1AEXA

Staphylococcal nuclease, methane thiol disulfide to v23c variant
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
135
structure length
134
Chain Sequence
LHKEPATLIKAIDGDTKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Nuclease
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title Mobile unnatural amino acid side chains in the core of staphylococcal nuclease.
pubmed rcsb
source organism Staphylococcus aureus
total genus 32
structure length 134
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1997-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1aexA00
2EYOA 4RKLA 3SK8A 3TP7A 5C5LA 5IGCA 3NUCA 2OXPA 4F7XA 4ID6A 2EXZA 5IODA 2QDBA 3MZ5A 1SYCA 4TRDA 4WORA 4DFAA 5C5MA 5KYLA 5JAVA 4B9WA 4I65A 2F0FA 1EYDA 5NUCA 2F0JA 3H6MA 4LAAA 4DGZA 4K8IA 4ZUIA 5ISRA 5K5PA 5J1ZA 4RKBA 5I9PA 1NUCA 1SNPA 1SNQA 1STBA 1EQVA 4KY6A 5CV4A 1A3TA 1KDCA 3SR1A 4HMIA 3OMGA 2OF1A 1STNA 1EY5A 1STYA 2KHSA 3D6CA 3VA5A 1STAA 1SNOA 4KY5A 5CV8A 3RUZA 2EY6A 4KY7A 4EVOA 4PNYA 1F2MA 5C3WA 5CV9A 3MHBA 4KTAA 5EGTA 3PMFA 4OL7A 4DU9A 5CGKA 2F0GA 2F0UA 4KV6A 2SNSA 3OWFA 1SNMA 4QF4A 3MXPA 3SK4A 3NK9A 4E6IA 3HEJA 3E5SA 5C4HA 1EY6A 1KDBA 2EY5A 1ENAA 4QMGA 1EY4A 4MIUA 1JORA 2F0DA 2HQEA 4WRDA 1SYBA 2F0TA 3HZXA 4HMJA 3SXHA 4G57A 2RBMA 4K14A 1EYAA 3OMCA 4ME5A 5C3XA 5I6WA 5IGFA 3SHLA 4K5VA 2F3WA 2PW7A 1II3A 2EYPA 3D4WA 2SNMA 2EYHA 2F0NA 1F2YA 4IUNA 1EYCA 1A2TA 3NP8A 4ZQ3A 3TP5A 4IZ8A 4DF7A 5KIXA 1TT2A 1AEXA 3OSOA 3P75A 4NMZA 4PMCA 3SK5A 5KRUA 4NP5A 2F0SA 5CV7A 5IGDA 4K8JA 5EKKA 2PZWA 1KDAA 2RDFA 5IIFA 5E1FA 1SYEA 4HTHA 4EQPA 1A3UA 3R3OA 2F0HA 5I6YA 2WACA 4K5XA 4R8NA 2F0VA 3TMEA 5CC4A 3EJIA 1JOQA 4YIJA 5JOBA 3U9OA 5CV5A 5M9OA 5C6AA 1ENCA 4K2KA 4KJNA 2PQEA 2PZTA 4EQOA 5IGEA 4K2LA 2RKSA 1SYFA 1TR5A 3QOJA 5CR3A 3NXWA 4NDXA 1JOKA 5F2DA 5J39A 3EROA 1IHZA 2PYKA 3T13A 3NHHA 1NSNS 2F3VA 2EYJA 3BDLA 3DMUA 2KQ3A 3BDCA 1U9RA 1EZ6A 2F0IA 2SOBA 3DHQA 1EZ8A 2F0LA 3D8GA 3LX0A 2LKVA 5DEHA 2F0OA 3T16A 5DAUA 1SNDA 3C1EA 3EVQA 4ODGA 1SYDA 5EKLA 5J22A 3MEHA 1EY9A 5KGUA 5CV6A 3S9WA 5I9OA 4KD4A 1KAAA 2EYFA 2F0KA 4NKLA 2F0MA 1A3VA 5E3FA 5C4ZA 4KD3A 1KABA 3QOLA 3TP6A 1SYGA 3NQTA 4QB4A 1F2ZA 2EYLA 4ZUJA 5KYIA 2M00A 1EY7A 5HURA 2ENBA 3D4DA 4N9TA 3TP8A 5IOCA 2O4XA 4F8MA 1STGA 1JOOA 2F0PA 2EY1A 3P1HA 2F0EA 1STHA 2F0QA 1EY0A 3ERQA 5IGGA 4J1MA 5KEEA 1A2UA 3MVVA 3SK6A 1EY8A 4KJOA 5HGTA 3V2TA 1SNCA 1TQOA 2PW5A 3C1FA 4J6HA 4B9XA 4S3SA 4K6DA 2PZUA 2EY2A 4H7BA 4K5WA 3QB3A 4IALA 5IGBA 2NUCA 2F0WA 4N9PA 4PMBA 1RKNA 4KHVA 4EQNA 2OEOA 3ITPA 2EYMA
chains in the Genus database with same CATH superfamily
2NN6H 2RCNA 5C44H 3A0JA 3OW2A 1UUPA 2EJMA 2EXZA 3I4OA 1TWCB 5C5MA 3S1NB 5C0XG 4B9WA 2DJGC 3ZYYX 4QL5A 1HR0L 2Z6BA 4DR7L 2L12A 3PUVA 4OGQC 4IUVA 2OT2A 4DV2Q 1WTPA 2E76C 1TS5A 4YCVA 4TQUS 1A6XA 1VQ8A 4KLKA 4KY7A 3GTJH 5D14A 3PMFA 2F0GA 5JVG3 2JA5B 5E7NA 2EY5A 2A8VA 2HHHL 4DV7Q 4F87A 1SYBA 3HKSA 3TSSA 4BBRB 1H9RA 1HNZQ 2F3WA 5JPMC 2H4OA 3ND8A 2RA4A 4JBJA 1PH8A 1UEBA 2R3ZA 3AYHB 4HSVA 1WTVA 5IYCH 1Y1VG 2WAQE 1LT6D 1WCMG 3K7AH 1KRSA 4A3GB 4CDFC 3CP0A 2V4DA 2KCCA 2NVTH 2IHFA 2UXCQ 3HOUH 4OO1G 3CCMA 2A69C 3S1RB 3ULLA 1CT1D 4WJ4A 5M3MG 4AIMA 1K73C 1IHZA 3CRKC 1EOTA 2KBNA 1HZCA 3MXUA 2K75A 2G5DA 2L1BA 1N34L 3VR6A 3S2HB 2Y0SE 2CQAA 5I9OA 2F4VQ 2XIWA 1HRJA 5FLXE 3S17H 2F0KA 4NKLA 3IKJA 1U5KA 3B6YA 1F9RA 4KI0A 2K5WA 4QB4A 2QKIC 3TP8A 2O4XA 3CRLC 1SJHD 2ASBA 3CAMA 3M4YA 4O2DA 4GLAC 1NR4A 1EQTA 1RTNA 2A6EC 4B9XA 3K8AA 4S3SA 4IUTA 1STEA 4MNOA 3G4SA 4LF7L 2NUCA 2H1EA 2CCZA 3KLSX 2OEOA 3ITPA 3TMEA 1PV4A 4AYBG 3S15H 2K14A 4DR1L 3W3AA 4B08A 3KF8A 3T1YL 2UXBQ 3JAMc 2Q2UA 2FHTA 3M4OH 3CCSA 4GNXA 2V1CC 4DR3L 1YHQA 2UUBL 1I3QB 4POFA 3MFYA 5L37A 2JA9A 3J7ZC 1LUZA 4YY3L 2D9UA 5FLXL 2KCMA 4DUYQ 1ZXTA 3RD4A 4OWTB 3DLLA 2E2IB 1PLFA 5IT9L 1ESFA 3E5SA 3GTLH 5GAHC 3J7YW 4OEMB 4OXPA 1LTRD 1YNND 1U0LA 3K58A 3K5OA 3SHLA 3M85A 1JQYD 2PW7A 3T51B 1SEBD 2RDHA 4UAIA 5GADC 5KRUA 3KUPA 4IFDI 4A3KG 3H94A 3I4MG 4JYAQ 2L5TA 1N9WA 4JV5L 4EX5A 5M5WB 4TKOB 3U9OA 5CV5A 2B2VA 3KBXA 1ESRA 3QG1A 1WD0A 5EAYA 3G7LA 1LV9A 1G6PA 2YU9B 2F4IA 1SFOB 2ATWA 1O80A 2R61A 3O13A 1VQAA 1Q1BA 4C3HH 1G8ZD 2B2TC 4RCNA 1BCPD 1U9RA 1V8QA 3L3OC 4HJ8A 3TS2A 4V0BA 3MEHA 1Y8PB 1JE5A 4RFBA 3BYTB 4J15A 1TWGB 3TP6A 2D2CC 2VNUD 2Z4HA 4LF8L 3U9SA 4F8MA 3QIAA 4R1JA 2R7ZG 1IXRA 3SDZA 1K8OA 1XNQQ 4RH6A 5FLMH 5IGGA 1Y1VB 1VQEA 4YCUA 3KJOA 3MVVA 1WCMB 2TSSA 2X6GA 1PDQA 5C4XG 2IJ0A 2C9OA 2MPMA 3T1HQ 4A3BG 2KHJA 3GTPH 1PZJD 1HR0W 2ALYB 3ULPA 2PNRC 4XYQA 3SK8A 2Q2TA 4WJWA 2JXMB 3Q6SA 5M3MB 4KK7A 2K05A 1BNZA 1U4LA 5IODA 4DFAA 4FF4A 5EKIA 1I4PA 3OWEB 5M5XB 1LABA 1XX8A 4JBMA 4CJ2C 1U4PA 1NAPA 3PIOA 1YNJC 1SNQA 1STBA 4V190 4K0KQ 3OHXC 1PH2A 1EY5A 1K8GA 2ID0A 3D6CA 3FDTA 2Q8TA 1OXXK 3GO5A 5BN3A 4RHRA 1HA5A 3HS0C 2EPBA 1ZKOA 1PRTF 1M90C 4HEDA 1BO0A 1EY4A 4JI6Q 3J80i 1AP0A 1YZ6A 1WI5A 2RBMA 4K14A 3TN2A 4A93G 1FNWA 1TS2A 4B3SL 1RODA 2B2WA 4ZQ3A 4JI3L 4AYBB 4NMZA 4B3RQ 5CV7A 3VR4A 2HDMA 1X6OA 1HFGA 2QW7A 1S3OA 3NTKA 1BQQT 3Q8DA 1CKMA 2XVSA 3BZKA 2Q8IB 3STBD 4DV1L 1JOQA 4L5QA 1TXYA 3ERSX 1SMXA 1ONLA 2NVXB 4ME3A 2XWJB 2C5CA 2RKSA 4CJ1B 5IYBH 4PQXA 4IJHA 3CMEA 3S2DB 3DWPA 2GN5A 3S16H 2OCEA 1LACA 3RZOH 1VQFA 2SOBA 2UUAL 3D8GA 2AQ1B 5EKLA 4ODGA 1FNVA 1EU3A 3N52A 4P72A 1S40A 1FD7D 1ASZA 1BUVT 2K03A 2AMCB 3GTQB 4KD4A 1CM9A 4F88A 1CQVA 4N8X1 3M3YH 4O42A 3VR2A 3CQZB 5C4ZA 4LFCL 2CW0D 4ZUJA 4JI8L 5JJIA 3DWAA 4IOAA 3D4DA 5EPJA 1O7YA 1HQMC 2JA8G 4A3KB 4KKUA 3F2DA 4LUVA 5KNBA 2BDNA 3JAME 1WTRA 1KC8C 1PRTB 2NBFA 1A8VA 4K6DA 3I90A 3IFTA 3IL8A 4YCWA 2JEAI 3FVQA 4CKBA 1QOHA 3OIQA 4FVMA 1WTWA 3OYYA 3ER0A 1ET6A 5LMNL 1HHVA 2I0QA 2YV5A 4BY7H 5ISRA 2KOLA 1RL2A 2DY8A 4JI0L 4DR4L 4NPSA 2D0OA 2CQOA 1EQVA 5TSSA 3SR1A 3P20A 3I4NG 3S14B 1N36Q 3BVGA 1Q46A 3EQLC 5C3EB 5GAGC 5EQ0A 2A68C 5IWAL 3PO2H 1Y1WH 1QG7A 3FPPA 3BS1A 3RMHA 4FP5D 2CVRA 3HEJA 5M5YH 1MKHA 4MIUA 1HNXL 5C4XB 3K0XA 3JAML 4GLXA 4A3BB 1YEZA 1YHAA 2E5LL 2VUMH 1TWAB 4JBWA 3OPOA 3OSOA 3F1ZA 2Y0SB 1GUGA 5IGDA 5BR8L 2E2DC 1DOLA 1SYEA 1SLJA 2J0TD 4K5XA 3SGIA 2XRSD 4C3IG 4DR5L 2F52A 5CC4A 1AFPA 4JI7L 1GOZA 1VMCA 4ZAIA 4HSPA 5IGEA 3EA6A 1HJPA 2RHQB 2F3VA 3BDCA 3HOXH 1QUQB 5AJ3Q 3G71A 1CK1A 2LMCB 3KLSA 4RWSC 4C3JH 1SNDA 1SYDA 1B1ZA 1GVPA 1H9SB 1XJVA 5CV6A 1E1OA 4A3MG 3LWUA 1E7ZA 1MBYA 4WFN3 4DV5L 4RGOS 4A93B 3KDFB 3RZDH 3PO3G 1W6KA 1EY7A 1TIID 3GTOH 4Y7NH 2F0EA 1GKHA 2F0QA 5K36H 1QVCA 2R7FA 2KHIA 2B63H 2IWHA 2WINB 1ILPA 1TWFB 5D3IB 3I55A 2BDOA 2BE5C 3QB3A 5JPNC 1JCKB 5IGBA 4GN3B 1XMOQ 5C0XJ 4TSSA 2NVYB 1LT3D 5C5LA 3KFUA 2QDBA 1NMFA 1H9KA 4WORA 1M8AA 2AUJD 3A56A 3UDIA 2UU9Q 3LWEA 2LXJA 1Z47A 3CCJA 4A3JH 1B2TA 3E3XA 1JMCA 1CSQA 4R9WA 3HOYB 4BBSB 5FLXc 2KHSA 2PMZE 4M8AA 4X64L 2XSCA 3RUZA 1K3BC 3MAQA 2AWOA 2K52A 2K5DA 4NB3A 1QCBD 2EQSA 2F0UA 2XWBB 3CC2A 2JA8B 1L1OA 1UE6A 1V1PA 1R9TB 4A3LH 1KL9A 4A3GG 4HMJA 2CHBD 1O78A 4AQYL 5CYUA 5KNCA 5JEAG 4KKSA 4UP7A 1X9NA 1X3QA 1PTOH 1MSHA 3KYHC 4R4CA 2NVQH 1NBWA 4PMCA 5I2XA 1NR2A 1IKLA 3L7ZC 5D3DA 4A3EB 4UP9A 1XWEA 4BY1H 2D5DA 2E2JB 3NEMA 4GNXC 2F0VA 2DN8A 3W5OA 2OTLA 4DV6L 4IPGA 2PQEA 2AKWB 4NXNQ 1FJGL 2XNAC 4XT3B 2EOTA 3I4NB 4NDXA 4A3DG 3NHHA 1Q7YC 5DLQE 1S5DD 4PG3A 4JG2A 3HRZC 1PTOD 1EIGA 1IL8A 3HOZH 2F0OA 5DAUA 1J5EQ 1I94Q 2E74C 1TVXA 5D65A 3HOWH 5KGUA 4DR6Q 4X62Q 1NJIC 5LL6S 1A3VA 4L8JA 2JA6H 5HY6A 1KABA 2NN6I 3DWQA 4B3ML 1EQQA 1EWHA 2BA0A 1NNXA 3AFQA 3KF6A 4U673 3CC4A 1F9SA 1ENFA 1HNWQ 4FXKC 2B2VC 1EY8A 4LF6Q 2XRQD 1YJ9A 4C3IB 4X65Q 4GKJL 1VQDA 1M4VA 1KQSA 3I73A 4UHVA 4KHZA 4PZ6A 4OWXB 4KHVA 2EYMA 3AFPA 3TREA 3BZCA 2RF4A 5EPLA 4I65A 5E4WC 4LF5Q 4ZUIA 5K5PA 3X3NA 4A3FB 3TRZA 1G91A 1I6VC 4KY6A 4CKEA 3BVZA 4A3MB 1STYA 3E9HA 2R93H 1AH9A 1PH9A 1YIJA 3PO3B 1BXTA 4KKTA 4LJZC 5EGTA 3J7A5 1GUOA 2ZM6L 2SNSA 2VW9A 1EY6A 2EE1A 2KVMA 5I2YA 2R92H 1F9QA 2A6HC 3DM3A 3FMCA 4UP8A 3NBHB 1YITA 2RVLA 3OMCA 1MIUA 3GTGB 2EYHA 1QB5D 1TY0A 2O5IC 3NP8A 2K5VA 1PH3A 3HKZE 5EJWA 4OX9Q 3J80c 3J7AF 4OIKA 2PI2A 2PZWA 3S1MB 2AWNA 4IPCA 1OXSC 2E2HH 3M3YB 2VB3X 2YTXA 5ELFA 1JWUD 5M9OA 1SE2A 4KJNA 4MHEA 4ABNA 1I50H 2UUCL 5J39A 5CR3A 2N49A 3FKIG 5FO9B 3J7AV 4R4IA 2L9HA 1W2BA 2MO1A 3I4MH 3H3VC 1B8AA 3S1QH 1VQBA 3GV6A 2JA7G 2DNEA 4CGYB 4LUZA 2MFIA 1EY9A 4A3IH 1IYUA 1LTAD 2CWAA 2B2WC 4LMQD 3I72A 1EL0A 4XTCS 2F0PA 3GD7A 1PXUA 1SROA 4JBKA 4XQQA 1B9NA 3ERQA 1OTCA 1YBYA 4CDEC 1VQPA 4KJOA 3V2TA 3NELA 4DV3Q 1R4QB 1GUTA 5M3FB 1PRTD 1IBLL 4IALA 3K57A 4ZK9B 1Y1WB 1I6HH 2RDGA 2B8GA 1VCIA 4N9PA 4ULLA 1N32Q 3K7UC 1B3AA 1E24A 2VQEL 3NUCA 2R7ZH 4A3DB 1PMRA 5LL6X 3H0GH 5LMUL 2F0JA 1AW7A 1WVLA 4I7AA 1XYIA 3I7FA 4B3RL 3FP9A 1G51A 2IX0A 3JC66 1STAA 1SNOA 4EQ5A 2Q2IA 4L6TB 1TS3A 3R8BA 1K83H 1IBKQ 4DNTB 5C3WA 5CV9A 4KTAA 3BG3A 5ELNA 1OXVA 2K33A 4ZRZA 1EFID 1PZKD 1E0BA 4E6IA 1GUWA 1VDZA 1GM5A 4X3SA 1EEID 4ME5A 3R93A 2QEJC 4NXML 2EYPA 2KCNA 4FXDA 4IUNA 4LF9Q 2NWGA 4HIDA 4JW0A 1TT2A 2F1MA 2ZTEA 2UXDL 4NP5A 4K8JA 4UDUC 2AUKA 4JI1Q 4PV1C 1JJ2A 4OWWB 4X3KA 5EBCA 1GXDC 4H13C 2B2UA 3CCQA 1CKNA 2FMCA 1IW7D 2NN6G 1PH7A 4HAEA 5IP9H 5FJ8G 3C3LA 5GAEC 4RGTA 1TWHB 3RN2A 1PZID 3J81i 3CXCA 1X3PA 1VQ9A 3PIPA 3PQIA 3DMUA 4Y52H 2D62A 1EIFA 3A8KE 1VQHA 3T16A 1XMQL 3K6OA 3LNNA 4G7OC 2L11A 2A5HA 2GVBA 1B44D 1OXUA 1VQGA 3I3CA 3L9AX 4JI2L 1VQ5A 3CPFA 3UDXA 1YNNC 1N36L 2PMZB 4JK1C 4R4TA 3K5LA 3M7GA 5CORA 1IYJB 1XPRA 1K0RA 3OIPA 3VYUA 5T1IA 4HCEA 4G4KA 4PMBA 1VF5C 3CW2C 2RQXA 1X3FA 4HJ7A 1AE2A 2WIIB 2PNHA 2VQFQ 1PYWD 2WAQG 5IYCG 4KHPL 5KNDA 1X65A 3FKIB 2DY7A 3QR8A 1UAPA 1TY2A 4FXGC 5C3EG 2BCOA 4ZKCB 2RHSB 5AFWA 2F0FA 4JVZA 1WJJA 4IFDJ 2JA7B 4C2MB 1NUCA 1HR0Q 4WJ3M 2AQ2B 1A3TA 1KDCA 4DR7Q 2X6LA 1D5XC 4QY7A 1X56A 4X66Q 2EY6A 4PMWA 5C4JH 2N88A 1BCPC 1LTGD 4KV6A 3VYSA 2K5QA 4YHHQ 2N8NA 2Y0SG 2IPKD 2VY3A 1CZWA 3J80E 3CCUA 3F8TA 1SDFA 1QZGA 2NTTA 1D1KA 5IY0A 5CMDA 3H09A 2G9DA 4WRDA 3HZXA 2HHHQ 3TZUA 5C3XA 3TS0A 3GTMH 4XYOA 5BN5A 4IFDH 2SNMA 3HOVH 4QIWE 4DV4L 1U4MA 4JI5L 2I5LX 1L0WA 1SMYD 2IW3A 2QDLA 1V9PA 5I9PA 3GP7A 1ET9A 4DAYA 1DJRD 1WTXA 4LFBL 4CHTB 4RGNA 3V96A 4K2KA 3PF5A 1ZYRD 2BH8A 4IUQA 1E3PA 5G3LF 3Q24A 4APVA 1SE3A 2BOSA 3VA7A 2MO0A 3RLNA 1L1OC 1IBML 3TEHB 4BXXH 1Q8KA 1XMOL 1BR9A 1EZ8A 2CWPA 2ICEC 4GKKL 5A2QE 1N34Q 3S9WA 1GUSA 1Q90A 3J80L 3P7JA 3LGJA 3NBIA 4LF4L 5IP7H 1IZ6A 4DXGA 3OTOL 4H0LC 3M4QA 1BBWA 4GN5A 5KIXA 4N9TA 1PFSA 3VYTA 4Q0FA 1MGSA 3MXNA 1D6EC 1O7ZA 1XPUA 2IY5B 3D4RA 2VS1A 1BBUA 3KOJA 4IJLA 1PHJA 1G6ZA 1E2WA 1TKWB 1GUNA 2Z9HA 1CA5A 1WOCA 3FRPB 1QZHA 5EPKA 4LFAL 3GDEA 3EBEA 4R4QA 3HOYG 2QEXA 4BBSG 5C44B 3NENA 3K5MA 2OXPA 2O5JC 1V1OA 4DR1Q 3L0OA 1UWVA 3W1BA 1CA6A 1TWCH 3S1NH 2QA4A 3T1YQ 1MJCA 5NUCA 3STBC 3Q0AA 1JT8A 1WD1A 2HD3A 3RLOA 4RKBA 1FL0A 2XGTA 3CCVA 4ZKBB 1F77A 1QWYA 2YYZA 4DR3Q 2UUBQ 3GTJB 2Z4IA 5CV8A 4YY3Q 3OW7A 2B2YA 3K0YA 2PI2E 1SNMA 2PCFB 5JEAJ 5C4HA 1HTPA 4FNFA 1ENAA 2FJ2A 4A3EG 2JA5H 1JORA 4DUZL 2K01A 3C46A 2KCTA 5IGFA 1VQ7A 4BBRH 2CW0C 2FMMA 2KJXA 4K5VA 4P71A 3D4WA 1B53A 4DF7A 1WFQA 1AEXA 3P75A 3GTKH 2WAQB 1YHBA 3A74A 3SK5A 5FLMG 3K7AB 3MC0B 5EKKA 1DGSA 4HTHA 3NWTA 3D31A 3M4PA 2WACA 2EJGC 2NVTB 3VR5A 1S5CD 4JV5Q 1LT4D 3HOUB 1U4RA 4DAMA 1UE7A 3CD6A 1B70B 2NYZD 3S1RH 5GROA 2PQAA 3NXWA 1GO3E 1HCZA 1Y69U 2EYJA 4DR2L 4RCOA 2F0IA 3DHQA 4K6LA 5DEHA 4GOPA 1BCPF 1MD2D 4NW2A 1YJWA 3S2HH 3S17B 4ZCKA 4UPAA 2XN9C 4HJ9A 3QOLA 2IL8A 2EYLA 5FOBB 4IOCA 2ENBA 1WYDA 4YWKA 1B7YB 5FKAC 4LF8Q 4FF2A 4GZYC 4HIOA 3A5UA 1LTID 3T56B 4EGVA 4N8FA 4P74A 1KRTA 4KMUC 3KLWA 4K5WA 4A3FG 3E0EA 3QJYA 2EZVA 3S15B 2JSOA 2JN4A 2EYOA 4YWLA 2B2TA 3KDFA 2OTJA 2JQOA 3ONAB 4DV0Q 3W1GA 2PO4A 3M4OB 4IUPA 4MN3A 1DZ1A 3FHWA 3H6MA 2A73B 4DV2L 3HP3A 1Z7TA 4OX9L 1S5ED 1JJGA 5FO7B 5IYBG 4HJAA 1BOSA 1CKOA 1UEAB 1E2VA 1I3QH 2I46A 1A15A 2LY7A 1C7YA 1YJNA 1Q86C 1VQLA 5FK9C 1ICWA 3MHBA 2LSSA 5CGKA 4B3TQ 4A3CH 3OWFA 5DM73 2ZXPA 4R4OA 4DV7L 2E2IH 3GTLB 3A54A 1N33Q 1YVCA 3VDYA 1KHIA 2WB1E 1HNZL 1VQOA 2YTYA 1LTTD 1A62A 2HCCA 3BDOA 4J8QA 2ES2A 1UE5A 1CUKA 3D0FA 3CF5A 2F0NA 1KNEA 4XIGS 1EYCA 4DN4M 1NTGA 3K5NA 4P73A 1PYSB 1SXTA 4JI3Q 1Q8IA 1PA6A 4M1UB 1DOKA 4DAVA 2MJ8A 2K4KA 1KLUD 2UXCL 3L2PA 5M5WH 5C0XH 1PFNA 5JOBA 2IX1A 2CH4W 1ENCA 4LW1A 1JC7A 4DV1Q 5IYDG 4IPDA 1ZEQX 1B3QA 4C1NI 1TR5A 4C3HB 3A8JE 4C1NK 2YU9H 5JJZA 1RD9D 1I5FA 1SFOH 1VQ6A 2SEBD 4BY7G 4H44C 4KN7C 4MTKA 3KJPA 2ZTCA 2F4VL 2UUAQ 4L5RC 3E9IA 4I7ZC 4IO9A 1JWMD 3J81c 3G48A 4QCLA 5M3FG 2LFNA 3PO2G 4QJFA 1Y1WG 1TWGH 4AH6A 1V1PB 2B3GA 4BA2I 1FGBD 1JOOA 2JP1A 4JI8Q 1EQRA 1RJTA 3H3VI 3J81j 2N78A 5KEEA 1Y1VH 4RHSA 2B2UC 1TQOA 1HA6A 1WCMH 4RGMA 1VS0A 1IBKL 2K50A 3CCEA 3GTPB 4HCSA 3I56A 4RG1A 1PYBA 3NTHA 1GJXA 4X6AH 1VQKA 3EFXD 5KYLA 4OO1H 1MHWC 2UXBL 1D2BA 1JR0D 5M3MH 1YI2A 1HUNA 5LMNQ 1VQ4A 3CCLA 4LF9L 5M5XH 1RIPA 4G7ZC 3K59A 4FDBA 4JI0Q 3A8IE 1SBBB 5CV4A 1UNSA 5LMNW 4DR4Q 2BA1A 4BWGB 2KEDA 1A63A 4DUYL 3CHBD 3TQYA 1PTOC 2AHOB 2KA7A 4C3JG 1I4QA 1F9PA 4QF4A 4X3TA 5IWAQ 1T5XD 1C8CA 2HIXA 3PSIA 1TS4A 1P8LA 1J9OA 4GLVB 4QUCA 1X3GA 3DEOA 3MEFA 3GQBA 1HNXQ 3KF6B 4H02A 1LYLA 5GQOA 3R2IA 4JYAL 5K36G 2NZOA 1IYVA 4AYBE 4XDXA 2B63G 3SEBA 4CDCC 1JE4A 1DXMA 4Z9CB 2HQLA 1KAWA 5BR8Q 2JEBI 3X3MA 4DR5Q 3I8ZA 5JVH3 3NBHA 1CTMA 3TBIB 2NVXH 1FGUA 1C0AA 3S16B 2HCIA 2WFWA 4YWMA 2WV6D 3S2DH 5COYA 3RZOB 1J8IA 4XXEA 4A3JG 4BS9A 2F3IA 3MFGA 2F0LA 3A7AB 1D7QA 3ND9A 2B39A 4A4IA 2X69A 1Y8OB 1HTLD 1JJCB 1V1QA 2MUYA 2EYFA 2H5XA 2B8FA 5J3BA 5FJ8H 4DNIA 3GTQH 3TZDA 4A76A 1EOVA 2IHEA 3CQZH 4DV5Q 3NTIA 3QO2A 1XNQL 5DM63 1EYGA 4A3LG 4IQZA 5IE8A 1A2UA 1Q1EA 3T1HL 4A3KH 4DK6C 4X66L 3KBGA 2KENA 3C1FA 5CBEE 1EU4A 3BU2A 3F2UA 1R4PB 3BVMA 4YHHL 2F0WA 3UDFA 2A69D 3IFDA 2QF7A 2OWOA 1B4OA 1F2LA 3RR5A 2NTSA 4BY1G 2FFKB 2R7DA 4F7XA 4DNRB 2KEEA 1SYCA 1Q3LA 1A0IA 4BY7B 1X32A 1X3EA 2CKZB 1XTDA 4KN4C 5JAVA 4ZYSA 1L2FA 4DGZA 4K8IA 2M2LA 3WDNA 4K0KL 3GTKB 2RSOA 3NE5B 5LHY1 4XT1B 2EXDA 1C9OA 4FYDA 3S14H 1M1KC 3AB9A 3PO2B 4X64Q 3HOZG 1XNRQ 5C3EH 3RN5A 3NQIA 3MTSA 5M5YB 4JI6L 3HOWG 4LWCA 1SRUA 5G3LD 1QNKA 4MTNA 2KECA 1GHJA 3W2DA 2F03A 2JA6G 2HQEA 2A6ED 4G57A 1TU2B 5C4XH 1KD1C 1NY4A 5I6WA 1VQIA 2VUMB 4A3BH 4L63B 4AQYQ 1QILA 1TWAH 1VQMA 3PUZA 1KDAA 1OO9B 5IIFA 1A3UA 2F0HA 2EDGA 3EJIA 5A35A 3KK7A 1PRTC 4O1NA 4YIJA 5E4XA 5BN4A 2ZJPA 1J6QA 4EQOA 4DV6Q 1WTHA 5IT9E 2C35B 3U50C 3J81E 1FJGQ 3SVMA 1H9JA 2B2YC 2PYKA 1YNXA 3HOXB 3H15A 1RCVD 1S5FD 4G7HC 4OIJA 3A55A 1EFWA 4C3JB 1PFBA 1C4QA 1Q81C 2NZ1D 2Z6KA 1PTOF 5J22A 4JOIA 2R93G 4CJ0B 1KAAA 1CZGA 1LLRD 3RZDB 4JI4Q 4DK3C 4FO2A 4JPBW 4R8IA 1DCZA 4A93H 3KF8B 2M00A 5HURA 3D3RA 3GTOB 2WP8J 5C44G 4Y7NB 1STGA 4B3MQ 1DD2A 2EY1A 1L0XB 2B63B 4ALPA 3AU7A 1K8AC 1I4GA 2R92G 4GNXB 1SNCA 4J6HA 3TDQA 3FPUB 3PF4A 1TWFH 1DM0B 2I5MX 3CMAA 2ZJQA 4GKJQ 4EQNA 3HKZG 1WTOA 3PGZA 3TP7A 2EIFA 3K80C 2NVYH 2WB1B 2GVAA 3WOEA 1H9MA 3J81L 3MZ5A 3ZJYC 4GOPC 3MWYW 1CKNB 2L15A 4A3JB 1EYDA 2L55A 2CFMA 2MGSA 1IW7C 3HOYH 4BBSH 1P16A 2OF1A 1STNA 3VA5A 1KXLA 1BVSA 1G291 4KY5A 2MQHA 3UE0A 1LO5D 2K5HA 5JJLA 2ZXRA 4DK1A 2HIVA 4RA8A 4OL7A 1RHPA 3MXPA 3UDGA 2ZM6Q 1AZPA 2JA8H 4A3IG 3F2BA 1R9TH 1D5MC 3HGBA 1EIHA 1GD7A 3SXHA 2RCFA 1EYAA 1O7LA 3HOUG 1QVFA 1PTOB 1DONA 1II3A 1SN8A 2Z8LA 2NVQB 2I5HA 4IZ8A 3M9BA 2HUGA 2JJQA 3V05A 4PZ8A 2A19A 4BY1B 1NCVA 4EQPA 3G6EA 5I6YA 4A3EH 4TVAB 1CSPA 2E2JH 3AQQA 1EWIA 2EVBA 1YNJD 3PCOB 1I4XA 4K2LA 1E22A 3EROA 2UUCQ 3I4NH 3H0GG 1NMGA 2Q8RE 5AJ3L 4HIKA 3CKIB 4GN4B 2MP1A 1SR3A 4HIMA 3HOZB 4PZ7A 1EZ6A 2LKVA 3EVQA 3C1EA 2EJFC 5I4DA 1DYQA 3HOWB 2LXKA 4DV0L 3CU7A 1IKMA 2L4NA 3MXGA 2JA6B 4CKCA 5IOCA 1G2TA 3A5ZB 2MNAA 2DNCA 2Q2HA 4P75A 2P5ZX 2VL6A 2MHVA 3UE1A 5HGTA 2LS01 2NZHA 1ML0D 4C3IH 5CBAE 2Z1CA 4HJ5A 4B3TL 1E1TA 3VYRA 4CDDC 1RKNA 1N33L 1IBLQ 5JJKA 4RKLA 3BYYB 4DAYB 3CPWA 3Q22A 1S72A 1SMYC 2OQ0A 3U4ZA 2FXQA 2N3SA 4ID6A 5FO8B 4ILWA 3DUZA 2VQEQ 1KIXA 4DAPA 2UU9L 2FINB 3S24A 1QNUA 3G6JB 5LMUQ 2KUMA 5J1ZA 5IP9G 4DA2A 1SNPA 4A3FH 1ZYRC 1HZAA 3MA2B 2R93B 1K8MA 1X54A 2ICIA 4A3MH 4EVOA 2A1AA 3SE0A 5ELOA 4DK0A 2GA4B 1RTOA 2TMPA 3PO3H 4LF7Q 3NK9A 1CI3M 2QGQA 2ZXOA 1XTCD 2R92B 1LTSD 2F0DA 1QJOA 2DUDA 4LNQA 1D5ZC 1PFMA 3PIP3 1NE3A 5EBDA 3A7LA 3MXNB 3GTGH 5A2QL 1C48A 3HKZB 1EIYB 4NXMQ 1LT5D 3U4VA 4C3HG 3AMUA 2F0SA 2IX3A 2E2HB 1SE4A 5KYIA 3S1MH 2UXDQ 4HN7A 4XQNA 3NWSA 1Z9FA 4NXNL 2J4XA 4JC0A 1XXGA 5C6AA 1I50B 3IAYA 2PZTA 3WWVA 1T9HA 1VQCA 3QOJA 1PVOA 4L5SA 1MI2A 3H91A 2QILA 3I4MB 4P2CB 3S1QB 3N6RA 3R2TA 4DPGA 2KQ3A 1KTKA 1QE6A 1J5EL 1I94L 3PUYA 2A68D 4DR6L 5ELEA 1K28A 4X62L 3PUWA 4A3IB 1XMQQ 4FF3A 1D1IA 4QUFA 5IYDH 1KLGD 1PH6A 1S5BD 1E2ZA 4OONA 4A3GH 5H1SE 1Q82C 4KD3A 1SYGA 2VXWA 2K6AA 5JEAH 2ZTDA 4JI2Q 1T5EA 1HNWL 1HFNA 2M9VA 1ILQA 2RSNA 4LF6L 1BBXC 1BDOA 4X65L 2IT1A 1PH5A 1HH2P 5ELBA 3I2ZA 3JAMi 3C2PA 4IFDG 1FNUA 3CC7A 1XPOA 1HUMA 2PZUA 3HOVG 1I6HB 4H7BA 5M3FH 1FVIA 1HQRD 3DM1A 2E75C 3I91A 2R7ZB 1H95A 3H0GB 4KHPQ 4A3DH 4LF5L 3DXJC 3NPPA 1AN8A 1CFMA 1EWCA 2AQ3B 2SDFA 4LAAA 2PQAB 3PIO3 1EUJA 1QUQA 4HMIA 2G9HD 1AZQA 3DEPA 1K83B 2JYOA 1H9SA 4U68A 1L0YB 4GOPB 4BXXG 1AE3A 1GHKA 1X55A 5ELDA 1K3RA 2QCPX 3T53B 3SK4A 4Q5VA 3FEWX 1KDBA 3I70A 4QMGA 5C0XI 1JWSD 5IP7G 1D8LA 1B50A 2F0TA 4FF1A 3Q23A 2DGYA 4BA1I 1W3SA 3E0JA 2BE5D 4O0AA 1F2YA 3NSWA 1CHQD 1A2TA 3TP5A 3EN2A 3BZDB 2R6GA 4DV4Q 4UY8C 2YTVA 4JI5Q 1K9MC 1N8RC 4R8NA 1Z6HA 4OELB 3PV0A 2HT1A 1FR3A 3HFZB 4LFBQ 1WTQA 2B29A 1SYFA 2L0CA 4IURA 1LTLA 4X3UA 1TWHH 1B9MA 1BF4A 1SE8A 2NB0A 4CBVA 1BCPB 3HG9A 1VQJA 1IBMQ 3VR3A 4B3SQ 3IRBA 4GKKQ 1HPCA 3OOCA 5DNFA 3PUXA 2A74C 1Y14B 1HXYD 5E3FA 3BJUA 1VQNA 4OO1I 2WKDA 3CCRA 3NQTA 2JE6I 4LF4Q 2K32A 3AEVA 3OTOQ 1SSOA 2HDLA 4OHJA 1STHA 2JA5G 1EY0A 4J1MA 1JICA 1V43A 4DV3L 1SAPA 2PW5A 4BBRG 1XNRL 2XTIA 1N32L 5IT9c 1RDPD 4LFAQ 1Y8NB 5IGCA 2E8GA 2OQKA 1HZ9A 3T4AC 2ZJRA 4L5TA 3FKIH 3K81C 4TRDA 1L1OB 2Z6KC 3QWNA 1MSGA 4LFCQ 4JOIC 3RNUA 2JK8A 2JA7H 4C2MH 2CH4A 1K0SA 3OMGA 4LUOA 4DXFA 3ICEA 5C4JB 2VUMG 4RMFA 4PNYA 2O2LD 1F2MA 1LTBD 2D0PA 4HR7B 4C56C 1ASYA 4JCVE 4DU9A 4QGUA 1I4HA 1OXTA 3RLFA 4IN3A 1ICFB 2DJFC 2ZT9C 1PH4A 4POGA 3GTMB 4ZLTF 1VF7A 4GS3A 4DUZQ 4QIWB 3HOVB 1DOMA 3M7NA 3UI2A 3GV3A 4JI1L 3F2CA 4QQBX 3HOXG 1O7IA 2RDFA 1EEFD 5E1FA 4JI4L 2K28A 3R3OA 3EIVA 3KLRA 4LK1C 2K7VA 2K5NA 2VZAA 1HZBA 2Z0SA 2J7ZA 2I07B 1CHPD 3E6ZX 2PPBC 3D6WA 5T1GA 4IUUA 4IPHA 5F2DA 1JOKA 3ULJA 5HGQA 5ELCA 3U58A 3T13A 1NSNS 1BKBA 3BDLA 1SJED 1UE1A 1I4RA 2BH2A 3LX0A 4DR2Q 1QVGA 2E5LQ 1FYCA 4RAUC 4DKAC 1G2SA 1Q12A 2A6HD 2F0MA 2VB2X 1W6JA 1PH1A 1F2ZA 4MZ9A 4A3CG 3H3VH 4JI7Q 1RF2D 1CQFA 4XQJA 3WOFA 3P1HA 1JB3A 2WB1G 1LM0A 1KNAA 3URYA 3SK6A 1JB7A 1IL2A 2K04A 2K1BA 1MJEA 1S4ZA 2EY2A 2VQFL 4A75A 3I4LA 1VMPA 2N55A 2WKCA
chains in the Genus database with same CATH topology
2NN6H 1UUPA 2EJMA 2EXZA 1TWCB 5C5MA 3S1NB 5C0XG 4B9WA 3ZYYX 2L12A 3PUVA 4OGQC 4IUVA 2OT2A 1WTPA 2E76C 1TS5A 4TQUS 1A6XA 4KY7A 5D14A 3PMFA 2F0GA 5JVG3 2JA5B 2EY5A 4F87A 1SYBA 3TSSA 4BBRB 1H9RA 2F3WA 5JPMC 2H4OA 3ND8A 2RA4A 4HSVA 2R3ZA 1WTVA 1LT6D 4A3GB 2V4DA 2KCCA 4OO1G 2A69C 3S1RB 1CT1D 1IHZA 3CRKC 1EOTA 3MXUA 2L1BA 3VR6A 3S2HB 2CQAA 5I9OA 2XIWA 1HRJA 5FLXE 2F0KA 4NKLA 3IKJA 1F9RA 4KI0A 2K5WA 4QB4A 2QKIC 3TP8A 2O4XA 3CRLC 1SJHD 3M4YA 1NR4A 1EQTA 1RTNA 2A6EC 4B9XA 4S3SA 4IUTA 1STEA 2NUCA 2H1EA 3KLSX 2OEOA 3ITPA 3TMEA 3W3AA 4B08A 3KF8A 2FHTA 1I3QB 3MFYA 2D9UA 5FLXL 1ZXTA 3RD4A 2E2IB 1PLFA 5IT9L 1ESFA 3E5SA 3J7YW 1LTRD 1YNND 3K58A 3K5OA 3SHLA 3M85A 1JQYD 2PW7A 3T51B 1SEBD 2RDHA 4UAIA 5KRUA 3KUPA 4IFDI 3H94A 2L5TA 5M5WB 4TKOB 3U9OA 5CV5A 2B2VA 3KBXA 1ESRA 3QG1A 1WD0A 3G7LA 1LV9A 2YU9B 2F4IA 1SFOB 1O80A 2R61A 3O13A 1Q1BA 1G8ZD 2B2TC 4RCNA 1BCPD 1U9RA 1V8QA 3L3OC 4V0BA 3MEHA 1Y8PB 4RFBA 3BYTB 1TWGB 3TP6A 2D2CC 2VNUD 2Z4HA 3U9SA 4F8MA 3QIAA 1K8OA 3SDZA 4RH6A 5IGGA 1Y1VB 3MVVA 1WCMB 2TSSA 2X6GA 1PDQA 2IJ0A 2C9OA 2MPMA 1PZJD 2PNRC 4XYQA 3SK8A 4WJWA 2JXMB 3Q6SA 5M3MB 4KK7A 2K05A 1BNZA 1U4LA 5IODA 4DFAA 4FF4A 5EKIA 1I4PA 3OWEB 5M5XB 1LABA 1XX8A 4CJ2C 1U4PA 1NAPA 1YNJC 1SNQA 1STBA 4V190 3OHXC 1EY5A 2ID0A 3D6CA 2Q8TA 3FDTA 1OXXK 3GO5A 5BN3A 4RHRA 1HA5A 3HS0C 2EPBA 1ZKOA 1PRTF 4HEDA 1BO0A 1EY4A 1AP0A 3TN2A 4K14A 2RBMA 1FNWA 1TS2A 1RODA 2B2WA 4ZQ3A 4AYBB 4NMZA 5CV7A 3VR4A 2HDMA 1HFGA 3NTKA 1BQQT 2XVSA 2Q8IB 1JOQA 1ONLA 2NVXB 2XWJB 2C5CA 2RKSA 4CJ1B 4PQXA 3S2DB 3DWPA 1LACA 2SOBA 3D8GA 2AQ1B 5EKLA 4ODGA 1FNVA 1EU3A 3N52A 1FD7D 1BUVT 2K03A 3GTQB 4KD4A 1CM9A 4F88A 1CQVA 4O42A 3VR2A 3CQZB 5C4ZA 2CW0D 4ZUJA 3DWAA 3D4DA 5EPJA 1O7YA 1HQMC 4A3KB 4KKUA 5KNBA 2BDNA 3JAME 1WTRA 1PRTB 2NBFA 4K6DA 3I90A 3IFTA 3IL8A 2JEAI 3FVQA 4CKBA 1QOHA 3OIQA 4FVMA 1WTWA 1ET6A 1HHVA 5ISRA 2KOLA 2DY8A 1EQVA 5TSSA 3SR1A 3P20A 3S14B 3BVGA 3EQLC 5C3EB 5EQ0A 2A68C 1QG7A 3FPPA 3BS1A 3RMHA 4FP5D 2CVRA 3HEJA 4MIUA 5C4XB 3JAML 4A3BB 1TWAB 4JBWA 3OPOA 3OSOA 2Y0SB 1GUGA 5IGDA 2WKCA 2E2DC 1DOLA 1SYEA 2J0TD 4K5XA 2XRSD 4C3IG 5CC4A 1AFPA 1GOZA 1VMCA 4ZAIA 4HSPA 5IGEA 3EA6A 2F3VA 3BDCA 1CK1A 2LMCB 3KLSA 4RWSC 1SNDA 1SYDA 1B1ZA 1H9SB 5CV6A 3LWUA 1MBYA 4WFN3 4RGOS 4A93B 1W6KA 1EY7A 1TIID 2F0EA 2F0QA 5K36H 2IWHA 2WINB 1ILPA 1TWFB 5D3IB 2BDOA 2BE5C 3QB3A 5JPNC 1JCKB 5IGBA 5C0XJ 4TSSA 2NVYB 1LT3D 5C5LA 2QDBA 1H9KA 4WORA 1M8AA 2AUJD 3A56A 3LWEA 1Z47A 1B2TA 4R9WA 3HOYB 4BBSB 2KHSA 4M8AA 2XSCA 3RUZA 3MAQA 2AWOA 2K5DA 1QCBD 2F0UA 2XWBB 2JA8B 1V1PA 1R9TB 4HMJA 2CHBD 1O78A 5CYUA 5KNCA 5JEAG 4KKSA 1X3QA 1PTOH 1MSHA 4PMCA 5I2XA 1NR2A 1IKLA 3L7ZC 5D3DA 4A3EB 1XWEA 2D5DA 2E2JB 2F0VA 2DN8A 2PQEA 2XNAC 4XT3B 2EOTA 3I4NB 4NDXA 3NHHA 1S5DD 3HRZC 1PTOD 1EIGA 1IL8A 2F0OA 5DAUA 2E74C 1TVXA 5D65A 5KGUA 5LL6S 1A3VA 4L8JA 1KABA 2NN6I 3DWQA 1EWHA 2BA0A 4U673 1F9SA 1ENFA 4FXKC 2B2VC 1EY8A 2XRQD 4C3IB 1M4VA 3I73A 4KHZA 4KHVA 2EYMA 5EPLA 4I65A 5E4WC 4ZUIA 5K5PA 3X3NA 4A3FB 1G91A 1I6VC 4KY6A 4CKEA 3BVZA 4A3MB 1STYA 3PO3B 1BXTA 4KKTA 4LJZC 5EGTA 1GUOA 2SNSA 1EY6A 2EE1A 2KVMA 5I2YA 1F9QA 2A6HC 3FMCA 2RVLA 3OMCA 3GTGB 2EYHA 1QB5D 1TY0A 2O5IC 3NP8A 5EJWA 3J7AF 4OIKA 2PZWA 3S1MB 2AWNA 1OXSC 3M3YB 2VB3X 5ELFA 1JWUD 5M9OA 1SE2A 4KJNA 4MHEA 4ABNA 5J39A 5CR3A 5FO9B 3J7AV 2L9HA 3H3VC 3GV6A 2DNEA 4CGYB 1EY9A 1IYUA 1LTAD 2B2WC 4LMQD 3I72A 1EL0A 4XTCS 2F0PA 3GD7A 1PXUA 4XQQA 1B9NA 3ERQA 4KJOA 3V2TA 1R4QB 1GUTA 5M3FB 1PRTD 4IALA 3K57A 4ZK9B 1Y1WB 2RDGA 2B8GA 1VCIA 4N9PA 4ULLA 1B3AA 3NUCA 4A3DB 1PMRA 5LL6X 2F0JA 1AW7A 1WVLA 1XYIA 2IX0A 1STAA 1SNOA 4L6TB 1TS3A 3R8BA 4DNTB 5C3WA 5CV9A 4KTAA 3BG3A 1OXVA 2K33A 4ZRZA 1EFID 1PZKD 1E0BA 4E6IA 1GUWA 1VDZA 4X3SA 1EEID 4ME5A 3R93A 2QEJC 2EYPA 2KCNA 4FXDA 4IUNA 2NWGA 1TT2A 2F1MA 4NP5A 4K8JA 4UDUC 2AUKA 4PV1C 4X3KA 5EBCA 1GXDC 4H13C 2B2UA 2FMCA 1IW7D 2NN6G 4HAEA 3C3LA 4RGTA 1TWHB 1PZID 1X3PA 3DMUA 2D62A 3A8KE 3T16A 3K6OA 3LNNA 4G7OC 2L11A 2A5HA 1B44D 1OXUA 3I3CA 3L9AX 1YNNC 2PMZB 4JK1C 3K5LA 3M7GA 5CORA 3OIPA 3VYUA 5T1IA 4HCEA 4G4KA 4PMBA 1VF5C 2RQXA 2WIIB 1PYWD 5KNDA 3FKIB 2DY7A 1UAPA 1TY2A 4FXGC 2BCOA 4ZKCB 5AFWA 2F0FA 4IFDJ 2JA7B 4C2MB 1NUCA 2AQ2B 1A3TA 1KDCA 2X6LA 1D5XC 2EY6A 4PMWA 2N88A 1BCPC 1LTGD 4KV6A 3VYSA 2K5QA 2IPKD 1CZWA 3J80E 1SDFA 2NTTA 1D1KA 5CMDA 3H09A 2G9DA 4WRDA 3HZXA 3TZUA 5C3XA 4XYOA 5BN5A 4IFDH 2SNMA 1U4MA 1SMYD 2IW3A 5I9PA 1ET9A 3GP7A 4DAYA 1DJRD 1WTXA 4CHTB 4RGNA 3V96A 4K2KA 1ZYRD 4IUQA 5G3LF 3Q24A 1SE3A 2BOSA 3VA7A 1BR9A 1EZ8A 2ICEC 5A2QE 3S9WA 1GUSA 1Q90A 3J80L 3P7JA 3NBIA 4DXGA 4H0LC 5KIXA 4N9TA 3VYTA 4Q0FA 1MGSA 3MXNA 1D6EC 1O7ZA 3D4RA 1G6ZA 1E2WA 1TKWB 1GUNA 1CA5A 3FRPB 5EPKA 5C44B 3K5MA 2OXPA 2O5JC 1V1OA 1CA6A 5NUCA 3Q0AA 1WD1A 4RKBA 4ZKBB 1F77A 1QWYA 2YYZA 3GTJB 2Z4IA 5CV8A 3OW7A 2B2YA 3K0YA 1SNMA 2PCFB 5JEAJ 5C4HA 1HTPA 4FNFA 1ENAA 2FJ2A 1JORA 2K01A 3C46A 5IGFA 2CW0C 2FMMA 2KJXA 4K5VA 3D4WA 1B53A 4DF7A 1AEXA 3P75A 2WAQB 3SK5A 3K7AB 3MC0B 5EKKA 4HTHA 3NWTA 3D31A 2WACA 2EJGC 2NVTB 3VR5A 1S5CD 1LT4D 3HOUB 1U4RA 2NYZD 3NXWA 1HCZA 1Y69U 2EYJA 4RCOA 2F0IA 3DHQA 4K6LA 5DEHA 1BCPF 1MD2D 4NW2A 3S17B 2XN9C 3QOLA 2IL8A 2EYLA 5FOBB 2ENBA 5FKAC 4FF2A 4GZYC 1LTID 3T56B 4EGVA 4KMUC 4K5WA 3QJYA 2EZVA 3S15B 2JSOA 2EYOA 2B2TA 3ONAB 2PO4A 3M4OB 4IUPA 4MN3A 1DZ1A 3H6MA 2A73B 3HP3A 1Z7TA 1S5ED 5FO7B 1BOSA 1UEAB 1E2VA 2I46A 1A15A 2LY7A 5FK9C 1ICWA 3MHBA 5CGKA 3OWFA 5DM73 2ZXPA 3GTLB 3A54A 1LTTD 2HCCA 3BDOA 4J8QA 2F0NA 1KNEA 4XIGS 1EYCA 4DN4M 3K5NA 1SXTA 1Q8IA 4M1UB 1DOKA 4DAVA 2MJ8A 1KLUD 5C0XH 1PFNA 5JOBA 2IX1A 1ENCA 1JC7A 1ZEQX 4C1NI 1TR5A 4C3HB 3A8JE 4C1NK 5JJZA 1RD9D 2SEBD 4H44C 4KN7C 4I7ZC 1JWMD 4QCLA 2LFNA 1V1PB 4BA2I 1FGBD 1JOOA 2JP1A 1RJTA 5KEEA 4RHSA 2B2UC 1TQOA 1HA6A 4RGMA 3GTPB 4HCSA 3NTHA 1GJXA 3EFXD 5KYLA 4OO1H 1D2BA 1JR0D 1HUNA 4G7ZC 3K59A 3A8IE 1SBBB 5CV4A 1UNSA 2BA1A 4BWGB 2KEDA 3CHBD 1PTOC 2KA7A 4C3JG 1I4QA 1F9PA 4QF4A 4X3TA 1T5XD 1C8CA 1TS4A 1J9OA 4QUCA 3DEOA 3GQBA 3R2IA 5K36G 1IYVA 4XDXA 3SEBA 1JE4A 1DXMA 4Z9CB 2JEBI 3X3MA 3I8ZA 5JVH3 3NBHA 1CTMA 3TBIB 3S16B 2HCIA 2WV6D 5COYA 3RZOB 1J8IA 4XXEA 4BS9A 3MFGA 2F0LA 3A7AB 3ND9A 2B39A 2X69A 1Y8OB 1HTLD 2MUYA 2EYFA 2B8FA 3TZDA 3NTIA 3QO2A 5DM63 4IQZA 1A2UA 1Q1EA 3KBGA 3C1FA 5CBEE 1EU4A 3F2UA 1R4PB 3BVMA 2F0WA 2A69D 3IFDA 2QF7A 1B4OA 1F2LA 2NTSA 2FFKB 4F7XA 4DNRB 2KEEA 1SYCA 1Q3LA 4BY7B 1X32A 4KN4C 5JAVA 4ZYSA 4DGZA 4K8IA 2M2LA 3WDNA 3GTKB 2RSOA 3NE5B 5LHY1 4XT1B 4FYDA 3AB9A 3PO2B 3NQIA 3MTSA 5M5YB 5G3LD 1QNKA 2KECA 1GHJA 3W2DA 2F03A 2HQEA 2A6ED 4G57A 1TU2B 5I6WA 2VUMB 4L63B 1QILA 3PUZA 1KDAA 1OO9B 1A3UA 2F0HA 2EDGA 3EJIA 5A35A 3KK7A 1PRTC 4O1NA 4YIJA 5E4XA 5BN4A 4EQOA 5IT9E 3J81E 3SVMA 1H9JA 2B2YC 2PYKA 3HOXB 1RCVD 1S5FD 4G7HC 4OIJA 3A55A 4C3JB 1PFBA 1C4QA 2NZ1D 1PTOF 5J22A 4CJ0B 1KAAA 1CZGA 1LLRD 3RZDB 4FO2A 4R8IA 1DCZA 2M00A 5HURA 3D3RA 3GTOB 2WP8J 4Y7NB 1STGA 1DD2A 2EY1A 1L0XB 2B63B 3AU7A 1I4GA 1SNCA 4J6HA 3TDQA 3FPUB 1DM0B 4EQNA 1WTOA 3TP7A 2WB1B 3WOEA 1H9MA 3J81L 3MZ5A 3MWYW 4A3JB 1EYDA 2L55A 2MGSA 1IW7C 2OF1A 1STNA 3VA5A 1G291 4KY5A 1LO5D 2ZXRA 4DK1A 4RA8A 4OL7A 1RHPA 3MXPA 1AZPA 1D5MC 3HGBA 1EIHA 3SXHA 1EYAA 1O7LA 1PTOB 1DONA 1II3A 2Z8LA 2NVQB 4IZ8A 2HUGA 3V05A 4BY1B 1NCVA 4EQPA 5I6YA 2EVBA 1YNJD 1I4XA 4K2LA 3EROA 2Q8RE 3CKIB 2MP1A 3HOZB 1EZ6A 2LKVA 3EVQA 3C1EA 2EJFC 5I4DA 1DYQA 3HOWB 3CU7A 1IKMA 2L4NA 3MXGA 2JA6B 4CKCA 5IOCA 1G2TA 2DNCA 2MHVA 5HGTA 2LS01 1ML0D 5CBAE 2Z1CA 3VYRA 1RKNA 4RKLA 3BYYB 3Q22A 1SMYC 4ID6A 5FO8B 4ILWA 3DUZA 4DAPA 2FINB 1QNUA 3G6JB 2KUMA 5J1ZA 4DA2A 1SNPA 1ZYRC 3MA2B 2R93B 1K8MA 2ICIA 4EVOA 3SE0A 4DK0A 2GA4B 1RTOA 2TMPA 3NK9A 1CI3M 2ZXOA 1XTCD 2R92B 1LTSD 2F0DA 1QJOA 1D5ZC 1PFMA 3PIP3 5EBDA 3A7LA 5A2QL 1C48A 3HKZB 1LT5D 4C3HG 3AMUA 2F0SA 2IX3A 2E2HB 1SE4A 5KYIA 4HN7A 4XQNA 3NWSA 2J4XA 1XXGA 5C6AA 1I50B 3IAYA 2PZTA 3QOJA 1MI2A 3H91A 2QILA 3I4MB 4P2CB 3S1QB 3N6RA 3R2TA 2KQ3A 1KTKA 1QE6A 3PUYA 2A68D 5ELEA 3PUWA 4A3IB 4FF3A 1D1IA 4QUFA 1KLGD 1S5BD 1E2ZA 4KD3A 1SYGA 2VXWA 2K6AA 5JEAH 1T5EA 1HFNA 2M9VA 1ILQA 2RSNA 1BBXC 1BDOA 2IT1A 5ELBA 3C2PA 4IFDG 1FNUA 1I6HB 1HUMA 2PZUA 4H7BA 1HQRD 3DM1A 2E75C 3I91A 2R7ZB 3H0GB 3DXJC 3NPPA 1AN8A 1CFMA 1EWCA 2AQ3B 2SDFA 4LAAA 3PIO3 4HMIA 2G9HD 1AZQA 3DEPA 1K83B 2JYOA 1H9SA 4U68A 1L0YB 1GHKA 5ELDA 2QCPX 3T53B 3SK4A 4Q5VA 3FEWX 1KDBA 3I70A 4QMGA 5C0XI 1JWSD 1B50A 2F0TA 4FF1A 3Q23A 4BA1I 3E0JA 2BE5D 1F2YA 3NSWA 1CHQD 1A2TA 3TP5A 3BZDB 2R6GA 4R8NA 1Z6HA 3PV0A 1FR3A 1WTQA 1SYFA 2L0CA 4IURA 4X3UA 1B9MA 1BF4A 2NB0A 4CBVA 1BCPB 3HG9A 3VR3A 1HPCA 3OOCA 5DNFA 3PUXA 2A74C 1HXYD 5E3FA 4OO1I 2WKDA 3NQTA 2JE6I 2K32A 1SSOA 2HDLA 4OHJA 1STHA 1EY0A 4J1MA 1JICA 1V43A 1SAPA 2PW5A 1RDPD 1Y8NB 5IGCA 3T4AC 4TRDA 3QWNA 1MSGA 3OMGA 4DXFA 5C4JB 4PNYA 2O2LD 1F2MA 1LTBD 4C56C 4HR7B 4DU9A 1I4HA 1OXTA 3RLFA 4IN3A 2ZT9C 3GTMB 4ZLTF 1VF7A 4QIWB 3HOVB 1DOMA 3M7NA 3UI2A 3GV3A 1EEFD 2RDFA 5E1FA 2K28A 3R3OA 3KLRA 4LK1C 2K7VA 2J7ZA 2I07B 1CHPD 3E6ZX 2PPBC 3D6WA 5T1GA 4IUUA 5F2DA 1JOKA 5ELCA 3T13A 1NSNS 3BDLA 1SJED 1I4RA 3LX0A 1FYCA 4RAUC 1G2SA 1Q12A 2A6HD 2F0MA 2VB2X 1W6JA 1F2ZA 1RF2D 1CQFA 4XQJA 3WOFA 3P1HA 1JB3A 1KNAA 3URYA 3SK6A 2K04A 2K1BA 1S4ZA 2EY2A 3I4LA 1VMPA 2N55A 5IIFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EYO A;  4RKL A;  3SK8 A;  3TP7 A;  5C5L A;  5IGC A;  3NUC A;  2OXP A;  4F7X A;  4ID6 A;  2EXZ A;  5IOD A;  2QDB A;  3MZ5 A;  1SYC A;  4TRD A;  4WOR A;  4DFA A;  5C5M A;  5KYL A;  5JAV A;  4B9W A;  4I65 A;  2F0F A;  1EYD A;  5NUC A;  2F0J A;  3H6M A;  4LAA A;  4DGZ A;  4K8I A;  4ZUI A;  5ISR A;  5K5P A;  5J1Z A;  4RKB A;  5I9P A;  1NUC A;  1SNP A;  1SNQ A;  1STB A;  1EQV A;  4KY6 A;  5CV4 A;  1A3T A;  1KDC A;  3SR1 A;  4HMI A;  3OMG A;  2OF1 A;  1STN A;  1EY5 A;  1STY A;  2KHS A;  3D6C A;  3VA5 A;  1STA A;  1SNO A;  4KY5 A;  5CV8 A;  3RUZ A;  2EY6 A;  4KY7 A;  4EVO A;  4PNY A;  1F2M A;  5C3W A;  5CV9 A;  3MHB A;  4KTA A;  5EGT A;  3PMF A;  4OL7 A;  4DU9 A;  5CGK A;  2F0G A;  2F0U A;  4KV6 A;  2SNS A;  3OWF A;  1SNM A;  4QF4 A;  3MXP A;  3SK4 A;  3NK9 A;  4E6I A;  3HEJ A;  3E5S A;  5C4H A;  1EY6 A;  1KDB A;  2EY5 A;  1ENA A;  4QMG A;  1EY4 A;  4MIU A;  1JOR A;  2F0D A;  2HQE A;  4WRD A;  1SYB A;  2F0T A;  3HZX A;  4HMJ A;  3SXH A;  4G57 A;  2RBM A;  4K14 A;  1EYA A;  3OMC A;  4ME5 A;  5C3X A;  5I6W A;  5IGF A;  3SHL A;  4K5V A;  2F3W A;  2PW7 A;  1II3 A;  2EYP A;  3D4W A;  2SNM A;  2EYH A;  2F0N A;  1F2Y A;  4IUN A;  1EYC A;  1A2T A;  3NP8 A;  4ZQ3 A;  3TP5 A;  4IZ8 A;  4DF7 A;  5KIX A;  1TT2 A;  1AEX A;  3OSO A;  3P75 A;  4NMZ A;  4PMC A;  3SK5 A;  5KRU A;  4NP5 A;  2F0S A;  5CV7 A;  5IGD A;  4K8J A;  5EKK A;  2PZW A;  1KDA A;  2RDF A;  5IIF A;  5E1F A;  1SYE A;  4HTH A;  4EQP A;  1A3U A;  3R3O A;  2F0H A;  5I6Y A;  2WAC A;  4K5X A;  4R8N A;  2F0V A;  3TME A;  5CC4 A;  3EJI A;  1JOQ A;  4YIJ A;  5JOB A;  3U9O A;  5CV5 A;  5M9O A;  5C6A A;  1ENC A;  4K2K A;  4KJN A;  2PQE A;  2PZT A;  4EQO A;  5IGE A;  4K2L A;  2RKS A;  1SYF A;  1TR5 A;  3QOJ A;  5CR3 A;  3NXW A;  4NDX A;  1JOK A;  5F2D A;  5J39 A;  3ERO A;  1IHZ A;  2PYK A;  3T13 A;  3NHH A;  1NSN S;  2F3V A;  2EYJ A;  3BDL A;  3DMU A;  2KQ3 A;  3BDC A;  1U9R A;  1EZ6 A;  2F0I A;  2SOB A;  3DHQ A;  1EZ8 A;  2F0L A;  3D8G A;  3LX0 A;  2LKV A;  5DEH A;  2F0O A;  3T16 A;  5DAU A;  1SND A;  3C1E A;  3EVQ A;  4ODG A;  1SYD A;  5EKL A;  5J22 A;  3MEH A;  1EY9 A;  5KGU A;  5CV6 A;  3S9W A;  5I9O A;  4KD4 A;  1KAA A;  2EYF A;  2F0K A;  4NKL A;  2F0M A;  1A3V A;  5E3F A;  5C4Z A;  4KD3 A;  1KAB A;  3QOL A;  3TP6 A;  1SYG A;  3NQT A;  4QB4 A;  1F2Z A;  2EYL A;  4ZUJ A;  5KYI A;  2M00 A;  1EY7 A;  5HUR A;  2ENB A;  3D4D A;  4N9T A;  3TP8 A;  5IOC A;  2O4X A;  4F8M A;  1STG A;  1JOO A;  2F0P A;  2EY1 A;  3P1H A;  2F0E A;  1STH A;  2F0Q A;  1EY0 A;  3ERQ A;  5IGG A;  4J1M A;  5KEE A;  1A2U A;  3MVV A;  3SK6 A;  1EY8 A;  4KJO A;  5HGT A;  3V2T A;  1SNC A;  1TQO A;  2PW5 A;  3C1F A;  4J6H A;  4B9X A;  4S3S A;  4K6D A;  2PZU A;  2EY2 A;  4H7B A;  4K5W A;  3QB3 A;  4IAL A;  5IGB A;  2NUC A;  2F0W A;  4N9P A;  4PMB A;  1RKN A;  4KHV A;  4EQN A;  2OEO A;  3ITP A;  2EYM A; 
#chains in the Genus database with same CATH topology
 2NN6 H;  2RCN A;  5C44 H;  3A0J A;  3OW2 A;  1UUP A;  2EJM A;  2EXZ A;  3I4O A;  1TWC B;  5C5M A;  3S1N B;  5C0X G;  4B9W A;  2DJG C;  3ZYY X;  4QL5 A;  1HR0 L;  2Z6B A;  4DR7 L;  2L12 A;  3PUV A;  4OGQ C;  4IUV A;  2OT2 A;  4DV2 Q;  1WTP A;  2E76 C;  1TS5 A;  4YCV A;  4TQU S;  1A6X A;  1VQ8 A;  4KLK A;  4KY7 A;  3GTJ H;  5D14 A;  3PMF A;  2F0G A;  5JVG 3;  2JA5 B;  5E7N A;  2EY5 A;  2A8V A;  2HHH L;  4DV7 Q;  4F87 A;  1SYB A;  3HKS A;  3TSS A;  4BBR B;  1H9R A;  1HNZ Q;  2F3W A;  5JPM C;  2H4O A;  3ND8 A;  2RA4 A;  4JBJ A;  1PH8 A;  1UEB A;  2R3Z A;  3AYH B;  4HSV A;  1WTV A;  5IYC H;  1Y1V G;  2WAQ E;  1LT6 D;  1WCM G;  3K7A H;  1KRS A;  4A3G B;  4CDF C;  3CP0 A;  2V4D A;  2KCC A;  2NVT H;  2IHF A;  2UXC Q;  3HOU H;  4OO1 G;  3CCM A;  2A69 C;  3S1R B;  3ULL A;  1CT1 D;  4WJ4 A;  5M3M G;  4AIM A;  1K73 C;  1IHZ A;  3CRK C;  1EOT A;  2KBN A;  1HZC A;  3MXU A;  2K75 A;  2G5D A;  2L1B A;  1N34 L;  3VR6 A;  3S2H B;  2Y0S E;  2CQA A;  5I9O A;  2F4V Q;  2XIW A;  1HRJ A;  5FLX E;  3S17 H;  2F0K A;  4NKL A;  3IKJ A;  1U5K A;  3B6Y A;  1F9R A;  4KI0 A;  2K5W A;  4QB4 A;  2QKI C;  3TP8 A;  2O4X A;  3CRL C;  1SJH D;  2ASB A;  3CAM A;  3M4Y A;  4O2D A;  4GLA C;  1NR4 A;  1EQT A;  1RTN A;  2A6E C;  4B9X A;  3K8A A;  4S3S A;  4IUT A;  1STE A;  4MNO A;  3G4S A;  4LF7 L;  2NUC A;  2H1E A;  2CCZ A;  3KLS X;  2OEO A;  3ITP A;  3TME A;  1PV4 A;  4AYB G;  3S15 H;  2K14 A;  4DR1 L;  3W3A A;  4B08 A;  3KF8 A;  3T1Y L;  2UXB Q;  3JAM c;  2Q2U A;  2FHT A;  3M4O H;  3CCS A;  4GNX A;  2V1C C;  4DR3 L;  1YHQ A;  2UUB L;  1I3Q B;  4POF A;  3MFY A;  5L37 A;  2JA9 A;  3J7Z C;  1LUZ A;  4YY3 L;  2D9U A;  5FLX L;  2KCM A;  4DUY Q;  1ZXT A;  3RD4 A;  4OWT B;  3DLL A;  2E2I B;  1PLF A;  5IT9 L;  1ESF A;  3E5S A;  3GTL H;  5GAH C;  3J7Y W;  4OEM B;  4OXP A;  1LTR D;  1YNN D;  1U0L A;  3K58 A;  3K5O A;  3SHL A;  3M85 A;  1JQY D;  2PW7 A;  3T51 B;  1SEB D;  2RDH A;  4UAI A;  5GAD C;  5KRU A;  3KUP A;  4IFD I;  4A3K G;  3H94 A;  3I4M G;  4JYA Q;  2L5T A;  1N9W A;  4JV5 L;  4EX5 A;  5M5W B;  4TKO B;  3U9O A;  5CV5 A;  2B2V A;  3KBX A;  1ESR A;  3QG1 A;  1WD0 A;  5EAY A;  3G7L A;  1LV9 A;  1G6P A;  2YU9 B;  2F4I A;  1SFO B;  2ATW A;  1O80 A;  2R61 A;  3O13 A;  1VQA A;  1Q1B A;  4C3H H;  1G8Z D;  2B2T C;  4RCN A;  1BCP D;  1U9R A;  1V8Q A;  3L3O C;  4HJ8 A;  3TS2 A;  4V0B A;  3MEH A;  1Y8P B;  1JE5 A;  4RFB A;  3BYT B;  4J15 A;  1TWG B;  3TP6 A;  2D2C C;  2VNU D;  2Z4H A;  4LF8 L;  3U9S A;  4F8M A;  3QIA A;  4R1J A;  2R7Z G;  1IXR A;  3SDZ A;  1K8O A;  1XNQ Q;  4RH6 A;  5FLM H;  5IGG A;  1Y1V B;  1VQE A;  4YCU A;  3KJO A;  3MVV A;  1WCM B;  2TSS A;  2X6G A;  1PDQ A;  5C4X G;  2IJ0 A;  2C9O A;  2MPM A;  3T1H Q;  4A3B G;  2KHJ A;  3GTP H;  1PZJ D;  1HR0 W;  2ALY B;  3ULP A;  2PNR C;  4XYQ A;  3SK8 A;  2Q2T A;  4WJW A;  2JXM B;  3Q6S A;  5M3M B;  4KK7 A;  2K05 A;  1BNZ A;  1U4L A;  5IOD A;  4DFA A;  4FF4 A;  5EKI A;  1I4P A;  3OWE B;  5M5X B;  1LAB A;  1XX8 A;  4JBM A;  4CJ2 C;  1U4P A;  1NAP A;  3PIO A;  1YNJ C;  1SNQ A;  1STB A;  4V19 0;  4K0K Q;  3OHX C;  1PH2 A;  1EY5 A;  1K8G A;  2ID0 A;  3D6C A;  3FDT A;  2Q8T A;  1OXX K;  3GO5 A;  5BN3 A;  4RHR A;  1HA5 A;  3HS0 C;  2EPB A;  1ZKO A;  1PRT F;  1M90 C;  4HED A;  1BO0 A;  1EY4 A;  4JI6 Q;  3J80 i;  1AP0 A;  1YZ6 A;  1WI5 A;  2RBM A;  4K14 A;  3TN2 A;  4A93 G;  1FNW A;  1TS2 A;  4B3S L;  1ROD A;  2B2W A;  4ZQ3 A;  4JI3 L;  4AYB B;  4NMZ A;  4B3R Q;  5CV7 A;  3VR4 A;  2HDM A;  1X6O A;  1HFG A;  2QW7 A;  1S3O A;  3NTK A;  1BQQ T;  3Q8D A;  1CKM A;  2XVS A;  3BZK A;  2Q8I B;  3STB D;  4DV1 L;  1JOQ A;  4L5Q A;  1TXY A;  3ERS X;  1SMX A;  1ONL A;  2NVX B;  4ME3 A;  2XWJ B;  2C5C A;  2RKS A;  4CJ1 B;  5IYB H;  4PQX A;  4IJH A;  3CME A;  3S2D B;  3DWP A;  2GN5 A;  3S16 H;  2OCE A;  1LAC A;  3RZO H;  1VQF A;  2SOB A;  2UUA L;  3D8G A;  2AQ1 B;  5EKL A;  4ODG A;  1FNV A;  1EU3 A;  3N52 A;  4P72 A;  1S40 A;  1FD7 D;  1ASZ A;  1BUV T;  2K03 A;  2AMC B;  3GTQ B;  4KD4 A;  1CM9 A;  4F88 A;  1CQV A;  4N8X 1;  3M3Y H;  4O42 A;  3VR2 A;  3CQZ B;  5C4Z A;  4LFC L;  2CW0 D;  4ZUJ A;  4JI8 L;  5JJI A;  3DWA A;  4IOA A;  3D4D A;  5EPJ A;  1O7Y A;  1HQM C;  2JA8 G;  4A3K B;  4KKU A;  3F2D A;  4LUV A;  5KNB A;  2BDN A;  3JAM E;  1WTR A;  1KC8 C;  1PRT B;  2NBF A;  1A8V A;  4K6D A;  3I90 A;  3IFT A;  3IL8 A;  4YCW A;  2JEA I;  3FVQ A;  4CKB A;  1QOH A;  3OIQ A;  4FVM A;  1WTW A;  3OYY A;  3ER0 A;  1ET6 A;  5LMN L;  1HHV A;  2I0Q A;  2YV5 A;  4BY7 H;  5ISR A;  2KOL A;  1RL2 A;  2DY8 A;  4JI0 L;  4DR4 L;  4NPS A;  2D0O A;  2CQO A;  1EQV A;  5TSS A;  3SR1 A;  3P20 A;  3I4N G;  3S14 B;  1N36 Q;  3BVG A;  1Q46 A;  3EQL C;  5C3E B;  5GAG C;  5EQ0 A;  2A68 C;  5IWA L;  3PO2 H;  1Y1W H;  1QG7 A;  3FPP A;  3BS1 A;  3RMH A;  4FP5 D;  2CVR A;  3HEJ A;  5M5Y H;  1MKH A;  4MIU A;  1HNX L;  5C4X B;  3K0X A;  3JAM L;  4GLX A;  4A3B B;  1YEZ A;  1YHA A;  2E5L L;  2VUM H;  1TWA B;  4JBW A;  3OPO A;  3OSO A;  3F1Z A;  2Y0S B;  1GUG A;  5IGD A;  5BR8 L;  2E2D C;  1DOL A;  1SYE A;  1SLJ A;  2J0T D;  4K5X A;  3SGI A;  2XRS D;  4C3I G;  4DR5 L;  2F52 A;  5CC4 A;  1AFP A;  4JI7 L;  1GOZ A;  1VMC A;  4ZAI A;  4HSP A;  5IGE A;  3EA6 A;  1HJP A;  2RHQ B;  2F3V A;  3BDC A;  3HOX H;  1QUQ B;  5AJ3 Q;  3G71 A;  1CK1 A;  2LMC B;  3KLS A;  4RWS C;  4C3J H;  1SND A;  1SYD A;  1B1Z A;  1GVP A;  1H9S B;  1XJV A;  5CV6 A;  1E1O A;  4A3M G;  3LWU A;  1E7Z A;  1MBY A;  4WFN 3;  4DV5 L;  4RGO S;  4A93 B;  3KDF B;  3RZD H;  3PO3 G;  1W6K A;  1EY7 A;  1TII D;  3GTO H;  4Y7N H;  2F0E A;  1GKH A;  2F0Q A;  5K36 H;  1QVC A;  2R7F A;  2KHI A;  2B63 H;  2IWH A;  2WIN B;  1ILP A;  1TWF B;  5D3I B;  3I55 A;  2BDO A;  2BE5 C;  3QB3 A;  5JPN C;  1JCK B;  5IGB A;  4GN3 B;  1XMO Q;  5C0X J;  4TSS A;  2NVY B;  1LT3 D;  5C5L A;  3KFU A;  2QDB A;  1NMF A;  1H9K A;  4WOR A;  1M8A A;  2AUJ D;  3A56 A;  3UDI A;  2UU9 Q;  3LWE A;  2LXJ A;  1Z47 A;  3CCJ A;  4A3J H;  1B2T A;  3E3X A;  1JMC A;  1CSQ A;  4R9W A;  3HOY B;  4BBS B;  5FLX c;  2KHS A;  2PMZ E;  4M8A A;  4X64 L;  2XSC A;  3RUZ A;  1K3B C;  3MAQ A;  2AWO A;  2K52 A;  2K5D A;  4NB3 A;  1QCB D;  2EQS A;  2F0U A;  2XWB B;  3CC2 A;  2JA8 B;  1L1O A;  1UE6 A;  1V1P A;  1R9T B;  4A3L H;  1KL9 A;  4A3G G;  4HMJ A;  2CHB D;  1O78 A;  4AQY L;  5CYU A;  5KNC A;  5JEA G;  4KKS A;  4UP7 A;  1X9N A;  1X3Q A;  1PTO H;  1MSH A;  3KYH C;  4R4C A;  2NVQ H;  1NBW A;  4PMC A;  5I2X A;  1NR2 A;  1IKL A;  3L7Z C;  5D3D A;  4A3E B;  4UP9 A;  1XWE A;  4BY1 H;  2D5D A;  2E2J B;  3NEM A;  4GNX C;  2F0V A;  2DN8 A;  3W5O A;  2OTL A;  4DV6 L;  4IPG A;  2PQE A;  2AKW B;  4NXN Q;  1FJG L;  2XNA C;  4XT3 B;  2EOT A;  3I4N B;  4NDX A;  4A3D G;  3NHH A;  1Q7Y C;  5DLQ E;  1S5D D;  4PG3 A;  4JG2 A;  3HRZ C;  1PTO D;  1EIG A;  1IL8 A;  3HOZ H;  2F0O A;  5DAU A;  1J5E Q;  1I94 Q;  2E74 C;  1TVX A;  5D65 A;  3HOW H;  5KGU A;  4DR6 Q;  4X62 Q;  1NJI C;  5LL6 S;  1A3V A;  4L8J A;  2JA6 H;  5HY6 A;  1KAB A;  2NN6 I;  3DWQ A;  4B3M L;  1EQQ A;  1EWH A;  2BA0 A;  1NNX A;  3AFQ A;  3KF6 A;  4U67 3;  3CC4 A;  1F9S A;  1ENF A;  1HNW Q;  4FXK C;  2B2V C;  1EY8 A;  4LF6 Q;  2XRQ D;  1YJ9 A;  4C3I B;  4X65 Q;  4GKJ L;  1VQD A;  1M4V A;  1KQS A;  3I73 A;  4UHV A;  4KHZ A;  4PZ6 A;  4OWX B;  4KHV A;  2EYM A;  3AFP A;  3TRE A;  3BZC A;  2RF4 A;  5EPL A;  4I65 A;  5E4W C;  4LF5 Q;  4ZUI A;  5K5P A;  3X3N A;  4A3F B;  3TRZ A;  1G91 A;  1I6V C;  4KY6 A;  4CKE A;  3BVZ A;  4A3M B;  1STY A;  3E9H A;  2R93 H;  1AH9 A;  1PH9 A;  1YIJ A;  3PO3 B;  1BXT A;  4KKT A;  4LJZ C;  5EGT A;  3J7A 5;  1GUO A;  2ZM6 L;  2SNS A;  2VW9 A;  1EY6 A;  2EE1 A;  2KVM A;  5I2Y A;  2R92 H;  1F9Q A;  2A6H C;  3DM3 A;  3FMC A;  4UP8 A;  3NBH B;  1YIT A;  2RVL A;  3OMC A;  1MIU A;  3GTG B;  2EYH A;  1QB5 D;  1TY0 A;  2O5I C;  3NP8 A;  2K5V A;  1PH3 A;  3HKZ E;  5EJW A;  4OX9 Q;  3J80 c;  3J7A F;  4OIK A;  2PI2 A;  2PZW A;  3S1M B;  2AWN A;  4IPC A;  1OXS C;  2E2H H;  3M3Y B;  2VB3 X;  2YTX A;  5ELF A;  1JWU D;  5M9O A;  1SE2 A;  4KJN A;  4MHE A;  4ABN A;  1I50 H;  2UUC L;  5J39 A;  5CR3 A;  2N49 A;  3FKI G;  5FO9 B;  3J7A V;  4R4I A;  2L9H A;  1W2B A;  2MO1 A;  3I4M H;  3H3V C;  1B8A A;  3S1Q H;  1VQB A;  3GV6 A;  2JA7 G;  2DNE A;  4CGY B;  4LUZ A;  2MFI A;  1EY9 A;  4A3I H;  1IYU A;  1LTA D;  2CWA A;  2B2W C;  4LMQ D;  3I72 A;  1EL0 A;  4XTC S;  2F0P A;  3GD7 A;  1PXU A;  1SRO A;  4JBK A;  4XQQ A;  1B9N A;  3ERQ A;  1OTC A;  1YBY A;  4CDE C;  1VQP A;  4KJO A;  3V2T A;  3NEL A;  4DV3 Q;  1R4Q B;  1GUT A;  5M3F B;  1PRT D;  1IBL L;  4IAL A;  3K57 A;  4ZK9 B;  1Y1W B;  1I6H H;  2RDG A;  2B8G A;  1VCI A;  4N9P A;  4ULL A;  1N32 Q;  3K7U C;  1B3A A;  1E24 A;  2VQE L;  3NUC A;  2R7Z H;  4A3D B;  1PMR A;  5LL6 X;  3H0G H;  5LMU L;  2F0J A;  1AW7 A;  1WVL A;  4I7A A;  1XYI A;  3I7F A;  4B3R L;  3FP9 A;  1G51 A;  2IX0 A;  3JC6 6;  1STA A;  1SNO A;  4EQ5 A;  2Q2I A;  4L6T B;  1TS3 A;  3R8B A;  1K83 H;  1IBK Q;  4DNT B;  5C3W A;  5CV9 A;  4KTA A;  3BG3 A;  5ELN A;  1OXV A;  2K33 A;  4ZRZ A;  1EFI D;  1PZK D;  1E0B A;  4E6I A;  1GUW A;  1VDZ A;  1GM5 A;  4X3S A;  1EEI D;  4ME5 A;  3R93 A;  2QEJ C;  4NXM L;  2EYP A;  2KCN A;  4FXD A;  4IUN A;  4LF9 Q;  2NWG A;  4HID A;  4JW0 A;  1TT2 A;  2F1M A;  2ZTE A;  2UXD L;  4NP5 A;  4K8J A;  4UDU C;  2AUK A;  4JI1 Q;  4PV1 C;  1JJ2 A;  4OWW B;  4X3K A;  5EBC A;  1GXD C;  4H13 C;  2B2U A;  3CCQ A;  1CKN A;  2FMC A;  1IW7 D;  2NN6 G;  1PH7 A;  4HAE A;  5IP9 H;  5FJ8 G;  3C3L A;  5GAE C;  4RGT A;  1TWH B;  3RN2 A;  1PZI D;  3J81 i;  3CXC A;  1X3P A;  1VQ9 A;  3PIP A;  3PQI A;  3DMU A;  4Y52 H;  2D62 A;  1EIF A;  3A8K E;  1VQH A;  3T16 A;  1XMQ L;  3K6O A;  3LNN A;  4G7O C;  2L11 A;  2A5H A;  2GVB A;  1B44 D;  1OXU A;  1VQG A;  3I3C A;  3L9A X;  4JI2 L;  1VQ5 A;  3CPF A;  3UDX A;  1YNN C;  1N36 L;  2PMZ B;  4JK1 C;  4R4T A;  3K5L A;  3M7G A;  5COR A;  1IYJ B;  1XPR A;  1K0R A;  3OIP A;  3VYU A;  5T1I A;  4HCE A;  4G4K A;  4PMB A;  1VF5 C;  3CW2 C;  2RQX A;  1X3F A;  4HJ7 A;  1AE2 A;  2WII B;  2PNH A;  2VQF Q;  1PYW D;  2WAQ G;  5IYC G;  4KHP L;  5KND A;  1X65 A;  3FKI B;  2DY7 A;  3QR8 A;  1UAP A;  1TY2 A;  4FXG C;  5C3E G;  2BCO A;  4ZKC B;  2RHS B;  5AFW A;  2F0F A;  4JVZ A;  1WJJ A;  4IFD J;  2JA7 B;  4C2M B;  1NUC A;  1HR0 Q;  4WJ3 M;  2AQ2 B;  1A3T A;  1KDC A;  4DR7 Q;  2X6L A;  1D5X C;  4QY7 A;  1X56 A;  4X66 Q;  2EY6 A;  4PMW A;  5C4J H;  2N88 A;  1BCP C;  1LTG D;  4KV6 A;  3VYS A;  2K5Q A;  4YHH Q;  2N8N A;  2Y0S G;  2IPK D;  2VY3 A;  1CZW A;  3J80 E;  3CCU A;  3F8T A;  1SDF A;  1QZG A;  2NTT A;  1D1K A;  5IY0 A;  5CMD A;  3H09 A;  2G9D A;  4WRD A;  3HZX A;  2HHH Q;  3TZU A;  5C3X A;  3TS0 A;  3GTM H;  4XYO A;  5BN5 A;  4IFD H;  2SNM A;  3HOV H;  4QIW E;  4DV4 L;  1U4M A;  4JI5 L;  2I5L X;  1L0W A;  1SMY D;  2IW3 A;  2QDL A;  1V9P A;  5I9P A;  3GP7 A;  1ET9 A;  4DAY A;  1DJR D;  1WTX A;  4LFB L;  4CHT B;  4RGN A;  3V96 A;  4K2K A;  3PF5 A;  1ZYR D;  2BH8 A;  4IUQ A;  1E3P A;  5G3L F;  3Q24 A;  4APV A;  1SE3 A;  2BOS A;  3VA7 A;  2MO0 A;  3RLN A;  1L1O C;  1IBM L;  3TEH B;  4BXX H;  1Q8K A;  1XMO L;  1BR9 A;  1EZ8 A;  2CWP A;  2ICE C;  4GKK L;  5A2Q E;  1N34 Q;  3S9W A;  1GUS A;  1Q90 A;  3J80 L;  3P7J A;  3LGJ A;  3NBI A;  4LF4 L;  5IP7 H;  1IZ6 A;  4DXG A;  3OTO L;  4H0L C;  3M4Q A;  1BBW A;  4GN5 A;  5KIX A;  4N9T A;  1PFS A;  3VYT A;  4Q0F A;  1MGS A;  3MXN A;  1D6E C;  1O7Z A;  1XPU A;  2IY5 B;  3D4R A;  2VS1 A;  1BBU A;  3KOJ A;  4IJL A;  1PHJ A;  1G6Z A;  1E2W A;  1TKW B;  1GUN A;  2Z9H A;  1CA5 A;  1WOC A;  3FRP B;  1QZH A;  5EPK A;  4LFA L;  3GDE A;  3EBE A;  4R4Q A;  3HOY G;  2QEX A;  4BBS G;  5C44 B;  3NEN A;  3K5M A;  2OXP A;  2O5J C;  1V1O A;  4DR1 Q;  3L0O A;  1UWV A;  3W1B A;  1CA6 A;  1TWC H;  3S1N H;  2QA4 A;  3T1Y Q;  1MJC A;  5NUC A;  3STB C;  3Q0A A;  1JT8 A;  1WD1 A;  2HD3 A;  3RLO A;  4RKB A;  1FL0 A;  2XGT A;  3CCV A;  4ZKB B;  1F77 A;  1QWY A;  2YYZ A;  4DR3 Q;  2UUB Q;  3GTJ B;  2Z4I A;  5CV8 A;  4YY3 Q;  3OW7 A;  2B2Y A;  3K0Y A;  2PI2 E;  1SNM A;  2PCF B;  5JEA J;  5C4H A;  1HTP A;  4FNF A;  1ENA A;  2FJ2 A;  4A3E G;  2JA5 H;  1JOR A;  4DUZ L;  2K01 A;  3C46 A;  2KCT A;  5IGF A;  1VQ7 A;  4BBR H;  2CW0 C;  2FMM A;  2KJX A;  4K5V A;  4P71 A;  3D4W A;  1B53 A;  4DF7 A;  1WFQ A;  1AEX A;  3P75 A;  3GTK H;  2WAQ B;  1YHB A;  3A74 A;  3SK5 A;  5FLM G;  3K7A B;  3MC0 B;  5EKK A;  1DGS A;  4HTH A;  3NWT A;  3D31 A;  3M4P A;  2WAC A;  2EJG C;  2NVT B;  3VR5 A;  1S5C D;  4JV5 Q;  1LT4 D;  3HOU B;  1U4R A;  4DAM A;  1UE7 A;  3CD6 A;  1B70 B;  2NYZ D;  3S1R H;  5GRO A;  2PQA A;  3NXW A;  1GO3 E;  1HCZ A;  1Y69 U;  2EYJ A;  4DR2 L;  4RCO A;  2F0I A;  3DHQ A;  4K6L A;  5DEH A;  4GOP A;  1BCP F;  1MD2 D;  4NW2 A;  1YJW A;  3S2H H;  3S17 B;  4ZCK A;  4UPA A;  2XN9 C;  4HJ9 A;  3QOL A;  2IL8 A;  2EYL A;  5FOB B;  4IOC A;  2ENB A;  1WYD A;  4YWK A;  1B7Y B;  5FKA C;  4LF8 Q;  4FF2 A;  4GZY C;  4HIO A;  3A5U A;  1LTI D;  3T56 B;  4EGV A;  4N8F A;  4P74 A;  1KRT A;  4KMU C;  3KLW A;  4K5W A;  4A3F G;  3E0E A;  3QJY A;  2EZV A;  3S15 B;  2JSO A;  2JN4 A;  2EYO A;  4YWL A;  2B2T A;  3KDF A;  2OTJ A;  2JQO A;  3ONA B;  4DV0 Q;  3W1G A;  2PO4 A;  3M4O B;  4IUP A;  4MN3 A;  1DZ1 A;  3FHW A;  3H6M A;  2A73 B;  4DV2 L;  3HP3 A;  1Z7T A;  4OX9 L;  1S5E D;  1JJG A;  5FO7 B;  5IYB G;  4HJA A;  1BOS A;  1CKO A;  1UEA B;  1E2V A;  1I3Q H;  2I46 A;  1A15 A;  2LY7 A;  1C7Y A;  1YJN A;  1Q86 C;  1VQL A;  5FK9 C;  1ICW A;  3MHB A;  2LSS A;  5CGK A;  4B3T Q;  4A3C H;  3OWF A;  5DM7 3;  2ZXP A;  4R4O A;  4DV7 L;  2E2I H;  3GTL B;  3A54 A;  1N33 Q;  1YVC A;  3VDY A;  1KHI A;  2WB1 E;  1HNZ L;  1VQO A;  2YTY A;  1LTT D;  1A62 A;  2HCC A;  3BDO A;  4J8Q A;  2ES2 A;  1UE5 A;  1CUK A;  3D0F A;  3CF5 A;  2F0N A;  1KNE A;  4XIG S;  1EYC A;  4DN4 M;  1NTG A;  3K5N A;  4P73 A;  1PYS B;  1SXT A;  4JI3 Q;  1Q8I A;  1PA6 A;  4M1U B;  1DOK A;  4DAV A;  2MJ8 A;  2K4K A;  1KLU D;  2UXC L;  3L2P A;  5M5W H;  5C0X H;  1PFN A;  5JOB A;  2IX1 A;  2CH4 W;  1ENC A;  4LW1 A;  1JC7 A;  4DV1 Q;  5IYD G;  4IPD A;  1ZEQ X;  1B3Q A;  4C1N I;  1TR5 A;  4C3H B;  3A8J E;  4C1N K;  2YU9 H;  5JJZ A;  1RD9 D;  1I5F A;  1SFO H;  1VQ6 A;  2SEB D;  4BY7 G;  4H44 C;  4KN7 C;  4MTK A;  3KJP A;  2ZTC A;  2F4V L;  2UUA Q;  4L5R C;  3E9I A;  4I7Z C;  4IO9 A;  1JWM D;  3J81 c;  3G48 A;  4QCL A;  5M3F G;  2LFN A;  3PO2 G;  4QJF A;  1Y1W G;  1TWG H;  4AH6 A;  1V1P B;  2B3G A;  4BA2 I;  1FGB D;  1JOO A;  2JP1 A;  4JI8 Q;  1EQR A;  1RJT A;  3H3V I;  3J81 j;  2N78 A;  5KEE A;  1Y1V H;  4RHS A;  2B2U C;  1TQO A;  1HA6 A;  1WCM H;  4RGM A;  1VS0 A;  1IBK L;  2K50 A;  3CCE A;  3GTP B;  4HCS A;  3I56 A;  4RG1 A;  1PYB A;  3NTH A;  1GJX A;  4X6A H;  1VQK A;  3EFX D;  5KYL A;  4OO1 H;  1MHW C;  2UXB L;  1D2B A;  1JR0 D;  5M3M H;  1YI2 A;  1HUN A;  5LMN Q;  1VQ4 A;  3CCL A;  4LF9 L;  5M5X H;  1RIP A;  4G7Z C;  3K59 A;  4FDB A;  4JI0 Q;  3A8I E;  1SBB B;  5CV4 A;  1UNS A;  5LMN W;  4DR4 Q;  2BA1 A;  4BWG B;  2KED A;  1A63 A;  4DUY L;  3CHB D;  3TQY A;  1PTO C;  2AHO B;  2KA7 A;  4C3J G;  1I4Q A;  1F9P A;  4QF4 A;  4X3T A;  5IWA Q;  1T5X D;  1C8C A;  2HIX A;  3PSI A;  1TS4 A;  1P8L A;  1J9O A;  4GLV B;  4QUC A;  1X3G A;  3DEO A;  3MEF A;  3GQB A;  1HNX Q;  3KF6 B;  4H02 A;  1LYL A;  5GQO A;  3R2I A;  4JYA L;  5K36 G;  2NZO A;  1IYV A;  4AYB E;  4XDX A;  2B63 G;  3SEB A;  4CDC C;  1JE4 A;  1DXM A;  4Z9C B;  2HQL A;  1KAW A;  5BR8 Q;  2JEB I;  3X3M A;  4DR5 Q;  3I8Z A;  5JVH 3;  3NBH A;  1CTM A;  3TBI B;  2NVX H;  1FGU A;  1C0A A;  3S16 B;  2HCI A;  2WFW A;  4YWM A;  2WV6 D;  3S2D H;  5COY A;  3RZO B;  1J8I A;  4XXE A;  4A3J G;  4BS9 A;  2F3I A;  3MFG A;  2F0L A;  3A7A B;  1D7Q A;  3ND9 A;  2B39 A;  4A4I A;  2X69 A;  1Y8O B;  1HTL D;  1JJC B;  1V1Q A;  2MUY A;  2EYF A;  2H5X A;  2B8F A;  5J3B A;  5FJ8 H;  4DNI A;  3GTQ H;  3TZD A;  4A76 A;  1EOV A;  2IHE A;  3CQZ H;  4DV5 Q;  3NTI A;  3QO2 A;  1XNQ L;  5DM6 3;  1EYG A;  4A3L G;  4IQZ A;  5IE8 A;  1A2U A;  1Q1E A;  3T1H L;  4A3K H;  4DK6 C;  4X66 L;  3KBG A;  2KEN A;  3C1F A;  5CBE E;  1EU4 A;  3BU2 A;  3F2U A;  1R4P B;  3BVM A;  4YHH L;  2F0W A;  3UDF A;  2A69 D;  3IFD A;  2QF7 A;  2OWO A;  1B4O A;  1F2L A;  3RR5 A;  2NTS A;  4BY1 G;  2FFK B;  2R7D A;  4F7X A;  4DNR B;  2KEE A;  1SYC A;  1Q3L A;  1A0I A;  4BY7 B;  1X32 A;  1X3E A;  2CKZ B;  1XTD A;  4KN4 C;  5JAV A;  4ZYS A;  1L2F A;  4DGZ A;  4K8I A;  2M2L A;  3WDN A;  4K0K L;  3GTK B;  2RSO A;  3NE5 B;  5LHY 1;  4XT1 B;  2EXD A;  1C9O A;  4FYD A;  3S14 H;  1M1K C;  3AB9 A;  3PO2 B;  4X64 Q;  3HOZ G;  1XNR Q;  5C3E H;  3RN5 A;  3NQI A;  3MTS A;  5M5Y B;  4JI6 L;  3HOW G;  4LWC A;  1SRU A;  5G3L D;  1QNK A;  4MTN A;  2KEC A;  1GHJ A;  3W2D A;  2F03 A;  2JA6 G;  2HQE A;  2A6E D;  4G57 A;  1TU2 B;  5C4X H;  1KD1 C;  1NY4 A;  5I6W A;  1VQI A;  2VUM B;  4A3B H;  4L63 B;  4AQY Q;  1QIL A;  1TWA H;  1VQM A;  3PUZ A;  1KDA A;  1OO9 B;  5IIF A;  1A3U A;  2F0H A;  2EDG A;  3EJI A;  5A35 A;  3KK7 A;  1PRT C;  4O1N A;  4YIJ A;  5E4X A;  5BN4 A;  2ZJP A;  1J6Q A;  4EQO A;  4DV6 Q;  1WTH A;  5IT9 E;  2C35 B;  3U50 C;  3J81 E;  1FJG Q;  3SVM A;  1H9J A;  2B2Y C;  2PYK A;  1YNX A;  3HOX B;  3H15 A;  1RCV D;  1S5F D;  4G7H C;  4OIJ A;  3A55 A;  1EFW A;  4C3J B;  1PFB A;  1C4Q A;  1Q81 C;  2NZ1 D;  2Z6K A;  1PTO F;  5J22 A;  4JOI A;  2R93 G;  4CJ0 B;  1KAA A;  1CZG A;  1LLR D;  3RZD B;  4JI4 Q;  4DK3 C;  4FO2 A;  4JPB W;  4R8I A;  1DCZ A;  4A93 H;  3KF8 B;  2M00 A;  5HUR A;  3D3R A;  3GTO B;  2WP8 J;  5C44 G;  4Y7N B;  1STG A;  4B3M Q;  1DD2 A;  2EY1 A;  1L0X B;  2B63 B;  4ALP A;  3AU7 A;  1K8A C;  1I4G A;  2R92 G;  4GNX B;  1SNC A;  4J6H A;  3TDQ A;  3FPU B;  3PF4 A;  1TWF H;  1DM0 B;  2I5M X;  3CMA A;  2ZJQ A;  4GKJ Q;  4EQN A;  3HKZ G;  1WTO A;  3PGZ A;  3TP7 A;  2EIF A;  3K80 C;  2NVY H;  2WB1 B;  2GVA A;  3WOE A;  1H9M A;  3J81 L;  3MZ5 A;  3ZJY C;  4GOP C;  3MWY W;  1CKN B;  2L15 A;  4A3J B;  1EYD A;  2L55 A;  2CFM A;  2MGS A;  1IW7 C;  3HOY H;  4BBS H;  1P16 A;  2OF1 A;  1STN A;  3VA5 A;  1KXL A;  1BVS A;  1G29 1;  4KY5 A;  2MQH A;  3UE0 A;  1LO5 D;  2K5H A;  5JJL A;  2ZXR A;  4DK1 A;  2HIV A;  4RA8 A;  4OL7 A;  1RHP A;  3MXP A;  3UDG A;  2ZM6 Q;  1AZP A;  2JA8 H;  4A3I G;  3F2B A;  1R9T H;  1D5M C;  3HGB A;  1EIH A;  1GD7 A;  3SXH A;  2RCF A;  1EYA A;  1O7L A;  3HOU G;  1QVF A;  1PTO B;  1DON A;  1II3 A;  1SN8 A;  2Z8L A;  2NVQ B;  2I5H A;  4IZ8 A;  3M9B A;  2HUG A;  2JJQ A;  3V05 A;  4PZ8 A;  2A19 A;  4BY1 B;  1NCV A;  4EQP A;  3G6E A;  5I6Y A;  4A3E H;  4TVA B;  1CSP A;  2E2J H;  3AQQ A;  1EWI A;  2EVB A;  1YNJ D;  3PCO B;  1I4X A;  4K2L A;  1E22 A;  3ERO A;  2UUC Q;  3I4N H;  3H0G G;  1NMG A;  2Q8R E;  5AJ3 L;  4HIK A;  3CKI B;  4GN4 B;  2MP1 A;  1SR3 A;  4HIM A;  3HOZ B;  4PZ7 A;  1EZ6 A;  2LKV A;  3EVQ A;  3C1E A;  2EJF C;  5I4D A;  1DYQ A;  3HOW B;  2LXK A;  4DV0 L;  3CU7 A;  1IKM A;  2L4N A;  3MXG A;  2JA6 B;  4CKC A;  5IOC A;  1G2T A;  3A5Z B;  2MNA A;  2DNC A;  2Q2H A;  4P75 A;  2P5Z X;  2VL6 A;  2MHV A;  3UE1 A;  5HGT A;  2LS0 1;  2NZH A;  1ML0 D;  4C3I H;  5CBA E;  2Z1C A;  4HJ5 A;  4B3T L;  1E1T A;  3VYR A;  4CDD C;  1RKN A;  1N33 L;  1IBL Q;  5JJK A;  4RKL A;  3BYY B;  4DAY B;  3CPW A;  3Q22 A;  1S72 A;  1SMY C;  2OQ0 A;  3U4Z A;  2FXQ A;  2N3S A;  4ID6 A;  5FO8 B;  4ILW A;  3DUZ A;  2VQE Q;  1KIX A;  4DAP A;  2UU9 L;  2FIN B;  3S24 A;  1QNU A;  3G6J B;  5LMU Q;  2KUM A;  5J1Z A;  5IP9 G;  4DA2 A;  1SNP A;  4A3F H;  1ZYR C;  1HZA A;  3MA2 B;  2R93 B;  1K8M A;  1X54 A;  2ICI A;  4A3M H;  4EVO A;  2A1A A;  3SE0 A;  5ELO A;  4DK0 A;  2GA4 B;  1RTO A;  2TMP A;  3PO3 H;  4LF7 Q;  3NK9 A;  1CI3 M;  2QGQ A;  2ZXO A;  1XTC D;  2R92 B;  1LTS D;  2F0D A;  1QJO A;  2DUD A;  4LNQ A;  1D5Z C;  1PFM A;  3PIP 3;  1NE3 A;  5EBD A;  3A7L A;  3MXN B;  3GTG H;  5A2Q L;  1C48 A;  3HKZ B;  1EIY B;  4NXM Q;  1LT5 D;  3U4V A;  4C3H G;  3AMU A;  2F0S A;  2IX3 A;  2E2H B;  1SE4 A;  5KYI A;  3S1M H;  2UXD Q;  4HN7 A;  4XQN A;  3NWS A;  1Z9F A;  4NXN L;  2J4X A;  4JC0 A;  1XXG A;  5C6A A;  1I50 B;  3IAY A;  2PZT A;  3WWV A;  1T9H A;  1VQC A;  3QOJ A;  1PVO A;  4L5S A;  1MI2 A;  3H91 A;  2QIL A;  3I4M B;  4P2C B;  3S1Q B;  3N6R A;  3R2T A;  4DPG A;  2KQ3 A;  1KTK A;  1QE6 A;  1J5E L;  1I94 L;  3PUY A;  2A68 D;  4DR6 L;  5ELE A;  1K28 A;  4X62 L;  3PUW A;  4A3I B;  1XMQ Q;  4FF3 A;  1D1I A;  4QUF A;  5IYD H;  1KLG D;  1PH6 A;  1S5B D;  1E2Z A;  4OON A;  4A3G H;  5H1S E;  1Q82 C;  4KD3 A;  1SYG A;  2VXW A;  2K6A A;  5JEA H;  2ZTD A;  4JI2 Q;  1T5E A;  1HNW L;  1HFN A;  2M9V A;  1ILQ A;  2RSN A;  4LF6 L;  1BBX C;  1BDO A;  4X65 L;  2IT1 A;  1PH5 A;  1HH2 P;  5ELB A;  3I2Z A;  3JAM i;  3C2P A;  4IFD G;  1FNU A;  3CC7 A;  1XPO A;  1HUM A;  2PZU A;  3HOV G;  1I6H B;  4H7B A;  5M3F H;  1FVI A;  1HQR D;  3DM1 A;  2E75 C;  3I91 A;  2R7Z B;  1H95 A;  3H0G B;  4KHP Q;  4A3D H;  4LF5 L;  3DXJ C;  3NPP A;  1AN8 A;  1CFM A;  1EWC A;  2AQ3 B;  2SDF A;  4LAA A;  2PQA B;  3PIO 3;  1EUJ A;  1QUQ A;  4HMI A;  2G9H D;  1AZQ A;  3DEP A;  1K83 B;  2JYO A;  1H9S A;  4U68 A;  1L0Y B;  4GOP B;  4BXX G;  1AE3 A;  1GHK A;  1X55 A;  5ELD A;  1K3R A;  2QCP X;  3T53 B;  3SK4 A;  4Q5V A;  3FEW X;  1KDB A;  3I70 A;  4QMG A;  5C0X I;  1JWS D;  5IP7 G;  1D8L A;  1B50 A;  2F0T A;  4FF1 A;  3Q23 A;  2DGY A;  4BA1 I;  1W3S A;  3E0J A;  2BE5 D;  4O0A A;  1F2Y A;  3NSW A;  1CHQ D;  1A2T A;  3TP5 A;  3EN2 A;  3BZD B;  2R6G A;  4DV4 Q;  4UY8 C;  2YTV A;  4JI5 Q;  1K9M C;  1N8R C;  4R8N A;  1Z6H A;  4OEL B;  3PV0 A;  2HT1 A;  1FR3 A;  3HFZ B;  4LFB Q;  1WTQ A;  2B29 A;  1SYF A;  2L0C A;  4IUR A;  1LTL A;  4X3U A;  1TWH H;  1B9M A;  1BF4 A;  1SE8 A;  2NB0 A;  4CBV A;  1BCP B;  3HG9 A;  1VQJ A;  1IBM Q;  3VR3 A;  4B3S Q;  3IRB A;  4GKK Q;  1HPC A;  3OOC A;  5DNF A;  3PUX A;  2A74 C;  1Y14 B;  1HXY D;  5E3F A;  3BJU A;  1VQN A;  4OO1 I;  2WKD A;  3CCR A;  3NQT A;  2JE6 I;  4LF4 Q;  2K32 A;  3AEV A;  3OTO Q;  1SSO A;  2HDL A;  4OHJ A;  1STH A;  2JA5 G;  1EY0 A;  4J1M A;  1JIC A;  1V43 A;  4DV3 L;  1SAP A;  2PW5 A;  4BBR G;  1XNR L;  2XTI A;  1N32 L;  5IT9 c;  1RDP D;  4LFA Q;  1Y8N B;  5IGC A;  2E8G A;  2OQK A;  1HZ9 A;  3T4A C;  2ZJR A;  4L5T A;  3FKI H;  3K81 C;  4TRD A;  1L1O B;  2Z6K C;  3QWN A;  1MSG A;  4LFC Q;  4JOI C;  3RNU A;  2JK8 A;  2JA7 H;  4C2M H;  2CH4 A;  1K0S A;  3OMG A;  4LUO A;  4DXF A;  3ICE A;  5C4J B;  2VUM G;  4RMF A;  4PNY A;  2O2L D;  1F2M A;  1LTB D;  2D0P A;  4HR7 B;  4C56 C;  1ASY A;  4JCV E;  4DU9 A;  4QGU A;  1I4H A;  1OXT A;  3RLF A;  4IN3 A;  1ICF B;  2DJF C;  2ZT9 C;  1PH4 A;  4POG A;  3GTM B;  4ZLT F;  1VF7 A;  4GS3 A;  4DUZ Q;  4QIW B;  3HOV B;  1DOM A;  3M7N A;  3UI2 A;  3GV3 A;  4JI1 L;  3F2C A;  4QQB X;  3HOX G;  1O7I A;  2RDF A;  1EEF D;  5E1F A;  4JI4 L;  2K28 A;  3R3O A;  3EIV A;  3KLR A;  4LK1 C;  2K7V A;  2K5N A;  2VZA A;  1HZB A;  2Z0S A;  2J7Z A;  2I07 B;  1CHP D;  3E6Z X;  2PPB C;  3D6W A;  5T1G A;  4IUU A;  4IPH A;  5F2D A;  1JOK A;  3ULJ A;  5HGQ A;  5ELC A;  3U58 A;  3T13 A;  1NSN S;  1BKB A;  3BDL A;  1SJE D;  1UE1 A;  1I4R A;  2BH2 A;  3LX0 A;  4DR2 Q;  1QVG A;  2E5L Q;  1FYC A;  4RAU C;  4DKA C;  1G2S A;  1Q12 A;  2A6H D;  2F0M A;  2VB2 X;  1W6J A;  1PH1 A;  1F2Z A;  4MZ9 A;  4A3C G;  3H3V H;  4JI7 Q;  1RF2 D;  1CQF A;  4XQJ A;  3WOF A;  3P1H A;  1JB3 A;  2WB1 G;  1LM0 A;  1KNA A;  3URY A;  3SK6 A;  1JB7 A;  1IL2 A;  2K04 A;  2K1B A;  1MJE A;  1S4Z A;  2EY2 A;  2VQF L;  4A75 A;  3I4L A;  1VMP A;  2N55 A;  2WKC A; 
#chains in the Genus database with same CATH homology
 2NN6 H;  1UUP A;  2EJM A;  2EXZ A;  1TWC B;  5C5M A;  3S1N B;  5C0X G;  4B9W A;  3ZYY X;  2L12 A;  3PUV A;  4OGQ C;  4IUV A;  2OT2 A;  1WTP A;  2E76 C;  1TS5 A;  4TQU S;  1A6X A;  4KY7 A;  5D14 A;  3PMF A;  2F0G A;  5JVG 3;  2JA5 B;  2EY5 A;  4F87 A;  1SYB A;  3TSS A;  4BBR B;  1H9R A;  2F3W A;  5JPM C;  2H4O A;  3ND8 A;  2RA4 A;  4HSV A;  2R3Z A;  1WTV A;  1LT6 D;  4A3G B;  2V4D A;  2KCC A;  4OO1 G;  2A69 C;  3S1R B;  1CT1 D;  1IHZ A;  3CRK C;  1EOT A;  3MXU A;  2L1B A;  3VR6 A;  3S2H B;  2CQA A;  5I9O A;  2XIW A;  1HRJ A;  5FLX E;  2F0K A;  4NKL A;  3IKJ A;  1F9R A;  4KI0 A;  2K5W A;  4QB4 A;  2QKI C;  3TP8 A;  2O4X A;  3CRL C;  1SJH D;  3M4Y A;  1NR4 A;  1EQT A;  1RTN A;  2A6E C;  4B9X A;  4S3S A;  4IUT A;  1STE A;  2NUC A;  2H1E A;  3KLS X;  2OEO A;  3ITP A;  3TME A;  3W3A A;  4B08 A;  3KF8 A;  2FHT A;  1I3Q B;  3MFY A;  2D9U A;  5FLX L;  1ZXT A;  3RD4 A;  2E2I B;  1PLF A;  5IT9 L;  1ESF A;  3E5S A;  3J7Y W;  1LTR D;  1YNN D;  3K58 A;  3K5O A;  3SHL A;  3M85 A;  1JQY D;  2PW7 A;  3T51 B;  1SEB D;  2RDH A;  4UAI A;  5KRU A;  3KUP A;  4IFD I;  3H94 A;  2L5T A;  5M5W B;  4TKO B;  3U9O A;  5CV5 A;  2B2V A;  3KBX A;  1ESR A;  3QG1 A;  1WD0 A;  3G7L A;  1LV9 A;  2YU9 B;  2F4I A;  1SFO B;  1O80 A;  2R61 A;  3O13 A;  1Q1B A;  1G8Z D;  2B2T C;  4RCN A;  1BCP D;  1U9R A;  1V8Q A;  3L3O C;  4V0B A;  3MEH A;  1Y8P B;  4RFB A;  3BYT B;  1TWG B;  3TP6 A;  2D2C C;  2VNU D;  2Z4H A;  3U9S A;  4F8M A;  3QIA A;  1K8O A;  3SDZ A;  4RH6 A;  5IGG A;  1Y1V B;  3MVV A;  1WCM B;  2TSS A;  2X6G A;  1PDQ A;  2IJ0 A;  2C9O A;  2MPM A;  1PZJ D;  2PNR C;  4XYQ A;  3SK8 A;  4WJW A;  2JXM B;  3Q6S A;  5M3M B;  4KK7 A;  2K05 A;  1BNZ A;  1U4L A;  5IOD A;  4DFA A;  4FF4 A;  5EKI A;  1I4P A;  3OWE B;  5M5X B;  1LAB A;  1XX8 A;  4CJ2 C;  1U4P A;  1NAP A;  1YNJ C;  1SNQ A;  1STB A;  4V19 0;  3OHX C;  1EY5 A;  2ID0 A;  3D6C A;  2Q8T A;  3FDT A;  1OXX K;  3GO5 A;  5BN3 A;  4RHR A;  1HA5 A;  3HS0 C;  2EPB A;  1ZKO A;  1PRT F;  4HED A;  1BO0 A;  1EY4 A;  1AP0 A;  3TN2 A;  4K14 A;  2RBM A;  1FNW A;  1TS2 A;  1ROD A;  2B2W A;  4ZQ3 A;  4AYB B;  4NMZ A;  5CV7 A;  3VR4 A;  2HDM A;  1HFG A;  3NTK A;  1BQQ T;  2XVS A;  2Q8I B;  1JOQ A;  1ONL A;  2NVX B;  2XWJ B;  2C5C A;  2RKS A;  4CJ1 B;  4PQX A;  3S2D B;  3DWP A;  1LAC A;  2SOB A;  3D8G A;  2AQ1 B;  5EKL A;  4ODG A;  1FNV A;  1EU3 A;  3N52 A;  1FD7 D;  1BUV T;  2K03 A;  3GTQ B;  4KD4 A;  1CM9 A;  4F88 A;  1CQV A;  4O42 A;  3VR2 A;  3CQZ B;  5C4Z A;  2CW0 D;  4ZUJ A;  3DWA A;  3D4D A;  5EPJ A;  1O7Y A;  1HQM C;  4A3K B;  4KKU A;  5KNB A;  2BDN A;  3JAM E;  1WTR A;  1PRT B;  2NBF A;  4K6D A;  3I90 A;  3IFT A;  3IL8 A;  2JEA I;  3FVQ A;  4CKB A;  1QOH A;  3OIQ A;  4FVM A;  1WTW A;  1ET6 A;  1HHV A;  5ISR A;  2KOL A;  2DY8 A;  1EQV A;  5TSS A;  3SR1 A;  3P20 A;  3S14 B;  3BVG A;  3EQL C;  5C3E B;  5EQ0 A;  2A68 C;  1QG7 A;  3FPP A;  3BS1 A;  3RMH A;  4FP5 D;  2CVR A;  3HEJ A;  4MIU A;  5C4X B;  3JAM L;  4A3B B;  1TWA B;  4JBW A;  3OPO A;  3OSO A;  2Y0S B;  1GUG A;  5IGD A;  2WKC A;  2E2D C;  1DOL A;  1SYE A;  2J0T D;  4K5X A;  2XRS D;  4C3I G;  5CC4 A;  1AFP A;  1GOZ A;  1VMC A;  4ZAI A;  4HSP A;  5IGE A;  3EA6 A;  2F3V A;  3BDC A;  1CK1 A;  2LMC B;  3KLS A;  4RWS C;  1SND A;  1SYD A;  1B1Z A;  1H9S B;  5CV6 A;  3LWU A;  1MBY A;  4WFN 3;  4RGO S;  4A93 B;  1W6K A;  1EY7 A;  1TII D;  2F0E A;  2F0Q A;  5K36 H;  2IWH A;  2WIN B;  1ILP A;  1TWF B;  5D3I B;  2BDO A;  2BE5 C;  3QB3 A;  5JPN C;  1JCK B;  5IGB A;  5C0X J;  4TSS A;  2NVY B;  1LT3 D;  5C5L A;  2QDB A;  1H9K A;  4WOR A;  1M8A A;  2AUJ D;  3A56 A;  3LWE A;  1Z47 A;  1B2T A;  4R9W A;  3HOY B;  4BBS B;  2KHS A;  4M8A A;  2XSC A;  3RUZ A;  3MAQ A;  2AWO A;  2K5D A;  1QCB D;  2F0U A;  2XWB B;  2JA8 B;  1V1P A;  1R9T B;  4HMJ A;  2CHB D;  1O78 A;  5CYU A;  5KNC A;  5JEA G;  4KKS A;  1X3Q A;  1PTO H;  1MSH A;  4PMC A;  5I2X A;  1NR2 A;  1IKL A;  3L7Z C;  5D3D A;  4A3E B;  1XWE A;  2D5D A;  2E2J B;  2F0V A;  2DN8 A;  2PQE A;  2XNA C;  4XT3 B;  2EOT A;  3I4N B;  4NDX A;  3NHH A;  1S5D D;  3HRZ C;  1PTO D;  1EIG A;  1IL8 A;  2F0O A;  5DAU A;  2E74 C;  1TVX A;  5D65 A;  5KGU A;  5LL6 S;  1A3V A;  4L8J A;  1KAB A;  2NN6 I;  3DWQ A;  1EWH A;  2BA0 A;  4U67 3;  1F9S A;  1ENF A;  4FXK C;  2B2V C;  1EY8 A;  2XRQ D;  4C3I B;  1M4V A;  3I73 A;  4KHZ A;  4KHV A;  2EYM A;  5EPL A;  4I65 A;  5E4W C;  4ZUI A;  5K5P A;  3X3N A;  4A3F B;  1G91 A;  1I6V C;  4KY6 A;  4CKE A;  3BVZ A;  4A3M B;  1STY A;  3PO3 B;  1BXT A;  4KKT A;  4LJZ C;  5EGT A;  1GUO A;  2SNS A;  1EY6 A;  2EE1 A;  2KVM A;  5I2Y A;  1F9Q A;  2A6H C;  3FMC A;  2RVL A;  3OMC A;  3GTG B;  2EYH A;  1QB5 D;  1TY0 A;  2O5I C;  3NP8 A;  5EJW A;  3J7A F;  4OIK A;  2PZW A;  3S1M B;  2AWN A;  1OXS C;  3M3Y B;  2VB3 X;  5ELF A;  1JWU D;  5M9O A;  1SE2 A;  4KJN A;  4MHE A;  4ABN A;  5J39 A;  5CR3 A;  5FO9 B;  3J7A V;  2L9H A;  3H3V C;  3GV6 A;  2DNE A;  4CGY B;  1EY9 A;  1IYU A;  1LTA D;  2B2W C;  4LMQ D;  3I72 A;  1EL0 A;  4XTC S;  2F0P A;  3GD7 A;  1PXU A;  4XQQ A;  1B9N A;  3ERQ A;  4KJO A;  3V2T A;  1R4Q B;  1GUT A;  5M3F B;  1PRT D;  4IAL A;  3K57 A;  4ZK9 B;  1Y1W B;  2RDG A;  2B8G A;  1VCI A;  4N9P A;  4ULL A;  1B3A A;  3NUC A;  4A3D B;  1PMR A;  5LL6 X;  2F0J A;  1AW7 A;  1WVL A;  1XYI A;  2IX0 A;  1STA A;  1SNO A;  4L6T B;  1TS3 A;  3R8B A;  4DNT B;  5C3W A;  5CV9 A;  4KTA A;  3BG3 A;  1OXV A;  2K33 A;  4ZRZ A;  1EFI D;  1PZK D;  1E0B A;  4E6I A;  1GUW A;  1VDZ A;  4X3S A;  1EEI D;  4ME5 A;  3R93 A;  2QEJ C;  2EYP A;  2KCN A;  4FXD A;  4IUN A;  2NWG A;  1TT2 A;  2F1M A;  4NP5 A;  4K8J A;  4UDU C;  2AUK A;  4PV1 C;  4X3K A;  5EBC A;  1GXD C;  4H13 C;  2B2U A;  2FMC A;  1IW7 D;  2NN6 G;  4HAE A;  3C3L A;  4RGT A;  1TWH B;  1PZI D;  1X3P A;  3DMU A;  2D62 A;  3A8K E;  3T16 A;  3K6O A;  3LNN A;  4G7O C;  2L11 A;  2A5H A;  1B44 D;  1OXU A;  3I3C A;  3L9A X;  1YNN C;  2PMZ B;  4JK1 C;  3K5L A;  3M7G A;  5COR A;  3OIP A;  3VYU A;  5T1I A;  4HCE A;  4G4K A;  4PMB A;  1VF5 C;  2RQX A;  2WII B;  1PYW D;  5KND A;  3FKI B;  2DY7 A;  1UAP A;  1TY2 A;  4FXG C;  2BCO A;  4ZKC B;  5AFW A;  2F0F A;  4IFD J;  2JA7 B;  4C2M B;  1NUC A;  2AQ2 B;  1A3T A;  1KDC A;  2X6L A;  1D5X C;  2EY6 A;  4PMW A;  2N88 A;  1BCP C;  1LTG D;  4KV6 A;  3VYS A;  2K5Q A;  2IPK D;  1CZW A;  3J80 E;  1SDF A;  2NTT A;  1D1K A;  5CMD A;  3H09 A;  2G9D A;  4WRD A;  3HZX A;  3TZU A;  5C3X A;  4XYO A;  5BN5 A;  4IFD H;  2SNM A;  1U4M A;  1SMY D;  2IW3 A;  5I9P A;  1ET9 A;  3GP7 A;  4DAY A;  1DJR D;  1WTX A;  4CHT B;  4RGN A;  3V96 A;  4K2K A;  1ZYR D;  4IUQ A;  5G3L F;  3Q24 A;  1SE3 A;  2BOS A;  3VA7 A;  1BR9 A;  1EZ8 A;  2ICE C;  5A2Q E;  3S9W A;  1GUS A;  1Q90 A;  3J80 L;  3P7J A;  3NBI A;  4DXG A;  4H0L C;  5KIX A;  4N9T A;  3VYT A;  4Q0F A;  1MGS A;  3MXN A;  1D6E C;  1O7Z A;  3D4R A;  1G6Z A;  1E2W A;  1TKW B;  1GUN A;  1CA5 A;  3FRP B;  5EPK A;  5C44 B;  3K5M A;  2OXP A;  2O5J C;  1V1O A;  1CA6 A;  5NUC A;  3Q0A A;  1WD1 A;  4RKB A;  4ZKB B;  1F77 A;  1QWY A;  2YYZ A;  3GTJ B;  2Z4I A;  5CV8 A;  3OW7 A;  2B2Y A;  3K0Y A;  1SNM A;  2PCF B;  5JEA J;  5C4H A;  1HTP A;  4FNF A;  1ENA A;  2FJ2 A;  1JOR A;  2K01 A;  3C46 A;  5IGF A;  2CW0 C;  2FMM A;  2KJX A;  4K5V A;  3D4W A;  1B53 A;  4DF7 A;  1AEX A;  3P75 A;  2WAQ B;  3SK5 A;  3K7A B;  3MC0 B;  5EKK A;  4HTH A;  3NWT A;  3D31 A;  2WAC A;  2EJG C;  2NVT B;  3VR5 A;  1S5C D;  1LT4 D;  3HOU B;  1U4R A;  2NYZ D;  3NXW A;  1HCZ A;  1Y69 U;  2EYJ A;  4RCO A;  2F0I A;  3DHQ A;  4K6L A;  5DEH A;  1BCP F;  1MD2 D;  4NW2 A;  3S17 B;  2XN9 C;  3QOL A;  2IL8 A;  2EYL A;  5FOB B;  2ENB A;  5FKA C;  4FF2 A;  4GZY C;  1LTI D;  3T56 B;  4EGV A;  4KMU C;  4K5W A;  3QJY A;  2EZV A;  3S15 B;  2JSO A;  2EYO A;  2B2T A;  3ONA B;  2PO4 A;  3M4O B;  4IUP A;  4MN3 A;  1DZ1 A;  3H6M A;  2A73 B;  3HP3 A;  1Z7T A;  1S5E D;  5FO7 B;  1BOS A;  1UEA B;  1E2V A;  2I46 A;  1A15 A;  2LY7 A;  5FK9 C;  1ICW A;  3MHB A;  5CGK A;  3OWF A;  5DM7 3;  2ZXP A;  3GTL B;  3A54 A;  1LTT D;  2HCC A;  3BDO A;  4J8Q A;  2F0N A;  1KNE A;  4XIG S;  1EYC A;  4DN4 M;  3K5N A;  1SXT A;  1Q8I A;  4M1U B;  1DOK A;  4DAV A;  2MJ8 A;  1KLU D;  5C0X H;  1PFN A;  5JOB A;  2IX1 A;  1ENC A;  1JC7 A;  1ZEQ X;  4C1N I;  1TR5 A;  4C3H B;  3A8J E;  4C1N K;  5JJZ A;  1RD9 D;  2SEB D;  4H44 C;  4KN7 C;  4I7Z C;  1JWM D;  4QCL A;  2LFN A;  1V1P B;  4BA2 I;  1FGB D;  1JOO A;  2JP1 A;  1RJT A;  5KEE A;  4RHS A;  2B2U C;  1TQO A;  1HA6 A;  4RGM A;  3GTP B;  4HCS A;  3NTH A;  1GJX A;  3EFX D;  5KYL A;  4OO1 H;  1D2B A;  1JR0 D;  1HUN A;  4G7Z C;  3K59 A;  3A8I E;  1SBB B;  5CV4 A;  1UNS A;  2BA1 A;  4BWG B;  2KED A;  3CHB D;  1PTO C;  2KA7 A;  4C3J G;  1I4Q A;  1F9P A;  4QF4 A;  4X3T A;  1T5X D;  1C8C A;  1TS4 A;  1J9O A;  4QUC A;  3DEO A;  3GQB A;  3R2I A;  5K36 G;  1IYV A;  4XDX A;  3SEB A;  1JE4 A;  1DXM A;  4Z9C B;  2JEB I;  3X3M A;  3I8Z A;  5JVH 3;  3NBH A;  1CTM A;  3TBI B;  3S16 B;  2HCI A;  2WV6 D;  5COY A;  3RZO B;  1J8I A;  4XXE A;  4BS9 A;  3MFG A;  2F0L A;  3A7A B;  3ND9 A;  2B39 A;  2X69 A;  1Y8O B;  1HTL D;  2MUY A;  2EYF A;  2B8F A;  3TZD A;  3NTI A;  3QO2 A;  5DM6 3;  4IQZ A;  1A2U A;  1Q1E A;  3KBG A;  3C1F A;  5CBE E;  1EU4 A;  3F2U A;  1R4P B;  3BVM A;  2F0W A;  2A69 D;  3IFD A;  2QF7 A;  1B4O A;  1F2L A;  2NTS A;  2FFK B;  4F7X A;  4DNR B;  2KEE A;  1SYC A;  1Q3L A;  4BY7 B;  1X32 A;  4KN4 C;  5JAV A;  4ZYS A;  4DGZ A;  4K8I A;  2M2L A;  3WDN A;  3GTK B;  2RSO A;  3NE5 B;  5LHY 1;  4XT1 B;  4FYD A;  3AB9 A;  3PO2 B;  3NQI A;  3MTS A;  5M5Y B;  5G3L D;  1QNK A;  2KEC A;  1GHJ A;  3W2D A;  2F03 A;  2HQE A;  2A6E D;  4G57 A;  1TU2 B;  5I6W A;  2VUM B;  4L63 B;  1QIL A;  3PUZ A;  1KDA A;  1OO9 B;  1A3U A;  2F0H A;  2EDG A;  3EJI A;  5A35 A;  3KK7 A;  1PRT C;  4O1N A;  4YIJ A;  5E4X A;  5BN4 A;  4EQO A;  5IT9 E;  3J81 E;  3SVM A;  1H9J A;  2B2Y C;  2PYK A;  3HOX B;  1RCV D;  1S5F D;  4G7H C;  4OIJ A;  3A55 A;  4C3J B;  1PFB A;  1C4Q A;  2NZ1 D;  1PTO F;  5J22 A;  4CJ0 B;  1KAA A;  1CZG A;  1LLR D;  3RZD B;  4FO2 A;  4R8I A;  1DCZ A;  2M00 A;  5HUR A;  3D3R A;  3GTO B;  2WP8 J;  4Y7N B;  1STG A;  1DD2 A;  2EY1 A;  1L0X B;  2B63 B;  3AU7 A;  1I4G A;  1SNC A;  4J6H A;  3TDQ A;  3FPU B;  1DM0 B;  4EQN A;  1WTO A;  3TP7 A;  2WB1 B;  3WOE A;  1H9M A;  3J81 L;  3MZ5 A;  3MWY W;  4A3J B;  1EYD A;  2L55 A;  2MGS A;  1IW7 C;  2OF1 A;  1STN A;  3VA5 A;  1G29 1;  4KY5 A;  1LO5 D;  2ZXR A;  4DK1 A;  4RA8 A;  4OL7 A;  1RHP A;  3MXP A;  1AZP A;  1D5M C;  3HGB A;  1EIH A;  3SXH A;  1EYA A;  1O7L A;  1PTO B;  1DON A;  1II3 A;  2Z8L A;  2NVQ B;  4IZ8 A;  2HUG A;  3V05 A;  4BY1 B;  1NCV A;  4EQP A;  5I6Y A;  2EVB A;  1YNJ D;  1I4X A;  4K2L A;  3ERO A;  2Q8R E;  3CKI B;  2MP1 A;  3HOZ B;  1EZ6 A;  2LKV A;  3EVQ A;  3C1E A;  2EJF C;  5I4D A;  1DYQ A;  3HOW B;  3CU7 A;  1IKM A;  2L4N A;  3MXG A;  2JA6 B;  4CKC A;  5IOC A;  1G2T A;  2DNC A;  2MHV A;  5HGT A;  2LS0 1;  1ML0 D;  5CBA E;  2Z1C A;  3VYR A;  1RKN A;  4RKL A;  3BYY B;  3Q22 A;  1SMY C;  4ID6 A;  5FO8 B;  4ILW A;  3DUZ A;  4DAP A;  2FIN B;  1QNU A;  3G6J B;  2KUM A;  5J1Z A;  4DA2 A;  1SNP A;  1ZYR C;  3MA2 B;  2R93 B;  1K8M A;  2ICI A;  4EVO A;  3SE0 A;  4DK0 A;  2GA4 B;  1RTO A;  2TMP A;  3NK9 A;  1CI3 M;  2ZXO A;  1XTC D;  2R92 B;  1LTS D;  2F0D A;  1QJO A;  1D5Z C;  1PFM A;  3PIP 3;  5EBD A;  3A7L A;  5A2Q L;  1C48 A;  3HKZ B;  1LT5 D;  4C3H G;  3AMU A;  2F0S A;  2IX3 A;  2E2H B;  1SE4 A;  5KYI A;  4HN7 A;  4XQN A;  3NWS A;  2J4X A;  1XXG A;  5C6A A;  1I50 B;  3IAY A;  2PZT A;  3QOJ A;  1MI2 A;  3H91 A;  2QIL A;  3I4M B;  4P2C B;  3S1Q B;  3N6R A;  3R2T A;  2KQ3 A;  1KTK A;  1QE6 A;  3PUY A;  2A68 D;  5ELE A;  3PUW A;  4A3I B;  4FF3 A;  1D1I A;  4QUF A;  1KLG D;  1S5B D;  1E2Z A;  4KD3 A;  1SYG A;  2VXW A;  2K6A A;  5JEA H;  1T5E A;  1HFN A;  2M9V A;  1ILQ A;  2RSN A;  1BBX C;  1BDO A;  2IT1 A;  5ELB A;  3C2P A;  4IFD G;  1FNU A;  1I6H B;  1HUM A;  2PZU A;  4H7B A;  1HQR D;  3DM1 A;  2E75 C;  3I91 A;  2R7Z B;  3H0G B;  3DXJ C;  3NPP A;  1AN8 A;  1CFM A;  1EWC A;  2AQ3 B;  2SDF A;  4LAA A;  3PIO 3;  4HMI A;  2G9H D;  1AZQ A;  3DEP A;  1K83 B;  2JYO A;  1H9S A;  4U68 A;  1L0Y B;  1GHK A;  5ELD A;  2QCP X;  3T53 B;  3SK4 A;  4Q5V A;  3FEW X;  1KDB A;  3I70 A;  4QMG A;  5C0X I;  1JWS D;  1B50 A;  2F0T A;  4FF1 A;  3Q23 A;  4BA1 I;  3E0J A;  2BE5 D;  1F2Y A;  3NSW A;  1CHQ D;  1A2T A;  3TP5 A;  3BZD B;  2R6G A;  4R8N A;  1Z6H A;  3PV0 A;  1FR3 A;  1WTQ A;  1SYF A;  2L0C A;  4IUR A;  4X3U A;  1B9M A;  1BF4 A;  2NB0 A;  4CBV A;  1BCP B;  3HG9 A;  3VR3 A;  1HPC A;  3OOC A;  5DNF A;  3PUX A;  2A74 C;  1HXY D;  5E3F A;  4OO1 I;  2WKD A;  3NQT A;  2JE6 I;  2K32 A;  1SSO A;  2HDL A;  4OHJ A;  1STH A;  1EY0 A;  4J1M A;  1JIC A;  1V43 A;  1SAP A;  2PW5 A;  1RDP D;  1Y8N B;  5IGC A;  3T4A C;  4TRD A;  3QWN A;  1MSG A;  3OMG A;  4DXF A;  5C4J B;  4PNY A;  2O2L D;  1F2M A;  1LTB D;  4C56 C;  4HR7 B;  4DU9 A;  1I4H A;  1OXT A;  3RLF A;  4IN3 A;  2ZT9 C;  3GTM B;  4ZLT F;  1VF7 A;  4QIW B;  3HOV B;  1DOM A;  3M7N A;  3UI2 A;  3GV3 A;  1EEF D;  2RDF A;  5E1F A;  2K28 A;  3R3O A;  3KLR A;  4LK1 C;  2K7V A;  2J7Z A;  2I07 B;  1CHP D;  3E6Z X;  2PPB C;  3D6W A;  5T1G A;  4IUU A;  5F2D A;  1JOK A;  5ELC A;  3T13 A;  1NSN S;  3BDL A;  1SJE D;  1I4R A;  3LX0 A;  1FYC A;  4RAU C;  1G2S A;  1Q12 A;  2A6H D;  2F0M A;  2VB2 X;  1W6J A;  1F2Z A;  1RF2 D;  1CQF A;  4XQJ A;  3WOF A;  3P1H A;  1JB3 A;  1KNA A;  3URY A;  3SK6 A;  2K04 A;  2K1B A;  1S4Z A;  2EY2 A;  3I4L A;  1VMP A;  2N55 A;  5IIF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...