4LW1A

Fragment-based discovery of a potent inhibitor of replication protein a protein-protein interactions
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
123
structure length
123
Chain Sequence
GSHMVGQLSRGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGNPVPYNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of a potent inhibitor of replication protein a protein-protein interactions using a fragment-linking approach.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/inhibitor
molecule keywords Replication protein A 70 kDa DNA-binding subunit
total genus 31
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2013-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04057 Rep-A_N Replication factor-A protein 1, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4lw1A00
1X54A 1U0LA 5GADC 3HOYG 4LFBL 2QEXA 1PH7A 2VNUD 4X66Q 2UUBQ 4LW1A 2K52A 2I0QA 1CKNA 4GOPA 3RZDH 2AWOA 1SFOH 1CSPA 5FJ8G 2EXDA 4BY1G 1HZ9A 5C3EH 4JV5L 3GTQH 1OXUA 4DR2L 1VQIA 2CWPA 4GS3A 3CW2C 2K4KA 3PCOB 4LUZA 4GKJL 1N32L 4DR4Q 3KJOA 4JI1L 3I55A 4LWCA 3F2BA 2R92G 1H95A 2VL6A 1X3FA 3ULLA 1UE5A 3K7AH 4AQYQ 4DV2Q 2NVTH 1VQDA 4A3IG 4OXPA 2KHJA 3KDFB 5IYDG 2E5LQ 4IFDI 4K0KQ 1OXVA 1VCIA 3PIOA 1BBUA 2PNHA 1XJVA 5ELOA 1OXXK 3ER0A 2QA4A 2WB1E 2HHHQ 4LF9Q 1VQ6A 5M5XH 2IX0A 4JI7Q 2OTLA 4DV7L 4XTCS 1VQ5A 1XNQQ 4HJ5A 4HJ9A 3TS2A 4LFAQ 1L2FA 4R4TA 3HOXH 5JJLA 1QZHA 5C44H 2YU9H 3L0OA 1PA6A 1K8GA 1VQLA 4B3TQ 1IBLQ 1PH9A 4A3FG 1SRUA 1N8RC 4GNXA 3ULJA 4DV4Q 4JI3Q 4YY3L 4HJ7A 1I5FA 4LF7Q 4BA2I 1HNWQ 1UE6A 2UXDQ 2KCMA 1EIYB 1FJGQ 4NXML 2OCEA 2IT1A 3CP0A 4A3MH 2H5XA 1HNWL 1N33L 3E9IA 4L5QA 1VQEA 2JK8A 2NZOA 2PQAB 3AYHB 3NELA 1K73C 5GROA 4RMFA 4JI6Q 4UY8C 3HOWH 4IPCA 2R6GA 1YHAA 4FDBA 4DK6C 1GM5A 1N34L 4BXXG 2MNAA 3CCJA 4PZ6A 3PO2H 3K80C 4DR6Q 4GOPC 5C4JH 1D7QA 3HOXG 2MQHA 3K8AA 3HOZG 4YHHQ 1E22A 1FGUA 2KBNA 5IE8A 4BY7H 2ZJRA 3HOVG 3PV0A 1YVCA 3TRZA 5HGQA 2UUAL 1VS0A 1EUJA 3OTOL 2LSSA 3K0XA 4R4CA 1E24A 2Q2UA 4R1JA 3CXCA 1GKHA 3T1YL 3KF6B 3H3VH 1VQJA 4GLVB 5BR8L 2E2JH 3BZKA 1MKHA 2UUAQ 4WJ4A 3PIPA 2Z0SA 4EQ5A 2EIFA 3H0GH 4LFBQ 4DUZQ 4HIKA 1J6QA 4BBRG 1HNZL 1X9NA 3CD6A 2N3SA 3TEHB 1C7YA 2YYZA 3VDYA 3FHWA 4OWWB 3G71A 3CAMA 4A75A 4IOCA 1SROA 1S3OA 2IX1A 3S1NH 3S2HH 2AWNA 3M3YH 3RR5A 1YBYA 2XGTA 2AHOB 3GTGH 4LFCL 4X64Q 1WJJA 3F1ZA 3HOVH 4JI2L 5M3FG 3TS0A 3L7ZC 2I5MX 1XMOL 1HNXQ 2Q2IA 1SR3A 3NENA 5IP7G 4C2MH 4IFDG 4DR2Q 1X3GA 2VW9A 1PH6A 1X55A 2JE6I 3CCVA 1XMQL 4A93G 2K5NA 1K3RA 1VQAA 4JI0Q 2NN6I 3PF4A 4LUOA 2UXDL 2Y0SE 5C44G 1JT8A 3PO3G 1V9PA 3WWVA 4DV7Q 3PO3H 4AYBE 4LUVA 2ID0A 2F52A 4X62Q 1A8VA 5C0XJ 3CCLA 1PFSA 1JMCA 1S72A 1GD7A 3FKIG 3FKIH 4XIGS 1Y1WH 4OWXB 1VQPA 1KXLA 1QUQA 3M85A 1VQ7A 2GN5A 4DV0L 2ALYB 3GDEA 1T9HA 4JOIC 3S2DH 4KHPL 1LTLA 3S1RH 1EOVA 1WOCA 5IT9c 1YJNA 1PYBA 3S17H 1P8LA 2E8GA 3KJPA 1B7YB 2MO1A 3NBHB 1L0WA 1VQKA 1I94Q 2GVAA 4L5SA 1L1OA 5EAYA 3I4OA 4OONA 3UDXA 1P16A 3HFZB 3I7FA 1IBLL 1U5KA 3U50C 3W5OA 1Q1EA 2BH8A 4BA1I 4A3BH 4YCWA 1QVGA 1NY4A 1IBKL 3OTOQ 3EN2A 4DPGA 4A4IA 4A3GH 4DK3C 2ZJQA 3TQYA 1EYGA 5GAHC 5LMUQ 2K75A 5J3BA 3F2DA 1HR0L 3E9HA 4HIOA 3S16H 3OW2A 4JBKA 1Z9FA 2L15A 5FLXc 1PHJA 2K14A 1L1OB 2R7DA 1KL9A 3HKZE 3J81i 4GN4B 4ALPA 1EQQA 1ASZA 1GVPA 1KRSA 3CCSA 1Y14B 4A3FH 3HOUG 1JJGA 3J7A5 4PG3A 1OXSC 4HJ8A 4YHHL 1SN8A 2K5HA 3B6YA 4GN3B 3BZCA 2UXCL 4GKKL 4B3RL 1HJPA 4BBSH 1PYSB 2JA6H 3H3VI 4KI0A 4A3MG 2JEBI 4X66L 1BKBA 2UUBL 4JI4L 1LM0A 2V1CC 2Q2HA 3U4VA 3JAMc 4DV3L 2VS1A 4GNXC 4JI6L 3ERSX 4YCVA 3AFPA 4DNIA 2CQOA 3I4NH 4P71A 3I4NG 4A93H 5DLQE 1KQSA 4IOAA 1LYLA 4P74A 1D8LA 1VQFA 4P75A 3UDFA 3RNUA 4JI7L 4GLAC 3D0FA 1XPUA 1BBWA 2RHQB 4R4QA 2ZTDA 1V1QA 1IBMQ 2EQSA 3GTPH 4X64L 1KRTA 2JA5G 4LFCQ 1VQOA 3GTLH 1XTDA 3T1YQ 2LXKA 2BH2A 1SLJA 1YHQA 5IYDH 4L5TA 1Q1BA 5LMNW 1E3PA 1VQ9A 1EWIA 4DV6L 4JG2A 5IY0A 2WB1G 2MFIA 2ZJPA 4LF6Q 1DGSA 4R4OA 4LF4L 5IYCH 3GTJH 4JC0A 2NVQH 3RZOH 4OO1G 4BBRH 1HNZQ 3HOUH 1J5EQ 3CMEA 4LF5L 1IL2A 1JJCB 1K8AC 3S24A 4DUYL 1PH4A 1YHBA 2WAQE 4Y7NH 4R4IA 4DV0Q 1K9MC 4LF4Q 4LF6L 5JEAG 4KHPQ 4K0KL 3PUVA 3KF8B 1Q46A 2JA8G 4ME3A 4PZ7A 3M7NA 2R7ZH 1HZAA 1JJ2A 4DUYQ 4J15A 1M90C 1IBML 2HIXA 3HKZG 4NXNL 3S1MH 5AJ3L 1N32Q 1E7ZA 4JBMA 3ICEA 1MJCA 1I50H 4DKAC 4DV6Q 2JA8H 4DAMA 3CF5A 4A3KH 4C3HH 5M5YH 3A5ZB 4JOIA 4C3JH 2AKWB 3W1GA 1YI2A 2R7FA 3E0EA 1KAWA 1L1OC 4MZ9A 4TVAB 1JB7A 1WI5A 3G48A 1KD1C 4B3MQ 4IPHA 3M4OH 1NJIC 4A3CG 4A3CH 1VQHA 1TWFH 1N9WA 2OQ0A 4P72A 4JI8Q 4B3SQ 4IO9A 4JYAQ 4YWMA 2C35B 4QGUA 3HOZH 3BU2A 5GAEC 1Q86C 2E2HH 2A19A 2HIVA 2KHIA 4LNQA 3T1HQ 1YEZA 4JI3L 4DAYB 2QGQA 1B70B 2Z6KC 5IYBG 5C0XI 4A3KG 1XNRL 4DV1L 3I4MH 4OO1I 5BR8Q 3CQZH 3J80c 3IRBA 1CKNB 3A5UA 4MNOA 4QQBX 1HZBA 4A3LG 3AFQA 3PUYA 1EIFA 5C4XH 2A1AA 4DR4L 1NMGA 4QIWE 2I5HA 5IP9G 4L5RC 4X65Q 4C3IH 1NTGA 3KOJA 3A74A 4NB3A 1HH2P 2MO0A 4DR6L 4GN5A 1FVIA 4YWKA 3TREA 3I2ZA 4IJHA 3OYYA 2B63H 5IYCG 4DR7Q 2D62A 5FLMG 4QJFA 4PZ8A 1XMOQ 1HNXL 3S15H 5M5WH 1G6PA 2NVXH 4GLXA 2UU9L 2JA9A 1QUQB 5IP7H 1KHIA 3L2PA 2F4VQ 1XMQQ 2NZHA 2IHEA 1NBWA 2KENA 2Y0SG 2E5LL 2GVBA 2VQFL 4AIMA 1PH3A 3AEVA 5M3FH 2ZTCA 5ELNA 4LF5Q 1A62A 4DV4L 4DR3Q 1ASYA 3MXNB 2UU9Q 5C4XG 3J81j 4UP7A 3PGZA 4JI1Q 4JI2Q 2ZM6Q 3CCUA 4Y52H 5JJIA 4GKJQ 4DR1L 4QL5A 3S1QH 3GTOH 1TWCH 2R92H 2CFMA 1M1KC 2R93H 1Q8KA 4A76A 4JI0L 5LMNQ 2JA5H 4KLKA 3CCQA 4APVA 1PH2A 2UXCQ 1FL0A 2N8NA 4BBSG 1W2BA 4WJ3M 4OX9Q 3H0GG 4YWLA 1WYDA 2HHHL 3ULPA 4LF9L 1HZCA 1WFQA 1YITA 2OWOA 1VQBA 4NPSA 3RLOA 5GQOA 2B29A 1IBKQ 3MEFA 4AH6A 2A8VA 1X65A 3DLLA 4HIMA 4A3EH 2IHFA 1G51A 3UDIA 1Y1VG 2N78A 4AQYL 4A3IH 1Q82C 5K36G 4GOPB 2VY3A 4H02A 4DR1Q 1K83H 4MTNA 3ZJYC 1C0AA 1UE7A 1HR0Q 4IJLA 4YY3Q 1I94L 1X6OA 4QY7A 1W3SA 3CCEA 1Z47A 2WP8J 1YJWA 1A63A 3H15A 4A3DG 4JYAL 1Y1VH 5C3EG 1O7IA 3AQQA 1AE2A 4DV5Q 2WAQG 1CUKA 3UE1A 4O2DA 4DV2L 4A3GG 2R7ZG 2YV5A 1QVCA 2VZAA 4DV1Q 4DV3Q 1Q81C 1UE1A 2JJQA 2YTVA 5LMUL 1AH9A 3JAMi 1JE5A 4B3TL 1EQRA 1Y1WG 1MIUA 2I5LX 1YJ9A 2UUCL 2RCNA 1IXRA 1LUZA 3KF6A 3CPFA 1NMFA 2PI2A 2NN6G 1A0IA 3PUWA 2HQLA 4JBJA 3U4ZA 5C0XG 4LFAL 2F4VL 4BXXH 1IYJB 5HY6A 3PUZA 4PMWA 5FLMH 3GTMH 1V43A 3SGIA 1B8AA 3STBD 5JJKA 4LF8L 1TXYA 1YZ6A 3J81c 4HJAA 1N36Q 1N33Q 4DR3L 4KHZA 4GNXB 3RN5A 1PH1A 3FP9A 4EX5A 1TWGH 2ATWA 4BY1H 4OWTB 4GKKQ 4YCUA 3CPWA 2VQEL 3GTKH 1C9OA 2CCZA 2UUCQ 5GAGC 1TWHH 1N36L 3HKSA 2PI2E 4RG1A 1CKOA 2RF4A 3F8TA 4P73A 1KIXA 1CSQA 4OX9L 3G4SA 3GO5A 2VQEQ 4A3JG 1PH8A 4A3DH 2DGYA 4IPGA 4UP9A 1MJEA 4DR7L 3S14H 1VQ4A 3PF5A 3J7ZC 4UPAA 4IPDA 1Q12A 1AE3A 3UE0A 3CMAA 2D0OA 1I3QH 2KCTA 3KDFA 2ZM6L 3HOWG 1R9TH 2NVYH 4X62L 1QVFA 1QZGA 2PMZE 5IWAQ 4DR5Q 4DUZL 2F3IA 1E1OA 2K5VA 5LMNL 3PUXA 1PV4A 1OXTA 4POGA 3M4PA 3K81C 1HR0W 3GD7A 4BY7G 1PH5A 2DUDA 2VUMG 2BA0A 1RL2A 3EBEA 4JI5Q 1KC8C 2VUMH 1SMXA 3W1BA 5H1SE 1I6HH 1G291 4DR5L 3NEMA 1J5EL 2XTIA 1GO3E 3G6EA 3CCMA 4TQUS 3I56A 1VQNA 2N49A 3JC66 1VQCA 2RHSB 1VQ8A 3CC4A 3HOYH 1SE8A 4A3LH 2OTJA 1EFWA 3RLNA 3M9BA 2AMCB 4UP8A 2JEAI 1XNQL 5IWAL 3BJUA 1UWVA 3A0JA 3RN2A 5AJ3Q 1XNRQ 1CKMA 4NXNQ 2D0PA 1IZ6A 3M4QA 3F2CA 2UXBL 4A3JH 2PQAA 4JV5Q 4DV5L 1Q7YC 2CWAA 2JA7H 3CCRA 3CC2A 1XPRA 2B3GA 4NXMQ 2YTYA 1UEBA 3J80i 2HT1A 2OQKA 2B63G 3T1HL 1E1TA 4HIDA 2UXBQ 4B3ML 1X3EA 3DM3A 2BA1A 1WCMG 3LGJA 1WCMH 1S40A 4B3SL 3Q8DA 2YTXA 1YIJA 2R93G 4JI8L 3STBC 5FJ8H 1PVOA 1FJGL 2ASBA 4X6AH 1K0RA 2LXJA 4LF8Q 2K50A 5M3MH 5M3MG 2Z6KA 5IYBH 4JI4Q 1VQGA 3I4MG 2FXQA 3K7UC 5E7NA 4JBWA 2JQOA 1TWAH 3RLFA 2VQFQ 2E2IH 4B3RQ 1OTCA 3KFUA 4A3EG 3D31A 1N34Q 1X56A 1RIPA 5IP9H 4LF7L 3EIVA 5JEAJ 2IY5B 1NE3A 2JA6G 1VQMA 3U58A 4POFA 3PSIA 4X65L 3CC7A 4JI5L 2JA7G 3UDGA 1BVSA 2CKZB 1XPOA 3KLWA 3PO2G 4IFDJ 2WFWA 4O0AA 4A3BG 2ZTEA 3KYHC 2Q2TA 2ES2A 4JCVE 1YNXA 4AYBG
chains in the Genus database with same CATH superfamily
5GADC 3HOYG 2VNUD 2QEXA 4GOPA 1CTMA 1HZ9A 3IL8A 2A69C 4DR2L 4JI1L 2VL6A 1X3FA 1UE5A 3K7AH 1VQDA 4A3IG 4OXPA 2E5LQ 2F0OA 5G3LF 2PNHA 2A6ED 3L3OC 2QA4A 1NR2A 5M5XH 2NVQB 4DV7L 4XTCS 3HOYB 2RCFA 1XNQQ 3TS2A 1H9MA 1PDQA 4ZQ3A 3I73A 1QNKA 3KLRA 1IBLQ 3K57A 5EBCA 4A3FG 4J6HA 4JI3Q 4DV4Q 4FXGC 1UE6A 2UXDQ 2KCMA 3TMEA 4NXML 1GUOA 3BDOA 2M2LA 1BDOA 2DN8A 2L12A 1N33L 4UY8C 4XYOA 2R6GA 1YHAA 1GUGA 4C3HB 3K80C 4DR6Q 2CHBD 4CDEC 4YHHQ 4BY7H 2QILA 1JC7A 4I7AA 3TRZA 1EUJA 2LSSA 1SDFA 1VMPA 4HMIA 4R1JA 4GLVB 2YU9B 3K5OA 4I65A 3T51B 4R9WA 4EQ5A 2BDOA 1L0YB 3OHXC 3E5SA 2ZT9C 4RH6A 3TEHB 3C46A 1SEBD 3CAMA 1TS2A 3S1NH 3DEPA 1H9SA 3MTSA 3RR5A 3HOXB 1GUWA 2XGTA 4G57A 3HOZB 1WJJA 3F1ZA 1JOOA 2I5MX 5LL6S 5ELFA 4A3JB 4DR2Q 1BXTA 4HTHA 5NUCA 2VW9A 1PH6A 3G7LA 5CGKA 2OXPA 2EYOA 5C4HA 1RHPA 1YNJD 3CCVA 1NSNS 2K5NA 1XMQL 1O7LA 4LUOA 1HTPA 1XX8A 2Y0SE 3PO3H 1K8OA 4AYBE 3WOFA 2F52A 3KLSA 4DAYA 1E0BA 4ZK9B 3MXPA 3TP7A 1RTNA 1TT2A 2M9VA 2AQ2B 4KY6A 4ZCKA 1Y1WH 4JK1C 1KXLA 3LX0A 3M85A 3S2DH 2VB3X 4DV0L 4KHPL 1T9HA 1EOVA 3S17H 2E8GA 2Q8TA 2MO1A 4RWSC 2GVAA 1L1OA 5EAYA 1WTHA 4OONA 5KGUA 3HOUB 1P16A 3HFZB 1HXYD 5ELBA 3I7FA 1IBLL 1CFMA 3U50C 1B1ZA 4A3BH 3S2HB 1SNMA 1NY4A 4MN3A 3OTOQ 1ILPA 3S15B 4A4IA 4DK3C 3TQYA 1II3A 2PZTA 5GAHC 2BOSA 4HCSA 1EOTA 3E9HA 3QIAA 5FLXc 3H09A 5FKAC 2R7DA 1KL9A 2LMCB 4C3JG 1W6JA 4ALPA 3K6OA 1Q3LA 2XIWA 3HOUG 1B53A 4HJ8A 2K04A 2K28A 1KNEA 1G6ZA 3DUZA 4KI0A 4Q5VA 1D1KA 3U4VA 4GNXC 5L37A 1F9PA 1CT1D 3VYUA 1C8CA 1IYVA 2JN4A 3G6JB 2F0TA 4P71A 1KQSA 3HS0C 1KLGD 4P75A 3OPOA 2M00A 2PW7A 4GLAC 1LTGD 3D0FA 1BBWA 2ZTDA 4IUUA 1PTOD 2EQSA 1LT5D 2BH2A 1YHQA 3IKJA 4A3BB 3A7AB 5LMNW 3NUCA 1YNJC 2F0KA 4OO1G 4MHEA 1Z7TA 2PZUA 3HOUH 4WORA 1J5EQ 2K01A 1ET6A 4DUYL 1PH4A 4Y7NH 1AW7A 3PUVA 1Q46A 1STAA 3GTLB 5FLXL 3M7NA 1X3PA 3AU7A 4N9TA 4DUYQ 2I07B 1JJ2A 1M90C 3HKZG 2CH4W 3MZ5A 3BVGA 4H13C 4RCOA 4DV6Q 4DAMA 4K5WA 4A3KH 4C3HH 3A5ZB 4WJWA 2AKWB 2NTSA 4CKBA 5D14A 4TVAB 2A68C 3G48A 5EPJA 4IPHA 3M4OH 4A3CG 1K8MA 4A3CH 1JB3A 4DK0A 5KNBA 1N9WA 4RKLA 1SYDA 4IO9A 3D4DA 3H91A 3ONAB 4QGUA 3BU2A 2E2HH 5JPMC 2QDLA 4XYQA 4LNQA 4JI3L 4DAYB 2QGQA 4DV1L 3J80E 2EYFA 5C4JB 3I8ZA 1HZBA 4A3LG 1EIFA 2K1BA 1D5XC 4QIWE 4L5RC 4K8IA 1HA5A 2I46A 1D5MC 2ZXPA 2TSSA 4C3HG 3J7YW 4DR6L 3TREA 2LKVA 3NK9A 4IN3A 5C4ZA 5FLMG 3NPPA 3R8BA 1XMOQ 1HNXL 3NXWA 1SYCA 2XVSA 4NKLA 3HOVB 3I70A 3TZDA 4GLXA 2JA9A 2UU9L 3HRZC 2F4VQ 2XRSD 3MVVA 3Q23A 3IAYA 1G2TA 5EBDA 1ENCA 2KENA 3EA6A 3H6MA 2VQFL 4AIMA 3ZYYX 3SR1A 5DM63 1A62A 4DV4L 3SK4A 3R2IA 4UDUC 4RGOS 2LFNA 2R93H 5LMNQ 2UXCQ 4APVA 1TVXA 1PH2A 1UEAB 2QDBA 1EU3A 5JOBA 1WYDA 5HGTA 2X6LA 3E6ZX 1BQQT 5CBAE 2L9HA 3K5MA 4AH6A 1X65A 4HIMA 2IHFA 1G51A 5K36G 2LY7A 5IT9E 3ZJYC 1JQYD 4K6DA 3DEOA 1X6OA 1A63A 4JYAL 1RD9D 4QF4A 2F0QA 4HN7A 4DV2L 4A3GG 4P2CB 2HD3A 3MAQA 3JAMi 1Y1WG 1IL8A 1U4LA 1IHZA 2I5LX 1YJ9A 1IXRA 3CPFA 3AB9A 4JBJA 4LFAL 2HDLA 2HQLA 3SK6A 5HY6A 3PUZA 4PMWA 5CV8A 1CA5A 1V43A 3SGIA 1B8AA 1TS4A 2NVXB 1FNWA 5T1GA 4HJAA 2EYMA 4GNXB 4OGQC 3FP9A 1PZJD 2O5IC 4EX5A 4ZKCB 3F2UA 2ATWA 3CPWA 4LJZC 1D5ZC 4A3GB 1C9OA 1I4RA 2X69A 4P73A 4OX9L 3GO5A 4EQPA 4UP9A 1MJEA 4B9WA 4XQNA 4DAVA 3IFTA 1Q12A 2F0WA 3SVMA 1R9TH 4X62L 5FK9C 1QVFA 5IWAQ 1E1OA 1PV4A 2Z6BA 4X3KA 1HR0W 3GD7A 2A69D 2EOTA 1EYDA 4DR5L 3NEMA 5G3LD 4TQUS 5I2YA 3I56A 2N49A 1SXTA 3CC4A 1S5CD 3M9BA 2AMCB 4J8QA 1CI3M 1GJXA 1XNRQ 1CKMA 3M4QA 1H9JA 2K5QA 5IGDA 2PQAA 1CZWA 4K5XA 3CCRA 4NXMQ 2B3GA 2L1BA 1XYIA 4RAUC 1U9RA 2JA6B 4ID6A 4B3ML 5JPNC 2N55A 1SYFA 1EQTA 1ET9A 5I2XA 3J7AF 4B3SL 5JEAH 2YTXA 1YIJA 1IW7C 1FJGL 1LTID 1AN8A 5M5XB 2LXJA 3I4MG 1VQGA 2EJGC 3DWAA 4F87A 4JBWA 3Q24A 3A55A 4IFDH 3RLFA 2VQFQ 4B3RQ 3OOCA 5C5LA 1TKWB 1N34Q 2ZXRA 1RIPA 2SDFA 5IP9H 4LF7L 1EY8A 2F3WA 5HURA 3CC7A 1WTXA 4UAIA 2JSOA 3KF8A 2Q2TA 1SJED 1SNPA 5K36H 2B2UC 5LL6X 2JA7H 3OWFA 4X3SA 2F0DA 2WACA 4CHTB 2UUBQ 2IW3A 3RZDH 4RGMA 3VA5A 4A3EB 4BY1G 4G7HC 4X3TA 2CWPA 3CW2C 2K4KA 4LUZA 4DR4Q 3I4LA 2R92G 1H95A 3ULLA 4DV2Q 3KDFB 4IFDI 1EY0A 1OXVA 5ELOA 2F0PA 4JI7Q 2OTLA 5A2QL 1JWMD 1VQ5A 5E4XA 1ZKOA 1L2FA 4R4TA 3HOXH 5JJLA 3FDTA 3NQIA 2YU9H 3L0OA 1PA6A 1VQLA 4B3TQ 2CH4A 4ULLA 1DONA 1SRUA 1N8RC 2BE5D 4GNXA 1HNWQ 4YY3L 4HJ7A 3GTOB 4Z9CB 1FJGQ 1STBA 1BUVT 1M4VA 2WINB 2H5XA 3VR6A 3AYHB 3NELA 4JI6Q 5GROA 4M8AA 4DK6C 2EZVA 1N34L 1BOSA 2NN6H 3O13A 4PZ6A 4CDDC 3PO2H 1EY5A 3SEBA 1FGUA 2KBNA 3A8JE 2ZJRA 5HGQA 2UUAL 3K0XA 1E24A 1A2TA 3CXCA 3T1YL 2E2JH 2E74C 5C4XB 2PNRC 4HIKA 3CD6A 3VDYA 1EEID 4TRDA 1A15A 3G71A 3TN2A 4A75A 3IFDA 1S3OA 3HEJA 3S2HH 3TP5A 3GTGH 3QO2A 4X64Q 1K28A 1Q90A 2Q2IA 2F0HA 4EQOA 5IP7G 4C2MH 3BYYB 2K6AA 3J81L 1R4QB 2UXDL 3PO3G 1CA6A 5E3FA 4LUVA 4BBRB 3CCLA 4XIGS 2QF7A 3FKIH 2IWHA 4L8JA 2GN5A 2ALYB 3GDEA 1LTLA 3S1RH 1YJNA 1PYBA 4RFBA 1P8LA 3DMUA 4HSPA 4OO1H 3UDXA 2KCCA 5F2DA 4EGVA 4RA8A 1PZID 2VB2X 4HSVA 4BA1I 3GV3A 4A93B 3J80L 1EY9A 3OMCA 1IBKL 3EN2A 4DPGA 4A3MB 3M7GA 2F0VA 2B2VC 5J3BA 3F2DA 1HR0L 3W2DA 4HIOA 3QB3A 3QG1A 3OW2A 1NNXA 2AUKA 5IGGA 3S16H 1Z9FA 2L15A 1EZ6A 1KNAA 2K14A 4YIJA 5ELCA 4GZYC 4NMZA 3HKZE 1Q8IA 4Q0FA 1TIID 4UHVA 1ASZA 1GVPA 3CCSA 5I9OA 1B3AA 4DXFA 3J7A5 1I4GA 3BDCA 1B3QA 3DWQA 3B6YA 4GN3B 3KK7A 2CQAA 4B3RL 1IW7D 1H9KA 2JA6H 4A3MG 1EIHA 1BKBA 5EKLA 3M4OB 3GTJB 2V1CC 3JAMc 4MTKA 4JI6L 2VS1A 2MHVA 3NWSA 2EDGA 1AZPA 2E76C 1YNNC 4YCVA 1CM9A 1SYBA 1EY7A 5COYA 1UAPA 3I72A 5EPLA 1QCBD 4JI7L 3ND9A 1XPUA 2RHQB 1V1QA 2IJ0A 3GTPH 4LFCQ 3D6CA 1VQOA 3GTLH 1XTDA 3TDQA 5ELDA 4DU9A 4L5TA 2IX3A 4CGYB 4ZKBB 1EWIA 4DV6L 2BCOA 2WB1G 4LF6Q 1DGSA 4R4OA 2NVQH 3GTJH 3RZOH 3EVQA 4AYBB 2WKCA 1HNZQ 4LF5L 1JJCB 3S24A 4LF6L 2WAQE 1V1OA 4R4IA 4DV0Q 4KHPQ 5JEAG 1KAAA 4IURA 2KHSA 3H3VC 1RJTA 1WTVA 4J15A 5CV7A 3A8IE 3RZOB 1HQRD 3ICEA 1MJCA 3CRKC 4DKAC 1ICWA 2DJFC 3NHHA 1GUSA 2SNSA 2C9OA 4O1NA 1TQOA 2R7FA 2F0EA 1J8IA 5EPKA 1KD1C 4B3MQ 1TWFH 2PO4A 4JVZA 2OQ0A 4P72A 4JI8Q 2JP1A 3PMFA 3BVZA 5GAEC 2HIVA 2F0UA 2KHIA 3I90A 5CV6A 3T1HQ 2Z6KC 5C0XI 2JA7B 5BR8Q 2ENBA 1JICA 2KECA 1TY0A 4V190 1ONLA 2A1AA 2R3ZA 2I5HA 5DNFA 2E2DC 3J7AV 2RDHA 3KOJA 2MO0A 4KN7C 3JAME 2QKIC 1PTOF 3R93A 4KKTA 2B8FA 5IYCG 5EGTA 3GV6A 3S15H 1G6PA 2X6GA 5FO9B 3RUZA 1GHJA 2V4DA 5IP7H 1KHIA 1JCKB 2IHEA 1HTLD 1RCVD 1NR4A 2E5LL 3S2DB 3VR4A 2F0SA 2H1EA 1PH3A 1T5EA 4CJ0B 4LF5Q 4X3UA 1NCVA 1LTBD 1QB5D 4JI1Q 3CCUA 5IT9L 3A7LA 4U673 4A3DB 3S1QH 4L63B 1WD0A 3FMCA 1Q8KA 3ERQA 1GXDC 2JA5H 4KLKA 3CCQA 2N8NA 1W2BA 4WJ3M 4YWLA 2SNMA 4ILWA 1YITA 1F2ZA 4KN4C 1VQBA 5GQOA 2E2IB 3KLSX 3MEFA 2A8VA 4AQYL 2PPBC 1Y1VG 1EYAA 4H02A 1K83H 1VF5C 2B8GA 5IGBA 2OEOA 4IJLA 1GOZA 1I94L 2QCPX 3CCEA 1Z47A 4FF3A 4A3DG 4C1NI 3DM1A 5JAVA 1AE2A 1TWGB 4DV5Q 1CUKA 5DEHA 1JR0D 3UE1A 3SK8A 2R7ZG 1QVCA 4DV3Q 1SMYC 1DZ1A 1Q81C 1UE1A 2YTVA 1UUPA 2Z4HA 4C3IB 1AH9A 2PW5A 1EQRA 1WTWA 5IGCA 2PI2A 4PMBA 4BXXH 1A0IA 1RF2D 5C0XG 3VR5A 1STGA 3STBD 1Y8NB 5FOBB 2EJMA 1N36Q 1N33Q 4DR3L 1PTOC 4KHZA 3RN5A 2OF1A 1PH1A 1TWGH 2A6HD 5BN4A 1MBYA 4BY1H 4OWTB 4GKKQ 4YCUA 3GTKH 2CCZA 3V96A 3X3MA 2CVRA 4RG1A 1CKOA 2RF4A 1JWSD 2K5WA 1CSQA 3G4SA 3LWUA 4A3DH 5A35A 1PH8A 4IPGA 4DR7L 5TSSA 4E6IA 1VQ4A 3S14H 3LWEA 5J1ZA 4UPAA 2EYLA 3UE0A 1I3QH 1VDZA 2ZM6L 3HOWG 3PQIA 2KOLA 3NQTA 2PMZE 3FKIB 4DR5Q 4DUZL 2F3IA 5LMNL 1YNND 3PUXA 4KHVA 3K7AB 2DUDA 1V1PB 4OELB 4JI5Q 1RL2A 2VUMG 2VUMH 4OIKA 1I6HH 3W1BA 1J5EL 1TU2B 5I6YA 1I4HA 1PZKD 1VQ8A 3HOYH 1SE8A 3M3YB 2F0GA 4UP8A 1LACA 1XNQL 4FNFA 5IWAL 3A0JA 5AJ3Q 4NXNQ 2D0PA 2P5ZX 1PXUA 1Q7YC 1WTRA 2FJ2A 3A56A 3VYRA 3CC2A 2K05A 2YTYA 2HT1A 2VUMB 1I6HB 2B2TA 2FFKB 3BVMA 4K2LA 1X3EA 5BN5A 1TWFB 4DNTB 1F2LA 2R93G 4JI8L 4FO2A 3STBC 5ELEA 1PVOA 1DXMA 4X6AH 5M3MG 1ESRA 3K7UC 5E7NA 1U4RA 4IALA 2JQOA 1ENAA 1TWAH 4O42A 1UNSA 3GTKB 2IY5B 2L0CA 3PSIA 3UDGA 1WCMB 1BVSA 2A68D 4A3IB 3SK5A 4Y7NB 4HR7B 4A3BG 1LV9A 2LS01 1U0LA 2DNEA 4LFBL 4X66Q 4LW1A 2K52A 2I0QA 1CKNA 2OT2A 2B2YA 4ZRZA 1CSPA 1NUCA 2EXDA 3M4YA 1IYUA 3EFXD 3MA2B 2JA8B 4JV5L 3GTQH 1OXUA 5KRUA 1VQIA 3TBIB 3PCOB 1LTRD 3KJOA 5D65A 2NTTA 2NVTH 2Y0SB 2KHJA 5IYDG 1VCIA 2EY1A 2A5HA 1XJVA 1RTOA 3T13A 4HCEA 1VQ6A 2WB1E 2HHHQ 3ND8A 1Z6HA 1DJRD 2IX0A 2RSOA 4HJ9A 1CQVA 1I4XA 3GQBA 4IUVA 5I4DA 2EY6A 1E2WA 5CMDA 1S4ZA 3GTQB 3MXNA 3CHBD 1PH9A 1DD2A 1CHQD 4ME5A 4LK1C 4FVMA 1LT6D 4LF7Q 1R9TB 1HCZA 3QOJA 3T4AC 2OCEA 1ICFB 2EXZA 2XRQD 2IT1A 2RQXA 4A3MH 1HNWL 3JAML 1DCZA 3E9IA 4L5QA 4ZAIA 3TP6A 1VQEA 2JK8A 2NZOA 2PQAB 3EQLC 3HOWH 4FDBA 2MNAA 1QWYA 5M5YB 4GOPC 2NB0A 3HOXG 4FXKC 2MP1A 3HOZG 2R7ZB 3S1RB 5LHY1 2A6EC 3C2PA 5IGFA 5IODA 4A3FB 5FLXE 3HOVG 3PV0A 4CJ2C 4KD4A 1VS0A 4I7ZC 4R4CA 2GA4B 4F88A 1QJOA 2Q2UA 3KF6B 1VQJA 3H94A 3BZKA 1FYCA 4XQJA 5C44B 3PIPA 4LFBQ 3NSWA 4DUZQ 2E75C 1F9RA 2B2WC 2KEDA 1TY2A 4B9XA 4OWWB 2ICEC 4IOCA 4F7XA 2IX1A 2AWNA 3M3YH 1YBYA 3P20A 2AHOB 3HOVH 1MGSA 5M3FG 3L7ZC 5CV5A 1SR3A 3NENA 3V05A 1EFID 5C3WA 3NBIA 3Q0AA 4IFDG 4R8NA 3T53B 1X55A 2JE6I 2UXCL 2PMZB 1K3RA 1VQAA 1JT8A 4ODGA 5C44G 5D3IB 1V9PA 4DV7Q 4R8IA 1A6XA 1S5FD 1WD1A 1A8VA 3C1FA 1SYEA 1JMCA 1GD7A 3FKIG 3E3XA 1VQPA 1SMYD 5J39A 3RD4A 1PRTC 3I3CA 5JVG3 5IT9c 1WOCA 1VQKA 3KJPA 1B7YB 3NBHB 1L0WA 4L5SA 2K7VA 1B2TA 1QOHA 1U5KA 5EKKA 1Q1EA 1QVGA 4QB4A 3R3OA 4DNRB 5LMUQ 2K75A 3GTPB 2PZWA 1FR3A 4JBKA 2KVMA 3I4NB 1QILA 2FMCA 4IUNA 3J81i 4GN4B 1U4MA 5KYIA 2HCIA 3SHLA 2DY8A 2O2LD 4PG3A 3HP3A 1H9SB 4DXGA 3CQZB 4YHHL 1SN8A 2K5HA 4IQZA 3BZCA 1PYSB 3H3VI 4FXDA 2JEBI 4X66L 4XDXA 4XT3B 4JI4L 1LM0A 2Z9HA 3SDZA 5E4WC 3FVQA 3T56B 3A8KE 1A3VA 2CQOA 4DNIA 3I4NG 3I4NH 3WOEA 4A93H 4P74A 1VQFA 3RNUA 4R4QA 1IKLA 1IBMQ 1KRTA 1K0SA 1SLJA 3BYTB 5IYDH 1WVLA 1Q1BA 3N52A 1VQ9A 2HDMA 4JG2A 1JWUD 1JJGA 3NTKA 5IYCH 2XN9C 4JC0A 1IKMA 2B2VA 4BBRH 4C56C 3D4WA 1CQFA 2DJGC 1YHBA 2EJFC 4K0KL 2JA8G 2B2YC 4N8X1 4HMJA 3S1MH 5AJ3L 5IGEA 4JBMA 2F0IA 1H9RA 1STEA 1I50H 1MSHA 1RKNA 3CF5A 5M5YH 4JOIA 4C3JH 2L11A 3W1GA 3E0EA 3P1HA 1KAWA 4CJ1B 4MZ9A 4KTAA 1WI5A 1DOMA 4IUPA 3J81E 1NJIC 2VXWA 1TWAB 1LT3D 3EROA 3QWNA 4JYAQ 4YWMA 3C1EA 1K3BC 2C35B 3GTGB 1Q86C 2TMPA 5ISRA 5CYUA 3HKZB 4K6LA 3V2TA 4DAPA 3KBGA 1YEZA 2FHTA 1B70B 5IYBG 1XNRL 3KBXA 4OO1I 3A5UA 3NTHA 1EZ8A 1TS5A 3PUYA 5C4XH 4OL7A 1PLFA 2E2JB 1WTQA 1NMGA 3W3AA 3K59A 4X65Q 4V0BA 1E2VA 3A74A 1HH2P 1QE6A 2BE5C 4GN5A 5C3XA 3I2ZA 4IJHA 4DR7Q 2D62A 5KIXA 4QJFA 1B44D 5M5WH 2B2UA 1TWCB 2R92B 1ILQA 3L2PA 2AQ1B 1BF4A 1G8ZD 1NBWA 1B50A 2XNAC 3AEVA 2ZTCA 2NBFA 1Y8PB 3MFYA 4DR3Q 1ASYA 2RA4A 4C1NK 2ZM6Q 3MC0B 4Y52H 5JJIA 3D3RA 4QL5A 1SNDA 2Z4IA 2PQEA 1TWCH 5C3EB 5CBEE 1AEXA 2CFMA 2R92H 3UI2A 3GTOH 4JI0L 2WAQB 1FL0A 3H0GG 2A74C 2WIIB 4LF9L 5M3FB 3ULPA 1HZCA 1PFBA 3RLOA 1D1IA 2F1MA 1XWEA 3DLLA 4A3EH 3UDIA 1Q82C 2N78A 3FEWX 2VY3A 4DFAA 4DR1Q 1C0AA 4RKBA 3GTMB 4YY3Q 5M5WB 1SE2A 1W3SA 2WP8J 1YJWA 2EE1A 5KEEA 1Y1VH 1SE3A 5C3EG 1O7IA 3AQQA 4G7ZC 2WAQG 5EQ0A 1LLRD 3DWPA 3VR3A 4DV1Q 4BS9A 1L0XB 3D8GA 4B3TL 5DM73 3L9AX 1HUMA 3VA7A 1PTOH 3PUWA 3A54A 2J7ZA 4NDXA 1IYJB 2Q8RE 1BCPF 5JJKA 1TXYA 2BDNA 3J81c 1RDPD 1SJHD 4EQNA 4OHJA 5CV9A 2VQEL 2MGSA 4C3JB 1K83B 3OMGA 2UUCQ 5GAGC 1TWHH 3BDLA 3HKSA 1N36L 2PI2E 2F4IA 1KIXA 2IL8A 4RGNA 2VQEQ 1PRTB 2RBMA 2SOBA 3MEHA 1R4PB 3J7ZC 1F2MA 2J0TD 3PO3B 3BS1A 1BCPD 5KYLA 2F0LA 2EY2A 2HQEA 2NVYH 3S1MB 4KD3A 3HG9A 5M9OA 2KUMA 2KCNA 3S1QB 4KMUC 1OXTA 2KQ3A 4BY7G 1PH5A 3BG3A 3EBEA 4CDFC 3D6WA 1SMXA 5H1SE 2D2CC 1S5ED 1GO3E 3G6EA 1VQNA 3JC66 2RHSB 4RCNA 2Z8LA 4KKUA 1LO5D 1EYCA 4A3LH 2DNCA 4C2MB 1EFWA 2OTJA 4JPBW 1HUNA 2XWJB 1FNUA 3RLNA 2A6HC 2O4XA 1IZ6A 5CV4A 4WFN3 3VYTA 3QR8A 1BCPB 4DN4M 4JV5Q 4DV5L 1SYGA 1O7ZA 5BN3A 3URYA 3CKIB 5IIFA 3K0YA 1UEBA 3J80i 3ITPA 1MD2D 2OQKA 3T1HL 1GHKA 2UXBQ 4HIDA 4U68A 3NE5B 2F0NA 2BA1A 3LGJA 2PCFB 3NWTA 5FJ8H 3PO2B 4CBVA 3S14B 1U4PA 2ASBA 2Q8IB 4LF8Q 2K50A 5M3MH 4OEMB 3MWYW 2FXQA 1D6EC 1TS3A 1OTCA 3KFUA 2NVTB 4A3EG 1PFMA 4BY1B 1X56A 2JXMB 4RHSA 5JEAJ 1NE3A 4KJOA 2JA6G 3U58A 4POFA 1SAPA 4X65L 4JI5L 3MXGA 1RODA 4PNYA 3K5LA 2CKZB 1XPOA 1JORA 3TZUA 3PO2G 4IFDJ 2WFWA 4O0AA 2ZTEA 2Z1CA 3QJYA 1J9OA 4FP5D 4DK1A 2ES2A 3I4MB 1BNZA 4AYBG 1X54A 1PH7A 5T1IA 2AWOA 1SFOH 5FJ8G 1STNA 3AMUA 3FPPA 5C3EH 5I9PA 3P7JA 1D2BA 4GS3A 4GKJL 4NP5A 1N32L 1EY6A 3I55A 4LWCA 3F2BA 2K03A 4AQYQ 3DXJC 1HHVA 2NWGA 4K0KQ 3RZDB 3PIOA 1BBUA 1GUNA 1F2YA 4CKCA 4WRDA 1CK1A 4PV1C 1OXXK 3ER0A 4LF9Q 1CZGA 4HJ5A 2J4XA 4LFAQ 3VYSA 2EPBA 1QZHA 2K32A 4H0LC 1B9NA 5C44H 1K8GA 3H0GB 4LMQD 3S9WA 5FO8B 3ULJA 4LAAA 4G4KA 4PMCA 1ZYRD 1I5FA 4BA2I 4KV6A 1EIYB 1LTSD 4PQXA 2F0MA 3CP0A 4IUTA 1KDBA 1HFGA 2EYPA 1K73C 4RMFA 4RGTA 1KLUD 4IPCA 1GM5A 1JOKA 2RDFA 1BBXC 4BXXG 3FPUB 3CCJA 1PTOB 2CW0D 4KY5A 5C4JH 3Q22A 1D7QA 2MQHA 3NTIA 4B08A 3K8AA 1EL0A 1E22A 5IE8A 2B2TC 1YVCA 1Y1WB 3OTOL 4FF4A 4JW0A 1SNOA 1EWCA 1GKHA 3H3VH 1SNQA 2NYZD 5BR8L 3K58A 1MKHA 3PIP3 2UUAQ 4WJ4A 2Z0SA 2EIFA 3H0GH 1J6QA 4BBRG 1I3QB 2IPKD 1X9NA 1HNZL 2N3SA 1C7YA 2YYZA 1PRTF 3FHWA 3QOLA 4XXEA 2AQ3B 1SROA 1G91A 4LFCL 4XT1B 4JI2L 1HQMC 3TS0A 1T5XD 1XMOL 1HNXQ 1DOKA 2KJXA 1SBBB 1X3GA 4A93G 4JI0Q 3PF4A 2NN6I 4CKEA 3WWVA 1BCPC 1W6KA 2ID0A 4X62Q 1FD7D 5C0XJ 3VR2A 1PFSA 1S72A 1JE4A 4OWXB 1QUQA 1VQ7A 4JOIC 5C5MA 4BY7B 4DGZA 4IUQA 4K14A 1I94Q 3I4OA 1EWHA 1B4OA 4KKSA 3W5OA 2BH8A 1EU4A 4YCWA 1SSOA 5KNDA 4H44C 3N6RA 1A3TA 4A3GH 1DYQA 2ZJQA 2EYHA 1EYGA 1HPCA 4KY7A 1BO0A 3Q6SA 5IOCA 1MSGA 1PHJA 1L1OB 3CU7A 3P75A 1HRJA 1O78A 1DM0B 3SXHA 3K5NA 3OSOA 1EQQA 1KRSA 4A3FH 1Y14B 2ICIA 3OIPA 1OXSC 2FINB 2JA5B 2QEJC 4GKKL 1HJPA 4BBSH 4QIWB 4QUCA 2UUBL 2XSCA 2F03A 2Q2HA 4DV3L 4KJNA 3ERSX 2FMMA 1Y69U 2PYKA 1LABA 3AFPA 2MUYA 1QNUA 5DLQE 1V1PA 4IOAA 1LYLA 1D8LA 3UDFA 1PYWD 4FF1A 1KDAA 1S5BD 4FF2A 4X64L 1PFNA 2JA5G 1SFOB 3T1YQ 2LXKA 1X32A 5J22A 4DF7A 1E3PA 5IY0A 4ABNA 2MFIA 4N9PA 2ZJPA 5C0XH 4LF4L 1JOQA 1SNCA 2L55A 3CMEA 1WTOA 1IL2A 1K8AC 2EY5A 4LF4Q 1K9MC 1XTCD 1HA6A 4QMGA 3I91A 3KF8B 1ZYRC 1F9QA 4ME3A 4PZ7A 2R7ZH 1HZAA 1IBML 2B63B 2HIXA 5AFWA 4NXNL 1N32Q 2G9HD 2RDGA 1E7ZA 5JVH3 1O7YA 2JA8H 3E0JA 1XXGA 5EKIA 1YI2A 1TWHB 5CR3A 3HGBA 2CW0C 1L1OC 2SEBD 1JB7A 5CORA 1ENFA 2A73B 4ZLTF 1LTAD 1VQHA 2H4OA 2O5JC 4ZUIA 4B3SQ 3HOZH 5DAUA 2A19A 5C6AA 2G9DA 1VMCA 3X3NA 3I4MH 4A3KG 4G7OC 3CQZH 3J80c 1C4QA 1EY4A 3IRBA 1CKNB 4MIUA 4OIJA 4MNOA 4QQBX 1VF7A 3AFQA 4F8MA 4DR4L 5IP9G 4TKOB 5A2QE 4C3IH 1NTGA 1A2UA 2B2WA 3KUPA 1WTPA 2K5DA 2HUGA 4H7BA 4NB3A 3C3LA 1DOLA 1C48A 1FVIA 4YWKA 2B63H 3OYYA 4PZ8A 3TP8A 2NVXH 2WKDA 1QUQB 4A3KB 3U9SA 1XMQQ 2NZHA 3CRLC 4XQQA 2Y0SG 1EQVA 2GVBA 2NZ1D 4QCLA 1I4PA 5M3FH 5ELNA 2UU9Q 5K5PA 1I6VC 5C4XG 3MXNB 2NVYB 3J81j 4UP7A 3PGZA 4JI2Q 1HFNA 1EEFD 4GKJQ 3DHQA 3LNNA 4HEDA 4TSSA 4DR1L 1O80A 3BZDB 2JYOA 1F9SA 4L6TB 1M1KC 4A76A 3S1NB 2B39A 4DA2A 4NW2A 4BBSG 4OX9Q 2QW7A 1B9MA 2HHHL 1WFQA 4C3IG 2OWOA 4NPSA 3OIQA 2B29A 4RHRA 1IBKQ 1AFPA 2N88A 4A3IH 3GP7A 4GOPB 4KK7A 4MTNA 1UE7A 1HR0Q 1FNVA 1EIGA 4QY7A 2AUJD 4HAEA 2RKSA 1CHPD 3H15A 4K5VA 1X3QA 4O2DA 2K33A 4K8JA 3RMHA 4CDCC 4BBSB 2YV5A 2VZAA 2JJQA 5LMUL 1JE5A 3R2TA 2UUCL 1MIUA 2RCNA 1LUZA 2NUCA 3KF6A 1NMFA 1Y1VB 2NN6G 1GUTA 3U4ZA 2F4VL 3U9OA 1A3UA 5FLMH 2L4NA 4N8FA 3HOWB 1ML0D 3GTMH 1PRTD 4LF8L 1YZ6A 3HZXA 5FO7B 2F0JA 2KA7A 1OO9B 4J1MA 1NAPA 1ZEQX 5I6WA 2WV6D 2D9UA 3EJIA 3F8TA 1ZXTA 2HCCA 1PMRA 4A3JG 1I50B 1G2SA 2DGYA 3PF5A 1Y8OB 4FYDA 4IPDA 3FRPB 1AE3A 3CMAA 2D0OA 2KCTA 3KDFA 1QZGA 3D4RA 2DY7A 2D5DA 2K5VA 1S5DD 4K2KA 4ZUJA 3WDNA 3M4PA 3K81C 4POGA 1QG7A 1TR5A 1AP0A 2L5TA 3S17B 2BA0A 3NBHA 1KC8C 1G291 1STHA 1I4QA 2XTIA 2KEEA 3CCMA 3MHBA 1LT4D 1VQCA 4S3SA 1KABA 3MFGA 1STYA 5D3DA 2JEAI 1SE4A 3BJUA 1UWVA 2WB1B 2EYJA 4M1UB 3RN2A 5M3MB 1KTKA 3F2CA 2UXBL 4A3JH 1FGBD 4EVOA 3MXUA 1LTTD 2CWAA 2MPMA 2EVBA 1XPRA 1KDCA 2XWBB 2B63G 1E1TA 1ESFA 2R61A 3DM3A 3NP8A 4IZ8A 1WCMG 1WCMH 1S40A 2F0FA 3Q8DA 2RSNA 4QUFA 2F3VA 1K0RA 2MJ8A 3PIO3 2E2HB 1BR9A 5IYBH 4JI4Q 2Z6KA 5EJWA 1AZQA 3S16B 3SE0A 4ZYSA 2G5DA 5JJZA 2E2IH 3D31A 3EIVA 1M8AA 3OWEB 1VQMA 1V8QA 3OW7A 2JA7G 5KNCA 3TSSA 2C5CA 1F77A 2RVLA 4BWGB 1MI2A 2ZXOA 2R93B 3T16A 3KLWA 5E1FA 1MHWC 3KYHC 5CC4A 4JCVE 1YNXA 1E2ZA
chains in the Genus database with same CATH topology
1X54A 1U0LA 5GADC 3HOYG 4LFBL 2QEXA 1PH7A 2VNUD 4X66Q 2UUBQ 4LW1A 2K52A 2I0QA 1CKNA 4GOPA 3RZDH 2AWOA 1SFOH 1CSPA 5FJ8G 2EXDA 4BY1G 1HZ9A 5C3EH 4JV5L 3GTQH 1OXUA 4DR2L 1VQIA 2CWPA 4GS3A 3CW2C 2K4KA 3PCOB 4LUZA 4GKJL 1N32L 4DR4Q 3KJOA 4JI1L 3I55A 4LWCA 3F2BA 2R92G 1H95A 2VL6A 1X3FA 3ULLA 1UE5A 3K7AH 4AQYQ 4DV2Q 2NVTH 1VQDA 4A3IG 4OXPA 2KHJA 3KDFB 5IYDG 2E5LQ 4IFDI 4K0KQ 1OXVA 1VCIA 3PIOA 1BBUA 2PNHA 1XJVA 5ELOA 1OXXK 3ER0A 2QA4A 2WB1E 2HHHQ 4LF9Q 1VQ6A 5M5XH 2IX0A 4JI7Q 2OTLA 4DV7L 4XTCS 1VQ5A 1XNQQ 4HJ5A 4HJ9A 3TS2A 4LFAQ 1L2FA 4R4TA 3HOXH 5JJLA 1QZHA 5C44H 2YU9H 3L0OA 1PA6A 1K8GA 1VQLA 4B3TQ 1IBLQ 1PH9A 4A3FG 1SRUA 1N8RC 4GNXA 3ULJA 4DV4Q 4JI3Q 4YY3L 4HJ7A 1I5FA 4LF7Q 4BA2I 1HNWQ 1UE6A 2UXDQ 2KCMA 1EIYB 1FJGQ 4NXML 2OCEA 2IT1A 3CP0A 4A3MH 2H5XA 1HNWL 1N33L 3E9IA 4L5QA 1VQEA 2JK8A 2NZOA 2PQAB 3AYHB 3NELA 1K73C 5GROA 4RMFA 4JI6Q 4UY8C 3HOWH 4IPCA 2R6GA 1YHAA 4FDBA 4DK6C 1GM5A 1N34L 4BXXG 2MNAA 3CCJA 4PZ6A 3PO2H 3K80C 4DR6Q 4GOPC 5C4JH 1D7QA 3HOXG 2MQHA 3K8AA 3HOZG 4YHHQ 1E22A 1FGUA 2KBNA 5IE8A 4BY7H 2ZJRA 3HOVG 3PV0A 1YVCA 3TRZA 5HGQA 2UUAL 1VS0A 1EUJA 3OTOL 2LSSA 3K0XA 4R4CA 1E24A 2Q2UA 4R1JA 3CXCA 1GKHA 3T1YL 3KF6B 3H3VH 1VQJA 4GLVB 5BR8L 2E2JH 3BZKA 1MKHA 2UUAQ 4WJ4A 3PIPA 2Z0SA 4EQ5A 2EIFA 3H0GH 4LFBQ 4DUZQ 4HIKA 1J6QA 4BBRG 1HNZL 1X9NA 3CD6A 2N3SA 3TEHB 1C7YA 2YYZA 3VDYA 3FHWA 4OWWB 3G71A 3CAMA 4A75A 4IOCA 1SROA 1S3OA 2IX1A 3S1NH 3S2HH 2AWNA 3M3YH 3RR5A 1YBYA 2XGTA 2AHOB 3GTGH 4LFCL 4X64Q 1WJJA 3F1ZA 3HOVH 4JI2L 5M3FG 3TS0A 3L7ZC 2I5MX 1XMOL 1HNXQ 2Q2IA 1SR3A 3NENA 5IP7G 4C2MH 4IFDG 4DR2Q 1X3GA 2VW9A 1PH6A 1X55A 2JE6I 3CCVA 1XMQL 4A93G 2K5NA 1K3RA 1VQAA 4JI0Q 2NN6I 3PF4A 4LUOA 2UXDL 2Y0SE 5C44G 1JT8A 3PO3G 1V9PA 3WWVA 4DV7Q 3PO3H 4AYBE 4LUVA 2ID0A 2F52A 4X62Q 1A8VA 5C0XJ 3CCLA 1PFSA 1JMCA 1S72A 1GD7A 3FKIG 3FKIH 4XIGS 1Y1WH 4OWXB 1VQPA 1KXLA 1QUQA 3M85A 1VQ7A 2GN5A 4DV0L 2ALYB 3GDEA 1T9HA 4JOIC 3S2DH 4KHPL 1LTLA 3S1RH 1EOVA 1WOCA 5IT9c 1YJNA 1PYBA 3S17H 1P8LA 2E8GA 3KJPA 1B7YB 2MO1A 3NBHB 1L0WA 1VQKA 1I94Q 2GVAA 4L5SA 1L1OA 5EAYA 3I4OA 4OONA 3UDXA 1P16A 3HFZB 3I7FA 1IBLL 1U5KA 3U50C 3W5OA 1Q1EA 2BH8A 4BA1I 4A3BH 4YCWA 1QVGA 1NY4A 1IBKL 3OTOQ 3EN2A 4DPGA 4A4IA 4A3GH 4DK3C 2ZJQA 3TQYA 1EYGA 5GAHC 5LMUQ 2K75A 5J3BA 3F2DA 1HR0L 3E9HA 4HIOA 3S16H 3OW2A 4JBKA 1Z9FA 2L15A 5FLXc 1PHJA 2K14A 1L1OB 2R7DA 1KL9A 3HKZE 3J81i 4GN4B 4ALPA 1EQQA 1ASZA 1GVPA 1KRSA 3CCSA 1Y14B 4A3FH 3HOUG 1JJGA 3J7A5 4PG3A 1OXSC 4HJ8A 4YHHL 1SN8A 2K5HA 3B6YA 4GN3B 3BZCA 2UXCL 4GKKL 4B3RL 1HJPA 4BBSH 1PYSB 2JA6H 3H3VI 4KI0A 4A3MG 2JEBI 4X66L 1BKBA 2UUBL 4JI4L 1LM0A 2V1CC 2Q2HA 3U4VA 3JAMc 4DV3L 2VS1A 4GNXC 4JI6L 3ERSX 4YCVA 3AFPA 4DNIA 2CQOA 3I4NH 4P71A 3I4NG 4A93H 5DLQE 1KQSA 4IOAA 1LYLA 4P74A 1D8LA 1VQFA 4P75A 3UDFA 3RNUA 4JI7L 4GLAC 3D0FA 1XPUA 1BBWA 2RHQB 4R4QA 2ZTDA 1V1QA 1IBMQ 2EQSA 3GTPH 4X64L 1KRTA 2JA5G 4LFCQ 1VQOA 3GTLH 1XTDA 3T1YQ 2LXKA 2BH2A 1SLJA 1YHQA 5IYDH 4L5TA 1Q1BA 5LMNW 1E3PA 1VQ9A 1EWIA 4DV6L 4JG2A 5IY0A 2WB1G 2MFIA 2ZJPA 4LF6Q 1DGSA 4R4OA 4LF4L 5IYCH 3GTJH 4JC0A 2NVQH 3RZOH 4OO1G 4BBRH 1HNZQ 3HOUH 1J5EQ 3CMEA 4LF5L 1IL2A 1JJCB 1K8AC 3S24A 4DUYL 1PH4A 1YHBA 2WAQE 4Y7NH 4R4IA 4DV0Q 1K9MC 4LF4Q 4LF6L 5JEAG 4KHPQ 4K0KL 3PUVA 3KF8B 1Q46A 2JA8G 4ME3A 4PZ7A 3M7NA 2R7ZH 1HZAA 1JJ2A 4DUYQ 4J15A 1M90C 1IBML 2HIXA 3HKZG 4NXNL 3S1MH 5AJ3L 1N32Q 1E7ZA 4JBMA 3ICEA 1MJCA 1I50H 4DKAC 4DV6Q 2JA8H 4DAMA 3CF5A 4A3KH 4C3HH 5M5YH 3A5ZB 4JOIA 4C3JH 2AKWB 3W1GA 1YI2A 2R7FA 3E0EA 1KAWA 1L1OC 4MZ9A 4TVAB 1JB7A 1WI5A 3G48A 1KD1C 4B3MQ 4IPHA 3M4OH 1NJIC 4A3CG 4A3CH 1VQHA 1TWFH 1N9WA 2OQ0A 4P72A 4JI8Q 4B3SQ 4IO9A 4JYAQ 4YWMA 2C35B 4QGUA 3HOZH 3BU2A 5GAEC 1Q86C 2E2HH 2A19A 2HIVA 2KHIA 4LNQA 3T1HQ 1YEZA 4JI3L 4DAYB 2QGQA 1B70B 2Z6KC 5IYBG 5C0XI 4A3KG 1XNRL 4DV1L 3I4MH 4OO1I 5BR8Q 3CQZH 3J80c 3IRBA 1CKNB 3A5UA 4MNOA 4QQBX 1HZBA 4A3LG 3AFQA 3PUYA 1EIFA 5C4XH 2A1AA 4DR4L 1NMGA 4QIWE 2I5HA 5IP9G 4L5RC 4X65Q 4C3IH 1NTGA 3KOJA 3A74A 4NB3A 1HH2P 2MO0A 4DR6L 4GN5A 1FVIA 4YWKA 3TREA 3I2ZA 4IJHA 3OYYA 2B63H 5IYCG 4DR7Q 2D62A 5FLMG 4QJFA 4PZ8A 1XMOQ 1HNXL 3S15H 5M5WH 1G6PA 2NVXH 4GLXA 2UU9L 2JA9A 1QUQB 5IP7H 1KHIA 3L2PA 2F4VQ 1XMQQ 2NZHA 2IHEA 1NBWA 2KENA 2Y0SG 2E5LL 2GVBA 2VQFL 4AIMA 1PH3A 3AEVA 5M3FH 2ZTCA 5ELNA 4LF5Q 1A62A 4DV4L 4DR3Q 1ASYA 3MXNB 2UU9Q 5C4XG 3J81j 4UP7A 3PGZA 4JI1Q 4JI2Q 2ZM6Q 3CCUA 4Y52H 5JJIA 4GKJQ 4DR1L 4QL5A 3S1QH 3GTOH 1TWCH 2R92H 2CFMA 1M1KC 2R93H 1Q8KA 4A76A 4JI0L 5LMNQ 2JA5H 4KLKA 3CCQA 4APVA 1PH2A 2UXCQ 1FL0A 2N8NA 4BBSG 1W2BA 4WJ3M 4OX9Q 3H0GG 4YWLA 1WYDA 2HHHL 3ULPA 4LF9L 1HZCA 1WFQA 1YITA 2OWOA 1VQBA 4NPSA 3RLOA 5GQOA 2B29A 1IBKQ 3MEFA 4AH6A 2A8VA 1X65A 3DLLA 4HIMA 4A3EH 2IHFA 1G51A 3UDIA 1Y1VG 2N78A 4AQYL 4A3IH 1Q82C 5K36G 4GOPB 2VY3A 4H02A 4DR1Q 1K83H 4MTNA 3ZJYC 1C0AA 1UE7A 1HR0Q 4IJLA 4YY3Q 1I94L 1X6OA 4QY7A 1W3SA 3CCEA 1Z47A 2WP8J 1YJWA 1A63A 3H15A 4A3DG 4JYAL 1Y1VH 5C3EG 1O7IA 3AQQA 1AE2A 4DV5Q 2WAQG 1CUKA 3UE1A 4O2DA 4DV2L 4A3GG 2R7ZG 2YV5A 1QVCA 2VZAA 4DV1Q 4DV3Q 1Q81C 1UE1A 2JJQA 2YTVA 5LMUL 1AH9A 3JAMi 1JE5A 4B3TL 1EQRA 1Y1WG 1MIUA 2I5LX 1YJ9A 2UUCL 2RCNA 1IXRA 1LUZA 3KF6A 3CPFA 1NMFA 2PI2A 2NN6G 1A0IA 3PUWA 2HQLA 4JBJA 3U4ZA 5C0XG 4LFAL 2F4VL 4BXXH 1IYJB 5HY6A 3PUZA 4PMWA 5FLMH 3GTMH 1V43A 3SGIA 1B8AA 3STBD 5JJKA 4LF8L 1TXYA 1YZ6A 3J81c 4HJAA 1N36Q 1N33Q 4DR3L 4KHZA 4GNXB 3RN5A 1PH1A 3FP9A 4EX5A 1TWGH 2ATWA 4BY1H 4OWTB 4GKKQ 4YCUA 3CPWA 2VQEL 3GTKH 1C9OA 2CCZA 2UUCQ 5GAGC 1TWHH 1N36L 3HKSA 2PI2E 4RG1A 1CKOA 2RF4A 3F8TA 4P73A 1KIXA 1CSQA 4OX9L 3G4SA 3GO5A 2VQEQ 4A3JG 1PH8A 4A3DH 2DGYA 4IPGA 4UP9A 1MJEA 4DR7L 3S14H 1VQ4A 3PF5A 3J7ZC 4UPAA 4IPDA 1Q12A 1AE3A 3UE0A 3CMAA 2D0OA 1I3QH 2KCTA 3KDFA 2ZM6L 3HOWG 1R9TH 2NVYH 4X62L 1QVFA 1QZGA 2PMZE 5IWAQ 4DR5Q 4DUZL 2F3IA 1E1OA 2K5VA 5LMNL 3PUXA 1PV4A 1OXTA 4POGA 3M4PA 3K81C 1HR0W 3GD7A 4BY7G 1PH5A 2DUDA 2VUMG 2BA0A 1RL2A 3EBEA 4JI5Q 1KC8C 2VUMH 1SMXA 3W1BA 5H1SE 1I6HH 1G291 4DR5L 3NEMA 1J5EL 2XTIA 1GO3E 3G6EA 3CCMA 4TQUS 3I56A 1VQNA 2N49A 3JC66 1VQCA 2RHSB 1VQ8A 3CC4A 3HOYH 1SE8A 4A3LH 2OTJA 1EFWA 3RLNA 3M9BA 2AMCB 4UP8A 2JEAI 1XNQL 5IWAL 3BJUA 1UWVA 3A0JA 3RN2A 5AJ3Q 1XNRQ 1CKMA 4NXNQ 2D0PA 1IZ6A 3M4QA 3F2CA 2UXBL 4A3JH 2PQAA 4JV5Q 4DV5L 1Q7YC 2CWAA 2JA7H 3CCRA 3CC2A 1XPRA 2B3GA 4NXMQ 2YTYA 1UEBA 3J80i 2HT1A 2OQKA 2B63G 3T1HL 1E1TA 4HIDA 2UXBQ 4B3ML 1X3EA 3DM3A 2BA1A 1WCMG 3LGJA 1WCMH 1S40A 4B3SL 3Q8DA 2YTXA 1YIJA 2R93G 4JI8L 3STBC 5FJ8H 1PVOA 1FJGL 2ASBA 4X6AH 1K0RA 2LXJA 4LF8Q 2K50A 5M3MH 5M3MG 2Z6KA 5IYBH 4JI4Q 1VQGA 3I4MG 2FXQA 3K7UC 5E7NA 4JBWA 2JQOA 1TWAH 3RLFA 2VQFQ 2E2IH 4B3RQ 1OTCA 3KFUA 4A3EG 3D31A 1N34Q 1X56A 1RIPA 5IP9H 4LF7L 3EIVA 5JEAJ 2IY5B 1NE3A 2JA6G 1VQMA 3U58A 4POFA 3PSIA 4X65L 3CC7A 4JI5L 2JA7G 3UDGA 1BVSA 2CKZB 1XPOA 3KLWA 3PO2G 4IFDJ 2WFWA 4O0AA 4A3BG 2ZTEA 3KYHC 2Q2TA 2ES2A 4JCVE 1YNXA 4AYBG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X54 A;  1U0L A;  5GAD C;  3HOY G;  4LFB L;  2QEX A;  1PH7 A;  2VNU D;  4X66 Q;  2UUB Q;  4LW1 A;  2K52 A;  2I0Q A;  1CKN A;  4GOP A;  3RZD H;  2AWO A;  1SFO H;  1CSP A;  5FJ8 G;  2EXD A;  4BY1 G;  1HZ9 A;  5C3E H;  4JV5 L;  3GTQ H;  1OXU A;  4DR2 L;  1VQI A;  2CWP A;  4GS3 A;  3CW2 C;  2K4K A;  3PCO B;  4LUZ A;  4GKJ L;  1N32 L;  4DR4 Q;  3KJO A;  4JI1 L;  3I55 A;  4LWC A;  3F2B A;  2R92 G;  1H95 A;  2VL6 A;  1X3F A;  3ULL A;  1UE5 A;  3K7A H;  4AQY Q;  4DV2 Q;  2NVT H;  1VQD A;  4A3I G;  4OXP A;  2KHJ A;  3KDF B;  5IYD G;  2E5L Q;  4IFD I;  4K0K Q;  1OXV A;  1VCI A;  3PIO A;  1BBU A;  2PNH A;  1XJV A;  5ELO A;  1OXX K;  3ER0 A;  2QA4 A;  2WB1 E;  2HHH Q;  4LF9 Q;  1VQ6 A;  5M5X H;  2IX0 A;  4JI7 Q;  2OTL A;  4DV7 L;  4XTC S;  1VQ5 A;  1XNQ Q;  4HJ5 A;  4HJ9 A;  3TS2 A;  4LFA Q;  1L2F A;  4R4T A;  3HOX H;  5JJL A;  1QZH A;  5C44 H;  2YU9 H;  3L0O A;  1PA6 A;  1K8G A;  1VQL A;  4B3T Q;  1IBL Q;  1PH9 A;  4A3F G;  1SRU A;  1N8R C;  4GNX A;  3ULJ A;  4DV4 Q;  4JI3 Q;  4YY3 L;  4HJ7 A;  1I5F A;  4LF7 Q;  4BA2 I;  1HNW Q;  1UE6 A;  2UXD Q;  2KCM A;  1EIY B;  1FJG Q;  4NXM L;  2OCE A;  2IT1 A;  3CP0 A;  4A3M H;  2H5X A;  1HNW L;  1N33 L;  3E9I A;  4L5Q A;  1VQE A;  2JK8 A;  2NZO A;  2PQA B;  3AYH B;  3NEL A;  1K73 C;  5GRO A;  4RMF A;  4JI6 Q;  4UY8 C;  3HOW H;  4IPC A;  2R6G A;  1YHA A;  4FDB A;  4DK6 C;  1GM5 A;  1N34 L;  4BXX G;  2MNA A;  3CCJ A;  4PZ6 A;  3PO2 H;  3K80 C;  4DR6 Q;  4GOP C;  5C4J H;  1D7Q A;  3HOX G;  2MQH A;  3K8A A;  3HOZ G;  4YHH Q;  1E22 A;  1FGU A;  2KBN A;  5IE8 A;  4BY7 H;  2ZJR A;  3HOV G;  3PV0 A;  1YVC A;  3TRZ A;  5HGQ A;  2UUA L;  1VS0 A;  1EUJ A;  3OTO L;  2LSS A;  3K0X A;  4R4C A;  1E24 A;  2Q2U A;  4R1J A;  3CXC A;  1GKH A;  3T1Y L;  3KF6 B;  3H3V H;  1VQJ A;  4GLV B;  5BR8 L;  2E2J H;  3BZK A;  1MKH A;  2UUA Q;  4WJ4 A;  3PIP A;  2Z0S A;  4EQ5 A;  2EIF A;  3H0G H;  4LFB Q;  4DUZ Q;  4HIK A;  1J6Q A;  4BBR G;  1HNZ L;  1X9N A;  3CD6 A;  2N3S A;  3TEH B;  1C7Y A;  2YYZ A;  3VDY A;  3FHW A;  4OWW B;  3G71 A;  3CAM A;  4A75 A;  4IOC A;  1SRO A;  1S3O A;  2IX1 A;  3S1N H;  3S2H H;  2AWN A;  3M3Y H;  3RR5 A;  1YBY A;  2XGT A;  2AHO B;  3GTG H;  4LFC L;  4X64 Q;  1WJJ A;  3F1Z A;  3HOV H;  4JI2 L;  5M3F G;  3TS0 A;  3L7Z C;  2I5M X;  1XMO L;  1HNX Q;  2Q2I A;  1SR3 A;  3NEN A;  5IP7 G;  4C2M H;  4IFD G;  4DR2 Q;  1X3G A;  2VW9 A;  1PH6 A;  1X55 A;  2JE6 I;  3CCV A;  1XMQ L;  4A93 G;  2K5N A;  1K3R A;  1VQA A;  4JI0 Q;  2NN6 I;  3PF4 A;  4LUO A;  2UXD L;  2Y0S E;  5C44 G;  1JT8 A;  3PO3 G;  1V9P A;  3WWV A;  4DV7 Q;  3PO3 H;  4AYB E;  4LUV A;  2ID0 A;  2F52 A;  4X62 Q;  1A8V A;  5C0X J;  3CCL A;  1PFS A;  1JMC A;  1S72 A;  1GD7 A;  3FKI G;  3FKI H;  4XIG S;  1Y1W H;  4OWX B;  1VQP A;  1KXL A;  1QUQ A;  3M85 A;  1VQ7 A;  2GN5 A;  4DV0 L;  2ALY B;  3GDE A;  1T9H A;  4JOI C;  3S2D H;  4KHP L;  1LTL A;  3S1R H;  1EOV A;  1WOC A;  5IT9 c;  1YJN A;  1PYB A;  3S17 H;  1P8L A;  2E8G A;  3KJP A;  1B7Y B;  2MO1 A;  3NBH B;  1L0W A;  1VQK A;  1I94 Q;  2GVA A;  4L5S A;  1L1O A;  5EAY A;  3I4O A;  4OON A;  3UDX A;  1P16 A;  3HFZ B;  3I7F A;  1IBL L;  1U5K A;  3U50 C;  3W5O A;  1Q1E A;  2BH8 A;  4BA1 I;  4A3B H;  4YCW A;  1QVG A;  1NY4 A;  1IBK L;  3OTO Q;  3EN2 A;  4DPG A;  4A4I A;  4A3G H;  4DK3 C;  2ZJQ A;  3TQY A;  1EYG A;  5GAH C;  5LMU Q;  2K75 A;  5J3B A;  3F2D A;  1HR0 L;  3E9H A;  4HIO A;  3S16 H;  3OW2 A;  4JBK A;  1Z9F A;  2L15 A;  5FLX c;  1PHJ A;  2K14 A;  1L1O B;  2R7D A;  1KL9 A;  3HKZ E;  3J81 i;  4GN4 B;  4ALP A;  1EQQ A;  1ASZ A;  1GVP A;  1KRS A;  3CCS A;  1Y14 B;  4A3F H;  3HOU G;  1JJG A;  3J7A 5;  4PG3 A;  1OXS C;  4HJ8 A;  4YHH L;  1SN8 A;  2K5H A;  3B6Y A;  4GN3 B;  3BZC A;  2UXC L;  4GKK L;  4B3R L;  1HJP A;  4BBS H;  1PYS B;  2JA6 H;  3H3V I;  4KI0 A;  4A3M G;  2JEB I;  4X66 L;  1BKB A;  2UUB L;  4JI4 L;  1LM0 A;  2V1C C;  2Q2H A;  3U4V A;  3JAM c;  4DV3 L;  2VS1 A;  4GNX C;  4JI6 L;  3ERS X;  4YCV A;  3AFP A;  4DNI A;  2CQO A;  3I4N H;  4P71 A;  3I4N G;  4A93 H;  5DLQ E;  1KQS A;  4IOA A;  1LYL A;  4P74 A;  1D8L A;  1VQF A;  4P75 A;  3UDF A;  3RNU A;  4JI7 L;  4GLA C;  3D0F A;  1XPU A;  1BBW A;  2RHQ B;  4R4Q A;  2ZTD A;  1V1Q A;  1IBM Q;  2EQS A;  3GTP H;  4X64 L;  1KRT A;  2JA5 G;  4LFC Q;  1VQO A;  3GTL H;  1XTD A;  3T1Y Q;  2LXK A;  2BH2 A;  1SLJ A;  1YHQ A;  5IYD H;  4L5T A;  1Q1B A;  5LMN W;  1E3P A;  1VQ9 A;  1EWI A;  4DV6 L;  4JG2 A;  5IY0 A;  2WB1 G;  2MFI A;  2ZJP A;  4LF6 Q;  1DGS A;  4R4O A;  4LF4 L;  5IYC H;  3GTJ H;  4JC0 A;  2NVQ H;  3RZO H;  4OO1 G;  4BBR H;  1HNZ Q;  3HOU H;  1J5E Q;  3CME A;  4LF5 L;  1IL2 A;  1JJC B;  1K8A C;  3S24 A;  4DUY L;  1PH4 A;  1YHB A;  2WAQ E;  4Y7N H;  4R4I A;  4DV0 Q;  1K9M C;  4LF4 Q;  4LF6 L;  5JEA G;  4KHP Q;  4K0K L;  3PUV A;  3KF8 B;  1Q46 A;  2JA8 G;  4ME3 A;  4PZ7 A;  3M7N A;  2R7Z H;  1HZA A;  1JJ2 A;  4DUY Q;  4J15 A;  1M90 C;  1IBM L;  2HIX A;  3HKZ G;  4NXN L;  3S1M H;  5AJ3 L;  1N32 Q;  1E7Z A;  4JBM A;  3ICE A;  1MJC A;  1I50 H;  4DKA C;  4DV6 Q;  2JA8 H;  4DAM A;  3CF5 A;  4A3K H;  4C3H H;  5M5Y H;  3A5Z B;  4JOI A;  4C3J H;  2AKW B;  3W1G A;  1YI2 A;  2R7F A;  3E0E A;  1KAW A;  1L1O C;  4MZ9 A;  4TVA B;  1JB7 A;  1WI5 A;  3G48 A;  1KD1 C;  4B3M Q;  4IPH A;  3M4O H;  1NJI C;  4A3C G;  4A3C H;  1VQH A;  1TWF H;  1N9W A;  2OQ0 A;  4P72 A;  4JI8 Q;  4B3S Q;  4IO9 A;  4JYA Q;  4YWM A;  2C35 B;  4QGU A;  3HOZ H;  3BU2 A;  5GAE C;  1Q86 C;  2E2H H;  2A19 A;  2HIV A;  2KHI A;  4LNQ A;  3T1H Q;  1YEZ A;  4JI3 L;  4DAY B;  2QGQ A;  1B70 B;  2Z6K C;  5IYB G;  5C0X I;  4A3K G;  1XNR L;  4DV1 L;  3I4M H;  4OO1 I;  5BR8 Q;  3CQZ H;  3J80 c;  3IRB A;  1CKN B;  3A5U A;  4MNO A;  4QQB X;  1HZB A;  4A3L G;  3AFQ A;  3PUY A;  1EIF A;  5C4X H;  2A1A A;  4DR4 L;  1NMG A;  4QIW E;  2I5H A;  5IP9 G;  4L5R C;  4X65 Q;  4C3I H;  1NTG A;  3KOJ A;  3A74 A;  4NB3 A;  1HH2 P;  2MO0 A;  4DR6 L;  4GN5 A;  1FVI A;  4YWK A;  3TRE A;  3I2Z A;  4IJH A;  3OYY A;  2B63 H;  5IYC G;  4DR7 Q;  2D62 A;  5FLM G;  4QJF A;  4PZ8 A;  1XMO Q;  1HNX L;  3S15 H;  5M5W H;  1G6P A;  2NVX H;  4GLX A;  2UU9 L;  2JA9 A;  1QUQ B;  5IP7 H;  1KHI A;  3L2P A;  2F4V Q;  1XMQ Q;  2NZH A;  2IHE A;  1NBW A;  2KEN A;  2Y0S G;  2E5L L;  2GVB A;  2VQF L;  4AIM A;  1PH3 A;  3AEV A;  5M3F H;  2ZTC A;  5ELN A;  4LF5 Q;  1A62 A;  4DV4 L;  4DR3 Q;  1ASY A;  3MXN B;  2UU9 Q;  5C4X G;  3J81 j;  4UP7 A;  3PGZ A;  4JI1 Q;  4JI2 Q;  2ZM6 Q;  3CCU A;  4Y52 H;  5JJI A;  4GKJ Q;  4DR1 L;  4QL5 A;  3S1Q H;  3GTO H;  1TWC H;  2R92 H;  2CFM A;  1M1K C;  2R93 H;  1Q8K A;  4A76 A;  4JI0 L;  5LMN Q;  2JA5 H;  4KLK A;  3CCQ A;  4APV A;  1PH2 A;  2UXC Q;  1FL0 A;  2N8N A;  4BBS G;  1W2B A;  4WJ3 M;  4OX9 Q;  3H0G G;  4YWL A;  1WYD A;  2HHH L;  3ULP A;  4LF9 L;  1HZC A;  1WFQ A;  1YIT A;  2OWO A;  1VQB A;  4NPS A;  3RLO A;  5GQO A;  2B29 A;  1IBK Q;  3MEF A;  4AH6 A;  2A8V A;  1X65 A;  3DLL A;  4HIM A;  4A3E H;  2IHF A;  1G51 A;  3UDI A;  1Y1V G;  2N78 A;  4AQY L;  4A3I H;  1Q82 C;  5K36 G;  4GOP B;  2VY3 A;  4H02 A;  4DR1 Q;  1K83 H;  4MTN A;  3ZJY C;  1C0A A;  1UE7 A;  1HR0 Q;  4IJL A;  4YY3 Q;  1I94 L;  1X6O A;  4QY7 A;  1W3S A;  3CCE A;  1Z47 A;  2WP8 J;  1YJW A;  1A63 A;  3H15 A;  4A3D G;  4JYA L;  1Y1V H;  5C3E G;  1O7I A;  3AQQ A;  1AE2 A;  4DV5 Q;  2WAQ G;  1CUK A;  3UE1 A;  4O2D A;  4DV2 L;  4A3G G;  2R7Z G;  2YV5 A;  1QVC A;  2VZA A;  4DV1 Q;  4DV3 Q;  1Q81 C;  1UE1 A;  2JJQ A;  2YTV A;  5LMU L;  1AH9 A;  3JAM i;  1JE5 A;  4B3T L;  1EQR A;  1Y1W G;  1MIU A;  2I5L X;  1YJ9 A;  2UUC L;  2RCN A;  1IXR A;  1LUZ A;  3KF6 A;  3CPF A;  1NMF A;  2PI2 A;  2NN6 G;  1A0I A;  3PUW A;  2HQL A;  4JBJ A;  3U4Z A;  5C0X G;  4LFA L;  2F4V L;  4BXX H;  1IYJ B;  5HY6 A;  3PUZ A;  4PMW A;  5FLM H;  3GTM H;  1V43 A;  3SGI A;  1B8A A;  3STB D;  5JJK A;  4LF8 L;  1TXY A;  1YZ6 A;  3J81 c;  4HJA A;  1N36 Q;  1N33 Q;  4DR3 L;  4KHZ A;  4GNX B;  3RN5 A;  1PH1 A;  3FP9 A;  4EX5 A;  1TWG H;  2ATW A;  4BY1 H;  4OWT B;  4GKK Q;  4YCU A;  3CPW A;  2VQE L;  3GTK H;  1C9O A;  2CCZ A;  2UUC Q;  5GAG C;  1TWH H;  1N36 L;  3HKS A;  2PI2 E;  4RG1 A;  1CKO A;  2RF4 A;  3F8T A;  4P73 A;  1KIX A;  1CSQ A;  4OX9 L;  3G4S A;  3GO5 A;  2VQE Q;  4A3J G;  1PH8 A;  4A3D H;  2DGY A;  4IPG A;  4UP9 A;  1MJE A;  4DR7 L;  3S14 H;  1VQ4 A;  3PF5 A;  3J7Z C;  4UPA A;  4IPD A;  1Q12 A;  1AE3 A;  3UE0 A;  3CMA A;  2D0O A;  1I3Q H;  2KCT A;  3KDF A;  2ZM6 L;  3HOW G;  1R9T H;  2NVY H;  4X62 L;  1QVF A;  1QZG A;  2PMZ E;  5IWA Q;  4DR5 Q;  4DUZ L;  2F3I A;  1E1O A;  2K5V A;  5LMN L;  3PUX A;  1PV4 A;  1OXT A;  4POG A;  3M4P A;  3K81 C;  1HR0 W;  3GD7 A;  4BY7 G;  1PH5 A;  2DUD A;  2VUM G;  2BA0 A;  1RL2 A;  3EBE A;  4JI5 Q;  1KC8 C;  2VUM H;  1SMX A;  3W1B A;  5H1S E;  1I6H H;  1G29 1;  4DR5 L;  3NEM A;  1J5E L;  2XTI A;  1GO3 E;  3G6E A;  3CCM A;  4TQU S;  3I56 A;  1VQN A;  2N49 A;  3JC6 6;  1VQC A;  2RHS B;  1VQ8 A;  3CC4 A;  3HOY H;  1SE8 A;  4A3L H;  2OTJ A;  1EFW A;  3RLN A;  3M9B A;  2AMC B;  4UP8 A;  2JEA I;  1XNQ L;  5IWA L;  3BJU A;  1UWV A;  3A0J A;  3RN2 A;  5AJ3 Q;  1XNR Q;  1CKM A;  4NXN Q;  2D0P A;  1IZ6 A;  3M4Q A;  3F2C A;  2UXB L;  4A3J H;  2PQA A;  4JV5 Q;  4DV5 L;  1Q7Y C;  2CWA A;  2JA7 H;  3CCR A;  3CC2 A;  1XPR A;  2B3G A;  4NXM Q;  2YTY A;  1UEB A;  3J80 i;  2HT1 A;  2OQK A;  2B63 G;  3T1H L;  1E1T A;  4HID A;  2UXB Q;  4B3M L;  1X3E A;  3DM3 A;  2BA1 A;  1WCM G;  3LGJ A;  1WCM H;  1S40 A;  4B3S L;  3Q8D A;  2YTX A;  1YIJ A;  2R93 G;  4JI8 L;  3STB C;  5FJ8 H;  1PVO A;  1FJG L;  2ASB A;  4X6A H;  1K0R A;  2LXJ A;  4LF8 Q;  2K50 A;  5M3M H;  5M3M G;  2Z6K A;  5IYB H;  4JI4 Q;  1VQG A;  3I4M G;  2FXQ A;  3K7U C;  5E7N A;  4JBW A;  2JQO A;  1TWA H;  3RLF A;  2VQF Q;  2E2I H;  4B3R Q;  1OTC A;  3KFU A;  4A3E G;  3D31 A;  1N34 Q;  1X56 A;  1RIP A;  5IP9 H;  4LF7 L;  3EIV A;  5JEA J;  2IY5 B;  1NE3 A;  2JA6 G;  1VQM A;  3U58 A;  4POF A;  3PSI A;  4X65 L;  3CC7 A;  4JI5 L;  2JA7 G;  3UDG A;  1BVS A;  2CKZ B;  1XPO A;  3KLW A;  3PO2 G;  4IFD J;  2WFW A;  4O0A A;  4A3B G;  2ZTE A;  3KYH C;  2Q2T A;  2ES2 A;  4JCV E;  1YNX A;  4AYB G; 
#chains in the Genus database with same CATH topology
 5GAD C;  3HOY G;  2VNU D;  2QEX A;  4GOP A;  1CTM A;  1HZ9 A;  3IL8 A;  2A69 C;  4DR2 L;  4JI1 L;  2VL6 A;  1X3F A;  1UE5 A;  3K7A H;  1VQD A;  4A3I G;  4OXP A;  2E5L Q;  2F0O A;  5G3L F;  2PNH A;  2A6E D;  3L3O C;  2QA4 A;  1NR2 A;  5M5X H;  2NVQ B;  4DV7 L;  4XTC S;  3HOY B;  2RCF A;  1XNQ Q;  3TS2 A;  1H9M A;  1PDQ A;  4ZQ3 A;  3I73 A;  1QNK A;  3KLR A;  1IBL Q;  3K57 A;  5EBC A;  4A3F G;  4J6H A;  4JI3 Q;  4DV4 Q;  4FXG C;  1UE6 A;  2UXD Q;  2KCM A;  3TME A;  4NXM L;  1GUO A;  3BDO A;  2M2L A;  1BDO A;  2DN8 A;  2L12 A;  1N33 L;  4UY8 C;  4XYO A;  2R6G A;  1YHA A;  1GUG A;  4C3H B;  3K80 C;  4DR6 Q;  2CHB D;  4CDE C;  4YHH Q;  4BY7 H;  2QIL A;  1JC7 A;  4I7A A;  3TRZ A;  1EUJ A;  2LSS A;  1SDF A;  1VMP A;  4HMI A;  4R1J A;  4GLV B;  2YU9 B;  3K5O A;  4I65 A;  3T51 B;  4R9W A;  4EQ5 A;  2BDO A;  1L0Y B;  3OHX C;  3E5S A;  2ZT9 C;  4RH6 A;  3TEH B;  3C46 A;  1SEB D;  3CAM A;  1TS2 A;  3S1N H;  3DEP A;  1H9S A;  3MTS A;  3RR5 A;  3HOX B;  1GUW A;  2XGT A;  4G57 A;  3HOZ B;  1WJJ A;  3F1Z A;  1JOO A;  2I5M X;  5LL6 S;  5ELF A;  4A3J B;  4DR2 Q;  1BXT A;  4HTH A;  5NUC A;  2VW9 A;  1PH6 A;  3G7L A;  5CGK A;  2OXP A;  2EYO A;  5C4H A;  1RHP A;  1YNJ D;  3CCV A;  1NSN S;  2K5N A;  1XMQ L;  1O7L A;  4LUO A;  1HTP A;  1XX8 A;  2Y0S E;  3PO3 H;  1K8O A;  4AYB E;  3WOF A;  2F52 A;  3KLS A;  4DAY A;  1E0B A;  4ZK9 B;  3MXP A;  3TP7 A;  1RTN A;  1TT2 A;  2M9V A;  2AQ2 B;  4KY6 A;  4ZCK A;  1Y1W H;  4JK1 C;  1KXL A;  3LX0 A;  3M85 A;  3S2D H;  2VB3 X;  4DV0 L;  4KHP L;  1T9H A;  1EOV A;  3S17 H;  2E8G A;  2Q8T A;  2MO1 A;  4RWS C;  2GVA A;  1L1O A;  5EAY A;  1WTH A;  4OON A;  5KGU A;  3HOU B;  1P16 A;  3HFZ B;  1HXY D;  5ELB A;  3I7F A;  1IBL L;  1CFM A;  3U50 C;  1B1Z A;  4A3B H;  3S2H B;  1SNM A;  1NY4 A;  4MN3 A;  3OTO Q;  1ILP A;  3S15 B;  4A4I A;  4DK3 C;  3TQY A;  1II3 A;  2PZT A;  5GAH C;  2BOS A;  4HCS A;  1EOT A;  3E9H A;  3QIA A;  5FLX c;  3H09 A;  5FKA C;  2R7D A;  1KL9 A;  2LMC B;  4C3J G;  1W6J A;  4ALP A;  3K6O A;  1Q3L A;  2XIW A;  3HOU G;  1B53 A;  4HJ8 A;  2K04 A;  2K28 A;  1KNE A;  1G6Z A;  3DUZ A;  4KI0 A;  4Q5V A;  1D1K A;  3U4V A;  4GNX C;  5L37 A;  1F9P A;  1CT1 D;  3VYU A;  1C8C A;  1IYV A;  2JN4 A;  3G6J B;  2F0T A;  4P71 A;  1KQS A;  3HS0 C;  1KLG D;  4P75 A;  3OPO A;  2M00 A;  2PW7 A;  4GLA C;  1LTG D;  3D0F A;  1BBW A;  2ZTD A;  4IUU A;  1PTO D;  2EQS A;  1LT5 D;  2BH2 A;  1YHQ A;  3IKJ A;  4A3B B;  3A7A B;  5LMN W;  3NUC A;  1YNJ C;  2F0K A;  4OO1 G;  4MHE A;  1Z7T A;  2PZU A;  3HOU H;  4WOR A;  1J5E Q;  2K01 A;  1ET6 A;  4DUY L;  1PH4 A;  4Y7N H;  1AW7 A;  3PUV A;  1Q46 A;  1STA A;  3GTL B;  5FLX L;  3M7N A;  1X3P A;  3AU7 A;  4N9T A;  4DUY Q;  2I07 B;  1JJ2 A;  1M90 C;  3HKZ G;  2CH4 W;  3MZ5 A;  3BVG A;  4H13 C;  4RCO A;  4DV6 Q;  4DAM A;  4K5W A;  4A3K H;  4C3H H;  3A5Z B;  4WJW A;  2AKW B;  2NTS A;  4CKB A;  5D14 A;  4TVA B;  2A68 C;  3G48 A;  5EPJ A;  4IPH A;  3M4O H;  4A3C G;  1K8M A;  4A3C H;  1JB3 A;  4DK0 A;  5KNB A;  1N9W A;  4RKL A;  1SYD A;  4IO9 A;  3D4D A;  3H91 A;  3ONA B;  4QGU A;  3BU2 A;  2E2H H;  5JPM C;  2QDL A;  4XYQ A;  4LNQ A;  4JI3 L;  4DAY B;  2QGQ A;  4DV1 L;  3J80 E;  2EYF A;  5C4J B;  3I8Z A;  1HZB A;  4A3L G;  1EIF A;  2K1B A;  1D5X C;  4QIW E;  4L5R C;  4K8I A;  1HA5 A;  2I46 A;  1D5M C;  2ZXP A;  2TSS A;  4C3H G;  3J7Y W;  4DR6 L;  3TRE A;  2LKV A;  3NK9 A;  4IN3 A;  5C4Z A;  5FLM G;  3NPP A;  3R8B A;  1XMO Q;  1HNX L;  3NXW A;  1SYC A;  2XVS A;  4NKL A;  3HOV B;  3I70 A;  3TZD A;  4GLX A;  2JA9 A;  2UU9 L;  3HRZ C;  2F4V Q;  2XRS D;  3MVV A;  3Q23 A;  3IAY A;  1G2T A;  5EBD A;  1ENC A;  2KEN A;  3EA6 A;  3H6M A;  2VQF L;  4AIM A;  3ZYY X;  3SR1 A;  5DM6 3;  1A62 A;  4DV4 L;  3SK4 A;  3R2I A;  4UDU C;  4RGO S;  2LFN A;  2R93 H;  5LMN Q;  2UXC Q;  4APV A;  1TVX A;  1PH2 A;  1UEA B;  2QDB A;  1EU3 A;  5JOB A;  1WYD A;  5HGT A;  2X6L A;  3E6Z X;  1BQQ T;  5CBA E;  2L9H A;  3K5M A;  4AH6 A;  1X65 A;  4HIM A;  2IHF A;  1G51 A;  5K36 G;  2LY7 A;  5IT9 E;  3ZJY C;  1JQY D;  4K6D A;  3DEO A;  1X6O A;  1A63 A;  4JYA L;  1RD9 D;  4QF4 A;  2F0Q A;  4HN7 A;  4DV2 L;  4A3G G;  4P2C B;  2HD3 A;  3MAQ A;  3JAM i;  1Y1W G;  1IL8 A;  1U4L A;  1IHZ A;  2I5L X;  1YJ9 A;  1IXR A;  3CPF A;  3AB9 A;  4JBJ A;  4LFA L;  2HDL A;  2HQL A;  3SK6 A;  5HY6 A;  3PUZ A;  4PMW A;  5CV8 A;  1CA5 A;  1V43 A;  3SGI A;  1B8A A;  1TS4 A;  2NVX B;  1FNW A;  5T1G A;  4HJA A;  2EYM A;  4GNX B;  4OGQ C;  3FP9 A;  1PZJ D;  2O5I C;  4EX5 A;  4ZKC B;  3F2U A;  2ATW A;  3CPW A;  4LJZ C;  1D5Z C;  4A3G B;  1C9O A;  1I4R A;  2X69 A;  4P73 A;  4OX9 L;  3GO5 A;  4EQP A;  4UP9 A;  1MJE A;  4B9W A;  4XQN A;  4DAV A;  3IFT A;  1Q12 A;  2F0W A;  3SVM A;  1R9T H;  4X62 L;  5FK9 C;  1QVF A;  5IWA Q;  1E1O A;  1PV4 A;  2Z6B A;  4X3K A;  1HR0 W;  3GD7 A;  2A69 D;  2EOT A;  1EYD A;  4DR5 L;  3NEM A;  5G3L D;  4TQU S;  5I2Y A;  3I56 A;  2N49 A;  1SXT A;  3CC4 A;  1S5C D;  3M9B A;  2AMC B;  4J8Q A;  1CI3 M;  1GJX A;  1XNR Q;  1CKM A;  3M4Q A;  1H9J A;  2K5Q A;  5IGD A;  2PQA A;  1CZW A;  4K5X A;  3CCR A;  4NXM Q;  2B3G A;  2L1B A;  1XYI A;  4RAU C;  1U9R A;  2JA6 B;  4ID6 A;  4B3M L;  5JPN C;  2N55 A;  1SYF A;  1EQT A;  1ET9 A;  5I2X A;  3J7A F;  4B3S L;  5JEA H;  2YTX A;  1YIJ A;  1IW7 C;  1FJG L;  1LTI D;  1AN8 A;  5M5X B;  2LXJ A;  3I4M G;  1VQG A;  2EJG C;  3DWA A;  4F87 A;  4JBW A;  3Q24 A;  3A55 A;  4IFD H;  3RLF A;  2VQF Q;  4B3R Q;  3OOC A;  5C5L A;  1TKW B;  1N34 Q;  2ZXR A;  1RIP A;  2SDF A;  5IP9 H;  4LF7 L;  1EY8 A;  2F3W A;  5HUR A;  3CC7 A;  1WTX A;  4UAI A;  2JSO A;  3KF8 A;  2Q2T A;  1SJE D;  1SNP A;  5K36 H;  2B2U C;  5LL6 X;  2JA7 H;  3OWF A;  4X3S A;  2F0D A;  2WAC A;  4CHT B;  2UUB Q;  2IW3 A;  3RZD H;  4RGM A;  3VA5 A;  4A3E B;  4BY1 G;  4G7H C;  4X3T A;  2CWP A;  3CW2 C;  2K4K A;  4LUZ A;  4DR4 Q;  3I4L A;  2R92 G;  1H95 A;  3ULL A;  4DV2 Q;  3KDF B;  4IFD I;  1EY0 A;  1OXV A;  5ELO A;  2F0P A;  4JI7 Q;  2OTL A;  5A2Q L;  1JWM D;  1VQ5 A;  5E4X A;  1ZKO A;  1L2F A;  4R4T A;  3HOX H;  5JJL A;  3FDT A;  3NQI A;  2YU9 H;  3L0O A;  1PA6 A;  1VQL A;  4B3T Q;  2CH4 A;  4ULL A;  1DON A;  1SRU A;  1N8R C;  2BE5 D;  4GNX A;  1HNW Q;  4YY3 L;  4HJ7 A;  3GTO B;  4Z9C B;  1FJG Q;  1STB A;  1BUV T;  1M4V A;  2WIN B;  2H5X A;  3VR6 A;  3AYH B;  3NEL A;  4JI6 Q;  5GRO A;  4M8A A;  4DK6 C;  2EZV A;  1N34 L;  1BOS A;  2NN6 H;  3O13 A;  4PZ6 A;  4CDD C;  3PO2 H;  1EY5 A;  3SEB A;  1FGU A;  2KBN A;  3A8J E;  2ZJR A;  5HGQ A;  2UUA L;  3K0X A;  1E24 A;  1A2T A;  3CXC A;  3T1Y L;  2E2J H;  2E74 C;  5C4X B;  2PNR C;  4HIK A;  3CD6 A;  3VDY A;  1EEI D;  4TRD A;  1A15 A;  3G71 A;  3TN2 A;  4A75 A;  3IFD A;  1S3O A;  3HEJ A;  3S2H H;  3TP5 A;  3GTG H;  3QO2 A;  4X64 Q;  1K28 A;  1Q90 A;  2Q2I A;  2F0H A;  4EQO A;  5IP7 G;  4C2M H;  3BYY B;  2K6A A;  3J81 L;  1R4Q B;  2UXD L;  3PO3 G;  1CA6 A;  5E3F A;  4LUV A;  4BBR B;  3CCL A;  4XIG S;  2QF7 A;  3FKI H;  2IWH A;  4L8J A;  2GN5 A;  2ALY B;  3GDE A;  1LTL A;  3S1R H;  1YJN A;  1PYB A;  4RFB A;  1P8L A;  3DMU A;  4HSP A;  4OO1 H;  3UDX A;  2KCC A;  5F2D A;  4EGV A;  4RA8 A;  1PZI D;  2VB2 X;  4HSV A;  4BA1 I;  3GV3 A;  4A93 B;  3J80 L;  1EY9 A;  3OMC A;  1IBK L;  3EN2 A;  4DPG A;  4A3M B;  3M7G A;  2F0V A;  2B2V C;  5J3B A;  3F2D A;  1HR0 L;  3W2D A;  4HIO A;  3QB3 A;  3QG1 A;  3OW2 A;  1NNX A;  2AUK A;  5IGG A;  3S16 H;  1Z9F A;  2L15 A;  1EZ6 A;  1KNA A;  2K14 A;  4YIJ A;  5ELC A;  4GZY C;  4NMZ A;  3HKZ E;  1Q8I A;  4Q0F A;  1TII D;  4UHV A;  1ASZ A;  1GVP A;  3CCS A;  5I9O A;  1B3A A;  4DXF A;  3J7A 5;  1I4G A;  3BDC A;  1B3Q A;  3DWQ A;  3B6Y A;  4GN3 B;  3KK7 A;  2CQA A;  4B3R L;  1IW7 D;  1H9K A;  2JA6 H;  4A3M G;  1EIH A;  1BKB A;  5EKL A;  3M4O B;  3GTJ B;  2V1C C;  3JAM c;  4MTK A;  4JI6 L;  2VS1 A;  2MHV A;  3NWS A;  2EDG A;  1AZP A;  2E76 C;  1YNN C;  4YCV A;  1CM9 A;  1SYB A;  1EY7 A;  5COY A;  1UAP A;  3I72 A;  5EPL A;  1QCB D;  4JI7 L;  3ND9 A;  1XPU A;  2RHQ B;  1V1Q A;  2IJ0 A;  3GTP H;  4LFC Q;  3D6C A;  1VQO A;  3GTL H;  1XTD A;  3TDQ A;  5ELD A;  4DU9 A;  4L5T A;  2IX3 A;  4CGY B;  4ZKB B;  1EWI A;  4DV6 L;  2BCO A;  2WB1 G;  4LF6 Q;  1DGS A;  4R4O A;  2NVQ H;  3GTJ H;  3RZO H;  3EVQ A;  4AYB B;  2WKC A;  1HNZ Q;  4LF5 L;  1JJC B;  3S24 A;  4LF6 L;  2WAQ E;  1V1O A;  4R4I A;  4DV0 Q;  4KHP Q;  5JEA G;  1KAA A;  4IUR A;  2KHS A;  3H3V C;  1RJT A;  1WTV A;  4J15 A;  5CV7 A;  3A8I E;  3RZO B;  1HQR D;  3ICE A;  1MJC A;  3CRK C;  4DKA C;  1ICW A;  2DJF C;  3NHH A;  1GUS A;  2SNS A;  2C9O A;  4O1N A;  1TQO A;  2R7F A;  2F0E A;  1J8I A;  5EPK A;  1KD1 C;  4B3M Q;  1TWF H;  2PO4 A;  4JVZ A;  2OQ0 A;  4P72 A;  4JI8 Q;  2JP1 A;  3PMF A;  3BVZ A;  5GAE C;  2HIV A;  2F0U A;  2KHI A;  3I90 A;  5CV6 A;  3T1H Q;  2Z6K C;  5C0X I;  2JA7 B;  5BR8 Q;  2ENB A;  1JIC A;  2KEC A;  1TY0 A;  4V19 0;  1ONL A;  2A1A A;  2R3Z A;  2I5H A;  5DNF A;  2E2D C;  3J7A V;  2RDH A;  3KOJ A;  2MO0 A;  4KN7 C;  3JAM E;  2QKI C;  1PTO F;  3R93 A;  4KKT A;  2B8F A;  5IYC G;  5EGT A;  3GV6 A;  3S15 H;  1G6P A;  2X6G A;  5FO9 B;  3RUZ A;  1GHJ A;  2V4D A;  5IP7 H;  1KHI A;  1JCK B;  2IHE A;  1HTL D;  1RCV D;  1NR4 A;  2E5L L;  3S2D B;  3VR4 A;  2F0S A;  2H1E A;  1PH3 A;  1T5E A;  4CJ0 B;  4LF5 Q;  4X3U A;  1NCV A;  1LTB D;  1QB5 D;  4JI1 Q;  3CCU A;  5IT9 L;  3A7L A;  4U67 3;  4A3D B;  3S1Q H;  4L63 B;  1WD0 A;  3FMC A;  1Q8K A;  3ERQ A;  1GXD C;  2JA5 H;  4KLK A;  3CCQ A;  2N8N A;  1W2B A;  4WJ3 M;  4YWL A;  2SNM A;  4ILW A;  1YIT A;  1F2Z A;  4KN4 C;  1VQB A;  5GQO A;  2E2I B;  3KLS X;  3MEF A;  2A8V A;  4AQY L;  2PPB C;  1Y1V G;  1EYA A;  4H02 A;  1K83 H;  1VF5 C;  2B8G A;  5IGB A;  2OEO A;  4IJL A;  1GOZ A;  1I94 L;  2QCP X;  3CCE A;  1Z47 A;  4FF3 A;  4A3D G;  4C1N I;  3DM1 A;  5JAV A;  1AE2 A;  1TWG B;  4DV5 Q;  1CUK A;  5DEH A;  1JR0 D;  3UE1 A;  3SK8 A;  2R7Z G;  1QVC A;  4DV3 Q;  1SMY C;  1DZ1 A;  1Q81 C;  1UE1 A;  2YTV A;  1UUP A;  2Z4H A;  4C3I B;  1AH9 A;  2PW5 A;  1EQR A;  1WTW A;  5IGC A;  2PI2 A;  4PMB A;  4BXX H;  1A0I A;  1RF2 D;  5C0X G;  3VR5 A;  1STG A;  3STB D;  1Y8N B;  5FOB B;  2EJM A;  1N36 Q;  1N33 Q;  4DR3 L;  1PTO C;  4KHZ A;  3RN5 A;  2OF1 A;  1PH1 A;  1TWG H;  2A6H D;  5BN4 A;  1MBY A;  4BY1 H;  4OWT B;  4GKK Q;  4YCU A;  3GTK H;  2CCZ A;  3V96 A;  3X3M A;  2CVR A;  4RG1 A;  1CKO A;  2RF4 A;  1JWS D;  2K5W A;  1CSQ A;  3G4S A;  3LWU A;  4A3D H;  5A35 A;  1PH8 A;  4IPG A;  4DR7 L;  5TSS A;  4E6I A;  1VQ4 A;  3S14 H;  3LWE A;  5J1Z A;  4UPA A;  2EYL A;  3UE0 A;  1I3Q H;  1VDZ A;  2ZM6 L;  3HOW G;  3PQI A;  2KOL A;  3NQT A;  2PMZ E;  3FKI B;  4DR5 Q;  4DUZ L;  2F3I A;  5LMN L;  1YNN D;  3PUX A;  4KHV A;  3K7A B;  2DUD A;  1V1P B;  4OEL B;  4JI5 Q;  1RL2 A;  2VUM G;  2VUM H;  4OIK A;  1I6H H;  3W1B A;  1J5E L;  1TU2 B;  5I6Y A;  1I4H A;  1PZK D;  1VQ8 A;  3HOY H;  1SE8 A;  3M3Y B;  2F0G A;  4UP8 A;  1LAC A;  1XNQ L;  4FNF A;  5IWA L;  3A0J A;  5AJ3 Q;  4NXN Q;  2D0P A;  2P5Z X;  1PXU A;  1Q7Y C;  1WTR A;  2FJ2 A;  3A56 A;  3VYR A;  3CC2 A;  2K05 A;  2YTY A;  2HT1 A;  2VUM B;  1I6H B;  2B2T A;  2FFK B;  3BVM A;  4K2L A;  1X3E A;  5BN5 A;  1TWF B;  4DNT B;  1F2L A;  2R93 G;  4JI8 L;  4FO2 A;  3STB C;  5ELE A;  1PVO A;  1DXM A;  4X6A H;  5M3M G;  1ESR A;  3K7U C;  5E7N A;  1U4R A;  4IAL A;  2JQO A;  1ENA A;  1TWA H;  4O42 A;  1UNS A;  3GTK B;  2IY5 B;  2L0C A;  3PSI A;  3UDG A;  1WCM B;  1BVS A;  2A68 D;  4A3I B;  3SK5 A;  4Y7N B;  4HR7 B;  4A3B G;  1LV9 A;  2LS0 1;  1U0L A;  2DNE A;  4LFB L;  4X66 Q;  4LW1 A;  2K52 A;  2I0Q A;  1CKN A;  2OT2 A;  2B2Y A;  4ZRZ A;  1CSP A;  1NUC A;  2EXD A;  3M4Y A;  1IYU A;  3EFX D;  3MA2 B;  2JA8 B;  4JV5 L;  3GTQ H;  1OXU A;  5KRU A;  1VQI A;  3TBI B;  3PCO B;  1LTR D;  3KJO A;  5D65 A;  2NTT A;  2NVT H;  2Y0S B;  2KHJ A;  5IYD G;  1VCI A;  2EY1 A;  2A5H A;  1XJV A;  1RTO A;  3T13 A;  4HCE A;  1VQ6 A;  2WB1 E;  2HHH Q;  3ND8 A;  1Z6H A;  1DJR D;  2IX0 A;  2RSO A;  4HJ9 A;  1CQV A;  1I4X A;  3GQB A;  4IUV A;  5I4D A;  2EY6 A;  1E2W A;  5CMD A;  1S4Z A;  3GTQ B;  3MXN A;  3CHB D;  1PH9 A;  1DD2 A;  1CHQ D;  4ME5 A;  4LK1 C;  4FVM A;  1LT6 D;  4LF7 Q;  1R9T B;  1HCZ A;  3QOJ A;  3T4A C;  2OCE A;  1ICF B;  2EXZ A;  2XRQ D;  2IT1 A;  2RQX A;  4A3M H;  1HNW L;  3JAM L;  1DCZ A;  3E9I A;  4L5Q A;  4ZAI A;  3TP6 A;  1VQE A;  2JK8 A;  2NZO A;  2PQA B;  3EQL C;  3HOW H;  4FDB A;  2MNA A;  1QWY A;  5M5Y B;  4GOP C;  2NB0 A;  3HOX G;  4FXK C;  2MP1 A;  3HOZ G;  2R7Z B;  3S1R B;  5LHY 1;  2A6E C;  3C2P A;  5IGF A;  5IOD A;  4A3F B;  5FLX E;  3HOV G;  3PV0 A;  4CJ2 C;  4KD4 A;  1VS0 A;  4I7Z C;  4R4C A;  2GA4 B;  4F88 A;  1QJO A;  2Q2U A;  3KF6 B;  1VQJ A;  3H94 A;  3BZK A;  1FYC A;  4XQJ A;  5C44 B;  3PIP A;  4LFB Q;  3NSW A;  4DUZ Q;  2E75 C;  1F9R A;  2B2W C;  2KED A;  1TY2 A;  4B9X A;  4OWW B;  2ICE C;  4IOC A;  4F7X A;  2IX1 A;  2AWN A;  3M3Y H;  1YBY A;  3P20 A;  2AHO B;  3HOV H;  1MGS A;  5M3F G;  3L7Z C;  5CV5 A;  1SR3 A;  3NEN A;  3V05 A;  1EFI D;  5C3W A;  3NBI A;  3Q0A A;  4IFD G;  4R8N A;  3T53 B;  1X55 A;  2JE6 I;  2UXC L;  2PMZ B;  1K3R A;  1VQA A;  1JT8 A;  4ODG A;  5C44 G;  5D3I B;  1V9P A;  4DV7 Q;  4R8I A;  1A6X A;  1S5F D;  1WD1 A;  1A8V A;  3C1F A;  1SYE A;  1JMC A;  1GD7 A;  3FKI G;  3E3X A;  1VQP A;  1SMY D;  5J39 A;  3RD4 A;  1PRT C;  3I3C A;  5JVG 3;  5IT9 c;  1WOC A;  1VQK A;  3KJP A;  1B7Y B;  3NBH B;  1L0W A;  4L5S A;  2K7V A;  1B2T A;  1QOH A;  1U5K A;  5EKK A;  1Q1E A;  1QVG A;  4QB4 A;  3R3O A;  4DNR B;  5LMU Q;  2K75 A;  3GTP B;  2PZW A;  1FR3 A;  4JBK A;  2KVM A;  3I4N B;  1QIL A;  2FMC A;  4IUN A;  3J81 i;  4GN4 B;  1U4M A;  5KYI A;  2HCI A;  3SHL A;  2DY8 A;  2O2L D;  4PG3 A;  3HP3 A;  1H9S B;  4DXG A;  3CQZ B;  4YHH L;  1SN8 A;  2K5H A;  4IQZ A;  3BZC A;  1PYS B;  3H3V I;  4FXD A;  2JEB I;  4X66 L;  4XDX A;  4XT3 B;  4JI4 L;  1LM0 A;  2Z9H A;  3SDZ A;  5E4W C;  3FVQ A;  3T56 B;  3A8K E;  1A3V A;  2CQO A;  4DNI A;  3I4N G;  3I4N H;  3WOE A;  4A93 H;  4P74 A;  1VQF A;  3RNU A;  4R4Q A;  1IKL A;  1IBM Q;  1KRT A;  1K0S A;  1SLJ A;  3BYT B;  5IYD H;  1WVL A;  1Q1B A;  3N52 A;  1VQ9 A;  2HDM A;  4JG2 A;  1JWU D;  1JJG A;  3NTK A;  5IYC H;  2XN9 C;  4JC0 A;  1IKM A;  2B2V A;  4BBR H;  4C56 C;  3D4W A;  1CQF A;  2DJG C;  1YHB A;  2EJF C;  4K0K L;  2JA8 G;  2B2Y C;  4N8X 1;  4HMJ A;  3S1M H;  5AJ3 L;  5IGE A;  4JBM A;  2F0I A;  1H9R A;  1STE A;  1I50 H;  1MSH A;  1RKN A;  3CF5 A;  5M5Y H;  4JOI A;  4C3J H;  2L11 A;  3W1G A;  3E0E A;  3P1H A;  1KAW A;  4CJ1 B;  4MZ9 A;  4KTA A;  1WI5 A;  1DOM A;  4IUP A;  3J81 E;  1NJI C;  2VXW A;  1TWA B;  1LT3 D;  3ERO A;  3QWN A;  4JYA Q;  4YWM A;  3C1E A;  1K3B C;  2C35 B;  3GTG B;  1Q86 C;  2TMP A;  5ISR A;  5CYU A;  3HKZ B;  4K6L A;  3V2T A;  4DAP A;  3KBG A;  1YEZ A;  2FHT A;  1B70 B;  5IYB G;  1XNR L;  3KBX A;  4OO1 I;  3A5U A;  3NTH A;  1EZ8 A;  1TS5 A;  3PUY A;  5C4X H;  4OL7 A;  1PLF A;  2E2J B;  1WTQ A;  1NMG A;  3W3A A;  3K59 A;  4X65 Q;  4V0B A;  1E2V A;  3A74 A;  1HH2 P;  1QE6 A;  2BE5 C;  4GN5 A;  5C3X A;  3I2Z A;  4IJH A;  4DR7 Q;  2D62 A;  5KIX A;  4QJF A;  1B44 D;  5M5W H;  2B2U A;  1TWC B;  2R92 B;  1ILQ A;  3L2P A;  2AQ1 B;  1BF4 A;  1G8Z D;  1NBW A;  1B50 A;  2XNA C;  3AEV A;  2ZTC A;  2NBF A;  1Y8P B;  3MFY A;  4DR3 Q;  1ASY A;  2RA4 A;  4C1N K;  2ZM6 Q;  3MC0 B;  4Y52 H;  5JJI A;  3D3R A;  4QL5 A;  1SND A;  2Z4I A;  2PQE A;  1TWC H;  5C3E B;  5CBE E;  1AEX A;  2CFM A;  2R92 H;  3UI2 A;  3GTO H;  4JI0 L;  2WAQ B;  1FL0 A;  3H0G G;  2A74 C;  2WII B;  4LF9 L;  5M3F B;  3ULP A;  1HZC A;  1PFB A;  3RLO A;  1D1I A;  2F1M A;  1XWE A;  3DLL A;  4A3E H;  3UDI A;  1Q82 C;  2N78 A;  3FEW X;  2VY3 A;  4DFA A;  4DR1 Q;  1C0A A;  4RKB A;  3GTM B;  4YY3 Q;  5M5W B;  1SE2 A;  1W3S A;  2WP8 J;  1YJW A;  2EE1 A;  5KEE A;  1Y1V H;  1SE3 A;  5C3E G;  1O7I A;  3AQQ A;  4G7Z C;  2WAQ G;  5EQ0 A;  1LLR D;  3DWP A;  3VR3 A;  4DV1 Q;  4BS9 A;  1L0X B;  3D8G A;  4B3T L;  5DM7 3;  3L9A X;  1HUM A;  3VA7 A;  1PTO H;  3PUW A;  3A54 A;  2J7Z A;  4NDX A;  1IYJ B;  2Q8R E;  1BCP F;  5JJK A;  1TXY A;  2BDN A;  3J81 c;  1RDP D;  1SJH D;  4EQN A;  4OHJ A;  5CV9 A;  2VQE L;  2MGS A;  4C3J B;  1K83 B;  3OMG A;  2UUC Q;  5GAG C;  1TWH H;  3BDL A;  3HKS A;  1N36 L;  2PI2 E;  2F4I A;  1KIX A;  2IL8 A;  4RGN A;  2VQE Q;  1PRT B;  2RBM A;  2SOB A;  3MEH A;  1R4P B;  3J7Z C;  1F2M A;  2J0T D;  3PO3 B;  3BS1 A;  1BCP D;  5KYL A;  2F0L A;  2EY2 A;  2HQE A;  2NVY H;  3S1M B;  4KD3 A;  3HG9 A;  5M9O A;  2KUM A;  2KCN A;  3S1Q B;  4KMU C;  1OXT A;  2KQ3 A;  4BY7 G;  1PH5 A;  3BG3 A;  3EBE A;  4CDF C;  3D6W A;  1SMX A;  5H1S E;  2D2C C;  1S5E D;  1GO3 E;  3G6E A;  1VQN A;  3JC6 6;  2RHS B;  4RCN A;  2Z8L A;  4KKU A;  1LO5 D;  1EYC A;  4A3L H;  2DNC A;  4C2M B;  1EFW A;  2OTJ A;  4JPB W;  1HUN A;  2XWJ B;  1FNU A;  3RLN A;  2A6H C;  2O4X A;  1IZ6 A;  5CV4 A;  4WFN 3;  3VYT A;  3QR8 A;  1BCP B;  4DN4 M;  4JV5 Q;  4DV5 L;  1SYG A;  1O7Z A;  5BN3 A;  3URY A;  3CKI B;  5IIF A;  3K0Y A;  1UEB A;  3J80 i;  3ITP A;  1MD2 D;  2OQK A;  3T1H L;  1GHK A;  2UXB Q;  4HID A;  4U68 A;  3NE5 B;  2F0N A;  2BA1 A;  3LGJ A;  2PCF B;  3NWT A;  5FJ8 H;  3PO2 B;  4CBV A;  3S14 B;  1U4P A;  2ASB A;  2Q8I B;  4LF8 Q;  2K50 A;  5M3M H;  4OEM B;  3MWY W;  2FXQ A;  1D6E C;  1TS3 A;  1OTC A;  3KFU A;  2NVT B;  4A3E G;  1PFM A;  4BY1 B;  1X56 A;  2JXM B;  4RHS A;  5JEA J;  1NE3 A;  4KJO A;  2JA6 G;  3U58 A;  4POF A;  1SAP A;  4X65 L;  4JI5 L;  3MXG A;  1ROD A;  4PNY A;  3K5L A;  2CKZ B;  1XPO A;  1JOR A;  3TZU A;  3PO2 G;  4IFD J;  2WFW A;  4O0A A;  2ZTE A;  2Z1C A;  3QJY A;  1J9O A;  4FP5 D;  4DK1 A;  2ES2 A;  3I4M B;  1BNZ A;  4AYB G;  1X54 A;  1PH7 A;  5T1I A;  2AWO A;  1SFO H;  5FJ8 G;  1STN A;  3AMU A;  3FPP A;  5C3E H;  5I9P A;  3P7J A;  1D2B A;  4GS3 A;  4GKJ L;  4NP5 A;  1N32 L;  1EY6 A;  3I55 A;  4LWC A;  3F2B A;  2K03 A;  4AQY Q;  3DXJ C;  1HHV A;  2NWG A;  4K0K Q;  3RZD B;  3PIO A;  1BBU A;  1GUN A;  1F2Y A;  4CKC A;  4WRD A;  1CK1 A;  4PV1 C;  1OXX K;  3ER0 A;  4LF9 Q;  1CZG A;  4HJ5 A;  2J4X A;  4LFA Q;  3VYS A;  2EPB A;  1QZH A;  2K32 A;  4H0L C;  1B9N A;  5C44 H;  1K8G A;  3H0G B;  4LMQ D;  3S9W A;  5FO8 B;  3ULJ A;  4LAA A;  4G4K A;  4PMC A;  1ZYR D;  1I5F A;  4BA2 I;  4KV6 A;  1EIY B;  1LTS D;  4PQX A;  2F0M A;  3CP0 A;  4IUT A;  1KDB A;  1HFG A;  2EYP A;  1K73 C;  4RMF A;  4RGT A;  1KLU D;  4IPC A;  1GM5 A;  1JOK A;  2RDF A;  1BBX C;  4BXX G;  3FPU B;  3CCJ A;  1PTO B;  2CW0 D;  4KY5 A;  5C4J H;  3Q22 A;  1D7Q A;  2MQH A;  3NTI A;  4B08 A;  3K8A A;  1EL0 A;  1E22 A;  5IE8 A;  2B2T C;  1YVC A;  1Y1W B;  3OTO L;  4FF4 A;  4JW0 A;  1SNO A;  1EWC A;  1GKH A;  3H3V H;  1SNQ A;  2NYZ D;  5BR8 L;  3K58 A;  1MKH A;  3PIP 3;  2UUA Q;  4WJ4 A;  2Z0S A;  2EIF A;  3H0G H;  1J6Q A;  4BBR G;  1I3Q B;  2IPK D;  1X9N A;  1HNZ L;  2N3S A;  1C7Y A;  2YYZ A;  1PRT F;  3FHW A;  3QOL A;  4XXE A;  2AQ3 B;  1SRO A;  1G91 A;  4LFC L;  4XT1 B;  4JI2 L;  1HQM C;  3TS0 A;  1T5X D;  1XMO L;  1HNX Q;  1DOK A;  2KJX A;  1SBB B;  1X3G A;  4A93 G;  4JI0 Q;  3PF4 A;  2NN6 I;  4CKE A;  3WWV A;  1BCP C;  1W6K A;  2ID0 A;  4X62 Q;  1FD7 D;  5C0X J;  3VR2 A;  1PFS A;  1S72 A;  1JE4 A;  4OWX B;  1QUQ A;  1VQ7 A;  4JOI C;  5C5M A;  4BY7 B;  4DGZ A;  4IUQ A;  4K14 A;  1I94 Q;  3I4O A;  1EWH A;  1B4O A;  4KKS A;  3W5O A;  2BH8 A;  1EU4 A;  4YCW A;  1SSO A;  5KND A;  4H44 C;  3N6R A;  1A3T A;  4A3G H;  1DYQ A;  2ZJQ A;  2EYH A;  1EYG A;  1HPC A;  4KY7 A;  1BO0 A;  3Q6S A;  5IOC A;  1MSG A;  1PHJ A;  1L1O B;  3CU7 A;  3P75 A;  1HRJ A;  1O78 A;  1DM0 B;  3SXH A;  3K5N A;  3OSO A;  1EQQ A;  1KRS A;  4A3F H;  1Y14 B;  2ICI A;  3OIP A;  1OXS C;  2FIN B;  2JA5 B;  2QEJ C;  4GKK L;  1HJP A;  4BBS H;  4QIW B;  4QUC A;  2UUB L;  2XSC A;  2F03 A;  2Q2H A;  4DV3 L;  4KJN A;  3ERS X;  2FMM A;  1Y69 U;  2PYK A;  1LAB A;  3AFP A;  2MUY A;  1QNU A;  5DLQ E;  1V1P A;  4IOA A;  1LYL A;  1D8L A;  3UDF A;  1PYW D;  4FF1 A;  1KDA A;  1S5B D;  4FF2 A;  4X64 L;  1PFN A;  2JA5 G;  1SFO B;  3T1Y Q;  2LXK A;  1X32 A;  5J22 A;  4DF7 A;  1E3P A;  5IY0 A;  4ABN A;  2MFI A;  4N9P A;  2ZJP A;  5C0X H;  4LF4 L;  1JOQ A;  1SNC A;  2L55 A;  3CME A;  1WTO A;  1IL2 A;  1K8A C;  2EY5 A;  4LF4 Q;  1K9M C;  1XTC D;  1HA6 A;  4QMG A;  3I91 A;  3KF8 B;  1ZYR C;  1F9Q A;  4ME3 A;  4PZ7 A;  2R7Z H;  1HZA A;  1IBM L;  2B63 B;  2HIX A;  5AFW A;  4NXN L;  1N32 Q;  2G9H D;  2RDG A;  1E7Z A;  5JVH 3;  1O7Y A;  2JA8 H;  3E0J A;  1XXG A;  5EKI A;  1YI2 A;  1TWH B;  5CR3 A;  3HGB A;  2CW0 C;  1L1O C;  2SEB D;  1JB7 A;  5COR A;  1ENF A;  2A73 B;  4ZLT F;  1LTA D;  1VQH A;  2H4O A;  2O5J C;  4ZUI A;  4B3S Q;  3HOZ H;  5DAU A;  2A19 A;  5C6A A;  2G9D A;  1VMC A;  3X3N A;  3I4M H;  4A3K G;  4G7O C;  3CQZ H;  3J80 c;  1C4Q A;  1EY4 A;  3IRB A;  1CKN B;  4MIU A;  4OIJ A;  4MNO A;  4QQB X;  1VF7 A;  3AFQ A;  4F8M A;  4DR4 L;  5IP9 G;  4TKO B;  5A2Q E;  4C3I H;  1NTG A;  1A2U A;  2B2W A;  3KUP A;  1WTP A;  2K5D A;  2HUG A;  4H7B A;  4NB3 A;  3C3L A;  1DOL A;  1C48 A;  1FVI A;  4YWK A;  2B63 H;  3OYY A;  4PZ8 A;  3TP8 A;  2NVX H;  2WKD A;  1QUQ B;  4A3K B;  3U9S A;  1XMQ Q;  2NZH A;  3CRL C;  4XQQ A;  2Y0S G;  1EQV A;  2GVB A;  2NZ1 D;  4QCL A;  1I4P A;  5M3F H;  5ELN A;  2UU9 Q;  5K5P A;  1I6V C;  5C4X G;  3MXN B;  2NVY B;  3J81 j;  4UP7 A;  3PGZ A;  4JI2 Q;  1HFN A;  1EEF D;  4GKJ Q;  3DHQ A;  3LNN A;  4HED A;  4TSS A;  4DR1 L;  1O80 A;  3BZD B;  2JYO A;  1F9S A;  4L6T B;  1M1K C;  4A76 A;  3S1N B;  2B39 A;  4DA2 A;  4NW2 A;  4BBS G;  4OX9 Q;  2QW7 A;  1B9M A;  2HHH L;  1WFQ A;  4C3I G;  2OWO A;  4NPS A;  3OIQ A;  2B29 A;  4RHR A;  1IBK Q;  1AFP A;  2N88 A;  4A3I H;  3GP7 A;  4GOP B;  4KK7 A;  4MTN A;  1UE7 A;  1HR0 Q;  1FNV A;  1EIG A;  4QY7 A;  2AUJ D;  4HAE A;  2RKS A;  1CHP D;  3H15 A;  4K5V A;  1X3Q A;  4O2D A;  2K33 A;  4K8J A;  3RMH A;  4CDC C;  4BBS B;  2YV5 A;  2VZA A;  2JJQ A;  5LMU L;  1JE5 A;  3R2T A;  2UUC L;  1MIU A;  2RCN A;  1LUZ A;  2NUC A;  3KF6 A;  1NMF A;  1Y1V B;  2NN6 G;  1GUT A;  3U4Z A;  2F4V L;  3U9O A;  1A3U A;  5FLM H;  2L4N A;  4N8F A;  3HOW B;  1ML0 D;  3GTM H;  1PRT D;  4LF8 L;  1YZ6 A;  3HZX A;  5FO7 B;  2F0J A;  2KA7 A;  1OO9 B;  4J1M A;  1NAP A;  1ZEQ X;  5I6W A;  2WV6 D;  2D9U A;  3EJI A;  3F8T A;  1ZXT A;  2HCC A;  1PMR A;  4A3J G;  1I50 B;  1G2S A;  2DGY A;  3PF5 A;  1Y8O B;  4FYD A;  4IPD A;  3FRP B;  1AE3 A;  3CMA A;  2D0O A;  2KCT A;  3KDF A;  1QZG A;  3D4R A;  2DY7 A;  2D5D A;  2K5V A;  1S5D D;  4K2K A;  4ZUJ A;  3WDN A;  3M4P A;  3K81 C;  4POG A;  1QG7 A;  1TR5 A;  1AP0 A;  2L5T A;  3S17 B;  2BA0 A;  3NBH A;  1KC8 C;  1G29 1;  1STH A;  1I4Q A;  2XTI A;  2KEE A;  3CCM A;  3MHB A;  1LT4 D;  1VQC A;  4S3S A;  1KAB A;  3MFG A;  1STY A;  5D3D A;  2JEA I;  1SE4 A;  3BJU A;  1UWV A;  2WB1 B;  2EYJ A;  4M1U B;  3RN2 A;  5M3M B;  1KTK A;  3F2C A;  2UXB L;  4A3J H;  1FGB D;  4EVO A;  3MXU A;  1LTT D;  2CWA A;  2MPM A;  2EVB A;  1XPR A;  1KDC A;  2XWB B;  2B63 G;  1E1T A;  1ESF A;  2R61 A;  3DM3 A;  3NP8 A;  4IZ8 A;  1WCM G;  1WCM H;  1S40 A;  2F0F A;  3Q8D A;  2RSN A;  4QUF A;  2F3V A;  1K0R A;  2MJ8 A;  3PIO 3;  2E2H B;  1BR9 A;  5IYB H;  4JI4 Q;  2Z6K A;  5EJW A;  1AZQ A;  3S16 B;  3SE0 A;  4ZYS A;  2G5D A;  5JJZ A;  2E2I H;  3D31 A;  3EIV A;  1M8A A;  3OWE B;  1VQM A;  1V8Q A;  3OW7 A;  2JA7 G;  5KNC A;  3TSS A;  2C5C A;  1F77 A;  2RVL A;  4BWG B;  1MI2 A;  2ZXO A;  2R93 B;  3T16 A;  3KLW A;  5E1F A;  1MHW C;  3KYH C;  5CC4 A;  4JCV E;  1YNX A;  1E2Z A; 
#chains in the Genus database with same CATH homology
 1X54 A;  1U0L A;  5GAD C;  3HOY G;  4LFB L;  2QEX A;  1PH7 A;  2VNU D;  4X66 Q;  2UUB Q;  4LW1 A;  2K52 A;  2I0Q A;  1CKN A;  4GOP A;  3RZD H;  2AWO A;  1SFO H;  1CSP A;  5FJ8 G;  2EXD A;  4BY1 G;  1HZ9 A;  5C3E H;  4JV5 L;  3GTQ H;  1OXU A;  4DR2 L;  1VQI A;  2CWP A;  4GS3 A;  3CW2 C;  2K4K A;  3PCO B;  4LUZ A;  4GKJ L;  1N32 L;  4DR4 Q;  3KJO A;  4JI1 L;  3I55 A;  4LWC A;  3F2B A;  2R92 G;  1H95 A;  2VL6 A;  1X3F A;  3ULL A;  1UE5 A;  3K7A H;  4AQY Q;  4DV2 Q;  2NVT H;  1VQD A;  4A3I G;  4OXP A;  2KHJ A;  3KDF B;  5IYD G;  2E5L Q;  4IFD I;  4K0K Q;  1OXV A;  1VCI A;  3PIO A;  1BBU A;  2PNH A;  1XJV A;  5ELO A;  1OXX K;  3ER0 A;  2QA4 A;  2WB1 E;  2HHH Q;  4LF9 Q;  1VQ6 A;  5M5X H;  2IX0 A;  4JI7 Q;  2OTL A;  4DV7 L;  4XTC S;  1VQ5 A;  1XNQ Q;  4HJ5 A;  4HJ9 A;  3TS2 A;  4LFA Q;  1L2F A;  4R4T A;  3HOX H;  5JJL A;  1QZH A;  5C44 H;  2YU9 H;  3L0O A;  1PA6 A;  1K8G A;  1VQL A;  4B3T Q;  1IBL Q;  1PH9 A;  4A3F G;  1SRU A;  1N8R C;  4GNX A;  3ULJ A;  4DV4 Q;  4JI3 Q;  4YY3 L;  4HJ7 A;  1I5F A;  4LF7 Q;  4BA2 I;  1HNW Q;  1UE6 A;  2UXD Q;  2KCM A;  1EIY B;  1FJG Q;  4NXM L;  2OCE A;  2IT1 A;  3CP0 A;  4A3M H;  2H5X A;  1HNW L;  1N33 L;  3E9I A;  4L5Q A;  1VQE A;  2JK8 A;  2NZO A;  2PQA B;  3AYH B;  3NEL A;  1K73 C;  5GRO A;  4RMF A;  4JI6 Q;  4UY8 C;  3HOW H;  4IPC A;  2R6G A;  1YHA A;  4FDB A;  4DK6 C;  1GM5 A;  1N34 L;  4BXX G;  2MNA A;  3CCJ A;  4PZ6 A;  3PO2 H;  3K80 C;  4DR6 Q;  4GOP C;  5C4J H;  1D7Q A;  3HOX G;  2MQH A;  3K8A A;  3HOZ G;  4YHH Q;  1E22 A;  1FGU A;  2KBN A;  5IE8 A;  4BY7 H;  2ZJR A;  3HOV G;  3PV0 A;  1YVC A;  3TRZ A;  5HGQ A;  2UUA L;  1VS0 A;  1EUJ A;  3OTO L;  2LSS A;  3K0X A;  4R4C A;  1E24 A;  2Q2U A;  4R1J A;  3CXC A;  1GKH A;  3T1Y L;  3KF6 B;  3H3V H;  1VQJ A;  4GLV B;  5BR8 L;  2E2J H;  3BZK A;  1MKH A;  2UUA Q;  4WJ4 A;  3PIP A;  2Z0S A;  4EQ5 A;  2EIF A;  3H0G H;  4LFB Q;  4DUZ Q;  4HIK A;  1J6Q A;  4BBR G;  1HNZ L;  1X9N A;  3CD6 A;  2N3S A;  3TEH B;  1C7Y A;  2YYZ A;  3VDY A;  3FHW A;  4OWW B;  3G71 A;  3CAM A;  4A75 A;  4IOC A;  1SRO A;  1S3O A;  2IX1 A;  3S1N H;  3S2H H;  2AWN A;  3M3Y H;  3RR5 A;  1YBY A;  2XGT A;  2AHO B;  3GTG H;  4LFC L;  4X64 Q;  1WJJ A;  3F1Z A;  3HOV H;  4JI2 L;  5M3F G;  3TS0 A;  3L7Z C;  2I5M X;  1XMO L;  1HNX Q;  2Q2I A;  1SR3 A;  3NEN A;  5IP7 G;  4C2M H;  4IFD G;  4DR2 Q;  1X3G A;  2VW9 A;  1PH6 A;  1X55 A;  2JE6 I;  3CCV A;  1XMQ L;  4A93 G;  2K5N A;  1K3R A;  1VQA A;  4JI0 Q;  2NN6 I;  3PF4 A;  4LUO A;  2UXD L;  2Y0S E;  5C44 G;  1JT8 A;  3PO3 G;  1V9P A;  3WWV A;  4DV7 Q;  3PO3 H;  4AYB E;  4LUV A;  2ID0 A;  2F52 A;  4X62 Q;  1A8V A;  5C0X J;  3CCL A;  1PFS A;  1JMC A;  1S72 A;  1GD7 A;  3FKI G;  3FKI H;  4XIG S;  1Y1W H;  4OWX B;  1VQP A;  1KXL A;  1QUQ A;  3M85 A;  1VQ7 A;  2GN5 A;  4DV0 L;  2ALY B;  3GDE A;  1T9H A;  4JOI C;  3S2D H;  4KHP L;  1LTL A;  3S1R H;  1EOV A;  1WOC A;  5IT9 c;  1YJN A;  1PYB A;  3S17 H;  1P8L A;  2E8G A;  3KJP A;  1B7Y B;  2MO1 A;  3NBH B;  1L0W A;  1VQK A;  1I94 Q;  2GVA A;  4L5S A;  1L1O A;  5EAY A;  3I4O A;  4OON A;  3UDX A;  1P16 A;  3HFZ B;  3I7F A;  1IBL L;  1U5K A;  3U50 C;  3W5O A;  1Q1E A;  2BH8 A;  4BA1 I;  4A3B H;  4YCW A;  1QVG A;  1NY4 A;  1IBK L;  3OTO Q;  3EN2 A;  4DPG A;  4A4I A;  4A3G H;  4DK3 C;  2ZJQ A;  3TQY A;  1EYG A;  5GAH C;  5LMU Q;  2K75 A;  5J3B A;  3F2D A;  1HR0 L;  3E9H A;  4HIO A;  3S16 H;  3OW2 A;  4JBK A;  1Z9F A;  2L15 A;  5FLX c;  1PHJ A;  2K14 A;  1L1O B;  2R7D A;  1KL9 A;  3HKZ E;  3J81 i;  4GN4 B;  4ALP A;  1EQQ A;  1ASZ A;  1GVP A;  1KRS A;  3CCS A;  1Y14 B;  4A3F H;  3HOU G;  1JJG A;  3J7A 5;  4PG3 A;  1OXS C;  4HJ8 A;  4YHH L;  1SN8 A;  2K5H A;  3B6Y A;  4GN3 B;  3BZC A;  2UXC L;  4GKK L;  4B3R L;  1HJP A;  4BBS H;  1PYS B;  2JA6 H;  3H3V I;  4KI0 A;  4A3M G;  2JEB I;  4X66 L;  1BKB A;  2UUB L;  4JI4 L;  1LM0 A;  2V1C C;  2Q2H A;  3U4V A;  3JAM c;  4DV3 L;  2VS1 A;  4GNX C;  4JI6 L;  3ERS X;  4YCV A;  3AFP A;  4DNI A;  2CQO A;  3I4N H;  4P71 A;  3I4N G;  4A93 H;  5DLQ E;  1KQS A;  4IOA A;  1LYL A;  4P74 A;  1D8L A;  1VQF A;  4P75 A;  3UDF A;  3RNU A;  4JI7 L;  4GLA C;  3D0F A;  1XPU A;  1BBW A;  2RHQ B;  4R4Q A;  2ZTD A;  1V1Q A;  1IBM Q;  2EQS A;  3GTP H;  4X64 L;  1KRT A;  2JA5 G;  4LFC Q;  1VQO A;  3GTL H;  1XTD A;  3T1Y Q;  2LXK A;  2BH2 A;  1SLJ A;  1YHQ A;  5IYD H;  4L5T A;  1Q1B A;  5LMN W;  1E3P A;  1VQ9 A;  1EWI A;  4DV6 L;  4JG2 A;  5IY0 A;  2WB1 G;  2MFI A;  2ZJP A;  4LF6 Q;  1DGS A;  4R4O A;  4LF4 L;  5IYC H;  3GTJ H;  4JC0 A;  2NVQ H;  3RZO H;  4OO1 G;  4BBR H;  1HNZ Q;  3HOU H;  1J5E Q;  3CME A;  4LF5 L;  1IL2 A;  1JJC B;  1K8A C;  3S24 A;  4DUY L;  1PH4 A;  1YHB A;  2WAQ E;  4Y7N H;  4R4I A;  4DV0 Q;  1K9M C;  4LF4 Q;  4LF6 L;  5JEA G;  4KHP Q;  4K0K L;  3PUV A;  3KF8 B;  1Q46 A;  2JA8 G;  4ME3 A;  4PZ7 A;  3M7N A;  2R7Z H;  1HZA A;  1JJ2 A;  4DUY Q;  4J15 A;  1M90 C;  1IBM L;  2HIX A;  3HKZ G;  4NXN L;  3S1M H;  5AJ3 L;  1N32 Q;  1E7Z A;  4JBM A;  3ICE A;  1MJC A;  1I50 H;  4DKA C;  4DV6 Q;  2JA8 H;  4DAM A;  3CF5 A;  4A3K H;  4C3H H;  5M5Y H;  3A5Z B;  4JOI A;  4C3J H;  2AKW B;  3W1G A;  1YI2 A;  2R7F A;  3E0E A;  1KAW A;  1L1O C;  4MZ9 A;  4TVA B;  1JB7 A;  1WI5 A;  3G48 A;  1KD1 C;  4B3M Q;  4IPH A;  3M4O H;  1NJI C;  4A3C G;  4A3C H;  1VQH A;  1TWF H;  1N9W A;  2OQ0 A;  4P72 A;  4JI8 Q;  4B3S Q;  4IO9 A;  4JYA Q;  4YWM A;  2C35 B;  4QGU A;  3HOZ H;  3BU2 A;  5GAE C;  1Q86 C;  2E2H H;  2A19 A;  2HIV A;  2KHI A;  4LNQ A;  3T1H Q;  1YEZ A;  4JI3 L;  4DAY B;  2QGQ A;  1B70 B;  2Z6K C;  5IYB G;  5C0X I;  4A3K G;  1XNR L;  4DV1 L;  3I4M H;  4OO1 I;  5BR8 Q;  3CQZ H;  3J80 c;  3IRB A;  1CKN B;  3A5U A;  4MNO A;  4QQB X;  1HZB A;  4A3L G;  3AFQ A;  3PUY A;  1EIF A;  5C4X H;  2A1A A;  4DR4 L;  1NMG A;  4QIW E;  2I5H A;  5IP9 G;  4L5R C;  4X65 Q;  4C3I H;  1NTG A;  3KOJ A;  3A74 A;  4NB3 A;  1HH2 P;  2MO0 A;  4DR6 L;  4GN5 A;  1FVI A;  4YWK A;  3TRE A;  3I2Z A;  4IJH A;  3OYY A;  2B63 H;  5IYC G;  4DR7 Q;  2D62 A;  5FLM G;  4QJF A;  4PZ8 A;  1XMO Q;  1HNX L;  3S15 H;  5M5W H;  1G6P A;  2NVX H;  4GLX A;  2UU9 L;  2JA9 A;  1QUQ B;  5IP7 H;  1KHI A;  3L2P A;  2F4V Q;  1XMQ Q;  2NZH A;  2IHE A;  1NBW A;  2KEN A;  2Y0S G;  2E5L L;  2GVB A;  2VQF L;  4AIM A;  1PH3 A;  3AEV A;  5M3F H;  2ZTC A;  5ELN A;  4LF5 Q;  1A62 A;  4DV4 L;  4DR3 Q;  1ASY A;  3MXN B;  2UU9 Q;  5C4X G;  3J81 j;  4UP7 A;  3PGZ A;  4JI1 Q;  4JI2 Q;  2ZM6 Q;  3CCU A;  4Y52 H;  5JJI A;  4GKJ Q;  4DR1 L;  4QL5 A;  3S1Q H;  3GTO H;  1TWC H;  2R92 H;  2CFM A;  1M1K C;  2R93 H;  1Q8K A;  4A76 A;  4JI0 L;  5LMN Q;  2JA5 H;  4KLK A;  3CCQ A;  4APV A;  1PH2 A;  2UXC Q;  1FL0 A;  2N8N A;  4BBS G;  1W2B A;  4WJ3 M;  4OX9 Q;  3H0G G;  4YWL A;  1WYD A;  2HHH L;  3ULP A;  4LF9 L;  1HZC A;  1WFQ A;  1YIT A;  2OWO A;  1VQB A;  4NPS A;  3RLO A;  5GQO A;  2B29 A;  1IBK Q;  3MEF A;  4AH6 A;  2A8V A;  1X65 A;  3DLL A;  4HIM A;  4A3E H;  2IHF A;  1G51 A;  3UDI A;  1Y1V G;  2N78 A;  4AQY L;  4A3I H;  1Q82 C;  5K36 G;  4GOP B;  2VY3 A;  4H02 A;  4DR1 Q;  1K83 H;  4MTN A;  3ZJY C;  1C0A A;  1UE7 A;  1HR0 Q;  4IJL A;  4YY3 Q;  1I94 L;  1X6O A;  4QY7 A;  1W3S A;  3CCE A;  1Z47 A;  2WP8 J;  1YJW A;  1A63 A;  3H15 A;  4A3D G;  4JYA L;  1Y1V H;  5C3E G;  1O7I A;  3AQQ A;  1AE2 A;  4DV5 Q;  2WAQ G;  1CUK A;  3UE1 A;  4O2D A;  4DV2 L;  4A3G G;  2R7Z G;  2YV5 A;  1QVC A;  2VZA A;  4DV1 Q;  4DV3 Q;  1Q81 C;  1UE1 A;  2JJQ A;  2YTV A;  5LMU L;  1AH9 A;  3JAM i;  1JE5 A;  4B3T L;  1EQR A;  1Y1W G;  1MIU A;  2I5L X;  1YJ9 A;  2UUC L;  2RCN A;  1IXR A;  1LUZ A;  3KF6 A;  3CPF A;  1NMF A;  2PI2 A;  2NN6 G;  1A0I A;  3PUW A;  2HQL A;  4JBJ A;  3U4Z A;  5C0X G;  4LFA L;  2F4V L;  4BXX H;  1IYJ B;  5HY6 A;  3PUZ A;  4PMW A;  5FLM H;  3GTM H;  1V43 A;  3SGI A;  1B8A A;  3STB D;  5JJK A;  4LF8 L;  1TXY A;  1YZ6 A;  3J81 c;  4HJA A;  1N36 Q;  1N33 Q;  4DR3 L;  4KHZ A;  4GNX B;  3RN5 A;  1PH1 A;  3FP9 A;  4EX5 A;  1TWG H;  2ATW A;  4BY1 H;  4OWT B;  4GKK Q;  4YCU A;  3CPW A;  2VQE L;  3GTK H;  1C9O A;  2CCZ A;  2UUC Q;  5GAG C;  1TWH H;  1N36 L;  3HKS A;  2PI2 E;  4RG1 A;  1CKO A;  2RF4 A;  3F8T A;  4P73 A;  1KIX A;  1CSQ A;  4OX9 L;  3G4S A;  3GO5 A;  2VQE Q;  4A3J G;  1PH8 A;  4A3D H;  2DGY A;  4IPG A;  4UP9 A;  1MJE A;  4DR7 L;  3S14 H;  1VQ4 A;  3PF5 A;  3J7Z C;  4UPA A;  4IPD A;  1Q12 A;  1AE3 A;  3UE0 A;  3CMA A;  2D0O A;  1I3Q H;  2KCT A;  3KDF A;  2ZM6 L;  3HOW G;  1R9T H;  2NVY H;  4X62 L;  1QVF A;  1QZG A;  2PMZ E;  5IWA Q;  4DR5 Q;  4DUZ L;  2F3I A;  1E1O A;  2K5V A;  5LMN L;  3PUX A;  1PV4 A;  1OXT A;  4POG A;  3M4P A;  3K81 C;  1HR0 W;  3GD7 A;  4BY7 G;  1PH5 A;  2DUD A;  2VUM G;  2BA0 A;  1RL2 A;  3EBE A;  4JI5 Q;  1KC8 C;  2VUM H;  1SMX A;  3W1B A;  5H1S E;  1I6H H;  1G29 1;  4DR5 L;  3NEM A;  1J5E L;  2XTI A;  1GO3 E;  3G6E A;  3CCM A;  4TQU S;  3I56 A;  1VQN A;  2N49 A;  3JC6 6;  1VQC A;  2RHS B;  1VQ8 A;  3CC4 A;  3HOY H;  1SE8 A;  4A3L H;  2OTJ A;  1EFW A;  3RLN A;  3M9B A;  2AMC B;  4UP8 A;  2JEA I;  1XNQ L;  5IWA L;  3BJU A;  1UWV A;  3A0J A;  3RN2 A;  5AJ3 Q;  1XNR Q;  1CKM A;  4NXN Q;  2D0P A;  1IZ6 A;  3M4Q A;  3F2C A;  2UXB L;  4A3J H;  2PQA A;  4JV5 Q;  4DV5 L;  1Q7Y C;  2CWA A;  2JA7 H;  3CCR A;  3CC2 A;  1XPR A;  2B3G A;  4NXM Q;  2YTY A;  1UEB A;  3J80 i;  2HT1 A;  2OQK A;  2B63 G;  3T1H L;  1E1T A;  4HID A;  2UXB Q;  4B3M L;  1X3E A;  3DM3 A;  2BA1 A;  1WCM G;  3LGJ A;  1WCM H;  1S40 A;  4B3S L;  3Q8D A;  2YTX A;  1YIJ A;  2R93 G;  4JI8 L;  3STB C;  5FJ8 H;  1PVO A;  1FJG L;  2ASB A;  4X6A H;  1K0R A;  2LXJ A;  4LF8 Q;  2K50 A;  5M3M H;  5M3M G;  2Z6K A;  5IYB H;  4JI4 Q;  1VQG A;  3I4M G;  2FXQ A;  3K7U C;  5E7N A;  4JBW A;  2JQO A;  1TWA H;  3RLF A;  2VQF Q;  2E2I H;  4B3R Q;  1OTC A;  3KFU A;  4A3E G;  3D31 A;  1N34 Q;  1X56 A;  1RIP A;  5IP9 H;  4LF7 L;  3EIV A;  5JEA J;  2IY5 B;  1NE3 A;  2JA6 G;  1VQM A;  3U58 A;  4POF A;  3PSI A;  4X65 L;  3CC7 A;  4JI5 L;  2JA7 G;  3UDG A;  1BVS A;  2CKZ B;  1XPO A;  3KLW A;  3PO2 G;  4IFD J;  2WFW A;  4O0A A;  4A3B G;  2ZTE A;  3KYH C;  2Q2T A;  2ES2 A;  4JCV E;  1YNX A;  4AYB G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...