1H9SB

Molybdate bound complex of dimop domain of mode from e.coli
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
137
structure length
137
Chain Sequence
QTSARNQWFGTITARDHDDVQQHVDVLLADGKTRLKVAITAQSGARLGLDEGKEVLILLKAPWVGITQDEAVAQNADNQLPGIISHIERGAEQCEVLMALPDGQTLCATVPVNEATSLEQGQNVTAYFNADSVIIAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords MOLYBDENUM TRANSPORT PROTEIN MODE
publication title Oxyanion Binding Alters Conformational and Quaternary Structure of the C-Terminal Domain of the Transcriptional Regulator Mode; Implications for Molybdate-Dependant Regulation, Signalling, Storage and Transport
pubmed doi rcsb
source organism Escherichia coli
total genus 33
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2001-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03459 TOBE TOBE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1h9sB02
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1h9sB01
3A8KE 1Y8OB 3WDNA 2F1MA 2K7VA 3BG3A 1LACA 3M7NA 3TZUA 3LNNA 4BA1I 1OXUA 2BE5D 3D4RA 4JK1C 3T56B 1GUGA 2EJFC 2NN6I 3P20A 2PCFB 3VR6A 5KNCA 1CFMA 3VR4A 2EJGC 4LJZC 3SE0A 1B9MA 1EWHA 2B8GA 5BN5A 4KKUA 1ZKOA 1E2WA 4JBWA 1H9JA 3GQBA 1VF5C 5BN3A 4HR7B 1FR3A 2EVBA 1YNJC 4KN7C 1V8QA 2DNCA 3QJYA 2B8FA 2A6ED 3VR2A 1O7LA 1OXSC 1Y69U 1GUOA 3AB9A 1HTPA 1Z7TA 2PNRC 1E2ZA 2A6HC 4KKSA 2A6EC 1H9SA 1I6VC 4G7OC 3A7AB 3M4YA 4OO1H 1K8OA 1CTMA 4DK1A 2LMCB 2KCCA 1HCZA 1OXXK 4H0LC 4OO1G 3CRKC 3NE5B 1Q12A 2PPBC 1LABA 3QIAA 2Q8IB 2JE6I 4KKTA 1TU2B 2ZT9C 3PUYA 4H13C 4DNTB 1B9NA 2D2CC 3I72A 2D5DA 1K8MA 3MFYA 1G291 3GD7A 1CI3M 2AUJD 1O78A 1Y8NB 2R6GA 2K32A 1DCZA 2NN6H 3DXJC 3PUVA 3N6RA 2A6HD 2E74C 4RCNA 2L5TA 3ND9A 4XTCS 1HQMC 1IYUA 3OOCA 4KI0A 2NN6G 4KMUC 2AWOA 1T5EA 3KLRA 3W3AA 4DK0A 3VA7A 1Q90A 5JEAH 1H9RA 4G7HC 5A35A 1TKWB 3T53B 3HGBA 4GZYC 5JEAG 4TKOB 1GHJA 1DD2A 2O5IC 2IT1A 1PMRA 1FYCA 4L8JA 2A69C 1OXVA 2O5JC 2D62A 3M85A 1GUSA 1H9KA 2AUKA 2CW0C 2E75C 2JEBI 2BDOA 2JXMB 2KA7A 1ONLA 4IQZA 3L7ZC 4KN4C 1SMYC 3PV0A 3U9SA 3VR3A 1Y8PB 4IFDH 3PUZA 4TQUS 3SDZA 5KNDA 2A68C 1ZYRC 3QG1A 2QF7A 4OGQC 1HPCA 1BDOA 3PUWA 1IW7C 1Q1EA 3IKJA 1VDZA 1E2VA 1Z6HA 3OPOA 4G7ZC 5BN4A 4IFDG 1V43A 1IYVA 2BA0A 3LWUA 4KHZA 3D31A 3FMCA 1GHKA 3A7LA 1YNNC 2EJMA 4DNRB 3A8IE 2A69D 3BDOA 3EQLC 3PUXA 2DN8A 3VR5A 2YYZA 5KNBA 1H9MA 2V4DA 1GUNA 1GUTA 3T51B 5K36H 1OXTA 4BA2I 1QJOA 2BE5C 3ND8A 3I73A 4I7ZC 5C0XH 4PV1C 2A68D 2BA1A 5K36G 1DXMA 1Q1BA 3FPPA 1IW7D 3RLFA 1GJXA 1H9SB 3MXUA 5C0XG 2E76C 3IFTA 3H94A 3I4LA 2JEAI 1VCIA 2EDGA 4XIGS 4LK1C 1VF7A 3A8JE 2K33A 4H44C 2DNEA 3OW7A 3CRLC 1A6XA
chains in the Genus database with same CATH superfamily
3AFPA 5A2QE 2E2IB 3HOUH 1PFNA 2A8VA 3OTOL 1LTBD 1PRTB 4GLAC 4XDXA 1SBBB 3HOUG 1WTXA 5LMNW 3P20A 1VQOA 4A3EB 2TSSA 5KNCA 1FNUA 4RGMA 1EWHA 3AFQA 3M9BA 1VS0A 3GTJH 1I3QB 2JP1A 3CMEA 1BBWA 3RN2A 2B8FA 1D7QA 1O7LA 2XWJB 4DR5L 1K9MC 1TY2A 1B2TA 4A3BH 4LF4Q 1SN8A 1G2TA 1SXTA 4G7OC 4A3BG 1STHA 2EE1A 5LMUQ 3S17B 2AQ2B 4UAIA 4LMQD 1SE4A 1XXGA 4H7BA 3BZKA 1IKLA 2JSOA 1G291 3U50C 2AUJD 5FLXc 4KY6A 1LO5D 3DXJC 1MKHA 4RCNA 1XMQQ 4K14A 3IRBA 1HQMC 1N8RC 4FYDA 3FHWA 2AWOA 3E9HA 4B3TL 4LFCL 1QUQA 1STEA 2PZWA 4AH6A 1IYJB 4FXDA 4XYQA 3TSSA 5FJ8H 3W1GA 4L8JA 3HOZH 1EOVA 1O7IA 3M4QA 4K6DA 2DUDA 2C35B 2NTTA 5FJ8G 4UPAA 3HOZG 2JA5B 3C1FA 3SDZA 3STBD 1CKNB 3QG1A 4OGQC 3R8BA 1B3QA 4F7XA 1LUZA 3FPUB 2I07B 3BYYB 4GS3A 1UUPA 5M5XB 1PH7A 1U4RA 1A3UA 1YBYA 2I5HA 1PVOA 2PNHA 1QB5D 1B70B 4HIMA 2R92B 1MIUA 3PUXA 1UE5A 2L15A 1WTVA 2UXCL 4RH6A 1N9WA 5J39A 1JOQA 1XPRA 4GN4B 4R8IA 1EIYB 1YEZA 2IW3A 1L1OB 3M4PA 4P74A 1YHAA 1K28A 4KD3A 4OWXB 3I56A 1ICFB 1TWHB 2WB1G 1CHQD 1VQFA 1F9PA 3I4OA 2R7FA 1D5XC 3CW2C 3RZDB 5FK9C 2NZ1D 2MNAA 4RFBA 5K5PA 4JI0Q 1EY9A 4K0KQ 3TBIB 2VNUD 4DR4Q 3VR6A 2ZJRA 5G3LF 2CVRA 1L0YB 5FLXE 1XMOL 1IBML 1VQGA 2WFWA 3AMUA 4ID6A 4MZ9A 5J1ZA 4AIMA 3GV6A 1JB7A 4DAYA 3FP9A 4ZUIA 1EQVA 2IX1A 3QR8A 2EYFA 1HA6A 1OXSC 3KF6A 3DWPA 4DGZA 4DV6Q 1E2ZA 1AN8A 4WFN3 4ZCKA 3A7AB 2NVYB 1KABA 2YU9B 3I7FA 5D3DA 4C2MH 5C5LA 4HJ8A 4LF6Q 3CCRA 2MFIA 3HOXH 1VQHA 2WIIB 4FXGC 1PRTC 2K28A 3NBHB 3OMCA 3I3CA 5GAEC 3Q24A 3CC7A 1TU2B 4LF9L 3PUYA 3HOXG 2RHSB 1B50A 2K6AA 3T1HQ 5H1SE 3F2BA 4Q5VA 1KAAA 3EJIA 4IOCA 4U673 3KOJA 5C0XI 5JJKA 4UP7A 3UDIA 1O80A 4HSVA 2HIVA 5KEEA 5A35A 4A3KH 2FINB 5I6WA 3GTGB 3DM1A 2VQEQ 1AZPA 4JI1L 3FRPB 1C48A 1TWAB 1LT4D 2AHOB 2F4IA 5C3XA 1VDZA 1Z6HA 4X66L 1A15A 4DV5L 4OWWB 1V43A 2D0OA 1IBLQ 3BDCA 3ULLA 2RBMA 1TY0A 3G4SA 3ER0A 3ITPA 1Z9FA 4AYBB 3HRZC 1A2TA 3SR1A 5CV9A 3JAML 5KNBA 1WYDA 4DV0Q 1WFQA 3MXGA 1YITA 3HFZB 1ASZA 2E2JH 1Z47A 3VYUA 4OIKA 4KD4A 3V05A 2EYOA 1QVCA 3GDEA 1X32A 1IHZA 4Y7NB 1EIHA 4ME3A 2DJFC 2KHIA 3CRLC 4PMWA 3S2HH 1F9RA 3K5MA 3RNUA 3HKZG 3JC66 1STBA 2IHFA 1TS3A 4QF4A 3SK8A 4BY7B 1V1QA 5M5YB 3CCEA 1NNXA 2L1BA 3U4ZA 4F87A 1DOLA 4P73A 2B3GA 3K59A 1SNPA 4IURA 1L0WA 1ET6A 1T9HA 4BBRB 1FNWA 3DUZA 1U0LA 4FF3A 2Y0SE 1L1OC 1LT3D 4P72A 2V1CC 4M8AA 5JVG3 1JJGA 4XQQA 4MTKA 4QL5A 1EY0A 3M4YA 3A54A 4HIOA 2DGYA 3GV3A 3TQYA 4IUNA 1OXXK 4ODGA 1HZ9A 3TP6A 2NYZD 4KKTA 4NB3A 3MFYA 1ASYA 2BDNA 3FKIB 4ZQ3A 3AU7A 2UXBL 4OELB 4DXGA 3MXPA 2P5ZX 2JQOA 5IYDG 4Y52H 3BS1A 3S1RB 4DR6L 1QZHA 5CBAE 2QCPX 1FGUA 3CXCA 3CMAA 1PRTD 1WJJA 3DHQA 3EA6A 3K7UC 3ONAB 2WAQB 1DZ1A 4ZRZA 2O5JC 1W6KA 1HR0Q 2CW0C 1H9KA 3OMGA 4EQNA 4QUFA 1XJVA 1RHPA 2F0WA 2OXPA 2VUMB 4O2DA 1SROA 4HTHA 4K2LA 2UXDL 3ZJYC 1PYBA 1AE2A 4X62L 3BVGA 1S5BD 3FMCA 1GHKA 1I4XA 3D4WA 1SNOA 1BR9A 5IWAL 5ELFA 3MAQA 2JA6H 3GTKB 2ICIA 3LWEA 1WTRA 3G6EA 3CCLA 2JA6G 2KCNA 5GAHC 3ULPA 4FF4A 1CZWA 2F0KA 4DPGA 1DONA 4DV2Q 1YJNA 1QWYA 3PO2H 4JYAL 1GJXA 1H9SB 1X55A 2XWBB 3UDXA 2NWGA 3PO2G 2AKWB 2UUCQ 3NPPA 4HSPA 3A74A 1KRTA 2HIXA 1S5CD 3H0GH 1CKNA 3A5ZB 3LNNA 3GTPB 2SNMA 1NTGA 3R93A 2J7ZA 2YTYA 3L0OA 2EYJA 4K2KA 1I94L 2NVQH 3H0GG 5E4WC 5HGQA 2F0LA 1K8GA 1QG7A 1I5FA 4LJZC 2KUMA 3S1NH 1EEID 3M4OB 2IY5B 4IOAA 1RF2D 2X6GA 1JE5A 2K4KA 4YCWA 1W2BA 2K01A 1E1OA 1KQSA 1EIGA 2QILA 1L1OA 1JE4A 2E5LQ 1I6HB 5D3IB 2R3ZA 4WJ3M 2PI2A 4HIKA 3KBXA 4UY8C 2B39A 4GLVB 3WWVA 3DWQA 3HP3A 5D14A 5C44B 3ERQA 3DLLA 1TWCB 5GAGC 2JA8B 2XN9C 5C4XH 1K83B 4L5RC 1UEAB 1Y8NB 4A3LH 4A3EH 3W1BA 3I8ZA 1Q8IA 2GVAA 3PUVA 4DAPA 5C4XG 1JORA 4A3LG 4A3EG 3OOCA 4FXKC 1I3QH 4EVOA 3UDGA 3P7JA 2LXJA 3NTHA 4K6LA 4P71A 3RLOA 1GHJA 2OCEA 2VZAA 2EXZA 3K5LA 1FYCA 2B2YC 4KJOA 4B9WA 5IY0A 2UXCQ 4IQZA 4RCOA 1WOCA 4XXEA 4KY7A 4C3HB 3S1QH 2A68C 3K8AA 5DNFA 2ZTEA 4EQPA 1NUCA 1KC8C 3CCSA 2M2LA 2MHVA 3NBHA 3K0YA 1SFOB 1GVPA 2F52A 4YY3L 1LTLA 3A8IE 4HEDA 3BVZA 2DN8A 4DF7A 3EROA 2CW0D 5JOBA 2XNAC 5K36H 5BR8Q 4TSSA 1ENFA 4IJLA 1EWCA 5K36G 3S2DB 1LT5D 1XMOQ 1IBMQ 5IT9c 1MSHA 3M3YB 1P8LA 2AQ1B 1VCIA 1MGSA 4YHHL 2ICEC 2PMZB 4HMIA 2VB2X 2JA9A 1KL9A 1LT6D 2JA5H 3UI2A 2F1MA 2K7VA 4NDXA 3RZOH 1BCPB 4IUUA 4PG3A 1DYQA 2B2WC 4IZ8A 2NN6I 5M5XH 3GTLH 3E9IA 1T5XD 4XT1B 1CFMA 2I0QA 1BBXC 4O42A 4AYBE 3F1ZA 4DV4Q 4LF9Q 1KRSA 1TQOA 4QUCA 4C1NK 2NUCA 1PV4A 2NVXB 2I5MX 1B8AA 3QJYA 1AE3A 5DEHA 3K0XA 1Y69U 2Z4IA 1NR4A 1EZ8A 1HTPA 2F0NA 1JJ2A 4B08A 1TWHH 1U4LA 2QGQA 1KDCA 2BH8A 5DAUA 3RZDH 1QZGA 1A2UA 4JI1Q 3HOYB 4A3DB 4KY5A 4FDBA 3CCMA 1UWVA 1K8MA 5ELOA 2R6GA 1DCZA 3TEHB 3DM3A 3C2PA 3KK7A 3K5OA 3ND9A 3NP8A 5ELCA 1CKOA 4ZYSA 4X66Q 3J7A5 3L3OC 1RTNA 4DV5Q 5ELDA 2ID0A 1DGSA 3S14B 4BBSB 2B2TC 1PH2A 1LTGD 4X64L 2WV6D 3KYHC 2PW7A 1I4PA 5HURA 1ML0D 1YHBA 1E22A 1SLJA 3M85A 3GTMB 2B2YA 5IT9E 3NELA 1LLRD 4KN4C 5ELNA 2XRSD 3PV0A 3VR3A 2YU9H 5LHY1 1YZ6A 1QVGA 4WJ4A 1HJPA 3H09A 4FF2A 5LMNL 2F0HA 1PFBA 1D5MC 3STBC 3D31A 4RKLA 2HDMA 3B6YA 1PH4A 1F2LA 4V0BA 3GTQH 1VQDA 1BXTA 2YYZA 1PZID 1EUJA 1A3TA 4OX9Q 3KDFB 3ND8A 2VS1A 3NXWA 3J81E 3AEVA 3C46A 2A68D 1S5DD 5FO8B 5EGTA 2F0VA 3RLFA 4B3RQ 3EFXD 4N9PA 4L5SA 3R2TA 4H44C 1X54A 1A6XA 2CWAA 1CA6A 1TWAH 2Q2UA 4J1MA 1YI2A 3U58A 1M4VA 1EYCA 3H15A 2JA7H 4HJ9A 1QNUA 3DEOA 1D6EC 1JQYD 4XQJA 1KTKA 5C0XJ 3H91A 3Q0AA 4I7AA 2EJFC 4JV5L 2JA7G 1N34Q 2PCFB 3PSIA 2Y0SB 2EJGC 1NMFA 1X3FA 1WCMB 3TDQA 2G9HD 2YTXA 1B9MA 2R93H 3SXHA 1S3OA 1H9JA 3CD6A 2VB3X 1U4PA 2R93G 3TS2A 3I4MB 1V8QA 2AWNA 3OIQA 5M3FH 3S1MH 1AFPA 5IYCH 4QCLA 2UXBQ 1JICA 2RSNA 1NCVA 4RGOS 5M3FG 5IYCG 5EKIA 1H9SA 1RTOA 5EJWA 3IAYA 2MP1A 1M1KC 3CRKC 1JWSD 2J0TD 1N33L 4A3IB 4B3MQ 1BCPC 2K5VA 4H13C 1EWIA 2C9OA 2EY2A 4R8NA 1C9OA 1YJWA 1CK1A 5C6AA 4GN5A 3K57A 4ALPA 5M5YH 4J8QA 2EYHA 2Q2HA 1PLFA 2J4XA 2NB0A 3VDYA 2DY8A 3ERSX 2MO1A 4X62Q 4KI0A 2DJGC 3MHBA 3S15B 5CYUA 5LL6X 2RKSA 4QIWB 5ELEA 2RSOA 5AJ3L 2B2TA 1XNRL 2L55A 1HXYD 5ELBA 3RMHA 1L2FA 1N32L 3NWSA 2PPBC 2CQOA 3BVMA 2F0IA 4GKKL 2PO4A 4NPSA 1BCPF 1R4PB 1SMYC 1TT2A 3KF8B 1Y8PB 2UUBL 4DR7Q 4JCVE 4LF5Q 1HPCA 2RVLA 4GOPB 1R9TB 1SSOA 4YWLA 1TWFB 4WORA 1EY6A 4KJNA 1VQ9A 1SMXA 4DAMA 2ZTDA 1F9QA 2JK8A 3CAMA 4DR1Q 1VQ4A 1LTID 1QJOA 4KHPL 2R7ZB 4I7ZC 1HUNA 4RHSA 5IP7H 5JVH3 1A3VA 4LWCA 2YV5A 1HR0W 1EIFA 1Q7YC 1U5KA 2A1AA 5IP7G 4LK1C 3RUZA 3CQZH 2UUAL 1ILPA 2WAQG 3KJPA 3K80C 3NHHA 3RLNA 3TZUA 3E5SA 2HHHL 1GUGA 2VXWA 3J7AF 4QGUA 5E1FA 2RCNA 1TWGH 4F88A 4ZLTF 3D6WA 5C3WA 4N8X1 4GN3B 2ZM6L 1EU3A 3NENA 3TZDA 2B63B 4NXNL 2EVBA 1VQ6A 2LSSA 1OTCA 2Q8RE 2A6ED 3A0JA 3CU7A 2ZXPA 1PXUA 5I2YA 4JBJA 1KAWA 4WJWA 4CDEC 1EYAA 3K5NA 3D4DA 5JPMC 4DV7L 5KRUA 3OSOA 3OHXC 2HCCA 4BY1H 2PMZE 3T16A 4YWKA 1AW7A 4AQYL 4A3FB 1MBYA 4R4OA 3U9OA 4BY1G 4HCSA 1EYDA 3HOVH 3I4NB 3PQIA 3HKZE 4U68A 4R9WA 3HOVG 2HCIA 4RAUC 3M4OH 2DY7A 4OIJA 4QQBX 1XWEA 2BCOA 4UHVA 4GZYC 1PTOB 4TKOB 1SRUA 1BCPD 4X3UA 4E6IA 2TMPA 2A69C 4QY7A 4A3MB 1HNXQ 1VQPA 1I6HH 1E7ZA 1UE1A 1SYGA 1F2ZA 4OWTB 1FD7D 1HH2P 2WINB 2QA4A 1J5EL 1ET9A 4C3JH 1RKNA 2HDLA 1SNCA 1TWCH 4IO9A 4B9XA 2JA8H 4C3JG 1K83H 4JI2L 1KDAA 1LM0A 1VQAA 2PZTA 4CDFC 4JI6Q 1I4QA 3ULJA 4RGNA 2JA8G 3S9WA 4JI5L 4POGA 3T1YL 1S72A 4B3SL 1SMYD 2BE5C 4A3KG 5C0XH 2YTVA 1Y1VB 1QNKA 3K58A 3WOEA 1PRTF 1NY4A 1KNAA 5C0XG 1PH5A 1EY7A 1M8AA 2D0PA 5IGDA 2L4NA 1CQVA 3OWFA 1AP0A 4YWMA 3Q23A 3A8KE 4JI3L 2MPMA 3WDNA 4C3HH 4GOPC 1HA5A 3X3NA 5CMDA 4C3HG 1TXYA 2RDFA 1SFOH 1N36L 2MUYA 5CBEE 1HZCA 1NBWA 4JI7L 1ZKOA 4A3JH 3Q6SA 2QDBA 2XSCA 3T13A 2EYLA 5C3EH 4O0AA 1XNQQ 4A3JG 3KDFA 1EY8A 1NAPA 2KVMA 5C3EG 3AB9A 3S2DH 4IUTA 4CKBA 3M3YH 4DUZL 1GKHA 1I6VC 4FO2A 1ZXTA 1BBUA 1MHWC 2KCMA 4YCUA 4A3GB 1JOKA 3D8GA 1B7YB 1O7YA 5JPNC 4LFBL 3D0FA 4JOIC 1HUMA 2K5WA 4OL7A 4IPHA 4X64Q 4DV1Q 1DM0B 4LFAL 4LF7L 1HNZQ 3I72A 1RDPD 2CH4W 3GD7A 2RA4A 1FJGL 1O78A 4JPBW 4OONA 1F77A 2OQ0A 4NXMQ 1RODA 5GADC 4LW1A 4I65A 1SAPA 1STAA 4XTCS 1IBKL 4DK0A 3KLRA 1H9RA 2NVXH 4G7HC 3HOWH 4IPCA 3GTJB 3BU2A 5KYIA 3QOJA 1NMGA 1UAPA 2G5DA 3HZXA 3HOWG 4HIDA 2SDFA 2LS01 2X69A 2EIFA 4IUPA 3U9SA 2EPBA 1KXLA 5CORA 2NZHA 5EPLA 1BDOA 1V1PB 3HOYH 4A3DH 3OPOA 2ZXOA 3A7LA 3PIPA 4PZ6A 2A19A 3CPFA 4PMBA 1II3A 1CM9A 3HOYG 4A3DG 2PZUA 2A69D 2F0SA 2FFKB 3BJUA 5AFWA 1Y14B 4RGTA 5GQOA 2PW5A 5CGKA 1PH3A 5M3MH 1SNDA 1BO0A 3A55A 3P75A 3VYTA 5M3MG 4BBSH 4M1UB 2F3IA 2XTIA 3NK9A 5IODA 5E3FA 1PTOC 1BUVT 1QVFA 4QIWE 4OO1I 4KK7A 4XYOA 3IFTA 4BBSG 2KQ3A 3K7AH 1A63A 1VQJA 3HOZB 3KF8A 3JAME 1D8LA 1YHQA 2RQXA 3M7NA 1E24A 4X3TA 1C8CA 1OXUA 2BE5D 4GOPA 3T56B 3OTOQ 3EBEA 3MWYW 1QE6A 3BZCA 1SE2A 1D1KA 2F03A 1N33Q 4DV3L 1Q86C 1KLUD 1PTOF 5BN3A 3QOLA 2R7DA 1YNJC 3GTOB 1FGBD 4C56C 1D1IA 3F2DA 5LMUL 4JBMA 2K03A 4IUQA 4DR5Q 4IFDI 2NBFA 1NJIC 5ISRA 2ALYB 1K3RA 3GP7A 3PO3H 3MVVA 4JOIA 5C4JB 1LABA 2A5HA 2Q8IB 1X6OA 2ZT9C 3PO3G 1N32Q 4QMGA 4MN3A 2WP8J 4IPDA 1I50H 2VY3A 4TVAB 5NUCA 1XMQL 2EYMA 1WCMH 1AZQA 1DJRD 1UE7A 2E2HH 1VQKA 2MO0A 1VQ5A 4R1JA 4ZUJA 1WCMG 4IN3A 2XVSA 2K50A 3HGBA 3KBGA 1DD2A 2O5IC 4ZAIA 4B3TQ 2F0JA 4LFCQ 2E2IH 1QCBD 4ZKCB 1LTSD 4MHEA 3H3VC 2KEDA 2HUGA 4C2MB 5EAYA 3I90A 5BN4A 2BA0A 5HGTA 5IGEA 2UU9L 3J7ZC 2GVBA 2UUAQ 3J7YW 5L37A 1KHIA 4DFAA 1OO9B 1WTPA 2K75A 1Q46A 4Z9CB 1GUNA 3T51B 3S15H 2KOLA 1TS5A 2RCFA 3I91A 4A76A 1G6PA 1B53A 3S17H 3PGZA 4CGYB 1GUWA 4PZ7A 1IYVA 2IWHA 3TP8A 4JI0L 4KV6A 4K0KL 2G9DA 1STNA 1Y8OB 1A8VA 3BG3A 4DA2A 1LACA 4DR4L 5IIFA 4BA1I 1R9TH 1S4ZA 1SE8A 1PTOD 3IL8A 4MIUA 3PIOA 2B8GA 5BN5A 1WTQA 2KHJA 2EXDA 4DU9A 4AQYQ 1KD1C 2H5XA 4DV6L 4Q0FA 3FVQA 1IL2A 2E2JB 4EQ5A 3A56A 2PNRC 4KKSA 4LF6L 1C4QA 4PMCA 1BOSA 3F2UA 1PH9A 1CSQA 2JA5G 3HKZB 1D5ZC 3I2ZA 3FDTA 3T1HL 5FLMH 3TREA 2O4XA 2ATWA 4DNTB 1YNJD 2LXKA 2D2CC 2R92H 3MEFA 2BOSA 1WI5A 1O7ZA 4L5TA 3QO2A 5FLMG 3J81c 2KECA 1JR0D 2EY6A 2NN6H 2R92G 1SYBA 3N6RA 3CCJA 5I9PA 3EVQA 2EQSA 2VQEL 2NN6G 1BKBA 1PYSB 2B63H 4K5WA 1YIJA 5IYBH 5JJIA 1X3PA 4JI2Q 4C3IB 2B63G 2D62A 5IYBG 4JI5Q 2AUKA 3K6OA 2RDHA 1ONLA 3DWAA 4RMFA 3PF5A 5GROA 5JEAJ 4PNYA 4G7ZC 1E2VA 1G8ZD 3SEBA 1B3AA 4P75A 4L5QA 1G2SA 4IJHA 2MQHA 4UP9A 3J80c 2PYKA 1YNNC 4JC0A 4POFA 4DV0L 2GA4B 2EJMA 3MEHA 5A2QL 1KNEA 1L0XB 3W2DA 1G6ZA 3EQLC 3QWNA 3RD4A 3C3LA 5TSSA 1STYA 1H9MA 3O13A 1OXTA 4NW2A 4XT3B 4BA2I 1UEBA 3UE0A 4WRDA 2Z0SA 2CFMA 5KYLA 2NVYH 2JEAI 2B29A 4MTNA 1M90C 1G91A 5JJZA 2K33A 1ESRA 5IGBA 3MZ5A 4CJ1B 2NVTB 3QB3A 3J81j 1V1PA 5T1IA 4DUZQ 1JMCA 4DK6C 4LUVA 4FP5D 2Q8TA 1ZEQX 1RCVD 5C4ZA 1CSPA 1HZAA 1AEXA 2CQAA 4LFAQ 1E2WA 2D9UA 5IE8A 2JA6B 4X65L 3GTGH 3GQBA 1VF5C 1PA6A 1GM5A 2N78A 3E3XA 2HT1A 1NR2A 3T4AC 5E4XA 1FJGQ 2JJQA 4HMJA 3SK4A 2K5NA 2HQLA 1PDQA 4ME5A 1EFID 2A6EC 2Q2IA 2B2UC 1LTRD 2H4OA 1LTAD 3CHBD 2EZVA 1VQEA 3J81i 2F4VL 5I9OA 1HFGA 1CI3M 3H0GB 3J80E 2K32A 4AYBG 4LNQA 4OHJA 2NVQB 4G57A 1SJED 4O1NA 4APVA 3S1NB 4TRDA 1JC7A 5EPJA 1XX8A 1X3GA 4Y7NH 3KUPA 3I55A 4CDDC 3H3VI 1Y1WB 4DR6Q 4GKJL 1GUSA 2JEBI 4YIJA 3C1EA 1VMPA 2IX0A 1YVCA 2KJXA 2WB1E 3KLSA 4JG2A 4TQUS 5KNDA 1WVLA 4BY7H 3J80i 5CV8A 3MXNA 5HY6A 2K04A 1WTWA 1K8AC 2F0GA 1H95A 3LWUA 4BY7G 2UXDQ 1HQRD 2MJ8A 2KHSA 2Z6KC 4BBRH 4OEMB 5C4XB 4JI8L 3VR5A 5IWAQ 4DV2L 1VQNA 1X56A 1FVIA 4ZKBB 4NP5A 2XRQD 4NKLA 1LTTD 4BBRG 5IGCA 2JYOA 3F2CA 3PIP3 4PV1C 3F8TA 5I6YA 1K0RA 3FPPA 4R4IA 1XTCD 1HHVA 2UUCL 5FLXL 3MXUA 1SNQA 1I4HA 2E76C 2F0FA 5CR3A 1YNND 2FJ2A 4DV3Q 4JI4L 4JYAQ 3OW7A 2K1BA 4R4TA 2R61A 1J8IA 1EL0A 4LUOA 1KIXA 1YNXA 2X6LA 3FKIH 4X3SA 3S1QB 2QDLA 3OW2A 3TRZA 2CHBD 4KLKA 3FKIG 3VR4A 4DR2L 3S1RH 1I94Q 1TS2A 3VYSA 1FR3A 2OTLA 3HS0C 3SHLA 1BF4A 1S5FD 2DNCA 2E5LL 2O2LD 3VR2A 1LYLA 5FOBB 5E7NA 1C0AA 2M9VA 1VQBA 2VUMH 1QILA 1Q3LA 1MJCA 2F0UA 1EY4A 2B2UA 2VUMG 1HCZA 3UE1A 1FL0A 5I4DA 1ILQA 1JWUD 1RL2A 1FNVA 3W5OA 3GTKH 1KLGD 1SE3A 4ZK9B 2ZJPA 3RZOB 2E8GA 3S24A 2I5LX 1MSGA 1LV9A 2F0QA 1D2BA 4HN7A 5J3BA 3GTLB 2QEXA 2E74C 4X6AH 5EBDA 5T1GA 1JT8A 1IYUA 4RA8A 5JEAH 3TP5A 2N55A 2SEBD 4DAVA 4J6HA 3GTOH 1XYIA 2UU9Q 3T53B 1RIPA 3TN2A 5JEAG 3EIVA 2IJ0A 1V9PA 4BWGB 1G51A 1ZYRD 1QOHA 3NSWA 3GTPH 4GLXA 4JVZA 1U4MA 2L11A 1RJTA 2A74C 3PUWA 5FKAC 3SK5A 5C4JH 1K73C 4MNOA 5JAVA 4ILWA 4KHZA 4OXPA 4X3KA 4IALA 4N9TA 5KIXA 2F0OA 5BR8L 2F0PA 3BDOA 1BNZA 3E0EA 2Z6KA 4YY3Q 4DXFA 2Z6BA 1GUTA 1ICWA 3IFDA 4IFDJ 2K52A 1IZ6A 5KGUA 4A93B 3OIPA 3I73A 3R3OA 1X3EA 2BA1A 2IPKD 1EY5A 2K5HA 4XIGS 2H1EA 4NMZA 2Z8LA 3X3MA 1MI2A 5C44H 4IUVA 5M5WB 2K5DA 2B2VC 4YHHQ 2QW7A 4H02A 5C44G 1E3PA 4DUYL 2WKCA 2N88A 3CF5A 4DV4L 1TIID 3SE0A 1PH8A 3AQQA 3CC2A 2EY1A 2OTJA 3GTQB 2F3VA 2EOTA 1WD1A 3VYRA 4CHTB 3PIO3 2K14A 1U9RA 1X3QA 4L6TB 2ENBA 4K8JA 3SK6A 3GO5A 3NQIA 2AMCB 3CCQA 3CPWA 4GNXB 1PZKD 2JA7B 5IGGA 3DMUA 3N52A 2OF1A 2RDGA 3S16B 2PQAB 2F0DA 2L5TA 1HNWL 1WTHA 3W3AA 2R93B 1DOMA 3HKSA 5EBCA 3BZDB 2Q2TA 3D6CA 1S5ED 4JW0A 5J22A 3OYYA 5M9OA 2VQFL 2IX3A 3JAMc 1PMRA 5M3FB 3S1MB 2XGTA 2QEJC 2E75C 2BDOA 1X9NA 3HOUB 1NE3A 3G48A 1BVSA 2SNSA 1JCKB 4QB4A 1XTDA 4CJ2C 1SYFA 3TMEA 1W6JA 2Z1CA 4R4CA 5LMNQ 2CCZA 2CH4A 1J9OA 5G3LD 4DNRB 4OX9L 1PYWD 1JJCB 4B3RL 4DR3L 1TVXA 2KBNA 1F2MA 4A3BB 4C3IH 1K0SA 4PQXA 4X65Q 4CKCA 1SDFA 4C3IG 3E6ZX 3KLSX 1N34L 2B2VA 3P1HA 5F2DA 3K81C 5IGFA 1EYGA 1EQRA 1ENAA 3KFUA 1IL8A 1PHJA 3ICEA 1CKMA 2CWPA 1E0BA 1VQ7A 4DK3C 3J7AV 4JV5Q 2N49A 4KKUA 3S14H 1GO3E 1SJHD 1NSNS 4LF8L 1SEBD 4HR7B 5IP9H 2F4VQ 2LKVA 5IYDH 2F0MA 2KENA 3BYTB 4KN7C 2F0TA 1SR3A 3GTMH 1P16A 4K8IA 5IP9G 4J15A 1VQLA 3NTIA 3TP7A 1AH9A 3Q22A 1Q82C 4OO1H 4CDCC 1PFSA 4DK1A 3VA5A 4B3ML 3UDFA 2LMCB 2BH2A 1F9SA 2N3SA 2ZXRA 4ULLA 5DM73 3CQZB 3MFGA 4OO1G 1SYDA 1F2YA 1Q12A 1KDBA 2L12A 3A5UA 4P2CB 1TS4A 1DOKA 2NVTH 3RR5A 1B9NA 4GKJQ 4V190 2FHTA 4CJ0B 4EX5A 4LAAA 3PMFA 1HTLD 4LF4L 3WOFA 3KJOA 4HCEA 2HQEA 2WKDA 3VA7A 1T5EA 1TWGB 1TR5A 2OEOA 1MJEA 1Q90A 2EY5A 3JAMi 3R2IA 4PZ8A 1TKWB 2WB1B 4K5XA 4UDUC 5EKLA 5FO7B 2IT1A 3MXNB 1OXVA 4JI8Q 3CKIB 5AJ3Q 2XIWA 4DR7L 1XNRQ 4LF5L 1UE6A 1EOTA 5LL6S 2N8NA 4IFDH 3PUZA 2CKZB 1SNMA 1EU4A 4GKKQ 3IKJA 5CV7A 4IFDG 2UUBQ 2L0CA 4GNXC 1JOOA 4BY1B 4JI4Q 2Y0SG 1PH1A 2KCTA 4DR1L 3I4MH 1VMCA 3HOVB 3NEMA 1Q81C 4RHRA 2F0EA 3I4MG 2OWOA 3L2PA 4EQOA 2ZJQA 1BQQT 1DXMA 1Q1BA 3FEWX 4DR2Q 4KHPQ 1Y1WH 1CA5A 2LFNA 2RHQB 3EN2A 3LX0A 5CV5A 2V4DA 2WACA 2DNEA 1Y1WG 2PQEA 4A3IH 1XPOA 3BDLA 3HOXB 1ENCA 2NTSA 4YCVA 4A3IG 1WD0A 4JK1C 3NWTA 3HEJA 5CC4A 2JN4A 2PI2E 1YJ9A 1WTOA 2E2DC 5EQ0A 4C3JB 2HHHQ 5EPKA 1IXRA 2AQ3B 4JBWA 4QJFA 3CCVA 1RD9D 5JJLA 1QUQB 1VQMA 3MC0B 2NZOA 4A3KB 3SVMA 1VQIA 3V2TA 1CZGA 2ZM6Q 4A4IA 3HG9A 4NXNQ 1GUOA 4K5VA 4C1NI 3AYHB 2A6HC 4HJ7A 1XPUA 1STGA 4HJAA 1CTMA 3URYA 2KCCA 2F3WA 4H0LC 1TWFH 4R4QA 5C5MA 4DV7Q 4A3GG 3TS0A 5IT9L 1PZJD 5C4HA 1HRJA 2R7ZH 4KMUC 2R7ZG 4A3JB 1R4QB 2KEEA 3E0JA 4S3SA 1SYCA 2QKIC 1HNXL 5C3EB 4EGVA 4HJ5A 3CCUA 2Z9HA 4RG1A 3NUCA 5DM63 1PFMA 3S2HB 3U4VA 1W3SA 3L7ZC 4KHVA 4DKAC 3J81L 4BXXH 4LUZA 1E1TA 2QF7A 1IW7C 1Q1EA 4BXXG 1I4GA 1EQTA 4JI6L 1J5EQ 2I46A 4UP8A 4GNXA 1IKMA 1JB3A 5IOCA 4FF1A 3NBIA 3KLWA 3DEPA 1J6QA 2IL8A 2PQAA 4DNIA 4DAYB 2EYPA 4DUYQ 3G71A 3KF6B 4F8MA 1EFWA 3T1YQ 4B3SQ 1EEFD 3PF4A 3HOWB 3D3RA 5CV4A 1IBLL 2K5QA 1CHPD 1K3BC 1UNSA 2EDGA 3ZYYX 1VF7A 3J80L 3Q8DA 5D65A 4A3FH 5EKKA 1B44D 3NTKA 2LY7A 1CUKA 3I4NH 4A3CH 1CT1D 3D4RA 4RWSC 2VW9A 2OT2A 4A3FG 3CC4A 4JI3Q 1SYEA 4IPGA 1VQ8A 1CQFA 4A3CG 3I4NG 1XNQL 1N36Q 1HFNA 1PTOH 5I2XA 4ABNA 4CKEA 4A75A 4HAEA 4JI7Q 2IHEA 4A93H 3M7GA 5M3MB 2OQKA 4A3MH 4XQNA 4N8FA 3L9AX 1Z7TA 4A93G 2MGSA 5FO9B 4A3MG 1HNWQ 3MA2B 1B1ZA 1V1OA 3CP0A 4DV1L 3OWEB 1K8OA 1EZ6A 1ESFA 2A73B 3I70A 4FNFA 5M5WH 1HNZL 1S40A 2ES2A 3NE5B 3K7AB 3QIAA 4LFBQ 2K05A 2JE6I 2VQFQ 4NXML 1B4OA 2D5DA 4DN4M 3LGJA 3RN5A 1X65A 4LF7Q 1MD2D 1GOZA 2RF4A 1PH6A 2A6HD 1I4RA 1Y1VH 2ZTCA 3NQTA 4KTAA 3G7LA 1Y1VG 3PO2B 1IBKQ 4JBKA 2VL6A 2Z4HA 2SOBA 2JXMB 2KA7A 1JWMD 3V96A 4CBVA 2HD3A 4L63B 4DR3Q 1HZBA 1ZYRC 4BS9A 2WAQE 5DLQE 3PO3B 3H6MA 1Q8KA 3PCOB 2C5CA 1I50B 3S16H 1HR0L 5COYA 2B2WA 2M00A 1A0IA 2FXQA 1VQCA 2FMMA 2L9HA 2FMCA 1EQQA 2E2HB 4FVMA 1GD7A 1A62A 1IW7D 4A3GH 5CV6A 4RKBA 2GN5A 3G6JB 3H94A 3I4LA 3SGIA 1C7YA 3H3VH 4G4KA 2ASBA 3A8JE 3MTSA 1GXDC 4LF8Q
chains in the Genus database with same CATH topology
5A2QE 2E2IB 1PFNA 1LTBD 1PRTB 4XDXA 1SBBB 1WTXA 3P20A 4A3EB 2TSSA 5KNCA 1FNUA 4RGMA 1EWHA 1I3QB 2JP1A 2B8FA 1O7LA 2XWJB 1TY2A 1B2TA 1G2TA 1SXTA 4G7OC 1STHA 2EE1A 3S17B 2AQ2B 4UAIA 4LMQD 1SE4A 1XXGA 4H7BA 1IKLA 2JSOA 1G291 2AUJD 4KY6A 1LO5D 3DXJC 4RCNA 4K14A 1HQMC 4FYDA 2AWOA 1STEA 2PZWA 4FXDA 4XYQA 3TSSA 4L8JA 4K6DA 2NTTA 2JA5B 3C1FA 3SDZA 3QG1A 4OGQC 3R8BA 4F7XA 2I07B 3FPUB 3BYYB 1UUPA 5M5XB 1U4RA 1A3UA 1QB5D 2R92B 3PUXA 1WTVA 4RH6A 5J39A 1JOQA 4R8IA 2IW3A 4KD3A 1TWHB 1CHQD 1F9PA 1D5XC 3RZDB 5FK9C 2NZ1D 4RFBA 5K5PA 1EY9A 3TBIB 2VNUD 3VR6A 5G3LF 2CVRA 1L0YB 5FLXE 3AMUA 4ID6A 5J1ZA 3GV6A 4DAYA 4ZUIA 1EQVA 2IX1A 2EYFA 1HA6A 1OXSC 3DWPA 4DGZA 1E2ZA 1AN8A 4WFN3 3A7AB 2NVYB 1KABA 2YU9B 5D3DA 5C5LA 2WIIB 4FXGC 1PRTC 2K28A 3I3CA 3OMCA 3Q24A 1TU2B 3PUYA 1B50A 2K6AA 4Q5VA 1KAAA 3EJIA 4U673 5C0XI 1O80A 4HSVA 5KEEA 5A35A 2FINB 5I6WA 3GTGB 3DM1A 1AZPA 3FRPB 1C48A 1TWAB 1LT4D 2F4IA 5C3XA 1VDZA 1Z6HA 1A15A 1V43A 3BDCA 2RBMA 1TY0A 3ITPA 4AYBB 3HRZC 1A2TA 3SR1A 5CV9A 3JAML 5KNBA 3MXGA 1Z47A 3VYUA 4OIKA 4KD4A 3V05A 2EYOA 1X32A 1IHZA 4Y7NB 1EIHA 3CRLC 4PMWA 1F9RA 3K5MA 1STBA 1TS3A 4QF4A 3SK8A 4BY7B 5M5YB 2L1BA 4F87A 1DOLA 3K59A 1SNPA 4IURA 1ET6A 4BBRB 1FNWA 3DUZA 4FF3A 1LT3D 4M8AA 5JVG3 4XQQA 1EY0A 3M4YA 3A54A 3GV3A 4IUNA 1OXXK 4ODGA 3TP6A 2NYZD 4KKTA 3MFYA 2BDNA 3FKIB 4ZQ3A 3AU7A 4DXGA 3MXPA 3BS1A 3S1RB 5CBAE 2QCPX 1PRTD 3DHQA 3EA6A 3ONAB 2WAQB 1DZ1A 4ZRZA 2O5JC 1W6KA 2CW0C 1H9KA 3OMGA 4EQNA 4QUFA 1RHPA 2F0WA 2OXPA 2VUMB 4HTHA 4K2LA 3BVGA 1S5BD 3FMCA 1GHKA 1I4XA 3D4WA 1SNOA 1BR9A 5ELFA 3MAQA 3GTKB 2ICIA 3LWEA 1WTRA 2KCNA 4FF4A 1CZWA 2F0KA 1DONA 1QWYA 1GJXA 1H9SB 2XWBB 2NWGA 3NPPA 4HSPA 1S5CD 3GTPB 3LNNA 2SNMA 3R93A 2J7ZA 2EYJA 4K2KA 5E4WC 2F0LA 1QG7A 4LJZC 2KUMA 1EEID 3M4OB 1RF2D 2X6GA 2K01A 1EIGA 2QILA 1JE4A 1I6HB 5D3IB 2R3ZA 3KBXA 2B39A 3DWQA 3HP3A 5D14A 5C44B 3ERQA 1TWCB 2JA8B 2XN9C 1K83B 1UEAB 1Y8NB 3I8ZA 1Q8IA 3PUVA 4DAPA 1JORA 3OOCA 4FXKC 4EVOA 3P7JA 3NTHA 4K6LA 1GHJA 2EXZA 3K5LA 1FYCA 2B2YC 4KJOA 4B9WA 4IQZA 4RCOA 4XXEA 4KY7A 4C3HB 2A68C 5DNFA 4EQPA 1NUCA 2M2LA 2MHVA 3NBHA 3K0YA 1SFOB 3A8IE 4HEDA 3BVZA 2DN8A 4DF7A 3EROA 2CW0D 5JOBA 2XNAC 5K36H 4TSSA 1ENFA 1EWCA 5K36G 3S2DB 1LT5D 1MSHA 3M3YB 2AQ1B 1VCIA 1MGSA 2ICEC 2PMZB 4HMIA 2VB2X 1LT6D 3UI2A 2F1MA 2K7VA 4NDXA 1BCPB 4IUUA 1DYQA 2B2WC 4IZ8A 2NN6I 1T5XD 4XT1B 1CFMA 1BBXC 4O42A 1TQOA 4QUCA 2NVXB 4C1NK 2NUCA 3QJYA 5DEHA 1Y69U 2Z4IA 1NR4A 1EZ8A 1HTPA 2F0NA 4B08A 1U4LA 1KDCA 5DAUA 1A2UA 3HOYB 4A3DB 4KY5A 1K8MA 2R6GA 1DCZA 3C2PA 3KK7A 3K5OA 3ND9A 3NP8A 5ELCA 4ZYSA 3L3OC 1RTNA 5ELDA 2ID0A 4BBSB 3S14B 2B2TC 1LTGD 2WV6D 2PW7A 1I4PA 5HURA 1ML0D 3M85A 3GTMB 2B2YA 5IT9E 1LLRD 4KN4C 2XRSD 3PV0A 3VR3A 5LHY1 3H09A 4FF2A 2F0HA 1PFBA 1D5MC 3D31A 4RKLA 2HDMA 1F2LA 4V0BA 1BXTA 2YYZA 1PZID 1A3TA 3ND8A 3NXWA 3J81E 3C46A 2A68D 1S5DD 5FO8B 5EGTA 2F0VA 3RLFA 3EFXD 4N9PA 3R2TA 4H44C 1A6XA 1CA6A 4J1MA 1M4VA 1EYCA 1QNUA 3DEOA 1D6EC 1JQYD 4XQJA 1KTKA 5C0XJ 3H91A 3Q0AA 2EJFC 2PCFB 2Y0SB 2EJGC 3TDQA 1WCMB 2G9HD 1B9MA 3SXHA 1H9JA 2VB3X 1U4PA 3I4MB 1V8QA 2AWNA 3OIQA 1AFPA 4QCLA 1JICA 2RSNA 1NCVA 4RGOS 5EKIA 1H9SA 1RTOA 5EJWA 3IAYA 2MP1A 3CRKC 1JWSD 2J0TD 4A3IB 1BCPC 4H13C 2EY2A 2C9OA 4R8NA 1CK1A 5C6AA 3K57A 4J8QA 2EYHA 1PLFA 2J4XA 2NB0A 2DY8A 4KI0A 3MHBA 3S15B 5CYUA 5LL6X 2RKSA 4QIWB 5ELEA 2RSOA 2B2TA 2L55A 1HXYD 5ELBA 3RMHA 3NWSA 2PPBC 3BVMA 2F0IA 2PO4A 1BCPF 1R4PB 1SMYC 1TT2A 1Y8PB 1HPCA 2RVLA 1R9TB 1SSOA 1TWFB 4WORA 1EY6A 4KJNA 1F9QA 1LTID 1QJOA 2R7ZB 4I7ZC 1HUNA 4RHSA 5JVH3 1A3VA 4LK1C 3RUZA 1ILPA 3NHHA 3TZUA 3E5SA 1GUGA 2VXWA 3J7AF 5E1FA 4F88A 4ZLTF 3D6WA 5C3WA 1EU3A 3TZDA 2B63B 2EVBA 2Q8RE 2A6ED 3CU7A 2ZXPA 1PXUA 5I2YA 4WJWA 1EYAA 3K5NA 3D4DA 5JPMC 5KRUA 3OSOA 3OHXC 2HCCA 3T16A 1AW7A 4A3FB 1MBYA 3U9OA 4HCSA 1EYDA 3I4NB 4U68A 4R9WA 2HCIA 4RAUC 2DY7A 4OIJA 1XWEA 2BCOA 4GZYC 1PTOB 4TKOB 1BCPD 4X3UA 4E6IA 2TMPA 2A69C 4A3MB 1SYGA 1F2ZA 1FD7D 2WINB 1ET9A 1RKNA 2HDLA 1SNCA 4B9XA 4C3JG 1KDAA 2PZTA 1I4QA 4RGNA 3S9WA 1SMYD 2BE5C 5C0XH 1Y1VB 1QNKA 3K58A 3WOEA 1PRTF 1KNAA 5C0XG 1EY7A 1M8AA 5IGDA 2L4NA 1CQVA 3OWFA 1AP0A 3Q23A 3A8KE 2MPMA 3WDNA 1HA5A 3X3NA 5CMDA 4C3HG 2RDFA 2MUYA 5CBEE 1ZKOA 3Q6SA 2QDBA 2XSCA 3T13A 2EYLA 1EY8A 1NAPA 2KVMA 3AB9A 4IUTA 4CKBA 1I6VC 4FO2A 1ZXTA 4A3GB 1JOKA 3D8GA 1O7YA 5JPNC 1HUMA 2K5WA 4OL7A 1DM0B 3I72A 1RDPD 3GD7A 2RA4A 1O78A 1F77A 1RODA 4I65A 1SAPA 1STAA 4XTCS 4DK0A 3KLRA 1H9RA 4G7HC 3GTJB 5KYIA 3QOJA 1UAPA 3HZXA 2SDFA 2LS01 2X69A 4IUPA 3U9SA 2EPBA 5CORA 5EPLA 1BDOA 1V1PB 3OPOA 2ZXOA 3A7LA 4PMBA 1II3A 1CM9A 2PZUA 2A69D 2F0SA 5AFWA 2FFKB 5CGKA 4RGTA 2PW5A 1SNDA 1BO0A 3A55A 3P75A 3VYTA 4M1UB 5IODA 3NK9A 5E3FA 1PTOC 1BUVT 4OO1I 4KK7A 4XYOA 3IFTA 2KQ3A 3HOZB 3KF8A 3JAME 2RQXA 3M7NA 4X3TA 1C8CA 1OXUA 2BE5D 3T56B 3MWYW 1QE6A 1SE2A 1D1KA 2F03A 1KLUD 1PTOF 5BN3A 3QOLA 1YNJC 3GTOB 1FGBD 4C56C 1D1IA 2K03A 4IUQA 4IFDI 2NBFA 5ISRA 3GP7A 3MVVA 5C4JB 1LABA 2A5HA 2Q8IB 2ZT9C 4QMGA 4MN3A 2WP8J 5NUCA 2EYMA 1AZQA 1DJRD 4ZUJA 4IN3A 2XVSA 3HGBA 3KBGA 1DD2A 2O5IC 4ZAIA 2F0JA 1QCBD 4ZKCB 1LTSD 4MHEA 3H3VC 2KEDA 2HUGA 4C2MB 3I90A 5BN4A 2BA0A 5HGTA 5IGEA 3J7YW 4DFAA 1OO9B 1WTPA 4Z9CB 1GUNA 3T51B 2KOLA 1TS5A 3I91A 1B53A 4CGYB 1GUWA 1IYVA 2IWHA 3TP8A 4KV6A 2G9DA 1STNA 1Y8OB 3BG3A 4DA2A 1LACA 5IIFA 4BA1I 1S4ZA 1PTOD 3IL8A 4MIUA 2B8GA 5BN5A 1WTQA 4DU9A 4Q0FA 3FVQA 2E2JB 3A56A 2PNRC 4KKSA 1C4QA 4PMCA 1BOSA 3F2UA 3HKZB 1D5ZC 3FDTA 2O4XA 4DNTB 1YNJD 2D2CC 2BOSA 1O7ZA 3QO2A 2KECA 1JR0D 2EY6A 2NN6H 1SYBA 3N6RA 5I9PA 3EVQA 2NN6G 4K5WA 1X3PA 4C3IB 2D62A 2AUKA 3K6OA 2RDHA 1ONLA 3DWAA 5JEAJ 4PNYA 4G7ZC 1E2VA 1G8ZD 3SEBA 1B3AA 1G2SA 2PYKA 1YNNC 2GA4B 2EJMA 3MEHA 5A2QL 1KNEA 1L0XB 3W2DA 1G6ZA 3EQLC 3QWNA 3RD4A 3C3LA 5TSSA 1STYA 1H9MA 3O13A 1OXTA 4NW2A 4XT3B 4BA2I 4WRDA 5KYLA 2JEAI 1G91A 5JJZA 2K33A 1ESRA 5IGBA 3MZ5A 4CJ1B 2NVTB 3QB3A 1V1PA 5T1IA 4FP5D 2Q8TA 1ZEQX 1RCVD 5C4ZA 1AEXA 2CQAA 1E2WA 2D9UA 2JA6B 3GQBA 1VF5C 1NR2A 3T4AC 5E4XA 4HMJA 3SK4A 1PDQA 4ME5A 1EFID 2A6EC 2B2UC 1LTRD 2H4OA 1LTAD 3CHBD 2EZVA 5I9OA 1HFGA 1CI3M 3H0GB 3J80E 2K32A 4OHJA 2NVQB 4G57A 1SJED 4O1NA 3S1NB 4TRDA 1JC7A 5EPJA 1XX8A 3KUPA 1Y1WB 1GUSA 2JEBI 4YIJA 3C1EA 1VMPA 2IX0A 2KJXA 3KLSA 4TQUS 5KNDA 1WVLA 5CV8A 3MXNA 2K04A 1WTWA 2F0GA 3LWUA 1HQRD 2MJ8A 2KHSA 5C4XB 3VR5A 4ZKBB 4NP5A 2XRQD 4NKLA 1LTTD 5IGCA 2JYOA 3PIP3 4PV1C 5I6YA 3FPPA 1XTCD 1HHVA 5FLXL 3MXUA 1SNQA 1I4HA 2E76C 2F0FA 5CR3A 1YNND 2FJ2A 3OW7A 2K1BA 2R61A 1J8IA 1EL0A 2X6LA 4X3SA 3S1QB 2CHBD 3VR4A 1TS2A 3VYSA 1FR3A 3HS0C 3SHLA 1BF4A 1S5FD 2DNCA 2O2LD 3VR2A 5FOBB 2M9VA 1QILA 1Q3LA 2F0UA 1EY4A 2B2UA 1HCZA 5I4DA 1ILQA 1JWUD 1FNVA 1KLGD 1SE3A 4ZK9B 3RZOB 1MSGA 1LV9A 2F0QA 1D2BA 4HN7A 3GTLB 2E74C 5EBDA 5T1GA 1IYUA 4RA8A 5JEAH 3TP5A 2N55A 2SEBD 4DAVA 4J6HA 1XYIA 3T53B 3TN2A 5JEAG 2IJ0A 4BWGB 1ZYRD 1QOHA 3NSWA 1U4MA 2L11A 1RJTA 2A74C 3PUWA 5FKAC 3SK5A 5JAVA 4ILWA 4KHZA 4X3KA 4IALA 4N9TA 5KIXA 2F0OA 2F0PA 3BDOA 1BNZA 4DXFA 1GUTA 1ICWA 3IFDA 4IFDJ 5KGUA 4A93B 3OIPA 3I73A 3R3OA 2BA1A 2IPKD 1EY5A 4XIGS 4NMZA 2H1EA 2Z8LA 3X3MA 1MI2A 5M5WB 4IUVA 2K5DA 2B2VC 2WKCA 2N88A 1TIID 3SE0A 2EY1A 3GTQB 2F3VA 2EOTA 1WD1A 3VYRA 4CHTB 3PIO3 1U9RA 1X3QA 4L6TB 2ENBA 4K8JA 3SK6A 3GO5A 3NQIA 1PZKD 2JA7B 5IGGA 3DMUA 3N52A 2OF1A 2RDGA 3S16B 2F0DA 2L5TA 3W3AA 2R93B 1DOMA 5EBCA 3BZDB 3D6CA 1S5ED 5J22A 5M9OA 2IX3A 1PMRA 5M3FB 3S1MB 2QEJC 2E75C 2BDOA 3HOUB 2SNSA 1JCKB 4QB4A 4CJ2C 1SYFA 3TMEA 1W6JA 2Z1CA 1J9OA 5G3LD 4DNRB 1PYWD 1TVXA 1F2MA 4A3BB 4PQXA 4CKCA 1SDFA 4C3IG 3E6ZX 3KLSX 2B2VA 3P1HA 5F2DA 5IGFA 1ENAA 1IL8A 1E0BA 3J7AV 4KKUA 1SJHD 1NSNS 1SEBD 4HR7B 2LKVA 2F0MA 3BYTB 4KN7C 2F0TA 4K8IA 3TP7A 3NTIA 3Q22A 4OO1H 4DK1A 3VA5A 2LMCB 1F9SA 2ZXRA 4ULLA 5DM73 3CQZB 3MFGA 4OO1G 1SYDA 1F2YA 1Q12A 1KDBA 2L12A 4P2CB 1TS4A 1DOKA 1B9NA 4V190 2FHTA 4CJ0B 4LAAA 3PMFA 1HTLD 3WOFA 4HCEA 2HQEA 2WKDA 3VA7A 1T5EA 1TWGB 1TR5A 2OEOA 1Q90A 2EY5A 3R2IA 1TKWB 2WB1B 4K5XA 4UDUC 5EKLA 5FO7B 2IT1A 1OXVA 3CKIB 2XIWA 1EOTA 5LL6S 4IFDH 3PUZA 1SNMA 1EU4A 3IKJA 5CV7A 4IFDG 2L0CA 1JOOA 4BY1B 1VMCA 3HOVB 4RHRA 2F0EA 4EQOA 1BQQT 1DXMA 1Q1BA 3FEWX 1CA5A 2LFNA 3LX0A 5CV5A 2V4DA 2WACA 2DNEA 2PQEA 3BDLA 3HOXB 1ENCA 2NTSA 1WD0A 4JK1C 3NWTA 3HEJA 5CC4A 1WTOA 2E2DC 5EQ0A 4C3JB 5EPKA 2AQ3B 4JBWA 1RD9D 3MC0B 4A3KB 3SVMA 3V2TA 1CZGA 3HG9A 1GUOA 4K5VA 4C1NI 2A6HC 1STGA 1CTMA 3URYA 2KCCA 2F3WA 4H0LC 5C5MA 5IT9L 1PZJD 5C4HA 1HRJA 4KMUC 4A3JB 1R4QB 2KEEA 3E0JA 4S3SA 1SYCA 2QKIC 5C3EB 4EGVA 3NUCA 5DM63 1PFMA 3S2HB 3L7ZC 4KHVA 3J81L 2QF7A 1IW7C 1Q1EA 1I4GA 1EQTA 2I46A 1IKMA 1JB3A 5IOCA 4FF1A 3NBIA 3DEPA 2IL8A 2EYPA 4F8MA 1EEFD 3HOWB 3D3RA 5CV4A 2K5QA 1CHPD 1UNSA 2EDGA 3ZYYX 1VF7A 3J80L 5D65A 5EKKA 1B44D 3NTKA 2LY7A 1CT1D 3D4RA 4RWSC 2OT2A 1SYEA 1CQFA 1HFNA 1PTOH 5I2XA 4ABNA 4CKEA 4HAEA 3M7GA 5M3MB 4XQNA 3L9AX 1Z7TA 2MGSA 5FO9B 3MA2B 1B1ZA 1V1OA 3OWEB 1K8OA 1EZ6A 1ESFA 2A73B 3I70A 4FNFA 3NE5B 3K7AB 3QIAA 2K05A 2JE6I 1B4OA 2D5DA 4DN4M 1MD2D 1GOZA 2A6HD 1I4RA 3NQTA 4KTAA 3G7LA 3PO2B 2Z4HA 2SOBA 2JXMB 2KA7A 1JWMD 3V96A 4CBVA 4L63B 1ZYRC 4BS9A 3PO3B 3H6MA 2C5CA 1I50B 5COYA 2B2WA 2M00A 2FMMA 2L9HA 2FMCA 2E2HB 4FVMA 1IW7D 5CV6A 4RKBA 3H94A 3G6JB 3I4LA 4G4KA 3A8JE 3MTSA 1GXDC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A8K E;  1Y8O B;  3WDN A;  2F1M A;  2K7V A;  3BG3 A;  1LAC A;  3M7N A;  3TZU A;  3LNN A;  4BA1 I;  1OXU A;  2BE5 D;  3D4R A;  4JK1 C;  3T56 B;  1GUG A;  2EJF C;  2NN6 I;  3P20 A;  2PCF B;  3VR6 A;  5KNC A;  1CFM A;  3VR4 A;  2EJG C;  4LJZ C;  3SE0 A;  1B9M A;  1EWH A;  2B8G A;  5BN5 A;  4KKU A;  1ZKO A;  1E2W A;  4JBW A;  1H9J A;  3GQB A;  1VF5 C;  5BN3 A;  4HR7 B;  1FR3 A;  2EVB A;  1YNJ C;  4KN7 C;  1V8Q A;  2DNC A;  3QJY A;  2B8F A;  2A6E D;  3VR2 A;  1O7L A;  1OXS C;  1Y69 U;  1GUO A;  3AB9 A;  1HTP A;  1Z7T A;  2PNR C;  1E2Z A;  2A6H C;  4KKS A;  2A6E C;  1H9S A;  1I6V C;  4G7O C;  3A7A B;  3M4Y A;  4OO1 H;  1K8O A;  1CTM A;  4DK1 A;  2LMC B;  2KCC A;  1HCZ A;  1OXX K;  4H0L C;  4OO1 G;  3CRK C;  3NE5 B;  1Q12 A;  2PPB C;  1LAB A;  3QIA A;  2Q8I B;  2JE6 I;  4KKT A;  1TU2 B;  2ZT9 C;  3PUY A;  4H13 C;  4DNT B;  1B9N A;  2D2C C;  3I72 A;  2D5D A;  1K8M A;  3MFY A;  1G29 1;  3GD7 A;  1CI3 M;  2AUJ D;  1O78 A;  1Y8N B;  2R6G A;  2K32 A;  1DCZ A;  2NN6 H;  3DXJ C;  3PUV A;  3N6R A;  2A6H D;  2E74 C;  4RCN A;  2L5T A;  3ND9 A;  4XTC S;  1HQM C;  1IYU A;  3OOC A;  4KI0 A;  2NN6 G;  4KMU C;  2AWO A;  1T5E A;  3KLR A;  3W3A A;  4DK0 A;  3VA7 A;  1Q90 A;  5JEA H;  1H9R A;  4G7H C;  5A35 A;  1TKW B;  3T53 B;  3HGB A;  4GZY C;  5JEA G;  4TKO B;  1GHJ A;  1DD2 A;  2O5I C;  2IT1 A;  1PMR A;  1FYC A;  4L8J A;  2A69 C;  1OXV A;  2O5J C;  2D62 A;  3M85 A;  1GUS A;  1H9K A;  2AUK A;  2CW0 C;  2E75 C;  2JEB I;  2BDO A;  2JXM B;  2KA7 A;  1ONL A;  4IQZ A;  3L7Z C;  4KN4 C;  1SMY C;  3PV0 A;  3U9S A;  3VR3 A;  1Y8P B;  4IFD H;  3PUZ A;  4TQU S;  3SDZ A;  5KND A;  2A68 C;  1ZYR C;  3QG1 A;  2QF7 A;  4OGQ C;  1HPC A;  1BDO A;  3PUW A;  1IW7 C;  1Q1E A;  3IKJ A;  1VDZ A;  1E2V A;  1Z6H A;  3OPO A;  4G7Z C;  5BN4 A;  4IFD G;  1V43 A;  1IYV A;  2BA0 A;  3LWU A;  4KHZ A;  3D31 A;  3FMC A;  1GHK A;  3A7L A;  1YNN C;  2EJM A;  4DNR B;  3A8I E;  2A69 D;  3BDO A;  3EQL C;  3PUX A;  2DN8 A;  3VR5 A;  2YYZ A;  5KNB A;  1H9M A;  2V4D A;  1GUN A;  1GUT A;  3T51 B;  5K36 H;  1OXT A;  4BA2 I;  1QJO A;  2BE5 C;  3ND8 A;  3I73 A;  4I7Z C;  5C0X H;  4PV1 C;  2A68 D;  2BA1 A;  5K36 G;  1DXM A;  1Q1B A;  3FPP A;  1IW7 D;  3RLF A;  1GJX A;  1H9S B;  3MXU A;  5C0X G;  2E76 C;  3IFT A;  3H94 A;  3I4L A;  2JEA I;  1VCI A;  2EDG A;  4XIG S;  4LK1 C;  1VF7 A;  3A8J E;  2K33 A;  4H44 C;  2DNE A;  3OW7 A;  3CRL C;  1A6X A; 
#chains in the Genus database with same CATH topology
 3AFP A;  5A2Q E;  2E2I B;  3HOU H;  1PFN A;  2A8V A;  3OTO L;  1LTB D;  1PRT B;  4GLA C;  4XDX A;  1SBB B;  3HOU G;  1WTX A;  5LMN W;  3P20 A;  1VQO A;  4A3E B;  2TSS A;  5KNC A;  1FNU A;  4RGM A;  1EWH A;  3AFQ A;  3M9B A;  1VS0 A;  3GTJ H;  1I3Q B;  2JP1 A;  3CME A;  1BBW A;  3RN2 A;  2B8F A;  1D7Q A;  1O7L A;  2XWJ B;  4DR5 L;  1K9M C;  1TY2 A;  1B2T A;  4A3B H;  4LF4 Q;  1SN8 A;  1G2T A;  1SXT A;  4G7O C;  4A3B G;  1STH A;  2EE1 A;  5LMU Q;  3S17 B;  2AQ2 B;  4UAI A;  4LMQ D;  1SE4 A;  1XXG A;  4H7B A;  3BZK A;  1IKL A;  2JSO A;  1G29 1;  3U50 C;  2AUJ D;  5FLX c;  4KY6 A;  1LO5 D;  3DXJ C;  1MKH A;  4RCN A;  1XMQ Q;  4K14 A;  3IRB A;  1HQM C;  1N8R C;  4FYD A;  3FHW A;  2AWO A;  3E9H A;  4B3T L;  4LFC L;  1QUQ A;  1STE A;  2PZW A;  4AH6 A;  1IYJ B;  4FXD A;  4XYQ A;  3TSS A;  5FJ8 H;  3W1G A;  4L8J A;  3HOZ H;  1EOV A;  1O7I A;  3M4Q A;  4K6D A;  2DUD A;  2C35 B;  2NTT A;  5FJ8 G;  4UPA A;  3HOZ G;  2JA5 B;  3C1F A;  3SDZ A;  3STB D;  1CKN B;  3QG1 A;  4OGQ C;  3R8B A;  1B3Q A;  4F7X A;  1LUZ A;  3FPU B;  2I07 B;  3BYY B;  4GS3 A;  1UUP A;  5M5X B;  1PH7 A;  1U4R A;  1A3U A;  1YBY A;  2I5H A;  1PVO A;  2PNH A;  1QB5 D;  1B70 B;  4HIM A;  2R92 B;  1MIU A;  3PUX A;  1UE5 A;  2L15 A;  1WTV A;  2UXC L;  4RH6 A;  1N9W A;  5J39 A;  1JOQ A;  1XPR A;  4GN4 B;  4R8I A;  1EIY B;  1YEZ A;  2IW3 A;  1L1O B;  3M4P A;  4P74 A;  1YHA A;  1K28 A;  4KD3 A;  4OWX B;  3I56 A;  1ICF B;  1TWH B;  2WB1 G;  1CHQ D;  1VQF A;  1F9P A;  3I4O A;  2R7F A;  1D5X C;  3CW2 C;  3RZD B;  5FK9 C;  2NZ1 D;  2MNA A;  4RFB A;  5K5P A;  4JI0 Q;  1EY9 A;  4K0K Q;  3TBI B;  2VNU D;  4DR4 Q;  3VR6 A;  2ZJR A;  5G3L F;  2CVR A;  1L0Y B;  5FLX E;  1XMO L;  1IBM L;  1VQG A;  2WFW A;  3AMU A;  4ID6 A;  4MZ9 A;  5J1Z A;  4AIM A;  3GV6 A;  1JB7 A;  4DAY A;  3FP9 A;  4ZUI A;  1EQV A;  2IX1 A;  3QR8 A;  2EYF A;  1HA6 A;  1OXS C;  3KF6 A;  3DWP A;  4DGZ A;  4DV6 Q;  1E2Z A;  1AN8 A;  4WFN 3;  4ZCK A;  3A7A B;  2NVY B;  1KAB A;  2YU9 B;  3I7F A;  5D3D A;  4C2M H;  5C5L A;  4HJ8 A;  4LF6 Q;  3CCR A;  2MFI A;  3HOX H;  1VQH A;  2WII B;  4FXG C;  1PRT C;  2K28 A;  3NBH B;  3OMC A;  3I3C A;  5GAE C;  3Q24 A;  3CC7 A;  1TU2 B;  4LF9 L;  3PUY A;  3HOX G;  2RHS B;  1B50 A;  2K6A A;  3T1H Q;  5H1S E;  3F2B A;  4Q5V A;  1KAA A;  3EJI A;  4IOC A;  4U67 3;  3KOJ A;  5C0X I;  5JJK A;  4UP7 A;  3UDI A;  1O80 A;  4HSV A;  2HIV A;  5KEE A;  5A35 A;  4A3K H;  2FIN B;  5I6W A;  3GTG B;  3DM1 A;  2VQE Q;  1AZP A;  4JI1 L;  3FRP B;  1C48 A;  1TWA B;  1LT4 D;  2AHO B;  2F4I A;  5C3X A;  1VDZ A;  1Z6H A;  4X66 L;  1A15 A;  4DV5 L;  4OWW B;  1V43 A;  2D0O A;  1IBL Q;  3BDC A;  3ULL A;  2RBM A;  1TY0 A;  3G4S A;  3ER0 A;  3ITP A;  1Z9F A;  4AYB B;  3HRZ C;  1A2T A;  3SR1 A;  5CV9 A;  3JAM L;  5KNB A;  1WYD A;  4DV0 Q;  1WFQ A;  3MXG A;  1YIT A;  3HFZ B;  1ASZ A;  2E2J H;  1Z47 A;  3VYU A;  4OIK A;  4KD4 A;  3V05 A;  2EYO A;  1QVC A;  3GDE A;  1X32 A;  1IHZ A;  4Y7N B;  1EIH A;  4ME3 A;  2DJF C;  2KHI A;  3CRL C;  4PMW A;  3S2H H;  1F9R A;  3K5M A;  3RNU A;  3HKZ G;  3JC6 6;  1STB A;  2IHF A;  1TS3 A;  4QF4 A;  3SK8 A;  4BY7 B;  1V1Q A;  5M5Y B;  3CCE A;  1NNX A;  2L1B A;  3U4Z A;  4F87 A;  1DOL A;  4P73 A;  2B3G A;  3K59 A;  1SNP A;  4IUR A;  1L0W A;  1ET6 A;  1T9H A;  4BBR B;  1FNW A;  3DUZ A;  1U0L A;  4FF3 A;  2Y0S E;  1L1O C;  1LT3 D;  4P72 A;  2V1C C;  4M8A A;  5JVG 3;  1JJG A;  4XQQ A;  4MTK A;  4QL5 A;  1EY0 A;  3M4Y A;  3A54 A;  4HIO A;  2DGY A;  3GV3 A;  3TQY A;  4IUN A;  1OXX K;  4ODG A;  1HZ9 A;  3TP6 A;  2NYZ D;  4KKT A;  4NB3 A;  3MFY A;  1ASY A;  2BDN A;  3FKI B;  4ZQ3 A;  3AU7 A;  2UXB L;  4OEL B;  4DXG A;  3MXP A;  2P5Z X;  2JQO A;  5IYD G;  4Y52 H;  3BS1 A;  3S1R B;  4DR6 L;  1QZH A;  5CBA E;  2QCP X;  1FGU A;  3CXC A;  3CMA A;  1PRT D;  1WJJ A;  3DHQ A;  3EA6 A;  3K7U C;  3ONA B;  2WAQ B;  1DZ1 A;  4ZRZ A;  2O5J C;  1W6K A;  1HR0 Q;  2CW0 C;  1H9K A;  3OMG A;  4EQN A;  4QUF A;  1XJV A;  1RHP A;  2F0W A;  2OXP A;  2VUM B;  4O2D A;  1SRO A;  4HTH A;  4K2L A;  2UXD L;  3ZJY C;  1PYB A;  1AE2 A;  4X62 L;  3BVG A;  1S5B D;  3FMC A;  1GHK A;  1I4X A;  3D4W A;  1SNO A;  1BR9 A;  5IWA L;  5ELF A;  3MAQ A;  2JA6 H;  3GTK B;  2ICI A;  3LWE A;  1WTR A;  3G6E A;  3CCL A;  2JA6 G;  2KCN A;  5GAH C;  3ULP A;  4FF4 A;  1CZW A;  2F0K A;  4DPG A;  1DON A;  4DV2 Q;  1YJN A;  1QWY A;  3PO2 H;  4JYA L;  1GJX A;  1H9S B;  1X55 A;  2XWB B;  3UDX A;  2NWG A;  3PO2 G;  2AKW B;  2UUC Q;  3NPP A;  4HSP A;  3A74 A;  1KRT A;  2HIX A;  1S5C D;  3H0G H;  1CKN A;  3A5Z B;  3LNN A;  3GTP B;  2SNM A;  1NTG A;  3R93 A;  2J7Z A;  2YTY A;  3L0O A;  2EYJ A;  4K2K A;  1I94 L;  2NVQ H;  3H0G G;  5E4W C;  5HGQ A;  2F0L A;  1K8G A;  1QG7 A;  1I5F A;  4LJZ C;  2KUM A;  3S1N H;  1EEI D;  3M4O B;  2IY5 B;  4IOA A;  1RF2 D;  2X6G A;  1JE5 A;  2K4K A;  4YCW A;  1W2B A;  2K01 A;  1E1O A;  1KQS A;  1EIG A;  2QIL A;  1L1O A;  1JE4 A;  2E5L Q;  1I6H B;  5D3I B;  2R3Z A;  4WJ3 M;  2PI2 A;  4HIK A;  3KBX A;  4UY8 C;  2B39 A;  4GLV B;  3WWV A;  3DWQ A;  3HP3 A;  5D14 A;  5C44 B;  3ERQ A;  3DLL A;  1TWC B;  5GAG C;  2JA8 B;  2XN9 C;  5C4X H;  1K83 B;  4L5R C;  1UEA B;  1Y8N B;  4A3L H;  4A3E H;  3W1B A;  3I8Z A;  1Q8I A;  2GVA A;  3PUV A;  4DAP A;  5C4X G;  1JOR A;  4A3L G;  4A3E G;  3OOC A;  4FXK C;  1I3Q H;  4EVO A;  3UDG A;  3P7J A;  2LXJ A;  3NTH A;  4K6L A;  4P71 A;  3RLO A;  1GHJ A;  2OCE A;  2VZA A;  2EXZ A;  3K5L A;  1FYC A;  2B2Y C;  4KJO A;  4B9W A;  5IY0 A;  2UXC Q;  4IQZ A;  4RCO A;  1WOC A;  4XXE A;  4KY7 A;  4C3H B;  3S1Q H;  2A68 C;  3K8A A;  5DNF A;  2ZTE A;  4EQP A;  1NUC A;  1KC8 C;  3CCS A;  2M2L A;  2MHV A;  3NBH A;  3K0Y A;  1SFO B;  1GVP A;  2F52 A;  4YY3 L;  1LTL A;  3A8I E;  4HED A;  3BVZ A;  2DN8 A;  4DF7 A;  3ERO A;  2CW0 D;  5JOB A;  2XNA C;  5K36 H;  5BR8 Q;  4TSS A;  1ENF A;  4IJL A;  1EWC A;  5K36 G;  3S2D B;  1LT5 D;  1XMO Q;  1IBM Q;  5IT9 c;  1MSH A;  3M3Y B;  1P8L A;  2AQ1 B;  1VCI A;  1MGS A;  4YHH L;  2ICE C;  2PMZ B;  4HMI A;  2VB2 X;  2JA9 A;  1KL9 A;  1LT6 D;  2JA5 H;  3UI2 A;  2F1M A;  2K7V A;  4NDX A;  3RZO H;  1BCP B;  4IUU A;  4PG3 A;  1DYQ A;  2B2W C;  4IZ8 A;  2NN6 I;  5M5X H;  3GTL H;  3E9I A;  1T5X D;  4XT1 B;  1CFM A;  2I0Q A;  1BBX C;  4O42 A;  4AYB E;  3F1Z A;  4DV4 Q;  4LF9 Q;  1KRS A;  1TQO A;  4QUC A;  4C1N K;  2NUC A;  1PV4 A;  2NVX B;  2I5M X;  1B8A A;  3QJY A;  1AE3 A;  5DEH A;  3K0X A;  1Y69 U;  2Z4I A;  1NR4 A;  1EZ8 A;  1HTP A;  2F0N A;  1JJ2 A;  4B08 A;  1TWH H;  1U4L A;  2QGQ A;  1KDC A;  2BH8 A;  5DAU A;  3RZD H;  1QZG A;  1A2U A;  4JI1 Q;  3HOY B;  4A3D B;  4KY5 A;  4FDB A;  3CCM A;  1UWV A;  1K8M A;  5ELO A;  2R6G A;  1DCZ A;  3TEH B;  3DM3 A;  3C2P A;  3KK7 A;  3K5O A;  3ND9 A;  3NP8 A;  5ELC A;  1CKO A;  4ZYS A;  4X66 Q;  3J7A 5;  3L3O C;  1RTN A;  4DV5 Q;  5ELD A;  2ID0 A;  1DGS A;  3S14 B;  4BBS B;  2B2T C;  1PH2 A;  1LTG D;  4X64 L;  2WV6 D;  3KYH C;  2PW7 A;  1I4P A;  5HUR A;  1ML0 D;  1YHB A;  1E22 A;  1SLJ A;  3M85 A;  3GTM B;  2B2Y A;  5IT9 E;  3NEL A;  1LLR D;  4KN4 C;  5ELN A;  2XRS D;  3PV0 A;  3VR3 A;  2YU9 H;  5LHY 1;  1YZ6 A;  1QVG A;  4WJ4 A;  1HJP A;  3H09 A;  4FF2 A;  5LMN L;  2F0H A;  1PFB A;  1D5M C;  3STB C;  3D31 A;  4RKL A;  2HDM A;  3B6Y A;  1PH4 A;  1F2L A;  4V0B A;  3GTQ H;  1VQD A;  1BXT A;  2YYZ A;  1PZI D;  1EUJ A;  1A3T A;  4OX9 Q;  3KDF B;  3ND8 A;  2VS1 A;  3NXW A;  3J81 E;  3AEV A;  3C46 A;  2A68 D;  1S5D D;  5FO8 B;  5EGT A;  2F0V A;  3RLF A;  4B3R Q;  3EFX D;  4N9P A;  4L5S A;  3R2T A;  4H44 C;  1X54 A;  1A6X A;  2CWA A;  1CA6 A;  1TWA H;  2Q2U A;  4J1M A;  1YI2 A;  3U58 A;  1M4V A;  1EYC A;  3H15 A;  2JA7 H;  4HJ9 A;  1QNU A;  3DEO A;  1D6E C;  1JQY D;  4XQJ A;  1KTK A;  5C0X J;  3H91 A;  3Q0A A;  4I7A A;  2EJF C;  4JV5 L;  2JA7 G;  1N34 Q;  2PCF B;  3PSI A;  2Y0S B;  2EJG C;  1NMF A;  1X3F A;  1WCM B;  3TDQ A;  2G9H D;  2YTX A;  1B9M A;  2R93 H;  3SXH A;  1S3O A;  1H9J A;  3CD6 A;  2VB3 X;  1U4P A;  2R93 G;  3TS2 A;  3I4M B;  1V8Q A;  2AWN A;  3OIQ A;  5M3F H;  3S1M H;  1AFP A;  5IYC H;  4QCL A;  2UXB Q;  1JIC A;  2RSN A;  1NCV A;  4RGO S;  5M3F G;  5IYC G;  5EKI A;  1H9S A;  1RTO A;  5EJW A;  3IAY A;  2MP1 A;  1M1K C;  3CRK C;  1JWS D;  2J0T D;  1N33 L;  4A3I B;  4B3M Q;  1BCP C;  2K5V A;  4H13 C;  1EWI A;  2C9O A;  2EY2 A;  4R8N A;  1C9O A;  1YJW A;  1CK1 A;  5C6A A;  4GN5 A;  3K57 A;  4ALP A;  5M5Y H;  4J8Q A;  2EYH A;  2Q2H A;  1PLF A;  2J4X A;  2NB0 A;  3VDY A;  2DY8 A;  3ERS X;  2MO1 A;  4X62 Q;  4KI0 A;  2DJG C;  3MHB A;  3S15 B;  5CYU A;  5LL6 X;  2RKS A;  4QIW B;  5ELE A;  2RSO A;  5AJ3 L;  2B2T A;  1XNR L;  2L55 A;  1HXY D;  5ELB A;  3RMH A;  1L2F A;  1N32 L;  3NWS A;  2PPB C;  2CQO A;  3BVM A;  2F0I A;  4GKK L;  2PO4 A;  4NPS A;  1BCP F;  1R4P B;  1SMY C;  1TT2 A;  3KF8 B;  1Y8P B;  2UUB L;  4DR7 Q;  4JCV E;  4LF5 Q;  1HPC A;  2RVL A;  4GOP B;  1R9T B;  1SSO A;  4YWL A;  1TWF B;  4WOR A;  1EY6 A;  4KJN A;  1VQ9 A;  1SMX A;  4DAM A;  2ZTD A;  1F9Q A;  2JK8 A;  3CAM A;  4DR1 Q;  1VQ4 A;  1LTI D;  1QJO A;  4KHP L;  2R7Z B;  4I7Z C;  1HUN A;  4RHS A;  5IP7 H;  5JVH 3;  1A3V A;  4LWC A;  2YV5 A;  1HR0 W;  1EIF A;  1Q7Y C;  1U5K A;  2A1A A;  5IP7 G;  4LK1 C;  3RUZ A;  3CQZ H;  2UUA L;  1ILP A;  2WAQ G;  3KJP A;  3K80 C;  3NHH A;  3RLN A;  3TZU A;  3E5S A;  2HHH L;  1GUG A;  2VXW A;  3J7A F;  4QGU A;  5E1F A;  2RCN A;  1TWG H;  4F88 A;  4ZLT F;  3D6W A;  5C3W A;  4N8X 1;  4GN3 B;  2ZM6 L;  1EU3 A;  3NEN A;  3TZD A;  2B63 B;  4NXN L;  2EVB A;  1VQ6 A;  2LSS A;  1OTC A;  2Q8R E;  2A6E D;  3A0J A;  3CU7 A;  2ZXP A;  1PXU A;  5I2Y A;  4JBJ A;  1KAW A;  4WJW A;  4CDE C;  1EYA A;  3K5N A;  3D4D A;  5JPM C;  4DV7 L;  5KRU A;  3OSO A;  3OHX C;  2HCC A;  4BY1 H;  2PMZ E;  3T16 A;  4YWK A;  1AW7 A;  4AQY L;  4A3F B;  1MBY A;  4R4O A;  3U9O A;  4BY1 G;  4HCS A;  1EYD A;  3HOV H;  3I4N B;  3PQI A;  3HKZ E;  4U68 A;  4R9W A;  3HOV G;  2HCI A;  4RAU C;  3M4O H;  2DY7 A;  4OIJ A;  4QQB X;  1XWE A;  2BCO A;  4UHV A;  4GZY C;  1PTO B;  4TKO B;  1SRU A;  1BCP D;  4X3U A;  4E6I A;  2TMP A;  2A69 C;  4QY7 A;  4A3M B;  1HNX Q;  1VQP A;  1I6H H;  1E7Z A;  1UE1 A;  1SYG A;  1F2Z A;  4OWT B;  1FD7 D;  1HH2 P;  2WIN B;  2QA4 A;  1J5E L;  1ET9 A;  4C3J H;  1RKN A;  2HDL A;  1SNC A;  1TWC H;  4IO9 A;  4B9X A;  2JA8 H;  4C3J G;  1K83 H;  4JI2 L;  1KDA A;  1LM0 A;  1VQA A;  2PZT A;  4CDF C;  4JI6 Q;  1I4Q A;  3ULJ A;  4RGN A;  2JA8 G;  3S9W A;  4JI5 L;  4POG A;  3T1Y L;  1S72 A;  4B3S L;  1SMY D;  2BE5 C;  4A3K G;  5C0X H;  2YTV A;  1Y1V B;  1QNK A;  3K58 A;  3WOE A;  1PRT F;  1NY4 A;  1KNA A;  5C0X G;  1PH5 A;  1EY7 A;  1M8A A;  2D0P A;  5IGD A;  2L4N A;  1CQV A;  3OWF A;  1AP0 A;  4YWM A;  3Q23 A;  3A8K E;  4JI3 L;  2MPM A;  3WDN A;  4C3H H;  4GOP C;  1HA5 A;  3X3N A;  5CMD A;  4C3H G;  1TXY A;  2RDF A;  1SFO H;  1N36 L;  2MUY A;  5CBE E;  1HZC A;  1NBW A;  4JI7 L;  1ZKO A;  4A3J H;  3Q6S A;  2QDB A;  2XSC A;  3T13 A;  2EYL A;  5C3E H;  4O0A A;  1XNQ Q;  4A3J G;  3KDF A;  1EY8 A;  1NAP A;  2KVM A;  5C3E G;  3AB9 A;  3S2D H;  4IUT A;  4CKB A;  3M3Y H;  4DUZ L;  1GKH A;  1I6V C;  4FO2 A;  1ZXT A;  1BBU A;  1MHW C;  2KCM A;  4YCU A;  4A3G B;  1JOK A;  3D8G A;  1B7Y B;  1O7Y A;  5JPN C;  4LFB L;  3D0F A;  4JOI C;  1HUM A;  2K5W A;  4OL7 A;  4IPH A;  4X64 Q;  4DV1 Q;  1DM0 B;  4LFA L;  4LF7 L;  1HNZ Q;  3I72 A;  1RDP D;  2CH4 W;  3GD7 A;  2RA4 A;  1FJG L;  1O78 A;  4JPB W;  4OON A;  1F77 A;  2OQ0 A;  4NXM Q;  1ROD A;  5GAD C;  4LW1 A;  4I65 A;  1SAP A;  1STA A;  4XTC S;  1IBK L;  4DK0 A;  3KLR A;  1H9R A;  2NVX H;  4G7H C;  3HOW H;  4IPC A;  3GTJ B;  3BU2 A;  5KYI A;  3QOJ A;  1NMG A;  1UAP A;  2G5D A;  3HZX A;  3HOW G;  4HID A;  2SDF A;  2LS0 1;  2X69 A;  2EIF A;  4IUP A;  3U9S A;  2EPB A;  1KXL A;  5COR A;  2NZH A;  5EPL A;  1BDO A;  1V1P B;  3HOY H;  4A3D H;  3OPO A;  2ZXO A;  3A7L A;  3PIP A;  4PZ6 A;  2A19 A;  3CPF A;  4PMB A;  1II3 A;  1CM9 A;  3HOY G;  4A3D G;  2PZU A;  2A69 D;  2F0S A;  2FFK B;  3BJU A;  5AFW A;  1Y14 B;  4RGT A;  5GQO A;  2PW5 A;  5CGK A;  1PH3 A;  5M3M H;  1SND A;  1BO0 A;  3A55 A;  3P75 A;  3VYT A;  5M3M G;  4BBS H;  4M1U B;  2F3I A;  2XTI A;  3NK9 A;  5IOD A;  5E3F A;  1PTO C;  1BUV T;  1QVF A;  4QIW E;  4OO1 I;  4KK7 A;  4XYO A;  3IFT A;  4BBS G;  2KQ3 A;  3K7A H;  1A63 A;  1VQJ A;  3HOZ B;  3KF8 A;  3JAM E;  1D8L A;  1YHQ A;  2RQX A;  3M7N A;  1E24 A;  4X3T A;  1C8C A;  1OXU A;  2BE5 D;  4GOP A;  3T56 B;  3OTO Q;  3EBE A;  3MWY W;  1QE6 A;  3BZC A;  1SE2 A;  1D1K A;  2F03 A;  1N33 Q;  4DV3 L;  1Q86 C;  1KLU D;  1PTO F;  5BN3 A;  3QOL A;  2R7D A;  1YNJ C;  3GTO B;  1FGB D;  4C56 C;  1D1I A;  3F2D A;  5LMU L;  4JBM A;  2K03 A;  4IUQ A;  4DR5 Q;  4IFD I;  2NBF A;  1NJI C;  5ISR A;  2ALY B;  1K3R A;  3GP7 A;  3PO3 H;  3MVV A;  4JOI A;  5C4J B;  1LAB A;  2A5H A;  2Q8I B;  1X6O A;  2ZT9 C;  3PO3 G;  1N32 Q;  4QMG A;  4MN3 A;  2WP8 J;  4IPD A;  1I50 H;  2VY3 A;  4TVA B;  5NUC A;  1XMQ L;  2EYM A;  1WCM H;  1AZQ A;  1DJR D;  1UE7 A;  2E2H H;  1VQK A;  2MO0 A;  1VQ5 A;  4R1J A;  4ZUJ A;  1WCM G;  4IN3 A;  2XVS A;  2K50 A;  3HGB A;  3KBG A;  1DD2 A;  2O5I C;  4ZAI A;  4B3T Q;  2F0J A;  4LFC Q;  2E2I H;  1QCB D;  4ZKC B;  1LTS D;  4MHE A;  3H3V C;  2KED A;  2HUG A;  4C2M B;  5EAY A;  3I90 A;  5BN4 A;  2BA0 A;  5HGT A;  5IGE A;  2UU9 L;  3J7Z C;  2GVB A;  2UUA Q;  3J7Y W;  5L37 A;  1KHI A;  4DFA A;  1OO9 B;  1WTP A;  2K75 A;  1Q46 A;  4Z9C B;  1GUN A;  3T51 B;  3S15 H;  2KOL A;  1TS5 A;  2RCF A;  3I91 A;  4A76 A;  1G6P A;  1B53 A;  3S17 H;  3PGZ A;  4CGY B;  1GUW A;  4PZ7 A;  1IYV A;  2IWH A;  3TP8 A;  4JI0 L;  4KV6 A;  4K0K L;  2G9D A;  1STN A;  1Y8O B;  1A8V A;  3BG3 A;  4DA2 A;  1LAC A;  4DR4 L;  5IIF A;  4BA1 I;  1R9T H;  1S4Z A;  1SE8 A;  1PTO D;  3IL8 A;  4MIU A;  3PIO A;  2B8G A;  5BN5 A;  1WTQ A;  2KHJ A;  2EXD A;  4DU9 A;  4AQY Q;  1KD1 C;  2H5X A;  4DV6 L;  4Q0F A;  3FVQ A;  1IL2 A;  2E2J B;  4EQ5 A;  3A56 A;  2PNR C;  4KKS A;  4LF6 L;  1C4Q A;  4PMC A;  1BOS A;  3F2U A;  1PH9 A;  1CSQ A;  2JA5 G;  3HKZ B;  1D5Z C;  3I2Z A;  3FDT A;  3T1H L;  5FLM H;  3TRE A;  2O4X A;  2ATW A;  4DNT B;  1YNJ D;  2LXK A;  2D2C C;  2R92 H;  3MEF A;  2BOS A;  1WI5 A;  1O7Z A;  4L5T A;  3QO2 A;  5FLM G;  3J81 c;  2KEC A;  1JR0 D;  2EY6 A;  2NN6 H;  2R92 G;  1SYB A;  3N6R A;  3CCJ A;  5I9P A;  3EVQ A;  2EQS A;  2VQE L;  2NN6 G;  1BKB A;  1PYS B;  2B63 H;  4K5W A;  1YIJ A;  5IYB H;  5JJI A;  1X3P A;  4JI2 Q;  4C3I B;  2B63 G;  2D62 A;  5IYB G;  4JI5 Q;  2AUK A;  3K6O A;  2RDH A;  1ONL A;  3DWA A;  4RMF A;  3PF5 A;  5GRO A;  5JEA J;  4PNY A;  4G7Z C;  1E2V A;  1G8Z D;  3SEB A;  1B3A A;  4P75 A;  4L5Q A;  1G2S A;  4IJH A;  2MQH A;  4UP9 A;  3J80 c;  2PYK A;  1YNN C;  4JC0 A;  4POF A;  4DV0 L;  2GA4 B;  2EJM A;  3MEH A;  5A2Q L;  1KNE A;  1L0X B;  3W2D A;  1G6Z A;  3EQL C;  3QWN A;  3RD4 A;  3C3L A;  5TSS A;  1STY A;  1H9M A;  3O13 A;  1OXT A;  4NW2 A;  4XT3 B;  4BA2 I;  1UEB A;  3UE0 A;  4WRD A;  2Z0S A;  2CFM A;  5KYL A;  2NVY H;  2JEA I;  2B29 A;  4MTN A;  1M90 C;  1G91 A;  5JJZ A;  2K33 A;  1ESR A;  5IGB A;  3MZ5 A;  4CJ1 B;  2NVT B;  3QB3 A;  3J81 j;  1V1P A;  5T1I A;  4DUZ Q;  1JMC A;  4DK6 C;  4LUV A;  4FP5 D;  2Q8T A;  1ZEQ X;  1RCV D;  5C4Z A;  1CSP A;  1HZA A;  1AEX A;  2CQA A;  4LFA Q;  1E2W A;  2D9U A;  5IE8 A;  2JA6 B;  4X65 L;  3GTG H;  3GQB A;  1VF5 C;  1PA6 A;  1GM5 A;  2N78 A;  3E3X A;  2HT1 A;  1NR2 A;  3T4A C;  5E4X A;  1FJG Q;  2JJQ A;  4HMJ A;  3SK4 A;  2K5N A;  2HQL A;  1PDQ A;  4ME5 A;  1EFI D;  2A6E C;  2Q2I A;  2B2U C;  1LTR D;  2H4O A;  1LTA D;  3CHB D;  2EZV A;  1VQE A;  3J81 i;  2F4V L;  5I9O A;  1HFG A;  1CI3 M;  3H0G B;  3J80 E;  2K32 A;  4AYB G;  4LNQ A;  4OHJ A;  2NVQ B;  4G57 A;  1SJE D;  4O1N A;  4APV A;  3S1N B;  4TRD A;  1JC7 A;  5EPJ A;  1XX8 A;  1X3G A;  4Y7N H;  3KUP A;  3I55 A;  4CDD C;  3H3V I;  1Y1W B;  4DR6 Q;  4GKJ L;  1GUS A;  2JEB I;  4YIJ A;  3C1E A;  1VMP A;  2IX0 A;  1YVC A;  2KJX A;  2WB1 E;  3KLS A;  4JG2 A;  4TQU S;  5KND A;  1WVL A;  4BY7 H;  3J80 i;  5CV8 A;  3MXN A;  5HY6 A;  2K04 A;  1WTW A;  1K8A C;  2F0G A;  1H95 A;  3LWU A;  4BY7 G;  2UXD Q;  1HQR D;  2MJ8 A;  2KHS A;  2Z6K C;  4BBR H;  4OEM B;  5C4X B;  4JI8 L;  3VR5 A;  5IWA Q;  4DV2 L;  1VQN A;  1X56 A;  1FVI A;  4ZKB B;  4NP5 A;  2XRQ D;  4NKL A;  1LTT D;  4BBR G;  5IGC A;  2JYO A;  3F2C A;  3PIP 3;  4PV1 C;  3F8T A;  5I6Y A;  1K0R A;  3FPP A;  4R4I A;  1XTC D;  1HHV A;  2UUC L;  5FLX L;  3MXU A;  1SNQ A;  1I4H A;  2E76 C;  2F0F A;  5CR3 A;  1YNN D;  2FJ2 A;  4DV3 Q;  4JI4 L;  4JYA Q;  3OW7 A;  2K1B A;  4R4T A;  2R61 A;  1J8I A;  1EL0 A;  4LUO A;  1KIX A;  1YNX A;  2X6L A;  3FKI H;  4X3S A;  3S1Q B;  2QDL A;  3OW2 A;  3TRZ A;  2CHB D;  4KLK A;  3FKI G;  3VR4 A;  4DR2 L;  3S1R H;  1I94 Q;  1TS2 A;  3VYS A;  1FR3 A;  2OTL A;  3HS0 C;  3SHL A;  1BF4 A;  1S5F D;  2DNC A;  2E5L L;  2O2L D;  3VR2 A;  1LYL A;  5FOB B;  5E7N A;  1C0A A;  2M9V A;  1VQB A;  2VUM H;  1QIL A;  1Q3L A;  1MJC A;  2F0U A;  1EY4 A;  2B2U A;  2VUM G;  1HCZ A;  3UE1 A;  1FL0 A;  5I4D A;  1ILQ A;  1JWU D;  1RL2 A;  1FNV A;  3W5O A;  3GTK H;  1KLG D;  1SE3 A;  4ZK9 B;  2ZJP A;  3RZO B;  2E8G A;  3S24 A;  2I5L X;  1MSG A;  1LV9 A;  2F0Q A;  1D2B A;  4HN7 A;  5J3B A;  3GTL B;  2QEX A;  2E74 C;  4X6A H;  5EBD A;  5T1G A;  1JT8 A;  1IYU A;  4RA8 A;  5JEA H;  3TP5 A;  2N55 A;  2SEB D;  4DAV A;  4J6H A;  3GTO H;  1XYI A;  2UU9 Q;  3T53 B;  1RIP A;  3TN2 A;  5JEA G;  3EIV A;  2IJ0 A;  1V9P A;  4BWG B;  1G51 A;  1ZYR D;  1QOH A;  3NSW A;  3GTP H;  4GLX A;  4JVZ A;  1U4M A;  2L11 A;  1RJT A;  2A74 C;  3PUW A;  5FKA C;  3SK5 A;  5C4J H;  1K73 C;  4MNO A;  5JAV A;  4ILW A;  4KHZ A;  4OXP A;  4X3K A;  4IAL A;  4N9T A;  5KIX A;  2F0O A;  5BR8 L;  2F0P A;  3BDO A;  1BNZ A;  3E0E A;  2Z6K A;  4YY3 Q;  4DXF A;  2Z6B A;  1GUT A;  1ICW A;  3IFD A;  4IFD J;  2K52 A;  1IZ6 A;  5KGU A;  4A93 B;  3OIP A;  3I73 A;  3R3O A;  1X3E A;  2BA1 A;  2IPK D;  1EY5 A;  2K5H A;  4XIG S;  2H1E A;  4NMZ A;  2Z8L A;  3X3M A;  1MI2 A;  5C44 H;  4IUV A;  5M5W B;  2K5D A;  2B2V C;  4YHH Q;  2QW7 A;  4H02 A;  5C44 G;  1E3P A;  4DUY L;  2WKC A;  2N88 A;  3CF5 A;  4DV4 L;  1TII D;  3SE0 A;  1PH8 A;  3AQQ A;  3CC2 A;  2EY1 A;  2OTJ A;  3GTQ B;  2F3V A;  2EOT A;  1WD1 A;  3VYR A;  4CHT B;  3PIO 3;  2K14 A;  1U9R A;  1X3Q A;  4L6T B;  2ENB A;  4K8J A;  3SK6 A;  3GO5 A;  3NQI A;  2AMC B;  3CCQ A;  3CPW A;  4GNX B;  1PZK D;  2JA7 B;  5IGG A;  3DMU A;  3N52 A;  2OF1 A;  2RDG A;  3S16 B;  2PQA B;  2F0D A;  2L5T A;  1HNW L;  1WTH A;  3W3A A;  2R93 B;  1DOM A;  3HKS A;  5EBC A;  3BZD B;  2Q2T A;  3D6C A;  1S5E D;  4JW0 A;  5J22 A;  3OYY A;  5M9O A;  2VQF L;  2IX3 A;  3JAM c;  1PMR A;  5M3F B;  3S1M B;  2XGT A;  2QEJ C;  2E75 C;  2BDO A;  1X9N A;  3HOU B;  1NE3 A;  3G48 A;  1BVS A;  2SNS A;  1JCK B;  4QB4 A;  1XTD A;  4CJ2 C;  1SYF A;  3TME A;  1W6J A;  2Z1C A;  4R4C A;  5LMN Q;  2CCZ A;  2CH4 A;  1J9O A;  5G3L D;  4DNR B;  4OX9 L;  1PYW D;  1JJC B;  4B3R L;  4DR3 L;  1TVX A;  2KBN A;  1F2M A;  4A3B B;  4C3I H;  1K0S A;  4PQX A;  4X65 Q;  4CKC A;  1SDF A;  4C3I G;  3E6Z X;  3KLS X;  1N34 L;  2B2V A;  3P1H A;  5F2D A;  3K81 C;  5IGF A;  1EYG A;  1EQR A;  1ENA A;  3KFU A;  1IL8 A;  1PHJ A;  3ICE A;  1CKM A;  2CWP A;  1E0B A;  1VQ7 A;  4DK3 C;  3J7A V;  4JV5 Q;  2N49 A;  4KKU A;  3S14 H;  1GO3 E;  1SJH D;  1NSN S;  4LF8 L;  1SEB D;  4HR7 B;  5IP9 H;  2F4V Q;  2LKV A;  5IYD H;  2F0M A;  2KEN A;  3BYT B;  4KN7 C;  2F0T A;  1SR3 A;  3GTM H;  1P16 A;  4K8I A;  5IP9 G;  4J15 A;  1VQL A;  3NTI A;  3TP7 A;  1AH9 A;  3Q22 A;  1Q82 C;  4OO1 H;  4CDC C;  1PFS A;  4DK1 A;  3VA5 A;  4B3M L;  3UDF A;  2LMC B;  2BH2 A;  1F9S A;  2N3S A;  2ZXR A;  4ULL A;  5DM7 3;  3CQZ B;  3MFG A;  4OO1 G;  1SYD A;  1F2Y A;  1Q12 A;  1KDB A;  2L12 A;  3A5U A;  4P2C B;  1TS4 A;  1DOK A;  2NVT H;  3RR5 A;  1B9N A;  4GKJ Q;  4V19 0;  2FHT A;  4CJ0 B;  4EX5 A;  4LAA A;  3PMF A;  1HTL D;  4LF4 L;  3WOF A;  3KJO A;  4HCE A;  2HQE A;  2WKD A;  3VA7 A;  1T5E A;  1TWG B;  1TR5 A;  2OEO A;  1MJE A;  1Q90 A;  2EY5 A;  3JAM i;  3R2I A;  4PZ8 A;  1TKW B;  2WB1 B;  4K5X A;  4UDU C;  5EKL A;  5FO7 B;  2IT1 A;  3MXN B;  1OXV A;  4JI8 Q;  3CKI B;  5AJ3 Q;  2XIW A;  4DR7 L;  1XNR Q;  4LF5 L;  1UE6 A;  1EOT A;  5LL6 S;  2N8N A;  4IFD H;  3PUZ A;  2CKZ B;  1SNM A;  1EU4 A;  4GKK Q;  3IKJ A;  5CV7 A;  4IFD G;  2UUB Q;  2L0C A;  4GNX C;  1JOO A;  4BY1 B;  4JI4 Q;  2Y0S G;  1PH1 A;  2KCT A;  4DR1 L;  3I4M H;  1VMC A;  3HOV B;  3NEM A;  1Q81 C;  4RHR A;  2F0E A;  3I4M G;  2OWO A;  3L2P A;  4EQO A;  2ZJQ A;  1BQQ T;  1DXM A;  1Q1B A;  3FEW X;  4DR2 Q;  4KHP Q;  1Y1W H;  1CA5 A;  2LFN A;  2RHQ B;  3EN2 A;  3LX0 A;  5CV5 A;  2V4D A;  2WAC A;  2DNE A;  1Y1W G;  2PQE A;  4A3I H;  1XPO A;  3BDL A;  3HOX B;  1ENC A;  2NTS A;  4YCV A;  4A3I G;  1WD0 A;  4JK1 C;  3NWT A;  3HEJ A;  5CC4 A;  2JN4 A;  2PI2 E;  1YJ9 A;  1WTO A;  2E2D C;  5EQ0 A;  4C3J B;  2HHH Q;  5EPK A;  1IXR A;  2AQ3 B;  4JBW A;  4QJF A;  3CCV A;  1RD9 D;  5JJL A;  1QUQ B;  1VQM A;  3MC0 B;  2NZO A;  4A3K B;  3SVM A;  1VQI A;  3V2T A;  1CZG A;  2ZM6 Q;  4A4I A;  3HG9 A;  4NXN Q;  1GUO A;  4K5V A;  4C1N I;  3AYH B;  2A6H C;  4HJ7 A;  1XPU A;  1STG A;  4HJA A;  1CTM A;  3URY A;  2KCC A;  2F3W A;  4H0L C;  1TWF H;  4R4Q A;  5C5M A;  4DV7 Q;  4A3G G;  3TS0 A;  5IT9 L;  1PZJ D;  5C4H A;  1HRJ A;  2R7Z H;  4KMU C;  2R7Z G;  4A3J B;  1R4Q B;  2KEE A;  3E0J A;  4S3S A;  1SYC A;  2QKI C;  1HNX L;  5C3E B;  4EGV A;  4HJ5 A;  3CCU A;  2Z9H A;  4RG1 A;  3NUC A;  5DM6 3;  1PFM A;  3S2H B;  3U4V A;  1W3S A;  3L7Z C;  4KHV A;  4DKA C;  3J81 L;  4BXX H;  4LUZ A;  1E1T A;  2QF7 A;  1IW7 C;  1Q1E A;  4BXX G;  1I4G A;  1EQT A;  4JI6 L;  1J5E Q;  2I46 A;  4UP8 A;  4GNX A;  1IKM A;  1JB3 A;  5IOC A;  4FF1 A;  3NBI A;  3KLW A;  3DEP A;  1J6Q A;  2IL8 A;  2PQA A;  4DNI A;  4DAY B;  2EYP A;  4DUY Q;  3G71 A;  3KF6 B;  4F8M A;  1EFW A;  3T1Y Q;  4B3S Q;  1EEF D;  3PF4 A;  3HOW B;  3D3R A;  5CV4 A;  1IBL L;  2K5Q A;  1CHP D;  1K3B C;  1UNS A;  2EDG A;  3ZYY X;  1VF7 A;  3J80 L;  3Q8D A;  5D65 A;  4A3F H;  5EKK A;  1B44 D;  3NTK A;  2LY7 A;  1CUK A;  3I4N H;  4A3C H;  1CT1 D;  3D4R A;  4RWS C;  2VW9 A;  2OT2 A;  4A3F G;  3CC4 A;  4JI3 Q;  1SYE A;  4IPG A;  1VQ8 A;  1CQF A;  4A3C G;  3I4N G;  1XNQ L;  1N36 Q;  1HFN A;  1PTO H;  5I2X A;  4ABN A;  4CKE A;  4A75 A;  4HAE A;  4JI7 Q;  2IHE A;  4A93 H;  3M7G A;  5M3M B;  2OQK A;  4A3M H;  4XQN A;  4N8F A;  3L9A X;  1Z7T A;  4A93 G;  2MGS A;  5FO9 B;  4A3M G;  1HNW Q;  3MA2 B;  1B1Z A;  1V1O A;  3CP0 A;  4DV1 L;  3OWE B;  1K8O A;  1EZ6 A;  1ESF A;  2A73 B;  3I70 A;  4FNF A;  5M5W H;  1HNZ L;  1S40 A;  2ES2 A;  3NE5 B;  3K7A B;  3QIA A;  4LFB Q;  2K05 A;  2JE6 I;  2VQF Q;  4NXM L;  1B4O A;  2D5D A;  4DN4 M;  3LGJ A;  3RN5 A;  1X65 A;  4LF7 Q;  1MD2 D;  1GOZ A;  2RF4 A;  1PH6 A;  2A6H D;  1I4R A;  1Y1V H;  2ZTC A;  3NQT A;  4KTA A;  3G7L A;  1Y1V G;  3PO2 B;  1IBK Q;  4JBK A;  2VL6 A;  2Z4H A;  2SOB A;  2JXM B;  2KA7 A;  1JWM D;  3V96 A;  4CBV A;  2HD3 A;  4L63 B;  4DR3 Q;  1HZB A;  1ZYR C;  4BS9 A;  2WAQ E;  5DLQ E;  3PO3 B;  3H6M A;  1Q8K A;  3PCO B;  2C5C A;  1I50 B;  3S16 H;  1HR0 L;  5COY A;  2B2W A;  2M00 A;  1A0I A;  2FXQ A;  1VQC A;  2FMM A;  2L9H A;  2FMC A;  1EQQ A;  2E2H B;  4FVM A;  1GD7 A;  1A62 A;  1IW7 D;  4A3G H;  5CV6 A;  4RKB A;  2GN5 A;  3G6J B;  3H94 A;  3I4L A;  3SGI A;  1C7Y A;  3H3V H;  4G4K A;  2ASB A;  3A8J E;  3MTS A;  1GXD C;  4LF8 Q; 
#chains in the Genus database with same CATH homology
 5A2Q E;  2E2I B;  1PFN A;  1LTB D;  1PRT B;  4XDX A;  1SBB B;  1WTX A;  3P20 A;  4A3E B;  2TSS A;  5KNC A;  1FNU A;  4RGM A;  1EWH A;  1I3Q B;  2JP1 A;  2B8F A;  1O7L A;  2XWJ B;  1TY2 A;  1B2T A;  1G2T A;  1SXT A;  4G7O C;  1STH A;  2EE1 A;  3S17 B;  2AQ2 B;  4UAI A;  4LMQ D;  1SE4 A;  1XXG A;  4H7B A;  1IKL A;  2JSO A;  1G29 1;  2AUJ D;  4KY6 A;  1LO5 D;  3DXJ C;  4RCN A;  4K14 A;  1HQM C;  4FYD A;  2AWO A;  1STE A;  2PZW A;  4FXD A;  4XYQ A;  3TSS A;  4L8J A;  4K6D A;  2NTT A;  2JA5 B;  3C1F A;  3SDZ A;  3QG1 A;  4OGQ C;  3R8B A;  4F7X A;  2I07 B;  3FPU B;  3BYY B;  1UUP A;  5M5X B;  1U4R A;  1A3U A;  1QB5 D;  2R92 B;  3PUX A;  1WTV A;  4RH6 A;  5J39 A;  1JOQ A;  4R8I A;  2IW3 A;  4KD3 A;  1TWH B;  1CHQ D;  1F9P A;  1D5X C;  3RZD B;  5FK9 C;  2NZ1 D;  4RFB A;  5K5P A;  1EY9 A;  3TBI B;  2VNU D;  3VR6 A;  5G3L F;  2CVR A;  1L0Y B;  5FLX E;  3AMU A;  4ID6 A;  5J1Z A;  3GV6 A;  4DAY A;  4ZUI A;  1EQV A;  2IX1 A;  2EYF A;  1HA6 A;  1OXS C;  3DWP A;  4DGZ A;  1E2Z A;  1AN8 A;  4WFN 3;  3A7A B;  2NVY B;  1KAB A;  2YU9 B;  5D3D A;  5C5L A;  2WII B;  4FXG C;  1PRT C;  2K28 A;  3I3C A;  3OMC A;  3Q24 A;  1TU2 B;  3PUY A;  1B50 A;  2K6A A;  4Q5V A;  1KAA A;  3EJI A;  4U67 3;  5C0X I;  1O80 A;  4HSV A;  5KEE A;  5A35 A;  2FIN B;  5I6W A;  3GTG B;  3DM1 A;  1AZP A;  3FRP B;  1C48 A;  1TWA B;  1LT4 D;  2F4I A;  5C3X A;  1VDZ A;  1Z6H A;  1A15 A;  1V43 A;  3BDC A;  2RBM A;  1TY0 A;  3ITP A;  4AYB B;  3HRZ C;  1A2T A;  3SR1 A;  5CV9 A;  3JAM L;  5KNB A;  3MXG A;  1Z47 A;  3VYU A;  4OIK A;  4KD4 A;  3V05 A;  2EYO A;  1X32 A;  1IHZ A;  4Y7N B;  1EIH A;  3CRL C;  4PMW A;  1F9R A;  3K5M A;  1STB A;  1TS3 A;  4QF4 A;  3SK8 A;  4BY7 B;  5M5Y B;  2L1B A;  4F87 A;  1DOL A;  3K59 A;  1SNP A;  4IUR A;  1ET6 A;  4BBR B;  1FNW A;  3DUZ A;  4FF3 A;  1LT3 D;  4M8A A;  5JVG 3;  4XQQ A;  1EY0 A;  3M4Y A;  3A54 A;  3GV3 A;  4IUN A;  1OXX K;  4ODG A;  3TP6 A;  2NYZ D;  4KKT A;  3MFY A;  2BDN A;  3FKI B;  4ZQ3 A;  3AU7 A;  4DXG A;  3MXP A;  3BS1 A;  3S1R B;  5CBA E;  2QCP X;  1PRT D;  3DHQ A;  3EA6 A;  3ONA B;  2WAQ B;  1DZ1 A;  4ZRZ A;  2O5J C;  1W6K A;  2CW0 C;  1H9K A;  3OMG A;  4EQN A;  4QUF A;  1RHP A;  2F0W A;  2OXP A;  2VUM B;  4HTH A;  4K2L A;  3BVG A;  1S5B D;  3FMC A;  1GHK A;  1I4X A;  3D4W A;  1SNO A;  1BR9 A;  5ELF A;  3MAQ A;  3GTK B;  2ICI A;  3LWE A;  1WTR A;  2KCN A;  4FF4 A;  1CZW A;  2F0K A;  1DON A;  1QWY A;  1GJX A;  1H9S B;  2XWB B;  2NWG A;  3NPP A;  4HSP A;  1S5C D;  3GTP B;  3LNN A;  2SNM A;  3R93 A;  2J7Z A;  2EYJ A;  4K2K A;  5E4W C;  2F0L A;  1QG7 A;  4LJZ C;  2KUM A;  1EEI D;  3M4O B;  1RF2 D;  2X6G A;  2K01 A;  1EIG A;  2QIL A;  1JE4 A;  1I6H B;  5D3I B;  2R3Z A;  3KBX A;  2B39 A;  3DWQ A;  3HP3 A;  5D14 A;  5C44 B;  3ERQ A;  1TWC B;  2JA8 B;  2XN9 C;  1K83 B;  1UEA B;  1Y8N B;  3I8Z A;  1Q8I A;  3PUV A;  4DAP A;  1JOR A;  3OOC A;  4FXK C;  4EVO A;  3P7J A;  3NTH A;  4K6L A;  1GHJ A;  2EXZ A;  3K5L A;  1FYC A;  2B2Y C;  4KJO A;  4B9W A;  4IQZ A;  4RCO A;  4XXE A;  4KY7 A;  4C3H B;  2A68 C;  5DNF A;  4EQP A;  1NUC A;  2M2L A;  2MHV A;  3NBH A;  3K0Y A;  1SFO B;  3A8I E;  4HED A;  3BVZ A;  2DN8 A;  4DF7 A;  3ERO A;  2CW0 D;  5JOB A;  2XNA C;  5K36 H;  4TSS A;  1ENF A;  1EWC A;  5K36 G;  3S2D B;  1LT5 D;  1MSH A;  3M3Y B;  2AQ1 B;  1VCI A;  1MGS A;  2ICE C;  2PMZ B;  4HMI A;  2VB2 X;  1LT6 D;  3UI2 A;  2F1M A;  2K7V A;  4NDX A;  1BCP B;  4IUU A;  1DYQ A;  2B2W C;  4IZ8 A;  2NN6 I;  1T5X D;  4XT1 B;  1CFM A;  1BBX C;  4O42 A;  1TQO A;  4QUC A;  2NVX B;  4C1N K;  2NUC A;  3QJY A;  5DEH A;  1Y69 U;  2Z4I A;  1NR4 A;  1EZ8 A;  1HTP A;  2F0N A;  4B08 A;  1U4L A;  1KDC A;  5DAU A;  1A2U A;  3HOY B;  4A3D B;  4KY5 A;  1K8M A;  2R6G A;  1DCZ A;  3C2P A;  3KK7 A;  3K5O A;  3ND9 A;  3NP8 A;  5ELC A;  4ZYS A;  3L3O C;  1RTN A;  5ELD A;  2ID0 A;  4BBS B;  3S14 B;  2B2T C;  1LTG D;  2WV6 D;  2PW7 A;  1I4P A;  5HUR A;  1ML0 D;  3M85 A;  3GTM B;  2B2Y A;  5IT9 E;  1LLR D;  4KN4 C;  2XRS D;  3PV0 A;  3VR3 A;  5LHY 1;  3H09 A;  4FF2 A;  2F0H A;  1PFB A;  1D5M C;  3D31 A;  4RKL A;  2HDM A;  1F2L A;  4V0B A;  1BXT A;  2YYZ A;  1PZI D;  1A3T A;  3ND8 A;  3NXW A;  3J81 E;  3C46 A;  2A68 D;  1S5D D;  5FO8 B;  5EGT A;  2F0V A;  3RLF A;  3EFX D;  4N9P A;  3R2T A;  4H44 C;  1A6X A;  1CA6 A;  4J1M A;  1M4V A;  1EYC A;  1QNU A;  3DEO A;  1D6E C;  1JQY D;  4XQJ A;  1KTK A;  5C0X J;  3H91 A;  3Q0A A;  2EJF C;  2PCF B;  2Y0S B;  2EJG C;  3TDQ A;  1WCM B;  2G9H D;  1B9M A;  3SXH A;  1H9J A;  2VB3 X;  1U4P A;  3I4M B;  1V8Q A;  2AWN A;  3OIQ A;  1AFP A;  4QCL A;  1JIC A;  2RSN A;  1NCV A;  4RGO S;  5EKI A;  1H9S A;  1RTO A;  5EJW A;  3IAY A;  2MP1 A;  3CRK C;  1JWS D;  2J0T D;  4A3I B;  1BCP C;  4H13 C;  2EY2 A;  2C9O A;  4R8N A;  1CK1 A;  5C6A A;  3K57 A;  4J8Q A;  2EYH A;  1PLF A;  2J4X A;  2NB0 A;  2DY8 A;  4KI0 A;  3MHB A;  3S15 B;  5CYU A;  5LL6 X;  2RKS A;  4QIW B;  5ELE A;  2RSO A;  2B2T A;  2L55 A;  1HXY D;  5ELB A;  3RMH A;  3NWS A;  2PPB C;  3BVM A;  2F0I A;  2PO4 A;  1BCP F;  1R4P B;  1SMY C;  1TT2 A;  1Y8P B;  1HPC A;  2RVL A;  1R9T B;  1SSO A;  1TWF B;  4WOR A;  1EY6 A;  4KJN A;  1F9Q A;  1LTI D;  1QJO A;  2R7Z B;  4I7Z C;  1HUN A;  4RHS A;  5JVH 3;  1A3V A;  4LK1 C;  3RUZ A;  1ILP A;  3NHH A;  3TZU A;  3E5S A;  1GUG A;  2VXW A;  3J7A F;  5E1F A;  4F88 A;  4ZLT F;  3D6W A;  5C3W A;  1EU3 A;  3TZD A;  2B63 B;  2EVB A;  2Q8R E;  2A6E D;  3CU7 A;  2ZXP A;  1PXU A;  5I2Y A;  4WJW A;  1EYA A;  3K5N A;  3D4D A;  5JPM C;  5KRU A;  3OSO A;  3OHX C;  2HCC A;  3T16 A;  1AW7 A;  4A3F B;  1MBY A;  3U9O A;  4HCS A;  1EYD A;  3I4N B;  4U68 A;  4R9W A;  2HCI A;  4RAU C;  2DY7 A;  4OIJ A;  1XWE A;  2BCO A;  4GZY C;  1PTO B;  4TKO B;  1BCP D;  4X3U A;  4E6I A;  2TMP A;  2A69 C;  4A3M B;  1SYG A;  1F2Z A;  1FD7 D;  2WIN B;  1ET9 A;  1RKN A;  2HDL A;  1SNC A;  4B9X A;  4C3J G;  1KDA A;  2PZT A;  1I4Q A;  4RGN A;  3S9W A;  1SMY D;  2BE5 C;  5C0X H;  1Y1V B;  1QNK A;  3K58 A;  3WOE A;  1PRT F;  1KNA A;  5C0X G;  1EY7 A;  1M8A A;  5IGD A;  2L4N A;  1CQV A;  3OWF A;  1AP0 A;  3Q23 A;  3A8K E;  2MPM A;  3WDN A;  1HA5 A;  3X3N A;  5CMD A;  4C3H G;  2RDF A;  2MUY A;  5CBE E;  1ZKO A;  3Q6S A;  2QDB A;  2XSC A;  3T13 A;  2EYL A;  1EY8 A;  1NAP A;  2KVM A;  3AB9 A;  4IUT A;  4CKB A;  1I6V C;  4FO2 A;  1ZXT A;  4A3G B;  1JOK A;  3D8G A;  1O7Y A;  5JPN C;  1HUM A;  2K5W A;  4OL7 A;  1DM0 B;  3I72 A;  1RDP D;  3GD7 A;  2RA4 A;  1O78 A;  1F77 A;  1ROD A;  4I65 A;  1SAP A;  1STA A;  4XTC S;  4DK0 A;  3KLR A;  1H9R A;  4G7H C;  3GTJ B;  5KYI A;  3QOJ A;  1UAP A;  3HZX A;  2SDF A;  2LS0 1;  2X69 A;  4IUP A;  3U9S A;  2EPB A;  5COR A;  5EPL A;  1BDO A;  1V1P B;  3OPO A;  2ZXO A;  3A7L A;  4PMB A;  1II3 A;  1CM9 A;  2PZU A;  2A69 D;  2F0S A;  5AFW A;  2FFK B;  5CGK A;  4RGT A;  2PW5 A;  1SND A;  1BO0 A;  3A55 A;  3P75 A;  3VYT A;  4M1U B;  5IOD A;  3NK9 A;  5E3F A;  1PTO C;  1BUV T;  4OO1 I;  4KK7 A;  4XYO A;  3IFT A;  2KQ3 A;  3HOZ B;  3KF8 A;  3JAM E;  2RQX A;  3M7N A;  4X3T A;  1C8C A;  1OXU A;  2BE5 D;  3T56 B;  3MWY W;  1QE6 A;  1SE2 A;  1D1K A;  2F03 A;  1KLU D;  1PTO F;  5BN3 A;  3QOL A;  1YNJ C;  3GTO B;  1FGB D;  4C56 C;  1D1I A;  2K03 A;  4IUQ A;  4IFD I;  2NBF A;  5ISR A;  3GP7 A;  3MVV A;  5C4J B;  1LAB A;  2A5H A;  2Q8I B;  2ZT9 C;  4QMG A;  4MN3 A;  2WP8 J;  5NUC A;  2EYM A;  1AZQ A;  1DJR D;  4ZUJ A;  4IN3 A;  2XVS A;  3HGB A;  3KBG A;  1DD2 A;  2O5I C;  4ZAI A;  2F0J A;  1QCB D;  4ZKC B;  1LTS D;  4MHE A;  3H3V C;  2KED A;  2HUG A;  4C2M B;  3I90 A;  5BN4 A;  2BA0 A;  5HGT A;  5IGE A;  3J7Y W;  4DFA A;  1OO9 B;  1WTP A;  4Z9C B;  1GUN A;  3T51 B;  2KOL A;  1TS5 A;  3I91 A;  1B53 A;  4CGY B;  1GUW A;  1IYV A;  2IWH A;  3TP8 A;  4KV6 A;  2G9D A;  1STN A;  1Y8O B;  3BG3 A;  4DA2 A;  1LAC A;  5IIF A;  4BA1 I;  1S4Z A;  1PTO D;  3IL8 A;  4MIU A;  2B8G A;  5BN5 A;  1WTQ A;  4DU9 A;  4Q0F A;  3FVQ A;  2E2J B;  3A56 A;  2PNR C;  4KKS A;  1C4Q A;  4PMC A;  1BOS A;  3F2U A;  3HKZ B;  1D5Z C;  3FDT A;  2O4X A;  4DNT B;  1YNJ D;  2D2C C;  2BOS A;  1O7Z A;  3QO2 A;  2KEC A;  1JR0 D;  2EY6 A;  2NN6 H;  1SYB A;  3N6R A;  5I9P A;  3EVQ A;  2NN6 G;  4K5W A;  1X3P A;  4C3I B;  2D62 A;  2AUK A;  3K6O A;  2RDH A;  1ONL A;  3DWA A;  5JEA J;  4PNY A;  4G7Z C;  1E2V A;  1G8Z D;  3SEB A;  1B3A A;  1G2S A;  2PYK A;  1YNN C;  2GA4 B;  2EJM A;  3MEH A;  5A2Q L;  1KNE A;  1L0X B;  3W2D A;  1G6Z A;  3EQL C;  3QWN A;  3RD4 A;  3C3L A;  5TSS A;  1STY A;  1H9M A;  3O13 A;  1OXT A;  4NW2 A;  4XT3 B;  4BA2 I;  4WRD A;  5KYL A;  2JEA I;  1G91 A;  5JJZ A;  2K33 A;  1ESR A;  5IGB A;  3MZ5 A;  4CJ1 B;  2NVT B;  3QB3 A;  1V1P A;  5T1I A;  4FP5 D;  2Q8T A;  1ZEQ X;  1RCV D;  5C4Z A;  1AEX A;  2CQA A;  1E2W A;  2D9U A;  2JA6 B;  3GQB A;  1VF5 C;  1NR2 A;  3T4A C;  5E4X A;  4HMJ A;  3SK4 A;  1PDQ A;  4ME5 A;  1EFI D;  2A6E C;  2B2U C;  1LTR D;  2H4O A;  1LTA D;  3CHB D;  2EZV A;  5I9O A;  1HFG A;  1CI3 M;  3H0G B;  3J80 E;  2K32 A;  4OHJ A;  2NVQ B;  4G57 A;  1SJE D;  4O1N A;  3S1N B;  4TRD A;  1JC7 A;  5EPJ A;  1XX8 A;  3KUP A;  1Y1W B;  1GUS A;  2JEB I;  4YIJ A;  3C1E A;  1VMP A;  2IX0 A;  2KJX A;  3KLS A;  4TQU S;  5KND A;  1WVL A;  5CV8 A;  3MXN A;  2K04 A;  1WTW A;  2F0G A;  3LWU A;  1HQR D;  2MJ8 A;  2KHS A;  5C4X B;  3VR5 A;  4ZKB B;  4NP5 A;  2XRQ D;  4NKL A;  1LTT D;  5IGC A;  2JYO A;  3PIP 3;  4PV1 C;  5I6Y A;  3FPP A;  1XTC D;  1HHV A;  5FLX L;  3MXU A;  1SNQ A;  1I4H A;  2E76 C;  2F0F A;  5CR3 A;  1YNN D;  2FJ2 A;  3OW7 A;  2K1B A;  2R61 A;  1J8I A;  1EL0 A;  2X6L A;  4X3S A;  3S1Q B;  2CHB D;  3VR4 A;  1TS2 A;  3VYS A;  1FR3 A;  3HS0 C;  3SHL A;  1BF4 A;  1S5F D;  2DNC A;  2O2L D;  3VR2 A;  5FOB B;  2M9V A;  1QIL A;  1Q3L A;  2F0U A;  1EY4 A;  2B2U A;  1HCZ A;  5I4D A;  1ILQ A;  1JWU D;  1FNV A;  1KLG D;  1SE3 A;  4ZK9 B;  3RZO B;  1MSG A;  1LV9 A;  2F0Q A;  1D2B A;  4HN7 A;  3GTL B;  2E74 C;  5EBD A;  5T1G A;  1IYU A;  4RA8 A;  5JEA H;  3TP5 A;  2N55 A;  2SEB D;  4DAV A;  4J6H A;  1XYI A;  3T53 B;  3TN2 A;  5JEA G;  2IJ0 A;  4BWG B;  1ZYR D;  1QOH A;  3NSW A;  1U4M A;  2L11 A;  1RJT A;  2A74 C;  3PUW A;  5FKA C;  3SK5 A;  5JAV A;  4ILW A;  4KHZ A;  4X3K A;  4IAL A;  4N9T A;  5KIX A;  2F0O A;  2F0P A;  3BDO A;  1BNZ A;  4DXF A;  1GUT A;  1ICW A;  3IFD A;  4IFD J;  5KGU A;  4A93 B;  3OIP A;  3I73 A;  3R3O A;  2BA1 A;  2IPK D;  1EY5 A;  4XIG S;  4NMZ A;  2H1E A;  2Z8L A;  3X3M A;  1MI2 A;  5M5W B;  4IUV A;  2K5D A;  2B2V C;  2WKC A;  2N88 A;  1TII D;  3SE0 A;  2EY1 A;  3GTQ B;  2F3V A;  2EOT A;  1WD1 A;  3VYR A;  4CHT B;  3PIO 3;  1U9R A;  1X3Q A;  4L6T B;  2ENB A;  4K8J A;  3SK6 A;  3GO5 A;  3NQI A;  1PZK D;  2JA7 B;  5IGG A;  3DMU A;  3N52 A;  2OF1 A;  2RDG A;  3S16 B;  2F0D A;  2L5T A;  3W3A A;  2R93 B;  1DOM A;  5EBC A;  3BZD B;  3D6C A;  1S5E D;  5J22 A;  5M9O A;  2IX3 A;  1PMR A;  5M3F B;  3S1M B;  2QEJ C;  2E75 C;  2BDO A;  3HOU B;  2SNS A;  1JCK B;  4QB4 A;  4CJ2 C;  1SYF A;  3TME A;  1W6J A;  2Z1C A;  1J9O A;  5G3L D;  4DNR B;  1PYW D;  1TVX A;  1F2M A;  4A3B B;  4PQX A;  4CKC A;  1SDF A;  4C3I G;  3E6Z X;  3KLS X;  2B2V A;  3P1H A;  5F2D A;  5IGF A;  1ENA A;  1IL8 A;  1E0B A;  3J7A V;  4KKU A;  1SJH D;  1NSN S;  1SEB D;  4HR7 B;  2LKV A;  2F0M A;  3BYT B;  4KN7 C;  2F0T A;  4K8I A;  3TP7 A;  3NTI A;  3Q22 A;  4OO1 H;  4DK1 A;  3VA5 A;  2LMC B;  1F9S A;  2ZXR A;  4ULL A;  5DM7 3;  3CQZ B;  3MFG A;  4OO1 G;  1SYD A;  1F2Y A;  1Q12 A;  1KDB A;  2L12 A;  4P2C B;  1TS4 A;  1DOK A;  1B9N A;  4V19 0;  2FHT A;  4CJ0 B;  4LAA A;  3PMF A;  1HTL D;  3WOF A;  4HCE A;  2HQE A;  2WKD A;  3VA7 A;  1T5E A;  1TWG B;  1TR5 A;  2OEO A;  1Q90 A;  2EY5 A;  3R2I A;  1TKW B;  2WB1 B;  4K5X A;  4UDU C;  5EKL A;  5FO7 B;  2IT1 A;  1OXV A;  3CKI B;  2XIW A;  1EOT A;  5LL6 S;  4IFD H;  3PUZ A;  1SNM A;  1EU4 A;  3IKJ A;  5CV7 A;  4IFD G;  2L0C A;  1JOO A;  4BY1 B;  1VMC A;  3HOV B;  4RHR A;  2F0E A;  4EQO A;  1BQQ T;  1DXM A;  1Q1B A;  3FEW X;  1CA5 A;  2LFN A;  3LX0 A;  5CV5 A;  2V4D A;  2WAC A;  2DNE A;  2PQE A;  3BDL A;  3HOX B;  1ENC A;  2NTS A;  1WD0 A;  4JK1 C;  3NWT A;  3HEJ A;  5CC4 A;  1WTO A;  2E2D C;  5EQ0 A;  4C3J B;  5EPK A;  2AQ3 B;  4JBW A;  1RD9 D;  3MC0 B;  4A3K B;  3SVM A;  3V2T A;  1CZG A;  3HG9 A;  1GUO A;  4K5V A;  4C1N I;  2A6H C;  1STG A;  1CTM A;  3URY A;  2KCC A;  2F3W A;  4H0L C;  5C5M A;  5IT9 L;  1PZJ D;  5C4H A;  1HRJ A;  4KMU C;  4A3J B;  1R4Q B;  2KEE A;  3E0J A;  4S3S A;  1SYC A;  2QKI C;  5C3E B;  4EGV A;  3NUC A;  5DM6 3;  1PFM A;  3S2H B;  3L7Z C;  4KHV A;  3J81 L;  2QF7 A;  1IW7 C;  1Q1E A;  1I4G A;  1EQT A;  2I46 A;  1IKM A;  1JB3 A;  5IOC A;  4FF1 A;  3NBI A;  3DEP A;  2IL8 A;  2EYP A;  4F8M A;  1EEF D;  3HOW B;  3D3R A;  5CV4 A;  2K5Q A;  1CHP D;  1UNS A;  2EDG A;  3ZYY X;  1VF7 A;  3J80 L;  5D65 A;  5EKK A;  1B44 D;  3NTK A;  2LY7 A;  1CT1 D;  3D4R A;  4RWS C;  2OT2 A;  1SYE A;  1CQF A;  1HFN A;  1PTO H;  5I2X A;  4ABN A;  4CKE A;  4HAE A;  3M7G A;  5M3M B;  4XQN A;  3L9A X;  1Z7T A;  2MGS A;  5FO9 B;  3MA2 B;  1B1Z A;  1V1O A;  3OWE B;  1K8O A;  1EZ6 A;  1ESF A;  2A73 B;  3I70 A;  4FNF A;  3NE5 B;  3K7A B;  3QIA A;  2K05 A;  2JE6 I;  1B4O A;  2D5D A;  4DN4 M;  1MD2 D;  1GOZ A;  2A6H D;  1I4R A;  3NQT A;  4KTA A;  3G7L A;  3PO2 B;  2Z4H A;  2SOB A;  2JXM B;  2KA7 A;  1JWM D;  3V96 A;  4CBV A;  4L63 B;  1ZYR C;  4BS9 A;  3PO3 B;  3H6M A;  2C5C A;  1I50 B;  5COY A;  2B2W A;  2M00 A;  2FMM A;  2L9H A;  2FMC A;  2E2H B;  4FVM A;  1IW7 D;  5CV6 A;  4RKB A;  3H94 A;  3G6J B;  3I4L A;  4G4K A;  3A8J E;  3MTS A;  1GXD C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...