1H9SB

Molybdate bound complex of dimop domain of mode from e.coli
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
137
structure length
137
Chain Sequence
QTSARNQWFGTITARDHDDVQQHVDVLLADGKTRLKVAITAQSGARLGLDEGKEVLILLKAPWVGITQDEAVAQNADNQLPGIISHIERGAEQCEVLMALPDGQTLCATVPVNEATSLEQGQNVTAYFNADSVIIAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MOLYBDENUM TRANSPORT PROTEIN MODE
publication title Oxyanion Binding Alters Conformational and Quaternary Structure of the C-Terminal Domain of the Transcriptional Regulator Mode; Implications for Molybdate-Dependant Regulation, Signalling, Storage and Transport
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription regulator
total genus 33
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2001-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03459 TOBE TOBE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1h9sB02
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1h9sB01
3VR2A 3IKJA 4LJZC 4BA1I 4LK1C 5JEAH 5JEAG 5BN3A 1I6VC 2D2CC 1Q90A 2YYZA 2R6GA 1OXUA 4RCNA 3PUXA 3VR3A 3WDNA 1FYCA 3L7ZC 2AUJD 2ZT9C 1OXTA 1Y8NB 1HTPA 2DNEA 1K8OA 2O5JC 1ONLA 3SE0A 2JEBI 1BDOA 2K7VA 1ZYRC 3BG3A 2JXMB 2EJMA 3ND8A 2A68C 2KCCA 2AWOA 4I7ZC 1GUGA 1ZKOA 2QF7A 4IQZA 2O5IC 4H13C 2B8FA 1QJOA 2EVBA 4KKTA 2NN6I 1GUTA 3AB9A 3MFYA 4PV1C 3T56B 2V4DA 3PUZA 1H9KA 1V43A 4G7HC 4L8JA 2Q8IB 3GD7A 3M85A 3LNNA 1DCZA 1HQMC 1OXVA 3W3AA 2E74C 2A6HD 2D62A 3RLFA 3HGBA 3QIAA 2IT1A 3I73A 1IW7C 1Q1BA 4H44C 3A8IE 1H9RA 3PUYA 3VA7A 1O78A 3FPPA 1DD2A 2DN8A 5KNCA 1H9SA 4KHZA 1K8MA 2F1MA 1HCZA 2BA1A 1E2ZA 2BE5D 1SMYC 3PUVA 2PPBC 3GQBA 4TQUS 4KN4C 3VR5A 2E75C 5BN5A 1YNJC 3ND9A 3DXJC 1DXMA 3A8KE 1GUOA 5A35A 1OXSC 2A69C 3M4YA 2E76C 4KI0A 3EQLC 1Z6HA 1CTMA 5K36H 5K36G 1VCIA 2L5TA 4KMUC 3OOCA 1LABA 1H9JA 2A6HC 1V8QA 2A6EC 1LACA 1H9MA 3OW7A 4OGQC 4DNTB 3VR6A 1GUSA 2K32A 4XIGS 2AUKA 4IFDG 3QG1A 2D5DA 3VR4A 4IFDH 1IYVA 1GHKA 4GZYC 1PMRA 1FR3A 4G7OC 3SDZA 1G291 3D4RA 2B8GA 2A68D 5KNBA 1GHJA 3NE5B 1CI3M 1Q12A 1H9SB 1Z7TA 1TU2B 2BA0A 2EJFC 3CRKC 3D31A 4KKUA 4XTCS 1O7LA 3H94A 1GUNA 3MXUA 3I4LA 2JE6I 3LWUA 1OXXK 3PV0A 1EWHA 1Q1EA 4HR7B 2DNCA 3N6RA 3BDOA 5C0XH 2EJGC 1IW7D 3T53B 2CW0C 5C0XG 3I72A 1Y69U 1T5EA 3QJYA 4DNRB 4G7ZC 2LMCB 3FMCA 4OO1G 5BN4A 4OO1H 1VF5C 1Y8PB 1GJXA 2NN6H 2NN6G 1YNNC 3OPOA 1VF7A 4DK1A 4DK0A 1E2WA 2BE5C 2EDGA 4KN7C 2PCFB 3T51B 1HPCA 3CRLC 4BA2I 1B9NA 4KKSA 1A6XA 2KA7A 5KNDA 1IYUA 2BDOA 2PNRC 3U9SA 1B9MA 2JEAI 1Y8OB 3A7AB 3A8JE 3KLRA 4JK1C 2A69D 3IFTA 3PUWA 1TKWB 4JBWA 4TKOB 3A7LA 1VDZA 3TZUA 2K33A 3P20A 1E2VA 3M7NA 4H0LC 2A6ED 1CFMA
chains in the Genus database with same CATH superfamily
4TVAB 5K5PA 4LJZC 4BA1I 1BOSA 2F0NA 1XNRL 3NK9A 4OWXB 4ID6A 3E6ZX 5D65A 4ME5A 3T16A 2NUCA 2QEXA 1D7QA 2O5IC 2L55A 2NB0A 1F77A 3HOYH 1VMCA 3VYRA 2SOBA 5IY0A 1STYA 1HUMA 1MSGA 2F0TA 2FMMA 3GTQB 1DOKA 1K8MA 2IX1A 1ENAA 3J80L 2F0DA 3GTLB 3OSOA 1CKOA 1VQ7A 1W3SA 2B2TC 2OXPA 1B1ZA 1YEZA 2MJ8A 4AH6A 2OTJA 4Q0FA 3DEOA 4MN3A 3MXNA 2UUBL 1DZ1A 1UEAB 2OEOA 4RHSA 3X3NA 3KF6B 5EPJA 5J22A 4A3BG 1X3PA 5DAUA 2CVRA 1SJED 1H9MA 1Q7YC 3HKZB 1TS3A 4QIWE 2BOSA 5E3FA 3H0GG 1WI5A 2H5XA 3W1GA 1VQ5A 3J7AV 4YCVA 1MGSA 1X9NA 3MWYW 3KLSA 5IP9H 5ELOA 5E7NA 3KJPA 4JI1L 3UDGA 3CRKC 1O7LA 3DWQA 4R8IA 4JCVE 2M9VA 2EOTA 2JE6I 1I4GA 4HIMA 3LWUA 1EU4A 2SNMA 1K8AC 2UUBQ 2BCOA 2F4VL 2XRQD 1ASYA 1E1OA 2HCIA 3S2DH 4X66L 2CW0C 3PGZA 4R4CA 3ERQA 5FLXL 2A1AA 3C2PA 2OCEA 1SROA 2HT1A 1PTOD 1VF5C 1LV9A 4DK0A 4LF4L 3X3MA 4JI0L 2RSNA 1ZEQX 2B63B 1PRTD 4R4TA 2EIFA 1EY0A 4JK1C 1X56A 2K5VA 1PTOF 5IIFA 1LT5D 1SJHD 4JI1Q 1M1KC 5KYLA 5C5MA 1XWEA 5C44B 4K2LA 3QR8A 4DV3L 2K5WA 1PRTF 4RCNA 2F3IA 2F4VQ 2ZT9C 1B53A 2RF4A 3PIO3 2R7ZG 2ALYB 4MIUA 3S16H 2VW9A 4DF7A 2L15A 1KTKA 2JXMB 2Q2IA 1X3GA 5A2QL 4F88A 1QJOA 1QWYA 5IE8A 4BS9A 4JI0Q 4J1MA 3JC66 3J7AF 4RGNA 4L8JA 5JJIA 3GD7A 1SN8A 1EUJA 2E74C 5EKLA 5KIXA 4B3MQ 1E22A 1GUWA 2UU9Q 3FKIH 2R93G 2RHSB 1CUKA 4IUPA 4V190 2PQEA 1HHVA 3TP5A 3HKZE 4DV3Q 1IYJB 1BQQT 3I56A 2BE5D 2KEEA 4NW2A 1MI2A 3NBHA 1I4PA 1TWAB 1KDAA 3GTOH 1JQYD 4ZUIA 1N32Q 2X6LA 4ABNA 5J39A 1X32A 5EPKA 5JEAJ 5IYCG 5D14A 1CT1D 2FJ2A 4A93B 1AFPA 1EEFD 4GKKL 3EFXD 4IURA 2HUGA 3FRPB 4A3DG 4IFDH 4FF4A 5NUCA 1UNSA 2K14A 2BH2A 1TWFB 3KK7A 5CV8A 4IALA 4X65L 4XQQA 1U4LA 5C4ZA 2B2VC 1JB3A 2DJFC 1FVIA 3S17B 2DY8A 2NVXH 2OT2A 4JOIA 1P16A 2K4KA 4ZQ3A 3RMHA 1T5EA 2VXWA 3D0FA 3S15H 1TS4A 2E2JH 1X3QA 3J7YW 1G2SA 4V0BA 3STBD 2Q2TA 1D5MC 1JOKA 1A6XA 1E3PA 4K6DA 2F0SA 3GTJH 3HS0C 4X65Q 5GADC 3PO3G 1PH5A 1VDZA 1PA6A 3TZUA 1E2VA 3M4QA 3S14H 3FHWA 3TDQA 4EGVA 2MFIA 3VR2A 5ELDA 1A2TA 1X3FA 3RUZA 4F87A 1K8OA 4I7AA 4DR6L 2K7VA 1EIFA 1YZ6A 1CA5A 3BZCA 3DWPA 3OMCA 3MVVA 4A3KB 4RFBA 4H13C 3NUCA 4QB4A 2EVBA 1G8ZD 2GA4B 4FXDA 2K5DA 5E4WC 2R92H 4DR2L 3A55A 1MD2D 1LT4D 2F52A 1GVPA 1HNWL 1O78A 4CDCC 2UXCL 5T1GA 4WJWA 5G3LD 4NP5A 2PNHA 2E75C 1FGBD 1UE5A 4DR6Q 2F0OA 5A35A 1OXSC 3L0OA 4I65A 3HOXG 2K28A 4ILWA 4GKJL 4TSSA 3E0JA 3OW2A 2F0PA 4DUYL 4DK3C 3OW7A 1JMCA 2F4IA 3VR6A 4DR2Q 3CCQA 4HCEA 1XJVA 4BY1H 4QL5A 2CWAA 1KHIA 2UUCL 3S1QH 1F2LA 4G7OC 5FKAC 3J81j 4Q5VA 2VB2X 1HNWQ 4DV0L 2VS1A 2UXCQ 3BZKA 4UAIA 1AEXA 1Q12A 1Z7TA 4XTCS 1EQVA 2NWGA 1GUNA 2C5CA 4N9PA 2YTYA 4IZ8A 4BY7G 2NVQB 1C9OA 2EYMA 4CJ1B 1RDPD 1EWIA 5C4XH 4GKJQ 1X55A 4C3IG 1JICA 4DUYQ 2B3GA 2G9DA 4FVMA 1SMYD 4DGZA 3U58A 3T51B 1XXGA 1YJ9A 2UUCQ 1B9NA 1HNXQ 1BBWA 3HOVB 4DV0Q 1U4MA 3D3RA 2WV6D 1KDCA 1TKWB 4L5RC 3AEVA 4K5WA 2JSOA 1V1OA 1GO3E 1KDBA 1VQGA 1QCBD 3P1HA 5KGUA 3A74A 3IKJA 5IT9c 4WFN3 3I4MB 5BN3A 1BKBA 1N9WA 1OXUA 3WDNA 2JA5B 2B2WA 4DNIA 3NTHA 2XVSA 5I2XA 3RZOB 4OIJA 1LO5D 1DOLA 5CBEE 2A73B 5IYBG 3ERSX 4HMJA 1IBKL 4C3HB 3RLNA 1E0BA 1KNAA 1EIHA 4KJOA 5CV4A 3GV3A 3TP8A 3J7ZC 3NQTA 4G7HC 5ELFA 3VA5A 4UPAA 2IW3A 2XRSD 1IW7C 5IGFA 2R7FA 4KHZA 1EZ8A 2F1MA 2VZAA 3J7A5 1JWUD 3FEWX 4PZ7A 3DXJC 1DXMA 1PXUA 2A69C 2EY2A 4ZCKA 1IBKQ 5EBDA 1Z6HA 4DR1L 1NAPA 4A3BH 3MXNB 2KOLA 2FXQA 4PZ6A 1U5KA 1S3OA 2Z9HA 3NENA 3GTKB 3H0GH 4XIGS 2M00A 2VY3A 1D1KA 2I07B 2N49A 5C3EG 4YCUA 5EBCA 2I46A 4DV4L 4Y52H 5EPLA 5M5YH 2B8GA 5J1ZA 4A3MB 5M3MB 2EJFC 1YJNA 4XYQA 3R2IA 1XYIA 3TS0A 5LMNW 4KY5A 4UP7A 4HAEA 1IXRA 1NSNS 1PZJD 1VQ9A 1I50H 4HEDA 4YY3L 4JYAL 3NTKA 2LMCB 3S9WA 1E24A 2CWPA 3ONAB 1ENCA 2EYLA 1SNPA 3V05A 5EAYA 1HA5A 2QILA 1LM0A 5IGBA 1OTCA 2E2HB 1NR2A 2CQOA 1QB5D 1K83B 3DHQA 4ZRZA 4C3JH 3FVQA 4DV4Q 2L4NA 3CF5A 5LMUQ 4IPGA 3CHBD 5I4DA 2EPBA 4NPSA 1G2TA 1J5EQ 4A3GG 1PVOA 3JAME 3NTIA 1BCPD 2WACA 1D5XC 4IPDA 5JEAG 4LF7L 2CQAA 4JI5L 2YYZA 2VL6A 5GAEC 1B70B 1OXTA 3H3VC 2R7ZH 2O5JC 3SE0A 1YHAA 4PMBA 5EJWA 4JYAQ 3S2HH 1BCPF 4JI8L 1CKNA 1GOZA 2PQAB 1OO9B 1EYAA 2N78A 4K0KL 4GNXA 4A3EB 3IRBA 3QIAA 3I73A 4K5XA 3HOVG 3VA7A 3FPPA 2Q2HA 1S40A 1JWMD 4DV2Q 1J6QA 3HOUB 2MPMA 1YNND 5CYUA 4JI5Q 4BBSB 3PUVA 3NP8A 3EROA 1IZ6A 2JA6H 4AQYQ 2F0HA 2ID0A 1S4ZA 1LTTD 1BUVT 2XNAC 3I4MG 1N36L 3UDXA 3LX0A 3NBHB 4JI8Q 5IYCH 1Q82C 2RBMA 1B50A 1Y1WG 3A0JA 3G71A 3BU2A 1WCMG 4UHVA 1RIPA 4OGQC 1W2BA 2JA8B 1VQAA 4A3DH 4P72A 2IY5B 1EOVA 1MKHA 1L2FA 1JJGA 4XQNA 1KL9A 2NVTH 3M9BA 2IJ0A 3K8AA 4WRDA 1KC8C 5AJ3Q 4JOIC 3SK4A 1TU2B 4JW0A 2KHSA 4QCLA 2Z6KA 1H95A 4OXPA 4LWCA 3F2CA 1N36Q 3CC7A 3C1EA 3M4OB 1HFNA 3NPPA 4P73A 4OX9L 1ASZA 1Y69U 1UEBA 4UDUC 3GTGB 1HZBA 5JAVA 1PLFA 5HURA 3K5OA 1GJXA 4DK1A 2NN6G 2IX0A 3EA6A 2WP8J 2EDGA 4CDDC 2PCFB 4NMZA 5C0XI 4DUZL 5M5WB 1IYUA 1EZ6A 3PO3H 3J81E 3ZYYX 4OWWB 1VQHA 3W2DA 4FF1A 4POFA 3AFQA 2NZHA 4FDBA 4ODGA 1I6HB 2JA7G 1CFMA 4U68A 1QNKA 2VUMB 1PFBA 1NCVA 2KCNA 1YITA 4FF3A 4Y7NB 3DM1A 1KLUD 4UP8A 3S1RH 2WIIB 3S24A 4MTNA 4A3FG 1QOHA 4PQXA 4OX9Q 1STEA 1NMGA 4IUVA 4JC0A 1TR5A 2ASBA 3M3YH 2HIVA 5LL6S 1LTRD 1XMOQ 2A68C 3WOEA 1ZKOA 2ZTDA 1O7IA 4DUZQ 3VYTA 2YU9H 3HOWH 3PCOB 2NN6I 3D8GA 3S1NH 3PUZA 1H9KA 2WAQB 4C1NK 2F0GA 3M85A 5IWAL 1DCZA 4R1JA 4B3RL 3MEHA 1VS0A 3M7GA 2CW0D 5H1SE 1TIID 1EY5A 5IYDH 1KAAA 2DGYA 4OELB 3NBIA 3S1MB 3CPFA 3TN2A 2PPBC 1FD7D 3OIPA 2RKSA 1WTRA 3KUPA 2VNUD 2J7ZA 2NZ1D 2K04A 3NHHA 1ET6A 3W1BA 3HOXH 3EQLC 4RGOS 1LABA 5FO7B 1AP0A 1AZPA 4QGUA 3G6EA 1F9QA 5FO9B 3OIQA 5IWAQ 1WTPA 1GUSA 4B3RQ 4XT1B 4IUUA 4N8X1 1B3QA 4EQ5A 1B8AA 1PMRA 3GTMB 5JOBA 1SAPA 3UI2A 4RA8A 4NDXA 3BDLA 4AIMA 3SGIA 4U673 2ZM6L 1PHJA 1WTXA 3BVZA 2J4XA 2BA0A 4LMQD 3MZ5A 1A0IA 1TWCH 4B3SL 5C4JH 3HOUG 1X54A 4FNFA 1M4VA 2ATWA 3CMEA 3K0YA 1A8VA 1VQDA 2EY5A 3JAML 5LMNL 1Q8IA 4BY7H 1F2ZA 3T53B 5DM63 3PF4A 1I3QH 4LUZA 4C3IH 2X69A 1RL2A 3PSIA 1Y8PB 4LFCL 1Q86C 1XMQL 2C9OA 1R9TH 1XNQL 1CQFA 2J0TD 5GAHC 4HN7A 1VQJA 2ZM6Q 3PO2G 3PUWA 3EVQA 2RDFA 4O42A 2VQEL 2ZJQA 1W6KA 1G51A 1STHA 1SEBD 2VQFL 1WD0A 4B3SQ 3H3VI 1PH1A 1WTOA 2WAQE 4LK1C 4LUOA 5LMNQ 4JG2A 1AW7A 4A3JG 1CZWA 3K80C 3MXPA 2PW7A 1QZGA 1O7ZA 2JEBI 1BDOA 1ZYRC 2F0LA 3BG3A 2P5ZX 2FHTA 1HRJA 2KCCA 4BBRH 5IYBH 3K7AH 1QVGA 2HHHL 4LFCQ 1PTOH 3PIP3 1XMQQ 1CQVA 1V1PB 2YTXA 1XNQQ 2F03A 2WFWA 2RHQB 4ZYSA 4B3ML 2ZXPA 3I4NB 5ELBA 2UU9L 2HIXA 3HOZB 1RTOA 1VQOA 2VQEQ 1S72A 1WFQA 3A8IE 2EXDA 4A75A 2UXBL 2VQFQ 4HCSA 2FINB 4X62L 1PFNA 2F0MA 2IHFA 1RKNA 2ES2A 2VUMG 1N32L 5BN5A 4YWLA 1YNJC 4EVOA 3WOFA 1UE6A 2NTSA 1NY4A 2PZTA 1JB7A 2HHHQ 2F0UA 2MHVA 3KBGA 2ZTCA 3I2ZA 1VCIA 4A76A 3T1HL 1JOQA 2A6EC 2SDFA 4NB3A 3HOYB 1CA6A 1LTID 1TWHB 5C3EH 4AYBB 2XWJB 1FNUA 2LXJA 2UXBQ 2WAQG 4X62Q 4K8IA 4R8NA 5KNBA 1GHJA 3B6YA 1H9SB 5LHY1 4RHRA 2L12A 3J81L 5M3FH 3K6OA 3AQQA 1SYDA 3N52A 5FJ8G 1KRSA 4JBKA 3KF8A 3PV0A 1UE7A 4MTKA 3MC0B 5EKKA 1PH6A 5IODA 3N6RA 4OHJA 3BDOA 3Q23A 3T1HQ 5D3IB 1VQPA 5FLMG 1X6OA 4KN7C 5KRUA 5C4HA 2KA7A 1A63A 5IOCA 2RDGA 3FP9A 2M2LA 2E2DC 3KLRA 2ICEC 4YCWA 3J80i 1EFID 4A3GH 1VQCA 3RN2A 3MEFA 1M90C 2EXZA 4KY6A 2QKIC 5JEAH 5L37A 3CCMA 5JJLA 3NXWA 1M8AA 5CC4A 4JBJA 3GTPH 3HG9A 2HCCA 2JP1A 4ME3A 1JORA 1G6PA 1SNQA 3S2DB 3RN5A 1SRUA 1YHQA 4J6HA 3BDCA 4YWKA 4MZ9A 3GV6A 3HKZG 1VQKA 3PQIA 1A15A 2KHIA 5C0XJ 4BXXH 1PH3A 1N34L 2UUAL 5DEHA 3TRZA 3E3XA 4WJ4A 3PUYA 1SXTA 2K1BA 4PG3A 5GQOA 3ER0A 4ZKBB 1PH2A 3C3LA 3T4AC 1EL0A 3DMUA 2EYHA 5C3WA 1Q81C 2LS01 2A5HA 2AQ2B 4TQUS 1DONA 4AYBE 2NVYH 4M1UB 3QWNA 1GUOA 1K73C 3S16B 4LUVA 5CR3A 1XX8A 1EYCA 2NZOA 1Y1WH 3J80c 3FDTA 4APVA 3DUZA 1HR0W 1LACA 1WCMH 5EQ0A 3Q0AA 3D6CA 4A4IA 1N34Q 1RJTA 2UUAQ 2IPKD 2B63G 4A3IB 3AMUA 3D4DA 2AQ3B 1SBBB 1EQRA 2Z6KC 3CAMA 1HJPA 3CCUA 3I4NG 3CU7A 2K52A 3FKIB 3TQYA 4IPCA 5C44G 4H02A 1NNXA 3H94A 4NXMQ 1CSPA 1K28A 3I4LA 3VYUA 2ZTEA 2G9HD 3GTOB 2RA4A 4JV5L 3SK5A 1IW7D 4LAAA 3FMCA 1QUQB 2NN6H 2QA4A 5J3BA 1HNXL 5C3XA 1L0WA 2F0JA 5IGGA 2EQSA 5KNDA 4OO1I 3G4SA 3A7AB 4DAPA 4XYOA 4P74A 2A69D 2K6AA 5IP7H 5FLXc 1D8LA 4QJFA 4XT3B 3M7NA 2JA7H 4LNQA 2I5MX 1XPUA 3SEBA 4MHEA 2D2CC 3CQZH 2OTLA 2R6GA 2K75A 1T9HA 4JV5Q 1SFOH 4A3FH 3BZDB 1TWGH 4CDFC 1A62A 1K9MC 2NVXB 1JOOA 4DV5Q 3TREA 4DV6L 3P75A 3S15B 2QF7A 3G48A 4A93G 4G57A 2E2JB 2RQXA 1HZAA 3LWEA 4PV1C 2B2TA 3AFPA 2F3WA 3TEHB 5I9OA 4C2MH 2D62A 1EEID 3RLFA 2Z0SA 3HGBA 2XN9C 3GTJB 1HZ9A 2IT1A 3CC4A 4H44C 3F8TA 4ALPA 3S14B 4K6LA 4KLKA 5M9OA 4WORA 5CV7A 4K5VA 1P8LA 1AE3A 3SK8A 2ENBA 4KD3A 2Q2UA 2XGTA 1LUZA 3RR5A 4DV6Q 1UUPA 3QO2A 1PH9A 1AZQA 1KXLA 4OL7A 1EY9A 1B44D 1EY7A 5K36G 1KNEA 1HQRD 4A3LG 4DNTB 5AFWA 1KRTA 2WB1B 3OYYA 1CHPD 1SYEA 2K03A 1F9PA 1LT3D 4JBMA 1SLJA 2R92B 2LXKA 4GZYC 1F2MA 2KECA 4EQPA 1FGUA 2X6GA 4M8AA 1TXYA 2PI2E 1NBWA 1MIUA 2MO1A 3I8ZA 3G7LA 3DEPA 4HIKA 3KDFA 2PMZB 2Z4IA 4JPBW 1Y1VB 4EQOA 1SNCA 2EE1A 3I72A 2KUMA 4A3KG 1QILA 2Y0SB 4BA2I 3CRLC 4IOAA 1X3EA 4BY1B 4DFAA 5LMUL 1EU3A 3A8JE 5TSSA 1J5EL 1DOMA 2EYJA 4GLXA 3PO2H 3S1QB 1EYGA 3K5NA 4A3IG 1C0AA 3P20A 4H0LC 3URYA 2R7DA 1Q90A 3T13A 1PH7A 3E9HA 2A74C 2B2UA 1BF4A 4FYDA 2MGSA 4A3JH 4DV1L 2N8NA 1HTPA 2HQLA 1D2BA 2CH4A 1ONLA 5M5XB 4LFBL 5LL6X 1A2UA 2XTIA 4I7ZC 1GUGA 4IQZA 3KFUA 3CP0A 3AB9A 1C4QA 3MFYA 5JPNC 1Q3LA 3OHXC 5EGTA 3D4WA 4DAYA 1IKLA 1HQMC 4HSVA 1LTAD 3RZDH 3W3AA 2A6HD 5M5WH 4DV2L 1NMFA 1O80A 4GN5A 2OF1A 5I6WA 2CKZB 2ZXRA 3DM3A 4AQYL 3J80E 1E2ZA 2KHJA 2WB1E 4ZLTF 4DV1Q 4KY7A 1WVLA 4FXGC 4LFBQ 1QE6A 1D6EC 3UDIA 4DR5L 4L5SA 2E76C 1TS2A 1CTMA 1AE2A 1ZXTA 1CKMA 2PMZE 5CGKA 1FL0A 3BYYB 1HR0L 5E4XA 2EYPA 3K58A 3EBEA 4DXFA 1D1IA 5IGDA 2R93H 1GHKA 5CV5A 1SYBA 1BO0A 3SVMA 5AJ3L 3NQIA 1G291 1YHBA 2K05A 2A68D 1K3RA 4X3SA 1E7ZA 3NE5B 3Q6SA 4IFDI 3TBIB 3U4ZA 2Y0SE 4F7XA 3MAQA 1Z9FA 1SR3A 2JA5G 5FJ8H 1I4XA 1RD9D 1OXXK 3H09A 2N88A 5FO8B 1LYLA 1TT2A 4R9WA 2DNCA 3BVGA 4DR5Q 5C0XG 1TS5A 4IJLA 3L3OC 2F0QA 1BBUA 1QNUA 1L1OA 4MNOA 5BN4A 4C3HG 3EIVA 4A3BB 3CXCA 2OWOA 2K01A 4Z9CB 5FLMH 1XTCD 1HR0Q 1HH2P 3A54A 3U4VA 3OWFA 3H0GB 3C46A 2JEAI 1UE1A 2TSSA 4QUCA 2WB1G 4GN3B 3H91A 3F1ZA 4DU9A 3GTMH 3GTQH 5M5YB 3F2DA 1EWCA 5JJKA 1STGA 2C35B 1STNA 2L11A 1F9SA 4FP5D 3GP7A 3GTLH 1R4PB 4DK6C 2E8GA 2R3ZA 2AUJD 2GVBA 3CW2C 1XMOL 3K7UC 1RCVD 1VQEA 3P7JA 1PV4A 3HFZB 1V9PA 1PH8A 1Y1VG 1LTGD 2DUDA 3LGJA 5IT9E 2AWOA 2MO0A 4RH6A 2RVLA 1SE8A 2TMPA 2CHBD 1I4QA 3PIOA 2V4DA 1V43A 3SHLA 4C3JB 2Y0SG 4B9WA 5COYA 4LF9L 1ICFB 4A3MG 5M3MG 4EX5A 3I90A 2AKWB 5CV9A 1SNMA 3R2TA 1LLRD 2F0FA 4CKEA 3K5MA 1HFGA 3PF5A 4B08A 1GD7A 3ICEA 1ET9A 2R7ZB 3KJOA 3K5LA 3CPWA 4P2CB 1QVFA 3QB3A 3S2HB 4WJ3M 1KLGD 3OOCA 1MJCA 5BR8L 2B2YA 2AQ1B 1I5FA 5KEEA 4P71A 2KEDA 2K32A 2B63H 1IYVA 1GKHA 4LF9Q 1II3A 3PMFA 3I4NH 3TMEA 2NBFA 2IWHA 5C44H 1AH9A 1Z47A 2ZJRA 1YVCA 1QG7A 4A3CG 3KYHC 2JA6B 2MUYA 1MBYA 2MP1A 1PFMA 4ULLA 2G5DA 2DJGC 4JI3L 5BR8Q 2RCFA 3UE0A 1YBYA 1R4QB 4HIOA 1WYDA 3ULPA 4A3EG 4A3DB 2PO4A 5ELEA 3I7FA 1YNJD 4CDEC 3MTSA 3RLOA 4RAUC 3TZDA 1TWHH 2AHOB 4JBWA 3A7LA 3IAYA 1WD1A 4QQBX 4P75A 2NVTB 1A3UA 2A6ED 4BBSG 1W6JA 2L0CA 1GM5A 1K0RA 1I6VC 1TWAH 2QDBA 1CSQA 4DPGA 4LF8L 1YJWA 2PW5A 2E2IB 1FYCA 2HDLA 1U0LA 4ZUJA 1XNRQ 2LFNA 2O2LD 2I5HA 4RGMA 4JI3Q 3EJIA 4HIDA 3T1YL 4A93H 3DWAA 1SNDA 4RGTA 4KKTA 2JA8G 1GUTA 2D0OA 2XSCA 1MSHA 2B2WC 5GROA 2WINB 1FNVA 1TWFH 1B7YB 1PZKD 4DR7L 1YNXA 3PO3B 3G6JB 4CJ0B 1XPOA 1IKMA 2LKVA 5C6AA 4LF8Q 3S17H 1JR0D 4CHTB 3VR5A 2Z1CA 3S1RB 3I91A 1SNOA 3T1YQ 1NUCA 4E6IA 1RHPA 1E1TA 2ZJPA 4X3UA 1KD1C 3M3YB 4HSPA 1KIXA 5K36H 2A19A 4OEMB 4KD4A 4KJNA 3CD6A 4A3LH 1S5ED 2YU9B 3HOWB 1A3VA 3S1NB 3SXHA 2D5DA 2N3SA 4DR7Q 1FR3A 4JI7L 4IJHA 1LTSD 1SE2A 4C3JG 5ELNA 4K8JA 3C1FA 2XWBB 4IUNA 3L2PA 2KJXA 4GLVB 2EYOA 1JE4A 1DM0B 3MXUA 3Q22A 2OQ0A 3I4OA 4O1NA 1Q1EA 3RD4A 1PZID 3CCLA 1SE4A 3KDFB 3TP6A 2MNAA 4B3TL 3CCEA 4JI6L 1A3TA 4G7ZC 5JPMC 3HOXB 4A3KH 5ELCA 4X66Q 2K50A 2PQAA 2F0EA 2UXDL 5IT9L 2KQ3A 4LF4Q 3GO5A 3K81C 4X64L 5HGQA 2BDOA 4JI7Q 1SDFA 2AWNA 2B2UC 3VDYA 4A3IH 4L5TA 4TKOB 1AN8A 5JVH3 3MXGA 4IFDJ 1LT6D 3HEJA 1ML0D 4DAMA 3K59A 2Z4HA 3KOJA 3H6MA 4KK7A 1TWCB 2PZWA 4OWTB 5C4JB 4LF6L 2NTTA 2Q8TA 4B3TQ 3A5UA 1IL8A 4JI6Q 1LTBD 4FXKC 4BY7B 2JA6G 2EJMA 1I3QB 4C3IB 2SEBD 4DKAC 2UXDQ 1B4OA 4X3TA 2RDHA 2SNSA 5ISRA 4X64Q 1R9TB 1NR4A 2Q8IB 1K8GA 2V1CC 1F2YA 3TP7A 3CMAA 3FPUB 4IUTA 3CC2A 2R61A 1Q1BA 1HA6A 1H9RA 1VQ6A 1XTDA 4DAYB 1PTOC 5I2YA 3HP3A 3JAMi 5CORA 1S5CD 4GNXC 4IOCA 4LF6Q 1T5XD 5FK9C 4YIJA 5F2DA 2PYKA 1FJGL 2NVQH 3W5OA 4GOPA 1PRTC 3ND9A 3A8KE 2CFMA 1L0XB 3V2TA 1MHWC 2H1EA 1C48A 2L5TA 4BBRB 1CKNB 3K7AB 1PTOB 1WTQA 1ICWA 3E9IA 4R4QA 1EY4A 4GNXB 3HOVH 4HTHA 2AUKA 2LSSA 4GKKQ 3WWVA 2LY7A 1VQ8A 4XDXA 2K5NA 1HNZL 4PMCA 2Z6BA 1PRTB 2AMCB 1VQBA 1TY2A 2D9UA 4HMIA 4OIKA 1S5BD 1CI3M 3EN2A 4NXML 2CH4W 3E5SA 3I4MH 1Q46A 3OMGA 4IN3A 1L1OC 1X65A 2JA5H 1FJGQ 1ESFA 4DR3L 3TS2A 4QY7A 2K5HA 3RZOH 2YTVA 5C0XH 2EJGC 1EIGA 4L6TB 3NWSA 3CKIB 4CBVA 3CCRA 4FF2A 1SSOA 4OO1G 4C3HH 3HZXA 2BE5C 1TY0A 1C7YA 1DYQA 4HJ7A 1L1OB 4KKSA 3JAMc 2H4OA 3HOZG 2B29A 1VQIA 1HNZQ 2FFKB 2PNRC 1STAA 1EY6A 3HOWG 1K0SA 5C3EB 4IUQA 3IFTA 4YHHL 1SYGA 2K5QA 4EQNA 1VMPA 1L0YB 2IL8A 3I3CA 3ZJYC 1JT8A 1IHZA 4DR3Q 2QDLA 2QW7A 2A8VA 5M3FB 5IYDG 3VR3A 3ULJA 1Y8NB 4DV5L 5JVG3 2DNEA 1IBLL 2CCZA 2KBNA 1EQTA 1Y1VH 1V1QA 5CMDA 3GTKH 3HOYG 1XPRA 4N9TA 5G3LF 2MQHA 1B2TA 1SYFA 2O4XA 1JC7A 2JA9A 4AYBG 4YHHQ 2WKDA 1KABA 4L5QA 3F2BA 3J81i 4A3MH 3V96A 2KCMA 1UWVA 5M3MH 1JE5A 4HJAA 2YV5A 2DN8A 3AU7A 5KNCA 2I0QA 4A3GB 2BA1A 3MHBA 1JJ2A 3STBC 3E0EA 4F8MA 1G6ZA 2B2YC 3KF6A 4KHVA 3BS1A 1IBLQ 1CHQD 5KYIA 1I4RA 3M4PA 3TSSA 3GTPB 3U9OA 3BYTB 1RODA 2EZVA 1C8CA 4LFAL 5M5XH 1BVSA 1H9JA 2E2HH 4YWMA 1K83H 2B39A 2L1BA 1EFWA 3K57A 4N8FA 1SYCA 2JJQA 1MJEA 2D0PA 5IP9G 4DN4M 3AYHB 1VQLA 4DA2A 2QCPX 5I6YA 3CCJA 1EQQA 3R8BA 3CCVA 3QOLA 4NXNL 4B9XA 2XIWA 5FOBB 4A3CH 1VQNA 1EWHA 2F0WA 1I4HA 3U50C 5GAGC 5E1FA 4CKBA 2NVYB 1WTWA 4LFAQ 3ULLA 4KHPL 4ZKCB 4JVZA 1RTNA 2KENA 4XQJA 3J81c 4ZAIA 1VF7A 1Y1WB 1V1PA 4KV6A 1DJRD 1WCMB 1IBML 5CBAE 3NWTA 4BBRG 4A3EH 1PYBA 3BJUA 5T1IA 4CJ2C 3H3VH 1B9MA 3HKSA 1Y8OB 3Q8DA 1NTGA 1B3AA 3HOUH 1WJJA 4BBSH 4C1NI 4NXNQ 2KVMA 1ILPA 1U4PA 2EY6A 1JCKB 1O7YA 3L7ZC 1EOTA 2BDNA 1KQSA 4JI4L 4RKLA 3NSWA 1S5DD 3H15A 4KHPQ 1EY8A 2KCTA 1JWSD 2HQEA 3ND8A 1N8RC 1WOCA 2HD3A 2RCNA 1IBMQ 2JA8H 4CGYB 3A56A 4G4KA 3BVMA 1HZCA 4RMFA 1ESRA 4XXEA 1LTLA 3LNNA 1GXDC 2QGQA 4X6AH 1CM9A 4J8QA 2L9HA 1DD2A 1EYDA 3FKIG 2OQKA 3OWEB 2EY1A 4K14A 4PZ8A 1H9SA 1CK1A 1HCZA 1TVXA 2JA7B 1NE3A 1SMYC 1BXTA 3GQBA 4KN4C 4S3SA 5CV6A 4JI4Q 3CQZB 3M4OH 4L63B 5C4XB 1FNWA 5M3FG 1SFOB 4A3FB 4QF4A 1TWGB 3GTGH 4KI0A 1N33L 1VQ4A 1S5FD 4UP9A 4KMUC 2Z8LA 1WTHA 1SE3A 1V8QA 4DR1Q 3VYSA 3OTOL 2F0VA 1QZHA 4KTAA 4K2KA 1F9RA 3MFGA 4IFDG 4NKLA 4HJ5A 4C2MB 2VB3X 3D4RA 2BH8A 1I6HH 1IL2A 2E5LL 2VUMH 2NYZD 4JI2L 4KKUA 2JQOA 4Y7NH 3UDFA 5JJZA 4DXGA 1JJCB 5I9PA 1KAWA 2ZXOA 4HR7B 4RG1A 2RSOA 4IPHA 4GLAC 5EKIA 2DY7A 1N33Q 2B2VA 2JK8A 1BR9A 1VQFA 3DLLA 3K0XA 5DM73 4HJ8A 1WTVA 3OTOQ 1BNZA 4YY3Q 1E2WA 2F3VA 5D3DA 4PMWA 1HPCA 3SR1A 3U9SA 2F0KA 1Y14B 1ILQA 1RF2D 2E5LQ 4RWSC 4BXXG 5C5LA 4JI2Q 4C56C 3S1MH 2Q8RE 1PFSA 4H7BA 2QEJC 1YI2A 1D5ZC 3I70A 3PUXA 4LF5L 5IGEA 5FLXE 3KF8B 3KLSX 3L9AX 4LF7Q 3MA2B 4CKCA 1J9OA 1PDQA 5HGTA 1HUNA 4X3KA 1I94L 4GN4B 1CZGA 4QMGA 1PYSB 1NJIC 1BBXC 1ENFA 4PNYA 2B8FA 3UE1A 2EYFA 3Q24A 5DNFA 3T56B 4LW1A 2R92G 1J8IA 1OXVA 4K0KQ 4IO9A 4R4IA 1HXYD 4DAVA 3PO2B 4GOPC 5HY6A 3PIPA 1YIJA 2F0IA 5IGCA 1QVCA 2IX3A 4LF5Q 4BWGB 3I55A 1I50B 3IFDA 3A5ZB 1Q8KA 5A2QE 4A3JB 3O13A 3GDEA 3KLWA 2E2IH 1I94Q 4O2DA 3M4YA 1UAPA 4GS3A 4HJ9A 1QUQA 4RCOA 4GOPB 2A6HC 1PYWD 1SMXA 3R3OA 1BCPC 2PI2A 1STBA 3D6WA 1DGSA 2HDMA 4BY1G 4FO2A 3NELA 3QG1A 3QOJA 3VR4A 4R4OA 4DR4L 1K3BC 3SDZA 3RZDB 2FMCA 4OONA 1G91A 2GVAA 4DV7L 3KBXA 2WKCA 2GN5A 3D31A 3IL8A 1VQMA 3F2UA 5IP7G 3NEMA 1EIYB 1BCPB 3SK6A 4QIWB 1U4RA 2I5LX 2ICIA 2N55A 3ITPA 1HTLD 3CCSA 1PH4A 5C4XG 3QJYA 4O0AA 4RKBA 3HRZC 4DNRB 4OO1H 4UY8C 4QUFA 1YNNC 3OPOA 5DLQE 1ZYRD 2PZUA 4DR4Q 1TQOA 2JN4A 3HOZH 2R93B 3RNUA 2JYOA 3R93A 4J15A 4DV7Q 4POGA 4TRDA 2K33A 2IHEA 1U9RA 4ZK9B
chains in the Genus database with same CATH topology
5K5PA 4LJZC 4BA1I 1BOSA 2F0NA 3NK9A 4ID6A 3E6ZX 5D65A 4ME5A 3T16A 2NUCA 2O5IC 2L55A 2NB0A 1F77A 1VMCA 3VYRA 2SOBA 1STYA 1HUMA 1MSGA 2F0TA 2FMMA 3GTQB 1DOKA 1K8MA 2IX1A 1ENAA 3J80L 2F0DA 3GTLB 3OSOA 2B2TC 2OXPA 1B1ZA 2MJ8A 4Q0FA 3DEOA 4MN3A 3MXNA 1DZ1A 1UEAB 2OEOA 4RHSA 3X3NA 5EPJA 5J22A 1X3PA 5DAUA 2CVRA 1SJED 1H9MA 3HKZB 1TS3A 5E3FA 2BOSA 3J7AV 1MGSA 3MWYW 3KLSA 3CRKC 1O7LA 3DWQA 4R8IA 2M9VA 2EOTA 2JE6I 1I4GA 3LWUA 1EU4A 2SNMA 2BCOA 2XRQD 2HCIA 2CW0C 3ERQA 5FLXL 3C2PA 1PTOD 1VF5C 1LV9A 4DK0A 3X3MA 2RSNA 1ZEQX 2B63B 1PRTD 1EY0A 4JK1C 1PTOF 5IIFA 1LT5D 1SJHD 5KYLA 5C5MA 1XWEA 5C44B 4K2LA 2K5WA 1PRTF 4RCNA 2ZT9C 1B53A 3PIO3 4MIUA 4DF7A 1KTKA 2JXMB 5A2QL 4F88A 1QJOA 1QWYA 4BS9A 4J1MA 3J7AF 4RGNA 4L8JA 3GD7A 2E74C 5EKLA 5KIXA 1GUWA 4IUPA 4V190 2PQEA 1HHVA 3TP5A 1BQQT 2BE5D 2KEEA 4NW2A 1MI2A 3NBHA 1I4PA 1TWAB 1KDAA 1JQYD 4ZUIA 2X6LA 4ABNA 5J39A 1X32A 5EPKA 5JEAJ 5D14A 1CT1D 2FJ2A 4A93B 1AFPA 1EEFD 3EFXD 4IURA 2HUGA 3FRPB 4IFDH 4FF4A 5NUCA 1UNSA 1TWFB 3KK7A 5CV8A 4IALA 4XQQA 1U4LA 5C4ZA 2B2VC 1JB3A 3S17B 2DY8A 2OT2A 4ZQ3A 3RMHA 1T5EA 2VXWA 1TS4A 1X3QA 3J7YW 1G2SA 4V0BA 1D5MC 1JOKA 1A6XA 4K6DA 2F0SA 3HS0C 1VDZA 3TZUA 1E2VA 3TDQA 4EGVA 3VR2A 5ELDA 1A2TA 3RUZA 4F87A 1K8OA 2K7VA 1CA5A 3DWPA 3OMCA 3MVVA 4A3KB 4RFBA 4H13C 3NUCA 4QB4A 2EVBA 1G8ZD 2GA4B 4FXDA 2K5DA 5E4WC 3A55A 1MD2D 1LT4D 1O78A 5T1GA 4WJWA 5G3LD 4NP5A 2E75C 1FGBD 2F0OA 5A35A 1OXSC 4I65A 2K28A 4ILWA 4TSSA 3E0JA 2F0PA 3OW7A 2F4IA 3VR6A 4HCEA 1F2LA 4G7OC 5FKAC 4Q5VA 2VB2X 4UAIA 1AEXA 1Q12A 1Z7TA 4XTCS 1EQVA 2NWGA 1GUNA 2C5CA 4N9PA 4IZ8A 2NVQB 2EYMA 4CJ1B 1RDPD 4C3IG 1JICA 2G9DA 4FVMA 1SMYD 4DGZA 3T51B 1XXGA 1B9NA 3HOVB 1U4MA 3D3RA 2WV6D 1KDCA 1TKWB 4K5WA 2JSOA 1V1OA 1KDBA 1QCBD 3P1HA 5KGUA 3IKJA 4WFN3 3I4MB 5BN3A 1OXUA 3WDNA 2JA5B 2B2WA 3NTHA 2XVSA 5I2XA 3RZOB 4OIJA 1LO5D 1DOLA 5CBEE 2A73B 4HMJA 4C3HB 1E0BA 1KNAA 1EIHA 4KJOA 5CV4A 3GV3A 3TP8A 3NQTA 4G7HC 5ELFA 3VA5A 2IW3A 2XRSD 1IW7C 5IGFA 4KHZA 1EZ8A 2F1MA 1JWUD 3FEWX 3DXJC 1DXMA 1PXUA 2A69C 2EY2A 5EBDA 1Z6HA 1NAPA 2KOLA 3GTKB 4XIGS 2M00A 1D1KA 2I07B 5EBCA 2I46A 5EPLA 2B8GA 5J1ZA 4A3MB 5M3MB 2EJFC 4XYQA 3R2IA 1XYIA 4KY5A 4HAEA 1NSNS 1PZJD 4HEDA 3NTKA 2LMCB 3S9WA 3ONAB 1ENCA 2EYLA 1SNPA 3V05A 1HA5A 2QILA 5IGBA 2E2HB 1NR2A 1QB5D 1K83B 3DHQA 4ZRZA 3FVQA 2L4NA 3CHBD 5I4DA 2EPBA 1G2TA 3JAME 3NTIA 1BCPD 2WACA 1D5XC 5JEAG 2CQAA 2YYZA 3H3VC 1OXTA 2O5JC 3SE0A 4PMBA 5EJWA 1BCPF 1GOZA 1OO9B 1EYAA 4A3EB 3QIAA 3I73A 4K5XA 3VA7A 3FPPA 1JWMD 3HOUB 2MPMA 1YNND 5CYUA 4BBSB 3PUVA 3NP8A 3EROA 2F0HA 2ID0A 1S4ZA 1LTTD 1BUVT 2XNAC 3LX0A 2RBMA 1B50A 4OGQC 2JA8B 4XQNA 4WRDA 2IJ0A 3SK4A 1TU2B 2KHSA 4QCLA 3C1EA 3M4OB 1HFNA 3NPPA 1Y69U 4UDUC 3GTGB 5JAVA 1PLFA 5HURA 3K5OA 1GJXA 4DK1A 2NN6G 2IX0A 3EA6A 2WP8J 2EDGA 2PCFB 4NMZA 5C0XI 5M5WB 1IYUA 1EZ6A 3J81E 3ZYYX 3W2DA 4FF1A 4ODGA 1I6HB 2VUMB 1CFMA 4U68A 1QNKA 1PFBA 1NCVA 2KCNA 4FF3A 4Y7NB 3DM1A 1KLUD 2WIIB 1QOHA 4PQXA 1STEA 4IUVA 1TR5A 5LL6S 1LTRD 2A68C 3WOEA 1ZKOA 3VYTA 2NN6I 3D8GA 3PUZA 1H9KA 2WAQB 4C1NK 2F0GA 3M85A 1DCZA 3MEHA 3M7GA 2CW0D 1TIID 1EY5A 1KAAA 3NBIA 3S1MB 3TN2A 2PPBC 1FD7D 3OIPA 2RKSA 1WTRA 3KUPA 2VNUD 2J7ZA 2NZ1D 2K04A 3NHHA 1ET6A 3EQLC 4RGOS 1LABA 5FO7B 1AP0A 1AZPA 1F9QA 5FO9B 3OIQA 1WTPA 1GUSA 4XT1B 4IUUA 3GTMB 1PMRA 5JOBA 1SAPA 3UI2A 4RA8A 4NDXA 3BDLA 4U673 1WTXA 3BVZA 2J4XA 2BA0A 4LMQD 3MZ5A 4FNFA 1M4VA 3K0YA 3JAML 2EY5A 1Q8IA 1F2ZA 3T53B 5DM63 2X69A 1Y8PB 2C9OA 1CQFA 2J0TD 4HN7A 3PUWA 3EVQA 2RDFA 4O42A 1W6KA 1STHA 1SEBD 1WD0A 1WTOA 4LK1C 1AW7A 1CZWA 3MXPA 2PW7A 1O7ZA 2JEBI 1BDOA 1ZYRC 2F0LA 3BG3A 2FHTA 1HRJA 2KCCA 1PTOH 3PIP3 1CQVA 1V1PB 2F03A 4ZYSA 2ZXPA 3I4NB 5ELBA 3HOZB 1RTOA 3A8IE 4HCSA 2FINB 1PFNA 2F0MA 1RKNA 5BN5A 1YNJC 4EVOA 3WOFA 2NTSA 2PZTA 2F0UA 2MHVA 3KBGA 1VCIA 1JOQA 2A6EC 2SDFA 3HOYB 1CA6A 1LTID 1TWHB 4AYBB 2XWJB 1FNUA 4K8IA 4R8NA 5KNBA 1GHJA 1H9SB 5LHY1 4RHRA 2L12A 3J81L 3K6OA 1SYDA 3N52A 3KF8A 3PV0A 5EKKA 3MC0B 5IODA 3N6RA 4OHJA 3BDOA 3Q23A 5D3IB 4KN7C 5KRUA 5C4HA 2KA7A 5IOCA 2RDGA 2M2LA 2E2DC 3KLRA 2ICEC 1EFID 2EXZA 4KY6A 2QKIC 5JEAH 3NXWA 1M8AA 5CC4A 3HG9A 2HCCA 2JP1A 1JORA 1SNQA 3S2DB 4J6HA 3BDCA 3GV6A 1A15A 5C0XJ 5DEHA 3PUYA 1SXTA 2K1BA 4ZKBB 3C3LA 1EL0A 3T4AC 3DMUA 2EYHA 5C3WA 2LS01 2A5HA 2AQ2B 4TQUS 1DONA 4M1UB 3QWNA 1GUOA 3S16B 5CR3A 1XX8A 1EYCA 3FDTA 3DUZA 1LACA 5EQ0A 3Q0AA 3D6CA 1RJTA 2IPKD 4A3IB 3AMUA 3D4DA 2AQ3B 1SBBB 3CU7A 3FKIB 3H94A 3I4LA 3VYUA 2G9HD 3GTOB 2RA4A 3SK5A 1IW7D 4LAAA 3FMCA 2NN6H 5C3XA 2F0JA 5IGGA 5KNDA 4OO1I 3A7AB 4DAPA 4XYOA 2A69D 2K6AA 4XT3B 3M7NA 3SEBA 4MHEA 2D2CC 2R6GA 3BZDB 2NVXB 1JOOA 3P75A 3S15B 2QF7A 4G57A 2E2JB 2RQXA 3LWEA 4PV1C 2B2TA 2F3WA 5I9OA 2D62A 1EEID 3RLFA 3HGBA 3GTJB 2XN9C 2IT1A 4H44C 3S14B 4K6LA 5M9OA 4WORA 5CV7A 4K5VA 3SK8A 2ENBA 4KD3A 1UUPA 3QO2A 1AZQA 4OL7A 1EY9A 1B44D 1EY7A 5K36G 1KNEA 1HQRD 4DNTB 5AFWA 2WB1B 1CHPD 1SYEA 2K03A 1F9PA 1LT3D 2R92B 4GZYC 1F2MA 2KECA 4EQPA 2X6GA 4M8AA 3I8ZA 3G7LA 3DEPA 2PMZB 2Z4IA 1Y1VB 4EQOA 1SNCA 2EE1A 3I72A 2KUMA 1QILA 2Y0SB 4BA2I 3CRLC 4BY1B 4DFAA 1EU3A 3A8JE 5TSSA 1DOMA 2EYJA 3S1QB 3K5NA 3P20A 4H0LC 3URYA 1Q90A 3T13A 2A74C 2B2UA 1BF4A 4FYDA 2MGSA 1HTPA 1D2BA 1ONLA 5M5XB 5LL6X 1A2UA 4I7ZC 1GUGA 4IQZA 3AB9A 1C4QA 3MFYA 5JPNC 1Q3LA 3OHXC 5EGTA 3D4WA 4DAYA 1IKLA 1HQMC 4HSVA 1LTAD 3W3AA 2A6HD 1O80A 2OF1A 5I6WA 2ZXRA 3J80E 1E2ZA 4ZLTF 4KY7A 1WVLA 4FXGC 1QE6A 1D6EC 2E76C 1TS2A 1CTMA 1ZXTA 5CGKA 3BYYB 5E4XA 2EYPA 3K58A 5IGDA 4DXFA 1D1IA 1GHKA 5CV5A 1SYBA 1BO0A 3SVMA 3NQIA 1G291 2K05A 2A68D 4X3SA 3NE5B 3Q6SA 4IFDI 3TBIB 4F7XA 3MAQA 1I4XA 1RD9D 1OXXK 3H09A 2N88A 5FO8B 1TT2A 4R9WA 2DNCA 3BVGA 5C0XG 1TS5A 3L3OC 2F0QA 1QNUA 5BN4A 4C3HG 4A3BB 2K01A 4Z9CB 1XTCD 3A54A 3OWFA 3H0GB 3C46A 2JEAI 2TSSA 4QUCA 3H91A 4DU9A 5M5YB 1EWCA 1STGA 4FP5D 1STNA 2L11A 1F9SA 3GP7A 1R4PB 2R3ZA 2AUJD 1RCVD 3P7JA 5IT9E 1LTGD 2AWOA 4RH6A 2RVLA 2TMPA 2CHBD 1I4QA 2V4DA 1V43A 3SHLA 4C3JB 4B9WA 5COYA 3I90A 5CV9A 1SNMA 3R2TA 1LLRD 2F0FA 4CKEA 3K5MA 1HFGA 4B08A 1ET9A 2R7ZB 3K5LA 4P2CB 3QB3A 3S2HB 1KLGD 3OOCA 2B2YA 2AQ1B 5KEEA 2KEDA 2K32A 1IYVA 1II3A 3PMFA 3TMEA 2NBFA 2IWHA 1Z47A 1QG7A 2JA6B 2MUYA 1MBYA 2MP1A 1PFMA 4ULLA 1R4QB 4A3DB 2PO4A 5ELEA 1YNJD 3MTSA 4RAUC 3TZDA 4JBWA 3A7LA 3IAYA 1WD1A 2NVTB 1A3UA 2A6ED 1W6JA 2L0CA 1I6VC 2QDBA 2E2IB 2PW5A 1FYCA 2HDLA 4ZUJA 2LFNA 2O2LD 4RGMA 3EJIA 3DWAA 1SNDA 4RGTA 4KKTA 1GUTA 2XSCA 1MSHA 2B2WC 2WINB 1FNVA 1PZKD 3PO3B 3G6JB 4CJ0B 1IKMA 2LKVA 5C6AA 1JR0D 4CHTB 3VR5A 2Z1CA 3S1RB 3I91A 1SNOA 1NUCA 4E6IA 1RHPA 4X3UA 3M3YB 4HSPA 5K36H 4KD4A 4KJNA 1S5ED 2YU9B 3HOWB 1A3VA 3S1NB 3SXHA 2D5DA 1FR3A 1LTSD 1SE2A 4C3JG 4K8JA 3C1FA 2XWBB 4IUNA 2KJXA 2EYOA 1JE4A 1DM0B 3MXUA 3Q22A 4O1NA 1Q1EA 3RD4A 1PZID 1SE4A 3TP6A 1A3TA 4G7ZC 5JPMC 3HOXB 5ELCA 2F0EA 5IT9L 2KQ3A 3GO5A 2BDOA 1SDFA 2AWNA 2B2UC 4TKOB 1AN8A 5JVH3 3MXGA 4IFDJ 1LT6D 3HEJA 1ML0D 3K59A 2Z4HA 3H6MA 4KK7A 1TWCB 2PZWA 5C4JB 2NTTA 2Q8TA 4BY7B 1IL8A 1LTBD 4FXKC 2EJMA 1I3QB 4C3IB 2SEBD 1B4OA 4X3TA 2RDHA 2SNSA 5ISRA 1R9TB 1NR4A 2Q8IB 1F2YA 3TP7A 3FPUB 4IUTA 2R61A 1Q1BA 1HA6A 1H9RA 1PTOC 5I2YA 3HP3A 5CORA 1S5CD 1T5XD 5FK9C 4YIJA 5F2DA 2PYKA 1PRTC 3ND9A 3A8KE 1L0XB 3V2TA 2H1EA 1C48A 2L5TA 4BBRB 3K7AB 1PTOB 1WTQA 1ICWA 1EY4A 4HTHA 2AUKA 2LY7A 4XDXA 4PMCA 1PRTB 1TY2A 2D9UA 4HMIA 4OIKA 1S5BD 1CI3M 3E5SA 3OMGA 4IN3A 1ESFA 5C0XH 2EJGC 1EIGA 4L6TB 3NWSA 3CKIB 4CBVA 4FF2A 1SSOA 4OO1G 3HZXA 2BE5C 1TY0A 1DYQA 4KKSA 2H4OA 2FFKB 2PNRC 1STAA 1EY6A 5C3EB 4IUQA 3IFTA 1SYGA 2K5QA 4EQNA 1VMPA 1L0YB 2IL8A 3I3CA 1IHZA 5M3FB 3VR3A 1Y8NB 5JVG3 2DNEA 1EQTA 5CMDA 4N9TA 5G3LF 1B2TA 1SYFA 2O4XA 1JC7A 2WKDA 1KABA 3V96A 2DN8A 3AU7A 5KNCA 4A3GB 2BA1A 3MHBA 4F8MA 1G6ZA 2B2YC 3BS1A 4KHVA 1CHQD 5KYIA 1I4RA 3TSSA 3GTPB 3U9OA 3BYTB 1RODA 2EZVA 1C8CA 1H9JA 2B39A 2L1BA 3K57A 1SYCA 4DN4M 4DA2A 2QCPX 5I6YA 3R8BA 3QOLA 4B9XA 2XIWA 5FOBB 1EWHA 2F0WA 1I4HA 5E1FA 4CKBA 2NVYB 1WTWA 4ZKCB 1RTNA 4XQJA 4ZAIA 1VF7A 1Y1WB 1V1PA 4KV6A 1DJRD 1WCMB 5CBAE 3NWTA 5T1IA 4CJ2C 1B9MA 1Y8OB 1B3AA 4C1NI 2KVMA 1ILPA 1U4PA 2EY6A 1JCKB 1O7YA 3L7ZC 1EOTA 2BDNA 4RKLA 3NSWA 1S5DD 1EY8A 1JWSD 2HQEA 3ND8A 4CGYB 3A56A 4G4KA 3BVMA 1ESRA 4XXEA 3LNNA 1GXDC 1CM9A 4J8QA 2L9HA 1DD2A 1EYDA 3OWEB 2EY1A 4K14A 1H9SA 1CK1A 1HCZA 1TVXA 2JA7B 1SMYC 1BXTA 3GQBA 4KN4C 4S3SA 5CV6A 3CQZB 4L63B 5C4XB 1FNWA 1SFOB 4A3FB 4QF4A 1TWGB 4KI0A 1S5FD 4KMUC 2Z8LA 1SE3A 1V8QA 3VYSA 2F0VA 4KTAA 4K2KA 1F9RA 3MFGA 4IFDG 4NKLA 4C2MB 2VB3X 3D4RA 2NYZD 4KKUA 5JJZA 4DXGA 5I9PA 2ZXOA 4HR7B 2RSOA 5EKIA 2DY7A 2B2VA 1BR9A 5DM73 1WTVA 1BNZA 1E2WA 2F3VA 5D3DA 4PMWA 1HPCA 3SR1A 3U9SA 2F0KA 1ILQA 1RF2D 4RWSC 5C5LA 4C56C 2Q8RE 4H7BA 2QEJC 1D5ZC 3I70A 3PUXA 5IGEA 5FLXE 3KLSX 3L9AX 3MA2B 4CKCA 1J9OA 1PDQA 5HGTA 1HUNA 4X3KA 1CZGA 4QMGA 1BBXC 1ENFA 4PNYA 2B8FA 2EYFA 3Q24A 5DNFA 3T56B 1J8IA 1OXVA 1HXYD 4DAVA 3PO2B 2F0IA 5IGCA 2IX3A 4BWGB 1I50B 3IFDA 5A2QE 4A3JB 3O13A 3M4YA 1UAPA 4RCOA 2A6HC 1PYWD 3R3OA 1BCPC 1STBA 3D6WA 2HDMA 4FO2A 3QG1A 3QOJA 3VR4A 3SDZA 3RZDB 2FMCA 1G91A 3KBXA 2WKCA 3D31A 3IL8A 3F2UA 1BCPB 3SK6A 4QIWB 1U4RA 2N55A 2ICIA 3ITPA 1HTLD 3QJYA 4RKBA 3HRZC 4DNRB 4OO1H 4QUFA 1YNNC 3OPOA 1ZYRD 2PZUA 1TQOA 2R93B 2JYOA 3R93A 4TRDA 2K33A 1U9RA 4ZK9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VR2 A;  3IKJ A;  4LJZ C;  4BA1 I;  4LK1 C;  5JEA H;  5JEA G;  5BN3 A;  1I6V C;  2D2C C;  1Q90 A;  2YYZ A;  2R6G A;  1OXU A;  4RCN A;  3PUX A;  3VR3 A;  3WDN A;  1FYC A;  3L7Z C;  2AUJ D;  2ZT9 C;  1OXT A;  1Y8N B;  1HTP A;  2DNE A;  1K8O A;  2O5J C;  1ONL A;  3SE0 A;  2JEB I;  1BDO A;  2K7V A;  1ZYR C;  3BG3 A;  2JXM B;  2EJM A;  3ND8 A;  2A68 C;  2KCC A;  2AWO A;  4I7Z C;  1GUG A;  1ZKO A;  2QF7 A;  4IQZ A;  2O5I C;  4H13 C;  2B8F A;  1QJO A;  2EVB A;  4KKT A;  2NN6 I;  1GUT A;  3AB9 A;  3MFY A;  4PV1 C;  3T56 B;  2V4D A;  3PUZ A;  1H9K A;  1V43 A;  4G7H C;  4L8J A;  2Q8I B;  3GD7 A;  3M85 A;  3LNN A;  1DCZ A;  1HQM C;  1OXV A;  3W3A A;  2E74 C;  2A6H D;  2D62 A;  3RLF A;  3HGB A;  3QIA A;  2IT1 A;  3I73 A;  1IW7 C;  1Q1B A;  4H44 C;  3A8I E;  1H9R A;  3PUY A;  3VA7 A;  1O78 A;  3FPP A;  1DD2 A;  2DN8 A;  5KNC A;  1H9S A;  4KHZ A;  1K8M A;  2F1M A;  1HCZ A;  2BA1 A;  1E2Z A;  2BE5 D;  1SMY C;  3PUV A;  2PPB C;  3GQB A;  4TQU S;  4KN4 C;  3VR5 A;  2E75 C;  5BN5 A;  1YNJ C;  3ND9 A;  3DXJ C;  1DXM A;  3A8K E;  1GUO A;  5A35 A;  1OXS C;  2A69 C;  3M4Y A;  2E76 C;  4KI0 A;  3EQL C;  1Z6H A;  1CTM A;  5K36 H;  5K36 G;  1VCI A;  2L5T A;  4KMU C;  3OOC A;  1LAB A;  1H9J A;  2A6H C;  1V8Q A;  2A6E C;  1LAC A;  1H9M A;  3OW7 A;  4OGQ C;  4DNT B;  3VR6 A;  1GUS A;  2K32 A;  4XIG S;  2AUK A;  4IFD G;  3QG1 A;  2D5D A;  3VR4 A;  4IFD H;  1IYV A;  1GHK A;  4GZY C;  1PMR A;  1FR3 A;  4G7O C;  3SDZ A;  1G29 1;  3D4R A;  2B8G A;  2A68 D;  5KNB A;  1GHJ A;  3NE5 B;  1CI3 M;  1Q12 A;  1H9S B;  1Z7T A;  1TU2 B;  2BA0 A;  2EJF C;  3CRK C;  3D31 A;  4KKU A;  4XTC S;  1O7L A;  3H94 A;  1GUN A;  3MXU A;  3I4L A;  2JE6 I;  3LWU A;  1OXX K;  3PV0 A;  1EWH A;  1Q1E A;  4HR7 B;  2DNC A;  3N6R A;  3BDO A;  5C0X H;  2EJG C;  1IW7 D;  3T53 B;  2CW0 C;  5C0X G;  3I72 A;  1Y69 U;  1T5E A;  3QJY A;  4DNR B;  4G7Z C;  2LMC B;  3FMC A;  4OO1 G;  5BN4 A;  4OO1 H;  1VF5 C;  1Y8P B;  1GJX A;  2NN6 H;  2NN6 G;  1YNN C;  3OPO A;  1VF7 A;  4DK1 A;  4DK0 A;  1E2W A;  2BE5 C;  2EDG A;  4KN7 C;  2PCF B;  3T51 B;  1HPC A;  3CRL C;  4BA2 I;  1B9N A;  4KKS A;  1A6X A;  2KA7 A;  5KND A;  1IYU A;  2BDO A;  2PNR C;  3U9S A;  1B9M A;  2JEA I;  1Y8O B;  3A7A B;  3A8J E;  3KLR A;  4JK1 C;  2A69 D;  3IFT A;  3PUW A;  1TKW B;  4JBW A;  4TKO B;  3A7L A;  1VDZ A;  3TZU A;  2K33 A;  3P20 A;  1E2V A;  3M7N A;  4H0L C;  2A6E D;  1CFM A; 
#chains in the Genus database with same CATH topology
 4TVA B;  5K5P A;  4LJZ C;  4BA1 I;  1BOS A;  2F0N A;  1XNR L;  3NK9 A;  4OWX B;  4ID6 A;  3E6Z X;  5D65 A;  4ME5 A;  3T16 A;  2NUC A;  2QEX A;  1D7Q A;  2O5I C;  2L55 A;  2NB0 A;  1F77 A;  3HOY H;  1VMC A;  3VYR A;  2SOB A;  5IY0 A;  1STY A;  1HUM A;  1MSG A;  2F0T A;  2FMM A;  3GTQ B;  1DOK A;  1K8M A;  2IX1 A;  1ENA A;  3J80 L;  2F0D A;  3GTL B;  3OSO A;  1CKO A;  1VQ7 A;  1W3S A;  2B2T C;  2OXP A;  1B1Z A;  1YEZ A;  2MJ8 A;  4AH6 A;  2OTJ A;  4Q0F A;  3DEO A;  4MN3 A;  3MXN A;  2UUB L;  1DZ1 A;  1UEA B;  2OEO A;  4RHS A;  3X3N A;  3KF6 B;  5EPJ A;  5J22 A;  4A3B G;  1X3P A;  5DAU A;  2CVR A;  1SJE D;  1H9M A;  1Q7Y C;  3HKZ B;  1TS3 A;  4QIW E;  2BOS A;  5E3F A;  3H0G G;  1WI5 A;  2H5X A;  3W1G A;  1VQ5 A;  3J7A V;  4YCV A;  1MGS A;  1X9N A;  3MWY W;  3KLS A;  5IP9 H;  5ELO A;  5E7N A;  3KJP A;  4JI1 L;  3UDG A;  3CRK C;  1O7L A;  3DWQ A;  4R8I A;  4JCV E;  2M9V A;  2EOT A;  2JE6 I;  1I4G A;  4HIM A;  3LWU A;  1EU4 A;  2SNM A;  1K8A C;  2UUB Q;  2BCO A;  2F4V L;  2XRQ D;  1ASY A;  1E1O A;  2HCI A;  3S2D H;  4X66 L;  2CW0 C;  3PGZ A;  4R4C A;  3ERQ A;  5FLX L;  2A1A A;  3C2P A;  2OCE A;  1SRO A;  2HT1 A;  1PTO D;  1VF5 C;  1LV9 A;  4DK0 A;  4LF4 L;  3X3M A;  4JI0 L;  2RSN A;  1ZEQ X;  2B63 B;  1PRT D;  4R4T A;  2EIF A;  1EY0 A;  4JK1 C;  1X56 A;  2K5V A;  1PTO F;  5IIF A;  1LT5 D;  1SJH D;  4JI1 Q;  1M1K C;  5KYL A;  5C5M A;  1XWE A;  5C44 B;  4K2L A;  3QR8 A;  4DV3 L;  2K5W A;  1PRT F;  4RCN A;  2F3I A;  2F4V Q;  2ZT9 C;  1B53 A;  2RF4 A;  3PIO 3;  2R7Z G;  2ALY B;  4MIU A;  3S16 H;  2VW9 A;  4DF7 A;  2L15 A;  1KTK A;  2JXM B;  2Q2I A;  1X3G A;  5A2Q L;  4F88 A;  1QJO A;  1QWY A;  5IE8 A;  4BS9 A;  4JI0 Q;  4J1M A;  3JC6 6;  3J7A F;  4RGN A;  4L8J A;  5JJI A;  3GD7 A;  1SN8 A;  1EUJ A;  2E74 C;  5EKL A;  5KIX A;  4B3M Q;  1E22 A;  1GUW A;  2UU9 Q;  3FKI H;  2R93 G;  2RHS B;  1CUK A;  4IUP A;  4V19 0;  2PQE A;  1HHV A;  3TP5 A;  3HKZ E;  4DV3 Q;  1IYJ B;  1BQQ T;  3I56 A;  2BE5 D;  2KEE A;  4NW2 A;  1MI2 A;  3NBH A;  1I4P A;  1TWA B;  1KDA A;  3GTO H;  1JQY D;  4ZUI A;  1N32 Q;  2X6L A;  4ABN A;  5J39 A;  1X32 A;  5EPK A;  5JEA J;  5IYC G;  5D14 A;  1CT1 D;  2FJ2 A;  4A93 B;  1AFP A;  1EEF D;  4GKK L;  3EFX D;  4IUR A;  2HUG A;  3FRP B;  4A3D G;  4IFD H;  4FF4 A;  5NUC A;  1UNS A;  2K14 A;  2BH2 A;  1TWF B;  3KK7 A;  5CV8 A;  4IAL A;  4X65 L;  4XQQ A;  1U4L A;  5C4Z A;  2B2V C;  1JB3 A;  2DJF C;  1FVI A;  3S17 B;  2DY8 A;  2NVX H;  2OT2 A;  4JOI A;  1P16 A;  2K4K A;  4ZQ3 A;  3RMH A;  1T5E A;  2VXW A;  3D0F A;  3S15 H;  1TS4 A;  2E2J H;  1X3Q A;  3J7Y W;  1G2S A;  4V0B A;  3STB D;  2Q2T A;  1D5M C;  1JOK A;  1A6X A;  1E3P A;  4K6D A;  2F0S A;  3GTJ H;  3HS0 C;  4X65 Q;  5GAD C;  3PO3 G;  1PH5 A;  1VDZ A;  1PA6 A;  3TZU A;  1E2V A;  3M4Q A;  3S14 H;  3FHW A;  3TDQ A;  4EGV A;  2MFI A;  3VR2 A;  5ELD A;  1A2T A;  1X3F A;  3RUZ A;  4F87 A;  1K8O A;  4I7A A;  4DR6 L;  2K7V A;  1EIF A;  1YZ6 A;  1CA5 A;  3BZC A;  3DWP A;  3OMC A;  3MVV A;  4A3K B;  4RFB A;  4H13 C;  3NUC A;  4QB4 A;  2EVB A;  1G8Z D;  2GA4 B;  4FXD A;  2K5D A;  5E4W C;  2R92 H;  4DR2 L;  3A55 A;  1MD2 D;  1LT4 D;  2F52 A;  1GVP A;  1HNW L;  1O78 A;  4CDC C;  2UXC L;  5T1G A;  4WJW A;  5G3L D;  4NP5 A;  2PNH A;  2E75 C;  1FGB D;  1UE5 A;  4DR6 Q;  2F0O A;  5A35 A;  1OXS C;  3L0O A;  4I65 A;  3HOX G;  2K28 A;  4ILW A;  4GKJ L;  4TSS A;  3E0J A;  3OW2 A;  2F0P A;  4DUY L;  4DK3 C;  3OW7 A;  1JMC A;  2F4I A;  3VR6 A;  4DR2 Q;  3CCQ A;  4HCE A;  1XJV A;  4BY1 H;  4QL5 A;  2CWA A;  1KHI A;  2UUC L;  3S1Q H;  1F2L A;  4G7O C;  5FKA C;  3J81 j;  4Q5V A;  2VB2 X;  1HNW Q;  4DV0 L;  2VS1 A;  2UXC Q;  3BZK A;  4UAI A;  1AEX A;  1Q12 A;  1Z7T A;  4XTC S;  1EQV A;  2NWG A;  1GUN A;  2C5C A;  4N9P A;  2YTY A;  4IZ8 A;  4BY7 G;  2NVQ B;  1C9O A;  2EYM A;  4CJ1 B;  1RDP D;  1EWI A;  5C4X H;  4GKJ Q;  1X55 A;  4C3I G;  1JIC A;  4DUY Q;  2B3G A;  2G9D A;  4FVM A;  1SMY D;  4DGZ A;  3U58 A;  3T51 B;  1XXG A;  1YJ9 A;  2UUC Q;  1B9N A;  1HNX Q;  1BBW A;  3HOV B;  4DV0 Q;  1U4M A;  3D3R A;  2WV6 D;  1KDC A;  1TKW B;  4L5R C;  3AEV A;  4K5W A;  2JSO A;  1V1O A;  1GO3 E;  1KDB A;  1VQG A;  1QCB D;  3P1H A;  5KGU A;  3A74 A;  3IKJ A;  5IT9 c;  4WFN 3;  3I4M B;  5BN3 A;  1BKB A;  1N9W A;  1OXU A;  3WDN A;  2JA5 B;  2B2W A;  4DNI A;  3NTH A;  2XVS A;  5I2X A;  3RZO B;  4OIJ A;  1LO5 D;  1DOL A;  5CBE E;  2A73 B;  5IYB G;  3ERS X;  4HMJ A;  1IBK L;  4C3H B;  3RLN A;  1E0B A;  1KNA A;  1EIH A;  4KJO A;  5CV4 A;  3GV3 A;  3TP8 A;  3J7Z C;  3NQT A;  4G7H C;  5ELF A;  3VA5 A;  4UPA A;  2IW3 A;  2XRS D;  1IW7 C;  5IGF A;  2R7F A;  4KHZ A;  1EZ8 A;  2F1M A;  2VZA A;  3J7A 5;  1JWU D;  3FEW X;  4PZ7 A;  3DXJ C;  1DXM A;  1PXU A;  2A69 C;  2EY2 A;  4ZCK A;  1IBK Q;  5EBD A;  1Z6H A;  4DR1 L;  1NAP A;  4A3B H;  3MXN B;  2KOL A;  2FXQ A;  4PZ6 A;  1U5K A;  1S3O A;  2Z9H A;  3NEN A;  3GTK B;  3H0G H;  4XIG S;  2M00 A;  2VY3 A;  1D1K A;  2I07 B;  2N49 A;  5C3E G;  4YCU A;  5EBC A;  2I46 A;  4DV4 L;  4Y52 H;  5EPL A;  5M5Y H;  2B8G A;  5J1Z A;  4A3M B;  5M3M B;  2EJF C;  1YJN A;  4XYQ A;  3R2I A;  1XYI A;  3TS0 A;  5LMN W;  4KY5 A;  4UP7 A;  4HAE A;  1IXR A;  1NSN S;  1PZJ D;  1VQ9 A;  1I50 H;  4HED A;  4YY3 L;  4JYA L;  3NTK A;  2LMC B;  3S9W A;  1E24 A;  2CWP A;  3ONA B;  1ENC A;  2EYL A;  1SNP A;  3V05 A;  5EAY A;  1HA5 A;  2QIL A;  1LM0 A;  5IGB A;  1OTC A;  2E2H B;  1NR2 A;  2CQO A;  1QB5 D;  1K83 B;  3DHQ A;  4ZRZ A;  4C3J H;  3FVQ A;  4DV4 Q;  2L4N A;  3CF5 A;  5LMU Q;  4IPG A;  3CHB D;  5I4D A;  2EPB A;  4NPS A;  1G2T A;  1J5E Q;  4A3G G;  1PVO A;  3JAM E;  3NTI A;  1BCP D;  2WAC A;  1D5X C;  4IPD A;  5JEA G;  4LF7 L;  2CQA A;  4JI5 L;  2YYZ A;  2VL6 A;  5GAE C;  1B70 B;  1OXT A;  3H3V C;  2R7Z H;  2O5J C;  3SE0 A;  1YHA A;  4PMB A;  5EJW A;  4JYA Q;  3S2H H;  1BCP F;  4JI8 L;  1CKN A;  1GOZ A;  2PQA B;  1OO9 B;  1EYA A;  2N78 A;  4K0K L;  4GNX A;  4A3E B;  3IRB A;  3QIA A;  3I73 A;  4K5X A;  3HOV G;  3VA7 A;  3FPP A;  2Q2H A;  1S40 A;  1JWM D;  4DV2 Q;  1J6Q A;  3HOU B;  2MPM A;  1YNN D;  5CYU A;  4JI5 Q;  4BBS B;  3PUV A;  3NP8 A;  3ERO A;  1IZ6 A;  2JA6 H;  4AQY Q;  2F0H A;  2ID0 A;  1S4Z A;  1LTT D;  1BUV T;  2XNA C;  3I4M G;  1N36 L;  3UDX A;  3LX0 A;  3NBH B;  4JI8 Q;  5IYC H;  1Q82 C;  2RBM A;  1B50 A;  1Y1W G;  3A0J A;  3G71 A;  3BU2 A;  1WCM G;  4UHV A;  1RIP A;  4OGQ C;  1W2B A;  2JA8 B;  1VQA A;  4A3D H;  4P72 A;  2IY5 B;  1EOV A;  1MKH A;  1L2F A;  1JJG A;  4XQN A;  1KL9 A;  2NVT H;  3M9B A;  2IJ0 A;  3K8A A;  4WRD A;  1KC8 C;  5AJ3 Q;  4JOI C;  3SK4 A;  1TU2 B;  4JW0 A;  2KHS A;  4QCL A;  2Z6K A;  1H95 A;  4OXP A;  4LWC A;  3F2C A;  1N36 Q;  3CC7 A;  3C1E A;  3M4O B;  1HFN A;  3NPP A;  4P73 A;  4OX9 L;  1ASZ A;  1Y69 U;  1UEB A;  4UDU C;  3GTG B;  1HZB A;  5JAV A;  1PLF A;  5HUR A;  3K5O A;  1GJX A;  4DK1 A;  2NN6 G;  2IX0 A;  3EA6 A;  2WP8 J;  2EDG A;  4CDD C;  2PCF B;  4NMZ A;  5C0X I;  4DUZ L;  5M5W B;  1IYU A;  1EZ6 A;  3PO3 H;  3J81 E;  3ZYY X;  4OWW B;  1VQH A;  3W2D A;  4FF1 A;  4POF A;  3AFQ A;  2NZH A;  4FDB A;  4ODG A;  1I6H B;  2JA7 G;  1CFM A;  4U68 A;  1QNK A;  2VUM B;  1PFB A;  1NCV A;  2KCN A;  1YIT A;  4FF3 A;  4Y7N B;  3DM1 A;  1KLU D;  4UP8 A;  3S1R H;  2WII B;  3S24 A;  4MTN A;  4A3F G;  1QOH A;  4PQX A;  4OX9 Q;  1STE A;  1NMG A;  4IUV A;  4JC0 A;  1TR5 A;  2ASB A;  3M3Y H;  2HIV A;  5LL6 S;  1LTR D;  1XMO Q;  2A68 C;  3WOE A;  1ZKO A;  2ZTD A;  1O7I A;  4DUZ Q;  3VYT A;  2YU9 H;  3HOW H;  3PCO B;  2NN6 I;  3D8G A;  3S1N H;  3PUZ A;  1H9K A;  2WAQ B;  4C1N K;  2F0G A;  3M85 A;  5IWA L;  1DCZ A;  4R1J A;  4B3R L;  3MEH A;  1VS0 A;  3M7G A;  2CW0 D;  5H1S E;  1TII D;  1EY5 A;  5IYD H;  1KAA A;  2DGY A;  4OEL B;  3NBI A;  3S1M B;  3CPF A;  3TN2 A;  2PPB C;  1FD7 D;  3OIP A;  2RKS A;  1WTR A;  3KUP A;  2VNU D;  2J7Z A;  2NZ1 D;  2K04 A;  3NHH A;  1ET6 A;  3W1B A;  3HOX H;  3EQL C;  4RGO S;  1LAB A;  5FO7 B;  1AP0 A;  1AZP A;  4QGU A;  3G6E A;  1F9Q A;  5FO9 B;  3OIQ A;  5IWA Q;  1WTP A;  1GUS A;  4B3R Q;  4XT1 B;  4IUU A;  4N8X 1;  1B3Q A;  4EQ5 A;  1B8A A;  1PMR A;  3GTM B;  5JOB A;  1SAP A;  3UI2 A;  4RA8 A;  4NDX A;  3BDL A;  4AIM A;  3SGI A;  4U67 3;  2ZM6 L;  1PHJ A;  1WTX A;  3BVZ A;  2J4X A;  2BA0 A;  4LMQ D;  3MZ5 A;  1A0I A;  1TWC H;  4B3S L;  5C4J H;  3HOU G;  1X54 A;  4FNF A;  1M4V A;  2ATW A;  3CME A;  3K0Y A;  1A8V A;  1VQD A;  2EY5 A;  3JAM L;  5LMN L;  1Q8I A;  4BY7 H;  1F2Z A;  3T53 B;  5DM6 3;  3PF4 A;  1I3Q H;  4LUZ A;  4C3I H;  2X69 A;  1RL2 A;  3PSI A;  1Y8P B;  4LFC L;  1Q86 C;  1XMQ L;  2C9O A;  1R9T H;  1XNQ L;  1CQF A;  2J0T D;  5GAH C;  4HN7 A;  1VQJ A;  2ZM6 Q;  3PO2 G;  3PUW A;  3EVQ A;  2RDF A;  4O42 A;  2VQE L;  2ZJQ A;  1W6K A;  1G51 A;  1STH A;  1SEB D;  2VQF L;  1WD0 A;  4B3S Q;  3H3V I;  1PH1 A;  1WTO A;  2WAQ E;  4LK1 C;  4LUO A;  5LMN Q;  4JG2 A;  1AW7 A;  4A3J G;  1CZW A;  3K80 C;  3MXP A;  2PW7 A;  1QZG A;  1O7Z A;  2JEB I;  1BDO A;  1ZYR C;  2F0L A;  3BG3 A;  2P5Z X;  2FHT A;  1HRJ A;  2KCC A;  4BBR H;  5IYB H;  3K7A H;  1QVG A;  2HHH L;  4LFC Q;  1PTO H;  3PIP 3;  1XMQ Q;  1CQV A;  1V1P B;  2YTX A;  1XNQ Q;  2F03 A;  2WFW A;  2RHQ B;  4ZYS A;  4B3M L;  2ZXP A;  3I4N B;  5ELB A;  2UU9 L;  2HIX A;  3HOZ B;  1RTO A;  1VQO A;  2VQE Q;  1S72 A;  1WFQ A;  3A8I E;  2EXD A;  4A75 A;  2UXB L;  2VQF Q;  4HCS A;  2FIN B;  4X62 L;  1PFN A;  2F0M A;  2IHF A;  1RKN A;  2ES2 A;  2VUM G;  1N32 L;  5BN5 A;  4YWL A;  1YNJ C;  4EVO A;  3WOF A;  1UE6 A;  2NTS A;  1NY4 A;  2PZT A;  1JB7 A;  2HHH Q;  2F0U A;  2MHV A;  3KBG A;  2ZTC A;  3I2Z A;  1VCI A;  4A76 A;  3T1H L;  1JOQ A;  2A6E C;  2SDF A;  4NB3 A;  3HOY B;  1CA6 A;  1LTI D;  1TWH B;  5C3E H;  4AYB B;  2XWJ B;  1FNU A;  2LXJ A;  2UXB Q;  2WAQ G;  4X62 Q;  4K8I A;  4R8N A;  5KNB A;  1GHJ A;  3B6Y A;  1H9S B;  5LHY 1;  4RHR A;  2L12 A;  3J81 L;  5M3F H;  3K6O A;  3AQQ A;  1SYD A;  3N52 A;  5FJ8 G;  1KRS A;  4JBK A;  3KF8 A;  3PV0 A;  1UE7 A;  4MTK A;  3MC0 B;  5EKK A;  1PH6 A;  5IOD A;  3N6R A;  4OHJ A;  3BDO A;  3Q23 A;  3T1H Q;  5D3I B;  1VQP A;  5FLM G;  1X6O A;  4KN7 C;  5KRU A;  5C4H A;  2KA7 A;  1A63 A;  5IOC A;  2RDG A;  3FP9 A;  2M2L A;  2E2D C;  3KLR A;  2ICE C;  4YCW A;  3J80 i;  1EFI D;  4A3G H;  1VQC A;  3RN2 A;  3MEF A;  1M90 C;  2EXZ A;  4KY6 A;  2QKI C;  5JEA H;  5L37 A;  3CCM A;  5JJL A;  3NXW A;  1M8A A;  5CC4 A;  4JBJ A;  3GTP H;  3HG9 A;  2HCC A;  2JP1 A;  4ME3 A;  1JOR A;  1G6P A;  1SNQ A;  3S2D B;  3RN5 A;  1SRU A;  1YHQ A;  4J6H A;  3BDC A;  4YWK A;  4MZ9 A;  3GV6 A;  3HKZ G;  1VQK A;  3PQI A;  1A15 A;  2KHI A;  5C0X J;  4BXX H;  1PH3 A;  1N34 L;  2UUA L;  5DEH A;  3TRZ A;  3E3X A;  4WJ4 A;  3PUY A;  1SXT A;  2K1B A;  4PG3 A;  5GQO A;  3ER0 A;  4ZKB B;  1PH2 A;  3C3L A;  3T4A C;  1EL0 A;  3DMU A;  2EYH A;  5C3W A;  1Q81 C;  2LS0 1;  2A5H A;  2AQ2 B;  4TQU S;  1DON A;  4AYB E;  2NVY H;  4M1U B;  3QWN A;  1GUO A;  1K73 C;  3S16 B;  4LUV A;  5CR3 A;  1XX8 A;  1EYC A;  2NZO A;  1Y1W H;  3J80 c;  3FDT A;  4APV A;  3DUZ A;  1HR0 W;  1LAC A;  1WCM H;  5EQ0 A;  3Q0A A;  3D6C A;  4A4I A;  1N34 Q;  1RJT A;  2UUA Q;  2IPK D;  2B63 G;  4A3I B;  3AMU A;  3D4D A;  2AQ3 B;  1SBB B;  1EQR A;  2Z6K C;  3CAM A;  1HJP A;  3CCU A;  3I4N G;  3CU7 A;  2K52 A;  3FKI B;  3TQY A;  4IPC A;  5C44 G;  4H02 A;  1NNX A;  3H94 A;  4NXM Q;  1CSP A;  1K28 A;  3I4L A;  3VYU A;  2ZTE A;  2G9H D;  3GTO B;  2RA4 A;  4JV5 L;  3SK5 A;  1IW7 D;  4LAA A;  3FMC A;  1QUQ B;  2NN6 H;  2QA4 A;  5J3B A;  1HNX L;  5C3X A;  1L0W A;  2F0J A;  5IGG A;  2EQS A;  5KND A;  4OO1 I;  3G4S A;  3A7A B;  4DAP A;  4XYO A;  4P74 A;  2A69 D;  2K6A A;  5IP7 H;  5FLX c;  1D8L A;  4QJF A;  4XT3 B;  3M7N A;  2JA7 H;  4LNQ A;  2I5M X;  1XPU A;  3SEB A;  4MHE A;  2D2C C;  3CQZ H;  2OTL A;  2R6G A;  2K75 A;  1T9H A;  4JV5 Q;  1SFO H;  4A3F H;  3BZD B;  1TWG H;  4CDF C;  1A62 A;  1K9M C;  2NVX B;  1JOO A;  4DV5 Q;  3TRE A;  4DV6 L;  3P75 A;  3S15 B;  2QF7 A;  3G48 A;  4A93 G;  4G57 A;  2E2J B;  2RQX A;  1HZA A;  3LWE A;  4PV1 C;  2B2T A;  3AFP A;  2F3W A;  3TEH B;  5I9O A;  4C2M H;  2D62 A;  1EEI D;  3RLF A;  2Z0S A;  3HGB A;  2XN9 C;  3GTJ B;  1HZ9 A;  2IT1 A;  3CC4 A;  4H44 C;  3F8T A;  4ALP A;  3S14 B;  4K6L A;  4KLK A;  5M9O A;  4WOR A;  5CV7 A;  4K5V A;  1P8L A;  1AE3 A;  3SK8 A;  2ENB A;  4KD3 A;  2Q2U A;  2XGT A;  1LUZ A;  3RR5 A;  4DV6 Q;  1UUP A;  3QO2 A;  1PH9 A;  1AZQ A;  1KXL A;  4OL7 A;  1EY9 A;  1B44 D;  1EY7 A;  5K36 G;  1KNE A;  1HQR D;  4A3L G;  4DNT B;  5AFW A;  1KRT A;  2WB1 B;  3OYY A;  1CHP D;  1SYE A;  2K03 A;  1F9P A;  1LT3 D;  4JBM A;  1SLJ A;  2R92 B;  2LXK A;  4GZY C;  1F2M A;  2KEC A;  4EQP A;  1FGU A;  2X6G A;  4M8A A;  1TXY A;  2PI2 E;  1NBW A;  1MIU A;  2MO1 A;  3I8Z A;  3G7L A;  3DEP A;  4HIK A;  3KDF A;  2PMZ B;  2Z4I A;  4JPB W;  1Y1V B;  4EQO A;  1SNC A;  2EE1 A;  3I72 A;  2KUM A;  4A3K G;  1QIL A;  2Y0S B;  4BA2 I;  3CRL C;  4IOA A;  1X3E A;  4BY1 B;  4DFA A;  5LMU L;  1EU3 A;  3A8J E;  5TSS A;  1J5E L;  1DOM A;  2EYJ A;  4GLX A;  3PO2 H;  3S1Q B;  1EYG A;  3K5N A;  4A3I G;  1C0A A;  3P20 A;  4H0L C;  3URY A;  2R7D A;  1Q90 A;  3T13 A;  1PH7 A;  3E9H A;  2A74 C;  2B2U A;  1BF4 A;  4FYD A;  2MGS A;  4A3J H;  4DV1 L;  2N8N A;  1HTP A;  2HQL A;  1D2B A;  2CH4 A;  1ONL A;  5M5X B;  4LFB L;  5LL6 X;  1A2U A;  2XTI A;  4I7Z C;  1GUG A;  4IQZ A;  3KFU A;  3CP0 A;  3AB9 A;  1C4Q A;  3MFY A;  5JPN C;  1Q3L A;  3OHX C;  5EGT A;  3D4W A;  4DAY A;  1IKL A;  1HQM C;  4HSV A;  1LTA D;  3RZD H;  3W3A A;  2A6H D;  5M5W H;  4DV2 L;  1NMF A;  1O80 A;  4GN5 A;  2OF1 A;  5I6W A;  2CKZ B;  2ZXR A;  3DM3 A;  4AQY L;  3J80 E;  1E2Z A;  2KHJ A;  2WB1 E;  4ZLT F;  4DV1 Q;  4KY7 A;  1WVL A;  4FXG C;  4LFB Q;  1QE6 A;  1D6E C;  3UDI A;  4DR5 L;  4L5S A;  2E76 C;  1TS2 A;  1CTM A;  1AE2 A;  1ZXT A;  1CKM A;  2PMZ E;  5CGK A;  1FL0 A;  3BYY B;  1HR0 L;  5E4X A;  2EYP A;  3K58 A;  3EBE A;  4DXF A;  1D1I A;  5IGD A;  2R93 H;  1GHK A;  5CV5 A;  1SYB A;  1BO0 A;  3SVM A;  5AJ3 L;  3NQI A;  1G29 1;  1YHB A;  2K05 A;  2A68 D;  1K3R A;  4X3S A;  1E7Z A;  3NE5 B;  3Q6S A;  4IFD I;  3TBI B;  3U4Z A;  2Y0S E;  4F7X A;  3MAQ A;  1Z9F A;  1SR3 A;  2JA5 G;  5FJ8 H;  1I4X A;  1RD9 D;  1OXX K;  3H09 A;  2N88 A;  5FO8 B;  1LYL A;  1TT2 A;  4R9W A;  2DNC A;  3BVG A;  4DR5 Q;  5C0X G;  1TS5 A;  4IJL A;  3L3O C;  2F0Q A;  1BBU A;  1QNU A;  1L1O A;  4MNO A;  5BN4 A;  4C3H G;  3EIV A;  4A3B B;  3CXC A;  2OWO A;  2K01 A;  4Z9C B;  5FLM H;  1XTC D;  1HR0 Q;  1HH2 P;  3A54 A;  3U4V A;  3OWF A;  3H0G B;  3C46 A;  2JEA I;  1UE1 A;  2TSS A;  4QUC A;  2WB1 G;  4GN3 B;  3H91 A;  3F1Z A;  4DU9 A;  3GTM H;  3GTQ H;  5M5Y B;  3F2D A;  1EWC A;  5JJK A;  1STG A;  2C35 B;  1STN A;  2L11 A;  1F9S A;  4FP5 D;  3GP7 A;  3GTL H;  1R4P B;  4DK6 C;  2E8G A;  2R3Z A;  2AUJ D;  2GVB A;  3CW2 C;  1XMO L;  3K7U C;  1RCV D;  1VQE A;  3P7J A;  1PV4 A;  3HFZ B;  1V9P A;  1PH8 A;  1Y1V G;  1LTG D;  2DUD A;  3LGJ A;  5IT9 E;  2AWO A;  2MO0 A;  4RH6 A;  2RVL A;  1SE8 A;  2TMP A;  2CHB D;  1I4Q A;  3PIO A;  2V4D A;  1V43 A;  3SHL A;  4C3J B;  2Y0S G;  4B9W A;  5COY A;  4LF9 L;  1ICF B;  4A3M G;  5M3M G;  4EX5 A;  3I90 A;  2AKW B;  5CV9 A;  1SNM A;  3R2T A;  1LLR D;  2F0F A;  4CKE A;  3K5M A;  1HFG A;  3PF5 A;  4B08 A;  1GD7 A;  3ICE A;  1ET9 A;  2R7Z B;  3KJO A;  3K5L A;  3CPW A;  4P2C B;  1QVF A;  3QB3 A;  3S2H B;  4WJ3 M;  1KLG D;  3OOC A;  1MJC A;  5BR8 L;  2B2Y A;  2AQ1 B;  1I5F A;  5KEE A;  4P71 A;  2KED A;  2K32 A;  2B63 H;  1IYV A;  1GKH A;  4LF9 Q;  1II3 A;  3PMF A;  3I4N H;  3TME A;  2NBF A;  2IWH A;  5C44 H;  1AH9 A;  1Z47 A;  2ZJR A;  1YVC A;  1QG7 A;  4A3C G;  3KYH C;  2JA6 B;  2MUY A;  1MBY A;  2MP1 A;  1PFM A;  4ULL A;  2G5D A;  2DJG C;  4JI3 L;  5BR8 Q;  2RCF A;  3UE0 A;  1YBY A;  1R4Q B;  4HIO A;  1WYD A;  3ULP A;  4A3E G;  4A3D B;  2PO4 A;  5ELE A;  3I7F A;  1YNJ D;  4CDE C;  3MTS A;  3RLO A;  4RAU C;  3TZD A;  1TWH H;  2AHO B;  4JBW A;  3A7L A;  3IAY A;  1WD1 A;  4QQB X;  4P75 A;  2NVT B;  1A3U A;  2A6E D;  4BBS G;  1W6J A;  2L0C A;  1GM5 A;  1K0R A;  1I6V C;  1TWA H;  2QDB A;  1CSQ A;  4DPG A;  4LF8 L;  1YJW A;  2PW5 A;  2E2I B;  1FYC A;  2HDL A;  1U0L A;  4ZUJ A;  1XNR Q;  2LFN A;  2O2L D;  2I5H A;  4RGM A;  4JI3 Q;  3EJI A;  4HID A;  3T1Y L;  4A93 H;  3DWA A;  1SND A;  4RGT A;  4KKT A;  2JA8 G;  1GUT A;  2D0O A;  2XSC A;  1MSH A;  2B2W C;  5GRO A;  2WIN B;  1FNV A;  1TWF H;  1B7Y B;  1PZK D;  4DR7 L;  1YNX A;  3PO3 B;  3G6J B;  4CJ0 B;  1XPO A;  1IKM A;  2LKV A;  5C6A A;  4LF8 Q;  3S17 H;  1JR0 D;  4CHT B;  3VR5 A;  2Z1C A;  3S1R B;  3I91 A;  1SNO A;  3T1Y Q;  1NUC A;  4E6I A;  1RHP A;  1E1T A;  2ZJP A;  4X3U A;  1KD1 C;  3M3Y B;  4HSP A;  1KIX A;  5K36 H;  2A19 A;  4OEM B;  4KD4 A;  4KJN A;  3CD6 A;  4A3L H;  1S5E D;  2YU9 B;  3HOW B;  1A3V A;  3S1N B;  3SXH A;  2D5D A;  2N3S A;  4DR7 Q;  1FR3 A;  4JI7 L;  4IJH A;  1LTS D;  1SE2 A;  4C3J G;  5ELN A;  4K8J A;  3C1F A;  2XWB B;  4IUN A;  3L2P A;  2KJX A;  4GLV B;  2EYO A;  1JE4 A;  1DM0 B;  3MXU A;  3Q22 A;  2OQ0 A;  3I4O A;  4O1N A;  1Q1E A;  3RD4 A;  1PZI D;  3CCL A;  1SE4 A;  3KDF B;  3TP6 A;  2MNA A;  4B3T L;  3CCE A;  4JI6 L;  1A3T A;  4G7Z C;  5JPM C;  3HOX B;  4A3K H;  5ELC A;  4X66 Q;  2K50 A;  2PQA A;  2F0E A;  2UXD L;  5IT9 L;  2KQ3 A;  4LF4 Q;  3GO5 A;  3K81 C;  4X64 L;  5HGQ A;  2BDO A;  4JI7 Q;  1SDF A;  2AWN A;  2B2U C;  3VDY A;  4A3I H;  4L5T A;  4TKO B;  1AN8 A;  5JVH 3;  3MXG A;  4IFD J;  1LT6 D;  3HEJ A;  1ML0 D;  4DAM A;  3K59 A;  2Z4H A;  3KOJ A;  3H6M A;  4KK7 A;  1TWC B;  2PZW A;  4OWT B;  5C4J B;  4LF6 L;  2NTT A;  2Q8T A;  4B3T Q;  3A5U A;  1IL8 A;  4JI6 Q;  1LTB D;  4FXK C;  4BY7 B;  2JA6 G;  2EJM A;  1I3Q B;  4C3I B;  2SEB D;  4DKA C;  2UXD Q;  1B4O A;  4X3T A;  2RDH A;  2SNS A;  5ISR A;  4X64 Q;  1R9T B;  1NR4 A;  2Q8I B;  1K8G A;  2V1C C;  1F2Y A;  3TP7 A;  3CMA A;  3FPU B;  4IUT A;  3CC2 A;  2R61 A;  1Q1B A;  1HA6 A;  1H9R A;  1VQ6 A;  1XTD A;  4DAY B;  1PTO C;  5I2Y A;  3HP3 A;  3JAM i;  5COR A;  1S5C D;  4GNX C;  4IOC A;  4LF6 Q;  1T5X D;  5FK9 C;  4YIJ A;  5F2D A;  2PYK A;  1FJG L;  2NVQ H;  3W5O A;  4GOP A;  1PRT C;  3ND9 A;  3A8K E;  2CFM A;  1L0X B;  3V2T A;  1MHW C;  2H1E A;  1C48 A;  2L5T A;  4BBR B;  1CKN B;  3K7A B;  1PTO B;  1WTQ A;  1ICW A;  3E9I A;  4R4Q A;  1EY4 A;  4GNX B;  3HOV H;  4HTH A;  2AUK A;  2LSS A;  4GKK Q;  3WWV A;  2LY7 A;  1VQ8 A;  4XDX A;  2K5N A;  1HNZ L;  4PMC A;  2Z6B A;  1PRT B;  2AMC B;  1VQB A;  1TY2 A;  2D9U A;  4HMI A;  4OIK A;  1S5B D;  1CI3 M;  3EN2 A;  4NXM L;  2CH4 W;  3E5S A;  3I4M H;  1Q46 A;  3OMG A;  4IN3 A;  1L1O C;  1X65 A;  2JA5 H;  1FJG Q;  1ESF A;  4DR3 L;  3TS2 A;  4QY7 A;  2K5H A;  3RZO H;  2YTV A;  5C0X H;  2EJG C;  1EIG A;  4L6T B;  3NWS A;  3CKI B;  4CBV A;  3CCR A;  4FF2 A;  1SSO A;  4OO1 G;  4C3H H;  3HZX A;  2BE5 C;  1TY0 A;  1C7Y A;  1DYQ A;  4HJ7 A;  1L1O B;  4KKS A;  3JAM c;  2H4O A;  3HOZ G;  2B29 A;  1VQI A;  1HNZ Q;  2FFK B;  2PNR C;  1STA A;  1EY6 A;  3HOW G;  1K0S A;  5C3E B;  4IUQ A;  3IFT A;  4YHH L;  1SYG A;  2K5Q A;  4EQN A;  1VMP A;  1L0Y B;  2IL8 A;  3I3C A;  3ZJY C;  1JT8 A;  1IHZ A;  4DR3 Q;  2QDL A;  2QW7 A;  2A8V A;  5M3F B;  5IYD G;  3VR3 A;  3ULJ A;  1Y8N B;  4DV5 L;  5JVG 3;  2DNE A;  1IBL L;  2CCZ A;  2KBN A;  1EQT A;  1Y1V H;  1V1Q A;  5CMD A;  3GTK H;  3HOY G;  1XPR A;  4N9T A;  5G3L F;  2MQH A;  1B2T A;  1SYF A;  2O4X A;  1JC7 A;  2JA9 A;  4AYB G;  4YHH Q;  2WKD A;  1KAB A;  4L5Q A;  3F2B A;  3J81 i;  4A3M H;  3V96 A;  2KCM A;  1UWV A;  5M3M H;  1JE5 A;  4HJA A;  2YV5 A;  2DN8 A;  3AU7 A;  5KNC A;  2I0Q A;  4A3G B;  2BA1 A;  3MHB A;  1JJ2 A;  3STB C;  3E0E A;  4F8M A;  1G6Z A;  2B2Y C;  3KF6 A;  4KHV A;  3BS1 A;  1IBL Q;  1CHQ D;  5KYI A;  1I4R A;  3M4P A;  3TSS A;  3GTP B;  3U9O A;  3BYT B;  1ROD A;  2EZV A;  1C8C A;  4LFA L;  5M5X H;  1BVS A;  1H9J A;  2E2H H;  4YWM A;  1K83 H;  2B39 A;  2L1B A;  1EFW A;  3K57 A;  4N8F A;  1SYC A;  2JJQ A;  1MJE A;  2D0P A;  5IP9 G;  4DN4 M;  3AYH B;  1VQL A;  4DA2 A;  2QCP X;  5I6Y A;  3CCJ A;  1EQQ A;  3R8B A;  3CCV A;  3QOL A;  4NXN L;  4B9X A;  2XIW A;  5FOB B;  4A3C H;  1VQN A;  1EWH A;  2F0W A;  1I4H A;  3U50 C;  5GAG C;  5E1F A;  4CKB A;  2NVY B;  1WTW A;  4LFA Q;  3ULL A;  4KHP L;  4ZKC B;  4JVZ A;  1RTN A;  2KEN A;  4XQJ A;  3J81 c;  4ZAI A;  1VF7 A;  1Y1W B;  1V1P A;  4KV6 A;  1DJR D;  1WCM B;  1IBM L;  5CBA E;  3NWT A;  4BBR G;  4A3E H;  1PYB A;  3BJU A;  5T1I A;  4CJ2 C;  3H3V H;  1B9M A;  3HKS A;  1Y8O B;  3Q8D A;  1NTG A;  1B3A A;  3HOU H;  1WJJ A;  4BBS H;  4C1N I;  4NXN Q;  2KVM A;  1ILP A;  1U4P A;  2EY6 A;  1JCK B;  1O7Y A;  3L7Z C;  1EOT A;  2BDN A;  1KQS A;  4JI4 L;  4RKL A;  3NSW A;  1S5D D;  3H15 A;  4KHP Q;  1EY8 A;  2KCT A;  1JWS D;  2HQE A;  3ND8 A;  1N8R C;  1WOC A;  2HD3 A;  2RCN A;  1IBM Q;  2JA8 H;  4CGY B;  3A56 A;  4G4K A;  3BVM A;  1HZC A;  4RMF A;  1ESR A;  4XXE A;  1LTL A;  3LNN A;  1GXD C;  2QGQ A;  4X6A H;  1CM9 A;  4J8Q A;  2L9H A;  1DD2 A;  1EYD A;  3FKI G;  2OQK A;  3OWE B;  2EY1 A;  4K14 A;  4PZ8 A;  1H9S A;  1CK1 A;  1HCZ A;  1TVX A;  2JA7 B;  1NE3 A;  1SMY C;  1BXT A;  3GQB A;  4KN4 C;  4S3S A;  5CV6 A;  4JI4 Q;  3CQZ B;  3M4O H;  4L63 B;  5C4X B;  1FNW A;  5M3F G;  1SFO B;  4A3F B;  4QF4 A;  1TWG B;  3GTG H;  4KI0 A;  1N33 L;  1VQ4 A;  1S5F D;  4UP9 A;  4KMU C;  2Z8L A;  1WTH A;  1SE3 A;  1V8Q A;  4DR1 Q;  3VYS A;  3OTO L;  2F0V A;  1QZH A;  4KTA A;  4K2K A;  1F9R A;  3MFG A;  4IFD G;  4NKL A;  4HJ5 A;  4C2M B;  2VB3 X;  3D4R A;  2BH8 A;  1I6H H;  1IL2 A;  2E5L L;  2VUM H;  2NYZ D;  4JI2 L;  4KKU A;  2JQO A;  4Y7N H;  3UDF A;  5JJZ A;  4DXG A;  1JJC B;  5I9P A;  1KAW A;  2ZXO A;  4HR7 B;  4RG1 A;  2RSO A;  4IPH A;  4GLA C;  5EKI A;  2DY7 A;  1N33 Q;  2B2V A;  2JK8 A;  1BR9 A;  1VQF A;  3DLL A;  3K0X A;  5DM7 3;  4HJ8 A;  1WTV A;  3OTO Q;  1BNZ A;  4YY3 Q;  1E2W A;  2F3V A;  5D3D A;  4PMW A;  1HPC A;  3SR1 A;  3U9S A;  2F0K A;  1Y14 B;  1ILQ A;  1RF2 D;  2E5L Q;  4RWS C;  4BXX G;  5C5L A;  4JI2 Q;  4C56 C;  3S1M H;  2Q8R E;  1PFS A;  4H7B A;  2QEJ C;  1YI2 A;  1D5Z C;  3I70 A;  3PUX A;  4LF5 L;  5IGE A;  5FLX E;  3KF8 B;  3KLS X;  3L9A X;  4LF7 Q;  3MA2 B;  4CKC A;  1J9O A;  1PDQ A;  5HGT A;  1HUN A;  4X3K A;  1I94 L;  4GN4 B;  1CZG A;  4QMG A;  1PYS B;  1NJI C;  1BBX C;  1ENF A;  4PNY A;  2B8F A;  3UE1 A;  2EYF A;  3Q24 A;  5DNF A;  3T56 B;  4LW1 A;  2R92 G;  1J8I A;  1OXV A;  4K0K Q;  4IO9 A;  4R4I A;  1HXY D;  4DAV A;  3PO2 B;  4GOP C;  5HY6 A;  3PIP A;  1YIJ A;  2F0I A;  5IGC A;  1QVC A;  2IX3 A;  4LF5 Q;  4BWG B;  3I55 A;  1I50 B;  3IFD A;  3A5Z B;  1Q8K A;  5A2Q E;  4A3J B;  3O13 A;  3GDE A;  3KLW A;  2E2I H;  1I94 Q;  4O2D A;  3M4Y A;  1UAP A;  4GS3 A;  4HJ9 A;  1QUQ A;  4RCO A;  4GOP B;  2A6H C;  1PYW D;  1SMX A;  3R3O A;  1BCP C;  2PI2 A;  1STB A;  3D6W A;  1DGS A;  2HDM A;  4BY1 G;  4FO2 A;  3NEL A;  3QG1 A;  3QOJ A;  3VR4 A;  4R4O A;  4DR4 L;  1K3B C;  3SDZ A;  3RZD B;  2FMC A;  4OON A;  1G91 A;  2GVA A;  4DV7 L;  3KBX A;  2WKC A;  2GN5 A;  3D31 A;  3IL8 A;  1VQM A;  3F2U A;  5IP7 G;  3NEM A;  1EIY B;  1BCP B;  3SK6 A;  4QIW B;  1U4R A;  2I5L X;  2ICI A;  2N55 A;  3ITP A;  1HTL D;  3CCS A;  1PH4 A;  5C4X G;  3QJY A;  4O0A A;  4RKB A;  3HRZ C;  4DNR B;  4OO1 H;  4UY8 C;  4QUF A;  1YNN C;  3OPO A;  5DLQ E;  1ZYR D;  2PZU A;  4DR4 Q;  1TQO A;  2JN4 A;  3HOZ H;  2R93 B;  3RNU A;  2JYO A;  3R93 A;  4J15 A;  4DV7 Q;  4POG A;  4TRD A;  2K33 A;  2IHE A;  1U9R A;  4ZK9 B; 
#chains in the Genus database with same CATH homology
 5K5P A;  4LJZ C;  4BA1 I;  1BOS A;  2F0N A;  3NK9 A;  4ID6 A;  3E6Z X;  5D65 A;  4ME5 A;  3T16 A;  2NUC A;  2O5I C;  2L55 A;  2NB0 A;  1F77 A;  1VMC A;  3VYR A;  2SOB A;  1STY A;  1HUM A;  1MSG A;  2F0T A;  2FMM A;  3GTQ B;  1DOK A;  1K8M A;  2IX1 A;  1ENA A;  3J80 L;  2F0D A;  3GTL B;  3OSO A;  2B2T C;  2OXP A;  1B1Z A;  2MJ8 A;  4Q0F A;  3DEO A;  4MN3 A;  3MXN A;  1DZ1 A;  1UEA B;  2OEO A;  4RHS A;  3X3N A;  5EPJ A;  5J22 A;  1X3P A;  5DAU A;  2CVR A;  1SJE D;  1H9M A;  3HKZ B;  1TS3 A;  5E3F A;  2BOS A;  3J7A V;  1MGS A;  3MWY W;  3KLS A;  3CRK C;  1O7L A;  3DWQ A;  4R8I A;  2M9V A;  2EOT A;  2JE6 I;  1I4G A;  3LWU A;  1EU4 A;  2SNM A;  2BCO A;  2XRQ D;  2HCI A;  2CW0 C;  3ERQ A;  5FLX L;  3C2P A;  1PTO D;  1VF5 C;  1LV9 A;  4DK0 A;  3X3M A;  2RSN A;  1ZEQ X;  2B63 B;  1PRT D;  1EY0 A;  4JK1 C;  1PTO F;  5IIF A;  1LT5 D;  1SJH D;  5KYL A;  5C5M A;  1XWE A;  5C44 B;  4K2L A;  2K5W A;  1PRT F;  4RCN A;  2ZT9 C;  1B53 A;  3PIO 3;  4MIU A;  4DF7 A;  1KTK A;  2JXM B;  5A2Q L;  4F88 A;  1QJO A;  1QWY A;  4BS9 A;  4J1M A;  3J7A F;  4RGN A;  4L8J A;  3GD7 A;  2E74 C;  5EKL A;  5KIX A;  1GUW A;  4IUP A;  4V19 0;  2PQE A;  1HHV A;  3TP5 A;  1BQQ T;  2BE5 D;  2KEE A;  4NW2 A;  1MI2 A;  3NBH A;  1I4P A;  1TWA B;  1KDA A;  1JQY D;  4ZUI A;  2X6L A;  4ABN A;  5J39 A;  1X32 A;  5EPK A;  5JEA J;  5D14 A;  1CT1 D;  2FJ2 A;  4A93 B;  1AFP A;  1EEF D;  3EFX D;  4IUR A;  2HUG A;  3FRP B;  4IFD H;  4FF4 A;  5NUC A;  1UNS A;  1TWF B;  3KK7 A;  5CV8 A;  4IAL A;  4XQQ A;  1U4L A;  5C4Z A;  2B2V C;  1JB3 A;  3S17 B;  2DY8 A;  2OT2 A;  4ZQ3 A;  3RMH A;  1T5E A;  2VXW A;  1TS4 A;  1X3Q A;  3J7Y W;  1G2S A;  4V0B A;  1D5M C;  1JOK A;  1A6X A;  4K6D A;  2F0S A;  3HS0 C;  1VDZ A;  3TZU A;  1E2V A;  3TDQ A;  4EGV A;  3VR2 A;  5ELD A;  1A2T A;  3RUZ A;  4F87 A;  1K8O A;  2K7V A;  1CA5 A;  3DWP A;  3OMC A;  3MVV A;  4A3K B;  4RFB A;  4H13 C;  3NUC A;  4QB4 A;  2EVB A;  1G8Z D;  2GA4 B;  4FXD A;  2K5D A;  5E4W C;  3A55 A;  1MD2 D;  1LT4 D;  1O78 A;  5T1G A;  4WJW A;  5G3L D;  4NP5 A;  2E75 C;  1FGB D;  2F0O A;  5A35 A;  1OXS C;  4I65 A;  2K28 A;  4ILW A;  4TSS A;  3E0J A;  2F0P A;  3OW7 A;  2F4I A;  3VR6 A;  4HCE A;  1F2L A;  4G7O C;  5FKA C;  4Q5V A;  2VB2 X;  4UAI A;  1AEX A;  1Q12 A;  1Z7T A;  4XTC S;  1EQV A;  2NWG A;  1GUN A;  2C5C A;  4N9P A;  4IZ8 A;  2NVQ B;  2EYM A;  4CJ1 B;  1RDP D;  4C3I G;  1JIC A;  2G9D A;  4FVM A;  1SMY D;  4DGZ A;  3T51 B;  1XXG A;  1B9N A;  3HOV B;  1U4M A;  3D3R A;  2WV6 D;  1KDC A;  1TKW B;  4K5W A;  2JSO A;  1V1O A;  1KDB A;  1QCB D;  3P1H A;  5KGU A;  3IKJ A;  4WFN 3;  3I4M B;  5BN3 A;  1OXU A;  3WDN A;  2JA5 B;  2B2W A;  3NTH A;  2XVS A;  5I2X A;  3RZO B;  4OIJ A;  1LO5 D;  1DOL A;  5CBE E;  2A73 B;  4HMJ A;  4C3H B;  1E0B A;  1KNA A;  1EIH A;  4KJO A;  5CV4 A;  3GV3 A;  3TP8 A;  3NQT A;  4G7H C;  5ELF A;  3VA5 A;  2IW3 A;  2XRS D;  1IW7 C;  5IGF A;  4KHZ A;  1EZ8 A;  2F1M A;  1JWU D;  3FEW X;  3DXJ C;  1DXM A;  1PXU A;  2A69 C;  2EY2 A;  5EBD A;  1Z6H A;  1NAP A;  2KOL A;  3GTK B;  4XIG S;  2M00 A;  1D1K A;  2I07 B;  5EBC A;  2I46 A;  5EPL A;  2B8G A;  5J1Z A;  4A3M B;  5M3M B;  2EJF C;  4XYQ A;  3R2I A;  1XYI A;  4KY5 A;  4HAE A;  1NSN S;  1PZJ D;  4HED A;  3NTK A;  2LMC B;  3S9W A;  3ONA B;  1ENC A;  2EYL A;  1SNP A;  3V05 A;  1HA5 A;  2QIL A;  5IGB A;  2E2H B;  1NR2 A;  1QB5 D;  1K83 B;  3DHQ A;  4ZRZ A;  3FVQ A;  2L4N A;  3CHB D;  5I4D A;  2EPB A;  1G2T A;  3JAM E;  3NTI A;  1BCP D;  2WAC A;  1D5X C;  5JEA G;  2CQA A;  2YYZ A;  3H3V C;  1OXT A;  2O5J C;  3SE0 A;  4PMB A;  5EJW A;  1BCP F;  1GOZ A;  1OO9 B;  1EYA A;  4A3E B;  3QIA A;  3I73 A;  4K5X A;  3VA7 A;  3FPP A;  1JWM D;  3HOU B;  2MPM A;  1YNN D;  5CYU A;  4BBS B;  3PUV A;  3NP8 A;  3ERO A;  2F0H A;  2ID0 A;  1S4Z A;  1LTT D;  1BUV T;  2XNA C;  3LX0 A;  2RBM A;  1B50 A;  4OGQ C;  2JA8 B;  4XQN A;  4WRD A;  2IJ0 A;  3SK4 A;  1TU2 B;  2KHS A;  4QCL A;  3C1E A;  3M4O B;  1HFN A;  3NPP A;  1Y69 U;  4UDU C;  3GTG B;  5JAV A;  1PLF A;  5HUR A;  3K5O A;  1GJX A;  4DK1 A;  2NN6 G;  2IX0 A;  3EA6 A;  2WP8 J;  2EDG A;  2PCF B;  4NMZ A;  5C0X I;  5M5W B;  1IYU A;  1EZ6 A;  3J81 E;  3ZYY X;  3W2D A;  4FF1 A;  4ODG A;  1I6H B;  2VUM B;  1CFM A;  4U68 A;  1QNK A;  1PFB A;  1NCV A;  2KCN A;  4FF3 A;  4Y7N B;  3DM1 A;  1KLU D;  2WII B;  1QOH A;  4PQX A;  1STE A;  4IUV A;  1TR5 A;  5LL6 S;  1LTR D;  2A68 C;  3WOE A;  1ZKO A;  3VYT A;  2NN6 I;  3D8G A;  3PUZ A;  1H9K A;  2WAQ B;  4C1N K;  2F0G A;  3M85 A;  1DCZ A;  3MEH A;  3M7G A;  2CW0 D;  1TII D;  1EY5 A;  1KAA A;  3NBI A;  3S1M B;  3TN2 A;  2PPB C;  1FD7 D;  3OIP A;  2RKS A;  1WTR A;  3KUP A;  2VNU D;  2J7Z A;  2NZ1 D;  2K04 A;  3NHH A;  1ET6 A;  3EQL C;  4RGO S;  1LAB A;  5FO7 B;  1AP0 A;  1AZP A;  1F9Q A;  5FO9 B;  3OIQ A;  1WTP A;  1GUS A;  4XT1 B;  4IUU A;  3GTM B;  1PMR A;  5JOB A;  1SAP A;  3UI2 A;  4RA8 A;  4NDX A;  3BDL A;  4U67 3;  1WTX A;  3BVZ A;  2J4X A;  2BA0 A;  4LMQ D;  3MZ5 A;  4FNF A;  1M4V A;  3K0Y A;  3JAM L;  2EY5 A;  1Q8I A;  1F2Z A;  3T53 B;  5DM6 3;  2X69 A;  1Y8P B;  2C9O A;  1CQF A;  2J0T D;  4HN7 A;  3PUW A;  3EVQ A;  2RDF A;  4O42 A;  1W6K A;  1STH A;  1SEB D;  1WD0 A;  1WTO A;  4LK1 C;  1AW7 A;  1CZW A;  3MXP A;  2PW7 A;  1O7Z A;  2JEB I;  1BDO A;  1ZYR C;  2F0L A;  3BG3 A;  2FHT A;  1HRJ A;  2KCC A;  1PTO H;  3PIP 3;  1CQV A;  1V1P B;  2F03 A;  4ZYS A;  2ZXP A;  3I4N B;  5ELB A;  3HOZ B;  1RTO A;  3A8I E;  4HCS A;  2FIN B;  1PFN A;  2F0M A;  1RKN A;  5BN5 A;  1YNJ C;  4EVO A;  3WOF A;  2NTS A;  2PZT A;  2F0U A;  2MHV A;  3KBG A;  1VCI A;  1JOQ A;  2A6E C;  2SDF A;  3HOY B;  1CA6 A;  1LTI D;  1TWH B;  4AYB B;  2XWJ B;  1FNU A;  4K8I A;  4R8N A;  5KNB A;  1GHJ A;  1H9S B;  5LHY 1;  4RHR A;  2L12 A;  3J81 L;  3K6O A;  1SYD A;  3N52 A;  3KF8 A;  3PV0 A;  5EKK A;  3MC0 B;  5IOD A;  3N6R A;  4OHJ A;  3BDO A;  3Q23 A;  5D3I B;  4KN7 C;  5KRU A;  5C4H A;  2KA7 A;  5IOC A;  2RDG A;  2M2L A;  2E2D C;  3KLR A;  2ICE C;  1EFI D;  2EXZ A;  4KY6 A;  2QKI C;  5JEA H;  3NXW A;  1M8A A;  5CC4 A;  3HG9 A;  2HCC A;  2JP1 A;  1JOR A;  1SNQ A;  3S2D B;  4J6H A;  3BDC A;  3GV6 A;  1A15 A;  5C0X J;  5DEH A;  3PUY A;  1SXT A;  2K1B A;  4ZKB B;  3C3L A;  1EL0 A;  3T4A C;  3DMU A;  2EYH A;  5C3W A;  2LS0 1;  2A5H A;  2AQ2 B;  4TQU S;  1DON A;  4M1U B;  3QWN A;  1GUO A;  3S16 B;  5CR3 A;  1XX8 A;  1EYC A;  3FDT A;  3DUZ A;  1LAC A;  5EQ0 A;  3Q0A A;  3D6C A;  1RJT A;  2IPK D;  4A3I B;  3AMU A;  3D4D A;  2AQ3 B;  1SBB B;  3CU7 A;  3FKI B;  3H94 A;  3I4L A;  3VYU A;  2G9H D;  3GTO B;  2RA4 A;  3SK5 A;  1IW7 D;  4LAA A;  3FMC A;  2NN6 H;  5C3X A;  2F0J A;  5IGG A;  5KND A;  4OO1 I;  3A7A B;  4DAP A;  4XYO A;  2A69 D;  2K6A A;  4XT3 B;  3M7N A;  3SEB A;  4MHE A;  2D2C C;  2R6G A;  3BZD B;  2NVX B;  1JOO A;  3P75 A;  3S15 B;  2QF7 A;  4G57 A;  2E2J B;  2RQX A;  3LWE A;  4PV1 C;  2B2T A;  2F3W A;  5I9O A;  2D62 A;  1EEI D;  3RLF A;  3HGB A;  3GTJ B;  2XN9 C;  2IT1 A;  4H44 C;  3S14 B;  4K6L A;  5M9O A;  4WOR A;  5CV7 A;  4K5V A;  3SK8 A;  2ENB A;  4KD3 A;  1UUP A;  3QO2 A;  1AZQ A;  4OL7 A;  1EY9 A;  1B44 D;  1EY7 A;  5K36 G;  1KNE A;  1HQR D;  4DNT B;  5AFW A;  2WB1 B;  1CHP D;  1SYE A;  2K03 A;  1F9P A;  1LT3 D;  2R92 B;  4GZY C;  1F2M A;  2KEC A;  4EQP A;  2X6G A;  4M8A A;  3I8Z A;  3G7L A;  3DEP A;  2PMZ B;  2Z4I A;  1Y1V B;  4EQO A;  1SNC A;  2EE1 A;  3I72 A;  2KUM A;  1QIL A;  2Y0S B;  4BA2 I;  3CRL C;  4BY1 B;  4DFA A;  1EU3 A;  3A8J E;  5TSS A;  1DOM A;  2EYJ A;  3S1Q B;  3K5N A;  3P20 A;  4H0L C;  3URY A;  1Q90 A;  3T13 A;  2A74 C;  2B2U A;  1BF4 A;  4FYD A;  2MGS A;  1HTP A;  1D2B A;  1ONL A;  5M5X B;  5LL6 X;  1A2U A;  4I7Z C;  1GUG A;  4IQZ A;  3AB9 A;  1C4Q A;  3MFY A;  5JPN C;  1Q3L A;  3OHX C;  5EGT A;  3D4W A;  4DAY A;  1IKL A;  1HQM C;  4HSV A;  1LTA D;  3W3A A;  2A6H D;  1O80 A;  2OF1 A;  5I6W A;  2ZXR A;  3J80 E;  1E2Z A;  4ZLT F;  4KY7 A;  1WVL A;  4FXG C;  1QE6 A;  1D6E C;  2E76 C;  1TS2 A;  1CTM A;  1ZXT A;  5CGK A;  3BYY B;  5E4X A;  2EYP A;  3K58 A;  5IGD A;  4DXF A;  1D1I A;  1GHK A;  5CV5 A;  1SYB A;  1BO0 A;  3SVM A;  3NQI A;  1G29 1;  2K05 A;  2A68 D;  4X3S A;  3NE5 B;  3Q6S A;  4IFD I;  3TBI B;  4F7X A;  3MAQ A;  1I4X A;  1RD9 D;  1OXX K;  3H09 A;  2N88 A;  5FO8 B;  1TT2 A;  4R9W A;  2DNC A;  3BVG A;  5C0X G;  1TS5 A;  3L3O C;  2F0Q A;  1QNU A;  5BN4 A;  4C3H G;  4A3B B;  2K01 A;  4Z9C B;  1XTC D;  3A54 A;  3OWF A;  3H0G B;  3C46 A;  2JEA I;  2TSS A;  4QUC A;  3H91 A;  4DU9 A;  5M5Y B;  1EWC A;  1STG A;  4FP5 D;  1STN A;  2L11 A;  1F9S A;  3GP7 A;  1R4P B;  2R3Z A;  2AUJ D;  1RCV D;  3P7J A;  5IT9 E;  1LTG D;  2AWO A;  4RH6 A;  2RVL A;  2TMP A;  2CHB D;  1I4Q A;  2V4D A;  1V43 A;  3SHL A;  4C3J B;  4B9W A;  5COY A;  3I90 A;  5CV9 A;  1SNM A;  3R2T A;  1LLR D;  2F0F A;  4CKE A;  3K5M A;  1HFG A;  4B08 A;  1ET9 A;  2R7Z B;  3K5L A;  4P2C B;  3QB3 A;  3S2H B;  1KLG D;  3OOC A;  2B2Y A;  2AQ1 B;  5KEE A;  2KED A;  2K32 A;  1IYV A;  1II3 A;  3PMF A;  3TME A;  2NBF A;  2IWH A;  1Z47 A;  1QG7 A;  2JA6 B;  2MUY A;  1MBY A;  2MP1 A;  1PFM A;  4ULL A;  1R4Q B;  4A3D B;  2PO4 A;  5ELE A;  1YNJ D;  3MTS A;  4RAU C;  3TZD A;  4JBW A;  3A7L A;  3IAY A;  1WD1 A;  2NVT B;  1A3U A;  2A6E D;  1W6J A;  2L0C A;  1I6V C;  2QDB A;  2E2I B;  2PW5 A;  1FYC A;  2HDL A;  4ZUJ A;  2LFN A;  2O2L D;  4RGM A;  3EJI A;  3DWA A;  1SND A;  4RGT A;  4KKT A;  1GUT A;  2XSC A;  1MSH A;  2B2W C;  2WIN B;  1FNV A;  1PZK D;  3PO3 B;  3G6J B;  4CJ0 B;  1IKM A;  2LKV A;  5C6A A;  1JR0 D;  4CHT B;  3VR5 A;  2Z1C A;  3S1R B;  3I91 A;  1SNO A;  1NUC A;  4E6I A;  1RHP A;  4X3U A;  3M3Y B;  4HSP A;  5K36 H;  4KD4 A;  4KJN A;  1S5E D;  2YU9 B;  3HOW B;  1A3V A;  3S1N B;  3SXH A;  2D5D A;  1FR3 A;  1LTS D;  1SE2 A;  4C3J G;  4K8J A;  3C1F A;  2XWB B;  4IUN A;  2KJX A;  2EYO A;  1JE4 A;  1DM0 B;  3MXU A;  3Q22 A;  4O1N A;  1Q1E A;  3RD4 A;  1PZI D;  1SE4 A;  3TP6 A;  1A3T A;  4G7Z C;  5JPM C;  3HOX B;  5ELC A;  2F0E A;  5IT9 L;  2KQ3 A;  3GO5 A;  2BDO A;  1SDF A;  2AWN A;  2B2U C;  4TKO B;  1AN8 A;  5JVH 3;  3MXG A;  4IFD J;  1LT6 D;  3HEJ A;  1ML0 D;  3K59 A;  2Z4H A;  3H6M A;  4KK7 A;  1TWC B;  2PZW A;  5C4J B;  2NTT A;  2Q8T A;  4BY7 B;  1IL8 A;  1LTB D;  4FXK C;  2EJM A;  1I3Q B;  4C3I B;  2SEB D;  1B4O A;  4X3T A;  2RDH A;  2SNS A;  5ISR A;  1R9T B;  1NR4 A;  2Q8I B;  1F2Y A;  3TP7 A;  3FPU B;  4IUT A;  2R61 A;  1Q1B A;  1HA6 A;  1H9R A;  1PTO C;  5I2Y A;  3HP3 A;  5COR A;  1S5C D;  1T5X D;  5FK9 C;  4YIJ A;  5F2D A;  2PYK A;  1PRT C;  3ND9 A;  3A8K E;  1L0X B;  3V2T A;  2H1E A;  1C48 A;  2L5T A;  4BBR B;  3K7A B;  1PTO B;  1WTQ A;  1ICW A;  1EY4 A;  4HTH A;  2AUK A;  2LY7 A;  4XDX A;  4PMC A;  1PRT B;  1TY2 A;  2D9U A;  4HMI A;  4OIK A;  1S5B D;  1CI3 M;  3E5S A;  3OMG A;  4IN3 A;  1ESF A;  5C0X H;  2EJG C;  1EIG A;  4L6T B;  3NWS A;  3CKI B;  4CBV A;  4FF2 A;  1SSO A;  4OO1 G;  3HZX A;  2BE5 C;  1TY0 A;  1DYQ A;  4KKS A;  2H4O A;  2FFK B;  2PNR C;  1STA A;  1EY6 A;  5C3E B;  4IUQ A;  3IFT A;  1SYG A;  2K5Q A;  4EQN A;  1VMP A;  1L0Y B;  2IL8 A;  3I3C A;  1IHZ A;  5M3F B;  3VR3 A;  1Y8N B;  5JVG 3;  2DNE A;  1EQT A;  5CMD A;  4N9T A;  5G3L F;  1B2T A;  1SYF A;  2O4X A;  1JC7 A;  2WKD A;  1KAB A;  3V96 A;  2DN8 A;  3AU7 A;  5KNC A;  4A3G B;  2BA1 A;  3MHB A;  4F8M A;  1G6Z A;  2B2Y C;  3BS1 A;  4KHV A;  1CHQ D;  5KYI A;  1I4R A;  3TSS A;  3GTP B;  3U9O A;  3BYT B;  1ROD A;  2EZV A;  1C8C A;  1H9J A;  2B39 A;  2L1B A;  3K57 A;  1SYC A;  4DN4 M;  4DA2 A;  2QCP X;  5I6Y A;  3R8B A;  3QOL A;  4B9X A;  2XIW A;  5FOB B;  1EWH A;  2F0W A;  1I4H A;  5E1F A;  4CKB A;  2NVY B;  1WTW A;  4ZKC B;  1RTN A;  4XQJ A;  4ZAI A;  1VF7 A;  1Y1W B;  1V1P A;  4KV6 A;  1DJR D;  1WCM B;  5CBA E;  3NWT A;  5T1I A;  4CJ2 C;  1B9M A;  1Y8O B;  1B3A A;  4C1N I;  2KVM A;  1ILP A;  1U4P A;  2EY6 A;  1JCK B;  1O7Y A;  3L7Z C;  1EOT A;  2BDN A;  4RKL A;  3NSW A;  1S5D D;  1EY8 A;  1JWS D;  2HQE A;  3ND8 A;  4CGY B;  3A56 A;  4G4K A;  3BVM A;  1ESR A;  4XXE A;  3LNN A;  1GXD C;  1CM9 A;  4J8Q A;  2L9H A;  1DD2 A;  1EYD A;  3OWE B;  2EY1 A;  4K14 A;  1H9S A;  1CK1 A;  1HCZ A;  1TVX A;  2JA7 B;  1SMY C;  1BXT A;  3GQB A;  4KN4 C;  4S3S A;  5CV6 A;  3CQZ B;  4L63 B;  5C4X B;  1FNW A;  1SFO B;  4A3F B;  4QF4 A;  1TWG B;  4KI0 A;  1S5F D;  4KMU C;  2Z8L A;  1SE3 A;  1V8Q A;  3VYS A;  2F0V A;  4KTA A;  4K2K A;  1F9R A;  3MFG A;  4IFD G;  4NKL A;  4C2M B;  2VB3 X;  3D4R A;  2NYZ D;  4KKU A;  5JJZ A;  4DXG A;  5I9P A;  2ZXO A;  4HR7 B;  2RSO A;  5EKI A;  2DY7 A;  2B2V A;  1BR9 A;  5DM7 3;  1WTV A;  1BNZ A;  1E2W A;  2F3V A;  5D3D A;  4PMW A;  1HPC A;  3SR1 A;  3U9S A;  2F0K A;  1ILQ A;  1RF2 D;  4RWS C;  5C5L A;  4C56 C;  2Q8R E;  4H7B A;  2QEJ C;  1D5Z C;  3I70 A;  3PUX A;  5IGE A;  5FLX E;  3KLS X;  3L9A X;  3MA2 B;  4CKC A;  1J9O A;  1PDQ A;  5HGT A;  1HUN A;  4X3K A;  1CZG A;  4QMG A;  1BBX C;  1ENF A;  4PNY A;  2B8F A;  2EYF A;  3Q24 A;  5DNF A;  3T56 B;  1J8I A;  1OXV A;  1HXY D;  4DAV A;  3PO2 B;  2F0I A;  5IGC A;  2IX3 A;  4BWG B;  1I50 B;  3IFD A;  5A2Q E;  4A3J B;  3O13 A;  3M4Y A;  1UAP A;  4RCO A;  2A6H C;  1PYW D;  3R3O A;  1BCP C;  1STB A;  3D6W A;  2HDM A;  4FO2 A;  3QG1 A;  3QOJ A;  3VR4 A;  3SDZ A;  3RZD B;  2FMC A;  1G91 A;  3KBX A;  2WKC A;  3D31 A;  3IL8 A;  3F2U A;  1BCP B;  3SK6 A;  4QIW B;  1U4R A;  2N55 A;  2ICI A;  3ITP A;  1HTL D;  3QJY A;  4RKB A;  3HRZ C;  4DNR B;  4OO1 H;  4QUF A;  1YNN C;  3OPO A;  1ZYR D;  2PZU A;  1TQO A;  2R93 B;  2JYO A;  3R93 A;  4TRD A;  2K33 A;  1U9R A;  4ZK9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...