4LW1A

Fragment-based discovery of a potent inhibitor of replication protein a protein-protein interactions
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
123
structure length
123
Chain Sequence
GSHMVGQLSRGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGNPVPYNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Replication protein A 70 kDa DNA-binding subunit
publication title Discovery of a potent inhibitor of replication protein a protein-protein interactions using a fragment-linking approach.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/inhibitor
total genus 31
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2013-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04057 Rep-A_N Replication factor-A protein 1, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4lw1A00
4J15A 3I2ZA 2NVYH 2KHJA 4X64Q 2IHEA 2YYZA 4P74A 1N34L 1ASZA 4B3SQ 2R7ZG 4C3HH 4LFBQ 4DUYL 1I6HH 1SR3A 4HJAA 3LGJA 3FKIH 1R9TH 2VQFQ 1K0RA 2F3IA 4DR5Q 4JI0L 5GROA 4OONA 4UP7A 4C3JH 1LUZA 5JJKA 5FLMG 1JE5A 1EQRA 2RHSB 2Y0SG 1B8AA 2I5LX 1I50H 1FVIA 1O7IA 3RZOH 3GTKH 1CKNA 4DK6C 1YHAA 1P16A 5E7NA 4YHHQ 5LMUL 3CC2A 5C0XG 4HJ8A 4YWKA 1PHJA 4JI3Q 1VQMA 1HR0W 4KHPL 1QVFA 4JYAQ 4DK3C 1U0LA 3L0OA 5H1SE 2MNAA 3CCVA 3HOVG 3SGIA 4LF4Q 5JJLA 1E1TA 4IPDA 4YWMA 2OQ0A 3JAMi 2UU9L 4B3MQ 2RF4A 1NJIC 2R93H 1FL0A 3HOZH 3B6YA 2DGYA 4DR6L 1GD7A 1KIXA 1WJJA 3CCJA 3TRZA 4GKKQ 1E1OA 2B29A 4JI1L 3W1GA 1Q12A 4GS3A 1YI2A 2JA5H 2UUAL 2RCNA 2E5LQ 4GLAC 4LF9Q 3I4OA 4DV7Q 1I5FA 3PGZA 2JA7G 1VQOA 2Z6KA 5GAGC 3ULLA 1GVPA 3RR5A 3H0GG 1VQJA 4QY7A 3MEFA 3I56A 4QJFA 4BBSH 2XGTA 3W1BA 4QIWE 5IYBH 3PUZA 1E22A 3KOJA 2Z6KC 3PSIA 1IBKL 4X6AH 2K52A 3KJPA 1UE5A 3G4SA 5C0XI 4NXML 2YTXA 1HNWL 1TWCH 3ERSX 3L2PA 2R6GA 3AYHB 4A3IH 4BA2I 4BBRG 1DGSA 4A3MH 2I5MX 4JBMA 1JT8A 1MIUA 1SFOH 5M3MH 1RIPA 5J3BA 1HZ9A 4DNIA 1J5EL 3GTOH 3HOUH 3JC66 3RLOA 1PVOA 3I4NH 2YV5A 4DV5L 4A3DH 4A76A 3PUXA 3UE0A 4MNOA 1AH9A 1PYSB 1X65A 1SN8A 3H3VI 3CCEA 1PH9A 1V1QA 1VQHA 4X66L 4K0KQ 1VQ4A 2YU9H 1UEBA 1FGUA 4POFA 5IYBG 1ASYA 1IBML 4BXXH 4MZ9A 2IX0A 1SE8A 4DR1Q 5AJ3L 1BVSA 3M7NA 1BBUA 3J80c 3CD6A 4AH6A 2UXBL 4DR3L 4A3MG 4JV5Q 4IFDJ 4DV1L 1VQAA 1N36Q 5M3MG 3RN5A 4JI7L 1Q1EA 4LF6Q 1VQ8A 1G51A 4A3CG 3E9IA 3GDEA 2WB1E 3F2CA 2ASBA 3I4NG 2L15A 2PNHA 1S40A 4B3TL 4LFCQ 2AKWB 3UDGA 2E8GA 2HHHL 1B70B 4LF7L 1Y14B 1TWAH 1VQNA 3AFQA 4JCVE 3J81i 3VDYA 4NXNL 2AWOA 4BXXG 2CQOA 3BU2A 5C3EH 5ELNA 3GTLH 3K0XA 1G6PA 1C0AA 4P72A 4JI5L 4PZ7A 2JA9A 3K81C 3RNUA 1VQ9A 4JBKA 4X62Q 4B3SL 2V1CC 2F4VQ 1WOCA 2KCMA 1IYJB 3KJOA 1X3GA 2VQFL 1VQ6A 4DR5L 2R7ZH 3F1ZA 4ALPA 2N49A 4HJ7A 3S14H 2K5HA 4DR4Q 2YTVA 1VQ7A 4JC0A 2JJQA 2VNUD 3ER0A 3CF5A 1YJ9A 3F8TA 2OQKA 4YHHL 4AYBG 3RZDH 1KC8C 3UDXA 4AQYQ 1Q81C 1CKMA 2WAQE 4JI3L 3ZJYC 2K5NA 2DUDA 3S24A 3HOWH 4B3RQ 1PYBA 1A62A 1HNZQ 4JYAL 1K9MC 5C44G 1XMOQ 2I0QA 4XIGS 1YEZA 4H02A 4LF4L 1PH6A 3NBHB 4GOPB 1YJWA 3BZCA 3CCMA 4R1JA 2CKZB 1VQIA 4B3ML 2Y0SE 2WAQG 4IJLA 3HOVH 2WP8J 4GKKL 2R7DA 3UE1A 2JQOA 1YHQA 3G48A 2ZJPA 4C3IH 1VS0A 2D0OA 4PZ6A 2E5LL 1Y1WG 4LF9L 1XPUA 1KL9A 2Q2HA 4A3BH 2ZTDA 3H3VH 1GKHA 1EFWA 4BY7H 1W3SA 4JOIA 4NB3A 2JA7H 1WFQA 3RLNA 3ICEA 3I7FA 3HOWG 4LFAQ 4LF5Q 2UXCQ 2WFWA 3A0JA 3H0GH 4DR2Q 2RHQB 3S16H 5C4XG 1XNRQ 1IZ6A 2A19A 4DR7Q 1Q86C 4IOCA 1MJEA 4JOIC 1X54A 4DV0Q 3CMAA 4DV4Q 3S1RH 2UUCQ 1Q7YC 4MTNA 2NN6G 1IBLL 2VZAA 3HKZG 2K4KA 2K5VA 4BBRH 2BH2A 1JJGA 4R4IA 1YNXA 2HQLA 3D31A 1NBWA 4QGUA 2IY5B 3PUVA 1HJPA 2JA8G 4A3BG 1AE3A 1EWIA 3CCUA 3K7UC 1CSPA 3T1YQ 4JI4Q 5M3FG 3STBC 4BY7G 4TVAB 5IY0A 4UY8C 3WWVA 4BY1H 4K0KL 1C7YA 2N3SA 1X6OA 3OYYA 4A3LG 1QVCA 2PQAB 2K14A 1XPOA 4JBJA 2B63G 1Y1VG 4PZ8A 4DR1L 4DV2Q 1P8LA 4P71A 3RN2A 3PV0A 2IT1A 1PH7A 4FDBA 3J80i 2JEAI 4NPSA 2N78A 4JV5L 1N36L 5HY6A 3TREA 1T9HA 1FJGL 3G6EA 1EOVA 1EUJA 4LUVA 4APVA 5C0XJ 1CUKA 2CWPA 5IYDG 4LF6L 3TQYA 2LXJA 3KFUA 3CC7A 3CCQA 4JI0Q 3S2HH 3STBD 2UXDQ 2NN6I 1VQKA 4IOAA 4OWTB 2OCEA 4JI6Q 5DLQE 3PIPA 3S1NH 4A3CH 1IXRA 2H5XA 2LXKA 3CQZH 4ME3A 4LF8Q 4BY1G 1UWVA 3CCRA 1K73C 1I94Q 2JK8A 1M1KC 1HZBA 4UPAA 2HIXA 5LMUQ 4GOPA 1U5KA 4A3FG 4R4QA 1WCMG 3E9HA 4DV6L 3TS2A 2JA6H 1D8LA 1OXSC 5BR8Q 4JG2A 4HIMA 1YJNA 1PH5A 1IL2A 2BA1A 1NE3A 4X62L 4GOPC 1S3OA 1PA6A 2HT1A 1OTCA 1KHIA 1L2FA 4IJHA 2I5HA 3AEVA 1LM0A 3J7ZC 2MQHA 1YHBA 3CPFA 2IHFA 3U4ZA 3CPWA 3A5UA 1SRUA 5FJ8G 3K80C 1YITA 4GKJQ 1SMXA 1N9WA 4DV3Q 2UUAQ 2ZTEA 3PUWA 1NMFA 1VQGA 2A1AA 1SLJA 3AFPA 4DPGA 3H15A 4A3KG 4POGA 1VQDA 4A3GG 1BKBA 1N32L 2B3GA 4AQYL 3T1HQ 2BA0A 3OTOQ 2VQEQ 1VQEA 1Q82C 3AQQA 4IPGA 1X3FA 2MO0A 2R7FA 2JA6G 1CKOA 2LSSA 2ZJQA 1Q46A 2IX1A 4L5QA 4L5RC 5C44H 1YVCA 2AHOB 4X64L 1XJVA 3S17H 4JI8Q 2GN5A 2CFMA 4LUZA 2JEBI 4LFBL 2N8NA 3GTMH 4HJ5A 4AYBE 3PO2G 1H95A 2EXDA 2JE6I 3CXCA 5GAHC 4HIKA 3MXNB 2PQAA 1GO3E 1N33Q 4YY3Q 2OWOA 4YCVA 4WJ3M 1GM5A 4XTCS 1VQLA 1Y1WH 5IP9G 4IPHA 3PF5A 3I4MG 1KRSA 4LF5L 3G71A 4OX9Q 4DR2L 3S1QH 2UXCL 2KENA 3M4PA 4DKAC 1CSQA 2ALYB 4X65Q 4DR7L 4PMWA 1OXTA 5C4XH 1QUQB 2KHIA 4DV0L 4EQ5A 1B7YB 2EIFA 2E2IH 4P75A 4Y52H 2QGQA 1C9OA 4DR3Q 4A3JH 1J6QA 4PG3A 2NZHA 4RG1A 5M5WH 4O2DA 3NENA 2D0PA 3A74A 2VUMH 5IWAQ 5LMNQ 4LNQA 1EYGA 1K8AC 3CW2C 4JI4L 2PI2A 3KLWA 2CCZA 2JA8H 2KCTA 1UE6A 4DV7L 3F2DA 2HHHQ 1PH1A 1A0IA 1VQCA 2EQSA 3CP0A 4GN4B 3OW2A 5M3FH 1XMQQ 4QL5A 5C4JH 3HFZB 4NXNQ 2ATWA 4DV2L 1HZCA 3S15H 2AMCB 4A3LH 3HKZE 1D7QA 2B63H 1Y1VH 1X9NA 2NVQH 1SROA 1VQPA 3HOXH 4HIDA 4JI5Q 1VQFA 1XNQQ 1HNXQ 3ULPA 4A3JG 1Q1BA 2UUBQ 3HOYG 4TQUS 3UDIA 3Q8DA 1PV4A 5M5XH 2NVXH 3NELA 1OXVA 3KDFA 3U50C 2VUMG 3GTPH 2Q2IA 1XPRA 1TXYA 2E2JH 3J81j 1E3PA 2UXDL 1X55A 3PO3H 2QA4A 3M4QA 5IYDH 4JI6L 3EBEA 1A63A 4LF8L 1I94L 4Y7NH 1NTGA 4JI2Q 1S72A 4YCUA 1A8VA 1XTDA 2Q2TA 4A93G 1V9PA 3GO5A 3PCOB 4BA1I 5JEAG 3L7ZC 3CMEA 1YIJA 4OWWB 1MKHA 4R4OA 2R92H 2ZM6Q 5IP7H 1KRTA 5BR8L 4A3FH 2OTLA 4DUZQ 3HOXG 1LYLA 1HR0Q 1WCMH 5JJIA 1HH2P 3I55A 4P73A 3M85A 1UE1A 4R4TA 3EN2A 3FKIG 1N34Q 2VL6A 4OXPA 4JBWA 3PO3G 4DUYQ 1TWFH 2HIVA 4GKJL 1NY4A 4DV3L 3PUYA 1V43A 4GN5A 5FJ8H 5FLXc 5IT9c 1PH3A 4LFCL 5GQOA 1L1OB 2VS1A 1NMGA 3IRBA 4GNXB 1VQBA 3T1HL 3OTOL 2VQEL 1QUQA 1VQ5A 4IFDG 4A3KH 2QEXA 4A3GH 1YBYA 2ZTCA 3BZKA 3KF6B 3GTGH 3NEMA 2AWNA 1PH2A 2R92G 4GN3B 5IP7G 3CCLA 3M4OH 3S2DH 2NZOA 5K36G 3TS0A 3EIVA 4IO9A 2D62A 2Z0SA 4KHPQ 2ES2A 4JI8L 2YTYA 2R93G 1X56A 3JAMc 3HOZG 2F4VL 1Q8KA 1VCIA 1KXLA 5JEAJ 4YCWA 1K3RA 4A3EH 1YZ6A 1IBLQ 2UU9Q 3TEHB 4DAMA 2JA5G 3M3YH 1OXUA 4UP8A 4L5SA 3K7AH 4DR6Q 2ID0A 1E24A 1RL2A 4R4CA 4HJ9A 5IE8A 1N33L 4YY3L 4JI1Q 3PO2H 1UE7A 5GAEC 4OO1G 4DR4L 2KBNA 3FP9A 1W2BA 4DAYB 1Z47A 1EQQA 3KDFB 2ZJRA 4YWLA 2E2HH 1WYDA 3CCSA 4OX9L 4BBSG 5IP9H 4HIOA 3I4MH 3KYHC 4UP9A 4X65L 1EIYB 4B3RL 1HNZL 1I3QH 3A5ZB 1QVGA 3GD7A 4IFDI 1XMOL 3BJUA 4A3IG 4L5TA 1BBWA 5M5YH 1CKNB 1QZHA 1K83H 1IBKQ 1JJCB 1EIFA 1TWGH 4NXMQ 1L0WA 1HNWQ 4A3EG 4LW1A 3GTQH 2CWAA 1FJGQ 2Q2UA 4LWCA 5IWAL 5LMNL 2NVTH 1KAWA 2K50A 2OTJA 1Z9FA 3HOUG 2XTIA 1G291 4KHZA 5GADC 4A3DG 2C35B 1KQSA 1J5EQ 2PI2E 2K75A 1XMQL 1WI5A 4OO1I 4DV5Q 4QQBX 5HGQA 3HKSA 3ULJA 3F2BA 1TWHH 4LFAL 3RLFA 5IYCH 1PH8A 2WB1G 4X66Q 1X3EA 4DV6Q 1XNRL 3S1MH 1IBMQ 1PFSA 3D0FA 4O0AA 5AJ3Q 4C2MH 2BH8A 1XNQL 2MFIA 4IPCA 3PIOA 2F52A 2PMZE 1HNXL 2A8VA 5ELOA 2GVBA 3M9BA 3UDFA 4DV4L 3K8AA 2UUBL 5EAYA 4KLKA 1HZAA 1QZGA 3KF8B 3E0EA 2UUCL 2UXBQ 1JB7A 4DV1Q 1L1OA 4LUOA 3GTJH 4GNXA 2VW9A 1MJCA 1M90C 4GLXA 3PF4A 3DLLA 5LMNW 4A75A 1LTLA 3HOYH 1AE2A 2VY3A 3KF6A 4JI7Q 1OXXK 3CC4A 3U4VA 4RMFA 2MO1A 3T1YL 4JI2L 1E7ZA 1L1OC 1N8RC 4GNXC 4EX5A 5FLMH 1JJ2A 4AIMA 4B3TQ 1N32Q 3FHWA 4OWXB 1PH4A 3U58A 1KD1C 4KI0A 3J81c 1K8GA 3J7A5 4LF7Q 5C3EG 5IYCG 3CAMA 3DM3A 4GLVB 2ZM6L 4A93H 3W5OA 4DUZL 4A4IA 1JMCA 1HR0L 4WJ4A 2GVAA 2FXQA
chains in the Genus database with same CATH superfamily
4J15A 4MHEA 2KHJA 4XQQA 4C3HH 1EY4A 1ML0D 4X3UA 4HTHA 1R9TH 2VQFQ 4DXFA 4JI0L 4BY1B 3VR5A 1JORA 5FLMG 2I5LX 2A6EC 3GTKH 4DK6C 4YHHQ 1P16A 3CC2A 4IFDH 2B2VC 1GXDC 5C0XG 3W2DA 1PYWD 1PHJA 2Q8TA 3OHXC 1E2VA 5EPJA 3A7LA 4DK3C 2EY5A 1V1PB 2C5CA 5JJLA 4IPDA 4B3MQ 2WKCA 1GD7A 1KIXA 3CQZB 1DM0B 4JI1L 3W1GA 1Q12A 1YI2A 1M8AA 5BN5A 2E5LQ 3I4OA 4DV7Q 2Z6KA 2JA6B 3ULLA 3I72A 3MEFA 4RKBA 4QJFA 3DEOA 5IYBH 4K5WA 1Q3LA 1E22A 3SK5A 1DOMA 1HNWL 5IGBA 4A3IH 1EZ8A 2I5MX 4JBMA 3IKJA 2R3ZA 4ZKBB 5CR3A 2B2UA 4IUPA 1SFOH 2TMPA 1RIPA 4G7OC 2QDBA 1TY0A 3JC66 5CMDA 3BVGA 1PYSB 2EYJA 3CCEA 1PH9A 1VQHA 4RGMA 4X66L 1VQ4A 1UEBA 4FP5D 3C2PA 1D5XC 3E0JA 4MZ9A 5CBEE 4PNYA 1IBML 4BXXH 5AJ3L 1BVSA 3K0YA 1BF4A 3GTMB 5J22A 4A3MG 4JV5Q 4DV1L 1GUWA 1S5CD 2EVBA 5M3MG 2EYPA 5LL6S 1VQ8A 5I9OA 2ASBA 2L15A 3S1QB 4B3TL 4LFCQ 3UDGA 1B70B 4V0BA 1KLGD 2ICIA 5C4XB 4JCVE 2KJXA 3BU2A 1I4QA 4C1NK 3ITPA 4K2KA 4A3JB 2TSSA 1C0AA 1AZPA 4NP5A 4JBKA 4R9WA 3P75A 1I4HA 1LLRD 4OL7A 3KJOA 3QO2A 1E2WA 3CKIB 3HGBA 3R93A 3SE0A 3S15B 1YJ9A 4UDUC 2B63B 1Y1VB 2NVQB 2WAQE 3ZJYC 1BQQT 4B3RQ 2DJGC 5C0XH 1K9MC 4L63B 2RDHA 4GOPB 1YJWA 1RJTA 3AU7A 1S4ZA 2DNCA 4XQNA 4IJLA 4GKKL 2RDFA 5FO8B 1J9OA 2JQOA 4G4KA 5IT9E 1U4LA 2MHVA 1XPUA 1IKMA 1KL9A 1FNUA 2ZTDA 3H3VH 2EPBA 4XXEA 4FF4A 1W3SA 1LTID 3I7FA 4LF5Q 2UXCQ 1SYEA 1GUSA 3U9SA 2LFNA 4HMJA 1X54A 3CMAA 4DV4Q 2UUCQ 4MTNA 1IBLL 4QF4A 2K5VA 2LY7A 1YNXA 2O2LD 4A3KB 4A3BG 4A3GB 2B2TC 1EWIA 1JE4A 2F0PA 3CCUA 1STBA 4TVAB 1BCPB 5IY0A 5FKAC 1C7YA 1X6OA 2PQAB 1VDZA 3J80E 2F0TA 1P8LA 4IUVA 4MTKA 2IT1A 1PH7A 4A3EB 4F88A 2O4XA 3M3YB 1TU2B 1T9HA 1EOVA 4PMBA 4WFN3 1CZWA 3TQYA 3KFUA 2E2HB 2F1MA 2OCEA 5DLQE 3S1NH 4ME3A 4LF8Q 5C4ZA 1K73C 1I3QB 2F0NA 1M1KC 2B2UC 4A3FG 4LJZC 1L0YB 3FPUB 4H13C 4X3TA 1RCVD 4R4QA 4DV6L 1WTXA 3TS2A 2G9HD 2Q8RE 1PH5A 1A2UA 1T5EA 1AFPA 4X62L 4GOPC 4IJHA 1BO0A 3J7ZC 3CPFA 2IHFA 3A5UA 5FJ8G 4ZK9B 3C3LA 1SMXA 4KJNA 3LWEA 1ICFB 1ENFA 1TWHB 3J7AF 4DPGA 1VQGA 3OIPA 1SLJA 4RGNA 4DNRB 1L0XB 2KUMA 1N32L 3S1MB 3T1HQ 2BA0A 2VQEQ 4IPGA 1X3FA 1PDQA 1CKOA 2RA4A 3TDQA 1LTBD 4L5QA 4RGTA 2L9HA 3JAML 3HOYB 4JI8Q 2CFMA 4IUQA 4OIJA 1H95A 4HIKA 1B4OA 3MXNB 2EZVA 4H7BA 4YY3Q 4YCVA 4WJ3M 3MXPA 4XTCS 1BCPC 5IP9G 2JP1A 1EEID 2B2WC 3G71A 4EQOA 3L3OC 1DOKA 3WOEA 5KEEA 4DR7L 4PMWA 1QWYA 1HHVA 1I6HB 4EQ5A 4P75A 3D3RA 2ENBA 2J0TD 3FKIB 3NUCA 4JW0A 3VR3A 4DR3Q 2WACA 1A3TA 4KY7A 2NZHA 3D4DA 4HCSA 4RG1A 4DA2A 1MI2A 4O2DA 2VB3X 2D0PA 3HZXA 5I4DA 1CFMA 3DEPA 1K8AC 4DV7L 2KECA 3F2DA 1PH1A 1VQCA 1RODA 1XMQQ 1QG7A 4NXNQ 2ATWA 4DV2L 1HZCA 3HKZE 2XWBB 2FMMA 1SROA 3A54A 3HOZB 1VQFA 4IZ8A 3ULPA 4XT3B 1IHZA 3QIAA 3Q8DA 1PV4A 2NVXH 2R61A 5I6YA 2VUMG 2Q2IA 1TXYA 1E3PA 3I3CA 1XWEA 1T5XD 5E4XA 3NXWA 1A63A 3RD4A 1A8VA 4A93G 2E76C 3K58A 2CH4W 4BA1I 1H9SB 1TWCB 5KYLA 4DU9A 4A3FH 2F4IA 2H4OA 2Z4IA 3E3XA 1DXMA 3MEHA 4LMQD 3GTOB 4OXPA 3I4NB 4JBWA 3PO3G 4A3DB 1D1IA 5FJ8H 5FLXc 5IT9c 1IL8A 1PH3A 4LFCL 5I2XA 1L1OB 1SE4A 2VS1A 4ME5A 3EROA 4KKUA 2HD3A 1QUQA 2ZTCA 3BZKA 4XT1B 3GTGH 2AWNA 3GP7A 2R92G 3CCLA 2O5JC 5L37A 2NZOA 1XXGA 2ES2A 2HCIA 1DD2A 5DM63 2R93G 1Q8KA 5CV4A 1KXLA 5JEAJ 1K3RA 2K28A 1YZ6A 1KDAA 3TEHB 4DAMA 2JA5G 2EYLA 4RHSA 2ID0A 3K6OA 5CV9A 1N33L 4OO1G 4JI1Q 2BDOA 5EGTA 1B3AA 1EY9A 1Z47A 1EQQA 2B8GA 4YWLA 3CCSA 5IP9H 1GJXA 4KJOA 1F2YA 1SE3A 3KYHC 4X65L 4B3RL 1PRTF 1U4PA 1LT4D 4L5TA 1H9KA 1BBWA 5M5YH 4DXGA 1TWGH 5M9OA 1L0WA 1HNWQ 3QWNA 2D5DA 3W3AA 4LW1A 4K8JA 3NTIA 2NVTH 3HOUG 2G9DA 1KDCA 2XTIA 1G291 4RA8A 3RZDB 1LTTD 1KNAA 2JYOA 3HOWB 1WI5A 3MC0B 5HGQA 3HKSA 3ULJA 2J4XA 2N88A 5D3DA 3K59A 1SSOA 4X66Q 3FVQA 4L6TB 3VYSA 1IBMQ 3HOVB 4O0AA 5AJ3Q 2A8VA 3PIOA 1D1KA 3MXGA 4DV4L 4L8JA 1HZAA 2UUCL 3E0EA 2A74C 4DV1Q 1D5ZC 4GNXA 3DLLA 4A75A 1S5ED 3GQBA 4KKSA 4ULLA 1IKLA 4RMFA 3OMGA 2IPKD 2NBFA 1E7ZA 1L1OC 4I65A 2EJGC 4B3TQ 1PH4A 5C3EG 2KOLA 3CAMA 5IYCG 2SNMA 4GLVB 2ZM6L 1WTPA 4A93H 3W5OA 1BNZA 5CGKA 1ZYRC 2RSNA 2FXQA 3SK8A 4BBRB 3I2ZA 4CKBA 5CBAE 2O5IC 1Q8IA 1BUVT 1ASZA 2R7ZG 1WVLA 5DEHA 2NWGA 3Q0AA 4HJAA 3LGJA 2F3IA 1PTOB 2B2VA 4OONA 4UP7A 2F0LA 1B9NA 5D65A 5JJKA 2BE5D 4NKLA 1O7IA 5CORA 1CKNA 1YHAA 1HCZA 4HJ8A 4YWKA 1VQMA 1C8CA 2PZUA 4KHPL 3L0OA 1ILQA 3S2HB 2RF4A 2R93H 1FL0A 2DGYA 2NYZD 4GKKQ 3CCJA 3M7GA 2D2CC 2QF7A 1GHJA 2WV6D 2JA5H 3T56B 2RCNA 4CDDC 4OO1H 4GLAC 1STYA 1I4PA 2JA7G 3PGZA 5GAGC 2A73B 3I56A 1EIHA 2F0OA 3NK9A 3KF8A 3W1BA 3PSIA 4X6AH 1WD1A 3G4SA 1UE5A 4NXML 5KNCA 2YTXA 4G7HC 4BA2I 1RD9D 1DGSA 1G2TA 2K6AA 1JT8A 3NTHA 1DZ1A 3NWTA 5J3BA 1HZ9A 3HOUH 4X3KA 2H1EA 1PVOA 1STGA 3PUXA 2DJFC 4MNOA 3UE0A 1X65A 2IJ0A 1IYVA 1V1QA 4POFA 2EJFC 5IYBG 3S17B 1BBUA 2B2YC 3MHBA 4AH6A 3VA7A 4DR3L 2EY6A 1SJHD 3ERQA 1Y1WB 4ZCKA 1CM9A 1G51A 1S5FD 1PTOC 3E9IA 1PFMA 3J81E 5I6WA 1JR0D 5DM73 4EGVA 1V1PA 3VDYA 1AN8A 4NXNL 4BXXG 2CQOA 5C3EH 2E2IB 5ELNA 2RQXA 3QR8A 3K0XA 3SVMA 1G6PA 4NMZA 4P72A 2JA9A 3K81C 5M5WB 3RNUA 1VQ9A 4J6HA 3DWPA 1LACA 4X62Q 2PYKA 4K2LA 1KABA 4KMUC 4FF2A 2F4VQ 3MWYW 2KCMA 5IGFA 1IYJB 2F0KA 1VQ6A 1Q90A 4DR5L 3HS0C 2R7ZH 3F1ZA 4ALPA 4HJ7A 5M3FB 3S14H 4TKOB 4DR4Q 2YTVA 4IALA 1WTWA 5IGGA 2VNUD 3I91A 3ER0A 1KC8C 1Q81C 1CKMA 2C9OA 3HOXB 1SNDA 3S24A 2A68D 3BG3A 3MZ5A 4JK1C 1HNZQ 4JYAL 3F2UA 4XIGS 5COYA 2I0QA 3V96A 3T53B 5CC4A 1X3PA 4ZUJA 4JVZA 4R1JA 3CCMA 2Y0SE 1EU3A 1STHA 2R7DA 3OOCA 1HUMA 5EQ0A 4J1MA 1YHQA 1HFGA 2K33A 1VS0A 4RCNA 1TS5A 3I90A 3PIP3 2Q2HA 4FVMA 3GTQB 1EWHA 2ZT9C 2K32A 4BY7H 4NB3A 3TP5A 2JA7H 3ICEA 4IUNA 2WFWA 3A0JA 5C4XG 2RHQB 2KCCA 4OIKA 1B3QA 1IZ6A 1DOLA 2A19A 3FEWX 4S3SA 4DR7Q 1MJEA 4JOIC 4TRDA 4QIWB 4DFAA 2QILA 4CJ2C 2B2TA 1EZ6A 1Q7YC 3HKZG 4HEDA 4R4IA 3D31A 1FD7D 1NBWA 3D6CA 3DUZA 4UHVA 1CSPA 4DNTB 3S2DB 4NW2A 4BY1H 3KLSX 3MFGA 3OYYA 3DMUA 2K14A 2B63G 2IX3A 1Y1VG 4PZ8A 4CHTB 4U68A 4DR1L 4DV2Q 2K5WA 3RN2A 3J80i 4O1NA 4NPSA 1E2ZA 2PCFB 1YNJD 1LTAD 1N36L 4LAAA 2ZXRA 5HY6A 3PO2B 4DAVA 4HMIA 1TIID 1EUJA 5E1FA 4E6IA 5IYDG 1A6XA 3T16A 4RWSC 3H6MA 3CC7A 1D2BA 4OWTB 4CDEC 3I4MB 1ENCA 1IXRA 2H5XA 3CQZH 3FDTA 2FJ2A 2OEOA 5IODA 2HIXA 4GOPA 1DONA 1EYDA 1U5KA 2NUCA 2OF1A 3E5SA 1CZGA 3E9HA 5HURA 1MGSA 1D8LA 3PIO3 2JA6H 1QJOA 4JG2A 3NWSA 2PW7A 2XRSD 3GV3A 1OTCA 1CHQD 3Q22A 5LHY1 2I5HA 5EKKA 5FOBB 1LM0A 4OGQC 2MQHA 4ABNA 3K5MA 3U4ZA 2PMZB 3V05A 1YITA 5FLXL 5IT9L 2UUAQ 1K28A 1DYQA 3PUWA 3H15A 4IOAA 2A1AA 4A3KG 4A3GG 1VMCA 4AQYL 2SEBD 1Q82C 4C2MB 3AQQA 3QG1A 2F0JA 2R7FA 2DY7A 1J8IA 2LSSA 5J39A 1Q46A 1U9RA 2CW0D 3N52A 2B39A 1I4XA 2WINB 4LUZA 1STEA 3GTMH 4KV6A 2B2WA 3CXCA 3FPPA 4K14A 1XYIA 2PQAA 1N33Q 2OWOA 3C1EA 5BN3A 5G3LD 3ND8A 1VMPA 3PF5A 1LV9A 4IUTA 3S1QH 1GUGA 3DWAA 4DKAC 2NVYB 1CSQA 4X65Q 5C4XH 4DV0L 3Q6SA 3TN2A 1B7YB 2EIFA 3G7LA 3TBIB 3WOFA 4Y52H 1C9OA 1QCBD 4A3JH 1C48A 4PG3A 1ZXTA 2JSOA 2IWHA 4IUUA 3U9OA 1I50B 5ISRA 4XYQA 4JI4L 3KLWA 2CCZA 3KLRA 2HHHQ 1A0IA 2EQSA 5A2QL 4QL5A 3HFZB 3MA2B 5JEAH 3S15H 3C46A 2WKDA 1GUNA 1D7QA 2B63H 5E4WC 1F2MA 1Y1VH 2NVQH 3IL8A 4HIDA 1BCPF 1JB3A 5JJZA 3HOYG 2QDLA 3NELA 2FINB 3KDFA 5I2YA 3J81j 2UXDL 4KD3A 2QA4A 5IYDH 5T1IA 1Z7TA 3EA6A 4BBSB 1S72A 2XWJB 4CJ1B 2Q2TA 1PZID 4FF1A 3GO5A 3L7ZC 3CMEA 4OWWB 2ZM6Q 5K36H 1HQRD 4A3MB 3P7JA 2XVSA 3R2TA 3I4LA 3NP8A 1HH2P 4EQPA 1ZKOA 3NSWA 3MXNA 2F0IA 5M3MB 4R4TA 1TQOA 3FKIG 2VL6A 1FNWA 5EPKA 4GN5A 1B2TA 1A2TA 2YU9B 3IRBA 3OTOL 2DN8A 1W6JA 4A3KH 4A3GH 1YBYA 2I07B 3KF6B 3VYUA 1PH2A 1ENAA 2Z1CA 2EE1A 4HN7A 3I70A 4KKTA 1CA6A 1FNVA 5KYIA 4IO9A 4KHPQ 3QOJA 3I73A 3ND9A 2YTYA 1OO9B 2KVMA 5D3IB 3HOZG 2F4VL 3MAQA 4YCWA 4A3EH 3M3YH 4UP8A 4L5SA 2MPMA 3BDOA 2HDMA 3EVQA 5IE8A 1TWAB 1UE7A 1SJED 4DR4L 4RH6A 3FP9A 2AQ1B 3GTLB 3KDFB 2ZJRA 2E2HH 3QB3A 4UP9A 1EIYB 1HNZL 1I3QH 1I6VC 4KN4C 3A8KE 2M2LA 1LO5D 1JJCB 4NXMQ 2EJMA 1ONLA 4FO2A 1LT3D 2QEJC 1K8OA 3VR6A 4KY6A 4KHZA 1H9SA 4A3DG 1KQSA 4KN7C 2PI2E 4CDFC 1S5DD 2CH4A 3F2BA 1TWHH 4P2CB 5FO9B 1X3EA 2L11A 1Y8OB 3S1MH 4I7AA 2BH8A 2EYOA 2PMZE 4C3IB 3M9BA 3SK4A 1DJRD 1L1OA 4A3BB 2VW9A 1MJCA 1DCZA 3PF4A 4C3JB 3HOYH 1LTLA 5CYUA 3DWQA 4EX5A 3H0GB 1JJ2A 3S16B 2ZXPA 3FHWA 3U58A 3J7A5 3KK7A 3DM3A 2JXMB 3D8GA 1JMCA 3S1RB 1HR0L 2NTSA 1G91A 1KNEA 2IHEA 3VR2A 1I6HH 1SR3A 3FKIH 2F0HA 5JPNC 1K0RA 2NTTA 4DR5Q 2FMCA 4C3JH 1JE5A 1EQRA 2RHSB 2Y0SG 1LT5D 1B8AA 4OEMB 1FVIA 4CKCA 1SYGA 5E7NA 5ELEA 2VB2X 3D4WA 3OWFA 4JYAQ 1SDFA 2F0VA 5H1SE 3JAME 2MNAA 3HOVG 5KGUA 3SGIA 4M1UB 1E1TA 3K5NA 4OELB 4YWMA 3V2TA 3VYTA 4Q5VA 2UU9L 1NJIC 3EQLC 3HOZH 3B6YA 4DR6L 5ELFA 2FFKB 4DK1A 1CK1A 1E1OA 2B29A 2F0EA 3TMEA 2UUAL 3IFDA 1RHPA 1GVPA 2X69A 4U673 1TS4A 1JWMD 2XGTA 1B9MA 3SK6A 2N55A 3PUZA 1RKNA 3KOJA 4N8X1 4WORA 3KJPA 2KHSA 1TWCH 4BBRG 3TSSA 3L9AX 1F9SA 1EYAA 1MIUA 4B9XA 3GTOH 4DAPA 4G57A 3RLOA 3I4NH 4AYBB 2YV5A 4GZYC 4A3DH 4IURA 2B2YA 3N6RA 1AH9A 3NBHA 5HGTA 1SN8A 2EY2A 4CKEA 5C44B 1ASYA 2K05A 1SE8A 4DR1Q 1HTLD 3J80c 1EY6A 1ET6A 1H9MA 3R8BA 1VQAA 1N36Q 1A3VA 1WTVA 4F8MA 3RN5A 4HCEA 5EJWA 2F0FA 4A3CG 3GDEA 4G7ZC 1LTRD 5ELCA 1SXTA 3NQTA 2AKWB 4UAIA 2E8GA 2HHHL 3ZYYX 5EKIA 5C3XA 1VQNA 3AFQA 3J81i 3KLSA 2AWOA 3T51B 2A69D 2Z6BA 1SYCA 4PZ7A 4DGZA 3T13A 2VUMB 1FYCA 4CBVA 4B3SL 2V1CC 2JA8B 1HA6A 2N49A 1W6KA 1R4PB 1E0BA 1K8MA 5C4JB 3KBXA 2K5HA 1FGBD 1VQ7A 3OW7A 2D9UA 1O7ZA 2OXPA 3NE5B 2GA4B 2BE5C 2Q8IB 3UDXA 4AQYQ 3RZDH 4JI3L 3OPOA 3HOWH 4ZAIA 1PYBA 1A62A 2CHBD 2IL8A 1BOSA 3AB9A 1XMOQ 1PTOF 3G6JB 5KRUA 5M5XB 4LF4L 4ZUIA 1PH6A 3GTPB 3NBHB 2E2JB 4FYDA 3BZCA 2CKZB 3PO3B 2WAQG 3HOVH 2QKIC 2WP8J 4YIJA 4Y7NB 4OHJA 4WJWA 1Y1WG 1KDBA 4LF9L 3RZOB 3MVVA 5KIXA 3BDLA 5AFWA 4K6LA 1M4VA 2R92B 1GKHA 5K5PA 1EWCA 1EFWA 1A15A 2PQEA 4JOIA 1UNSA 1WCMB 4LFAQ 2ICEC 1XNRQ 3UI2A 4DV0Q 1TWFB 3S9WA 2VZAA 2K4KA 4BBRH 4QCLA 1ET9A 4QGUA 2IW3A 4ZLTF 4B9WA 2IY5B 3PUVA 3LX0A 4JI4Q 5M3FG 3M4OB 4BY7G 3FMCA 1EEFD 3WWVA 4K0KL 1PTOH 1PZKD 2N3SA 1QVCA 1XPOA 1RTOA 4EQNA 1JQYD 1QB5D 2NB0A 3X3NA 4P71A 3PV0A 4FDBA 2JEAI 3A56A 3HG9A 1QOHA 3K7AB 1NR4A 3TREA 4K5VA 3G6EA 4TSSA 2AUJD 4LUVA 4LF6L 1CUKA 1UEAB 4C1NI 3NPPA 2UXDQ 2OT2A 4H0LC 3S2HH 2NN6I 1VQKA 1VF5C 2X6GA 4A3CH 2LXKA 4BY1G 3CCRA 1F9QA 1HTPA 1HZBA 1WTRA 1CHPD 3NTKA 4UPAA 5LMUQ 2RSOA 1K83B 1SMYD 2F0MA 1EY8A 1OXSC 1H9RA 1YJNA 1IL2A 3TZDA 1D6EC 1A3UA 1S3OA 1KHIA 1L2FA 3DXJC 1CQFA 1PRTD 1TR5A 1YHBA 3KUPA 2I46A 4Z9CB 3DHQA 1HPCA 4WJ4A 1NMFA 3AFPA 4POGA 1VQDA 1EYCA 3OTOQ 2MGSA 1TVXA 2MO0A 2JA6G 1Y69U 3RMHA 2WIIB 2ZJQA 3VR4A 3IAYA 2IX1A 3GTJB 3TP8A 2A68C 5TSSA 4L5RC 1YVCA 4EVOA 2M00A 2AHOB 3S17H 2GN5A 2N8NA 2HCCA 4AYBE 5BN4A 3PO2G 2EXDA 2F3VA 2PZTA 5GAHC 4PV1C 1F9PA 3BS1A 1WTQA 3OWEB 1CI3M 5EBCA 1X32A 1RF2D 2EOTA 1Y1WH 2A6HD 3I4MG 1KRSA 1RDPD 4DR2L 3CU7A 3M4PA 1II3A 2ALYB 4DF7A 1OXTA 1CT1D 4C3HB 2HUGA 5CV7A 4KK7A 2K01A 1HXYD 2E2IH 1R9TB 5KNDA 1GUOA 1J6QA 2LS01 5M5WH 4F7XA 3H09A 3NENA 5EPLA 4LNQA 5CV8A 1EYGA 3NHHA 3GTKB 2PI2A 1UE6A 4N8FA 4GN4B 3CP0A 1EFID 3FRPB 4JPBW 5M3FH 3OW2A 1MSHA 2PZWA 1TY2A 2EY1A 4CGYB 1X9NA 1UAPA 3AMUA 4JI5Q 1VQPA 3HOXH 4IQZA 3VYRA 4A3JG 1Q1BA 4HSVA 2KCNA 1OXVA 1PFNA 1YNJC 3U50C 4KD4A 1X55A 2F0SA 3K5LA 2PNRC 4JI6L 1BR9A 2LKVA 1B50A 3P20A 1I94L 2FHTA 2MJ8A 3HRZC 1YNND 3PMFA 4YCUA 2PO4A 1XTDA 3GTQH 5JEAG 1MKHA 4A3IB 5IP7H 5BR8L 5DAUA 2OTLA 1ILPA 1HR0Q 5JJIA 1EY0A 2DY8A 4P73A 3M85A 1SFOB 3LNNA 4KY5A 5IGEA 1JOKA 3C1FA 4I7ZC 2F0UA 4GKJL 1XTCD 5CV6A 4QUFA 3D4RA 4DV3L 3PUYA 1O78A 2A6ED 5JVH3 1NMGA 1VQBA 1V8QA 5JVG3 4ZYSA 2XRQD 1VQ5A 2EYMA 2WB1B 3NEMA 5K36G 3S2DH 5JOBA 2A5HA 3TS0A 3EIVA 2D62A 2Z0SA 3DM1A 1JWSD 1NNXA 2CW0C 5A35A 1VCIA 1H9JA 2UU9Q 5LL6X 3SR1A 1OXUA 4DR6Q 4R4CA 1E24A 4HJ9A 2XSCA 1BBXC 2XNAC 3PO2H 1SNQA 3E6ZX 1WYDA 4PMCA 4OX9L 4BBSG 1NR2A 1WTOA 3I4MH 1QILA 4IFDI 3A5ZB 1QVGA 3GD7A 1XMOL 1QZHA 1EIFA 1SNPA 4A3EG 1FJGQ 1XX8A 5IWAL 5LMNL 1KAWA 1NUCA 1EY5A 2SDFA 1ESRA 2K5QA 5GADC 1KAAA 4N9TA 1GHKA 2K7VA 2P5ZX 3NBIA 4LFAL 1PH8A 1XNRL 3BDCA 3J80L 1PFSA 3D0FA 4C2MH 1XNQL 1HNXL 4IPCA 2F52A 3SXHA 4ILWA 2GVBA 3HKZB 2UUBL 3K8AA 3HEJA 4KLKA 1QZGA 3GV6A 3RUZA 1AP0A 4LUOA 2Z4HA 1M90C 1AE2A 3KF6A 1OXXK 3CC4A 2MO1A 4JI2L 5FLMH 4AIMA 3CRLC 4OWXB 1KD1C 3J81c 4RFBA 2HDLA 4DUZL 4DK0A 3OSOA 5E3FA 2HQEA 2NVYH 4X64Q 2BDNA 2YYZA 4P74A 1N34L 3EJIA 4B3SQ 4LFBQ 4DUYL 2XN9C 1EOTA 5FLXE 5GROA 1LUZA 1I50H 3I8ZA 5LMUL 4JI3Q 2L4NA 1MSGA 3WDNA 1HR0W 4NDXA 1GUTA 1QVFA 4QB4A 4BS9A 2BOSA 1U0LA 4N9PA 3CCVA 1B1ZA 4LF4Q 1R4QB 2OQ0A 4C3IG 3JAMi 2AUKA 3A8JE 3TRZA 1WJJA 3S1NB 4XQJA 4GS3A 4C3JG 4RCOA 1ICWA 4LF9Q 2F03A 1I5FA 1VQOA 1G8ZD 3RR5A 3H0GG 1VQJA 4QY7A 4BBSH 1BXTA 3KBGA 4QIWE 2Z6KC 3J7YW 4HR7B 1IBKL 2K52A 5C0XI 3ERSX 3L2PA 2R6GA 3AYHB 4A3MH 2LMCB 2Z8LA 1JC7A 3H3VC 5M3MH 1CTMA 4DNIA 2QCPX 3Q23A 1J5EL 4DV5L 5A2QE 4A76A 1TS2A 1F77A 4IN3A 3H3VI 4K0KQ 2YU9H 1FGUA 4KTAA 2IX0A 4QMGA 3M7NA 3CD6A 3M4YA 2UXBL 4IFDJ 5I9PA 5IGDA 1PMRA 4RKLA 2X6LA 5NUCA 4LF6Q 4JI7L 1Q1EA 5FK9C 3TZUA 1IW7C 1MD2D 2WB1E 3F2CA 3I4NG 2PNHA 1S40A 1Z6HA 2J7ZA 4LF7L 1Y14B 1TWAH 1MBYA 1FR3A 3GTLH 1LTGD 4JI5L 1I4RA 1LT6D 2K1BA 4ODGA 2KEDA 1PLFA 5IOCA 2L0CA 2F0GA 1WOCA 1X3GA 2F0QA 2VQFL 1IW7D 5EBDA 1QNUA 1KTKA 2MUYA 4JC0A 2JJQA 3IFTA 3CF5A 5C5LA 3F8TA 2OQKA 4YHHL 4AYBG 1SNCA 1AZQA 2K5NA 2DUDA 4ID6A 5DNFA 1PFBA 2VXWA 5C44G 4FF3A 3SHLA 2EXZA 2NVXB 1YEZA 4H02A 4ZKCB 3TP6A 3A7AB 1VQIA 4B3ML 1SYBA 3UE1A 3OIQA 3G48A 2ZJPA 4C3IH 1JOQA 2PW5A 2D0OA 1BCPD 3BZDB 4PZ6A 2E5LL 1PZJD 4A3BH 3K57A 3BVZA 4A3FB 3BYYB 3D6WA 1HA5A 4XYOA 3X3MA 2ZXOA 1WFQA 3RLNA 2M9VA 3HOWG 2NZ1D 3QOLA 4DR2Q 3H0GH 5ELDA 1WD0A 3S16H 1HFNA 1Q86C 4IOCA 2RDGA 3TP7A 4CDCC 5C4HA 3S1RH 4K6DA 2E75C 2NN6G 1C4QA 1QE6A 2BH2A 1JJGA 1MHWC 2HQLA 3A55A 1TKWB 5FO7B 2JA8G 1HJPA 1AE3A 3K5OA 3R2IA 3GTGB 3K7UC 1NAPA 3T1YQ 3STBC 3HP3A 1NCVA 4UY8C 4Q0FA 4A3LG 2EYFA 4JBJA 3MXUA 5C5MA 1F9RA 1I4GA 2EYHA 3EFXD 4RHRA 1UUPA 2K04A 2Z9HA 2N78A 4JV5L 1FJGL 2XIWA 1JOOA 5C0XJ 4R8IA 4LK1C 4APVA 2CWPA 4MN3A 1F2ZA 2SNSA 1G2SA 2LXJA 3CCQA 4JI0Q 3STBD 1VF7A 4JI6Q 3PIPA 3J7AV 1SYFA 1UWVA 1S5BD 1I94Q 1CA5A 2JK8A 4H44C 1SNOA 5M5YB 4B08A 1JWUD 2MP1A 1TWGB 1WCMG 3BYTB 1EQTA 1EL0A 1U4RA 5BR8Q 2BCOA 4HIMA 4QUCA 2BA1A 3T4AC 3MTSA 1NE3A 2A69C 3H94A 2NVTB 1PA6A 1O7LA 1B53A 1Y8PB 5JAVA 2HT1A 4PQXA 3AEVA 1LABA 3CPWA 1SRUA 1SBBB 2F3WA 3K80C 1CQVA 4GKJQ 2E2DC 1N9WA 2B8FA 3URYA 4DV3Q 2ZTEA 1AEXA 2RCFA 5KNBA 4HAEA 4WRDA 1BKBA 2RVLA 2B3GA 2JN4A 1VQEA 2KA7A 1SYDA 3CHBD 3PQIA 1QNKA 1V1OA 5C44H 3SDZA 4X64L 1XJVA 1K0SA 1JICA 1K3BC 2JEBI 4LFBL 4HJ5A 5EKLA 2JE6I 1PRTB 2Y0SB 4KHVA 1F2LA 1GO3E 5CV5A 5C3WA 1GM5A 1VQLA 4A93B 4IPHA 1EIGA 1BDOA 2AQ2B 4LF5L 2UXCL 4OX9Q 2KENA 3QJYA 3MFYA 1QUQB 2KHIA 1EU4A 2KQ3A 2QGQA 4ZQ3A 1RTNA 3A74A 2NN6H 2VUMH 5IWAQ 5LMNQ 1TT2A 3CW2C 3VA5A 2JA8H 2KCTA 1HQMC 1LTSD 5C4JH 2AQ3B 4DN4M 3P1HA 2AMCB 4A3LH 3LWUA 4CJ0B 2R93B 2L12A 1IYUA 1XNQQ 1Y8NB 1HNXQ 2F0WA 2UUBQ 2JA5B 4TQUS 3UDIA 4DAYA 5M5XH 1SEBD 1ESFA 3GTPH 1XPRA 2E2JH 5J1ZA 5IGCA 4K5XA 3PO3H 3M4QA 1SAPA 3SEBA 3EBEA 4LF8L 4Y7NH 5C6AA 1NTGA 4JI2Q 3J81L 2DNEA 2CQAA 1V9PA 3PCOB 3RZOH 1YIJA 1ZYRD 4R4OA 2R92H 2RKSA 1PXUA 4HSPA 1KRTA 4DUZQ 3HOXG 1WTHA 1LYLA 1WCMH 1ZEQX 1SMYC 3I55A 2KEEA 4C3HG 1UE1A 3A8IE 4FXDA 3EN2A 1EQVA 1SNMA 4X3SA 4ZRZA 3HOUB 4K8IA 1N34Q 3O13A 1B44D 2L1BA 1TWFH 2HIVA 4FNFA 4DUYQ 1PRTC 1NY4A 1V43A 3CRKC 4RGOS 5GQOA 1EY7A 4GNXB 5D14A 3T1HL 3OMCA 2VQEL 4XDXA 4IFDG 1O80A 2QEXA 2QW7A 4GN3B 5IP7G 3M4OH 4FXGC 5JPMC 1STNA 1X3QA 1KLUD 2SOBA 4JI8L 3Q24A 4MIUA 1X56A 3JAMc 5F2DA 1IBLQ 3K7AH 2G5DA 1RL2A 1G6ZA 4YY3L 5GAEC 2KBNA 1STAA 1W2BA 2RBMA 4DAYB 5C3EB 2K03A 4HIOA 2A6HC 4RAUC 2L5TA 1HUNA 3BJUA 4A3IG 2WAQB 1AW7A 2CVRA 1CKNB 1K83H 1IBKQ 2R7ZB 2CWAA 2K5DA 3H91A 2Q2UA 3S14B 1D5MC 4LWCA 5IIFA 2K50A 4BWGB 2EDGA 1Z9FA 2OTJA 4O42A 4M8AA 2C35B 1J5EQ 4V190 2K75A 1XMQL 3BVMA 4OO1I 4DV5Q 4QQBX 3RLFA 4F87A 5IYCH 2WB1G 1TS3A 4DV6Q 4J8QA 1NSNS 1GOZA 2E74C 2MFIA 5T1GA 4FXKC 5ELOA 3UDFA 2L55A 5EAYA 3KF8B 3R3OA 2UXBQ 1HRJA 3NQIA 1JB7A 3GTJH 5G3LF 1PTOD 4GLXA 5LMNW 2VY3A 1O7YA 4BY7B 3ONAB 4JI7Q 2PPBC 2JA7B 1SE2A 3U4VA 3T1YL 5ELBA 4C56C 1N8RC 4GNXC 1JCKB 1N32Q 1K8GA 1U4MA 4KI0A 4LF7Q 1YNNC 4R8NA 2F0DA 4A4IA 2GVAA 2V4DA
chains in the Genus database with same CATH topology
4J15A 3I2ZA 2NVYH 2KHJA 4X64Q 2IHEA 2YYZA 4P74A 1N34L 1ASZA 4B3SQ 2R7ZG 4C3HH 4LFBQ 4DUYL 1I6HH 1SR3A 4HJAA 3LGJA 3FKIH 1R9TH 2VQFQ 1K0RA 2F3IA 4DR5Q 4JI0L 5GROA 4OONA 4UP7A 4C3JH 1LUZA 5JJKA 5FLMG 1JE5A 1EQRA 2RHSB 2Y0SG 1B8AA 2I5LX 1I50H 1FVIA 1O7IA 3RZOH 3GTKH 1CKNA 4DK6C 1YHAA 1P16A 5E7NA 4YHHQ 5LMUL 3CC2A 5C0XG 4HJ8A 4YWKA 1PHJA 4JI3Q 1VQMA 1HR0W 4KHPL 1QVFA 4JYAQ 4DK3C 1U0LA 3L0OA 5H1SE 2MNAA 3CCVA 3HOVG 3SGIA 4LF4Q 5JJLA 1E1TA 4IPDA 4YWMA 2OQ0A 3JAMi 2UU9L 4B3MQ 2RF4A 1NJIC 2R93H 1FL0A 3HOZH 3B6YA 2DGYA 4DR6L 1GD7A 1KIXA 1WJJA 3CCJA 3TRZA 4GKKQ 1E1OA 2B29A 4JI1L 3W1GA 1Q12A 4GS3A 1YI2A 2JA5H 2UUAL 2RCNA 2E5LQ 4GLAC 4LF9Q 3I4OA 4DV7Q 1I5FA 3PGZA 2JA7G 1VQOA 2Z6KA 5GAGC 3ULLA 1GVPA 3RR5A 3H0GG 1VQJA 4QY7A 3MEFA 3I56A 4QJFA 4BBSH 2XGTA 3W1BA 4QIWE 5IYBH 3PUZA 1E22A 3KOJA 2Z6KC 3PSIA 1IBKL 4X6AH 2K52A 3KJPA 1UE5A 3G4SA 5C0XI 4NXML 2YTXA 1HNWL 1TWCH 3ERSX 3L2PA 2R6GA 3AYHB 4A3IH 4BA2I 4BBRG 1DGSA 4A3MH 2I5MX 4JBMA 1JT8A 1MIUA 1SFOH 5M3MH 1RIPA 5J3BA 1HZ9A 4DNIA 1J5EL 3GTOH 3HOUH 3JC66 3RLOA 1PVOA 3I4NH 2YV5A 4DV5L 4A3DH 4A76A 3PUXA 3UE0A 4MNOA 1AH9A 1PYSB 1X65A 1SN8A 3H3VI 3CCEA 1PH9A 1V1QA 1VQHA 4X66L 4K0KQ 1VQ4A 2YU9H 1UEBA 1FGUA 4POFA 5IYBG 1ASYA 1IBML 4BXXH 4MZ9A 2IX0A 1SE8A 4DR1Q 5AJ3L 1BVSA 3M7NA 1BBUA 3J80c 3CD6A 4AH6A 2UXBL 4DR3L 4A3MG 4JV5Q 4IFDJ 4DV1L 1VQAA 1N36Q 5M3MG 3RN5A 4JI7L 1Q1EA 4LF6Q 1VQ8A 1G51A 4A3CG 3E9IA 3GDEA 2WB1E 3F2CA 2ASBA 3I4NG 2L15A 2PNHA 1S40A 4B3TL 4LFCQ 2AKWB 3UDGA 2E8GA 2HHHL 1B70B 4LF7L 1Y14B 1TWAH 1VQNA 3AFQA 4JCVE 3J81i 3VDYA 4NXNL 2AWOA 4BXXG 2CQOA 3BU2A 5C3EH 5ELNA 3GTLH 3K0XA 1G6PA 1C0AA 4P72A 4JI5L 4PZ7A 2JA9A 3K81C 3RNUA 1VQ9A 4JBKA 4X62Q 4B3SL 2V1CC 2F4VQ 1WOCA 2KCMA 1IYJB 3KJOA 1X3GA 2VQFL 1VQ6A 4DR5L 2R7ZH 3F1ZA 4ALPA 2N49A 4HJ7A 3S14H 2K5HA 4DR4Q 2YTVA 1VQ7A 4JC0A 2JJQA 2VNUD 3ER0A 3CF5A 1YJ9A 3F8TA 2OQKA 4YHHL 4AYBG 3RZDH 1KC8C 3UDXA 4AQYQ 1Q81C 1CKMA 2WAQE 4JI3L 3ZJYC 2K5NA 2DUDA 3S24A 3HOWH 4B3RQ 1PYBA 1A62A 1HNZQ 4JYAL 1K9MC 5C44G 1XMOQ 2I0QA 4XIGS 1YEZA 4H02A 4LF4L 1PH6A 3NBHB 4GOPB 1YJWA 3BZCA 3CCMA 4R1JA 2CKZB 1VQIA 4B3ML 2Y0SE 2WAQG 4IJLA 3HOVH 2WP8J 4GKKL 2R7DA 3UE1A 2JQOA 1YHQA 3G48A 2ZJPA 4C3IH 1VS0A 2D0OA 4PZ6A 2E5LL 1Y1WG 4LF9L 1XPUA 1KL9A 2Q2HA 4A3BH 2ZTDA 3H3VH 1GKHA 1EFWA 4BY7H 1W3SA 4JOIA 4NB3A 2JA7H 1WFQA 3RLNA 3ICEA 3I7FA 3HOWG 4LFAQ 4LF5Q 2UXCQ 2WFWA 3A0JA 3H0GH 4DR2Q 2RHQB 3S16H 5C4XG 1XNRQ 1IZ6A 2A19A 4DR7Q 1Q86C 4IOCA 1MJEA 4JOIC 1X54A 4DV0Q 3CMAA 4DV4Q 3S1RH 2UUCQ 1Q7YC 4MTNA 2NN6G 1IBLL 2VZAA 3HKZG 2K4KA 2K5VA 4BBRH 2BH2A 1JJGA 4R4IA 1YNXA 2HQLA 3D31A 1NBWA 4QGUA 2IY5B 3PUVA 1HJPA 2JA8G 4A3BG 1AE3A 1EWIA 3CCUA 3K7UC 1CSPA 3T1YQ 4JI4Q 5M3FG 3STBC 4BY7G 4TVAB 5IY0A 4UY8C 3WWVA 4BY1H 4K0KL 1C7YA 2N3SA 1X6OA 3OYYA 4A3LG 1QVCA 2PQAB 2K14A 1XPOA 4JBJA 2B63G 1Y1VG 4PZ8A 4DR1L 4DV2Q 1P8LA 4P71A 3RN2A 3PV0A 2IT1A 1PH7A 4FDBA 3J80i 2JEAI 4NPSA 2N78A 4JV5L 1N36L 5HY6A 3TREA 1T9HA 1FJGL 3G6EA 1EOVA 1EUJA 4LUVA 4APVA 5C0XJ 1CUKA 2CWPA 5IYDG 4LF6L 3TQYA 2LXJA 3KFUA 3CC7A 3CCQA 4JI0Q 3S2HH 3STBD 2UXDQ 2NN6I 1VQKA 4IOAA 4OWTB 2OCEA 4JI6Q 5DLQE 3PIPA 3S1NH 4A3CH 1IXRA 2H5XA 2LXKA 3CQZH 4ME3A 4LF8Q 4BY1G 1UWVA 3CCRA 1K73C 1I94Q 2JK8A 1M1KC 1HZBA 4UPAA 2HIXA 5LMUQ 4GOPA 1U5KA 4A3FG 4R4QA 1WCMG 3E9HA 4DV6L 3TS2A 2JA6H 1D8LA 1OXSC 5BR8Q 4JG2A 4HIMA 1YJNA 1PH5A 1IL2A 2BA1A 1NE3A 4X62L 4GOPC 1S3OA 1PA6A 2HT1A 1OTCA 1KHIA 1L2FA 4IJHA 2I5HA 3AEVA 1LM0A 3J7ZC 2MQHA 1YHBA 3CPFA 2IHFA 3U4ZA 3CPWA 3A5UA 1SRUA 5FJ8G 3K80C 1YITA 4GKJQ 1SMXA 1N9WA 4DV3Q 2UUAQ 2ZTEA 3PUWA 1NMFA 1VQGA 2A1AA 1SLJA 3AFPA 4DPGA 3H15A 4A3KG 4POGA 1VQDA 4A3GG 1BKBA 1N32L 2B3GA 4AQYL 3T1HQ 2BA0A 3OTOQ 2VQEQ 1VQEA 1Q82C 3AQQA 4IPGA 1X3FA 2MO0A 2R7FA 2JA6G 1CKOA 2LSSA 2ZJQA 1Q46A 2IX1A 4L5QA 4L5RC 5C44H 1YVCA 2AHOB 4X64L 1XJVA 3S17H 4JI8Q 2GN5A 2CFMA 4LUZA 2JEBI 4LFBL 2N8NA 3GTMH 4HJ5A 4AYBE 3PO2G 1H95A 2EXDA 2JE6I 3CXCA 5GAHC 4HIKA 3MXNB 2PQAA 1GO3E 1N33Q 4YY3Q 2OWOA 4YCVA 4WJ3M 1GM5A 4XTCS 1VQLA 1Y1WH 5IP9G 4IPHA 3PF5A 3I4MG 1KRSA 4LF5L 3G71A 4OX9Q 4DR2L 3S1QH 2UXCL 2KENA 3M4PA 4DKAC 1CSQA 2ALYB 4X65Q 4DR7L 4PMWA 1OXTA 5C4XH 1QUQB 2KHIA 4DV0L 4EQ5A 1B7YB 2EIFA 2E2IH 4P75A 4Y52H 2QGQA 1C9OA 4DR3Q 4A3JH 1J6QA 4PG3A 2NZHA 4RG1A 5M5WH 4O2DA 3NENA 2D0PA 3A74A 2VUMH 5IWAQ 5LMNQ 4LNQA 1EYGA 1K8AC 3CW2C 4JI4L 2PI2A 3KLWA 2CCZA 2JA8H 2KCTA 1UE6A 4DV7L 3F2DA 2HHHQ 1PH1A 1A0IA 1VQCA 2EQSA 3CP0A 4GN4B 3OW2A 5M3FH 1XMQQ 4QL5A 5C4JH 3HFZB 4NXNQ 2ATWA 4DV2L 1HZCA 3S15H 2AMCB 4A3LH 3HKZE 1D7QA 2B63H 1Y1VH 1X9NA 2NVQH 1SROA 1VQPA 3HOXH 4HIDA 4JI5Q 1VQFA 1XNQQ 1HNXQ 3ULPA 4A3JG 1Q1BA 2UUBQ 3HOYG 4TQUS 3UDIA 3Q8DA 1PV4A 5M5XH 2NVXH 3NELA 1OXVA 3KDFA 3U50C 2VUMG 3GTPH 2Q2IA 1XPRA 1TXYA 2E2JH 3J81j 1E3PA 2UXDL 1X55A 3PO3H 2QA4A 3M4QA 5IYDH 4JI6L 3EBEA 1A63A 4LF8L 1I94L 4Y7NH 1NTGA 4JI2Q 1S72A 4YCUA 1A8VA 1XTDA 2Q2TA 4A93G 1V9PA 3GO5A 3PCOB 4BA1I 5JEAG 3L7ZC 3CMEA 1YIJA 4OWWB 1MKHA 4R4OA 2R92H 2ZM6Q 5IP7H 1KRTA 5BR8L 4A3FH 2OTLA 4DUZQ 3HOXG 1LYLA 1HR0Q 1WCMH 5JJIA 1HH2P 3I55A 4P73A 3M85A 1UE1A 4R4TA 3EN2A 3FKIG 1N34Q 2VL6A 4OXPA 4JBWA 3PO3G 4DUYQ 1TWFH 2HIVA 4GKJL 1NY4A 4DV3L 3PUYA 1V43A 4GN5A 5FJ8H 5FLXc 5IT9c 1PH3A 4LFCL 5GQOA 1L1OB 2VS1A 1NMGA 3IRBA 4GNXB 1VQBA 3T1HL 3OTOL 2VQEL 1QUQA 1VQ5A 4IFDG 4A3KH 2QEXA 4A3GH 1YBYA 2ZTCA 3BZKA 3KF6B 3GTGH 3NEMA 2AWNA 1PH2A 2R92G 4GN3B 5IP7G 3CCLA 3M4OH 3S2DH 2NZOA 5K36G 3TS0A 3EIVA 4IO9A 2D62A 2Z0SA 4KHPQ 2ES2A 4JI8L 2YTYA 2R93G 1X56A 3JAMc 3HOZG 2F4VL 1Q8KA 1VCIA 1KXLA 5JEAJ 4YCWA 1K3RA 4A3EH 1YZ6A 1IBLQ 2UU9Q 3TEHB 4DAMA 2JA5G 3M3YH 1OXUA 4UP8A 4L5SA 3K7AH 4DR6Q 2ID0A 1E24A 1RL2A 4R4CA 4HJ9A 5IE8A 1N33L 4YY3L 4JI1Q 3PO2H 1UE7A 5GAEC 4OO1G 4DR4L 2KBNA 3FP9A 1W2BA 4DAYB 1Z47A 1EQQA 3KDFB 2ZJRA 4YWLA 2E2HH 1WYDA 3CCSA 4OX9L 4BBSG 5IP9H 4HIOA 3I4MH 3KYHC 4UP9A 4X65L 1EIYB 4B3RL 1HNZL 1I3QH 3A5ZB 1QVGA 3GD7A 4IFDI 1XMOL 3BJUA 4A3IG 4L5TA 1BBWA 5M5YH 1CKNB 1QZHA 1K83H 1IBKQ 1JJCB 1EIFA 1TWGH 4NXMQ 1L0WA 1HNWQ 4A3EG 4LW1A 3GTQH 2CWAA 1FJGQ 2Q2UA 4LWCA 5IWAL 5LMNL 2NVTH 1KAWA 2K50A 2OTJA 1Z9FA 3HOUG 2XTIA 1G291 4KHZA 5GADC 4A3DG 2C35B 1KQSA 1J5EQ 2PI2E 2K75A 1XMQL 1WI5A 4OO1I 4DV5Q 4QQBX 5HGQA 3HKSA 3ULJA 3F2BA 1TWHH 4LFAL 3RLFA 5IYCH 1PH8A 2WB1G 4X66Q 1X3EA 4DV6Q 1XNRL 3S1MH 1IBMQ 1PFSA 3D0FA 4O0AA 5AJ3Q 4C2MH 2BH8A 1XNQL 2MFIA 4IPCA 3PIOA 2F52A 2PMZE 1HNXL 2A8VA 5ELOA 2GVBA 3M9BA 3UDFA 4DV4L 3K8AA 2UUBL 5EAYA 4KLKA 1HZAA 1QZGA 3KF8B 3E0EA 2UUCL 2UXBQ 1JB7A 4DV1Q 1L1OA 4LUOA 3GTJH 4GNXA 2VW9A 1MJCA 1M90C 4GLXA 3PF4A 3DLLA 5LMNW 4A75A 1LTLA 3HOYH 1AE2A 2VY3A 3KF6A 4JI7Q 1OXXK 3CC4A 3U4VA 4RMFA 2MO1A 3T1YL 4JI2L 1E7ZA 1L1OC 1N8RC 4GNXC 4EX5A 5FLMH 1JJ2A 4AIMA 4B3TQ 1N32Q 3FHWA 4OWXB 1PH4A 3U58A 1KD1C 4KI0A 3J81c 1K8GA 3J7A5 4LF7Q 5C3EG 5IYCG 3CAMA 3DM3A 4GLVB 2ZM6L 4A93H 3W5OA 4DUZL 4A4IA 1JMCA 1HR0L 4WJ4A 2GVAA 2FXQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J15 A;  3I2Z A;  2NVY H;  2KHJ A;  4X64 Q;  2IHE A;  2YYZ A;  4P74 A;  1N34 L;  1ASZ A;  4B3S Q;  2R7Z G;  4C3H H;  4LFB Q;  4DUY L;  1I6H H;  1SR3 A;  4HJA A;  3LGJ A;  3FKI H;  1R9T H;  2VQF Q;  1K0R A;  2F3I A;  4DR5 Q;  4JI0 L;  5GRO A;  4OON A;  4UP7 A;  4C3J H;  1LUZ A;  5JJK A;  5FLM G;  1JE5 A;  1EQR A;  2RHS B;  2Y0S G;  1B8A A;  2I5L X;  1I50 H;  1FVI A;  1O7I A;  3RZO H;  3GTK H;  1CKN A;  4DK6 C;  1YHA A;  1P16 A;  5E7N A;  4YHH Q;  5LMU L;  3CC2 A;  5C0X G;  4HJ8 A;  4YWK A;  1PHJ A;  4JI3 Q;  1VQM A;  1HR0 W;  4KHP L;  1QVF A;  4JYA Q;  4DK3 C;  1U0L A;  3L0O A;  5H1S E;  2MNA A;  3CCV A;  3HOV G;  3SGI A;  4LF4 Q;  5JJL A;  1E1T A;  4IPD A;  4YWM A;  2OQ0 A;  3JAM i;  2UU9 L;  4B3M Q;  2RF4 A;  1NJI C;  2R93 H;  1FL0 A;  3HOZ H;  3B6Y A;  2DGY A;  4DR6 L;  1GD7 A;  1KIX A;  1WJJ A;  3CCJ A;  3TRZ A;  4GKK Q;  1E1O A;  2B29 A;  4JI1 L;  3W1G A;  1Q12 A;  4GS3 A;  1YI2 A;  2JA5 H;  2UUA L;  2RCN A;  2E5L Q;  4GLA C;  4LF9 Q;  3I4O A;  4DV7 Q;  1I5F A;  3PGZ A;  2JA7 G;  1VQO A;  2Z6K A;  5GAG C;  3ULL A;  1GVP A;  3RR5 A;  3H0G G;  1VQJ A;  4QY7 A;  3MEF A;  3I56 A;  4QJF A;  4BBS H;  2XGT A;  3W1B A;  4QIW E;  5IYB H;  3PUZ A;  1E22 A;  3KOJ A;  2Z6K C;  3PSI A;  1IBK L;  4X6A H;  2K52 A;  3KJP A;  1UE5 A;  3G4S A;  5C0X I;  4NXM L;  2YTX A;  1HNW L;  1TWC H;  3ERS X;  3L2P A;  2R6G A;  3AYH B;  4A3I H;  4BA2 I;  4BBR G;  1DGS A;  4A3M H;  2I5M X;  4JBM A;  1JT8 A;  1MIU A;  1SFO H;  5M3M H;  1RIP A;  5J3B A;  1HZ9 A;  4DNI A;  1J5E L;  3GTO H;  3HOU H;  3JC6 6;  3RLO A;  1PVO A;  3I4N H;  2YV5 A;  4DV5 L;  4A3D H;  4A76 A;  3PUX A;  3UE0 A;  4MNO A;  1AH9 A;  1PYS B;  1X65 A;  1SN8 A;  3H3V I;  3CCE A;  1PH9 A;  1V1Q A;  1VQH A;  4X66 L;  4K0K Q;  1VQ4 A;  2YU9 H;  1UEB A;  1FGU A;  4POF A;  5IYB G;  1ASY A;  1IBM L;  4BXX H;  4MZ9 A;  2IX0 A;  1SE8 A;  4DR1 Q;  5AJ3 L;  1BVS A;  3M7N A;  1BBU A;  3J80 c;  3CD6 A;  4AH6 A;  2UXB L;  4DR3 L;  4A3M G;  4JV5 Q;  4IFD J;  4DV1 L;  1VQA A;  1N36 Q;  5M3M G;  3RN5 A;  4JI7 L;  1Q1E A;  4LF6 Q;  1VQ8 A;  1G51 A;  4A3C G;  3E9I A;  3GDE A;  2WB1 E;  3F2C A;  2ASB A;  3I4N G;  2L15 A;  2PNH A;  1S40 A;  4B3T L;  4LFC Q;  2AKW B;  3UDG A;  2E8G A;  2HHH L;  1B70 B;  4LF7 L;  1Y14 B;  1TWA H;  1VQN A;  3AFQ A;  4JCV E;  3J81 i;  3VDY A;  4NXN L;  2AWO A;  4BXX G;  2CQO A;  3BU2 A;  5C3E H;  5ELN A;  3GTL H;  3K0X A;  1G6P A;  1C0A A;  4P72 A;  4JI5 L;  4PZ7 A;  2JA9 A;  3K81 C;  3RNU A;  1VQ9 A;  4JBK A;  4X62 Q;  4B3S L;  2V1C C;  2F4V Q;  1WOC A;  2KCM A;  1IYJ B;  3KJO A;  1X3G A;  2VQF L;  1VQ6 A;  4DR5 L;  2R7Z H;  3F1Z A;  4ALP A;  2N49 A;  4HJ7 A;  3S14 H;  2K5H A;  4DR4 Q;  2YTV A;  1VQ7 A;  4JC0 A;  2JJQ A;  2VNU D;  3ER0 A;  3CF5 A;  1YJ9 A;  3F8T A;  2OQK A;  4YHH L;  4AYB G;  3RZD H;  1KC8 C;  3UDX A;  4AQY Q;  1Q81 C;  1CKM A;  2WAQ E;  4JI3 L;  3ZJY C;  2K5N A;  2DUD A;  3S24 A;  3HOW H;  4B3R Q;  1PYB A;  1A62 A;  1HNZ Q;  4JYA L;  1K9M C;  5C44 G;  1XMO Q;  2I0Q A;  4XIG S;  1YEZ A;  4H02 A;  4LF4 L;  1PH6 A;  3NBH B;  4GOP B;  1YJW A;  3BZC A;  3CCM A;  4R1J A;  2CKZ B;  1VQI A;  4B3M L;  2Y0S E;  2WAQ G;  4IJL A;  3HOV H;  2WP8 J;  4GKK L;  2R7D A;  3UE1 A;  2JQO A;  1YHQ A;  3G48 A;  2ZJP A;  4C3I H;  1VS0 A;  2D0O A;  4PZ6 A;  2E5L L;  1Y1W G;  4LF9 L;  1XPU A;  1KL9 A;  2Q2H A;  4A3B H;  2ZTD A;  3H3V H;  1GKH A;  1EFW A;  4BY7 H;  1W3S A;  4JOI A;  4NB3 A;  2JA7 H;  1WFQ A;  3RLN A;  3ICE A;  3I7F A;  3HOW G;  4LFA Q;  4LF5 Q;  2UXC Q;  2WFW A;  3A0J A;  3H0G H;  4DR2 Q;  2RHQ B;  3S16 H;  5C4X G;  1XNR Q;  1IZ6 A;  2A19 A;  4DR7 Q;  1Q86 C;  4IOC A;  1MJE A;  4JOI C;  1X54 A;  4DV0 Q;  3CMA A;  4DV4 Q;  3S1R H;  2UUC Q;  1Q7Y C;  4MTN A;  2NN6 G;  1IBL L;  2VZA A;  3HKZ G;  2K4K A;  2K5V A;  4BBR H;  2BH2 A;  1JJG A;  4R4I A;  1YNX A;  2HQL A;  3D31 A;  1NBW A;  4QGU A;  2IY5 B;  3PUV A;  1HJP A;  2JA8 G;  4A3B G;  1AE3 A;  1EWI A;  3CCU A;  3K7U C;  1CSP A;  3T1Y Q;  4JI4 Q;  5M3F G;  3STB C;  4BY7 G;  4TVA B;  5IY0 A;  4UY8 C;  3WWV A;  4BY1 H;  4K0K L;  1C7Y A;  2N3S A;  1X6O A;  3OYY A;  4A3L G;  1QVC A;  2PQA B;  2K14 A;  1XPO A;  4JBJ A;  2B63 G;  1Y1V G;  4PZ8 A;  4DR1 L;  4DV2 Q;  1P8L A;  4P71 A;  3RN2 A;  3PV0 A;  2IT1 A;  1PH7 A;  4FDB A;  3J80 i;  2JEA I;  4NPS A;  2N78 A;  4JV5 L;  1N36 L;  5HY6 A;  3TRE A;  1T9H A;  1FJG L;  3G6E A;  1EOV A;  1EUJ A;  4LUV A;  4APV A;  5C0X J;  1CUK A;  2CWP A;  5IYD G;  4LF6 L;  3TQY A;  2LXJ A;  3KFU A;  3CC7 A;  3CCQ A;  4JI0 Q;  3S2H H;  3STB D;  2UXD Q;  2NN6 I;  1VQK A;  4IOA A;  4OWT B;  2OCE A;  4JI6 Q;  5DLQ E;  3PIP A;  3S1N H;  4A3C H;  1IXR A;  2H5X A;  2LXK A;  3CQZ H;  4ME3 A;  4LF8 Q;  4BY1 G;  1UWV A;  3CCR A;  1K73 C;  1I94 Q;  2JK8 A;  1M1K C;  1HZB A;  4UPA A;  2HIX A;  5LMU Q;  4GOP A;  1U5K A;  4A3F G;  4R4Q A;  1WCM G;  3E9H A;  4DV6 L;  3TS2 A;  2JA6 H;  1D8L A;  1OXS C;  5BR8 Q;  4JG2 A;  4HIM A;  1YJN A;  1PH5 A;  1IL2 A;  2BA1 A;  1NE3 A;  4X62 L;  4GOP C;  1S3O A;  1PA6 A;  2HT1 A;  1OTC A;  1KHI A;  1L2F A;  4IJH A;  2I5H A;  3AEV A;  1LM0 A;  3J7Z C;  2MQH A;  1YHB A;  3CPF A;  2IHF A;  3U4Z A;  3CPW A;  3A5U A;  1SRU A;  5FJ8 G;  3K80 C;  1YIT A;  4GKJ Q;  1SMX A;  1N9W A;  4DV3 Q;  2UUA Q;  2ZTE A;  3PUW A;  1NMF A;  1VQG A;  2A1A A;  1SLJ A;  3AFP A;  4DPG A;  3H15 A;  4A3K G;  4POG A;  1VQD A;  4A3G G;  1BKB A;  1N32 L;  2B3G A;  4AQY L;  3T1H Q;  2BA0 A;  3OTO Q;  2VQE Q;  1VQE A;  1Q82 C;  3AQQ A;  4IPG A;  1X3F A;  2MO0 A;  2R7F A;  2JA6 G;  1CKO A;  2LSS A;  2ZJQ A;  1Q46 A;  2IX1 A;  4L5Q A;  4L5R C;  5C44 H;  1YVC A;  2AHO B;  4X64 L;  1XJV A;  3S17 H;  4JI8 Q;  2GN5 A;  2CFM A;  4LUZ A;  2JEB I;  4LFB L;  2N8N A;  3GTM H;  4HJ5 A;  4AYB E;  3PO2 G;  1H95 A;  2EXD A;  2JE6 I;  3CXC A;  5GAH C;  4HIK A;  3MXN B;  2PQA A;  1GO3 E;  1N33 Q;  4YY3 Q;  2OWO A;  4YCV A;  4WJ3 M;  1GM5 A;  4XTC S;  1VQL A;  1Y1W H;  5IP9 G;  4IPH A;  3PF5 A;  3I4M G;  1KRS A;  4LF5 L;  3G71 A;  4OX9 Q;  4DR2 L;  3S1Q H;  2UXC L;  2KEN A;  3M4P A;  4DKA C;  1CSQ A;  2ALY B;  4X65 Q;  4DR7 L;  4PMW A;  1OXT A;  5C4X H;  1QUQ B;  2KHI A;  4DV0 L;  4EQ5 A;  1B7Y B;  2EIF A;  2E2I H;  4P75 A;  4Y52 H;  2QGQ A;  1C9O A;  4DR3 Q;  4A3J H;  1J6Q A;  4PG3 A;  2NZH A;  4RG1 A;  5M5W H;  4O2D A;  3NEN A;  2D0P A;  3A74 A;  2VUM H;  5IWA Q;  5LMN Q;  4LNQ A;  1EYG A;  1K8A C;  3CW2 C;  4JI4 L;  2PI2 A;  3KLW A;  2CCZ A;  2JA8 H;  2KCT A;  1UE6 A;  4DV7 L;  3F2D A;  2HHH Q;  1PH1 A;  1A0I A;  1VQC A;  2EQS A;  3CP0 A;  4GN4 B;  3OW2 A;  5M3F H;  1XMQ Q;  4QL5 A;  5C4J H;  3HFZ B;  4NXN Q;  2ATW A;  4DV2 L;  1HZC A;  3S15 H;  2AMC B;  4A3L H;  3HKZ E;  1D7Q A;  2B63 H;  1Y1V H;  1X9N A;  2NVQ H;  1SRO A;  1VQP A;  3HOX H;  4HID A;  4JI5 Q;  1VQF A;  1XNQ Q;  1HNX Q;  3ULP A;  4A3J G;  1Q1B A;  2UUB Q;  3HOY G;  4TQU S;  3UDI A;  3Q8D A;  1PV4 A;  5M5X H;  2NVX H;  3NEL A;  1OXV A;  3KDF A;  3U50 C;  2VUM G;  3GTP H;  2Q2I A;  1XPR A;  1TXY A;  2E2J H;  3J81 j;  1E3P A;  2UXD L;  1X55 A;  3PO3 H;  2QA4 A;  3M4Q A;  5IYD H;  4JI6 L;  3EBE A;  1A63 A;  4LF8 L;  1I94 L;  4Y7N H;  1NTG A;  4JI2 Q;  1S72 A;  4YCU A;  1A8V A;  1XTD A;  2Q2T A;  4A93 G;  1V9P A;  3GO5 A;  3PCO B;  4BA1 I;  5JEA G;  3L7Z C;  3CME A;  1YIJ A;  4OWW B;  1MKH A;  4R4O A;  2R92 H;  2ZM6 Q;  5IP7 H;  1KRT A;  5BR8 L;  4A3F H;  2OTL A;  4DUZ Q;  3HOX G;  1LYL A;  1HR0 Q;  1WCM H;  5JJI A;  1HH2 P;  3I55 A;  4P73 A;  3M85 A;  1UE1 A;  4R4T A;  3EN2 A;  3FKI G;  1N34 Q;  2VL6 A;  4OXP A;  4JBW A;  3PO3 G;  4DUY Q;  1TWF H;  2HIV A;  4GKJ L;  1NY4 A;  4DV3 L;  3PUY A;  1V43 A;  4GN5 A;  5FJ8 H;  5FLX c;  5IT9 c;  1PH3 A;  4LFC L;  5GQO A;  1L1O B;  2VS1 A;  1NMG A;  3IRB A;  4GNX B;  1VQB A;  3T1H L;  3OTO L;  2VQE L;  1QUQ A;  1VQ5 A;  4IFD G;  4A3K H;  2QEX A;  4A3G H;  1YBY A;  2ZTC A;  3BZK A;  3KF6 B;  3GTG H;  3NEM A;  2AWN A;  1PH2 A;  2R92 G;  4GN3 B;  5IP7 G;  3CCL A;  3M4O H;  3S2D H;  2NZO A;  5K36 G;  3TS0 A;  3EIV A;  4IO9 A;  2D62 A;  2Z0S A;  4KHP Q;  2ES2 A;  4JI8 L;  2YTY A;  2R93 G;  1X56 A;  3JAM c;  3HOZ G;  2F4V L;  1Q8K A;  1VCI A;  1KXL A;  5JEA J;  4YCW A;  1K3R A;  4A3E H;  1YZ6 A;  1IBL Q;  2UU9 Q;  3TEH B;  4DAM A;  2JA5 G;  3M3Y H;  1OXU A;  4UP8 A;  4L5S A;  3K7A H;  4DR6 Q;  2ID0 A;  1E24 A;  1RL2 A;  4R4C A;  4HJ9 A;  5IE8 A;  1N33 L;  4YY3 L;  4JI1 Q;  3PO2 H;  1UE7 A;  5GAE C;  4OO1 G;  4DR4 L;  2KBN A;  3FP9 A;  1W2B A;  4DAY B;  1Z47 A;  1EQQ A;  3KDF B;  2ZJR A;  4YWL A;  2E2H H;  1WYD A;  3CCS A;  4OX9 L;  4BBS G;  5IP9 H;  4HIO A;  3I4M H;  3KYH C;  4UP9 A;  4X65 L;  1EIY B;  4B3R L;  1HNZ L;  1I3Q H;  3A5Z B;  1QVG A;  3GD7 A;  4IFD I;  1XMO L;  3BJU A;  4A3I G;  4L5T A;  1BBW A;  5M5Y H;  1CKN B;  1QZH A;  1K83 H;  1IBK Q;  1JJC B;  1EIF A;  1TWG H;  4NXM Q;  1L0W A;  1HNW Q;  4A3E G;  4LW1 A;  3GTQ H;  2CWA A;  1FJG Q;  2Q2U A;  4LWC A;  5IWA L;  5LMN L;  2NVT H;  1KAW A;  2K50 A;  2OTJ A;  1Z9F A;  3HOU G;  2XTI A;  1G29 1;  4KHZ A;  5GAD C;  4A3D G;  2C35 B;  1KQS A;  1J5E Q;  2PI2 E;  2K75 A;  1XMQ L;  1WI5 A;  4OO1 I;  4DV5 Q;  4QQB X;  5HGQ A;  3HKS A;  3ULJ A;  3F2B A;  1TWH H;  4LFA L;  3RLF A;  5IYC H;  1PH8 A;  2WB1 G;  4X66 Q;  1X3E A;  4DV6 Q;  1XNR L;  3S1M H;  1IBM Q;  1PFS A;  3D0F A;  4O0A A;  5AJ3 Q;  4C2M H;  2BH8 A;  1XNQ L;  2MFI A;  4IPC A;  3PIO A;  2F52 A;  2PMZ E;  1HNX L;  2A8V A;  5ELO A;  2GVB A;  3M9B A;  3UDF A;  4DV4 L;  3K8A A;  2UUB L;  5EAY A;  4KLK A;  1HZA A;  1QZG A;  3KF8 B;  3E0E A;  2UUC L;  2UXB Q;  1JB7 A;  4DV1 Q;  1L1O A;  4LUO A;  3GTJ H;  4GNX A;  2VW9 A;  1MJC A;  1M90 C;  4GLX A;  3PF4 A;  3DLL A;  5LMN W;  4A75 A;  1LTL A;  3HOY H;  1AE2 A;  2VY3 A;  3KF6 A;  4JI7 Q;  1OXX K;  3CC4 A;  3U4V A;  4RMF A;  2MO1 A;  3T1Y L;  4JI2 L;  1E7Z A;  1L1O C;  1N8R C;  4GNX C;  4EX5 A;  5FLM H;  1JJ2 A;  4AIM A;  4B3T Q;  1N32 Q;  3FHW A;  4OWX B;  1PH4 A;  3U58 A;  1KD1 C;  4KI0 A;  3J81 c;  1K8G A;  3J7A 5;  4LF7 Q;  5C3E G;  5IYC G;  3CAM A;  3DM3 A;  4GLV B;  2ZM6 L;  4A93 H;  3W5O A;  4DUZ L;  4A4I A;  1JMC A;  1HR0 L;  4WJ4 A;  2GVA A;  2FXQ A; 
#chains in the Genus database with same CATH topology
 4J15 A;  4MHE A;  2KHJ A;  4XQQ A;  4C3H H;  1EY4 A;  1ML0 D;  4X3U A;  4HTH A;  1R9T H;  2VQF Q;  4DXF A;  4JI0 L;  4BY1 B;  3VR5 A;  1JOR A;  5FLM G;  2I5L X;  2A6E C;  3GTK H;  4DK6 C;  4YHH Q;  1P16 A;  3CC2 A;  4IFD H;  2B2V C;  1GXD C;  5C0X G;  3W2D A;  1PYW D;  1PHJ A;  2Q8T A;  3OHX C;  1E2V A;  5EPJ A;  3A7L A;  4DK3 C;  2EY5 A;  1V1P B;  2C5C A;  5JJL A;  4IPD A;  4B3M Q;  2WKC A;  1GD7 A;  1KIX A;  3CQZ B;  1DM0 B;  4JI1 L;  3W1G A;  1Q12 A;  1YI2 A;  1M8A A;  5BN5 A;  2E5L Q;  3I4O A;  4DV7 Q;  2Z6K A;  2JA6 B;  3ULL A;  3I72 A;  3MEF A;  4RKB A;  4QJF A;  3DEO A;  5IYB H;  4K5W A;  1Q3L A;  1E22 A;  3SK5 A;  1DOM A;  1HNW L;  5IGB A;  4A3I H;  1EZ8 A;  2I5M X;  4JBM A;  3IKJ A;  2R3Z A;  4ZKB B;  5CR3 A;  2B2U A;  4IUP A;  1SFO H;  2TMP A;  1RIP A;  4G7O C;  2QDB A;  1TY0 A;  3JC6 6;  5CMD A;  3BVG A;  1PYS B;  2EYJ A;  3CCE A;  1PH9 A;  1VQH A;  4RGM A;  4X66 L;  1VQ4 A;  1UEB A;  4FP5 D;  3C2P A;  1D5X C;  3E0J A;  4MZ9 A;  5CBE E;  4PNY A;  1IBM L;  4BXX H;  5AJ3 L;  1BVS A;  3K0Y A;  1BF4 A;  3GTM B;  5J22 A;  4A3M G;  4JV5 Q;  4DV1 L;  1GUW A;  1S5C D;  2EVB A;  5M3M G;  2EYP A;  5LL6 S;  1VQ8 A;  5I9O A;  2ASB A;  2L15 A;  3S1Q B;  4B3T L;  4LFC Q;  3UDG A;  1B70 B;  4V0B A;  1KLG D;  2ICI A;  5C4X B;  4JCV E;  2KJX A;  3BU2 A;  1I4Q A;  4C1N K;  3ITP A;  4K2K A;  4A3J B;  2TSS A;  1C0A A;  1AZP A;  4NP5 A;  4JBK A;  4R9W A;  3P75 A;  1I4H A;  1LLR D;  4OL7 A;  3KJO A;  3QO2 A;  1E2W A;  3CKI B;  3HGB A;  3R93 A;  3SE0 A;  3S15 B;  1YJ9 A;  4UDU C;  2B63 B;  1Y1V B;  2NVQ B;  2WAQ E;  3ZJY C;  1BQQ T;  4B3R Q;  2DJG C;  5C0X H;  1K9M C;  4L63 B;  2RDH A;  4GOP B;  1YJW A;  1RJT A;  3AU7 A;  1S4Z A;  2DNC A;  4XQN A;  4IJL A;  4GKK L;  2RDF A;  5FO8 B;  1J9O A;  2JQO A;  4G4K A;  5IT9 E;  1U4L A;  2MHV A;  1XPU A;  1IKM A;  1KL9 A;  1FNU A;  2ZTD A;  3H3V H;  2EPB A;  4XXE A;  4FF4 A;  1W3S A;  1LTI D;  3I7F A;  4LF5 Q;  2UXC Q;  1SYE A;  1GUS A;  3U9S A;  2LFN A;  4HMJ A;  1X54 A;  3CMA A;  4DV4 Q;  2UUC Q;  4MTN A;  1IBL L;  4QF4 A;  2K5V A;  2LY7 A;  1YNX A;  2O2L D;  4A3K B;  4A3B G;  4A3G B;  2B2T C;  1EWI A;  1JE4 A;  2F0P A;  3CCU A;  1STB A;  4TVA B;  1BCP B;  5IY0 A;  5FKA C;  1C7Y A;  1X6O A;  2PQA B;  1VDZ A;  3J80 E;  2F0T A;  1P8L A;  4IUV A;  4MTK A;  2IT1 A;  1PH7 A;  4A3E B;  4F88 A;  2O4X A;  3M3Y B;  1TU2 B;  1T9H A;  1EOV A;  4PMB A;  4WFN 3;  1CZW A;  3TQY A;  3KFU A;  2E2H B;  2F1M A;  2OCE A;  5DLQ E;  3S1N H;  4ME3 A;  4LF8 Q;  5C4Z A;  1K73 C;  1I3Q B;  2F0N A;  1M1K C;  2B2U C;  4A3F G;  4LJZ C;  1L0Y B;  3FPU B;  4H13 C;  4X3T A;  1RCV D;  4R4Q A;  4DV6 L;  1WTX A;  3TS2 A;  2G9H D;  2Q8R E;  1PH5 A;  1A2U A;  1T5E A;  1AFP A;  4X62 L;  4GOP C;  4IJH A;  1BO0 A;  3J7Z C;  3CPF A;  2IHF A;  3A5U A;  5FJ8 G;  4ZK9 B;  3C3L A;  1SMX A;  4KJN A;  3LWE A;  1ICF B;  1ENF A;  1TWH B;  3J7A F;  4DPG A;  1VQG A;  3OIP A;  1SLJ A;  4RGN A;  4DNR B;  1L0X B;  2KUM A;  1N32 L;  3S1M B;  3T1H Q;  2BA0 A;  2VQE Q;  4IPG A;  1X3F A;  1PDQ A;  1CKO A;  2RA4 A;  3TDQ A;  1LTB D;  4L5Q A;  4RGT A;  2L9H A;  3JAM L;  3HOY B;  4JI8 Q;  2CFM A;  4IUQ A;  4OIJ A;  1H95 A;  4HIK A;  1B4O A;  3MXN B;  2EZV A;  4H7B A;  4YY3 Q;  4YCV A;  4WJ3 M;  3MXP A;  4XTC S;  1BCP C;  5IP9 G;  2JP1 A;  1EEI D;  2B2W C;  3G71 A;  4EQO A;  3L3O C;  1DOK A;  3WOE A;  5KEE A;  4DR7 L;  4PMW A;  1QWY A;  1HHV A;  1I6H B;  4EQ5 A;  4P75 A;  3D3R A;  2ENB A;  2J0T D;  3FKI B;  3NUC A;  4JW0 A;  3VR3 A;  4DR3 Q;  2WAC A;  1A3T A;  4KY7 A;  2NZH A;  3D4D A;  4HCS A;  4RG1 A;  4DA2 A;  1MI2 A;  4O2D A;  2VB3 X;  2D0P A;  3HZX A;  5I4D A;  1CFM A;  3DEP A;  1K8A C;  4DV7 L;  2KEC A;  3F2D A;  1PH1 A;  1VQC A;  1ROD A;  1XMQ Q;  1QG7 A;  4NXN Q;  2ATW A;  4DV2 L;  1HZC A;  3HKZ E;  2XWB B;  2FMM A;  1SRO A;  3A54 A;  3HOZ B;  1VQF A;  4IZ8 A;  3ULP A;  4XT3 B;  1IHZ A;  3QIA A;  3Q8D A;  1PV4 A;  2NVX H;  2R61 A;  5I6Y A;  2VUM G;  2Q2I A;  1TXY A;  1E3P A;  3I3C A;  1XWE A;  1T5X D;  5E4X A;  3NXW A;  1A63 A;  3RD4 A;  1A8V A;  4A93 G;  2E76 C;  3K58 A;  2CH4 W;  4BA1 I;  1H9S B;  1TWC B;  5KYL A;  4DU9 A;  4A3F H;  2F4I A;  2H4O A;  2Z4I A;  3E3X A;  1DXM A;  3MEH A;  4LMQ D;  3GTO B;  4OXP A;  3I4N B;  4JBW A;  3PO3 G;  4A3D B;  1D1I A;  5FJ8 H;  5FLX c;  5IT9 c;  1IL8 A;  1PH3 A;  4LFC L;  5I2X A;  1L1O B;  1SE4 A;  2VS1 A;  4ME5 A;  3ERO A;  4KKU A;  2HD3 A;  1QUQ A;  2ZTC A;  3BZK A;  4XT1 B;  3GTG H;  2AWN A;  3GP7 A;  2R92 G;  3CCL A;  2O5J C;  5L37 A;  2NZO A;  1XXG A;  2ES2 A;  2HCI A;  1DD2 A;  5DM6 3;  2R93 G;  1Q8K A;  5CV4 A;  1KXL A;  5JEA J;  1K3R A;  2K28 A;  1YZ6 A;  1KDA A;  3TEH B;  4DAM A;  2JA5 G;  2EYL A;  4RHS A;  2ID0 A;  3K6O A;  5CV9 A;  1N33 L;  4OO1 G;  4JI1 Q;  2BDO A;  5EGT A;  1B3A A;  1EY9 A;  1Z47 A;  1EQQ A;  2B8G A;  4YWL A;  3CCS A;  5IP9 H;  1GJX A;  4KJO A;  1F2Y A;  1SE3 A;  3KYH C;  4X65 L;  4B3R L;  1PRT F;  1U4P A;  1LT4 D;  4L5T A;  1H9K A;  1BBW A;  5M5Y H;  4DXG A;  1TWG H;  5M9O A;  1L0W A;  1HNW Q;  3QWN A;  2D5D A;  3W3A A;  4LW1 A;  4K8J A;  3NTI A;  2NVT H;  3HOU G;  2G9D A;  1KDC A;  2XTI A;  1G29 1;  4RA8 A;  3RZD B;  1LTT D;  1KNA A;  2JYO A;  3HOW B;  1WI5 A;  3MC0 B;  5HGQ A;  3HKS A;  3ULJ A;  2J4X A;  2N88 A;  5D3D A;  3K59 A;  1SSO A;  4X66 Q;  3FVQ A;  4L6T B;  3VYS A;  1IBM Q;  3HOV B;  4O0A A;  5AJ3 Q;  2A8V A;  3PIO A;  1D1K A;  3MXG A;  4DV4 L;  4L8J A;  1HZA A;  2UUC L;  3E0E A;  2A74 C;  4DV1 Q;  1D5Z C;  4GNX A;  3DLL A;  4A75 A;  1S5E D;  3GQB A;  4KKS A;  4ULL A;  1IKL A;  4RMF A;  3OMG A;  2IPK D;  2NBF A;  1E7Z A;  1L1O C;  4I65 A;  2EJG C;  4B3T Q;  1PH4 A;  5C3E G;  2KOL A;  3CAM A;  5IYC G;  2SNM A;  4GLV B;  2ZM6 L;  1WTP A;  4A93 H;  3W5O A;  1BNZ A;  5CGK A;  1ZYR C;  2RSN A;  2FXQ A;  3SK8 A;  4BBR B;  3I2Z A;  4CKB A;  5CBA E;  2O5I C;  1Q8I A;  1BUV T;  1ASZ A;  2R7Z G;  1WVL A;  5DEH A;  2NWG A;  3Q0A A;  4HJA A;  3LGJ A;  2F3I A;  1PTO B;  2B2V A;  4OON A;  4UP7 A;  2F0L A;  1B9N A;  5D65 A;  5JJK A;  2BE5 D;  4NKL A;  1O7I A;  5COR A;  1CKN A;  1YHA A;  1HCZ A;  4HJ8 A;  4YWK A;  1VQM A;  1C8C A;  2PZU A;  4KHP L;  3L0O A;  1ILQ A;  3S2H B;  2RF4 A;  2R93 H;  1FL0 A;  2DGY A;  2NYZ D;  4GKK Q;  3CCJ A;  3M7G A;  2D2C C;  2QF7 A;  1GHJ A;  2WV6 D;  2JA5 H;  3T56 B;  2RCN A;  4CDD C;  4OO1 H;  4GLA C;  1STY A;  1I4P A;  2JA7 G;  3PGZ A;  5GAG C;  2A73 B;  3I56 A;  1EIH A;  2F0O A;  3NK9 A;  3KF8 A;  3W1B A;  3PSI A;  4X6A H;  1WD1 A;  3G4S A;  1UE5 A;  4NXM L;  5KNC A;  2YTX A;  4G7H C;  4BA2 I;  1RD9 D;  1DGS A;  1G2T A;  2K6A A;  1JT8 A;  3NTH A;  1DZ1 A;  3NWT A;  5J3B A;  1HZ9 A;  3HOU H;  4X3K A;  2H1E A;  1PVO A;  1STG A;  3PUX A;  2DJF C;  4MNO A;  3UE0 A;  1X65 A;  2IJ0 A;  1IYV A;  1V1Q A;  4POF A;  2EJF C;  5IYB G;  3S17 B;  1BBU A;  2B2Y C;  3MHB A;  4AH6 A;  3VA7 A;  4DR3 L;  2EY6 A;  1SJH D;  3ERQ A;  1Y1W B;  4ZCK A;  1CM9 A;  1G51 A;  1S5F D;  1PTO C;  3E9I A;  1PFM A;  3J81 E;  5I6W A;  1JR0 D;  5DM7 3;  4EGV A;  1V1P A;  3VDY A;  1AN8 A;  4NXN L;  4BXX G;  2CQO A;  5C3E H;  2E2I B;  5ELN A;  2RQX A;  3QR8 A;  3K0X A;  3SVM A;  1G6P A;  4NMZ A;  4P72 A;  2JA9 A;  3K81 C;  5M5W B;  3RNU A;  1VQ9 A;  4J6H A;  3DWP A;  1LAC A;  4X62 Q;  2PYK A;  4K2L A;  1KAB A;  4KMU C;  4FF2 A;  2F4V Q;  3MWY W;  2KCM A;  5IGF A;  1IYJ B;  2F0K A;  1VQ6 A;  1Q90 A;  4DR5 L;  3HS0 C;  2R7Z H;  3F1Z A;  4ALP A;  4HJ7 A;  5M3F B;  3S14 H;  4TKO B;  4DR4 Q;  2YTV A;  4IAL A;  1WTW A;  5IGG A;  2VNU D;  3I91 A;  3ER0 A;  1KC8 C;  1Q81 C;  1CKM A;  2C9O A;  3HOX B;  1SND A;  3S24 A;  2A68 D;  3BG3 A;  3MZ5 A;  4JK1 C;  1HNZ Q;  4JYA L;  3F2U A;  4XIG S;  5COY A;  2I0Q A;  3V96 A;  3T53 B;  5CC4 A;  1X3P A;  4ZUJ A;  4JVZ A;  4R1J A;  3CCM A;  2Y0S E;  1EU3 A;  1STH A;  2R7D A;  3OOC A;  1HUM A;  5EQ0 A;  4J1M A;  1YHQ A;  1HFG A;  2K33 A;  1VS0 A;  4RCN A;  1TS5 A;  3I90 A;  3PIP 3;  2Q2H A;  4FVM A;  3GTQ B;  1EWH A;  2ZT9 C;  2K32 A;  4BY7 H;  4NB3 A;  3TP5 A;  2JA7 H;  3ICE A;  4IUN A;  2WFW A;  3A0J A;  5C4X G;  2RHQ B;  2KCC A;  4OIK A;  1B3Q A;  1IZ6 A;  1DOL A;  2A19 A;  3FEW X;  4S3S A;  4DR7 Q;  1MJE A;  4JOI C;  4TRD A;  4QIW B;  4DFA A;  2QIL A;  4CJ2 C;  2B2T A;  1EZ6 A;  1Q7Y C;  3HKZ G;  4HED A;  4R4I A;  3D31 A;  1FD7 D;  1NBW A;  3D6C A;  3DUZ A;  4UHV A;  1CSP A;  4DNT B;  3S2D B;  4NW2 A;  4BY1 H;  3KLS X;  3MFG A;  3OYY A;  3DMU A;  2K14 A;  2B63 G;  2IX3 A;  1Y1V G;  4PZ8 A;  4CHT B;  4U68 A;  4DR1 L;  4DV2 Q;  2K5W A;  3RN2 A;  3J80 i;  4O1N A;  4NPS A;  1E2Z A;  2PCF B;  1YNJ D;  1LTA D;  1N36 L;  4LAA A;  2ZXR A;  5HY6 A;  3PO2 B;  4DAV A;  4HMI A;  1TII D;  1EUJ A;  5E1F A;  4E6I A;  5IYD G;  1A6X A;  3T16 A;  4RWS C;  3H6M A;  3CC7 A;  1D2B A;  4OWT B;  4CDE C;  3I4M B;  1ENC A;  1IXR A;  2H5X A;  3CQZ H;  3FDT A;  2FJ2 A;  2OEO A;  5IOD A;  2HIX A;  4GOP A;  1DON A;  1EYD A;  1U5K A;  2NUC A;  2OF1 A;  3E5S A;  1CZG A;  3E9H A;  5HUR A;  1MGS A;  1D8L A;  3PIO 3;  2JA6 H;  1QJO A;  4JG2 A;  3NWS A;  2PW7 A;  2XRS D;  3GV3 A;  1OTC A;  1CHQ D;  3Q22 A;  5LHY 1;  2I5H A;  5EKK A;  5FOB B;  1LM0 A;  4OGQ C;  2MQH A;  4ABN A;  3K5M A;  3U4Z A;  2PMZ B;  3V05 A;  1YIT A;  5FLX L;  5IT9 L;  2UUA Q;  1K28 A;  1DYQ A;  3PUW A;  3H15 A;  4IOA A;  2A1A A;  4A3K G;  4A3G G;  1VMC A;  4AQY L;  2SEB D;  1Q82 C;  4C2M B;  3AQQ A;  3QG1 A;  2F0J A;  2R7F A;  2DY7 A;  1J8I A;  2LSS A;  5J39 A;  1Q46 A;  1U9R A;  2CW0 D;  3N52 A;  2B39 A;  1I4X A;  2WIN B;  4LUZ A;  1STE A;  3GTM H;  4KV6 A;  2B2W A;  3CXC A;  3FPP A;  4K14 A;  1XYI A;  2PQA A;  1N33 Q;  2OWO A;  3C1E A;  5BN3 A;  5G3L D;  3ND8 A;  1VMP A;  3PF5 A;  1LV9 A;  4IUT A;  3S1Q H;  1GUG A;  3DWA A;  4DKA C;  2NVY B;  1CSQ A;  4X65 Q;  5C4X H;  4DV0 L;  3Q6S A;  3TN2 A;  1B7Y B;  2EIF A;  3G7L A;  3TBI B;  3WOF A;  4Y52 H;  1C9O A;  1QCB D;  4A3J H;  1C48 A;  4PG3 A;  1ZXT A;  2JSO A;  2IWH A;  4IUU A;  3U9O A;  1I50 B;  5ISR A;  4XYQ A;  4JI4 L;  3KLW A;  2CCZ A;  3KLR A;  2HHH Q;  1A0I A;  2EQS A;  5A2Q L;  4QL5 A;  3HFZ B;  3MA2 B;  5JEA H;  3S15 H;  3C46 A;  2WKD A;  1GUN A;  1D7Q A;  2B63 H;  5E4W C;  1F2M A;  1Y1V H;  2NVQ H;  3IL8 A;  4HID A;  1BCP F;  1JB3 A;  5JJZ A;  3HOY G;  2QDL A;  3NEL A;  2FIN B;  3KDF A;  5I2Y A;  3J81 j;  2UXD L;  4KD3 A;  2QA4 A;  5IYD H;  5T1I A;  1Z7T A;  3EA6 A;  4BBS B;  1S72 A;  2XWJ B;  4CJ1 B;  2Q2T A;  1PZI D;  4FF1 A;  3GO5 A;  3L7Z C;  3CME A;  4OWW B;  2ZM6 Q;  5K36 H;  1HQR D;  4A3M B;  3P7J A;  2XVS A;  3R2T A;  3I4L A;  3NP8 A;  1HH2 P;  4EQP A;  1ZKO A;  3NSW A;  3MXN A;  2F0I A;  5M3M B;  4R4T A;  1TQO A;  3FKI G;  2VL6 A;  1FNW A;  5EPK A;  4GN5 A;  1B2T A;  1A2T A;  2YU9 B;  3IRB A;  3OTO L;  2DN8 A;  1W6J A;  4A3K H;  4A3G H;  1YBY A;  2I07 B;  3KF6 B;  3VYU A;  1PH2 A;  1ENA A;  2Z1C A;  2EE1 A;  4HN7 A;  3I70 A;  4KKT A;  1CA6 A;  1FNV A;  5KYI A;  4IO9 A;  4KHP Q;  3QOJ A;  3I73 A;  3ND9 A;  2YTY A;  1OO9 B;  2KVM A;  5D3I B;  3HOZ G;  2F4V L;  3MAQ A;  4YCW A;  4A3E H;  3M3Y H;  4UP8 A;  4L5S A;  2MPM A;  3BDO A;  2HDM A;  3EVQ A;  5IE8 A;  1TWA B;  1UE7 A;  1SJE D;  4DR4 L;  4RH6 A;  3FP9 A;  2AQ1 B;  3GTL B;  3KDF B;  2ZJR A;  2E2H H;  3QB3 A;  4UP9 A;  1EIY B;  1HNZ L;  1I3Q H;  1I6V C;  4KN4 C;  3A8K E;  2M2L A;  1LO5 D;  1JJC B;  4NXM Q;  2EJM A;  1ONL A;  4FO2 A;  1LT3 D;  2QEJ C;  1K8O A;  3VR6 A;  4KY6 A;  4KHZ A;  1H9S A;  4A3D G;  1KQS A;  4KN7 C;  2PI2 E;  4CDF C;  1S5D D;  2CH4 A;  3F2B A;  1TWH H;  4P2C B;  5FO9 B;  1X3E A;  2L11 A;  1Y8O B;  3S1M H;  4I7A A;  2BH8 A;  2EYO A;  2PMZ E;  4C3I B;  3M9B A;  3SK4 A;  1DJR D;  1L1O A;  4A3B B;  2VW9 A;  1MJC A;  1DCZ A;  3PF4 A;  4C3J B;  3HOY H;  1LTL A;  5CYU A;  3DWQ A;  4EX5 A;  3H0G B;  1JJ2 A;  3S16 B;  2ZXP A;  3FHW A;  3U58 A;  3J7A 5;  3KK7 A;  3DM3 A;  2JXM B;  3D8G A;  1JMC A;  3S1R B;  1HR0 L;  2NTS A;  1G91 A;  1KNE A;  2IHE A;  3VR2 A;  1I6H H;  1SR3 A;  3FKI H;  2F0H A;  5JPN C;  1K0R A;  2NTT A;  4DR5 Q;  2FMC A;  4C3J H;  1JE5 A;  1EQR A;  2RHS B;  2Y0S G;  1LT5 D;  1B8A A;  4OEM B;  1FVI A;  4CKC A;  1SYG A;  5E7N A;  5ELE A;  2VB2 X;  3D4W A;  3OWF A;  4JYA Q;  1SDF A;  2F0V A;  5H1S E;  3JAM E;  2MNA A;  3HOV G;  5KGU A;  3SGI A;  4M1U B;  1E1T A;  3K5N A;  4OEL B;  4YWM A;  3V2T A;  3VYT A;  4Q5V A;  2UU9 L;  1NJI C;  3EQL C;  3HOZ H;  3B6Y A;  4DR6 L;  5ELF A;  2FFK B;  4DK1 A;  1CK1 A;  1E1O A;  2B29 A;  2F0E A;  3TME A;  2UUA L;  3IFD A;  1RHP A;  1GVP A;  2X69 A;  4U67 3;  1TS4 A;  1JWM D;  2XGT A;  1B9M A;  3SK6 A;  2N55 A;  3PUZ A;  1RKN A;  3KOJ A;  4N8X 1;  4WOR A;  3KJP A;  2KHS A;  1TWC H;  4BBR G;  3TSS A;  3L9A X;  1F9S A;  1EYA A;  1MIU A;  4B9X A;  3GTO H;  4DAP A;  4G57 A;  3RLO A;  3I4N H;  4AYB B;  2YV5 A;  4GZY C;  4A3D H;  4IUR A;  2B2Y A;  3N6R A;  1AH9 A;  3NBH A;  5HGT A;  1SN8 A;  2EY2 A;  4CKE A;  5C44 B;  1ASY A;  2K05 A;  1SE8 A;  4DR1 Q;  1HTL D;  3J80 c;  1EY6 A;  1ET6 A;  1H9M A;  3R8B A;  1VQA A;  1N36 Q;  1A3V A;  1WTV A;  4F8M A;  3RN5 A;  4HCE A;  5EJW A;  2F0F A;  4A3C G;  3GDE A;  4G7Z C;  1LTR D;  5ELC A;  1SXT A;  3NQT A;  2AKW B;  4UAI A;  2E8G A;  2HHH L;  3ZYY X;  5EKI A;  5C3X A;  1VQN A;  3AFQ A;  3J81 i;  3KLS A;  2AWO A;  3T51 B;  2A69 D;  2Z6B A;  1SYC A;  4PZ7 A;  4DGZ A;  3T13 A;  2VUM B;  1FYC A;  4CBV A;  4B3S L;  2V1C C;  2JA8 B;  1HA6 A;  2N49 A;  1W6K A;  1R4P B;  1E0B A;  1K8M A;  5C4J B;  3KBX A;  2K5H A;  1FGB D;  1VQ7 A;  3OW7 A;  2D9U A;  1O7Z A;  2OXP A;  3NE5 B;  2GA4 B;  2BE5 C;  2Q8I B;  3UDX A;  4AQY Q;  3RZD H;  4JI3 L;  3OPO A;  3HOW H;  4ZAI A;  1PYB A;  1A62 A;  2CHB D;  2IL8 A;  1BOS A;  3AB9 A;  1XMO Q;  1PTO F;  3G6J B;  5KRU A;  5M5X B;  4LF4 L;  4ZUI A;  1PH6 A;  3GTP B;  3NBH B;  2E2J B;  4FYD A;  3BZC A;  2CKZ B;  3PO3 B;  2WAQ G;  3HOV H;  2QKI C;  2WP8 J;  4YIJ A;  4Y7N B;  4OHJ A;  4WJW A;  1Y1W G;  1KDB A;  4LF9 L;  3RZO B;  3MVV A;  5KIX A;  3BDL A;  5AFW A;  4K6L A;  1M4V A;  2R92 B;  1GKH A;  5K5P A;  1EWC A;  1EFW A;  1A15 A;  2PQE A;  4JOI A;  1UNS A;  1WCM B;  4LFA Q;  2ICE C;  1XNR Q;  3UI2 A;  4DV0 Q;  1TWF B;  3S9W A;  2VZA A;  2K4K A;  4BBR H;  4QCL A;  1ET9 A;  4QGU A;  2IW3 A;  4ZLT F;  4B9W A;  2IY5 B;  3PUV A;  3LX0 A;  4JI4 Q;  5M3F G;  3M4O B;  4BY7 G;  3FMC A;  1EEF D;  3WWV A;  4K0K L;  1PTO H;  1PZK D;  2N3S A;  1QVC A;  1XPO A;  1RTO A;  4EQN A;  1JQY D;  1QB5 D;  2NB0 A;  3X3N A;  4P71 A;  3PV0 A;  4FDB A;  2JEA I;  3A56 A;  3HG9 A;  1QOH A;  3K7A B;  1NR4 A;  3TRE A;  4K5V A;  3G6E A;  4TSS A;  2AUJ D;  4LUV A;  4LF6 L;  1CUK A;  1UEA B;  4C1N I;  3NPP A;  2UXD Q;  2OT2 A;  4H0L C;  3S2H H;  2NN6 I;  1VQK A;  1VF5 C;  2X6G A;  4A3C H;  2LXK A;  4BY1 G;  3CCR A;  1F9Q A;  1HTP A;  1HZB A;  1WTR A;  1CHP D;  3NTK A;  4UPA A;  5LMU Q;  2RSO A;  1K83 B;  1SMY D;  2F0M A;  1EY8 A;  1OXS C;  1H9R A;  1YJN A;  1IL2 A;  3TZD A;  1D6E C;  1A3U A;  1S3O A;  1KHI A;  1L2F A;  3DXJ C;  1CQF A;  1PRT D;  1TR5 A;  1YHB A;  3KUP A;  2I46 A;  4Z9C B;  3DHQ A;  1HPC A;  4WJ4 A;  1NMF A;  3AFP A;  4POG A;  1VQD A;  1EYC A;  3OTO Q;  2MGS A;  1TVX A;  2MO0 A;  2JA6 G;  1Y69 U;  3RMH A;  2WII B;  2ZJQ A;  3VR4 A;  3IAY A;  2IX1 A;  3GTJ B;  3TP8 A;  2A68 C;  5TSS A;  4L5R C;  1YVC A;  4EVO A;  2M00 A;  2AHO B;  3S17 H;  2GN5 A;  2N8N A;  2HCC A;  4AYB E;  5BN4 A;  3PO2 G;  2EXD A;  2F3V A;  2PZT A;  5GAH C;  4PV1 C;  1F9P A;  3BS1 A;  1WTQ A;  3OWE B;  1CI3 M;  5EBC A;  1X32 A;  1RF2 D;  2EOT A;  1Y1W H;  2A6H D;  3I4M G;  1KRS A;  1RDP D;  4DR2 L;  3CU7 A;  3M4P A;  1II3 A;  2ALY B;  4DF7 A;  1OXT A;  1CT1 D;  4C3H B;  2HUG A;  5CV7 A;  4KK7 A;  2K01 A;  1HXY D;  2E2I H;  1R9T B;  5KND A;  1GUO A;  1J6Q A;  2LS0 1;  5M5W H;  4F7X A;  3H09 A;  3NEN A;  5EPL A;  4LNQ A;  5CV8 A;  1EYG A;  3NHH A;  3GTK B;  2PI2 A;  1UE6 A;  4N8F A;  4GN4 B;  3CP0 A;  1EFI D;  3FRP B;  4JPB W;  5M3F H;  3OW2 A;  1MSH A;  2PZW A;  1TY2 A;  2EY1 A;  4CGY B;  1X9N A;  1UAP A;  3AMU A;  4JI5 Q;  1VQP A;  3HOX H;  4IQZ A;  3VYR A;  4A3J G;  1Q1B A;  4HSV A;  2KCN A;  1OXV A;  1PFN A;  1YNJ C;  3U50 C;  4KD4 A;  1X55 A;  2F0S A;  3K5L A;  2PNR C;  4JI6 L;  1BR9 A;  2LKV A;  1B50 A;  3P20 A;  1I94 L;  2FHT A;  2MJ8 A;  3HRZ C;  1YNN D;  3PMF A;  4YCU A;  2PO4 A;  1XTD A;  3GTQ H;  5JEA G;  1MKH A;  4A3I B;  5IP7 H;  5BR8 L;  5DAU A;  2OTL A;  1ILP A;  1HR0 Q;  5JJI A;  1EY0 A;  2DY8 A;  4P73 A;  3M85 A;  1SFO B;  3LNN A;  4KY5 A;  5IGE A;  1JOK A;  3C1F A;  4I7Z C;  2F0U A;  4GKJ L;  1XTC D;  5CV6 A;  4QUF A;  3D4R A;  4DV3 L;  3PUY A;  1O78 A;  2A6E D;  5JVH 3;  1NMG A;  1VQB A;  1V8Q A;  5JVG 3;  4ZYS A;  2XRQ D;  1VQ5 A;  2EYM A;  2WB1 B;  3NEM A;  5K36 G;  3S2D H;  5JOB A;  2A5H A;  3TS0 A;  3EIV A;  2D62 A;  2Z0S A;  3DM1 A;  1JWS D;  1NNX A;  2CW0 C;  5A35 A;  1VCI A;  1H9J A;  2UU9 Q;  5LL6 X;  3SR1 A;  1OXU A;  4DR6 Q;  4R4C A;  1E24 A;  4HJ9 A;  2XSC A;  1BBX C;  2XNA C;  3PO2 H;  1SNQ A;  3E6Z X;  1WYD A;  4PMC A;  4OX9 L;  4BBS G;  1NR2 A;  1WTO A;  3I4M H;  1QIL A;  4IFD I;  3A5Z B;  1QVG A;  3GD7 A;  1XMO L;  1QZH A;  1EIF A;  1SNP A;  4A3E G;  1FJG Q;  1XX8 A;  5IWA L;  5LMN L;  1KAW A;  1NUC A;  1EY5 A;  2SDF A;  1ESR A;  2K5Q A;  5GAD C;  1KAA A;  4N9T A;  1GHK A;  2K7V A;  2P5Z X;  3NBI A;  4LFA L;  1PH8 A;  1XNR L;  3BDC A;  3J80 L;  1PFS A;  3D0F A;  4C2M H;  1XNQ L;  1HNX L;  4IPC A;  2F52 A;  3SXH A;  4ILW A;  2GVB A;  3HKZ B;  2UUB L;  3K8A A;  3HEJ A;  4KLK A;  1QZG A;  3GV6 A;  3RUZ A;  1AP0 A;  4LUO A;  2Z4H A;  1M90 C;  1AE2 A;  3KF6 A;  1OXX K;  3CC4 A;  2MO1 A;  4JI2 L;  5FLM H;  4AIM A;  3CRL C;  4OWX B;  1KD1 C;  3J81 c;  4RFB A;  2HDL A;  4DUZ L;  4DK0 A;  3OSO A;  5E3F A;  2HQE A;  2NVY H;  4X64 Q;  2BDN A;  2YYZ A;  4P74 A;  1N34 L;  3EJI A;  4B3S Q;  4LFB Q;  4DUY L;  2XN9 C;  1EOT A;  5FLX E;  5GRO A;  1LUZ A;  1I50 H;  3I8Z A;  5LMU L;  4JI3 Q;  2L4N A;  1MSG A;  3WDN A;  1HR0 W;  4NDX A;  1GUT A;  1QVF A;  4QB4 A;  4BS9 A;  2BOS A;  1U0L A;  4N9P A;  3CCV A;  1B1Z A;  4LF4 Q;  1R4Q B;  2OQ0 A;  4C3I G;  3JAM i;  2AUK A;  3A8J E;  3TRZ A;  1WJJ A;  3S1N B;  4XQJ A;  4GS3 A;  4C3J G;  4RCO A;  1ICW A;  4LF9 Q;  2F03 A;  1I5F A;  1VQO A;  1G8Z D;  3RR5 A;  3H0G G;  1VQJ A;  4QY7 A;  4BBS H;  1BXT A;  3KBG A;  4QIW E;  2Z6K C;  3J7Y W;  4HR7 B;  1IBK L;  2K52 A;  5C0X I;  3ERS X;  3L2P A;  2R6G A;  3AYH B;  4A3M H;  2LMC B;  2Z8L A;  1JC7 A;  3H3V C;  5M3M H;  1CTM A;  4DNI A;  2QCP X;  3Q23 A;  1J5E L;  4DV5 L;  5A2Q E;  4A76 A;  1TS2 A;  1F77 A;  4IN3 A;  3H3V I;  4K0K Q;  2YU9 H;  1FGU A;  4KTA A;  2IX0 A;  4QMG A;  3M7N A;  3CD6 A;  3M4Y A;  2UXB L;  4IFD J;  5I9P A;  5IGD A;  1PMR A;  4RKL A;  2X6L A;  5NUC A;  4LF6 Q;  4JI7 L;  1Q1E A;  5FK9 C;  3TZU A;  1IW7 C;  1MD2 D;  2WB1 E;  3F2C A;  3I4N G;  2PNH A;  1S40 A;  1Z6H A;  2J7Z A;  4LF7 L;  1Y14 B;  1TWA H;  1MBY A;  1FR3 A;  3GTL H;  1LTG D;  4JI5 L;  1I4R A;  1LT6 D;  2K1B A;  4ODG A;  2KED A;  1PLF A;  5IOC A;  2L0C A;  2F0G A;  1WOC A;  1X3G A;  2F0Q A;  2VQF L;  1IW7 D;  5EBD A;  1QNU A;  1KTK A;  2MUY A;  4JC0 A;  2JJQ A;  3IFT A;  3CF5 A;  5C5L A;  3F8T A;  2OQK A;  4YHH L;  4AYB G;  1SNC A;  1AZQ A;  2K5N A;  2DUD A;  4ID6 A;  5DNF A;  1PFB A;  2VXW A;  5C44 G;  4FF3 A;  3SHL A;  2EXZ A;  2NVX B;  1YEZ A;  4H02 A;  4ZKC B;  3TP6 A;  3A7A B;  1VQI A;  4B3M L;  1SYB A;  3UE1 A;  3OIQ A;  3G48 A;  2ZJP A;  4C3I H;  1JOQ A;  2PW5 A;  2D0O A;  1BCP D;  3BZD B;  4PZ6 A;  2E5L L;  1PZJ D;  4A3B H;  3K57 A;  3BVZ A;  4A3F B;  3BYY B;  3D6W A;  1HA5 A;  4XYO A;  3X3M A;  2ZXO A;  1WFQ A;  3RLN A;  2M9V A;  3HOW G;  2NZ1 D;  3QOL A;  4DR2 Q;  3H0G H;  5ELD A;  1WD0 A;  3S16 H;  1HFN A;  1Q86 C;  4IOC A;  2RDG A;  3TP7 A;  4CDC C;  5C4H A;  3S1R H;  4K6D A;  2E75 C;  2NN6 G;  1C4Q A;  1QE6 A;  2BH2 A;  1JJG A;  1MHW C;  2HQL A;  3A55 A;  1TKW B;  5FO7 B;  2JA8 G;  1HJP A;  1AE3 A;  3K5O A;  3R2I A;  3GTG B;  3K7U C;  1NAP A;  3T1Y Q;  3STB C;  3HP3 A;  1NCV A;  4UY8 C;  4Q0F A;  4A3L G;  2EYF A;  4JBJ A;  3MXU A;  5C5M A;  1F9R A;  1I4G A;  2EYH A;  3EFX D;  4RHR A;  1UUP A;  2K04 A;  2Z9H A;  2N78 A;  4JV5 L;  1FJG L;  2XIW A;  1JOO A;  5C0X J;  4R8I A;  4LK1 C;  4APV A;  2CWP A;  4MN3 A;  1F2Z A;  2SNS A;  1G2S A;  2LXJ A;  3CCQ A;  4JI0 Q;  3STB D;  1VF7 A;  4JI6 Q;  3PIP A;  3J7A V;  1SYF A;  1UWV A;  1S5B D;  1I94 Q;  1CA5 A;  2JK8 A;  4H44 C;  1SNO A;  5M5Y B;  4B08 A;  1JWU D;  2MP1 A;  1TWG B;  1WCM G;  3BYT B;  1EQT A;  1EL0 A;  1U4R A;  5BR8 Q;  2BCO A;  4HIM A;  4QUC A;  2BA1 A;  3T4A C;  3MTS A;  1NE3 A;  2A69 C;  3H94 A;  2NVT B;  1PA6 A;  1O7L A;  1B53 A;  1Y8P B;  5JAV A;  2HT1 A;  4PQX A;  3AEV A;  1LAB A;  3CPW A;  1SRU A;  1SBB B;  2F3W A;  3K80 C;  1CQV A;  4GKJ Q;  2E2D C;  1N9W A;  2B8F A;  3URY A;  4DV3 Q;  2ZTE A;  1AEX A;  2RCF A;  5KNB A;  4HAE A;  4WRD A;  1BKB A;  2RVL A;  2B3G A;  2JN4 A;  1VQE A;  2KA7 A;  1SYD A;  3CHB D;  3PQI A;  1QNK A;  1V1O A;  5C44 H;  3SDZ A;  4X64 L;  1XJV A;  1K0S A;  1JIC A;  1K3B C;  2JEB I;  4LFB L;  4HJ5 A;  5EKL A;  2JE6 I;  1PRT B;  2Y0S B;  4KHV A;  1F2L A;  1GO3 E;  5CV5 A;  5C3W A;  1GM5 A;  1VQL A;  4A93 B;  4IPH A;  1EIG A;  1BDO A;  2AQ2 B;  4LF5 L;  2UXC L;  4OX9 Q;  2KEN A;  3QJY A;  3MFY A;  1QUQ B;  2KHI A;  1EU4 A;  2KQ3 A;  2QGQ A;  4ZQ3 A;  1RTN A;  3A74 A;  2NN6 H;  2VUM H;  5IWA Q;  5LMN Q;  1TT2 A;  3CW2 C;  3VA5 A;  2JA8 H;  2KCT A;  1HQM C;  1LTS D;  5C4J H;  2AQ3 B;  4DN4 M;  3P1H A;  2AMC B;  4A3L H;  3LWU A;  4CJ0 B;  2R93 B;  2L12 A;  1IYU A;  1XNQ Q;  1Y8N B;  1HNX Q;  2F0W A;  2UUB Q;  2JA5 B;  4TQU S;  3UDI A;  4DAY A;  5M5X H;  1SEB D;  1ESF A;  3GTP H;  1XPR A;  2E2J H;  5J1Z A;  5IGC A;  4K5X A;  3PO3 H;  3M4Q A;  1SAP A;  3SEB A;  3EBE A;  4LF8 L;  4Y7N H;  5C6A A;  1NTG A;  4JI2 Q;  3J81 L;  2DNE A;  2CQA A;  1V9P A;  3PCO B;  3RZO H;  1YIJ A;  1ZYR D;  4R4O A;  2R92 H;  2RKS A;  1PXU A;  4HSP A;  1KRT A;  4DUZ Q;  3HOX G;  1WTH A;  1LYL A;  1WCM H;  1ZEQ X;  1SMY C;  3I55 A;  2KEE A;  4C3H G;  1UE1 A;  3A8I E;  4FXD A;  3EN2 A;  1EQV A;  1SNM A;  4X3S A;  4ZRZ A;  3HOU B;  4K8I A;  1N34 Q;  3O13 A;  1B44 D;  2L1B A;  1TWF H;  2HIV A;  4FNF A;  4DUY Q;  1PRT C;  1NY4 A;  1V43 A;  3CRK C;  4RGO S;  5GQO A;  1EY7 A;  4GNX B;  5D14 A;  3T1H L;  3OMC A;  2VQE L;  4XDX A;  4IFD G;  1O80 A;  2QEX A;  2QW7 A;  4GN3 B;  5IP7 G;  3M4O H;  4FXG C;  5JPM C;  1STN A;  1X3Q A;  1KLU D;  2SOB A;  4JI8 L;  3Q24 A;  4MIU A;  1X56 A;  3JAM c;  5F2D A;  1IBL Q;  3K7A H;  2G5D A;  1RL2 A;  1G6Z A;  4YY3 L;  5GAE C;  2KBN A;  1STA A;  1W2B A;  2RBM A;  4DAY B;  5C3E B;  2K03 A;  4HIO A;  2A6H C;  4RAU C;  2L5T A;  1HUN A;  3BJU A;  4A3I G;  2WAQ B;  1AW7 A;  2CVR A;  1CKN B;  1K83 H;  1IBK Q;  2R7Z B;  2CWA A;  2K5D A;  3H91 A;  2Q2U A;  3S14 B;  1D5M C;  4LWC A;  5IIF A;  2K50 A;  4BWG B;  2EDG A;  1Z9F A;  2OTJ A;  4O42 A;  4M8A A;  2C35 B;  1J5E Q;  4V19 0;  2K75 A;  1XMQ L;  3BVM A;  4OO1 I;  4DV5 Q;  4QQB X;  3RLF A;  4F87 A;  5IYC H;  2WB1 G;  1TS3 A;  4DV6 Q;  4J8Q A;  1NSN S;  1GOZ A;  2E74 C;  2MFI A;  5T1G A;  4FXK C;  5ELO A;  3UDF A;  2L55 A;  5EAY A;  3KF8 B;  3R3O A;  2UXB Q;  1HRJ A;  3NQI A;  1JB7 A;  3GTJ H;  5G3L F;  1PTO D;  4GLX A;  5LMN W;  2VY3 A;  1O7Y A;  4BY7 B;  3ONA B;  4JI7 Q;  2PPB C;  2JA7 B;  1SE2 A;  3U4V A;  3T1Y L;  5ELB A;  4C56 C;  1N8R C;  4GNX C;  1JCK B;  1N32 Q;  1K8G A;  1U4M A;  4KI0 A;  4LF7 Q;  1YNN C;  4R8N A;  2F0D A;  4A4I A;  2GVA A;  2V4D A; 
#chains in the Genus database with same CATH homology
 4J15 A;  3I2Z A;  2NVY H;  2KHJ A;  4X64 Q;  2IHE A;  2YYZ A;  4P74 A;  1N34 L;  1ASZ A;  4B3S Q;  2R7Z G;  4C3H H;  4LFB Q;  4DUY L;  1I6H H;  1SR3 A;  4HJA A;  3LGJ A;  3FKI H;  1R9T H;  2VQF Q;  1K0R A;  2F3I A;  4DR5 Q;  4JI0 L;  5GRO A;  4OON A;  4UP7 A;  4C3J H;  1LUZ A;  5JJK A;  5FLM G;  1JE5 A;  1EQR A;  2RHS B;  2Y0S G;  1B8A A;  2I5L X;  1I50 H;  1FVI A;  1O7I A;  3RZO H;  3GTK H;  1CKN A;  4DK6 C;  1YHA A;  1P16 A;  5E7N A;  4YHH Q;  5LMU L;  3CC2 A;  5C0X G;  4HJ8 A;  4YWK A;  1PHJ A;  4JI3 Q;  1VQM A;  1HR0 W;  4KHP L;  1QVF A;  4JYA Q;  4DK3 C;  1U0L A;  3L0O A;  5H1S E;  2MNA A;  3CCV A;  3HOV G;  3SGI A;  4LF4 Q;  5JJL A;  1E1T A;  4IPD A;  4YWM A;  2OQ0 A;  3JAM i;  2UU9 L;  4B3M Q;  2RF4 A;  1NJI C;  2R93 H;  1FL0 A;  3HOZ H;  3B6Y A;  2DGY A;  4DR6 L;  1GD7 A;  1KIX A;  1WJJ A;  3CCJ A;  3TRZ A;  4GKK Q;  1E1O A;  2B29 A;  4JI1 L;  3W1G A;  1Q12 A;  4GS3 A;  1YI2 A;  2JA5 H;  2UUA L;  2RCN A;  2E5L Q;  4GLA C;  4LF9 Q;  3I4O A;  4DV7 Q;  1I5F A;  3PGZ A;  2JA7 G;  1VQO A;  2Z6K A;  5GAG C;  3ULL A;  1GVP A;  3RR5 A;  3H0G G;  1VQJ A;  4QY7 A;  3MEF A;  3I56 A;  4QJF A;  4BBS H;  2XGT A;  3W1B A;  4QIW E;  5IYB H;  3PUZ A;  1E22 A;  3KOJ A;  2Z6K C;  3PSI A;  1IBK L;  4X6A H;  2K52 A;  3KJP A;  1UE5 A;  3G4S A;  5C0X I;  4NXM L;  2YTX A;  1HNW L;  1TWC H;  3ERS X;  3L2P A;  2R6G A;  3AYH B;  4A3I H;  4BA2 I;  4BBR G;  1DGS A;  4A3M H;  2I5M X;  4JBM A;  1JT8 A;  1MIU A;  1SFO H;  5M3M H;  1RIP A;  5J3B A;  1HZ9 A;  4DNI A;  1J5E L;  3GTO H;  3HOU H;  3JC6 6;  3RLO A;  1PVO A;  3I4N H;  2YV5 A;  4DV5 L;  4A3D H;  4A76 A;  3PUX A;  3UE0 A;  4MNO A;  1AH9 A;  1PYS B;  1X65 A;  1SN8 A;  3H3V I;  3CCE A;  1PH9 A;  1V1Q A;  1VQH A;  4X66 L;  4K0K Q;  1VQ4 A;  2YU9 H;  1UEB A;  1FGU A;  4POF A;  5IYB G;  1ASY A;  1IBM L;  4BXX H;  4MZ9 A;  2IX0 A;  1SE8 A;  4DR1 Q;  5AJ3 L;  1BVS A;  3M7N A;  1BBU A;  3J80 c;  3CD6 A;  4AH6 A;  2UXB L;  4DR3 L;  4A3M G;  4JV5 Q;  4IFD J;  4DV1 L;  1VQA A;  1N36 Q;  5M3M G;  3RN5 A;  4JI7 L;  1Q1E A;  4LF6 Q;  1VQ8 A;  1G51 A;  4A3C G;  3E9I A;  3GDE A;  2WB1 E;  3F2C A;  2ASB A;  3I4N G;  2L15 A;  2PNH A;  1S40 A;  4B3T L;  4LFC Q;  2AKW B;  3UDG A;  2E8G A;  2HHH L;  1B70 B;  4LF7 L;  1Y14 B;  1TWA H;  1VQN A;  3AFQ A;  4JCV E;  3J81 i;  3VDY A;  4NXN L;  2AWO A;  4BXX G;  2CQO A;  3BU2 A;  5C3E H;  5ELN A;  3GTL H;  3K0X A;  1G6P A;  1C0A A;  4P72 A;  4JI5 L;  4PZ7 A;  2JA9 A;  3K81 C;  3RNU A;  1VQ9 A;  4JBK A;  4X62 Q;  4B3S L;  2V1C C;  2F4V Q;  1WOC A;  2KCM A;  1IYJ B;  3KJO A;  1X3G A;  2VQF L;  1VQ6 A;  4DR5 L;  2R7Z H;  3F1Z A;  4ALP A;  2N49 A;  4HJ7 A;  3S14 H;  2K5H A;  4DR4 Q;  2YTV A;  1VQ7 A;  4JC0 A;  2JJQ A;  2VNU D;  3ER0 A;  3CF5 A;  1YJ9 A;  3F8T A;  2OQK A;  4YHH L;  4AYB G;  3RZD H;  1KC8 C;  3UDX A;  4AQY Q;  1Q81 C;  1CKM A;  2WAQ E;  4JI3 L;  3ZJY C;  2K5N A;  2DUD A;  3S24 A;  3HOW H;  4B3R Q;  1PYB A;  1A62 A;  1HNZ Q;  4JYA L;  1K9M C;  5C44 G;  1XMO Q;  2I0Q A;  4XIG S;  1YEZ A;  4H02 A;  4LF4 L;  1PH6 A;  3NBH B;  4GOP B;  1YJW A;  3BZC A;  3CCM A;  4R1J A;  2CKZ B;  1VQI A;  4B3M L;  2Y0S E;  2WAQ G;  4IJL A;  3HOV H;  2WP8 J;  4GKK L;  2R7D A;  3UE1 A;  2JQO A;  1YHQ A;  3G48 A;  2ZJP A;  4C3I H;  1VS0 A;  2D0O A;  4PZ6 A;  2E5L L;  1Y1W G;  4LF9 L;  1XPU A;  1KL9 A;  2Q2H A;  4A3B H;  2ZTD A;  3H3V H;  1GKH A;  1EFW A;  4BY7 H;  1W3S A;  4JOI A;  4NB3 A;  2JA7 H;  1WFQ A;  3RLN A;  3ICE A;  3I7F A;  3HOW G;  4LFA Q;  4LF5 Q;  2UXC Q;  2WFW A;  3A0J A;  3H0G H;  4DR2 Q;  2RHQ B;  3S16 H;  5C4X G;  1XNR Q;  1IZ6 A;  2A19 A;  4DR7 Q;  1Q86 C;  4IOC A;  1MJE A;  4JOI C;  1X54 A;  4DV0 Q;  3CMA A;  4DV4 Q;  3S1R H;  2UUC Q;  1Q7Y C;  4MTN A;  2NN6 G;  1IBL L;  2VZA A;  3HKZ G;  2K4K A;  2K5V A;  4BBR H;  2BH2 A;  1JJG A;  4R4I A;  1YNX A;  2HQL A;  3D31 A;  1NBW A;  4QGU A;  2IY5 B;  3PUV A;  1HJP A;  2JA8 G;  4A3B G;  1AE3 A;  1EWI A;  3CCU A;  3K7U C;  1CSP A;  3T1Y Q;  4JI4 Q;  5M3F G;  3STB C;  4BY7 G;  4TVA B;  5IY0 A;  4UY8 C;  3WWV A;  4BY1 H;  4K0K L;  1C7Y A;  2N3S A;  1X6O A;  3OYY A;  4A3L G;  1QVC A;  2PQA B;  2K14 A;  1XPO A;  4JBJ A;  2B63 G;  1Y1V G;  4PZ8 A;  4DR1 L;  4DV2 Q;  1P8L A;  4P71 A;  3RN2 A;  3PV0 A;  2IT1 A;  1PH7 A;  4FDB A;  3J80 i;  2JEA I;  4NPS A;  2N78 A;  4JV5 L;  1N36 L;  5HY6 A;  3TRE A;  1T9H A;  1FJG L;  3G6E A;  1EOV A;  1EUJ A;  4LUV A;  4APV A;  5C0X J;  1CUK A;  2CWP A;  5IYD G;  4LF6 L;  3TQY A;  2LXJ A;  3KFU A;  3CC7 A;  3CCQ A;  4JI0 Q;  3S2H H;  3STB D;  2UXD Q;  2NN6 I;  1VQK A;  4IOA A;  4OWT B;  2OCE A;  4JI6 Q;  5DLQ E;  3PIP A;  3S1N H;  4A3C H;  1IXR A;  2H5X A;  2LXK A;  3CQZ H;  4ME3 A;  4LF8 Q;  4BY1 G;  1UWV A;  3CCR A;  1K73 C;  1I94 Q;  2JK8 A;  1M1K C;  1HZB A;  4UPA A;  2HIX A;  5LMU Q;  4GOP A;  1U5K A;  4A3F G;  4R4Q A;  1WCM G;  3E9H A;  4DV6 L;  3TS2 A;  2JA6 H;  1D8L A;  1OXS C;  5BR8 Q;  4JG2 A;  4HIM A;  1YJN A;  1PH5 A;  1IL2 A;  2BA1 A;  1NE3 A;  4X62 L;  4GOP C;  1S3O A;  1PA6 A;  2HT1 A;  1OTC A;  1KHI A;  1L2F A;  4IJH A;  2I5H A;  3AEV A;  1LM0 A;  3J7Z C;  2MQH A;  1YHB A;  3CPF A;  2IHF A;  3U4Z A;  3CPW A;  3A5U A;  1SRU A;  5FJ8 G;  3K80 C;  1YIT A;  4GKJ Q;  1SMX A;  1N9W A;  4DV3 Q;  2UUA Q;  2ZTE A;  3PUW A;  1NMF A;  1VQG A;  2A1A A;  1SLJ A;  3AFP A;  4DPG A;  3H15 A;  4A3K G;  4POG A;  1VQD A;  4A3G G;  1BKB A;  1N32 L;  2B3G A;  4AQY L;  3T1H Q;  2BA0 A;  3OTO Q;  2VQE Q;  1VQE A;  1Q82 C;  3AQQ A;  4IPG A;  1X3F A;  2MO0 A;  2R7F A;  2JA6 G;  1CKO A;  2LSS A;  2ZJQ A;  1Q46 A;  2IX1 A;  4L5Q A;  4L5R C;  5C44 H;  1YVC A;  2AHO B;  4X64 L;  1XJV A;  3S17 H;  4JI8 Q;  2GN5 A;  2CFM A;  4LUZ A;  2JEB I;  4LFB L;  2N8N A;  3GTM H;  4HJ5 A;  4AYB E;  3PO2 G;  1H95 A;  2EXD A;  2JE6 I;  3CXC A;  5GAH C;  4HIK A;  3MXN B;  2PQA A;  1GO3 E;  1N33 Q;  4YY3 Q;  2OWO A;  4YCV A;  4WJ3 M;  1GM5 A;  4XTC S;  1VQL A;  1Y1W H;  5IP9 G;  4IPH A;  3PF5 A;  3I4M G;  1KRS A;  4LF5 L;  3G71 A;  4OX9 Q;  4DR2 L;  3S1Q H;  2UXC L;  2KEN A;  3M4P A;  4DKA C;  1CSQ A;  2ALY B;  4X65 Q;  4DR7 L;  4PMW A;  1OXT A;  5C4X H;  1QUQ B;  2KHI A;  4DV0 L;  4EQ5 A;  1B7Y B;  2EIF A;  2E2I H;  4P75 A;  4Y52 H;  2QGQ A;  1C9O A;  4DR3 Q;  4A3J H;  1J6Q A;  4PG3 A;  2NZH A;  4RG1 A;  5M5W H;  4O2D A;  3NEN A;  2D0P A;  3A74 A;  2VUM H;  5IWA Q;  5LMN Q;  4LNQ A;  1EYG A;  1K8A C;  3CW2 C;  4JI4 L;  2PI2 A;  3KLW A;  2CCZ A;  2JA8 H;  2KCT A;  1UE6 A;  4DV7 L;  3F2D A;  2HHH Q;  1PH1 A;  1A0I A;  1VQC A;  2EQS A;  3CP0 A;  4GN4 B;  3OW2 A;  5M3F H;  1XMQ Q;  4QL5 A;  5C4J H;  3HFZ B;  4NXN Q;  2ATW A;  4DV2 L;  1HZC A;  3S15 H;  2AMC B;  4A3L H;  3HKZ E;  1D7Q A;  2B63 H;  1Y1V H;  1X9N A;  2NVQ H;  1SRO A;  1VQP A;  3HOX H;  4HID A;  4JI5 Q;  1VQF A;  1XNQ Q;  1HNX Q;  3ULP A;  4A3J G;  1Q1B A;  2UUB Q;  3HOY G;  4TQU S;  3UDI A;  3Q8D A;  1PV4 A;  5M5X H;  2NVX H;  3NEL A;  1OXV A;  3KDF A;  3U50 C;  2VUM G;  3GTP H;  2Q2I A;  1XPR A;  1TXY A;  2E2J H;  3J81 j;  1E3P A;  2UXD L;  1X55 A;  3PO3 H;  2QA4 A;  3M4Q A;  5IYD H;  4JI6 L;  3EBE A;  1A63 A;  4LF8 L;  1I94 L;  4Y7N H;  1NTG A;  4JI2 Q;  1S72 A;  4YCU A;  1A8V A;  1XTD A;  2Q2T A;  4A93 G;  1V9P A;  3GO5 A;  3PCO B;  4BA1 I;  5JEA G;  3L7Z C;  3CME A;  1YIJ A;  4OWW B;  1MKH A;  4R4O A;  2R92 H;  2ZM6 Q;  5IP7 H;  1KRT A;  5BR8 L;  4A3F H;  2OTL A;  4DUZ Q;  3HOX G;  1LYL A;  1HR0 Q;  1WCM H;  5JJI A;  1HH2 P;  3I55 A;  4P73 A;  3M85 A;  1UE1 A;  4R4T A;  3EN2 A;  3FKI G;  1N34 Q;  2VL6 A;  4OXP A;  4JBW A;  3PO3 G;  4DUY Q;  1TWF H;  2HIV A;  4GKJ L;  1NY4 A;  4DV3 L;  3PUY A;  1V43 A;  4GN5 A;  5FJ8 H;  5FLX c;  5IT9 c;  1PH3 A;  4LFC L;  5GQO A;  1L1O B;  2VS1 A;  1NMG A;  3IRB A;  4GNX B;  1VQB A;  3T1H L;  3OTO L;  2VQE L;  1QUQ A;  1VQ5 A;  4IFD G;  4A3K H;  2QEX A;  4A3G H;  1YBY A;  2ZTC A;  3BZK A;  3KF6 B;  3GTG H;  3NEM A;  2AWN A;  1PH2 A;  2R92 G;  4GN3 B;  5IP7 G;  3CCL A;  3M4O H;  3S2D H;  2NZO A;  5K36 G;  3TS0 A;  3EIV A;  4IO9 A;  2D62 A;  2Z0S A;  4KHP Q;  2ES2 A;  4JI8 L;  2YTY A;  2R93 G;  1X56 A;  3JAM c;  3HOZ G;  2F4V L;  1Q8K A;  1VCI A;  1KXL A;  5JEA J;  4YCW A;  1K3R A;  4A3E H;  1YZ6 A;  1IBL Q;  2UU9 Q;  3TEH B;  4DAM A;  2JA5 G;  3M3Y H;  1OXU A;  4UP8 A;  4L5S A;  3K7A H;  4DR6 Q;  2ID0 A;  1E24 A;  1RL2 A;  4R4C A;  4HJ9 A;  5IE8 A;  1N33 L;  4YY3 L;  4JI1 Q;  3PO2 H;  1UE7 A;  5GAE C;  4OO1 G;  4DR4 L;  2KBN A;  3FP9 A;  1W2B A;  4DAY B;  1Z47 A;  1EQQ A;  3KDF B;  2ZJR A;  4YWL A;  2E2H H;  1WYD A;  3CCS A;  4OX9 L;  4BBS G;  5IP9 H;  4HIO A;  3I4M H;  3KYH C;  4UP9 A;  4X65 L;  1EIY B;  4B3R L;  1HNZ L;  1I3Q H;  3A5Z B;  1QVG A;  3GD7 A;  4IFD I;  1XMO L;  3BJU A;  4A3I G;  4L5T A;  1BBW A;  5M5Y H;  1CKN B;  1QZH A;  1K83 H;  1IBK Q;  1JJC B;  1EIF A;  1TWG H;  4NXM Q;  1L0W A;  1HNW Q;  4A3E G;  4LW1 A;  3GTQ H;  2CWA A;  1FJG Q;  2Q2U A;  4LWC A;  5IWA L;  5LMN L;  2NVT H;  1KAW A;  2K50 A;  2OTJ A;  1Z9F A;  3HOU G;  2XTI A;  1G29 1;  4KHZ A;  5GAD C;  4A3D G;  2C35 B;  1KQS A;  1J5E Q;  2PI2 E;  2K75 A;  1XMQ L;  1WI5 A;  4OO1 I;  4DV5 Q;  4QQB X;  5HGQ A;  3HKS A;  3ULJ A;  3F2B A;  1TWH H;  4LFA L;  3RLF A;  5IYC H;  1PH8 A;  2WB1 G;  4X66 Q;  1X3E A;  4DV6 Q;  1XNR L;  3S1M H;  1IBM Q;  1PFS A;  3D0F A;  4O0A A;  5AJ3 Q;  4C2M H;  2BH8 A;  1XNQ L;  2MFI A;  4IPC A;  3PIO A;  2F52 A;  2PMZ E;  1HNX L;  2A8V A;  5ELO A;  2GVB A;  3M9B A;  3UDF A;  4DV4 L;  3K8A A;  2UUB L;  5EAY A;  4KLK A;  1HZA A;  1QZG A;  3KF8 B;  3E0E A;  2UUC L;  2UXB Q;  1JB7 A;  4DV1 Q;  1L1O A;  4LUO A;  3GTJ H;  4GNX A;  2VW9 A;  1MJC A;  1M90 C;  4GLX A;  3PF4 A;  3DLL A;  5LMN W;  4A75 A;  1LTL A;  3HOY H;  1AE2 A;  2VY3 A;  3KF6 A;  4JI7 Q;  1OXX K;  3CC4 A;  3U4V A;  4RMF A;  2MO1 A;  3T1Y L;  4JI2 L;  1E7Z A;  1L1O C;  1N8R C;  4GNX C;  4EX5 A;  5FLM H;  1JJ2 A;  4AIM A;  4B3T Q;  1N32 Q;  3FHW A;  4OWX B;  1PH4 A;  3U58 A;  1KD1 C;  4KI0 A;  3J81 c;  1K8G A;  3J7A 5;  4LF7 Q;  5C3E G;  5IYC G;  3CAM A;  3DM3 A;  4GLV B;  2ZM6 L;  4A93 H;  3W5O A;  4DUZ L;  4A4I A;  1JMC A;  1HR0 L;  4WJ4 A;  2GVA A;  2FXQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...