1H9SB

Molybdate bound complex of dimop domain of mode from e.coli
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
137
structure length
137
Chain Sequence
QTSARNQWFGTITARDHDDVQQHVDVLLADGKTRLKVAITAQSGARLGLDEGKEVLILLKAPWVGITQDEAVAQNADNQLPGIISHIERGAEQCEVLMALPDGQTLCATVPVNEATSLEQGQNVTAYFNADSVIIAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MOLYBDENUM TRANSPORT PROTEIN MODE
publication title Oxyanion Binding Alters Conformational and Quaternary Structure of the C-Terminal Domain of the Transcriptional Regulator Mode; Implications for Molybdate-Dependant Regulation, Signalling, Storage and Transport
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription regulator
total genus 33
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2001-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03459 TOBE TOBE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1h9sB02
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1h9sB01
2A68C 3ND9A 3TZUA 1LABA 3HGBA 2BDOA 4G7ZC 3U9SA 3SDZA 1E2VA 1OXXK 1V8QA 4XIGS 1BDOA 1H9RA 4GZYC 1O78A 3GQBA 2B8FA 1CI3M 1GUNA 3PUWA 4TKOB 3VR3A 4H13C 2NN6G 3I72A 1VF5C 1ZYRC 1K8OA 3P20A 3VR6A 4OGQC 1V43A 4KKTA 1Y8OB 1GJXA 3W3AA 1G291 4DNRB 1OXVA 2EJGC 2JEAI 1GUTA 2BA0A 3OW7A 1ONLA 5KNBA 3FMCA 4KHZA 1CTMA 1IW7C 3DXJC 2BE5D 1FR3A 1H9JA 5BN4A 2KCCA 2DNEA 2EJFC 1IYVA 2B8GA 5JEAH 3M85A 3CRLC 1Z6HA 3VR5A 1E2WA 2CW0C 4KN7C 2AWOA 1YNNC 2A68D 3D31A 1OXSC 2AUJD 3T51B 3WDNA 3EQLC 2Q8IB 3VR4A 4PV1C 2PPBC 1Q12A 1QJOA 1T5EA 2A6HC 4IFDH 3KLRA 1K8MA 5A35A 1VDZA 5JEAG 3N6RA 4H44C 1O7LA 5K36H 2YYZA 2D2CC 1ZKOA 3A8JE 2A6ED 2JXMB 4JK1C 4LJZC 3VR2A 1EWHA 2F1MA 1TKWB 4I7ZC 3BG3A 1TU2B 4DNTB 4KN4C 2A6EC 1IW7D 3CRKC 4IFDG 2JEBI 4HR7B 3I4LA 4LK1C 1OXUA 3M4YA 1GUOA 1Q90A 1YNJC 1B9MA 3H94A 4L8JA 1B9NA 3NE5B 1Q1BA 3PUZA 3QG1A 5K36G 2E76C 2KA7A 3QIAA 1PMRA 3PUYA 3SE0A 1GUSA 1DD2A 4BA1I 3RLFA 4DK0A 4KMUC 3PV0A 1HCZA 1LACA 2A6HD 2K7VA 3FPPA 2ZT9C 1H9MA 2D62A 2LMCB 5KNDA 1HTPA 1GHKA 3OPOA 2QF7A 2BE5C 1I6VC 5C0XH 2L5TA 2O5JC 3L7ZC 1Y8PB 4DK1A 3IKJA 4JBWA 1E2ZA 2A69C 1Y69U 2DNCA 4G7HC 1DCZA 3A8KE 3A8IE 5BN5A 3I73A 1VCIA 3LWUA 1SMYC 1Y8NB 2PCFB 2DN8A 2EVBA 2NN6I 1GUGA 1Z7TA 1A6XA 1H9KA 1IYUA 4IQZA 5C0XG 3MXUA 2EJMA 4OO1H 2R6GA 3VA7A 3LNNA 1CFMA 3T53B 2PNRC 2AUKA 3IFTA 3AB9A 2JE6I 3OOCA 1HQMC 3GD7A 4TQUS 4XTCS 3MFYA 2V4DA 3A7AB 4G7OC 2K33A 1H9SA 4RCNA 2IT1A 2E75C 1FYCA 2K32A 3A7LA 2O5IC 2D5DA 2BA1A 4KI0A 1H9SB 1VF7A 5BN3A 3QJYA 3D4RA 1OXTA 3PUVA 5KNCA 4OO1G 4H0LC 4BA2I 2NN6H 3BDOA 2A69D 4KKSA 1DXMA 3ND8A 3PUXA 1HPCA 2E74C 4KKUA 3M7NA 2EDGA 3T56B 1Q1EA 1GHJA
chains in the Genus database with same CATH superfamily
1Y1VB 1N36Q 5EPKA 4AYBB 1NMFA 3CXCA 4OX9L 2N78A 1S40A 1BDOA 4GZYC 1ENAA 5I9PA 1SFOB 1K8OA 2AWNA 2F0TA 3O13A 3J81L 4X65Q 1N33Q 4NB3A 1S72A 4HN7A 1EIFA 2PO4A 3SHLA 4O2DA 3E5SA 1SEBD 1Z6HA 4DF7A 2EYMA 3D31A 5A2QL 4ILWA 3AMUA 3Q8DA 1EOVA 4Y7NH 1NNXA 4HCSA 4KJOA 1T9HA 1K28A 3S1RB 1R9TH 2Z4IA 2R7FA 1RCVD 3SK5A 2K75A 1F2YA 2VZAA 1IXRA 4C56C 4HJ9A 5IOCA 2D2CC 4I7ZC 4DNTB 1HUMA 1JOQA 1LTLA 4NXNQ 3CCJA 3CQZH 4RKLA 1GUOA 3I8ZA 2D0PA 1Q1BA 1LT6D 1EIGA 1JOOA 1JC7A 3CCVA 1WI5A 2KA7A 3ITPA 3CCEA 1SNCA 3NHHA 2OCEA 4YCVA 1YEZA 3UE1A 1HCZA 1STAA 3HOYG 4JV5L 1PH9A 4CGYB 2F0WA 1XXGA 2RF4A 4X3TA 4BBSG 4A3DG 3RR5A 1QVGA 5FLMG 3A8IE 1WTHA 1Y14B 1QE6A 2F0IA 2A1AA 1AZQA 3A0JA 2VQFQ 1A62A 1SYDA 1KDBA 4RKBA 3GTLH 3GTQB 1G6PA 2ICEC 1YNJD 4YY3Q 4RHSA 1TWGH 3G7LA 1KL9A 1F2ZA 4DV3Q 4J1MA 2SEBD 4R4IA 3IFTA 5IWAL 3HKSA 1VQDA 1HQMC 1PH7A 5M5WH 1VQLA 1ILPA 2VB2X 4K5XA 4G7OC 1FNUA 4N9PA 1PYWD 1STEA 1SR3A 1B1ZA 4HIDA 2JYOA 3D4RA 1YNXA 3W2DA 4LFCQ 2R92B 1S4ZA 1BR9A 2F03A 3RLNA 4GKJL 3I3CA 4A3MG 1OXXK 1DM0B 4IUQA 2GA4B 3K7UC 1WTWA 3GQBA 2BH2A 2JA9A 4P72A 3VR3A 1KC8C 2UXDL 4XXEA 2RKSA 2RDGA 3OTOL 1J6QA 3NQTA 5M3FH 3HOUG 1VQFA 3K7AH 4HSPA 1FJGL 2JA5H 3DEPA 3TP5A 3KLSA 4DR6Q 2RVLA 3J80L 1N9WA 3T16A 1RD9D 1TY0A 2I5HA 3NTKA 4F88A 5CGKA 4BY1B 4AH6A 1NSNS 2DJGC 2ZM6Q 1OXSC 2Z6KC 3ERSX 2R7DA 4A3KB 1GUWA 5JEAG 4H44C 3K5MA 1Z47A 2DY7A 3PO2B 1MGSA 5K36H 2YYZA 2WFWA 3CCSA 3NQIA 1FNVA 2KEEA 2NWGA 3EBEA 4IPHA 3S15B 1IW7D 3CRKC 4IZ8A 3CC4A 4A3IG 2LSSA 2KECA 2HDLA 5I6WA 1DYQA 3R8BA 4XT3B 4J15A 3PMFA 2J4XA 1FD7D 3S1NH 3Q22A 1YNND 3BU2A 2ID0A 1PXUA 2Z9HA 3MXNB 1GUSA 4BA1I 5LMNL 2A6HD 5AJ3Q 1D1IA 5KNDA 1IBMQ 4QUCA 1GHKA 3I4NB 4L6TB 3MHBA 1E2ZA 2J0TD 1EFID 4JI5L 1XNQL 2J7ZA 5TSSA 2Z8LA 2B2WC 3ZJYC 2YU9B 4FXDA 2DGYA 3LWUA 3HOWB 1AZPA 2PCFB 4J6HA 3J81j 1VQMA 1HA5A 1ESFA 3K81C 3T53B 3WWVA 4ZUJA 1RJTA 2NVTB 4OO1I 2CKZB 1ASZA 2Y0SG 1KLUD 3PO3B 5JOBA 4LF8Q 4RA8A 1F77A 1BF4A 4FVMA 4P71A 1I4QA 5CORA 4DAPA 3EA6A 1IBKL 2KBNA 1ICFB 2QEXA 1VQGA 3BDOA 5LMUQ 3ND8A 5E3FA 1S5ED 2PMZE 4HCEA 3TZUA 2P5ZX 2F4IA 5C0XJ 4A3JB 1CA5A 4LF7Q 3HOXB 3URYA 3EFXD 1KRTA 3U4ZA 5IP9H 5M9OA 3RD4A 5GAGC 3CQZB 1I3QB 1HRJA 2VS1A 3OIPA 1WD1A 1GJXA 3T1HQ 4B3SL 1VQ6A 2JA7G 1BBXC 3FMCA 4HMJA 2NZHA 3H0GB 4JI2L 1H9JA 2B2VC 5BN4A 4B08A 3R93A 3EVQA 3GTKB 3GV6A 1U4LA 3GTGB 5AFWA 3S1QH 4LW1A 3D4DA 3S9WA 4BXXH 5IY0A 1JE5A 1C48A 1YVCA 3WDNA 1CZWA 2HUGA 2PPBC 5HGQA 4DAYB 2OWOA 4A93H 5A35A 3GTLB 1QNUA 5CC4A 1XMQQ 3N6RA 4QY7A 2I0QA 4HEDA 1QZHA 3G71A 1WTPA 2TMPA 1WCMH 2JN4A 3LX0A 3H6MA 1ILQA 3BVZA 1R4QB 1WD0A 3DM1A 2OQKA 1EY9A 3KF6B 5M5WB 2OTLA 3KDFB 1HZCA 1KHIA 1N34Q 3ULPA 5EAYA 2F0QA 3FKIG 4IUTA 4YCUA 3MEHA 3NTIA 1QVCA 1PMRA 2VNUD 1NAPA 2UUCQ 3W5OA 4FXGC 2F0SA 4ME5A 2HIXA 1PFBA 1EEFD 1D8LA 1TWAB 1Q8KA 4HSVA 3TP7A 1BQQT 2C5CA 3L7ZC 4GLAC 2A69C 2JP1A 1HNXQ 1SSOA 3FRPB 2NVQB 1MSHA 4CJ1B 2RCFA 3D6CA 4GN5A 3VYSA 3S2DB 1EQRA 1CUKA 2XNAC 4KY6A 1I50H 1H9KA 3MVVA 4A3EH 3CF5A 2L15A 4QF4A 4K0KL 2JA5B 2N8NA 2JA8B 4P74A 2I07B 4OIJA 2N88A 5FO8B 1Y1WB 1D5XC 1EUJA 1XPOA 3CCQA 3HRZC 3DWQA 2K32A 5LL6X 4QCLA 4DXFA 2E5LQ 4B3RQ 2EYHA 2MO1A 2QDBA 4IOCA 5IYCH 3ICEA 1K3BC 2WINB 2AMCB 4A3BG 1GHJA 5HY6A 4IPGA 1E2VA 5BR8L 3CCMA 4XQQA 1SE2A 2K5HA 1L2FA 2B8FA 2A19A 1X3EA 1EYDA 1SNQA 2VUMG 3K0XA 2Q8TA 4DNRB 3S1NB 3CC7A 5C5MA 4X66L 3BZCA 1X3GA 4X62L 2EJFC 1M4VA 1EYGA 2WB1G 2F0UA 4MZ9A 4JI7L 1FGUA 1VQNA 4JI1L 4PV1C 1SN8A 2K04A 1QJOA 2UUBL 3W1BA 2O2LD 2ASBA 4CHTB 1SDFA 4R4CA 4TRDA 4DV7Q 4GKKQ 3S1MH 4Q5VA 1G51A 4P75A 3VR2A 4Z9CB 2L4NA 3R2IA 3FP9A 2XGTA 5FLXc 4MTNA 2VL6A 4LUOA 1QZGA 2B2TA 1PTOC 4L8JA 4DR4Q 3PUZA 5ELNA 1L1OB 4L5TA 3H15A 4JYAL 2XIWA 3PUYA 5FLXE 4DV2L 3KYHC 1N33L 1EEID 3NEMA 2M00A 1PLFA 4DK0A 1VQ8A 1MJCA 5IODA 2KENA 1KLGD 4YWKA 1U4MA 2L5TA 1JWMD 2B63H 1Y1VH 4FYDA 2F0FA 4JI8L 1CM9A 2PW5A 4JBMA 4OELB 4QJFA 2DN8A 1VQKA 4FNFA 4IQZA 1HJPA 3CCRA 1PFMA 5IGDA 3CCLA 5C3EG 2DJFC 4WJWA 1EQTA 2EXDA 4OXPA 3OOCA 2V4DA 3G6JB 3JC66 1WYDA 1VF7A 4OHJA 5CV4A 2KQ3A 5JJLA 3Q23A 2NN6H 1XNRQ 4JI6L 2M2LA 3HOZB 2EZVA 4PG3A 3M7NA 3QIAA 5GADC 5CMDA 3S1RH 1QG7A 4I7AA 3U9SA 3JAMi 4CDCC 3DUZA 3SK4A 2JSOA 4X64Q 1ZYRC 3DHQA 3I4MG 3VR6A 4KKTA 2KOLA 3G4SA 1G291 4LF4Q 2ZXPA 2EJGC 2EOTA 2F4VQ 4KHZA 2PNHA 2ZTDA 2JK8A 1PTOF 2X69A 1UEAB 1D6EC 2KCCA 2L12A 2VY3A 5KYIA 1JORA 4YY3L 2HD3A 2KUMA 1O7ZA 1DZ1A 4DV4Q 2NB0A 3S24A 4LFAL 2EE1A 1T5EA 4YIJA 1QB5D 2RA4A 4NMZA 5EGTA 4C3HG 1VQOA 4R4TA 3TBIB 3I4OA 4A3EB 1VQEA 1GVPA 3P7JA 4B3ML 2KCTA 3GTQH 3HG9A 3HOVG 2FINB 4KN4C 3PIO3 2ZJRA 3NK9A 3TN2A 2CH4W 3IRBA 2JEBI 3TRZA 4HJ8A 4A3GG 4RGNA 4C1NI 1EY6A 5CV8A 4HJ7A 3IFDA 2R7ZH 4WJ4A 4B3TL 3FDTA 2GVAA 2WB1E 1HFGA 3RLFA 1ZEQX 1ML0D 1GM5A 2GN5A 5DNFA 2R92H 4QQBX 1HZAA 4KK7A 1WJJA 2ES2A 2LMCB 4OL7A 2RHQB 1YHQA 5C0XH 1HZBA 2XSCA 4DV1Q 1A63A 4JBWA 3OMCA 1HNZQ 2ZJQA 4UP7A 1W3SA 4LFBQ 2LKVA 2EY1A 1J5EQ 3STBC 1Q86C 1GUGA 4RGMA 1MSGA 2XRSD 3NBHA 1RL2A 3B6YA 1KAWA 4CKBA 4R9WA 4JC0A 2F0PA 1CFMA 4JG2A 2G9HD 4ODGA 3HOYB 2JE6I 1SYBA 4NPSA 1H95A 1PYSB 4DR2Q 3RZOH 4A3DB 1LO5D 1SYFA 3OWFA 4BBSB 2PMZB 1HFNA 2IJ0A 1EQQA 1ZXTA 4J8QA 3PUVA 4E6IA 1PRTC 2ZXOA 1SROA 4BA2I 3KOJA 3IL8A 2E2IH 2FHTA 5EPLA 2E74C 1FNWA 2A68C 1O80A 3F2DA 3TQYA 4DUZL 1HR0Q 4X6AH 1V8QA 3PO2H 4LF9L 3PF4A 5M3MG 1UUPA 3C2PA 1CI3M 4KHPQ 2B2UA 3BJUA 5IYDH 1LTTD 4PQXA 1HH2P 2B2VA 2QW7A 1WVLA 1SNOA 2JEAI 3T4AC 1SYCA 4FXKC 2BH8A 2VW9A 1PTOB 4A3MB 3UDXA 1X55A 2EY2A 4PZ8A 1E2WA 2TSSA 1ASYA 3L9AX 3RLOA 1XJVA 3I4NH 4AQYQ 2K28A 5CBAE 4FF2A 5C44G 3RN2A 1PV4A 2YU9H 1O7LA 4POFA 3HOWH 3HOUB 4IN3A 3BDCA 3A56A 5JPNC 4EQOA 1BKBA 1S3OA 4A3CG 2K03A 1OTCA 3RN5A 4NXMQ 1NE3A 2NVTH 3DWAA 1C0AA 3D3RA 4MHEA 3PO3H 2CW0D 2E76C 2X6GA 1GKHA 4EQPA 2HQLA 1MKHA 2ENBA 3A5UA 1PRTF 1LACA 3AQQA 1BUVT 4OIKA 4PNYA 4DR1L 4K14A 3OPOA 5E7NA 5IT9L 1X65A 2I5MX 4A3IB 4A3JH 2LFNA 2DNCA 2R93H 3HOXH 4A3LH 3F1ZA 1E3PA 4XYOA 1I3QH 2WKCA 4XQJA 2K05A 1Z7TA 1A6XA 2CFMA 1DONA 1PZJD 1M1KC 4POGA 3LNNA 4KJNA 1Q7YC 3TEHB 4JI4Q 2B2TC 2H5XA 3H0GH 1I4XA 4XTCS 4EQNA 3E6ZX 4U673 4O0AA 3H3VC 3GTKH 3GTGH 1SE3A 5BN3A 4QB4A 2B39A 4DA2A 1A2TA 3GTJB 3CMAA 2OXPA 3I56A 5L37A 1BCPB 4KKSA 2EDGA 1B8AA 1SMYD 2EYJA 5D65A 1SNPA 2VQEQ 2PZWA 1BBUA 1GXDC 1H9RA 1RTNA 1CK1A 2Y0SB 4WRDA 2NTSA 1HTLD 2K1BA 1Y8OB 1SLJA 1XWEA 1LV9A 2M9VA 3W3AA 2WP8J 4C3JG 2R7ZB 2CHBD 5IIFA 2UXBQ 3HKZG 1JB7A 4IO9A 3J7A5 3S2HB 5C3XA 5DM63 3C1EA 2ZTEA 1DOMA 3TDQA 3J81c 3AYHB 1TWAH 2KHSA 1QUQA 1TWFB 3H3VI 5IGGA 4JI3Q 2F0NA 3UDFA 1EOTA 2JA7B 3RMHA 3SGIA 2KHJA 2QGQA 3J81E 2NVQH 1PH3A 5EPJA 3MEFA 3S2DH 1TQOA 5E1FA 3SR1A 5G3LD 1P16A 1DGSA 1NY4A 1BXTA 1TU2B 4UY8C 2L1BA 3RZOB 4IFDG 3E0JA 2JA8H 1MI2A 1VMPA 1YIJA 1B9MA 1YNJC 2FMCA 2I5LX 1Y1WH 1HNWL 1V1PA 3OHXC 4DV6Q 4F87A 5A2QE 2E2DC 2E2IB 5HURA 4RGTA 1K73C 5JEAJ 1LTBD 4QUFA 1WTOA 2OT2A 3P1HA 4HAEA 1S5CD 1PRTB 1UE6A 4ME3A 3HS0C 1S5DD 1TY2A 1RODA 2F0JA 2EQSA 1C8CA 1VCIA 5C4XG 5CV5A 2Q2HA 1B2TA 3N52A 1CKNA 3HP3A 1IYUA 3GDEA 4OO1H 1F9PA 1JWSD 3F8TA 1RF2D 4RG1A 4C3IG 1CHPD 4DR7L 3AB9A 2RSOA 4KD3A 2K5DA 4DR5L 3K5NA 5ELEA 3R2TA 2AHOB 4HMIA 4B9XA 4CKEA 2EXZA 3SK6A 4RFBA 4N9TA 3QJYA 2HHHQ 5EJWA 1X54A 4GOPA 4JW0A 1W6JA 3CW2C 3K0YA 2YTXA 4H7BA 2UU9Q 2F3WA 4CDFC 4F8MA 1E7ZA 1IYJB 5ELBA 1QCBD 1VQ7A 1EU3A 4HTHA 1NR4A 4G57A 2WIIB 2XWBB 1O78A 3Q6SA 3E3XA 1TWCH 4NDXA 1YHBA 1TT2A 4PZ7A 4DV0L 4PMCA 4BY7G 2Q2UA 1B50A 4KY5A 2E8GA 2L0CA 3FVQA 4A3FG 1IW7C 2YTVA 2ALYB 2DY8A 4K5VA 1LT3D 4CBVA 3M3YB 4A3BB 3BVGA 3Q0AA 1TS4A 2UUAL 1YNNC 1HUNA 2R93B 1ESRA 1SE4A 2A5HA 1STGA 1TVXA 3T51B 3EQLC 3ZYYX 4FF4A 1YZ6A 4OX9Q 1KDAA 4FDBA 2A6HC 4WORA 4K6DA 3PCOB 5ELOA 4BWGB 1N32L 3M7GA 3J80c 5JJKA 1LUZA 2B2UC 4R4OA 3FPUB 3S14B 1U4PA 2I46A 4IALA 1PH5A 3BG3A 5C4ZA 2WB1B 1X56A 4UAIA 1E24A 5EQ0A 3J80E 3K6OA 1PHJA 2RCNA 5CV6A 4XQNA 1Q46A 2Z4HA 3OSOA 1B9NA 1ET9A 2WAQG 3L3OC 1TWHB 2MNAA 1CHQD 3KBGA 5IP7H 2JA6G 3PV0A 4L63B 5FK9C 4RWSC 3HOZH 2QF7A 1I6VC 4K2LA 5FJ8H 5I6YA 3D0FA 5DLQE 1JICA 2CH4A 4ABNA 2K5QA 4NP5A 1UEBA 1KNAA 4GS3A 1W2BA 5IYBH 4BBRG 1IKLA 4IJHA 1TIID 4BY1G 1QVFA 3GTPB 2K4KA 5KEEA 1FVIA 3GD7A 4UP8A 4OWXB 3H91A 2IT1A 2H1EA 4DKAC 1UNSA 4A3KG 5FO9B 2DUDA 3J7AV 1PA6A 4UDUC 3CHBD 3F2UA 4K8JA 4ZQ3A 4JV5Q 1AEXA 5KNCA 2K5WA 4DUYL 4DAMA 1M8AA 5ELDA 2RQXA 5JPMC 1JQYD 2A73B 3M4OB 5C3EB 2BDOA 1UWVA 1RKNA 4K5WA 4XIGS 3SK8A 2UXCL 2V1CC 2B2YA 5I2XA 3AU7A 1KABA 1IBLL 4H13C 1TS2A 5IWAQ 1X6OA 4DR3L 3OW7A 3BDLA 4PMWA 3DXJC 1HXYD 3EJIA 4IUVA 4DK6C 3DWPA 3HFZB 5K5PA 4YHHL 1WTRA 4LUVA 5DM73 2QDLA 3U4VA 3T1YQ 4RGOS 3I4MB 4GKJQ 2KJXA 2F3VA 3VR4A 2CCZA 1QWYA 3NP8A 4LF6L 1LM0A 3DLLA 1XMOL 1EL0A 2UXDQ 4M8AA 2B29A 4LJZC 5C4JH 5M5YB 1MHWC 3QR8A 3OTOQ 2K50A 3UI2A 2Y0SE 2X6LA 3PSIA 4GNXA 3UDIA 3HOYH 1FJGQ 3BZKA 1EY8A 2Z0SA 3S16B 1PFSA 3NTHA 1PH8A 4BBSH 4A3DH 4FP5D 4JI0L 1EY0A 5FLMH 3A5ZB 1GOZA 1YI2A 5J22A 3KJPA 2K7VA 3K5OA 2D62A 1N8RC 3HOVB 4ZAIA 3VYUA 1TWCB 1Y69U 2RDHA 3UE0A 3I55A 4A3GB 1F2LA 1NMGA 5EKLA 1N36L 1R4PB 3NENA 3CPWA 4DXGA 2FJ2A 1D7QA 4R4QA 3EN2A 1K3RA 3NXWA 2K14A 4K6LA 3NBHB 1B4OA 4TVAB 1PDQA 4X65L 5EBDA 2EY6A 1U5KA 5D14A 2PI2A 3I7FA 1PTOH 4A3MH 5LMNQ 3LGJA 1NR2A 1VQHA 2K52A 4WFN3 1IZ6A 2WKDA 2FMMA 1CT1D 3WOFA 3TS0A 2F3IA 3M4QA 2MPMA 4JI5Q 1XNQQ 1LLRD 1K8GA 2L55A 1LABA 1SMXA 3HGBA 1GD7A 3HOUH 3QB3A 3FHWA 1I4HA 1GUNA 2MQHA 1E22A 2BCOA 1VF5C 2KCMA 3KF8A 1V43A 3GTOH 2JJQA 3Q24A 2BA0A 1KAAA 3G48A 1LT5D 5T1GA 4DGZA 4HIOA 3OYYA 3D4WA 4YWMA 5JVG3 4NXNL 3MC0B 1IBKQ 1AP0A 4JCVE 2A74C 5JEAH 5D3IB 1STYA 4GOPC 5M3MB 4HJAA 1YJ9A 3QO2A 2IX1A 5M3FG 2JA5G 4A3IH 1K8MA 3E9HA 2N49A 5KYLA 3AEVA 4IFDI 1X32A 2A8VA 2ZXRA 4B3SQ 3MAQA 2VQFL 3K80C 3KUPA 1X9NA 1SNDA 1TS5A 1EZ8A 4Y52H 2XTIA 4JI2Q 2B3GA 3PIOA 1D1KA 4DV3L 2LS01 1I4GA 1XX8A 5K36G 1KQSA 1AE2A 3MZ5A 1WTXA 5C44B 1CZGA 2MO0A 2EYOA 4R8IA 4APVA 3GTJH 3NWSA 4KMUC 2MFIA 4CDEC 1ICWA 3FPPA 2ZT9C 1Q8IA 2EPBA 2F0OA 4LFCL 3DM3A 4ZUIA 1V1OA 1AN8A 2MP1A 5JJIA 5M5XB 5ELFA 3V96A 1YBYA 1XYIA 2NN6I 5GAEC 4FF3A 5IGCA 2SOBA 3E9IA 4HIMA 4OWWB 1VQAA 1LTAD 5E4WC 1VQ9A 2E2JB 1SJED 4TQUS 1P8LA 3U50C 4C2MB 3S2HH 1BVSA 2PQAA 1ENFA 1G8ZD 3PIP3 1HA6A 4DR6L 5D3DA 1K8AC 1DXMA 4GLXA 1TWFH 2KEDA 2ZM6L 3RZDB 2JA7H 5IGBA 3X3MA 2PI2E 3LWEA 5C4JB 1JJ2A 1DOKA 4M1UB 1V1QA 4TKOB 4UPAA 4K0KQ 3BVMA 5CBEE 3K57A 5C4HA 3CD6A 1ONLA 1B53A 5IP9G 2F0HA 3WOEA 1UE1A 4QIWE 1IL2A 2PYKA 2Q8RE 3CKIB 4G4KA 1IKMA 1E0BA 2AWOA 4RHRA 4AIMA 1RIPA 3CP0A 1JMCA 3AFPA 3OIQA 3F2BA 2PZTA 1K83B 4JBJA 5BR8Q 4C3JB 5AJ3L 1IBML 1AFPA 1QUQB 3L2PA 4L5RC 3S17B 1T5XD 3FKIH 2B2YC 3K59A 2F0EA 4BXXG 4DN4M 3MXPA 1K0SA 4ZLTF 1SYGA 4A93G 1STNA 4RAUC 5J3BA 4C1NK 4LK1C 1OXUA 3C3LA 4X62Q 3ER0A 4X66Q 1EIHA 4CJ0B 2Z1CA 1B70B 1SYEA 1WCMG 3J7ZC 1I4PA 1PH6A 1MD2D 1V1PB 4JI7Q 2IWHA 2F0DA 1VQBA 2LY7A 1C4QA 4LF8L 1I4RA 1JCKB 4JI1Q 2N3SA 4OWTB 2UUBQ 1VQ4A 2YV5A 1B3AA 3OWEB 4DK1A 1RTOA 5LMUL 4IOAA 2F0KA 2F0VA 3M4PA 5J1ZA 1CQFA 2F0LA 3GTOB 5KIXA 3SVMA 3NSWA 1WOCA 4LF7L 1AH9A 2EVBA 1VQJA 2CQOA 3KLSX 3NELA 4GNXC 4KTAA 2RBMA 1CKNB 4GN3B 3VA7A 1YJWA 3NBIA 3T1HL 4JYAQ 4A3BH 4DV2Q 1M90C 3M3YH 3A7AB 1Q81C 1YHAA 1NJIC 1JJCB 5FO7B 5IGFA 4A75A 4A3EG 5C4XB 4ZK9B 4DNIA 4F7XA 1JE4A 4GOPB 4JI8Q 4ALPA 2VUMH 3MXGA 5DAUA 3VYRA 3T56B 1Q1EA 3PQIA 1EWCA 4DK3C 1NUCA 2HCIA 4RMFA 1HQRD 3SDZA 4C3IB 5JJZA 1D5ZC 4K8IA 3IAYA 2IX3A 1O7YA 4OONA 1XMQL 3GO5A 3S14H 5IYCG 2L9HA 3P20A 4OGQC 5IGEA 1SXTA 4UHVA 1CQVA 3C1FA 4BS9A 4TSSA 4KY7A 3QOJA 4O1NA 5ELCA 4EQ5A 1N34L 3P75A 1STBA 3K5LA 1TWHH 5H1SE 2AKWB 4DPGA 5FOBB 4GN4B 4JI6Q 3H3VH 2CW0C 3HEJA 1O7IA 4NKLA 2UUCL 4BY7B 4CKCA 1D2BA 4IUPA 4N8X1 3KLRA 1SRUA 1SE8A 4A3FB 4R1JA 2QA4A 3MA2B 1HNXL 1VQCA 4JK1C 1J8IA 5LHY1 5I4DA 4HJ5A 2F1MA 1KNEA 2RDFA 1K0RA 2KCNA 3L0OA 1KD1C 3DMUA 3GTPH 2IHFA 4XDXA 4EX5A 1LYLA 2E2HH 3GTMB 3JAML 1B44D 3MFGA 4ZRZA 1II3A 2E5LL 4B3RL 4LFAQ 1H9MA 3TREA 1XPUA 1VQIA 1NTGA 2HIVA 3M4OH 5LL6S 1E1OA 5C3EH 4O42A 3IKJA 2K5NA 1L0YB 2AQ2B 2CWPA 3TP8A 1DCZA 3A8KE 4IFDJ 4B3MQ 1SMYC 3D8GA 3TS2A 1A3VA 3T1YL 4QMGA 2WAQB 4LF5Q 1NBWA 3NWTA 2IPKD 2QILA 1C7YA 1MIUA 3VYTA 1Y1VG 2B63G 2JA6B 4AYBG 5IT9c 4B3TQ 1JOKA 3ULJA 2O4XA 1H9SA 4IPDA 2E75C 1FYCA 5EBCA 3GV3A 1EY7A 1WTQA 5KGUA 5IT9E 1DJRD 1VQPA 3F2CA 5GROA 1JT8A 4UP9A 2MHVA 3I4MH 1I5FA 5IE8A 2R61A 1HPCA 3FKIB 1K9MC 3H09A 4RCNA 4BBRB 4EVOA 3CPFA 2FXQA 2XRQD 2CQAA 4DV7L 5COYA 3PUWA 1OO9B 2NN6G 4GKKL 5NUCA 2BDNA 5M5YH 2R3ZA 3E0EA 4A4IA 1A15A 1OXVA 4ZKCB 2N55A 1GO3E 2FFKB 3S16H 1I94Q 3G6EA 1EZ6A 2NVXB 3CC2A 2IW3A 2EYLA 3SXHA 1IYVA 4DR4L 4C3HH 2B8GA 4YCWA 3QWNA 1EIYB 1DOLA 2SNMA 3HOVH 1XTDA 4DUZQ 1Q12A 3MTSA 1PZID 3BS1A 4LF9Q 3FEWX 4A3GH 2JQOA 2MGSA 3HZXA 2ZJPA 2K01A 1PVOA 5GAHC 1LT4D 5CV9A 3T13A 1A2UA 1BOSA 1F9QA 4ZKBB 1FL0A 4HR7B 3JAMc 4DV5Q 4GNXB 4IUUA 1E1TA 3M4YA 1Q90A 1FGBD 3C46A 1X3FA 4R8NA 1EFWA 1VMCA 1L1OC 1AW7A 3JAME 2WACA 2GVBA 4IUNA 2VUMB 3UDGA 4FO2A 1KXLA 2WV6D 5HGTA 2HQEA 5J39A 1BO0A 4X3KA 4Y7NB 2NUCA 2O5JC 1XNRL 1Y8PB 2R7ZG 1PH2A 1R9TB 5JAVA 5BN5A 1LTID 1G2SA 4HIKA 2R92G 3HKZE 2F0MA 4LWCA 3KLWA 5C6AA 1UAPA 5C0XG 3MXUA 4X64L 2C9OA 5G3LF 2PNRC 4RCOA 1J9OA 4IPCA 4LUZA 4LF4L 4JOIA 2K33A 1U9RA 1SJHD 2F4VL 2O5IC 3OMGA 3OW2A 4KI0A 3K58A 3EIVA 2CVRA 4KD4A 4B9WA 5M3MH 1A8VA 4DR1Q 1AE3A 2SNSA 2A69D 3PUXA 2ATWA 2IHEA 4XYQA 3ND9A 5EKIA 4DV4L 3K8AA 2NBFA 1JB3A 2EYPA 1F9RA 2Q2TA 2K5VA 4QIWB 2OEOA 4AYBE 3KF8B 1TWGB 2EIFA 2EYFA 2E2HB 3BZDB 5KNBA 3A54A 3PO2G 5C5LA 1CTMA 2BE5D 1FR3A 3AFQA 4DU9A 5C44H 1I6HH 3J7AF 2F0GA 3M85A 3CRLC 4CDDC 5IYDG 3VR5A 4KN7C 1JWUD 2BOSA 1RHPA 2HCCA 3NPPA 4MIUA 5FLXL 1BBWA 1F2MA 4A3CH 3A55A 1YJNA 1CKOA 3KFUA 1VDZA 1CKMA 4DV1L 5M5XH 3PGZA 1HNZL 2JXMB 4I65A 1TKWB 4LFBL 4MTKA 1J5EL 3I4NG 1HZ9A 2E2JH 5M3FB 3HOWG 3NE5B 1KDCA 3K7AB 2F52A 3MXNA 1RDPD 2HDMA 4C2MH 1A3TA 1PH1A 3SE0A 1JR0D 1MBYA 1PFNA 4DR2L 2LXJA 4S3SA 3EROA 1MJEA 1TS3A 4NW2A 1CSPA 3W1GA 2NYZD 3CAMA 1XPRA 2OTJA 1EU4A 4L5QA 2BE5C 2L11A 1F9SA 3PO3G 5EKKA 3RZDH 4KHVA 2H4OA 3I2ZA 1QILA 5GQOA 1HR0L 3KBXA 1PZKD 1V9PA 4KHPL 1PTOD 1HNWQ 1PYBA 4OEMB 4DFAA 4A3JG 2R93G 3RNUA 4C3HB 3HOXG 4A3LG 1KTKA 1NCVA 2KHIA 4N8FA 3J81i 3MFYA 3CCUA 1EY4A 2G5DA 2BA1A 1EWIA 3M9BA 2PQAB 4H0LC 4X3UA 3H0GG 1K83H 1ENCA 4KKUA 2Q2IA 4C3JH 2A6ED 2XWJB 4JVZA 4G7ZC 4JPBW 2EY5A 4AQYL 3S17H 2Z6BA 3U58A 4MNOA 4PMBA 4MN3A 1L0XB 2WAQE 4GLVB 2XVSA 1YITA 4DR7Q 2MUYA 5CV7A 1HHVA 3TSSA 3V2TA 1QOHA 2VXWA 4DR5Q 5E4XA 4NXML 1WFQA 5LMNW 3CU7A 2IY5B 3SEBA 3ULLA 2AQ3B 4PZ6A 5JVH3 1QNKA 1X3QA 3TZDA 4DAYA 2AUJD 3X3NA 4FF1A 2Q8IB 3BYTB 4A76A 4LMQD 2NVYH 2PW7A 4IFDH 1KRSA 1S5FD 3VA5A 4IJLA 1G2TA 1ZYRD 2G9DA 4DV0Q 1XTCD 2K6AA 3TP6A 3KF6A 1ZKOA 1EYAA 3A8JE 3KDFA 2PQEA 1LTGD 1BNZA 1SBBB 4QGUA 2A6EC 1B7YB 4ZCKA 5T1IA 1SFOH 1WTVA 2MJ8A 3BYYB 1BCPD 4JI4L 3R3OA 4K2KA 2OQ0A 2UUAQ 3V05A 3S1QB 2SDFA 2IL8A 5C4XH 1ET6A 1DD2A 2JA8G 2RSNA 4V0BA 1EYCA 1Y1WG 2OF1A 1S5BD 1N32Q 4A93B 3RUZA 2PZUA 4LAAA 4C3IH 3I73A 2VQEL 2C35B 1WCMB 4X3SA 1U0LA 1X3PA 2CWAA 1C9OA 2R6GA 1Q3LA 1I6HB 4YWLA 1CA6A 1A3UA 2D0OA 2UXBL 2ICIA 1LTSD 2D5DA 2IX0A 1W6KA 1OXTA 4OO1G 4V190 2VB3X 4IURA 1Q82C 3VDYA 3J80i 2YTYA 5C3WA 3PIPA 1BCPC 4BY7H 2Z6KA 4ULLA 3STBD 3I70A 3CMEA 4JI3L 4A3FH 3QOLA 4QL5A 1A0IA 2QEJC 5I2YA 3I72A 1VS0A 3U9OA 4U68A 1I50B 1G91A 3D6WA 4EGVA 1SNMA 1GUTA 3DEOA 5F2DA 2QKIC 2D9UA 4JOIC 4LF5L 1PRTD 2LXKA 2DNEA 4DUYQ 4DV6L 3GTMH 1G6ZA 3I91A 2QCPX 3I90A 5CR3A 4L5SA 1EY5A 2A68D 5FKAC 4ZYSA 1Z9FA 1D5MC 2UXCQ 3KK7A 4H02A 1IBLQ 2B2WA 3A74A 2AQ1B 5DEHA 1UE5A 5CYUA 3GP7A 1VQ5A 4ID6A 4XT1B 3ERQA 4RH6A 1EWHA 1SAPA 4DR3Q 1UE7A 2JA6H 1U4RA 4JBKA 5I9OA 3I4LA 2KVMA 1L1OA 3H94A 1JJGA 3QG1A 1KIXA 4YHHQ 1TR5A 1LTRD 1CSQA 2XN9C 1HR0W 1PH4A 1I94L 1STHA 2RHSB 3HKZB 2HHHL 1HTPA 4LF6Q 2NZ1D 1TXYA 1BCPF 4BBRH 4P2CB 4CJ2C 3PF5A 5ISRA 1XMOQ 2NZOA 4P73A 3TMEA 2UU9L 4G7HC 4BY1H 2ZTCA 5KRUA 5C0XI 1Y8NB 5IP7G 3S1MB 1L0WA 1IL8A 4A3KH 3HOZG 4DAVA 1IHZA 2EJMA 5FJ8G 4KV6A 2HT1A 3KJOA 2AUKA 3S15H 4JI0Q 3J7YW 2NVXH 3A7LA 2NTTA 1EQVA 1H9SB 3NUCA 1B3QA 5IYBG 4DV5L 2NVYB 3ONAB 4WJ3M 4Q0FA 4KLKA 3MWYW 4LNQA 2B63B
chains in the Genus database with same CATH topology
1Y1VB 5EPKA 4AYBB 1BDOA 4GZYC 1ENAA 5I9PA 1SFOB 1K8OA 2AWNA 2F0TA 3O13A 3J81L 4HN7A 2PO4A 3SHLA 3E5SA 1SEBD 1Z6HA 4DF7A 2EYMA 3D31A 5A2QL 4ILWA 3AMUA 4HCSA 4KJOA 3S1RB 2Z4IA 1RCVD 3SK5A 1F2YA 4C56C 5IOCA 2D2CC 4I7ZC 4DNTB 1HUMA 1JOQA 4RKLA 1GUOA 3I8ZA 1Q1BA 1LT6D 1EIGA 1JOOA 1JC7A 2KA7A 3ITPA 1SNCA 3NHHA 1HCZA 1STAA 4CGYB 2F0WA 1XXGA 4X3TA 3A8IE 1QE6A 2F0IA 1AZQA 1SYDA 1KDBA 4RKBA 3GTQB 2ICEC 1YNJD 4RHSA 3G7LA 1F2ZA 4J1MA 2SEBD 3IFTA 1HQMC 1ILPA 2VB2X 4K5XA 4G7OC 1FNUA 4N9PA 1PYWD 1STEA 1B1ZA 2JYOA 3D4RA 3W2DA 2R92B 1S4ZA 1BR9A 2F03A 3I3CA 1OXXK 1DM0B 4IUQA 2GA4B 1WTWA 3GQBA 3VR3A 4XXEA 2RKSA 2RDGA 3NQTA 4HSPA 3DEPA 3TP5A 3KLSA 2RVLA 3J80L 3T16A 1RD9D 1TY0A 3NTKA 4F88A 5CGKA 4BY1B 1NSNS 1OXSC 4A3KB 1GUWA 5JEAG 4H44C 3K5MA 1Z47A 2DY7A 3PO2B 1MGSA 5K36H 2YYZA 3NQIA 1FNVA 2KEEA 2NWGA 3S15B 1IW7D 3CRKC 4IZ8A 2KECA 2HDLA 5I6WA 1DYQA 3R8BA 4XT3B 3PMFA 2J4XA 1FD7D 3Q22A 1YNND 2ID0A 1PXUA 1GUSA 4BA1I 2A6HD 1D1IA 5KNDA 4QUCA 1GHKA 3I4NB 4L6TB 3MHBA 1E2ZA 2J0TD 1EFID 2J7ZA 5TSSA 2Z8LA 2B2WC 2YU9B 4FXDA 3LWUA 3HOWB 1AZPA 2PCFB 4J6HA 1HA5A 1ESFA 3T53B 4ZUJA 1RJTA 2NVTB 4OO1I 3PO3B 1KLUD 5JOBA 4RA8A 1F77A 1BF4A 4FVMA 1I4QA 5CORA 4DAPA 3EA6A 3BDOA 3ND8A 5E3FA 1S5ED 4HCEA 3TZUA 2F4IA 5C0XJ 4A3JB 1CA5A 3HOXB 3URYA 3EFXD 5M9OA 3RD4A 3CQZB 1I3QB 1HRJA 3OIPA 1WD1A 1GJXA 1BBXC 3FMCA 4HMJA 3H0GB 1H9JA 2B2VC 5BN4A 4B08A 3R93A 3EVQA 3GTKB 3GV6A 1U4LA 3GTGB 5AFWA 3D4DA 3S9WA 1C48A 3WDNA 1CZWA 2HUGA 2PPBC 5A35A 3GTLB 1QNUA 5CC4A 3N6RA 4HEDA 1WTPA 2TMPA 3LX0A 3H6MA 1ILQA 3BVZA 1R4QB 1WD0A 3DM1A 1EY9A 5M5WB 2F0QA 4IUTA 3MEHA 3NTIA 1PMRA 2VNUD 1NAPA 4FXGC 2F0SA 4ME5A 1PFBA 1EEFD 1TWAB 4HSVA 3TP7A 1BQQT 2C5CA 3L7ZC 2A69C 2JP1A 2NVQB 1SSOA 3FRPB 1MSHA 4CJ1B 3D6CA 3VYSA 3S2DB 2XNAC 4KY6A 1H9KA 3MVVA 4QF4A 2JA5B 2JA8B 2I07B 4OIJA 2N88A 5FO8B 1Y1WB 1D5XC 3HRZC 3DWQA 2K32A 5LL6X 4QCLA 4DXFA 2EYHA 2QDBA 2WINB 1GHJA 1E2VA 4XQQA 1SE2A 2B8FA 1EYDA 1SNQA 2Q8TA 4DNRB 3S1NB 5C5MA 2EJFC 1M4VA 2F0UA 4PV1C 2K04A 1QJOA 2O2LD 4CHTB 1SDFA 4TRDA 4Q5VA 3VR2A 4Z9CB 2L4NA 3R2IA 2B2TA 1PTOC 4L8JA 3PUZA 2XIWA 3PUYA 5FLXE 1EEID 2M00A 1PLFA 4DK0A 5IODA 1KLGD 1U4MA 2L5TA 1JWMD 4FYDA 2F0FA 1CM9A 2PW5A 2DN8A 4FNFA 4IQZA 1PFMA 5IGDA 4WJWA 1EQTA 3OOCA 2V4DA 3G6JB 1VF7A 4OHJA 5CV4A 2KQ3A 3Q23A 2NN6H 2M2LA 3HOZB 2EZVA 3M7NA 3QIAA 5CMDA 1QG7A 3U9SA 3DUZA 3SK4A 2JSOA 1ZYRC 3DHQA 3VR6A 4KKTA 2KOLA 1G291 2ZXPA 2EJGC 2EOTA 4KHZA 1PTOF 2X69A 1UEAB 1D6EC 2KCCA 2L12A 5KYIA 1JORA 2KUMA 1O7ZA 1DZ1A 2NB0A 2EE1A 1T5EA 4YIJA 1QB5D 2RA4A 4NMZA 5EGTA 4C3HG 3TBIB 4A3EB 3P7JA 3HG9A 2FINB 4KN4C 3PIO3 3NK9A 3TN2A 2JEBI 4RGNA 4C1NI 1EY6A 5CV8A 3IFDA 3FDTA 1HFGA 3RLFA 1ZEQX 1ML0D 5DNFA 4KK7A 2LMCB 4OL7A 5C0XH 2XSCA 4JBWA 3OMCA 2LKVA 2EY1A 1GUGA 4RGMA 1MSGA 2XRSD 3NBHA 4CKBA 4R9WA 2F0PA 1CFMA 4ODGA 2G9HD 3HOYB 2JE6I 1SYBA 4BBSB 4A3DB 1LO5D 1SYFA 3OWFA 2PMZB 1HFNA 2IJ0A 1ZXTA 4J8QA 3PUVA 4E6IA 1PRTC 2ZXOA 4BA2I 3IL8A 2FHTA 5EPLA 2E74C 1FNWA 2A68C 1O80A 1V8QA 1UUPA 3C2PA 1CI3M 2B2UA 1LTTD 4PQXA 2B2VA 1WVLA 2JEAI 1SNOA 3T4AC 1SYCA 4FXKC 1PTOB 4A3MB 2EY2A 1E2WA 2TSSA 3L9AX 2K28A 5CBAE 4FF2A 1O7LA 3HOUB 4IN3A 3BDCA 3A56A 5JPNC 4EQOA 2K03A 3DWAA 3D3RA 4MHEA 2CW0D 2E76C 2X6GA 4EQPA 2ENBA 1PRTF 1LACA 1BUVT 4OIKA 4PNYA 4K14A 3OPOA 5IT9L 4A3IB 2LFNA 2DNCA 4XYOA 2WKCA 4XQJA 2K05A 1Z7TA 1A6XA 1DONA 1PZJD 3LNNA 4KJNA 2B2TC 1I4XA 4XTCS 4EQNA 3E6ZX 4U673 3H3VC 1SE3A 5BN3A 4QB4A 2B39A 4DA2A 1A2TA 3GTJB 2OXPA 1BCPB 4KKSA 2EDGA 1SMYD 2EYJA 5D65A 1SNPA 2PZWA 1GXDC 1H9RA 1RTNA 1CK1A 2Y0SB 4WRDA 2NTSA 1HTLD 2K1BA 1Y8OB 1XWEA 1LV9A 2M9VA 3W3AA 2WP8J 4C3JG 2R7ZB 2CHBD 5IIFA 3S2HB 5C3XA 5DM63 3C1EA 1DOMA 3TDQA 2KHSA 1TWFB 5IGGA 2F0NA 1EOTA 2JA7B 3RMHA 3J81E 5EPJA 1TQOA 5E1FA 3SR1A 5G3LD 1BXTA 1TU2B 2L1BA 3RZOB 4IFDG 3E0JA 1MI2A 1VMPA 1B9MA 1YNJC 2FMCA 1V1PA 3OHXC 4F87A 5A2QE 2E2DC 2E2IB 5HURA 4RGTA 5JEAJ 1LTBD 4QUFA 1WTOA 2OT2A 3P1HA 4HAEA 1S5CD 1PRTB 3HS0C 1S5DD 1TY2A 1RODA 2F0JA 1C8CA 1VCIA 5CV5A 1B2TA 3N52A 3HP3A 1IYUA 4OO1H 1F9PA 1JWSD 1RF2D 4C3IG 1CHPD 3AB9A 2RSOA 4KD3A 2K5DA 3K5NA 5ELEA 3R2TA 4B9XA 4HMIA 4CKEA 2EXZA 3SK6A 4RFBA 4N9TA 3QJYA 5EJWA 1W6JA 3K0YA 4H7BA 2F3WA 4F8MA 5ELBA 1QCBD 1EU3A 4HTHA 1NR4A 4G57A 2WIIB 2XWBB 1O78A 3Q6SA 4NDXA 1TT2A 4PMCA 1B50A 4KY5A 2L0CA 3FVQA 1IW7C 4A3BB 2DY8A 4K5VA 3M3YB 1LT3D 4CBVA 3BVGA 3Q0AA 1TS4A 1YNNC 1HUNA 2R93B 1ESRA 1SE4A 2A5HA 1STGA 1TVXA 3T51B 3EQLC 3ZYYX 4FF4A 1KDAA 2A6HC 4WORA 4K6DA 4BWGB 3M7GA 2B2UC 3FPUB 3S14B 1U4PA 2I46A 4IALA 3BG3A 5C4ZA 2WB1B 4UAIA 5EQ0A 3J80E 3K6OA 5CV6A 4XQNA 2Z4HA 3OSOA 1B9NA 1ET9A 3L3OC 1TWHB 1CHQD 3KBGA 3PV0A 4L63B 5FK9C 4RWSC 2QF7A 1I6VC 4K2LA 5I6YA 1JICA 4ABNA 2K5QA 4NP5A 1KNAA 1IKLA 1TIID 3GTPB 5KEEA 3GD7A 2IT1A 2H1EA 3H91A 1UNSA 5FO9B 3J7AV 4UDUC 3CHBD 3F2UA 4K8JA 4ZQ3A 1AEXA 5KNCA 2K5WA 1M8AA 5ELDA 2RQXA 5JPMC 1JQYD 2A73B 3M4OB 5C3EB 2BDOA 1RKNA 4K5WA 4XIGS 3SK8A 2B2YA 5I2XA 3AU7A 1KABA 4H13C 1TS2A 3OW7A 3BDLA 4PMWA 3DXJC 1HXYD 3EJIA 4IUVA 3DWPA 5K5PA 1WTRA 5DM73 4RGOS 3I4MB 2KJXA 2F3VA 3VR4A 1QWYA 3NP8A 1EL0A 4M8AA 4LJZC 5M5YB 3UI2A 2X6LA 1EY8A 3S16B 3NTHA 4FP5D 1EY0A 1GOZA 5J22A 2K7VA 3K5OA 2D62A 3HOVB 4ZAIA 3VYUA 1TWCB 1Y69U 2RDHA 4A3GB 1F2LA 5EKLA 1R4PB 4DXGA 2FJ2A 3NXWA 4K6LA 1B4OA 1PDQA 5EBDA 2EY6A 5D14A 1PTOH 1NR2A 4WFN3 2WKDA 2FMMA 1CT1D 3WOFA 3MWYW 2MPMA 1LLRD 2L55A 1LABA 3HGBA 3QB3A 1I4HA 1GUNA 2BCOA 1VF5C 3KF8A 1V43A 3Q24A 2BA0A 1KAAA 4DGZA 1LT5D 5T1GA 3D4WA 5JVG3 3MC0B 1AP0A 2A74C 5JEAH 5D3IB 1STYA 5M3MB 3QO2A 2IX1A 1K8MA 5KYLA 4IFDI 1X32A 2ZXRA 3MAQA 3KUPA 1SNDA 1TS5A 1EZ8A 1D1KA 2LS01 1I4GA 1XX8A 5K36G 3MZ5A 1WTXA 5C44B 1CZGA 2EYOA 4R8IA 3NWSA 4KMUC 1ICWA 3FPPA 2ZT9C 1Q8IA 2EPBA 2F0OA 4ZUIA 1V1OA 1AN8A 2MP1A 5M5XB 5ELFA 3V96A 1XYIA 2NN6I 4FF3A 5IGCA 2SOBA 1LTAD 5E4WC 2E2JB 1SJED 4TQUS 4C2MB 1ENFA 1G8ZD 3PIP3 1HA6A 5D3DA 1DXMA 2KEDA 3RZDB 5IGBA 3X3MA 3LWEA 5C4JB 1DOKA 4M1UB 4TKOB 3BVMA 5CBEE 3K57A 5C4HA 1ONLA 1B53A 2F0HA 3WOEA 2PYKA 2Q8RE 3CKIB 4G4KA 1IKMA 1E0BA 2AWOA 4RHRA 3OIQA 2PZTA 1K83B 4C3JB 1AFPA 3S17B 1T5XD 2B2YC 3K59A 2F0EA 4DN4M 3MXPA 1SYGA 1STNA 4RAUC 4C1NK 4LK1C 1OXUA 3C3LA 1EIHA 4CJ0B 2Z1CA 1SYEA 1I4PA 1MD2D 1V1PB 2IWHA 2F0DA 2LY7A 1C4QA 1I4RA 1JCKB 1B3AA 3OWEB 4DK1A 1RTOA 2F0KA 2F0VA 5J1ZA 1CQFA 2F0LA 3GTOB 5KIXA 3SVMA 3NSWA 2EVBA 3KLSX 4KTAA 2RBMA 3VA7A 3NBIA 3A7AB 5FO7B 5IGFA 5C4XB 4ZK9B 4F7XA 1JE4A 3MXGA 5DAUA 3VYRA 3T56B 1Q1EA 1EWCA 3SDZA 1NUCA 2HCIA 5JJZA 1HQRD 4C3IB 1D5ZC 4K8IA 3IAYA 2IX3A 1O7YA 3GO5A 2L9HA 3P20A 4OGQC 5IGEA 1SXTA 1CQVA 3C1FA 4BS9A 4TSSA 4KY7A 3QOJA 4O1NA 5ELCA 3P75A 1STBA 3K5LA 5FOBB 2CW0C 3HEJA 4NKLA 4BY7B 4CKCA 1D2BA 4IUPA 3KLRA 4A3FB 3MA2B 4JK1C 1J8IA 5LHY1 5I4DA 2F1MA 1KNEA 2RDFA 2KCNA 3DMUA 4XDXA 3GTMB 3JAML 1B44D 3MFGA 4ZRZA 1II3A 1H9MA 5LL6S 4O42A 3IKJA 1L0YB 2AQ2B 3TP8A 1DCZA 3A8KE 4IFDJ 1SMYC 3D8GA 1A3VA 4QMGA 2WAQB 3NWTA 2IPKD 2QILA 3VYTA 2JA6B 1JOKA 2O4XA 1H9SA 2E75C 1FYCA 5EBCA 3GV3A 1EY7A 1WTQA 5KGUA 5IT9E 1DJRD 2MHVA 2R61A 1HPCA 3FKIB 3H09A 4RCNA 4BBRB 4EVOA 2XRQD 2CQAA 5COYA 3PUWA 1OO9B 2NN6G 5NUCA 2BDNA 2R3ZA 1A15A 1OXVA 4ZKCB 2N55A 2FFKB 1EZ6A 2NVXB 2IW3A 2EYLA 3SXHA 1IYVA 2B8GA 3QWNA 1DOLA 2SNMA 1Q12A 3MTSA 1PZID 3BS1A 3FEWX 2MGSA 3HZXA 2K01A 1LT4D 5CV9A 3T13A 1A2UA 1BOSA 1F9QA 4ZKBB 4HR7B 4IUUA 3M4YA 1Q90A 1FGBD 3C46A 4R8NA 1VMCA 1AW7A 3JAME 2WACA 4IUNA 2VUMB 4FO2A 2WV6D 5HGTA 2HQEA 5J39A 1BO0A 4X3KA 4Y7NB 2NUCA 2O5JC 1Y8PB 1R9TB 5JAVA 5BN5A 1LTID 1G2SA 2F0MA 5C6AA 1UAPA 5C0XG 3MXUA 2C9OA 5G3LF 2PNRC 4RCOA 1J9OA 2K33A 1U9RA 1SJHD 2O5IC 3OMGA 4KI0A 3K58A 2CVRA 4KD4A 4B9WA 2SNSA 2A69D 3PUXA 4XYQA 3ND9A 5EKIA 2NBFA 1JB3A 2EYPA 1F9RA 4QIWB 2OEOA 1TWGB 2EYFA 2E2HB 3BZDB 5KNBA 3A54A 5C5LA 1CTMA 2BE5D 1FR3A 4DU9A 3J7AF 2F0GA 3M85A 3CRLC 3VR5A 4KN7C 1JWUD 2BOSA 1RHPA 2HCCA 3NPPA 4MIUA 5FLXL 1F2MA 3A55A 1VDZA 2JXMB 4I65A 1TKWB 5M3FB 3NE5B 1KDCA 3K7AB 1RDPD 3MXNA 2HDMA 1A3TA 3SE0A 1JR0D 1MBYA 1PFNA 4S3SA 3EROA 1TS3A 4NW2A 2NYZD 1EU4A 2BE5C 2L11A 1F9SA 5EKKA 4KHVA 2H4OA 1QILA 3KBXA 1PZKD 1PTOD 4DFAA 4C3HB 1KTKA 1NCVA 3MFYA 1EY4A 2BA1A 4H0LC 4X3UA 1ENCA 4KKUA 2A6ED 2XWJB 4G7ZC 2EY5A 4PMBA 4MN3A 1L0XB 2XVSA 2MUYA 5CV7A 1HHVA 3TSSA 3V2TA 1QOHA 2VXWA 5E4XA 3CU7A 3SEBA 2AQ3B 5JVH3 1QNKA 1X3QA 3TZDA 4DAYA 2AUJD 3X3NA 4FF1A 2Q8IB 3BYTB 4LMQD 2PW7A 4IFDH 3VA5A 1S5FD 1G2TA 1ZYRD 2G9DA 1XTCD 2K6AA 3TP6A 1ZKOA 1EYAA 3A8JE 2PQEA 1LTGD 1BNZA 1SBBB 2A6EC 5T1IA 1WTVA 2MJ8A 3BYYB 1BCPD 3R3OA 4K2KA 3V05A 3S1QB 2SDFA 2IL8A 1DD2A 1ET6A 2RSNA 4V0BA 1EYCA 2OF1A 1S5BD 4A93B 3RUZA 2PZUA 4LAAA 3I73A 1WCMB 4X3SA 1X3PA 2R6GA 1Q3LA 1I6HB 1CA6A 1A3UA 2ICIA 1LTSD 2D5DA 2IX0A 1W6KA 1OXTA 4OO1G 4V190 2VB3X 4IURA 5C3WA 1BCPC 4ULLA 3I70A 3QOLA 2QEJC 5I2YA 3I72A 3U9OA 4U68A 1I50B 1G91A 3D6WA 4EGVA 1SNMA 1GUTA 3DEOA 5F2DA 2QKIC 2D9UA 1PRTD 2DNEA 1G6ZA 3I91A 2QCPX 3I90A 5CR3A 1EY5A 2A68D 5FKAC 4ZYSA 1D5MC 3KK7A 2B2WA 2AQ1B 5DEHA 5CYUA 3GP7A 4ID6A 4XT1B 3ERQA 4RH6A 1EWHA 1SAPA 1U4RA 5I9OA 3I4LA 2KVMA 3H94A 3QG1A 1TR5A 1LTRD 2XN9C 1STHA 3HKZB 1HTPA 2NZ1D 4CJ2C 1BCPF 4P2CB 5ISRA 3TMEA 4G7HC 5KRUA 5C0XI 1Y8NB 3S1MB 1IL8A 4DAVA 1IHZA 2EJMA 4KV6A 2AUKA 3J7YW 3A7LA 2NTTA 1EQVA 1H9SB 3NUCA 2NVYB 3ONAB 4Q0FA 4ZLTF 2B63B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A68 C;  3ND9 A;  3TZU A;  1LAB A;  3HGB A;  2BDO A;  4G7Z C;  3U9S A;  3SDZ A;  1E2V A;  1OXX K;  1V8Q A;  4XIG S;  1BDO A;  1H9R A;  4GZY C;  1O78 A;  3GQB A;  2B8F A;  1CI3 M;  1GUN A;  3PUW A;  4TKO B;  3VR3 A;  4H13 C;  2NN6 G;  3I72 A;  1VF5 C;  1ZYR C;  1K8O A;  3P20 A;  3VR6 A;  4OGQ C;  1V43 A;  4KKT A;  1Y8O B;  1GJX A;  3W3A A;  1G29 1;  4DNR B;  1OXV A;  2EJG C;  2JEA I;  1GUT A;  2BA0 A;  3OW7 A;  1ONL A;  5KNB A;  3FMC A;  4KHZ A;  1CTM A;  1IW7 C;  3DXJ C;  2BE5 D;  1FR3 A;  1H9J A;  5BN4 A;  2KCC A;  2DNE A;  2EJF C;  1IYV A;  2B8G A;  5JEA H;  3M85 A;  3CRL C;  1Z6H A;  3VR5 A;  1E2W A;  2CW0 C;  4KN7 C;  2AWO A;  1YNN C;  2A68 D;  3D31 A;  1OXS C;  2AUJ D;  3T51 B;  3WDN A;  3EQL C;  2Q8I B;  3VR4 A;  4PV1 C;  2PPB C;  1Q12 A;  1QJO A;  1T5E A;  2A6H C;  4IFD H;  3KLR A;  1K8M A;  5A35 A;  1VDZ A;  5JEA G;  3N6R A;  4H44 C;  1O7L A;  5K36 H;  2YYZ A;  2D2C C;  1ZKO A;  3A8J E;  2A6E D;  2JXM B;  4JK1 C;  4LJZ C;  3VR2 A;  1EWH A;  2F1M A;  1TKW B;  4I7Z C;  3BG3 A;  1TU2 B;  4DNT B;  4KN4 C;  2A6E C;  1IW7 D;  3CRK C;  4IFD G;  2JEB I;  4HR7 B;  3I4L A;  4LK1 C;  1OXU A;  3M4Y A;  1GUO A;  1Q90 A;  1YNJ C;  1B9M A;  3H94 A;  4L8J A;  1B9N A;  3NE5 B;  1Q1B A;  3PUZ A;  3QG1 A;  5K36 G;  2E76 C;  2KA7 A;  3QIA A;  1PMR A;  3PUY A;  3SE0 A;  1GUS A;  1DD2 A;  4BA1 I;  3RLF A;  4DK0 A;  4KMU C;  3PV0 A;  1HCZ A;  1LAC A;  2A6H D;  2K7V A;  3FPP A;  2ZT9 C;  1H9M A;  2D62 A;  2LMC B;  5KND A;  1HTP A;  1GHK A;  3OPO A;  2QF7 A;  2BE5 C;  1I6V C;  5C0X H;  2L5T A;  2O5J C;  3L7Z C;  1Y8P B;  4DK1 A;  3IKJ A;  4JBW A;  1E2Z A;  2A69 C;  1Y69 U;  2DNC A;  4G7H C;  1DCZ A;  3A8K E;  3A8I E;  5BN5 A;  3I73 A;  1VCI A;  3LWU A;  1SMY C;  1Y8N B;  2PCF B;  2DN8 A;  2EVB A;  2NN6 I;  1GUG A;  1Z7T A;  1A6X A;  1H9K A;  1IYU A;  4IQZ A;  5C0X G;  3MXU A;  2EJM A;  4OO1 H;  2R6G A;  3VA7 A;  3LNN A;  1CFM A;  3T53 B;  2PNR C;  2AUK A;  3IFT A;  3AB9 A;  2JE6 I;  3OOC A;  1HQM C;  3GD7 A;  4TQU S;  4XTC S;  3MFY A;  2V4D A;  3A7A B;  4G7O C;  2K33 A;  1H9S A;  4RCN A;  2IT1 A;  2E75 C;  1FYC A;  2K32 A;  3A7L A;  2O5I C;  2D5D A;  2BA1 A;  4KI0 A;  1H9S B;  1VF7 A;  5BN3 A;  3QJY A;  3D4R A;  1OXT A;  3PUV A;  5KNC A;  4OO1 G;  4H0L C;  4BA2 I;  2NN6 H;  3BDO A;  2A69 D;  4KKS A;  1DXM A;  3ND8 A;  3PUX A;  1HPC A;  2E74 C;  4KKU A;  3M7N A;  2EDG A;  3T56 B;  1Q1E A;  1GHJ A; 
#chains in the Genus database with same CATH topology
 1Y1V B;  1N36 Q;  5EPK A;  4AYB B;  1NMF A;  3CXC A;  4OX9 L;  2N78 A;  1S40 A;  1BDO A;  4GZY C;  1ENA A;  5I9P A;  1SFO B;  1K8O A;  2AWN A;  2F0T A;  3O13 A;  3J81 L;  4X65 Q;  1N33 Q;  4NB3 A;  1S72 A;  4HN7 A;  1EIF A;  2PO4 A;  3SHL A;  4O2D A;  3E5S A;  1SEB D;  1Z6H A;  4DF7 A;  2EYM A;  3D31 A;  5A2Q L;  4ILW A;  3AMU A;  3Q8D A;  1EOV A;  4Y7N H;  1NNX A;  4HCS A;  4KJO A;  1T9H A;  1K28 A;  3S1R B;  1R9T H;  2Z4I A;  2R7F A;  1RCV D;  3SK5 A;  2K75 A;  1F2Y A;  2VZA A;  1IXR A;  4C56 C;  4HJ9 A;  5IOC A;  2D2C C;  4I7Z C;  4DNT B;  1HUM A;  1JOQ A;  1LTL A;  4NXN Q;  3CCJ A;  3CQZ H;  4RKL A;  1GUO A;  3I8Z A;  2D0P A;  1Q1B A;  1LT6 D;  1EIG A;  1JOO A;  1JC7 A;  3CCV A;  1WI5 A;  2KA7 A;  3ITP A;  3CCE A;  1SNC A;  3NHH A;  2OCE A;  4YCV A;  1YEZ A;  3UE1 A;  1HCZ A;  1STA A;  3HOY G;  4JV5 L;  1PH9 A;  4CGY B;  2F0W A;  1XXG A;  2RF4 A;  4X3T A;  4BBS G;  4A3D G;  3RR5 A;  1QVG A;  5FLM G;  3A8I E;  1WTH A;  1Y14 B;  1QE6 A;  2F0I A;  2A1A A;  1AZQ A;  3A0J A;  2VQF Q;  1A62 A;  1SYD A;  1KDB A;  4RKB A;  3GTL H;  3GTQ B;  1G6P A;  2ICE C;  1YNJ D;  4YY3 Q;  4RHS A;  1TWG H;  3G7L A;  1KL9 A;  1F2Z A;  4DV3 Q;  4J1M A;  2SEB D;  4R4I A;  3IFT A;  5IWA L;  3HKS A;  1VQD A;  1HQM C;  1PH7 A;  5M5W H;  1VQL A;  1ILP A;  2VB2 X;  4K5X A;  4G7O C;  1FNU A;  4N9P A;  1PYW D;  1STE A;  1SR3 A;  1B1Z A;  4HID A;  2JYO A;  3D4R A;  1YNX A;  3W2D A;  4LFC Q;  2R92 B;  1S4Z A;  1BR9 A;  2F03 A;  3RLN A;  4GKJ L;  3I3C A;  4A3M G;  1OXX K;  1DM0 B;  4IUQ A;  2GA4 B;  3K7U C;  1WTW A;  3GQB A;  2BH2 A;  2JA9 A;  4P72 A;  3VR3 A;  1KC8 C;  2UXD L;  4XXE A;  2RKS A;  2RDG A;  3OTO L;  1J6Q A;  3NQT A;  5M3F H;  3HOU G;  1VQF A;  3K7A H;  4HSP A;  1FJG L;  2JA5 H;  3DEP A;  3TP5 A;  3KLS A;  4DR6 Q;  2RVL A;  3J80 L;  1N9W A;  3T16 A;  1RD9 D;  1TY0 A;  2I5H A;  3NTK A;  4F88 A;  5CGK A;  4BY1 B;  4AH6 A;  1NSN S;  2DJG C;  2ZM6 Q;  1OXS C;  2Z6K C;  3ERS X;  2R7D A;  4A3K B;  1GUW A;  5JEA G;  4H44 C;  3K5M A;  1Z47 A;  2DY7 A;  3PO2 B;  1MGS A;  5K36 H;  2YYZ A;  2WFW A;  3CCS A;  3NQI A;  1FNV A;  2KEE A;  2NWG A;  3EBE A;  4IPH A;  3S15 B;  1IW7 D;  3CRK C;  4IZ8 A;  3CC4 A;  4A3I G;  2LSS A;  2KEC A;  2HDL A;  5I6W A;  1DYQ A;  3R8B A;  4XT3 B;  4J15 A;  3PMF A;  2J4X A;  1FD7 D;  3S1N H;  3Q22 A;  1YNN D;  3BU2 A;  2ID0 A;  1PXU A;  2Z9H A;  3MXN B;  1GUS A;  4BA1 I;  5LMN L;  2A6H D;  5AJ3 Q;  1D1I A;  5KND A;  1IBM Q;  4QUC A;  1GHK A;  3I4N B;  4L6T B;  3MHB A;  1E2Z A;  2J0T D;  1EFI D;  4JI5 L;  1XNQ L;  2J7Z A;  5TSS A;  2Z8L A;  2B2W C;  3ZJY C;  2YU9 B;  4FXD A;  2DGY A;  3LWU A;  3HOW B;  1AZP A;  2PCF B;  4J6H A;  3J81 j;  1VQM A;  1HA5 A;  1ESF A;  3K81 C;  3T53 B;  3WWV A;  4ZUJ A;  1RJT A;  2NVT B;  4OO1 I;  2CKZ B;  1ASZ A;  2Y0S G;  1KLU D;  3PO3 B;  5JOB A;  4LF8 Q;  4RA8 A;  1F77 A;  1BF4 A;  4FVM A;  4P71 A;  1I4Q A;  5COR A;  4DAP A;  3EA6 A;  1IBK L;  2KBN A;  1ICF B;  2QEX A;  1VQG A;  3BDO A;  5LMU Q;  3ND8 A;  5E3F A;  1S5E D;  2PMZ E;  4HCE A;  3TZU A;  2P5Z X;  2F4I A;  5C0X J;  4A3J B;  1CA5 A;  4LF7 Q;  3HOX B;  3URY A;  3EFX D;  1KRT A;  3U4Z A;  5IP9 H;  5M9O A;  3RD4 A;  5GAG C;  3CQZ B;  1I3Q B;  1HRJ A;  2VS1 A;  3OIP A;  1WD1 A;  1GJX A;  3T1H Q;  4B3S L;  1VQ6 A;  2JA7 G;  1BBX C;  3FMC A;  4HMJ A;  2NZH A;  3H0G B;  4JI2 L;  1H9J A;  2B2V C;  5BN4 A;  4B08 A;  3R93 A;  3EVQ A;  3GTK B;  3GV6 A;  1U4L A;  3GTG B;  5AFW A;  3S1Q H;  4LW1 A;  3D4D A;  3S9W A;  4BXX H;  5IY0 A;  1JE5 A;  1C48 A;  1YVC A;  3WDN A;  1CZW A;  2HUG A;  2PPB C;  5HGQ A;  4DAY B;  2OWO A;  4A93 H;  5A35 A;  3GTL B;  1QNU A;  5CC4 A;  1XMQ Q;  3N6R A;  4QY7 A;  2I0Q A;  4HED A;  1QZH A;  3G71 A;  1WTP A;  2TMP A;  1WCM H;  2JN4 A;  3LX0 A;  3H6M A;  1ILQ A;  3BVZ A;  1R4Q B;  1WD0 A;  3DM1 A;  2OQK A;  1EY9 A;  3KF6 B;  5M5W B;  2OTL A;  3KDF B;  1HZC A;  1KHI A;  1N34 Q;  3ULP A;  5EAY A;  2F0Q A;  3FKI G;  4IUT A;  4YCU A;  3MEH A;  3NTI A;  1QVC A;  1PMR A;  2VNU D;  1NAP A;  2UUC Q;  3W5O A;  4FXG C;  2F0S A;  4ME5 A;  2HIX A;  1PFB A;  1EEF D;  1D8L A;  1TWA B;  1Q8K A;  4HSV A;  3TP7 A;  1BQQ T;  2C5C A;  3L7Z C;  4GLA C;  2A69 C;  2JP1 A;  1HNX Q;  1SSO A;  3FRP B;  2NVQ B;  1MSH A;  4CJ1 B;  2RCF A;  3D6C A;  4GN5 A;  3VYS A;  3S2D B;  1EQR A;  1CUK A;  2XNA C;  4KY6 A;  1I50 H;  1H9K A;  3MVV A;  4A3E H;  3CF5 A;  2L15 A;  4QF4 A;  4K0K L;  2JA5 B;  2N8N A;  2JA8 B;  4P74 A;  2I07 B;  4OIJ A;  2N88 A;  5FO8 B;  1Y1W B;  1D5X C;  1EUJ A;  1XPO A;  3CCQ A;  3HRZ C;  3DWQ A;  2K32 A;  5LL6 X;  4QCL A;  4DXF A;  2E5L Q;  4B3R Q;  2EYH A;  2MO1 A;  2QDB A;  4IOC A;  5IYC H;  3ICE A;  1K3B C;  2WIN B;  2AMC B;  4A3B G;  1GHJ A;  5HY6 A;  4IPG A;  1E2V A;  5BR8 L;  3CCM A;  4XQQ A;  1SE2 A;  2K5H A;  1L2F A;  2B8F A;  2A19 A;  1X3E A;  1EYD A;  1SNQ A;  2VUM G;  3K0X A;  2Q8T A;  4DNR B;  3S1N B;  3CC7 A;  5C5M A;  4X66 L;  3BZC A;  1X3G A;  4X62 L;  2EJF C;  1M4V A;  1EYG A;  2WB1 G;  2F0U A;  4MZ9 A;  4JI7 L;  1FGU A;  1VQN A;  4JI1 L;  4PV1 C;  1SN8 A;  2K04 A;  1QJO A;  2UUB L;  3W1B A;  2O2L D;  2ASB A;  4CHT B;  1SDF A;  4R4C A;  4TRD A;  4DV7 Q;  4GKK Q;  3S1M H;  4Q5V A;  1G51 A;  4P75 A;  3VR2 A;  4Z9C B;  2L4N A;  3R2I A;  3FP9 A;  2XGT A;  5FLX c;  4MTN A;  2VL6 A;  4LUO A;  1QZG A;  2B2T A;  1PTO C;  4L8J A;  4DR4 Q;  3PUZ A;  5ELN A;  1L1O B;  4L5T A;  3H15 A;  4JYA L;  2XIW A;  3PUY A;  5FLX E;  4DV2 L;  3KYH C;  1N33 L;  1EEI D;  3NEM A;  2M00 A;  1PLF A;  4DK0 A;  1VQ8 A;  1MJC A;  5IOD A;  2KEN A;  1KLG D;  4YWK A;  1U4M A;  2L5T A;  1JWM D;  2B63 H;  1Y1V H;  4FYD A;  2F0F A;  4JI8 L;  1CM9 A;  2PW5 A;  4JBM A;  4OEL B;  4QJF A;  2DN8 A;  1VQK A;  4FNF A;  4IQZ A;  1HJP A;  3CCR A;  1PFM A;  5IGD A;  3CCL A;  5C3E G;  2DJF C;  4WJW A;  1EQT A;  2EXD A;  4OXP A;  3OOC A;  2V4D A;  3G6J B;  3JC6 6;  1WYD A;  1VF7 A;  4OHJ A;  5CV4 A;  2KQ3 A;  5JJL A;  3Q23 A;  2NN6 H;  1XNR Q;  4JI6 L;  2M2L A;  3HOZ B;  2EZV A;  4PG3 A;  3M7N A;  3QIA A;  5GAD C;  5CMD A;  3S1R H;  1QG7 A;  4I7A A;  3U9S A;  3JAM i;  4CDC C;  3DUZ A;  3SK4 A;  2JSO A;  4X64 Q;  1ZYR C;  3DHQ A;  3I4M G;  3VR6 A;  4KKT A;  2KOL A;  3G4S A;  1G29 1;  4LF4 Q;  2ZXP A;  2EJG C;  2EOT A;  2F4V Q;  4KHZ A;  2PNH A;  2ZTD A;  2JK8 A;  1PTO F;  2X69 A;  1UEA B;  1D6E C;  2KCC A;  2L12 A;  2VY3 A;  5KYI A;  1JOR A;  4YY3 L;  2HD3 A;  2KUM A;  1O7Z A;  1DZ1 A;  4DV4 Q;  2NB0 A;  3S24 A;  4LFA L;  2EE1 A;  1T5E A;  4YIJ A;  1QB5 D;  2RA4 A;  4NMZ A;  5EGT A;  4C3H G;  1VQO A;  4R4T A;  3TBI B;  3I4O A;  4A3E B;  1VQE A;  1GVP A;  3P7J A;  4B3M L;  2KCT A;  3GTQ H;  3HG9 A;  3HOV G;  2FIN B;  4KN4 C;  3PIO 3;  2ZJR A;  3NK9 A;  3TN2 A;  2CH4 W;  3IRB A;  2JEB I;  3TRZ A;  4HJ8 A;  4A3G G;  4RGN A;  4C1N I;  1EY6 A;  5CV8 A;  4HJ7 A;  3IFD A;  2R7Z H;  4WJ4 A;  4B3T L;  3FDT A;  2GVA A;  2WB1 E;  1HFG A;  3RLF A;  1ZEQ X;  1ML0 D;  1GM5 A;  2GN5 A;  5DNF A;  2R92 H;  4QQB X;  1HZA A;  4KK7 A;  1WJJ A;  2ES2 A;  2LMC B;  4OL7 A;  2RHQ B;  1YHQ A;  5C0X H;  1HZB A;  2XSC A;  4DV1 Q;  1A63 A;  4JBW A;  3OMC A;  1HNZ Q;  2ZJQ A;  4UP7 A;  1W3S A;  4LFB Q;  2LKV A;  2EY1 A;  1J5E Q;  3STB C;  1Q86 C;  1GUG A;  4RGM A;  1MSG A;  2XRS D;  3NBH A;  1RL2 A;  3B6Y A;  1KAW A;  4CKB A;  4R9W A;  4JC0 A;  2F0P A;  1CFM A;  4JG2 A;  2G9H D;  4ODG A;  3HOY B;  2JE6 I;  1SYB A;  4NPS A;  1H95 A;  1PYS B;  4DR2 Q;  3RZO H;  4A3D B;  1LO5 D;  1SYF A;  3OWF A;  4BBS B;  2PMZ B;  1HFN A;  2IJ0 A;  1EQQ A;  1ZXT A;  4J8Q A;  3PUV A;  4E6I A;  1PRT C;  2ZXO A;  1SRO A;  4BA2 I;  3KOJ A;  3IL8 A;  2E2I H;  2FHT A;  5EPL A;  2E74 C;  1FNW A;  2A68 C;  1O80 A;  3F2D A;  3TQY A;  4DUZ L;  1HR0 Q;  4X6A H;  1V8Q A;  3PO2 H;  4LF9 L;  3PF4 A;  5M3M G;  1UUP A;  3C2P A;  1CI3 M;  4KHP Q;  2B2U A;  3BJU A;  5IYD H;  1LTT D;  4PQX A;  1HH2 P;  2B2V A;  2QW7 A;  1WVL A;  1SNO A;  2JEA I;  3T4A C;  1SYC A;  4FXK C;  2BH8 A;  2VW9 A;  1PTO B;  4A3M B;  3UDX A;  1X55 A;  2EY2 A;  4PZ8 A;  1E2W A;  2TSS A;  1ASY A;  3L9A X;  3RLO A;  1XJV A;  3I4N H;  4AQY Q;  2K28 A;  5CBA E;  4FF2 A;  5C44 G;  3RN2 A;  1PV4 A;  2YU9 H;  1O7L A;  4POF A;  3HOW H;  3HOU B;  4IN3 A;  3BDC A;  3A56 A;  5JPN C;  4EQO A;  1BKB A;  1S3O A;  4A3C G;  2K03 A;  1OTC A;  3RN5 A;  4NXM Q;  1NE3 A;  2NVT H;  3DWA A;  1C0A A;  3D3R A;  4MHE A;  3PO3 H;  2CW0 D;  2E76 C;  2X6G A;  1GKH A;  4EQP A;  2HQL A;  1MKH A;  2ENB A;  3A5U A;  1PRT F;  1LAC A;  3AQQ A;  1BUV T;  4OIK A;  4PNY A;  4DR1 L;  4K14 A;  3OPO A;  5E7N A;  5IT9 L;  1X65 A;  2I5M X;  4A3I B;  4A3J H;  2LFN A;  2DNC A;  2R93 H;  3HOX H;  4A3L H;  3F1Z A;  1E3P A;  4XYO A;  1I3Q H;  2WKC A;  4XQJ A;  2K05 A;  1Z7T A;  1A6X A;  2CFM A;  1DON A;  1PZJ D;  1M1K C;  4POG A;  3LNN A;  4KJN A;  1Q7Y C;  3TEH B;  4JI4 Q;  2B2T C;  2H5X A;  3H0G H;  1I4X A;  4XTC S;  4EQN A;  3E6Z X;  4U67 3;  4O0A A;  3H3V C;  3GTK H;  3GTG H;  1SE3 A;  5BN3 A;  4QB4 A;  2B39 A;  4DA2 A;  1A2T A;  3GTJ B;  3CMA A;  2OXP A;  3I56 A;  5L37 A;  1BCP B;  4KKS A;  2EDG A;  1B8A A;  1SMY D;  2EYJ A;  5D65 A;  1SNP A;  2VQE Q;  2PZW A;  1BBU A;  1GXD C;  1H9R A;  1RTN A;  1CK1 A;  2Y0S B;  4WRD A;  2NTS A;  1HTL D;  2K1B A;  1Y8O B;  1SLJ A;  1XWE A;  1LV9 A;  2M9V A;  3W3A A;  2WP8 J;  4C3J G;  2R7Z B;  2CHB D;  5IIF A;  2UXB Q;  3HKZ G;  1JB7 A;  4IO9 A;  3J7A 5;  3S2H B;  5C3X A;  5DM6 3;  3C1E A;  2ZTE A;  1DOM A;  3TDQ A;  3J81 c;  3AYH B;  1TWA H;  2KHS A;  1QUQ A;  1TWF B;  3H3V I;  5IGG A;  4JI3 Q;  2F0N A;  3UDF A;  1EOT A;  2JA7 B;  3RMH A;  3SGI A;  2KHJ A;  2QGQ A;  3J81 E;  2NVQ H;  1PH3 A;  5EPJ A;  3MEF A;  3S2D H;  1TQO A;  5E1F A;  3SR1 A;  5G3L D;  1P16 A;  1DGS A;  1NY4 A;  1BXT A;  1TU2 B;  4UY8 C;  2L1B A;  3RZO B;  4IFD G;  3E0J A;  2JA8 H;  1MI2 A;  1VMP A;  1YIJ A;  1B9M A;  1YNJ C;  2FMC A;  2I5L X;  1Y1W H;  1HNW L;  1V1P A;  3OHX C;  4DV6 Q;  4F87 A;  5A2Q E;  2E2D C;  2E2I B;  5HUR A;  4RGT A;  1K73 C;  5JEA J;  1LTB D;  4QUF A;  1WTO A;  2OT2 A;  3P1H A;  4HAE A;  1S5C D;  1PRT B;  1UE6 A;  4ME3 A;  3HS0 C;  1S5D D;  1TY2 A;  1ROD A;  2F0J A;  2EQS A;  1C8C A;  1VCI A;  5C4X G;  5CV5 A;  2Q2H A;  1B2T A;  3N52 A;  1CKN A;  3HP3 A;  1IYU A;  3GDE A;  4OO1 H;  1F9P A;  1JWS D;  3F8T A;  1RF2 D;  4RG1 A;  4C3I G;  1CHP D;  4DR7 L;  3AB9 A;  2RSO A;  4KD3 A;  2K5D A;  4DR5 L;  3K5N A;  5ELE A;  3R2T A;  2AHO B;  4HMI A;  4B9X A;  4CKE A;  2EXZ A;  3SK6 A;  4RFB A;  4N9T A;  3QJY A;  2HHH Q;  5EJW A;  1X54 A;  4GOP A;  4JW0 A;  1W6J A;  3CW2 C;  3K0Y A;  2YTX A;  4H7B A;  2UU9 Q;  2F3W A;  4CDF C;  4F8M A;  1E7Z A;  1IYJ B;  5ELB A;  1QCB D;  1VQ7 A;  1EU3 A;  4HTH A;  1NR4 A;  4G57 A;  2WII B;  2XWB B;  1O78 A;  3Q6S A;  3E3X A;  1TWC H;  4NDX A;  1YHB A;  1TT2 A;  4PZ7 A;  4DV0 L;  4PMC A;  4BY7 G;  2Q2U A;  1B50 A;  4KY5 A;  2E8G A;  2L0C A;  3FVQ A;  4A3F G;  1IW7 C;  2YTV A;  2ALY B;  2DY8 A;  4K5V A;  1LT3 D;  4CBV A;  3M3Y B;  4A3B B;  3BVG A;  3Q0A A;  1TS4 A;  2UUA L;  1YNN C;  1HUN A;  2R93 B;  1ESR A;  1SE4 A;  2A5H A;  1STG A;  1TVX A;  3T51 B;  3EQL C;  3ZYY X;  4FF4 A;  1YZ6 A;  4OX9 Q;  1KDA A;  4FDB A;  2A6H C;  4WOR A;  4K6D A;  3PCO B;  5ELO A;  4BWG B;  1N32 L;  3M7G A;  3J80 c;  5JJK A;  1LUZ A;  2B2U C;  4R4O A;  3FPU B;  3S14 B;  1U4P A;  2I46 A;  4IAL A;  1PH5 A;  3BG3 A;  5C4Z A;  2WB1 B;  1X56 A;  4UAI A;  1E24 A;  5EQ0 A;  3J80 E;  3K6O A;  1PHJ A;  2RCN A;  5CV6 A;  4XQN A;  1Q46 A;  2Z4H A;  3OSO A;  1B9N A;  1ET9 A;  2WAQ G;  3L3O C;  1TWH B;  2MNA A;  1CHQ D;  3KBG A;  5IP7 H;  2JA6 G;  3PV0 A;  4L63 B;  5FK9 C;  4RWS C;  3HOZ H;  2QF7 A;  1I6V C;  4K2L A;  5FJ8 H;  5I6Y A;  3D0F A;  5DLQ E;  1JIC A;  2CH4 A;  4ABN A;  2K5Q A;  4NP5 A;  1UEB A;  1KNA A;  4GS3 A;  1W2B A;  5IYB H;  4BBR G;  1IKL A;  4IJH A;  1TII D;  4BY1 G;  1QVF A;  3GTP B;  2K4K A;  5KEE A;  1FVI A;  3GD7 A;  4UP8 A;  4OWX B;  3H91 A;  2IT1 A;  2H1E A;  4DKA C;  1UNS A;  4A3K G;  5FO9 B;  2DUD A;  3J7A V;  1PA6 A;  4UDU C;  3CHB D;  3F2U A;  4K8J A;  4ZQ3 A;  4JV5 Q;  1AEX A;  5KNC A;  2K5W A;  4DUY L;  4DAM A;  1M8A A;  5ELD A;  2RQX A;  5JPM C;  1JQY D;  2A73 B;  3M4O B;  5C3E B;  2BDO A;  1UWV A;  1RKN A;  4K5W A;  4XIG S;  3SK8 A;  2UXC L;  2V1C C;  2B2Y A;  5I2X A;  3AU7 A;  1KAB A;  1IBL L;  4H13 C;  1TS2 A;  5IWA Q;  1X6O A;  4DR3 L;  3OW7 A;  3BDL A;  4PMW A;  3DXJ C;  1HXY D;  3EJI A;  4IUV A;  4DK6 C;  3DWP A;  3HFZ B;  5K5P A;  4YHH L;  1WTR A;  4LUV A;  5DM7 3;  2QDL A;  3U4V A;  3T1Y Q;  4RGO S;  3I4M B;  4GKJ Q;  2KJX A;  2F3V A;  3VR4 A;  2CCZ A;  1QWY A;  3NP8 A;  4LF6 L;  1LM0 A;  3DLL A;  1XMO L;  1EL0 A;  2UXD Q;  4M8A A;  2B29 A;  4LJZ C;  5C4J H;  5M5Y B;  1MHW C;  3QR8 A;  3OTO Q;  2K50 A;  3UI2 A;  2Y0S E;  2X6L A;  3PSI A;  4GNX A;  3UDI A;  3HOY H;  1FJG Q;  3BZK A;  1EY8 A;  2Z0S A;  3S16 B;  1PFS A;  3NTH A;  1PH8 A;  4BBS H;  4A3D H;  4FP5 D;  4JI0 L;  1EY0 A;  5FLM H;  3A5Z B;  1GOZ A;  1YI2 A;  5J22 A;  3KJP A;  2K7V A;  3K5O A;  2D62 A;  1N8R C;  3HOV B;  4ZAI A;  3VYU A;  1TWC B;  1Y69 U;  2RDH A;  3UE0 A;  3I55 A;  4A3G B;  1F2L A;  1NMG A;  5EKL A;  1N36 L;  1R4P B;  3NEN A;  3CPW A;  4DXG A;  2FJ2 A;  1D7Q A;  4R4Q A;  3EN2 A;  1K3R A;  3NXW A;  2K14 A;  4K6L A;  3NBH B;  1B4O A;  4TVA B;  1PDQ A;  4X65 L;  5EBD A;  2EY6 A;  1U5K A;  5D14 A;  2PI2 A;  3I7F A;  1PTO H;  4A3M H;  5LMN Q;  3LGJ A;  1NR2 A;  1VQH A;  2K52 A;  4WFN 3;  1IZ6 A;  2WKD A;  2FMM A;  1CT1 D;  3WOF A;  3TS0 A;  2F3I A;  3M4Q A;  2MPM A;  4JI5 Q;  1XNQ Q;  1LLR D;  1K8G A;  2L55 A;  1LAB A;  1SMX A;  3HGB A;  1GD7 A;  3HOU H;  3QB3 A;  3FHW A;  1I4H A;  1GUN A;  2MQH A;  1E22 A;  2BCO A;  1VF5 C;  2KCM A;  3KF8 A;  1V43 A;  3GTO H;  2JJQ A;  3Q24 A;  2BA0 A;  1KAA A;  3G48 A;  1LT5 D;  5T1G A;  4DGZ A;  4HIO A;  3OYY A;  3D4W A;  4YWM A;  5JVG 3;  4NXN L;  3MC0 B;  1IBK Q;  1AP0 A;  4JCV E;  2A74 C;  5JEA H;  5D3I B;  1STY A;  4GOP C;  5M3M B;  4HJA A;  1YJ9 A;  3QO2 A;  2IX1 A;  5M3F G;  2JA5 G;  4A3I H;  1K8M A;  3E9H A;  2N49 A;  5KYL A;  3AEV A;  4IFD I;  1X32 A;  2A8V A;  2ZXR A;  4B3S Q;  3MAQ A;  2VQF L;  3K80 C;  3KUP A;  1X9N A;  1SND A;  1TS5 A;  1EZ8 A;  4Y52 H;  2XTI A;  4JI2 Q;  2B3G A;  3PIO A;  1D1K A;  4DV3 L;  2LS0 1;  1I4G A;  1XX8 A;  5K36 G;  1KQS A;  1AE2 A;  3MZ5 A;  1WTX A;  5C44 B;  1CZG A;  2MO0 A;  2EYO A;  4R8I A;  4APV A;  3GTJ H;  3NWS A;  4KMU C;  2MFI A;  4CDE C;  1ICW A;  3FPP A;  2ZT9 C;  1Q8I A;  2EPB A;  2F0O A;  4LFC L;  3DM3 A;  4ZUI A;  1V1O A;  1AN8 A;  2MP1 A;  5JJI A;  5M5X B;  5ELF A;  3V96 A;  1YBY A;  1XYI A;  2NN6 I;  5GAE C;  4FF3 A;  5IGC A;  2SOB A;  3E9I A;  4HIM A;  4OWW B;  1VQA A;  1LTA D;  5E4W C;  1VQ9 A;  2E2J B;  1SJE D;  4TQU S;  1P8L A;  3U50 C;  4C2M B;  3S2H H;  1BVS A;  2PQA A;  1ENF A;  1G8Z D;  3PIP 3;  1HA6 A;  4DR6 L;  5D3D A;  1K8A C;  1DXM A;  4GLX A;  1TWF H;  2KED A;  2ZM6 L;  3RZD B;  2JA7 H;  5IGB A;  3X3M A;  2PI2 E;  3LWE A;  5C4J B;  1JJ2 A;  1DOK A;  4M1U B;  1V1Q A;  4TKO B;  4UPA A;  4K0K Q;  3BVM A;  5CBE E;  3K57 A;  5C4H A;  3CD6 A;  1ONL A;  1B53 A;  5IP9 G;  2F0H A;  3WOE A;  1UE1 A;  4QIW E;  1IL2 A;  2PYK A;  2Q8R E;  3CKI B;  4G4K A;  1IKM A;  1E0B A;  2AWO A;  4RHR A;  4AIM A;  1RIP A;  3CP0 A;  1JMC A;  3AFP A;  3OIQ A;  3F2B A;  2PZT A;  1K83 B;  4JBJ A;  5BR8 Q;  4C3J B;  5AJ3 L;  1IBM L;  1AFP A;  1QUQ B;  3L2P A;  4L5R C;  3S17 B;  1T5X D;  3FKI H;  2B2Y C;  3K59 A;  2F0E A;  4BXX G;  4DN4 M;  3MXP A;  1K0S A;  4ZLT F;  1SYG A;  4A93 G;  1STN A;  4RAU C;  5J3B A;  4C1N K;  4LK1 C;  1OXU A;  3C3L A;  4X62 Q;  3ER0 A;  4X66 Q;  1EIH A;  4CJ0 B;  2Z1C A;  1B70 B;  1SYE A;  1WCM G;  3J7Z C;  1I4P A;  1PH6 A;  1MD2 D;  1V1P B;  4JI7 Q;  2IWH A;  2F0D A;  1VQB A;  2LY7 A;  1C4Q A;  4LF8 L;  1I4R A;  1JCK B;  4JI1 Q;  2N3S A;  4OWT B;  2UUB Q;  1VQ4 A;  2YV5 A;  1B3A A;  3OWE B;  4DK1 A;  1RTO A;  5LMU L;  4IOA A;  2F0K A;  2F0V A;  3M4P A;  5J1Z A;  1CQF A;  2F0L A;  3GTO B;  5KIX A;  3SVM A;  3NSW A;  1WOC A;  4LF7 L;  1AH9 A;  2EVB A;  1VQJ A;  2CQO A;  3KLS X;  3NEL A;  4GNX C;  4KTA A;  2RBM A;  1CKN B;  4GN3 B;  3VA7 A;  1YJW A;  3NBI A;  3T1H L;  4JYA Q;  4A3B H;  4DV2 Q;  1M90 C;  3M3Y H;  3A7A B;  1Q81 C;  1YHA A;  1NJI C;  1JJC B;  5FO7 B;  5IGF A;  4A75 A;  4A3E G;  5C4X B;  4ZK9 B;  4DNI A;  4F7X A;  1JE4 A;  4GOP B;  4JI8 Q;  4ALP A;  2VUM H;  3MXG A;  5DAU A;  3VYR A;  3T56 B;  1Q1E A;  3PQI A;  1EWC A;  4DK3 C;  1NUC A;  2HCI A;  4RMF A;  1HQR D;  3SDZ A;  4C3I B;  5JJZ A;  1D5Z C;  4K8I A;  3IAY A;  2IX3 A;  1O7Y A;  4OON A;  1XMQ L;  3GO5 A;  3S14 H;  5IYC G;  2L9H A;  3P20 A;  4OGQ C;  5IGE A;  1SXT A;  4UHV A;  1CQV A;  3C1F A;  4BS9 A;  4TSS A;  4KY7 A;  3QOJ A;  4O1N A;  5ELC A;  4EQ5 A;  1N34 L;  3P75 A;  1STB A;  3K5L A;  1TWH H;  5H1S E;  2AKW B;  4DPG A;  5FOB B;  4GN4 B;  4JI6 Q;  3H3V H;  2CW0 C;  3HEJ A;  1O7I A;  4NKL A;  2UUC L;  4BY7 B;  4CKC A;  1D2B A;  4IUP A;  4N8X 1;  3KLR A;  1SRU A;  1SE8 A;  4A3F B;  4R1J A;  2QA4 A;  3MA2 B;  1HNX L;  1VQC A;  4JK1 C;  1J8I A;  5LHY 1;  5I4D A;  4HJ5 A;  2F1M A;  1KNE A;  2RDF A;  1K0R A;  2KCN A;  3L0O A;  1KD1 C;  3DMU A;  3GTP H;  2IHF A;  4XDX A;  4EX5 A;  1LYL A;  2E2H H;  3GTM B;  3JAM L;  1B44 D;  3MFG A;  4ZRZ A;  1II3 A;  2E5L L;  4B3R L;  4LFA Q;  1H9M A;  3TRE A;  1XPU A;  1VQI A;  1NTG A;  2HIV A;  3M4O H;  5LL6 S;  1E1O A;  5C3E H;  4O42 A;  3IKJ A;  2K5N A;  1L0Y B;  2AQ2 B;  2CWP A;  3TP8 A;  1DCZ A;  3A8K E;  4IFD J;  4B3M Q;  1SMY C;  3D8G A;  3TS2 A;  1A3V A;  3T1Y L;  4QMG A;  2WAQ B;  4LF5 Q;  1NBW A;  3NWT A;  2IPK D;  2QIL A;  1C7Y A;  1MIU A;  3VYT A;  1Y1V G;  2B63 G;  2JA6 B;  4AYB G;  5IT9 c;  4B3T Q;  1JOK A;  3ULJ A;  2O4X A;  1H9S A;  4IPD A;  2E75 C;  1FYC A;  5EBC A;  3GV3 A;  1EY7 A;  1WTQ A;  5KGU A;  5IT9 E;  1DJR D;  1VQP A;  3F2C A;  5GRO A;  1JT8 A;  4UP9 A;  2MHV A;  3I4M H;  1I5F A;  5IE8 A;  2R61 A;  1HPC A;  3FKI B;  1K9M C;  3H09 A;  4RCN A;  4BBR B;  4EVO A;  3CPF A;  2FXQ A;  2XRQ D;  2CQA A;  4DV7 L;  5COY A;  3PUW A;  1OO9 B;  2NN6 G;  4GKK L;  5NUC A;  2BDN A;  5M5Y H;  2R3Z A;  3E0E A;  4A4I A;  1A15 A;  1OXV A;  4ZKC B;  2N55 A;  1GO3 E;  2FFK B;  3S16 H;  1I94 Q;  3G6E A;  1EZ6 A;  2NVX B;  3CC2 A;  2IW3 A;  2EYL A;  3SXH A;  1IYV A;  4DR4 L;  4C3H H;  2B8G A;  4YCW A;  3QWN A;  1EIY B;  1DOL A;  2SNM A;  3HOV H;  1XTD A;  4DUZ Q;  1Q12 A;  3MTS A;  1PZI D;  3BS1 A;  4LF9 Q;  3FEW X;  4A3G H;  2JQO A;  2MGS A;  3HZX A;  2ZJP A;  2K01 A;  1PVO A;  5GAH C;  1LT4 D;  5CV9 A;  3T13 A;  1A2U A;  1BOS A;  1F9Q A;  4ZKB B;  1FL0 A;  4HR7 B;  3JAM c;  4DV5 Q;  4GNX B;  4IUU A;  1E1T A;  3M4Y A;  1Q90 A;  1FGB D;  3C46 A;  1X3F A;  4R8N A;  1EFW A;  1VMC A;  1L1O C;  1AW7 A;  3JAM E;  2WAC A;  2GVB A;  4IUN A;  2VUM B;  3UDG A;  4FO2 A;  1KXL A;  2WV6 D;  5HGT A;  2HQE A;  5J39 A;  1BO0 A;  4X3K A;  4Y7N B;  2NUC A;  2O5J C;  1XNR L;  1Y8P B;  2R7Z G;  1PH2 A;  1R9T B;  5JAV A;  5BN5 A;  1LTI D;  1G2S A;  4HIK A;  2R92 G;  3HKZ E;  2F0M A;  4LWC A;  3KLW A;  5C6A A;  1UAP A;  5C0X G;  3MXU A;  4X64 L;  2C9O A;  5G3L F;  2PNR C;  4RCO A;  1J9O A;  4IPC A;  4LUZ A;  4LF4 L;  4JOI A;  2K33 A;  1U9R A;  1SJH D;  2F4V L;  2O5I C;  3OMG A;  3OW2 A;  4KI0 A;  3K58 A;  3EIV A;  2CVR A;  4KD4 A;  4B9W A;  5M3M H;  1A8V A;  4DR1 Q;  1AE3 A;  2SNS A;  2A69 D;  3PUX A;  2ATW A;  2IHE A;  4XYQ A;  3ND9 A;  5EKI A;  4DV4 L;  3K8A A;  2NBF A;  1JB3 A;  2EYP A;  1F9R A;  2Q2T A;  2K5V A;  4QIW B;  2OEO A;  4AYB E;  3KF8 B;  1TWG B;  2EIF A;  2EYF A;  2E2H B;  3BZD B;  5KNB A;  3A54 A;  3PO2 G;  5C5L A;  1CTM A;  2BE5 D;  1FR3 A;  3AFQ A;  4DU9 A;  5C44 H;  1I6H H;  3J7A F;  2F0G A;  3M85 A;  3CRL C;  4CDD C;  5IYD G;  3VR5 A;  4KN7 C;  1JWU D;  2BOS A;  1RHP A;  2HCC A;  3NPP A;  4MIU A;  5FLX L;  1BBW A;  1F2M A;  4A3C H;  3A55 A;  1YJN A;  1CKO A;  3KFU A;  1VDZ A;  1CKM A;  4DV1 L;  5M5X H;  3PGZ A;  1HNZ L;  2JXM B;  4I65 A;  1TKW B;  4LFB L;  4MTK A;  1J5E L;  3I4N G;  1HZ9 A;  2E2J H;  5M3F B;  3HOW G;  3NE5 B;  1KDC A;  3K7A B;  2F52 A;  3MXN A;  1RDP D;  2HDM A;  4C2M H;  1A3T A;  1PH1 A;  3SE0 A;  1JR0 D;  1MBY A;  1PFN A;  4DR2 L;  2LXJ A;  4S3S A;  3ERO A;  1MJE A;  1TS3 A;  4NW2 A;  1CSP A;  3W1G A;  2NYZ D;  3CAM A;  1XPR A;  2OTJ A;  1EU4 A;  4L5Q A;  2BE5 C;  2L11 A;  1F9S A;  3PO3 G;  5EKK A;  3RZD H;  4KHV A;  2H4O A;  3I2Z A;  1QIL A;  5GQO A;  1HR0 L;  3KBX A;  1PZK D;  1V9P A;  4KHP L;  1PTO D;  1HNW Q;  1PYB A;  4OEM B;  4DFA A;  4A3J G;  2R93 G;  3RNU A;  4C3H B;  3HOX G;  4A3L G;  1KTK A;  1NCV A;  2KHI A;  4N8F A;  3J81 i;  3MFY A;  3CCU A;  1EY4 A;  2G5D A;  2BA1 A;  1EWI A;  3M9B A;  2PQA B;  4H0L C;  4X3U A;  3H0G G;  1K83 H;  1ENC A;  4KKU A;  2Q2I A;  4C3J H;  2A6E D;  2XWJ B;  4JVZ A;  4G7Z C;  4JPB W;  2EY5 A;  4AQY L;  3S17 H;  2Z6B A;  3U58 A;  4MNO A;  4PMB A;  4MN3 A;  1L0X B;  2WAQ E;  4GLV B;  2XVS A;  1YIT A;  4DR7 Q;  2MUY A;  5CV7 A;  1HHV A;  3TSS A;  3V2T A;  1QOH A;  2VXW A;  4DR5 Q;  5E4X A;  4NXM L;  1WFQ A;  5LMN W;  3CU7 A;  2IY5 B;  3SEB A;  3ULL A;  2AQ3 B;  4PZ6 A;  5JVH 3;  1QNK A;  1X3Q A;  3TZD A;  4DAY A;  2AUJ D;  3X3N A;  4FF1 A;  2Q8I B;  3BYT B;  4A76 A;  4LMQ D;  2NVY H;  2PW7 A;  4IFD H;  1KRS A;  1S5F D;  3VA5 A;  4IJL A;  1G2T A;  1ZYR D;  2G9D A;  4DV0 Q;  1XTC D;  2K6A A;  3TP6 A;  3KF6 A;  1ZKO A;  1EYA A;  3A8J E;  3KDF A;  2PQE A;  1LTG D;  1BNZ A;  1SBB B;  4QGU A;  2A6E C;  1B7Y B;  4ZCK A;  5T1I A;  1SFO H;  1WTV A;  2MJ8 A;  3BYY B;  1BCP D;  4JI4 L;  3R3O A;  4K2K A;  2OQ0 A;  2UUA Q;  3V05 A;  3S1Q B;  2SDF A;  2IL8 A;  5C4X H;  1ET6 A;  1DD2 A;  2JA8 G;  2RSN A;  4V0B A;  1EYC A;  1Y1W G;  2OF1 A;  1S5B D;  1N32 Q;  4A93 B;  3RUZ A;  2PZU A;  4LAA A;  4C3I H;  3I73 A;  2VQE L;  2C35 B;  1WCM B;  4X3S A;  1U0L A;  1X3P A;  2CWA A;  1C9O A;  2R6G A;  1Q3L A;  1I6H B;  4YWL A;  1CA6 A;  1A3U A;  2D0O A;  2UXB L;  2ICI A;  1LTS D;  2D5D A;  2IX0 A;  1W6K A;  1OXT A;  4OO1 G;  4V19 0;  2VB3 X;  4IUR A;  1Q82 C;  3VDY A;  3J80 i;  2YTY A;  5C3W A;  3PIP A;  1BCP C;  4BY7 H;  2Z6K A;  4ULL A;  3STB D;  3I70 A;  3CME A;  4JI3 L;  4A3F H;  3QOL A;  4QL5 A;  1A0I A;  2QEJ C;  5I2Y A;  3I72 A;  1VS0 A;  3U9O A;  4U68 A;  1I50 B;  1G91 A;  3D6W A;  4EGV A;  1SNM A;  1GUT A;  3DEO A;  5F2D A;  2QKI C;  2D9U A;  4JOI C;  4LF5 L;  1PRT D;  2LXK A;  2DNE A;  4DUY Q;  4DV6 L;  3GTM H;  1G6Z A;  3I91 A;  2QCP X;  3I90 A;  5CR3 A;  4L5S A;  1EY5 A;  2A68 D;  5FKA C;  4ZYS A;  1Z9F A;  1D5M C;  2UXC Q;  3KK7 A;  4H02 A;  1IBL Q;  2B2W A;  3A74 A;  2AQ1 B;  5DEH A;  1UE5 A;  5CYU A;  3GP7 A;  1VQ5 A;  4ID6 A;  4XT1 B;  3ERQ A;  4RH6 A;  1EWH A;  1SAP A;  4DR3 Q;  1UE7 A;  2JA6 H;  1U4R A;  4JBK A;  5I9O A;  3I4L A;  2KVM A;  1L1O A;  3H94 A;  1JJG A;  3QG1 A;  1KIX A;  4YHH Q;  1TR5 A;  1LTR D;  1CSQ A;  2XN9 C;  1HR0 W;  1PH4 A;  1I94 L;  1STH A;  2RHS B;  3HKZ B;  2HHH L;  1HTP A;  4LF6 Q;  2NZ1 D;  1TXY A;  1BCP F;  4BBR H;  4P2C B;  4CJ2 C;  3PF5 A;  5ISR A;  1XMO Q;  2NZO A;  4P73 A;  3TME A;  2UU9 L;  4G7H C;  4BY1 H;  2ZTC A;  5KRU A;  5C0X I;  1Y8N B;  5IP7 G;  3S1M B;  1L0W A;  1IL8 A;  4A3K H;  3HOZ G;  4DAV A;  1IHZ A;  2EJM A;  5FJ8 G;  4KV6 A;  2HT1 A;  3KJO A;  2AUK A;  3S15 H;  4JI0 Q;  3J7Y W;  2NVX H;  3A7L A;  2NTT A;  1EQV A;  1H9S B;  3NUC A;  1B3Q A;  5IYB G;  4DV5 L;  2NVY B;  3ONA B;  4WJ3 M;  4Q0F A;  4KLK A;  3MWY W;  4LNQ A;  2B63 B; 
#chains in the Genus database with same CATH homology
 1Y1V B;  5EPK A;  4AYB B;  1BDO A;  4GZY C;  1ENA A;  5I9P A;  1SFO B;  1K8O A;  2AWN A;  2F0T A;  3O13 A;  3J81 L;  4HN7 A;  2PO4 A;  3SHL A;  3E5S A;  1SEB D;  1Z6H A;  4DF7 A;  2EYM A;  3D31 A;  5A2Q L;  4ILW A;  3AMU A;  4HCS A;  4KJO A;  3S1R B;  2Z4I A;  1RCV D;  3SK5 A;  1F2Y A;  4C56 C;  5IOC A;  2D2C C;  4I7Z C;  4DNT B;  1HUM A;  1JOQ A;  4RKL A;  1GUO A;  3I8Z A;  1Q1B A;  1LT6 D;  1EIG A;  1JOO A;  1JC7 A;  2KA7 A;  3ITP A;  1SNC A;  3NHH A;  1HCZ A;  1STA A;  4CGY B;  2F0W A;  1XXG A;  4X3T A;  3A8I E;  1QE6 A;  2F0I A;  1AZQ A;  1SYD A;  1KDB A;  4RKB A;  3GTQ B;  2ICE C;  1YNJ D;  4RHS A;  3G7L A;  1F2Z A;  4J1M A;  2SEB D;  3IFT A;  1HQM C;  1ILP A;  2VB2 X;  4K5X A;  4G7O C;  1FNU A;  4N9P A;  1PYW D;  1STE A;  1B1Z A;  2JYO A;  3D4R A;  3W2D A;  2R92 B;  1S4Z A;  1BR9 A;  2F03 A;  3I3C A;  1OXX K;  1DM0 B;  4IUQ A;  2GA4 B;  1WTW A;  3GQB A;  3VR3 A;  4XXE A;  2RKS A;  2RDG A;  3NQT A;  4HSP A;  3DEP A;  3TP5 A;  3KLS A;  2RVL A;  3J80 L;  3T16 A;  1RD9 D;  1TY0 A;  3NTK A;  4F88 A;  5CGK A;  4BY1 B;  1NSN S;  1OXS C;  4A3K B;  1GUW A;  5JEA G;  4H44 C;  3K5M A;  1Z47 A;  2DY7 A;  3PO2 B;  1MGS A;  5K36 H;  2YYZ A;  3NQI A;  1FNV A;  2KEE A;  2NWG A;  3S15 B;  1IW7 D;  3CRK C;  4IZ8 A;  2KEC A;  2HDL A;  5I6W A;  1DYQ A;  3R8B A;  4XT3 B;  3PMF A;  2J4X A;  1FD7 D;  3Q22 A;  1YNN D;  2ID0 A;  1PXU A;  1GUS A;  4BA1 I;  2A6H D;  1D1I A;  5KND A;  4QUC A;  1GHK A;  3I4N B;  4L6T B;  3MHB A;  1E2Z A;  2J0T D;  1EFI D;  2J7Z A;  5TSS A;  2Z8L A;  2B2W C;  2YU9 B;  4FXD A;  3LWU A;  3HOW B;  1AZP A;  2PCF B;  4J6H A;  1HA5 A;  1ESF A;  3T53 B;  4ZUJ A;  1RJT A;  2NVT B;  4OO1 I;  3PO3 B;  1KLU D;  5JOB A;  4RA8 A;  1F77 A;  1BF4 A;  4FVM A;  1I4Q A;  5COR A;  4DAP A;  3EA6 A;  3BDO A;  3ND8 A;  5E3F A;  1S5E D;  4HCE A;  3TZU A;  2F4I A;  5C0X J;  4A3J B;  1CA5 A;  3HOX B;  3URY A;  3EFX D;  5M9O A;  3RD4 A;  3CQZ B;  1I3Q B;  1HRJ A;  3OIP A;  1WD1 A;  1GJX A;  1BBX C;  3FMC A;  4HMJ A;  3H0G B;  1H9J A;  2B2V C;  5BN4 A;  4B08 A;  3R93 A;  3EVQ A;  3GTK B;  3GV6 A;  1U4L A;  3GTG B;  5AFW A;  3D4D A;  3S9W A;  1C48 A;  3WDN A;  1CZW A;  2HUG A;  2PPB C;  5A35 A;  3GTL B;  1QNU A;  5CC4 A;  3N6R A;  4HED A;  1WTP A;  2TMP A;  3LX0 A;  3H6M A;  1ILQ A;  3BVZ A;  1R4Q B;  1WD0 A;  3DM1 A;  1EY9 A;  5M5W B;  2F0Q A;  4IUT A;  3MEH A;  3NTI A;  1PMR A;  2VNU D;  1NAP A;  4FXG C;  2F0S A;  4ME5 A;  1PFB A;  1EEF D;  1TWA B;  4HSV A;  3TP7 A;  1BQQ T;  2C5C A;  3L7Z C;  2A69 C;  2JP1 A;  2NVQ B;  1SSO A;  3FRP B;  1MSH A;  4CJ1 B;  3D6C A;  3VYS A;  3S2D B;  2XNA C;  4KY6 A;  1H9K A;  3MVV A;  4QF4 A;  2JA5 B;  2JA8 B;  2I07 B;  4OIJ A;  2N88 A;  5FO8 B;  1Y1W B;  1D5X C;  3HRZ C;  3DWQ A;  2K32 A;  5LL6 X;  4QCL A;  4DXF A;  2EYH A;  2QDB A;  2WIN B;  1GHJ A;  1E2V A;  4XQQ A;  1SE2 A;  2B8F A;  1EYD A;  1SNQ A;  2Q8T A;  4DNR B;  3S1N B;  5C5M A;  2EJF C;  1M4V A;  2F0U A;  4PV1 C;  2K04 A;  1QJO A;  2O2L D;  4CHT B;  1SDF A;  4TRD A;  4Q5V A;  3VR2 A;  4Z9C B;  2L4N A;  3R2I A;  2B2T A;  1PTO C;  4L8J A;  3PUZ A;  2XIW A;  3PUY A;  5FLX E;  1EEI D;  2M00 A;  1PLF A;  4DK0 A;  5IOD A;  1KLG D;  1U4M A;  2L5T A;  1JWM D;  4FYD A;  2F0F A;  1CM9 A;  2PW5 A;  2DN8 A;  4FNF A;  4IQZ A;  1PFM A;  5IGD A;  4WJW A;  1EQT A;  3OOC A;  2V4D A;  3G6J B;  1VF7 A;  4OHJ A;  5CV4 A;  2KQ3 A;  3Q23 A;  2NN6 H;  2M2L A;  3HOZ B;  2EZV A;  3M7N A;  3QIA A;  5CMD A;  1QG7 A;  3U9S A;  3DUZ A;  3SK4 A;  2JSO A;  1ZYR C;  3DHQ A;  3VR6 A;  4KKT A;  2KOL A;  1G29 1;  2ZXP A;  2EJG C;  2EOT A;  4KHZ A;  1PTO F;  2X69 A;  1UEA B;  1D6E C;  2KCC A;  2L12 A;  5KYI A;  1JOR A;  2KUM A;  1O7Z A;  1DZ1 A;  2NB0 A;  2EE1 A;  1T5E A;  4YIJ A;  1QB5 D;  2RA4 A;  4NMZ A;  5EGT A;  4C3H G;  3TBI B;  4A3E B;  3P7J A;  3HG9 A;  2FIN B;  4KN4 C;  3PIO 3;  3NK9 A;  3TN2 A;  2JEB I;  4RGN A;  4C1N I;  1EY6 A;  5CV8 A;  3IFD A;  3FDT A;  1HFG A;  3RLF A;  1ZEQ X;  1ML0 D;  5DNF A;  4KK7 A;  2LMC B;  4OL7 A;  5C0X H;  2XSC A;  4JBW A;  3OMC A;  2LKV A;  2EY1 A;  1GUG A;  4RGM A;  1MSG A;  2XRS D;  3NBH A;  4CKB A;  4R9W A;  2F0P A;  1CFM A;  4ODG A;  2G9H D;  3HOY B;  2JE6 I;  1SYB A;  4BBS B;  4A3D B;  1LO5 D;  1SYF A;  3OWF A;  2PMZ B;  1HFN A;  2IJ0 A;  1ZXT A;  4J8Q A;  3PUV A;  4E6I A;  1PRT C;  2ZXO A;  4BA2 I;  3IL8 A;  2FHT A;  5EPL A;  2E74 C;  1FNW A;  2A68 C;  1O80 A;  1V8Q A;  1UUP A;  3C2P A;  1CI3 M;  2B2U A;  1LTT D;  4PQX A;  2B2V A;  1WVL A;  2JEA I;  1SNO A;  3T4A C;  1SYC A;  4FXK C;  1PTO B;  4A3M B;  2EY2 A;  1E2W A;  2TSS A;  3L9A X;  2K28 A;  5CBA E;  4FF2 A;  1O7L A;  3HOU B;  4IN3 A;  3BDC A;  3A56 A;  5JPN C;  4EQO A;  2K03 A;  3DWA A;  3D3R A;  4MHE A;  2CW0 D;  2E76 C;  2X6G A;  4EQP A;  2ENB A;  1PRT F;  1LAC A;  1BUV T;  4OIK A;  4PNY A;  4K14 A;  3OPO A;  5IT9 L;  4A3I B;  2LFN A;  2DNC A;  4XYO A;  2WKC A;  4XQJ A;  2K05 A;  1Z7T A;  1A6X A;  1DON A;  1PZJ D;  3LNN A;  4KJN A;  2B2T C;  1I4X A;  4XTC S;  4EQN A;  3E6Z X;  4U67 3;  3H3V C;  1SE3 A;  5BN3 A;  4QB4 A;  2B39 A;  4DA2 A;  1A2T A;  3GTJ B;  2OXP A;  1BCP B;  4KKS A;  2EDG A;  1SMY D;  2EYJ A;  5D65 A;  1SNP A;  2PZW A;  1GXD C;  1H9R A;  1RTN A;  1CK1 A;  2Y0S B;  4WRD A;  2NTS A;  1HTL D;  2K1B A;  1Y8O B;  1XWE A;  1LV9 A;  2M9V A;  3W3A A;  2WP8 J;  4C3J G;  2R7Z B;  2CHB D;  5IIF A;  3S2H B;  5C3X A;  5DM6 3;  3C1E A;  1DOM A;  3TDQ A;  2KHS A;  1TWF B;  5IGG A;  2F0N A;  1EOT A;  2JA7 B;  3RMH A;  3J81 E;  5EPJ A;  1TQO A;  5E1F A;  3SR1 A;  5G3L D;  1BXT A;  1TU2 B;  2L1B A;  3RZO B;  4IFD G;  3E0J A;  1MI2 A;  1VMP A;  1B9M A;  1YNJ C;  2FMC A;  1V1P A;  3OHX C;  4F87 A;  5A2Q E;  2E2D C;  2E2I B;  5HUR A;  4RGT A;  5JEA J;  1LTB D;  4QUF A;  1WTO A;  2OT2 A;  3P1H A;  4HAE A;  1S5C D;  1PRT B;  3HS0 C;  1S5D D;  1TY2 A;  1ROD A;  2F0J A;  1C8C A;  1VCI A;  5CV5 A;  1B2T A;  3N52 A;  3HP3 A;  1IYU A;  4OO1 H;  1F9P A;  1JWS D;  1RF2 D;  4C3I G;  1CHP D;  3AB9 A;  2RSO A;  4KD3 A;  2K5D A;  3K5N A;  5ELE A;  3R2T A;  4B9X A;  4HMI A;  4CKE A;  2EXZ A;  3SK6 A;  4RFB A;  4N9T A;  3QJY A;  5EJW A;  1W6J A;  3K0Y A;  4H7B A;  2F3W A;  4F8M A;  5ELB A;  1QCB D;  1EU3 A;  4HTH A;  1NR4 A;  4G57 A;  2WII B;  2XWB B;  1O78 A;  3Q6S A;  4NDX A;  1TT2 A;  4PMC A;  1B50 A;  4KY5 A;  2L0C A;  3FVQ A;  1IW7 C;  4A3B B;  2DY8 A;  4K5V A;  3M3Y B;  1LT3 D;  4CBV A;  3BVG A;  3Q0A A;  1TS4 A;  1YNN C;  1HUN A;  2R93 B;  1ESR A;  1SE4 A;  2A5H A;  1STG A;  1TVX A;  3T51 B;  3EQL C;  3ZYY X;  4FF4 A;  1KDA A;  2A6H C;  4WOR A;  4K6D A;  4BWG B;  3M7G A;  2B2U C;  3FPU B;  3S14 B;  1U4P A;  2I46 A;  4IAL A;  3BG3 A;  5C4Z A;  2WB1 B;  4UAI A;  5EQ0 A;  3J80 E;  3K6O A;  5CV6 A;  4XQN A;  2Z4H A;  3OSO A;  1B9N A;  1ET9 A;  3L3O C;  1TWH B;  1CHQ D;  3KBG A;  3PV0 A;  4L63 B;  5FK9 C;  4RWS C;  2QF7 A;  1I6V C;  4K2L A;  5I6Y A;  1JIC A;  4ABN A;  2K5Q A;  4NP5 A;  1KNA A;  1IKL A;  1TII D;  3GTP B;  5KEE A;  3GD7 A;  2IT1 A;  2H1E A;  3H91 A;  1UNS A;  5FO9 B;  3J7A V;  4UDU C;  3CHB D;  3F2U A;  4K8J A;  4ZQ3 A;  1AEX A;  5KNC A;  2K5W A;  1M8A A;  5ELD A;  2RQX A;  5JPM C;  1JQY D;  2A73 B;  3M4O B;  5C3E B;  2BDO A;  1RKN A;  4K5W A;  4XIG S;  3SK8 A;  2B2Y A;  5I2X A;  3AU7 A;  1KAB A;  4H13 C;  1TS2 A;  3OW7 A;  3BDL A;  4PMW A;  3DXJ C;  1HXY D;  3EJI A;  4IUV A;  3DWP A;  5K5P A;  1WTR A;  5DM7 3;  4RGO S;  3I4M B;  2KJX A;  2F3V A;  3VR4 A;  1QWY A;  3NP8 A;  1EL0 A;  4M8A A;  4LJZ C;  5M5Y B;  3UI2 A;  2X6L A;  1EY8 A;  3S16 B;  3NTH A;  4FP5 D;  1EY0 A;  1GOZ A;  5J22 A;  2K7V A;  3K5O A;  2D62 A;  3HOV B;  4ZAI A;  3VYU A;  1TWC B;  1Y69 U;  2RDH A;  4A3G B;  1F2L A;  5EKL A;  1R4P B;  4DXG A;  2FJ2 A;  3NXW A;  4K6L A;  1B4O A;  1PDQ A;  5EBD A;  2EY6 A;  5D14 A;  1PTO H;  1NR2 A;  4WFN 3;  2WKD A;  2FMM A;  1CT1 D;  3WOF A;  3MWY W;  2MPM A;  1LLR D;  2L55 A;  1LAB A;  3HGB A;  3QB3 A;  1I4H A;  1GUN A;  2BCO A;  1VF5 C;  3KF8 A;  1V43 A;  3Q24 A;  2BA0 A;  1KAA A;  4DGZ A;  1LT5 D;  5T1G A;  3D4W A;  5JVG 3;  3MC0 B;  1AP0 A;  2A74 C;  5JEA H;  5D3I B;  1STY A;  5M3M B;  3QO2 A;  2IX1 A;  1K8M A;  5KYL A;  4IFD I;  1X32 A;  2ZXR A;  3MAQ A;  3KUP A;  1SND A;  1TS5 A;  1EZ8 A;  1D1K A;  2LS0 1;  1I4G A;  1XX8 A;  5K36 G;  3MZ5 A;  1WTX A;  5C44 B;  1CZG A;  2EYO A;  4R8I A;  3NWS A;  4KMU C;  1ICW A;  3FPP A;  2ZT9 C;  1Q8I A;  2EPB A;  2F0O A;  4ZUI A;  1V1O A;  1AN8 A;  2MP1 A;  5M5X B;  5ELF A;  3V96 A;  1XYI A;  2NN6 I;  4FF3 A;  5IGC A;  2SOB A;  1LTA D;  5E4W C;  2E2J B;  1SJE D;  4TQU S;  4C2M B;  1ENF A;  1G8Z D;  3PIP 3;  1HA6 A;  5D3D A;  1DXM A;  2KED A;  3RZD B;  5IGB A;  3X3M A;  3LWE A;  5C4J B;  1DOK A;  4M1U B;  4TKO B;  3BVM A;  5CBE E;  3K57 A;  5C4H A;  1ONL A;  1B53 A;  2F0H A;  3WOE A;  2PYK A;  2Q8R E;  3CKI B;  4G4K A;  1IKM A;  1E0B A;  2AWO A;  4RHR A;  3OIQ A;  2PZT A;  1K83 B;  4C3J B;  1AFP A;  3S17 B;  1T5X D;  2B2Y C;  3K59 A;  2F0E A;  4DN4 M;  3MXP A;  1SYG A;  1STN A;  4RAU C;  4C1N K;  4LK1 C;  1OXU A;  3C3L A;  1EIH A;  4CJ0 B;  2Z1C A;  1SYE A;  1I4P A;  1MD2 D;  1V1P B;  2IWH A;  2F0D A;  2LY7 A;  1C4Q A;  1I4R A;  1JCK B;  1B3A A;  3OWE B;  4DK1 A;  1RTO A;  2F0K A;  2F0V A;  5J1Z A;  1CQF A;  2F0L A;  3GTO B;  5KIX A;  3SVM A;  3NSW A;  2EVB A;  3KLS X;  4KTA A;  2RBM A;  3VA7 A;  3NBI A;  3A7A B;  5FO7 B;  5IGF A;  5C4X B;  4ZK9 B;  4F7X A;  1JE4 A;  3MXG A;  5DAU A;  3VYR A;  3T56 B;  1Q1E A;  1EWC A;  3SDZ A;  1NUC A;  2HCI A;  5JJZ A;  1HQR D;  4C3I B;  1D5Z C;  4K8I A;  3IAY A;  2IX3 A;  1O7Y A;  3GO5 A;  2L9H A;  3P20 A;  4OGQ C;  5IGE A;  1SXT A;  1CQV A;  3C1F A;  4BS9 A;  4TSS A;  4KY7 A;  3QOJ A;  4O1N A;  5ELC A;  3P75 A;  1STB A;  3K5L A;  5FOB B;  2CW0 C;  3HEJ A;  4NKL A;  4BY7 B;  4CKC A;  1D2B A;  4IUP A;  3KLR A;  4A3F B;  3MA2 B;  4JK1 C;  1J8I A;  5LHY 1;  5I4D A;  2F1M A;  1KNE A;  2RDF A;  2KCN A;  3DMU A;  4XDX A;  3GTM B;  3JAM L;  1B44 D;  3MFG A;  4ZRZ A;  1II3 A;  1H9M A;  5LL6 S;  4O42 A;  3IKJ A;  1L0Y B;  2AQ2 B;  3TP8 A;  1DCZ A;  3A8K E;  4IFD J;  1SMY C;  3D8G A;  1A3V A;  4QMG A;  2WAQ B;  3NWT A;  2IPK D;  2QIL A;  3VYT A;  2JA6 B;  1JOK A;  2O4X A;  1H9S A;  2E75 C;  1FYC A;  5EBC A;  3GV3 A;  1EY7 A;  1WTQ A;  5KGU A;  5IT9 E;  1DJR D;  2MHV A;  2R61 A;  1HPC A;  3FKI B;  3H09 A;  4RCN A;  4BBR B;  4EVO A;  2XRQ D;  2CQA A;  5COY A;  3PUW A;  1OO9 B;  2NN6 G;  5NUC A;  2BDN A;  2R3Z A;  1A15 A;  1OXV A;  4ZKC B;  2N55 A;  2FFK B;  1EZ6 A;  2NVX B;  2IW3 A;  2EYL A;  3SXH A;  1IYV A;  2B8G A;  3QWN A;  1DOL A;  2SNM A;  1Q12 A;  3MTS A;  1PZI D;  3BS1 A;  3FEW X;  2MGS A;  3HZX A;  2K01 A;  1LT4 D;  5CV9 A;  3T13 A;  1A2U A;  1BOS A;  1F9Q A;  4ZKB B;  4HR7 B;  4IUU A;  3M4Y A;  1Q90 A;  1FGB D;  3C46 A;  4R8N A;  1VMC A;  1AW7 A;  3JAM E;  2WAC A;  4IUN A;  2VUM B;  4FO2 A;  2WV6 D;  5HGT A;  2HQE A;  5J39 A;  1BO0 A;  4X3K A;  4Y7N B;  2NUC A;  2O5J C;  1Y8P B;  1R9T B;  5JAV A;  5BN5 A;  1LTI D;  1G2S A;  2F0M A;  5C6A A;  1UAP A;  5C0X G;  3MXU A;  2C9O A;  5G3L F;  2PNR C;  4RCO A;  1J9O A;  2K33 A;  1U9R A;  1SJH D;  2O5I C;  3OMG A;  4KI0 A;  3K58 A;  2CVR A;  4KD4 A;  4B9W A;  2SNS A;  2A69 D;  3PUX A;  4XYQ A;  3ND9 A;  5EKI A;  2NBF A;  1JB3 A;  2EYP A;  1F9R A;  4QIW B;  2OEO A;  1TWG B;  2EYF A;  2E2H B;  3BZD B;  5KNB A;  3A54 A;  5C5L A;  1CTM A;  2BE5 D;  1FR3 A;  4DU9 A;  3J7A F;  2F0G A;  3M85 A;  3CRL C;  3VR5 A;  4KN7 C;  1JWU D;  2BOS A;  1RHP A;  2HCC A;  3NPP A;  4MIU A;  5FLX L;  1F2M A;  3A55 A;  1VDZ A;  2JXM B;  4I65 A;  1TKW B;  5M3F B;  3NE5 B;  1KDC A;  3K7A B;  1RDP D;  3MXN A;  2HDM A;  1A3T A;  3SE0 A;  1JR0 D;  1MBY A;  1PFN A;  4S3S A;  3ERO A;  1TS3 A;  4NW2 A;  2NYZ D;  1EU4 A;  2BE5 C;  2L11 A;  1F9S A;  5EKK A;  4KHV A;  2H4O A;  1QIL A;  3KBX A;  1PZK D;  1PTO D;  4DFA A;  4C3H B;  1KTK A;  1NCV A;  3MFY A;  1EY4 A;  2BA1 A;  4H0L C;  4X3U A;  1ENC A;  4KKU A;  2A6E D;  2XWJ B;  4G7Z C;  2EY5 A;  4PMB A;  4MN3 A;  1L0X B;  2XVS A;  2MUY A;  5CV7 A;  1HHV A;  3TSS A;  3V2T A;  1QOH A;  2VXW A;  5E4X A;  3CU7 A;  3SEB A;  2AQ3 B;  5JVH 3;  1QNK A;  1X3Q A;  3TZD A;  4DAY A;  2AUJ D;  3X3N A;  4FF1 A;  2Q8I B;  3BYT B;  4LMQ D;  2PW7 A;  4IFD H;  3VA5 A;  1S5F D;  1G2T A;  1ZYR D;  2G9D A;  1XTC D;  2K6A A;  3TP6 A;  1ZKO A;  1EYA A;  3A8J E;  2PQE A;  1LTG D;  1BNZ A;  1SBB B;  2A6E C;  5T1I A;  1WTV A;  2MJ8 A;  3BYY B;  1BCP D;  3R3O A;  4K2K A;  3V05 A;  3S1Q B;  2SDF A;  2IL8 A;  1DD2 A;  1ET6 A;  2RSN A;  4V0B A;  1EYC A;  2OF1 A;  1S5B D;  4A93 B;  3RUZ A;  2PZU A;  4LAA A;  3I73 A;  1WCM B;  4X3S A;  1X3P A;  2R6G A;  1Q3L A;  1I6H B;  1CA6 A;  1A3U A;  2ICI A;  1LTS D;  2D5D A;  2IX0 A;  1W6K A;  1OXT A;  4OO1 G;  4V19 0;  2VB3 X;  4IUR A;  5C3W A;  1BCP C;  4ULL A;  3I70 A;  3QOL A;  2QEJ C;  5I2Y A;  3I72 A;  3U9O A;  4U68 A;  1I50 B;  1G91 A;  3D6W A;  4EGV A;  1SNM A;  1GUT A;  3DEO A;  5F2D A;  2QKI C;  2D9U A;  1PRT D;  2DNE A;  1G6Z A;  3I91 A;  2QCP X;  3I90 A;  5CR3 A;  1EY5 A;  2A68 D;  5FKA C;  4ZYS A;  1D5M C;  3KK7 A;  2B2W A;  2AQ1 B;  5DEH A;  5CYU A;  3GP7 A;  4ID6 A;  4XT1 B;  3ERQ A;  4RH6 A;  1EWH A;  1SAP A;  1U4R A;  5I9O A;  3I4L A;  2KVM A;  3H94 A;  3QG1 A;  1TR5 A;  1LTR D;  2XN9 C;  1STH A;  3HKZ B;  1HTP A;  2NZ1 D;  4CJ2 C;  1BCP F;  4P2C B;  5ISR A;  3TME A;  4G7H C;  5KRU A;  5C0X I;  1Y8N B;  3S1M B;  1IL8 A;  4DAV A;  1IHZ A;  2EJM A;  4KV6 A;  2AUK A;  3J7Y W;  3A7L A;  2NTT A;  1EQV A;  1H9S B;  3NUC A;  2NVY B;  3ONA B;  4Q0F A;  4ZLT F;  2B63 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...