2KECA

Structure of sdf-1/cxcl12
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
68
structure length
68
Chain Sequence
KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine
molecule keywords Stromal cell-derived factor 1-alpha
publication title Monomeric structure of the cardioprotective chemokine SDF-1/CXCL12
pubmed doi rcsb
source organism Homo sapiens
total genus 13
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2009-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2kecA00
1LV9A 1WTXA 1ML0D 5DNFA 1EQTA 4ZLTF 1QE6A 2K05A 2B2TC 3HP3A 5AFWA 1B50A 4ZKCB 1MGSA 1NR2A 1F9SA 2KUMA 3P7JA 5D65A 3MTSA 2L4NA 1BNZA 1HFNA 2HDMA 1BBXC 2KEEA 4UAIA 1MSGA 4IURA 2RVLA 4X3SA 1WTOA 1WTPA 3KUPA 1J8IA 5COYA 1SDFA 3H91A 1KNAA 2KECA 5EPKA 1HRJA 2B2UA 2K1BA 3FDTA 1ILQA 2L12A 1U4MA 1F2LA 1QG7A 2DY7A 2B2YC 2NWGA 3LWEA 4ZAIA 4O42A 1HHVA 1RTOA 4R8IA 1DOKA 1AZQA 2D9UA 2RSOA 3GV3A 1HUNA 5EJWA 2Q8TA 1PFBA 1NR4A 1DOLA 4U68A 5E4XA 1WD0A 2L9HA 1EL0A 3F2UA 1F9QA 1RHPA 1SAPA 2N55A 2L1BA 2IL8A 2MJ8A 2FINB 1VMPA 2Q8RE 4XDXA 2B2VA 3DEOA 1X3PA 5E4WC 4CJ2C 3SVMA 1WVLA 3IFDA 1WTVA 4R9WA 1C8CA 3IL8A 1WTWA 2NZ1D 3MWYW 1EIGA 1NAPA 2HDLA 2NYZD 4IUQA 1S4ZA 3DM1A 4X3TA 4LMQD 1B53A 5CORA 2EE1A 2B2TA 1IKLA 2RSNA 4RA8A 5CBAE 1NCVA 1J9OA 1ZXTA 4HAEA 1E0BA 1M8AA 4OIKA 4CJ1B 1O80A 1B2TA 1A15A 1JICA 1MSHA 1HUMA 2FHTA 2X6GA 3I8ZA 2HCCA 3QO2A 4IUPA 3R93A 3UI2A 1CM9A 1RTNA 1X3QA 2KVMA 5EPLA 3TZDA 4OIJA 1EIHA 1ICWA 1IKMA 3G7LA 1BF4A 1RJTA 1SSOA 2B2YA 4DN4M 2JYOA 2M2LA 1GUWA 1IL8A 2KOLA 1DZ1A 1F9PA 2B2WC 4MN3A 2FJ2A 2X69A 1PDQA 1G2TA 1G6ZA 1U4LA 4QUFA 4MHEA 1B3AA 2X6LA 3KBXA 2VXWA 1AP0A 1Q3LA 2K28A 4XT3B 3Q6SA 4HCSA 2CVRA 5T1IA 2EOTA 1X32A 2MGSA 1EOTA 1WTQA 1DONA 5CBEE 2HUGA 2RA4A 4IUUA 3I90A 1F9RA 2K04A 1DOMA 4QUCA 4HSVA 3FPUB 1QNKA 1PFMA 1HA6A 4XT1B 3DEPA 1BO0A 3ONAB 2L11A 1B4OA 1CA5A 1PLFA 4ZK9B 3TN2A 2KEDA 4RAUC 1ILPA 2BDNA 3I91A 5T1GA 2B2UC 2SDFA 1XYIA 2HCIA 2FMMA 1HFGA 1KNEA 1MI2A 1O7YA 5EQ0A 1XX8A 2FFKB 4X3UA 2J7ZA 1ESRA 3GV6A 5CMDA 2JP1A 4IUVA 4ZKBB 1RODA 2DY8A 4X3KA 1VMCA 4NW2A 1U4RA 1JE4A 2N88A 2MPMA 4IUTA 2B2WA 5D14A 4RWSC 1CA6A 1G2SA 1TVXA 4CJ0B 5JJZA 2K03A 2MP1A 3D6WA 1U4PA 3I3CA 1WD1A 2R3ZA 3N52A 1AZPA 5EPJA 2B2VC 1G91A 1PFNA 4HEDA 2K01A 5EKIA 1O7ZA 1WTRA 2EPBA 2H1EA 2XIWA
chains in the Genus database with same CATH superfamily
2N78A 2UUBL 2JA7H 2PZTA 2XNAC 2Q8IB 5I4DA 1Q7YC 2RF4A 4A3DG 2F0FA 1I6VC 3STBC 5M3MG 1LT4D 4JCVE 1CSQA 4JPBW 1N33Q 2MO0A 1WTOA 2F0KA 3I4MB 2HHHQ 4WORA 3OHXC 3CRLC 3OW2A 1N33L 1KC8C 5HURA 5KGUA 3A7AB 4K14A 1VQ6A 3M9BA 4DV0Q 2HHHL 2EJMA 1CSPA 1RHPA 4KHZA 2A6ED 4DXFA 4DV0L 1RIPA 5IE8A 3K57A 3DEOA 3O13A 4DV7L 2F3VA 4JBMA 1C8CA 3DM3A 4BBRG 1IKLA 3PF4A 3PCOB 3E0JA 2A74C 1D1KA 5C3EB 4DV3Q 1E0BA 4OIKA 4A3DH 2F0IA 5M3MH 3UI2A 5JAVA 2HQEA 3SGIA 1WCMG 2B2YA 4LUOA 2E8GA 4XYQA 1GUTA 3BG3A 1E2WA 3NBHB 4KHVA 5C44G 4R4OA 1BCPF 1SN8A 3WDNA 2K28A 2Y0SB 1SROA 5T1IA 1B7YB 3TP7A 5ELDA 1X3EA 3HOYH 2RCFA 1DOMA 5LMNW 5FLMG 1X55A 3W1GA 3EN2A 4X66L 2L11A 1B1ZA 1GUGA 1II3A 1S5DD 2BH2A 3QJYA 4K5WA 4JK1C 4LFCL 2K50A 1GJXA 3BYTB 3SK8A 2EYLA 1L0XB 4CDEC 5C4XG 1Q8KA 2DJGC 1WCMH 5D14A 4RWSC 4JI8Q 3CCMA 4IO9A 3Q23A 1WTHA 1TS4A 3OIPA 3I73A 4GLAC 3HOYB 4POFA 1PFNA 1XMOQ 4JI8L 3S16H 3NUCA 1JMCA 1VQCA 1EQTA 2XRQD 1IZ6A 3I56A 2KCTA 3MTSA 3RN2A 4DR7L 1XMOL 4HMIA 2R92B 3JC66 2LFNA 5FLMH 1BXTA 1BVSA 3D3RA 1X9NA 1KDAA 3MVVA 2CHBD 2H5XA 4EQNA 3AYHB 1LTGD 3HKZE 2D5DA 1IXRA 2K75A 1AZQA 4JG2A 2YTXA 1Y1WB 1HZCA 3HGBA 4BBSB 2GVAA 2R61A 4LF7Q 1W2BA 3U50C 1PH7A 4X62L 2AMCB 1WVLA 3FRPB 4QGUA 1PZID 4IALA 1G51A 2E2IH 3C1EA 4O2DA 4AYBB 1EIGA 4LF7L 4RGOS 2XRSD 2MQHA 3S17H 2I46A 2PZWA 4X65L 1Q82C 4HTHA 3J81E 4BWGB 1IYUA 1K3BC 3IAYA 1ET9A 4IJLA 3OWFA 3HOZG 2ZXOA 1EIHA 1BBUA 3SXHA 1PTOB 4DV6L 4MN3A 2VB2X 2PW7A 5J22A 3S1QH 1VQ9A 1EY4A 3JAME 3Q6SA 1DM0B 5BN4A 1QZHA 4JOIC 4BY1G 2WKCA 2E2IB 2OEOA 4ZRZA 2ZJRA 1HZBA 4IUUA 4KLKA 3H94A 4LUVA 2WV6D 1QNKA 5JVG3 3S17B 1FNWA 1HA6A 4K6LA 4IN3A 2AQ3B 3Q8DA 4R4TA 3EJIA 4ZK9B 1TWGB 2RBMA 5JPNC 2PCFB 3I91A 4CKCA 3RNUA 1KHIA 2KHSA 3IRBA 3AMUA 1XX8A 4UHVA 3DUZA 1BDOA 3HOZH 3HOWH 4A93H 1JR0D 4OGQC 2YTVA 3PMFA 2CKZB 4NDXA 2A6HD 3I4OA 3N52A 1XPRA 3H3VH 3TP5A 2E2JH 5C5LA 5FO7B 1JWSD 3WOEA 1SYBA 1C7YA 1GHJA 5A2QE 1H95A 1F9SA 4BY1H 2GA4B 2RVLA 1Q86C 4DUYQ 1KRSA 2L12A 4A3MB 2B2YC 4B9XA 3HG9A 3NTIA 3QWNA 3HOUG 1RTOA 5I9PA 5ELNA 3HOWB 2LXKA 4A93B 2SEBD 1PFBA 4DUYL 2L9HA 3U4ZA 1STEA 2E5LQ 4DGZA 4R4IA 2L0CA 4CJ2C 1WTVA 4X6AH 1R4QB 4MTKA 2E5LL 2OTJA 1L1OB 1TWAH 3MA2B 4J1MA 1CT1D 4UP9A 3HOXB 4E6IA 1SYCA 1K83H 2NTSA 1EUJA 5EGTA 5IGGA 4HJ9A 3CCVA 3FKIG 3NENA 4WRDA 2Q2TA 5LMUL 2Z6KA 3KBXA 1EY7A 4UP7A 1AP0A 2EY5A 2WAQB 3CC2A 1Y8PB 3S9WA 3AEVA 1SXTA 2IWHA 2I07B 2EOTA 4KKSA 1WTQA 5CBEE 4JYAQ 1VQ8A 3AFPA 4KD4A 5KRUA 1KABA 1PLFA 4NXMQ 4IZ8A 1BCPD 3UDGA 4Y7NB 2JQOA 4HCEA 4O1NA 1MI2A 2JA8B 4IFDH 1Y1VB 3HRZC 2NZHA 4ME3A 5IT9c 1I4HA 3A56A 4ZKBB 2IX0A 1EQQA 1SE3A 1SYDA 3D6CA 2G9DA 1SBBB 5JJLA 1JE4A 2MPMA 2O5JC 1D5XC 3FKIH 2EYFA 2B2WA 2PZUA 3D4WA 3S24A 5F2DA 1X3FA 5ELBA 1Z6HA 1T5EA 2Y0SE 2EYMA 5DEHA 3P20A 3GTLH 2F0OA 2JN4A 3CMAA 3QR8A 2OF1A 4CDFC 2A68D 5ISRA 1WFQA 3PQIA 1NR2A 3OTOL 2KQ3A 4OONA 1SMXA 3QOLA 1PH4A 3C46A 4UP8A 2HIXA 3GQBA 5DM73 4F8MA 5LL6X 4FF2A 2P5ZX 4BA1I 1HRJA 4H02A 1Z47A 3CCUA 1HTPA 2RHQB 1KLGD 1KDBA 1CKNA 3IFTA 1DYQA 4DAPA 3A8KE 3I72A 5EJWA 3S1RH 4U68A 1EOVA 1SRUA 5E4XA 5DLQE 4Y52H 5KYLA 3G6EA 2YU9B 3GTLB 2QGQA 1G6PA 2VY3A 1M1KC 3MXNB 2ATWA 4J6HA 4F88A 3CCEA 3HKZG 4G57A 2B2TA 2EE1A 3SK5A 1SFOH 1HPCA 3BVMA 2Z1CA 3STBD 1UE1A 1CI3M 1LTLA 3MFGA 5G3LF 1AE2A 2F1MA 1Q8IA 1RTNA 1BR9A 1V1PA 3T13A 4LW1A 4R1JA 1I3QH 1JOOA 1S5BD 4MNOA 1BF4A 3J80i 1V9PA 3VYSA 4DR6Q 1VQGA 1OXUA 2EXZA 2DJFC 1S3OA 2KCCA 1FL0A 5K5PA 3M4OB 4OO1G 3HFZB 4GS3A 3TP8A 4L63B 3I90A 1F9RA 4QUCA 3FPUB 1QB5D 1C9OA 4C2MH 3I4NB 1BBWA 4A3JB 2UXBQ 3L9AX 1PVOA 1SFOB 2R93G 1VQFA 3GP7A 4LF4Q 2PI2A 4FF3A 2FFKB 1VQKA 2A6HC 1C0AA 1XXGA 1VQJA 3VA7A 1HJPA 2I5MX 4C3HG 2C5CA 4DR3Q 4S3SA 5FLXL 3N6RA 1NSNS 3BZKA 3BS1A 4A4IA 3BVZA 4NXNL 3P1HA 3GTMH 5HY6A 4PMBA 2WACA 2MP1A 1TXYA 4BY7G 4DR3L 4ID6A 2Z4HA 3K5LA 1QILA 2F0UA 2E76C 3ULJA 4DNTB 1E24A 4A3IH 4JBKA 3CKIB 1W3SA 4LFAL 2NZOA 5HGTA 1HNWQ 3FPPA 1MGSA 1TWCB 3F2BA 4OO1H 1RD9D 1U5KA 4KY6A 2MFIA 1Q90A 4QF4A 1IYJB 4P74A 3A54A 3KDFB 3C2PA 1K0RA 2R93H 4A3EB 1FD7D 4PZ7A 3TMEA 5JEAG 1I50B 3NWTA 4A3BG 4B3MQ 4QCLA 2Z6KC 1X54A 2CWPA 3DMUA 3CQZH 3F2UA 4C3HH 1LLRD 2N55A 3U9OA 1D6EC 3H3VC 1EY8A 2H4OA 1WYDA 3OSOA 1JE5A 1TQOA 3SVMA 4B3ML 3GTQB 2B8GA 2OXPA 3S1MH 4A3IB 4BY7H 4GZYC 4X64Q 2SNSA 1WJJA 5C4JH 3ZJYC 1I4PA 1TY0A 1W6JA 1H9MA 3FP9A 1CQVA 5CV7A 4HAEA 5JVH3 4AQYQ 3KDFA 4X64L 2FHTA 1Y8OB 4G7ZC 1STNA 2VUMB 1Y69U 2E2DC 2NVQB 1VQNA 3CAMA 3TP6A 1GUWA 2JYOA 1CKOA 4DNRB 3M4YA 3OMGA 2A5HA 5IP7G 4GLVB 2B63H 1I4RA 1RDPD 2B2WC 1G6ZA 2NVYB 4AH6A 3CQZB 4EVOA 3PUVA 3I4MG 5JPMC 2AHOB 3AQQA 4A3BH 4GN5A 2PNHA 1ENCA 3NQIA 1DONA 1NNXA 3EBEA 1PTOF 5IGCA 4JI3L 3K0YA 3P75A 3ZYYX 1JOQA 4XT1B 4YHHQ 2IJ0A 2AQ1B 3GTGB 2BDNA 1D5ZC 3SR1A 5M5WB 1IW7C 1KNEA 5M3FH 3AU7A 3CPWA 3U4VA 3KLWA 1KRTA 1VMCA 1U4RA 3PIP3 2B63B 2O2LD 1TVXA 2ZTCA 5IP7H 3J81j 3RR5A 1I94Q 1FJGL 1WTXA 2NTTA 3I4MH 2CW0D 3KF8B 1OXXK 2B2TC 1XTCD 4IPGA 2D0PA 2L4NA 1FYCA 1V8QA 1HR0Q 1J8IA 1HFNA 1WTPA 4RFBA 4QB4A 4V0BA 1TY2A 2Y0SG 3NEMA 1VCIA 3LGJA 3LWEA 3TBIB 2QKIC 1JC7A 1HR0L 1NMFA 1S5FD 3FVQA 1E1OA 5CV5A 3DWAA 2RDGA 5E3FA 4NPSA 2D9UA 2F52A 3IKJA 1VS0A 2K5DA 4JI5Q 1A6XA 1AH9A 3KBGA 4ZUIA 4XDXA 3A7LA 3D8GA 3F8TA 2KJXA 4RGMA 4JI5L 3CMEA 2PO4A 5C3EH 3KF8A 4IUQA 4QMGA 1YHQA 3NHHA 4ILWA 4LF5Q 3K81C 3V05A 2QDLA 5IT9E 2VQFQ 2ZJPA 1S5ED 3SEBA 4HIDA 2F0HA 2Z0SA 3GD7A 4RKBA 4DV7Q 2CWAA 3HOYG 4TVAB 1PH9A 4LF5L 1I6HH 2VQFL 3E6ZX 3GDEA 2R92G 5IYBH 1A2UA 1VQEA 4DR4Q 1U9RA 1HXYD 1PRTB 1X32A 3NP8A 5G3LD 1EOTA 4PQXA 1JJ2A 4OXPA 1FR3A 4DR4L 5A35A 1B4OA 1MJCA 1Y1WG 2ES2A 5CYUA 4MZ9A 2A1AA 4BXXG 1HFGA 2PI2E 3C3LA 4YCWA 4GOPB 1EY5A 2ZXPA 2LY7A 5GQOA 1RODA 4OEMB 4V190 5GAGC 4DV5L 4AYBG 4NW2A 1I6HB 1PH5A 1EZ8A 2GN5A 4P2CB 3GTJB 5C6AA 4X66Q 3EFXD 1CA6A 3PO2B 3D6WA 4JVZA 4HN7A 3PO3B 2SOBA 1HH2P 3RUZA 4NMZA 4LFCQ 2R92H 1HQRD 2IW3A 1QE6A 1DCZA 4ZKCB 1N34L 4U673 1Y14B 3PIO3 2HDMA 1VF7A 4IURA 3EA6A 1KNAA 3E3XA 2XTIA 1FVIA 2PNRC 1MD2D 2E74C 1IHZA 4EGVA 1Y1WH 3NBHA 1PH3A 4BBSH 4BXXH 1H9RA 5C4HA 3J80c 3SDZA 2RSOA 2Q8TA 4DR7Q 1WI5A 4OWTB 3OW7A 5BN5A 1GOZA 3T1HQ 4GKKQ 4K8IA 3CXCA 4DK6C 2NZ1D 2HD3A 5GAHC 1X6OA 1NBWA 3T1HL 1D2BA 4R8NA 4GKKL 1UWVA 3OPOA 2LSSA 4DV4Q 4H44C 1TIID 1L2FA 1ESFA 3ND8A 4DV1L 1PTOH 2FXQA 5IOCA 3CPFA 3RZDB 2J4XA 5DAUA 3R93A 4DV4L 4G4KA 4X62Q 2ZJQA 3J7AV 3TZDA 5D3IB 4HIMA 1A3VA 3K59A 2F0NA 1P8LA 1F9PA 2XGTA 3M7GA 4JBJA 2FJ2A 4X65Q 4PMWA 3M3YB 5IGEA 1VQAA 2L55A 1LT6D 1SYEA 1JT8A 3W3AA 3SHLA 3CCJA 1TWGH 4J15A 4C1NK 4A3MG 2NBFA 2CFMA 4DV6Q 1PFMA 4QY7A 3DEPA 4IJHA 2O5IC 3HOWG 4A93G 3I55A 5FK9C 2JSOA 4I65A 1EFID 1AN8A 4F87A 4CHTB 5E7NA 3H0GH 3T53B 1QUQB 5E1FA 1PTOD 3BDLA 4RHSA 2F0WA 4C3JH 1N9WA 1W6KA 4LAAA 2QEJC 4LK1C 2CH4A 5JEAJ 4QIWE 1T5XD 2UUCQ 5M9OA 2CW0C 3NELA 4UPAA 1G91A 2UUCL 2IX3A 3ER0A 3B6YA 4PMCA 2PQAB 4RCNA 2F3IA 1SNCA 4OX9Q 2ZXRA 5D65A 2UU9Q 5IY0A 1QJOA 2JEBI 4A3MH 3T56B 1XMQQ 2EJGC 1SJED 3C1FA 3A5UA 2WAQG 3FHWA 4OX9L 2UU9L 3H0GB 3QOJA 4DR2Q 1A3UA 4LF9L 1QUQA 4KK7A 1NE3A 1TS3A 1XMQL 1QVCA 4C3JB 5JOBA 4A3GB 3RD4A 4FO2A 1PZKD 5K36G 3W1BA 2KA7A 4DR2L 1DOLA 1YITA 1OXSC 3I2ZA 1G291 2PYKA 1SR3A 2L1BA 2AWNA 5M5XB 3CC7A 2EXDA 2QA4A 2JA8G 1Y1VG 2G5DA 2NN6I 3IL8A 1A2TA 1A3TA 1CK1A 3J7A5 2HQLA 2F0SA 4F7XA 3DWQA 3HOXH 3BU2A 1B53A 3T1YQ 2OQ0A 2RSNA 4RA8A 1NCVA 4DK3C 2KCMA 4B3SL 3NWSA 4H13C 5EBDA 2DUDA 2X6GA 1S40A 2F0QA 3T1YL 4CGYB 4HJ7A 2JJQA 5IWAL 2AWOA 1IKMA 1E1TA 2C9OA 1LTAD 2BA1A 1C4QA 5GADC 5C0XH 3NE5B 2K5VA 4MIUA 4NP5A 3UDXA 1B3AA 2EIFA 1R9TB 3L7ZC 4XT3B 2K5QA 5K36H 1A0IA 4TKOB 4IFDG 1K73C 2WIIB 2TSSA 2M9VA 2WB1B 4Y7NH 4KJNA 5GAEC 3J81L 2HT1A 3K8AA 1HTLD 1BO0A 2ENBA 2SNMA 1Y1VH 3A55A 2JA8H 1J6QA 2BOSA 5LMUQ 5JJIA 1SNQA 3VYUA 1VQOA 3CU7A 2HCIA 4JC0A 2NB0A 5FOBB 4GOPC 4A75A 3EQLC 3D4RA 2IT1A 2KCNA 1RCVD 1KLUD 1E2ZA 4GN3B 2Z9HA 1JB7A 1WOCA 1O7IA 2JA5B 3JAML 4N9PA 4CJ0B 5JJZA 5BR8L 3W5OA 1L1OA 2EYHA 2I5HA 1YNJC 4XTCS 5TSSA 4OELB 1YI2A 1Q12A 3GTPB 3M4QA 4ZLTF 1QVGA 1Z7TA 2NVTB 3OOCA 1B9MA 4N8FA 1B44D 2PMZB 2BA0A 2B39A 1TKWB 4YWMA 1EWIA 2AUKA 2B2UA 4GNXB 1EYCA 1F2LA 1QG7A 1V1OA 1IW7D 1LTBD 1STBA 4GLXA 3Q22A 2Z6BA 4DK0A 4K6DA 3G6JB 4FXGC 2YU9H 3I4NG 2AQ2B 3OTOQ 4A3JG 4JI4Q 1JOKA 1SAPA 3L0OA 4HJ5A 1SNDA 4IQZA 5E4WC 4N9TA 4JI4L 1JORA 1I4GA 4HMJA 4KV6A 2NYZD 3U9SA 3DM1A 3EVQA 3S2DB 1EQRA 1PYBA 3KF6B 3PUYA 2EQSA 2RDFA 4MTNA 4CJ1B 1HUMA 3K5NA 1JQYD 1KTKA 1K8AC 1ZKOA 3R2IA 2K14A 4A3CH 3G7LA 1R4PB 1XWEA 1N36Q 3VR6A 1A62A 3GTOB 2KOLA 3ND9A 1TU2B 4AIMA 2K7VA 2VNUD 3M4OH 4QUFA 4K2LA 4ZUJA 3RN5A 1EEID 1N36L 1M4VA 1LTTD 2R7ZB 3I4NH 5EBCA 1D7QA 2QEXA 4A3JH 1K8OA 3X3MA 4DFAA 2CQAA 4A3EG 1KDCA 1EY0A 1PTOC 4PV1C 2KEDA 2L5TA 4RAUC 1Q46A 1UEAB 4K8JA 2K52A 3DWPA 1PRTF 1ESRA 2DNEA 2MO1A 5BN3A 2XWBB 3J80E 3Q0AA 4A76A 3KK7A 3TREA 4LUZA 4A3IG 4Q5VA 5C5MA 1O7LA 1XNRQ 2VS1A 3HS0C 4TSSA 2EZVA 4K5XA 3MXNA 3I3CA 4AYBE 1TS5A 1F77A 1TWCH 1XNRL 1JB3A 1WTRA 4IOAA 4XQQA 2PPBC 2VUMG 1ZYRC 2NVXH 4RCOA 4CKBA 1HNZL 3VR3A 1GUSA 3CF5A 4XQNA 1Q1BA 4UAIA 4NXNQ 1GUNA 4A3EH 1SE4A 3QB3A 1SMYC 3HOVB 2KECA 5EPKA 3F2CA 1I50H 3CRKC 1P16A 2RHSB 2DY7A 2B3GA 4KHPQ 1HHVA 3URYA 4RMFA 3T16A 4YWLA 4ZYSA 5KIXA 4LFAQ 1H9SB 5KNDA 3K7AB 3EIVA 3GTQH 4KHPL 1RL2A 4KKUA 2KHIA 3L3OC 4EQ5A 5I9OA 2DGYA 2IL8A 1NMGA 1YIJA 2ALYB 1X3PA 3S1NH 5CV4A 2UUAQ 2BH8A 3MXPA 3MWYW 2IPKD 2NVXB 1BUVT 1J9OA 3TEHB 4YY3L 2B63G 3MEFA 1EFWA 2VUMH 2UUAL 1DGSA 1ZXTA 2NVQH 4RHRA 5EKKA 3PV0A 3H3VI 1A15A 4CDCC 3U58A 1ICWA 2NVYH 2F0LA 1VQMA 1O78A 3BVGA 1DD2A 4FYDA 4K0KQ 5JJKA 1C48A 1L1OC 3R2TA 4FXKC 5D3DA 4P72A 4I7ZC 5HGQA 5GROA 3S1NB 4K0KL 3KOJA 2EVBA 2F0JA 1PH2A 5M3FG 2K04A 3GTGH 1ASZA 3K80C 5M5WH 4HJ8A 1PH6A 4JI7L 2F0VA 3UE1A 4A3FB 4WJ4A 2B2UC 2SDFA 1XYIA 1ASYA 4C3IB 1I5FA 1UAPA 2J7ZA 1XJVA 1IBLQ 3GV6A 4H7BA 3TRZA 1UE6A 5M5YB 1OXTA 1CZWA 1VQBA 4JI3Q 3PUXA 1HNXQ 5CV6A 3K5MA 1KIXA 4B3TL 1SLJA 1IBLL 1EU3A 4KD3A 1CKMA 3NSWA 2R7FA 2MNAA 2QW7A 4HIKA 1HNXL 4Z9CB 1B9NA 3A5ZB 3A0JA 3K7UC 4IPCA 2H1EA 2XIWA 5AJ3L 1TWHH 1LV9A 1ML0D 5FJ8G 3VR5A 2K05A 1FNVA 3D31A 4KTAA 4HIOA 3PUWA 1U0LA 3H91A 2L15A 2JA6H 2DNCA 2Q2HA 4ZAIA 1U4MA 1VF5C 3G71A 2KENA 4JI1Q 4PZ8A 1FJGQ 2LS01 5ELFA 4R8IA 3NQTA 2WAQE 3E0EA 5CV9A 3I4LA 5C3EG 3CCQA 1HUNA 2WFWA 3OIQA 4B9WA 3QG1A 2GVBA 2N49A 4I7AA 1EL0A 1SYGA 3ERSX 1K3RA 3KYHC 4JI1L 5I2XA 1M90C 4IFDI 1VQHA 1JCKB 3UDFA 2MJ8A 2FINB 4G7HC 2F0TA 2EYPA 2E2HH 1TWHB 4IFDJ 2J0TD 2ASBA 4X3TA 3KFUA 2EDGA 1UUPA 3CP0A 2PMZE 5FJ8H 1SNPA 5KYIA 3PO2G 4EQOA 1O80A 1JICA 5IYBG 3TS0A 2JA6B 1FNUA 1YJ9A 1L0WA 3PO3G 4B3RQ 3G48A 1RJTA 1Q81C 3CCSA 2JK8A 1EEFD 1FGUA 3F1ZA 4B3RL 3H15A 1SNMA 1OTCA 3S2HH 4A3KB 3RLOA 2JE6I 4RGTA 4DKAC 4DNIA 4OHJA 5J1ZA 5IP9H 2E2HB 4PNYA 1EYGA 4DAMA 3BYYB 4KN4C 3W2DA 2OT2A 1N32L 2F4IA 3VYRA 3CHBD 2ICIA 2EY2A 5CR3A 3PF5A 2V1CC 1YHAA 3GTJH 1EY6A 1LTRD 3EROA 5CMDA 3PO2H 4L5RC 1GXDC 1SYFA 3NTHA 3KLSA 3E9HA 1DXMA 3PO3H 2Q2IA 2N88A 4PG3A 2XN9C 1K8GA 1Q1EA 3VA5A 1AEXA 5FLXc 3S2HB 2F0DA 2F0MA 5L37A 4KN7C 1PRTD 2A73B 3Q24A 4BBSG 1K9MC 4DV5Q 3P7JA 1VQ4A 4YCUA 2JA7B 1YEZA 2ZTEA 2TMPA 1GHKA 5IGFA 3HEJA 1DJRD 1E7ZA 2CCZA 1YJNA 1A8VA 4R4QA 2IHFA 4OWWB 4KJOA 3BJUA 1N34Q 4DV3L 1F9QA 1BOSA 1EU4A 4A3LG 3MZ5A 3PUZA 1B8AA 1MIUA 1VMPA 1UE7A 2B2VA 3K58A 4DAYB 4DU9A 1HZ9A 4R9WA 1LT5D 1QOHA 2XSCA 1YNJD 1HA5A 1S4ZA 1KAWA 1NUCA 3J7YW 3RZDH 1V43A 2F4VQ 1TWFH 4GOPA 1AE3A 1B70B 3I7FA 2LMCB 1EYAA 4LJZC 3BDCA 1MSHA 3I8ZA 2C35B 1X3QA 2WP8J 3MC0B 4BBRH 3RZOH 1UE5A 2F4VL 5LMNQ 3M3YH 1SSOA 1D1IA 1UNSA 2M2LA 4LFBQ 4A3DB 1IL8A 4OO1I 4C56C 5M3MB 1BQQT 1LUZA 1V1QA 4ULLA 4DF7A 1E22A 1LTID 4B08A 5LMNL 1CZGA 4DV1Q 5CC4A 1Q3LA 4LFBL 4HCSA 2OWOA 4LF6Q 4DAYA 3NK9A 3H0GG 1GVPA 4A3LH 3PGZA 4KMUC 1E3PA 2JXMB 4HJAA 3BZCA 4H0LC 4C3JG 1TS2A 5C44H 4A3GG 4LF6L 3ONAB 1OXVA 2ZT9C 1TWFB 5IT9L 4ALPA 4LWCA 5I6WA 3BZDB 1QZGA 5IYDG 2FMMA 4KY7A 1PV4A 3CCLA 4X3UA 3TSSA 5ELEA 1QNUA 4BBRB 3RZOB 3ULLA 1PYSB 1GO3E 4FP5D 2LKVA 1GKHA 3J7AF 1HZAA 4YWKA 4GN4B 4FVMA 4XQJA 1WCMB 5EKIA 2B29A 2K01A 4QJFA 5C4XH 4DR5Q 2QF7A 1LT3D 5DNFA 3R3OA 3HP3A 5C44B 4G7OC 1STGA 3S16B 3OYYA 4DR5L 3J81i 1CUKA 1RKNA 1GUOA 1TT2A 1LACA 3HZXA 4A3GH 1NY4A 2K1BA 4FNFA 1GD7A 4O42A 3OWEB 1K0SA 5IYDH 2V4DA 2RCNA 2WB1G 1LABA 3GV3A 3HOXG 1NR4A 5M5XH 4XXEA 5CGKA 2N3SA 3RLNA 3JAMi 2JA9A 2WINB 3MXGA 1Z9FA 2Q8RE 3IFDA 1YBYA 5C4XB 4LF9Q 3T51B 2A19A 5C0XG 4L5TA 1ZYRD 2D62A 2AUJD 4J8QA 4C1NI 2F3WA 1PZJD 2JA5G 3V96A 2XWJB 2Z4IA 3M4PA 4FXDA 1B2TA 4IUPA 4JI0Q 3S15H 1CM9A 5EPLA 1SMYD 1YNND 3A8IE 1L0YB 1T9HA 2D2CC 1R9TH 2F0GA 3M7NA 4GKJQ 2EY1A 3LX0A 1GM5A 1DZ1A 1AW7A 2RDHA 1PXUA 2VZAA 5EKLA 4JI0L 4N8X1 1CQFA 1SE8A 4MHEA 4LNQA 4B3SQ 1IL2A 4GKJL 2PQAA 4RGNA 2A69D 2MGSA 1EIFA 5ELCA 5IWAQ 3S1QB 1XTDA 2HUGA 2K4KA 1CTMA 2F03A 4HSVA 4L6TB 5CV8A 3OMCA 2K5NA 2M00A 4Q0FA 1I4QA 1VDZA 3KLSX 3A74A 1PYWD 3H6MA 5T1GA 1YVCA 5I6YA 3S15B 3GTKH 4ZQ3A 4DV2Q 2JA5H 2ICEC 4X3KA 1F2ZA 1PRTC 4YCVA 4IUTA 3S14H 2A6EC 4DV2L 4NB3A 1Y8NB 3HOZB 2K03A 1U4PA 4L5QA 2BE5D 3FMCA 1LM0A 1WD1A 2IHEA 2B2VC 5EPJA 3GTPH 2ID0A 2NVTH 1IBMQ 1MBYA 4BA2I 2F0PA 5IODA 3WOFA 1B50A 2KUMA 1BNZA 3LNNA 2E2JB 3VYTA 1IBML 2KEEA 1MSGA 4L5SA 3HKSA 1XPUA 3KUPA 5H1SE 1KD1C 5BR8Q 1CFMA 2FMCA 4BY1B 2D0OA 1S72A 4FF4A 2R7ZG 1KAAA 3GTKB 3H09A 4OWXB 4DUZQ 5ELOA 5LHY1 3VR2A 2I5LX 2QDBA 3S14B 3UDIA 3SE0A 3J7ZC 4DUZL 3AB9A 2BCOA 4P71A 1SJHD 1YZ6A 4FF1A 4ZCKA 3HOUH 3S2DH 4APVA 3ULPA 4KY5A 3E9IA 2MHVA 3ITPA 2K5HA 4A3CG 2K33A 2O4XA 1X3GA 5IGDA 1MJEA 1KXLA 1B3QA 2EJFC 1E2VA 5CBAE 2YTYA 1BCPB 1I4XA 1ENAA 1ONLA 1JWMD 1TWAB 3TDQA 5C3WA 5IYCG 3GTOH 2HCCA 2JEAI 1NJIC 2KVMA 4JYAL 1TR5A 3G4SA 3UE0A 3SK6A 3D4DA 2A8VA 3KJOA 3MHBA 5DM63 1K83B 4O0AA 1PH8A 2R7ZH 2KBNA 2IY5B 1G2TA 4NXML 1F2YA 5FLXE 3CD6A 1CKNB 1X65A 3ERQA 2X6LA 4POGA 2VXWA 5A2QL 1NTGA 2CVRA 4TQUS 4RG1A 3HOVG 3DXJC 3HOUB 4IPHA 1F2MA 1PHJA 4JI2Q 5IIFA 4WFN3 2ZM6Q 4GNXA 3KLRA 5KNBA 2OCEA 5FO8B 3BDOA 3X3NA 1RF2D 1QWYA 4JI2L 5KEEA 4UY8C 5EQ0A 1EYDA 2IX1A 4ME5A 2ZM6L 5FO9B 2RQXA 4CKEA 2JP1A 5IYCH 2VB3X 1VQ7A 4QQBX 1V1PB 1STYA 4DPGA 1YHBA 1G2SA 3TQYA 1VQDA 1H9JA 2E75C 4YIJA 3FKIB 4QL5A 1VQPA 5J39A 3KF6A 1EWHA 1SEBD 5AFWA 2OTLA 3KJPA 1XNQQ 1HCZA 3HOVH 4WJ3M 1H9KA 3RMHA 5C4ZA 1BBXC 1BKBA 2DN8A 5COYA 1SDFA 1XNQL 1ZEQX 2BDOA 3FDTA 3K7AH 2NWGA 1A63A 3R8BA 2AKWB 4L8JA 3M85A 1DOKA 1X56A 4CDDC 3CW2C 2K6AA 2UXDQ 1HNZQ 3TZUA 3QIAA 4RKLA 2NUCA 2PQEA 3VR4A 3K6OA 4OL7A 4EQPA 3S1RB 2UXDL 1QCBD 1ENFA 4A3FG 1J5EQ 1HQMC 4C3IG 1PH1A 1ET6A 2WKDA 3PIPA 1NAPA 1FGBD 1JJCB 4LMQD 4DR6L 5CORA 1YNNC 4ABNA 1J5EL 2OQKA 2YV5A 1IBKQ 1LTSD 4UDUC 3NBIA 4DA2A 1ILPA 3QO2A 1UEBA 1OO9B 2A69C 5J3BA 1IBKL 1ICFB 4DN4M 2UXBL 3CCRA 3SK4A 2CQOA 1PDQA 1I3QB 3CC4A 4YY3Q 2K32A 4LF4L 2VW9A 1PFSA 2VQEQ 2B8FA 4K5VA 1PMRA 3D0FA 2RA4A 1VQLA 4JV5Q 3T4AC 2VQEL 4FDBA 4A3FH 2Q2UA 2I0QA 4C3IH 1CA5A 4EX5A 4JW0A 3TN2A 1K28A 4JV5L 2R6GA 4C2MB 5M5YH 3J81c 3FEWX 4TRDA 3MXUA 1H9SA 3VDYA 2CH4W 2BE5C 4IPDA 4IUVA 2DY8A 1XPOA 3HKZB 1EIYB 1HNWL 2PW5A 3DHQA 1EZ6A 4RH6A 2QILA 4JI7Q 2YYZA 1STAA 5EAYA 1AZPA 2EY6A 4DXGA 3JAMc 3GTMB 2JA6G 3TS2A 1PA6A 5C0XI 2MUYA 3PSIA 4DR1Q 3NTKA 2G9HD 5C0XJ 4B3TQ 4X3SA 1LYLA 2QCPX 5LL6S 2ZTDA 3J80L 4DR1L 4NKLA 1ILQA 4A3KG 4ODGA 1G8ZD 4LF8Q 2UXCQ 4HSPA 5AJ3Q 3K0XA 2R93B 4KI0A 4K2KA 5NUCA 4LF8L 1WD0A 2UXCL 4M1UB 4AQYL 2VL6A 3RLFA 4HR7B 2WB1E 3ICEA 3GO5A 4QIWB 3L2PA 4R4CA 3NXWA 4C3HB 1WTWA 5JEAH 2K5WA 1D5MC 1LO5D 2HDLA 2RKSA 1N8RC 4DAVA 1JJGA 1JWUD 1KL9A 4GNXC 1BCPC 5I2YA 1K8MA 2N8NA 4IUNA 1VQ5A 3S1MB 1AFPA 4BY7B 4P75A 4DK1A 3MAQA 1M8AA 3DLLA 2NN6G 1CHQD 5C4JB 2EYJA 3MFYA 4OIJA 1VQIA 5IP9G 2EYOA 4YHHL 1HR0W 3PIOA 4M8AA 4A3KH 2X69A 1U4LA 5KNCA 5IGBA 1EQVA 2JA7G 3K5OA 4PZ6A 5C3XA 4JI6Q 1IYVA 2HIVA 2A68C 1SNOA 2Z8LA 1MKHA 1D8LA 1QVFA 4XIGS 2XVSA 4JI6L 4A3BB 4XYOA 3F2DA 1STHA 1CHPD 1YNXA 3I70A 3NPPA 4KKTA 4CBVA 4IOCA 3V2TA 1I94L 1O7YA 2KHJA 1SE2A 5FKAC 2F0EA 1MHWC 2LXJA 3LWUA 4BS9A 1EY9A 2NN6H 4WJWA 1S5CD 3AFQA 5M3FB 2R7DA 1N32Q 1KQSA 2UUBQ 2R3ZA 1YJWA 3MEHA 1EWCA 3E5SA 4P73A 3WWVA 4JBWA 4HEDA 3A8JE 1O7ZA 2EPBA 4JOIA
chains in the Genus database with same CATH topology
2PZTA 2XNAC 2Q8IB 5I4DA 2F0FA 1I6VC 1LT4D 3I4MB 1WTOA 2F0KA 4WORA 3OHXC 3CRLC 5HURA 5KGUA 3A7AB 4K14A 2EJMA 1RHPA 4KHZA 2A6ED 4DXFA 3K57A 3DEOA 3O13A 2F3VA 1C8CA 1IKLA 3E0JA 2A74C 1D1KA 5C3EB 1E0BA 4OIKA 2F0IA 3UI2A 5JAVA 2HQEA 2B2YA 4XYQA 1GUTA 3BG3A 1E2WA 4KHVA 1BCPF 3WDNA 2K28A 2Y0SB 5T1IA 3TP7A 5ELDA 1DOMA 2L11A 1B1ZA 1GUGA 1II3A 1S5DD 3QJYA 4K5WA 4JK1C 1GJXA 3BYTB 3SK8A 2EYLA 1L0XB 5D14A 4RWSC 3Q23A 1TS4A 3OIPA 3I73A 3HOYB 1PFNA 3NUCA 1EQTA 2XRQD 3MTSA 2R92B 4HMIA 2LFNA 1BXTA 3D3RA 1KDAA 3MVVA 2CHBD 4EQNA 1LTGD 2D5DA 1AZQA 1Y1WB 3HGBA 4BBSB 2R61A 1WVLA 3FRPB 1PZID 4IALA 4AYBB 3C1EA 1EIGA 4RGOS 2XRSD 2I46A 2PZWA 4HTHA 3J81E 4BWGB 1IYUA 3IAYA 1ET9A 3OWFA 2ZXOA 1EIHA 3SXHA 1PTOB 4MN3A 2VB2X 2PW7A 5J22A 1EY4A 3JAME 3Q6SA 1DM0B 5BN4A 2WKCA 2E2IB 2OEOA 4ZRZA 4IUUA 3H94A 2WV6D 1QNKA 5JVG3 3S17B 1FNWA 1HA6A 4K6LA 4IN3A 2AQ3B 3EJIA 4ZK9B 1TWGB 2RBMA 5JPNC 2PCFB 3I91A 4CKCA 2KHSA 3AMUA 1XX8A 3DUZA 1BDOA 1JR0D 4OGQC 3PMFA 4NDXA 2A6HD 3N52A 3TP5A 5C5LA 5FO7B 1JWSD 3WOEA 1SYBA 1GHJA 5A2QE 1F9SA 2GA4B 2RVLA 2L12A 4A3MB 2B2YC 4B9XA 3HG9A 3NTIA 3QWNA 1RTOA 5I9PA 3HOWB 4A93B 2SEBD 1PFBA 2L9HA 1STEA 4DGZA 2L0CA 4CJ2C 1WTVA 1R4QB 3MA2B 4J1MA 1CT1D 3HOXB 4E6IA 1SYCA 2NTSA 5EGTA 5IGGA 4WRDA 3KBXA 1EY7A 1AP0A 2EY5A 2WAQB 1Y8PB 3S9WA 1SXTA 2IWHA 2I07B 2EOTA 4KKSA 1WTQA 5CBEE 4KD4A 5KRUA 1KABA 1PLFA 4IZ8A 1BCPD 4Y7NB 4HCEA 4O1NA 1MI2A 2JA8B 4IFDH 1Y1VB 3HRZC 1I4HA 3A56A 4ZKBB 2IX0A 1SE3A 1SYDA 3D6CA 2G9DA 1SBBB 1JE4A 2MPMA 2O5JC 1D5XC 2EYFA 2B2WA 2PZUA 3D4WA 5F2DA 5ELBA 1Z6HA 1T5EA 2EYMA 5DEHA 3P20A 2F0OA 2OF1A 2A68D 5ISRA 1NR2A 2KQ3A 3QOLA 3C46A 3GQBA 5DM73 4F8MA 5LL6X 4FF2A 4BA1I 1HRJA 1Z47A 1HTPA 1KLGD 1KDBA 3IFTA 1DYQA 4DAPA 3A8KE 3I72A 5EJWA 4U68A 5E4XA 5KYLA 2YU9B 3GTLB 4J6HA 4F88A 4G57A 2EE1A 2B2TA 3SK5A 1HPCA 3BVMA 2Z1CA 1CI3M 3MFGA 5G3LF 2F1MA 1Q8IA 1RTNA 1BR9A 1V1PA 3T13A 1JOOA 1S5BD 1BF4A 3VYSA 1OXUA 2EXZA 2KCCA 5K5PA 3M4OB 4OO1G 3TP8A 4L63B 3I90A 1F9RA 4QUCA 3FPUB 1QB5D 3I4NB 4A3JB 3L9AX 1SFOB 3GP7A 4FF3A 2FFKB 2A6HC 1XXGA 3VA7A 4C3HG 2C5CA 4S3SA 5FLXL 3N6RA 1NSNS 3BS1A 3BVZA 3P1HA 4PMBA 2WACA 2MP1A 4ID6A 2Z4HA 3K5LA 1QILA 2F0UA 2E76C 4DNTB 3CKIB 5HGTA 3FPPA 1MGSA 1TWCB 4OO1H 1RD9D 4KY6A 1Q90A 4QF4A 3C2PA 3A54A 4A3EB 1FD7D 3TMEA 5JEAG 1I50B 3NWTA 4QCLA 3DMUA 3F2UA 1LLRD 2N55A 3U9OA 1D6EC 3H3VC 1EY8A 2H4OA 3OSOA 3SVMA 1TQOA 3GTQB 2B8GA 2OXPA 4A3IB 4GZYC 2SNSA 1I4PA 1TY0A 1W6JA 1H9MA 1CQVA 5CV7A 4HAEA 5JVH3 2FHTA 1Y8OB 4G7ZC 1STNA 2VUMB 1Y69U 2E2DC 2NVQB 3TP6A 1GUWA 2JYOA 4DNRB 3M4YA 3OMGA 2A5HA 1I4RA 1RDPD 2B2WC 1G6ZA 2NVYB 3CQZB 4EVOA 3PUVA 5JPMC 1ENCA 3NQIA 1DONA 1PTOF 5IGCA 3K0YA 3P75A 3ZYYX 1JOQA 4XT1B 2IJ0A 2AQ1B 3GTGB 2BDNA 1D5ZC 3SR1A 5M5WB 1IW7C 1KNEA 3AU7A 1VMCA 1U4RA 3PIP3 2B63B 2O2LD 1TVXA 1WTXA 2NTTA 2CW0D 1OXXK 2B2TC 1XTCD 2L4NA 1FYCA 1V8QA 1J8IA 1HFNA 1WTPA 4RFBA 4QB4A 4V0BA 1TY2A 1VCIA 3LWEA 3TBIB 2QKIC 1JC7A 1S5FD 3FVQA 5CV5A 3DWAA 2RDGA 5E3FA 2D9UA 3IKJA 2K5DA 1A6XA 3KBGA 4ZUIA 4XDXA 3A7LA 3D8GA 2KJXA 4RGMA 2PO4A 3KF8A 4IUQA 4QMGA 3NHHA 4ILWA 3V05A 5IT9E 1S5ED 3SEBA 2F0HA 3GD7A 4RKBA 3E6ZX 1A2UA 1U9RA 1HXYD 1PRTB 1X32A 3NP8A 5G3LD 1EOTA 4PQXA 1FR3A 5A35A 1B4OA 5CYUA 1HFGA 3C3LA 1EY5A 2ZXPA 2LY7A 1RODA 4V190 1I6HB 4NW2A 1EZ8A 4P2CB 3GTJB 5C6AA 3EFXD 1CA6A 3PO2B 3D6WA 4HN7A 3PO3B 2SOBA 3RUZA 4NMZA 1HQRD 2IW3A 1QE6A 1DCZA 4ZKCB 4U673 3PIO3 2HDMA 1VF7A 4IURA 3EA6A 1KNAA 2PNRC 1MD2D 2E74C 1IHZA 4EGVA 3NBHA 1H9RA 5C4HA 3SDZA 2RSOA 2Q8TA 3OW7A 5BN5A 1GOZA 4K8IA 2NZ1D 1D2BA 4R8NA 3OPOA 4H44C 1TIID 1ESFA 3ND8A 1PTOH 5IOCA 3RZDB 2J4XA 5DAUA 3R93A 3J7AV 4G4KA 3TZDA 5D3IB 1A3VA 3K59A 2F0NA 1F9PA 3M7GA 2FJ2A 4PMWA 3M3YB 5IGEA 2L55A 1LT6D 1SYEA 3W3AA 3SHLA 4C1NK 2NBFA 1PFMA 3DEPA 2O5IC 5FK9C 2JSOA 4I65A 1EFID 1AN8A 4F87A 4CHTB 3T53B 5E1FA 1PTOD 3BDLA 4RHSA 2F0WA 1W6KA 4LAAA 2QEJC 4LK1C 5JEAJ 1T5XD 5M9OA 2CW0C 1G91A 2IX3A 4PMCA 4RCNA 1SNCA 2ZXRA 5D65A 1QJOA 2JEBI 3T56B 2EJGC 1SJED 3C1FA 3H0GB 3QOJA 1A3UA 4KK7A 1TS3A 4C3JB 5JOBA 4A3GB 3RD4A 4FO2A 1PZKD 5K36G 2KA7A 1DOLA 1OXSC 1G291 2PYKA 2L1BA 2AWNA 5M5XB 2NN6I 3IL8A 1A2TA 1A3TA 1CK1A 2F0SA 4F7XA 3DWQA 1B53A 2RSNA 4RA8A 1NCVA 3NWSA 4H13C 5EBDA 2X6GA 2F0QA 4CGYB 2AWOA 1IKMA 2C9OA 1LTAD 2BA1A 1C4QA 5C0XH 3NE5B 4MIUA 4NP5A 1B3AA 1R9TB 3L7ZC 4XT3B 2K5QA 5K36H 4TKOB 4IFDG 2WIIB 2TSSA 2M9VA 2WB1B 4KJNA 3J81L 1HTLD 1BO0A 2ENBA 2SNMA 3A55A 2BOSA 1SNQA 3VYUA 3CU7A 2HCIA 2NB0A 5FOBB 3EQLC 3D4RA 2IT1A 2KCNA 1RCVD 1KLUD 1E2ZA 2JA5B 3JAML 4N9PA 4CJ0B 5JJZA 2EYHA 1YNJC 5TSSA 4XTCS 1Q12A 3GTPB 4ZLTF 1Z7TA 2NVTB 3OOCA 1B9MA 1B44D 2PMZB 2BA0A 2B39A 1TKWB 2AUKA 2B2UA 1EYCA 1QG7A 1F2LA 1V1OA 1IW7D 1LTBD 1STBA 3Q22A 4DK0A 4K6DA 3G6JB 4FXGC 2AQ2B 1JOKA 1SAPA 1SNDA 4IQZA 5E4WC 4N9TA 1JORA 1I4GA 4HMJA 4KV6A 2NYZD 3U9SA 3DM1A 3EVQA 3S2DB 3PUYA 2RDFA 4CJ1B 1HUMA 3K5NA 1JQYD 1KTKA 1ZKOA 3R2IA 3G7LA 1R4PB 1XWEA 3GTOB 3VR6A 2KOLA 3ND9A 1TU2B 2K7VA 2VNUD 4QUFA 4K2LA 4ZUJA 1EEID 1M4VA 1LTTD 2R7ZB 5EBCA 1K8OA 3X3MA 4DFAA 2CQAA 1KDCA 1EY0A 1PTOC 4PV1C 2KEDA 2L5TA 4RAUC 1UEAB 4K8JA 3DWPA 1PRTF 1ESRA 2DNEA 5BN3A 3Q0AA 2XWBB 3J80E 3KK7A 4Q5VA 5C5MA 1O7LA 3HS0C 4TSSA 2EZVA 4K5XA 3MXNA 3I3CA 1TS5A 1F77A 1JB3A 1WTRA 4XQQA 2PPBC 1ZYRC 4RCOA 4CKBA 3VR3A 1GUSA 4XQNA 1Q1BA 4UAIA 1GUNA 1SE4A 3QB3A 1SMYC 3HOVB 2KECA 5EPKA 3CRKC 2DY7A 1HHVA 3URYA 3T16A 5KIXA 4ZYSA 1H9SB 5KNDA 3K7AB 4KKUA 3L3OC 5I9OA 2IL8A 1X3PA 5CV4A 3MXPA 3MWYW 2IPKD 2NVXB 1BUVT 1J9OA 1ZXTA 4RHRA 5EKKA 3PV0A 1A15A 1ICWA 2F0LA 1O78A 3BVGA 1DD2A 4FYDA 1C48A 3R2TA 4FXKC 5D3DA 4I7ZC 3S1NB 2EVBA 2F0JA 2K04A 2F0VA 4A3FB 2B2UC 2SDFA 1XYIA 4C3IB 1UAPA 2J7ZA 3GV6A 4H7BA 5M5YB 1OXTA 1CZWA 3PUXA 5CV6A 3K5MA 1EU3A 4KD3A 3NSWA 4Z9CB 1B9NA 2H1EA 2XIWA 1LV9A 1ML0D 3VR5A 2K05A 1FNVA 3D31A 4KTAA 3PUWA 3H91A 2DNCA 4ZAIA 1U4MA 1VF5C 2LS01 5ELFA 4R8IA 3NQTA 5CV9A 3I4LA 1HUNA 3OIQA 4B9WA 3QG1A 1EL0A 1SYGA 5I2XA 4IFDI 1JCKB 2MJ8A 2FINB 4G7HC 2F0TA 2EYPA 1TWHB 4IFDJ 2J0TD 4X3TA 2EDGA 1UUPA 1SNPA 5KYIA 4EQOA 1O80A 1JICA 2JA6B 1FNUA 1RJTA 1EEFD 1SNMA 4A3KB 2JE6I 4RGTA 4OHJA 5J1ZA 2E2HB 4PNYA 3BYYB 4KN4C 3W2DA 2OT2A 2F4IA 3VYRA 3CHBD 2ICIA 2EY2A 5CR3A 1EY6A 1LTRD 3EROA 5CMDA 1GXDC 1SYFA 3NTHA 3KLSA 1DXMA 2N88A 2XN9C 1Q1EA 3VA5A 1AEXA 3S2HB 2F0DA 2F0MA 4KN7C 1PRTD 2A73B 3Q24A 3P7JA 2JA7B 2TMPA 1GHKA 5IGFA 3HEJA 1DJRD 4KJOA 1F9QA 1BOSA 1EU4A 3MZ5A 3PUZA 1VMPA 2B2VA 3K58A 4DU9A 4R9WA 1LT5D 1QOHA 2XSCA 1YNJD 1HA5A 1S4ZA 1NUCA 3J7YW 1V43A 2LMCB 1EYAA 4LJZC 3BDCA 1MSHA 3I8ZA 1X3QA 2WP8J 3MC0B 1SSOA 1D1IA 1UNSA 2M2LA 4A3DB 1IL8A 4OO1I 4C56C 5M3MB 1BQQT 4ULLA 4DF7A 1LTID 4B08A 1CZGA 5CC4A 1Q3LA 4HCSA 4DAYA 3NK9A 4KMUC 2JXMB 4H0LC 4C3JG 1TS2A 3ONAB 1OXVA 2ZT9C 1TWFB 5IT9L 5I6WA 3BZDB 2FMMA 4KY7A 4X3UA 3TSSA 5ELEA 1QNUA 4BBRB 3RZOB 4FP5D 2LKVA 3J7AF 4FVMA 4XQJA 1WCMB 5EKIA 2K01A 2QF7A 1LT3D 5DNFA 3R3OA 3HP3A 5C44B 4G7OC 1STGA 3S16B 1RKNA 1GUOA 1TT2A 1LACA 3HZXA 2K1BA 4FNFA 4O42A 3OWEB 2V4DA 1LABA 3GV3A 1NR4A 4XXEA 5CGKA 2WINB 3MXGA 2Q8RE 3IFDA 5C4XB 3T51B 5C0XG 1ZYRD 2D62A 2AUJD 4J8QA 4C1NI 2F3WA 1PZJD 3V96A 2XWJB 2Z4IA 4FXDA 1B2TA 4IUPA 1CM9A 5EPLA 1SMYD 1YNND 3A8IE 1L0YB 3M7NA 2D2CC 2F0GA 2EY1A 3LX0A 1DZ1A 1AW7A 2RDHA 1PXUA 5EKLA 1CQFA 4MHEA 4RGNA 2A69D 2MGSA 5ELCA 3S1QB 2HUGA 1CTMA 2F03A 4HSVA 4L6TB 5CV8A 3OMCA 2M00A 4Q0FA 1I4QA 1VDZA 3KLSX 1PYWD 3H6MA 5T1GA 5I6YA 3S15B 4ZQ3A 2ICEC 4X3KA 1F2ZA 1PRTC 4IUTA 2A6EC 1Y8NB 3HOZB 2K03A 1U4PA 1WD1A 2BE5D 3FMCA 5EPJA 2B2VC 2ID0A 1MBYA 4BA2I 2F0PA 5IODA 3WOFA 1B50A 2KUMA 1BNZA 3LNNA 2E2JB 3VYTA 2KEEA 1MSGA 3KUPA 1CFMA 2FMCA 4BY1B 4FF4A 1KAAA 3GTKB 3H09A 5LHY1 3VR2A 2QDBA 3S14B 3SE0A 3AB9A 2BCOA 1SJHD 4FF1A 4KY5A 2MHVA 3ITPA 2K33A 2O4XA 5IGDA 2EJFC 1E2VA 5CBAE 1BCPB 1I4XA 1ENAA 1ONLA 1JWMD 1TWAB 3TDQA 5C3WA 2HCCA 2JEAI 2KVMA 1TR5A 3SK6A 3D4DA 3MHBA 5DM63 1K83B 1G2TA 1F2YA 5FLXE 3ERQA 2X6LA 2VXWA 5A2QL 2CVRA 4TQUS 3DXJC 3HOUB 1F2MA 5IIFA 4WFN3 3KLRA 5KNBA 5FO8B 3BDOA 3X3NA 1RF2D 1QWYA 5KEEA 5EQ0A 1EYDA 2IX1A 4ME5A 5FO9B 2RQXA 4CKEA 2JP1A 2VB3X 1V1PB 1STYA 1G2SA 1H9JA 2E75C 4YIJA 3FKIB 5J39A 1EWHA 1SEBD 5AFWA 1HCZA 1H9KA 3RMHA 5C4ZA 1BBXC 2DN8A 5COYA 1SDFA 1ZEQX 2BDOA 3FDTA 2NWGA 3R8BA 4L8JA 3M85A 1DOKA 2K6AA 3TZUA 3QIAA 4RKLA 2NUCA 2PQEA 3VR4A 3K6OA 4OL7A 4EQPA 3S1RB 1QCBD 1ENFA 1HQMC 4C3IG 1ET6A 2WKDA 1NAPA 1FGBD 4LMQD 5CORA 1YNNC 4ABNA 1LTSD 4UDUC 3NBIA 4DA2A 1ILPA 3QO2A 1OO9B 2A69C 4DN4M 3SK4A 1PDQA 1I3QB 2K32A 2B8FA 4K5VA 1PMRA 2RA4A 3T4AC 1CA5A 3TN2A 2R6GA 4C2MB 3FEWX 4TRDA 3MXUA 1H9SA 2BE5C 4IUVA 2DY8A 3HKZB 2PW5A 3DHQA 4RH6A 1EZ6A 2QILA 2YYZA 1STAA 1AZPA 2EY6A 4DXGA 3GTMB 5C0XI 2MUYA 3NTKA 2G9HD 5C0XJ 4X3SA 2QCPX 5LL6S 3J80L 4NKLA 1ILQA 4ODGA 1G8ZD 4HSPA 2R93B 4KI0A 4K2KA 5NUCA 1WD0A 4M1UB 3RLFA 4HR7B 3GO5A 4QIWB 3NXWA 4C3HB 1WTWA 5JEAH 2K5WA 1D5MC 1LO5D 2HDLA 2RKSA 4DAVA 1JWUD 1BCPC 5I2YA 1K8MA 4IUNA 3S1MB 1AFPA 4BY7B 4DK1A 3MAQA 1M8AA 2NN6G 1CHQD 5C4JB 2EYJA 3MFYA 4OIJA 2EYOA 4M8AA 2X69A 1U4LA 5KNCA 5IGBA 1EQVA 3K5OA 5C3XA 1IYVA 2A68C 1SNOA 2Z8LA 4XIGS 2XVSA 4A3BB 4XYOA 1STHA 1CHPD 3I70A 3NPPA 4KKTA 4CBVA 3V2TA 1O7YA 1SE2A 5FKAC 2F0EA 3LWUA 4BS9A 1EY9A 2NN6H 4WJWA 1S5CD 5M3FB 2R3ZA 3MEHA 1EWCA 3E5SA 4JBWA 4HEDA 3A8JE 1O7ZA 2EPBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LV9 A;  1WTX A;  1ML0 D;  5DNF A;  1EQT A;  4ZLT F;  1QE6 A;  2K05 A;  2B2T C;  3HP3 A;  5AFW A;  1B50 A;  4ZKC B;  1MGS A;  1NR2 A;  1F9S A;  2KUM A;  3P7J A;  5D65 A;  3MTS A;  2L4N A;  1BNZ A;  1HFN A;  2HDM A;  1BBX C;  2KEE A;  4UAI A;  1MSG A;  4IUR A;  2RVL A;  4X3S A;  1WTO A;  1WTP A;  3KUP A;  1J8I A;  5COY A;  1SDF A;  3H91 A;  1KNA A;  2KEC A;  5EPK A;  1HRJ A;  2B2U A;  2K1B A;  3FDT A;  1ILQ A;  2L12 A;  1U4M A;  1F2L A;  1QG7 A;  2DY7 A;  2B2Y C;  2NWG A;  3LWE A;  4ZAI A;  4O42 A;  1HHV A;  1RTO A;  4R8I A;  1DOK A;  1AZQ A;  2D9U A;  2RSO A;  3GV3 A;  1HUN A;  5EJW A;  2Q8T A;  1PFB A;  1NR4 A;  1DOL A;  4U68 A;  5E4X A;  1WD0 A;  2L9H A;  1EL0 A;  3F2U A;  1F9Q A;  1RHP A;  1SAP A;  2N55 A;  2L1B A;  2IL8 A;  2MJ8 A;  2FIN B;  1VMP A;  2Q8R E;  4XDX A;  2B2V A;  3DEO A;  1X3P A;  5E4W C;  4CJ2 C;  3SVM A;  1WVL A;  3IFD A;  1WTV A;  4R9W A;  1C8C A;  3IL8 A;  1WTW A;  2NZ1 D;  3MWY W;  1EIG A;  1NAP A;  2HDL A;  2NYZ D;  4IUQ A;  1S4Z A;  3DM1 A;  4X3T A;  4LMQ D;  1B53 A;  5COR A;  2EE1 A;  2B2T A;  1IKL A;  2RSN A;  4RA8 A;  5CBA E;  1NCV A;  1J9O A;  1ZXT A;  4HAE A;  1E0B A;  1M8A A;  4OIK A;  4CJ1 B;  1O80 A;  1B2T A;  1A15 A;  1JIC A;  1MSH A;  1HUM A;  2FHT A;  2X6G A;  3I8Z A;  2HCC A;  3QO2 A;  4IUP A;  3R93 A;  3UI2 A;  1CM9 A;  1RTN A;  1X3Q A;  2KVM A;  5EPL A;  3TZD A;  4OIJ A;  1EIH A;  1ICW A;  1IKM A;  3G7L A;  1BF4 A;  1RJT A;  1SSO A;  2B2Y A;  4DN4 M;  2JYO A;  2M2L A;  1GUW A;  1IL8 A;  2KOL A;  1DZ1 A;  1F9P A;  2B2W C;  4MN3 A;  2FJ2 A;  2X69 A;  1PDQ A;  1G2T A;  1G6Z A;  1U4L A;  4QUF A;  4MHE A;  1B3A A;  2X6L A;  3KBX A;  2VXW A;  1AP0 A;  1Q3L A;  2K28 A;  4XT3 B;  3Q6S A;  4HCS A;  2CVR A;  5T1I A;  2EOT A;  1X32 A;  2MGS A;  1EOT A;  1WTQ A;  1DON A;  5CBE E;  2HUG A;  2RA4 A;  4IUU A;  3I90 A;  1F9R A;  2K04 A;  1DOM A;  4QUC A;  4HSV A;  3FPU B;  1QNK A;  1PFM A;  1HA6 A;  4XT1 B;  3DEP A;  1BO0 A;  3ONA B;  2L11 A;  1B4O A;  1CA5 A;  1PLF A;  4ZK9 B;  3TN2 A;  2KED A;  4RAU C;  1ILP A;  2BDN A;  3I91 A;  5T1G A;  2B2U C;  2SDF A;  1XYI A;  2HCI A;  2FMM A;  1HFG A;  1KNE A;  1MI2 A;  1O7Y A;  5EQ0 A;  1XX8 A;  2FFK B;  4X3U A;  2J7Z A;  1ESR A;  3GV6 A;  5CMD A;  2JP1 A;  4IUV A;  4ZKB B;  1ROD A;  2DY8 A;  4X3K A;  1VMC A;  4NW2 A;  1U4R A;  1JE4 A;  2N88 A;  2MPM A;  4IUT A;  2B2W A;  5D14 A;  4RWS C;  1CA6 A;  1G2S A;  1TVX A;  4CJ0 B;  5JJZ A;  2K03 A;  2MP1 A;  3D6W A;  1U4P A;  3I3C A;  1WD1 A;  2R3Z A;  3N52 A;  1AZP A;  5EPJ A;  2B2V C;  1G91 A;  1PFN A;  4HED A;  2K01 A;  5EKI A;  1O7Z A;  1WTR A;  2EPB A;  2H1E A;  2XIW A; 
#chains in the Genus database with same CATH topology
 2N78 A;  2UUB L;  2JA7 H;  2PZT A;  2XNA C;  2Q8I B;  5I4D A;  1Q7Y C;  2RF4 A;  4A3D G;  2F0F A;  1I6V C;  3STB C;  5M3M G;  1LT4 D;  4JCV E;  1CSQ A;  4JPB W;  1N33 Q;  2MO0 A;  1WTO A;  2F0K A;  3I4M B;  2HHH Q;  4WOR A;  3OHX C;  3CRL C;  3OW2 A;  1N33 L;  1KC8 C;  5HUR A;  5KGU A;  3A7A B;  4K14 A;  1VQ6 A;  3M9B A;  4DV0 Q;  2HHH L;  2EJM A;  1CSP A;  1RHP A;  4KHZ A;  2A6E D;  4DXF A;  4DV0 L;  1RIP A;  5IE8 A;  3K57 A;  3DEO A;  3O13 A;  4DV7 L;  2F3V A;  4JBM A;  1C8C A;  3DM3 A;  4BBR G;  1IKL A;  3PF4 A;  3PCO B;  3E0J A;  2A74 C;  1D1K A;  5C3E B;  4DV3 Q;  1E0B A;  4OIK A;  4A3D H;  2F0I A;  5M3M H;  3UI2 A;  5JAV A;  2HQE A;  3SGI A;  1WCM G;  2B2Y A;  4LUO A;  2E8G A;  4XYQ A;  1GUT A;  3BG3 A;  1E2W A;  3NBH B;  4KHV A;  5C44 G;  4R4O A;  1BCP F;  1SN8 A;  3WDN A;  2K28 A;  2Y0S B;  1SRO A;  5T1I A;  1B7Y B;  3TP7 A;  5ELD A;  1X3E A;  3HOY H;  2RCF A;  1DOM A;  5LMN W;  5FLM G;  1X55 A;  3W1G A;  3EN2 A;  4X66 L;  2L11 A;  1B1Z A;  1GUG A;  1II3 A;  1S5D D;  2BH2 A;  3QJY A;  4K5W A;  4JK1 C;  4LFC L;  2K50 A;  1GJX A;  3BYT B;  3SK8 A;  2EYL A;  1L0X B;  4CDE C;  5C4X G;  1Q8K A;  2DJG C;  1WCM H;  5D14 A;  4RWS C;  4JI8 Q;  3CCM A;  4IO9 A;  3Q23 A;  1WTH A;  1TS4 A;  3OIP A;  3I73 A;  4GLA C;  3HOY B;  4POF A;  1PFN A;  1XMO Q;  4JI8 L;  3S16 H;  3NUC A;  1JMC A;  1VQC A;  1EQT A;  2XRQ D;  1IZ6 A;  3I56 A;  2KCT A;  3MTS A;  3RN2 A;  4DR7 L;  1XMO L;  4HMI A;  2R92 B;  3JC6 6;  2LFN A;  5FLM H;  1BXT A;  1BVS A;  3D3R A;  1X9N A;  1KDA A;  3MVV A;  2CHB D;  2H5X A;  4EQN A;  3AYH B;  1LTG D;  3HKZ E;  2D5D A;  1IXR A;  2K75 A;  1AZQ A;  4JG2 A;  2YTX A;  1Y1W B;  1HZC A;  3HGB A;  4BBS B;  2GVA A;  2R61 A;  4LF7 Q;  1W2B A;  3U50 C;  1PH7 A;  4X62 L;  2AMC B;  1WVL A;  3FRP B;  4QGU A;  1PZI D;  4IAL A;  1G51 A;  2E2I H;  3C1E A;  4O2D A;  4AYB B;  1EIG A;  4LF7 L;  4RGO S;  2XRS D;  2MQH A;  3S17 H;  2I46 A;  2PZW A;  4X65 L;  1Q82 C;  4HTH A;  3J81 E;  4BWG B;  1IYU A;  1K3B C;  3IAY A;  1ET9 A;  4IJL A;  3OWF A;  3HOZ G;  2ZXO A;  1EIH A;  1BBU A;  3SXH A;  1PTO B;  4DV6 L;  4MN3 A;  2VB2 X;  2PW7 A;  5J22 A;  3S1Q H;  1VQ9 A;  1EY4 A;  3JAM E;  3Q6S A;  1DM0 B;  5BN4 A;  1QZH A;  4JOI C;  4BY1 G;  2WKC A;  2E2I B;  2OEO A;  4ZRZ A;  2ZJR A;  1HZB A;  4IUU A;  4KLK A;  3H94 A;  4LUV A;  2WV6 D;  1QNK A;  5JVG 3;  3S17 B;  1FNW A;  1HA6 A;  4K6L A;  4IN3 A;  2AQ3 B;  3Q8D A;  4R4T A;  3EJI A;  4ZK9 B;  1TWG B;  2RBM A;  5JPN C;  2PCF B;  3I91 A;  4CKC A;  3RNU A;  1KHI A;  2KHS A;  3IRB A;  3AMU A;  1XX8 A;  4UHV A;  3DUZ A;  1BDO A;  3HOZ H;  3HOW H;  4A93 H;  1JR0 D;  4OGQ C;  2YTV A;  3PMF A;  2CKZ B;  4NDX A;  2A6H D;  3I4O A;  3N52 A;  1XPR A;  3H3V H;  3TP5 A;  2E2J H;  5C5L A;  5FO7 B;  1JWS D;  3WOE A;  1SYB A;  1C7Y A;  1GHJ A;  5A2Q E;  1H95 A;  1F9S A;  4BY1 H;  2GA4 B;  2RVL A;  1Q86 C;  4DUY Q;  1KRS A;  2L12 A;  4A3M B;  2B2Y C;  4B9X A;  3HG9 A;  3NTI A;  3QWN A;  3HOU G;  1RTO A;  5I9P A;  5ELN A;  3HOW B;  2LXK A;  4A93 B;  2SEB D;  1PFB A;  4DUY L;  2L9H A;  3U4Z A;  1STE A;  2E5L Q;  4DGZ A;  4R4I A;  2L0C A;  4CJ2 C;  1WTV A;  4X6A H;  1R4Q B;  4MTK A;  2E5L L;  2OTJ A;  1L1O B;  1TWA H;  3MA2 B;  4J1M A;  1CT1 D;  4UP9 A;  3HOX B;  4E6I A;  1SYC A;  1K83 H;  2NTS A;  1EUJ A;  5EGT A;  5IGG A;  4HJ9 A;  3CCV A;  3FKI G;  3NEN A;  4WRD A;  2Q2T A;  5LMU L;  2Z6K A;  3KBX A;  1EY7 A;  4UP7 A;  1AP0 A;  2EY5 A;  2WAQ B;  3CC2 A;  1Y8P B;  3S9W A;  3AEV A;  1SXT A;  2IWH A;  2I07 B;  2EOT A;  4KKS A;  1WTQ A;  5CBE E;  4JYA Q;  1VQ8 A;  3AFP A;  4KD4 A;  5KRU A;  1KAB A;  1PLF A;  4NXM Q;  4IZ8 A;  1BCP D;  3UDG A;  4Y7N B;  2JQO A;  4HCE A;  4O1N A;  1MI2 A;  2JA8 B;  4IFD H;  1Y1V B;  3HRZ C;  2NZH A;  4ME3 A;  5IT9 c;  1I4H A;  3A56 A;  4ZKB B;  2IX0 A;  1EQQ A;  1SE3 A;  1SYD A;  3D6C A;  2G9D A;  1SBB B;  5JJL A;  1JE4 A;  2MPM A;  2O5J C;  1D5X C;  3FKI H;  2EYF A;  2B2W A;  2PZU A;  3D4W A;  3S24 A;  5F2D A;  1X3F A;  5ELB A;  1Z6H A;  1T5E A;  2Y0S E;  2EYM A;  5DEH A;  3P20 A;  3GTL H;  2F0O A;  2JN4 A;  3CMA A;  3QR8 A;  2OF1 A;  4CDF C;  2A68 D;  5ISR A;  1WFQ A;  3PQI A;  1NR2 A;  3OTO L;  2KQ3 A;  4OON A;  1SMX A;  3QOL A;  1PH4 A;  3C46 A;  4UP8 A;  2HIX A;  3GQB A;  5DM7 3;  4F8M A;  5LL6 X;  4FF2 A;  2P5Z X;  4BA1 I;  1HRJ A;  4H02 A;  1Z47 A;  3CCU A;  1HTP A;  2RHQ B;  1KLG D;  1KDB A;  1CKN A;  3IFT A;  1DYQ A;  4DAP A;  3A8K E;  3I72 A;  5EJW A;  3S1R H;  4U68 A;  1EOV A;  1SRU A;  5E4X A;  5DLQ E;  4Y52 H;  5KYL A;  3G6E A;  2YU9 B;  3GTL B;  2QGQ A;  1G6P A;  2VY3 A;  1M1K C;  3MXN B;  2ATW A;  4J6H A;  4F88 A;  3CCE A;  3HKZ G;  4G57 A;  2B2T A;  2EE1 A;  3SK5 A;  1SFO H;  1HPC A;  3BVM A;  2Z1C A;  3STB D;  1UE1 A;  1CI3 M;  1LTL A;  3MFG A;  5G3L F;  1AE2 A;  2F1M A;  1Q8I A;  1RTN A;  1BR9 A;  1V1P A;  3T13 A;  4LW1 A;  4R1J A;  1I3Q H;  1JOO A;  1S5B D;  4MNO A;  1BF4 A;  3J80 i;  1V9P A;  3VYS A;  4DR6 Q;  1VQG A;  1OXU A;  2EXZ A;  2DJF C;  1S3O A;  2KCC A;  1FL0 A;  5K5P A;  3M4O B;  4OO1 G;  3HFZ B;  4GS3 A;  3TP8 A;  4L63 B;  3I90 A;  1F9R A;  4QUC A;  3FPU B;  1QB5 D;  1C9O A;  4C2M H;  3I4N B;  1BBW A;  4A3J B;  2UXB Q;  3L9A X;  1PVO A;  1SFO B;  2R93 G;  1VQF A;  3GP7 A;  4LF4 Q;  2PI2 A;  4FF3 A;  2FFK B;  1VQK A;  2A6H C;  1C0A A;  1XXG A;  1VQJ A;  3VA7 A;  1HJP A;  2I5M X;  4C3H G;  2C5C A;  4DR3 Q;  4S3S A;  5FLX L;  3N6R A;  1NSN S;  3BZK A;  3BS1 A;  4A4I A;  3BVZ A;  4NXN L;  3P1H A;  3GTM H;  5HY6 A;  4PMB A;  2WAC A;  2MP1 A;  1TXY A;  4BY7 G;  4DR3 L;  4ID6 A;  2Z4H A;  3K5L A;  1QIL A;  2F0U A;  2E76 C;  3ULJ A;  4DNT B;  1E24 A;  4A3I H;  4JBK A;  3CKI B;  1W3S A;  4LFA L;  2NZO A;  5HGT A;  1HNW Q;  3FPP A;  1MGS A;  1TWC B;  3F2B A;  4OO1 H;  1RD9 D;  1U5K A;  4KY6 A;  2MFI A;  1Q90 A;  4QF4 A;  1IYJ B;  4P74 A;  3A54 A;  3KDF B;  3C2P A;  1K0R A;  2R93 H;  4A3E B;  1FD7 D;  4PZ7 A;  3TME A;  5JEA G;  1I50 B;  3NWT A;  4A3B G;  4B3M Q;  4QCL A;  2Z6K C;  1X54 A;  2CWP A;  3DMU A;  3CQZ H;  3F2U A;  4C3H H;  1LLR D;  2N55 A;  3U9O A;  1D6E C;  3H3V C;  1EY8 A;  2H4O A;  1WYD A;  3OSO A;  1JE5 A;  1TQO A;  3SVM A;  4B3M L;  3GTQ B;  2B8G A;  2OXP A;  3S1M H;  4A3I B;  4BY7 H;  4GZY C;  4X64 Q;  2SNS A;  1WJJ A;  5C4J H;  3ZJY C;  1I4P A;  1TY0 A;  1W6J A;  1H9M A;  3FP9 A;  1CQV A;  5CV7 A;  4HAE A;  5JVH 3;  4AQY Q;  3KDF A;  4X64 L;  2FHT A;  1Y8O B;  4G7Z C;  1STN A;  2VUM B;  1Y69 U;  2E2D C;  2NVQ B;  1VQN A;  3CAM A;  3TP6 A;  1GUW A;  2JYO A;  1CKO A;  4DNR B;  3M4Y A;  3OMG A;  2A5H A;  5IP7 G;  4GLV B;  2B63 H;  1I4R A;  1RDP D;  2B2W C;  1G6Z A;  2NVY B;  4AH6 A;  3CQZ B;  4EVO A;  3PUV A;  3I4M G;  5JPM C;  2AHO B;  3AQQ A;  4A3B H;  4GN5 A;  2PNH A;  1ENC A;  3NQI A;  1DON A;  1NNX A;  3EBE A;  1PTO F;  5IGC A;  4JI3 L;  3K0Y A;  3P75 A;  3ZYY X;  1JOQ A;  4XT1 B;  4YHH Q;  2IJ0 A;  2AQ1 B;  3GTG B;  2BDN A;  1D5Z C;  3SR1 A;  5M5W B;  1IW7 C;  1KNE A;  5M3F H;  3AU7 A;  3CPW A;  3U4V A;  3KLW A;  1KRT A;  1VMC A;  1U4R A;  3PIP 3;  2B63 B;  2O2L D;  1TVX A;  2ZTC A;  5IP7 H;  3J81 j;  3RR5 A;  1I94 Q;  1FJG L;  1WTX A;  2NTT A;  3I4M H;  2CW0 D;  3KF8 B;  1OXX K;  2B2T C;  1XTC D;  4IPG A;  2D0P A;  2L4N A;  1FYC A;  1V8Q A;  1HR0 Q;  1J8I A;  1HFN A;  1WTP A;  4RFB A;  4QB4 A;  4V0B A;  1TY2 A;  2Y0S G;  3NEM A;  1VCI A;  3LGJ A;  3LWE A;  3TBI B;  2QKI C;  1JC7 A;  1HR0 L;  1NMF A;  1S5F D;  3FVQ A;  1E1O A;  5CV5 A;  3DWA A;  2RDG A;  5E3F A;  4NPS A;  2D9U A;  2F52 A;  3IKJ A;  1VS0 A;  2K5D A;  4JI5 Q;  1A6X A;  1AH9 A;  3KBG A;  4ZUI A;  4XDX A;  3A7L A;  3D8G A;  3F8T A;  2KJX A;  4RGM A;  4JI5 L;  3CME A;  2PO4 A;  5C3E H;  3KF8 A;  4IUQ A;  4QMG A;  1YHQ A;  3NHH A;  4ILW A;  4LF5 Q;  3K81 C;  3V05 A;  2QDL A;  5IT9 E;  2VQF Q;  2ZJP A;  1S5E D;  3SEB A;  4HID A;  2F0H A;  2Z0S A;  3GD7 A;  4RKB A;  4DV7 Q;  2CWA A;  3HOY G;  4TVA B;  1PH9 A;  4LF5 L;  1I6H H;  2VQF L;  3E6Z X;  3GDE A;  2R92 G;  5IYB H;  1A2U A;  1VQE A;  4DR4 Q;  1U9R A;  1HXY D;  1PRT B;  1X32 A;  3NP8 A;  5G3L D;  1EOT A;  4PQX A;  1JJ2 A;  4OXP A;  1FR3 A;  4DR4 L;  5A35 A;  1B4O A;  1MJC A;  1Y1W G;  2ES2 A;  5CYU A;  4MZ9 A;  2A1A A;  4BXX G;  1HFG A;  2PI2 E;  3C3L A;  4YCW A;  4GOP B;  1EY5 A;  2ZXP A;  2LY7 A;  5GQO A;  1ROD A;  4OEM B;  4V19 0;  5GAG C;  4DV5 L;  4AYB G;  4NW2 A;  1I6H B;  1PH5 A;  1EZ8 A;  2GN5 A;  4P2C B;  3GTJ B;  5C6A A;  4X66 Q;  3EFX D;  1CA6 A;  3PO2 B;  3D6W A;  4JVZ A;  4HN7 A;  3PO3 B;  2SOB A;  1HH2 P;  3RUZ A;  4NMZ A;  4LFC Q;  2R92 H;  1HQR D;  2IW3 A;  1QE6 A;  1DCZ A;  4ZKC B;  1N34 L;  4U67 3;  1Y14 B;  3PIO 3;  2HDM A;  1VF7 A;  4IUR A;  3EA6 A;  1KNA A;  3E3X A;  2XTI A;  1FVI A;  2PNR C;  1MD2 D;  2E74 C;  1IHZ A;  4EGV A;  1Y1W H;  3NBH A;  1PH3 A;  4BBS H;  4BXX H;  1H9R A;  5C4H A;  3J80 c;  3SDZ A;  2RSO A;  2Q8T A;  4DR7 Q;  1WI5 A;  4OWT B;  3OW7 A;  5BN5 A;  1GOZ A;  3T1H Q;  4GKK Q;  4K8I A;  3CXC A;  4DK6 C;  2NZ1 D;  2HD3 A;  5GAH C;  1X6O A;  1NBW A;  3T1H L;  1D2B A;  4R8N A;  4GKK L;  1UWV A;  3OPO A;  2LSS A;  4DV4 Q;  4H44 C;  1TII D;  1L2F A;  1ESF A;  3ND8 A;  4DV1 L;  1PTO H;  2FXQ A;  5IOC A;  3CPF A;  3RZD B;  2J4X A;  5DAU A;  3R93 A;  4DV4 L;  4G4K A;  4X62 Q;  2ZJQ A;  3J7A V;  3TZD A;  5D3I B;  4HIM A;  1A3V A;  3K59 A;  2F0N A;  1P8L A;  1F9P A;  2XGT A;  3M7G A;  4JBJ A;  2FJ2 A;  4X65 Q;  4PMW A;  3M3Y B;  5IGE A;  1VQA A;  2L55 A;  1LT6 D;  1SYE A;  1JT8 A;  3W3A A;  3SHL A;  3CCJ A;  1TWG H;  4J15 A;  4C1N K;  4A3M G;  2NBF A;  2CFM A;  4DV6 Q;  1PFM A;  4QY7 A;  3DEP A;  4IJH A;  2O5I C;  3HOW G;  4A93 G;  3I55 A;  5FK9 C;  2JSO A;  4I65 A;  1EFI D;  1AN8 A;  4F87 A;  4CHT B;  5E7N A;  3H0G H;  3T53 B;  1QUQ B;  5E1F A;  1PTO D;  3BDL A;  4RHS A;  2F0W A;  4C3J H;  1N9W A;  1W6K A;  4LAA A;  2QEJ C;  4LK1 C;  2CH4 A;  5JEA J;  4QIW E;  1T5X D;  2UUC Q;  5M9O A;  2CW0 C;  3NEL A;  4UPA A;  1G91 A;  2UUC L;  2IX3 A;  3ER0 A;  3B6Y A;  4PMC A;  2PQA B;  4RCN A;  2F3I A;  1SNC A;  4OX9 Q;  2ZXR A;  5D65 A;  2UU9 Q;  5IY0 A;  1QJO A;  2JEB I;  4A3M H;  3T56 B;  1XMQ Q;  2EJG C;  1SJE D;  3C1F A;  3A5U A;  2WAQ G;  3FHW A;  4OX9 L;  2UU9 L;  3H0G B;  3QOJ A;  4DR2 Q;  1A3U A;  4LF9 L;  1QUQ A;  4KK7 A;  1NE3 A;  1TS3 A;  1XMQ L;  1QVC A;  4C3J B;  5JOB A;  4A3G B;  3RD4 A;  4FO2 A;  1PZK D;  5K36 G;  3W1B A;  2KA7 A;  4DR2 L;  1DOL A;  1YIT A;  1OXS C;  3I2Z A;  1G29 1;  2PYK A;  1SR3 A;  2L1B A;  2AWN A;  5M5X B;  3CC7 A;  2EXD A;  2QA4 A;  2JA8 G;  1Y1V G;  2G5D A;  2NN6 I;  3IL8 A;  1A2T A;  1A3T A;  1CK1 A;  3J7A 5;  2HQL A;  2F0S A;  4F7X A;  3DWQ A;  3HOX H;  3BU2 A;  1B53 A;  3T1Y Q;  2OQ0 A;  2RSN A;  4RA8 A;  1NCV A;  4DK3 C;  2KCM A;  4B3S L;  3NWS A;  4H13 C;  5EBD A;  2DUD A;  2X6G A;  1S40 A;  2F0Q A;  3T1Y L;  4CGY B;  4HJ7 A;  2JJQ A;  5IWA L;  2AWO A;  1IKM A;  1E1T A;  2C9O A;  1LTA D;  2BA1 A;  1C4Q A;  5GAD C;  5C0X H;  3NE5 B;  2K5V A;  4MIU A;  4NP5 A;  3UDX A;  1B3A A;  2EIF A;  1R9T B;  3L7Z C;  4XT3 B;  2K5Q A;  5K36 H;  1A0I A;  4TKO B;  4IFD G;  1K73 C;  2WII B;  2TSS A;  2M9V A;  2WB1 B;  4Y7N H;  4KJN A;  5GAE C;  3J81 L;  2HT1 A;  3K8A A;  1HTL D;  1BO0 A;  2ENB A;  2SNM A;  1Y1V H;  3A55 A;  2JA8 H;  1J6Q A;  2BOS A;  5LMU Q;  5JJI A;  1SNQ A;  3VYU A;  1VQO A;  3CU7 A;  2HCI A;  4JC0 A;  2NB0 A;  5FOB B;  4GOP C;  4A75 A;  3EQL C;  3D4R A;  2IT1 A;  2KCN A;  1RCV D;  1KLU D;  1E2Z A;  4GN3 B;  2Z9H A;  1JB7 A;  1WOC A;  1O7I A;  2JA5 B;  3JAM L;  4N9P A;  4CJ0 B;  5JJZ A;  5BR8 L;  3W5O A;  1L1O A;  2EYH A;  2I5H A;  1YNJ C;  4XTC S;  5TSS A;  4OEL B;  1YI2 A;  1Q12 A;  3GTP B;  3M4Q A;  4ZLT F;  1QVG A;  1Z7T A;  2NVT B;  3OOC A;  1B9M A;  4N8F A;  1B44 D;  2PMZ B;  2BA0 A;  2B39 A;  1TKW B;  4YWM A;  1EWI A;  2AUK A;  2B2U A;  4GNX B;  1EYC A;  1F2L A;  1QG7 A;  1V1O A;  1IW7 D;  1LTB D;  1STB A;  4GLX A;  3Q22 A;  2Z6B A;  4DK0 A;  4K6D A;  3G6J B;  4FXG C;  2YU9 H;  3I4N G;  2AQ2 B;  3OTO Q;  4A3J G;  4JI4 Q;  1JOK A;  1SAP A;  3L0O A;  4HJ5 A;  1SND A;  4IQZ A;  5E4W C;  4N9T A;  4JI4 L;  1JOR A;  1I4G A;  4HMJ A;  4KV6 A;  2NYZ D;  3U9S A;  3DM1 A;  3EVQ A;  3S2D B;  1EQR A;  1PYB A;  3KF6 B;  3PUY A;  2EQS A;  2RDF A;  4MTN A;  4CJ1 B;  1HUM A;  3K5N A;  1JQY D;  1KTK A;  1K8A C;  1ZKO A;  3R2I A;  2K14 A;  4A3C H;  3G7L A;  1R4P B;  1XWE A;  1N36 Q;  3VR6 A;  1A62 A;  3GTO B;  2KOL A;  3ND9 A;  1TU2 B;  4AIM A;  2K7V A;  2VNU D;  3M4O H;  4QUF A;  4K2L A;  4ZUJ A;  3RN5 A;  1EEI D;  1N36 L;  1M4V A;  1LTT D;  2R7Z B;  3I4N H;  5EBC A;  1D7Q A;  2QEX A;  4A3J H;  1K8O A;  3X3M A;  4DFA A;  2CQA A;  4A3E G;  1KDC A;  1EY0 A;  1PTO C;  4PV1 C;  2KED A;  2L5T A;  4RAU C;  1Q46 A;  1UEA B;  4K8J A;  2K52 A;  3DWP A;  1PRT F;  1ESR A;  2DNE A;  2MO1 A;  5BN3 A;  2XWB B;  3J80 E;  3Q0A A;  4A76 A;  3KK7 A;  3TRE A;  4LUZ A;  4A3I G;  4Q5V A;  5C5M A;  1O7L A;  1XNR Q;  2VS1 A;  3HS0 C;  4TSS A;  2EZV A;  4K5X A;  3MXN A;  3I3C A;  4AYB E;  1TS5 A;  1F77 A;  1TWC H;  1XNR L;  1JB3 A;  1WTR A;  4IOA A;  4XQQ A;  2PPB C;  2VUM G;  1ZYR C;  2NVX H;  4RCO A;  4CKB A;  1HNZ L;  3VR3 A;  1GUS A;  3CF5 A;  4XQN A;  1Q1B A;  4UAI A;  4NXN Q;  1GUN A;  4A3E H;  1SE4 A;  3QB3 A;  1SMY C;  3HOV B;  2KEC A;  5EPK A;  3F2C A;  1I50 H;  3CRK C;  1P16 A;  2RHS B;  2DY7 A;  2B3G A;  4KHP Q;  1HHV A;  3URY A;  4RMF A;  3T16 A;  4YWL A;  4ZYS A;  5KIX A;  4LFA Q;  1H9S B;  5KND A;  3K7A B;  3EIV A;  3GTQ H;  4KHP L;  1RL2 A;  4KKU A;  2KHI A;  3L3O C;  4EQ5 A;  5I9O A;  2DGY A;  2IL8 A;  1NMG A;  1YIJ A;  2ALY B;  1X3P A;  3S1N H;  5CV4 A;  2UUA Q;  2BH8 A;  3MXP A;  3MWY W;  2IPK D;  2NVX B;  1BUV T;  1J9O A;  3TEH B;  4YY3 L;  2B63 G;  3MEF A;  1EFW A;  2VUM H;  2UUA L;  1DGS A;  1ZXT A;  2NVQ H;  4RHR A;  5EKK A;  3PV0 A;  3H3V I;  1A15 A;  4CDC C;  3U58 A;  1ICW A;  2NVY H;  2F0L A;  1VQM A;  1O78 A;  3BVG A;  1DD2 A;  4FYD A;  4K0K Q;  5JJK A;  1C48 A;  1L1O C;  3R2T A;  4FXK C;  5D3D A;  4P72 A;  4I7Z C;  5HGQ A;  5GRO A;  3S1N B;  4K0K L;  3KOJ A;  2EVB A;  2F0J A;  1PH2 A;  5M3F G;  2K04 A;  3GTG H;  1ASZ A;  3K80 C;  5M5W H;  4HJ8 A;  1PH6 A;  4JI7 L;  2F0V A;  3UE1 A;  4A3F B;  4WJ4 A;  2B2U C;  2SDF A;  1XYI A;  1ASY A;  4C3I B;  1I5F A;  1UAP A;  2J7Z A;  1XJV A;  1IBL Q;  3GV6 A;  4H7B A;  3TRZ A;  1UE6 A;  5M5Y B;  1OXT A;  1CZW A;  1VQB A;  4JI3 Q;  3PUX A;  1HNX Q;  5CV6 A;  3K5M A;  1KIX A;  4B3T L;  1SLJ A;  1IBL L;  1EU3 A;  4KD3 A;  1CKM A;  3NSW A;  2R7F A;  2MNA A;  2QW7 A;  4HIK A;  1HNX L;  4Z9C B;  1B9N A;  3A5Z B;  3A0J A;  3K7U C;  4IPC A;  2H1E A;  2XIW A;  5AJ3 L;  1TWH H;  1LV9 A;  1ML0 D;  5FJ8 G;  3VR5 A;  2K05 A;  1FNV A;  3D31 A;  4KTA A;  4HIO A;  3PUW A;  1U0L A;  3H91 A;  2L15 A;  2JA6 H;  2DNC A;  2Q2H A;  4ZAI A;  1U4M A;  1VF5 C;  3G71 A;  2KEN A;  4JI1 Q;  4PZ8 A;  1FJG Q;  2LS0 1;  5ELF A;  4R8I A;  3NQT A;  2WAQ E;  3E0E A;  5CV9 A;  3I4L A;  5C3E G;  3CCQ A;  1HUN A;  2WFW A;  3OIQ A;  4B9W A;  3QG1 A;  2GVB A;  2N49 A;  4I7A A;  1EL0 A;  1SYG A;  3ERS X;  1K3R A;  3KYH C;  4JI1 L;  5I2X A;  1M90 C;  4IFD I;  1VQH A;  1JCK B;  3UDF A;  2MJ8 A;  2FIN B;  4G7H C;  2F0T A;  2EYP A;  2E2H H;  1TWH B;  4IFD J;  2J0T D;  2ASB A;  4X3T A;  3KFU A;  2EDG A;  1UUP A;  3CP0 A;  2PMZ E;  5FJ8 H;  1SNP A;  5KYI A;  3PO2 G;  4EQO A;  1O80 A;  1JIC A;  5IYB G;  3TS0 A;  2JA6 B;  1FNU A;  1YJ9 A;  1L0W A;  3PO3 G;  4B3R Q;  3G48 A;  1RJT A;  1Q81 C;  3CCS A;  2JK8 A;  1EEF D;  1FGU A;  3F1Z A;  4B3R L;  3H15 A;  1SNM A;  1OTC A;  3S2H H;  4A3K B;  3RLO A;  2JE6 I;  4RGT A;  4DKA C;  4DNI A;  4OHJ A;  5J1Z A;  5IP9 H;  2E2H B;  4PNY A;  1EYG A;  4DAM A;  3BYY B;  4KN4 C;  3W2D A;  2OT2 A;  1N32 L;  2F4I A;  3VYR A;  3CHB D;  2ICI A;  2EY2 A;  5CR3 A;  3PF5 A;  2V1C C;  1YHA A;  3GTJ H;  1EY6 A;  1LTR D;  3ERO A;  5CMD A;  3PO2 H;  4L5R C;  1GXD C;  1SYF A;  3NTH A;  3KLS A;  3E9H A;  1DXM A;  3PO3 H;  2Q2I A;  2N88 A;  4PG3 A;  2XN9 C;  1K8G A;  1Q1E A;  3VA5 A;  1AEX A;  5FLX c;  3S2H B;  2F0D A;  2F0M A;  5L37 A;  4KN7 C;  1PRT D;  2A73 B;  3Q24 A;  4BBS G;  1K9M C;  4DV5 Q;  3P7J A;  1VQ4 A;  4YCU A;  2JA7 B;  1YEZ A;  2ZTE A;  2TMP A;  1GHK A;  5IGF A;  3HEJ A;  1DJR D;  1E7Z A;  2CCZ A;  1YJN A;  1A8V A;  4R4Q A;  2IHF A;  4OWW B;  4KJO A;  3BJU A;  1N34 Q;  4DV3 L;  1F9Q A;  1BOS A;  1EU4 A;  4A3L G;  3MZ5 A;  3PUZ A;  1B8A A;  1MIU A;  1VMP A;  1UE7 A;  2B2V A;  3K58 A;  4DAY B;  4DU9 A;  1HZ9 A;  4R9W A;  1LT5 D;  1QOH A;  2XSC A;  1YNJ D;  1HA5 A;  1S4Z A;  1KAW A;  1NUC A;  3J7Y W;  3RZD H;  1V43 A;  2F4V Q;  1TWF H;  4GOP A;  1AE3 A;  1B70 B;  3I7F A;  2LMC B;  1EYA A;  4LJZ C;  3BDC A;  1MSH A;  3I8Z A;  2C35 B;  1X3Q A;  2WP8 J;  3MC0 B;  4BBR H;  3RZO H;  1UE5 A;  2F4V L;  5LMN Q;  3M3Y H;  1SSO A;  1D1I A;  1UNS A;  2M2L A;  4LFB Q;  4A3D B;  1IL8 A;  4OO1 I;  4C56 C;  5M3M B;  1BQQ T;  1LUZ A;  1V1Q A;  4ULL A;  4DF7 A;  1E22 A;  1LTI D;  4B08 A;  5LMN L;  1CZG A;  4DV1 Q;  5CC4 A;  1Q3L A;  4LFB L;  4HCS A;  2OWO A;  4LF6 Q;  4DAY A;  3NK9 A;  3H0G G;  1GVP A;  4A3L H;  3PGZ A;  4KMU C;  1E3P A;  2JXM B;  4HJA A;  3BZC A;  4H0L C;  4C3J G;  1TS2 A;  5C44 H;  4A3G G;  4LF6 L;  3ONA B;  1OXV A;  2ZT9 C;  1TWF B;  5IT9 L;  4ALP A;  4LWC A;  5I6W A;  3BZD B;  1QZG A;  5IYD G;  2FMM A;  4KY7 A;  1PV4 A;  3CCL A;  4X3U A;  3TSS A;  5ELE A;  1QNU A;  4BBR B;  3RZO B;  3ULL A;  1PYS B;  1GO3 E;  4FP5 D;  2LKV A;  1GKH A;  3J7A F;  1HZA A;  4YWK A;  4GN4 B;  4FVM A;  4XQJ A;  1WCM B;  5EKI A;  2B29 A;  2K01 A;  4QJF A;  5C4X H;  4DR5 Q;  2QF7 A;  1LT3 D;  5DNF A;  3R3O A;  3HP3 A;  5C44 B;  4G7O C;  1STG A;  3S16 B;  3OYY A;  4DR5 L;  3J81 i;  1CUK A;  1RKN A;  1GUO A;  1TT2 A;  1LAC A;  3HZX A;  4A3G H;  1NY4 A;  2K1B A;  4FNF A;  1GD7 A;  4O42 A;  3OWE B;  1K0S A;  5IYD H;  2V4D A;  2RCN A;  2WB1 G;  1LAB A;  3GV3 A;  3HOX G;  1NR4 A;  5M5X H;  4XXE A;  5CGK A;  2N3S A;  3RLN A;  3JAM i;  2JA9 A;  2WIN B;  3MXG A;  1Z9F A;  2Q8R E;  3IFD A;  1YBY A;  5C4X B;  4LF9 Q;  3T51 B;  2A19 A;  5C0X G;  4L5T A;  1ZYR D;  2D62 A;  2AUJ D;  4J8Q A;  4C1N I;  2F3W A;  1PZJ D;  2JA5 G;  3V96 A;  2XWJ B;  2Z4I A;  3M4P A;  4FXD A;  1B2T A;  4IUP A;  4JI0 Q;  3S15 H;  1CM9 A;  5EPL A;  1SMY D;  1YNN D;  3A8I E;  1L0Y B;  1T9H A;  2D2C C;  1R9T H;  2F0G A;  3M7N A;  4GKJ Q;  2EY1 A;  3LX0 A;  1GM5 A;  1DZ1 A;  1AW7 A;  2RDH A;  1PXU A;  2VZA A;  5EKL A;  4JI0 L;  4N8X 1;  1CQF A;  1SE8 A;  4MHE A;  4LNQ A;  4B3S Q;  1IL2 A;  4GKJ L;  2PQA A;  4RGN A;  2A69 D;  2MGS A;  1EIF A;  5ELC A;  5IWA Q;  3S1Q B;  1XTD A;  2HUG A;  2K4K A;  1CTM A;  2F03 A;  4HSV A;  4L6T B;  5CV8 A;  3OMC A;  2K5N A;  2M00 A;  4Q0F A;  1I4Q A;  1VDZ A;  3KLS X;  3A74 A;  1PYW D;  3H6M A;  5T1G A;  1YVC A;  5I6Y A;  3S15 B;  3GTK H;  4ZQ3 A;  4DV2 Q;  2JA5 H;  2ICE C;  4X3K A;  1F2Z A;  1PRT C;  4YCV A;  4IUT A;  3S14 H;  2A6E C;  4DV2 L;  4NB3 A;  1Y8N B;  3HOZ B;  2K03 A;  1U4P A;  4L5Q A;  2BE5 D;  3FMC A;  1LM0 A;  1WD1 A;  2IHE A;  2B2V C;  5EPJ A;  3GTP H;  2ID0 A;  2NVT H;  1IBM Q;  1MBY A;  4BA2 I;  2F0P A;  5IOD A;  3WOF A;  1B50 A;  2KUM A;  1BNZ A;  3LNN A;  2E2J B;  3VYT A;  1IBM L;  2KEE A;  1MSG A;  4L5S A;  3HKS A;  1XPU A;  3KUP A;  5H1S E;  1KD1 C;  5BR8 Q;  1CFM A;  2FMC A;  4BY1 B;  2D0O A;  1S72 A;  4FF4 A;  2R7Z G;  1KAA A;  3GTK B;  3H09 A;  4OWX B;  4DUZ Q;  5ELO A;  5LHY 1;  3VR2 A;  2I5L X;  2QDB A;  3S14 B;  3UDI A;  3SE0 A;  3J7Z C;  4DUZ L;  3AB9 A;  2BCO A;  4P71 A;  1SJH D;  1YZ6 A;  4FF1 A;  4ZCK A;  3HOU H;  3S2D H;  4APV A;  3ULP A;  4KY5 A;  3E9I A;  2MHV A;  3ITP A;  2K5H A;  4A3C G;  2K33 A;  2O4X A;  1X3G A;  5IGD A;  1MJE A;  1KXL A;  1B3Q A;  2EJF C;  1E2V A;  5CBA E;  2YTY A;  1BCP B;  1I4X A;  1ENA A;  1ONL A;  1JWM D;  1TWA B;  3TDQ A;  5C3W A;  5IYC G;  3GTO H;  2HCC A;  2JEA I;  1NJI C;  2KVM A;  4JYA L;  1TR5 A;  3G4S A;  3UE0 A;  3SK6 A;  3D4D A;  2A8V A;  3KJO A;  3MHB A;  5DM6 3;  1K83 B;  4O0A A;  1PH8 A;  2R7Z H;  2KBN A;  2IY5 B;  1G2T A;  4NXM L;  1F2Y A;  5FLX E;  3CD6 A;  1CKN B;  1X65 A;  3ERQ A;  2X6L A;  4POG A;  2VXW A;  5A2Q L;  1NTG A;  2CVR A;  4TQU S;  4RG1 A;  3HOV G;  3DXJ C;  3HOU B;  4IPH A;  1F2M A;  1PHJ A;  4JI2 Q;  5IIF A;  4WFN 3;  2ZM6 Q;  4GNX A;  3KLR A;  5KNB A;  2OCE A;  5FO8 B;  3BDO A;  3X3N A;  1RF2 D;  1QWY A;  4JI2 L;  5KEE A;  4UY8 C;  5EQ0 A;  1EYD A;  2IX1 A;  4ME5 A;  2ZM6 L;  5FO9 B;  2RQX A;  4CKE A;  2JP1 A;  5IYC H;  2VB3 X;  1VQ7 A;  4QQB X;  1V1P B;  1STY A;  4DPG A;  1YHB A;  1G2S A;  3TQY A;  1VQD A;  1H9J A;  2E75 C;  4YIJ A;  3FKI B;  4QL5 A;  1VQP A;  5J39 A;  3KF6 A;  1EWH A;  1SEB D;  5AFW A;  2OTL A;  3KJP A;  1XNQ Q;  1HCZ A;  3HOV H;  4WJ3 M;  1H9K A;  3RMH A;  5C4Z A;  1BBX C;  1BKB A;  2DN8 A;  5COY A;  1SDF A;  1XNQ L;  1ZEQ X;  2BDO A;  3FDT A;  3K7A H;  2NWG A;  1A63 A;  3R8B A;  2AKW B;  4L8J A;  3M85 A;  1DOK A;  1X56 A;  4CDD C;  3CW2 C;  2K6A A;  2UXD Q;  1HNZ Q;  3TZU A;  3QIA A;  4RKL A;  2NUC A;  2PQE A;  3VR4 A;  3K6O A;  4OL7 A;  4EQP A;  3S1R B;  2UXD L;  1QCB D;  1ENF A;  4A3F G;  1J5E Q;  1HQM C;  4C3I G;  1PH1 A;  1ET6 A;  2WKD A;  3PIP A;  1NAP A;  1FGB D;  1JJC B;  4LMQ D;  4DR6 L;  5COR A;  1YNN C;  4ABN A;  1J5E L;  2OQK A;  2YV5 A;  1IBK Q;  1LTS D;  4UDU C;  3NBI A;  4DA2 A;  1ILP A;  3QO2 A;  1UEB A;  1OO9 B;  2A69 C;  5J3B A;  1IBK L;  1ICF B;  4DN4 M;  2UXB L;  3CCR A;  3SK4 A;  2CQO A;  1PDQ A;  1I3Q B;  3CC4 A;  4YY3 Q;  2K32 A;  4LF4 L;  2VW9 A;  1PFS A;  2VQE Q;  2B8F A;  4K5V A;  1PMR A;  3D0F A;  2RA4 A;  1VQL A;  4JV5 Q;  3T4A C;  2VQE L;  4FDB A;  4A3F H;  2Q2U A;  2I0Q A;  4C3I H;  1CA5 A;  4EX5 A;  4JW0 A;  3TN2 A;  1K28 A;  4JV5 L;  2R6G A;  4C2M B;  5M5Y H;  3J81 c;  3FEW X;  4TRD A;  3MXU A;  1H9S A;  3VDY A;  2CH4 W;  2BE5 C;  4IPD A;  4IUV A;  2DY8 A;  1XPO A;  3HKZ B;  1EIY B;  1HNW L;  2PW5 A;  3DHQ A;  1EZ6 A;  4RH6 A;  2QIL A;  4JI7 Q;  2YYZ A;  1STA A;  5EAY A;  1AZP A;  2EY6 A;  4DXG A;  3JAM c;  3GTM B;  2JA6 G;  3TS2 A;  1PA6 A;  5C0X I;  2MUY A;  3PSI A;  4DR1 Q;  3NTK A;  2G9H D;  5C0X J;  4B3T Q;  4X3S A;  1LYL A;  2QCP X;  5LL6 S;  2ZTD A;  3J80 L;  4DR1 L;  4NKL A;  1ILQ A;  4A3K G;  4ODG A;  1G8Z D;  4LF8 Q;  2UXC Q;  4HSP A;  5AJ3 Q;  3K0X A;  2R93 B;  4KI0 A;  4K2K A;  5NUC A;  4LF8 L;  1WD0 A;  2UXC L;  4M1U B;  4AQY L;  2VL6 A;  3RLF A;  4HR7 B;  2WB1 E;  3ICE A;  3GO5 A;  4QIW B;  3L2P A;  4R4C A;  3NXW A;  4C3H B;  1WTW A;  5JEA H;  2K5W A;  1D5M C;  1LO5 D;  2HDL A;  2RKS A;  1N8R C;  4DAV A;  1JJG A;  1JWU D;  1KL9 A;  4GNX C;  1BCP C;  5I2Y A;  1K8M A;  2N8N A;  4IUN A;  1VQ5 A;  3S1M B;  1AFP A;  4BY7 B;  4P75 A;  4DK1 A;  3MAQ A;  1M8A A;  3DLL A;  2NN6 G;  1CHQ D;  5C4J B;  2EYJ A;  3MFY A;  4OIJ A;  1VQI A;  5IP9 G;  2EYO A;  4YHH L;  1HR0 W;  3PIO A;  4M8A A;  4A3K H;  2X69 A;  1U4L A;  5KNC A;  5IGB A;  1EQV A;  2JA7 G;  3K5O A;  4PZ6 A;  5C3X A;  4JI6 Q;  1IYV A;  2HIV A;  2A68 C;  1SNO A;  2Z8L A;  1MKH A;  1D8L A;  1QVF A;  4XIG S;  2XVS A;  4JI6 L;  4A3B B;  4XYO A;  3F2D A;  1STH A;  1CHP D;  1YNX A;  3I70 A;  3NPP A;  4KKT A;  4CBV A;  4IOC A;  3V2T A;  1I94 L;  1O7Y A;  2KHJ A;  1SE2 A;  5FKA C;  2F0E A;  1MHW C;  2LXJ A;  3LWU A;  4BS9 A;  1EY9 A;  2NN6 H;  4WJW A;  1S5C D;  3AFQ A;  5M3F B;  2R7D A;  1N32 Q;  1KQS A;  2UUB Q;  2R3Z A;  1YJW A;  3MEH A;  1EWC A;  3E5S A;  4P73 A;  3WWV A;  4JBW A;  4HED A;  3A8J E;  1O7Z A;  2EPB A;  4JOI A; 
#chains in the Genus database with same CATH homology
 2PZT A;  2XNA C;  2Q8I B;  5I4D A;  2F0F A;  1I6V C;  1LT4 D;  3I4M B;  1WTO A;  2F0K A;  4WOR A;  3OHX C;  3CRL C;  5HUR A;  5KGU A;  3A7A B;  4K14 A;  2EJM A;  1RHP A;  4KHZ A;  2A6E D;  4DXF A;  3K57 A;  3DEO A;  3O13 A;  2F3V A;  1C8C A;  1IKL A;  3E0J A;  2A74 C;  1D1K A;  5C3E B;  1E0B A;  4OIK A;  2F0I A;  3UI2 A;  5JAV A;  2HQE A;  2B2Y A;  4XYQ A;  1GUT A;  3BG3 A;  1E2W A;  4KHV A;  1BCP F;  3WDN A;  2K28 A;  2Y0S B;  5T1I A;  3TP7 A;  5ELD A;  1DOM A;  2L11 A;  1B1Z A;  1GUG A;  1II3 A;  1S5D D;  3QJY A;  4K5W A;  4JK1 C;  1GJX A;  3BYT B;  3SK8 A;  2EYL A;  1L0X B;  5D14 A;  4RWS C;  3Q23 A;  1TS4 A;  3OIP A;  3I73 A;  3HOY B;  1PFN A;  3NUC A;  1EQT A;  2XRQ D;  3MTS A;  2R92 B;  4HMI A;  2LFN A;  1BXT A;  3D3R A;  1KDA A;  3MVV A;  2CHB D;  4EQN A;  1LTG D;  2D5D A;  1AZQ A;  1Y1W B;  3HGB A;  4BBS B;  2R61 A;  1WVL A;  3FRP B;  1PZI D;  4IAL A;  4AYB B;  3C1E A;  1EIG A;  4RGO S;  2XRS D;  2I46 A;  2PZW A;  4HTH A;  3J81 E;  4BWG B;  1IYU A;  3IAY A;  1ET9 A;  3OWF A;  2ZXO A;  1EIH A;  3SXH A;  1PTO B;  4MN3 A;  2VB2 X;  2PW7 A;  5J22 A;  1EY4 A;  3JAM E;  3Q6S A;  1DM0 B;  5BN4 A;  2WKC A;  2E2I B;  2OEO A;  4ZRZ A;  4IUU A;  3H94 A;  2WV6 D;  1QNK A;  5JVG 3;  3S17 B;  1FNW A;  1HA6 A;  4K6L A;  4IN3 A;  2AQ3 B;  3EJI A;  4ZK9 B;  1TWG B;  2RBM A;  5JPN C;  2PCF B;  3I91 A;  4CKC A;  2KHS A;  3AMU A;  1XX8 A;  3DUZ A;  1BDO A;  1JR0 D;  4OGQ C;  3PMF A;  4NDX A;  2A6H D;  3N52 A;  3TP5 A;  5C5L A;  5FO7 B;  1JWS D;  3WOE A;  1SYB A;  1GHJ A;  5A2Q E;  1F9S A;  2GA4 B;  2RVL A;  2L12 A;  4A3M B;  2B2Y C;  4B9X A;  3HG9 A;  3NTI A;  3QWN A;  1RTO A;  5I9P A;  3HOW B;  4A93 B;  2SEB D;  1PFB A;  2L9H A;  1STE A;  4DGZ A;  2L0C A;  4CJ2 C;  1WTV A;  1R4Q B;  3MA2 B;  4J1M A;  1CT1 D;  3HOX B;  4E6I A;  1SYC A;  2NTS A;  5EGT A;  5IGG A;  4WRD A;  3KBX A;  1EY7 A;  1AP0 A;  2EY5 A;  2WAQ B;  1Y8P B;  3S9W A;  1SXT A;  2IWH A;  2I07 B;  2EOT A;  4KKS A;  1WTQ A;  5CBE E;  4KD4 A;  5KRU A;  1KAB A;  1PLF A;  4IZ8 A;  1BCP D;  4Y7N B;  4HCE A;  4O1N A;  1MI2 A;  2JA8 B;  4IFD H;  1Y1V B;  3HRZ C;  1I4H A;  3A56 A;  4ZKB B;  2IX0 A;  1SE3 A;  1SYD A;  3D6C A;  2G9D A;  1SBB B;  1JE4 A;  2MPM A;  2O5J C;  1D5X C;  2EYF A;  2B2W A;  2PZU A;  3D4W A;  5F2D A;  5ELB A;  1Z6H A;  1T5E A;  2EYM A;  5DEH A;  3P20 A;  2F0O A;  2OF1 A;  2A68 D;  5ISR A;  1NR2 A;  2KQ3 A;  3QOL A;  3C46 A;  3GQB A;  5DM7 3;  4F8M A;  5LL6 X;  4FF2 A;  4BA1 I;  1HRJ A;  1Z47 A;  1HTP A;  1KLG D;  1KDB A;  3IFT A;  1DYQ A;  4DAP A;  3A8K E;  3I72 A;  5EJW A;  4U68 A;  5E4X A;  5KYL A;  2YU9 B;  3GTL B;  4J6H A;  4F88 A;  4G57 A;  2EE1 A;  2B2T A;  3SK5 A;  1HPC A;  3BVM A;  2Z1C A;  1CI3 M;  3MFG A;  5G3L F;  2F1M A;  1Q8I A;  1RTN A;  1BR9 A;  1V1P A;  3T13 A;  1JOO A;  1S5B D;  1BF4 A;  3VYS A;  1OXU A;  2EXZ A;  2KCC A;  5K5P A;  3M4O B;  4OO1 G;  3TP8 A;  4L63 B;  3I90 A;  1F9R A;  4QUC A;  3FPU B;  1QB5 D;  3I4N B;  4A3J B;  3L9A X;  1SFO B;  3GP7 A;  4FF3 A;  2FFK B;  2A6H C;  1XXG A;  3VA7 A;  4C3H G;  2C5C A;  4S3S A;  5FLX L;  3N6R A;  1NSN S;  3BS1 A;  3BVZ A;  3P1H A;  4PMB A;  2WAC A;  2MP1 A;  4ID6 A;  2Z4H A;  3K5L A;  1QIL A;  2F0U A;  2E76 C;  4DNT B;  3CKI B;  5HGT A;  3FPP A;  1MGS A;  1TWC B;  4OO1 H;  1RD9 D;  4KY6 A;  1Q90 A;  4QF4 A;  3C2P A;  3A54 A;  4A3E B;  1FD7 D;  3TME A;  5JEA G;  1I50 B;  3NWT A;  4QCL A;  3DMU A;  3F2U A;  1LLR D;  2N55 A;  3U9O A;  1D6E C;  3H3V C;  1EY8 A;  2H4O A;  3OSO A;  3SVM A;  1TQO A;  3GTQ B;  2B8G A;  2OXP A;  4A3I B;  4GZY C;  2SNS A;  1I4P A;  1TY0 A;  1W6J A;  1H9M A;  1CQV A;  5CV7 A;  4HAE A;  5JVH 3;  2FHT A;  1Y8O B;  4G7Z C;  1STN A;  2VUM B;  1Y69 U;  2E2D C;  2NVQ B;  3TP6 A;  1GUW A;  2JYO A;  4DNR B;  3M4Y A;  3OMG A;  2A5H A;  1I4R A;  1RDP D;  2B2W C;  1G6Z A;  2NVY B;  3CQZ B;  4EVO A;  3PUV A;  5JPM C;  1ENC A;  3NQI A;  1DON A;  1PTO F;  5IGC A;  3K0Y A;  3P75 A;  3ZYY X;  1JOQ A;  4XT1 B;  2IJ0 A;  2AQ1 B;  3GTG B;  2BDN A;  1D5Z C;  3SR1 A;  5M5W B;  1IW7 C;  1KNE A;  3AU7 A;  1VMC A;  1U4R A;  3PIP 3;  2B63 B;  2O2L D;  1TVX A;  1WTX A;  2NTT A;  2CW0 D;  1OXX K;  2B2T C;  1XTC D;  2L4N A;  1FYC A;  1V8Q A;  1J8I A;  1HFN A;  1WTP A;  4RFB A;  4QB4 A;  4V0B A;  1TY2 A;  1VCI A;  3LWE A;  3TBI B;  2QKI C;  1JC7 A;  1S5F D;  3FVQ A;  5CV5 A;  3DWA A;  2RDG A;  5E3F A;  2D9U A;  3IKJ A;  2K5D A;  1A6X A;  3KBG A;  4ZUI A;  4XDX A;  3A7L A;  3D8G A;  2KJX A;  4RGM A;  2PO4 A;  3KF8 A;  4IUQ A;  4QMG A;  3NHH A;  4ILW A;  3V05 A;  5IT9 E;  1S5E D;  3SEB A;  2F0H A;  3GD7 A;  4RKB A;  3E6Z X;  1A2U A;  1U9R A;  1HXY D;  1PRT B;  1X32 A;  3NP8 A;  5G3L D;  1EOT A;  4PQX A;  1FR3 A;  5A35 A;  1B4O A;  5CYU A;  1HFG A;  3C3L A;  1EY5 A;  2ZXP A;  2LY7 A;  1ROD A;  4V19 0;  1I6H B;  4NW2 A;  1EZ8 A;  4P2C B;  3GTJ B;  5C6A A;  3EFX D;  1CA6 A;  3PO2 B;  3D6W A;  4HN7 A;  3PO3 B;  2SOB A;  3RUZ A;  4NMZ A;  1HQR D;  2IW3 A;  1QE6 A;  1DCZ A;  4ZKC B;  4U67 3;  3PIO 3;  2HDM A;  1VF7 A;  4IUR A;  3EA6 A;  1KNA A;  2PNR C;  1MD2 D;  2E74 C;  1IHZ A;  4EGV A;  3NBH A;  1H9R A;  5C4H A;  3SDZ A;  2RSO A;  2Q8T A;  3OW7 A;  5BN5 A;  1GOZ A;  4K8I A;  2NZ1 D;  1D2B A;  4R8N A;  3OPO A;  4H44 C;  1TII D;  1ESF A;  3ND8 A;  1PTO H;  5IOC A;  3RZD B;  2J4X A;  5DAU A;  3R93 A;  3J7A V;  4G4K A;  3TZD A;  5D3I B;  1A3V A;  3K59 A;  2F0N A;  1F9P A;  3M7G A;  2FJ2 A;  4PMW A;  3M3Y B;  5IGE A;  2L55 A;  1LT6 D;  1SYE A;  3W3A A;  3SHL A;  4C1N K;  2NBF A;  1PFM A;  3DEP A;  2O5I C;  5FK9 C;  2JSO A;  4I65 A;  1EFI D;  1AN8 A;  4F87 A;  4CHT B;  3T53 B;  5E1F A;  1PTO D;  3BDL A;  4RHS A;  2F0W A;  1W6K A;  4LAA A;  2QEJ C;  4LK1 C;  5JEA J;  1T5X D;  5M9O A;  2CW0 C;  1G91 A;  2IX3 A;  4PMC A;  4RCN A;  1SNC A;  2ZXR A;  5D65 A;  1QJO A;  2JEB I;  3T56 B;  2EJG C;  1SJE D;  3C1F A;  3H0G B;  3QOJ A;  1A3U A;  4KK7 A;  1TS3 A;  4C3J B;  5JOB A;  4A3G B;  3RD4 A;  4FO2 A;  1PZK D;  5K36 G;  2KA7 A;  1DOL A;  1OXS C;  1G29 1;  2PYK A;  2L1B A;  2AWN A;  5M5X B;  2NN6 I;  3IL8 A;  1A2T A;  1A3T A;  1CK1 A;  2F0S A;  4F7X A;  3DWQ A;  1B53 A;  2RSN A;  4RA8 A;  1NCV A;  3NWS A;  4H13 C;  5EBD A;  2X6G A;  2F0Q A;  4CGY B;  2AWO A;  1IKM A;  2C9O A;  1LTA D;  2BA1 A;  1C4Q A;  5C0X H;  3NE5 B;  4MIU A;  4NP5 A;  1B3A A;  1R9T B;  3L7Z C;  4XT3 B;  2K5Q A;  5K36 H;  4TKO B;  4IFD G;  2WII B;  2TSS A;  2M9V A;  2WB1 B;  4KJN A;  3J81 L;  1HTL D;  1BO0 A;  2ENB A;  2SNM A;  3A55 A;  2BOS A;  1SNQ A;  3VYU A;  3CU7 A;  2HCI A;  2NB0 A;  5FOB B;  3EQL C;  3D4R A;  2IT1 A;  2KCN A;  1RCV D;  1KLU D;  1E2Z A;  2JA5 B;  3JAM L;  4N9P A;  4CJ0 B;  5JJZ A;  2EYH A;  1YNJ C;  5TSS A;  4XTC S;  1Q12 A;  3GTP B;  4ZLT F;  1Z7T A;  2NVT B;  3OOC A;  1B9M A;  1B44 D;  2PMZ B;  2BA0 A;  2B39 A;  1TKW B;  2AUK A;  2B2U A;  1EYC A;  1QG7 A;  1F2L A;  1V1O A;  1IW7 D;  1LTB D;  1STB A;  3Q22 A;  4DK0 A;  4K6D A;  3G6J B;  4FXG C;  2AQ2 B;  1JOK A;  1SAP A;  1SND A;  4IQZ A;  5E4W C;  4N9T A;  1JOR A;  1I4G A;  4HMJ A;  4KV6 A;  2NYZ D;  3U9S A;  3DM1 A;  3EVQ A;  3S2D B;  3PUY A;  2RDF A;  4CJ1 B;  1HUM A;  3K5N A;  1JQY D;  1KTK A;  1ZKO A;  3R2I A;  3G7L A;  1R4P B;  1XWE A;  3GTO B;  3VR6 A;  2KOL A;  3ND9 A;  1TU2 B;  2K7V A;  2VNU D;  4QUF A;  4K2L A;  4ZUJ A;  1EEI D;  1M4V A;  1LTT D;  2R7Z B;  5EBC A;  1K8O A;  3X3M A;  4DFA A;  2CQA A;  1KDC A;  1EY0 A;  1PTO C;  4PV1 C;  2KED A;  2L5T A;  4RAU C;  1UEA B;  4K8J A;  3DWP A;  1PRT F;  1ESR A;  2DNE A;  5BN3 A;  3Q0A A;  2XWB B;  3J80 E;  3KK7 A;  4Q5V A;  5C5M A;  1O7L A;  3HS0 C;  4TSS A;  2EZV A;  4K5X A;  3MXN A;  3I3C A;  1TS5 A;  1F77 A;  1JB3 A;  1WTR A;  4XQQ A;  2PPB C;  1ZYR C;  4RCO A;  4CKB A;  3VR3 A;  1GUS A;  4XQN A;  1Q1B A;  4UAI A;  1GUN A;  1SE4 A;  3QB3 A;  1SMY C;  3HOV B;  2KEC A;  5EPK A;  3CRK C;  2DY7 A;  1HHV A;  3URY A;  3T16 A;  5KIX A;  4ZYS A;  1H9S B;  5KND A;  3K7A B;  4KKU A;  3L3O C;  5I9O A;  2IL8 A;  1X3P A;  5CV4 A;  3MXP A;  3MWY W;  2IPK D;  2NVX B;  1BUV T;  1J9O A;  1ZXT A;  4RHR A;  5EKK A;  3PV0 A;  1A15 A;  1ICW A;  2F0L A;  1O78 A;  3BVG A;  1DD2 A;  4FYD A;  1C48 A;  3R2T A;  4FXK C;  5D3D A;  4I7Z C;  3S1N B;  2EVB A;  2F0J A;  2K04 A;  2F0V A;  4A3F B;  2B2U C;  2SDF A;  1XYI A;  4C3I B;  1UAP A;  2J7Z A;  3GV6 A;  4H7B A;  5M5Y B;  1OXT A;  1CZW A;  3PUX A;  5CV6 A;  3K5M A;  1EU3 A;  4KD3 A;  3NSW A;  4Z9C B;  1B9N A;  2H1E A;  2XIW A;  1LV9 A;  1ML0 D;  3VR5 A;  2K05 A;  1FNV A;  3D31 A;  4KTA A;  3PUW A;  3H91 A;  2DNC A;  4ZAI A;  1U4M A;  1VF5 C;  2LS0 1;  5ELF A;  4R8I A;  3NQT A;  5CV9 A;  3I4L A;  1HUN A;  3OIQ A;  4B9W A;  3QG1 A;  1EL0 A;  1SYG A;  5I2X A;  4IFD I;  1JCK B;  2MJ8 A;  2FIN B;  4G7H C;  2F0T A;  2EYP A;  1TWH B;  4IFD J;  2J0T D;  4X3T A;  2EDG A;  1UUP A;  1SNP A;  5KYI A;  4EQO A;  1O80 A;  1JIC A;  2JA6 B;  1FNU A;  1RJT A;  1EEF D;  1SNM A;  4A3K B;  2JE6 I;  4RGT A;  4OHJ A;  5J1Z A;  2E2H B;  4PNY A;  3BYY B;  4KN4 C;  3W2D A;  2OT2 A;  2F4I A;  3VYR A;  3CHB D;  2ICI A;  2EY2 A;  5CR3 A;  1EY6 A;  1LTR D;  3ERO A;  5CMD A;  1GXD C;  1SYF A;  3NTH A;  3KLS A;  1DXM A;  2N88 A;  2XN9 C;  1Q1E A;  3VA5 A;  1AEX A;  3S2H B;  2F0D A;  2F0M A;  4KN7 C;  1PRT D;  2A73 B;  3Q24 A;  3P7J A;  2JA7 B;  2TMP A;  1GHK A;  5IGF A;  3HEJ A;  1DJR D;  4KJO A;  1F9Q A;  1BOS A;  1EU4 A;  3MZ5 A;  3PUZ A;  1VMP A;  2B2V A;  3K58 A;  4DU9 A;  4R9W A;  1LT5 D;  1QOH A;  2XSC A;  1YNJ D;  1HA5 A;  1S4Z A;  1NUC A;  3J7Y W;  1V43 A;  2LMC B;  1EYA A;  4LJZ C;  3BDC A;  1MSH A;  3I8Z A;  1X3Q A;  2WP8 J;  3MC0 B;  1SSO A;  1D1I A;  1UNS A;  2M2L A;  4A3D B;  1IL8 A;  4OO1 I;  4C56 C;  5M3M B;  1BQQ T;  4ULL A;  4DF7 A;  1LTI D;  4B08 A;  1CZG A;  5CC4 A;  1Q3L A;  4HCS A;  4DAY A;  3NK9 A;  4KMU C;  2JXM B;  4H0L C;  4C3J G;  1TS2 A;  3ONA B;  1OXV A;  2ZT9 C;  1TWF B;  5IT9 L;  5I6W A;  3BZD B;  2FMM A;  4KY7 A;  4X3U A;  3TSS A;  5ELE A;  1QNU A;  4BBR B;  3RZO B;  4FP5 D;  2LKV A;  3J7A F;  4FVM A;  4XQJ A;  1WCM B;  5EKI A;  2K01 A;  2QF7 A;  1LT3 D;  5DNF A;  3R3O A;  3HP3 A;  5C44 B;  4G7O C;  1STG A;  3S16 B;  1RKN A;  1GUO A;  1TT2 A;  1LAC A;  3HZX A;  2K1B A;  4FNF A;  4O42 A;  3OWE B;  2V4D A;  1LAB A;  3GV3 A;  1NR4 A;  4XXE A;  5CGK A;  2WIN B;  3MXG A;  2Q8R E;  3IFD A;  5C4X B;  3T51 B;  5C0X G;  1ZYR D;  2D62 A;  2AUJ D;  4J8Q A;  4C1N I;  2F3W A;  1PZJ D;  3V96 A;  2XWJ B;  2Z4I A;  4FXD A;  1B2T A;  4IUP A;  1CM9 A;  5EPL A;  1SMY D;  1YNN D;  3A8I E;  1L0Y B;  3M7N A;  2D2C C;  2F0G A;  2EY1 A;  3LX0 A;  1DZ1 A;  1AW7 A;  2RDH A;  1PXU A;  5EKL A;  1CQF A;  4MHE A;  4RGN A;  2A69 D;  2MGS A;  5ELC A;  3S1Q B;  2HUG A;  1CTM A;  2F03 A;  4HSV A;  4L6T B;  5CV8 A;  3OMC A;  2M00 A;  4Q0F A;  1I4Q A;  1VDZ A;  3KLS X;  1PYW D;  3H6M A;  5T1G A;  5I6Y A;  3S15 B;  4ZQ3 A;  2ICE C;  4X3K A;  1F2Z A;  1PRT C;  4IUT A;  2A6E C;  1Y8N B;  3HOZ B;  2K03 A;  1U4P A;  1WD1 A;  2BE5 D;  3FMC A;  5EPJ A;  2B2V C;  2ID0 A;  1MBY A;  4BA2 I;  2F0P A;  5IOD A;  3WOF A;  1B50 A;  2KUM A;  1BNZ A;  3LNN A;  2E2J B;  3VYT A;  2KEE A;  1MSG A;  3KUP A;  1CFM A;  2FMC A;  4BY1 B;  4FF4 A;  1KAA A;  3GTK B;  3H09 A;  5LHY 1;  3VR2 A;  2QDB A;  3S14 B;  3SE0 A;  3AB9 A;  2BCO A;  1SJH D;  4FF1 A;  4KY5 A;  2MHV A;  3ITP A;  2K33 A;  2O4X A;  5IGD A;  2EJF C;  1E2V A;  5CBA E;  1BCP B;  1I4X A;  1ENA A;  1ONL A;  1JWM D;  1TWA B;  3TDQ A;  5C3W A;  2HCC A;  2JEA I;  2KVM A;  1TR5 A;  3SK6 A;  3D4D A;  3MHB A;  5DM6 3;  1K83 B;  1G2T A;  1F2Y A;  5FLX E;  3ERQ A;  2X6L A;  2VXW A;  5A2Q L;  2CVR A;  4TQU S;  3DXJ C;  3HOU B;  1F2M A;  5IIF A;  4WFN 3;  3KLR A;  5KNB A;  5FO8 B;  3BDO A;  3X3N A;  1RF2 D;  1QWY A;  5KEE A;  5EQ0 A;  1EYD A;  2IX1 A;  4ME5 A;  5FO9 B;  2RQX A;  4CKE A;  2JP1 A;  2VB3 X;  1V1P B;  1STY A;  1G2S A;  1H9J A;  2E75 C;  4YIJ A;  3FKI B;  5J39 A;  1EWH A;  1SEB D;  5AFW A;  1HCZ A;  1H9K A;  3RMH A;  5C4Z A;  1BBX C;  2DN8 A;  5COY A;  1SDF A;  1ZEQ X;  2BDO A;  3FDT A;  2NWG A;  3R8B A;  4L8J A;  3M85 A;  1DOK A;  2K6A A;  3TZU A;  3QIA A;  4RKL A;  2NUC A;  2PQE A;  3VR4 A;  3K6O A;  4OL7 A;  4EQP A;  3S1R B;  1QCB D;  1ENF A;  1HQM C;  4C3I G;  1ET6 A;  2WKD A;  1NAP A;  1FGB D;  4LMQ D;  5COR A;  1YNN C;  4ABN A;  1LTS D;  4UDU C;  3NBI A;  4DA2 A;  1ILP A;  3QO2 A;  1OO9 B;  2A69 C;  4DN4 M;  3SK4 A;  1PDQ A;  1I3Q B;  2K32 A;  2B8F A;  4K5V A;  1PMR A;  2RA4 A;  3T4A C;  1CA5 A;  3TN2 A;  2R6G A;  4C2M B;  3FEW X;  4TRD A;  3MXU A;  1H9S A;  2BE5 C;  4IUV A;  2DY8 A;  3HKZ B;  2PW5 A;  3DHQ A;  4RH6 A;  1EZ6 A;  2QIL A;  2YYZ A;  1STA A;  1AZP A;  2EY6 A;  4DXG A;  3GTM B;  5C0X I;  2MUY A;  3NTK A;  2G9H D;  5C0X J;  4X3S A;  2QCP X;  5LL6 S;  3J80 L;  4NKL A;  1ILQ A;  4ODG A;  1G8Z D;  4HSP A;  2R93 B;  4KI0 A;  4K2K A;  5NUC A;  1WD0 A;  4M1U B;  3RLF A;  4HR7 B;  3GO5 A;  4QIW B;  3NXW A;  4C3H B;  1WTW A;  5JEA H;  2K5W A;  1D5M C;  1LO5 D;  2HDL A;  2RKS A;  4DAV A;  1JWU D;  1BCP C;  5I2Y A;  1K8M A;  4IUN A;  3S1M B;  1AFP A;  4BY7 B;  4DK1 A;  3MAQ A;  1M8A A;  2NN6 G;  1CHQ D;  5C4J B;  2EYJ A;  3MFY A;  4OIJ A;  2EYO A;  4M8A A;  2X69 A;  1U4L A;  5KNC A;  5IGB A;  1EQV A;  3K5O A;  5C3X A;  1IYV A;  2A68 C;  1SNO A;  2Z8L A;  4XIG S;  2XVS A;  4A3B B;  4XYO A;  1STH A;  1CHP D;  3I70 A;  3NPP A;  4KKT A;  4CBV A;  3V2T A;  1O7Y A;  1SE2 A;  5FKA C;  2F0E A;  3LWU A;  4BS9 A;  1EY9 A;  2NN6 H;  4WJW A;  1S5C D;  5M3F B;  2R3Z A;  3MEH A;  1EWC A;  3E5S A;  4JBW A;  4HED A;  3A8J E;  1O7Z A;  2EPB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...