1AEXA

Staphylococcal nuclease, methane thiol disulfide to v23c variant
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
135
structure length
134
Chain Sequence
LHKEPATLIKAIDGDTKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title Mobile unnatural amino acid side chains in the core of staphylococcal nuclease.
pubmed rcsb
source organism Staphylococcus aureus
molecule tags Nuclease
total genus 32
structure length 134
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1997-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1aexA00
1EYAA 2KHSA 2RDFA 4N9PA 5CV5A 3SK5A 4B9WA 5I6WA 4QF4A 4IZ8A 1EZ6A 4PNYA 1SYFA 2OF1A 4ID6A 2EYLA 3QOJA 2F0VA 2EY5A 4KY6A 5J1ZA 5IGDA 5HGTA 2EYHA 2F3VA 1TR5A 2F0SA 4ODGA 4F8MA 4KD4A 4G57A 3T13A 3ITPA 1STBA 3EJIA 5CV4A 1EYDA 2F0MA 1ENCA 1EYCA 3VA5A 4K5VA 1A2TA 1KDBA 3SXHA 1EQVA 2F0DA 3NP8A 5HURA 3OWFA 1F2YA 2PW5A 3SR1A 4DFAA 3V2TA 3HZXA 1EY5A 2SOBA 4I65A 1JOOA 2PZUA 4K8IA 1A2UA 1NUCA 3MXPA 5DAUA 1SNMA 3RUZA 5IGCA 4K2KA 3BDLA 4ZUJA 4B9XA 2HQEA 5J22A 1JOQA 2NUCA 1STNA 2QDBA 4EQOA 2F0KA 2F0NA 1II3A 4K2LA 4HTHA 4K6DA 4KJOA 1EY9A 4EVOA 4IUNA 1STHA 2EY6A 1KAAA 1KDCA 3NXWA 5CV6A 5C5MA 3TP6A 1F2ZA 2EYPA 3MEHA 3D8GA 4J1MA 4K8JA 3MVVA 4PMCA 1SNQA 4KY5A 1RKNA 1SYGA 4E6IA 3SK4A 3E5SA 5KRUA 1SYDA 4KY7A 3OMGA 1SNCA 2EYJA 3QOLA 3PMFA 4R8NA 4RKLA 5DEHA 1STGA 5E1FA 2F0EA 2PYKA 2EY2A 2F0GA 3EROA 2F3WA 3DHQA 5CV9A 1A3UA 2EYMA 2F0FA 2OEOA 2PZWA 3HEJA 5C3WA 4F7XA 2F0HA 1TT2A 3LX0A 5KGUA 1F2MA 3R3OA 3C1FA 5I9PA 4IALA 1SYBA 3T16A 5IODA 5KYLA 2ENBA 1A3VA 2OXPA 2EY1A 2WACA 4MIUA 2PW7A 1EZ8A 3TP8A 5C4ZA 5IGBA 2F0PA 1STYA 2EXZA 3NK9A 1KABA 1EY8A 4DU9A 3DMUA 5ISRA 1SYCA 3D4WA 4DGZA 4ZUIA 1JORA 1JOKA 1AEXA 2M00A 2F0LA 3H6MA 3NUCA 5IOCA 1SNOA 3U9OA 3D4DA 1SNDA 3TP5A 3P75A 5CC4A 1IHZA 4NMZA 4DF7A 4TRDA 5I6YA 1EY0A 5IGFA 3C1EA 4WORA 4HMJA 4KD3A 3OMCA 4K5WA 4K14A 2F0IA 4KHVA 2F0TA 3BDCA 2F0QA 2LKVA 4HMIA 4PMBA 1U9RA 4KV6A 5EKLA 3D6CA 4ME5A 4K5XA 1KDAA 2RBMA 4EQPA 1EY4A 4KTAA 5K5PA 4YIJA 3MHBA 1A3TA 2RKSA 5NUCA 5KYIA 4RKBA 4ZQ3A 4NP5A 5CV7A 4WRDA 5C6AA 3QB3A 5EKKA 2EYOA 5JOBA 1TQOA 2PZTA 5C5LA 4QB4A 5IIFA 1NSNS 3NQTA 2EYFA 5JAVA 2SNMA 1STAA 5KIXA 5CGKA 5KEEA 5M9OA 5CR3A 1ENAA 5EGTA 3SHLA 2O4XA 4LAAA 5I9OA 1SNPA 4J6HA 2PQEA 3OSOA 3TMEA 2SNSA 2F0WA 5C4HA 4NKLA 1SYEA 1EY6A 4NDXA 5F2DA 4OL7A 5J39A 4S3SA 2KQ3A 1EY7A 2F0OA 3MZ5A 3TP7A 5IGEA 2F0JA 4EQNA 3ERQA 3NHHA 2F0UA 4KJNA 3SK8A 4N9TA 3S9WA 5C3XA 3EVQA 4H7BA 5CV8A 5E3FA 3SK6A 5IGGA 3P1HA 4QMGA
chains in the Genus database with same CATH superfamily
1GUWA 4B3SL 4QIWE 5A35A 4IFDJ 4ID6A 3URYA 2KHIA 4QL5A 4KY6A 3S1RB 5JJIA 3I4MG 3R93A 3ITPA 3F2CA 1K0RA 2A5HA 3BDOA 2K03A 3W1GA 4RFBA 3PIO3 1WTQA 1N32Q 3SXHA 3J7ZC 1JR0D 1VF7A 1QZGA 3H0GG 1J5EL 4GNXC 3KJPA 1H9JA 1GUTA 5IGCA 4F87A 2B2WC 2H4OA 2NTTA 5EBCA 4EQOA 5BR8L 1SFOH 1EY9A 4IJLA 1SE8A 1UE6A 3PO3G 3D8GA 1FNWA 1IBKL 1SNQA 1MGSA 4IFDH 5J3BA 3N6RA 5KRUA 1GVPA 1JJCB 1A62A 5K36H 4MZ9A 3CCEA 5DEHA 4JI6L 4LF8L 5D3IB 4OWWB 2BH2A 5ISRA 4JCVE 1BQQT 2WFWA 2KBNA 1P16A 2PNRC 1V1QA 1ET6A 2ENBA 2Z4IA 4MIUA 4DAMA 3U58A 3I70A 4GNXA 3T1HQ 1XMQL 2Q2UA 3CD6A 1X6OA 3D4WA 4L63B 2KEEA 2B2WA 3IFTA 4CDDC 4I7AA 3VYSA 4N8FA 2NVTB 2A69C 2QEJC 1N36Q 3P20A 1K8AC 5I2XA 2Z6KC 1HRJA 3VR4A 1UE1A 1PTOB 4MTNA 4LUOA 4DR3Q 3BDCA 4HMIA 1Y1VG 1JJGA 1VQHA 2QDLA 4B3SQ 2B2YA 1JE4A 2KVMA 3GTMB 4YIJA 5BN3A 3OW2A 1D6EC 4WRDA 5JOBA 1TQOA 4BBRG 3K80C 4X3UA 1WI5A 5ELBA 1E2ZA 3J7YW 1HNZL 1ENAA 5I9OA 2IHEA 2FMCA 4NDXA 1UEAB 3GTOH 1YJ9A 4N9TA 5JVH3 2R61A 4A3CH 2ZJRA 2JA5G 2F4VL 2FINB 2Z6KA 5BR8Q 1VQIA 2N3SA 1TWHB 3VR2A 1XX8A 4OO1H 1ZYRC 3NTHA 3ER0A 4CJ0B 2PQAA 4YCWA 5COYA 2F0SA 1GHKA 2JA7G 4JI6Q 2H5XA 4LF8Q 2OCEA 1EEID 1JB3A 3NP8A 4HCSA 1LTAD 4BY1G 1UE5A 3E0EA 1TS3A 3V2TA 1MJCA 4C3JG 2AWOA 1SNMA 4ABNA 1IKLA 1PFNA 3DWAA 1E1OA 2E2IB 1JOQA 1EWCA 1XMQQ 2F0NA 4K2LA 4M1UB 3HOWH 4LF5L 4YY3L 1STHA 3TP6A 1TVXA 4TVAB 4E6IA 4IFDI 2E5LL 2MUYA 3QOLA 5M3FB 4F88A 1VQLA 3DHQA 2DGYA 1RJTA 1HR0W 2KHJA 4C1NK 3BU2A 4F7XA 3K5MA 2K33A 1TKWB 3VYRA 4QIWB 4L5QA 4QCLA 3KF8A 2PW7A 4C56C 1O80A 1S40A 3HOVH 5IGBA 3S17H 2R7ZB 1K3RA 1YNND 3D3RA 4QJFA 2CQAA 1HNZQ 3H6MA 1XNQL 2CH4A 3NUCA 2V1CC 1UWVA 4MNOA 3P75A 4A3EG 3KK7A 4OWXB 4IPHA 1X55A 5M5XH 4P75A 3HGBA 1I4RA 4LJZC 5CYUA 2VQFL 4DV5L 5K5PA 5LMUL 1MIUA 1VF5C 2HQLA 3J81E 5IT9L 2Q8IB 1I4QA 1SE4A 1DOMA 2V4DA 1C7YA 2R3ZA 1EY6A 4CHTB 1Y8NB 3NHHA 1CZGA 1X3EA 2N78A 1KL9A 2ZXPA 1EU4A 1C48A 2XN9C 5E3FA 1F2LA 1FYCA 4DR1L 1NJIC 2NVQH 4LF5Q 4BXXH 2L55A 4YY3Q 1EUJA 3KDFB 4B9WA 1Z47A 1EZ6A 4B3TQ 4IFDG 4UY8C 3PUXA 4OO1I 4DNRB 5HGTA 1M8AA 5C44B 3FHWA 2A19A 5JJKA 2DNEA 2XIWA 2KECA 1RD9D 5BN5A 1SBBB 3T4AC 1KAWA 1YZ6A 2K6AA 3CAMA 4ZUJA 3K7AH 3K6OA 4R4QA 2NVXH 2F0KA 2CWPA 1EL0A 3CCJA 5JJZA 4A3IB 2EZVA 4P74A 1XNQQ 4K8JA 4PMCA 1RKNA 1FNUA 3MXNB 1EIGA 1BF4A 4A3FH 1VQ5A 1XPUA 2G9HD 4H13C 2A1AA 2VZAA 1TWFH 1PTOC 1QVFA 3DXJC 3LNNA 3C3LA 4DV5Q 4GN4B 5LMUQ 2E2HB 1AFPA 1A3VA 4ZAIA 1PV4A 1WTOA 1AEXA 2K5WA 2C5CA 2B39A 2B2UA 4DK1A 1A63A 2R92B 2C35B 3TP5A 4GLVB 2D62A 2UUBL 1EY0A 3A7AB 1NR4A 4HMJA 4A3CG 1CHPD 4CKBA 4KHVA 3R2TA 1PTOF 1EIHA 1BOSA 5JPNC 3I4NH 5ELDA 3D6CA 1YVCA 4OO1G 2D0OA 5D14A 3D31A 3MHBA 5LMNW 2R93B 1IYVA 3AQQA 5EKKA 1NR2A 3L2PA 3G71A 3K5NA 4LF7L 5GADC 4IUTA 2R6GA 1GUGA 5T1IA 3KLRA 3W3AA 4A3MH 3S2DB 2VS1A 1WD1A 1SNPA 5FK9C 5J39A 1JMCA 1SYEA 2E76C 3CCMA 4R8IA 1PLFA 2F0JA 5IY0A 1LTRD 2ZJPA 2UXCL 4AH6A 1V1PA 2NBFA 1I4PA 5IGGA 4RWSC 3HOWG 4XT1B 2CW0D 1LT6D 3BYTB 5T1GA 5CV5A 1QJOA 3S14B 1IZ6A 2SDFA 4OX9L 1CKOA 1JWMD 1JQYD 1MHWC 4KD4A 1X54A 5TSSA 1B53A 2AMCB 2VUMB 2N49A 1F9RA 4CDFC 3KJOA 3FVQA 4RA8A 4POFA 2ZT9C 3HOVG 3W1BA 2WAQG 4OXPA 3CQZH 4ZCKA 3S2HB 4X3KA 4DNIA 1HA6A 3BJUA 4EVOA 1JE5A 4J15A 1BR9A 3ULJA 1PH4A 4FF2A 1BDOA 3RZOB 1UEBA 1RIPA 4HIKA 1B3QA 1MBYA 4RKLA 4KLKA 3CRKC 2WB1B 2EYMA 3TDQA 4G7OC 2UXDL 1T9HA 3TQYA 1WTHA 4G7ZC 3M9BA 1R4PB 1VQ6A 3V96A 2MFIA 5FLXE 4LF7Q 1G6PA 3A74A 5FKAC 1HUMA 2BH8A 3I4MB 3UDFA 2EDGA 1SROA 1SNOA 4BA1I 2Z4HA 4UDUC 2HUGA 1TS5A 1YEZA 4IUUA 3H0GB 3PO2B 3KLSA 4BBSH 4BY7H 2UXCQ 1WJJA 2R7FA 2KCNA 5IP7G 2PMZE 4HIMA 4BXXG 4GNXB 3MWYW 4A76A 4X64L 3AYHB 1JWUD 5EAYA 5CBAE 4OX9Q 3KUPA 4RKBA 4X6AH 2DY7A 5CV7A 3QB3A 1R9TH 3CP0A 3WDNA 2IX0A 4YWKA 1QILA 5H1SE 1NMGA 3SDZA 1T5EA 3GTPH 2AWNA 4QQBX 2FXQA 2LMCB 4L5TA 2FMMA 2OQ0A 3NELA 4R1JA 2E2JH 3NQIA 4JI8L 3CC2A 3PIPA 2QF7A 2VW9A 4IZ8A 4CJ1B 1EIFA 2BDNA 3CCLA 4A3FG 1LT5D 3W5OA 1Q86C 4CDCC 1T5XD 1XMOL 3HOXB 2B29A 2PW5A 1Y1VB 4DFAA 5IP9H 2HQEA 5J22A 4A3LH 2QDBA 2YV5A 4BBRB 4KJOA 2QEXA 1HCZA 1CM9A 1NCVA 1ILPA 3CCSA 1KAAA 3MEHA 1LTBD 3T1YL 1I3QH 1Q81C 4KY5A 1PH3A 3S16B 3HKZG 3CF5A 5E1FA 2EIFA 1PRTD 4BWGB 3M3YH 3I4NG 3B6YA 2JA5B 1D7QA 5FOBB 4KKUA 4X64Q 1TS4A 1KTKA 3OPOA 2F03A 2IX1A 2FFKB 5LHY1 5GAEC 3NSWA 3DMUA 2BA0A 4C3IH 4DXFA 4A3MG 2ICEC 2MQHA 3K0YA 2JA7B 1Q46A 1YHBA 2G9DA 4IPCA 3C46A 1WD0A 1FL0A 4Y52H 2B63H 1JWSD 1G51A 3QIAA 1VQEA 3VYTA 4C2MB 1CQVA 1VQ4A 4PQXA 5E4XA 3PIP3 3BVGA 4LF6L 1D1KA 2K52A 1GXDC 1XYIA 1Q90A 4JI8Q 5BN4A 2LKVA 1DYQA 4ME5A 4A3BH 1NTGA 1LTTD 2A74C 2XWBB 4WJWA 1LACA 3CCVA 1Z6HA 3UDIA 1S72A 1HH2P 2EYFA 3RLOA 3WOEA 1BVSA 1XMOQ 3SHLA 5HY6A 2JE6I 3TMEA 2VNUD 2D9UA 4JI7L 1B4OA 4OL7A 4S3SA 3H15A 1N34L 2EJGC 2JYOA 2I46A 1XTCD 2K01A 1WTVA 3RN5A 4DUZL 3I55A 4P73A 3FPUB 3T1YQ 3QOJA 5IYDH 2F0VA 4A3EB 1UUPA 1XJVA 4HJ9A 2F0MA 4FDBA 2AQ3B 3NE5B 4Y7NH 1B7YB 4XYOA 2L9HA 3FPPA 3SR1A 1EY5A 4GN3B 4IQZA 4R4IA 4PMWA 2K1BA 2JEBI 2IL8A 1IKMA 3TS0A 4RCOA 1Y1WH 1F9PA 4A75A 1TWGH 2PO4A 1VMCA 2EYPA 4J1MA 1S4ZA 3CKIB 5C3EB 2Q2TA 1I94L 4HIOA 4M8AA 3OMGA 4BBSG 4X65L 4BY7G 3PMFA 4R8NA 4LF6Q 1S5ED 4AYBB 1A3UA 3TZDA 3MFYA 4IOCA 2XTIA 4U68A 1NNXA 1L0WA 1SFOB 2F0HA 2J4XA 1F2MA 2MP1A 3T16A 2HHHQ 4FXDA 1EZ8A 3F2DA 4O2DA 1W6KA 1ESFA 1PFBA 2ID0A 1JORA 4XIGS 4I7ZC 3CHBD 3IKJA 2Y0SE 4NPSA 1SLJA 3T53B 3RD4A 4A93H 4JI7Q 2VB3X 1K28A 4QGUA 4CDEC 1N34Q 2IJ0A 3S1RH 2XVSA 2B2YC 3X3NA 2F52A 3I7FA 4LFBL 4UAIA 2F0TA 4DA2A 1STEA 1U9RA 1YJNA 2ZXRA 4K5XA 1DOKA 4EQPA 4DUZQ 4H02A 1LUZA 1A3TA 3DM3A 2NTSA 1X3GA 1C0AA 1EYGA 1HR0Q 1IW7D 3NQTA 2YTXA 1FR3A 3K5OA 1U4MA 1DGSA 5EGTA 1PH8A 3OTOQ 4KHPQ 4ULLA 2SNSA 5F2DA 2FHTA 2EVBA 2D2CC 5GAHC 3TP7A 5IP9G 4A3KG 3ERQA 3ULPA 1DXMA 1IBLQ 4HN7A 3RR5A 4A3LG 2HIVA 3ERSX 3IRBA 4G7HC 1GD7A 1LT3D 3S1MH 3PV0A 3G6EA 1ONLA 1VQJA 1Q8KA 3K81C 2OF1A 4JYAL 3TS2A 2ZTEA 3LWEA 5D3DA 2L12A 1VQ9A 3GTOB 4X65Q 1FNVA 4DAYA 1B50A 2WINB 4QUFA 4BS9A 5IT9E 1SRUA 3FP9A 2KJXA 1YNNC 2RA4A 4ALPA 1V1PB 2RSNA 4K5VA 2KEDA 2L4NA 3K0XA 3L9AX 1J5EQ 3J80L 2JA6B 1PA6A 1LTLA 4HAEA 3CCQA 3RUZA 4K2KA 2PI2A 3K59A 3W2DA 2DY8A 4IURA 4HTHA 4C3IG 1P8LA 3I2ZA 1SMYD 3HOZH 2O5JC 2KOLA 3V05A 5C5MA 1IBKQ 3GV3A 1E22A 4H0LC 1K8OA 3MVVA 2B63G 1EWIA 2BE5D 2EXDA 2CQOA 3L7ZC 1YBYA 3GP7A 3HKZE 5E7NA 1MSGA 4ZRZA 1STGA 2K5QA 2PCFB 3SVMA 4LFBQ 1JICA 5LMNL 3MAQA 4A3BG 3A8IE 5C3WA 3HOWB 1QVGA 1TWCH 1EWHA 2NN6H 3C1FA 5IODA 5GAGC 3PF4A 2RQXA 1KXLA 2A6HD 1U4RA 3ONAB 2M00A 5IYBH 1RCVD 3A54A 3H91A 4DK0A 1Z9FA 3HP3A 2M9VA 2IW3A 1GKHA 3D4RA 5CC4A 4TSSA 4HCEA 3PQIA 4UP7A 2RCNA 4NXNL 2AQ2B 4K5WA 4Q0FA 3HOVB 3J80c 3S17B 1B70B 1S5BD 2WAQB 1KIXA 4UP8A 5KNBA 1DD2A 1LTID 3HRZC 1K73C 5IYDG 1PFMA 1Q1EA 2KUMA 1V43A 5M5WB 3M4OH 3NEMA 1E3PA 5M5XB 4OGQC 3KYHC 3OOCA 1HZBA 3QR8A 2WKCA 3N52A 1PXUA 1LM0A 4XDXA 2IY5B 2F0WA 5AFWA 3UDGA 4GOPA 1B44D 1HXYD 1LTSD 1CT1D 3QJYA 5C4JH 4A3DB 4PZ7A 3D0FA 3SK8A 1JCKB 1IBML 1A0IA 3J80i 2F4VQ 1Y1WG 4XT3B 4CKCA 4N9PA 2KHSA 1QOHA 2Q2HA 5FJ8H 4JG2A 5ELNA 5JPMC 1A8VA 4K0KL 1XTDA 4OIJA 1JT8A 1CKNA 4XTCS 1DZ1A 1M1KC 2EYHA 1J9OA 1M4VA 5I4DA 2Z8LA 1ENCA 5LMNQ 1A2TA 2NVQB 3CMAA 3ND8A 4OELB 4LFCL 4K8IA 3DWQA 3F1ZA 1TY0A 4LMQD 1ZKOA 5IP7H 3BS1A 1ZEQX 1STNA 1BBWA 2JA8H 1PRTB 1IYUA 1GO3E 4A93G 4YWMA 1RHPA 1X65A 2E5LQ 4R4CA 3SK4A 1PYWD 3GDEA 3E9IA 3GTLH 1TXYA 2SEBD 4NXNQ 4JK1C 2WIIB 1H95A 5FLMH 4FYDA 3K7AB 4P2CB 1F77A 2NB0A 2NVXB 2JK8A 1EFWA 4A3JH 1E2VA 1C9OA 2NN6I 1Q12A 1VQKA 3S24A 2MJ8A 3TP8A 2B2UC 5C4ZA 2EXZA 1J8IA 4A3FB 4GLXA 4EGVA 5CMDA 5L37A 1CI3M 1KRTA 5JJLA 3PSIA 5IT9c 4C1NI 1LABA 2CW0C 4JBJA 1TWFB 3RLNA 1BCPD 3GTKH 4L8JA 1RTOA 1VQBA 4DF7A 3U9SA 4LW1A 1VQCA 4FO2A 4B3RL 5A2QL 1IBMQ 2F0IA 1S5DD 4V190 3VR6A 3I4LA 3IAYA 2VQFQ 3KFUA 1ASZA 3RZDH 4K0KQ 4ZKCB 4L6TB 2I07B 1TY2A 3UDXA 3VR5A 1PH5A 3VDYA 1ENFA 4FVMA 1PH6A 1STAA 5KEEA 3F8TA 4A3IH 4J6HA 1I50H 3I4NB 4GKKL 1EY7A 4LFCQ 3GQBA 5IGEA 3L0OA 4DV6L 4WJ4A 4DV3L 2PI2E 1L0YB 5CV8A 4XQQA 4DR1Q 3HOZG 1EYAA 2EJFC 3SK5A 4A3MB 2E2HH 1CKMA 4OWTB 2QCPX 2JP1A 2CCZA 2KCMA 2LXJA 1X3PA 2F3VA 1TR5A 3EJIA 1Y69U 4B08A 1EYDA 1WTXA 4HEDA 2NN6G 2R92H 3CRLC 2KA7A 4Q5VA 3G6JB 5CORA 3HZXA 1ML0D 1TU2B 1KLGD 1PFSA 4JI3L 5IYBG 3AMUA 3TBIB 1E0BA 1HJPA 1KLUD 1B1ZA 3I73A 1AP0A 2R93H 5IE8A 3S1QH 3QO2A 2LY7A 3EIVA 1D5ZC 4B3RQ 5GROA 1EQRA 2PYKA 4LUZA 3R8BA 2RDHA 1Q82C 2NYZD 3CQZB 3EQLC 2A8VA 4UPAA 2JN4A 2J0TD 2HIXA 3Q6SA 1H9RA 2OXPA 2RDGA 2RHQB 3PUVA 5JEAJ 1SE2A 4PG3A 1OXTA 4HR7B 2Z9HA 4X62L 4ZUIA 1U4PA 1L1OA 1D2BA 1U4LA 1W6JA 1NMFA 4CBVA 4DR5L 1FD7D 2GVBA 4GKKQ 2UUBQ 3GTJH 4WJ3M 1FJGL 4DV6Q 4DV3Q 3O13A 5EPKA 2ATWA 1PZKD 2LFNA 1OO9B 4PMBA 1C4QA 5FJ8G 3SGIA 1KDAA 1EY4A 3HOYH 3MC0B 2XRSD 1SEBD 3MTSA 1MI2A 5KYIA 2QGQA 5C4XH 1NSNS 5JEAH 4BBSB 2SNMA 4BY7B 1PYSB 2Y0SG 4GKJL 2CKZB 1W2BA 3VYUA 1PH9A 2IPKD 2OTJA 2UUAL 3M7NA 3DEPA 1YNJD 2F0UA 3K58A 2EQSA 4OEMB 2JA8G 1R9TB 4JI3Q 2JQOA 1TIID 4JPBW 5M5YB 1AE3A 2RDFA 1O7LA 1PRTC 4DK6C 5IYCH 4TQUS 1CUKA 3S1NB 3PO3B 3GTPB 1SXTA 1BUVT 2IWHA 5IGDA 1Y14B 4YCVA 2CFMA 5FLMG 1EOVA 2VY3A 1STBA 3Q23A 4UHVA 1OXVA 3NTIA 1RODA 4A3JG 1FVIA 2UXBL 2E2JB 2F0DA 4JBMA 3OWFA 3OIPA 3GD7A 4I65A 2AKWB 5KIXA 3LGJA 3PO2H 1A2UA 3MA2B 4R4OA 3X3MA 1II3A 4K6DA 1PRTF 1EQQA 2IT1A 4DAYB 2YTVA 3J7AF 2L15A 4DR5Q 2NZHA 1PYBA 2K28A 3E5SA 4KY7A 3G7LA 1NAPA 2GVAA 1N33L 1IXRA 4FNFA 5ELEA 3H09A 2F0EA 3DM1A 1CTMA 2F0FA 2UXDQ 1QWYA 1OXUA 1V1OA 2B8GA 2XWJB 5IWAL 4RAUC 3JAME 2RHSB 4JOIA 3ICEA 3S15H 4A3KH 1VQFA 4B3ML 1HZ9A 1G2SA 4LF4L 1KABA 2PPBC 1HFNA 1CK1A 2PQAB 3VA7A 4P71A 4A3IG 1DOLA 2UUCL 3ND9A 1XPOA 4HJ8A 4GKJQ 4DV0L 1K83H 1SJHD 4WFN3 1HTLD 2EPBA 5M3MH 1HPCA 1Q8IA 4MN3A 4IPGA 3SE0A 2YU9H 1VQ8A 4KD3A 5EKIA 1VQPA 1XPRA 4RGMA 4XQNA 2B2VA 1B9MA 3HOXH 2IX3A 1XWEA 4XQJA 3K7UC 4P72A 1E1TA 1TWAH 2RKSA 1GOZA 4IUQA 2QA4A 1D5MC 1JJ2A 3FDTA 2B63B 5IIFA 4X66L 3FEWX 2D5DA 3QWNA 4JV5L 5ELCA 3E9HA 1LO5D 2O2LD 2RVLA 4DV4L 2WKDA 4LAAA 4C3HH 2R92G 2X6GA 1Q7YC 4BY1B 3MZ5A 3E6ZX 4A3GH 1I5FA 4JI4L 4C3JB 3KF8B 3I72A 2BDOA 3CCRA 1X56A 1K0SA 3GTGB 3CW2C 2NVYB 2F1MA 2A68C 4PNYA 4AQYL 2R93G 1HZCA 2AQ1B 4O42A 3H3VH 2HDMA 1N33Q 3M85A 1I4HA 1V8QA 5LL6S 1E7ZA 1EYCA 4LK1C 3Q8DA 1KDBA 3F2BA 1N32L 4MTKA 1G2TA 4DR6L 1AH9A 1GJXA 5IWAQ 1I6HH 4GS3A 5DAUA 4B3MQ 3G48A 1YNXA 1ASYA 1CKNB 1DM0B 1H9KA 3J7A5 4X3TA 2UUCQ 5CV6A 1EU3A 1HUNA 4Y7NB 1WCMH 1GUNA 1CA5A 2K5DA 1SYDA 2K32A 4AIMA 5EQ0A 2EY2A 3JAML 2PMZB 2PZWA 2OEOA 5G3LD 1IW7C 1CSPA 4RMFA 3HOYG 3K57A 1PDQA 1TWGB 1BCPB 1PZJD 1QUQA 3OYYA 1ICFB 1K3BC 1FGUA 2WACA 3J80E 1EFID 2GN5A 3PUYA 3AB9A 4X66Q 1STYA 5C4XG 2D0PA 5JEAG 3BYYB 4JV5Q 4IJHA 3RN2A 1GUOA 4G4KA 1B8AA 1HHVA 3D4DA 4DR2L 2Q2IA 3PGZA 3GTQH 1N36L 4TRDA 1DJRD 1WOCA 3CU7A 2N55A 4XXEA 4JI4Q 2K7VA 3FKIH 2A68D 2ZTCA 2LXKA 3HOUH 4EQNA 5IYCG 1X3QA 3PF5A 4AQYQ 2B2TA 4A93B 3HS0C 1VQNA 2AHOB 2KCTA 4FXKC 1E24A 1VMPA 3TREA 4CKEA 3EA6A 3MEFA 2PQEA 3OSOA 1SMYC 5C4HA 4NKLA 5C3EH 4DR6Q 3SEBA 3PO2G 3OHXC 1SJED 3JAMc 3I91A 4KJNA 2BE5C 3E0JA 2A6ED 3S9WA 4H7BA 3GV6A 2ZXOA 1IYJB 3EN2A 1W3SA 1B3AA 2E8GA 1TS2A 3PUWA 1L2FA 4KKTA 5I6WA 1HNXL 1EOTA 1AZPA 5J1ZA 3H3VI 1SR3A 5EJWA 1NE3A 1VQGA 2LSSA 2HCIA 3STBD 4EQ5A 5EBDA 2A6HC 3S1MB 3CXCA 3KF6A 1J6QA 2RF4A 3KLSX 4OONA 3JAMi 4DN4M 1JOOA 2XSCA 3Q24A 1RDPD 1EEFD 2O5IC 4B9XA 1QZHA 2Z1CA 1HQRD 2IHFA 1VDZA 2EY6A 1KDCA 3K8AA 1F2ZA 2OT2A 1YJWA 1CHQD 1LTGD 1I94Q 2CH4W 4PZ6A 5M3MG 4DR2Q 3I56A 1H9SA 1AZQA 1HNWL 1K8MA 4R9WA 5CV9A 2NVTH 3HOXG 3AFQA 4DK3C 3HOZB 1VCIA 2QW7A 3D6WA 5I9PA 1KNAA 5KYLA 1WYDA 3RMHA 1PH7A 1UNSA 1S5CD 1BBUA 5GQOA 4A4IA 2HD3A 1PTOH 4HJ7A 3Q0AA 1EY8A 2L11A 4DGZA 4JW0A 3TN2A 3HKSA 3OW7A 3GTMH 2F0LA 2UU9L 4C3HG 2TMPA 2JA9A 2FJ2A 2OTLA 4A3GG 1SNDA 1TWCB 4DNTB 2K14A 4KN4C 1VQAA 3BVMA 3CCUA 1IL2A 1O78A 3H3VC 1SDFA 1A6XA 1OTCA 2JA6H 4FXGC 1HNXQ 1L1OB 3U50C 4ZQ3A 3NBHA 2EYOA 5C5LA 3FMCA 4QB4A 1VS0A 5E4WC 1BNZA 5CBEE 4LF9L 4GOPC 4DV7L 4BA2I 1TWHH 2O4XA 2OWOA 3NPPA 5EPJA 1VQMA 2X69A 1K8GA 4GN5A 3M4QA 1WFQA 4DR7L 4YCUA 2QKIC 4ZKBB 1B2TA 3SK6A 3M4OB 4O1NA 1BXTA 4OHJA 3KLWA 2JXMB 2A69D 1X3FA 5A2QE 3CMEA 1MD2D 3CPFA 4JYAQ 3J81j 1WCMG 4B3TL 1O7IA 2KENA 2E2IH 1HNWQ 5C4JB 2WV6D 3T56B 4F8MA 1QE6A 3AFPA 1WTWA 2K04A 3GO5A 1MKHA 4LNQA 1SN8A 2K5VA 3MXPA 1BCPC 4PV1C 5M3FH 4HJAA 1RL2A 2DJFC 2I5LX 4JI0L 4X3SA 1WTPA 3UE0A 1R4QB 3NXWA 2UU9Q 3IFDA 1GHJA 2K75A 2Y0SB 2EJMA 2JEAI 4DPGA 4DR4L 1DCZA 2R7ZH 4LUVA 3ULLA 2NWGA 5HGQA 5M5WH 1U5KA 1F9QA 1ET9A 3FKIG 3EROA 3HOUG 2DUDA 2JA8B 3KBXA 1ZYRD 4U673 2N88A 2E2DC 1PMRA 3NWSA 5EPLA 1SAPA 1SYBA 3ZYYX 1BCPF 3DLLA 4A3DH 2H1EA 4DU9A 3GTLB 1DONA 4LF9Q 2I5MX 1JOKA 3BZCA 2JSOA 4DV7Q 3CPWA 4H44C 1KRSA 2LS01 5C3EG 4A3JB 4RHRA 4JVZA 4HIDA 3DEOA 4WORA 4JI1L 4DR7Q 1C8CA 2WB1E 3PUZA 4K14A 4AYBG 1AN8A 4YHHL 4KTAA 2L1BA 3H94A 2RSOA 3A56A 5D65A 1G291 3GTKB 3NWTA 3AU7A 4CGYB 2PZTA 2QILA 5K36G 4DKAC 1X32A 4HSVA 3BZKA 4NB3A 3BVZA 4RHSA 3DUZA 2NZOA 2AUKA 4K6LA 1WVLA 5FO8B 3U4VA 4IO9A 1S3OA 2VQEL 3RZDB 3I4OA 5C44H 1S5FD 2VB2X 3MXGA 5C0XJ 4JI0Q 1EQTA 5LL6X 3A8JE 3PCOB 2EOTA 5KNDA 3U4ZA 4QF4A 2E74C 2K4KA 1SYFA 1Y8OB 4DR4Q 1I50B 1SMXA 2EY5A 4IUVA 4ODGA 3HKZB 2ZJQA 1PHJA 3T13A 1FGBD 4ZYSA 2CHBD 1MSHA 2L5TA 1EQVA 5HURA 4O0AA 1F2YA 3NTKA 2SOBA 4NW2A 1IL8A 3BDLA 1BO0A 2NUCA 3A5UA 5C0XH 3C2PA 2XRQD 2I5HA 1I4GA 1U0LA 3G4SA 2DNCA 1SYGA 1WTRA 1I6VC 2VL6A 3I90A 4JI1Q 4QY7A 4V0BA 1G8ZD 3RLFA 1HA5A 2OQKA 1QCBD 1TT2A 4YHHQ 2JA6G 3J81L 4IALA 4DV1L 2P5ZX 2HDLA 4RGOS 1L1OC 4JI2L 3BZDB 3S1QB 3NK9A 1VQ7A 1VQDA 1LT4D 4HSPA 1QVCA 2VXWA 4UP9A 1YNJC 4KHZA 1ILQA 1QB5D 4MHEA 3RNUA 1YHAA 1KNEA 1NY4A 2E75C 1IHZA 4NMZA 2VQEQ 5IGFA 3C1EA 3IL8A 4CJ2C 1QUQB 2ALYB 1GM5A 4JI5L 3S2DH 1G6ZA 2F0QA 2MPMA 5EKLA 4KV6A 1XXGA 1QNUA 2R7DA 2M2LA 4IPDA 4TKOB 4NP5A 5C6AA 3GTJB 1L0XB 4IOAA 2Z0SA 1PTOD 5JAVA 1BKBA 1EIYB 3M4PA 5M9OA 1XNRL 1K9MC 3S14H 4DV2L 4HJ5A 2B3GA 1YI2A 3A55A 2MO1A 2F0OA 3HOYB 1Y8PB 5M3FG 1RTNA 4FP5D 2XNAC 1YHQA 3P1HA 3J81c 2VUMH 5C4XB 1V9PA 2G5DA 5AJ3L 4JC0A 3UE1A 3HFZB 1KC8C 3R2IA 2B8FA 2MNAA 2R7ZG 4FF3A 4KK7A 3S2HH 1LYLA 2Q8TA 1AW7A 4ILWA 1Q1BA 2ZTDA 5CV4A 5DM63 3TEHB 4RCNA 3VA5A 1ICWA 1KHIA 1QG7A 3P7JA 3RZOH 1Q3LA 2KCCA 4DV1Q 4JBKA 4A3DG 3TRZA 3L3OC 4JI2Q 2AUJD 4NXML 1KQSA 2MO0A 3KBGA 3FRPB 1YIJA 5KNCA 1F9SA 4YWLA 4DXGA 3J81i 2ZM6L 1RF2D 5C0XI 4DAVA 3KOJA 2MHVA 1LLRD 1CZWA 5KGUA 1CSQA 2TSSA 1YITA 4RGNA 5JVG3 3KF6B 1KD1C 1SNCA 2EYJA 1SSOA 3I4MH 4JI5Q 2F0GA 4JOIC 2F3WA 1JC7A 3NBIA 3HEJA 1GUSA 1O7YA 3VR3A 2XGTA 1QNKA 2YTYA 2I0QA 4RG1A 1PVOA 3LWUA 3LX0A 3QG1A 3R3OA 3H0GH 2EY1A 4FF4A 2F0PA 4DAPA 3K5LA 4X62Q 1LV9A 3MFGA 1H9SB 1UE7A 3A5ZB 4RH6A 4LFAL 5M5YH 2F4IA 1XNRQ 2MGSA 4DV2Q 3S1NH 3NENA 3M4YA 3PO3H 4KN7C 4GLAC 1FJGQ 3M7GA 2B2VC 2K05A 2L0CA 3S15B 3T51B 5C44G 4A3KB 4L5SA 2HT1A 4AYBE 2HCCA 3A8KE 1VQOA 2A73B 2PNHA 1CQFA 3OWEB 1UAPA 5AJ3Q 4N8X1 1I3QB 3JC66 1K83B 3F2UA 1CFMA 1D5XC 4J8QA 5M3MB 1SE3A 1JB7A 3KDFA 2F3IA 3I8ZA 3WOFA 2YU9B 2K5NA 1D1IA 5DLQE 5FO7B 3EBEA 1HTPA 3M3YB 1PZID 1OXSC 5DM73 2UUAQ 5DNFA 4LWCA 1HZAA 2KQ3A 2WP8J 2YYZA 1ZXTA 3CC7A 4NXMQ 1TWAB 5C3XA 3DWPA 5C0XG 2CWAA 4C3IB 3NBHB 2ZM6Q 4QMGA 1Y1VH 2Z6BA 2ASBA 1I4XA 1B9NA 4PZ8A 4C3HB 2EYLA 4ZK9B 4A3GB 2JJQA 2RCFA 4BBRH 4G57A 3TSSA 2GA4B 3ZJYC 2UXBQ 1N9WA 4A3BB 3MXNA 5I2YA 4R4TA 1M90C 3MXUA 2NZ1D 3S16H 2K5HA 4XYQA 5FLXL 2PZUA 4ME3A 1NUCA 4DUYL 2DN8A 4IN3A 1D8LA 4QUCA 1HFGA 1ESRA 4LFAQ 2JA5H 1A15A 4IUNA 5G3LF 4RGTA 4EX5A 1I6HB 1BBXC 2C9OA 4GOPB 4ZLTF 1CA6A 3J7AV 1G91A 2JA7H 2J7ZA 1O7ZA 5ELOA 1HQMC 1NBWA 4POGA 4GZYC 1PH2A 3PIOA 4C2MH 4BY1H 3EFXD 2N8NA 3AEVA 3OIQA 1WCMB 4C3JH 2HHHL 4LF4Q 2X6LA 1Z7TA 1SYCA 3BG3A 3GTGH 4APVA 2A6EC 4DV0Q 2NVYH 3WWVA 2ES2A 1AE2A 2DJGC 1E2WA 3U9OA 5IOCA 5I6YA 4L5RC 1MJEA 4JBWA 3CC4A 3Q22A 3OMCA 4IUPA 2Q8RE 2VUMG 3I3CA 4FF1A 4KMUC 4OIKA 1N8RC 1OXXK 2B2TC 1Y1WB 5FLXc 3STBC 1H9MA 2K50A 2RBMA 3UI2A 4Z9CB 2EE1A 1X9NA 5NUCA 2BCOA 3A7LA 1PH1A 2CVRA 3T1HL 3GTQB 4DV4Q 1HR0L 3A0JA 5CGKA 5CR3A 3FKIB 3TZUA 2BA1A 4KKSA 3HOUB 3OTOL 4KHPL 5FO9B 3E3XA 4A3EH 4DUYQ 2WB1G 3HG9A 2ICIA 1IBLL 3EVQA 2BOSA 2WAQE 5ELFA 4KI0A 4DR3L
chains in the Genus database with same CATH topology
1GUWA 5A35A 4IFDJ 4ID6A 3URYA 4KY6A 3S1RB 3R93A 3ITPA 2A5HA 3BDOA 2K03A 4RFBA 3PIO3 1WTQA 3SXHA 1JR0D 1VF7A 1H9JA 1GUTA 5IGCA 4F87A 2B2WC 2H4OA 2NTTA 5EBCA 4EQOA 1EY9A 3D8GA 1FNWA 1SNQA 1MGSA 4IFDH 3N6RA 5KRUA 5K36H 5DEHA 5D3IB 5ISRA 1BQQT 2PNRC 1ET6A 2ENBA 2Z4IA 4MIUA 3I70A 3D4WA 4L63B 2KEEA 2B2WA 3IFTA 3VYSA 2NVTB 2A69C 2QEJC 3P20A 5I2XA 1HRJA 3VR4A 1PTOB 3BDCA 4HMIA 3GTMB 2B2YA 1JE4A 2KVMA 4YIJA 5BN3A 1D6EC 4WRDA 5JOBA 1TQOA 4X3UA 5ELBA 1E2ZA 3J7YW 1ENAA 5I9OA 2FMCA 4NDXA 1UEAB 4N9TA 5JVH3 2R61A 2FINB 1TWHB 3VR2A 1XX8A 4OO1H 1ZYRC 3NTHA 4CJ0B 5COYA 2F0SA 1GHKA 1EEID 1JB3A 3NP8A 4HCSA 1LTAD 1TS3A 3V2TA 4C3JG 2AWOA 1SNMA 4ABNA 1IKLA 1PFNA 3DWAA 1JOQA 2E2IB 1EWCA 2F0NA 4K2LA 4M1UB 1STHA 3TP6A 1TVXA 4E6IA 4IFDI 2MUYA 3QOLA 5M3FB 4F88A 3DHQA 1RJTA 4C1NK 4F7XA 3K5MA 2K33A 1TKWB 3VYRA 4QIWB 4QCLA 3KF8A 2PW7A 4C56C 1O80A 5IGBA 2R7ZB 1YNND 3D3RA 2CQAA 3H6MA 3NUCA 3P75A 3KK7A 3HGBA 1I4RA 4LJZC 5CYUA 5K5PA 1VF5C 3J81E 5IT9L 2Q8IB 1I4QA 1SE4A 1DOMA 2V4DA 2R3ZA 1EY6A 4CHTB 1Y8NB 3NHHA 1CZGA 2ZXPA 1EU4A 1C48A 2XN9C 5E3FA 1F2LA 1FYCA 2L55A 4B9WA 1Z47A 1EZ6A 4IFDG 3PUXA 4OO1I 4DNRB 5HGTA 1M8AA 5C44B 2DNEA 2XIWA 2KECA 1RD9D 5BN5A 1SBBB 3T4AC 2K6AA 4ZUJA 3K6OA 2F0KA 1EL0A 5JJZA 4A3IB 2EZVA 4K8JA 4PMCA 1RKNA 1FNUA 1EIGA 1BF4A 2G9HD 4H13C 1PTOC 3DXJC 3LNNA 3C3LA 2E2HB 1AFPA 1A3VA 4ZAIA 1WTOA 1AEXA 2K5WA 2C5CA 2B39A 2B2UA 4DK1A 2R92B 3TP5A 2D62A 1EY0A 3A7AB 1NR4A 4HMJA 1CHPD 4CKBA 4KHVA 3R2TA 1PTOF 1EIHA 1BOSA 5JPNC 5ELDA 3D6CA 4OO1G 5D14A 3D31A 3MHBA 2R93B 1IYVA 5EKKA 1NR2A 3K5NA 4IUTA 2R6GA 1GUGA 5T1IA 3KLRA 3W3AA 3S2DB 1WD1A 1SNPA 5FK9C 5J39A 1SYEA 2E76C 4R8IA 1PLFA 2F0JA 1LTRD 1V1PA 2NBFA 1I4PA 5IGGA 4RWSC 4XT1B 2CW0D 1LT6D 3BYTB 5T1GA 5CV5A 1QJOA 3S14B 2SDFA 1JWMD 1JQYD 4KD4A 5TSSA 1B53A 2VUMB 1F9RA 3FVQA 4RA8A 2ZT9C 3S2HB 4X3KA 1HA6A 4EVOA 1BR9A 4FF2A 1BDOA 3RZOB 1MBYA 4RKLA 3CRKC 2WB1B 2EYMA 3TDQA 4G7OC 4G7ZC 1R4PB 3V96A 5FLXE 5FKAC 1HUMA 3I4MB 2EDGA 1SNOA 4BA1I 2Z4HA 4UDUC 2HUGA 1TS5A 4IUUA 3PO2B 3H0GB 3KLSA 2KCNA 3MWYW 1JWUD 5CBAE 3KUPA 4RKBA 2DY7A 5CV7A 3QB3A 3WDNA 2IX0A 1QILA 3SDZA 1T5EA 2AWNA 2LMCB 2FMMA 3NQIA 2QF7A 4IZ8A 4CJ1B 2BDNA 1LT5D 1T5XD 3HOXB 2PW5A 1Y1VB 4DFAA 2HQEA 5J22A 2QDBA 4BBRB 4KJOA 1HCZA 1CM9A 1NCVA 1ILPA 1KAAA 3MEHA 1LTBD 4KY5A 3S16B 5E1FA 1PRTD 4BWGB 2JA5B 5FOBB 4KKUA 1TS4A 1KTKA 3OPOA 2F03A 2IX1A 2FFKB 5LHY1 3NSWA 3DMUA 2BA0A 4DXFA 2ICEC 2JA7B 3K0YA 2G9DA 3C46A 1WD0A 1JWSD 3VYTA 3QIAA 4C2MB 1CQVA 4PQXA 5E4XA 3PIP3 3BVGA 1D1KA 1GXDC 1XYIA 1Q90A 5BN4A 2LKVA 1DYQA 4ME5A 1LTTD 2A74C 2XWBB 4WJWA 1LACA 1Z6HA 2EYFA 3WOEA 3SHLA 2JE6I 3TMEA 2VNUD 2D9UA 1B4OA 4OL7A 4S3SA 2EJGC 2JYOA 2I46A 1XTCD 2K01A 1WTVA 3FPUB 3QOJA 2F0VA 4A3EB 1UUPA 2F0MA 2AQ3B 3NE5B 4XYOA 2L9HA 3FPPA 3SR1A 1EY5A 4IQZA 4PMWA 2K1BA 2JEBI 2IL8A 1IKMA 4RCOA 1F9PA 2PO4A 1VMCA 2EYPA 4J1MA 1S4ZA 3CKIB 5C3EB 4M8AA 3OMGA 3PMFA 4R8NA 1S5ED 4AYBB 1A3UA 3TZDA 3MFYA 4U68A 1SFOB 2F0HA 2J4XA 1F2MA 2MP1A 3T16A 4FXDA 1EZ8A 1W6KA 1ESFA 1PFBA 2ID0A 1JORA 4XIGS 4I7ZC 3CHBD 3IKJA 3T53B 3RD4A 2VB3X 2IJ0A 2XVSA 2B2YC 3X3NA 4UAIA 2F0TA 4DA2A 1STEA 1U9RA 2ZXRA 4K5XA 1DOKA 4EQPA 1A3TA 2NTSA 1IW7D 3NQTA 1FR3A 3K5OA 1U4MA 5EGTA 4ULLA 2SNSA 5F2DA 2FHTA 2EVBA 2D2CC 3TP7A 3ERQA 1DXMA 4HN7A 4G7HC 1LT3D 3PV0A 1ONLA 2OF1A 5D3DA 3LWEA 2L12A 3GTOB 1FNVA 4DAYA 1B50A 2WINB 4QUFA 4BS9A 5IT9E 2KJXA 1YNNC 2RA4A 1V1PB 2RSNA 4K5VA 2KEDA 2L4NA 3L9AX 3J80L 2JA6B 4HAEA 3RUZA 4K2KA 3K59A 3W2DA 2DY8A 4IURA 4HTHA 4C3IG 1SMYD 2O5JC 2KOLA 3V05A 5C5MA 3GV3A 4H0LC 1K8OA 3MVVA 2BE5D 3L7ZC 3GP7A 1MSGA 4ZRZA 1STGA 2K5QA 2PCFB 3SVMA 1JICA 3MAQA 3A8IE 5C3WA 3HOWB 1EWHA 2NN6H 3C1FA 5IODA 2RQXA 2A6HD 1U4RA 3ONAB 2M00A 1RCVD 3A54A 3H91A 4DK0A 3HP3A 2M9VA 2IW3A 3D4RA 5CC4A 4TSSA 4HCEA 2AQ2B 4K5WA 4Q0FA 3HOVB 3S17B 1S5BD 2WAQB 5KNBA 1DD2A 1LTID 3HRZC 1PFMA 1Q1EA 2KUMA 1V43A 5M5WB 5M5XB 4OGQC 3OOCA 2WKCA 1PXUA 3N52A 4XDXA 2F0WA 5AFWA 1B44D 1HXYD 1LTSD 1CT1D 3QJYA 4A3DB 3SK8A 1JCKB 4XT3B 4CKCA 4N9PA 2KHSA 1QOHA 5JPMC 4OIJA 4XTCS 1DZ1A 2EYHA 1J9OA 1M4VA 5I4DA 2Z8LA 1ENCA 1A2TA 2NVQB 3ND8A 4K8IA 3DWQA 1TY0A 4LMQD 1ZKOA 3BS1A 1ZEQX 1STNA 1PRTB 1IYUA 1RHPA 3SK4A 1PYWD 2SEBD 4JK1C 2WIIB 4FYDA 3K7AB 4P2CB 1F77A 2NB0A 2NVXB 1E2VA 2NN6I 1Q12A 2MJ8A 3TP8A 2B2UC 5C4ZA 2EXZA 1J8IA 4A3FB 4EGVA 5CMDA 1CI3M 4C1NI 1LABA 2CW0C 1TWFB 1BCPD 4L8JA 1RTOA 4DF7A 3U9SA 4FO2A 5A2QL 2F0IA 1S5DD 4V190 3VR6A 3I4LA 3IAYA 4ZKCB 4L6TB 2I07B 1TY2A 3VR5A 1ENFA 4FVMA 1STAA 5KEEA 4J6HA 3I4NB 1EY7A 3GQBA 5IGEA 1L0YB 5CV8A 4XQQA 1EYAA 2EJFC 3SK5A 4A3MB 2QCPX 2JP1A 1X3PA 2F3VA 1TR5A 3EJIA 1Y69U 4B08A 1EYDA 1WTXA 4HEDA 2NN6G 3CRLC 2KA7A 4Q5VA 3G6JB 5CORA 3HZXA 1ML0D 1TU2B 1KLGD 3AMUA 3TBIB 1E0BA 1KLUD 1B1ZA 3I73A 1AP0A 3QO2A 2LY7A 1D5ZC 2PYKA 3R8BA 2RDHA 2NYZD 3CQZB 3EQLC 2J0TD 3Q6SA 1H9RA 2OXPA 2RDGA 3PUVA 5JEAJ 1SE2A 1OXTA 4HR7B 4ZUIA 1U4PA 1D2BA 1U4LA 1W6JA 4CBVA 1FD7D 3O13A 5EPKA 1PZKD 2LFNA 1OO9B 4PMBA 1C4QA 1KDAA 1EY4A 3MC0B 2XRSD 1SEBD 3MTSA 1MI2A 5KYIA 1NSNS 5JEAH 4BBSB 2SNMA 4BY7B 3VYUA 2IPKD 3M7NA 3DEPA 1YNJD 2F0UA 3K58A 1R9TB 5M5YB 1TIID 2RDFA 1O7LA 1PRTC 4TQUS 3S1NB 3PO3B 3GTPB 1SXTA 1BUVT 2IWHA 5IGDA 1STBA 3Q23A 1OXVA 3NTIA 1RODA 2E2JB 2F0DA 3OWFA 3OIPA 3GD7A 4I65A 5KIXA 1A2UA 3MA2B 3X3MA 1II3A 4K6DA 1PRTF 2IT1A 3J7AF 2K28A 3E5SA 4KY7A 3G7LA 1NAPA 4FNFA 5ELEA 3H09A 2F0EA 3DM1A 1CTMA 2F0FA 1QWYA 1OXUA 1V1OA 2B8GA 2XWJB 4RAUC 3JAME 1G2SA 1KABA 2PPBC 1HFNA 1CK1A 3VA7A 1DOLA 3ND9A 1SJHD 4WFN3 1HTLD 2EPBA 1HPCA 1Q8IA 4MN3A 3SE0A 4KD3A 5EKIA 4RGMA 4XQNA 2B2VA 1B9MA 2IX3A 1XWEA 4XQJA 2RKSA 1GOZA 4IUQA 1D5MC 2B63B 3FDTA 5IIFA 3FEWX 2D5DA 3QWNA 5ELCA 1LO5D 2O2LD 2RVLA 2WKDA 4LAAA 2X6GA 4BY1B 3MZ5A 3E6ZX 4C3JB 3I72A 2BDOA 3GTGB 2NVYB 2F1MA 2A68C 4PNYA 2AQ1B 4O42A 2HDMA 3M85A 1I4HA 1V8QA 5LL6S 4LK1C 1EYCA 1KDBA 1G2TA 1GJXA 5DAUA 1DM0B 1H9KA 4X3TA 5CV6A 1EU3A 1HUNA 4Y7NB 1GUNA 1CA5A 2K5DA 1SYDA 2K32A 5EQ0A 2EY2A 3JAML 2PMZB 2PZWA 2OEOA 5G3LD 1IW7C 3K57A 1PDQA 1TWGB 1BCPB 1PZJD 2WACA 3J80E 1EFID 3PUYA 3AB9A 1STYA 5JEAG 3BYYB 1GUOA 4G4KA 1HHVA 3D4DA 4TRDA 1DJRD 3CU7A 2N55A 4XXEA 2K7VA 2A68D 4EQNA 1X3QA 2B2TA 4A93B 3HS0C 4FXKC 1VMPA 4CKEA 3EA6A 2PQEA 3OSOA 1SMYC 5C4HA 4NKLA 3SEBA 3OHXC 1SJED 3I91A 4KJNA 2BE5C 3E0JA 2A6ED 3S9WA 4H7BA 3GV6A 2ZXOA 1B3AA 1TS2A 3PUWA 4KKTA 5I6WA 1EOTA 1AZPA 5J1ZA 5EJWA 2HCIA 5EBDA 2A6HC 3S1MB 3KLSX 4DN4M 1JOOA 2XSCA 3Q24A 1RDPD 1EEFD 2O5IC 4B9XA 2Z1CA 1HQRD 1VDZA 2EY6A 1KDCA 1F2ZA 2OT2A 1CHQD 1LTGD 1H9SA 1AZQA 1K8MA 4R9WA 5CV9A 3HOZB 1VCIA 3D6WA 5I9PA 1KNAA 5KYLA 3RMHA 1UNSA 1S5CD 1PTOH 3Q0AA 1EY8A 2L11A 4DGZA 3TN2A 3OW7A 2F0LA 4C3HG 2TMPA 2FJ2A 1SNDA 1TWCB 4DNTB 4KN4C 3BVMA 1O78A 3H3VC 1SDFA 1A6XA 4FXGC 4ZQ3A 3NBHA 2EYOA 5C5LA 3FMCA 4QB4A 5E4WC 1BNZA 5CBEE 4BA2I 2O4XA 3NPPA 5EPJA 2X69A 4ZKBB 2QKIC 1B2TA 3SK6A 3M4OB 4O1NA 1BXTA 4OHJA 2JXMB 2A69D 5A2QE 1MD2D 5C4JB 2WV6D 3T56B 4F8MA 1QE6A 1WTWA 2K04A 3GO5A 3MXPA 1BCPC 4PV1C 4X3SA 1WTPA 1R4QB 3NXWA 3IFDA 1GHJA 2JEAI 2Y0SB 2EJMA 1DCZA 2NWGA 1F9QA 1ET9A 3EROA 2JA8B 3KBXA 1ZYRD 4U673 2N88A 2E2DC 1PMRA 3NWSA 5EPLA 1SAPA 1SYBA 3ZYYX 1BCPF 2H1EA 4DU9A 3GTLB 1DONA 1JOKA 2JSOA 4H44C 2LS01 4A3JB 4RHRA 3DEOA 4WORA 1C8CA 3PUZA 4K14A 1AN8A 4KTAA 2L1BA 3H94A 2RSOA 3A56A 5D65A 1G291 3GTKB 3NWTA 3AU7A 4CGYB 2PZTA 2QILA 5K36G 1X32A 4HSVA 3BVZA 4RHSA 3DUZA 2AUKA 4K6LA 1WVLA 5FO8B 3RZDB 1S5FD 2VB2X 3MXGA 5C0XJ 1EQTA 5LL6X 3A8JE 2EOTA 5KNDA 4QF4A 2E74C 1SYFA 1Y8OB 1I50B 2EY5A 4IUVA 4ODGA 3HKZB 3T13A 1FGBD 4ZYSA 2CHBD 1MSHA 2L5TA 1EQVA 5HURA 1F2YA 3NTKA 2SOBA 4NW2A 1IL8A 3BDLA 1BO0A 2NUCA 5C0XH 3C2PA 2XRQD 1I4GA 2DNCA 1SYGA 1WTRA 1I6VC 3I90A 4V0BA 1G8ZD 3RLFA 1HA5A 1QCBD 1TT2A 3J81L 4IALA 2HDLA 4RGOS 3BZDB 3S1QB 3NK9A 4HSPA 1LT4D 2VXWA 1YNJC 4KHZA 1ILQA 1QB5D 4MHEA 1KNEA 2E75C 1IHZA 4NMZA 5IGFA 3C1EA 3IL8A 4CJ2C 1G6ZA 2F0QA 2MPMA 5EKLA 4KV6A 1XXGA 1QNUA 2M2LA 4TKOB 4NP5A 5C6AA 3GTJB 1L0XB 1PTOD 5JAVA 5M9OA 3A55A 2F0OA 3HOYB 1Y8PB 1RTNA 4FP5D 2XNAC 3P1HA 5C4XB 3R2IA 2B8FA 4FF3A 4KK7A 2Q8TA 1AW7A 4ILWA 1Q1BA 5CV4A 5DM63 4RCNA 3VA5A 1ICWA 1QG7A 3P7JA 1Q3LA 2KCCA 3L3OC 2AUJD 3KBGA 3FRPB 5KNCA 1F9SA 4DXGA 1RF2D 5C0XI 4DAVA 2MHVA 1LLRD 1CZWA 5KGUA 2TSSA 4RGNA 5JVG3 1SNCA 2EYJA 1SSOA 2F0GA 2F3WA 1JC7A 3NBIA 3HEJA 1GUSA 1O7YA 3VR3A 1QNKA 3LWUA 3LX0A 3QG1A 3R3OA 2EY1A 4FF4A 2F0PA 4DAPA 3K5LA 1LV9A 3MFGA 1H9SB 4RH6A 2F4IA 2MGSA 3M4YA 4KN7C 3M7GA 2B2VC 2K05A 2L0CA 3S15B 3T51B 4A3KB 2HCCA 3A8KE 2A73B 1CQFA 3OWEB 1UAPA 1I3QB 1K83B 3F2UA 1CFMA 1D5XC 4J8QA 5M3MB 1SE3A 3WOFA 3I8ZA 2YU9B 1D1IA 5FO7B 3M3YB 1HTPA 1PZID 1OXSC 5DM73 5DNFA 2KQ3A 2WP8J 2YYZA 1ZXTA 1TWAB 5C3XA 3DWPA 5C0XG 4C3IB 4QMGA 1I4XA 1B9NA 4C3HB 2EYLA 4ZK9B 4A3GB 4G57A 3TSSA 2GA4B 4A3BB 3MXNA 5I2YA 3MXUA 2NZ1D 4XYQA 5FLXL 2PZUA 1NUCA 2DN8A 4IN3A 4QUCA 1HFGA 1ESRA 1A15A 4IUNA 5G3LF 4RGTA 1I6HB 1BBXC 2C9OA 4ZLTF 1CA6A 3J7AV 1G91A 2J7ZA 1O7ZA 1HQMC 4GZYC 3EFXD 3OIQA 1WCMB 2X6LA 1Z7TA 1SYCA 3BG3A 2A6EC 5IOCA 1E2WA 3U9OA 5I6YA 4JBWA 3Q22A 3OMCA 4IUPA 2Q8RE 3I3CA 4FF1A 4KMUC 4OIKA 1OXXK 2B2TC 1Y1WB 1H9MA 2RBMA 3UI2A 4Z9CB 2EE1A 5NUCA 2BCOA 3A7LA 2CVRA 3GTQB 5CGKA 5CR3A 3FKIB 3TZUA 2BA1A 4KKSA 3HOUB 5FO9B 3HG9A 2ICIA 3EVQA 2BOSA 5ELFA 4KI0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EYA A;  2KHS A;  2RDF A;  4N9P A;  5CV5 A;  3SK5 A;  4B9W A;  5I6W A;  4QF4 A;  4IZ8 A;  1EZ6 A;  4PNY A;  1SYF A;  2OF1 A;  4ID6 A;  2EYL A;  3QOJ A;  2F0V A;  2EY5 A;  4KY6 A;  5J1Z A;  5IGD A;  5HGT A;  2EYH A;  2F3V A;  1TR5 A;  2F0S A;  4ODG A;  4F8M A;  4KD4 A;  4G57 A;  3T13 A;  3ITP A;  1STB A;  3EJI A;  5CV4 A;  1EYD A;  2F0M A;  1ENC A;  1EYC A;  3VA5 A;  4K5V A;  1A2T A;  1KDB A;  3SXH A;  1EQV A;  2F0D A;  3NP8 A;  5HUR A;  3OWF A;  1F2Y A;  2PW5 A;  3SR1 A;  4DFA A;  3V2T A;  3HZX A;  1EY5 A;  2SOB A;  4I65 A;  1JOO A;  2PZU A;  4K8I A;  1A2U A;  1NUC A;  3MXP A;  5DAU A;  1SNM A;  3RUZ A;  5IGC A;  4K2K A;  3BDL A;  4ZUJ A;  4B9X A;  2HQE A;  5J22 A;  1JOQ A;  2NUC A;  1STN A;  2QDB A;  4EQO A;  2F0K A;  2F0N A;  1II3 A;  4K2L A;  4HTH A;  4K6D A;  4KJO A;  1EY9 A;  4EVO A;  4IUN A;  1STH A;  2EY6 A;  1KAA A;  1KDC A;  3NXW A;  5CV6 A;  5C5M A;  3TP6 A;  1F2Z A;  2EYP A;  3MEH A;  3D8G A;  4J1M A;  4K8J A;  3MVV A;  4PMC A;  1SNQ A;  4KY5 A;  1RKN A;  1SYG A;  4E6I A;  3SK4 A;  3E5S A;  5KRU A;  1SYD A;  4KY7 A;  3OMG A;  1SNC A;  2EYJ A;  3QOL A;  3PMF A;  4R8N A;  4RKL A;  5DEH A;  1STG A;  5E1F A;  2F0E A;  2PYK A;  2EY2 A;  2F0G A;  3ERO A;  2F3W A;  3DHQ A;  5CV9 A;  1A3U A;  2EYM A;  2F0F A;  2OEO A;  2PZW A;  3HEJ A;  5C3W A;  4F7X A;  2F0H A;  1TT2 A;  3LX0 A;  5KGU A;  1F2M A;  3R3O A;  3C1F A;  5I9P A;  4IAL A;  1SYB A;  3T16 A;  5IOD A;  5KYL A;  2ENB A;  1A3V A;  2OXP A;  2EY1 A;  2WAC A;  4MIU A;  2PW7 A;  1EZ8 A;  3TP8 A;  5C4Z A;  5IGB A;  2F0P A;  1STY A;  2EXZ A;  3NK9 A;  1KAB A;  1EY8 A;  4DU9 A;  3DMU A;  5ISR A;  1SYC A;  3D4W A;  4DGZ A;  4ZUI A;  1JOR A;  1JOK A;  1AEX A;  2M00 A;  2F0L A;  3H6M A;  3NUC A;  5IOC A;  1SNO A;  3U9O A;  3D4D A;  1SND A;  3TP5 A;  3P75 A;  5CC4 A;  1IHZ A;  4NMZ A;  4DF7 A;  4TRD A;  5I6Y A;  1EY0 A;  5IGF A;  3C1E A;  4WOR A;  4HMJ A;  4KD3 A;  3OMC A;  4K5W A;  4K14 A;  2F0I A;  4KHV A;  2F0T A;  3BDC A;  2F0Q A;  2LKV A;  4HMI A;  4PMB A;  1U9R A;  4KV6 A;  5EKL A;  3D6C A;  4ME5 A;  4K5X A;  1KDA A;  2RBM A;  4EQP A;  1EY4 A;  4KTA A;  5K5P A;  4YIJ A;  3MHB A;  1A3T A;  2RKS A;  5NUC A;  5KYI A;  4RKB A;  4ZQ3 A;  4NP5 A;  5CV7 A;  4WRD A;  5C6A A;  3QB3 A;  5EKK A;  2EYO A;  5JOB A;  1TQO A;  2PZT A;  5C5L A;  4QB4 A;  5IIF A;  1NSN S;  3NQT A;  2EYF A;  5JAV A;  2SNM A;  1STA A;  5KIX A;  5CGK A;  5KEE A;  5M9O A;  5CR3 A;  1ENA A;  5EGT A;  3SHL A;  2O4X A;  4LAA A;  5I9O A;  1SNP A;  4J6H A;  2PQE A;  3OSO A;  3TME A;  2SNS A;  2F0W A;  5C4H A;  4NKL A;  1SYE A;  1EY6 A;  4NDX A;  5F2D A;  4OL7 A;  5J39 A;  4S3S A;  2KQ3 A;  1EY7 A;  2F0O A;  3MZ5 A;  3TP7 A;  5IGE A;  2F0J A;  4EQN A;  3ERQ A;  3NHH A;  2F0U A;  4KJN A;  3SK8 A;  4N9T A;  3S9W A;  5C3X A;  3EVQ A;  4H7B A;  5CV8 A;  5E3F A;  3SK6 A;  5IGG A;  3P1H A;  4QMG A; 
#chains in the Genus database with same CATH topology
 1GUW A;  4B3S L;  4QIW E;  5A35 A;  4IFD J;  4ID6 A;  3URY A;  2KHI A;  4QL5 A;  4KY6 A;  3S1R B;  5JJI A;  3I4M G;  3R93 A;  3ITP A;  3F2C A;  1K0R A;  2A5H A;  3BDO A;  2K03 A;  3W1G A;  4RFB A;  3PIO 3;  1WTQ A;  1N32 Q;  3SXH A;  3J7Z C;  1JR0 D;  1VF7 A;  1QZG A;  3H0G G;  1J5E L;  4GNX C;  3KJP A;  1H9J A;  1GUT A;  5IGC A;  4F87 A;  2B2W C;  2H4O A;  2NTT A;  5EBC A;  4EQO A;  5BR8 L;  1SFO H;  1EY9 A;  4IJL A;  1SE8 A;  1UE6 A;  3PO3 G;  3D8G A;  1FNW A;  1IBK L;  1SNQ A;  1MGS A;  4IFD H;  5J3B A;  3N6R A;  5KRU A;  1GVP A;  1JJC B;  1A62 A;  5K36 H;  4MZ9 A;  3CCE A;  5DEH A;  4JI6 L;  4LF8 L;  5D3I B;  4OWW B;  2BH2 A;  5ISR A;  4JCV E;  1BQQ T;  2WFW A;  2KBN A;  1P16 A;  2PNR C;  1V1Q A;  1ET6 A;  2ENB A;  2Z4I A;  4MIU A;  4DAM A;  3U58 A;  3I70 A;  4GNX A;  3T1H Q;  1XMQ L;  2Q2U A;  3CD6 A;  1X6O A;  3D4W A;  4L63 B;  2KEE A;  2B2W A;  3IFT A;  4CDD C;  4I7A A;  3VYS A;  4N8F A;  2NVT B;  2A69 C;  2QEJ C;  1N36 Q;  3P20 A;  1K8A C;  5I2X A;  2Z6K C;  1HRJ A;  3VR4 A;  1UE1 A;  1PTO B;  4MTN A;  4LUO A;  4DR3 Q;  3BDC A;  4HMI A;  1Y1V G;  1JJG A;  1VQH A;  2QDL A;  4B3S Q;  2B2Y A;  1JE4 A;  2KVM A;  3GTM B;  4YIJ A;  5BN3 A;  3OW2 A;  1D6E C;  4WRD A;  5JOB A;  1TQO A;  4BBR G;  3K80 C;  4X3U A;  1WI5 A;  5ELB A;  1E2Z A;  3J7Y W;  1HNZ L;  1ENA A;  5I9O A;  2IHE A;  2FMC A;  4NDX A;  1UEA B;  3GTO H;  1YJ9 A;  4N9T A;  5JVH 3;  2R61 A;  4A3C H;  2ZJR A;  2JA5 G;  2F4V L;  2FIN B;  2Z6K A;  5BR8 Q;  1VQI A;  2N3S A;  1TWH B;  3VR2 A;  1XX8 A;  4OO1 H;  1ZYR C;  3NTH A;  3ER0 A;  4CJ0 B;  2PQA A;  4YCW A;  5COY A;  2F0S A;  1GHK A;  2JA7 G;  4JI6 Q;  2H5X A;  4LF8 Q;  2OCE A;  1EEI D;  1JB3 A;  3NP8 A;  4HCS A;  1LTA D;  4BY1 G;  1UE5 A;  3E0E A;  1TS3 A;  3V2T A;  1MJC A;  4C3J G;  2AWO A;  1SNM A;  4ABN A;  1IKL A;  1PFN A;  3DWA A;  1E1O A;  2E2I B;  1JOQ A;  1EWC A;  1XMQ Q;  2F0N A;  4K2L A;  4M1U B;  3HOW H;  4LF5 L;  4YY3 L;  1STH A;  3TP6 A;  1TVX A;  4TVA B;  4E6I A;  4IFD I;  2E5L L;  2MUY A;  3QOL A;  5M3F B;  4F88 A;  1VQL A;  3DHQ A;  2DGY A;  1RJT A;  1HR0 W;  2KHJ A;  4C1N K;  3BU2 A;  4F7X A;  3K5M A;  2K33 A;  1TKW B;  3VYR A;  4QIW B;  4L5Q A;  4QCL A;  3KF8 A;  2PW7 A;  4C56 C;  1O80 A;  1S40 A;  3HOV H;  5IGB A;  3S17 H;  2R7Z B;  1K3R A;  1YNN D;  3D3R A;  4QJF A;  2CQA A;  1HNZ Q;  3H6M A;  1XNQ L;  2CH4 A;  3NUC A;  2V1C C;  1UWV A;  4MNO A;  3P75 A;  4A3E G;  3KK7 A;  4OWX B;  4IPH A;  1X55 A;  5M5X H;  4P75 A;  3HGB A;  1I4R A;  4LJZ C;  5CYU A;  2VQF L;  4DV5 L;  5K5P A;  5LMU L;  1MIU A;  1VF5 C;  2HQL A;  3J81 E;  5IT9 L;  2Q8I B;  1I4Q A;  1SE4 A;  1DOM A;  2V4D A;  1C7Y A;  2R3Z A;  1EY6 A;  4CHT B;  1Y8N B;  3NHH A;  1CZG A;  1X3E A;  2N78 A;  1KL9 A;  2ZXP A;  1EU4 A;  1C48 A;  2XN9 C;  5E3F A;  1F2L A;  1FYC A;  4DR1 L;  1NJI C;  2NVQ H;  4LF5 Q;  4BXX H;  2L55 A;  4YY3 Q;  1EUJ A;  3KDF B;  4B9W A;  1Z47 A;  1EZ6 A;  4B3T Q;  4IFD G;  4UY8 C;  3PUX A;  4OO1 I;  4DNR B;  5HGT A;  1M8A A;  5C44 B;  3FHW A;  2A19 A;  5JJK A;  2DNE A;  2XIW A;  2KEC A;  1RD9 D;  5BN5 A;  1SBB B;  3T4A C;  1KAW A;  1YZ6 A;  2K6A A;  3CAM A;  4ZUJ A;  3K7A H;  3K6O A;  4R4Q A;  2NVX H;  2F0K A;  2CWP A;  1EL0 A;  3CCJ A;  5JJZ A;  4A3I B;  2EZV A;  4P74 A;  1XNQ Q;  4K8J A;  4PMC A;  1RKN A;  1FNU A;  3MXN B;  1EIG A;  1BF4 A;  4A3F H;  1VQ5 A;  1XPU A;  2G9H D;  4H13 C;  2A1A A;  2VZA A;  1TWF H;  1PTO C;  1QVF A;  3DXJ C;  3LNN A;  3C3L A;  4DV5 Q;  4GN4 B;  5LMU Q;  2E2H B;  1AFP A;  1A3V A;  4ZAI A;  1PV4 A;  1WTO A;  1AEX A;  2K5W A;  2C5C A;  2B39 A;  2B2U A;  4DK1 A;  1A63 A;  2R92 B;  2C35 B;  3TP5 A;  4GLV B;  2D62 A;  2UUB L;  1EY0 A;  3A7A B;  1NR4 A;  4HMJ A;  4A3C G;  1CHP D;  4CKB A;  4KHV A;  3R2T A;  1PTO F;  1EIH A;  1BOS A;  5JPN C;  3I4N H;  5ELD A;  3D6C A;  1YVC A;  4OO1 G;  2D0O A;  5D14 A;  3D31 A;  3MHB A;  5LMN W;  2R93 B;  1IYV A;  3AQQ A;  5EKK A;  1NR2 A;  3L2P A;  3G71 A;  3K5N A;  4LF7 L;  5GAD C;  4IUT A;  2R6G A;  1GUG A;  5T1I A;  3KLR A;  3W3A A;  4A3M H;  3S2D B;  2VS1 A;  1WD1 A;  1SNP A;  5FK9 C;  5J39 A;  1JMC A;  1SYE A;  2E76 C;  3CCM A;  4R8I A;  1PLF A;  2F0J A;  5IY0 A;  1LTR D;  2ZJP A;  2UXC L;  4AH6 A;  1V1P A;  2NBF A;  1I4P A;  5IGG A;  4RWS C;  3HOW G;  4XT1 B;  2CW0 D;  1LT6 D;  3BYT B;  5T1G A;  5CV5 A;  1QJO A;  3S14 B;  1IZ6 A;  2SDF A;  4OX9 L;  1CKO A;  1JWM D;  1JQY D;  1MHW C;  4KD4 A;  1X54 A;  5TSS A;  1B53 A;  2AMC B;  2VUM B;  2N49 A;  1F9R A;  4CDF C;  3KJO A;  3FVQ A;  4RA8 A;  4POF A;  2ZT9 C;  3HOV G;  3W1B A;  2WAQ G;  4OXP A;  3CQZ H;  4ZCK A;  3S2H B;  4X3K A;  4DNI A;  1HA6 A;  3BJU A;  4EVO A;  1JE5 A;  4J15 A;  1BR9 A;  3ULJ A;  1PH4 A;  4FF2 A;  1BDO A;  3RZO B;  1UEB A;  1RIP A;  4HIK A;  1B3Q A;  1MBY A;  4RKL A;  4KLK A;  3CRK C;  2WB1 B;  2EYM A;  3TDQ A;  4G7O C;  2UXD L;  1T9H A;  3TQY A;  1WTH A;  4G7Z C;  3M9B A;  1R4P B;  1VQ6 A;  3V96 A;  2MFI A;  5FLX E;  4LF7 Q;  1G6P A;  3A74 A;  5FKA C;  1HUM A;  2BH8 A;  3I4M B;  3UDF A;  2EDG A;  1SRO A;  1SNO A;  4BA1 I;  2Z4H A;  4UDU C;  2HUG A;  1TS5 A;  1YEZ A;  4IUU A;  3H0G B;  3PO2 B;  3KLS A;  4BBS H;  4BY7 H;  2UXC Q;  1WJJ A;  2R7F A;  2KCN A;  5IP7 G;  2PMZ E;  4HIM A;  4BXX G;  4GNX B;  3MWY W;  4A76 A;  4X64 L;  3AYH B;  1JWU D;  5EAY A;  5CBA E;  4OX9 Q;  3KUP A;  4RKB A;  4X6A H;  2DY7 A;  5CV7 A;  3QB3 A;  1R9T H;  3CP0 A;  3WDN A;  2IX0 A;  4YWK A;  1QIL A;  5H1S E;  1NMG A;  3SDZ A;  1T5E A;  3GTP H;  2AWN A;  4QQB X;  2FXQ A;  2LMC B;  4L5T A;  2FMM A;  2OQ0 A;  3NEL A;  4R1J A;  2E2J H;  3NQI A;  4JI8 L;  3CC2 A;  3PIP A;  2QF7 A;  2VW9 A;  4IZ8 A;  4CJ1 B;  1EIF A;  2BDN A;  3CCL A;  4A3F G;  1LT5 D;  3W5O A;  1Q86 C;  4CDC C;  1T5X D;  1XMO L;  3HOX B;  2B29 A;  2PW5 A;  1Y1V B;  4DFA A;  5IP9 H;  2HQE A;  5J22 A;  4A3L H;  2QDB A;  2YV5 A;  4BBR B;  4KJO A;  2QEX A;  1HCZ A;  1CM9 A;  1NCV A;  1ILP A;  3CCS A;  1KAA A;  3MEH A;  1LTB D;  3T1Y L;  1I3Q H;  1Q81 C;  4KY5 A;  1PH3 A;  3S16 B;  3HKZ G;  3CF5 A;  5E1F A;  2EIF A;  1PRT D;  4BWG B;  3M3Y H;  3I4N G;  3B6Y A;  2JA5 B;  1D7Q A;  5FOB B;  4KKU A;  4X64 Q;  1TS4 A;  1KTK A;  3OPO A;  2F03 A;  2IX1 A;  2FFK B;  5LHY 1;  5GAE C;  3NSW A;  3DMU A;  2BA0 A;  4C3I H;  4DXF A;  4A3M G;  2ICE C;  2MQH A;  3K0Y A;  2JA7 B;  1Q46 A;  1YHB A;  2G9D A;  4IPC A;  3C46 A;  1WD0 A;  1FL0 A;  4Y52 H;  2B63 H;  1JWS D;  1G51 A;  3QIA A;  1VQE A;  3VYT A;  4C2M B;  1CQV A;  1VQ4 A;  4PQX A;  5E4X A;  3PIP 3;  3BVG A;  4LF6 L;  1D1K A;  2K52 A;  1GXD C;  1XYI A;  1Q90 A;  4JI8 Q;  5BN4 A;  2LKV A;  1DYQ A;  4ME5 A;  4A3B H;  1NTG A;  1LTT D;  2A74 C;  2XWB B;  4WJW A;  1LAC A;  3CCV A;  1Z6H A;  3UDI A;  1S72 A;  1HH2 P;  2EYF A;  3RLO A;  3WOE A;  1BVS A;  1XMO Q;  3SHL A;  5HY6 A;  2JE6 I;  3TME A;  2VNU D;  2D9U A;  4JI7 L;  1B4O A;  4OL7 A;  4S3S A;  3H15 A;  1N34 L;  2EJG C;  2JYO A;  2I46 A;  1XTC D;  2K01 A;  1WTV A;  3RN5 A;  4DUZ L;  3I55 A;  4P73 A;  3FPU B;  3T1Y Q;  3QOJ A;  5IYD H;  2F0V A;  4A3E B;  1UUP A;  1XJV A;  4HJ9 A;  2F0M A;  4FDB A;  2AQ3 B;  3NE5 B;  4Y7N H;  1B7Y B;  4XYO A;  2L9H A;  3FPP A;  3SR1 A;  1EY5 A;  4GN3 B;  4IQZ A;  4R4I A;  4PMW A;  2K1B A;  2JEB I;  2IL8 A;  1IKM A;  3TS0 A;  4RCO A;  1Y1W H;  1F9P A;  4A75 A;  1TWG H;  2PO4 A;  1VMC A;  2EYP A;  4J1M A;  1S4Z A;  3CKI B;  5C3E B;  2Q2T A;  1I94 L;  4HIO A;  4M8A A;  3OMG A;  4BBS G;  4X65 L;  4BY7 G;  3PMF A;  4R8N A;  4LF6 Q;  1S5E D;  4AYB B;  1A3U A;  3TZD A;  3MFY A;  4IOC A;  2XTI A;  4U68 A;  1NNX A;  1L0W A;  1SFO B;  2F0H A;  2J4X A;  1F2M A;  2MP1 A;  3T16 A;  2HHH Q;  4FXD A;  1EZ8 A;  3F2D A;  4O2D A;  1W6K A;  1ESF A;  1PFB A;  2ID0 A;  1JOR A;  4XIG S;  4I7Z C;  3CHB D;  3IKJ A;  2Y0S E;  4NPS A;  1SLJ A;  3T53 B;  3RD4 A;  4A93 H;  4JI7 Q;  2VB3 X;  1K28 A;  4QGU A;  4CDE C;  1N34 Q;  2IJ0 A;  3S1R H;  2XVS A;  2B2Y C;  3X3N A;  2F52 A;  3I7F A;  4LFB L;  4UAI A;  2F0T A;  4DA2 A;  1STE A;  1U9R A;  1YJN A;  2ZXR A;  4K5X A;  1DOK A;  4EQP A;  4DUZ Q;  4H02 A;  1LUZ A;  1A3T A;  3DM3 A;  2NTS A;  1X3G A;  1C0A A;  1EYG A;  1HR0 Q;  1IW7 D;  3NQT A;  2YTX A;  1FR3 A;  3K5O A;  1U4M A;  1DGS A;  5EGT A;  1PH8 A;  3OTO Q;  4KHP Q;  4ULL A;  2SNS A;  5F2D A;  2FHT A;  2EVB A;  2D2C C;  5GAH C;  3TP7 A;  5IP9 G;  4A3K G;  3ERQ A;  3ULP A;  1DXM A;  1IBL Q;  4HN7 A;  3RR5 A;  4A3L G;  2HIV A;  3ERS X;  3IRB A;  4G7H C;  1GD7 A;  1LT3 D;  3S1M H;  3PV0 A;  3G6E A;  1ONL A;  1VQJ A;  1Q8K A;  3K81 C;  2OF1 A;  4JYA L;  3TS2 A;  2ZTE A;  3LWE A;  5D3D A;  2L12 A;  1VQ9 A;  3GTO B;  4X65 Q;  1FNV A;  4DAY A;  1B50 A;  2WIN B;  4QUF A;  4BS9 A;  5IT9 E;  1SRU A;  3FP9 A;  2KJX A;  1YNN C;  2RA4 A;  4ALP A;  1V1P B;  2RSN A;  4K5V A;  2KED A;  2L4N A;  3K0X A;  3L9A X;  1J5E Q;  3J80 L;  2JA6 B;  1PA6 A;  1LTL A;  4HAE A;  3CCQ A;  3RUZ A;  4K2K A;  2PI2 A;  3K59 A;  3W2D A;  2DY8 A;  4IUR A;  4HTH A;  4C3I G;  1P8L A;  3I2Z A;  1SMY D;  3HOZ H;  2O5J C;  2KOL A;  3V05 A;  5C5M A;  1IBK Q;  3GV3 A;  1E22 A;  4H0L C;  1K8O A;  3MVV A;  2B63 G;  1EWI A;  2BE5 D;  2EXD A;  2CQO A;  3L7Z C;  1YBY A;  3GP7 A;  3HKZ E;  5E7N A;  1MSG A;  4ZRZ A;  1STG A;  2K5Q A;  2PCF B;  3SVM A;  4LFB Q;  1JIC A;  5LMN L;  3MAQ A;  4A3B G;  3A8I E;  5C3W A;  3HOW B;  1QVG A;  1TWC H;  1EWH A;  2NN6 H;  3C1F A;  5IOD A;  5GAG C;  3PF4 A;  2RQX A;  1KXL A;  2A6H D;  1U4R A;  3ONA B;  2M00 A;  5IYB H;  1RCV D;  3A54 A;  3H91 A;  4DK0 A;  1Z9F A;  3HP3 A;  2M9V A;  2IW3 A;  1GKH A;  3D4R A;  5CC4 A;  4TSS A;  4HCE A;  3PQI A;  4UP7 A;  2RCN A;  4NXN L;  2AQ2 B;  4K5W A;  4Q0F A;  3HOV B;  3J80 c;  3S17 B;  1B70 B;  1S5B D;  2WAQ B;  1KIX A;  4UP8 A;  5KNB A;  1DD2 A;  1LTI D;  3HRZ C;  1K73 C;  5IYD G;  1PFM A;  1Q1E A;  2KUM A;  1V43 A;  5M5W B;  3M4O H;  3NEM A;  1E3P A;  5M5X B;  4OGQ C;  3KYH C;  3OOC A;  1HZB A;  3QR8 A;  2WKC A;  3N52 A;  1PXU A;  1LM0 A;  4XDX A;  2IY5 B;  2F0W A;  5AFW A;  3UDG A;  4GOP A;  1B44 D;  1HXY D;  1LTS D;  1CT1 D;  3QJY A;  5C4J H;  4A3D B;  4PZ7 A;  3D0F A;  3SK8 A;  1JCK B;  1IBM L;  1A0I A;  3J80 i;  2F4V Q;  1Y1W G;  4XT3 B;  4CKC A;  4N9P A;  2KHS A;  1QOH A;  2Q2H A;  5FJ8 H;  4JG2 A;  5ELN A;  5JPM C;  1A8V A;  4K0K L;  1XTD A;  4OIJ A;  1JT8 A;  1CKN A;  4XTC S;  1DZ1 A;  1M1K C;  2EYH A;  1J9O A;  1M4V A;  5I4D A;  2Z8L A;  1ENC A;  5LMN Q;  1A2T A;  2NVQ B;  3CMA A;  3ND8 A;  4OEL B;  4LFC L;  4K8I A;  3DWQ A;  3F1Z A;  1TY0 A;  4LMQ D;  1ZKO A;  5IP7 H;  3BS1 A;  1ZEQ X;  1STN A;  1BBW A;  2JA8 H;  1PRT B;  1IYU A;  1GO3 E;  4A93 G;  4YWM A;  1RHP A;  1X65 A;  2E5L Q;  4R4C A;  3SK4 A;  1PYW D;  3GDE A;  3E9I A;  3GTL H;  1TXY A;  2SEB D;  4NXN Q;  4JK1 C;  2WII B;  1H95 A;  5FLM H;  4FYD A;  3K7A B;  4P2C B;  1F77 A;  2NB0 A;  2NVX B;  2JK8 A;  1EFW A;  4A3J H;  1E2V A;  1C9O A;  2NN6 I;  1Q12 A;  1VQK A;  3S24 A;  2MJ8 A;  3TP8 A;  2B2U C;  5C4Z A;  2EXZ A;  1J8I A;  4A3F B;  4GLX A;  4EGV A;  5CMD A;  5L37 A;  1CI3 M;  1KRT A;  5JJL A;  3PSI A;  5IT9 c;  4C1N I;  1LAB A;  2CW0 C;  4JBJ A;  1TWF B;  3RLN A;  1BCP D;  3GTK H;  4L8J A;  1RTO A;  1VQB A;  4DF7 A;  3U9S A;  4LW1 A;  1VQC A;  4FO2 A;  4B3R L;  5A2Q L;  1IBM Q;  2F0I A;  1S5D D;  4V19 0;  3VR6 A;  3I4L A;  3IAY A;  2VQF Q;  3KFU A;  1ASZ A;  3RZD H;  4K0K Q;  4ZKC B;  4L6T B;  2I07 B;  1TY2 A;  3UDX A;  3VR5 A;  1PH5 A;  3VDY A;  1ENF A;  4FVM A;  1PH6 A;  1STA A;  5KEE A;  3F8T A;  4A3I H;  4J6H A;  1I50 H;  3I4N B;  4GKK L;  1EY7 A;  4LFC Q;  3GQB A;  5IGE A;  3L0O A;  4DV6 L;  4WJ4 A;  4DV3 L;  2PI2 E;  1L0Y B;  5CV8 A;  4XQQ A;  4DR1 Q;  3HOZ G;  1EYA A;  2EJF C;  3SK5 A;  4A3M B;  2E2H H;  1CKM A;  4OWT B;  2QCP X;  2JP1 A;  2CCZ A;  2KCM A;  2LXJ A;  1X3P A;  2F3V A;  1TR5 A;  3EJI A;  1Y69 U;  4B08 A;  1EYD A;  1WTX A;  4HED A;  2NN6 G;  2R92 H;  3CRL C;  2KA7 A;  4Q5V A;  3G6J B;  5COR A;  3HZX A;  1ML0 D;  1TU2 B;  1KLG D;  1PFS A;  4JI3 L;  5IYB G;  3AMU A;  3TBI B;  1E0B A;  1HJP A;  1KLU D;  1B1Z A;  3I73 A;  1AP0 A;  2R93 H;  5IE8 A;  3S1Q H;  3QO2 A;  2LY7 A;  3EIV A;  1D5Z C;  4B3R Q;  5GRO A;  1EQR A;  2PYK A;  4LUZ A;  3R8B A;  2RDH A;  1Q82 C;  2NYZ D;  3CQZ B;  3EQL C;  2A8V A;  4UPA A;  2JN4 A;  2J0T D;  2HIX A;  3Q6S A;  1H9R A;  2OXP A;  2RDG A;  2RHQ B;  3PUV A;  5JEA J;  1SE2 A;  4PG3 A;  1OXT A;  4HR7 B;  2Z9H A;  4X62 L;  4ZUI A;  1U4P A;  1L1O A;  1D2B A;  1U4L A;  1W6J A;  1NMF A;  4CBV A;  4DR5 L;  1FD7 D;  2GVB A;  4GKK Q;  2UUB Q;  3GTJ H;  4WJ3 M;  1FJG L;  4DV6 Q;  4DV3 Q;  3O13 A;  5EPK A;  2ATW A;  1PZK D;  2LFN A;  1OO9 B;  4PMB A;  1C4Q A;  5FJ8 G;  3SGI A;  1KDA A;  1EY4 A;  3HOY H;  3MC0 B;  2XRS D;  1SEB D;  3MTS A;  1MI2 A;  5KYI A;  2QGQ A;  5C4X H;  1NSN S;  5JEA H;  4BBS B;  2SNM A;  4BY7 B;  1PYS B;  2Y0S G;  4GKJ L;  2CKZ B;  1W2B A;  3VYU A;  1PH9 A;  2IPK D;  2OTJ A;  2UUA L;  3M7N A;  3DEP A;  1YNJ D;  2F0U A;  3K58 A;  2EQS A;  4OEM B;  2JA8 G;  1R9T B;  4JI3 Q;  2JQO A;  1TII D;  4JPB W;  5M5Y B;  1AE3 A;  2RDF A;  1O7L A;  1PRT C;  4DK6 C;  5IYC H;  4TQU S;  1CUK A;  3S1N B;  3PO3 B;  3GTP B;  1SXT A;  1BUV T;  2IWH A;  5IGD A;  1Y14 B;  4YCV A;  2CFM A;  5FLM G;  1EOV A;  2VY3 A;  1STB A;  3Q23 A;  4UHV A;  1OXV A;  3NTI A;  1ROD A;  4A3J G;  1FVI A;  2UXB L;  2E2J B;  2F0D A;  4JBM A;  3OWF A;  3OIP A;  3GD7 A;  4I65 A;  2AKW B;  5KIX A;  3LGJ A;  3PO2 H;  1A2U A;  3MA2 B;  4R4O A;  3X3M A;  1II3 A;  4K6D A;  1PRT F;  1EQQ A;  2IT1 A;  4DAY B;  2YTV A;  3J7A F;  2L15 A;  4DR5 Q;  2NZH A;  1PYB A;  2K28 A;  3E5S A;  4KY7 A;  3G7L A;  1NAP A;  2GVA A;  1N33 L;  1IXR A;  4FNF A;  5ELE A;  3H09 A;  2F0E A;  3DM1 A;  1CTM A;  2F0F A;  2UXD Q;  1QWY A;  1OXU A;  1V1O A;  2B8G A;  2XWJ B;  5IWA L;  4RAU C;  3JAM E;  2RHS B;  4JOI A;  3ICE A;  3S15 H;  4A3K H;  1VQF A;  4B3M L;  1HZ9 A;  1G2S A;  4LF4 L;  1KAB A;  2PPB C;  1HFN A;  1CK1 A;  2PQA B;  3VA7 A;  4P71 A;  4A3I G;  1DOL A;  2UUC L;  3ND9 A;  1XPO A;  4HJ8 A;  4GKJ Q;  4DV0 L;  1K83 H;  1SJH D;  4WFN 3;  1HTL D;  2EPB A;  5M3M H;  1HPC A;  1Q8I A;  4MN3 A;  4IPG A;  3SE0 A;  2YU9 H;  1VQ8 A;  4KD3 A;  5EKI A;  1VQP A;  1XPR A;  4RGM A;  4XQN A;  2B2V A;  1B9M A;  3HOX H;  2IX3 A;  1XWE A;  4XQJ A;  3K7U C;  4P72 A;  1E1T A;  1TWA H;  2RKS A;  1GOZ A;  4IUQ A;  2QA4 A;  1D5M C;  1JJ2 A;  3FDT A;  2B63 B;  5IIF A;  4X66 L;  3FEW X;  2D5D A;  3QWN A;  4JV5 L;  5ELC A;  3E9H A;  1LO5 D;  2O2L D;  2RVL A;  4DV4 L;  2WKD A;  4LAA A;  4C3H H;  2R92 G;  2X6G A;  1Q7Y C;  4BY1 B;  3MZ5 A;  3E6Z X;  4A3G H;  1I5F A;  4JI4 L;  4C3J B;  3KF8 B;  3I72 A;  2BDO A;  3CCR A;  1X56 A;  1K0S A;  3GTG B;  3CW2 C;  2NVY B;  2F1M A;  2A68 C;  4PNY A;  4AQY L;  2R93 G;  1HZC A;  2AQ1 B;  4O42 A;  3H3V H;  2HDM A;  1N33 Q;  3M85 A;  1I4H A;  1V8Q A;  5LL6 S;  1E7Z A;  1EYC A;  4LK1 C;  3Q8D A;  1KDB A;  3F2B A;  1N32 L;  4MTK A;  1G2T A;  4DR6 L;  1AH9 A;  1GJX A;  5IWA Q;  1I6H H;  4GS3 A;  5DAU A;  4B3M Q;  3G48 A;  1YNX A;  1ASY A;  1CKN B;  1DM0 B;  1H9K A;  3J7A 5;  4X3T A;  2UUC Q;  5CV6 A;  1EU3 A;  1HUN A;  4Y7N B;  1WCM H;  1GUN A;  1CA5 A;  2K5D A;  1SYD A;  2K32 A;  4AIM A;  5EQ0 A;  2EY2 A;  3JAM L;  2PMZ B;  2PZW A;  2OEO A;  5G3L D;  1IW7 C;  1CSP A;  4RMF A;  3HOY G;  3K57 A;  1PDQ A;  1TWG B;  1BCP B;  1PZJ D;  1QUQ A;  3OYY A;  1ICF B;  1K3B C;  1FGU A;  2WAC A;  3J80 E;  1EFI D;  2GN5 A;  3PUY A;  3AB9 A;  4X66 Q;  1STY A;  5C4X G;  2D0P A;  5JEA G;  3BYY B;  4JV5 Q;  4IJH A;  3RN2 A;  1GUO A;  4G4K A;  1B8A A;  1HHV A;  3D4D A;  4DR2 L;  2Q2I A;  3PGZ A;  3GTQ H;  1N36 L;  4TRD A;  1DJR D;  1WOC A;  3CU7 A;  2N55 A;  4XXE A;  4JI4 Q;  2K7V A;  3FKI H;  2A68 D;  2ZTC A;  2LXK A;  3HOU H;  4EQN A;  5IYC G;  1X3Q A;  3PF5 A;  4AQY Q;  2B2T A;  4A93 B;  3HS0 C;  1VQN A;  2AHO B;  2KCT A;  4FXK C;  1E24 A;  1VMP A;  3TRE A;  4CKE A;  3EA6 A;  3MEF A;  2PQE A;  3OSO A;  1SMY C;  5C4H A;  4NKL A;  5C3E H;  4DR6 Q;  3SEB A;  3PO2 G;  3OHX C;  1SJE D;  3JAM c;  3I91 A;  4KJN A;  2BE5 C;  3E0J A;  2A6E D;  3S9W A;  4H7B A;  3GV6 A;  2ZXO A;  1IYJ B;  3EN2 A;  1W3S A;  1B3A A;  2E8G A;  1TS2 A;  3PUW A;  1L2F A;  4KKT A;  5I6W A;  1HNX L;  1EOT A;  1AZP A;  5J1Z A;  3H3V I;  1SR3 A;  5EJW A;  1NE3 A;  1VQG A;  2LSS A;  2HCI A;  3STB D;  4EQ5 A;  5EBD A;  2A6H C;  3S1M B;  3CXC A;  3KF6 A;  1J6Q A;  2RF4 A;  3KLS X;  4OON A;  3JAM i;  4DN4 M;  1JOO A;  2XSC A;  3Q24 A;  1RDP D;  1EEF D;  2O5I C;  4B9X A;  1QZH A;  2Z1C A;  1HQR D;  2IHF A;  1VDZ A;  2EY6 A;  1KDC A;  3K8A A;  1F2Z A;  2OT2 A;  1YJW A;  1CHQ D;  1LTG D;  1I94 Q;  2CH4 W;  4PZ6 A;  5M3M G;  4DR2 Q;  3I56 A;  1H9S A;  1AZQ A;  1HNW L;  1K8M A;  4R9W A;  5CV9 A;  2NVT H;  3HOX G;  3AFQ A;  4DK3 C;  3HOZ B;  1VCI A;  2QW7 A;  3D6W A;  5I9P A;  1KNA A;  5KYL A;  1WYD A;  3RMH A;  1PH7 A;  1UNS A;  1S5C D;  1BBU A;  5GQO A;  4A4I A;  2HD3 A;  1PTO H;  4HJ7 A;  3Q0A A;  1EY8 A;  2L11 A;  4DGZ A;  4JW0 A;  3TN2 A;  3HKS A;  3OW7 A;  3GTM H;  2F0L A;  2UU9 L;  4C3H G;  2TMP A;  2JA9 A;  2FJ2 A;  2OTL A;  4A3G G;  1SND A;  1TWC B;  4DNT B;  2K14 A;  4KN4 C;  1VQA A;  3BVM A;  3CCU A;  1IL2 A;  1O78 A;  3H3V C;  1SDF A;  1A6X A;  1OTC A;  2JA6 H;  4FXG C;  1HNX Q;  1L1O B;  3U50 C;  4ZQ3 A;  3NBH A;  2EYO A;  5C5L A;  3FMC A;  4QB4 A;  1VS0 A;  5E4W C;  1BNZ A;  5CBE E;  4LF9 L;  4GOP C;  4DV7 L;  4BA2 I;  1TWH H;  2O4X A;  2OWO A;  3NPP A;  5EPJ A;  1VQM A;  2X69 A;  1K8G A;  4GN5 A;  3M4Q A;  1WFQ A;  4DR7 L;  4YCU A;  2QKI C;  4ZKB B;  1B2T A;  3SK6 A;  3M4O B;  4O1N A;  1BXT A;  4OHJ A;  3KLW A;  2JXM B;  2A69 D;  1X3F A;  5A2Q E;  3CME A;  1MD2 D;  3CPF A;  4JYA Q;  3J81 j;  1WCM G;  4B3T L;  1O7I A;  2KEN A;  2E2I H;  1HNW Q;  5C4J B;  2WV6 D;  3T56 B;  4F8M A;  1QE6 A;  3AFP A;  1WTW A;  2K04 A;  3GO5 A;  1MKH A;  4LNQ A;  1SN8 A;  2K5V A;  3MXP A;  1BCP C;  4PV1 C;  5M3F H;  4HJA A;  1RL2 A;  2DJF C;  2I5L X;  4JI0 L;  4X3S A;  1WTP A;  3UE0 A;  1R4Q B;  3NXW A;  2UU9 Q;  3IFD A;  1GHJ A;  2K75 A;  2Y0S B;  2EJM A;  2JEA I;  4DPG A;  4DR4 L;  1DCZ A;  2R7Z H;  4LUV A;  3ULL A;  2NWG A;  5HGQ A;  5M5W H;  1U5K A;  1F9Q A;  1ET9 A;  3FKI G;  3ERO A;  3HOU G;  2DUD A;  2JA8 B;  3KBX A;  1ZYR D;  4U67 3;  2N88 A;  2E2D C;  1PMR A;  3NWS A;  5EPL A;  1SAP A;  1SYB A;  3ZYY X;  1BCP F;  3DLL A;  4A3D H;  2H1E A;  4DU9 A;  3GTL B;  1DON A;  4LF9 Q;  2I5M X;  1JOK A;  3BZC A;  2JSO A;  4DV7 Q;  3CPW A;  4H44 C;  1KRS A;  2LS0 1;  5C3E G;  4A3J B;  4RHR A;  4JVZ A;  4HID A;  3DEO A;  4WOR A;  4JI1 L;  4DR7 Q;  1C8C A;  2WB1 E;  3PUZ A;  4K14 A;  4AYB G;  1AN8 A;  4YHH L;  4KTA A;  2L1B A;  3H94 A;  2RSO A;  3A56 A;  5D65 A;  1G29 1;  3GTK B;  3NWT A;  3AU7 A;  4CGY B;  2PZT A;  2QIL A;  5K36 G;  4DKA C;  1X32 A;  4HSV A;  3BZK A;  4NB3 A;  3BVZ A;  4RHS A;  3DUZ A;  2NZO A;  2AUK A;  4K6L A;  1WVL A;  5FO8 B;  3U4V A;  4IO9 A;  1S3O A;  2VQE L;  3RZD B;  3I4O A;  5C44 H;  1S5F D;  2VB2 X;  3MXG A;  5C0X J;  4JI0 Q;  1EQT A;  5LL6 X;  3A8J E;  3PCO B;  2EOT A;  5KND A;  3U4Z A;  4QF4 A;  2E74 C;  2K4K A;  1SYF A;  1Y8O B;  4DR4 Q;  1I50 B;  1SMX A;  2EY5 A;  4IUV A;  4ODG A;  3HKZ B;  2ZJQ A;  1PHJ A;  3T13 A;  1FGB D;  4ZYS A;  2CHB D;  1MSH A;  2L5T A;  1EQV A;  5HUR A;  4O0A A;  1F2Y A;  3NTK A;  2SOB A;  4NW2 A;  1IL8 A;  3BDL A;  1BO0 A;  2NUC A;  3A5U A;  5C0X H;  3C2P A;  2XRQ D;  2I5H A;  1I4G A;  1U0L A;  3G4S A;  2DNC A;  1SYG A;  1WTR A;  1I6V C;  2VL6 A;  3I90 A;  4JI1 Q;  4QY7 A;  4V0B A;  1G8Z D;  3RLF A;  1HA5 A;  2OQK A;  1QCB D;  1TT2 A;  4YHH Q;  2JA6 G;  3J81 L;  4IAL A;  4DV1 L;  2P5Z X;  2HDL A;  4RGO S;  1L1O C;  4JI2 L;  3BZD B;  3S1Q B;  3NK9 A;  1VQ7 A;  1VQD A;  1LT4 D;  4HSP A;  1QVC A;  2VXW A;  4UP9 A;  1YNJ C;  4KHZ A;  1ILQ A;  1QB5 D;  4MHE A;  3RNU A;  1YHA A;  1KNE A;  1NY4 A;  2E75 C;  1IHZ A;  4NMZ A;  2VQE Q;  5IGF A;  3C1E A;  3IL8 A;  4CJ2 C;  1QUQ B;  2ALY B;  1GM5 A;  4JI5 L;  3S2D H;  1G6Z A;  2F0Q A;  2MPM A;  5EKL A;  4KV6 A;  1XXG A;  1QNU A;  2R7D A;  2M2L A;  4IPD A;  4TKO B;  4NP5 A;  5C6A A;  3GTJ B;  1L0X B;  4IOA A;  2Z0S A;  1PTO D;  5JAV A;  1BKB A;  1EIY B;  3M4P A;  5M9O A;  1XNR L;  1K9M C;  3S14 H;  4DV2 L;  4HJ5 A;  2B3G A;  1YI2 A;  3A55 A;  2MO1 A;  2F0O A;  3HOY B;  1Y8P B;  5M3F G;  1RTN A;  4FP5 D;  2XNA C;  1YHQ A;  3P1H A;  3J81 c;  2VUM H;  5C4X B;  1V9P A;  2G5D A;  5AJ3 L;  4JC0 A;  3UE1 A;  3HFZ B;  1KC8 C;  3R2I A;  2B8F A;  2MNA A;  2R7Z G;  4FF3 A;  4KK7 A;  3S2H H;  1LYL A;  2Q8T A;  1AW7 A;  4ILW A;  1Q1B A;  2ZTD A;  5CV4 A;  5DM6 3;  3TEH B;  4RCN A;  3VA5 A;  1ICW A;  1KHI A;  1QG7 A;  3P7J A;  3RZO H;  1Q3L A;  2KCC A;  4DV1 Q;  4JBK A;  4A3D G;  3TRZ A;  3L3O C;  4JI2 Q;  2AUJ D;  4NXM L;  1KQS A;  2MO0 A;  3KBG A;  3FRP B;  1YIJ A;  5KNC A;  1F9S A;  4YWL A;  4DXG A;  3J81 i;  2ZM6 L;  1RF2 D;  5C0X I;  4DAV A;  3KOJ A;  2MHV A;  1LLR D;  1CZW A;  5KGU A;  1CSQ A;  2TSS A;  1YIT A;  4RGN A;  5JVG 3;  3KF6 B;  1KD1 C;  1SNC A;  2EYJ A;  1SSO A;  3I4M H;  4JI5 Q;  2F0G A;  4JOI C;  2F3W A;  1JC7 A;  3NBI A;  3HEJ A;  1GUS A;  1O7Y A;  3VR3 A;  2XGT A;  1QNK A;  2YTY A;  2I0Q A;  4RG1 A;  1PVO A;  3LWU A;  3LX0 A;  3QG1 A;  3R3O A;  3H0G H;  2EY1 A;  4FF4 A;  2F0P A;  4DAP A;  3K5L A;  4X62 Q;  1LV9 A;  3MFG A;  1H9S B;  1UE7 A;  3A5Z B;  4RH6 A;  4LFA L;  5M5Y H;  2F4I A;  1XNR Q;  2MGS A;  4DV2 Q;  3S1N H;  3NEN A;  3M4Y A;  3PO3 H;  4KN7 C;  4GLA C;  1FJG Q;  3M7G A;  2B2V C;  2K05 A;  2L0C A;  3S15 B;  3T51 B;  5C44 G;  4A3K B;  4L5S A;  2HT1 A;  4AYB E;  2HCC A;  3A8K E;  1VQO A;  2A73 B;  2PNH A;  1CQF A;  3OWE B;  1UAP A;  5AJ3 Q;  4N8X 1;  1I3Q B;  3JC6 6;  1K83 B;  3F2U A;  1CFM A;  1D5X C;  4J8Q A;  5M3M B;  1SE3 A;  1JB7 A;  3KDF A;  2F3I A;  3I8Z A;  3WOF A;  2YU9 B;  2K5N A;  1D1I A;  5DLQ E;  5FO7 B;  3EBE A;  1HTP A;  3M3Y B;  1PZI D;  1OXS C;  5DM7 3;  2UUA Q;  5DNF A;  4LWC A;  1HZA A;  2KQ3 A;  2WP8 J;  2YYZ A;  1ZXT A;  3CC7 A;  4NXM Q;  1TWA B;  5C3X A;  3DWP A;  5C0X G;  2CWA A;  4C3I B;  3NBH B;  2ZM6 Q;  4QMG A;  1Y1V H;  2Z6B A;  2ASB A;  1I4X A;  1B9N A;  4PZ8 A;  4C3H B;  2EYL A;  4ZK9 B;  4A3G B;  2JJQ A;  2RCF A;  4BBR H;  4G57 A;  3TSS A;  2GA4 B;  3ZJY C;  2UXB Q;  1N9W A;  4A3B B;  3MXN A;  5I2Y A;  4R4T A;  1M90 C;  3MXU A;  2NZ1 D;  3S16 H;  2K5H A;  4XYQ A;  5FLX L;  2PZU A;  4ME3 A;  1NUC A;  4DUY L;  2DN8 A;  4IN3 A;  1D8L A;  4QUC A;  1HFG A;  1ESR A;  4LFA Q;  2JA5 H;  1A15 A;  4IUN A;  5G3L F;  4RGT A;  4EX5 A;  1I6H B;  1BBX C;  2C9O A;  4GOP B;  4ZLT F;  1CA6 A;  3J7A V;  1G91 A;  2JA7 H;  2J7Z A;  1O7Z A;  5ELO A;  1HQM C;  1NBW A;  4POG A;  4GZY C;  1PH2 A;  3PIO A;  4C2M H;  4BY1 H;  3EFX D;  2N8N A;  3AEV A;  3OIQ A;  1WCM B;  4C3J H;  2HHH L;  4LF4 Q;  2X6L A;  1Z7T A;  1SYC A;  3BG3 A;  3GTG H;  4APV A;  2A6E C;  4DV0 Q;  2NVY H;  3WWV A;  2ES2 A;  1AE2 A;  2DJG C;  1E2W A;  3U9O A;  5IOC A;  5I6Y A;  4L5R C;  1MJE A;  4JBW A;  3CC4 A;  3Q22 A;  3OMC A;  4IUP A;  2Q8R E;  2VUM G;  3I3C A;  4FF1 A;  4KMU C;  4OIK A;  1N8R C;  1OXX K;  2B2T C;  1Y1W B;  5FLX c;  3STB C;  1H9M A;  2K50 A;  2RBM A;  3UI2 A;  4Z9C B;  2EE1 A;  1X9N A;  5NUC A;  2BCO A;  3A7L A;  1PH1 A;  2CVR A;  3T1H L;  3GTQ B;  4DV4 Q;  1HR0 L;  3A0J A;  5CGK A;  5CR3 A;  3FKI B;  3TZU A;  2BA1 A;  4KKS A;  3HOU B;  3OTO L;  4KHP L;  5FO9 B;  3E3X A;  4A3E H;  4DUY Q;  2WB1 G;  3HG9 A;  2ICI A;  1IBL L;  3EVQ A;  2BOS A;  2WAQ E;  5ELF A;  4KI0 A;  4DR3 L; 
#chains in the Genus database with same CATH homology
 1GUW A;  5A35 A;  4IFD J;  4ID6 A;  3URY A;  4KY6 A;  3S1R B;  3R93 A;  3ITP A;  2A5H A;  3BDO A;  2K03 A;  4RFB A;  3PIO 3;  1WTQ A;  3SXH A;  1JR0 D;  1VF7 A;  1H9J A;  1GUT A;  5IGC A;  4F87 A;  2B2W C;  2H4O A;  2NTT A;  5EBC A;  4EQO A;  1EY9 A;  3D8G A;  1FNW A;  1SNQ A;  1MGS A;  4IFD H;  3N6R A;  5KRU A;  5K36 H;  5DEH A;  5D3I B;  5ISR A;  1BQQ T;  2PNR C;  1ET6 A;  2ENB A;  2Z4I A;  4MIU A;  3I70 A;  3D4W A;  4L63 B;  2KEE A;  2B2W A;  3IFT A;  3VYS A;  2NVT B;  2A69 C;  2QEJ C;  3P20 A;  5I2X A;  1HRJ A;  3VR4 A;  1PTO B;  3BDC A;  4HMI A;  3GTM B;  2B2Y A;  1JE4 A;  2KVM A;  4YIJ A;  5BN3 A;  1D6E C;  4WRD A;  5JOB A;  1TQO A;  4X3U A;  5ELB A;  1E2Z A;  3J7Y W;  1ENA A;  5I9O A;  2FMC A;  4NDX A;  1UEA B;  4N9T A;  5JVH 3;  2R61 A;  2FIN B;  1TWH B;  3VR2 A;  1XX8 A;  4OO1 H;  1ZYR C;  3NTH A;  4CJ0 B;  5COY A;  2F0S A;  1GHK A;  1EEI D;  1JB3 A;  3NP8 A;  4HCS A;  1LTA D;  1TS3 A;  3V2T A;  4C3J G;  2AWO A;  1SNM A;  4ABN A;  1IKL A;  1PFN A;  3DWA A;  1JOQ A;  2E2I B;  1EWC A;  2F0N A;  4K2L A;  4M1U B;  1STH A;  3TP6 A;  1TVX A;  4E6I A;  4IFD I;  2MUY A;  3QOL A;  5M3F B;  4F88 A;  3DHQ A;  1RJT A;  4C1N K;  4F7X A;  3K5M A;  2K33 A;  1TKW B;  3VYR A;  4QIW B;  4QCL A;  3KF8 A;  2PW7 A;  4C56 C;  1O80 A;  5IGB A;  2R7Z B;  1YNN D;  3D3R A;  2CQA A;  3H6M A;  3NUC A;  3P75 A;  3KK7 A;  3HGB A;  1I4R A;  4LJZ C;  5CYU A;  5K5P A;  1VF5 C;  3J81 E;  5IT9 L;  2Q8I B;  1I4Q A;  1SE4 A;  1DOM A;  2V4D A;  2R3Z A;  1EY6 A;  4CHT B;  1Y8N B;  3NHH A;  1CZG A;  2ZXP A;  1EU4 A;  1C48 A;  2XN9 C;  5E3F A;  1F2L A;  1FYC A;  2L55 A;  4B9W A;  1Z47 A;  1EZ6 A;  4IFD G;  3PUX A;  4OO1 I;  4DNR B;  5HGT A;  1M8A A;  5C44 B;  2DNE A;  2XIW A;  2KEC A;  1RD9 D;  5BN5 A;  1SBB B;  3T4A C;  2K6A A;  4ZUJ A;  3K6O A;  2F0K A;  1EL0 A;  5JJZ A;  4A3I B;  2EZV A;  4K8J A;  4PMC A;  1RKN A;  1FNU A;  1EIG A;  1BF4 A;  2G9H D;  4H13 C;  1PTO C;  3DXJ C;  3LNN A;  3C3L A;  2E2H B;  1AFP A;  1A3V A;  4ZAI A;  1WTO A;  1AEX A;  2K5W A;  2C5C A;  2B39 A;  2B2U A;  4DK1 A;  2R92 B;  3TP5 A;  2D62 A;  1EY0 A;  3A7A B;  1NR4 A;  4HMJ A;  1CHP D;  4CKB A;  4KHV A;  3R2T A;  1PTO F;  1EIH A;  1BOS A;  5JPN C;  5ELD A;  3D6C A;  4OO1 G;  5D14 A;  3D31 A;  3MHB A;  2R93 B;  1IYV A;  5EKK A;  1NR2 A;  3K5N A;  4IUT A;  2R6G A;  1GUG A;  5T1I A;  3KLR A;  3W3A A;  3S2D B;  1WD1 A;  1SNP A;  5FK9 C;  5J39 A;  1SYE A;  2E76 C;  4R8I A;  1PLF A;  2F0J A;  1LTR D;  1V1P A;  2NBF A;  1I4P A;  5IGG A;  4RWS C;  4XT1 B;  2CW0 D;  1LT6 D;  3BYT B;  5T1G A;  5CV5 A;  1QJO A;  3S14 B;  2SDF A;  1JWM D;  1JQY D;  4KD4 A;  5TSS A;  1B53 A;  2VUM B;  1F9R A;  3FVQ A;  4RA8 A;  2ZT9 C;  3S2H B;  4X3K A;  1HA6 A;  4EVO A;  1BR9 A;  4FF2 A;  1BDO A;  3RZO B;  1MBY A;  4RKL A;  3CRK C;  2WB1 B;  2EYM A;  3TDQ A;  4G7O C;  4G7Z C;  1R4P B;  3V96 A;  5FLX E;  5FKA C;  1HUM A;  3I4M B;  2EDG A;  1SNO A;  4BA1 I;  2Z4H A;  4UDU C;  2HUG A;  1TS5 A;  4IUU A;  3PO2 B;  3H0G B;  3KLS A;  2KCN A;  3MWY W;  1JWU D;  5CBA E;  3KUP A;  4RKB A;  2DY7 A;  5CV7 A;  3QB3 A;  3WDN A;  2IX0 A;  1QIL A;  3SDZ A;  1T5E A;  2AWN A;  2LMC B;  2FMM A;  3NQI A;  2QF7 A;  4IZ8 A;  4CJ1 B;  2BDN A;  1LT5 D;  1T5X D;  3HOX B;  2PW5 A;  1Y1V B;  4DFA A;  2HQE A;  5J22 A;  2QDB A;  4BBR B;  4KJO A;  1HCZ A;  1CM9 A;  1NCV A;  1ILP A;  1KAA A;  3MEH A;  1LTB D;  4KY5 A;  3S16 B;  5E1F A;  1PRT D;  4BWG B;  2JA5 B;  5FOB B;  4KKU A;  1TS4 A;  1KTK A;  3OPO A;  2F03 A;  2IX1 A;  2FFK B;  5LHY 1;  3NSW A;  3DMU A;  2BA0 A;  4DXF A;  2ICE C;  2JA7 B;  3K0Y A;  2G9D A;  3C46 A;  1WD0 A;  1JWS D;  3VYT A;  3QIA A;  4C2M B;  1CQV A;  4PQX A;  5E4X A;  3PIP 3;  3BVG A;  1D1K A;  1GXD C;  1XYI A;  1Q90 A;  5BN4 A;  2LKV A;  1DYQ A;  4ME5 A;  1LTT D;  2A74 C;  2XWB B;  4WJW A;  1LAC A;  1Z6H A;  2EYF A;  3WOE A;  3SHL A;  2JE6 I;  3TME A;  2VNU D;  2D9U A;  1B4O A;  4OL7 A;  4S3S A;  2EJG C;  2JYO A;  2I46 A;  1XTC D;  2K01 A;  1WTV A;  3FPU B;  3QOJ A;  2F0V A;  4A3E B;  1UUP A;  2F0M A;  2AQ3 B;  3NE5 B;  4XYO A;  2L9H A;  3FPP A;  3SR1 A;  1EY5 A;  4IQZ A;  4PMW A;  2K1B A;  2JEB I;  2IL8 A;  1IKM A;  4RCO A;  1F9P A;  2PO4 A;  1VMC A;  2EYP A;  4J1M A;  1S4Z A;  3CKI B;  5C3E B;  4M8A A;  3OMG A;  3PMF A;  4R8N A;  1S5E D;  4AYB B;  1A3U A;  3TZD A;  3MFY A;  4U68 A;  1SFO B;  2F0H A;  2J4X A;  1F2M A;  2MP1 A;  3T16 A;  4FXD A;  1EZ8 A;  1W6K A;  1ESF A;  1PFB A;  2ID0 A;  1JOR A;  4XIG S;  4I7Z C;  3CHB D;  3IKJ A;  3T53 B;  3RD4 A;  2VB3 X;  2IJ0 A;  2XVS A;  2B2Y C;  3X3N A;  4UAI A;  2F0T A;  4DA2 A;  1STE A;  1U9R A;  2ZXR A;  4K5X A;  1DOK A;  4EQP A;  1A3T A;  2NTS A;  1IW7 D;  3NQT A;  1FR3 A;  3K5O A;  1U4M A;  5EGT A;  4ULL A;  2SNS A;  5F2D A;  2FHT A;  2EVB A;  2D2C C;  3TP7 A;  3ERQ A;  1DXM A;  4HN7 A;  4G7H C;  1LT3 D;  3PV0 A;  1ONL A;  2OF1 A;  5D3D A;  3LWE A;  2L12 A;  3GTO B;  1FNV A;  4DAY A;  1B50 A;  2WIN B;  4QUF A;  4BS9 A;  5IT9 E;  2KJX A;  1YNN C;  2RA4 A;  1V1P B;  2RSN A;  4K5V A;  2KED A;  2L4N A;  3L9A X;  3J80 L;  2JA6 B;  4HAE A;  3RUZ A;  4K2K A;  3K59 A;  3W2D A;  2DY8 A;  4IUR A;  4HTH A;  4C3I G;  1SMY D;  2O5J C;  2KOL A;  3V05 A;  5C5M A;  3GV3 A;  4H0L C;  1K8O A;  3MVV A;  2BE5 D;  3L7Z C;  3GP7 A;  1MSG A;  4ZRZ A;  1STG A;  2K5Q A;  2PCF B;  3SVM A;  1JIC A;  3MAQ A;  3A8I E;  5C3W A;  3HOW B;  1EWH A;  2NN6 H;  3C1F A;  5IOD A;  2RQX A;  2A6H D;  1U4R A;  3ONA B;  2M00 A;  1RCV D;  3A54 A;  3H91 A;  4DK0 A;  3HP3 A;  2M9V A;  2IW3 A;  3D4R A;  5CC4 A;  4TSS A;  4HCE A;  2AQ2 B;  4K5W A;  4Q0F A;  3HOV B;  3S17 B;  1S5B D;  2WAQ B;  5KNB A;  1DD2 A;  1LTI D;  3HRZ C;  1PFM A;  1Q1E A;  2KUM A;  1V43 A;  5M5W B;  5M5X B;  4OGQ C;  3OOC A;  2WKC A;  1PXU A;  3N52 A;  4XDX A;  2F0W A;  5AFW A;  1B44 D;  1HXY D;  1LTS D;  1CT1 D;  3QJY A;  4A3D B;  3SK8 A;  1JCK B;  4XT3 B;  4CKC A;  4N9P A;  2KHS A;  1QOH A;  5JPM C;  4OIJ A;  4XTC S;  1DZ1 A;  2EYH A;  1J9O A;  1M4V A;  5I4D A;  2Z8L A;  1ENC A;  1A2T A;  2NVQ B;  3ND8 A;  4K8I A;  3DWQ A;  1TY0 A;  4LMQ D;  1ZKO A;  3BS1 A;  1ZEQ X;  1STN A;  1PRT B;  1IYU A;  1RHP A;  3SK4 A;  1PYW D;  2SEB D;  4JK1 C;  2WII B;  4FYD A;  3K7A B;  4P2C B;  1F77 A;  2NB0 A;  2NVX B;  1E2V A;  2NN6 I;  1Q12 A;  2MJ8 A;  3TP8 A;  2B2U C;  5C4Z A;  2EXZ A;  1J8I A;  4A3F B;  4EGV A;  5CMD A;  1CI3 M;  4C1N I;  1LAB A;  2CW0 C;  1TWF B;  1BCP D;  4L8J A;  1RTO A;  4DF7 A;  3U9S A;  4FO2 A;  5A2Q L;  2F0I A;  1S5D D;  4V19 0;  3VR6 A;  3I4L A;  3IAY A;  4ZKC B;  4L6T B;  2I07 B;  1TY2 A;  3VR5 A;  1ENF A;  4FVM A;  1STA A;  5KEE A;  4J6H A;  3I4N B;  1EY7 A;  3GQB A;  5IGE A;  1L0Y B;  5CV8 A;  4XQQ A;  1EYA A;  2EJF C;  3SK5 A;  4A3M B;  2QCP X;  2JP1 A;  1X3P A;  2F3V A;  1TR5 A;  3EJI A;  1Y69 U;  4B08 A;  1EYD A;  1WTX A;  4HED A;  2NN6 G;  3CRL C;  2KA7 A;  4Q5V A;  3G6J B;  5COR A;  3HZX A;  1ML0 D;  1TU2 B;  1KLG D;  3AMU A;  3TBI B;  1E0B A;  1KLU D;  1B1Z A;  3I73 A;  1AP0 A;  3QO2 A;  2LY7 A;  1D5Z C;  2PYK A;  3R8B A;  2RDH A;  2NYZ D;  3CQZ B;  3EQL C;  2J0T D;  3Q6S A;  1H9R A;  2OXP A;  2RDG A;  3PUV A;  5JEA J;  1SE2 A;  1OXT A;  4HR7 B;  4ZUI A;  1U4P A;  1D2B A;  1U4L A;  1W6J A;  4CBV A;  1FD7 D;  3O13 A;  5EPK A;  1PZK D;  2LFN A;  1OO9 B;  4PMB A;  1C4Q A;  1KDA A;  1EY4 A;  3MC0 B;  2XRS D;  1SEB D;  3MTS A;  1MI2 A;  5KYI A;  1NSN S;  5JEA H;  4BBS B;  2SNM A;  4BY7 B;  3VYU A;  2IPK D;  3M7N A;  3DEP A;  1YNJ D;  2F0U A;  3K58 A;  1R9T B;  5M5Y B;  1TII D;  2RDF A;  1O7L A;  1PRT C;  4TQU S;  3S1N B;  3PO3 B;  3GTP B;  1SXT A;  1BUV T;  2IWH A;  5IGD A;  1STB A;  3Q23 A;  1OXV A;  3NTI A;  1ROD A;  2E2J B;  2F0D A;  3OWF A;  3OIP A;  3GD7 A;  4I65 A;  5KIX A;  1A2U A;  3MA2 B;  3X3M A;  1II3 A;  4K6D A;  1PRT F;  2IT1 A;  3J7A F;  2K28 A;  3E5S A;  4KY7 A;  3G7L A;  1NAP A;  4FNF A;  5ELE A;  3H09 A;  2F0E A;  3DM1 A;  1CTM A;  2F0F A;  1QWY A;  1OXU A;  1V1O A;  2B8G A;  2XWJ B;  4RAU C;  3JAM E;  1G2S A;  1KAB A;  2PPB C;  1HFN A;  1CK1 A;  3VA7 A;  1DOL A;  3ND9 A;  1SJH D;  4WFN 3;  1HTL D;  2EPB A;  1HPC A;  1Q8I A;  4MN3 A;  3SE0 A;  4KD3 A;  5EKI A;  4RGM A;  4XQN A;  2B2V A;  1B9M A;  2IX3 A;  1XWE A;  4XQJ A;  2RKS A;  1GOZ A;  4IUQ A;  1D5M C;  2B63 B;  3FDT A;  5IIF A;  3FEW X;  2D5D A;  3QWN A;  5ELC A;  1LO5 D;  2O2L D;  2RVL A;  2WKD A;  4LAA A;  2X6G A;  4BY1 B;  3MZ5 A;  3E6Z X;  4C3J B;  3I72 A;  2BDO A;  3GTG B;  2NVY B;  2F1M A;  2A68 C;  4PNY A;  2AQ1 B;  4O42 A;  2HDM A;  3M85 A;  1I4H A;  1V8Q A;  5LL6 S;  4LK1 C;  1EYC A;  1KDB A;  1G2T A;  1GJX A;  5DAU A;  1DM0 B;  1H9K A;  4X3T A;  5CV6 A;  1EU3 A;  1HUN A;  4Y7N B;  1GUN A;  1CA5 A;  2K5D A;  1SYD A;  2K32 A;  5EQ0 A;  2EY2 A;  3JAM L;  2PMZ B;  2PZW A;  2OEO A;  5G3L D;  1IW7 C;  3K57 A;  1PDQ A;  1TWG B;  1BCP B;  1PZJ D;  2WAC A;  3J80 E;  1EFI D;  3PUY A;  3AB9 A;  1STY A;  5JEA G;  3BYY B;  1GUO A;  4G4K A;  1HHV A;  3D4D A;  4TRD A;  1DJR D;  3CU7 A;  2N55 A;  4XXE A;  2K7V A;  2A68 D;  4EQN A;  1X3Q A;  2B2T A;  4A93 B;  3HS0 C;  4FXK C;  1VMP A;  4CKE A;  3EA6 A;  2PQE A;  3OSO A;  1SMY C;  5C4H A;  4NKL A;  3SEB A;  3OHX C;  1SJE D;  3I91 A;  4KJN A;  2BE5 C;  3E0J A;  2A6E D;  3S9W A;  4H7B A;  3GV6 A;  2ZXO A;  1B3A A;  1TS2 A;  3PUW A;  4KKT A;  5I6W A;  1EOT A;  1AZP A;  5J1Z A;  5EJW A;  2HCI A;  5EBD A;  2A6H C;  3S1M B;  3KLS X;  4DN4 M;  1JOO A;  2XSC A;  3Q24 A;  1RDP D;  1EEF D;  2O5I C;  4B9X A;  2Z1C A;  1HQR D;  1VDZ A;  2EY6 A;  1KDC A;  1F2Z A;  2OT2 A;  1CHQ D;  1LTG D;  1H9S A;  1AZQ A;  1K8M A;  4R9W A;  5CV9 A;  3HOZ B;  1VCI A;  3D6W A;  5I9P A;  1KNA A;  5KYL A;  3RMH A;  1UNS A;  1S5C D;  1PTO H;  3Q0A A;  1EY8 A;  2L11 A;  4DGZ A;  3TN2 A;  3OW7 A;  2F0L A;  4C3H G;  2TMP A;  2FJ2 A;  1SND A;  1TWC B;  4DNT B;  4KN4 C;  3BVM A;  1O78 A;  3H3V C;  1SDF A;  1A6X A;  4FXG C;  4ZQ3 A;  3NBH A;  2EYO A;  5C5L A;  3FMC A;  4QB4 A;  5E4W C;  1BNZ A;  5CBE E;  4BA2 I;  2O4X A;  3NPP A;  5EPJ A;  2X69 A;  4ZKB B;  2QKI C;  1B2T A;  3SK6 A;  3M4O B;  4O1N A;  1BXT A;  4OHJ A;  2JXM B;  2A69 D;  5A2Q E;  1MD2 D;  5C4J B;  2WV6 D;  3T56 B;  4F8M A;  1QE6 A;  1WTW A;  2K04 A;  3GO5 A;  3MXP A;  1BCP C;  4PV1 C;  4X3S A;  1WTP A;  1R4Q B;  3NXW A;  3IFD A;  1GHJ A;  2JEA I;  2Y0S B;  2EJM A;  1DCZ A;  2NWG A;  1F9Q A;  1ET9 A;  3ERO A;  2JA8 B;  3KBX A;  1ZYR D;  4U67 3;  2N88 A;  2E2D C;  1PMR A;  3NWS A;  5EPL A;  1SAP A;  1SYB A;  3ZYY X;  1BCP F;  2H1E A;  4DU9 A;  3GTL B;  1DON A;  1JOK A;  2JSO A;  4H44 C;  2LS0 1;  4A3J B;  4RHR A;  3DEO A;  4WOR A;  1C8C A;  3PUZ A;  4K14 A;  1AN8 A;  4KTA A;  2L1B A;  3H94 A;  2RSO A;  3A56 A;  5D65 A;  1G29 1;  3GTK B;  3NWT A;  3AU7 A;  4CGY B;  2PZT A;  2QIL A;  5K36 G;  1X32 A;  4HSV A;  3BVZ A;  4RHS A;  3DUZ A;  2AUK A;  4K6L A;  1WVL A;  5FO8 B;  3RZD B;  1S5F D;  2VB2 X;  3MXG A;  5C0X J;  1EQT A;  5LL6 X;  3A8J E;  2EOT A;  5KND A;  4QF4 A;  2E74 C;  1SYF A;  1Y8O B;  1I50 B;  2EY5 A;  4IUV A;  4ODG A;  3HKZ B;  3T13 A;  1FGB D;  4ZYS A;  2CHB D;  1MSH A;  2L5T A;  1EQV A;  5HUR A;  1F2Y A;  3NTK A;  2SOB A;  4NW2 A;  1IL8 A;  3BDL A;  1BO0 A;  2NUC A;  5C0X H;  3C2P A;  2XRQ D;  1I4G A;  2DNC A;  1SYG A;  1WTR A;  1I6V C;  3I90 A;  4V0B A;  1G8Z D;  3RLF A;  1HA5 A;  1QCB D;  1TT2 A;  3J81 L;  4IAL A;  2HDL A;  4RGO S;  3BZD B;  3S1Q B;  3NK9 A;  4HSP A;  1LT4 D;  2VXW A;  1YNJ C;  4KHZ A;  1ILQ A;  1QB5 D;  4MHE A;  1KNE A;  2E75 C;  1IHZ A;  4NMZ A;  5IGF A;  3C1E A;  3IL8 A;  4CJ2 C;  1G6Z A;  2F0Q A;  2MPM A;  5EKL A;  4KV6 A;  1XXG A;  1QNU A;  2M2L A;  4TKO B;  4NP5 A;  5C6A A;  3GTJ B;  1L0X B;  1PTO D;  5JAV A;  5M9O A;  3A55 A;  2F0O A;  3HOY B;  1Y8P B;  1RTN A;  4FP5 D;  2XNA C;  3P1H A;  5C4X B;  3R2I A;  2B8F A;  4FF3 A;  4KK7 A;  2Q8T A;  1AW7 A;  4ILW A;  1Q1B A;  5CV4 A;  5DM6 3;  4RCN A;  3VA5 A;  1ICW A;  1QG7 A;  3P7J A;  1Q3L A;  2KCC A;  3L3O C;  2AUJ D;  3KBG A;  3FRP B;  5KNC A;  1F9S A;  4DXG A;  1RF2 D;  5C0X I;  4DAV A;  2MHV A;  1LLR D;  1CZW A;  5KGU A;  2TSS A;  4RGN A;  5JVG 3;  1SNC A;  2EYJ A;  1SSO A;  2F0G A;  2F3W A;  1JC7 A;  3NBI A;  3HEJ A;  1GUS A;  1O7Y A;  3VR3 A;  1QNK A;  3LWU A;  3LX0 A;  3QG1 A;  3R3O A;  2EY1 A;  4FF4 A;  2F0P A;  4DAP A;  3K5L A;  1LV9 A;  3MFG A;  1H9S B;  4RH6 A;  2F4I A;  2MGS A;  3M4Y A;  4KN7 C;  3M7G A;  2B2V C;  2K05 A;  2L0C A;  3S15 B;  3T51 B;  4A3K B;  2HCC A;  3A8K E;  2A73 B;  1CQF A;  3OWE B;  1UAP A;  1I3Q B;  1K83 B;  3F2U A;  1CFM A;  1D5X C;  4J8Q A;  5M3M B;  1SE3 A;  3WOF A;  3I8Z A;  2YU9 B;  1D1I A;  5FO7 B;  3M3Y B;  1HTP A;  1PZI D;  1OXS C;  5DM7 3;  5DNF A;  2KQ3 A;  2WP8 J;  2YYZ A;  1ZXT A;  1TWA B;  5C3X A;  3DWP A;  5C0X G;  4C3I B;  4QMG A;  1I4X A;  1B9N A;  4C3H B;  2EYL A;  4ZK9 B;  4A3G B;  4G57 A;  3TSS A;  2GA4 B;  4A3B B;  3MXN A;  5I2Y A;  3MXU A;  2NZ1 D;  4XYQ A;  5FLX L;  2PZU A;  1NUC A;  2DN8 A;  4IN3 A;  4QUC A;  1HFG A;  1ESR A;  1A15 A;  4IUN A;  5G3L F;  4RGT A;  1I6H B;  1BBX C;  2C9O A;  4ZLT F;  1CA6 A;  3J7A V;  1G91 A;  2J7Z A;  1O7Z A;  1HQM C;  4GZY C;  3EFX D;  3OIQ A;  1WCM B;  2X6L A;  1Z7T A;  1SYC A;  3BG3 A;  2A6E C;  5IOC A;  1E2W A;  3U9O A;  5I6Y A;  4JBW A;  3Q22 A;  3OMC A;  4IUP A;  2Q8R E;  3I3C A;  4FF1 A;  4KMU C;  4OIK A;  1OXX K;  2B2T C;  1Y1W B;  1H9M A;  2RBM A;  3UI2 A;  4Z9C B;  2EE1 A;  5NUC A;  2BCO A;  3A7L A;  2CVR A;  3GTQ B;  5CGK A;  5CR3 A;  3FKI B;  3TZU A;  2BA1 A;  4KKS A;  3HOU B;  5FO9 B;  3HG9 A;  2ICI A;  3EVQ A;  2BOS A;  5ELF A;  4KI0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...