1D1IA

Mutated shiga-like toxin b subunit (w34a) complexed with receptor gb3 analogue
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
69
structure length
69
Chain Sequence
TPDCVTGKVEYTKYNDDDTFTVKVGDKELFTNRANLQSLLLSAQITGMTVTIKTNACHNGGGFSEVIFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Mutated Shiga-like Toxin B Subunit (W34A) Complexed with Receptor Gb3 Analogue
rcsb
source organism Escherichia coli
molecule tags Toxin
molecule keywords SHIGA TOXIN B-CHAIN
total genus 16
structure length 69
sequence length 69
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 1999-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.70 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1d1iA00
1C48A 1DM0B 1C4QA 1D1KA 1CQFA 4ULLA 2C5CA 2XSCA 1CZWA 4M1UB 4P2CB 1D1IA 1R4PB 1BOSA 2GA4B 1R4QB 1CZGA 1QNUA 2BOSA 1QOHA 3MXGA
chains in the Genus database with same CATH superfamily
2EZVA 1SMXA 2QEJC 4MIUA 4HJ9A 1FYCA 1SBBB 2MFIA 2R7FA 3CCUA 2VUMH 5JJZA 2FHTA 1WTHA 3E5SA 1HZBA 3NBHB 1PRTC 1RTNA 2E75C 2YTVA 2A6HC 3CCMA 3F2UA 1PZKD 4A3JG 1EY6A 1N36Q 2XN9C 4JI6Q 1C7YA 4X64L 1PLFA 1K28A 2MPMA 3L9AX 2RCNA 1XNQQ 1EYDA 3NE5B 1TWGB 3D8GA 3O13A 5E4XA 2EDGA 5C0XJ 1ESRA 1L0YB 4L63B 3PO2H 1PFBA 3PUYA 5C44H 4LFCQ 3V2TA 4NXNL 4JV5Q 1X3FA 1VQHA 3I72A 3CP0A 2K5NA 4IUNA 1JICA 5JPNC 3EBEA 1PH4A 2TMPA 4JI2L 3L0OA 2AQ1B 1K3BC 1R4QB 4DPGA 2N3SA 1VF7A 1LABA 1EYGA 5G3LF 1Q81C 2B2UA 1BCPB 1PTOF 4PQXA 1QNUA 1J9OA 2RVLA 3NTHA 5C3XA 2ID0A 4HSPA 1CQFA 3QIAA 3GTPB 4X66Q 1LACA 1H9RA 3A55A 3HOYB 3TZDA 3OPOA 1BUVT 2IX0A 1CZWA 1JMCA 4OONA 4BS9A 1S5ED 4C56C 1YNJC 4DUYL 1WJJA 1LT3D 1IBKL 4JI7L 1O7ZA 3X3MA 1HR0L 1IBLQ 4LFAQ 1CTMA 3FMCA 1C9OA 1K0SA 3M4QA 4K0KQ 2HIVA 1I4XA 3H94A 3K0YA 5IOCA 3FHWA 2BCOA 5M5XH 3HOXG 1MIUA 2X69A 4JW0A 5C0XG 3KF8B 4B3ML 2V4DA 3PO2G 3S2DB 1G6ZA 2DJFC 4DK6C 2OTLA 1M8AA 1SYDA 2XNAC 1DONA 3M7NA 4HJ5A 2K6AA 1WCMG 3E3XA 1PH1A 2IL8A 4XQJA 1SAPA 1SYCA 2HCCA 2QDBA 3S2HH 5KGUA 1N34L 3G71A 4JI4L 3MAQA 4CBVA 2K75A 3AEVA 3RLOA 3QWNA 1BO0A 2F0TA 2CW0C 4ZKCB 5CV9A 4DR3Q 2EYJA 4DAYA 1GVPA 1G6PA 2F3IA 4KKTA 1WOCA 2K4KA 1HA5A 1ET9A 3EFXD 4TKOB 4GOPB 4DA2A 5IP9G 1SNMA 4GN5A 4C3HB 1ENAA 1PRTD 5ISRA 3CCJA 2CQOA 1MI2A 3PQIA 3RZDB 1K8OA 4IFDG 2WIIB 2RCFA 1KL9A 1MSGA 1HFGA 3HOVB 1PTOD 4OO1H 1OXSC 1TY2A 1ZYRD 1X54A 1X3PA 3RNUA 3S1RB 1B9MA 1YHQA 2R61A 1ENCA 4IUPA 2JA6B 5D3IB 1EEID 1U4RA 3NWTA 5ELNA 4B3TQ 2LY7A 4C3IB 4JK1C 1HNXQ 1QB5D 1BCPF 2FFKB 1JB7A 5ELBA 1VQ7A 4JI0Q 1DM0B 4ME3A 4B3RL 4DR5L 1AH9A 4QL5A 4OGQC 3BVZA 3BU2A 4NDXA 2MJ8A 2L9HA 1AZQA 2Q2UA 2CH4W 3RZOB 2ASBA 1PYBA 5C3EG 4DKAC 2AUJD 3U4VA 5JEAH 5C4HA 2NZ1D 2JEBI 4KN4C 2KCMA 2EYMA 3RLNA 1XMQL 4IUVA 4PZ7A 4UY8C 1Y69U 4O42A 4HEDA 2I46A 1HQRD 4NPSA 1EIFA 4GNXA 4YCVA 1A3UA 5JPMC 4XTCS 1CSQA 3HOWH 4DR1Q 3R8BA 2RHSB 2JA5G 5E7NA 1G2TA 3EVQA 4YIJA 1S3OA 4JI3Q 1WCMB 4HJ7A 2JA7H 1I6HB 2R92B 2Z4HA 5M3FB 3TQYA 4QCLA 2KA7A 5IYCH 2UUBL 1F9PA 2E2IB 1S5BD 1TXYA 4O2DA 4MZ9A 4CHTB 1R9TH 3P75A 2KHIA 2F3VA 3CMAA 4NXMQ 1MSHA 1VQJA 5IP7H 1UAPA 2YU9H 3NPPA 2LS01 4YHHL 3S14H 3SK4A 1I4HA 5JEAJ 1EOVA 1L0XB 3W1BA 4C3HH 3WOFA 5LHY1 3KF6A 1AFPA 1IZ6A 5AJ3Q 1Y14B 1SE2A 1SYBA 3STBD 1M1KC 3ITPA 1TWHH 3I8ZA 2A19A 3HOUH 4BBSH 2KVMA 5L37A 4KHPL 2KEEA 4FYDA 2O4XA 1N33L 4H44C 1HFNA 4GKKL 1C0AA 5KEEA 1F9RA 2PNHA 4IQZA 2XVSA 1J5EL 2E8GA 1SDFA 2A1AA 1NUCA 3DMUA 1RF2D 3VDYA 1R4PB 4RGOS 2X6LA 1TS4A 5BN3A 2RKSA 4YY3L 2F0DA 1IYVA 2LMCB 1UE7A 2JA9A 1EY7A 1Y1WB 1Q3LA 2CCZA 2QCPX 3HOVH 1NBWA 1STBA 3U9SA 5IGFA 3TP7A 3AFPA 2QEXA 4CJ1B 5FJ8H 5AFWA 2F03A 2E2HB 3GTQB 3FDTA 2Q8RE 1P16A 3NXWA 5IT9E 1S4ZA 3A56A 4DV0L 1QVFA 4DAVA 1VQGA 2A68D 3NBIA 2EYFA 3OHXC 3F2CA 5GROA 3BYYB 1EZ6A 3H6MA 2F0NA 3HEJA 1EU3A 3BZKA 2D5DA 3ZJYC 1Y8OB 1GHJA 4RKBA 4UP8A 1O78A 1T5XD 1TWCH 3S1MB 2EY5A 2ZTEA 2F4VQ 3J80c 1AEXA 1Y1VG 2OQKA 3LWUA 4XT3B 1CSPA 3HOZG 1I50H 3PIPA 3PIO3 5JAVA 4LF9Q 1A2TA 5IYBG 1ICFB 2IPKD 3HP3A 1PH2A 1D5MC 5FOBB 4A3DH 4DV6Q 2PW7A 2Z6KA 3S1NB 2KUMA 2E2DC 1QVCA 4BBRH 2XWBB 4DF7A 4LJZC 1GUSA 1RTOA 1UEAB 3GTMH 2L1BA 1M4VA 2F0WA 2FXQA 3H09A 3I7FA 4A3IH 4L5RC 4X65Q 4M8AA 2A8VA 1VQEA 3HFZB 1VCIA 4ZRZA 1SJHD 1WTVA 1NR4A 1IKMA 4JC0A 1H9JA 2QILA 1SE4A 4GLAC 1CI3M 2AWOA 3GTJH 3BDOA 4IPHA 1HTPA 2PQEA 1SXTA 1K83B 3P20A 2XGTA 3CQZH 2AKWB 4DK1A 4A3LH 4B9WA 2NYZD 2FINB 4UP7A 4HCSA 2OQ0A 3EN2A 1M90C 1H9KA 2VXWA 1D5ZC 4I7AA 2ZTCA 4KKSA 1NY4A 4G7HC 3S15B 2DNEA 1WTRA 1VQPA 1B4OA 3P1HA 2H4OA 2MP1A 2VB2X 2QF7A 4HJAA 4MNOA 5C0XH 2RDGA 2YYZA 4PMCA 3T1HL 1PYSB 2VQFL 5IYDH 4XYQA 1JWMD 4OL7A 4N8FA 3VA5A 1DXMA 4L5SA 5EKKA 5IWAQ 4ZQ3A 4DU9A 5JVH3 5D3DA 4IUTA 1HJPA 2B2YC 2EYPA 1VQOA 3I73A 3A8IE 3MXPA 3RZOH 3D4RA 4OWWB 5IGEA 4HCEA 1EY4A 3TS2A 2R93B 2A73B 2F0KA 1I94Q 3J7A5 3TSSA 4RH6A 3G7LA 2BDOA 4RHSA 4ALPA 4AYBG 3M4OB 4PZ6A 3SXHA 1Q86C 3J7ZC 2OTJA 1EFWA 4GKJL 1J8IA 3C2PA 3MFGA 2HHHQ 2R7ZB 1JR0D 2ZJRA 4MHEA 2BH2A 4A3LG 5C44G 2K5HA 3L2PA 1SNOA 1Q8KA 2EYOA 2MO0A 3TDQA 3TS0A 2SNSA 2F0VA 1KC8C 5IODA 1SRUA 1LT4D 1YNNC 2YTXA 1UEBA 2JA6H 1N32L 4FF3A 1U4LA 2K52A 2NB0A 4DR6L 3AU7A 4ZUIA 3KF8A 4A3JH 5I6WA 5A2QE 1HNZQ 3IAYA 2XTIA 1PTOC 4A3MG 1LT6D 1TS5A 1KLUD 2H1EA 3ND9A 1ZYRC 1XTDA 4JPBW 4YWMA 5I2YA 1Y1WH 4DR6Q 2NTTA 4JG2A 2Z8LA 2KOLA 3HKZE 5NUCA 3T53B 3ND8A 4A3FG 2FJ2A 1N32Q 3C46A 2JXMB 3R2IA 4K8IA 4R8NA 2JN4A 3KYHC 4R9WA 2Q2TA 3M7GA 1B8AA 5KIXA 1I6VC 5GAHC 1Q1EA 1SYFA 1K0RA 4P2CB 4GNXC 1GXDC 1QUQA 3DM3A 1Y1VH 2EOTA 4F7XA 2I0QA 4A3BH 1ICWA 3SGIA 4TRDA 1V1OA 2HHHL 1JC7A 1K3RA 5EPLA 4ZKBB 3S16B 3S2DH 1SE8A 3MA2B 2NVTH 4OIKA 1NMGA 3G6EA 3J81L 4LF8L 1B3QA 2C9OA 2L55A 3GDEA 1WVLA 1JWUD 4HIMA 1II3A 2MUYA 3U9OA 3BVMA 1F2LA 4QUFA 1E3PA 5CV6A 4I7ZC 4IPCA 4A93G 1TVXA 1X32A 4AQYQ 3T56B 5FLMG 2YTYA 5K36H 2KBNA 5IWAL 4LW1A 1TWFB 1YJ9A 3S16H 1GUTA 3QG1A 3VR4A 1JORA 1U0LA 2G5DA 2VQFQ 4IJHA 3T1HQ 1F9QA 2K05A 4ZAIA 2R6GA 4N9TA 3HOYH 4ZCKA 3Q24A 5G3LD 2EXDA 3DHQA 3F8TA 3VR3A 1R9TB 3U4ZA 4AYBE 2YV5A 2L11A 2E2JH 1AN8A 1QE6A 1KQSA 3K59A 3MWYW 4B08A 2L12A 3L7ZC 1X56A 3I91A 1ML0D 4RG1A 1QZHA 4IPDA 2DGYA 1BBUA 3STBC 1MGSA 1PH3A 2R7ZH 4A3JB 4IJLA 2EYLA 2Z1CA 1FGUA 2PQAA 1EQRA 4C3IH 3KFUA 5IP7G 4IO9A 2VUMB 1QVGA 4HIKA 1FNUA 3F2DA 1CHQD 5GAGC 4LF7Q 2WINB 1LTTD 5E3FA 2VS1A 5IYCG 3CW2C 5C4XB 1FGBD 3S1QB 4JYAL 3OIQA 4DV6L 1BOSA 4ABNA 2G9DA 1SNPA 1LTBD 1JJGA 4C2MB 2F0GA 3D0FA 1MD2D 4J8QA 5HGTA 3HOVG 2K7VA 3FKIH 4DN4M 2F0UA 1JB3A 3ZYYX 1RIPA 1CKNA 3PUZA 2Z6KC 1A3VA 1RJTA 3HG9A 3KDFA 2X6GA 1STEA 2I5LX 3HS0C 4DK0A 3EJIA 2H5XA 2F4VL 1LT5D 2EQSA 2K1BA 1EOTA 1VQBA 3HOYG 2EJMA 3QOJA 1JWSD 2D62A 2WV6D 4C3IG 1DD2A 1V43A 1EY9A 2RBMA 1KLGD 2ALYB 4JOIA 4KY7A 4LAAA 3C3LA 1CKOA 4JOIC 4KKUA 1PMRA 1BCPC 4DV0Q 1S5DD 2UUAL 1TWAH 2A6EC 5IY0A 1E1OA 4A93B 2N8NA 3TREA 1O7IA 2A74C 3K0XA 1JQYD 4BWGB 3A54A 4F88A 4X62Q 3UDGA 4OWXB 3J81E 5DNFA 3KLRA 4IN3A 2B2VC 3J80L 4FDBA 1STGA 2M00A 1IKLA 5A35A 1SE3A 3M4OH 1PVOA 3K80C 3GTJB 4HMJA 1K8AC 3BZDB 4IFDH 2HT1A 1EEFD 1N33Q 1V1QA 4HMIA 2K5DA 5DM63 4DR7L 1IL2A 2F52A 4RGMA 1I3QH 5JOBA 1L1OB 4A93H 2Z6BA 1IXRA 2MO1A 2N78A 2IHFA 4CKCA 4J6HA 1GM5A 2IHEA 5C3EH 4JI8L 3J81c 4A3MH 1EWIA 3Q23A 4QGUA 1KTKA 2RQXA 3R93A 3S14B 1MJEA 3GTPH 3F1ZA 1Q12A 2IJ0A 4NXML 1EY0A 1L2FA 1NCVA 2JA6G 3PO2B 2F0OA 1RD9D 2VQEQ 2NN6G 3MTSA 4HIDA 2UUBQ 4DUZQ 4LUZA 1E22A 3A8JE 2PW5A 1CZGA 2VB3X 2IX3A 3VR5A 1EZ8A 4IUUA 4JI3L 4QQBX 3JAMi 2A69C 2NTSA 4N9PA 5IT9c 4EQNA 4DUZL 1ESFA 1NTGA 2VQEL 3CCEA 1VQFA 3RN2A 1PDQA 4K8JA 2PCFB 3D3RA 4P73A 4OO1G 4KY6A 4YWKA 1TWFH 1XMQQ 1W6JA 4JI8Q 3DXJC 2EXZA 4UHVA 2F0HA 1QOHA 4EGVA 1K83H 3GO5A 3HKZG 1MJCA 1EQQA 1UNSA 4HAEA 4K6LA 2AHOB 4K5VA 2F0JA 4DR7Q 5EBCA 1L1OA 1BCPD 2GVAA 1T9HA 4MTNA 3LGJA 2WP8J 3Q0AA 2D0PA 3CCSA 2PZUA 1QILA 2R92G 3H0GG 3H3VI 4B3TL 3QJYA 1VQ5A 3TN2A 4GOPA 1BDOA 3W2DA 3GTKB 2D9UA 3KK7A 5CV8A 1TY0A 2YU9B 3NEMA 2CVRA 2NN6H 3TEHB 4HN7A 3CD6A 4X62L 5CC4A 5EKIA 1Q7YC 1XJVA 4U673 5FLXE 3EIVA 1YIJA 1O7LA 3G48A 3RZDH 3A5UA 4E6IA 5FO9B 2F3WA 3K81C 3BG3A 1PRTF 2P5ZX 4QIWB 3UE1A 2UUAQ 1I6HH 3K7AB 1D6EC 4FO2A 1VQMA 4FXDA 2MNAA 3MXGA 4QB4A 5EQ0A 3S24A 1LM0A 3J81i 1TWCB 1YJWA 3MEHA 3E9IA 3H0GB 1Q90A 1KRSA 4DR3L 1PZJD 1JT8A 1PYWD 3DWAA 3A8KE 1WYDA 4A3IG 2I5MX 2EE1A 2JYOA 5M5YH 4IOAA 1QCBD 5C3EB 1KDAA 1WTXA 2D2CC 1YNXA 3J80E 2JA5B 1LUZA 3CMEA 3PSIA 3OOCA 3K7AH 2BOSA 2WB1E 4XT1B 2IY5B 3H91A 2WKDA 2J4XA 1LYLA 2XIWA 3JAMc 1KRTA 3SK6A 3MEFA 4R4TA 2TSSA 4X3KA 4B3MQ 4I65A 2B2WA 2A69D 3K58A 1W6KA 4JYAQ 1XWEA 3OYYA 4F8MA 4PG3A 4LMQD 4XYOA 2LSSA 3FPPA 3K7UC 4PV1C 3Q22A 2E76C 1N9WA 5M3FG 1IBLL 1HR0Q 4LF7L 4LUVA 4JI7Q 1X3QA 3OMGA 5KYIA 2QKIC 1QUQB 1B9NA 1HUMA 3VA7A 4WORA 1HPCA 3TRZA 4UPAA 3UDXA 2XSCA 4M1UB 3I3CA 1G51A 1Y1VB 4L5QA 1K9MC 5EGTA 1YNND 1K8MA 1RHPA 5I9OA 4HIOA 3CRKC 1D5XC 2A6HD 1OXXK 5IT9L 3DLLA 5IGCA 4KLKA 2LXKA 3DWPA 4JI2Q 3AMUA 3TBIB 2JA8H 4JV5L 3NQIA 4BXXH 4NXNQ 4H7BA 2MHVA 2OEOA 5E4WC 4LFCL 2ZXPA 4P74A 3DEOA 3VR2A 4ULLA 4KV6A 4EX5A 5JJLA 4LNQA 4HR7B 4V190 1XNQL 3ULPA 3MXNB 1JOKA 5F2DA 1NMFA 1F2ZA 5CGKA 1Q82C 2HUGA 1U4MA 3QO2A 1A15A 1G91A 4G57A 5COYA 4A3CH 1JE5A 5M3MH 4AQYL 1ET6A 2AWNA 3J81j 4FXGC 3J7YW 3G4SA 2RDFA 4C3HG 4A75A 4QF4A 4BA2I 4A3GG 4DNTB 5CMDA 4A3IB 1KNAA 1EL0A 2R7DA 1PH9A 4PNYA 4XQNA 4A3MB 3I4LA 1VQNA 1SFOH 5ELDA 4BY7G 4LF8Q 1KAWA 1S5FD 4TQUS 1IL8A 4J1MA 4KHVA 2AMCB 2WAQE 2QGQA 1DYQA 4UAIA 5M5XB 3E0JA 4LF4Q 1AZPA 2CFMA 2RDHA 4WJWA 4DV2L 1H95A 4DAPA 2JA5H 1V1PA 1QWYA 4DV5Q 4A3EG 2B8FA 3OSOA 4DFAA 3HOUG 1JJ2A 4XXEA 4RAUC 1FNWA 1PH5A 5GQOA 3E0EA 2QA4A 1HUNA 2PZTA 4A3GB 2K5QA 1FJGL 5LL6S 2A6ED 2DY8A 5C6AA 2VW9A 1STNA 1CQVA 5HGQA 1HNZL 3CCLA 5IGBA 4LWCA 3CKIB 3D31A 4A3CG 2KQ3A 3KDFB 3R2TA 3S15H 1HZCA 4B3SL 4DXGA 3CCRA 3FPUB 1BXTA 3CU7A 2NVXB 2R7ZG 2B63G 4R4CA 2JP1A 4X3TA 1JCKB 1E24A 1KDCA 3NP8A 3D6WA 5J3BA 1Y8PB 3KLSA 4GN3B 3RMHA 2DUDA 4LFBL 4RFBA 1EIHA 1BNZA 1EFID 3EQLC 4KJOA 4BBSB 3S1QH 1GO3E 1Q1BA 4GKJQ 5FO7B 4X6AH 3PUXA 4FP5D 4FVMA 1A0IA 1LTGD 4RGTA 4GNXB 3CPWA 2Q2HA 3LWEA 4GS3A 1RCVD 3PUVA 5EPJA 2ZJPA 4OO1I 4OHJA 3S17H 4DNRB 2O5JC 2QDLA 2F4IA 2K32A 4R1JA 1I94L 3M9BA 3C1FA 3QR8A 4HSVA 3I56A 3PUWA 3D6CA 2R93G 2KCTA 5FLMH 2NVXH 1G2SA 4NW2A 4LF6Q 3LX0A 4GOPC 1XPOA 4QJFA 3PGZA 5M3FH 1IYJB 5I4DA 2JSOA 5M3MB 4ZUJA 2BH8A 1HCZA 1EY5A 1B44D 2F0PA 2E2JB 3NTIA 3L3OC 1W2BA 3S1MH 2BA0A 2OXPA 3VYTA 2VY3A 1SROA 2DY7A 4JBMA 1EIGA 3FRPB 4JVZA 4C1NI 3GTQH 3K57A 1GHKA 3GQBA 3M4YA 5C5MA 3SK5A 4B9XA 3KBXA 4PZ8A 4TVAB 2RSNA 4A3BG 4A4IA 4Z9CB 3HOXH 1STAA 5C4XH 1LTSD 1A2UA 5LMUL 3CXCA 5IP9H 2LFNA 2HIXA 1SSOA 4P75A 3GTMB 1A62A 2Y0SB 2VZAA 4BBRB 2PYKA 5J1ZA 4RGNA 3SVMA 4X65L 1A63A 2XRSD 5CBEE 2OF1A 2WKCA 1X3EA 5CR3A 2L5TA 1E0BA 2EPBA 3H3VC 1OXVA 3FVQA 2RA4A 3MHBA 3M85A 2A5HA 4LF5Q 5DM73 1EYCA 2F0MA 2NZHA 3CCVA 3NHHA 4KJNA 2B2WC 4BY1H 4K2KA 1PFSA 4LF9L 1GD7A 3UE0A 1EQTA 2AUKA 1IBMQ 1TWAB 3H15A 1KIXA 3NWSA 2MGSA 1G291 4ODGA 3PO3H 3GTLH 3T4AC 4IALA 1EWHA 3N52A 3CF5A 2R92H 1PV4A 1BQQT 4IZ8A 2KHJA 3K5OA 1NJIC 4F87A 5ELOA 2L4NA 1L0WA 2O2LD 4YCUA 2JEAI 1S72A 3NQTA 3EA6A 3PIP3 2WACA 1GKHA 2UU9L 2G9HD 3A0JA 1TR5A 4K5XA 5GADC 5I9PA 4A3KB 3E9HA 2B39A 2SEBD 1MHWC 3CPFA 1YITA 2I07B 5ELFA 1HZAA 3M4PA 1X55A 1WD1A 1ZXTA 3EROA 2KEDA 4KN7C 3GV6A 5KRUA 2N55A 1DOLA 1LTID 2KENA 4DR2L 1IW7D 2M9VA 1B50A 1C8CA 1KDBA 5LL6X 3HGBA 1N8RC 3HRZC 4YY3Q 2F0SA 2WAQB 3SE0A 3RLFA 2UXCL 1U5KA 1HR0W 3PF5A 1XPRA 4U68A 4A3BB 1JE4A 3M3YH 1VDZA 4FF4A 4DR4L 1J5EQ 4HTHA 3DM1A 2OT2A 4A3DB 1UE6A 4GKKQ 1XNRQ 1GOZA 4POFA 3OMCA 3PMFA 1EY8A 5KYLA 1PH6A 1PHJA 4DV1L 1CA6A 4KHPQ 2A68C 1PRTB 5FLXc 1D7QA 1TU2B 3NELA 1UE1A 1JOOA 1YHAA 4CDEC 1WFQA 2HCIA 5AJ3L 2Y0SG 4Q5VA 2VUMG 1GJXA 3W3AA 5GAEC 3T1YL 2F0FA 2IT1A 1FVIA 3C1EA 1VS0A 4YHHQ 1BVSA 1EQVA 4JI1L 1VQ9A 1D2BA 1PTOB 5T1IA 2B2VA 4WJ4A 2F0QA 2E5LQ 1I4RA 1AP0A 3ULLA 1Y8NB 3OTOL 4BBRG 1H9MA 2PQAB 3SEBA 1WTQA 3W1GA 3I4NG 1VQIA 3ERSX 4A3DG 1YBYA 2E2IH 3ER0A 3IFTA 5IYBH 2Z9HA 2BE5C 1D8LA 1I4PA 2CWAA 2ES2A 1ILQA 2SOBA 1XPUA 4DR1L 1P8LA 1F9SA 4KI0A 2JA7B 2Y0SE 4OX9Q 4JI5Q 3SR1A 2B2TA 3DUZA 1WD0A 1NSNS 3NUCA 2B2TC 4JBWA 1SYEA 4QIWE 3MZ5A 3R3OA 3CHBD 3MFYA 1GUWA 5EJWA 3LNNA 1YEZA 3VYSA 3GTLB 3I70A 2K33A 4A3KG 3X3NA 1CKNB 1RDPD 3IL8A 3CC7A 3I4OA 2CHBD 2RHQB 3PCOB 2CH4A 1PA6A 4FF2A 1VF5C 3T51B 4JCVE 2N49A 3K8AA 4R4IA 5KNBA 1MBYA 4DR5Q 4B3RQ 3VYRA 1SR3A 2VL6A 3K5MA 4JI0L 3GTGH 3I4NB 1PH8A 4NP5A 1WTPA 3NSWA 3SDZA 1HNXL 1GUOA 2Z0SA 2V1CC 1X9NA 1VQKA 3W5OA 4MTKA 1SMYC 2EY2A 2NVYH 1GUNA 3V96A 1UE5A 2N88A 2JA7G 5FJ8G 1HNWQ 2C5CA 3KBGA 4QY7A 3T16A 2PMZE 1ZEQX 2GA4B 1PH7A 1H9SB 2JA8B 3A5ZB 4WRDA 1Z7TA 3RD4A 1OTCA 1XYIA 1I4GA 4C1NK 1SLJA 5A2QL 3HOXB 1KNEA 2WAQG 1SEBD 4TSSA 2ZXRA 2ZXOA 1DCZA 3BJUA 5CBAE 4O0AA 3AQQA 4ZYSA 4XDXA 3HKZB 5IE8A 5HURA 3AFQA 2EJFC 4DAMA 4L8JA 3J80i 3WDNA 5HY6A 3HOWB 2B29A 5CYUA 3CC2A 3OWFA 1TKWB 4FXKC 1VMPA 2PI2A 3A7LA 1L1OC 4N8X1 4P71A 3VYUA 2AQ2B 1BBWA 5T1GA 4EQ5A 3KUPA 2HDMA 3OW7A 1PTOH 1YHBA 5C4JB 4Y7NH 5BN4A 2K04A 4JI4Q 5CV4A 4OIJA 2HQLA 4IOCA 1N34Q 2HQEA 1EWCA 1CK1A 2XWJB 3RR5A 1HRJA 2GN5A 4X3SA 3TMEA 1OXTA 2Q8IB 5DEHA 4POGA 2IW3A 4MN3A 1BKBA 2IX1A 2BDNA 1B2TA 4V0BA 3P7JA 4KK7A 2WB1G 2K03A 3KLWA 3WWVA 3OW2A 3HOWG 4K0KL 3ICEA 2Q8TA 5FK9C 3KF6B 5C4JH 5EPKA 3GTKH 3PV0A 4LFAL 3D4DA 4LK1C 4DUYQ 1IBKQ 2ATWA 1ILPA 1WI5A 1X3GA 1YJNA 2SDFA 1VQ4A 2JQOA 1K8GA 4X66L 2D0OA 5C5LA 5JEAG 4DAYB 3Q6SA 2L0CA 4G7ZC 4R4OA 5FLXL 1S40A 4DNIA 2EY1A 1BF4A 4L6TB 2JJQA 4CKBA 1DOMA 2CWPA 5CV5A 2ZT9C 4A3KH 1WCMH 4RCOA 4Q0FA 1KAAA 2HDLA 2KECA 5FO8B 2K5VA 1WTWA 1TWGH 2HD3A 4AYBB 1VQAA 3F2BA 1XXGA 5FKAC 3NBHA 2DJGC 3BVGA 1CM9A 1G8ZD 1C48A 4X64Q 2RF4A 1SYGA 1QZGA 1HNWL 1J6QA 2K14A 4JI6L 1LV9A 1N36L 4UP9A 5M5WH 3B6YA 3D4WA 1Y1WG 3WOEA 1WTOA 2DNCA 1IYUA 1ONLA 4C2MH 2BA1A 3S1NH 2Q2IA 3ONAB 2ICEC 3K5LA 1STHA 4EQPA 5E1FA 2F0IA 1TS2A 2JK8A 2EVBA 3JC66 3URYA 4IUQA 1Z9FA 4FF1A 1EYAA 3N6RA 1QG7A 3KJOA 2RSOA 1U4PA 2B3GA 1Q8IA 4C3JH 4DV4Q 1XMOL 3G6JB 2NWGA 4NB3A 4IFDI 3BYTB 4ID6A 3I4MH 1SNQA 3PO3G 4JI5L 4OX9L 1CHPD 2K50A 4Y52H 2WB1B 2PZWA 3I55A 1ASZA 5M9OA 1QJOA 2EJGC 5BN5A 1HA6A 2PPBC 2ZM6Q 1YVCA 1V1PB 1C4QA 5M5YB 1ENFA 1UWVA 1QNKA 2GVBA 1HH2P 1B3AA 2UXDQ 3OTOQ 3IRBA 5KNCA 3H0GH 4OEMB 4C3JG 2E5LL 4OELB 4ZLTF 1DJRD 1Z47A 1XTCD 2EYHA 3I2ZA 4BY7B 2F0LA 1STYA 1FD7D 2B2YA 2R3ZA 4EVOA 1CUKA 1E2WA 1IW7C 2K5WA 4JI1Q 1ASYA 3GTOH 2UXBQ 1KXLA 1RODA 1D1IA 3T1YQ 3ERQA 2NVYB 1E2VA 1HTLD 2JE6I 3IFDA 3GD7A 5IGGA 3OIPA 5IIFA 5J39A 5BR8L 4RKLA 5IYDG 1VQ6A 2NVQB 3PO3B 1HHVA 1PFNA 2Z4IA 1JJCB 5D65A 4DV1Q 3SHLA 1EIYB 1XX8A 4NKLA 1CT1D 5C4ZA 1XNRL 4RCNA 4EQOA 4CJ0B 2UUCL 3A7AB 4DR4Q 3MVVA 1NR2A 3S9WA 1CFMA 2PMZB 3NK9A 3I4MG 1B53A 1YI2A 2PI2E 5C0XI 2UXCQ 1I50B 3KLSX 4R4QA 4S3SA 2OWOA 3Q8DA 5CV7A 1EU4A 1H9SA 3BS1A 5LMNQ 1PXUA 5C3WA 3FKIB 4DR2Q 1HZ9A 4CKEA 1FL0A 3AB9A 4BY1G 4WFN3 2NBFA 1VQ8A 1F77A 3AYHB 3U50C 3HOZB 1SJED 2LXJA 4Y7NB 5IGDA 2R93H 1AW7A 2K01A 4QUCA 2XRQD 3KOJA 2B63B 3GTOB 5H1SE 4DV7Q 1AE3A 2FMMA 4J15A 4K6DA 2C35B 2ENBA 4XIGS 2B2UC 3GV3A 2UU9Q 4PMBA 4CGYB 2CW0D 4YCWA 3UI2A 4IPGA 2F1MA 3I4MB 2CKZB 2KJXA 3A74A 1TS3A 4DV3Q 3HOZH 5C4XG 2OCEA 4KTAA 2M2LA 1SN8A 3PF4A 1X6OA 4BA1I 3NENA 4IFDJ 3MC0B 1HXYD 1DOKA 4BY1B 3MXNA 1E2ZA 4CDFC 1IBML 1KD1C 2B63H 1V8QA 2DN8A 5EAYA 4G7OC 1NNXA 4C3JB 4NMZA 4K14A 4JBJA 2CQAA 3J7AV 4LF5L 3M3YB 3K5NA 3JAME 3DEPA 1Q46A 1IHZA 3BZCA 4P72A 2O5IC 1B7YB 4KMUC 1O80A 3HOUB 1SNCA 1A3TA 1OXUA 5DLQE 3V05A 1CA5A 2WFWA 4JBKA 3K6OA 4OWTB 5CORA 2FMCA 3KJPA 5DAUA 5TSSA 3TZUA 3U58A 2K28A 1A8VA 4H13C 3TP6A 3S1RH 5M5WB 1SNDA 1LO5D 4A3EH 5LMUQ 1VQDA 4H02A 4HJ8A 4A3FB 4ME5A 1VMCA 1I4QA 4WJ3M 5KNDA 2SNMA 1W3SA 4KY5A 1YZ6A 2NVTB 3CQZB 1AE2A 2KCNA 4K5WA 4YWLA 4O1NA 2I5HA 1NAPA 5ELCA 1B70B 3CCQA 4DV3L 3UDIA 3T13A 5JJKA 3FKIG 1F2YA 1TT2A 1HQMC 3GP7A 1V9PA 4BBSG 4LUOA 2PO4A 2AQ3B 1B1ZA 2ZTDA 4AH6A 1DGSA 1FR3A 3UDFA 1CKMA 4GN4B 3DWQA 2BE5D 1EUJA 1NE3A 3H3VH 1RL2A 3TP5A 1LLRD 1E1TA 4DV7L 4LF6L 4RA8A 5M3MG 2LKVA 4ZK9B 4QMGA 3RN5A 1D1KA 3FP9A 1UUPA 4AIMA 1U9RA 2NN6I 2PNRC 4CDDC 3S2HB 3BDLA 1TQOA 5LMNL 2KHSA 3CAMA 5JJIA 3NTKA 1O7YA 4UDUC 1T5EA 1ZKOA 3JAML 3PIOA 1PZID 5ELEA 5LMNW 3J7AF 4KD3A 4BXXG 1I3QB 4G4KA 4DXFA 3S17B 3E6ZX 1K73C 2UUCQ 2NUCA 3BDCA 4GZYC 5EKLA 2NZOA 3MXUA 4LFBQ 4H0LC 3ULJA 1KABA 1MKHA 4RWSC 1LTAD 1OO9B 1SMYD 2B8GA 4RHRA 3CRLC 1TIID 2QW7A 5I6YA 1VQLA 1GUGA 3VR6A 4GLVB 2EY6A 5BR8Q 1TWHB 2ZJQA 4CDCC 3SK8A 4BY7H 1RKNA 4B3SQ 4ILWA 4APVA 1BR9A 2NVQH 3HKSA 5I2XA 4RMFA 5D14A 2UXBL 5K36G 3QB3A 1JOQA 5EBDA 4XQQA 4KD4A 2L15A 4A76A 4A3GH 1YNJD 1BBXC 3CC4A 1DZ1A 3OWEB 1LTLA 3I90A 2F0EA 4DGZA 1FJGQ 3RUZA 2VNUD 4R8IA 3QOLA 4PMWA 2ICIA 2UXDL 1A6XA 5K5PA 1VQCA 4FNFA 2MQHA 1X65A 4IURA 2E74C 2ZM6L 4DV5L 5C44B 4GLXA 1FNVA 2E2HH 4DV2Q 4OXPA 1Z6HA 4KHZA 4A3EB 2IWHA 1LTRD 3I4NH 1F2MA 2EIFA 4LF4L 1E7ZA 5J22A 4L5TA 4DK3C 2J0TD 2JA8G 1S5CD 5JVG3 4DV4L 1XMOQ 1SFOB 3TP8A 3IKJA 3FEWX 2KCCA 1PFMA 2J7ZA 4X3UA 3GTGB 1I5FA 3HZXA 4CJ2C 1KHIA 4A3FH 4K2LA
chains in the Genus database with same CATH topology
2EZVA 2QEJC 4MIUA 1FYCA 1SBBB 5JJZA 2FHTA 3E5SA 1PRTC 1RTNA 2E75C 2A6HC 3F2UA 1PZKD 1EY6A 2XN9C 1PLFA 2MPMA 3L9AX 1EYDA 3NE5B 1TWGB 3D8GA 3O13A 5E4XA 2EDGA 5C0XJ 1ESRA 1L0YB 4L63B 1PFBA 3PUYA 3V2TA 3I72A 4IUNA 5JPNC 1JICA 2TMPA 2AQ1B 1R4QB 1VF7A 1LABA 5G3LF 2B2UA 1BCPB 1PTOF 4PQXA 1QNUA 1J9OA 2RVLA 3NTHA 5C3XA 2ID0A 4HSPA 1CQFA 3QIAA 3GTPB 1LACA 1H9RA 3A55A 3HOYB 3TZDA 3OPOA 1BUVT 2IX0A 1CZWA 4BS9A 1S5ED 4C56C 1YNJC 1LT3D 1O7ZA 3X3MA 1CTMA 3FMCA 1I4XA 3H94A 3K0YA 5IOCA 2BCOA 2X69A 5C0XG 2V4DA 3S2DB 1G6ZA 1M8AA 1SYDA 2XNAC 1DONA 3M7NA 2K6AA 2IL8A 4XQJA 1SAPA 1SYCA 2HCCA 2QDBA 5KGUA 3MAQA 4CBVA 3QWNA 1BO0A 2F0TA 2CW0C 4ZKCB 5CV9A 2EYJA 4DAYA 4KKTA 3EFXD 1HA5A 1ET9A 4TKOB 4DA2A 1SNMA 4C3HB 5ISRA 1ENAA 1PRTD 1MI2A 3RZDB 1K8OA 4IFDG 2WIIB 1MSGA 1HFGA 3HOVB 1PTOD 4OO1H 1OXSC 1TY2A 1ZYRD 1X3PA 3S1RB 1B9MA 2R61A 1ENCA 4IUPA 2JA6B 5D3IB 1EEID 1U4RA 3NWTA 4C3IB 2LY7A 4JK1C 1QB5D 1BCPF 2FFKB 5ELBA 1DM0B 4OGQC 3BVZA 4NDXA 2MJ8A 2L9HA 1AZQA 3RZOB 2AUJD 5JEAH 5C4HA 2NZ1D 2JEBI 4KN4C 2EYMA 4IUVA 1Y69U 4O42A 4HEDA 2I46A 1HQRD 1A3UA 5JPMC 4XTCS 3R8BA 1G2TA 3EVQA 4YIJA 1WCMB 1I6HB 2R92B 2Z4HA 5M3FB 4QCLA 2KA7A 1F9PA 2E2IB 1S5BD 4CHTB 3P75A 2F3VA 1MSHA 1UAPA 3NPPA 2LS01 3SK4A 1I4HA 5JEAJ 1L0XB 3WOFA 5LHY1 1AFPA 1SE2A 1SYBA 3ITPA 3I8ZA 2KVMA 2KEEA 4FYDA 2O4XA 4H44C 1HFNA 5KEEA 1F9RA 4IQZA 2XVSA 1SDFA 1NUCA 3DMUA 1RF2D 1R4PB 4RGOS 2X6LA 1TS4A 5BN3A 2RKSA 2F0DA 1IYVA 2LMCB 1EY7A 1Y1WB 1Q3LA 2QCPX 1STBA 3U9SA 5IGFA 3TP7A 4CJ1B 5AFWA 2F03A 2E2HB 3GTQB 3FDTA 2Q8RE 5IT9E 3NXWA 1S4ZA 3A56A 4DAVA 2A68D 3NBIA 2EYFA 3OHXC 3BYYB 1EZ6A 3H6MA 2F0NA 3HEJA 1EU3A 2D5DA 1Y8OB 1GHJA 4RKBA 1O78A 1T5XD 3S1MB 2EY5A 1AEXA 3LWUA 4XT3B 3PIO3 5JAVA 1A2TA 2IPKD 3HP3A 1D5MC 5FOBB 2PW7A 3S1NB 2KUMA 2E2DC 2XWBB 4DF7A 4LJZC 1GUSA 1RTOA 1UEAB 2L1BA 1M4VA 2F0WA 3H09A 4M8AA 1VCIA 4ZRZA 1SJHD 1WTVA 1NR4A 1IKMA 1H9JA 2QILA 1SE4A 1CI3M 2AWOA 3BDOA 1HTPA 2PQEA 1SXTA 1K83B 4DK1A 3P20A 4B9WA 2NYZD 2FINB 4HCSA 1H9KA 2VXWA 1D5ZC 4KKSA 4G7HC 3S15B 2DNEA 1WTRA 1B4OA 3P1HA 2H4OA 2MP1A 2VB2X 2QF7A 5C0XH 2RDGA 2YYZA 4PMCA 4XYQA 1JWMD 4OL7A 3VA5A 1DXMA 5EKKA 4ZQ3A 4DU9A 5JVH3 5D3DA 4IUTA 2B2YC 2EYPA 3I73A 3A8IE 3MXPA 3D4RA 5IGEA 4HCEA 1EY4A 2R93B 2A73B 2F0KA 3TSSA 4RH6A 3G7LA 2BDOA 4RHSA 3M4OB 3SXHA 1J8IA 3C2PA 3MFGA 2R7ZB 1JR0D 4MHEA 1SNOA 2EYOA 3TDQA 2SNSA 2F0VA 5IODA 1LT4D 1YNNC 4FF3A 1U4LA 2NB0A 3AU7A 4ZUIA 3KF8A 5I6WA 5A2QE 3IAYA 1PTOC 1LT6D 1TS5A 1KLUD 2H1EA 3ND9A 1ZYRC 5I2YA 2NTTA 2Z8LA 2KOLA 5NUCA 3T53B 3ND8A 2FJ2A 3C46A 2JXMB 3R2IA 4K8IA 4R8NA 4R9WA 3M7GA 5KIXA 1I6VC 1Q1EA 1SYFA 4P2CB 1GXDC 2EOTA 4F7XA 1ICWA 4TRDA 1V1OA 1JC7A 5EPLA 4ZKBB 3S16B 3MA2B 4OIKA 3J81L 2C9OA 2L55A 1WVLA 1JWUD 1II3A 2MUYA 3U9OA 3BVMA 1F2LA 4QUFA 5CV6A 4I7ZC 1TVXA 1X32A 3T56B 5K36H 1TWFB 1GUTA 3QG1A 3VR4A 1JORA 1F9QA 2K05A 4ZAIA 2R6GA 4N9TA 3Q24A 5G3LD 3DHQA 3VR3A 1R9TB 2L11A 1QE6A 1AN8A 3K59A 3MWYW 4B08A 2L12A 3L7ZC 3I91A 1ML0D 1MGSA 4A3JB 2EYLA 2Z1CA 2VUMB 1FNUA 1CHQD 2WINB 1LTTD 5E3FA 5C4XB 1FGBD 3S1QB 3OIQA 1BOSA 4ABNA 2G9DA 1SNPA 1LTBD 4C2MB 2F0GA 4J8QA 1MD2D 5HGTA 2K7VA 4DN4M 2F0UA 1JB3A 3ZYYX 3PUZA 1A3VA 1RJTA 3HG9A 2X6GA 1STEA 3HS0C 4DK0A 3EJIA 1LT5D 2K1BA 1EOTA 2EJMA 3QOJA 1JWSD 2D62A 2WV6D 4C3IG 1DD2A 1V43A 1EY9A 2RBMA 1KLGD 4KY7A 4LAAA 3C3LA 4KKUA 1PMRA 1BCPC 1S5DD 2A6EC 4A93B 2A74C 1JQYD 4BWGB 3A54A 4F88A 3J81E 5DNFA 3KLRA 4IN3A 2B2VC 3J80L 1STGA 2M00A 1IKLA 5A35A 1SE3A 3GTJB 4HMJA 3BZDB 4IFDH 1EEFD 4HMIA 2K5DA 5DM63 4RGMA 5JOBA 4CKCA 4J6HA 3Q23A 1KTKA 2RQXA 3R93A 3S14B 1Q12A 2IJ0A 1EY0A 1NCVA 3PO2B 2F0OA 1RD9D 2NN6G 3MTSA 3A8JE 2PW5A 1CZGA 2VB3X 2IX3A 3VR5A 1EZ8A 4IUUA 2A69C 2NTSA 4N9PA 4EQNA 1ESFA 1PDQA 4K8JA 2PCFB 3D3RA 4OO1G 4KY6A 1W6JA 3DXJC 2EXZA 2F0HA 1QOHA 4EGVA 3GO5A 1UNSA 4HAEA 4K6LA 4K5VA 2F0JA 5EBCA 1BCPD 2WP8J 3Q0AA 2PZUA 1QILA 3QJYA 3TN2A 1BDOA 3W2DA 3GTKB 2D9UA 3KK7A 5CV8A 1TY0A 2YU9B 2CVRA 2NN6H 4HN7A 5CC4A 5EKIA 4U673 5FLXE 1O7LA 4E6IA 5FO9B 2F3WA 3BG3A 1PRTF 4QIWB 3K7AB 1D6EC 4FO2A 4FXDA 3MXGA 4QB4A 5EQ0A 1TWCB 3MEHA 3H0GB 1Q90A 1PZJD 1PYWD 3DWAA 3A8KE 2EE1A 2JYOA 1QCBD 5C3EB 1KDAA 1WTXA 2D2CC 3J80E 2JA5B 3OOCA 4XT1B 2BOSA 3H91A 2WKDA 2J4XA 2XIWA 3SK6A 2TSSA 4X3KA 3K58A 4I65A 2B2WA 2A69D 1W6KA 1XWEA 4F8MA 4LMQD 4XYOA 3FPPA 4PV1C 3Q22A 2E76C 1X3QA 3OMGA 5KYIA 2QKIC 1B9NA 1HUMA 3VA7A 4WORA 1HPCA 2XSCA 4M1UB 3I3CA 1Y1VB 5EGTA 1YNND 1K8MA 1RHPA 5I9OA 3CRKC 1D5XC 2A6HD 1OXXK 5IT9L 5IGCA 3DWPA 3AMUA 3TBIB 3NQIA 4H7BA 2MHVA 2OEOA 5E4WC 2ZXPA 3DEOA 3VR2A 4ULLA 4KV6A 4HR7B 4V190 1JOKA 5F2DA 1F2ZA 5CGKA 2HUGA 1U4MA 3QO2A 1A15A 1G91A 4G57A 5COYA 1ET6A 2AWNA 4FXGC 3J7YW 2RDFA 4C3HG 4QF4A 4BA2I 4DNTB 5CMDA 4A3IB 1KNAA 1EL0A 4PNYA 4XQNA 4A3MB 3I4LA 5ELDA 1S5FD 4TQUS 1IL8A 4J1MA 4KHVA 1DYQA 4UAIA 5M5XB 3E0JA 1AZPA 2RDHA 4WJWA 4DAPA 1V1PA 1QWYA 2B8FA 3OSOA 4DFAA 4XXEA 4RAUC 1FNWA 1HUNA 2PZTA 4A3GB 2K5QA 5LL6S 2A6ED 2DY8A 5C6AA 1STNA 1CQVA 5IGBA 3CKIB 3D31A 2KQ3A 3R2TA 4DXGA 3FPUB 1BXTA 3CU7A 2NVXB 2JP1A 4X3TA 1JCKB 1KDCA 3NP8A 3D6WA 1Y8PB 3KLSA 3RMHA 4RFBA 1EIHA 1BNZA 1EFID 3EQLC 4KJOA 4BBSB 1Q1BA 5FO7B 3PUXA 4FP5D 4FVMA 1LTGD 4RGTA 3LWEA 1RCVD 3PUVA 5EPJA 4OO1I 4OHJA 4DNRB 2O5JC 2F4IA 2K32A 3C1FA 4HSVA 3PUWA 3D6CA 1G2SA 4NW2A 3LX0A 5I4DA 5M3MB 2JSOA 4ZUJA 1HCZA 1EY5A 1B44D 2F0PA 2E2JB 3NTIA 3L3OC 2BA0A 2OXPA 3VYTA 2DY7A 1EIGA 3FRPB 4C1NI 3K57A 1GHKA 3GQBA 3M4YA 5C5MA 3SK5A 4B9XA 3KBXA 2RSNA 4Z9CB 1STAA 1LTSD 1A2UA 2LFNA 1SSOA 3GTMB 2Y0SB 4BBRB 2PYKA 5J1ZA 4RGNA 3SVMA 2XRSD 5CBEE 2OF1A 2WKCA 5CR3A 2L5TA 1E0BA 2EPBA 3H3VC 1OXVA 3FVQA 2RA4A 3MHBA 3M85A 2A5HA 5DM73 1EYCA 2F0MA 3NHHA 4KJNA 2B2WC 4K2KA 1EQTA 2AUKA 1TWAB 3NWSA 2MGSA 1G291 4ODGA 3T4AC 4IALA 1EWHA 3N52A 1BQQT 4IZ8A 3K5OA 4F87A 2L4NA 2O2LD 2JEAI 3NQTA 3EA6A 3PIP3 2WACA 2G9HD 4K5XA 1TR5A 5I9PA 4A3KB 2B39A 2SEBD 2I07B 5ELFA 1WD1A 1ZXTA 2KEDA 3EROA 4KN7C 3GV6A 5KRUA 2N55A 1DOLA 1LTID 1IW7D 2M9VA 1B50A 1C8CA 1KDBA 5LL6X 3HGBA 3HRZC 2F0SA 2WAQB 3SE0A 3RLFA 4U68A 4A3BB 1JE4A 1VDZA 4FF4A 4HTHA 3DM1A 2OT2A 4A3DB 1GOZA 3OMCA 3PMFA 1EY8A 5KYLA 1CA6A 2A68C 1PRTB 1TU2B 1JOOA 2HCIA 4Q5VA 1GJXA 3W3AA 2F0FA 2IT1A 3C1EA 1EQVA 1D2BA 1PTOB 5T1IA 2B2VA 2F0QA 1I4RA 1AP0A 1Y8NB 1H9MA 3SEBA 1WTQA 3IFTA 2BE5C 1I4PA 1ILQA 2SOBA 1F9SA 4KI0A 2JA7B 3SR1A 2B2TA 3DUZA 1WD0A 1NSNS 3NUCA 2B2TC 4JBWA 1SYEA 3MZ5A 3R3OA 3CHBD 3MFYA 1GUWA 5EJWA 3LNNA 3VYSA 3GTLB 3I70A 2K33A 3X3NA 1RDPD 3IL8A 2CHBD 4FF2A 1VF5C 3T51B 5KNBA 1MBYA 3VYRA 3K5MA 3I4NB 4NP5A 1WTPA 3NSWA 3SDZA 1GUOA 1SMYC 2EY2A 1GUNA 3V96A 2N88A 2C5CA 3KBGA 3T16A 1ZEQX 2GA4B 2JA8B 1H9SB 4WRDA 1Z7TA 3RD4A 1XYIA 1I4GA 4C1NK 3HOXB 5A2QL 1KNEA 4TSSA 1SEBD 2ZXRA 2ZXOA 1DCZA 5CBAE 4ZYSA 4XDXA 3HKZB 5HURA 2EJFC 4L8JA 3WDNA 3HOWB 5CYUA 3OWFA 1TKWB 4FXKC 1VMPA 3A7LA 3VYUA 2AQ2B 5T1GA 3KUPA 2HDMA 3OW7A 1PTOH 5C4JB 5BN4A 2K04A 5CV4A 4OIJA 2HQEA 1EWCA 1CK1A 2XWJB 1HRJA 4X3SA 3TMEA 1OXTA 2Q8IB 5DEHA 2IW3A 4MN3A 2IX1A 2BDNA 1B2TA 4V0BA 3P7JA 4KK7A 2K03A 2Q8TA 5FK9C 5EPKA 3PV0A 3D4DA 4LK1C 1ILPA 2SDFA 5C5LA 5JEAG 3Q6SA 2L0CA 4G7ZC 5FLXL 2EY1A 1BF4A 4L6TB 4CKBA 1DOMA 5CV5A 2ZT9C 4RCOA 4Q0FA 1KAAA 2HDLA 2KECA 5FO8B 1WTWA 4AYBB 1XXGA 5FKAC 3NBHA 3BVGA 1CM9A 1G8ZD 1C48A 1SYGA 1LV9A 3D4WA 3WOEA 1WTOA 2DNCA 1IYUA 1ONLA 2BA1A 3ONAB 2ICEC 3K5LA 1STHA 4EQPA 5E1FA 2F0IA 1TS2A 2EVBA 3URYA 4IUQA 4FF1A 1EYAA 3N6RA 1QG7A 2RSOA 1U4PA 1Q8IA 3G6JB 2NWGA 4IFDI 3BYTB 4ID6A 1SNQA 1CHPD 2WB1B 2PZWA 5M9OA 1QJOA 2EJGC 5BN5A 1HA6A 2PPBC 1V1PB 1C4QA 5M5YB 1ENFA 1QNKA 1B3AA 5KNCA 4C3JG 4ZLTF 1DJRD 1Z47A 1XTCD 2EYHA 4BY7B 2F0LA 1STYA 1FD7D 2B2YA 2R3ZA 4EVOA 1E2WA 1IW7C 2K5WA 1RODA 1D1IA 3ERQA 2NVYB 1E2VA 5J39A 1HTLD 5IGGA 2JE6I 3GD7A 3IFDA 3OIPA 5IIFA 4RKLA 2NVQB 3PO3B 1HHVA 1PFNA 2Z4IA 5D65A 3SHLA 1XX8A 4NKLA 1CT1D 5C4ZA 4RCNA 4EQOA 4CJ0B 3A7AB 3MVVA 1NR2A 3S9WA 1CFMA 2PMZB 3NK9A 1B53A 5C0XI 1I50B 3KLSX 4S3SA 5CV7A 1EU4A 1H9SA 3BS1A 1PXUA 5C3WA 3FKIB 4CKEA 3AB9A 4WFN3 2NBFA 1F77A 3HOZB 1SJED 4Y7NB 5IGDA 1AW7A 2K01A 4QUCA 2XRQD 2B63B 3GTOB 2FMMA 4K6DA 2ENBA 4XIGS 2B2UC 3GV3A 4PMBA 4CGYB 2CW0D 3UI2A 2F1MA 3I4MB 2KJXA 1TS3A 4KTAA 2M2LA 4BA1I 4IFDJ 3MC0B 1HXYD 1DOKA 4BY1B 3MXNA 1E2ZA 1V8QA 2DN8A 4G7OC 4C3JB 4NMZA 4K14A 2CQAA 3J7AV 3M3YB 3K5NA 3JAME 3DEPA 1IHZA 2O5IC 4KMUC 1O80A 3HOUB 3V05A 1SNCA 1A3TA 1OXUA 1CA5A 3K6OA 5CORA 2FMCA 5DAUA 5TSSA 3TZUA 2K28A 4H13C 3TP6A 5M5WB 1SNDA 1LO5D 4A3FB 4ME5A 1VMCA 1I4QA 5KNDA 2SNMA 4KY5A 2NVTB 3CQZB 2KCNA 4K5WA 4O1NA 1NAPA 5ELCA 3T13A 1F2YA 1TT2A 1HQMC 3GP7A 2PO4A 2AQ3B 1B1ZA 1FR3A 3DWQA 2BE5D 3TP5A 1LLRD 4RA8A 2LKVA 4ZK9B 4QMGA 1D1KA 1UUPA 1U9RA 2NN6I 2PNRC 3S2HB 3BDLA 1TQOA 2KHSA 3NTKA 1O7YA 4UDUC 1T5EA 1ZKOA 3JAML 1PZID 5ELEA 3J7AF 4KD3A 1I3QB 4G4KA 4DXFA 3S17B 3E6ZX 4GZYC 2NUCA 3BDCA 5EKLA 3MXUA 4H0LC 1KABA 4RWSC 1LTAD 1OO9B 1SMYD 2B8GA 4RHRA 3CRLC 1TIID 5I6YA 1GUGA 3VR6A 2EY6A 1TWHB 3SK8A 1RKNA 4ILWA 1BR9A 5I2XA 5D14A 5K36G 3QB3A 1JOQA 5EBDA 4XQQA 4KD4A 1YNJD 1BBXC 1DZ1A 3OWEB 3I90A 2F0EA 4DGZA 3RUZA 2VNUD 4R8IA 3QOLA 4PMWA 2ICIA 1A6XA 5K5PA 4FNFA 4IURA 2E74C 5C44B 1FNVA 1Z6HA 4KHZA 4A3EB 2IWHA 1LTRD 1F2MA 5J22A 2J0TD 1S5CD 5JVG3 1SFOB 3TP8A 3IKJA 3FEWX 2KCCA 1PFMA 2J7ZA 4X3UA 3GTGB 3HZXA 4CJ2C 4K2LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C48 A;  1DM0 B;  1C4Q A;  1D1K A;  1CQF A;  4ULL A;  2C5C A;  2XSC A;  1CZW A;  4M1U B;  4P2C B;  1D1I A;  1R4P B;  1BOS A;  2GA4 B;  1R4Q B;  1CZG A;  1QNU A;  2BOS A;  1QOH A;  3MXG A; 
#chains in the Genus database with same CATH topology
 2EZV A;  1SMX A;  2QEJ C;  4MIU A;  4HJ9 A;  1FYC A;  1SBB B;  2MFI A;  2R7F A;  3CCU A;  2VUM H;  5JJZ A;  2FHT A;  1WTH A;  3E5S A;  1HZB A;  3NBH B;  1PRT C;  1RTN A;  2E75 C;  2YTV A;  2A6H C;  3CCM A;  3F2U A;  1PZK D;  4A3J G;  1EY6 A;  1N36 Q;  2XN9 C;  4JI6 Q;  1C7Y A;  4X64 L;  1PLF A;  1K28 A;  2MPM A;  3L9A X;  2RCN A;  1XNQ Q;  1EYD A;  3NE5 B;  1TWG B;  3D8G A;  3O13 A;  5E4X A;  2EDG A;  5C0X J;  1ESR A;  1L0Y B;  4L63 B;  3PO2 H;  1PFB A;  3PUY A;  5C44 H;  4LFC Q;  3V2T A;  4NXN L;  4JV5 Q;  1X3F A;  1VQH A;  3I72 A;  3CP0 A;  2K5N A;  4IUN A;  1JIC A;  5JPN C;  3EBE A;  1PH4 A;  2TMP A;  4JI2 L;  3L0O A;  2AQ1 B;  1K3B C;  1R4Q B;  4DPG A;  2N3S A;  1VF7 A;  1LAB A;  1EYG A;  5G3L F;  1Q81 C;  2B2U A;  1BCP B;  1PTO F;  4PQX A;  1QNU A;  1J9O A;  2RVL A;  3NTH A;  5C3X A;  2ID0 A;  4HSP A;  1CQF A;  3QIA A;  3GTP B;  4X66 Q;  1LAC A;  1H9R A;  3A55 A;  3HOY B;  3TZD A;  3OPO A;  1BUV T;  2IX0 A;  1CZW A;  1JMC A;  4OON A;  4BS9 A;  1S5E D;  4C56 C;  1YNJ C;  4DUY L;  1WJJ A;  1LT3 D;  1IBK L;  4JI7 L;  1O7Z A;  3X3M A;  1HR0 L;  1IBL Q;  4LFA Q;  1CTM A;  3FMC A;  1C9O A;  1K0S A;  3M4Q A;  4K0K Q;  2HIV A;  1I4X A;  3H94 A;  3K0Y A;  5IOC A;  3FHW A;  2BCO A;  5M5X H;  3HOX G;  1MIU A;  2X69 A;  4JW0 A;  5C0X G;  3KF8 B;  4B3M L;  2V4D A;  3PO2 G;  3S2D B;  1G6Z A;  2DJF C;  4DK6 C;  2OTL A;  1M8A A;  1SYD A;  2XNA C;  1DON A;  3M7N A;  4HJ5 A;  2K6A A;  1WCM G;  3E3X A;  1PH1 A;  2IL8 A;  4XQJ A;  1SAP A;  1SYC A;  2HCC A;  2QDB A;  3S2H H;  5KGU A;  1N34 L;  3G71 A;  4JI4 L;  3MAQ A;  4CBV A;  2K75 A;  3AEV A;  3RLO A;  3QWN A;  1BO0 A;  2F0T A;  2CW0 C;  4ZKC B;  5CV9 A;  4DR3 Q;  2EYJ A;  4DAY A;  1GVP A;  1G6P A;  2F3I A;  4KKT A;  1WOC A;  2K4K A;  1HA5 A;  1ET9 A;  3EFX D;  4TKO B;  4GOP B;  4DA2 A;  5IP9 G;  1SNM A;  4GN5 A;  4C3H B;  1ENA A;  1PRT D;  5ISR A;  3CCJ A;  2CQO A;  1MI2 A;  3PQI A;  3RZD B;  1K8O A;  4IFD G;  2WII B;  2RCF A;  1KL9 A;  1MSG A;  1HFG A;  3HOV B;  1PTO D;  4OO1 H;  1OXS C;  1TY2 A;  1ZYR D;  1X54 A;  1X3P A;  3RNU A;  3S1R B;  1B9M A;  1YHQ A;  2R61 A;  1ENC A;  4IUP A;  2JA6 B;  5D3I B;  1EEI D;  1U4R A;  3NWT A;  5ELN A;  4B3T Q;  2LY7 A;  4C3I B;  4JK1 C;  1HNX Q;  1QB5 D;  1BCP F;  2FFK B;  1JB7 A;  5ELB A;  1VQ7 A;  4JI0 Q;  1DM0 B;  4ME3 A;  4B3R L;  4DR5 L;  1AH9 A;  4QL5 A;  4OGQ C;  3BVZ A;  3BU2 A;  4NDX A;  2MJ8 A;  2L9H A;  1AZQ A;  2Q2U A;  2CH4 W;  3RZO B;  2ASB A;  1PYB A;  5C3E G;  4DKA C;  2AUJ D;  3U4V A;  5JEA H;  5C4H A;  2NZ1 D;  2JEB I;  4KN4 C;  2KCM A;  2EYM A;  3RLN A;  1XMQ L;  4IUV A;  4PZ7 A;  4UY8 C;  1Y69 U;  4O42 A;  4HED A;  2I46 A;  1HQR D;  4NPS A;  1EIF A;  4GNX A;  4YCV A;  1A3U A;  5JPM C;  4XTC S;  1CSQ A;  3HOW H;  4DR1 Q;  3R8B A;  2RHS B;  2JA5 G;  5E7N A;  1G2T A;  3EVQ A;  4YIJ A;  1S3O A;  4JI3 Q;  1WCM B;  4HJ7 A;  2JA7 H;  1I6H B;  2R92 B;  2Z4H A;  5M3F B;  3TQY A;  4QCL A;  2KA7 A;  5IYC H;  2UUB L;  1F9P A;  2E2I B;  1S5B D;  1TXY A;  4O2D A;  4MZ9 A;  4CHT B;  1R9T H;  3P75 A;  2KHI A;  2F3V A;  3CMA A;  4NXM Q;  1MSH A;  1VQJ A;  5IP7 H;  1UAP A;  2YU9 H;  3NPP A;  2LS0 1;  4YHH L;  3S14 H;  3SK4 A;  1I4H A;  5JEA J;  1EOV A;  1L0X B;  3W1B A;  4C3H H;  3WOF A;  5LHY 1;  3KF6 A;  1AFP A;  1IZ6 A;  5AJ3 Q;  1Y14 B;  1SE2 A;  1SYB A;  3STB D;  1M1K C;  3ITP A;  1TWH H;  3I8Z A;  2A19 A;  3HOU H;  4BBS H;  2KVM A;  5L37 A;  4KHP L;  2KEE A;  4FYD A;  2O4X A;  1N33 L;  4H44 C;  1HFN A;  4GKK L;  1C0A A;  5KEE A;  1F9R A;  2PNH A;  4IQZ A;  2XVS A;  1J5E L;  2E8G A;  1SDF A;  2A1A A;  1NUC A;  3DMU A;  1RF2 D;  3VDY A;  1R4P B;  4RGO S;  2X6L A;  1TS4 A;  5BN3 A;  2RKS A;  4YY3 L;  2F0D A;  1IYV A;  2LMC B;  1UE7 A;  2JA9 A;  1EY7 A;  1Y1W B;  1Q3L A;  2CCZ A;  2QCP X;  3HOV H;  1NBW A;  1STB A;  3U9S A;  5IGF A;  3TP7 A;  3AFP A;  2QEX A;  4CJ1 B;  5FJ8 H;  5AFW A;  2F03 A;  2E2H B;  3GTQ B;  3FDT A;  2Q8R E;  1P16 A;  3NXW A;  5IT9 E;  1S4Z A;  3A56 A;  4DV0 L;  1QVF A;  4DAV A;  1VQG A;  2A68 D;  3NBI A;  2EYF A;  3OHX C;  3F2C A;  5GRO A;  3BYY B;  1EZ6 A;  3H6M A;  2F0N A;  3HEJ A;  1EU3 A;  3BZK A;  2D5D A;  3ZJY C;  1Y8O B;  1GHJ A;  4RKB A;  4UP8 A;  1O78 A;  1T5X D;  1TWC H;  3S1M B;  2EY5 A;  2ZTE A;  2F4V Q;  3J80 c;  1AEX A;  1Y1V G;  2OQK A;  3LWU A;  4XT3 B;  1CSP A;  3HOZ G;  1I50 H;  3PIP A;  3PIO 3;  5JAV A;  4LF9 Q;  1A2T A;  5IYB G;  1ICF B;  2IPK D;  3HP3 A;  1PH2 A;  1D5M C;  5FOB B;  4A3D H;  4DV6 Q;  2PW7 A;  2Z6K A;  3S1N B;  2KUM A;  2E2D C;  1QVC A;  4BBR H;  2XWB B;  4DF7 A;  4LJZ C;  1GUS A;  1RTO A;  1UEA B;  3GTM H;  2L1B A;  1M4V A;  2F0W A;  2FXQ A;  3H09 A;  3I7F A;  4A3I H;  4L5R C;  4X65 Q;  4M8A A;  2A8V A;  1VQE A;  3HFZ B;  1VCI A;  4ZRZ A;  1SJH D;  1WTV A;  1NR4 A;  1IKM A;  4JC0 A;  1H9J A;  2QIL A;  1SE4 A;  4GLA C;  1CI3 M;  2AWO A;  3GTJ H;  3BDO A;  4IPH A;  1HTP A;  2PQE A;  1SXT A;  1K83 B;  3P20 A;  2XGT A;  3CQZ H;  2AKW B;  4DK1 A;  4A3L H;  4B9W A;  2NYZ D;  2FIN B;  4UP7 A;  4HCS A;  2OQ0 A;  3EN2 A;  1M90 C;  1H9K A;  2VXW A;  1D5Z C;  4I7A A;  2ZTC A;  4KKS A;  1NY4 A;  4G7H C;  3S15 B;  2DNE A;  1WTR A;  1VQP A;  1B4O A;  3P1H A;  2H4O A;  2MP1 A;  2VB2 X;  2QF7 A;  4HJA A;  4MNO A;  5C0X H;  2RDG A;  2YYZ A;  4PMC A;  3T1H L;  1PYS B;  2VQF L;  5IYD H;  4XYQ A;  1JWM D;  4OL7 A;  4N8F A;  3VA5 A;  1DXM A;  4L5S A;  5EKK A;  5IWA Q;  4ZQ3 A;  4DU9 A;  5JVH 3;  5D3D A;  4IUT A;  1HJP A;  2B2Y C;  2EYP A;  1VQO A;  3I73 A;  3A8I E;  3MXP A;  3RZO H;  3D4R A;  4OWW B;  5IGE A;  4HCE A;  1EY4 A;  3TS2 A;  2R93 B;  2A73 B;  2F0K A;  1I94 Q;  3J7A 5;  3TSS A;  4RH6 A;  3G7L A;  2BDO A;  4RHS A;  4ALP A;  4AYB G;  3M4O B;  4PZ6 A;  3SXH A;  1Q86 C;  3J7Z C;  2OTJ A;  1EFW A;  4GKJ L;  1J8I A;  3C2P A;  3MFG A;  2HHH Q;  2R7Z B;  1JR0 D;  2ZJR A;  4MHE A;  2BH2 A;  4A3L G;  5C44 G;  2K5H A;  3L2P A;  1SNO A;  1Q8K A;  2EYO A;  2MO0 A;  3TDQ A;  3TS0 A;  2SNS A;  2F0V A;  1KC8 C;  5IOD A;  1SRU A;  1LT4 D;  1YNN C;  2YTX A;  1UEB A;  2JA6 H;  1N32 L;  4FF3 A;  1U4L A;  2K52 A;  2NB0 A;  4DR6 L;  3AU7 A;  4ZUI A;  3KF8 A;  4A3J H;  5I6W A;  5A2Q E;  1HNZ Q;  3IAY A;  2XTI A;  1PTO C;  4A3M G;  1LT6 D;  1TS5 A;  1KLU D;  2H1E A;  3ND9 A;  1ZYR C;  1XTD A;  4JPB W;  4YWM A;  5I2Y A;  1Y1W H;  4DR6 Q;  2NTT A;  4JG2 A;  2Z8L A;  2KOL A;  3HKZ E;  5NUC A;  3T53 B;  3ND8 A;  4A3F G;  2FJ2 A;  1N32 Q;  3C46 A;  2JXM B;  3R2I A;  4K8I A;  4R8N A;  2JN4 A;  3KYH C;  4R9W A;  2Q2T A;  3M7G A;  1B8A A;  5KIX A;  1I6V C;  5GAH C;  1Q1E A;  1SYF A;  1K0R A;  4P2C B;  4GNX C;  1GXD C;  1QUQ A;  3DM3 A;  1Y1V H;  2EOT A;  4F7X A;  2I0Q A;  4A3B H;  1ICW A;  3SGI A;  4TRD A;  1V1O A;  2HHH L;  1JC7 A;  1K3R A;  5EPL A;  4ZKB B;  3S16 B;  3S2D H;  1SE8 A;  3MA2 B;  2NVT H;  4OIK A;  1NMG A;  3G6E A;  3J81 L;  4LF8 L;  1B3Q A;  2C9O A;  2L55 A;  3GDE A;  1WVL A;  1JWU D;  4HIM A;  1II3 A;  2MUY A;  3U9O A;  3BVM A;  1F2L A;  4QUF A;  1E3P A;  5CV6 A;  4I7Z C;  4IPC A;  4A93 G;  1TVX A;  1X32 A;  4AQY Q;  3T56 B;  5FLM G;  2YTY A;  5K36 H;  2KBN A;  5IWA L;  4LW1 A;  1TWF B;  1YJ9 A;  3S16 H;  1GUT A;  3QG1 A;  3VR4 A;  1JOR A;  1U0L A;  2G5D A;  2VQF Q;  4IJH A;  3T1H Q;  1F9Q A;  2K05 A;  4ZAI A;  2R6G A;  4N9T A;  3HOY H;  4ZCK A;  3Q24 A;  5G3L D;  2EXD A;  3DHQ A;  3F8T A;  3VR3 A;  1R9T B;  3U4Z A;  4AYB E;  2YV5 A;  2L11 A;  2E2J H;  1AN8 A;  1QE6 A;  1KQS A;  3K59 A;  3MWY W;  4B08 A;  2L12 A;  3L7Z C;  1X56 A;  3I91 A;  1ML0 D;  4RG1 A;  1QZH A;  4IPD A;  2DGY A;  1BBU A;  3STB C;  1MGS A;  1PH3 A;  2R7Z H;  4A3J B;  4IJL A;  2EYL A;  2Z1C A;  1FGU A;  2PQA A;  1EQR A;  4C3I H;  3KFU A;  5IP7 G;  4IO9 A;  2VUM B;  1QVG A;  4HIK A;  1FNU A;  3F2D A;  1CHQ D;  5GAG C;  4LF7 Q;  2WIN B;  1LTT D;  5E3F A;  2VS1 A;  5IYC G;  3CW2 C;  5C4X B;  1FGB D;  3S1Q B;  4JYA L;  3OIQ A;  4DV6 L;  1BOS A;  4ABN A;  2G9D A;  1SNP A;  1LTB D;  1JJG A;  4C2M B;  2F0G A;  3D0F A;  1MD2 D;  4J8Q A;  5HGT A;  3HOV G;  2K7V A;  3FKI H;  4DN4 M;  2F0U A;  1JB3 A;  3ZYY X;  1RIP A;  1CKN A;  3PUZ A;  2Z6K C;  1A3V A;  1RJT A;  3HG9 A;  3KDF A;  2X6G A;  1STE A;  2I5L X;  3HS0 C;  4DK0 A;  3EJI A;  2H5X A;  2F4V L;  1LT5 D;  2EQS A;  2K1B A;  1EOT A;  1VQB A;  3HOY G;  2EJM A;  3QOJ A;  1JWS D;  2D62 A;  2WV6 D;  4C3I G;  1DD2 A;  1V43 A;  1EY9 A;  2RBM A;  1KLG D;  2ALY B;  4JOI A;  4KY7 A;  4LAA A;  3C3L A;  1CKO A;  4JOI C;  4KKU A;  1PMR A;  1BCP C;  4DV0 Q;  1S5D D;  2UUA L;  1TWA H;  2A6E C;  5IY0 A;  1E1O A;  4A93 B;  2N8N A;  3TRE A;  1O7I A;  2A74 C;  3K0X A;  1JQY D;  4BWG B;  3A54 A;  4F88 A;  4X62 Q;  3UDG A;  4OWX B;  3J81 E;  5DNF A;  3KLR A;  4IN3 A;  2B2V C;  3J80 L;  4FDB A;  1STG A;  2M00 A;  1IKL A;  5A35 A;  1SE3 A;  3M4O H;  1PVO A;  3K80 C;  3GTJ B;  4HMJ A;  1K8A C;  3BZD B;  4IFD H;  2HT1 A;  1EEF D;  1N33 Q;  1V1Q A;  4HMI A;  2K5D A;  5DM6 3;  4DR7 L;  1IL2 A;  2F52 A;  4RGM A;  1I3Q H;  5JOB A;  1L1O B;  4A93 H;  2Z6B A;  1IXR A;  2MO1 A;  2N78 A;  2IHF A;  4CKC A;  4J6H A;  1GM5 A;  2IHE A;  5C3E H;  4JI8 L;  3J81 c;  4A3M H;  1EWI A;  3Q23 A;  4QGU A;  1KTK A;  2RQX A;  3R93 A;  3S14 B;  1MJE A;  3GTP H;  3F1Z A;  1Q12 A;  2IJ0 A;  4NXM L;  1EY0 A;  1L2F A;  1NCV A;  2JA6 G;  3PO2 B;  2F0O A;  1RD9 D;  2VQE Q;  2NN6 G;  3MTS A;  4HID A;  2UUB Q;  4DUZ Q;  4LUZ A;  1E22 A;  3A8J E;  2PW5 A;  1CZG A;  2VB3 X;  2IX3 A;  3VR5 A;  1EZ8 A;  4IUU A;  4JI3 L;  4QQB X;  3JAM i;  2A69 C;  2NTS A;  4N9P A;  5IT9 c;  4EQN A;  4DUZ L;  1ESF A;  1NTG A;  2VQE L;  3CCE A;  1VQF A;  3RN2 A;  1PDQ A;  4K8J A;  2PCF B;  3D3R A;  4P73 A;  4OO1 G;  4KY6 A;  4YWK A;  1TWF H;  1XMQ Q;  1W6J A;  4JI8 Q;  3DXJ C;  2EXZ A;  4UHV A;  2F0H A;  1QOH A;  4EGV A;  1K83 H;  3GO5 A;  3HKZ G;  1MJC A;  1EQQ A;  1UNS A;  4HAE A;  4K6L A;  2AHO B;  4K5V A;  2F0J A;  4DR7 Q;  5EBC A;  1L1O A;  1BCP D;  2GVA A;  1T9H A;  4MTN A;  3LGJ A;  2WP8 J;  3Q0A A;  2D0P A;  3CCS A;  2PZU A;  1QIL A;  2R92 G;  3H0G G;  3H3V I;  4B3T L;  3QJY A;  1VQ5 A;  3TN2 A;  4GOP A;  1BDO A;  3W2D A;  3GTK B;  2D9U A;  3KK7 A;  5CV8 A;  1TY0 A;  2YU9 B;  3NEM A;  2CVR A;  2NN6 H;  3TEH B;  4HN7 A;  3CD6 A;  4X62 L;  5CC4 A;  5EKI A;  1Q7Y C;  1XJV A;  4U67 3;  5FLX E;  3EIV A;  1YIJ A;  1O7L A;  3G48 A;  3RZD H;  3A5U A;  4E6I A;  5FO9 B;  2F3W A;  3K81 C;  3BG3 A;  1PRT F;  2P5Z X;  4QIW B;  3UE1 A;  2UUA Q;  1I6H H;  3K7A B;  1D6E C;  4FO2 A;  1VQM A;  4FXD A;  2MNA A;  3MXG A;  4QB4 A;  5EQ0 A;  3S24 A;  1LM0 A;  3J81 i;  1TWC B;  1YJW A;  3MEH A;  3E9I A;  3H0G B;  1Q90 A;  1KRS A;  4DR3 L;  1PZJ D;  1JT8 A;  1PYW D;  3DWA A;  3A8K E;  1WYD A;  4A3I G;  2I5M X;  2EE1 A;  2JYO A;  5M5Y H;  4IOA A;  1QCB D;  5C3E B;  1KDA A;  1WTX A;  2D2C C;  1YNX A;  3J80 E;  2JA5 B;  1LUZ A;  3CME A;  3PSI A;  3OOC A;  3K7A H;  2BOS A;  2WB1 E;  4XT1 B;  2IY5 B;  3H91 A;  2WKD A;  2J4X A;  1LYL A;  2XIW A;  3JAM c;  1KRT A;  3SK6 A;  3MEF A;  4R4T A;  2TSS A;  4X3K A;  4B3M Q;  4I65 A;  2B2W A;  2A69 D;  3K58 A;  1W6K A;  4JYA Q;  1XWE A;  3OYY A;  4F8M A;  4PG3 A;  4LMQ D;  4XYO A;  2LSS A;  3FPP A;  3K7U C;  4PV1 C;  3Q22 A;  2E76 C;  1N9W A;  5M3F G;  1IBL L;  1HR0 Q;  4LF7 L;  4LUV A;  4JI7 Q;  1X3Q A;  3OMG A;  5KYI A;  2QKI C;  1QUQ B;  1B9N A;  1HUM A;  3VA7 A;  4WOR A;  1HPC A;  3TRZ A;  4UPA A;  3UDX A;  2XSC A;  4M1U B;  3I3C A;  1G51 A;  1Y1V B;  4L5Q A;  1K9M C;  5EGT A;  1YNN D;  1K8M A;  1RHP A;  5I9O A;  4HIO A;  3CRK C;  1D5X C;  2A6H D;  1OXX K;  5IT9 L;  3DLL A;  5IGC A;  4KLK A;  2LXK A;  3DWP A;  4JI2 Q;  3AMU A;  3TBI B;  2JA8 H;  4JV5 L;  3NQI A;  4BXX H;  4NXN Q;  4H7B A;  2MHV A;  2OEO A;  5E4W C;  4LFC L;  2ZXP A;  4P74 A;  3DEO A;  3VR2 A;  4ULL A;  4KV6 A;  4EX5 A;  5JJL A;  4LNQ A;  4HR7 B;  4V19 0;  1XNQ L;  3ULP A;  3MXN B;  1JOK A;  5F2D A;  1NMF A;  1F2Z A;  5CGK A;  1Q82 C;  2HUG A;  1U4M A;  3QO2 A;  1A15 A;  1G91 A;  4G57 A;  5COY A;  4A3C H;  1JE5 A;  5M3M H;  4AQY L;  1ET6 A;  2AWN A;  3J81 j;  4FXG C;  3J7Y W;  3G4S A;  2RDF A;  4C3H G;  4A75 A;  4QF4 A;  4BA2 I;  4A3G G;  4DNT B;  5CMD A;  4A3I B;  1KNA A;  1EL0 A;  2R7D A;  1PH9 A;  4PNY A;  4XQN A;  4A3M B;  3I4L A;  1VQN A;  1SFO H;  5ELD A;  4BY7 G;  4LF8 Q;  1KAW A;  1S5F D;  4TQU S;  1IL8 A;  4J1M A;  4KHV A;  2AMC B;  2WAQ E;  2QGQ A;  1DYQ A;  4UAI A;  5M5X B;  3E0J A;  4LF4 Q;  1AZP A;  2CFM A;  2RDH A;  4WJW A;  4DV2 L;  1H95 A;  4DAP A;  2JA5 H;  1V1P A;  1QWY A;  4DV5 Q;  4A3E G;  2B8F A;  3OSO A;  4DFA A;  3HOU G;  1JJ2 A;  4XXE A;  4RAU C;  1FNW A;  1PH5 A;  5GQO A;  3E0E A;  2QA4 A;  1HUN A;  2PZT A;  4A3G B;  2K5Q A;  1FJG L;  5LL6 S;  2A6E D;  2DY8 A;  5C6A A;  2VW9 A;  1STN A;  1CQV A;  5HGQ A;  1HNZ L;  3CCL A;  5IGB A;  4LWC A;  3CKI B;  3D31 A;  4A3C G;  2KQ3 A;  3KDF B;  3R2T A;  3S15 H;  1HZC A;  4B3S L;  4DXG A;  3CCR A;  3FPU B;  1BXT A;  3CU7 A;  2NVX B;  2R7Z G;  2B63 G;  4R4C A;  2JP1 A;  4X3T A;  1JCK B;  1E24 A;  1KDC A;  3NP8 A;  3D6W A;  5J3B A;  1Y8P B;  3KLS A;  4GN3 B;  3RMH A;  2DUD A;  4LFB L;  4RFB A;  1EIH A;  1BNZ A;  1EFI D;  3EQL C;  4KJO A;  4BBS B;  3S1Q H;  1GO3 E;  1Q1B A;  4GKJ Q;  5FO7 B;  4X6A H;  3PUX A;  4FP5 D;  4FVM A;  1A0I A;  1LTG D;  4RGT A;  4GNX B;  3CPW A;  2Q2H A;  3LWE A;  4GS3 A;  1RCV D;  3PUV A;  5EPJ A;  2ZJP A;  4OO1 I;  4OHJ A;  3S17 H;  4DNR B;  2O5J C;  2QDL A;  2F4I A;  2K32 A;  4R1J A;  1I94 L;  3M9B A;  3C1F A;  3QR8 A;  4HSV A;  3I56 A;  3PUW A;  3D6C A;  2R93 G;  2KCT A;  5FLM H;  2NVX H;  1G2S A;  4NW2 A;  4LF6 Q;  3LX0 A;  4GOP C;  1XPO A;  4QJF A;  3PGZ A;  5M3F H;  1IYJ B;  5I4D A;  2JSO A;  5M3M B;  4ZUJ A;  2BH8 A;  1HCZ A;  1EY5 A;  1B44 D;  2F0P A;  2E2J B;  3NTI A;  3L3O C;  1W2B A;  3S1M H;  2BA0 A;  2OXP A;  3VYT A;  2VY3 A;  1SRO A;  2DY7 A;  4JBM A;  1EIG A;  3FRP B;  4JVZ A;  4C1N I;  3GTQ H;  3K57 A;  1GHK A;  3GQB A;  3M4Y A;  5C5M A;  3SK5 A;  4B9X A;  3KBX A;  4PZ8 A;  4TVA B;  2RSN A;  4A3B G;  4A4I A;  4Z9C B;  3HOX H;  1STA A;  5C4X H;  1LTS D;  1A2U A;  5LMU L;  3CXC A;  5IP9 H;  2LFN A;  2HIX A;  1SSO A;  4P75 A;  3GTM B;  1A62 A;  2Y0S B;  2VZA A;  4BBR B;  2PYK A;  5J1Z A;  4RGN A;  3SVM A;  4X65 L;  1A63 A;  2XRS D;  5CBE E;  2OF1 A;  2WKC A;  1X3E A;  5CR3 A;  2L5T A;  1E0B A;  2EPB A;  3H3V C;  1OXV A;  3FVQ A;  2RA4 A;  3MHB A;  3M85 A;  2A5H A;  4LF5 Q;  5DM7 3;  1EYC A;  2F0M A;  2NZH A;  3CCV A;  3NHH A;  4KJN A;  2B2W C;  4BY1 H;  4K2K A;  1PFS A;  4LF9 L;  1GD7 A;  3UE0 A;  1EQT A;  2AUK A;  1IBM Q;  1TWA B;  3H15 A;  1KIX A;  3NWS A;  2MGS A;  1G29 1;  4ODG A;  3PO3 H;  3GTL H;  3T4A C;  4IAL A;  1EWH A;  3N52 A;  3CF5 A;  2R92 H;  1PV4 A;  1BQQ T;  4IZ8 A;  2KHJ A;  3K5O A;  1NJI C;  4F87 A;  5ELO A;  2L4N A;  1L0W A;  2O2L D;  4YCU A;  2JEA I;  1S72 A;  3NQT A;  3EA6 A;  3PIP 3;  2WAC A;  1GKH A;  2UU9 L;  2G9H D;  3A0J A;  1TR5 A;  4K5X A;  5GAD C;  5I9P A;  4A3K B;  3E9H A;  2B39 A;  2SEB D;  1MHW C;  3CPF A;  1YIT A;  2I07 B;  5ELF A;  1HZA A;  3M4P A;  1X55 A;  1WD1 A;  1ZXT A;  3ERO A;  2KED A;  4KN7 C;  3GV6 A;  5KRU A;  2N55 A;  1DOL A;  1LTI D;  2KEN A;  4DR2 L;  1IW7 D;  2M9V A;  1B50 A;  1C8C A;  1KDB A;  5LL6 X;  3HGB A;  1N8R C;  3HRZ C;  4YY3 Q;  2F0S A;  2WAQ B;  3SE0 A;  3RLF A;  2UXC L;  1U5K A;  1HR0 W;  3PF5 A;  1XPR A;  4U68 A;  4A3B B;  1JE4 A;  3M3Y H;  1VDZ A;  4FF4 A;  4DR4 L;  1J5E Q;  4HTH A;  3DM1 A;  2OT2 A;  4A3D B;  1UE6 A;  4GKK Q;  1XNR Q;  1GOZ A;  4POF A;  3OMC A;  3PMF A;  1EY8 A;  5KYL A;  1PH6 A;  1PHJ A;  4DV1 L;  1CA6 A;  4KHP Q;  2A68 C;  1PRT B;  5FLX c;  1D7Q A;  1TU2 B;  3NEL A;  1UE1 A;  1JOO A;  1YHA A;  4CDE C;  1WFQ A;  2HCI A;  5AJ3 L;  2Y0S G;  4Q5V A;  2VUM G;  1GJX A;  3W3A A;  5GAE C;  3T1Y L;  2F0F A;  2IT1 A;  1FVI A;  3C1E A;  1VS0 A;  4YHH Q;  1BVS A;  1EQV A;  4JI1 L;  1VQ9 A;  1D2B A;  1PTO B;  5T1I A;  2B2V A;  4WJ4 A;  2F0Q A;  2E5L Q;  1I4R A;  1AP0 A;  3ULL A;  1Y8N B;  3OTO L;  4BBR G;  1H9M A;  2PQA B;  3SEB A;  1WTQ A;  3W1G A;  3I4N G;  1VQI A;  3ERS X;  4A3D G;  1YBY A;  2E2I H;  3ER0 A;  3IFT A;  5IYB H;  2Z9H A;  2BE5 C;  1D8L A;  1I4P A;  2CWA A;  2ES2 A;  1ILQ A;  2SOB A;  1XPU A;  4DR1 L;  1P8L A;  1F9S A;  4KI0 A;  2JA7 B;  2Y0S E;  4OX9 Q;  4JI5 Q;  3SR1 A;  2B2T A;  3DUZ A;  1WD0 A;  1NSN S;  3NUC A;  2B2T C;  4JBW A;  1SYE A;  4QIW E;  3MZ5 A;  3R3O A;  3CHB D;  3MFY A;  1GUW A;  5EJW A;  3LNN A;  1YEZ A;  3VYS A;  3GTL B;  3I70 A;  2K33 A;  4A3K G;  3X3N A;  1CKN B;  1RDP D;  3IL8 A;  3CC7 A;  3I4O A;  2CHB D;  2RHQ B;  3PCO B;  2CH4 A;  1PA6 A;  4FF2 A;  1VF5 C;  3T51 B;  4JCV E;  2N49 A;  3K8A A;  4R4I A;  5KNB A;  1MBY A;  4DR5 Q;  4B3R Q;  3VYR A;  1SR3 A;  2VL6 A;  3K5M A;  4JI0 L;  3GTG H;  3I4N B;  1PH8 A;  4NP5 A;  1WTP A;  3NSW A;  3SDZ A;  1HNX L;  1GUO A;  2Z0S A;  2V1C C;  1X9N A;  1VQK A;  3W5O A;  4MTK A;  1SMY C;  2EY2 A;  2NVY H;  1GUN A;  3V96 A;  1UE5 A;  2N88 A;  2JA7 G;  5FJ8 G;  1HNW Q;  2C5C A;  3KBG A;  4QY7 A;  3T16 A;  2PMZ E;  1ZEQ X;  2GA4 B;  1PH7 A;  1H9S B;  2JA8 B;  3A5Z B;  4WRD A;  1Z7T A;  3RD4 A;  1OTC A;  1XYI A;  1I4G A;  4C1N K;  1SLJ A;  5A2Q L;  3HOX B;  1KNE A;  2WAQ G;  1SEB D;  4TSS A;  2ZXR A;  2ZXO A;  1DCZ A;  3BJU A;  5CBA E;  4O0A A;  3AQQ A;  4ZYS A;  4XDX A;  3HKZ B;  5IE8 A;  5HUR A;  3AFQ A;  2EJF C;  4DAM A;  4L8J A;  3J80 i;  3WDN A;  5HY6 A;  3HOW B;  2B29 A;  5CYU A;  3CC2 A;  3OWF A;  1TKW B;  4FXK C;  1VMP A;  2PI2 A;  3A7L A;  1L1O C;  4N8X 1;  4P71 A;  3VYU A;  2AQ2 B;  1BBW A;  5T1G A;  4EQ5 A;  3KUP A;  2HDM A;  3OW7 A;  1PTO H;  1YHB A;  5C4J B;  4Y7N H;  5BN4 A;  2K04 A;  4JI4 Q;  5CV4 A;  4OIJ A;  2HQL A;  4IOC A;  1N34 Q;  2HQE A;  1EWC A;  1CK1 A;  2XWJ B;  3RR5 A;  1HRJ A;  2GN5 A;  4X3S A;  3TME A;  1OXT A;  2Q8I B;  5DEH A;  4POG A;  2IW3 A;  4MN3 A;  1BKB A;  2IX1 A;  2BDN A;  1B2T A;  4V0B A;  3P7J A;  4KK7 A;  2WB1 G;  2K03 A;  3KLW A;  3WWV A;  3OW2 A;  3HOW G;  4K0K L;  3ICE A;  2Q8T A;  5FK9 C;  3KF6 B;  5C4J H;  5EPK A;  3GTK H;  3PV0 A;  4LFA L;  3D4D A;  4LK1 C;  4DUY Q;  1IBK Q;  2ATW A;  1ILP A;  1WI5 A;  1X3G A;  1YJN A;  2SDF A;  1VQ4 A;  2JQO A;  1K8G A;  4X66 L;  2D0O A;  5C5L A;  5JEA G;  4DAY B;  3Q6S A;  2L0C A;  4G7Z C;  4R4O A;  5FLX L;  1S40 A;  4DNI A;  2EY1 A;  1BF4 A;  4L6T B;  2JJQ A;  4CKB A;  1DOM A;  2CWP A;  5CV5 A;  2ZT9 C;  4A3K H;  1WCM H;  4RCO A;  4Q0F A;  1KAA A;  2HDL A;  2KEC A;  5FO8 B;  2K5V A;  1WTW A;  1TWG H;  2HD3 A;  4AYB B;  1VQA A;  3F2B A;  1XXG A;  5FKA C;  3NBH A;  2DJG C;  3BVG A;  1CM9 A;  1G8Z D;  1C48 A;  4X64 Q;  2RF4 A;  1SYG A;  1QZG A;  1HNW L;  1J6Q A;  2K14 A;  4JI6 L;  1LV9 A;  1N36 L;  4UP9 A;  5M5W H;  3B6Y A;  3D4W A;  1Y1W G;  3WOE A;  1WTO A;  2DNC A;  1IYU A;  1ONL A;  4C2M H;  2BA1 A;  3S1N H;  2Q2I A;  3ONA B;  2ICE C;  3K5L A;  1STH A;  4EQP A;  5E1F A;  2F0I A;  1TS2 A;  2JK8 A;  2EVB A;  3JC6 6;  3URY A;  4IUQ A;  1Z9F A;  4FF1 A;  1EYA A;  3N6R A;  1QG7 A;  3KJO A;  2RSO A;  1U4P A;  2B3G A;  1Q8I A;  4C3J H;  4DV4 Q;  1XMO L;  3G6J B;  2NWG A;  4NB3 A;  4IFD I;  3BYT B;  4ID6 A;  3I4M H;  1SNQ A;  3PO3 G;  4JI5 L;  4OX9 L;  1CHP D;  2K50 A;  4Y52 H;  2WB1 B;  2PZW A;  3I55 A;  1ASZ A;  5M9O A;  1QJO A;  2EJG C;  5BN5 A;  1HA6 A;  2PPB C;  2ZM6 Q;  1YVC A;  1V1P B;  1C4Q A;  5M5Y B;  1ENF A;  1UWV A;  1QNK A;  2GVB A;  1HH2 P;  1B3A A;  2UXD Q;  3OTO Q;  3IRB A;  5KNC A;  3H0G H;  4OEM B;  4C3J G;  2E5L L;  4OEL B;  4ZLT F;  1DJR D;  1Z47 A;  1XTC D;  2EYH A;  3I2Z A;  4BY7 B;  2F0L A;  1STY A;  1FD7 D;  2B2Y A;  2R3Z A;  4EVO A;  1CUK A;  1E2W A;  1IW7 C;  2K5W A;  4JI1 Q;  1ASY A;  3GTO H;  2UXB Q;  1KXL A;  1ROD A;  1D1I A;  3T1Y Q;  3ERQ A;  2NVY B;  1E2V A;  1HTL D;  2JE6 I;  3IFD A;  3GD7 A;  5IGG A;  3OIP A;  5IIF A;  5J39 A;  5BR8 L;  4RKL A;  5IYD G;  1VQ6 A;  2NVQ B;  3PO3 B;  1HHV A;  1PFN A;  2Z4I A;  1JJC B;  5D65 A;  4DV1 Q;  3SHL A;  1EIY B;  1XX8 A;  4NKL A;  1CT1 D;  5C4Z A;  1XNR L;  4RCN A;  4EQO A;  4CJ0 B;  2UUC L;  3A7A B;  4DR4 Q;  3MVV A;  1NR2 A;  3S9W A;  1CFM A;  2PMZ B;  3NK9 A;  3I4M G;  1B53 A;  1YI2 A;  2PI2 E;  5C0X I;  2UXC Q;  1I50 B;  3KLS X;  4R4Q A;  4S3S A;  2OWO A;  3Q8D A;  5CV7 A;  1EU4 A;  1H9S A;  3BS1 A;  5LMN Q;  1PXU A;  5C3W A;  3FKI B;  4DR2 Q;  1HZ9 A;  4CKE A;  1FL0 A;  3AB9 A;  4BY1 G;  4WFN 3;  2NBF A;  1VQ8 A;  1F77 A;  3AYH B;  3U50 C;  3HOZ B;  1SJE D;  2LXJ A;  4Y7N B;  5IGD A;  2R93 H;  1AW7 A;  2K01 A;  4QUC A;  2XRQ D;  3KOJ A;  2B63 B;  3GTO B;  5H1S E;  4DV7 Q;  1AE3 A;  2FMM A;  4J15 A;  4K6D A;  2C35 B;  2ENB A;  4XIG S;  2B2U C;  3GV3 A;  2UU9 Q;  4PMB A;  4CGY B;  2CW0 D;  4YCW A;  3UI2 A;  4IPG A;  2F1M A;  3I4M B;  2CKZ B;  2KJX A;  3A74 A;  1TS3 A;  4DV3 Q;  3HOZ H;  5C4X G;  2OCE A;  4KTA A;  2M2L A;  1SN8 A;  3PF4 A;  1X6O A;  4BA1 I;  3NEN A;  4IFD J;  3MC0 B;  1HXY D;  1DOK A;  4BY1 B;  3MXN A;  1E2Z A;  4CDF C;  1IBM L;  1KD1 C;  2B63 H;  1V8Q A;  2DN8 A;  5EAY A;  4G7O C;  1NNX A;  4C3J B;  4NMZ A;  4K14 A;  4JBJ A;  2CQA A;  3J7A V;  4LF5 L;  3M3Y B;  3K5N A;  3JAM E;  3DEP A;  1Q46 A;  1IHZ A;  3BZC A;  4P72 A;  2O5I C;  1B7Y B;  4KMU C;  1O80 A;  3HOU B;  1SNC A;  1A3T A;  1OXU A;  5DLQ E;  3V05 A;  1CA5 A;  2WFW A;  4JBK A;  3K6O A;  4OWT B;  5COR A;  2FMC A;  3KJP A;  5DAU A;  5TSS A;  3TZU A;  3U58 A;  2K28 A;  1A8V A;  4H13 C;  3TP6 A;  3S1R H;  5M5W B;  1SND A;  1LO5 D;  4A3E H;  5LMU Q;  1VQD A;  4H02 A;  4HJ8 A;  4A3F B;  4ME5 A;  1VMC A;  1I4Q A;  4WJ3 M;  5KND A;  2SNM A;  1W3S A;  4KY5 A;  1YZ6 A;  2NVT B;  3CQZ B;  1AE2 A;  2KCN A;  4K5W A;  4YWL A;  4O1N A;  2I5H A;  1NAP A;  5ELC A;  1B70 B;  3CCQ A;  4DV3 L;  3UDI A;  3T13 A;  5JJK A;  3FKI G;  1F2Y A;  1TT2 A;  1HQM C;  3GP7 A;  1V9P A;  4BBS G;  4LUO A;  2PO4 A;  2AQ3 B;  1B1Z A;  2ZTD A;  4AH6 A;  1DGS A;  1FR3 A;  3UDF A;  1CKM A;  4GN4 B;  3DWQ A;  2BE5 D;  1EUJ A;  1NE3 A;  3H3V H;  1RL2 A;  3TP5 A;  1LLR D;  1E1T A;  4DV7 L;  4LF6 L;  4RA8 A;  5M3M G;  2LKV A;  4ZK9 B;  4QMG A;  3RN5 A;  1D1K A;  3FP9 A;  1UUP A;  4AIM A;  1U9R A;  2NN6 I;  2PNR C;  4CDD C;  3S2H B;  3BDL A;  1TQO A;  5LMN L;  2KHS A;  3CAM A;  5JJI A;  3NTK A;  1O7Y A;  4UDU C;  1T5E A;  1ZKO A;  3JAM L;  3PIO A;  1PZI D;  5ELE A;  5LMN W;  3J7A F;  4KD3 A;  4BXX G;  1I3Q B;  4G4K A;  4DXF A;  3S17 B;  3E6Z X;  1K73 C;  2UUC Q;  2NUC A;  3BDC A;  4GZY C;  5EKL A;  2NZO A;  3MXU A;  4LFB Q;  4H0L C;  3ULJ A;  1KAB A;  1MKH A;  4RWS C;  1LTA D;  1OO9 B;  1SMY D;  2B8G A;  4RHR A;  3CRL C;  1TII D;  2QW7 A;  5I6Y A;  1VQL A;  1GUG A;  3VR6 A;  4GLV B;  2EY6 A;  5BR8 Q;  1TWH B;  2ZJQ A;  4CDC C;  3SK8 A;  4BY7 H;  1RKN A;  4B3S Q;  4ILW A;  4APV A;  1BR9 A;  2NVQ H;  3HKS A;  5I2X A;  4RMF A;  5D14 A;  2UXB L;  5K36 G;  3QB3 A;  1JOQ A;  5EBD A;  4XQQ A;  4KD4 A;  2L15 A;  4A76 A;  4A3G H;  1YNJ D;  1BBX C;  3CC4 A;  1DZ1 A;  3OWE B;  1LTL A;  3I90 A;  2F0E A;  4DGZ A;  1FJG Q;  3RUZ A;  2VNU D;  4R8I A;  3QOL A;  4PMW A;  2ICI A;  2UXD L;  1A6X A;  5K5P A;  1VQC A;  4FNF A;  2MQH A;  1X65 A;  4IUR A;  2E74 C;  2ZM6 L;  4DV5 L;  5C44 B;  4GLX A;  1FNV A;  2E2H H;  4DV2 Q;  4OXP A;  1Z6H A;  4KHZ A;  4A3E B;  2IWH A;  1LTR D;  3I4N H;  1F2M A;  2EIF A;  4LF4 L;  1E7Z A;  5J22 A;  4L5T A;  4DK3 C;  2J0T D;  2JA8 G;  1S5C D;  5JVG 3;  4DV4 L;  1XMO Q;  1SFO B;  3TP8 A;  3IKJ A;  3FEW X;  2KCC A;  1PFM A;  2J7Z A;  4X3U A;  3GTG B;  1I5F A;  3HZX A;  4CJ2 C;  1KHI A;  4A3F H;  4K2L A; 
#chains in the Genus database with same CATH homology
 2EZV A;  2QEJ C;  4MIU A;  1FYC A;  1SBB B;  5JJZ A;  2FHT A;  3E5S A;  1PRT C;  1RTN A;  2E75 C;  2A6H C;  3F2U A;  1PZK D;  1EY6 A;  2XN9 C;  1PLF A;  2MPM A;  3L9A X;  1EYD A;  3NE5 B;  1TWG B;  3D8G A;  3O13 A;  5E4X A;  2EDG A;  5C0X J;  1ESR A;  1L0Y B;  4L63 B;  1PFB A;  3PUY A;  3V2T A;  3I72 A;  4IUN A;  5JPN C;  1JIC A;  2TMP A;  2AQ1 B;  1R4Q B;  1VF7 A;  1LAB A;  5G3L F;  2B2U A;  1BCP B;  1PTO F;  4PQX A;  1QNU A;  1J9O A;  2RVL A;  3NTH A;  5C3X A;  2ID0 A;  4HSP A;  1CQF A;  3QIA A;  3GTP B;  1LAC A;  1H9R A;  3A55 A;  3HOY B;  3TZD A;  3OPO A;  1BUV T;  2IX0 A;  1CZW A;  4BS9 A;  1S5E D;  4C56 C;  1YNJ C;  1LT3 D;  1O7Z A;  3X3M A;  1CTM A;  3FMC A;  1I4X A;  3H94 A;  3K0Y A;  5IOC A;  2BCO A;  2X69 A;  5C0X G;  2V4D A;  3S2D B;  1G6Z A;  1M8A A;  1SYD A;  2XNA C;  1DON A;  3M7N A;  2K6A A;  2IL8 A;  4XQJ A;  1SAP A;  1SYC A;  2HCC A;  2QDB A;  5KGU A;  3MAQ A;  4CBV A;  3QWN A;  1BO0 A;  2F0T A;  2CW0 C;  4ZKC B;  5CV9 A;  2EYJ A;  4DAY A;  4KKT A;  3EFX D;  1HA5 A;  1ET9 A;  4TKO B;  4DA2 A;  1SNM A;  4C3H B;  5ISR A;  1ENA A;  1PRT D;  1MI2 A;  3RZD B;  1K8O A;  4IFD G;  2WII B;  1MSG A;  1HFG A;  3HOV B;  1PTO D;  4OO1 H;  1OXS C;  1TY2 A;  1ZYR D;  1X3P A;  3S1R B;  1B9M A;  2R61 A;  1ENC A;  4IUP A;  2JA6 B;  5D3I B;  1EEI D;  1U4R A;  3NWT A;  4C3I B;  2LY7 A;  4JK1 C;  1QB5 D;  1BCP F;  2FFK B;  5ELB A;  1DM0 B;  4OGQ C;  3BVZ A;  4NDX A;  2MJ8 A;  2L9H A;  1AZQ A;  3RZO B;  2AUJ D;  5JEA H;  5C4H A;  2NZ1 D;  2JEB I;  4KN4 C;  2EYM A;  4IUV A;  1Y69 U;  4O42 A;  4HED A;  2I46 A;  1HQR D;  1A3U A;  5JPM C;  4XTC S;  3R8B A;  1G2T A;  3EVQ A;  4YIJ A;  1WCM B;  1I6H B;  2R92 B;  2Z4H A;  5M3F B;  4QCL A;  2KA7 A;  1F9P A;  2E2I B;  1S5B D;  4CHT B;  3P75 A;  2F3V A;  1MSH A;  1UAP A;  3NPP A;  2LS0 1;  3SK4 A;  1I4H A;  5JEA J;  1L0X B;  3WOF A;  5LHY 1;  1AFP A;  1SE2 A;  1SYB A;  3ITP A;  3I8Z A;  2KVM A;  2KEE A;  4FYD A;  2O4X A;  4H44 C;  1HFN A;  5KEE A;  1F9R A;  4IQZ A;  2XVS A;  1SDF A;  1NUC A;  3DMU A;  1RF2 D;  1R4P B;  4RGO S;  2X6L A;  1TS4 A;  5BN3 A;  2RKS A;  2F0D A;  1IYV A;  2LMC B;  1EY7 A;  1Y1W B;  1Q3L A;  2QCP X;  1STB A;  3U9S A;  5IGF A;  3TP7 A;  4CJ1 B;  5AFW A;  2F03 A;  2E2H B;  3GTQ B;  3FDT A;  2Q8R E;  5IT9 E;  3NXW A;  1S4Z A;  3A56 A;  4DAV A;  2A68 D;  3NBI A;  2EYF A;  3OHX C;  3BYY B;  1EZ6 A;  3H6M A;  2F0N A;  3HEJ A;  1EU3 A;  2D5D A;  1Y8O B;  1GHJ A;  4RKB A;  1O78 A;  1T5X D;  3S1M B;  2EY5 A;  1AEX A;  3LWU A;  4XT3 B;  3PIO 3;  5JAV A;  1A2T A;  2IPK D;  3HP3 A;  1D5M C;  5FOB B;  2PW7 A;  3S1N B;  2KUM A;  2E2D C;  2XWB B;  4DF7 A;  4LJZ C;  1GUS A;  1RTO A;  1UEA B;  2L1B A;  1M4V A;  2F0W A;  3H09 A;  4M8A A;  1VCI A;  4ZRZ A;  1SJH D;  1WTV A;  1NR4 A;  1IKM A;  1H9J A;  2QIL A;  1SE4 A;  1CI3 M;  2AWO A;  3BDO A;  1HTP A;  2PQE A;  1SXT A;  1K83 B;  4DK1 A;  3P20 A;  4B9W A;  2NYZ D;  2FIN B;  4HCS A;  1H9K A;  2VXW A;  1D5Z C;  4KKS A;  4G7H C;  3S15 B;  2DNE A;  1WTR A;  1B4O A;  3P1H A;  2H4O A;  2MP1 A;  2VB2 X;  2QF7 A;  5C0X H;  2RDG A;  2YYZ A;  4PMC A;  4XYQ A;  1JWM D;  4OL7 A;  3VA5 A;  1DXM A;  5EKK A;  4ZQ3 A;  4DU9 A;  5JVH 3;  5D3D A;  4IUT A;  2B2Y C;  2EYP A;  3I73 A;  3A8I E;  3MXP A;  3D4R A;  5IGE A;  4HCE A;  1EY4 A;  2R93 B;  2A73 B;  2F0K A;  3TSS A;  4RH6 A;  3G7L A;  2BDO A;  4RHS A;  3M4O B;  3SXH A;  1J8I A;  3C2P A;  3MFG A;  2R7Z B;  1JR0 D;  4MHE A;  1SNO A;  2EYO A;  3TDQ A;  2SNS A;  2F0V A;  5IOD A;  1LT4 D;  1YNN C;  4FF3 A;  1U4L A;  2NB0 A;  3AU7 A;  4ZUI A;  3KF8 A;  5I6W A;  5A2Q E;  3IAY A;  1PTO C;  1LT6 D;  1TS5 A;  1KLU D;  2H1E A;  3ND9 A;  1ZYR C;  5I2Y A;  2NTT A;  2Z8L A;  2KOL A;  5NUC A;  3T53 B;  3ND8 A;  2FJ2 A;  3C46 A;  2JXM B;  3R2I A;  4K8I A;  4R8N A;  4R9W A;  3M7G A;  5KIX A;  1I6V C;  1Q1E A;  1SYF A;  4P2C B;  1GXD C;  2EOT A;  4F7X A;  1ICW A;  4TRD A;  1V1O A;  1JC7 A;  5EPL A;  4ZKB B;  3S16 B;  3MA2 B;  4OIK A;  3J81 L;  2C9O A;  2L55 A;  1WVL A;  1JWU D;  1II3 A;  2MUY A;  3U9O A;  3BVM A;  1F2L A;  4QUF A;  5CV6 A;  4I7Z C;  1TVX A;  1X32 A;  3T56 B;  5K36 H;  1TWF B;  1GUT A;  3QG1 A;  3VR4 A;  1JOR A;  1F9Q A;  2K05 A;  4ZAI A;  2R6G A;  4N9T A;  3Q24 A;  5G3L D;  3DHQ A;  3VR3 A;  1R9T B;  2L11 A;  1QE6 A;  1AN8 A;  3K59 A;  3MWY W;  4B08 A;  2L12 A;  3L7Z C;  3I91 A;  1ML0 D;  1MGS A;  4A3J B;  2EYL A;  2Z1C A;  2VUM B;  1FNU A;  1CHQ D;  2WIN B;  1LTT D;  5E3F A;  5C4X B;  1FGB D;  3S1Q B;  3OIQ A;  1BOS A;  4ABN A;  2G9D A;  1SNP A;  1LTB D;  4C2M B;  2F0G A;  4J8Q A;  1MD2 D;  5HGT A;  2K7V A;  4DN4 M;  2F0U A;  1JB3 A;  3ZYY X;  3PUZ A;  1A3V A;  1RJT A;  3HG9 A;  2X6G A;  1STE A;  3HS0 C;  4DK0 A;  3EJI A;  1LT5 D;  2K1B A;  1EOT A;  2EJM A;  3QOJ A;  1JWS D;  2D62 A;  2WV6 D;  4C3I G;  1DD2 A;  1V43 A;  1EY9 A;  2RBM A;  1KLG D;  4KY7 A;  4LAA A;  3C3L A;  4KKU A;  1PMR A;  1BCP C;  1S5D D;  2A6E C;  4A93 B;  2A74 C;  1JQY D;  4BWG B;  3A54 A;  4F88 A;  3J81 E;  5DNF A;  3KLR A;  4IN3 A;  2B2V C;  3J80 L;  1STG A;  2M00 A;  1IKL A;  5A35 A;  1SE3 A;  3GTJ B;  4HMJ A;  3BZD B;  4IFD H;  1EEF D;  4HMI A;  2K5D A;  5DM6 3;  4RGM A;  5JOB A;  4CKC A;  4J6H A;  3Q23 A;  1KTK A;  2RQX A;  3R93 A;  3S14 B;  1Q12 A;  2IJ0 A;  1EY0 A;  1NCV A;  3PO2 B;  2F0O A;  1RD9 D;  2NN6 G;  3MTS A;  3A8J E;  2PW5 A;  1CZG A;  2VB3 X;  2IX3 A;  3VR5 A;  1EZ8 A;  4IUU A;  2A69 C;  2NTS A;  4N9P A;  4EQN A;  1ESF A;  1PDQ A;  4K8J A;  2PCF B;  3D3R A;  4OO1 G;  4KY6 A;  1W6J A;  3DXJ C;  2EXZ A;  2F0H A;  1QOH A;  4EGV A;  3GO5 A;  1UNS A;  4HAE A;  4K6L A;  4K5V A;  2F0J A;  5EBC A;  1BCP D;  2WP8 J;  3Q0A A;  2PZU A;  1QIL A;  3QJY A;  3TN2 A;  1BDO A;  3W2D A;  3GTK B;  2D9U A;  3KK7 A;  5CV8 A;  1TY0 A;  2YU9 B;  2CVR A;  2NN6 H;  4HN7 A;  5CC4 A;  5EKI A;  4U67 3;  5FLX E;  1O7L A;  4E6I A;  5FO9 B;  2F3W A;  3BG3 A;  1PRT F;  4QIW B;  3K7A B;  1D6E C;  4FO2 A;  4FXD A;  3MXG A;  4QB4 A;  5EQ0 A;  1TWC B;  3MEH A;  3H0G B;  1Q90 A;  1PZJ D;  1PYW D;  3DWA A;  3A8K E;  2EE1 A;  2JYO A;  1QCB D;  5C3E B;  1KDA A;  1WTX A;  2D2C C;  3J80 E;  2JA5 B;  3OOC A;  4XT1 B;  2BOS A;  3H91 A;  2WKD A;  2J4X A;  2XIW A;  3SK6 A;  2TSS A;  4X3K A;  3K58 A;  4I65 A;  2B2W A;  2A69 D;  1W6K A;  1XWE A;  4F8M A;  4LMQ D;  4XYO A;  3FPP A;  4PV1 C;  3Q22 A;  2E76 C;  1X3Q A;  3OMG A;  5KYI A;  2QKI C;  1B9N A;  1HUM A;  3VA7 A;  4WOR A;  1HPC A;  2XSC A;  4M1U B;  3I3C A;  1Y1V B;  5EGT A;  1YNN D;  1K8M A;  1RHP A;  5I9O A;  3CRK C;  1D5X C;  2A6H D;  1OXX K;  5IT9 L;  5IGC A;  3DWP A;  3AMU A;  3TBI B;  3NQI A;  4H7B A;  2MHV A;  2OEO A;  5E4W C;  2ZXP A;  3DEO A;  3VR2 A;  4ULL A;  4KV6 A;  4HR7 B;  4V19 0;  1JOK A;  5F2D A;  1F2Z A;  5CGK A;  2HUG A;  1U4M A;  3QO2 A;  1A15 A;  1G91 A;  4G57 A;  5COY A;  1ET6 A;  2AWN A;  4FXG C;  3J7Y W;  2RDF A;  4C3H G;  4QF4 A;  4BA2 I;  4DNT B;  5CMD A;  4A3I B;  1KNA A;  1EL0 A;  4PNY A;  4XQN A;  4A3M B;  3I4L A;  5ELD A;  1S5F D;  4TQU S;  1IL8 A;  4J1M A;  4KHV A;  1DYQ A;  4UAI A;  5M5X B;  3E0J A;  1AZP A;  2RDH A;  4WJW A;  4DAP A;  1V1P A;  1QWY A;  2B8F A;  3OSO A;  4DFA A;  4XXE A;  4RAU C;  1FNW A;  1HUN A;  2PZT A;  4A3G B;  2K5Q A;  5LL6 S;  2A6E D;  2DY8 A;  5C6A A;  1STN A;  1CQV A;  5IGB A;  3CKI B;  3D31 A;  2KQ3 A;  3R2T A;  4DXG A;  3FPU B;  1BXT A;  3CU7 A;  2NVX B;  2JP1 A;  4X3T A;  1JCK B;  1KDC A;  3NP8 A;  3D6W A;  1Y8P B;  3KLS A;  3RMH A;  4RFB A;  1EIH A;  1BNZ A;  1EFI D;  3EQL C;  4KJO A;  4BBS B;  1Q1B A;  5FO7 B;  3PUX A;  4FP5 D;  4FVM A;  1LTG D;  4RGT A;  3LWE A;  1RCV D;  3PUV A;  5EPJ A;  4OO1 I;  4OHJ A;  4DNR B;  2O5J C;  2F4I A;  2K32 A;  3C1F A;  4HSV A;  3PUW A;  3D6C A;  1G2S A;  4NW2 A;  3LX0 A;  5I4D A;  5M3M B;  2JSO A;  4ZUJ A;  1HCZ A;  1EY5 A;  1B44 D;  2F0P A;  2E2J B;  3NTI A;  3L3O C;  2BA0 A;  2OXP A;  3VYT A;  2DY7 A;  1EIG A;  3FRP B;  4C1N I;  3K57 A;  1GHK A;  3GQB A;  3M4Y A;  5C5M A;  3SK5 A;  4B9X A;  3KBX A;  2RSN A;  4Z9C B;  1STA A;  1LTS D;  1A2U A;  2LFN A;  1SSO A;  3GTM B;  2Y0S B;  4BBR B;  2PYK A;  5J1Z A;  4RGN A;  3SVM A;  2XRS D;  5CBE E;  2OF1 A;  2WKC A;  5CR3 A;  2L5T A;  1E0B A;  2EPB A;  3H3V C;  1OXV A;  3FVQ A;  2RA4 A;  3MHB A;  3M85 A;  2A5H A;  5DM7 3;  1EYC A;  2F0M A;  3NHH A;  4KJN A;  2B2W C;  4K2K A;  1EQT A;  2AUK A;  1TWA B;  3NWS A;  2MGS A;  1G29 1;  4ODG A;  3T4A C;  4IAL A;  1EWH A;  3N52 A;  1BQQ T;  4IZ8 A;  3K5O A;  4F87 A;  2L4N A;  2O2L D;  2JEA I;  3NQT A;  3EA6 A;  3PIP 3;  2WAC A;  2G9H D;  4K5X A;  1TR5 A;  5I9P A;  4A3K B;  2B39 A;  2SEB D;  2I07 B;  5ELF A;  1WD1 A;  1ZXT A;  2KED A;  3ERO A;  4KN7 C;  3GV6 A;  5KRU A;  2N55 A;  1DOL A;  1LTI D;  1IW7 D;  2M9V A;  1B50 A;  1C8C A;  1KDB A;  5LL6 X;  3HGB A;  3HRZ C;  2F0S A;  2WAQ B;  3SE0 A;  3RLF A;  4U68 A;  4A3B B;  1JE4 A;  1VDZ A;  4FF4 A;  4HTH A;  3DM1 A;  2OT2 A;  4A3D B;  1GOZ A;  3OMC A;  3PMF A;  1EY8 A;  5KYL A;  1CA6 A;  2A68 C;  1PRT B;  1TU2 B;  1JOO A;  2HCI A;  4Q5V A;  1GJX A;  3W3A A;  2F0F A;  2IT1 A;  3C1E A;  1EQV A;  1D2B A;  1PTO B;  5T1I A;  2B2V A;  2F0Q A;  1I4R A;  1AP0 A;  1Y8N B;  1H9M A;  3SEB A;  1WTQ A;  3IFT A;  2BE5 C;  1I4P A;  1ILQ A;  2SOB A;  1F9S A;  4KI0 A;  2JA7 B;  3SR1 A;  2B2T A;  3DUZ A;  1WD0 A;  1NSN S;  3NUC A;  2B2T C;  4JBW A;  1SYE A;  3MZ5 A;  3R3O A;  3CHB D;  3MFY A;  1GUW A;  5EJW A;  3LNN A;  3VYS A;  3GTL B;  3I70 A;  2K33 A;  3X3N A;  1RDP D;  3IL8 A;  2CHB D;  4FF2 A;  1VF5 C;  3T51 B;  5KNB A;  1MBY A;  3VYR A;  3K5M A;  3I4N B;  4NP5 A;  1WTP A;  3NSW A;  3SDZ A;  1GUO A;  1SMY C;  2EY2 A;  1GUN A;  3V96 A;  2N88 A;  2C5C A;  3KBG A;  3T16 A;  1ZEQ X;  2GA4 B;  2JA8 B;  1H9S B;  4WRD A;  1Z7T A;  3RD4 A;  1XYI A;  1I4G A;  4C1N K;  3HOX B;  5A2Q L;  1KNE A;  4TSS A;  1SEB D;  2ZXR A;  2ZXO A;  1DCZ A;  5CBA E;  4ZYS A;  4XDX A;  3HKZ B;  5HUR A;  2EJF C;  4L8J A;  3WDN A;  3HOW B;  5CYU A;  3OWF A;  1TKW B;  4FXK C;  1VMP A;  3A7L A;  3VYU A;  2AQ2 B;  5T1G A;  3KUP A;  2HDM A;  3OW7 A;  1PTO H;  5C4J B;  5BN4 A;  2K04 A;  5CV4 A;  4OIJ A;  2HQE A;  1EWC A;  1CK1 A;  2XWJ B;  1HRJ A;  4X3S A;  3TME A;  1OXT A;  2Q8I B;  5DEH A;  2IW3 A;  4MN3 A;  2IX1 A;  2BDN A;  1B2T A;  4V0B A;  3P7J A;  4KK7 A;  2K03 A;  2Q8T A;  5FK9 C;  5EPK A;  3PV0 A;  3D4D A;  4LK1 C;  1ILP A;  2SDF A;  5C5L A;  5JEA G;  3Q6S A;  2L0C A;  4G7Z C;  5FLX L;  2EY1 A;  1BF4 A;  4L6T B;  4CKB A;  1DOM A;  5CV5 A;  2ZT9 C;  4RCO A;  4Q0F A;  1KAA A;  2HDL A;  2KEC A;  5FO8 B;  1WTW A;  4AYB B;  1XXG A;  5FKA C;  3NBH A;  3BVG A;  1CM9 A;  1G8Z D;  1C48 A;  1SYG A;  1LV9 A;  3D4W A;  3WOE A;  1WTO A;  2DNC A;  1IYU A;  1ONL A;  2BA1 A;  3ONA B;  2ICE C;  3K5L A;  1STH A;  4EQP A;  5E1F A;  2F0I A;  1TS2 A;  2EVB A;  3URY A;  4IUQ A;  4FF1 A;  1EYA A;  3N6R A;  1QG7 A;  2RSO A;  1U4P A;  1Q8I A;  3G6J B;  2NWG A;  4IFD I;  3BYT B;  4ID6 A;  1SNQ A;  1CHP D;  2WB1 B;  2PZW A;  5M9O A;  1QJO A;  2EJG C;  5BN5 A;  1HA6 A;  2PPB C;  1V1P B;  1C4Q A;  5M5Y B;  1ENF A;  1QNK A;  1B3A A;  5KNC A;  4C3J G;  4ZLT F;  1DJR D;  1Z47 A;  1XTC D;  2EYH A;  4BY7 B;  2F0L A;  1STY A;  1FD7 D;  2B2Y A;  2R3Z A;  4EVO A;  1E2W A;  1IW7 C;  2K5W A;  1ROD A;  1D1I A;  3ERQ A;  2NVY B;  1E2V A;  5J39 A;  1HTL D;  5IGG A;  2JE6 I;  3GD7 A;  3IFD A;  3OIP A;  5IIF A;  4RKL A;  2NVQ B;  3PO3 B;  1HHV A;  1PFN A;  2Z4I A;  5D65 A;  3SHL A;  1XX8 A;  4NKL A;  1CT1 D;  5C4Z A;  4RCN A;  4EQO A;  4CJ0 B;  3A7A B;  3MVV A;  1NR2 A;  3S9W A;  1CFM A;  2PMZ B;  3NK9 A;  1B53 A;  5C0X I;  1I50 B;  3KLS X;  4S3S A;  5CV7 A;  1EU4 A;  1H9S A;  3BS1 A;  1PXU A;  5C3W A;  3FKI B;  4CKE A;  3AB9 A;  4WFN 3;  2NBF A;  1F77 A;  3HOZ B;  1SJE D;  4Y7N B;  5IGD A;  1AW7 A;  2K01 A;  4QUC A;  2XRQ D;  2B63 B;  3GTO B;  2FMM A;  4K6D A;  2ENB A;  4XIG S;  2B2U C;  3GV3 A;  4PMB A;  4CGY B;  2CW0 D;  3UI2 A;  2F1M A;  3I4M B;  2KJX A;  1TS3 A;  4KTA A;  2M2L A;  4BA1 I;  4IFD J;  3MC0 B;  1HXY D;  1DOK A;  4BY1 B;  3MXN A;  1E2Z A;  1V8Q A;  2DN8 A;  4G7O C;  4C3J B;  4NMZ A;  4K14 A;  2CQA A;  3J7A V;  3M3Y B;  3K5N A;  3JAM E;  3DEP A;  1IHZ A;  2O5I C;  4KMU C;  1O80 A;  3HOU B;  3V05 A;  1SNC A;  1A3T A;  1OXU A;  1CA5 A;  3K6O A;  5COR A;  2FMC A;  5DAU A;  5TSS A;  3TZU A;  2K28 A;  4H13 C;  3TP6 A;  5M5W B;  1SND A;  1LO5 D;  4A3F B;  4ME5 A;  1VMC A;  1I4Q A;  5KND A;  2SNM A;  4KY5 A;  2NVT B;  3CQZ B;  2KCN A;  4K5W A;  4O1N A;  1NAP A;  5ELC A;  3T13 A;  1F2Y A;  1TT2 A;  1HQM C;  3GP7 A;  2PO4 A;  2AQ3 B;  1B1Z A;  1FR3 A;  3DWQ A;  2BE5 D;  3TP5 A;  1LLR D;  4RA8 A;  2LKV A;  4ZK9 B;  4QMG A;  1D1K A;  1UUP A;  1U9R A;  2NN6 I;  2PNR C;  3S2H B;  3BDL A;  1TQO A;  2KHS A;  3NTK A;  1O7Y A;  4UDU C;  1T5E A;  1ZKO A;  3JAM L;  1PZI D;  5ELE A;  3J7A F;  4KD3 A;  1I3Q B;  4G4K A;  4DXF A;  3S17 B;  3E6Z X;  4GZY C;  2NUC A;  3BDC A;  5EKL A;  3MXU A;  4H0L C;  1KAB A;  4RWS C;  1LTA D;  1OO9 B;  1SMY D;  2B8G A;  4RHR A;  3CRL C;  1TII D;  5I6Y A;  1GUG A;  3VR6 A;  2EY6 A;  1TWH B;  3SK8 A;  1RKN A;  4ILW A;  1BR9 A;  5I2X A;  5D14 A;  5K36 G;  3QB3 A;  1JOQ A;  5EBD A;  4XQQ A;  4KD4 A;  1YNJ D;  1BBX C;  1DZ1 A;  3OWE B;  3I90 A;  2F0E A;  4DGZ A;  3RUZ A;  2VNU D;  4R8I A;  3QOL A;  4PMW A;  2ICI A;  1A6X A;  5K5P A;  4FNF A;  4IUR A;  2E74 C;  5C44 B;  1FNV A;  1Z6H A;  4KHZ A;  4A3E B;  2IWH A;  1LTR D;  1F2M A;  5J22 A;  2J0T D;  1S5C D;  5JVG 3;  1SFO B;  3TP8 A;  3IKJ A;  3FEW X;  2KCC A;  1PFM A;  2J7Z A;  4X3U A;  3GTG B;  3HZX A;  4CJ2 C;  4K2L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...