1H9SB

Molybdate bound complex of dimop domain of mode from e.coli
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
137
structure length
137
Chain Sequence
b'QTSARNQWFGTITARDHDDVQQHVDVLLADGKTRLKVAITAQSGARLGLDEGKEVLILLKAPWVGITQDEAVAQNADNQLPGIISHIERGAEQCEVLMALPDGQTLCATVPVNEATSLEQGQNVTAYFNADSVIIAT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MOLYBDENUM TRANSPORT PROTEIN MODE
molecule tags Transcription regulator
source organism Escherichia coli
publication title Oxyanion Binding Alters Conformational and Quaternary Structure of the C-Terminal Domain of the Transcriptional Regulator Mode; Implications for Molybdate-Dependant Regulation, Signalling, Storage and Transport
pubmed doi rcsb
total genus 33
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2001-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03459 TOBE TOBE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1h9sB02
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1h9sB01
2JEBI 1GHKA 3W3AA 1B9MA 1Q1BA 3BG3A 1GUGA 3A7AB 2BE5D 2PCFB 3OW7A 3SE0A 4OO1G 3I4LA 2LMCB 3U9SA 1CI3M 2JEAI 3PUVA 4KKTA 1PMRA 1TU2B 1GUSA 3GD7A 3QG1A 5JEAH 4OGQC 2EDGA 4KN4C 3IFTA 4KHZA 2D2CC 4BA1I 3ND9A 2EJGC 1V8QA 4JK1C 2AUJD 1YNJC 2QF7A 3OOCA 1O78A 3OPOA 3TZUA 3FMCA 2R6GA 1IYUA 4XTCS 4DK1A 4H44C 1E2ZA 1VCIA 1Y8PB 2K33A 2EJFC 3CRLC 3AB9A 2K32A 5BN5A 5BN4A 2E74C 1Y69U 3KLRA 2EJMA 2K7VA 4G7OC 1YNNC 2A69D 2CW0C 1Y8OB 3GQBA 4H0LC 5KNDA 3LWUA 2BA1A 3EQLC 2AWOA 3NE5B 3T56B 4GZYC 5K36G 1LABA 4KKSA 3A8JE 1I6VC 2NN6H 2A68D 4G7ZC 3H94A 1EWHA 3D4RA 4DNTB 4IFDH 4KN7C 1LACA 4G7HC 3DXJC 3PUXA 2JXMB 2D5DA 1GUOA 1VF7A 5JEAG 3M7NA 2Q8IB 3VR2A 3VA7A 4KI0A 4IQZA 1H9MA 2DN8A 4TQUS 4RCNA 1QJOA 5A35A 1DD2A 2KCCA 1GUNA 1OXSC 4KMUC 2ZT9C 1E2WA 5KNBA 2B8FA 3PUZA 5BN3A 1IW7C 3CRKC 2DNCA 4LK1C 3MXUA 2E76C 4IFDG 1OXVA 2O5IC 3M4YA 1K8MA 1H9JA 1HPCA 1V43A 2D62A 4XIGS 2A69C 2YYZA 4KKUA 4DK0A 1OXTA 1ZKOA 1K8OA 3VR5A 1A6XA 1IYVA 1GJXA 1H9SA 2L5TA 3SDZA 3I72A 5C0XH 1BDOA 3I73A 4H13C 1OXUA 2A6EC 2E75C 4L8JA 4LJZC 3WDNA 3A8IE 4I7ZC 4HR7B 4DNRB 1CFMA 1SMYC 3QJYA 1DXMA 3A7LA 1CTMA 1OXXK 2KA7A 2V4DA 1ZYRC 3HGBA 3D31A 3N6RA 5KNCA 2F1MA 2AUKA 3L7ZC 4JBWA 1Q1EA 1Y8NB 3PUWA 1E2VA 4PV1C 2JE6I 2BE5C 3M85A 2IT1A 1H9KA 1Z7TA 2NN6I 1H9RA 1HQMC 1ONLA 3VR4A 1H9SB 2PPBC 3T51B 1IW7D 3VR3A 3VR6A 1VF5C 1B9NA 3P20A 1T5EA 3PUYA 1TKWB 1Z6HA 2A68C 3QIAA 3T53B 1VDZA 2O5JC 3BDOA 3ND8A 2A6HC 3A8KE 1Q12A 3PV0A 5C0XG 1DCZA 1HCZA 4OO1H 1GUTA 2BA0A 2EVBA 1GHJA 4BA2I 1O7LA 1G291 3LNNA 4TKOB 1HTPA 2DNEA 1FR3A 2BDOA 3FPPA 3IKJA 2PNRC 5K36H 3RLFA 2A6ED 2A6HD 2NN6G 3MFYA 1Q90A 1FYCA 2B8GA
chains in the Genus database with same CATH superfamily
5KIXA 4OHJA 1I94L 4IFDJ 3J7A5 2JA9A 1XNRL 2GVAA 4K2LA 5EKIA 3EVQA 2VQFQ 1X3FA 4JI7Q 5FLXL 2LFNA 5CV9A 1V8QA 2I5HA 4IUVA 1YHQA 1HNZQ 2VB3X 2JA8B 3OPOA 3TZUA 2E2DC 1PFMA 4H44C 4DK1A 2Z1CA 2EY1A 4DV1Q 3RZOB 2G5DA 4R4IA 4QCLA 5FO8B 4DV5Q 4DV6Q 2V1CC 1AFPA 1SXTA 1K83B 5BR8L 2RKSA 4A3KB 4OWXB 1J6QA 3TMEA 1L0WA 5IYDH 3HG9A 1GVPA 3NWSA 4QUFA 5M5WB 1D5XC 3NEMA 3KJOA 2B39A 3I4MB 1JWUD 1FGUA 3E9IA 3OWEB 3D4WA 4WJ4A 1TWHB 2RF4A 3KF6A 2E2IH 1AN8A 1DD2A 2E2IB 4BBSH 1V9PA 1HJPA 1E2WA 4IZ8A 3A5UA 2ES2A 3P1HA 1SYCA 3VYUA 3C1FA 4LF5Q 1P16A 2ICEC 3CW2C 4K2KA 1A6XA 1PTOC 1H9SA 4BY1G 1F2MA 3I2ZA 3HEJA 4ODGA 3QB3A 5IYBG 4DV0L 1IZ6A 1S72A 2WAQE 4OWTB 5C4HA 1K8AC 4B3MQ 1Y1VB 2F0NA 3Q8DA 4J15A 2IPKD 3KBGA 4JI4Q 2QDLA 3HKZB 2AMCB 4KJNA 4X3UA 1BBUA 2K14A 3AMUA 4K0KQ 4JI0L 3RZDB 4GNXA 1EQTA 2WKCA 4X64L 1SNCA 4IO9A 4FP5D 5IGCA 3F2DA 2EXDA 3T4AC 4TVAB 4OO1H 3Q24A 4NKLA 3AYHB 2DJGC 2EZVA 2I07B 3HFZB 4GLAC 3N52A 2FJ2A 1SR3A 3K5LA 3OSOA 5T1IA 1PRTC 5K36H 2WB1E 2NVTH 2UUBL 1Q90A 3H3VI 3Q0AA 1BXTA 4BBRH 2F52A 2FMMA 1SEBD 1DONA 5IT9L 1SE4A 2D0OA 1YIJA 1IBKQ 2EXZA 1HHVA 3K80C 1WFQA 1IKLA 4A3JB 3J80E 1XNRQ 3M3YH 3HOUG 1NTGA 4S3SA 4B9XA 1PTOB 3C2PA 5GAGC 2WFWA 3WWVA 4XTCS 5BN5A 5AJ3Q 4DR1Q 2UXDQ 3GQBA 5CV7A 2VL6A 2BA1A 3NTIA 4GZYC 3OWFA 2R92B 2CH4W 1I6VC 1HZAA 4P74A 5IWAQ 3BVZA 1EOVA 4DUYL 1STGA 1XPOA 2R93G 1LT5D 1N34L 5JAVA 5ISRA 4DV4L 2KUMA 4GOPB 2FMCA 2CKZB 1ASYA 2B2VA 3TN2A 1PFBA 1QJOA 3HOZG 1EQVA 3R3OA 4DA2A 1B50A 5J22A 5EAYA 1F9SA 2G9DA 2NVQH 2B2YA 4HJ9A 3GV3A 4LAAA 4BBSB 3E0JA 1MHWC 2A69C 3HKZE 1ZKOA 1D2BA 1IYVA 1QCBD 5IOCA 1MBYA 3GTLH 1BCPC 1K0SA 3HOVB 5C4JB 3FKIG 1DXMA 3A7LA 1T5XD 2V4DA 3NELA 2CQOA 2F1MA 4P71A 1R4PB 1ENAA 2BH8A 5JJIA 3RN2A 4CJ1B 1FD7D 1PHJA 1Z7TA 2UXBQ 1EWCA 2IHFA 2NB0A 1H9SB 2RVLA 2YU9H 1BVSA 2WAQG 1CK1A 1U4RA 2MO1A 2A68C 3FHWA 3DLLA 2YTXA 2CWAA 1NBWA 1VQFA 1PFSA 4O42A 2NZ1D 2F0KA 1JE5A 4X3SA 4XT3B 1UWVA 4TKOB 3HKZG 4HEDA 2BDOA 5IIFA 5C3EG 2IJ0A 5CYUA 5JJLA 2B2UC 1B8AA 1D1IA 1ZYRD 3MEFA 2ZTEA 1W2BA 2ZJPA 3K58A 4A3IG 3MC0B 4DR3Q 1I5FA 3DM1A 3A7AB 1NSNS 3SE0A 1CUKA 4GLXA 3CC4A 3HOXB 2VUMG 4ZKBB 1Q82C 4A3BG 4LF9Q 3MEHA 1LUZA 1IBML 4C3JH 3J7AF 1Z47A 2EDGA 5EJWA 3MZ5A 2IX3A 1A62A 2A5HA 2Y0SE 1MI2A 3FMCA 1E2ZA 4XXEA 3AU7A 1PLFA 5LMUL 2FINB 2VS1A 4ZYSA 1PH1A 5I9PA 2F0EA 2RDHA 4YCUA 2QA4A 5EBDA 2F3WA 4FNFA 2K04A 4PQXA 3SVMA 4BWGB 1K3BC 3CC7A 5F2DA 1Z9FA 4L63B 3CAMA 4TQUS 2I5MX 5A35A 1F2LA 2B8FA 4IUQA 1IW7C 4HJ8A 1U4PA 4H7BA 1X3PA 5JPNC 4JOIC 2OCEA 2LS01 4DK0A 3JAME 1AE3A 5C44G 1K8OA 4HMIA 1D6EC 1FVIA 1VQOA 4X62L 4R4TA 1YHAA 2QW7A 1SSOA 4A3DB 2K5NA 5CV5A 4C1NI 4LF8Q 4NP5A 3FRPB 2PI2E 5IT9E 1F2YA 4GN4B 2AKWB 3I55A 4Q5VA 4FYDA 4DF7A 3PIPA 4B3SL 1XYIA 2N78A 4N8FA 4DV2L 5FOBB 3STBC 1RIPA 5LL6S 4A3FB 1X3QA 3MAQA 5GAEC 1SYEA 4O1NA 3CMEA 2R7ZG 4K6LA 3VYSA 2XGTA 5C4XG 2PMZE 2HQEA 4K5XA 1KD1C 3TBIB 1G291 1U4LA 2B2WC 1LT4D 5H1SE 1QVFA 4P73A 2OXPA 4L5RC 4A3EG 2MO0A 4J6HA 3EFXD 1KLUD 2PW5A 1LTID 4CJ2C 2C9OA 2JEBI 3OMCA 5M3FH 3I4OA 4PNYA 3BG3A 4DR4Q 4C56C 4LNQA 1VQKA 3I4LA 1DOMA 2EE1A 2UUCQ 5FJ8G 4B9WA 1S5ED 1CZWA 5FLMH 4GOPA 1I4RA 4A93H 4DAYA 2KVMA 2Z6BA 3FEWX 1Y1WB 1GOZA 1BQQT 4BBRG 2JA7B 1N33L 3K0XA 2JA8H 4F88A 1SYFA 2UUBQ 2EJFC 2K32A 2VUMB 3PO2H 3RMHA 1Y8OB 1E0BA 3K81C 1WCMB 3T56B 5M9OA 1PH5A 1JJCB 5IY0A 3GTMH 4A3MH 3TDQA 5KEEA 1K9MC 1IL2A 2KHSA 3HOWH 4DK3C 1Y1VG 1HNWL 4X65L 3NBHA 1TWHH 4XQQA 1CHQD 2OEOA 4HN7A 2HHHQ 1JE4A 2JA5H 4YWKA 1B70B 2ZXPA 1PH7A 1PYWD 2E5LQ 4LF4Q 3OYYA 2PYKA 1FNWA 1YNND 5LMUQ 2IY5B 5AFWA 2NTSA 3S1QH 3SDZA 3S1MB 2JSOA 3LWEA 1UNSA 1HQRD 3I91A 4GLVB 1JC7A 4HCSA 1SMYC 2R92H 2KA7A 1F2ZA 5I6YA 1SDFA 1GUWA 4OIKA 5IP7H 3GTKH 3I7FA 3CXCA 4BBSG 5LMNQ 2IT1A 2NN6I 3PSIA 1SNPA 5C4XB 2AWNA 2KHJA 3OHXC 4OONA 4DAMA 3K57A 2WV6D 3MVVA 4DR7L 1Z6HA 2MUYA 3H3VC 1S5BD 4AYBE 3L2PA 1TIID 4QB4A 1EY8A 1C0AA 3BYYB 3QOLA 3M7GA 4IUNA 5EKKA 4NMZA 5M3MB 2MGSA 4K5VA 1Y14B 2B3GA 1X56A 2PZTA 1E24A 1B9MA 1VS0A 4H02A 5D3IB 4M1UB 1HRJA 2F4IA 4YHHL 4WRDA 4IFDI 2DJFC 1ICFB 1S3OA 2LMCB 3GV6A 3ULLA 1LM0A 4BBRB 2JA7G 1PMRA 1A2TA 1AE2A 3BS1A 1JMCA 3DM3A 1XMQQ 3S17B 1CA6A 3ND9A 1CKNA 1ZXTA 1JOKA 1XMOQ 1MSGA 1A2UA 1SE8A 1Y8PB 1KAAA 4F87A 1E7ZA 3HRZC 3J81i 3BVGA 1KRTA 1VQ5A 4O0AA 1D5MC 2B2TA 2X6LA 2Z8LA 5C3EB 1UE6A 5DM73 1WTQA 1VQIA 1HA6A 1GXDC 5JJZA 1HXYD 4KLKA 5CMDA 4RCNA 4IPHA 1GUNA 4JI5L 1PA6A 3AFQA 3E0EA 1NJIC 5C5LA 2EYMA 1PH4A 4LK1C 1V1QA 3RLNA 1OXVA 3C3LA 5JPMC 1BNZA 3RNUA 3EBEA 1HNWQ 4OO1I 3ZJYC 4XT1B 2NVTB 4DR2L 4RG1A 1D8LA 3TSSA 2NWGA 2Z6KC 1S5DD 1XMQL 4QJFA 1MJEA 5C4ZA 3CCVA 4A3FH 2A8VA 1LV9A 1RF2D 4C1NK 1JICA 3LGJA 4YY3Q 1JJGA 4L5TA 1DM0B 4UDUC 1WTRA 5D65A 3V96A 3K7UC 1UE1A 4BA2I 3U4ZA 3J7AV 1C7YA 2X6GA 2IWHA 3HOUH 1I6HH 4POGA 5A2QL 1KTKA 4KK7A 1RCVD 2F3IA 2R92G 3TZDA 4LW1A 3OW7A 2K52A 3UDXA 2OQ0A 5I4DA 1XPRA 1X65A 2OT2A 2EOTA 5HGTA 4UY8C 4R9WA 4GOPC 4CHTB 1NMGA 3IFTA 3AEVA 2OQKA 2EJGC 4A3EB 4JI2Q 2QF7A 1L1OC 1HTLD 2NYZD 4HJ7A 2CVRA 4LF7Q 1TWFH 1Y69U 2PQAA 2EPBA 1SMXA 1LT3D 4G7OC 1FGBD 5KNDA 3PIOA 3A5ZB 1V1PB 3NE5B 1VQ6A 5IE8A 3J7YW 4LF8L 1TWAB 3J80i 2B2WA 4DNTB 1IBLL 4RFBA 2Q2UA 1DGSA 2FFKB 1LACA 5IGDA 1Y1WG 2L1BA 2VW9A 2EYFA 4LFBL 3KK7A 4IJHA 5GAHC 1RKNA 2D5DA 2HUGA 4F8MA 4KTAA 4X65Q 4AIMA 1DOLA 1VQAA 1I4PA 2ZT9C 3VA5A 3G6JB 1YJ9A 3S17H 4ID6A 1V43A 5E7NA 2YYZA 4JI8Q 1OXTA 2CHBD 1OTCA 2VY3A 5C3XA 2IX0A 3KUPA 5ELFA 1XMOL 3ONAB 5COYA 1RD9D 3CQZH 1NY4A 2EQSA 1YNJD 3HGBA 2R7ZH 1DJRD 4JI7L 3D8GA 1N8RC 1VQLA 4JOIA 3NWTA 1SRUA 4C3HH 1E2VA 1G2SA 4A3BH 3H0GH 3E9HA 2EYLA 1M90C 1KABA 3CP0A 1M1KC 3KDFB 3VR3A 3DEPA 2LY7A 4B3RL 1WOCA 2WINB 4R8NA 1QNUA 2D0PA 1VDZA 1KRSA 4LUVA 1PZKD 3T1YQ 1GHJA 2E2JH 4POFA 1J5EQ 3LNNA 5A2QE 3UI2A 3IAYA 4ME3A 4NW2A 1CM9A 3I4NB 5FLMG 2RA4A 1N36L 4K6DA 2KQ3A 1MGSA 5M3FB 1UEAB 1GUGA 1LTLA 1KL9A 2VZAA 3E5SA 3P7JA 4KY6A 3CCMA 4HJAA 2K6AA 4EVOA 5KGUA 1EEFD 3G71A 4A75A 5IGFA 2IW3A 4DKAC 4XYOA 1EOTA 3KOJA 3J80c 3CQZB 2C35B 2K5VA 1RL2A 3A74A 2NVXB 3IFDA 4NXMQ 3RZOH 1RTNA 1A3UA 5DAUA 1M8AA 2A69D 5C3EH 2ICIA 2G9HD 2XN9C 3RD4A 3K8AA 1ET9A 1TVXA 2ID0A 1N32L 2B2UA 1N32Q 1LABA 1CKMA 5DM63 4XYQA 4CDDC 4IFDH 3D0FA 4JI6L 1WTVA 3V2TA 4A3MB 1O80A 2EYOA 4EQPA 1ICWA 1L0XB 2B29A 3F8TA 3VA7A 4LUZA 1PH8A 1H9MA 5IP7G 1I3QH 1AZPA 3DUZA 4CGYB 4E6IA 1VQJA 4A3FG 3S2DH 3VYRA 2N88A 1H9JA 4GN5A 3TS2A 2PW7A 1EY5A 2HQLA 5E1FA 1EL0A 1TWFB 2R3ZA 2JK8A 1U5KA 3CCEA 3EJIA 3V05A 2A6EC 5ELCA 4Y7NB 4I7ZC 2XTIA 5M5XH 1J5EL 1IL8A 4EGVA 1ZYRC 1NNXA 3NQTA 1BKBA 2JA5G 2Q2TA 2ATWA 5DEHA 4AYBG 2Q2IA 3BZDB 2F0UA 1VQ7A 2BDNA 3PIP3 1R9TB 2F0HA 1L2FA 3M85A 3PO3H 3RZDH 5LMNW 1YI2A 2CCZA 1X32A 4BY1H 2F0MA 1EY4A 2Z4IA 2GVBA 3P20A 2F4VL 3RR5A 3FVQA 4BXXH 4JC0A 3I4NG 1PH6A 1G8ZD 5ELNA 1O7LA 4A3GG 3H3VH 5ELDA 1A3TA 1UAPA 1EFID 4FVMA 4HSVA 1S40A 2VXWA 1JB3A 4DV3Q 4RH6A 1K3RA 2ALYB 1FNVA 4IALA 4YWLA 4CKBA 1K0RA 2KBNA 5CBEE 3HOXH 3J81j 3RUZA 1HNXL 4ZQ3A 2Z9HA 4RGOS 3M4QA 3GD7A 4A4IA 3QG1A 4C3JB 5JEAH 3A56A 1MIUA 1STEA 5CC4A 3J7ZC 5IGEA 3HOWG 4RMFA 5I6WA 1EQQA 5JVG3 2TSSA 4JPBW 4UP7A 3S1QB 1IYUA 1VCIA 1ENCA 2NTTA 4J8QA 1TY0A 1HR0L 4RWSC 1YZ6A 1SE3A 3K6OA 2ZXRA 4WJ3M 2A19A 5HURA 2XRQD 3CCQA 4GKJQ 2KECA 3DXJC 4LFAL 3SK6A 2R7DA 1GUOA 3L3OC 3B6YA 1I6HB 3I8ZA 1T9HA 5FJ8H 3G48A 2VQEQ 1BOSA 4GNXC 1EEID 3D4DA 4IPDA 3MXUA 3STBD 4L6TB 1K8MA 4KKUA 2UXDL 1G91A 4PZ6A 3I70A 5IP9G 5C0XH 3AQQA 4AYBB 5C4JH 2KENA 3I73A 4H13C 4UPAA 2K28A 4DR6L 3PCOB 1JCKB 1MJCA 1STBA 4RA8A 3I4MG 4DV6L 3CMAA 4JBWA 4YWMA 5GADC 4ILWA 2HCCA 4YCVA 1H9KA 1H9RA 2RSOA 4DR3L 2MHVA 1KC8C 1G6PA 3CPWA 1IW7D 2YU9B 3VR6A 3AFPA 1DZ1A 2HD3A 5ELBA 1O7YA 3TRZA 3QIAA 3UDGA 1TWGB 2CWPA 1Q12A 5JEAJ 2BA0A 2EVBA 3M9BA 1BF4A 4DNIA 3IKJA 3DWPA 4ALPA 3S1RB 4RGTA 1CQVA 1TWGH 4GKKQ 2QKIC 2NZHA 1A8VA 3KDFA 1L1OA 4B08A 3PO2G 2Q8TA 3GTQB 1D7QA 2B8GA 1KDCA 1KXLA 1NMFA 1TWCB 4LFCQ 1O7IA 1EZ8A 4DUYQ 1KNEA 1IBLQ 2QGQA 4CKEA 3GP7A 4OGQC 3MXNA 2NVQB 2D2CC 4I65A 4ZUJA 4MZ9A 1ASZA 1KIXA 3E3XA 4QIWB 5CGKA 3OOCA 4AQYQ 4EX5A 5AJ3L 5FLXc 4HIMA 2I5LX 4ZUIA 4LF7L 1IKMA 1II3A 5M5YB 2MPMA 5CV6A 4FF4A 1SNOA 2JN4A 1BUVT 1SJED 2HDLA 3CHBD 5K5PA 4GKKL 1YNNC 3BDCA 2RSNA 2JA6G 5C44H 2JYOA 3A8JE 1JB7A 5C3WA 3W5OA 2EYHA 2EY2A 3HOWB 4A3CH 2KJXA 5KYLA 2N8NA 1TWAH 4UAIA 1VQDA 4DV4Q 4TSSA 2E2JB 2OTLA 4JCVE 2Y0SB 4HJ5A 1HZBA 4IURA 3ER0A 2Z6KA 5NUCA 3S1RH 2P5ZX 3SXHA 1SNDA 2AQ2B 4IFDG 2HIXA 1D5ZC 3ITPA 2K5QA 4YHHQ 5IGBA 3Q23A 3M4OB 1J9OA 4ABNA 4A93B 2ZTCA 3MA2B 1PH9A 1I4QA 1FNUA 2R7ZB 3QJYA 4DV7Q 1XJVA 1R4QB 4R4QA 3L0OA 4JI4L 2PO4A 3PUWA 5I2YA 2NVXH 3BDLA 1RODA 1I4HA 4V190 3GTGH 3DWAA 3K59A 3Q6SA 2B2TC 2O4XA 1K83H 2TMPA 1I50B 2XWJB 1VQMA 3ZYYX 2O5JC 3NENA 3PV0A 2IHEA 2F0DA 1DCZA 3S2DB 3PO2B 5M5WH 1L1OB 3X3NA 3A55A 2DNEA 4L5SA 3FPPA 3EIVA 4UHVA 2PNRC 1YEZA 4WFN3 1LTAD 3TP8A 3RLFA 4KD4A 5FO9B 4DUZQ 3GTOH 3HOVH 1NR4A 2DY7A 3PQIA 4K14A 4X64Q 3S2HB 4O2DA 1EYGA 2PCFB 4A3CG 2KCNA 5FO7B 2I0QA 4OO1G 1DOKA 3U9SA 3KLSX 3S14B 1Q3LA 3DWQA 1R9TH 1JQYD 2HHHL 4RHSA 3JC66 4LFCL 1HNXQ 4KN4C 5BR8Q 1QUQA 2QCPX 1QE6A 4A76A 2L4NA 4ZKCB 5KYIA 2AHOB 5ELEA 4PMCA 2Q8RE 2RDGA 2R61A 1SNQA 1RTOA 2R6GA 4CBVA 2NVYH 1W3SA 2D9UA 3R8BA 3HZXA 3QO2A 4ME5A 1WYDA 2CW0C 1EFWA 3TREA 1L0YB 2K5WA 4ULLA 3M4PA 1HR0Q 1EIFA 1B7YB 2RDFA 1YJNA 1EWHA 1LYLA 2J4XA 3NP8A 2Y0SG 4RHRA 5DLQE 4NDXA 1HZ9A 2Q8IB 3VR2A 1VMPA 4IQZA 1KLGD 3Q22A 1VQHA 2AQ3B 1S5CD 2B63H 4A3LH 4JW0A 4U68A 1EY7A 1CSPA 2JA6B 4PG3A 5CV4A 4C3IB 5GQOA 3JAMc 1FJGQ 1YJWA 3H0GG 2HDMA 2PNHA 3PGZA 1PRTB 1BR9A 4PMBA 4HIDA 2F0PA 2F0JA 2E75C 4Y7NH 5IYDG 3WDNA 3A8IE 1K8GA 4K8JA 1OXXK 2ZTDA 2J0TD 3E6ZX 3D31A 1HUNA 1OO9B 3U9OA 3CCRA 5CBAE 1G6ZA 3RLOA 2F0TA 2JE6I 4GS3A 5IT9c 2BE5C 1CA5A 5M5XB 3HOYH 3NXWA 2F4VQ 4B3RQ 3HP3A 3NTKA 1STYA 4HTHA 4X3TA 4JI1Q 1KQSA 3CCLA 4JYAL 1WTXA 3MTSA 1B9NA 3U4VA 4DV2Q 3D3RA 1ET6A 1XTDA 2JQOA 3CCJA 4OX9Q 2A6HC 1QUQB 3QOJA 3OW2A 1SNMA 1A63A 1QNKA 5KRUA 5L37A 3KLWA 2NUCA 3PO3G 2K01A 1I3QB 2NN6G 3DEOA 2XRSD 3MFYA 4C2MH 2PZUA 2F0WA 3GO5A 1PZJD 1CT1D 4QY7A 2JJQA 3OIPA 1Y1WH 2H1EA 2B63B 3KBXA 5C5MA 4KKTA 4A3MG 3NQIA 4A3GH 1QWYA 1WD0A 1MKHA 5HGQA 1D1KA 4G57A 3KJPA 3L9AX 1YNJC 4I7AA 1TY2A 1WI5A 3F1ZA 4DV3L 2UXBL 1EU4A 1QG7A 3F2BA 4FF1A 2K33A 3MXNB 4J1MA 1A3VA 1VQNA 3I56A 2J7ZA 3RN5A 1HR0W 3MXGA 5K36G 2AWOA 2L15A 3S16H 1LT6D 3UE1A 1JJ2A 1LTRD 4EQNA 2UUCL 3H91A 2NBFA 1Q86C 4LWCA 5FK9C 2F0LA 1ZEQX 4OEMB 2JA8G 1K73C 2JA5B 2CQAA 4DR4L 2DGYA 1RHPA 5IP9H 1JOOA 4KI0A 3CCUA 1AP0A 4HIOA 2A73B 4ZRZA 3O13A 1AW7A 1Q8IA 1VQEA 2YTVA 4G4KA 2GA4B 4QIWE 2N55A 4R1JA 4DXGA 2WAQB 3CRKC 3PF4A 2LSSA 2O5IC 1Q8KA 1STHA 2CH4A 2C5CA 1WTPA 1PXUA 3CD6A 1BBWA 2WIIB 2L0CA 5IYCG 1XX8A 4JG2A 4MHEA 3VR5A 1VQ4A 1EY0A 4CKCA 3HOYG 3UDFA 1U4MA 1WCMG 4FXGC 1C9OA 1XPUA 3GTPH 1RJTA 4L8JA 1B3AA 4IJLA 1CFMA 3HOZH 3CPFA 3T1YL 5LL6X 3J81E 1ESRA 4P2CB 1STNA 1B53A 1UE7A 4OWWB 4CDEC 2ENBA 3H0GB 4A3BB 4FXDA 3CC2A 3KFUA 4CJ0B 1TQOA 4DN4M 1T5EA 4LFBQ 4HMJA 3T53B 4QUCA 4A3IH 1EYCA 2OWOA 1ENFA 5C0XG 1F9RA 1JORA 2PQEA 3J80L 3GTJH 3SK5A 2O2LD 3QR8A 3J81L 4JV5L 4B3ML 1EWIA 1SJHD 5EQ0A 2BOSA 4DV0Q 1LO5D 3KF8A 3ICEA 1B4OA 4V0BA 4JI8L 4IOAA 4DPGA 2F0GA 3SR1A 1E3PA 3G4SA 3PUVA 1PTOH 1E22A 1GUSA 4IUPA 2YTYA 1C8CA 4K5WA 3SEBA 2EIFA 5C4XH 4KY7A 3I3CA 1O78A 1KDBA 4APVA 4X6AH 3BVMA 1SLJA 3NPPA 1KHIA 1JR0D 1E1OA 4H0LC 5IWAL 1KNAA 1U0LA 1CZGA 2LXKA 3KYHC 2K75A 1EIHA 1M4VA 3F2UA 1NE3A 5FKAC 4LF6Q 2ZJQA 4OX9L 4HSPA 3T1HQ 1VQBA 3D6CA 1CQFA 3I4MH 4IUTA 4A3KH 2JXMB 3S15B 2K03A 2KHIA 4X66L 5C0XJ 4CDFC 1TR5A 2WKDA 1A0IA 2QEJC 1YHBA 3C46A 1PTOD 3PUZA 2JA6H 5BN3A 3GDEA 1B44D 2E76C 1IBKL 1WJJA 3GTQH 3DMUA 3NBIA 1I94Q 1GO3E 1ILPA 1GJXA 3MWYW 3TP6A 2B2YC 2AQ1B 1KDAA 4WORA 2EYJA 4KHPQ 1GD7A 3N6RA 1UUPA 1SBBB 1NR2A 2WACA 3W2DA 2B2VC 1BCPB 2H4OA 3WOEA 2KEEA 4YY3L 5G3LD 1LTSD 3T51B 1GKHA 1VQGA 3KF6B 4XQJA 4F7XA 4JBJA 4LUOA 1PRTD 3FKIB 5LMNL 5M3FG 2DY8A 1NUCA 3A8KE 5TSSA 1EYAA 5EKLA 4R8IA 3SK8A 1QB5D 2Z4HA 1GM5A 3NSWA 3IRBA 2F0IA 1B3QA 2RBMA 1X9NA 2SOBA 1AH9A 5EPLA 4DR2Q 1I4GA 1YBYA 3GTOB 1SMYD 1F77A 4C2MB 3X3MA 1B1ZA 1GHKA 2CFMA 4JI2L 4AQYL 4RAUC 4MN3A 3I4NH 1EY6A 4KY5A 4LF5L 1FL0A 2R93H 2E5LL 4LF4L 1J8IA 2BCOA 4P72A 5EBCA 2H5XA 3GTLB 2L12A 3S1NB 5EPJA 5C6AA 3EROA 1QILA 1WTHA 4A3LG 4DFAA 2HT1A 3TEHB 3K7AH 1JWMD 1SAPA 3G7LA 5BN4A 3HOXG 2UUAQ 4JBKA 3S1MH 2EJMA 4YIJA 4OXPA 3LWUA 2SDFA 4KKSA 2RQXA 1Q7YC 5HY6A 2NVYB 5E3FA 3FP9A 1VQPA 1TS2A 4KN7C 4QF4A 4G7HC 1F9QA 2ZM6Q 1WVLA 4RCOA 2E2HH 2MFIA 2MP1A 1B2TA 4UP9A 4LMQD 1HNZL 4RGMA 1BO0A 2KCCA 2OF1A 1OXSC 4P75A 3PMFA 1HH2P 1XNQQ 3OTOQ 4RGNA 1ML0D 4C3IH 1YNXA 4DV7L 1PH3A 4BXXG 2K50A 3VYTA 4XIGS 2FHTA 4KJOA 2PI2A 4AH6A 3F2CA 4IOCA 2UU9Q 1LTTD 4A3KG 1CKOA 2F0FA 2F0SA 4LJZC 3KF8B 3J81c 1X3GA 3UE0A 1PV4A 1UE5A 1SROA 3L7ZC 5LHY1 2BH2A 1Y8NB 4PV1C 3T13A 2F0OA 5C44B 1EQRA 3PF5A 1XTCD 2HIVA 3S15H 1PH2A 4DR7Q 3UDIA 1ONLA 1HFNA 3K5NA 4IPGA 1ESFA 1VF5C 3PUYA 1MSHA 2F0QA 4LFAQ 1TT2A 2F3VA 3K7AB 3A0JA 3ULPA 1AZQA 3BDOA 1S4ZA 4ZLTF 2N3SA 1G2TA 1HCZA 5IGGA 1GUTA 3S24A 1G51A 3NK9A 1X55A 1PVOA 2IL8A 2DUDA 2HCIA 4JVZA 4L5QA 4C3JG 5IYBH 1PYBA 2LXJA 1XWEA 4MTKA 3M4OH 4JI3Q 4GNXB 1N33Q 1FYCA 3K5MA 1V1OA 1JT8A 3NUCA 1TWCH 1U9RA 4KD3A 1HA5A 4DXFA 1IHZA 1CI3M 3R2TA 2XNAC 2JEAI 3NTHA 2ASBA 5JVH3 1UEBA 1SN8A 1BCPF 3URYA 2PQAB 2N49A 4B3TL 2A1AA 1LTBD 1F9PA 2GN5A 4KHPL 3QWNA 3EA6A 4C3HB 4OL7A 3C1EA 2UUAL 4HCEA 4FO2A 5JOBA 3CRLC 3H15A 4PZ8A 2E74C 2SEBD 4MNOA 3U58A 1K28A 5IYCH 1H95A 1P8LA 5E4XA 3HOYB 2A68D 4U673 2VQFL 2LKVA 3BYTB 4X3KA 4QGUA 2M2LA 3PUXA 1KAWA 4RKLA 1HUMA 1VQ8A 4OELB 1C48A 2XWBB 5J39A 4K8IA 4KMUC 4GKJL 1STAA 5KNBA 4ZK9B 3S1NH 1QZGA 5I2XA 4DR5L 4BY7B 4M8AA 4IN3A 3H09A 4QMGA 4X62Q 3JAML 1SFOB 1SFOH 1ILQA 1BDOA 2PMZB 1WTOA 1OXUA 1WTWA 1Y1VH 3PO3B 3GTMB 1CTMA 3H6MA 1EIYB 3HS0C 1QVGA 1EYDA 2AUKA 2RHSB 2VUMH 2VQEL 3FDTA 4EQOA 1V1PA 2KOLA 5M5YH 2CW0D 2B63G 1HZCA 5T1GA 3S9WA 3TS0A 3K5OA 3R93A 5E4WC 3PIO3 1N9WA 3P75A 1HTPA 1FR3A 2PZWA 1VQCA 1SYDA 4NXNL 4NPSA 4N9PA 4FDBA 3S14H 5D14A 1BBXC 2DN8A 1AEXA 2UXCL 5CV8A 1YITA 3A54A 4QQBX 1TS5A 4XDXA 1TU2B 4BY7H 4LF6L 4A3JH 4LF9L 5M3MG 2EYPA 1JWSD 1X6OA 2KEDA 2M9VA 4KHZA 4BA1I 4DR6Q 5FLXE 4JK1C 4BY1B 1TS3A 3BZCA 4N8X1 4DU9A 1CHPD 4DGZA 3CU7A 4A3EH 3KLRA 1LTGD 4A3DH 3GTKB 4XQNA 2ZXOA 1WCMH 1W6JA 3EQLC 1QVCA 1PTOF 2MQHA 2EY5A 1TXYA 2NN6H 3GTGB 3H94A 3OIQA 2L55A 3D4RA 1Q46A 3W1BA 2E2HB 4FXKC 4A3JG 1VF7A 2RHQB 4X66Q 4DR5Q 1Q81C 4R4CA 4RKBA 2KCMA 4B3TQ 4B3SQ 3T1HL 4JI6Q 1IBMQ 1XXGA 1PFNA 1YVCA 5IODA 3CCSA 1VQ9A 4JV5Q 3M4YA 1NCVA 1HPCA 2D62A 5EPKA 3SGIA 2UXCQ 4ZAIA 1NAPA 3CF5A 5G3LF 4KV6A 1TS4A 2L9HA 2R7FA 4YCWA 1VMCA 4DNRB 1HFGA 4HR7B 1PRTF 3W1GA 3S2HH 1I4XA 3ERSX 5GROA 1X54A 2RCFA 2NZOA 4JBMA 2XIWA 1EIGA 1E1TA 3MXPA 1Q1EA 3MFGA 2E8GA 4IUUA 4HAEA 2QILA 2QEXA 3FPUB 3BZKA 2WB1B 4BY7G 3VR4A 3DHQA 4PZ7A 3I90A 3IL8A 2JA7H 3BJUA 3SHLA 4JI0Q 1N34Q 1I50H 1TKWB 3CKIB 1N36Q 2KCTA 2F0VA 4MIUA 1CKNB 2I46A 4TRDA 1LLRD 1A15A 1EY9A 1DYQA 4GN3B 2RCNA 4CDCC 1SYGA 3OMGA 4A3DG 4QL5A 3NBHB 5M3MH 3JAMi 2A6ED 2A6HD 4NXML 3TP7A 5I9OA 3W3AA 1Q1BA 2BE5D 2IX1A 3HOZB 4Q0FA 1EZ6A 1JOQA 2K5HA 4Y52H 2SNMA 1X3EA 4KHVA 1IYJB 3GTPB 1SE2A 3WOFA 2Z0SA 2L11A 4R4OA 4DAVA 3LX0A 1XNQL 2QDBA 3D6WA 5J1ZA 2R93B 2AUJD 1EUJA 1O7ZA 1QZHA 3HOVG 2M00A 2F03A 3M3YB 1PYSB 3AB9A 2K5DA 2A74C 3HKSA 2K7VA 2MJ8A 5CR3A 2SNSA 3GTJB 2WP8J 5ELOA 3NHHA 4FF2A 3S16B 4IPCA 4G7ZC 4A3IB 3SK4A 5J3BA 4C3IG 4HIKA 4DV1L 3FKIH 1EU3A 4OIJA 5JEAG 4WJWA 3M7NA 3TQYA 5CORA 2FXQA 5EGTA 2ZJRA 4NXNQ 2EY6A 1IXRA 4DAPA 3OTOL 1CSQA 5JJKA 2DNCA 1RDPD 4PMWA 1C4QA 3G6EA 3VDYA 3ERQA 2JP1A 5DNFA 3T16A 2L5TA 2ZM6L 4A3GB 3I72A 2MNAA 5D3DA 4JI3L 4Z9CB 4DK6C 3R2IA 4JI1L 2X69A 4EQ5A 5C0XI 5KNCA 2VB2X 3K0YA 1MD2D 2OTJA 4NB3A 2XSCA 3U50C 4JI5Q 3KLSA 1HQMC 1PZID 2PPBC 3EN2A 4ZCKA 3BU2A 4K0KL 2XVSA 4DUZL 3ULJA 1QOHA 4N9TA 3ND8A 3TP5A 2VNUD 4DAYB 4MTNA 2Q2HA 2YV5A 4C3HG 4BS9A 1S5FD 1FJGL 3MHBA 4A93G 1BCPD 1WD1A 4DR1L 4DV5L 4UP8A 3HOUB 2K05A 1W6KA 2WB1G 4FF3A 2UU9L 2K4KA 1SYBA 1PDQA 4JYAQ 2K1BA
chains in the Genus database with same CATH topology
5KIXA 4OHJA 4IFDJ 4K2LA 5EKIA 3EVQA 5FLXL 2LFNA 5CV9A 1V8QA 4IUVA 2VB3X 2JA8B 3OPOA 3TZUA 2E2DC 1PFMA 4H44C 4DK1A 2Z1CA 2EY1A 3RZOB 4QCLA 5FO8B 1AFPA 1SXTA 1K83B 2RKSA 4A3KB 3TMEA 3HG9A 3NWSA 4QUFA 5M5WB 1D5XC 2B39A 3I4MB 1JWUD 3OWEB 3D4WA 1TWHB 1DD2A 1AN8A 2E2IB 1E2WA 4IZ8A 3P1HA 1SYCA 3VYUA 3C1FA 2ICEC 4K2KA 1A6XA 1PTOC 1H9SA 1F2MA 3HEJA 4ODGA 3QB3A 5C4HA 1Y1VB 2F0NA 2IPKD 3KBGA 3HKZB 4KJNA 4X3UA 3AMUA 3RZDB 1EQTA 2WKCA 1SNCA 4FP5D 5IGCA 3T4AC 4OO1H 3Q24A 4NKLA 2EZVA 2I07B 3N52A 2FJ2A 3K5LA 3OSOA 5T1IA 1PRTC 5K36H 1Q90A 3Q0AA 1BXTA 2FMMA 1SEBD 1DONA 5IT9L 1SE4A 2EXZA 1HHVA 1IKLA 4A3JB 3J80E 4S3SA 4B9XA 1PTOB 3C2PA 4XTCS 5BN5A 3GQBA 5CV7A 2BA1A 3NTIA 4GZYC 3OWFA 2R92B 1I6VC 3BVZA 1STGA 1LT5D 5JAVA 5ISRA 2KUMA 2FMCA 2B2VA 3TN2A 1PFBA 1QJOA 1EQVA 3R3OA 4DA2A 1B50A 5J22A 1F9SA 2G9DA 2B2YA 3GV3A 4LAAA 4BBSB 3E0JA 2A69C 1ZKOA 1D2BA 1IYVA 1QCBD 5IOCA 1MBYA 1BCPC 3HOVB 5C4JB 1DXMA 3A7LA 1T5XD 2V4DA 2F1MA 1R4PB 1ENAA 4CJ1B 1FD7D 1Z7TA 1EWCA 2NB0A 1H9SB 2RVLA 1CK1A 1U4RA 2A68C 4O42A 2NZ1D 2F0KA 4X3SA 4XT3B 4TKOB 4HEDA 2BDOA 5IIFA 2IJ0A 5CYUA 2B2UC 1D1IA 1ZYRD 3K58A 3MC0B 3DM1A 3A7AB 1NSNS 3SE0A 3HOXB 4ZKBB 3MEHA 3J7AF 1Z47A 2EDGA 5EJWA 3MZ5A 2IX3A 2A5HA 1MI2A 3FMCA 1E2ZA 4XXEA 3AU7A 1PLFA 2FINB 4ZYSA 5I9PA 2F0EA 2RDHA 5EBDA 2F3WA 4FNFA 2K04A 4PQXA 3SVMA 4BWGB 5F2DA 4L63B 4TQUS 5A35A 1F2LA 2B8FA 4IUQA 1IW7C 1U4PA 4H7BA 1X3PA 5JPNC 2LS01 4DK0A 3JAME 1K8OA 4HMIA 1D6EC 1SSOA 4A3DB 5CV5A 4C1NI 4NP5A 3FRPB 5IT9E 1F2YA 4Q5VA 4FYDA 4DF7A 1XYIA 5FOBB 5LL6S 4A3FB 3MAQA 1X3QA 1SYEA 4O1NA 4K6LA 3VYSA 2HQEA 4K5XA 3TBIB 1G291 1U4LA 2B2WC 1LT4D 2OXPA 4J6HA 3EFXD 1KLUD 2PW5A 1LTID 4CJ2C 2C9OA 2JEBI 3OMCA 4PNYA 3BG3A 4C56C 3I4LA 1DOMA 2EE1A 4B9WA 1S5ED 1CZWA 1I4RA 4DAYA 2KVMA 3FEWX 1Y1WB 1GOZA 1BQQT 2JA7B 4F88A 1SYFA 2EJFC 2K32A 2VUMB 3RMHA 1Y8OB 1E0BA 5M9OA 1WCMB 3T56B 3TDQA 5KEEA 2KHSA 3NBHA 4XQQA 1CHQD 2OEOA 4HN7A 1JE4A 2ZXPA 1PYWD 2PYKA 1FNWA 1YNND 5AFWA 2NTSA 3SDZA 3S1MB 2JSOA 3LWEA 1UNSA 1HQRD 3I91A 1JC7A 4HCSA 1SMYC 2KA7A 1F2ZA 5I6YA 1SDFA 1GUWA 4OIKA 2IT1A 2NN6I 1SNPA 5C4XB 2AWNA 3OHXC 3K57A 2WV6D 3MVVA 1Z6HA 2MUYA 3H3VC 1S5BD 1TIID 4QB4A 1EY8A 3BYYB 3QOLA 3M7GA 4IUNA 5EKKA 4NMZA 5M3MB 2MGSA 4K5VA 2PZTA 1B9MA 5D3IB 4M1UB 1HRJA 2F4IA 4IFDI 4WRDA 2LMCB 3GV6A 4BBRB 1PMRA 1A2TA 3BS1A 3S17B 1CA6A 3ND9A 1ZXTA 1JOKA 1MSGA 1A2UA 1Y8PB 1KAAA 4F87A 3HRZC 3BVGA 1D5MC 2B2TA 2X6LA 2Z8LA 5C3EB 5DM73 1WTQA 1HA6A 1GXDC 5JJZA 1HXYD 5CMDA 4RCNA 1GUNA 5C5LA 2EYMA 4LK1C 1OXVA 3C3LA 5JPMC 1BNZA 4OO1I 4XT1B 2NVTB 3TSSA 2NWGA 1S5DD 5C4ZA 1LV9A 1RF2D 4C1NK 1JICA 1DM0B 4UDUC 1WTRA 5D65A 3V96A 4BA2I 3J7AV 2X6GA 2IWHA 5A2QL 1KTKA 4KK7A 1RCVD 3TZDA 3OW7A 5I4DA 2OT2A 2EOTA 5HGTA 4R9WA 4CHTB 3IFTA 4A3EB 2EJGC 2QF7A 1HTLD 2NYZD 2CVRA 1Y69U 2EPBA 1LT3D 4G7OC 1FGBD 5KNDA 1V1PB 3NE5B 3J7YW 1TWAB 2B2WA 4DNTB 4RFBA 2FFKB 1LACA 5IGDA 2L1BA 2EYFA 3KK7A 1RKNA 2D5DA 2HUGA 4F8MA 4KTAA 1DOLA 1I4PA 2ZT9C 3VA5A 3G6JB 4ID6A 1V43A 2YYZA 1OXTA 2CHBD 5C3XA 2IX0A 3KUPA 5ELFA 3ONAB 5COYA 1RD9D 1YNJD 3HGBA 1DJRD 3D8GA 3NWTA 1E2VA 1G2SA 2EYLA 1KABA 3VR3A 3DEPA 2LY7A 2WINB 4R8NA 1QNUA 1VDZA 1PZKD 1GHJA 3LNNA 5A2QE 3UI2A 3IAYA 4NW2A 1CM9A 3I4NB 2RA4A 4K6DA 2KQ3A 1MGSA 5M3FB 1UEAB 1GUGA 3E5SA 3P7JA 4KY6A 2K6AA 4EVOA 5KGUA 1EEFD 5IGFA 2IW3A 4XYOA 1EOTA 3CQZB 2NVXB 3IFDA 1RTNA 1A3UA 5DAUA 1M8AA 2A69D 2ICIA 2G9HD 2XN9C 3RD4A 1ET9A 1TVXA 2ID0A 2B2UA 1LABA 5DM63 4XYQA 4IFDH 1WTVA 3V2TA 4A3MB 1O80A 2EYOA 4EQPA 1ICWA 1L0XB 3VA7A 1H9MA 1AZPA 3DUZA 4CGYB 4E6IA 3VYRA 2N88A 1H9JA 2PW7A 1EY5A 5E1FA 1EL0A 1TWFB 2R3ZA 3EJIA 3V05A 2A6EC 5ELCA 4Y7NB 4I7ZC 1IL8A 4EGVA 1ZYRC 3NQTA 5DEHA 3BZDB 2F0UA 2BDNA 3PIP3 1R9TB 2F0HA 3M85A 1X32A 2F0MA 1EY4A 2Z4IA 3P20A 3FVQA 1G8ZD 1O7LA 5ELDA 1A3TA 1UAPA 1EFID 4FVMA 4HSVA 2VXWA 1JB3A 4RH6A 1FNVA 4IALA 4CKBA 5CBEE 3RUZA 4ZQ3A 4RGOS 3GD7A 3QG1A 4C3JB 5JEAH 3A56A 1STEA 5CC4A 5IGEA 5I6WA 5JVG3 2TSSA 3S1QB 1IYUA 1VCIA 1ENCA 2NTTA 4J8QA 1TY0A 4RWSC 1SE3A 3K6OA 2ZXRA 5HURA 2XRQD 2KECA 3DXJC 3SK6A 1GUOA 3L3OC 1I6HB 3I8ZA 1BOSA 1EEID 3D4DA 3MXUA 4L6TB 1K8MA 4KKUA 1G91A 3I70A 5C0XH 4AYBB 3I73A 4H13C 2K28A 1JCKB 1STBA 4RA8A 4JBWA 4ILWA 2HCCA 1H9KA 1H9RA 2RSOA 2MHVA 2YU9B 1IW7D 3VR6A 1DZ1A 5ELBA 1O7YA 3QIAA 1TWGB 1Q12A 5JEAJ 2BA0A 2EVBA 1BF4A 3IKJA 3DWPA 3S1RB 4RGTA 1CQVA 2QKIC 4B08A 2Q8TA 3GTQB 2B8GA 1KDCA 1TWCB 1EZ8A 1KNEA 4CKEA 3GP7A 4OGQC 3MXNA 2NVQB 2D2CC 4I65A 4ZUJA 4QIWB 5CGKA 3OOCA 4ZUIA 1IKMA 1II3A 5M5YB 2MPMA 5CV6A 4FF4A 1SNOA 3CHBD 1BUVT 1SJED 2HDLA 5K5PA 1YNNC 3BDCA 2RSNA 2JYOA 3A8JE 5C3WA 2EYHA 2EY2A 3HOWB 2KJXA 5KYLA 4UAIA 4TSSA 2E2JB 2Y0SB 4IURA 5NUCA 3SXHA 1SNDA 2AQ2B 4IFDG 1D5ZC 3ITPA 2K5QA 5IGBA 3Q23A 3M4OB 1J9OA 4ABNA 4A93B 3MA2B 1I4QA 1FNUA 2R7ZB 3QJYA 1R4QB 2PO4A 3PUWA 5I2YA 3BDLA 1RODA 1I4HA 4V190 3DWAA 3K59A 3Q6SA 2B2TC 2O4XA 2TMPA 1I50B 2XWJB 3ZYYX 2O5JC 3PV0A 2F0DA 1DCZA 3S2DB 3PO2B 3X3NA 3A55A 2DNEA 3FPPA 2PNRC 4WFN3 1LTAD 3TP8A 3RLFA 4KD4A 5FO9B 1NR4A 2DY7A 4K14A 3S2HB 2PCFB 2KCNA 5FO7B 4OO1G 1DOKA 3U9SA 3KLSX 3S14B 1Q3LA 3DWQA 1JQYD 4RHSA 4KN4C 2QCPX 1QE6A 2L4NA 4ZKCB 5KYIA 5ELEA 4PMCA 2Q8RE 2RDGA 2R61A 1SNQA 1RTOA 2R6GA 4CBVA 2D9UA 3R8BA 3HZXA 3QO2A 4ME5A 2CW0C 1L0YB 2K5WA 4ULLA 2RDFA 1EWHA 2J4XA 3NP8A 4RHRA 4NDXA 2Q8IB 3VR2A 1VMPA 4IQZA 3Q22A 1KLGD 2AQ3B 1S5CD 4U68A 1EY7A 2JA6B 5CV4A 4C3IB 2HDMA 1PRTB 1BR9A 4PMBA 2F0PA 2F0JA 2E75C 3WDNA 3A8IE 4K8JA 1OXXK 2J0TD 3E6ZX 3D31A 1HUNA 1OO9B 3U9OA 5CBAE 1G6ZA 2F0TA 2JE6I 2BE5C 1CA5A 5M5XB 3NXWA 3HP3A 3NTKA 1STYA 4HTHA 4X3TA 1WTXA 3MTSA 1B9NA 3D3RA 1ET6A 2A6HC 3QOJA 1SNMA 1QNKA 5KRUA 2NUCA 2K01A 1I3QB 2NN6G 3DEOA 2XRSD 3MFYA 2PZUA 2F0WA 3GO5A 1PZJD 1CT1D 3OIPA 2H1EA 2B63B 3KBXA 5C5MA 4KKTA 3NQIA 1QWYA 1WD0A 1D1KA 4G57A 3L9AX 1YNJC 1TY2A 1EU4A 1QG7A 4FF1A 2K33A 4J1MA 1A3VA 2J7ZA 3MXGA 5K36G 2AWOA 1LT6D 1LTRD 4EQNA 3H91A 2NBFA 5FK9C 2F0LA 1ZEQX 2JA5B 2CQAA 1RHPA 1JOOA 4KI0A 1AP0A 2A73B 4ZRZA 3O13A 1AW7A 1Q8IA 4G4KA 2GA4B 2N55A 4DXGA 2WAQB 3CRKC 2O5IC 1STHA 1WTPA 2C5CA 1PXUA 2WIIB 2L0CA 1XX8A 4MHEA 3VR5A 1EY0A 4CKCA 1U4MA 4FXGC 1RJTA 4L8JA 1B3AA 1CFMA 3J81E 5LL6X 1ESRA 4P2CB 1STNA 1B53A 2ENBA 3H0GB 4A3BB 4FXDA 4CJ0B 4DN4M 1TQOA 1T5EA 4HMJA 3T53B 4QUCA 1EYCA 1ENFA 5C0XG 1F9RA 1JORA 2PQEA 3J80L 3SK5A 2O2LD 3J81L 1SJHD 5EQ0A 2BOSA 1LO5D 3KF8A 1B4OA 4V0BA 2F0GA 3SR1A 3PUVA 1PTOH 1GUSA 4IUPA 1C8CA 4K5WA 3SEBA 4KY7A 3I3CA 1O78A 1KDBA 3BVMA 3NPPA 1JR0D 4H0LC 1KNAA 1CZGA 1EIHA 1M4VA 3F2UA 5FKAC 4HSPA 3D6CA 1CQFA 4IUTA 2JXMB 3S15B 2K03A 5C0XJ 1TR5A 2WKDA 2QEJC 3C46A 1PTOD 3PUZA 5BN3A 1B44D 2E76C 3DMUA 3NBIA 1ILPA 1GJXA 3MWYW 3TP6A 2B2YC 2AQ1B 1KDAA 4WORA 2EYJA 3N6RA 1UUPA 1SBBB 1NR2A 2WACA 3W2DA 2B2VC 1BCPB 2H4OA 3WOEA 2KEEA 5G3LD 1LTSD 3T51B 4XQJA 4F7XA 1PRTD 3FKIB 2DY8A 1NUCA 3A8KE 5TSSA 1EYAA 5EKLA 4R8IA 3SK8A 1QB5D 2Z4HA 3NSWA 2F0IA 2RBMA 2SOBA 5EPLA 1I4GA 3GTOB 1SMYD 1F77A 4C2MB 3X3MA 1B1ZA 1GHKA 4RAUC 4MN3A 1EY6A 4KY5A 1J8IA 2BCOA 5EBCA 3GTLB 2L12A 3S1NB 5EPJA 5C6AA 3EROA 1QILA 4DFAA 1JWMD 1SAPA 3G7LA 5BN4A 2EJMA 4YIJA 3LWUA 2SDFA 4KKSA 2RQXA 2NVYB 5E3FA 1TS2A 4KN7C 4QF4A 4G7HC 1F9QA 1WVLA 4RCOA 2MP1A 1B2TA 4LMQD 4RGMA 1BO0A 2KCCA 2OF1A 1OXSC 3PMFA 4RGNA 1ML0D 3VYTA 4XIGS 2FHTA 4KJOA 1LTTD 2F0FA 2F0SA 4LJZC 3L7ZC 5LHY1 1Y8NB 4PV1C 3T13A 2F0OA 5C44B 1XTCD 1ONLA 1HFNA 3K5NA 1ESFA 1VF5C 3PUYA 1MSHA 2F0QA 1TT2A 2F3VA 3K7AB 1AZQA 3BDOA 1S4ZA 4ZLTF 1G2TA 1HCZA 5IGGA 1GUTA 3NK9A 2IL8A 2HCIA 4C3JG 1XWEA 1FYCA 3K5MA 1V1OA 3NUCA 1U9RA 4KD3A 1HA5A 4DXFA 1IHZA 1CI3M 3R2TA 2XNAC 2JEAI 3NTHA 5JVH3 3URYA 1BCPF 1LTBD 1F9PA 3QWNA 3EA6A 4C3HB 4OL7A 3C1EA 4HCEA 4FO2A 5JOBA 3CRLC 2E74C 2SEBD 5E4XA 3HOYB 2A68D 4U673 2LKVA 3BYTB 4X3KA 2M2LA 3PUXA 4RKLA 1HUMA 1C48A 2XWBB 5J39A 4K8IA 4KMUC 1STAA 5KNBA 4ZK9B 5I2XA 4BY7B 4M8AA 4IN3A 3H09A 4QMGA 3JAML 1SFOB 1BDOA 1ILQA 2PMZB 1WTOA 1OXUA 1WTWA 3PO3B 3GTMB 1CTMA 3H6MA 3HS0C 1EYDA 2AUKA 3FDTA 4EQOA 1V1PA 2KOLA 2CW0D 5T1GA 3S9WA 3K5OA 3R93A 5E4WC 3PIO3 3P75A 1HTPA 1FR3A 2PZWA 1SYDA 4N9PA 5D14A 1BBXC 2DN8A 1AEXA 5CV8A 3A54A 1TS5A 4XDXA 1TU2B 2EYPA 1JWSD 2KEDA 2M9VA 4KHZA 4BA1I 5FLXE 4JK1C 4BY1B 1TS3A 4DU9A 1CHPD 4DGZA 3CU7A 3KLRA 1LTGD 3GTKB 4XQNA 2ZXOA 1W6JA 3EQLC 1PTOF 2EY5A 2NN6H 3GTGB 3H94A 3OIQA 2L55A 3D4RA 2E2HB 4FXKC 1VF7A 4RKBA 1XXGA 1PFNA 5IODA 3M4YA 1NCVA 1HPCA 2D62A 5EPKA 4ZAIA 1NAPA 5G3LF 4KV6A 1TS4A 2L9HA 1VMCA 4DNRB 1HFGA 4HR7B 1PRTF 1I4XA 2XIWA 1EIGA 3MXPA 1Q1EA 3MFGA 4IUUA 4HAEA 2QILA 3FPUB 2WB1B 3VR4A 3DHQA 3I90A 3IL8A 3SHLA 1TKWB 3CKIB 2F0VA 4MIUA 2I46A 4TRDA 1LLRD 1A15A 1EY9A 1DYQA 1SYGA 3OMGA 2A6ED 2A6HD 3TP7A 5I9OA 3W3AA 1Q1BA 2BE5D 2IX1A 3HOZB 4Q0FA 1EZ6A 1JOQA 2SNMA 4KHVA 3GTPB 1SE2A 3WOFA 2L11A 4DAVA 3LX0A 2QDBA 3D6WA 5J1ZA 2R93B 2AUJD 1O7ZA 2M00A 2F03A 3M3YB 3AB9A 2K5DA 2A74C 2K7VA 2MJ8A 5CR3A 2SNSA 3GTJB 2WP8J 3NHHA 4FF2A 3S16B 4G7ZC 4A3IB 3SK4A 4C3IG 1EU3A 4OIJA 5JEAG 4WJWA 3M7NA 5CORA 5EGTA 2EY6A 4DAPA 2DNCA 1RDPD 4PMWA 1C4QA 3ERQA 2JP1A 5DNFA 3T16A 2L5TA 4A3GB 3I72A 5D3DA 4Z9CB 3R2IA 2X69A 5C0XI 5KNCA 2VB2X 3K0YA 1MD2D 2XSCA 3KLSA 1HQMC 1PZID 2PPBC 2XVSA 1QOHA 4N9TA 3ND8A 3TP5A 2VNUD 4C3HG 4BS9A 1S5FD 3MHBA 1BCPD 1WD1A 3HOUB 2K05A 1W6KA 4FF3A 1SYBA 1PDQA 2K1BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JEB I;  1GHK A;  3W3A A;  1B9M A;  1Q1B A;  3BG3 A;  1GUG A;  3A7A B;  2BE5 D;  2PCF B;  3OW7 A;  3SE0 A;  4OO1 G;  3I4L A;  2LMC B;  3U9S A;  1CI3 M;  2JEA I;  3PUV A;  4KKT A;  1PMR A;  1TU2 B;  1GUS A;  3GD7 A;  3QG1 A;  5JEA H;  4OGQ C;  2EDG A;  4KN4 C;  3IFT A;  4KHZ A;  2D2C C;  4BA1 I;  3ND9 A;  2EJG C;  1V8Q A;  4JK1 C;  2AUJ D;  1YNJ C;  2QF7 A;  3OOC A;  1O78 A;  3OPO A;  3TZU A;  3FMC A;  2R6G A;  1IYU A;  4XTC S;  4DK1 A;  4H44 C;  1E2Z A;  1VCI A;  1Y8P B;  2K33 A;  2EJF C;  3CRL C;  3AB9 A;  2K32 A;  5BN5 A;  5BN4 A;  2E74 C;  1Y69 U;  3KLR A;  2EJM A;  2K7V A;  4G7O C;  1YNN C;  2A69 D;  2CW0 C;  1Y8O B;  3GQB A;  4H0L C;  5KND A;  3LWU A;  2BA1 A;  3EQL C;  2AWO A;  3NE5 B;  3T56 B;  4GZY C;  5K36 G;  1LAB A;  4KKS A;  3A8J E;  1I6V C;  2NN6 H;  2A68 D;  4G7Z C;  3H94 A;  1EWH A;  3D4R A;  4DNT B;  4IFD H;  4KN7 C;  1LAC A;  4G7H C;  3DXJ C;  3PUX A;  2JXM B;  2D5D A;  1GUO A;  1VF7 A;  5JEA G;  3M7N A;  2Q8I B;  3VR2 A;  3VA7 A;  4KI0 A;  4IQZ A;  1H9M A;  2DN8 A;  4TQU S;  4RCN A;  1QJO A;  5A35 A;  1DD2 A;  2KCC A;  1GUN A;  1OXS C;  4KMU C;  2ZT9 C;  1E2W A;  5KNB A;  2B8F A;  3PUZ A;  5BN3 A;  1IW7 C;  3CRK C;  2DNC A;  4LK1 C;  3MXU A;  2E76 C;  4IFD G;  1OXV A;  2O5I C;  3M4Y A;  1K8M A;  1H9J A;  1HPC A;  1V43 A;  2D62 A;  4XIG S;  2A69 C;  2YYZ A;  4KKU A;  4DK0 A;  1OXT A;  1ZKO A;  1K8O A;  3VR5 A;  1A6X A;  1IYV A;  1GJX A;  1H9S A;  2L5T A;  3SDZ A;  3I72 A;  5C0X H;  1BDO A;  3I73 A;  4H13 C;  1OXU A;  2A6E C;  2E75 C;  4L8J A;  4LJZ C;  3WDN A;  3A8I E;  4I7Z C;  4HR7 B;  4DNR B;  1CFM A;  1SMY C;  3QJY A;  1DXM A;  3A7L A;  1CTM A;  1OXX K;  2KA7 A;  2V4D A;  1ZYR C;  3HGB A;  3D31 A;  3N6R A;  5KNC A;  2F1M A;  2AUK A;  3L7Z C;  4JBW A;  1Q1E A;  1Y8N B;  3PUW A;  1E2V A;  4PV1 C;  2JE6 I;  2BE5 C;  3M85 A;  2IT1 A;  1H9K A;  1Z7T A;  2NN6 I;  1H9R A;  1HQM C;  1ONL A;  3VR4 A;  1H9S B;  2PPB C;  3T51 B;  1IW7 D;  3VR3 A;  3VR6 A;  1VF5 C;  1B9N A;  3P20 A;  1T5E A;  3PUY A;  1TKW B;  1Z6H A;  2A68 C;  3QIA A;  3T53 B;  1VDZ A;  2O5J C;  3BDO A;  3ND8 A;  2A6H C;  3A8K E;  1Q12 A;  3PV0 A;  5C0X G;  1DCZ A;  1HCZ A;  4OO1 H;  1GUT A;  2BA0 A;  2EVB A;  1GHJ A;  4BA2 I;  1O7L A;  1G29 1;  3LNN A;  4TKO B;  1HTP A;  2DNE A;  1FR3 A;  2BDO A;  3FPP A;  3IKJ A;  2PNR C;  5K36 H;  3RLF A;  2A6E D;  2A6H D;  2NN6 G;  3MFY A;  1Q90 A;  1FYC A;  2B8G A; 
#chains in the Genus database with same CATH topology
 5KIX A;  4OHJ A;  1I94 L;  4IFD J;  3J7A 5;  2JA9 A;  1XNR L;  2GVA A;  4K2L A;  5EKI A;  3EVQ A;  2VQF Q;  1X3F A;  4JI7 Q;  5FLX L;  2LFN A;  5CV9 A;  1V8Q A;  2I5H A;  4IUV A;  1YHQ A;  1HNZ Q;  2VB3 X;  2JA8 B;  3OPO A;  3TZU A;  2E2D C;  1PFM A;  4H44 C;  4DK1 A;  2Z1C A;  2EY1 A;  4DV1 Q;  3RZO B;  2G5D A;  4R4I A;  4QCL A;  5FO8 B;  4DV5 Q;  4DV6 Q;  2V1C C;  1AFP A;  1SXT A;  1K83 B;  5BR8 L;  2RKS A;  4A3K B;  4OWX B;  1J6Q A;  3TME A;  1L0W A;  5IYD H;  3HG9 A;  1GVP A;  3NWS A;  4QUF A;  5M5W B;  1D5X C;  3NEM A;  3KJO A;  2B39 A;  3I4M B;  1JWU D;  1FGU A;  3E9I A;  3OWE B;  3D4W A;  4WJ4 A;  1TWH B;  2RF4 A;  3KF6 A;  2E2I H;  1AN8 A;  1DD2 A;  2E2I B;  4BBS H;  1V9P A;  1HJP A;  1E2W A;  4IZ8 A;  3A5U A;  2ES2 A;  3P1H A;  1SYC A;  3VYU A;  3C1F A;  4LF5 Q;  1P16 A;  2ICE C;  3CW2 C;  4K2K A;  1A6X A;  1PTO C;  1H9S A;  4BY1 G;  1F2M A;  3I2Z A;  3HEJ A;  4ODG A;  3QB3 A;  5IYB G;  4DV0 L;  1IZ6 A;  1S72 A;  2WAQ E;  4OWT B;  5C4H A;  1K8A C;  4B3M Q;  1Y1V B;  2F0N A;  3Q8D A;  4J15 A;  2IPK D;  3KBG A;  4JI4 Q;  2QDL A;  3HKZ B;  2AMC B;  4KJN A;  4X3U A;  1BBU A;  2K14 A;  3AMU A;  4K0K Q;  4JI0 L;  3RZD B;  4GNX A;  1EQT A;  2WKC A;  4X64 L;  1SNC A;  4IO9 A;  4FP5 D;  5IGC A;  3F2D A;  2EXD A;  3T4A C;  4TVA B;  4OO1 H;  3Q24 A;  4NKL A;  3AYH B;  2DJG C;  2EZV A;  2I07 B;  3HFZ B;  4GLA C;  3N52 A;  2FJ2 A;  1SR3 A;  3K5L A;  3OSO A;  5T1I A;  1PRT C;  5K36 H;  2WB1 E;  2NVT H;  2UUB L;  1Q90 A;  3H3V I;  3Q0A A;  1BXT A;  4BBR H;  2F52 A;  2FMM A;  1SEB D;  1DON A;  5IT9 L;  1SE4 A;  2D0O A;  1YIJ A;  1IBK Q;  2EXZ A;  1HHV A;  3K80 C;  1WFQ A;  1IKL A;  4A3J B;  3J80 E;  1XNR Q;  3M3Y H;  3HOU G;  1NTG A;  4S3S A;  4B9X A;  1PTO B;  3C2P A;  5GAG C;  2WFW A;  3WWV A;  4XTC S;  5BN5 A;  5AJ3 Q;  4DR1 Q;  2UXD Q;  3GQB A;  5CV7 A;  2VL6 A;  2BA1 A;  3NTI A;  4GZY C;  3OWF A;  2R92 B;  2CH4 W;  1I6V C;  1HZA A;  4P74 A;  5IWA Q;  3BVZ A;  1EOV A;  4DUY L;  1STG A;  1XPO A;  2R93 G;  1LT5 D;  1N34 L;  5JAV A;  5ISR A;  4DV4 L;  2KUM A;  4GOP B;  2FMC A;  2CKZ B;  1ASY A;  2B2V A;  3TN2 A;  1PFB A;  1QJO A;  3HOZ G;  1EQV A;  3R3O A;  4DA2 A;  1B50 A;  5J22 A;  5EAY A;  1F9S A;  2G9D A;  2NVQ H;  2B2Y A;  4HJ9 A;  3GV3 A;  4LAA A;  4BBS B;  3E0J A;  1MHW C;  2A69 C;  3HKZ E;  1ZKO A;  1D2B A;  1IYV A;  1QCB D;  5IOC A;  1MBY A;  3GTL H;  1BCP C;  1K0S A;  3HOV B;  5C4J B;  3FKI G;  1DXM A;  3A7L A;  1T5X D;  2V4D A;  3NEL A;  2CQO A;  2F1M A;  4P71 A;  1R4P B;  1ENA A;  2BH8 A;  5JJI A;  3RN2 A;  4CJ1 B;  1FD7 D;  1PHJ A;  1Z7T A;  2UXB Q;  1EWC A;  2IHF A;  2NB0 A;  1H9S B;  2RVL A;  2YU9 H;  1BVS A;  2WAQ G;  1CK1 A;  1U4R A;  2MO1 A;  2A68 C;  3FHW A;  3DLL A;  2YTX A;  2CWA A;  1NBW A;  1VQF A;  1PFS A;  4O42 A;  2NZ1 D;  2F0K A;  1JE5 A;  4X3S A;  4XT3 B;  1UWV A;  4TKO B;  3HKZ G;  4HED A;  2BDO A;  5IIF A;  5C3E G;  2IJ0 A;  5CYU A;  5JJL A;  2B2U C;  1B8A A;  1D1I A;  1ZYR D;  3MEF A;  2ZTE A;  1W2B A;  2ZJP A;  3K58 A;  4A3I G;  3MC0 B;  4DR3 Q;  1I5F A;  3DM1 A;  3A7A B;  1NSN S;  3SE0 A;  1CUK A;  4GLX A;  3CC4 A;  3HOX B;  2VUM G;  4ZKB B;  1Q82 C;  4A3B G;  4LF9 Q;  3MEH A;  1LUZ A;  1IBM L;  4C3J H;  3J7A F;  1Z47 A;  2EDG A;  5EJW A;  3MZ5 A;  2IX3 A;  1A62 A;  2A5H A;  2Y0S E;  1MI2 A;  3FMC A;  1E2Z A;  4XXE A;  3AU7 A;  1PLF A;  5LMU L;  2FIN B;  2VS1 A;  4ZYS A;  1PH1 A;  5I9P A;  2F0E A;  2RDH A;  4YCU A;  2QA4 A;  5EBD A;  2F3W A;  4FNF A;  2K04 A;  4PQX A;  3SVM A;  4BWG B;  1K3B C;  3CC7 A;  5F2D A;  1Z9F A;  4L63 B;  3CAM A;  4TQU S;  2I5M X;  5A35 A;  1F2L A;  2B8F A;  4IUQ A;  1IW7 C;  4HJ8 A;  1U4P A;  4H7B A;  1X3P A;  5JPN C;  4JOI C;  2OCE A;  2LS0 1;  4DK0 A;  3JAM E;  1AE3 A;  5C44 G;  1K8O A;  4HMI A;  1D6E C;  1FVI A;  1VQO A;  4X62 L;  4R4T A;  1YHA A;  2QW7 A;  1SSO A;  4A3D B;  2K5N A;  5CV5 A;  4C1N I;  4LF8 Q;  4NP5 A;  3FRP B;  2PI2 E;  5IT9 E;  1F2Y A;  4GN4 B;  2AKW B;  3I55 A;  4Q5V A;  4FYD A;  4DF7 A;  3PIP A;  4B3S L;  1XYI A;  2N78 A;  4N8F A;  4DV2 L;  5FOB B;  3STB C;  1RIP A;  5LL6 S;  4A3F B;  1X3Q A;  3MAQ A;  5GAE C;  1SYE A;  4O1N A;  3CME A;  2R7Z G;  4K6L A;  3VYS A;  2XGT A;  5C4X G;  2PMZ E;  2HQE A;  4K5X A;  1KD1 C;  3TBI B;  1G29 1;  1U4L A;  2B2W C;  1LT4 D;  5H1S E;  1QVF A;  4P73 A;  2OXP A;  4L5R C;  4A3E G;  2MO0 A;  4J6H A;  3EFX D;  1KLU D;  2PW5 A;  1LTI D;  4CJ2 C;  2C9O A;  2JEB I;  3OMC A;  5M3F H;  3I4O A;  4PNY A;  3BG3 A;  4DR4 Q;  4C56 C;  4LNQ A;  1VQK A;  3I4L A;  1DOM A;  2EE1 A;  2UUC Q;  5FJ8 G;  4B9W A;  1S5E D;  1CZW A;  5FLM H;  4GOP A;  1I4R A;  4A93 H;  4DAY A;  2KVM A;  2Z6B A;  3FEW X;  1Y1W B;  1GOZ A;  1BQQ T;  4BBR G;  2JA7 B;  1N33 L;  3K0X A;  2JA8 H;  4F88 A;  1SYF A;  2UUB Q;  2EJF C;  2K32 A;  2VUM B;  3PO2 H;  3RMH A;  1Y8O B;  1E0B A;  3K81 C;  1WCM B;  3T56 B;  5M9O A;  1PH5 A;  1JJC B;  5IY0 A;  3GTM H;  4A3M H;  3TDQ A;  5KEE A;  1K9M C;  1IL2 A;  2KHS A;  3HOW H;  4DK3 C;  1Y1V G;  1HNW L;  4X65 L;  3NBH A;  1TWH H;  4XQQ A;  1CHQ D;  2OEO A;  4HN7 A;  2HHH Q;  1JE4 A;  2JA5 H;  4YWK A;  1B70 B;  2ZXP A;  1PH7 A;  1PYW D;  2E5L Q;  4LF4 Q;  3OYY A;  2PYK A;  1FNW A;  1YNN D;  5LMU Q;  2IY5 B;  5AFW A;  2NTS A;  3S1Q H;  3SDZ A;  3S1M B;  2JSO A;  3LWE A;  1UNS A;  1HQR D;  3I91 A;  4GLV B;  1JC7 A;  4HCS A;  1SMY C;  2R92 H;  2KA7 A;  1F2Z A;  5I6Y A;  1SDF A;  1GUW A;  4OIK A;  5IP7 H;  3GTK H;  3I7F A;  3CXC A;  4BBS G;  5LMN Q;  2IT1 A;  2NN6 I;  3PSI A;  1SNP A;  5C4X B;  2AWN A;  2KHJ A;  3OHX C;  4OON A;  4DAM A;  3K57 A;  2WV6 D;  3MVV A;  4DR7 L;  1Z6H A;  2MUY A;  3H3V C;  1S5B D;  4AYB E;  3L2P A;  1TII D;  4QB4 A;  1EY8 A;  1C0A A;  3BYY B;  3QOL A;  3M7G A;  4IUN A;  5EKK A;  4NMZ A;  5M3M B;  2MGS A;  4K5V A;  1Y14 B;  2B3G A;  1X56 A;  2PZT A;  1E24 A;  1B9M A;  1VS0 A;  4H02 A;  5D3I B;  4M1U B;  1HRJ A;  2F4I A;  4YHH L;  4WRD A;  4IFD I;  2DJF C;  1ICF B;  1S3O A;  2LMC B;  3GV6 A;  3ULL A;  1LM0 A;  4BBR B;  2JA7 G;  1PMR A;  1A2T A;  1AE2 A;  3BS1 A;  1JMC A;  3DM3 A;  1XMQ Q;  3S17 B;  1CA6 A;  3ND9 A;  1CKN A;  1ZXT A;  1JOK A;  1XMO Q;  1MSG A;  1A2U A;  1SE8 A;  1Y8P B;  1KAA A;  4F87 A;  1E7Z A;  3HRZ C;  3J81 i;  3BVG A;  1KRT A;  1VQ5 A;  4O0A A;  1D5M C;  2B2T A;  2X6L A;  2Z8L A;  5C3E B;  1UE6 A;  5DM7 3;  1WTQ A;  1VQI A;  1HA6 A;  1GXD C;  5JJZ A;  1HXY D;  4KLK A;  5CMD A;  4RCN A;  4IPH A;  1GUN A;  4JI5 L;  1PA6 A;  3AFQ A;  3E0E A;  1NJI C;  5C5L A;  2EYM A;  1PH4 A;  4LK1 C;  1V1Q A;  3RLN A;  1OXV A;  3C3L A;  5JPM C;  1BNZ A;  3RNU A;  3EBE A;  1HNW Q;  4OO1 I;  3ZJY C;  4XT1 B;  2NVT B;  4DR2 L;  4RG1 A;  1D8L A;  3TSS A;  2NWG A;  2Z6K C;  1S5D D;  1XMQ L;  4QJF A;  1MJE A;  5C4Z A;  3CCV A;  4A3F H;  2A8V A;  1LV9 A;  1RF2 D;  4C1N K;  1JIC A;  3LGJ A;  4YY3 Q;  1JJG A;  4L5T A;  1DM0 B;  4UDU C;  1WTR A;  5D65 A;  3V96 A;  3K7U C;  1UE1 A;  4BA2 I;  3U4Z A;  3J7A V;  1C7Y A;  2X6G A;  2IWH A;  3HOU H;  1I6H H;  4POG A;  5A2Q L;  1KTK A;  4KK7 A;  1RCV D;  2F3I A;  2R92 G;  3TZD A;  4LW1 A;  3OW7 A;  2K52 A;  3UDX A;  2OQ0 A;  5I4D A;  1XPR A;  1X65 A;  2OT2 A;  2EOT A;  5HGT A;  4UY8 C;  4R9W A;  4GOP C;  4CHT B;  1NMG A;  3IFT A;  3AEV A;  2OQK A;  2EJG C;  4A3E B;  4JI2 Q;  2QF7 A;  1L1O C;  1HTL D;  2NYZ D;  4HJ7 A;  2CVR A;  4LF7 Q;  1TWF H;  1Y69 U;  2PQA A;  2EPB A;  1SMX A;  1LT3 D;  4G7O C;  1FGB D;  5KND A;  3PIO A;  3A5Z B;  1V1P B;  3NE5 B;  1VQ6 A;  5IE8 A;  3J7Y W;  4LF8 L;  1TWA B;  3J80 i;  2B2W A;  4DNT B;  1IBL L;  4RFB A;  2Q2U A;  1DGS A;  2FFK B;  1LAC A;  5IGD A;  1Y1W G;  2L1B A;  2VW9 A;  2EYF A;  4LFB L;  3KK7 A;  4IJH A;  5GAH C;  1RKN A;  2D5D A;  2HUG A;  4F8M A;  4KTA A;  4X65 Q;  4AIM A;  1DOL A;  1VQA A;  1I4P A;  2ZT9 C;  3VA5 A;  3G6J B;  1YJ9 A;  3S17 H;  4ID6 A;  1V43 A;  5E7N A;  2YYZ A;  4JI8 Q;  1OXT A;  2CHB D;  1OTC A;  2VY3 A;  5C3X A;  2IX0 A;  3KUP A;  5ELF A;  1XMO L;  3ONA B;  5COY A;  1RD9 D;  3CQZ H;  1NY4 A;  2EQS A;  1YNJ D;  3HGB A;  2R7Z H;  1DJR D;  4JI7 L;  3D8G A;  1N8R C;  1VQL A;  4JOI A;  3NWT A;  1SRU A;  4C3H H;  1E2V A;  1G2S A;  4A3B H;  3H0G H;  3E9H A;  2EYL A;  1M90 C;  1KAB A;  3CP0 A;  1M1K C;  3KDF B;  3VR3 A;  3DEP A;  2LY7 A;  4B3R L;  1WOC A;  2WIN B;  4R8N A;  1QNU A;  2D0P A;  1VDZ A;  1KRS A;  4LUV A;  1PZK D;  3T1Y Q;  1GHJ A;  2E2J H;  4POF A;  1J5E Q;  3LNN A;  5A2Q E;  3UI2 A;  3IAY A;  4ME3 A;  4NW2 A;  1CM9 A;  3I4N B;  5FLM G;  2RA4 A;  1N36 L;  4K6D A;  2KQ3 A;  1MGS A;  5M3F B;  1UEA B;  1GUG A;  1LTL A;  1KL9 A;  2VZA A;  3E5S A;  3P7J A;  4KY6 A;  3CCM A;  4HJA A;  2K6A A;  4EVO A;  5KGU A;  1EEF D;  3G71 A;  4A75 A;  5IGF A;  2IW3 A;  4DKA C;  4XYO A;  1EOT A;  3KOJ A;  3J80 c;  3CQZ B;  2C35 B;  2K5V A;  1RL2 A;  3A74 A;  2NVX B;  3IFD A;  4NXM Q;  3RZO H;  1RTN A;  1A3U A;  5DAU A;  1M8A A;  2A69 D;  5C3E H;  2ICI A;  2G9H D;  2XN9 C;  3RD4 A;  3K8A A;  1ET9 A;  1TVX A;  2ID0 A;  1N32 L;  2B2U A;  1N32 Q;  1LAB A;  1CKM A;  5DM6 3;  4XYQ A;  4CDD C;  4IFD H;  3D0F A;  4JI6 L;  1WTV A;  3V2T A;  4A3M B;  1O80 A;  2EYO A;  4EQP A;  1ICW A;  1L0X B;  2B29 A;  3F8T A;  3VA7 A;  4LUZ A;  1PH8 A;  1H9M A;  5IP7 G;  1I3Q H;  1AZP A;  3DUZ A;  4CGY B;  4E6I A;  1VQJ A;  4A3F G;  3S2D H;  3VYR A;  2N88 A;  1H9J A;  4GN5 A;  3TS2 A;  2PW7 A;  1EY5 A;  2HQL A;  5E1F A;  1EL0 A;  1TWF B;  2R3Z A;  2JK8 A;  1U5K A;  3CCE A;  3EJI A;  3V05 A;  2A6E C;  5ELC A;  4Y7N B;  4I7Z C;  2XTI A;  5M5X H;  1J5E L;  1IL8 A;  4EGV A;  1ZYR C;  1NNX A;  3NQT A;  1BKB A;  2JA5 G;  2Q2T A;  2ATW A;  5DEH A;  4AYB G;  2Q2I A;  3BZD B;  2F0U A;  1VQ7 A;  2BDN A;  3PIP 3;  1R9T B;  2F0H A;  1L2F A;  3M85 A;  3PO3 H;  3RZD H;  5LMN W;  1YI2 A;  2CCZ A;  1X32 A;  4BY1 H;  2F0M A;  1EY4 A;  2Z4I A;  2GVB A;  3P20 A;  2F4V L;  3RR5 A;  3FVQ A;  4BXX H;  4JC0 A;  3I4N G;  1PH6 A;  1G8Z D;  5ELN A;  1O7L A;  4A3G G;  3H3V H;  5ELD A;  1A3T A;  1UAP A;  1EFI D;  4FVM A;  4HSV A;  1S40 A;  2VXW A;  1JB3 A;  4DV3 Q;  4RH6 A;  1K3R A;  2ALY B;  1FNV A;  4IAL A;  4YWL A;  4CKB A;  1K0R A;  2KBN A;  5CBE E;  3HOX H;  3J81 j;  3RUZ A;  1HNX L;  4ZQ3 A;  2Z9H A;  4RGO S;  3M4Q A;  3GD7 A;  4A4I A;  3QG1 A;  4C3J B;  5JEA H;  3A56 A;  1MIU A;  1STE A;  5CC4 A;  3J7Z C;  5IGE A;  3HOW G;  4RMF A;  5I6W A;  1EQQ A;  5JVG 3;  2TSS A;  4JPB W;  4UP7 A;  3S1Q B;  1IYU A;  1VCI A;  1ENC A;  2NTT A;  4J8Q A;  1TY0 A;  1HR0 L;  4RWS C;  1YZ6 A;  1SE3 A;  3K6O A;  2ZXR A;  4WJ3 M;  2A19 A;  5HUR A;  2XRQ D;  3CCQ A;  4GKJ Q;  2KEC A;  3DXJ C;  4LFA L;  3SK6 A;  2R7D A;  1GUO A;  3L3O C;  3B6Y A;  1I6H B;  3I8Z A;  1T9H A;  5FJ8 H;  3G48 A;  2VQE Q;  1BOS A;  4GNX C;  1EEI D;  3D4D A;  4IPD A;  3MXU A;  3STB D;  4L6T B;  1K8M A;  4KKU A;  2UXD L;  1G91 A;  4PZ6 A;  3I70 A;  5IP9 G;  5C0X H;  3AQQ A;  4AYB B;  5C4J H;  2KEN A;  3I73 A;  4H13 C;  4UPA A;  2K28 A;  4DR6 L;  3PCO B;  1JCK B;  1MJC A;  1STB A;  4RA8 A;  3I4M G;  4DV6 L;  3CMA A;  4JBW A;  4YWM A;  5GAD C;  4ILW A;  2HCC A;  4YCV A;  1H9K A;  1H9R A;  2RSO A;  4DR3 L;  2MHV A;  1KC8 C;  1G6P A;  3CPW A;  1IW7 D;  2YU9 B;  3VR6 A;  3AFP A;  1DZ1 A;  2HD3 A;  5ELB A;  1O7Y A;  3TRZ A;  3QIA A;  3UDG A;  1TWG B;  2CWP A;  1Q12 A;  5JEA J;  2BA0 A;  2EVB A;  3M9B A;  1BF4 A;  4DNI A;  3IKJ A;  3DWP A;  4ALP A;  3S1R B;  4RGT A;  1CQV A;  1TWG H;  4GKK Q;  2QKI C;  2NZH A;  1A8V A;  3KDF A;  1L1O A;  4B08 A;  3PO2 G;  2Q8T A;  3GTQ B;  1D7Q A;  2B8G A;  1KDC A;  1KXL A;  1NMF A;  1TWC B;  4LFC Q;  1O7I A;  1EZ8 A;  4DUY Q;  1KNE A;  1IBL Q;  2QGQ A;  4CKE A;  3GP7 A;  4OGQ C;  3MXN A;  2NVQ B;  2D2C C;  4I65 A;  4ZUJ A;  4MZ9 A;  1ASZ A;  1KIX A;  3E3X A;  4QIW B;  5CGK A;  3OOC A;  4AQY Q;  4EX5 A;  5AJ3 L;  5FLX c;  4HIM A;  2I5L X;  4ZUI A;  4LF7 L;  1IKM A;  1II3 A;  5M5Y B;  2MPM A;  5CV6 A;  4FF4 A;  1SNO A;  2JN4 A;  1BUV T;  1SJE D;  2HDL A;  3CHB D;  5K5P A;  4GKK L;  1YNN C;  3BDC A;  2RSN A;  2JA6 G;  5C44 H;  2JYO A;  3A8J E;  1JB7 A;  5C3W A;  3W5O A;  2EYH A;  2EY2 A;  3HOW B;  4A3C H;  2KJX A;  5KYL A;  2N8N A;  1TWA H;  4UAI A;  1VQD A;  4DV4 Q;  4TSS A;  2E2J B;  2OTL A;  4JCV E;  2Y0S B;  4HJ5 A;  1HZB A;  4IUR A;  3ER0 A;  2Z6K A;  5NUC A;  3S1R H;  2P5Z X;  3SXH A;  1SND A;  2AQ2 B;  4IFD G;  2HIX A;  1D5Z C;  3ITP A;  2K5Q A;  4YHH Q;  5IGB A;  3Q23 A;  3M4O B;  1J9O A;  4ABN A;  4A93 B;  2ZTC A;  3MA2 B;  1PH9 A;  1I4Q A;  1FNU A;  2R7Z B;  3QJY A;  4DV7 Q;  1XJV A;  1R4Q B;  4R4Q A;  3L0O A;  4JI4 L;  2PO4 A;  3PUW A;  5I2Y A;  2NVX H;  3BDL A;  1ROD A;  1I4H A;  4V19 0;  3GTG H;  3DWA A;  3K59 A;  3Q6S A;  2B2T C;  2O4X A;  1K83 H;  2TMP A;  1I50 B;  2XWJ B;  1VQM A;  3ZYY X;  2O5J C;  3NEN A;  3PV0 A;  2IHE A;  2F0D A;  1DCZ A;  3S2D B;  3PO2 B;  5M5W H;  1L1O B;  3X3N A;  3A55 A;  2DNE A;  4L5S A;  3FPP A;  3EIV A;  4UHV A;  2PNR C;  1YEZ A;  4WFN 3;  1LTA D;  3TP8 A;  3RLF A;  4KD4 A;  5FO9 B;  4DUZ Q;  3GTO H;  3HOV H;  1NR4 A;  2DY7 A;  3PQI A;  4K14 A;  4X64 Q;  3S2H B;  4O2D A;  1EYG A;  2PCF B;  4A3C G;  2KCN A;  5FO7 B;  2I0Q A;  4OO1 G;  1DOK A;  3U9S A;  3KLS X;  3S14 B;  1Q3L A;  3DWQ A;  1R9T H;  1JQY D;  2HHH L;  4RHS A;  3JC6 6;  4LFC L;  1HNX Q;  4KN4 C;  5BR8 Q;  1QUQ A;  2QCP X;  1QE6 A;  4A76 A;  2L4N A;  4ZKC B;  5KYI A;  2AHO B;  5ELE A;  4PMC A;  2Q8R E;  2RDG A;  2R61 A;  1SNQ A;  1RTO A;  2R6G A;  4CBV A;  2NVY H;  1W3S A;  2D9U A;  3R8B A;  3HZX A;  3QO2 A;  4ME5 A;  1WYD A;  2CW0 C;  1EFW A;  3TRE A;  1L0Y B;  2K5W A;  4ULL A;  3M4P A;  1HR0 Q;  1EIF A;  1B7Y B;  2RDF A;  1YJN A;  1EWH A;  1LYL A;  2J4X A;  3NP8 A;  2Y0S G;  4RHR A;  5DLQ E;  4NDX A;  1HZ9 A;  2Q8I B;  3VR2 A;  1VMP A;  4IQZ A;  1KLG D;  3Q22 A;  1VQH A;  2AQ3 B;  1S5C D;  2B63 H;  4A3L H;  4JW0 A;  4U68 A;  1EY7 A;  1CSP A;  2JA6 B;  4PG3 A;  5CV4 A;  4C3I B;  5GQO A;  3JAM c;  1FJG Q;  1YJW A;  3H0G G;  2HDM A;  2PNH A;  3PGZ A;  1PRT B;  1BR9 A;  4PMB A;  4HID A;  2F0P A;  2F0J A;  2E75 C;  4Y7N H;  5IYD G;  3WDN A;  3A8I E;  1K8G A;  4K8J A;  1OXX K;  2ZTD A;  2J0T D;  3E6Z X;  3D31 A;  1HUN A;  1OO9 B;  3U9O A;  3CCR A;  5CBA E;  1G6Z A;  3RLO A;  2F0T A;  2JE6 I;  4GS3 A;  5IT9 c;  2BE5 C;  1CA5 A;  5M5X B;  3HOY H;  3NXW A;  2F4V Q;  4B3R Q;  3HP3 A;  3NTK A;  1STY A;  4HTH A;  4X3T A;  4JI1 Q;  1KQS A;  3CCL A;  4JYA L;  1WTX A;  3MTS A;  1B9N A;  3U4V A;  4DV2 Q;  3D3R A;  1ET6 A;  1XTD A;  2JQO A;  3CCJ A;  4OX9 Q;  2A6H C;  1QUQ B;  3QOJ A;  3OW2 A;  1SNM A;  1A63 A;  1QNK A;  5KRU A;  5L37 A;  3KLW A;  2NUC A;  3PO3 G;  2K01 A;  1I3Q B;  2NN6 G;  3DEO A;  2XRS D;  3MFY A;  4C2M H;  2PZU A;  2F0W A;  3GO5 A;  1PZJ D;  1CT1 D;  4QY7 A;  2JJQ A;  3OIP A;  1Y1W H;  2H1E A;  2B63 B;  3KBX A;  5C5M A;  4KKT A;  4A3M G;  3NQI A;  4A3G H;  1QWY A;  1WD0 A;  1MKH A;  5HGQ A;  1D1K A;  4G57 A;  3KJP A;  3L9A X;  1YNJ C;  4I7A A;  1TY2 A;  1WI5 A;  3F1Z A;  4DV3 L;  2UXB L;  1EU4 A;  1QG7 A;  3F2B A;  4FF1 A;  2K33 A;  3MXN B;  4J1M A;  1A3V A;  1VQN A;  3I56 A;  2J7Z A;  3RN5 A;  1HR0 W;  3MXG A;  5K36 G;  2AWO A;  2L15 A;  3S16 H;  1LT6 D;  3UE1 A;  1JJ2 A;  1LTR D;  4EQN A;  2UUC L;  3H91 A;  2NBF A;  1Q86 C;  4LWC A;  5FK9 C;  2F0L A;  1ZEQ X;  4OEM B;  2JA8 G;  1K73 C;  2JA5 B;  2CQA A;  4DR4 L;  2DGY A;  1RHP A;  5IP9 H;  1JOO A;  4KI0 A;  3CCU A;  1AP0 A;  4HIO A;  2A73 B;  4ZRZ A;  3O13 A;  1AW7 A;  1Q8I A;  1VQE A;  2YTV A;  4G4K A;  2GA4 B;  4QIW E;  2N55 A;  4R1J A;  4DXG A;  2WAQ B;  3CRK C;  3PF4 A;  2LSS A;  2O5I C;  1Q8K A;  1STH A;  2CH4 A;  2C5C A;  1WTP A;  1PXU A;  3CD6 A;  1BBW A;  2WII B;  2L0C A;  5IYC G;  1XX8 A;  4JG2 A;  4MHE A;  3VR5 A;  1VQ4 A;  1EY0 A;  4CKC A;  3HOY G;  3UDF A;  1U4M A;  1WCM G;  4FXG C;  1C9O A;  1XPU A;  3GTP H;  1RJT A;  4L8J A;  1B3A A;  4IJL A;  1CFM A;  3HOZ H;  3CPF A;  3T1Y L;  5LL6 X;  3J81 E;  1ESR A;  4P2C B;  1STN A;  1B53 A;  1UE7 A;  4OWW B;  4CDE C;  2ENB A;  3H0G B;  4A3B B;  4FXD A;  3CC2 A;  3KFU A;  4CJ0 B;  1TQO A;  4DN4 M;  1T5E A;  4LFB Q;  4HMJ A;  3T53 B;  4QUC A;  4A3I H;  1EYC A;  2OWO A;  1ENF A;  5C0X G;  1F9R A;  1JOR A;  2PQE A;  3J80 L;  3GTJ H;  3SK5 A;  2O2L D;  3QR8 A;  3J81 L;  4JV5 L;  4B3M L;  1EWI A;  1SJH D;  5EQ0 A;  2BOS A;  4DV0 Q;  1LO5 D;  3KF8 A;  3ICE A;  1B4O A;  4V0B A;  4JI8 L;  4IOA A;  4DPG A;  2F0G A;  3SR1 A;  1E3P A;  3G4S A;  3PUV A;  1PTO H;  1E22 A;  1GUS A;  4IUP A;  2YTY A;  1C8C A;  4K5W A;  3SEB A;  2EIF A;  5C4X H;  4KY7 A;  3I3C A;  1O78 A;  1KDB A;  4APV A;  4X6A H;  3BVM A;  1SLJ A;  3NPP A;  1KHI A;  1JR0 D;  1E1O A;  4H0L C;  5IWA L;  1KNA A;  1U0L A;  1CZG A;  2LXK A;  3KYH C;  2K75 A;  1EIH A;  1M4V A;  3F2U A;  1NE3 A;  5FKA C;  4LF6 Q;  2ZJQ A;  4OX9 L;  4HSP A;  3T1H Q;  1VQB A;  3D6C A;  1CQF A;  3I4M H;  4IUT A;  4A3K H;  2JXM B;  3S15 B;  2K03 A;  2KHI A;  4X66 L;  5C0X J;  4CDF C;  1TR5 A;  2WKD A;  1A0I A;  2QEJ C;  1YHB A;  3C46 A;  1PTO D;  3PUZ A;  2JA6 H;  5BN3 A;  3GDE A;  1B44 D;  2E76 C;  1IBK L;  1WJJ A;  3GTQ H;  3DMU A;  3NBI A;  1I94 Q;  1GO3 E;  1ILP A;  1GJX A;  3MWY W;  3TP6 A;  2B2Y C;  2AQ1 B;  1KDA A;  4WOR A;  2EYJ A;  4KHP Q;  1GD7 A;  3N6R A;  1UUP A;  1SBB B;  1NR2 A;  2WAC A;  3W2D A;  2B2V C;  1BCP B;  2H4O A;  3WOE A;  2KEE A;  4YY3 L;  5G3L D;  1LTS D;  3T51 B;  1GKH A;  1VQG A;  3KF6 B;  4XQJ A;  4F7X A;  4JBJ A;  4LUO A;  1PRT D;  3FKI B;  5LMN L;  5M3F G;  2DY8 A;  1NUC A;  3A8K E;  5TSS A;  1EYA A;  5EKL A;  4R8I A;  3SK8 A;  1QB5 D;  2Z4H A;  1GM5 A;  3NSW A;  3IRB A;  2F0I A;  1B3Q A;  2RBM A;  1X9N A;  2SOB A;  1AH9 A;  5EPL A;  4DR2 Q;  1I4G A;  1YBY A;  3GTO B;  1SMY D;  1F77 A;  4C2M B;  3X3M A;  1B1Z A;  1GHK A;  2CFM A;  4JI2 L;  4AQY L;  4RAU C;  4MN3 A;  3I4N H;  1EY6 A;  4KY5 A;  4LF5 L;  1FL0 A;  2R93 H;  2E5L L;  4LF4 L;  1J8I A;  2BCO A;  4P72 A;  5EBC A;  2H5X A;  3GTL B;  2L12 A;  3S1N B;  5EPJ A;  5C6A A;  3ERO A;  1QIL A;  1WTH A;  4A3L G;  4DFA A;  2HT1 A;  3TEH B;  3K7A H;  1JWM D;  1SAP A;  3G7L A;  5BN4 A;  3HOX G;  2UUA Q;  4JBK A;  3S1M H;  2EJM A;  4YIJ A;  4OXP A;  3LWU A;  2SDF A;  4KKS A;  2RQX A;  1Q7Y C;  5HY6 A;  2NVY B;  5E3F A;  3FP9 A;  1VQP A;  1TS2 A;  4KN7 C;  4QF4 A;  4G7H C;  1F9Q A;  2ZM6 Q;  1WVL A;  4RCO A;  2E2H H;  2MFI A;  2MP1 A;  1B2T A;  4UP9 A;  4LMQ D;  1HNZ L;  4RGM A;  1BO0 A;  2KCC A;  2OF1 A;  1OXS C;  4P75 A;  3PMF A;  1HH2 P;  1XNQ Q;  3OTO Q;  4RGN A;  1ML0 D;  4C3I H;  1YNX A;  4DV7 L;  1PH3 A;  4BXX G;  2K50 A;  3VYT A;  4XIG S;  2FHT A;  4KJO A;  2PI2 A;  4AH6 A;  3F2C A;  4IOC A;  2UU9 Q;  1LTT D;  4A3K G;  1CKO A;  2F0F A;  2F0S A;  4LJZ C;  3KF8 B;  3J81 c;  1X3G A;  3UE0 A;  1PV4 A;  1UE5 A;  1SRO A;  3L7Z C;  5LHY 1;  2BH2 A;  1Y8N B;  4PV1 C;  3T13 A;  2F0O A;  5C44 B;  1EQR A;  3PF5 A;  1XTC D;  2HIV A;  3S15 H;  1PH2 A;  4DR7 Q;  3UDI A;  1ONL A;  1HFN A;  3K5N A;  4IPG A;  1ESF A;  1VF5 C;  3PUY A;  1MSH A;  2F0Q A;  4LFA Q;  1TT2 A;  2F3V A;  3K7A B;  3A0J A;  3ULP A;  1AZQ A;  3BDO A;  1S4Z A;  4ZLT F;  2N3S A;  1G2T A;  1HCZ A;  5IGG A;  1GUT A;  3S24 A;  1G51 A;  3NK9 A;  1X55 A;  1PVO A;  2IL8 A;  2DUD A;  2HCI A;  4JVZ A;  4L5Q A;  4C3J G;  5IYB H;  1PYB A;  2LXJ A;  1XWE A;  4MTK A;  3M4O H;  4JI3 Q;  4GNX B;  1N33 Q;  1FYC A;  3K5M A;  1V1O A;  1JT8 A;  3NUC A;  1TWC H;  1U9R A;  4KD3 A;  1HA5 A;  4DXF A;  1IHZ A;  1CI3 M;  3R2T A;  2XNA C;  2JEA I;  3NTH A;  2ASB A;  5JVH 3;  1UEB A;  1SN8 A;  1BCP F;  3URY A;  2PQA B;  2N49 A;  4B3T L;  2A1A A;  1LTB D;  1F9P A;  2GN5 A;  4KHP L;  3QWN A;  3EA6 A;  4C3H B;  4OL7 A;  3C1E A;  2UUA L;  4HCE A;  4FO2 A;  5JOB A;  3CRL C;  3H15 A;  4PZ8 A;  2E74 C;  2SEB D;  4MNO A;  3U58 A;  1K28 A;  5IYC H;  1H95 A;  1P8L A;  5E4X A;  3HOY B;  2A68 D;  4U67 3;  2VQF L;  2LKV A;  3BYT B;  4X3K A;  4QGU A;  2M2L A;  3PUX A;  1KAW A;  4RKL A;  1HUM A;  1VQ8 A;  4OEL B;  1C48 A;  2XWB B;  5J39 A;  4K8I A;  4KMU C;  4GKJ L;  1STA A;  5KNB A;  4ZK9 B;  3S1N H;  1QZG A;  5I2X A;  4DR5 L;  4BY7 B;  4M8A A;  4IN3 A;  3H09 A;  4QMG A;  4X62 Q;  3JAM L;  1SFO B;  1SFO H;  1ILQ A;  1BDO A;  2PMZ B;  1WTO A;  1OXU A;  1WTW A;  1Y1V H;  3PO3 B;  3GTM B;  1CTM A;  3H6M A;  1EIY B;  3HS0 C;  1QVG A;  1EYD A;  2AUK A;  2RHS B;  2VUM H;  2VQE L;  3FDT A;  4EQO A;  1V1P A;  2KOL A;  5M5Y H;  2CW0 D;  2B63 G;  1HZC A;  5T1G A;  3S9W A;  3TS0 A;  3K5O A;  3R93 A;  5E4W C;  3PIO 3;  1N9W A;  3P75 A;  1HTP A;  1FR3 A;  2PZW A;  1VQC A;  1SYD A;  4NXN L;  4NPS A;  4N9P A;  4FDB A;  3S14 H;  5D14 A;  1BBX C;  2DN8 A;  1AEX A;  2UXC L;  5CV8 A;  1YIT A;  3A54 A;  4QQB X;  1TS5 A;  4XDX A;  1TU2 B;  4BY7 H;  4LF6 L;  4A3J H;  4LF9 L;  5M3M G;  2EYP A;  1JWS D;  1X6O A;  2KED A;  2M9V A;  4KHZ A;  4BA1 I;  4DR6 Q;  5FLX E;  4JK1 C;  4BY1 B;  1TS3 A;  3BZC A;  4N8X 1;  4DU9 A;  1CHP D;  4DGZ A;  3CU7 A;  4A3E H;  3KLR A;  1LTG D;  4A3D H;  3GTK B;  4XQN A;  2ZXO A;  1WCM H;  1W6J A;  3EQL C;  1QVC A;  1PTO F;  2MQH A;  2EY5 A;  1TXY A;  2NN6 H;  3GTG B;  3H94 A;  3OIQ A;  2L55 A;  3D4R A;  1Q46 A;  3W1B A;  2E2H B;  4FXK C;  4A3J G;  1VF7 A;  2RHQ B;  4X66 Q;  4DR5 Q;  1Q81 C;  4R4C A;  4RKB A;  2KCM A;  4B3T Q;  4B3S Q;  3T1H L;  4JI6 Q;  1IBM Q;  1XXG A;  1PFN A;  1YVC A;  5IOD A;  3CCS A;  1VQ9 A;  4JV5 Q;  3M4Y A;  1NCV A;  1HPC A;  2D62 A;  5EPK A;  3SGI A;  2UXC Q;  4ZAI A;  1NAP A;  3CF5 A;  5G3L F;  4KV6 A;  1TS4 A;  2L9H A;  2R7F A;  4YCW A;  1VMC A;  4DNR B;  1HFG A;  4HR7 B;  1PRT F;  3W1G A;  3S2H H;  1I4X A;  3ERS X;  5GRO A;  1X54 A;  2RCF A;  2NZO A;  4JBM A;  2XIW A;  1EIG A;  1E1T A;  3MXP A;  1Q1E A;  3MFG A;  2E8G A;  4IUU A;  4HAE A;  2QIL A;  2QEX A;  3FPU B;  3BZK A;  2WB1 B;  4BY7 G;  3VR4 A;  3DHQ A;  4PZ7 A;  3I90 A;  3IL8 A;  2JA7 H;  3BJU A;  3SHL A;  4JI0 Q;  1N34 Q;  1I50 H;  1TKW B;  3CKI B;  1N36 Q;  2KCT A;  2F0V A;  4MIU A;  1CKN B;  2I46 A;  4TRD A;  1LLR D;  1A15 A;  1EY9 A;  1DYQ A;  4GN3 B;  2RCN A;  4CDC C;  1SYG A;  3OMG A;  4A3D G;  4QL5 A;  3NBH B;  5M3M H;  3JAM i;  2A6E D;  2A6H D;  4NXM L;  3TP7 A;  5I9O A;  3W3A A;  1Q1B A;  2BE5 D;  2IX1 A;  3HOZ B;  4Q0F A;  1EZ6 A;  1JOQ A;  2K5H A;  4Y52 H;  2SNM A;  1X3E A;  4KHV A;  1IYJ B;  3GTP B;  1SE2 A;  3WOF A;  2Z0S A;  2L11 A;  4R4O A;  4DAV A;  3LX0 A;  1XNQ L;  2QDB A;  3D6W A;  5J1Z A;  2R93 B;  2AUJ D;  1EUJ A;  1O7Z A;  1QZH A;  3HOV G;  2M00 A;  2F03 A;  3M3Y B;  1PYS B;  3AB9 A;  2K5D A;  2A74 C;  3HKS A;  2K7V A;  2MJ8 A;  5CR3 A;  2SNS A;  3GTJ B;  2WP8 J;  5ELO A;  3NHH A;  4FF2 A;  3S16 B;  4IPC A;  4G7Z C;  4A3I B;  3SK4 A;  5J3B A;  4C3I G;  4HIK A;  4DV1 L;  3FKI H;  1EU3 A;  4OIJ A;  5JEA G;  4WJW A;  3M7N A;  3TQY A;  5COR A;  2FXQ A;  5EGT A;  2ZJR A;  4NXN Q;  2EY6 A;  1IXR A;  4DAP A;  3OTO L;  1CSQ A;  5JJK A;  2DNC A;  1RDP D;  4PMW A;  1C4Q A;  3G6E A;  3VDY A;  3ERQ A;  2JP1 A;  5DNF A;  3T16 A;  2L5T A;  2ZM6 L;  4A3G B;  3I72 A;  2MNA A;  5D3D A;  4JI3 L;  4Z9C B;  4DK6 C;  3R2I A;  4JI1 L;  2X69 A;  4EQ5 A;  5C0X I;  5KNC A;  2VB2 X;  3K0Y A;  1MD2 D;  2OTJ A;  4NB3 A;  2XSC A;  3U50 C;  4JI5 Q;  3KLS A;  1HQM C;  1PZI D;  2PPB C;  3EN2 A;  4ZCK A;  3BU2 A;  4K0K L;  2XVS A;  4DUZ L;  3ULJ A;  1QOH A;  4N9T A;  3ND8 A;  3TP5 A;  2VNU D;  4DAY B;  4MTN A;  2Q2H A;  2YV5 A;  4C3H G;  4BS9 A;  1S5F D;  1FJG L;  3MHB A;  4A93 G;  1BCP D;  1WD1 A;  4DR1 L;  4DV5 L;  4UP8 A;  3HOU B;  2K05 A;  1W6K A;  2WB1 G;  4FF3 A;  2UU9 L;  2K4K A;  1SYB A;  1PDQ A;  4JYA Q;  2K1B A; 
#chains in the Genus database with same CATH homology
 5KIX A;  4OHJ A;  4IFD J;  4K2L A;  5EKI A;  3EVQ A;  5FLX L;  2LFN A;  5CV9 A;  1V8Q A;  4IUV A;  2VB3 X;  2JA8 B;  3OPO A;  3TZU A;  2E2D C;  1PFM A;  4H44 C;  4DK1 A;  2Z1C A;  2EY1 A;  3RZO B;  4QCL A;  5FO8 B;  1AFP A;  1SXT A;  1K83 B;  2RKS A;  4A3K B;  3TME A;  3HG9 A;  3NWS A;  4QUF A;  5M5W B;  1D5X C;  2B39 A;  3I4M B;  1JWU D;  3OWE B;  3D4W A;  1TWH B;  1DD2 A;  1AN8 A;  2E2I B;  1E2W A;  4IZ8 A;  3P1H A;  1SYC A;  3VYU A;  3C1F A;  2ICE C;  4K2K A;  1A6X A;  1PTO C;  1H9S A;  1F2M A;  3HEJ A;  4ODG A;  3QB3 A;  5C4H A;  1Y1V B;  2F0N A;  2IPK D;  3KBG A;  3HKZ B;  4KJN A;  4X3U A;  3AMU A;  3RZD B;  1EQT A;  2WKC A;  1SNC A;  4FP5 D;  5IGC A;  3T4A C;  4OO1 H;  3Q24 A;  4NKL A;  2EZV A;  2I07 B;  3N52 A;  2FJ2 A;  3K5L A;  3OSO A;  5T1I A;  1PRT C;  5K36 H;  1Q90 A;  3Q0A A;  1BXT A;  2FMM A;  1SEB D;  1DON A;  5IT9 L;  1SE4 A;  2EXZ A;  1HHV A;  1IKL A;  4A3J B;  3J80 E;  4S3S A;  4B9X A;  1PTO B;  3C2P A;  4XTC S;  5BN5 A;  3GQB A;  5CV7 A;  2BA1 A;  3NTI A;  4GZY C;  3OWF A;  2R92 B;  1I6V C;  3BVZ A;  1STG A;  1LT5 D;  5JAV A;  5ISR A;  2KUM A;  2FMC A;  2B2V A;  3TN2 A;  1PFB A;  1QJO A;  1EQV A;  3R3O A;  4DA2 A;  1B50 A;  5J22 A;  1F9S A;  2G9D A;  2B2Y A;  3GV3 A;  4LAA A;  4BBS B;  3E0J A;  2A69 C;  1ZKO A;  1D2B A;  1IYV A;  1QCB D;  5IOC A;  1MBY A;  1BCP C;  3HOV B;  5C4J B;  1DXM A;  3A7L A;  1T5X D;  2V4D A;  2F1M A;  1R4P B;  1ENA A;  4CJ1 B;  1FD7 D;  1Z7T A;  1EWC A;  2NB0 A;  1H9S B;  2RVL A;  1CK1 A;  1U4R A;  2A68 C;  4O42 A;  2NZ1 D;  2F0K A;  4X3S A;  4XT3 B;  4TKO B;  4HED A;  2BDO A;  5IIF A;  2IJ0 A;  5CYU A;  2B2U C;  1D1I A;  1ZYR D;  3K58 A;  3MC0 B;  3DM1 A;  3A7A B;  1NSN S;  3SE0 A;  3HOX B;  4ZKB B;  3MEH A;  3J7A F;  1Z47 A;  2EDG A;  5EJW A;  3MZ5 A;  2IX3 A;  2A5H A;  1MI2 A;  3FMC A;  1E2Z A;  4XXE A;  3AU7 A;  1PLF A;  2FIN B;  4ZYS A;  5I9P A;  2F0E A;  2RDH A;  5EBD A;  2F3W A;  4FNF A;  2K04 A;  4PQX A;  3SVM A;  4BWG B;  5F2D A;  4L63 B;  4TQU S;  5A35 A;  1F2L A;  2B8F A;  4IUQ A;  1IW7 C;  1U4P A;  4H7B A;  1X3P A;  5JPN C;  2LS0 1;  4DK0 A;  3JAM E;  1K8O A;  4HMI A;  1D6E C;  1SSO A;  4A3D B;  5CV5 A;  4C1N I;  4NP5 A;  3FRP B;  5IT9 E;  1F2Y A;  4Q5V A;  4FYD A;  4DF7 A;  1XYI A;  5FOB B;  5LL6 S;  4A3F B;  3MAQ A;  1X3Q A;  1SYE A;  4O1N A;  4K6L A;  3VYS A;  2HQE A;  4K5X A;  3TBI B;  1G29 1;  1U4L A;  2B2W C;  1LT4 D;  2OXP A;  4J6H A;  3EFX D;  1KLU D;  2PW5 A;  1LTI D;  4CJ2 C;  2C9O A;  2JEB I;  3OMC A;  4PNY A;  3BG3 A;  4C56 C;  3I4L A;  1DOM A;  2EE1 A;  4B9W A;  1S5E D;  1CZW A;  1I4R A;  4DAY A;  2KVM A;  3FEW X;  1Y1W B;  1GOZ A;  1BQQ T;  2JA7 B;  4F88 A;  1SYF A;  2EJF C;  2K32 A;  2VUM B;  3RMH A;  1Y8O B;  1E0B A;  5M9O A;  1WCM B;  3T56 B;  3TDQ A;  5KEE A;  2KHS A;  3NBH A;  4XQQ A;  1CHQ D;  2OEO A;  4HN7 A;  1JE4 A;  2ZXP A;  1PYW D;  2PYK A;  1FNW A;  1YNN D;  5AFW A;  2NTS A;  3SDZ A;  3S1M B;  2JSO A;  3LWE A;  1UNS A;  1HQR D;  3I91 A;  1JC7 A;  4HCS A;  1SMY C;  2KA7 A;  1F2Z A;  5I6Y A;  1SDF A;  1GUW A;  4OIK A;  2IT1 A;  2NN6 I;  1SNP A;  5C4X B;  2AWN A;  3OHX C;  3K57 A;  2WV6 D;  3MVV A;  1Z6H A;  2MUY A;  3H3V C;  1S5B D;  1TII D;  4QB4 A;  1EY8 A;  3BYY B;  3QOL A;  3M7G A;  4IUN A;  5EKK A;  4NMZ A;  5M3M B;  2MGS A;  4K5V A;  2PZT A;  1B9M A;  5D3I B;  4M1U B;  1HRJ A;  2F4I A;  4IFD I;  4WRD A;  2LMC B;  3GV6 A;  4BBR B;  1PMR A;  1A2T A;  3BS1 A;  3S17 B;  1CA6 A;  3ND9 A;  1ZXT A;  1JOK A;  1MSG A;  1A2U A;  1Y8P B;  1KAA A;  4F87 A;  3HRZ C;  3BVG A;  1D5M C;  2B2T A;  2X6L A;  2Z8L A;  5C3E B;  5DM7 3;  1WTQ A;  1HA6 A;  1GXD C;  5JJZ A;  1HXY D;  5CMD A;  4RCN A;  1GUN A;  5C5L A;  2EYM A;  4LK1 C;  1OXV A;  3C3L A;  5JPM C;  1BNZ A;  4OO1 I;  4XT1 B;  2NVT B;  3TSS A;  2NWG A;  1S5D D;  5C4Z A;  1LV9 A;  1RF2 D;  4C1N K;  1JIC A;  1DM0 B;  4UDU C;  1WTR A;  5D65 A;  3V96 A;  4BA2 I;  3J7A V;  2X6G A;  2IWH A;  5A2Q L;  1KTK A;  4KK7 A;  1RCV D;  3TZD A;  3OW7 A;  5I4D A;  2OT2 A;  2EOT A;  5HGT A;  4R9W A;  4CHT B;  3IFT A;  4A3E B;  2EJG C;  2QF7 A;  1HTL D;  2NYZ D;  2CVR A;  1Y69 U;  2EPB A;  1LT3 D;  4G7O C;  1FGB D;  5KND A;  1V1P B;  3NE5 B;  3J7Y W;  1TWA B;  2B2W A;  4DNT B;  4RFB A;  2FFK B;  1LAC A;  5IGD A;  2L1B A;  2EYF A;  3KK7 A;  1RKN A;  2D5D A;  2HUG A;  4F8M A;  4KTA A;  1DOL A;  1I4P A;  2ZT9 C;  3VA5 A;  3G6J B;  4ID6 A;  1V43 A;  2YYZ A;  1OXT A;  2CHB D;  5C3X A;  2IX0 A;  3KUP A;  5ELF A;  3ONA B;  5COY A;  1RD9 D;  1YNJ D;  3HGB A;  1DJR D;  3D8G A;  3NWT A;  1E2V A;  1G2S A;  2EYL A;  1KAB A;  3VR3 A;  3DEP A;  2LY7 A;  2WIN B;  4R8N A;  1QNU A;  1VDZ A;  1PZK D;  1GHJ A;  3LNN A;  5A2Q E;  3UI2 A;  3IAY A;  4NW2 A;  1CM9 A;  3I4N B;  2RA4 A;  4K6D A;  2KQ3 A;  1MGS A;  5M3F B;  1UEA B;  1GUG A;  3E5S A;  3P7J A;  4KY6 A;  2K6A A;  4EVO A;  5KGU A;  1EEF D;  5IGF A;  2IW3 A;  4XYO A;  1EOT A;  3CQZ B;  2NVX B;  3IFD A;  1RTN A;  1A3U A;  5DAU A;  1M8A A;  2A69 D;  2ICI A;  2G9H D;  2XN9 C;  3RD4 A;  1ET9 A;  1TVX A;  2ID0 A;  2B2U A;  1LAB A;  5DM6 3;  4XYQ A;  4IFD H;  1WTV A;  3V2T A;  4A3M B;  1O80 A;  2EYO A;  4EQP A;  1ICW A;  1L0X B;  3VA7 A;  1H9M A;  1AZP A;  3DUZ A;  4CGY B;  4E6I A;  3VYR A;  2N88 A;  1H9J A;  2PW7 A;  1EY5 A;  5E1F A;  1EL0 A;  1TWF B;  2R3Z A;  3EJI A;  3V05 A;  2A6E C;  5ELC A;  4Y7N B;  4I7Z C;  1IL8 A;  4EGV A;  1ZYR C;  3NQT A;  5DEH A;  3BZD B;  2F0U A;  2BDN A;  3PIP 3;  1R9T B;  2F0H A;  3M85 A;  1X32 A;  2F0M A;  1EY4 A;  2Z4I A;  3P20 A;  3FVQ A;  1G8Z D;  1O7L A;  5ELD A;  1A3T A;  1UAP A;  1EFI D;  4FVM A;  4HSV A;  2VXW A;  1JB3 A;  4RH6 A;  1FNV A;  4IAL A;  4CKB A;  5CBE E;  3RUZ A;  4ZQ3 A;  4RGO S;  3GD7 A;  3QG1 A;  4C3J B;  5JEA H;  3A56 A;  1STE A;  5CC4 A;  5IGE A;  5I6W A;  5JVG 3;  2TSS A;  3S1Q B;  1IYU A;  1VCI A;  1ENC A;  2NTT A;  4J8Q A;  1TY0 A;  4RWS C;  1SE3 A;  3K6O A;  2ZXR A;  5HUR A;  2XRQ D;  2KEC A;  3DXJ C;  3SK6 A;  1GUO A;  3L3O C;  1I6H B;  3I8Z A;  1BOS A;  1EEI D;  3D4D A;  3MXU A;  4L6T B;  1K8M A;  4KKU A;  1G91 A;  3I70 A;  5C0X H;  4AYB B;  3I73 A;  4H13 C;  2K28 A;  1JCK B;  1STB A;  4RA8 A;  4JBW A;  4ILW A;  2HCC A;  1H9K A;  1H9R A;  2RSO A;  2MHV A;  2YU9 B;  1IW7 D;  3VR6 A;  1DZ1 A;  5ELB A;  1O7Y A;  3QIA A;  1TWG B;  1Q12 A;  5JEA J;  2BA0 A;  2EVB A;  1BF4 A;  3IKJ A;  3DWP A;  3S1R B;  4RGT A;  1CQV A;  2QKI C;  4B08 A;  2Q8T A;  3GTQ B;  2B8G A;  1KDC A;  1TWC B;  1EZ8 A;  1KNE A;  4CKE A;  3GP7 A;  4OGQ C;  3MXN A;  2NVQ B;  2D2C C;  4I65 A;  4ZUJ A;  4QIW B;  5CGK A;  3OOC A;  4ZUI A;  1IKM A;  1II3 A;  5M5Y B;  2MPM A;  5CV6 A;  4FF4 A;  1SNO A;  3CHB D;  1BUV T;  1SJE D;  2HDL A;  5K5P A;  1YNN C;  3BDC A;  2RSN A;  2JYO A;  3A8J E;  5C3W A;  2EYH A;  2EY2 A;  3HOW B;  2KJX A;  5KYL A;  4UAI A;  4TSS A;  2E2J B;  2Y0S B;  4IUR A;  5NUC A;  3SXH A;  1SND A;  2AQ2 B;  4IFD G;  1D5Z C;  3ITP A;  2K5Q A;  5IGB A;  3Q23 A;  3M4O B;  1J9O A;  4ABN A;  4A93 B;  3MA2 B;  1I4Q A;  1FNU A;  2R7Z B;  3QJY A;  1R4Q B;  2PO4 A;  3PUW A;  5I2Y A;  3BDL A;  1ROD A;  1I4H A;  4V19 0;  3DWA A;  3K59 A;  3Q6S A;  2B2T C;  2O4X A;  2TMP A;  1I50 B;  2XWJ B;  3ZYY X;  2O5J C;  3PV0 A;  2F0D A;  1DCZ A;  3S2D B;  3PO2 B;  3X3N A;  3A55 A;  2DNE A;  3FPP A;  2PNR C;  4WFN 3;  1LTA D;  3TP8 A;  3RLF A;  4KD4 A;  5FO9 B;  1NR4 A;  2DY7 A;  4K14 A;  3S2H B;  2PCF B;  2KCN A;  5FO7 B;  4OO1 G;  1DOK A;  3U9S A;  3KLS X;  3S14 B;  1Q3L A;  3DWQ A;  1JQY D;  4RHS A;  4KN4 C;  2QCP X;  1QE6 A;  2L4N A;  4ZKC B;  5KYI A;  5ELE A;  4PMC A;  2Q8R E;  2RDG A;  2R61 A;  1SNQ A;  1RTO A;  2R6G A;  4CBV A;  2D9U A;  3R8B A;  3HZX A;  3QO2 A;  4ME5 A;  2CW0 C;  1L0Y B;  2K5W A;  4ULL A;  2RDF A;  1EWH A;  2J4X A;  3NP8 A;  4RHR A;  4NDX A;  2Q8I B;  3VR2 A;  1VMP A;  4IQZ A;  3Q22 A;  1KLG D;  2AQ3 B;  1S5C D;  4U68 A;  1EY7 A;  2JA6 B;  5CV4 A;  4C3I B;  2HDM A;  1PRT B;  1BR9 A;  4PMB A;  2F0P A;  2F0J A;  2E75 C;  3WDN A;  3A8I E;  4K8J A;  1OXX K;  2J0T D;  3E6Z X;  3D31 A;  1HUN A;  1OO9 B;  3U9O A;  5CBA E;  1G6Z A;  2F0T A;  2JE6 I;  2BE5 C;  1CA5 A;  5M5X B;  3NXW A;  3HP3 A;  3NTK A;  1STY A;  4HTH A;  4X3T A;  1WTX A;  3MTS A;  1B9N A;  3D3R A;  1ET6 A;  2A6H C;  3QOJ A;  1SNM A;  1QNK A;  5KRU A;  2NUC A;  2K01 A;  1I3Q B;  2NN6 G;  3DEO A;  2XRS D;  3MFY A;  2PZU A;  2F0W A;  3GO5 A;  1PZJ D;  1CT1 D;  3OIP A;  2H1E A;  2B63 B;  3KBX A;  5C5M A;  4KKT A;  3NQI A;  1QWY A;  1WD0 A;  1D1K A;  4G57 A;  3L9A X;  1YNJ C;  1TY2 A;  1EU4 A;  1QG7 A;  4FF1 A;  2K33 A;  4J1M A;  1A3V A;  2J7Z A;  3MXG A;  5K36 G;  2AWO A;  1LT6 D;  1LTR D;  4EQN A;  3H91 A;  2NBF A;  5FK9 C;  2F0L A;  1ZEQ X;  2JA5 B;  2CQA A;  1RHP A;  1JOO A;  4KI0 A;  1AP0 A;  2A73 B;  4ZRZ A;  3O13 A;  1AW7 A;  1Q8I A;  4G4K A;  2GA4 B;  2N55 A;  4DXG A;  2WAQ B;  3CRK C;  2O5I C;  1STH A;  1WTP A;  2C5C A;  1PXU A;  2WII B;  2L0C A;  1XX8 A;  4MHE A;  3VR5 A;  1EY0 A;  4CKC A;  1U4M A;  4FXG C;  1RJT A;  4L8J A;  1B3A A;  1CFM A;  3J81 E;  5LL6 X;  1ESR A;  4P2C B;  1STN A;  1B53 A;  2ENB A;  3H0G B;  4A3B B;  4FXD A;  4CJ0 B;  4DN4 M;  1TQO A;  1T5E A;  4HMJ A;  3T53 B;  4QUC A;  1EYC A;  1ENF A;  5C0X G;  1F9R A;  1JOR A;  2PQE A;  3J80 L;  3SK5 A;  2O2L D;  3J81 L;  1SJH D;  5EQ0 A;  2BOS A;  1LO5 D;  3KF8 A;  1B4O A;  4V0B A;  2F0G A;  3SR1 A;  3PUV A;  1PTO H;  1GUS A;  4IUP A;  1C8C A;  4K5W A;  3SEB A;  4KY7 A;  3I3C A;  1O78 A;  1KDB A;  3BVM A;  3NPP A;  1JR0 D;  4H0L C;  1KNA A;  1CZG A;  1EIH A;  1M4V A;  3F2U A;  5FKA C;  4HSP A;  3D6C A;  1CQF A;  4IUT A;  2JXM B;  3S15 B;  2K03 A;  5C0X J;  1TR5 A;  2WKD A;  2QEJ C;  3C46 A;  1PTO D;  3PUZ A;  5BN3 A;  1B44 D;  2E76 C;  3DMU A;  3NBI A;  1ILP A;  1GJX A;  3MWY W;  3TP6 A;  2B2Y C;  2AQ1 B;  1KDA A;  4WOR A;  2EYJ A;  3N6R A;  1UUP A;  1SBB B;  1NR2 A;  2WAC A;  3W2D A;  2B2V C;  1BCP B;  2H4O A;  3WOE A;  2KEE A;  5G3L D;  1LTS D;  3T51 B;  4XQJ A;  4F7X A;  1PRT D;  3FKI B;  2DY8 A;  1NUC A;  3A8K E;  5TSS A;  1EYA A;  5EKL A;  4R8I A;  3SK8 A;  1QB5 D;  2Z4H A;  3NSW A;  2F0I A;  2RBM A;  2SOB A;  5EPL A;  1I4G A;  3GTO B;  1SMY D;  1F77 A;  4C2M B;  3X3M A;  1B1Z A;  1GHK A;  4RAU C;  4MN3 A;  1EY6 A;  4KY5 A;  1J8I A;  2BCO A;  5EBC A;  3GTL B;  2L12 A;  3S1N B;  5EPJ A;  5C6A A;  3ERO A;  1QIL A;  4DFA A;  1JWM D;  1SAP A;  3G7L A;  5BN4 A;  2EJM A;  4YIJ A;  3LWU A;  2SDF A;  4KKS A;  2RQX A;  2NVY B;  5E3F A;  1TS2 A;  4KN7 C;  4QF4 A;  4G7H C;  1F9Q A;  1WVL A;  4RCO A;  2MP1 A;  1B2T A;  4LMQ D;  4RGM A;  1BO0 A;  2KCC A;  2OF1 A;  1OXS C;  3PMF A;  4RGN A;  1ML0 D;  3VYT A;  4XIG S;  2FHT A;  4KJO A;  1LTT D;  2F0F A;  2F0S A;  4LJZ C;  3L7Z C;  5LHY 1;  1Y8N B;  4PV1 C;  3T13 A;  2F0O A;  5C44 B;  1XTC D;  1ONL A;  1HFN A;  3K5N A;  1ESF A;  1VF5 C;  3PUY A;  1MSH A;  2F0Q A;  1TT2 A;  2F3V A;  3K7A B;  1AZQ A;  3BDO A;  1S4Z A;  4ZLT F;  1G2T A;  1HCZ A;  5IGG A;  1GUT A;  3NK9 A;  2IL8 A;  2HCI A;  4C3J G;  1XWE A;  1FYC A;  3K5M A;  1V1O A;  3NUC A;  1U9R A;  4KD3 A;  1HA5 A;  4DXF A;  1IHZ A;  1CI3 M;  3R2T A;  2XNA C;  2JEA I;  3NTH A;  5JVH 3;  3URY A;  1BCP F;  1LTB D;  1F9P A;  3QWN A;  3EA6 A;  4C3H B;  4OL7 A;  3C1E A;  4HCE A;  4FO2 A;  5JOB A;  3CRL C;  2E74 C;  2SEB D;  5E4X A;  3HOY B;  2A68 D;  4U67 3;  2LKV A;  3BYT B;  4X3K A;  2M2L A;  3PUX A;  4RKL A;  1HUM A;  1C48 A;  2XWB B;  5J39 A;  4K8I A;  4KMU C;  1STA A;  5KNB A;  4ZK9 B;  5I2X A;  4BY7 B;  4M8A A;  4IN3 A;  3H09 A;  4QMG A;  3JAM L;  1SFO B;  1BDO A;  1ILQ A;  2PMZ B;  1WTO A;  1OXU A;  1WTW A;  3PO3 B;  3GTM B;  1CTM A;  3H6M A;  3HS0 C;  1EYD A;  2AUK A;  3FDT A;  4EQO A;  1V1P A;  2KOL A;  2CW0 D;  5T1G A;  3S9W A;  3K5O A;  3R93 A;  5E4W C;  3PIO 3;  3P75 A;  1HTP A;  1FR3 A;  2PZW A;  1SYD A;  4N9P A;  5D14 A;  1BBX C;  2DN8 A;  1AEX A;  5CV8 A;  3A54 A;  1TS5 A;  4XDX A;  1TU2 B;  2EYP A;  1JWS D;  2KED A;  2M9V A;  4KHZ A;  4BA1 I;  5FLX E;  4JK1 C;  4BY1 B;  1TS3 A;  4DU9 A;  1CHP D;  4DGZ A;  3CU7 A;  3KLR A;  1LTG D;  3GTK B;  4XQN A;  2ZXO A;  1W6J A;  3EQL C;  1PTO F;  2EY5 A;  2NN6 H;  3GTG B;  3H94 A;  3OIQ A;  2L55 A;  3D4R A;  2E2H B;  4FXK C;  1VF7 A;  4RKB A;  1XXG A;  1PFN A;  5IOD A;  3M4Y A;  1NCV A;  1HPC A;  2D62 A;  5EPK A;  4ZAI A;  1NAP A;  5G3L F;  4KV6 A;  1TS4 A;  2L9H A;  1VMC A;  4DNR B;  1HFG A;  4HR7 B;  1PRT F;  1I4X A;  2XIW A;  1EIG A;  3MXP A;  1Q1E A;  3MFG A;  4IUU A;  4HAE A;  2QIL A;  3FPU B;  2WB1 B;  3VR4 A;  3DHQ A;  3I90 A;  3IL8 A;  3SHL A;  1TKW B;  3CKI B;  2F0V A;  4MIU A;  2I46 A;  4TRD A;  1LLR D;  1A15 A;  1EY9 A;  1DYQ A;  1SYG A;  3OMG A;  2A6E D;  2A6H D;  3TP7 A;  5I9O A;  3W3A A;  1Q1B A;  2BE5 D;  2IX1 A;  3HOZ B;  4Q0F A;  1EZ6 A;  1JOQ A;  2SNM A;  4KHV A;  3GTP B;  1SE2 A;  3WOF A;  2L11 A;  4DAV A;  3LX0 A;  2QDB A;  3D6W A;  5J1Z A;  2R93 B;  2AUJ D;  1O7Z A;  2M00 A;  2F03 A;  3M3Y B;  3AB9 A;  2K5D A;  2A74 C;  2K7V A;  2MJ8 A;  5CR3 A;  2SNS A;  3GTJ B;  2WP8 J;  3NHH A;  4FF2 A;  3S16 B;  4G7Z C;  4A3I B;  3SK4 A;  4C3I G;  1EU3 A;  4OIJ A;  5JEA G;  4WJW A;  3M7N A;  5COR A;  5EGT A;  2EY6 A;  4DAP A;  2DNC A;  1RDP D;  4PMW A;  1C4Q A;  3ERQ A;  2JP1 A;  5DNF A;  3T16 A;  2L5T A;  4A3G B;  3I72 A;  5D3D A;  4Z9C B;  3R2I A;  2X69 A;  5C0X I;  5KNC A;  2VB2 X;  3K0Y A;  1MD2 D;  2XSC A;  3KLS A;  1HQM C;  1PZI D;  2PPB C;  2XVS A;  1QOH A;  4N9T A;  3ND8 A;  3TP5 A;  2VNU D;  4C3H G;  4BS9 A;  1S5F D;  3MHB A;  1BCP D;  1WD1 A;  3HOU B;  2K05 A;  1W6K A;  4FF3 A;  1SYB A;  1PDQ A;  2K1B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...