2KECA

Structure of sdf-1/cxcl12
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
68
structure length
68
Chain Sequence
KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Stromal cell-derived factor 1-alpha
publication title Monomeric structure of the cardioprotective chemokine SDF-1/CXCL12
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 13
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2009-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2kecA00
1GUWA 1G2SA 1O80A 3H91A 4XT1B 1RTOA 1M8AA 4MHEA 2KEEA 4XT3B 2VXWA 3F2UA 2L11A 1NR4A 3QO2A 1PFBA 2M2LA 4OIKA 4ZLTF 1WTQA 1F9SA 4R8IA 3I8ZA 1SAPA 3I90A 2NWGA 5AFWA 2H1EA 5E4XA 4HAEA 2J7ZA 1PFNA 1QG7A 1U4RA 2X6GA 4U68A 1BF4A 2FHTA 5EJWA 2K03A 4CJ2C 1B50A 2NZ1D 1G6ZA 2Q8RE 1WVLA 3HP3A 1U4PA 2FJ2A 3TN2A 1LV9A 1QNKA 1HFGA 1O7YA 2K01A 1WTVA 1F2LA 4ZAIA 1RTNA 1JICA 1WTPA 1PLFA 5EKIA 1AZQA 1F9RA 2BDNA 5CMDA 4OIJA 1PDQA 5CBAE 1X3PA 3ONAB 2FFKB 2K28A 1S4ZA 2D9UA 1SSOA 3GV6A 1HHVA 1MI2A 5T1GA 1G91A 1CA5A 1IKLA 5COYA 1X32A 3FDTA 2XIWA 1B4OA 4R9WA 1B3AA 3LWEA 1XYIA 5DNFA 2DY7A 1CM9A 1IKMA 1EIHA 2MGSA 2RA4A 1VMPA 2N88A 2L9HA 4IUUA 1WTOA 2HDLA 1B2TA 1AZPA 1B53A 1BBXC 1E0BA 1PFMA 1BNZA 1AP0A 2B2VC 2MP1A 5T1IA 3SVMA 3P7JA 3IL8A 1EQTA 1ML0D 4CJ0B 1IL8A 1SDFA 1XX8A 2JYOA 2RVLA 4LMQD 2K05A 2SDFA 2B2UC 2EPBA 4HSVA 2CVRA 4UAIA 3G7LA 1WTWA 2K1BA 3Q6SA 3N52A 1ZXTA 4CJ1B 1WD0A 1DONA 1DZ1A 1U4MA 1TVXA 2RSOA 2B2VA 1MSGA 4IUPA 1QE6A 2N55A 2K04A 4IUVA 3TZDA 1DOKA 4QUCA 2B2WC 2JP1A 5CORA 4X3TA 5EPKA 1EIGA 4HCSA 4ZK9B 2B2YC 4DN4M 1U4LA 3DEPA 3R93A 4ZKCB 2B2UA 3I91A 4RWSC 2KOLA 1NR2A 2KECA 1RJTA 1F9QA 5D65A 4O42A 5EPJA 4IUTA 1KNEA 2IL8A 1JE4A 3IFDA 2B2WA 2HUGA 2R3ZA 1F9PA 2B2YA 1DOLA 3DEOA 1ICWA 4NW2A 3KBXA 2HCCA 2EOTA 4IUQA 4X3UA 1VMCA 3DM1A 3MWYW 4HEDA 1MGSA 1CA6A 1J9OA 5JJZA 1RODA 1HUNA 2B2TC 5CBEE 1C8CA 2L12A 4QUFA 2KUMA 1DOMA 3I3CA 4RAUC 1WTXA 2RSNA 4IURA 1EL0A 2HDMA 1G2TA 4XDXA 4X3KA 4X3SA 5EPLA 1ILQA 2HCIA 2MPMA 2EE1A 2B2TA 4MN3A 1WD1A 1MSHA 1Q3LA 3UI2A 1WTRA 2FMMA 2L1BA 2NYZD 1ILPA 1NCVA 1HUMA 2Q8TA 2FINB 1NAPA 1HRJA 1HA6A 1HFNA 2X69A 2X6LA 1A15A 3GV3A 5EQ0A 1KNAA 1BO0A 4RA8A 5D14A 2MJ8A 1O7ZA 1ESRA 1RHPA 4ZKBB 2L4NA 1J8IA 2DY8A 3FPUB 1X3QA 2KVMA 3MTSA 1EOTA 3D6WA 3KUPA 2KEDA 5E4WC
chains in the Genus database with same CATH superfamily
5IOCA 3VYSA 2JA8H 1RTOA 3PIOA 4GLVB 4C2MB 2A68C 3OTOQ 1Q81C 1BCPB 1F9SA 1OO9B 1VQNA 4OONA 2YU9B 4R8NA 2F0LA 1PFNA 1Y69U 4A3CH 4PG3A 3NUCA 2OEOA 5IT9L 2B29A 3NQIA 2K01A 3A55A 3PO3H 1F9RA 4IJLA 3I2ZA 3DLLA 4B08A 3MEHA 5GAEC 2HHHQ 3E0EA 1PV4A 5EBCA 3J7AF 1XXGA 5KNBA 4LF9Q 2EYMA 4K2LA 1GHJA 1WCMG 3CPFA 2ZJRA 4YWLA 1S5FD 3S14H 3EFXD 2ZTCA 3I72A 1H9SB 4PMBA 4JI2Q 2ICEC 4JI5L 3PIPA 2JA6B 5KNDA 4FXDA 5K36G 3CKIB 3EIVA 2FMCA 2IW3A 2R6GA 1XMQL 3M85A 2NVQH 1JC7A 1BXTA 4DV6L 2UUAL 4R4QA 1HQMC 5IIFA 2KCTA 4H13C 3I73A 4KN7C 3UDIA 3QOJA 3EQLC 1WTWA 4A3BB 2JEBI 3HOXB 3N52A 4ZRZA 3JAML 1UE1A 3LWUA 4ABNA 2WIIB 1Y1VB 2PI2E 5KYIA 4ZK9B 4HCSA 1L1OC 3S15B 3V2TA 3I91A 3FEWX 1CQFA 1CTMA 4I7ZC 1VS0A 3J81j 4LF5L 3M7GA 3Q8DA 4IUQA 1VMCA 5FLXE 1WYDA 3MWYW 3VYUA 1VQMA 3GTOH 1HUNA 3P75A 4I7AA 3G48A 3QWNA 2A6ED 4A3DH 1I5FA 3N6RA 5IYCG 1LTRD 4XDXA 2QILA 1W2BA 1Z6HA 5IGEA 5IP9G 4IUNA 1X56A 2L1BA 2UXCL 1L1OB 1AE2A 1HA6A 4H7BA 2K33A 1A15A 3HOUH 4R4OA 2NVTH 3U4VA 4K8IA 3K5MA 1J5EQ 1J8IA 3MTSA 1X3QA 2KVMA 3M9BA 5C4JB 4JI4L 4XT1B 2IWHA 1S5CD 3NWTA 4G7OC 2NVXB 1PFBA 4A93G 5I6WA 3C1EA 1SAPA 2WB1B 1W6KA 4C1NI 1E22A 3BDOA 1QG7A 4A3IG 4HN7A 2E2IH 2PQAA 3CCVA 3T1YL 2A5HA 5F2DA 2ENBA 4JYAQ 4JVZA 1KHIA 1VQLA 2R7FA 3SK4A 4JI6L 2E2JH 1VQDA 1HNZQ 3ONAB 1PYBA 1TS2A 5IYBG 3TS0A 4TSSA 1ET9A 4KY6A 5E3FA 1C0AA 5LMNW 3E5SA 3PO2H 3NELA 4DA2A 1N32Q 1GUGA 1PTOF 3PIO3 1TKWB 4IPDA 1QB5D 3PUWA 3NHHA 4YY3Q 4P2CB 5IGDA 1A62A 4C56C 2B2UC 3H3VH 3OWEB 4GKJL 4BY7B 3SGIA 1ZXTA 1DONA 1MSGA 4RGTA 2GVBA 3H0GG 5CORA 1I4PA 1EIGA 3CQZB 3NXWA 2IPKD 4QIWE 1R9TH 4M8AA 3E6ZX 3L9AX 1H95A 2HUGA 2JN4A 1STEA 5M3MH 2B2YA 5IT9c 2ATWA 4K0KL 5M5XB 1BQQT 3PIP3 3I56A 1CSPA 4CDCC 4ME3A 3HOXH 4A3GG 3X3NA 1S5BD 2I0QA 4LFAL 3S16H 1B70B 5ISRA 4RAUC 1WTXA 1ENCA 3X3MA 4DAYB 2E8GA 2E74C 1SLJA 1HA5A 4CGYB 3UI2A 4A3JG 1ILPA 3GTLH 5JJKA 4Y7NB 5C6AA 5E7NA 1G8ZD 2MJ8A 2I5MX 3F1ZA 4XQQA 2DY8A 4IFDG 2XSCA 1STHA 4K5VA 1ONLA 1MHWC 2ZM6L 4CBVA 1FGBD 3NE5B 3RUZA 5BN5A 3KFUA 2M2LA 1STNA 2A6EC 3HOVG 4JI0L 1X3GA 4DUYL 3PMFA 1HXYD 2WV6D 4U68A 5GAGC 3W3AA 1TWCB 4LF4L 1U4PA 3CF5A 3CC7A 1LV9A 1HFGA 4N9PA 4FO2A 1YIJA 3FVQA 1WTPA 3JC66 3SHLA 1YHAA 4DPGA 1I4XA 4XYQA 1Q90A 1A6XA 1X3PA 2NZOA 3KJPA 4DKAC 2D9UA 2NBFA 1SSOA 2R7ZB 1HHVA 4R1JA 4B3ML 1STBA 1CA5A 1OXUA 2BH2A 4DV4Q 3T53B 4KHPQ 4DR3Q 1EIHA 4GN5A 2MGSA 5JJLA 1WTOA 4IUUA 5JPMC 1TWFH 1WJJA 3AEVA 2F3VA 3MXPA 1EQTA 3M4PA 2JYOA 2Z0SA 4EGVA 2SEBD 5CV6A 4B3SQ 3G7LA 3J7YW 3S1NB 1GUWA 4XTCS 4LF6Q 2RSOA 1TVXA 1NE3A 3TZDA 1PH7A 1HR0L 1STGA 5EPKA 4A3DG 4RHRA 2ZJPA 4DN4M 3M4YA 3HKSA 2R61A 2JXMB 4C3IG 3WDNA 2DJGC 3RN5A 4IUTA 1PHJA 3L3OC 3TEHB 1FJGL 1XPOA 1A0IA 1VQBA 1LTTD 2RDFA 1JWSD 4K5XA 3VR6A 1IL2A 1SNMA 1LTGD 4DK6C 3KBXA 3TP7A 1BCPF 1YZ6A 5CV4A 3SR1A 4X65L 3RNUA 3DWPA 2F0JA 2PO4A 4NMZA 1IBKQ 1EFWA 2C5CA 3HZXA 1D1IA 2J0TD 2N78A 3A8JE 4IURA 4X3SA 4HMJA 1N36L 4X6AH 4JI1L 4YHHL 1HNXL 3NWSA 1MKHA 5A2QE 1HRJA 2OTLA 1BR9A 5FJ8G 4HIOA 1RL2A 4HJ8A 4YWKA 2F0FA 3IFTA 3KUPA 3K57A 3TRZA 5EGTA 4V0BA 1TIID 2CCZA 1NUCA 1LM0A 3QO2A 4P74A 1GD7A 3R2IA 3D4DA 3PO2G 1Q8KA 3KF8A 5M3FG 4BBRG 2RHSB 3P1HA 4G57A 4HAEA 2LKVA 4JI5Q 5EJWA 1HCZA 3Q0AA 1PH5A 1XMQQ 3NBHA 4DV6Q 2UUAQ 2DJFC 1CZGA 2EIFA 1D5XC 4KK7A 1VQ5A 1PH2A 5CC4A 2NVYB 3GV6A 2TMPA 1HR0W 1GUNA 4A3FG 1MJEA 1RF2D 4LF8L 1LT4D 4BBSH 5DNFA 2DY7A 1QVGA 1EYCA 2RA4A 2N88A 5LMNQ 2L9HA 1MBYA 3H6MA 1CSQA 4DV7L 4QF4A 1B53A 2Q2UA 1E0BA 2AUJD 4UHVA 2Z9HA 2F3WA 3S1MH 3A5ZB 3SK5A 1R4PB 3WWVA 3W1GA 4JCVE 2LFNA 2RVLA 4IO9A 1U5KA 2SDFA 4HSVA 4OHJA 5C0XJ 4ALPA 2F1MA 4LF5Q 2VQEL 1D5ZC 4TVAB 1E3PA 4ME5A 4A3EB 4IFDI 4EQPA 2E76C 4JBJA 1KC8C 2JP1A 3KOJA 3LX0A 3GD7A 1UNSA 1I94L 2EYOA 2EYHA 5IY0A 1KNEA 3AFQA 1PTOC 2B2WA 1N9WA 3R8BA 4RG1A 1BCPD 2YYZA 2R92G 2UXCQ 2EY6A 1PH1A 2QGQA 5KIXA 2DUDA 4DV0L 4A3MB 1E1OA 1SYBA 1J9OA 4C3HH 4QGUA 3K7UC 3CMEA 4RGOS 5M5YH 3F2BA 4JI4Q 1WCMH 1N32L 4X3KA 1SNCA 1SNOA 3K8AA 5I2YA 2VY3A 4B3RQ 4YY3L 5K36H 1I50H 4XIGS 5TSSA 2A19A 2M00A 3AU7A 2RCFA 3CCRA 1J6QA 2X69A 1TS4A 4PZ6A 2O5IC 1YJNA 1KDCA 2L4NA 3T1YQ 2F0DA 4A3GB 3QOLA 1PTOB 4QIWB 4KN4C 3LGJA 4HJ9A 2JA8B 2A68D 1M8AA 2MHVA 4JI6Q 3BDCA 2F0UA 5LMUL 2I46A 2Y0SG 4CKBA 4LUVA 1ENAA 1NR4A 2KA7A 2WFWA 2EYPA 2XRSD 1ZEQX 5DLQE 1NBWA 4YCWA 2CW0D 2PNRC 4DR4L 1B50A 1WVLA 3HP3A 2I5LX 5IGBA 3G4SA 2OTJA 3PO3B 2QA4A 4RH6A 1LTAD 4QMGA 1EZ8A 5E1FA 4GKJQ 1QUQA 1UE6A 3KYHC 3KLWA 1LTLA 4AYBE 5IYCH 3S14B 1Z47A 1DD2A 5IP9H 4CKCA 4Z9CB 1PFMA 2NVQB 2VL6A 2IHEA 2K32A 2UU9L 4K8JA 5C3XA 2CVRA 1HNWL 2K1BA 4K0KQ 3NTKA 4BY1G 3W2DA 5IGGA 4N9TA 4QUCA 1QCBD 4H02A 3U9SA 5FO9B 1NMFA 4LFAQ 4HJAA 3D3RA 4A93H 1HJPA 4DV1L 4NKLA 1V1PA 1I3QB 1CKNA 3FKIG 1YI2A 4A3IH 1NTGA 3EN2A 1TS5A 2ZXRA 4DV5L 1E7ZA 3HGBA 4GNXA 3NEMA 3AYHB 4GKKL 2EDGA 4BWGB 3D4WA 4DR6L 2AMCB 4UPAA 3GTOB 3R3OA 5CBEE 4PNYA 4YCVA 4GOPB 3BJUA 1KAWA 3U58A 4A3DB 5IYBH 1NSNS 5I9PA 2E5LL 3KDFA 2JE6I 4HIMA 2ZM6Q 2EJGC 4FDBA 2KBNA 2NN6I 4DR5L 1DGSA 2R93G 4DNIA 2NYZD 4JOIA 4JI0Q 4DUYQ 2BA1A 5GADC 1KIXA 3HOUB 1BO0A 4F87A 2NVTB 1E2ZA 3Q23A 1BCPC 1PRTB 2WAQB 4LF4Q 3CCQA 1RCVD 1SRUA 3QR8A 1JB7A 2YTXA 1TWAH 2F0PA 1CZWA 3H91A 4H44C 3H0GH 3TBIB 1GUTA 1JR0D 1B3QA 4FF1A 1P8LA 3J7ZC 3H3VC 4B3MQ 1PH3A 1DXMA 5I4DA 2H1EA 4A75A 2E2IB 2N49A 4CDDC 2BA0A 2D0PA 2IX1A 2XWJB 5ELDA 3SK8A 3PF5A 4CDFC 3TP8A 4Q0FA 1EOVA 3D4RA 1AZQA 3I4NG 1QWYA 2E2JB 3TP5A 4AQYL 3GTGH 2FXQA 2D0OA 1D8LA 2VUMG 2YTVA 2ES2A 1XMOL 1A3TA 1F2ZA 4GS3A 1HR0Q 3LWEA 1L2FA 3PO2B 3BU2A 5CGKA 5M5WH 4A3JH 2VNUD 3H94A 2LXKA 4YCUA 2D62A 5ELBA 3MFGA 1SDFA 2RCNA 1FJGQ 2ID0A 2CW0C 2KENA 4O0AA 4IFDH 1GVPA 4C3HG 2AQ3B 1A3UA 4N8X1 4X65Q 3GTMH 4IJHA 2UUCL 3S2DH 3RN2A 3R93A 1W6JA 1X3FA 3HOVH 2CFMA 4H0LC 1R9TB 3CCUA 3IFDA 1K3RA 5M3MB 4MTNA 4I65A 1L1OA 1N36Q 2Z6KC 3PCOB 3MEFA 4JI1Q 1Y8OB 4YHHQ 1HNXQ 1ZKOA 5FO8B 1K8OA 3DM1A 4ZUIA 2B63G 3OSOA 1VQJA 1B9MA 3FPPA 5FLXL 1RODA 1K3BC 3STBD 1C8CA 3KF6B 2NTTA 1K83H 3S16B 3PV0A 1PH6A 1CHPD 3KBGA 5L37A 3EBEA 2NB0A 5LMNL 1G2TA 1LYLA 5HY6A 3CC4A 1TU2B 4L5QA 3T1HL 4UP8A 1WD1A 1TY0A 1WTRA 3GTPH 1I3QH 1FD7D 3GTLB 1HUMA 4DR7L 1EYDA 3W5OA 4B3TL 3S2HH 2EJFC 4A3KG 2XTIA 1LABA 1K8MA 1EOTA 3M3YH 2KEDA 5E4WC 2K5VA 4OWWB 2WKDA 1VQEA 3I4MG 3F2UA 4KKTA 1RD9D 1O78A 1WTQA 4C3IH 3I8ZA 4LF8Q 2J7ZA 3HKZG 4G7HC 1X55A 5DM73 4DV7Q 3A56A 4LJZC 2RDHA 1JICA 3OOCA 2AQ1B 3K0YA 3K81C 1PDQA 5C5LA 1BDOA 1FL0A 1W3SA 2K52A 2Y0SB 2VQEQ 1G91A 4B3RL 1B4OA 1LT6D 1LTBD 1Q8IA 1JOKA 1QILA 1VMPA 5J3BA 5KGUA 1I94Q 1TWFB 1NY4A 5D3DA 1I4RA 4LFBL 3MZ5A 1RDPD 3MXUA 3O13A 4KKSA 1EY0A 3GO5A 3C2PA 2R7DA 2QW7A 5FJ8H 1S72A 3Q6SA 2VZAA 5KEEA 3GTKH 4LUZA 2ZXPA 3VR2A 4DV0Q 3F8TA 4ID6A 3ULPA 3MAQA 2PNHA 1H9KA 4F8MA 1YNND 2B2UA 2HIXA 5CV5A 4ZKCB 4JI7L 1G6PA 4DGZA 1RJTA 5C4XG 4DU9A 5M3FH 4BBRH 3PF4A 5J22A 4JPBW 2R3ZA 3Q22A 2CHBD 2QCPX 4B9WA 4Q5VA 1E2VA 1D7QA 4JBKA 4AYBB 4KHVA 1PYSB 1LTSD 2L12A 1HQRD 2UXDL 1Z9FA 3CMAA 4A3FH 3HOYG 1GOZA 1VQAA 3PUXA 4UP7A 2EY2A 5LMUQ 4DK3C 3EA6A 5I6YA 4WFN3 1EU4A 3CCMA 2AWOA 2F4VL 4JC0A 4RCOA 5EQ0A 2F3IA 1ESRA 2C9OA 4DR4Q 4K6LA 4GN3B 3NBIA 1LT3D 2EY5A 2H5XA 1TQOA 3AB9A 1KABA 2DGYA 4IPGA 3HOWG 3STBC 1JOOA 3URYA 1BVSA 5ELCA 4U673 3QG1A 1KDBA 1U4RA 2CQAA 3AMUA 4F88A 2EY1A 3TSSA 4CJ2C 2PQAB 3ND9A 3TQYA 4WJWA 4OWXB 2R92H 2FJ2A 1SYDA 1VQGA 1VQCA 4IQZA 5FLXc 4IFDJ 4DF7A 3D8GA 5CMDA 1CFMA 2CH4W 2UU9Q 3K58A 3E9HA 1HNWQ 4JBWA 1ET6A 1X32A 4BBSB 3UDGA 1XYIA 1EY7A 1CM9A 5CYUA 4IOAA 2LY7A 3T16A 2EYLA 3H09A 4IN3A 2IJ0A 4JV5L 3S1MB 1II3A 4DV1Q 4IALA 1XX8A 4DV5Q 4LFCL 1JJ2A 4WRDA 4GKKQ 3F2DA 1U9RA 4DR6Q 4MIUA 2VUMB 4DXFA 1B8AA 1DOKA 3T13A 4UY8C 4PZ8A 4KKUA 4E6IA 1SE4A 1IHZA 4RWSC 1PTOD 2KECA 2E5LQ 1AEXA 1PRTF 4O42A 1TT2A 2K5NA 2IHFA 5ELFA 5C3EG 1TXYA 4DR5Q 1QVCA 1A2UA 1BOSA 2PI2A 2G9HD 3MXNB 4OX9L 4BA2I 1NNXA 4NPSA 2OXPA 5I2XA 1SYFA 1EU3A 4C3HB 4A76A 5J1ZA 2SNSA 4QUFA 5M5YB 1WCMB 4DAMA 2HDMA 4J1MA 2WAQE 4O2DA 4DUZL 3M4OH 4PMCA 2JA5G 1B7YB 5GAHC 1I50B 1YNNC 4CHTB 1JB3A 4LNQA 4A4IA 1Y1WH 5A2QL 3I70A 1SN8A 5C4ZA 1G51A 1HZ9A 4BY1H 5CV9A 2WACA 2Z6BA 3VR3A 1PFSA 1U0LA 1KRSA 5FK9C 2B3GA 4DAVA 2ZJQA 3BVZA 2MFIA 1ESFA 2VXWA 4AQYQ 1VQ7A 4ZLTF 3MFYA 3M7NA 5AFWA 1XMOQ 3FKIH 1AH9A 1DCZA 4C3JG 1BF4A 4R4TA 3A5UA 4L8JA 3BS1A 2XVSA 1G6ZA 5C44H 1SXTA 4GLXA 4ZAIA 4X66L 1WI5A 4HTHA 5CBAE 4HJ7A 4JI8Q 3K80C 1M90C 1T5EA 2AUKA 4UDUC 1MI2A 3WOFA 1T9HA 2EYFA 1Q12A 1VQIA 4RHSA 3CU7A 4UP9A 2NTSA 4NXML 1EY9A 2DNCA 2UUCQ 3AQQA 3F2CA 2R93H 4GZYC 2IT1A 3CHBD 1SNPA 1IZ6A 2A69C 3K59A 3K5LA 1PVOA 4B9XA 1K8GA 5HURA 4C1NK 4X3TA 1OXXK 3BVMA 1YBYA 1PRTD 1U4LA 3DEPA 1SYCA 2LXJA 3OW7A 3TS2A 4A93B 4KMUC 5EPJA 2NN6G 3J7A5 3SK6A 4A3IB 3T1HQ 2CWPA 1DOLA 2ALYB 5C5MA 5IYDG 4X3UA 1HZBA 4FP5D 5DEHA 4DR7Q 1MGSA 3UE1A 2RKSA 4B3TQ 3I4NH 5JJZA 1CKOA 1EY8A 1KRTA 4KLKA 1SMYC 4JK1C 2VUMH 1DOMA 2HD3A 4BXXG 3DHQA 1PH4A 1UE5A 1ILQA 3BYYB 2JA6G 1F2YA 1V9PA 1STYA 5EAYA 4JW0A 4KTAA 1QVFA 4ZYSA 1N33L 1HFNA 3GV3A 2SOBA 3SE0A 2SNMA 5C0XG 4A3BG 3FPUB 1IBLL 4MTKA 2G5DA 1SE3A 3QJYA 1TWAB 2A74C 3H0GB 4NDXA 1Y1VG 2IX3A 1KXLA 4FVMA 2O4XA 1HTLD 1LTID 1UUPA 2F0NA 2F0OA 3GQBA 1PH8A 4OGQC 3RMHA 3I90A 3KF8B 3J80E 3U4ZA 1XWEA 2B8GA 2Y0SE 1SEBD 2D2CC 2FHTA 3OWFA 5ELNA 1HZAA 3ULLA 4DV3L 2PW7A 1FNWA 2Q8RE 1EY5A 2AHOB 3EVQA 4F7XA 4HIDA 1QNKA 2NZHA 3NBHB 4DK1A 4LFBQ 2B63H 5NUCA 4MNOA 1AW7A 3ICEA 3GTGB 2JQOA 1HTPA 3HEJA 1FGUA 3HOZG 2GVAA 5COYA 1A8VA 2PZWA 3FHWA 3CRLC 2J4XA 3ULJA 3NTHA 5M5WB 1H9MA 4A3JB 4JI7Q 1AP0A 4BA1I 2B2VC 3SVMA 1D5MC 1ML0D 3PUYA 1MIUA 2L0CA 3T56B 3MHBA 1C4QA 3PGZA 4UAIA 2VQFL 1UWVA 4A3KH 5LL6X 2K7VA 4CJ1B 2F4IA 1U4MA 3ERQA 2N55A 4CDEC 3GTMB 5IP7G 1GXDC 2OWOA 3MA2B 3S2DB 4ODGA 3I4MH 3I4OA 5JVH3 2A8VA 3GTQH 2UXDQ 1Z7TA 1E1TA 3HOVB 2WB1G 1EFID 3CCLA 1A2TA 1F9PA 2O2LD 1FNVA 2KHIA 4GOPC 2B8FA 4NW2A 2HCCA 2EOTA 3K5NA 1Y1WG 1TS3A 2F0QA 2XN9C 3U50C 1GUSA 2F4VQ 2KHJA 5BN4A 1BBUA 3PUZA 1K83B 2A1AA 1N34L 2HT1A 3ND8A 1MJCA 1I6HB 1TWGH 2ASBA 2WKCA 2OCEA 1DYQA 4LW1A 1PRTC 4ZCKA 3GTPB 3CC2A 1Q86C 2YTYA 1ASZA 1GJXA 5C44G 5JVG3 3S2HB 1PZJD 4IOCA 4XXEA 4BY7G 3M3YB 3S1RH 1GUOA 4PQXA 1V1QA 1SYGA 5H1SE 3CCSA 2JA7G 5JEAG 3S17H 4LK1C 3SXHA 3ERSX 2F0HA 3CP0A 4ZUJA 4C3IB 1BUVT 5C4XH 2KQ3A 1A3VA 2C35B 1KTKA 1RKNA 1IBML 5IGFA 4A3LG 3FRPB 1VQHA 4JV5Q 2D5DA 4KV6A 4X64L 1M4VA 1K0SA 2P5ZX 4LFCQ 2MNAA 2L5TA 4X62Q 1QUQB 4DNTB 2K14A 4P72A 3HOYH 1I4QA 3D31A 3FDTA 3C3LA 1H9SA 4TRDA 3S9WA 1AZPA 1GM5A 3RZDB 4RFBA 1IYUA 1VDZA 4LUOA 5ELOA 3C46A 4DV2L 1SNDA 2VW9A 2O5JC 5C0XI 1JCKB 1O7IA 1EWHA 4OEMB 4OX9Q 3KF6A 3BZKA 3GTKB 4IUVA 1JWUD 2LS01 4Y52H 2HQLA 3G6JB 3HOWH 4L6TB 4BS9A 5BR8L 1EZ6A 2V1CC 1V1PB 2F52A 5M3FB 1D1KA 4BBRB 2IL8A 3GTJH 4DUZQ 1AFPA 1JOQA 3HFZB 2L55A 2MQHA 1K28A 4GNXB 2KCCA 3E9IA 1E24A 4JI8L 2B2TC 1PZKD 2CQOA 3RR5A 2R7ZG 2KHSA 2Z6KA 4A3FB 4XYOA 3DUZA 3DWQA 2ZTEA 3KDFB 1K9MC 5AJ3L 3OMCA 1A63A 5EPLA 2XGTA 4DR1L 2HCIA 1CQVA 4G7ZC 1R4QB 4FNFA 3GDEA 4S3SA 2RF4A 2FINB 3T51B 2EQSA 4LF7L 2ICIA 3TMEA 5EKLA 4RA8A 3A7LA 3Q24A 4RCNA 1D2BA 1CK1A 5FLMG 4X66Q 3W1BA 1GKHA 4APVA 1I6HH 3AFPA 1BBWA 4OIKA 2UUBL 4PV1C 4NXNL 1D6EC 1Y8NB 4NXMQ 3EJIA 5C3EH 2KCNA 5IT9E 2F0EA 2WINB 4DFAA 4PMWA 4FYDA 2R92B 3TN2A 4KD4A 3UDFA 1T5XD 4EQOA 4LWCA 2EZVA 3HKZE 1HZCA 3K7AH 3KLSA 5KRUA 5JAVA 1ZYRC 1P16A 2FFKB 4M1UB 1DJRD 2QDLA 2WP8J 4JG2A 2OQ0A 4POFA 2CKZB 2XIWA 4L5RC 1M1KC 2JA5H 3KLRA 1SR3A 1BBXC 5KYLA 1YJWA 3P7JA 2VB2X 4AIMA 2Q8IB 3BVGA 1EUJA 2G9DA 1VQ4A 3JAME 1XNQL 2EPBA 1TWHH 1B44D 1WD0A 4G4KA 1SJED 3L7ZC 3CRKC 2PMZE 2K5DA 3HOZB 3CCJA 3CW2C 5EBDA 1H9RA 3HG9A 1F9QA 3PUVA 3RZOB 2AKWB 1CT1D 4C3JH 3IKJA 1SFOH 2RQXA 3RZDH 1JT8A 4OO1G 5M9OA 3K6OA 5GROA 1N33Q 2F0GA 3DXJC 5G3LF 1VCIA 3OYYA 4J15A 1IBLQ 2E2HH 1YNXA 3TZUA 4KHZA 3E0JA 4DAYA 3M4OB 1K8AC 1JJCB 4QY7A 1Q3LA 2OF1A 3KJOA 2Z4HA 2UXBL 4FXGC 1EYGA 1PXUA 4IPHA 3CAMA 2K50A 2EXDA 1Y1WB 3UDXA 4DV3Q 2K5HA 5IE8A 2RSNA 4BY1B 1KLGD 4YWMA 4A3EG 1RIPA 1O80A 1V43A 1X54A 1UE7A 1AN8A 4C2MH 4KJNA 2K5WA 4P73A 4R8IA 4DR2L 2RHQB 1Y14B 2YU9H 2PCFB 2NWGA 3FKIB 2NN6H 5E4XA 3ZJYC 2QDBA 4QB4A 1IW7D 1YVCA 1VQ9A 3J80i 1LO5D 3OMGA 1I4HA 5C44B 1K73C 2AWNA 3C1FA 1FR3A 5IYDH 1O7YA 1FVIA 1XPUA 3VA7A 4A3MG 1S3OA 2HQEA 2EXZA 2VQFQ 3VYTA 2KCMA 1JJGA 2JA7B 3J81i 4BXXH 4JI3L 3HS0C 1Q7YC 4O1NA 2JA6H 3QIAA 2R93B 2HDLA 1YJ9A 3A74A 2A69D 2F0SA 1L0WA 1K0RA 2MP1A 5T1IA 4QL5A 1KAAA 2BE5D 3MXNA 1IL8A 3OPOA 3A8KE 2F0MA 4QQBX 2K05A 1H9JA 5C0XH 3ZYYX 4A3BH 3BDLA 2E2DC 4IUPA 1NMGA 1QE6A 2JA8G 2ZTDA 1WOCA 1Y1VH 1EQVA 3NTIA 1IYJB 2B2YC 2ZT9C 3S15H 1N34Q 2B39A 1ICFB 4FF4A 4A3CG 3NP8A 3ITPA 2F03A 2BCOA 2BOSA 5G3LD 1PMRA 3JAMc 3PO3G 2XWBB 1EY4A 1CA6A 3I4NB 4X62L 1SMYD 1V8QA 3NENA 3VYRA 3TREA 3HOZH 4AH6A 3G71A 4DK0A 2M9VA 5LL6S 3OIPA 2K5QA 1PA6A 3L0OA 1FYCA 2JEAI 3RZOH 1N8RC 1L0XB 1VQPA 1XTDA 2RBMA 2EYJA 3IRBA 3BZCA 2Q8TA 4ZQ3A 4HMIA 1S5DD 3SEBA 2X6LA 5IWAL 1IBMQ 1QNUA 1LLRD 3NPPA 1BKBA 5C4JH 4X64Q 1G2SA 5IP7H 2KEEA 4XT3B 3OIQA 3S24A 2YV5A 2NVXH 1SE2A 2PYKA 4L5SA 5IODA 1I4GA 4K2KA 5CV7A 3KLSX 2PW5A 1XNRL 1OTCA 5I9OA 4HIKA 4MZ9A 1MD2D 2JSOA 4OO1I 4RKBA 2F0VA 4P71A 4RKLA 4GLAC 1F2LA 2B63B 1RTNA 5EKIA 4DV2Q 1YEZA 2BDNA 4OIJA 2QEJC 2GN5A 5DM63 3J7AV 3OTOL 3V96A 3CXCA 4TKOB 2OT2A 4WORA 4NP5A 1IKMA 2EVBA 4XQJA 1EY6A 2QEXA 4RMFA 1HPCA 1X9NA 5BR8Q 5CR3A 1BNZA 2HIVA 1Q46A 4V190 1SMXA 2I07B 5A35A 3A8IE 1QOHA 2MO1A 4CJ0B 1IW7C 3HOUG 4PZ7A 2HHHL 4A3KB 4LF9L 5CV8A 2WAQG 1CI3M 4BY7H 2ZXOA 3I4LA 1S40A 2Q2IA 1JWMD 2Z1CA 1EEID 1C48A 1PZID 3VA5A 4JI2L 1QZHA 3CQZH 1ENFA 3I4MB 1Y8PB 4JBMA 2JA7H 5JEAH 3GTQB 1NR2A 2PZUA 5D65A 5IGCA 2IY5B 1KDAA 5AJ3Q 3D6CA 5ELEA 3HKZB 4DR1Q 2I5HA 4FF2A 4RGMA 2GA4B 4A3LH 3DEOA 1YNJD 5M5XH 4OELB 1VF7A 4DXGA 2AQ2B 2BE5C 4LF7Q 1OXSC 2PZTA 3QB3A 3T4AC 4KD3A 1IXRA 3BG3A 1I6VC 2VB3X 3I3CA 5FO7B 1TWGB 1EL0A 2F0WA 2A6HD 2MPMA 4QCLA 3WOEA 4MN3A 5D3IB 2CH4A 3L2PA 5FOBB 1VQKA 2N3SA 1ASYA 2UUBQ 5KNCA 1WFQA 4NXNQ 3BYTB 4Y7NH 4IZ8A 4DNRB 2PMZB 3I55A 4L63B 3RLNA 1RHPA 4R4CA 1UEBA 4K14A 4EVOA 3S1RB 4HSPA 4MHEA 1S5ED 1STAA 1Q1BA 4FXKC 4L5TA 4HJ5A 3S1QB 3K5OA 3TDQA 1YHQA 3S17B 4KY5A 1VQFA 1EIYB 1NJIC 5C4XB 2VS1A 2X6GA 3TP6A 5M3MG 3J80L 1SYEA 1GO3E 2NZ1D 1J5EL 1TWCH 4N8FA 3IAYA 1IYVA 3B6YA 1JORA 1VQ6A 3HOXG 4ULLA 2QKIC 1XNQQ 1OXTA 1S4ZA 3DMUA 2R7ZH 5T1GA 3J81L 1DM0B 3D0FA 3PSIA 3HOYB 1IKLA 3NK9A 1X65A 4R9WA 3EROA 1TY2A 2F0TA 3VR5A 1B2TA 1EWIA 4JYAL 3E3XA 2BH8A 4KY7A 3IL8A 1UAPA 2JJQA 4HCEA 4LMQD 1HNZL 1SNQA 3BZDB 3S1NH 1DZ1A 3A54A 1KD1C 2B2VA 3JAMi 4FF3A 1X3EA 4QJFA 2K04A 3J81E 3RLOA 5FLMH 2B2WC 2LSSA 2RDGA 1CHQD 3HOWB 3NQTA 3DWAA 2PPBC 2Q2TA 4CKEA 1C7YA 3UE0A 3VDYA 3I7FA 5C4HA 3GTJB 1VF5C 2V4DA 4WJ4A 4KJOA 1JE4A 1QJOA 5C3WA 1PYWD 4WJ3M 5EKKA 1ICWA 3VR4A 1LUZA 2WB1E 2UXBQ 3DM3A 2H4OA 1YHBA 2BDOA 2CWAA 4GOPA 1PH9A 3GP7A 2XRQD 2QF7A 2IX0A 4KI0A 1VQOA 1JQYD 1EYAA 2EE1A 2PQEA 2FMMA 2JK8A 4DR2Q 4R4IA 3K0XA 1C9OA 4POGA 4J8QA 1Q82C 1SE8A 1JMCA 1SROA 1KNAA 5D14A 1O7ZA 2N8NA 4P75A 4ZKBB 2E75C 1YNJC 3P20A 1UEAB 1OXVA 1Q1EA 1KQSA 1F2MA 3PQIA 2K75A 5HGQA 2XNAC 1WTHA 2L11A 5JPNC 1CKMA 5GQOA 3V05A 2F0IA 1JE5A 1SJHD 3MC0B 1B1ZA 4JI3Q 1VQ8A 1EQRA 2A6HC 5C3EB 2LMCB 3A7AB 3MXGA 2K03A 4OO1H 1QZGA 1CUKA 1ZYRD 3RLFA 4LAAA 3K7AB 1LACA 2F0KA 4YIJA 4AYBG 1WTVA 1PLFA 5JOBA 1TR5A 4OWTB 3CCEA 1HH2P 2K28A 2MUYA 2NVYH 1G291 2TSSA 2Z4IA 4OXPA 5DAUA 5HGTA 5JEAJ 3S1QH 3U9OA 1B3AA 3M4QA 4TQUS 4RGNA 2JA5B 5K5PA 1LT5D 4EQNA 1EIFA 4K6DA 3R2TA 5J39A 2Z8LA 1F77A 1TWHB 3HRZC 3H3VI 3LNNA 1E2WA 1SBBB 2EJMA 2Q2HA 4A3EH 4EX5A 1YITA 4DV4L 3RD4A 4KHPL 2NUCA 4DR3L 4GNXC 2K4KA 1X6OA 1AE3A 5FKAC 2KOLA 1EEFD 2JA9A 2DN8A 3J80c 2OQKA 4C3JB 2A73B 3OHXC 1FNUA 5LHY1 4DAPA 4XQNA 1XJVA 1XPRA 1SFOB 4B3SL 5JJIA 1O7LA 2L15A 4LF6L 4J6HA 2K6AA 3NSWA 1V1OA 5BN3A 3OW2A 4HEDA 1GHKA 4A3MH 3SDZA 5IWAQ 3ER0A 3KK7A 1EQQA 1XTCD 4OL7A 3FP9A 3J81c 2KUMA 4JOIC 4GN4B 2E2HB 3G6EA 2DNEA 3CPWA 4ILWA 4BBSG 1B9NA 4K5WA 4NB3A 3H15A 4IPCA 2B2TA 1MSHA 1CKNB 4HR7B 3A0JA 1NCVA 1KLUD 3MVVA 2KJXA 1NAPA 2MO0A 1XNRQ 3FMCA 1IBKL 1EWCA 1KL9A 3CD6A 1L0YB 4A3GH 3D6WA 4EQ5A 1PTOH
chains in the Genus database with same CATH topology
5IOCA 3VYSA 1RTOA 4C2MB 2A68C 1BCPB 1F9SA 1OO9B 2YU9B 4R8NA 2F0LA 1PFNA 1Y69U 3NUCA 2OEOA 5IT9L 3NQIA 2K01A 3A55A 1F9RA 4B08A 3MEHA 3J7AF 5EBCA 1XXGA 5KNBA 2EYMA 4K2LA 1GHJA 1S5FD 3EFXD 3I72A 4PMBA 1H9SB 4FXDA 2ICEC 2JA6B 5KNDA 5K36G 3CKIB 2FMCA 2IW3A 2R6GA 3M85A 1JC7A 1BXTA 1HQMC 5IIFA 4H13C 3I73A 4KN7C 3QOJA 3EQLC 1WTWA 4A3BB 2JEBI 3HOXB 3N52A 4ZRZA 3JAML 3LWUA 4ABNA 2WIIB 1Y1VB 5KYIA 4ZK9B 4HCSA 3S15B 3V2TA 3I91A 3FEWX 1CQFA 1CTMA 4I7ZC 3M7GA 4IUQA 1VMCA 5FLXE 3VYUA 3MWYW 1HUNA 3P75A 3QWNA 2A6ED 3N6RA 1LTRD 4XDXA 2QILA 1Z6HA 5IGEA 4IUNA 2L1BA 1HA6A 4H7BA 2K33A 1A15A 4K8IA 3K5MA 1J8IA 3MTSA 1X3QA 2KVMA 5C4JB 4XT1B 2IWHA 1S5CD 3NWTA 4G7OC 2NVXB 1PFBA 5I6WA 3C1EA 1SAPA 2WB1B 1W6KA 4C1NI 3BDOA 1QG7A 4HN7A 2A5HA 5F2DA 2ENBA 3SK4A 3ONAB 1TS2A 4TSSA 1ET9A 4KY6A 5E3FA 3E5SA 4DA2A 1GUGA 1PTOF 3PIO3 1TKWB 1QB5D 3PUWA 3NHHA 4P2CB 5IGDA 4C56C 2B2UC 3OWEB 4BY7B 1ZXTA 1DONA 1MSGA 4RGTA 5CORA 1I4PA 1EIGA 3CQZB 3NXWA 2IPKD 4M8AA 3E6ZX 3L9AX 2HUGA 1STEA 2B2YA 5M5XB 1BQQT 3PIP3 3X3NA 1S5BD 5ISRA 4RAUC 1WTXA 1ENCA 3X3MA 2E74C 1HA5A 4CGYB 3UI2A 1ILPA 4Y7NB 5C6AA 1G8ZD 2MJ8A 4XQQA 2DY8A 4IFDG 2XSCA 1STHA 4K5VA 1ONLA 4CBVA 1FGBD 3NE5B 3RUZA 5BN5A 2M2LA 1STNA 2A6EC 3PMFA 1HXYD 2WV6D 4U68A 3W3AA 1TWCB 1U4PA 1LV9A 1HFGA 4N9PA 4FO2A 3FVQA 1WTPA 3SHLA 1I4XA 4XYQA 1Q90A 1A6XA 1X3PA 2D9UA 2NBFA 1SSOA 2R7ZB 1HHVA 1STBA 1CA5A 1OXUA 3T53B 1EIHA 2MGSA 1WTOA 4IUUA 5JPMC 2F3VA 3MXPA 1EQTA 2JYOA 4EGVA 2SEBD 5CV6A 3G7LA 3J7YW 3S1NB 1GUWA 4XTCS 2RSOA 1TVXA 3TZDA 1STGA 5EPKA 4RHRA 4DN4M 3M4YA 2R61A 2JXMB 4C3IG 3WDNA 4IUTA 3L3OC 1LTTD 2RDFA 1JWSD 4K5XA 3VR6A 1SNMA 1LTGD 3KBXA 3TP7A 1BCPF 5CV4A 3SR1A 3DWPA 2F0JA 2PO4A 4NMZA 2C5CA 3HZXA 1D1IA 2J0TD 3A8JE 4IURA 4X3SA 4HMJA 3NWSA 5A2QE 1HRJA 1BR9A 2F0FA 3IFTA 3KUPA 3K57A 5EGTA 4V0BA 1TIID 1NUCA 3QO2A 3R2IA 3D4DA 3KF8A 4HAEA 3P1HA 4G57A 2LKVA 5EJWA 1HCZA 3Q0AA 3NBHA 1CZGA 1D5XC 4KK7A 5CC4A 2NVYB 3GV6A 2TMPA 1GUNA 1RF2D 1LT4D 5DNFA 2DY7A 1EYCA 2RA4A 2N88A 2L9HA 1MBYA 3H6MA 4QF4A 1B53A 1E0BA 2AUJD 2F3WA 3SK5A 1R4PB 2LFNA 2RVLA 2SDFA 4HSVA 4OHJA 5C0XJ 2F1MA 1D5ZC 4ME5A 4A3EB 4IFDI 4EQPA 2E76C 2JP1A 3LX0A 3GD7A 1UNSA 2EYOA 2EYHA 1KNEA 1PTOC 2B2WA 3R8BA 1BCPD 2YYZA 2EY6A 5KIXA 4A3MB 1SYBA 1J9OA 4RGOS 4X3KA 1SNCA 1SNOA 5I2YA 5K36H 4XIGS 5TSSA 2M00A 3AU7A 2X69A 1TS4A 2O5IC 1KDCA 2L4NA 2F0DA 4A3GB 4QIWB 3QOLA 1PTOB 4KN4C 2JA8B 2A68D 1M8AA 2MHVA 3BDCA 2F0UA 2I46A 4CKBA 1ENAA 1NR4A 2KA7A 2EYPA 2XRSD 1ZEQX 2CW0D 2PNRC 1B50A 1WVLA 3HP3A 5IGBA 3PO3B 4RH6A 1LTAD 4QMGA 1EZ8A 5E1FA 3S14B 1Z47A 1DD2A 4CKCA 4Z9CB 1PFMA 2NVQB 2K32A 4K8JA 5C3XA 2CVRA 2K1BA 3NTKA 3W2DA 5IGGA 4N9TA 4QUCA 1QCBD 3U9SA 5FO9B 3D3RA 4NKLA 1V1PA 1I3QB 1TS5A 2ZXRA 3HGBA 2EDGA 4BWGB 3D4WA 3GTOB 3R3OA 5CBEE 4PNYA 4A3DB 1NSNS 5I9PA 2JE6I 2EJGC 2NN6I 2NYZD 2BA1A 3HOUB 1BO0A 4F87A 2NVTB 1E2ZA 3Q23A 1BCPC 1PRTB 2WAQB 1RCVD 2F0PA 3H91A 1CZWA 4H44C 3TBIB 1GUTA 1JR0D 4FF1A 3H3VC 1DXMA 5I4DA 2H1EA 2E2IB 2BA0A 2IX1A 2XWJB 5ELDA 3SK8A 3TP8A 4Q0FA 3D4RA 1AZQA 1QWYA 2E2JB 3TP5A 1A3TA 1F2ZA 3LWEA 3PO2B 5CGKA 2VNUD 3H94A 2D62A 5ELBA 3MFGA 1SDFA 2ID0A 2CW0C 4IFDH 4C3HG 2AQ3B 1A3UA 3R93A 1W6JA 4H0LC 1R9TB 3IFDA 5M3MB 4I65A 1Y8OB 1ZKOA 5FO8B 1K8OA 3DM1A 4ZUIA 3OSOA 1B9MA 3FPPA 5FLXL 1RODA 1C8CA 2NTTA 3S16B 3PV0A 1CHPD 3KBGA 2NB0A 1G2TA 1TU2B 1WD1A 1TY0A 1WTRA 1FD7D 3GTLB 1HUMA 1EYDA 2EJFC 1LABA 1K8MA 1EOTA 2KEDA 5E4WC 2WKDA 3F2UA 4KKTA 1RD9D 1O78A 1WTQA 3I8ZA 2J7ZA 4G7HC 5DM73 3A56A 4LJZC 2RDHA 1JICA 3OOCA 2AQ1B 3K0YA 1PDQA 5C5LA 1BDOA 2Y0SB 1G91A 1B4OA 1LT6D 1LTBD 1Q8IA 1JOKA 1QILA 1VMPA 5KGUA 1TWFB 5D3DA 1I4RA 3MZ5A 1RDPD 3MXUA 3O13A 4KKSA 1EY0A 3GO5A 3C2PA 3Q6SA 5KEEA 2ZXPA 3VR2A 4ID6A 3MAQA 1H9KA 4F8MA 1YNND 2B2UA 5CV5A 4ZKCB 4DGZA 1RJTA 4DU9A 5J22A 2R3ZA 3Q22A 2CHBD 2QCPX 4B9WA 4Q5VA 1E2VA 4AYBB 4KHVA 2L12A 1LTSD 1HQRD 1GOZA 3PUXA 2EY2A 3EA6A 5I6YA 4WFN3 1EU4A 2AWOA 4RCOA 5EQ0A 1ESRA 2C9OA 4K6LA 3NBIA 1LT3D 2EY5A 1TQOA 3AB9A 1KABA 1JOOA 3URYA 5ELCA 4U673 3QG1A 1KDBA 1U4RA 2CQAA 3AMUA 4F88A 2EY1A 3TSSA 4CJ2C 3ND9A 4WJWA 2FJ2A 1SYDA 4IQZA 4IFDJ 4DF7A 3D8GA 5CMDA 1CFMA 3K58A 4JBWA 1ET6A 1X32A 4BBSB 1XYIA 1EY7A 1CM9A 5CYUA 2LY7A 3T16A 2EYLA 3H09A 4IN3A 2IJ0A 3S1MB 1II3A 4IALA 1XX8A 4WRDA 1U9RA 4MIUA 2VUMB 4DXFA 1DOKA 3T13A 4KKUA 4E6IA 1SE4A 1IHZA 4RWSC 1PTOD 2KECA 1AEXA 1PRTF 4O42A 1TT2A 5ELFA 1A2UA 1BOSA 2G9HD 4BA2I 2OXPA 5I2XA 1SYFA 1EU3A 4C3HB 5J1ZA 2SNSA 4QUFA 5M5YB 1WCMB 2HDMA 4J1MA 4PMCA 1I50B 1YNNC 4CHTB 1JB3A 5A2QL 3I70A 5C4ZA 5CV9A 2WACA 3VR3A 5FK9C 4DAVA 3BVZA 1ESFA 2VXWA 4ZLTF 3MFYA 3M7NA 5AFWA 1DCZA 4C3JG 1BF4A 4L8JA 3BS1A 2XVSA 1G6ZA 1SXTA 4ZAIA 4HTHA 5CBAE 1T5EA 2AUKA 4UDUC 1MI2A 3WOFA 2EYFA 4RHSA 1Q12A 3CU7A 2NTSA 1EY9A 2DNCA 4GZYC 2IT1A 3CHBD 1SNPA 2A69C 3K59A 3K5LA 4B9XA 5HURA 4C1NK 4X3TA 1OXXK 3BVMA 1PRTD 1U4LA 3DEPA 1SYCA 3OW7A 4A93B 4KMUC 5EPJA 2NN6G 3SK6A 4A3IB 1DOLA 5C5MA 4X3UA 4FP5D 5DEHA 1MGSA 2RKSA 5JJZA 1EY8A 1SMYC 4JK1C 1DOMA 3DHQA 1ILQA 3BYYB 1F2YA 1STYA 4KTAA 4ZYSA 1HFNA 3GV3A 2SOBA 3SE0A 2SNMA 5C0XG 3FPUB 1SE3A 3QJYA 1TWAB 2A74C 3H0GB 4NDXA 2IX3A 4FVMA 2O4XA 1HTLD 1LTID 1UUPA 2F0NA 2F0OA 3GQBA 4OGQC 3RMHA 3I90A 3J80E 1XWEA 2B8GA 1SEBD 2D2CC 2FHTA 3OWFA 2PW7A 1FNWA 2Q8RE 1EY5A 3EVQA 4F7XA 1QNKA 4DK1A 5NUCA 1AW7A 3GTGB 1HTPA 3HEJA 5COYA 2PZWA 3CRLC 2J4XA 3NTHA 5M5WB 1H9MA 4A3JB 1AP0A 4BA1I 2B2VC 3SVMA 1D5MC 1ML0D 3PUYA 2L0CA 3T56B 3MHBA 1C4QA 4UAIA 5LL6X 2K7VA 4CJ1B 2F4IA 1U4MA 3ERQA 2N55A 3GTMB 1GXDC 3MA2B 3S2DB 4ODGA 5JVH3 1Z7TA 3HOVB 1EFID 1A2TA 1F9PA 2O2LD 1FNVA 2B8FA 4NW2A 2HCCA 2EOTA 3K5NA 1TS3A 2F0QA 2XN9C 1GUSA 5BN4A 3PUZA 1K83B 1I6HB 3ND8A 2WKCA 1DYQA 1PRTC 3GTPB 1GJXA 5JVG3 3S2HB 1PZJD 4XXEA 3M3YB 1GUOA 4PQXA 1SYGA 5JEAG 4LK1C 3SXHA 2F0HA 4ZUJA 4C3IB 1BUVT 2KQ3A 1A3VA 1KTKA 1RKNA 5IGFA 3FRPB 2D5DA 4KV6A 1M4VA 2L5TA 4DNTB 1I4QA 3D31A 3FDTA 3C3LA 1H9SA 4TRDA 3S9WA 1AZPA 3RZDB 4RFBA 1IYUA 1VDZA 3C46A 1SNDA 2O5JC 5C0XI 1JCKB 1EWHA 3GTKB 4IUVA 1JWUD 2LS01 3G6JB 4L6TB 4BS9A 1EZ6A 1V1PB 5M3FB 1D1KA 4BBRB 2IL8A 1AFPA 1JOQA 2L55A 2KCCA 2B2TC 1PZKD 2KHSA 4A3FB 4XYOA 3DUZA 3DWQA 3OMCA 5EPLA 2HCIA 1CQVA 4G7ZC 1R4QB 4FNFA 4S3SA 2FINB 3T51B 2ICIA 3TMEA 5EKLA 4RA8A 3A7LA 3Q24A 4RCNA 1D2BA 1CK1A 4OIKA 4PV1C 1D6EC 1Y8NB 3EJIA 2KCNA 5IT9E 2F0EA 2WINB 4DFAA 4PMWA 4FYDA 2R92B 3TN2A 4KD4A 4EQOA 1T5XD 2EZVA 5KRUA 3KLSA 5JAVA 1ZYRC 2FFKB 4M1UB 1DJRD 2WP8J 2XIWA 3KLRA 1BBXC 5KYLA 3P7JA 2VB2X 2Q8IB 3BVGA 2G9DA 3JAME 2EPBA 1B44D 1WD0A 4G4KA 1SJED 3L7ZC 3CRKC 2K5DA 3HOZB 5EBDA 1H9RA 3HG9A 1F9QA 3PUVA 3RZOB 1CT1D 3IKJA 2RQXA 4OO1G 5M9OA 3K6OA 2F0GA 3DXJC 5G3LF 1VCIA 3TZUA 4KHZA 3E0JA 4DAYA 3M4OB 1Q3LA 2OF1A 2Z4HA 4FXGC 1PXUA 1Y1WB 2RSNA 4BY1B 1KLGD 1O80A 1V43A 1AN8A 4KJNA 2K5WA 4R8IA 2PCFB 2NWGA 3FKIB 2NN6H 5E4XA 2QDBA 4QB4A 1IW7D 1LO5D 3OMGA 1I4HA 5C44B 2AWNA 3C1FA 1FR3A 1O7YA 3VA7A 2HQEA 2EXZA 3VYTA 2JA7B 3HS0C 4O1NA 3QIAA 2R93B 2HDLA 2A69D 2F0SA 2MP1A 5T1IA 1KAAA 2BE5D 3MXNA 1IL8A 3OPOA 3A8KE 2F0MA 2K05A 1H9JA 5C0XH 3ZYYX 3BDLA 2E2DC 4IUPA 1QE6A 1EQVA 3NTIA 2B2YC 2ZT9C 2B39A 4FF4A 3NP8A 3ITPA 2F03A 2BCOA 2BOSA 5G3LD 1PMRA 2XWBB 1EY4A 1CA6A 3I4NB 1SMYD 1V8QA 3VYRA 4DK0A 2M9VA 5LL6S 3OIPA 2K5QA 2JEAI 1FYCA 1L0XB 2RBMA 2EYJA 2Q8TA 4ZQ3A 4HMIA 1S5DD 3SEBA 2X6LA 1QNUA 1LLRD 3NPPA 1G2SA 2KEEA 4XT3B 3OIQA 1SE2A 2PYKA 5IODA 1I4GA 4K2KA 5CV7A 3KLSX 2PW5A 5I9OA 1MD2D 2JSOA 4OO1I 4RKBA 2F0VA 4RKLA 1F2LA 2B63B 1RTNA 5EKIA 2BDNA 4OIJA 2QEJC 5DM63 3J7AV 3V96A 4TKOB 2OT2A 4WORA 4NP5A 1IKMA 2EVBA 4XQJA 1EY6A 1HPCA 5CR3A 1BNZA 4V190 2I07B 5A35A 3A8IE 1QOHA 4CJ0B 1IW7C 4A3KB 5CV8A 1CI3M 2ZXOA 3I4LA 1JWMD 2Z1CA 1EEID 1C48A 1PZID 3VA5A 1ENFA 3I4MB 1Y8PB 5JEAH 3GTQB 1NR2A 2PZUA 5D65A 5IGCA 1KDAA 3D6CA 5ELEA 3HKZB 4FF2A 4RGMA 2GA4B 3DEOA 1YNJD 1VF7A 4DXGA 2AQ2B 2BE5C 1OXSC 2PZTA 3T4AC 3QB3A 4KD3A 3BG3A 1I6VC 2VB3X 3I3CA 5FO7B 1TWGB 1EL0A 2F0WA 2A6HD 2MPMA 4QCLA 3WOEA 4MN3A 5D3IB 5FOBB 5KNCA 3BYTB 4IZ8A 4DNRB 2PMZB 4L63B 1RHPA 4K14A 4EVOA 3S1RB 4HSPA 4MHEA 1S5ED 1STAA 1Q1BA 4FXKC 3S1QB 3K5OA 3TDQA 3S17B 4KY5A 5C4XB 2X6GA 3TP6A 3J80L 1SYEA 2NZ1D 3IAYA 1IYVA 1JORA 4ULLA 2QKIC 1OXTA 1S4ZA 3DMUA 5T1GA 3J81L 1DM0B 3HOYB 1IKLA 3NK9A 4R9WA 3EROA 1TY2A 2F0TA 3VR5A 1B2TA 4KY7A 3IL8A 1UAPA 4HCEA 4LMQD 1SNQA 3BZDB 1DZ1A 3A54A 2B2VA 4FF3A 2K04A 3J81E 2B2WC 2RDGA 1CHQD 3HOWB 3NQTA 3DWAA 2PPBC 4CKEA 5C4HA 3GTJB 1VF5C 2V4DA 4KJOA 1JE4A 1QJOA 5C3WA 1PYWD 5EKKA 1ICWA 3VR4A 2H4OA 2BDOA 3GP7A 2XRQD 2QF7A 2IX0A 4KI0A 1JQYD 1EYAA 2EE1A 2PQEA 2FMMA 4J8QA 1KNAA 5D14A 1O7ZA 4ZKBB 2E75C 1YNJC 3P20A 1UEAB 1OXVA 1Q1EA 1F2MA 2XNAC 5JPNC 2L11A 3V05A 2F0IA 1SJHD 3MC0B 1B1ZA 2A6HC 5C3EB 2LMCB 3A7AB 3MXGA 2K03A 4OO1H 3RLFA 1ZYRD 4LAAA 3K7AB 1LACA 2F0KA 4YIJA 1WTVA 1PLFA 5JOBA 1TR5A 2K28A 2MUYA 1G291 2TSSA 2Z4IA 5DAUA 5HGTA 5JEAJ 3U9OA 1B3AA 4TQUS 4RGNA 2JA5B 5K5PA 1LT5D 4EQNA 4K6DA 3R2TA 5J39A 2Z8LA 1F77A 1TWHB 3HRZC 3LNNA 1E2WA 1SBBB 2EJMA 3RD4A 2NUCA 5FKAC 2KOLA 1EEFD 2DN8A 4C3JB 2A73B 3OHXC 1FNUA 5LHY1 4DAPA 4XQNA 1SFOB 1O7LA 4J6HA 2K6AA 3NSWA 1V1OA 5BN3A 4HEDA 1GHKA 3SDZA 3KK7A 1XTCD 4OL7A 2KUMA 2E2HB 2DNEA 4ILWA 1B9NA 4K5WA 2B2TA 1MSHA 4HR7B 1NCVA 1KLUD 3MVVA 2KJXA 1NAPA 3FMCA 1EWCA 1L0YB 3D6WA 1PTOH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GUW A;  1G2S A;  1O80 A;  3H91 A;  4XT1 B;  1RTO A;  1M8A A;  4MHE A;  2KEE A;  4XT3 B;  2VXW A;  3F2U A;  2L11 A;  1NR4 A;  3QO2 A;  1PFB A;  2M2L A;  4OIK A;  4ZLT F;  1WTQ A;  1F9S A;  4R8I A;  3I8Z A;  1SAP A;  3I90 A;  2NWG A;  5AFW A;  2H1E A;  5E4X A;  4HAE A;  2J7Z A;  1PFN A;  1QG7 A;  1U4R A;  2X6G A;  4U68 A;  1BF4 A;  2FHT A;  5EJW A;  2K03 A;  4CJ2 C;  1B50 A;  2NZ1 D;  1G6Z A;  2Q8R E;  1WVL A;  3HP3 A;  1U4P A;  2FJ2 A;  3TN2 A;  1LV9 A;  1QNK A;  1HFG A;  1O7Y A;  2K01 A;  1WTV A;  1F2L A;  4ZAI A;  1RTN A;  1JIC A;  1WTP A;  1PLF A;  5EKI A;  1AZQ A;  1F9R A;  2BDN A;  5CMD A;  4OIJ A;  1PDQ A;  5CBA E;  1X3P A;  3ONA B;  2FFK B;  2K28 A;  1S4Z A;  2D9U A;  1SSO A;  3GV6 A;  1HHV A;  1MI2 A;  5T1G A;  1G91 A;  1CA5 A;  1IKL A;  5COY A;  1X32 A;  3FDT A;  2XIW A;  1B4O A;  4R9W A;  1B3A A;  3LWE A;  1XYI A;  5DNF A;  2DY7 A;  1CM9 A;  1IKM A;  1EIH A;  2MGS A;  2RA4 A;  1VMP A;  2N88 A;  2L9H A;  4IUU A;  1WTO A;  2HDL A;  1B2T A;  1AZP A;  1B53 A;  1BBX C;  1E0B A;  1PFM A;  1BNZ A;  1AP0 A;  2B2V C;  2MP1 A;  5T1I A;  3SVM A;  3P7J A;  3IL8 A;  1EQT A;  1ML0 D;  4CJ0 B;  1IL8 A;  1SDF A;  1XX8 A;  2JYO A;  2RVL A;  4LMQ D;  2K05 A;  2SDF A;  2B2U C;  2EPB A;  4HSV A;  2CVR A;  4UAI A;  3G7L A;  1WTW A;  2K1B A;  3Q6S A;  3N52 A;  1ZXT A;  4CJ1 B;  1WD0 A;  1DON A;  1DZ1 A;  1U4M A;  1TVX A;  2RSO A;  2B2V A;  1MSG A;  4IUP A;  1QE6 A;  2N55 A;  2K04 A;  4IUV A;  3TZD A;  1DOK A;  4QUC A;  2B2W C;  2JP1 A;  5COR A;  4X3T A;  5EPK A;  1EIG A;  4HCS A;  4ZK9 B;  2B2Y C;  4DN4 M;  1U4L A;  3DEP A;  3R93 A;  4ZKC B;  2B2U A;  3I91 A;  4RWS C;  2KOL A;  1NR2 A;  2KEC A;  1RJT A;  1F9Q A;  5D65 A;  4O42 A;  5EPJ A;  4IUT A;  1KNE A;  2IL8 A;  1JE4 A;  3IFD A;  2B2W A;  2HUG A;  2R3Z A;  1F9P A;  2B2Y A;  1DOL A;  3DEO A;  1ICW A;  4NW2 A;  3KBX A;  2HCC A;  2EOT A;  4IUQ A;  4X3U A;  1VMC A;  3DM1 A;  3MWY W;  4HED A;  1MGS A;  1CA6 A;  1J9O A;  5JJZ A;  1ROD A;  1HUN A;  2B2T C;  5CBE E;  1C8C A;  2L12 A;  4QUF A;  2KUM A;  1DOM A;  3I3C A;  4RAU C;  1WTX A;  2RSN A;  4IUR A;  1EL0 A;  2HDM A;  1G2T A;  4XDX A;  4X3K A;  4X3S A;  5EPL A;  1ILQ A;  2HCI A;  2MPM A;  2EE1 A;  2B2T A;  4MN3 A;  1WD1 A;  1MSH A;  1Q3L A;  3UI2 A;  1WTR A;  2FMM A;  2L1B A;  2NYZ D;  1ILP A;  1NCV A;  1HUM A;  2Q8T A;  2FIN B;  1NAP A;  1HRJ A;  1HA6 A;  1HFN A;  2X69 A;  2X6L A;  1A15 A;  3GV3 A;  5EQ0 A;  1KNA A;  1BO0 A;  4RA8 A;  5D14 A;  2MJ8 A;  1O7Z A;  1ESR A;  1RHP A;  4ZKB B;  2L4N A;  1J8I A;  2DY8 A;  3FPU B;  1X3Q A;  2KVM A;  3MTS A;  1EOT A;  3D6W A;  3KUP A;  2KED A;  5E4W C; 
#chains in the Genus database with same CATH topology
 5IOC A;  3VYS A;  2JA8 H;  1RTO A;  3PIO A;  4GLV B;  4C2M B;  2A68 C;  3OTO Q;  1Q81 C;  1BCP B;  1F9S A;  1OO9 B;  1VQN A;  4OON A;  2YU9 B;  4R8N A;  2F0L A;  1PFN A;  1Y69 U;  4A3C H;  4PG3 A;  3NUC A;  2OEO A;  5IT9 L;  2B29 A;  3NQI A;  2K01 A;  3A55 A;  3PO3 H;  1F9R A;  4IJL A;  3I2Z A;  3DLL A;  4B08 A;  3MEH A;  5GAE C;  2HHH Q;  3E0E A;  1PV4 A;  5EBC A;  3J7A F;  1XXG A;  5KNB A;  4LF9 Q;  2EYM A;  4K2L A;  1GHJ A;  1WCM G;  3CPF A;  2ZJR A;  4YWL A;  1S5F D;  3S14 H;  3EFX D;  2ZTC A;  3I72 A;  1H9S B;  4PMB A;  4JI2 Q;  2ICE C;  4JI5 L;  3PIP A;  2JA6 B;  5KND A;  4FXD A;  5K36 G;  3CKI B;  3EIV A;  2FMC A;  2IW3 A;  2R6G A;  1XMQ L;  3M85 A;  2NVQ H;  1JC7 A;  1BXT A;  4DV6 L;  2UUA L;  4R4Q A;  1HQM C;  5IIF A;  2KCT A;  4H13 C;  3I73 A;  4KN7 C;  3UDI A;  3QOJ A;  3EQL C;  1WTW A;  4A3B B;  2JEB I;  3HOX B;  3N52 A;  4ZRZ A;  3JAM L;  1UE1 A;  3LWU A;  4ABN A;  2WII B;  1Y1V B;  2PI2 E;  5KYI A;  4ZK9 B;  4HCS A;  1L1O C;  3S15 B;  3V2T A;  3I91 A;  3FEW X;  1CQF A;  1CTM A;  4I7Z C;  1VS0 A;  3J81 j;  4LF5 L;  3M7G A;  3Q8D A;  4IUQ A;  1VMC A;  5FLX E;  1WYD A;  3MWY W;  3VYU A;  1VQM A;  3GTO H;  1HUN A;  3P75 A;  4I7A A;  3G48 A;  3QWN A;  2A6E D;  4A3D H;  1I5F A;  3N6R A;  5IYC G;  1LTR D;  4XDX A;  2QIL A;  1W2B A;  1Z6H A;  5IGE A;  5IP9 G;  4IUN A;  1X56 A;  2L1B A;  2UXC L;  1L1O B;  1AE2 A;  1HA6 A;  4H7B A;  2K33 A;  1A15 A;  3HOU H;  4R4O A;  2NVT H;  3U4V A;  4K8I A;  3K5M A;  1J5E Q;  1J8I A;  3MTS A;  1X3Q A;  2KVM A;  3M9B A;  5C4J B;  4JI4 L;  4XT1 B;  2IWH A;  1S5C D;  3NWT A;  4G7O C;  2NVX B;  1PFB A;  4A93 G;  5I6W A;  3C1E A;  1SAP A;  2WB1 B;  1W6K A;  4C1N I;  1E22 A;  3BDO A;  1QG7 A;  4A3I G;  4HN7 A;  2E2I H;  2PQA A;  3CCV A;  3T1Y L;  2A5H A;  5F2D A;  2ENB A;  4JYA Q;  4JVZ A;  1KHI A;  1VQL A;  2R7F A;  3SK4 A;  4JI6 L;  2E2J H;  1VQD A;  1HNZ Q;  3ONA B;  1PYB A;  1TS2 A;  5IYB G;  3TS0 A;  4TSS A;  1ET9 A;  4KY6 A;  5E3F A;  1C0A A;  5LMN W;  3E5S A;  3PO2 H;  3NEL A;  4DA2 A;  1N32 Q;  1GUG A;  1PTO F;  3PIO 3;  1TKW B;  4IPD A;  1QB5 D;  3PUW A;  3NHH A;  4YY3 Q;  4P2C B;  5IGD A;  1A62 A;  4C56 C;  2B2U C;  3H3V H;  3OWE B;  4GKJ L;  4BY7 B;  3SGI A;  1ZXT A;  1DON A;  1MSG A;  4RGT A;  2GVB A;  3H0G G;  5COR A;  1I4P A;  1EIG A;  3CQZ B;  3NXW A;  2IPK D;  4QIW E;  1R9T H;  4M8A A;  3E6Z X;  3L9A X;  1H95 A;  2HUG A;  2JN4 A;  1STE A;  5M3M H;  2B2Y A;  5IT9 c;  2ATW A;  4K0K L;  5M5X B;  1BQQ T;  3PIP 3;  3I56 A;  1CSP A;  4CDC C;  4ME3 A;  3HOX H;  4A3G G;  3X3N A;  1S5B D;  2I0Q A;  4LFA L;  3S16 H;  1B70 B;  5ISR A;  4RAU C;  1WTX A;  1ENC A;  3X3M A;  4DAY B;  2E8G A;  2E74 C;  1SLJ A;  1HA5 A;  4CGY B;  3UI2 A;  4A3J G;  1ILP A;  3GTL H;  5JJK A;  4Y7N B;  5C6A A;  5E7N A;  1G8Z D;  2MJ8 A;  2I5M X;  3F1Z A;  4XQQ A;  2DY8 A;  4IFD G;  2XSC A;  1STH A;  4K5V A;  1ONL A;  1MHW C;  2ZM6 L;  4CBV A;  1FGB D;  3NE5 B;  3RUZ A;  5BN5 A;  3KFU A;  2M2L A;  1STN A;  2A6E C;  3HOV G;  4JI0 L;  1X3G A;  4DUY L;  3PMF A;  1HXY D;  2WV6 D;  4U68 A;  5GAG C;  3W3A A;  1TWC B;  4LF4 L;  1U4P A;  3CF5 A;  3CC7 A;  1LV9 A;  1HFG A;  4N9P A;  4FO2 A;  1YIJ A;  3FVQ A;  1WTP A;  3JC6 6;  3SHL A;  1YHA A;  4DPG A;  1I4X A;  4XYQ A;  1Q90 A;  1A6X A;  1X3P A;  2NZO A;  3KJP A;  4DKA C;  2D9U A;  2NBF A;  1SSO A;  2R7Z B;  1HHV A;  4R1J A;  4B3M L;  1STB A;  1CA5 A;  1OXU A;  2BH2 A;  4DV4 Q;  3T53 B;  4KHP Q;  4DR3 Q;  1EIH A;  4GN5 A;  2MGS A;  5JJL A;  1WTO A;  4IUU A;  5JPM C;  1TWF H;  1WJJ A;  3AEV A;  2F3V A;  3MXP A;  1EQT A;  3M4P A;  2JYO A;  2Z0S A;  4EGV A;  2SEB D;  5CV6 A;  4B3S Q;  3G7L A;  3J7Y W;  3S1N B;  1GUW A;  4XTC S;  4LF6 Q;  2RSO A;  1TVX A;  1NE3 A;  3TZD A;  1PH7 A;  1HR0 L;  1STG A;  5EPK A;  4A3D G;  4RHR A;  2ZJP A;  4DN4 M;  3M4Y A;  3HKS A;  2R61 A;  2JXM B;  4C3I G;  3WDN A;  2DJG C;  3RN5 A;  4IUT A;  1PHJ A;  3L3O C;  3TEH B;  1FJG L;  1XPO A;  1A0I A;  1VQB A;  1LTT D;  2RDF A;  1JWS D;  4K5X A;  3VR6 A;  1IL2 A;  1SNM A;  1LTG D;  4DK6 C;  3KBX A;  3TP7 A;  1BCP F;  1YZ6 A;  5CV4 A;  3SR1 A;  4X65 L;  3RNU A;  3DWP A;  2F0J A;  2PO4 A;  4NMZ A;  1IBK Q;  1EFW A;  2C5C A;  3HZX A;  1D1I A;  2J0T D;  2N78 A;  3A8J E;  4IUR A;  4X3S A;  4HMJ A;  1N36 L;  4X6A H;  4JI1 L;  4YHH L;  1HNX L;  3NWS A;  1MKH A;  5A2Q E;  1HRJ A;  2OTL A;  1BR9 A;  5FJ8 G;  4HIO A;  1RL2 A;  4HJ8 A;  4YWK A;  2F0F A;  3IFT A;  3KUP A;  3K57 A;  3TRZ A;  5EGT A;  4V0B A;  1TII D;  2CCZ A;  1NUC A;  1LM0 A;  3QO2 A;  4P74 A;  1GD7 A;  3R2I A;  3D4D A;  3PO2 G;  1Q8K A;  3KF8 A;  5M3F G;  4BBR G;  2RHS B;  3P1H A;  4G57 A;  4HAE A;  2LKV A;  4JI5 Q;  5EJW A;  1HCZ A;  3Q0A A;  1PH5 A;  1XMQ Q;  3NBH A;  4DV6 Q;  2UUA Q;  2DJF C;  1CZG A;  2EIF A;  1D5X C;  4KK7 A;  1VQ5 A;  1PH2 A;  5CC4 A;  2NVY B;  3GV6 A;  2TMP A;  1HR0 W;  1GUN A;  4A3F G;  1MJE A;  1RF2 D;  4LF8 L;  1LT4 D;  4BBS H;  5DNF A;  2DY7 A;  1QVG A;  1EYC A;  2RA4 A;  2N88 A;  5LMN Q;  2L9H A;  1MBY A;  3H6M A;  1CSQ A;  4DV7 L;  4QF4 A;  1B53 A;  2Q2U A;  1E0B A;  2AUJ D;  4UHV A;  2Z9H A;  2F3W A;  3S1M H;  3A5Z B;  3SK5 A;  1R4P B;  3WWV A;  3W1G A;  4JCV E;  2LFN A;  2RVL A;  4IO9 A;  1U5K A;  2SDF A;  4HSV A;  4OHJ A;  5C0X J;  4ALP A;  2F1M A;  4LF5 Q;  2VQE L;  1D5Z C;  4TVA B;  1E3P A;  4ME5 A;  4A3E B;  4IFD I;  4EQP A;  2E76 C;  4JBJ A;  1KC8 C;  2JP1 A;  3KOJ A;  3LX0 A;  3GD7 A;  1UNS A;  1I94 L;  2EYO A;  2EYH A;  5IY0 A;  1KNE A;  3AFQ A;  1PTO C;  2B2W A;  1N9W A;  3R8B A;  4RG1 A;  1BCP D;  2YYZ A;  2R92 G;  2UXC Q;  2EY6 A;  1PH1 A;  2QGQ A;  5KIX A;  2DUD A;  4DV0 L;  4A3M B;  1E1O A;  1SYB A;  1J9O A;  4C3H H;  4QGU A;  3K7U C;  3CME A;  4RGO S;  5M5Y H;  3F2B A;  4JI4 Q;  1WCM H;  1N32 L;  4X3K A;  1SNC A;  1SNO A;  3K8A A;  5I2Y A;  2VY3 A;  4B3R Q;  4YY3 L;  5K36 H;  1I50 H;  4XIG S;  5TSS A;  2A19 A;  2M00 A;  3AU7 A;  2RCF A;  3CCR A;  1J6Q A;  2X69 A;  1TS4 A;  4PZ6 A;  2O5I C;  1YJN A;  1KDC A;  2L4N A;  3T1Y Q;  2F0D A;  4A3G B;  3QOL A;  1PTO B;  4QIW B;  4KN4 C;  3LGJ A;  4HJ9 A;  2JA8 B;  2A68 D;  1M8A A;  2MHV A;  4JI6 Q;  3BDC A;  2F0U A;  5LMU L;  2I46 A;  2Y0S G;  4CKB A;  4LUV A;  1ENA A;  1NR4 A;  2KA7 A;  2WFW A;  2EYP A;  2XRS D;  1ZEQ X;  5DLQ E;  1NBW A;  4YCW A;  2CW0 D;  2PNR C;  4DR4 L;  1B50 A;  1WVL A;  3HP3 A;  2I5L X;  5IGB A;  3G4S A;  2OTJ A;  3PO3 B;  2QA4 A;  4RH6 A;  1LTA D;  4QMG A;  1EZ8 A;  5E1F A;  4GKJ Q;  1QUQ A;  1UE6 A;  3KYH C;  3KLW A;  1LTL A;  4AYB E;  5IYC H;  3S14 B;  1Z47 A;  1DD2 A;  5IP9 H;  4CKC A;  4Z9C B;  1PFM A;  2NVQ B;  2VL6 A;  2IHE A;  2K32 A;  2UU9 L;  4K8J A;  5C3X A;  2CVR A;  1HNW L;  2K1B A;  4K0K Q;  3NTK A;  4BY1 G;  3W2D A;  5IGG A;  4N9T A;  4QUC A;  1QCB D;  4H02 A;  3U9S A;  5FO9 B;  1NMF A;  4LFA Q;  4HJA A;  3D3R A;  4A93 H;  1HJP A;  4DV1 L;  4NKL A;  1V1P A;  1I3Q B;  1CKN A;  3FKI G;  1YI2 A;  4A3I H;  1NTG A;  3EN2 A;  1TS5 A;  2ZXR A;  4DV5 L;  1E7Z A;  3HGB A;  4GNX A;  3NEM A;  3AYH B;  4GKK L;  2EDG A;  4BWG B;  3D4W A;  4DR6 L;  2AMC B;  4UPA A;  3GTO B;  3R3O A;  5CBE E;  4PNY A;  4YCV A;  4GOP B;  3BJU A;  1KAW A;  3U58 A;  4A3D B;  5IYB H;  1NSN S;  5I9P A;  2E5L L;  3KDF A;  2JE6 I;  4HIM A;  2ZM6 Q;  2EJG C;  4FDB A;  2KBN A;  2NN6 I;  4DR5 L;  1DGS A;  2R93 G;  4DNI A;  2NYZ D;  4JOI A;  4JI0 Q;  4DUY Q;  2BA1 A;  5GAD C;  1KIX A;  3HOU B;  1BO0 A;  4F87 A;  2NVT B;  1E2Z A;  3Q23 A;  1BCP C;  1PRT B;  2WAQ B;  4LF4 Q;  3CCQ A;  1RCV D;  1SRU A;  3QR8 A;  1JB7 A;  2YTX A;  1TWA H;  2F0P A;  1CZW A;  3H91 A;  4H44 C;  3H0G H;  3TBI B;  1GUT A;  1JR0 D;  1B3Q A;  4FF1 A;  1P8L A;  3J7Z C;  3H3V C;  4B3M Q;  1PH3 A;  1DXM A;  5I4D A;  2H1E A;  4A75 A;  2E2I B;  2N49 A;  4CDD C;  2BA0 A;  2D0P A;  2IX1 A;  2XWJ B;  5ELD A;  3SK8 A;  3PF5 A;  4CDF C;  3TP8 A;  4Q0F A;  1EOV A;  3D4R A;  1AZQ A;  3I4N G;  1QWY A;  2E2J B;  3TP5 A;  4AQY L;  3GTG H;  2FXQ A;  2D0O A;  1D8L A;  2VUM G;  2YTV A;  2ES2 A;  1XMO L;  1A3T A;  1F2Z A;  4GS3 A;  1HR0 Q;  3LWE A;  1L2F A;  3PO2 B;  3BU2 A;  5CGK A;  5M5W H;  4A3J H;  2VNU D;  3H94 A;  2LXK A;  4YCU A;  2D62 A;  5ELB A;  3MFG A;  1SDF A;  2RCN A;  1FJG Q;  2ID0 A;  2CW0 C;  2KEN A;  4O0A A;  4IFD H;  1GVP A;  4C3H G;  2AQ3 B;  1A3U A;  4N8X 1;  4X65 Q;  3GTM H;  4IJH A;  2UUC L;  3S2D H;  3RN2 A;  3R93 A;  1W6J A;  1X3F A;  3HOV H;  2CFM A;  4H0L C;  1R9T B;  3CCU A;  3IFD A;  1K3R A;  5M3M B;  4MTN A;  4I65 A;  1L1O A;  1N36 Q;  2Z6K C;  3PCO B;  3MEF A;  4JI1 Q;  1Y8O B;  4YHH Q;  1HNX Q;  1ZKO A;  5FO8 B;  1K8O A;  3DM1 A;  4ZUI A;  2B63 G;  3OSO A;  1VQJ A;  1B9M A;  3FPP A;  5FLX L;  1ROD A;  1K3B C;  3STB D;  1C8C A;  3KF6 B;  2NTT A;  1K83 H;  3S16 B;  3PV0 A;  1PH6 A;  1CHP D;  3KBG A;  5L37 A;  3EBE A;  2NB0 A;  5LMN L;  1G2T A;  1LYL A;  5HY6 A;  3CC4 A;  1TU2 B;  4L5Q A;  3T1H L;  4UP8 A;  1WD1 A;  1TY0 A;  1WTR A;  3GTP H;  1I3Q H;  1FD7 D;  3GTL B;  1HUM A;  4DR7 L;  1EYD A;  3W5O A;  4B3T L;  3S2H H;  2EJF C;  4A3K G;  2XTI A;  1LAB A;  1K8M A;  1EOT A;  3M3Y H;  2KED A;  5E4W C;  2K5V A;  4OWW B;  2WKD A;  1VQE A;  3I4M G;  3F2U A;  4KKT A;  1RD9 D;  1O78 A;  1WTQ A;  4C3I H;  3I8Z A;  4LF8 Q;  2J7Z A;  3HKZ G;  4G7H C;  1X55 A;  5DM7 3;  4DV7 Q;  3A56 A;  4LJZ C;  2RDH A;  1JIC A;  3OOC A;  2AQ1 B;  3K0Y A;  3K81 C;  1PDQ A;  5C5L A;  1BDO A;  1FL0 A;  1W3S A;  2K52 A;  2Y0S B;  2VQE Q;  1G91 A;  4B3R L;  1B4O A;  1LT6 D;  1LTB D;  1Q8I A;  1JOK A;  1QIL A;  1VMP A;  5J3B A;  5KGU A;  1I94 Q;  1TWF B;  1NY4 A;  5D3D A;  1I4R A;  4LFB L;  3MZ5 A;  1RDP D;  3MXU A;  3O13 A;  4KKS A;  1EY0 A;  3GO5 A;  3C2P A;  2R7D A;  2QW7 A;  5FJ8 H;  1S72 A;  3Q6S A;  2VZA A;  5KEE A;  3GTK H;  4LUZ A;  2ZXP A;  3VR2 A;  4DV0 Q;  3F8T A;  4ID6 A;  3ULP A;  3MAQ A;  2PNH A;  1H9K A;  4F8M A;  1YNN D;  2B2U A;  2HIX A;  5CV5 A;  4ZKC B;  4JI7 L;  1G6P A;  4DGZ A;  1RJT A;  5C4X G;  4DU9 A;  5M3F H;  4BBR H;  3PF4 A;  5J22 A;  4JPB W;  2R3Z A;  3Q22 A;  2CHB D;  2QCP X;  4B9W A;  4Q5V A;  1E2V A;  1D7Q A;  4JBK A;  4AYB B;  4KHV A;  1PYS B;  1LTS D;  2L12 A;  1HQR D;  2UXD L;  1Z9F A;  3CMA A;  4A3F H;  3HOY G;  1GOZ A;  1VQA A;  3PUX A;  4UP7 A;  2EY2 A;  5LMU Q;  4DK3 C;  3EA6 A;  5I6Y A;  4WFN 3;  1EU4 A;  3CCM A;  2AWO A;  2F4V L;  4JC0 A;  4RCO A;  5EQ0 A;  2F3I A;  1ESR A;  2C9O A;  4DR4 Q;  4K6L A;  4GN3 B;  3NBI A;  1LT3 D;  2EY5 A;  2H5X A;  1TQO A;  3AB9 A;  1KAB A;  2DGY A;  4IPG A;  3HOW G;  3STB C;  1JOO A;  3URY A;  1BVS A;  5ELC A;  4U67 3;  3QG1 A;  1KDB A;  1U4R A;  2CQA A;  3AMU A;  4F88 A;  2EY1 A;  3TSS A;  4CJ2 C;  2PQA B;  3ND9 A;  3TQY A;  4WJW A;  4OWX B;  2R92 H;  2FJ2 A;  1SYD A;  1VQG A;  1VQC A;  4IQZ A;  5FLX c;  4IFD J;  4DF7 A;  3D8G A;  5CMD A;  1CFM A;  2CH4 W;  2UU9 Q;  3K58 A;  3E9H A;  1HNW Q;  4JBW A;  1ET6 A;  1X32 A;  4BBS B;  3UDG A;  1XYI A;  1EY7 A;  1CM9 A;  5CYU A;  4IOA A;  2LY7 A;  3T16 A;  2EYL A;  3H09 A;  4IN3 A;  2IJ0 A;  4JV5 L;  3S1M B;  1II3 A;  4DV1 Q;  4IAL A;  1XX8 A;  4DV5 Q;  4LFC L;  1JJ2 A;  4WRD A;  4GKK Q;  3F2D A;  1U9R A;  4DR6 Q;  4MIU A;  2VUM B;  4DXF A;  1B8A A;  1DOK A;  3T13 A;  4UY8 C;  4PZ8 A;  4KKU A;  4E6I A;  1SE4 A;  1IHZ A;  4RWS C;  1PTO D;  2KEC A;  2E5L Q;  1AEX A;  1PRT F;  4O42 A;  1TT2 A;  2K5N A;  2IHF A;  5ELF A;  5C3E G;  1TXY A;  4DR5 Q;  1QVC A;  1A2U A;  1BOS A;  2PI2 A;  2G9H D;  3MXN B;  4OX9 L;  4BA2 I;  1NNX A;  4NPS A;  2OXP A;  5I2X A;  1SYF A;  1EU3 A;  4C3H B;  4A76 A;  5J1Z A;  2SNS A;  4QUF A;  5M5Y B;  1WCM B;  4DAM A;  2HDM A;  4J1M A;  2WAQ E;  4O2D A;  4DUZ L;  3M4O H;  4PMC A;  2JA5 G;  1B7Y B;  5GAH C;  1I50 B;  1YNN C;  4CHT B;  1JB3 A;  4LNQ A;  4A4I A;  1Y1W H;  5A2Q L;  3I70 A;  1SN8 A;  5C4Z A;  1G51 A;  1HZ9 A;  4BY1 H;  5CV9 A;  2WAC A;  2Z6B A;  3VR3 A;  1PFS A;  1U0L A;  1KRS A;  5FK9 C;  2B3G A;  4DAV A;  2ZJQ A;  3BVZ A;  2MFI A;  1ESF A;  2VXW A;  4AQY Q;  1VQ7 A;  4ZLT F;  3MFY A;  3M7N A;  5AFW A;  1XMO Q;  3FKI H;  1AH9 A;  1DCZ A;  4C3J G;  1BF4 A;  4R4T A;  3A5U A;  4L8J A;  3BS1 A;  2XVS A;  1G6Z A;  5C44 H;  1SXT A;  4GLX A;  4ZAI A;  4X66 L;  1WI5 A;  4HTH A;  5CBA E;  4HJ7 A;  4JI8 Q;  3K80 C;  1M90 C;  1T5E A;  2AUK A;  4UDU C;  1MI2 A;  3WOF A;  1T9H A;  2EYF A;  1Q12 A;  1VQI A;  4RHS A;  3CU7 A;  4UP9 A;  2NTS A;  4NXM L;  1EY9 A;  2DNC A;  2UUC Q;  3AQQ A;  3F2C A;  2R93 H;  4GZY C;  2IT1 A;  3CHB D;  1SNP A;  1IZ6 A;  2A69 C;  3K59 A;  3K5L A;  1PVO A;  4B9X A;  1K8G A;  5HUR A;  4C1N K;  4X3T A;  1OXX K;  3BVM A;  1YBY A;  1PRT D;  1U4L A;  3DEP A;  1SYC A;  2LXJ A;  3OW7 A;  3TS2 A;  4A93 B;  4KMU C;  5EPJ A;  2NN6 G;  3J7A 5;  3SK6 A;  4A3I B;  3T1H Q;  2CWP A;  1DOL A;  2ALY B;  5C5M A;  5IYD G;  4X3U A;  1HZB A;  4FP5 D;  5DEH A;  4DR7 Q;  1MGS A;  3UE1 A;  2RKS A;  4B3T Q;  3I4N H;  5JJZ A;  1CKO A;  1EY8 A;  1KRT A;  4KLK A;  1SMY C;  4JK1 C;  2VUM H;  1DOM A;  2HD3 A;  4BXX G;  3DHQ A;  1PH4 A;  1UE5 A;  1ILQ A;  3BYY B;  2JA6 G;  1F2Y A;  1V9P A;  1STY A;  5EAY A;  4JW0 A;  4KTA A;  1QVF A;  4ZYS A;  1N33 L;  1HFN A;  3GV3 A;  2SOB A;  3SE0 A;  2SNM A;  5C0X G;  4A3B G;  3FPU B;  1IBL L;  4MTK A;  2G5D A;  1SE3 A;  3QJY A;  1TWA B;  2A74 C;  3H0G B;  4NDX A;  1Y1V G;  2IX3 A;  1KXL A;  4FVM A;  2O4X A;  1HTL D;  1LTI D;  1UUP A;  2F0N A;  2F0O A;  3GQB A;  1PH8 A;  4OGQ C;  3RMH A;  3I90 A;  3KF8 B;  3J80 E;  3U4Z A;  1XWE A;  2B8G A;  2Y0S E;  1SEB D;  2D2C C;  2FHT A;  3OWF A;  5ELN A;  1HZA A;  3ULL A;  4DV3 L;  2PW7 A;  1FNW A;  2Q8R E;  1EY5 A;  2AHO B;  3EVQ A;  4F7X A;  4HID A;  1QNK A;  2NZH A;  3NBH B;  4DK1 A;  4LFB Q;  2B63 H;  5NUC A;  4MNO A;  1AW7 A;  3ICE A;  3GTG B;  2JQO A;  1HTP A;  3HEJ A;  1FGU A;  3HOZ G;  2GVA A;  5COY A;  1A8V A;  2PZW A;  3FHW A;  3CRL C;  2J4X A;  3ULJ A;  3NTH A;  5M5W B;  1H9M A;  4A3J B;  4JI7 Q;  1AP0 A;  4BA1 I;  2B2V C;  3SVM A;  1D5M C;  1ML0 D;  3PUY A;  1MIU A;  2L0C A;  3T56 B;  3MHB A;  1C4Q A;  3PGZ A;  4UAI A;  2VQF L;  1UWV A;  4A3K H;  5LL6 X;  2K7V A;  4CJ1 B;  2F4I A;  1U4M A;  3ERQ A;  2N55 A;  4CDE C;  3GTM B;  5IP7 G;  1GXD C;  2OWO A;  3MA2 B;  3S2D B;  4ODG A;  3I4M H;  3I4O A;  5JVH 3;  2A8V A;  3GTQ H;  2UXD Q;  1Z7T A;  1E1T A;  3HOV B;  2WB1 G;  1EFI D;  3CCL A;  1A2T A;  1F9P A;  2O2L D;  1FNV A;  2KHI A;  4GOP C;  2B8F A;  4NW2 A;  2HCC A;  2EOT A;  3K5N A;  1Y1W G;  1TS3 A;  2F0Q A;  2XN9 C;  3U50 C;  1GUS A;  2F4V Q;  2KHJ A;  5BN4 A;  1BBU A;  3PUZ A;  1K83 B;  2A1A A;  1N34 L;  2HT1 A;  3ND8 A;  1MJC A;  1I6H B;  1TWG H;  2ASB A;  2WKC A;  2OCE A;  1DYQ A;  4LW1 A;  1PRT C;  4ZCK A;  3GTP B;  3CC2 A;  1Q86 C;  2YTY A;  1ASZ A;  1GJX A;  5C44 G;  5JVG 3;  3S2H B;  1PZJ D;  4IOC A;  4XXE A;  4BY7 G;  3M3Y B;  3S1R H;  1GUO A;  4PQX A;  1V1Q A;  1SYG A;  5H1S E;  3CCS A;  2JA7 G;  5JEA G;  3S17 H;  4LK1 C;  3SXH A;  3ERS X;  2F0H A;  3CP0 A;  4ZUJ A;  4C3I B;  1BUV T;  5C4X H;  2KQ3 A;  1A3V A;  2C35 B;  1KTK A;  1RKN A;  1IBM L;  5IGF A;  4A3L G;  3FRP B;  1VQH A;  4JV5 Q;  2D5D A;  4KV6 A;  4X64 L;  1M4V A;  1K0S A;  2P5Z X;  4LFC Q;  2MNA A;  2L5T A;  4X62 Q;  1QUQ B;  4DNT B;  2K14 A;  4P72 A;  3HOY H;  1I4Q A;  3D31 A;  3FDT A;  3C3L A;  1H9S A;  4TRD A;  3S9W A;  1AZP A;  1GM5 A;  3RZD B;  4RFB A;  1IYU A;  1VDZ A;  4LUO A;  5ELO A;  3C46 A;  4DV2 L;  1SND A;  2VW9 A;  2O5J C;  5C0X I;  1JCK B;  1O7I A;  1EWH A;  4OEM B;  4OX9 Q;  3KF6 A;  3BZK A;  3GTK B;  4IUV A;  1JWU D;  2LS0 1;  4Y52 H;  2HQL A;  3G6J B;  3HOW H;  4L6T B;  4BS9 A;  5BR8 L;  1EZ6 A;  2V1C C;  1V1P B;  2F52 A;  5M3F B;  1D1K A;  4BBR B;  2IL8 A;  3GTJ H;  4DUZ Q;  1AFP A;  1JOQ A;  3HFZ B;  2L55 A;  2MQH A;  1K28 A;  4GNX B;  2KCC A;  3E9I A;  1E24 A;  4JI8 L;  2B2T C;  1PZK D;  2CQO A;  3RR5 A;  2R7Z G;  2KHS A;  2Z6K A;  4A3F B;  4XYO A;  3DUZ A;  3DWQ A;  2ZTE A;  3KDF B;  1K9M C;  5AJ3 L;  3OMC A;  1A63 A;  5EPL A;  2XGT A;  4DR1 L;  2HCI A;  1CQV A;  4G7Z C;  1R4Q B;  4FNF A;  3GDE A;  4S3S A;  2RF4 A;  2FIN B;  3T51 B;  2EQS A;  4LF7 L;  2ICI A;  3TME A;  5EKL A;  4RA8 A;  3A7L A;  3Q24 A;  4RCN A;  1D2B A;  1CK1 A;  5FLM G;  4X66 Q;  3W1B A;  1GKH A;  4APV A;  1I6H H;  3AFP A;  1BBW A;  4OIK A;  2UUB L;  4PV1 C;  4NXN L;  1D6E C;  1Y8N B;  4NXM Q;  3EJI A;  5C3E H;  2KCN A;  5IT9 E;  2F0E A;  2WIN B;  4DFA A;  4PMW A;  4FYD A;  2R92 B;  3TN2 A;  4KD4 A;  3UDF A;  1T5X D;  4EQO A;  4LWC A;  2EZV A;  3HKZ E;  1HZC A;  3K7A H;  3KLS A;  5KRU A;  5JAV A;  1ZYR C;  1P16 A;  2FFK B;  4M1U B;  1DJR D;  2QDL A;  2WP8 J;  4JG2 A;  2OQ0 A;  4POF A;  2CKZ B;  2XIW A;  4L5R C;  1M1K C;  2JA5 H;  3KLR A;  1SR3 A;  1BBX C;  5KYL A;  1YJW A;  3P7J A;  2VB2 X;  4AIM A;  2Q8I B;  3BVG A;  1EUJ A;  2G9D A;  1VQ4 A;  3JAM E;  1XNQ L;  2EPB A;  1TWH H;  1B44 D;  1WD0 A;  4G4K A;  1SJE D;  3L7Z C;  3CRK C;  2PMZ E;  2K5D A;  3HOZ B;  3CCJ A;  3CW2 C;  5EBD A;  1H9R A;  3HG9 A;  1F9Q A;  3PUV A;  3RZO B;  2AKW B;  1CT1 D;  4C3J H;  3IKJ A;  1SFO H;  2RQX A;  3RZD H;  1JT8 A;  4OO1 G;  5M9O A;  3K6O A;  5GRO A;  1N33 Q;  2F0G A;  3DXJ C;  5G3L F;  1VCI A;  3OYY A;  4J15 A;  1IBL Q;  2E2H H;  1YNX A;  3TZU A;  4KHZ A;  3E0J A;  4DAY A;  3M4O B;  1K8A C;  1JJC B;  4QY7 A;  1Q3L A;  2OF1 A;  3KJO A;  2Z4H A;  2UXB L;  4FXG C;  1EYG A;  1PXU A;  4IPH A;  3CAM A;  2K50 A;  2EXD A;  1Y1W B;  3UDX A;  4DV3 Q;  2K5H A;  5IE8 A;  2RSN A;  4BY1 B;  1KLG D;  4YWM A;  4A3E G;  1RIP A;  1O80 A;  1V43 A;  1X54 A;  1UE7 A;  1AN8 A;  4C2M H;  4KJN A;  2K5W A;  4P73 A;  4R8I A;  4DR2 L;  2RHQ B;  1Y14 B;  2YU9 H;  2PCF B;  2NWG A;  3FKI B;  2NN6 H;  5E4X A;  3ZJY C;  2QDB A;  4QB4 A;  1IW7 D;  1YVC A;  1VQ9 A;  3J80 i;  1LO5 D;  3OMG A;  1I4H A;  5C44 B;  1K73 C;  2AWN A;  3C1F A;  1FR3 A;  5IYD H;  1O7Y A;  1FVI A;  1XPU A;  3VA7 A;  4A3M G;  1S3O A;  2HQE A;  2EXZ A;  2VQF Q;  3VYT A;  2KCM A;  1JJG A;  2JA7 B;  3J81 i;  4BXX H;  4JI3 L;  3HS0 C;  1Q7Y C;  4O1N A;  2JA6 H;  3QIA A;  2R93 B;  2HDL A;  1YJ9 A;  3A74 A;  2A69 D;  2F0S A;  1L0W A;  1K0R A;  2MP1 A;  5T1I A;  4QL5 A;  1KAA A;  2BE5 D;  3MXN A;  1IL8 A;  3OPO A;  3A8K E;  2F0M A;  4QQB X;  2K05 A;  1H9J A;  5C0X H;  3ZYY X;  4A3B H;  3BDL A;  2E2D C;  4IUP A;  1NMG A;  1QE6 A;  2JA8 G;  2ZTD A;  1WOC A;  1Y1V H;  1EQV A;  3NTI A;  1IYJ B;  2B2Y C;  2ZT9 C;  3S15 H;  1N34 Q;  2B39 A;  1ICF B;  4FF4 A;  4A3C G;  3NP8 A;  3ITP A;  2F03 A;  2BCO A;  2BOS A;  5G3L D;  1PMR A;  3JAM c;  3PO3 G;  2XWB B;  1EY4 A;  1CA6 A;  3I4N B;  4X62 L;  1SMY D;  1V8Q A;  3NEN A;  3VYR A;  3TRE A;  3HOZ H;  4AH6 A;  3G71 A;  4DK0 A;  2M9V A;  5LL6 S;  3OIP A;  2K5Q A;  1PA6 A;  3L0O A;  1FYC A;  2JEA I;  3RZO H;  1N8R C;  1L0X B;  1VQP A;  1XTD A;  2RBM A;  2EYJ A;  3IRB A;  3BZC A;  2Q8T A;  4ZQ3 A;  4HMI A;  1S5D D;  3SEB A;  2X6L A;  5IWA L;  1IBM Q;  1QNU A;  1LLR D;  3NPP A;  1BKB A;  5C4J H;  4X64 Q;  1G2S A;  5IP7 H;  2KEE A;  4XT3 B;  3OIQ A;  3S24 A;  2YV5 A;  2NVX H;  1SE2 A;  2PYK A;  4L5S A;  5IOD A;  1I4G A;  4K2K A;  5CV7 A;  3KLS X;  2PW5 A;  1XNR L;  1OTC A;  5I9O A;  4HIK A;  4MZ9 A;  1MD2 D;  2JSO A;  4OO1 I;  4RKB A;  2F0V A;  4P71 A;  4RKL A;  4GLA C;  1F2L A;  2B63 B;  1RTN A;  5EKI A;  4DV2 Q;  1YEZ A;  2BDN A;  4OIJ A;  2QEJ C;  2GN5 A;  5DM6 3;  3J7A V;  3OTO L;  3V96 A;  3CXC A;  4TKO B;  2OT2 A;  4WOR A;  4NP5 A;  1IKM A;  2EVB A;  4XQJ A;  1EY6 A;  2QEX A;  4RMF A;  1HPC A;  1X9N A;  5BR8 Q;  5CR3 A;  1BNZ A;  2HIV A;  1Q46 A;  4V19 0;  1SMX A;  2I07 B;  5A35 A;  3A8I E;  1QOH A;  2MO1 A;  4CJ0 B;  1IW7 C;  3HOU G;  4PZ7 A;  2HHH L;  4A3K B;  4LF9 L;  5CV8 A;  2WAQ G;  1CI3 M;  4BY7 H;  2ZXO A;  3I4L A;  1S40 A;  2Q2I A;  1JWM D;  2Z1C A;  1EEI D;  1C48 A;  1PZI D;  3VA5 A;  4JI2 L;  1QZH A;  3CQZ H;  1ENF A;  3I4M B;  1Y8P B;  4JBM A;  2JA7 H;  5JEA H;  3GTQ B;  1NR2 A;  2PZU A;  5D65 A;  5IGC A;  2IY5 B;  1KDA A;  5AJ3 Q;  3D6C A;  5ELE A;  3HKZ B;  4DR1 Q;  2I5H A;  4FF2 A;  4RGM A;  2GA4 B;  4A3L H;  3DEO A;  1YNJ D;  5M5X H;  4OEL B;  1VF7 A;  4DXG A;  2AQ2 B;  2BE5 C;  4LF7 Q;  1OXS C;  2PZT A;  3QB3 A;  3T4A C;  4KD3 A;  1IXR A;  3BG3 A;  1I6V C;  2VB3 X;  3I3C A;  5FO7 B;  1TWG B;  1EL0 A;  2F0W A;  2A6H D;  2MPM A;  4QCL A;  3WOE A;  4MN3 A;  5D3I B;  2CH4 A;  3L2P A;  5FOB B;  1VQK A;  2N3S A;  1ASY A;  2UUB Q;  5KNC A;  1WFQ A;  4NXN Q;  3BYT B;  4Y7N H;  4IZ8 A;  4DNR B;  2PMZ B;  3I55 A;  4L63 B;  3RLN A;  1RHP A;  4R4C A;  1UEB A;  4K14 A;  4EVO A;  3S1R B;  4HSP A;  4MHE A;  1S5E D;  1STA A;  1Q1B A;  4FXK C;  4L5T A;  4HJ5 A;  3S1Q B;  3K5O A;  3TDQ A;  1YHQ A;  3S17 B;  4KY5 A;  1VQF A;  1EIY B;  1NJI C;  5C4X B;  2VS1 A;  2X6G A;  3TP6 A;  5M3M G;  3J80 L;  1SYE A;  1GO3 E;  2NZ1 D;  1J5E L;  1TWC H;  4N8F A;  3IAY A;  1IYV A;  3B6Y A;  1JOR A;  1VQ6 A;  3HOX G;  4ULL A;  2QKI C;  1XNQ Q;  1OXT A;  1S4Z A;  3DMU A;  2R7Z H;  5T1G A;  3J81 L;  1DM0 B;  3D0F A;  3PSI A;  3HOY B;  1IKL A;  3NK9 A;  1X65 A;  4R9W A;  3ERO A;  1TY2 A;  2F0T A;  3VR5 A;  1B2T A;  1EWI A;  4JYA L;  3E3X A;  2BH8 A;  4KY7 A;  3IL8 A;  1UAP A;  2JJQ A;  4HCE A;  4LMQ D;  1HNZ L;  1SNQ A;  3BZD B;  3S1N H;  1DZ1 A;  3A54 A;  1KD1 C;  2B2V A;  3JAM i;  4FF3 A;  1X3E A;  4QJF A;  2K04 A;  3J81 E;  3RLO A;  5FLM H;  2B2W C;  2LSS A;  2RDG A;  1CHQ D;  3HOW B;  3NQT A;  3DWA A;  2PPB C;  2Q2T A;  4CKE A;  1C7Y A;  3UE0 A;  3VDY A;  3I7F A;  5C4H A;  3GTJ B;  1VF5 C;  2V4D A;  4WJ4 A;  4KJO A;  1JE4 A;  1QJO A;  5C3W A;  1PYW D;  4WJ3 M;  5EKK A;  1ICW A;  3VR4 A;  1LUZ A;  2WB1 E;  2UXB Q;  3DM3 A;  2H4O A;  1YHB A;  2BDO A;  2CWA A;  4GOP A;  1PH9 A;  3GP7 A;  2XRQ D;  2QF7 A;  2IX0 A;  4KI0 A;  1VQO A;  1JQY D;  1EYA A;  2EE1 A;  2PQE A;  2FMM A;  2JK8 A;  4DR2 Q;  4R4I A;  3K0X A;  1C9O A;  4POG A;  4J8Q A;  1Q82 C;  1SE8 A;  1JMC A;  1SRO A;  1KNA A;  5D14 A;  1O7Z A;  2N8N A;  4P75 A;  4ZKB B;  2E75 C;  1YNJ C;  3P20 A;  1UEA B;  1OXV A;  1Q1E A;  1KQS A;  1F2M A;  3PQI A;  2K75 A;  5HGQ A;  2XNA C;  1WTH A;  2L11 A;  5JPN C;  1CKM A;  5GQO A;  3V05 A;  2F0I A;  1JE5 A;  1SJH D;  3MC0 B;  1B1Z A;  4JI3 Q;  1VQ8 A;  1EQR A;  2A6H C;  5C3E B;  2LMC B;  3A7A B;  3MXG A;  2K03 A;  4OO1 H;  1QZG A;  1CUK A;  1ZYR D;  3RLF A;  4LAA A;  3K7A B;  1LAC A;  2F0K A;  4YIJ A;  4AYB G;  1WTV A;  1PLF A;  5JOB A;  1TR5 A;  4OWT B;  3CCE A;  1HH2 P;  2K28 A;  2MUY A;  2NVY H;  1G29 1;  2TSS A;  2Z4I A;  4OXP A;  5DAU A;  5HGT A;  5JEA J;  3S1Q H;  3U9O A;  1B3A A;  3M4Q A;  4TQU S;  4RGN A;  2JA5 B;  5K5P A;  1LT5 D;  4EQN A;  1EIF A;  4K6D A;  3R2T A;  5J39 A;  2Z8L A;  1F77 A;  1TWH B;  3HRZ C;  3H3V I;  3LNN A;  1E2W A;  1SBB B;  2EJM A;  2Q2H A;  4A3E H;  4EX5 A;  1YIT A;  4DV4 L;  3RD4 A;  4KHP L;  2NUC A;  4DR3 L;  4GNX C;  2K4K A;  1X6O A;  1AE3 A;  5FKA C;  2KOL A;  1EEF D;  2JA9 A;  2DN8 A;  3J80 c;  2OQK A;  4C3J B;  2A73 B;  3OHX C;  1FNU A;  5LHY 1;  4DAP A;  4XQN A;  1XJV A;  1XPR A;  1SFO B;  4B3S L;  5JJI A;  1O7L A;  2L15 A;  4LF6 L;  4J6H A;  2K6A A;  3NSW A;  1V1O A;  5BN3 A;  3OW2 A;  4HED A;  1GHK A;  4A3M H;  3SDZ A;  5IWA Q;  3ER0 A;  3KK7 A;  1EQQ A;  1XTC D;  4OL7 A;  3FP9 A;  3J81 c;  2KUM A;  4JOI C;  4GN4 B;  2E2H B;  3G6E A;  2DNE A;  3CPW A;  4ILW A;  4BBS G;  1B9N A;  4K5W A;  4NB3 A;  3H15 A;  4IPC A;  2B2T A;  1MSH A;  1CKN B;  4HR7 B;  3A0J A;  1NCV A;  1KLU D;  3MVV A;  2KJX A;  1NAP A;  2MO0 A;  1XNR Q;  3FMC A;  1IBK L;  1EWC A;  1KL9 A;  3CD6 A;  1L0Y B;  4A3G H;  3D6W A;  4EQ5 A;  1PTO H; 
#chains in the Genus database with same CATH homology
 5IOC A;  3VYS A;  1RTO A;  4C2M B;  2A68 C;  1BCP B;  1F9S A;  1OO9 B;  2YU9 B;  4R8N A;  2F0L A;  1PFN A;  1Y69 U;  3NUC A;  2OEO A;  5IT9 L;  3NQI A;  2K01 A;  3A55 A;  1F9R A;  4B08 A;  3MEH A;  3J7A F;  5EBC A;  1XXG A;  5KNB A;  2EYM A;  4K2L A;  1GHJ A;  1S5F D;  3EFX D;  3I72 A;  4PMB A;  1H9S B;  4FXD A;  2ICE C;  2JA6 B;  5KND A;  5K36 G;  3CKI B;  2FMC A;  2IW3 A;  2R6G A;  3M85 A;  1JC7 A;  1BXT A;  1HQM C;  5IIF A;  4H13 C;  3I73 A;  4KN7 C;  3QOJ A;  3EQL C;  1WTW A;  4A3B B;  2JEB I;  3HOX B;  3N52 A;  4ZRZ A;  3JAM L;  3LWU A;  4ABN A;  2WII B;  1Y1V B;  5KYI A;  4ZK9 B;  4HCS A;  3S15 B;  3V2T A;  3I91 A;  3FEW X;  1CQF A;  1CTM A;  4I7Z C;  3M7G A;  4IUQ A;  1VMC A;  5FLX E;  3VYU A;  3MWY W;  1HUN A;  3P75 A;  3QWN A;  2A6E D;  3N6R A;  1LTR D;  4XDX A;  2QIL A;  1Z6H A;  5IGE A;  4IUN A;  2L1B A;  1HA6 A;  4H7B A;  2K33 A;  1A15 A;  4K8I A;  3K5M A;  1J8I A;  3MTS A;  1X3Q A;  2KVM A;  5C4J B;  4XT1 B;  2IWH A;  1S5C D;  3NWT A;  4G7O C;  2NVX B;  1PFB A;  5I6W A;  3C1E A;  1SAP A;  2WB1 B;  1W6K A;  4C1N I;  3BDO A;  1QG7 A;  4HN7 A;  2A5H A;  5F2D A;  2ENB A;  3SK4 A;  3ONA B;  1TS2 A;  4TSS A;  1ET9 A;  4KY6 A;  5E3F A;  3E5S A;  4DA2 A;  1GUG A;  1PTO F;  3PIO 3;  1TKW B;  1QB5 D;  3PUW A;  3NHH A;  4P2C B;  5IGD A;  4C56 C;  2B2U C;  3OWE B;  4BY7 B;  1ZXT A;  1DON A;  1MSG A;  4RGT A;  5COR A;  1I4P A;  1EIG A;  3CQZ B;  3NXW A;  2IPK D;  4M8A A;  3E6Z X;  3L9A X;  2HUG A;  1STE A;  2B2Y A;  5M5X B;  1BQQ T;  3PIP 3;  3X3N A;  1S5B D;  5ISR A;  4RAU C;  1WTX A;  1ENC A;  3X3M A;  2E74 C;  1HA5 A;  4CGY B;  3UI2 A;  1ILP A;  4Y7N B;  5C6A A;  1G8Z D;  2MJ8 A;  4XQQ A;  2DY8 A;  4IFD G;  2XSC A;  1STH A;  4K5V A;  1ONL A;  4CBV A;  1FGB D;  3NE5 B;  3RUZ A;  5BN5 A;  2M2L A;  1STN A;  2A6E C;  3PMF A;  1HXY D;  2WV6 D;  4U68 A;  3W3A A;  1TWC B;  1U4P A;  1LV9 A;  1HFG A;  4N9P A;  4FO2 A;  3FVQ A;  1WTP A;  3SHL A;  1I4X A;  4XYQ A;  1Q90 A;  1A6X A;  1X3P A;  2D9U A;  2NBF A;  1SSO A;  2R7Z B;  1HHV A;  1STB A;  1CA5 A;  1OXU A;  3T53 B;  1EIH A;  2MGS A;  1WTO A;  4IUU A;  5JPM C;  2F3V A;  3MXP A;  1EQT A;  2JYO A;  4EGV A;  2SEB D;  5CV6 A;  3G7L A;  3J7Y W;  3S1N B;  1GUW A;  4XTC S;  2RSO A;  1TVX A;  3TZD A;  1STG A;  5EPK A;  4RHR A;  4DN4 M;  3M4Y A;  2R61 A;  2JXM B;  4C3I G;  3WDN A;  4IUT A;  3L3O C;  1LTT D;  2RDF A;  1JWS D;  4K5X A;  3VR6 A;  1SNM A;  1LTG D;  3KBX A;  3TP7 A;  1BCP F;  5CV4 A;  3SR1 A;  3DWP A;  2F0J A;  2PO4 A;  4NMZ A;  2C5C A;  3HZX A;  1D1I A;  2J0T D;  3A8J E;  4IUR A;  4X3S A;  4HMJ A;  3NWS A;  5A2Q E;  1HRJ A;  1BR9 A;  2F0F A;  3IFT A;  3KUP A;  3K57 A;  5EGT A;  4V0B A;  1TII D;  1NUC A;  3QO2 A;  3R2I A;  3D4D A;  3KF8 A;  4HAE A;  3P1H A;  4G57 A;  2LKV A;  5EJW A;  1HCZ A;  3Q0A A;  3NBH A;  1CZG A;  1D5X C;  4KK7 A;  5CC4 A;  2NVY B;  3GV6 A;  2TMP A;  1GUN A;  1RF2 D;  1LT4 D;  5DNF A;  2DY7 A;  1EYC A;  2RA4 A;  2N88 A;  2L9H A;  1MBY A;  3H6M A;  4QF4 A;  1B53 A;  1E0B A;  2AUJ D;  2F3W A;  3SK5 A;  1R4P B;  2LFN A;  2RVL A;  2SDF A;  4HSV A;  4OHJ A;  5C0X J;  2F1M A;  1D5Z C;  4ME5 A;  4A3E B;  4IFD I;  4EQP A;  2E76 C;  2JP1 A;  3LX0 A;  3GD7 A;  1UNS A;  2EYO A;  2EYH A;  1KNE A;  1PTO C;  2B2W A;  3R8B A;  1BCP D;  2YYZ A;  2EY6 A;  5KIX A;  4A3M B;  1SYB A;  1J9O A;  4RGO S;  4X3K A;  1SNC A;  1SNO A;  5I2Y A;  5K36 H;  4XIG S;  5TSS A;  2M00 A;  3AU7 A;  2X69 A;  1TS4 A;  2O5I C;  1KDC A;  2L4N A;  2F0D A;  4A3G B;  4QIW B;  3QOL A;  1PTO B;  4KN4 C;  2JA8 B;  2A68 D;  1M8A A;  2MHV A;  3BDC A;  2F0U A;  2I46 A;  4CKB A;  1ENA A;  1NR4 A;  2KA7 A;  2EYP A;  2XRS D;  1ZEQ X;  2CW0 D;  2PNR C;  1B50 A;  1WVL A;  3HP3 A;  5IGB A;  3PO3 B;  4RH6 A;  1LTA D;  4QMG A;  1EZ8 A;  5E1F A;  3S14 B;  1Z47 A;  1DD2 A;  4CKC A;  4Z9C B;  1PFM A;  2NVQ B;  2K32 A;  4K8J A;  5C3X A;  2CVR A;  2K1B A;  3NTK A;  3W2D A;  5IGG A;  4N9T A;  4QUC A;  1QCB D;  3U9S A;  5FO9 B;  3D3R A;  4NKL A;  1V1P A;  1I3Q B;  1TS5 A;  2ZXR A;  3HGB A;  2EDG A;  4BWG B;  3D4W A;  3GTO B;  3R3O A;  5CBE E;  4PNY A;  4A3D B;  1NSN S;  5I9P A;  2JE6 I;  2EJG C;  2NN6 I;  2NYZ D;  2BA1 A;  3HOU B;  1BO0 A;  4F87 A;  2NVT B;  1E2Z A;  3Q23 A;  1BCP C;  1PRT B;  2WAQ B;  1RCV D;  2F0P A;  3H91 A;  1CZW A;  4H44 C;  3TBI B;  1GUT A;  1JR0 D;  4FF1 A;  3H3V C;  1DXM A;  5I4D A;  2H1E A;  2E2I B;  2BA0 A;  2IX1 A;  2XWJ B;  5ELD A;  3SK8 A;  3TP8 A;  4Q0F A;  3D4R A;  1AZQ A;  1QWY A;  2E2J B;  3TP5 A;  1A3T A;  1F2Z A;  3LWE A;  3PO2 B;  5CGK A;  2VNU D;  3H94 A;  2D62 A;  5ELB A;  3MFG A;  1SDF A;  2ID0 A;  2CW0 C;  4IFD H;  4C3H G;  2AQ3 B;  1A3U A;  3R93 A;  1W6J A;  4H0L C;  1R9T B;  3IFD A;  5M3M B;  4I65 A;  1Y8O B;  1ZKO A;  5FO8 B;  1K8O A;  3DM1 A;  4ZUI A;  3OSO A;  1B9M A;  3FPP A;  5FLX L;  1ROD A;  1C8C A;  2NTT A;  3S16 B;  3PV0 A;  1CHP D;  3KBG A;  2NB0 A;  1G2T A;  1TU2 B;  1WD1 A;  1TY0 A;  1WTR A;  1FD7 D;  3GTL B;  1HUM A;  1EYD A;  2EJF C;  1LAB A;  1K8M A;  1EOT A;  2KED A;  5E4W C;  2WKD A;  3F2U A;  4KKT A;  1RD9 D;  1O78 A;  1WTQ A;  3I8Z A;  2J7Z A;  4G7H C;  5DM7 3;  3A56 A;  4LJZ C;  2RDH A;  1JIC A;  3OOC A;  2AQ1 B;  3K0Y A;  1PDQ A;  5C5L A;  1BDO A;  2Y0S B;  1G91 A;  1B4O A;  1LT6 D;  1LTB D;  1Q8I A;  1JOK A;  1QIL A;  1VMP A;  5KGU A;  1TWF B;  5D3D A;  1I4R A;  3MZ5 A;  1RDP D;  3MXU A;  3O13 A;  4KKS A;  1EY0 A;  3GO5 A;  3C2P A;  3Q6S A;  5KEE A;  2ZXP A;  3VR2 A;  4ID6 A;  3MAQ A;  1H9K A;  4F8M A;  1YNN D;  2B2U A;  5CV5 A;  4ZKC B;  4DGZ A;  1RJT A;  4DU9 A;  5J22 A;  2R3Z A;  3Q22 A;  2CHB D;  2QCP X;  4B9W A;  4Q5V A;  1E2V A;  4AYB B;  4KHV A;  2L12 A;  1LTS D;  1HQR D;  1GOZ A;  3PUX A;  2EY2 A;  3EA6 A;  5I6Y A;  4WFN 3;  1EU4 A;  2AWO A;  4RCO A;  5EQ0 A;  1ESR A;  2C9O A;  4K6L A;  3NBI A;  1LT3 D;  2EY5 A;  1TQO A;  3AB9 A;  1KAB A;  1JOO A;  3URY A;  5ELC A;  4U67 3;  3QG1 A;  1KDB A;  1U4R A;  2CQA A;  3AMU A;  4F88 A;  2EY1 A;  3TSS A;  4CJ2 C;  3ND9 A;  4WJW A;  2FJ2 A;  1SYD A;  4IQZ A;  4IFD J;  4DF7 A;  3D8G A;  5CMD A;  1CFM A;  3K58 A;  4JBW A;  1ET6 A;  1X32 A;  4BBS B;  1XYI A;  1EY7 A;  1CM9 A;  5CYU A;  2LY7 A;  3T16 A;  2EYL A;  3H09 A;  4IN3 A;  2IJ0 A;  3S1M B;  1II3 A;  4IAL A;  1XX8 A;  4WRD A;  1U9R A;  4MIU A;  2VUM B;  4DXF A;  1DOK A;  3T13 A;  4KKU A;  4E6I A;  1SE4 A;  1IHZ A;  4RWS C;  1PTO D;  2KEC A;  1AEX A;  1PRT F;  4O42 A;  1TT2 A;  5ELF A;  1A2U A;  1BOS A;  2G9H D;  4BA2 I;  2OXP A;  5I2X A;  1SYF A;  1EU3 A;  4C3H B;  5J1Z A;  2SNS A;  4QUF A;  5M5Y B;  1WCM B;  2HDM A;  4J1M A;  4PMC A;  1I50 B;  1YNN C;  4CHT B;  1JB3 A;  5A2Q L;  3I70 A;  5C4Z A;  5CV9 A;  2WAC A;  3VR3 A;  5FK9 C;  4DAV A;  3BVZ A;  1ESF A;  2VXW A;  4ZLT F;  3MFY A;  3M7N A;  5AFW A;  1DCZ A;  4C3J G;  1BF4 A;  4L8J A;  3BS1 A;  2XVS A;  1G6Z A;  1SXT A;  4ZAI A;  4HTH A;  5CBA E;  1T5E A;  2AUK A;  4UDU C;  1MI2 A;  3WOF A;  2EYF A;  4RHS A;  1Q12 A;  3CU7 A;  2NTS A;  1EY9 A;  2DNC A;  4GZY C;  2IT1 A;  3CHB D;  1SNP A;  2A69 C;  3K59 A;  3K5L A;  4B9X A;  5HUR A;  4C1N K;  4X3T A;  1OXX K;  3BVM A;  1PRT D;  1U4L A;  3DEP A;  1SYC A;  3OW7 A;  4A93 B;  4KMU C;  5EPJ A;  2NN6 G;  3SK6 A;  4A3I B;  1DOL A;  5C5M A;  4X3U A;  4FP5 D;  5DEH A;  1MGS A;  2RKS A;  5JJZ A;  1EY8 A;  1SMY C;  4JK1 C;  1DOM A;  3DHQ A;  1ILQ A;  3BYY B;  1F2Y A;  1STY A;  4KTA A;  4ZYS A;  1HFN A;  3GV3 A;  2SOB A;  3SE0 A;  2SNM A;  5C0X G;  3FPU B;  1SE3 A;  3QJY A;  1TWA B;  2A74 C;  3H0G B;  4NDX A;  2IX3 A;  4FVM A;  2O4X A;  1HTL D;  1LTI D;  1UUP A;  2F0N A;  2F0O A;  3GQB A;  4OGQ C;  3RMH A;  3I90 A;  3J80 E;  1XWE A;  2B8G A;  1SEB D;  2D2C C;  2FHT A;  3OWF A;  2PW7 A;  1FNW A;  2Q8R E;  1EY5 A;  3EVQ A;  4F7X A;  1QNK A;  4DK1 A;  5NUC A;  1AW7 A;  3GTG B;  1HTP A;  3HEJ A;  5COY A;  2PZW A;  3CRL C;  2J4X A;  3NTH A;  5M5W B;  1H9M A;  4A3J B;  1AP0 A;  4BA1 I;  2B2V C;  3SVM A;  1D5M C;  1ML0 D;  3PUY A;  2L0C A;  3T56 B;  3MHB A;  1C4Q A;  4UAI A;  5LL6 X;  2K7V A;  4CJ1 B;  2F4I A;  1U4M A;  3ERQ A;  2N55 A;  3GTM B;  1GXD C;  3MA2 B;  3S2D B;  4ODG A;  5JVH 3;  1Z7T A;  3HOV B;  1EFI D;  1A2T A;  1F9P A;  2O2L D;  1FNV A;  2B8F A;  4NW2 A;  2HCC A;  2EOT A;  3K5N A;  1TS3 A;  2F0Q A;  2XN9 C;  1GUS A;  5BN4 A;  3PUZ A;  1K83 B;  1I6H B;  3ND8 A;  2WKC A;  1DYQ A;  1PRT C;  3GTP B;  1GJX A;  5JVG 3;  3S2H B;  1PZJ D;  4XXE A;  3M3Y B;  1GUO A;  4PQX A;  1SYG A;  5JEA G;  4LK1 C;  3SXH A;  2F0H A;  4ZUJ A;  4C3I B;  1BUV T;  2KQ3 A;  1A3V A;  1KTK A;  1RKN A;  5IGF A;  3FRP B;  2D5D A;  4KV6 A;  1M4V A;  2L5T A;  4DNT B;  1I4Q A;  3D31 A;  3FDT A;  3C3L A;  1H9S A;  4TRD A;  3S9W A;  1AZP A;  3RZD B;  4RFB A;  1IYU A;  1VDZ A;  3C46 A;  1SND A;  2O5J C;  5C0X I;  1JCK B;  1EWH A;  3GTK B;  4IUV A;  1JWU D;  2LS0 1;  3G6J B;  4L6T B;  4BS9 A;  1EZ6 A;  1V1P B;  5M3F B;  1D1K A;  4BBR B;  2IL8 A;  1AFP A;  1JOQ A;  2L55 A;  2KCC A;  2B2T C;  1PZK D;  2KHS A;  4A3F B;  4XYO A;  3DUZ A;  3DWQ A;  3OMC A;  5EPL A;  2HCI A;  1CQV A;  4G7Z C;  1R4Q B;  4FNF A;  4S3S A;  2FIN B;  3T51 B;  2ICI A;  3TME A;  5EKL A;  4RA8 A;  3A7L A;  3Q24 A;  4RCN A;  1D2B A;  1CK1 A;  4OIK A;  4PV1 C;  1D6E C;  1Y8N B;  3EJI A;  2KCN A;  5IT9 E;  2F0E A;  2WIN B;  4DFA A;  4PMW A;  4FYD A;  2R92 B;  3TN2 A;  4KD4 A;  4EQO A;  1T5X D;  2EZV A;  5KRU A;  3KLS A;  5JAV A;  1ZYR C;  2FFK B;  4M1U B;  1DJR D;  2WP8 J;  2XIW A;  3KLR A;  1BBX C;  5KYL A;  3P7J A;  2VB2 X;  2Q8I B;  3BVG A;  2G9D A;  3JAM E;  2EPB A;  1B44 D;  1WD0 A;  4G4K A;  1SJE D;  3L7Z C;  3CRK C;  2K5D A;  3HOZ B;  5EBD A;  1H9R A;  3HG9 A;  1F9Q A;  3PUV A;  3RZO B;  1CT1 D;  3IKJ A;  2RQX A;  4OO1 G;  5M9O A;  3K6O A;  2F0G A;  3DXJ C;  5G3L F;  1VCI A;  3TZU A;  4KHZ A;  3E0J A;  4DAY A;  3M4O B;  1Q3L A;  2OF1 A;  2Z4H A;  4FXG C;  1PXU A;  1Y1W B;  2RSN A;  4BY1 B;  1KLG D;  1O80 A;  1V43 A;  1AN8 A;  4KJN A;  2K5W A;  4R8I A;  2PCF B;  2NWG A;  3FKI B;  2NN6 H;  5E4X A;  2QDB A;  4QB4 A;  1IW7 D;  1LO5 D;  3OMG A;  1I4H A;  5C44 B;  2AWN A;  3C1F A;  1FR3 A;  1O7Y A;  3VA7 A;  2HQE A;  2EXZ A;  3VYT A;  2JA7 B;  3HS0 C;  4O1N A;  3QIA A;  2R93 B;  2HDL A;  2A69 D;  2F0S A;  2MP1 A;  5T1I A;  1KAA A;  2BE5 D;  3MXN A;  1IL8 A;  3OPO A;  3A8K E;  2F0M A;  2K05 A;  1H9J A;  5C0X H;  3ZYY X;  3BDL A;  2E2D C;  4IUP A;  1QE6 A;  1EQV A;  3NTI A;  2B2Y C;  2ZT9 C;  2B39 A;  4FF4 A;  3NP8 A;  3ITP A;  2F03 A;  2BCO A;  2BOS A;  5G3L D;  1PMR A;  2XWB B;  1EY4 A;  1CA6 A;  3I4N B;  1SMY D;  1V8Q A;  3VYR A;  4DK0 A;  2M9V A;  5LL6 S;  3OIP A;  2K5Q A;  2JEA I;  1FYC A;  1L0X B;  2RBM A;  2EYJ A;  2Q8T A;  4ZQ3 A;  4HMI A;  1S5D D;  3SEB A;  2X6L A;  1QNU A;  1LLR D;  3NPP A;  1G2S A;  2KEE A;  4XT3 B;  3OIQ A;  1SE2 A;  2PYK A;  5IOD A;  1I4G A;  4K2K A;  5CV7 A;  3KLS X;  2PW5 A;  5I9O A;  1MD2 D;  2JSO A;  4OO1 I;  4RKB A;  2F0V A;  4RKL A;  1F2L A;  2B63 B;  1RTN A;  5EKI A;  2BDN A;  4OIJ A;  2QEJ C;  5DM6 3;  3J7A V;  3V96 A;  4TKO B;  2OT2 A;  4WOR A;  4NP5 A;  1IKM A;  2EVB A;  4XQJ A;  1EY6 A;  1HPC A;  5CR3 A;  1BNZ A;  4V19 0;  2I07 B;  5A35 A;  3A8I E;  1QOH A;  4CJ0 B;  1IW7 C;  4A3K B;  5CV8 A;  1CI3 M;  2ZXO A;  3I4L A;  1JWM D;  2Z1C A;  1EEI D;  1C48 A;  1PZI D;  3VA5 A;  1ENF A;  3I4M B;  1Y8P B;  5JEA H;  3GTQ B;  1NR2 A;  2PZU A;  5D65 A;  5IGC A;  1KDA A;  3D6C A;  5ELE A;  3HKZ B;  4FF2 A;  4RGM A;  2GA4 B;  3DEO A;  1YNJ D;  1VF7 A;  4DXG A;  2AQ2 B;  2BE5 C;  1OXS C;  2PZT A;  3T4A C;  3QB3 A;  4KD3 A;  3BG3 A;  1I6V C;  2VB3 X;  3I3C A;  5FO7 B;  1TWG B;  1EL0 A;  2F0W A;  2A6H D;  2MPM A;  4QCL A;  3WOE A;  4MN3 A;  5D3I B;  5FOB B;  5KNC A;  3BYT B;  4IZ8 A;  4DNR B;  2PMZ B;  4L63 B;  1RHP A;  4K14 A;  4EVO A;  3S1R B;  4HSP A;  4MHE A;  1S5E D;  1STA A;  1Q1B A;  4FXK C;  3S1Q B;  3K5O A;  3TDQ A;  3S17 B;  4KY5 A;  5C4X B;  2X6G A;  3TP6 A;  3J80 L;  1SYE A;  2NZ1 D;  3IAY A;  1IYV A;  1JOR A;  4ULL A;  2QKI C;  1OXT A;  1S4Z A;  3DMU A;  5T1G A;  3J81 L;  1DM0 B;  3HOY B;  1IKL A;  3NK9 A;  4R9W A;  3ERO A;  1TY2 A;  2F0T A;  3VR5 A;  1B2T A;  4KY7 A;  3IL8 A;  1UAP A;  4HCE A;  4LMQ D;  1SNQ A;  3BZD B;  1DZ1 A;  3A54 A;  2B2V A;  4FF3 A;  2K04 A;  3J81 E;  2B2W C;  2RDG A;  1CHQ D;  3HOW B;  3NQT A;  3DWA A;  2PPB C;  4CKE A;  5C4H A;  3GTJ B;  1VF5 C;  2V4D A;  4KJO A;  1JE4 A;  1QJO A;  5C3W A;  1PYW D;  5EKK A;  1ICW A;  3VR4 A;  2H4O A;  2BDO A;  3GP7 A;  2XRQ D;  2QF7 A;  2IX0 A;  4KI0 A;  1JQY D;  1EYA A;  2EE1 A;  2PQE A;  2FMM A;  4J8Q A;  1KNA A;  5D14 A;  1O7Z A;  4ZKB B;  2E75 C;  1YNJ C;  3P20 A;  1UEA B;  1OXV A;  1Q1E A;  1F2M A;  2XNA C;  5JPN C;  2L11 A;  3V05 A;  2F0I A;  1SJH D;  3MC0 B;  1B1Z A;  2A6H C;  5C3E B;  2LMC B;  3A7A B;  3MXG A;  2K03 A;  4OO1 H;  3RLF A;  1ZYR D;  4LAA A;  3K7A B;  1LAC A;  2F0K A;  4YIJ A;  1WTV A;  1PLF A;  5JOB A;  1TR5 A;  2K28 A;  2MUY A;  1G29 1;  2TSS A;  2Z4I A;  5DAU A;  5HGT A;  5JEA J;  3U9O A;  1B3A A;  4TQU S;  4RGN A;  2JA5 B;  5K5P A;  1LT5 D;  4EQN A;  4K6D A;  3R2T A;  5J39 A;  2Z8L A;  1F77 A;  1TWH B;  3HRZ C;  3LNN A;  1E2W A;  1SBB B;  2EJM A;  3RD4 A;  2NUC A;  5FKA C;  2KOL A;  1EEF D;  2DN8 A;  4C3J B;  2A73 B;  3OHX C;  1FNU A;  5LHY 1;  4DAP A;  4XQN A;  1SFO B;  1O7L A;  4J6H A;  2K6A A;  3NSW A;  1V1O A;  5BN3 A;  4HED A;  1GHK A;  3SDZ A;  3KK7 A;  1XTC D;  4OL7 A;  2KUM A;  2E2H B;  2DNE A;  4ILW A;  1B9N A;  4K5W A;  2B2T A;  1MSH A;  4HR7 B;  1NCV A;  1KLU D;  3MVV A;  2KJX A;  1NAP A;  3FMC A;  1EWC A;  1L0Y B;  3D6W A;  1PTO H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...