1AEXA

Staphylococcal nuclease, methane thiol disulfide to v23c variant
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
135
structure length
134
Chain Sequence
LHKEPATLIKAIDGDTKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title Mobile unnatural amino acid side chains in the core of staphylococcal nuclease.
pubmed rcsb
source organism Staphylococcus aureus
molecule tags Nuclease
total genus 32
structure length 134
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1997-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1aexA00
5IGCA 1SNCA 5JOBA 5I6WA 4H7BA 5C5LA 2F0MA 2F0NA 4N9PA 4DGZA 4I65A 5EKLA 1EY4A 1EY0A 2RBMA 2F0IA 1SYCA 3TP8A 5CV6A 3ERQA 1SYEA 1A3UA 1A2TA 3U9OA 5I9PA 5C6AA 2NUCA 1EZ6A 3NQTA 2EYPA 2O4XA 3DHQA 4R8NA 1KDCA 3TP7A 1EY8A 4DF7A 5IOCA 5CC4A 5I9OA 4KY6A 3MVVA 4RKLA 4K5WA 3HZXA 1EQVA 5DAUA 3TMEA 5KEEA 3NHHA 2SNSA 4MIUA 3P1HA 4ID6A 1U9RA 2OXPA 3BDCA 4QMGA 5CGKA 3SK4A 3MHBA 3P75A 5C3XA 2QDBA 4J6HA 2F0TA 1EYAA 3EVQA 1F2YA 1II3A 2F0DA 2PZUA 4WRDA 3OSOA 4E6IA 3LX0A 3NXWA 2EXZA 5ISRA 4IUNA 4K2KA 1EZ8A 5F2DA 5E1FA 2F0VA 4KJOA 5CV7A 5CV5A 3SXHA 1JORA 4B9WA 3SR1A 5KRUA 1SYFA 2EYFA 1KAAA 1EY9A 1SYBA 3H6MA 4ODGA 5CV4A 4WORA 5KIXA 5M9OA 5C5MA 2M00A 3MEHA 4K8JA 4ME5A 4HMIA 3SK8A 1JOQA 5KGUA 4KHVA 1EYDA 2EYHA 4PMCA 4ZUIA 4S3SA 1TQOA 1STHA 1RKNA 2F0EA 4K2LA 3VA5A 4N9TA 1EY7A 2PQEA 3T16A 3QOJA 5HGTA 5IGGA 3D8GA 3TP6A 3S9WA 3OWFA 4J1MA 4K8IA 3EJIA 2F0HA 2F0LA 2F0PA 3D6CA 4KD4A 1KDAA 3V2TA 1KABA 5IGBA 1TR5A 1SYDA 5IGEA 2OF1A 3R3OA 1NSNS 3OMCA 4PNYA 3MZ5A 5CV8A 2EY5A 2PW7A 1STGA 2SOBA 4ZQ3A 2RKSA 5EKKA 4EQNA 4F7XA 4ZUJA 1F2ZA 5DEHA 4RKBA 1JOKA 5HURA 4HMJA 4PMBA 1ENAA 1ENCA 5C4ZA 2SNMA 3NUCA 3NP8A 4G57A 2EYOA 2F3WA 3SK6A 5JAVA 4K5VA 4QF4A 3BDLA 1A2UA 1EYCA 2EY1A 5I6YA 2PW5A 3OMGA 3RUZA 2F0GA 1STNA 4QB4A 5K5PA 5CV9A 4B9XA 2F0UA 2PYKA 4KJNA 5EGTA 1SYGA 3DMUA 4LAAA 4DFAA 2F0KA 3E5SA 2EYLA 2EYMA 1STBA 5J39A 4K5XA 4DU9A 3T13A 5IGFA 2PZTA 3EROA 4EQOA 1SNMA 5IGDA 1STYA 4KD3A 4IALA 1STAA 1NUCA 2EYJA 5J1ZA 4KY7A 3PMFA 3ITPA 2EY6A 5E3FA 1EY6A 1SNDA 2WACA 4IZ8A 2ENBA 4HTHA 1A3TA 1IHZA 5C3WA 2PZWA 5IODA 2F0QA 2OEOA 1AEXA 1EY5A 3C1FA 3MXPA 3HEJA 3QB3A 3TP5A 5CR3A 4NDXA 1SNPA 4YIJA 3NK9A 3SK5A 4K14A 5IIFA 4KV6A 4EVOA 4NP5A 2RDFA 2HQEA 2KHSA 3SHLA 5KYLA 1SNOA 4KTAA 4NKLA 4TRDA 2F0WA 2KQ3A 3D4DA 3QOLA 5NUCA 1JOOA 5C4HA 1SNQA 1A3VA 1F2MA 2EY2A 2F0JA 2F0SA 2F3VA 3D4WA 2F0OA 4NMZA 4EQPA 4KY5A 1KDBA 4OL7A 5J22A 4F8MA 1TT2A 3C1EA 5KYIA 2F0FA 2LKVA 4K6DA
chains in the Genus database with same CATH superfamily
4H7BA 1Q81C 4JI6Q 1SN8A 2DJFC 2K03A 2RVLA 3X3NA 3H3VH 4A3BB 3IRBA 3HOUB 2V4DA 3J81i 1SFOB 1D1IA 1EZ6A 4DUYQ 1P8LA 4UDUC 4R4OA 2VUMG 1NTGA 2RHQB 1I4PA 1SROA 4J6HA 4ILWA 3MXGA 1XX8A 2SDFA 3D0FA 3NXWA 3LX0A 4IUNA 1TWGB 3CCRA 2I5HA 4YWKA 4JI4Q 2C35B 2WV6D 4ME5A 1V8QA 2JA8H 5COYA 2NVXH 1CM9A 3CKIB 1CA6A 4JW0A 1H9SB 1TQOA 4IN3A 2AUJD 1XMQL 4IOAA 2KUMA 5EPJA 3L2PA 1I4QA 2E74C 1PH5A 1YZ6A 2PI2E 4J1MA 4N8X1 4LF4L 1GXDC 3EIVA 4FP5D 1G2SA 1N32Q 1QUQA 2YTYA 4GOPB 3S1MB 2Y0SE 3QG1A 2Z6KC 4CKEA 2AQ1B 5C3EG 1FR3A 3NP8A 4DR1L 3SK6A 2E76C 2GVAA 3BDLA 1VF7A 3MXNA 3PSIA 3RUZA 3MFGA 1B50A 1TWAH 5JJKA 5EJWA 2QDLA 3KF8B 2B2WC 5FO8B 1PFSA 2ZTCA 4XT3B 2BDOA 4DR6Q 1LTTD 2PZTA 3DEOA 2J7ZA 4OEMB 4CHTB 5H1SE 1ASYA 1EEID 1CFMA 2B8FA 3ERSX 3GTKH 2A6HC 5EKIA 4GZYC 3K6OA 1EY6A 2Y0SB 2ENBA 2EVBA 3GTPB 1EIGA 2R6GA 1PTOH 1IL2A 2O5JC 3RD4A 3S1RB 3NK9A 1JCKB 1ESRA 4FVMA 4KTAA 1A0IA 1LT3D 5AFWA 1O7IA 4GN4B 1N36L 4OL7A 5EAYA 5FLXc 4ALPA 3OW2A 4A3LG 1IKMA 1M4VA 4UP9A 2YU9B 3CMEA 3S2HB 5KNBA 5G3LD 4QCLA 2B2TC 4HJ9A 1KRTA 1EWIA 4R8NA 1PYWD 4L63B 5IYBG 4IFDJ 2FJ2A 3CF5A 1BNZA 3WOEA 2JA7H 3GV3A 2AHOB 3KK7A 5C3XA 2QDBA 1HCZA 1HFNA 3K81C 3GTQB 2RHSB 1V1PB 3V96A 4AH6A 1HJPA 1VQLA 2NVYH 5LMUL 1C7YA 2I0QA 3OIQA 2KJXA 1PDQA 3GTGH 3OTOQ 3EN2A 2H1EA 3CCSA 2MUYA 2CVRA 3A7AB 2O2LD 4PMCA 1Q82C 3NPPA 3TQYA 2KCCA 3K5LA 1PH7A 2Z4HA 3W3AA 3TN2A 3FVQA 4A3GH 1HQRD 3QOJA 1K8AC 2E2IH 2JJQA 3D8GA 5E4XA 3OYYA 2JA5H 3C3LA 3S1QB 4K8IA 2OTJA 1B1ZA 4JBKA 1YHBA 3FRPB 1LTRD 3PUVA 5FLXL 3OMCA 2GVBA 5C0XH 1X65A 2Z9HA 4DV6L 2PQAB 3HOYH 1OTCA 1J5EQ 3CCMA 1RJTA 4QIWB 2B2UA 3M4OB 4A3EG 1JJ2A 1L0YB 2QGQA 1L0WA 4UY8C 1GM5A 3AFQA 1ENFA 1LO5D 2QILA 2TMPA 2X6LA 2B2VC 4BBSB 4A3IB 5BN3A 2JA6H 1VQJA 2YYZA 4CGYB 4A3BG 2JEAI 3HOUG 1WCMB 3E6ZX 2ZXPA 3BG3A 2VB2X 5M5YH 5J1ZA 2M9VA 1I94Q 1JICA 2B29A 1A3TA 1JC7A 5GQOA 4ABNA 2A68C 3KDFB 2I46A 1W6JA 1JWSD 4LUZA 2K14A 4NDXA 5M5WB 4A93H 4DXGA 2LXJA 5TSSA 5FO9B 1ZEQX 1QG7A 4C1NI 1UE7A 3S2DH 4Y7NH 3S16B 1X3QA 5C4HA 1SNQA 2FINB 4X65Q 2HCIA 1F2MA 4NMZA 1X3FA 4KY5A 3CW2C 1JOQA 4LF6L 1E2VA 5IGCA 4HJ5A 2WP8J 2CH4A 4HIKA 1SYCA 3TP8A 1SYEA 1A2TA 1H9KA 2EE1A 4JC0A 1MGSA 2E2HB 1PZKD 2N49A 4FXKC 2Q2UA 4KY6A 3NHHA 3H91A 4P72A 1ZYRD 3PUWA 5D3DA 1D5MC 2ASBA 1AZQA 3Q8DA 2DY8A 2XIWA 4RHRA 5IP9G 3K7AB 3CC2A 4X3UA 2MP1A 1QJOA 5FKAC 1VQ4A 1CSPA 1SBBB 1TY0A 1TWFH 2EYFA 3T51B 4BY1H 2BH8A 2OCEA 4QGUA 3FHWA 2L15A 2F4VQ 3MEHA 3K5OA 3MTSA 4A3DB 4ZUIA 3T53B 1KLUD 3BVGA 5HGTA 4A3MB 3TS2A 3G7LA 3H15A 4B3MQ 3CXCA 3PV0A 4RG1A 2ALYB 1U5KA 2Y0SG 2R7ZH 1EOVA 2YTVA 1BCPB 4A3JB 4NXNL 2EY5A 1VCIA 2WB1E 3FMCA 5M5XB 2P5ZX 2FMMA 4K0KQ 1F2ZA 3OOCA 5BN5A 3VYTA 4LNQA 1GKHA 4JV5Q 1WTVA 4Z9CB 3S14B 1EYCA 2MQHA 3OMGA 1GVPA 2CKZB 1KL9A 4DFAA 4BBRB 5GROA 3CQZH 4DNIA 4K5XA 4LF8Q 4IJLA 4A3FH 2AQ2B 2EXDA 2KHIA 2QKIC 3GTOB 4KD3A 1GUWA 1Y1WB 2B3GA 1JJCB 2EJFC 1UE6A 4KLKA 1N9WA 4OXPA 2WB1B 1VQKA 1HZ9A 1I4GA 3F2BA 2B63B 1SJED 5C44B 4BXXH 2L55A 3EQLC 3E9IA 3IL8A 4X64L 3MXPA 3I2ZA 2D2CC 4K14A 4CDEC 4CDFC 2HIVA 3HOZH 3U50C 4DNTB 1JOOA 1A3VA 1CKNB 3NTIA 1Y1VB 2JXMB 4DV4Q 4JI3L 4LF9L 4DN4M 2A69C 1U0LA 3GTLB 4Q0FA 4UPAA 1XNQL 4GKKQ 4O2DA 2RSNA 1D1KA 1DONA 1XJVA 3DHQA 1G8ZD 2JP1A 4B3RL 2FFKB 1UUPA 5FJ8H 4YCVA 3TMEA 1VQHA 2SNSA 3KLSA 4OIJA 4P2CB 3NTKA 1PYBA 2ZM6L 3P75A 2PZUA 3W5OA 2QA4A 4ZCKA 1KC8C 2K28A 1DGSA 3WOFA 1A63A 1Q7YC 5CV7A 1OXVA 2A73B 3SR1A 5IYDG 1Z9FA 3T1HQ 1JJGA 1KAAA 1IZ6A 1EY9A 1SYBA 3K80C 4PMWA 5IYCH 4HMIA 3KBGA 4JOIC 4XDXA 3AQQA 4A3IG 4RWSC 3NSWA 5M3MH 1E1TA 1WOCA 2UUBQ 1WTHA 3KLWA 1PZJD 5JPNC 3J80E 3SE0A 3S9WA 3A74A 3SEBA 4X6AH 3HKSA 1KDAA 1CQFA 1A8VA 1N8RC 3D6WA 2UXDL 4DAMA 1Q1EA 1YNND 1PHJA 2ZTEA 4X3TA 1L0XB 4F88A 1DD2A 4ZKCB 3I4NG 1UAPA 4BY7H 4LF5Q 3CCJA 3CP0A 2NB0A 3QR8A 3TS0A 3BDOA 4P74A 1QNUA 4HN7A 2BOSA 1PFNA 1VMPA 2VQEQ 2HHHQ 1NAPA 2MGSA 2JQOA 1CUKA 3S24A 3CD6A 1IL8A 3HFZB 3NENA 2NVTH 1A15A 3GP7A 2K01A 3S1NH 4GKJQ 2F1MA 2NVQH 2F0QA 1LUZA 2EDGA 4JBMA 4MZ9A 5C4JB 3NEMA 5IIFA 4C3HB 1GOZA 3CPFA 4NP5A 4IUUA 2IL8A 4JI0Q 3J7AF 4LF4Q 4RGOS 2EY2A 1QVCA 2NN6G 3ND9A 3R93A 4A3DG 4BA2I 1VQ8A 3S15B 1CA5A 1LT6D 2R7FA 4M1UB 1VQFA 2NWGA 1MIUA 5BN4A 3MAQA 5C6AA 3JAME 1ICWA 1AE2A 4JI5L 3NBHB 1FGBD 4TKOB 3A54A 5I9OA 4A3JG 3P20A 4JI7L 4OHJA 5L37A 3GTMH 1W6KA 1B3AA 5C3EB 4HIMA 4DR3L 1XTCD 5ISRA 5JEAG 4K2KA 5EPKA 2CWPA 5E1FA 5CV5A 1I6HH 1XWEA 4ODGA 2DUDA 2CHBD 4GLVB 4KHVA 4DR5Q 4BBRG 3HOVH 4PG3A 2OTLA 1SEBD 3K5MA 3VA5A 3KOJA 1Y1WG 4FXGC 2X69A 3CU7A 2WB1G 2F0PA 1M8AA 1CZWA 4OELB 5C4XH 5C44G 5IT9E 1N36Q 1J6QA 1TS5A 3ZJYC 2HT1A 2QEXA 1ZXTA 2YV5A 5DEHA 4DV1L 1LTBD 1ENAA 1H9JA 2ZT9C 3DWAA 4DV5Q 4QF4A 2NN6I 4CDCC 4PZ6A 2R93B 1Y1VG 2VUMH 4RGNA 1KD1C 1IYJB 4GS3A 1HXYD 2NYZD 2E75C 2AUKA 4EQOA 3FKIB 3GO5A 4MHEA 4B3SL 3VR6A 4X62L 1NUCA 1UEBA 3PIP3 1EOTA 1VQ7A 1KXLA 2WAQE 3HOWG 1N33L 2MO1A 4O42A 3RZDH 3L3OC 5M3FB 4PV1C 5IWAQ 2R92H 1U4RA 1K3BC 1TXYA 2OEOA 3TRZA 1EWCA 1Q90A 4JVZA 1SNPA 2IHEA 4CDDC 4EVOA 1CTMA 2KQ3A 3PO2B 2A6HD 2B2YA 1FL0A 5A2QL 2F0SA 4M8AA 4DK1A 1JT8A 1KDBA 1EQTA 3LWEA 1MSGA 1Y14B 2JYOA 3LNNA 3WDNA 1SNCA 4R1JA 4DGZA 4RHSA 2UU9Q 1UNSA 1T9HA 5I2XA 3PGZA 2G5DA 2A6EC 1LLRD 4DR2L 1LTAD 1KIXA 1JMCA 2L9HA 1RHPA 3MWYW 2A19A 1EY8A 1EIHA 1YJ9A 3B6YA 1SE2A 5D65A 5DAUA 4C3IG 3Q23A 3HP3A 4DV0L 1I50B 1E2WA 3I4MH 4KN4C 1HUNA 4A3EB 4WRDA 5AJ3L 1PH1A 4C1NK 1HTPA 3K58A 2HCCA 4RAUC 1S3OA 2SEBD 4OONA 2F0VA 3PIO3 1SYFA 4H02A 2ZJQA 3T1YL 4DV7Q 5DM73 1MD2D 1VQ9A 2H4OA 1W3SA 3QIAA 3CAMA 4QUFA 2KEDA 1HNZL 5FO7B 2PMZB 1V43A 3T16A 2Q8IB 1B53A 2I5LX 2N88A 2F0HA 4X66L 2EIFA 3M4QA 4A3LH 5IGEA 3S17H 3H0GB 1UE1A 2RKSA 5DM63 1QVGA 4C3HG 4JYAQ 3GTJB 1DCZA 3A56A 3N6RA 4A75A 1WYDA 4YCWA 2E5LQ 5IYBH 3NWSA 3PO3H 1SJHD 1YNJC 3DXJC 1C0AA 1MSHA 1X55A 1RCVD 3CCVA 1LM0A 2PYKA 2XGTA 4KJNA 5EGTA 4DK3C 1D5XC 4X3SA 3TREA 2XNAC 1MI2A 3L0OA 3NWTA 5J39A 4L6TB 1SAPA 3J81c 1ILQA 3BS1A 5GADC 1Y69U 2QCPX 3OHXC 4JI1Q 1H9SA 4DUZQ 3X3MA 4C3JB 1S5ED 1YJWA 3PMFA 3NBIA 1G6ZA 1XMOQ 4P73A 1SNDA 4JI8L 4LW1A 5I2YA 3IFDA 3C1FA 4HAEA 2ID0A 4GOPA 1HNWL 1TKWB 1NBWA 1HNXQ 4NKLA 4TRDA 2K4KA 3ULPA 1WTPA 1K83B 5J22A 4PZ8A 1TT2A 3FPPA 2F0FA 4J15A 4JI2L 4K6DA 2A68D 2WIIB 4FF2A 3KF8A 2RBMA 1Q1BA 2F0IA 4C2MB 2NTSA 3U9OA 2PI2A 4EGVA 2O4XA 4U673 2ZJPA 3HOXG 4DV2L 1LV9A 2K5NA 4ID6A 1U9RA 2OXPA 3J81L 4A3BH 1EFID 1SFOH 3M4PA 1Y8PB 3FEWX 1IBKQ 4YHHL 1JB7A 2L4NA 4AQYL 3L7ZC 2PPBC 1TY2A 2QEJC 2R93G 2C5CA 2VL6A 5C5MA 5J3BA 1IBLL 1DXMA 2F3IA 2ZJRA 2UXBL 1TWGH 4FF3A 1FJGL 3FKIG 2FMCA 3BZKA 2N78A 3EJIA 3VYSA 2LSSA 1A6XA 5IGBA 4N8FA 2R3ZA 1XPRA 5M3FG 1TR5A 1SYDA 1IBMQ 3BJUA 1YNXA 2MO0A 2IW3A 3E3XA 5CORA 3ULLA 3R2IA 2KHJA 5JVG3 4IO9A 2IJ0A 1Q86C 2J0TD 2UUCL 1BVSA 1YJNA 4DR4Q 2JA8G 3PO2G 5T1GA 3F2UA 2VQFL 4GNXC 1A2UA 2UXCQ 2L1BA 1V1PA 2F0GA 5K5PA 3S1MH 2R7DA 1DOKA 1CK1A 3AEVA 1J8IA 4IURA 1MJCA 1PVOA 3I90A 1FNVA 3F2DA 1S40A 3RNUA 2WAQG 4J8QA 3UE1A 5IY0A 2K04A 1XPUA 3I4OA 1STAA 4B3TQ 1M1KC 3DUZA 2E8GA 1PH2A 3K59A 4LFAQ 2VW9A 2RCNA 1IHZA 4AIMA 3C2PA 1HR0L 3A5ZB 3STBC 3SVMA 4IPGA 2F4IA 4KHPQ 4DA2A 2PQAA 1PRTC 1HQMC 3CRLC 3D4DA 4A3KB 3GTPH 1GUSA 2DJGC 3H3VI 1KQSA 4KI0A 5ELNA 2LKVA 3BYYB 1F2LA 2I5MX 4O0AA 3S1RH 3A8IE 4U68A 1ONLA 1AW7A 1EY4A 1NY4A 2CWAA 3ERQA 5GAHC 1GJXA 4LFBQ 5ELFA 4DF7A 2D62A 3H0GG 1VQCA 2YU9H 3S2HH 2A69D 3I4NB 2JSOA 1TWHH 3EVQA 3AFPA 4IUPA 2E2DC 1QOHA 3V05A 1L1OC 2BH2A 4R4IA 4JI6L 2I07B 1LYLA 1G51A 4XT1B 5CV4A 1PYSB 2M00A 4K8JA 4OIKA 4DUYL 3GTQH 1ML0D 1RKNA 4IPDA 2QW7A 1I3QB 1BO0A 1R9TB 1KNEA 3F8TA 1BOSA 1VQMA 2Z1CA 3WWVA 4C3JG 1FNUA 1AN8A 3ULJA 4KK7A 3ONAB 1EQRA 3V2TA 4FDBA 5JEAJ 2A1AA 3J81j 3R3OA 4JI4L 3MZ5A 2PW7A 4EQNA 1SSOA 4JK1C 4I7AA 3J7AV 3S1QH 1YHQA 1LACA 2B8GA 4K5VA 3HKZE 4DV3Q 4UP7A 4DAPA 4IFDH 4A3GG 1FNWA 1QE6A 3DWPA 2DNEA 4OX9Q 2RDGA 3VR3A 4QUCA 1N32L 3M4OH 1SNMA 1ET6A 2LS01 5FLMH 4IALA 2KEEA 1Q12A 3CC4A 5IYDH 2B2WA 2DGYA 3HOYG 2KCNA 1S72A 4G7ZC 1SRUA 4BBSH 1SDFA 4A3IH 1VQAA 2PZWA 4HIDA 1IYUA 2Q2HA 1STEA 2K7VA 1WCMH 3LGJA 1P16A 1HHVA 5BR8Q 3A5UA 3W1GA 2KHSA 3QOLA 4DR6L 1G6PA 1B9NA 1SR3A 1E1OA 2EJGC 3G6EA 1WI5A 3C1EA 1G2TA 3OPOA 4HJ7A 5M5WH 2F0MA 4MTNA 1EY0A 2PNHA 3S16H 5I9PA 3CCQA 2QF7A 2NUCA 3PF4A 4GN3B 3TP7A 4EQ5A 1XNRQ 1K28A 1MBYA 3PF5A 2ZXRA 1WD0A 3HZXA 3E9HA 4NPSA 3KJPA 1PTOF 5CGKA 4BY7B 2B2TA 4CJ1B 1EYAA 1C48A 3H3VC 4NXML 1JR0D 2CQAA 2E2HH 2D0OA 1QILA 1BKBA 2M2LA 4KJOA 3N52A 2N3SA 1X9NA 3GV6A 1CSQA 1BR9A 2CH4W 2BA0A 2K1BA 2FHTA 4GNXB 4A3CG 2L11A 3SK8A 3PIPA 1JE5A 1CKNA 4S3SA 1XYIA 1STHA 3AU7A 1NNXA 2F0EA 3K7AH 2NVTB 5C0XI 4OO1H 1KRSA 3HOWB 1AP0A 5ELOA 3D31A 3J80i 2IX0A 1G91A 1FYCA 4O1NA 4A3DH 1Q46A 1NSNS 1G291 2IT1A 1NE3A 2WKCA 1IW7C 3AYHB 3OTOL 4A3MH 2EQSA 2RQXA 5T1IA 4BY1G 1JOKA 2EJMA 4PMBA 1H95A 4IUVA 3NUCA 4A3KG 4A3JH 1K8OA 4QB4A 2A5HA 5GAGC 5M5XH 1S4ZA 2F0UA 4XYOA 1YVCA 2EPBA 4LUVA 1PH6A 4YY3Q 3S14H 4WFN3 1C4QA 4LFCL 4RCOA 4C3IB 3J80c 2B2VA 1J5EL 1B7YB 1SMXA 4BBRH 4TVAB 1TS4A 3PIOA 3TZDA 3GTOH 4R8IA 1Y1WH 1B70B 4LK1C 1UEAB 4QJFA 1TVXA 1SNOA 1ET9A 2B63H 1E3PA 5C44H 4X66Q 3EA6A 1L1OB 2F0OA 1D5ZC 1SXTA 3URYA 1II3A 4L8JA 5I6WA 3FP9A 5C5LA 4N9PA 2KA7A 1PTOC 1V1OA 1I94L 1GO3E 2Q2IA 2KENA 5EBCA 1TS2A 4BXXG 1Y1VH 3DEPA 1E22A 2EYPA 3MFYA 5EBDA 2AWOA 1TWCB 1XMQQ 3J7A5 3GTLH 3HOZG 1N34L 4X65L 1F9RA 5D3IB 3CRKC 2F0TA 1X54A 4JCVE 4ULLA 3OSOA 3W1BA 3RZOB 2A6ED 3A7LA 3GD7A 1RL2A 1K8MA 2HD3A 4HIOA 3HGBA 3J80L 1X56A 1JORA 4JPBW 4IFDI 2N55A 3RLFA 2WFWA 3M9BA 3M3YB 2LFNA 3ND8A 3OIPA 3UDFA 4G4KA 4RGTA 1H9MA 3Q6SA 4DR1Q 3LWUA 1KAWA 2E2JB 3D4RA 1B3QA 2L12A 3M7GA 4L5QA 3TP6A 1Z6HA 4YWLA 4ZK9B 4KD4A 2Q8TA 1PMRA 3P7JA 4DK6C 4CKBA 5CV8A 3NBHA 4F7XA 3GQBA 1Q8KA 3HG9A 1VQOA 2F4VL 4IUQA 3A0JA 4H44C 5IYCG 5K36G 4G57A 1HH2P 3KBXA 3KF6B 3OWEB 5LL6S 3A8JE 4B3ML 2G9HD 1KLGD 1E24A 3E5SA 1QZGA 5LMNL 5D14A 3HOXB 3EROA 5IGDA 4WJ3M 5JVH3 1QZHA 1XTDA 2NZHA 1D6EC 4K0KL 3QO2A 2F03A 1YNJD 4JV5L 2K6AA 4K6LA 4BY7G 3QB3A 2K5DA 1VQEA 1BBUA 4YIJA 3M7NA 4XXEA 3U58A 5KYLA 2AMCB 4RCNA 4LF8L 1SMYC 4NB3A 2F3VA 4YWMA 3BU2A 3CCEA 3I91A 2MFIA 5C4JH 3KLRA 1OXUA 5JOBA 4C3HH 4C56C 4DAYB 5LMUQ 3RN2A 5EKLA 2K33A 3RMHA 3PUZA 2IWHA 3KYHC 1ICFB 2Z4IA 1KDCA 1MKHA 3NELA 2X6GA 2K5VA 3S15H 4JG2A 2WINB 3ER0A 4X3KA 4AYBE 2JA8B 2NVXB 4DV4L 2NZOA 5IP7G 1TU2B 1B9MA 3KLSX 1JWUD 2CW0C 3VR5A 3DWQA 4DV6Q 4B9WA 1S5FD 2GN5A 1HZCA 1WFQA 4MTKA 1VS0A 4GKKL 2WAQB 5C3EH 1X3PA 4Y52H 1AZPA 2VS1A 4Q5VA 5KNCA 1HTLD 1TIID 1I4XA 4N9TA 4RH6A 4HJ8A 1HA5A 4JOIA 5HY6A 3G6JB 4RA8A 4DR7L 2OQKA 2IHFA 1KABA 1YIJA 2B2UC 5LMNW 3BZDB 1TWAB 5EKKA 3KJOA 3T1HL 4CKCA 5HURA 1QVFA 1ENCA 1B4OA 4L5TA 2EZVA 2F3WA 1I5FA 2UUBL 1PLFA 2L5TA 3CMAA 3GTKB 1VQDA 2Z8LA 4H13C 4ZRZA 3UDXA 3DMUA 4B08A 4R4CA 2ATWA 1OXSC 2R61A 2Q2TA 3T13A 5C4XG 3CPWA 1IXRA 1PTOB 1EYGA 2XWBB 1NMFA 2R93H 1GUNA 4LF6Q 2KVMA 1BBXC 1LABA 1PFBA 5E3FA 1LTGD 3NTHA 1YEZA 4LF5L 2IX3A 1F9QA 1O7YA 1CQVA 2AWNA 1AEXA 4BWGB 3HEJA 4KHZA 3FKIH 5CR3A 2IY5B 3TEHB 4F87A 4P71A 2VQEL 3K7UC 2HHHL 1NR2A 1RIPA 3Q22A 2UUAL 3PCOB 5M3FH 4CBVA 2K05A 5C0XJ 2RA4A 1WJJA 3D3RA 1K0SA 3STBD 4R4TA 1S5CD 4I65A 2JA7B 2ES2A 5ELEA 3RN5A 3PO2H 2HDMA 1K3RA 3J81E 1DOMA 1QB5D 4GKJL 1A3UA 1PRTD 1QUQB 3I4LA 2R92G 3NQTA 5IOCA 4FYDA 2NVYB 2RDHA 5HGQA 3MVVA 1VQGA 3PQIA 4FO2A 5KNDA 3GTGB 2C9OA 3I72A 4JI0L 5JJIA 2K75A 4XTCS 1AH9A 1HPCA 1VQ5A 1S5DD 3K8AA 1F2YA 3MXNB 2XSCA 4FXDA 2NBFA 4NXNQ 2IPKD 1FGUA 4A3GB 1EEFD 2VXWA 2VNUD 2E2IB 1JWMD 3AMUA 2JA5B 4QL5A 1I50H 5M9OA 1PRTF 3KFUA 5KGUA 4HCSA 4R4QA 4A3EH 4HEDA 4WJ4A 2WKDA 3C46A 3HOYB 1NJIC 1EY7A 1ILPA 1AFPA 3I4MG 4UHVA 1E2ZA 3Q0AA 3HOUH 3VYUA 4PZ7A 3SDZA 1W2BA 4PNYA 4XQJA 1I4HA 1BCPC 1HFGA 1OXXK 2RSOA 3BVZA 1BXTA 2DY7A 1HUMA 1WTWA 2SNMA 4DR5L 2JA6B 1DOLA 1ESFA 2A74C 1YITA 4QY7A 1QNKA 3H0GH 5FLXE 1MHWC 4X64Q 4GLXA 5M5YB 5DNFA 4B9XA 2YTXA 2BCOA 3UI2A 3TDQA 3GTJH 5CYUA 3K5NA 3ZYYX 1CHPD 4NXMQ 1STYA 1WTQA 4JI3Q 4LF9Q 5DLQE 1JE4A 4A93B 2EY6A 3S2DB 4Y7NB 1TWHB 4HTHA 1XNQQ 4DV5L 2BE5C 3TP5A 3I3CA 1WTXA 3PO3G 4B3RQ 4C3JH 4KV6A 4KKSA 2HQEA 2VY3A 2F0WA 2G9DA 2ZM6Q 4HCEA 3D4WA 2XWJB 4POFA 5IP9H 4HSPA 5KYIA 5ELDA 5FOBB 4ZLTF 4MNOA 2AQ3B 2PCFB 5G3LF 1DZ1A 2NTTA 4QIWE 5IWAL 1K83H 3I7FA 1VQIA 3QJYA 5JPMC 3UDGA 4AYBG 1NMGA 1SE3A 2PO4A 4YCUA 4XQNA 2D9UA 1S5BD 1VDZA 4BY1B 1VQNA 1TWFB 4CJ2C 3VA7A 1PH3A 1O7LA 2JEBI 4QMGA 2JN4A 4C2MH 3G48A 1AE3A 3QWNA 5ELCA 1MJEA 1E0BA 4I7ZC 2EXZA 4RMFA 3W2DA 4LWCA 3DLLA 3CC7A 2UXDQ 4LFCQ 1B8AA 2GA4B 2UU9L 2H5XA 3SXHA 4LJZC 1BQQT 1BF4A 3NE5B 1V9PA 2R7ZB 1B2TA 2EYHA 1YHAA 4UAIA 2FXQA 3E0JA 4LF7L 2K52A 4K2LA 3MA2B 3UDIA 1Q3LA 1WTRA 1WVLA 2OT2A 2LXKA 2XRQD 2CFMA 5JJZA 3JC66 4XIGS 4P75A 1L2FA 3KDFA 2XVSA 4LMQD 4KN7C 1GUGA 4RKBA 5JJLA 1E7ZA 1HZBA 4DV7L 3CQZB 1K9MC 1I6VC 1UWVA 1LTSD 4A3FB 5IE8A 4HSVA 1C8CA 3I73A 1B44D 1FD7D 4TQUS 1D2BA 5I6YA 2EY1A 4IOCA 1PA6A 2Z0SA 4BS9A 1CHQD 2BA1A 1N34Q 1IW7D 3E0EA 2K5HA 2EYLA 2JA7G 3KUPA 4DNRB 1X3EA 1CKOA 2CQOA 4DKAC 2OQ0A 2A8VA 3K0XA 1A62A 4WJWA 3U9SA 1TS3A 4JYAL 3HOZB 3ITPA 4A3CH 4OWTB 2V1CC 1EIYB 1Y8NB 1F9SA 4KMUC 5C3WA 2E5LL 1SE8A 1K0RA 4JI5Q 1HR0W 1BDOA 3SK5A 3BVMA 4JI7Q 2Z6KA 3SHLA 2LY7A 1VQPA 2KBNA 1H9RA 3GDEA 2JA5G 2BDNA 2F0JA 4DR3Q 4EQPA 4JI1L 4DUZL 3T4AC 5C0XG 1YI2A 2F0NA 1XMOL 1DM0B 2K32A 1RTOA 1QCBD 3M85A 4A3KH 3G4SA 2VB3X 1HRJA 3AB9A 2J4XA 3HKZB 4K5WA 4NW2A 1OO9B 1EQVA 1HNXL 1Q8IA 3TBIB 3BDCA 3SK4A 1PTOD 4KKTA 5LMNQ 2VZAA 5M3MB 2JA6G 1PXUA 3G71A 3MXUA 3NQIA 2Z6BA 3H6MA 3HRZC 4DV1Q 1O80A 3I4NH 1X6OA 3K57A 4POGA 2HIXA 3I8ZA 1IKLA 3MEFA 3TZUA 3I56A 1CI3M 1EIFA 2DN8A 2D5DA 3BZCA 1C9OA 4TSSA 4A93G 2RF4A 1EL0A 1GD7A 1EFWA 1IBKL 1EUJA 1U4MA 2IX1A 1K8GA 4B3SQ 1STGA 2SOBA 4X62Q 1I3QH 1R9TH 1PH8A 1N33Q 5C4ZA 1VF5C 4FF1A 1GHJA 2EYOA 5JAVA 1RDPD 2L0CA 4DK0A 5CV9A 1SYGA 4LAAA 2F0KA 3S1NB 2EYMA 4IPHA 2NVQB 4GNXA 4DU9A 2NN6H 4BA1I 1IBML 2TSSA 1JQYD 1EU3A 4KY7A 3TSSA 4R9WA 2MPMA 1ASZA 4DR4L 4XQQA 1U4PA 5IODA 3H94A 4DR2Q 2B2YC 2UXCL 5LL6X 2LMCB 1O7ZA 3F2CA 5E4WC 3I70A 1PRTB 1DJRD 4ZYSA 4G7HC 3I55A 1U4LA 2RDFA 4DV0Q 4IFDG 4DR7Q 1RF2D 4GN5A 1FVIA 4IJHA 4V0BA 5I4DA 3ICEA 1ZKOA 4RFBA 5JEAH 2R7ZG 5AJ3Q 5CBAE 3IAYA 5FLMG 1ZYRC 4B3TL 3F1ZA 3GTMB 4XYQA 3EBEA 2KCMA 4LFAL 1I4RA 5GAEC 5K36H 4FNFA 2K5WA 5LHY1 3T1YQ 4BBSG 4A76A 1SMYD 3A8KE 4DAVA 1WCMG 3VR4A 5CC4A 4KHPL 1HZAA 1HNZQ 4RKLA 4QQBX 1I6HB 4MIUA 1O78A 3P1HA 2OWOA 2N8NA 1X3GA 4ME3A 2HDLA 3R8BA 2F0DA 4E6IA 3HOVB 2ICEC 1LTLA 4L5RC 4A3FG 1EZ8A 5F2DA 1IYVA 5KRUA 3UE0A 5KIXA 2KCTA 1VMCA 3FDTA 5E7NA 5EPLA 4UP8A 3SGIA 5C4XB 4HR7B 2MNAA 4LFBL 1L1OA 2NZ1D 3JAMi 2PQEA 5IGGA 2CW0D 1LTID 1PH4A 2UUAQ 4KKUA 2F0LA 3D6CA 3PUYA 1KTKA 1CT1D 5EQ0A 3CCUA 3OW7A 2HUGA 2OF1A 2VUMB 1Z47A 4MN3A 4ZUJA 3HOWH 5A35A 3A55A 2XTIA 4HMJA 4G7OC 1T5EA 4IQZA 4JI8Q 2EOTA 4DXFA 4H0LC 3T56B 3VYRA 1RODA 1KNAA 1STNA 4JBWA 1J9OA 3J7YW 4OO1G 1HNWQ 5FJ8G 3RR5A 1BBWA 3RZDB 1STBA 1M90C 5IP7H 1Y8OB 2DNCA 2R92B 3JAMc 2KOLA 1GUOA 1QWYA 2D0PA 4JI2Q 2AKWB 2EYJA 1VQBA 2MJ8A 3CHBD 1NR4A 4A3MG 4GOPC 3HKZG 1LT4D 2KECA 3H09A 4DV3L 1EY5A 1CKMA 4DV2Q 5M3MG 1XXGA 3U4ZA 4C3IH 3VDYA 3EFXD 3K0YA 2O5IC 1WTOA 5CBEE 5NUCA 3M4YA 4OX9L 1K73C 4LUOA 4PQXA 3HS0C 1HA6A 3DM1A 1X32A 2Q8RE 3KF6A 2RCFA 4YHHQ 4AQYQ 3DM3A 1YBYA 2F52A 1XPOA 1F77A 4ZKBB 3I4MB 4FF4A 5CV6A 1GHKA 4JBJA 1EQQA 3O13A 5A2QE 1WD1A 5IT9c 1IBLQ 1RD9D 1UE5A 2ZXOA 1T5XD 2MHVA 2UXBQ 5BR8L 1FJGQ 5KEEA 1D7QA 2B63G 3MHBA 3JAML 4EX5A 2XN9C 4GLAC 1TWCH 4OGQC 3Q24A 3CCLA 4OO1I 3IKJA 4WORA 2UUCQ 1R4QB 1EYDA 3PUXA 4CJ0B 1PFMA 1YNNC 1V1QA 3S17B 3RZOH 1XNRL 2VQFQ 4ZAIA 1F9PA 2K5QA 1CZGA 2JK8A 1DYQA 1PV4A 3FPUB 3OWFA 4DAYA 5ELBA 3VR2A 3M3YH 3MC0B 1NCVA 1RTNA 2B39A 4RGMA 3PO3B 2E2JH 5FK9C 1KHIA 1EWHA 4ZQ3A 4HJAA 1VQ6A 1D8LA 3BYTB 3RLNA 1R4PB 4OWWB 4L5SA 1HR0Q 5IT9L 1PZID 2XRSD 2HQLA 1EU4A 2PW5A 4APVA 4V190 1LT5D 1BCPD 2K50A 3L9AX 3R2TA 1SE4A 1Z7TA 5CMDA 5IGFA 4AYBB 1GUTA 1JB3A 3U4VA 2WACA 4DPGA 4IZ8A 1PH9A 2CCZA 3HOXH 2PMZE 4LF7Q 3HOVG 1BUVT 1SLJA 4IUTA 3J7ZC 1BCPF 2ICIA 4OWXB 1OXTA 2JE6I 4YY3L 4A4IA 2ZTDA 3IFTA 2PNRC 4F8MA 2JA9A 4IPCA 2BE5D 3RLOA
chains in the Genus database with same CATH topology
4H7BA 3X3NA 2K03A 2RVLA 4A3BB 3HOUB 2V4DA 1SFOB 1D1IA 1EZ6A 4UDUC 1I4PA 4J6HA 4ILWA 3MXGA 1XX8A 2SDFA 3LX0A 3NXWA 4IUNA 1TWGB 2WV6D 4ME5A 1V8QA 5COYA 1CM9A 3CKIB 1CA6A 1H9SB 1TQOA 4IN3A 2AUJD 2KUMA 5EPJA 1I4QA 2E74C 4J1MA 1GXDC 4FP5D 1G2SA 3S1MB 3QG1A 4CKEA 2AQ1B 1FR3A 3NP8A 3SK6A 2E76C 3BDLA 1VF7A 3MXNA 3RUZA 3MFGA 1B50A 5EJWA 2B2WC 5FO8B 4XT3B 2BDOA 1LTTD 2PZTA 3DEOA 2J7ZA 4CHTB 1EEID 1CFMA 2B8FA 2A6HC 5EKIA 4GZYC 3K6OA 1EY6A 2Y0SB 2ENBA 2EVBA 3GTPB 1EIGA 2R6GA 1PTOH 2O5JC 3RD4A 3S1RB 3NK9A 1JCKB 1ESRA 4FVMA 4KTAA 1LT3D 5AFWA 4OL7A 1IKMA 1M4VA 2YU9B 3S2HB 5KNBA 5G3LD 4QCLA 2B2TC 4R8NA 1PYWD 4L63B 4IFDJ 2FJ2A 1BNZA 3WOEA 3GV3A 3KK7A 5C3XA 2QDBA 1HCZA 1HFNA 3GTQB 1V1PB 3V96A 3OIQA 2KJXA 1PDQA 2H1EA 2MUYA 2CVRA 3A7AB 2O2LD 4PMCA 3NPPA 2KCCA 3K5LA 2Z4HA 3W3AA 3TN2A 3FVQA 1HQRD 3QOJA 3C3LA 3D8GA 5E4XA 3S1QB 4K8IA 1B1ZA 3FRPB 1LTRD 3PUVA 5FLXL 3OMCA 5C0XH 1RJTA 4QIWB 2B2UA 3M4OB 1L0YB 1ENFA 1LO5D 2QILA 2TMPA 2X6LA 2B2VC 4BBSB 4A3IB 5BN3A 2YYZA 4CGYB 2JEAI 1WCMB 3E6ZX 2ZXPA 3BG3A 2VB2X 5J1ZA 2M9VA 1JICA 1A3TA 1JC7A 4ABNA 2A68C 2I46A 1W6JA 1JWSD 4NDXA 5M5WB 4DXGA 5TSSA 5FO9B 1ZEQX 1QG7A 4C1NI 3S16B 1X3QA 5C4HA 1SNQA 2FINB 2HCIA 1F2MA 4NMZA 4KY5A 1JOQA 1E2VA 5IGCA 2WP8J 1SYCA 3TP8A 1SYEA 1A2TA 1H9KA 2EE1A 1MGSA 2E2HB 1PZKD 4FXKC 4KY6A 3NHHA 3H91A 1ZYRD 3PUWA 5D3DA 1D5MC 1AZQA 2DY8A 2XIWA 4RHRA 3K7AB 4X3UA 2MP1A 1QJOA 5FKAC 1SBBB 1TY0A 2EYFA 3T51B 3MEHA 3K5OA 3MTSA 4A3DB 4ZUIA 3T53B 1KLUD 3BVGA 5HGTA 4A3MB 3G7LA 3PV0A 1BCPB 4A3JB 2EY5A 1VCIA 3FMCA 5M5XB 2FMMA 1F2ZA 3OOCA 5BN5A 3VYTA 1WTVA 4Z9CB 3S14B 1EYCA 3OMGA 4DFAA 4BBRB 4K5XA 2AQ2B 2QKIC 3GTOB 4KD3A 1GUWA 1Y1WB 2EJFC 2WB1B 1I4GA 2B63B 1SJED 5C44B 2L55A 3EQLC 3IL8A 3MXPA 2D2CC 4K14A 4DNTB 1JOOA 1A3VA 3NTIA 1Y1VB 2JXMB 4DN4M 2A69C 3GTLB 4Q0FA 2RSNA 1D1KA 1DONA 3DHQA 1G8ZD 2JP1A 2FFKB 1UUPA 3TMEA 2SNSA 3KLSA 4OIJA 4P2CB 3NTKA 3P75A 2PZUA 2K28A 3WOFA 5CV7A 1OXVA 2A73B 3SR1A 1KAAA 1EY9A 1SYBA 4PMWA 4HMIA 3KBGA 4XDXA 4RWSC 3NSWA 5JPNC 1PZJD 3J80E 3SE0A 3S9WA 3SEBA 1KDAA 1CQFA 3D6WA 1Q1EA 1YNND 4X3TA 1L0XB 4F88A 1DD2A 4ZKCB 1UAPA 2NB0A 3BDOA 1QNUA 4HN7A 2BOSA 1PFNA 1VMPA 1NAPA 2MGSA 1IL8A 1A15A 3GP7A 2K01A 2F1MA 2F0QA 2EDGA 5C4JB 5IIFA 4C3HB 1GOZA 4NP5A 4IUUA 2IL8A 3J7AF 4RGOS 2EY2A 2NN6G 3ND9A 3R93A 4BA2I 3S15B 1CA5A 1LT6D 4M1UB 2NWGA 5BN4A 3MAQA 5C6AA 3JAME 1ICWA 1FGBD 4TKOB 3A54A 5I9OA 3P20A 4OHJA 1W6KA 1B3AA 5C3EB 1XTCD 5ISRA 5JEAG 4K2KA 5EPKA 5E1FA 5CV5A 1XWEA 4ODGA 2CHBD 4KHVA 1SEBD 3K5MA 3VA5A 4FXGC 2X69A 3CU7A 2F0PA 1CZWA 1M8AA 5IT9E 1TS5A 1ZXTA 5DEHA 1LTBD 1ENAA 1H9JA 2ZT9C 3DWAA 4QF4A 2NN6I 2R93B 4RGNA 1HXYD 2NYZD 2E75C 2AUKA 4EQOA 3FKIB 3GO5A 4MHEA 3VR6A 1NUCA 3PIP3 1EOTA 4O42A 3L3OC 5M3FB 4PV1C 1U4RA 2OEOA 1EWCA 1Q90A 1SNPA 4EVOA 1CTMA 2KQ3A 3PO2B 2A6HD 2B2YA 5A2QL 2F0SA 4M8AA 4DK1A 1KDBA 1EQTA 3LWEA 1MSGA 2JYOA 3LNNA 3WDNA 1SNCA 4DGZA 4RHSA 1UNSA 5I2XA 2A6EC 1LLRD 1LTAD 2L9HA 1RHPA 3MWYW 1EY8A 1EIHA 1SE2A 5D65A 5DAUA 4C3IG 3Q23A 3HP3A 1I50B 1E2WA 4KN4C 1HUNA 4A3EB 4WRDA 4C1NK 1HTPA 3K58A 2HCCA 4RAUC 2SEBD 2F0VA 3PIO3 1SYFA 5DM73 1MD2D 2H4OA 3QIAA 4QUFA 2KEDA 5FO7B 2PMZB 1V43A 3T16A 2Q8IB 1B53A 2N88A 2F0HA 5IGEA 3H0GB 2RKSA 5DM63 4C3HG 3GTJB 1DCZA 3A56A 3N6RA 3NWSA 1SJHD 1YNJC 3DXJC 1MSHA 1RCVD 2PYKA 4KJNA 5EGTA 1D5XC 4X3SA 2XNAC 1MI2A 3NWTA 5J39A 4L6TB 1SAPA 1ILQA 3BS1A 1Y69U 2QCPX 3OHXC 1H9SA 3X3MA 4C3JB 1S5ED 3PMFA 3NBIA 1G6ZA 1SNDA 5I2YA 3IFDA 3C1FA 4HAEA 2ID0A 1TKWB 4NKLA 4TRDA 1WTPA 1K83B 5J22A 1TT2A 3FPPA 2F0FA 4K6DA 2A68D 2WIIB 4FF2A 3KF8A 2RBMA 1Q1BA 2F0IA 4C2MB 2NTSA 3U9OA 4EGVA 2O4XA 4U673 1LV9A 4ID6A 1U9RA 2OXPA 3J81L 1EFID 1Y8PB 3FEWX 2L4NA 3L7ZC 2PPBC 1TY2A 2QEJC 2C5CA 5C5MA 1DXMA 4FF3A 2FMCA 3EJIA 3VYSA 1A6XA 5IGBA 2R3ZA 1TR5A 1SYDA 2IW3A 5CORA 3R2IA 5JVG3 2IJ0A 2J0TD 5T1GA 3F2UA 1A2UA 2L1BA 1V1PA 2F0GA 5K5PA 1DOKA 1CK1A 1J8IA 4IURA 3I90A 1FNVA 4J8QA 2K04A 1STAA 3DUZA 3K59A 1IHZA 3C2PA 3SVMA 2F4IA 4DA2A 1PRTC 1HQMC 3CRLC 3D4DA 4A3KB 1GUSA 4KI0A 2LKVA 3BYYB 1F2LA 3A8IE 4U68A 1ONLA 1AW7A 1EY4A 3ERQA 1GJXA 5ELFA 4DF7A 2D62A 2A69D 3I4NB 2JSOA 3EVQA 4IUPA 2E2DC 1QOHA 3V05A 2I07B 4XT1B 5CV4A 2M00A 4K8JA 4OIKA 1ML0D 1RKNA 1I3QB 1BO0A 1R9TB 1KNEA 1BOSA 2Z1CA 4C3JG 1FNUA 1AN8A 4KK7A 3ONAB 3V2TA 5JEAJ 3R3OA 3MZ5A 2PW7A 4EQNA 1SSOA 4JK1C 3J7AV 1LACA 2B8GA 4K5VA 4DAPA 4IFDH 1FNWA 1QE6A 3DWPA 2DNEA 2RDGA 3VR3A 4QUCA 1SNMA 1ET6A 2LS01 4IALA 2KEEA 1Q12A 2B2WA 2KCNA 4G7ZC 1SDFA 2PZWA 1IYUA 1STEA 2K7VA 1HHVA 2KHSA 3QOLA 1B9NA 2EJGC 3C1EA 1G2TA 3OPOA 2F0MA 1EY0A 5I9PA 2QF7A 2NUCA 3TP7A 1MBYA 2ZXRA 1WD0A 3HZXA 1PTOF 5CGKA 4BY7B 2B2TA 4CJ1B 1EYAA 1C48A 3H3VC 1JR0D 2CQAA 1QILA 2M2LA 4KJOA 3N52A 3GV6A 1BR9A 2BA0A 2K1BA 2FHTA 2L11A 3SK8A 4S3SA 1XYIA 1STHA 3AU7A 2NVTB 2F0EA 5C0XI 4OO1H 3HOWB 1AP0A 3D31A 2IX0A 1G91A 1FYCA 4O1NA 1NSNS 1G291 2IT1A 2WKCA 1IW7C 5T1IA 2RQXA 1JOKA 2EJMA 4PMBA 4IUVA 3NUCA 1K8OA 4QB4A 2A5HA 1S4ZA 2F0UA 4XYOA 2EPBA 4WFN3 1C4QA 4RCOA 4C3IB 2B2VA 1TS4A 3TZDA 4R8IA 4LK1C 1UEAB 1TVXA 1SNOA 1ET9A 3EA6A 2F0OA 1D5ZC 1SXTA 3URYA 1II3A 4L8JA 5I6WA 5C5LA 4N9PA 2KA7A 1PTOC 1V1OA 5EBCA 1TS2A 3DEPA 2EYPA 3MFYA 5EBDA 2AWOA 1TWCB 1F9RA 5D3IB 3CRKC 2F0TA 4ULLA 3OSOA 3RZOB 2A6ED 3A7LA 3GD7A 1K8MA 3HGBA 3J80L 1JORA 4IFDI 2N55A 3RLFA 3M3YB 2LFNA 3ND8A 3OIPA 4G4KA 4RGTA 1H9MA 3Q6SA 3LWUA 2E2JB 3D4RA 2L12A 3M7GA 3TP6A 1Z6HA 4ZK9B 4KD4A 2Q8TA 1PMRA 3P7JA 4CKBA 5CV8A 3NBHA 4F7XA 3GQBA 3HG9A 4IUQA 4H44C 5K36G 4G57A 3KBXA 3OWEB 5LL6S 3A8JE 2G9HD 1KLGD 3E5SA 5D14A 3HOXB 3EROA 5IGDA 5JVH3 1D6EC 3QO2A 2F03A 1YNJD 2K6AA 4K6LA 3QB3A 2K5DA 4YIJA 3M7NA 4XXEA 5KYLA 4RCNA 1SMYC 2F3VA 3I91A 3KLRA 1OXUA 5JOBA 4C56C 5EKLA 2K33A 3RMHA 3PUZA 2IWHA 2Z4IA 1KDCA 2X6GA 2WINB 4X3KA 2JA8B 2NVXB 1TU2B 1B9MA 3KLSX 1JWUD 2CW0C 3VR5A 3DWQA 4B9WA 1S5FD 2WAQB 1X3PA 1AZPA 4Q5VA 5KNCA 1HTLD 1TIID 1I4XA 4N9TA 4RH6A 1HA5A 3G6JB 4RA8A 1KABA 2B2UC 3BZDB 1TWAB 5EKKA 4CKCA 5HURA 1ENCA 1B4OA 2EZVA 2F3WA 1PLFA 2L5TA 3GTKB 2Z8LA 4H13C 4ZRZA 3DMUA 4B08A 1OXSC 2R61A 3T13A 1PTOB 2XWBB 1GUNA 2KVMA 1BBXC 1LABA 1PFBA 5E3FA 1LTGD 3NTHA 2IX3A 1F9QA 1O7YA 1CQVA 2AWNA 1AEXA 4BWGB 3HEJA 4KHZA 5CR3A 4F87A 1NR2A 3Q22A 4CBVA 2K05A 5C0XJ 2RA4A 3D3RA 1S5CD 4I65A 2JA7B 5ELEA 2HDMA 3J81E 1DOMA 1QB5D 1A3UA 1PRTD 3I4LA 3NQTA 5IOCA 4FYDA 2NVYB 2RDHA 3MVVA 4FO2A 5KNDA 3GTGB 2C9OA 3I72A 4XTCS 1HPCA 1S5DD 1F2YA 2XSCA 4FXDA 2NBFA 2IPKD 4A3GB 1EEFD 2VXWA 2VNUD 2E2IB 1JWMD 3AMUA 2JA5B 5M9OA 1PRTF 5KGUA 4HCSA 4HEDA 2WKDA 3C46A 3HOYB 1EY7A 1ILPA 1AFPA 1E2ZA 3Q0AA 3VYUA 3SDZA 4PNYA 4XQJA 1I4HA 1BCPC 1HFGA 1OXXK 2RSOA 3BVZA 1BXTA 2DY7A 1HUMA 1WTWA 2SNMA 2JA6B 1DOLA 1ESFA 2A74C 1QNKA 5FLXE 5M5YB 5DNFA 4B9XA 2BCOA 3UI2A 3TDQA 5CYUA 3K5NA 3ZYYX 1CHPD 1STYA 1WTQA 1JE4A 4A93B 2EY6A 3S2DB 4Y7NB 1TWHB 4HTHA 2BE5C 3TP5A 3I3CA 1WTXA 4KV6A 4KKSA 2HQEA 2F0WA 2G9DA 4HCEA 3D4WA 2XWJB 4HSPA 5KYIA 5ELDA 5FOBB 4ZLTF 2AQ3B 2PCFB 5G3LF 1DZ1A 2NTTA 3QJYA 5JPMC 1SE3A 2PO4A 4XQNA 2D9UA 1S5BD 1VDZA 4BY1B 1TWFB 4CJ2C 3VA7A 1O7LA 2JEBI 4QMGA 3QWNA 5ELCA 1E0BA 4I7ZC 2EXZA 3W2DA 2GA4B 3SXHA 4LJZC 1BQQT 1BF4A 3NE5B 2R7ZB 1B2TA 2EYHA 4UAIA 3E0JA 4K2LA 3MA2B 1Q3LA 1WTRA 1WVLA 2OT2A 2XRQD 5JJZA 4XIGS 2XVSA 4LMQD 4KN7C 1GUGA 4RKBA 3CQZB 1I6VC 1LTSD 4A3FB 4HSVA 1C8CA 3I73A 1B44D 1FD7D 4TQUS 1D2BA 5I6YA 2EY1A 4BS9A 1CHQD 2BA1A 1IW7D 2EYLA 3KUPA 4DNRB 3U9SA 4WJWA 1TS3A 3HOZB 3ITPA 1Y8NB 1F9SA 4KMUC 5C3WA 1BDOA 3SK5A 3BVMA 3SHLA 2LY7A 1H9RA 2BDNA 2F0JA 4EQPA 3T4AC 5C0XG 2F0NA 1DM0B 2K32A 1RTOA 1QCBD 3M85A 2VB3X 1HRJA 3AB9A 2J4XA 3HKZB 4K5WA 4NW2A 1OO9B 1EQVA 1Q8IA 3TBIB 3BDCA 3SK4A 1PTOD 4KKTA 5M3MB 1PXUA 3MXUA 3NQIA 3H6MA 3HRZC 1O80A 3K57A 3I8ZA 1IKLA 3TZUA 1CI3M 2DN8A 2D5DA 4TSSA 1EL0A 1U4MA 2IX1A 1STGA 2SOBA 5C4ZA 1VF5C 4FF1A 1GHJA 2EYOA 5JAVA 1RDPD 2L0CA 4DK0A 5CV9A 1SYGA 4LAAA 2F0KA 3S1NB 2EYMA 2NVQB 4DU9A 2NN6H 4BA1I 2TSSA 1JQYD 1EU3A 4KY7A 3TSSA 4R9WA 2MPMA 4XQQA 1U4PA 5IODA 3H94A 2B2YC 5LL6X 2LMCB 1O7ZA 5E4WC 3I70A 1PRTB 1DJRD 4ZYSA 4G7HC 1U4LA 2RDFA 4IFDG 1RF2D 4V0BA 5I4DA 1ZKOA 4RFBA 5JEAH 5CBAE 3IAYA 1ZYRC 3GTMB 4XYQA 1I4RA 5K36H 4FNFA 2K5WA 5LHY1 1SMYD 3A8KE 4DAVA 3VR4A 5CC4A 4RKLA 1I6HB 4MIUA 1O78A 3P1HA 2HDLA 3R8BA 2F0DA 4E6IA 3HOVB 2ICEC 1EZ8A 5F2DA 1IYVA 5KRUA 5KIXA 1VMCA 3FDTA 5EPLA 5C4XB 4HR7B 2NZ1D 2PQEA 5IGGA 2CW0D 1LTID 4KKUA 2F0LA 3D6CA 3PUYA 1KTKA 1CT1D 5EQ0A 3OW7A 2HUGA 2OF1A 2VUMB 1Z47A 4MN3A 4ZUJA 5A35A 3A55A 4HMJA 4G7OC 1T5EA 4IQZA 2EOTA 4DXFA 4H0LC 3T56B 3VYRA 1RODA 1KNAA 1STNA 4JBWA 1J9OA 3J7YW 4OO1G 3RZDB 1STBA 1Y8OB 2DNCA 2R92B 2KOLA 1GUOA 1QWYA 2EYJA 2MJ8A 3CHBD 1NR4A 1LT4D 2KECA 3H09A 1EY5A 1XXGA 3EFXD 3K0YA 2O5IC 1WTOA 5CBEE 5NUCA 3M4YA 4PQXA 3HS0C 1HA6A 3DM1A 1X32A 2Q8RE 1F77A 4ZKBB 3I4MB 4FF4A 5CV6A 1GHKA 3O13A 5A2QE 1WD1A 1RD9D 2ZXOA 1T5XD 2MHVA 5KEEA 3MHBA 3JAML 2XN9C 4OGQC 3Q24A 4OO1I 3IKJA 4WORA 1R4QB 1EYDA 3PUXA 4CJ0B 1PFMA 1YNNC 3S17B 4ZAIA 1F9PA 2K5QA 1CZGA 1DYQA 3FPUB 3OWFA 4DAYA 5ELBA 3VR2A 3MC0B 1NCVA 1RTNA 2B39A 4RGMA 3PO3B 5FK9C 4ZQ3A 1EWHA 3BYTB 1R4PB 5IT9L 1PZID 2XRSD 1EU4A 2PW5A 4V190 1LT5D 1BCPD 3L9AX 3R2TA 1SE4A 1Z7TA 5CMDA 5IGFA 4AYBB 1GUTA 1JB3A 2WACA 4IZ8A 1BUVT 4IUTA 1BCPF 2ICIA 1OXTA 2JE6I 3IFTA 2PNRC 4F8MA 2BE5D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IGC A;  1SNC A;  5JOB A;  5I6W A;  4H7B A;  5C5L A;  2F0M A;  2F0N A;  4N9P A;  4DGZ A;  4I65 A;  5EKL A;  1EY4 A;  1EY0 A;  2RBM A;  2F0I A;  1SYC A;  3TP8 A;  5CV6 A;  3ERQ A;  1SYE A;  1A3U A;  1A2T A;  3U9O A;  5I9P A;  5C6A A;  2NUC A;  1EZ6 A;  3NQT A;  2EYP A;  2O4X A;  3DHQ A;  4R8N A;  1KDC A;  3TP7 A;  1EY8 A;  4DF7 A;  5IOC A;  5CC4 A;  5I9O A;  4KY6 A;  3MVV A;  4RKL A;  4K5W A;  3HZX A;  1EQV A;  5DAU A;  3TME A;  5KEE A;  3NHH A;  2SNS A;  4MIU A;  3P1H A;  4ID6 A;  1U9R A;  2OXP A;  3BDC A;  4QMG A;  5CGK A;  3SK4 A;  3MHB A;  3P75 A;  5C3X A;  2QDB A;  4J6H A;  2F0T A;  1EYA A;  3EVQ A;  1F2Y A;  1II3 A;  2F0D A;  2PZU A;  4WRD A;  3OSO A;  4E6I A;  3LX0 A;  3NXW A;  2EXZ A;  5ISR A;  4IUN A;  4K2K A;  1EZ8 A;  5F2D A;  5E1F A;  2F0V A;  4KJO A;  5CV7 A;  5CV5 A;  3SXH A;  1JOR A;  4B9W A;  3SR1 A;  5KRU A;  1SYF A;  2EYF A;  1KAA A;  1EY9 A;  1SYB A;  3H6M A;  4ODG A;  5CV4 A;  4WOR A;  5KIX A;  5M9O A;  5C5M A;  2M00 A;  3MEH A;  4K8J A;  4ME5 A;  4HMI A;  3SK8 A;  1JOQ A;  5KGU A;  4KHV A;  1EYD A;  2EYH A;  4PMC A;  4ZUI A;  4S3S A;  1TQO A;  1STH A;  1RKN A;  2F0E A;  4K2L A;  3VA5 A;  4N9T A;  1EY7 A;  2PQE A;  3T16 A;  3QOJ A;  5HGT A;  5IGG A;  3D8G A;  3TP6 A;  3S9W A;  3OWF A;  4J1M A;  4K8I A;  3EJI A;  2F0H A;  2F0L A;  2F0P A;  3D6C A;  4KD4 A;  1KDA A;  3V2T A;  1KAB A;  5IGB A;  1TR5 A;  1SYD A;  5IGE A;  2OF1 A;  3R3O A;  1NSN S;  3OMC A;  4PNY A;  3MZ5 A;  5CV8 A;  2EY5 A;  2PW7 A;  1STG A;  2SOB A;  4ZQ3 A;  2RKS A;  5EKK A;  4EQN A;  4F7X A;  4ZUJ A;  1F2Z A;  5DEH A;  4RKB A;  1JOK A;  5HUR A;  4HMJ A;  4PMB A;  1ENA A;  1ENC A;  5C4Z A;  2SNM A;  3NUC A;  3NP8 A;  4G57 A;  2EYO A;  2F3W A;  3SK6 A;  5JAV A;  4K5V A;  4QF4 A;  3BDL A;  1A2U A;  1EYC A;  2EY1 A;  5I6Y A;  2PW5 A;  3OMG A;  3RUZ A;  2F0G A;  1STN A;  4QB4 A;  5K5P A;  5CV9 A;  4B9X A;  2F0U A;  2PYK A;  4KJN A;  5EGT A;  1SYG A;  3DMU A;  4LAA A;  4DFA A;  2F0K A;  3E5S A;  2EYL A;  2EYM A;  1STB A;  5J39 A;  4K5X A;  4DU9 A;  3T13 A;  5IGF A;  2PZT A;  3ERO A;  4EQO A;  1SNM A;  5IGD A;  1STY A;  4KD3 A;  4IAL A;  1STA A;  1NUC A;  2EYJ A;  5J1Z A;  4KY7 A;  3PMF A;  3ITP A;  2EY6 A;  5E3F A;  1EY6 A;  1SND A;  2WAC A;  4IZ8 A;  2ENB A;  4HTH A;  1A3T A;  1IHZ A;  5C3W A;  2PZW A;  5IOD A;  2F0Q A;  2OEO A;  1AEX A;  1EY5 A;  3C1F A;  3MXP A;  3HEJ A;  3QB3 A;  3TP5 A;  5CR3 A;  4NDX A;  1SNP A;  4YIJ A;  3NK9 A;  3SK5 A;  4K14 A;  5IIF A;  4KV6 A;  4EVO A;  4NP5 A;  2RDF A;  2HQE A;  2KHS A;  3SHL A;  5KYL A;  1SNO A;  4KTA A;  4NKL A;  4TRD A;  2F0W A;  2KQ3 A;  3D4D A;  3QOL A;  5NUC A;  1JOO A;  5C4H A;  1SNQ A;  1A3V A;  1F2M A;  2EY2 A;  2F0J A;  2F0S A;  2F3V A;  3D4W A;  2F0O A;  4NMZ A;  4EQP A;  4KY5 A;  1KDB A;  4OL7 A;  5J22 A;  4F8M A;  1TT2 A;  3C1E A;  5KYI A;  2F0F A;  2LKV A;  4K6D A; 
#chains in the Genus database with same CATH topology
 4H7B A;  1Q81 C;  4JI6 Q;  1SN8 A;  2DJF C;  2K03 A;  2RVL A;  3X3N A;  3H3V H;  4A3B B;  3IRB A;  3HOU B;  2V4D A;  3J81 i;  1SFO B;  1D1I A;  1EZ6 A;  4DUY Q;  1P8L A;  4UDU C;  4R4O A;  2VUM G;  1NTG A;  2RHQ B;  1I4P A;  1SRO A;  4J6H A;  4ILW A;  3MXG A;  1XX8 A;  2SDF A;  3D0F A;  3NXW A;  3LX0 A;  4IUN A;  1TWG B;  3CCR A;  2I5H A;  4YWK A;  4JI4 Q;  2C35 B;  2WV6 D;  4ME5 A;  1V8Q A;  2JA8 H;  5COY A;  2NVX H;  1CM9 A;  3CKI B;  1CA6 A;  4JW0 A;  1H9S B;  1TQO A;  4IN3 A;  2AUJ D;  1XMQ L;  4IOA A;  2KUM A;  5EPJ A;  3L2P A;  1I4Q A;  2E74 C;  1PH5 A;  1YZ6 A;  2PI2 E;  4J1M A;  4N8X 1;  4LF4 L;  1GXD C;  3EIV A;  4FP5 D;  1G2S A;  1N32 Q;  1QUQ A;  2YTY A;  4GOP B;  3S1M B;  2Y0S E;  3QG1 A;  2Z6K C;  4CKE A;  2AQ1 B;  5C3E G;  1FR3 A;  3NP8 A;  4DR1 L;  3SK6 A;  2E76 C;  2GVA A;  3BDL A;  1VF7 A;  3MXN A;  3PSI A;  3RUZ A;  3MFG A;  1B50 A;  1TWA H;  5JJK A;  5EJW A;  2QDL A;  3KF8 B;  2B2W C;  5FO8 B;  1PFS A;  2ZTC A;  4XT3 B;  2BDO A;  4DR6 Q;  1LTT D;  2PZT A;  3DEO A;  2J7Z A;  4OEM B;  4CHT B;  5H1S E;  1ASY A;  1EEI D;  1CFM A;  2B8F A;  3ERS X;  3GTK H;  2A6H C;  5EKI A;  4GZY C;  3K6O A;  1EY6 A;  2Y0S B;  2ENB A;  2EVB A;  3GTP B;  1EIG A;  2R6G A;  1PTO H;  1IL2 A;  2O5J C;  3RD4 A;  3S1R B;  3NK9 A;  1JCK B;  1ESR A;  4FVM A;  4KTA A;  1A0I A;  1LT3 D;  5AFW A;  1O7I A;  4GN4 B;  1N36 L;  4OL7 A;  5EAY A;  5FLX c;  4ALP A;  3OW2 A;  4A3L G;  1IKM A;  1M4V A;  4UP9 A;  2YU9 B;  3CME A;  3S2H B;  5KNB A;  5G3L D;  4QCL A;  2B2T C;  4HJ9 A;  1KRT A;  1EWI A;  4R8N A;  1PYW D;  4L63 B;  5IYB G;  4IFD J;  2FJ2 A;  3CF5 A;  1BNZ A;  3WOE A;  2JA7 H;  3GV3 A;  2AHO B;  3KK7 A;  5C3X A;  2QDB A;  1HCZ A;  1HFN A;  3K81 C;  3GTQ B;  2RHS B;  1V1P B;  3V96 A;  4AH6 A;  1HJP A;  1VQL A;  2NVY H;  5LMU L;  1C7Y A;  2I0Q A;  3OIQ A;  2KJX A;  1PDQ A;  3GTG H;  3OTO Q;  3EN2 A;  2H1E A;  3CCS A;  2MUY A;  2CVR A;  3A7A B;  2O2L D;  4PMC A;  1Q82 C;  3NPP A;  3TQY A;  2KCC A;  3K5L A;  1PH7 A;  2Z4H A;  3W3A A;  3TN2 A;  3FVQ A;  4A3G H;  1HQR D;  3QOJ A;  1K8A C;  2E2I H;  2JJQ A;  3D8G A;  5E4X A;  3OYY A;  2JA5 H;  3C3L A;  3S1Q B;  4K8I A;  2OTJ A;  1B1Z A;  4JBK A;  1YHB A;  3FRP B;  1LTR D;  3PUV A;  5FLX L;  3OMC A;  2GVB A;  5C0X H;  1X65 A;  2Z9H A;  4DV6 L;  2PQA B;  3HOY H;  1OTC A;  1J5E Q;  3CCM A;  1RJT A;  4QIW B;  2B2U A;  3M4O B;  4A3E G;  1JJ2 A;  1L0Y B;  2QGQ A;  1L0W A;  4UY8 C;  1GM5 A;  3AFQ A;  1ENF A;  1LO5 D;  2QIL A;  2TMP A;  2X6L A;  2B2V C;  4BBS B;  4A3I B;  5BN3 A;  2JA6 H;  1VQJ A;  2YYZ A;  4CGY B;  4A3B G;  2JEA I;  3HOU G;  1WCM B;  3E6Z X;  2ZXP A;  3BG3 A;  2VB2 X;  5M5Y H;  5J1Z A;  2M9V A;  1I94 Q;  1JIC A;  2B29 A;  1A3T A;  1JC7 A;  5GQO A;  4ABN A;  2A68 C;  3KDF B;  2I46 A;  1W6J A;  1JWS D;  4LUZ A;  2K14 A;  4NDX A;  5M5W B;  4A93 H;  4DXG A;  2LXJ A;  5TSS A;  5FO9 B;  1ZEQ X;  1QG7 A;  4C1N I;  1UE7 A;  3S2D H;  4Y7N H;  3S16 B;  1X3Q A;  5C4H A;  1SNQ A;  2FIN B;  4X65 Q;  2HCI A;  1F2M A;  4NMZ A;  1X3F A;  4KY5 A;  3CW2 C;  1JOQ A;  4LF6 L;  1E2V A;  5IGC A;  4HJ5 A;  2WP8 J;  2CH4 A;  4HIK A;  1SYC A;  3TP8 A;  1SYE A;  1A2T A;  1H9K A;  2EE1 A;  4JC0 A;  1MGS A;  2E2H B;  1PZK D;  2N49 A;  4FXK C;  2Q2U A;  4KY6 A;  3NHH A;  3H91 A;  4P72 A;  1ZYR D;  3PUW A;  5D3D A;  1D5M C;  2ASB A;  1AZQ A;  3Q8D A;  2DY8 A;  2XIW A;  4RHR A;  5IP9 G;  3K7A B;  3CC2 A;  4X3U A;  2MP1 A;  1QJO A;  5FKA C;  1VQ4 A;  1CSP A;  1SBB B;  1TY0 A;  1TWF H;  2EYF A;  3T51 B;  4BY1 H;  2BH8 A;  2OCE A;  4QGU A;  3FHW A;  2L15 A;  2F4V Q;  3MEH A;  3K5O A;  3MTS A;  4A3D B;  4ZUI A;  3T53 B;  1KLU D;  3BVG A;  5HGT A;  4A3M B;  3TS2 A;  3G7L A;  3H15 A;  4B3M Q;  3CXC A;  3PV0 A;  4RG1 A;  2ALY B;  1U5K A;  2Y0S G;  2R7Z H;  1EOV A;  2YTV A;  1BCP B;  4A3J B;  4NXN L;  2EY5 A;  1VCI A;  2WB1 E;  3FMC A;  5M5X B;  2P5Z X;  2FMM A;  4K0K Q;  1F2Z A;  3OOC A;  5BN5 A;  3VYT A;  4LNQ A;  1GKH A;  4JV5 Q;  1WTV A;  4Z9C B;  3S14 B;  1EYC A;  2MQH A;  3OMG A;  1GVP A;  2CKZ B;  1KL9 A;  4DFA A;  4BBR B;  5GRO A;  3CQZ H;  4DNI A;  4K5X A;  4LF8 Q;  4IJL A;  4A3F H;  2AQ2 B;  2EXD A;  2KHI A;  2QKI C;  3GTO B;  4KD3 A;  1GUW A;  1Y1W B;  2B3G A;  1JJC B;  2EJF C;  1UE6 A;  4KLK A;  1N9W A;  4OXP A;  2WB1 B;  1VQK A;  1HZ9 A;  1I4G A;  3F2B A;  2B63 B;  1SJE D;  5C44 B;  4BXX H;  2L55 A;  3EQL C;  3E9I A;  3IL8 A;  4X64 L;  3MXP A;  3I2Z A;  2D2C C;  4K14 A;  4CDE C;  4CDF C;  2HIV A;  3HOZ H;  3U50 C;  4DNT B;  1JOO A;  1A3V A;  1CKN B;  3NTI A;  1Y1V B;  2JXM B;  4DV4 Q;  4JI3 L;  4LF9 L;  4DN4 M;  2A69 C;  1U0L A;  3GTL B;  4Q0F A;  4UPA A;  1XNQ L;  4GKK Q;  4O2D A;  2RSN A;  1D1K A;  1DON A;  1XJV A;  3DHQ A;  1G8Z D;  2JP1 A;  4B3R L;  2FFK B;  1UUP A;  5FJ8 H;  4YCV A;  3TME A;  1VQH A;  2SNS A;  3KLS A;  4OIJ A;  4P2C B;  3NTK A;  1PYB A;  2ZM6 L;  3P75 A;  2PZU A;  3W5O A;  2QA4 A;  4ZCK A;  1KC8 C;  2K28 A;  1DGS A;  3WOF A;  1A63 A;  1Q7Y C;  5CV7 A;  1OXV A;  2A73 B;  3SR1 A;  5IYD G;  1Z9F A;  3T1H Q;  1JJG A;  1KAA A;  1IZ6 A;  1EY9 A;  1SYB A;  3K80 C;  4PMW A;  5IYC H;  4HMI A;  3KBG A;  4JOI C;  4XDX A;  3AQQ A;  4A3I G;  4RWS C;  3NSW A;  5M3M H;  1E1T A;  1WOC A;  2UUB Q;  1WTH A;  3KLW A;  1PZJ D;  5JPN C;  3J80 E;  3SE0 A;  3S9W A;  3A74 A;  3SEB A;  4X6A H;  3HKS A;  1KDA A;  1CQF A;  1A8V A;  1N8R C;  3D6W A;  2UXD L;  4DAM A;  1Q1E A;  1YNN D;  1PHJ A;  2ZTE A;  4X3T A;  1L0X B;  4F88 A;  1DD2 A;  4ZKC B;  3I4N G;  1UAP A;  4BY7 H;  4LF5 Q;  3CCJ A;  3CP0 A;  2NB0 A;  3QR8 A;  3TS0 A;  3BDO A;  4P74 A;  1QNU A;  4HN7 A;  2BOS A;  1PFN A;  1VMP A;  2VQE Q;  2HHH Q;  1NAP A;  2MGS A;  2JQO A;  1CUK A;  3S24 A;  3CD6 A;  1IL8 A;  3HFZ B;  3NEN A;  2NVT H;  1A15 A;  3GP7 A;  2K01 A;  3S1N H;  4GKJ Q;  2F1M A;  2NVQ H;  2F0Q A;  1LUZ A;  2EDG A;  4JBM A;  4MZ9 A;  5C4J B;  3NEM A;  5IIF A;  4C3H B;  1GOZ A;  3CPF A;  4NP5 A;  4IUU A;  2IL8 A;  4JI0 Q;  3J7A F;  4LF4 Q;  4RGO S;  2EY2 A;  1QVC A;  2NN6 G;  3ND9 A;  3R93 A;  4A3D G;  4BA2 I;  1VQ8 A;  3S15 B;  1CA5 A;  1LT6 D;  2R7F A;  4M1U B;  1VQF A;  2NWG A;  1MIU A;  5BN4 A;  3MAQ A;  5C6A A;  3JAM E;  1ICW A;  1AE2 A;  4JI5 L;  3NBH B;  1FGB D;  4TKO B;  3A54 A;  5I9O A;  4A3J G;  3P20 A;  4JI7 L;  4OHJ A;  5L37 A;  3GTM H;  1W6K A;  1B3A A;  5C3E B;  4HIM A;  4DR3 L;  1XTC D;  5ISR A;  5JEA G;  4K2K A;  5EPK A;  2CWP A;  5E1F A;  5CV5 A;  1I6H H;  1XWE A;  4ODG A;  2DUD A;  2CHB D;  4GLV B;  4KHV A;  4DR5 Q;  4BBR G;  3HOV H;  4PG3 A;  2OTL A;  1SEB D;  3K5M A;  3VA5 A;  3KOJ A;  1Y1W G;  4FXG C;  2X69 A;  3CU7 A;  2WB1 G;  2F0P A;  1M8A A;  1CZW A;  4OEL B;  5C4X H;  5C44 G;  5IT9 E;  1N36 Q;  1J6Q A;  1TS5 A;  3ZJY C;  2HT1 A;  2QEX A;  1ZXT A;  2YV5 A;  5DEH A;  4DV1 L;  1LTB D;  1ENA A;  1H9J A;  2ZT9 C;  3DWA A;  4DV5 Q;  4QF4 A;  2NN6 I;  4CDC C;  4PZ6 A;  2R93 B;  1Y1V G;  2VUM H;  4RGN A;  1KD1 C;  1IYJ B;  4GS3 A;  1HXY D;  2NYZ D;  2E75 C;  2AUK A;  4EQO A;  3FKI B;  3GO5 A;  4MHE A;  4B3S L;  3VR6 A;  4X62 L;  1NUC A;  1UEB A;  3PIP 3;  1EOT A;  1VQ7 A;  1KXL A;  2WAQ E;  3HOW G;  1N33 L;  2MO1 A;  4O42 A;  3RZD H;  3L3O C;  5M3F B;  4PV1 C;  5IWA Q;  2R92 H;  1U4R A;  1K3B C;  1TXY A;  2OEO A;  3TRZ A;  1EWC A;  1Q90 A;  4JVZ A;  1SNP A;  2IHE A;  4CDD C;  4EVO A;  1CTM A;  2KQ3 A;  3PO2 B;  2A6H D;  2B2Y A;  1FL0 A;  5A2Q L;  2F0S A;  4M8A A;  4DK1 A;  1JT8 A;  1KDB A;  1EQT A;  3LWE A;  1MSG A;  1Y14 B;  2JYO A;  3LNN A;  3WDN A;  1SNC A;  4R1J A;  4DGZ A;  4RHS A;  2UU9 Q;  1UNS A;  1T9H A;  5I2X A;  3PGZ A;  2G5D A;  2A6E C;  1LLR D;  4DR2 L;  1LTA D;  1KIX A;  1JMC A;  2L9H A;  1RHP A;  3MWY W;  2A19 A;  1EY8 A;  1EIH A;  1YJ9 A;  3B6Y A;  1SE2 A;  5D65 A;  5DAU A;  4C3I G;  3Q23 A;  3HP3 A;  4DV0 L;  1I50 B;  1E2W A;  3I4M H;  4KN4 C;  1HUN A;  4A3E B;  4WRD A;  5AJ3 L;  1PH1 A;  4C1N K;  1HTP A;  3K58 A;  2HCC A;  4RAU C;  1S3O A;  2SEB D;  4OON A;  2F0V A;  3PIO 3;  1SYF A;  4H02 A;  2ZJQ A;  3T1Y L;  4DV7 Q;  5DM7 3;  1MD2 D;  1VQ9 A;  2H4O A;  1W3S A;  3QIA A;  3CAM A;  4QUF A;  2KED A;  1HNZ L;  5FO7 B;  2PMZ B;  1V43 A;  3T16 A;  2Q8I B;  1B53 A;  2I5L X;  2N88 A;  2F0H A;  4X66 L;  2EIF A;  3M4Q A;  4A3L H;  5IGE A;  3S17 H;  3H0G B;  1UE1 A;  2RKS A;  5DM6 3;  1QVG A;  4C3H G;  4JYA Q;  3GTJ B;  1DCZ A;  3A56 A;  3N6R A;  4A75 A;  1WYD A;  4YCW A;  2E5L Q;  5IYB H;  3NWS A;  3PO3 H;  1SJH D;  1YNJ C;  3DXJ C;  1C0A A;  1MSH A;  1X55 A;  1RCV D;  3CCV A;  1LM0 A;  2PYK A;  2XGT A;  4KJN A;  5EGT A;  4DK3 C;  1D5X C;  4X3S A;  3TRE A;  2XNA C;  1MI2 A;  3L0O A;  3NWT A;  5J39 A;  4L6T B;  1SAP A;  3J81 c;  1ILQ A;  3BS1 A;  5GAD C;  1Y69 U;  2QCP X;  3OHX C;  4JI1 Q;  1H9S A;  4DUZ Q;  3X3M A;  4C3J B;  1S5E D;  1YJW A;  3PMF A;  3NBI A;  1G6Z A;  1XMO Q;  4P73 A;  1SND A;  4JI8 L;  4LW1 A;  5I2Y A;  3IFD A;  3C1F A;  4HAE A;  2ID0 A;  4GOP A;  1HNW L;  1TKW B;  1NBW A;  1HNX Q;  4NKL A;  4TRD A;  2K4K A;  3ULP A;  1WTP A;  1K83 B;  5J22 A;  4PZ8 A;  1TT2 A;  3FPP A;  2F0F A;  4J15 A;  4JI2 L;  4K6D A;  2A68 D;  2WII B;  4FF2 A;  3KF8 A;  2RBM A;  1Q1B A;  2F0I A;  4C2M B;  2NTS A;  3U9O A;  2PI2 A;  4EGV A;  2O4X A;  4U67 3;  2ZJP A;  3HOX G;  4DV2 L;  1LV9 A;  2K5N A;  4ID6 A;  1U9R A;  2OXP A;  3J81 L;  4A3B H;  1EFI D;  1SFO H;  3M4P A;  1Y8P B;  3FEW X;  1IBK Q;  4YHH L;  1JB7 A;  2L4N A;  4AQY L;  3L7Z C;  2PPB C;  1TY2 A;  2QEJ C;  2R93 G;  2C5C A;  2VL6 A;  5C5M A;  5J3B A;  1IBL L;  1DXM A;  2F3I A;  2ZJR A;  2UXB L;  1TWG H;  4FF3 A;  1FJG L;  3FKI G;  2FMC A;  3BZK A;  2N78 A;  3EJI A;  3VYS A;  2LSS A;  1A6X A;  5IGB A;  4N8F A;  2R3Z A;  1XPR A;  5M3F G;  1TR5 A;  1SYD A;  1IBM Q;  3BJU A;  1YNX A;  2MO0 A;  2IW3 A;  3E3X A;  5COR A;  3ULL A;  3R2I A;  2KHJ A;  5JVG 3;  4IO9 A;  2IJ0 A;  1Q86 C;  2J0T D;  2UUC L;  1BVS A;  1YJN A;  4DR4 Q;  2JA8 G;  3PO2 G;  5T1G A;  3F2U A;  2VQF L;  4GNX C;  1A2U A;  2UXC Q;  2L1B A;  1V1P A;  2F0G A;  5K5P A;  3S1M H;  2R7D A;  1DOK A;  1CK1 A;  3AEV A;  1J8I A;  4IUR A;  1MJC A;  1PVO A;  3I90 A;  1FNV A;  3F2D A;  1S40 A;  3RNU A;  2WAQ G;  4J8Q A;  3UE1 A;  5IY0 A;  2K04 A;  1XPU A;  3I4O A;  1STA A;  4B3T Q;  1M1K C;  3DUZ A;  2E8G A;  1PH2 A;  3K59 A;  4LFA Q;  2VW9 A;  2RCN A;  1IHZ A;  4AIM A;  3C2P A;  1HR0 L;  3A5Z B;  3STB C;  3SVM A;  4IPG A;  2F4I A;  4KHP Q;  4DA2 A;  2PQA A;  1PRT C;  1HQM C;  3CRL C;  3D4D A;  4A3K B;  3GTP H;  1GUS A;  2DJG C;  3H3V I;  1KQS A;  4KI0 A;  5ELN A;  2LKV A;  3BYY B;  1F2L A;  2I5M X;  4O0A A;  3S1R H;  3A8I E;  4U68 A;  1ONL A;  1AW7 A;  1EY4 A;  1NY4 A;  2CWA A;  3ERQ A;  5GAH C;  1GJX A;  4LFB Q;  5ELF A;  4DF7 A;  2D62 A;  3H0G G;  1VQC A;  2YU9 H;  3S2H H;  2A69 D;  3I4N B;  2JSO A;  1TWH H;  3EVQ A;  3AFP A;  4IUP A;  2E2D C;  1QOH A;  3V05 A;  1L1O C;  2BH2 A;  4R4I A;  4JI6 L;  2I07 B;  1LYL A;  1G51 A;  4XT1 B;  5CV4 A;  1PYS B;  2M00 A;  4K8J A;  4OIK A;  4DUY L;  3GTQ H;  1ML0 D;  1RKN A;  4IPD A;  2QW7 A;  1I3Q B;  1BO0 A;  1R9T B;  1KNE A;  3F8T A;  1BOS A;  1VQM A;  2Z1C A;  3WWV A;  4C3J G;  1FNU A;  1AN8 A;  3ULJ A;  4KK7 A;  3ONA B;  1EQR A;  3V2T A;  4FDB A;  5JEA J;  2A1A A;  3J81 j;  3R3O A;  4JI4 L;  3MZ5 A;  2PW7 A;  4EQN A;  1SSO A;  4JK1 C;  4I7A A;  3J7A V;  3S1Q H;  1YHQ A;  1LAC A;  2B8G A;  4K5V A;  3HKZ E;  4DV3 Q;  4UP7 A;  4DAP A;  4IFD H;  4A3G G;  1FNW A;  1QE6 A;  3DWP A;  2DNE A;  4OX9 Q;  2RDG A;  3VR3 A;  4QUC A;  1N32 L;  3M4O H;  1SNM A;  1ET6 A;  2LS0 1;  5FLM H;  4IAL A;  2KEE A;  1Q12 A;  3CC4 A;  5IYD H;  2B2W A;  2DGY A;  3HOY G;  2KCN A;  1S72 A;  4G7Z C;  1SRU A;  4BBS H;  1SDF A;  4A3I H;  1VQA A;  2PZW A;  4HID A;  1IYU A;  2Q2H A;  1STE A;  2K7V A;  1WCM H;  3LGJ A;  1P16 A;  1HHV A;  5BR8 Q;  3A5U A;  3W1G A;  2KHS A;  3QOL A;  4DR6 L;  1G6P A;  1B9N A;  1SR3 A;  1E1O A;  2EJG C;  3G6E A;  1WI5 A;  3C1E A;  1G2T A;  3OPO A;  4HJ7 A;  5M5W H;  2F0M A;  4MTN A;  1EY0 A;  2PNH A;  3S16 H;  5I9P A;  3CCQ A;  2QF7 A;  2NUC A;  3PF4 A;  4GN3 B;  3TP7 A;  4EQ5 A;  1XNR Q;  1K28 A;  1MBY A;  3PF5 A;  2ZXR A;  1WD0 A;  3HZX A;  3E9H A;  4NPS A;  3KJP A;  1PTO F;  5CGK A;  4BY7 B;  2B2T A;  4CJ1 B;  1EYA A;  1C48 A;  3H3V C;  4NXM L;  1JR0 D;  2CQA A;  2E2H H;  2D0O A;  1QIL A;  1BKB A;  2M2L A;  4KJO A;  3N52 A;  2N3S A;  1X9N A;  3GV6 A;  1CSQ A;  1BR9 A;  2CH4 W;  2BA0 A;  2K1B A;  2FHT A;  4GNX B;  4A3C G;  2L11 A;  3SK8 A;  3PIP A;  1JE5 A;  1CKN A;  4S3S A;  1XYI A;  1STH A;  3AU7 A;  1NNX A;  2F0E A;  3K7A H;  2NVT B;  5C0X I;  4OO1 H;  1KRS A;  3HOW B;  1AP0 A;  5ELO A;  3D31 A;  3J80 i;  2IX0 A;  1G91 A;  1FYC A;  4O1N A;  4A3D H;  1Q46 A;  1NSN S;  1G29 1;  2IT1 A;  1NE3 A;  2WKC A;  1IW7 C;  3AYH B;  3OTO L;  4A3M H;  2EQS A;  2RQX A;  5T1I A;  4BY1 G;  1JOK A;  2EJM A;  4PMB A;  1H95 A;  4IUV A;  3NUC A;  4A3K G;  4A3J H;  1K8O A;  4QB4 A;  2A5H A;  5GAG C;  5M5X H;  1S4Z A;  2F0U A;  4XYO A;  1YVC A;  2EPB A;  4LUV A;  1PH6 A;  4YY3 Q;  3S14 H;  4WFN 3;  1C4Q A;  4LFC L;  4RCO A;  4C3I B;  3J80 c;  2B2V A;  1J5E L;  1B7Y B;  1SMX A;  4BBR H;  4TVA B;  1TS4 A;  3PIO A;  3TZD A;  3GTO H;  4R8I A;  1Y1W H;  1B70 B;  4LK1 C;  1UEA B;  4QJF A;  1TVX A;  1SNO A;  1ET9 A;  2B63 H;  1E3P A;  5C44 H;  4X66 Q;  3EA6 A;  1L1O B;  2F0O A;  1D5Z C;  1SXT A;  3URY A;  1II3 A;  4L8J A;  5I6W A;  3FP9 A;  5C5L A;  4N9P A;  2KA7 A;  1PTO C;  1V1O A;  1I94 L;  1GO3 E;  2Q2I A;  2KEN A;  5EBC A;  1TS2 A;  4BXX G;  1Y1V H;  3DEP A;  1E22 A;  2EYP A;  3MFY A;  5EBD A;  2AWO A;  1TWC B;  1XMQ Q;  3J7A 5;  3GTL H;  3HOZ G;  1N34 L;  4X65 L;  1F9R A;  5D3I B;  3CRK C;  2F0T A;  1X54 A;  4JCV E;  4ULL A;  3OSO A;  3W1B A;  3RZO B;  2A6E D;  3A7L A;  3GD7 A;  1RL2 A;  1K8M A;  2HD3 A;  4HIO A;  3HGB A;  3J80 L;  1X56 A;  1JOR A;  4JPB W;  4IFD I;  2N55 A;  3RLF A;  2WFW A;  3M9B A;  3M3Y B;  2LFN A;  3ND8 A;  3OIP A;  3UDF A;  4G4K A;  4RGT A;  1H9M A;  3Q6S A;  4DR1 Q;  3LWU A;  1KAW A;  2E2J B;  3D4R A;  1B3Q A;  2L12 A;  3M7G A;  4L5Q A;  3TP6 A;  1Z6H A;  4YWL A;  4ZK9 B;  4KD4 A;  2Q8T A;  1PMR A;  3P7J A;  4DK6 C;  4CKB A;  5CV8 A;  3NBH A;  4F7X A;  3GQB A;  1Q8K A;  3HG9 A;  1VQO A;  2F4V L;  4IUQ A;  3A0J A;  4H44 C;  5IYC G;  5K36 G;  4G57 A;  1HH2 P;  3KBX A;  3KF6 B;  3OWE B;  5LL6 S;  3A8J E;  4B3M L;  2G9H D;  1KLG D;  1E24 A;  3E5S A;  1QZG A;  5LMN L;  5D14 A;  3HOX B;  3ERO A;  5IGD A;  4WJ3 M;  5JVH 3;  1QZH A;  1XTD A;  2NZH A;  1D6E C;  4K0K L;  3QO2 A;  2F03 A;  1YNJ D;  4JV5 L;  2K6A A;  4K6L A;  4BY7 G;  3QB3 A;  2K5D A;  1VQE A;  1BBU A;  4YIJ A;  3M7N A;  4XXE A;  3U58 A;  5KYL A;  2AMC B;  4RCN A;  4LF8 L;  1SMY C;  4NB3 A;  2F3V A;  4YWM A;  3BU2 A;  3CCE A;  3I91 A;  2MFI A;  5C4J H;  3KLR A;  1OXU A;  5JOB A;  4C3H H;  4C56 C;  4DAY B;  5LMU Q;  3RN2 A;  5EKL A;  2K33 A;  3RMH A;  3PUZ A;  2IWH A;  3KYH C;  1ICF B;  2Z4I A;  1KDC A;  1MKH A;  3NEL A;  2X6G A;  2K5V A;  3S15 H;  4JG2 A;  2WIN B;  3ER0 A;  4X3K A;  4AYB E;  2JA8 B;  2NVX B;  4DV4 L;  2NZO A;  5IP7 G;  1TU2 B;  1B9M A;  3KLS X;  1JWU D;  2CW0 C;  3VR5 A;  3DWQ A;  4DV6 Q;  4B9W A;  1S5F D;  2GN5 A;  1HZC A;  1WFQ A;  4MTK A;  1VS0 A;  4GKK L;  2WAQ B;  5C3E H;  1X3P A;  4Y52 H;  1AZP A;  2VS1 A;  4Q5V A;  5KNC A;  1HTL D;  1TII D;  1I4X A;  4N9T A;  4RH6 A;  4HJ8 A;  1HA5 A;  4JOI A;  5HY6 A;  3G6J B;  4RA8 A;  4DR7 L;  2OQK A;  2IHF A;  1KAB A;  1YIJ A;  2B2U C;  5LMN W;  3BZD B;  1TWA B;  5EKK A;  3KJO A;  3T1H L;  4CKC A;  5HUR A;  1QVF A;  1ENC A;  1B4O A;  4L5T A;  2EZV A;  2F3W A;  1I5F A;  2UUB L;  1PLF A;  2L5T A;  3CMA A;  3GTK B;  1VQD A;  2Z8L A;  4H13 C;  4ZRZ A;  3UDX A;  3DMU A;  4B08 A;  4R4C A;  2ATW A;  1OXS C;  2R61 A;  2Q2T A;  3T13 A;  5C4X G;  3CPW A;  1IXR A;  1PTO B;  1EYG A;  2XWB B;  1NMF A;  2R93 H;  1GUN A;  4LF6 Q;  2KVM A;  1BBX C;  1LAB A;  1PFB A;  5E3F A;  1LTG D;  3NTH A;  1YEZ A;  4LF5 L;  2IX3 A;  1F9Q A;  1O7Y A;  1CQV A;  2AWN A;  1AEX A;  4BWG B;  3HEJ A;  4KHZ A;  3FKI H;  5CR3 A;  2IY5 B;  3TEH B;  4F87 A;  4P71 A;  2VQE L;  3K7U C;  2HHH L;  1NR2 A;  1RIP A;  3Q22 A;  2UUA L;  3PCO B;  5M3F H;  4CBV A;  2K05 A;  5C0X J;  2RA4 A;  1WJJ A;  3D3R A;  1K0S A;  3STB D;  4R4T A;  1S5C D;  4I65 A;  2JA7 B;  2ES2 A;  5ELE A;  3RN5 A;  3PO2 H;  2HDM A;  1K3R A;  3J81 E;  1DOM A;  1QB5 D;  4GKJ L;  1A3U A;  1PRT D;  1QUQ B;  3I4L A;  2R92 G;  3NQT A;  5IOC A;  4FYD A;  2NVY B;  2RDH A;  5HGQ A;  3MVV A;  1VQG A;  3PQI A;  4FO2 A;  5KND A;  3GTG B;  2C9O A;  3I72 A;  4JI0 L;  5JJI A;  2K75 A;  4XTC S;  1AH9 A;  1HPC A;  1VQ5 A;  1S5D D;  3K8A A;  1F2Y A;  3MXN B;  2XSC A;  4FXD A;  2NBF A;  4NXN Q;  2IPK D;  1FGU A;  4A3G B;  1EEF D;  2VXW A;  2VNU D;  2E2I B;  1JWM D;  3AMU A;  2JA5 B;  4QL5 A;  1I50 H;  5M9O A;  1PRT F;  3KFU A;  5KGU A;  4HCS A;  4R4Q A;  4A3E H;  4HED A;  4WJ4 A;  2WKD A;  3C46 A;  3HOY B;  1NJI C;  1EY7 A;  1ILP A;  1AFP A;  3I4M G;  4UHV A;  1E2Z A;  3Q0A A;  3HOU H;  3VYU A;  4PZ7 A;  3SDZ A;  1W2B A;  4PNY A;  4XQJ A;  1I4H A;  1BCP C;  1HFG A;  1OXX K;  2RSO A;  3BVZ A;  1BXT A;  2DY7 A;  1HUM A;  1WTW A;  2SNM A;  4DR5 L;  2JA6 B;  1DOL A;  1ESF A;  2A74 C;  1YIT A;  4QY7 A;  1QNK A;  3H0G H;  5FLX E;  1MHW C;  4X64 Q;  4GLX A;  5M5Y B;  5DNF A;  4B9X A;  2YTX A;  2BCO A;  3UI2 A;  3TDQ A;  3GTJ H;  5CYU A;  3K5N A;  3ZYY X;  1CHP D;  4NXM Q;  1STY A;  1WTQ A;  4JI3 Q;  4LF9 Q;  5DLQ E;  1JE4 A;  4A93 B;  2EY6 A;  3S2D B;  4Y7N B;  1TWH B;  4HTH A;  1XNQ Q;  4DV5 L;  2BE5 C;  3TP5 A;  3I3C A;  1WTX A;  3PO3 G;  4B3R Q;  4C3J H;  4KV6 A;  4KKS A;  2HQE A;  2VY3 A;  2F0W A;  2G9D A;  2ZM6 Q;  4HCE A;  3D4W A;  2XWJ B;  4POF A;  5IP9 H;  4HSP A;  5KYI A;  5ELD A;  5FOB B;  4ZLT F;  4MNO A;  2AQ3 B;  2PCF B;  5G3L F;  1DZ1 A;  2NTT A;  4QIW E;  5IWA L;  1K83 H;  3I7F A;  1VQI A;  3QJY A;  5JPM C;  3UDG A;  4AYB G;  1NMG A;  1SE3 A;  2PO4 A;  4YCU A;  4XQN A;  2D9U A;  1S5B D;  1VDZ A;  4BY1 B;  1VQN A;  1TWF B;  4CJ2 C;  3VA7 A;  1PH3 A;  1O7L A;  2JEB I;  4QMG A;  2JN4 A;  4C2M H;  3G48 A;  1AE3 A;  3QWN A;  5ELC A;  1MJE A;  1E0B A;  4I7Z C;  2EXZ A;  4RMF A;  3W2D A;  4LWC A;  3DLL A;  3CC7 A;  2UXD Q;  4LFC Q;  1B8A A;  2GA4 B;  2UU9 L;  2H5X A;  3SXH A;  4LJZ C;  1BQQ T;  1BF4 A;  3NE5 B;  1V9P A;  2R7Z B;  1B2T A;  2EYH A;  1YHA A;  4UAI A;  2FXQ A;  3E0J A;  4LF7 L;  2K52 A;  4K2L A;  3MA2 B;  3UDI A;  1Q3L A;  1WTR A;  1WVL A;  2OT2 A;  2LXK A;  2XRQ D;  2CFM A;  5JJZ A;  3JC6 6;  4XIG S;  4P75 A;  1L2F A;  3KDF A;  2XVS A;  4LMQ D;  4KN7 C;  1GUG A;  4RKB A;  5JJL A;  1E7Z A;  1HZB A;  4DV7 L;  3CQZ B;  1K9M C;  1I6V C;  1UWV A;  1LTS D;  4A3F B;  5IE8 A;  4HSV A;  1C8C A;  3I73 A;  1B44 D;  1FD7 D;  4TQU S;  1D2B A;  5I6Y A;  2EY1 A;  4IOC A;  1PA6 A;  2Z0S A;  4BS9 A;  1CHQ D;  2BA1 A;  1N34 Q;  1IW7 D;  3E0E A;  2K5H A;  2EYL A;  2JA7 G;  3KUP A;  4DNR B;  1X3E A;  1CKO A;  2CQO A;  4DKA C;  2OQ0 A;  2A8V A;  3K0X A;  1A62 A;  4WJW A;  3U9S A;  1TS3 A;  4JYA L;  3HOZ B;  3ITP A;  4A3C H;  4OWT B;  2V1C C;  1EIY B;  1Y8N B;  1F9S A;  4KMU C;  5C3W A;  2E5L L;  1SE8 A;  1K0R A;  4JI5 Q;  1HR0 W;  1BDO A;  3SK5 A;  3BVM A;  4JI7 Q;  2Z6K A;  3SHL A;  2LY7 A;  1VQP A;  2KBN A;  1H9R A;  3GDE A;  2JA5 G;  2BDN A;  2F0J A;  4DR3 Q;  4EQP A;  4JI1 L;  4DUZ L;  3T4A C;  5C0X G;  1YI2 A;  2F0N A;  1XMO L;  1DM0 B;  2K32 A;  1RTO A;  1QCB D;  3M85 A;  4A3K H;  3G4S A;  2VB3 X;  1HRJ A;  3AB9 A;  2J4X A;  3HKZ B;  4K5W A;  4NW2 A;  1OO9 B;  1EQV A;  1HNX L;  1Q8I A;  3TBI B;  3BDC A;  3SK4 A;  1PTO D;  4KKT A;  5LMN Q;  2VZA A;  5M3M B;  2JA6 G;  1PXU A;  3G71 A;  3MXU A;  3NQI A;  2Z6B A;  3H6M A;  3HRZ C;  4DV1 Q;  1O80 A;  3I4N H;  1X6O A;  3K57 A;  4POG A;  2HIX A;  3I8Z A;  1IKL A;  3MEF A;  3TZU A;  3I56 A;  1CI3 M;  1EIF A;  2DN8 A;  2D5D A;  3BZC A;  1C9O A;  4TSS A;  4A93 G;  2RF4 A;  1EL0 A;  1GD7 A;  1EFW A;  1IBK L;  1EUJ A;  1U4M A;  2IX1 A;  1K8G A;  4B3S Q;  1STG A;  2SOB A;  4X62 Q;  1I3Q H;  1R9T H;  1PH8 A;  1N33 Q;  5C4Z A;  1VF5 C;  4FF1 A;  1GHJ A;  2EYO A;  5JAV A;  1RDP D;  2L0C A;  4DK0 A;  5CV9 A;  1SYG A;  4LAA A;  2F0K A;  3S1N B;  2EYM A;  4IPH A;  2NVQ B;  4GNX A;  4DU9 A;  2NN6 H;  4BA1 I;  1IBM L;  2TSS A;  1JQY D;  1EU3 A;  4KY7 A;  3TSS A;  4R9W A;  2MPM A;  1ASZ A;  4DR4 L;  4XQQ A;  1U4P A;  5IOD A;  3H94 A;  4DR2 Q;  2B2Y C;  2UXC L;  5LL6 X;  2LMC B;  1O7Z A;  3F2C A;  5E4W C;  3I70 A;  1PRT B;  1DJR D;  4ZYS A;  4G7H C;  3I55 A;  1U4L A;  2RDF A;  4DV0 Q;  4IFD G;  4DR7 Q;  1RF2 D;  4GN5 A;  1FVI A;  4IJH A;  4V0B A;  5I4D A;  3ICE A;  1ZKO A;  4RFB A;  5JEA H;  2R7Z G;  5AJ3 Q;  5CBA E;  3IAY A;  5FLM G;  1ZYR C;  4B3T L;  3F1Z A;  3GTM B;  4XYQ A;  3EBE A;  2KCM A;  4LFA L;  1I4R A;  5GAE C;  5K36 H;  4FNF A;  2K5W A;  5LHY 1;  3T1Y Q;  4BBS G;  4A76 A;  1SMY D;  3A8K E;  4DAV A;  1WCM G;  3VR4 A;  5CC4 A;  4KHP L;  1HZA A;  1HNZ Q;  4RKL A;  4QQB X;  1I6H B;  4MIU A;  1O78 A;  3P1H A;  2OWO A;  2N8N A;  1X3G A;  4ME3 A;  2HDL A;  3R8B A;  2F0D A;  4E6I A;  3HOV B;  2ICE C;  1LTL A;  4L5R C;  4A3F G;  1EZ8 A;  5F2D A;  1IYV A;  5KRU A;  3UE0 A;  5KIX A;  2KCT A;  1VMC A;  3FDT A;  5E7N A;  5EPL A;  4UP8 A;  3SGI A;  5C4X B;  4HR7 B;  2MNA A;  4LFB L;  1L1O A;  2NZ1 D;  3JAM i;  2PQE A;  5IGG A;  2CW0 D;  1LTI D;  1PH4 A;  2UUA Q;  4KKU A;  2F0L A;  3D6C A;  3PUY A;  1KTK A;  1CT1 D;  5EQ0 A;  3CCU A;  3OW7 A;  2HUG A;  2OF1 A;  2VUM B;  1Z47 A;  4MN3 A;  4ZUJ A;  3HOW H;  5A35 A;  3A55 A;  2XTI A;  4HMJ A;  4G7O C;  1T5E A;  4IQZ A;  4JI8 Q;  2EOT A;  4DXF A;  4H0L C;  3T56 B;  3VYR A;  1ROD A;  1KNA A;  1STN A;  4JBW A;  1J9O A;  3J7Y W;  4OO1 G;  1HNW Q;  5FJ8 G;  3RR5 A;  1BBW A;  3RZD B;  1STB A;  1M90 C;  5IP7 H;  1Y8O B;  2DNC A;  2R92 B;  3JAM c;  2KOL A;  1GUO A;  1QWY A;  2D0P A;  4JI2 Q;  2AKW B;  2EYJ A;  1VQB A;  2MJ8 A;  3CHB D;  1NR4 A;  4A3M G;  4GOP C;  3HKZ G;  1LT4 D;  2KEC A;  3H09 A;  4DV3 L;  1EY5 A;  1CKM A;  4DV2 Q;  5M3M G;  1XXG A;  3U4Z A;  4C3I H;  3VDY A;  3EFX D;  3K0Y A;  2O5I C;  1WTO A;  5CBE E;  5NUC A;  3M4Y A;  4OX9 L;  1K73 C;  4LUO A;  4PQX A;  3HS0 C;  1HA6 A;  3DM1 A;  1X32 A;  2Q8R E;  3KF6 A;  2RCF A;  4YHH Q;  4AQY Q;  3DM3 A;  1YBY A;  2F52 A;  1XPO A;  1F77 A;  4ZKB B;  3I4M B;  4FF4 A;  5CV6 A;  1GHK A;  4JBJ A;  1EQQ A;  3O13 A;  5A2Q E;  1WD1 A;  5IT9 c;  1IBL Q;  1RD9 D;  1UE5 A;  2ZXO A;  1T5X D;  2MHV A;  2UXB Q;  5BR8 L;  1FJG Q;  5KEE A;  1D7Q A;  2B63 G;  3MHB A;  3JAM L;  4EX5 A;  2XN9 C;  4GLA C;  1TWC H;  4OGQ C;  3Q24 A;  3CCL A;  4OO1 I;  3IKJ A;  4WOR A;  2UUC Q;  1R4Q B;  1EYD A;  3PUX A;  4CJ0 B;  1PFM A;  1YNN C;  1V1Q A;  3S17 B;  3RZO H;  1XNR L;  2VQF Q;  4ZAI A;  1F9P A;  2K5Q A;  1CZG A;  2JK8 A;  1DYQ A;  1PV4 A;  3FPU B;  3OWF A;  4DAY A;  5ELB A;  3VR2 A;  3M3Y H;  3MC0 B;  1NCV A;  1RTN A;  2B39 A;  4RGM A;  3PO3 B;  2E2J H;  5FK9 C;  1KHI A;  1EWH A;  4ZQ3 A;  4HJA A;  1VQ6 A;  1D8L A;  3BYT B;  3RLN A;  1R4P B;  4OWW B;  4L5S A;  1HR0 Q;  5IT9 L;  1PZI D;  2XRS D;  2HQL A;  1EU4 A;  2PW5 A;  4APV A;  4V19 0;  1LT5 D;  1BCP D;  2K50 A;  3L9A X;  3R2T A;  1SE4 A;  1Z7T A;  5CMD A;  5IGF A;  4AYB B;  1GUT A;  1JB3 A;  3U4V A;  2WAC A;  4DPG A;  4IZ8 A;  1PH9 A;  2CCZ A;  3HOX H;  2PMZ E;  4LF7 Q;  3HOV G;  1BUV T;  1SLJ A;  4IUT A;  3J7Z C;  1BCP F;  2ICI A;  4OWX B;  1OXT A;  2JE6 I;  4YY3 L;  4A4I A;  2ZTD A;  3IFT A;  2PNR C;  4F8M A;  2JA9 A;  4IPC A;  2BE5 D;  3RLO A; 
#chains in the Genus database with same CATH homology
 4H7B A;  3X3N A;  2K03 A;  2RVL A;  4A3B B;  3HOU B;  2V4D A;  1SFO B;  1D1I A;  1EZ6 A;  4UDU C;  1I4P A;  4J6H A;  4ILW A;  3MXG A;  1XX8 A;  2SDF A;  3LX0 A;  3NXW A;  4IUN A;  1TWG B;  2WV6 D;  4ME5 A;  1V8Q A;  5COY A;  1CM9 A;  3CKI B;  1CA6 A;  1H9S B;  1TQO A;  4IN3 A;  2AUJ D;  2KUM A;  5EPJ A;  1I4Q A;  2E74 C;  4J1M A;  1GXD C;  4FP5 D;  1G2S A;  3S1M B;  3QG1 A;  4CKE A;  2AQ1 B;  1FR3 A;  3NP8 A;  3SK6 A;  2E76 C;  3BDL A;  1VF7 A;  3MXN A;  3RUZ A;  3MFG A;  1B50 A;  5EJW A;  2B2W C;  5FO8 B;  4XT3 B;  2BDO A;  1LTT D;  2PZT A;  3DEO A;  2J7Z A;  4CHT B;  1EEI D;  1CFM A;  2B8F A;  2A6H C;  5EKI A;  4GZY C;  3K6O A;  1EY6 A;  2Y0S B;  2ENB A;  2EVB A;  3GTP B;  1EIG A;  2R6G A;  1PTO H;  2O5J C;  3RD4 A;  3S1R B;  3NK9 A;  1JCK B;  1ESR A;  4FVM A;  4KTA A;  1LT3 D;  5AFW A;  4OL7 A;  1IKM A;  1M4V A;  2YU9 B;  3S2H B;  5KNB A;  5G3L D;  4QCL A;  2B2T C;  4R8N A;  1PYW D;  4L63 B;  4IFD J;  2FJ2 A;  1BNZ A;  3WOE A;  3GV3 A;  3KK7 A;  5C3X A;  2QDB A;  1HCZ A;  1HFN A;  3GTQ B;  1V1P B;  3V96 A;  3OIQ A;  2KJX A;  1PDQ A;  2H1E A;  2MUY A;  2CVR A;  3A7A B;  2O2L D;  4PMC A;  3NPP A;  2KCC A;  3K5L A;  2Z4H A;  3W3A A;  3TN2 A;  3FVQ A;  1HQR D;  3QOJ A;  3C3L A;  3D8G A;  5E4X A;  3S1Q B;  4K8I A;  1B1Z A;  3FRP B;  1LTR D;  3PUV A;  5FLX L;  3OMC A;  5C0X H;  1RJT A;  4QIW B;  2B2U A;  3M4O B;  1L0Y B;  1ENF A;  1LO5 D;  2QIL A;  2TMP A;  2X6L A;  2B2V C;  4BBS B;  4A3I B;  5BN3 A;  2YYZ A;  4CGY B;  2JEA I;  1WCM B;  3E6Z X;  2ZXP A;  3BG3 A;  2VB2 X;  5J1Z A;  2M9V A;  1JIC A;  1A3T A;  1JC7 A;  4ABN A;  2A68 C;  2I46 A;  1W6J A;  1JWS D;  4NDX A;  5M5W B;  4DXG A;  5TSS A;  5FO9 B;  1ZEQ X;  1QG7 A;  4C1N I;  3S16 B;  1X3Q A;  5C4H A;  1SNQ A;  2FIN B;  2HCI A;  1F2M A;  4NMZ A;  4KY5 A;  1JOQ A;  1E2V A;  5IGC A;  2WP8 J;  1SYC A;  3TP8 A;  1SYE A;  1A2T A;  1H9K A;  2EE1 A;  1MGS A;  2E2H B;  1PZK D;  4FXK C;  4KY6 A;  3NHH A;  3H91 A;  1ZYR D;  3PUW A;  5D3D A;  1D5M C;  1AZQ A;  2DY8 A;  2XIW A;  4RHR A;  3K7A B;  4X3U A;  2MP1 A;  1QJO A;  5FKA C;  1SBB B;  1TY0 A;  2EYF A;  3T51 B;  3MEH A;  3K5O A;  3MTS A;  4A3D B;  4ZUI A;  3T53 B;  1KLU D;  3BVG A;  5HGT A;  4A3M B;  3G7L A;  3PV0 A;  1BCP B;  4A3J B;  2EY5 A;  1VCI A;  3FMC A;  5M5X B;  2FMM A;  1F2Z A;  3OOC A;  5BN5 A;  3VYT A;  1WTV A;  4Z9C B;  3S14 B;  1EYC A;  3OMG A;  4DFA A;  4BBR B;  4K5X A;  2AQ2 B;  2QKI C;  3GTO B;  4KD3 A;  1GUW A;  1Y1W B;  2EJF C;  2WB1 B;  1I4G A;  2B63 B;  1SJE D;  5C44 B;  2L55 A;  3EQL C;  3IL8 A;  3MXP A;  2D2C C;  4K14 A;  4DNT B;  1JOO A;  1A3V A;  3NTI A;  1Y1V B;  2JXM B;  4DN4 M;  2A69 C;  3GTL B;  4Q0F A;  2RSN A;  1D1K A;  1DON A;  3DHQ A;  1G8Z D;  2JP1 A;  2FFK B;  1UUP A;  3TME A;  2SNS A;  3KLS A;  4OIJ A;  4P2C B;  3NTK A;  3P75 A;  2PZU A;  2K28 A;  3WOF A;  5CV7 A;  1OXV A;  2A73 B;  3SR1 A;  1KAA A;  1EY9 A;  1SYB A;  4PMW A;  4HMI A;  3KBG A;  4XDX A;  4RWS C;  3NSW A;  5JPN C;  1PZJ D;  3J80 E;  3SE0 A;  3S9W A;  3SEB A;  1KDA A;  1CQF A;  3D6W A;  1Q1E A;  1YNN D;  4X3T A;  1L0X B;  4F88 A;  1DD2 A;  4ZKC B;  1UAP A;  2NB0 A;  3BDO A;  1QNU A;  4HN7 A;  2BOS A;  1PFN A;  1VMP A;  1NAP A;  2MGS A;  1IL8 A;  1A15 A;  3GP7 A;  2K01 A;  2F1M A;  2F0Q A;  2EDG A;  5C4J B;  5IIF A;  4C3H B;  1GOZ A;  4NP5 A;  4IUU A;  2IL8 A;  3J7A F;  4RGO S;  2EY2 A;  2NN6 G;  3ND9 A;  3R93 A;  4BA2 I;  3S15 B;  1CA5 A;  1LT6 D;  4M1U B;  2NWG A;  5BN4 A;  3MAQ A;  5C6A A;  3JAM E;  1ICW A;  1FGB D;  4TKO B;  3A54 A;  5I9O A;  3P20 A;  4OHJ A;  1W6K A;  1B3A A;  5C3E B;  1XTC D;  5ISR A;  5JEA G;  4K2K A;  5EPK A;  5E1F A;  5CV5 A;  1XWE A;  4ODG A;  2CHB D;  4KHV A;  1SEB D;  3K5M A;  3VA5 A;  4FXG C;  2X69 A;  3CU7 A;  2F0P A;  1CZW A;  1M8A A;  5IT9 E;  1TS5 A;  1ZXT A;  5DEH A;  1LTB D;  1ENA A;  1H9J A;  2ZT9 C;  3DWA A;  4QF4 A;  2NN6 I;  2R93 B;  4RGN A;  1HXY D;  2NYZ D;  2E75 C;  2AUK A;  4EQO A;  3FKI B;  3GO5 A;  4MHE A;  3VR6 A;  1NUC A;  3PIP 3;  1EOT A;  4O42 A;  3L3O C;  5M3F B;  4PV1 C;  1U4R A;  2OEO A;  1EWC A;  1Q90 A;  1SNP A;  4EVO A;  1CTM A;  2KQ3 A;  3PO2 B;  2A6H D;  2B2Y A;  5A2Q L;  2F0S A;  4M8A A;  4DK1 A;  1KDB A;  1EQT A;  3LWE A;  1MSG A;  2JYO A;  3LNN A;  3WDN A;  1SNC A;  4DGZ A;  4RHS A;  1UNS A;  5I2X A;  2A6E C;  1LLR D;  1LTA D;  2L9H A;  1RHP A;  3MWY W;  1EY8 A;  1EIH A;  1SE2 A;  5D65 A;  5DAU A;  4C3I G;  3Q23 A;  3HP3 A;  1I50 B;  1E2W A;  4KN4 C;  1HUN A;  4A3E B;  4WRD A;  4C1N K;  1HTP A;  3K58 A;  2HCC A;  4RAU C;  2SEB D;  2F0V A;  3PIO 3;  1SYF A;  5DM7 3;  1MD2 D;  2H4O A;  3QIA A;  4QUF A;  2KED A;  5FO7 B;  2PMZ B;  1V43 A;  3T16 A;  2Q8I B;  1B53 A;  2N88 A;  2F0H A;  5IGE A;  3H0G B;  2RKS A;  5DM6 3;  4C3H G;  3GTJ B;  1DCZ A;  3A56 A;  3N6R A;  3NWS A;  1SJH D;  1YNJ C;  3DXJ C;  1MSH A;  1RCV D;  2PYK A;  4KJN A;  5EGT A;  1D5X C;  4X3S A;  2XNA C;  1MI2 A;  3NWT A;  5J39 A;  4L6T B;  1SAP A;  1ILQ A;  3BS1 A;  1Y69 U;  2QCP X;  3OHX C;  1H9S A;  3X3M A;  4C3J B;  1S5E D;  3PMF A;  3NBI A;  1G6Z A;  1SND A;  5I2Y A;  3IFD A;  3C1F A;  4HAE A;  2ID0 A;  1TKW B;  4NKL A;  4TRD A;  1WTP A;  1K83 B;  5J22 A;  1TT2 A;  3FPP A;  2F0F A;  4K6D A;  2A68 D;  2WII B;  4FF2 A;  3KF8 A;  2RBM A;  1Q1B A;  2F0I A;  4C2M B;  2NTS A;  3U9O A;  4EGV A;  2O4X A;  4U67 3;  1LV9 A;  4ID6 A;  1U9R A;  2OXP A;  3J81 L;  1EFI D;  1Y8P B;  3FEW X;  2L4N A;  3L7Z C;  2PPB C;  1TY2 A;  2QEJ C;  2C5C A;  5C5M A;  1DXM A;  4FF3 A;  2FMC A;  3EJI A;  3VYS A;  1A6X A;  5IGB A;  2R3Z A;  1TR5 A;  1SYD A;  2IW3 A;  5COR A;  3R2I A;  5JVG 3;  2IJ0 A;  2J0T D;  5T1G A;  3F2U A;  1A2U A;  2L1B A;  1V1P A;  2F0G A;  5K5P A;  1DOK A;  1CK1 A;  1J8I A;  4IUR A;  3I90 A;  1FNV A;  4J8Q A;  2K04 A;  1STA A;  3DUZ A;  3K59 A;  1IHZ A;  3C2P A;  3SVM A;  2F4I A;  4DA2 A;  1PRT C;  1HQM C;  3CRL C;  3D4D A;  4A3K B;  1GUS A;  4KI0 A;  2LKV A;  3BYY B;  1F2L A;  3A8I E;  4U68 A;  1ONL A;  1AW7 A;  1EY4 A;  3ERQ A;  1GJX A;  5ELF A;  4DF7 A;  2D62 A;  2A69 D;  3I4N B;  2JSO A;  3EVQ A;  4IUP A;  2E2D C;  1QOH A;  3V05 A;  2I07 B;  4XT1 B;  5CV4 A;  2M00 A;  4K8J A;  4OIK A;  1ML0 D;  1RKN A;  1I3Q B;  1BO0 A;  1R9T B;  1KNE A;  1BOS A;  2Z1C A;  4C3J G;  1FNU A;  1AN8 A;  4KK7 A;  3ONA B;  3V2T A;  5JEA J;  3R3O A;  3MZ5 A;  2PW7 A;  4EQN A;  1SSO A;  4JK1 C;  3J7A V;  1LAC A;  2B8G A;  4K5V A;  4DAP A;  4IFD H;  1FNW A;  1QE6 A;  3DWP A;  2DNE A;  2RDG A;  3VR3 A;  4QUC A;  1SNM A;  1ET6 A;  2LS0 1;  4IAL A;  2KEE A;  1Q12 A;  2B2W A;  2KCN A;  4G7Z C;  1SDF A;  2PZW A;  1IYU A;  1STE A;  2K7V A;  1HHV A;  2KHS A;  3QOL A;  1B9N A;  2EJG C;  3C1E A;  1G2T A;  3OPO A;  2F0M A;  1EY0 A;  5I9P A;  2QF7 A;  2NUC A;  3TP7 A;  1MBY A;  2ZXR A;  1WD0 A;  3HZX A;  1PTO F;  5CGK A;  4BY7 B;  2B2T A;  4CJ1 B;  1EYA A;  1C48 A;  3H3V C;  1JR0 D;  2CQA A;  1QIL A;  2M2L A;  4KJO A;  3N52 A;  3GV6 A;  1BR9 A;  2BA0 A;  2K1B A;  2FHT A;  2L11 A;  3SK8 A;  4S3S A;  1XYI A;  1STH A;  3AU7 A;  2NVT B;  2F0E A;  5C0X I;  4OO1 H;  3HOW B;  1AP0 A;  3D31 A;  2IX0 A;  1G91 A;  1FYC A;  4O1N A;  1NSN S;  1G29 1;  2IT1 A;  2WKC A;  1IW7 C;  5T1I A;  2RQX A;  1JOK A;  2EJM A;  4PMB A;  4IUV A;  3NUC A;  1K8O A;  4QB4 A;  2A5H A;  1S4Z A;  2F0U A;  4XYO A;  2EPB A;  4WFN 3;  1C4Q A;  4RCO A;  4C3I B;  2B2V A;  1TS4 A;  3TZD A;  4R8I A;  4LK1 C;  1UEA B;  1TVX A;  1SNO A;  1ET9 A;  3EA6 A;  2F0O A;  1D5Z C;  1SXT A;  3URY A;  1II3 A;  4L8J A;  5I6W A;  5C5L A;  4N9P A;  2KA7 A;  1PTO C;  1V1O A;  5EBC A;  1TS2 A;  3DEP A;  2EYP A;  3MFY A;  5EBD A;  2AWO A;  1TWC B;  1F9R A;  5D3I B;  3CRK C;  2F0T A;  4ULL A;  3OSO A;  3RZO B;  2A6E D;  3A7L A;  3GD7 A;  1K8M A;  3HGB A;  3J80 L;  1JOR A;  4IFD I;  2N55 A;  3RLF A;  3M3Y B;  2LFN A;  3ND8 A;  3OIP A;  4G4K A;  4RGT A;  1H9M A;  3Q6S A;  3LWU A;  2E2J B;  3D4R A;  2L12 A;  3M7G A;  3TP6 A;  1Z6H A;  4ZK9 B;  4KD4 A;  2Q8T A;  1PMR A;  3P7J A;  4CKB A;  5CV8 A;  3NBH A;  4F7X A;  3GQB A;  3HG9 A;  4IUQ A;  4H44 C;  5K36 G;  4G57 A;  3KBX A;  3OWE B;  5LL6 S;  3A8J E;  2G9H D;  1KLG D;  3E5S A;  5D14 A;  3HOX B;  3ERO A;  5IGD A;  5JVH 3;  1D6E C;  3QO2 A;  2F03 A;  1YNJ D;  2K6A A;  4K6L A;  3QB3 A;  2K5D A;  4YIJ A;  3M7N A;  4XXE A;  5KYL A;  4RCN A;  1SMY C;  2F3V A;  3I91 A;  3KLR A;  1OXU A;  5JOB A;  4C56 C;  5EKL A;  2K33 A;  3RMH A;  3PUZ A;  2IWH A;  2Z4I A;  1KDC A;  2X6G A;  2WIN B;  4X3K A;  2JA8 B;  2NVX B;  1TU2 B;  1B9M A;  3KLS X;  1JWU D;  2CW0 C;  3VR5 A;  3DWQ A;  4B9W A;  1S5F D;  2WAQ B;  1X3P A;  1AZP A;  4Q5V A;  5KNC A;  1HTL D;  1TII D;  1I4X A;  4N9T A;  4RH6 A;  1HA5 A;  3G6J B;  4RA8 A;  1KAB A;  2B2U C;  3BZD B;  1TWA B;  5EKK A;  4CKC A;  5HUR A;  1ENC A;  1B4O A;  2EZV A;  2F3W A;  1PLF A;  2L5T A;  3GTK B;  2Z8L A;  4H13 C;  4ZRZ A;  3DMU A;  4B08 A;  1OXS C;  2R61 A;  3T13 A;  1PTO B;  2XWB B;  1GUN A;  2KVM A;  1BBX C;  1LAB A;  1PFB A;  5E3F A;  1LTG D;  3NTH A;  2IX3 A;  1F9Q A;  1O7Y A;  1CQV A;  2AWN A;  1AEX A;  4BWG B;  3HEJ A;  4KHZ A;  5CR3 A;  4F87 A;  1NR2 A;  3Q22 A;  4CBV A;  2K05 A;  5C0X J;  2RA4 A;  3D3R A;  1S5C D;  4I65 A;  2JA7 B;  5ELE A;  2HDM A;  3J81 E;  1DOM A;  1QB5 D;  1A3U A;  1PRT D;  3I4L A;  3NQT A;  5IOC A;  4FYD A;  2NVY B;  2RDH A;  3MVV A;  4FO2 A;  5KND A;  3GTG B;  2C9O A;  3I72 A;  4XTC S;  1HPC A;  1S5D D;  1F2Y A;  2XSC A;  4FXD A;  2NBF A;  2IPK D;  4A3G B;  1EEF D;  2VXW A;  2VNU D;  2E2I B;  1JWM D;  3AMU A;  2JA5 B;  5M9O A;  1PRT F;  5KGU A;  4HCS A;  4HED A;  2WKD A;  3C46 A;  3HOY B;  1EY7 A;  1ILP A;  1AFP A;  1E2Z A;  3Q0A A;  3VYU A;  3SDZ A;  4PNY A;  4XQJ A;  1I4H A;  1BCP C;  1HFG A;  1OXX K;  2RSO A;  3BVZ A;  1BXT A;  2DY7 A;  1HUM A;  1WTW A;  2SNM A;  2JA6 B;  1DOL A;  1ESF A;  2A74 C;  1QNK A;  5FLX E;  5M5Y B;  5DNF A;  4B9X A;  2BCO A;  3UI2 A;  3TDQ A;  5CYU A;  3K5N A;  3ZYY X;  1CHP D;  1STY A;  1WTQ A;  1JE4 A;  4A93 B;  2EY6 A;  3S2D B;  4Y7N B;  1TWH B;  4HTH A;  2BE5 C;  3TP5 A;  3I3C A;  1WTX A;  4KV6 A;  4KKS A;  2HQE A;  2F0W A;  2G9D A;  4HCE A;  3D4W A;  2XWJ B;  4HSP A;  5KYI A;  5ELD A;  5FOB B;  4ZLT F;  2AQ3 B;  2PCF B;  5G3L F;  1DZ1 A;  2NTT A;  3QJY A;  5JPM C;  1SE3 A;  2PO4 A;  4XQN A;  2D9U A;  1S5B D;  1VDZ A;  4BY1 B;  1TWF B;  4CJ2 C;  3VA7 A;  1O7L A;  2JEB I;  4QMG A;  3QWN A;  5ELC A;  1E0B A;  4I7Z C;  2EXZ A;  3W2D A;  2GA4 B;  3SXH A;  4LJZ C;  1BQQ T;  1BF4 A;  3NE5 B;  2R7Z B;  1B2T A;  2EYH A;  4UAI A;  3E0J A;  4K2L A;  3MA2 B;  1Q3L A;  1WTR A;  1WVL A;  2OT2 A;  2XRQ D;  5JJZ A;  4XIG S;  2XVS A;  4LMQ D;  4KN7 C;  1GUG A;  4RKB A;  3CQZ B;  1I6V C;  1LTS D;  4A3F B;  4HSV A;  1C8C A;  3I73 A;  1B44 D;  1FD7 D;  4TQU S;  1D2B A;  5I6Y A;  2EY1 A;  4BS9 A;  1CHQ D;  2BA1 A;  1IW7 D;  2EYL A;  3KUP A;  4DNR B;  3U9S A;  4WJW A;  1TS3 A;  3HOZ B;  3ITP A;  1Y8N B;  1F9S A;  4KMU C;  5C3W A;  1BDO A;  3SK5 A;  3BVM A;  3SHL A;  2LY7 A;  1H9R A;  2BDN A;  2F0J A;  4EQP A;  3T4A C;  5C0X G;  2F0N A;  1DM0 B;  2K32 A;  1RTO A;  1QCB D;  3M85 A;  2VB3 X;  1HRJ A;  3AB9 A;  2J4X A;  3HKZ B;  4K5W A;  4NW2 A;  1OO9 B;  1EQV A;  1Q8I A;  3TBI B;  3BDC A;  3SK4 A;  1PTO D;  4KKT A;  5M3M B;  1PXU A;  3MXU A;  3NQI A;  3H6M A;  3HRZ C;  1O80 A;  3K57 A;  3I8Z A;  1IKL A;  3TZU A;  1CI3 M;  2DN8 A;  2D5D A;  4TSS A;  1EL0 A;  1U4M A;  2IX1 A;  1STG A;  2SOB A;  5C4Z A;  1VF5 C;  4FF1 A;  1GHJ A;  2EYO A;  5JAV A;  1RDP D;  2L0C A;  4DK0 A;  5CV9 A;  1SYG A;  4LAA A;  2F0K A;  3S1N B;  2EYM A;  2NVQ B;  4DU9 A;  2NN6 H;  4BA1 I;  2TSS A;  1JQY D;  1EU3 A;  4KY7 A;  3TSS A;  4R9W A;  2MPM A;  4XQQ A;  1U4P A;  5IOD A;  3H94 A;  2B2Y C;  5LL6 X;  2LMC B;  1O7Z A;  5E4W C;  3I70 A;  1PRT B;  1DJR D;  4ZYS A;  4G7H C;  1U4L A;  2RDF A;  4IFD G;  1RF2 D;  4V0B A;  5I4D A;  1ZKO A;  4RFB A;  5JEA H;  5CBA E;  3IAY A;  1ZYR C;  3GTM B;  4XYQ A;  1I4R A;  5K36 H;  4FNF A;  2K5W A;  5LHY 1;  1SMY D;  3A8K E;  4DAV A;  3VR4 A;  5CC4 A;  4RKL A;  1I6H B;  4MIU A;  1O78 A;  3P1H A;  2HDL A;  3R8B A;  2F0D A;  4E6I A;  3HOV B;  2ICE C;  1EZ8 A;  5F2D A;  1IYV A;  5KRU A;  5KIX A;  1VMC A;  3FDT A;  5EPL A;  5C4X B;  4HR7 B;  2NZ1 D;  2PQE A;  5IGG A;  2CW0 D;  1LTI D;  4KKU A;  2F0L A;  3D6C A;  3PUY A;  1KTK A;  1CT1 D;  5EQ0 A;  3OW7 A;  2HUG A;  2OF1 A;  2VUM B;  1Z47 A;  4MN3 A;  4ZUJ A;  5A35 A;  3A55 A;  4HMJ A;  4G7O C;  1T5E A;  4IQZ A;  2EOT A;  4DXF A;  4H0L C;  3T56 B;  3VYR A;  1ROD A;  1KNA A;  1STN A;  4JBW A;  1J9O A;  3J7Y W;  4OO1 G;  3RZD B;  1STB A;  1Y8O B;  2DNC A;  2R92 B;  2KOL A;  1GUO A;  1QWY A;  2EYJ A;  2MJ8 A;  3CHB D;  1NR4 A;  1LT4 D;  2KEC A;  3H09 A;  1EY5 A;  1XXG A;  3EFX D;  3K0Y A;  2O5I C;  1WTO A;  5CBE E;  5NUC A;  3M4Y A;  4PQX A;  3HS0 C;  1HA6 A;  3DM1 A;  1X32 A;  2Q8R E;  1F77 A;  4ZKB B;  3I4M B;  4FF4 A;  5CV6 A;  1GHK A;  3O13 A;  5A2Q E;  1WD1 A;  1RD9 D;  2ZXO A;  1T5X D;  2MHV A;  5KEE A;  3MHB A;  3JAM L;  2XN9 C;  4OGQ C;  3Q24 A;  4OO1 I;  3IKJ A;  4WOR A;  1R4Q B;  1EYD A;  3PUX A;  4CJ0 B;  1PFM A;  1YNN C;  3S17 B;  4ZAI A;  1F9P A;  2K5Q A;  1CZG A;  1DYQ A;  3FPU B;  3OWF A;  4DAY A;  5ELB A;  3VR2 A;  3MC0 B;  1NCV A;  1RTN A;  2B39 A;  4RGM A;  3PO3 B;  5FK9 C;  4ZQ3 A;  1EWH A;  3BYT B;  1R4P B;  5IT9 L;  1PZI D;  2XRS D;  1EU4 A;  2PW5 A;  4V19 0;  1LT5 D;  1BCP D;  3L9A X;  3R2T A;  1SE4 A;  1Z7T A;  5CMD A;  5IGF A;  4AYB B;  1GUT A;  1JB3 A;  2WAC A;  4IZ8 A;  1BUV T;  4IUT A;  1BCP F;  2ICI A;  1OXT A;  2JE6 I;  3IFT A;  2PNR C;  4F8M A;  2BE5 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...