA7 A;  3EVQ A;  4JI6 Q;  5D3I B;  1X3E A;  2G9D A;  3BVG A;  3DWA A;  3H91 A;  3TP5 A;  3KJP A;  2XGT A;  1W6K A;  4B3S Q;  3S24 A;  4IPD A;  2E76 C;  3NWT A;  4ZCK A;  3BZK A;  1JB7 A;  3OTO L;  5IWA Q;  4PMC A;  4CKB A;  3HOZ B;  1A3U A;  1EL0 A;  4JBJ A;  1BUV T;  4GKJ Q;  1QJO A;  4WJW A;  4JI2 Q;  4R4Q A;  2EY2 A;  1E22 A;  4DXG A;  5C0X J;  1EY5 A;  3FEW X;  2RDF A;  5GAH C;  1J5E L;  3W3A A;  5F2D A;  2R7Z G;  3BDC A;  1R4P B;  1XPU A;  1HFG A;  1JJC B;  1MGS A;  1HNX L;  1A62 A;  1T5E A;  4DV0 Q;  4TQU S;  1VS0 A;  3STB C;  1N32 Q;  1B9M A;  1IXR A;  5M3F G;  1RTO A;  4L5S A;  3L9A X;  4K2L A;  1N33 L;  1Z6H A;  3T16 A;  2PMZ E;  3F2C A;  2JJQ A;  2M9V A;  4I65 A;  2JA9 A;  4EQN A;  1KNE A;  3HOU G;  3K58 A;  3PSI A;  3BVM A;  1GUS A;  1YNN D;  4X3T A;  3MEH A;  2RCF A;  2QDB A;  4ZKC B;  1CQV A;  3MVV A;  1IBK Q;  3E9I A;  2D0P A;  2HCI A;  5JJK A;  1F9R A;  3TP8 A;  2RDG A;  1Z9F A;  5ELB A;  3X3M A;  3NSW A;  2ZTC A;  5C4X H;  2K32 A;  1CKO A;  1RIP A;  1XTC D;  4YCU A;  3E5S A;  4OWW B;  2TMP A;  2EY1 A;  1FVI A;  1BR9 A;  2F0D A;  1VQJ A;  2D2C C;  2NB0 A;  3RR5 A;  5EPL A;  4PQX A;  3MHB A;  1IBM Q;  1Q86 C;  2FIN B;  4JI4 Q;  3F2D A;  2HIV A;  5C4H A;  3NQI A;  3OOC A;  3RUZ A;  1PHJ A;  3HOX G;  4BXX H;  1JOO A;  1NBW A;  3RLO A;  1FD7 D;  4APV A;  2JP1 A;  4A3B G;  2J0T D;  4A3F G;  3S1Q H;  2HDL A;  1LTI D;  1NE3 A;  2JA7 H;  4QJF A;  1G51 A;  4LF8 L;  1STH A;  3QO2 A;  2RCN A;  1BBX C;  3RLN A;  1BQQ T;  5DEH A;  2CWA A;  5FJ8 H;  1HXY D;  1RCV D;  5LMN Q;  3HFZ B;  3HG9 A;  2VZA A;  5ELD A;  2KED A;  2EXD A;  2MQH A;  2AUK A;  4DV2 Q;  1P8L A;  1E2Z A;  4NP5 A;  1QB5 D;  4KJO A;  1X9N A;  4HTH A;  1EOT A;  1SND A;  4A3M G;  4YHH Q;  2Q8T A;  3BZD B;  2D62 A;  1VQ4 A;  4DAY A;  1EUJ A;  1DCZ A;  3HGB A;  1PFM A;  3HOY G;  1V9P A;  3L2P A;  1X3F A;  2KEN A;  2WP8 J;  4FO2 A;  4XT1 B;  5C4X B;  4FNF A;  5IOC A;  1PH1 A;  1YZ6 A;  3CAM A;  2K14 A;  5J1Z A;  2Z6B A;  4QY7 A;  5JEA H;  2LMC B;  1SJE D;  1RTN A;  1U0L A;  2IJ0 A;  4IJL A;  3CP0 A;  1HFN A;  1EOV A;  1HTP A;  2B2V A;  2KHI A;  3MC0 B;  4RWS C;  4DR5 L;  5A35 A;  4NMZ A;  1TWG H;  4N8X 1;  2I5L X;  3TP6 A;  2B2W A;  1HRJ A;  4LF6 Q;  4A3G H;  1WJJ A;  3MTS A;  5ISR A;  4BY1 H;  4GKK Q;  1TS3 A;  2L1B A;  2N8N A;  2B39 A;  1SNC A;  3IAY A;  2XWJ B;  3JAM E;  3PUV A;  3SEB A;  3S1Q B;  4A3J H;  5L37 A;  1LTT D;  2AQ2 B;  2JA7 B;  3PO3 H;  1EYA A;  2X6L A;  3CC7 A;  1KLG D;  4KMU C;  4XYO A;  3F2B A;  4KKU A;  5IE8 A;  4FXK C;  5M5X H;  1SEB D;  1TS4 A;  4YCV A;  1II3 A;  1PDQ A;  1CA5 A;  4QL5 A;  1YIT A;  3ITP A;  3SHL A;  2AQ1 B;  2KHS A;  2LKV A;  3HOZ G;  3NTH A;  2UU9 L;  1D5Z C;  1D8L A;  4QCL A;  1K8G A;  2YYZ A;  2NWG A;  4KY6 A;  4O2D A;  5C4Z A;  5BR8 Q;  2EY5 A;  4HR7 B;  4DV6 Q;  3IL8 A;  3D6W A;  4RCO A;  1F77 A;  1G8Z D;  3OYY A;  2K1B A;  2ID0 A;  1QVF A;  1SNP A;  2A6E D;  2X6G A;  1V43 A;  4J15 A;  3J80 L;  2QKI C;  1ZKO A;  4O0A A;  2K5N A;  3CRL C;  1WFQ A;  2B2T A;  1LT5 D;  1B53 A;  1TWG B;  2C9O A;  1HH2 P;  1HZ9 A;  1I5F A;  1G91 A;  1F2M A;  2OEO A;  1QUQ B;  3FP9 A;  4QGU A;  2ZM6 Q;  4BY1 B;  1FNV A;  5HGQ A;  2PZT A;  1FJG Q;  4LF4 Q;  2B63 G;  3GTQ H;  3VYS A;  1AZP A;  1CT1 D;  4RKB A;  1EFW A;  4L5Q A;  4H7B A;  4G7H C;  4X3S A;  2K6A A;  1LUZ A;  2XN9 C;  3RD4 A;  3PO3 B;  4M8A A;  2BE5 C;  3OW2 A;  1EYD A;  2E74 C;  4IQZ A;  1D6E C;  2CWP A;  3CQZ B;  4L8J A;  1BDO A;  1I4X A;  4R4T A;  4IUQ A;  3M85 A;  2EVB A;  5M5X B;  4OWX B;  2PQA A;  3AYH B;  4IOC A;  4N8F A;  2JYO A;  3BYT B;  1EEF D;  3PIO 3;  1ICW A;  1W3S A;  2UUC L;  4BS9 A;  1XMQ L;  4WOR A;  4LFA L;  3CCS A;  1E24 A;  5E3F A;  4JI1 Q;  4X66 Q;  2ZTE A;  4JI0 L;  4IOA A;  4K5V A;  4PG3 A;  4LNQ A;  1VMC A;  3ERS X;  2ASB A;  3UDI A;  1SYF A;  2K5W A;  2E2I H;  3Q6S A;  3UE1 A;  1HNZ L;  3KOJ A;  5K36 G;  2F52 A;  3MZ5 A;  3K6O A;  5FOB B;  4DXF A;  5C5L A;  1JOK A;  2NZH A;  1W2B A;  2IX0 A;  1HNW Q;  2EIF A;  1HHV A;  1X6O A;  1ENC A;  1N34 L;  1XNR L;  2VS1 A;  4XDX A;  2Y0S B;  3HKS A;  2UUB Q;  1HA5 A;  2PW5 A;  5BN5 A;  3NBH A;  1LTB D;  4V0B A;  2CW0 C;  1JJG A;  3GTQ B;  3TZU A;  1PFS A;  2CQO A;  2QEX A;  1GKH A;  1Y14 B;  4DKA C;  5IGF A;  1L1O C;  3NHH A;  5JVG 3;  3UE0 A;  1STE A;  4OO1 I;  1HZA A;  2XTI A;  3IFD A;  4HCS A;  4KKT A;  1Y69 U;  4KD4 A;  1LTS D;  1DYQ A;  1O7L A;  4C1N I;  4BA2 I;  3PMF A;  2R92 H;  4K0K L;  1FNW A;  3OWF A;  4A3D H;  1W6J A;  2OTL A;  5EQ0 A;  2EOT A;  3VA5 A;  2VY3 A;  3CKI B;  3ERO A;  3I2Z A;  1UE6 A;  5CV5 A;  5LMU L;  1G6Z A;  1NUC A;  4MNO A;  3GTK B;  4BXX G;  2Q2T A;  3GD7 A;  2IHE A;  4FF1 A;  4UPA A;  3D31 A;  1O7Z A;  1RHP A;  3I70 A;  4NW2 A;  3B6Y A;  2JA7 G;  1EY6 A;  1JJ2 A;  2K5Q A;  2E2I B;  4HSV A;  4EGV A;  1EY4 A;  5T1G A;  1QNK A;  1J9O A;  2CKZ B;  4UP7 A;  3BU2 A;  1HR0 Q;  4PV1 C;  1TXY A;  1ENF A;  4OHJ A;  1CSP A;  2HUG A;  1V1P A;  4FYD A;  2R7D A;  3ICE A;  1KRS A;  1DOK A;  3CCU A;  2A19 A;  2IX1 A;  1F9P A;  1X32 A;  3SXH A;  3PGZ A;  1YHQ A;  3H0G H;  4CDE C;  4L6T B;  4DR6 Q;  1L2F A;  4DAP A;  3GTO H;  1PYW D;  2QEJ C;  3Q0A A;  3RZD H;  3D0F A;  4NDX A;  1HUN A;  5JEA G;  3QB3 A;  1YEZ A;  2MGS A;  3ZYY X;  3RN5 A;  2H4O A;  2FHT A;  2R92 B;  1QVC A;  3CC4 A;  2UXB L;  2A68 D;  1BBW A;  2SOB A;  4IPG A;  2EYO A;  4A3D B;  3S14 H;  4IUT A;  1VQ5 A;  1QE6 A;  4HN7 A;  4IUR A;  5GAE C;  3AMU A;  4B3T L;  1YI2 A;  5AFW A;  3PIO A;  3QIA A;  4A3G G;  2KCT A;  4BY1 G;  3M3Y H;  2J4X A;  2ZXO A;  4DV7 L;  1QZG A;  4IZ8 A;  3J80 i;  2BA0 A;  4LF7 L;  2F0M A;  4UAI A;  3ER0 A;  4U67 3;  4A3I H;  3A8I E;  5EJW A;  4KHZ A;  4KJN A;  4A3J G;  3HOW G;  4A4I A;  3PO3 G;  4LF9 Q;  4A3E G;  3I4L A;  2SDF A;  4LWC A;  3K5L A;  1AFP A;  2B8F A;  1CZG A;  3OMG A;  1XXG A;  3G4S A;  4C3H H;  3DWP A;  5GQO A;  5HGT A;  2XVS A;  3NP8 A;  3ND9 A;  3CCR A;  5ELE A;  1LTL A;  1BOS A;  4KN4 C;  4OEM B;  1E1O A;  4GN5 A;  3NBI A;  4O1N A;  1CQF A;  5FLX E;  2K5D A;  1M90 C;  2BOS A;  1G6P A;  1WTR A;  1JB3 A;  3J7A 5;  4B3R L;  1DON A;  1NSN S;  1IBL Q;  3H0G B;  4V19 0;  1VQM A;  4JV5 L;  1LTG D;  1SYC A;  1CKN B;  5DLQ E;  5KYI A;  1JE5 A;  2QF7 A;  3TZD A;  4RGM A;  1UE1 A;  4I7Z C;  4DV1 L;  3RZD B;  1TWF H;  4LFB L;  4DR4 Q;  5KNC A;  1QZH A;  1JR0 D;  3CC2 A;  1V1O A;  1H9S B;  2R93 G;  1J6Q A;  3DXJ C;  2NZO A;  2DNE A;  3BJU A;  4DV4 Q;  1P16 A;  3AFP A;  3GTL H;  1Y8P B;  3PUZ A;  3I73 A;  2EZV A;  3J7A V;  4F88 A;  4S3S A;  3HOV H;  1YJ9 A;  3M3Y B;  2D5D A;  4LUV A;  4X65 L;  2WV6 D;  1YNN C;  3JAM c;  2I46 A;  3T56 B;  1VQO A;  5FLM H;  1SBB B;  4A3I B;  1DXM A;  2L4N A;  1B9N A;  2PW7 A;  3T1H L;  1XYI A;  3M4O H;  5KRU A;  5IYC H;  2YTY A;  2F0V A;  2VUM H;  3A56 A;  3E3X A;  3V05 A;  1NAP A;  2ZJR A;  4C3H B;  1TQO A;  1X56 A;  2IW3 A;  4RKL A;  5C3X A;  1Y8O B;  2L12 A;  2MO1 A;  3IRB A;  3H15 A;  4LF5 Q;  1TWC H;  2DY7 A;  4ME5 A;  1CSQ A;  1C8C A;  1Q90 A;  2VXW A;  5I2Y A;  3OWE B;  3I4M H;  1HUM A;  4DUY Q;  4C56 C;  1H9J A;  1TU2 B;  5J39 A;  1KQS A;  4K5X A;  1T5X D;  3RN2 A;  2IL8 A;  1VQG A;  1ASZ A;  4DR1 L;  1Z7T A;  4RMF A;  4B3M Q;  2Q8R E;  1GO3 E;  4IJH A;  1I4H A;  3DM1 A;  1TWF B;  3KDF B;  5J3B A;  5EKL A;  1SR3 A;  3H09 A;  4LMQ D;  3J7Z C;  4CJ2 C;  2LS0 1;  4Z9C B;  1K73 C;  2WB1 E;  1X3Q A;  1YHB A;  2QIL A;  1Q3L A;  5I6Y A;  4IUP A;  2WFW A;  2UUA L;  4HIM A;  3GTL B;  1L0Y B;  4XYQ A;  2Z4H A;  1DOL A;  4BY7 G;  4MTN A;  4YY3 Q;  3HOV B;  1OXS C;  1CK1 A;  4ME3 A;  2EYJ A;  3P7J A;  4PZ7 A;  1WI5 A;  1KLU D;  1PTO D;  1VQL A;  2JE6 I;  1JC7 A;  3J7Y W;  3TME A;  2CQA A;  1EY8 A;  1QWY A;  3M4O B;  2F0K A;  4IPH A;  3T1Y L;  1IYJ B;  2MFI A;  2VUM B;  3FVQ A;  2ZJQ A;  1WTO A;  4DR2 Q;  3HKZ B;  4JI5 L;  1EFI D;  2B2Y C;  1ESF A;  4DK3 C;  1BBU A;  2IY5 B;  2R92 G;  1MSG A;  1SE3 A;  1TWC B;  4A3D G;  4A93 H;  3I55 A;  5E1F A;  2ZXP A;  5IP7 H;  4CKC A;  3I4M B;  1AN8 A;  2VB3 X;  3TBI B;  3KK7 A;  4PMW A;  4JI6 L;  2HT1 A;  2PPB C;  1CI3 M;  1PVO A;  2K5V A;  4B3S L;  1NTG A;  4X62 Q;  2K33 A;  2R6G A;  3PO2 H;  1AZQ A;  5JOB A;  5IWA L;  1PH2 A;  1H95 A;  4AYB B;  4OGQ C;  1KNA A;  4GKJ L;  2F0H A;  4HID A;  4JI2 L;  4WRD A;  2Z9H A;  2VQF Q;  1VQN A;  4LJZ C;  1CTM A;  3TDQ A;  2K5H A;  3TSS A;  4A3K H;  2NVY H;  3R2I A;  5H1S E;  5AJ3 Q;  2RSN A;  4X64 Q;  1XPR A;  2WAQ G;  3O13 A;  4DV0 L;  4NXM Q;  4QB4 A;  1N32 L;  3FPP A;  3MXN B;  1PTO F;  1HZC A;  2EE1 A;  4DU9 A;  2Z6K C;  2F0F A;  3CW2 C;  1QCB D;  3H0G G;  1VQH A;  4KN7 C;  1U4P A;  3A7A B;  3BDO A;  4MHE A;  2E8G A;  3DWQ A;  4DA2 A;  1FNU A;  2F0P A;  4PZ8 A;  1F2Z A;  2A6E C;  3KYH C;  1TII D;  2CH4 A;  2QA4 A;  1B50 A;  1UAP A;  4HMJ A;  2FFK B;  1JIC A;  4QIW B;  2EXZ A;  4ID6 A;  3GV6 A;  1IBK L;  1NMF A;  4A93 B;  4KHV A;  4O42 A;  1Y8N B;  3W2D A;  1AH9 A;  1WYD A;  2MHV A;  2SNM A;  4I7A A;  2WII B;  5CV4 A;  3VR2 A;  4DNT B;  4GOP C;  5CMD A;  4CBV A;  4DR7 Q;  5HY6 A;  1X54 A;  1NR4 A;  3HZX A;  4JI7 Q;  2E5L Q;  1S5F D;  4Y52 H;  4DR3 Q;  4A3I G;  3PO2 B;  4Q5V A;  2QW7 A;  4JK1 C;  4CDF C;  3SVM A;  1IBM L;  1LV9 A;  3PV0 A;  4JI4 L;  4BWG B;  1HCZ A;  3S2H H;  2OXP A;  4K2K A;  1G2S A;  3DM3 A;  1I94 Q;  1E0B A;  1QNU A;  4NPS A;  1B7Y B;  4QQB X;  4C3H G;  1E2W A;  4A3K B;  2NVY B;  2E75 C;  4DF7 A;  2N3S A;  1EWC A;  1U4R A;  4CJ1 B;  3ERQ A;  3LGJ A;  1RF2 D;  5COR A;  5IGB A;  3NEM A;  4JOI A;  3H94 A;  1UWV A;  4MZ9 A;  1U5K A;  2XRQ D;  2L55 A;  1STB A;  4OWT B;  3TN2 A;  1C0A A;  3W1B A;  5LMN L;  4GNX A;  1MI2 A;  4KV6 A;  1U4L A;  2PQE A;  4H13 C;  2FMC A;  1ML0 D;  1C48 A;  2ENB A;  1C7Y A;  5LMN W;  4DV2 L;  1O7I A;  3S16 H;  3NPP A;  1STY A;  3NWS A;  4MN3 A;  3NK9 A;  4JW0 A;  4YHH L;  5C44 B;  4OXP A;  3P75 A;  4P2C B;  2HHH Q;  2K03 A;  5A2Q L;  2I0Q A;  1D5M C;  2YU9 H;  5JJL A;  1PLF A;  2Z1C A;  2NN6 I;  5FLM G;  3URY A;  1SE8 A;  3GTG H;  1IYU A;  4HMI A;  4XT3 B;  1VQA A;  1UEB A;  1R9T H;  3J81 c;  1DM0 B;  1EQR A;  1Q8K A;  2RA4 A;  3L0O A;  2VUM G;  2E2H H;  2YTV A;  3S2H B;  4LF6 L;  1SYG A;  3HKZ G;  2WAQ E;  4OIJ A;  3A7L A;  2A5H A;  2MNA A;  4DV5 Q;  2K52 A;  4GKK L;  5KND A;  3CCM A;  5JJZ A;  1ET9 A;  2PI2 A;  5IT9 E;  2RHS B;  1IZ6 A;  4ZYS A;  1I4G A;  2PNH A;  4N9T A;  3CME A;  1KC8 C;  3D4D A;  4OX9 Q;  1STA A;  5FLX c;  3LX0 A;  4FF2 A;  3ULL A;  1ENA A;  3CQZ H;  4IAL A;  4F87 A;  1WCM H;  2EJM A;  1E2V A;  2CCZ A;  3T51 B;  4JI3 Q;  5I4D A;  3WWV A;  3S16 B;  3PF5 A;  3EN2 A;  4FF4 A;  1TWA H;  3A5Z B;  2B2U C;  1G2T A;  5BR8 L;  4DV6 L;  3U9S A;  3WOF A;  3I4N H;  2PO4 A;  3OSO A;  5D3D A;  2PNR C;  1VQF A;  4IN3 A;  2XWB B;  3W5O A;  4HIO A;  2YU9 B;  4HJA A;  3BG3 A;  1H9R A;  2IWH A;  3K57 A;  2A74 C;  1IHZ A;  4DAM A;  2O4X A;  3GTG B;  1KIX A;  3G6J B;  1R9T B;  4X3U A;  3D4R A;  2NTT A;  3HP3 A;  2GVA A;  1A63 A;  4C3I H;  3UDF A;  4GOP B;  1GUN A;  4RGO S;  2E2H B;  5C0X I;  3PF4 A;  2ZM6 L;  2F0G A;  2DUD A;  2E2D C;  1MKH A;  2Z0S A;  3GTM H;  3NEL A;  1TT2 A;  1H9K A;  4DNR B;  1FJG L;  2DGY A;  2EYM A;  5FO7 B;  4A93 G;  3K7A B;  1AW7 A;  1VCI A;  5LL6 S;  2A68 C;  5ELF A;  2K50 A;  5IP7 G;  3S17 H;  4NXN Q;  3DEP A;  2F0N A;  3K7U C;  1QIL A;  3PIP 3;  4C2M H;  4J8Q A;  1HZB A;  3DHQ A;  2JSO A;  2VNU D;  2K75 A;  1WCM B;  1Z47 A;  2A73 B;  1EIY B;  1G29 1;  1ILQ A;  1L0X B;  1QVG A;  2FMM A;  4IUU A;  1BF4 A;  2KCN A;  4H0L C;  3PO2 G;  1I4R A;  1ZXT A;  2GN5 A;  3VR4 A;  4POF A;  1KAW A;  4G57 A;  4UHV A;  1EYG A;  3IFT A;  4EVO A;  1TWA B;  3SGI A;  3K5N A;  3GTK H;  4JI1 L;  4X66 L;  3G7L A;  2NTS A;  5IY0 A;  4A3K G;  1K8M A;  2VQE Q;  3I4N B;  4LK1 C;  3CPW A;  1MJE A;  1MJC A;  2TSS A;  4RHR A;  4FDB A;  5IYD H;  3FRP B;  1HJP A;  1IYV A;  5CC4 A;  4K8J A;  1VQK A;  1RDP D;  1S40 A;  1WTV A;  1K9M C;  1LT6 D;  4A3C H;  4HED A;  2AHO B;  1HNW L;  1O80 A;  3G6E A;  1XMO Q;  1K8A C;  4C3I B;  3T13 A;  1B70 B;  5JPM C;  4R1J A;  3TP7 A;  5EPJ A;  3CCE A;  3GTM B;  2UUB L;  2NVX H;  2K4K A;  4PZ6 A;  1BKB A;  5CV9 A;  1I3Q H;  2MJ8 A;  2PI2 E;  2N55 A;  4M1U B;  3CMA A;  3F8T A;  2ICI A;  3S17 B;  4N9P A;  5C4X G;  2F4I A;  3ONA B;  4C2M B;  3M9B A;  2KEC A;  2WKC A;  5EBC A;  4G4K A;  1PMR A;  5M3M B;  5ELO A;  1ET6 A;  4BBR H;  2CVR A;  5FKA C;  3M4Q A;  1ZYR C;  2F0L A;  1CHQ D;  1TY2 A;  1KD1 C;  5BN3 A;  1VQC A;  4LUZ A;  4NB3 A;  1TR5 A;  3ND8 A;  2EJF C;  4LW1 A;  4C3J H;  5CV8 A;  3J81 j;  3R93 A;  2KVM A;  3MFG A;  3KF8 B;  4DPG A;  5I2X A;  1IW7 C;  1ESR A;  3S1M H;  2A6H D;  4RGN A;  3K59 A;  4POG A;  4ZLT F;  5FJ8 G;  4KY5 A;  4MIU A;  1LT3 D;  1XJV A;  5T1I A;  4AQY Q;  2F0O A;  3FMC A;  1HR0 L;  5IIF A;  1C4Q A;  5CR3 A;  1B4O A;  4JYA Q;  1HR0 W;  3EA6 A;  3EQL C;  2SEB D;  1T9H A;  5COY A;  4HJ9 A;  5GAG C;  4EQP A;  2NVX B;  1S3O A;  1XNQ Q;  1I3Q B;  3L7Z C;  3KF6 B;  1LAC A;  1EYC A;  3MXP A;  2JA8 H;  2F4V Q;  1JE4 A;  1VQ7 A;  1TS5 A;  2RBM A;  4K6L A;  4OL7 A;  1KDA A;  3RZO H;  3MEF A;  4LFC Q;  1S5D D;  4DR6 L;  4OO1 H;  2C35 B;  4J1M A;  5J22 A;  3VR6 A;  1NCV A;  1SXT A;  3S2D H;  3K5M A;  1ONL A;  3I91 A;  1QUQ A;  1VQI A;  3PIP A;  3J7A F;  4BBR B;  1WD1 A;  3D4W A;  3MWY W;  1GUO A;  3QR8 A;  5M3F H;  1A0I A;  1DGS A;  2A69 D;  1PTO C;  4H02 A;  2O2L D;  2KQ3 A;  2L0C A;  3CD6 A;  2ALY B;  3TS2 A;  3VYR A;  4DAV A;  4B9X A;  2RSO A;  4OIK A;  4OON A;  4C3J B;  2BCO A;  4YCW A;  2DJF C;  5TSS A;  1Q7Y C;  4B08 A;  4DK0 A;  4JBM A;  1I6V C;  2F3V A;  3J81 E;  3H3V C;  1QG7 A;  3S1M B;  1Y1V H;  2BE5 D;  1NJI C;  4LF9 L;  1S5C D;  1CUK A;  3S15 H;  1SLJ A;  3SE0 A;  1C9O A;  3L3O C;  3V96 A;  1WCM G;  4B9W A;  1LM0 A;  4K5W A;  2B2V C;  5E4X A;  1JOR A;  2N88 A;  3GDE A;  4X6A H;  4KHP Q;  1LTR D;  2K7V A;  2RVL A;  2B2W C;  2AUJ D;  4GLX A;  5HUR A; 
#chains in the Genus database with same CATH homology
 5D14 A;  3HS0 C;  1D1K A;  2NVT B;  2LY7 A;  2F0W A;  1O7Y A;  1EY7 A;  5FO9 B;  1EY0 A;  3SR1 A;  2JA8 B;  5CBE E;  2JEB I;  1OXU A;  1PZK D;  3RZO B;  2M00 A;  3NTI A;  3E6Z X;  3S2D B;  4G7O C;  1IKM A;  5M3F B;  4FF3 A;  3M7N A;  5CBA E;  3QG1 A;  3A8K E;  3AB9 A;  3I8Z A;  4UDU C;  4X3K A;  2JXM B;  1V8Q A;  2O5I C;  1M8A A;  4C3I G;  5LL6 X;  4RCN A;  5IGG A;  5C6A A;  1GUW A;  4XXE A;  2CW0 D;  1BCP D;  5IGE A;  2O5J C;  3VR5 A;  1PTO H;  2CHB D;  4CJ0 B;  2F0J A;  1Y1V B;  2K05 A;  3RMH A;  1TVX A;  1KDB A;  3S15 B;  1EY9 A;  1SMY D;  2Z8L A;  1AP0 A;  1MBY A;  1S5B D;  4KD3 A;  1VF7 A;  2B2T C;  1D5X C;  4ZKB B;  3HRZ C;  1NR2 A;  2L5T A;  5DM6 3;  1WD0 A;  1EWH A;  3WOE A;  2OT2 A;  3OIP A;  3PUY A;  3WDN A;  2WIN B;  4A3F B;  1TS2 A;  4HCE A;  3NE5 B;  3D3R A;  4BA1 I;  4ZUJ A;  1Q12 A;  4ZAI A;  4U68 A;  2DY8 A;  2NVQ B;  4XQJ A;  3S1R B;  1HA6 A;  4Q0F A;  5I9O A;  3PUW A;  5E4W C;  1BO0 A;  3D8G A;  1BCP F;  1UEA B;  3MXU A;  1EQT A;  1I4Q A;  3C1E A;  4A3M B;  3N6R A;  1PTO B;  4RA8 A;  2E2J B;  2X69 A;  1GJX A;  2I07 B;  1CM9 A;  2RQX A;  4QMG A;  3DEO A;  4KY7 A;  1F9S A;  1OXV A;  1LO5 D;  2MUY A;  4C3J G;  5JPN C;  4RH6 A;  5CV6 A;  5EGT A;  4K14 A;  1UNS A;  1S4Z A;  2EYP A;  3SK4 A;  4ILW A;  2IT1 A;  1STG A;  3Q22 A;  4DN4 M;  5I9P A;  3K0Y A;  2F0E A;  3A55 A;  4RFB A;  3Q24 A;  1YNJ D;  3FPU B;  3HEJ A;  4R8I A;  3BDL A;  4E6I A;  3C2P A;  2BDO A;  3T53 B;  3GO5 A;  3SDZ A;  2F0Q A;  1K83 B;  1CZW A;  1H9S A;  3LNN A;  1A6X A;  1A3V A;  4OO1 G;  1B44 D;  4YIJ A;  2WAC A;  2R3Z A;  4ZRZ A;  2H1E A;  5K36 H;  2JA5 B;  1AEX A;  4J6H A;  5CYU A;  5JVH 3;  4IFD I;  3LWU A;  2AQ3 B;  4TKO B;  1LTA D;  3QWN A;  3BYY B;  1SFO B;  5M5Y B;  1JWM D;  1VMP A;  5C3E B;  2B63 B;  1ROD A;  4H44 C;  1PRT D;  5JAV A;  3DUZ A;  2BDN A;  1PRT B;  5EKK A;  2EJG C;  1EZ6 A;  1ZEQ X;  1TWH B;  1D1I A;  3JAM L;  5IT9 L;  1LAB A;  3S1N B;  2KEE A;  2ZT9 C;  1OXX K;  1TY0 A;  4LAA A;  1PZJ D;  5DM7 3;  4HAE A;  2F0T A;  1EU3 A;  1SE2 A;  4QUC A;  1JWU D;  1BNZ A;  4G7Z C;  3M7G A;  1SSO A;  2NBF A;  1KTK A;  1EQV A;  1XWE A;  3P20 A;  3S9W A;  1JQY D;  3EJI A;  2OF1 A;  1GHK A;  1B3A A;  1FR3 A;  1FYC A;  1X3P A;  4IFD H;  4TRD A;  4ODG A;  1Q1E A;  3X3N A;  2R61 A;  5IGD A;  4PMB A;  5KYL A;  5EBD A;  1PRT F;  3GTP B;  1SJH D;  3AU7 A;  2HCC A;  4R8N A;  2C5C A;  1H9M A;  1CHP D;  3NQT A;  1RJT A;  4IUV A;  2NYZ D;  4Y7N B;  2WKD A;  2EYL A;  3NUC A;  2PYK A;  1I4P A;  1MD2 D;  3MAQ A;  1LLR D;  3D6C A;  1RD9 D;  1DOM A;  5KNB A;  3OPO A;  4FXG C;  4FVM A;  3PUX A;  1K8O A;  5K5P A;  2HQE A;  2A6H C;  2XNA C;  2MP1 A;  4EQO A;  3MXN A;  3A8J E;  2V4D A;  3KBX A;  5EPK A;  4R9W A;  3VR3 A;  1GUT A;  2QCP X;  1U9R A;  2HDM A;  3RLF A;  4DFA A;  2RKS A;  3BVZ A;  2DN8 A;  2NN6 H;  3BS1 A;  3A54 A;  1V1P B;  5C5M A;  5A2Q E;  4RAU C;  1Q1B A;  1SDF A;  1KAA A;  2EYF A;  2XIW A;  1EIG A;  4FP5 D;  1KDC A;  2A69 C;  2F03 A;  4IUN A;  1SE4 A;  5M5W B;  3DMU A;  1OO9 B;  1A2T A;  3QOL A;  4A3G B;  3KLR A;  1WTP A;  2WB1 B;  2ICE C;  4A3J B;  1WVL A;  4WFN 3;  3HOW B;  5C4J B;  3I90 A;  4A3E B;  4BBS B;  3K5O A;  3OW7 A;  1EIH A;  3R2T A;  3MFY A;  2KUM A;  2PZW A;  1VDZ A;  5DAU A;  1A2U A;  3VYU A;  1VF5 C;  5CV7 A;  2JEA I;  3P1H A;  1SYD A;  4ULL A;  4ZQ3 A;  1I50 B;  3C1F A;  3VA7 A;  1B1Z A;  3EFX D;  1PZI D;  3F2U A;  5C0X H;  5DNF A;  1GXD C;  1JOQ A;  3R3O A;  1TKW B;  3J80 E;  1A15 A;  1QOH A;  1FGB D;  2B2Y A;  4KI0 A;  4JBW A;  2R93 B;  3QJY A;  2XSC A;  2J7Z A;  2B8G A;  2D9U A;  3I72 A;  5IGC A;  5M9O A;  2L9H A;  2DNC A;  5D65 A;  1BCP C;  1J8I A;  2JA6 B;  4NKL A;  1PFB A;  5KGU A;  1UUP A;  1BXT A;  2F0U A;  1SMY C;  2PMZ B;  2IPK D;  3Q23 A;  4F8M A;  1Y1W B;  4L63 B;  2Z4I A;  4XQN A;  3J81 L;  1GHJ A;  2EPB A;  4CKE A;  3GTJ B;  1GOZ A;  1WTQ A;  3CHB D;  1B2T A;  2VB2 X;  1SAP A;  2LFN A;  2K28 A;  4F7X A;  3H6M A;  2PZU A;  4DK1 A;  1O78 A;  3I3C A;  3MXG A;  1SNO A;  1OXT A;  3V2T A;  2NZ1 D;  5FLX L;  1HPC A;  4K8I A;  3T4A C;  3C3L A;  2K01 A;  4IFD G;  1HQR D;  1EZ8 A;  5BN4 A;  4BY7 B;  1KAB A;  4RHS A;  3FKI B;  4C1N K;  1CFM A;  3OIQ A;  3GQB A;  4RGT A;  1GUG A;  1U4M A;  2XRS D;  1DZ1 A;  4PNY A;  1I6H B;  1LT4 D;  1ILP A;  3QOJ A;  4GZY C;  2M2L A;  5G3L D;  1STN A;  5CGK A;  1PXU A;  4FXD A;  3OMC A;  4XTC S;  3KLS X;  3MA2 B;  5I6W A;  2IX3 A;  2BA1 A;  4ZK9 B;  2RDH A;  2F3W A;  4HSP A;  5KIX A;  2ZXR A;  2KOL A;  3KLS A;  1Q8I A;  2F0S A;  3SK8 A;  1EU4 A;  1YNJ C;  2R7Z B;  5IOD A;  2SNS A;  2Q8I B;  1WTX A;  3N52 A;  3OHX C;  1WTW A;  2WAQ B;  5NUC A;  4IFD J;  1IL8 A;  4QUF A;  2NN6 G;  5EKI A;  3C46 A;  3FDT A;  3HOU B;  3GTO B;  1F2L A;  5G3L F;  4XQQ A;  4XIG S;  1DJR D;  3CU7 A;  4CGY B;  5FO8 B;  1BCP B;  3GP7 A;  3S14 B;  1XX8 A;  2F1M A;  5JEA J;  1HQM C;  2EY6 A;  1S5E D;  3CRK C;  1F9Q A;  4ZUI A;  4KKS A;  2K04 A;  5KEE A;  3IKJ A;  1ZYR D;  2L11 A;  3KF8 A;  2KJX A;  3UI2 A;  1PRT C;  1DD2 A;  3SK5 A;  3KBG A;  1CA6 A;  4CHT B;  3HOX B;  1RKN A;  3SK6 A;  2B2U A;  2G9H D;  1IW7 D;  4A3B B;  1F2Y A;  4ABN A;  1SNM A;  2GA4 B;  3NTK A;  1JWS D;  1M4V A;  4K6D A;  4TSS A;  1D2B A;  2NUC A;  2PCF B;  1SNQ A;  5C0X G;  1R4Q B;  2EYH A;  1IKL A;  5ELC A;  3KUP A;  3GV3 A;  1SYB A;  4KK7 A;  3HOY B;  3VYT A;  3M4Y A;  5C3W A;  5LHY 1;  3NXW A;  1SYE A;  5FK9 C;  2MPM A;  3U9O A;  3R8B A;  2F0I A;  1EEI D;  1JCK B;  1MSH A;  4QF4 A;  1PFN A;  1HTL D;  4KTA A;  4DGZ A;  3E0J A;  1A3T A;  2AWN A;  2AWO A;  2EDG A;  2KCC A;  3LWE A;  2FJ2 A;  2KA7 A;  3EVQ A;  5D3I B;  3DWA A;  2G9D A;  3BVG A;  3H91 A;  3TP5 A;  1W6K A;  2E76 C;  3NWT A;  4PMC A;  4CKB A;  3HOZ B;  1A3U A;  1EL0 A;  1BUV T;  1QJO A;  4WJW A;  2EY2 A;  4DXG A;  5C0X J;  1EY5 A;  3FEW X;  2RDF A;  3W3A A;  5F2D A;  3BDC A;  1R4P B;  1HFG A;  1MGS A;  1T5E A;  4TQU S;  1B9M A;  1RTO A;  3L9A X;  4K2L A;  1Z6H A;  3T16 A;  2M9V A;  4I65 A;  4EQN A;  1KNE A;  3K58 A;  3BVM A;  1GUS A;  1YNN D;  4X3T A;  3MEH A;  2QDB A;  4ZKC B;  1CQV A;  3MVV A;  2HCI A;  1F9R A;  3TP8 A;  2RDG A;  5ELB A;  3X3M A;  3NSW A;  2K32 A;  1XTC D;  3E5S A;  2TMP A;  2EY1 A;  1BR9 A;  2F0D A;  2D2C C;  2NB0 A;  5EPL A;  4PQX A;  3MHB A;  2FIN B;  5C4H A;  3NQI A;  3OOC A;  3RUZ A;  1JOO A;  1FD7 D;  2JP1 A;  2J0T D;  2HDL A;  1LTI D;  1STH A;  3QO2 A;  1BBX C;  1BQQ T;  5DEH A;  1HXY D;  1RCV D;  3HG9 A;  5ELD A;  2KED A;  2AUK A;  1E2Z A;  4NP5 A;  1QB5 D;  4KJO A;  4HTH A;  1EOT A;  1SND A;  2Q8T A;  3BZD B;  2D62 A;  4DAY A;  1DCZ A;  3HGB A;  1PFM A;  2WP8 J;  4XT1 B;  4FO2 A;  5C4X B;  4FNF A;  5IOC A;  5J1Z A;  5JEA H;  2LMC B;  1SJE D;  1RTN A;  2IJ0 A;  1HFN A;  1HTP A;  2B2V A;  3MC0 B;  4RWS C;  5A35 A;  4NMZ A;  3TP6 A;  2B2W A;  1HRJ A;  3MTS A;  5ISR A;  1TS3 A;  2L1B A;  2B39 A;  1SNC A;  3IAY A;  2XWJ B;  3JAM E;  3PUV A;  3SEB A;  3S1Q B;  1LTT D;  2AQ2 B;  2JA7 B;  1EYA A;  2X6L A;  1KLG D;  4KMU C;  4XYO A;  4KKU A;  4FXK C;  1SEB D;  1TS4 A;  1II3 A;  1PDQ A;  1CA5 A;  3ITP A;  3SHL A;  2AQ1 B;  2KHS A;  2LKV A;  3NTH A;  1D5Z C;  4QCL A;  2YYZ A;  2NWG A;  4KY6 A;  5C4Z A;  2EY5 A;  4HR7 B;  3IL8 A;  3D6W A;  4RCO A;  1F77 A;  1G8Z D;  2K1B A;  2ID0 A;  1SNP A;  2A6E D;  2X6G A;  1V43 A;  3J80 L;  2QKI C;  1ZKO A;  3CRL C;  2B2T A;  1LT5 D;  1B53 A;  1TWG B;  2C9O A;  1G91 A;  1F2M A;  2OEO A;  4BY1 B;  1FNV A;  2PZT A;  3VYS A;  1AZP A;  1CT1 D;  4RKB A;  4H7B A;  4G7H C;  4X3S A;  2K6A A;  3RD4 A;  2XN9 C;  3PO3 B;  4M8A A;  2BE5 C;  1EYD A;  2E74 C;  4IQZ A;  1D6E C;  3CQZ B;  4L8J A;  1BDO A;  1I4X A;  4IUQ A;  3M85 A;  2EVB A;  5M5X B;  2JYO A;  3BYT B;  1EEF D;  3PIO 3;  1ICW A;  4BS9 A;  4WOR A;  5E3F A;  4K5V A;  1VMC A;  1SYF A;  2K5W A;  3Q6S A;  5K36 G;  3MZ5 A;  3K6O A;  5FOB B;  4DXF A;  5C5L A;  1JOK A;  2IX0 A;  1HHV A;  1ENC A;  4XDX A;  2Y0S B;  1HA5 A;  2PW5 A;  5BN5 A;  3NBH A;  1LTB D;  4V0B A;  2CW0 C;  3GTQ B;  3TZU A;  5IGF A;  3NHH A;  5JVG 3;  1STE A;  4OO1 I;  3IFD A;  4HCS A;  4KKT A;  1Y69 U;  4KD4 A;  1LTS D;  1DYQ A;  1O7L A;  4C1N I;  4BA2 I;  3PMF A;  1FNW A;  3OWF A;  1W6J A;  5EQ0 A;  2EOT A;  3VA5 A;  3CKI B;  3ERO A;  5CV5 A;  1G6Z A;  1NUC A;  3GTK B;  3GD7 A;  4FF1 A;  3D31 A;  1O7Z A;  1RHP A;  3I70 A;  4NW2 A;  1EY6 A;  2K5Q A;  2E2I B;  4HSV A;  4EGV A;  1EY4 A;  5T1G A;  1QNK A;  1J9O A;  4PV1 C;  1ENF A;  4OHJ A;  2HUG A;  1V1P A;  4FYD A;  1DOK A;  2IX1 A;  1F9P A;  1X32 A;  3SXH A;  4L6T B;  4DAP A;  1PYW D;  2QEJ C;  3Q0A A;  4NDX A;  1HUN A;  5JEA G;  3QB3 A;  3ZYY X;  2MGS A;  2H4O A;  2FHT A;  2R92 B;  2A68 D;  2SOB A;  2EYO A;  4A3D B;  4IUT A;  1QE6 A;  4HN7 A;  4IUR A;  3AMU A;  5AFW A;  3QIA A;  2J4X A;  2ZXO A;  4IZ8 A;  2BA0 A;  2F0M A;  4UAI A;  4U67 3;  3A8I E;  5EJW A;  4KHZ A;  4KJN A;  3I4L A;  2SDF A;  3K5L A;  1AFP A;  2B8F A;  1CZG A;  3OMG A;  1XXG A;  3DWP A;  5HGT A;  2XVS A;  3NP8 A;  3ND9 A;  5ELE A;  1BOS A;  4KN4 C;  3NBI A;  4O1N A;  1CQF A;  5FLX E;  2K5D A;  2BOS A;  1WTR A;  1JB3 A;  1DON A;  1NSN S;  3H0G B;  4V19 0;  1LTG D;  1SYC A;  5KYI A;  2QF7 A;  3TZD A;  4RGM A;  4I7Z C;  3RZD B;  5KNC A;  1JR0 D;  1V1O A;  1H9S B;  3DXJ C;  2DNE A;  1Y8P B;  3PUZ A;  3I73 A;  2EZV A;  3J7A V;  4F88 A;  4S3S A;  3M3Y B;  2D5D A;  2WV6 D;  1YNN C;  2I46 A;  3T56 B;  1SBB B;  4A3I B;  1DXM A;  2L4N A;  1B9N A;  2PW7 A;  1XYI A;  5KRU A;  2F0V A;  3A56 A;  3V05 A;  1NAP A;  4C3H B;  1TQO A;  2IW3 A;  4RKL A;  5C3X A;  1Y8O B;  2L12 A;  2DY7 A;  4ME5 A;  1C8C A;  1Q90 A;  2VXW A;  5I2Y A;  3OWE B;  1HUM A;  4C56 C;  1H9J A;  1TU2 B;  5J39 A;  4K5X A;  1T5X D;  2IL8 A;  1Z7T A;  2Q8R E;  1I4H A;  3DM1 A;  1TWF B;  5EKL A;  3H09 A;  4LMQ D;  4CJ2 C;  2LS0 1;  4Z9C B;  1X3Q A;  2QIL A;  1Q3L A;  5I6Y A;  4IUP A;  3GTL B;  1L0Y B;  4XYQ A;  2Z4H A;  1DOL A;  3HOV B;  1OXS C;  1CK1 A;  2EYJ A;  3P7J A;  1KLU D;  1PTO D;  2JE6 I;  1JC7 A;  3J7Y W;  3TME A;  2CQA A;  1EY8 A;  1QWY A;  3M4O B;  2F0K A;  2VUM B;  3FVQ A;  1WTO A;  3HKZ B;  1EFI D;  2B2Y C;  1ESF A;  1MSG A;  1SE3 A;  1TWC B;  5E1F A;  2ZXP A;  4CKC A;  3I4M B;  1AN8 A;  2VB3 X;  3TBI B;  3KK7 A;  4PMW A;  2PPB C;  1CI3 M;  2K33 A;  2R6G A;  1AZQ A;  5JOB A;  4AYB B;  4OGQ C;  1KNA A;  2F0H A;  4WRD A;  4LJZ C;  1CTM A;  3TDQ A;  3TSS A;  3R2I A;  2RSN A;  3O13 A;  4QB4 A;  3FPP A;  1PTO F;  2EE1 A;  4DU9 A;  2F0F A;  1QCB D;  4KN7 C;  1U4P A;  3A7A B;  4MHE A;  3BDO A;  3DWQ A;  4DA2 A;  1FNU A;  2F0P A;  1F2Z A;  2A6E C;  1TII D;  1B50 A;  1UAP A;  4HMJ A;  2FFK B;  1JIC A;  4QIW B;  2EXZ A;  4ID6 A;  3GV6 A;  4A93 B;  4KHV A;  4O42 A;  1Y8N B;  3W2D A;  2MHV A;  2SNM A;  5CV4 A;  2WII B;  3VR2 A;  4DNT B;  5CMD A;  4CBV A;  1NR4 A;  3HZX A;  1S5F D;  3PO2 B;  4Q5V A;  4JK1 C;  3SVM A;  1LV9 A;  3PV0 A;  4BWG B;  1HCZ A;  2OXP A;  4K2K A;  1G2S A;  1E0B A;  1QNU A;  4C3H G;  1E2W A;  4A3K B;  2NVY B;  2E75 C;  4DF7 A;  1EWC A;  1U4R A;  4CJ1 B;  3ERQ A;  1RF2 D;  5COR A;  5IGB A;  3H94 A;  2XRQ D;  2L55 A;  1STB A;  3TN2 A;  1MI2 A;  4KV6 A;  1U4L A;  2PQE A;  4H13 C;  2FMC A;  1ML0 D;  1C48 A;  2ENB A;  3NPP A;  1STY A;  3NWS A;  4MN3 A;  3NK9 A;  5C44 B;  3P75 A;  4P2C B;  2K03 A;  5A2Q L;  1D5M C;  1PLF A;  2Z1C A;  2NN6 I;  3URY A;  1IYU A;  4HMI A;  4XT3 B;  1DM0 B;  2RA4 A;  3S2H B;  1SYG A;  4OIJ A;  3A7L A;  2A5H A;  5KND A;  5JJZ A;  1ET9 A;  5IT9 E;  4ZYS A;  1I4G A;  4N9T A;  3D4D A;  1STA A;  3LX0 A;  4FF2 A;  1ENA A;  4IAL A;  4F87 A;  2EJM A;  1E2V A;  3T51 B;  5I4D A;  3S16 B;  4FF4 A;  2B2U C;  1G2T A;  3U9S A;  3WOF A;  2PO4 A;  3OSO A;  5D3D A;  2PNR C;  4IN3 A;  2XWB B;  2YU9 B;  3BG3 A;  1H9R A;  2IWH A;  3K57 A;  2A74 C;  1IHZ A;  2O4X A;  3GTG B;  3G6J B;  1R9T B;  4X3U A;  3D4R A;  2NTT A;  3HP3 A;  2E2H B;  1GUN A;  4RGO S;  5C0X I;  2F0G A;  2E2D C;  1TT2 A;  1H9K A;  4DNR B;  2EYM A;  5FO7 B;  3K7A B;  1AW7 A;  1VCI A;  5LL6 S;  2A68 C;  5ELF A;  3DEP A;  2F0N A;  1QIL A;  3PIP 3;  4J8Q A;  3DHQ A;  2JSO A;  2VNU D;  1WCM B;  1Z47 A;  2A73 B;  1G29 1;  1ILQ A;  1L0X B;  2FMM A;  4IUU A;  1BF4 A;  2KCN A;  4H0L C;  1I4R A;  1ZXT A;  3VR4 A;  4G57 A;  3IFT A;  4EVO A;  1TWA B;  3K5N A;  2NTS A;  3G7L A;  1K8M A;  3I4N B;  4LK1 C;  2TSS A;  4RHR A;  3FRP B;  1IYV A;  5CC4 A;  4K8J A;  1RDP D;  1WTV A;  1LT6 D;  4HED A;  1O80 A;  4C3I B;  3T13 A;  5JPM C;  3TP7 A;  5EPJ A;  3GTM B;  5CV9 A;  2MJ8 A;  2N55 A;  4M1U B;  2ICI A;  3S17 B;  4N9P A;  2F4I A;  3ONA B;  4C2M B;  2KEC A;  2WKC A;  5EBC A;  4G4K A;  1PMR A;  5M3M B;  1ET6 A;  2CVR A;  5FKA C;  1ZYR C;  2F0L A;  1CHQ D;  1TY2 A;  5BN3 A;  1TR5 A;  3ND8 A;  2EJF C;  5CV8 A;  3R93 A;  2KVM A;  3MFG A;  5I2X A;  1IW7 C;  1ESR A;  2A6H D;  4RGN A;  3K59 A;  4ZLT F;  4KY5 A;  4MIU A;  1LT3 D;  5T1I A;  2F0O A;  3FMC A;  5IIF A;  1C4Q A;  5CR3 A;  1B4O A;  3EA6 A;  3EQL C;  2SEB D;  5COY A;  2NVX B;  4EQP A;  1I3Q B;  3L7Z C;  1LAC A;  1EYC A;  3MXP A;  1JE4 A;  1TS5 A;  2RBM A;  4K6L A;  4OL7 A;  1KDA A;  1S5D D;  4OO1 H;  5J22 A;  4J1M A;  3VR6 A;  1NCV A;  1SXT A;  3K5M A;  1ONL A;  3I91 A;  3J7A F;  4BBR B;  1WD1 A;  3D4W A;  3MWY W;  1GUO A;  2A69 D;  1PTO C;  2O2L D;  2KQ3 A;  2L0C A;  3VYR A;  4DAV A;  4B9X A;  2RSO A;  4OIK A;  4C3J B;  2BCO A;  5TSS A;  4B08 A;  4DK0 A;  1I6V C;  2F3V A;  3J81 E;  3H3V C;  1QG7 A;  3S1M B;  2BE5 D;  1S5C D;  3SE0 A;  3L3O C;  3V96 A;  4B9W A;  4K5W A;  2B2V C;  5E4X A;  1JOR A;  2N88 A;  1LTR D;  2K7V A;  2RVL A;  2B2W C;  2AUJ D;  5HUR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...