1H9SB

Molybdate bound complex of dimop domain of mode from e.coli
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
137
structure length
137
Chain Sequence
QTSARNQWFGTITARDHDDVQQHVDVLLADGKTRLKVAITAQSGARLGLDEGKEVLILLKAPWVGITQDEAVAQNADNQLPGIISHIERGAEQCEVLMALPDGQTLCATVPVNEATSLEQGQNVTAYFNADSVIIAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Oxyanion Binding Alters Conformational and Quaternary Structure of the C-Terminal Domain of the Transcriptional Regulator Mode; Implications for Molybdate-Dependant Regulation, Signalling, Storage and Transport
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription regulator
molecule keywords MOLYBDENUM TRANSPORT PROTEIN MODE
total genus 33
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2001-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03459 TOBE TOBE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1h9sB02
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1h9sB01
2EJFC 1SMYC 2V4DA 2O5JC 1YNNC 5BN3A 4RCNA 1E2WA 4IFDG 3QJYA 5BN5A 4KN4C 1GUTA 2JE6I 1CTMA 4KKUA 1E2ZA 4OGQC 1Q1BA 4H44C 1H9KA 3GD7A 1A6XA 3VR5A 1DCZA 4I7ZC 4IQZA 3I73A 1Z6HA 4JK1C 3T56B 1LABA 3OW7A 1GHKA 3L7ZC 4KMUC 3BG3A 1K8MA 5K36H 1H9SA 2D5DA 4TQUS 1HCZA 2E74C 3VA7A 1K8OA 2DNCA 3MXUA 1ZYRC 1QJOA 1ONLA 3A8KE 3T53B 3D4RA 3EQLC 1OXSC 2Q8IB 5C0XG 1GUNA 1IYUA 2A68D 2DNEA 2A69C 2CW0C 1B9NA 3A8JE 1E2VA 1H9MA 1TKWB 1Y8OB 1YNJC 2K7VA 3MFYA 3T51B 5K36G 2AUKA 3VR3A 3PUVA 1CFMA 5JEAH 2A69D 1V8QA 1B9MA 2KCCA 2BE5C 2A68C 2JEBI 2K32A 3H94A 4G7HC 3U9SA 2EJGC 1DXMA 2A6HD 2E75C 3IFTA 3QG1A 2DN8A 2A6HC 2PCFB 3I72A 1PMRA 1Q90A 2BA0A 4G7ZC 2L5TA 1H9JA 1O7LA 2R6GA 4OO1H 2BE5D 1DD2A 2AWOA 3WDNA 5JEAG 3CRKC 4HR7B 1VDZA 2KA7A 3TZUA 4DNTB 3KLRA 2BDOA 1EWHA 1ZKOA 1Y8NB 3DXJC 3VR2A 1OXXK 2A6ED 3LNNA 2NN6G 4G7OC 3RLFA 1H9SB 3PV0A 2E76C 2LMCB 1G291 3A8IE 1O78A 4DNRB 1FYCA 3HGBA 3OPOA 3M85A 1Z7TA 1Q12A 2PNRC 1GUSA 3FPPA 4GZYC 3PUZA 4H13C 5KNDA 2JXMB 2IT1A 2BA1A 3N6RA 4LJZC 1VF5C 1GUOA 4JBWA 4KKSA 4KN7C 1TU2B 4KKTA 1I6VC 3SDZA 2F1MA 4DK1A 3CRLC 3VR6A 1IYVA 3LWUA 1GHJA 3FMCA 1V43A 5C0XH 1HTPA 2D62A 1VCIA 1LACA 3D31A 4LK1C 5BN4A 4XTCS 4XIGS 3OOCA 3PUXA 3M7NA 2B8GA 3PUYA 3W3AA 3SE0A 2A6EC 2EVBA 4KI0A 4BA2I 3I4LA 2JEAI 1HQMC 1GJXA 1VF7A 2AUJD 2YYZA 3BDOA 2NN6I 1GUGA 2PPBC 3GQBA 5KNCA 1IW7C 2ZT9C 1T5EA 3A7AB 2B8FA 1Y8PB 3P20A 4TKOB 3M4YA 1CI3M 1BDOA 4L8JA 2QF7A 1H9RA 1OXVA 5KNBA 5A35A 2O5IC 1FR3A 1IW7D 3PUWA 3IKJA 4KHZA 3VR4A 4IFDH 3NE5B 4PV1C 4OO1G 3ND8A 1HPCA 2NN6H 3QIAA 1OXTA 4BA1I 2EDGA 1Y69U 2D2CC 2EJMA 1OXUA 2K33A 3A7LA 4H0LC 4DK0A 3AB9A 3ND9A 1Q1EA
chains in the Genus database with same CATH superfamily
1VQBA 5DLQE 3CCMA 3SK5A 1TT2A 5BN5A 1PH1A 1RF2D 3FDTA 3GTGB 3GV6A 1NBWA 2VZAA 2B29A 4F87A 4LUVA 3ULPA 3KF8B 2RHSB 3L3OC 1ML0D 4AYBB 2C9OA 1XX8A 5I6WA 3W5OA 2UXBQ 2JA5B 1F2LA 1K8OA 3E9IA 4DNIA 1TWHH 3EQLC 5IGCA 5C0XG 2L55A 5KEEA 3T1HL 3H6MA 1T5XD 5GADC 5C3XA 3T1YL 3H3VC 2R7DA 4P72A 1FNUA 2A1AA 1CFMA 2VQFQ 4OIJA 2KCCA 4ODGA 2WKCA 2LKVA 3S14B 1L1OA 3R2TA 3QO2A 1VQHA 3GTOH 2UU9Q 4ABNA 1P8LA 4GKKQ 4A3EG 2PCFB 1PLFA 2ENBA 3MAQA 5I2YA 3S9WA 3S16H 1BCPF 3Q24A 4U673 2K5WA 5M5YH 3D4DA 1N32Q 3GTKH 5HY6A 2QW7A 3CD6A 3CU7A 1U5KA 1VQEA 1EQQA 1WFQA 4IUVA 1KABA 2Z4HA 4DR3Q 3A8IE 2JQOA 4JPBW 2ZJRA 1HJPA 3HOVB 1FJGQ 4R4CA 1K83H 3FRPB 1D1KA 1KAWA 3WOFA 5KYLA 1JWUD 1KTKA 5ELFA 4DPGA 1V43A 5LMUL 3J80c 1TS3A 4WFN3 5C0XH 2D62A 3Q6SA 1G2TA 2R7ZG 2JA5H 4XIGS 4RFBA 1XNRQ 4CDEC 1YEZA 3ONAB 1SNCA 3FVQA 4L5RC 2ZTDA 5A2QE 2JA8H 3G4SA 1PZKD 2PMZE 1SE3A 2B2TC 3CQZB 3M9BA 4TKOB 4JI5Q 1BCPC 1TIID 1YHBA 5KNBA 1F77A 2IX3A 1XXGA 2YU9B 3K0YA 3I90A 5C3EG 5JJZA 2OXPA 4IO9A 3URYA 1Y69U 3ER0A 4H0LC 1VQKA 4B3TL 1JCKB 1TQOA 2JK8A 1E0BA 4DR2Q 1GKHA 5E7NA 4PMBA 4G7OC 5EKKA 4BY7G 2QEXA 1PTOB 1ET9A 2E2HH 1SNMA 2K5HA 1A63A 1AEXA 2MQHA 1V1OA 1SR3A 3I73A 2CH4W 1RIPA 2VL6A 1LABA 2N3SA 4R4TA 1A0IA 3RLNA 5C4JB 5IWAQ 4X6AH 2TMPA 4FDBA 4A3FG 4X3TA 1VQMA 2M9VA 2XRQD 3TP5A 4BBRH 3CCJA 1NTGA 1K73C 3T53B 4NXML 2NVQH 1OO9B 1VQAA 2AQ3B 5NUCA 4B08A 4DAYA 1X65A 1HA5A 3C2PA 3AMUA 4JI7Q 4KHPQ 1PFBA 5T1IA 3PO3H 4KD3A 2R3ZA 3PUVA 4V0BA 5JEAH 1VQGA 1W6JA 2E2JB 4NKLA 4G57A 4HJ8A 2KCTA 1DXMA 2RBMA 5LMNW 5M5XH 1EYCA 2A73B 3I72A 2AQ1B 3EFXD 4A3DG 2HUGA 1PZJD 3T1YQ 3S16B 3NQTA 4C3IH 2FFKB 2SOBA 3K5OA 4NDXA 5IP7H 4J1MA 2D9UA 3OPOA 5CR3A 1Z7TA 3M85A 2PNRC 2K52A 3TDQA 3S1MH 4E6IA 4B3ML 3C1FA 2JA7G 3RZOB 4DK1A 1I6VC 2MO1A 3CRLC 4AYBG 4LNQA 5IYDH 2EPBA 4MTNA 2JA9A 1HR0W 4HJ7A 4JI4L 1KDCA 4HSVA 3HOXG 1LTSD 2XSCA 1HFGA 2NTSA 3CCQA 2A8VA 1M8AA 5HURA 2AKWB 3TZDA 2PPBC 3G6JB 4P73A 1STAA 1VQ8A 1QVGA 4DU9A 2O4XA 1H9RA 2HDLA 3CMEA 3VR4A 2F3WA 3ND8A 3D3RA 1Y1WH 1DJRD 3DWQA 2EYJA 3I55A 2EJMA 3S14H 1RKNA 4JI1Q 3RR5A 4F7XA 1B8AA 4DR1L 2V4DA 4X62L 2I46A 3J81c 3NTHA 1R4QB 1K0SA 3A5ZB 1U9RA 2K01A 4C3HG 3FHWA 3RMHA 4K6DA 1CKMA 3CCUA 1ESRA 1N9WA 4K2KA 2EYPA 1HUNA 1VQJA 4NW2A 1HTLD 1SFOH 1L1OB 2KEEA 4BBSB 4UY8C 4K5WA 2HIXA 3GTJH 3AQQA 3NUCA 1IBML 2CQAA 5IT9L 2A5HA 1JWSD 2LXJA 1C8CA 4UPAA 2PI2A 1QVFA 1RDPD 4C3JG 2VS1A 1KRSA 1HFNA 1LTLA 3D0FA 5IYCG 2BE5C 3MA2B 1ZXTA 2O2LD 1TY0A 1TS4A 3GTLB 1B2TA 3AFQA 2WIIB 4PZ8A 1T9HA 5KGUA 2R7ZH 2BA0A 2UXDQ 2P5ZX 3M3YH 4HCSA 4QL5A 1WCMB 3HS0C 3KK7A 1AZPA 4DNTB 1JB7A 1Y8NB 5IGDA 2BCOA 3B6YA 1Q3LA 1CUKA 1LLRD 1SNPA 1E24A 1CKOA 3I56A 2RHQB 4DNRB 2DJFC 2PQEA 2KOLA 4JVZA 1L0XB 3S2HH 4YHHQ 1GUSA 5LHY1 2IT1A 4B3RL 1K3RA 1JE4A 4QIWB 5A2QL 4KKSA 2Q2HA 4KN7C 4KKTA 4C56C 3RZOH 3BYYB 3M4OH 5JAVA 4B9WA 5CMDA 1EZ8A 1A3VA 2WAQE 4FP5D 3OOCA 2R7FA 4MIUA 2WFWA 3W3AA 1LTBD 4XYQA 1QOHA 4KI0A 5FO8B 5M3MH 1I94Q 4JI5L 4LFCL 5C3EH 1A3TA 3J7AV 2L9HA 4LF4L 2HD3A 1NE3A 1I94L 1Y8PB 1PDQA 4DUZQ 4POGA 1BDOA 4Y7NB 1QB5D 3R2IA 5EBCA 3SK4A 4NPSA 2KVMA 1NCVA 4OWTB 2F0OA 2XNAC 4A75A 3DEOA 5G3LF 1XTDA 2D2CC 4HAEA 1I4RA 5DM73 2Z1CA 4C1NK 1WTOA 3KDFA 1XMOQ 1TWCH 3NK9A 4FO2A 3U4VA 1EL0A 4IFDG 3SK6A 1SSOA 5M5YB 1CK1A 3NENA 3HOZH 4IUUA 1H9KA 3DWPA 4RGTA 2B2UA 4DR6Q 5EAYA 3PGZA 3GP7A 2VQEQ 4UP8A 1AE3A 4DV6Q 1FGUA 1Q46A 3TREA 2EY5A 2PW5A 2GN5A 2NTTA 4RG1A 3VR3A 4A3MB 5AJ3Q 3J80E 1FNVA 1MBYA 1VQ9A 4IFDI 3KLSX 2E75C 1I5FA 1UUPA 4OONA 3HFZB 1JR0D 1S3OA 2F0TA 3VDYA 2UU9L 4GKKL 1E22A 4TSSA 5DM63 4GN3B 5J39A 3PMFA 1NSNS 3CQZH 3C3LA 2LY7A 5C3WA 3ERSX 1BKBA 3E3XA 2IWHA 4Z9CB 4LF6L 3AYHB 2E76C 2LMCB 5M3FH 4DR7L 1Y1WB 3NBIA 2R92G 3FKIB 1Y1WG 3GTJB 3BDCA 4JI8Q 3PQIA 1VF5C 2OT2A 3P75A 1LT3D 1I50H 3TP7A 4NB3A 3S1NH 3W2DA 1JJ2A 1XTCD 3P7JA 1X56A 3NHHA 4CKEA 2MUYA 2WKDA 3IFDA 3ZYYX 1SFOB 1LTTD 2XGTA 3BDOA 5EPLA 4I65A 1Q7YC 1HRJA 2PQAB 3GQBA 2XRSD 1DYQA 2XN9C 1RL2A 4RKBA 2F0LA 1S5CD 1GUWA 2MHVA 5A35A 3A55A 1EY5A 4IFDJ 3RZDH 4JI6Q 4OO1G 4DV5L 2OQ0A 3R93A 1SAPA 3G6EA 1S4ZA 1HNXL 1WCMG 3AB9A 4XQJA 5FOBB 1Q1EA 1YNNC 1GO3E 4ALPA 2E2DC 4UP7A 1BQQT 1QNKA 1GUTA 3PIOA 1YI2A 4UP9A 1X6OA 1VQ5A 3TEHB 1K0RA 4RAUC 5IY0A 4K5XA 2Z9HA 4QJFA 5JPNC 2Q8TA 5IWAL 2Q2UA 2OQKA 1L0WA 2ASBA 2DNEA 1ET6A 2M00A 4BY7H 4LFBL 2C5CA 3L9AX 1B9NA 2LFNA 1YNJC 3KJPA 1CT1D 3T51B 1O80A 5G3LD 1JICA 2KJXA 5C44H 4DV7Q 4RHRA 3H94A 4R9WA 1IZ6A 1XPUA 2KUMA 2B3GA 2DN8A 2KHSA 1PRTF 3ITPA 1Q90A 4OO1H 1O7LA 1PVOA 5D14A 5C4XH 1G91A 2MJ8A 1KHIA 1WCMH 1JWMD 4XT1B 4L63B 1FNWA 1YITA 4ME5A 3KBGA 2CH4A 2EOTA 1EY4A 1S40A 3DM1A 4A3IB 2IL8A 3UDGA 2AQ2B 5CORA 2D0PA 3KLSA 5E4XA 3MEFA 1DGSA 3I4NB 5CV5A 4MHEA 3PO2G 1IYVA 4X66L 1I4QA 2K04A 4KHVA 1F9QA 2DGYA 1CHPD 1U0LA 2SEBD 2Z6KC 4GN5A 5EGTA 4IZ8A 2B8GA 4P71A 4BBRB 2EVBA 4DUZL 2QDLA 2F0DA 4C3HB 2ZTEA 1VQNA 1K9MC 1QUQA 5M9OA 4NXNL 4OEMB 1XMQQ 1B53A 2Y0SG 3EJIA 1IBKL 1Y14B 1JE5A 3QR8A 1L0YB 3GTMH 2K28A 2E5LL 2VW9A 1N8RC 4KJNA 3W1BA 3HOWG 3MWYW 2NB0A 4X3SA 1B70B 2WB1B 1GVPA 1AN8A 1WTXA 3HZXA 1SMYD 1EQVA 3MXNA 2JE6I 1S5DD 1Q1BA 2JP1A 5CV7A 4EGVA 2PNHA 1TWAH 1HHVA 2VQEL 3I70A 1TWFH 2RA4A 3BJUA 1HNXQ 1J9OA 2EZVA 4K2LA 2GA4B 3OW2A 2D5DA 4TQUS 5C6AA 2F3IA 3I4NG 4CHTB 2H1EA 2X6LA 1BNZA 2KENA 3KF6B 1E7ZA 1TWHB 1VQLA 5ELEA 3VYTA 1GUNA 4DR5L 4ZKCB 1PH4A 1WTVA 1M1KC 4FVMA 1XPRA 4YCVA 1Y8OB 1PTOF 4R8IA 2K7VA 2OWOA 2F03A 2CW0D 1SRUA 3X3NA 3OIPA 4HCEA 2JEBI 2VQFL 5FLXE 5JVH3 4RGNA 4XYOA 2JN4A 4KV6A 4QIWE 4HMJA 3TRZA 4A3CH 4G7ZC 3K57A 5E1FA 3RN2A 1SXTA 4BY1B 3E6ZX 4YY3Q 1D8LA 4HR7B 4MN3A 2WAQB 4YWKA 5E4WC 1D5ZC 1BBWA 4FF3A 4DR7Q 3HOYG 4KHPL 1KQSA 1Z47A 1XNQQ 3K5NA 1R9TB 4XT3B 1K8GA 2C35B 4EQPA 1FYCA 2OTJA 2D0OA 4C2MB 2R93H 1Q12A 3FPPA 4K14A 3CPWA 3WWVA 2WV6D 4YCWA 5T1GA 2L12A 3EIVA 2I0QA 2AWNA 3VR6A 1SE4A 3ERQA 4CKCA 3I4NH 3MZ5A 1ASYA 3S1NB 2PQAA 3GTPH 3HKZG 5C44B 1PH5A 5IGGA 5JJKA 3JC66 3NTIA 2UUAQ 5CV4A 3Q22A 3S1MB 3STBD 5M3FB 1UAPA 4A3BH 4ZUIA 4CJ1B 1MD2D 1ILPA 4WJ3M 4DR4L 4JI0Q 3FP9A 3S1QH 3HOVG 3UE0A 1HNZQ 1K83B 1U4LA 4TVAB 4DV5Q 3M4YA 1D5MC 1I50B 1CA5A 1IW7D 1UEAB 3PUWA 1N33L 2UUBQ 4A3LH 4DV4Q 1CQFA 1CKNB 1SJED 5KIXA 1HH2P 2ZTCA 4DA2A 2X6GA 1MGSA 3CKIB 3V96A 2R61A 1CQVA 4J15A 4GOPB 2ES2A 2BH2A 4F88A 3HEJA 5IYDG 4NXMQ 2VXWA 1X32A 3HOUG 2EYHA 4HMIA 4OO1I 4C3IB 1EIFA 4ZQ3A 3T56B 1WVLA 3M4QA 1KRTA 3L7ZC 1QZHA 1PRTB 4ZYSA 2KEDA 3CCRA 3H0GH 1ZYRC 3HOZG 1VS0A 3RUZA 3AEVA 4A93G 2NVXB 3MXPA 2ALYB 4B3SQ 1WI5A 5GAGC 2PI2E 1E1TA 4DR1Q 2SNMA 4JV5Q 1FVIA 1AFPA 3ICEA 2WB1G 1G51A 2A68C 3LWEA 3K80C 3F8TA 5COYA 4LF9L 1GXDC 4B9XA 2EYOA 3J81j 2XVSA 2ZM6Q 4A3KH 1SNQA 4U68A 4DK3C 2NZHA 4A3LG 3HKSA 1O7IA 1EU3A 3Q8DA 4RHSA 1VQCA 3WDNA 1TR5A 1R4PB 5JOBA 1WTRA 2FJ2A 1WTQA 1EWHA 2A6ED 2X69A 1PTOC 5IOCA 1YHQA 4DV2Q 2XWBB 5D3DA 2GVBA 3K5MA 1N36Q 4LF4Q 4PZ7A 4H13C 2BA1A 1HZAA 2HQLA 4APVA 1XPOA 2VB2X 3FMCA 2VUMG 1LTRD 2ZXOA 5GAHC 5IYCH 1HA6A 3TP8A 1SYEA 3VYRA 3S2HB 2H5XA 1FD7D 1H95A 4C3JB 4DR3L 3K8AA 1EEFD 2EY6A 3OWEB 5EBDA 2AUJD 2HHHQ 4H02A 3GTGH 1EUJA 3CPFA 3EVQA 1BCPB 4OX9Q 1EWCA 4FF4A 3HOUH 5IODA 1FR3A 2TSSA 3DUZA 5LMNQ 4HSPA 1UE6A 2F0PA 4IUQA 2R7ZB 3DMUA 1OXUA 4CDFC 1ICWA 3GTLH 4A3DH 2L15A 3K81C 4LF5Q 1C9OA 1E2WA 2K14A 3ZJYC 1SNDA 1IBMQ 5C4XB 2IW3A 5J22A 5IGFA 2F3VA 4K8JA 3MFGA 5IP9G 2F0JA 2N49A 1GHKA 4K0KQ 2BH8A 1YIJA 2NVYH 2NVTH 2Z8LA 2F0GA 2PO4A 1SDFA 4ZCKA 4HJ9A 4CKBA 5ELOA 1SROA 3QWNA 1EQTA 2CWAA 2A69D 2PYKA 2KHIA 4G7HC 1KC8C 3BZKA 4DV1Q 4DUYQ 4DR6L 2K75A 4BBSH 2AHOB 3IFTA 1VQPA 4BXXH 4Q5VA 2UXDL 3GO5A 1HR0Q 4R4IA 1PRTC 2LXKA 4DKAC 1EOVA 4ULLA 2ZJPA 3BS1A 1PZID 4IURA 1QILA 4A3BG 2KA7A 3GV3A 1HUMA 5EKIA 3U50C 5FJ8H 2RCFA 3PV0A 2E2JH 1EFID 1PTOD 5ELDA 1ENFA 4RGOS 1STHA 1D6EC 1YJNA 4J8QA 4GZYC 1Q82C 4YIJA 1D2BA 3OTOL 4JBJA 4JI6L 4FNFA 1N33Q 3RD4A 1PYWD 1LTID 3T4AC 4QB4A 5I2XA 1UE5A 3QOLA 1VCIA 1LACA 3D31A 5ELBA 3U4ZA 5BN4A 4GOPC 1MKHA 3J81i 4X3UA 1BOSA 1SYBA 4DV3L 4WJ4A 2JEAI 1SMXA 3W1GA 3QOJA 2ZT9C 4V190 4BBSG 1PH8A 3BVZA 4CGYB 2K5QA 1QE6A 3NELA 2CCZA 4KHZA 3HG9A 3NEMA 1EFWA 2JYOA 1A2TA 1C48A 5KRUA 4BA1I 2EIFA 1C4QA 2EDGA 3BZDB 2RDGA 1EY9A 3ND9A 4GLXA 2G9HD 1S5BD 1PA6A 3E5SA 1VMPA 3F1ZA 4QMGA 1WTWA 1DOLA 4KN4C 4DV6L 1GD7A 4RCOA 1LM0A 4ZKBB 1I3QB 2QILA 5DEHA 3K0XA 1I4GA 3Q23A 1EQRA 1VQIA 3AU7A 3EBEA 1G6PA 2DJGC 2RCNA 3KOJA 2NVXH 1IYUA 4BY1G 1BR9A 2CKZB 1S72A 2A69C 3KF8A 3NTKA 3MFYA 2WP8J 4JOIA 4X65L 2BOSA 2MO0A 2QA4A 5BR8L 1X3QA 2HCIA 2PZTA 1V8QA 3TS0A 4DV2L 4LAAA 3MVVA 2A6HD 4LWCA 1IKMA 1EY7A 1YVCA 2F0FA 3H3VH 2WB1E 2OF1A 4A3DB 3BVGA 2G5DA 2B63G 3MC0B 4JC0A 2JSOA 4XQNA 2HCCA 4POFA 1PH3A 2ICIA 5DNFA 4Y7NH 4LW1A 3IRBA 4GN4B 4A3MH 3HKZB 3OYYA 3VYUA 3K59A 1LO5D 1KD1C 1OXXK 4X3KA 2QKIC 4ME3A 3KLWA 4GNXA 3OHXC 1O78A 3HGBA 1YJWA 3F2UA 4NXNQ 1HQRD 5KYIA 2Z0SA 1G6ZA 4HIKA 2MNAA 1LTAD 4K8IA 4JCVE 1CSQA 1PYBA 1TWFB 1SYGA 3NQIA 2R92B 1TWGH 2E2IH 3A56A 1IL2A 2N88A 3BVMA 5C44G 1LT6D 1II3A 1WJJA 2PMZB 4F8MA 5I6YA 4ID6A 5LMUQ 1NAPA 3H09A 2NVTB 1NR2A 4X64Q 2LSSA 2F0IA 4GLAC 2E2HB 2L4NA 1QWYA 2PZUA 1JT8A 1MSHA 1OXVA 2F4VL 1I4HA 2GVAA 3TQYA 3RLOA 1B3AA 1L2FA 1JQYD 3S24A 4DR5Q 4C3HH 4JI3Q 2F52A 1SMYC 3MEHA 2KHJA 1SE2A 4EX5A 2ZXRA 4BY1H 2F0QA 4DXFA 5F2DA 4YCUA 2IY5B 1TS5A 1AH9A 2K50A 1EWIA 1PV4A 3HOUB 2NWGA 1Z6HA 2RVLA 3SHLA 1Y1VB 4A3IG 4DGZA 4GNXB 3BDLA 1H9SA 1HCZA 2Z6BA 3UDFA 1TY2A 1RTNA 5H1SE 4PZ6A 2I07B 3HP3A 1A2UA 1KAAA 3VA5A 2I5HA 2HDMA 1E2VA 1H9MA 2RQXA 3SVMA 1A62A 5CV9A 3H91A 3PO3G 2ZM6L 4UHVA 4OXPA 4EQOA 3OTOQ 2A6HC 2L5TA 1A8VA 2XWJB 1QZGA 4LF8Q 1F9PA 3CRKC 3STBC 5C0XJ 4AQYQ 4R4QA 1G8ZD 1XYIA 2QCPX 1JJGA 1QNUA 5JEAJ 3PCOB 3JAME 1CZWA 1PXUA 3I4MG 3DM3A 2K5DA 1G291 4HIDA 1UNSA 5ELNA 5AJ3L 1RJTA 5EQ0A 1CM9A 2Q2IA 2XTIA 4DFAA 3J80i 4A3FB 5FLMH 1I6HB 1TU2B 5M5WB 3OSOA 4DAPA 1PHJA 1SYFA 1Y1VG 2MPMA 1WTPA 1PRTD 1J5EL 4HIOA 2H4OA 1EYGA 1N36L 3IL8A 1BBUA 5CBAE 5GROA 2B2WA 1CA6A 1UEBA 1ZEQX 2A6EC 4BA2I 1NNXA 2QGQA 3I4LA 1EZ6A 3NXWA 2UUCL 1EEID 3Q0AA 4QCLA 3FKIG 2Q2TA 5KNCA 2DUDA 4NMZA 3E0EA 2HHHL 1CI3M 2L1BA 3BYTB 1LTGD 4IFDH 2F0NA 4PV1C 2F0WA 1IBLL 3HOYH 3JAML 1STBA 1I4XA 3KFUA 2FMMA 3CAMA 4QF4A 3LX0A 1WYDA 2J7ZA 2KQ3A 5J3BA 1S5FD 3MHBA 4LF7L 2B2VA 3QJYA 4GS3A 3KYHC 3VR5A 4QY7A 1U4RA 4I7ZC 4JYAQ 4IOCA 3LGJA 4A3JH 1X3GA 3OW7A 1TVXA 3TSSA 4KMUC 3BG3A 2B63B 1K8MA 5K36H 1B7YB 5M3MB 1YHAA 3T1HQ 3SGIA 2KECA 3HOWB 3D4RA 3K7UC 4R1JA 2Q8IB 1D7QA 1BVSA 5BR8Q 2CW0C 3M4OB 3GTPB 1OTCA 3D6WA 4P2CB 1SBBB 4WJWA 4IJLA 1WOCA 2IJ0A 2R92H 5JJIA 3H15A 2UXCL 1ZYRD 3T16A 3K6OA 1F2YA 3DEPA 4O2DA 2IPKD 2OEOA 3C46A 4A3EB 5JEAG 1EYDA 2MFIA 1VDZA 3JAMi 5J1ZA 2RF4A 4DV1L 3DXJC 4RH6A 3LNNA 3DHQA 1NUCA 5CC4A 3J7ZC 1W6KA 4FF1A 2K5VA 4L6TB 3CCSA 3JAMc 1DZ1A 1KDAA 3CCVA 3OIQA 2K5NA 1D5XC 3CMAA 1TXYA 2HT1A 2F4VQ 4LJZC 1GUOA 4A3GB 3S1RB 1MJEA 2KBNA 2PW7A 2B2YA 3H0GB 4CJ0B 4LK1C 4X64L 1SE8A 1VMCA 3E0JA 5AFWA 5FO9B 3PUYA 4P75A 2F0HA 3AFPA 1LV9A 3SEBA 2IX1A 1RTOA 4IPCA 1IYJB 1MIUA 2ATWA 3SK8A 1HNZL 4HTHA 4L8JA 3V05A 3M7GA 1GOZA 2ZXPA 3NE5B 2AMCB 1P16A 1LT5D 4DR2L 1O7ZA 3GTQH 3QIAA 4N9PA 3CC4A 1EOTA 3G7LA 3QB3A 3NPPA 3D4WA 2K33A 1VQOA 3I8ZA 1E1OA 1RODA 4DK0A 4IALA 1IXRA 4RCNA 4KKUA 4OGQC 1E2ZA 1JORA 3M3YB 4EQ5A 2IHEA 4DN4M 4C1NI 4IUNA 2E8GA 4JOIC 4O42A 3GTOB 2L11A 4PG3A 4KJOA 3MXUA 1PH2A 1PH9A 1DOKA 3K58A 2JA8B 1ONLA 1Z9FA 3A8KE 2JA8G 1OXSC 2I5MX 1LT4D 2WACA 4ZAIA 4YWLA 3GDEA 2OTLA 1HZBA 1I6HH 5FLMG 4KK7A 1B9MA 3CP0A 1EIGA 2K32A 5EJWA 1WD0A 5LL6X 3RN5A 4RA8A 3U9SA 1Y1VH 5FLXc 2FXQA 2YV5A 5EPJA 5C4HA 4DR4Q 3EN2A 4ZUJA 3KJOA 5CBEE 5L37A 2R6GA 1STNA 3J81L 3HOVH 2BE5D 2YTXA 1SEBD 2AWOA 1L1OC 4XXEA 3PIPA 3DLLA 2RSOA 3TZUA 2SDFA 4KLKA 3KLRA 1HZCA 2NN6G 1X3EA 1EYAA 4JI2Q 4XQQA 5JVG3 4DV3Q 5ELCA 2CHBD 4JI8L 5IIFA 4HEDA 1U4PA 3NWTA 5IT9c 3PUZA 1B4OA 1B3QA 4A3MG 2VY3A 3PIO3 1HNWQ 2IX0A 3LWUA 4EQNA 2B63H 1BF4A 1I3QH 5HGQA 1V1PA 3T13A 1V9PA 5CV6A 1UWVA 3HOWH 4A3GG 2E5LQ 4B3RQ 3SE0A 3X3MA 4A3JG 2NVYB 3CCEA 3FKIH 3D8GA 1GJXA 3CC2A 2YYZA 4DV0Q 2NN6I 2QDBA 4DAYB 2FINB 4GKJQ 1CSPA 1IW7C 3VYSA 5FK9C 2NZ1D 2F0UA 3BU2A 3J7YW 1IBLQ 3HOZB 4JI0L 5LL6S 1C0AA 1BCPD 2B2VC 2MP1A 1HPCA 1G2SA 3D6CA 4IPHA 3A54A 4JI3L 3TMEA 5IGBA 1M90C 4DK6C 2EXZA 4AIMA 3G48A 1ILQA 4R8NA 2EJFC 1HZ9A 3J81E 5BN3A 4TRDA 5M3MG 1FGBD 3U9OA 1HXYD 4A3EH 1EY6A 1A6XA 3GD7A 4IJHA 1X55A 2N78A 1DCZA 4ZRZA 3PO3B 1X9NA 1UE7A 4HJ5A 3GTMB 2J0TD 1MJCA 2E74C 1JB3A 3VA7A 1QG7A 4K6LA 2DNCA 1VQ4A 1IL8A 1O7YA 3TP6A 1QJOA 4M1UB 4CDDC 4LFAL 3CXCA 4J6HA 1M4VA 2VB3X 4A3GH 3C1EA 4N8FA 1ICFB 1TKWB 1IHZA 2F4IA 5C5LA 4XDXA 4B3SL 1V1PB 2F0SA 2K4KA 1B1ZA 2EJGC 2RDHA 1AZQA 3S15H 4IN3A 1HR0L 2CWPA 3UDXA 2HIVA 1STYA 1PMRA 4DF7A 4LF9Q 5IGEA 2BDNA 4Q0FA 3I4OA 1IKLA 3MTSA 4N9TA 2YTYA 5C4ZA 5C4XG 3PF4A 1F2MA 3VR2A 1YNXA 4GLVB 4JV5L 3HOYB 1BO0A 4RWSC 2NYZD 4IPGA 1JOOA 2IHFA 4RKLA 2WAQG 2G9DA 1WD1A 4B3MQ 3S1QB 1DOMA 4FF2A 3H3VI 2F0EA 1FL0A 2JA6G 3K5LA 2EXDA 2F1MA 1Q8KA 4BY7B 4OELB 1A15A 2JJQA 3EA6A 4B3TQ 2EYFA 4XTCS 3G71A 2RKSA 3I91A 1A3UA 5M3FG 1VQFA 3NSWA 3KUPA 3R8BA 3I7FA 3CF5A 2M2LA 2V1CC 4CBVA 1AE2A 1FJGL 1T5EA 1NJIC 2B8FA 5IE8A 1F9SA 2QF7A 3V2TA 2B39A 3J7A5 3MXNB 4LUOA 1E3PA 5CV8A 4FYDA 4MTKA 1BXTA 4PMCA 4BXXG 3H0GG 4JW0A 1SJHD 3A7LA 4IPDA 1YBYA 4RMFA 4GKJL 4A93H 2O5JC 4MNOA 5D3IB 5E3FA 4AYBE 1TS2A 3KF6A 4GNXC 5JPMC 4G4KA 1CTMA 4MZ9A 3R3OA 4IQZA 1YZ6A 2ICEC 4PMWA 4AH6A 3A5UA 1Q8IA 3PO2B 3RZDB 2KCNA 2HQEA 2JA6B 3UI2A 4K0KL 2NUCA 3TBIB 1RD9D 4KY5A 1GM5A 2A68D 3PIP3 3S2DB 2WINB 4IUTA 1TWGB 3E9HA 3OMCA 2VNUD 5K36G 4LF5L 2AUKA 4HN7A 4ZLTF 1SNOA 1VQDA 4H7BA 1K28A 4A3CG 2ID0A 5FKAC 2UXCQ 1J8IA 1PTOH 4KD4A 1NY4A 3WOEA 1J5EQ 2NBFA 1X54A 1V1QA 4O1NA 5FLXL 3OWFA 1SYDA 3RNUA 4S3SA 2BDOA 1KNEA 3KBXA 2JA5G 1YJ9A 3FEWX 4OHJA 3HRZC 5TSSA 1Q86C 4FXGC 1STEA 1KIXA 2UUCQ 1RCVD 5I9PA 1I4PA 5IT9E 2Z6KA 2EYMA 3KDFB 4DUYL 1MSGA 1XNQL 3U58A 5KNDA 2F0KA 2K6AA 3ULJA 4JBWA 3HOXH 3OMGA 2VUMB 1U4MA 1F2ZA 4JBMA 4JI1L 5GAEC 2E2IB 5LMNL 4OWXB 1BUVT 3NBHB 1PH7A 2CQOA 5K5PA 5C0XI 1CKNA 1XNRL 1EIHA 1F9RA 4JYAL 4L5QA 3A7AB 4GOPA 1Q81C 2UUBL 3TS2A 1B44D 3I4MH 3CW2C 2F0VA 2ZJQA 3HKZE 3IKJA 4OWWB 5IYBG 2DY7A 3F2BA 4IOAA 4ILWA 3UDIA 1ENAA 1B50A 4HJAA 3F2DA 1R9TH 2OCEA 1SN8A 3GTKB 4QUCA 3EROA 3SR1A 3IAYA 2YTVA 1XMOL 4KTAA 1WTHA 3S17H 4JBKA 2RDFA 1W2BA 4JK1C 1N34L 3ULLA 4CDCC 5DAUA 3L0OA 1W3SA 4C3JH 4QQBX 4IUPA 4KY6A 4A3BB 2XIWA 3I2ZA 2NZOA 3CC7A 4DV7L 5IP7G 5C3EB 1D1IA 2CVRA 5GQOA 3A8JE 4JI7L 5D65A 4LF7Q 1JJCB 1VQ7A 5M5WH 4AQYL 1LYLA 5I4DA 1YNJD 5HGTA 1KXLA 2K05A 3CHBD 2LS01 5FO7B 4UAIA 2EY2A 1CHQD 2EYLA 2Z4IA 1ASZA 3QG1A 2B2WC 2K1BA 4KY7A 4ZK9B 4NP5A 5FJ8G 1JC7A 5IYBH 2UXBL 1EU4A 1DD2A 2KCMA 2Y0SB 4QGUA 2PZWA 1KL9A 1QCBD 5EKLA 4LF6Q 1VQ6A 4P74A 1H9SB 1C7YA 4JI2L 2B2TA 1AW7A 2EY1A 4DXGA 1KDBA 3J80L 1YNND 2FHTA 2JXMB 3N6RA 4LUZA 1NMGA 3SDZA 4I7AA 1GHJA 2I5LX 1S5ED 1LUZA 1N32L 1X3FA 1HTPA 4BWGB 2Y0SE 4LMQD 1NR4A 3PUXA 4A3JB 3NWSA 4OX9L 1XMQL 1HNWL 2MGSA 1EY0A 1HQMC 1VF7A 2EE1A 1X3PA 2R93G 1GUGA 1SYCA 1TWCB 2L0CA 3PF5A 1XWEA 2B2YC 2A74C 1XJVA 3S1RH 1JMCA 2O5IC 3I3CA 1OXTA 2RSNA 3UE1A 1MHWC 4RGMA 4X62Q 4OL7A 1PFSA 1KLGD 4A76A 1J6QA 3P1HA 1SLJA 4DAMA 2N55A 4H44C 4M8AA 4DV4L 1JOQA 1STGA 4K5VA 4X65Q 1RHPA 5IP9H 3PO2H 1PH6A 2FMCA 4UDUC 4FXKC 1QVCA 1PFNA 3FPUB 5C5MA 2B2UC 4YWMA 4L5TA 2J4XA 2N8NA 4WORA 4A3FH 1N34Q 4LFBQ 3HOXB 4Y52H 4JG2A 4N8X1 2QEJC 1EIYB 4C2MH 2R93B 4LFAQ 1K3BC 4HIMA 4YY3L 3K7AB 1MI2A 1H9JA 4DAVA 2CFMA 2JA7B 1QUQB 3BZCA 3S17B 4A93B 3M4PA 1BBXC 5EPKA 3A74A 4QUFA 1ZKOA 3GTQB 4LF8L 2UUAL 2YU9H 3F2CA 3I4MB 4BBRG 3RLFA 1KLUD 4YHHL 4C3IG 4DV0L 1NMFA 4A3KG 4FXDA 3CCLA 4A3KB 2SNSA 5CYUA 1AP0A 3NBHA 4EVOA 4CJ2C 3L2PA 4O0AA 1PYSB 1CZGA 4X66Q 3O13A 4A4IA 5ISRA 2Q8RE 3N52A 3S2DH 4BS9A 1DONA 1JOKA 5C4JH 3M7NA 1PFMA 4PNYA 4LFCQ 2JA6H 3J7AF 4L5SA 2F0MA 1K8AC 1ESFA 3DWAA 2VUMH 1EY8A 2NVQB 1TWAB 3P20A 5CGKA 2A19A 3PSIA 2K03A 1UE1A 4A3IH 2DY8A 1DM0B 3TN2A 4R4OA 3NP8A 2NN6H 1IBKQ 4PQXA 3MXGA 3SXHA 5I9OA 3S15B 3A0JA 4WRDA 5JJLA 1ENCA 1KNAA 2JA7H 4JI4Q 5M5XB 2EQSA 3K7AH 4OIKA
chains in the Genus database with same CATH topology
3SK5A 1TT2A 5BN5A 1RF2D 3FDTA 3GTGB 3GV6A 4F87A 3L3OC 1ML0D 4AYBB 2C9OA 1XX8A 5I6WA 2JA5B 1F2LA 1K8OA 3EQLC 5IGCA 5C0XG 2L55A 5KEEA 3H6MA 1T5XD 3H3VC 5C3XA 1FNUA 1CFMA 4OIJA 2KCCA 4ODGA 2WKCA 2LKVA 3S14B 3R2TA 3QO2A 4ABNA 2PCFB 1PLFA 2ENBA 3MAQA 5I2YA 3S9WA 1BCPF 3Q24A 4U673 2K5WA 3D4DA 3CU7A 4IUVA 1KABA 2Z4HA 3A8IE 3HOVB 3FRPB 1D1KA 3WOFA 5KYLA 1JWUD 1KTKA 5ELFA 1V43A 1TS3A 4WFN3 5C0XH 2D62A 3Q6SA 1G2TA 4XIGS 4RFBA 3ONAB 1SNCA 3FVQA 5A2QE 1PZKD 1SE3A 2B2TC 3CQZB 4TKOB 1BCPC 1TIID 5KNBA 1F77A 2IX3A 1XXGA 2YU9B 3K0YA 3I90A 5JJZA 2OXPA 3URYA 1Y69U 4H0LC 1JCKB 1TQOA 1E0BA 4PMBA 4G7OC 5EKKA 1PTOB 1ET9A 1SNMA 1AEXA 1V1OA 3I73A 1LABA 5C4JB 2TMPA 4X3TA 2M9VA 2XRQD 3TP5A 3T53B 2VUMB 4B08A 1OO9B 2AQ3B 5NUCA 4DAYA 3C2PA 1HA5A 3AMUA 1PFBA 5T1IA 4KD3A 2R3ZA 3PUVA 4V0BA 5JEAH 1W6JA 2E2JB 4NKLA 4G57A 1DXMA 2RBMA 1EYCA 2A73B 3I72A 2AQ1B 3EFXD 2HUGA 1PZJD 3S16B 3NQTA 2FFKB 2SOBA 3K5OA 4NDXA 4J1MA 2D9UA 3OPOA 5CR3A 1Z7TA 3M85A 2PNRC 3TDQA 4E6IA 3C1FA 3RZOB 4DK1A 1I6VC 3CRLC 2EPBA 1KDCA 4HSVA 1LTSD 2XSCA 1HFGA 2NTSA 1M8AA 5HURA 3TZDA 2PPBC 3G6JB 1STAA 4DU9A 2O4XA 1H9RA 2HDLA 3VR4A 2F3WA 3ND8A 3D3RA 1DJRD 3DWQA 2EYJA 2EJMA 1RKNA 4F7XA 2V4DA 2I46A 3NTHA 1R4QB 1U9RA 2K01A 4C3HG 3RMHA 4K6DA 1ESRA 4K2KA 2EYPA 1HUNA 4NW2A 1HTLD 2KEEA 4BBSB 4K5WA 3NUCA 2CQAA 5IT9L 2A5HA 1JWSD 1C8CA 1RDPD 4C3JG 1HFNA 2BE5C 3MA2B 1ZXTA 2O2LD 1TY0A 1TS4A 3GTLB 1B2TA 2WIIB 5KGUA 2BA0A 4HCSA 1WCMB 3HS0C 3KK7A 1AZPA 4DNTB 1Y8NB 5IGDA 2BCOA 1Q3LA 1LLRD 1SNPA 4DNRB 2PQEA 2KOLA 1L0XB 1GUSA 5LHY1 2IT1A 1JE4A 4QIWB 5A2QL 4KKSA 4KN7C 4KKTA 4C56C 3BYYB 5JAVA 4B9WA 5CMDA 1EZ8A 1A3VA 4FP5D 3OOCA 4MIUA 3W3AA 1LTBD 4XYQA 1QOHA 4KI0A 5FO8B 1A3TA 3J7AV 2L9HA 1Y8PB 1PDQA 1BDOA 4Y7NB 1QB5D 3R2IA 5EBCA 3SK4A 2KVMA 1NCVA 2F0OA 2XNAC 3DEOA 5G3LF 4HAEA 2D2CC 1I4RA 5DM73 2Z1CA 4C1NK 1WTOA 3NK9A 4FO2A 1EL0A 4IFDG 3SK6A 1SSOA 5M5YB 1CK1A 4IUUA 1H9KA 3DWPA 4RGTA 2B2UA 3GP7A 2EY5A 2PW5A 2NTTA 3VR3A 4A3MB 3J80E 1FNVA 1MBYA 4IFDI 3KLSX 2E75C 1UUPA 1JR0D 2F0TA 4TSSA 5DM63 5J39A 3PMFA 1NSNS 3C3LA 2LY7A 5C3WA 2IWHA 4Z9CB 2E76C 2LMCB 1Y1WB 3NBIA 3FKIB 3GTJB 3BDCA 1VF5C 2OT2A 3P75A 1LT3D 3TP7A 3W2DA 1XTCD 3P7JA 3NHHA 4CKEA 2MUYA 2WKDA 3IFDA 3ZYYX 1SFOB 1LTTD 5EPLA 3BDOA 4I65A 1HRJA 3GQBA 2XRSD 1DYQA 2XN9C 4RKBA 2F0LA 1S5CD 1GUWA 2MHVA 5A35A 3A55A 1EY5A 4IFDJ 4OO1G 3R93A 1SAPA 1S4ZA 4XQJA 3AB9A 5FOBB 1Q1EA 1YNNC 2E2DC 1BQQT 1QNKA 1GUTA 4RAUC 4K5XA 5JPNC 2Q8TA 2DNEA 1ET6A 2M00A 2C5CA 3L9AX 1B9NA 2LFNA 1YNJC 1CT1D 3T51B 1O80A 5G3LD 1JICA 2KJXA 4RHRA 3H94A 4R9WA 2KUMA 2DN8A 2KHSA 1PRTF 3ITPA 1Q90A 4OO1H 1O7LA 5D14A 1G91A 2MJ8A 1JWMD 4XT1B 4L63B 1FNWA 4ME5A 3KBGA 2EOTA 1EY4A 3DM1A 4A3IB 2IL8A 2AQ2B 5CORA 3KLSA 5E4XA 3I4NB 5CV5A 4MHEA 1IYVA 1I4QA 2K04A 4KHVA 1F9QA 1CHPD 2SEBD 5EGTA 4IZ8A 2B8GA 4BBRB 2EVBA 2F0DA 4C3HB 5M9OA 1B53A 3EJIA 1L0YB 2K28A 4KJNA 3MWYW 2NB0A 4X3SA 2WB1B 1AN8A 1WTXA 3HZXA 1SMYD 1EQVA 3MXNA 2JE6I 1S5DD 1Q1BA 2JP1A 5CV7A 4EGVA 1HHVA 3I70A 2RA4A 1J9OA 2EZVA 4K2LA 2GA4B 2D5DA 4TQUS 5C6AA 4CHTB 2H1EA 2X6LA 1BNZA 1TWHB 5ELEA 3VYTA 1GUNA 4ZKCB 1WTVA 4FVMA 4R8IA 1Y8OB 1PTOF 2K7VA 2F03A 2CW0D 3X3NA 3OIPA 4HCEA 2JEBI 5FLXE 5JVH3 4RGNA 4XYOA 4KV6A 4HMJA 4G7ZC 3K57A 5E1FA 1SXTA 4BY1B 3E6ZX 4HR7B 4MN3A 2WAQB 5E4WC 1D5ZC 4FF3A 1Z47A 3K5NA 1R9TB 4XT3B 4EQPA 1FYCA 4C2MB 1Q12A 3FPPA 4K14A 2WV6D 5T1GA 2L12A 2AWNA 3VR6A 1SE4A 3ERQA 4CKCA 3MZ5A 3S1NB 5C44B 5IGGA 3NTIA 5CV4A 3Q22A 3S1MB 5M3FB 1UAPA 4ZUIA 4CJ1B 1MD2D 1ILPA 1K83B 1U4LA 3M4YA 1D5MC 1I50B 1CA5A 1IW7D 1UEAB 3PUWA 1CQFA 1SJED 5KIXA 4DA2A 2X6GA 1MGSA 3CKIB 3V96A 2R61A 1CQVA 4F88A 3HEJA 2VXWA 1X32A 2EYHA 4HMIA 4OO1I 4C3IB 4ZQ3A 3T56B 1WVLA 3L7ZC 1PRTB 4ZYSA 2KEDA 1ZYRC 3RUZA 2NVXB 3MXPA 2SNMA 1AFPA 2A68C 3LWEA 5COYA 4B9XA 1GXDC 2EYOA 2XVSA 1SNQA 4U68A 1EU3A 4RHSA 3WDNA 1TR5A 1R4PB 5JOBA 1WTRA 2FJ2A 1WTQA 1EWHA 2A6ED 2X69A 1PTOC 5IOCA 2XWBB 5D3DA 3K5MA 4H13C 2BA1A 2VB2X 3FMCA 1LTRD 2ZXOA 1HA6A 3TP8A 1SYEA 3VYRA 3S2HB 1FD7D 4C3JB 1EEFD 2EY6A 3OWEB 5EBDA 2AUJD 3EVQA 1BCPB 1EWCA 4FF4A 5IODA 1FR3A 2TSSA 3DUZA 4HSPA 2F0PA 4IUQA 2R7ZB 3DMUA 1OXUA 1ICWA 1E2WA 1SNDA 5C4XB 2IW3A 5J22A 5IGFA 2F3VA 4K8JA 3MFGA 2F0JA 1GHKA 2Z8LA 2F0GA 2PO4A 1SDFA 4CKBA 3QWNA 1EQTA 2A69D 2PYKA 4G7HC 3IFTA 4Q5VA 3GO5A 1PRTC 4ULLA 3BS1A 1PZID 4IURA 1QILA 2KA7A 3GV3A 1HUMA 5EKIA 3PV0A 1EFID 1PTOD 5ELDA 1ENFA 4RGOS 1STHA 1D6EC 4GZYC 4J8QA 4YIJA 1D2BA 4FNFA 3RD4A 1PYWD 1LTID 3T4AC 4QB4A 5I2XA 3QOLA 1VCIA 1LACA 3D31A 5ELBA 5BN4A 4X3UA 1BOSA 1SYBA 2JEAI 3QOJA 2ZT9C 4V190 4CGYB 3BVZA 2K5QA 1QE6A 4KHZA 3HG9A 2JYOA 1A2TA 1C48A 5KRUA 4BA1I 1C4QA 2EDGA 3BZDB 2RDGA 1EY9A 3ND9A 2G9HD 1S5BD 3E5SA 1VMPA 4QMGA 1WTWA 1DOLA 4KN4C 4RCOA 4ZKBB 1I3QB 2QILA 5DEHA 1I4GA 3Q23A 3AU7A 1IYUA 1BR9A 2A69C 3KF8A 3NTKA 3MFYA 2WP8J 2BOSA 1X3QA 2HCIA 2PZTA 1V8QA 4LAAA 3MVVA 2A6HD 1IKMA 1EY7A 2F0FA 2OF1A 4A3DB 3BVGA 3MC0B 2JSOA 4XQNA 2HCCA 2ICIA 5DNFA 3HKZB 3VYUA 3K59A 1LO5D 1OXXK 4X3KA 2QKIC 3OHXC 1O78A 3HGBA 3F2UA 1HQRD 5KYIA 1G6ZA 1LTAD 4K8IA 1TWFB 1SYGA 3NQIA 2R92B 3A56A 2N88A 3BVMA 1LT6D 1II3A 2PMZB 4F8MA 5I6YA 4ID6A 1NAPA 3H09A 2NVTB 1NR2A 2F0IA 2E2HB 2L4NA 1QWYA 2PZUA 1MSHA 1OXVA 1I4HA 1B3AA 1JQYD 1SMYC 3MEHA 1SE2A 2ZXRA 2F0QA 4DXFA 5F2DA 1TS5A 3HOUB 2NWGA 1Z6HA 2RVLA 3SHLA 1Y1VB 4DGZA 3BDLA 1H9SA 1HCZA 1TY2A 1RTNA 2I07B 3HP3A 1A2UA 1KAAA 3VA5A 2HDMA 1E2VA 1H9MA 2RQXA 3SVMA 5CV9A 3H91A 4EQOA 2A6HC 2L5TA 2XWJB 1F9PA 3CRKC 5C0XJ 1G8ZD 1XYIA 2QCPX 1QNUA 5JEAJ 3JAME 1CZWA 1PXUA 2K5DA 1G291 1UNSA 1RJTA 5EQ0A 1CM9A 4DFAA 4A3FB 1I6HB 1TU2B 5M5WB 3OSOA 4DAPA 1SYFA 2MPMA 1WTPA 1PRTD 2H4OA 3IL8A 5CBAE 2B2WA 1CA6A 1ZEQX 2A6EC 4BA2I 3I4LA 1EZ6A 3NXWA 1EEID 3Q0AA 4QCLA 5KNCA 4NMZA 1CI3M 2L1BA 3BYTB 1LTGD 4IFDH 2F0NA 4PV1C 2F0WA 3JAML 1STBA 1I4XA 2FMMA 4QF4A 3LX0A 2J7ZA 2KQ3A 1S5FD 3MHBA 2B2VA 3QJYA 3VR5A 1U4RA 4I7ZC 3OW7A 1TVXA 3TSSA 4KMUC 3BG3A 2B63B 1K8MA 5K36H 5M3MB 2KECA 3HOWB 3D4RA 2Q8IB 2CW0C 3M4OB 3GTPB 3D6WA 4P2CB 1SBBB 4WJWA 2IJ0A 1ZYRD 3T16A 3K6OA 1F2YA 3DEPA 2IPKD 2OEOA 3C46A 4A3EB 5JEAG 1EYDA 1VDZA 5J1ZA 3DXJC 4RH6A 3LNNA 3DHQA 1NUCA 5CC4A 1W6KA 4FF1A 4L6TB 1DZ1A 1KDAA 3OIQA 1D5XC 4LJZC 1GUOA 4A3GB 3S1RB 2PW7A 2B2YA 3H0GB 4CJ0B 4LK1C 1VMCA 3E0JA 5AFWA 5FO9B 3PUYA 2F0HA 1LV9A 3SEBA 2IX1A 1RTOA 3SK8A 4HTHA 4L8JA 3V05A 3M7GA 1GOZA 2ZXPA 3NE5B 1LT5D 1O7ZA 3QIAA 4N9PA 1EOTA 3G7LA 3QB3A 3NPPA 3D4WA 2K33A 3I8ZA 1RODA 4DK0A 4IALA 4RCNA 4KKUA 4OGQC 1E2ZA 1JORA 3M3YB 4DN4M 4C1NI 4IUNA 4O42A 3GTOB 2L11A 4KJOA 3MXUA 1DOKA 3K58A 2JA8B 1ONLA 3A8KE 1OXSC 1LT4D 2WACA 4ZAIA 4KK7A 1B9MA 1EIGA 2K32A 5EJWA 1WD0A 5LL6X 4RA8A 3U9SA 5EPJA 5C4HA 4ZUJA 5CBEE 2R6GA 1STNA 3J81L 2BE5D 1SEBD 2AWOA 4XXEA 2RSOA 3TZUA 2SDFA 3KLRA 2NN6G 1EYAA 4XQQA 5JVG3 5ELCA 2CHBD 5IIFA 4HEDA 1U4PA 3NWTA 3PUZA 1B4OA 3PIO3 2IX0A 3LWUA 4EQNA 1BF4A 1V1PA 3T13A 5CV6A 3SE0A 3X3MA 2NVYB 3D8GA 1GJXA 2YYZA 2NN6I 2QDBA 2FINB 1IW7C 3VYSA 3HOZB 3J7YW 5FK9C 2F0UA 2NZ1D 5LL6S 1BCPD 2B2VC 2MP1A 1HPCA 1G2SA 3D6CA 3A54A 3TMEA 5IGBA 2EXZA 1ILQA 4R8NA 2EJFC 3J81E 5BN3A 4TRDA 1FGBD 3U9OA 1HXYD 1EY6A 1A6XA 3GD7A 1DCZA 4ZRZA 3PO3B 3GTMB 2J0TD 2E74C 1JB3A 3VA7A 1QG7A 4K6LA 2DNCA 1IL8A 1O7YA 3TP6A 1QJOA 4M1UB 4J6HA 1M4VA 2VB3X 3C1EA 1TKWB 1IHZA 2F4IA 5C5LA 4XDXA 1V1PB 2F0SA 1B1ZA 2EJGC 2RDHA 1AZQA 4IN3A 1STYA 1PMRA 4DF7A 5IGEA 2BDNA 4Q0FA 1IKLA 3MTSA 4N9TA 5C4ZA 1F2MA 3VR2A 3HOYB 1BO0A 4RWSC 2NYZD 1JOOA 4RKLA 2G9DA 1WD1A 3S1QB 1DOMA 4FF2A 2F0EA 3K5LA 2F1MA 4BY7B 1A15A 3EA6A 2EYFA 4XTCS 2RKSA 3I91A 1A3UA 3NSWA 3KUPA 3R8BA 2M2LA 4CBVA 1T5EA 2B8FA 1F9SA 2QF7A 3V2TA 2B39A 5CV8A 4FYDA 1BXTA 4PMCA 1SJHD 3A7LA 2O5JC 5D3IB 5E3FA 1TS2A 5JPMC 4G4KA 1CTMA 3R3OA 4IQZA 4PMWA 2ICEC 1Q8IA 3PO2B 3RZDB 2KCNA 2HQEA 2JA6B 3UI2A 2NUCA 3TBIB 1RD9D 4KY5A 2A68D 3PIP3 3S2DB 2WINB 4IUTA 1TWGB 3OMCA 2VNUD 5K36G 2AUKA 4HN7A 4ZLTF 1SNOA 4H7BA 2ID0A 5FKAC 1J8IA 1PTOH 4KD4A 3WOEA 2NBFA 4O1NA 5FLXL 3OWFA 1SYDA 4S3SA 2BDOA 1KNEA 3KBXA 3FEWX 4OHJA 3HRZC 5TSSA 4FXGC 1STEA 1RCVD 5I9PA 1I4PA 5IT9E 2EYMA 1MSGA 5KNDA 2F0KA 2K6AA 4JBWA 3OMGA 1U4MA 1F2ZA 2E2IB 1BUVT 5K5PA 5C0XI 1EIHA 1F9RA 3A7AB 1B44D 2F0VA 3IKJA 2DY7A 4ILWA 1ENAA 1B50A 3GTKB 4QUCA 3EROA 3SR1A 3IAYA 4KTAA 2RDFA 4JK1C 5DAUA 4IUPA 4KY6A 4A3BB 2XIWA 5C3EB 1D1IA 2CVRA 3A8JE 5D65A 5I4DA 1YNJD 5HGTA 2K05A 3CHBD 2LS01 5FO7B 4UAIA 2EY2A 1CHQD 2EYLA 2Z4IA 3QG1A 2B2WC 2K1BA 4KY7A 4ZK9B 4NP5A 1JC7A 1EU4A 1DD2A 2Y0SB 2PZWA 1QCBD 5EKLA 1H9SB 2B2TA 1AW7A 2EY1A 4DXGA 1KDBA 3J80L 1YNND 2FHTA 2JXMB 3N6RA 3SDZA 1GHJA 1S5ED 1HTPA 4BWGB 4LMQD 1NR4A 3PUXA 4A3JB 3NWSA 2MGSA 1EY0A 1HQMC 1VF7A 2EE1A 1X3PA 1GUGA 1SYCA 1TWCB 2L0CA 1XWEA 2B2YC 2A74C 2O5IC 3I3CA 1OXTA 2RSNA 4RGMA 4OL7A 1KLGD 3P1HA 2N55A 4H44C 4M8AA 1JOQA 1STGA 4K5VA 1RHPA 2FMCA 4UDUC 4FXKC 1PFNA 3FPUB 5C5MA 2B2UC 4WORA 2J4XA 3HOXB 2QEJC 2R93B 3K7AB 1MI2A 1H9JA 4DAVA 2JA7B 3S17B 4A93B 1BBXC 5EPKA 4QUFA 1ZKOA 3GTQB 3I4MB 3RLFA 1KLUD 4C3IG 4FXDA 4A3KB 2SNSA 5CYUA 1AP0A 3NBHA 4EVOA 4CJ2C 1CZGA 3O13A 5ISRA 2Q8RE 3N52A 4BS9A 1DONA 1JOKA 3M7NA 1PFMA 4PNYA 3J7AF 2F0MA 1ESFA 3DWAA 2NVQB 1EY8A 1TWAB 3P20A 5CGKA 2K03A 2DY8A 1DM0B 3TN2A 3NP8A 2NN6H 4PQXA 3MXGA 5I9OA 3SXHA 3S15B 4WRDA 1ENCA 1KNAA 5M5XB 4OIKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EJF C;  1SMY C;  2V4D A;  2O5J C;  1YNN C;  5BN3 A;  4RCN A;  1E2W A;  4IFD G;  3QJY A;  5BN5 A;  4KN4 C;  1GUT A;  2JE6 I;  1CTM A;  4KKU A;  1E2Z A;  4OGQ C;  1Q1B A;  4H44 C;  1H9K A;  3GD7 A;  1A6X A;  3VR5 A;  1DCZ A;  4I7Z C;  4IQZ A;  3I73 A;  1Z6H A;  4JK1 C;  3T56 B;  1LAB A;  3OW7 A;  1GHK A;  3L7Z C;  4KMU C;  3BG3 A;  1K8M A;  5K36 H;  1H9S A;  2D5D A;  4TQU S;  1HCZ A;  2E74 C;  3VA7 A;  1K8O A;  2DNC A;  3MXU A;  1ZYR C;  1QJO A;  1ONL A;  3A8K E;  3T53 B;  3D4R A;  3EQL C;  1OXS C;  2Q8I B;  5C0X G;  1GUN A;  1IYU A;  2A68 D;  2DNE A;  2A69 C;  2CW0 C;  1B9N A;  3A8J E;  1E2V A;  1H9M A;  1TKW B;  1Y8O B;  1YNJ C;  2K7V A;  3MFY A;  3T51 B;  5K36 G;  2AUK A;  3VR3 A;  3PUV A;  1CFM A;  5JEA H;  2A69 D;  1V8Q A;  1B9M A;  2KCC A;  2BE5 C;  2A68 C;  2JEB I;  2K32 A;  3H94 A;  4G7H C;  3U9S A;  2EJG C;  1DXM A;  2A6H D;  2E75 C;  3IFT A;  3QG1 A;  2DN8 A;  2A6H C;  2PCF B;  3I72 A;  1PMR A;  1Q90 A;  2BA0 A;  4G7Z C;  2L5T A;  1H9J A;  1O7L A;  2R6G A;  4OO1 H;  2BE5 D;  1DD2 A;  2AWO A;  3WDN A;  5JEA G;  3CRK C;  4HR7 B;  1VDZ A;  2KA7 A;  3TZU A;  4DNT B;  3KLR A;  2BDO A;  1EWH A;  1ZKO A;  1Y8N B;  3DXJ C;  3VR2 A;  1OXX K;  2A6E D;  3LNN A;  2NN6 G;  4G7O C;  3RLF A;  1H9S B;  3PV0 A;  2E76 C;  2LMC B;  1G29 1;  3A8I E;  1O78 A;  4DNR B;  1FYC A;  3HGB A;  3OPO A;  3M85 A;  1Z7T A;  1Q12 A;  2PNR C;  1GUS A;  3FPP A;  4GZY C;  3PUZ A;  4H13 C;  5KND A;  2JXM B;  2IT1 A;  2BA1 A;  3N6R A;  4LJZ C;  1VF5 C;  1GUO A;  4JBW A;  4KKS A;  4KN7 C;  1TU2 B;  4KKT A;  1I6V C;  3SDZ A;  2F1M A;  4DK1 A;  3CRL C;  3VR6 A;  1IYV A;  3LWU A;  1GHJ A;  3FMC A;  1V43 A;  5C0X H;  1HTP A;  2D62 A;  1VCI A;  1LAC A;  3D31 A;  4LK1 C;  5BN4 A;  4XTC S;  4XIG S;  3OOC A;  3PUX A;  3M7N A;  2B8G A;  3PUY A;  3W3A A;  3SE0 A;  2A6E C;  2EVB A;  4KI0 A;  4BA2 I;  3I4L A;  2JEA I;  1HQM C;  1GJX A;  1VF7 A;  2AUJ D;  2YYZ A;  3BDO A;  2NN6 I;  1GUG A;  2PPB C;  3GQB A;  5KNC A;  1IW7 C;  2ZT9 C;  1T5E A;  3A7A B;  2B8F A;  1Y8P B;  3P20 A;  4TKO B;  3M4Y A;  1CI3 M;  1BDO A;  4L8J A;  2QF7 A;  1H9R A;  1OXV A;  5KNB A;  5A35 A;  2O5I C;  1FR3 A;  1IW7 D;  3PUW A;  3IKJ A;  4KHZ A;  3VR4 A;  4IFD H;  3NE5 B;  4PV1 C;  4OO1 G;  3ND8 A;  1HPC A;  2NN6 H;  3QIA A;  1OXT A;  4BA1 I;  2EDG A;  1Y69 U;  2D2C C;  2EJM A;  1OXU A;  2K33 A;  3A7L A;  4H0L C;  4DK0 A;  3AB9 A;  3ND9 A;  1Q1E A; 
#chains in the Genus database with same CATH topology
 1VQB A;  5DLQ E;  3CCM A;  3SK5 A;  1TT2 A;  5BN5 A;  1PH1 A;  1RF2 D;  3FDT A;  3GTG B;  3GV6 A;  1NBW A;  2VZA A;  2B29 A;  4F87 A;  4LUV A;  3ULP A;  3KF8 B;  2RHS B;  3L3O C;  1ML0 D;  4AYB B;  2C9O A;  1XX8 A;  5I6W A;  3W5O A;  2UXB Q;  2JA5 B;  1F2L A;  1K8O A;  3E9I A;  4DNI A;  1TWH H;  3EQL C;  5IGC A;  5C0X G;  2L55 A;  5KEE A;  3T1H L;  3H6M A;  1T5X D;  5GAD C;  5C3X A;  3T1Y L;  3H3V C;  2R7D A;  4P72 A;  1FNU A;  2A1A A;  1CFM A;  2VQF Q;  4OIJ A;  2KCC A;  4ODG A;  2WKC A;  2LKV A;  3S14 B;  1L1O A;  3R2T A;  3QO2 A;  1VQH A;  3GTO H;  2UU9 Q;  4ABN A;  1P8L A;  4GKK Q;  4A3E G;  2PCF B;  1PLF A;  2ENB A;  3MAQ A;  5I2Y A;  3S9W A;  3S16 H;  1BCP F;  3Q24 A;  4U67 3;  2K5W A;  5M5Y H;  3D4D A;  1N32 Q;  3GTK H;  5HY6 A;  2QW7 A;  3CD6 A;  3CU7 A;  1U5K A;  1VQE A;  1EQQ A;  1WFQ A;  4IUV A;  1KAB A;  2Z4H A;  4DR3 Q;  3A8I E;  2JQO A;  4JPB W;  2ZJR A;  1HJP A;  3HOV B;  1FJG Q;  4R4C A;  1K83 H;  3FRP B;  1D1K A;  1KAW A;  3WOF A;  5KYL A;  1JWU D;  1KTK A;  5ELF A;  4DPG A;  1V43 A;  5LMU L;  3J80 c;  1TS3 A;  4WFN 3;  5C0X H;  2D62 A;  3Q6S A;  1G2T A;  2R7Z G;  2JA5 H;  4XIG S;  4RFB A;  1XNR Q;  4CDE C;  1YEZ A;  3ONA B;  1SNC A;  3FVQ A;  4L5R C;  2ZTD A;  5A2Q E;  2JA8 H;  3G4S A;  1PZK D;  2PMZ E;  1SE3 A;  2B2T C;  3CQZ B;  3M9B A;  4TKO B;  4JI5 Q;  1BCP C;  1TII D;  1YHB A;  5KNB A;  1F77 A;  2IX3 A;  1XXG A;  2YU9 B;  3K0Y A;  3I90 A;  5C3E G;  5JJZ A;  2OXP A;  4IO9 A;  3URY A;  1Y69 U;  3ER0 A;  4H0L C;  1VQK A;  4B3T L;  1JCK B;  1TQO A;  2JK8 A;  1E0B A;  4DR2 Q;  1GKH A;  5E7N A;  4PMB A;  4G7O C;  5EKK A;  4BY7 G;  2QEX A;  1PTO B;  1ET9 A;  2E2H H;  1SNM A;  2K5H A;  1A63 A;  1AEX A;  2MQH A;  1V1O A;  1SR3 A;  3I73 A;  2CH4 W;  1RIP A;  2VL6 A;  1LAB A;  2N3S A;  4R4T A;  1A0I A;  3RLN A;  5C4J B;  5IWA Q;  4X6A H;  2TMP A;  4FDB A;  4A3F G;  4X3T A;  1VQM A;  2M9V A;  2XRQ D;  3TP5 A;  4BBR H;  3CCJ A;  1NTG A;  1K73 C;  3T53 B;  4NXM L;  2NVQ H;  1OO9 B;  1VQA A;  2AQ3 B;  5NUC A;  4B08 A;  4DAY A;  1X65 A;  1HA5 A;  3C2P A;  3AMU A;  4JI7 Q;  4KHP Q;  1PFB A;  5T1I A;  3PO3 H;  4KD3 A;  2R3Z A;  3PUV A;  4V0B A;  5JEA H;  1VQG A;  1W6J A;  2E2J B;  4NKL A;  4G57 A;  4HJ8 A;  2KCT A;  1DXM A;  2RBM A;  5LMN W;  5M5X H;  1EYC A;  2A73 B;  3I72 A;  2AQ1 B;  3EFX D;  4A3D G;  2HUG A;  1PZJ D;  3T1Y Q;  3S16 B;  3NQT A;  4C3I H;  2FFK B;  2SOB A;  3K5O A;  4NDX A;  5IP7 H;  4J1M A;  2D9U A;  3OPO A;  5CR3 A;  1Z7T A;  3M85 A;  2PNR C;  2K52 A;  3TDQ A;  3S1M H;  4E6I A;  4B3M L;  3C1F A;  2JA7 G;  3RZO B;  4DK1 A;  1I6V C;  2MO1 A;  3CRL C;  4AYB G;  4LNQ A;  5IYD H;  2EPB A;  4MTN A;  2JA9 A;  1HR0 W;  4HJ7 A;  4JI4 L;  1KDC A;  4HSV A;  3HOX G;  1LTS D;  2XSC A;  1HFG A;  2NTS A;  3CCQ A;  2A8V A;  1M8A A;  5HUR A;  2AKW B;  3TZD A;  2PPB C;  3G6J B;  4P73 A;  1STA A;  1VQ8 A;  1QVG A;  4DU9 A;  2O4X A;  1H9R A;  2HDL A;  3CME A;  3VR4 A;  2F3W A;  3ND8 A;  3D3R A;  1Y1W H;  1DJR D;  3DWQ A;  2EYJ A;  3I55 A;  2EJM A;  3S14 H;  1RKN A;  4JI1 Q;  3RR5 A;  4F7X A;  1B8A A;  4DR1 L;  2V4D A;  4X62 L;  2I46 A;  3J81 c;  3NTH A;  1R4Q B;  1K0S A;  3A5Z B;  1U9R A;  2K01 A;  4C3H G;  3FHW A;  3RMH A;  4K6D A;  1CKM A;  3CCU A;  1ESR A;  1N9W A;  4K2K A;  2EYP A;  1HUN A;  1VQJ A;  4NW2 A;  1HTL D;  1SFO H;  1L1O B;  2KEE A;  4BBS B;  4UY8 C;  4K5W A;  2HIX A;  3GTJ H;  3AQQ A;  3NUC A;  1IBM L;  2CQA A;  5IT9 L;  2A5H A;  1JWS D;  2LXJ A;  1C8C A;  4UPA A;  2PI2 A;  1QVF A;  1RDP D;  4C3J G;  2VS1 A;  1KRS A;  1HFN A;  1LTL A;  3D0F A;  5IYC G;  2BE5 C;  3MA2 B;  1ZXT A;  2O2L D;  1TY0 A;  1TS4 A;  3GTL B;  1B2T A;  3AFQ A;  2WII B;  4PZ8 A;  1T9H A;  5KGU A;  2R7Z H;  2BA0 A;  2UXD Q;  2P5Z X;  3M3Y H;  4HCS A;  4QL5 A;  1WCM B;  3HS0 C;  3KK7 A;  1AZP A;  4DNT B;  1JB7 A;  1Y8N B;  5IGD A;  2BCO A;  3B6Y A;  1Q3L A;  1CUK A;  1LLR D;  1SNP A;  1E24 A;  1CKO A;  3I56 A;  2RHQ B;  4DNR B;  2DJF C;  2PQE A;  2KOL A;  4JVZ A;  1L0X B;  3S2H H;  4YHH Q;  1GUS A;  5LHY 1;  2IT1 A;  4B3R L;  1K3R A;  1JE4 A;  4QIW B;  5A2Q L;  4KKS A;  2Q2H A;  4KN7 C;  4KKT A;  4C56 C;  3RZO H;  3BYY B;  3M4O H;  5JAV A;  4B9W A;  5CMD A;  1EZ8 A;  1A3V A;  2WAQ E;  4FP5 D;  3OOC A;  2R7F A;  4MIU A;  2WFW A;  3W3A A;  1LTB D;  4XYQ A;  1QOH A;  4KI0 A;  5FO8 B;  5M3M H;  1I94 Q;  4JI5 L;  4LFC L;  5C3E H;  1A3T A;  3J7A V;  2L9H A;  4LF4 L;  2HD3 A;  1NE3 A;  1I94 L;  1Y8P B;  1PDQ A;  4DUZ Q;  4POG A;  1BDO A;  4Y7N B;  1QB5 D;  3R2I A;  5EBC A;  3SK4 A;  4NPS A;  2KVM A;  1NCV A;  4OWT B;  2F0O A;  2XNA C;  4A75 A;  3DEO A;  5G3L F;  1XTD A;  2D2C C;  4HAE A;  1I4R A;  5DM7 3;  2Z1C A;  4C1N K;  1WTO A;  3KDF A;  1XMO Q;  1TWC H;  3NK9 A;  4FO2 A;  3U4V A;  1EL0 A;  4IFD G;  3SK6 A;  1SSO A;  5M5Y B;  1CK1 A;  3NEN A;  3HOZ H;  4IUU A;  1H9K A;  3DWP A;  4RGT A;  2B2U A;  4DR6 Q;  5EAY A;  3PGZ A;  3GP7 A;  2VQE Q;  4UP8 A;  1AE3 A;  4DV6 Q;  1FGU A;  1Q46 A;  3TRE A;  2EY5 A;  2PW5 A;  2GN5 A;  2NTT A;  4RG1 A;  3VR3 A;  4A3M B;  5AJ3 Q;  3J80 E;  1FNV A;  1MBY A;  1VQ9 A;  4IFD I;  3KLS X;  2E75 C;  1I5F A;  1UUP A;  4OON A;  3HFZ B;  1JR0 D;  1S3O A;  2F0T A;  3VDY A;  2UU9 L;  4GKK L;  1E22 A;  4TSS A;  5DM6 3;  4GN3 B;  5J39 A;  3PMF A;  1NSN S;  3CQZ H;  3C3L A;  2LY7 A;  5C3W A;  3ERS X;  1BKB A;  3E3X A;  2IWH A;  4Z9C B;  4LF6 L;  3AYH B;  2E76 C;  2LMC B;  5M3F H;  4DR7 L;  1Y1W B;  3NBI A;  2R92 G;  3FKI B;  1Y1W G;  3GTJ B;  3BDC A;  4JI8 Q;  3PQI A;  1VF5 C;  2OT2 A;  3P75 A;  1LT3 D;  1I50 H;  3TP7 A;  4NB3 A;  3S1N H;  3W2D A;  1JJ2 A;  1XTC D;  3P7J A;  1X56 A;  3NHH A;  4CKE A;  2MUY A;  2WKD A;  3IFD A;  3ZYY X;  1SFO B;  1LTT D;  2XGT A;  3BDO A;  5EPL A;  4I65 A;  1Q7Y C;  1HRJ A;  2PQA B;  3GQB A;  2XRS D;  1DYQ A;  2XN9 C;  1RL2 A;  4RKB A;  2F0L A;  1S5C D;  1GUW A;  2MHV A;  5A35 A;  3A55 A;  1EY5 A;  4IFD J;  3RZD H;  4JI6 Q;  4OO1 G;  4DV5 L;  2OQ0 A;  3R93 A;  1SAP A;  3G6E A;  1S4Z A;  1HNX L;  1WCM G;  3AB9 A;  4XQJ A;  5FOB B;  1Q1E A;  1YNN C;  1GO3 E;  4ALP A;  2E2D C;  4UP7 A;  1BQQ T;  1QNK A;  1GUT A;  3PIO A;  1YI2 A;  4UP9 A;  1X6O A;  1VQ5 A;  3TEH B;  1K0R A;  4RAU C;  5IY0 A;  4K5X A;  2Z9H A;  4QJF A;  5JPN C;  2Q8T A;  5IWA L;  2Q2U A;  2OQK A;  1L0W A;  2ASB A;  2DNE A;  1ET6 A;  2M00 A;  4BY7 H;  4LFB L;  2C5C A;  3L9A X;  1B9N A;  2LFN A;  1YNJ C;  3KJP A;  1CT1 D;  3T51 B;  1O80 A;  5G3L D;  1JIC A;  2KJX A;  5C44 H;  4DV7 Q;  4RHR A;  3H94 A;  4R9W A;  1IZ6 A;  1XPU A;  2KUM A;  2B3G A;  2DN8 A;  2KHS A;  1PRT F;  3ITP A;  1Q90 A;  4OO1 H;  1O7L A;  1PVO A;  5D14 A;  5C4X H;  1G91 A;  2MJ8 A;  1KHI A;  1WCM H;  1JWM D;  4XT1 B;  4L63 B;  1FNW A;  1YIT A;  4ME5 A;  3KBG A;  2CH4 A;  2EOT A;  1EY4 A;  1S40 A;  3DM1 A;  4A3I B;  2IL8 A;  3UDG A;  2AQ2 B;  5COR A;  2D0P A;  3KLS A;  5E4X A;  3MEF A;  1DGS A;  3I4N B;  5CV5 A;  4MHE A;  3PO2 G;  1IYV A;  4X66 L;  1I4Q A;  2K04 A;  4KHV A;  1F9Q A;  2DGY A;  1CHP D;  1U0L A;  2SEB D;  2Z6K C;  4GN5 A;  5EGT A;  4IZ8 A;  2B8G A;  4P71 A;  4BBR B;  2EVB A;  4DUZ L;  2QDL A;  2F0D A;  4C3H B;  2ZTE A;  1VQN A;  1K9M C;  1QUQ A;  5M9O A;  4NXN L;  4OEM B;  1XMQ Q;  1B53 A;  2Y0S G;  3EJI A;  1IBK L;  1Y14 B;  1JE5 A;  3QR8 A;  1L0Y B;  3GTM H;  2K28 A;  2E5L L;  2VW9 A;  1N8R C;  4KJN A;  3W1B A;  3HOW G;  3MWY W;  2NB0 A;  4X3S A;  1B70 B;  2WB1 B;  1GVP A;  1AN8 A;  1WTX A;  3HZX A;  1SMY D;  1EQV A;  3MXN A;  2JE6 I;  1S5D D;  1Q1B A;  2JP1 A;  5CV7 A;  4EGV A;  2PNH A;  1TWA H;  1HHV A;  2VQE L;  3I70 A;  1TWF H;  2RA4 A;  3BJU A;  1HNX Q;  1J9O A;  2EZV A;  4K2L A;  2GA4 B;  3OW2 A;  2D5D A;  4TQU S;  5C6A A;  2F3I A;  3I4N G;  4CHT B;  2H1E A;  2X6L A;  1BNZ A;  2KEN A;  3KF6 B;  1E7Z A;  1TWH B;  1VQL A;  5ELE A;  3VYT A;  1GUN A;  4DR5 L;  4ZKC B;  1PH4 A;  1WTV A;  1M1K C;  4FVM A;  1XPR A;  4YCV A;  1Y8O B;  1PTO F;  4R8I A;  2K7V A;  2OWO A;  2F03 A;  2CW0 D;  1SRU A;  3X3N A;  3OIP A;  4HCE A;  2JEB I;  2VQF L;  5FLX E;  5JVH 3;  4RGN A;  4XYO A;  2JN4 A;  4KV6 A;  4QIW E;  4HMJ A;  3TRZ A;  4A3C H;  4G7Z C;  3K57 A;  5E1F A;  3RN2 A;  1SXT A;  4BY1 B;  3E6Z X;  4YY3 Q;  1D8L A;  4HR7 B;  4MN3 A;  2WAQ B;  4YWK A;  5E4W C;  1D5Z C;  1BBW A;  4FF3 A;  4DR7 Q;  3HOY G;  4KHP L;  1KQS A;  1Z47 A;  1XNQ Q;  3K5N A;  1R9T B;  4XT3 B;  1K8G A;  2C35 B;  4EQP A;  1FYC A;  2OTJ A;  2D0O A;  4C2M B;  2R93 H;  1Q12 A;  3FPP A;  4K14 A;  3CPW A;  3WWV A;  2WV6 D;  4YCW A;  5T1G A;  2L12 A;  3EIV A;  2I0Q A;  2AWN A;  3VR6 A;  1SE4 A;  3ERQ A;  4CKC A;  3I4N H;  3MZ5 A;  1ASY A;  3S1N B;  2PQA A;  3GTP H;  3HKZ G;  5C44 B;  1PH5 A;  5IGG A;  5JJK A;  3JC6 6;  3NTI A;  2UUA Q;  5CV4 A;  3Q22 A;  3S1M B;  3STB D;  5M3F B;  1UAP A;  4A3B H;  4ZUI A;  4CJ1 B;  1MD2 D;  1ILP A;  4WJ3 M;  4DR4 L;  4JI0 Q;  3FP9 A;  3S1Q H;  3HOV G;  3UE0 A;  1HNZ Q;  1K83 B;  1U4L A;  4TVA B;  4DV5 Q;  3M4Y A;  1D5M C;  1I50 B;  1CA5 A;  1IW7 D;  1UEA B;  3PUW A;  1N33 L;  2UUB Q;  4A3L H;  4DV4 Q;  1CQF A;  1CKN B;  1SJE D;  5KIX A;  1HH2 P;  2ZTC A;  4DA2 A;  2X6G A;  1MGS A;  3CKI B;  3V96 A;  2R61 A;  1CQV A;  4J15 A;  4GOP B;  2ES2 A;  2BH2 A;  4F88 A;  3HEJ A;  5IYD G;  4NXM Q;  2VXW A;  1X32 A;  3HOU G;  2EYH A;  4HMI A;  4OO1 I;  4C3I B;  1EIF A;  4ZQ3 A;  3T56 B;  1WVL A;  3M4Q A;  1KRT A;  3L7Z C;  1QZH A;  1PRT B;  4ZYS A;  2KED A;  3CCR A;  3H0G H;  1ZYR C;  3HOZ G;  1VS0 A;  3RUZ A;  3AEV A;  4A93 G;  2NVX B;  3MXP A;  2ALY B;  4B3S Q;  1WI5 A;  5GAG C;  2PI2 E;  1E1T A;  4DR1 Q;  2SNM A;  4JV5 Q;  1FVI A;  1AFP A;  3ICE A;  2WB1 G;  1G51 A;  2A68 C;  3LWE A;  3K80 C;  3F8T A;  5COY A;  4LF9 L;  1GXD C;  4B9X A;  2EYO A;  3J81 j;  2XVS A;  2ZM6 Q;  4A3K H;  1SNQ A;  4U68 A;  4DK3 C;  2NZH A;  4A3L G;  3HKS A;  1O7I A;  1EU3 A;  3Q8D A;  4RHS A;  1VQC A;  3WDN A;  1TR5 A;  1R4P B;  5JOB A;  1WTR A;  2FJ2 A;  1WTQ A;  1EWH A;  2A6E D;  2X69 A;  1PTO C;  5IOC A;  1YHQ A;  4DV2 Q;  2XWB B;  5D3D A;  2GVB A;  3K5M A;  1N36 Q;  4LF4 Q;  4PZ7 A;  4H13 C;  2BA1 A;  1HZA A;  2HQL A;  4APV A;  1XPO A;  2VB2 X;  3FMC A;  2VUM G;  1LTR D;  2ZXO A;  5GAH C;  5IYC H;  1HA6 A;  3TP8 A;  1SYE A;  3VYR A;  3S2H B;  2H5X A;  1FD7 D;  1H95 A;  4C3J B;  4DR3 L;  3K8A A;  1EEF D;  2EY6 A;  3OWE B;  5EBD A;  2AUJ D;  2HHH Q;  4H02 A;  3GTG H;  1EUJ A;  3CPF A;  3EVQ A;  1BCP B;  4OX9 Q;  1EWC A;  4FF4 A;  3HOU H;  5IOD A;  1FR3 A;  2TSS A;  3DUZ A;  5LMN Q;  4HSP A;  1UE6 A;  2F0P A;  4IUQ A;  2R7Z B;  3DMU A;  1OXU A;  4CDF C;  1ICW A;  3GTL H;  4A3D H;  2L15 A;  3K81 C;  4LF5 Q;  1C9O A;  1E2W A;  2K14 A;  3ZJY C;  1SND A;  1IBM Q;  5C4X B;  2IW3 A;  5J22 A;  5IGF A;  2F3V A;  4K8J A;  3MFG A;  5IP9 G;  2F0J A;  2N49 A;  1GHK A;  4K0K Q;  2BH8 A;  1YIJ A;  2NVY H;  2NVT H;  2Z8L A;  2F0G A;  2PO4 A;  1SDF A;  4ZCK A;  4HJ9 A;  4CKB A;  5ELO A;  1SRO A;  3QWN A;  1EQT A;  2CWA A;  2A69 D;  2PYK A;  2KHI A;  4G7H C;  1KC8 C;  3BZK A;  4DV1 Q;  4DUY Q;  4DR6 L;  2K75 A;  4BBS H;  2AHO B;  3IFT A;  1VQP A;  4BXX H;  4Q5V A;  2UXD L;  3GO5 A;  1HR0 Q;  4R4I A;  1PRT C;  2LXK A;  4DKA C;  1EOV A;  4ULL A;  2ZJP A;  3BS1 A;  1PZI D;  4IUR A;  1QIL A;  4A3B G;  2KA7 A;  3GV3 A;  1HUM A;  5EKI A;  3U50 C;  5FJ8 H;  2RCF A;  3PV0 A;  2E2J H;  1EFI D;  1PTO D;  5ELD A;  1ENF A;  4RGO S;  1STH A;  1D6E C;  1YJN A;  4J8Q A;  4GZY C;  1Q82 C;  4YIJ A;  1D2B A;  3OTO L;  4JBJ A;  4JI6 L;  4FNF A;  1N33 Q;  3RD4 A;  1PYW D;  1LTI D;  3T4A C;  4QB4 A;  5I2X A;  1UE5 A;  3QOL A;  1VCI A;  1LAC A;  3D31 A;  5ELB A;  3U4Z A;  5BN4 A;  4GOP C;  1MKH A;  3J81 i;  4X3U A;  1BOS A;  1SYB A;  4DV3 L;  4WJ4 A;  2JEA I;  1SMX A;  3W1G A;  3QOJ A;  2ZT9 C;  4V19 0;  4BBS G;  1PH8 A;  3BVZ A;  4CGY B;  2K5Q A;  1QE6 A;  3NEL A;  2CCZ A;  4KHZ A;  3HG9 A;  3NEM A;  1EFW A;  2JYO A;  1A2T A;  1C48 A;  5KRU A;  4BA1 I;  2EIF A;  1C4Q A;  2EDG A;  3BZD B;  2RDG A;  1EY9 A;  3ND9 A;  4GLX A;  2G9H D;  1S5B D;  1PA6 A;  3E5S A;  1VMP A;  3F1Z A;  4QMG A;  1WTW A;  1DOL A;  4KN4 C;  4DV6 L;  1GD7 A;  4RCO A;  1LM0 A;  4ZKB B;  1I3Q B;  2QIL A;  5DEH A;  3K0X A;  1I4G A;  3Q23 A;  1EQR A;  1VQI A;  3AU7 A;  3EBE A;  1G6P A;  2DJG C;  2RCN A;  3KOJ A;  2NVX H;  1IYU A;  4BY1 G;  1BR9 A;  2CKZ B;  1S72 A;  2A69 C;  3KF8 A;  3NTK A;  3MFY A;  2WP8 J;  4JOI A;  4X65 L;  2BOS A;  2MO0 A;  2QA4 A;  5BR8 L;  1X3Q A;  2HCI A;  2PZT A;  1V8Q A;  3TS0 A;  4DV2 L;  4LAA A;  3MVV A;  2A6H D;  4LWC A;  1IKM A;  1EY7 A;  1YVC A;  2F0F A;  3H3V H;  2WB1 E;  2OF1 A;  4A3D B;  3BVG A;  2G5D A;  2B63 G;  3MC0 B;  4JC0 A;  2JSO A;  4XQN A;  2HCC A;  4POF A;  1PH3 A;  2ICI A;  5DNF A;  4Y7N H;  4LW1 A;  3IRB A;  4GN4 B;  4A3M H;  3HKZ B;  3OYY A;  3VYU A;  3K59 A;  1LO5 D;  1KD1 C;  1OXX K;  4X3K A;  2QKI C;  4ME3 A;  3KLW A;  4GNX A;  3OHX C;  1O78 A;  3HGB A;  1YJW A;  3F2U A;  4NXN Q;  1HQR D;  5KYI A;  2Z0S A;  1G6Z A;  4HIK A;  2MNA A;  1LTA D;  4K8I A;  4JCV E;  1CSQ A;  1PYB A;  1TWF B;  1SYG A;  3NQI A;  2R92 B;  1TWG H;  2E2I H;  3A56 A;  1IL2 A;  2N88 A;  3BVM A;  5C44 G;  1LT6 D;  1II3 A;  1WJJ A;  2PMZ B;  4F8M A;  5I6Y A;  4ID6 A;  5LMU Q;  1NAP A;  3H09 A;  2NVT B;  1NR2 A;  4X64 Q;  2LSS A;  2F0I A;  4GLA C;  2E2H B;  2L4N A;  1QWY A;  2PZU A;  1JT8 A;  1MSH A;  1OXV A;  2F4V L;  1I4H A;  2GVA A;  3TQY A;  3RLO A;  1B3A A;  1L2F A;  1JQY D;  3S24 A;  4DR5 Q;  4C3H H;  4JI3 Q;  2F52 A;  1SMY C;  3MEH A;  2KHJ A;  1SE2 A;  4EX5 A;  2ZXR A;  4BY1 H;  2F0Q A;  4DXF A;  5F2D A;  4YCU A;  2IY5 B;  1TS5 A;  1AH9 A;  2K50 A;  1EWI A;  1PV4 A;  3HOU B;  2NWG A;  1Z6H A;  2RVL A;  3SHL A;  1Y1V B;  4A3I G;  4DGZ A;  4GNX B;  3BDL A;  1H9S A;  1HCZ A;  2Z6B A;  3UDF A;  1TY2 A;  1RTN A;  5H1S E;  4PZ6 A;  2I07 B;  3HP3 A;  1A2U A;  1KAA A;  3VA5 A;  2I5H A;  2HDM A;  1E2V A;  1H9M A;  2RQX A;  3SVM A;  1A62 A;  5CV9 A;  3H91 A;  3PO3 G;  2ZM6 L;  4UHV A;  4OXP A;  4EQO A;  3OTO Q;  2A6H C;  2L5T A;  1A8V A;  2XWJ B;  1QZG A;  4LF8 Q;  1F9P A;  3CRK C;  3STB C;  5C0X J;  4AQY Q;  4R4Q A;  1G8Z D;  1XYI A;  2QCP X;  1JJG A;  1QNU A;  5JEA J;  3PCO B;  3JAM E;  1CZW A;  1PXU A;  3I4M G;  3DM3 A;  2K5D A;  1G29 1;  4HID A;  1UNS A;  5ELN A;  5AJ3 L;  1RJT A;  5EQ0 A;  1CM9 A;  2Q2I A;  2XTI A;  4DFA A;  3J80 i;  4A3F B;  5FLM H;  1I6H B;  1TU2 B;  5M5W B;  3OSO A;  4DAP A;  1PHJ A;  1SYF A;  1Y1V G;  2MPM A;  1WTP A;  1PRT D;  1J5E L;  4HIO A;  2H4O A;  1EYG A;  1N36 L;  3IL8 A;  1BBU A;  5CBA E;  5GRO A;  2B2W A;  1CA6 A;  1UEB A;  1ZEQ X;  2A6E C;  4BA2 I;  1NNX A;  2QGQ A;  3I4L A;  1EZ6 A;  3NXW A;  2UUC L;  1EEI D;  3Q0A A;  4QCL A;  3FKI G;  2Q2T A;  5KNC A;  2DUD A;  4NMZ A;  3E0E A;  2HHH L;  1CI3 M;  2L1B A;  3BYT B;  1LTG D;  4IFD H;  2F0N A;  4PV1 C;  2F0W A;  1IBL L;  3HOY H;  3JAM L;  1STB A;  1I4X A;  3KFU A;  2FMM A;  3CAM A;  4QF4 A;  3LX0 A;  1WYD A;  2J7Z A;  2KQ3 A;  5J3B A;  1S5F D;  3MHB A;  4LF7 L;  2B2V A;  3QJY A;  4GS3 A;  3KYH C;  3VR5 A;  4QY7 A;  1U4R A;  4I7Z C;  4JYA Q;  4IOC A;  3LGJ A;  4A3J H;  1X3G A;  3OW7 A;  1TVX A;  3TSS A;  4KMU C;  3BG3 A;  2B63 B;  1K8M A;  5K36 H;  1B7Y B;  5M3M B;  1YHA A;  3T1H Q;  3SGI A;  2KEC A;  3HOW B;  3D4R A;  3K7U C;  4R1J A;  2Q8I B;  1D7Q A;  1BVS A;  5BR8 Q;  2CW0 C;  3M4O B;  3GTP B;  1OTC A;  3D6W A;  4P2C B;  1SBB B;  4WJW A;  4IJL A;  1WOC A;  2IJ0 A;  2R92 H;  5JJI A;  3H15 A;  2UXC L;  1ZYR D;  3T16 A;  3K6O A;  1F2Y A;  3DEP A;  4O2D A;  2IPK D;  2OEO A;  3C46 A;  4A3E B;  5JEA G;  1EYD A;  2MFI A;  1VDZ A;  3JAM i;  5J1Z A;  2RF4 A;  4DV1 L;  3DXJ C;  4RH6 A;  3LNN A;  3DHQ A;  1NUC A;  5CC4 A;  3J7Z C;  1W6K A;  4FF1 A;  2K5V A;  4L6T B;  3CCS A;  3JAM c;  1DZ1 A;  1KDA A;  3CCV A;  3OIQ A;  2K5N A;  1D5X C;  3CMA A;  1TXY A;  2HT1 A;  2F4V Q;  4LJZ C;  1GUO A;  4A3G B;  3S1R B;  1MJE A;  2KBN A;  2PW7 A;  2B2Y A;  3H0G B;  4CJ0 B;  4LK1 C;  4X64 L;  1SE8 A;  1VMC A;  3E0J A;  5AFW A;  5FO9 B;  3PUY A;  4P75 A;  2F0H A;  3AFP A;  1LV9 A;  3SEB A;  2IX1 A;  1RTO A;  4IPC A;  1IYJ B;  1MIU A;  2ATW A;  3SK8 A;  1HNZ L;  4HTH A;  4L8J A;  3V05 A;  3M7G A;  1GOZ A;  2ZXP A;  3NE5 B;  2AMC B;  1P16 A;  1LT5 D;  4DR2 L;  1O7Z A;  3GTQ H;  3QIA A;  4N9P A;  3CC4 A;  1EOT A;  3G7L A;  3QB3 A;  3NPP A;  3D4W A;  2K33 A;  1VQO A;  3I8Z A;  1E1O A;  1ROD A;  4DK0 A;  4IAL A;  1IXR A;  4RCN A;  4KKU A;  4OGQ C;  1E2Z A;  1JOR A;  3M3Y B;  4EQ5 A;  2IHE A;  4DN4 M;  4C1N I;  4IUN A;  2E8G A;  4JOI C;  4O42 A;  3GTO B;  2L11 A;  4PG3 A;  4KJO A;  3MXU A;  1PH2 A;  1PH9 A;  1DOK A;  3K58 A;  2JA8 B;  1ONL A;  1Z9F A;  3A8K E;  2JA8 G;  1OXS C;  2I5M X;  1LT4 D;  2WAC A;  4ZAI A;  4YWL A;  3GDE A;  2OTL A;  1HZB A;  1I6H H;  5FLM G;  4KK7 A;  1B9M A;  3CP0 A;  1EIG A;  2K32 A;  5EJW A;  1WD0 A;  5LL6 X;  3RN5 A;  4RA8 A;  3U9S A;  1Y1V H;  5FLX c;  2FXQ A;  2YV5 A;  5EPJ A;  5C4H A;  4DR4 Q;  3EN2 A;  4ZUJ A;  3KJO A;  5CBE E;  5L37 A;  2R6G A;  1STN A;  3J81 L;  3HOV H;  2BE5 D;  2YTX A;  1SEB D;  2AWO A;  1L1O C;  4XXE A;  3PIP A;  3DLL A;  2RSO A;  3TZU A;  2SDF A;  4KLK A;  3KLR A;  1HZC A;  2NN6 G;  1X3E A;  1EYA A;  4JI2 Q;  4XQQ A;  5JVG 3;  4DV3 Q;  5ELC A;  2CHB D;  4JI8 L;  5IIF A;  4HED A;  1U4P A;  3NWT A;  5IT9 c;  3PUZ A;  1B4O A;  1B3Q A;  4A3M G;  2VY3 A;  3PIO 3;  1HNW Q;  2IX0 A;  3LWU A;  4EQN A;  2B63 H;  1BF4 A;  1I3Q H;  5HGQ A;  1V1P A;  3T13 A;  1V9P A;  5CV6 A;  1UWV A;  3HOW H;  4A3G G;  2E5L Q;  4B3R Q;  3SE0 A;  3X3M A;  4A3J G;  2NVY B;  3CCE A;  3FKI H;  3D8G A;  1GJX A;  3CC2 A;  2YYZ A;  4DV0 Q;  2NN6 I;  2QDB A;  4DAY B;  2FIN B;  4GKJ Q;  1CSP A;  1IW7 C;  3VYS A;  5FK9 C;  2NZ1 D;  2F0U A;  3BU2 A;  3J7Y W;  1IBL Q;  3HOZ B;  4JI0 L;  5LL6 S;  1C0A A;  1BCP D;  2B2V C;  2MP1 A;  1HPC A;  1G2S A;  3D6C A;  4IPH A;  3A54 A;  4JI3 L;  3TME A;  5IGB A;  1M90 C;  4DK6 C;  2EXZ A;  4AIM A;  3G48 A;  1ILQ A;  4R8N A;  2EJF C;  1HZ9 A;  3J81 E;  5BN3 A;  4TRD A;  5M3M G;  1FGB D;  3U9O A;  1HXY D;  4A3E H;  1EY6 A;  1A6X A;  3GD7 A;  4IJH A;  1X55 A;  2N78 A;  1DCZ A;  4ZRZ A;  3PO3 B;  1X9N A;  1UE7 A;  4HJ5 A;  3GTM B;  2J0T D;  1MJC A;  2E74 C;  1JB3 A;  3VA7 A;  1QG7 A;  4K6L A;  2DNC A;  1VQ4 A;  1IL8 A;  1O7Y A;  3TP6 A;  1QJO A;  4M1U B;  4CDD C;  4LFA L;  3CXC A;  4J6H A;  1M4V A;  2VB3 X;  4A3G H;  3C1E A;  4N8F A;  1ICF B;  1TKW B;  1IHZ A;  2F4I A;  5C5L A;  4XDX A;  4B3S L;  1V1P B;  2F0S A;  2K4K A;  1B1Z A;  2EJG C;  2RDH A;  1AZQ A;  3S15 H;  4IN3 A;  1HR0 L;  2CWP A;  3UDX A;  2HIV A;  1STY A;  1PMR A;  4DF7 A;  4LF9 Q;  5IGE A;  2BDN A;  4Q0F A;  3I4O A;  1IKL A;  3MTS A;  4N9T A;  2YTY A;  5C4Z A;  5C4X G;  3PF4 A;  1F2M A;  3VR2 A;  1YNX A;  4GLV B;  4JV5 L;  3HOY B;  1BO0 A;  4RWS C;  2NYZ D;  4IPG A;  1JOO A;  2IHF A;  4RKL A;  2WAQ G;  2G9D A;  1WD1 A;  4B3M Q;  3S1Q B;  1DOM A;  4FF2 A;  3H3V I;  2F0E A;  1FL0 A;  2JA6 G;  3K5L A;  2EXD A;  2F1M A;  1Q8K A;  4BY7 B;  4OEL B;  1A15 A;  2JJQ A;  3EA6 A;  4B3T Q;  2EYF A;  4XTC S;  3G71 A;  2RKS A;  3I91 A;  1A3U A;  5M3F G;  1VQF A;  3NSW A;  3KUP A;  3R8B A;  3I7F A;  3CF5 A;  2M2L A;  2V1C C;  4CBV A;  1AE2 A;  1FJG L;  1T5E A;  1NJI C;  2B8F A;  5IE8 A;  1F9S A;  2QF7 A;  3V2T A;  2B39 A;  3J7A 5;  3MXN B;  4LUO A;  1E3P A;  5CV8 A;  4FYD A;  4MTK A;  1BXT A;  4PMC A;  4BXX G;  3H0G G;  4JW0 A;  1SJH D;  3A7L A;  4IPD A;  1YBY A;  4RMF A;  4GKJ L;  4A93 H;  2O5J C;  4MNO A;  5D3I B;  5E3F A;  4AYB E;  1TS2 A;  3KF6 A;  4GNX C;  5JPM C;  4G4K A;  1CTM A;  4MZ9 A;  3R3O A;  4IQZ A;  1YZ6 A;  2ICE C;  4PMW A;  4AH6 A;  3A5U A;  1Q8I A;  3PO2 B;  3RZD B;  2KCN A;  2HQE A;  2JA6 B;  3UI2 A;  4K0K L;  2NUC A;  3TBI B;  1RD9 D;  4KY5 A;  1GM5 A;  2A68 D;  3PIP 3;  3S2D B;  2WIN B;  4IUT A;  1TWG B;  3E9H A;  3OMC A;  2VNU D;  5K36 G;  4LF5 L;  2AUK A;  4HN7 A;  4ZLT F;  1SNO A;  1VQD A;  4H7B A;  1K28 A;  4A3C G;  2ID0 A;  5FKA C;  2UXC Q;  1J8I A;  1PTO H;  4KD4 A;  1NY4 A;  3WOE A;  1J5E Q;  2NBF A;  1X54 A;  1V1Q A;  4O1N A;  5FLX L;  3OWF A;  1SYD A;  3RNU A;  4S3S A;  2BDO A;  1KNE A;  3KBX A;  2JA5 G;  1YJ9 A;  3FEW X;  4OHJ A;  3HRZ C;  5TSS A;  1Q86 C;  4FXG C;  1STE A;  1KIX A;  2UUC Q;  1RCV D;  5I9P A;  1I4P A;  5IT9 E;  2Z6K A;  2EYM A;  3KDF B;  4DUY L;  1MSG A;  1XNQ L;  3U58 A;  5KND A;  2F0K A;  2K6A A;  3ULJ A;  4JBW A;  3HOX H;  3OMG A;  2VUM B;  1U4M A;  1F2Z A;  4JBM A;  4JI1 L;  5GAE C;  2E2I B;  5LMN L;  4OWX B;  1BUV T;  3NBH B;  1PH7 A;  2CQO A;  5K5P A;  5C0X I;  1CKN A;  1XNR L;  1EIH A;  1F9R A;  4JYA L;  4L5Q A;  3A7A B;  4GOP A;  1Q81 C;  2UUB L;  3TS2 A;  1B44 D;  3I4M H;  3CW2 C;  2F0V A;  2ZJQ A;  3HKZ E;  3IKJ A;  4OWW B;  5IYB G;  2DY7 A;  3F2B A;  4IOA A;  4ILW A;  3UDI A;  1ENA A;  1B50 A;  4HJA A;  3F2D A;  1R9T H;  2OCE A;  1SN8 A;  3GTK B;  4QUC A;  3ERO A;  3SR1 A;  3IAY A;  2YTV A;  1XMO L;  4KTA A;  1WTH A;  3S17 H;  4JBK A;  2RDF A;  1W2B A;  4JK1 C;  1N34 L;  3ULL A;  4CDC C;  5DAU A;  3L0O A;  1W3S A;  4C3J H;  4QQB X;  4IUP A;  4KY6 A;  4A3B B;  2XIW A;  3I2Z A;  2NZO A;  3CC7 A;  4DV7 L;  5IP7 G;  5C3E B;  1D1I A;  2CVR A;  5GQO A;  3A8J E;  4JI7 L;  5D65 A;  4LF7 Q;  1JJC B;  1VQ7 A;  5M5W H;  4AQY L;  1LYL A;  5I4D A;  1YNJ D;  5HGT A;  1KXL A;  2K05 A;  3CHB D;  2LS0 1;  5FO7 B;  4UAI A;  2EY2 A;  1CHQ D;  2EYL A;  2Z4I A;  1ASZ A;  3QG1 A;  2B2W C;  2K1B A;  4KY7 A;  4ZK9 B;  4NP5 A;  5FJ8 G;  1JC7 A;  5IYB H;  2UXB L;  1EU4 A;  1DD2 A;  2KCM A;  2Y0S B;  4QGU A;  2PZW A;  1KL9 A;  1QCB D;  5EKL A;  4LF6 Q;  1VQ6 A;  4P74 A;  1H9S B;  1C7Y A;  4JI2 L;  2B2T A;  1AW7 A;  2EY1 A;  4DXG A;  1KDB A;  3J80 L;  1YNN D;  2FHT A;  2JXM B;  3N6R A;  4LUZ A;  1NMG A;  3SDZ A;  4I7A A;  1GHJ A;  2I5L X;  1S5E D;  1LUZ A;  1N32 L;  1X3F A;  1HTP A;  4BWG B;  2Y0S E;  4LMQ D;  1NR4 A;  3PUX A;  4A3J B;  3NWS A;  4OX9 L;  1XMQ L;  1HNW L;  2MGS A;  1EY0 A;  1HQM C;  1VF7 A;  2EE1 A;  1X3P A;  2R93 G;  1GUG A;  1SYC A;  1TWC B;  2L0C A;  3PF5 A;  1XWE A;  2B2Y C;  2A74 C;  1XJV A;  3S1R H;  1JMC A;  2O5I C;  3I3C A;  1OXT A;  2RSN A;  3UE1 A;  1MHW C;  4RGM A;  4X62 Q;  4OL7 A;  1PFS A;  1KLG D;  4A76 A;  1J6Q A;  3P1H A;  1SLJ A;  4DAM A;  2N55 A;  4H44 C;  4M8A A;  4DV4 L;  1JOQ A;  1STG A;  4K5V A;  4X65 Q;  1RHP A;  5IP9 H;  3PO2 H;  1PH6 A;  2FMC A;  4UDU C;  4FXK C;  1QVC A;  1PFN A;  3FPU B;  5C5M A;  2B2U C;  4YWM A;  4L5T A;  2J4X A;  2N8N A;  4WOR A;  4A3F H;  1N34 Q;  4LFB Q;  3HOX B;  4Y52 H;  4JG2 A;  4N8X 1;  2QEJ C;  1EIY B;  4C2M H;  2R93 B;  4LFA Q;  1K3B C;  4HIM A;  4YY3 L;  3K7A B;  1MI2 A;  1H9J A;  4DAV A;  2CFM A;  2JA7 B;  1QUQ B;  3BZC A;  3S17 B;  4A93 B;  3M4P A;  1BBX C;  5EPK A;  3A74 A;  4QUF A;  1ZKO A;  3GTQ B;  4LF8 L;  2UUA L;  2YU9 H;  3F2C A;  3I4M B;  4BBR G;  3RLF A;  1KLU D;  4YHH L;  4C3I G;  4DV0 L;  1NMF A;  4A3K G;  4FXD A;  3CCL A;  4A3K B;  2SNS A;  5CYU A;  1AP0 A;  3NBH A;  4EVO A;  4CJ2 C;  3L2P A;  4O0A A;  1PYS B;  1CZG A;  4X66 Q;  3O13 A;  4A4I A;  5ISR A;  2Q8R E;  3N52 A;  3S2D H;  4BS9 A;  1DON A;  1JOK A;  5C4J H;  3M7N A;  1PFM A;  4PNY A;  4LFC Q;  2JA6 H;  3J7A F;  4L5S A;  2F0M A;  1K8A C;  1ESF A;  3DWA A;  2VUM H;  1EY8 A;  2NVQ B;  1TWA B;  3P20 A;  5CGK A;  2A19 A;  3PSI A;  2K03 A;  1UE1 A;  4A3I H;  2DY8 A;  1DM0 B;  3TN2 A;  4R4O A;  3NP8 A;  2NN6 H;  1IBK Q;  4PQX A;  3MXG A;  3SXH A;  5I9O A;  3S15 B;  3A0J A;  4WRD A;  5JJL A;  1ENC A;  1KNA A;  2JA7 H;  4JI4 Q;  5M5X B;  2EQS A;  3K7A H;  4OIK A; 
#chains in the Genus database with same CATH homology
 3SK5 A;  1TT2 A;  5BN5 A;  1RF2 D;  3FDT A;  3GTG B;  3GV6 A;  4F87 A;  3L3O C;  1ML0 D;  4AYB B;  2C9O A;  1XX8 A;  5I6W A;  2JA5 B;  1F2L A;  1K8O A;  3EQL C;  5IGC A;  5C0X G;  2L55 A;  5KEE A;  3H6M A;  1T5X D;  3H3V C;  5C3X A;  1FNU A;  1CFM A;  4OIJ A;  2KCC A;  4ODG A;  2WKC A;  2LKV A;  3S14 B;  3R2T A;  3QO2 A;  4ABN A;  2PCF B;  1PLF A;  2ENB A;  3MAQ A;  5I2Y A;  3S9W A;  1BCP F;  3Q24 A;  4U67 3;  2K5W A;  3D4D A;  3CU7 A;  4IUV A;  1KAB A;  2Z4H A;  3A8I E;  3HOV B;  3FRP B;  1D1K A;  3WOF A;  5KYL A;  1JWU D;  1KTK A;  5ELF A;  1V43 A;  1TS3 A;  4WFN 3;  5C0X H;  2D62 A;  3Q6S A;  1G2T A;  4XIG S;  4RFB A;  3ONA B;  1SNC A;  3FVQ A;  5A2Q E;  1PZK D;  1SE3 A;  2B2T C;  3CQZ B;  4TKO B;  1BCP C;  1TII D;  5KNB A;  1F77 A;  2IX3 A;  1XXG A;  2YU9 B;  3K0Y A;  3I90 A;  5JJZ A;  2OXP A;  3URY A;  1Y69 U;  4H0L C;  1JCK B;  1TQO A;  1E0B A;  4PMB A;  4G7O C;  5EKK A;  1PTO B;  1ET9 A;  1SNM A;  1AEX A;  1V1O A;  3I73 A;  1LAB A;  5C4J B;  2TMP A;  4X3T A;  2M9V A;  2XRQ D;  3TP5 A;  3T53 B;  2VUM B;  4B08 A;  1OO9 B;  2AQ3 B;  5NUC A;  4DAY A;  3C2P A;  1HA5 A;  3AMU A;  1PFB A;  5T1I A;  4KD3 A;  2R3Z A;  3PUV A;  4V0B A;  5JEA H;  1W6J A;  2E2J B;  4NKL A;  4G57 A;  1DXM A;  2RBM A;  1EYC A;  2A73 B;  3I72 A;  2AQ1 B;  3EFX D;  2HUG A;  1PZJ D;  3S16 B;  3NQT A;  2FFK B;  2SOB A;  3K5O A;  4NDX A;  4J1M A;  2D9U A;  3OPO A;  5CR3 A;  1Z7T A;  3M85 A;  2PNR C;  3TDQ A;  4E6I A;  3C1F A;  3RZO B;  4DK1 A;  1I6V C;  3CRL C;  2EPB A;  1KDC A;  4HSV A;  1LTS D;  2XSC A;  1HFG A;  2NTS A;  1M8A A;  5HUR A;  3TZD A;  2PPB C;  3G6J B;  1STA A;  4DU9 A;  2O4X A;  1H9R A;  2HDL A;  3VR4 A;  2F3W A;  3ND8 A;  3D3R A;  1DJR D;  3DWQ A;  2EYJ A;  2EJM A;  1RKN A;  4F7X A;  2V4D A;  2I46 A;  3NTH A;  1R4Q B;  1U9R A;  2K01 A;  4C3H G;  3RMH A;  4K6D A;  1ESR A;  4K2K A;  2EYP A;  1HUN A;  4NW2 A;  1HTL D;  2KEE A;  4BBS B;  4K5W A;  3NUC A;  2CQA A;  5IT9 L;  2A5H A;  1JWS D;  1C8C A;  1RDP D;  4C3J G;  1HFN A;  2BE5 C;  3MA2 B;  1ZXT A;  2O2L D;  1TY0 A;  1TS4 A;  3GTL B;  1B2T A;  2WII B;  5KGU A;  2BA0 A;  4HCS A;  1WCM B;  3HS0 C;  3KK7 A;  1AZP A;  4DNT B;  1Y8N B;  5IGD A;  2BCO A;  1Q3L A;  1LLR D;  1SNP A;  4DNR B;  2PQE A;  2KOL A;  1L0X B;  1GUS A;  5LHY 1;  2IT1 A;  1JE4 A;  4QIW B;  5A2Q L;  4KKS A;  4KN7 C;  4KKT A;  4C56 C;  3BYY B;  5JAV A;  4B9W A;  5CMD A;  1EZ8 A;  1A3V A;  4FP5 D;  3OOC A;  4MIU A;  3W3A A;  1LTB D;  4XYQ A;  1QOH A;  4KI0 A;  5FO8 B;  1A3T A;  3J7A V;  2L9H A;  1Y8P B;  1PDQ A;  1BDO A;  4Y7N B;  1QB5 D;  3R2I A;  5EBC A;  3SK4 A;  2KVM A;  1NCV A;  2F0O A;  2XNA C;  3DEO A;  5G3L F;  4HAE A;  2D2C C;  1I4R A;  5DM7 3;  2Z1C A;  4C1N K;  1WTO A;  3NK9 A;  4FO2 A;  1EL0 A;  4IFD G;  3SK6 A;  1SSO A;  5M5Y B;  1CK1 A;  4IUU A;  1H9K A;  3DWP A;  4RGT A;  2B2U A;  3GP7 A;  2EY5 A;  2PW5 A;  2NTT A;  3VR3 A;  4A3M B;  3J80 E;  1FNV A;  1MBY A;  4IFD I;  3KLS X;  2E75 C;  1UUP A;  1JR0 D;  2F0T A;  4TSS A;  5DM6 3;  5J39 A;  3PMF A;  1NSN S;  3C3L A;  2LY7 A;  5C3W A;  2IWH A;  4Z9C B;  2E76 C;  2LMC B;  1Y1W B;  3NBI A;  3FKI B;  3GTJ B;  3BDC A;  1VF5 C;  2OT2 A;  3P75 A;  1LT3 D;  3TP7 A;  3W2D A;  1XTC D;  3P7J A;  3NHH A;  4CKE A;  2MUY A;  2WKD A;  3IFD A;  3ZYY X;  1SFO B;  1LTT D;  5EPL A;  3BDO A;  4I65 A;  1HRJ A;  3GQB A;  2XRS D;  1DYQ A;  2XN9 C;  4RKB A;  2F0L A;  1S5C D;  1GUW A;  2MHV A;  5A35 A;  3A55 A;  1EY5 A;  4IFD J;  4OO1 G;  3R93 A;  1SAP A;  1S4Z A;  4XQJ A;  3AB9 A;  5FOB B;  1Q1E A;  1YNN C;  2E2D C;  1BQQ T;  1QNK A;  1GUT A;  4RAU C;  4K5X A;  5JPN C;  2Q8T A;  2DNE A;  1ET6 A;  2M00 A;  2C5C A;  3L9A X;  1B9N A;  2LFN A;  1YNJ C;  1CT1 D;  3T51 B;  1O80 A;  5G3L D;  1JIC A;  2KJX A;  4RHR A;  3H94 A;  4R9W A;  2KUM A;  2DN8 A;  2KHS A;  1PRT F;  3ITP A;  1Q90 A;  4OO1 H;  1O7L A;  5D14 A;  1G91 A;  2MJ8 A;  1JWM D;  4XT1 B;  4L63 B;  1FNW A;  4ME5 A;  3KBG A;  2EOT A;  1EY4 A;  3DM1 A;  4A3I B;  2IL8 A;  2AQ2 B;  5COR A;  3KLS A;  5E4X A;  3I4N B;  5CV5 A;  4MHE A;  1IYV A;  1I4Q A;  2K04 A;  4KHV A;  1F9Q A;  1CHP D;  2SEB D;  5EGT A;  4IZ8 A;  2B8G A;  4BBR B;  2EVB A;  2F0D A;  4C3H B;  5M9O A;  1B53 A;  3EJI A;  1L0Y B;  2K28 A;  4KJN A;  3MWY W;  2NB0 A;  4X3S A;  2WB1 B;  1AN8 A;  1WTX A;  3HZX A;  1SMY D;  1EQV A;  3MXN A;  2JE6 I;  1S5D D;  1Q1B A;  2JP1 A;  5CV7 A;  4EGV A;  1HHV A;  3I70 A;  2RA4 A;  1J9O A;  2EZV A;  4K2L A;  2GA4 B;  2D5D A;  4TQU S;  5C6A A;  4CHT B;  2H1E A;  2X6L A;  1BNZ A;  1TWH B;  5ELE A;  3VYT A;  1GUN A;  4ZKC B;  1WTV A;  4FVM A;  4R8I A;  1Y8O B;  1PTO F;  2K7V A;  2F03 A;  2CW0 D;  3X3N A;  3OIP A;  4HCE A;  2JEB I;  5FLX E;  5JVH 3;  4RGN A;  4XYO A;  4KV6 A;  4HMJ A;  4G7Z C;  3K57 A;  5E1F A;  1SXT A;  4BY1 B;  3E6Z X;  4HR7 B;  4MN3 A;  2WAQ B;  5E4W C;  1D5Z C;  4FF3 A;  1Z47 A;  3K5N A;  1R9T B;  4XT3 B;  4EQP A;  1FYC A;  4C2M B;  1Q12 A;  3FPP A;  4K14 A;  2WV6 D;  5T1G A;  2L12 A;  2AWN A;  3VR6 A;  1SE4 A;  3ERQ A;  4CKC A;  3MZ5 A;  3S1N B;  5C44 B;  5IGG A;  3NTI A;  5CV4 A;  3Q22 A;  3S1M B;  5M3F B;  1UAP A;  4ZUI A;  4CJ1 B;  1MD2 D;  1ILP A;  1K83 B;  1U4L A;  3M4Y A;  1D5M C;  1I50 B;  1CA5 A;  1IW7 D;  1UEA B;  3PUW A;  1CQF A;  1SJE D;  5KIX A;  4DA2 A;  2X6G A;  1MGS A;  3CKI B;  3V96 A;  2R61 A;  1CQV A;  4F88 A;  3HEJ A;  2VXW A;  1X32 A;  2EYH A;  4HMI A;  4OO1 I;  4C3I B;  4ZQ3 A;  3T56 B;  1WVL A;  3L7Z C;  1PRT B;  4ZYS A;  2KED A;  1ZYR C;  3RUZ A;  2NVX B;  3MXP A;  2SNM A;  1AFP A;  2A68 C;  3LWE A;  5COY A;  4B9X A;  1GXD C;  2EYO A;  2XVS A;  1SNQ A;  4U68 A;  1EU3 A;  4RHS A;  3WDN A;  1TR5 A;  1R4P B;  5JOB A;  1WTR A;  2FJ2 A;  1WTQ A;  1EWH A;  2A6E D;  2X69 A;  1PTO C;  5IOC A;  2XWB B;  5D3D A;  3K5M A;  4H13 C;  2BA1 A;  2VB2 X;  3FMC A;  1LTR D;  2ZXO A;  1HA6 A;  3TP8 A;  1SYE A;  3VYR A;  3S2H B;  1FD7 D;  4C3J B;  1EEF D;  2EY6 A;  3OWE B;  5EBD A;  2AUJ D;  3EVQ A;  1BCP B;  1EWC A;  4FF4 A;  5IOD A;  1FR3 A;  2TSS A;  3DUZ A;  4HSP A;  2F0P A;  4IUQ A;  2R7Z B;  3DMU A;  1OXU A;  1ICW A;  1E2W A;  1SND A;  5C4X B;  2IW3 A;  5J22 A;  5IGF A;  2F3V A;  4K8J A;  3MFG A;  2F0J A;  1GHK A;  2Z8L A;  2F0G A;  2PO4 A;  1SDF A;  4CKB A;  3QWN A;  1EQT A;  2A69 D;  2PYK A;  4G7H C;  3IFT A;  4Q5V A;  3GO5 A;  1PRT C;  4ULL A;  3BS1 A;  1PZI D;  4IUR A;  1QIL A;  2KA7 A;  3GV3 A;  1HUM A;  5EKI A;  3PV0 A;  1EFI D;  1PTO D;  5ELD A;  1ENF A;  4RGO S;  1STH A;  1D6E C;  4GZY C;  4J8Q A;  4YIJ A;  1D2B A;  4FNF A;  3RD4 A;  1PYW D;  1LTI D;  3T4A C;  4QB4 A;  5I2X A;  3QOL A;  1VCI A;  1LAC A;  3D31 A;  5ELB A;  5BN4 A;  4X3U A;  1BOS A;  1SYB A;  2JEA I;  3QOJ A;  2ZT9 C;  4V19 0;  4CGY B;  3BVZ A;  2K5Q A;  1QE6 A;  4KHZ A;  3HG9 A;  2JYO A;  1A2T A;  1C48 A;  5KRU A;  4BA1 I;  1C4Q A;  2EDG A;  3BZD B;  2RDG A;  1EY9 A;  3ND9 A;  2G9H D;  1S5B D;  3E5S A;  1VMP A;  4QMG A;  1WTW A;  1DOL A;  4KN4 C;  4RCO A;  4ZKB B;  1I3Q B;  2QIL A;  5DEH A;  1I4G A;  3Q23 A;  3AU7 A;  1IYU A;  1BR9 A;  2A69 C;  3KF8 A;  3NTK A;  3MFY A;  2WP8 J;  2BOS A;  1X3Q A;  2HCI A;  2PZT A;  1V8Q A;  4LAA A;  3MVV A;  2A6H D;  1IKM A;  1EY7 A;  2F0F A;  2OF1 A;  4A3D B;  3BVG A;  3MC0 B;  2JSO A;  4XQN A;  2HCC A;  2ICI A;  5DNF A;  3HKZ B;  3VYU A;  3K59 A;  1LO5 D;  1OXX K;  4X3K A;  2QKI C;  3OHX C;  1O78 A;  3HGB A;  3F2U A;  1HQR D;  5KYI A;  1G6Z A;  1LTA D;  4K8I A;  1TWF B;  1SYG A;  3NQI A;  2R92 B;  3A56 A;  2N88 A;  3BVM A;  1LT6 D;  1II3 A;  2PMZ B;  4F8M A;  5I6Y A;  4ID6 A;  1NAP A;  3H09 A;  2NVT B;  1NR2 A;  2F0I A;  2E2H B;  2L4N A;  1QWY A;  2PZU A;  1MSH A;  1OXV A;  1I4H A;  1B3A A;  1JQY D;  1SMY C;  3MEH A;  1SE2 A;  2ZXR A;  2F0Q A;  4DXF A;  5F2D A;  1TS5 A;  3HOU B;  2NWG A;  1Z6H A;  2RVL A;  3SHL A;  1Y1V B;  4DGZ A;  3BDL A;  1H9S A;  1HCZ A;  1TY2 A;  1RTN A;  2I07 B;  3HP3 A;  1A2U A;  1KAA A;  3VA5 A;  2HDM A;  1E2V A;  1H9M A;  2RQX A;  3SVM A;  5CV9 A;  3H91 A;  4EQO A;  2A6H C;  2L5T A;  2XWJ B;  1F9P A;  3CRK C;  5C0X J;  1G8Z D;  1XYI A;  2QCP X;  1QNU A;  5JEA J;  3JAM E;  1CZW A;  1PXU A;  2K5D A;  1G29 1;  1UNS A;  1RJT A;  5EQ0 A;  1CM9 A;  4DFA A;  4A3F B;  1I6H B;  1TU2 B;  5M5W B;  3OSO A;  4DAP A;  1SYF A;  2MPM A;  1WTP A;  1PRT D;  2H4O A;  3IL8 A;  5CBA E;  2B2W A;  1CA6 A;  1ZEQ X;  2A6E C;  4BA2 I;  3I4L A;  1EZ6 A;  3NXW A;  1EEI D;  3Q0A A;  4QCL A;  5KNC A;  4NMZ A;  1CI3 M;  2L1B A;  3BYT B;  1LTG D;  4IFD H;  2F0N A;  4PV1 C;  2F0W A;  3JAM L;  1STB A;  1I4X A;  2FMM A;  4QF4 A;  3LX0 A;  2J7Z A;  2KQ3 A;  1S5F D;  3MHB A;  2B2V A;  3QJY A;  3VR5 A;  1U4R A;  4I7Z C;  3OW7 A;  1TVX A;  3TSS A;  4KMU C;  3BG3 A;  2B63 B;  1K8M A;  5K36 H;  5M3M B;  2KEC A;  3HOW B;  3D4R A;  2Q8I B;  2CW0 C;  3M4O B;  3GTP B;  3D6W A;  4P2C B;  1SBB B;  4WJW A;  2IJ0 A;  1ZYR D;  3T16 A;  3K6O A;  1F2Y A;  3DEP A;  2IPK D;  2OEO A;  3C46 A;  4A3E B;  5JEA G;  1EYD A;  1VDZ A;  5J1Z A;  3DXJ C;  4RH6 A;  3LNN A;  3DHQ A;  1NUC A;  5CC4 A;  1W6K A;  4FF1 A;  4L6T B;  1DZ1 A;  1KDA A;  3OIQ A;  1D5X C;  4LJZ C;  1GUO A;  4A3G B;  3S1R B;  2PW7 A;  2B2Y A;  3H0G B;  4CJ0 B;  4LK1 C;  1VMC A;  3E0J A;  5AFW A;  5FO9 B;  3PUY A;  2F0H A;  1LV9 A;  3SEB A;  2IX1 A;  1RTO A;  3SK8 A;  4HTH A;  4L8J A;  3V05 A;  3M7G A;  1GOZ A;  2ZXP A;  3NE5 B;  1LT5 D;  1O7Z A;  3QIA A;  4N9P A;  1EOT A;  3G7L A;  3QB3 A;  3NPP A;  3D4W A;  2K33 A;  3I8Z A;  1ROD A;  4DK0 A;  4IAL A;  4RCN A;  4KKU A;  4OGQ C;  1E2Z A;  1JOR A;  3M3Y B;  4DN4 M;  4C1N I;  4IUN A;  4O42 A;  3GTO B;  2L11 A;  4KJO A;  3MXU A;  1DOK A;  3K58 A;  2JA8 B;  1ONL A;  3A8K E;  1OXS C;  1LT4 D;  2WAC A;  4ZAI A;  4KK7 A;  1B9M A;  1EIG A;  2K32 A;  5EJW A;  1WD0 A;  5LL6 X;  4RA8 A;  3U9S A;  5EPJ A;  5C4H A;  4ZUJ A;  5CBE E;  2R6G A;  1STN A;  3J81 L;  2BE5 D;  1SEB D;  2AWO A;  4XXE A;  2RSO A;  3TZU A;  2SDF A;  3KLR A;  2NN6 G;  1EYA A;  4XQQ A;  5JVG 3;  5ELC A;  2CHB D;  5IIF A;  4HED A;  1U4P A;  3NWT A;  3PUZ A;  1B4O A;  3PIO 3;  2IX0 A;  3LWU A;  4EQN A;  1BF4 A;  1V1P A;  3T13 A;  5CV6 A;  3SE0 A;  3X3M A;  2NVY B;  3D8G A;  1GJX A;  2YYZ A;  2NN6 I;  2QDB A;  2FIN B;  1IW7 C;  3VYS A;  3HOZ B;  3J7Y W;  5FK9 C;  2F0U A;  2NZ1 D;  5LL6 S;  1BCP D;  2B2V C;  2MP1 A;  1HPC A;  1G2S A;  3D6C A;  3A54 A;  3TME A;  5IGB A;  2EXZ A;  1ILQ A;  4R8N A;  2EJF C;  3J81 E;  5BN3 A;  4TRD A;  1FGB D;  3U9O A;  1HXY D;  1EY6 A;  1A6X A;  3GD7 A;  1DCZ A;  4ZRZ A;  3PO3 B;  3GTM B;  2J0T D;  2E74 C;  1JB3 A;  3VA7 A;  1QG7 A;  4K6L A;  2DNC A;  1IL8 A;  1O7Y A;  3TP6 A;  1QJO A;  4M1U B;  4J6H A;  1M4V A;  2VB3 X;  3C1E A;  1TKW B;  1IHZ A;  2F4I A;  5C5L A;  4XDX A;  1V1P B;  2F0S A;  1B1Z A;  2EJG C;  2RDH A;  1AZQ A;  4IN3 A;  1STY A;  1PMR A;  4DF7 A;  5IGE A;  2BDN A;  4Q0F A;  1IKL A;  3MTS A;  4N9T A;  5C4Z A;  1F2M A;  3VR2 A;  3HOY B;  1BO0 A;  4RWS C;  2NYZ D;  1JOO A;  4RKL A;  2G9D A;  1WD1 A;  3S1Q B;  1DOM A;  4FF2 A;  2F0E A;  3K5L A;  2F1M A;  4BY7 B;  1A15 A;  3EA6 A;  2EYF A;  4XTC S;  2RKS A;  3I91 A;  1A3U A;  3NSW A;  3KUP A;  3R8B A;  2M2L A;  4CBV A;  1T5E A;  2B8F A;  1F9S A;  2QF7 A;  3V2T A;  2B39 A;  5CV8 A;  4FYD A;  1BXT A;  4PMC A;  1SJH D;  3A7L A;  2O5J C;  5D3I B;  5E3F A;  1TS2 A;  5JPM C;  4G4K A;  1CTM A;  3R3O A;  4IQZ A;  4PMW A;  2ICE C;  1Q8I A;  3PO2 B;  3RZD B;  2KCN A;  2HQE A;  2JA6 B;  3UI2 A;  2NUC A;  3TBI B;  1RD9 D;  4KY5 A;  2A68 D;  3PIP 3;  3S2D B;  2WIN B;  4IUT A;  1TWG B;  3OMC A;  2VNU D;  5K36 G;  2AUK A;  4HN7 A;  4ZLT F;  1SNO A;  4H7B A;  2ID0 A;  5FKA C;  1J8I A;  1PTO H;  4KD4 A;  3WOE A;  2NBF A;  4O1N A;  5FLX L;  3OWF A;  1SYD A;  4S3S A;  2BDO A;  1KNE A;  3KBX A;  3FEW X;  4OHJ A;  3HRZ C;  5TSS A;  4FXG C;  1STE A;  1RCV D;  5I9P A;  1I4P A;  5IT9 E;  2EYM A;  1MSG A;  5KND A;  2F0K A;  2K6A A;  4JBW A;  3OMG A;  1U4M A;  1F2Z A;  2E2I B;  1BUV T;  5K5P A;  5C0X I;  1EIH A;  1F9R A;  3A7A B;  1B44 D;  2F0V A;  3IKJ A;  2DY7 A;  4ILW A;  1ENA A;  1B50 A;  3GTK B;  4QUC A;  3ERO A;  3SR1 A;  3IAY A;  4KTA A;  2RDF A;  4JK1 C;  5DAU A;  4IUP A;  4KY6 A;  4A3B B;  2XIW A;  5C3E B;  1D1I A;  2CVR A;  3A8J E;  5D65 A;  5I4D A;  1YNJ D;  5HGT A;  2K05 A;  3CHB D;  2LS0 1;  5FO7 B;  4UAI A;  2EY2 A;  1CHQ D;  2EYL A;  2Z4I A;  3QG1 A;  2B2W C;  2K1B A;  4KY7 A;  4ZK9 B;  4NP5 A;  1JC7 A;  1EU4 A;  1DD2 A;  2Y0S B;  2PZW A;  1QCB D;  5EKL A;  1H9S B;  2B2T A;  1AW7 A;  2EY1 A;  4DXG A;  1KDB A;  3J80 L;  1YNN D;  2FHT A;  2JXM B;  3N6R A;  3SDZ A;  1GHJ A;  1S5E D;  1HTP A;  4BWG B;  4LMQ D;  1NR4 A;  3PUX A;  4A3J B;  3NWS A;  2MGS A;  1EY0 A;  1HQM C;  1VF7 A;  2EE1 A;  1X3P A;  1GUG A;  1SYC A;  1TWC B;  2L0C A;  1XWE A;  2B2Y C;  2A74 C;  2O5I C;  3I3C A;  1OXT A;  2RSN A;  4RGM A;  4OL7 A;  1KLG D;  3P1H A;  2N55 A;  4H44 C;  4M8A A;  1JOQ A;  1STG A;  4K5V A;  1RHP A;  2FMC A;  4UDU C;  4FXK C;  1PFN A;  3FPU B;  5C5M A;  2B2U C;  4WOR A;  2J4X A;  3HOX B;  2QEJ C;  2R93 B;  3K7A B;  1MI2 A;  1H9J A;  4DAV A;  2JA7 B;  3S17 B;  4A93 B;  1BBX C;  5EPK A;  4QUF A;  1ZKO A;  3GTQ B;  3I4M B;  3RLF A;  1KLU D;  4C3I G;  4FXD A;  4A3K B;  2SNS A;  5CYU A;  1AP0 A;  3NBH A;  4EVO A;  4CJ2 C;  1CZG A;  3O13 A;  5ISR A;  2Q8R E;  3N52 A;  4BS9 A;  1DON A;  1JOK A;  3M7N A;  1PFM A;  4PNY A;  3J7A F;  2F0M A;  1ESF A;  3DWA A;  2NVQ B;  1EY8 A;  1TWA B;  3P20 A;  5CGK A;  2K03 A;  2DY8 A;  1DM0 B;  3TN2 A;  3NP8 A;  2NN6 H;  4PQX A;  3MXG A;  5I9O A;  3SXH A;  3S15 B;  4WRD A;  1ENC A;  1KNA A;  5M5X B;  4OIK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...