4LFAQ

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 20
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4lfaQ00
1J6QA 3HOVH 4X66L 2I0QA 1EWIA 1SE8A 4QQBX 2F3IA 4A3MH 2K4KA 2QGQA 4A3IH 4A3FG 1HNWL 1UEBA 2KCTA 4UP9A 4A3BH 2UXBQ 4P71A 1VCIA 4HJ5A 3I56A 1OXVA 1SROA 4HJ9A 3KLWA 1IBKL 1RIPA 3PO2H 3T1HL 2B63G 2JA7G 1I6HH 5JEAG 1SMXA 1YNXA 4KHZA 4IJHA 2BH2A 4KHPL 4QIWE 4A3KG 1HNZL 1QVCA 4JI0Q 2OWOA 4UPAA 1S40A 5JJLA 3KDFB 3T1YQ 5M3MG 2E2HH 1I94Q 3HOYG 4DK6C 4GKJL 4JBKA 2UU9Q 2Z0SA 1A0IA 1P8LA 1Q12A 1Y1VG 3KF8B 4IJLA 3E9HA 2Q2HA 3PUZA 4X66Q 1YEZA 5IY0A 2Q2UA 1TWHH 2OQ0A 5IWAL 1FJGL 1SLJA 2MO1A 2JJQA 4A3EG 1E1TA 3HFZB 4DV1Q 3DM3A 1N33Q 1QZGA 4GKJQ 3CCLA 2QEXA 1QVGA 1IXRA 2VNUD 3I4MG 1AE2A 3CXCA 3HKZG 1TWFH 3AFQA 3I4NH 4DV2L 2WFWA 3S2HH 2IT1A 3K7AH 3M4PA 4DUZL 3ULPA 4JI6Q 3BJUA 4X65Q 2NN6G 2FXQA 2E5LQ 1YHQA 2UXDL 4X6AH 4TVAB 5AJ3Q 4B3TQ 4HIDA 3HOWG 2E5LL 2UXDQ 3PGZA 1CUKA 4AYBE 3PCOB 1HR0L 1G291 1C9OA 3M3YH 1K3RA 4IFDJ 2I5LX 4OWWB 1VQGA 2WAQG 4P73A 2AWNA 4HJAA 2VUMG 2PI2A 3GTKH 3M7NA 4LF9Q 3U4VA 4YCVA 3M85A 3GDEA 1KRSA 4LFAQ 4LF8L 2H5XA 1EUJA 1ASYA 1M1KC 1HNZQ 2B3GA 1WOCA 1FGUA 1UE5A 2A1AA 4XTCS 3JC66 3CPWA 2ASBA 1Q86C 2HHHL 1PFSA 2R92G 3EBEA 3STBD 3HKZE 1VQEA 3UE0A 2JA5G 5GAGC 3I4OA 4GNXA 1VQCA 3E9IA 2ZJRA 2EQSA 4RMFA 4A4IA 2K5HA 4YWKA 5IWAQ 2ZM6Q 1VQ6A 1KRTA 2JA5H 1NJIC 4DV1L 1V1QA 4MTNA 3W1GA 1PYBA 1OXXK 4R1JA 1GVPA 1Q8KA 4LFAL 4LF5Q 1JJCB 1SFOH 4DV7Q 2JK8A 4J15A 5LMNL 2Z6KA 4PZ8A 1HZCA 3H0GG 2OTLA 4POGA 4X64L 2JA6G 1YVCA 4BA1I 4JI2Q 4PZ6A 2V1CC 3STBC 3PO3H 1EIFA 4H02A 1VQNA 3CAMA 1AE3A 3E0EA 4POFA 1PH7A 1GM5A 3BU2A 1UE7A 4DUYQ 1MJEA 1AH9A 1X9NA 2UUAQ 4A3CH 1UE6A 4B3ML 4UP8A 2R92H 1YJ9A 5IYBH 3J80i 1XNRQ 5GQOA 1YI2A 1Q1BA 4C2MH 5M5XH 1X55A 4IO9A 1I50H 4LF5L 2YYZA 4ALPA 3RN2A 3S1MH 2NVTH 3J81c 3HOXG 2D0PA 1NMGA 3A0JA 2GVAA 4LFCL 5FJ8H 3I2ZA 4A3IG 4A3FH 1YJWA 1TXYA 1N9WA 4LFCQ 1X65A 2MFIA 2PI2E 4KI0A 3CCVA 2PMZE 1CKNA 3FKIH 3F2CA 1XPOA 4O2DA 1PH3A 1OXTA 4OWXB 3FP9A 4AH6A 3JAMc 5C44G 1PH1A 3PUWA 4QGUA 5EAYA 4GNXB 4AQYL 1OXSC 4JI7L 1G6PA 3G4SA 3M4OH 2YV5A 1V43A 5M3FH 1Y14B 1PYSB 2CKZB 2RF4A 3AQQA 4YHHQ 2Y0SG 3CF5A 5IP7H 2VZAA 4DV0Q 1HZBA 3AFPA 2A8VA 3ULLA 1EQRA 4DV0L 3EN2A 5K36G 1VQ9A 3S17H 4EQ5A 1W2BA 5IP9G 1VQ4A 3G6EA 1Z9FA 3EIVA 2A19A 3PIOA 1UWVA 4B3RQ 2JA9A 1JJGA 1KXLA 1I5FA 2ALYB 2Z6KC 4KLKA 4YY3L 3CD6A 4B3MQ 4HIOA 1X3EA 2XGTA 2JEAI 2R93H 4LF6L 1FL0A 3D0FA 4GKKQ 4GLAC 4DV7L 1LUZA 3CCUA 2DUDA 1JJ2A 4IPHA 1IBLQ 4O0AA 4NXNQ 3S2DH 4GS3A 1CKOA 5GAEC 3TREA 4DR7L 2E8GA 4YCWA 3W5OA 3HOUH 4AYBG 1XMQL 2VUMH 3HOVG 2F4VQ 3KF6A 1B8AA 1XPUA 1VQAA 3HOYH 2YTYA 1JT8A 1KC8C 1X54A 1HR0W 3HOXH 2CCZA 3CQZH 1H95A 1X56A 4P75A 5FLMH 2YU9H 4LF6Q 4OO1G 2MNAA 4B3SQ 3GD7A 5C0XI 4KHPQ 1N32L 1NMFA 1N32Q 4JI0L 1VQ5A 4HIMA 1NTGA 2XTIA 1FVIA 4TQUS 4A3CG 5GADC 4JV5L 1XNQL 3S15H 1E1OA 4FDBA 3PF5A 2HIVA 5IYCH 4MNOA 4X62L 1HNWQ 4C3IH 1QUQA 1YZ6A 4JBWA 1Y1VH 1WCMG 3TEHB 1JE5A 1XPRA 1A8VA 3K0XA 1WFQA 3RLOA 1L1OA 3NENA 4WJ3M 4OONA 4YCUA 2IX0A 4YWMA 4A3JH 3K7UC 3IRBA 4R4IA 4YHHL 5BR8L 5M3MH 1I3QH 1IBML 1W3SA 1GD7A 3HKSA 3G71A 1HH2P 4NXNL 4BBSG 3M9BA 3KF6B 2CQOA 4A3GH 1E3PA 1C0AA 3T1YL 4A3JG 2E2JH 2Q2IA 2D62A 4IOAA 3JAMi 2VS1A 4JBJA 4JI8L 3ULJA 4R4QA 4DR3L 1YIJA 1K9MC 5M5WH 2ZTDA 4A93G 2F52A 5IYDH 4JBMA 2MQHA 2K52A 2PQAA 5DLQE 4EX5A 3VDYA 1YJNA 3GTJH 2OTJA 2PNHA 1BBWA 4L5QA 1VQDA 4XIGS 4K0KQ 3RR5A 2K50A 4GOPA 1QVFA 1MIUA 2EXDA 2R7FA 3UDFA 3J81j 3B6YA 3FHWA 1K8AC 1BBUA 4BY7H 5E7NA 4A3LH 2KCMA 4LUOA 3WWVA 4DV6L 2HT1A 4BBRH 2K5VA 1RL2A 2R7ZH 1IBMQ 3F2BA 3J7A5 5C4JH 4DR6Q 1I94L 3NEMA 1N34L 2E2IH 2JA8G 4DUZQ 2JQOA 2VL6A 3SGIA 1Q1EA 1XTDA 4DK3C 4JI3L 2VQEQ 1N8RC 1KL9A 2F4VL 3PV0A 3K8AA 5FJ8G 4L5SA 4DR4Q 3T1HQ 5H1SE 2K5NA 2N3SA 2CWAA 5ELOA 3BZKA 4HJ7A 3AYHB 4LUVA 5LMUL 1L2FA 2VW9A 2UXCL 4LF8Q 1TWGH 2EIFA 5IYBG 5BR8Q 2UXCQ 5GAHC 3PIPA 3GTQH 3RZDH 3OTOQ 2LXJA 2MO0A 4L5RC 1NBWA 4R4CA 4Y52H 4A75A 3OTOL 4X65L 3CCQA 5FLXc 1N34Q 1K0RA 4BY7G 4B3TL 5JJKA 2B29A 1X6OA 4L5TA 4LW1A 1G51A 4NB3A 4R4OA 3ZJYC 1MJCA 1VQFA 2VQFQ 2BA1A 4JCVE 5IP7G 2UU9L 1TWAH 3GTMH 3ICEA 3W1BA 5M5YH 3FKIG 4C3HH 1LTLA 1D7QA 1CKMA 4DR1Q 2KHIA 3ERSX 3HOZH 1EQQA 3S24A 5C4XH 4DR7Q 3OYYA 5LMUQ 3L0OA 4DV6Q 4PMWA 1K73C 4JI1Q 4DV2Q 3KOJA 3RLNA 3LGJA 4DV4L 2N8NA 3AEVA 4JI6L 2OQKA 4GLXA 1SN8A 2I5HA 3UDIA 1QZHA 3I7FA 2R6GA 4BY1G 2N78A 3CCEA 4ME3A 1X3GA 1EIYB 5AJ3L 3GO5A 1PH6A 3PF4A 1Q46A 3GTOH 1X3FA 2R7DA 1HR0Q 4K0KL 1KQSA 4DR5Q 4JOIA 1PA6A 1VQHA 5FLMG 2LXKA 4JI5Q 1ASZA 4Y7NH 4JC0A 3TRZA 2AHOB 4JI1L 1WJJA 3H15A 5C3EH 4P72A 1YITA 1QUQB 1P16A 4GN4B 4X64Q 4LFBL 2VQEL 4JI3Q 4IFDI 2R93G 2K75A 1HZAA 4LUZA 4OWTB 4GN3B 1KAWA 2VQFL 1LYLA 3PSIA 5IE8A 3CCSA 4GNXC 5IYDG 2UXBL 3TS0A 4MZ9A 1KHIA 2AKWB 3D31A 2IX1A 4BXXH 2HQLA 1D8LA 3CW2C 1HNXQ 1VQLA 1PVOA 4YWLA 3GTPH 1HNXL 4P74A 1XNRL 1IZ6A 4DV4Q 2UUBL 2JE6I 2IHFA 2NZOA 3CCMA 1PHJA 4C3JH 1IYJB 4A3DH 4DR2Q 5C44H 5IP9H 1S72A 1VQPA 5LMNW 4IPDA 1Q82C 2HHHQ 4LFBQ 4GLVB 3A5ZB 2WP8J 4A3MG 3RLFA 2QA4A 3H3VH 3S1RH 1M90C 4JI2L 4GOPB 3S16H 2I5MX 3H3VI 4JG2A 5ELNA 1VQOA 4DR5L 4AQYQ 1N33L 4QJFA 3K80C 3CCRA 4BBRG 4DV3Q 5C0XG 1L1OB 4IPCA 4OXPA 4OO1I 4BA2I 3CC2A 1XJVA 4B3SL 1WI5A 1PH2A 2D0OA 1SR3A 1VQJA 3CP0A 3UDGA 1SRUA 4UY8C 1BVSA 1VQIA 1YBYA 3HOWH 2WAQE 4BXXG 4UP7A 1E24A 3K81C 1EOVA 1CSPA 2NN6I 3CC7A 2AMCB 4NXMQ 1VQKA 5J3BA 1YHBA 1R9TH 5HGQA 2CWPA 3I55A 4DUYL 3H0GH 3U50C 2GN5A 4JI5L 2ZJQA 4A3DG 5C3EG 1C7YA 3DLLA 4LF7Q 3PO3G 4LF4Q 3L7ZC 4IOCA 4LF7L 2JA7H 2DGYA 2UUBQ 1WYDA 5JJIA 3CC4A 1CKNB 3RN5A 3A5UA 1WCMH 3KFUA 4APVA 2ZTCA 3J80c 2YTVA 1XMQQ 2KBNA 5HY6A 1VQBA 2JA6H 3F8TA 4A3BG 3J81i 2PQAB 2ZM6L 3CCJA 2ES2A 3M4QA 3A74A 4WJ4A 1OXUA 4NPSA 5GROA 3KJPA 2UUAL 1O7IA 1U5KA 4RG1A 1EYGA 3I4NG 2NVYH 4DV3L 4YY3Q 1U0LA 3GTGH 1IBLL 4A3KH 1V9PA 5JEAJ 2VY3A 4AIMA 1VQMA 3UDXA 3UE1A 4JYAQ 1K8GA 1HJPA 1S3OA 1TWCH 3TS2A 2IHEA 5LMNQ 1NY4A 3I4MH 2IY5B 3L2PA 5C4XG 4DR2L 3NBHB 4DKAC 4GOPC 4A93H 5IT9c 4JI8Q 3PUXA 1VQ8A 1EFWA 2B63H 1J5EL 4DAYB 3KDFA 1NE3A 3NELA 2CFMA 4HJ8A 4R4TA 1MKHA 1K83H 1YHAA 4B3RL 1IL2A 1Z47A 1PH8A 1LM0A 3J7ZC 4JI7Q 1A63A 2R7ZG 4JI4Q 4LF4L 3Q8DA 4PZ7A 4QY7A 2NVQH 2N49A 4GKKL 1B70B 1KIXA 4JYAL 4LWCA 3F1ZA 1Q7YC 5C0XJ 3HOZG 1KD1C 2WB1E 4JOIC 1XMOL 4A3EH 2NVXH 1L1OC 4DR3Q 3CMEA 2L15A 4IFDG 4NXML 4X62Q 4DPGA 4DNIA 4BY1H 1JB7A 1Y1WH 3S14H 4QL5A 1UE1A 1GO3E 4OX9Q 3MXNB 4OX9L 1A62A 3KYHC 2C35B 2JA8H 4DV5Q 1N36Q 3PUVA 2ZJPA 1PV4A 2ID0A 1B7YB 2NZHA 4LNQA 3BZCA 4IPGA 4BBSH 2YTXA 4DV5L 1N36L 1JMCA 2KENA 2K14A 1E22A 2RHQB 3S1QH 4DR6L 1PH5A 3PO2G 1CSQA 1XMOQ 2Q2TA 1XNQQ 3OW2A 1E7ZA 2Y0SE 2BH8A 3ER0A 1J5EQ 3RZOH 4DAMA 1OTCA 5IYCG 3RNUA 2RHSB 2OCEA 2JEBI 3KJOA 1PH9A 4A3GG 4DR4L 3CMAA 1HZ9A 1Y1WG 2RCNA 3PUYA 1IBKQ 1FJGQ 4GN5A 2GVBA 4DR1L 3U4ZA 2WB1G 1VQ7A 3GTLH 3HOUG 3G48A 3CPFA 2AWOA 2ZTEA 3MEFA 1PH4A 4LF9L 1BKBA 5M3FG 4JI4L 4PG3A 2UUCQ 4A76A 3U58A 4A3LG 2UUCL 3F2DA 1VS0A 1DGSA 4HIKA 1Q81C 3S1NH 1GKHA 2LSSA 1L0WA 2ATWA 1T9HA 2KHJA 2HIXA 3TQYA 2BA0A 4JV5Q
chains in the Genus database with same CATH superfamily
1EWIA 1SYEA 1UEBA 4FP5D 2ENBA 4C2MB 4IUQA 5M5XB 3TDQA 1IBKL 3KLWA 3S1QB 1DZ1A 2EJFC 3K7AB 4TSSA 5FO8B 4IJHA 4I7AA 4QIWE 4A3KG 1HNZL 4C1NK 5CV9A 1S40A 5JJLA 1I94Q 3CU7A 4JBKA 1PRTC 1A0IA 1Y1VG 1D1KA 4FXKC 3E9HA 4X66Q 2B2TC 1YEZA 2MPMA 5IY0A 1CQVA 5IWAL 2JJQA 4KJOA 2GA4B 2K04A 1QVGA 1IXRA 2WV6D 1TY0A 3CXCA 5CV4A 3JAML 3GP7A 3TZDA 4L6TB 2IT1A 2F0KA 4JI6Q 3M4PA 1TWFB 3ULPA 4CKBA 4X65Q 2UXDL 4X6AH 1KLGD 3NQIA 2E5LL 1CUKA 4AYBE 4IFDJ 1C9OA 2EJGC 2R7ZB 1NAPA 5I2YA 4P73A 4LF9Q 3HRZC 4IUVA 4B9WA 1EUJA 1JB3A 4RAUC 1UE5A 3CPWA 2SNSA 4HSVA 4DF7A 1XWEA 4FNFA 1B44D 3Q24A 4EGVA 1G8ZD 3H3VC 3HKZE 1VQEA 2JA5G 3CQZB 3I4OA 4GNXA 4K8JA 2EQSA 1NJIC 3BYTB 5IGGA 1V1QA 4TRDA 2F0DA 1GVPA 3BDLA 4LFAL 3I4LA 2K01A 2L55A 4J15A 2J4XA 3R3OA 1HZCA 4POGA 2EY1A 2F0LA 3GTGB 2CW0C 1EIFA 4H02A 1BCPB 3E0EA 1GM5A 4POFA 3BU2A 3MHBA 4K14A 2QKIC 1GUGA 3I8ZA 1TU2B 4WORA 5IYBH 1VDZA 1W6JA 1YI2A 3NTIA 4LF5L 1X55A 4IO9A 2OEOA 5I2XA 2D0PA 4KD4A 1NMGA 3A0JA 3IFTA 5FJ8H 5KRUA 4A3IG 3D8GA 3H91A 2PI2E 4X3KA 3CCVA 1CKNA 1PH3A 4H13C 5EQ0A 4OWXB 4AH6A 2L4NA 1CTMA 2E2HB 2XRQD 5EAYA 1II3A 1DOLA 4DU9A 1G6PA 5IOCA 4ZCKA 1I4RA 4F87A 5M3FH 2CKZB 4YHHQ 4QIWB 1SNOA 3CF5A 3OSOA 1H9JA 3AFPA 2A8VA 3T56B 1PMRA 4C3HG 1I4GA 5I9OA 2PPBC 4QMGA 3V96A 1FR3A 1JJGA 1UWVA 4B3RQ 2KCCA 5EKKA 2RKSA 5T1GA 2HCCA 3EJIA 1HTLD 4KTAA 2Z6KC 2B63B 1YNND 4CDCC 4B3MQ 4HIOA 2JEAI 4IURA 3I90A 2AUKA 3AU7A 1JCKB 2DUDA 2IX3A 4GS3A 3MEHA 2ICIA 2EDGA 4AYBG 4PQXA 1SNCA 1TQOA 1VQAA 2PW5A 1I4XA 1BXTA 1X54A 2CVRA 2K28A 3CQZH 1H95A 1BUVT 4OO1G 4IN3A 5C0XI 4KHPQ 2F0WA 5GADC 2MJ8A 3S15H 3PF5A 5KIXA 4XDXA 1HNWQ 1O7LA 4C3IH 1B9MA 1WCMG 1XPRA 1TR5A 3J7AV 3BG3A 3BDOA 4R4IA 3K57A 5BR8L 1H9MA 5M3MH 4A3GH 1HH2P 1C0AA 3M9BA 3PIP3 3T1YL 1WVLA 2D62A 3JAMi 4JI8L 4S3SA 4R4QA 4RCNA 1YIJA 2XRSD 5M5WH 2MQHA 1Q3LA 2K52A 3VDYA 3GV6A 1B2TA 1BBWA 4L5QA 3UDFA 1K8AC 3J81j 3B6YA 4I65A 5FOBB 1FNVA 3RZOB 4ABNA 1IBMQ 5FLXE 2B2VA 2I07B 5CBAE 3NEMA 4C3HB 1N34L 2E2IH 2JQOA 1O78A 2F3VA 5KGUA 4CJ0B 4JI3L 2F0IA 5EPJA 2F4VL 2F3WA 5FJ8G 4IFDH 5ELBA 1EEFD 5H1SE 3HOUB 2CWAA 5CMDA 3AYHB 1L2FA 2UXCL 5IYBG 2UXCQ 2IW3A 1PLFA 3OTOQ 2LXJA 2MO0A 4R4CA 1F2MA 3A7LA 1F9RA 1K0RA 3TN2A 4BY7G 2B29A 4NB3A 4L5TA 2UU9L 3GTMH 2F0JA 5BN4A 2QW7A 2K5WA 3LX0A 5M5YH 4C3HH 1EL0A 2F0MA 5C3XA 3HOZH 1MI2A 2Z4IA 3OYYA 3KBGA 4DAYA 5LMUQ 1WTOA 1EQVA 3KK7A 4OGQC 4PMWA 4DV2Q 2EYMA 3BS1A 4DV4L 1A6XA 3IL8A 3MFYA 4CDDC 3GTKB 2EY6A 4ZLTF 4OELB 4GLXA 2I5HA 1QZHA 3I7FA 4BY1G 4B08A 1EFID 2N78A 4ME3A 4Q0FA 3GO5A 3C1FA 3PF4A 3GTOH 1X3FA 5E1FA 1KQSA 5FLMG 1A2TA 5HGTA 1NCVA 2CHBD 3ERQA 2K5QA 4JI1L 4ZAIA 5IT9E 3MC0B 1QUQB 1P16A 4X64Q 4HMIA 2KEEA 4GN3B 1SE2A 5IE8A 2QCPX 3CCSA 1E2WA 4H44C 2RCFA 4MZ9A 2AQ1B 1AZPA 1SNMA 1PVOA 2VUMB 1XNRL 4RHRA 2PZWA 2JE6I 2IHFA 3EFXD 3VR2A 4DR2Q 3CRKC 1VQPA 2HHHQ 4IPDA 4LFBQ 3H3VH 2DJFC 3T13A 1SAPA 4C56C 1RJTA 4GOPB 3H3VI 4JG2A 4NMZA 5ELNA 2A73B 1EZ6A 2WAQB 1A3UA 4BBRG 3T51B 1B1ZA 5C0XG 1L1OB 2K6AA 1HFGA 3HOWB 3URYA 1HXYD 1SR3A 4BY1B 3CP0A 3UDGA 3NTKA 2WAQE 4TKOB 4NXMQ 5J3BA 1ILQA 1R9TH 2KVMA 3H6MA 5D3DA 2GN5A 2ZJQA 3KLRA 2WACA 1C7YA 4RA8A 4LF4Q 4MHEA 4RGTA 5JJIA 3S9WA 3RN5A 3KFUA 1WCMH 2ZTCA 1JR0D 4KY6A 3SK8A 5BN5A 1VQBA 2JA6H 3DXJC 3J81i 1H9KA 3A74A 4WJ4A 1RODA 3KJPA 1XYIA 2WB1B 5ELDA 4FF2A 1F9PA 4YY3Q 5I6WA 1U4MA 4A3KH 2VY3A 1SE4A 1VQMA 4ZK9B 4JYAQ 3H0GB 4KKUA 5LMNQ 5C4XG 3L2PA 3C2PA 1F77A 4ME5A 3Q23A 1V1OA 4A93H 4JI8Q 2B63H 4G7ZC 3HEJA 2KEDA 2CFMA 1BR9A 1K83H 1YHAA 4B3RL 1H9SB 1Z47A 1PYWD 1D5ZC 4ZRZA 4JI4Q 3MXGA 2A69D 2VB3X 2CQAA 3F1ZA 1PZID 2Z1CA 1Q7YC 1KD1C 4WFN3 3MXUA 1L1OC 4KHVA 1FGBD 2NB0A 4X62Q 3D3RA 4K5WA 4DPGA 4BY1H 1Y1WH 3Q6SA 2OXPA 4OX9L 3C3LA 2D9UA 2C35B 1WTVA 2SOBA 4DV5Q 3PUVA 4WJ3M 1B7YB 1EY9A 4LNQA 4KV6A 1N36L 1CM9A 2PZTA 2RHQB 3S1QH 1JWSD 1S5BD 1PH5A 1CA6A 4XQQA 1STAA 1GJXA 4ZYSA 1J5EQ 3RZOH 3ER0A 1DYQA 4DAMA 1RD9D 1OTCA 1AP0A 2OCEA 3CMAA 1DXMA 1Y1WG 3EROA 4GN5A 2GVBA 3GTLH 1RDPD 2ZTEA 5M3FG 1L0YB 4PG3A 2UUCQ 1AEXA 1V8QA 4EQNA 4A3LG 2UUCL 4JPBW 3I91A 2ATWA 1T9HA 4K2LA 4XT3B 1BOSA 1IHZA 4X66L 2I0QA 1SE8A 4QQBX 2QGQA 4A3IH 5KEEA 1HNWL 1LTGD 3SK6A 4BS9A 1Y8OB 4HJ9A 3MTSA 2B63G 1I6HH 1EY0A 2A6EC 2L1BA 4KHPL 3DUZA 3KDFB 3T1YQ 4UDUC 1SJHD 2BDOA 1Q12A 1ZYRC 5KNBA 2PMZB 5A2QL 4A3GB 3K5NA 2Q2UA 3EQLC 5K5PA 5IGDA 3DM3A 3S14B 3QB3A 1XTCD 3CCLA 1SNDA 1NR2A 1PZJD 1STHA 3D6WA 2SDFA 3AFQA 4DK0A 3GTMB 4DV2L 3K5MA 3K7AH 1H9RA 5ELEA 2NN6G 2E5LQ 5CBEE 5AJ3Q 3PGZA 2EVBA 1HR0L 1K3RA 2XN9C 3I3CA 1PXUA 4OWWB 1VQGA 3GTKH 1PFBA 3GDEA 1O7ZA 2H5XA 1BDOA 1ASYA 1M1KC 5EGTA 1EY6A 1FGUA 3EVQA 3KUPA 1TY2A 5CGKA 2EY5A 3K5LA 2F0SA 3UE0A 5J39A 1ILPA 3L3OC 2B39A 4C3JB 2K5HA 4YWKA 2HD3A 1VQ6A 1K8MA 1LTRD 4RCOA 5KYIA 4DV1L 1PYBA 5CC4A 4R1JA 2NZ1D 3VR3A 4LF5Q 2NTSA 2PCFB 2JK8A 5LMNL 4PZ8A 2OTLA 2F0TA 4X64L 2KQ3A 4JI2Q 2V1CC 3PO3H 2V4DA 1VQNA 4C3IG 3CAMA 1PH7A 4DUYQ 1MHWC 1JQYD 1X32A 1AH9A 4KN4C 1X3PA 4RH6A 1ET9A 4A3CH 1YJ9A 2DNEA 4HSPA 3J80i 1XNRQ 5GQOA 2PNRC 3TP7A 4OIKA 1SBBB 2YYZA 4ALPA 4PV1C 3RN2A 2NVTH 1UEAB 3OMCA 5M5YB 1YJWA 2JN4A 2MFIA 4KI0A 4K6DA 3F2CA 1XPOA 3MWYW 3PUWA 4QGUA 3WDNA 4DFAA 4AQYL 4UAIA 2E2JB 3AQQA 1MBYA 3BVGA 3Q22A 3C46A 3L9AX 2Y0SG 2MGSA 5IGEA 3SR1A 4HR7B 5A35A 3ULLA 1EQRA 2A6HD 3EN2A 2JA8B 5K36G 4EQ5A 1YNNC 1X3QA 4Y7NB 2DY8A 4IUUA 3PIOA 3NUCA 1KXLA 2ICEC 3FMCA 4M1UB 4KLKA 4IQZA 1R4PB 2XGTA 1FL0A 4GKKQ 4GLAC 1U4LA 2RQXA 4DV7L 1JJ2A 5GAEC 1CKOA 3NSWA 3TREA 1SDFA 1T5EA 1RKNA 1I3QB 3W5OA 1FD7D 4K5VA 3HOVG 5M3FB 2XIWA 1B8AA 1XPUA 4N9PA 2YTYA 1HR0W 4Q5VA 4P75A 4LF6Q 4RGMA 5A2QE 1ET6A 4MIUA 5LHY1 5D14A 1VQ5A 4HIMA 4JV5L 2HUGA 3PO2B 5JPNC 1E1OA 4FDBA 3J80L 1S5FD 4X62L 4MNOA 2O5IC 2IJ0A 4JBWA 2L0CA 3K0XA 1L1OA 1BCPC 4XYQA 4OONA 3FKIB 4YWMA 4IUTA 3MVVA 3BVZA 1EU4A 2F0UA 1W3SA 3OW7A 3HKSA 2CQOA 2E2JH 1XX8A 4OHJA 3A8JE 3IFDA 1F2YA 1MGSA 1K9MC 4A3KB 2ZTDA 2F52A 5L37A 4JBMA 2OTJA 3TZUA 2PQAA 5DLQE 3E6ZX 2SNMA 1VQDA 5FO7B 4GOPA 5D65A 4DAVA 4HCSA 2R7FA 1BBUA 5E7NA 2BDNA 3WWVA 1HFNA 1Y1VB 2R7ZH 3F2BA 3J7A5 1GUOA 2G9HD 1LT5D 2VL6A 3SGIA 4DK3C 1Y8PB 4C1NI 3K8AA 2XWJB 3BZKA 4DNRB 3PO3B 5LMUL 5FLXL 1NUCA 3GTQB 1IKLA 2VW9A 1ESRA 1EY4A 1TWGH 3A54A 4FF1A 2XVSA 5GAHC 1EWCA 5CV5A 2EE1A 4B3TL 1QE6A 2PO4A 2VQFQ 4LW1A 3FKIG 1D7QA 1EY5A 1CKMA 5C3EB 2KHIA 1UNSA 2KHSA 1WTRA 1STNA 3FRPB 3TBIB 4DV6Q 5AFWA 4JI1Q 3RLNA 3LGJA 4PMBA 2OQKA 3MAQA 3OPOA 1Y69U 4Z9CB 2R6GA 5HURA 1HQMC 2I46A 1G91A 1CHPD 5AJ3L 1Q46A 2R7DA 4L8JA 3D4RA 4JOIA 1DONA 4JI5Q 3MFGA 4Y7NH 1VF7A 4QB4A 2D5DA 2FMMA 1PZKD 2O4XA 3H15A 5KNDA 1PFNA 3C1EA 2A74C 1K28A 1QNKA 3NTHA 4JI3Q 1PRTB 4OWTB 3J81E 4IUPA 2UXBL 2BOSA 2AKWB 3D31A 4BXXH 3CW2C 3VA5A 4YWLA 4V190 4C3JG 1EWHA 4H7BA 1R4QB 1WTWA 2JSOA 5EPKA 3UI2A 2NZOA 1PHJA 1IYJB 1R9TB 5CV7A 5IP9H 4GLVB 2WP8J 3CKIB 5EBCA 2QA4A 5JVG3 4A3MG 3IAYA 2I5MX 4N8FA 4R9WA 4DR5L 2Z4HA 1WTXA 3K80C 4UHVA 3CCRA 4DV3Q 4OO1I 4BA2I 3CC2A 2BE5C 5EJWA 2PYKA 1WI5A 2D0OA 3E5SA 4UY8C 1BVSA 1WTPA 4UP7A 1E24A 3SHLA 1B50A 5M3MB 3R8BA 1DM0B 2R61A 5HGQA 3I55A 4X3SA 3H0GH 4ULLA 2EYFA 2F4IA 3N52A 3L7ZC 2DGYA 3S1RB 1WYDA 3CC4A 3D4WA 4APVA 2NVQB 1XMQQ 5HY6A 4NP5A 1T5XD 4ILWA 4A3BG 1TVXA 4IUNA 1G6ZA 4NPSA 2KCNA 5GROA 1O7IA 3I4NG 1EYGA 2H1EA 2RSNA 3P1HA 1K8GA 1GUSA 1S3OA 2IHEA 1NY4A 2IWHA 1ZEQX 3U9SA 1HCZA 3SE0A 4HN7A 1KDAA 1J5EL 1LT3D 1I50B 4QUFA 4R4TA 1MKHA 3KBXA 3S1MB 4ODGA 5CV8A 3J7ZC 4JI7Q 4F8MA 4ZUJA 5EKIA 5DNFA 2NVQH 1B70B 5KNCA 5C0XJ 4JOIC 2HCIA 4A3EH 1XMOL 4DR3Q 1HRJA 4IFDG 4FVMA 3RD4A 1JB7A 5C6AA 3I4MB 3S14H 1UE1A 4OX9Q 3MXNB 4K5XA 3PQIA 2CW0D 1N36Q 3IKJA 2NZHA 4A3GG 4CJ1B 2F0EA 2K14A 1E22A 1TWAB 4AYBB 4DR6L 2G9DA 1V1PA 1V1PB 1Y8NB 4DA2A 2BH8A 1SYBA 4EQPA 5CR3A 4DR4L 1TS3A 2D2CC 3NBHA 1QG7A 1IBKQ 3U4ZA 3HOUG 3G48A 4RGOS 2M9VA 4LF9L 1BKBA 1WD1A 4A76A 4FXDA 1JICA 1VS0A 1PTOC 1Q81C 2L11A 4JVZA 3GTOB 2KHJA 2HIXA 3VR4A 4JV5Q 1CZGA 3LWUA 3A55A 3RZDB 4A3MH 4UP9A 4A3BH 2UXBQ 1VCIA 4HJ5A 3I56A 1CHQD 3I4NB 5JEAG 4KHZA 1SYFA 4NDXA 1XXGA 2RSOA 2PQEA 3NPPA 2OWOA 4UPAA 4QF4A 1G2TA 4CKEA 4DK6C 4GKJL 4J6HA 2Z0SA 3H09A 1P8LA 2BCOA 5I9PA 2N88A 3KF8B 4IZ8A 1HUMA 4FXGC 2NWGA 2C9OA 2A5HA 2KOLA 2OQ0A 1SLJA 1IYUA 3ITPA 4XQNA 1FJGL 3FDTA 1Y1WB 1ICFB 1QZGA 2QEXA 1GXDC 3J81L 5JOBA 3I4MG 3GQBA 1TWFH 3I4NH 3V2TA 4A3MB 2AQ3B 4DUZL 1YHQA 4B3TQ 4HIDA 3HOWG 3EA6A 3PCOB 2EXZA 4M8AA 2WAQG 4HJAA 1QWYA 2DNCA 1U4RA 2PI2A 2X6GA 5IIFA 3KF8A 3NQTA 4KMUC 4LFAQ 1EZ8A 1G2SA 4XT1B 2X6LA 1HNZQ 2FJ2A 1WOCA 3JC66 1TKWB 1LO5D 2ASBA 1Q86C 4K6LA 3K58A 5GAGC 2H4OA 1VQCA 3E9IA 3M4YA 4KKSA 1RTOA 2FHTA 2ZJRA 1SNQA 1KRTA 2JA5H 4MTNA 3W1GA 2ZXOA 2QEJC 1Q8KA 4DAPA 2E2DC 1UUPA 4DXGA 2O2LD 2WKCA 1KABA 1HA6A 1S5DD 1M8AA 2JA6G 4BA1I 2ZXRA 1B53A 4PZ6A 2Z8LA 1AE3A 2F0NA 4ID6A 4RHSA 4NW2A 1UE7A 1MJEA 1LACA 3TP8A 1UE6A 4B3ML 2R92H 1YNJC 1M4VA 3TP5A 3VA7A 2LY7A 1Q1BA 4LK1C 2X69A 1QB5D 1I50H 3S1MH 3J81c 3HOXG 1NNXA 3S16B 5IT9L 2GVAA 4A3FH 1TXYA 1N9WA 3KLSA 5EKLA 2B2TA 1DJRD 3FKIH 4BBRB 4O2DA 1OXTA 3FP9A 3M4OB 2XSCA 2RDHA 3R2TA 4JI7L 3G4SA 2YV5A 2F1MA 2M00A 1CT1D 5IGCA 1PYSB 1O80A 3MZ5A 2EYPA 3DHQA 5IP7H 2VZAA 3S17B 1C4QA 4U673 1EU3A 2ZXPA 5ISRA 2EYJA 1S5ED 3OMGA 3G6EA 1Z9FA 3EIVA 2A19A 2JA9A 4R8NA 2ALYB 3TSSA 1B9NA 1X3EA 5JEAH 2R93H 2TMPA 3WOFA 2RDGA 3D0FA 2G5DA 4A3FB 1AZQA 2JA6B 2JYOA 4IPHA 4XXEA 5LL6S 1KAAA 1AN8A 1VMCA 1RCVD 5NUCA 4YCWA 2L5TA 3HOUH 5FK9C 1EYDA 2VUMH 2MP1A 1FYCA 2F4VQ 2NYZD 3KF6A 1GOZA 1JT8A 1KC8C 5I4DA 1LTAD 1B3AA 5FLMH 2YU9H 3GD7A 1NMFA 1N32Q 2F03A 3GTJB 2XTIA 4A3CG 1XNQL 4JK1C 4WJWA 2EY2A 4DGZA 5IYCH 1TS4A 1QUQA 5FKAC 1Y1VH 1LT4D 1RHPA 3RLOA 3NENA 5C4JB 2K32A 4RFBA 4J1MA 1PRTD 4YCUA 2IX0A 4RGNA 3SK5A 4A3JH 3IRBA 3OIPA 4YHHL 1JC7A 1I3QH 1IBML 1GD7A 1FNWA 4BBSG 4NXNL 3KF6B 3GTLB 1O7YA 3AMUA 3HZXA 2Q2IA 4IOAA 1HQRD 5C3WA 2VS1A 3ULJA 2R3ZA 2OT2A 1SSOA 4EVOA 1STGA 1YJNA 3GTJH 3HG9A 4LAAA 4K0KQ 3ONAB 4BY7H 2EXDA 4A3LH 1ZXTA 3WOEA 1E0BA 4KK7A 4LUOA 1WTQA 2P5ZX 4BY7B 4BBRH 3M3YB 3O13A 5C4JH 2RVLA 4DR6Q 4FF4A 4DUZQ 4RKBA 4QCLA 1XTDA 3GV3A 2VQEQ 3CHBD 1IKMA 2F0QA 1IW7C 1N8RC 3T4AC 3PV0A 3J7AF 3T1HQ 2K5NA 2N3SA 5ELOA 1STBA 3OOCA 4ZKBB 4HJ7A 3E0JA 1A3VA 4LF8Q 2EIFA 2EZVA 1D2BA 1IL8A 3TMEA 4EQOA 1SEBD 1EY7A 4PMCA 4L5RC 1NBWA 4A75A 1I6VC 4X65L 3CCQA 1HHVA 1N34Q 2NTTA 1X6OA 4R4OA 3ZJYC 5J1ZA 2QDBA 1H9SA 2QDLA 3H94A 4DR1Q 3ERSX 1EQQA 3S24A 2FINB 1SNPA 3ND9A 1AW7A 3L0OA 1FNUA 3KOJA 1STEA 3AEVA 4JI6L 2B2WA 5E3FA 1SN8A 2A69C 3UDIA 1NSNS 3CCEA 1EIYB 1PH6A 1HR0Q 4DR5Q 1ASZA 1EY8A 1JORA 4C3IB 4F7XA 3Q0AA 5C3EH 1YITA 1MD2D 3BZDB 4LFBL 4IFDI 2R93G 1HZAA 2HDMA 1KAWA 1LYLA 3PSIA 3RMHA 5IYDG 1U4PA 3TS0A 4H0LC 3F2UA 2A6ED 1KDBA 4GZYC 3X3NA 1Q8IA 1IZ6A 1GHJA 1D1IA 3U9OA 3CCMA 4CHTB 5CV6A 3NWSA 1D5XC 3VYTA 2K05A 3RLFA 4JI2L 2B2YA 4NKLA 2L9HA 4QUCA 1NR4A 3S16H 2F0OA 1N33L 3DWQA 3P20A 5DAUA 4CBVA 1LV9A 4PNYA 4B3SL 1PH2A 1VQJA 1SRUA 3SK4A 1QILA 2NN6I 3CC7A 2Q8RE 1VQKA 3DEOA 2B2UC 1ZKOA 1YHBA 4F88A 4A3DB 4DUYL 3U50C 5IGBA 1W6KA 4A3DG 4XYOA 3HP3A 4IOCA 2UUBQ 2IPKD 1EYAA 3A5UA 2E76C 1KNAA 1BQQT 2YTVA 3K5OA 2KECA 2ZM6L 2ES2A 3VYUA 2EPBA 4RG1A 1F2ZA 2KUMA 2NVYH 1U0LA 3GTGH 1IBLL 1V9PA 5JEAJ 4AIMA 3UE1A 4A93B 2IY5B 3TS2A 3I4MH 4DR2L 3NBHB 1IYVA 1JOKA 4GOPC 5J22A 1LABA 3PUXA 1VQ8A 1EFWA 1Z7TA 4DAYB 3KDFA 2F0VA 2NN6H 3R2IA 3NELA 5CYUA 2DJGC 2Z9HA 4ZQ3A 1PH8A 1JOQA 1LM0A 1PTOH 3NBIA 1VMPA 2R7ZG 4LF4L 3Q8DA 4K2KA 1DCZA 3NE5B 2O5JC 4GKKL 4X3TA 2A68C 4JYAL 1ENFA 1JWUD 1GUNA 2PZUA 4NXML 4DNIA 2EYLA 5F2DA 1K3BC 1GO3E 3DWAA 1QJOA 5IGFA 1PV4A 2ID0A 3SXHA 3BZCA 4IPGA 2YTXA 1F9SA 1JMCA 2KENA 1QOHA 3CRLC 1PFMA 1CSQA 3HOZB 2Q2TA 1XNQQ 1E7ZA 3V05A 1ESFA 1L0XB 3RNUA 3KJOA 1PH9A 5EPLA 1HZ9A 3PUYA 4DR1L 2WB1G 1EOTA 2AWOA 4DR7L 3MEFA 2NVXB 1E2VA 3U58A 5DM63 3F2DA 4R8IA 4G7HC 1GKHA 1BBXC 3GTPB 1L0WA 4GKJQ 3S1NB 1J6QA 3HS0C 3HOVH 2N55A 4OL7A 2F3IA 4YIJA 2K4KA 4A3FG 3LWEA 3J80E 2KCTA 4P71A 3A8IE 5ELCA 1OXVA 1SROA 3NWTA 4G7OC 1RIPA 3PO2H 3T1HL 2JA7G 2DY7A 2TSSA 1SMXA 1LTSD 1YNXA 2EYHA 2RBMA 2E2IB 1K83B 4DK1A 2BH2A 1SYGA 1QVCA 4JI0Q 1Q90A 2E2HH 5M3MG 3HOYG 2UU9Q 4IJLA 2B2UA 4ZUIA 2Q2HA 3PUZA 1ML0D 1TWHH 2MO1A 1WTHA 4A3EG 1EEID 1E1TA 3HFZB 1TS2A 4U68A 4DV1Q 5C44B 1N33Q 2VNUD 3ND8A 1AE2A 2PW7A 4JW0A 3HKZG 3PIO3 2L12A 2MHVA 2WFWA 3S2HH 3BJUA 1SJED 2FXQA 4E6IA 4V0BA 3I73A 4TVAB 1SFOB 2UXDQ 1QCBD 1G291 1TS5A 3M3YH 4FYDA 2I5LX 2VUMG 2AWNA 2CH4A 3M7NA 3OIQA 3U4VA 4YCVA 3M85A 1KRSA 4LF8L 2B3GA 2A1AA 1PRTF 4XTCS 3NK9A 2HHHL 1ZYRD 1PFSA 2R92G 3EBEA 5C4ZA 3BDCA 3K6OA 3STBD 5E4WC 2Q8IB 3I70A 4KY7A 5C5LA 4RMFA 4A4IA 5JVH3 5IWAQ 2ZM6Q 4N9TA 3NXWA 1OXXK 4I7ZC 1SYCA 3OHXC 2C5CA 1DOMA 1JJCB 1RF2D 4HEDA 1SFOH 5EBDA 4DV7Q 2Z6KA 3OWFA 3H0GG 5C4XB 1YVCA 3OWEB 3STBC 4O1NA 2B2VC 2K5DA 5DM73 1IW7D 3LNNA 1E2ZA 2LMCB 1X9NA 2UUAQ 2B2WC 4CDFC 4HMJA 4UP8A 5K36H 1TWHB 5DEHA 2NVTB 2FFKB 4C2MH 5M5XH 4LFCL 1I6HB 2Y0SB 3I2ZA 1PTOF 2J0TD 4LFCQ 1CA5A 1X65A 3HKZB 1S4ZA 4CKCA 2PMZE 3MXNA 3JAMc 5C44G 5COYA 3S2DB 1PH1A 4GNXB 2Q8TA 4A3EB 1OXSC 3M4OH 1LTTD 1V43A 1BCPD 1Y14B 5ELFA 2RF4A 3FEWX 3K59A 5LL6X 3HOXB 3QIAA 4DV0Q 1HZBA 5G3LF 1LTID 4J8QA 3J7YW 4DV0L 2HDLA 1VQ9A 3S17H 5IODA 1W2BA 5IP9G 1VQ4A 2MUYA 5TSSA 4G57A 1I5FA 1MSHA 4YY3L 3CD6A 2EOTA 2F0PA 4LF6L 4CJ2C 3VYRA 1I4HA 1LUZA 3CCUA 1IBLQ 4NXNQ 3S2DH 4O0AA 5C0XH 3VR6A 4MN3A 2HQEA 1ONLA 2E8GA 1SE3A 1U9RA 1XMQL 1SYDA 3HOYH 3FVQA 5JJZA 2CCZA 3HOXH 1D5MC 1X56A 2NUCA 2MNAA 4B3SQ 1N32L 3S15B 4JI0L 3ZYYX 1CI3M 1NTGA 1FVIA 4TQUS 2HIVA 2SEBD 3PMFA 1YZ6A 2XNAC 2B8GA 3TEHB 1JE5A 1A8VA 1WFQA 4DN4M 3DMUA 3K7UC 1I4QA 3G71A 4ZKCB 1D6EC 2WIIB 3D6CA 1E3PA 4A3JG 4JBJA 4DR3L 2RDFA 2XWBB 4LMQD 3QG1A 1ENCA 4A93G 3QOLA 5IYDH 4EX5A 1PTOD 2PNHA 2JA7B 4XIGS 4KKTA 3SDZA 3S2HB 3RR5A 2K50A 3A8KE 2E74C 1HTPA 1QVFA 4LJZC 1MIUA 1YNJD 1GUTA 3FHWA 5M9OA 2KCMA 1SMYD 4DV6L 2HT1A 4A3BB 2K5VA 1RL2A 1C8CA 1I94L 2J7ZA 2JA8G 1STYA 3FPUB 1Q1EA 4FO2A 3HGBA 1BO0A 1KL9A 4DR4Q 3A56A 4L5SA 4N8X1 3P7JA 4KY5A 1TWCB 3D4DA 2FMCA 4LUVA 5BR8Q 1HUNA 3GTQH 3PIPA 1CQFA 3RZDH 3AB9A 5M5WB 4Y52H 2CH4W 4K8IA 3OTOL 5FLXc 3M7GA 3MA2B 2KA7A 1Z6HA 1BNZA 5JJKA 1ENAA 2F0HA 2K7VA 1G51A 2A6HC 1MJCA 1A2UA 1VQFA 2BA1A 2DN8A 4JCVE 5IP7G 1TWAH 3ICEA 4OIJA 3W1BA 1TT2A 4MTKA 1LTLA 3R93A 4HCEA 5C4XH 1WCMB 3W3AA 4DR7Q 4CDEC 1BCPF 1K73C 2N8NA 1F2LA 3TP6A 4A3JB 5CORA 2AUJD 3N6RA 3JAME 2QILA 1X3GA 2B2YC 5T1IA 2NBFA 2IL8A 5BN3A 4K0KL 1B3QA 1DOKA 1PA6A 1VQHA 3DEPA 4FF3A 2LXKA 5JPMC 4JC0A 3TRZA 2AHOB 3NHHA 1WJJA 2JA5B 4P72A 2LFNA 4GN4B 2R93B 2VQEL 1SMYC 2K75A 4LUZA 5C4HA 5C5MA 2VQFL 2F0GA 4GNXC 1I4PA 1J9OA 3QOJA 1KHIA 2IX1A 4RKLA 2HQLA 1D8LA 3QO2A 1HNXQ 1VQLA 4HTHA 3RUZA 3GTPH 1HNXL 4P74A 4BWGB 1HA5A 4KD3A 2K1BA 4DV4Q 1LTBD 2UUBL 4OO1H 2KJXA 4G4KA 1EYCA 3X3MA 2JXMB 4C3JH 4A3DH 2R92B 5C44H 1S72A 5LMNW 1Q82C 3A5ZB 4DXFA 3SEBA 3BYYB 3S1RH 1M90C 2EYOA 1A15A 1CK1A 1JWMD 5JAVA 1C48A 1VQOA 2A68D 4AQYQ 4QJFA 5E4XA 2ZT9C 4CGYB 4IPCA 4OXPA 1XJVA 4O42A 2WKDA 2LS01 3QR8A 1MSGA 2EJMA 1VQIA 1YBYA 2F0FA 3DM1A 3HOWH 4BXXG 3K81C 1ICWA 1EOVA 1CSPA 2LKVA 2AMCB 3BVMA 2Z6BA 1JE4A 1QNUA 2CWPA 3QJYA 2K03A 4JI5L 1KDCA 5C3EG 3DLLA 4LF7Q 3PO3G 1LT6D 1TIID 3G7LA 4LF7L 2WINB 2JA7H 3T53B 1DD2A 4A3IB 1PTOB 4X3UA 1CKNB 1A3TA 2M2LA 3MXPA 3J80c 1AFPA 2KBNA 1KNEA 3F8TA 3K0YA 4KN7C 2PQAB 3QWNA 1SXTA 3CCJA 1WD0A 1EIHA 3M4QA 1OXUA 2UUAL 2E75C 1U5KA 4DV3L 1EQTA 3VYSA 3A7AB 3UDXA 3SVMA 1HJPA 1TWCH 5I6YA 1VF5C 4DKAC 2OF1A 5IT9c 4L63B 4KJNA 4BBSB 1NE3A 1OO9B 1K8OA 3VR5A 4HJ8A 4DNTB 4OEMB 2AQ2B 2VB2X 1IL2A 1F9QA 2BE5D 3I72A 3T16A 3E3XA 1A63A 1GUWA 1B4OA 4PZ7A 4QY7A 2N49A 3NP8A 1CFMA 4P2CB 1KIXA 4LWCA 1K0SA 1J8IA 3HOZG 4XQJA 2NVXH 2WB1E 1JOOA 3KLSX 2NVYB 1EIGA 3CMEA 1KLUD 2L15A 3P75A 4WRDA 4IALA 2RA4A 1TWGB 5FO9B 1LLRD 1KTKA 4QL5A 2YU9B 3W2DA 1HPCA 2JP1A 1S5CD 1A62A 3KYHC 2JA8H 3DWPA 2ZJPA 4BBSH 2K33A 4DV5L 3HOVB 1UAPA 2QF7A 1PDQA 3PO2G 1XMOQ 1RTNA 3OW2A 2Y0SE 1CZWA 1BF4A 5IYCG 2RHSB 4RWSC 2JEBI 5G3LD 5KYLA 5D3IB 2RCNA 1FJGQ 1VQ7A 3G6JB 3CPFA 1PH4A 4JI4L 4B9XA 3FPPA 2VXWA 1DGSA 4HIKA 3S1NH 4HAEA 3HOYB 1GHKA 2B8FA 2LSSA 3TQYA 2BA0A
chains in the Genus database with same CATH topology
1J6QA 3HOVH 4X66L 2I0QA 1EWIA 1SE8A 4QQBX 2F3IA 4A3MH 2K4KA 2QGQA 4A3IH 4A3FG 1HNWL 1UEBA 2KCTA 4UP9A 4A3BH 2UXBQ 4P71A 1VCIA 4HJ5A 3I56A 1OXVA 1SROA 4HJ9A 3KLWA 1IBKL 1RIPA 3PO2H 3T1HL 2B63G 2JA7G 1I6HH 5JEAG 1SMXA 1YNXA 4KHZA 4IJHA 2BH2A 4KHPL 4QIWE 4A3KG 1HNZL 1QVCA 4JI0Q 2OWOA 4UPAA 1S40A 5JJLA 3KDFB 3T1YQ 5M3MG 2E2HH 1I94Q 3HOYG 4DK6C 4GKJL 4JBKA 2UU9Q 2Z0SA 1A0IA 1P8LA 1Q12A 1Y1VG 3KF8B 4IJLA 3E9HA 2Q2HA 3PUZA 4X66Q 1YEZA 5IY0A 2Q2UA 1TWHH 2OQ0A 5IWAL 1FJGL 1SLJA 2MO1A 2JJQA 4A3EG 1E1TA 3HFZB 4DV1Q 3DM3A 1N33Q 1QZGA 4GKJQ 3CCLA 2QEXA 1QVGA 1IXRA 2VNUD 3I4MG 1AE2A 3CXCA 3HKZG 1TWFH 3AFQA 3I4NH 4DV2L 2WFWA 3S2HH 2IT1A 3K7AH 3M4PA 4DUZL 3ULPA 4JI6Q 3BJUA 4X65Q 2NN6G 2FXQA 2E5LQ 1YHQA 2UXDL 4X6AH 4TVAB 5AJ3Q 4B3TQ 4HIDA 3HOWG 2E5LL 2UXDQ 3PGZA 1CUKA 4AYBE 3PCOB 1HR0L 1G291 1C9OA 3M3YH 1K3RA 4IFDJ 2I5LX 4OWWB 1VQGA 2WAQG 4P73A 2AWNA 4HJAA 2VUMG 2PI2A 3GTKH 3M7NA 4LF9Q 3U4VA 4YCVA 3M85A 3GDEA 1KRSA 4LFAQ 4LF8L 2H5XA 1EUJA 1ASYA 1M1KC 1HNZQ 2B3GA 1WOCA 1FGUA 1UE5A 2A1AA 4XTCS 3JC66 3CPWA 2ASBA 1Q86C 2HHHL 1PFSA 2R92G 3EBEA 3STBD 3HKZE 1VQEA 3UE0A 2JA5G 5GAGC 3I4OA 4GNXA 1VQCA 3E9IA 2ZJRA 2EQSA 4RMFA 4A4IA 2K5HA 4YWKA 5IWAQ 2ZM6Q 1VQ6A 1KRTA 2JA5H 1NJIC 4DV1L 1V1QA 4MTNA 3W1GA 1PYBA 1OXXK 4R1JA 1GVPA 1Q8KA 4LFAL 4LF5Q 1JJCB 1SFOH 4DV7Q 2JK8A 4J15A 5LMNL 2Z6KA 4PZ8A 1HZCA 3H0GG 2OTLA 4POGA 4X64L 2JA6G 1YVCA 4BA1I 4JI2Q 4PZ6A 2V1CC 3STBC 3PO3H 1EIFA 4H02A 1VQNA 3CAMA 1AE3A 3E0EA 4POFA 1PH7A 1GM5A 3BU2A 1UE7A 4DUYQ 1MJEA 1AH9A 1X9NA 2UUAQ 4A3CH 1UE6A 4B3ML 4UP8A 2R92H 1YJ9A 5IYBH 3J80i 1XNRQ 5GQOA 1YI2A 1Q1BA 4C2MH 5M5XH 1X55A 4IO9A 1I50H 4LF5L 2YYZA 4ALPA 3RN2A 3S1MH 2NVTH 3J81c 3HOXG 2D0PA 1NMGA 3A0JA 2GVAA 4LFCL 5FJ8H 3I2ZA 4A3IG 4A3FH 1YJWA 1TXYA 1N9WA 4LFCQ 1X65A 2MFIA 2PI2E 4KI0A 3CCVA 2PMZE 1CKNA 3FKIH 3F2CA 1XPOA 4O2DA 1PH3A 1OXTA 4OWXB 3FP9A 4AH6A 3JAMc 5C44G 1PH1A 3PUWA 4QGUA 5EAYA 4GNXB 4AQYL 1OXSC 4JI7L 1G6PA 3G4SA 3M4OH 2YV5A 1V43A 5M3FH 1Y14B 1PYSB 2CKZB 2RF4A 3AQQA 4YHHQ 2Y0SG 3CF5A 5IP7H 2VZAA 4DV0Q 1HZBA 3AFPA 2A8VA 3ULLA 1EQRA 4DV0L 3EN2A 5K36G 1VQ9A 3S17H 4EQ5A 1W2BA 5IP9G 1VQ4A 3G6EA 1Z9FA 3EIVA 2A19A 3PIOA 1UWVA 4B3RQ 2JA9A 1JJGA 1KXLA 1I5FA 2ALYB 2Z6KC 4KLKA 4YY3L 3CD6A 4B3MQ 4HIOA 1X3EA 2XGTA 2JEAI 2R93H 4LF6L 1FL0A 3D0FA 4GKKQ 4GLAC 4DV7L 1LUZA 3CCUA 2DUDA 1JJ2A 4IPHA 1IBLQ 4O0AA 4NXNQ 3S2DH 4GS3A 1CKOA 5GAEC 3TREA 4DR7L 2E8GA 4YCWA 3W5OA 3HOUH 4AYBG 1XMQL 2VUMH 3HOVG 2F4VQ 3KF6A 1B8AA 1XPUA 1VQAA 3HOYH 2YTYA 1JT8A 1KC8C 1X54A 1HR0W 3HOXH 2CCZA 3CQZH 1H95A 1X56A 4P75A 5FLMH 2YU9H 4LF6Q 4OO1G 2MNAA 4B3SQ 3GD7A 5C0XI 4KHPQ 1N32L 1NMFA 1N32Q 4JI0L 1VQ5A 4HIMA 1NTGA 2XTIA 1FVIA 4TQUS 4A3CG 5GADC 4JV5L 1XNQL 3S15H 1E1OA 4FDBA 3PF5A 2HIVA 5IYCH 4MNOA 4X62L 1HNWQ 4C3IH 1QUQA 1YZ6A 4JBWA 1Y1VH 1WCMG 3TEHB 1JE5A 1XPRA 1A8VA 3K0XA 1WFQA 3RLOA 1L1OA 3NENA 4WJ3M 4OONA 4YCUA 2IX0A 4YWMA 4A3JH 3K7UC 3IRBA 4R4IA 4YHHL 5BR8L 5M3MH 1I3QH 1IBML 1W3SA 1GD7A 3HKSA 3G71A 1HH2P 4NXNL 4BBSG 3M9BA 3KF6B 2CQOA 4A3GH 1E3PA 1C0AA 3T1YL 4A3JG 2E2JH 2Q2IA 2D62A 4IOAA 3JAMi 2VS1A 4JBJA 4JI8L 3ULJA 4R4QA 4DR3L 1YIJA 1K9MC 5M5WH 2ZTDA 4A93G 2F52A 5IYDH 4JBMA 2MQHA 2K52A 2PQAA 5DLQE 4EX5A 3VDYA 1YJNA 3GTJH 2OTJA 2PNHA 1BBWA 4L5QA 1VQDA 4XIGS 4K0KQ 3RR5A 2K50A 4GOPA 1QVFA 1MIUA 2EXDA 2R7FA 3UDFA 3J81j 3B6YA 3FHWA 1K8AC 1BBUA 4BY7H 5E7NA 4A3LH 2KCMA 4LUOA 3WWVA 4DV6L 2HT1A 4BBRH 2K5VA 1RL2A 2R7ZH 1IBMQ 3F2BA 3J7A5 5C4JH 4DR6Q 1I94L 3NEMA 1N34L 2E2IH 2JA8G 4DUZQ 2JQOA 2VL6A 3SGIA 1Q1EA 1XTDA 4DK3C 4JI3L 2VQEQ 1N8RC 1KL9A 2F4VL 3PV0A 3K8AA 5FJ8G 4L5SA 4DR4Q 3T1HQ 5H1SE 2K5NA 2N3SA 2CWAA 5ELOA 3BZKA 4HJ7A 3AYHB 4LUVA 5LMUL 1L2FA 2VW9A 2UXCL 4LF8Q 1TWGH 2EIFA 5IYBG 5BR8Q 2UXCQ 5GAHC 3PIPA 3GTQH 3RZDH 3OTOQ 2LXJA 2MO0A 4L5RC 1NBWA 4R4CA 4Y52H 4A75A 3OTOL 4X65L 3CCQA 5FLXc 1N34Q 1K0RA 4BY7G 4B3TL 5JJKA 2B29A 1X6OA 4L5TA 4LW1A 1G51A 4NB3A 4R4OA 3ZJYC 1MJCA 1VQFA 2VQFQ 2BA1A 4JCVE 5IP7G 2UU9L 1TWAH 3GTMH 3ICEA 3W1BA 5M5YH 3FKIG 4C3HH 1LTLA 1D7QA 1CKMA 4DR1Q 2KHIA 3ERSX 3HOZH 1EQQA 3S24A 5C4XH 4DR7Q 3OYYA 5LMUQ 3L0OA 4DV6Q 4PMWA 1K73C 4JI1Q 4DV2Q 3KOJA 3RLNA 3LGJA 4DV4L 2N8NA 3AEVA 4JI6L 2OQKA 4GLXA 1SN8A 2I5HA 3UDIA 1QZHA 3I7FA 2R6GA 4BY1G 2N78A 3CCEA 4ME3A 1X3GA 1EIYB 5AJ3L 3GO5A 1PH6A 3PF4A 1Q46A 3GTOH 1X3FA 2R7DA 1HR0Q 4K0KL 1KQSA 4DR5Q 4JOIA 1PA6A 1VQHA 5FLMG 2LXKA 4JI5Q 1ASZA 4Y7NH 4JC0A 3TRZA 2AHOB 4JI1L 1WJJA 3H15A 5C3EH 4P72A 1YITA 1QUQB 1P16A 4GN4B 4X64Q 4LFBL 2VQEL 4JI3Q 4IFDI 2R93G 2K75A 1HZAA 4LUZA 4OWTB 4GN3B 1KAWA 2VQFL 1LYLA 3PSIA 5IE8A 3CCSA 4GNXC 5IYDG 2UXBL 3TS0A 4MZ9A 1KHIA 2AKWB 3D31A 2IX1A 4BXXH 2HQLA 1D8LA 3CW2C 1HNXQ 1VQLA 1PVOA 4YWLA 3GTPH 1HNXL 4P74A 1XNRL 1IZ6A 4DV4Q 2UUBL 2JE6I 2IHFA 2NZOA 3CCMA 1PHJA 4C3JH 1IYJB 4A3DH 4DR2Q 5C44H 5IP9H 1S72A 1VQPA 5LMNW 4IPDA 1Q82C 2HHHQ 4LFBQ 4GLVB 3A5ZB 2WP8J 4A3MG 3RLFA 2QA4A 3H3VH 3S1RH 1M90C 4JI2L 4GOPB 3S16H 2I5MX 3H3VI 4JG2A 5ELNA 1VQOA 4DR5L 4AQYQ 1N33L 4QJFA 3K80C 3CCRA 4BBRG 4DV3Q 5C0XG 1L1OB 4IPCA 4OXPA 4OO1I 4BA2I 3CC2A 1XJVA 4B3SL 1WI5A 1PH2A 2D0OA 1SR3A 1VQJA 3CP0A 3UDGA 1SRUA 4UY8C 1BVSA 1VQIA 1YBYA 3HOWH 2WAQE 4BXXG 4UP7A 1E24A 3K81C 1EOVA 1CSPA 2NN6I 3CC7A 2AMCB 4NXMQ 1VQKA 5J3BA 1YHBA 1R9TH 5HGQA 2CWPA 3I55A 4DUYL 3H0GH 3U50C 2GN5A 4JI5L 2ZJQA 4A3DG 5C3EG 1C7YA 3DLLA 4LF7Q 3PO3G 4LF4Q 3L7ZC 4IOCA 4LF7L 2JA7H 2DGYA 2UUBQ 1WYDA 5JJIA 3CC4A 1CKNB 3RN5A 3A5UA 1WCMH 3KFUA 4APVA 2ZTCA 3J80c 2YTVA 1XMQQ 2KBNA 5HY6A 1VQBA 2JA6H 3F8TA 4A3BG 3J81i 2PQAB 2ZM6L 3CCJA 2ES2A 3M4QA 3A74A 4WJ4A 1OXUA 4NPSA 5GROA 3KJPA 2UUAL 1O7IA 1U5KA 4RG1A 1EYGA 3I4NG 2NVYH 4DV3L 4YY3Q 1U0LA 3GTGH 1IBLL 4A3KH 1V9PA 5JEAJ 2VY3A 4AIMA 1VQMA 3UDXA 3UE1A 4JYAQ 1K8GA 1HJPA 1S3OA 1TWCH 3TS2A 2IHEA 5LMNQ 1NY4A 3I4MH 2IY5B 3L2PA 5C4XG 4DR2L 3NBHB 4DKAC 4GOPC 4A93H 5IT9c 4JI8Q 3PUXA 1VQ8A 1EFWA 2B63H 1J5EL 4DAYB 3KDFA 1NE3A 3NELA 2CFMA 4HJ8A 4R4TA 1MKHA 1K83H 1YHAA 4B3RL 1IL2A 1Z47A 1PH8A 1LM0A 3J7ZC 4JI7Q 1A63A 2R7ZG 4JI4Q 4LF4L 3Q8DA 4PZ7A 4QY7A 2NVQH 2N49A 4GKKL 1B70B 1KIXA 4JYAL 4LWCA 3F1ZA 1Q7YC 5C0XJ 3HOZG 1KD1C 2WB1E 4JOIC 1XMOL 4A3EH 2NVXH 1L1OC 4DR3Q 3CMEA 2L15A 4IFDG 4NXML 4X62Q 4DPGA 4DNIA 4BY1H 1JB7A 1Y1WH 3S14H 4QL5A 1UE1A 1GO3E 4OX9Q 3MXNB 4OX9L 1A62A 3KYHC 2C35B 2JA8H 4DV5Q 1N36Q 3PUVA 2ZJPA 1PV4A 2ID0A 1B7YB 2NZHA 4LNQA 3BZCA 4IPGA 4BBSH 2YTXA 4DV5L 1N36L 1JMCA 2KENA 2K14A 1E22A 2RHQB 3S1QH 4DR6L 1PH5A 3PO2G 1CSQA 1XMOQ 2Q2TA 1XNQQ 3OW2A 1E7ZA 2Y0SE 2BH8A 3ER0A 1J5EQ 3RZOH 4DAMA 1OTCA 5IYCG 3RNUA 2RHSB 2OCEA 2JEBI 3KJOA 1PH9A 4A3GG 4DR4L 3CMAA 1HZ9A 1Y1WG 2RCNA 3PUYA 1IBKQ 1FJGQ 4GN5A 2GVBA 4DR1L 3U4ZA 2WB1G 1VQ7A 3GTLH 3HOUG 3G48A 3CPFA 2AWOA 2ZTEA 3MEFA 1PH4A 4LF9L 1BKBA 5M3FG 4JI4L 4PG3A 2UUCQ 4A76A 3U58A 4A3LG 2UUCL 3F2DA 1VS0A 1DGSA 4HIKA 1Q81C 3S1NH 1GKHA 2LSSA 1L0WA 2ATWA 1T9HA 2KHJA 2HIXA 3TQYA 2BA0A 4JV5Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J6Q A;  3HOV H;  4X66 L;  2I0Q A;  1EWI A;  1SE8 A;  4QQB X;  2F3I A;  4A3M H;  2K4K A;  2QGQ A;  4A3I H;  4A3F G;  1HNW L;  1UEB A;  2KCT A;  4UP9 A;  4A3B H;  2UXB Q;  4P71 A;  1VCI A;  4HJ5 A;  3I56 A;  1OXV A;  1SRO A;  4HJ9 A;  3KLW A;  1IBK L;  1RIP A;  3PO2 H;  3T1H L;  2B63 G;  2JA7 G;  1I6H H;  5JEA G;  1SMX A;  1YNX A;  4KHZ A;  4IJH A;  2BH2 A;  4KHP L;  4QIW E;  4A3K G;  1HNZ L;  1QVC A;  4JI0 Q;  2OWO A;  4UPA A;  1S40 A;  5JJL A;  3KDF B;  3T1Y Q;  5M3M G;  2E2H H;  1I94 Q;  3HOY G;  4DK6 C;  4GKJ L;  4JBK A;  2UU9 Q;  2Z0S A;  1A0I A;  1P8L A;  1Q12 A;  1Y1V G;  3KF8 B;  4IJL A;  3E9H A;  2Q2H A;  3PUZ A;  4X66 Q;  1YEZ A;  5IY0 A;  2Q2U A;  1TWH H;  2OQ0 A;  5IWA L;  1FJG L;  1SLJ A;  2MO1 A;  2JJQ A;  4A3E G;  1E1T A;  3HFZ B;  4DV1 Q;  3DM3 A;  1N33 Q;  1QZG A;  4GKJ Q;  3CCL A;  2QEX A;  1QVG A;  1IXR A;  2VNU D;  3I4M G;  1AE2 A;  3CXC A;  3HKZ G;  1TWF H;  3AFQ A;  3I4N H;  4DV2 L;  2WFW A;  3S2H H;  2IT1 A;  3K7A H;  3M4P A;  4DUZ L;  3ULP A;  4JI6 Q;  3BJU A;  4X65 Q;  2NN6 G;  2FXQ A;  2E5L Q;  1YHQ A;  2UXD L;  4X6A H;  4TVA B;  5AJ3 Q;  4B3T Q;  4HID A;  3HOW G;  2E5L L;  2UXD Q;  3PGZ A;  1CUK A;  4AYB E;  3PCO B;  1HR0 L;  1G29 1;  1C9O A;  3M3Y H;  1K3R A;  4IFD J;  2I5L X;  4OWW B;  1VQG A;  2WAQ G;  4P73 A;  2AWN A;  4HJA A;  2VUM G;  2PI2 A;  3GTK H;  3M7N A;  4LF9 Q;  3U4V A;  4YCV A;  3M85 A;  3GDE A;  1KRS A;  4LFA Q;  4LF8 L;  2H5X A;  1EUJ A;  1ASY A;  1M1K C;  1HNZ Q;  2B3G A;  1WOC A;  1FGU A;  1UE5 A;  2A1A A;  4XTC S;  3JC6 6;  3CPW A;  2ASB A;  1Q86 C;  2HHH L;  1PFS A;  2R92 G;  3EBE A;  3STB D;  3HKZ E;  1VQE A;  3UE0 A;  2JA5 G;  5GAG C;  3I4O A;  4GNX A;  1VQC A;  3E9I A;  2ZJR A;  2EQS A;  4RMF A;  4A4I A;  2K5H A;  4YWK A;  5IWA Q;  2ZM6 Q;  1VQ6 A;  1KRT A;  2JA5 H;  1NJI C;  4DV1 L;  1V1Q A;  4MTN A;  3W1G A;  1PYB A;  1OXX K;  4R1J A;  1GVP A;  1Q8K A;  4LFA L;  4LF5 Q;  1JJC B;  1SFO H;  4DV7 Q;  2JK8 A;  4J15 A;  5LMN L;  2Z6K A;  4PZ8 A;  1HZC A;  3H0G G;  2OTL A;  4POG A;  4X64 L;  2JA6 G;  1YVC A;  4BA1 I;  4JI2 Q;  4PZ6 A;  2V1C C;  3STB C;  3PO3 H;  1EIF A;  4H02 A;  1VQN A;  3CAM A;  1AE3 A;  3E0E A;  4POF A;  1PH7 A;  1GM5 A;  3BU2 A;  1UE7 A;  4DUY Q;  1MJE A;  1AH9 A;  1X9N A;  2UUA Q;  4A3C H;  1UE6 A;  4B3M L;  4UP8 A;  2R92 H;  1YJ9 A;  5IYB H;  3J80 i;  1XNR Q;  5GQO A;  1YI2 A;  1Q1B A;  4C2M H;  5M5X H;  1X55 A;  4IO9 A;  1I50 H;  4LF5 L;  2YYZ A;  4ALP A;  3RN2 A;  3S1M H;  2NVT H;  3J81 c;  3HOX G;  2D0P A;  1NMG A;  3A0J A;  2GVA A;  4LFC L;  5FJ8 H;  3I2Z A;  4A3I G;  4A3F H;  1YJW A;  1TXY A;  1N9W A;  4LFC Q;  1X65 A;  2MFI A;  2PI2 E;  4KI0 A;  3CCV A;  2PMZ E;  1CKN A;  3FKI H;  3F2C A;  1XPO A;  4O2D A;  1PH3 A;  1OXT A;  4OWX B;  3FP9 A;  4AH6 A;  3JAM c;  5C44 G;  1PH1 A;  3PUW A;  4QGU A;  5EAY A;  4GNX B;  4AQY L;  1OXS C;  4JI7 L;  1G6P A;  3G4S A;  3M4O H;  2YV5 A;  1V43 A;  5M3F H;  1Y14 B;  1PYS B;  2CKZ B;  2RF4 A;  3AQQ A;  4YHH Q;  2Y0S G;  3CF5 A;  5IP7 H;  2VZA A;  4DV0 Q;  1HZB A;  3AFP A;  2A8V A;  3ULL A;  1EQR A;  4DV0 L;  3EN2 A;  5K36 G;  1VQ9 A;  3S17 H;  4EQ5 A;  1W2B A;  5IP9 G;  1VQ4 A;  3G6E A;  1Z9F A;  3EIV A;  2A19 A;  3PIO A;  1UWV A;  4B3R Q;  2JA9 A;  1JJG A;  1KXL A;  1I5F A;  2ALY B;  2Z6K C;  4KLK A;  4YY3 L;  3CD6 A;  4B3M Q;  4HIO A;  1X3E A;  2XGT A;  2JEA I;  2R93 H;  4LF6 L;  1FL0 A;  3D0F A;  4GKK Q;  4GLA C;  4DV7 L;  1LUZ A;  3CCU A;  2DUD A;  1JJ2 A;  4IPH A;  1IBL Q;  4O0A A;  4NXN Q;  3S2D H;  4GS3 A;  1CKO A;  5GAE C;  3TRE A;  4DR7 L;  2E8G A;  4YCW A;  3W5O A;  3HOU H;  4AYB G;  1XMQ L;  2VUM H;  3HOV G;  2F4V Q;  3KF6 A;  1B8A A;  1XPU A;  1VQA A;  3HOY H;  2YTY A;  1JT8 A;  1KC8 C;  1X54 A;  1HR0 W;  3HOX H;  2CCZ A;  3CQZ H;  1H95 A;  1X56 A;  4P75 A;  5FLM H;  2YU9 H;  4LF6 Q;  4OO1 G;  2MNA A;  4B3S Q;  3GD7 A;  5C0X I;  4KHP Q;  1N32 L;  1NMF A;  1N32 Q;  4JI0 L;  1VQ5 A;  4HIM A;  1NTG A;  2XTI A;  1FVI A;  4TQU S;  4A3C G;  5GAD C;  4JV5 L;  1XNQ L;  3S15 H;  1E1O A;  4FDB A;  3PF5 A;  2HIV A;  5IYC H;  4MNO A;  4X62 L;  1HNW Q;  4C3I H;  1QUQ A;  1YZ6 A;  4JBW A;  1Y1V H;  1WCM G;  3TEH B;  1JE5 A;  1XPR A;  1A8V A;  3K0X A;  1WFQ A;  3RLO A;  1L1O A;  3NEN A;  4WJ3 M;  4OON A;  4YCU A;  2IX0 A;  4YWM A;  4A3J H;  3K7U C;  3IRB A;  4R4I A;  4YHH L;  5BR8 L;  5M3M H;  1I3Q H;  1IBM L;  1W3S A;  1GD7 A;  3HKS A;  3G71 A;  1HH2 P;  4NXN L;  4BBS G;  3M9B A;  3KF6 B;  2CQO A;  4A3G H;  1E3P A;  1C0A A;  3T1Y L;  4A3J G;  2E2J H;  2Q2I A;  2D62 A;  4IOA A;  3JAM i;  2VS1 A;  4JBJ A;  4JI8 L;  3ULJ A;  4R4Q A;  4DR3 L;  1YIJ A;  1K9M C;  5M5W H;  2ZTD A;  4A93 G;  2F52 A;  5IYD H;  4JBM A;  2MQH A;  2K52 A;  2PQA A;  5DLQ E;  4EX5 A;  3VDY A;  1YJN A;  3GTJ H;  2OTJ A;  2PNH A;  1BBW A;  4L5Q A;  1VQD A;  4XIG S;  4K0K Q;  3RR5 A;  2K50 A;  4GOP A;  1QVF A;  1MIU A;  2EXD A;  2R7F A;  3UDF A;  3J81 j;  3B6Y A;  3FHW A;  1K8A C;  1BBU A;  4BY7 H;  5E7N A;  4A3L H;  2KCM A;  4LUO A;  3WWV A;  4DV6 L;  2HT1 A;  4BBR H;  2K5V A;  1RL2 A;  2R7Z H;  1IBM Q;  3F2B A;  3J7A 5;  5C4J H;  4DR6 Q;  1I94 L;  3NEM A;  1N34 L;  2E2I H;  2JA8 G;  4DUZ Q;  2JQO A;  2VL6 A;  3SGI A;  1Q1E A;  1XTD A;  4DK3 C;  4JI3 L;  2VQE Q;  1N8R C;  1KL9 A;  2F4V L;  3PV0 A;  3K8A A;  5FJ8 G;  4L5S A;  4DR4 Q;  3T1H Q;  5H1S E;  2K5N A;  2N3S A;  2CWA A;  5ELO A;  3BZK A;  4HJ7 A;  3AYH B;  4LUV A;  5LMU L;  1L2F A;  2VW9 A;  2UXC L;  4LF8 Q;  1TWG H;  2EIF A;  5IYB G;  5BR8 Q;  2UXC Q;  5GAH C;  3PIP A;  3GTQ H;  3RZD H;  3OTO Q;  2LXJ A;  2MO0 A;  4L5R C;  1NBW A;  4R4C A;  4Y52 H;  4A75 A;  3OTO L;  4X65 L;  3CCQ A;  5FLX c;  1N34 Q;  1K0R A;  4BY7 G;  4B3T L;  5JJK A;  2B29 A;  1X6O A;  4L5T A;  4LW1 A;  1G51 A;  4NB3 A;  4R4O A;  3ZJY C;  1MJC A;  1VQF A;  2VQF Q;  2BA1 A;  4JCV E;  5IP7 G;  2UU9 L;  1TWA H;  3GTM H;  3ICE A;  3W1B A;  5M5Y H;  3FKI G;  4C3H H;  1LTL A;  1D7Q A;  1CKM A;  4DR1 Q;  2KHI A;  3ERS X;  3HOZ H;  1EQQ A;  3S24 A;  5C4X H;  4DR7 Q;  3OYY A;  5LMU Q;  3L0O A;  4DV6 Q;  4PMW A;  1K73 C;  4JI1 Q;  4DV2 Q;  3KOJ A;  3RLN A;  3LGJ A;  4DV4 L;  2N8N A;  3AEV A;  4JI6 L;  2OQK A;  4GLX A;  1SN8 A;  2I5H A;  3UDI A;  1QZH A;  3I7F A;  2R6G A;  4BY1 G;  2N78 A;  3CCE A;  4ME3 A;  1X3G A;  1EIY B;  5AJ3 L;  3GO5 A;  1PH6 A;  3PF4 A;  1Q46 A;  3GTO H;  1X3F A;  2R7D A;  1HR0 Q;  4K0K L;  1KQS A;  4DR5 Q;  4JOI A;  1PA6 A;  1VQH A;  5FLM G;  2LXK A;  4JI5 Q;  1ASZ A;  4Y7N H;  4JC0 A;  3TRZ A;  2AHO B;  4JI1 L;  1WJJ A;  3H15 A;  5C3E H;  4P72 A;  1YIT A;  1QUQ B;  1P16 A;  4GN4 B;  4X64 Q;  4LFB L;  2VQE L;  4JI3 Q;  4IFD I;  2R93 G;  2K75 A;  1HZA A;  4LUZ A;  4OWT B;  4GN3 B;  1KAW A;  2VQF L;  1LYL A;  3PSI A;  5IE8 A;  3CCS A;  4GNX C;  5IYD G;  2UXB L;  3TS0 A;  4MZ9 A;  1KHI A;  2AKW B;  3D31 A;  2IX1 A;  4BXX H;  2HQL A;  1D8L A;  3CW2 C;  1HNX Q;  1VQL A;  1PVO A;  4YWL A;  3GTP H;  1HNX L;  4P74 A;  1XNR L;  1IZ6 A;  4DV4 Q;  2UUB L;  2JE6 I;  2IHF A;  2NZO A;  3CCM A;  1PHJ A;  4C3J H;  1IYJ B;  4A3D H;  4DR2 Q;  5C44 H;  5IP9 H;  1S72 A;  1VQP A;  5LMN W;  4IPD A;  1Q82 C;  2HHH Q;  4LFB Q;  4GLV B;  3A5Z B;  2WP8 J;  4A3M G;  3RLF A;  2QA4 A;  3H3V H;  3S1R H;  1M90 C;  4JI2 L;  4GOP B;  3S16 H;  2I5M X;  3H3V I;  4JG2 A;  5ELN A;  1VQO A;  4DR5 L;  4AQY Q;  1N33 L;  4QJF A;  3K80 C;  3CCR A;  4BBR G;  4DV3 Q;  5C0X G;  1L1O B;  4IPC A;  4OXP A;  4OO1 I;  4BA2 I;  3CC2 A;  1XJV A;  4B3S L;  1WI5 A;  1PH2 A;  2D0O A;  1SR3 A;  1VQJ A;  3CP0 A;  3UDG A;  1SRU A;  4UY8 C;  1BVS A;  1VQI A;  1YBY A;  3HOW H;  2WAQ E;  4BXX G;  4UP7 A;  1E24 A;  3K81 C;  1EOV A;  1CSP A;  2NN6 I;  3CC7 A;  2AMC B;  4NXM Q;  1VQK A;  5J3B A;  1YHB A;  1R9T H;  5HGQ A;  2CWP A;  3I55 A;  4DUY L;  3H0G H;  3U50 C;  2GN5 A;  4JI5 L;  2ZJQ A;  4A3D G;  5C3E G;  1C7Y A;  3DLL A;  4LF7 Q;  3PO3 G;  4LF4 Q;  3L7Z C;  4IOC A;  4LF7 L;  2JA7 H;  2DGY A;  2UUB Q;  1WYD A;  5JJI A;  3CC4 A;  1CKN B;  3RN5 A;  3A5U A;  1WCM H;  3KFU A;  4APV A;  2ZTC A;  3J80 c;  2YTV A;  1XMQ Q;  2KBN A;  5HY6 A;  1VQB A;  2JA6 H;  3F8T A;  4A3B G;  3J81 i;  2PQA B;  2ZM6 L;  3CCJ A;  2ES2 A;  3M4Q A;  3A74 A;  4WJ4 A;  1OXU A;  4NPS A;  5GRO A;  3KJP A;  2UUA L;  1O7I A;  1U5K A;  4RG1 A;  1EYG A;  3I4N G;  2NVY H;  4DV3 L;  4YY3 Q;  1U0L A;  3GTG H;  1IBL L;  4A3K H;  1V9P A;  5JEA J;  2VY3 A;  4AIM A;  1VQM A;  3UDX A;  3UE1 A;  4JYA Q;  1K8G A;  1HJP A;  1S3O A;  1TWC H;  3TS2 A;  2IHE A;  5LMN Q;  1NY4 A;  3I4M H;  2IY5 B;  3L2P A;  5C4X G;  4DR2 L;  3NBH B;  4DKA C;  4GOP C;  4A93 H;  5IT9 c;  4JI8 Q;  3PUX A;  1VQ8 A;  1EFW A;  2B63 H;  1J5E L;  4DAY B;  3KDF A;  1NE3 A;  3NEL A;  2CFM A;  4HJ8 A;  4R4T A;  1MKH A;  1K83 H;  1YHA A;  4B3R L;  1IL2 A;  1Z47 A;  1PH8 A;  1LM0 A;  3J7Z C;  4JI7 Q;  1A63 A;  2R7Z G;  4JI4 Q;  4LF4 L;  3Q8D A;  4PZ7 A;  4QY7 A;  2NVQ H;  2N49 A;  4GKK L;  1B70 B;  1KIX A;  4JYA L;  4LWC A;  3F1Z A;  1Q7Y C;  5C0X J;  3HOZ G;  1KD1 C;  2WB1 E;  4JOI C;  1XMO L;  4A3E H;  2NVX H;  1L1O C;  4DR3 Q;  3CME A;  2L15 A;  4IFD G;  4NXM L;  4X62 Q;  4DPG A;  4DNI A;  4BY1 H;  1JB7 A;  1Y1W H;  3S14 H;  4QL5 A;  1UE1 A;  1GO3 E;  4OX9 Q;  3MXN B;  4OX9 L;  1A62 A;  3KYH C;  2C35 B;  2JA8 H;  4DV5 Q;  1N36 Q;  3PUV A;  2ZJP A;  1PV4 A;  2ID0 A;  1B7Y B;  2NZH A;  4LNQ A;  3BZC A;  4IPG A;  4BBS H;  2YTX A;  4DV5 L;  1N36 L;  1JMC A;  2KEN A;  2K14 A;  1E22 A;  2RHQ B;  3S1Q H;  4DR6 L;  1PH5 A;  3PO2 G;  1CSQ A;  1XMO Q;  2Q2T A;  1XNQ Q;  3OW2 A;  1E7Z A;  2Y0S E;  2BH8 A;  3ER0 A;  1J5E Q;  3RZO H;  4DAM A;  1OTC A;  5IYC G;  3RNU A;  2RHS B;  2OCE A;  2JEB I;  3KJO A;  1PH9 A;  4A3G G;  4DR4 L;  3CMA A;  1HZ9 A;  1Y1W G;  2RCN A;  3PUY A;  1IBK Q;  1FJG Q;  4GN5 A;  2GVB A;  4DR1 L;  3U4Z A;  2WB1 G;  1VQ7 A;  3GTL H;  3HOU G;  3G48 A;  3CPF A;  2AWO A;  2ZTE A;  3MEF A;  1PH4 A;  4LF9 L;  1BKB A;  5M3F G;  4JI4 L;  4PG3 A;  2UUC Q;  4A76 A;  3U58 A;  4A3L G;  2UUC L;  3F2D A;  1VS0 A;  1DGS A;  4HIK A;  1Q81 C;  3S1N H;  1GKH A;  2LSS A;  1L0W A;  2ATW A;  1T9H A;  2KHJ A;  2HIX A;  3TQY A;  2BA0 A;  4JV5 Q; 
#chains in the Genus database with same CATH topology
 1EWI A;  1SYE A;  1UEB A;  4FP5 D;  2ENB A;  4C2M B;  4IUQ A;  5M5X B;  3TDQ A;  1IBK L;  3KLW A;  3S1Q B;  1DZ1 A;  2EJF C;  3K7A B;  4TSS A;  5FO8 B;  4IJH A;  4I7A A;  4QIW E;  4A3K G;  1HNZ L;  4C1N K;  5CV9 A;  1S40 A;  5JJL A;  1I94 Q;  3CU7 A;  4JBK A;  1PRT C;  1A0I A;  1Y1V G;  1D1K A;  4FXK C;  3E9H A;  4X66 Q;  2B2T C;  1YEZ A;  2MPM A;  5IY0 A;  1CQV A;  5IWA L;  2JJQ A;  4KJO A;  2GA4 B;  2K04 A;  1QVG A;  1IXR A;  2WV6 D;  1TY0 A;  3CXC A;  5CV4 A;  3JAM L;  3GP7 A;  3TZD A;  4L6T B;  2IT1 A;  2F0K A;  4JI6 Q;  3M4P A;  1TWF B;  3ULP A;  4CKB A;  4X65 Q;  2UXD L;  4X6A H;  1KLG D;  3NQI A;  2E5L L;  1CUK A;  4AYB E;  4IFD J;  1C9O A;  2EJG C;  2R7Z B;  1NAP A;  5I2Y A;  4P73 A;  4LF9 Q;  3HRZ C;  4IUV A;  4B9W A;  1EUJ A;  1JB3 A;  4RAU C;  1UE5 A;  3CPW A;  2SNS A;  4HSV A;  4DF7 A;  1XWE A;  4FNF A;  1B44 D;  3Q24 A;  4EGV A;  1G8Z D;  3H3V C;  3HKZ E;  1VQE A;  2JA5 G;  3CQZ B;  3I4O A;  4GNX A;  4K8J A;  2EQS A;  1NJI C;  3BYT B;  5IGG A;  1V1Q A;  4TRD A;  2F0D A;  1GVP A;  3BDL A;  4LFA L;  3I4L A;  2K01 A;  2L55 A;  4J15 A;  2J4X A;  3R3O A;  1HZC A;  4POG A;  2EY1 A;  2F0L A;  3GTG B;  2CW0 C;  1EIF A;  4H02 A;  1BCP B;  3E0E A;  1GM5 A;  4POF A;  3BU2 A;  3MHB A;  4K14 A;  2QKI C;  1GUG A;  3I8Z A;  1TU2 B;  4WOR A;  5IYB H;  1VDZ A;  1W6J A;  1YI2 A;  3NTI A;  4LF5 L;  1X55 A;  4IO9 A;  2OEO A;  5I2X A;  2D0P A;  4KD4 A;  1NMG A;  3A0J A;  3IFT A;  5FJ8 H;  5KRU A;  4A3I G;  3D8G A;  3H91 A;  2PI2 E;  4X3K A;  3CCV A;  1CKN A;  1PH3 A;  4H13 C;  5EQ0 A;  4OWX B;  4AH6 A;  2L4N A;  1CTM A;  2E2H B;  2XRQ D;  5EAY A;  1II3 A;  1DOL A;  4DU9 A;  1G6P A;  5IOC A;  4ZCK A;  1I4R A;  4F87 A;  5M3F H;  2CKZ B;  4YHH Q;  4QIW B;  1SNO A;  3CF5 A;  3OSO A;  1H9J A;  3AFP A;  2A8V A;  3T56 B;  1PMR A;  4C3H G;  1I4G A;  5I9O A;  2PPB C;  4QMG A;  3V96 A;  1FR3 A;  1JJG A;  1UWV A;  4B3R Q;  2KCC A;  5EKK A;  2RKS A;  5T1G A;  2HCC A;  3EJI A;  1HTL D;  4KTA A;  2Z6K C;  2B63 B;  1YNN D;  4CDC C;  4B3M Q;  4HIO A;  2JEA I;  4IUR A;  3I90 A;  2AUK A;  3AU7 A;  1JCK B;  2DUD A;  2IX3 A;  4GS3 A;  3MEH A;  2ICI A;  2EDG A;  4AYB G;  4PQX A;  1SNC A;  1TQO A;  1VQA A;  2PW5 A;  1I4X A;  1BXT A;  1X54 A;  2CVR A;  2K28 A;  3CQZ H;  1H95 A;  1BUV T;  4OO1 G;  4IN3 A;  5C0X I;  4KHP Q;  2F0W A;  5GAD C;  2MJ8 A;  3S15 H;  3PF5 A;  5KIX A;  4XDX A;  1HNW Q;  1O7L A;  4C3I H;  1B9M A;  1WCM G;  1XPR A;  1TR5 A;  3J7A V;  3BG3 A;  3BDO A;  4R4I A;  3K57 A;  5BR8 L;  1H9M A;  5M3M H;  4A3G H;  1HH2 P;  1C0A A;  3M9B A;  3PIP 3;  3T1Y L;  1WVL A;  2D62 A;  3JAM i;  4JI8 L;  4S3S A;  4R4Q A;  4RCN A;  1YIJ A;  2XRS D;  5M5W H;  2MQH A;  1Q3L A;  2K52 A;  3VDY A;  3GV6 A;  1B2T A;  1BBW A;  4L5Q A;  3UDF A;  1K8A C;  3J81 j;  3B6Y A;  4I65 A;  5FOB B;  1FNV A;  3RZO B;  4ABN A;  1IBM Q;  5FLX E;  2B2V A;  2I07 B;  5CBA E;  3NEM A;  4C3H B;  1N34 L;  2E2I H;  2JQO A;  1O78 A;  2F3V A;  5KGU A;  4CJ0 B;  4JI3 L;  2F0I A;  5EPJ A;  2F4V L;  2F3W A;  5FJ8 G;  4IFD H;  5ELB A;  1EEF D;  5H1S E;  3HOU B;  2CWA A;  5CMD A;  3AYH B;  1L2F A;  2UXC L;  5IYB G;  2UXC Q;  2IW3 A;  1PLF A;  3OTO Q;  2LXJ A;  2MO0 A;  4R4C A;  1F2M A;  3A7L A;  1F9R A;  1K0R A;  3TN2 A;  4BY7 G;  2B29 A;  4NB3 A;  4L5T A;  2UU9 L;  3GTM H;  2F0J A;  5BN4 A;  2QW7 A;  2K5W A;  3LX0 A;  5M5Y H;  4C3H H;  1EL0 A;  2F0M A;  5C3X A;  3HOZ H;  1MI2 A;  2Z4I A;  3OYY A;  3KBG A;  4DAY A;  5LMU Q;  1WTO A;  1EQV A;  3KK7 A;  4OGQ C;  4PMW A;  4DV2 Q;  2EYM A;  3BS1 A;  4DV4 L;  1A6X A;  3IL8 A;  3MFY A;  4CDD C;  3GTK B;  2EY6 A;  4ZLT F;  4OEL B;  4GLX A;  2I5H A;  1QZH A;  3I7F A;  4BY1 G;  4B08 A;  1EFI D;  2N78 A;  4ME3 A;  4Q0F A;  3GO5 A;  3C1F A;  3PF4 A;  3GTO H;  1X3F A;  5E1F A;  1KQS A;  5FLM G;  1A2T A;  5HGT A;  1NCV A;  2CHB D;  3ERQ A;  2K5Q A;  4JI1 L;  4ZAI A;  5IT9 E;  3MC0 B;  1QUQ B;  1P16 A;  4X64 Q;  4HMI A;  2KEE A;  4GN3 B;  1SE2 A;  5IE8 A;  2QCP X;  3CCS A;  1E2W A;  4H44 C;  2RCF A;  4MZ9 A;  2AQ1 B;  1AZP A;  1SNM A;  1PVO A;  2VUM B;  1XNR L;  4RHR A;  2PZW A;  2JE6 I;  2IHF A;  3EFX D;  3VR2 A;  4DR2 Q;  3CRK C;  1VQP A;  2HHH Q;  4IPD A;  4LFB Q;  3H3V H;  2DJF C;  3T13 A;  1SAP A;  4C56 C;  1RJT A;  4GOP B;  3H3V I;  4JG2 A;  4NMZ A;  5ELN A;  2A73 B;  1EZ6 A;  2WAQ B;  1A3U A;  4BBR G;  3T51 B;  1B1Z A;  5C0X G;  1L1O B;  2K6A A;  1HFG A;  3HOW B;  3URY A;  1HXY D;  1SR3 A;  4BY1 B;  3CP0 A;  3UDG A;  3NTK A;  2WAQ E;  4TKO B;  4NXM Q;  5J3B A;  1ILQ A;  1R9T H;  2KVM A;  3H6M A;  5D3D A;  2GN5 A;  2ZJQ A;  3KLR A;  2WAC A;  1C7Y A;  4RA8 A;  4LF4 Q;  4MHE A;  4RGT A;  5JJI A;  3S9W A;  3RN5 A;  3KFU A;  1WCM H;  2ZTC A;  1JR0 D;  4KY6 A;  3SK8 A;  5BN5 A;  1VQB A;  2JA6 H;  3DXJ C;  3J81 i;  1H9K A;  3A74 A;  4WJ4 A;  1ROD A;  3KJP A;  1XYI A;  2WB1 B;  5ELD A;  4FF2 A;  1F9P A;  4YY3 Q;  5I6W A;  1U4M A;  4A3K H;  2VY3 A;  1SE4 A;  1VQM A;  4ZK9 B;  4JYA Q;  3H0G B;  4KKU A;  5LMN Q;  5C4X G;  3L2P A;  3C2P A;  1F77 A;  4ME5 A;  3Q23 A;  1V1O A;  4A93 H;  4JI8 Q;  2B63 H;  4G7Z C;  3HEJ A;  2KED A;  2CFM A;  1BR9 A;  1K83 H;  1YHA A;  4B3R L;  1H9S B;  1Z47 A;  1PYW D;  1D5Z C;  4ZRZ A;  4JI4 Q;  3MXG A;  2A69 D;  2VB3 X;  2CQA A;  3F1Z A;  1PZI D;  2Z1C A;  1Q7Y C;  1KD1 C;  4WFN 3;  3MXU A;  1L1O C;  4KHV A;  1FGB D;  2NB0 A;  4X62 Q;  3D3R A;  4K5W A;  4DPG A;  4BY1 H;  1Y1W H;  3Q6S A;  2OXP A;  4OX9 L;  3C3L A;  2D9U A;  2C35 B;  1WTV A;  2SOB A;  4DV5 Q;  3PUV A;  4WJ3 M;  1B7Y B;  1EY9 A;  4LNQ A;  4KV6 A;  1N36 L;  1CM9 A;  2PZT A;  2RHQ B;  3S1Q H;  1JWS D;  1S5B D;  1PH5 A;  1CA6 A;  4XQQ A;  1STA A;  1GJX A;  4ZYS A;  1J5E Q;  3RZO H;  3ER0 A;  1DYQ A;  4DAM A;  1RD9 D;  1OTC A;  1AP0 A;  2OCE A;  3CMA A;  1DXM A;  1Y1W G;  3ERO A;  4GN5 A;  2GVB A;  3GTL H;  1RDP D;  2ZTE A;  5M3F G;  1L0Y B;  4PG3 A;  2UUC Q;  1AEX A;  1V8Q A;  4EQN A;  4A3L G;  2UUC L;  4JPB W;  3I91 A;  2ATW A;  1T9H A;  4K2L A;  4XT3 B;  1BOS A;  1IHZ A;  4X66 L;  2I0Q A;  1SE8 A;  4QQB X;  2QGQ A;  4A3I H;  5KEE A;  1HNW L;  1LTG D;  3SK6 A;  4BS9 A;  1Y8O B;  4HJ9 A;  3MTS A;  2B63 G;  1I6H H;  1EY0 A;  2A6E C;  2L1B A;  4KHP L;  3DUZ A;  3KDF B;  3T1Y Q;  4UDU C;  1SJH D;  2BDO A;  1Q12 A;  1ZYR C;  5KNB A;  2PMZ B;  5A2Q L;  4A3G B;  3K5N A;  2Q2U A;  3EQL C;  5K5P A;  5IGD A;  3DM3 A;  3S14 B;  3QB3 A;  1XTC D;  3CCL A;  1SND A;  1NR2 A;  1PZJ D;  1STH A;  3D6W A;  2SDF A;  3AFQ A;  4DK0 A;  3GTM B;  4DV2 L;  3K5M A;  3K7A H;  1H9R A;  5ELE A;  2NN6 G;  2E5L Q;  5CBE E;  5AJ3 Q;  3PGZ A;  2EVB A;  1HR0 L;  1K3R A;  2XN9 C;  3I3C A;  1PXU A;  4OWW B;  1VQG A;  3GTK H;  1PFB A;  3GDE A;  1O7Z A;  2H5X A;  1BDO A;  1ASY A;  1M1K C;  5EGT A;  1EY6 A;  1FGU A;  3EVQ A;  3KUP A;  1TY2 A;  5CGK A;  2EY5 A;  3K5L A;  2F0S A;  3UE0 A;  5J39 A;  1ILP A;  3L3O C;  2B39 A;  4C3J B;  2K5H A;  4YWK A;  2HD3 A;  1VQ6 A;  1K8M A;  1LTR D;  4RCO A;  5KYI A;  4DV1 L;  1PYB A;  5CC4 A;  4R1J A;  2NZ1 D;  3VR3 A;  4LF5 Q;  2NTS A;  2PCF B;  2JK8 A;  5LMN L;  4PZ8 A;  2OTL A;  2F0T A;  4X64 L;  2KQ3 A;  4JI2 Q;  2V1C C;  3PO3 H;  2V4D A;  1VQN A;  4C3I G;  3CAM A;  1PH7 A;  4DUY Q;  1MHW C;  1JQY D;  1X32 A;  1AH9 A;  4KN4 C;  1X3P A;  4RH6 A;  1ET9 A;  4A3C H;  1YJ9 A;  2DNE A;  4HSP A;  3J80 i;  1XNR Q;  5GQO A;  2PNR C;  3TP7 A;  4OIK A;  1SBB B;  2YYZ A;  4ALP A;  4PV1 C;  3RN2 A;  2NVT H;  1UEA B;  3OMC A;  5M5Y B;  1YJW A;  2JN4 A;  2MFI A;  4KI0 A;  4K6D A;  3F2C A;  1XPO A;  3MWY W;  3PUW A;  4QGU A;  3WDN A;  4DFA A;  4AQY L;  4UAI A;  2E2J B;  3AQQ A;  1MBY A;  3BVG A;  3Q22 A;  3C46 A;  3L9A X;  2Y0S G;  2MGS A;  5IGE A;  3SR1 A;  4HR7 B;  5A35 A;  3ULL A;  1EQR A;  2A6H D;  3EN2 A;  2JA8 B;  5K36 G;  4EQ5 A;  1YNN C;  1X3Q A;  4Y7N B;  2DY8 A;  4IUU A;  3PIO A;  3NUC A;  1KXL A;  2ICE C;  3FMC A;  4M1U B;  4KLK A;  4IQZ A;  1R4P B;  2XGT A;  1FL0 A;  4GKK Q;  4GLA C;  1U4L A;  2RQX A;  4DV7 L;  1JJ2 A;  5GAE C;  1CKO A;  3NSW A;  3TRE A;  1SDF A;  1T5E A;  1RKN A;  1I3Q B;  3W5O A;  1FD7 D;  4K5V A;  3HOV G;  5M3F B;  2XIW A;  1B8A A;  1XPU A;  4N9P A;  2YTY A;  1HR0 W;  4Q5V A;  4P75 A;  4LF6 Q;  4RGM A;  5A2Q E;  1ET6 A;  4MIU A;  5LHY 1;  5D14 A;  1VQ5 A;  4HIM A;  4JV5 L;  2HUG A;  3PO2 B;  5JPN C;  1E1O A;  4FDB A;  3J80 L;  1S5F D;  4X62 L;  4MNO A;  2O5I C;  2IJ0 A;  4JBW A;  2L0C A;  3K0X A;  1L1O A;  1BCP C;  4XYQ A;  4OON A;  3FKI B;  4YWM A;  4IUT A;  3MVV A;  3BVZ A;  1EU4 A;  2F0U A;  1W3S A;  3OW7 A;  3HKS A;  2CQO A;  2E2J H;  1XX8 A;  4OHJ A;  3A8J E;  3IFD A;  1F2Y A;  1MGS A;  1K9M C;  4A3K B;  2ZTD A;  2F52 A;  5L37 A;  4JBM A;  2OTJ A;  3TZU A;  2PQA A;  5DLQ E;  3E6Z X;  2SNM A;  1VQD A;  5FO7 B;  4GOP A;  5D65 A;  4DAV A;  4HCS A;  2R7F A;  1BBU A;  5E7N A;  2BDN A;  3WWV A;  1HFN A;  1Y1V B;  2R7Z H;  3F2B A;  3J7A 5;  1GUO A;  2G9H D;  1LT5 D;  2VL6 A;  3SGI A;  4DK3 C;  1Y8P B;  4C1N I;  3K8A A;  2XWJ B;  3BZK A;  4DNR B;  3PO3 B;  5LMU L;  5FLX L;  1NUC A;  3GTQ B;  1IKL A;  2VW9 A;  1ESR A;  1EY4 A;  1TWG H;  3A54 A;  4FF1 A;  2XVS A;  5GAH C;  1EWC A;  5CV5 A;  2EE1 A;  4B3T L;  1QE6 A;  2PO4 A;  2VQF Q;  4LW1 A;  3FKI G;  1D7Q A;  1EY5 A;  1CKM A;  5C3E B;  2KHI A;  1UNS A;  2KHS A;  1WTR A;  1STN A;  3FRP B;  3TBI B;  4DV6 Q;  5AFW A;  4JI1 Q;  3RLN A;  3LGJ A;  4PMB A;  2OQK A;  3MAQ A;  3OPO A;  1Y69 U;  4Z9C B;  2R6G A;  5HUR A;  1HQM C;  2I46 A;  1G91 A;  1CHP D;  5AJ3 L;  1Q46 A;  2R7D A;  4L8J A;  3D4R A;  4JOI A;  1DON A;  4JI5 Q;  3MFG A;  4Y7N H;  1VF7 A;  4QB4 A;  2D5D A;  2FMM A;  1PZK D;  2O4X A;  3H15 A;  5KND A;  1PFN A;  3C1E A;  2A74 C;  1K28 A;  1QNK A;  3NTH A;  4JI3 Q;  1PRT B;  4OWT B;  3J81 E;  4IUP A;  2UXB L;  2BOS A;  2AKW B;  3D31 A;  4BXX H;  3CW2 C;  3VA5 A;  4YWL A;  4V19 0;  4C3J G;  1EWH A;  4H7B A;  1R4Q B;  1WTW A;  2JSO A;  5EPK A;  3UI2 A;  2NZO A;  1PHJ A;  1IYJ B;  1R9T B;  5CV7 A;  5IP9 H;  4GLV B;  2WP8 J;  3CKI B;  5EBC A;  2QA4 A;  5JVG 3;  4A3M G;  3IAY A;  2I5M X;  4N8F A;  4R9W A;  4DR5 L;  2Z4H A;  1WTX A;  3K80 C;  4UHV A;  3CCR A;  4DV3 Q;  4OO1 I;  4BA2 I;  3CC2 A;  2BE5 C;  5EJW A;  2PYK A;  1WI5 A;  2D0O A;  3E5S A;  4UY8 C;  1BVS A;  1WTP A;  4UP7 A;  1E24 A;  3SHL A;  1B50 A;  5M3M B;  3R8B A;  1DM0 B;  2R61 A;  5HGQ A;  3I55 A;  4X3S A;  3H0G H;  4ULL A;  2EYF A;  2F4I A;  3N52 A;  3L7Z C;  2DGY A;  3S1R B;  1WYD A;  3CC4 A;  3D4W A;  4APV A;  2NVQ B;  1XMQ Q;  5HY6 A;  4NP5 A;  1T5X D;  4ILW A;  4A3B G;  1TVX A;  4IUN A;  1G6Z A;  4NPS A;  2KCN A;  5GRO A;  1O7I A;  3I4N G;  1EYG A;  2H1E A;  2RSN A;  3P1H A;  1K8G A;  1GUS A;  1S3O A;  2IHE A;  1NY4 A;  2IWH A;  1ZEQ X;  3U9S A;  1HCZ A;  3SE0 A;  4HN7 A;  1KDA A;  1J5E L;  1LT3 D;  1I50 B;  4QUF A;  4R4T A;  1MKH A;  3KBX A;  3S1M B;  4ODG A;  5CV8 A;  3J7Z C;  4JI7 Q;  4F8M A;  4ZUJ A;  5EKI A;  5DNF A;  2NVQ H;  1B70 B;  5KNC A;  5C0X J;  4JOI C;  2HCI A;  4A3E H;  1XMO L;  4DR3 Q;  1HRJ A;  4IFD G;  4FVM A;  3RD4 A;  1JB7 A;  5C6A A;  3I4M B;  3S14 H;  1UE1 A;  4OX9 Q;  3MXN B;  4K5X A;  3PQI A;  2CW0 D;  1N36 Q;  3IKJ A;  2NZH A;  4A3G G;  4CJ1 B;  2F0E A;  2K14 A;  1E22 A;  1TWA B;  4AYB B;  4DR6 L;  2G9D A;  1V1P A;  1V1P B;  1Y8N B;  4DA2 A;  2BH8 A;  1SYB A;  4EQP A;  5CR3 A;  4DR4 L;  1TS3 A;  2D2C C;  3NBH A;  1QG7 A;  1IBK Q;  3U4Z A;  3HOU G;  3G48 A;  4RGO S;  2M9V A;  4LF9 L;  1BKB A;  1WD1 A;  4A76 A;  4FXD A;  1JIC A;  1VS0 A;  1PTO C;  1Q81 C;  2L11 A;  4JVZ A;  3GTO B;  2KHJ A;  2HIX A;  3VR4 A;  4JV5 Q;  1CZG A;  3LWU A;  3A55 A;  3RZD B;  4A3M H;  4UP9 A;  4A3B H;  2UXB Q;  1VCI A;  4HJ5 A;  3I56 A;  1CHQ D;  3I4N B;  5JEA G;  4KHZ A;  1SYF A;  4NDX A;  1XXG A;  2RSO A;  2PQE A;  3NPP A;  2OWO A;  4UPA A;  4QF4 A;  1G2T A;  4CKE A;  4DK6 C;  4GKJ L;  4J6H A;  2Z0S A;  3H09 A;  1P8L A;  2BCO A;  5I9P A;  2N88 A;  3KF8 B;  4IZ8 A;  1HUM A;  4FXG C;  2NWG A;  2C9O A;  2A5H A;  2KOL A;  2OQ0 A;  1SLJ A;  1IYU A;  3ITP A;  4XQN A;  1FJG L;  3FDT A;  1Y1W B;  1ICF B;  1QZG A;  2QEX A;  1GXD C;  3J81 L;  5JOB A;  3I4M G;  3GQB A;  1TWF H;  3I4N H;  3V2T A;  4A3M B;  2AQ3 B;  4DUZ L;  1YHQ A;  4B3T Q;  4HID A;  3HOW G;  3EA6 A;  3PCO B;  2EXZ A;  4M8A A;  2WAQ G;  4HJA A;  1QWY A;  2DNC A;  1U4R A;  2PI2 A;  2X6G A;  5IIF A;  3KF8 A;  3NQT A;  4KMU C;  4LFA Q;  1EZ8 A;  1G2S A;  4XT1 B;  2X6L A;  1HNZ Q;  2FJ2 A;  1WOC A;  3JC6 6;  1TKW B;  1LO5 D;  2ASB A;  1Q86 C;  4K6L A;  3K58 A;  5GAG C;  2H4O A;  1VQC A;  3E9I A;  3M4Y A;  4KKS A;  1RTO A;  2FHT A;  2ZJR A;  1SNQ A;  1KRT A;  2JA5 H;  4MTN A;  3W1G A;  2ZXO A;  2QEJ C;  1Q8K A;  4DAP A;  2E2D C;  1UUP A;  4DXG A;  2O2L D;  2WKC A;  1KAB A;  1HA6 A;  1S5D D;  1M8A A;  2JA6 G;  4BA1 I;  2ZXR A;  1B53 A;  4PZ6 A;  2Z8L A;  1AE3 A;  2F0N A;  4ID6 A;  4RHS A;  4NW2 A;  1UE7 A;  1MJE A;  1LAC A;  3TP8 A;  1UE6 A;  4B3M L;  2R92 H;  1YNJ C;  1M4V A;  3TP5 A;  3VA7 A;  2LY7 A;  1Q1B A;  4LK1 C;  2X69 A;  1QB5 D;  1I50 H;  3S1M H;  3J81 c;  3HOX G;  1NNX A;  3S16 B;  5IT9 L;  2GVA A;  4A3F H;  1TXY A;  1N9W A;  3KLS A;  5EKL A;  2B2T A;  1DJR D;  3FKI H;  4BBR B;  4O2D A;  1OXT A;  3FP9 A;  3M4O B;  2XSC A;  2RDH A;  3R2T A;  4JI7 L;  3G4S A;  2YV5 A;  2F1M A;  2M00 A;  1CT1 D;  5IGC A;  1PYS B;  1O80 A;  3MZ5 A;  2EYP A;  3DHQ A;  5IP7 H;  2VZA A;  3S17 B;  1C4Q A;  4U67 3;  1EU3 A;  2ZXP A;  5ISR A;  2EYJ A;  1S5E D;  3OMG A;  3G6E A;  1Z9F A;  3EIV A;  2A19 A;  2JA9 A;  4R8N A;  2ALY B;  3TSS A;  1B9N A;  1X3E A;  5JEA H;  2R93 H;  2TMP A;  3WOF A;  2RDG A;  3D0F A;  2G5D A;  4A3F B;  1AZQ A;  2JA6 B;  2JYO A;  4IPH A;  4XXE A;  5LL6 S;  1KAA A;  1AN8 A;  1VMC A;  1RCV D;  5NUC A;  4YCW A;  2L5T A;  3HOU H;  5FK9 C;  1EYD A;  2VUM H;  2MP1 A;  1FYC A;  2F4V Q;  2NYZ D;  3KF6 A;  1GOZ A;  1JT8 A;  1KC8 C;  5I4D A;  1LTA D;  1B3A A;  5FLM H;  2YU9 H;  3GD7 A;  1NMF A;  1N32 Q;  2F03 A;  3GTJ B;  2XTI A;  4A3C G;  1XNQ L;  4JK1 C;  4WJW A;  2EY2 A;  4DGZ A;  5IYC H;  1TS4 A;  1QUQ A;  5FKA C;  1Y1V H;  1LT4 D;  1RHP A;  3RLO A;  3NEN A;  5C4J B;  2K32 A;  4RFB A;  4J1M A;  1PRT D;  4YCU A;  2IX0 A;  4RGN A;  3SK5 A;  4A3J H;  3IRB A;  3OIP A;  4YHH L;  1JC7 A;  1I3Q H;  1IBM L;  1GD7 A;  1FNW A;  4BBS G;  4NXN L;  3KF6 B;  3GTL B;  1O7Y A;  3AMU A;  3HZX A;  2Q2I A;  4IOA A;  1HQR D;  5C3W A;  2VS1 A;  3ULJ A;  2R3Z A;  2OT2 A;  1SSO A;  4EVO A;  1STG A;  1YJN A;  3GTJ H;  3HG9 A;  4LAA A;  4K0K Q;  3ONA B;  4BY7 H;  2EXD A;  4A3L H;  1ZXT A;  3WOE A;  1E0B A;  4KK7 A;  4LUO A;  1WTQ A;  2P5Z X;  4BY7 B;  4BBR H;  3M3Y B;  3O13 A;  5C4J H;  2RVL A;  4DR6 Q;  4FF4 A;  4DUZ Q;  4RKB A;  4QCL A;  1XTD A;  3GV3 A;  2VQE Q;  3CHB D;  1IKM A;  2F0Q A;  1IW7 C;  1N8R C;  3T4A C;  3PV0 A;  3J7A F;  3T1H Q;  2K5N A;  2N3S A;  5ELO A;  1STB A;  3OOC A;  4ZKB B;  4HJ7 A;  3E0J A;  1A3V A;  4LF8 Q;  2EIF A;  2EZV A;  1D2B A;  1IL8 A;  3TME A;  4EQO A;  1SEB D;  1EY7 A;  4PMC A;  4L5R C;  1NBW A;  4A75 A;  1I6V C;  4X65 L;  3CCQ A;  1HHV A;  1N34 Q;  2NTT A;  1X6O A;  4R4O A;  3ZJY C;  5J1Z A;  2QDB A;  1H9S A;  2QDL A;  3H94 A;  4DR1 Q;  3ERS X;  1EQQ A;  3S24 A;  2FIN B;  1SNP A;  3ND9 A;  1AW7 A;  3L0O A;  1FNU A;  3KOJ A;  1STE A;  3AEV A;  4JI6 L;  2B2W A;  5E3F A;  1SN8 A;  2A69 C;  3UDI A;  1NSN S;  3CCE A;  1EIY B;  1PH6 A;  1HR0 Q;  4DR5 Q;  1ASZ A;  1EY8 A;  1JOR A;  4C3I B;  4F7X A;  3Q0A A;  5C3E H;  1YIT A;  1MD2 D;  3BZD B;  4LFB L;  4IFD I;  2R93 G;  1HZA A;  2HDM A;  1KAW A;  1LYL A;  3PSI A;  3RMH A;  5IYD G;  1U4P A;  3TS0 A;  4H0L C;  3F2U A;  2A6E D;  1KDB A;  4GZY C;  3X3N A;  1Q8I A;  1IZ6 A;  1GHJ A;  1D1I A;  3U9O A;  3CCM A;  4CHT B;  5CV6 A;  3NWS A;  1D5X C;  3VYT A;  2K05 A;  3RLF A;  4JI2 L;  2B2Y A;  4NKL A;  2L9H A;  4QUC A;  1NR4 A;  3S16 H;  2F0O A;  1N33 L;  3DWQ A;  3P20 A;  5DAU A;  4CBV A;  1LV9 A;  4PNY A;  4B3S L;  1PH2 A;  1VQJ A;  1SRU A;  3SK4 A;  1QIL A;  2NN6 I;  3CC7 A;  2Q8R E;  1VQK A;  3DEO A;  2B2U C;  1ZKO A;  1YHB A;  4F88 A;  4A3D B;  4DUY L;  3U50 C;  5IGB A;  1W6K A;  4A3D G;  4XYO A;  3HP3 A;  4IOC A;  2UUB Q;  2IPK D;  1EYA A;  3A5U A;  2E76 C;  1KNA A;  1BQQ T;  2YTV A;  3K5O A;  2KEC A;  2ZM6 L;  2ES2 A;  3VYU A;  2EPB A;  4RG1 A;  1F2Z A;  2KUM A;  2NVY H;  1U0L A;  3GTG H;  1IBL L;  1V9P A;  5JEA J;  4AIM A;  3UE1 A;  4A93 B;  2IY5 B;  3TS2 A;  3I4M H;  4DR2 L;  3NBH B;  1IYV A;  1JOK A;  4GOP C;  5J22 A;  1LAB A;  3PUX A;  1VQ8 A;  1EFW A;  1Z7T A;  4DAY B;  3KDF A;  2F0V A;  2NN6 H;  3R2I A;  3NEL A;  5CYU A;  2DJG C;  2Z9H A;  4ZQ3 A;  1PH8 A;  1JOQ A;  1LM0 A;  1PTO H;  3NBI A;  1VMP A;  2R7Z G;  4LF4 L;  3Q8D A;  4K2K A;  1DCZ A;  3NE5 B;  2O5J C;  4GKK L;  4X3T A;  2A68 C;  4JYA L;  1ENF A;  1JWU D;  1GUN A;  2PZU A;  4NXM L;  4DNI A;  2EYL A;  5F2D A;  1K3B C;  1GO3 E;  3DWA A;  1QJO A;  5IGF A;  1PV4 A;  2ID0 A;  3SXH A;  3BZC A;  4IPG A;  2YTX A;  1F9S A;  1JMC A;  2KEN A;  1QOH A;  3CRL C;  1PFM A;  1CSQ A;  3HOZ B;  2Q2T A;  1XNQ Q;  1E7Z A;  3V05 A;  1ESF A;  1L0X B;  3RNU A;  3KJO A;  1PH9 A;  5EPL A;  1HZ9 A;  3PUY A;  4DR1 L;  2WB1 G;  1EOT A;  2AWO A;  4DR7 L;  3MEF A;  2NVX B;  1E2V A;  3U58 A;  5DM6 3;  3F2D A;  4R8I A;  4G7H C;  1GKH A;  1BBX C;  3GTP B;  1L0W A;  4GKJ Q;  3S1N B;  1J6Q A;  3HS0 C;  3HOV H;  2N55 A;  4OL7 A;  2F3I A;  4YIJ A;  2K4K A;  4A3F G;  3LWE A;  3J80 E;  2KCT A;  4P71 A;  3A8I E;  5ELC A;  1OXV A;  1SRO A;  3NWT A;  4G7O C;  1RIP A;  3PO2 H;  3T1H L;  2JA7 G;  2DY7 A;  2TSS A;  1SMX A;  1LTS D;  1YNX A;  2EYH A;  2RBM A;  2E2I B;  1K83 B;  4DK1 A;  2BH2 A;  1SYG A;  1QVC A;  4JI0 Q;  1Q90 A;  2E2H H;  5M3M G;  3HOY G;  2UU9 Q;  4IJL A;  2B2U A;  4ZUI A;  2Q2H A;  3PUZ A;  1ML0 D;  1TWH H;  2MO1 A;  1WTH A;  4A3E G;  1EEI D;  1E1T A;  3HFZ B;  1TS2 A;  4U68 A;  4DV1 Q;  5C44 B;  1N33 Q;  2VNU D;  3ND8 A;  1AE2 A;  2PW7 A;  4JW0 A;  3HKZ G;  3PIO 3;  2L12 A;  2MHV A;  2WFW A;  3S2H H;  3BJU A;  1SJE D;  2FXQ A;  4E6I A;  4V0B A;  3I73 A;  4TVA B;  1SFO B;  2UXD Q;  1QCB D;  1G29 1;  1TS5 A;  3M3Y H;  4FYD A;  2I5L X;  2VUM G;  2AWN A;  2CH4 A;  3M7N A;  3OIQ A;  3U4V A;  4YCV A;  3M85 A;  1KRS A;  4LF8 L;  2B3G A;  2A1A A;  1PRT F;  4XTC S;  3NK9 A;  2HHH L;  1ZYR D;  1PFS A;  2R92 G;  3EBE A;  5C4Z A;  3BDC A;  3K6O A;  3STB D;  5E4W C;  2Q8I B;  3I70 A;  4KY7 A;  5C5L A;  4RMF A;  4A4I A;  5JVH 3;  5IWA Q;  2ZM6 Q;  4N9T A;  3NXW A;  1OXX K;  4I7Z C;  1SYC A;  3OHX C;  2C5C A;  1DOM A;  1JJC B;  1RF2 D;  4HED A;  1SFO H;  5EBD A;  4DV7 Q;  2Z6K A;  3OWF A;  3H0G G;  5C4X B;  1YVC A;  3OWE B;  3STB C;  4O1N A;  2B2V C;  2K5D A;  5DM7 3;  1IW7 D;  3LNN A;  1E2Z A;  2LMC B;  1X9N A;  2UUA Q;  2B2W C;  4CDF C;  4HMJ A;  4UP8 A;  5K36 H;  1TWH B;  5DEH A;  2NVT B;  2FFK B;  4C2M H;  5M5X H;  4LFC L;  1I6H B;  2Y0S B;  3I2Z A;  1PTO F;  2J0T D;  4LFC Q;  1CA5 A;  1X65 A;  3HKZ B;  1S4Z A;  4CKC A;  2PMZ E;  3MXN A;  3JAM c;  5C44 G;  5COY A;  3S2D B;  1PH1 A;  4GNX B;  2Q8T A;  4A3E B;  1OXS C;  3M4O H;  1LTT D;  1V43 A;  1BCP D;  1Y14 B;  5ELF A;  2RF4 A;  3FEW X;  3K59 A;  5LL6 X;  3HOX B;  3QIA A;  4DV0 Q;  1HZB A;  5G3L F;  1LTI D;  4J8Q A;  3J7Y W;  4DV0 L;  2HDL A;  1VQ9 A;  3S17 H;  5IOD A;  1W2B A;  5IP9 G;  1VQ4 A;  2MUY A;  5TSS A;  4G57 A;  1I5F A;  1MSH A;  4YY3 L;  3CD6 A;  2EOT A;  2F0P A;  4LF6 L;  4CJ2 C;  3VYR A;  1I4H A;  1LUZ A;  3CCU A;  1IBL Q;  4NXN Q;  3S2D H;  4O0A A;  5C0X H;  3VR6 A;  4MN3 A;  2HQE A;  1ONL A;  2E8G A;  1SE3 A;  1U9R A;  1XMQ L;  1SYD A;  3HOY H;  3FVQ A;  5JJZ A;  2CCZ A;  3HOX H;  1D5M C;  1X56 A;  2NUC A;  2MNA A;  4B3S Q;  1N32 L;  3S15 B;  4JI0 L;  3ZYY X;  1CI3 M;  1NTG A;  1FVI A;  4TQU S;  2HIV A;  2SEB D;  3PMF A;  1YZ6 A;  2XNA C;  2B8G A;  3TEH B;  1JE5 A;  1A8V A;  1WFQ A;  4DN4 M;  3DMU A;  3K7U C;  1I4Q A;  3G71 A;  4ZKC B;  1D6E C;  2WII B;  3D6C A;  1E3P A;  4A3J G;  4JBJ A;  4DR3 L;  2RDF A;  2XWB B;  4LMQ D;  3QG1 A;  1ENC A;  4A93 G;  3QOL A;  5IYD H;  4EX5 A;  1PTO D;  2PNH A;  2JA7 B;  4XIG S;  4KKT A;  3SDZ A;  3S2H B;  3RR5 A;  2K50 A;  3A8K E;  2E74 C;  1HTP A;  1QVF A;  4LJZ C;  1MIU A;  1YNJ D;  1GUT A;  3FHW A;  5M9O A;  2KCM A;  1SMY D;  4DV6 L;  2HT1 A;  4A3B B;  2K5V A;  1RL2 A;  1C8C A;  1I94 L;  2J7Z A;  2JA8 G;  1STY A;  3FPU B;  1Q1E A;  4FO2 A;  3HGB A;  1BO0 A;  1KL9 A;  4DR4 Q;  3A56 A;  4L5S A;  4N8X 1;  3P7J A;  4KY5 A;  1TWC B;  3D4D A;  2FMC A;  4LUV A;  5BR8 Q;  1HUN A;  3GTQ H;  3PIP A;  1CQF A;  3RZD H;  3AB9 A;  5M5W B;  4Y52 H;  2CH4 W;  4K8I A;  3OTO L;  5FLX c;  3M7G A;  3MA2 B;  2KA7 A;  1Z6H A;  1BNZ A;  5JJK A;  1ENA A;  2F0H A;  2K7V A;  1G51 A;  2A6H C;  1MJC A;  1A2U A;  1VQF A;  2BA1 A;  2DN8 A;  4JCV E;  5IP7 G;  1TWA H;  3ICE A;  4OIJ A;  3W1B A;  1TT2 A;  4MTK A;  1LTL A;  3R93 A;  4HCE A;  5C4X H;  1WCM B;  3W3A A;  4DR7 Q;  4CDE C;  1BCP F;  1K73 C;  2N8N A;  1F2L A;  3TP6 A;  4A3J B;  5COR A;  2AUJ D;  3N6R A;  3JAM E;  2QIL A;  1X3G A;  2B2Y C;  5T1I A;  2NBF A;  2IL8 A;  5BN3 A;  4K0K L;  1B3Q A;  1DOK A;  1PA6 A;  1VQH A;  3DEP A;  4FF3 A;  2LXK A;  5JPM C;  4JC0 A;  3TRZ A;  2AHO B;  3NHH A;  1WJJ A;  2JA5 B;  4P72 A;  2LFN A;  4GN4 B;  2R93 B;  2VQE L;  1SMY C;  2K75 A;  4LUZ A;  5C4H A;  5C5M A;  2VQF L;  2F0G A;  4GNX C;  1I4P A;  1J9O A;  3QOJ A;  1KHI A;  2IX1 A;  4RKL A;  2HQL A;  1D8L A;  3QO2 A;  1HNX Q;  1VQL A;  4HTH A;  3RUZ A;  3GTP H;  1HNX L;  4P74 A;  4BWG B;  1HA5 A;  4KD3 A;  2K1B A;  4DV4 Q;  1LTB D;  2UUB L;  4OO1 H;  2KJX A;  4G4K A;  1EYC A;  3X3M A;  2JXM B;  4C3J H;  4A3D H;  2R92 B;  5C44 H;  1S72 A;  5LMN W;  1Q82 C;  3A5Z B;  4DXF A;  3SEB A;  3BYY B;  3S1R H;  1M90 C;  2EYO A;  1A15 A;  1CK1 A;  1JWM D;  5JAV A;  1C48 A;  1VQO A;  2A68 D;  4AQY Q;  4QJF A;  5E4X A;  2ZT9 C;  4CGY B;  4IPC A;  4OXP A;  1XJV A;  4O42 A;  2WKD A;  2LS0 1;  3QR8 A;  1MSG A;  2EJM A;  1VQI A;  1YBY A;  2F0F A;  3DM1 A;  3HOW H;  4BXX G;  3K81 C;  1ICW A;  1EOV A;  1CSP A;  2LKV A;  2AMC B;  3BVM A;  2Z6B A;  1JE4 A;  1QNU A;  2CWP A;  3QJY A;  2K03 A;  4JI5 L;  1KDC A;  5C3E G;  3DLL A;  4LF7 Q;  3PO3 G;  1LT6 D;  1TII D;  3G7L A;  4LF7 L;  2WIN B;  2JA7 H;  3T53 B;  1DD2 A;  4A3I B;  1PTO B;  4X3U A;  1CKN B;  1A3T A;  2M2L A;  3MXP A;  3J80 c;  1AFP A;  2KBN A;  1KNE A;  3F8T A;  3K0Y A;  4KN7 C;  2PQA B;  3QWN A;  1SXT A;  3CCJ A;  1WD0 A;  1EIH A;  3M4Q A;  1OXU A;  2UUA L;  2E75 C;  1U5K A;  4DV3 L;  1EQT A;  3VYS A;  3A7A B;  3UDX A;  3SVM A;  1HJP A;  1TWC H;  5I6Y A;  1VF5 C;  4DKA C;  2OF1 A;  5IT9 c;  4L63 B;  4KJN A;  4BBS B;  1NE3 A;  1OO9 B;  1K8O A;  3VR5 A;  4HJ8 A;  4DNT B;  4OEM B;  2AQ2 B;  2VB2 X;  1IL2 A;  1F9Q A;  2BE5 D;  3I72 A;  3T16 A;  3E3X A;  1A63 A;  1GUW A;  1B4O A;  4PZ7 A;  4QY7 A;  2N49 A;  3NP8 A;  1CFM A;  4P2C B;  1KIX A;  4LWC A;  1K0S A;  1J8I A;  3HOZ G;  4XQJ A;  2NVX H;  2WB1 E;  1JOO A;  3KLS X;  2NVY B;  1EIG A;  3CME A;  1KLU D;  2L15 A;  3P75 A;  4WRD A;  4IAL A;  2RA4 A;  1TWG B;  5FO9 B;  1LLR D;  1KTK A;  4QL5 A;  2YU9 B;  3W2D A;  1HPC A;  2JP1 A;  1S5C D;  1A62 A;  3KYH C;  2JA8 H;  3DWP A;  2ZJP A;  4BBS H;  2K33 A;  4DV5 L;  3HOV B;  1UAP A;  2QF7 A;  1PDQ A;  3PO2 G;  1XMO Q;  1RTN A;  3OW2 A;  2Y0S E;  1CZW A;  1BF4 A;  5IYC G;  2RHS B;  4RWS C;  2JEB I;  5G3L D;  5KYL A;  5D3I B;  2RCN A;  1FJG Q;  1VQ7 A;  3G6J B;  3CPF A;  1PH4 A;  4JI4 L;  4B9X A;  3FPP A;  2VXW A;  1DGS A;  4HIK A;  3S1N H;  4HAE A;  3HOY B;  1GHK A;  2B8F A;  2LSS A;  3TQY A;  2BA0 A; 
#chains in the Genus database with same CATH homology
 1J6Q A;  3HOV H;  4X66 L;  2I0Q A;  1EWI A;  1SE8 A;  4QQB X;  2F3I A;  4A3M H;  2K4K A;  2QGQ A;  4A3I H;  4A3F G;  1HNW L;  1UEB A;  2KCT A;  4UP9 A;  4A3B H;  2UXB Q;  4P71 A;  1VCI A;  4HJ5 A;  3I56 A;  1OXV A;  1SRO A;  4HJ9 A;  3KLW A;  1IBK L;  1RIP A;  3PO2 H;  3T1H L;  2B63 G;  2JA7 G;  1I6H H;  5JEA G;  1SMX A;  1YNX A;  4KHZ A;  4IJH A;  2BH2 A;  4KHP L;  4QIW E;  4A3K G;  1HNZ L;  1QVC A;  4JI0 Q;  2OWO A;  4UPA A;  1S40 A;  5JJL A;  3KDF B;  3T1Y Q;  5M3M G;  2E2H H;  1I94 Q;  3HOY G;  4DK6 C;  4GKJ L;  4JBK A;  2UU9 Q;  2Z0S A;  1A0I A;  1P8L A;  1Q12 A;  1Y1V G;  3KF8 B;  4IJL A;  3E9H A;  2Q2H A;  3PUZ A;  4X66 Q;  1YEZ A;  5IY0 A;  2Q2U A;  1TWH H;  2OQ0 A;  5IWA L;  1FJG L;  1SLJ A;  2MO1 A;  2JJQ A;  4A3E G;  1E1T A;  3HFZ B;  4DV1 Q;  3DM3 A;  1N33 Q;  1QZG A;  4GKJ Q;  3CCL A;  2QEX A;  1QVG A;  1IXR A;  2VNU D;  3I4M G;  1AE2 A;  3CXC A;  3HKZ G;  1TWF H;  3AFQ A;  3I4N H;  4DV2 L;  2WFW A;  3S2H H;  2IT1 A;  3K7A H;  3M4P A;  4DUZ L;  3ULP A;  4JI6 Q;  3BJU A;  4X65 Q;  2NN6 G;  2FXQ A;  2E5L Q;  1YHQ A;  2UXD L;  4X6A H;  4TVA B;  5AJ3 Q;  4B3T Q;  4HID A;  3HOW G;  2E5L L;  2UXD Q;  3PGZ A;  1CUK A;  4AYB E;  3PCO B;  1HR0 L;  1G29 1;  1C9O A;  3M3Y H;  1K3R A;  4IFD J;  2I5L X;  4OWW B;  1VQG A;  2WAQ G;  4P73 A;  2AWN A;  4HJA A;  2VUM G;  2PI2 A;  3GTK H;  3M7N A;  4LF9 Q;  3U4V A;  4YCV A;  3M85 A;  3GDE A;  1KRS A;  4LFA Q;  4LF8 L;  2H5X A;  1EUJ A;  1ASY A;  1M1K C;  1HNZ Q;  2B3G A;  1WOC A;  1FGU A;  1UE5 A;  2A1A A;  4XTC S;  3JC6 6;  3CPW A;  2ASB A;  1Q86 C;  2HHH L;  1PFS A;  2R92 G;  3EBE A;  3STB D;  3HKZ E;  1VQE A;  3UE0 A;  2JA5 G;  5GAG C;  3I4O A;  4GNX A;  1VQC A;  3E9I A;  2ZJR A;  2EQS A;  4RMF A;  4A4I A;  2K5H A;  4YWK A;  5IWA Q;  2ZM6 Q;  1VQ6 A;  1KRT A;  2JA5 H;  1NJI C;  4DV1 L;  1V1Q A;  4MTN A;  3W1G A;  1PYB A;  1OXX K;  4R1J A;  1GVP A;  1Q8K A;  4LFA L;  4LF5 Q;  1JJC B;  1SFO H;  4DV7 Q;  2JK8 A;  4J15 A;  5LMN L;  2Z6K A;  4PZ8 A;  1HZC A;  3H0G G;  2OTL A;  4POG A;  4X64 L;  2JA6 G;  1YVC A;  4BA1 I;  4JI2 Q;  4PZ6 A;  2V1C C;  3STB C;  3PO3 H;  1EIF A;  4H02 A;  1VQN A;  3CAM A;  1AE3 A;  3E0E A;  4POF A;  1PH7 A;  1GM5 A;  3BU2 A;  1UE7 A;  4DUY Q;  1MJE A;  1AH9 A;  1X9N A;  2UUA Q;  4A3C H;  1UE6 A;  4B3M L;  4UP8 A;  2R92 H;  1YJ9 A;  5IYB H;  3J80 i;  1XNR Q;  5GQO A;  1YI2 A;  1Q1B A;  4C2M H;  5M5X H;  1X55 A;  4IO9 A;  1I50 H;  4LF5 L;  2YYZ A;  4ALP A;  3RN2 A;  3S1M H;  2NVT H;  3J81 c;  3HOX G;  2D0P A;  1NMG A;  3A0J A;  2GVA A;  4LFC L;  5FJ8 H;  3I2Z A;  4A3I G;  4A3F H;  1YJW A;  1TXY A;  1N9W A;  4LFC Q;  1X65 A;  2MFI A;  2PI2 E;  4KI0 A;  3CCV A;  2PMZ E;  1CKN A;  3FKI H;  3F2C A;  1XPO A;  4O2D A;  1PH3 A;  1OXT A;  4OWX B;  3FP9 A;  4AH6 A;  3JAM c;  5C44 G;  1PH1 A;  3PUW A;  4QGU A;  5EAY A;  4GNX B;  4AQY L;  1OXS C;  4JI7 L;  1G6P A;  3G4S A;  3M4O H;  2YV5 A;  1V43 A;  5M3F H;  1Y14 B;  1PYS B;  2CKZ B;  2RF4 A;  3AQQ A;  4YHH Q;  2Y0S G;  3CF5 A;  5IP7 H;  2VZA A;  4DV0 Q;  1HZB A;  3AFP A;  2A8V A;  3ULL A;  1EQR A;  4DV0 L;  3EN2 A;  5K36 G;  1VQ9 A;  3S17 H;  4EQ5 A;  1W2B A;  5IP9 G;  1VQ4 A;  3G6E A;  1Z9F A;  3EIV A;  2A19 A;  3PIO A;  1UWV A;  4B3R Q;  2JA9 A;  1JJG A;  1KXL A;  1I5F A;  2ALY B;  2Z6K C;  4KLK A;  4YY3 L;  3CD6 A;  4B3M Q;  4HIO A;  1X3E A;  2XGT A;  2JEA I;  2R93 H;  4LF6 L;  1FL0 A;  3D0F A;  4GKK Q;  4GLA C;  4DV7 L;  1LUZ A;  3CCU A;  2DUD A;  1JJ2 A;  4IPH A;  1IBL Q;  4O0A A;  4NXN Q;  3S2D H;  4GS3 A;  1CKO A;  5GAE C;  3TRE A;  4DR7 L;  2E8G A;  4YCW A;  3W5O A;  3HOU H;  4AYB G;  1XMQ L;  2VUM H;  3HOV G;  2F4V Q;  3KF6 A;  1B8A A;  1XPU A;  1VQA A;  3HOY H;  2YTY A;  1JT8 A;  1KC8 C;  1X54 A;  1HR0 W;  3HOX H;  2CCZ A;  3CQZ H;  1H95 A;  1X56 A;  4P75 A;  5FLM H;  2YU9 H;  4LF6 Q;  4OO1 G;  2MNA A;  4B3S Q;  3GD7 A;  5C0X I;  4KHP Q;  1N32 L;  1NMF A;  1N32 Q;  4JI0 L;  1VQ5 A;  4HIM A;  1NTG A;  2XTI A;  1FVI A;  4TQU S;  4A3C G;  5GAD C;  4JV5 L;  1XNQ L;  3S15 H;  1E1O A;  4FDB A;  3PF5 A;  2HIV A;  5IYC H;  4MNO A;  4X62 L;  1HNW Q;  4C3I H;  1QUQ A;  1YZ6 A;  4JBW A;  1Y1V H;  1WCM G;  3TEH B;  1JE5 A;  1XPR A;  1A8V A;  3K0X A;  1WFQ A;  3RLO A;  1L1O A;  3NEN A;  4WJ3 M;  4OON A;  4YCU A;  2IX0 A;  4YWM A;  4A3J H;  3K7U C;  3IRB A;  4R4I A;  4YHH L;  5BR8 L;  5M3M H;  1I3Q H;  1IBM L;  1W3S A;  1GD7 A;  3HKS A;  3G71 A;  1HH2 P;  4NXN L;  4BBS G;  3M9B A;  3KF6 B;  2CQO A;  4A3G H;  1E3P A;  1C0A A;  3T1Y L;  4A3J G;  2E2J H;  2Q2I A;  2D62 A;  4IOA A;  3JAM i;  2VS1 A;  4JBJ A;  4JI8 L;  3ULJ A;  4R4Q A;  4DR3 L;  1YIJ A;  1K9M C;  5M5W H;  2ZTD A;  4A93 G;  2F52 A;  5IYD H;  4JBM A;  2MQH A;  2K52 A;  2PQA A;  5DLQ E;  4EX5 A;  3VDY A;  1YJN A;  3GTJ H;  2OTJ A;  2PNH A;  1BBW A;  4L5Q A;  1VQD A;  4XIG S;  4K0K Q;  3RR5 A;  2K50 A;  4GOP A;  1QVF A;  1MIU A;  2EXD A;  2R7F A;  3UDF A;  3J81 j;  3B6Y A;  3FHW A;  1K8A C;  1BBU A;  4BY7 H;  5E7N A;  4A3L H;  2KCM A;  4LUO A;  3WWV A;  4DV6 L;  2HT1 A;  4BBR H;  2K5V A;  1RL2 A;  2R7Z H;  1IBM Q;  3F2B A;  3J7A 5;  5C4J H;  4DR6 Q;  1I94 L;  3NEM A;  1N34 L;  2E2I H;  2JA8 G;  4DUZ Q;  2JQO A;  2VL6 A;  3SGI A;  1Q1E A;  1XTD A;  4DK3 C;  4JI3 L;  2VQE Q;  1N8R C;  1KL9 A;  2F4V L;  3PV0 A;  3K8A A;  5FJ8 G;  4L5S A;  4DR4 Q;  3T1H Q;  5H1S E;  2K5N A;  2N3S A;  2CWA A;  5ELO A;  3BZK A;  4HJ7 A;  3AYH B;  4LUV A;  5LMU L;  1L2F A;  2VW9 A;  2UXC L;  4LF8 Q;  1TWG H;  2EIF A;  5IYB G;  5BR8 Q;  2UXC Q;  5GAH C;  3PIP A;  3GTQ H;  3RZD H;  3OTO Q;  2LXJ A;  2MO0 A;  4L5R C;  1NBW A;  4R4C A;  4Y52 H;  4A75 A;  3OTO L;  4X65 L;  3CCQ A;  5FLX c;  1N34 Q;  1K0R A;  4BY7 G;  4B3T L;  5JJK A;  2B29 A;  1X6O A;  4L5T A;  4LW1 A;  1G51 A;  4NB3 A;  4R4O A;  3ZJY C;  1MJC A;  1VQF A;  2VQF Q;  2BA1 A;  4JCV E;  5IP7 G;  2UU9 L;  1TWA H;  3GTM H;  3ICE A;  3W1B A;  5M5Y H;  3FKI G;  4C3H H;  1LTL A;  1D7Q A;  1CKM A;  4DR1 Q;  2KHI A;  3ERS X;  3HOZ H;  1EQQ A;  3S24 A;  5C4X H;  4DR7 Q;  3OYY A;  5LMU Q;  3L0O A;  4DV6 Q;  4PMW A;  1K73 C;  4JI1 Q;  4DV2 Q;  3KOJ A;  3RLN A;  3LGJ A;  4DV4 L;  2N8N A;  3AEV A;  4JI6 L;  2OQK A;  4GLX A;  1SN8 A;  2I5H A;  3UDI A;  1QZH A;  3I7F A;  2R6G A;  4BY1 G;  2N78 A;  3CCE A;  4ME3 A;  1X3G A;  1EIY B;  5AJ3 L;  3GO5 A;  1PH6 A;  3PF4 A;  1Q46 A;  3GTO H;  1X3F A;  2R7D A;  1HR0 Q;  4K0K L;  1KQS A;  4DR5 Q;  4JOI A;  1PA6 A;  1VQH A;  5FLM G;  2LXK A;  4JI5 Q;  1ASZ A;  4Y7N H;  4JC0 A;  3TRZ A;  2AHO B;  4JI1 L;  1WJJ A;  3H15 A;  5C3E H;  4P72 A;  1YIT A;  1QUQ B;  1P16 A;  4GN4 B;  4X64 Q;  4LFB L;  2VQE L;  4JI3 Q;  4IFD I;  2R93 G;  2K75 A;  1HZA A;  4LUZ A;  4OWT B;  4GN3 B;  1KAW A;  2VQF L;  1LYL A;  3PSI A;  5IE8 A;  3CCS A;  4GNX C;  5IYD G;  2UXB L;  3TS0 A;  4MZ9 A;  1KHI A;  2AKW B;  3D31 A;  2IX1 A;  4BXX H;  2HQL A;  1D8L A;  3CW2 C;  1HNX Q;  1VQL A;  1PVO A;  4YWL A;  3GTP H;  1HNX L;  4P74 A;  1XNR L;  1IZ6 A;  4DV4 Q;  2UUB L;  2JE6 I;  2IHF A;  2NZO A;  3CCM A;  1PHJ A;  4C3J H;  1IYJ B;  4A3D H;  4DR2 Q;  5C44 H;  5IP9 H;  1S72 A;  1VQP A;  5LMN W;  4IPD A;  1Q82 C;  2HHH Q;  4LFB Q;  4GLV B;  3A5Z B;  2WP8 J;  4A3M G;  3RLF A;  2QA4 A;  3H3V H;  3S1R H;  1M90 C;  4JI2 L;  4GOP B;  3S16 H;  2I5M X;  3H3V I;  4JG2 A;  5ELN A;  1VQO A;  4DR5 L;  4AQY Q;  1N33 L;  4QJF A;  3K80 C;  3CCR A;  4BBR G;  4DV3 Q;  5C0X G;  1L1O B;  4IPC A;  4OXP A;  4OO1 I;  4BA2 I;  3CC2 A;  1XJV A;  4B3S L;  1WI5 A;  1PH2 A;  2D0O A;  1SR3 A;  1VQJ A;  3CP0 A;  3UDG A;  1SRU A;  4UY8 C;  1BVS A;  1VQI A;  1YBY A;  3HOW H;  2WAQ E;  4BXX G;  4UP7 A;  1E24 A;  3K81 C;  1EOV A;  1CSP A;  2NN6 I;  3CC7 A;  2AMC B;  4NXM Q;  1VQK A;  5J3B A;  1YHB A;  1R9T H;  5HGQ A;  2CWP A;  3I55 A;  4DUY L;  3H0G H;  3U50 C;  2GN5 A;  4JI5 L;  2ZJQ A;  4A3D G;  5C3E G;  1C7Y A;  3DLL A;  4LF7 Q;  3PO3 G;  4LF4 Q;  3L7Z C;  4IOC A;  4LF7 L;  2JA7 H;  2DGY A;  2UUB Q;  1WYD A;  5JJI A;  3CC4 A;  1CKN B;  3RN5 A;  3A5U A;  1WCM H;  3KFU A;  4APV A;  2ZTC A;  3J80 c;  2YTV A;  1XMQ Q;  2KBN A;  5HY6 A;  1VQB A;  2JA6 H;  3F8T A;  4A3B G;  3J81 i;  2PQA B;  2ZM6 L;  3CCJ A;  2ES2 A;  3M4Q A;  3A74 A;  4WJ4 A;  1OXU A;  4NPS A;  5GRO A;  3KJP A;  2UUA L;  1O7I A;  1U5K A;  4RG1 A;  1EYG A;  3I4N G;  2NVY H;  4DV3 L;  4YY3 Q;  1U0L A;  3GTG H;  1IBL L;  4A3K H;  1V9P A;  5JEA J;  2VY3 A;  4AIM A;  1VQM A;  3UDX A;  3UE1 A;  4JYA Q;  1K8G A;  1HJP A;  1S3O A;  1TWC H;  3TS2 A;  2IHE A;  5LMN Q;  1NY4 A;  3I4M H;  2IY5 B;  3L2P A;  5C4X G;  4DR2 L;  3NBH B;  4DKA C;  4GOP C;  4A93 H;  5IT9 c;  4JI8 Q;  3PUX A;  1VQ8 A;  1EFW A;  2B63 H;  1J5E L;  4DAY B;  3KDF A;  1NE3 A;  3NEL A;  2CFM A;  4HJ8 A;  4R4T A;  1MKH A;  1K83 H;  1YHA A;  4B3R L;  1IL2 A;  1Z47 A;  1PH8 A;  1LM0 A;  3J7Z C;  4JI7 Q;  1A63 A;  2R7Z G;  4JI4 Q;  4LF4 L;  3Q8D A;  4PZ7 A;  4QY7 A;  2NVQ H;  2N49 A;  4GKK L;  1B70 B;  1KIX A;  4JYA L;  4LWC A;  3F1Z A;  1Q7Y C;  5C0X J;  3HOZ G;  1KD1 C;  2WB1 E;  4JOI C;  1XMO L;  4A3E H;  2NVX H;  1L1O C;  4DR3 Q;  3CME A;  2L15 A;  4IFD G;  4NXM L;  4X62 Q;  4DPG A;  4DNI A;  4BY1 H;  1JB7 A;  1Y1W H;  3S14 H;  4QL5 A;  1UE1 A;  1GO3 E;  4OX9 Q;  3MXN B;  4OX9 L;  1A62 A;  3KYH C;  2C35 B;  2JA8 H;  4DV5 Q;  1N36 Q;  3PUV A;  2ZJP A;  1PV4 A;  2ID0 A;  1B7Y B;  2NZH A;  4LNQ A;  3BZC A;  4IPG A;  4BBS H;  2YTX A;  4DV5 L;  1N36 L;  1JMC A;  2KEN A;  2K14 A;  1E22 A;  2RHQ B;  3S1Q H;  4DR6 L;  1PH5 A;  3PO2 G;  1CSQ A;  1XMO Q;  2Q2T A;  1XNQ Q;  3OW2 A;  1E7Z A;  2Y0S E;  2BH8 A;  3ER0 A;  1J5E Q;  3RZO H;  4DAM A;  1OTC A;  5IYC G;  3RNU A;  2RHS B;  2OCE A;  2JEB I;  3KJO A;  1PH9 A;  4A3G G;  4DR4 L;  3CMA A;  1HZ9 A;  1Y1W G;  2RCN A;  3PUY A;  1IBK Q;  1FJG Q;  4GN5 A;  2GVB A;  4DR1 L;  3U4Z A;  2WB1 G;  1VQ7 A;  3GTL H;  3HOU G;  3G48 A;  3CPF A;  2AWO A;  2ZTE A;  3MEF A;  1PH4 A;  4LF9 L;  1BKB A;  5M3F G;  4JI4 L;  4PG3 A;  2UUC Q;  4A76 A;  3U58 A;  4A3L G;  2UUC L;  3F2D A;  1VS0 A;  1DGS A;  4HIK A;  1Q81 C;  3S1N H;  1GKH A;  2LSS A;  1L0W A;  2ATW A;  1T9H A;  2KHJ A;  2HIX A;  3TQY A;  2BA0 A;  4JV5 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...