4LW1A

Fragment-based discovery of a potent inhibitor of replication protein a protein-protein interactions
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
123
structure length
123
Chain Sequence
GSHMVGQLSRGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGNPVPYNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of a potent inhibitor of replication protein a protein-protein interactions using a fragment-linking approach.
pubmed doi rcsb
molecule keywords Replication protein A 70 kDa DNA-binding subunit
molecule tags Dna binding protein/inhibitor
source organism Homo sapiens
total genus 31
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2013-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04057 Rep-A_N Replication factor-A protein 1, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4lw1A00
4OWXB 4KHZA 5C4XG 4DV5Q 1LYLA 4A3FH 2IX0A 3AQQA 2D62A 1L0WA 4IPGA 4A93H 4BBRG 3MEFA 1X56A 1NTGA 3PUWA 3AEVA 2ZJRA 4JI3L 1Q1EA 1K8GA 1E24A 1HZCA 4QGUA 1HH2P 1HNXQ 4B3TL 1X6OA 4O2DA 1J6QA 3PUYA 3GTQH 2WB1E 3EN2A 4EX5A 4DR7L 3T1YL 1FJGL 1Q7YC 1Y1WH 3OW2A 4DV3Q 1C0AA 1HR0W 1AH9A 4OWWB 4DUZL 1HNZQ 2NN6G 2VUMH 5DLQE 4DPGA 2PMZE 4K0KL 5M3MH 4UP8A 1KC8C 3HOZG 4RG1A 5IYCH 3I2ZA 1GVPA 3HOVH 3D31A 4DV7Q 1YJNA 3E9HA 4WJ3M 2R7ZG 4A3EG 2V1CC 4DV5L 2WFWA 3RZOH 2JA8G 1PHJA 1FGUA 2H5XA 4JC0A 3KJOA 1Q86C 3FHWA 4A3FG 4GS3A 1E3PA 3PF5A 1VQOA 4A93G 3F8TA 2PI2A 1WCMH 1B8AA 3K8AA 4TQUS 3JAMi 1SE8A 3GTMH 1HNXL 2LXKA 3S16H 3TS2A 1EIYB 2VNUD 1IL2A 4P75A 2HQLA 1WYDA 1YITA 4P74A 2QEXA 2KHIA 1B70B 1V1QA 4P72A 4AYBE 4MNOA 3J81j 3PCOB 1RL2A 4DK3C 2K4KA 5IE8A 4DV3L 1XMQL 3ICEA 1N9WA 1L1OB 3CF5A 1Y1WG 3CCRA 1HNZL 1Q12A 1PA6A 3S15H 4LF5Q 1PH3A 3HOYH 2C35B 1NJIC 1L2FA 2F52A 4GN3B 2D0PA 1C9OA 4YCVA 5LMUQ 2VUMG 4OONA 1WJJA 2B29A 4JBWA 3K80C 4XTCS 5M3MG 4DAYB 4DV7L 4DV4Q 5IYCG 1O7IA 2UUAQ 2MFIA 5FLMH 1ASYA 2UU9Q 1FL0A 1YJ9A 3HOVG 4J15A 4C3IH 1KL9A 2WB1G 4GLXA 1T9HA 3B6YA 4YY3L 3CCJA 1PH9A 3CCVA 2HT1A 1EUJA 1UEBA 1YVCA 4YWLA 4DNIA 1X3GA 1OXUA 1WCMG 4PZ6A 4DK6C 2Y0SE 4LUVA 1MJCA 3S1NH 2YU9H 3CD6A 5GAHC 2UXCL 2JK8A 3U4VA 1A8VA 1NMGA 2F4VQ 4X66Q 4DR5L 4X65Q 1SMXA 1Q1BA 4JI1Q 4L5SA 4X62Q 1XNQQ 3I56A 3NEMA 4GLVB 4DKAC 4OO1G 4JI7Q 1SRUA 4LF5L 2EIFA 1XPOA 3H3VI 2NZOA 4GOPB 1FVIA 4UP7A 1M1KC 2UXBL 3WWVA 5LMUL 2I5MX 1C7YA 1D8LA 1VQLA 3HOYG 4JI5L 1SFOH 4A3DH 4JOIC 4DV4L 5ELNA 1WI5A 1PH4A 4LW1A 2RF4A 3KDFA 5E7NA 2LXJA 5C3EH 4DR1Q 2UU9L 4IJHA 1IBMQ 1BKBA 3TEHB 5JJLA 5FLMG 1VQFA 4O0AA 1EWIA 5LMNQ 1XMOL 1N33Q 2XTIA 3CCUA 1R9TH 4B3SL 2DUDA 2AWNA 3G6EA 4AYBG 1BBUA 2Z6KA 5IP9H 2OTLA 1SR3A 1P16A 1TWFH 1VQ9A 3DM3A 2BH8A 3CP0A 1I94Q 4QQBX 4R4CA 2KENA 1JJGA 4LFBQ 2EQSA 4UP9A 2IHFA 3PUXA 2JA5H 4X64Q 2BH2A 2F4VL 3CQZH 1SROA 4X66L 4X65L 1DGSA 4HJ9A 1NE3A 1YHQA 3CCQA 1EQQA 3RR5A 2CWAA 4X62L 1XNQL 4DUYL 4BA2I 2OCEA 1UWVA 4LFAQ 4JI7L 2AMCB 1VQ7A 1XTDA 4PMWA 1VQHA 3ULLA 2NVQH 3K81C 4AH6A 2NVXH 1XNRQ 3W1BA 3UDFA 4DV2Q 4LUOA 2IHEA 4HJ7A 4XIGS 2VW9A 4R4QA 4DR1L 4L5RC 2IY5B 1NMFA 1IBML 2OQ0A 5C3EG 1EFWA 1N33L 2Y0SG 5GADC 4R1JA 5JEAG 1HR0Q 4IFDI 4C3HH 4LF6Q 3A5UA 1VQ8A 4C2MH 1I94L 2AWOA 4YCWA 2UUBQ 5IP9G 4HIOA 3KF8B 4LFBL 2PQAA 2YV5A 1H95A 1TWCH 2CKZB 1PH1A 4DV1L 3RLOA 2JA5G 1JJ2A 2F3IA 1G51A 3BJUA 3K0XA 3CCEA 4IPCA 4LFAL 1IZ6A 3FKIH 4BY7H 4MZ9A 4LNQA 1XPUA 3HOUH 4R4TA 4JI4Q 3PV0A 1EYGA 2ES2A 5C0XI 2CQOA 2OWOA 3S14H 4POGA 1VQKA 1XNRL 4APVA 2NN6I 1QVCA 3ZJYC 4H02A 4DV2L 2E2JH 2MO0A 1QVFA 4JG2A 4JI2Q 3OYYA 3CAMA 3GTLH 2BA0A 3L7ZC 1N36Q 1V43A 5C44H 1I50H 2N49A 3U58A 1N8RC 3CCLA 1JB7A 3E9IA 5BR8Q 1CKOA 1U0LA 4GLAC 1VS0A 3HFZB 2E8GA 4IPDA 3RZDH 4GKKQ 1NBWA 1UE5A 1YIJA 4P73A 3GTOH 1GKHA 2UUBL 2R7FA 1G6PA 4GN5A 1VQMA 1EIFA 1EQRA 4A75A 4B3RQ 2ZTDA 3U50C 1VQDA 3HKSA 1HZBA 5IYBH 2QA4A 5H1SE 5GAGC 3SGIA 5M5XH 1X3EA 4DR3Q 3GTGH 4PZ8A 3A74A 3UDXA 2ZM6Q 1BBWA 3FKIG 2I0QA 2CCZA 2JA7H 4BY7G 3HOUG 2VS1A 4JI8Q 3RNUA 1N34Q 1HJPA 5C4JH 3PO3H 1IBLQ 2MNAA 4NPSA 4L5TA 3UE0A 3U4ZA 1UE6A 1J5EQ 4JI2L 3PF4A 1N36L 1XPRA 3AFQA 3GTPH 5BR8L 2LSSA 3HKZG 5C44G 4DAMA 2JA6H 4JV5Q 2Z0SA 2OTJA 1PH6A 3RLNA 1W2BA 1VQ6A 3IRBA 1QZHA 2OQKA 2YTXA 3CCMA 3S24A 3UDIA 1L1OA 2JEBI 2RCNA 3J81c 2HHHQ 1GD7A 1JJCB 5GQOA 3UE1A 4GNXC 1XJVA 4HIDA 5J3BA 1YI2A 4DR3L 2ASBA 5IYBG 3PIOA 1MKHA 2K5NA 3RN2A 4UPAA 2Q2HA 4A3GH 3I55A 2IX1A 4MTNA 4HJ5A 1VCIA 4JI8L 2R92H 4A3KH 1N34L 1TWHH 1K3RA 2HIXA 3J80c 4DV6Q 3CW2C 1IBLL 2JA7G 4OO1I 2YYZA 2MQHA 4IFDJ 4LFCQ 1PFSA 1J5EL 2VZAA 3PO3G 3VDYA 3CC4A 2Z6KC 4C3JH 2K5VA 3F2CA 2UXDQ 1CSQA 1KAWA 3CC2A 4Y52H 1PH5A 4JV5L 4NXNQ 1JMCA 2MO1A 5EAYA 4GNXB 2UUAL 2JA6G 3A5ZB 3EBEA 3I7FA 2WAQE 4A76A 1RIPA 1KQSA 4UY8C 3PO2H 4BBSH 4NB3A 2R6GA 3FP9A 3J7A5 4P71A 2HHHL 5C0XJ 3DLLA 1YJWA 1QUQA 4JBMA 2N78A 3M9BA 4GOPA 1HZ9A 1YBYA 2A1AA 3E0EA 1IYJB 1KD1C 1PH8A 1WOCA 3I4NH 4OX9Q 3BZKA 1E1TA 1LM0A 1P8LA 3NBHB 4A3GG 4DV6L 1LTLA 1Q46A 2WP8J 2XGTA 4JI1L 3M85A 1VQPA 2R92G 4BXXH 4A3KG 4LFCL 3L0OA 3CCSA 1V9PA 1YZ6A 3ER0A 2UUCQ 4A3DG 3HOWH 2PNHA 4JYAQ 3K7AH 1PV4A 3G71A 1Q81C 1B7YB 4YHHQ 1JT8A 2B63H 2UXDL 3GTJH 1W3SA 1VQIA 1E1OA 1MIUA 4NXNL 1OTCA 3GTKH 1YNXA 1CKNB 2R7DA 1VQ4A 1XMOQ 3T1HQ 1A63A 2ALYB 3PUZA 3KF6B 3AYHB 1VQCA 3GO5A 1GO3E 5LMNL 4R4OA 1CUKA 3W5OA 3G4SA 3PO2G 4BBSG 1VQEA 2K52A 4FDBA 2JQOA 3M3YH 1LUZA 4GKJQ 1OXXK 2IT1A 2AKWB 3H0GH 5HY6A 1SN8A 3HOXH 5IWAQ 1A0IA 1EOVA 3S1RH 3S1MH 3HKZE 1VQGA 4OX9L 4OWTB 4X64L 1Z9FA 3OTOQ 3L2PA 3W1GA 3I4NG 1Q8KA 4POFA 3NELA 4YWKA 3T1YQ 1KHIA 3TREA 3CPWA 1I5FA 4AQYQ 2UUCL 3TQYA 4JI6Q 4BXXG 4JYAL 2KHJA 2K14A 1AE2A 1K9MC 2AHOB 3RN5A 3HOWG 5M5WH 2WAQG 3MXNB 1VQJA 2GN5A 2PI2E 4PG3A 3STBC 3Q8DA 4A3BH 4A3MH 5GAEC 2B63G 2EXDA 4HJAA 1S72A 3H15A 4A3IH 4A3LH 2VQFQ 2N8NA 3T1HL 1KIXA 2ID0A 4IFDG 1CKMA 2YTVA 1K73C 1Y1VH 1YHBA 2B3GA 4LUZA 2Q2UA 1HR0L 4GN4B 2FXQA 1E22A 2DGYA 5FJ8H 3PUVA 4Y7NH 5M3FH 4LF6L 4GKJL 1Q82C 4DR4Q 2A19A 3ULJA 5IP7H 4LF9Q 4AIMA 5IWAL 1YHAA 2E2IH 4BY1H 4LF4Q 1KXLA 3H0GG 4IOCA 3M4PA 3OTOL 3HOXG 3PSIA 3J81i 1Z47A 2K75A 1IBKQ 4QL5A 4AQYL 2QGQA 4JI6L 1UE7A 3G48A 2NVYH 4A3JH 1XMQQ 5C0XG 1KRTA 2JE6I 1A62A 2CWPA 4JI4L 2ATWA 4B3MQ 4R4IA 3PIPA 3CXCA 1QZGA 4JBJA 3J80i 1UE1A 4DR6Q 1L1OC 1HNWQ 2VQFL 1I3QH 3TRZA 1TWGH 2YTYA 3GDEA 3ERSX 5AJ3Q 4IO9A 4A3MG 4A3BG 4A3LG 4A3IG 3K7UC 3BZCA 3PGZA 1X65A 1X3FA 3F2BA 4KHPQ 2L15A 1M90C 5JJIA 2JA9A 1Y1VG 2E2HH 1D7QA 4GKKL 3M4QA 1S40A 4YY3Q 4DR4L 5FJ8G 4LF9L 3I4OA 5M3FG 1TWAH 1YEZA 3M4OH 5IYDH 4LF4L 4B3RL 3CPFA 5IP7G 1ASZA 3UDGA 5IY0A 3AFPA 4KLKA 4BY1G 2UXCQ 1IBKL 1MJEA 4DV0Q 2RHQB 4DR5Q 2NZHA 1K8AC 2ZJQA 1I6HH 1OXSC 2ZTCA 3KLWA 3S2HH 1TXYA 2N3SA 2ZM6L 4A3JG 2UXBQ 2CFMA 4B3ML 3STBD 5JEAJ 4JCVE 3S2DH 3S1QH 1OXVA 3H3VH 4A3CH 2VY3A 4DR6L 1HNWL 4HIKA 4IPHA 4JI5Q 1JE5A 5AJ3L 1IXRA 1GM5A 2Q2TA 5IT9c 1X9NA 1PH2A 4GOPC 2VQEQ 2D0OA 4NXMQ 5M5YH 1BVSA 3ULPA 4LF7Q 4JI0Q 3M7NA 4KHPL 3EIVA 1VQNA 2RHSB 4QY7A 4B3SQ 1Y14B 2K5HA 2K50A 1HZAA 2JEAI 3GD7A 4EQ5A 3JAMc 3J7ZC 4DR2Q 2R93H 1CSPA 3I4MH 2Q2IA 3KFUA 1WFQA 5IYDG 1KRSA 2BA1A 2VL6A 3KDFB 4HIMA 4DV0L 4ALPA 4X6AH 4ME3A 3LGJA 2JJQA 1PVOA 1AE3A 3F2DA 2ZTEA 1S3OA 1K0RA 1X55A 4DUYQ 5K36G 4LF8Q 4OXPA 3JC66 3CMAA 4IOAA 1N32Q 1E7ZA 1U5KA 4GNXA 1QUQB 1PYBA 1VQBA 4BA1I 4A3CG 3F1ZA 1NY4A 3KYHC 2E5LQ 3A0JA 2VQEL 1QVGA 4QJFA 4PZ7A 4IJLA 4NXML 4LF7L 4JI0L 3KJPA 1SLJA 4JBKA 5GROA 5C4XH 4WJ4A 2I5HA 1VQAA 4DR2L 5JJKA 4BBRH 1PYSB 2R93G 3I4MG 4JOIA 2KCMA 2ZJPA 4DV1Q 3NENA 3KOJA 4JI3Q 5ELOA 3RLFA 3CMEA 2GVAA 4LF8L 3CC7A 4TVAB 2KBNA 4YCUA 4YWMA 1N32L 3TS0A 4B3TQ 1CKNA 4HJ8A 2I5LX 4A4IA 3KF6A 4DR7Q 1FJGQ 1PH7A 5FLXc 3BU2A 5LMNW 2PQAB 2E5LL 4QIWE 1VQ5A 3D0FA 4YHHL 4DUZQ 3HOZH 1K83H 2HIVA 3S17H 2A8VA 4K0KQ 1G291 1X54A 1OXTA 4LWCA 4KI0A 5HGQA 2GVBA 2NVTH 2R7ZH 4A3EH 2KCTA 4RMFA 4L5QA 2JA8H
chains in the Genus database with same CATH superfamily
4BWGB 1HFNA 1K83B 1R4PB 4BBRG 1A15A 4CDEC 4LMQD 2SNMA 1UEAB 5A2QE 4QGUA 1HNXQ 1X6OA 4HCSA 4DR7L 1SMYC 1Q7YC 3IAYA 5ELFA 4PV1C 4DV3Q 2RDFA 1X3PA 4DUZL 3R3OA 5FO7B 3G6JB 5IYCH 4OIJA 2IL8A 5BN5A 1GVPA 4CDCC 5CC4A 5G3LF 2E2JB 2RSOA 2SEBD 3RZOH 1NR2A 1Q86C 3C46A 3KJOA 4GS3A 3RZDB 2PI2A 1QE6A 1SE8A 5I9PA 2LXKA 3S16H 1EIYB 1IL2A 1ESFA 5FLXL 3K5OA 1V1QA 3HGBA 2FMMA 2OXPA 5L37A 3GP7A 5IGEA 5IE8A 3ICEA 1K0SA 3LNNA 3CF5A 1LTRD 3CCRA 2SNSA 1HNZL 3S16B 4LF5Q 1PH3A 1GOZA 5CV6A 1NJIC 2UXBQ 2D0PA 5CORA 1WJJA 5C4JB 4XYQA 1O7LA 4DV4Q 1WTWA 2UU9Q 1FL0A 1XXGA 3OMCA 1E2VA 2WB1G 4H7BA 4XT1B 3B6YA 4YY3L 1EUJA 4DNIA 4YWLA 1LTGD 4FF3A 1B53A 1B9MA 4B9WA 3CD6A 1STNA 3NQIA 4L8JA 2F4VQ 4CJ0B 1PZKD 4PMCA 1MSGA 3NEMA 4GLVB 2VB3X 3MXPA 1XPOA 1F9SA 2NZOA 4GOPB 5JPMC 1M1KC 4TKOB 4IALA 4A3KB 1TWHB 1C7YA 4J8QA 4JOIC 1PH4A 5ELNA 3QIAA 5C3EH 4IJHA 4CKCA 3TEHB 3L3OC 1VQFA 3P75A 4O0AA 1N33Q 1HA6A 4RKLA 4RFBA 1BBUA 1VQ9A 4R4CA 4GZYC 2CQAA 1A3TA 2JA5H 3CQZH 1SROA 4X66L 1GHKA 3CCQA 4BA2I 4IUNA 1K8OA 1TY0A 3HRZC 3T13A 3ULLA 4H0LC 1RD9D 3W2DA 2NVQH 3K81C 3CQZB 2NB0A 4HR7B 4AH6A 1XNRQ 3UDFA 4DV2Q 1E2ZA 4LUOA 1Y8OB 4HJ7A 2EYJA 3MFGA 4DR1L 1IBML 4ZYSA 5EPKA 4KY7A 4WRDA 4RWSC 1SAPA 4R1JA 4IFDI 1TT2A 2F0DA 3LWUA 2QEJC 2UUBQ 2PW5A 4LFBL 2AUJD 2SOBA 1SNCA 3QOJA 4DV1L 3RLOA 2KHSA 4KD4A 4DN4M 3CCEA 4RCOA 1IZ6A 3H0GB 4BY7H 2B2WA 1IYUA 2RDGA 3URYA 1G8ZD 3DUZA 3SHLA 1QVCA 4H02A 2MO0A 1DONA 5C3XA 4JG2A 1QWYA 3L7ZC 3H6MA 2F0LA 1I50H 1LTID 3E9IA 4R9WA 2DJGC 2A5HA 4A3MB 2E8GA 4IPDA 1EQVA 2WINB 1NBWA 1O78A 1CA6A 3GTOH 1VQMA 3HKZB 1XTCD 1S5FD 1EIFA 3A56A 2L55A 3K5NA 5IYBH 4PNYA 2C9OA 4DR3Q 2PPBC 4PZ8A 5JOBA 2ZM6Q 3FKIG 2CCZA 2A6HC 3HOUG 3NTHA 1N34Q 5C5MA 5CYUA 4L5TA 3UE0A 1RJTA 3PF4A 2K05A 1EIGA 4R8IA 1RTOA 5BR8L 2K33A 1EYAA 2I07B 4DAMA 2JA6H 2L11A 4JV5Q 3MWYW 2EYFA 3IRBA 1QZHA 1JOQA 2YTXA 3E3XA 1L1OA 2RCNA 2BCOA 5HURA 5EKKA 4C1NK 2E2HB 5J3BA 1YI2A 2CVRA 1D1IA 1Y69U 3K57A 2ASBA 1MKHA 1Y8PB 3I55A 2DJFC 4JI8L 1D1KA 3CW2C 1IBLL 3NHHA 2AQ2B 1PFSA 5C3WA 1J5EL 3VDYA 4C3JH 4IUUA 4DA2A 1KAWA 1TIID 2LKVA 2K03A 1JMCA 4ZKBB 5EAYA 4RGOS 4GNXB 1LTSD 3I72A 3EBEA 1QOHA 4YIJA 1EFID 1RIPA 4C3JB 4A76A 4UY8C 2R6GA 1PTOD 5M5YB 3DLLA 2HQEA 3M9BA 5FOBB 1EY7A 1T5EA 3E0EA 2JYOA 1IKLA 3EJIA 1PH8A 1KD1C 1GUSA 3R93A 4DV6L 3M85A 1DZ1A 5J22A 4A3DG 2UUCQ 3CCSA 1V9PA 1EYDA 3HOWH 1B3QA 2PNHA 4C1NI 1PV4A 5E4WC 1Q81C 2UXDL 2WACA 3EVQA 1W3SA 3GTJH 3HZXA 3GTKH 1II3A 2R7DA 1XMOQ 3QWNA 4IFDH 1Z7TA 1AW7A 2N55A 2ALYB 2X69A 3T1HQ 3HOWB 2F0NA 1A63A 3AYHB 1U4LA 4DXFA 2KUMA 2QILA 2H1EA 1CUKA 2F0KA 3DWQA 3W5OA 3G4SA 3PO2G 4KHVA 1CHPD 2JQOA 4BBSG 1QJOA 3GTKB 4GKJQ 1CK1A 3NP8A 4DU9A 4MN3A 5HY6A 4BBRB 1A0IA 4OX9L 1F9PA 4OWTB 2A6ED 1Z9FA 3SK6A 5I6WA 2EE1A 3I4NG 5IT9L 3EQLC 4AQYQ 1I5FA 4BXXG 4F88A 2F0EA 1G2SA 1AE2A 1DOLA 2F1MA 3NTIA 1K9MC 3A8JE 3MXNB 3RUZA 3U9SA 4UDUC 4PG3A 2EXDA 4A3LH 3H15A 2J4XA 1KIXA 3CU7A 1JQYD 5EBCA 1CKMA 3MFYA 1K73C 2B3GA 4DFAA 2Q2UA 3S17B 3QR8A 2NVTB 3W3AA 1FNWA 3DWPA 2CW0D 4MHEA 2MUYA 4LF9Q 4AIMA 5IWAL 1YHAA 4ZQ3A 1DXMA 3OTOL 5ELDA 1F77A 1S5CD 4QL5A 1CZGA 1IBKQ 2QGQA 1PZID 3DM1A 1HQRD 2CWPA 2ATWA 4B3MQ 3D4RA 3GTQB 1X32A 1EY4A 5E1FA 1V8QA 3A7AB 4A3IG 3K7UC 2E2DC 3BZCA 3PGZA 2IX3A 4FXKC 4X3TA 1M90C 4CHTB 3I3CA 2EXZA 4YY3Q 4DR4L 2Q8IB 3I4OA 3M4OH 3PMFA 2Z8LA 5IP7G 4KK7A 2C5CA 4OIKA 4XYOA 2QCPX 1OO9B 1UNSA 2PQEA 2NZHA 1F2MA 1SYCA 1MI2A 3Q24A 3S2HH 4A3JG 5JEAJ 1FNUA 3S2DH 2A73B 3S1QH 4IPHA 1CFMA 5AJ3L 1IXRA 2Q2TA 1X9NA 1BBXC 3M7NA 1STGA 4LF7Q 1CM9A 1AFPA 1VQNA 2RHSB 4RHSA 2K5HA 4ZUIA 3GD7A 2R93H 1PFBA 4QUCA 2BE5C 1SJED 2Q2IA 2F0IA 1WFQA 1KRSA 2F0WA 3IL8A 1SYBA 4HIMA 2JJQA 5KIXA 2ZTEA 1K0RA 1X55A 2R93B 5K36G 3VR6A 1CQFA 3K5MA 3CMAA 4IOAA 2B2VC 4K5XA 3S1NB 2Z4HA 4KKTA 1NCVA 3CHBD 2KOLA 3TN2A 1YNJD 4A3CG 3F1ZA 1H9SA 2E5LQ 3A0JA 1GUTA 2VQEL 4NXML 4RA8A 1XX8A 3VR4A 1PYSB 1SBBB 3G7LA 1R9TB 4OEMB 4DV1Q 1HTLD 2K28A 1PXUA 5ELOA 2Z9HA 3CC7A 4TVAB 4LF8L 2E76C 2K01A 2I5LX 2F0GA 3IFDA 2P5ZX 3KF6A 3MXGA 1PH7A 5KGUA 2NN6H 3BU2A 5LMNW 1WTXA 5CGKA 4V0BA 4YHHL 3HS0C 4QMGA 1BXTA 5NUCA 4K0KQ 4V190 2R7ZH 1WTOA 4L5QA 2JA8H 4K2LA 4KHZA 5LL6S 4A3FH 2D62A 1L0WA 1A6XA 1RKNA 5D3DA 3PUWA 2ZJRA 1S5ED 4JI3L 1JC7A 1E24A 1ZYRC 3J81E 2F0QA 3FEWX 1J6QA 4EX5A 3K6OA 2PZTA 3GQBA 3TSSA 3QOLA 4RCNA 1HPCA 2EY1A 4KKSA 1AH9A 3J80E 1PFNA 3HOUB 2F0MA 4DPGA 5M3MH 5AFWA 3HOZG 4M1UB 4CKEA 3HOVH 5I4DA 3D31A 4F87A 4DV7Q 1YJNA 1TR5A 3ND9A 2V1CC 4ZKCB 4DV5L 2WFWA 3FPPA 1TS3A 4A3EG 1SE2A 4NMZA 1U4RA 2XRSD 3FHWA 1VQOA 1F9QA 4A93G 1JCKB 1Q8IA 2DY7A 3K8AA 1CHQD 5C4HA 1B3AA 2KEEA 1YITA 2QEXA 1S4ZA 1SYGA 3J81j 3PCOB 1RL2A 3ITPA 4J1MA 4DK3C 3A55A 1XMQL 5M5XB 1Y1WG 3H09A 3GTGB 1Q12A 1LO5D 1PA6A 1PFMA 2C35B 1QG7A 4CDDC 1GHJA 4YCVA 2VUMG 5LMUQ 2B29A 3K80C 4XTCS 4DAYB 1O7IA 2EJMA 5E4XA 2EY5A 4J15A 4C3IH 3D8GA 3CCJA 1TKWB 1X3GA 4K14A 1OXUA 1WCMG 4DK6C 2Y0SE 5JJZA 2YU9H 1GJXA 5GAHC 3U4VA 1A8VA 2NTTA 3T51B 1LTAD 4UHVA 2HDLA 1I6VC 4OO1G 4JI7Q 2L0CA 1SRUA 1DOKA 1RHPA 2EIFA 3H3VI 4UP7A 4QB4A 4A3DB 4LK1C 1D8LA 4HTHA 3HOYG 4Q0FA 3MZ5A 4JI5L 4OHJA 5E7NA 3KDFA 2LXJA 2K5WA 4KY5A 5FLMG 1ET6A 5CR3A 1F2ZA 1KDCA 3CCUA 4B3SL 1H9SB 4AYBG 1SR3A 1P16A 4QQBX 3DM3A 2CW0C 3PO2B 4HAEA 2EQSA 4UP9A 2IHFA 4X65L 1EQQA 2L12A 4X62L 1XNQL 4DUYL 5FO8B 1BOSA 1VQ7A 2KCCA 1VQHA 3I4NB 3MA2B 5CV5A 1FGBD 2NVXH 4ZRZA 3W1BA 2WKCA 4XIGS 4KJNA 4L5RC 3K7AB 2K5QA 2IY5B 5EPLA 2OQ0A 4XXEA 1JR0D 5JEAG 2A69D 4UAIA 5D3IB 2JN4A 1WTQA 4CGYB 1I94L 4YCWA 5IP9G 1L0YB 3MHBA 2NZ1D 1H95A 2B2YA 1TQOA 3MAQA 3M3YB 3K0XA 4LFAL 3TP8A 1XPUA 3S1MB 3PV0A 1EYGA 4RGNA 4HSPA 3M4YA 3ZJYC 4E6IA 2E2JH 3RMHA 4JI2Q 4KTAA 3SK4A 1YNND 3CAMA 3OYYA 2BA0A 4CDFC 1BDOA 1N36Q 4EVOA 2N49A 1JB7A 3D6CA 1EWCA 3HFZB 3RZDH 1ZKOA 4EQNA 4P73A 1G6PA 1GKHA 4C3HG 5KEEA 2BDOA 3U50C 3VR3A 1MGSA 4Y7NB 2QA4A 5H1SE 5GAGC 3SGIA 4TSSA 4P2CB 3VYTA 3A74A 3UDXA 2G9DA 2I0QA 3VA7A 2JA7H 2VS1A 5ELEA 3U9OA 3OHXC 1HJPA 1H9RA 5C4JH 2MNAA 4A3JB 3U4ZA 1UE6A 1M8AA 2IWHA 3AFQA 2K1BA 2JA7B 5HGTA 4OGQC 4FF1A 3NWTA 5C44G 1L0XB 1PH6A 1I3QB 2QDLA 4IUPA 2OQKA 3S24A 3UDIA 3X3MA 3N52A 4GNXC 3SDZA 4HIDA 3SVMA 2G5DA 2O4XA 2Q2HA 2IX1A 2L1BA 2LMCB 4A3KH 1TWHH 4OO1I 1IKMA 2MQHA 1I6HB 1BR9A 3PO3G 1JB3A 3EFXD 5FLXE 4R8NA 1CSQA 4M8AA 3F2CA 3PIO3 4NXNQ 2X6GA 3J7AV 2WAQE 1KQSA 4DK0A 3NUCA 4NB3A 3NSWA 2TSSA 3J7A5 4P71A 2HHHL 4JK1C 4JBMA 3A7LA 4ZUJA 1HZ9A 4B9XA 1IYJB 3MXUA 1CT1D 1STYA 1P8LA 4A3GG 4JI1L 2R92G 1EY0A 4LFCL 3L0OA 2HD3A 1YZ6A 4KY6A 3T56B 4JYAQ 3E0JA 1ILQA 1D5MC 1PTOF 1Y8NB 4N8X1 1DCZA 4YHHQ 1MIUA 4ZAIA 1G2TA 2EDGA 3LX0A 2WAQB 2M00A 3GO5A 1A2TA 1LACA 5LMNL 1S5BD 2B2WC 2K52A 3T4AC 3QJYA 1LTBD 1PLFA 2IT1A 3H0GH 3MTSA 3TZDA 3VYSA 1UUPA 1EOVA 2B2TA 3HKZE 4X64L 4K5WA 4POFA 1KHIA 2F0FA 1ENFA 1U9RA 2F3WA 3TQYA 3A8KE 1IL8A 2RVLA 3DWAA 1F9RA 3A54A 1VQJA 2PI2E 4X3KA 3STBC 4A3MH 3KF8A 5GAEC 2B63G 4HJAA 2XSCA 1S72A 1SNQA 2VQFQ 3PQIA 2ID0A 4CJ2C 3HOZB 1YHBA 5DM63 1B44D 4GN4B 3BVZA 1SEBD 5FJ8H 4A3EB 1ESRA 2XN9C 2A19A 3ULJA 1ONLA 4BY1H 4LF4Q 2J0TD 2QW7A 2EJGC 2RKSA 3M4PA 4IOCA 4A93B 3HOXG 3PSIA 3BG3A 2A68C 5COYA 3K59A 4JI6L 1QCBD 1ICFB 2H4OA 1O7YA 5C0XG 4QIWB 1XMQQ 1W6JA 1A62A 2K6AA 4JI4L 4BY1B 1CI3M 3E6ZX 3PIPA 1I4XA 5EJWA 2QKIC 4DR6Q 1HFGA 1L1OC 1Y1WB 4Q5VA 3TRZA 4A3BG 3ERSX 5ISRA 3DEOA 2VUMB 3F2BA 5JJIA 3MEHA 1Y1VG 2E2HH 3K0YA 3AMUA 1HXYD 2HCCA 5EBDA 4GKKL 2IW3A 5M3FG 5IYDH 4B3RL 3CPFA 4RGMA 2B2UA 3OW7A 3UDGA 3J7AF 1MJEA 4DV0Q 2RHQB 1K8AC 1WCMB 3BVGA 3NBIA 5IGBA 2CFMA 1STAA 2PMZB 1OXVA 2VY3A 1HNWL 4JI5Q 1JE5A 5KRUA 1GM5A 4DK1A 2WV6D 5IT9c 1SNMA 1PH2A 2RCFA 5M5YH 3HOYB 5FKAC 4KHPL 3Q6SA 4B3SQ 2JEAI 1HZAA 1QNUA 4EQ5A 3JAMc 3J7ZC 4HN7A 2D5DA 3KFUA 4K6DA 4EQOA 1KLUD 4PQXA 4IZ8A 4ALPA 4RH6A 3C1EA 1DYQA 4DUYQ 2XNAC 3R2IA 1N32Q 1E7ZA 3D4DA 2HUGA 1KAAA 1F2LA 3NTKA 1EEID 3S9WA 1TVXA 4QJFA 1EY6A 4IJLA 5JVG3 4FXGC 4JI0L 1TU2B 4C3IG 1SLJA 3KJPA 5GROA 2I5HA 1SFOB 4DR2L 1SNOA 3CRLC 1B2TA 4BBRH 4FYDA 3DMUA 3I4MG 3I4LA 1PMRA 1HUNA 5EKLA 1MSHA 3NENA 3KOJA 5J1ZA 2EYPA 2KCNA 4LJZC 1WTRA 4YWMA 1BNZA 3TS0A 1CKNA 2KQ3A 4U68A 4G7ZC 2ZXPA 4DR7Q 5I2YA 4NP5A 2PYKA 3GV6A 4G7OC 1VQ5A 3QB3A 4DUZQ 4HMJA 4QUFA 3S17H 1BO0A 3JAML 1G291 2NVTH 3KK7A 5HGQA 4KI0A 4RMFA 1A2UA 5C4XG 2IX0A 3AQQA 3T16A 4IPGA 1ILPA 2XIWA 1X56A 5BN4A 1QB5D 1S5DD 2FHTA 4C3HB 5M9OA 2OT2A 4NW2A 3AEVA 1HZCA 1HH2P 4B3TL 1SNDA 1K28A 3GTQH 2WB1E 3EN2A 3HG9A 1TWCB 4F7XA 1Q3LA 1FJGL 1ENAA 2TMPA 3OW2A 5C4ZA 2CHBD 2DNEA 1HR0W 1SE3A 4OWWB 1HNZQ 5DLQE 4DAVA 1KC8C 3S14B 1J9OA 4RG1A 5IGCA 5IT9E 3I2ZA 2RDHA 5IIFA 4WJ3M 3E9HA 1ENCA 2EVBA 2MJ8A 5CBAE 2H5XA 5C44B 1B1ZA 3F8TA 3PIP3 3SR1A 3N6RA 1B8AA 1PRTD 3JAMi 1G91A 1HNXL 2VNUD 2WB1B 4P75A 4DF7A 4P72A 4MNOA 1DOMA 2K4KA 4DV3L 1L1OB 2LY7A 3S15H 4IQZA 1UAPA 1L2FA 4GN3B 4H44C 2EZVA 4JBWA 1ML0D 3PO3B 3ZYYX 5IYCG 1V1PA 2MFIA 1ASYA 1YJ9A 2Q8RE 4Z9CB 5KNCA 2R61A 4FP5D 3S15B 1NAPA 3GTPB 1T9HA 2HT1A 1PH9A 4CBVA 1YVCA 1SMYD 4LUVA 3S1NH 4DNTB 2UXCL 2AQ3B 1NMGA 4X66Q 4DR5L 4L5SA 1SMXA 4JI1Q 1AEXA 4DKAC 3DXJC 2F0SA 2PCFB 2NUCA 4LF5L 4A3GB 4HCEA 1FVIA 1TS2A 3FDTA 2UXBL 2R92B 4K8JA 1VQLA 1TY2A 3WOEA 4DV4L 1WI5A 4LW1A 4DR1Q 2UU9L 3P20A 2F0HA 1IBMQ 1BKBA 1DJRD 1EWIA 3V2TA 5C6AA 5LMNQ 2XTIA 1R9TH 2DUDA 3G6EA 3E5SA 4ILWA 2Z6KA 3NBHA 3R8BA 1TWFH 2BH8A 3CP0A 2KENA 4LFBQ 2DN8A 3OOCA 4X64Q 1RF2D 2F4VL 1EQTA 2CWAA 4L63B 1TWFB 4KMUC 2AMCB 1XTDA 4PMWA 2XWBB 5CV7A 1EWHA 4EGVA 3EROA 4R4QA 1KLGD 1H9MA 1NMFA 3X3NA 5C3EG 1EFWA 2B63B 1N33L 4ZLTF 2FMCA 1VQ8A 4C2MH 2AWOA 4BS9A 1O7ZA 1BCPD 2PQAA 1W6KA 1PH1A 2NTSA 2JA5G 2F3IA 3BJUA 1WTHA 4IPCA 3C1FA 4C2MB 1EY8A 3FKIH 4MZ9A 3HOUH 1HUMA 3HOXB 4R4TA 3OIPA 4JI4Q 2ES2A 2CQOA 1XNRL 2NWGA 4APVA 1QVFA 5C5LA 4DV2L 3FKIB 3VYUA 3GTLH 1V43A 4QF4A 3U58A 5M5WB 1N8RC 3CCLA 5BR8Q 4GLAC 1HHVA 4GKKQ 5DNFA 1UE5A 1YIJA 2UUBL 1IW7D 3GTLB 4GN5A 4N9TA 1EQRA 1Y1VB 4B3RQ 1ET9A 1VQDA 3HKSA 4L6TB 1PTOC 2EYMA 1HZBA 5M3FB 5M5XH 1X3EA 3GTGH 3ERQA 3CKIB 5FK9C 3V05A 1BBWA 4BY7G 1HRJA 4JI8Q 1IBLQ 2F3VA 4NPSA 2JSOA 1J5EQ 4KN7C 1R4QB 4WFN3 3FVQA 4G4KA 2Q8TA 1XPRA 2LSSA 3HKZG 4IN3A 1LT4D 1I4RA 1NNXA 2EY6A 2F0PA 4MIUA 4JVZA 2FFKB 3H3VC 1LT5D 2WIIB 1GD7A 1JJCB 5GQOA 3VA5A 1XJVA 1EEFD 4DR3L 1TWAB 5IYBG 2K5NA 3PIOA 2O5JC 1X3QA 4MTNA 1VDZA 2RBMA 1VCIA 4A3DH 1N34L 1K3RA 2HIXA 2RA4A 4DV6Q 2A6EC 2YYZA 2VZAA 3AU7A 3SK5A 3OPOA 3SK8A 2K5VA 3C3LA 2UXDQ 1D2BA 1WTVA 3IFTA 1PH5A 2D2CC 4JV5L 2UUAL 2JA6G 3A5ZB 3PO2H 4BBSH 3I70A 5C0XJ 1JE4A 2N78A 4GOPA 3Q23A 2EYLA 1YBYA 2A6HD 2A1AA 3ND8A 3I4MB 2VXWA 4BBSB 1WOCA 3I4NH 1J8IA 4OX9Q 3BZKA 1E1TA 1HCZA 1LM0A 1M4VA 3NBHB 1LTLA 1Q46A 1XWEA 1VQPA 4BXXH 1JOKA 3TP7A 5I9OA 3ER0A 3K7AH 1NSNS 4FVMA 1B7YB 4X3SA 1JT8A 4IUVA 1AN8A 4C3JG 1E1OA 3L9AX 1OTCA 3BVMA 1MD2D 5K5PA 5A2QL 3KF6B 1E0BA 1VQCA 1GO3E 4ZCKA 4C56C 4FDBA 3M3YH 3FPUB 1LUZA 2ENBA 1OXXK 5T1IA 1PZJD 4O1NA 1SN8A 5IWAQ 3S1RH 3NE5B 3S1MH 5E3FA 1VQGA 3OTOQ 3I8ZA 1Q8KA 3NELA 5ELCA 4YWKA 3TREA 3CPWA 2UUCL 5IGFA 3I73A 2HCIA 3HP3A 3RN5A 3S1RB 1DD2A 3HOWG 4FXDA 3I91A 1RCVD 1U4MA 3Q8DA 2O2LD 2NBFA 4A3IH 4OL7A 2N8NA 2FINB 4I7AA 3T1HL 4JW0A 4IFDG 2YTVA 1SNPA 1HR0L 2EYHA 2RQXA 1BQQT 4A3IB 4Y7NH 4LF6L 4GKJL 3VR5A 4DR4Q 4S3SA 5IP7H 1C4QA 1KXLA 4XQJA 4ULLA 4AQYL 3G48A 4A3JH 3OSOA 4R4IA 1QZGA 4OELB 4G57A 1UE1A 4KD3A 1I3QH 1TWGH 2YTYA 3MVVA 1PTOH 3RD4A 5AJ3Q 4IO9A 4A3LG 4ODGA 1YNJC 2BOSA 1X3FA 1D7QA 3M4QA 1TWGB 4FNFA 1PTOB 3F2UA 4LF9L 3RZOB 3SE0A 1ASZA 4FF2A 5IY0A 3AFPA 2UXCQ 1IBKL 1NR4A 3KLRA 5K36H 4DR5Q 1I6HH 1SE4A 1OXSC 2N3SA 4B3ML 1JWUD 5EKIA 3H3VH 4A3CH 4HIKA 4DAPA 1FNVA 2VQEQ 4NXMQ 3ULPA 1BVSA 3D3RA 3EIVA 4QY7A 2EY2A 2A74C 2NYZD 3NWSA 1B50A 4RKBA 2VB2X 2F4IA 1CSPA 1LLRD 3TMEA 2BA1A 3KDFB 1BCPC 4ME3A 3LGJA 4J6HA 3F2DA 4LF8Q 4OXPA 3JC66 1U5KA 4GNXA 1JICA 2K7VA 1PYBA 1K8MA 2LS01 4BA1I 5BN3A 2B39A 2F03A 2PZUA 3KYHC 3FMCA 3VYRA 1E2WA 4LF7L 3LWEA 4K6LA 3Q22A 1IYVA 1I4GA 2B2TC 4WJ4A 1VQAA 5C3EB 2X6LA 2R93G 1IW7C 4JOIA 3D4WA 1KDBA 1VMCA 2ZJPA 4RAUC 4JI3Q 1FD7D 4ABNA 2GVAA 2KBNA 1G6ZA 4A4IA 2JA5B 2KECA 3BDCA 4KJOA 5D14A 2QF7A 1EIHA 2DY8A 2E5LL 4QIWE 5JPNC 3D0FA 3HOZH 5EPJA 3SEBA 2HIVA 2A8VA 4LWCA 1X54A 1OXTA 3BDOA 5IOCA 2NVQB 2GVBA 4A3EH 2BE5D 4OWXB 2EJFC 1VF5C 2IPKD 1KTKA 2PNRC 1LYLA 4RGTA 2CH4A 4DV5Q 1WVLA 2B8FA 4A93H 1PRTB 1KABA 3MEFA 5LL6X 1JORA 1NTGA 3MXNA 3R2TA 3TZUA 1Q1EA 4DNRB 1K8GA 4XQNA 5G3LD 4O2DA 3WOFA 3PUYA 3DHQA 1I4QA 4DXGA 1RTNA 3T1YL 1Y1WH 1C0AA 1GUGA 2K32A 4BY7B 5DAUA 2EYOA 2NN6G 2VUMH 5F2DA 2PMZE 4K0KL 4UP8A 2F0UA 4IUQA 2SDFA 2B2UC 2R7ZG 2JA8G 2E74C 1EL0A 1PHJA 1FGUA 4JC0A 1I50B 4A3FG 5ELBA 1E3PA 3PF5A 1I4PA 2F0OA 1H9KA 4NDXA 1WCMH 4TQUS 3GTOB 3GTMH 3J7YW 3TS2A 1STHA 2HQLA 1WYDA 4P74A 2KHIA 1B70B 4AYBE 1LTTD 4OO1H 1N9WA 3GTMB 1U4PA 2F0TA 4NKLA 2XWJB 1CQVA 4CJ1B 3HOYH 1PRTF 2F52A 1C9OA 3K58A 1DM0B 4OONA 5M3MG 4DV7L 3KLSA 2UUAQ 3NK9A 5FLMH 3HOVG 2F0VA 2WKDA 1KL9A 4GLXA 2JA6B 1ZYRD 2ZXRA 1FYCA 2MGSA 1GUOA 3D6WA 3CCVA 2A69C 1UEBA 4IURA 1BUVT 4PZ6A 1A3VA 1MJCA 4AYBB 2KVMA 2JK8A 3QG1A 1B9NA 2AQ1B 4X65Q 1Q1BA 4X62Q 1XNQQ 3A8IE 3I56A 2M2LA 1LT6D 3TDQA 3K5LA 1C48A 3WWVA 5LMUL 1V1OA 2I5MX 1SFOH 2RF4A 1CTMA 5D65A 5I2XA 5IGDA 5JEAH 1GUNA 5JJLA 1YNNC 1RODA 2IJ0A 1VMPA 2AWNA 2I46A 4LAAA 5CV8A 3V96A 1BCPB 5IP9H 2OTLA 4X3UA 1I94Q 1JJGA 4KKUA 3PUXA 2BH2A 2KEDA 4HJ9A 1YHQA 1DGSA 1NE3A 2BDNA 3RR5A 2OCEA 1UWVA 4LFAQ 2Z4IA 2Z6BA 4JI7L 4MTKA 1CZWA 2KA7A 1HQMC 1ICWA 3TP5A 1WD1A 3HEJA 5DM73 2LFNA 2G9HD 1XYIA 2OEOA 2IHEA 2VW9A 3TBIB 4EQPA 4HSVA 1EYCA 2Y0SG 3BDLA 5GADC 3GTJB 1SYEA 1HR0Q 4FF4A 4C3HH 2L5TA 4LF6Q 5A35A 5KNBA 3A5UA 3M7GA 4HIOA 3KF8B 4XDXA 2YV5A 1TWCH 2EOTA 2CKZB 1JJ2A 1G51A 1QNKA 4FO2A 4N8FA 1STBA 1KNAA 4LNQA 1EOTA 1EU4A 5C0XI 4K2KA 2OWOA 3NXWA 3S14H 5LHY1 4POGA 1VQKA 3GV3A 2NN6I 5CV4A 1ZEQX 1FR3A 1BCPF 1PDQA 1EZ6A 2PO4A 2FJ2A 2L4NA 5C44H 1Q90A 1CKOA 1U0LA 4ME5A 1VS0A 4PMBA 2O5IC 2R7FA 1D5ZC 2KJXA 4A75A 3EA6A 4H13C 2ZTDA 3JAME 3C2PA 1EU3A 4ID6A 3MC0B 2OF1A 3KUPA 3H91A 2MPMA 2EPBA 3RNUA 5CBEE 1ZXTA 3PO3H 3SXHA 4IUTA 1JWSD 4XT3B 2B8GA 4JI2L 4JPBW 4K8IA 1N36L 5EQ0A 3GTPH 3OWEB 1D6EC 5IODA 2Z0SA 2OTJA 3RLNA 1W2BA 1RDPD 2K5DA 1VQ6A 3P1HA 3CCMA 2AUKA 1TS4A 2L9HA 2ZT9C 3NQTA 2JEBI 4O42A 3J81c 4DGZA 2HHHQ 1T5XD 3UE1A 2ZXOA 3I90A 2J7ZA 5TSSA 2V4DA 3M4OB 3RN2A 4UPAA 4DAYA 4A3GH 4HJ5A 2R92H 5IGGA 3J80c 2JA7G 1SXTA 1HTPA 4IFDJ 1SSOA 4LFCQ 1JOOA 3S2HB 3DEPA 3CC4A 2Z6KC 5DEHA 3S2DB 3Q0AA 4KN4C 5T1GA 3S1QB 3CC2A 4Y52H 2MO1A 1MHWC 2JP1A 2XRQD 3I7FA 5KNDA 1EY5A 4F8MA 1EY9A 3FP9A 1EZ8A 1YJWA 1QUQA 4XQQA 4HMIA 1D5XC 1GXDC 2XGTA 2WP8J 4G7HC 4A3KG 3G71A 2B63H 4RHRA 1WTPA 1VQIA 3QO2A 4NXNL 1YNXA 1CKNB 1HA5A 2B2VA 1VQ4A 3J81L 1Z6HA 3PUZA 2MHVA 3WDNA 1AZQA 4R4OA 2ICEC 1VQEA 2AKWB 1VF7A 1QILA 3J80L 3HOXH 1IHZA 3L2PA 3W1GA 1B4OA 3H94A 3T1YQ 5C0XH 3IKJA 4JI6Q 2RSNA 4JYAL 2KHJA 2K14A 5EGTA 2AHOB 5M5WH 2WAQG 3BYTB 3OWFA 2GN5A 4A3BH 5KYIA 5KYLA 4KV6A 2ICIA 3O13A 1Y1VH 4B08A 4LUZA 1BF4A 1LV9A 3OMGA 3OIQA 3NPPA 4A3BB 2FXQA 1E22A 2DGYA 2R7ZB 3PUVA 5M3FH 2JA8B 1Q82C 2M9VA 2E2IH 4A3FB 3H0GG 3ONAB 5J39A 3J81i 1Z47A 2K75A 1O80A 2R3ZA 1UE7A 5FO9B 2NVYH 1KRTA 2JE6I 2MP1A 2E2IB 1LT3D 1K3BC 2DNCA 3CXCA 4JBJA 3J80i 1HNWQ 4HEDA 3KLSX 2VQFL 2QDBA 2NVYB 3GDEA 4A3MG 5I6YA 3KBGA 1PYWD 1X65A 4K5VA 2PZWA 2L15A 5M3MB 4KHPQ 1AP0A 2JA9A 3HOVB 1S40A 2Z1CA 5FJ8G 1TWAH 1YEZA 4LF4L 3P7JA 4BY1G 4KLKA 1V1PB 5JVH3 1KDAA 2ZJQA 4QCLA 2ZTCA 3KLWA 5CMDA 1TXYA 2ZM6L 3STBD 4JCVE 4DR6L 1TS5A 1STEA 1KNEA 4GOPC 2D0OA 1I4HA 2PW7A 1C8CA 4TRDA 5CV9A 4CKBA 1NUCA 2CH4W 4JI0Q 3AB9A 3TP6A 1SJHD 1Y14B 2K50A 2E75C 4DR2Q 3I4MH 1F2YA 3CRKC 2D9UA 3T53B 3KBXA 2A68D 4C3IB 5IYDG 2VL6A 4N9PA 4X6AH 4DV0L 3BS1A 1PVOA 1AE3A 4WJWA 1S3OA 1AZPA 1SDFA 1QUQB 2YU9B 1MBYA 1VQBA 3UI2A 1NY4A 3BYYB 3FRPB 1WD0A 1QVGA 4PZ7A 2XVSA 4JBKA 5C4XH 4U673 2B2YC 1GUWA 5JJKA 3BZDB 2Y0SB 1LABA 2KCMA 4I7ZC 5C4XB 2N88A 3RLFA 3CMEA 4YCUA 1N32L 1PRTC 4B3TQ 4HJ8A 1SYFA 2GA4B 5JAVA 3VR2A 1H9JA 4I65A 1FJGQ 1A3UA 5FLXc 1JWMD 2PQAB 2HDMA 4ZK9B 1K83H 2K04A 4WORA 2NVXB 1SYDA 2F0JA 2KCTA 2JXMB 1XMOL 1CA5A
chains in the Genus database with same CATH topology
4OWXB 4KHZA 5C4XG 4DV5Q 1LYLA 4A3FH 2IX0A 3AQQA 2D62A 1L0WA 4IPGA 4A93H 4BBRG 3MEFA 1X56A 1NTGA 3PUWA 3AEVA 2ZJRA 4JI3L 1Q1EA 1K8GA 1E24A 1HZCA 4QGUA 1HH2P 1HNXQ 4B3TL 1X6OA 4O2DA 1J6QA 3PUYA 3GTQH 2WB1E 3EN2A 4EX5A 4DR7L 3T1YL 1FJGL 1Q7YC 1Y1WH 3OW2A 4DV3Q 1C0AA 1HR0W 1AH9A 4OWWB 4DUZL 1HNZQ 2NN6G 2VUMH 5DLQE 4DPGA 2PMZE 4K0KL 5M3MH 4UP8A 1KC8C 3HOZG 4RG1A 5IYCH 3I2ZA 1GVPA 3HOVH 3D31A 4DV7Q 1YJNA 3E9HA 4WJ3M 2R7ZG 4A3EG 2V1CC 4DV5L 2WFWA 3RZOH 2JA8G 1PHJA 1FGUA 2H5XA 4JC0A 3KJOA 1Q86C 3FHWA 4A3FG 4GS3A 1E3PA 3PF5A 1VQOA 4A93G 3F8TA 2PI2A 1WCMH 1B8AA 3K8AA 4TQUS 3JAMi 1SE8A 3GTMH 1HNXL 2LXKA 3S16H 3TS2A 1EIYB 2VNUD 1IL2A 4P75A 2HQLA 1WYDA 1YITA 4P74A 2QEXA 2KHIA 1B70B 1V1QA 4P72A 4AYBE 4MNOA 3J81j 3PCOB 1RL2A 4DK3C 2K4KA 5IE8A 4DV3L 1XMQL 3ICEA 1N9WA 1L1OB 3CF5A 1Y1WG 3CCRA 1HNZL 1Q12A 1PA6A 3S15H 4LF5Q 1PH3A 3HOYH 2C35B 1NJIC 1L2FA 2F52A 4GN3B 2D0PA 1C9OA 4YCVA 5LMUQ 2VUMG 4OONA 1WJJA 2B29A 4JBWA 3K80C 4XTCS 5M3MG 4DAYB 4DV7L 4DV4Q 5IYCG 1O7IA 2UUAQ 2MFIA 5FLMH 1ASYA 2UU9Q 1FL0A 1YJ9A 3HOVG 4J15A 4C3IH 1KL9A 2WB1G 4GLXA 1T9HA 3B6YA 4YY3L 3CCJA 1PH9A 3CCVA 2HT1A 1EUJA 1UEBA 1YVCA 4YWLA 4DNIA 1X3GA 1OXUA 1WCMG 4PZ6A 4DK6C 2Y0SE 4LUVA 1MJCA 3S1NH 2YU9H 3CD6A 5GAHC 2UXCL 2JK8A 3U4VA 1A8VA 1NMGA 2F4VQ 4X66Q 4DR5L 4X65Q 1SMXA 1Q1BA 4JI1Q 4L5SA 4X62Q 1XNQQ 3I56A 3NEMA 4GLVB 4DKAC 4OO1G 4JI7Q 1SRUA 4LF5L 2EIFA 1XPOA 3H3VI 2NZOA 4GOPB 1FVIA 4UP7A 1M1KC 2UXBL 3WWVA 5LMUL 2I5MX 1C7YA 1D8LA 1VQLA 3HOYG 4JI5L 1SFOH 4A3DH 4JOIC 4DV4L 5ELNA 1WI5A 1PH4A 4LW1A 2RF4A 3KDFA 5E7NA 2LXJA 5C3EH 4DR1Q 2UU9L 4IJHA 1IBMQ 1BKBA 3TEHB 5JJLA 5FLMG 1VQFA 4O0AA 1EWIA 5LMNQ 1XMOL 1N33Q 2XTIA 3CCUA 1R9TH 4B3SL 2DUDA 2AWNA 3G6EA 4AYBG 1BBUA 2Z6KA 5IP9H 2OTLA 1SR3A 1P16A 1TWFH 1VQ9A 3DM3A 2BH8A 3CP0A 1I94Q 4QQBX 4R4CA 2KENA 1JJGA 4LFBQ 2EQSA 4UP9A 2IHFA 3PUXA 2JA5H 4X64Q 2BH2A 2F4VL 3CQZH 1SROA 4X66L 4X65L 1DGSA 4HJ9A 1NE3A 1YHQA 3CCQA 1EQQA 3RR5A 2CWAA 4X62L 1XNQL 4DUYL 4BA2I 2OCEA 1UWVA 4LFAQ 4JI7L 2AMCB 1VQ7A 1XTDA 4PMWA 1VQHA 3ULLA 2NVQH 3K81C 4AH6A 2NVXH 1XNRQ 3W1BA 3UDFA 4DV2Q 4LUOA 2IHEA 4HJ7A 4XIGS 2VW9A 4R4QA 4DR1L 4L5RC 2IY5B 1NMFA 1IBML 2OQ0A 5C3EG 1EFWA 1N33L 2Y0SG 5GADC 4R1JA 5JEAG 1HR0Q 4IFDI 4C3HH 4LF6Q 3A5UA 1VQ8A 4C2MH 1I94L 2AWOA 4YCWA 2UUBQ 5IP9G 4HIOA 3KF8B 4LFBL 2PQAA 2YV5A 1H95A 1TWCH 2CKZB 1PH1A 4DV1L 3RLOA 2JA5G 1JJ2A 2F3IA 1G51A 3BJUA 3K0XA 3CCEA 4IPCA 4LFAL 1IZ6A 3FKIH 4BY7H 4MZ9A 4LNQA 1XPUA 3HOUH 4R4TA 4JI4Q 3PV0A 1EYGA 2ES2A 5C0XI 2CQOA 2OWOA 3S14H 4POGA 1VQKA 1XNRL 4APVA 2NN6I 1QVCA 3ZJYC 4H02A 4DV2L 2E2JH 2MO0A 1QVFA 4JG2A 4JI2Q 3OYYA 3CAMA 3GTLH 2BA0A 3L7ZC 1N36Q 1V43A 5C44H 1I50H 2N49A 3U58A 1N8RC 3CCLA 1JB7A 3E9IA 5BR8Q 1CKOA 1U0LA 4GLAC 1VS0A 3HFZB 2E8GA 4IPDA 3RZDH 4GKKQ 1NBWA 1UE5A 1YIJA 4P73A 3GTOH 1GKHA 2UUBL 2R7FA 1G6PA 4GN5A 1VQMA 1EIFA 1EQRA 4A75A 4B3RQ 2ZTDA 3U50C 1VQDA 3HKSA 1HZBA 5IYBH 2QA4A 5H1SE 5GAGC 3SGIA 5M5XH 1X3EA 4DR3Q 3GTGH 4PZ8A 3A74A 3UDXA 2ZM6Q 1BBWA 3FKIG 2I0QA 2CCZA 2JA7H 4BY7G 3HOUG 2VS1A 4JI8Q 3RNUA 1N34Q 1HJPA 5C4JH 3PO3H 1IBLQ 2MNAA 4NPSA 4L5TA 3UE0A 3U4ZA 1UE6A 1J5EQ 4JI2L 3PF4A 1N36L 1XPRA 3AFQA 3GTPH 5BR8L 2LSSA 3HKZG 5C44G 4DAMA 2JA6H 4JV5Q 2Z0SA 2OTJA 1PH6A 3RLNA 1W2BA 1VQ6A 3IRBA 1QZHA 2OQKA 2YTXA 3CCMA 3S24A 3UDIA 1L1OA 2JEBI 2RCNA 3J81c 2HHHQ 1GD7A 1JJCB 5GQOA 3UE1A 4GNXC 1XJVA 4HIDA 5J3BA 1YI2A 4DR3L 2ASBA 5IYBG 3PIOA 1MKHA 2K5NA 3RN2A 4UPAA 2Q2HA 4A3GH 3I55A 2IX1A 4MTNA 4HJ5A 1VCIA 4JI8L 2R92H 4A3KH 1N34L 1TWHH 1K3RA 2HIXA 3J80c 4DV6Q 3CW2C 1IBLL 2JA7G 4OO1I 2YYZA 2MQHA 4IFDJ 4LFCQ 1PFSA 1J5EL 2VZAA 3PO3G 3VDYA 3CC4A 2Z6KC 4C3JH 2K5VA 3F2CA 2UXDQ 1CSQA 1KAWA 3CC2A 4Y52H 1PH5A 4JV5L 4NXNQ 1JMCA 2MO1A 5EAYA 4GNXB 2UUAL 2JA6G 3A5ZB 3EBEA 3I7FA 2WAQE 4A76A 1RIPA 1KQSA 4UY8C 3PO2H 4BBSH 4NB3A 2R6GA 3FP9A 3J7A5 4P71A 2HHHL 5C0XJ 3DLLA 1YJWA 1QUQA 4JBMA 2N78A 3M9BA 4GOPA 1HZ9A 1YBYA 2A1AA 3E0EA 1IYJB 1KD1C 1PH8A 1WOCA 3I4NH 4OX9Q 3BZKA 1E1TA 1LM0A 1P8LA 3NBHB 4A3GG 4DV6L 1LTLA 1Q46A 2WP8J 2XGTA 4JI1L 3M85A 1VQPA 2R92G 4BXXH 4A3KG 4LFCL 3L0OA 3CCSA 1V9PA 1YZ6A 3ER0A 2UUCQ 4A3DG 3HOWH 2PNHA 4JYAQ 3K7AH 1PV4A 3G71A 1Q81C 1B7YB 4YHHQ 1JT8A 2B63H 2UXDL 3GTJH 1W3SA 1VQIA 1E1OA 1MIUA 4NXNL 1OTCA 3GTKH 1YNXA 1CKNB 2R7DA 1VQ4A 1XMOQ 3T1HQ 1A63A 2ALYB 3PUZA 3KF6B 3AYHB 1VQCA 3GO5A 1GO3E 5LMNL 4R4OA 1CUKA 3W5OA 3G4SA 3PO2G 4BBSG 1VQEA 2K52A 4FDBA 2JQOA 3M3YH 1LUZA 4GKJQ 1OXXK 2IT1A 2AKWB 3H0GH 5HY6A 1SN8A 3HOXH 5IWAQ 1A0IA 1EOVA 3S1RH 3S1MH 3HKZE 1VQGA 4OX9L 4OWTB 4X64L 1Z9FA 3OTOQ 3L2PA 3W1GA 3I4NG 1Q8KA 4POFA 3NELA 4YWKA 3T1YQ 1KHIA 3TREA 3CPWA 1I5FA 4AQYQ 2UUCL 3TQYA 4JI6Q 4BXXG 4JYAL 2KHJA 2K14A 1AE2A 1K9MC 2AHOB 3RN5A 3HOWG 5M5WH 2WAQG 3MXNB 1VQJA 2GN5A 2PI2E 4PG3A 3STBC 3Q8DA 4A3BH 4A3MH 5GAEC 2B63G 2EXDA 4HJAA 1S72A 3H15A 4A3IH 4A3LH 2VQFQ 2N8NA 3T1HL 1KIXA 2ID0A 4IFDG 1CKMA 2YTVA 1K73C 1Y1VH 1YHBA 2B3GA 4LUZA 2Q2UA 1HR0L 4GN4B 2FXQA 1E22A 2DGYA 5FJ8H 3PUVA 4Y7NH 5M3FH 4LF6L 4GKJL 1Q82C 4DR4Q 2A19A 3ULJA 5IP7H 4LF9Q 4AIMA 5IWAL 1YHAA 2E2IH 4BY1H 4LF4Q 1KXLA 3H0GG 4IOCA 3M4PA 3OTOL 3HOXG 3PSIA 3J81i 1Z47A 2K75A 1IBKQ 4QL5A 4AQYL 2QGQA 4JI6L 1UE7A 3G48A 2NVYH 4A3JH 1XMQQ 5C0XG 1KRTA 2JE6I 1A62A 2CWPA 4JI4L 2ATWA 4B3MQ 4R4IA 3PIPA 3CXCA 1QZGA 4JBJA 3J80i 1UE1A 4DR6Q 1L1OC 1HNWQ 2VQFL 1I3QH 3TRZA 1TWGH 2YTYA 3GDEA 3ERSX 5AJ3Q 4IO9A 4A3MG 4A3BG 4A3LG 4A3IG 3K7UC 3BZCA 3PGZA 1X65A 1X3FA 3F2BA 4KHPQ 2L15A 1M90C 5JJIA 2JA9A 1Y1VG 2E2HH 1D7QA 4GKKL 3M4QA 1S40A 4YY3Q 4DR4L 5FJ8G 4LF9L 3I4OA 5M3FG 1TWAH 1YEZA 3M4OH 5IYDH 4LF4L 4B3RL 3CPFA 5IP7G 1ASZA 3UDGA 5IY0A 3AFPA 4KLKA 4BY1G 2UXCQ 1IBKL 1MJEA 4DV0Q 2RHQB 4DR5Q 2NZHA 1K8AC 2ZJQA 1I6HH 1OXSC 2ZTCA 3KLWA 3S2HH 1TXYA 2N3SA 2ZM6L 4A3JG 2UXBQ 2CFMA 4B3ML 3STBD 5JEAJ 4JCVE 3S2DH 3S1QH 1OXVA 3H3VH 4A3CH 2VY3A 4DR6L 1HNWL 4HIKA 4IPHA 4JI5Q 1JE5A 5AJ3L 1IXRA 1GM5A 2Q2TA 5IT9c 1X9NA 1PH2A 4GOPC 2VQEQ 2D0OA 4NXMQ 5M5YH 1BVSA 3ULPA 4LF7Q 4JI0Q 3M7NA 4KHPL 3EIVA 1VQNA 2RHSB 4QY7A 4B3SQ 1Y14B 2K5HA 2K50A 1HZAA 2JEAI 3GD7A 4EQ5A 3JAMc 3J7ZC 4DR2Q 2R93H 1CSPA 3I4MH 2Q2IA 3KFUA 1WFQA 5IYDG 1KRSA 2BA1A 2VL6A 3KDFB 4HIMA 4DV0L 4ALPA 4X6AH 4ME3A 3LGJA 2JJQA 1PVOA 1AE3A 3F2DA 2ZTEA 1S3OA 1K0RA 1X55A 4DUYQ 5K36G 4LF8Q 4OXPA 3JC66 3CMAA 4IOAA 1N32Q 1E7ZA 1U5KA 4GNXA 1QUQB 1PYBA 1VQBA 4BA1I 4A3CG 3F1ZA 1NY4A 3KYHC 2E5LQ 3A0JA 2VQEL 1QVGA 4QJFA 4PZ7A 4IJLA 4NXML 4LF7L 4JI0L 3KJPA 1SLJA 4JBKA 5GROA 5C4XH 4WJ4A 2I5HA 1VQAA 4DR2L 5JJKA 4BBRH 1PYSB 2R93G 3I4MG 4JOIA 2KCMA 2ZJPA 4DV1Q 3NENA 3KOJA 4JI3Q 5ELOA 3RLFA 3CMEA 2GVAA 4LF8L 3CC7A 4TVAB 2KBNA 4YCUA 4YWMA 1N32L 3TS0A 4B3TQ 1CKNA 4HJ8A 2I5LX 4A4IA 3KF6A 4DR7Q 1FJGQ 1PH7A 5FLXc 3BU2A 5LMNW 2PQAB 2E5LL 4QIWE 1VQ5A 3D0FA 4YHHL 4DUZQ 3HOZH 1K83H 2HIVA 3S17H 2A8VA 4K0KQ 1G291 1X54A 1OXTA 4LWCA 4KI0A 5HGQA 2GVBA 2NVTH 2R7ZH 4A3EH 2KCTA 4RMFA 4L5QA 2JA8H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OWX B;  4KHZ A;  5C4X G;  4DV5 Q;  1LYL A;  4A3F H;  2IX0 A;  3AQQ A;  2D62 A;  1L0W A;  4IPG A;  4A93 H;  4BBR G;  3MEF A;  1X56 A;  1NTG A;  3PUW A;  3AEV A;  2ZJR A;  4JI3 L;  1Q1E A;  1K8G A;  1E24 A;  1HZC A;  4QGU A;  1HH2 P;  1HNX Q;  4B3T L;  1X6O A;  4O2D A;  1J6Q A;  3PUY A;  3GTQ H;  2WB1 E;  3EN2 A;  4EX5 A;  4DR7 L;  3T1Y L;  1FJG L;  1Q7Y C;  1Y1W H;  3OW2 A;  4DV3 Q;  1C0A A;  1HR0 W;  1AH9 A;  4OWW B;  4DUZ L;  1HNZ Q;  2NN6 G;  2VUM H;  5DLQ E;  4DPG A;  2PMZ E;  4K0K L;  5M3M H;  4UP8 A;  1KC8 C;  3HOZ G;  4RG1 A;  5IYC H;  3I2Z A;  1GVP A;  3HOV H;  3D31 A;  4DV7 Q;  1YJN A;  3E9H A;  4WJ3 M;  2R7Z G;  4A3E G;  2V1C C;  4DV5 L;  2WFW A;  3RZO H;  2JA8 G;  1PHJ A;  1FGU A;  2H5X A;  4JC0 A;  3KJO A;  1Q86 C;  3FHW A;  4A3F G;  4GS3 A;  1E3P A;  3PF5 A;  1VQO A;  4A93 G;  3F8T A;  2PI2 A;  1WCM H;  1B8A A;  3K8A A;  4TQU S;  3JAM i;  1SE8 A;  3GTM H;  1HNX L;  2LXK A;  3S16 H;  3TS2 A;  1EIY B;  2VNU D;  1IL2 A;  4P75 A;  2HQL A;  1WYD A;  1YIT A;  4P74 A;  2QEX A;  2KHI A;  1B70 B;  1V1Q A;  4P72 A;  4AYB E;  4MNO A;  3J81 j;  3PCO B;  1RL2 A;  4DK3 C;  2K4K A;  5IE8 A;  4DV3 L;  1XMQ L;  3ICE A;  1N9W A;  1L1O B;  3CF5 A;  1Y1W G;  3CCR A;  1HNZ L;  1Q12 A;  1PA6 A;  3S15 H;  4LF5 Q;  1PH3 A;  3HOY H;  2C35 B;  1NJI C;  1L2F A;  2F52 A;  4GN3 B;  2D0P A;  1C9O A;  4YCV A;  5LMU Q;  2VUM G;  4OON A;  1WJJ A;  2B29 A;  4JBW A;  3K80 C;  4XTC S;  5M3M G;  4DAY B;  4DV7 L;  4DV4 Q;  5IYC G;  1O7I A;  2UUA Q;  2MFI A;  5FLM H;  1ASY A;  2UU9 Q;  1FL0 A;  1YJ9 A;  3HOV G;  4J15 A;  4C3I H;  1KL9 A;  2WB1 G;  4GLX A;  1T9H A;  3B6Y A;  4YY3 L;  3CCJ A;  1PH9 A;  3CCV A;  2HT1 A;  1EUJ A;  1UEB A;  1YVC A;  4YWL A;  4DNI A;  1X3G A;  1OXU A;  1WCM G;  4PZ6 A;  4DK6 C;  2Y0S E;  4LUV A;  1MJC A;  3S1N H;  2YU9 H;  3CD6 A;  5GAH C;  2UXC L;  2JK8 A;  3U4V A;  1A8V A;  1NMG A;  2F4V Q;  4X66 Q;  4DR5 L;  4X65 Q;  1SMX A;  1Q1B A;  4JI1 Q;  4L5S A;  4X62 Q;  1XNQ Q;  3I56 A;  3NEM A;  4GLV B;  4DKA C;  4OO1 G;  4JI7 Q;  1SRU A;  4LF5 L;  2EIF A;  1XPO A;  3H3V I;  2NZO A;  4GOP B;  1FVI A;  4UP7 A;  1M1K C;  2UXB L;  3WWV A;  5LMU L;  2I5M X;  1C7Y A;  1D8L A;  1VQL A;  3HOY G;  4JI5 L;  1SFO H;  4A3D H;  4JOI C;  4DV4 L;  5ELN A;  1WI5 A;  1PH4 A;  4LW1 A;  2RF4 A;  3KDF A;  5E7N A;  2LXJ A;  5C3E H;  4DR1 Q;  2UU9 L;  4IJH A;  1IBM Q;  1BKB A;  3TEH B;  5JJL A;  5FLM G;  1VQF A;  4O0A A;  1EWI A;  5LMN Q;  1XMO L;  1N33 Q;  2XTI A;  3CCU A;  1R9T H;  4B3S L;  2DUD A;  2AWN A;  3G6E A;  4AYB G;  1BBU A;  2Z6K A;  5IP9 H;  2OTL A;  1SR3 A;  1P16 A;  1TWF H;  1VQ9 A;  3DM3 A;  2BH8 A;  3CP0 A;  1I94 Q;  4QQB X;  4R4C A;  2KEN A;  1JJG A;  4LFB Q;  2EQS A;  4UP9 A;  2IHF A;  3PUX A;  2JA5 H;  4X64 Q;  2BH2 A;  2F4V L;  3CQZ H;  1SRO A;  4X66 L;  4X65 L;  1DGS A;  4HJ9 A;  1NE3 A;  1YHQ A;  3CCQ A;  1EQQ A;  3RR5 A;  2CWA A;  4X62 L;  1XNQ L;  4DUY L;  4BA2 I;  2OCE A;  1UWV A;  4LFA Q;  4JI7 L;  2AMC B;  1VQ7 A;  1XTD A;  4PMW A;  1VQH A;  3ULL A;  2NVQ H;  3K81 C;  4AH6 A;  2NVX H;  1XNR Q;  3W1B A;  3UDF A;  4DV2 Q;  4LUO A;  2IHE A;  4HJ7 A;  4XIG S;  2VW9 A;  4R4Q A;  4DR1 L;  4L5R C;  2IY5 B;  1NMF A;  1IBM L;  2OQ0 A;  5C3E G;  1EFW A;  1N33 L;  2Y0S G;  5GAD C;  4R1J A;  5JEA G;  1HR0 Q;  4IFD I;  4C3H H;  4LF6 Q;  3A5U A;  1VQ8 A;  4C2M H;  1I94 L;  2AWO A;  4YCW A;  2UUB Q;  5IP9 G;  4HIO A;  3KF8 B;  4LFB L;  2PQA A;  2YV5 A;  1H95 A;  1TWC H;  2CKZ B;  1PH1 A;  4DV1 L;  3RLO A;  2JA5 G;  1JJ2 A;  2F3I A;  1G51 A;  3BJU A;  3K0X A;  3CCE A;  4IPC A;  4LFA L;  1IZ6 A;  3FKI H;  4BY7 H;  4MZ9 A;  4LNQ A;  1XPU A;  3HOU H;  4R4T A;  4JI4 Q;  3PV0 A;  1EYG A;  2ES2 A;  5C0X I;  2CQO A;  2OWO A;  3S14 H;  4POG A;  1VQK A;  1XNR L;  4APV A;  2NN6 I;  1QVC A;  3ZJY C;  4H02 A;  4DV2 L;  2E2J H;  2MO0 A;  1QVF A;  4JG2 A;  4JI2 Q;  3OYY A;  3CAM A;  3GTL H;  2BA0 A;  3L7Z C;  1N36 Q;  1V43 A;  5C44 H;  1I50 H;  2N49 A;  3U58 A;  1N8R C;  3CCL A;  1JB7 A;  3E9I A;  5BR8 Q;  1CKO A;  1U0L A;  4GLA C;  1VS0 A;  3HFZ B;  2E8G A;  4IPD A;  3RZD H;  4GKK Q;  1NBW A;  1UE5 A;  1YIJ A;  4P73 A;  3GTO H;  1GKH A;  2UUB L;  2R7F A;  1G6P A;  4GN5 A;  1VQM A;  1EIF A;  1EQR A;  4A75 A;  4B3R Q;  2ZTD A;  3U50 C;  1VQD A;  3HKS A;  1HZB A;  5IYB H;  2QA4 A;  5H1S E;  5GAG C;  3SGI A;  5M5X H;  1X3E A;  4DR3 Q;  3GTG H;  4PZ8 A;  3A74 A;  3UDX A;  2ZM6 Q;  1BBW A;  3FKI G;  2I0Q A;  2CCZ A;  2JA7 H;  4BY7 G;  3HOU G;  2VS1 A;  4JI8 Q;  3RNU A;  1N34 Q;  1HJP A;  5C4J H;  3PO3 H;  1IBL Q;  2MNA A;  4NPS A;  4L5T A;  3UE0 A;  3U4Z A;  1UE6 A;  1J5E Q;  4JI2 L;  3PF4 A;  1N36 L;  1XPR A;  3AFQ A;  3GTP H;  5BR8 L;  2LSS A;  3HKZ G;  5C44 G;  4DAM A;  2JA6 H;  4JV5 Q;  2Z0S A;  2OTJ A;  1PH6 A;  3RLN A;  1W2B A;  1VQ6 A;  3IRB A;  1QZH A;  2OQK A;  2YTX A;  3CCM A;  3S24 A;  3UDI A;  1L1O A;  2JEB I;  2RCN A;  3J81 c;  2HHH Q;  1GD7 A;  1JJC B;  5GQO A;  3UE1 A;  4GNX C;  1XJV A;  4HID A;  5J3B A;  1YI2 A;  4DR3 L;  2ASB A;  5IYB G;  3PIO A;  1MKH A;  2K5N A;  3RN2 A;  4UPA A;  2Q2H A;  4A3G H;  3I55 A;  2IX1 A;  4MTN A;  4HJ5 A;  1VCI A;  4JI8 L;  2R92 H;  4A3K H;  1N34 L;  1TWH H;  1K3R A;  2HIX A;  3J80 c;  4DV6 Q;  3CW2 C;  1IBL L;  2JA7 G;  4OO1 I;  2YYZ A;  2MQH A;  4IFD J;  4LFC Q;  1PFS A;  1J5E L;  2VZA A;  3PO3 G;  3VDY A;  3CC4 A;  2Z6K C;  4C3J H;  2K5V A;  3F2C A;  2UXD Q;  1CSQ A;  1KAW A;  3CC2 A;  4Y52 H;  1PH5 A;  4JV5 L;  4NXN Q;  1JMC A;  2MO1 A;  5EAY A;  4GNX B;  2UUA L;  2JA6 G;  3A5Z B;  3EBE A;  3I7F A;  2WAQ E;  4A76 A;  1RIP A;  1KQS A;  4UY8 C;  3PO2 H;  4BBS H;  4NB3 A;  2R6G A;  3FP9 A;  3J7A 5;  4P71 A;  2HHH L;  5C0X J;  3DLL A;  1YJW A;  1QUQ A;  4JBM A;  2N78 A;  3M9B A;  4GOP A;  1HZ9 A;  1YBY A;  2A1A A;  3E0E A;  1IYJ B;  1KD1 C;  1PH8 A;  1WOC A;  3I4N H;  4OX9 Q;  3BZK A;  1E1T A;  1LM0 A;  1P8L A;  3NBH B;  4A3G G;  4DV6 L;  1LTL A;  1Q46 A;  2WP8 J;  2XGT A;  4JI1 L;  3M85 A;  1VQP A;  2R92 G;  4BXX H;  4A3K G;  4LFC L;  3L0O A;  3CCS A;  1V9P A;  1YZ6 A;  3ER0 A;  2UUC Q;  4A3D G;  3HOW H;  2PNH A;  4JYA Q;  3K7A H;  1PV4 A;  3G71 A;  1Q81 C;  1B7Y B;  4YHH Q;  1JT8 A;  2B63 H;  2UXD L;  3GTJ H;  1W3S A;  1VQI A;  1E1O A;  1MIU A;  4NXN L;  1OTC A;  3GTK H;  1YNX A;  1CKN B;  2R7D A;  1VQ4 A;  1XMO Q;  3T1H Q;  1A63 A;  2ALY B;  3PUZ A;  3KF6 B;  3AYH B;  1VQC A;  3GO5 A;  1GO3 E;  5LMN L;  4R4O A;  1CUK A;  3W5O A;  3G4S A;  3PO2 G;  4BBS G;  1VQE A;  2K52 A;  4FDB A;  2JQO A;  3M3Y H;  1LUZ A;  4GKJ Q;  1OXX K;  2IT1 A;  2AKW B;  3H0G H;  5HY6 A;  1SN8 A;  3HOX H;  5IWA Q;  1A0I A;  1EOV A;  3S1R H;  3S1M H;  3HKZ E;  1VQG A;  4OX9 L;  4OWT B;  4X64 L;  1Z9F A;  3OTO Q;  3L2P A;  3W1G A;  3I4N G;  1Q8K A;  4POF A;  3NEL A;  4YWK A;  3T1Y Q;  1KHI A;  3TRE A;  3CPW A;  1I5F A;  4AQY Q;  2UUC L;  3TQY A;  4JI6 Q;  4BXX G;  4JYA L;  2KHJ A;  2K14 A;  1AE2 A;  1K9M C;  2AHO B;  3RN5 A;  3HOW G;  5M5W H;  2WAQ G;  3MXN B;  1VQJ A;  2GN5 A;  2PI2 E;  4PG3 A;  3STB C;  3Q8D A;  4A3B H;  4A3M H;  5GAE C;  2B63 G;  2EXD A;  4HJA A;  1S72 A;  3H15 A;  4A3I H;  4A3L H;  2VQF Q;  2N8N A;  3T1H L;  1KIX A;  2ID0 A;  4IFD G;  1CKM A;  2YTV A;  1K73 C;  1Y1V H;  1YHB A;  2B3G A;  4LUZ A;  2Q2U A;  1HR0 L;  4GN4 B;  2FXQ A;  1E22 A;  2DGY A;  5FJ8 H;  3PUV A;  4Y7N H;  5M3F H;  4LF6 L;  4GKJ L;  1Q82 C;  4DR4 Q;  2A19 A;  3ULJ A;  5IP7 H;  4LF9 Q;  4AIM A;  5IWA L;  1YHA A;  2E2I H;  4BY1 H;  4LF4 Q;  1KXL A;  3H0G G;  4IOC A;  3M4P A;  3OTO L;  3HOX G;  3PSI A;  3J81 i;  1Z47 A;  2K75 A;  1IBK Q;  4QL5 A;  4AQY L;  2QGQ A;  4JI6 L;  1UE7 A;  3G48 A;  2NVY H;  4A3J H;  1XMQ Q;  5C0X G;  1KRT A;  2JE6 I;  1A62 A;  2CWP A;  4JI4 L;  2ATW A;  4B3M Q;  4R4I A;  3PIP A;  3CXC A;  1QZG A;  4JBJ A;  3J80 i;  1UE1 A;  4DR6 Q;  1L1O C;  1HNW Q;  2VQF L;  1I3Q H;  3TRZ A;  1TWG H;  2YTY A;  3GDE A;  3ERS X;  5AJ3 Q;  4IO9 A;  4A3M G;  4A3B G;  4A3L G;  4A3I G;  3K7U C;  3BZC A;  3PGZ A;  1X65 A;  1X3F A;  3F2B A;  4KHP Q;  2L15 A;  1M90 C;  5JJI A;  2JA9 A;  1Y1V G;  2E2H H;  1D7Q A;  4GKK L;  3M4Q A;  1S40 A;  4YY3 Q;  4DR4 L;  5FJ8 G;  4LF9 L;  3I4O A;  5M3F G;  1TWA H;  1YEZ A;  3M4O H;  5IYD H;  4LF4 L;  4B3R L;  3CPF A;  5IP7 G;  1ASZ A;  3UDG A;  5IY0 A;  3AFP A;  4KLK A;  4BY1 G;  2UXC Q;  1IBK L;  1MJE A;  4DV0 Q;  2RHQ B;  4DR5 Q;  2NZH A;  1K8A C;  2ZJQ A;  1I6H H;  1OXS C;  2ZTC A;  3KLW A;  3S2H H;  1TXY A;  2N3S A;  2ZM6 L;  4A3J G;  2UXB Q;  2CFM A;  4B3M L;  3STB D;  5JEA J;  4JCV E;  3S2D H;  3S1Q H;  1OXV A;  3H3V H;  4A3C H;  2VY3 A;  4DR6 L;  1HNW L;  4HIK A;  4IPH A;  4JI5 Q;  1JE5 A;  5AJ3 L;  1IXR A;  1GM5 A;  2Q2T A;  5IT9 c;  1X9N A;  1PH2 A;  4GOP C;  2VQE Q;  2D0O A;  4NXM Q;  5M5Y H;  1BVS A;  3ULP A;  4LF7 Q;  4JI0 Q;  3M7N A;  4KHP L;  3EIV A;  1VQN A;  2RHS B;  4QY7 A;  4B3S Q;  1Y14 B;  2K5H A;  2K50 A;  1HZA A;  2JEA I;  3GD7 A;  4EQ5 A;  3JAM c;  3J7Z C;  4DR2 Q;  2R93 H;  1CSP A;  3I4M H;  2Q2I A;  3KFU A;  1WFQ A;  5IYD G;  1KRS A;  2BA1 A;  2VL6 A;  3KDF B;  4HIM A;  4DV0 L;  4ALP A;  4X6A H;  4ME3 A;  3LGJ A;  2JJQ A;  1PVO A;  1AE3 A;  3F2D A;  2ZTE A;  1S3O A;  1K0R A;  1X55 A;  4DUY Q;  5K36 G;  4LF8 Q;  4OXP A;  3JC6 6;  3CMA A;  4IOA A;  1N32 Q;  1E7Z A;  1U5K A;  4GNX A;  1QUQ B;  1PYB A;  1VQB A;  4BA1 I;  4A3C G;  3F1Z A;  1NY4 A;  3KYH C;  2E5L Q;  3A0J A;  2VQE L;  1QVG A;  4QJF A;  4PZ7 A;  4IJL A;  4NXM L;  4LF7 L;  4JI0 L;  3KJP A;  1SLJ A;  4JBK A;  5GRO A;  5C4X H;  4WJ4 A;  2I5H A;  1VQA A;  4DR2 L;  5JJK A;  4BBR H;  1PYS B;  2R93 G;  3I4M G;  4JOI A;  2KCM A;  2ZJP A;  4DV1 Q;  3NEN A;  3KOJ A;  4JI3 Q;  5ELO A;  3RLF A;  3CME A;  2GVA A;  4LF8 L;  3CC7 A;  4TVA B;  2KBN A;  4YCU A;  4YWM A;  1N32 L;  3TS0 A;  4B3T Q;  1CKN A;  4HJ8 A;  2I5L X;  4A4I A;  3KF6 A;  4DR7 Q;  1FJG Q;  1PH7 A;  5FLX c;  3BU2 A;  5LMN W;  2PQA B;  2E5L L;  4QIW E;  1VQ5 A;  3D0F A;  4YHH L;  4DUZ Q;  3HOZ H;  1K83 H;  2HIV A;  3S17 H;  2A8V A;  4K0K Q;  1G29 1;  1X54 A;  1OXT A;  4LWC A;  4KI0 A;  5HGQ A;  2GVB A;  2NVT H;  2R7Z H;  4A3E H;  2KCT A;  4RMF A;  4L5Q A;  2JA8 H; 
#chains in the Genus database with same CATH topology
 4BWG B;  1HFN A;  1K83 B;  1R4P B;  4BBR G;  1A15 A;  4CDE C;  4LMQ D;  2SNM A;  1UEA B;  5A2Q E;  4QGU A;  1HNX Q;  1X6O A;  4HCS A;  4DR7 L;  1SMY C;  1Q7Y C;  3IAY A;  5ELF A;  4PV1 C;  4DV3 Q;  2RDF A;  1X3P A;  4DUZ L;  3R3O A;  5FO7 B;  3G6J B;  5IYC H;  4OIJ A;  2IL8 A;  5BN5 A;  1GVP A;  4CDC C;  5CC4 A;  5G3L F;  2E2J B;  2RSO A;  2SEB D;  3RZO H;  1NR2 A;  1Q86 C;  3C46 A;  3KJO A;  4GS3 A;  3RZD B;  2PI2 A;  1QE6 A;  1SE8 A;  5I9P A;  2LXK A;  3S16 H;  1EIY B;  1IL2 A;  1ESF A;  5FLX L;  3K5O A;  1V1Q A;  3HGB A;  2FMM A;  2OXP A;  5L37 A;  3GP7 A;  5IGE A;  5IE8 A;  3ICE A;  1K0S A;  3LNN A;  3CF5 A;  1LTR D;  3CCR A;  2SNS A;  1HNZ L;  3S16 B;  4LF5 Q;  1PH3 A;  1GOZ A;  5CV6 A;  1NJI C;  2UXB Q;  2D0P A;  5COR A;  1WJJ A;  5C4J B;  4XYQ A;  1O7L A;  4DV4 Q;  1WTW A;  2UU9 Q;  1FL0 A;  1XXG A;  3OMC A;  1E2V A;  2WB1 G;  4H7B A;  4XT1 B;  3B6Y A;  4YY3 L;  1EUJ A;  4DNI A;  4YWL A;  1LTG D;  4FF3 A;  1B53 A;  1B9M A;  4B9W A;  3CD6 A;  1STN A;  3NQI A;  4L8J A;  2F4V Q;  4CJ0 B;  1PZK D;  4PMC A;  1MSG A;  3NEM A;  4GLV B;  2VB3 X;  3MXP A;  1XPO A;  1F9S A;  2NZO A;  4GOP B;  5JPM C;  1M1K C;  4TKO B;  4IAL A;  4A3K B;  1TWH B;  1C7Y A;  4J8Q A;  4JOI C;  1PH4 A;  5ELN A;  3QIA A;  5C3E H;  4IJH A;  4CKC A;  3TEH B;  3L3O C;  1VQF A;  3P75 A;  4O0A A;  1N33 Q;  1HA6 A;  4RKL A;  4RFB A;  1BBU A;  1VQ9 A;  4R4C A;  4GZY C;  2CQA A;  1A3T A;  2JA5 H;  3CQZ H;  1SRO A;  4X66 L;  1GHK A;  3CCQ A;  4BA2 I;  4IUN A;  1K8O A;  1TY0 A;  3HRZ C;  3T13 A;  3ULL A;  4H0L C;  1RD9 D;  3W2D A;  2NVQ H;  3K81 C;  3CQZ B;  2NB0 A;  4HR7 B;  4AH6 A;  1XNR Q;  3UDF A;  4DV2 Q;  1E2Z A;  4LUO A;  1Y8O B;  4HJ7 A;  2EYJ A;  3MFG A;  4DR1 L;  1IBM L;  4ZYS A;  5EPK A;  4KY7 A;  4WRD A;  4RWS C;  1SAP A;  4R1J A;  4IFD I;  1TT2 A;  2F0D A;  3LWU A;  2QEJ C;  2UUB Q;  2PW5 A;  4LFB L;  2AUJ D;  2SOB A;  1SNC A;  3QOJ A;  4DV1 L;  3RLO A;  2KHS A;  4KD4 A;  4DN4 M;  3CCE A;  4RCO A;  1IZ6 A;  3H0G B;  4BY7 H;  2B2W A;  1IYU A;  2RDG A;  3URY A;  1G8Z D;  3DUZ A;  3SHL A;  1QVC A;  4H02 A;  2MO0 A;  1DON A;  5C3X A;  4JG2 A;  1QWY A;  3L7Z C;  3H6M A;  2F0L A;  1I50 H;  1LTI D;  3E9I A;  4R9W A;  2DJG C;  2A5H A;  4A3M B;  2E8G A;  4IPD A;  1EQV A;  2WIN B;  1NBW A;  1O78 A;  1CA6 A;  3GTO H;  1VQM A;  3HKZ B;  1XTC D;  1S5F D;  1EIF A;  3A56 A;  2L55 A;  3K5N A;  5IYB H;  4PNY A;  2C9O A;  4DR3 Q;  2PPB C;  4PZ8 A;  5JOB A;  2ZM6 Q;  3FKI G;  2CCZ A;  2A6H C;  3HOU G;  3NTH A;  1N34 Q;  5C5M A;  5CYU A;  4L5T A;  3UE0 A;  1RJT A;  3PF4 A;  2K05 A;  1EIG A;  4R8I A;  1RTO A;  5BR8 L;  2K33 A;  1EYA A;  2I07 B;  4DAM A;  2JA6 H;  2L11 A;  4JV5 Q;  3MWY W;  2EYF A;  3IRB A;  1QZH A;  1JOQ A;  2YTX A;  3E3X A;  1L1O A;  2RCN A;  2BCO A;  5HUR A;  5EKK A;  4C1N K;  2E2H B;  5J3B A;  1YI2 A;  2CVR A;  1D1I A;  1Y69 U;  3K57 A;  2ASB A;  1MKH A;  1Y8P B;  3I55 A;  2DJF C;  4JI8 L;  1D1K A;  3CW2 C;  1IBL L;  3NHH A;  2AQ2 B;  1PFS A;  5C3W A;  1J5E L;  3VDY A;  4C3J H;  4IUU A;  4DA2 A;  1KAW A;  1TII D;  2LKV A;  2K03 A;  1JMC A;  4ZKB B;  5EAY A;  4RGO S;  4GNX B;  1LTS D;  3I72 A;  3EBE A;  1QOH A;  4YIJ A;  1EFI D;  1RIP A;  4C3J B;  4A76 A;  4UY8 C;  2R6G A;  1PTO D;  5M5Y B;  3DLL A;  2HQE A;  3M9B A;  5FOB B;  1EY7 A;  1T5E A;  3E0E A;  2JYO A;  1IKL A;  3EJI A;  1PH8 A;  1KD1 C;  1GUS A;  3R93 A;  4DV6 L;  3M85 A;  1DZ1 A;  5J22 A;  4A3D G;  2UUC Q;  3CCS A;  1V9P A;  1EYD A;  3HOW H;  1B3Q A;  2PNH A;  4C1N I;  1PV4 A;  5E4W C;  1Q81 C;  2UXD L;  2WAC A;  3EVQ A;  1W3S A;  3GTJ H;  3HZX A;  3GTK H;  1II3 A;  2R7D A;  1XMO Q;  3QWN A;  4IFD H;  1Z7T A;  1AW7 A;  2N55 A;  2ALY B;  2X69 A;  3T1H Q;  3HOW B;  2F0N A;  1A63 A;  3AYH B;  1U4L A;  4DXF A;  2KUM A;  2QIL A;  2H1E A;  1CUK A;  2F0K A;  3DWQ A;  3W5O A;  3G4S A;  3PO2 G;  4KHV A;  1CHP D;  2JQO A;  4BBS G;  1QJO A;  3GTK B;  4GKJ Q;  1CK1 A;  3NP8 A;  4DU9 A;  4MN3 A;  5HY6 A;  4BBR B;  1A0I A;  4OX9 L;  1F9P A;  4OWT B;  2A6E D;  1Z9F A;  3SK6 A;  5I6W A;  2EE1 A;  3I4N G;  5IT9 L;  3EQL C;  4AQY Q;  1I5F A;  4BXX G;  4F88 A;  2F0E A;  1G2S A;  1AE2 A;  1DOL A;  2F1M A;  3NTI A;  1K9M C;  3A8J E;  3MXN B;  3RUZ A;  3U9S A;  4UDU C;  4PG3 A;  2EXD A;  4A3L H;  3H15 A;  2J4X A;  1KIX A;  3CU7 A;  1JQY D;  5EBC A;  1CKM A;  3MFY A;  1K73 C;  2B3G A;  4DFA A;  2Q2U A;  3S17 B;  3QR8 A;  2NVT B;  3W3A A;  1FNW A;  3DWP A;  2CW0 D;  4MHE A;  2MUY A;  4LF9 Q;  4AIM A;  5IWA L;  1YHA A;  4ZQ3 A;  1DXM A;  3OTO L;  5ELD A;  1F77 A;  1S5C D;  4QL5 A;  1CZG A;  1IBK Q;  2QGQ A;  1PZI D;  3DM1 A;  1HQR D;  2CWP A;  2ATW A;  4B3M Q;  3D4R A;  3GTQ B;  1X32 A;  1EY4 A;  5E1F A;  1V8Q A;  3A7A B;  4A3I G;  3K7U C;  2E2D C;  3BZC A;  3PGZ A;  2IX3 A;  4FXK C;  4X3T A;  1M90 C;  4CHT B;  3I3C A;  2EXZ A;  4YY3 Q;  4DR4 L;  2Q8I B;  3I4O A;  3M4O H;  3PMF A;  2Z8L A;  5IP7 G;  4KK7 A;  2C5C A;  4OIK A;  4XYO A;  2QCP X;  1OO9 B;  1UNS A;  2PQE A;  2NZH A;  1F2M A;  1SYC A;  1MI2 A;  3Q24 A;  3S2H H;  4A3J G;  5JEA J;  1FNU A;  3S2D H;  2A73 B;  3S1Q H;  4IPH A;  1CFM A;  5AJ3 L;  1IXR A;  2Q2T A;  1X9N A;  1BBX C;  3M7N A;  1STG A;  4LF7 Q;  1CM9 A;  1AFP A;  1VQN A;  2RHS B;  4RHS A;  2K5H A;  4ZUI A;  3GD7 A;  2R93 H;  1PFB A;  4QUC A;  2BE5 C;  1SJE D;  2Q2I A;  2F0I A;  1WFQ A;  1KRS A;  2F0W A;  3IL8 A;  1SYB A;  4HIM A;  2JJQ A;  5KIX A;  2ZTE A;  1K0R A;  1X55 A;  2R93 B;  5K36 G;  3VR6 A;  1CQF A;  3K5M A;  3CMA A;  4IOA A;  2B2V C;  4K5X A;  3S1N B;  2Z4H A;  4KKT A;  1NCV A;  3CHB D;  2KOL A;  3TN2 A;  1YNJ D;  4A3C G;  3F1Z A;  1H9S A;  2E5L Q;  3A0J A;  1GUT A;  2VQE L;  4NXM L;  4RA8 A;  1XX8 A;  3VR4 A;  1PYS B;  1SBB B;  3G7L A;  1R9T B;  4OEM B;  4DV1 Q;  1HTL D;  2K28 A;  1PXU A;  5ELO A;  2Z9H A;  3CC7 A;  4TVA B;  4LF8 L;  2E76 C;  2K01 A;  2I5L X;  2F0G A;  3IFD A;  2P5Z X;  3KF6 A;  3MXG A;  1PH7 A;  5KGU A;  2NN6 H;  3BU2 A;  5LMN W;  1WTX A;  5CGK A;  4V0B A;  4YHH L;  3HS0 C;  4QMG A;  1BXT A;  5NUC A;  4K0K Q;  4V19 0;  2R7Z H;  1WTO A;  4L5Q A;  2JA8 H;  4K2L A;  4KHZ A;  5LL6 S;  4A3F H;  2D62 A;  1L0W A;  1A6X A;  1RKN A;  5D3D A;  3PUW A;  2ZJR A;  1S5E D;  4JI3 L;  1JC7 A;  1E24 A;  1ZYR C;  3J81 E;  2F0Q A;  3FEW X;  1J6Q A;  4EX5 A;  3K6O A;  2PZT A;  3GQB A;  3TSS A;  3QOL A;  4RCN A;  1HPC A;  2EY1 A;  4KKS A;  1AH9 A;  3J80 E;  1PFN A;  3HOU B;  2F0M A;  4DPG A;  5M3M H;  5AFW A;  3HOZ G;  4M1U B;  4CKE A;  3HOV H;  5I4D A;  3D31 A;  4F87 A;  4DV7 Q;  1YJN A;  1TR5 A;  3ND9 A;  2V1C C;  4ZKC B;  4DV5 L;  2WFW A;  3FPP A;  1TS3 A;  4A3E G;  1SE2 A;  4NMZ A;  1U4R A;  2XRS D;  3FHW A;  1VQO A;  1F9Q A;  4A93 G;  1JCK B;  1Q8I A;  2DY7 A;  3K8A A;  1CHQ D;  5C4H A;  1B3A A;  2KEE A;  1YIT A;  2QEX A;  1S4Z A;  1SYG A;  3J81 j;  3PCO B;  1RL2 A;  3ITP A;  4J1M A;  4DK3 C;  3A55 A;  1XMQ L;  5M5X B;  1Y1W G;  3H09 A;  3GTG B;  1Q12 A;  1LO5 D;  1PA6 A;  1PFM A;  2C35 B;  1QG7 A;  4CDD C;  1GHJ A;  4YCV A;  2VUM G;  5LMU Q;  2B29 A;  3K80 C;  4XTC S;  4DAY B;  1O7I A;  2EJM A;  5E4X A;  2EY5 A;  4J15 A;  4C3I H;  3D8G A;  3CCJ A;  1TKW B;  1X3G A;  4K14 A;  1OXU A;  1WCM G;  4DK6 C;  2Y0S E;  5JJZ A;  2YU9 H;  1GJX A;  5GAH C;  3U4V A;  1A8V A;  2NTT A;  3T51 B;  1LTA D;  4UHV A;  2HDL A;  1I6V C;  4OO1 G;  4JI7 Q;  2L0C A;  1SRU A;  1DOK A;  1RHP A;  2EIF A;  3H3V I;  4UP7 A;  4QB4 A;  4A3D B;  4LK1 C;  1D8L A;  4HTH A;  3HOY G;  4Q0F A;  3MZ5 A;  4JI5 L;  4OHJ A;  5E7N A;  3KDF A;  2LXJ A;  2K5W A;  4KY5 A;  5FLM G;  1ET6 A;  5CR3 A;  1F2Z A;  1KDC A;  3CCU A;  4B3S L;  1H9S B;  4AYB G;  1SR3 A;  1P16 A;  4QQB X;  3DM3 A;  2CW0 C;  3PO2 B;  4HAE A;  2EQS A;  4UP9 A;  2IHF A;  4X65 L;  1EQQ A;  2L12 A;  4X62 L;  1XNQ L;  4DUY L;  5FO8 B;  1BOS A;  1VQ7 A;  2KCC A;  1VQH A;  3I4N B;  3MA2 B;  5CV5 A;  1FGB D;  2NVX H;  4ZRZ A;  3W1B A;  2WKC A;  4XIG S;  4KJN A;  4L5R C;  3K7A B;  2K5Q A;  2IY5 B;  5EPL A;  2OQ0 A;  4XXE A;  1JR0 D;  5JEA G;  2A69 D;  4UAI A;  5D3I B;  2JN4 A;  1WTQ A;  4CGY B;  1I94 L;  4YCW A;  5IP9 G;  1L0Y B;  3MHB A;  2NZ1 D;  1H95 A;  2B2Y A;  1TQO A;  3MAQ A;  3M3Y B;  3K0X A;  4LFA L;  3TP8 A;  1XPU A;  3S1M B;  3PV0 A;  1EYG A;  4RGN A;  4HSP A;  3M4Y A;  3ZJY C;  4E6I A;  2E2J H;  3RMH A;  4JI2 Q;  4KTA A;  3SK4 A;  1YNN D;  3CAM A;  3OYY A;  2BA0 A;  4CDF C;  1BDO A;  1N36 Q;  4EVO A;  2N49 A;  1JB7 A;  3D6C A;  1EWC A;  3HFZ B;  3RZD H;  1ZKO A;  4EQN A;  4P73 A;  1G6P A;  1GKH A;  4C3H G;  5KEE A;  2BDO A;  3U50 C;  3VR3 A;  1MGS A;  4Y7N B;  2QA4 A;  5H1S E;  5GAG C;  3SGI A;  4TSS A;  4P2C B;  3VYT A;  3A74 A;  3UDX A;  2G9D A;  2I0Q A;  3VA7 A;  2JA7 H;  2VS1 A;  5ELE A;  3U9O A;  3OHX C;  1HJP A;  1H9R A;  5C4J H;  2MNA A;  4A3J B;  3U4Z A;  1UE6 A;  1M8A A;  2IWH A;  3AFQ A;  2K1B A;  2JA7 B;  5HGT A;  4OGQ C;  4FF1 A;  3NWT A;  5C44 G;  1L0X B;  1PH6 A;  1I3Q B;  2QDL A;  4IUP A;  2OQK A;  3S24 A;  3UDI A;  3X3M A;  3N52 A;  4GNX C;  3SDZ A;  4HID A;  3SVM A;  2G5D A;  2O4X A;  2Q2H A;  2IX1 A;  2L1B A;  2LMC B;  4A3K H;  1TWH H;  4OO1 I;  1IKM A;  2MQH A;  1I6H B;  1BR9 A;  3PO3 G;  1JB3 A;  3EFX D;  5FLX E;  4R8N A;  1CSQ A;  4M8A A;  3F2C A;  3PIO 3;  4NXN Q;  2X6G A;  3J7A V;  2WAQ E;  1KQS A;  4DK0 A;  3NUC A;  4NB3 A;  3NSW A;  2TSS A;  3J7A 5;  4P71 A;  2HHH L;  4JK1 C;  4JBM A;  3A7L A;  4ZUJ A;  1HZ9 A;  4B9X A;  1IYJ B;  3MXU A;  1CT1 D;  1STY A;  1P8L A;  4A3G G;  4JI1 L;  2R92 G;  1EY0 A;  4LFC L;  3L0O A;  2HD3 A;  1YZ6 A;  4KY6 A;  3T56 B;  4JYA Q;  3E0J A;  1ILQ A;  1D5M C;  1PTO F;  1Y8N B;  4N8X 1;  1DCZ A;  4YHH Q;  1MIU A;  4ZAI A;  1G2T A;  2EDG A;  3LX0 A;  2WAQ B;  2M00 A;  3GO5 A;  1A2T A;  1LAC A;  5LMN L;  1S5B D;  2B2W C;  2K52 A;  3T4A C;  3QJY A;  1LTB D;  1PLF A;  2IT1 A;  3H0G H;  3MTS A;  3TZD A;  3VYS A;  1UUP A;  1EOV A;  2B2T A;  3HKZ E;  4X64 L;  4K5W A;  4POF A;  1KHI A;  2F0F A;  1ENF A;  1U9R A;  2F3W A;  3TQY A;  3A8K E;  1IL8 A;  2RVL A;  3DWA A;  1F9R A;  3A54 A;  1VQJ A;  2PI2 E;  4X3K A;  3STB C;  4A3M H;  3KF8 A;  5GAE C;  2B63 G;  4HJA A;  2XSC A;  1S72 A;  1SNQ A;  2VQF Q;  3PQI A;  2ID0 A;  4CJ2 C;  3HOZ B;  1YHB A;  5DM6 3;  1B44 D;  4GN4 B;  3BVZ A;  1SEB D;  5FJ8 H;  4A3E B;  1ESR A;  2XN9 C;  2A19 A;  3ULJ A;  1ONL A;  4BY1 H;  4LF4 Q;  2J0T D;  2QW7 A;  2EJG C;  2RKS A;  3M4P A;  4IOC A;  4A93 B;  3HOX G;  3PSI A;  3BG3 A;  2A68 C;  5COY A;  3K59 A;  4JI6 L;  1QCB D;  1ICF B;  2H4O A;  1O7Y A;  5C0X G;  4QIW B;  1XMQ Q;  1W6J A;  1A62 A;  2K6A A;  4JI4 L;  4BY1 B;  1CI3 M;  3E6Z X;  3PIP A;  1I4X A;  5EJW A;  2QKI C;  4DR6 Q;  1HFG A;  1L1O C;  1Y1W B;  4Q5V A;  3TRZ A;  4A3B G;  3ERS X;  5ISR A;  3DEO A;  2VUM B;  3F2B A;  5JJI A;  3MEH A;  1Y1V G;  2E2H H;  3K0Y A;  3AMU A;  1HXY D;  2HCC A;  5EBD A;  4GKK L;  2IW3 A;  5M3F G;  5IYD H;  4B3R L;  3CPF A;  4RGM A;  2B2U A;  3OW7 A;  3UDG A;  3J7A F;  1MJE A;  4DV0 Q;  2RHQ B;  1K8A C;  1WCM B;  3BVG A;  3NBI A;  5IGB A;  2CFM A;  1STA A;  2PMZ B;  1OXV A;  2VY3 A;  1HNW L;  4JI5 Q;  1JE5 A;  5KRU A;  1GM5 A;  4DK1 A;  2WV6 D;  5IT9 c;  1SNM A;  1PH2 A;  2RCF A;  5M5Y H;  3HOY B;  5FKA C;  4KHP L;  3Q6S A;  4B3S Q;  2JEA I;  1HZA A;  1QNU A;  4EQ5 A;  3JAM c;  3J7Z C;  4HN7 A;  2D5D A;  3KFU A;  4K6D A;  4EQO A;  1KLU D;  4PQX A;  4IZ8 A;  4ALP A;  4RH6 A;  3C1E A;  1DYQ A;  4DUY Q;  2XNA C;  3R2I A;  1N32 Q;  1E7Z A;  3D4D A;  2HUG A;  1KAA A;  1F2L A;  3NTK A;  1EEI D;  3S9W A;  1TVX A;  4QJF A;  1EY6 A;  4IJL A;  5JVG 3;  4FXG C;  4JI0 L;  1TU2 B;  4C3I G;  1SLJ A;  3KJP A;  5GRO A;  2I5H A;  1SFO B;  4DR2 L;  1SNO A;  3CRL C;  1B2T A;  4BBR H;  4FYD A;  3DMU A;  3I4M G;  3I4L A;  1PMR A;  1HUN A;  5EKL A;  1MSH A;  3NEN A;  3KOJ A;  5J1Z A;  2EYP A;  2KCN A;  4LJZ C;  1WTR A;  4YWM A;  1BNZ A;  3TS0 A;  1CKN A;  2KQ3 A;  4U68 A;  4G7Z C;  2ZXP A;  4DR7 Q;  5I2Y A;  4NP5 A;  2PYK A;  3GV6 A;  4G7O C;  1VQ5 A;  3QB3 A;  4DUZ Q;  4HMJ A;  4QUF A;  3S17 H;  1BO0 A;  3JAM L;  1G29 1;  2NVT H;  3KK7 A;  5HGQ A;  4KI0 A;  4RMF A;  1A2U A;  5C4X G;  2IX0 A;  3AQQ A;  3T16 A;  4IPG A;  1ILP A;  2XIW A;  1X56 A;  5BN4 A;  1QB5 D;  1S5D D;  2FHT A;  4C3H B;  5M9O A;  2OT2 A;  4NW2 A;  3AEV A;  1HZC A;  1HH2 P;  4B3T L;  1SND A;  1K28 A;  3GTQ H;  2WB1 E;  3EN2 A;  3HG9 A;  1TWC B;  4F7X A;  1Q3L A;  1FJG L;  1ENA A;  2TMP A;  3OW2 A;  5C4Z A;  2CHB D;  2DNE A;  1HR0 W;  1SE3 A;  4OWW B;  1HNZ Q;  5DLQ E;  4DAV A;  1KC8 C;  3S14 B;  1J9O A;  4RG1 A;  5IGC A;  5IT9 E;  3I2Z A;  2RDH A;  5IIF A;  4WJ3 M;  3E9H A;  1ENC A;  2EVB A;  2MJ8 A;  5CBA E;  2H5X A;  5C44 B;  1B1Z A;  3F8T A;  3PIP 3;  3SR1 A;  3N6R A;  1B8A A;  1PRT D;  3JAM i;  1G91 A;  1HNX L;  2VNU D;  2WB1 B;  4P75 A;  4DF7 A;  4P72 A;  4MNO A;  1DOM A;  2K4K A;  4DV3 L;  1L1O B;  2LY7 A;  3S15 H;  4IQZ A;  1UAP A;  1L2F A;  4GN3 B;  4H44 C;  2EZV A;  4JBW A;  1ML0 D;  3PO3 B;  3ZYY X;  5IYC G;  1V1P A;  2MFI A;  1ASY A;  1YJ9 A;  2Q8R E;  4Z9C B;  5KNC A;  2R61 A;  4FP5 D;  3S15 B;  1NAP A;  3GTP B;  1T9H A;  2HT1 A;  1PH9 A;  4CBV A;  1YVC A;  1SMY D;  4LUV A;  3S1N H;  4DNT B;  2UXC L;  2AQ3 B;  1NMG A;  4X66 Q;  4DR5 L;  4L5S A;  1SMX A;  4JI1 Q;  1AEX A;  4DKA C;  3DXJ C;  2F0S A;  2PCF B;  2NUC A;  4LF5 L;  4A3G B;  4HCE A;  1FVI A;  1TS2 A;  3FDT A;  2UXB L;  2R92 B;  4K8J A;  1VQL A;  1TY2 A;  3WOE A;  4DV4 L;  1WI5 A;  4LW1 A;  4DR1 Q;  2UU9 L;  3P20 A;  2F0H A;  1IBM Q;  1BKB A;  1DJR D;  1EWI A;  3V2T A;  5C6A A;  5LMN Q;  2XTI A;  1R9T H;  2DUD A;  3G6E A;  3E5S A;  4ILW A;  2Z6K A;  3NBH A;  3R8B A;  1TWF H;  2BH8 A;  3CP0 A;  2KEN A;  4LFB Q;  2DN8 A;  3OOC A;  4X64 Q;  1RF2 D;  2F4V L;  1EQT A;  2CWA A;  4L63 B;  1TWF B;  4KMU C;  2AMC B;  1XTD A;  4PMW A;  2XWB B;  5CV7 A;  1EWH A;  4EGV A;  3ERO A;  4R4Q A;  1KLG D;  1H9M A;  1NMF A;  3X3N A;  5C3E G;  1EFW A;  2B63 B;  1N33 L;  4ZLT F;  2FMC A;  1VQ8 A;  4C2M H;  2AWO A;  4BS9 A;  1O7Z A;  1BCP D;  2PQA A;  1W6K A;  1PH1 A;  2NTS A;  2JA5 G;  2F3I A;  3BJU A;  1WTH A;  4IPC A;  3C1F A;  4C2M B;  1EY8 A;  3FKI H;  4MZ9 A;  3HOU H;  1HUM A;  3HOX B;  4R4T A;  3OIP A;  4JI4 Q;  2ES2 A;  2CQO A;  1XNR L;  2NWG A;  4APV A;  1QVF A;  5C5L A;  4DV2 L;  3FKI B;  3VYU A;  3GTL H;  1V43 A;  4QF4 A;  3U58 A;  5M5W B;  1N8R C;  3CCL A;  5BR8 Q;  4GLA C;  1HHV A;  4GKK Q;  5DNF A;  1UE5 A;  1YIJ A;  2UUB L;  1IW7 D;  3GTL B;  4GN5 A;  4N9T A;  1EQR A;  1Y1V B;  4B3R Q;  1ET9 A;  1VQD A;  3HKS A;  4L6T B;  1PTO C;  2EYM A;  1HZB A;  5M3F B;  5M5X H;  1X3E A;  3GTG H;  3ERQ A;  3CKI B;  5FK9 C;  3V05 A;  1BBW A;  4BY7 G;  1HRJ A;  4JI8 Q;  1IBL Q;  2F3V A;  4NPS A;  2JSO A;  1J5E Q;  4KN7 C;  1R4Q B;  4WFN 3;  3FVQ A;  4G4K A;  2Q8T A;  1XPR A;  2LSS A;  3HKZ G;  4IN3 A;  1LT4 D;  1I4R A;  1NNX A;  2EY6 A;  2F0P A;  4MIU A;  4JVZ A;  2FFK B;  3H3V C;  1LT5 D;  2WII B;  1GD7 A;  1JJC B;  5GQO A;  3VA5 A;  1XJV A;  1EEF D;  4DR3 L;  1TWA B;  5IYB G;  2K5N A;  3PIO A;  2O5J C;  1X3Q A;  4MTN A;  1VDZ A;  2RBM A;  1VCI A;  4A3D H;  1N34 L;  1K3R A;  2HIX A;  2RA4 A;  4DV6 Q;  2A6E C;  2YYZ A;  2VZA A;  3AU7 A;  3SK5 A;  3OPO A;  3SK8 A;  2K5V A;  3C3L A;  2UXD Q;  1D2B A;  1WTV A;  3IFT A;  1PH5 A;  2D2C C;  4JV5 L;  2UUA L;  2JA6 G;  3A5Z B;  3PO2 H;  4BBS H;  3I70 A;  5C0X J;  1JE4 A;  2N78 A;  4GOP A;  3Q23 A;  2EYL A;  1YBY A;  2A6H D;  2A1A A;  3ND8 A;  3I4M B;  2VXW A;  4BBS B;  1WOC A;  3I4N H;  1J8I A;  4OX9 Q;  3BZK A;  1E1T A;  1HCZ A;  1LM0 A;  1M4V A;  3NBH B;  1LTL A;  1Q46 A;  1XWE A;  1VQP A;  4BXX H;  1JOK A;  3TP7 A;  5I9O A;  3ER0 A;  3K7A H;  1NSN S;  4FVM A;  1B7Y B;  4X3S A;  1JT8 A;  4IUV A;  1AN8 A;  4C3J G;  1E1O A;  3L9A X;  1OTC A;  3BVM A;  1MD2 D;  5K5P A;  5A2Q L;  3KF6 B;  1E0B A;  1VQC A;  1GO3 E;  4ZCK A;  4C56 C;  4FDB A;  3M3Y H;  3FPU B;  1LUZ A;  2ENB A;  1OXX K;  5T1I A;  1PZJ D;  4O1N A;  1SN8 A;  5IWA Q;  3S1R H;  3NE5 B;  3S1M H;  5E3F A;  1VQG A;  3OTO Q;  3I8Z A;  1Q8K A;  3NEL A;  5ELC A;  4YWK A;  3TRE A;  3CPW A;  2UUC L;  5IGF A;  3I73 A;  2HCI A;  3HP3 A;  3RN5 A;  3S1R B;  1DD2 A;  3HOW G;  4FXD A;  3I91 A;  1RCV D;  1U4M A;  3Q8D A;  2O2L D;  2NBF A;  4A3I H;  4OL7 A;  2N8N A;  2FIN B;  4I7A A;  3T1H L;  4JW0 A;  4IFD G;  2YTV A;  1SNP A;  1HR0 L;  2EYH A;  2RQX A;  1BQQ T;  4A3I B;  4Y7N H;  4LF6 L;  4GKJ L;  3VR5 A;  4DR4 Q;  4S3S A;  5IP7 H;  1C4Q A;  1KXL A;  4XQJ A;  4ULL A;  4AQY L;  3G48 A;  4A3J H;  3OSO A;  4R4I A;  1QZG A;  4OEL B;  4G57 A;  1UE1 A;  4KD3 A;  1I3Q H;  1TWG H;  2YTY A;  3MVV A;  1PTO H;  3RD4 A;  5AJ3 Q;  4IO9 A;  4A3L G;  4ODG A;  1YNJ C;  2BOS A;  1X3F A;  1D7Q A;  3M4Q A;  1TWG B;  4FNF A;  1PTO B;  3F2U A;  4LF9 L;  3RZO B;  3SE0 A;  1ASZ A;  4FF2 A;  5IY0 A;  3AFP A;  2UXC Q;  1IBK L;  1NR4 A;  3KLR A;  5K36 H;  4DR5 Q;  1I6H H;  1SE4 A;  1OXS C;  2N3S A;  4B3M L;  1JWU D;  5EKI A;  3H3V H;  4A3C H;  4HIK A;  4DAP A;  1FNV A;  2VQE Q;  4NXM Q;  3ULP A;  1BVS A;  3D3R A;  3EIV A;  4QY7 A;  2EY2 A;  2A74 C;  2NYZ D;  3NWS A;  1B50 A;  4RKB A;  2VB2 X;  2F4I A;  1CSP A;  1LLR D;  3TME A;  2BA1 A;  3KDF B;  1BCP C;  4ME3 A;  3LGJ A;  4J6H A;  3F2D A;  4LF8 Q;  4OXP A;  3JC6 6;  1U5K A;  4GNX A;  1JIC A;  2K7V A;  1PYB A;  1K8M A;  2LS0 1;  4BA1 I;  5BN3 A;  2B39 A;  2F03 A;  2PZU A;  3KYH C;  3FMC A;  3VYR A;  1E2W A;  4LF7 L;  3LWE A;  4K6L A;  3Q22 A;  1IYV A;  1I4G A;  2B2T C;  4WJ4 A;  1VQA A;  5C3E B;  2X6L A;  2R93 G;  1IW7 C;  4JOI A;  3D4W A;  1KDB A;  1VMC A;  2ZJP A;  4RAU C;  4JI3 Q;  1FD7 D;  4ABN A;  2GVA A;  2KBN A;  1G6Z A;  4A4I A;  2JA5 B;  2KEC A;  3BDC A;  4KJO A;  5D14 A;  2QF7 A;  1EIH A;  2DY8 A;  2E5L L;  4QIW E;  5JPN C;  3D0F A;  3HOZ H;  5EPJ A;  3SEB A;  2HIV A;  2A8V A;  4LWC A;  1X54 A;  1OXT A;  3BDO A;  5IOC A;  2NVQ B;  2GVB A;  4A3E H;  2BE5 D;  4OWX B;  2EJF C;  1VF5 C;  2IPK D;  1KTK A;  2PNR C;  1LYL A;  4RGT A;  2CH4 A;  4DV5 Q;  1WVL A;  2B8F A;  4A93 H;  1PRT B;  1KAB A;  3MEF A;  5LL6 X;  1JOR A;  1NTG A;  3MXN A;  3R2T A;  3TZU A;  1Q1E A;  4DNR B;  1K8G A;  4XQN A;  5G3L D;  4O2D A;  3WOF A;  3PUY A;  3DHQ A;  1I4Q A;  4DXG A;  1RTN A;  3T1Y L;  1Y1W H;  1C0A A;  1GUG A;  2K32 A;  4BY7 B;  5DAU A;  2EYO A;  2NN6 G;  2VUM H;  5F2D A;  2PMZ E;  4K0K L;  4UP8 A;  2F0U A;  4IUQ A;  2SDF A;  2B2U C;  2R7Z G;  2JA8 G;  2E74 C;  1EL0 A;  1PHJ A;  1FGU A;  4JC0 A;  1I50 B;  4A3F G;  5ELB A;  1E3P A;  3PF5 A;  1I4P A;  2F0O A;  1H9K A;  4NDX A;  1WCM H;  4TQU S;  3GTO B;  3GTM H;  3J7Y W;  3TS2 A;  1STH A;  2HQL A;  1WYD A;  4P74 A;  2KHI A;  1B70 B;  4AYB E;  1LTT D;  4OO1 H;  1N9W A;  3GTM B;  1U4P A;  2F0T A;  4NKL A;  2XWJ B;  1CQV A;  4CJ1 B;  3HOY H;  1PRT F;  2F52 A;  1C9O A;  3K58 A;  1DM0 B;  4OON A;  5M3M G;  4DV7 L;  3KLS A;  2UUA Q;  3NK9 A;  5FLM H;  3HOV G;  2F0V A;  2WKD A;  1KL9 A;  4GLX A;  2JA6 B;  1ZYR D;  2ZXR A;  1FYC A;  2MGS A;  1GUO A;  3D6W A;  3CCV A;  2A69 C;  1UEB A;  4IUR A;  1BUV T;  4PZ6 A;  1A3V A;  1MJC A;  4AYB B;  2KVM A;  2JK8 A;  3QG1 A;  1B9N A;  2AQ1 B;  4X65 Q;  1Q1B A;  4X62 Q;  1XNQ Q;  3A8I E;  3I56 A;  2M2L A;  1LT6 D;  3TDQ A;  3K5L A;  1C48 A;  3WWV A;  5LMU L;  1V1O A;  2I5M X;  1SFO H;  2RF4 A;  1CTM A;  5D65 A;  5I2X A;  5IGD A;  5JEA H;  1GUN A;  5JJL A;  1YNN C;  1ROD A;  2IJ0 A;  1VMP A;  2AWN A;  2I46 A;  4LAA A;  5CV8 A;  3V96 A;  1BCP B;  5IP9 H;  2OTL A;  4X3U A;  1I94 Q;  1JJG A;  4KKU A;  3PUX A;  2BH2 A;  2KED A;  4HJ9 A;  1YHQ A;  1DGS A;  1NE3 A;  2BDN A;  3RR5 A;  2OCE A;  1UWV A;  4LFA Q;  2Z4I A;  2Z6B A;  4JI7 L;  4MTK A;  1CZW A;  2KA7 A;  1HQM C;  1ICW A;  3TP5 A;  1WD1 A;  3HEJ A;  5DM7 3;  2LFN A;  2G9H D;  1XYI A;  2OEO A;  2IHE A;  2VW9 A;  3TBI B;  4EQP A;  4HSV A;  1EYC A;  2Y0S G;  3BDL A;  5GAD C;  3GTJ B;  1SYE A;  1HR0 Q;  4FF4 A;  4C3H H;  2L5T A;  4LF6 Q;  5A35 A;  5KNB A;  3A5U A;  3M7G A;  4HIO A;  3KF8 B;  4XDX A;  2YV5 A;  1TWC H;  2EOT A;  2CKZ B;  1JJ2 A;  1G51 A;  1QNK A;  4FO2 A;  4N8F A;  1STB A;  1KNA A;  4LNQ A;  1EOT A;  1EU4 A;  5C0X I;  4K2K A;  2OWO A;  3NXW A;  3S14 H;  5LHY 1;  4POG A;  1VQK A;  3GV3 A;  2NN6 I;  5CV4 A;  1ZEQ X;  1FR3 A;  1BCP F;  1PDQ A;  1EZ6 A;  2PO4 A;  2FJ2 A;  2L4N A;  5C44 H;  1Q90 A;  1CKO A;  1U0L A;  4ME5 A;  1VS0 A;  4PMB A;  2O5I C;  2R7F A;  1D5Z C;  2KJX A;  4A75 A;  3EA6 A;  4H13 C;  2ZTD A;  3JAM E;  3C2P A;  1EU3 A;  4ID6 A;  3MC0 B;  2OF1 A;  3KUP A;  3H91 A;  2MPM A;  2EPB A;  3RNU A;  5CBE E;  1ZXT A;  3PO3 H;  3SXH A;  4IUT A;  1JWS D;  4XT3 B;  2B8G A;  4JI2 L;  4JPB W;  4K8I A;  1N36 L;  5EQ0 A;  3GTP H;  3OWE B;  1D6E C;  5IOD A;  2Z0S A;  2OTJ A;  3RLN A;  1W2B A;  1RDP D;  2K5D A;  1VQ6 A;  3P1H A;  3CCM A;  2AUK A;  1TS4 A;  2L9H A;  2ZT9 C;  3NQT A;  2JEB I;  4O42 A;  3J81 c;  4DGZ A;  2HHH Q;  1T5X D;  3UE1 A;  2ZXO A;  3I90 A;  2J7Z A;  5TSS A;  2V4D A;  3M4O B;  3RN2 A;  4UPA A;  4DAY A;  4A3G H;  4HJ5 A;  2R92 H;  5IGG A;  3J80 c;  2JA7 G;  1SXT A;  1HTP A;  4IFD J;  1SSO A;  4LFC Q;  1JOO A;  3S2H B;  3DEP A;  3CC4 A;  2Z6K C;  5DEH A;  3S2D B;  3Q0A A;  4KN4 C;  5T1G A;  3S1Q B;  3CC2 A;  4Y52 H;  2MO1 A;  1MHW C;  2JP1 A;  2XRQ D;  3I7F A;  5KND A;  1EY5 A;  4F8M A;  1EY9 A;  3FP9 A;  1EZ8 A;  1YJW A;  1QUQ A;  4XQQ A;  4HMI A;  1D5X C;  1GXD C;  2XGT A;  2WP8 J;  4G7H C;  4A3K G;  3G71 A;  2B63 H;  4RHR A;  1WTP A;  1VQI A;  3QO2 A;  4NXN L;  1YNX A;  1CKN B;  1HA5 A;  2B2V A;  1VQ4 A;  3J81 L;  1Z6H A;  3PUZ A;  2MHV A;  3WDN A;  1AZQ A;  4R4O A;  2ICE C;  1VQE A;  2AKW B;  1VF7 A;  1QIL A;  3J80 L;  3HOX H;  1IHZ A;  3L2P A;  3W1G A;  1B4O A;  3H94 A;  3T1Y Q;  5C0X H;  3IKJ A;  4JI6 Q;  2RSN A;  4JYA L;  2KHJ A;  2K14 A;  5EGT A;  2AHO B;  5M5W H;  2WAQ G;  3BYT B;  3OWF A;  2GN5 A;  4A3B H;  5KYI A;  5KYL A;  4KV6 A;  2ICI A;  3O13 A;  1Y1V H;  4B08 A;  4LUZ A;  1BF4 A;  1LV9 A;  3OMG A;  3OIQ A;  3NPP A;  4A3B B;  2FXQ A;  1E22 A;  2DGY A;  2R7Z B;  3PUV A;  5M3F H;  2JA8 B;  1Q82 C;  2M9V A;  2E2I H;  4A3F B;  3H0G G;  3ONA B;  5J39 A;  3J81 i;  1Z47 A;  2K75 A;  1O80 A;  2R3Z A;  1UE7 A;  5FO9 B;  2NVY H;  1KRT A;  2JE6 I;  2MP1 A;  2E2I B;  1LT3 D;  1K3B C;  2DNC A;  3CXC A;  4JBJ A;  3J80 i;  1HNW Q;  4HED A;  3KLS X;  2VQF L;  2QDB A;  2NVY B;  3GDE A;  4A3M G;  5I6Y A;  3KBG A;  1PYW D;  1X65 A;  4K5V A;  2PZW A;  2L15 A;  5M3M B;  4KHP Q;  1AP0 A;  2JA9 A;  3HOV B;  1S40 A;  2Z1C A;  5FJ8 G;  1TWA H;  1YEZ A;  4LF4 L;  3P7J A;  4BY1 G;  4KLK A;  1V1P B;  5JVH 3;  1KDA A;  2ZJQ A;  4QCL A;  2ZTC A;  3KLW A;  5CMD A;  1TXY A;  2ZM6 L;  3STB D;  4JCV E;  4DR6 L;  1TS5 A;  1STE A;  1KNE A;  4GOP C;  2D0O A;  1I4H A;  2PW7 A;  1C8C A;  4TRD A;  5CV9 A;  4CKB A;  1NUC A;  2CH4 W;  4JI0 Q;  3AB9 A;  3TP6 A;  1SJH D;  1Y14 B;  2K50 A;  2E75 C;  4DR2 Q;  3I4M H;  1F2Y A;  3CRK C;  2D9U A;  3T53 B;  3KBX A;  2A68 D;  4C3I B;  5IYD G;  2VL6 A;  4N9P A;  4X6A H;  4DV0 L;  3BS1 A;  1PVO A;  1AE3 A;  4WJW A;  1S3O A;  1AZP A;  1SDF A;  1QUQ B;  2YU9 B;  1MBY A;  1VQB A;  3UI2 A;  1NY4 A;  3BYY B;  3FRP B;  1WD0 A;  1QVG A;  4PZ7 A;  2XVS A;  4JBK A;  5C4X H;  4U67 3;  2B2Y C;  1GUW A;  5JJK A;  3BZD B;  2Y0S B;  1LAB A;  2KCM A;  4I7Z C;  5C4X B;  2N88 A;  3RLF A;  3CME A;  4YCU A;  1N32 L;  1PRT C;  4B3T Q;  4HJ8 A;  1SYF A;  2GA4 B;  5JAV A;  3VR2 A;  1H9J A;  4I65 A;  1FJG Q;  1A3U A;  5FLX c;  1JWM D;  2PQA B;  2HDM A;  4ZK9 B;  1K83 H;  2K04 A;  4WOR A;  2NVX B;  1SYD A;  2F0J A;  2KCT A;  2JXM B;  1XMO L;  1CA5 A; 
#chains in the Genus database with same CATH homology
 4OWX B;  4KHZ A;  5C4X G;  4DV5 Q;  1LYL A;  4A3F H;  2IX0 A;  3AQQ A;  2D62 A;  1L0W A;  4IPG A;  4A93 H;  4BBR G;  3MEF A;  1X56 A;  1NTG A;  3PUW A;  3AEV A;  2ZJR A;  4JI3 L;  1Q1E A;  1K8G A;  1E24 A;  1HZC A;  4QGU A;  1HH2 P;  1HNX Q;  4B3T L;  1X6O A;  4O2D A;  1J6Q A;  3PUY A;  3GTQ H;  2WB1 E;  3EN2 A;  4EX5 A;  4DR7 L;  3T1Y L;  1FJG L;  1Q7Y C;  1Y1W H;  3OW2 A;  4DV3 Q;  1C0A A;  1HR0 W;  1AH9 A;  4OWW B;  4DUZ L;  1HNZ Q;  2NN6 G;  2VUM H;  5DLQ E;  4DPG A;  2PMZ E;  4K0K L;  5M3M H;  4UP8 A;  1KC8 C;  3HOZ G;  4RG1 A;  5IYC H;  3I2Z A;  1GVP A;  3HOV H;  3D31 A;  4DV7 Q;  1YJN A;  3E9H A;  4WJ3 M;  2R7Z G;  4A3E G;  2V1C C;  4DV5 L;  2WFW A;  3RZO H;  2JA8 G;  1PHJ A;  1FGU A;  2H5X A;  4JC0 A;  3KJO A;  1Q86 C;  3FHW A;  4A3F G;  4GS3 A;  1E3P A;  3PF5 A;  1VQO A;  4A93 G;  3F8T A;  2PI2 A;  1WCM H;  1B8A A;  3K8A A;  4TQU S;  3JAM i;  1SE8 A;  3GTM H;  1HNX L;  2LXK A;  3S16 H;  3TS2 A;  1EIY B;  2VNU D;  1IL2 A;  4P75 A;  2HQL A;  1WYD A;  1YIT A;  4P74 A;  2QEX A;  2KHI A;  1B70 B;  1V1Q A;  4P72 A;  4AYB E;  4MNO A;  3J81 j;  3PCO B;  1RL2 A;  4DK3 C;  2K4K A;  5IE8 A;  4DV3 L;  1XMQ L;  3ICE A;  1N9W A;  1L1O B;  3CF5 A;  1Y1W G;  3CCR A;  1HNZ L;  1Q12 A;  1PA6 A;  3S15 H;  4LF5 Q;  1PH3 A;  3HOY H;  2C35 B;  1NJI C;  1L2F A;  2F52 A;  4GN3 B;  2D0P A;  1C9O A;  4YCV A;  5LMU Q;  2VUM G;  4OON A;  1WJJ A;  2B29 A;  4JBW A;  3K80 C;  4XTC S;  5M3M G;  4DAY B;  4DV7 L;  4DV4 Q;  5IYC G;  1O7I A;  2UUA Q;  2MFI A;  5FLM H;  1ASY A;  2UU9 Q;  1FL0 A;  1YJ9 A;  3HOV G;  4J15 A;  4C3I H;  1KL9 A;  2WB1 G;  4GLX A;  1T9H A;  3B6Y A;  4YY3 L;  3CCJ A;  1PH9 A;  3CCV A;  2HT1 A;  1EUJ A;  1UEB A;  1YVC A;  4YWL A;  4DNI A;  1X3G A;  1OXU A;  1WCM G;  4PZ6 A;  4DK6 C;  2Y0S E;  4LUV A;  1MJC A;  3S1N H;  2YU9 H;  3CD6 A;  5GAH C;  2UXC L;  2JK8 A;  3U4V A;  1A8V A;  1NMG A;  2F4V Q;  4X66 Q;  4DR5 L;  4X65 Q;  1SMX A;  1Q1B A;  4JI1 Q;  4L5S A;  4X62 Q;  1XNQ Q;  3I56 A;  3NEM A;  4GLV B;  4DKA C;  4OO1 G;  4JI7 Q;  1SRU A;  4LF5 L;  2EIF A;  1XPO A;  3H3V I;  2NZO A;  4GOP B;  1FVI A;  4UP7 A;  1M1K C;  2UXB L;  3WWV A;  5LMU L;  2I5M X;  1C7Y A;  1D8L A;  1VQL A;  3HOY G;  4JI5 L;  1SFO H;  4A3D H;  4JOI C;  4DV4 L;  5ELN A;  1WI5 A;  1PH4 A;  4LW1 A;  2RF4 A;  3KDF A;  5E7N A;  2LXJ A;  5C3E H;  4DR1 Q;  2UU9 L;  4IJH A;  1IBM Q;  1BKB A;  3TEH B;  5JJL A;  5FLM G;  1VQF A;  4O0A A;  1EWI A;  5LMN Q;  1XMO L;  1N33 Q;  2XTI A;  3CCU A;  1R9T H;  4B3S L;  2DUD A;  2AWN A;  3G6E A;  4AYB G;  1BBU A;  2Z6K A;  5IP9 H;  2OTL A;  1SR3 A;  1P16 A;  1TWF H;  1VQ9 A;  3DM3 A;  2BH8 A;  3CP0 A;  1I94 Q;  4QQB X;  4R4C A;  2KEN A;  1JJG A;  4LFB Q;  2EQS A;  4UP9 A;  2IHF A;  3PUX A;  2JA5 H;  4X64 Q;  2BH2 A;  2F4V L;  3CQZ H;  1SRO A;  4X66 L;  4X65 L;  1DGS A;  4HJ9 A;  1NE3 A;  1YHQ A;  3CCQ A;  1EQQ A;  3RR5 A;  2CWA A;  4X62 L;  1XNQ L;  4DUY L;  4BA2 I;  2OCE A;  1UWV A;  4LFA Q;  4JI7 L;  2AMC B;  1VQ7 A;  1XTD A;  4PMW A;  1VQH A;  3ULL A;  2NVQ H;  3K81 C;  4AH6 A;  2NVX H;  1XNR Q;  3W1B A;  3UDF A;  4DV2 Q;  4LUO A;  2IHE A;  4HJ7 A;  4XIG S;  2VW9 A;  4R4Q A;  4DR1 L;  4L5R C;  2IY5 B;  1NMF A;  1IBM L;  2OQ0 A;  5C3E G;  1EFW A;  1N33 L;  2Y0S G;  5GAD C;  4R1J A;  5JEA G;  1HR0 Q;  4IFD I;  4C3H H;  4LF6 Q;  3A5U A;  1VQ8 A;  4C2M H;  1I94 L;  2AWO A;  4YCW A;  2UUB Q;  5IP9 G;  4HIO A;  3KF8 B;  4LFB L;  2PQA A;  2YV5 A;  1H95 A;  1TWC H;  2CKZ B;  1PH1 A;  4DV1 L;  3RLO A;  2JA5 G;  1JJ2 A;  2F3I A;  1G51 A;  3BJU A;  3K0X A;  3CCE A;  4IPC A;  4LFA L;  1IZ6 A;  3FKI H;  4BY7 H;  4MZ9 A;  4LNQ A;  1XPU A;  3HOU H;  4R4T A;  4JI4 Q;  3PV0 A;  1EYG A;  2ES2 A;  5C0X I;  2CQO A;  2OWO A;  3S14 H;  4POG A;  1VQK A;  1XNR L;  4APV A;  2NN6 I;  1QVC A;  3ZJY C;  4H02 A;  4DV2 L;  2E2J H;  2MO0 A;  1QVF A;  4JG2 A;  4JI2 Q;  3OYY A;  3CAM A;  3GTL H;  2BA0 A;  3L7Z C;  1N36 Q;  1V43 A;  5C44 H;  1I50 H;  2N49 A;  3U58 A;  1N8R C;  3CCL A;  1JB7 A;  3E9I A;  5BR8 Q;  1CKO A;  1U0L A;  4GLA C;  1VS0 A;  3HFZ B;  2E8G A;  4IPD A;  3RZD H;  4GKK Q;  1NBW A;  1UE5 A;  1YIJ A;  4P73 A;  3GTO H;  1GKH A;  2UUB L;  2R7F A;  1G6P A;  4GN5 A;  1VQM A;  1EIF A;  1EQR A;  4A75 A;  4B3R Q;  2ZTD A;  3U50 C;  1VQD A;  3HKS A;  1HZB A;  5IYB H;  2QA4 A;  5H1S E;  5GAG C;  3SGI A;  5M5X H;  1X3E A;  4DR3 Q;  3GTG H;  4PZ8 A;  3A74 A;  3UDX A;  2ZM6 Q;  1BBW A;  3FKI G;  2I0Q A;  2CCZ A;  2JA7 H;  4BY7 G;  3HOU G;  2VS1 A;  4JI8 Q;  3RNU A;  1N34 Q;  1HJP A;  5C4J H;  3PO3 H;  1IBL Q;  2MNA A;  4NPS A;  4L5T A;  3UE0 A;  3U4Z A;  1UE6 A;  1J5E Q;  4JI2 L;  3PF4 A;  1N36 L;  1XPR A;  3AFQ A;  3GTP H;  5BR8 L;  2LSS A;  3HKZ G;  5C44 G;  4DAM A;  2JA6 H;  4JV5 Q;  2Z0S A;  2OTJ A;  1PH6 A;  3RLN A;  1W2B A;  1VQ6 A;  3IRB A;  1QZH A;  2OQK A;  2YTX A;  3CCM A;  3S24 A;  3UDI A;  1L1O A;  2JEB I;  2RCN A;  3J81 c;  2HHH Q;  1GD7 A;  1JJC B;  5GQO A;  3UE1 A;  4GNX C;  1XJV A;  4HID A;  5J3B A;  1YI2 A;  4DR3 L;  2ASB A;  5IYB G;  3PIO A;  1MKH A;  2K5N A;  3RN2 A;  4UPA A;  2Q2H A;  4A3G H;  3I55 A;  2IX1 A;  4MTN A;  4HJ5 A;  1VCI A;  4JI8 L;  2R92 H;  4A3K H;  1N34 L;  1TWH H;  1K3R A;  2HIX A;  3J80 c;  4DV6 Q;  3CW2 C;  1IBL L;  2JA7 G;  4OO1 I;  2YYZ A;  2MQH A;  4IFD J;  4LFC Q;  1PFS A;  1J5E L;  2VZA A;  3PO3 G;  3VDY A;  3CC4 A;  2Z6K C;  4C3J H;  2K5V A;  3F2C A;  2UXD Q;  1CSQ A;  1KAW A;  3CC2 A;  4Y52 H;  1PH5 A;  4JV5 L;  4NXN Q;  1JMC A;  2MO1 A;  5EAY A;  4GNX B;  2UUA L;  2JA6 G;  3A5Z B;  3EBE A;  3I7F A;  2WAQ E;  4A76 A;  1RIP A;  1KQS A;  4UY8 C;  3PO2 H;  4BBS H;  4NB3 A;  2R6G A;  3FP9 A;  3J7A 5;  4P71 A;  2HHH L;  5C0X J;  3DLL A;  1YJW A;  1QUQ A;  4JBM A;  2N78 A;  3M9B A;  4GOP A;  1HZ9 A;  1YBY A;  2A1A A;  3E0E A;  1IYJ B;  1KD1 C;  1PH8 A;  1WOC A;  3I4N H;  4OX9 Q;  3BZK A;  1E1T A;  1LM0 A;  1P8L A;  3NBH B;  4A3G G;  4DV6 L;  1LTL A;  1Q46 A;  2WP8 J;  2XGT A;  4JI1 L;  3M85 A;  1VQP A;  2R92 G;  4BXX H;  4A3K G;  4LFC L;  3L0O A;  3CCS A;  1V9P A;  1YZ6 A;  3ER0 A;  2UUC Q;  4A3D G;  3HOW H;  2PNH A;  4JYA Q;  3K7A H;  1PV4 A;  3G71 A;  1Q81 C;  1B7Y B;  4YHH Q;  1JT8 A;  2B63 H;  2UXD L;  3GTJ H;  1W3S A;  1VQI A;  1E1O A;  1MIU A;  4NXN L;  1OTC A;  3GTK H;  1YNX A;  1CKN B;  2R7D A;  1VQ4 A;  1XMO Q;  3T1H Q;  1A63 A;  2ALY B;  3PUZ A;  3KF6 B;  3AYH B;  1VQC A;  3GO5 A;  1GO3 E;  5LMN L;  4R4O A;  1CUK A;  3W5O A;  3G4S A;  3PO2 G;  4BBS G;  1VQE A;  2K52 A;  4FDB A;  2JQO A;  3M3Y H;  1LUZ A;  4GKJ Q;  1OXX K;  2IT1 A;  2AKW B;  3H0G H;  5HY6 A;  1SN8 A;  3HOX H;  5IWA Q;  1A0I A;  1EOV A;  3S1R H;  3S1M H;  3HKZ E;  1VQG A;  4OX9 L;  4OWT B;  4X64 L;  1Z9F A;  3OTO Q;  3L2P A;  3W1G A;  3I4N G;  1Q8K A;  4POF A;  3NEL A;  4YWK A;  3T1Y Q;  1KHI A;  3TRE A;  3CPW A;  1I5F A;  4AQY Q;  2UUC L;  3TQY A;  4JI6 Q;  4BXX G;  4JYA L;  2KHJ A;  2K14 A;  1AE2 A;  1K9M C;  2AHO B;  3RN5 A;  3HOW G;  5M5W H;  2WAQ G;  3MXN B;  1VQJ A;  2GN5 A;  2PI2 E;  4PG3 A;  3STB C;  3Q8D A;  4A3B H;  4A3M H;  5GAE C;  2B63 G;  2EXD A;  4HJA A;  1S72 A;  3H15 A;  4A3I H;  4A3L H;  2VQF Q;  2N8N A;  3T1H L;  1KIX A;  2ID0 A;  4IFD G;  1CKM A;  2YTV A;  1K73 C;  1Y1V H;  1YHB A;  2B3G A;  4LUZ A;  2Q2U A;  1HR0 L;  4GN4 B;  2FXQ A;  1E22 A;  2DGY A;  5FJ8 H;  3PUV A;  4Y7N H;  5M3F H;  4LF6 L;  4GKJ L;  1Q82 C;  4DR4 Q;  2A19 A;  3ULJ A;  5IP7 H;  4LF9 Q;  4AIM A;  5IWA L;  1YHA A;  2E2I H;  4BY1 H;  4LF4 Q;  1KXL A;  3H0G G;  4IOC A;  3M4P A;  3OTO L;  3HOX G;  3PSI A;  3J81 i;  1Z47 A;  2K75 A;  1IBK Q;  4QL5 A;  4AQY L;  2QGQ A;  4JI6 L;  1UE7 A;  3G48 A;  2NVY H;  4A3J H;  1XMQ Q;  5C0X G;  1KRT A;  2JE6 I;  1A62 A;  2CWP A;  4JI4 L;  2ATW A;  4B3M Q;  4R4I A;  3PIP A;  3CXC A;  1QZG A;  4JBJ A;  3J80 i;  1UE1 A;  4DR6 Q;  1L1O C;  1HNW Q;  2VQF L;  1I3Q H;  3TRZ A;  1TWG H;  2YTY A;  3GDE A;  3ERS X;  5AJ3 Q;  4IO9 A;  4A3M G;  4A3B G;  4A3L G;  4A3I G;  3K7U C;  3BZC A;  3PGZ A;  1X65 A;  1X3F A;  3F2B A;  4KHP Q;  2L15 A;  1M90 C;  5JJI A;  2JA9 A;  1Y1V G;  2E2H H;  1D7Q A;  4GKK L;  3M4Q A;  1S40 A;  4YY3 Q;  4DR4 L;  5FJ8 G;  4LF9 L;  3I4O A;  5M3F G;  1TWA H;  1YEZ A;  3M4O H;  5IYD H;  4LF4 L;  4B3R L;  3CPF A;  5IP7 G;  1ASZ A;  3UDG A;  5IY0 A;  3AFP A;  4KLK A;  4BY1 G;  2UXC Q;  1IBK L;  1MJE A;  4DV0 Q;  2RHQ B;  4DR5 Q;  2NZH A;  1K8A C;  2ZJQ A;  1I6H H;  1OXS C;  2ZTC A;  3KLW A;  3S2H H;  1TXY A;  2N3S A;  2ZM6 L;  4A3J G;  2UXB Q;  2CFM A;  4B3M L;  3STB D;  5JEA J;  4JCV E;  3S2D H;  3S1Q H;  1OXV A;  3H3V H;  4A3C H;  2VY3 A;  4DR6 L;  1HNW L;  4HIK A;  4IPH A;  4JI5 Q;  1JE5 A;  5AJ3 L;  1IXR A;  1GM5 A;  2Q2T A;  5IT9 c;  1X9N A;  1PH2 A;  4GOP C;  2VQE Q;  2D0O A;  4NXM Q;  5M5Y H;  1BVS A;  3ULP A;  4LF7 Q;  4JI0 Q;  3M7N A;  4KHP L;  3EIV A;  1VQN A;  2RHS B;  4QY7 A;  4B3S Q;  1Y14 B;  2K5H A;  2K50 A;  1HZA A;  2JEA I;  3GD7 A;  4EQ5 A;  3JAM c;  3J7Z C;  4DR2 Q;  2R93 H;  1CSP A;  3I4M H;  2Q2I A;  3KFU A;  1WFQ A;  5IYD G;  1KRS A;  2BA1 A;  2VL6 A;  3KDF B;  4HIM A;  4DV0 L;  4ALP A;  4X6A H;  4ME3 A;  3LGJ A;  2JJQ A;  1PVO A;  1AE3 A;  3F2D A;  2ZTE A;  1S3O A;  1K0R A;  1X55 A;  4DUY Q;  5K36 G;  4LF8 Q;  4OXP A;  3JC6 6;  3CMA A;  4IOA A;  1N32 Q;  1E7Z A;  1U5K A;  4GNX A;  1QUQ B;  1PYB A;  1VQB A;  4BA1 I;  4A3C G;  3F1Z A;  1NY4 A;  3KYH C;  2E5L Q;  3A0J A;  2VQE L;  1QVG A;  4QJF A;  4PZ7 A;  4IJL A;  4NXM L;  4LF7 L;  4JI0 L;  3KJP A;  1SLJ A;  4JBK A;  5GRO A;  5C4X H;  4WJ4 A;  2I5H A;  1VQA A;  4DR2 L;  5JJK A;  4BBR H;  1PYS B;  2R93 G;  3I4M G;  4JOI A;  2KCM A;  2ZJP A;  4DV1 Q;  3NEN A;  3KOJ A;  4JI3 Q;  5ELO A;  3RLF A;  3CME A;  2GVA A;  4LF8 L;  3CC7 A;  4TVA B;  2KBN A;  4YCU A;  4YWM A;  1N32 L;  3TS0 A;  4B3T Q;  1CKN A;  4HJ8 A;  2I5L X;  4A4I A;  3KF6 A;  4DR7 Q;  1FJG Q;  1PH7 A;  5FLX c;  3BU2 A;  5LMN W;  2PQA B;  2E5L L;  4QIW E;  1VQ5 A;  3D0F A;  4YHH L;  4DUZ Q;  3HOZ H;  1K83 H;  2HIV A;  3S17 H;  2A8V A;  4K0K Q;  1G29 1;  1X54 A;  1OXT A;  4LWC A;  4KI0 A;  5HGQ A;  2GVB A;  2NVT H;  2R7Z H;  4A3E H;  2KCT A;  4RMF A;  4L5Q A;  2JA8 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...