4LW1A

Fragment-based discovery of a potent inhibitor of replication protein a protein-protein interactions
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
123
structure length
123
Chain Sequence
GSHMVGQLSRGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGNPVPYNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of a potent inhibitor of replication protein a protein-protein interactions using a fragment-linking approach.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/inhibitor
molecule keywords Replication protein A 70 kDa DNA-binding subunit
total genus 31
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2013-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04057 Rep-A_N Replication factor-A protein 1, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4lw1A00
2HT1A 5K36G 1P8LA 1C9OA 2E5LL 3UDXA 1EIYB 3OYYA 3PSIA 3RLOA 1LM0A 4A3IH 5FLMH 4JI8L 4JV5Q 4JI1L 2B63G 2F3IA 4DAMA 1SRUA 2RHSB 3GO5A 1VQ4A 1AE3A 1WJJA 3GDEA 4JI8Q 4JV5L 3CXCA 3VDYA 3UE1A 4NXML 1VQDA 1GM5A 1XPUA 1XMOL 4AQYL 1AE2A 5GQOA 1I50H 4LF4Q 4A3DG 5BR8Q 1SR3A 3HOXH 5C4XH 3BU2A 3OTOQ 3RLFA 4DUYL 3ULPA 1S72A 4JI3Q 3HOWG 3PO2G 2UXCL 3BZKA 5GADC 2Y0SE 4K0KL 4A3MH 4GN4B 1SROA 2BA1A 2PI2A 1WCMH 4P73A 5M5YH 1A62A 4X66Q 4AH6A 4LF6Q 1X56A 5IYCH 2E5LQ 1BVSA 5JJLA 3F2CA 1E1OA 2IY5B 3RN2A 1PYSB 4AIMA 3HOUH 3I4NG 1W3SA 2LXJA 5DLQE 1C7YA 4LFCQ 4A3CG 3J81i 4JI2Q 2OQ0A 3T1HQ 2NVTH 4HIDA 5GAHC 2R93G 1JT8A 3F2DA 3RLNA 2PQAA 3TEHB 3I55A 3CCUA 2RHQB 1PA6A 3K81C 4IOCA 4B3ML 1Y1VG 5M3MG 4R4CA 4L5SA 4DR1Q 4HJAA 4YWMA 2AHOB 5M5WH 4BXXH 3KFUA 3CC7A 4JBJA 1I6HH 3U4ZA 1B8AA 2QGQA 4DR2L 5LMUQ 4A3KG 3CPWA 1WYDA 2MNAA 1KQSA 4YCUA 3FP9A 3DLLA 4POFA 5GAGC 4OXPA 2Q2UA 3NELA 3S24A 2K14A 3H0GG 1SE8A 3I4OA 3U50C 4DR3Q 1QVFA 2XTIA 2JA6H 1A63A 4BY1H 3KLWA 3CCLA 3PIPA 4X62L 1VQ5A 3HOYG 5C4JH 4OWWB 4BA2I 2UUAQ 2KENA 1PH8A 2KHIA 3CPFA 4MNOA 4R4TA 2WP8J 4QY7A 3I4MH 4DR1L 4DV1Q 1WOCA 4OO1I 4EX5A 1X6OA 1HR0Q 3AEVA 1PVOA 1S3OA 5GROA 5JJKA 3JAMc 2PI2E 2N49A 1EFWA 1SMXA 1B7YB 2KBNA 4UP7A 2MQHA 3A5ZB 3TQYA 2UXDL 1KXLA 1KL9A 3W1BA 4JI3L 1BKBA 2ALYB 2VY3A 1HR0L 5M3MH 4GKKL 3M85A 1PH3A 2ZTDA 4AQYQ 3STBD 3KDFB 4YWKA 4BBSH 2UU9Q 4UPAA 3TS2A 4DV7Q 1HNXQ 3GTMH 3OW2A 2OWOA 3S1MH 1Y1WG 1NMGA 2JK8A 1X3FA 3ERSX 1VQFA 2ES2A 1JE5A 1SFOH 1QZHA 4JBWA 3J80c 2WB1E 3UE0A 4JI0L 4GKKQ 4LNQA 3U4VA 1XJVA 1NY4A 3AQQA 2E2IH 1I3QH 5M3FH 1YHAA 1OTCA 4JI2L 4GOPA 4L5TA 1Y1WH 2E2JH 1LYLA 2AMCB 3IRBA 1WCMG 1L0WA 4NPSA 1YITA 4X6AH 2I5LX 4DK6C 3M4OH 4GNXB 1H95A 3K0XA 4DPGA 2JEAI 4KHPL 4X65Q 3EIVA 4LF7L 4LF7Q 3CP0A 4DAYB 1YBYA 3I7FA 3H3VH 1L1OA 4B3MQ 3J7ZC 2R92H 2ID0A 4ME3A 1HH2P 4DV2Q 4YHHQ 4K0KQ 1AH9A 3W1GA 2ZJRA 1K9MC 1N33Q 1D7QA 4JI6Q 3HOZG 5FLXc 1FGUA 2JJQA 4A93G 5BR8L 2B29A 1BBUA 1NBWA 2KCMA 4JOIA 4P72A 5M3FG 2K52A 4OWTB 1X3GA 4GNXC 4A3EG 1PH7A 5FLMG 1KD1C 4B3TQ 2NVQH 3KYHC 2VUMH 1E22A 4LF9Q 1X54A 5AJ3L 3M7NA 1VQBA 1I5FA 1WI5A 2BH8A 1XPOA 5HY6A 1VQ7A 1VQCA 4BBRG 4A93H 2DGYA 3HOZH 1TWFH 1JB7A 2I0QA 4L5RC 1HNWL 1IBMQ 3UDGA 5IYDG 2B3GA 1RL2A 1V43A 4GNXA 4DV4Q 5IP9G 1DGSA 4GKJQ 2QA4A 3I2ZA 2UUAL 1VQIA 4LW1A 3S16H 4HIMA 4BXXG 1LUZA 1YVCA 1Y1VH 2AKWB 2ZJQA 1MKHA 2UUCL 4LF5Q 1TWCH 4H02A 2R7FA 4X62Q 4BBRH 3ER0A 1Q81C 1UE6A 1Y14B 4GN3B 1KIXA 1VQ9A 3CCSA 4IPHA 1PH5A 2Q2TA 2R7ZG 3K7AH 3HOYH 2UUBQ 5ELNA 1VQKA 4APVA 2KHJA 2Q2HA 2NVXH 1CSQA 3E9HA 1N36L 3OTOL 3H0GH 1U5KA 1I94Q 4GKJL 5JEAG 4UP9A 1XMOQ 1NE3A 3UDIA 4UP8A 3PF4A 1YHQA 4DR6L 3F2BA 2EXDA 1RIPA 4X66L 1VQMA 1Q86C 1WFQA 1M90C 4JI1Q 3D0FA 4DR6Q 4QJFA 2D62A 4JG2A 3FHWA 3HOXG 3RNUA 4A3JH 3HOVG 4LUOA 3M3YH 4LFBQ 2CFMA 3B6YA 3AYHB 4DV0L 2A19A 3FKIG 4JBKA 1NTGA 2K5HA 2UXBQ 2UXCQ 4OONA 1E24A 2HQLA 3KF6B 1X9NA 2E8GA 4DV5L 1IL2A 3EBEA 2EIFA 3CQZH 2VS1A 3M9BA 1YNXA 3PGZA 4P74A 4PZ8A 3RZDH 2WAQG 3G4SA 4JI6L 4LF4L 1N33L 4PZ7A 4JCVE 5LMNW 2UUBL 4Y52H 4OX9L 1Q1BA 2N3SA 1YJNA 1CSPA 1IBML 4R4OA 3WWVA 2IHEA 4X64Q 4IFDJ 3CW2C 2NZOA 1OXVA 2C35B 1N34L 5IP7H 4R1JA 1X3EA 4A4IA 4KHPQ 1Q1EA 1X65A 1L1OC 1PHJA 4EQ5A 4LFCL 3TS0A 4DR7Q 1EIFA 4KI0A 1HZAA 4DUYQ 4B3SQ 2Y0SG 2N78A 4JOIC 3STBC 1MJEA 2IX1A 1Q46A 3J7A5 1LTLA 4DV0Q 3BJUA 5C44H 2R7DA 3CCRA 4HJ9A 1N32L 4LFBL 4HIKA 2D0PA 1U0LA 2GVAA 3J80i 1W2BA 2F52A 4YHHL 4YWLA 3HKZG 5IP9H 2JA8G 1Z47A 4IPDA 4QGUA 3A5UA 3PUXA 2D0OA 4TVAB 2UUCQ 1A0IA 1D8LA 4WJ3M 3I4MG 1CKOA 1OXUA 4B3TL 4DR4L 1VQ6A 1TWHH 2NZHA 3KDFA 4NXNL 4DV3L 3T1YL 2WFWA 1QVGA 1GD7A 2R6GA 4HJ8A 1M1KC 3CC2A 4IFDG 1OXTA 1QZGA 3E9IA 1HJPA 4O2DA 3CMEA 4C2MH 4DV3Q 1YJ9A 4C3JH 5EAYA 3KJOA 1YI2A 3GTQH 3JC66 3K8AA 2IHFA 5IE8A 2CWAA 5IYDH 2I5HA 4FDBA 2BH2A 4HJ5A 4HJ7A 1G6PA 4JI7Q 3CD6A 3KOJA 3RZOH 3FKIH 5C3EG 4A3KH 4BA1I 1XMQQ 1FJGL 2IT1A 2OTJA 3HKZE 1K8GA 2NN6I 2R92G 3L7ZC 2V1CC 1BBWA 5JEAJ 4A3BG 2CCZA 1X55A 5IWAQ 4O0AA 1YIJA 4LF8Q 3J81j 4GS3A 4AYBG 1QUQA 4GLAC 1VQHA 5J3BA 4B3RQ 1E3PA 4MZ9A 2JA5H 1N34Q 4PMWA 4RMFA 3H3VI 4IO9A 2HIVA 1K0RA 1XNRL 3Q8DA 4JI0Q 4A3LH 4A3CH 1KC8C 4L5QA 4HIOA 1VQGA 4A3GG 3I4NH 4DV1L 1G291 4JYAQ 3HOUG 3BZCA 1MIUA 3EN2A 5IT9c 3U58A 3S1QH 3S15H 2H5XA 3GTJH 1HNXL 1EOVA 4OX9Q 3MXNB 5IYCG 2A8VA 4BY1G 4GOPB 4LF9L 3W5OA 2JA7G 2K50A 2FXQA 1CUKA 1YEZA 3D31A 3PF5A 1I94L 1IBLL 1E7ZA 2N8NA 3PIOA 1T9HA 3RN5A 1VQ8A 2I5MX 2RF4A 4BBSG 1Z9FA 1IXRA 1XNRQ 3S2DH 2K4KA 2IX0A 2ZTCA 4DR5L 3J81c 1MJCA 1VS0A 2KCTA 3S1RH 4ALPA 3S2HH 4C3HH 2GVBA 1P16A 4LFAQ 1VQLA 3ZJYC 4A3DH 1EUJA 4WJ4A 3A0JA 2EQSA 4IPGA 2GN5A 1IZ6A 1G51A 2CKZB 2K75A 3LGJA 4JI5L 5C0XJ 3NEMA 2ATWA 1VQOA 1PYBA 3TRZA 4X65L 2ZTEA 1K8AC 2ASBA 1QUQB 2CWPA 1QVCA 2Q2IA 2XGTA 3AFPA 2VQFQ 4LFAL 1IYJB 4DV6L 4AYBE 4DR3L 1KRTA 2JA7H 4DV4L 2AWNA 2MO0A 4JBMA 3L2PA 4DV6Q 3K7UC 1SLJA 3A74A 4A3EH 2VUMG 3ICEA 1VQPA 1JJ2A 1V9PA 5E7NA 4NXNQ 4PG3A 4DR2Q 4DUZL 3GD7A 4A3LG 5AJ3Q 1J6QA 4A76A 2RCNA 2MO1A 3PUVA 3I56A 1A8VA 2NVYH 3PUZA 2HHHL 4QL5A 4JI4Q 3PO2H 3GTKH 5FJ8H 3HOWH 2NN6G 1N9WA 1HZ9A 2BA0A 2YTYA 2AWOA 3F1ZA 1JJCB 4KHZA 3TREA 4A3FG 3E0EA 3G48A 1HZBA 1HNWQ 1HZCA 4QQBX 5C3EH 2K5VA 4JI4L 1PH2A 2HHHQ 2VW9A 3T1YQ 1C0AA 1YZ6A 3G71A 1VQAA 5IYBH 4NXMQ 2L15A 1UE7A 1HR0W 4A3IG 1PH4A 4POGA 2DUDA 2A1AA 1PV4A 4JI7L 3RR5A 3SGIA 4J15A 1XTDA 2YTVA 4IJHA 4DK3C 1K73C 1EQRA 1K3RA 4B3RL 4JC0A 4LF8L 3CCJA 1HNZL 1CKNB 1O7IA 5IWAL 4IPCA 1PH1A 1UEBA 3JAMi 3HKSA 4R4IA 4OWXB 4PZ6A 3ULJA 5GAEC 2JA8H 1IBLQ 4YCVA 1EYGA 2HIXA 4YY3Q 4DV7L 4YCWA 1IBKL 5C44G 1FJGQ 1OXXK 2WAQE 4BY7H 3KF6A 1FVIA 4QIWE 4IFDI 1K83H 2WB1G 3CF5A 1V1QA 1GO3E 1S40A 3HFZB 3G6EA 2ZJPA 4GLXA 4R4QA 1GVPA 2PNHA 4OO1G 1UE5A 2CQOA 1ASYA 1NMFA 1EQQA 2Z0SA 3UDFA 4DR5Q 4C3IH 5JJIA 3MEFA 4MTNA 3PUYA 1OXSC 4GLVB 1L2FA 3GTPH 3DM3A 2UXBL 3M4QA 3PV0A 1B70B 1KAWA 3M4PA 2OTLA 1N8RC 2JA6G 4XIGS 3PO3H 4JI5Q 5IYBG 4P75A 1Q8KA 5H1SE 4A3GH 2UU9L 1VCIA 2QEXA 1CKNA 5C0XI 1VQJA 4DUZQ 1J5EL 4XTCS 5ELOA 2K5NA 2B63H 1R9TH 3CMAA 1SN8A 1J5EQ 1N32Q 1TXYA 2UXDQ 4DKAC 1PFSA 4GN5A 4A3JG 1Q82C 4IJLA 3CCVA 2PMZE 5LMNL 3HOVH 3S14H 1VQEA 4NB3A 4DV5Q 1XPRA 3K80C 2VQFL 3KF8B 4DR7L 4Y7NH 1L1OB 1TWGH 5HGQA 2JQOA 3PUWA 3NBHB 3H15A 2ZM6Q 2YU9H 1XNQQ 4DR4Q 2R93H 2VQEL 1KHIA 4LF6L 2Z6KC 1NJIC 4X64L 1XMQL 1VQNA 2OQKA 3PO3G 3CCEA 3CC4A 1FL0A 1JJGA 1PH9A 1EWIA 3CAMA 1YJWA 3ULLA 3KJPA 2PQAB 4IOAA 2LXKA 4GOPC 2LSSA 2JE6I 3CCQA 3T1HL 4KLKA 2R7ZH 4A75A 1ASZA 4RG1A 2JA5G 4B3SL 2VZAA 3S17H 2OCEA 1Q7YC 2MFIA 4A3MG 1E1TA 2Z6KA 3PCOB 5LMNQ 1KRSA 1UWVA 2JEBI 4P71A 5LMUL 3F8TA 4A3FH 1HNZQ 2F4VQ 3S1NH 2E2HH 4LWCA 1JMCA 4BY7G 4A3BH 2YTXA 5C4XG 1CKMA 1Q12A 1YHBA 5FJ8G 4DV2L 4DNIA 4UY8C 5M5XH 5IY0A 5C0XG 2YV5A 3NENA 1UE1A 4LF5L 2VQEQ 1PH6A 1IBKQ 3GTOH 1GKHA 4TQUS 4YY3L 2ZM6L 3AFQA 1XNQL 2VL6A 3L0OA 3GTGH 2VNUD 3GTLH 2F4VL 4JYAL 1TWAH 3CCMA 2JA9A 4LUZA 2YYZA 4LUVA 5IP7G 1N36Q
chains in the Genus database with same CATH superfamily
1C9OA 5EKLA 2BCOA 1TS4A 3OYYA 4C1NK 4JI8L 1WTPA 1EYCA 2ZT9C 4C3HB 1CZGA 3GO5A 1AE3A 3MZ5A 4JI8Q 5C4JB 5ELDA 3SK8A 1XMOL 1PTOB 4AQYL 2PPBC 4ZUIA 3BU2A 3HOWG 4C3HG 3BZKA 1F2MA 1EY8A 4GN4B 3J7AV 1R4PB 2BA1A 2PI2A 4FO2A 3KF8A 1IKMA 4LF6Q 1X56A 2BOSA 1BVSA 1ZKOA 4HCEA 3F2CA 2OXPA 4ABNA 3I4NG 4HEDA 1W3SA 5DLQE 4K5VA 5K5PA 5GAHC 2R93G 1CTMA 1JT8A 3F2DA 1PA6A 4IUNA 4QUCA 4IOCA 1Y1VG 5KRUA 2D9UA 4L5SA 1HFNA 4DR1Q 2AHOB 3R93A 3CC7A 2F0KA 3U4ZA 4KJOA 1YNJD 5IT9L 3FP9A 5GAGC 4A3IB 1HCZA 1STEA 1SE8A 4DR3Q 3LX0A 1IKLA 4X62L 4WRDA 4DXFA 4OWWB 1PH8A 1TS2A 4R4TA 4Q5VA 2WP8J 4DV1Q 3AEVA 1X6OA 1LT4D 4NDXA 3FRPB 1LACA 3KLSA 1DOKA 3JAMc 3TQYA 1QNUA 2WINB 2UXDL 5EGTA 1TKWB 4JI3L 1STGA 1EFID 5M3MH 4NMZA 3C1FA 3STBD 1ZEQX 2XRSD 4UPAA 1HNXQ 1LTGD 3OW2A 4JBWA 4CJ2C 2WB1E 4GKKQ 4LNQA 3IAYA 1EY6A 4BBRB 1AW7A 1I3QH 3S1RB 1YHAA 1LYLA 1AZQA 1MSHA 2O5JC 3M4OH 4DPGA 3S16B 2JEAI 1I4HA 2PCFB 4DAYB 2PO4A 4KY7A 3I73A 2EY2A 2ID0A 1SNMA 4BY1B 1LTRD 4LK1C 1PXUA 1HTPA 3M3YB 4G7OC 1EOTA 4A93G 5BR8L 1D6EC 2EZVA 2JSOA 3I91A 3GTMB 2ZXPA 3RUZA 3S1MB 1JQYD 5JPMC 3SK6A 2EY5A 4ODGA 2K03A 3J81L 1I5FA 1XPOA 2BH8A 1VQ7A 2PZWA 4KK7A 4A93H 2E74C 1TWFH 1IBMQ 4XDXA 2B3GA 3BZDB 5IP9G 1VQIA 2EYMA 4LW1A 2Q8TA 3P1HA 4XYQA 3K5MA 4BXXG 1JWSD 1YVCA 4X3UA 1MKHA 2UUCL 4G7ZC 4LF5Q 3T4AC 2O2LD 1E2WA 1UE6A 3ER0A 1CA6A 3CCSA 2RBMA 5CV7A 1S5CD 4RGOS 2CH4A 4APVA 3NHHA 2M00A 4OELB 1CSQA 2G9DA 2WKDA 3OTOL 1VMPA 4HMIA 3VR2A 1Q8IA 2B2YA 4ID6A 2B39A 4OGQC 4RFBA 1RODA 3HGBA 2EXDA 3K0YA 4DXGA 1ICWA 5IGDA 4QJFA 2D62A 3HOXG 1GUGA 2M9VA 3RNUA 4A3JH 3HOVG 4LFBQ 1HFGA 2CFMA 2NUCA 1SYFA 4DV0L 1CK1A 2K5HA 4OONA 1X9NA 3KF6B 3RZDH 2B63G 1CFMA 3S2DH 1LTAD 2WAQG 1N33L 1Y69U 5C4XB 2F0FA 4PZ7A 2UUBL 4Y52H 1Q1BA 1IBML 4V0BA 1F9QA 3KLSX 5G3LD 5ELBA 1D5MC 1B2TA 5EPLA 2C35B 3HEJA 5IP7H 1JOOA 2NVXB 3S1QB 2FJ2A 1RHPA 4DR7Q 4LFCL 3TS0A 1EIFA 1HZAA 3PO3B 1IL8A 3P75A 2N78A 5I4DA 3STBC 1Q46A 4QIWB 2HDLA 4DV0Q 1ENAA 3CCRA 1N32L 2D0PA 2F52A 3UI2A 4YWLA 1SEBD 3HKZG 4DGZA 4FNFA 1EY7A 3R2IA 3H94A 5I2XA 1D8LA 3A55A 3BVGA 2ZXRA 4HSPA 3KDFA 2HUGA 4Y7NB 3CC2A 4O2DA 3CMEA 4K2KA 2WB1B 4DV3Q 5EAYA 1YI2A 3GTQH 2IHFA 2CWAA 4IUUA 1A6XA 4HR7B 4FDBA 1BCPC 2BH2A 1EQVA 2EJGC 3KOJA 3RZOH 2IX3A 3FKIH 1FJGL 4C1NI 2R92G 1YNJC 5A35A 3GP7A 3L7ZC 5JEAJ 1F9SA 3I4MB 4O0AA 4LF8Q 5J3BA 1E3PA 2JA5H 1N34Q 2H4OA 4PMWA 1DCZA 4IO9A 3Q8DA 4JI0Q 1KC8C 3JAML 3I4NH 4DV1L 1KAAA 1MIUA 3U58A 4QB4A 2D5DA 1PRTB 3NXWA 1CUKA 1AFPA 1Z9FA 2K4KA 3BDOA 3BVZA 2CQAA 2F4IA 2KOLA 3X3NA 4C3HH 3L3OC 4N8X1 4LFAQ 1EIGA 1PTOD 1M8AA 2K75A 1G51A 4JI5L 1PYBA 2AQ2B 3WOEA 3A8IE 4EVOA 2VQFQ 1W6KA 4H0LC 4XT3B 4AYBE 2JA7H 2AUJD 2MO0A 1SE3A 3K7UC 3Q0AA 4A3EH 3ICEA 3A7AB 1DZ1A 5CR3A 4WFN3 1JJ2A 2K01A 2NZ1D 4PG3A 3GD7A 3D4DA 1J6QA 3DHQA 5FLXL 2MO1A 4J1MA 4IUVA 2NVTB 1TWCB 5FOBB 5FJ8H 4ME5A 5EPJA 4F88A 1FD7D 2L0CA 1HNWQ 3HKZB 4C3IB 3ZYYX 4JI4L 3S15B 2F0NA 3S9WA 1YZ6A 3GTPB 5IYBH 2L15A 1UE7A 4EGVA 2DUDA 1PV4A 1PTOF 3SK4A 3QB3A 4B3RL 4JC0A 3HOYB 4LF8L 3CCJA 1CKNB 3BS1A 2ZXOA 2LKVA 4OWXB 3TBIB 3VYSA 4YCVA 2EDGA 2HIXA 1PDQA 1IBKL 5C44G 1FJGQ 1OXXK 2WAQE 1B4OA 2WACA 3K5OA 3CF5A 4PMCA 3HFZB 2ZJPA 2KJXA 3CRLC 1GVPA 4OO1G 1D5XC 1D1KA 2Z0SA 3M7GA 4ZAIA 1CQVA 1EY9A 1K28A 2KHSA 2JA6G 4XYOA 4C3IG 3PO3H 5A2QL 3OPOA 1A2UA 4KHVA 1Q8KA 4P75A 1VCIA 1VQJA 4G7HC 1R9TH 4GZYC 1J5EQ 1BXTA 1U4RA 4GN5A 2F0QA 1Q82C 5COYA 2F1MA 2F0TA 3K80C 4DR7L 1TWGH 2X6GA 2XIWA 2K1BA 4CKCA 5HGQA 3J80L 3PUWA 4DAPA 3CHBD 4BY7B 1SNOA 4C2MB 3D6CA 3L9AX 1B9MA 1KHIA 1SE4A 1JB3A 1WVLA 1U4LA 2OQKA 3PO3G 1F77A 3CC4A 1PLFA 1YJWA 3KJPA 5I6YA 4IOAA 3IFDA 2R7ZH 4OO1H 1STYA 2MUYA 2DN8A 2VZAA 3S17H 1Q7YC 4A3MG 3H91A 1E1TA 5KYLA 3PCOB 5LMUL 1KRSA 4IALA 2JEBI 3U9SA 2E2HH 2DY7A 2JN4A 5C4XG 4A93B 3HRZC 3DMUA 5M5XH 4LF5L 2YV5A 1GKHA 4YY3L 2ZM6L 5C5MA 3L0OA 5KNDA 2F4VL 4JYAL 3CCMA 4LUZA 2F0PA 2YYZA 3KK7A 4RCOA 1WD0A 4A3GB 2HT1A 5K36G 1P8LA 3QO2A 3VR5A 2QEJC 2KA7A 3UDXA 1EIYB 3PSIA 4PMBA 3V96A 2B63B 3WDNA 2NYZD 2F3IA 1SRUA 4RWSC 1F9PA 1BF4A 3K57A 1GM5A 4M8AA 4LF4Q 1I50H 2B2UA 4A3DG 5BR8Q 2EE1A 3OTOQ 2YU9B 5JAVA 2MPMA 1KLUD 2Y0SE 3OWFA 4K0KL 1WCMH 3VYRA 4AH6A 3VA5A 2Z8LA 3DEOA 3GTGB 2EOTA 5IYCH 2E5LQ 3RZDB 2J7ZA 2OF1A 3FDTA 4LFCQ 4HCSA 4A3CG 1T5EA 3J81i 2NVTH 3GTKB 1NR2A 3I55A 3CCUA 1BQQT 1ILQA 4HJAA 4YWMA 5M5WH 2X6LA 3KFUA 1I6HH 2LMCB 4DR2L 5LMUQ 4A3KG 4YCUA 5C44B 3NSWA 3AMUA 4HTHA 3S24A 5C4HA 1B44D 1QVFA 4I65A 1B1ZA 2PYKA 2XTIA 3U50C 3RZOB 2KCNA 3CCLA 5IGBA 2F0GA 3PIPA 4X3TA 1ML0D 2HQEA 3OSOA 1VQ5A 3HOYG 3T51B 2DNCA 2KENA 3KBXA 2IL8A 1GXDC 1L0YB 4QY7A 3I4MH 1Y8OB 3HOXB 1J8IA 1IW7D 1PRTF 4I7AA 1PVOA 1HHVA 2D2CC 1B7YB 1BKBA 3BVMA 1I4GA 3FEWX 3QWNA 3HG9A 4GKKL 1ET6A 2OT2A 2ZTDA 5C3XA 3KDFB 4YWKA 4EQNA 1VMCA 4DV7Q 5JEAH 2OWOA 3S1MH 5J22A 3ERSX 1Y1WG 1MGSA 1SYBA 3J80c 3H09A 5G3LF 3UE0A 1K0SA 1K83B 1XJVA 5KEEA 3SK5A 1AN8A 2E2IH 5E1FA 2PZUA 4GOPA 3E0JA 1HRJA 3IRBA 1WCMG 1L0WA 4X6AH 3K0XA 3ND8A 3EIVA 1RJTA 3H6MA 3CP0A 3MVVA 3I7FA 3H3VH 1L1OA 3KUPA 3K5NA 2EYHA 3J7ZC 2R92H 1HH2P 2JA7B 4YHHQ 1ET9A 4K0KQ 2EYJA 4EQOA 3W1GA 1FNWA 1B50A 1K9MC 1H9SB 5EKIA 1HTLD 1FGUA 2JJQA 4YIJA 3TN2A 3VR3A 3SHLA 3ND9A 1BBUA 2RSNA 1NBWA 4JOIA 4GNXC 5M3FG 1PH7A 2K52A 1KD1C 2NVQH 4B3TQ 2VUMH 1UUPA 2VB2X 1E22A 1K8MA 1VDZA 4LF9Q 1X54A 5AJ3L 1VQBA 3N52A 5IGCA 4BBRG 2L5TA 1JB7A 2I0QA 1PFNA 4L5RC 3X3MA 2SDFA 2A6ED 2HCIA 1EYAA 1RL2A 1C8CA 4IUQA 1D5ZC 2QA4A 4H44C 4PQXA 4HIMA 1LUZA 1O7ZA 2ZJQA 2AKWB 1G91A 3BYYB 4L6TB 1E2VA 4OIJA 1TWCH 2R7FA 4X62Q 5EBCA 1Y14B 1KIXA 1KLGD 1H9SA 4IPHA 1PH5A 2R7ZG 1BCPB 1NR4A 3H0GH 1I50B 1U5KA 4RH6A 4CDDC 3NUCA 1I94Q 4GKJL 1XMOQ 3GTQB 4DR6L 4N8FA 1NNXA 2J0TD 1RIPA 1VQMA 3HOZB 3QR8A 3EA6A 1JCKB 1RCVD 1QE6A 1SMYD 4DR6Q 3FHWA 1Q90A 3B6YA 3AYHB 2A19A 4JBKA 1SSOA 2UXBQ 4N9PA 1E24A 2HQLA 2E8GA 1IL2A 1KTKA 2VS1A 3EBEA 5ELCA 4CKEA 4PZ8A 4LF4L 3G4SA 2A74C 4X64Q 4IFDJ 3CW2C 4OEMB 2Q8RE 3WOFA 4A3KB 1X3EA 5EJWA 1X65A 1L1OC 1PHJA 2BE5D 4U673 1ESRA 2Y0SG 2B2VC 1Y1VB 4PV1C 3J7A5 2F0HA 3P7JA 3BJUA 5C44H 4HIKA 5IP9H 2D0OA 1A0IA 3GV6A 1HXYD 1CKOA 1U4PA 1HA5A 3I4NB 3HOVB 1OXUA 2BE5C 4B3TL 4ZKCB 1TWHH 4NXNL 3T1YL 1TVXA 2WFWA 1GD7A 2R6GA 3CQZB 4HJ8A 1QVGA 1M1KC 4IFDG 3E9IA 3KLRA 4RGNA 4C2MH 5A2QE 2C9OA 4C3JH 3KJOA 5IE8A 2F0WA 5HURA 2F0UA 1G6PA 4HJ5A 1C48A 3CD6A 1Z7TA 1DD2A 5IIFA 3PIP3 4A3DB 1K8GA 2NN6I 1LT5D 2NB0A 3S17B 2V1CC 1U4MA 1WTHA 1X55A 1LV9A 5IWAQ 1YIJA 4NKLA 4HAEA 4J6HA 4AYBG 3I72A 4MZ9A 4RMFA 5LL6X 2HIVA 1S5FD 2B2TC 1ZYRD 4L5QA 2IWHA 4TKOB 1VQGA 1I4XA 4KY5A 4A3GG 3HOUG 2WIIB 3S15H 1EWHA 1ENCA 3MXNB 3W5OA 2JA7G 2K50A 2FXQA 1I94L 1UAPA 1VQ8A 1E7ZA 2N8NA 3PIOA 2RF4A 4RKBA 2ZTCA 2IX0A 4DR5L 2DJGC 4HMJA 5M3FB 4ALPA 4DU9A 4FF4A 3GQBA 3C46A 1PFMA 1EUJA 2F0MA 3OWEB 3A0JA 3DUZA 4IPGA 3SXHA 2CKZB 3LGJA 2ATWA 5BN5A 4KV6A 3NP8A 4X65L 2FMCA 2A6EC 2EXZA 2Q2IA 3AFPA 4LFAL 1IYJB 4DV6L 1MD2D 1X3QA 1EY5A 4DV4L 2AWNA 2VUMG 3A74A 5D3IB 3BYTB 2N88A 4HSVA 3EJIA 1Z6HA 1LABA 1V9PA 2RDHA 2Z1CA 4NXNQ 2FHTA 4MIUA 1NUCA 2JYOA 1BR9A 4A76A 4XXEA 2NBFA 3I56A 2NVYH 4QF4A 2K05A 1CZWA 2ENBA 4JI4Q 3GTKH 2HCCA 5CV4A 3HOWH 2YTYA 3D3RA 4KMUC 4DNRB 4S3SA 5JOBA 2O4XA 3TREA 4A3FG 3G48A 1HZBA 1HZCA 1BCPD 5HGTA 4KN4C 1PH2A 2VW9A 1TQOA 4NXMQ 2EPBA 1D1IA 3RR5A 3SGIA 4RAUC 1SYGA 4B9WA 2YTVA 1G2TA 1QWYA 4DAYA 1HNZL 1O7LA 4OIKA 5KGUA 1RDPD 5CC4A 1EZ8A 1IBLQ 5C5LA 5ISRA 4ZUJA 1E0BA 4DV7L 4XQJA 2QILA 4DN4M 1K83H 2WB1G 4A3BB 1V1QA 4KD4A 2KEEA 4H7BA 4R4QA 4GLXA 4DA2A 2P5ZX 2PNHA 2F3WA 2CQOA 1EQQA 1KDBA 3EROA 4CDFC 1L2FA 1KNAA 3DM3A 3M4QA 1KAWA 2OTLA 1N8RC 3EVQA 3BDCA 1H9RA 4IURA 4A3GH 4DK0A 5H1SE 1HQRD 2QEXA 1MSGA 1WD1A 2FMMA 3MTSA 2B63H 3ITPA 1SN8A 2I46A 2QCPX 2XN9C 2UXDQ 4DKAC 1LT3D 4A3JG 1Y1WB 4IJLA 3CCVA 2PMZE 5LMNL 3HOVH 1G6ZA 1XPRA 2JA8B 5I9OA 1GHJA 1KDAA 3T56B 4FYDA 5E3FA 4K6LA 2ZM6Q 1Y8NB 2L4NA 2Z6KC 3MWYW 3PMFA 1WTQA 1GUOA 4C3JG 3CCEA 1CQFA 1JJGA 1PZID 2DNEA 1EWIA 3CAMA 3ULLA 2KUMA 2B2YC 2L12A 1KNEA 2LXKA 2JE6I 3T1HL 4P2CB 1I4PA 1ASZA 5EBDA 4QCLA 3FPPA 2F0SA 2Z6KA 5LMNQ 4P71A 3F8TA 1F2YA 1HUMA 4PNYA 2YTXA 3AB9A 1SMYC 1YHBA 3A8JE 1DOMA 1S4ZA 3KBGA 2F0DA 3GTGH 2VNUD 3MXPA 5JVH3 1Y8PB 2JA9A 4LUVA 1N36Q 2F03A 2UUAQ 1BBXC 3R8BA 2E5LL 1XXGA 4A3IH 2L55A 1GOZA 5IOCA 4JV5Q 1EZ6A 2CHBD 1VQ4A 1WJJA 3GDEA 4A3JB 4JV5L 4CHTB 3CXCA 2KQ3A 3UE1A 1DXMA 1AE2A 5GQOA 2AQ3B 1JWUD 1SR3A 2NTSA 5C4XH 3J7YW 3ULPA 1S72A 5IGGA 2UXCL 4JI3Q 5CORA 3VR4A 4A3MH 2K28A 2R61A 1SROA 2MP1A 1JR0D 5M5YH 4X66Q 2K5WA 2PW5A 3BG3A 1PYWD 5JJLA 2IY5B 2F0EA 1PYSB 1BO0A 1I6VC 3S1NB 3T1HQ 4HIDA 2B2UC 3VR6A 2ICEC 3RLNA 4DK1A 2PQAA 3TEHB 4B3ML 5M3MG 4FXKC 1TY2A 4UDUC 4ZKBB 2F0LA 3I3CA 1B8AA 2DY8A 5ELEA 2FFKB 4TRDA 4JVZA 2NTTA 3CPWA 2MNAA 2DJFC 4POFA 1HQMC 4OXPA 2Q2UA 5I6WA 1YNNC 3H0GG 3I4OA 2JA6H 4U68A 5DEHA 5JPNC 4BY1H 5CGKA 2G9HD 4KTAA 2KHIA 1V1PB 2NVQB 3OIQA 3BDLA 5TSSA 4DR1L 1WOCA 3I90A 3VA7A 4X3KA 4EX5A 1S3OA 2IJ0A 1WTOA 3QIAA 1EFWA 1SMXA 3A5ZB 4V190 1KL9A 1F9RA 3W1BA 2ALYB 4K5WA 2VY3A 1HR0L 3G7LA 5DAUA 3M85A 1PH3A 4AQYQ 4BBSH 2CW0C 1DOLA 3GTMH 2J4XA 2JK8A 1VQFA 1ICFB 3NBIA 3MAQA 2AUKA 1NY4A 3AQQA 1B53A 3A8KE 4WJWA 5M3FH 4L5TA 1Y1WH 2AMCB 2I07B 1YITA 4NPSA 2I5LX 1H95A 4KHPL 5DM73 2XWJB 5C6AA 4LF7Q 2Y0SB 4O42A 2L11A 4DV2Q 4JPBW 2A68C 3V2TA 3SVMA 1AH9A 2ICIA 2ZJRA 1D7QA 4JI6Q 4FXGC 3HOZG 2B29A 4Q0FA 4P72A 2EYOA 4A3EG 1X3GA 3H0GB 3NTIA 1NCVA 3KYHC 4AYBB 1GUTA 3ERQA 1WI5A 5L37A 5HY6A 3R3OA 5D3DA 4XT1B 2MHVA 1VQCA 2DGYA 3HOZH 2IW3A 5JJZA 1HNWL 3UDGA 4KKSA 1V43A 2XWBB 4DV4Q 1I4QA 3T13A 2A6HC 3S16H 2Q8IB 1PTOC 5IGEA 3TDQA 4A3FB 1LTID 2WV6D 2Z9HA 3RMHA 1EQTA 3TP6A 5CMDA 3TMEA 4H02A 4G4KA 1Q81C 4CJ1B 3MEHA 2Q2TA 3OHXC 3K7AH 3HOYH 1UNSA 5ELNA 2NVXH 1STHA 4FVMA 3E9HA 1LT6D 4FF2A 2QF7A 3Q23A 3J80E 3I8ZA 1NE3A 3PF4A 1YHQA 1H9MA 3F2BA 1GHKA 3I4LA 1EL0A 1Q86C 1WFQA 3A7LA 3D0FA 2K6AA 5M5YB 2MJ8A 2K32A 3M3YH 4LUOA 2Z6BA 3FKIG 4R8NA 1EU4A 2RQXA 5IYDH 4DV5L 2KEDA 1VQPA 3M9BA 4JI6L 5KNBA 4JCVE 2E76C 3G6JB 2JA5B 1A15A 2B2WC 1HA6A 1PMRA 5T1IA 1N34L 1DYQA 1WTXA 1MHWC 4KHPQ 4NP5A 3IKJA 1CT1D 3TP5A 1R4QB 4DUYQ 3HOUB 4B3SQ 5D14A 3OMCA 3NQTA 1FYCA 1LTLA 1STNA 2R7DA 2WAQB 4HJ9A 3NE5B 1U0LA 2GVAA 1W2BA 2LFNA 2JA8G 1Z47A 4QGUA 3NQIA 3R2TA 3A5UA 3PUXA 1Q3LA 2UUCQ 4X3SA 2XRQD 1VQ6A 2NZHA 4DV3L 1GUWA 3S2DB 3O13A 1OXTA 4IUPA 1YJ9A 5K36H 1EIHA 3JC66 3K8AA 3MXGA 4O1NA 4C56C 5M5XB 5F2DA 4BWGB 5C3EG 1XMQQ 1BNZA 4H13C 5FO9B 2OEOA 3HKZE 4G57A 4CGYB 1BBWA 3DWQA 2CCZA 3IL8A 5C4ZA 3H3VC 1GJXA 1L0XB 3Q22A 2A69C 3OW7A 3H3VI 1K0RA 4A3LH 1EWCA 2F0VA 4K2LA 3K5LA 3BZCA 3D8GA 4F87A 3GTJH 4OX9Q 2KECA 3GTLB 4GOPB 1A3UA 1YEZA 1RF2D 1K3BC 3RN5A 1T9HA 2I5MX 4FP5D 1IXRA 1A3VA 1MJCA 5IGFA 1RTNA 1I3QB 3S2HH 2GVBA 4RKLA 3ZJYC 2PMZB 4FXDA 4R8IA 3OOCA 3D4RA 4KY6A 2F3VA 1IZ6A 1LO5D 5C0XJ 3NEMA 1VQOA 1SNDA 2ZTEA 1WTWA 1QUQB 3IFTA 3SE0A 4ZYSA 3K59A 3LNNA 1QNKA 1DM0B 1H9KA 1SXTA 3LWUA 4LMQD 2QDLA 3JAME 1SLJA 4J8QA 1SBBB 1V1OA 4MN3A 5E7NA 1XX8A 4DR2Q 4DUZL 1B3QA 5AJ3Q 4UAIA 2QDBA 2RCNA 3HZXA 3PUVA 3EQLC 3W3AA 5EKKA 4JK1C 2EY1A 3PO2H 2TSSA 1SJED 2H1EA 1R9TB 3OIPA 1N9WA 2BA0A 1JE4A 2AWOA 2CH4W 1JJCB 1SE2A 3VYUA 1FGBD 1F2LA 2K33A 4FF1A 4QQBX 2HHHQ 3G71A 1VQAA 5LHY1 4POGA 2A1AA 5E4XA 4JI7L 4IJHA 5EPKA 2LY7A 1O80A 1EQRA 1K73C 5BN4A 2RDGA 1O7IA 1HPCA 4IPCA 5IWAL 1PH1A 4R4IA 4PZ6A 2IPKD 1SJHD 3DWPA 4BY7H 2TMPA 1DONA 1VF5C 3KF6A 1FVIA 4QIWE 1A2TA 1S40A 1CHPD 3MA2B 1UE5A 5KNCA 3MEFA 4MTNA 1S5ED 1T5XD 1OXSC 4GLVB 1PRTD 5T1GA 3PV0A 1B70B 3M4PA 3Q6SA 1XTCD 2B8GA 4KJNA 2L1BA 1CKNA 5C0XI 4DUZQ 1J5EL 1TU2B 2K5NA 4ZQ3A 1LTTD 1RD9D 1TXYA 1PFSA 3S14H 2E2JB 5C3EB 1VQEA 3QOLA 3KF8B 5CV8A 3K6OA 1L1OB 1TS5A 3K58A 3NBHB 3H15A 2YU9H 4JW0A 4DR4Q 2SNMA 2R93H 4LF6L 3OMGA 4E6IA 4X64L 4A3MB 1VQNA 5D65A 1H9JA 1E2ZA 4K8IA 4F8MA 1PH9A 1YNND 3I70A 1GUNA 2LSSA 4KLKA 4A75A 2JA5G 2OCEA 3C2PA 4IZ8A 1UWVA 4A3FH 1HNZQ 2F4VQ 4JYAQ 4BY7G 4R9WA 3NWTA 5EQ0A 4UY8C 3K7AB 1PH6A 1XNQL 3AFQA 2LS01 3GTLH 2RKSA 1TWAH 4RGMA 1TWGB 1VF7A 5IP7G 2QW7A 2HD3A 5J39A 1IYVA 2PZTA 3F2UA 5CYUA 1LM0A 1ZYRC 3RLOA 5FLMH 2JA6B 4JI1L 3S2HB 4DAMA 2RHSB 2SNSA 3C3LA 5I2YA 3VDYA 4BS9A 4NXML 3A54A 1VQDA 1AEXA 1XPUA 2R7ZB 2F0OA 5C0XH 1II3A 5CV9A 3HOXH 4DUYL 3RLFA 3E5SA 3PO2G 5GADC 4ULLA 1EY0A 2JP1A 4P73A 1A62A 3DWAA 2B2TA 4HN7A 3E6ZX 4BBSB 4K5XA 5AFWA 1E1OA 3RN2A 4AIMA 3HOUH 4IFDH 2LXJA 1BUVT 2O5IC 3Q24A 1C7YA 4JI2Q 2OQ0A 3PIO3 2FINB 3DEPA 2SEBD 2E2IB 2RHQB 3K81C 5DM63 4A3EB 1WTRA 1HUNA 4R4CA 4BXXH 4JBJA 1QOHA 2QGQA 1BCPF 2B8FA 2N55A 1WYDA 1KQSA 3D6WA 5FK9C 4EQPA 1SYEA 3DLLA 4B9XA 3NELA 2K14A 5KYIA 4XQNA 1A63A 3KLWA 2K5QA 5FKAC 1TT2A 1W6JA 2RSOA 5C4JH 4BA2I 3CPFA 2WKCA 4MNOA 2BDOA 1TY0A 4OO1I 1HR0Q 2E2DC 3DM1A 5GROA 5JJKA 2JXMB 2PI2E 2R92B 2N49A 3NPPA 3U9OA 2KBNA 2F0JA 4UP7A 2MQHA 1CM9A 1SYDA 1KXLA 1WCMB 1FNVA 4DAVA 5M5WB 1O7YA 1I6HB 2UU9Q 2QKIC 1PZKD 2K04A 3TS2A 2VUMB 2K7VA 1NMGA 1X3FA 2KCCA 2ES2A 2SOBA 3W2DA 1JE5A 1SFOH 3ONAB 1QZHA 3DXJC 3E3XA 4JI0L 3U4VA 4KKTA 1JWMD 1RKNA 4B08A 1OTCA 4JI2L 1QB5D 4ZLTF 5CBEE 2E2JH 1BDOA 4RA8A 4DK6C 4GNXB 1LTBD 4X65Q 3T16A 5CV5A 5IT9E 4LF7L 4ZRZA 1YBYA 1I4RA 2E75C 3TZUA 2AQ1B 4M1UB 4B3MQ 2EJMA 4MTKA 4KD3A 4ME3A 5FO8B 4DFAA 1TS3A 3M4YA 2Z4HA 4K8JA 2CVRA 1N33Q 5FLXc 4UHVA 4CDCC 3VYTA 2KCMA 1ONLA 1A3TA 4IQZA 4OWTB 5FLMG 4OHJA 1G2SA 1PRTC 1SAPA 3LWEA 3M7NA 3SDZA 3HOWB 4L63B 5IYDG 4GNXA 3QOJA 4RCNA 1DGSA 5M3MB 4GKJQ 4LAAA 1QILA 3I2ZA 2UUAL 2Z4IA 1SNQA 1TWAB 2RVLA 4QMGA 2A5HA 1Y1VH 1JOQA 3RD4A 2EYFA 2E2HB 3PO2B 2RDFA 4BBRH 3J7AF 4GN3B 1VQ9A 2UUBQ 1TIID 1VQKA 2KHJA 2Q2HA 4CBVA 1N36L 1CA5A 1JOKA 3TP8A 3N6RA 1PFBA 5JEAG 4UP9A 3UDIA 4UP8A 2X69A 1XYIA 1NAPA 3T53B 4X66L 1M90C 4JI1Q 3FVQA 3QG1A 1UEAB 4JG2A 2L9HA 1KABA 5CBAE 4DF7A 4IN3A 1NTGA 2UXCQ 1TWHB 3EFXD 2EIFA 3CQZH 1S5BD 3PGZA 1YNXA 4P74A 5E4WC 3MXNA 5LMNW 4OX9L 4WORA 2N3SA 1YJNA 1CSPA 1EU3A 4R4OA 3WWVA 1TR5A 2IHEA 5IODA 5FO7B 2NZOA 1OXVA 4R1JA 2EYPA 4A4IA 1Q1EA 1G8ZD 4ILWA 5JVG3 4EQ5A 4KI0A 1V1PA 4JOIC 1MJEA 2IX1A 1AZPA 1RTOA 2XNAC 1EY4A 3FPUB 4LFBL 3J80i 4YHHL 1FNUA 3D4WA 4IPDA 4F7XA 3MFYA 4TVAB 5C3WA 4WJ3M 3I4MG 1S5DD 1SNPA 3NBHA 1IW7C 1SYCA 3GTJB 1FR3A 4DR4L 2RA4A 1V8QA 1EYDA 1QZGA 1HJPA 2PQEA 2I5HA 4HJ7A 4JI7Q 2A69D 5J1ZA 4A3KH 4BA1I 2IT1A 2OTJA 4L8JA 1STBA 5LL6S 2F0IA 4IUTA 1QG7A 4K14A 4A3BG 3MC0B 5FLXE 1MBYA 3CKIB 3NK9A 3GV3A 1SFOB 3SR1A 3J81j 4GS3A 1QUQA 4GLAC 1VQHA 4B3RQ 1XNRL 4A3CH 4HIOA 2M2LA 4XQQA 3GTOB 1G291 3EN2A 4N9TA 5IT9c 3S1QH 2H5XA 1HNXL 1EOVA 2A8VA 5IYCG 4BY1G 4LF9L 2EVBA 4RHSA 3D31A 3PF5A 1IBLL 1B3AA 1D2BA 2KVMA 4BBSG 1XNRQ 4ZK9B 1QCBD 3P20A 3J81c 1VS0A 1CHQD 1KDCA 2KCTA 1X32A 1K8OA 2HDMA 3S1RH 2A68D 3A56A 1P16A 1IYUA 1VQLA 3CU7A 1ILPA 4A3DH 4WJ4A 2EQSA 4ZCKA 2GN5A 2BDNA 1PTOH 3TZDA 2GA4B 1SDFA 1JORA 3TRZA 5ELFA 1GUSA 1K8AC 2ASBA 2CWPA 1MI2A 1QVCA 2XGTA 2VB3X 4C3JB 2B2VA 1STAA 5M9OA 4DR3L 2C5CA 1KRTA 3NTHA 4JBMA 3L2PA 4DV6Q 4K6DA 1JC7A 1IHZA 2EYLA 2RCFA 1O78A 4A3LG 1J9OA 3HS0C 2CW0D 3CRKC 1A8VA 3PUZA 2HHHL 4QL5A 2NN6G 1HZ9A 5KIXA 1JICA 4OL7A 3FMCA 1EEFD 1TWFB 3F1ZA 4KHZA 3E0EA 1ESFA 2B2WA 5C3EH 2K5VA 3T1YQ 1C0AA 1LTSD 4FF3A 3HP3A 1AP0A 1ZXTA 3C1EA 3SEBA 1C4QA 4A3IG 1PH4A 1HR0W 2R93B 4J15A 1XTDA 4DK3C 1K3RA 1ENFA 1WTVA 3S14B 3PQIA 1CI3M 4TSSA 1XWEA 1OO9B 1UEBA 4DNTB 3JAMi 3HKSA 5GAEC 1BOSA 5DNFA 3ULJA 2JA8H 2NN6H 1EYGA 3MFGA 5I9PA 2A6HD 4CDEC 4YY3Q 4YCWA 1NSNS 2NVYB 3MHBA 4Z9CB 1PZJD 4IFDI 2V4DA 3AU7A 1GO3E 4CKBA 1B9NA 3G6EA 4KKUA 1U9RA 2K5DA 2NWGA 1NMFA 1ASYA 3UDFA 4DR5Q 4C3IH 5JJIA 4KN7C 3PUYA 2R3ZA 3GTPH 2UXBL 5NUCA 4XIGS 5BN3A 4JI5Q 5IYBG 3TP7A 2UU9L 4RHRA 1X3PA 2PNRC 1M4VA 4XTCS 5ELOA 3CMAA 2EJFC 2A73B 1N32Q 1SNCA 3TSSA 4CJ0B 2G5DA 2EY6A 2VXWA 3NWSA 4NB3A 4DV5Q 3M4OB 4I7ZC 4MHEA 2VQFL 4Y7NH 2JQOA 1LLRD 1XNQQ 5CV6A 2VQEL 1NJIC 1XMQL 1QJOA 2XSCA 1FL0A 3FKIB 1F2ZA 2PQAB 4GOPC 3CCQA 1DJRD 3QJYA 4RG1A 4B3SL 3MXUA 2MFIA 3S1NH 4NW2A 3V05A 4LWCA 1EEID 1JMCA 4A3BH 1CKMA 1Q12A 4LJZC 5FJ8G 4DV2L 4DNIA 5IY0A 5C0XG 3NENA 1UE1A 2VQEQ 2MGSA 1IBKQ 3GTOH 4TQUS 3NTKA 2XVSA 2VL6A 4RGTA 4QUFA 3J81E 2PW7A 3URYA
chains in the Genus database with same CATH topology
2HT1A 5K36G 1P8LA 1C9OA 2E5LL 3UDXA 1EIYB 3OYYA 3PSIA 3RLOA 1LM0A 4A3IH 5FLMH 4JI8L 4JV5Q 4JI1L 2B63G 2F3IA 4DAMA 1SRUA 2RHSB 3GO5A 1VQ4A 1AE3A 1WJJA 3GDEA 4JI8Q 4JV5L 3CXCA 3VDYA 3UE1A 4NXML 1VQDA 1GM5A 1XPUA 1XMOL 4AQYL 1AE2A 5GQOA 1I50H 4LF4Q 4A3DG 5BR8Q 1SR3A 3HOXH 5C4XH 3BU2A 3OTOQ 3RLFA 4DUYL 3ULPA 1S72A 4JI3Q 3HOWG 3PO2G 2UXCL 3BZKA 5GADC 2Y0SE 4K0KL 4A3MH 4GN4B 1SROA 2BA1A 2PI2A 1WCMH 4P73A 5M5YH 1A62A 4X66Q 4AH6A 4LF6Q 1X56A 5IYCH 2E5LQ 1BVSA 5JJLA 3F2CA 1E1OA 2IY5B 3RN2A 1PYSB 4AIMA 3HOUH 3I4NG 1W3SA 2LXJA 5DLQE 1C7YA 4LFCQ 4A3CG 3J81i 4JI2Q 2OQ0A 3T1HQ 2NVTH 4HIDA 5GAHC 2R93G 1JT8A 3F2DA 3RLNA 2PQAA 3TEHB 3I55A 3CCUA 2RHQB 1PA6A 3K81C 4IOCA 4B3ML 1Y1VG 5M3MG 4R4CA 4L5SA 4DR1Q 4HJAA 4YWMA 2AHOB 5M5WH 4BXXH 3KFUA 3CC7A 4JBJA 1I6HH 3U4ZA 1B8AA 2QGQA 4DR2L 5LMUQ 4A3KG 3CPWA 1WYDA 2MNAA 1KQSA 4YCUA 3FP9A 3DLLA 4POFA 5GAGC 4OXPA 2Q2UA 3NELA 3S24A 2K14A 3H0GG 1SE8A 3I4OA 3U50C 4DR3Q 1QVFA 2XTIA 2JA6H 1A63A 4BY1H 3KLWA 3CCLA 3PIPA 4X62L 1VQ5A 3HOYG 5C4JH 4OWWB 4BA2I 2UUAQ 2KENA 1PH8A 2KHIA 3CPFA 4MNOA 4R4TA 2WP8J 4QY7A 3I4MH 4DR1L 4DV1Q 1WOCA 4OO1I 4EX5A 1X6OA 1HR0Q 3AEVA 1PVOA 1S3OA 5GROA 5JJKA 3JAMc 2PI2E 2N49A 1EFWA 1SMXA 1B7YB 2KBNA 4UP7A 2MQHA 3A5ZB 3TQYA 2UXDL 1KXLA 1KL9A 3W1BA 4JI3L 1BKBA 2ALYB 2VY3A 1HR0L 5M3MH 4GKKL 3M85A 1PH3A 2ZTDA 4AQYQ 3STBD 3KDFB 4YWKA 4BBSH 2UU9Q 4UPAA 3TS2A 4DV7Q 1HNXQ 3GTMH 3OW2A 2OWOA 3S1MH 1Y1WG 1NMGA 2JK8A 1X3FA 3ERSX 1VQFA 2ES2A 1JE5A 1SFOH 1QZHA 4JBWA 3J80c 2WB1E 3UE0A 4JI0L 4GKKQ 4LNQA 3U4VA 1XJVA 1NY4A 3AQQA 2E2IH 1I3QH 5M3FH 1YHAA 1OTCA 4JI2L 4GOPA 4L5TA 1Y1WH 2E2JH 1LYLA 2AMCB 3IRBA 1WCMG 1L0WA 4NPSA 1YITA 4X6AH 2I5LX 4DK6C 3M4OH 4GNXB 1H95A 3K0XA 4DPGA 2JEAI 4KHPL 4X65Q 3EIVA 4LF7L 4LF7Q 3CP0A 4DAYB 1YBYA 3I7FA 3H3VH 1L1OA 4B3MQ 3J7ZC 2R92H 2ID0A 4ME3A 1HH2P 4DV2Q 4YHHQ 4K0KQ 1AH9A 3W1GA 2ZJRA 1K9MC 1N33Q 1D7QA 4JI6Q 3HOZG 5FLXc 1FGUA 2JJQA 4A93G 5BR8L 2B29A 1BBUA 1NBWA 2KCMA 4JOIA 4P72A 5M3FG 2K52A 4OWTB 1X3GA 4GNXC 4A3EG 1PH7A 5FLMG 1KD1C 4B3TQ 2NVQH 3KYHC 2VUMH 1E22A 4LF9Q 1X54A 5AJ3L 3M7NA 1VQBA 1I5FA 1WI5A 2BH8A 1XPOA 5HY6A 1VQ7A 1VQCA 4BBRG 4A93H 2DGYA 3HOZH 1TWFH 1JB7A 2I0QA 4L5RC 1HNWL 1IBMQ 3UDGA 5IYDG 2B3GA 1RL2A 1V43A 4GNXA 4DV4Q 5IP9G 1DGSA 4GKJQ 2QA4A 3I2ZA 2UUAL 1VQIA 4LW1A 3S16H 4HIMA 4BXXG 1LUZA 1YVCA 1Y1VH 2AKWB 2ZJQA 1MKHA 2UUCL 4LF5Q 1TWCH 4H02A 2R7FA 4X62Q 4BBRH 3ER0A 1Q81C 1UE6A 1Y14B 4GN3B 1KIXA 1VQ9A 3CCSA 4IPHA 1PH5A 2Q2TA 2R7ZG 3K7AH 3HOYH 2UUBQ 5ELNA 1VQKA 4APVA 2KHJA 2Q2HA 2NVXH 1CSQA 3E9HA 1N36L 3OTOL 3H0GH 1U5KA 1I94Q 4GKJL 5JEAG 4UP9A 1XMOQ 1NE3A 3UDIA 4UP8A 3PF4A 1YHQA 4DR6L 3F2BA 2EXDA 1RIPA 4X66L 1VQMA 1Q86C 1WFQA 1M90C 4JI1Q 3D0FA 4DR6Q 4QJFA 2D62A 4JG2A 3FHWA 3HOXG 3RNUA 4A3JH 3HOVG 4LUOA 3M3YH 4LFBQ 2CFMA 3B6YA 3AYHB 4DV0L 2A19A 3FKIG 4JBKA 1NTGA 2K5HA 2UXBQ 2UXCQ 4OONA 1E24A 2HQLA 3KF6B 1X9NA 2E8GA 4DV5L 1IL2A 3EBEA 2EIFA 3CQZH 2VS1A 3M9BA 1YNXA 3PGZA 4P74A 4PZ8A 3RZDH 2WAQG 3G4SA 4JI6L 4LF4L 1N33L 4PZ7A 4JCVE 5LMNW 2UUBL 4Y52H 4OX9L 1Q1BA 2N3SA 1YJNA 1CSPA 1IBML 4R4OA 3WWVA 2IHEA 4X64Q 4IFDJ 3CW2C 2NZOA 1OXVA 2C35B 1N34L 5IP7H 4R1JA 1X3EA 4A4IA 4KHPQ 1Q1EA 1X65A 1L1OC 1PHJA 4EQ5A 4LFCL 3TS0A 4DR7Q 1EIFA 4KI0A 1HZAA 4DUYQ 4B3SQ 2Y0SG 2N78A 4JOIC 3STBC 1MJEA 2IX1A 1Q46A 3J7A5 1LTLA 4DV0Q 3BJUA 5C44H 2R7DA 3CCRA 4HJ9A 1N32L 4LFBL 4HIKA 2D0PA 1U0LA 2GVAA 3J80i 1W2BA 2F52A 4YHHL 4YWLA 3HKZG 5IP9H 2JA8G 1Z47A 4IPDA 4QGUA 3A5UA 3PUXA 2D0OA 4TVAB 2UUCQ 1A0IA 1D8LA 4WJ3M 3I4MG 1CKOA 1OXUA 4B3TL 4DR4L 1VQ6A 1TWHH 2NZHA 3KDFA 4NXNL 4DV3L 3T1YL 2WFWA 1QVGA 1GD7A 2R6GA 4HJ8A 1M1KC 3CC2A 4IFDG 1OXTA 1QZGA 3E9IA 1HJPA 4O2DA 3CMEA 4C2MH 4DV3Q 1YJ9A 4C3JH 5EAYA 3KJOA 1YI2A 3GTQH 3JC66 3K8AA 2IHFA 5IE8A 2CWAA 5IYDH 2I5HA 4FDBA 2BH2A 4HJ5A 4HJ7A 1G6PA 4JI7Q 3CD6A 3KOJA 3RZOH 3FKIH 5C3EG 4A3KH 4BA1I 1XMQQ 1FJGL 2IT1A 2OTJA 3HKZE 1K8GA 2NN6I 2R92G 3L7ZC 2V1CC 1BBWA 5JEAJ 4A3BG 2CCZA 1X55A 5IWAQ 4O0AA 1YIJA 4LF8Q 3J81j 4GS3A 4AYBG 1QUQA 4GLAC 1VQHA 5J3BA 4B3RQ 1E3PA 4MZ9A 2JA5H 1N34Q 4PMWA 4RMFA 3H3VI 4IO9A 2HIVA 1K0RA 1XNRL 3Q8DA 4JI0Q 4A3LH 4A3CH 1KC8C 4L5QA 4HIOA 1VQGA 4A3GG 3I4NH 4DV1L 1G291 4JYAQ 3HOUG 3BZCA 1MIUA 3EN2A 5IT9c 3U58A 3S1QH 3S15H 2H5XA 3GTJH 1HNXL 1EOVA 4OX9Q 3MXNB 5IYCG 2A8VA 4BY1G 4GOPB 4LF9L 3W5OA 2JA7G 2K50A 2FXQA 1CUKA 1YEZA 3D31A 3PF5A 1I94L 1IBLL 1E7ZA 2N8NA 3PIOA 1T9HA 3RN5A 1VQ8A 2I5MX 2RF4A 4BBSG 1Z9FA 1IXRA 1XNRQ 3S2DH 2K4KA 2IX0A 2ZTCA 4DR5L 3J81c 1MJCA 1VS0A 2KCTA 3S1RH 4ALPA 3S2HH 4C3HH 2GVBA 1P16A 4LFAQ 1VQLA 3ZJYC 4A3DH 1EUJA 4WJ4A 3A0JA 2EQSA 4IPGA 2GN5A 1IZ6A 1G51A 2CKZB 2K75A 3LGJA 4JI5L 5C0XJ 3NEMA 2ATWA 1VQOA 1PYBA 3TRZA 4X65L 2ZTEA 1K8AC 2ASBA 1QUQB 2CWPA 1QVCA 2Q2IA 2XGTA 3AFPA 2VQFQ 4LFAL 1IYJB 4DV6L 4AYBE 4DR3L 1KRTA 2JA7H 4DV4L 2AWNA 2MO0A 4JBMA 3L2PA 4DV6Q 3K7UC 1SLJA 3A74A 4A3EH 2VUMG 3ICEA 1VQPA 1JJ2A 1V9PA 5E7NA 4NXNQ 4PG3A 4DR2Q 4DUZL 3GD7A 4A3LG 5AJ3Q 1J6QA 4A76A 2RCNA 2MO1A 3PUVA 3I56A 1A8VA 2NVYH 3PUZA 2HHHL 4QL5A 4JI4Q 3PO2H 3GTKH 5FJ8H 3HOWH 2NN6G 1N9WA 1HZ9A 2BA0A 2YTYA 2AWOA 3F1ZA 1JJCB 4KHZA 3TREA 4A3FG 3E0EA 3G48A 1HZBA 1HNWQ 1HZCA 4QQBX 5C3EH 2K5VA 4JI4L 1PH2A 2HHHQ 2VW9A 3T1YQ 1C0AA 1YZ6A 3G71A 1VQAA 5IYBH 4NXMQ 2L15A 1UE7A 1HR0W 4A3IG 1PH4A 4POGA 2DUDA 2A1AA 1PV4A 4JI7L 3RR5A 3SGIA 4J15A 1XTDA 2YTVA 4IJHA 4DK3C 1K73C 1EQRA 1K3RA 4B3RL 4JC0A 4LF8L 3CCJA 1HNZL 1CKNB 1O7IA 5IWAL 4IPCA 1PH1A 1UEBA 3JAMi 3HKSA 4R4IA 4OWXB 4PZ6A 3ULJA 5GAEC 2JA8H 1IBLQ 4YCVA 1EYGA 2HIXA 4YY3Q 4DV7L 4YCWA 1IBKL 5C44G 1FJGQ 1OXXK 2WAQE 4BY7H 3KF6A 1FVIA 4QIWE 4IFDI 1K83H 2WB1G 3CF5A 1V1QA 1GO3E 1S40A 3HFZB 3G6EA 2ZJPA 4GLXA 4R4QA 1GVPA 2PNHA 4OO1G 1UE5A 2CQOA 1ASYA 1NMFA 1EQQA 2Z0SA 3UDFA 4DR5Q 4C3IH 5JJIA 3MEFA 4MTNA 3PUYA 1OXSC 4GLVB 1L2FA 3GTPH 3DM3A 2UXBL 3M4QA 3PV0A 1B70B 1KAWA 3M4PA 2OTLA 1N8RC 2JA6G 4XIGS 3PO3H 4JI5Q 5IYBG 4P75A 1Q8KA 5H1SE 4A3GH 2UU9L 1VCIA 2QEXA 1CKNA 5C0XI 1VQJA 4DUZQ 1J5EL 4XTCS 5ELOA 2K5NA 2B63H 1R9TH 3CMAA 1SN8A 1J5EQ 1N32Q 1TXYA 2UXDQ 4DKAC 1PFSA 4GN5A 4A3JG 1Q82C 4IJLA 3CCVA 2PMZE 5LMNL 3HOVH 3S14H 1VQEA 4NB3A 4DV5Q 1XPRA 3K80C 2VQFL 3KF8B 4DR7L 4Y7NH 1L1OB 1TWGH 5HGQA 2JQOA 3PUWA 3NBHB 3H15A 2ZM6Q 2YU9H 1XNQQ 4DR4Q 2R93H 2VQEL 1KHIA 4LF6L 2Z6KC 1NJIC 4X64L 1XMQL 1VQNA 2OQKA 3PO3G 3CCEA 3CC4A 1FL0A 1JJGA 1PH9A 1EWIA 3CAMA 1YJWA 3ULLA 3KJPA 2PQAB 4IOAA 2LXKA 4GOPC 2LSSA 2JE6I 3CCQA 3T1HL 4KLKA 2R7ZH 4A75A 1ASZA 4RG1A 2JA5G 4B3SL 2VZAA 3S17H 2OCEA 1Q7YC 2MFIA 4A3MG 1E1TA 2Z6KA 3PCOB 5LMNQ 1KRSA 1UWVA 2JEBI 4P71A 5LMUL 3F8TA 4A3FH 1HNZQ 2F4VQ 3S1NH 2E2HH 4LWCA 1JMCA 4BY7G 4A3BH 2YTXA 5C4XG 1CKMA 1Q12A 1YHBA 5FJ8G 4DV2L 4DNIA 4UY8C 5M5XH 5IY0A 5C0XG 2YV5A 3NENA 1UE1A 4LF5L 2VQEQ 1PH6A 1IBKQ 3GTOH 1GKHA 4TQUS 4YY3L 2ZM6L 3AFQA 1XNQL 2VL6A 3L0OA 3GTGH 2VNUD 3GTLH 2F4VL 4JYAL 1TWAH 3CCMA 2JA9A 4LUZA 2YYZA 4LUVA 5IP7G 1N36Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HT1 A;  5K36 G;  1P8L A;  1C9O A;  2E5L L;  3UDX A;  1EIY B;  3OYY A;  3PSI A;  3RLO A;  1LM0 A;  4A3I H;  5FLM H;  4JI8 L;  4JV5 Q;  4JI1 L;  2B63 G;  2F3I A;  4DAM A;  1SRU A;  2RHS B;  3GO5 A;  1VQ4 A;  1AE3 A;  1WJJ A;  3GDE A;  4JI8 Q;  4JV5 L;  3CXC A;  3VDY A;  3UE1 A;  4NXM L;  1VQD A;  1GM5 A;  1XPU A;  1XMO L;  4AQY L;  1AE2 A;  5GQO A;  1I50 H;  4LF4 Q;  4A3D G;  5BR8 Q;  1SR3 A;  3HOX H;  5C4X H;  3BU2 A;  3OTO Q;  3RLF A;  4DUY L;  3ULP A;  1S72 A;  4JI3 Q;  3HOW G;  3PO2 G;  2UXC L;  3BZK A;  5GAD C;  2Y0S E;  4K0K L;  4A3M H;  4GN4 B;  1SRO A;  2BA1 A;  2PI2 A;  1WCM H;  4P73 A;  5M5Y H;  1A62 A;  4X66 Q;  4AH6 A;  4LF6 Q;  1X56 A;  5IYC H;  2E5L Q;  1BVS A;  5JJL A;  3F2C A;  1E1O A;  2IY5 B;  3RN2 A;  1PYS B;  4AIM A;  3HOU H;  3I4N G;  1W3S A;  2LXJ A;  5DLQ E;  1C7Y A;  4LFC Q;  4A3C G;  3J81 i;  4JI2 Q;  2OQ0 A;  3T1H Q;  2NVT H;  4HID A;  5GAH C;  2R93 G;  1JT8 A;  3F2D A;  3RLN A;  2PQA A;  3TEH B;  3I55 A;  3CCU A;  2RHQ B;  1PA6 A;  3K81 C;  4IOC A;  4B3M L;  1Y1V G;  5M3M G;  4R4C A;  4L5S A;  4DR1 Q;  4HJA A;  4YWM A;  2AHO B;  5M5W H;  4BXX H;  3KFU A;  3CC7 A;  4JBJ A;  1I6H H;  3U4Z A;  1B8A A;  2QGQ A;  4DR2 L;  5LMU Q;  4A3K G;  3CPW A;  1WYD A;  2MNA A;  1KQS A;  4YCU A;  3FP9 A;  3DLL A;  4POF A;  5GAG C;  4OXP A;  2Q2U A;  3NEL A;  3S24 A;  2K14 A;  3H0G G;  1SE8 A;  3I4O A;  3U50 C;  4DR3 Q;  1QVF A;  2XTI A;  2JA6 H;  1A63 A;  4BY1 H;  3KLW A;  3CCL A;  3PIP A;  4X62 L;  1VQ5 A;  3HOY G;  5C4J H;  4OWW B;  4BA2 I;  2UUA Q;  2KEN A;  1PH8 A;  2KHI A;  3CPF A;  4MNO A;  4R4T A;  2WP8 J;  4QY7 A;  3I4M H;  4DR1 L;  4DV1 Q;  1WOC A;  4OO1 I;  4EX5 A;  1X6O A;  1HR0 Q;  3AEV A;  1PVO A;  1S3O A;  5GRO A;  5JJK A;  3JAM c;  2PI2 E;  2N49 A;  1EFW A;  1SMX A;  1B7Y B;  2KBN A;  4UP7 A;  2MQH A;  3A5Z B;  3TQY A;  2UXD L;  1KXL A;  1KL9 A;  3W1B A;  4JI3 L;  1BKB A;  2ALY B;  2VY3 A;  1HR0 L;  5M3M H;  4GKK L;  3M85 A;  1PH3 A;  2ZTD A;  4AQY Q;  3STB D;  3KDF B;  4YWK A;  4BBS H;  2UU9 Q;  4UPA A;  3TS2 A;  4DV7 Q;  1HNX Q;  3GTM H;  3OW2 A;  2OWO A;  3S1M H;  1Y1W G;  1NMG A;  2JK8 A;  1X3F A;  3ERS X;  1VQF A;  2ES2 A;  1JE5 A;  1SFO H;  1QZH A;  4JBW A;  3J80 c;  2WB1 E;  3UE0 A;  4JI0 L;  4GKK Q;  4LNQ A;  3U4V A;  1XJV A;  1NY4 A;  3AQQ A;  2E2I H;  1I3Q H;  5M3F H;  1YHA A;  1OTC A;  4JI2 L;  4GOP A;  4L5T A;  1Y1W H;  2E2J H;  1LYL A;  2AMC B;  3IRB A;  1WCM G;  1L0W A;  4NPS A;  1YIT A;  4X6A H;  2I5L X;  4DK6 C;  3M4O H;  4GNX B;  1H95 A;  3K0X A;  4DPG A;  2JEA I;  4KHP L;  4X65 Q;  3EIV A;  4LF7 L;  4LF7 Q;  3CP0 A;  4DAY B;  1YBY A;  3I7F A;  3H3V H;  1L1O A;  4B3M Q;  3J7Z C;  2R92 H;  2ID0 A;  4ME3 A;  1HH2 P;  4DV2 Q;  4YHH Q;  4K0K Q;  1AH9 A;  3W1G A;  2ZJR A;  1K9M C;  1N33 Q;  1D7Q A;  4JI6 Q;  3HOZ G;  5FLX c;  1FGU A;  2JJQ A;  4A93 G;  5BR8 L;  2B29 A;  1BBU A;  1NBW A;  2KCM A;  4JOI A;  4P72 A;  5M3F G;  2K52 A;  4OWT B;  1X3G A;  4GNX C;  4A3E G;  1PH7 A;  5FLM G;  1KD1 C;  4B3T Q;  2NVQ H;  3KYH C;  2VUM H;  1E22 A;  4LF9 Q;  1X54 A;  5AJ3 L;  3M7N A;  1VQB A;  1I5F A;  1WI5 A;  2BH8 A;  1XPO A;  5HY6 A;  1VQ7 A;  1VQC A;  4BBR G;  4A93 H;  2DGY A;  3HOZ H;  1TWF H;  1JB7 A;  2I0Q A;  4L5R C;  1HNW L;  1IBM Q;  3UDG A;  5IYD G;  2B3G A;  1RL2 A;  1V43 A;  4GNX A;  4DV4 Q;  5IP9 G;  1DGS A;  4GKJ Q;  2QA4 A;  3I2Z A;  2UUA L;  1VQI A;  4LW1 A;  3S16 H;  4HIM A;  4BXX G;  1LUZ A;  1YVC A;  1Y1V H;  2AKW B;  2ZJQ A;  1MKH A;  2UUC L;  4LF5 Q;  1TWC H;  4H02 A;  2R7F A;  4X62 Q;  4BBR H;  3ER0 A;  1Q81 C;  1UE6 A;  1Y14 B;  4GN3 B;  1KIX A;  1VQ9 A;  3CCS A;  4IPH A;  1PH5 A;  2Q2T A;  2R7Z G;  3K7A H;  3HOY H;  2UUB Q;  5ELN A;  1VQK A;  4APV A;  2KHJ A;  2Q2H A;  2NVX H;  1CSQ A;  3E9H A;  1N36 L;  3OTO L;  3H0G H;  1U5K A;  1I94 Q;  4GKJ L;  5JEA G;  4UP9 A;  1XMO Q;  1NE3 A;  3UDI A;  4UP8 A;  3PF4 A;  1YHQ A;  4DR6 L;  3F2B A;  2EXD A;  1RIP A;  4X66 L;  1VQM A;  1Q86 C;  1WFQ A;  1M90 C;  4JI1 Q;  3D0F A;  4DR6 Q;  4QJF A;  2D62 A;  4JG2 A;  3FHW A;  3HOX G;  3RNU A;  4A3J H;  3HOV G;  4LUO A;  3M3Y H;  4LFB Q;  2CFM A;  3B6Y A;  3AYH B;  4DV0 L;  2A19 A;  3FKI G;  4JBK A;  1NTG A;  2K5H A;  2UXB Q;  2UXC Q;  4OON A;  1E24 A;  2HQL A;  3KF6 B;  1X9N A;  2E8G A;  4DV5 L;  1IL2 A;  3EBE A;  2EIF A;  3CQZ H;  2VS1 A;  3M9B A;  1YNX A;  3PGZ A;  4P74 A;  4PZ8 A;  3RZD H;  2WAQ G;  3G4S A;  4JI6 L;  4LF4 L;  1N33 L;  4PZ7 A;  4JCV E;  5LMN W;  2UUB L;  4Y52 H;  4OX9 L;  1Q1B A;  2N3S A;  1YJN A;  1CSP A;  1IBM L;  4R4O A;  3WWV A;  2IHE A;  4X64 Q;  4IFD J;  3CW2 C;  2NZO A;  1OXV A;  2C35 B;  1N34 L;  5IP7 H;  4R1J A;  1X3E A;  4A4I A;  4KHP Q;  1Q1E A;  1X65 A;  1L1O C;  1PHJ A;  4EQ5 A;  4LFC L;  3TS0 A;  4DR7 Q;  1EIF A;  4KI0 A;  1HZA A;  4DUY Q;  4B3S Q;  2Y0S G;  2N78 A;  4JOI C;  3STB C;  1MJE A;  2IX1 A;  1Q46 A;  3J7A 5;  1LTL A;  4DV0 Q;  3BJU A;  5C44 H;  2R7D A;  3CCR A;  4HJ9 A;  1N32 L;  4LFB L;  4HIK A;  2D0P A;  1U0L A;  2GVA A;  3J80 i;  1W2B A;  2F52 A;  4YHH L;  4YWL A;  3HKZ G;  5IP9 H;  2JA8 G;  1Z47 A;  4IPD A;  4QGU A;  3A5U A;  3PUX A;  2D0O A;  4TVA B;  2UUC Q;  1A0I A;  1D8L A;  4WJ3 M;  3I4M G;  1CKO A;  1OXU A;  4B3T L;  4DR4 L;  1VQ6 A;  1TWH H;  2NZH A;  3KDF A;  4NXN L;  4DV3 L;  3T1Y L;  2WFW A;  1QVG A;  1GD7 A;  2R6G A;  4HJ8 A;  1M1K C;  3CC2 A;  4IFD G;  1OXT A;  1QZG A;  3E9I A;  1HJP A;  4O2D A;  3CME A;  4C2M H;  4DV3 Q;  1YJ9 A;  4C3J H;  5EAY A;  3KJO A;  1YI2 A;  3GTQ H;  3JC6 6;  3K8A A;  2IHF A;  5IE8 A;  2CWA A;  5IYD H;  2I5H A;  4FDB A;  2BH2 A;  4HJ5 A;  4HJ7 A;  1G6P A;  4JI7 Q;  3CD6 A;  3KOJ A;  3RZO H;  3FKI H;  5C3E G;  4A3K H;  4BA1 I;  1XMQ Q;  1FJG L;  2IT1 A;  2OTJ A;  3HKZ E;  1K8G A;  2NN6 I;  2R92 G;  3L7Z C;  2V1C C;  1BBW A;  5JEA J;  4A3B G;  2CCZ A;  1X55 A;  5IWA Q;  4O0A A;  1YIJ A;  4LF8 Q;  3J81 j;  4GS3 A;  4AYB G;  1QUQ A;  4GLA C;  1VQH A;  5J3B A;  4B3R Q;  1E3P A;  4MZ9 A;  2JA5 H;  1N34 Q;  4PMW A;  4RMF A;  3H3V I;  4IO9 A;  2HIV A;  1K0R A;  1XNR L;  3Q8D A;  4JI0 Q;  4A3L H;  4A3C H;  1KC8 C;  4L5Q A;  4HIO A;  1VQG A;  4A3G G;  3I4N H;  4DV1 L;  1G29 1;  4JYA Q;  3HOU G;  3BZC A;  1MIU A;  3EN2 A;  5IT9 c;  3U58 A;  3S1Q H;  3S15 H;  2H5X A;  3GTJ H;  1HNX L;  1EOV A;  4OX9 Q;  3MXN B;  5IYC G;  2A8V A;  4BY1 G;  4GOP B;  4LF9 L;  3W5O A;  2JA7 G;  2K50 A;  2FXQ A;  1CUK A;  1YEZ A;  3D31 A;  3PF5 A;  1I94 L;  1IBL L;  1E7Z A;  2N8N A;  3PIO A;  1T9H A;  3RN5 A;  1VQ8 A;  2I5M X;  2RF4 A;  4BBS G;  1Z9F A;  1IXR A;  1XNR Q;  3S2D H;  2K4K A;  2IX0 A;  2ZTC A;  4DR5 L;  3J81 c;  1MJC A;  1VS0 A;  2KCT A;  3S1R H;  4ALP A;  3S2H H;  4C3H H;  2GVB A;  1P16 A;  4LFA Q;  1VQL A;  3ZJY C;  4A3D H;  1EUJ A;  4WJ4 A;  3A0J A;  2EQS A;  4IPG A;  2GN5 A;  1IZ6 A;  1G51 A;  2CKZ B;  2K75 A;  3LGJ A;  4JI5 L;  5C0X J;  3NEM A;  2ATW A;  1VQO A;  1PYB A;  3TRZ A;  4X65 L;  2ZTE A;  1K8A C;  2ASB A;  1QUQ B;  2CWP A;  1QVC A;  2Q2I A;  2XGT A;  3AFP A;  2VQF Q;  4LFA L;  1IYJ B;  4DV6 L;  4AYB E;  4DR3 L;  1KRT A;  2JA7 H;  4DV4 L;  2AWN A;  2MO0 A;  4JBM A;  3L2P A;  4DV6 Q;  3K7U C;  1SLJ A;  3A74 A;  4A3E H;  2VUM G;  3ICE A;  1VQP A;  1JJ2 A;  1V9P A;  5E7N A;  4NXN Q;  4PG3 A;  4DR2 Q;  4DUZ L;  3GD7 A;  4A3L G;  5AJ3 Q;  1J6Q A;  4A76 A;  2RCN A;  2MO1 A;  3PUV A;  3I56 A;  1A8V A;  2NVY H;  3PUZ A;  2HHH L;  4QL5 A;  4JI4 Q;  3PO2 H;  3GTK H;  5FJ8 H;  3HOW H;  2NN6 G;  1N9W A;  1HZ9 A;  2BA0 A;  2YTY A;  2AWO A;  3F1Z A;  1JJC B;  4KHZ A;  3TRE A;  4A3F G;  3E0E A;  3G48 A;  1HZB A;  1HNW Q;  1HZC A;  4QQB X;  5C3E H;  2K5V A;  4JI4 L;  1PH2 A;  2HHH Q;  2VW9 A;  3T1Y Q;  1C0A A;  1YZ6 A;  3G71 A;  1VQA A;  5IYB H;  4NXM Q;  2L15 A;  1UE7 A;  1HR0 W;  4A3I G;  1PH4 A;  4POG A;  2DUD A;  2A1A A;  1PV4 A;  4JI7 L;  3RR5 A;  3SGI A;  4J15 A;  1XTD A;  2YTV A;  4IJH A;  4DK3 C;  1K73 C;  1EQR A;  1K3R A;  4B3R L;  4JC0 A;  4LF8 L;  3CCJ A;  1HNZ L;  1CKN B;  1O7I A;  5IWA L;  4IPC A;  1PH1 A;  1UEB A;  3JAM i;  3HKS A;  4R4I A;  4OWX B;  4PZ6 A;  3ULJ A;  5GAE C;  2JA8 H;  1IBL Q;  4YCV A;  1EYG A;  2HIX A;  4YY3 Q;  4DV7 L;  4YCW A;  1IBK L;  5C44 G;  1FJG Q;  1OXX K;  2WAQ E;  4BY7 H;  3KF6 A;  1FVI A;  4QIW E;  4IFD I;  1K83 H;  2WB1 G;  3CF5 A;  1V1Q A;  1GO3 E;  1S40 A;  3HFZ B;  3G6E A;  2ZJP A;  4GLX A;  4R4Q A;  1GVP A;  2PNH A;  4OO1 G;  1UE5 A;  2CQO A;  1ASY A;  1NMF A;  1EQQ A;  2Z0S A;  3UDF A;  4DR5 Q;  4C3I H;  5JJI A;  3MEF A;  4MTN A;  3PUY A;  1OXS C;  4GLV B;  1L2F A;  3GTP H;  3DM3 A;  2UXB L;  3M4Q A;  3PV0 A;  1B70 B;  1KAW A;  3M4P A;  2OTL A;  1N8R C;  2JA6 G;  4XIG S;  3PO3 H;  4JI5 Q;  5IYB G;  4P75 A;  1Q8K A;  5H1S E;  4A3G H;  2UU9 L;  1VCI A;  2QEX A;  1CKN A;  5C0X I;  1VQJ A;  4DUZ Q;  1J5E L;  4XTC S;  5ELO A;  2K5N A;  2B63 H;  1R9T H;  3CMA A;  1SN8 A;  1J5E Q;  1N32 Q;  1TXY A;  2UXD Q;  4DKA C;  1PFS A;  4GN5 A;  4A3J G;  1Q82 C;  4IJL A;  3CCV A;  2PMZ E;  5LMN L;  3HOV H;  3S14 H;  1VQE A;  4NB3 A;  4DV5 Q;  1XPR A;  3K80 C;  2VQF L;  3KF8 B;  4DR7 L;  4Y7N H;  1L1O B;  1TWG H;  5HGQ A;  2JQO A;  3PUW A;  3NBH B;  3H15 A;  2ZM6 Q;  2YU9 H;  1XNQ Q;  4DR4 Q;  2R93 H;  2VQE L;  1KHI A;  4LF6 L;  2Z6K C;  1NJI C;  4X64 L;  1XMQ L;  1VQN A;  2OQK A;  3PO3 G;  3CCE A;  3CC4 A;  1FL0 A;  1JJG A;  1PH9 A;  1EWI A;  3CAM A;  1YJW A;  3ULL A;  3KJP A;  2PQA B;  4IOA A;  2LXK A;  4GOP C;  2LSS A;  2JE6 I;  3CCQ A;  3T1H L;  4KLK A;  2R7Z H;  4A75 A;  1ASZ A;  4RG1 A;  2JA5 G;  4B3S L;  2VZA A;  3S17 H;  2OCE A;  1Q7Y C;  2MFI A;  4A3M G;  1E1T A;  2Z6K A;  3PCO B;  5LMN Q;  1KRS A;  1UWV A;  2JEB I;  4P71 A;  5LMU L;  3F8T A;  4A3F H;  1HNZ Q;  2F4V Q;  3S1N H;  2E2H H;  4LWC A;  1JMC A;  4BY7 G;  4A3B H;  2YTX A;  5C4X G;  1CKM A;  1Q12 A;  1YHB A;  5FJ8 G;  4DV2 L;  4DNI A;  4UY8 C;  5M5X H;  5IY0 A;  5C0X G;  2YV5 A;  3NEN A;  1UE1 A;  4LF5 L;  2VQE Q;  1PH6 A;  1IBK Q;  3GTO H;  1GKH A;  4TQU S;  4YY3 L;  2ZM6 L;  3AFQ A;  1XNQ L;  2VL6 A;  3L0O A;  3GTG H;  2VNU D;  3GTL H;  2F4V L;  4JYA L;  1TWA H;  3CCM A;  2JA9 A;  4LUZ A;  2YYZ A;  4LUV A;  5IP7 G;  1N36 Q; 
#chains in the Genus database with same CATH topology
 1C9O A;  5EKL A;  2BCO A;  1TS4 A;  3OYY A;  4C1N K;  4JI8 L;  1WTP A;  1EYC A;  2ZT9 C;  4C3H B;  1CZG A;  3GO5 A;  1AE3 A;  3MZ5 A;  4JI8 Q;  5C4J B;  5ELD A;  3SK8 A;  1XMO L;  1PTO B;  4AQY L;  2PPB C;  4ZUI A;  3BU2 A;  3HOW G;  4C3H G;  3BZK A;  1F2M A;  1EY8 A;  4GN4 B;  3J7A V;  1R4P B;  2BA1 A;  2PI2 A;  4FO2 A;  3KF8 A;  1IKM A;  4LF6 Q;  1X56 A;  2BOS A;  1BVS A;  1ZKO A;  4HCE A;  3F2C A;  2OXP A;  4ABN A;  3I4N G;  4HED A;  1W3S A;  5DLQ E;  4K5V A;  5K5P A;  5GAH C;  2R93 G;  1CTM A;  1JT8 A;  3F2D A;  1PA6 A;  4IUN A;  4QUC A;  4IOC A;  1Y1V G;  5KRU A;  2D9U A;  4L5S A;  1HFN A;  4DR1 Q;  2AHO B;  3R93 A;  3CC7 A;  2F0K A;  3U4Z A;  4KJO A;  1YNJ D;  5IT9 L;  3FP9 A;  5GAG C;  4A3I B;  1HCZ A;  1STE A;  1SE8 A;  4DR3 Q;  3LX0 A;  1IKL A;  4X62 L;  4WRD A;  4DXF A;  4OWW B;  1PH8 A;  1TS2 A;  4R4T A;  4Q5V A;  2WP8 J;  4DV1 Q;  3AEV A;  1X6O A;  1LT4 D;  4NDX A;  3FRP B;  1LAC A;  3KLS A;  1DOK A;  3JAM c;  3TQY A;  1QNU A;  2WIN B;  2UXD L;  5EGT A;  1TKW B;  4JI3 L;  1STG A;  1EFI D;  5M3M H;  4NMZ A;  3C1F A;  3STB D;  1ZEQ X;  2XRS D;  4UPA A;  1HNX Q;  1LTG D;  3OW2 A;  4JBW A;  4CJ2 C;  2WB1 E;  4GKK Q;  4LNQ A;  3IAY A;  1EY6 A;  4BBR B;  1AW7 A;  1I3Q H;  3S1R B;  1YHA A;  1LYL A;  1AZQ A;  1MSH A;  2O5J C;  3M4O H;  4DPG A;  3S16 B;  2JEA I;  1I4H A;  2PCF B;  4DAY B;  2PO4 A;  4KY7 A;  3I73 A;  2EY2 A;  2ID0 A;  1SNM A;  4BY1 B;  1LTR D;  4LK1 C;  1PXU A;  1HTP A;  3M3Y B;  4G7O C;  1EOT A;  4A93 G;  5BR8 L;  1D6E C;  2EZV A;  2JSO A;  3I91 A;  3GTM B;  2ZXP A;  3RUZ A;  3S1M B;  1JQY D;  5JPM C;  3SK6 A;  2EY5 A;  4ODG A;  2K03 A;  3J81 L;  1I5F A;  1XPO A;  2BH8 A;  1VQ7 A;  2PZW A;  4KK7 A;  4A93 H;  2E74 C;  1TWF H;  1IBM Q;  4XDX A;  2B3G A;  3BZD B;  5IP9 G;  1VQI A;  2EYM A;  4LW1 A;  2Q8T A;  3P1H A;  4XYQ A;  3K5M A;  4BXX G;  1JWS D;  1YVC A;  4X3U A;  1MKH A;  2UUC L;  4G7Z C;  4LF5 Q;  3T4A C;  2O2L D;  1E2W A;  1UE6 A;  3ER0 A;  1CA6 A;  3CCS A;  2RBM A;  5CV7 A;  1S5C D;  4RGO S;  2CH4 A;  4APV A;  3NHH A;  2M00 A;  4OEL B;  1CSQ A;  2G9D A;  2WKD A;  3OTO L;  1VMP A;  4HMI A;  3VR2 A;  1Q8I A;  2B2Y A;  4ID6 A;  2B39 A;  4OGQ C;  4RFB A;  1ROD A;  3HGB A;  2EXD A;  3K0Y A;  4DXG A;  1ICW A;  5IGD A;  4QJF A;  2D62 A;  3HOX G;  1GUG A;  2M9V A;  3RNU A;  4A3J H;  3HOV G;  4LFB Q;  1HFG A;  2CFM A;  2NUC A;  1SYF A;  4DV0 L;  1CK1 A;  2K5H A;  4OON A;  1X9N A;  3KF6 B;  3RZD H;  2B63 G;  1CFM A;  3S2D H;  1LTA D;  2WAQ G;  1N33 L;  1Y69 U;  5C4X B;  2F0F A;  4PZ7 A;  2UUB L;  4Y52 H;  1Q1B A;  1IBM L;  4V0B A;  1F9Q A;  3KLS X;  5G3L D;  5ELB A;  1D5M C;  1B2T A;  5EPL A;  2C35 B;  3HEJ A;  5IP7 H;  1JOO A;  2NVX B;  3S1Q B;  2FJ2 A;  1RHP A;  4DR7 Q;  4LFC L;  3TS0 A;  1EIF A;  1HZA A;  3PO3 B;  1IL8 A;  3P75 A;  2N78 A;  5I4D A;  3STB C;  1Q46 A;  4QIW B;  2HDL A;  4DV0 Q;  1ENA A;  3CCR A;  1N32 L;  2D0P A;  2F52 A;  3UI2 A;  4YWL A;  1SEB D;  3HKZ G;  4DGZ A;  4FNF A;  1EY7 A;  3R2I A;  3H94 A;  5I2X A;  1D8L A;  3A55 A;  3BVG A;  2ZXR A;  4HSP A;  3KDF A;  2HUG A;  4Y7N B;  3CC2 A;  4O2D A;  3CME A;  4K2K A;  2WB1 B;  4DV3 Q;  5EAY A;  1YI2 A;  3GTQ H;  2IHF A;  2CWA A;  4IUU A;  1A6X A;  4HR7 B;  4FDB A;  1BCP C;  2BH2 A;  1EQV A;  2EJG C;  3KOJ A;  3RZO H;  2IX3 A;  3FKI H;  1FJG L;  4C1N I;  2R92 G;  1YNJ C;  5A35 A;  3GP7 A;  3L7Z C;  5JEA J;  1F9S A;  3I4M B;  4O0A A;  4LF8 Q;  5J3B A;  1E3P A;  2JA5 H;  1N34 Q;  2H4O A;  4PMW A;  1DCZ A;  4IO9 A;  3Q8D A;  4JI0 Q;  1KC8 C;  3JAM L;  3I4N H;  4DV1 L;  1KAA A;  1MIU A;  3U58 A;  4QB4 A;  2D5D A;  1PRT B;  3NXW A;  1CUK A;  1AFP A;  1Z9F A;  2K4K A;  3BDO A;  3BVZ A;  2CQA A;  2F4I A;  2KOL A;  3X3N A;  4C3H H;  3L3O C;  4N8X 1;  4LFA Q;  1EIG A;  1PTO D;  1M8A A;  2K75 A;  1G51 A;  4JI5 L;  1PYB A;  2AQ2 B;  3WOE A;  3A8I E;  4EVO A;  2VQF Q;  1W6K A;  4H0L C;  4XT3 B;  4AYB E;  2JA7 H;  2AUJ D;  2MO0 A;  1SE3 A;  3K7U C;  3Q0A A;  4A3E H;  3ICE A;  3A7A B;  1DZ1 A;  5CR3 A;  4WFN 3;  1JJ2 A;  2K01 A;  2NZ1 D;  4PG3 A;  3GD7 A;  3D4D A;  1J6Q A;  3DHQ A;  5FLX L;  2MO1 A;  4J1M A;  4IUV A;  2NVT B;  1TWC B;  5FOB B;  5FJ8 H;  4ME5 A;  5EPJ A;  4F88 A;  1FD7 D;  2L0C A;  1HNW Q;  3HKZ B;  4C3I B;  3ZYY X;  4JI4 L;  3S15 B;  2F0N A;  3S9W A;  1YZ6 A;  3GTP B;  5IYB H;  2L15 A;  1UE7 A;  4EGV A;  2DUD A;  1PV4 A;  1PTO F;  3SK4 A;  3QB3 A;  4B3R L;  4JC0 A;  3HOY B;  4LF8 L;  3CCJ A;  1CKN B;  3BS1 A;  2ZXO A;  2LKV A;  4OWX B;  3TBI B;  3VYS A;  4YCV A;  2EDG A;  2HIX A;  1PDQ A;  1IBK L;  5C44 G;  1FJG Q;  1OXX K;  2WAQ E;  1B4O A;  2WAC A;  3K5O A;  3CF5 A;  4PMC A;  3HFZ B;  2ZJP A;  2KJX A;  3CRL C;  1GVP A;  4OO1 G;  1D5X C;  1D1K A;  2Z0S A;  3M7G A;  4ZAI A;  1CQV A;  1EY9 A;  1K28 A;  2KHS A;  2JA6 G;  4XYO A;  4C3I G;  3PO3 H;  5A2Q L;  3OPO A;  1A2U A;  4KHV A;  1Q8K A;  4P75 A;  1VCI A;  1VQJ A;  4G7H C;  1R9T H;  4GZY C;  1J5E Q;  1BXT A;  1U4R A;  4GN5 A;  2F0Q A;  1Q82 C;  5COY A;  2F1M A;  2F0T A;  3K80 C;  4DR7 L;  1TWG H;  2X6G A;  2XIW A;  2K1B A;  4CKC A;  5HGQ A;  3J80 L;  3PUW A;  4DAP A;  3CHB D;  4BY7 B;  1SNO A;  4C2M B;  3D6C A;  3L9A X;  1B9M A;  1KHI A;  1SE4 A;  1JB3 A;  1WVL A;  1U4L A;  2OQK A;  3PO3 G;  1F77 A;  3CC4 A;  1PLF A;  1YJW A;  3KJP A;  5I6Y A;  4IOA A;  3IFD A;  2R7Z H;  4OO1 H;  1STY A;  2MUY A;  2DN8 A;  2VZA A;  3S17 H;  1Q7Y C;  4A3M G;  3H91 A;  1E1T A;  5KYL A;  3PCO B;  5LMU L;  1KRS A;  4IAL A;  2JEB I;  3U9S A;  2E2H H;  2DY7 A;  2JN4 A;  5C4X G;  4A93 B;  3HRZ C;  3DMU A;  5M5X H;  4LF5 L;  2YV5 A;  1GKH A;  4YY3 L;  2ZM6 L;  5C5M A;  3L0O A;  5KND A;  2F4V L;  4JYA L;  3CCM A;  4LUZ A;  2F0P A;  2YYZ A;  3KK7 A;  4RCO A;  1WD0 A;  4A3G B;  2HT1 A;  5K36 G;  1P8L A;  3QO2 A;  3VR5 A;  2QEJ C;  2KA7 A;  3UDX A;  1EIY B;  3PSI A;  4PMB A;  3V96 A;  2B63 B;  3WDN A;  2NYZ D;  2F3I A;  1SRU A;  4RWS C;  1F9P A;  1BF4 A;  3K57 A;  1GM5 A;  4M8A A;  4LF4 Q;  1I50 H;  2B2U A;  4A3D G;  5BR8 Q;  2EE1 A;  3OTO Q;  2YU9 B;  5JAV A;  2MPM A;  1KLU D;  2Y0S E;  3OWF A;  4K0K L;  1WCM H;  3VYR A;  4AH6 A;  3VA5 A;  2Z8L A;  3DEO A;  3GTG B;  2EOT A;  5IYC H;  2E5L Q;  3RZD B;  2J7Z A;  2OF1 A;  3FDT A;  4LFC Q;  4HCS A;  4A3C G;  1T5E A;  3J81 i;  2NVT H;  3GTK B;  1NR2 A;  3I55 A;  3CCU A;  1BQQ T;  1ILQ A;  4HJA A;  4YWM A;  5M5W H;  2X6L A;  3KFU A;  1I6H H;  2LMC B;  4DR2 L;  5LMU Q;  4A3K G;  4YCU A;  5C44 B;  3NSW A;  3AMU A;  4HTH A;  3S24 A;  5C4H A;  1B44 D;  1QVF A;  4I65 A;  1B1Z A;  2PYK A;  2XTI A;  3U50 C;  3RZO B;  2KCN A;  3CCL A;  5IGB A;  2F0G A;  3PIP A;  4X3T A;  1ML0 D;  2HQE A;  3OSO A;  1VQ5 A;  3HOY G;  3T51 B;  2DNC A;  2KEN A;  3KBX A;  2IL8 A;  1GXD C;  1L0Y B;  4QY7 A;  3I4M H;  1Y8O B;  3HOX B;  1J8I A;  1IW7 D;  1PRT F;  4I7A A;  1PVO A;  1HHV A;  2D2C C;  1B7Y B;  1BKB A;  3BVM A;  1I4G A;  3FEW X;  3QWN A;  3HG9 A;  4GKK L;  1ET6 A;  2OT2 A;  2ZTD A;  5C3X A;  3KDF B;  4YWK A;  4EQN A;  1VMC A;  4DV7 Q;  5JEA H;  2OWO A;  3S1M H;  5J22 A;  3ERS X;  1Y1W G;  1MGS A;  1SYB A;  3J80 c;  3H09 A;  5G3L F;  3UE0 A;  1K0S A;  1K83 B;  1XJV A;  5KEE A;  3SK5 A;  1AN8 A;  2E2I H;  5E1F A;  2PZU A;  4GOP A;  3E0J A;  1HRJ A;  3IRB A;  1WCM G;  1L0W A;  4X6A H;  3K0X A;  3ND8 A;  3EIV A;  1RJT A;  3H6M A;  3CP0 A;  3MVV A;  3I7F A;  3H3V H;  1L1O A;  3KUP A;  3K5N A;  2EYH A;  3J7Z C;  2R92 H;  1HH2 P;  2JA7 B;  4YHH Q;  1ET9 A;  4K0K Q;  2EYJ A;  4EQO A;  3W1G A;  1FNW A;  1B50 A;  1K9M C;  1H9S B;  5EKI A;  1HTL D;  1FGU A;  2JJQ A;  4YIJ A;  3TN2 A;  3VR3 A;  3SHL A;  3ND9 A;  1BBU A;  2RSN A;  1NBW A;  4JOI A;  4GNX C;  5M3F G;  1PH7 A;  2K52 A;  1KD1 C;  2NVQ H;  4B3T Q;  2VUM H;  1UUP A;  2VB2 X;  1E22 A;  1K8M A;  1VDZ A;  4LF9 Q;  1X54 A;  5AJ3 L;  1VQB A;  3N52 A;  5IGC A;  4BBR G;  2L5T A;  1JB7 A;  2I0Q A;  1PFN A;  4L5R C;  3X3M A;  2SDF A;  2A6E D;  2HCI A;  1EYA A;  1RL2 A;  1C8C A;  4IUQ A;  1D5Z C;  2QA4 A;  4H44 C;  4PQX A;  4HIM A;  1LUZ A;  1O7Z A;  2ZJQ A;  2AKW B;  1G91 A;  3BYY B;  4L6T B;  1E2V A;  4OIJ A;  1TWC H;  2R7F A;  4X62 Q;  5EBC A;  1Y14 B;  1KIX A;  1KLG D;  1H9S A;  4IPH A;  1PH5 A;  2R7Z G;  1BCP B;  1NR4 A;  3H0G H;  1I50 B;  1U5K A;  4RH6 A;  4CDD C;  3NUC A;  1I94 Q;  4GKJ L;  1XMO Q;  3GTQ B;  4DR6 L;  4N8F A;  1NNX A;  2J0T D;  1RIP A;  1VQM A;  3HOZ B;  3QR8 A;  3EA6 A;  1JCK B;  1RCV D;  1QE6 A;  1SMY D;  4DR6 Q;  3FHW A;  1Q90 A;  3B6Y A;  3AYH B;  2A19 A;  4JBK A;  1SSO A;  2UXB Q;  4N9P A;  1E24 A;  2HQL A;  2E8G A;  1IL2 A;  1KTK A;  2VS1 A;  3EBE A;  5ELC A;  4CKE A;  4PZ8 A;  4LF4 L;  3G4S A;  2A74 C;  4X64 Q;  4IFD J;  3CW2 C;  4OEM B;  2Q8R E;  3WOF A;  4A3K B;  1X3E A;  5EJW A;  1X65 A;  1L1O C;  1PHJ A;  2BE5 D;  4U67 3;  1ESR A;  2Y0S G;  2B2V C;  1Y1V B;  4PV1 C;  3J7A 5;  2F0H A;  3P7J A;  3BJU A;  5C44 H;  4HIK A;  5IP9 H;  2D0O A;  1A0I A;  3GV6 A;  1HXY D;  1CKO A;  1U4P A;  1HA5 A;  3I4N B;  3HOV B;  1OXU A;  2BE5 C;  4B3T L;  4ZKC B;  1TWH H;  4NXN L;  3T1Y L;  1TVX A;  2WFW A;  1GD7 A;  2R6G A;  3CQZ B;  4HJ8 A;  1QVG A;  1M1K C;  4IFD G;  3E9I A;  3KLR A;  4RGN A;  4C2M H;  5A2Q E;  2C9O A;  4C3J H;  3KJO A;  5IE8 A;  2F0W A;  5HUR A;  2F0U A;  1G6P A;  4HJ5 A;  1C48 A;  3CD6 A;  1Z7T A;  1DD2 A;  5IIF A;  3PIP 3;  4A3D B;  1K8G A;  2NN6 I;  1LT5 D;  2NB0 A;  3S17 B;  2V1C C;  1U4M A;  1WTH A;  1X55 A;  1LV9 A;  5IWA Q;  1YIJ A;  4NKL A;  4HAE A;  4J6H A;  4AYB G;  3I72 A;  4MZ9 A;  4RMF A;  5LL6 X;  2HIV A;  1S5F D;  2B2T C;  1ZYR D;  4L5Q A;  2IWH A;  4TKO B;  1VQG A;  1I4X A;  4KY5 A;  4A3G G;  3HOU G;  2WII B;  3S15 H;  1EWH A;  1ENC A;  3MXN B;  3W5O A;  2JA7 G;  2K50 A;  2FXQ A;  1I94 L;  1UAP A;  1VQ8 A;  1E7Z A;  2N8N A;  3PIO A;  2RF4 A;  4RKB A;  2ZTC A;  2IX0 A;  4DR5 L;  2DJG C;  4HMJ A;  5M3F B;  4ALP A;  4DU9 A;  4FF4 A;  3GQB A;  3C46 A;  1PFM A;  1EUJ A;  2F0M A;  3OWE B;  3A0J A;  3DUZ A;  4IPG A;  3SXH A;  2CKZ B;  3LGJ A;  2ATW A;  5BN5 A;  4KV6 A;  3NP8 A;  4X65 L;  2FMC A;  2A6E C;  2EXZ A;  2Q2I A;  3AFP A;  4LFA L;  1IYJ B;  4DV6 L;  1MD2 D;  1X3Q A;  1EY5 A;  4DV4 L;  2AWN A;  2VUM G;  3A74 A;  5D3I B;  3BYT B;  2N88 A;  4HSV A;  3EJI A;  1Z6H A;  1LAB A;  1V9P A;  2RDH A;  2Z1C A;  4NXN Q;  2FHT A;  4MIU A;  1NUC A;  2JYO A;  1BR9 A;  4A76 A;  4XXE A;  2NBF A;  3I56 A;  2NVY H;  4QF4 A;  2K05 A;  1CZW A;  2ENB A;  4JI4 Q;  3GTK H;  2HCC A;  5CV4 A;  3HOW H;  2YTY A;  3D3R A;  4KMU C;  4DNR B;  4S3S A;  5JOB A;  2O4X A;  3TRE A;  4A3F G;  3G48 A;  1HZB A;  1HZC A;  1BCP D;  5HGT A;  4KN4 C;  1PH2 A;  2VW9 A;  1TQO A;  4NXM Q;  2EPB A;  1D1I A;  3RR5 A;  3SGI A;  4RAU C;  1SYG A;  4B9W A;  2YTV A;  1G2T A;  1QWY A;  4DAY A;  1HNZ L;  1O7L A;  4OIK A;  5KGU A;  1RDP D;  5CC4 A;  1EZ8 A;  1IBL Q;  5C5L A;  5ISR A;  4ZUJ A;  1E0B A;  4DV7 L;  4XQJ A;  2QIL A;  4DN4 M;  1K83 H;  2WB1 G;  4A3B B;  1V1Q A;  4KD4 A;  2KEE A;  4H7B A;  4R4Q A;  4GLX A;  4DA2 A;  2P5Z X;  2PNH A;  2F3W A;  2CQO A;  1EQQ A;  1KDB A;  3ERO A;  4CDF C;  1L2F A;  1KNA A;  3DM3 A;  3M4Q A;  1KAW A;  2OTL A;  1N8R C;  3EVQ A;  3BDC A;  1H9R A;  4IUR A;  4A3G H;  4DK0 A;  5H1S E;  1HQR D;  2QEX A;  1MSG A;  1WD1 A;  2FMM A;  3MTS A;  2B63 H;  3ITP A;  1SN8 A;  2I46 A;  2QCP X;  2XN9 C;  2UXD Q;  4DKA C;  1LT3 D;  4A3J G;  1Y1W B;  4IJL A;  3CCV A;  2PMZ E;  5LMN L;  3HOV H;  1G6Z A;  1XPR A;  2JA8 B;  5I9O A;  1GHJ A;  1KDA A;  3T56 B;  4FYD A;  5E3F A;  4K6L A;  2ZM6 Q;  1Y8N B;  2L4N A;  2Z6K C;  3MWY W;  3PMF A;  1WTQ A;  1GUO A;  4C3J G;  3CCE A;  1CQF A;  1JJG A;  1PZI D;  2DNE A;  1EWI A;  3CAM A;  3ULL A;  2KUM A;  2B2Y C;  2L12 A;  1KNE A;  2LXK A;  2JE6 I;  3T1H L;  4P2C B;  1I4P A;  1ASZ A;  5EBD A;  4QCL A;  3FPP A;  2F0S A;  2Z6K A;  5LMN Q;  4P71 A;  3F8T A;  1F2Y A;  1HUM A;  4PNY A;  2YTX A;  3AB9 A;  1SMY C;  1YHB A;  3A8J E;  1DOM A;  1S4Z A;  3KBG A;  2F0D A;  3GTG H;  2VNU D;  3MXP A;  5JVH 3;  1Y8P B;  2JA9 A;  4LUV A;  1N36 Q;  2F03 A;  2UUA Q;  1BBX C;  3R8B A;  2E5L L;  1XXG A;  4A3I H;  2L55 A;  1GOZ A;  5IOC A;  4JV5 Q;  1EZ6 A;  2CHB D;  1VQ4 A;  1WJJ A;  3GDE A;  4A3J B;  4JV5 L;  4CHT B;  3CXC A;  2KQ3 A;  3UE1 A;  1DXM A;  1AE2 A;  5GQO A;  2AQ3 B;  1JWU D;  1SR3 A;  2NTS A;  5C4X H;  3J7Y W;  3ULP A;  1S72 A;  5IGG A;  2UXC L;  4JI3 Q;  5COR A;  3VR4 A;  4A3M H;  2K28 A;  2R61 A;  1SRO A;  2MP1 A;  1JR0 D;  5M5Y H;  4X66 Q;  2K5W A;  2PW5 A;  3BG3 A;  1PYW D;  5JJL A;  2IY5 B;  2F0E A;  1PYS B;  1BO0 A;  1I6V C;  3S1N B;  3T1H Q;  4HID A;  2B2U C;  3VR6 A;  2ICE C;  3RLN A;  4DK1 A;  2PQA A;  3TEH B;  4B3M L;  5M3M G;  4FXK C;  1TY2 A;  4UDU C;  4ZKB B;  2F0L A;  3I3C A;  1B8A A;  2DY8 A;  5ELE A;  2FFK B;  4TRD A;  4JVZ A;  2NTT A;  3CPW A;  2MNA A;  2DJF C;  4POF A;  1HQM C;  4OXP A;  2Q2U A;  5I6W A;  1YNN C;  3H0G G;  3I4O A;  2JA6 H;  4U68 A;  5DEH A;  5JPN C;  4BY1 H;  5CGK A;  2G9H D;  4KTA A;  2KHI A;  1V1P B;  2NVQ B;  3OIQ A;  3BDL A;  5TSS A;  4DR1 L;  1WOC A;  3I90 A;  3VA7 A;  4X3K A;  4EX5 A;  1S3O A;  2IJ0 A;  1WTO A;  3QIA A;  1EFW A;  1SMX A;  3A5Z B;  4V19 0;  1KL9 A;  1F9R A;  3W1B A;  2ALY B;  4K5W A;  2VY3 A;  1HR0 L;  3G7L A;  5DAU A;  3M85 A;  1PH3 A;  4AQY Q;  4BBS H;  2CW0 C;  1DOL A;  3GTM H;  2J4X A;  2JK8 A;  1VQF A;  1ICF B;  3NBI A;  3MAQ A;  2AUK A;  1NY4 A;  3AQQ A;  1B53 A;  3A8K E;  4WJW A;  5M3F H;  4L5T A;  1Y1W H;  2AMC B;  2I07 B;  1YIT A;  4NPS A;  2I5L X;  1H95 A;  4KHP L;  5DM7 3;  2XWJ B;  5C6A A;  4LF7 Q;  2Y0S B;  4O42 A;  2L11 A;  4DV2 Q;  4JPB W;  2A68 C;  3V2T A;  3SVM A;  1AH9 A;  2ICI A;  2ZJR A;  1D7Q A;  4JI6 Q;  4FXG C;  3HOZ G;  2B29 A;  4Q0F A;  4P72 A;  2EYO A;  4A3E G;  1X3G A;  3H0G B;  3NTI A;  1NCV A;  3KYH C;  4AYB B;  1GUT A;  3ERQ A;  1WI5 A;  5L37 A;  5HY6 A;  3R3O A;  5D3D A;  4XT1 B;  2MHV A;  1VQC A;  2DGY A;  3HOZ H;  2IW3 A;  5JJZ A;  1HNW L;  3UDG A;  4KKS A;  1V43 A;  2XWB B;  4DV4 Q;  1I4Q A;  3T13 A;  2A6H C;  3S16 H;  2Q8I B;  1PTO C;  5IGE A;  3TDQ A;  4A3F B;  1LTI D;  2WV6 D;  2Z9H A;  3RMH A;  1EQT A;  3TP6 A;  5CMD A;  3TME A;  4H02 A;  4G4K A;  1Q81 C;  4CJ1 B;  3MEH A;  2Q2T A;  3OHX C;  3K7A H;  3HOY H;  1UNS A;  5ELN A;  2NVX H;  1STH A;  4FVM A;  3E9H A;  1LT6 D;  4FF2 A;  2QF7 A;  3Q23 A;  3J80 E;  3I8Z A;  1NE3 A;  3PF4 A;  1YHQ A;  1H9M A;  3F2B A;  1GHK A;  3I4L A;  1EL0 A;  1Q86 C;  1WFQ A;  3A7L A;  3D0F A;  2K6A A;  5M5Y B;  2MJ8 A;  2K32 A;  3M3Y H;  4LUO A;  2Z6B A;  3FKI G;  4R8N A;  1EU4 A;  2RQX A;  5IYD H;  4DV5 L;  2KED A;  1VQP A;  3M9B A;  4JI6 L;  5KNB A;  4JCV E;  2E76 C;  3G6J B;  2JA5 B;  1A15 A;  2B2W C;  1HA6 A;  1PMR A;  5T1I A;  1N34 L;  1DYQ A;  1WTX A;  1MHW C;  4KHP Q;  4NP5 A;  3IKJ A;  1CT1 D;  3TP5 A;  1R4Q B;  4DUY Q;  3HOU B;  4B3S Q;  5D14 A;  3OMC A;  3NQT A;  1FYC A;  1LTL A;  1STN A;  2R7D A;  2WAQ B;  4HJ9 A;  3NE5 B;  1U0L A;  2GVA A;  1W2B A;  2LFN A;  2JA8 G;  1Z47 A;  4QGU A;  3NQI A;  3R2T A;  3A5U A;  3PUX A;  1Q3L A;  2UUC Q;  4X3S A;  2XRQ D;  1VQ6 A;  2NZH A;  4DV3 L;  1GUW A;  3S2D B;  3O13 A;  1OXT A;  4IUP A;  1YJ9 A;  5K36 H;  1EIH A;  3JC6 6;  3K8A A;  3MXG A;  4O1N A;  4C56 C;  5M5X B;  5F2D A;  4BWG B;  5C3E G;  1XMQ Q;  1BNZ A;  4H13 C;  5FO9 B;  2OEO A;  3HKZ E;  4G57 A;  4CGY B;  1BBW A;  3DWQ A;  2CCZ A;  3IL8 A;  5C4Z A;  3H3V C;  1GJX A;  1L0X B;  3Q22 A;  2A69 C;  3OW7 A;  3H3V I;  1K0R A;  4A3L H;  1EWC A;  2F0V A;  4K2L A;  3K5L A;  3BZC A;  3D8G A;  4F87 A;  3GTJ H;  4OX9 Q;  2KEC A;  3GTL B;  4GOP B;  1A3U A;  1YEZ A;  1RF2 D;  1K3B C;  3RN5 A;  1T9H A;  2I5M X;  4FP5 D;  1IXR A;  1A3V A;  1MJC A;  5IGF A;  1RTN A;  1I3Q B;  3S2H H;  2GVB A;  4RKL A;  3ZJY C;  2PMZ B;  4FXD A;  4R8I A;  3OOC A;  3D4R A;  4KY6 A;  2F3V A;  1IZ6 A;  1LO5 D;  5C0X J;  3NEM A;  1VQO A;  1SND A;  2ZTE A;  1WTW A;  1QUQ B;  3IFT A;  3SE0 A;  4ZYS A;  3K59 A;  3LNN A;  1QNK A;  1DM0 B;  1H9K A;  1SXT A;  3LWU A;  4LMQ D;  2QDL A;  3JAM E;  1SLJ A;  4J8Q A;  1SBB B;  1V1O A;  4MN3 A;  5E7N A;  1XX8 A;  4DR2 Q;  4DUZ L;  1B3Q A;  5AJ3 Q;  4UAI A;  2QDB A;  2RCN A;  3HZX A;  3PUV A;  3EQL C;  3W3A A;  5EKK A;  4JK1 C;  2EY1 A;  3PO2 H;  2TSS A;  1SJE D;  2H1E A;  1R9T B;  3OIP A;  1N9W A;  2BA0 A;  1JE4 A;  2AWO A;  2CH4 W;  1JJC B;  1SE2 A;  3VYU A;  1FGB D;  1F2L A;  2K33 A;  4FF1 A;  4QQB X;  2HHH Q;  3G71 A;  1VQA A;  5LHY 1;  4POG A;  2A1A A;  5E4X A;  4JI7 L;  4IJH A;  5EPK A;  2LY7 A;  1O80 A;  1EQR A;  1K73 C;  5BN4 A;  2RDG A;  1O7I A;  1HPC A;  4IPC A;  5IWA L;  1PH1 A;  4R4I A;  4PZ6 A;  2IPK D;  1SJH D;  3DWP A;  4BY7 H;  2TMP A;  1DON A;  1VF5 C;  3KF6 A;  1FVI A;  4QIW E;  1A2T A;  1S40 A;  1CHP D;  3MA2 B;  1UE5 A;  5KNC A;  3MEF A;  4MTN A;  1S5E D;  1T5X D;  1OXS C;  4GLV B;  1PRT D;  5T1G A;  3PV0 A;  1B70 B;  3M4P A;  3Q6S A;  1XTC D;  2B8G A;  4KJN A;  2L1B A;  1CKN A;  5C0X I;  4DUZ Q;  1J5E L;  1TU2 B;  2K5N A;  4ZQ3 A;  1LTT D;  1RD9 D;  1TXY A;  1PFS A;  3S14 H;  2E2J B;  5C3E B;  1VQE A;  3QOL A;  3KF8 B;  5CV8 A;  3K6O A;  1L1O B;  1TS5 A;  3K58 A;  3NBH B;  3H15 A;  2YU9 H;  4JW0 A;  4DR4 Q;  2SNM A;  2R93 H;  4LF6 L;  3OMG A;  4E6I A;  4X64 L;  4A3M B;  1VQN A;  5D65 A;  1H9J A;  1E2Z A;  4K8I A;  4F8M A;  1PH9 A;  1YNN D;  3I70 A;  1GUN A;  2LSS A;  4KLK A;  4A75 A;  2JA5 G;  2OCE A;  3C2P A;  4IZ8 A;  1UWV A;  4A3F H;  1HNZ Q;  2F4V Q;  4JYA Q;  4BY7 G;  4R9W A;  3NWT A;  5EQ0 A;  4UY8 C;  3K7A B;  1PH6 A;  1XNQ L;  3AFQ A;  2LS0 1;  3GTL H;  2RKS A;  1TWA H;  4RGM A;  1TWG B;  1VF7 A;  5IP7 G;  2QW7 A;  2HD3 A;  5J39 A;  1IYV A;  2PZT A;  3F2U A;  5CYU A;  1LM0 A;  1ZYR C;  3RLO A;  5FLM H;  2JA6 B;  4JI1 L;  3S2H B;  4DAM A;  2RHS B;  2SNS A;  3C3L A;  5I2Y A;  3VDY A;  4BS9 A;  4NXM L;  3A54 A;  1VQD A;  1AEX A;  1XPU A;  2R7Z B;  2F0O A;  5C0X H;  1II3 A;  5CV9 A;  3HOX H;  4DUY L;  3RLF A;  3E5S A;  3PO2 G;  5GAD C;  4ULL A;  1EY0 A;  2JP1 A;  4P73 A;  1A62 A;  3DWA A;  2B2T A;  4HN7 A;  3E6Z X;  4BBS B;  4K5X A;  5AFW A;  1E1O A;  3RN2 A;  4AIM A;  3HOU H;  4IFD H;  2LXJ A;  1BUV T;  2O5I C;  3Q24 A;  1C7Y A;  4JI2 Q;  2OQ0 A;  3PIO 3;  2FIN B;  3DEP A;  2SEB D;  2E2I B;  2RHQ B;  3K81 C;  5DM6 3;  4A3E B;  1WTR A;  1HUN A;  4R4C A;  4BXX H;  4JBJ A;  1QOH A;  2QGQ A;  1BCP F;  2B8F A;  2N55 A;  1WYD A;  1KQS A;  3D6W A;  5FK9 C;  4EQP A;  1SYE A;  3DLL A;  4B9X A;  3NEL A;  2K14 A;  5KYI A;  4XQN A;  1A63 A;  3KLW A;  2K5Q A;  5FKA C;  1TT2 A;  1W6J A;  2RSO A;  5C4J H;  4BA2 I;  3CPF A;  2WKC A;  4MNO A;  2BDO A;  1TY0 A;  4OO1 I;  1HR0 Q;  2E2D C;  3DM1 A;  5GRO A;  5JJK A;  2JXM B;  2PI2 E;  2R92 B;  2N49 A;  3NPP A;  3U9O A;  2KBN A;  2F0J A;  4UP7 A;  2MQH A;  1CM9 A;  1SYD A;  1KXL A;  1WCM B;  1FNV A;  4DAV A;  5M5W B;  1O7Y A;  1I6H B;  2UU9 Q;  2QKI C;  1PZK D;  2K04 A;  3TS2 A;  2VUM B;  2K7V A;  1NMG A;  1X3F A;  2KCC A;  2ES2 A;  2SOB A;  3W2D A;  1JE5 A;  1SFO H;  3ONA B;  1QZH A;  3DXJ C;  3E3X A;  4JI0 L;  3U4V A;  4KKT A;  1JWM D;  1RKN A;  4B08 A;  1OTC A;  4JI2 L;  1QB5 D;  4ZLT F;  5CBE E;  2E2J H;  1BDO A;  4RA8 A;  4DK6 C;  4GNX B;  1LTB D;  4X65 Q;  3T16 A;  5CV5 A;  5IT9 E;  4LF7 L;  4ZRZ A;  1YBY A;  1I4R A;  2E75 C;  3TZU A;  2AQ1 B;  4M1U B;  4B3M Q;  2EJM A;  4MTK A;  4KD3 A;  4ME3 A;  5FO8 B;  4DFA A;  1TS3 A;  3M4Y A;  2Z4H A;  4K8J A;  2CVR A;  1N33 Q;  5FLX c;  4UHV A;  4CDC C;  3VYT A;  2KCM A;  1ONL A;  1A3T A;  4IQZ A;  4OWT B;  5FLM G;  4OHJ A;  1G2S A;  1PRT C;  1SAP A;  3LWE A;  3M7N A;  3SDZ A;  3HOW B;  4L63 B;  5IYD G;  4GNX A;  3QOJ A;  4RCN A;  1DGS A;  5M3M B;  4GKJ Q;  4LAA A;  1QIL A;  3I2Z A;  2UUA L;  2Z4I A;  1SNQ A;  1TWA B;  2RVL A;  4QMG A;  2A5H A;  1Y1V H;  1JOQ A;  3RD4 A;  2EYF A;  2E2H B;  3PO2 B;  2RDF A;  4BBR H;  3J7A F;  4GN3 B;  1VQ9 A;  2UUB Q;  1TII D;  1VQK A;  2KHJ A;  2Q2H A;  4CBV A;  1N36 L;  1CA5 A;  1JOK A;  3TP8 A;  3N6R A;  1PFB A;  5JEA G;  4UP9 A;  3UDI A;  4UP8 A;  2X69 A;  1XYI A;  1NAP A;  3T53 B;  4X66 L;  1M90 C;  4JI1 Q;  3FVQ A;  3QG1 A;  1UEA B;  4JG2 A;  2L9H A;  1KAB A;  5CBA E;  4DF7 A;  4IN3 A;  1NTG A;  2UXC Q;  1TWH B;  3EFX D;  2EIF A;  3CQZ H;  1S5B D;  3PGZ A;  1YNX A;  4P74 A;  5E4W C;  3MXN A;  5LMN W;  4OX9 L;  4WOR A;  2N3S A;  1YJN A;  1CSP A;  1EU3 A;  4R4O A;  3WWV A;  1TR5 A;  2IHE A;  5IOD A;  5FO7 B;  2NZO A;  1OXV A;  4R1J A;  2EYP A;  4A4I A;  1Q1E A;  1G8Z D;  4ILW A;  5JVG 3;  4EQ5 A;  4KI0 A;  1V1P A;  4JOI C;  1MJE A;  2IX1 A;  1AZP A;  1RTO A;  2XNA C;  1EY4 A;  3FPU B;  4LFB L;  3J80 i;  4YHH L;  1FNU A;  3D4W A;  4IPD A;  4F7X A;  3MFY A;  4TVA B;  5C3W A;  4WJ3 M;  3I4M G;  1S5D D;  1SNP A;  3NBH A;  1IW7 C;  1SYC A;  3GTJ B;  1FR3 A;  4DR4 L;  2RA4 A;  1V8Q A;  1EYD A;  1QZG A;  1HJP A;  2PQE A;  2I5H A;  4HJ7 A;  4JI7 Q;  2A69 D;  5J1Z A;  4A3K H;  4BA1 I;  2IT1 A;  2OTJ A;  4L8J A;  1STB A;  5LL6 S;  2F0I A;  4IUT A;  1QG7 A;  4K14 A;  4A3B G;  3MC0 B;  5FLX E;  1MBY A;  3CKI B;  3NK9 A;  3GV3 A;  1SFO B;  3SR1 A;  3J81 j;  4GS3 A;  1QUQ A;  4GLA C;  1VQH A;  4B3R Q;  1XNR L;  4A3C H;  4HIO A;  2M2L A;  4XQQ A;  3GTO B;  1G29 1;  3EN2 A;  4N9T A;  5IT9 c;  3S1Q H;  2H5X A;  1HNX L;  1EOV A;  2A8V A;  5IYC G;  4BY1 G;  4LF9 L;  2EVB A;  4RHS A;  3D31 A;  3PF5 A;  1IBL L;  1B3A A;  1D2B A;  2KVM A;  4BBS G;  1XNR Q;  4ZK9 B;  1QCB D;  3P20 A;  3J81 c;  1VS0 A;  1CHQ D;  1KDC A;  2KCT A;  1X32 A;  1K8O A;  2HDM A;  3S1R H;  2A68 D;  3A56 A;  1P16 A;  1IYU A;  1VQL A;  3CU7 A;  1ILP A;  4A3D H;  4WJ4 A;  2EQS A;  4ZCK A;  2GN5 A;  2BDN A;  1PTO H;  3TZD A;  2GA4 B;  1SDF A;  1JOR A;  3TRZ A;  5ELF A;  1GUS A;  1K8A C;  2ASB A;  2CWP A;  1MI2 A;  1QVC A;  2XGT A;  2VB3 X;  4C3J B;  2B2V A;  1STA A;  5M9O A;  4DR3 L;  2C5C A;  1KRT A;  3NTH A;  4JBM A;  3L2P A;  4DV6 Q;  4K6D A;  1JC7 A;  1IHZ A;  2EYL A;  2RCF A;  1O78 A;  4A3L G;  1J9O A;  3HS0 C;  2CW0 D;  3CRK C;  1A8V A;  3PUZ A;  2HHH L;  4QL5 A;  2NN6 G;  1HZ9 A;  5KIX A;  1JIC A;  4OL7 A;  3FMC A;  1EEF D;  1TWF B;  3F1Z A;  4KHZ A;  3E0E A;  1ESF A;  2B2W A;  5C3E H;  2K5V A;  3T1Y Q;  1C0A A;  1LTS D;  4FF3 A;  3HP3 A;  1AP0 A;  1ZXT A;  3C1E A;  3SEB A;  1C4Q A;  4A3I G;  1PH4 A;  1HR0 W;  2R93 B;  4J15 A;  1XTD A;  4DK3 C;  1K3R A;  1ENF A;  1WTV A;  3S14 B;  3PQI A;  1CI3 M;  4TSS A;  1XWE A;  1OO9 B;  1UEB A;  4DNT B;  3JAM i;  3HKS A;  5GAE C;  1BOS A;  5DNF A;  3ULJ A;  2JA8 H;  2NN6 H;  1EYG A;  3MFG A;  5I9P A;  2A6H D;  4CDE C;  4YY3 Q;  4YCW A;  1NSN S;  2NVY B;  3MHB A;  4Z9C B;  1PZJ D;  4IFD I;  2V4D A;  3AU7 A;  1GO3 E;  4CKB A;  1B9N A;  3G6E A;  4KKU A;  1U9R A;  2K5D A;  2NWG A;  1NMF A;  1ASY A;  3UDF A;  4DR5 Q;  4C3I H;  5JJI A;  4KN7 C;  3PUY A;  2R3Z A;  3GTP H;  2UXB L;  5NUC A;  4XIG S;  5BN3 A;  4JI5 Q;  5IYB G;  3TP7 A;  2UU9 L;  4RHR A;  1X3P A;  2PNR C;  1M4V A;  4XTC S;  5ELO A;  3CMA A;  2EJF C;  2A73 B;  1N32 Q;  1SNC A;  3TSS A;  4CJ0 B;  2G5D A;  2EY6 A;  2VXW A;  3NWS A;  4NB3 A;  4DV5 Q;  3M4O B;  4I7Z C;  4MHE A;  2VQF L;  4Y7N H;  2JQO A;  1LLR D;  1XNQ Q;  5CV6 A;  2VQE L;  1NJI C;  1XMQ L;  1QJO A;  2XSC A;  1FL0 A;  3FKI B;  1F2Z A;  2PQA B;  4GOP C;  3CCQ A;  1DJR D;  3QJY A;  4RG1 A;  4B3S L;  3MXU A;  2MFI A;  3S1N H;  4NW2 A;  3V05 A;  4LWC A;  1EEI D;  1JMC A;  4A3B H;  1CKM A;  1Q12 A;  4LJZ C;  5FJ8 G;  4DV2 L;  4DNI A;  5IY0 A;  5C0X G;  3NEN A;  1UE1 A;  2VQE Q;  2MGS A;  1IBK Q;  3GTO H;  4TQU S;  3NTK A;  2XVS A;  2VL6 A;  4RGT A;  4QUF A;  3J81 E;  2PW7 A;  3URY A; 
#chains in the Genus database with same CATH homology
 2HT1 A;  5K36 G;  1P8L A;  1C9O A;  2E5L L;  3UDX A;  1EIY B;  3OYY A;  3PSI A;  3RLO A;  1LM0 A;  4A3I H;  5FLM H;  4JI8 L;  4JV5 Q;  4JI1 L;  2B63 G;  2F3I A;  4DAM A;  1SRU A;  2RHS B;  3GO5 A;  1VQ4 A;  1AE3 A;  1WJJ A;  3GDE A;  4JI8 Q;  4JV5 L;  3CXC A;  3VDY A;  3UE1 A;  4NXM L;  1VQD A;  1GM5 A;  1XPU A;  1XMO L;  4AQY L;  1AE2 A;  5GQO A;  1I50 H;  4LF4 Q;  4A3D G;  5BR8 Q;  1SR3 A;  3HOX H;  5C4X H;  3BU2 A;  3OTO Q;  3RLF A;  4DUY L;  3ULP A;  1S72 A;  4JI3 Q;  3HOW G;  3PO2 G;  2UXC L;  3BZK A;  5GAD C;  2Y0S E;  4K0K L;  4A3M H;  4GN4 B;  1SRO A;  2BA1 A;  2PI2 A;  1WCM H;  4P73 A;  5M5Y H;  1A62 A;  4X66 Q;  4AH6 A;  4LF6 Q;  1X56 A;  5IYC H;  2E5L Q;  1BVS A;  5JJL A;  3F2C A;  1E1O A;  2IY5 B;  3RN2 A;  1PYS B;  4AIM A;  3HOU H;  3I4N G;  1W3S A;  2LXJ A;  5DLQ E;  1C7Y A;  4LFC Q;  4A3C G;  3J81 i;  4JI2 Q;  2OQ0 A;  3T1H Q;  2NVT H;  4HID A;  5GAH C;  2R93 G;  1JT8 A;  3F2D A;  3RLN A;  2PQA A;  3TEH B;  3I55 A;  3CCU A;  2RHQ B;  1PA6 A;  3K81 C;  4IOC A;  4B3M L;  1Y1V G;  5M3M G;  4R4C A;  4L5S A;  4DR1 Q;  4HJA A;  4YWM A;  2AHO B;  5M5W H;  4BXX H;  3KFU A;  3CC7 A;  4JBJ A;  1I6H H;  3U4Z A;  1B8A A;  2QGQ A;  4DR2 L;  5LMU Q;  4A3K G;  3CPW A;  1WYD A;  2MNA A;  1KQS A;  4YCU A;  3FP9 A;  3DLL A;  4POF A;  5GAG C;  4OXP A;  2Q2U A;  3NEL A;  3S24 A;  2K14 A;  3H0G G;  1SE8 A;  3I4O A;  3U50 C;  4DR3 Q;  1QVF A;  2XTI A;  2JA6 H;  1A63 A;  4BY1 H;  3KLW A;  3CCL A;  3PIP A;  4X62 L;  1VQ5 A;  3HOY G;  5C4J H;  4OWW B;  4BA2 I;  2UUA Q;  2KEN A;  1PH8 A;  2KHI A;  3CPF A;  4MNO A;  4R4T A;  2WP8 J;  4QY7 A;  3I4M H;  4DR1 L;  4DV1 Q;  1WOC A;  4OO1 I;  4EX5 A;  1X6O A;  1HR0 Q;  3AEV A;  1PVO A;  1S3O A;  5GRO A;  5JJK A;  3JAM c;  2PI2 E;  2N49 A;  1EFW A;  1SMX A;  1B7Y B;  2KBN A;  4UP7 A;  2MQH A;  3A5Z B;  3TQY A;  2UXD L;  1KXL A;  1KL9 A;  3W1B A;  4JI3 L;  1BKB A;  2ALY B;  2VY3 A;  1HR0 L;  5M3M H;  4GKK L;  3M85 A;  1PH3 A;  2ZTD A;  4AQY Q;  3STB D;  3KDF B;  4YWK A;  4BBS H;  2UU9 Q;  4UPA A;  3TS2 A;  4DV7 Q;  1HNX Q;  3GTM H;  3OW2 A;  2OWO A;  3S1M H;  1Y1W G;  1NMG A;  2JK8 A;  1X3F A;  3ERS X;  1VQF A;  2ES2 A;  1JE5 A;  1SFO H;  1QZH A;  4JBW A;  3J80 c;  2WB1 E;  3UE0 A;  4JI0 L;  4GKK Q;  4LNQ A;  3U4V A;  1XJV A;  1NY4 A;  3AQQ A;  2E2I H;  1I3Q H;  5M3F H;  1YHA A;  1OTC A;  4JI2 L;  4GOP A;  4L5T A;  1Y1W H;  2E2J H;  1LYL A;  2AMC B;  3IRB A;  1WCM G;  1L0W A;  4NPS A;  1YIT A;  4X6A H;  2I5L X;  4DK6 C;  3M4O H;  4GNX B;  1H95 A;  3K0X A;  4DPG A;  2JEA I;  4KHP L;  4X65 Q;  3EIV A;  4LF7 L;  4LF7 Q;  3CP0 A;  4DAY B;  1YBY A;  3I7F A;  3H3V H;  1L1O A;  4B3M Q;  3J7Z C;  2R92 H;  2ID0 A;  4ME3 A;  1HH2 P;  4DV2 Q;  4YHH Q;  4K0K Q;  1AH9 A;  3W1G A;  2ZJR A;  1K9M C;  1N33 Q;  1D7Q A;  4JI6 Q;  3HOZ G;  5FLX c;  1FGU A;  2JJQ A;  4A93 G;  5BR8 L;  2B29 A;  1BBU A;  1NBW A;  2KCM A;  4JOI A;  4P72 A;  5M3F G;  2K52 A;  4OWT B;  1X3G A;  4GNX C;  4A3E G;  1PH7 A;  5FLM G;  1KD1 C;  4B3T Q;  2NVQ H;  3KYH C;  2VUM H;  1E22 A;  4LF9 Q;  1X54 A;  5AJ3 L;  3M7N A;  1VQB A;  1I5F A;  1WI5 A;  2BH8 A;  1XPO A;  5HY6 A;  1VQ7 A;  1VQC A;  4BBR G;  4A93 H;  2DGY A;  3HOZ H;  1TWF H;  1JB7 A;  2I0Q A;  4L5R C;  1HNW L;  1IBM Q;  3UDG A;  5IYD G;  2B3G A;  1RL2 A;  1V43 A;  4GNX A;  4DV4 Q;  5IP9 G;  1DGS A;  4GKJ Q;  2QA4 A;  3I2Z A;  2UUA L;  1VQI A;  4LW1 A;  3S16 H;  4HIM A;  4BXX G;  1LUZ A;  1YVC A;  1Y1V H;  2AKW B;  2ZJQ A;  1MKH A;  2UUC L;  4LF5 Q;  1TWC H;  4H02 A;  2R7F A;  4X62 Q;  4BBR H;  3ER0 A;  1Q81 C;  1UE6 A;  1Y14 B;  4GN3 B;  1KIX A;  1VQ9 A;  3CCS A;  4IPH A;  1PH5 A;  2Q2T A;  2R7Z G;  3K7A H;  3HOY H;  2UUB Q;  5ELN A;  1VQK A;  4APV A;  2KHJ A;  2Q2H A;  2NVX H;  1CSQ A;  3E9H A;  1N36 L;  3OTO L;  3H0G H;  1U5K A;  1I94 Q;  4GKJ L;  5JEA G;  4UP9 A;  1XMO Q;  1NE3 A;  3UDI A;  4UP8 A;  3PF4 A;  1YHQ A;  4DR6 L;  3F2B A;  2EXD A;  1RIP A;  4X66 L;  1VQM A;  1Q86 C;  1WFQ A;  1M90 C;  4JI1 Q;  3D0F A;  4DR6 Q;  4QJF A;  2D62 A;  4JG2 A;  3FHW A;  3HOX G;  3RNU A;  4A3J H;  3HOV G;  4LUO A;  3M3Y H;  4LFB Q;  2CFM A;  3B6Y A;  3AYH B;  4DV0 L;  2A19 A;  3FKI G;  4JBK A;  1NTG A;  2K5H A;  2UXB Q;  2UXC Q;  4OON A;  1E24 A;  2HQL A;  3KF6 B;  1X9N A;  2E8G A;  4DV5 L;  1IL2 A;  3EBE A;  2EIF A;  3CQZ H;  2VS1 A;  3M9B A;  1YNX A;  3PGZ A;  4P74 A;  4PZ8 A;  3RZD H;  2WAQ G;  3G4S A;  4JI6 L;  4LF4 L;  1N33 L;  4PZ7 A;  4JCV E;  5LMN W;  2UUB L;  4Y52 H;  4OX9 L;  1Q1B A;  2N3S A;  1YJN A;  1CSP A;  1IBM L;  4R4O A;  3WWV A;  2IHE A;  4X64 Q;  4IFD J;  3CW2 C;  2NZO A;  1OXV A;  2C35 B;  1N34 L;  5IP7 H;  4R1J A;  1X3E A;  4A4I A;  4KHP Q;  1Q1E A;  1X65 A;  1L1O C;  1PHJ A;  4EQ5 A;  4LFC L;  3TS0 A;  4DR7 Q;  1EIF A;  4KI0 A;  1HZA A;  4DUY Q;  4B3S Q;  2Y0S G;  2N78 A;  4JOI C;  3STB C;  1MJE A;  2IX1 A;  1Q46 A;  3J7A 5;  1LTL A;  4DV0 Q;  3BJU A;  5C44 H;  2R7D A;  3CCR A;  4HJ9 A;  1N32 L;  4LFB L;  4HIK A;  2D0P A;  1U0L A;  2GVA A;  3J80 i;  1W2B A;  2F52 A;  4YHH L;  4YWL A;  3HKZ G;  5IP9 H;  2JA8 G;  1Z47 A;  4IPD A;  4QGU A;  3A5U A;  3PUX A;  2D0O A;  4TVA B;  2UUC Q;  1A0I A;  1D8L A;  4WJ3 M;  3I4M G;  1CKO A;  1OXU A;  4B3T L;  4DR4 L;  1VQ6 A;  1TWH H;  2NZH A;  3KDF A;  4NXN L;  4DV3 L;  3T1Y L;  2WFW A;  1QVG A;  1GD7 A;  2R6G A;  4HJ8 A;  1M1K C;  3CC2 A;  4IFD G;  1OXT A;  1QZG A;  3E9I A;  1HJP A;  4O2D A;  3CME A;  4C2M H;  4DV3 Q;  1YJ9 A;  4C3J H;  5EAY A;  3KJO A;  1YI2 A;  3GTQ H;  3JC6 6;  3K8A A;  2IHF A;  5IE8 A;  2CWA A;  5IYD H;  2I5H A;  4FDB A;  2BH2 A;  4HJ5 A;  4HJ7 A;  1G6P A;  4JI7 Q;  3CD6 A;  3KOJ A;  3RZO H;  3FKI H;  5C3E G;  4A3K H;  4BA1 I;  1XMQ Q;  1FJG L;  2IT1 A;  2OTJ A;  3HKZ E;  1K8G A;  2NN6 I;  2R92 G;  3L7Z C;  2V1C C;  1BBW A;  5JEA J;  4A3B G;  2CCZ A;  1X55 A;  5IWA Q;  4O0A A;  1YIJ A;  4LF8 Q;  3J81 j;  4GS3 A;  4AYB G;  1QUQ A;  4GLA C;  1VQH A;  5J3B A;  4B3R Q;  1E3P A;  4MZ9 A;  2JA5 H;  1N34 Q;  4PMW A;  4RMF A;  3H3V I;  4IO9 A;  2HIV A;  1K0R A;  1XNR L;  3Q8D A;  4JI0 Q;  4A3L H;  4A3C H;  1KC8 C;  4L5Q A;  4HIO A;  1VQG A;  4A3G G;  3I4N H;  4DV1 L;  1G29 1;  4JYA Q;  3HOU G;  3BZC A;  1MIU A;  3EN2 A;  5IT9 c;  3U58 A;  3S1Q H;  3S15 H;  2H5X A;  3GTJ H;  1HNX L;  1EOV A;  4OX9 Q;  3MXN B;  5IYC G;  2A8V A;  4BY1 G;  4GOP B;  4LF9 L;  3W5O A;  2JA7 G;  2K50 A;  2FXQ A;  1CUK A;  1YEZ A;  3D31 A;  3PF5 A;  1I94 L;  1IBL L;  1E7Z A;  2N8N A;  3PIO A;  1T9H A;  3RN5 A;  1VQ8 A;  2I5M X;  2RF4 A;  4BBS G;  1Z9F A;  1IXR A;  1XNR Q;  3S2D H;  2K4K A;  2IX0 A;  2ZTC A;  4DR5 L;  3J81 c;  1MJC A;  1VS0 A;  2KCT A;  3S1R H;  4ALP A;  3S2H H;  4C3H H;  2GVB A;  1P16 A;  4LFA Q;  1VQL A;  3ZJY C;  4A3D H;  1EUJ A;  4WJ4 A;  3A0J A;  2EQS A;  4IPG A;  2GN5 A;  1IZ6 A;  1G51 A;  2CKZ B;  2K75 A;  3LGJ A;  4JI5 L;  5C0X J;  3NEM A;  2ATW A;  1VQO A;  1PYB A;  3TRZ A;  4X65 L;  2ZTE A;  1K8A C;  2ASB A;  1QUQ B;  2CWP A;  1QVC A;  2Q2I A;  2XGT A;  3AFP A;  2VQF Q;  4LFA L;  1IYJ B;  4DV6 L;  4AYB E;  4DR3 L;  1KRT A;  2JA7 H;  4DV4 L;  2AWN A;  2MO0 A;  4JBM A;  3L2P A;  4DV6 Q;  3K7U C;  1SLJ A;  3A74 A;  4A3E H;  2VUM G;  3ICE A;  1VQP A;  1JJ2 A;  1V9P A;  5E7N A;  4NXN Q;  4PG3 A;  4DR2 Q;  4DUZ L;  3GD7 A;  4A3L G;  5AJ3 Q;  1J6Q A;  4A76 A;  2RCN A;  2MO1 A;  3PUV A;  3I56 A;  1A8V A;  2NVY H;  3PUZ A;  2HHH L;  4QL5 A;  4JI4 Q;  3PO2 H;  3GTK H;  5FJ8 H;  3HOW H;  2NN6 G;  1N9W A;  1HZ9 A;  2BA0 A;  2YTY A;  2AWO A;  3F1Z A;  1JJC B;  4KHZ A;  3TRE A;  4A3F G;  3E0E A;  3G48 A;  1HZB A;  1HNW Q;  1HZC A;  4QQB X;  5C3E H;  2K5V A;  4JI4 L;  1PH2 A;  2HHH Q;  2VW9 A;  3T1Y Q;  1C0A A;  1YZ6 A;  3G71 A;  1VQA A;  5IYB H;  4NXM Q;  2L15 A;  1UE7 A;  1HR0 W;  4A3I G;  1PH4 A;  4POG A;  2DUD A;  2A1A A;  1PV4 A;  4JI7 L;  3RR5 A;  3SGI A;  4J15 A;  1XTD A;  2YTV A;  4IJH A;  4DK3 C;  1K73 C;  1EQR A;  1K3R A;  4B3R L;  4JC0 A;  4LF8 L;  3CCJ A;  1HNZ L;  1CKN B;  1O7I A;  5IWA L;  4IPC A;  1PH1 A;  1UEB A;  3JAM i;  3HKS A;  4R4I A;  4OWX B;  4PZ6 A;  3ULJ A;  5GAE C;  2JA8 H;  1IBL Q;  4YCV A;  1EYG A;  2HIX A;  4YY3 Q;  4DV7 L;  4YCW A;  1IBK L;  5C44 G;  1FJG Q;  1OXX K;  2WAQ E;  4BY7 H;  3KF6 A;  1FVI A;  4QIW E;  4IFD I;  1K83 H;  2WB1 G;  3CF5 A;  1V1Q A;  1GO3 E;  1S40 A;  3HFZ B;  3G6E A;  2ZJP A;  4GLX A;  4R4Q A;  1GVP A;  2PNH A;  4OO1 G;  1UE5 A;  2CQO A;  1ASY A;  1NMF A;  1EQQ A;  2Z0S A;  3UDF A;  4DR5 Q;  4C3I H;  5JJI A;  3MEF A;  4MTN A;  3PUY A;  1OXS C;  4GLV B;  1L2F A;  3GTP H;  3DM3 A;  2UXB L;  3M4Q A;  3PV0 A;  1B70 B;  1KAW A;  3M4P A;  2OTL A;  1N8R C;  2JA6 G;  4XIG S;  3PO3 H;  4JI5 Q;  5IYB G;  4P75 A;  1Q8K A;  5H1S E;  4A3G H;  2UU9 L;  1VCI A;  2QEX A;  1CKN A;  5C0X I;  1VQJ A;  4DUZ Q;  1J5E L;  4XTC S;  5ELO A;  2K5N A;  2B63 H;  1R9T H;  3CMA A;  1SN8 A;  1J5E Q;  1N32 Q;  1TXY A;  2UXD Q;  4DKA C;  1PFS A;  4GN5 A;  4A3J G;  1Q82 C;  4IJL A;  3CCV A;  2PMZ E;  5LMN L;  3HOV H;  3S14 H;  1VQE A;  4NB3 A;  4DV5 Q;  1XPR A;  3K80 C;  2VQF L;  3KF8 B;  4DR7 L;  4Y7N H;  1L1O B;  1TWG H;  5HGQ A;  2JQO A;  3PUW A;  3NBH B;  3H15 A;  2ZM6 Q;  2YU9 H;  1XNQ Q;  4DR4 Q;  2R93 H;  2VQE L;  1KHI A;  4LF6 L;  2Z6K C;  1NJI C;  4X64 L;  1XMQ L;  1VQN A;  2OQK A;  3PO3 G;  3CCE A;  3CC4 A;  1FL0 A;  1JJG A;  1PH9 A;  1EWI A;  3CAM A;  1YJW A;  3ULL A;  3KJP A;  2PQA B;  4IOA A;  2LXK A;  4GOP C;  2LSS A;  2JE6 I;  3CCQ A;  3T1H L;  4KLK A;  2R7Z H;  4A75 A;  1ASZ A;  4RG1 A;  2JA5 G;  4B3S L;  2VZA A;  3S17 H;  2OCE A;  1Q7Y C;  2MFI A;  4A3M G;  1E1T A;  2Z6K A;  3PCO B;  5LMN Q;  1KRS A;  1UWV A;  2JEB I;  4P71 A;  5LMU L;  3F8T A;  4A3F H;  1HNZ Q;  2F4V Q;  3S1N H;  2E2H H;  4LWC A;  1JMC A;  4BY7 G;  4A3B H;  2YTX A;  5C4X G;  1CKM A;  1Q12 A;  1YHB A;  5FJ8 G;  4DV2 L;  4DNI A;  4UY8 C;  5M5X H;  5IY0 A;  5C0X G;  2YV5 A;  3NEN A;  1UE1 A;  4LF5 L;  2VQE Q;  1PH6 A;  1IBK Q;  3GTO H;  1GKH A;  4TQU S;  4YY3 L;  2ZM6 L;  3AFQ A;  1XNQ L;  2VL6 A;  3L0O A;  3GTG H;  2VNU D;  3GTL H;  2F4V L;  4JYA L;  1TWA H;  3CCM A;  2JA9 A;  4LUZ A;  2YYZ A;  4LUV A;  5IP7 G;  1N36 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...