4LFAQ

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 20
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4lfaQ00
2GVBA 2K52A 2YYZA 1N8RC 4B3RQ 2E2HH 1HNWL 2AMCB 3H3VI 4C2MH 4R4CA 2QGQA 4A3EH 1TXYA 1UE5A 1Y1VG 4H02A 2E2JH 4IPHA 3W1GA 4DR6Q 1EOVA 5FJ8G 1CSQA 1TWHH 1VCIA 4JOIC 1K3RA 4GLVB 1LTLA 1LYLA 3RLOA 4DNIA 1QZGA 4LFAL 2JA6H 2R92G 3DM3A 4A3LG 4LF6Q 1L0WA 3HOXG 1X65A 3PUWA 4AYBG 1K8GA 4L5TA 3FHWA 3ERSX 3I7FA 3CMEA 4DPGA 3GTLH 1YJ9A 3J80c 1PA6A 3HOYG 3CP0A 4UP8A 2VQFL 1Y14B 1MKHA 4QL5A 4B3ML 5GAEC 2EIFA 1X54A 4P75A 3T1YQ 4A3JH 1N36L 4KHPL 3HKSA 4BBRG 4OX9L 1S3OA 1X6OA 1Y1WG 3KF6A 2ALYB 2JA7H 5GROA 4MZ9A 5IYCG 2DUDA 1NJIC 1JJGA 3AFPA 3GTMH 1E22A 3S24A 4DUYQ 2MO1A 2KBNA 2JA5G 1CSPA 2LXKA 2YTVA 3OYYA 2H5XA 3K81C 1VQHA 3CCJA 4LFAQ 4X65Q 3G48A 3RLFA 4GNXA 3OTOL 4YWLA 3CW2C 4LFBQ 2BA0A 3BU2A 2HIXA 3J7A5 1LUZA 4R4TA 4O2DA 2ID0A 4YHHL 3EIVA 4YCVA 2UXDL 4XIGS 1PV4A 1J5EL 1ASYA 1HJPA 2VW9A 4HIDA 3HFZB 2OQ0A 1PVOA 4NXML 2NVTH 1TWAH 2VL6A 5ELOA 2NVXH 4LF5L 1Q81C 1IBKL 4XTCS 1K73C 2B3GA 1CUKA 4X66L 3GO5A 3UE1A 5BR8Q 2F52A 1VQIA 5M3FG 1XMQQ 5E7NA 1JMCA 1RIPA 3U50C 5IWAL 2E5LL 3I4MH 4QJFA 3CCVA 1XNQQ 1W2BA 1PH6A 4QQBX 1VQFA 3VDYA 1NTGA 4DV7L 2R7DA 4JI0L 1U5KA 2RCNA 4YY3L 1IL2A 1GO3E 3M3YH 1SMXA 3S1NH 4LFCL 1EUJA 1HNXQ 1WFQA 2UUBL 4MTNA 4GOPC 5LMNL 2JK8A 1HNZL 1GD7A 3AYHB 4DV2Q 4AQYQ 3T1HL 4LF8Q 1Z47A 1PH5A 3RLNA 1J5EQ 5C0XJ 1SROA 3HKZE 3A5ZB 3S16H 4X62Q 5IP7H 3GTGH 1Q86C 4LF5Q 1I50H 2HIVA 1VQ7A 4DR7L 1N32Q 2IHFA 2YU9H 1XJVA 2D62A 4A3IG 4WJ3M 1HH2P 3S15H 4YWKA 5IY0A 2Q2UA 5C4XG 4PMWA 1YHAA 4HJ7A 4LF9L 4DV7Q 4HJ8A 1OXTA 1X3EA 4P72A 1M1KC 4LNQA 4GKKL 3TQYA 4JI2Q 4A3BG 1NMGA 1G51A 1JJCB 2K5NA 3KLWA 4JI8Q 3SGIA 3G6EA 1KC8C 3D0FA 1DGSA 2B63G 4JYAL 5C0XG 2K14A 5IP9G 1N33Q 1AH9A 4BBSH 4IFDJ 5AJ3L 1CKNA 2HHHQ 3W5OA 1X56A 4GKJL 1EYGA 1PHJA 1Q8KA 1HR0L 4GN3B 4A3DH 1ASZA 3HOWH 4B3RL 1WJJA 3HOVG 1TWCH 3EN2A 3IRBA 2UUAQ 5C44G 3UDFA 2UU9L 1UEBA 4DV1Q 4B3SL 2UU9Q 1FGUA 4Y52H 3F8TA 1IBLQ 2D0PA 4DAMA 4DR6L 3Q8DA 2EXDA 3CPWA 1SN8A 4IJLA 4P71A 3KOJA 4BY1H 1O7IA 4PZ6A 2BH2A 3RNUA 3CPFA 1A0IA 4A3FH 4LF6L 2NZOA 3D31A 4QGUA 4DK6C 2B29A 1XPRA 1V1QA 4A3MG 2XTIA 3RR5A 4HIMA 3HOZH 4WJ4A 4C3HH 4A3GG 5JJLA 2OWOA 1YZ6A 4NPSA 1BBWA 1Q1BA 4R4QA 3ZJYC 3T1YL 1S40A 5M5WH 5J3BA 3STBC 1FJGQ 1KL9A 3H3VH 4A3CG 2VY3A 3NENA 1E3PA 4PZ7A 1VQOA 1VQPA 4X6AH 3L2PA 4B3SQ 2IX0A 4NXNQ 1PYSB 4HJ5A 1KD1C 4DUYL 1XTDA 3M4PA 4JCVE 5M3MH 2NVQH 1RL2A 3F2BA 4X65L 2E2IH 1Y1VH 4PZ8A 5EAYA 3TS2A 4OO1G 4ME3A 1KQSA 5IYBH 4LFBL 2Y0SG 3K8AA 3AFQA 5IYDG 5FJ8H 3J81c 4A3EG 1BKBA 2N3SA 4DR5Q 2R92H 1YNXA 2L15A 3BZCA 5DLQE 3CCUA 2WP8J 4DR2Q 3S1MH 5C4JH 4OO1I 1QUQA 4L5QA 2RF4A 3F1ZA 1V9PA 4AIMA 4EQ5A 4BBSG 3H0GH 4UY8C 3HOYH 4L5SA 2JA6G 4BA2I 2UXBQ 2WAQE 1H95A 1AE2A 2WFWA 3MXNB 4AYBE 5BR8L 4POGA 3S2DH 1XMQL 4GNXC 3JC66 1Y1WH 3E0EA 1CKOA 4A76A 1XPOA 1KIXA 2OTLA 4DR3L 4C3IH 3U4VA 1XNQL 4JI3L 5IYCH 3DLLA 2ZM6Q 4A3JG 1WI5A 2OQKA 1Q12A 3FKIH 4DV4Q 4JI6Q 1NBWA 4BXXH 2Q2HA 3W1BA 5GAGC 2JA7G 3PF4A 2JA5H 4C3JH 1HNXL 2VUMG 3K7UC 2F4VQ 1YJWA 1QUQB 4LUZA 4DAYB 4DV2L 3PCOB 4AQYL 4LF8L 1Q82C 4JV5Q 1KHIA 1SR3A 1EWIA 3TEHB 2PNHA 4JI4Q 3S1QH 1PYBA 4JI1Q 4X62L 1VQMA 1M90C 4JI7Q 3ICEA 2RHQB 3HOWG 2PI2E 4MNOA 4YWMA 2R6GA 3ULLA 4JBMA 1N32L 3RN2A 2F3IA 4QY7A 4ALPA 2V1CC 4R4IA 2UXCQ 2CWPA 1HZCA 3GTJH 4DR3Q 1K8AC 3M4OH 2JA9A 4JI3Q 4L5RC 2HQLA 3E9IA 3U58A 3ULPA 4GN5A 4JI5Q 2ATWA 1FL0A 3J80i 1OTCA 4LW1A 3PIOA 5GAHC 3CF5A 1B7YB 1K0RA 3PUXA 4JI2L 1VQEA 2K5VA 4JI8L 3GTKH 1EIFA 2HT1A 2CQOA 1T9HA 2IX1A 4UP9A 1YHQA 1YI2A 1B70B 3NELA 1S72A 1IBMQ 1N33L 4P73A 3AQQA 2ZJQA 2IHEA 1KAWA 1SLJA 3L0OA 2HHHL 3CCLA 3I4MG 2E8GA 4KI0A 4A93G 1I5FA 2JE6I 2UUCQ 2KHIA 4A3KH 3FP9A 4LF7Q 1PH8A 2R7ZH 2XGTA 4J15A 1SE8A 2KHJA 4NB3A 3CCEA 5C3EG 1YBYA 3GTPH 5FLMG 2Z6KA 3I4NH 2VNUD 2UUAL 1L2FA 4DV1L 4X64Q 3G4SA 4JBWA 1X55A 2CFMA 2Z0SA 3K0XA 2YTXA 4R4OA 4BA1I 5IE8A 1IBLL 1EFWA 4LF4Q 5LMUQ 1WCMH 2GN5A 2N8NA 3LGJA 2WB1G 3UDIA 1CKMA 1HZAA 4A3IH 4YCWA 4AH6A 5IT9c 4DUZQ 5GQOA 4GKJQ 3GTOH 2PI2A 2MO0A 2ZTEA 4DV6Q 1VQCA 1QVGA 1VQAA 4IPDA 3F2CA 1LM0A 3PO2G 2Q2TA 1UE1A 2Q2IA 3RZOH 4BY7H 2N49A 1FJGL 1E24A 2MNAA 4DV5L 3A74A 3PIPA 3J81j 1YIJA 1X9NA 1XNRQ 3KFUA 2IY5B 5C0XI 1MIUA 4NXNL 3UE0A 2BA1A 5JEAJ 1VQJA 1EQRA 4IOAA 4JBKA 1A8VA 4YCUA 3HOUG 2A1AA 3HOVH 4FDBA 1XMOQ 5C44H 4IJHA 5JJKA 2JA8H 2YV5A 3GTQH 3PO3G 1J6QA 1NE3A 1SFOH 4OXPA 2JEAI 1FVIA 2NN6G 1A63A 1YEZA 1OXUA 1OXVA 2N78A 1Q46A 1E1OA 4GOPB 1VQ4A 4IFDG 1KRTA 2OTJA 3RZDH 3A5UA 4DR5L 4DR2L 1N34Q 1Z9FA 3U4ZA 1TWGH 2R93G 2KENA 4BY1G 2AHOB 4DV5Q 2K50A 3KJOA 4IFDI 4A3FG 3B6YA 4RMFA 1JB7A 2UXBL 1E1TA 3TRZA 1IYJB 1VQ8A 2MFIA 1QVCA 4DR1Q 4KHZA 1I94Q 3HOZG 3S17H 1UE6A 1IZ6A 1L1OA 2VZAA 2ZM6L 1I6HH 4DV4L 2JQOA 4JI6L 3CCMA 4DV0Q 1GM5A 2I0QA 1GKHA 1VQNA 4DR4Q 2F4VL 2K4KA 2NZHA 4JV5L 2MQHA 4A3LH 1W3SA 2VQEQ 3HOXH 5IYDH 1UWVA 3K80C 5M3MG 1G291 4JI4L 2A8VA 2ZTCA 4JI1L 2QEXA 4JI7L 5IYBG 1E7ZA 2RHSB 2Y0SE 3RN5A 5H1SE 1PH7A 3AEVA 4IOCA 1L1OB 4BBRH 3F2DA 1D7QA 3ULJA 2UXCL 1C7YA 1BBUA 3JAMc 3BJUA 2WAQG 3PV0A 1MJEA 3S2HH 4K0KQ 1D8LA 4JI5L 3BZKA 4JOIA 5FLXc 3H0GG 3CXCA 4TQUS 3PGZA 4PG3A 4GLXA 1VQBA 2IT1A 2DGYA 2K75A 2R7FA 4DV3Q 1OXSC 1IBML 1V43A 1QZHA 4KLKA 1VQ5A 1NY4A 2KCMA 4APVA 5M5XH 1TWFH 1HNWQ 1A62A 4LF7L 5K36G 2UUCL 2KCTA 3MEFA 1P16A 3NBHB 2VUMH 1X3FA 5HY6A 3FKIG 1NMFA 1K83H 1VS0A 2CKZB 4Y7NH 4BXXG 2I5HA 1PH4A 4X64L 1KXLA 3KF8B 3J7ZC 1JE5A 4UP7A 4LF4L 3PSIA 1JJ2A 2JEBI 4B3TL 5LMUL 1YJNA 3CCSA 1KRSA 2GVAA 3J81i 4JC0A 1B8AA 3PUZA 5M3FH 4DUZL 4HIKA 2ZJRA 1YVCA 3GD7A 2VQFQ 4B3MQ 3PF5A 4DV6L 3KF6B 4O0AA 4IO9A 1N36Q 4KHPQ 3I55A 4OWTB 4OX9Q 1VQLA 1EIYB 2Z6KC 4OWXB 3CCRA 1VQKA 3CC2A 4A75A 1XPUA 1C9OA 1YITA 4UPAA 1HZ9A 2C35B 2I5MX 2CCZA 2K5HA 4R1JA 1EQQA 1XNRL 3JAMi 1PFSA 4POFA 2BH8A 1I3QH 2ASBA 4A93H 3ER0A 1U0LA 3HKZG 4GNXB 3OW2A 1PH3A 4B3TQ 3I56A 3NEMA 5C3EH 5FLMH 1Q1EA 3OTOQ 1XMOL 3G71A 3M7NA 3CAMA 1N9WA 4OONA 4TVAB 4A3KG 1YHBA 3UDGA 2R7ZG 1IXRA 2PMZE 4JBJA 3KYHC 3UDXA 5IP7G 4YHHQ 3I4NG 5C4XH 1C0AA 2UXDQ 2LXJA 2AKWB 1X3GA 5LMNW 1R9TH 3E9HA 3H15A 4RG1A 4GOPA 1N34L 4NXMQ 1WCMG 4A3BH 1IBKQ 3S14H 1G6PA 2A19A 2WB1E 3WWVA 4X66Q 2B63H 1Q7YC 3PUYA 4GLAC 1MJCA 3KDFA 5IP9H 2E5LQ 3PO2H 2ZTDA 1P8LA 3M4QA 2OCEA 5IWAQ 1VQGA 3CQZH 4DR1L 1I94L 2ES2A 3KJPA 4JI0Q 4HJ9A 4YY3Q 1OXXK 1WOCA 4BY7G 3I4OA 2FXQA 4HJAA 4LFCQ 3M9BA 4A3DG 2UUBQ 3CD6A 1PH9A 5JJIA 4DV0L 4LUVA 5LMNQ 1HNZQ 4DKAC 3K7AH 1VQDA 4EX5A 1BVSA 1HZBA 4JG2A 5M5YH 2AWNA 3T1HQ 3HOUH 3EBEA 4A4IA 4DR4L 1AE3A 4GS3A 1JT8A 3L7ZC 2EQSA 1VQ6A 3PO3H 2PQAA 2VQEL 4LUOA 2JJQA 1WYDA 3KDFB 4DR7Q 4A3MH 2NN6I 1HR0W 2YTYA 2JA8G 4QIWE 3CC4A 5ELNA 3CMAA 4A3GH 2VS1A 2QA4A 1QVFA 1L1OC 3S1RH 5JEAG 3STBD 2R93H 2D0OA 4P74A 1PH2A 2LSSA 4IPCA 3I2ZA 1SRUA 4LF9Q 5HGQA 3TS0A 2CWAA 1VQ9A 3A0JA 3GDEA 3CCQA 2ZJPA 4DK3C 4A3CH 4GKKQ 4LWCA 4K0KL 3PUVA 4IPGA 1CKNB 3M85A 2AWOA 4JYAQ 4HIOA 3CC7A 1GVPA 5GADC 2PQAB 4GN4B 5AJ3Q 1UE7A 2I5LX 1K9MC 4DV3L 4OWWB 1HR0Q 3TREA 2NVYH 1PH1A
chains in the Genus database with same CATH superfamily
3SXHA 2YYZA 4RA8A 4UAIA 4X3SA 3EA6A 3P1HA 4ZYSA 3M3YB 4A3EH 2E2JH 3NBHA 4DR6Q 1S5ED 5I4DA 4LFAL 1LTLA 1QZGA 3RLOA 2WB1B 4A3LG 2RQXA 2HCCA 3Q22A 4LF6Q 4WJ4A 2E74C 3KLSA 1YJ9A 3J80c 1PA6A 4G4KA 4IZ8A 4ULLA 4R8IA 4QL5A 5GAEC 2EIFA 1X54A 3T1YQ 3NWTA 3PO2B 2LMCB 5C3XA 3URYA 2DJGC 5GROA 4MZ9A 1NJIC 4LMQD 1PTOB 1JJGA 1QNKA 4NDXA 4ZK9B 4RCNA 1Y8NB 2WKDA 2D5DA 3OYYA 5M5YB 3G48A 2NZ1D 3EFXD 2L12A 4QIWB 4LFBQ 4EQPA 5KIXA 2F0OA 1BBXC 3I3CA 1BOSA 4YCVA 1XWEA 1BF4A 2EYLA 4HIDA 3HFZB 4LF5L 2VL6A 1K73C 5CYUA 2F52A 3SE0A 1RCVD 5E7NA 3U50C 3K57A 1H9JA 3I73A 5CV8A 3ONAB 1V1PA 1SNQA 4QQBX 1SSOA 1NTGA 1F2MA 1IL2A 3C2PA 3S1NH 1VF5C 2NB0A 3T1HL 4LF8Q 1SROA 3HKZE 1ONLA 3GTGH 1Q86C 3C1FA 1G2SA 4DNTB 2X6GA 1PFBA 3WDNA 4RKBA 2YU9H 2NYZD 2BDOA 3S15H 4IUTA 4YWKA 3J81L 1SDFA 1YHAA 4LF9L 3PIO3 5BN5A 2EOTA 3BVMA 4HJ8A 4P72A 1F2ZA 1M1KC 2F0GA 1V1OA 1SJHD 4JI8Q 3SGIA 3NTHA 3G6EA 3CKIB 3I8ZA 2JA7B 4FO2A 2HHHQ 3W5OA 2HDMA 1WJJA 1SNDA 3BYTB 3EN2A 4LAAA 4Y52H 2D0PA 2EVBA 4DR6L 4HCEA 3Q8DA 4K5WA 4XT3B 3CPWA 4BY1H 3RNUA 1PTOD 3D4RA 3J7YW 1DOKA 2LS01 4LF6L 4QGUA 4RFBA 5FO9B 2XTIA 4HSPA 1BXTA 3HOZH 1GUWA 5G3LD 4A3GG 1EFID 1YZ6A 3D8GA 3KLRA 1BBWA 1Q1BA 4R4QA 3ZJYC 4F88A 1VMPA 5M5WH 3T1YL 3STBC 3PIP3 4R8NA 5IOCA 4DXGA 2DNEA 2K03A 4PZ7A 4Q0FA 4X6AH 3L2PA 4B3SQ 4LJZC 2EE1A 1PYSB 1KD1C 2G9HD 4KD3A 1BCPB 1WTXA 1WD1A 2NVQH 2ZXRA 1ET6A 3F2BA 4IUNA 5IYBH 4LFBL 1SNPA 3AFQA 5IYDG 3J81c 2B2TC 2R7ZB 3I4NB 1I50B 4KJOA 4A3EG 2N3SA 4DR5Q 3CCUA 3S1MH 4L5QA 2KOLA 3NQIA 4ODGA 3H0GH 4UY8C 4L63B 3H94A 4L5SA 2UXBQ 2WFWA 4POGA 2EYJA 4U673 2XNAC 1I4PA 5JOBA 3JC66 1XPOA 4JI3L 2ZM6Q 1JWSD 1NBWA 1W6KA 4CJ2C 4BXXH 3VYUA 1EY6A 2JA5H 3HOWB 3K7UC 4LUZA 4DAYB 4LF8L 1EWIA 2WV6D 4JI4Q 1DXMA 1VQMA 1GHJA 2EYMA 2PI2E 2JA8B 2R6GA 3RN2A 2Q8RE 1VF7A 4QY7A 3OPOA 2V1CC 4R4IA 2JA9A 1FD7D 2A69C 3E9IA 1LT4D 3ULPA 4CDEC 2Z1CA 1KAAA 4DGZA 4OWWB 3PUXA 2B2VA 1II3A 2K5VA 4JI8L 2K5QA 2HT1A 2IX1A 4QUFA 5NUCA 1Z7TA 2HHHL 3CCLA 3SEBA 2E8GA 4A93G 2JE6I 1NR2A 3IL8A 2XGTA 4J15A 4KN7C 3CCEA 5ELFA 1Y1VB 1EWHA 1L2FA 4RHRA 2BCOA 2CFMA 1A2UA 3IFTA 5IE8A 2QF7A 2B8FA 3IFDA 3WOEA 3OWEB 2EY6A 3T13A 4FF4A 1HZAA 4A3IH 3GTOH 1BCPD 3HOYB 4NP5A 3F2CA 5T1IA 2A74C 2HUGA 1UE1A 4BBRB 2PZWA 4BY7H 2N49A 4TKOB 2ZXPA 3TSSA 2RSNA 1DJRD 4C1NI 3KFUA 1J9OA 3FKIB 1EYAA 1WVLA 3MTSA 4IOAA 4ILWA 3HOUG 2A1AA 4F8MA 2CHBD 1ZEQX 5JJKA 2NWGA 2YV5A 3PO3G 1MHWC 4J6HA 1STHA 2ENBA 5IGCA 2H1EA 1YEZA 1O7ZA 4DK0A 2QKIC 3A5UA 4DR5L 1N34Q 3VR3A 2R93G 2F1MA 5C4ZA 2KENA 4BY1G 2AHOB 3MEHA 1JOOA 3N52A 5IODA 2UXBL 4R9WA 4WJWA 3TBIB 5M3FB 2MFIA 1QVCA 3HOZG 1CHQD 3ITPA 2ZM6L 1WTOA 3I91A 4DV0Q 4RCOA 3CRKC 1GM5A 5E4WC 4NKLA 2K4KA 2VQEQ 3CU7A 1MD2D 1CQVA 4FYDA 4XYQA 4JI4L 2A8VA 3Q6SA 1YNNC 5IYBG 1E7ZA 2RHSB 2Y0SE 1PH7A 5DM73 1L1OB 4RH6A 3Q24A 1D7QA 1ZYRD 2K01A 3JAMc 2WAQG 3S2HH 1VDZA 5CV6A 2EJFC 2Z4IA 5D65A 4A3BB 3H0GG 4O1NA 2PZTA 3HS0C 5CBEE 2DGYA 2NTTA 4DV3Q 1KTKA 3VYRA 3BVZA 5KYLA 5M5XH 1HNWQ 4ZAIA 3MEFA 2VUMH 1B4OA 3FDTA 5FLXE 3HOVB 2KQ3A 1VS0A 5ELCA 5C44B 2CKZB 4Y7NH 4BXXG 3KF8B 4UP7A 2PNRC 2V4DA 3PSIA 2JEBI 3CCSA 2Z4HA 3NQTA 1GHKA 3PUZA 1JORA 4KHVA 4HIKA 4A3MB 1CQFA 4O0AA 4FF2A 3HEJA 4IURA 1VQLA 1B2TA 4OWXB 3CC2A 2HQEA 1ML0D 2DNCA 1YITA 2C35B 3KLSX 2FINB 4EVOA 4MTKA 1I3QH 3QOJA 4X3KA 3HKZG 1AP0A 4JK1C 4N8FA 2IW3A 1Q1EA 2L4NA 2NVYB 5EGTA 3L3OC 3UDGA 5IP7G 3DXJC 5DEHA 3K5LA 1HUMA 1R9TH 1N34L 4NXMQ 1A15A 2Z9HA 3S14H 4BBSB 2A19A 2F0VA 4X66Q 2JA6B 4C56C 1LABA 4GLAC 1MJCA 2WIIB 4K6LA 1TS3A 5IP9H 2E5LQ 2ZTDA 1P8LA 4M1UB 2OCEA 3PO2H 4FNFA 3D3RA 2ES2A 2WKCA 3TZDA 3SDZA 1U4MA 1WOCA 2KEEA 4BY7G 4N9TA 4LFCQ 2FXQA 4EQNA 5JJZA 5CMDA 1PH9A 3PMFA 5JJIA 4DV0L 3QWNA 4DKAC 3K7AH 5M5YH 1BVSA 1STEA 3KK7A 3L7ZC 3R93A 4I65A 2KEDA 2PQAA 4KMUC 5EPLA 2VQEL 1LLRD 5EKLA 1WYDA 3KDFB 3E5SA 1STGA 2YTYA 1H9MA 3CC4A 5ELNA 2QA4A 4ID6A 3S1RH 3STBD 1FR3A 2LSSA 2KECA 5HGQA 3QJYA 3AU7A 5KGUA 1TQOA 1MSGA 3RD4A 2KUMA 4JYAQ 4GZYC 2K28A 4DNRB 1K9MC 3GV3A 4DV3L 5AFWA 5FKAC 2K52A 4B3RQ 1HNWL 4JPBW 5IGDA 2EZVA 4EGVA 1UE5A 1ZKOA 4G7ZC 1R4QB 5FJ8G 1CSQA 1VCIA 3BDCA 2R92G 1JCKB 3KF8A 3DM3A 1L0WA 5CBAE 1X65A 3NXWA 1EZ8A 3PUWA 4L5TA 1K8GA 4ZKCB 3I70A 4MIUA 5E3FA 2RSOA 4A3JH 1WTVA 2B2TA 2F0JA 1S3OA 1X6OA 1Y1WG 1B1ZA 2JA7H 4K6DA 1E22A 3S24A 4DUYQ 4CDFC 1CSPA 4C3JG 3NPPA 3K81C 1JC7A 4X3TA 4LFAQ 3RLFA 2L9HA 3CW2C 2BA0A 5CV7A 5TSSA 1CA6A 2HIXA 3J7A5 1LUZA 1TWCB 4O2DA 1CM9A 3EIVA 2KCNA 2A69D 1G2TA 2F0LA 1ASYA 4ZUIA 3U9OA 2GA4B 4NXML 2NVTH 1TWAH 2K1BA 2EJMA 1SXTA 3LX0A 2Q8IB 4X66L 3UE1A 4PMBA 3K5OA 2E5LL 3TP5A 1VQFA 1PMRA 1GO3E 3P7JA 2RBMA 1QE6A 4LFCL 4V190 1EUJA 1C4QA 4GOPC 2E2HB 2JK8A 3NTIA 1GD7A 4DV2Q 2F0KA 3A7AB 3T56B 2F0SA 3A5ZB 1LO5D 3S16H 4X62Q 1TWHB 4LF5Q 1I50H 1VQ7A 1K0SA 1N32Q 4B9XA 2MP1A 1V1PB 1XJVA 3Q0AA 2OF1A 4WJ3M 1HH2P 1WTHA 3RMHA 4DXFA 3VR5A 5IY0A 4PMWA 5HGTA 1OXTA 1NSNS 1X3EA 3W2DA 4LNQA 3TQYA 4JI2Q 1NMGA 1NAPA 3TP8A 1KC8C 1DGSA 1PLFA 4JYAL 5EJWA 1F9RA 4HMJA 5IP9G 2DY8A 4EQOA 3GTMB 1X56A 2F3VA 3LWEA 1EYGA 1Q8KA 1TT2A 1S5DD 4C3IB 1ASZA 3HOWH 4B3RL 3R2IA 3IRBA 3UDFA 2K33A 1UEBA 4DV1Q 2UU9Q 2SDFA 2XIWA 2EXDA 4LK1C 3KOJA 1O7IA 4PZ6A 2J7ZA 3CPFA 4A3FH 3I72A 5EPJA 3S1QB 1V1QA 4KY6A 1GOZA 3RR5A 4HIMA 2NVXB 4DFAA 2OWOA 4NPSA 2K7VA 1SYCA 5DAUA 1S40A 2L0CA 2IJ0A 4QCLA 3M4OB 1FJGQ 1AZPA 4KY5A 4RGMA 1FNUA 3I4LA 3NENA 2EYPA 4CDCC 5IGBA 4CKBA 4HJ5A 3M7GA 4DUYL 5FOBB 2MHVA 3GTKB 1XTDA 3VR6A 3MXGA 5M3MH 1QG7A 2F0QA 1RL2A 1YNND 1Y1VH 4PZ8A 2F0HA 3TS2A 1UNSA 5JVH3 1ESRA 2Y0SG 3K8AA 1PRTB 2EY2A 1EY7A 5JAVA 1B9MA 3A8IE 1XXGA 5DLQE 5C4JH 4OO1I 3T51B 1QUQA 1FNVA 2RF4A 1SMYC 2SNMA 3F1ZA 3SK6A 1V9PA 1WCMB 2D2CC 1GUSA 4EQ5A 3HOYH 2JP1A 4BA2I 2WAQE 3MXNB 4AYBE 3D6CA 1STBA 1DCZA 4GNXC 1CKOA 1TVXA 4A76A 1KIXA 4DR3L 2F0WA 1UEAB 3U4VA 4Q5VA 3OMCA 5I6WA 5IYCH 3DLLA 4A3JG 1WI5A 2OQKA 1Q12A 3FKIH 3RZOB 2L55A 2Q2HA 3PF4A 4A3DB 3E0JA 2JA7G 1YJWA 4DV2L 1WTPA 1B3QA 4JV5Q 1Q82C 1KHIA 3TEHB 1I6VC 4X62L 1LTID 1TIID 1G91A 4CJ0B 4JBMA 1BO0A 4YWMA 5EPKA 1N32L 2M2LA 1O80A 1JQYD 1K8AC 4C3HB 3RZDB 4JI3Q 1ESFA 3PQIA 2F0UA 4JI5Q 1FL0A 1Z6HA 1B7YB 4JI2L 4F87A 1IYUA 1HFNA 3U9SA 1WD0A 1EIFA 2CQOA 1EY0A 1YHQA 1YI2A 3A8KE 4PNYA 4OHJA 1IBMQ 3AQQA 2E76C 1KAWA 2FMCA 5D3DA 3DEOA 1JR0D 1I5FA 4LF7Q 4A3KH 2KHJA 5C3EG 1YBYA 1I6HB 4DV1L 4PMCA 2OXPA 4X64Q 3G4SA 1STAA 1X55A 2UU9L 4BA1I 1KNEA 3L9AX 3LGJA 1HUNA 1CKMA 1LTRD 5DNFA 5KRUA 4DUZQ 1JWMD 2XWJB 5GQOA 2PI2A 1O7YA 3DUZA 5CORA 2MO0A 4DV6Q 3BZDB 2XRSD 1H9RA 4IPDA 3S2DB 2BE5C 1PRTD 3D6WA 2A6HC 1FJGL 4DV5L 2MNAA 2E2DC 5IT9E 1YIJA 2IY5B 2F0TA 3UE0A 2BA1A 5JEAJ 1B44D 1VQJA 1EQRA 4DK1A 1A8VA 2EYOA 3HOVH 4FDBA 2HD3A 5C44H 4IJHA 5C5MA 2B8GA 1NE3A 1SFOH 1TWFB 1FVIA 1A63A 1OXVA 2N78A 1Q46A 4GOPB 1VQ4A 4IFDG 1KRTA 5EKIA 2VB3X 4DU9A 1PZID 4FF3A 1J8IA 3OIPA 1YNJD 2K50A 1SE3A 4A3FG 2C9OA 3B6YA 4RMFA 2XRQD 1LTBD 1IYJB 1V8QA 4KHZA 3NP8A 3MXNA 4N9PA 3T53B 4DR1Q 3HGBA 3S17H 1IZ6A 3KBXA 5A35A 1BNZA 1EEID 2VZAA 1GUTA 4ABNA 2ZT9C 5KNDA 2I0QA 3GTPB 4ZKBB 4JV5L 4RHSA 3CHBD 1A3UA 3HOXH 5M3MG 1G291 2CW0D 1I4QA 4KY7A 1S5BD 5L37A 4K5XA 3O13A 5H1SE 4IOCA 3F2DA 4OELB 1KNAA 2HDLA 3BJUA 1SNMA 4K0KQ 1D8LA 4JI5L 2M00A 3BZKA 1JE4A 3CXCA 2ICEC 4TQUS 4GLXA 2AUKA 2IT1A 3F2UA 1IBML 5COYA 1QZHA 4KLKA 1VQ5A 4APVA 2FJ2A 4LF7L 1X3FA 3FKIG 1NMFA 2PQEA 4X64L 1KDBA 4CBVA 2A6ED 2GVAA 3V05A 4DUZL 2ZJRA 1YVCA 3GD7A 1X32A 2VQFQ 1CK1A 4A3GB 4DV6L 3KF6B 1N36Q 4OWTB 1MI2A 1QILA 1VQKA 2Z6KC 4KV6A 2OEOA 1LV9A 3TZUA 4UPAA 2CCZA 3OWFA 1EQQA 3JAMi 4QF4A 4POFA 2BH8A 2VB2X 3ER0A 4GNXB 5KNCA 3I56A 2EDGA 5FLMH 3OTOQ 1D1KA 4OONA 4TVAB 2RDGA 1ZXTA 4HCSA 5DM63 5T1GA 4A3KG 3QOLA 2VXWA 3KYHC 3UDXA 4YHHQ 5C4XH 4A3EB 2LXJA 2E2JB 4GOPA 1G6ZA 1IBKQ 2WB1E 3OSOA 3H09A 4XXEA 5IWAQ 1VQGA 3CQZH 4DR1L 3NBIA 4JI0Q 4HJ9A 4YY3Q 2F3WA 3I4OA 4HJAA 3M9BA 2UUBQ 3CD6A 2AQ3B 4LUVA 1HNZQ 2MUYA 1HZBA 4EX5A 4G7HC 4K2LA 4O42A 3TN2A 4A4IA 1JT8A 2EQSA 4LUOA 2JJQA 4WFN3 2NN6I 4QIWE 3CMAA 1QVFA 1D5MC 4IUVA 4P74A 4IPCA 1SRUA 3MAQA 1TR5A 2CWAA 4K0KL 1SYGA 4IPGA 4ZRZA 1CZWA 1QNUA 1FNWA 1GVPA 2PQAB 4GN4B 5AJ3Q 2QW7A 1KDCA 2KHSA 1D2BA 4GKJQ 3QB3A 1Y69U 1T5XD 2GVBA 4A93B 2EYHA 1N8RC 2E2HH 1AFPA 2AMCB 2PMZB 3H91A 3H3VI 1HTPA 3S1NB 1FYCA 1SMYD 1TWHH 3BG3A 1EL0A 4GLVB 2Z6BA 3HOXG 4AYBG 3ERSX 4DPGA 3I90A 3CP0A 2F0EA 4UP8A 3V96A 2VQFL 2KVMA 4E6IA 2B63B 2YU9B 1N36L 3S15B 3HKSA 3DEPA 3KF6A 2IPKD 2DUDA 3J80E 1F2LA 3GTMH 1F77A 2JA5G 1Q8IA 2LXKA 2YTVA 1IKMA 3CCJA 3HOUB 1K8OA 4X65Q 2N88A 2KA7A 4GNXA 5D14A 3OTOL 2G9DA 3PO3B 4XQQA 1EIGA 1D1IA 2Z8LA 4R4TA 4YHHL 3MXUA 1XYIA 4XIGS 1PV4A 3MXPA 1J5EL 2A73B 1TS2A 1MSHA 2VW9A 2OQ0A 1PVOA 2R93B 5ELOA 2NVXH 4BY1B 1Q81C 1IBKL 4XTCS 1CUKA 3GO5A 5BR8Q 1H9SA 3HZXA 1XMQQ 1JMCA 5IWAL 3I4MH 4UDUC 4QJFA 3CCVA 1DZ1A 1XNQQ 1NCVA 3HOZB 1STNA 3VDYA 1EYCA 4DV7L 4JI0L 1U5KA 4YY3L 3M3YH 5M5WB 3OW7A 1A2TA 2EXZA 1HNXQ 1SEBD 2SOBA 4MTNA 2UUBL 4ZQ3A 1HNZL 4C2MB 4AQYQ 1DONA 5C0XJ 5LHY1 1IYVA 1FGBD 4PV1C 3TP6A 2NVQB 2HIVA 2JSOA 3HG9A 2D62A 4A3IG 2BE5D 1IHZA 3GTLB 2Q2UA 5C4XG 3H6MA 2A6HD 4HJ7A 2WAQB 1D5XC 5C4HA 3S1MB 1PTOH 4OIJA 4OEMB 2K5NA 1F9SA 1JJCB 3H0GB 3QO2A 3M4YA 2K32A 5JPNC 4HR7B 2K14A 1RF2D 5AJ3L 5G3LF 2F03A 4GKJL 1PHJA 4FXGC 3GQBA 3NWSA 4GN3B 4XT1B 4A3DH 3A8JE 1TU2B 2NN6H 2UUAQ 1KLGD 1IBLQ 1HFGA 1SN8A 4IJLA 1E2VA 3MVVA 1LTSD 1A0IA 3D31A 5ELEA 5JEAH 2B29A 2LKVA 1XPRA 2LFNA 1B50A 1VMCA 3DWPA 4C3HH 5CGKA 1B3AA 1Y8PB 5J3BA 1TKWB 3K0YA 1R4PB 1KL9A 3H3VH 1VQOA 1E3PA 2IX0A 4NXNQ 3NTKA 3HKZB 3AB9A 1KLUD 3M4PA 4JCVE 1ENCA 1JOKA 4X65L 5EAYA 2NTSA 1PYWD 1KQSA 3K5MA 4S3SA 4ME5A 1S5CD 3QIAA 1HCZA 1YNXA 3BZCA 4IQZA 3GV6A 2A5HA 4AIMA 3J81E 2B2YC 2MGSA 3S2DH 1SNOA 5BR8L 1K3BC 1EEFD 2AUJD 1C8CA 1XMQL 2B39A 2X6LA 2OTLA 1XNQL 3R8BA 2RA4A 4WORA 2K6AA 4JI6Q 4BY7B 4IUUA 1HNXL 1SYEA 2F4IA 2VUMG 1QUQB 4AQYL 1QCBD 1SR3A 1EU3A 1ET9A 2PNHA 2RDHA 1M90C 1E2ZA 2MPMA 1RTOA 2RHQB 2ICIA 3ULLA 1AW7A 3SR1A 2F3IA 2UXCQ 2QDBA 1HZCA 3EJIA 2R3ZA 5E4XA 4DR3Q 3J7AV 4L5RC 1A3TA 1K8MA 2ATWA 2EY5A 3J80i 4IUQA 3PIOA 3CF5A 2O5IC 1K0RA 1UAPA 3SHLA 1EY4A 1OO9B 3OMGA 2ZJQA 2IHEA 1PDQA 3L0OA 3I4MG 2QILA 2CH4A 2KHIA 2F0PA 2SNSA 3FP9A 2UUCQ 2X69A 1PH8A 2R7ZH 3GTPH 3I4NH 2Z6KA 2UUAL 2E2IB 3E6ZX 2TSSA 2PPBC 1HRJA 3K0XA 1IBLL 4LF4Q 5LMUQ 2N8NA 2O4XA 2WB1G 2I46A 1T5EA 1CI3M 2R92B 3D4DA 2KJXA 3LNNA 4YCWA 2B2WC 3P75A 1LT3D 1DOMA 5BN4A 2ZTEA 4HN7A 1SAPA 1VQCA 1QVGA 1PFMA 4FXDA 3V2TA 1VQAA 3PO2G 3LWUA 2Q2TA 3R2TA 1Y1WB 3MC0B 1EY9A 3A74A 3PIPA 3J81j 1X9NA 3S2HB 2XVSA 1WTRA 5C0XI 1MIUA 3UI2A 5BN3A 4NXNL 1BCPC 5FLXL 4L6TB 4JBKA 4C3JB 2PZUA 2XN9C 2JA8H 1J6QA 5C3WA 2JEAI 2NN6G 3C3LA 5IGFA 1OXUA 1E1OA 3A7LA 2OTJA 2O2LD 4Y7NB 2E75C 2FFKB 2NBFA 3NSWA 3U4ZA 5I9OA 3GTJB 4DV5Q 3KJOA 1JICA 3P20A 3EROA 4V0BA 1JB7A 1E1TA 3MWYW 2R61A 5EKKA 1I94Q 4M8AA 1TS5A 2FHTA 5I9PA 2J0TD 3SK4A 1S4ZA 3FPPA 4J1MA 4JI6L 4K5VA 4FXKC 1GUNA 1DYQA 3VYSA 4DR4Q 1W3SA 1I3QB 4H44C 2C5CA 5IYDH 3K80C 1MBYA 1AN8A 3HRZC 4G7OC 1DD2A 2CVRA 4DAVA 3RN5A 4DAPA 3BDOA 4BBRH 3FEWX 3ULJA 1C7YA 1BBUA 2UXCL 1HPCA 1MJEA 1R9TB 2QCPX 1SNCA 5FLXc 3S14B 1I4HA 4IUPA 4PG3A 3K58A 1VQBA 4I7ZC 1EYDA 3FRPB 3JAME 1DOLA 1I4RA 1ZYRC 2UUCL 3KBGA 3GTQB 2I5HA 1TY2A 3J7ZC 1JE5A 2P5ZX 3K7AB 4KJNA 2RDFA 4LF4L 4B3TL 5LMUL 2XSCA 1E2WA 3J81i 5M3FH 1TWGB 1U4PA 3NHHA 1EZ6A 2F0IA 4B3MQ 3PF5A 5EBDA 4OIKA 4IO9A 4KHPQ 3S1RB 4OX9Q 3NE5B 3D4WA 1EIYB 4A75A 4C1NK 1Q3LA 4OGQC 1C9OA 1HZ9A 3DWAA 5A2QE 4FP5D 3MFGA 2K5HA 1PFSA 3N6RA 1I4XA 2ASBA 1L0YB 4A93H 1U0LA 1PH3A 3KUPA 1NNXA 2F0DA 1QOHA 5LL6X 3M7NA 1IW7C 3G6JB 1LT6D 4K8JA 4HMIA 2Y0SB 1YHBA 2R7ZG 1IXRA 4JBJA 3I4NG 4DF7A 1QJOA 3A55A 1C0AA 2UXDQ 1ILQA 2XWBB 3CRLC 4JW0A 2AKWB 1X3GA 3H15A 4RG1A 4A3BH 1DM0B 1X3QA 1G6PA 3WWVA 4K14A 4HEDA 1AEXA 4KTAA 4K2KA 3PUYA 3X3MA 4HSVA 4DN4M 5C0XH 2B63H 3K5NA 4N8X1 3BDLA 1WTQA 1Q90A 2J4XA 1I94L 4DA2A 5KNBA 4A3JB 1ENFA 4KKUA 1XTCD 2AQ2B 5ELDA 5LMNQ 3HOWG 4JG2A 3HOUH 2AWNA 4YIJA 4DR4L 1K83B 1VQ6A 1WTWA 1TY0A 3PO3H 2DN8A 1KDAA 4QB4A 1UUPA 5CC4A 1RDPD 4DR7Q 4A3MH 1ICFB 4BS9A 2JA8G 4WRDA 1L1OC 1CHPD 2R93H 2L5TA 2O5JC 3I2ZA 3S9WA 3TS0A 3GDEA 5CR3A 2ZJPA 2I07B 4L8JA 4DK3C 4GKKQ 4A3CH 1G8ZD 3PUVA 2NVTB 1CKNB 1TWAB 5KEEA 2AWOA 4HIOA 1UE7A 4B08A 1HR0Q 2F0NA 2NVYH 2CWPA 1PH1A 4OO1H 2K5DA 4C2MH 1SE2A 4R4CA 3VR2A 2QGQA 5C3EB 1TXYA 1Y1VG 4H02A 1TS4A 4IPHA 3W1GA 1EOVA 4TSSA 1GUOA 4JOIC 1CA5A 1K3RA 4KKSA 1LYLA 4DNIA 5I2XA 5ISRA 4BBSH 2JA6H 1BUVT 3GP7A 4QUCA 3J7AF 3CMEA 3FHWA 3I7FA 2PW5A 4MHEA 3S16B 2KCCA 3FPUB 3GTLH 4KKTA 3ND8A 3HOYG 1Y14B 1MKHA 4B3ML 4P75A 5IGGA 4KHPL 3BYYB 4BBRG 4OX9L 2ALYB 4JVZA 5IYCG 3SVMA 4I7AA 2A68C 3AFPA 2G5DA 2RCFA 2MO1A 2KBNA 2B2YA 2H5XA 1VQHA 3DMUA 4YWLA 3BU2A 4KN4C 2ID0A 3IAYA 3VA5A 2UXDL 3OIQA 2B2UC 1HJPA 1GXDC 5LL6S 2B3GA 1M8AA 1W6JA 4A3FB 1VQIA 5M3FG 1HA6A 1HQMC 1RIPA 4Z9CB 1W2BA 1PH6A 3HP3A 2R7DA 1PZJD 1LACA 2RCNA 5C5LA 3ND9A 1SMXA 4NW2A 1WFQA 2D9UA 1E0BA 5LMNL 3AYHB 1Z47A 1NR4A 4CJ1B 3RLNA 1PH5A 1J5EQ 3K59A 5IP7H 5M3MB 1HA5A 1H9SB 4DR7L 1U9RA 3T16A 2IHFA 2PYKA 4XQNA 4DV7Q 1S5FD 5C4JB 4GKKL 2QDLA 4A3BG 1G51A 3KLWA 2IWHA 3D0FA 1IL8A 2B63G 5C0XG 1N33Q 1AH9A 2B2WA 4IFDJ 1CKNA 5J22A 1HXYD 1HR0L 3JAML 1D5ZC 2F0FA 1TWCH 1C48A 3HOVG 4ZCKA 5C44G 4B3SL 4XQJA 1FGUA 3F8TA 3C1EA 4DAMA 5K5PA 2Q8TA 1SYBA 2WACA 4P71A 4FF1A 2BH2A 1B9NA 5CV9A 2NZOA 1A6XA 4DK6C 5JPMC 4A3MG 5JJLA 1K28A 4FVMA 2AQ1B 3OOCA 2EJGC 5CV5A 4A3CG 2VY3A 1VQPA 4ZLTF 1LT5D 5A2QL 3QR8A 4BWGB 5CV4A 3A56A 1HHVA 1F9QA 2E2IH 4P2CB 4OO1G 4ME3A 4KD4A 4A3KB 5FJ8H 4CDDC 2ZXOA 4K8IA 3BS1A 1SYDA 3GTGB 1BKBA 2R92H 2L15A 4H0LC 4DR2Q 2WP8J 2OT2A 4J8QA 4NMZA 2K5WA 4DAYA 2IX3A 4BBSG 3ZYYX 2EY1A 2JA6G 4RGTA 1EIHA 1AE2A 1H95A 5EBCA 5J39A 1GUGA 1I4GA 1BR9A 1EU4A 4HTHA 3E0EA 5IT9L 1Y1WH 4IN3A 4C3IH 1PXUA 1RJTA 5K36H 2LY7A 4DV4Q 1ENAA 3W1BA 5GAGC 2K05A 4C3JH 5IGEA 4TRDA 4HAEA 2F4VQ 1RODA 1BQQT 3PCOB 4IALA 5FO7B 1SE4A 5F2DA 1D6EC 2L1BA 3S1QH 3W3AA 1PYBA 4JI1Q 4JI7Q 3SK8A 3AMUA 3ICEA 4MNOA 4CGYB 1SFOB 4ALPA 2JXMB 2L11A 3GTJH 3M4OH 4U68A 1U4LA 2HQLA 3U58A 4GN5A 1A3VA 1EQVA 1HTLD 2DY7A 2EPBA 1OTCA 4LW1A 5GAHC 1RKNA 1VQEA 2WINB 3GTKH 3TMEA 1T9HA 4UP9A 1F2YA 1B70B 3NELA 1S72A 1N33L 1IW7D 4P73A 4OL7A 1SLJA 4KI0A 1MGSA 3S17B 2MJ8A 5JVG3 1PRTF 1SE8A 4NB3A 2VNUD 3VR4A 5FLMG 1STYA 4JBWA 2Z0SA 1ICWA 4R4OA 2YTXA 3Q23A 4CKEA 1EFWA 5M9OA 1WCMH 2GN5A 4RGNA 5I6YA 3DM1A 3UDIA 2RKSA 2HCIA 1O7LA 4KK7A 1X3PA 3HOXB 4AYBB 4AH6A 3MFYA 5IT9c 1PTOF 4QMGA 1ILPA 1LM0A 1RHPA 2Q2IA 3RZOH 2H4OA 1JWUD 1E24A 3R3OA 1M4VA 4B9WA 1XNRQ 1EOTA 2JA5B 4YCUA 1PZKD 5KYIA 1XMOQ 3GTQH 1PRTC 2K04A 4RAUC 4RWSC 4OXPA 3TDQA 4G57A 3E3XA 2PCFB 3RZDH 4DR2L 2PW7A 1Z9FA 3QG1A 4RGOS 1TWGH 1O78A 3EQLC 1H9KA 3DWQA 1PTOC 4IFDI 1XX8A 4CKCA 1SJED 3TRZA 1VQ8A 3X3NA 1GJXA 3C46A 1UE6A 1EQTA 5FK9C 1L1OA 5FO8B 5IIFA 1I6HH 4DV4L 2JQOA 3CCMA 1YNJC 4PQXA 1GKHA 1VQNA 5I2YA 2F4VL 1CFMA 2NZHA 4A3LH 2MQHA 3MA2B 1SBBB 1HQRD 1CZGA 1UWVA 5E1FA 2ZTCA 4JI1L 1L0XB 2QEXA 4JI7L 4CHTB 4A3IB 3AEVA 5J1ZA 3GTOB 2TMPA 5C4XB 4H7BA 3IKJA 3PV0A 4X3UA 2A68D 4JOIA 1LTAD 3H3VC 2CW0C 1F9PA 3PGZA 1CT1D 4RKLA 2K75A 3ERQA 2R7FA 4XYOA 1OXSC 1V43A 3CQZB 1NY4A 2KCMA 4H13C 3NK9A 1TWFH 4C3IG 1A62A 5K36G 2KCTA 3NBHB 1P16A 1KABA 5HY6A 2CQAA 1K83H 1U4RA 1EY8A 1PH4A 1KXLA 1JJ2A 2BDNA 1YJNA 2B2VC 1KRSA 1EY5A 5ELBA 3OHXC 4JC0A 1B8AA 3RUZA 2JN4A 3TP7A 1Y8OB 3NUCA 5D3IB 1BCPF 3I55A 2QEJC 3CCRA 1XPUA 2EYFA 2A6EC 2B2UA 1JOQA 2I5MX 1SYFA 3FMCA 4R1JA 1XNRL 3SK5A 3EVQA 2JYOA 3OW2A 3DHQA 4B3TQ 3NEMA 5C3EH 1XMOL 3G71A 3CAMA 1N9WA 3MZ5A 2IL8A 2PMZE 2N55A 1RD9D 5LMNW 3E9HA 5EQ0A 1WCMG 3BVGA 2BOSA 1QB5D 1Q7YC 3KDFA 1BDOA 1B53A 1PFNA 1QWYA 5HURA 3M4QA 2RVLA 3J80L 3KJPA 3FVQA 1OXXK 1RTNA 4UHVA 4A3DG 1CTMA 2PO4A 5M5XB 3K6OA 1VQDA 2VUMB 3T1HQ 3EBEA 1AE3A 2CH4W 4GS3A 3VYTA 2SEBD 5C6AA 3MHBA 2F0MA 2DJFC 1HR0W 3VA7A 4IFDH 4A3GH 1AZQA 2VS1A 5JEAG 2FMMA 1LTTD 1IKLA 4ZUJA 2D0OA 1PH2A 1EWCA 3T4AC 4LF9Q 4XDXA 4C3HG 1VQ9A 3A0JA 3CCQA 4LWCA 1NUCA 3A54A 4F7XA 3M85A 1LTGD 3G7LA 2NUCA 3CC7A 5GADC 2I5LX 3WOFA 1JB3A 3TREA 3I4MB 2M9VA 4MN3A
chains in the Genus database with same CATH topology
2GVBA 2K52A 2YYZA 1N8RC 4B3RQ 2E2HH 1HNWL 2AMCB 3H3VI 4C2MH 4R4CA 2QGQA 4A3EH 1TXYA 1UE5A 1Y1VG 4H02A 2E2JH 4IPHA 3W1GA 4DR6Q 1EOVA 5FJ8G 1CSQA 1TWHH 1VCIA 4JOIC 1K3RA 4GLVB 1LTLA 1LYLA 3RLOA 4DNIA 1QZGA 4LFAL 2JA6H 2R92G 3DM3A 4A3LG 4LF6Q 1L0WA 3HOXG 1X65A 3PUWA 4AYBG 1K8GA 4L5TA 3FHWA 3ERSX 3I7FA 3CMEA 4DPGA 3GTLH 1YJ9A 3J80c 1PA6A 3HOYG 3CP0A 4UP8A 2VQFL 1Y14B 1MKHA 4QL5A 4B3ML 5GAEC 2EIFA 1X54A 4P75A 3T1YQ 4A3JH 1N36L 4KHPL 3HKSA 4BBRG 4OX9L 1S3OA 1X6OA 1Y1WG 3KF6A 2ALYB 2JA7H 5GROA 4MZ9A 5IYCG 2DUDA 1NJIC 1JJGA 3AFPA 3GTMH 1E22A 3S24A 4DUYQ 2MO1A 2KBNA 2JA5G 1CSPA 2LXKA 2YTVA 3OYYA 2H5XA 3K81C 1VQHA 3CCJA 4LFAQ 4X65Q 3G48A 3RLFA 4GNXA 3OTOL 4YWLA 3CW2C 4LFBQ 2BA0A 3BU2A 2HIXA 3J7A5 1LUZA 4R4TA 4O2DA 2ID0A 4YHHL 3EIVA 4YCVA 2UXDL 4XIGS 1PV4A 1J5EL 1ASYA 1HJPA 2VW9A 4HIDA 3HFZB 2OQ0A 1PVOA 4NXML 2NVTH 1TWAH 2VL6A 5ELOA 2NVXH 4LF5L 1Q81C 1IBKL 4XTCS 1K73C 2B3GA 1CUKA 4X66L 3GO5A 3UE1A 5BR8Q 2F52A 1VQIA 5M3FG 1XMQQ 5E7NA 1JMCA 1RIPA 3U50C 5IWAL 2E5LL 3I4MH 4QJFA 3CCVA 1XNQQ 1W2BA 1PH6A 4QQBX 1VQFA 3VDYA 1NTGA 4DV7L 2R7DA 4JI0L 1U5KA 2RCNA 4YY3L 1IL2A 1GO3E 3M3YH 1SMXA 3S1NH 4LFCL 1EUJA 1HNXQ 1WFQA 2UUBL 4MTNA 4GOPC 5LMNL 2JK8A 1HNZL 1GD7A 3AYHB 4DV2Q 4AQYQ 3T1HL 4LF8Q 1Z47A 1PH5A 3RLNA 1J5EQ 5C0XJ 1SROA 3HKZE 3A5ZB 3S16H 4X62Q 5IP7H 3GTGH 1Q86C 4LF5Q 1I50H 2HIVA 1VQ7A 4DR7L 1N32Q 2IHFA 2YU9H 1XJVA 2D62A 4A3IG 4WJ3M 1HH2P 3S15H 4YWKA 5IY0A 2Q2UA 5C4XG 4PMWA 1YHAA 4HJ7A 4LF9L 4DV7Q 4HJ8A 1OXTA 1X3EA 4P72A 1M1KC 4LNQA 4GKKL 3TQYA 4JI2Q 4A3BG 1NMGA 1G51A 1JJCB 2K5NA 3KLWA 4JI8Q 3SGIA 3G6EA 1KC8C 3D0FA 1DGSA 2B63G 4JYAL 5C0XG 2K14A 5IP9G 1N33Q 1AH9A 4BBSH 4IFDJ 5AJ3L 1CKNA 2HHHQ 3W5OA 1X56A 4GKJL 1EYGA 1PHJA 1Q8KA 1HR0L 4GN3B 4A3DH 1ASZA 3HOWH 4B3RL 1WJJA 3HOVG 1TWCH 3EN2A 3IRBA 2UUAQ 5C44G 3UDFA 2UU9L 1UEBA 4DV1Q 4B3SL 2UU9Q 1FGUA 4Y52H 3F8TA 1IBLQ 2D0PA 4DAMA 4DR6L 3Q8DA 2EXDA 3CPWA 1SN8A 4IJLA 4P71A 3KOJA 4BY1H 1O7IA 4PZ6A 2BH2A 3RNUA 3CPFA 1A0IA 4A3FH 4LF6L 2NZOA 3D31A 4QGUA 4DK6C 2B29A 1XPRA 1V1QA 4A3MG 2XTIA 3RR5A 4HIMA 3HOZH 4WJ4A 4C3HH 4A3GG 5JJLA 2OWOA 1YZ6A 4NPSA 1BBWA 1Q1BA 4R4QA 3ZJYC 3T1YL 1S40A 5M5WH 5J3BA 3STBC 1FJGQ 1KL9A 3H3VH 4A3CG 2VY3A 3NENA 1E3PA 4PZ7A 1VQOA 1VQPA 4X6AH 3L2PA 4B3SQ 2IX0A 4NXNQ 1PYSB 4HJ5A 1KD1C 4DUYL 1XTDA 3M4PA 4JCVE 5M3MH 2NVQH 1RL2A 3F2BA 4X65L 2E2IH 1Y1VH 4PZ8A 5EAYA 3TS2A 4OO1G 4ME3A 1KQSA 5IYBH 4LFBL 2Y0SG 3K8AA 3AFQA 5IYDG 5FJ8H 3J81c 4A3EG 1BKBA 2N3SA 4DR5Q 2R92H 1YNXA 2L15A 3BZCA 5DLQE 3CCUA 2WP8J 4DR2Q 3S1MH 5C4JH 4OO1I 1QUQA 4L5QA 2RF4A 3F1ZA 1V9PA 4AIMA 4EQ5A 4BBSG 3H0GH 4UY8C 3HOYH 4L5SA 2JA6G 4BA2I 2UXBQ 2WAQE 1H95A 1AE2A 2WFWA 3MXNB 4AYBE 5BR8L 4POGA 3S2DH 1XMQL 4GNXC 3JC66 1Y1WH 3E0EA 1CKOA 4A76A 1XPOA 1KIXA 2OTLA 4DR3L 4C3IH 3U4VA 1XNQL 4JI3L 5IYCH 3DLLA 2ZM6Q 4A3JG 1WI5A 2OQKA 1Q12A 3FKIH 4DV4Q 4JI6Q 1NBWA 4BXXH 2Q2HA 3W1BA 5GAGC 2JA7G 3PF4A 2JA5H 4C3JH 1HNXL 2VUMG 3K7UC 2F4VQ 1YJWA 1QUQB 4LUZA 4DAYB 4DV2L 3PCOB 4AQYL 4LF8L 1Q82C 4JV5Q 1KHIA 1SR3A 1EWIA 3TEHB 2PNHA 4JI4Q 3S1QH 1PYBA 4JI1Q 4X62L 1VQMA 1M90C 4JI7Q 3ICEA 2RHQB 3HOWG 2PI2E 4MNOA 4YWMA 2R6GA 3ULLA 4JBMA 1N32L 3RN2A 2F3IA 4QY7A 4ALPA 2V1CC 4R4IA 2UXCQ 2CWPA 1HZCA 3GTJH 4DR3Q 1K8AC 3M4OH 2JA9A 4JI3Q 4L5RC 2HQLA 3E9IA 3U58A 3ULPA 4GN5A 4JI5Q 2ATWA 1FL0A 3J80i 1OTCA 4LW1A 3PIOA 5GAHC 3CF5A 1B7YB 1K0RA 3PUXA 4JI2L 1VQEA 2K5VA 4JI8L 3GTKH 1EIFA 2HT1A 2CQOA 1T9HA 2IX1A 4UP9A 1YHQA 1YI2A 1B70B 3NELA 1S72A 1IBMQ 1N33L 4P73A 3AQQA 2ZJQA 2IHEA 1KAWA 1SLJA 3L0OA 2HHHL 3CCLA 3I4MG 2E8GA 4KI0A 4A93G 1I5FA 2JE6I 2UUCQ 2KHIA 4A3KH 3FP9A 4LF7Q 1PH8A 2R7ZH 2XGTA 4J15A 1SE8A 2KHJA 4NB3A 3CCEA 5C3EG 1YBYA 3GTPH 5FLMG 2Z6KA 3I4NH 2VNUD 2UUAL 1L2FA 4DV1L 4X64Q 3G4SA 4JBWA 1X55A 2CFMA 2Z0SA 3K0XA 2YTXA 4R4OA 4BA1I 5IE8A 1IBLL 1EFWA 4LF4Q 5LMUQ 1WCMH 2GN5A 2N8NA 3LGJA 2WB1G 3UDIA 1CKMA 1HZAA 4A3IH 4YCWA 4AH6A 5IT9c 4DUZQ 5GQOA 4GKJQ 3GTOH 2PI2A 2MO0A 2ZTEA 4DV6Q 1VQCA 1QVGA 1VQAA 4IPDA 3F2CA 1LM0A 3PO2G 2Q2TA 1UE1A 2Q2IA 3RZOH 4BY7H 2N49A 1FJGL 1E24A 2MNAA 4DV5L 3A74A 3PIPA 3J81j 1YIJA 1X9NA 1XNRQ 3KFUA 2IY5B 5C0XI 1MIUA 4NXNL 3UE0A 2BA1A 5JEAJ 1VQJA 1EQRA 4IOAA 4JBKA 1A8VA 4YCUA 3HOUG 2A1AA 3HOVH 4FDBA 1XMOQ 5C44H 4IJHA 5JJKA 2JA8H 2YV5A 3GTQH 3PO3G 1J6QA 1NE3A 1SFOH 4OXPA 2JEAI 1FVIA 2NN6G 1A63A 1YEZA 1OXUA 1OXVA 2N78A 1Q46A 1E1OA 4GOPB 1VQ4A 4IFDG 1KRTA 2OTJA 3RZDH 3A5UA 4DR5L 4DR2L 1N34Q 1Z9FA 3U4ZA 1TWGH 2R93G 2KENA 4BY1G 2AHOB 4DV5Q 2K50A 3KJOA 4IFDI 4A3FG 3B6YA 4RMFA 1JB7A 2UXBL 1E1TA 3TRZA 1IYJB 1VQ8A 2MFIA 1QVCA 4DR1Q 4KHZA 1I94Q 3HOZG 3S17H 1UE6A 1IZ6A 1L1OA 2VZAA 2ZM6L 1I6HH 4DV4L 2JQOA 4JI6L 3CCMA 4DV0Q 1GM5A 2I0QA 1GKHA 1VQNA 4DR4Q 2F4VL 2K4KA 2NZHA 4JV5L 2MQHA 4A3LH 1W3SA 2VQEQ 3HOXH 5IYDH 1UWVA 3K80C 5M3MG 1G291 4JI4L 2A8VA 2ZTCA 4JI1L 2QEXA 4JI7L 5IYBG 1E7ZA 2RHSB 2Y0SE 3RN5A 5H1SE 1PH7A 3AEVA 4IOCA 1L1OB 4BBRH 3F2DA 1D7QA 3ULJA 2UXCL 1C7YA 1BBUA 3JAMc 3BJUA 2WAQG 3PV0A 1MJEA 3S2HH 4K0KQ 1D8LA 4JI5L 3BZKA 4JOIA 5FLXc 3H0GG 3CXCA 4TQUS 3PGZA 4PG3A 4GLXA 1VQBA 2IT1A 2DGYA 2K75A 2R7FA 4DV3Q 1OXSC 1IBML 1V43A 1QZHA 4KLKA 1VQ5A 1NY4A 2KCMA 4APVA 5M5XH 1TWFH 1HNWQ 1A62A 4LF7L 5K36G 2UUCL 2KCTA 3MEFA 1P16A 3NBHB 2VUMH 1X3FA 5HY6A 3FKIG 1NMFA 1K83H 1VS0A 2CKZB 4Y7NH 4BXXG 2I5HA 1PH4A 4X64L 1KXLA 3KF8B 3J7ZC 1JE5A 4UP7A 4LF4L 3PSIA 1JJ2A 2JEBI 4B3TL 5LMUL 1YJNA 3CCSA 1KRSA 2GVAA 3J81i 4JC0A 1B8AA 3PUZA 5M3FH 4DUZL 4HIKA 2ZJRA 1YVCA 3GD7A 2VQFQ 4B3MQ 3PF5A 4DV6L 3KF6B 4O0AA 4IO9A 1N36Q 4KHPQ 3I55A 4OWTB 4OX9Q 1VQLA 1EIYB 2Z6KC 4OWXB 3CCRA 1VQKA 3CC2A 4A75A 1XPUA 1C9OA 1YITA 4UPAA 1HZ9A 2C35B 2I5MX 2CCZA 2K5HA 4R1JA 1EQQA 1XNRL 3JAMi 1PFSA 4POFA 2BH8A 1I3QH 2ASBA 4A93H 3ER0A 1U0LA 3HKZG 4GNXB 3OW2A 1PH3A 4B3TQ 3I56A 3NEMA 5C3EH 5FLMH 1Q1EA 3OTOQ 1XMOL 3G71A 3M7NA 3CAMA 1N9WA 4OONA 4TVAB 4A3KG 1YHBA 3UDGA 2R7ZG 1IXRA 2PMZE 4JBJA 3KYHC 3UDXA 5IP7G 4YHHQ 3I4NG 5C4XH 1C0AA 2UXDQ 2LXJA 2AKWB 1X3GA 5LMNW 1R9TH 3E9HA 3H15A 4RG1A 4GOPA 1N34L 4NXMQ 1WCMG 4A3BH 1IBKQ 3S14H 1G6PA 2A19A 2WB1E 3WWVA 4X66Q 2B63H 1Q7YC 3PUYA 4GLAC 1MJCA 3KDFA 5IP9H 2E5LQ 3PO2H 2ZTDA 1P8LA 3M4QA 2OCEA 5IWAQ 1VQGA 3CQZH 4DR1L 1I94L 2ES2A 3KJPA 4JI0Q 4HJ9A 4YY3Q 1OXXK 1WOCA 4BY7G 3I4OA 2FXQA 4HJAA 4LFCQ 3M9BA 4A3DG 2UUBQ 3CD6A 1PH9A 5JJIA 4DV0L 4LUVA 5LMNQ 1HNZQ 4DKAC 3K7AH 1VQDA 4EX5A 1BVSA 1HZBA 4JG2A 5M5YH 2AWNA 3T1HQ 3HOUH 3EBEA 4A4IA 4DR4L 1AE3A 4GS3A 1JT8A 3L7ZC 2EQSA 1VQ6A 3PO3H 2PQAA 2VQEL 4LUOA 2JJQA 1WYDA 3KDFB 4DR7Q 4A3MH 2NN6I 1HR0W 2YTYA 2JA8G 4QIWE 3CC4A 5ELNA 3CMAA 4A3GH 2VS1A 2QA4A 1QVFA 1L1OC 3S1RH 5JEAG 3STBD 2R93H 2D0OA 4P74A 1PH2A 2LSSA 4IPCA 3I2ZA 1SRUA 4LF9Q 5HGQA 3TS0A 2CWAA 1VQ9A 3A0JA 3GDEA 3CCQA 2ZJPA 4DK3C 4A3CH 4GKKQ 4LWCA 4K0KL 3PUVA 4IPGA 1CKNB 3M85A 2AWOA 4JYAQ 4HIOA 3CC7A 1GVPA 5GADC 2PQAB 4GN4B 5AJ3Q 1UE7A 2I5LX 1K9MC 4DV3L 4OWWB 1HR0Q 3TREA 2NVYH 1PH1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GVB A;  2K52 A;  2YYZ A;  1N8R C;  4B3R Q;  2E2H H;  1HNW L;  2AMC B;  3H3V I;  4C2M H;  4R4C A;  2QGQ A;  4A3E H;  1TXY A;  1UE5 A;  1Y1V G;  4H02 A;  2E2J H;  4IPH A;  3W1G A;  4DR6 Q;  1EOV A;  5FJ8 G;  1CSQ A;  1TWH H;  1VCI A;  4JOI C;  1K3R A;  4GLV B;  1LTL A;  1LYL A;  3RLO A;  4DNI A;  1QZG A;  4LFA L;  2JA6 H;  2R92 G;  3DM3 A;  4A3L G;  4LF6 Q;  1L0W A;  3HOX G;  1X65 A;  3PUW A;  4AYB G;  1K8G A;  4L5T A;  3FHW A;  3ERS X;  3I7F A;  3CME A;  4DPG A;  3GTL H;  1YJ9 A;  3J80 c;  1PA6 A;  3HOY G;  3CP0 A;  4UP8 A;  2VQF L;  1Y14 B;  1MKH A;  4QL5 A;  4B3M L;  5GAE C;  2EIF A;  1X54 A;  4P75 A;  3T1Y Q;  4A3J H;  1N36 L;  4KHP L;  3HKS A;  4BBR G;  4OX9 L;  1S3O A;  1X6O A;  1Y1W G;  3KF6 A;  2ALY B;  2JA7 H;  5GRO A;  4MZ9 A;  5IYC G;  2DUD A;  1NJI C;  1JJG A;  3AFP A;  3GTM H;  1E22 A;  3S24 A;  4DUY Q;  2MO1 A;  2KBN A;  2JA5 G;  1CSP A;  2LXK A;  2YTV A;  3OYY A;  2H5X A;  3K81 C;  1VQH A;  3CCJ A;  4LFA Q;  4X65 Q;  3G48 A;  3RLF A;  4GNX A;  3OTO L;  4YWL A;  3CW2 C;  4LFB Q;  2BA0 A;  3BU2 A;  2HIX A;  3J7A 5;  1LUZ A;  4R4T A;  4O2D A;  2ID0 A;  4YHH L;  3EIV A;  4YCV A;  2UXD L;  4XIG S;  1PV4 A;  1J5E L;  1ASY A;  1HJP A;  2VW9 A;  4HID A;  3HFZ B;  2OQ0 A;  1PVO A;  4NXM L;  2NVT H;  1TWA H;  2VL6 A;  5ELO A;  2NVX H;  4LF5 L;  1Q81 C;  1IBK L;  4XTC S;  1K73 C;  2B3G A;  1CUK A;  4X66 L;  3GO5 A;  3UE1 A;  5BR8 Q;  2F52 A;  1VQI A;  5M3F G;  1XMQ Q;  5E7N A;  1JMC A;  1RIP A;  3U50 C;  5IWA L;  2E5L L;  3I4M H;  4QJF A;  3CCV A;  1XNQ Q;  1W2B A;  1PH6 A;  4QQB X;  1VQF A;  3VDY A;  1NTG A;  4DV7 L;  2R7D A;  4JI0 L;  1U5K A;  2RCN A;  4YY3 L;  1IL2 A;  1GO3 E;  3M3Y H;  1SMX A;  3S1N H;  4LFC L;  1EUJ A;  1HNX Q;  1WFQ A;  2UUB L;  4MTN A;  4GOP C;  5LMN L;  2JK8 A;  1HNZ L;  1GD7 A;  3AYH B;  4DV2 Q;  4AQY Q;  3T1H L;  4LF8 Q;  1Z47 A;  1PH5 A;  3RLN A;  1J5E Q;  5C0X J;  1SRO A;  3HKZ E;  3A5Z B;  3S16 H;  4X62 Q;  5IP7 H;  3GTG H;  1Q86 C;  4LF5 Q;  1I50 H;  2HIV A;  1VQ7 A;  4DR7 L;  1N32 Q;  2IHF A;  2YU9 H;  1XJV A;  2D62 A;  4A3I G;  4WJ3 M;  1HH2 P;  3S15 H;  4YWK A;  5IY0 A;  2Q2U A;  5C4X G;  4PMW A;  1YHA A;  4HJ7 A;  4LF9 L;  4DV7 Q;  4HJ8 A;  1OXT A;  1X3E A;  4P72 A;  1M1K C;  4LNQ A;  4GKK L;  3TQY A;  4JI2 Q;  4A3B G;  1NMG A;  1G51 A;  1JJC B;  2K5N A;  3KLW A;  4JI8 Q;  3SGI A;  3G6E A;  1KC8 C;  3D0F A;  1DGS A;  2B63 G;  4JYA L;  5C0X G;  2K14 A;  5IP9 G;  1N33 Q;  1AH9 A;  4BBS H;  4IFD J;  5AJ3 L;  1CKN A;  2HHH Q;  3W5O A;  1X56 A;  4GKJ L;  1EYG A;  1PHJ A;  1Q8K A;  1HR0 L;  4GN3 B;  4A3D H;  1ASZ A;  3HOW H;  4B3R L;  1WJJ A;  3HOV G;  1TWC H;  3EN2 A;  3IRB A;  2UUA Q;  5C44 G;  3UDF A;  2UU9 L;  1UEB A;  4DV1 Q;  4B3S L;  2UU9 Q;  1FGU A;  4Y52 H;  3F8T A;  1IBL Q;  2D0P A;  4DAM A;  4DR6 L;  3Q8D A;  2EXD A;  3CPW A;  1SN8 A;  4IJL A;  4P71 A;  3KOJ A;  4BY1 H;  1O7I A;  4PZ6 A;  2BH2 A;  3RNU A;  3CPF A;  1A0I A;  4A3F H;  4LF6 L;  2NZO A;  3D31 A;  4QGU A;  4DK6 C;  2B29 A;  1XPR A;  1V1Q A;  4A3M G;  2XTI A;  3RR5 A;  4HIM A;  3HOZ H;  4WJ4 A;  4C3H H;  4A3G G;  5JJL A;  2OWO A;  1YZ6 A;  4NPS A;  1BBW A;  1Q1B A;  4R4Q A;  3ZJY C;  3T1Y L;  1S40 A;  5M5W H;  5J3B A;  3STB C;  1FJG Q;  1KL9 A;  3H3V H;  4A3C G;  2VY3 A;  3NEN A;  1E3P A;  4PZ7 A;  1VQO A;  1VQP A;  4X6A H;  3L2P A;  4B3S Q;  2IX0 A;  4NXN Q;  1PYS B;  4HJ5 A;  1KD1 C;  4DUY L;  1XTD A;  3M4P A;  4JCV E;  5M3M H;  2NVQ H;  1RL2 A;  3F2B A;  4X65 L;  2E2I H;  1Y1V H;  4PZ8 A;  5EAY A;  3TS2 A;  4OO1 G;  4ME3 A;  1KQS A;  5IYB H;  4LFB L;  2Y0S G;  3K8A A;  3AFQ A;  5IYD G;  5FJ8 H;  3J81 c;  4A3E G;  1BKB A;  2N3S A;  4DR5 Q;  2R92 H;  1YNX A;  2L15 A;  3BZC A;  5DLQ E;  3CCU A;  2WP8 J;  4DR2 Q;  3S1M H;  5C4J H;  4OO1 I;  1QUQ A;  4L5Q A;  2RF4 A;  3F1Z A;  1V9P A;  4AIM A;  4EQ5 A;  4BBS G;  3H0G H;  4UY8 C;  3HOY H;  4L5S A;  2JA6 G;  4BA2 I;  2UXB Q;  2WAQ E;  1H95 A;  1AE2 A;  2WFW A;  3MXN B;  4AYB E;  5BR8 L;  4POG A;  3S2D H;  1XMQ L;  4GNX C;  3JC6 6;  1Y1W H;  3E0E A;  1CKO A;  4A76 A;  1XPO A;  1KIX A;  2OTL A;  4DR3 L;  4C3I H;  3U4V A;  1XNQ L;  4JI3 L;  5IYC H;  3DLL A;  2ZM6 Q;  4A3J G;  1WI5 A;  2OQK A;  1Q12 A;  3FKI H;  4DV4 Q;  4JI6 Q;  1NBW A;  4BXX H;  2Q2H A;  3W1B A;  5GAG C;  2JA7 G;  3PF4 A;  2JA5 H;  4C3J H;  1HNX L;  2VUM G;  3K7U C;  2F4V Q;  1YJW A;  1QUQ B;  4LUZ A;  4DAY B;  4DV2 L;  3PCO B;  4AQY L;  4LF8 L;  1Q82 C;  4JV5 Q;  1KHI A;  1SR3 A;  1EWI A;  3TEH B;  2PNH A;  4JI4 Q;  3S1Q H;  1PYB A;  4JI1 Q;  4X62 L;  1VQM A;  1M90 C;  4JI7 Q;  3ICE A;  2RHQ B;  3HOW G;  2PI2 E;  4MNO A;  4YWM A;  2R6G A;  3ULL A;  4JBM A;  1N32 L;  3RN2 A;  2F3I A;  4QY7 A;  4ALP A;  2V1C C;  4R4I A;  2UXC Q;  2CWP A;  1HZC A;  3GTJ H;  4DR3 Q;  1K8A C;  3M4O H;  2JA9 A;  4JI3 Q;  4L5R C;  2HQL A;  3E9I A;  3U58 A;  3ULP A;  4GN5 A;  4JI5 Q;  2ATW A;  1FL0 A;  3J80 i;  1OTC A;  4LW1 A;  3PIO A;  5GAH C;  3CF5 A;  1B7Y B;  1K0R A;  3PUX A;  4JI2 L;  1VQE A;  2K5V A;  4JI8 L;  3GTK H;  1EIF A;  2HT1 A;  2CQO A;  1T9H A;  2IX1 A;  4UP9 A;  1YHQ A;  1YI2 A;  1B70 B;  3NEL A;  1S72 A;  1IBM Q;  1N33 L;  4P73 A;  3AQQ A;  2ZJQ A;  2IHE A;  1KAW A;  1SLJ A;  3L0O A;  2HHH L;  3CCL A;  3I4M G;  2E8G A;  4KI0 A;  4A93 G;  1I5F A;  2JE6 I;  2UUC Q;  2KHI A;  4A3K H;  3FP9 A;  4LF7 Q;  1PH8 A;  2R7Z H;  2XGT A;  4J15 A;  1SE8 A;  2KHJ A;  4NB3 A;  3CCE A;  5C3E G;  1YBY A;  3GTP H;  5FLM G;  2Z6K A;  3I4N H;  2VNU D;  2UUA L;  1L2F A;  4DV1 L;  4X64 Q;  3G4S A;  4JBW A;  1X55 A;  2CFM A;  2Z0S A;  3K0X A;  2YTX A;  4R4O A;  4BA1 I;  5IE8 A;  1IBL L;  1EFW A;  4LF4 Q;  5LMU Q;  1WCM H;  2GN5 A;  2N8N A;  3LGJ A;  2WB1 G;  3UDI A;  1CKM A;  1HZA A;  4A3I H;  4YCW A;  4AH6 A;  5IT9 c;  4DUZ Q;  5GQO A;  4GKJ Q;  3GTO H;  2PI2 A;  2MO0 A;  2ZTE A;  4DV6 Q;  1VQC A;  1QVG A;  1VQA A;  4IPD A;  3F2C A;  1LM0 A;  3PO2 G;  2Q2T A;  1UE1 A;  2Q2I A;  3RZO H;  4BY7 H;  2N49 A;  1FJG L;  1E24 A;  2MNA A;  4DV5 L;  3A74 A;  3PIP A;  3J81 j;  1YIJ A;  1X9N A;  1XNR Q;  3KFU A;  2IY5 B;  5C0X I;  1MIU A;  4NXN L;  3UE0 A;  2BA1 A;  5JEA J;  1VQJ A;  1EQR A;  4IOA A;  4JBK A;  1A8V A;  4YCU A;  3HOU G;  2A1A A;  3HOV H;  4FDB A;  1XMO Q;  5C44 H;  4IJH A;  5JJK A;  2JA8 H;  2YV5 A;  3GTQ H;  3PO3 G;  1J6Q A;  1NE3 A;  1SFO H;  4OXP A;  2JEA I;  1FVI A;  2NN6 G;  1A63 A;  1YEZ A;  1OXU A;  1OXV A;  2N78 A;  1Q46 A;  1E1O A;  4GOP B;  1VQ4 A;  4IFD G;  1KRT A;  2OTJ A;  3RZD H;  3A5U A;  4DR5 L;  4DR2 L;  1N34 Q;  1Z9F A;  3U4Z A;  1TWG H;  2R93 G;  2KEN A;  4BY1 G;  2AHO B;  4DV5 Q;  2K50 A;  3KJO A;  4IFD I;  4A3F G;  3B6Y A;  4RMF A;  1JB7 A;  2UXB L;  1E1T A;  3TRZ A;  1IYJ B;  1VQ8 A;  2MFI A;  1QVC A;  4DR1 Q;  4KHZ A;  1I94 Q;  3HOZ G;  3S17 H;  1UE6 A;  1IZ6 A;  1L1O A;  2VZA A;  2ZM6 L;  1I6H H;  4DV4 L;  2JQO A;  4JI6 L;  3CCM A;  4DV0 Q;  1GM5 A;  2I0Q A;  1GKH A;  1VQN A;  4DR4 Q;  2F4V L;  2K4K A;  2NZH A;  4JV5 L;  2MQH A;  4A3L H;  1W3S A;  2VQE Q;  3HOX H;  5IYD H;  1UWV A;  3K80 C;  5M3M G;  1G29 1;  4JI4 L;  2A8V A;  2ZTC A;  4JI1 L;  2QEX A;  4JI7 L;  5IYB G;  1E7Z A;  2RHS B;  2Y0S E;  3RN5 A;  5H1S E;  1PH7 A;  3AEV A;  4IOC A;  1L1O B;  4BBR H;  3F2D A;  1D7Q A;  3ULJ A;  2UXC L;  1C7Y A;  1BBU A;  3JAM c;  3BJU A;  2WAQ G;  3PV0 A;  1MJE A;  3S2H H;  4K0K Q;  1D8L A;  4JI5 L;  3BZK A;  4JOI A;  5FLX c;  3H0G G;  3CXC A;  4TQU S;  3PGZ A;  4PG3 A;  4GLX A;  1VQB A;  2IT1 A;  2DGY A;  2K75 A;  2R7F A;  4DV3 Q;  1OXS C;  1IBM L;  1V43 A;  1QZH A;  4KLK A;  1VQ5 A;  1NY4 A;  2KCM A;  4APV A;  5M5X H;  1TWF H;  1HNW Q;  1A62 A;  4LF7 L;  5K36 G;  2UUC L;  2KCT A;  3MEF A;  1P16 A;  3NBH B;  2VUM H;  1X3F A;  5HY6 A;  3FKI G;  1NMF A;  1K83 H;  1VS0 A;  2CKZ B;  4Y7N H;  4BXX G;  2I5H A;  1PH4 A;  4X64 L;  1KXL A;  3KF8 B;  3J7Z C;  1JE5 A;  4UP7 A;  4LF4 L;  3PSI A;  1JJ2 A;  2JEB I;  4B3T L;  5LMU L;  1YJN A;  3CCS A;  1KRS A;  2GVA A;  3J81 i;  4JC0 A;  1B8A A;  3PUZ A;  5M3F H;  4DUZ L;  4HIK A;  2ZJR A;  1YVC A;  3GD7 A;  2VQF Q;  4B3M Q;  3PF5 A;  4DV6 L;  3KF6 B;  4O0A A;  4IO9 A;  1N36 Q;  4KHP Q;  3I55 A;  4OWT B;  4OX9 Q;  1VQL A;  1EIY B;  2Z6K C;  4OWX B;  3CCR A;  1VQK A;  3CC2 A;  4A75 A;  1XPU A;  1C9O A;  1YIT A;  4UPA A;  1HZ9 A;  2C35 B;  2I5M X;  2CCZ A;  2K5H A;  4R1J A;  1EQQ A;  1XNR L;  3JAM i;  1PFS A;  4POF A;  2BH8 A;  1I3Q H;  2ASB A;  4A93 H;  3ER0 A;  1U0L A;  3HKZ G;  4GNX B;  3OW2 A;  1PH3 A;  4B3T Q;  3I56 A;  3NEM A;  5C3E H;  5FLM H;  1Q1E A;  3OTO Q;  1XMO L;  3G71 A;  3M7N A;  3CAM A;  1N9W A;  4OON A;  4TVA B;  4A3K G;  1YHB A;  3UDG A;  2R7Z G;  1IXR A;  2PMZ E;  4JBJ A;  3KYH C;  3UDX A;  5IP7 G;  4YHH Q;  3I4N G;  5C4X H;  1C0A A;  2UXD Q;  2LXJ A;  2AKW B;  1X3G A;  5LMN W;  1R9T H;  3E9H A;  3H15 A;  4RG1 A;  4GOP A;  1N34 L;  4NXM Q;  1WCM G;  4A3B H;  1IBK Q;  3S14 H;  1G6P A;  2A19 A;  2WB1 E;  3WWV A;  4X66 Q;  2B63 H;  1Q7Y C;  3PUY A;  4GLA C;  1MJC A;  3KDF A;  5IP9 H;  2E5L Q;  3PO2 H;  2ZTD A;  1P8L A;  3M4Q A;  2OCE A;  5IWA Q;  1VQG A;  3CQZ H;  4DR1 L;  1I94 L;  2ES2 A;  3KJP A;  4JI0 Q;  4HJ9 A;  4YY3 Q;  1OXX K;  1WOC A;  4BY7 G;  3I4O A;  2FXQ A;  4HJA A;  4LFC Q;  3M9B A;  4A3D G;  2UUB Q;  3CD6 A;  1PH9 A;  5JJI A;  4DV0 L;  4LUV A;  5LMN Q;  1HNZ Q;  4DKA C;  3K7A H;  1VQD A;  4EX5 A;  1BVS A;  1HZB A;  4JG2 A;  5M5Y H;  2AWN A;  3T1H Q;  3HOU H;  3EBE A;  4A4I A;  4DR4 L;  1AE3 A;  4GS3 A;  1JT8 A;  3L7Z C;  2EQS A;  1VQ6 A;  3PO3 H;  2PQA A;  2VQE L;  4LUO A;  2JJQ A;  1WYD A;  3KDF B;  4DR7 Q;  4A3M H;  2NN6 I;  1HR0 W;  2YTY A;  2JA8 G;  4QIW E;  3CC4 A;  5ELN A;  3CMA A;  4A3G H;  2VS1 A;  2QA4 A;  1QVF A;  1L1O C;  3S1R H;  5JEA G;  3STB D;  2R93 H;  2D0O A;  4P74 A;  1PH2 A;  2LSS A;  4IPC A;  3I2Z A;  1SRU A;  4LF9 Q;  5HGQ A;  3TS0 A;  2CWA A;  1VQ9 A;  3A0J A;  3GDE A;  3CCQ A;  2ZJP A;  4DK3 C;  4A3C H;  4GKK Q;  4LWC A;  4K0K L;  3PUV A;  4IPG A;  1CKN B;  3M85 A;  2AWO A;  4JYA Q;  4HIO A;  3CC7 A;  1GVP A;  5GAD C;  2PQA B;  4GN4 B;  5AJ3 Q;  1UE7 A;  2I5L X;  1K9M C;  4DV3 L;  4OWW B;  1HR0 Q;  3TRE A;  2NVY H;  1PH1 A; 
#chains in the Genus database with same CATH topology
 3SXH A;  2YYZ A;  4RA8 A;  4UAI A;  4X3S A;  3EA6 A;  3P1H A;  4ZYS A;  3M3Y B;  4A3E H;  2E2J H;  3NBH A;  4DR6 Q;  1S5E D;  5I4D A;  4LFA L;  1LTL A;  1QZG A;  3RLO A;  2WB1 B;  4A3L G;  2RQX A;  2HCC A;  3Q22 A;  4LF6 Q;  4WJ4 A;  2E74 C;  3KLS A;  1YJ9 A;  3J80 c;  1PA6 A;  4G4K A;  4IZ8 A;  4ULL A;  4R8I A;  4QL5 A;  5GAE C;  2EIF A;  1X54 A;  3T1Y Q;  3NWT A;  3PO2 B;  2LMC B;  5C3X A;  3URY A;  2DJG C;  5GRO A;  4MZ9 A;  1NJI C;  4LMQ D;  1PTO B;  1JJG A;  1QNK A;  4NDX A;  4ZK9 B;  4RCN A;  1Y8N B;  2WKD A;  2D5D A;  3OYY A;  5M5Y B;  3G48 A;  2NZ1 D;  3EFX D;  2L12 A;  4QIW B;  4LFB Q;  4EQP A;  5KIX A;  2F0O A;  1BBX C;  3I3C A;  1BOS A;  4YCV A;  1XWE A;  1BF4 A;  2EYL A;  4HID A;  3HFZ B;  4LF5 L;  2VL6 A;  1K73 C;  5CYU A;  2F52 A;  3SE0 A;  1RCV D;  5E7N A;  3U50 C;  3K57 A;  1H9J A;  3I73 A;  5CV8 A;  3ONA B;  1V1P A;  1SNQ A;  4QQB X;  1SSO A;  1NTG A;  1F2M A;  1IL2 A;  3C2P A;  3S1N H;  1VF5 C;  2NB0 A;  3T1H L;  4LF8 Q;  1SRO A;  3HKZ E;  1ONL A;  3GTG H;  1Q86 C;  3C1F A;  1G2S A;  4DNT B;  2X6G A;  1PFB A;  3WDN A;  4RKB A;  2YU9 H;  2NYZ D;  2BDO A;  3S15 H;  4IUT A;  4YWK A;  3J81 L;  1SDF A;  1YHA A;  4LF9 L;  3PIO 3;  5BN5 A;  2EOT A;  3BVM A;  4HJ8 A;  4P72 A;  1F2Z A;  1M1K C;  2F0G A;  1V1O A;  1SJH D;  4JI8 Q;  3SGI A;  3NTH A;  3G6E A;  3CKI B;  3I8Z A;  2JA7 B;  4FO2 A;  2HHH Q;  3W5O A;  2HDM A;  1WJJ A;  1SND A;  3BYT B;  3EN2 A;  4LAA A;  4Y52 H;  2D0P A;  2EVB A;  4DR6 L;  4HCE A;  3Q8D A;  4K5W A;  4XT3 B;  3CPW A;  4BY1 H;  3RNU A;  1PTO D;  3D4R A;  3J7Y W;  1DOK A;  2LS0 1;  4LF6 L;  4QGU A;  4RFB A;  5FO9 B;  2XTI A;  4HSP A;  1BXT A;  3HOZ H;  1GUW A;  5G3L D;  4A3G G;  1EFI D;  1YZ6 A;  3D8G A;  3KLR A;  1BBW A;  1Q1B A;  4R4Q A;  3ZJY C;  4F88 A;  1VMP A;  5M5W H;  3T1Y L;  3STB C;  3PIP 3;  4R8N A;  5IOC A;  4DXG A;  2DNE A;  2K03 A;  4PZ7 A;  4Q0F A;  4X6A H;  3L2P A;  4B3S Q;  4LJZ C;  2EE1 A;  1PYS B;  1KD1 C;  2G9H D;  4KD3 A;  1BCP B;  1WTX A;  1WD1 A;  2NVQ H;  2ZXR A;  1ET6 A;  3F2B A;  4IUN A;  5IYB H;  4LFB L;  1SNP A;  3AFQ A;  5IYD G;  3J81 c;  2B2T C;  2R7Z B;  3I4N B;  1I50 B;  4KJO A;  4A3E G;  2N3S A;  4DR5 Q;  3CCU A;  3S1M H;  4L5Q A;  2KOL A;  3NQI A;  4ODG A;  3H0G H;  4UY8 C;  4L63 B;  3H94 A;  4L5S A;  2UXB Q;  2WFW A;  4POG A;  2EYJ A;  4U67 3;  2XNA C;  1I4P A;  5JOB A;  3JC6 6;  1XPO A;  4JI3 L;  2ZM6 Q;  1JWS D;  1NBW A;  1W6K A;  4CJ2 C;  4BXX H;  3VYU A;  1EY6 A;  2JA5 H;  3HOW B;  3K7U C;  4LUZ A;  4DAY B;  4LF8 L;  1EWI A;  2WV6 D;  4JI4 Q;  1DXM A;  1VQM A;  1GHJ A;  2EYM A;  2PI2 E;  2JA8 B;  2R6G A;  3RN2 A;  2Q8R E;  1VF7 A;  4QY7 A;  3OPO A;  2V1C C;  4R4I A;  2JA9 A;  1FD7 D;  2A69 C;  3E9I A;  1LT4 D;  3ULP A;  4CDE C;  2Z1C A;  1KAA A;  4DGZ A;  4OWW B;  3PUX A;  2B2V A;  1II3 A;  2K5V A;  4JI8 L;  2K5Q A;  2HT1 A;  2IX1 A;  4QUF A;  5NUC A;  1Z7T A;  2HHH L;  3CCL A;  3SEB A;  2E8G A;  4A93 G;  2JE6 I;  1NR2 A;  3IL8 A;  2XGT A;  4J15 A;  4KN7 C;  3CCE A;  5ELF A;  1Y1V B;  1EWH A;  1L2F A;  4RHR A;  2BCO A;  2CFM A;  1A2U A;  3IFT A;  5IE8 A;  2QF7 A;  2B8F A;  3IFD A;  3WOE A;  3OWE B;  2EY6 A;  3T13 A;  4FF4 A;  1HZA A;  4A3I H;  3GTO H;  1BCP D;  3HOY B;  4NP5 A;  3F2C A;  5T1I A;  2A74 C;  2HUG A;  1UE1 A;  4BBR B;  2PZW A;  4BY7 H;  2N49 A;  4TKO B;  2ZXP A;  3TSS A;  2RSN A;  1DJR D;  4C1N I;  3KFU A;  1J9O A;  3FKI B;  1EYA A;  1WVL A;  3MTS A;  4IOA A;  4ILW A;  3HOU G;  2A1A A;  4F8M A;  2CHB D;  1ZEQ X;  5JJK A;  2NWG A;  2YV5 A;  3PO3 G;  1MHW C;  4J6H A;  1STH A;  2ENB A;  5IGC A;  2H1E A;  1YEZ A;  1O7Z A;  4DK0 A;  2QKI C;  3A5U A;  4DR5 L;  1N34 Q;  3VR3 A;  2R93 G;  2F1M A;  5C4Z A;  2KEN A;  4BY1 G;  2AHO B;  3MEH A;  1JOO A;  3N52 A;  5IOD A;  2UXB L;  4R9W A;  4WJW A;  3TBI B;  5M3F B;  2MFI A;  1QVC A;  3HOZ G;  1CHQ D;  3ITP A;  2ZM6 L;  1WTO A;  3I91 A;  4DV0 Q;  4RCO A;  3CRK C;  1GM5 A;  5E4W C;  4NKL A;  2K4K A;  2VQE Q;  3CU7 A;  1MD2 D;  1CQV A;  4FYD A;  4XYQ A;  4JI4 L;  2A8V A;  3Q6S A;  1YNN C;  5IYB G;  1E7Z A;  2RHS B;  2Y0S E;  1PH7 A;  5DM7 3;  1L1O B;  4RH6 A;  3Q24 A;  1D7Q A;  1ZYR D;  2K01 A;  3JAM c;  2WAQ G;  3S2H H;  1VDZ A;  5CV6 A;  2EJF C;  2Z4I A;  5D65 A;  4A3B B;  3H0G G;  4O1N A;  2PZT A;  3HS0 C;  5CBE E;  2DGY A;  2NTT A;  4DV3 Q;  1KTK A;  3VYR A;  3BVZ A;  5KYL A;  5M5X H;  1HNW Q;  4ZAI A;  3MEF A;  2VUM H;  1B4O A;  3FDT A;  5FLX E;  3HOV B;  2KQ3 A;  1VS0 A;  5ELC A;  5C44 B;  2CKZ B;  4Y7N H;  4BXX G;  3KF8 B;  4UP7 A;  2PNR C;  2V4D A;  3PSI A;  2JEB I;  3CCS A;  2Z4H A;  3NQT A;  1GHK A;  3PUZ A;  1JOR A;  4KHV A;  4HIK A;  4A3M B;  1CQF A;  4O0A A;  4FF2 A;  3HEJ A;  4IUR A;  1VQL A;  1B2T A;  4OWX B;  3CC2 A;  2HQE A;  1ML0 D;  2DNC A;  1YIT A;  2C35 B;  3KLS X;  2FIN B;  4EVO A;  4MTK A;  1I3Q H;  3QOJ A;  4X3K A;  3HKZ G;  1AP0 A;  4JK1 C;  4N8F A;  2IW3 A;  1Q1E A;  2L4N A;  2NVY B;  5EGT A;  3L3O C;  3UDG A;  5IP7 G;  3DXJ C;  5DEH A;  3K5L A;  1HUM A;  1R9T H;  1N34 L;  4NXM Q;  1A15 A;  2Z9H A;  3S14 H;  4BBS B;  2A19 A;  2F0V A;  4X66 Q;  2JA6 B;  4C56 C;  1LAB A;  4GLA C;  1MJC A;  2WII B;  4K6L A;  1TS3 A;  5IP9 H;  2E5L Q;  2ZTD A;  1P8L A;  4M1U B;  2OCE A;  3PO2 H;  4FNF A;  3D3R A;  2ES2 A;  2WKC A;  3TZD A;  3SDZ A;  1U4M A;  1WOC A;  2KEE A;  4BY7 G;  4N9T A;  4LFC Q;  2FXQ A;  4EQN A;  5JJZ A;  5CMD A;  1PH9 A;  3PMF A;  5JJI A;  4DV0 L;  3QWN A;  4DKA C;  3K7A H;  5M5Y H;  1BVS A;  1STE A;  3KK7 A;  3L7Z C;  3R93 A;  4I65 A;  2KED A;  2PQA A;  4KMU C;  5EPL A;  2VQE L;  1LLR D;  5EKL A;  1WYD A;  3KDF B;  3E5S A;  1STG A;  2YTY A;  1H9M A;  3CC4 A;  5ELN A;  2QA4 A;  4ID6 A;  3S1R H;  3STB D;  1FR3 A;  2LSS A;  2KEC A;  5HGQ A;  3QJY A;  3AU7 A;  5KGU A;  1TQO A;  1MSG A;  3RD4 A;  2KUM A;  4JYA Q;  4GZY C;  2K28 A;  4DNR B;  1K9M C;  3GV3 A;  4DV3 L;  5AFW A;  5FKA C;  2K52 A;  4B3R Q;  1HNW L;  4JPB W;  5IGD A;  2EZV A;  4EGV A;  1UE5 A;  1ZKO A;  4G7Z C;  1R4Q B;  5FJ8 G;  1CSQ A;  1VCI A;  3BDC A;  2R92 G;  1JCK B;  3KF8 A;  3DM3 A;  1L0W A;  5CBA E;  1X65 A;  3NXW A;  1EZ8 A;  3PUW A;  4L5T A;  1K8G A;  4ZKC B;  3I70 A;  4MIU A;  5E3F A;  2RSO A;  4A3J H;  1WTV A;  2B2T A;  2F0J A;  1S3O A;  1X6O A;  1Y1W G;  1B1Z A;  2JA7 H;  4K6D A;  1E22 A;  3S24 A;  4DUY Q;  4CDF C;  1CSP A;  4C3J G;  3NPP A;  3K81 C;  1JC7 A;  4X3T A;  4LFA Q;  3RLF A;  2L9H A;  3CW2 C;  2BA0 A;  5CV7 A;  5TSS A;  1CA6 A;  2HIX A;  3J7A 5;  1LUZ A;  1TWC B;  4O2D A;  1CM9 A;  3EIV A;  2KCN A;  2A69 D;  1G2T A;  2F0L A;  1ASY A;  4ZUI A;  3U9O A;  2GA4 B;  4NXM L;  2NVT H;  1TWA H;  2K1B A;  2EJM A;  1SXT A;  3LX0 A;  2Q8I B;  4X66 L;  3UE1 A;  4PMB A;  3K5O A;  2E5L L;  3TP5 A;  1VQF A;  1PMR A;  1GO3 E;  3P7J A;  2RBM A;  1QE6 A;  4LFC L;  4V19 0;  1EUJ A;  1C4Q A;  4GOP C;  2E2H B;  2JK8 A;  3NTI A;  1GD7 A;  4DV2 Q;  2F0K A;  3A7A B;  3T56 B;  2F0S A;  3A5Z B;  1LO5 D;  3S16 H;  4X62 Q;  1TWH B;  4LF5 Q;  1I50 H;  1VQ7 A;  1K0S A;  1N32 Q;  4B9X A;  2MP1 A;  1V1P B;  1XJV A;  3Q0A A;  2OF1 A;  4WJ3 M;  1HH2 P;  1WTH A;  3RMH A;  4DXF A;  3VR5 A;  5IY0 A;  4PMW A;  5HGT A;  1OXT A;  1NSN S;  1X3E A;  3W2D A;  4LNQ A;  3TQY A;  4JI2 Q;  1NMG A;  1NAP A;  3TP8 A;  1KC8 C;  1DGS A;  1PLF A;  4JYA L;  5EJW A;  1F9R A;  4HMJ A;  5IP9 G;  2DY8 A;  4EQO A;  3GTM B;  1X56 A;  2F3V A;  3LWE A;  1EYG A;  1Q8K A;  1TT2 A;  1S5D D;  4C3I B;  1ASZ A;  3HOW H;  4B3R L;  3R2I A;  3IRB A;  3UDF A;  2K33 A;  1UEB A;  4DV1 Q;  2UU9 Q;  2SDF A;  2XIW A;  2EXD A;  4LK1 C;  3KOJ A;  1O7I A;  4PZ6 A;  2J7Z A;  3CPF A;  4A3F H;  3I72 A;  5EPJ A;  3S1Q B;  1V1Q A;  4KY6 A;  1GOZ A;  3RR5 A;  4HIM A;  2NVX B;  4DFA A;  2OWO A;  4NPS A;  2K7V A;  1SYC A;  5DAU A;  1S40 A;  2L0C A;  2IJ0 A;  4QCL A;  3M4O B;  1FJG Q;  1AZP A;  4KY5 A;  4RGM A;  1FNU A;  3I4L A;  3NEN A;  2EYP A;  4CDC C;  5IGB A;  4CKB A;  4HJ5 A;  3M7G A;  4DUY L;  5FOB B;  2MHV A;  3GTK B;  1XTD A;  3VR6 A;  3MXG A;  5M3M H;  1QG7 A;  2F0Q A;  1RL2 A;  1YNN D;  1Y1V H;  4PZ8 A;  2F0H A;  3TS2 A;  1UNS A;  5JVH 3;  1ESR A;  2Y0S G;  3K8A A;  1PRT B;  2EY2 A;  1EY7 A;  5JAV A;  1B9M A;  3A8I E;  1XXG A;  5DLQ E;  5C4J H;  4OO1 I;  3T51 B;  1QUQ A;  1FNV A;  2RF4 A;  1SMY C;  2SNM A;  3F1Z A;  3SK6 A;  1V9P A;  1WCM B;  2D2C C;  1GUS A;  4EQ5 A;  3HOY H;  2JP1 A;  4BA2 I;  2WAQ E;  3MXN B;  4AYB E;  3D6C A;  1STB A;  1DCZ A;  4GNX C;  1CKO A;  1TVX A;  4A76 A;  1KIX A;  4DR3 L;  2F0W A;  1UEA B;  3U4V A;  4Q5V A;  3OMC A;  5I6W A;  5IYC H;  3DLL A;  4A3J G;  1WI5 A;  2OQK A;  1Q12 A;  3FKI H;  3RZO B;  2L55 A;  2Q2H A;  3PF4 A;  4A3D B;  3E0J A;  2JA7 G;  1YJW A;  4DV2 L;  1WTP A;  1B3Q A;  4JV5 Q;  1Q82 C;  1KHI A;  3TEH B;  1I6V C;  4X62 L;  1LTI D;  1TII D;  1G91 A;  4CJ0 B;  4JBM A;  1BO0 A;  4YWM A;  5EPK A;  1N32 L;  2M2L A;  1O80 A;  1JQY D;  1K8A C;  4C3H B;  3RZD B;  4JI3 Q;  1ESF A;  3PQI A;  2F0U A;  4JI5 Q;  1FL0 A;  1Z6H A;  1B7Y B;  4JI2 L;  4F87 A;  1IYU A;  1HFN A;  3U9S A;  1WD0 A;  1EIF A;  2CQO A;  1EY0 A;  1YHQ A;  1YI2 A;  3A8K E;  4PNY A;  4OHJ A;  1IBM Q;  3AQQ A;  2E76 C;  1KAW A;  2FMC A;  5D3D A;  3DEO A;  1JR0 D;  1I5F A;  4LF7 Q;  4A3K H;  2KHJ A;  5C3E G;  1YBY A;  1I6H B;  4DV1 L;  4PMC A;  2OXP A;  4X64 Q;  3G4S A;  1STA A;  1X55 A;  2UU9 L;  4BA1 I;  1KNE A;  3L9A X;  3LGJ A;  1HUN A;  1CKM A;  1LTR D;  5DNF A;  5KRU A;  4DUZ Q;  1JWM D;  2XWJ B;  5GQO A;  2PI2 A;  1O7Y A;  3DUZ A;  5COR A;  2MO0 A;  4DV6 Q;  3BZD B;  2XRS D;  1H9R A;  4IPD A;  3S2D B;  2BE5 C;  1PRT D;  3D6W A;  2A6H C;  1FJG L;  4DV5 L;  2MNA A;  2E2D C;  5IT9 E;  1YIJ A;  2IY5 B;  2F0T A;  3UE0 A;  2BA1 A;  5JEA J;  1B44 D;  1VQJ A;  1EQR A;  4DK1 A;  1A8V A;  2EYO A;  3HOV H;  4FDB A;  2HD3 A;  5C44 H;  4IJH A;  5C5M A;  2B8G A;  1NE3 A;  1SFO H;  1TWF B;  1FVI A;  1A63 A;  1OXV A;  2N78 A;  1Q46 A;  4GOP B;  1VQ4 A;  4IFD G;  1KRT A;  5EKI A;  2VB3 X;  4DU9 A;  1PZI D;  4FF3 A;  1J8I A;  3OIP A;  1YNJ D;  2K50 A;  1SE3 A;  4A3F G;  2C9O A;  3B6Y A;  4RMF A;  2XRQ D;  1LTB D;  1IYJ B;  1V8Q A;  4KHZ A;  3NP8 A;  3MXN A;  4N9P A;  3T53 B;  4DR1 Q;  3HGB A;  3S17 H;  1IZ6 A;  3KBX A;  5A35 A;  1BNZ A;  1EEI D;  2VZA A;  1GUT A;  4ABN A;  2ZT9 C;  5KND A;  2I0Q A;  3GTP B;  4ZKB B;  4JV5 L;  4RHS A;  3CHB D;  1A3U A;  3HOX H;  5M3M G;  1G29 1;  2CW0 D;  1I4Q A;  4KY7 A;  1S5B D;  5L37 A;  4K5X A;  3O13 A;  5H1S E;  4IOC A;  3F2D A;  4OEL B;  1KNA A;  2HDL A;  3BJU A;  1SNM A;  4K0K Q;  1D8L A;  4JI5 L;  2M00 A;  3BZK A;  1JE4 A;  3CXC A;  2ICE C;  4TQU S;  4GLX A;  2AUK A;  2IT1 A;  3F2U A;  1IBM L;  5COY A;  1QZH A;  4KLK A;  1VQ5 A;  4APV A;  2FJ2 A;  4LF7 L;  1X3F A;  3FKI G;  1NMF A;  2PQE A;  4X64 L;  1KDB A;  4CBV A;  2A6E D;  2GVA A;  3V05 A;  4DUZ L;  2ZJR A;  1YVC A;  3GD7 A;  1X32 A;  2VQF Q;  1CK1 A;  4A3G B;  4DV6 L;  3KF6 B;  1N36 Q;  4OWT B;  1MI2 A;  1QIL A;  1VQK A;  2Z6K C;  4KV6 A;  2OEO A;  1LV9 A;  3TZU A;  4UPA A;  2CCZ A;  3OWF A;  1EQQ A;  3JAM i;  4QF4 A;  4POF A;  2BH8 A;  2VB2 X;  3ER0 A;  4GNX B;  5KNC A;  3I56 A;  2EDG A;  5FLM H;  3OTO Q;  1D1K A;  4OON A;  4TVA B;  2RDG A;  1ZXT A;  4HCS A;  5DM6 3;  5T1G A;  4A3K G;  3QOL A;  2VXW A;  3KYH C;  3UDX A;  4YHH Q;  5C4X H;  4A3E B;  2LXJ A;  2E2J B;  4GOP A;  1G6Z A;  1IBK Q;  2WB1 E;  3OSO A;  3H09 A;  4XXE A;  5IWA Q;  1VQG A;  3CQZ H;  4DR1 L;  3NBI A;  4JI0 Q;  4HJ9 A;  4YY3 Q;  2F3W A;  3I4O A;  4HJA A;  3M9B A;  2UUB Q;  3CD6 A;  2AQ3 B;  4LUV A;  1HNZ Q;  2MUY A;  1HZB A;  4EX5 A;  4G7H C;  4K2L A;  4O42 A;  3TN2 A;  4A4I A;  1JT8 A;  2EQS A;  4LUO A;  2JJQ A;  4WFN 3;  2NN6 I;  4QIW E;  3CMA A;  1QVF A;  1D5M C;  4IUV A;  4P74 A;  4IPC A;  1SRU A;  3MAQ A;  1TR5 A;  2CWA A;  4K0K L;  1SYG A;  4IPG A;  4ZRZ A;  1CZW A;  1QNU A;  1FNW A;  1GVP A;  2PQA B;  4GN4 B;  5AJ3 Q;  2QW7 A;  1KDC A;  2KHS A;  1D2B A;  4GKJ Q;  3QB3 A;  1Y69 U;  1T5X D;  2GVB A;  4A93 B;  2EYH A;  1N8R C;  2E2H H;  1AFP A;  2AMC B;  2PMZ B;  3H91 A;  3H3V I;  1HTP A;  3S1N B;  1FYC A;  1SMY D;  1TWH H;  3BG3 A;  1EL0 A;  4GLV B;  2Z6B A;  3HOX G;  4AYB G;  3ERS X;  4DPG A;  3I90 A;  3CP0 A;  2F0E A;  4UP8 A;  3V96 A;  2VQF L;  2KVM A;  4E6I A;  2B63 B;  2YU9 B;  1N36 L;  3S15 B;  3HKS A;  3DEP A;  3KF6 A;  2IPK D;  2DUD A;  3J80 E;  1F2L A;  3GTM H;  1F77 A;  2JA5 G;  1Q8I A;  2LXK A;  2YTV A;  1IKM A;  3CCJ A;  3HOU B;  1K8O A;  4X65 Q;  2N88 A;  2KA7 A;  4GNX A;  5D14 A;  3OTO L;  2G9D A;  3PO3 B;  4XQQ A;  1EIG A;  1D1I A;  2Z8L A;  4R4T A;  4YHH L;  3MXU A;  1XYI A;  4XIG S;  1PV4 A;  3MXP A;  1J5E L;  2A73 B;  1TS2 A;  1MSH A;  2VW9 A;  2OQ0 A;  1PVO A;  2R93 B;  5ELO A;  2NVX H;  4BY1 B;  1Q81 C;  1IBK L;  4XTC S;  1CUK A;  3GO5 A;  5BR8 Q;  1H9S A;  3HZX A;  1XMQ Q;  1JMC A;  5IWA L;  3I4M H;  4UDU C;  4QJF A;  3CCV A;  1DZ1 A;  1XNQ Q;  1NCV A;  3HOZ B;  1STN A;  3VDY A;  1EYC A;  4DV7 L;  4JI0 L;  1U5K A;  4YY3 L;  3M3Y H;  5M5W B;  3OW7 A;  1A2T A;  2EXZ A;  1HNX Q;  1SEB D;  2SOB A;  4MTN A;  2UUB L;  4ZQ3 A;  1HNZ L;  4C2M B;  4AQY Q;  1DON A;  5C0X J;  5LHY 1;  1IYV A;  1FGB D;  4PV1 C;  3TP6 A;  2NVQ B;  2HIV A;  2JSO A;  3HG9 A;  2D62 A;  4A3I G;  2BE5 D;  1IHZ A;  3GTL B;  2Q2U A;  5C4X G;  3H6M A;  2A6H D;  4HJ7 A;  2WAQ B;  1D5X C;  5C4H A;  3S1M B;  1PTO H;  4OIJ A;  4OEM B;  2K5N A;  1F9S A;  1JJC B;  3H0G B;  3QO2 A;  3M4Y A;  2K32 A;  5JPN C;  4HR7 B;  2K14 A;  1RF2 D;  5AJ3 L;  5G3L F;  2F03 A;  4GKJ L;  1PHJ A;  4FXG C;  3GQB A;  3NWS A;  4GN3 B;  4XT1 B;  4A3D H;  3A8J E;  1TU2 B;  2NN6 H;  2UUA Q;  1KLG D;  1IBL Q;  1HFG A;  1SN8 A;  4IJL A;  1E2V A;  3MVV A;  1LTS D;  1A0I A;  3D31 A;  5ELE A;  5JEA H;  2B29 A;  2LKV A;  1XPR A;  2LFN A;  1B50 A;  1VMC A;  3DWP A;  4C3H H;  5CGK A;  1B3A A;  1Y8P B;  5J3B A;  1TKW B;  3K0Y A;  1R4P B;  1KL9 A;  3H3V H;  1VQO A;  1E3P A;  2IX0 A;  4NXN Q;  3NTK A;  3HKZ B;  3AB9 A;  1KLU D;  3M4P A;  4JCV E;  1ENC A;  1JOK A;  4X65 L;  5EAY A;  2NTS A;  1PYW D;  1KQS A;  3K5M A;  4S3S A;  4ME5 A;  1S5C D;  3QIA A;  1HCZ A;  1YNX A;  3BZC A;  4IQZ A;  3GV6 A;  2A5H A;  4AIM A;  3J81 E;  2B2Y C;  2MGS A;  3S2D H;  1SNO A;  5BR8 L;  1K3B C;  1EEF D;  2AUJ D;  1C8C A;  1XMQ L;  2B39 A;  2X6L A;  2OTL A;  1XNQ L;  3R8B A;  2RA4 A;  4WOR A;  2K6A A;  4JI6 Q;  4BY7 B;  4IUU A;  1HNX L;  1SYE A;  2F4I A;  2VUM G;  1QUQ B;  4AQY L;  1QCB D;  1SR3 A;  1EU3 A;  1ET9 A;  2PNH A;  2RDH A;  1M90 C;  1E2Z A;  2MPM A;  1RTO A;  2RHQ B;  2ICI A;  3ULL A;  1AW7 A;  3SR1 A;  2F3I A;  2UXC Q;  2QDB A;  1HZC A;  3EJI A;  2R3Z A;  5E4X A;  4DR3 Q;  3J7A V;  4L5R C;  1A3T A;  1K8M A;  2ATW A;  2EY5 A;  3J80 i;  4IUQ A;  3PIO A;  3CF5 A;  2O5I C;  1K0R A;  1UAP A;  3SHL A;  1EY4 A;  1OO9 B;  3OMG A;  2ZJQ A;  2IHE A;  1PDQ A;  3L0O A;  3I4M G;  2QIL A;  2CH4 A;  2KHI A;  2F0P A;  2SNS A;  3FP9 A;  2UUC Q;  2X69 A;  1PH8 A;  2R7Z H;  3GTP H;  3I4N H;  2Z6K A;  2UUA L;  2E2I B;  3E6Z X;  2TSS A;  2PPB C;  1HRJ A;  3K0X A;  1IBL L;  4LF4 Q;  5LMU Q;  2N8N A;  2O4X A;  2WB1 G;  2I46 A;  1T5E A;  1CI3 M;  2R92 B;  3D4D A;  2KJX A;  3LNN A;  4YCW A;  2B2W C;  3P75 A;  1LT3 D;  1DOM A;  5BN4 A;  2ZTE A;  4HN7 A;  1SAP A;  1VQC A;  1QVG A;  1PFM A;  4FXD A;  3V2T A;  1VQA A;  3PO2 G;  3LWU A;  2Q2T A;  3R2T A;  1Y1W B;  3MC0 B;  1EY9 A;  3A74 A;  3PIP A;  3J81 j;  1X9N A;  3S2H B;  2XVS A;  1WTR A;  5C0X I;  1MIU A;  3UI2 A;  5BN3 A;  4NXN L;  1BCP C;  5FLX L;  4L6T B;  4JBK A;  4C3J B;  2PZU A;  2XN9 C;  2JA8 H;  1J6Q A;  5C3W A;  2JEA I;  2NN6 G;  3C3L A;  5IGF A;  1OXU A;  1E1O A;  3A7L A;  2OTJ A;  2O2L D;  4Y7N B;  2E75 C;  2FFK B;  2NBF A;  3NSW A;  3U4Z A;  5I9O A;  3GTJ B;  4DV5 Q;  3KJO A;  1JIC A;  3P20 A;  3ERO A;  4V0B A;  1JB7 A;  1E1T A;  3MWY W;  2R61 A;  5EKK A;  1I94 Q;  4M8A A;  1TS5 A;  2FHT A;  5I9P A;  2J0T D;  3SK4 A;  1S4Z A;  3FPP A;  4J1M A;  4JI6 L;  4K5V A;  4FXK C;  1GUN A;  1DYQ A;  3VYS A;  4DR4 Q;  1W3S A;  1I3Q B;  4H44 C;  2C5C A;  5IYD H;  3K80 C;  1MBY A;  1AN8 A;  3HRZ C;  4G7O C;  1DD2 A;  2CVR A;  4DAV A;  3RN5 A;  4DAP A;  3BDO A;  4BBR H;  3FEW X;  3ULJ A;  1C7Y A;  1BBU A;  2UXC L;  1HPC A;  1MJE A;  1R9T B;  2QCP X;  1SNC A;  5FLX c;  3S14 B;  1I4H A;  4IUP A;  4PG3 A;  3K58 A;  1VQB A;  4I7Z C;  1EYD A;  3FRP B;  3JAM E;  1DOL A;  1I4R A;  1ZYR C;  2UUC L;  3KBG A;  3GTQ B;  2I5H A;  1TY2 A;  3J7Z C;  1JE5 A;  2P5Z X;  3K7A B;  4KJN A;  2RDF A;  4LF4 L;  4B3T L;  5LMU L;  2XSC A;  1E2W A;  3J81 i;  5M3F H;  1TWG B;  1U4P A;  3NHH A;  1EZ6 A;  2F0I A;  4B3M Q;  3PF5 A;  5EBD A;  4OIK A;  4IO9 A;  4KHP Q;  3S1R B;  4OX9 Q;  3NE5 B;  3D4W A;  1EIY B;  4A75 A;  4C1N K;  1Q3L A;  4OGQ C;  1C9O A;  1HZ9 A;  3DWA A;  5A2Q E;  4FP5 D;  3MFG A;  2K5H A;  1PFS A;  3N6R A;  1I4X A;  2ASB A;  1L0Y B;  4A93 H;  1U0L A;  1PH3 A;  3KUP A;  1NNX A;  2F0D A;  1QOH A;  5LL6 X;  3M7N A;  1IW7 C;  3G6J B;  1LT6 D;  4K8J A;  4HMI A;  2Y0S B;  1YHB A;  2R7Z G;  1IXR A;  4JBJ A;  3I4N G;  4DF7 A;  1QJO A;  3A55 A;  1C0A A;  2UXD Q;  1ILQ A;  2XWB B;  3CRL C;  4JW0 A;  2AKW B;  1X3G A;  3H15 A;  4RG1 A;  4A3B H;  1DM0 B;  1X3Q A;  1G6P A;  3WWV A;  4K14 A;  4HED A;  1AEX A;  4KTA A;  4K2K A;  3PUY A;  3X3M A;  4HSV A;  4DN4 M;  5C0X H;  2B63 H;  3K5N A;  4N8X 1;  3BDL A;  1WTQ A;  1Q90 A;  2J4X A;  1I94 L;  4DA2 A;  5KNB A;  4A3J B;  1ENF A;  4KKU A;  1XTC D;  2AQ2 B;  5ELD A;  5LMN Q;  3HOW G;  4JG2 A;  3HOU H;  2AWN A;  4YIJ A;  4DR4 L;  1K83 B;  1VQ6 A;  1WTW A;  1TY0 A;  3PO3 H;  2DN8 A;  1KDA A;  4QB4 A;  1UUP A;  5CC4 A;  1RDP D;  4DR7 Q;  4A3M H;  1ICF B;  4BS9 A;  2JA8 G;  4WRD A;  1L1O C;  1CHP D;  2R93 H;  2L5T A;  2O5J C;  3I2Z A;  3S9W A;  3TS0 A;  3GDE A;  5CR3 A;  2ZJP A;  2I07 B;  4L8J A;  4DK3 C;  4GKK Q;  4A3C H;  1G8Z D;  3PUV A;  2NVT B;  1CKN B;  1TWA B;  5KEE A;  2AWO A;  4HIO A;  1UE7 A;  4B08 A;  1HR0 Q;  2F0N A;  2NVY H;  2CWP A;  1PH1 A;  4OO1 H;  2K5D A;  4C2M H;  1SE2 A;  4R4C A;  3VR2 A;  2QGQ A;  5C3E B;  1TXY A;  1Y1V G;  4H02 A;  1TS4 A;  4IPH A;  3W1G A;  1EOV A;  4TSS A;  1GUO A;  4JOI C;  1CA5 A;  1K3R A;  4KKS A;  1LYL A;  4DNI A;  5I2X A;  5ISR A;  4BBS H;  2JA6 H;  1BUV T;  3GP7 A;  4QUC A;  3J7A F;  3CME A;  3FHW A;  3I7F A;  2PW5 A;  4MHE A;  3S16 B;  2KCC A;  3FPU B;  3GTL H;  4KKT A;  3ND8 A;  3HOY G;  1Y14 B;  1MKH A;  4B3M L;  4P75 A;  5IGG A;  4KHP L;  3BYY B;  4BBR G;  4OX9 L;  2ALY B;  4JVZ A;  5IYC G;  3SVM A;  4I7A A;  2A68 C;  3AFP A;  2G5D A;  2RCF A;  2MO1 A;  2KBN A;  2B2Y A;  2H5X A;  1VQH A;  3DMU A;  4YWL A;  3BU2 A;  4KN4 C;  2ID0 A;  3IAY A;  3VA5 A;  2UXD L;  3OIQ A;  2B2U C;  1HJP A;  1GXD C;  5LL6 S;  2B3G A;  1M8A A;  1W6J A;  4A3F B;  1VQI A;  5M3F G;  1HA6 A;  1HQM C;  1RIP A;  4Z9C B;  1W2B A;  1PH6 A;  3HP3 A;  2R7D A;  1PZJ D;  1LAC A;  2RCN A;  5C5L A;  3ND9 A;  1SMX A;  4NW2 A;  1WFQ A;  2D9U A;  1E0B A;  5LMN L;  3AYH B;  1Z47 A;  1NR4 A;  4CJ1 B;  3RLN A;  1PH5 A;  1J5E Q;  3K59 A;  5IP7 H;  5M3M B;  1HA5 A;  1H9S B;  4DR7 L;  1U9R A;  3T16 A;  2IHF A;  2PYK A;  4XQN A;  4DV7 Q;  1S5F D;  5C4J B;  4GKK L;  2QDL A;  4A3B G;  1G51 A;  3KLW A;  2IWH A;  3D0F A;  1IL8 A;  2B63 G;  5C0X G;  1N33 Q;  1AH9 A;  2B2W A;  4IFD J;  1CKN A;  5J22 A;  1HXY D;  1HR0 L;  3JAM L;  1D5Z C;  2F0F A;  1TWC H;  1C48 A;  3HOV G;  4ZCK A;  5C44 G;  4B3S L;  4XQJ A;  1FGU A;  3F8T A;  3C1E A;  4DAM A;  5K5P A;  2Q8T A;  1SYB A;  2WAC A;  4P71 A;  4FF1 A;  2BH2 A;  1B9N A;  5CV9 A;  2NZO A;  1A6X A;  4DK6 C;  5JPM C;  4A3M G;  5JJL A;  1K28 A;  4FVM A;  2AQ1 B;  3OOC A;  2EJG C;  5CV5 A;  4A3C G;  2VY3 A;  1VQP A;  4ZLT F;  1LT5 D;  5A2Q L;  3QR8 A;  4BWG B;  5CV4 A;  3A56 A;  1HHV A;  1F9Q A;  2E2I H;  4P2C B;  4OO1 G;  4ME3 A;  4KD4 A;  4A3K B;  5FJ8 H;  4CDD C;  2ZXO A;  4K8I A;  3BS1 A;  1SYD A;  3GTG B;  1BKB A;  2R92 H;  2L15 A;  4H0L C;  4DR2 Q;  2WP8 J;  2OT2 A;  4J8Q A;  4NMZ A;  2K5W A;  4DAY A;  2IX3 A;  4BBS G;  3ZYY X;  2EY1 A;  2JA6 G;  4RGT A;  1EIH A;  1AE2 A;  1H95 A;  5EBC A;  5J39 A;  1GUG A;  1I4G A;  1BR9 A;  1EU4 A;  4HTH A;  3E0E A;  5IT9 L;  1Y1W H;  4IN3 A;  4C3I H;  1PXU A;  1RJT A;  5K36 H;  2LY7 A;  4DV4 Q;  1ENA A;  3W1B A;  5GAG C;  2K05 A;  4C3J H;  5IGE A;  4TRD A;  4HAE A;  2F4V Q;  1ROD A;  1BQQ T;  3PCO B;  4IAL A;  5FO7 B;  1SE4 A;  5F2D A;  1D6E C;  2L1B A;  3S1Q H;  3W3A A;  1PYB A;  4JI1 Q;  4JI7 Q;  3SK8 A;  3AMU A;  3ICE A;  4MNO A;  4CGY B;  1SFO B;  4ALP A;  2JXM B;  2L11 A;  3GTJ H;  3M4O H;  4U68 A;  1U4L A;  2HQL A;  3U58 A;  4GN5 A;  1A3V A;  1EQV A;  1HTL D;  2DY7 A;  2EPB A;  1OTC A;  4LW1 A;  5GAH C;  1RKN A;  1VQE A;  2WIN B;  3GTK H;  3TME A;  1T9H A;  4UP9 A;  1F2Y A;  1B70 B;  3NEL A;  1S72 A;  1N33 L;  1IW7 D;  4P73 A;  4OL7 A;  1SLJ A;  4KI0 A;  1MGS A;  3S17 B;  2MJ8 A;  5JVG 3;  1PRT F;  1SE8 A;  4NB3 A;  2VNU D;  3VR4 A;  5FLM G;  1STY A;  4JBW A;  2Z0S A;  1ICW A;  4R4O A;  2YTX A;  3Q23 A;  4CKE A;  1EFW A;  5M9O A;  1WCM H;  2GN5 A;  4RGN A;  5I6Y A;  3DM1 A;  3UDI A;  2RKS A;  2HCI A;  1O7L A;  4KK7 A;  1X3P A;  3HOX B;  4AYB B;  4AH6 A;  3MFY A;  5IT9 c;  1PTO F;  4QMG A;  1ILP A;  1LM0 A;  1RHP A;  2Q2I A;  3RZO H;  2H4O A;  1JWU D;  1E24 A;  3R3O A;  1M4V A;  4B9W A;  1XNR Q;  1EOT A;  2JA5 B;  4YCU A;  1PZK D;  5KYI A;  1XMO Q;  3GTQ H;  1PRT C;  2K04 A;  4RAU C;  4RWS C;  4OXP A;  3TDQ A;  4G57 A;  3E3X A;  2PCF B;  3RZD H;  4DR2 L;  2PW7 A;  1Z9F A;  3QG1 A;  4RGO S;  1TWG H;  1O78 A;  3EQL C;  1H9K A;  3DWQ A;  1PTO C;  4IFD I;  1XX8 A;  4CKC A;  1SJE D;  3TRZ A;  1VQ8 A;  3X3N A;  1GJX A;  3C46 A;  1UE6 A;  1EQT A;  5FK9 C;  1L1O A;  5FO8 B;  5IIF A;  1I6H H;  4DV4 L;  2JQO A;  3CCM A;  1YNJ C;  4PQX A;  1GKH A;  1VQN A;  5I2Y A;  2F4V L;  1CFM A;  2NZH A;  4A3L H;  2MQH A;  3MA2 B;  1SBB B;  1HQR D;  1CZG A;  1UWV A;  5E1F A;  2ZTC A;  4JI1 L;  1L0X B;  2QEX A;  4JI7 L;  4CHT B;  4A3I B;  3AEV A;  5J1Z A;  3GTO B;  2TMP A;  5C4X B;  4H7B A;  3IKJ A;  3PV0 A;  4X3U A;  2A68 D;  4JOI A;  1LTA D;  3H3V C;  2CW0 C;  1F9P A;  3PGZ A;  1CT1 D;  4RKL A;  2K75 A;  3ERQ A;  2R7F A;  4XYO A;  1OXS C;  1V43 A;  3CQZ B;  1NY4 A;  2KCM A;  4H13 C;  3NK9 A;  1TWF H;  4C3I G;  1A62 A;  5K36 G;  2KCT A;  3NBH B;  1P16 A;  1KAB A;  5HY6 A;  2CQA A;  1K83 H;  1U4R A;  1EY8 A;  1PH4 A;  1KXL A;  1JJ2 A;  2BDN A;  1YJN A;  2B2V C;  1KRS A;  1EY5 A;  5ELB A;  3OHX C;  4JC0 A;  1B8A A;  3RUZ A;  2JN4 A;  3TP7 A;  1Y8O B;  3NUC A;  5D3I B;  1BCP F;  3I55 A;  2QEJ C;  3CCR A;  1XPU A;  2EYF A;  2A6E C;  2B2U A;  1JOQ A;  2I5M X;  1SYF A;  3FMC A;  4R1J A;  1XNR L;  3SK5 A;  3EVQ A;  2JYO A;  3OW2 A;  3DHQ A;  4B3T Q;  3NEM A;  5C3E H;  1XMO L;  3G71 A;  3CAM A;  1N9W A;  3MZ5 A;  2IL8 A;  2PMZ E;  2N55 A;  1RD9 D;  5LMN W;  3E9H A;  5EQ0 A;  1WCM G;  3BVG A;  2BOS A;  1QB5 D;  1Q7Y C;  3KDF A;  1BDO A;  1B53 A;  1PFN A;  1QWY A;  5HUR A;  3M4Q A;  2RVL A;  3J80 L;  3KJP A;  3FVQ A;  1OXX K;  1RTN A;  4UHV A;  4A3D G;  1CTM A;  2PO4 A;  5M5X B;  3K6O A;  1VQD A;  2VUM B;  3T1H Q;  3EBE A;  1AE3 A;  2CH4 W;  4GS3 A;  3VYT A;  2SEB D;  5C6A A;  3MHB A;  2F0M A;  2DJF C;  1HR0 W;  3VA7 A;  4IFD H;  4A3G H;  1AZQ A;  2VS1 A;  5JEA G;  2FMM A;  1LTT D;  1IKL A;  4ZUJ A;  2D0O A;  1PH2 A;  1EWC A;  3T4A C;  4LF9 Q;  4XDX A;  4C3H G;  1VQ9 A;  3A0J A;  3CCQ A;  4LWC A;  1NUC A;  3A54 A;  4F7X A;  3M85 A;  1LTG D;  3G7L A;  2NUC A;  3CC7 A;  5GAD C;  2I5L X;  3WOF A;  1JB3 A;  3TRE A;  3I4M B;  2M9V A;  4MN3 A; 
#chains in the Genus database with same CATH homology
 2GVB A;  2K52 A;  2YYZ A;  1N8R C;  4B3R Q;  2E2H H;  1HNW L;  2AMC B;  3H3V I;  4C2M H;  4R4C A;  2QGQ A;  4A3E H;  1TXY A;  1UE5 A;  1Y1V G;  4H02 A;  2E2J H;  4IPH A;  3W1G A;  4DR6 Q;  1EOV A;  5FJ8 G;  1CSQ A;  1TWH H;  1VCI A;  4JOI C;  1K3R A;  4GLV B;  1LTL A;  1LYL A;  3RLO A;  4DNI A;  1QZG A;  4LFA L;  2JA6 H;  2R92 G;  3DM3 A;  4A3L G;  4LF6 Q;  1L0W A;  3HOX G;  1X65 A;  3PUW A;  4AYB G;  1K8G A;  4L5T A;  3FHW A;  3ERS X;  3I7F A;  3CME A;  4DPG A;  3GTL H;  1YJ9 A;  3J80 c;  1PA6 A;  3HOY G;  3CP0 A;  4UP8 A;  2VQF L;  1Y14 B;  1MKH A;  4QL5 A;  4B3M L;  5GAE C;  2EIF A;  1X54 A;  4P75 A;  3T1Y Q;  4A3J H;  1N36 L;  4KHP L;  3HKS A;  4BBR G;  4OX9 L;  1S3O A;  1X6O A;  1Y1W G;  3KF6 A;  2ALY B;  2JA7 H;  5GRO A;  4MZ9 A;  5IYC G;  2DUD A;  1NJI C;  1JJG A;  3AFP A;  3GTM H;  1E22 A;  3S24 A;  4DUY Q;  2MO1 A;  2KBN A;  2JA5 G;  1CSP A;  2LXK A;  2YTV A;  3OYY A;  2H5X A;  3K81 C;  1VQH A;  3CCJ A;  4LFA Q;  4X65 Q;  3G48 A;  3RLF A;  4GNX A;  3OTO L;  4YWL A;  3CW2 C;  4LFB Q;  2BA0 A;  3BU2 A;  2HIX A;  3J7A 5;  1LUZ A;  4R4T A;  4O2D A;  2ID0 A;  4YHH L;  3EIV A;  4YCV A;  2UXD L;  4XIG S;  1PV4 A;  1J5E L;  1ASY A;  1HJP A;  2VW9 A;  4HID A;  3HFZ B;  2OQ0 A;  1PVO A;  4NXM L;  2NVT H;  1TWA H;  2VL6 A;  5ELO A;  2NVX H;  4LF5 L;  1Q81 C;  1IBK L;  4XTC S;  1K73 C;  2B3G A;  1CUK A;  4X66 L;  3GO5 A;  3UE1 A;  5BR8 Q;  2F52 A;  1VQI A;  5M3F G;  1XMQ Q;  5E7N A;  1JMC A;  1RIP A;  3U50 C;  5IWA L;  2E5L L;  3I4M H;  4QJF A;  3CCV A;  1XNQ Q;  1W2B A;  1PH6 A;  4QQB X;  1VQF A;  3VDY A;  1NTG A;  4DV7 L;  2R7D A;  4JI0 L;  1U5K A;  2RCN A;  4YY3 L;  1IL2 A;  1GO3 E;  3M3Y H;  1SMX A;  3S1N H;  4LFC L;  1EUJ A;  1HNX Q;  1WFQ A;  2UUB L;  4MTN A;  4GOP C;  5LMN L;  2JK8 A;  1HNZ L;  1GD7 A;  3AYH B;  4DV2 Q;  4AQY Q;  3T1H L;  4LF8 Q;  1Z47 A;  1PH5 A;  3RLN A;  1J5E Q;  5C0X J;  1SRO A;  3HKZ E;  3A5Z B;  3S16 H;  4X62 Q;  5IP7 H;  3GTG H;  1Q86 C;  4LF5 Q;  1I50 H;  2HIV A;  1VQ7 A;  4DR7 L;  1N32 Q;  2IHF A;  2YU9 H;  1XJV A;  2D62 A;  4A3I G;  4WJ3 M;  1HH2 P;  3S15 H;  4YWK A;  5IY0 A;  2Q2U A;  5C4X G;  4PMW A;  1YHA A;  4HJ7 A;  4LF9 L;  4DV7 Q;  4HJ8 A;  1OXT A;  1X3E A;  4P72 A;  1M1K C;  4LNQ A;  4GKK L;  3TQY A;  4JI2 Q;  4A3B G;  1NMG A;  1G51 A;  1JJC B;  2K5N A;  3KLW A;  4JI8 Q;  3SGI A;  3G6E A;  1KC8 C;  3D0F A;  1DGS A;  2B63 G;  4JYA L;  5C0X G;  2K14 A;  5IP9 G;  1N33 Q;  1AH9 A;  4BBS H;  4IFD J;  5AJ3 L;  1CKN A;  2HHH Q;  3W5O A;  1X56 A;  4GKJ L;  1EYG A;  1PHJ A;  1Q8K A;  1HR0 L;  4GN3 B;  4A3D H;  1ASZ A;  3HOW H;  4B3R L;  1WJJ A;  3HOV G;  1TWC H;  3EN2 A;  3IRB A;  2UUA Q;  5C44 G;  3UDF A;  2UU9 L;  1UEB A;  4DV1 Q;  4B3S L;  2UU9 Q;  1FGU A;  4Y52 H;  3F8T A;  1IBL Q;  2D0P A;  4DAM A;  4DR6 L;  3Q8D A;  2EXD A;  3CPW A;  1SN8 A;  4IJL A;  4P71 A;  3KOJ A;  4BY1 H;  1O7I A;  4PZ6 A;  2BH2 A;  3RNU A;  3CPF A;  1A0I A;  4A3F H;  4LF6 L;  2NZO A;  3D31 A;  4QGU A;  4DK6 C;  2B29 A;  1XPR A;  1V1Q A;  4A3M G;  2XTI A;  3RR5 A;  4HIM A;  3HOZ H;  4WJ4 A;  4C3H H;  4A3G G;  5JJL A;  2OWO A;  1YZ6 A;  4NPS A;  1BBW A;  1Q1B A;  4R4Q A;  3ZJY C;  3T1Y L;  1S40 A;  5M5W H;  5J3B A;  3STB C;  1FJG Q;  1KL9 A;  3H3V H;  4A3C G;  2VY3 A;  3NEN A;  1E3P A;  4PZ7 A;  1VQO A;  1VQP A;  4X6A H;  3L2P A;  4B3S Q;  2IX0 A;  4NXN Q;  1PYS B;  4HJ5 A;  1KD1 C;  4DUY L;  1XTD A;  3M4P A;  4JCV E;  5M3M H;  2NVQ H;  1RL2 A;  3F2B A;  4X65 L;  2E2I H;  1Y1V H;  4PZ8 A;  5EAY A;  3TS2 A;  4OO1 G;  4ME3 A;  1KQS A;  5IYB H;  4LFB L;  2Y0S G;  3K8A A;  3AFQ A;  5IYD G;  5FJ8 H;  3J81 c;  4A3E G;  1BKB A;  2N3S A;  4DR5 Q;  2R92 H;  1YNX A;  2L15 A;  3BZC A;  5DLQ E;  3CCU A;  2WP8 J;  4DR2 Q;  3S1M H;  5C4J H;  4OO1 I;  1QUQ A;  4L5Q A;  2RF4 A;  3F1Z A;  1V9P A;  4AIM A;  4EQ5 A;  4BBS G;  3H0G H;  4UY8 C;  3HOY H;  4L5S A;  2JA6 G;  4BA2 I;  2UXB Q;  2WAQ E;  1H95 A;  1AE2 A;  2WFW A;  3MXN B;  4AYB E;  5BR8 L;  4POG A;  3S2D H;  1XMQ L;  4GNX C;  3JC6 6;  1Y1W H;  3E0E A;  1CKO A;  4A76 A;  1XPO A;  1KIX A;  2OTL A;  4DR3 L;  4C3I H;  3U4V A;  1XNQ L;  4JI3 L;  5IYC H;  3DLL A;  2ZM6 Q;  4A3J G;  1WI5 A;  2OQK A;  1Q12 A;  3FKI H;  4DV4 Q;  4JI6 Q;  1NBW A;  4BXX H;  2Q2H A;  3W1B A;  5GAG C;  2JA7 G;  3PF4 A;  2JA5 H;  4C3J H;  1HNX L;  2VUM G;  3K7U C;  2F4V Q;  1YJW A;  1QUQ B;  4LUZ A;  4DAY B;  4DV2 L;  3PCO B;  4AQY L;  4LF8 L;  1Q82 C;  4JV5 Q;  1KHI A;  1SR3 A;  1EWI A;  3TEH B;  2PNH A;  4JI4 Q;  3S1Q H;  1PYB A;  4JI1 Q;  4X62 L;  1VQM A;  1M90 C;  4JI7 Q;  3ICE A;  2RHQ B;  3HOW G;  2PI2 E;  4MNO A;  4YWM A;  2R6G A;  3ULL A;  4JBM A;  1N32 L;  3RN2 A;  2F3I A;  4QY7 A;  4ALP A;  2V1C C;  4R4I A;  2UXC Q;  2CWP A;  1HZC A;  3GTJ H;  4DR3 Q;  1K8A C;  3M4O H;  2JA9 A;  4JI3 Q;  4L5R C;  2HQL A;  3E9I A;  3U58 A;  3ULP A;  4GN5 A;  4JI5 Q;  2ATW A;  1FL0 A;  3J80 i;  1OTC A;  4LW1 A;  3PIO A;  5GAH C;  3CF5 A;  1B7Y B;  1K0R A;  3PUX A;  4JI2 L;  1VQE A;  2K5V A;  4JI8 L;  3GTK H;  1EIF A;  2HT1 A;  2CQO A;  1T9H A;  2IX1 A;  4UP9 A;  1YHQ A;  1YI2 A;  1B70 B;  3NEL A;  1S72 A;  1IBM Q;  1N33 L;  4P73 A;  3AQQ A;  2ZJQ A;  2IHE A;  1KAW A;  1SLJ A;  3L0O A;  2HHH L;  3CCL A;  3I4M G;  2E8G A;  4KI0 A;  4A93 G;  1I5F A;  2JE6 I;  2UUC Q;  2KHI A;  4A3K H;  3FP9 A;  4LF7 Q;  1PH8 A;  2R7Z H;  2XGT A;  4J15 A;  1SE8 A;  2KHJ A;  4NB3 A;  3CCE A;  5C3E G;  1YBY A;  3GTP H;  5FLM G;  2Z6K A;  3I4N H;  2VNU D;  2UUA L;  1L2F A;  4DV1 L;  4X64 Q;  3G4S A;  4JBW A;  1X55 A;  2CFM A;  2Z0S A;  3K0X A;  2YTX A;  4R4O A;  4BA1 I;  5IE8 A;  1IBL L;  1EFW A;  4LF4 Q;  5LMU Q;  1WCM H;  2GN5 A;  2N8N A;  3LGJ A;  2WB1 G;  3UDI A;  1CKM A;  1HZA A;  4A3I H;  4YCW A;  4AH6 A;  5IT9 c;  4DUZ Q;  5GQO A;  4GKJ Q;  3GTO H;  2PI2 A;  2MO0 A;  2ZTE A;  4DV6 Q;  1VQC A;  1QVG A;  1VQA A;  4IPD A;  3F2C A;  1LM0 A;  3PO2 G;  2Q2T A;  1UE1 A;  2Q2I A;  3RZO H;  4BY7 H;  2N49 A;  1FJG L;  1E24 A;  2MNA A;  4DV5 L;  3A74 A;  3PIP A;  3J81 j;  1YIJ A;  1X9N A;  1XNR Q;  3KFU A;  2IY5 B;  5C0X I;  1MIU A;  4NXN L;  3UE0 A;  2BA1 A;  5JEA J;  1VQJ A;  1EQR A;  4IOA A;  4JBK A;  1A8V A;  4YCU A;  3HOU G;  2A1A A;  3HOV H;  4FDB A;  1XMO Q;  5C44 H;  4IJH A;  5JJK A;  2JA8 H;  2YV5 A;  3GTQ H;  3PO3 G;  1J6Q A;  1NE3 A;  1SFO H;  4OXP A;  2JEA I;  1FVI A;  2NN6 G;  1A63 A;  1YEZ A;  1OXU A;  1OXV A;  2N78 A;  1Q46 A;  1E1O A;  4GOP B;  1VQ4 A;  4IFD G;  1KRT A;  2OTJ A;  3RZD H;  3A5U A;  4DR5 L;  4DR2 L;  1N34 Q;  1Z9F A;  3U4Z A;  1TWG H;  2R93 G;  2KEN A;  4BY1 G;  2AHO B;  4DV5 Q;  2K50 A;  3KJO A;  4IFD I;  4A3F G;  3B6Y A;  4RMF A;  1JB7 A;  2UXB L;  1E1T A;  3TRZ A;  1IYJ B;  1VQ8 A;  2MFI A;  1QVC A;  4DR1 Q;  4KHZ A;  1I94 Q;  3HOZ G;  3S17 H;  1UE6 A;  1IZ6 A;  1L1O A;  2VZA A;  2ZM6 L;  1I6H H;  4DV4 L;  2JQO A;  4JI6 L;  3CCM A;  4DV0 Q;  1GM5 A;  2I0Q A;  1GKH A;  1VQN A;  4DR4 Q;  2F4V L;  2K4K A;  2NZH A;  4JV5 L;  2MQH A;  4A3L H;  1W3S A;  2VQE Q;  3HOX H;  5IYD H;  1UWV A;  3K80 C;  5M3M G;  1G29 1;  4JI4 L;  2A8V A;  2ZTC A;  4JI1 L;  2QEX A;  4JI7 L;  5IYB G;  1E7Z A;  2RHS B;  2Y0S E;  3RN5 A;  5H1S E;  1PH7 A;  3AEV A;  4IOC A;  1L1O B;  4BBR H;  3F2D A;  1D7Q A;  3ULJ A;  2UXC L;  1C7Y A;  1BBU A;  3JAM c;  3BJU A;  2WAQ G;  3PV0 A;  1MJE A;  3S2H H;  4K0K Q;  1D8L A;  4JI5 L;  3BZK A;  4JOI A;  5FLX c;  3H0G G;  3CXC A;  4TQU S;  3PGZ A;  4PG3 A;  4GLX A;  1VQB A;  2IT1 A;  2DGY A;  2K75 A;  2R7F A;  4DV3 Q;  1OXS C;  1IBM L;  1V43 A;  1QZH A;  4KLK A;  1VQ5 A;  1NY4 A;  2KCM A;  4APV A;  5M5X H;  1TWF H;  1HNW Q;  1A62 A;  4LF7 L;  5K36 G;  2UUC L;  2KCT A;  3MEF A;  1P16 A;  3NBH B;  2VUM H;  1X3F A;  5HY6 A;  3FKI G;  1NMF A;  1K83 H;  1VS0 A;  2CKZ B;  4Y7N H;  4BXX G;  2I5H A;  1PH4 A;  4X64 L;  1KXL A;  3KF8 B;  3J7Z C;  1JE5 A;  4UP7 A;  4LF4 L;  3PSI A;  1JJ2 A;  2JEB I;  4B3T L;  5LMU L;  1YJN A;  3CCS A;  1KRS A;  2GVA A;  3J81 i;  4JC0 A;  1B8A A;  3PUZ A;  5M3F H;  4DUZ L;  4HIK A;  2ZJR A;  1YVC A;  3GD7 A;  2VQF Q;  4B3M Q;  3PF5 A;  4DV6 L;  3KF6 B;  4O0A A;  4IO9 A;  1N36 Q;  4KHP Q;  3I55 A;  4OWT B;  4OX9 Q;  1VQL A;  1EIY B;  2Z6K C;  4OWX B;  3CCR A;  1VQK A;  3CC2 A;  4A75 A;  1XPU A;  1C9O A;  1YIT A;  4UPA A;  1HZ9 A;  2C35 B;  2I5M X;  2CCZ A;  2K5H A;  4R1J A;  1EQQ A;  1XNR L;  3JAM i;  1PFS A;  4POF A;  2BH8 A;  1I3Q H;  2ASB A;  4A93 H;  3ER0 A;  1U0L A;  3HKZ G;  4GNX B;  3OW2 A;  1PH3 A;  4B3T Q;  3I56 A;  3NEM A;  5C3E H;  5FLM H;  1Q1E A;  3OTO Q;  1XMO L;  3G71 A;  3M7N A;  3CAM A;  1N9W A;  4OON A;  4TVA B;  4A3K G;  1YHB A;  3UDG A;  2R7Z G;  1IXR A;  2PMZ E;  4JBJ A;  3KYH C;  3UDX A;  5IP7 G;  4YHH Q;  3I4N G;  5C4X H;  1C0A A;  2UXD Q;  2LXJ A;  2AKW B;  1X3G A;  5LMN W;  1R9T H;  3E9H A;  3H15 A;  4RG1 A;  4GOP A;  1N34 L;  4NXM Q;  1WCM G;  4A3B H;  1IBK Q;  3S14 H;  1G6P A;  2A19 A;  2WB1 E;  3WWV A;  4X66 Q;  2B63 H;  1Q7Y C;  3PUY A;  4GLA C;  1MJC A;  3KDF A;  5IP9 H;  2E5L Q;  3PO2 H;  2ZTD A;  1P8L A;  3M4Q A;  2OCE A;  5IWA Q;  1VQG A;  3CQZ H;  4DR1 L;  1I94 L;  2ES2 A;  3KJP A;  4JI0 Q;  4HJ9 A;  4YY3 Q;  1OXX K;  1WOC A;  4BY7 G;  3I4O A;  2FXQ A;  4HJA A;  4LFC Q;  3M9B A;  4A3D G;  2UUB Q;  3CD6 A;  1PH9 A;  5JJI A;  4DV0 L;  4LUV A;  5LMN Q;  1HNZ Q;  4DKA C;  3K7A H;  1VQD A;  4EX5 A;  1BVS A;  1HZB A;  4JG2 A;  5M5Y H;  2AWN A;  3T1H Q;  3HOU H;  3EBE A;  4A4I A;  4DR4 L;  1AE3 A;  4GS3 A;  1JT8 A;  3L7Z C;  2EQS A;  1VQ6 A;  3PO3 H;  2PQA A;  2VQE L;  4LUO A;  2JJQ A;  1WYD A;  3KDF B;  4DR7 Q;  4A3M H;  2NN6 I;  1HR0 W;  2YTY A;  2JA8 G;  4QIW E;  3CC4 A;  5ELN A;  3CMA A;  4A3G H;  2VS1 A;  2QA4 A;  1QVF A;  1L1O C;  3S1R H;  5JEA G;  3STB D;  2R93 H;  2D0O A;  4P74 A;  1PH2 A;  2LSS A;  4IPC A;  3I2Z A;  1SRU A;  4LF9 Q;  5HGQ A;  3TS0 A;  2CWA A;  1VQ9 A;  3A0J A;  3GDE A;  3CCQ A;  2ZJP A;  4DK3 C;  4A3C H;  4GKK Q;  4LWC A;  4K0K L;  3PUV A;  4IPG A;  1CKN B;  3M85 A;  2AWO A;  4JYA Q;  4HIO A;  3CC7 A;  1GVP A;  5GAD C;  2PQA B;  4GN4 B;  5AJ3 Q;  1UE7 A;  2I5L X;  1K9M C;  4DV3 L;  4OWW B;  1HR0 Q;  3TRE A;  2NVY H;  1PH1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...