1H9SB

Molybdate bound complex of dimop domain of mode from e.coli
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
137
structure length
137
Chain Sequence
QTSARNQWFGTITARDHDDVQQHVDVLLADGKTRLKVAITAQSGARLGLDEGKEVLILLKAPWVGITQDEAVAQNADNQLPGIISHIERGAEQCEVLMALPDGQTLCATVPVNEATSLEQGQNVTAYFNADSVIIAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Oxyanion Binding Alters Conformational and Quaternary Structure of the C-Terminal Domain of the Transcriptional Regulator Mode; Implications for Molybdate-Dependant Regulation, Signalling, Storage and Transport
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription regulator
molecule keywords MOLYBDENUM TRANSPORT PROTEIN MODE
total genus 33
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2001-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03459 TOBE TOBE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1h9sB02
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1h9sB01
1H9RA 2BDOA 3T56B 1A6XA 2V4DA 1Q1EA 3DXJC 2NN6H 3SDZA 2JEAI 1GUTA 1Q90A 2A6ED 2DNEA 2EVBA 2B8FA 3FPPA 2KA7A 1Z7TA 4KKTA 5KNDA 1LACA 4DK1A 2JE6I 4L8JA 4KKUA 3A7AB 1HPCA 4KN4C 3ND8A 2PCFB 1HTPA 2EJFC 2ZT9C 3VR2A 5C0XH 1OXSC 2A6HC 2R6GA 1TU2B 3W3AA 1Y69U 3AB9A 1YNJC 3BG3A 5BN4A 1H9MA 1K8OA 3A8JE 4TKOB 2A68D 3GD7A 1VDZA 3PUWA 4XTCS 3RLFA 2BA0A 5C0XG 3OOCA 2AWOA 1VF5C 1ONLA 1IW7D 1H9SA 1E2VA 1SMYC 4KN7C 3WDNA 1PMRA 3IFTA 2NN6I 3PUXA 4DK0A 1Y8PB 3QIAA 4G7ZC 1GUSA 1IYVA 5JEAG 2EDGA 1FR3A 1GHKA 1GUOA 1OXVA 4IQZA 1HQMC 2A68C 1OXUA 2DNCA 2PNRC 1E2WA 3GQBA 3ND9A 1BDOA 1B9MA 3A7LA 4KI0A 5JEAH 3M7NA 2YYZA 5K36H 3U9SA 2BE5C 1DD2A 1Y8OB 5KNBA 1DCZA 5K36G 2E75C 1K8MA 1H9JA 2A6HD 2E74C 4KHZA 5BN5A 2A6EC 3CRKC 2PPBC 1OXXK 1B9NA 1OXTA 2AUKA 2E76C 1H9KA 1LABA 2K7VA 2KCCA 3A8KE 3OPOA 4HR7B 3VR4A 2K33A 3VR3A 2O5JC 3IKJA 1FYCA 3EQLC 4BA1I 1ZYRC 4H0LC 2D62A 2A69D 3KLRA 1ZKOA 2QF7A 1EWHA 3MXUA 1HCZA 1GUGA 3I4LA 3SE0A 1GJXA 2K32A 3PUZA 4GZYC 3VR6A 1E2ZA 3A8IE 4TQUS 4LJZC 1TKWB 4JBWA 1I6VC 2A69C 2DN8A 2L5TA 4LK1C 2JXMB 3L7ZC 5KNCA 3FMCA 1DXMA 1G291 2EJMA 4DNTB 2F1MA 3P20A 5BN3A 4G7OC 4H13C 3T53B 3D31A 2AUJD 3H94A 1V43A 3D4RA 3N6RA 3NE5B 3PUYA 3M4YA 4DNRB 2O5IC 4OO1G 4G7HC 4RCNA 1IYUA 4OO1H 2IT1A 1CI3M 1VCIA 1YNNC 3QJYA 1VF7A 1Q12A 1O7LA 3I72A 4IFDH 3PV0A 3TZUA 3LWUA 3LNNA 3HGBA 4IFDG 1CFMA 4PV1C 3M85A 2B8GA 4KKSA 1H9SB 4JK1C 1Q1BA 2BE5D 3BDOA 3VA7A 3QG1A 1GHJA 2JEBI 3PUVA 1O78A 4XIGS 5A35A 3MFYA 2LMCB 2CW0C 3I73A 3T51B 4BA2I 4I7ZC 1Z6HA 1CTMA 1IW7C 3CRLC 2Q8IB 4KMUC 2BA1A 2EJGC 1V8QA 1Y8NB 3VR5A 2NN6G 3OW7A 2D2CC 1GUNA 2D5DA 1T5EA 4OGQC 4H44C 1QJOA
chains in the Genus database with same CATH superfamily
2ICEC 2XVSA 1P16A 3H0GG 2B63B 1PH3A 1AE2A 4CJ2C 1JOOA 1S3OA 4NKLA 4P74A 1MGSA 4DK1A 3MHBA 3H6MA 1SE8A 1SJED 1U4PA 1MSHA 3MVVA 4R9WA 2PCFB 1ASZA 5IGBA 3CCQA 1A3UA 4PZ8A 2AHOB 1I94Q 2Q8TA 1K3BC 2H4OA 3BG3A 2ZXRA 2K52A 3JAMi 4A3LH 1ESRA 3TP7A 4A3DB 2IPKD 5M5XB 4KK7A 1CUKA 1TWAB 4N8FA 4CGYB 5J3BA 3PIO3 4OONA 2PZWA 1TWFB 3ONAB 2EDGA 1PFBA 4O0AA 1HRJA 3PSIA 3FVQA 4UHVA 1NCVA 1W3SA 4IQZA 1OXUA 5JEAH 3EBEA 1Q7YC 1O80A 3CCEA 1JQYD 2EY5A 4RAUC 1SBBB 1B9NA 1JWSD 3VR3A 4BBSB 2K33A 3LGJA 1VMCA 3EQLC 4GNXA 4H0LC 1JOKA 4YCUA 3X3NA 3PUZA 5KGUA 2JA6G 1BBUA 1R4QB 3KJPA 2QEXA 3GTGH 1DONA 2D0OA 2PQAA 3U9OA 1HZBA 2KHSA 3CC4A 1WTRA 4OXPA 4M8AA 5CV7A 3URYA 3HP3A 2ZTDA 1ET9A 4RCNA 4DN4M 3TEHB 1GM5A 3I4MG 2RQXA 3S17H 1TQOA 1A63A 2JA9A 3HGBA 1IHZA 4N8X1 4CJ0B 5C4XB 1Q1BA 3PUVA 1L1OA 1RDPD 4BXXG 3PO3G 4ZKCB 2EY1A 1BQQT 4K2KA 1WTWA 2R3ZA 1CTMA 1X6OA 1J9OA 1RTNA 4GOPB 3W1GA 1EIYB 2F3IA 1H9RA 2M2LA 4HTHA 2QILA 1TS3A 2NB0A 4LAAA 4A3MH 2NN6H 1KDBA 3GTLB 2UXDL 1G8ZD 1NSNS 1RIPA 1F77A 5E7NA 1I4XA 5KEEA 5TSSA 3STBD 2UUBL 2K5VA 4XYQA 1QUQB 3MFGA 4DV5L 3HOVB 2AWNA 3JC66 5BN4A 3CAMA 2NYZD 4DA2A 4A3IH 4ZQ3A 3B6YA 3GTKB 3PF5A 3RZDB 1BCPF 5HURA 1SYCA 3J81E 1E2VA 4KN7C 2MP1A 3O13A 5J22A 4A3EH 2RCFA 2F0MA 5C44H 2A8VA 3GV6A 3T1YL 1ET6A 2RSOA 3I4MH 2TSSA 4KJOA 2EPBA 1Q8KA 1XPOA 1YHBA 1SYFA 4OWXB 1B2TA 1C7YA 5K36H 3TZDA 1EYAA 1Y8OB 4C2MH 4HIOA 1QE6A 1KC8C 2ZTCA 2AUKA 2NWGA 1TT2A 5DM63 2GN5A 3IKJA 2EYFA 2HDLA 5FOBB 1HNXQ 2E5LL 1VQNA 1GXDC 1X3GA 2WV6D 2IX3A 4L6TB 4DR1L 3NTKA 2A19A 3S16B 4GLAC 1CK1A 3BZKA 2I46A 3GTJH 1VMPA 4G7OC 4GKKL 3BJUA 3PUYA 3NQIA 1NMGA 4YHHQ 1RTOA 3S1MB 3S9WA 2KQ3A 5EBDA 1VQLA 3S1MH 1EFWA 3Q6SA 1Z47A 4EQOA 4PV1C 4K8JA 4GN5A 2OT2A 5IWAQ 1L2FA 1O78A 3H3VI 2LMCB 2K14A 2CW0C 3J7ZC 4OL7A 2KJXA 2ZJRA 4AQYL 1MD2D 4HMJA 5IP9H 4DR5L 2ZJQA 3C1FA 3KFUA 1RKNA 4GNXC 5L37A 1HZAA 3FEWX 4A4IA 1PTOH 1EY0A 1IBML 1JJ2A 3DXJC 3SDZA 3JAME 1PHJA 2K5QA 1K83H 2Q2IA 4DK6C 1HR0L 4WJ3M 2KA7A 5EAYA 3HKZG 5I4DA 3I55A 3IL8A 1VQ9A 1B70B 2B2TC 4LF6L 1AZQA 3EFXD 2OXPA 3WOEA 2R6GA 4ABNA 1ILQA 3ITPA 3R93A 2PMZE 3KBGA 2JA5G 2B3GA 2IL8A 4LMQD 2PMZB 5ELDA 3RLFA 2WAQG 3RZOB 4A3MG 1K0SA 2AWOA 1E0BA 3F2CA 2A5HA 3WDNA 2X6GA 4IJLA 1L0WA 3OYYA 3MXGA 1GUWA 2CH4A 2IHEA 4GOPA 5EGTA 3I4NG 5JVH3 3K7AB 3U9SA 2BE5C 1LTSD 4FYDA 2X69A 1L1OB 4DUZL 1NE3A 1WD0A 1QVCA 4NXNQ 1OXXK 1AH9A 2F0HA 4HR7B 4P73A 1F9QA 2I5LX 3BZCA 2GA4B 1TWCH 4BA1I 5C5MA 2I5MX 3KBXA 2DY8A 1F9SA 1YEZA 3QOJA 3SE0A 4JI2Q 3M3YH 3A8IE 4LJZC 4P72A 4JBWA 2ALYB 3TSSA 4DAPA 4QIWB 4GOPC 1PFNA 3CXCA 3W5OA 1G291 2JA6H 1FVIA 3ULPA 3NTIA 2KECA 1Q82C 4A3DG 2MUYA 4RA8A 3D4RA 3N6RA 3KJOA 5ELOA 4Y7NH 2WP8J 4DV1Q 2M9VA 1ML0D 4GLXA 1CT1D 4FP5D 4XQQA 2RVLA 3HOYG 5FLMG 1K0RA 4U68A 4A3GG 1C8CA 3PV0A 3TZUA 2Y0SG 4JYAL 1TS5A 1STAA 4KY5A 1H9SB 1S5BD 1C9OA 4BY7H 4LF6Q 1T9HA 2KCTA 3PGZA 4RHRA 1X9NA 1I4HA 1UE6A 1E3PA 3GTQB 4PZ6A 1Y8NB 1ZYRD 2JA8G 4CKEA 5GAHC 4A3LG 2EVBA 1QWYA 4R4QA 2VL6A 1Z7TA 5C0XI 2ENBA 4K6LA 4ULLA 3K7AH 5FO7B 4FXKC 4WJ4A 1R9TH 1SYEA 1VQ7A 3E6ZX 4KV6A 5EKLA 1XPUA 1LT3D 4CBVA 1A62A 4UAIA 4IPHA 3TS0A 1O7YA 3H0GH 2J7ZA 1B1ZA 3OOCA 5CMDA 4KHVA 1SMYC 4DFAA 2J0TD 3I2ZA 3IFTA 2NN6I 1GVPA 1X56A 4ZUJA 5ELFA 4IO9A 3GV3A 3KYHC 1B50A 3SGIA 4A3FG 1VQEA 2JA8H 2JA6B 5ELEA 3I4OA 1MIUA 1HQMC 2A68C 2PNRC 4DUYQ 1NR2A 1K3RA 5LHY1 3U4ZA 2E74C 5FLMH 3RN2A 4XT1B 3OW2A 4OEMB 4JBKA 1C0AA 3OPOA 2SNMA 2XSCA 3H91A 3PIOA 1PFSA 5M5YH 1EWHA 1YI2A 1CSQA 3FKIG 4B3MQ 4GZYC 3MAQA 1MJCA 2LKVA 3EN2A 4KTAA 3QO2A 1BVSA 1J5EL 4R1JA 4IPGA 4C3HG 4FF4A 3U4VA 4MNOA 1AE3A 2N8NA 1B4OA 2LS01 2O5IC 3KF6B 4DAMA 2XTIA 2PYKA 1X3FA 3ZYYX 2F4VQ 4NMZA 1PRTB 3NWSA 1I50H 2MO0A 4GKKQ 1CFMA 4B3ML 5JJLA 2KUMA 1E1OA 1UEAB 1NJIC 1TS2A 2BE5D 4OX9L 4IUNA 1CQFA 3PO2H 1SROA 2OQ0A 4BA2I 4MTKA 1VQKA 1C48A 5IIFA 5IE8A 3NBHA 1J8IA 1QJOA 5IGDA 2B39A 2EOTA 3HS0C 2JEAI 4K0KL 4F87A 2Q8RE 2ZM6L 1Q90A 2F3VA 4DR2L 3BDCA 1WTQA 4DR5Q 1QB5D 5JVG3 2JE6I 1EZ6A 4EGVA 4RKBA 4LF8L 2EZVA 4NXML 2R93G 1L1OC 5C0XH 2A6HC 5CV8A 2N88A 1D5XC 3PCOB 4FF1A 1Y1WG 3KF8B 4A3KG 1X32A 3D4DA 1H9MA 2L12A 3A8JE 4PMWA 5A2QL 1EIFA 2A68D 2G9HD 2PQAB 4L5TA 2UU9L 4LFAQ 5IT9L 1CKNA 1PH1A 1PH9A 2UXCQ 4DR7Q 1E1TA 1K83B 3OMGA 4HN7A 5CV6A 1PMRA 3FDTA 4ALPA 2A73B 4JI4Q 4G7ZC 5GQOA 2LY7A 4CDEC 5JEAG 4QB4A 3X3MA 4BY1G 4YY3L 1QUQA 2B2TA 3CCJA 4NXMQ 1VQAA 3P7JA 2DUDA 3ND9A 1BDOA 5C5LA 2N78A 2X6LA 4FXGC 5I6YA 3SVMA 2O4XA 4LF4L 3MEFA 4UPAA 4EQ5A 3FRPB 1N36L 4DGZA 2OEOA 4DV0Q 1D2BA 1S40A 1OXTA 1XMQL 1I4PA 5H1SE 3AYHB 3E5SA 3DEOA 1VQCA 4DNIA 5I6WA 4KJNA 3S1QH 2NVXH 1LYLA 2F0SA 1EY4A 4NXNL 2DN8A 3RR5A 3FMCA 4KD4A 3CCMA 3VYSA 2CFMA 2PO4A 3CMEA 4JI5Q 1ILPA 1HHVA 3H94A 3Q22A 1PYBA 4KY7A 2ZJPA 2Z6BA 5M3MB 2PI2A 4OO1G 2WAQE 1EOVA 5LMUL 1H95A 1SLJA 4K0KQ 4KLKA 4IFDH 2D9UA 3G7LA 2Z8LA 4KKSA 3K57A 4UY8C 3CD6A 3QG1A 1GHJA 2JEBI 3BU2A 2JYOA 3PO3B 1A15A 1XPRA 2F0GA 3MFYA 3HOWB 1UUPA 1CSPA 3G71A 5C44G 3Q0AA 4KY6A 3BDLA 1TWHB 4DV7L 1XTCD 2F0PA 2BDOA 5DEHA 5I2XA 1GUTA 4JI4L 2ID0A 4A3BB 5M3MG 3KUPA 4KKTA 4DAYB 4F88A 2R7DA 5F2DA 1PV4A 2KVMA 2B2UC 4WFN3 1T5XD 2QW7A 4LFBL 2OTLA 1BO0A 2BCOA 3DEPA 4LF5Q 4LF7Q 4ME5A 3PUWA 4DR1Q 5C0XG 3S16H 3K5OA 1SFOB 2HIXA 1LTAD 4DV6Q 3J7A5 1XNQQ 2CQOA 4A3JH 1Y8PB 4DR2Q 3AEVA 2F0JA 2VNUD 4X64Q 2MHVA 5KYIA 1VQDA 3NBHB 1D8LA 2E5LQ 1B9MA 2EYHA 3A7LA 3UI2A 1U0LA 3TBIB 3J7YW 2L0CA 1STHA 5C6AA 1EQQA 2L4NA 5M3MH 2VW9A 3GP7A 2VQFQ 1W2BA 4A3CG 3OIPA 2EXZA 2UUAL 4YWKA 4XQJA 3RLOA 2BDNA 1N8RC 2NZ1D 1U9RA 4YWLA 3KLRA 5HGTA 2PZUA 4A93H 1XJVA 4JI7Q 2Z1CA 4PMCA 2CCZA 2NBFA 1E24A 2VQEL 1X3PA 2QDLA 4X3SA 3RZDH 3BVMA 3L7ZC 4XYOA 5GROA 3UE0A 4A3JB 2HQEA 2F0DA 1BCPC 3TRZA 1KAWA 3T53B 1PDQA 2WKDA 1HR0Q 4OIJA 1U4LA 3LWEA 1QILA 1UEBA 3PIP3 1NNXA 4DV4Q 1MHWC 4Y52H 4K5VA 1LTID 5D3DA 1BOSA 1EQTA 1CI3M 4OO1H 1FJGL 3S24A 3FKIH 1HA5A 1O7LA 1HR0W 1N33L 1WTOA 2NVYH 3STBC 3M85A 3I90A 4S3SA 1D1IA 5DM73 4C3JG 1E22A 1I94L 1J5EQ 3V05A 3FP9A 1Z6HA 2F0LA 3OTOQ 4ID6A 1KLUD 1EL0A 3CRLC 4DPGA 3H3VC 2PNHA 4DR3L 2V1CC 3M4OH 4RWSC 4OX9Q 1A6XA 2V4DA 1MKHA 5I9PA 1NBWA 3ERQA 2IX1A 4ODGA 1JICA 2R92B 5CV9A 4IALA 2ASBA 4ME3A 3RD4A 1PYWD 1LACA 5EPLA 1A2TA 4B9WA 4C3HB 5KYLA 2QCPX 1HPCA 1NMFA 1SRUA 2DY7A 3SK4A 2F4VL 4BY7B 1YNJC 4HSVA 3M3YB 3T1HL 3ULJA 1X55A 1TXYA 4FF3A 1YNJD 4UDUC 5M5WH 5T1IA 2JJQA 2VY3A 4OWWB 4A3KH 2C35B 3R3OA 3R8BA 1U4MA 2HDMA 4H7BA 2PW5A 5CBEE 3M4OB 1F9PA 3GTMB 3S15H 2CH4W 2B63G 1GHKA 2AQ1B 1GOZA 2SOBA 4QY7A 3I4NB 1SNCA 2DNCA 2KEDA 4ZAIA 1DD2A 3M7NA 5C4ZA 3J7AF 5GAEC 5KNBA 5K36G 2L15A 4JI2L 4N9TA 4PZ7A 1EZ8A 2DGYA 1SNPA 2C5CA 4LNQA 3S14H 2DJFC 1R4PB 3G6JB 2QEJC 1YJNA 3R2IA 2Z9HA 2YTXA 1XYIA 2QGQA 1ENFA 4XDXA 2F0KA 3J80c 1QCBD 1GJXA 5E4WC 2K32A 1HUMA 4TQUS 1SYBA 2WACA 1I6VC 2FHTA 1B3QA 4DR6Q 1QOHA 4LK1C 2ZXOA 3I70A 5KNCA 2JK8A 1EY7A 3HOXB 5D14A 3P20A 3QWNA 3Q8DA 2Z4HA 2FFKB 1DJRD 3K0XA 3GTMH 1VQBA 4UP9A 4V0BA 4FNFA 2SEBD 1IBKQ 1TWHH 5IGEA 4MZ9A 4GN4B 3MXNA 4BY1B 4B3RQ 3D4WA 4UP7A 3BDOA 1ICFB 1S4ZA 1V1PA 3K5MA 1SNMA 1HTLD 3CC2A 2YU9B 1G6ZA 1U5KA 2B2VC 3E0JA 3HOUB 1FD7D 3SR1A 4FXDA 2NVQB 4RG1A 5FO9B 5ELNA 3PO2G 4OGQC 4X3KA 4A3IB 1ZEQX 1HQRD 3E9HA 1XNRL 4JI8Q 1N34Q 1DGSA 5IYCG 3S2DB 5M3FG 1XWEA 4DU9A 4C1NI 3A7AB 4RCOA 2CHBD 1SNQA 3J81i 4OIKA 1HTPA 3NBIA 1EY9A 1LTGD 1EU4A 2WAQB 2K05A 1TU2B 4G4KA 4BBRB 4C3IB 4BBRG 1VDZA 1VQGA 3V2TA 1B44D 4L63B 3K0YA 1B8AA 1AW7A 4YCVA 2B2YA 2F0NA 1XNRQ 4A3BH 2N49A 4HJ9A 3HFZB 1PZJD 4DR4L 3M9BA 4CDDC 1BBXC 3K80C 3WOFA 3BYYB 1TWGH 3H3VH 3QR8A 3A0JA 4TRDA 3I7FA 4DV3Q 1GUOA 5JAVA 3IFDA 4HSPA 5ELBA 1VS0A 1PVOA 2K50A 1WJJA 2YYZA 1VQ6A 4OHJA 2K5HA 3Q24A 1B53A 4KHPQ 1IBLQ 4I7AA 4X65L 3CCVA 3CW2C 4O1NA 1KTKA 1ENCA 3QB3A 1B7YB 5C3EB 1QVGA 4WORA 1EQVA 1R9TB 5LL6X 1GUGA 5JJKA 4C2MB 1STGA 2YU9H 3HOVG 1TWCB 4X62Q 2JXMB 4K8IA 2EXDA 4IZ8A 1SDFA 4HJ8A 4JI6Q 3HOZG 1TS4A 1RODA 4AQYQ 4F7XA 2RSNA 1F2LA 1O7ZA 1UNSA 3M4YA 4GN3B 5JPNC 5JOBA 1HNWQ 4DXGA 4EX5A 4GS3A 1YHAA 3RNUA 3UDGA 2FINB 2I5HA 1N34L 1WYDA 1Q8IA 1Z9FA 2B2WC 4E6IA 2IJ0A 4IURA 5M9OA 3NXWA 3VA7A 1HJPA 2R93H 1UE1A 2YV5A 5A35A 3H15A 1WTXA 2NUCA 4I7ZC 1Y14B 4IUUA 2EY6A 2WB1E 1A2UA 2VUMB 1KRTA 1IW7C 3TMEA 2WB1B 1GUNA 3T56B 4I65A 3CC7A 2KENA 5I9OA 5IYCH 1N33Q 3UDFA 4LUOA 3FPPA 2PW7A 5KNDA 4KN4C 1K8GA 2LSSA 4EQPA 2C9OA 1EEID 3S15B 2UXCL 2WFWA 2LXKA 2WKCA 4JVZA 1Q46A 4TKOB 4DR3Q 5HY6A 2UXBQ 4AYBE 1K9MC 3CCRA 1NAPA 5E4XA 4LF9L 1S5FD 4JI8L 1SE3A 3MTSA 1VQMA 4L5SA 3NEMA 3T1HQ 2HCIA 3A5UA 3MWYW 1KNEA 2AQ2B 1JB7A 1QNUA 3J7AV 3HOUH 2KEEA 1SSOA 3GTOB 1LTTD 2XN9C 3J80E 3S2HH 1CQVA 4KI0A 4YIJA 2MQHA 1I4QA 3MXNB 1BF4A 2F0TA 5KIXA 2B29A 1PZKD 2XRQD 2YTVA 3TREA 2A6EC 4EQNA 4CDCC 4UP8A 3VR4A 4R4TA 2R92G 4GKJQ 5C4XG 1HUNA 1ZKOA 1HCZA 5CV5A 5J1ZA 2B2WA 3VR6A 3AU7A 4PG3A 1A8VA 5CR3A 1SNOA 5DLQE 2L9HA 3D31A 5FO8B 2PQEA 2AUJD 4Q0FA 4TSSA 1AP0A 1I6HH 1IBLL 4R4IA 4DNRB 3VA5A 1FGBD 5C3WA 1N9WA 3NUCA 2B63H 5LMNW 2IT1A 3QJYA 2Y0SB 1PYSB 3I72A 4JPBW 5EKKA 1LTRD 3SK8A 2R7FA 3G48A 2HT1A 3DLLA 3K58A 3GTPH 3VYUA 3QOLA 1BCPD 1HZCA 2Z6KA 1IKLA 1Q86C 4NPSA 3GTPB 1XMQQ 3HOWG 2DJGC 5AJ3Q 3CPWA 4POGA 3T51B 1XNQL 1JR0D 4RFBA 1S5DD 4DV5Q 1VQ5A 1IBKL 2L1BA 1SE2A 2BA1A 1XX8A 3KK7A 1X65A 4X64L 5C4HA 2NVTB 1JT8A 1XMOL 3MXPA 4RKLA 2K75A 2EYMA 4RGNA 5C3XA 2VUMH 4P71A 1EU3A 3D6WA 3S14B 3CP0A 3F2BA 2JP1A 4RGMA 3D6CA 3T1YQ 1JCKB 5LMUQ 4HMIA 2IY5B 3I91A 2G9DA 4F8MA 1PRTF 3DHQA 1PH6A 4JG2A 5FLXc 3JAML 3GD7A 3I56A 4A93B 4XTCS 2BA0A 1YJ9A 2JA7B 3CKIB 3RMHA 1A0IA 3CCSA 3F2DA 4DK0A 1KIXA 2H1EA 2OQKA 3SXHA 1CKMA 3J81j 2M00A 4A3BG 1AFPA 1VQ4A 2OTJA 1FR3A 3FPUB 1WTPA 3IRBA 5DAUA 2E2IH 1XTDA 3JAMc 3VYTA 1KL9A 3OIQA 1SE4A 1PH7A 1YZ6A 1S5CD 1SYGA 5GADC 4DR4Q 1TR5A 2QA4A 2KHJA 2F52A 2VB3X 4R8NA 3U50C 4X66Q 4XT3B 2JSOA 2HHHQ 2HCCA 3HOZB 5M3FB 3CHBD 1EY8A 1EYCA 3K5LA 3NHHA 1ZYRC 3T4AC 4A93G 4ZCKA 4A3EG 4ZUIA 5CGKA 4RGTA 5C4XH 3I4LA 4LF7L 5ELCA 1D6EC 3PO3H 4JW0A 5IWAL 3KLSA 1K28A 1N32Q 1Y1VB 3NP8A 1DXMA 1CKOA 1D5MC 2BH2A 3OWFA 3TDQA 1V1OA 3MC0B 3L9AX 1KNAA 4H13C 3F1ZA 4JOIA 4RMFA 1CHPD 2F4IA 1LTLA 2K4KA 4ILWA 2FMCA 2UUCQ 2E2IB 5D65A 1GKHA 2AQ3B 3P75A 4IPCA 5IODA 3TQYA 1HNZL 2AMCB 3LWUA 1TWFH 1I4RA 3EJIA 2VQFL 4JK1C 1CM9A 3C2PA 2MNAA 1D7QA 1CZWA 4N9PA 2RCNA 3C1EA 3RLNA 3HOXG 1V8QA 3AFPA 5T1GA 1MSGA 1HNWL 1WVLA 5IP7G 4YHHL 1AEXA 1Q1EA 4JBMA 1EOTA 3G4SA 1PFMA 5EKIA 1ICWA 1KRSA 2K1BA 3E9IA 4IFDJ 5C4JB 4GNXB 1KAAA 3CMAA 1LV9A 3L0OA 5IGCA 4ZLTF 3S2HB 1Y69U 1Q3LA 4HJ7A 5JJIA 2VUMG 2F0FA 3NK9A 1H9SA 4DAYA 1HNXL 1RJTA 3A55A 1B3AA 3SK6A 1BNZA 3I3CA 1CA5A 3N52A 5BR8L 2HIVA 3OHXC 3HOWH 4A3GB 1G6PA 2JA5B 4B08A 1QVFA 3GQBA 2QDBA 1EYDA 3I8ZA 1X3QA 1WI5A 1CKNB 2YTYA 4M1UB 3I4MB 4APVA 2E75C 1VQPA 2G5DA 5EPKA 3F8TA 4MN3A 4P75A 5FKAC 5IYBH 4HCEA 2O5JC 1SXTA 5IGGA 1YVCA 3J81L 2RHQB 3OSOA 4JYAQ 4QIWE 3A56A 4DV7Q 1X54A 1OO9B 4BY7G 5EQ0A 2EYOA 4JOIC 4FF2A 1DOLA 4Q5VA 2RDHA 1EIHA 5M5WB 4AIMA 2NZOA 4X3UA 5G3LF 2JA7H 3HZXA 4QUCA 2NVXB 1GO3E 4G7HC 2VS1A 4OO1I 5IT9c 2OCEA 1IXRA 2RF4A 1Q12A 4GKJL 1D5ZC 4ZYSA 1QG7A 1FGUA 1A3VA 1LO5D 4XXEA 2F0QA 2ATWA 1DZ1A 4XIGS 4U673 3HOUG 4WRDA 4DV6L 4DAVA 4LFBQ 1PTOF 3AQQA 1BKBA 3RZOH 1PH2A 1X3EA 3M4QA 3PMFA 2EJGC 1PLFA 2R7ZH 3PF4A 2NN6G 3DWPA 3SHLA 2D5DA 1ENAA 5K5PA 3RN5A 1EYGA 3KDFA 1SJHD 1S72A 4OELB 4NP5A 1JORA 1SYDA 4JBJA 4LFCL 4V190 3TP8A 1PTOB 4K6DA 4DK3C 3I4NH 4TVAB 2I07B 3P1HA 4K14A 3BVZA 1WD1A 5LMNQ 3GTJB 1AZPA 1OTCA 2HQLA 1PH4A 1VQHA 1NUCA 1RCVD 3ER0A 1PTOD 1QZGA 3GO5A 4C3IG 2VXWA 1TWAH 3U58A 5M5YB 4QF4A 3K59A 2I0QA 3E3XA 3GTLH 2VQEQ 2XWBB 2UUAQ 2B2YC 1ONLA 1IW7D 1SR3A 2MJ8A 5I2YA 3CQZH 1V1PB 1HXYD 1UWVA 2NVQH 1FNWA 4PQXA 2BH8A 4KHPL 3D3RA 3K81C 2Z4IA 2R7ZB 5J39A 2UUBQ 2R7ZG 2F0VA 4A3KB 4MTNA 2JA8B 3SK5A 1EEFD 4DXFA 2EY2A 2RDFA 4YWMA 2CQAA 2A6HD 3OWEB 4DKAC 5BN5A 3S2DH 3AMUA 3CF5A 1FJGQ 2D62A 2JA7G 2A69D 3EA6A 4QL5A 2QF7A 2IX0A 1EUJA 3VYRA 4O42A 4J6HA 1JE4A 1YNXA 4X66L 2A69C 3IAYA 3DWQA 1RD9D 4C1NK 4DNTB 4PMBA 2JN4A 4PNYA 2PZTA 4HAEA 1V43A 3HG9A 1N36Q 4RH6A 4DUZQ 4HEDA 3CCUA 4DF7A 1TWGB 2Q2HA 5FLXE 1YNNC 4BS9A 1EFID 1II3A 3RUZA 4K5XA 4ZKBB 2J4XA 4AH6A 2F0OA 2Z0SA 1PH5A 4IFDG 4R4CA 1KDAA 1YNND 5LL6S 5C44B 3KLWA 1N32L 1WTVA 5CC4A 5KRUA 4LF9Q 4ZK9B 3S1RB 4B3SL 2E2HB 2F0UA 5GAGC 3G6EA 1G2SA 2CWPA 4KMUC 2B2VA 3ULLA 1PXUA 2IW3A 2OF1A 1T5EA 1PTOC 3FKIB 4HIMA 1HZ9A 5D3IB 1WFQA 3GTOH 2ICIA 2ES2A 2XWJB 4IUVA 1YHQA 3A74A 3NSWA 4L8JA 1DYQA 1Y1VG 4IPDA 5JPMC 3WWVA 5IGFA 1K8AC 3CU7A 3BZDB 3J80L 2R92H 4A3GH 3PO2B 3R2TA 5C4JH 3NTHA 2VZAA 3W1BA 1EIGA 2ZM6Q 3PUXA 3NELA 1D1KA 4RHSA 3QIAA 4A3DH 1VQ8A 2TMPA 4XQNA 4LFCQ 4KD3A 1G91A 1UE5A 4K5WA 5IP7H 5LMNL 3TN2A 1HFNA 1E2WA 2L55A 1VQJA 3T16A 1ZXTA 3VDYA 1Y1WH 5IYDG 3HOYB 5IY0A 2HUGA 3HOXH 3TP6A 2Q2TA 2CW0D 4B3RL 3M4PA 5BR8Q 1SMXA 2MFIA 3A8KE 1LABA 1YIJA 1MBYA 1UAPA 3M7GA 4J8QA 2N55A 1DOMA 4HCSA 4K2LA 5FLXL 3GTGB 1LT4D 2FMMA 3NWTA 1JOQA 5IOCA 5ISRA 5NUCA 1LTBD 4MHEA 4CKCA 1LT6D 3ICEA 2RA4A 2EIFA 4C3IH 5HGQA 1TY2A 3NE5B 4OWTB 3J80i 3DWAA 2B2UA 2AKWB 1VCIA 3Q23A 1VF7A 4IOAA 2KHIA 1G2TA 3A5ZB 1NTGA 4WJWA 1A3TA 5JEAJ 2QKIC 4C56C 1V1QA 1O7IA 4EVOA 1KDCA 2EE1A 4HJAA 5COYA 2Q8IB 1PRTC 4LFAL 1L0YB 1YITA 3UDIA 4H44C 4GLVB 1ESFA 1IKMA 4LWCA 1G51A 2KBNA 2DNEA 1PH8A 3HOZH 1LLRD 4DV1L 1I6HB 1V9PA 2ZT9C 4ZRZA 1F2MA 1NR4A 4QGUA 3GTQH 5IP9G 3H09A 2WB1G 1KD1C 3C46A 1VQIA 5CBAE 1YJWA 2SDFA 2H5XA 1FL0A 1Y1VH 4DV3L 3GTKH 1EQRA 3W2DA 4BBSG 1C4QA 4J1MA 4QUFA 1SFOH 1L0XB 4QMGA 5IT9E 4JC0A 5EPJA 1SEBD 1GUSA 2E2JH 1KLGD 1J6QA 2UUCL 2HHHL 1XMOQ 1RHPA 2LXJA 1WOCA 1OXVA 3PIPA 4X62L 4L5RC 5FK9C 1I4GA 3DM3A 1K73C 3K8AA 4KHZA 2PPBC 2E76C 2F0WA 1P8LA 1WCMH 1EY6A 2F3WA 2K5NA 1Q81C 4JI6L 3S1NB 1JJCB 1KHIA 2BOSA 1JC7A 1JWMD 1JJGA 2MPMA 2EQSA 1E2ZA 5JJZA 4QQBX 1TKWB 2K28A 1RL2A 3BS1A 4JI0L 1JMCA 5BN3A 3S1QB 1BR9A 1TY0A 4QJFA 4DV0L 3LX0A 5E3FA 4C3JH 1DM0B 1RF2D 5C0XJ 2KCNA 3KF8A 3MEHA 4DV2Q 1LUZA 4B3TL 4JV5Q 4IJHA 4FO2A 4AYBB 2F0IA 4X6AH 1I3QH 5EBCA 3LNNA 2NTTA 3AFQA 3DUZA 4H02A 5CORA 5FJ8H 1CA6A 4NW2A 2UXBL 4QCLA 1MI2A 4A75A 4JI0Q 1BBWA 2PI2E 4JI1L 3EIVA 4HJ5A 4JI5L 1JB3A 3T13A 4A3JG 1M90C 1NY4A 4IOCA 3KOJA 3OW7A 2MGSA 2XNAC 4A3EB 1ASYA 1UE7A 4B3SQ 4C3HH 1TVXA 3HKZE 4BXXH 2EYPA 3ND8A 1VQOA 4BWGB 2EJFC 3VR2A 4A3CH 2K03A 1IBMQ 1JWUD 3AB9A 1M8AA 1K8OA 3MZ5A 1Y1WB 1YBYA 5AFWA 4J15A 3L3OC 4CJ1B 1VF5C 2F03A 1S5ED 3OMCA 2K04A 2RBMA 2E8GA 3HKSA 5A2QE 4A3FH 3NENA 1STYA 4LUVA 2JA5H 4A3FB 5IYDH 2NTSA 2NVTH 1EWCA 1K8MA 2JQOA 1IZ6A 5DNFA 1H9JA 2IHFA 4LF8Q 1WCMG 2K01A 4YY3Q 5M5XH 2K7VA 1H9KA 1KABA 2KCCA 4DR7L 3CPFA 1FYCA 2A74C 4B3TQ 4JV5L 3KF6A 1HFGA 3A54A 3UDXA 4B9XA 2RKSA 3NPPA 5G3LD 2CKZB 2Z6KC 4NB3A 3HEJA 4CHTB 4G57A 2L5TA 3EROA 3PQIA 4HIDA 1M1KC 3HOVH 4YCWA 4JI1Q 2RDGA 4IUTA 4LF4Q 3OTOL 3NQTA 2K5DA 4MIUA 3EVQA 2HD3A 2SNSA 1EWIA 4Y7NB 1IL2A 1SAPA 2UXDQ 2O2LD 1FNUA 1I50B 3MA2B 4BBSH 2D0PA 1SNDA 2E2DC 5AJ3L 2VB2X 1AN8A 3C3LA 1HA6A 1SN8A 2E2HH 2F0EA 1F9RA 2B8GA 3F2UA 2R61A 3CQZB 1LT5D 1STEA 2XRSD 2P5ZX 3GDEA 2IWHA 2CVRA 3L2PA 3VR5A 3SEBA 2D2CC 4DV4L 4CKBA 4JI3Q 2FXQA 1IYJB 4DV2L 1IL8A 4R4OA 2A6ED 4IFDI 4L5QA 1M4VA 2B8FA 4NDXA 2OWOA 1W6KA 3DMUA 4KKUA 5CYUA 1W6JA 2ZTEA 4BBRH 1OXSC 4R8IA 1EY5A 3W3AA 1KQSA 1STBA 2WIIB 3K5NA 5C3EG 2WINB 4P2CB 2EYLA 4BY1H 3K6OA 5M3FH 1I3QB 4HIKA 1WCMB 1QZHA 3HKZB 1U4RA 3S17B 5CV4A 4POFA 3S1NH 1IYVA 1FNVA 4AYBG 2Q2UA 3HOYH 2GVAA 1KXLA 2K6AA 2N3SA 2NZHA 1PA6A 1CHQD 4A3IG 3J81c 2KCMA 1DCZA 2LFNA 4JCVE 2KOLA 1STNA 3CRKC 3UE1A 1MJEA 1TIID 5E1FA 1BXTA 4Z9CB 1PRTD 1F2YA 5EJWA 2E2JB 2MO1A 1HNZQ 4LF5L 3MXUA 3H0GB 2Y0SE 1I5FA 3K7UC 1LM0A 4A76A 2XIWA 4CDFC 5FJ8G 2EJMA 2F1MA 3DM1A 2ZXPA 3D0FA 4IUQA 4X65Q 2RHSB 4O2DA 3ZJYC 1JE5A 4JI3L 3CCLA 1BUVT 1IYUA 1E7ZA 1PZID 2FJ2A 4LUZA 4RGOS 4IN3A 3TP5A 4DUYL 3TS2A 4FDBA 1DOKA 1VQFA 1XXGA 3E0EA 3HRZC 1WTHA 1QNKA 2GVBA 3V96A 3KDFB 2EYJA 4LW1A 1GD7A 4FVMA 1CZGA 1HH2P 2R93B 2UU9Q 4X3TA 1BCPB 2L11A 2XGTA 3S1RH 5C3EH 4DR6L 1F2ZA 4C3JB 3I73A 3BVGA 3ERSX 2K5WA 3BYTB 4A3MB 4JI7L 4IUPA 1SMYD 2A1AA 3KLSX 3FHWA 2CWAA 2NVYB 5IYBG 3D8GA
chains in the Genus database with same CATH topology
2ICEC 2XVSA 2B63B 4CJ2C 1JOOA 4NKLA 1MGSA 4DK1A 3MHBA 3H6MA 1SJED 1U4PA 1MSHA 3MVVA 4R9WA 2PCFB 5IGBA 1A3UA 2Q8TA 2H4OA 3BG3A 2ZXRA 1ESRA 3TP7A 4A3DB 2IPKD 5M5XB 4KK7A 1TWAB 4CGYB 3PIO3 2PZWA 1TWFB 3ONAB 2EDGA 1PFBA 1HRJA 3FVQA 1NCVA 4IQZA 1OXUA 5JEAH 1O80A 1JQYD 2EY5A 4RAUC 1SBBB 1B9NA 1JWSD 3VR3A 4BBSB 2K33A 1VMCA 3EQLC 4H0LC 1JOKA 3X3NA 3PUZA 5KGUA 1R4QB 1DONA 3U9OA 2KHSA 1WTRA 4M8AA 5CV7A 3URYA 3HP3A 1ET9A 4RCNA 4DN4M 2RQXA 1TQOA 3HGBA 1IHZA 4CJ0B 5C4XB 1Q1BA 3PUVA 1RDPD 4ZKCB 2EY1A 1BQQT 4K2KA 1WTWA 2R3ZA 1CTMA 1J9OA 1RTNA 1H9RA 2M2LA 4HTHA 2QILA 1TS3A 2NB0A 4LAAA 2NN6H 1KDBA 3GTLB 1G8ZD 1NSNS 1F77A 1I4XA 5KEEA 5TSSA 4XYQA 3HOVB 3MFGA 2AWNA 5BN4A 2NYZD 4DA2A 4ZQ3A 3GTKB 3RZDB 1BCPF 5HURA 1SYCA 3J81E 1E2VA 4KN7C 2MP1A 3O13A 5J22A 2F0MA 3GV6A 1ET6A 2RSOA 2TSSA 4KJOA 2EPBA 1SYFA 1B2TA 5K36H 3TZDA 1EYAA 1Y8OB 1QE6A 2AUKA 2NWGA 1TT2A 5DM63 3IKJA 2EYFA 2HDLA 5FOBB 1GXDC 2WV6D 2IX3A 4L6TB 3NTKA 3S16B 1CK1A 2I46A 4G7OC 1VMPA 3PUYA 3NQIA 1RTOA 3S1MB 3S9WA 2KQ3A 5EBDA 3Q6SA 1Z47A 4EQOA 4PV1C 4K8JA 2OT2A 1O78A 2LMCB 2CW0C 4OL7A 2KJXA 1MD2D 4HMJA 3C1FA 1RKNA 3FEWX 1PTOH 1EY0A 3DXJC 3SDZA 3JAME 2K5QA 2KA7A 5I4DA 3IL8A 2B2TC 1AZQA 3EFXD 2OXPA 3WOEA 2R6GA 4ABNA 1ILQA 3ITPA 3R93A 3KBGA 2IL8A 4LMQD 2PMZB 5ELDA 3RLFA 3RZOB 2AWOA 1E0BA 2A5HA 3WDNA 2X6GA 3MXGA 1GUWA 5EGTA 5JVH3 3K7AB 3U9SA 2BE5C 1LTSD 4FYDA 2X69A 1WD0A 1OXXK 2F0HA 4HR7B 1F9QA 2GA4B 4BA1I 5C5MA 3KBXA 2DY8A 1F9SA 3QOJA 3SE0A 3A8IE 4LJZC 4JBWA 3TSSA 4DAPA 4QIWB 1PFNA 1G291 3NTIA 2KECA 2MUYA 4RA8A 3D4RA 3N6RA 2WP8J 2M9VA 1ML0D 1CT1D 4FP5D 4XQQA 2RVLA 4U68A 1C8CA 3PV0A 3TZUA 1TS5A 1STAA 4KY5A 1H9SB 1S5BD 4RHRA 1I4HA 3GTQB 1Y8NB 1ZYRD 4CKEA 2EVBA 1QWYA 1Z7TA 5C0XI 2ENBA 4K6LA 4ULLA 5FO7B 4FXKC 1SYEA 3E6ZX 4KV6A 5EKLA 1LT3D 4CBVA 4UAIA 1O7YA 2J7ZA 1B1ZA 3OOCA 5CMDA 4KHVA 1SMYC 4DFAA 2J0TD 3IFTA 2NN6I 4ZUJA 5ELFA 3GV3A 1B50A 2JA6B 5ELEA 1HQMC 2A68C 2PNRC 1NR2A 5LHY1 2E74C 4XT1B 3OPOA 2SNMA 2XSCA 3H91A 1EWHA 4GZYC 3MAQA 2LKVA 4KTAA 3QO2A 4C3HG 4FF4A 1B4OA 2LS01 2O5IC 2PYKA 3ZYYX 4NMZA 1PRTB 3NWSA 1CFMA 2KUMA 1UEAB 1TS2A 2BE5D 4IUNA 1CQFA 4BA2I 1C48A 5IIFA 3NBHA 1J8IA 1QJOA 5IGDA 2B39A 2EOTA 3HS0C 2JEAI 4F87A 2Q8RE 1Q90A 2F3VA 3BDCA 1WTQA 1QB5D 5JVG3 2JE6I 1EZ6A 4EGVA 4RKBA 2EZVA 5C0XH 2A6HC 5CV8A 2N88A 1D5XC 4FF1A 1X32A 3D4DA 1H9MA 2L12A 3A8JE 4PMWA 5A2QL 2A68D 2G9HD 5IT9L 1K83B 3OMGA 4HN7A 5CV6A 1PMRA 3FDTA 2A73B 4G7ZC 2LY7A 5JEAG 4QB4A 3X3MA 2B2TA 3P7JA 3ND9A 1BDOA 5C5LA 4FXGC 2X6LA 3SVMA 5I6YA 2O4XA 3FRPB 4DGZA 2OEOA 1D2BA 1OXTA 1I4PA 3E5SA 3DEOA 5I6WA 4KJNA 2F0SA 1EY4A 2DN8A 3FMCA 4KD4A 3VYSA 2PO4A 1ILPA 1HHVA 3H94A 3Q22A 4KY7A 5M3MB 4OO1G 4IFDH 2D9UA 3G7LA 2Z8LA 4KKSA 3K57A 3QG1A 1GHJA 2JEBI 2JYOA 3PO3B 1A15A 2F0GA 3MFYA 3HOWB 1UUPA 3Q0AA 4KY6A 3BDLA 1TWHB 1XTCD 2F0PA 2BDOA 5DEHA 5I2XA 1GUTA 2ID0A 4A3BB 3KUPA 4KKTA 4F88A 5F2DA 2KVMA 2B2UC 4WFN3 1T5XD 1BO0A 2BCOA 3DEPA 4ME5A 3PUWA 5C0XG 3K5OA 1SFOB 1LTAD 1Y8PB 2F0JA 2VNUD 2MHVA 5KYIA 1B9MA 2EYHA 3A7LA 3UI2A 3TBIB 3J7YW 2L0CA 1STHA 5C6AA 2L4NA 3GP7A 3OIPA 2EXZA 4XQJA 2BDNA 2NZ1D 1U9RA 3KLRA 5HGTA 2PZUA 2Z1CA 4PMCA 2NBFA 1X3PA 4X3SA 3BVMA 3L7ZC 4XYOA 4A3JB 2HQEA 2F0DA 1BCPC 3T53B 1PDQA 2WKDA 4OIJA 1U4LA 3LWEA 1QILA 3PIP3 4K5VA 1LTID 5D3DA 1BOSA 1EQTA 1CI3M 4OO1H 1HA5A 1O7LA 1WTOA 3M85A 3I90A 4S3SA 1D1IA 5DM73 4C3JG 3V05A 1Z6HA 2F0LA 4ID6A 1KLUD 1EL0A 3CRLC 3H3VC 4RWSC 1A6XA 2V4DA 5I9PA 3ERQA 2IX1A 4ODGA 1JICA 2R92B 5CV9A 4IALA 3RD4A 1PYWD 1LACA 5EPLA 1A2TA 4B9WA 4C3HB 5KYLA 2QCPX 1HPCA 2DY7A 3SK4A 4BY7B 1YNJC 4HSVA 3M3YB 4FF3A 1YNJD 4UDUC 5T1IA 3R3OA 3R8BA 1U4MA 2HDMA 4H7BA 2PW5A 5CBEE 3M4OB 1F9PA 3GTMB 1GHKA 2AQ1B 1GOZA 2SOBA 3I4NB 1SNCA 2DNCA 2KEDA 4ZAIA 1DD2A 3M7NA 5C4ZA 3J7AF 5KNBA 5K36G 4N9TA 1EZ8A 1SNPA 2C5CA 1R4PB 3G6JB 2QEJC 3R2IA 1XYIA 1ENFA 4XDXA 2F0KA 1QCBD 1GJXA 5E4WC 2K32A 1HUMA 4TQUS 1SYBA 2WACA 1I6VC 2FHTA 1QOHA 4LK1C 2ZXOA 3I70A 5KNCA 1EY7A 3HOXB 5D14A 3P20A 3QWNA 2Z4HA 2FFKB 1DJRD 4V0BA 4FNFA 2SEBD 5IGEA 3MXNA 4BY1B 3D4WA 3BDOA 1S4ZA 1V1PA 3K5MA 1SNMA 1HTLD 2YU9B 1G6ZA 2B2VC 3HOUB 3E0JA 1FD7D 3SR1A 4FXDA 2NVQB 5FO9B 4OGQC 4X3KA 4A3IB 1ZEQX 1HQRD 3S2DB 1XWEA 4DU9A 4C1NI 3A7AB 4RCOA 2CHBD 1SNQA 4OIKA 1HTPA 3NBIA 1EY9A 1LTGD 1EU4A 2WAQB 2K05A 1TU2B 4G4KA 4BBRB 4C3IB 1VDZA 3V2TA 1B44D 4L63B 3K0YA 1AW7A 2B2YA 2F0NA 1PZJD 1BBXC 3WOFA 3BYYB 4TRDA 1GUOA 5JAVA 3IFDA 4HSPA 5ELBA 2YYZA 4OHJA 3Q24A 1B53A 4O1NA 1KTKA 1ENCA 3QB3A 5C3EB 4WORA 1EQVA 1R9TB 5LL6X 1GUGA 4C2MB 1STGA 1TWCB 2JXMB 4K8IA 4IZ8A 1SDFA 1TS4A 1RODA 4F7XA 2RSNA 1F2LA 1O7ZA 1UNSA 3M4YA 5JPNC 5JOBA 4DXGA 2FINB 1Q8IA 2B2WC 4E6IA 2IJ0A 4IURA 5M9OA 3NXWA 3VA7A 5A35A 1WTXA 2NUCA 4I7ZC 4IUUA 2VUMB 2EY6A 1A2UA 1IW7C 3TMEA 2WB1B 1GUNA 3T56B 4I65A 5I9OA 3FPPA 2PW7A 5KNDA 4KN4C 4EQPA 2C9OA 1EEID 3S15B 2WKCA 4TKOB 1NAPA 5E4XA 1S5FD 1SE3A 3MTSA 2HCIA 3MWYW 1KNEA 2AQ2B 3J7AV 1QNUA 2KEEA 1SSOA 3GTOB 1LTTD 2XN9C 3J80E 1CQVA 4KI0A 4YIJA 1I4QA 1BF4A 2F0TA 5KIXA 1PZKD 2XRQD 2A6EC 4EQNA 3VR4A 1HUNA 1ZKOA 1HCZA 5CV5A 5J1ZA 2B2WA 3VR6A 3AU7A 5CR3A 1SNOA 2L9HA 3D31A 5FO8B 2PQEA 2AUJD 4Q0FA 4TSSA 1AP0A 4DNRB 3VA5A 1FGBD 5C3WA 3NUCA 2IT1A 3QJYA 2Y0SB 3I72A 5EKKA 1LTRD 3SK8A 3K58A 3VYUA 3QOLA 1BCPD 1IKLA 3GTPB 3T51B 1JR0D 4RFBA 1S5DD 2L1BA 1SE2A 2BA1A 1XX8A 3KK7A 5C4HA 2NVTB 3MXPA 4RKLA 4RGNA 2EYMA 5C3XA 1EU3A 3D6WA 3S14B 2JP1A 4RGMA 3D6CA 1JCKB 4HMIA 3I91A 2G9DA 4F8MA 1PRTF 3DHQA 3JAML 3GD7A 4A93B 4XTCS 2BA0A 2JA7B 3CKIB 3RMHA 4DK0A 2H1EA 3SXHA 2M00A 1AFPA 1FR3A 3FPUB 1WTPA 5DAUA 3VYTA 1SE4A 3OIQA 1S5CD 1SYGA 1TR5A 2VB3X 4R8NA 4XT3B 2JSOA 2HCCA 3HOZB 5M3FB 3CHBD 1EY8A 1EYCA 3K5LA 3NHHA 1ZYRC 3T4AC 4ZUIA 5CGKA 4RGTA 3I4LA 5ELCA 1D6EC 3KLSA 1Y1VB 3NP8A 1DXMA 1D5MC 3OWFA 3TDQA 1V1OA 3MC0B 3L9AX 1KNAA 4H13C 1CHPD 2F4IA 4ILWA 2E2IB 2FMCA 5D65A 2AQ3B 3P75A 5IODA 3LWUA 1I4RA 3EJIA 4JK1C 1CM9A 3C2PA 1CZWA 4N9PA 3C1EA 1V8QA 5T1GA 1MSGA 1WVLA 1AEXA 1Q1EA 1EOTA 1PFMA 5EKIA 1ICWA 2K1BA 4IFDJ 5C4JB 1KAAA 1LV9A 5IGCA 4ZLTF 3S2HB 1Y69U 1Q3LA 2F0FA 3NK9A 1H9SA 4DAYA 1RJTA 3A55A 1B3AA 3SK6A 1BNZA 3I3CA 1CA5A 3N52A 3OHXC 4A3GB 2JA5B 4B08A 3GQBA 2QDBA 1EYDA 3I8ZA 1X3QA 4M1UB 3I4MB 2E75C 5EPKA 4MN3A 5FKAC 4HCEA 2O5JC 1SXTA 5IGGA 3J81L 3OSOA 3A56A 1OO9B 5EQ0A 2EYOA 4FF2A 1DOLA 4Q5VA 2RDHA 1EIHA 5M5WB 4X3UA 5G3LF 3HZXA 4QUCA 2NVXB 4G7HC 4OO1I 1Q12A 1D5ZC 4ZYSA 1QG7A 1A3VA 1LO5D 4XXEA 2F0QA 1DZ1A 4XIGS 4U673 4WRDA 4DAVA 1PTOF 3PMFA 2EJGC 1PLFA 2NN6G 3DWPA 3SHLA 2D5DA 1ENAA 5K5PA 1SJHD 4NP5A 1JORA 1SYDA 4V190 3TP8A 1PTOB 4K6DA 2I07B 3P1HA 4K14A 3BVZA 1WD1A 3GTJB 1AZPA 1NUCA 1RCVD 1PTOD 3GO5A 4C3IG 2VXWA 5M5YB 4QF4A 3K59A 2XWBB 2B2YC 1ONLA 1IW7D 2MJ8A 5I2YA 1V1PB 1HXYD 1FNWA 4PQXA 3D3RA 2Z4IA 2R7ZB 5J39A 2F0VA 4A3KB 2JA8B 3SK5A 1EEFD 4DXFA 2EY2A 2RDFA 2CQAA 2A6HD 3OWEB 5BN5A 3AMUA 2D62A 2A69D 3EA6A 2QF7A 2IX0A 3VYRA 4O42A 4J6HA 1JE4A 2A69C 3IAYA 3DWQA 1RD9D 4C1NK 4DNTB 4PMBA 4PNYA 2PZTA 4HAEA 1V43A 3HG9A 4RH6A 4HEDA 4DF7A 1TWGB 5FLXE 1YNNC 4BS9A 1EFID 1II3A 3RUZA 4K5XA 4ZKBB 2J4XA 4IFDG 2F0OA 1KDAA 1YNND 5LL6S 5C44B 1WTVA 5CC4A 5KRUA 4ZK9B 3S1RB 2E2HB 2F0UA 1G2SA 4KMUC 2B2VA 1PXUA 2IW3A 2OF1A 1T5EA 1PTOC 3FKIB 5D3IB 2ICIA 2XWJB 4IUVA 3NSWA 4L8JA 1DYQA 5JPMC 5IGFA 3CU7A 3BZDB 3J80L 3PO2B 3R2TA 3NTHA 1EIGA 3PUXA 1D1KA 4RHSA 3QIAA 2TMPA 4XQNA 4KD3A 1G91A 4K5WA 3TN2A 1HFNA 1E2WA 2L55A 3T16A 1ZXTA 3HOYB 2HUGA 3TP6A 2CW0D 3A8KE 1LABA 1MBYA 1UAPA 3M7GA 4J8QA 2N55A 1DOMA 4HCSA 4K2LA 5FLXL 3GTGB 1LT4D 2FMMA 3NWTA 1JOQA 5IOCA 5ISRA 5NUCA 1LTBD 4MHEA 4CKCA 1LT6D 2RA4A 1TY2A 3NE5B 3DWAA 2B2UA 1VCIA 3Q23A 1VF7A 1G2TA 4WJWA 1A3TA 5JEAJ 2QKIC 4C56C 4EVOA 1KDCA 2EE1A 5COYA 2Q8IB 1PRTC 1L0YB 4H44C 1ESFA 1IKMA 2DNEA 1LLRD 1I6HB 2ZT9C 4ZRZA 1F2MA 1NR4A 3H09A 3C46A 5CBAE 2SDFA 3W2DA 1C4QA 4J1MA 4QUFA 1L0XB 4QMGA 5IT9E 5EPJA 1SEBD 1GUSA 1KLGD 1RHPA 1OXVA 5FK9C 1I4GA 4KHZA 2PPBC 2E76C 2F0WA 1EY6A 2F3WA 3S1NB 2BOSA 1JC7A 1JWMD 2MPMA 1E2ZA 5JJZA 1TKWB 2K28A 3BS1A 5BN3A 3S1QB 1BR9A 1TY0A 3LX0A 5E3FA 5C0XJ 1DM0B 1RF2D 2KCNA 3KF8A 3MEHA 4FO2A 4AYBB 2F0IA 5EBCA 3LNNA 2NTTA 3DUZA 5CORA 1CA6A 4NW2A 4QCLA 1MI2A 1JB3A 3T13A 3OW7A 2MGSA 2XNAC 4A3EB 1TVXA 2EYPA 3ND8A 4BWGB 2EJFC 3VR2A 2K03A 1JWUD 3AB9A 1M8AA 1K8OA 3MZ5A 1Y1WB 5AFWA 3L3OC 4CJ1B 1VF5C 2F03A 1S5ED 3OMCA 2K04A 2RBMA 5A2QE 1STYA 4A3FB 2NTSA 1EWCA 1K8MA 5DNFA 1H9JA 2K01A 2K7VA 1H9KA 1KABA 2KCCA 1FYCA 2A74C 1HFGA 3A54A 4B9XA 2RKSA 3NPPA 5G3LD 3HEJA 4CHTB 4G57A 2L5TA 3EROA 2RDGA 4IUTA 3NQTA 2K5DA 4MIUA 3EVQA 4Y7NB 2SNSA 1SAPA 2O2LD 1FNUA 1I50B 3MA2B 1SNDA 2E2DC 2VB2X 1AN8A 3C3LA 1HA6A 2F0EA 1F9RA 2B8GA 3F2UA 2R61A 3CQZB 1LT5D 1STEA 2XRSD 2IWHA 2CVRA 3VR5A 3SEBA 2D2CC 4CKBA 1IL8A 2A6ED 4IFDI 1M4VA 2B8FA 4NDXA 1W6KA 3DMUA 4KKUA 5CYUA 1W6JA 1OXSC 4R8IA 1EY5A 3W3AA 1STBA 2WIIB 3K5NA 2WINB 4P2CB 2EYLA 3K6OA 1I3QB 1WCMB 3HKZB 1U4RA 3S17B 5CV4A 1IYVA 1FNVA 2K6AA 1CHQD 1DCZA 2LFNA 2KOLA 1STNA 3CRKC 1TIID 5E1FA 1BXTA 4Z9CB 1PRTD 1F2YA 5EJWA 2E2JB 3MXUA 3H0GB 2XIWA 2EJMA 2F1MA 3DM1A 2ZXPA 4IUQA 1BUVT 1IYUA 1PZID 2FJ2A 3TP5A 4RGOS 4IN3A 1DOKA 1XXGA 3HRZC 1QNKA 3V96A 2EYJA 4FVMA 1CZGA 2R93B 4X3TA 1BCPB 2L11A 1F2ZA 4C3JB 3I73A 3BVGA 2K5WA 3BYTB 4A3MB 4IUPA 1SMYD 3KLSX 2NVYB 3D8GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H9R A;  2BDO A;  3T56 B;  1A6X A;  2V4D A;  1Q1E A;  3DXJ C;  2NN6 H;  3SDZ A;  2JEA I;  1GUT A;  1Q90 A;  2A6E D;  2DNE A;  2EVB A;  2B8F A;  3FPP A;  2KA7 A;  1Z7T A;  4KKT A;  5KND A;  1LAC A;  4DK1 A;  2JE6 I;  4L8J A;  4KKU A;  3A7A B;  1HPC A;  4KN4 C;  3ND8 A;  2PCF B;  1HTP A;  2EJF C;  2ZT9 C;  3VR2 A;  5C0X H;  1OXS C;  2A6H C;  2R6G A;  1TU2 B;  3W3A A;  1Y69 U;  3AB9 A;  1YNJ C;  3BG3 A;  5BN4 A;  1H9M A;  1K8O A;  3A8J E;  4TKO B;  2A68 D;  3GD7 A;  1VDZ A;  3PUW A;  4XTC S;  3RLF A;  2BA0 A;  5C0X G;  3OOC A;  2AWO A;  1VF5 C;  1ONL A;  1IW7 D;  1H9S A;  1E2V A;  1SMY C;  4KN7 C;  3WDN A;  1PMR A;  3IFT A;  2NN6 I;  3PUX A;  4DK0 A;  1Y8P B;  3QIA A;  4G7Z C;  1GUS A;  1IYV A;  5JEA G;  2EDG A;  1FR3 A;  1GHK A;  1GUO A;  1OXV A;  4IQZ A;  1HQM C;  2A68 C;  1OXU A;  2DNC A;  2PNR C;  1E2W A;  3GQB A;  3ND9 A;  1BDO A;  1B9M A;  3A7L A;  4KI0 A;  5JEA H;  3M7N A;  2YYZ A;  5K36 H;  3U9S A;  2BE5 C;  1DD2 A;  1Y8O B;  5KNB A;  1DCZ A;  5K36 G;  2E75 C;  1K8M A;  1H9J A;  2A6H D;  2E74 C;  4KHZ A;  5BN5 A;  2A6E C;  3CRK C;  2PPB C;  1OXX K;  1B9N A;  1OXT A;  2AUK A;  2E76 C;  1H9K A;  1LAB A;  2K7V A;  2KCC A;  3A8K E;  3OPO A;  4HR7 B;  3VR4 A;  2K33 A;  3VR3 A;  2O5J C;  3IKJ A;  1FYC A;  3EQL C;  4BA1 I;  1ZYR C;  4H0L C;  2D62 A;  2A69 D;  3KLR A;  1ZKO A;  2QF7 A;  1EWH A;  3MXU A;  1HCZ A;  1GUG A;  3I4L A;  3SE0 A;  1GJX A;  2K32 A;  3PUZ A;  4GZY C;  3VR6 A;  1E2Z A;  3A8I E;  4TQU S;  4LJZ C;  1TKW B;  4JBW A;  1I6V C;  2A69 C;  2DN8 A;  2L5T A;  4LK1 C;  2JXM B;  3L7Z C;  5KNC A;  3FMC A;  1DXM A;  1G29 1;  2EJM A;  4DNT B;  2F1M A;  3P20 A;  5BN3 A;  4G7O C;  4H13 C;  3T53 B;  3D31 A;  2AUJ D;  3H94 A;  1V43 A;  3D4R A;  3N6R A;  3NE5 B;  3PUY A;  3M4Y A;  4DNR B;  2O5I C;  4OO1 G;  4G7H C;  4RCN A;  1IYU A;  4OO1 H;  2IT1 A;  1CI3 M;  1VCI A;  1YNN C;  3QJY A;  1VF7 A;  1Q12 A;  1O7L A;  3I72 A;  4IFD H;  3PV0 A;  3TZU A;  3LWU A;  3LNN A;  3HGB A;  4IFD G;  1CFM A;  4PV1 C;  3M85 A;  2B8G A;  4KKS A;  1H9S B;  4JK1 C;  1Q1B A;  2BE5 D;  3BDO A;  3VA7 A;  3QG1 A;  1GHJ A;  2JEB I;  3PUV A;  1O78 A;  4XIG S;  5A35 A;  3MFY A;  2LMC B;  2CW0 C;  3I73 A;  3T51 B;  4BA2 I;  4I7Z C;  1Z6H A;  1CTM A;  1IW7 C;  3CRL C;  2Q8I B;  4KMU C;  2BA1 A;  2EJG C;  1V8Q A;  1Y8N B;  3VR5 A;  2NN6 G;  3OW7 A;  2D2C C;  1GUN A;  2D5D A;  1T5E A;  4OGQ C;  4H44 C;  1QJO A; 
#chains in the Genus database with same CATH topology
 2ICE C;  2XVS A;  1P16 A;  3H0G G;  2B63 B;  1PH3 A;  1AE2 A;  4CJ2 C;  1JOO A;  1S3O A;  4NKL A;  4P74 A;  1MGS A;  4DK1 A;  3MHB A;  3H6M A;  1SE8 A;  1SJE D;  1U4P A;  1MSH A;  3MVV A;  4R9W A;  2PCF B;  1ASZ A;  5IGB A;  3CCQ A;  1A3U A;  4PZ8 A;  2AHO B;  1I94 Q;  2Q8T A;  1K3B C;  2H4O A;  3BG3 A;  2ZXR A;  2K52 A;  3JAM i;  4A3L H;  1ESR A;  3TP7 A;  4A3D B;  2IPK D;  5M5X B;  4KK7 A;  1CUK A;  1TWA B;  4N8F A;  4CGY B;  5J3B A;  3PIO 3;  4OON A;  2PZW A;  1TWF B;  3ONA B;  2EDG A;  1PFB A;  4O0A A;  1HRJ A;  3PSI A;  3FVQ A;  4UHV A;  1NCV A;  1W3S A;  4IQZ A;  1OXU A;  5JEA H;  3EBE A;  1Q7Y C;  1O80 A;  3CCE A;  1JQY D;  2EY5 A;  4RAU C;  1SBB B;  1B9N A;  1JWS D;  3VR3 A;  4BBS B;  2K33 A;  3LGJ A;  1VMC A;  3EQL C;  4GNX A;  4H0L C;  1JOK A;  4YCU A;  3X3N A;  3PUZ A;  5KGU A;  2JA6 G;  1BBU A;  1R4Q B;  3KJP A;  2QEX A;  3GTG H;  1DON A;  2D0O A;  2PQA A;  3U9O A;  1HZB A;  2KHS A;  3CC4 A;  1WTR A;  4OXP A;  4M8A A;  5CV7 A;  3URY A;  3HP3 A;  2ZTD A;  1ET9 A;  4RCN A;  4DN4 M;  3TEH B;  1GM5 A;  3I4M G;  2RQX A;  3S17 H;  1TQO A;  1A63 A;  2JA9 A;  3HGB A;  1IHZ A;  4N8X 1;  4CJ0 B;  5C4X B;  1Q1B A;  3PUV A;  1L1O A;  1RDP D;  4BXX G;  3PO3 G;  4ZKC B;  2EY1 A;  1BQQ T;  4K2K A;  1WTW A;  2R3Z A;  1CTM A;  1X6O A;  1J9O A;  1RTN A;  4GOP B;  3W1G A;  1EIY B;  2F3I A;  1H9R A;  2M2L A;  4HTH A;  2QIL A;  1TS3 A;  2NB0 A;  4LAA A;  4A3M H;  2NN6 H;  1KDB A;  3GTL B;  2UXD L;  1G8Z D;  1NSN S;  1RIP A;  1F77 A;  5E7N A;  1I4X A;  5KEE A;  5TSS A;  3STB D;  2UUB L;  2K5V A;  4XYQ A;  1QUQ B;  3MFG A;  4DV5 L;  3HOV B;  2AWN A;  3JC6 6;  5BN4 A;  3CAM A;  2NYZ D;  4DA2 A;  4A3I H;  4ZQ3 A;  3B6Y A;  3GTK B;  3PF5 A;  3RZD B;  1BCP F;  5HUR A;  1SYC A;  3J81 E;  1E2V A;  4KN7 C;  2MP1 A;  3O13 A;  5J22 A;  4A3E H;  2RCF A;  2F0M A;  5C44 H;  2A8V A;  3GV6 A;  3T1Y L;  1ET6 A;  2RSO A;  3I4M H;  2TSS A;  4KJO A;  2EPB A;  1Q8K A;  1XPO A;  1YHB A;  1SYF A;  4OWX B;  1B2T A;  1C7Y A;  5K36 H;  3TZD A;  1EYA A;  1Y8O B;  4C2M H;  4HIO A;  1QE6 A;  1KC8 C;  2ZTC A;  2AUK A;  2NWG A;  1TT2 A;  5DM6 3;  2GN5 A;  3IKJ A;  2EYF A;  2HDL A;  5FOB B;  1HNX Q;  2E5L L;  1VQN A;  1GXD C;  1X3G A;  2WV6 D;  2IX3 A;  4L6T B;  4DR1 L;  3NTK A;  2A19 A;  3S16 B;  4GLA C;  1CK1 A;  3BZK A;  2I46 A;  3GTJ H;  1VMP A;  4G7O C;  4GKK L;  3BJU A;  3PUY A;  3NQI A;  1NMG A;  4YHH Q;  1RTO A;  3S1M B;  3S9W A;  2KQ3 A;  5EBD A;  1VQL A;  3S1M H;  1EFW A;  3Q6S A;  1Z47 A;  4EQO A;  4PV1 C;  4K8J A;  4GN5 A;  2OT2 A;  5IWA Q;  1L2F A;  1O78 A;  3H3V I;  2LMC B;  2K14 A;  2CW0 C;  3J7Z C;  4OL7 A;  2KJX A;  2ZJR A;  4AQY L;  1MD2 D;  4HMJ A;  5IP9 H;  4DR5 L;  2ZJQ A;  3C1F A;  3KFU A;  1RKN A;  4GNX C;  5L37 A;  1HZA A;  3FEW X;  4A4I A;  1PTO H;  1EY0 A;  1IBM L;  1JJ2 A;  3DXJ C;  3SDZ A;  3JAM E;  1PHJ A;  2K5Q A;  1K83 H;  2Q2I A;  4DK6 C;  1HR0 L;  4WJ3 M;  2KA7 A;  5EAY A;  3HKZ G;  5I4D A;  3I55 A;  3IL8 A;  1VQ9 A;  1B70 B;  2B2T C;  4LF6 L;  1AZQ A;  3EFX D;  2OXP A;  3WOE A;  2R6G A;  4ABN A;  1ILQ A;  3ITP A;  3R93 A;  2PMZ E;  3KBG A;  2JA5 G;  2B3G A;  2IL8 A;  4LMQ D;  2PMZ B;  5ELD A;  3RLF A;  2WAQ G;  3RZO B;  4A3M G;  1K0S A;  2AWO A;  1E0B A;  3F2C A;  2A5H A;  3WDN A;  2X6G A;  4IJL A;  1L0W A;  3OYY A;  3MXG A;  1GUW A;  2CH4 A;  2IHE A;  4GOP A;  5EGT A;  3I4N G;  5JVH 3;  3K7A B;  3U9S A;  2BE5 C;  1LTS D;  4FYD A;  2X69 A;  1L1O B;  4DUZ L;  1NE3 A;  1WD0 A;  1QVC A;  4NXN Q;  1OXX K;  1AH9 A;  2F0H A;  4HR7 B;  4P73 A;  1F9Q A;  2I5L X;  3BZC A;  2GA4 B;  1TWC H;  4BA1 I;  5C5M A;  2I5M X;  3KBX A;  2DY8 A;  1F9S A;  1YEZ A;  3QOJ A;  3SE0 A;  4JI2 Q;  3M3Y H;  3A8I E;  4LJZ C;  4P72 A;  4JBW A;  2ALY B;  3TSS A;  4DAP A;  4QIW B;  4GOP C;  1PFN A;  3CXC A;  3W5O A;  1G29 1;  2JA6 H;  1FVI A;  3ULP A;  3NTI A;  2KEC A;  1Q82 C;  4A3D G;  2MUY A;  4RA8 A;  3D4R A;  3N6R A;  3KJO A;  5ELO A;  4Y7N H;  2WP8 J;  4DV1 Q;  2M9V A;  1ML0 D;  4GLX A;  1CT1 D;  4FP5 D;  4XQQ A;  2RVL A;  3HOY G;  5FLM G;  1K0R A;  4U68 A;  4A3G G;  1C8C A;  3PV0 A;  3TZU A;  2Y0S G;  4JYA L;  1TS5 A;  1STA A;  4KY5 A;  1H9S B;  1S5B D;  1C9O A;  4BY7 H;  4LF6 Q;  1T9H A;  2KCT A;  3PGZ A;  4RHR A;  1X9N A;  1I4H A;  1UE6 A;  1E3P A;  3GTQ B;  4PZ6 A;  1Y8N B;  1ZYR D;  2JA8 G;  4CKE A;  5GAH C;  4A3L G;  2EVB A;  1QWY A;  4R4Q A;  2VL6 A;  1Z7T A;  5C0X I;  2ENB A;  4K6L A;  4ULL A;  3K7A H;  5FO7 B;  4FXK C;  4WJ4 A;  1R9T H;  1SYE A;  1VQ7 A;  3E6Z X;  4KV6 A;  5EKL A;  1XPU A;  1LT3 D;  4CBV A;  1A62 A;  4UAI A;  4IPH A;  3TS0 A;  1O7Y A;  3H0G H;  2J7Z A;  1B1Z A;  3OOC A;  5CMD A;  4KHV A;  1SMY C;  4DFA A;  2J0T D;  3I2Z A;  3IFT A;  2NN6 I;  1GVP A;  1X56 A;  4ZUJ A;  5ELF A;  4IO9 A;  3GV3 A;  3KYH C;  1B50 A;  3SGI A;  4A3F G;  1VQE A;  2JA8 H;  2JA6 B;  5ELE A;  3I4O A;  1MIU A;  1HQM C;  2A68 C;  2PNR C;  4DUY Q;  1NR2 A;  1K3R A;  5LHY 1;  3U4Z A;  2E74 C;  5FLM H;  3RN2 A;  4XT1 B;  3OW2 A;  4OEM B;  4JBK A;  1C0A A;  3OPO A;  2SNM A;  2XSC A;  3H91 A;  3PIO A;  1PFS A;  5M5Y H;  1EWH A;  1YI2 A;  1CSQ A;  3FKI G;  4B3M Q;  4GZY C;  3MAQ A;  1MJC A;  2LKV A;  3EN2 A;  4KTA A;  3QO2 A;  1BVS A;  1J5E L;  4R1J A;  4IPG A;  4C3H G;  4FF4 A;  3U4V A;  4MNO A;  1AE3 A;  2N8N A;  1B4O A;  2LS0 1;  2O5I C;  3KF6 B;  4DAM A;  2XTI A;  2PYK A;  1X3F A;  3ZYY X;  2F4V Q;  4NMZ A;  1PRT B;  3NWS A;  1I50 H;  2MO0 A;  4GKK Q;  1CFM A;  4B3M L;  5JJL A;  2KUM A;  1E1O A;  1UEA B;  1NJI C;  1TS2 A;  2BE5 D;  4OX9 L;  4IUN A;  1CQF A;  3PO2 H;  1SRO A;  2OQ0 A;  4BA2 I;  4MTK A;  1VQK A;  1C48 A;  5IIF A;  5IE8 A;  3NBH A;  1J8I A;  1QJO A;  5IGD A;  2B39 A;  2EOT A;  3HS0 C;  2JEA I;  4K0K L;  4F87 A;  2Q8R E;  2ZM6 L;  1Q90 A;  2F3V A;  4DR2 L;  3BDC A;  1WTQ A;  4DR5 Q;  1QB5 D;  5JVG 3;  2JE6 I;  1EZ6 A;  4EGV A;  4RKB A;  4LF8 L;  2EZV A;  4NXM L;  2R93 G;  1L1O C;  5C0X H;  2A6H C;  5CV8 A;  2N88 A;  1D5X C;  3PCO B;  4FF1 A;  1Y1W G;  3KF8 B;  4A3K G;  1X32 A;  3D4D A;  1H9M A;  2L12 A;  3A8J E;  4PMW A;  5A2Q L;  1EIF A;  2A68 D;  2G9H D;  2PQA B;  4L5T A;  2UU9 L;  4LFA Q;  5IT9 L;  1CKN A;  1PH1 A;  1PH9 A;  2UXC Q;  4DR7 Q;  1E1T A;  1K83 B;  3OMG A;  4HN7 A;  5CV6 A;  1PMR A;  3FDT A;  4ALP A;  2A73 B;  4JI4 Q;  4G7Z C;  5GQO A;  2LY7 A;  4CDE C;  5JEA G;  4QB4 A;  3X3M A;  4BY1 G;  4YY3 L;  1QUQ A;  2B2T A;  3CCJ A;  4NXM Q;  1VQA A;  3P7J A;  2DUD A;  3ND9 A;  1BDO A;  5C5L A;  2N78 A;  2X6L A;  4FXG C;  5I6Y A;  3SVM A;  2O4X A;  4LF4 L;  3MEF A;  4UPA A;  4EQ5 A;  3FRP B;  1N36 L;  4DGZ A;  2OEO A;  4DV0 Q;  1D2B A;  1S40 A;  1OXT A;  1XMQ L;  1I4P A;  5H1S E;  3AYH B;  3E5S A;  3DEO A;  1VQC A;  4DNI A;  5I6W A;  4KJN A;  3S1Q H;  2NVX H;  1LYL A;  2F0S A;  1EY4 A;  4NXN L;  2DN8 A;  3RR5 A;  3FMC A;  4KD4 A;  3CCM A;  3VYS A;  2CFM A;  2PO4 A;  3CME A;  4JI5 Q;  1ILP A;  1HHV A;  3H94 A;  3Q22 A;  1PYB A;  4KY7 A;  2ZJP A;  2Z6B A;  5M3M B;  2PI2 A;  4OO1 G;  2WAQ E;  1EOV A;  5LMU L;  1H95 A;  1SLJ A;  4K0K Q;  4KLK A;  4IFD H;  2D9U A;  3G7L A;  2Z8L A;  4KKS A;  3K57 A;  4UY8 C;  3CD6 A;  3QG1 A;  1GHJ A;  2JEB I;  3BU2 A;  2JYO A;  3PO3 B;  1A15 A;  1XPR A;  2F0G A;  3MFY A;  3HOW B;  1UUP A;  1CSP A;  3G71 A;  5C44 G;  3Q0A A;  4KY6 A;  3BDL A;  1TWH B;  4DV7 L;  1XTC D;  2F0P A;  2BDO A;  5DEH A;  5I2X A;  1GUT A;  4JI4 L;  2ID0 A;  4A3B B;  5M3M G;  3KUP A;  4KKT A;  4DAY B;  4F88 A;  2R7D A;  5F2D A;  1PV4 A;  2KVM A;  2B2U C;  4WFN 3;  1T5X D;  2QW7 A;  4LFB L;  2OTL A;  1BO0 A;  2BCO A;  3DEP A;  4LF5 Q;  4LF7 Q;  4ME5 A;  3PUW A;  4DR1 Q;  5C0X G;  3S16 H;  3K5O A;  1SFO B;  2HIX A;  1LTA D;  4DV6 Q;  3J7A 5;  1XNQ Q;  2CQO A;  4A3J H;  1Y8P B;  4DR2 Q;  3AEV A;  2F0J A;  2VNU D;  4X64 Q;  2MHV A;  5KYI A;  1VQD A;  3NBH B;  1D8L A;  2E5L Q;  1B9M A;  2EYH A;  3A7L A;  3UI2 A;  1U0L A;  3TBI B;  3J7Y W;  2L0C A;  1STH A;  5C6A A;  1EQQ A;  2L4N A;  5M3M H;  2VW9 A;  3GP7 A;  2VQF Q;  1W2B A;  4A3C G;  3OIP A;  2EXZ A;  2UUA L;  4YWK A;  4XQJ A;  3RLO A;  2BDN A;  1N8R C;  2NZ1 D;  1U9R A;  4YWL A;  3KLR A;  5HGT A;  2PZU A;  4A93 H;  1XJV A;  4JI7 Q;  2Z1C A;  4PMC A;  2CCZ A;  2NBF A;  1E24 A;  2VQE L;  1X3P A;  2QDL A;  4X3S A;  3RZD H;  3BVM A;  3L7Z C;  4XYO A;  5GRO A;  3UE0 A;  4A3J B;  2HQE A;  2F0D A;  1BCP C;  3TRZ A;  1KAW A;  3T53 B;  1PDQ A;  2WKD A;  1HR0 Q;  4OIJ A;  1U4L A;  3LWE A;  1QIL A;  1UEB A;  3PIP 3;  1NNX A;  4DV4 Q;  1MHW C;  4Y52 H;  4K5V A;  1LTI D;  5D3D A;  1BOS A;  1EQT A;  1CI3 M;  4OO1 H;  1FJG L;  3S24 A;  3FKI H;  1HA5 A;  1O7L A;  1HR0 W;  1N33 L;  1WTO A;  2NVY H;  3STB C;  3M85 A;  3I90 A;  4S3S A;  1D1I A;  5DM7 3;  4C3J G;  1E22 A;  1I94 L;  1J5E Q;  3V05 A;  3FP9 A;  1Z6H A;  2F0L A;  3OTO Q;  4ID6 A;  1KLU D;  1EL0 A;  3CRL C;  4DPG A;  3H3V C;  2PNH A;  4DR3 L;  2V1C C;  3M4O H;  4RWS C;  4OX9 Q;  1A6X A;  2V4D A;  1MKH A;  5I9P A;  1NBW A;  3ERQ A;  2IX1 A;  4ODG A;  1JIC A;  2R92 B;  5CV9 A;  4IAL A;  2ASB A;  4ME3 A;  3RD4 A;  1PYW D;  1LAC A;  5EPL A;  1A2T A;  4B9W A;  4C3H B;  5KYL A;  2QCP X;  1HPC A;  1NMF A;  1SRU A;  2DY7 A;  3SK4 A;  2F4V L;  4BY7 B;  1YNJ C;  4HSV A;  3M3Y B;  3T1H L;  3ULJ A;  1X55 A;  1TXY A;  4FF3 A;  1YNJ D;  4UDU C;  5M5W H;  5T1I A;  2JJQ A;  2VY3 A;  4OWW B;  4A3K H;  2C35 B;  3R3O A;  3R8B A;  1U4M A;  2HDM A;  4H7B A;  2PW5 A;  5CBE E;  3M4O B;  1F9P A;  3GTM B;  3S15 H;  2CH4 W;  2B63 G;  1GHK A;  2AQ1 B;  1GOZ A;  2SOB A;  4QY7 A;  3I4N B;  1SNC A;  2DNC A;  2KED A;  4ZAI A;  1DD2 A;  3M7N A;  5C4Z A;  3J7A F;  5GAE C;  5KNB A;  5K36 G;  2L15 A;  4JI2 L;  4N9T A;  4PZ7 A;  1EZ8 A;  2DGY A;  1SNP A;  2C5C A;  4LNQ A;  3S14 H;  2DJF C;  1R4P B;  3G6J B;  2QEJ C;  1YJN A;  3R2I A;  2Z9H A;  2YTX A;  1XYI A;  2QGQ A;  1ENF A;  4XDX A;  2F0K A;  3J80 c;  1QCB D;  1GJX A;  5E4W C;  2K32 A;  1HUM A;  4TQU S;  1SYB A;  2WAC A;  1I6V C;  2FHT A;  1B3Q A;  4DR6 Q;  1QOH A;  4LK1 C;  2ZXO A;  3I70 A;  5KNC A;  2JK8 A;  1EY7 A;  3HOX B;  5D14 A;  3P20 A;  3QWN A;  3Q8D A;  2Z4H A;  2FFK B;  1DJR D;  3K0X A;  3GTM H;  1VQB A;  4UP9 A;  4V0B A;  4FNF A;  2SEB D;  1IBK Q;  1TWH H;  5IGE A;  4MZ9 A;  4GN4 B;  3MXN A;  4BY1 B;  4B3R Q;  3D4W A;  4UP7 A;  3BDO A;  1ICF B;  1S4Z A;  1V1P A;  3K5M A;  1SNM A;  1HTL D;  3CC2 A;  2YU9 B;  1G6Z A;  1U5K A;  2B2V C;  3E0J A;  3HOU B;  1FD7 D;  3SR1 A;  4FXD A;  2NVQ B;  4RG1 A;  5FO9 B;  5ELN A;  3PO2 G;  4OGQ C;  4X3K A;  4A3I B;  1ZEQ X;  1HQR D;  3E9H A;  1XNR L;  4JI8 Q;  1N34 Q;  1DGS A;  5IYC G;  3S2D B;  5M3F G;  1XWE A;  4DU9 A;  4C1N I;  3A7A B;  4RCO A;  2CHB D;  1SNQ A;  3J81 i;  4OIK A;  1HTP A;  3NBI A;  1EY9 A;  1LTG D;  1EU4 A;  2WAQ B;  2K05 A;  1TU2 B;  4G4K A;  4BBR B;  4C3I B;  4BBR G;  1VDZ A;  1VQG A;  3V2T A;  1B44 D;  4L63 B;  3K0Y A;  1B8A A;  1AW7 A;  4YCV A;  2B2Y A;  2F0N A;  1XNR Q;  4A3B H;  2N49 A;  4HJ9 A;  3HFZ B;  1PZJ D;  4DR4 L;  3M9B A;  4CDD C;  1BBX C;  3K80 C;  3WOF A;  3BYY B;  1TWG H;  3H3V H;  3QR8 A;  3A0J A;  4TRD A;  3I7F A;  4DV3 Q;  1GUO A;  5JAV A;  3IFD A;  4HSP A;  5ELB A;  1VS0 A;  1PVO A;  2K50 A;  1WJJ A;  2YYZ A;  1VQ6 A;  4OHJ A;  2K5H A;  3Q24 A;  1B53 A;  4KHP Q;  1IBL Q;  4I7A A;  4X65 L;  3CCV A;  3CW2 C;  4O1N A;  1KTK A;  1ENC A;  3QB3 A;  1B7Y B;  5C3E B;  1QVG A;  4WOR A;  1EQV A;  1R9T B;  5LL6 X;  1GUG A;  5JJK A;  4C2M B;  1STG A;  2YU9 H;  3HOV G;  1TWC B;  4X62 Q;  2JXM B;  4K8I A;  2EXD A;  4IZ8 A;  1SDF A;  4HJ8 A;  4JI6 Q;  3HOZ G;  1TS4 A;  1ROD A;  4AQY Q;  4F7X A;  2RSN A;  1F2L A;  1O7Z A;  1UNS A;  3M4Y A;  4GN3 B;  5JPN C;  5JOB A;  1HNW Q;  4DXG A;  4EX5 A;  4GS3 A;  1YHA A;  3RNU A;  3UDG A;  2FIN B;  2I5H A;  1N34 L;  1WYD A;  1Q8I A;  1Z9F A;  2B2W C;  4E6I A;  2IJ0 A;  4IUR A;  5M9O A;  3NXW A;  3VA7 A;  1HJP A;  2R93 H;  1UE1 A;  2YV5 A;  5A35 A;  3H15 A;  1WTX A;  2NUC A;  4I7Z C;  1Y14 B;  4IUU A;  2EY6 A;  2WB1 E;  1A2U A;  2VUM B;  1KRT A;  1IW7 C;  3TME A;  2WB1 B;  1GUN A;  3T56 B;  4I65 A;  3CC7 A;  2KEN A;  5I9O A;  5IYC H;  1N33 Q;  3UDF A;  4LUO A;  3FPP A;  2PW7 A;  5KND A;  4KN4 C;  1K8G A;  2LSS A;  4EQP A;  2C9O A;  1EEI D;  3S15 B;  2UXC L;  2WFW A;  2LXK A;  2WKC A;  4JVZ A;  1Q46 A;  4TKO B;  4DR3 Q;  5HY6 A;  2UXB Q;  4AYB E;  1K9M C;  3CCR A;  1NAP A;  5E4X A;  4LF9 L;  1S5F D;  4JI8 L;  1SE3 A;  3MTS A;  1VQM A;  4L5S A;  3NEM A;  3T1H Q;  2HCI A;  3A5U A;  3MWY W;  1KNE A;  2AQ2 B;  1JB7 A;  1QNU A;  3J7A V;  3HOU H;  2KEE A;  1SSO A;  3GTO B;  1LTT D;  2XN9 C;  3J80 E;  3S2H H;  1CQV A;  4KI0 A;  4YIJ A;  2MQH A;  1I4Q A;  3MXN B;  1BF4 A;  2F0T A;  5KIX A;  2B29 A;  1PZK D;  2XRQ D;  2YTV A;  3TRE A;  2A6E C;  4EQN A;  4CDC C;  4UP8 A;  3VR4 A;  4R4T A;  2R92 G;  4GKJ Q;  5C4X G;  1HUN A;  1ZKO A;  1HCZ A;  5CV5 A;  5J1Z A;  2B2W A;  3VR6 A;  3AU7 A;  4PG3 A;  1A8V A;  5CR3 A;  1SNO A;  5DLQ E;  2L9H A;  3D31 A;  5FO8 B;  2PQE A;  2AUJ D;  4Q0F A;  4TSS A;  1AP0 A;  1I6H H;  1IBL L;  4R4I A;  4DNR B;  3VA5 A;  1FGB D;  5C3W A;  1N9W A;  3NUC A;  2B63 H;  5LMN W;  2IT1 A;  3QJY A;  2Y0S B;  1PYS B;  3I72 A;  4JPB W;  5EKK A;  1LTR D;  3SK8 A;  2R7F A;  3G48 A;  2HT1 A;  3DLL A;  3K58 A;  3GTP H;  3VYU A;  3QOL A;  1BCP D;  1HZC A;  2Z6K A;  1IKL A;  1Q86 C;  4NPS A;  3GTP B;  1XMQ Q;  3HOW G;  2DJG C;  5AJ3 Q;  3CPW A;  4POG A;  3T51 B;  1XNQ L;  1JR0 D;  4RFB A;  1S5D D;  4DV5 Q;  1VQ5 A;  1IBK L;  2L1B A;  1SE2 A;  2BA1 A;  1XX8 A;  3KK7 A;  1X65 A;  4X64 L;  5C4H A;  2NVT B;  1JT8 A;  1XMO L;  3MXP A;  4RKL A;  2K75 A;  2EYM A;  4RGN A;  5C3X A;  2VUM H;  4P71 A;  1EU3 A;  3D6W A;  3S14 B;  3CP0 A;  3F2B A;  2JP1 A;  4RGM A;  3D6C A;  3T1Y Q;  1JCK B;  5LMU Q;  4HMI A;  2IY5 B;  3I91 A;  2G9D A;  4F8M A;  1PRT F;  3DHQ A;  1PH6 A;  4JG2 A;  5FLX c;  3JAM L;  3GD7 A;  3I56 A;  4A93 B;  4XTC S;  2BA0 A;  1YJ9 A;  2JA7 B;  3CKI B;  3RMH A;  1A0I A;  3CCS A;  3F2D A;  4DK0 A;  1KIX A;  2H1E A;  2OQK A;  3SXH A;  1CKM A;  3J81 j;  2M00 A;  4A3B G;  1AFP A;  1VQ4 A;  2OTJ A;  1FR3 A;  3FPU B;  1WTP A;  3IRB A;  5DAU A;  2E2I H;  1XTD A;  3JAM c;  3VYT A;  1KL9 A;  3OIQ A;  1SE4 A;  1PH7 A;  1YZ6 A;  1S5C D;  1SYG A;  5GAD C;  4DR4 Q;  1TR5 A;  2QA4 A;  2KHJ A;  2F52 A;  2VB3 X;  4R8N A;  3U50 C;  4X66 Q;  4XT3 B;  2JSO A;  2HHH Q;  2HCC A;  3HOZ B;  5M3F B;  3CHB D;  1EY8 A;  1EYC A;  3K5L A;  3NHH A;  1ZYR C;  3T4A C;  4A93 G;  4ZCK A;  4A3E G;  4ZUI A;  5CGK A;  4RGT A;  5C4X H;  3I4L A;  4LF7 L;  5ELC A;  1D6E C;  3PO3 H;  4JW0 A;  5IWA L;  3KLS A;  1K28 A;  1N32 Q;  1Y1V B;  3NP8 A;  1DXM A;  1CKO A;  1D5M C;  2BH2 A;  3OWF A;  3TDQ A;  1V1O A;  3MC0 B;  3L9A X;  1KNA A;  4H13 C;  3F1Z A;  4JOI A;  4RMF A;  1CHP D;  2F4I A;  1LTL A;  2K4K A;  4ILW A;  2FMC A;  2UUC Q;  2E2I B;  5D65 A;  1GKH A;  2AQ3 B;  3P75 A;  4IPC A;  5IOD A;  3TQY A;  1HNZ L;  2AMC B;  3LWU A;  1TWF H;  1I4R A;  3EJI A;  2VQF L;  4JK1 C;  1CM9 A;  3C2P A;  2MNA A;  1D7Q A;  1CZW A;  4N9P A;  2RCN A;  3C1E A;  3RLN A;  3HOX G;  1V8Q A;  3AFP A;  5T1G A;  1MSG A;  1HNW L;  1WVL A;  5IP7 G;  4YHH L;  1AEX A;  1Q1E A;  4JBM A;  1EOT A;  3G4S A;  1PFM A;  5EKI A;  1ICW A;  1KRS A;  2K1B A;  3E9I A;  4IFD J;  5C4J B;  4GNX B;  1KAA A;  3CMA A;  1LV9 A;  3L0O A;  5IGC A;  4ZLT F;  3S2H B;  1Y69 U;  1Q3L A;  4HJ7 A;  5JJI A;  2VUM G;  2F0F A;  3NK9 A;  1H9S A;  4DAY A;  1HNX L;  1RJT A;  3A55 A;  1B3A A;  3SK6 A;  1BNZ A;  3I3C A;  1CA5 A;  3N52 A;  5BR8 L;  2HIV A;  3OHX C;  3HOW H;  4A3G B;  1G6P A;  2JA5 B;  4B08 A;  1QVF A;  3GQB A;  2QDB A;  1EYD A;  3I8Z A;  1X3Q A;  1WI5 A;  1CKN B;  2YTY A;  4M1U B;  3I4M B;  4APV A;  2E75 C;  1VQP A;  2G5D A;  5EPK A;  3F8T A;  4MN3 A;  4P75 A;  5FKA C;  5IYB H;  4HCE A;  2O5J C;  1SXT A;  5IGG A;  1YVC A;  3J81 L;  2RHQ B;  3OSO A;  4JYA Q;  4QIW E;  3A56 A;  4DV7 Q;  1X54 A;  1OO9 B;  4BY7 G;  5EQ0 A;  2EYO A;  4JOI C;  4FF2 A;  1DOL A;  4Q5V A;  2RDH A;  1EIH A;  5M5W B;  4AIM A;  2NZO A;  4X3U A;  5G3L F;  2JA7 H;  3HZX A;  4QUC A;  2NVX B;  1GO3 E;  4G7H C;  2VS1 A;  4OO1 I;  5IT9 c;  2OCE A;  1IXR A;  2RF4 A;  1Q12 A;  4GKJ L;  1D5Z C;  4ZYS A;  1QG7 A;  1FGU A;  1A3V A;  1LO5 D;  4XXE A;  2F0Q A;  2ATW A;  1DZ1 A;  4XIG S;  4U67 3;  3HOU G;  4WRD A;  4DV6 L;  4DAV A;  4LFB Q;  1PTO F;  3AQQ A;  1BKB A;  3RZO H;  1PH2 A;  1X3E A;  3M4Q A;  3PMF A;  2EJG C;  1PLF A;  2R7Z H;  3PF4 A;  2NN6 G;  3DWP A;  3SHL A;  2D5D A;  1ENA A;  5K5P A;  3RN5 A;  1EYG A;  3KDF A;  1SJH D;  1S72 A;  4OEL B;  4NP5 A;  1JOR A;  1SYD A;  4JBJ A;  4LFC L;  4V19 0;  3TP8 A;  1PTO B;  4K6D A;  4DK3 C;  3I4N H;  4TVA B;  2I07 B;  3P1H A;  4K14 A;  3BVZ A;  1WD1 A;  5LMN Q;  3GTJ B;  1AZP A;  1OTC A;  2HQL A;  1PH4 A;  1VQH A;  1NUC A;  1RCV D;  3ER0 A;  1PTO D;  1QZG A;  3GO5 A;  4C3I G;  2VXW A;  1TWA H;  3U58 A;  5M5Y B;  4QF4 A;  3K59 A;  2I0Q A;  3E3X A;  3GTL H;  2VQE Q;  2XWB B;  2UUA Q;  2B2Y C;  1ONL A;  1IW7 D;  1SR3 A;  2MJ8 A;  5I2Y A;  3CQZ H;  1V1P B;  1HXY D;  1UWV A;  2NVQ H;  1FNW A;  4PQX A;  2BH8 A;  4KHP L;  3D3R A;  3K81 C;  2Z4I A;  2R7Z B;  5J39 A;  2UUB Q;  2R7Z G;  2F0V A;  4A3K B;  4MTN A;  2JA8 B;  3SK5 A;  1EEF D;  4DXF A;  2EY2 A;  2RDF A;  4YWM A;  2CQA A;  2A6H D;  3OWE B;  4DKA C;  5BN5 A;  3S2D H;  3AMU A;  3CF5 A;  1FJG Q;  2D62 A;  2JA7 G;  2A69 D;  3EA6 A;  4QL5 A;  2QF7 A;  2IX0 A;  1EUJ A;  3VYR A;  4O42 A;  4J6H A;  1JE4 A;  1YNX A;  4X66 L;  2A69 C;  3IAY A;  3DWQ A;  1RD9 D;  4C1N K;  4DNT B;  4PMB A;  2JN4 A;  4PNY A;  2PZT A;  4HAE A;  1V43 A;  3HG9 A;  1N36 Q;  4RH6 A;  4DUZ Q;  4HED A;  3CCU A;  4DF7 A;  1TWG B;  2Q2H A;  5FLX E;  1YNN C;  4BS9 A;  1EFI D;  1II3 A;  3RUZ A;  4K5X A;  4ZKB B;  2J4X A;  4AH6 A;  2F0O A;  2Z0S A;  1PH5 A;  4IFD G;  4R4C A;  1KDA A;  1YNN D;  5LL6 S;  5C44 B;  3KLW A;  1N32 L;  1WTV A;  5CC4 A;  5KRU A;  4LF9 Q;  4ZK9 B;  3S1R B;  4B3S L;  2E2H B;  2F0U A;  5GAG C;  3G6E A;  1G2S A;  2CWP A;  4KMU C;  2B2V A;  3ULL A;  1PXU A;  2IW3 A;  2OF1 A;  1T5E A;  1PTO C;  3FKI B;  4HIM A;  1HZ9 A;  5D3I B;  1WFQ A;  3GTO H;  2ICI A;  2ES2 A;  2XWJ B;  4IUV A;  1YHQ A;  3A74 A;  3NSW A;  4L8J A;  1DYQ A;  1Y1V G;  4IPD A;  5JPM C;  3WWV A;  5IGF A;  1K8A C;  3CU7 A;  3BZD B;  3J80 L;  2R92 H;  4A3G H;  3PO2 B;  3R2T A;  5C4J H;  3NTH A;  2VZA A;  3W1B A;  1EIG A;  2ZM6 Q;  3PUX A;  3NEL A;  1D1K A;  4RHS A;  3QIA A;  4A3D H;  1VQ8 A;  2TMP A;  4XQN A;  4LFC Q;  4KD3 A;  1G91 A;  1UE5 A;  4K5W A;  5IP7 H;  5LMN L;  3TN2 A;  1HFN A;  1E2W A;  2L55 A;  1VQJ A;  3T16 A;  1ZXT A;  3VDY A;  1Y1W H;  5IYD G;  3HOY B;  5IY0 A;  2HUG A;  3HOX H;  3TP6 A;  2Q2T A;  2CW0 D;  4B3R L;  3M4P A;  5BR8 Q;  1SMX A;  2MFI A;  3A8K E;  1LAB A;  1YIJ A;  1MBY A;  1UAP A;  3M7G A;  4J8Q A;  2N55 A;  1DOM A;  4HCS A;  4K2L A;  5FLX L;  3GTG B;  1LT4 D;  2FMM A;  3NWT A;  1JOQ A;  5IOC A;  5ISR A;  5NUC A;  1LTB D;  4MHE A;  4CKC A;  1LT6 D;  3ICE A;  2RA4 A;  2EIF A;  4C3I H;  5HGQ A;  1TY2 A;  3NE5 B;  4OWT B;  3J80 i;  3DWA A;  2B2U A;  2AKW B;  1VCI A;  3Q23 A;  1VF7 A;  4IOA A;  2KHI A;  1G2T A;  3A5Z B;  1NTG A;  4WJW A;  1A3T A;  5JEA J;  2QKI C;  4C56 C;  1V1Q A;  1O7I A;  4EVO A;  1KDC A;  2EE1 A;  4HJA A;  5COY A;  2Q8I B;  1PRT C;  4LFA L;  1L0Y B;  1YIT A;  3UDI A;  4H44 C;  4GLV B;  1ESF A;  1IKM A;  4LWC A;  1G51 A;  2KBN A;  2DNE A;  1PH8 A;  3HOZ H;  1LLR D;  4DV1 L;  1I6H B;  1V9P A;  2ZT9 C;  4ZRZ A;  1F2M A;  1NR4 A;  4QGU A;  3GTQ H;  5IP9 G;  3H09 A;  2WB1 G;  1KD1 C;  3C46 A;  1VQI A;  5CBA E;  1YJW A;  2SDF A;  2H5X A;  1FL0 A;  1Y1V H;  4DV3 L;  3GTK H;  1EQR A;  3W2D A;  4BBS G;  1C4Q A;  4J1M A;  4QUF A;  1SFO H;  1L0X B;  4QMG A;  5IT9 E;  4JC0 A;  5EPJ A;  1SEB D;  1GUS A;  2E2J H;  1KLG D;  1J6Q A;  2UUC L;  2HHH L;  1XMO Q;  1RHP A;  2LXJ A;  1WOC A;  1OXV A;  3PIP A;  4X62 L;  4L5R C;  5FK9 C;  1I4G A;  3DM3 A;  1K73 C;  3K8A A;  4KHZ A;  2PPB C;  2E76 C;  2F0W A;  1P8L A;  1WCM H;  1EY6 A;  2F3W A;  2K5N A;  1Q81 C;  4JI6 L;  3S1N B;  1JJC B;  1KHI A;  2BOS A;  1JC7 A;  1JWM D;  1JJG A;  2MPM A;  2EQS A;  1E2Z A;  5JJZ A;  4QQB X;  1TKW B;  2K28 A;  1RL2 A;  3BS1 A;  4JI0 L;  1JMC A;  5BN3 A;  3S1Q B;  1BR9 A;  1TY0 A;  4QJF A;  4DV0 L;  3LX0 A;  5E3F A;  4C3J H;  1DM0 B;  1RF2 D;  5C0X J;  2KCN A;  3KF8 A;  3MEH A;  4DV2 Q;  1LUZ A;  4B3T L;  4JV5 Q;  4IJH A;  4FO2 A;  4AYB B;  2F0I A;  4X6A H;  1I3Q H;  5EBC A;  3LNN A;  2NTT A;  3AFQ A;  3DUZ A;  4H02 A;  5COR A;  5FJ8 H;  1CA6 A;  4NW2 A;  2UXB L;  4QCL A;  1MI2 A;  4A75 A;  4JI0 Q;  1BBW A;  2PI2 E;  4JI1 L;  3EIV A;  4HJ5 A;  4JI5 L;  1JB3 A;  3T13 A;  4A3J G;  1M90 C;  1NY4 A;  4IOC A;  3KOJ A;  3OW7 A;  2MGS A;  2XNA C;  4A3E B;  1ASY A;  1UE7 A;  4B3S Q;  4C3H H;  1TVX A;  3HKZ E;  4BXX H;  2EYP A;  3ND8 A;  1VQO A;  4BWG B;  2EJF C;  3VR2 A;  4A3C H;  2K03 A;  1IBM Q;  1JWU D;  3AB9 A;  1M8A A;  1K8O A;  3MZ5 A;  1Y1W B;  1YBY A;  5AFW A;  4J15 A;  3L3O C;  4CJ1 B;  1VF5 C;  2F03 A;  1S5E D;  3OMC A;  2K04 A;  2RBM A;  2E8G A;  3HKS A;  5A2Q E;  4A3F H;  3NEN A;  1STY A;  4LUV A;  2JA5 H;  4A3F B;  5IYD H;  2NTS A;  2NVT H;  1EWC A;  1K8M A;  2JQO A;  1IZ6 A;  5DNF A;  1H9J A;  2IHF A;  4LF8 Q;  1WCM G;  2K01 A;  4YY3 Q;  5M5X H;  2K7V A;  1H9K A;  1KAB A;  2KCC A;  4DR7 L;  3CPF A;  1FYC A;  2A74 C;  4B3T Q;  4JV5 L;  3KF6 A;  1HFG A;  3A54 A;  3UDX A;  4B9X A;  2RKS A;  3NPP A;  5G3L D;  2CKZ B;  2Z6K C;  4NB3 A;  3HEJ A;  4CHT B;  4G57 A;  2L5T A;  3ERO A;  3PQI A;  4HID A;  1M1K C;  3HOV H;  4YCW A;  4JI1 Q;  2RDG A;  4IUT A;  4LF4 Q;  3OTO L;  3NQT A;  2K5D A;  4MIU A;  3EVQ A;  2HD3 A;  2SNS A;  1EWI A;  4Y7N B;  1IL2 A;  1SAP A;  2UXD Q;  2O2L D;  1FNU A;  1I50 B;  3MA2 B;  4BBS H;  2D0P A;  1SND A;  2E2D C;  5AJ3 L;  2VB2 X;  1AN8 A;  3C3L A;  1HA6 A;  1SN8 A;  2E2H H;  2F0E A;  1F9R A;  2B8G A;  3F2U A;  2R61 A;  3CQZ B;  1LT5 D;  1STE A;  2XRS D;  2P5Z X;  3GDE A;  2IWH A;  2CVR A;  3L2P A;  3VR5 A;  3SEB A;  2D2C C;  4DV4 L;  4CKB A;  4JI3 Q;  2FXQ A;  1IYJ B;  4DV2 L;  1IL8 A;  4R4O A;  2A6E D;  4IFD I;  4L5Q A;  1M4V A;  2B8F A;  4NDX A;  2OWO A;  1W6K A;  3DMU A;  4KKU A;  5CYU A;  1W6J A;  2ZTE A;  4BBR H;  1OXS C;  4R8I A;  1EY5 A;  3W3A A;  1KQS A;  1STB A;  2WII B;  3K5N A;  5C3E G;  2WIN B;  4P2C B;  2EYL A;  4BY1 H;  3K6O A;  5M3F H;  1I3Q B;  4HIK A;  1WCM B;  1QZH A;  3HKZ B;  1U4R A;  3S17 B;  5CV4 A;  4POF A;  3S1N H;  1IYV A;  1FNV A;  4AYB G;  2Q2U A;  3HOY H;  2GVA A;  1KXL A;  2K6A A;  2N3S A;  2NZH A;  1PA6 A;  1CHQ D;  4A3I G;  3J81 c;  2KCM A;  1DCZ A;  2LFN A;  4JCV E;  2KOL A;  1STN A;  3CRK C;  3UE1 A;  1MJE A;  1TII D;  5E1F A;  1BXT A;  4Z9C B;  1PRT D;  1F2Y A;  5EJW A;  2E2J B;  2MO1 A;  1HNZ Q;  4LF5 L;  3MXU A;  3H0G B;  2Y0S E;  1I5F A;  3K7U C;  1LM0 A;  4A76 A;  2XIW A;  4CDF C;  5FJ8 G;  2EJM A;  2F1M A;  3DM1 A;  2ZXP A;  3D0F A;  4IUQ A;  4X65 Q;  2RHS B;  4O2D A;  3ZJY C;  1JE5 A;  4JI3 L;  3CCL A;  1BUV T;  1IYU A;  1E7Z A;  1PZI D;  2FJ2 A;  4LUZ A;  4RGO S;  4IN3 A;  3TP5 A;  4DUY L;  3TS2 A;  4FDB A;  1DOK A;  1VQF A;  1XXG A;  3E0E A;  3HRZ C;  1WTH A;  1QNK A;  2GVB A;  3V96 A;  3KDF B;  2EYJ A;  4LW1 A;  1GD7 A;  4FVM A;  1CZG A;  1HH2 P;  2R93 B;  2UU9 Q;  4X3T A;  1BCP B;  2L11 A;  2XGT A;  3S1R H;  5C3E H;  4DR6 L;  1F2Z A;  4C3J B;  3I73 A;  3BVG A;  3ERS X;  2K5W A;  3BYT B;  4A3M B;  4JI7 L;  4IUP A;  1SMY D;  2A1A A;  3KLS X;  3FHW A;  2CWA A;  2NVY B;  5IYB G;  3D8G A; 
#chains in the Genus database with same CATH homology
 2ICE C;  2XVS A;  2B63 B;  4CJ2 C;  1JOO A;  4NKL A;  1MGS A;  4DK1 A;  3MHB A;  3H6M A;  1SJE D;  1U4P A;  1MSH A;  3MVV A;  4R9W A;  2PCF B;  5IGB A;  1A3U A;  2Q8T A;  2H4O A;  3BG3 A;  2ZXR A;  1ESR A;  3TP7 A;  4A3D B;  2IPK D;  5M5X B;  4KK7 A;  1TWA B;  4CGY B;  3PIO 3;  2PZW A;  1TWF B;  3ONA B;  2EDG A;  1PFB A;  1HRJ A;  3FVQ A;  1NCV A;  4IQZ A;  1OXU A;  5JEA H;  1O80 A;  1JQY D;  2EY5 A;  4RAU C;  1SBB B;  1B9N A;  1JWS D;  3VR3 A;  4BBS B;  2K33 A;  1VMC A;  3EQL C;  4H0L C;  1JOK A;  3X3N A;  3PUZ A;  5KGU A;  1R4Q B;  1DON A;  3U9O A;  2KHS A;  1WTR A;  4M8A A;  5CV7 A;  3URY A;  3HP3 A;  1ET9 A;  4RCN A;  4DN4 M;  2RQX A;  1TQO A;  3HGB A;  1IHZ A;  4CJ0 B;  5C4X B;  1Q1B A;  3PUV A;  1RDP D;  4ZKC B;  2EY1 A;  1BQQ T;  4K2K A;  1WTW A;  2R3Z A;  1CTM A;  1J9O A;  1RTN A;  1H9R A;  2M2L A;  4HTH A;  2QIL A;  1TS3 A;  2NB0 A;  4LAA A;  2NN6 H;  1KDB A;  3GTL B;  1G8Z D;  1NSN S;  1F77 A;  1I4X A;  5KEE A;  5TSS A;  4XYQ A;  3HOV B;  3MFG A;  2AWN A;  5BN4 A;  2NYZ D;  4DA2 A;  4ZQ3 A;  3GTK B;  3RZD B;  1BCP F;  5HUR A;  1SYC A;  3J81 E;  1E2V A;  4KN7 C;  2MP1 A;  3O13 A;  5J22 A;  2F0M A;  3GV6 A;  1ET6 A;  2RSO A;  2TSS A;  4KJO A;  2EPB A;  1SYF A;  1B2T A;  5K36 H;  3TZD A;  1EYA A;  1Y8O B;  1QE6 A;  2AUK A;  2NWG A;  1TT2 A;  5DM6 3;  3IKJ A;  2EYF A;  2HDL A;  5FOB B;  1GXD C;  2WV6 D;  2IX3 A;  4L6T B;  3NTK A;  3S16 B;  1CK1 A;  2I46 A;  4G7O C;  1VMP A;  3PUY A;  3NQI A;  1RTO A;  3S1M B;  3S9W A;  2KQ3 A;  5EBD A;  3Q6S A;  1Z47 A;  4EQO A;  4PV1 C;  4K8J A;  2OT2 A;  1O78 A;  2LMC B;  2CW0 C;  4OL7 A;  2KJX A;  1MD2 D;  4HMJ A;  3C1F A;  1RKN A;  3FEW X;  1PTO H;  1EY0 A;  3DXJ C;  3SDZ A;  3JAM E;  2K5Q A;  2KA7 A;  5I4D A;  3IL8 A;  2B2T C;  1AZQ A;  3EFX D;  2OXP A;  3WOE A;  2R6G A;  4ABN A;  1ILQ A;  3ITP A;  3R93 A;  3KBG A;  2IL8 A;  4LMQ D;  2PMZ B;  5ELD A;  3RLF A;  3RZO B;  2AWO A;  1E0B A;  2A5H A;  3WDN A;  2X6G A;  3MXG A;  1GUW A;  5EGT A;  5JVH 3;  3K7A B;  3U9S A;  2BE5 C;  1LTS D;  4FYD A;  2X69 A;  1WD0 A;  1OXX K;  2F0H A;  4HR7 B;  1F9Q A;  2GA4 B;  4BA1 I;  5C5M A;  3KBX A;  2DY8 A;  1F9S A;  3QOJ A;  3SE0 A;  3A8I E;  4LJZ C;  4JBW A;  3TSS A;  4DAP A;  4QIW B;  1PFN A;  1G29 1;  3NTI A;  2KEC A;  2MUY A;  4RA8 A;  3D4R A;  3N6R A;  2WP8 J;  2M9V A;  1ML0 D;  1CT1 D;  4FP5 D;  4XQQ A;  2RVL A;  4U68 A;  1C8C A;  3PV0 A;  3TZU A;  1TS5 A;  1STA A;  4KY5 A;  1H9S B;  1S5B D;  4RHR A;  1I4H A;  3GTQ B;  1Y8N B;  1ZYR D;  4CKE A;  2EVB A;  1QWY A;  1Z7T A;  5C0X I;  2ENB A;  4K6L A;  4ULL A;  5FO7 B;  4FXK C;  1SYE A;  3E6Z X;  4KV6 A;  5EKL A;  1LT3 D;  4CBV A;  4UAI A;  1O7Y A;  2J7Z A;  1B1Z A;  3OOC A;  5CMD A;  4KHV A;  1SMY C;  4DFA A;  2J0T D;  3IFT A;  2NN6 I;  4ZUJ A;  5ELF A;  3GV3 A;  1B50 A;  2JA6 B;  5ELE A;  1HQM C;  2A68 C;  2PNR C;  1NR2 A;  5LHY 1;  2E74 C;  4XT1 B;  3OPO A;  2SNM A;  2XSC A;  3H91 A;  1EWH A;  4GZY C;  3MAQ A;  2LKV A;  4KTA A;  3QO2 A;  4C3H G;  4FF4 A;  1B4O A;  2LS0 1;  2O5I C;  2PYK A;  3ZYY X;  4NMZ A;  1PRT B;  3NWS A;  1CFM A;  2KUM A;  1UEA B;  1TS2 A;  2BE5 D;  4IUN A;  1CQF A;  4BA2 I;  1C48 A;  5IIF A;  3NBH A;  1J8I A;  1QJO A;  5IGD A;  2B39 A;  2EOT A;  3HS0 C;  2JEA I;  4F87 A;  2Q8R E;  1Q90 A;  2F3V A;  3BDC A;  1WTQ A;  1QB5 D;  5JVG 3;  2JE6 I;  1EZ6 A;  4EGV A;  4RKB A;  2EZV A;  5C0X H;  2A6H C;  5CV8 A;  2N88 A;  1D5X C;  4FF1 A;  1X32 A;  3D4D A;  1H9M A;  2L12 A;  3A8J E;  4PMW A;  5A2Q L;  2A68 D;  2G9H D;  5IT9 L;  1K83 B;  3OMG A;  4HN7 A;  5CV6 A;  1PMR A;  3FDT A;  2A73 B;  4G7Z C;  2LY7 A;  5JEA G;  4QB4 A;  3X3M A;  2B2T A;  3P7J A;  3ND9 A;  1BDO A;  5C5L A;  4FXG C;  2X6L A;  3SVM A;  5I6Y A;  2O4X A;  3FRP B;  4DGZ A;  2OEO A;  1D2B A;  1OXT A;  1I4P A;  3E5S A;  3DEO A;  5I6W A;  4KJN A;  2F0S A;  1EY4 A;  2DN8 A;  3FMC A;  4KD4 A;  3VYS A;  2PO4 A;  1ILP A;  1HHV A;  3H94 A;  3Q22 A;  4KY7 A;  5M3M B;  4OO1 G;  4IFD H;  2D9U A;  3G7L A;  2Z8L A;  4KKS A;  3K57 A;  3QG1 A;  1GHJ A;  2JEB I;  2JYO A;  3PO3 B;  1A15 A;  2F0G A;  3MFY A;  3HOW B;  1UUP A;  3Q0A A;  4KY6 A;  3BDL A;  1TWH B;  1XTC D;  2F0P A;  2BDO A;  5DEH A;  5I2X A;  1GUT A;  2ID0 A;  4A3B B;  3KUP A;  4KKT A;  4F88 A;  5F2D A;  2KVM A;  2B2U C;  4WFN 3;  1T5X D;  1BO0 A;  2BCO A;  3DEP A;  4ME5 A;  3PUW A;  5C0X G;  3K5O A;  1SFO B;  1LTA D;  1Y8P B;  2F0J A;  2VNU D;  2MHV A;  5KYI A;  1B9M A;  2EYH A;  3A7L A;  3UI2 A;  3TBI B;  3J7Y W;  2L0C A;  1STH A;  5C6A A;  2L4N A;  3GP7 A;  3OIP A;  2EXZ A;  4XQJ A;  2BDN A;  2NZ1 D;  1U9R A;  3KLR A;  5HGT A;  2PZU A;  2Z1C A;  4PMC A;  2NBF A;  1X3P A;  4X3S A;  3BVM A;  3L7Z C;  4XYO A;  4A3J B;  2HQE A;  2F0D A;  1BCP C;  3T53 B;  1PDQ A;  2WKD A;  4OIJ A;  1U4L A;  3LWE A;  1QIL A;  3PIP 3;  4K5V A;  1LTI D;  5D3D A;  1BOS A;  1EQT A;  1CI3 M;  4OO1 H;  1HA5 A;  1O7L A;  1WTO A;  3M85 A;  3I90 A;  4S3S A;  1D1I A;  5DM7 3;  4C3J G;  3V05 A;  1Z6H A;  2F0L A;  4ID6 A;  1KLU D;  1EL0 A;  3CRL C;  3H3V C;  4RWS C;  1A6X A;  2V4D A;  5I9P A;  3ERQ A;  2IX1 A;  4ODG A;  1JIC A;  2R92 B;  5CV9 A;  4IAL A;  3RD4 A;  1PYW D;  1LAC A;  5EPL A;  1A2T A;  4B9W A;  4C3H B;  5KYL A;  2QCP X;  1HPC A;  2DY7 A;  3SK4 A;  4BY7 B;  1YNJ C;  4HSV A;  3M3Y B;  4FF3 A;  1YNJ D;  4UDU C;  5T1I A;  3R3O A;  3R8B A;  1U4M A;  2HDM A;  4H7B A;  2PW5 A;  5CBE E;  3M4O B;  1F9P A;  3GTM B;  1GHK A;  2AQ1 B;  1GOZ A;  2SOB A;  3I4N B;  1SNC A;  2DNC A;  2KED A;  4ZAI A;  1DD2 A;  3M7N A;  5C4Z A;  3J7A F;  5KNB A;  5K36 G;  4N9T A;  1EZ8 A;  1SNP A;  2C5C A;  1R4P B;  3G6J B;  2QEJ C;  3R2I A;  1XYI A;  1ENF A;  4XDX A;  2F0K A;  1QCB D;  1GJX A;  5E4W C;  2K32 A;  1HUM A;  4TQU S;  1SYB A;  2WAC A;  1I6V C;  2FHT A;  1QOH A;  4LK1 C;  2ZXO A;  3I70 A;  5KNC A;  1EY7 A;  3HOX B;  5D14 A;  3P20 A;  3QWN A;  2Z4H A;  2FFK B;  1DJR D;  4V0B A;  4FNF A;  2SEB D;  5IGE A;  3MXN A;  4BY1 B;  3D4W A;  3BDO A;  1S4Z A;  1V1P A;  3K5M A;  1SNM A;  1HTL D;  2YU9 B;  1G6Z A;  2B2V C;  3HOU B;  3E0J A;  1FD7 D;  3SR1 A;  4FXD A;  2NVQ B;  5FO9 B;  4OGQ C;  4X3K A;  4A3I B;  1ZEQ X;  1HQR D;  3S2D B;  1XWE A;  4DU9 A;  4C1N I;  3A7A B;  4RCO A;  2CHB D;  1SNQ A;  4OIK A;  1HTP A;  3NBI A;  1EY9 A;  1LTG D;  1EU4 A;  2WAQ B;  2K05 A;  1TU2 B;  4G4K A;  4BBR B;  4C3I B;  1VDZ A;  3V2T A;  1B44 D;  4L63 B;  3K0Y A;  1AW7 A;  2B2Y A;  2F0N A;  1PZJ D;  1BBX C;  3WOF A;  3BYY B;  4TRD A;  1GUO A;  5JAV A;  3IFD A;  4HSP A;  5ELB A;  2YYZ A;  4OHJ A;  3Q24 A;  1B53 A;  4O1N A;  1KTK A;  1ENC A;  3QB3 A;  5C3E B;  4WOR A;  1EQV A;  1R9T B;  5LL6 X;  1GUG A;  4C2M B;  1STG A;  1TWC B;  2JXM B;  4K8I A;  4IZ8 A;  1SDF A;  1TS4 A;  1ROD A;  4F7X A;  2RSN A;  1F2L A;  1O7Z A;  1UNS A;  3M4Y A;  5JPN C;  5JOB A;  4DXG A;  2FIN B;  1Q8I A;  2B2W C;  4E6I A;  2IJ0 A;  4IUR A;  5M9O A;  3NXW A;  3VA7 A;  5A35 A;  1WTX A;  2NUC A;  4I7Z C;  4IUU A;  2VUM B;  2EY6 A;  1A2U A;  1IW7 C;  3TME A;  2WB1 B;  1GUN A;  3T56 B;  4I65 A;  5I9O A;  3FPP A;  2PW7 A;  5KND A;  4KN4 C;  4EQP A;  2C9O A;  1EEI D;  3S15 B;  2WKC A;  4TKO B;  1NAP A;  5E4X A;  1S5F D;  1SE3 A;  3MTS A;  2HCI A;  3MWY W;  1KNE A;  2AQ2 B;  3J7A V;  1QNU A;  2KEE A;  1SSO A;  3GTO B;  1LTT D;  2XN9 C;  3J80 E;  1CQV A;  4KI0 A;  4YIJ A;  1I4Q A;  1BF4 A;  2F0T A;  5KIX A;  1PZK D;  2XRQ D;  2A6E C;  4EQN A;  3VR4 A;  1HUN A;  1ZKO A;  1HCZ A;  5CV5 A;  5J1Z A;  2B2W A;  3VR6 A;  3AU7 A;  5CR3 A;  1SNO A;  2L9H A;  3D31 A;  5FO8 B;  2PQE A;  2AUJ D;  4Q0F A;  4TSS A;  1AP0 A;  4DNR B;  3VA5 A;  1FGB D;  5C3W A;  3NUC A;  2IT1 A;  3QJY A;  2Y0S B;  3I72 A;  5EKK A;  1LTR D;  3SK8 A;  3K58 A;  3VYU A;  3QOL A;  1BCP D;  1IKL A;  3GTP B;  3T51 B;  1JR0 D;  4RFB A;  1S5D D;  2L1B A;  1SE2 A;  2BA1 A;  1XX8 A;  3KK7 A;  5C4H A;  2NVT B;  3MXP A;  4RKL A;  4RGN A;  2EYM A;  5C3X A;  1EU3 A;  3D6W A;  3S14 B;  2JP1 A;  4RGM A;  3D6C A;  1JCK B;  4HMI A;  3I91 A;  2G9D A;  4F8M A;  1PRT F;  3DHQ A;  3JAM L;  3GD7 A;  4A93 B;  4XTC S;  2BA0 A;  2JA7 B;  3CKI B;  3RMH A;  4DK0 A;  2H1E A;  3SXH A;  2M00 A;  1AFP A;  1FR3 A;  3FPU B;  1WTP A;  5DAU A;  3VYT A;  1SE4 A;  3OIQ A;  1S5C D;  1SYG A;  1TR5 A;  2VB3 X;  4R8N A;  4XT3 B;  2JSO A;  2HCC A;  3HOZ B;  5M3F B;  3CHB D;  1EY8 A;  1EYC A;  3K5L A;  3NHH A;  1ZYR C;  3T4A C;  4ZUI A;  5CGK A;  4RGT A;  3I4L A;  5ELC A;  1D6E C;  3KLS A;  1Y1V B;  3NP8 A;  1DXM A;  1D5M C;  3OWF A;  3TDQ A;  1V1O A;  3MC0 B;  3L9A X;  1KNA A;  4H13 C;  1CHP D;  2F4I A;  4ILW A;  2E2I B;  2FMC A;  5D65 A;  2AQ3 B;  3P75 A;  5IOD A;  3LWU A;  1I4R A;  3EJI A;  4JK1 C;  1CM9 A;  3C2P A;  1CZW A;  4N9P A;  3C1E A;  1V8Q A;  5T1G A;  1MSG A;  1WVL A;  1AEX A;  1Q1E A;  1EOT A;  1PFM A;  5EKI A;  1ICW A;  2K1B A;  4IFD J;  5C4J B;  1KAA A;  1LV9 A;  5IGC A;  4ZLT F;  3S2H B;  1Y69 U;  1Q3L A;  2F0F A;  3NK9 A;  1H9S A;  4DAY A;  1RJT A;  3A55 A;  1B3A A;  3SK6 A;  1BNZ A;  3I3C A;  1CA5 A;  3N52 A;  3OHX C;  4A3G B;  2JA5 B;  4B08 A;  3GQB A;  2QDB A;  1EYD A;  3I8Z A;  1X3Q A;  4M1U B;  3I4M B;  2E75 C;  5EPK A;  4MN3 A;  5FKA C;  4HCE A;  2O5J C;  1SXT A;  5IGG A;  3J81 L;  3OSO A;  3A56 A;  1OO9 B;  5EQ0 A;  2EYO A;  4FF2 A;  1DOL A;  4Q5V A;  2RDH A;  1EIH A;  5M5W B;  4X3U A;  5G3L F;  3HZX A;  4QUC A;  2NVX B;  4G7H C;  4OO1 I;  1Q12 A;  1D5Z C;  4ZYS A;  1QG7 A;  1A3V A;  1LO5 D;  4XXE A;  2F0Q A;  1DZ1 A;  4XIG S;  4U67 3;  4WRD A;  4DAV A;  1PTO F;  3PMF A;  2EJG C;  1PLF A;  2NN6 G;  3DWP A;  3SHL A;  2D5D A;  1ENA A;  5K5P A;  1SJH D;  4NP5 A;  1JOR A;  1SYD A;  4V19 0;  3TP8 A;  1PTO B;  4K6D A;  2I07 B;  3P1H A;  4K14 A;  3BVZ A;  1WD1 A;  3GTJ B;  1AZP A;  1NUC A;  1RCV D;  1PTO D;  3GO5 A;  4C3I G;  2VXW A;  5M5Y B;  4QF4 A;  3K59 A;  2XWB B;  2B2Y C;  1ONL A;  1IW7 D;  2MJ8 A;  5I2Y A;  1V1P B;  1HXY D;  1FNW A;  4PQX A;  3D3R A;  2Z4I A;  2R7Z B;  5J39 A;  2F0V A;  4A3K B;  2JA8 B;  3SK5 A;  1EEF D;  4DXF A;  2EY2 A;  2RDF A;  2CQA A;  2A6H D;  3OWE B;  5BN5 A;  3AMU A;  2D62 A;  2A69 D;  3EA6 A;  2QF7 A;  2IX0 A;  3VYR A;  4O42 A;  4J6H A;  1JE4 A;  2A69 C;  3IAY A;  3DWQ A;  1RD9 D;  4C1N K;  4DNT B;  4PMB A;  4PNY A;  2PZT A;  4HAE A;  1V43 A;  3HG9 A;  4RH6 A;  4HED A;  4DF7 A;  1TWG B;  5FLX E;  1YNN C;  4BS9 A;  1EFI D;  1II3 A;  3RUZ A;  4K5X A;  4ZKB B;  2J4X A;  4IFD G;  2F0O A;  1KDA A;  1YNN D;  5LL6 S;  5C44 B;  1WTV A;  5CC4 A;  5KRU A;  4ZK9 B;  3S1R B;  2E2H B;  2F0U A;  1G2S A;  4KMU C;  2B2V A;  1PXU A;  2IW3 A;  2OF1 A;  1T5E A;  1PTO C;  3FKI B;  5D3I B;  2ICI A;  2XWJ B;  4IUV A;  3NSW A;  4L8J A;  1DYQ A;  5JPM C;  5IGF A;  3CU7 A;  3BZD B;  3J80 L;  3PO2 B;  3R2T A;  3NTH A;  1EIG A;  3PUX A;  1D1K A;  4RHS A;  3QIA A;  2TMP A;  4XQN A;  4KD3 A;  1G91 A;  4K5W A;  3TN2 A;  1HFN A;  1E2W A;  2L55 A;  3T16 A;  1ZXT A;  3HOY B;  2HUG A;  3TP6 A;  2CW0 D;  3A8K E;  1LAB A;  1MBY A;  1UAP A;  3M7G A;  4J8Q A;  2N55 A;  1DOM A;  4HCS A;  4K2L A;  5FLX L;  3GTG B;  1LT4 D;  2FMM A;  3NWT A;  1JOQ A;  5IOC A;  5ISR A;  5NUC A;  1LTB D;  4MHE A;  4CKC A;  1LT6 D;  2RA4 A;  1TY2 A;  3NE5 B;  3DWA A;  2B2U A;  1VCI A;  3Q23 A;  1VF7 A;  1G2T A;  4WJW A;  1A3T A;  5JEA J;  2QKI C;  4C56 C;  4EVO A;  1KDC A;  2EE1 A;  5COY A;  2Q8I B;  1PRT C;  1L0Y B;  4H44 C;  1ESF A;  1IKM A;  2DNE A;  1LLR D;  1I6H B;  2ZT9 C;  4ZRZ A;  1F2M A;  1NR4 A;  3H09 A;  3C46 A;  5CBA E;  2SDF A;  3W2D A;  1C4Q A;  4J1M A;  4QUF A;  1L0X B;  4QMG A;  5IT9 E;  5EPJ A;  1SEB D;  1GUS A;  1KLG D;  1RHP A;  1OXV A;  5FK9 C;  1I4G A;  4KHZ A;  2PPB C;  2E76 C;  2F0W A;  1EY6 A;  2F3W A;  3S1N B;  2BOS A;  1JC7 A;  1JWM D;  2MPM A;  1E2Z A;  5JJZ A;  1TKW B;  2K28 A;  3BS1 A;  5BN3 A;  3S1Q B;  1BR9 A;  1TY0 A;  3LX0 A;  5E3F A;  5C0X J;  1DM0 B;  1RF2 D;  2KCN A;  3KF8 A;  3MEH A;  4FO2 A;  4AYB B;  2F0I A;  5EBC A;  3LNN A;  2NTT A;  3DUZ A;  5COR A;  1CA6 A;  4NW2 A;  4QCL A;  1MI2 A;  1JB3 A;  3T13 A;  3OW7 A;  2MGS A;  2XNA C;  4A3E B;  1TVX A;  2EYP A;  3ND8 A;  4BWG B;  2EJF C;  3VR2 A;  2K03 A;  1JWU D;  3AB9 A;  1M8A A;  1K8O A;  3MZ5 A;  1Y1W B;  5AFW A;  3L3O C;  4CJ1 B;  1VF5 C;  2F03 A;  1S5E D;  3OMC A;  2K04 A;  2RBM A;  5A2Q E;  1STY A;  4A3F B;  2NTS A;  1EWC A;  1K8M A;  5DNF A;  1H9J A;  2K01 A;  2K7V A;  1H9K A;  1KAB A;  2KCC A;  1FYC A;  2A74 C;  1HFG A;  3A54 A;  4B9X A;  2RKS A;  3NPP A;  5G3L D;  3HEJ A;  4CHT B;  4G57 A;  2L5T A;  3ERO A;  2RDG A;  4IUT A;  3NQT A;  2K5D A;  4MIU A;  3EVQ A;  4Y7N B;  2SNS A;  1SAP A;  2O2L D;  1FNU A;  1I50 B;  3MA2 B;  1SND A;  2E2D C;  2VB2 X;  1AN8 A;  3C3L A;  1HA6 A;  2F0E A;  1F9R A;  2B8G A;  3F2U A;  2R61 A;  3CQZ B;  1LT5 D;  1STE A;  2XRS D;  2IWH A;  2CVR A;  3VR5 A;  3SEB A;  2D2C C;  4CKB A;  1IL8 A;  2A6E D;  4IFD I;  1M4V A;  2B8F A;  4NDX A;  1W6K A;  3DMU A;  4KKU A;  5CYU A;  1W6J A;  1OXS C;  4R8I A;  1EY5 A;  3W3A A;  1STB A;  2WII B;  3K5N A;  2WIN B;  4P2C B;  2EYL A;  3K6O A;  1I3Q B;  1WCM B;  3HKZ B;  1U4R A;  3S17 B;  5CV4 A;  1IYV A;  1FNV A;  2K6A A;  1CHQ D;  1DCZ A;  2LFN A;  2KOL A;  1STN A;  3CRK C;  1TII D;  5E1F A;  1BXT A;  4Z9C B;  1PRT D;  1F2Y A;  5EJW A;  2E2J B;  3MXU A;  3H0G B;  2XIW A;  2EJM A;  2F1M A;  3DM1 A;  2ZXP A;  4IUQ A;  1BUV T;  1IYU A;  1PZI D;  2FJ2 A;  3TP5 A;  4RGO S;  4IN3 A;  1DOK A;  1XXG A;  3HRZ C;  1QNK A;  3V96 A;  2EYJ A;  4FVM A;  1CZG A;  2R93 B;  4X3T A;  1BCP B;  2L11 A;  1F2Z A;  4C3J B;  3I73 A;  3BVG A;  2K5W A;  3BYT B;  4A3M B;  4IUP A;  1SMY D;  3KLS X;  2NVY B;  3D8G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...