4LFAQ

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
104
structure length
104
Chain Sequence
b'PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSKRGGKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 20
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4lfaQ00
1IL2A 2QEXA 2F52A 4LF8L 3S14H 1XNRL 4IFDJ 1NMGA 5FLMH 1UWVA 4OO1G 2LSSA 1UEBA 1EIFA 1A0IA 4OWTB 3CCRA 4DUYQ 3RLFA 4HIOA 3H0GH 2E5LQ 4OO1I 4L5RC 3MEFA 4UY8C 3S1RH 1WFQA 2JQOA 4DV2Q 1PHJA 3FKIG 4GNXA 1XNRQ 5JJKA 4LF9L 4HJAA 2JA6G 4PZ6A 4IOCA 1K8GA 1NTGA 3BZKA 3T1YQ 4FDBA 3KJPA 4YCUA 1PH5A 1VQ5A 1AE3A 1YNXA 4A3MG 1HR0L 1JMCA 1UE5A 4BBRG 3AFQA 4PMWA 1X54A 3KYHC 1VQ4A 3CMAA 5C0XJ 3ER0A 2UUCL 1C9OA 3M4OH 4LUOA 4OX9L 1YEZA 3U4ZA 1YZ6A 3BU2A 3GTPH 4A3DH 2UXDL 3U4VA 1XNQL 1Z9FA 1YIJA 3JAMc 4UP8A 1BVSA 2Q2HA 4HJ5A 5LMNQ 3CCMA 3S1MH 2K5NA 4DR5Q 3T1HL 1D7QA 2KCTA 2E2IH 1XPUA 3HFZB 3W1GA 2JE6I 3E0EA 2MO1A 3F8TA 1VQGA 2BA0A 3S24A 4OX9Q 5M5YH 4DR3L 1CKNA 1YITA 4A75A 2HHHL 1SRUA 1AH9A 4JI8L 4GKKL 4KHPQ 1VQIA 1C7YA 3J80i 5GAGC 4X65L 2WP8J 1L1OC 1S3OA 2F3IA 2PI2A 4A93H 1XTDA 4YY3Q 4DUZQ 4JI4L 2B3GA 1W3SA 3F2CA 4DR2Q 1JJGA 1MIUA 3HOZG 1G6PA 5C3EH 1PH2A 2LXKA 3TS0A 3PUYA 3H0GG 3UDFA 4GKKQ 4X6AH 1N34L 5JEAG 3JC66 4GNXB 2OTJA 2UXCQ 1UE7A 2LXJA 1X55A 1PH8A 3HOYG 2R93H 1CSQA 3HKSA 5ELNA 4DV0L 2Z6KA 3HOWH 4JI0L 4C3JH 4L5TA 4R4IA 5HY6A 4P72A 1EQRA 3HKZE 2AKWB 2V1CC 3M4QA 3GTKH 4A3BG 4XTCS 1Y14B 2JEAI 4A3CH 5IWAL 3J7ZC 2XTIA 1VQEA 1P8LA 4JC0A 3CC2A 3I4NG 1CSPA 1C0AA 4AQYL 3HKZG 2A19A 1HNZL 2K5VA 5M5XH 4GOPC 1GM5A 4L5SA 2CWPA 3S1QH 3S1NH 1K8AC 3EN2A 1RIPA 4X62L 3RLOA 3W5OA 3KJOA 2CCZA 4POGA 2NZOA 2ZTCA 3GO5A 4A3EG 2Q2UA 2OQ0A 3TS2A 1PH6A 4B3RQ 1J6QA 2R7DA 2VZAA 3RZOH 5AJ3L 4JI7Q 4MNOA 2B29A 1CKNB 3L7ZC 2IX0A 2VQEL 3K0XA 3CCVA 5ELOA 3UDIA 2C35B 1E3PA 4C3IH 5M3FG 3PO2H 4LFAQ 5IT9c 2QA4A 2PQAA 3W1BA 2JJQA 4LFCQ 1B7YB 1H95A 4JI5Q 3H15A 5E7NA 3L0OA 1WOCA 1E22A 4DV1Q 1SFOH 4Y52H 3J80c 4R4OA 1SN8A 3CCEA 4Y7NH 4A3IG 2NVTH 4PZ8A 2KBNA 3RN2A 3HOVH 5AJ3Q 3PO3G 3CPFA 4POFA 4JV5Q 1OXXK 1X3GA 4DR6L 3OTOL 3UE1A 3CP0A 3CPWA 1TWCH 5C0XG 3PF5A 3KFUA 2ES2A 5C3EG 4GKJL 4A3JG 4DR7L 4WJ3M 4GN3B 3KF6B 4JI3L 5JJLA 4K0KQ 4NPSA 1Q46A 2VUMG 4BXXH 1X65A 2MO0A 4RG1A 4B3SL 4EQ5A 1HNWL 1HR0W 4AIMA 2WAQE 3K8AA 2IHFA 3B6YA 2JA7H 2Q2IA 1HZCA 2R7FA 5IYCG 2IHEA 1QVFA 4GS3A 3A5UA 1VQNA 3HOXH 2QGQA 4AYBE 4DV3L 4HJ9A 2WAQG 3TREA 2A1AA 1Z47A 2EXDA 4TQUS 1XPOA 2HT1A 1OXUA 4JG2A 4JI1L 5BR8L 1Q7YC 1VQ6A 3I56A 1NE3A 3DM3A 3RLNA 4AYBG 2NVXH 4B3SQ 1X3EA 1XMQL 4DV7Q 1E24A 1QUQA 2CFMA 3A74A 1W2BA 1EYGA 4B3ML 4A3KG 4UPAA 2YYZA 1KC8C 2HIVA 5IYBH 1NBWA 4LF5L 2ZM6Q 4A3GH 1K83H 1VQBA 4JYAL 3RN5A 4JI6Q 3I4MH 3UDXA 1VQ7A 1I94Q 1G51A 3NEMA 2PQAB 4LF8Q 1PH9A 2YTVA 4P73A 1EUJA 4BA1I 1XMQQ 1QVCA 2ATWA 1IBML 1JB7A 2ID0A 1Q86C 4GLAC 1VQPA 1L1OA 1VQDA 2K4KA 3PIOA 5C4XH 1SMXA 1TWAH 5FJ8H 4BBSH 2BH8A 3G48A 3I4NH 3S2DH 2RCNA 2PNHA 2R6GA 4JOIA 3KF8B 3RZDH 3ULLA 4LF9Q 2R92H 4YHHL 5GAHC 2NVQH 1VQLA 1MJCA 4NXNL 3PIPA 2K52A 4YCWA 4LUZA 1IBMQ 1UE1A 1HR0Q 3PCOB 2K14A 3PUXA 2UU9L 3RR5A 1EQQA 5JJIA 2VQFL 1T9HA 4R4QA 3GTMH 5K36G 3K7AH 1WCMG 4PG3A 2UUCQ 2D0OA 4DR1L 2B63H 1JJCB 1E7ZA 2AWOA 3D31A 1HZ9A 2UXDQ 2CWAA 4YHHQ 3CC4A 1DGSA 1XNQQ 1LTLA 2NZHA 1K0RA 3I4OA 4DNIA 3CC7A 4NXNQ 1PYBA 4GOPA 1L2FA 4WJ4A 2R7ZH 4C2MH 1EOVA 1Y1VG 3T1HQ 1J5EL 2UU9Q 1YHAA 1B8AA 3A5ZB 3AYHB 4UP9A 4LF7L 2A8VA 2OWOA 1FL0A 1OXSC 5FLMG 4LF6Q 4QIWE 4A3FH 3I55A 4DR3Q 5IP9H 1PA6A 2HHHQ 4O2DA 1GO3E 1HZAA 2JEBI 3CW2C 4JI8Q 4X66L 4QY7A 5M3MH 4JBMA 3H3VH 3J7A5 2MNAA 3HOUH 1KQSA 4X65Q 4B3TL 1U5KA 5M5WH 1A63A 2HQLA 1Q1EA 5C44H 2XGTA 1ASYA 4YWMA 4APVA 1PH7A 4JI4Q 3PUZA 4OXPA 1YVCA 1VQ9A 2YTYA 4A3LH 4JBWA 4PZ7A 1Q81C 5FLXc 1N34Q 2JA5H 1E1OA 4JI2L 3OYYA 4HJ7A 4B3TQ 1VCIA 4HIMA 4DV0Q 2WFWA 1VQFA 3CCSA 3IRBA 4UP7A 4DR4L 4JI0Q 2DUDA 3F2DA 2K5HA 1N8RC 3EIVA 2UUBL 2E8GA 3GTQH 4A3DG 1CKMA 4IFDG 1LYLA 3BJUA 1X3FA 3LGJA 1N32Q 5IWAQ 2H5XA 1CUKA 4DAMA 3DLLA 4BY1H 3GTLH 4IFDI 4AQYQ 1HNZQ 4MTNA 1LUZA 2MQHA 3ERSX 3M7NA 2RHQB 4DV5L 4BY7H 5IYDH 1OTCA 2ZJRA 2UXBL 4X64L 3FHWA 5GAEC 1OXTA 4X62Q 1U0LA 3STBC 2UUBQ 2K75A 2IT1A 1NJIC 2AWNA 2GVBA 3GDEA 3M85A 1UE6A 2DGYA 2Z0SA 3U50C 1TWHH 1SE8A 3GTJH 4A93G 2YV5A 4HJ8A 2VQEQ 4DV3Q 1M90C 1Y1WH 4LF4L 3ULPA 1NMFA 3KLWA 3NENA 3MXNB 3FKIH 4X64Q 2VS1A 3S16H 2JA6H 1N32L 3CD6A 3GTGH 5C0XI 4GKJQ 3AQQA 2Z6KC 4P74A 4OWWB 3HOUG 4BBRH 2I5HA 3EBEA 4DPGA 2R93G 1M1KC 4IJHA 3HOWG 1YHBA 5C44G 1X6OA 1RL2A 2JA9A 4KHZA 2YU9H 3K81C 4DR6Q 4TVAB 3OTOQ 5HGQA 4HIDA 1IBKL 1HZBA 4DR7Q 4L5QA 4YCVA 5JEAJ 1PV4A 1A62A 4A3CG 4JI3Q 2CQOA 4R1JA 4DV6L 2FXQA 1HNWQ 1Q8KA 5GROA 4HIKA 2VW9A 2IY5B 3ICEA 5DLQE 2I5LX 4DV4L 4LF6L 1BBUA 3S15H 3S17H 1K9MC 3E9HA 2VNUD 4QJFA 1MJEA 3F1ZA 1D8LA 3CCLA 1WI5A 4JI1Q 5BR8Q 1IBKQ 3CAMA 4JV5L 4LW1A 3PGZA 2E2HH 1KL9A 2GN5A 2PI2E 5C4JH 4JBKA 1YI2A 4DV2L 1VQKA 2RF4A 1R9TH 3PO2G 4B3MQ 4QL5A 1S72A 3A0JA 4LF5Q 1PH1A 3HOZH 2N3SA 1A8VA 1VS0A 1VQMA 3K7UC 3T1YL 4NB3A 5IE8A 4JYAQ 1E1TA 1EIYB 1IZ6A 4A4IA 1K73C 1VQHA 3GD7A 3PSIA 1X56A 3PV0A 1Q82C 3HOVG 1V9PA 4JCVE 3HOYH 4H02A 2N8NA 1Y1WG 2ZTDA 2E2JH 2D62A 1TXYA 2ZTEA 3J81j 5LMUL 1SLJA 5GQOA 1VQCA 1HH2P 3L2PA 1KRTA 4A3BH 1XMOL 4DKAC 4IPDA 4BXXG 4IOAA 4BA2I 5LMNL 2EQSA 3STBD 1PYSB 4IO9A 3CCQA 3NELA 4DR5L 1XJVA 2I0QA 2KHJA 1FJGL 4DAYB 1VQJA 1LM0A 3G71A 2JA7G 2JA8H 5IP7H 2MFIA 1Q1BA 4RMFA 2Q2TA 3HOXG 1S40A 4YWLA 5LMUQ 1PVOA 2PMZE 3VDYA 2EIFA 4OONA 5J3BA 1ASZA 3CMEA 1CKOA 1QUQB 4DK6C 4KHPL 2VQFQ 3Q8DA 4A3EH 1WYDA 1YJ9A 1XMOQ 2YTXA 1XPRA 4IJLA 2N78A 4J15A 4DR1Q 1FJGQ 2ASBA 4NXML 4P75A 4YY3L 5M3FH 4DUZL 4JBJA 3FP9A 3TQYA 1PH4A 1P16A 5EAYA 5IYBG 3F2BA 4DR2L 1KIXA 2JK8A 1VQOA 3G6EA 1Q12A 3GTOH 2RHSB 4GNXC 4XIGS 4A3GG 3AEVA 3S2HH 2IX1A 1N9WA 1J5EQ 4P71A 3I2ZA 1PFSA 3CCUA 3I4MG 3M3YH 4LF7Q 4A3IH 1QZHA 2NVYH 1N33L 4GN5A 4LWCA 1L1OB 1BBWA 3M4PA 2UXCL 2ALYB 2VY3A 2KHIA 4NXMQ 1IBLL 4C3HH 3PO3H 4R4TA 2VL6A 3OW2A 4X66Q 1B70B 1PH3A 1AE2A 1GD7A 1K3RA 4LUVA 3UDGA 5C4XG 3KOJA 4JOIC 4A3JH 1QVGA 3U58A 1HNXL 5FJ8G 4BBSG 3ZJYC 3J81i 1YJWA 4GLVB 5H1SE 2F4VL 3UE0A 2VUMH 2OQKA 1N33Q 1L0WA 1O7IA 2R92G 3SGIA 3KF6A 1IBLQ 3ULJA 5IYCH 3CF5A 3KDFA 1MKHA 2GVAA 2ZJQA 4JI2Q 1I5FA 1VQAA 1BKBA 1HNXQ 4B3RL 2I5MX 1QZGA 1V1QA 1JJ2A 4GOPB 2WB1E 2F4VQ 4DR4Q 2B63G 3WWVA 4JI7L 2UUAL 4A76A 1IXRA 1GKHA 1V43A 4LFBL 2CKZB 1EFWA 2JA8G 3PUVA 4A3KH 4LFAL 5IP7G 1KXLA 2WB1G 4LFCL 4DK3C 4JI5L 2KENA 2R7ZG 4AH6A 1JT8A 4DV1L 4DV5Q 4EX5A 1SROA 3BZCA 2UXBQ 3E9IA 1NY4A 4GN4B 5IY0A 1VQ8A 3NBHB 2BA1A 4A3FG 2UUAQ 3AFPA 1JE5A 5IP9G 4MZ9A 1HJPA 2L15A 5M3MG 4GLXA 1KRSA 2AMCB 3TEHB 4QGUA 4ME3A 2ZJPA 4A3MH 2AHOB 1X9NA 2OTLA 1TWGH 2HIXA 1SR3A 4O0AA 1I6HH 3K80C 1OXVA 3H3VI 4OWXB 1YBYA 4K0KL 2BH2A 1IYJB 3G4SA 1I50H 4LF4Q 4KLKA 1GVPA 5GADC 1KD1C 2D0PA 3CQZH 3D0FA 4YWKA 1YJNA 3PF4A 1I3QH 4IPCA 2K50A 3I7FA 1N36L 4A3LG 3CXCA 3JAMi 4R4CA 1EWIA 1FGUA 1YHQA 2KCMA 1KAWA 2JA5G 2NN6G 1WJJA 4IPGA 4ALPA 3PUWA 3J81c 2OCEA 2NN6I 3M9BA 1WCMH 1KHIA 2Y0SE 3CCJA 3TRZA 4KI0A 3KDFB 5LMNW 4DV7L 1G291 4DUYL 1TWFH 2E5LL 1N36Q 4QQBX 4IPHA 4LNQA 2Y0SG 2N49A 4BY1G 2ZM6L 3RNUA 4DV6Q 4LFBQ 1I94L 1FVIA 4JI6L 1Y1VH 4BY7G 5IYDG 4DV4Q
chains in the Genus database with same CATH superfamily
4LF8L 1XNRL 2A69C 3ERQA 2EZVA 5FLMH 1MHWC 1A0IA 1DD2A 3H6MA 3MHBA 1ICWA 1MI2A 2MUYA 3MEFA 2JQOA 4DV2Q 1UAPA 4RKBA 2RDGA 4PQXA 4GNXA 4OL7A 1XNRQ 4LF9L 1QNUA 4PZ6A 5DAUA 4A3BB 1CQFA 4A3MG 1HR0L 2WKCA 3AFQA 3A8JE 1GUNA 1WTHA 2MP1A 5C0XJ 1ILPA 4OX9L 1ZXTA 3GTPH 1Z9FA 1YIJA 5G3LF 4DR5Q 3T1HL 3S1MB 1M8AA 1XPUA 3HFZB 3QOJA 5IODA 1J8IA 1H9SA 2BA0A 2RSOA 4OX9Q 1YITA 2HHHL 1STEA 1CA5A 4KHPQ 4UHVA 1C7YA 5GAGC 1S3OA 5COYA 5EKKA 3LWEA 1KLUD 4RHSA 1MIUA 3HOZG 4K14A 2M00A 3IL8A 5C3EB 3H0GG 3UDFA 4DAVA 2RSNA 3VR5A 3JC66 2OTJA 3T13A 1X55A 3MC0B 5ELNA 2R93H 4C3JH 1V8QA 1SE3A 2IJ0A 5NUCA 2WAQB 5CV5A 1Y14B 2JEAI 2A73B 1HQMC 1LTGD 1RTNA 4JC0A 4A3CH 1C0AA 2B2WC 2KA7A 3HKZG 1PDQA 4IUVA 3VA7A 1PMRA 3EQLC 1EWCA 1K8AC 3EN2A 1EIGA 3GV6A 2F0JA 1WTWA 3ND9A 4POGA 2DNCA 3TP7A 3K5MA 4GZYC 3TS2A 2L11A 2A68D 3RZOH 5AJ3L 4MNOA 1L0YB 1MBYA 2K32A 3PO2H 3MEHA 2KCCA 2DJFC 4ILWA 4LFAQ 3S1NB 1VMCA 4DF7A 1TWGB 4JI5Q 5E7NA 4FNFA 4DV1Q 1SFOH 1I50B 3RN2A 5FLXL 5AJ3Q 4K5XA 4JV5Q 3C2PA 3OTOL 3CPWA 3CP0A 3BDLA 4A3JG 4JI3L 4K0KQ 3D8GA 2H4OA 1VDZA 1OO9B 2NBFA 1HZCA 1TWFB 3BDOA 2R7FA 2RDFA 4GS3A 4ZRZA 3BVZA 2QGQA 2SEBD 3HOXB 4FXKC 4F7XA 4JG2A 4ODGA 1Q7YC 4AYBG 5KNDA 1LTAD 3A74A 1VF5C 5FK9C 4RGNA 1XXGA 4A3GB 3RN5A 4QIWB 2N88A 3UDXA 4C1NI 3NEMA 1PTOF 2PQAB 4HN7A 4N9TA 4RFBA 5CYUA 2P5ZX 1EUJA 3C46A 3G6JB 3ND8A 5EBCA 5CV4A 4OGQC 4L8JA 2SDFA 4GLAC 1VQDA 1KDAA 1QWYA 2PZWA 1K8MA 3PIOA 4XT3B 2XSCA 3DWPA 2BH8A 4BBSB 2PNHA 3SE0A 2R6GA 3RZDH 3ULLA 3GTPB 1MJCA 2K33A 2MPMA 4NXNL 3PIPA 2R92B 4YCWA 4LUZA 1PFBA 4TRDA 1CM9A 5C3WA 4H7BA 2UUCQ 2NTSA 1JJCB 1CZGA 3IFTA 2UXDQ 3KLRA 2NZHA 3I4OA 3CC7A 4NXNQ 3LNNA 1S5CD 4RA8A 3H09A 1Y1VG 1DONA 3AYHB 1T5XD 1ESFA 2OWOA 1FL0A 3I55A 4DR3Q 4O2DA 2JEBI 3CW2C 4JI8Q 4X66L 4A3FB 1GUTA 3H3VH 1IW7C 4X65Q 3HOUB 1Q1EA 1E2ZA 4RGTA 1YNJC 2EXZA 4L63B 1ASYA 4APVA 4JI4Q 1TS2A 4C3JB 2B39A 2O2LD 5DM73 1ML0D 3Q23A 3R8BA 5FLXc 2B2TA 1E1OA 4HAEA 4JI2L 2F0NA 5AFWA 1VCIA 4DV0Q 3LWUA 1VQFA 4JK1C 5JVH3 3IRBA 5KEEA 3GTQH 3EIVA 1LYLA 3K5NA 3SXHA 5J39A 4DAMA 3DLLA 4AQYQ 1HNZQ 2MQHA 2RHQB 4DV5L 4FF2A 4RAUC 4XQJA 3KBXA 1H9MA 5JVG3 3CKIB 3M85A 1UE6A 2B2VC 1DOKA 1TWHH 5D3DA 3GTJB 2B2YC 2XNAC 3MXUA 3BYYB 1TKWB 3KLWA 5KNBA 1Y1WB 1CFMA 4KHVA 3GTGH 4OIJA 1KNEA 3OW7A 4DPGA 1M1KC 4IJHA 4KHZA 2YU9H 2K6AA 4M1UB 5FO9B 4TVAB 1QB5D 2XIWA 3TSSA 1NNXA 4JPBW 4YCVA 1PV4A 2KUMA 2WINB 1NR2A 1K28A 4UAIA 3ITPA 4HIKA 2B2UC 2KHSA 2IWHA 1WTPA 3S15B 2VNUD 4QJFA 1MJEA 3CCLA 1VF7A 1SJED 1RDPD 2F0DA 5I6YA 1KL9A 2GN5A 5EJWA 2JSOA 2R61A 2TSSA 1R9TH 5FOBB 1C8CA 3A55A 4QL5A 3A0JA 1PH1A 3HOZH 5ELFA 1A8VA 2LKVA 4Q0FA 4J6HA 1EIYB 2A6ED 1VQHA 5IGDA 3PSIA 1DZ1A 1X56A 3RZDB 5KIXA 3J81j 4ZUJA 2E2JB 5GQOA 3O13A 1EY9A 4DKAC 4BXXG 2I0QA 5CBEE 2E76C 1XJVA 1CTMA 1FNVA 3KBGA 2JA8H 2AUKA 3HOXG 4YWLA 2MJ8A 2JXMB 4IQZA 3VDYA 3CMEA 2HCCA 2VQFQ 4DGZA 1AFPA 1XPRA 3F2UA 2F0FA 2HUGA 2CH4A 4YY3L 4DUZL 5T1IA 3TQYA 3VYSA 1P16A 5EAYA 4A3GG 1VQOA 3PQIA 1SMYC 3T16A 3T51B 3S2HH 2IX1A 4PV1C 1PFSA 2BE5C 3CCUA 1QZHA 4GN5A 4LWCA 4H44C 5EPKA 1PZID 2VY3A 5LHY1 1JE4A 4R4TA 2VL6A 2I07B 1B70B 1A2UA 1GD7A 1QJOA 4A3JH 3U58A 3VR6A 4BBSG 4XDXA 3J81i 4GLVB 3JAML 3V05A 1C4QA 2F0PA 1Z6HA 2R92G 2SNMA 4IUQA 1F2MA 3DMUA 1VQAA 3I90A 1U4MA 3OOCA 4B9XA 1ESRA 1I4RA 5IGGA 4DR4Q 3W3AA 3FVQA 2CKZB 3NHHA 5E1FA 2WB1G 1KXLA 1JB3A 1BCPC 1JT8A 3WOEA 1LT4D 3BZCA 2UXBQ 5IY0A 1VQ8A 3NBHB 4A3FG 5IP9G 2L15A 4GLXA 1X9NA 2F0VA 2Z9HA 3QB3A 3K5LA 4A3MB 2LY7A 3C1EA 3H3VI 4CKCA 1YBYA 4LF4Q 4IZ8A 5GADC 1KD1C 3PF4A 3C3LA 2K50A 3I7FA 3CXCA 1YHQA 2KCMA 4LJZC 2AQ3B 3A7LA 5JJZA 5EPJA 3CCJA 1ZKOA 5LMNW 1FD7D 4ZCKA 1X3QA 2VB2X 2E5LL 4QQBX 2Y0SG 2N49A 2K5WA 2OXPA 2EYOA 2K7VA 4DV6Q 4JI6L 1V1OA 1Y1VH 2RDHA 4K6DA 1EYCA 1R9TB 2QEXA 2FMCA 1IKLA 2Q8RE 4IFDJ 2BDNA 3S14B 3WOFA 5BN5A 1UWVA 2LSSA 4OWTB 1BBXC 2E5LQ 1IKMA 3H0GB 4YIJA 2EYPA 4DXGA 3S1RH 1QNKA 4NMZA 3OIQA 1K8GA 4IOCA 4ID6A 3BZKA 3KJPA 1AE3A 1EOTA 1YNXA 3K58A 1F2YA 4NP5A 3HKZB 1PZKD 4PMWA 3NPPA 1VQ4A 3ER0A 4IUUA 1PYWD 1LLRD 4X3SA 1YEZA 1YZ6A 2Z1CA 4KJOA 4A3DB 3JAMc 4G4KA 4WFN3 2Q2HA 5LMNQ 3CCMA 3S1MH 4QMGA 3W1GA 3E0EA 3DWQA 2MO1A 1EYDA 1NAPA 3S24A 4CDFC 1JICA 4CJ0B 1SRUA 4FF3A 4GKKL 2IL8A 3J80i 3E5SA 3GQBA 4KN7C 2PPBC 1L1OC 2F3IA 2B3GA 2K28A 3F2CA 4J1MA 5C0XH 3QJYA 5C3EH 1PH2A 2LXKA 3X3MA 4OHJA 3TS0A 4A3JB 1KDCA 4GKKQ 1N34L 5D14A 2UXCQ 1I4HA 1UE7A 2LXJA 2WKDA 1EY4A 4KJNA 1PH8A 1CSQA 2E2DC 3HKSA 1LT6D 1WD1A 3DHQA 1DYQA 4P72A 1EQRA 2V1CC 3M4QA 3E0JA 5IGFA 4XTCS 3GTKH 5E4XA 5J1ZA 3CC2A 1I4GA 2A69D 1VQEA 4I7AA 2BDOA 3SK6A 4KY5A 2A5HA 3TP5A 3X3NA 2K5VA 4GOPC 1WTOA 4AYBB 1GM5A 4IALA 1FYCA 2A6HC 1GHJA 3EJIA 3L9AX 3WDNA 4X62L 3A8IE 1SDFA 5IGBA 1S5DD 3W5OA 5ELBA 3GO5A 2HCIA 2OQ0A 2Q2UA 3Q22A 1J6QA 3FRPB 2MGSA 3U9OA 2R7DA 4ME5A 4XXEA 2B29A 1CKNB 4DV3L 5ELOA 3UDIA 2C35B 5M3FG 2QF7A 1JWMD 4B9WA 2JJQA 1H95A 1B3QA 4XYQA 3SEBA 4IN3A 1BR9A 4Y52H 1PLFA 2NVTH 2KQ3A 3NTIA 3PO3G 2PZUA 3CPFA 3HOVB 1GXDC 4GKJL 2ICIA 4GN3B 3KF6B 1SYBA 4BXXH 1Q46A 2K01A 1HR0W 2WAQE 1U4LA 3B6YA 1STGA 2IHEA 3A5UA 1VQNA 3HOXH 4HJ9A 1KDBA 1Z47A 2M2LA 1UNSA 1Y1VB 3I56A 3RLNA 2HD3A 1X3EA 4DV7Q 1EYGA 5KNCA 4DXFA 4A3KG 1KC8C 2Z8LA 2HIVA 1NBWA 4A3GH 1B1ZA 1K83B 3S1RB 1QILA 1I94Q 2EY2A 1Q3LA 1PH9A 4LF8Q 2YTVA 4RHRA 2ENBA 4P73A 2ATWA 1IBML 3D4DA 5EGTA 1TS4A 5C4XB 1EIHA 4BBSH 5HURA 2RCNA 3P1HA 4LF9Q 2R92H 5GAHC 1HPCA 2NUCA 1VQLA 4K8JA 2NVQB 1IBMQ 1UE1A 1HR0Q 3PCOB 5K5PA 3PUXA 3D4RA 1WCMG 1QCBD 3Q0AA 4EQPA 3K6OA 1E7ZA 2CHBD 5EBDA 5L37A 2CWAA 1DGSA 1LTLA 1PYBA 1L2FA 4C2MH 1EOVA 1TY0A 3T1HQ 2G9HD 2R7ZB 1YHAA 1B8AA 1MSHA 3S9WA 5EQ0A 4QIWE 4A3FH 1KABA 4N9PA 5IP9H 2HHHQ 1GO3E 1HZAA 4JBMA 1NCVA 3MXNA 2MNAA 3HOUH 2PYKA 3MFYA 2HQLA 4KKUA 5JOBA 2QCPX 2F0WA 3GTKB 5CV6A 3HZXA 4XT1B 1D6EC 4ZQ3A 1SYGA 5JPMC 4HJ7A 4JW0A 4HIMA 3TP8A 4UP7A 4PNYA 2DUDA 4A3DG 4DU9A 1CKMA 4IFDG 3LGJA 3OSOA 2H5XA 2K05A 4BY1B 2JYOA 2KJXA 3M7NA 3HRZC 2ZJRA 1OTCA 4CGYB 1NSNS 1F9PA 3FHWA 5GAEC 1OXTA 4L6TB 1CI3M 1U0LA 5EPLA 3STBC 3GV3A 5DNFA 3OWEB 2IT1A 2AWNA 2GVBA 1SYFA 3L3OC 2BCOA 2NVTB 3GTJH 4A93G 4HJ8A 1M90C 1Y1WH 3ULPA 4QCLA 3NENA 1F2ZA 5FKAC 5IOCA 2VS1A 3TDQA 3S16H 5IIFA 5C0XI 4M8AA 4HMIA 3K57A 1R4QB 3EBEA 1SYCA 3HOWG 5C44G 1X6OA 1SE2A 1RL2A 3K81C 3OTOQ 3DUZA 5HGQA 1IBKL 5C5MA 5ISRA 4JI3Q 4R1JA 2M9VA 3NK9A 2G5DA 1E2VA 1Q8KA 1PRTC 2PMZB 2VW9A 3ICEA 5DLQE 2I5LX 3IKJA 4C1NK 4DV4L 4LF6L 1BBUA 4G7OC 3S15H 1S5FD 1IW7D 1K9MC 2D9UA 2C9OA 1YNJD 5FLXE 4G7ZC 2F0QA 1Q8IA 1Z7TA 1BOSA 1IBKQ 2E2HH 1F77A 1VQKA 1K3BC 1SNDA 1GUOA 4U673 5C4JB 4ZK9B 1S72A 1VQMA 1VS0A 1PVOA 3T1YL 2KECA 4NB3A 4LMQD 5CMDA 1IZ6A 1X32A 1K73C 2K1BA 4KV6A 1HA5A 3GD7A 1F9SA 3PV0A 1H9JA 2QILA 1V9PA 3I70A 3HOVG 3SVMA 3D3RA 2E2JH 3J81L 1SLJA 2HDMA 3TZUA 1VQCA 3L2PA 1KRTA 1G2SA 5LL6S 1XMOL 4BA2I 1I4XA 2LS01 3NELA 3CCQA 4OEMB 4DAYB 1VQJA 1LM0A 3G71A 2JA7G 4EVOA 5IP7H 2CVRA 1S40A 5I6WA 2WB1B 1ASZA 5J3BA 1CKOA 1QUQB 4DK6C 4C2MB 3Q8DA 1YJ9A 1XMOQ 5BN3A 2YTXA 4ZLTF 4X3TA 5CC4A 4NXML 1EY6A 4P75A 1PH4A 5M3FH 4JBJA 3FP9A 5IYBG 3NP8A 5I2XA 3F2BA 4DR2L 2MHVA 4GNXC 3GTOB 2X6GA 3I2ZA 1I6VC 3M3YB 5M9OA 4NXMQ 3PO3H 1DXMA 3DWAA 4X66Q 2ICEC 1PH3A 4LUVA 1K3RA 5C4XG 3KOJA 3LX0A 1ET6A 2OQKA 1O7IA 3KF6A 4F8MA 2LFNA 2O5IC 1JQYD 4IUTA 4WRDA 3MAQA 2Y0SB 3KDFA 1SBBB 4JI2Q 4K5WA 1I5FA 1LTID 4BWGB 4B3RL 1CHPD 1QZGA 1FNUA 4FF4A 4IURA 2B63G 4JI7L 4LFBL 1PZJD 4A3KH 5ELCA 4LFCL 1ENCA 3FDTA 2R7ZG 4V0BA 4DV5Q 3VR3A 4EX5A 1D1IA 4MN3A 2ZXOA 1JE5A 1S5ED 3S16B 5M3MG 4XQNA 4A3MH 1A3VA 2F0GA 4O0AA 1ET9A 3HEJA 1I6HH 2RKSA 1OXVA 3K80C 2L4NA 4OELB 2TMPA 1V1PB 2BH2A 5A2QL 1DJRD 1GVPA 3CQZH 3D0FA 1EEID 4R4CA 4RKLA 1XWEA 2NN6G 1WJJA 5D3IB 1D2BA 5CV8A 1Y8PB 3J81c 4I65A 2OCEA 4IUNA 1SMYD 1WCMH 4KI0A 3P7JA 2BE5D 1G291 4DUYL 1I4QA 2PNRC 3SDZA 4BY1G 5BN4A 2ZM6L 4FO2A 1WD0A 5IT9L 1I94L 1J9OA 4ABNA 2E2HB 4BY7G 2KCNA 4QUCA 1IL2A 2F52A 1WTVA 3S14H 2ZXRA 1NMGA 3J80L 1HRJA 1YNNC 1PRTB 4OO1G 1UEBA 3CCRA 4DUYQ 4HIOA 3H0GH 1H9RA 3T53B 4UY8C 1WFQA 2L9HA 1PHJA 3KLSA 1S4ZA 4HJAA 2B8FA 3R3OA 4YCUA 4CDCC 2DY8A 1JMCA 1S5BD 1SNCA 1UE5A 2EY5A 5D65A 1HCZA 3KYHC 1RHPA 3CMAA 1BCPD 1C9OA 4LUOA 3VR2A 4TSSA 3U4ZA 4A3DH 3U4VA 1XNQL 4IFDH 3FPUB 4UP8A 2X6LA 1BVSA 1SXTA 4PMBA 2DNEA 2K5NA 4K5VA 2KCTA 4DK1A 2E2IH 2XWJB 2JE6I 5M3FB 5CR3A 3F8TA 2NB0A 1VQGA 1HHVA 2EJGC 1SAPA 2QDLA 1NUCA 5M5YH 3I73A 2PCFB 3DEPA 1TR5A 2PI2A 4A93H 1LO5D 4YY3Q 4DUZQ 3PO3B 1W3SA 4UDUC 1JJGA 4R8NA 5KRUA 1SNMA 3NE5B 4FXGC 3PUYA 4X6AH 1ZYRC 1PTOC 4GNXB 1O78A 3HOYG 3HOWH 2Z6KA 2F0IA 1U9RA 3TBIB 4JI0L 4L5TA 4R4IA 3SK4A 3HKZE 2AKWB 1CZWA 3BZDB 1N32L 5IWAL 3J7ZC 2XTIA 1P8LA 3I4NG 1CSPA 1TQOA 2A19A 5M5XH 4L5SA 1IYUA 1F9QA 3S1QH 2F1MA 1RKNA 4A3KB 1RIPA 4EGVA 3KJOA 2NZOA 2ZTCA 5IGCA 3RD4A 3V96A 1PH6A 3FPPA 2VZAA 1O7YA 4DNTB 2VQEL 3L7ZC 5I9OA 2IX0A 3CCVA 3K0XA 5IT9c 4C3IB 2PQAA 3W1BA 3JAME 1B7YB 2SNSA 3H15A 1I6HB 4EQNA 1WOCA 1E22A 2F3WA 3J80c 3G7LA 4R4OA 3CCEA 4Y7NH 3OMCA 5I9PA 2KBNA 2B2TC 3CQZB 3HOVH 1B2TA 1OXXK 4DR6L 3SR1A 2EYJA 2OT2A 3PF5A 2ES2A 1TWCB 4DR7L 1HFNA 5JJLA 2L0CA 4NPSA 1CQVA 1X65A 5DM63 4RG1A 4B3SL 1HNWL 1WCMB 4EQ5A 4AIMA 3K8AA 2IHFA 1TIID 4PMCA 2JA7H 3A7AB 3MXGA 5IYCG 1QVFA 4AYBE 3SHLA 2EXDA 4TQUS 4DAYA 2DJGC 1XPOA 1OXUA 4JI1L 5BR8L 1XYIA 1NE3A 2WIIB 4B3SQ 2NVXB 4TKOB 1QUQA 1LTBD 3QR8A 1JC7A 1W2BA 4B3ML 2KEDA 5IYBH 4LF5L 1TS5A 3C1FA 1K83H 1VQBA 4JYAL 4JI6Q 2A74C 3BG3A 4U68A 4WORA 1STNA 4BA1I 3NQTA 2ID0A 2IW3A 1Q86C 2K4KA 2A6HD 5C4XH 1SMXA 4KN4C 3AU7A 3NQIA 5IGEA 1AEXA 1TWAB 2EY6A 3S2DB 4JOIA 3KF8B 4R9WA 4G7HC 2F0TA 4YHHL 2NVQH 2K14A 3RR5A 1JORA 4KKSA 2CW0C 5JJIA 1A15A 3GTMH 2DN8A 2E2IB 3QOLA 3K7AB 4DR1L 2B63H 2F0EA 1LTTD 3D31A 4JVZA 1KLGD 4DA2A 5M5YB 4YHHQ 2EDGA 3CC4A 2B2WA 4DNIA 4NDXA 3ONAB 4H13C 4CDEC 2R7ZH 1J5EL 3RUZA 4A93B 4LF7L 2A8VA 4UP9A 2F0OA 5E3FA 2FJ2A 1OXSC 2XVSA 5M3MH 3KLSX 1WVLA 3NWTA 3OIPA 1U5KA 5M5WH 3HOWB 2XGTA 4HMJA 5C44B 4OXPA 3KK7A 4KMUC 2VXWA 1B4OA 4PZ7A 3FEWX 3CRLC 1N34Q 3CU7A 2JA5B 2NN6H 5M5XB 3S1QB 5KYLA 1PTOB 3CCSA 3F2DA 1BQQT 2UUBL 2E8GA 3MXPA 1PRTF 3BJUA 1X3FA 4IFDI 1CUKA 4BY1H 3GTLH 5KYIA 2HDLA 4BY7H 1BNZA 2FHTA 4MHEA 4X64L 4X62Q 2UUBQ 4OO1H 2SOBA 1BCPB 3KUPA 4Y7NB 2DGYA 3U50C 2YV5A 4HSPA 4RGOS 4DV3Q 1GUGA 2D2CC 1GHKA 3P20A 4KD4A 1K0SA 4X64Q 1O7ZA 1Q90A 3NSWA 4HSVA 2JA6B 3AQQA 2Z6KC 4P74A 1IHZA 4B08A 2NWGA 1YHBA 2JA7B 5CGKA 4NKLA 3J7YW 2DY7A 1LABA 1HUNA 1RD9D 4HIDA 4V190 1WTQA 2LMCB 4GKJQ 1O80A 4L5QA 4OIKA 5JEAJ 1L0XB 3D4WA 2FXQA 5JPNC 5CORA 3E9HA 4FVMA 3F1ZA 4R8IA 3CAMA 1U4PA 1SE4A 4LW1A 1JOKA 3PGZA 2PI2E 4JBKA 5C4JH 2IPKD 4DV2L 2GA4B 2RF4A 4C3IG 2N3SA 4CKBA 3K7UC 1E1TA 1A6XA 4A4IA 1HTPA 3PMFA 1DM0B 4WJWA 1MD2D 3T56B 4JCVE 2Z4HA 3HOYH 4H02A 2N8NA 1T5EA 1TXYA 2ZTEA 5LMUL 3TP6A 2PW5A 4KY6A 2L55A 4IPDA 2L5TA 4DFAA 4HCEA 3GTMB 3I4NH 3STBD 1PYSB 2K5DA 2N55A 4DR5L 1FJGL 1DOMA 2KHJA 1STBA 2B63B 1QG7A 2MFIA 5FO8B 3UI2A 1NR4A 5LMUQ 2PMZE 3R93A 2AQ2B 2J4XA 4KHPL 2F0UA 4A3EB 2EPBA 3I91A 2N78A 4J15A 1FJGQ 2ASBA 3EFXD 3GP7A 5M3MB 1D5ZC 1KIXA 2JK8A 3GTOH 1Q12A 2RHSB 1STHA 3NBHA 4E6IA 1N9WA 5M5WB 2G9DA 3I4MG 2FMMA 3P75A 3M3YH 2NVYH 1M4VA 4A3IB 1L1OB 4K8IA 2KHIA 1IBLL 4C3HB 1PRTD 2ZXPA 2C5CA 1AE2A 2B2VA 3UDGA 4JOIC 2B2YA 4QB4A 1HNXL 5FJ8G 3CHBD 3ZJYC 1YJWA 1Y69U 2F4VL 3UE0A 1SYEA 5J22A 2VUMB 1RTOA 4N8FA 2ZT9C 3HG9A 1IBLQ 5IYCH 3BVMA 3CF5A 5A35A 2E75C 1MKHA 2EVBA 3GTLB 1JOQA 1BKBA 4CJ2C 4LAAA 4BY7B 1HNXQ 2F4VQ 4GOPB 2WB1E 2L12A 1GUWA 4F88A 1EFWA 2JA8G 4LFAL 3MWYW 4DK3C 2B2UA 4JI5L 2KENA 4AH6A 3DEOA 4DV1L 3HGBA 3NTHA 3URYA 4FF1A 3QIAA 2Q8IB 3E9IA 3QWNA 2PQEA 3NBIA 1BUVT 2QDBA 1TY2A 1G8ZD 4MZ9A 5C4HA 1SNQA 1KRSA 2AMCB 3TEHB 4QGUA 4ME3A 2OTLA 4JV5L 1Y8OB 2AHOB 1QE6A 1SR3A 4OWXB 3NUCA 4K0KL 1B53A 1IYJB 1JWUD 3VR4A 4KLKA 2D0PA 1I3QH 1N36L 2RBMA 5C6AA 5CV7A 4A3LG 1FGUA 2JA5G 1GUSA 3KF8A 4IPGA 4CKEA 5F2DA 2AUJD 2NN6I 4QF4A 1KHIA 2Y0SE 4CBVA 1SYDA 3TRZA 1G2TA 5EKLA 1LACA 3EA6A 5I4DA 1N36Q 4LNQA 1AZQA 2OF1A 3J7AV 1II3A 4DK0A 1STAA 5IYDG 1LV9A 4DV4Q 4LF6Q 3MVVA 4H0LC 1IL8A 1CT1D 2NZ1D 1EIFA 3RLFA 4NW2A 4OO1I 4L5RC 1I4PA 4S3SA 1G91A 3HOYB 1WTRA 1X3PA 1HXYD 3DM1A 2F0KA 3FKIG 5JJKA 2JA6G 1NTGA 3T1YQ 2A68C 4FDBA 1PH5A 1VQ5A 1TU2B 3I4NB 1LTSD 3MA2B 4BBRG 5G3LD 1PFNA 1X54A 1QOHA 2UUCL 3OPOA 3M4OH 2PO4A 3BU2A 2UXDL 2AQ1B 2K04A 1FNWA 4HJ5A 1BCPF 1EQTA 4CHTB 1D7QA 1G6ZA 4RGMA 3TN2A 3NWSA 3H3VC 4DR3L 1CKNA 3K0YA 4A75A 1AH9A 4JI8L 1VQIA 3SK5A 3J81E 2NVYB 4X65L 1EL0A 1HQRD 2WP8J 3V2TA 1KAAA 1XTDA 5T1GA 3BDCA 4JI4L 3VYTA 1G6PA 1LT5D 4DR2Q 1ENAA 3M7GA 4ZAIA 5JEAG 4QUFA 2O5JC 1A3UA 3N6RA 4DV0L 2R93B 2Z4IA 4G57A 5HY6A 4A3BG 1YNND 3PIO3 2L1BA 4AQYL 1HNZL 2CWPA 3U9SA 1DCZA 3NTKA 1FGBD 4I7ZC 3HP3A 3QG1A 1EFID 4DNRB 4O42A 3RLOA 3PIP3 1B9NA 2RQXA 3OWFA 2CCZA 2FFKB 4K2KA 4A3EG 1JR0D 4B3RQ 4X3KA 1ILQA 3VYUA 4JI7Q 4LFBQ 3RZOB 4C3IH 1E3PA 3PO2B 2QA4A 4FP5D 1B50A 4LFCQ 4LK1C 4XQQA 3VA5A 4Q5VA 3L0OA 2QW7A 4A3IG 1SN8A 1SFOB 2EOTA 4PZ8A 2V4DA 1I3QB 4C3HG 4POFA 1X3GA 3A56A 3UE1A 2Q8TA 1TWCH 5C0XG 3KFUA 5C3EG 4WJ3M 4HEDA 1GOZA 2NTTA 2RVLA 1MGSA 2VUMG 1AN8A 2MO0A 1HFGA 1B3AA 4HR7B 5DEHA 1ICFB 1LTRD 1FR3A 2Q2IA 4O1NA 4RH6A 1ZEQX 1AW7A 2WAQG 3TREA 2A1AA 2HT1A 4HCSA 1VQ6A 3DM3A 2NVXH 1JOOA 1XMQL 1E24A 2CFMA 1ZYRD 1PTOD 2NYZD 1SNOA 1A3TA 4UPAA 2YYZA 4ULLA 5A2QE 1XTCD 2F0SA 2ZM6Q 4KKTA 3EVQA 1XX8A 3AMUA 3I3CA 3I4MH 1VQ7A 5EKIA 1G51A 3NXWA 3H91A 1XMQQ 1SNPA 1MSGA 1QVCA 1JB7A 2JP1A 2PZTA 3Q6SA 1VQPA 1L1OA 5C5LA 2H1EA 1TWAH 4MIUA 4IUPA 5FJ8H 3G48A 4KTAA 3S2DH 1R4PB 1TT2A 3M4OB 5IT9E 1U4RA 3VYRA 3I72A 2QKIC 2K52A 3SK8A 1DOLA 1GJXA 3J80E 2FINB 2UU9L 1RODA 1EY7A 1VMPA 1TVXA 4RCNA 1EQQA 1CK1A 2VQFL 1T9HA 4R4QA 3MFGA 5K36G 3K7AH 4PG3A 2D0OA 3D6CA 1ENFA 1D5MC 1EY8A 2AWOA 1HZ9A 1XNQQ 1K0RA 4GOPA 4WJ4A 2UU9Q 3A5ZB 2J0TD 1K8OA 5FLMG 1JWSD 2O4XA 2EYHA 1PA6A 4K2LA 2RA4A 4QY7A 3HS0C 3J7A5 3DXJC 1KQSA 3A54A 4B3TL 2WACA 5C3XA 1A63A 1BDOA 1AZPA 1O7LA 5C44H 1RCVD 1D5XC 4YWMA 1PH7A 1W6KA 2EE1A 2X69A 3PUZA 1B9MA 1YVCA 1VQ9A 1UEAB 2YTYA 3H94A 4A3LH 1EWHA 4JBWA 1Q81C 2JA5H 4XYOA 3OHXC 2EJMA 3OYYA 2KVMA 3BYTB 4B3TQ 1PTOH 2WFWA 4DR4L 2A6EC 2HQEA 4JI0Q 2K5HA 1N8RC 2RCFA 3GTQB 1AP0A 3E3XA 1EZ6A 5IWAQ 1H9SB 1N32Q 2VB3X 4MTNA 1LUZA 3ERSX 5IYDH 2UXBL 4CDDC 3RMHA 1EQVA 1Y8NB 5HGTA 2PW7A 1E2WA 4Z9CB 2K75A 1SEBD 1NJIC 3GDEA 2Z0SA 1SE8A 2VQEQ 1TWHB 4LF4L 1LT3D 1NMFA 3MXNB 2CW0D 3FKIH 2JA6H 3CD6A 3GTGB 1BXTA 3TZDA 3AB9A 4OWWB 2KOLA 1KNAA 1EU3A 4BBRH 2I5HA 4C56C 1WTXA 3IFDA 3HOUG 2QEJC 4KY7A 2R93G 3D6WA 3OMGA 2JA9A 4MTKA 4C3JG 1C48A 2XRSD 2YU9B 4DR6Q 1HZBA 4DR7Q 4A3CG 1A62A 2CQOA 2K5QA 4DV6L 1SSOA 5GROA 2XN9C 1HNWQ 5CBAE 2IY5B 1BO0A 5FO7B 1SJHD 3S17H 2E74C 1EZ8A 3I4LA 3IAYA 4ZKCB 1E0BA 1D8LA 1WI5A 4JI1Q 5BR8Q 1EY5A 3I4MB 1CA6A 1UUPA 1EU4A 5KGUA 1YI2A 3PO2G 2F0MA 4B3MQ 4J8QA 2K03A 2EYMA 3FMCA 4LF5Q 5IE8A 3HOZB 4JYAQ 1EYAA 3TMEA 5JEAH 1RF2D 5JAVA 5CV9A 1PFMA 1Q82C 1PXUA 5LL6X 1Y1WG 2ZTDA 3BS1A 1B44D 2D62A 1H9KA 1HH2P 4A3BH 4IOAA 5LMNL 1KTKA 2EQSA 4IO9A 1STYA 3K59A 4RMFA 1Q1BA 1BF4A 2Q2TA 2JA8B 4EQOA 2EIFA 4OONA 2Z6BA 2EYFA 3R2TA 4A3EH 1WYDA 4X3UA 2J7ZA 4DN4M 5I2YA 4IJLA 4FYDA 4ZKBB 4DR1Q 1EY0A 3T4AC 1A2TA 2XRQD 3G6EA 2F03A 2IX3A 2I46A 2XWBB 4XIGS 1ONLA 3AEVA 1J5EQ 4P71A 3S2HB 5E4WC 4HTHA 3QO2A 4LF7Q 4RWSC 4A3IH 1N33L 5ELEA 1BBWA 3M4PA 2UXCL 1V1PA 2ALYB 2F0LA 4P2CB 4C3HH 3R2IA 3OW2A 1HTLD 1D1KA 1EEFD 2EJFC 3EROA 1QVGA 1HUMA 1RJTA 4N8X1 5H1SE 2VUMH 1N33Q 1L0WA 1CHQD 2OEOA 3SGIA 2F0HA 4CJ1B 2CH4W 3K5OA 3ULJA 2GVAA 2ZJQA 4ZYSA 4FXDA 2I5MX 1V1QA 1JJ2A 2JN4A 1F2LA 3WWVA 2UUAL 3I8ZA 1IXRA 1GKHA 1V43A 4A76A 3MTSA 3PUVA 5TSSA 5IP7G 3MZ5A 1JCKB 1TS3A 2D5DA 2EY1A 2F3VA 4BS9A 5C4ZA 1SROA 4GN4B 1NY4A 3W2DA 3FKIB 2BA1A 3E6ZX 2UUAQ 3AFPA 1HJPA 3S1NH 2ZJPA 3M4YA 4DAPA 1TWGH 2HIXA 1IYVA 4BBRB 3A8KE 3G4SA 1I50H 4YWKA 1YJNA 2EYLA 2R3ZA 3N52A 4IPCA 3Q24A 3JAMi 1EWIA 4KK7A 3BVGA 1KAWA 2CQAA 1F9RA 2WV6D 4ALPA 1HA6A 3PUWA 3M9BA 5K36H 3S17B 1W6JA 3KDFB 4DV7L 1TWFH 2KEEA 3CRKC 4F87A 4IPHA 3RNUA 2BOSA 5ELDA 1FVIA 4K6LA 2F4IA 4RCOA 3ZYYX 3J7AF 4KD3A 2B8GA 4ZUIA
chains in the Genus database with same CATH topology
1IL2A 2QEXA 2F52A 4LF8L 3S14H 1XNRL 4IFDJ 1NMGA 5FLMH 1UWVA 4OO1G 2LSSA 1UEBA 1EIFA 1A0IA 4OWTB 3CCRA 4DUYQ 3RLFA 4HIOA 3H0GH 2E5LQ 4OO1I 4L5RC 3MEFA 4UY8C 3S1RH 1WFQA 2JQOA 4DV2Q 1PHJA 3FKIG 4GNXA 1XNRQ 5JJKA 4LF9L 4HJAA 2JA6G 4PZ6A 4IOCA 1K8GA 1NTGA 3BZKA 3T1YQ 4FDBA 3KJPA 4YCUA 1PH5A 1VQ5A 1AE3A 1YNXA 4A3MG 1HR0L 1JMCA 1UE5A 4BBRG 3AFQA 4PMWA 1X54A 3KYHC 1VQ4A 3CMAA 5C0XJ 3ER0A 2UUCL 1C9OA 3M4OH 4LUOA 4OX9L 1YEZA 3U4ZA 1YZ6A 3BU2A 3GTPH 4A3DH 2UXDL 3U4VA 1XNQL 1Z9FA 1YIJA 3JAMc 4UP8A 1BVSA 2Q2HA 4HJ5A 5LMNQ 3CCMA 3S1MH 2K5NA 4DR5Q 3T1HL 1D7QA 2KCTA 2E2IH 1XPUA 3HFZB 3W1GA 2JE6I 3E0EA 2MO1A 3F8TA 1VQGA 2BA0A 3S24A 4OX9Q 5M5YH 4DR3L 1CKNA 1YITA 4A75A 2HHHL 1SRUA 1AH9A 4JI8L 4GKKL 4KHPQ 1VQIA 1C7YA 3J80i 5GAGC 4X65L 2WP8J 1L1OC 1S3OA 2F3IA 2PI2A 4A93H 1XTDA 4YY3Q 4DUZQ 4JI4L 2B3GA 1W3SA 3F2CA 4DR2Q 1JJGA 1MIUA 3HOZG 1G6PA 5C3EH 1PH2A 2LXKA 3TS0A 3PUYA 3H0GG 3UDFA 4GKKQ 4X6AH 1N34L 5JEAG 3JC66 4GNXB 2OTJA 2UXCQ 1UE7A 2LXJA 1X55A 1PH8A 3HOYG 2R93H 1CSQA 3HKSA 5ELNA 4DV0L 2Z6KA 3HOWH 4JI0L 4C3JH 4L5TA 4R4IA 5HY6A 4P72A 1EQRA 3HKZE 2AKWB 2V1CC 3M4QA 3GTKH 4A3BG 4XTCS 1Y14B 2JEAI 4A3CH 5IWAL 3J7ZC 2XTIA 1VQEA 1P8LA 4JC0A 3CC2A 3I4NG 1CSPA 1C0AA 4AQYL 3HKZG 2A19A 1HNZL 2K5VA 5M5XH 4GOPC 1GM5A 4L5SA 2CWPA 3S1QH 3S1NH 1K8AC 3EN2A 1RIPA 4X62L 3RLOA 3W5OA 3KJOA 2CCZA 4POGA 2NZOA 2ZTCA 3GO5A 4A3EG 2Q2UA 2OQ0A 3TS2A 1PH6A 4B3RQ 1J6QA 2R7DA 2VZAA 3RZOH 5AJ3L 4JI7Q 4MNOA 2B29A 1CKNB 3L7ZC 2IX0A 2VQEL 3K0XA 3CCVA 5ELOA 3UDIA 2C35B 1E3PA 4C3IH 5M3FG 3PO2H 4LFAQ 5IT9c 2QA4A 2PQAA 3W1BA 2JJQA 4LFCQ 1B7YB 1H95A 4JI5Q 3H15A 5E7NA 3L0OA 1WOCA 1E22A 4DV1Q 1SFOH 4Y52H 3J80c 4R4OA 1SN8A 3CCEA 4Y7NH 4A3IG 2NVTH 4PZ8A 2KBNA 3RN2A 3HOVH 5AJ3Q 3PO3G 3CPFA 4POFA 4JV5Q 1OXXK 1X3GA 4DR6L 3OTOL 3UE1A 3CP0A 3CPWA 1TWCH 5C0XG 3PF5A 3KFUA 2ES2A 5C3EG 4GKJL 4A3JG 4DR7L 4WJ3M 4GN3B 3KF6B 4JI3L 5JJLA 4K0KQ 4NPSA 1Q46A 2VUMG 4BXXH 1X65A 2MO0A 4RG1A 4B3SL 4EQ5A 1HNWL 1HR0W 4AIMA 2WAQE 3K8AA 2IHFA 3B6YA 2JA7H 2Q2IA 1HZCA 2R7FA 5IYCG 2IHEA 1QVFA 4GS3A 3A5UA 1VQNA 3HOXH 2QGQA 4AYBE 4DV3L 4HJ9A 2WAQG 3TREA 2A1AA 1Z47A 2EXDA 4TQUS 1XPOA 2HT1A 1OXUA 4JG2A 4JI1L 5BR8L 1Q7YC 1VQ6A 3I56A 1NE3A 3DM3A 3RLNA 4AYBG 2NVXH 4B3SQ 1X3EA 1XMQL 4DV7Q 1E24A 1QUQA 2CFMA 3A74A 1W2BA 1EYGA 4B3ML 4A3KG 4UPAA 2YYZA 1KC8C 2HIVA 5IYBH 1NBWA 4LF5L 2ZM6Q 4A3GH 1K83H 1VQBA 4JYAL 3RN5A 4JI6Q 3I4MH 3UDXA 1VQ7A 1I94Q 1G51A 3NEMA 2PQAB 4LF8Q 1PH9A 2YTVA 4P73A 1EUJA 4BA1I 1XMQQ 1QVCA 2ATWA 1IBML 1JB7A 2ID0A 1Q86C 4GLAC 1VQPA 1L1OA 1VQDA 2K4KA 3PIOA 5C4XH 1SMXA 1TWAH 5FJ8H 4BBSH 2BH8A 3G48A 3I4NH 3S2DH 2RCNA 2PNHA 2R6GA 4JOIA 3KF8B 3RZDH 3ULLA 4LF9Q 2R92H 4YHHL 5GAHC 2NVQH 1VQLA 1MJCA 4NXNL 3PIPA 2K52A 4YCWA 4LUZA 1IBMQ 1UE1A 1HR0Q 3PCOB 2K14A 3PUXA 2UU9L 3RR5A 1EQQA 5JJIA 2VQFL 1T9HA 4R4QA 3GTMH 5K36G 3K7AH 1WCMG 4PG3A 2UUCQ 2D0OA 4DR1L 2B63H 1JJCB 1E7ZA 2AWOA 3D31A 1HZ9A 2UXDQ 2CWAA 4YHHQ 3CC4A 1DGSA 1XNQQ 1LTLA 2NZHA 1K0RA 3I4OA 4DNIA 3CC7A 4NXNQ 1PYBA 4GOPA 1L2FA 4WJ4A 2R7ZH 4C2MH 1EOVA 1Y1VG 3T1HQ 1J5EL 2UU9Q 1YHAA 1B8AA 3A5ZB 3AYHB 4UP9A 4LF7L 2A8VA 2OWOA 1FL0A 1OXSC 5FLMG 4LF6Q 4QIWE 4A3FH 3I55A 4DR3Q 5IP9H 1PA6A 2HHHQ 4O2DA 1GO3E 1HZAA 2JEBI 3CW2C 4JI8Q 4X66L 4QY7A 5M3MH 4JBMA 3H3VH 3J7A5 2MNAA 3HOUH 1KQSA 4X65Q 4B3TL 1U5KA 5M5WH 1A63A 2HQLA 1Q1EA 5C44H 2XGTA 1ASYA 4YWMA 4APVA 1PH7A 4JI4Q 3PUZA 4OXPA 1YVCA 1VQ9A 2YTYA 4A3LH 4JBWA 4PZ7A 1Q81C 5FLXc 1N34Q 2JA5H 1E1OA 4JI2L 3OYYA 4HJ7A 4B3TQ 1VCIA 4HIMA 4DV0Q 2WFWA 1VQFA 3CCSA 3IRBA 4UP7A 4DR4L 4JI0Q 2DUDA 3F2DA 2K5HA 1N8RC 3EIVA 2UUBL 2E8GA 3GTQH 4A3DG 1CKMA 4IFDG 1LYLA 3BJUA 1X3FA 3LGJA 1N32Q 5IWAQ 2H5XA 1CUKA 4DAMA 3DLLA 4BY1H 3GTLH 4IFDI 4AQYQ 1HNZQ 4MTNA 1LUZA 2MQHA 3ERSX 3M7NA 2RHQB 4DV5L 4BY7H 5IYDH 1OTCA 2ZJRA 2UXBL 4X64L 3FHWA 5GAEC 1OXTA 4X62Q 1U0LA 3STBC 2UUBQ 2K75A 2IT1A 1NJIC 2AWNA 2GVBA 3GDEA 3M85A 1UE6A 2DGYA 2Z0SA 3U50C 1TWHH 1SE8A 3GTJH 4A93G 2YV5A 4HJ8A 2VQEQ 4DV3Q 1M90C 1Y1WH 4LF4L 3ULPA 1NMFA 3KLWA 3NENA 3MXNB 3FKIH 4X64Q 2VS1A 3S16H 2JA6H 1N32L 3CD6A 3GTGH 5C0XI 4GKJQ 3AQQA 2Z6KC 4P74A 4OWWB 3HOUG 4BBRH 2I5HA 3EBEA 4DPGA 2R93G 1M1KC 4IJHA 3HOWG 1YHBA 5C44G 1X6OA 1RL2A 2JA9A 4KHZA 2YU9H 3K81C 4DR6Q 4TVAB 3OTOQ 5HGQA 4HIDA 1IBKL 1HZBA 4DR7Q 4L5QA 4YCVA 5JEAJ 1PV4A 1A62A 4A3CG 4JI3Q 2CQOA 4R1JA 4DV6L 2FXQA 1HNWQ 1Q8KA 5GROA 4HIKA 2VW9A 2IY5B 3ICEA 5DLQE 2I5LX 4DV4L 4LF6L 1BBUA 3S15H 3S17H 1K9MC 3E9HA 2VNUD 4QJFA 1MJEA 3F1ZA 1D8LA 3CCLA 1WI5A 4JI1Q 5BR8Q 1IBKQ 3CAMA 4JV5L 4LW1A 3PGZA 2E2HH 1KL9A 2GN5A 2PI2E 5C4JH 4JBKA 1YI2A 4DV2L 1VQKA 2RF4A 1R9TH 3PO2G 4B3MQ 4QL5A 1S72A 3A0JA 4LF5Q 1PH1A 3HOZH 2N3SA 1A8VA 1VS0A 1VQMA 3K7UC 3T1YL 4NB3A 5IE8A 4JYAQ 1E1TA 1EIYB 1IZ6A 4A4IA 1K73C 1VQHA 3GD7A 3PSIA 1X56A 3PV0A 1Q82C 3HOVG 1V9PA 4JCVE 3HOYH 4H02A 2N8NA 1Y1WG 2ZTDA 2E2JH 2D62A 1TXYA 2ZTEA 3J81j 5LMUL 1SLJA 5GQOA 1VQCA 1HH2P 3L2PA 1KRTA 4A3BH 1XMOL 4DKAC 4IPDA 4BXXG 4IOAA 4BA2I 5LMNL 2EQSA 3STBD 1PYSB 4IO9A 3CCQA 3NELA 4DR5L 1XJVA 2I0QA 2KHJA 1FJGL 4DAYB 1VQJA 1LM0A 3G71A 2JA7G 2JA8H 5IP7H 2MFIA 1Q1BA 4RMFA 2Q2TA 3HOXG 1S40A 4YWLA 5LMUQ 1PVOA 2PMZE 3VDYA 2EIFA 4OONA 5J3BA 1ASZA 3CMEA 1CKOA 1QUQB 4DK6C 4KHPL 2VQFQ 3Q8DA 4A3EH 1WYDA 1YJ9A 1XMOQ 2YTXA 1XPRA 4IJLA 2N78A 4J15A 4DR1Q 1FJGQ 2ASBA 4NXML 4P75A 4YY3L 5M3FH 4DUZL 4JBJA 3FP9A 3TQYA 1PH4A 1P16A 5EAYA 5IYBG 3F2BA 4DR2L 1KIXA 2JK8A 1VQOA 3G6EA 1Q12A 3GTOH 2RHSB 4GNXC 4XIGS 4A3GG 3AEVA 3S2HH 2IX1A 1N9WA 1J5EQ 4P71A 3I2ZA 1PFSA 3CCUA 3I4MG 3M3YH 4LF7Q 4A3IH 1QZHA 2NVYH 1N33L 4GN5A 4LWCA 1L1OB 1BBWA 3M4PA 2UXCL 2ALYB 2VY3A 2KHIA 4NXMQ 1IBLL 4C3HH 3PO3H 4R4TA 2VL6A 3OW2A 4X66Q 1B70B 1PH3A 1AE2A 1GD7A 1K3RA 4LUVA 3UDGA 5C4XG 3KOJA 4JOIC 4A3JH 1QVGA 3U58A 1HNXL 5FJ8G 4BBSG 3ZJYC 3J81i 1YJWA 4GLVB 5H1SE 2F4VL 3UE0A 2VUMH 2OQKA 1N33Q 1L0WA 1O7IA 2R92G 3SGIA 3KF6A 1IBLQ 3ULJA 5IYCH 3CF5A 3KDFA 1MKHA 2GVAA 2ZJQA 4JI2Q 1I5FA 1VQAA 1BKBA 1HNXQ 4B3RL 2I5MX 1QZGA 1V1QA 1JJ2A 4GOPB 2WB1E 2F4VQ 4DR4Q 2B63G 3WWVA 4JI7L 2UUAL 4A76A 1IXRA 1GKHA 1V43A 4LFBL 2CKZB 1EFWA 2JA8G 3PUVA 4A3KH 4LFAL 5IP7G 1KXLA 2WB1G 4LFCL 4DK3C 4JI5L 2KENA 2R7ZG 4AH6A 1JT8A 4DV1L 4DV5Q 4EX5A 1SROA 3BZCA 2UXBQ 3E9IA 1NY4A 4GN4B 5IY0A 1VQ8A 3NBHB 2BA1A 4A3FG 2UUAQ 3AFPA 1JE5A 5IP9G 4MZ9A 1HJPA 2L15A 5M3MG 4GLXA 1KRSA 2AMCB 3TEHB 4QGUA 4ME3A 2ZJPA 4A3MH 2AHOB 1X9NA 2OTLA 1TWGH 2HIXA 1SR3A 4O0AA 1I6HH 3K80C 1OXVA 3H3VI 4OWXB 1YBYA 4K0KL 2BH2A 1IYJB 3G4SA 1I50H 4LF4Q 4KLKA 1GVPA 5GADC 1KD1C 2D0PA 3CQZH 3D0FA 4YWKA 1YJNA 3PF4A 1I3QH 4IPCA 2K50A 3I7FA 1N36L 4A3LG 3CXCA 3JAMi 4R4CA 1EWIA 1FGUA 1YHQA 2KCMA 1KAWA 2JA5G 2NN6G 1WJJA 4IPGA 4ALPA 3PUWA 3J81c 2OCEA 2NN6I 3M9BA 1WCMH 1KHIA 2Y0SE 3CCJA 3TRZA 4KI0A 3KDFB 5LMNW 4DV7L 1G291 4DUYL 1TWFH 2E5LL 1N36Q 4QQBX 4IPHA 4LNQA 2Y0SG 2N49A 4BY1G 2ZM6L 3RNUA 4DV6Q 4LFBQ 1I94L 1FVIA 4JI6L 1Y1VH 4BY7G 5IYDG 4DV4Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IL2 A;  2QEX A;  2F52 A;  4LF8 L;  3S14 H;  1XNR L;  4IFD J;  1NMG A;  5FLM H;  1UWV A;  4OO1 G;  2LSS A;  1UEB A;  1EIF A;  1A0I A;  4OWT B;  3CCR A;  4DUY Q;  3RLF A;  4HIO A;  3H0G H;  2E5L Q;  4OO1 I;  4L5R C;  3MEF A;  4UY8 C;  3S1R H;  1WFQ A;  2JQO A;  4DV2 Q;  1PHJ A;  3FKI G;  4GNX A;  1XNR Q;  5JJK A;  4LF9 L;  4HJA A;  2JA6 G;  4PZ6 A;  4IOC A;  1K8G A;  1NTG A;  3BZK A;  3T1Y Q;  4FDB A;  3KJP A;  4YCU A;  1PH5 A;  1VQ5 A;  1AE3 A;  1YNX A;  4A3M G;  1HR0 L;  1JMC A;  1UE5 A;  4BBR G;  3AFQ A;  4PMW A;  1X54 A;  3KYH C;  1VQ4 A;  3CMA A;  5C0X J;  3ER0 A;  2UUC L;  1C9O A;  3M4O H;  4LUO A;  4OX9 L;  1YEZ A;  3U4Z A;  1YZ6 A;  3BU2 A;  3GTP H;  4A3D H;  2UXD L;  3U4V A;  1XNQ L;  1Z9F A;  1YIJ A;  3JAM c;  4UP8 A;  1BVS A;  2Q2H A;  4HJ5 A;  5LMN Q;  3CCM A;  3S1M H;  2K5N A;  4DR5 Q;  3T1H L;  1D7Q A;  2KCT A;  2E2I H;  1XPU A;  3HFZ B;  3W1G A;  2JE6 I;  3E0E A;  2MO1 A;  3F8T A;  1VQG A;  2BA0 A;  3S24 A;  4OX9 Q;  5M5Y H;  4DR3 L;  1CKN A;  1YIT A;  4A75 A;  2HHH L;  1SRU A;  1AH9 A;  4JI8 L;  4GKK L;  4KHP Q;  1VQI A;  1C7Y A;  3J80 i;  5GAG C;  4X65 L;  2WP8 J;  1L1O C;  1S3O A;  2F3I A;  2PI2 A;  4A93 H;  1XTD A;  4YY3 Q;  4DUZ Q;  4JI4 L;  2B3G A;  1W3S A;  3F2C A;  4DR2 Q;  1JJG A;  1MIU A;  3HOZ G;  1G6P A;  5C3E H;  1PH2 A;  2LXK A;  3TS0 A;  3PUY A;  3H0G G;  3UDF A;  4GKK Q;  4X6A H;  1N34 L;  5JEA G;  3JC6 6;  4GNX B;  2OTJ A;  2UXC Q;  1UE7 A;  2LXJ A;  1X55 A;  1PH8 A;  3HOY G;  2R93 H;  1CSQ A;  3HKS A;  5ELN A;  4DV0 L;  2Z6K A;  3HOW H;  4JI0 L;  4C3J H;  4L5T A;  4R4I A;  5HY6 A;  4P72 A;  1EQR A;  3HKZ E;  2AKW B;  2V1C C;  3M4Q A;  3GTK H;  4A3B G;  4XTC S;  1Y14 B;  2JEA I;  4A3C H;  5IWA L;  3J7Z C;  2XTI A;  1VQE A;  1P8L A;  4JC0 A;  3CC2 A;  3I4N G;  1CSP A;  1C0A A;  4AQY L;  3HKZ G;  2A19 A;  1HNZ L;  2K5V A;  5M5X H;  4GOP C;  1GM5 A;  4L5S A;  2CWP A;  3S1Q H;  3S1N H;  1K8A C;  3EN2 A;  1RIP A;  4X62 L;  3RLO A;  3W5O A;  3KJO A;  2CCZ A;  4POG A;  2NZO A;  2ZTC A;  3GO5 A;  4A3E G;  2Q2U A;  2OQ0 A;  3TS2 A;  1PH6 A;  4B3R Q;  1J6Q A;  2R7D A;  2VZA A;  3RZO H;  5AJ3 L;  4JI7 Q;  4MNO A;  2B29 A;  1CKN B;  3L7Z C;  2IX0 A;  2VQE L;  3K0X A;  3CCV A;  5ELO A;  3UDI A;  2C35 B;  1E3P A;  4C3I H;  5M3F G;  3PO2 H;  4LFA Q;  5IT9 c;  2QA4 A;  2PQA A;  3W1B A;  2JJQ A;  4LFC Q;  1B7Y B;  1H95 A;  4JI5 Q;  3H15 A;  5E7N A;  3L0O A;  1WOC A;  1E22 A;  4DV1 Q;  1SFO H;  4Y52 H;  3J80 c;  4R4O A;  1SN8 A;  3CCE A;  4Y7N H;  4A3I G;  2NVT H;  4PZ8 A;  2KBN A;  3RN2 A;  3HOV H;  5AJ3 Q;  3PO3 G;  3CPF A;  4POF A;  4JV5 Q;  1OXX K;  1X3G A;  4DR6 L;  3OTO L;  3UE1 A;  3CP0 A;  3CPW A;  1TWC H;  5C0X G;  3PF5 A;  3KFU A;  2ES2 A;  5C3E G;  4GKJ L;  4A3J G;  4DR7 L;  4WJ3 M;  4GN3 B;  3KF6 B;  4JI3 L;  5JJL A;  4K0K Q;  4NPS A;  1Q46 A;  2VUM G;  4BXX H;  1X65 A;  2MO0 A;  4RG1 A;  4B3S L;  4EQ5 A;  1HNW L;  1HR0 W;  4AIM A;  2WAQ E;  3K8A A;  2IHF A;  3B6Y A;  2JA7 H;  2Q2I A;  1HZC A;  2R7F A;  5IYC G;  2IHE A;  1QVF A;  4GS3 A;  3A5U A;  1VQN A;  3HOX H;  2QGQ A;  4AYB E;  4DV3 L;  4HJ9 A;  2WAQ G;  3TRE A;  2A1A A;  1Z47 A;  2EXD A;  4TQU S;  1XPO A;  2HT1 A;  1OXU A;  4JG2 A;  4JI1 L;  5BR8 L;  1Q7Y C;  1VQ6 A;  3I56 A;  1NE3 A;  3DM3 A;  3RLN A;  4AYB G;  2NVX H;  4B3S Q;  1X3E A;  1XMQ L;  4DV7 Q;  1E24 A;  1QUQ A;  2CFM A;  3A74 A;  1W2B A;  1EYG A;  4B3M L;  4A3K G;  4UPA A;  2YYZ A;  1KC8 C;  2HIV A;  5IYB H;  1NBW A;  4LF5 L;  2ZM6 Q;  4A3G H;  1K83 H;  1VQB A;  4JYA L;  3RN5 A;  4JI6 Q;  3I4M H;  3UDX A;  1VQ7 A;  1I94 Q;  1G51 A;  3NEM A;  2PQA B;  4LF8 Q;  1PH9 A;  2YTV A;  4P73 A;  1EUJ A;  4BA1 I;  1XMQ Q;  1QVC A;  2ATW A;  1IBM L;  1JB7 A;  2ID0 A;  1Q86 C;  4GLA C;  1VQP A;  1L1O A;  1VQD A;  2K4K A;  3PIO A;  5C4X H;  1SMX A;  1TWA H;  5FJ8 H;  4BBS H;  2BH8 A;  3G48 A;  3I4N H;  3S2D H;  2RCN A;  2PNH A;  2R6G A;  4JOI A;  3KF8 B;  3RZD H;  3ULL A;  4LF9 Q;  2R92 H;  4YHH L;  5GAH C;  2NVQ H;  1VQL A;  1MJC A;  4NXN L;  3PIP A;  2K52 A;  4YCW A;  4LUZ A;  1IBM Q;  1UE1 A;  1HR0 Q;  3PCO B;  2K14 A;  3PUX A;  2UU9 L;  3RR5 A;  1EQQ A;  5JJI A;  2VQF L;  1T9H A;  4R4Q A;  3GTM H;  5K36 G;  3K7A H;  1WCM G;  4PG3 A;  2UUC Q;  2D0O A;  4DR1 L;  2B63 H;  1JJC B;  1E7Z A;  2AWO A;  3D31 A;  1HZ9 A;  2UXD Q;  2CWA A;  4YHH Q;  3CC4 A;  1DGS A;  1XNQ Q;  1LTL A;  2NZH A;  1K0R A;  3I4O A;  4DNI A;  3CC7 A;  4NXN Q;  1PYB A;  4GOP A;  1L2F A;  4WJ4 A;  2R7Z H;  4C2M H;  1EOV A;  1Y1V G;  3T1H Q;  1J5E L;  2UU9 Q;  1YHA A;  1B8A A;  3A5Z B;  3AYH B;  4UP9 A;  4LF7 L;  2A8V A;  2OWO A;  1FL0 A;  1OXS C;  5FLM G;  4LF6 Q;  4QIW E;  4A3F H;  3I55 A;  4DR3 Q;  5IP9 H;  1PA6 A;  2HHH Q;  4O2D A;  1GO3 E;  1HZA A;  2JEB I;  3CW2 C;  4JI8 Q;  4X66 L;  4QY7 A;  5M3M H;  4JBM A;  3H3V H;  3J7A 5;  2MNA A;  3HOU H;  1KQS A;  4X65 Q;  4B3T L;  1U5K A;  5M5W H;  1A63 A;  2HQL A;  1Q1E A;  5C44 H;  2XGT A;  1ASY A;  4YWM A;  4APV A;  1PH7 A;  4JI4 Q;  3PUZ A;  4OXP A;  1YVC A;  1VQ9 A;  2YTY A;  4A3L H;  4JBW A;  4PZ7 A;  1Q81 C;  5FLX c;  1N34 Q;  2JA5 H;  1E1O A;  4JI2 L;  3OYY A;  4HJ7 A;  4B3T Q;  1VCI A;  4HIM A;  4DV0 Q;  2WFW A;  1VQF A;  3CCS A;  3IRB A;  4UP7 A;  4DR4 L;  4JI0 Q;  2DUD A;  3F2D A;  2K5H A;  1N8R C;  3EIV A;  2UUB L;  2E8G A;  3GTQ H;  4A3D G;  1CKM A;  4IFD G;  1LYL A;  3BJU A;  1X3F A;  3LGJ A;  1N32 Q;  5IWA Q;  2H5X A;  1CUK A;  4DAM A;  3DLL A;  4BY1 H;  3GTL H;  4IFD I;  4AQY Q;  1HNZ Q;  4MTN A;  1LUZ A;  2MQH A;  3ERS X;  3M7N A;  2RHQ B;  4DV5 L;  4BY7 H;  5IYD H;  1OTC A;  2ZJR A;  2UXB L;  4X64 L;  3FHW A;  5GAE C;  1OXT A;  4X62 Q;  1U0L A;  3STB C;  2UUB Q;  2K75 A;  2IT1 A;  1NJI C;  2AWN A;  2GVB A;  3GDE A;  3M85 A;  1UE6 A;  2DGY A;  2Z0S A;  3U50 C;  1TWH H;  1SE8 A;  3GTJ H;  4A93 G;  2YV5 A;  4HJ8 A;  2VQE Q;  4DV3 Q;  1M90 C;  1Y1W H;  4LF4 L;  3ULP A;  1NMF A;  3KLW A;  3NEN A;  3MXN B;  3FKI H;  4X64 Q;  2VS1 A;  3S16 H;  2JA6 H;  1N32 L;  3CD6 A;  3GTG H;  5C0X I;  4GKJ Q;  3AQQ A;  2Z6K C;  4P74 A;  4OWW B;  3HOU G;  4BBR H;  2I5H A;  3EBE A;  4DPG A;  2R93 G;  1M1K C;  4IJH A;  3HOW G;  1YHB A;  5C44 G;  1X6O A;  1RL2 A;  2JA9 A;  4KHZ A;  2YU9 H;  3K81 C;  4DR6 Q;  4TVA B;  3OTO Q;  5HGQ A;  4HID A;  1IBK L;  1HZB A;  4DR7 Q;  4L5Q A;  4YCV A;  5JEA J;  1PV4 A;  1A62 A;  4A3C G;  4JI3 Q;  2CQO A;  4R1J A;  4DV6 L;  2FXQ A;  1HNW Q;  1Q8K A;  5GRO A;  4HIK A;  2VW9 A;  2IY5 B;  3ICE A;  5DLQ E;  2I5L X;  4DV4 L;  4LF6 L;  1BBU A;  3S15 H;  3S17 H;  1K9M C;  3E9H A;  2VNU D;  4QJF A;  1MJE A;  3F1Z A;  1D8L A;  3CCL A;  1WI5 A;  4JI1 Q;  5BR8 Q;  1IBK Q;  3CAM A;  4JV5 L;  4LW1 A;  3PGZ A;  2E2H H;  1KL9 A;  2GN5 A;  2PI2 E;  5C4J H;  4JBK A;  1YI2 A;  4DV2 L;  1VQK A;  2RF4 A;  1R9T H;  3PO2 G;  4B3M Q;  4QL5 A;  1S72 A;  3A0J A;  4LF5 Q;  1PH1 A;  3HOZ H;  2N3S A;  1A8V A;  1VS0 A;  1VQM A;  3K7U C;  3T1Y L;  4NB3 A;  5IE8 A;  4JYA Q;  1E1T A;  1EIY B;  1IZ6 A;  4A4I A;  1K73 C;  1VQH A;  3GD7 A;  3PSI A;  1X56 A;  3PV0 A;  1Q82 C;  3HOV G;  1V9P A;  4JCV E;  3HOY H;  4H02 A;  2N8N A;  1Y1W G;  2ZTD A;  2E2J H;  2D62 A;  1TXY A;  2ZTE A;  3J81 j;  5LMU L;  1SLJ A;  5GQO A;  1VQC A;  1HH2 P;  3L2P A;  1KRT A;  4A3B H;  1XMO L;  4DKA C;  4IPD A;  4BXX G;  4IOA A;  4BA2 I;  5LMN L;  2EQS A;  3STB D;  1PYS B;  4IO9 A;  3CCQ A;  3NEL A;  4DR5 L;  1XJV A;  2I0Q A;  2KHJ A;  1FJG L;  4DAY B;  1VQJ A;  1LM0 A;  3G71 A;  2JA7 G;  2JA8 H;  5IP7 H;  2MFI A;  1Q1B A;  4RMF A;  2Q2T A;  3HOX G;  1S40 A;  4YWL A;  5LMU Q;  1PVO A;  2PMZ E;  3VDY A;  2EIF A;  4OON A;  5J3B A;  1ASZ A;  3CME A;  1CKO A;  1QUQ B;  4DK6 C;  4KHP L;  2VQF Q;  3Q8D A;  4A3E H;  1WYD A;  1YJ9 A;  1XMO Q;  2YTX A;  1XPR A;  4IJL A;  2N78 A;  4J15 A;  4DR1 Q;  1FJG Q;  2ASB A;  4NXM L;  4P75 A;  4YY3 L;  5M3F H;  4DUZ L;  4JBJ A;  3FP9 A;  3TQY A;  1PH4 A;  1P16 A;  5EAY A;  5IYB G;  3F2B A;  4DR2 L;  1KIX A;  2JK8 A;  1VQO A;  3G6E A;  1Q12 A;  3GTO H;  2RHS B;  4GNX C;  4XIG S;  4A3G G;  3AEV A;  3S2H H;  2IX1 A;  1N9W A;  1J5E Q;  4P71 A;  3I2Z A;  1PFS A;  3CCU A;  3I4M G;  3M3Y H;  4LF7 Q;  4A3I H;  1QZH A;  2NVY H;  1N33 L;  4GN5 A;  4LWC A;  1L1O B;  1BBW A;  3M4P A;  2UXC L;  2ALY B;  2VY3 A;  2KHI A;  4NXM Q;  1IBL L;  4C3H H;  3PO3 H;  4R4T A;  2VL6 A;  3OW2 A;  4X66 Q;  1B70 B;  1PH3 A;  1AE2 A;  1GD7 A;  1K3R A;  4LUV A;  3UDG A;  5C4X G;  3KOJ A;  4JOI C;  4A3J H;  1QVG A;  3U58 A;  1HNX L;  5FJ8 G;  4BBS G;  3ZJY C;  3J81 i;  1YJW A;  4GLV B;  5H1S E;  2F4V L;  3UE0 A;  2VUM H;  2OQK A;  1N33 Q;  1L0W A;  1O7I A;  2R92 G;  3SGI A;  3KF6 A;  1IBL Q;  3ULJ A;  5IYC H;  3CF5 A;  3KDF A;  1MKH A;  2GVA A;  2ZJQ A;  4JI2 Q;  1I5F A;  1VQA A;  1BKB A;  1HNX Q;  4B3R L;  2I5M X;  1QZG A;  1V1Q A;  1JJ2 A;  4GOP B;  2WB1 E;  2F4V Q;  4DR4 Q;  2B63 G;  3WWV A;  4JI7 L;  2UUA L;  4A76 A;  1IXR A;  1GKH A;  1V43 A;  4LFB L;  2CKZ B;  1EFW A;  2JA8 G;  3PUV A;  4A3K H;  4LFA L;  5IP7 G;  1KXL A;  2WB1 G;  4LFC L;  4DK3 C;  4JI5 L;  2KEN A;  2R7Z G;  4AH6 A;  1JT8 A;  4DV1 L;  4DV5 Q;  4EX5 A;  1SRO A;  3BZC A;  2UXB Q;  3E9I A;  1NY4 A;  4GN4 B;  5IY0 A;  1VQ8 A;  3NBH B;  2BA1 A;  4A3F G;  2UUA Q;  3AFP A;  1JE5 A;  5IP9 G;  4MZ9 A;  1HJP A;  2L15 A;  5M3M G;  4GLX A;  1KRS A;  2AMC B;  3TEH B;  4QGU A;  4ME3 A;  2ZJP A;  4A3M H;  2AHO B;  1X9N A;  2OTL A;  1TWG H;  2HIX A;  1SR3 A;  4O0A A;  1I6H H;  3K80 C;  1OXV A;  3H3V I;  4OWX B;  1YBY A;  4K0K L;  2BH2 A;  1IYJ B;  3G4S A;  1I50 H;  4LF4 Q;  4KLK A;  1GVP A;  5GAD C;  1KD1 C;  2D0P A;  3CQZ H;  3D0F A;  4YWK A;  1YJN A;  3PF4 A;  1I3Q H;  4IPC A;  2K50 A;  3I7F A;  1N36 L;  4A3L G;  3CXC A;  3JAM i;  4R4C A;  1EWI A;  1FGU A;  1YHQ A;  2KCM A;  1KAW A;  2JA5 G;  2NN6 G;  1WJJ A;  4IPG A;  4ALP A;  3PUW A;  3J81 c;  2OCE A;  2NN6 I;  3M9B A;  1WCM H;  1KHI A;  2Y0S E;  3CCJ A;  3TRZ A;  4KI0 A;  3KDF B;  5LMN W;  4DV7 L;  1G29 1;  4DUY L;  1TWF H;  2E5L L;  1N36 Q;  4QQB X;  4IPH A;  4LNQ A;  2Y0S G;  2N49 A;  4BY1 G;  2ZM6 L;  3RNU A;  4DV6 Q;  4LFB Q;  1I94 L;  1FVI A;  4JI6 L;  1Y1V H;  4BY7 G;  5IYD G;  4DV4 Q; 
#chains in the Genus database with same CATH topology
 4LF8 L;  1XNR L;  2A69 C;  3ERQ A;  2EZV A;  5FLM H;  1MHW C;  1A0I A;  1DD2 A;  3H6M A;  3MHB A;  1ICW A;  1MI2 A;  2MUY A;  3MEF A;  2JQO A;  4DV2 Q;  1UAP A;  4RKB A;  2RDG A;  4PQX A;  4GNX A;  4OL7 A;  1XNR Q;  4LF9 L;  1QNU A;  4PZ6 A;  5DAU A;  4A3B B;  1CQF A;  4A3M G;  1HR0 L;  2WKC A;  3AFQ A;  3A8J E;  1GUN A;  1WTH A;  2MP1 A;  5C0X J;  1ILP A;  4OX9 L;  1ZXT A;  3GTP H;  1Z9F A;  1YIJ A;  5G3L F;  4DR5 Q;  3T1H L;  3S1M B;  1M8A A;  1XPU A;  3HFZ B;  3QOJ A;  5IOD A;  1J8I A;  1H9S A;  2BA0 A;  2RSO A;  4OX9 Q;  1YIT A;  2HHH L;  1STE A;  1CA5 A;  4KHP Q;  4UHV A;  1C7Y A;  5GAG C;  1S3O A;  5COY A;  5EKK A;  3LWE A;  1KLU D;  4RHS A;  1MIU A;  3HOZ G;  4K14 A;  2M00 A;  3IL8 A;  5C3E B;  3H0G G;  3UDF A;  4DAV A;  2RSN A;  3VR5 A;  3JC6 6;  2OTJ A;  3T13 A;  1X55 A;  3MC0 B;  5ELN A;  2R93 H;  4C3J H;  1V8Q A;  1SE3 A;  2IJ0 A;  5NUC A;  2WAQ B;  5CV5 A;  1Y14 B;  2JEA I;  2A73 B;  1HQM C;  1LTG D;  1RTN A;  4JC0 A;  4A3C H;  1C0A A;  2B2W C;  2KA7 A;  3HKZ G;  1PDQ A;  4IUV A;  3VA7 A;  1PMR A;  3EQL C;  1EWC A;  1K8A C;  3EN2 A;  1EIG A;  3GV6 A;  2F0J A;  1WTW A;  3ND9 A;  4POG A;  2DNC A;  3TP7 A;  3K5M A;  4GZY C;  3TS2 A;  2L11 A;  2A68 D;  3RZO H;  5AJ3 L;  4MNO A;  1L0Y B;  1MBY A;  2K32 A;  3PO2 H;  3MEH A;  2KCC A;  2DJF C;  4ILW A;  4LFA Q;  3S1N B;  1VMC A;  4DF7 A;  1TWG B;  4JI5 Q;  5E7N A;  4FNF A;  4DV1 Q;  1SFO H;  1I50 B;  3RN2 A;  5FLX L;  5AJ3 Q;  4K5X A;  4JV5 Q;  3C2P A;  3OTO L;  3CPW A;  3CP0 A;  3BDL A;  4A3J G;  4JI3 L;  4K0K Q;  3D8G A;  2H4O A;  1VDZ A;  1OO9 B;  2NBF A;  1HZC A;  1TWF B;  3BDO A;  2R7F A;  2RDF A;  4GS3 A;  4ZRZ A;  3BVZ A;  2QGQ A;  2SEB D;  3HOX B;  4FXK C;  4F7X A;  4JG2 A;  4ODG A;  1Q7Y C;  4AYB G;  5KND A;  1LTA D;  3A74 A;  1VF5 C;  5FK9 C;  4RGN A;  1XXG A;  4A3G B;  3RN5 A;  4QIW B;  2N88 A;  3UDX A;  4C1N I;  3NEM A;  1PTO F;  2PQA B;  4HN7 A;  4N9T A;  4RFB A;  5CYU A;  2P5Z X;  1EUJ A;  3C46 A;  3G6J B;  3ND8 A;  5EBC A;  5CV4 A;  4OGQ C;  4L8J A;  2SDF A;  4GLA C;  1VQD A;  1KDA A;  1QWY A;  2PZW A;  1K8M A;  3PIO A;  4XT3 B;  2XSC A;  3DWP A;  2BH8 A;  4BBS B;  2PNH A;  3SE0 A;  2R6G A;  3RZD H;  3ULL A;  3GTP B;  1MJC A;  2K33 A;  2MPM A;  4NXN L;  3PIP A;  2R92 B;  4YCW A;  4LUZ A;  1PFB A;  4TRD A;  1CM9 A;  5C3W A;  4H7B A;  2UUC Q;  2NTS A;  1JJC B;  1CZG A;  3IFT A;  2UXD Q;  3KLR A;  2NZH A;  3I4O A;  3CC7 A;  4NXN Q;  3LNN A;  1S5C D;  4RA8 A;  3H09 A;  1Y1V G;  1DON A;  3AYH B;  1T5X D;  1ESF A;  2OWO A;  1FL0 A;  3I55 A;  4DR3 Q;  4O2D A;  2JEB I;  3CW2 C;  4JI8 Q;  4X66 L;  4A3F B;  1GUT A;  3H3V H;  1IW7 C;  4X65 Q;  3HOU B;  1Q1E A;  1E2Z A;  4RGT A;  1YNJ C;  2EXZ A;  4L63 B;  1ASY A;  4APV A;  4JI4 Q;  1TS2 A;  4C3J B;  2B39 A;  2O2L D;  5DM7 3;  1ML0 D;  3Q23 A;  3R8B A;  5FLX c;  2B2T A;  1E1O A;  4HAE A;  4JI2 L;  2F0N A;  5AFW A;  1VCI A;  4DV0 Q;  3LWU A;  1VQF A;  4JK1 C;  5JVH 3;  3IRB A;  5KEE A;  3GTQ H;  3EIV A;  1LYL A;  3K5N A;  3SXH A;  5J39 A;  4DAM A;  3DLL A;  4AQY Q;  1HNZ Q;  2MQH A;  2RHQ B;  4DV5 L;  4FF2 A;  4RAU C;  4XQJ A;  3KBX A;  1H9M A;  5JVG 3;  3CKI B;  3M85 A;  1UE6 A;  2B2V C;  1DOK A;  1TWH H;  5D3D A;  3GTJ B;  2B2Y C;  2XNA C;  3MXU A;  3BYY B;  1TKW B;  3KLW A;  5KNB A;  1Y1W B;  1CFM A;  4KHV A;  3GTG H;  4OIJ A;  1KNE A;  3OW7 A;  4DPG A;  1M1K C;  4IJH A;  4KHZ A;  2YU9 H;  2K6A A;  4M1U B;  5FO9 B;  4TVA B;  1QB5 D;  2XIW A;  3TSS A;  1NNX A;  4JPB W;  4YCV A;  1PV4 A;  2KUM A;  2WIN B;  1NR2 A;  1K28 A;  4UAI A;  3ITP A;  4HIK A;  2B2U C;  2KHS A;  2IWH A;  1WTP A;  3S15 B;  2VNU D;  4QJF A;  1MJE A;  3CCL A;  1VF7 A;  1SJE D;  1RDP D;  2F0D A;  5I6Y A;  1KL9 A;  2GN5 A;  5EJW A;  2JSO A;  2R61 A;  2TSS A;  1R9T H;  5FOB B;  1C8C A;  3A55 A;  4QL5 A;  3A0J A;  1PH1 A;  3HOZ H;  5ELF A;  1A8V A;  2LKV A;  4Q0F A;  4J6H A;  1EIY B;  2A6E D;  1VQH A;  5IGD A;  3PSI A;  1DZ1 A;  1X56 A;  3RZD B;  5KIX A;  3J81 j;  4ZUJ A;  2E2J B;  5GQO A;  3O13 A;  1EY9 A;  4DKA C;  4BXX G;  2I0Q A;  5CBE E;  2E76 C;  1XJV A;  1CTM A;  1FNV A;  3KBG A;  2JA8 H;  2AUK A;  3HOX G;  4YWL A;  2MJ8 A;  2JXM B;  4IQZ A;  3VDY A;  3CME A;  2HCC A;  2VQF Q;  4DGZ A;  1AFP A;  1XPR A;  3F2U A;  2F0F A;  2HUG A;  2CH4 A;  4YY3 L;  4DUZ L;  5T1I A;  3TQY A;  3VYS A;  1P16 A;  5EAY A;  4A3G G;  1VQO A;  3PQI A;  1SMY C;  3T16 A;  3T51 B;  3S2H H;  2IX1 A;  4PV1 C;  1PFS A;  2BE5 C;  3CCU A;  1QZH A;  4GN5 A;  4LWC A;  4H44 C;  5EPK A;  1PZI D;  2VY3 A;  5LHY 1;  1JE4 A;  4R4T A;  2VL6 A;  2I07 B;  1B70 B;  1A2U A;  1GD7 A;  1QJO A;  4A3J H;  3U58 A;  3VR6 A;  4BBS G;  4XDX A;  3J81 i;  4GLV B;  3JAM L;  3V05 A;  1C4Q A;  2F0P A;  1Z6H A;  2R92 G;  2SNM A;  4IUQ A;  1F2M A;  3DMU A;  1VQA A;  3I90 A;  1U4M A;  3OOC A;  4B9X A;  1ESR A;  1I4R A;  5IGG A;  4DR4 Q;  3W3A A;  3FVQ A;  2CKZ B;  3NHH A;  5E1F A;  2WB1 G;  1KXL A;  1JB3 A;  1BCP C;  1JT8 A;  3WOE A;  1LT4 D;  3BZC A;  2UXB Q;  5IY0 A;  1VQ8 A;  3NBH B;  4A3F G;  5IP9 G;  2L15 A;  4GLX A;  1X9N A;  2F0V A;  2Z9H A;  3QB3 A;  3K5L A;  4A3M B;  2LY7 A;  3C1E A;  3H3V I;  4CKC A;  1YBY A;  4LF4 Q;  4IZ8 A;  5GAD C;  1KD1 C;  3PF4 A;  3C3L A;  2K50 A;  3I7F A;  3CXC A;  1YHQ A;  2KCM A;  4LJZ C;  2AQ3 B;  3A7L A;  5JJZ A;  5EPJ A;  3CCJ A;  1ZKO A;  5LMN W;  1FD7 D;  4ZCK A;  1X3Q A;  2VB2 X;  2E5L L;  4QQB X;  2Y0S G;  2N49 A;  2K5W A;  2OXP A;  2EYO A;  2K7V A;  4DV6 Q;  4JI6 L;  1V1O A;  1Y1V H;  2RDH A;  4K6D A;  1EYC A;  1R9T B;  2QEX A;  2FMC A;  1IKL A;  2Q8R E;  4IFD J;  2BDN A;  3S14 B;  3WOF A;  5BN5 A;  1UWV A;  2LSS A;  4OWT B;  1BBX C;  2E5L Q;  1IKM A;  3H0G B;  4YIJ A;  2EYP A;  4DXG A;  3S1R H;  1QNK A;  4NMZ A;  3OIQ A;  1K8G A;  4IOC A;  4ID6 A;  3BZK A;  3KJP A;  1AE3 A;  1EOT A;  1YNX A;  3K58 A;  1F2Y A;  4NP5 A;  3HKZ B;  1PZK D;  4PMW A;  3NPP A;  1VQ4 A;  3ER0 A;  4IUU A;  1PYW D;  1LLR D;  4X3S A;  1YEZ A;  1YZ6 A;  2Z1C A;  4KJO A;  4A3D B;  3JAM c;  4G4K A;  4WFN 3;  2Q2H A;  5LMN Q;  3CCM A;  3S1M H;  4QMG A;  3W1G A;  3E0E A;  3DWQ A;  2MO1 A;  1EYD A;  1NAP A;  3S24 A;  4CDF C;  1JIC A;  4CJ0 B;  1SRU A;  4FF3 A;  4GKK L;  2IL8 A;  3J80 i;  3E5S A;  3GQB A;  4KN7 C;  2PPB C;  1L1O C;  2F3I A;  2B3G A;  2K28 A;  3F2C A;  4J1M A;  5C0X H;  3QJY A;  5C3E H;  1PH2 A;  2LXK A;  3X3M A;  4OHJ A;  3TS0 A;  4A3J B;  1KDC A;  4GKK Q;  1N34 L;  5D14 A;  2UXC Q;  1I4H A;  1UE7 A;  2LXJ A;  2WKD A;  1EY4 A;  4KJN A;  1PH8 A;  1CSQ A;  2E2D C;  3HKS A;  1LT6 D;  1WD1 A;  3DHQ A;  1DYQ A;  4P72 A;  1EQR A;  2V1C C;  3M4Q A;  3E0J A;  5IGF A;  4XTC S;  3GTK H;  5E4X A;  5J1Z A;  3CC2 A;  1I4G A;  2A69 D;  1VQE A;  4I7A A;  2BDO A;  3SK6 A;  4KY5 A;  2A5H A;  3TP5 A;  3X3N A;  2K5V A;  4GOP C;  1WTO A;  4AYB B;  1GM5 A;  4IAL A;  1FYC A;  2A6H C;  1GHJ A;  3EJI A;  3L9A X;  3WDN A;  4X62 L;  3A8I E;  1SDF A;  5IGB A;  1S5D D;  3W5O A;  5ELB A;  3GO5 A;  2HCI A;  2OQ0 A;  2Q2U A;  3Q22 A;  1J6Q A;  3FRP B;  2MGS A;  3U9O A;  2R7D A;  4ME5 A;  4XXE A;  2B29 A;  1CKN B;  4DV3 L;  5ELO A;  3UDI A;  2C35 B;  5M3F G;  2QF7 A;  1JWM D;  4B9W A;  2JJQ A;  1H95 A;  1B3Q A;  4XYQ A;  3SEB A;  4IN3 A;  1BR9 A;  4Y52 H;  1PLF A;  2NVT H;  2KQ3 A;  3NTI A;  3PO3 G;  2PZU A;  3CPF A;  3HOV B;  1GXD C;  4GKJ L;  2ICI A;  4GN3 B;  3KF6 B;  1SYB A;  4BXX H;  1Q46 A;  2K01 A;  1HR0 W;  2WAQ E;  1U4L A;  3B6Y A;  1STG A;  2IHE A;  3A5U A;  1VQN A;  3HOX H;  4HJ9 A;  1KDB A;  1Z47 A;  2M2L A;  1UNS A;  1Y1V B;  3I56 A;  3RLN A;  2HD3 A;  1X3E A;  4DV7 Q;  1EYG A;  5KNC A;  4DXF A;  4A3K G;  1KC8 C;  2Z8L A;  2HIV A;  1NBW A;  4A3G H;  1B1Z A;  1K83 B;  3S1R B;  1QIL A;  1I94 Q;  2EY2 A;  1Q3L A;  1PH9 A;  4LF8 Q;  2YTV A;  4RHR A;  2ENB A;  4P73 A;  2ATW A;  1IBM L;  3D4D A;  5EGT A;  1TS4 A;  5C4X B;  1EIH A;  4BBS H;  5HUR A;  2RCN A;  3P1H A;  4LF9 Q;  2R92 H;  5GAH C;  1HPC A;  2NUC A;  1VQL A;  4K8J A;  2NVQ B;  1IBM Q;  1UE1 A;  1HR0 Q;  3PCO B;  5K5P A;  3PUX A;  3D4R A;  1WCM G;  1QCB D;  3Q0A A;  4EQP A;  3K6O A;  1E7Z A;  2CHB D;  5EBD A;  5L37 A;  2CWA A;  1DGS A;  1LTL A;  1PYB A;  1L2F A;  4C2M H;  1EOV A;  1TY0 A;  3T1H Q;  2G9H D;  2R7Z B;  1YHA A;  1B8A A;  1MSH A;  3S9W A;  5EQ0 A;  4QIW E;  4A3F H;  1KAB A;  4N9P A;  5IP9 H;  2HHH Q;  1GO3 E;  1HZA A;  4JBM A;  1NCV A;  3MXN A;  2MNA A;  3HOU H;  2PYK A;  3MFY A;  2HQL A;  4KKU A;  5JOB A;  2QCP X;  2F0W A;  3GTK B;  5CV6 A;  3HZX A;  4XT1 B;  1D6E C;  4ZQ3 A;  1SYG A;  5JPM C;  4HJ7 A;  4JW0 A;  4HIM A;  3TP8 A;  4UP7 A;  4PNY A;  2DUD A;  4A3D G;  4DU9 A;  1CKM A;  4IFD G;  3LGJ A;  3OSO A;  2H5X A;  2K05 A;  4BY1 B;  2JYO A;  2KJX A;  3M7N A;  3HRZ C;  2ZJR A;  1OTC A;  4CGY B;  1NSN S;  1F9P A;  3FHW A;  5GAE C;  1OXT A;  4L6T B;  1CI3 M;  1U0L A;  5EPL A;  3STB C;  3GV3 A;  5DNF A;  3OWE B;  2IT1 A;  2AWN A;  2GVB A;  1SYF A;  3L3O C;  2BCO A;  2NVT B;  3GTJ H;  4A93 G;  4HJ8 A;  1M90 C;  1Y1W H;  3ULP A;  4QCL A;  3NEN A;  1F2Z A;  5FKA C;  5IOC A;  2VS1 A;  3TDQ A;  3S16 H;  5IIF A;  5C0X I;  4M8A A;  4HMI A;  3K57 A;  1R4Q B;  3EBE A;  1SYC A;  3HOW G;  5C44 G;  1X6O A;  1SE2 A;  1RL2 A;  3K81 C;  3OTO Q;  3DUZ A;  5HGQ A;  1IBK L;  5C5M A;  5ISR A;  4JI3 Q;  4R1J A;  2M9V A;  3NK9 A;  2G5D A;  1E2V A;  1Q8K A;  1PRT C;  2PMZ B;  2VW9 A;  3ICE A;  5DLQ E;  2I5L X;  3IKJ A;  4C1N K;  4DV4 L;  4LF6 L;  1BBU A;  4G7O C;  3S15 H;  1S5F D;  1IW7 D;  1K9M C;  2D9U A;  2C9O A;  1YNJ D;  5FLX E;  4G7Z C;  2F0Q A;  1Q8I A;  1Z7T A;  1BOS A;  1IBK Q;  2E2H H;  1F77 A;  1VQK A;  1K3B C;  1SND A;  1GUO A;  4U67 3;  5C4J B;  4ZK9 B;  1S72 A;  1VQM A;  1VS0 A;  1PVO A;  3T1Y L;  2KEC A;  4NB3 A;  4LMQ D;  5CMD A;  1IZ6 A;  1X32 A;  1K73 C;  2K1B A;  4KV6 A;  1HA5 A;  3GD7 A;  1F9S A;  3PV0 A;  1H9J A;  2QIL A;  1V9P A;  3I70 A;  3HOV G;  3SVM A;  3D3R A;  2E2J H;  3J81 L;  1SLJ A;  2HDM A;  3TZU A;  1VQC A;  3L2P A;  1KRT A;  1G2S A;  5LL6 S;  1XMO L;  4BA2 I;  1I4X A;  2LS0 1;  3NEL A;  3CCQ A;  4OEM B;  4DAY B;  1VQJ A;  1LM0 A;  3G71 A;  2JA7 G;  4EVO A;  5IP7 H;  2CVR A;  1S40 A;  5I6W A;  2WB1 B;  1ASZ A;  5J3B A;  1CKO A;  1QUQ B;  4DK6 C;  4C2M B;  3Q8D A;  1YJ9 A;  1XMO Q;  5BN3 A;  2YTX A;  4ZLT F;  4X3T A;  5CC4 A;  4NXM L;  1EY6 A;  4P75 A;  1PH4 A;  5M3F H;  4JBJ A;  3FP9 A;  5IYB G;  3NP8 A;  5I2X A;  3F2B A;  4DR2 L;  2MHV A;  4GNX C;  3GTO B;  2X6G A;  3I2Z A;  1I6V C;  3M3Y B;  5M9O A;  4NXM Q;  3PO3 H;  1DXM A;  3DWA A;  4X66 Q;  2ICE C;  1PH3 A;  4LUV A;  1K3R A;  5C4X G;  3KOJ A;  3LX0 A;  1ET6 A;  2OQK A;  1O7I A;  3KF6 A;  4F8M A;  2LFN A;  2O5I C;  1JQY D;  4IUT A;  4WRD A;  3MAQ A;  2Y0S B;  3KDF A;  1SBB B;  4JI2 Q;  4K5W A;  1I5F A;  1LTI D;  4BWG B;  4B3R L;  1CHP D;  1QZG A;  1FNU A;  4FF4 A;  4IUR A;  2B63 G;  4JI7 L;  4LFB L;  1PZJ D;  4A3K H;  5ELC A;  4LFC L;  1ENC A;  3FDT A;  2R7Z G;  4V0B A;  4DV5 Q;  3VR3 A;  4EX5 A;  1D1I A;  4MN3 A;  2ZXO A;  1JE5 A;  1S5E D;  3S16 B;  5M3M G;  4XQN A;  4A3M H;  1A3V A;  2F0G A;  4O0A A;  1ET9 A;  3HEJ A;  1I6H H;  2RKS A;  1OXV A;  3K80 C;  2L4N A;  4OEL B;  2TMP A;  1V1P B;  2BH2 A;  5A2Q L;  1DJR D;  1GVP A;  3CQZ H;  3D0F A;  1EEI D;  4R4C A;  4RKL A;  1XWE A;  2NN6 G;  1WJJ A;  5D3I B;  1D2B A;  5CV8 A;  1Y8P B;  3J81 c;  4I65 A;  2OCE A;  4IUN A;  1SMY D;  1WCM H;  4KI0 A;  3P7J A;  2BE5 D;  1G29 1;  4DUY L;  1I4Q A;  2PNR C;  3SDZ A;  4BY1 G;  5BN4 A;  2ZM6 L;  4FO2 A;  1WD0 A;  5IT9 L;  1I94 L;  1J9O A;  4ABN A;  2E2H B;  4BY7 G;  2KCN A;  4QUC A;  1IL2 A;  2F52 A;  1WTV A;  3S14 H;  2ZXR A;  1NMG A;  3J80 L;  1HRJ A;  1YNN C;  1PRT B;  4OO1 G;  1UEB A;  3CCR A;  4DUY Q;  4HIO A;  3H0G H;  1H9R A;  3T53 B;  4UY8 C;  1WFQ A;  2L9H A;  1PHJ A;  3KLS A;  1S4Z A;  4HJA A;  2B8F A;  3R3O A;  4YCU A;  4CDC C;  2DY8 A;  1JMC A;  1S5B D;  1SNC A;  1UE5 A;  2EY5 A;  5D65 A;  1HCZ A;  3KYH C;  1RHP A;  3CMA A;  1BCP D;  1C9O A;  4LUO A;  3VR2 A;  4TSS A;  3U4Z A;  4A3D H;  3U4V A;  1XNQ L;  4IFD H;  3FPU B;  4UP8 A;  2X6L A;  1BVS A;  1SXT A;  4PMB A;  2DNE A;  2K5N A;  4K5V A;  2KCT A;  4DK1 A;  2E2I H;  2XWJ B;  2JE6 I;  5M3F B;  5CR3 A;  3F8T A;  2NB0 A;  1VQG A;  1HHV A;  2EJG C;  1SAP A;  2QDL A;  1NUC A;  5M5Y H;  3I73 A;  2PCF B;  3DEP A;  1TR5 A;  2PI2 A;  4A93 H;  1LO5 D;  4YY3 Q;  4DUZ Q;  3PO3 B;  1W3S A;  4UDU C;  1JJG A;  4R8N A;  5KRU A;  1SNM A;  3NE5 B;  4FXG C;  3PUY A;  4X6A H;  1ZYR C;  1PTO C;  4GNX B;  1O78 A;  3HOY G;  3HOW H;  2Z6K A;  2F0I A;  1U9R A;  3TBI B;  4JI0 L;  4L5T A;  4R4I A;  3SK4 A;  3HKZ E;  2AKW B;  1CZW A;  3BZD B;  1N32 L;  5IWA L;  3J7Z C;  2XTI A;  1P8L A;  3I4N G;  1CSP A;  1TQO A;  2A19 A;  5M5X H;  4L5S A;  1IYU A;  1F9Q A;  3S1Q H;  2F1M A;  1RKN A;  4A3K B;  1RIP A;  4EGV A;  3KJO A;  2NZO A;  2ZTC A;  5IGC A;  3RD4 A;  3V96 A;  1PH6 A;  3FPP A;  2VZA A;  1O7Y A;  4DNT B;  2VQE L;  3L7Z C;  5I9O A;  2IX0 A;  3CCV A;  3K0X A;  5IT9 c;  4C3I B;  2PQA A;  3W1B A;  3JAM E;  1B7Y B;  2SNS A;  3H15 A;  1I6H B;  4EQN A;  1WOC A;  1E22 A;  2F3W A;  3J80 c;  3G7L A;  4R4O A;  3CCE A;  4Y7N H;  3OMC A;  5I9P A;  2KBN A;  2B2T C;  3CQZ B;  3HOV H;  1B2T A;  1OXX K;  4DR6 L;  3SR1 A;  2EYJ A;  2OT2 A;  3PF5 A;  2ES2 A;  1TWC B;  4DR7 L;  1HFN A;  5JJL A;  2L0C A;  4NPS A;  1CQV A;  1X65 A;  5DM6 3;  4RG1 A;  4B3S L;  1HNW L;  1WCM B;  4EQ5 A;  4AIM A;  3K8A A;  2IHF A;  1TII D;  4PMC A;  2JA7 H;  3A7A B;  3MXG A;  5IYC G;  1QVF A;  4AYB E;  3SHL A;  2EXD A;  4TQU S;  4DAY A;  2DJG C;  1XPO A;  1OXU A;  4JI1 L;  5BR8 L;  1XYI A;  1NE3 A;  2WII B;  4B3S Q;  2NVX B;  4TKO B;  1QUQ A;  1LTB D;  3QR8 A;  1JC7 A;  1W2B A;  4B3M L;  2KED A;  5IYB H;  4LF5 L;  1TS5 A;  3C1F A;  1K83 H;  1VQB A;  4JYA L;  4JI6 Q;  2A74 C;  3BG3 A;  4U68 A;  4WOR A;  1STN A;  4BA1 I;  3NQT A;  2ID0 A;  2IW3 A;  1Q86 C;  2K4K A;  2A6H D;  5C4X H;  1SMX A;  4KN4 C;  3AU7 A;  3NQI A;  5IGE A;  1AEX A;  1TWA B;  2EY6 A;  3S2D B;  4JOI A;  3KF8 B;  4R9W A;  4G7H C;  2F0T A;  4YHH L;  2NVQ H;  2K14 A;  3RR5 A;  1JOR A;  4KKS A;  2CW0 C;  5JJI A;  1A15 A;  3GTM H;  2DN8 A;  2E2I B;  3QOL A;  3K7A B;  4DR1 L;  2B63 H;  2F0E A;  1LTT D;  3D31 A;  4JVZ A;  1KLG D;  4DA2 A;  5M5Y B;  4YHH Q;  2EDG A;  3CC4 A;  2B2W A;  4DNI A;  4NDX A;  3ONA B;  4H13 C;  4CDE C;  2R7Z H;  1J5E L;  3RUZ A;  4A93 B;  4LF7 L;  2A8V A;  4UP9 A;  2F0O A;  5E3F A;  2FJ2 A;  1OXS C;  2XVS A;  5M3M H;  3KLS X;  1WVL A;  3NWT A;  3OIP A;  1U5K A;  5M5W H;  3HOW B;  2XGT A;  4HMJ A;  5C44 B;  4OXP A;  3KK7 A;  4KMU C;  2VXW A;  1B4O A;  4PZ7 A;  3FEW X;  3CRL C;  1N34 Q;  3CU7 A;  2JA5 B;  2NN6 H;  5M5X B;  3S1Q B;  5KYL A;  1PTO B;  3CCS A;  3F2D A;  1BQQ T;  2UUB L;  2E8G A;  3MXP A;  1PRT F;  3BJU A;  1X3F A;  4IFD I;  1CUK A;  4BY1 H;  3GTL H;  5KYI A;  2HDL A;  4BY7 H;  1BNZ A;  2FHT A;  4MHE A;  4X64 L;  4X62 Q;  2UUB Q;  4OO1 H;  2SOB A;  1BCP B;  3KUP A;  4Y7N B;  2DGY A;  3U50 C;  2YV5 A;  4HSP A;  4RGO S;  4DV3 Q;  1GUG A;  2D2C C;  1GHK A;  3P20 A;  4KD4 A;  1K0S A;  4X64 Q;  1O7Z A;  1Q90 A;  3NSW A;  4HSV A;  2JA6 B;  3AQQ A;  2Z6K C;  4P74 A;  1IHZ A;  4B08 A;  2NWG A;  1YHB A;  2JA7 B;  5CGK A;  4NKL A;  3J7Y W;  2DY7 A;  1LAB A;  1HUN A;  1RD9 D;  4HID A;  4V19 0;  1WTQ A;  2LMC B;  4GKJ Q;  1O80 A;  4L5Q A;  4OIK A;  5JEA J;  1L0X B;  3D4W A;  2FXQ A;  5JPN C;  5COR A;  3E9H A;  4FVM A;  3F1Z A;  4R8I A;  3CAM A;  1U4P A;  1SE4 A;  4LW1 A;  1JOK A;  3PGZ A;  2PI2 E;  4JBK A;  5C4J H;  2IPK D;  4DV2 L;  2GA4 B;  2RF4 A;  4C3I G;  2N3S A;  4CKB A;  3K7U C;  1E1T A;  1A6X A;  4A4I A;  1HTP A;  3PMF A;  1DM0 B;  4WJW A;  1MD2 D;  3T56 B;  4JCV E;  2Z4H A;  3HOY H;  4H02 A;  2N8N A;  1T5E A;  1TXY A;  2ZTE A;  5LMU L;  3TP6 A;  2PW5 A;  4KY6 A;  2L55 A;  4IPD A;  2L5T A;  4DFA A;  4HCE A;  3GTM B;  3I4N H;  3STB D;  1PYS B;  2K5D A;  2N55 A;  4DR5 L;  1FJG L;  1DOM A;  2KHJ A;  1STB A;  2B63 B;  1QG7 A;  2MFI A;  5FO8 B;  3UI2 A;  1NR4 A;  5LMU Q;  2PMZ E;  3R93 A;  2AQ2 B;  2J4X A;  4KHP L;  2F0U A;  4A3E B;  2EPB A;  3I91 A;  2N78 A;  4J15 A;  1FJG Q;  2ASB A;  3EFX D;  3GP7 A;  5M3M B;  1D5Z C;  1KIX A;  2JK8 A;  3GTO H;  1Q12 A;  2RHS B;  1STH A;  3NBH A;  4E6I A;  1N9W A;  5M5W B;  2G9D A;  3I4M G;  2FMM A;  3P75 A;  3M3Y H;  2NVY H;  1M4V A;  4A3I B;  1L1O B;  4K8I A;  2KHI A;  1IBL L;  4C3H B;  1PRT D;  2ZXP A;  2C5C A;  1AE2 A;  2B2V A;  3UDG A;  4JOI C;  2B2Y A;  4QB4 A;  1HNX L;  5FJ8 G;  3CHB D;  3ZJY C;  1YJW A;  1Y69 U;  2F4V L;  3UE0 A;  1SYE A;  5J22 A;  2VUM B;  1RTO A;  4N8F A;  2ZT9 C;  3HG9 A;  1IBL Q;  5IYC H;  3BVM A;  3CF5 A;  5A35 A;  2E75 C;  1MKH A;  2EVB A;  3GTL B;  1JOQ A;  1BKB A;  4CJ2 C;  4LAA A;  4BY7 B;  1HNX Q;  2F4V Q;  4GOP B;  2WB1 E;  2L12 A;  1GUW A;  4F88 A;  1EFW A;  2JA8 G;  4LFA L;  3MWY W;  4DK3 C;  2B2U A;  4JI5 L;  2KEN A;  4AH6 A;  3DEO A;  4DV1 L;  3HGB A;  3NTH A;  3URY A;  4FF1 A;  3QIA A;  2Q8I B;  3E9I A;  3QWN A;  2PQE A;  3NBI A;  1BUV T;  2QDB A;  1TY2 A;  1G8Z D;  4MZ9 A;  5C4H A;  1SNQ A;  1KRS A;  2AMC B;  3TEH B;  4QGU A;  4ME3 A;  2OTL A;  4JV5 L;  1Y8O B;  2AHO B;  1QE6 A;  1SR3 A;  4OWX B;  3NUC A;  4K0K L;  1B53 A;  1IYJ B;  1JWU D;  3VR4 A;  4KLK A;  2D0P A;  1I3Q H;  1N36 L;  2RBM A;  5C6A A;  5CV7 A;  4A3L G;  1FGU A;  2JA5 G;  1GUS A;  3KF8 A;  4IPG A;  4CKE A;  5F2D A;  2AUJ D;  2NN6 I;  4QF4 A;  1KHI A;  2Y0S E;  4CBV A;  1SYD A;  3TRZ A;  1G2T A;  5EKL A;  1LAC A;  3EA6 A;  5I4D A;  1N36 Q;  4LNQ A;  1AZQ A;  2OF1 A;  3J7A V;  1II3 A;  4DK0 A;  1STA A;  5IYD G;  1LV9 A;  4DV4 Q;  4LF6 Q;  3MVV A;  4H0L C;  1IL8 A;  1CT1 D;  2NZ1 D;  1EIF A;  3RLF A;  4NW2 A;  4OO1 I;  4L5R C;  1I4P A;  4S3S A;  1G91 A;  3HOY B;  1WTR A;  1X3P A;  1HXY D;  3DM1 A;  2F0K A;  3FKI G;  5JJK A;  2JA6 G;  1NTG A;  3T1Y Q;  2A68 C;  4FDB A;  1PH5 A;  1VQ5 A;  1TU2 B;  3I4N B;  1LTS D;  3MA2 B;  4BBR G;  5G3L D;  1PFN A;  1X54 A;  1QOH A;  2UUC L;  3OPO A;  3M4O H;  2PO4 A;  3BU2 A;  2UXD L;  2AQ1 B;  2K04 A;  1FNW A;  4HJ5 A;  1BCP F;  1EQT A;  4CHT B;  1D7Q A;  1G6Z A;  4RGM A;  3TN2 A;  3NWS A;  3H3V C;  4DR3 L;  1CKN A;  3K0Y A;  4A75 A;  1AH9 A;  4JI8 L;  1VQI A;  3SK5 A;  3J81 E;  2NVY B;  4X65 L;  1EL0 A;  1HQR D;  2WP8 J;  3V2T A;  1KAA A;  1XTD A;  5T1G A;  3BDC A;  4JI4 L;  3VYT A;  1G6P A;  1LT5 D;  4DR2 Q;  1ENA A;  3M7G A;  4ZAI A;  5JEA G;  4QUF A;  2O5J C;  1A3U A;  3N6R A;  4DV0 L;  2R93 B;  2Z4I A;  4G57 A;  5HY6 A;  4A3B G;  1YNN D;  3PIO 3;  2L1B A;  4AQY L;  1HNZ L;  2CWP A;  3U9S A;  1DCZ A;  3NTK A;  1FGB D;  4I7Z C;  3HP3 A;  3QG1 A;  1EFI D;  4DNR B;  4O42 A;  3RLO A;  3PIP 3;  1B9N A;  2RQX A;  3OWF A;  2CCZ A;  2FFK B;  4K2K A;  4A3E G;  1JR0 D;  4B3R Q;  4X3K A;  1ILQ A;  3VYU A;  4JI7 Q;  4LFB Q;  3RZO B;  4C3I H;  1E3P A;  3PO2 B;  2QA4 A;  4FP5 D;  1B50 A;  4LFC Q;  4LK1 C;  4XQQ A;  3VA5 A;  4Q5V A;  3L0O A;  2QW7 A;  4A3I G;  1SN8 A;  1SFO B;  2EOT A;  4PZ8 A;  2V4D A;  1I3Q B;  4C3H G;  4POF A;  1X3G A;  3A56 A;  3UE1 A;  2Q8T A;  1TWC H;  5C0X G;  3KFU A;  5C3E G;  4WJ3 M;  4HED A;  1GOZ A;  2NTT A;  2RVL A;  1MGS A;  2VUM G;  1AN8 A;  2MO0 A;  1HFG A;  1B3A A;  4HR7 B;  5DEH A;  1ICF B;  1LTR D;  1FR3 A;  2Q2I A;  4O1N A;  4RH6 A;  1ZEQ X;  1AW7 A;  2WAQ G;  3TRE A;  2A1A A;  2HT1 A;  4HCS A;  1VQ6 A;  3DM3 A;  2NVX H;  1JOO A;  1XMQ L;  1E24 A;  2CFM A;  1ZYR D;  1PTO D;  2NYZ D;  1SNO A;  1A3T A;  4UPA A;  2YYZ A;  4ULL A;  5A2Q E;  1XTC D;  2F0S A;  2ZM6 Q;  4KKT A;  3EVQ A;  1XX8 A;  3AMU A;  3I3C A;  3I4M H;  1VQ7 A;  5EKI A;  1G51 A;  3NXW A;  3H91 A;  1XMQ Q;  1SNP A;  1MSG A;  1QVC A;  1JB7 A;  2JP1 A;  2PZT A;  3Q6S A;  1VQP A;  1L1O A;  5C5L A;  2H1E A;  1TWA H;  4MIU A;  4IUP A;  5FJ8 H;  3G48 A;  4KTA A;  3S2D H;  1R4P B;  1TT2 A;  3M4O B;  5IT9 E;  1U4R A;  3VYR A;  3I72 A;  2QKI C;  2K52 A;  3SK8 A;  1DOL A;  1GJX A;  3J80 E;  2FIN B;  2UU9 L;  1ROD A;  1EY7 A;  1VMP A;  1TVX A;  4RCN A;  1EQQ A;  1CK1 A;  2VQF L;  1T9H A;  4R4Q A;  3MFG A;  5K36 G;  3K7A H;  4PG3 A;  2D0O A;  3D6C A;  1ENF A;  1D5M C;  1EY8 A;  2AWO A;  1HZ9 A;  1XNQ Q;  1K0R A;  4GOP A;  4WJ4 A;  2UU9 Q;  3A5Z B;  2J0T D;  1K8O A;  5FLM G;  1JWS D;  2O4X A;  2EYH A;  1PA6 A;  4K2L A;  2RA4 A;  4QY7 A;  3HS0 C;  3J7A 5;  3DXJ C;  1KQS A;  3A54 A;  4B3T L;  2WAC A;  5C3X A;  1A63 A;  1BDO A;  1AZP A;  1O7L A;  5C44 H;  1RCV D;  1D5X C;  4YWM A;  1PH7 A;  1W6K A;  2EE1 A;  2X69 A;  3PUZ A;  1B9M A;  1YVC A;  1VQ9 A;  1UEA B;  2YTY A;  3H94 A;  4A3L H;  1EWH A;  4JBW A;  1Q81 C;  2JA5 H;  4XYO A;  3OHX C;  2EJM A;  3OYY A;  2KVM A;  3BYT B;  4B3T Q;  1PTO H;  2WFW A;  4DR4 L;  2A6E C;  2HQE A;  4JI0 Q;  2K5H A;  1N8R C;  2RCF A;  3GTQ B;  1AP0 A;  3E3X A;  1EZ6 A;  5IWA Q;  1H9S B;  1N32 Q;  2VB3 X;  4MTN A;  1LUZ A;  3ERS X;  5IYD H;  2UXB L;  4CDD C;  3RMH A;  1EQV A;  1Y8N B;  5HGT A;  2PW7 A;  1E2W A;  4Z9C B;  2K75 A;  1SEB D;  1NJI C;  3GDE A;  2Z0S A;  1SE8 A;  2VQE Q;  1TWH B;  4LF4 L;  1LT3 D;  1NMF A;  3MXN B;  2CW0 D;  3FKI H;  2JA6 H;  3CD6 A;  3GTG B;  1BXT A;  3TZD A;  3AB9 A;  4OWW B;  2KOL A;  1KNA A;  1EU3 A;  4BBR H;  2I5H A;  4C56 C;  1WTX A;  3IFD A;  3HOU G;  2QEJ C;  4KY7 A;  2R93 G;  3D6W A;  3OMG A;  2JA9 A;  4MTK A;  4C3J G;  1C48 A;  2XRS D;  2YU9 B;  4DR6 Q;  1HZB A;  4DR7 Q;  4A3C G;  1A62 A;  2CQO A;  2K5Q A;  4DV6 L;  1SSO A;  5GRO A;  2XN9 C;  1HNW Q;  5CBA E;  2IY5 B;  1BO0 A;  5FO7 B;  1SJH D;  3S17 H;  2E74 C;  1EZ8 A;  3I4L A;  3IAY A;  4ZKC B;  1E0B A;  1D8L A;  1WI5 A;  4JI1 Q;  5BR8 Q;  1EY5 A;  3I4M B;  1CA6 A;  1UUP A;  1EU4 A;  5KGU A;  1YI2 A;  3PO2 G;  2F0M A;  4B3M Q;  4J8Q A;  2K03 A;  2EYM A;  3FMC A;  4LF5 Q;  5IE8 A;  3HOZ B;  4JYA Q;  1EYA A;  3TME A;  5JEA H;  1RF2 D;  5JAV A;  5CV9 A;  1PFM A;  1Q82 C;  1PXU A;  5LL6 X;  1Y1W G;  2ZTD A;  3BS1 A;  1B44 D;  2D62 A;  1H9K A;  1HH2 P;  4A3B H;  4IOA A;  5LMN L;  1KTK A;  2EQS A;  4IO9 A;  1STY A;  3K59 A;  4RMF A;  1Q1B A;  1BF4 A;  2Q2T A;  2JA8 B;  4EQO A;  2EIF A;  4OON A;  2Z6B A;  2EYF A;  3R2T A;  4A3E H;  1WYD A;  4X3U A;  2J7Z A;  4DN4 M;  5I2Y A;  4IJL A;  4FYD A;  4ZKB B;  4DR1 Q;  1EY0 A;  3T4A C;  1A2T A;  2XRQ D;  3G6E A;  2F03 A;  2IX3 A;  2I46 A;  2XWB B;  4XIG S;  1ONL A;  3AEV A;  1J5E Q;  4P71 A;  3S2H B;  5E4W C;  4HTH A;  3QO2 A;  4LF7 Q;  4RWS C;  4A3I H;  1N33 L;  5ELE A;  1BBW A;  3M4P A;  2UXC L;  1V1P A;  2ALY B;  2F0L A;  4P2C B;  4C3H H;  3R2I A;  3OW2 A;  1HTL D;  1D1K A;  1EEF D;  2EJF C;  3ERO A;  1QVG A;  1HUM A;  1RJT A;  4N8X 1;  5H1S E;  2VUM H;  1N33 Q;  1L0W A;  1CHQ D;  2OEO A;  3SGI A;  2F0H A;  4CJ1 B;  2CH4 W;  3K5O A;  3ULJ A;  2GVA A;  2ZJQ A;  4ZYS A;  4FXD A;  2I5M X;  1V1Q A;  1JJ2 A;  2JN4 A;  1F2L A;  3WWV A;  2UUA L;  3I8Z A;  1IXR A;  1GKH A;  1V43 A;  4A76 A;  3MTS A;  3PUV A;  5TSS A;  5IP7 G;  3MZ5 A;  1JCK B;  1TS3 A;  2D5D A;  2EY1 A;  2F3V A;  4BS9 A;  5C4Z A;  1SRO A;  4GN4 B;  1NY4 A;  3W2D A;  3FKI B;  2BA1 A;  3E6Z X;  2UUA Q;  3AFP A;  1HJP A;  3S1N H;  2ZJP A;  3M4Y A;  4DAP A;  1TWG H;  2HIX A;  1IYV A;  4BBR B;  3A8K E;  3G4S A;  1I50 H;  4YWK A;  1YJN A;  2EYL A;  2R3Z A;  3N52 A;  4IPC A;  3Q24 A;  3JAM i;  1EWI A;  4KK7 A;  3BVG A;  1KAW A;  2CQA A;  1F9R A;  2WV6 D;  4ALP A;  1HA6 A;  3PUW A;  3M9B A;  5K36 H;  3S17 B;  1W6J A;  3KDF B;  4DV7 L;  1TWF H;  2KEE A;  3CRK C;  4F87 A;  4IPH A;  3RNU A;  2BOS A;  5ELD A;  1FVI A;  4K6L A;  2F4I A;  4RCO A;  3ZYY X;  3J7A F;  4KD3 A;  2B8G A;  4ZUI A; 
#chains in the Genus database with same CATH homology
 1IL2 A;  2QEX A;  2F52 A;  4LF8 L;  3S14 H;  1XNR L;  4IFD J;  1NMG A;  5FLM H;  1UWV A;  4OO1 G;  2LSS A;  1UEB A;  1EIF A;  1A0I A;  4OWT B;  3CCR A;  4DUY Q;  3RLF A;  4HIO A;  3H0G H;  2E5L Q;  4OO1 I;  4L5R C;  3MEF A;  4UY8 C;  3S1R H;  1WFQ A;  2JQO A;  4DV2 Q;  1PHJ A;  3FKI G;  4GNX A;  1XNR Q;  5JJK A;  4LF9 L;  4HJA A;  2JA6 G;  4PZ6 A;  4IOC A;  1K8G A;  1NTG A;  3BZK A;  3T1Y Q;  4FDB A;  3KJP A;  4YCU A;  1PH5 A;  1VQ5 A;  1AE3 A;  1YNX A;  4A3M G;  1HR0 L;  1JMC A;  1UE5 A;  4BBR G;  3AFQ A;  4PMW A;  1X54 A;  3KYH C;  1VQ4 A;  3CMA A;  5C0X J;  3ER0 A;  2UUC L;  1C9O A;  3M4O H;  4LUO A;  4OX9 L;  1YEZ A;  3U4Z A;  1YZ6 A;  3BU2 A;  3GTP H;  4A3D H;  2UXD L;  3U4V A;  1XNQ L;  1Z9F A;  1YIJ A;  3JAM c;  4UP8 A;  1BVS A;  2Q2H A;  4HJ5 A;  5LMN Q;  3CCM A;  3S1M H;  2K5N A;  4DR5 Q;  3T1H L;  1D7Q A;  2KCT A;  2E2I H;  1XPU A;  3HFZ B;  3W1G A;  2JE6 I;  3E0E A;  2MO1 A;  3F8T A;  1VQG A;  2BA0 A;  3S24 A;  4OX9 Q;  5M5Y H;  4DR3 L;  1CKN A;  1YIT A;  4A75 A;  2HHH L;  1SRU A;  1AH9 A;  4JI8 L;  4GKK L;  4KHP Q;  1VQI A;  1C7Y A;  3J80 i;  5GAG C;  4X65 L;  2WP8 J;  1L1O C;  1S3O A;  2F3I A;  2PI2 A;  4A93 H;  1XTD A;  4YY3 Q;  4DUZ Q;  4JI4 L;  2B3G A;  1W3S A;  3F2C A;  4DR2 Q;  1JJG A;  1MIU A;  3HOZ G;  1G6P A;  5C3E H;  1PH2 A;  2LXK A;  3TS0 A;  3PUY A;  3H0G G;  3UDF A;  4GKK Q;  4X6A H;  1N34 L;  5JEA G;  3JC6 6;  4GNX B;  2OTJ A;  2UXC Q;  1UE7 A;  2LXJ A;  1X55 A;  1PH8 A;  3HOY G;  2R93 H;  1CSQ A;  3HKS A;  5ELN A;  4DV0 L;  2Z6K A;  3HOW H;  4JI0 L;  4C3J H;  4L5T A;  4R4I A;  5HY6 A;  4P72 A;  1EQR A;  3HKZ E;  2AKW B;  2V1C C;  3M4Q A;  3GTK H;  4A3B G;  4XTC S;  1Y14 B;  2JEA I;  4A3C H;  5IWA L;  3J7Z C;  2XTI A;  1VQE A;  1P8L A;  4JC0 A;  3CC2 A;  3I4N G;  1CSP A;  1C0A A;  4AQY L;  3HKZ G;  2A19 A;  1HNZ L;  2K5V A;  5M5X H;  4GOP C;  1GM5 A;  4L5S A;  2CWP A;  3S1Q H;  3S1N H;  1K8A C;  3EN2 A;  1RIP A;  4X62 L;  3RLO A;  3W5O A;  3KJO A;  2CCZ A;  4POG A;  2NZO A;  2ZTC A;  3GO5 A;  4A3E G;  2Q2U A;  2OQ0 A;  3TS2 A;  1PH6 A;  4B3R Q;  1J6Q A;  2R7D A;  2VZA A;  3RZO H;  5AJ3 L;  4JI7 Q;  4MNO A;  2B29 A;  1CKN B;  3L7Z C;  2IX0 A;  2VQE L;  3K0X A;  3CCV A;  5ELO A;  3UDI A;  2C35 B;  1E3P A;  4C3I H;  5M3F G;  3PO2 H;  4LFA Q;  5IT9 c;  2QA4 A;  2PQA A;  3W1B A;  2JJQ A;  4LFC Q;  1B7Y B;  1H95 A;  4JI5 Q;  3H15 A;  5E7N A;  3L0O A;  1WOC A;  1E22 A;  4DV1 Q;  1SFO H;  4Y52 H;  3J80 c;  4R4O A;  1SN8 A;  3CCE A;  4Y7N H;  4A3I G;  2NVT H;  4PZ8 A;  2KBN A;  3RN2 A;  3HOV H;  5AJ3 Q;  3PO3 G;  3CPF A;  4POF A;  4JV5 Q;  1OXX K;  1X3G A;  4DR6 L;  3OTO L;  3UE1 A;  3CP0 A;  3CPW A;  1TWC H;  5C0X G;  3PF5 A;  3KFU A;  2ES2 A;  5C3E G;  4GKJ L;  4A3J G;  4DR7 L;  4WJ3 M;  4GN3 B;  3KF6 B;  4JI3 L;  5JJL A;  4K0K Q;  4NPS A;  1Q46 A;  2VUM G;  4BXX H;  1X65 A;  2MO0 A;  4RG1 A;  4B3S L;  4EQ5 A;  1HNW L;  1HR0 W;  4AIM A;  2WAQ E;  3K8A A;  2IHF A;  3B6Y A;  2JA7 H;  2Q2I A;  1HZC A;  2R7F A;  5IYC G;  2IHE A;  1QVF A;  4GS3 A;  3A5U A;  1VQN A;  3HOX H;  2QGQ A;  4AYB E;  4DV3 L;  4HJ9 A;  2WAQ G;  3TRE A;  2A1A A;  1Z47 A;  2EXD A;  4TQU S;  1XPO A;  2HT1 A;  1OXU A;  4JG2 A;  4JI1 L;  5BR8 L;  1Q7Y C;  1VQ6 A;  3I56 A;  1NE3 A;  3DM3 A;  3RLN A;  4AYB G;  2NVX H;  4B3S Q;  1X3E A;  1XMQ L;  4DV7 Q;  1E24 A;  1QUQ A;  2CFM A;  3A74 A;  1W2B A;  1EYG A;  4B3M L;  4A3K G;  4UPA A;  2YYZ A;  1KC8 C;  2HIV A;  5IYB H;  1NBW A;  4LF5 L;  2ZM6 Q;  4A3G H;  1K83 H;  1VQB A;  4JYA L;  3RN5 A;  4JI6 Q;  3I4M H;  3UDX A;  1VQ7 A;  1I94 Q;  1G51 A;  3NEM A;  2PQA B;  4LF8 Q;  1PH9 A;  2YTV A;  4P73 A;  1EUJ A;  4BA1 I;  1XMQ Q;  1QVC A;  2ATW A;  1IBM L;  1JB7 A;  2ID0 A;  1Q86 C;  4GLA C;  1VQP A;  1L1O A;  1VQD A;  2K4K A;  3PIO A;  5C4X H;  1SMX A;  1TWA H;  5FJ8 H;  4BBS H;  2BH8 A;  3G48 A;  3I4N H;  3S2D H;  2RCN A;  2PNH A;  2R6G A;  4JOI A;  3KF8 B;  3RZD H;  3ULL A;  4LF9 Q;  2R92 H;  4YHH L;  5GAH C;  2NVQ H;  1VQL A;  1MJC A;  4NXN L;  3PIP A;  2K52 A;  4YCW A;  4LUZ A;  1IBM Q;  1UE1 A;  1HR0 Q;  3PCO B;  2K14 A;  3PUX A;  2UU9 L;  3RR5 A;  1EQQ A;  5JJI A;  2VQF L;  1T9H A;  4R4Q A;  3GTM H;  5K36 G;  3K7A H;  1WCM G;  4PG3 A;  2UUC Q;  2D0O A;  4DR1 L;  2B63 H;  1JJC B;  1E7Z A;  2AWO A;  3D31 A;  1HZ9 A;  2UXD Q;  2CWA A;  4YHH Q;  3CC4 A;  1DGS A;  1XNQ Q;  1LTL A;  2NZH A;  1K0R A;  3I4O A;  4DNI A;  3CC7 A;  4NXN Q;  1PYB A;  4GOP A;  1L2F A;  4WJ4 A;  2R7Z H;  4C2M H;  1EOV A;  1Y1V G;  3T1H Q;  1J5E L;  2UU9 Q;  1YHA A;  1B8A A;  3A5Z B;  3AYH B;  4UP9 A;  4LF7 L;  2A8V A;  2OWO A;  1FL0 A;  1OXS C;  5FLM G;  4LF6 Q;  4QIW E;  4A3F H;  3I55 A;  4DR3 Q;  5IP9 H;  1PA6 A;  2HHH Q;  4O2D A;  1GO3 E;  1HZA A;  2JEB I;  3CW2 C;  4JI8 Q;  4X66 L;  4QY7 A;  5M3M H;  4JBM A;  3H3V H;  3J7A 5;  2MNA A;  3HOU H;  1KQS A;  4X65 Q;  4B3T L;  1U5K A;  5M5W H;  1A63 A;  2HQL A;  1Q1E A;  5C44 H;  2XGT A;  1ASY A;  4YWM A;  4APV A;  1PH7 A;  4JI4 Q;  3PUZ A;  4OXP A;  1YVC A;  1VQ9 A;  2YTY A;  4A3L H;  4JBW A;  4PZ7 A;  1Q81 C;  5FLX c;  1N34 Q;  2JA5 H;  1E1O A;  4JI2 L;  3OYY A;  4HJ7 A;  4B3T Q;  1VCI A;  4HIM A;  4DV0 Q;  2WFW A;  1VQF A;  3CCS A;  3IRB A;  4UP7 A;  4DR4 L;  4JI0 Q;  2DUD A;  3F2D A;  2K5H A;  1N8R C;  3EIV A;  2UUB L;  2E8G A;  3GTQ H;  4A3D G;  1CKM A;  4IFD G;  1LYL A;  3BJU A;  1X3F A;  3LGJ A;  1N32 Q;  5IWA Q;  2H5X A;  1CUK A;  4DAM A;  3DLL A;  4BY1 H;  3GTL H;  4IFD I;  4AQY Q;  1HNZ Q;  4MTN A;  1LUZ A;  2MQH A;  3ERS X;  3M7N A;  2RHQ B;  4DV5 L;  4BY7 H;  5IYD H;  1OTC A;  2ZJR A;  2UXB L;  4X64 L;  3FHW A;  5GAE C;  1OXT A;  4X62 Q;  1U0L A;  3STB C;  2UUB Q;  2K75 A;  2IT1 A;  1NJI C;  2AWN A;  2GVB A;  3GDE A;  3M85 A;  1UE6 A;  2DGY A;  2Z0S A;  3U50 C;  1TWH H;  1SE8 A;  3GTJ H;  4A93 G;  2YV5 A;  4HJ8 A;  2VQE Q;  4DV3 Q;  1M90 C;  1Y1W H;  4LF4 L;  3ULP A;  1NMF A;  3KLW A;  3NEN A;  3MXN B;  3FKI H;  4X64 Q;  2VS1 A;  3S16 H;  2JA6 H;  1N32 L;  3CD6 A;  3GTG H;  5C0X I;  4GKJ Q;  3AQQ A;  2Z6K C;  4P74 A;  4OWW B;  3HOU G;  4BBR H;  2I5H A;  3EBE A;  4DPG A;  2R93 G;  1M1K C;  4IJH A;  3HOW G;  1YHB A;  5C44 G;  1X6O A;  1RL2 A;  2JA9 A;  4KHZ A;  2YU9 H;  3K81 C;  4DR6 Q;  4TVA B;  3OTO Q;  5HGQ A;  4HID A;  1IBK L;  1HZB A;  4DR7 Q;  4L5Q A;  4YCV A;  5JEA J;  1PV4 A;  1A62 A;  4A3C G;  4JI3 Q;  2CQO A;  4R1J A;  4DV6 L;  2FXQ A;  1HNW Q;  1Q8K A;  5GRO A;  4HIK A;  2VW9 A;  2IY5 B;  3ICE A;  5DLQ E;  2I5L X;  4DV4 L;  4LF6 L;  1BBU A;  3S15 H;  3S17 H;  1K9M C;  3E9H A;  2VNU D;  4QJF A;  1MJE A;  3F1Z A;  1D8L A;  3CCL A;  1WI5 A;  4JI1 Q;  5BR8 Q;  1IBK Q;  3CAM A;  4JV5 L;  4LW1 A;  3PGZ A;  2E2H H;  1KL9 A;  2GN5 A;  2PI2 E;  5C4J H;  4JBK A;  1YI2 A;  4DV2 L;  1VQK A;  2RF4 A;  1R9T H;  3PO2 G;  4B3M Q;  4QL5 A;  1S72 A;  3A0J A;  4LF5 Q;  1PH1 A;  3HOZ H;  2N3S A;  1A8V A;  1VS0 A;  1VQM A;  3K7U C;  3T1Y L;  4NB3 A;  5IE8 A;  4JYA Q;  1E1T A;  1EIY B;  1IZ6 A;  4A4I A;  1K73 C;  1VQH A;  3GD7 A;  3PSI A;  1X56 A;  3PV0 A;  1Q82 C;  3HOV G;  1V9P A;  4JCV E;  3HOY H;  4H02 A;  2N8N A;  1Y1W G;  2ZTD A;  2E2J H;  2D62 A;  1TXY A;  2ZTE A;  3J81 j;  5LMU L;  1SLJ A;  5GQO A;  1VQC A;  1HH2 P;  3L2P A;  1KRT A;  4A3B H;  1XMO L;  4DKA C;  4IPD A;  4BXX G;  4IOA A;  4BA2 I;  5LMN L;  2EQS A;  3STB D;  1PYS B;  4IO9 A;  3CCQ A;  3NEL A;  4DR5 L;  1XJV A;  2I0Q A;  2KHJ A;  1FJG L;  4DAY B;  1VQJ A;  1LM0 A;  3G71 A;  2JA7 G;  2JA8 H;  5IP7 H;  2MFI A;  1Q1B A;  4RMF A;  2Q2T A;  3HOX G;  1S40 A;  4YWL A;  5LMU Q;  1PVO A;  2PMZ E;  3VDY A;  2EIF A;  4OON A;  5J3B A;  1ASZ A;  3CME A;  1CKO A;  1QUQ B;  4DK6 C;  4KHP L;  2VQF Q;  3Q8D A;  4A3E H;  1WYD A;  1YJ9 A;  1XMO Q;  2YTX A;  1XPR A;  4IJL A;  2N78 A;  4J15 A;  4DR1 Q;  1FJG Q;  2ASB A;  4NXM L;  4P75 A;  4YY3 L;  5M3F H;  4DUZ L;  4JBJ A;  3FP9 A;  3TQY A;  1PH4 A;  1P16 A;  5EAY A;  5IYB G;  3F2B A;  4DR2 L;  1KIX A;  2JK8 A;  1VQO A;  3G6E A;  1Q12 A;  3GTO H;  2RHS B;  4GNX C;  4XIG S;  4A3G G;  3AEV A;  3S2H H;  2IX1 A;  1N9W A;  1J5E Q;  4P71 A;  3I2Z A;  1PFS A;  3CCU A;  3I4M G;  3M3Y H;  4LF7 Q;  4A3I H;  1QZH A;  2NVY H;  1N33 L;  4GN5 A;  4LWC A;  1L1O B;  1BBW A;  3M4P A;  2UXC L;  2ALY B;  2VY3 A;  2KHI A;  4NXM Q;  1IBL L;  4C3H H;  3PO3 H;  4R4T A;  2VL6 A;  3OW2 A;  4X66 Q;  1B70 B;  1PH3 A;  1AE2 A;  1GD7 A;  1K3R A;  4LUV A;  3UDG A;  5C4X G;  3KOJ A;  4JOI C;  4A3J H;  1QVG A;  3U58 A;  1HNX L;  5FJ8 G;  4BBS G;  3ZJY C;  3J81 i;  1YJW A;  4GLV B;  5H1S E;  2F4V L;  3UE0 A;  2VUM H;  2OQK A;  1N33 Q;  1L0W A;  1O7I A;  2R92 G;  3SGI A;  3KF6 A;  1IBL Q;  3ULJ A;  5IYC H;  3CF5 A;  3KDF A;  1MKH A;  2GVA A;  2ZJQ A;  4JI2 Q;  1I5F A;  1VQA A;  1BKB A;  1HNX Q;  4B3R L;  2I5M X;  1QZG A;  1V1Q A;  1JJ2 A;  4GOP B;  2WB1 E;  2F4V Q;  4DR4 Q;  2B63 G;  3WWV A;  4JI7 L;  2UUA L;  4A76 A;  1IXR A;  1GKH A;  1V43 A;  4LFB L;  2CKZ B;  1EFW A;  2JA8 G;  3PUV A;  4A3K H;  4LFA L;  5IP7 G;  1KXL A;  2WB1 G;  4LFC L;  4DK3 C;  4JI5 L;  2KEN A;  2R7Z G;  4AH6 A;  1JT8 A;  4DV1 L;  4DV5 Q;  4EX5 A;  1SRO A;  3BZC A;  2UXB Q;  3E9I A;  1NY4 A;  4GN4 B;  5IY0 A;  1VQ8 A;  3NBH B;  2BA1 A;  4A3F G;  2UUA Q;  3AFP A;  1JE5 A;  5IP9 G;  4MZ9 A;  1HJP A;  2L15 A;  5M3M G;  4GLX A;  1KRS A;  2AMC B;  3TEH B;  4QGU A;  4ME3 A;  2ZJP A;  4A3M H;  2AHO B;  1X9N A;  2OTL A;  1TWG H;  2HIX A;  1SR3 A;  4O0A A;  1I6H H;  3K80 C;  1OXV A;  3H3V I;  4OWX B;  1YBY A;  4K0K L;  2BH2 A;  1IYJ B;  3G4S A;  1I50 H;  4LF4 Q;  4KLK A;  1GVP A;  5GAD C;  1KD1 C;  2D0P A;  3CQZ H;  3D0F A;  4YWK A;  1YJN A;  3PF4 A;  1I3Q H;  4IPC A;  2K50 A;  3I7F A;  1N36 L;  4A3L G;  3CXC A;  3JAM i;  4R4C A;  1EWI A;  1FGU A;  1YHQ A;  2KCM A;  1KAW A;  2JA5 G;  2NN6 G;  1WJJ A;  4IPG A;  4ALP A;  3PUW A;  3J81 c;  2OCE A;  2NN6 I;  3M9B A;  1WCM H;  1KHI A;  2Y0S E;  3CCJ A;  3TRZ A;  4KI0 A;  3KDF B;  5LMN W;  4DV7 L;  1G29 1;  4DUY L;  1TWF H;  2E5L L;  1N36 Q;  4QQB X;  4IPH A;  4LNQ A;  2Y0S G;  2N49 A;  4BY1 G;  2ZM6 L;  3RNU A;  4DV6 Q;  4LFB Q;  1I94 L;  1FVI A;  4JI6 L;  1Y1V H;  4BY7 G;  5IYD G;  4DV4 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...