4LW1A

Fragment-based discovery of a potent inhibitor of replication protein a protein-protein interactions
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
123
structure length
123
Chain Sequence
b'GSHMVGQLSRGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGNPVPYNE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Replication protein A 70 kDa DNA-binding subunit
publication title Discovery of a potent inhibitor of replication protein a protein-protein interactions using a fragment-linking approach.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/inhibitor
total genus 31
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2013-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04057 Rep-A_N Replication factor-A protein 1, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4lw1A00
3G6EA 1OXTA 3A5UA 2Q2UA 2K75A 1Q82C 4RMFA 1VQIA 2UU9Q 3KYHC 4K0KQ 4LFBQ 1IXRA 2PI2E 5LMUQ 4GKKQ 1Y1WH 1YBYA 2E2HH 4OWTB 1UE6A 2IHFA 4OXPA 3BZKA 1G51A 1KHIA 3CCMA 2RHQB 1LUZA 4X66Q 3S24A 1X3GA 2VW9A 1GM5A 3I2ZA 1EOVA 3S2DH 1EIFA 5LMNW 2YTYA 4KLKA 3W5OA 4YHHL 4A3IH 4BA2I 4DR7L 5IP7G 2IY5B 3FHWA 4A3JG 1VQDA 4JI0Q 1WOCA 1OXSC 2JK8A 2VY3A 3HOWH 1I94L 1PH9A 3T1HL 2E8GA 4JI6Q 1A62A 4DUYQ 3NELA 4DV6Q 2PQAA 3G4SA 1K73C 1VS0A 2HIVA 1VQJA 1XNQL 3S1MH 1E1OA 3K7AH 4AQYQ 3ULPA 3HOYG 3F1ZA 1Q7YC 3PO2H 2LSSA 4LFBL 1NMFA 3M7NA 1CKNB 4GKKL 5LMUL 3BZCA 3VDYA 4PZ7A 4YCVA 4A3EG 1VQOA 3TS0A 1YITA 1VQ7A 1YVCA 4X6AH 1NBWA 3G71A 1Q86C 4DAMA 5HY6A 4LUOA 2ZJQA 3GD7A 4GKJQ 2UUBQ 2EXDA 4GN5A 4X66L 4MZ9A 4DV1L 1FJGQ 1VQNA 4DKAC 4BY7H 3CCJA 1S40A 4LF6Q 3AFQA 4NXML 3S17H 1Q8KA 4IPGA 4WJ3M 5IWAQ 4NB3A 2EQSA 2QEXA 4P74A 5LMNL 4X62Q 2FXQA 3FKIH 4DV2Q 4JI0L 2VUMG 1XPUA 1T9HA 1QVFA 2JQOA 4LFAL 1U0LA 4A75A 5GADC 1JJCB 3J80c 4JI6L 2IX0A 1XMOQ 4LNQA 4GLAC 1E22A 2WB1E 5M5YH 3HOXG 3E9HA 3D31A 4DV6L 1WCMH 1SROA 4H02A 2CWPA 4OONA 4JG2A 1N32Q 3J7A5 1VQHA 3KOJA 3PUYA 1VQPA 1WJJA 1A0IA 1IZ6A 1UE1A 1OXVA 4XIGS 4A3MG 3M3YH 1HZCA 4DAYB 4GKJL 2VL6A 1E1TA 4RG1A 1KIXA 1SE8A 1JT8A 4NPSA 1FJGL 4GNXA 3PO3G 2F52A 4LF6L 2R93G 2B63H 2HT1A 5IWAL 1PH8A 1YJWA 3PCOB 1A63A 1I5FA 3BU2A 3KF8B 4X62L 4DV2L 2JEBI 1N33L 1NTGA 4UP9A 5BR8L 3KDFB 4A3DG 2A19A 2OTJA 1JE5A 1LM0A 1SN8A 5IYBH 1Q46A 1XMOL 1HR0W 2D62A 4LF8Q 1I6HH 2R6GA 1B8AA 2AWNA 1TXYA 4DV0Q 1HR0Q 5M3MG 2YU9H 2N8NA 1LTLA 1PH1A 3JAMc 3K81C 1VQ6A 4P71A 2K5HA 5ELNA 3OW2A 1IL2A 5IYDH 3GTOH 2YTXA 4BBSH 1SRUA 1VQFA 1TWAH 2RHSB 3J81c 3OYYA 3JC66 2JJQA 3CAMA 3HOVH 3I7FA 3I4MH 3S1NH 2E5LQ 1WYDA 4ALPA 1FL0A 2CWAA 2XTIA 1K9MC 3HFZB 1BBWA 1E3PA 3EBEA 2BA0A 5C3EH 2D0OA 5FLMH 3S14H 3PUXA 1N9WA 2I5LX 1X6OA 3L0OA 4IPCA 4L5TA 2ID0A 1QUQB 1Q12A 1RIPA 5FJ8G 4DR7Q 4IFDI 2YYZA 4L5RC 4DV4Q 3J7ZC 3E0EA 1HZAA 4R1JA 1D8LA 1GD7A 1TWFH 4KI0A 3TEHB 1X3FA 2MQHA 3M9BA 3GTJH 4GLXA 3J81j 4L5SA 1JJ2A 1I94Q 4DR4Q 4LF8L 2MO0A 3A0JA 3F8TA 1JB7A 3SGIA 2K5VA 2JA8G 5H1SE 2AKWB 3U4ZA 4DV0L 1HR0L 1PVOA 4B3MQ 1K83H 1TWHH 1TWCH 3UE1A 4BY1H 4JBKA 2JE6I 4PZ6A 3RZDH 2ZTEA 4KHPQ 2VS1A 3CQZH 4JI5Q 3AQQA 1W2BA 3H3VI 3I4NH 3K80C 1Y1VG 4O2DA 1VQ5A 1U5KA 1K8AC 2UUCQ 1PYSB 4R4CA 4IFDG 2UXBL 3PV0A 4DK6C 5HGQA 4WJ4A 3MXNB 4A3KG 3UDFA 1YI2A 4GS3A 4QJFA 3GTKH 4DR1Q 2R7DA 3DM3A 1YJNA 1MIUA 2E5LL 1J6QA 3KFUA 2EIFA 1YNXA 3J80i 4HJ7A 3GTMH 2HQLA 3KF6A 3T1YQ 5IP9G 4DV1Q 3K8AA 4DPGA 3CCQA 4UP8A 1IBKL 4NXMQ 3M4PA 2AWOA 4Y7NH 2RCNA 2YTVA 1M1KC 4A3LH 1MJCA 1UE7A 2OCEA 1PH7A 2K5NA 4DV4L 2MO1A 3CCUA 4JBMA 3RLNA 2CQOA 4BXXG 5LMNQ 3CPWA 5C4XH 1VQMA 4NXNL 3AFPA 5GAHC 4A3BG 4DR4L 1KD1C 4LFAQ 4MNOA 3EIVA 3G48A 4EQ5A 4JI3Q 4A3CH 4JCVE 1VQKA 2OTLA 4KHZA 1PA6A 4B3ML 4J15A 2R92H 4KHPL 4YCWA 1MJEA 1KQSA 2PNHA 4IOCA 2JA6G 4JI5L 2JA5G 3UE0A 4BBRG 3NBHB 3U50C 4ME3A 2NZOA 2UUCL 5EAYA 3HOZG 1Q1EA 2DGYA 3CCVA 3RNUA 4DR1L 3CF5A 2AMCB 3F2CA 2HHHQ 3RZOH 1VQ4A 3KJOA 3T1YL 4R4OA 4GNXC 2Y0SE 4MTNA 1NJIC 3H15A 3IRBA 1PH5A 1HH2P 3STBC 3JAMi 2OWOA 4LF4Q 2UXDQ 1D7QA 3CP0A 1OXUA 1GVPA 1BVSA 5IP7H 2N3SA 3PF4A 4A3JH 1N33Q 2N49A 1OXXK 3S15H 5BR8Q 5GQOA 1HZBA 2WAQE 4JI3L 3J81i 4DK3C 3FP9A 4DR3Q 4A3FG 2UUAQ 1VQ8A 1HJPA 3CCRA 4HIOA 2MFIA 3GDEA 3PUVA 4LF9Q 1CKMA 2Z0SA 1GKHA 2CKZB 4HJAA 1CKNA 2ES2A 3CCEA 2I5MX 3CC4A 4IJHA 4LFCQ 5M3FG 3HOYH 3ER0A 1PH6A 1PH2A 2OQKA 4R4TA 1CUKA 3F2BA 5JJLA 4JOIA 2R7FA 3OTOQ 4YWKA 4A3EH 3CD6A 1GO3E 4P75A 2LXJA 2JEAI 5C0XI 2DUDA 1QVGA 2L15A 2Y0SG 3L7ZC 4JI2Q 4IOAA 5M5XH 2HHHL 4GN3B 1Y14B 1Z47A 1KC8C 4DUZQ 2ZJRA 4IPHA 4UY8C 4LF4L 2UXDL 3PF5A 4AIMA 2VUMH 1B70B 2WB1G 1B7YB 1HNZQ 2R7ZH 3CCLA 1P16A 3RLFA 1L0WA 1QZHA 4DR3L 4LF9L 2UUAL 1X3EA 5C0XG 2K4KA 2AHOB 1EQRA 3MEFA 3CPFA 4LFCL 2QGQA 4JV5Q 4P72A 2WP8J 2WFWA 1UE5A 3CMAA 2ZJPA 1N36Q 4LUVA 4LF7L 3HKZE 4APVA 3L2PA 4GOPB 1K3RA 2ASBA 2H5XA 2NVYH 1L1OB 3OTOL 1SMXA 2UXBQ 1EYGA 1G6PA 3CMEA 4OX9Q 2VQEL 2I5HA 1N34Q 4JI2L 3E9IA 4DR6Q 4A3MH 3H0GG 1YEZA 5IYCG 2VQFQ 3EN2A 2KHIA 3I4OA 2KCMA 5GROA 4AH6A 5C44G 2JA7G 4DUZL 1HZ9A 3PO3H 2R93H 4A93H 2IT1A 3KDFA 1IBKQ 2MNAA 4DR5Q 1PV4A 1VQBA 3HOUG 4A3GG 4JI8L 4DV7Q 3AEVA 1YHQA 4DV3Q 1HNWQ 1HNZL 1ASYA 4LF5Q 2ZM6Q 4A3DH 2YV5A 1X56A 3ZJYC 3F2DA 1VQCA 2JA9A 4YWLA 3A5ZB 3HKZG 4X65Q 4A76A 4JI7Q 4JV5L 1V1QA 1Y1WG 1TWGH 2F4VL 5M3MH 1N36L 4GLVB 5DLQE 1WI5A 1XPOA 4TQUS 3KLWA 2NVXH 1V43A 1E24A 3RLOA 2NVTH 4B3TQ 1HNXQ 4OX9L 4HIDA 3I55A 1KRSA 1N34L 4A3IG 4B3SQ 4DR6L 2NZHA 1YZ6A 3STBD 2IX1A 3KF6B 2VQFL 4HJ8A 1VQLA 1VQGA 1QUQA 2BA1A 4OWXB 1XPRA 2ZTDA 4P73A 3HOWG 4OO1I 4JC0A 2K50A 1VQEA 2K14A 1KRTA 2R7ZG 4DR5L 3BJUA 3W1BA 1Z9FA 4BA1I 5FJ8H 4DV7L 1MKHA 1Q1BA 4QL5A 4DV3L 1SFOH 1HNWL 4QGUA 4LF5L 2ZM6L 3PO2G 4JYAL 4R4QA 1C7YA 2CCZA 2KENA 2K52A 2CFMA 1K0RA 4YY3Q 2PQAB 1JJGA 3GTPH 4QIWE 4X65L 4JI7L 3PIOA 2JA8H 4IFDJ 3ULLA 4LW1A 1QVCA 5IT9c 4NXNQ 1EWIA 3GO5A 3GTGH 3CCSA 2A8VA 2E2IH 4OO1G 1NMGA 3PUWA 1KL9A 1S72A 1KXLA 1Y1VH 2PMZE 4B3TL 1HNXL 4JI1Q 4BY7G 4JOIC 4PG3A 4C2MH 4A3KH 4B3SL 1AE3A 3ERSX 1PH4A 3FKIG 3KJPA 3NEMA 1XNQQ 4IPDA 5IP9H 1YJ9A 1EQQA 4A4IA 1NE3A 5IE8A 5J3BA 4Y52H 1XNRQ 3Q8DA 4C3HH 2RF4A 1X9NA 2E2JH 3PUZA 1WCMG 4BXXH 1PFSA 1L2FA 4YCUA 1WFQA 4LUZA 4DR2Q 3U4VA 1VQ9A 3H3VH 2UXCQ 1K8GA 4PMWA 3UDGA 1AE2A 4A3BH 1NY4A 3LGJA 4YY3L 2UU9L 4K0KL 1G291 3A74A 2ATWA 2B29A 1BBUA 2Q2IA 3CXCA 2KCTA 4IO9A 1N8RC 2VZAA 2JA6H 2N78A 1PYBA 1I50H 5E7NA 1X55A 1ASZA 2JA5H 4LF7Q 4DV5Q 2ZTCA 4BBRH 1OTCA 4JI1L 4C3JH 1P8LA 5IY0A 3HOZH 1VCIA 2B63G 4DNIA 4HIMA 2Q2HA 4TVAB 2VQEQ 4GNXB 1C0AA 5JJIA 4QY7A 2VNUD 1XTDA 5JEAG 4HIKA 1XMQQ 5K36G 3UDIA 1XNRL 1IBLQ 3CC2A 4B3RQ 5IYBG 1YIJA 2XGTA 1PH3A 1CKOA 3U58A 4DUYL 5M5WH 1S3OA 2BH8A 2OQ0A 2WAQG 2UXCL 4DR2L 1AH9A 1QZGA 1I3QH 3UDXA 4JBWA 1V9PA 4AQYL 4JI8Q 5FLXc 3AYHB 3PSIA 1BKBA 1SLJA 1FVIA 1UWVA 3RR5A 3GTQH 1J5EQ 1EFWA 5IYDG 3S1RH 4A3FH 4BBSG 1A8VA 3HOXH 4GOPC 2Z6KC 3M85A 1YHBA 4C3IH 1M90C 3HOVG 1L1OC 3I4MG 5M3FH 2F4VQ 3HKSA 1CSQA 4GN4B 3WWVA 4X64Q 5AJ3Q 2UUBL 2F3IA 3S1QH 4DV5L 3TQYA 1C9OA 2IHEA 3PGZA 5JEAJ 4R4IA 1YHAA 5C3EG 2NVQH 4FDBA 5FLMG 4JI4Q 4A93G 2GVAA 2PI2A 2D0PA 4JBJA 3S2HH 2NN6I 4QQBX 1VQAA 2I0QA 1XMQL 2Q2TA 3S16H 1CSPA 1DGSA 1X54A 4L5QA 4YWMA 3TRZA 3TS2A 1IBLL 4O0AA 4AYBE 4B3RL 3DLLA 3RN2A 1IBMQ 3W1GA 1KAWA 5GAGC 5C0XJ 4BY1G 1X65A 1XJVA 1JMCA 1N32L 4UPAA 3B6YA 3CC7A 3I4NG 4JYAQ 1O7IA 1J5EL 1LYLA 3NENA 1PHJA 2GN5A 1FGUA 4EX5A 2A1AA 2NN6G 2Z6KA 5C4JH 4GOPA 3ICEA 2QA4A 1L1OA 4PZ8A 5AJ3L 5ELOA 4X64L 1W3SA 1EIYB 2KBNA 3TREA 1H95A 4HJ5A 4POGA 4JI4L 3K0XA 2BH2A 3CW2C 2GVBA 3PIPA 1Q81C 4LWCA 1SR3A 2HIXA 4A3LG 3M4OH 4AYBG 4OWWB 4YHHQ 1RL2A 3H0GH 3RN5A 5IYCH 1EUJA 2ALYB 2KHJA 5C4XG 1IYJB 5C44H 1R9TH 3GTLH 1E7ZA 3M4QA 2JA7H 1IBML 3D0FA 4UP7A 3K7UC 4A3CG 5GAEC 3T1HQ 2C35B 2LXKA 4HJ9A 2B3GA 4XTCS 5JJKA 3I56A 1UEBA 4POFA 2R92G 3HOUH 4A3GH 4IJLA 2V1CC 3ULJA
chains in the Genus database with same CATH superfamily
2JSOA 2FMCA 1Q82C 3KYHC 4GKKQ 3GP7A 1EYAA 2EY5A 2F0UA 2WKCA 2EY6A 4OXPA 3MEHA 1G51A 1KHIA 3CCMA 1TWCB 2RHQB 4BY1B 1QB5D 1X3GA 2BE5C 4BA2I 3T13A 4A3IH 4KLKA 4NDXA 4RHRA 1SYDA 1DM0B 4QUCA 5I4DA 1LABA 2VY3A 3HOWH 1I94L 1LTGD 1ICFB 2K03A 3GTMB 1B2TA 2SNSA 3VYUA 1A62A 1F77A 4DV6Q 1HCZA 2PQAA 1RCVD 2Z4IA 5I2YA 1ICWA 1BQQT 3ULPA 4LK1C 4I7ZC 3M7NA 5LMUL 3VDYA 1VQOA 4YCVA 1PZID 1SAPA 2UUBQ 2EXDA 4HMJA 1BCPC 2EJGC 1VQNA 3L3OC 1UAPA 2XIWA 2EPBA 5CV8A 1HFNA 5IWAQ 2QEXA 2CW0D 3FKIH 3QWNA 2QDLA 1JJCB 3RZOB 5JPMC 3D31A 1WCMH 1SROA 4H02A 2M9VA 1ET6A 3J7A5 3KOJA 3PUYA 1WJJA 1A0IA 1IZ6A 1PFMA 2J0TD 3MTSA 4ODGA 3DM1A 1H9JA 3S15B 1OXVA 4RKLA 4A3MG 3M3YH 4H0LC 3HGBA 1MD2D 1SE8A 2R7ZB 1PRTB 2F52A 2B63H 3RUZA 1PTOC 1G91A 1YJWA 1I5FA 3BU2A 4X62L 4A3EB 1LTTD 4QB4A 5JEAH 5BR8L 5K36H 5M5XB 1Q46A 1XMOL 1F9QA 1GXDC 4WFN3 1HR0W 2R6GA 4RAUC 4DV0Q 5M3MG 2YU9H 1LTLA 1PH1A 1TU2B 2Z9HA 3K81C 1QNUA 1G6ZA 2EVBA 2VUMB 5I2XA 5IYDH 4KN4C 1VQFA 1TWAH 3J81c 1SYGA 1BUVT 2JJQA 3HOVH 3S1NH 2HCCA 1R4QB 1FL0A 3HOXB 1K0SA 2XTIA 3HFZB 3C3LA 4HSVA 3EBEA 1E3PA 3S14H 1DONA 3VA5A 4FVMA 1N9WA 1D1IA 1RIPA 4XT1B 1R4PB 3I73A 1D8LA 4NP5A 1GD7A 1TWFH 3KLSX 2NUCA 4PV1C 3TP7A 3J81j 2NTSA 3CKIB 3F8TA 3A0JA 2X6LA 3SEBA 4V190 3SGIA 2K5VA 3QOLA 3I3CA 5CBAE 1TWHH 2R93B 5KNCA 4K5WA 1HA5A 2Z4HA 5EQ0A 5CMDA 3RZDH 2PPBC 3AQQA 1EZ8A 1SXTA 2SEBD 4R4CA 2UXBL 3NTKA 3PV0A 5CORA 4DK6C 3SK6A 3MXNB 3UDFA 2B2YA 1JCKB 4DR1Q 1F2MA 1VDZA 5JAVA 5LHY1 2E5LL 3KFUA 2EIFA 3VR2A 2E76C 4KTAA 3T56B 3M4YA 4DV1Q 3K8AA 1WTPA 3CCQA 2RVLA 3DHQA 1KNAA 1MJCA 2OCEA 5DNFA 4OEMB 2MO1A 4BXXG 5FO9B 2NVTB 1GUSA 2K33A 1LLRD 1TS5A 1VQMA 2F0MA 1LTAD 4DR4L 3EIVA 2E75C 5DAUA 4JI3Q 1ILQA 4PMBA 1WD0A 1KDAA 4J15A 2WIIB 5CV4A 1KQSA 4IOCA 4JI5L 2JA5G 1B53A 3UE0A 3QG1A 1UNSA 4KD3A 2UUCL 4ME3A 1SMYD 4ZUJA 2KOLA 4ZRZA 1B1ZA 1S5FD 4RA8A 2HHHQ 3KJOA 3T1YL 5EGTA 5AFWA 3CU7A 4GNXC 1XXGA 2Y0SE 1PH5A 1HH2P 1Y1VB 4LF4Q 3LX0A 4FO2A 1D7QA 3CP0A 1Y8PB 2F0LA 4DU9A 1FNVA 2N3SA 3PF4A 2N49A 1HZBA 1EOTA 3FP9A 4A3FG 1Q90A 1HJPA 4HIOA 2MFIA 3GDEA 1E2WA 2CVRA 1CKMA 3PUVA 2CKZB 4C3IG 1JR0D 3QIAA 1PH6A 2NZ1D 1EYCA 4YWKA 4P75A 2E2DC 1HRJA 1HXYD 1AN8A 4ZUIA 2EJFC 3VR4A 2A6HD 1XWEA 3E6ZX 3E3XA 3HG9A 4L6TB 5IGGA 1DZ1A 2UXDL 4BBRB 5KEEA 1QILA 1B70B 2Z6BA 2A74C 4EQPA 1QZHA 4DR3L 4LF9L 5C0XG 1EQRA 4DNTB 1JWUD 2WFWA 4IUNA 4LF7L 4G7HC 2H5XA 3OTOL 3Q6SA 3CMEA 1VF7A 2VQEL 2I5HA 1N34Q 3GTQB 4A3MH 2KECA 3OMGA 2KHIA 4HTHA 3KF8A 4DUZL 2K5DA 1F2LA 4NW2A 3KDFA 3S1QB 2NVQB 3HOUG 4A3GG 3DMUA 4DV7Q 3K6OA 4CGYB 5G3LF 4L8JA 5FO7B 2DNEA 1B44D 2B2VA 1ASYA 2ZM6Q 2K6AA 5EBCA 4KD4A 2JA9A 4YWLA 3HKZG 3FPUB 4X65Q 5CC4A 4JV5L 1TWGH 5M3MH 5DLQE 1XPOA 3CHBD 3BVGA 3HEJA 4JPBW 1V43A 1HHVA 4N9PA 2NB0A 2ICIA 3LWUA 1Q8IA 2VQFL 2BA1A 4OWXB 1XPRA 2ZTDA 2KVMA 3W2DA 4ZAIA 3TP8A 4KKTA 4XYOA 1KLGD 3MFYA 1Z9FA 1I6VC 3TDQA 1Q1BA 3EQLC 1HNWL 4QGUA 5J39A 1OO9B 4JYAL 4R4QA 2KENA 2K52A 1T5EA 3GTPH 1R9TB 1VMCA 3PIOA 4IFDJ 2JA7B 4LW1A 1QVCA 2XVSA 3AB9A 5CR3A 3GTGH 4XT3B 1FR3A 4OO1G 1YNJC 1BR9A 5IT9L 1KXLA 5D14A 3EJIA 3RZDB 1HNXL 4JOIC 4HEDA 1PH4A 1EFID 3KJPA 4M1UB 1Y1WB 4CJ0B 1A2UA 3HZXA 4U68A 1EWHA 4Y52H 1XNRQ 3Q8DA 2L55A 1AZPA 4BXXH 1PFSA 1L2FA 1A15A 1WFQA 4LUZA 4DR2Q 2UXCQ 1GJXA 1K8OA 2G9HD 1H9KA 3UDGA 1NY4A 1EY8A 2AQ2B 1ENCA 1LACA 1K28A 1BBUA 1N8RC 2B2TA 3H3VC 5D65A 2N78A 4KKSA 4N8FA 2JA5H 3DWPA 1OTCA 4C3JH 2LMCB 1MSGA 3SR1A 1PRTC 1HFGA 3DEPA 1XTDA 4QCLA 1XMQQ 3VR5A 3UDIA 5J22A 2F0DA 2IL8A 3U58A 3A8KE 5A2QE 2QCPX 3TZUA 3UDXA 5FLXc 1E0BA 2L4NA 1JOKA 1X3PA 5EBDA 3P1HA 1BKBA 1SLJA 1FVIA 3IL8A 4QMGA 4A3FH 1A8VA 2B2UA 1BOSA 3EVQA 4C3IH 1M90C 4UHVA 2F4VQ 4GN4B 1CSQA 5IGFA 4X64Q 5AJ3Q 2UUBL 2F3IA 2KQ3A 4DV5L 1F9SA 3PGZA 4QIWB 5JEAJ 4N8X1 1IKMA 2FINB 1ONLA 3S2HH 1EU4A 1FNWA 2O5JC 1PTOB 2K01A 2PMZB 1X54A 4L5QA 3TRZA 3TS2A 1II3A 4O0AA 4B3RL 5I9PA 1RDPD 3VYSA 4MIUA 4N9TA 4DXGA 3TSSA 4IZ8A 4UPAA 3B6YA 3I4NG 4KY7A 1O7IA 5C0XH 2IPKD 2F0OA 1FGUA 4EX5A 2NN6G 2Z6KA 4GOPA 4K8JA 1STBA 1JB3A 3PIO3 2F0GA 3ND8A 4POGA 2B2WC 1PFNA 1C4QA 3K0XA 3K59A 3CW2C 4LWCA 2HIXA 3M4OH 1RL2A 3GTOB 4BBSB 1EUJA 1IYJB 3IKJA 3M4QA 3I4MB 1IBML 3D0FA 3K7UC 4A3CG 1TQOA 3FMCA 3HOUH 5C3EB 3Q23A 2R92G 4A3GH 1D1KA 2V1CC 3PF5A 2Q2TA 1RODA 1A3TA 1OXTA 3A5UA 2Q2UA 2K75A 1ZXTA 2UU9Q 4LFBQ 3FDTA 3T53B 1LTSD 2DNCA 4H7BA 3BZKA 1K83B 1LUZA 4X66Q 3DWQA 1GOZA 4ME5A 2ENBA 1GM5A 1KLUD 3I2ZA 1EOVA 3J7YW 1AW7A 4YHHL 2EYJA 4A3JG 3I70A 1KAAA 5D3DA 4JI0Q 2E8GA 3NELA 1QJOA 3K7AH 4AQYQ 4AYBB 3BDCA 5BN5A 2OT2A 5C4XB 1CKNB 4X6AH 4PZ7A 2D5DA 4FNFA 3G71A 2D2CC 3GD7A 4GKJQ 4OO1H 4GN5A 4DV1L 1FJGQ 2AQ3B 2Q8TA 1BNZA 4CJ2C 1CK1A 4LF6Q 3AFQA 3S17H 1F9RA 2F0WA 4BWGB 4WJ3M 4NB3A 4R9WA 5KYLA 1STGA 2JQOA 1G2SA 4CHTB 3OOCA 4KY6A 4C1NI 4JI6L 2IX0A 3TN2A 4LNQA 4GLAC 3OIQA 2WB1E 5M5YH 4KHVA 1TS3A 2CWPA 4XQQA 3J80L 2WV6D 1N32Q 4ZCKA 1M4VA 1VQHA 4C56C 3SVMA 2FFKB 1E1TA 2K04A 4NPSA 1SJHD 2P5ZX 3DUZA 1SYCA 3PO3G 5C4ZA 3HOYB 1O7YA 2PNRC 4C3JB 4XYQA 4DV2L 2JEBI 1NTGA 3BYTB 1CHQD 3Q0AA 2LS01 1HA6A 3C1EA 2A19A 4ID6A 4LF8Q 1I6HH 4G7OC 1B8AA 2AWNA 1HR0Q 1U4RA 2RSOA 4CBVA 3QB3A 2K5HA 5ELNA 3OW2A 1IL2A 1B3QA 1EY6A 2YTXA 1SRUA 2DJGC 3JAML 2RHSB 2BE5D 2B2YC 2F0QA 3I7FA 3F2UA 2MUYA 3URYA 2CWAA 2OF1A 1H9MA 5ELBA 1RHPA 1O7LA 2VB3X 1RD9D 4IPCA 4IFDI 3MZ5A 5FJ8G 2NVYB 4L5RC 2LFNA 1JWSD 2R3ZA 5C5LA 1I4RA 5FO8B 4KI0A 3TEHB 5E1FA 2MQHA 3V05A 4F87A 3SK5A 3GTJH 1JJ2A 1STYA 2I46A 4FF1A 1Y8OB 5H1SE 4B3MQ 4S3SA 4JBKA 4PZ6A 4KHPQ 1SNDA 3CQZH 3MA2B 3I4NH 4O2DA 1VQ5A 1V1PA 5JPNC 5T1IA 1O7ZA 5HGQA 1S4ZA 2NN6H 2L5TA 4A3DB 4GS3A 4QJFA 3GTKH 1EIGA 1ILPA 1J6QA 2LY7A 3KF6A 1NSNS 5IP9G 1C8CA 5ELEA 1ENFA 4LJZC 2CQAA 4B9XA 4NXMQ 3M4PA 4Y7NH 2RCNA 4DV4L 3CCUA 2CQOA 3IFTA 5LMNQ 5LL6S 4NXNL 3M4OB 3AFPA 5GAHC 4RKBA 4FF3A 4LFAQ 3RD4A 3G48A 4EQ5A 4A3CH 4M8AA 4JCVE 2F0FA 2R92H 1LTBD 1MJEA 2JA6G 3D8GA 2NYZD 3HOZG 1SFOB 1IKLA 1Q1EA 2DGYA 3L9AX 5EKLA 3CCVA 2XRQD 2MPMA 2AMCB 2JA8B 1VQ4A 5ELCA 3A8IE 4MTNA 1S5DD 3VA7A 5E4WC 3FVQA 3STBC 1OXUA 1BVSA 1ZYRD 3MVVA 4C2MB 4A3JH 4A3KB 1N33Q 3Q24A 2WAQE 3CCRA 4HJAA 4C3HB 4IJHA 5M3FG 2E2JB 3NHHA 3N6RA 1QOHA 2KEDA 5JJLA 1I4PA 3AMUA 1IL8A 4A3BB 2JEAI 2F0SA 2DUDA 3NUCA 1SYFA 2F0NA 2Y0SG 1SSOA 3L7ZC 1QVGA 4GN3B 4CKBA 3DWAA 1KC8C 3EROA 1KDBA 4IPHA 1I50B 2LKVA 2R61A 2RSNA 1W6KA 1SDFA 1SYBA 5EPKA 1B7YB 4KKUA 1DJRD 1RF2D 1YNND 1L0WA 4O1NA 2UUAL 1X3EA 2AHOB 1IYVA 3CPFA 4LFCL 1MSHA 2XSCA 2WP8J 1UE5A 1LTRD 3NWTA 4DAYA 2ASBA 1LV9A 1G6PA 1EYGA 3CRKC 1QG7A 3TP5A 4JI2L 3E9IA 3H0GG 1YEZA 2H1EA 3EN2A 4AH6A 2KCMA 5GROA 4MHEA 5C44G 4JVZA 2A5HA 4UAIA 1PZKD 3PO3H 4EQOA 4A93H 4R8NA 1DOLA 1IBKQ 2MNAA 1ET9A 1HQRD 3SXHA 2SNMA 3AEVA 1YHQA 1HNZL 4LF5Q 2EE1A 3F2DA 3S16B 4A76A 4JI7Q 4I65A 3QOJA 4XQNA 2F4VL 1N36L 1CHPD 1HTPA 1WI5A 4TQUS 1V1PB 3KLWA 2NVXH 3K0YA 2WB1B 4J6HA 4B3TQ 3E5SA 4OX9L 3I55A 1KRSA 2QDBA 4DR6L 2IX1A 3KF6B 2HDMA 5C4JB 2F4IA 1QUQA 4RCNA 1LT6D 4JC0A 2K14A 1KRTA 4DR5L 1EU3A 3W1BA 5FJ8H 1H9SA 4DV3L 3PO2G 2A6ED 2CCZA 1K0RA 2PQAB 5JOBA 4QIWE 3ND9A 5ELFA 3N52A 1IHZA 1EWIA 2B2TC 1HUNA 2E2IH 1WTOA 2QILA 1NMGA 1KL9A 5D3IB 2PMZE 4BY7G 4PG3A 4ZK9B 4B3SL 2E74C 5JJZA 1EL0A 1X3QA 4IPDA 5IP9H 5IE8A 3PMFA 3PUZA 1MI2A 4RGMA 4YCUA 4ZQ3A 2G5DA 1VQ9A 2HD3A 1K8GA 4A3IB 1I4HA 4PMWA 3NBIA 1AE2A 4DAPA 4YY3L 2UU9L 3A74A 2B29A 3HOWB 3NBHA 2B2UC 3D3RA 3T4AC 2JA6H 5E7NA 1X55A 3H94A 5IT9E 2ZTCA 4JI1L 3HOZH 1J9OA 4IN3A 4DNIA 4HIMA 1NR2A 1F2YA 4FP5D 1C0AA 2VNUD 3SK8A 4K2LA 3H6MA 4ZKCB 3MFGA 5BN4A 1I4XA 1SBBB 1AFPA 1YIJA 2XGTA 1PH3A 1SNCA 1CKOA 1I4QA 1I3QH 4AQYL 4JBWA 1V9PA 1B9NA 4ILWA 3PSIA 1RTOA 3NP8A 3R93A 3S9WA 3FKIB 1J5EQ 3S1RH 1XYIA 4GOPC 2Z6KC 2K7VA 1EQVA 5M3FH 3ZYYX 4CKEA 2N55A 1WCMB 1C9OA 2IHEA 2BDNA 3BVZA 2GVAA 3PIP3 2PI2A 2D0PA 4PMCA 4QQBX 1VQAA 4K2KA 3VR3A 4YWMA 1STAA 3M3YB 1IBLL 3NWSA 4AYBE 3W1GA 4HCSA 2F0TA 5GAGC 4ZLTF 4HN7A 4BY1G 2B63B 1EYDA 2IW3A 4WRDA 1N32L 1NCVA 1LYLA 2PCFB 2GN5A 2AUKA 3ICEA 4JK1C 1L1OA 2TSSA 2KBNA 1H95A 2WAQB 1EY9A 3DXJC 2YU9B 4IUVA 5EKIA 4JI4L 2Z1CA 2XNAC 1D5ZC 1SR3A 4K14A 4PQXA 3D4DA 1WTWA 3H0GH 2A6HC 2ALYB 2KHJA 2X69A 1TWAB 5C4HA 5C44H 2CHBD 3GTLH 3HOVB 3S1NB 3G7LA 2O5IC 1H9SB 5GAEC 4HSPA 3D6WA 4HJ9A 3I56A 3S14B 2EYMA 4FXGC 4A93B 4IJLA 4FF4A 3U9OA 1VQIA 3E0JA 1TWFB 5LMUQ 3NXWA 4DF7A 1PRTD 1YBYA 1STNA 4OWTB 2E2HH 1UE6A 1HPCA 1TWHB 3MHBA 2EJMA 2RBMA 1QE6A 3S2DH 2YTYA 3OIPA 5IP7G 3FHWA 1FYCA 1VQDA 2RQXA 1OXSC 1CTMA 3MC0B 4DNRB 1PH9A 1J8IA 3MXGA 3T1HL 1JOQA 4MN3A 4F8MA 2CH4A 4DUYQ 1K73C 2R7ZG 3G4SA 3S1MH 1VS0A 2HIVA 1XNQL 3KLRA 1E1OA 3F1ZA 1Q7YC 5IODA 3PO2H 1NMFA 4GKKL 4IUPA 4G4KA 2A73B 4A3EG 3TS0A 4DAMA 2ZJQA 1WTXA 3HRZC 2KCNA 4MZ9A 4G57A 4DKAC 1A6XA 1WTVA 4BY7H 4NXML 1S40A 1Q8KA 1LT3D 2EQSA 4P74A 5LMNL 4X62Q 5HURA 2FXQA 2VUMG 1T9HA 4LFAL 1U0LA 1WD1A 5KYIA 1TT2A 3FRPB 1XMOQ 3A7AB 1E22A 3HOXG 4DV6L 1V1OA 3K58A 2F1MA 1EY7A 3KLSA 3J7AV 2PQEA 2ZXRA 1HZCA 4OHJA 2VL6A 1KIXA 1JT8A 1DD2A 4GNXA 5C6AA 2R93G 2HT1A 4ULLA 5IWAL 2L12A 3KF8B 1N33L 4UP9A 1FD7D 3GV3A 4HR7B 5CGKA 3KDFB 1SN8A 2D62A 1D6EC 1U4PA 1ZEQX 1TS4A 1TXYA 2N8NA 3J80E 2HUGA 2QF7A 1VQ6A 4GZYC 1NAPA 1QCBD 3JC66 3CAMA 2E5LQ 2F0EA 1WYDA 3TZDA 1CQVA 1VF5C 3J81L 1FNUA 1KTKA 1BBWA 3QO2A 2D0OA 5EKKA 1W6JA 3I91A 1U9RA 3X3NA 3L0OA 1X6OA 4L5TA 1B3AA 1Q12A 4DR7Q 1IW7D 2YYZA 2IX3A 2A68D 3E0EA 4R1JA 5CV6A 3A54A 1MBYA 4A3MB 4L5SA 4DR4Q 2BDOA 2MO0A 1JB7A 4FF2A 2AKWB 3U4ZA 4DV0L 1BF4A 4BY1H 1TWCH 1TKWB 3UE1A 2ZTEA 2VS1A 1BCPF 4JI5Q 3H3VI 1Y1VG 3KBGA 2UUCQ 1ESFA 1JOOA 1PYSB 5K5PA 4IFDG 1C48A 3JAME 3V2TA 2I07B 1YJNA 1MIUA 1YNXA 3J80i 4HJ7A 3GTMH 2HQLA 2V4DA 3R3OA 3OSOA 1TWGB 4E6IA 5M3MB 3T1YQ 1JC7A 4DPGA 1IBKL 4UP8A 1WTHA 3OHXC 2AWOA 2YTVA 4HMIA 1PH7A 2K5NA 4JBMA 4X3SA 4MNOA 2SDFA 4CJ1B 3NTIA 4KHZA 1PA6A 4IUQA 4YCWA 1NNXA 5KIXA 4BBRG 1PTOF 5EAYA 2TMPA 4DR1L 3CF5A 2F0PA 2JYOA 2M2LA 3BS1A 3GTPB 3I90A 3RZOH 3EFXD 4JW0A 2F0JA 3GTGB 2HCIA 4R4OA 5IGDA 3R2IA 4L63B 1LT4D 5C3WA 3H15A 2OWOA 3JAMi 4IURA 2UXDQ 1GVPA 4DK0A 1PDQA 5IP7H 3S15H 3J7AF 5GQOA 4JI3L 3NE5B 3H91A 4DK3C 4DR3Q 4LF9Q 2RCFA 1VQ8A 2R7ZH 1GKHA 1NR4A 3CC4A 3CCEA 2I5MX 3TBIB 1PH2A 3M7GA 1F9PA 2G9DA 1CUKA 4R4TA 1D5XC 4JOIA 2R7FA 3OTOQ 4A3EH 3CD6A 1GO3E 2A69D 5A35A 5M5XH 2HHHL 2KUMA 1Y14B 1Z47A 4DUZQ 2ZJRA 2PO4A 2JA5B 4O42A 4LF4L 5C5MA 1PYWD 4AIMA 1GUOA 3LNNA 2VUMH 2H4OA 3CCLA 4WJWA 1DYQA 3RLFA 2F03A 3SDZA 1SE2A 2K4KA 2QGQA 4JV5Q 1Q3LA 3CMAA 4LMQD 4LUVA 4GOPB 1K3RA 4X3KA 4NMZA 2EYFA 1RTNA 3VYRA 4A3FB 5IYCG 2VQFQ 3I4OA 4C3IB 2EYLA 2JA7G 1HZ9A 1RJTA 2R93H 2F3WA 1PV4A 1QNKA 2WACA 2DY8A 1SE4A 4U673 1HNWQ 3S2HB 5ISRA 1SYEA 2YV5A 1X56A 3ZJYC 3A8JE 3BYYB 3A5ZB 1Y1WG 4GLVB 1LT5D 1MHWC 1BCPD 1JE4A 2EYOA 3RLOA 2NVTH 1HNXQ 4PNYA 1N34L 2NZHA 3STBD 2EY1A 3OMCA 1VQGA 2KHSA 3BDLA 2O2LD 1CQFA 5FKAC 2F0KA 2K50A 4KK7A 1VQEA 4UDUC 1B50A 4DV7L 1MKHA 3WDNA 1EY4A 2ZM6L 1C7YA 1Z7TA 1RKNA 4X65L 3NPPA 5IT9c 3GO5A 3CCSA 3MXNA 3HOUB 2B2WA 4A3GB 1Y1VH 4IFDH 3SE0A 1AE3A 1JICA 1PTOD 3K57A 3HKZB 3NQIA 2KEEA 3NEMA 2J7ZA 1YJ9A 1NE3A 5J3BA 1GUNA 1SNQA 1S5ED 3ONAB 1CZWA 2KCCA 1A3VA 1CT1D 3A56A 5KRUA 1SJED 1CA5A 1EY0A 3AU7A 5M9OA 3R8BA 4DAVA 1E2ZA 2Q2IA 4EQNA 2KCTA 1PMRA 2IJ0A 1QWYA 2SOBA 1PYBA 1I4GA 4DV5Q 4BBRH 5IGEA 3K7AB 4CDFC 1P8LA 1VCIA 4B9WA 4TVAB 1EZ6A 1HUMA 5JJIA 4QY7A 3BDOA 5I6YA 3IAYA 4HIKA 2DN8A 1XNRL 1IYUA 4B3RQ 5IYBG 2FJ2A 4DUYL 2MHVA 5M5WH 2BH8A 2UXCL 4DR2L 1AH9A 1QZGA 3C1FA 3S17B 4JI8Q 3AYHB 2B2VC 5FK9C 2VXWA 3GTQH 1EFWA 5J1ZA 5FLXL 4BBSG 3C2PA 3M85A 1ESRA 3I4MG 1L1OC 3V96A 3HKSA 5M5YB 2DJFC 3S1QH 1GUWA 4Q0FA 3TQYA 2NVQH 3T16A 5C3EG 5FLMG 1ENAA 4KN7C 3UI2A 4RCOA 2PW5A 3LWEA 4XXEA 2XN9C 1EIHA 2RDFA 2K05A 4OL7A 2ZXOA 2I0QA 2ZXPA 1XMQL 3SK4A 3DLLA 3RN2A 1IBMQ 3OWEB 3IFDA 1KAWA 5C0XJ 1ZYRC 1XJVA 1JMCA 2CW0C 2X6GA 3NENA 4H13C 1PHJA 2A1AA 3A7LA 5AJ3L 5ELOA 4X64L 1W3SA 1ZKOA 1I6HB 4RH6A 1TY0A 3TREA 2BH2A 3PIPA 1Q81C 4A3LG 4AYBG 1KABA 4OWWB 1DCZA 4YHHQ 3RN5A 5IYCH 5C4XG 1LTID 1R9TH 1E7ZA 5BN3A 2JA7H 1EEID 1D5MC 2PZTA 4FXDA 4UP7A 3VYTA 2C35B 2LXKA 3K5OA 2B3GA 1EWCA 5JJKA 1AP0A 4ZYSA 2Z8LA 3ULJA 3G6EA 1YNNC 4RMFA 2PZUA 4K0KQ 1PRTF 1IXRA 2BCOA 2PI2E 4OELB 3GTJB 1Y1WH 5C3XA 1GHKA 1SEBD 2IHFA 2HDLA 1KNEA 2F0VA 3S24A 5JVG3 2CH4W 2VW9A 1K3BC 3CQZB 1K8MA 3I4NB 1EIFA 1TIID 5LMNW 3W5OA 4DR7L 4RGNA 5KNBA 2HQEA 2IY5B 4IALA 1B4OA 2AQ1B 3GTKB 2K5QA 1WOCA 2JK8A 5ELDA 4JI6Q 4K8IA 2F0HA 4F88A 2PW7A 1VQJA 2XWBB 3HOYG 4Y7NB 1GHJA 1PFBA 2N88A 2MJ8A 3NSWA 2LSSA 4C3JG 4LFBL 3BZCA 1VQ7A 1YITA 1YVCA 1NBWA 1Q86C 5HY6A 4LUOA 5CV5A 4X66L 2R92B 1TY2A 5EJWA 3CCJA 4IPGA 3TP6A 1X32A 4DV2Q 4JI0L 5IIFA 1XPUA 1QVFA 4A75A 1H9RA 5GADC 3J80c 1WTRA 3E9HA 1CFMA 4OONA 4JG2A 2RDGA 2A6EC 5KNDA 1VQPA 2DY7A 4A3JB 2BOSA 4KJOA 1UE1A 1PTOH 4XIGS 4DAYB 4X3TA 4GKJL 4RG1A 1FJGL 1SMYC 1STHA 4LF6L 2EXZA 1PH8A 1A63A 3PCOB 1BDOA 3WOEA 3D4RA 4A3DG 5IGCA 2OTJA 1JE5A 1GUGA 1LM0A 2EYHA 3D6CA 1TR5A 5IYBH 4YIJA 1UUPA 5FOBB 1WVLA 5M5WB 3JAMc 1YNJD 4P71A 3GTOH 1GUTA 4BBSH 3OYYA 3I4MH 2L9HA 4ALPA 3QR8A 1K9MC 1F2ZA 2EYPA 2VB2X 4KV6A 2BA0A 5C3EH 5FLMH 2OEOA 4K6LA 3PUXA 5CV7A 2I5LX 4KMUC 2K1BA 2ID0A 1QUQB 3VR6A 4DV4Q 3J7ZC 1WTQA 1HZAA 4TKOB 4NXNQ 4GLXA 1X3FA 2PZWA 3M9BA 4FXKC 1I94Q 1SE3A 4LF8L 4MTKA 2JA8G 5NUCA 1HR0L 3PO3B 1K83H 2JE6I 2JXMB 2B39A 4OIKA 1W2BA 3NTHA 3K80C 5IGBA 1AEXA 5DM73 1U5KA 1K8AC 4WJ4A 4A3KG 2D9UA 1YI2A 2R7DA 3DM3A 4ZKBB 4DXFA 1V8QA 3J81E 1XTCD 1ML0D 3OPOA 4J8QA 4C1NK 4XDXA 4C3HG 4Q5VA 2NVXB 4A3LH 1M1KC 1UE7A 3PQIA 3ITPA 3RLNA 1TVXA 2QKIC 5C4XH 4DGZA 5DEHA 3CPWA 4A3BG 1KD1C 4TSSA 4ABNA 1VQKA 2OTLA 3FPPA 4B3ML 3EA6A 4J1MA 5I6WA 4KHPL 2PNHA 4XQJA 4TRDA 3NBHB 3U50C 2NZOA 2ICEC 2EDGA 1PLFA 5CYUA 2GA4B 4DK1A 2QW7A 3RNUA 3C46A 1PZJD 2L1BA 4NKLA 1L0YB 2PYKA 3F2CA 5L37A 1S5BD 4DN4M 1PXUA 2JP1A 3Q22A 2E2IB 1NJIC 3IRBA 5HGTA 5F2DA 1CZGA 5DM63 4CKCA 2NTTA 1DOMA 1OXXK 5BR8Q 3J81i 1XX8A 4P2CB 2C9OA 2UUAQ 2K5WA 1PVOA 2Z0SA 2ES2A 1CKNA 4LFCQ 2K28A 3BG3A 4CDDC 3HOYH 3NK9A 3ER0A 4H44C 1KDCA 2OQKA 3F2BA 2XWJB 3G6JB 4DA2A 2FMMA 5COYA 2LXJA 3GQBA 1DXMA 1BCPB 5C0XI 4R8IA 2L15A 1SNOA 4JI2Q 3I72A 4IOAA 3R2TA 1LO5D 3MWYW 1EQTA 1FGBD 2JA6B 4RGOS 4V0BA 4RWSC 3O13A 4I7AA 4UY8C 5E3FA 3KUPA 1T5XD 3HOZB 1B9MA 5IOCA 2WB1G 1HNZQ 3K5MA 4EGVA 1P16A 2RKSA 5JVH3 3MEFA 3KK7A 1NUCA 4P72A 3H09A 2ZJPA 2J4XA 4RFBA 1N36Q 1O78A 3HKZE 4APVA 3L2PA 4X3UA 1I3QB 2NVYH 1L1OB 1SMXA 2UXBQ 4OX9Q 1BXTA 2MGSA 2ZT9C 4DR6Q 4DFAA 3S1RB 1BBXC 5LL6X 1CI3M 4KY5A 1U4LA 5M3FB 2IT1A 4DR5Q 1E2VA 2Q8RE 1VQBA 3FEWX 4JI8L 2EZVA 4IUTA 4F7XA 4DV3Q 1JWMD 2Y0SB 5G3LD 4A3DH 1VQCA 1S5CD 4HAEA 1G2TA 2QEJC 1V1QA 1L0XB 4HCEA 3GV6A 2XRSD 5T1GA 1TS2A 1E24A 3CRLC 4RGTA 4HIDA 1Z6HA 3I4LA 4A3IG 4B3SQ 1YZ6A 2F0IA 4HJ8A 1VQLA 2WKDA 3TMEA 5E4XA 1A2TA 4P73A 3HOWG 4K6DA 4OO1I 2F3VA 1G8ZD 1DOKA 3BJUA 4BA1I 2C5CA 1CM9A 3WOFA 4QL5A 1SFOH 4LF5L 3W3AA 5CV9A 2OXPA 3H0GB 2CFMA 1SNMA 3OWFA 5TSSA 4YY3Q 1JJGA 3GTLB 5C44B 4JI7L 4EVOA 1HTLD 3K5LA 2JA8H 2AUJD 3ULLA 4CDCC 1D2BA 3D4WA 3HP3A 2A8VA 3PUWA 1S72A 4B3TL 3BVMA 4JI1Q 4C2MH 4A3KH 1HQMC 4WORA 3ERSX 1CA6A 1BO0A 3FKIG 3P7JA 2L0CA 2E2HB 1EQQA 3MAQA 4A4IA 5KGUA 4C3HH 2RF4A 4OGQC 1X9NA 1IW7C 2E2JH 5A2QL 2A68C 1WCMG 3U4VA 2K32A 5CBEE 3H3VH 3OW7A 3S2DB 4QF4A 4IQZA 4A3BH 3I8ZA 3LGJA 4K0KL 1G291 2NBFA 2ATWA 3CXCA 3T51B 4Z9CB 4IO9A 2VZAA 1I50H 1ASZA 2RDHA 3S1MB 4LF7Q 3MXUA 3QJYA 1STEA 2KJXA 5IY0A 2B63G 2O4XA 1AZQA 3PO2B 3ERQA 2FHTA 2Q2HA 2VQEQ 2B8FA 4GNXB 3BZDB 3X3MA 4CDEC 5JEAG 1MGSA 5K36G 1IBLQ 3CC2A 4K5XA 1Y8NB 5EPJA 3A55A 1S3OA 2OQ0A 2WAQG 4BY7B 2B8GA 2NWGA 2M00A 3P75A 4IUUA 1UWVA 2KA7A 3RR5A 4OIJA 1Y69U 3MXPA 1O80A 5IYDG 1A3UA 3HOXH 1SNPA 4RHSA 1YHBA 3HOVG 3WWVA 4BS9A 1M8AA 4R4IA 1YHAA 5EPLA 4A93G 4FDBA 4JI4Q 1JQYD 2JN4A 2EOTA 4JBJA 2NN6I 4LAAA 4QUFA 3S16H 1CSPA 1DGSA 2L11A 1JORA 4G7ZC 3RMHA 1UEAB 3K5NA 1X65A 5I9OA 1EEFD 3DEOA 3CC7A 2RA4A 2IWHA 1VMPA 3SHLA 4JYAQ 1J5EL 5FLXE 5C4JH 3KBXA 4KJNA 2QA4A 3P20A 4PZ8A 2MP1A 1EIYB 4FYDA 4HJ5A 2EY2A 1U4MA 2Q8IB 2GVBA 4K5VA 2A69C 4B08A 2WINB 3U9SA 3NQTA 3HS0C 1EY5A 3T1HQ 4XTCS 1UEBA 4POFA 1XNQQ
chains in the Genus database with same CATH topology
3G6EA 1OXTA 3A5UA 2Q2UA 2K75A 1Q82C 4RMFA 1VQIA 2UU9Q 3KYHC 4K0KQ 4LFBQ 1IXRA 2PI2E 5LMUQ 4GKKQ 1Y1WH 1YBYA 2E2HH 4OWTB 1UE6A 2IHFA 4OXPA 3BZKA 1G51A 1KHIA 3CCMA 2RHQB 1LUZA 4X66Q 3S24A 1X3GA 2VW9A 1GM5A 3I2ZA 1EOVA 3S2DH 1EIFA 5LMNW 2YTYA 4KLKA 3W5OA 4YHHL 4A3IH 4BA2I 4DR7L 5IP7G 2IY5B 3FHWA 4A3JG 1VQDA 4JI0Q 1WOCA 1OXSC 2JK8A 2VY3A 3HOWH 1I94L 1PH9A 3T1HL 2E8GA 4JI6Q 1A62A 4DUYQ 3NELA 4DV6Q 2PQAA 3G4SA 1K73C 1VS0A 2HIVA 1VQJA 1XNQL 3S1MH 1E1OA 3K7AH 4AQYQ 3ULPA 3HOYG 3F1ZA 1Q7YC 3PO2H 2LSSA 4LFBL 1NMFA 3M7NA 1CKNB 4GKKL 5LMUL 3BZCA 3VDYA 4PZ7A 4YCVA 4A3EG 1VQOA 3TS0A 1YITA 1VQ7A 1YVCA 4X6AH 1NBWA 3G71A 1Q86C 4DAMA 5HY6A 4LUOA 2ZJQA 3GD7A 4GKJQ 2UUBQ 2EXDA 4GN5A 4X66L 4MZ9A 4DV1L 1FJGQ 1VQNA 4DKAC 4BY7H 3CCJA 1S40A 4LF6Q 3AFQA 4NXML 3S17H 1Q8KA 4IPGA 4WJ3M 5IWAQ 4NB3A 2EQSA 2QEXA 4P74A 5LMNL 4X62Q 2FXQA 3FKIH 4DV2Q 4JI0L 2VUMG 1XPUA 1T9HA 1QVFA 2JQOA 4LFAL 1U0LA 4A75A 5GADC 1JJCB 3J80c 4JI6L 2IX0A 1XMOQ 4LNQA 4GLAC 1E22A 2WB1E 5M5YH 3HOXG 3E9HA 3D31A 4DV6L 1WCMH 1SROA 4H02A 2CWPA 4OONA 4JG2A 1N32Q 3J7A5 1VQHA 3KOJA 3PUYA 1VQPA 1WJJA 1A0IA 1IZ6A 1UE1A 1OXVA 4XIGS 4A3MG 3M3YH 1HZCA 4DAYB 4GKJL 2VL6A 1E1TA 4RG1A 1KIXA 1SE8A 1JT8A 4NPSA 1FJGL 4GNXA 3PO3G 2F52A 4LF6L 2R93G 2B63H 2HT1A 5IWAL 1PH8A 1YJWA 3PCOB 1A63A 1I5FA 3BU2A 3KF8B 4X62L 4DV2L 2JEBI 1N33L 1NTGA 4UP9A 5BR8L 3KDFB 4A3DG 2A19A 2OTJA 1JE5A 1LM0A 1SN8A 5IYBH 1Q46A 1XMOL 1HR0W 2D62A 4LF8Q 1I6HH 2R6GA 1B8AA 2AWNA 1TXYA 4DV0Q 1HR0Q 5M3MG 2YU9H 2N8NA 1LTLA 1PH1A 3JAMc 3K81C 1VQ6A 4P71A 2K5HA 5ELNA 3OW2A 1IL2A 5IYDH 3GTOH 2YTXA 4BBSH 1SRUA 1VQFA 1TWAH 2RHSB 3J81c 3OYYA 3JC66 2JJQA 3CAMA 3HOVH 3I7FA 3I4MH 3S1NH 2E5LQ 1WYDA 4ALPA 1FL0A 2CWAA 2XTIA 1K9MC 3HFZB 1BBWA 1E3PA 3EBEA 2BA0A 5C3EH 2D0OA 5FLMH 3S14H 3PUXA 1N9WA 2I5LX 1X6OA 3L0OA 4IPCA 4L5TA 2ID0A 1QUQB 1Q12A 1RIPA 5FJ8G 4DR7Q 4IFDI 2YYZA 4L5RC 4DV4Q 3J7ZC 3E0EA 1HZAA 4R1JA 1D8LA 1GD7A 1TWFH 4KI0A 3TEHB 1X3FA 2MQHA 3M9BA 3GTJH 4GLXA 3J81j 4L5SA 1JJ2A 1I94Q 4DR4Q 4LF8L 2MO0A 3A0JA 3F8TA 1JB7A 3SGIA 2K5VA 2JA8G 5H1SE 2AKWB 3U4ZA 4DV0L 1HR0L 1PVOA 4B3MQ 1K83H 1TWHH 1TWCH 3UE1A 4BY1H 4JBKA 2JE6I 4PZ6A 3RZDH 2ZTEA 4KHPQ 2VS1A 3CQZH 4JI5Q 3AQQA 1W2BA 3H3VI 3I4NH 3K80C 1Y1VG 4O2DA 1VQ5A 1U5KA 1K8AC 2UUCQ 1PYSB 4R4CA 4IFDG 2UXBL 3PV0A 4DK6C 5HGQA 4WJ4A 3MXNB 4A3KG 3UDFA 1YI2A 4GS3A 4QJFA 3GTKH 4DR1Q 2R7DA 3DM3A 1YJNA 1MIUA 2E5LL 1J6QA 3KFUA 2EIFA 1YNXA 3J80i 4HJ7A 3GTMH 2HQLA 3KF6A 3T1YQ 5IP9G 4DV1Q 3K8AA 4DPGA 3CCQA 4UP8A 1IBKL 4NXMQ 3M4PA 2AWOA 4Y7NH 2RCNA 2YTVA 1M1KC 4A3LH 1MJCA 1UE7A 2OCEA 1PH7A 2K5NA 4DV4L 2MO1A 3CCUA 4JBMA 3RLNA 2CQOA 4BXXG 5LMNQ 3CPWA 5C4XH 1VQMA 4NXNL 3AFPA 5GAHC 4A3BG 4DR4L 1KD1C 4LFAQ 4MNOA 3EIVA 3G48A 4EQ5A 4JI3Q 4A3CH 4JCVE 1VQKA 2OTLA 4KHZA 1PA6A 4B3ML 4J15A 2R92H 4KHPL 4YCWA 1MJEA 1KQSA 2PNHA 4IOCA 2JA6G 4JI5L 2JA5G 3UE0A 4BBRG 3NBHB 3U50C 4ME3A 2NZOA 2UUCL 5EAYA 3HOZG 1Q1EA 2DGYA 3CCVA 3RNUA 4DR1L 3CF5A 2AMCB 3F2CA 2HHHQ 3RZOH 1VQ4A 3KJOA 3T1YL 4R4OA 4GNXC 2Y0SE 4MTNA 1NJIC 3H15A 3IRBA 1PH5A 1HH2P 3STBC 3JAMi 2OWOA 4LF4Q 2UXDQ 1D7QA 3CP0A 1OXUA 1GVPA 1BVSA 5IP7H 2N3SA 3PF4A 4A3JH 1N33Q 2N49A 1OXXK 3S15H 5BR8Q 5GQOA 1HZBA 2WAQE 4JI3L 3J81i 4DK3C 3FP9A 4DR3Q 4A3FG 2UUAQ 1VQ8A 1HJPA 3CCRA 4HIOA 2MFIA 3GDEA 3PUVA 4LF9Q 1CKMA 2Z0SA 1GKHA 2CKZB 4HJAA 1CKNA 2ES2A 3CCEA 2I5MX 3CC4A 4IJHA 4LFCQ 5M3FG 3HOYH 3ER0A 1PH6A 1PH2A 2OQKA 4R4TA 1CUKA 3F2BA 5JJLA 4JOIA 2R7FA 3OTOQ 4YWKA 4A3EH 3CD6A 1GO3E 4P75A 2LXJA 2JEAI 5C0XI 2DUDA 1QVGA 2L15A 2Y0SG 3L7ZC 4JI2Q 4IOAA 5M5XH 2HHHL 4GN3B 1Y14B 1Z47A 1KC8C 4DUZQ 2ZJRA 4IPHA 4UY8C 4LF4L 2UXDL 3PF5A 4AIMA 2VUMH 1B70B 2WB1G 1B7YB 1HNZQ 2R7ZH 3CCLA 1P16A 3RLFA 1L0WA 1QZHA 4DR3L 4LF9L 2UUAL 1X3EA 5C0XG 2K4KA 2AHOB 1EQRA 3MEFA 3CPFA 4LFCL 2QGQA 4JV5Q 4P72A 2WP8J 2WFWA 1UE5A 3CMAA 2ZJPA 1N36Q 4LUVA 4LF7L 3HKZE 4APVA 3L2PA 4GOPB 1K3RA 2ASBA 2H5XA 2NVYH 1L1OB 3OTOL 1SMXA 2UXBQ 1EYGA 1G6PA 3CMEA 4OX9Q 2VQEL 2I5HA 1N34Q 4JI2L 3E9IA 4DR6Q 4A3MH 3H0GG 1YEZA 5IYCG 2VQFQ 3EN2A 2KHIA 3I4OA 2KCMA 5GROA 4AH6A 5C44G 2JA7G 4DUZL 1HZ9A 3PO3H 2R93H 4A93H 2IT1A 3KDFA 1IBKQ 2MNAA 4DR5Q 1PV4A 1VQBA 3HOUG 4A3GG 4JI8L 4DV7Q 3AEVA 1YHQA 4DV3Q 1HNWQ 1HNZL 1ASYA 4LF5Q 2ZM6Q 4A3DH 2YV5A 1X56A 3ZJYC 3F2DA 1VQCA 2JA9A 4YWLA 3A5ZB 3HKZG 4X65Q 4A76A 4JI7Q 4JV5L 1V1QA 1Y1WG 1TWGH 2F4VL 5M3MH 1N36L 4GLVB 5DLQE 1WI5A 1XPOA 4TQUS 3KLWA 2NVXH 1V43A 1E24A 3RLOA 2NVTH 4B3TQ 1HNXQ 4OX9L 4HIDA 3I55A 1KRSA 1N34L 4A3IG 4B3SQ 4DR6L 2NZHA 1YZ6A 3STBD 2IX1A 3KF6B 2VQFL 4HJ8A 1VQLA 1VQGA 1QUQA 2BA1A 4OWXB 1XPRA 2ZTDA 4P73A 3HOWG 4OO1I 4JC0A 2K50A 1VQEA 2K14A 1KRTA 2R7ZG 4DR5L 3BJUA 3W1BA 1Z9FA 4BA1I 5FJ8H 4DV7L 1MKHA 1Q1BA 4QL5A 4DV3L 1SFOH 1HNWL 4QGUA 4LF5L 2ZM6L 3PO2G 4JYAL 4R4QA 1C7YA 2CCZA 2KENA 2K52A 2CFMA 1K0RA 4YY3Q 2PQAB 1JJGA 3GTPH 4QIWE 4X65L 4JI7L 3PIOA 2JA8H 4IFDJ 3ULLA 4LW1A 1QVCA 5IT9c 4NXNQ 1EWIA 3GO5A 3GTGH 3CCSA 2A8VA 2E2IH 4OO1G 1NMGA 3PUWA 1KL9A 1S72A 1KXLA 1Y1VH 2PMZE 4B3TL 1HNXL 4JI1Q 4BY7G 4JOIC 4PG3A 4C2MH 4A3KH 4B3SL 1AE3A 3ERSX 1PH4A 3FKIG 3KJPA 3NEMA 1XNQQ 4IPDA 5IP9H 1YJ9A 1EQQA 4A4IA 1NE3A 5IE8A 5J3BA 4Y52H 1XNRQ 3Q8DA 4C3HH 2RF4A 1X9NA 2E2JH 3PUZA 1WCMG 4BXXH 1PFSA 1L2FA 4YCUA 1WFQA 4LUZA 4DR2Q 3U4VA 1VQ9A 3H3VH 2UXCQ 1K8GA 4PMWA 3UDGA 1AE2A 4A3BH 1NY4A 3LGJA 4YY3L 2UU9L 4K0KL 1G291 3A74A 2ATWA 2B29A 1BBUA 2Q2IA 3CXCA 2KCTA 4IO9A 1N8RC 2VZAA 2JA6H 2N78A 1PYBA 1I50H 5E7NA 1X55A 1ASZA 2JA5H 4LF7Q 4DV5Q 2ZTCA 4BBRH 1OTCA 4JI1L 4C3JH 1P8LA 5IY0A 3HOZH 1VCIA 2B63G 4DNIA 4HIMA 2Q2HA 4TVAB 2VQEQ 4GNXB 1C0AA 5JJIA 4QY7A 2VNUD 1XTDA 5JEAG 4HIKA 1XMQQ 5K36G 3UDIA 1XNRL 1IBLQ 3CC2A 4B3RQ 5IYBG 1YIJA 2XGTA 1PH3A 1CKOA 3U58A 4DUYL 5M5WH 1S3OA 2BH8A 2OQ0A 2WAQG 2UXCL 4DR2L 1AH9A 1QZGA 1I3QH 3UDXA 4JBWA 1V9PA 4AQYL 4JI8Q 5FLXc 3AYHB 3PSIA 1BKBA 1SLJA 1FVIA 1UWVA 3RR5A 3GTQH 1J5EQ 1EFWA 5IYDG 3S1RH 4A3FH 4BBSG 1A8VA 3HOXH 4GOPC 2Z6KC 3M85A 1YHBA 4C3IH 1M90C 3HOVG 1L1OC 3I4MG 5M3FH 2F4VQ 3HKSA 1CSQA 4GN4B 3WWVA 4X64Q 5AJ3Q 2UUBL 2F3IA 3S1QH 4DV5L 3TQYA 1C9OA 2IHEA 3PGZA 5JEAJ 4R4IA 1YHAA 5C3EG 2NVQH 4FDBA 5FLMG 4JI4Q 4A93G 2GVAA 2PI2A 2D0PA 4JBJA 3S2HH 2NN6I 4QQBX 1VQAA 2I0QA 1XMQL 2Q2TA 3S16H 1CSPA 1DGSA 1X54A 4L5QA 4YWMA 3TRZA 3TS2A 1IBLL 4O0AA 4AYBE 4B3RL 3DLLA 3RN2A 1IBMQ 3W1GA 1KAWA 5GAGC 5C0XJ 4BY1G 1X65A 1XJVA 1JMCA 1N32L 4UPAA 3B6YA 3CC7A 3I4NG 4JYAQ 1O7IA 1J5EL 1LYLA 3NENA 1PHJA 2GN5A 1FGUA 4EX5A 2A1AA 2NN6G 2Z6KA 5C4JH 4GOPA 3ICEA 2QA4A 1L1OA 4PZ8A 5AJ3L 5ELOA 4X64L 1W3SA 1EIYB 2KBNA 3TREA 1H95A 4HJ5A 4POGA 4JI4L 3K0XA 2BH2A 3CW2C 2GVBA 3PIPA 1Q81C 4LWCA 1SR3A 2HIXA 4A3LG 3M4OH 4AYBG 4OWWB 4YHHQ 1RL2A 3H0GH 3RN5A 5IYCH 1EUJA 2ALYB 2KHJA 5C4XG 1IYJB 5C44H 1R9TH 3GTLH 1E7ZA 3M4QA 2JA7H 1IBML 3D0FA 4UP7A 3K7UC 4A3CG 5GAEC 3T1HQ 2C35B 2LXKA 4HJ9A 2B3GA 4XTCS 5JJKA 3I56A 1UEBA 4POFA 2R92G 3HOUH 4A3GH 4IJLA 2V1CC 3ULJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G6E A;  1OXT A;  3A5U A;  2Q2U A;  2K75 A;  1Q82 C;  4RMF A;  1VQI A;  2UU9 Q;  3KYH C;  4K0K Q;  4LFB Q;  1IXR A;  2PI2 E;  5LMU Q;  4GKK Q;  1Y1W H;  1YBY A;  2E2H H;  4OWT B;  1UE6 A;  2IHF A;  4OXP A;  3BZK A;  1G51 A;  1KHI A;  3CCM A;  2RHQ B;  1LUZ A;  4X66 Q;  3S24 A;  1X3G A;  2VW9 A;  1GM5 A;  3I2Z A;  1EOV A;  3S2D H;  1EIF A;  5LMN W;  2YTY A;  4KLK A;  3W5O A;  4YHH L;  4A3I H;  4BA2 I;  4DR7 L;  5IP7 G;  2IY5 B;  3FHW A;  4A3J G;  1VQD A;  4JI0 Q;  1WOC A;  1OXS C;  2JK8 A;  2VY3 A;  3HOW H;  1I94 L;  1PH9 A;  3T1H L;  2E8G A;  4JI6 Q;  1A62 A;  4DUY Q;  3NEL A;  4DV6 Q;  2PQA A;  3G4S A;  1K73 C;  1VS0 A;  2HIV A;  1VQJ A;  1XNQ L;  3S1M H;  1E1O A;  3K7A H;  4AQY Q;  3ULP A;  3HOY G;  3F1Z A;  1Q7Y C;  3PO2 H;  2LSS A;  4LFB L;  1NMF A;  3M7N A;  1CKN B;  4GKK L;  5LMU L;  3BZC A;  3VDY A;  4PZ7 A;  4YCV A;  4A3E G;  1VQO A;  3TS0 A;  1YIT A;  1VQ7 A;  1YVC A;  4X6A H;  1NBW A;  3G71 A;  1Q86 C;  4DAM A;  5HY6 A;  4LUO A;  2ZJQ A;  3GD7 A;  4GKJ Q;  2UUB Q;  2EXD A;  4GN5 A;  4X66 L;  4MZ9 A;  4DV1 L;  1FJG Q;  1VQN A;  4DKA C;  4BY7 H;  3CCJ A;  1S40 A;  4LF6 Q;  3AFQ A;  4NXM L;  3S17 H;  1Q8K A;  4IPG A;  4WJ3 M;  5IWA Q;  4NB3 A;  2EQS A;  2QEX A;  4P74 A;  5LMN L;  4X62 Q;  2FXQ A;  3FKI H;  4DV2 Q;  4JI0 L;  2VUM G;  1XPU A;  1T9H A;  1QVF A;  2JQO A;  4LFA L;  1U0L A;  4A75 A;  5GAD C;  1JJC B;  3J80 c;  4JI6 L;  2IX0 A;  1XMO Q;  4LNQ A;  4GLA C;  1E22 A;  2WB1 E;  5M5Y H;  3HOX G;  3E9H A;  3D31 A;  4DV6 L;  1WCM H;  1SRO A;  4H02 A;  2CWP A;  4OON A;  4JG2 A;  1N32 Q;  3J7A 5;  1VQH A;  3KOJ A;  3PUY A;  1VQP A;  1WJJ A;  1A0I A;  1IZ6 A;  1UE1 A;  1OXV A;  4XIG S;  4A3M G;  3M3Y H;  1HZC A;  4DAY B;  4GKJ L;  2VL6 A;  1E1T A;  4RG1 A;  1KIX A;  1SE8 A;  1JT8 A;  4NPS A;  1FJG L;  4GNX A;  3PO3 G;  2F52 A;  4LF6 L;  2R93 G;  2B63 H;  2HT1 A;  5IWA L;  1PH8 A;  1YJW A;  3PCO B;  1A63 A;  1I5F A;  3BU2 A;  3KF8 B;  4X62 L;  4DV2 L;  2JEB I;  1N33 L;  1NTG A;  4UP9 A;  5BR8 L;  3KDF B;  4A3D G;  2A19 A;  2OTJ A;  1JE5 A;  1LM0 A;  1SN8 A;  5IYB H;  1Q46 A;  1XMO L;  1HR0 W;  2D62 A;  4LF8 Q;  1I6H H;  2R6G A;  1B8A A;  2AWN A;  1TXY A;  4DV0 Q;  1HR0 Q;  5M3M G;  2YU9 H;  2N8N A;  1LTL A;  1PH1 A;  3JAM c;  3K81 C;  1VQ6 A;  4P71 A;  2K5H A;  5ELN A;  3OW2 A;  1IL2 A;  5IYD H;  3GTO H;  2YTX A;  4BBS H;  1SRU A;  1VQF A;  1TWA H;  2RHS B;  3J81 c;  3OYY A;  3JC6 6;  2JJQ A;  3CAM A;  3HOV H;  3I7F A;  3I4M H;  3S1N H;  2E5L Q;  1WYD A;  4ALP A;  1FL0 A;  2CWA A;  2XTI A;  1K9M C;  3HFZ B;  1BBW A;  1E3P A;  3EBE A;  2BA0 A;  5C3E H;  2D0O A;  5FLM H;  3S14 H;  3PUX A;  1N9W A;  2I5L X;  1X6O A;  3L0O A;  4IPC A;  4L5T A;  2ID0 A;  1QUQ B;  1Q12 A;  1RIP A;  5FJ8 G;  4DR7 Q;  4IFD I;  2YYZ A;  4L5R C;  4DV4 Q;  3J7Z C;  3E0E A;  1HZA A;  4R1J A;  1D8L A;  1GD7 A;  1TWF H;  4KI0 A;  3TEH B;  1X3F A;  2MQH A;  3M9B A;  3GTJ H;  4GLX A;  3J81 j;  4L5S A;  1JJ2 A;  1I94 Q;  4DR4 Q;  4LF8 L;  2MO0 A;  3A0J A;  3F8T A;  1JB7 A;  3SGI A;  2K5V A;  2JA8 G;  5H1S E;  2AKW B;  3U4Z A;  4DV0 L;  1HR0 L;  1PVO A;  4B3M Q;  1K83 H;  1TWH H;  1TWC H;  3UE1 A;  4BY1 H;  4JBK A;  2JE6 I;  4PZ6 A;  3RZD H;  2ZTE A;  4KHP Q;  2VS1 A;  3CQZ H;  4JI5 Q;  3AQQ A;  1W2B A;  3H3V I;  3I4N H;  3K80 C;  1Y1V G;  4O2D A;  1VQ5 A;  1U5K A;  1K8A C;  2UUC Q;  1PYS B;  4R4C A;  4IFD G;  2UXB L;  3PV0 A;  4DK6 C;  5HGQ A;  4WJ4 A;  3MXN B;  4A3K G;  3UDF A;  1YI2 A;  4GS3 A;  4QJF A;  3GTK H;  4DR1 Q;  2R7D A;  3DM3 A;  1YJN A;  1MIU A;  2E5L L;  1J6Q A;  3KFU A;  2EIF A;  1YNX A;  3J80 i;  4HJ7 A;  3GTM H;  2HQL A;  3KF6 A;  3T1Y Q;  5IP9 G;  4DV1 Q;  3K8A A;  4DPG A;  3CCQ A;  4UP8 A;  1IBK L;  4NXM Q;  3M4P A;  2AWO A;  4Y7N H;  2RCN A;  2YTV A;  1M1K C;  4A3L H;  1MJC A;  1UE7 A;  2OCE A;  1PH7 A;  2K5N A;  4DV4 L;  2MO1 A;  3CCU A;  4JBM A;  3RLN A;  2CQO A;  4BXX G;  5LMN Q;  3CPW A;  5C4X H;  1VQM A;  4NXN L;  3AFP A;  5GAH C;  4A3B G;  4DR4 L;  1KD1 C;  4LFA Q;  4MNO A;  3EIV A;  3G48 A;  4EQ5 A;  4JI3 Q;  4A3C H;  4JCV E;  1VQK A;  2OTL A;  4KHZ A;  1PA6 A;  4B3M L;  4J15 A;  2R92 H;  4KHP L;  4YCW A;  1MJE A;  1KQS A;  2PNH A;  4IOC A;  2JA6 G;  4JI5 L;  2JA5 G;  3UE0 A;  4BBR G;  3NBH B;  3U50 C;  4ME3 A;  2NZO A;  2UUC L;  5EAY A;  3HOZ G;  1Q1E A;  2DGY A;  3CCV A;  3RNU A;  4DR1 L;  3CF5 A;  2AMC B;  3F2C A;  2HHH Q;  3RZO H;  1VQ4 A;  3KJO A;  3T1Y L;  4R4O A;  4GNX C;  2Y0S E;  4MTN A;  1NJI C;  3H15 A;  3IRB A;  1PH5 A;  1HH2 P;  3STB C;  3JAM i;  2OWO A;  4LF4 Q;  2UXD Q;  1D7Q A;  3CP0 A;  1OXU A;  1GVP A;  1BVS A;  5IP7 H;  2N3S A;  3PF4 A;  4A3J H;  1N33 Q;  2N49 A;  1OXX K;  3S15 H;  5BR8 Q;  5GQO A;  1HZB A;  2WAQ E;  4JI3 L;  3J81 i;  4DK3 C;  3FP9 A;  4DR3 Q;  4A3F G;  2UUA Q;  1VQ8 A;  1HJP A;  3CCR A;  4HIO A;  2MFI A;  3GDE A;  3PUV A;  4LF9 Q;  1CKM A;  2Z0S A;  1GKH A;  2CKZ B;  4HJA A;  1CKN A;  2ES2 A;  3CCE A;  2I5M X;  3CC4 A;  4IJH A;  4LFC Q;  5M3F G;  3HOY H;  3ER0 A;  1PH6 A;  1PH2 A;  2OQK A;  4R4T A;  1CUK A;  3F2B A;  5JJL A;  4JOI A;  2R7F A;  3OTO Q;  4YWK A;  4A3E H;  3CD6 A;  1GO3 E;  4P75 A;  2LXJ A;  2JEA I;  5C0X I;  2DUD A;  1QVG A;  2L15 A;  2Y0S G;  3L7Z C;  4JI2 Q;  4IOA A;  5M5X H;  2HHH L;  4GN3 B;  1Y14 B;  1Z47 A;  1KC8 C;  4DUZ Q;  2ZJR A;  4IPH A;  4UY8 C;  4LF4 L;  2UXD L;  3PF5 A;  4AIM A;  2VUM H;  1B70 B;  2WB1 G;  1B7Y B;  1HNZ Q;  2R7Z H;  3CCL A;  1P16 A;  3RLF A;  1L0W A;  1QZH A;  4DR3 L;  4LF9 L;  2UUA L;  1X3E A;  5C0X G;  2K4K A;  2AHO B;  1EQR A;  3MEF A;  3CPF A;  4LFC L;  2QGQ A;  4JV5 Q;  4P72 A;  2WP8 J;  2WFW A;  1UE5 A;  3CMA A;  2ZJP A;  1N36 Q;  4LUV A;  4LF7 L;  3HKZ E;  4APV A;  3L2P A;  4GOP B;  1K3R A;  2ASB A;  2H5X A;  2NVY H;  1L1O B;  3OTO L;  1SMX A;  2UXB Q;  1EYG A;  1G6P A;  3CME A;  4OX9 Q;  2VQE L;  2I5H A;  1N34 Q;  4JI2 L;  3E9I A;  4DR6 Q;  4A3M H;  3H0G G;  1YEZ A;  5IYC G;  2VQF Q;  3EN2 A;  2KHI A;  3I4O A;  2KCM A;  5GRO A;  4AH6 A;  5C44 G;  2JA7 G;  4DUZ L;  1HZ9 A;  3PO3 H;  2R93 H;  4A93 H;  2IT1 A;  3KDF A;  1IBK Q;  2MNA A;  4DR5 Q;  1PV4 A;  1VQB A;  3HOU G;  4A3G G;  4JI8 L;  4DV7 Q;  3AEV A;  1YHQ A;  4DV3 Q;  1HNW Q;  1HNZ L;  1ASY A;  4LF5 Q;  2ZM6 Q;  4A3D H;  2YV5 A;  1X56 A;  3ZJY C;  3F2D A;  1VQC A;  2JA9 A;  4YWL A;  3A5Z B;  3HKZ G;  4X65 Q;  4A76 A;  4JI7 Q;  4JV5 L;  1V1Q A;  1Y1W G;  1TWG H;  2F4V L;  5M3M H;  1N36 L;  4GLV B;  5DLQ E;  1WI5 A;  1XPO A;  4TQU S;  3KLW A;  2NVX H;  1V43 A;  1E24 A;  3RLO A;  2NVT H;  4B3T Q;  1HNX Q;  4OX9 L;  4HID A;  3I55 A;  1KRS A;  1N34 L;  4A3I G;  4B3S Q;  4DR6 L;  2NZH A;  1YZ6 A;  3STB D;  2IX1 A;  3KF6 B;  2VQF L;  4HJ8 A;  1VQL A;  1VQG A;  1QUQ A;  2BA1 A;  4OWX B;  1XPR A;  2ZTD A;  4P73 A;  3HOW G;  4OO1 I;  4JC0 A;  2K50 A;  1VQE A;  2K14 A;  1KRT A;  2R7Z G;  4DR5 L;  3BJU A;  3W1B A;  1Z9F A;  4BA1 I;  5FJ8 H;  4DV7 L;  1MKH A;  1Q1B A;  4QL5 A;  4DV3 L;  1SFO H;  1HNW L;  4QGU A;  4LF5 L;  2ZM6 L;  3PO2 G;  4JYA L;  4R4Q A;  1C7Y A;  2CCZ A;  2KEN A;  2K52 A;  2CFM A;  1K0R A;  4YY3 Q;  2PQA B;  1JJG A;  3GTP H;  4QIW E;  4X65 L;  4JI7 L;  3PIO A;  2JA8 H;  4IFD J;  3ULL A;  4LW1 A;  1QVC A;  5IT9 c;  4NXN Q;  1EWI A;  3GO5 A;  3GTG H;  3CCS A;  2A8V A;  2E2I H;  4OO1 G;  1NMG A;  3PUW A;  1KL9 A;  1S72 A;  1KXL A;  1Y1V H;  2PMZ E;  4B3T L;  1HNX L;  4JI1 Q;  4BY7 G;  4JOI C;  4PG3 A;  4C2M H;  4A3K H;  4B3S L;  1AE3 A;  3ERS X;  1PH4 A;  3FKI G;  3KJP A;  3NEM A;  1XNQ Q;  4IPD A;  5IP9 H;  1YJ9 A;  1EQQ A;  4A4I A;  1NE3 A;  5IE8 A;  5J3B A;  4Y52 H;  1XNR Q;  3Q8D A;  4C3H H;  2RF4 A;  1X9N A;  2E2J H;  3PUZ A;  1WCM G;  4BXX H;  1PFS A;  1L2F A;  4YCU A;  1WFQ A;  4LUZ A;  4DR2 Q;  3U4V A;  1VQ9 A;  3H3V H;  2UXC Q;  1K8G A;  4PMW A;  3UDG A;  1AE2 A;  4A3B H;  1NY4 A;  3LGJ A;  4YY3 L;  2UU9 L;  4K0K L;  1G29 1;  3A74 A;  2ATW A;  2B29 A;  1BBU A;  2Q2I A;  3CXC A;  2KCT A;  4IO9 A;  1N8R C;  2VZA A;  2JA6 H;  2N78 A;  1PYB A;  1I50 H;  5E7N A;  1X55 A;  1ASZ A;  2JA5 H;  4LF7 Q;  4DV5 Q;  2ZTC A;  4BBR H;  1OTC A;  4JI1 L;  4C3J H;  1P8L A;  5IY0 A;  3HOZ H;  1VCI A;  2B63 G;  4DNI A;  4HIM A;  2Q2H A;  4TVA B;  2VQE Q;  4GNX B;  1C0A A;  5JJI A;  4QY7 A;  2VNU D;  1XTD A;  5JEA G;  4HIK A;  1XMQ Q;  5K36 G;  3UDI A;  1XNR L;  1IBL Q;  3CC2 A;  4B3R Q;  5IYB G;  1YIJ A;  2XGT A;  1PH3 A;  1CKO A;  3U58 A;  4DUY L;  5M5W H;  1S3O A;  2BH8 A;  2OQ0 A;  2WAQ G;  2UXC L;  4DR2 L;  1AH9 A;  1QZG A;  1I3Q H;  3UDX A;  4JBW A;  1V9P A;  4AQY L;  4JI8 Q;  5FLX c;  3AYH B;  3PSI A;  1BKB A;  1SLJ A;  1FVI A;  1UWV A;  3RR5 A;  3GTQ H;  1J5E Q;  1EFW A;  5IYD G;  3S1R H;  4A3F H;  4BBS G;  1A8V A;  3HOX H;  4GOP C;  2Z6K C;  3M85 A;  1YHB A;  4C3I H;  1M90 C;  3HOV G;  1L1O C;  3I4M G;  5M3F H;  2F4V Q;  3HKS A;  1CSQ A;  4GN4 B;  3WWV A;  4X64 Q;  5AJ3 Q;  2UUB L;  2F3I A;  3S1Q H;  4DV5 L;  3TQY A;  1C9O A;  2IHE A;  3PGZ A;  5JEA J;  4R4I A;  1YHA A;  5C3E G;  2NVQ H;  4FDB A;  5FLM G;  4JI4 Q;  4A93 G;  2GVA A;  2PI2 A;  2D0P A;  4JBJ A;  3S2H H;  2NN6 I;  4QQB X;  1VQA A;  2I0Q A;  1XMQ L;  2Q2T A;  3S16 H;  1CSP A;  1DGS A;  1X54 A;  4L5Q A;  4YWM A;  3TRZ A;  3TS2 A;  1IBL L;  4O0A A;  4AYB E;  4B3R L;  3DLL A;  3RN2 A;  1IBM Q;  3W1G A;  1KAW A;  5GAG C;  5C0X J;  4BY1 G;  1X65 A;  1XJV A;  1JMC A;  1N32 L;  4UPA A;  3B6Y A;  3CC7 A;  3I4N G;  4JYA Q;  1O7I A;  1J5E L;  1LYL A;  3NEN A;  1PHJ A;  2GN5 A;  1FGU A;  4EX5 A;  2A1A A;  2NN6 G;  2Z6K A;  5C4J H;  4GOP A;  3ICE A;  2QA4 A;  1L1O A;  4PZ8 A;  5AJ3 L;  5ELO A;  4X64 L;  1W3S A;  1EIY B;  2KBN A;  3TRE A;  1H95 A;  4HJ5 A;  4POG A;  4JI4 L;  3K0X A;  2BH2 A;  3CW2 C;  2GVB A;  3PIP A;  1Q81 C;  4LWC A;  1SR3 A;  2HIX A;  4A3L G;  3M4O H;  4AYB G;  4OWW B;  4YHH Q;  1RL2 A;  3H0G H;  3RN5 A;  5IYC H;  1EUJ A;  2ALY B;  2KHJ A;  5C4X G;  1IYJ B;  5C44 H;  1R9T H;  3GTL H;  1E7Z A;  3M4Q A;  2JA7 H;  1IBM L;  3D0F A;  4UP7 A;  3K7U C;  4A3C G;  5GAE C;  3T1H Q;  2C35 B;  2LXK A;  4HJ9 A;  2B3G A;  4XTC S;  5JJK A;  3I56 A;  1UEB A;  4POF A;  2R92 G;  3HOU H;  4A3G H;  4IJL A;  2V1C C;  3ULJ A; 
#chains in the Genus database with same CATH topology
 2JSO A;  2FMC A;  1Q82 C;  3KYH C;  4GKK Q;  3GP7 A;  1EYA A;  2EY5 A;  2F0U A;  2WKC A;  2EY6 A;  4OXP A;  3MEH A;  1G51 A;  1KHI A;  3CCM A;  1TWC B;  2RHQ B;  4BY1 B;  1QB5 D;  1X3G A;  2BE5 C;  4BA2 I;  3T13 A;  4A3I H;  4KLK A;  4NDX A;  4RHR A;  1SYD A;  1DM0 B;  4QUC A;  5I4D A;  1LAB A;  2VY3 A;  3HOW H;  1I94 L;  1LTG D;  1ICF B;  2K03 A;  3GTM B;  1B2T A;  2SNS A;  3VYU A;  1A62 A;  1F77 A;  4DV6 Q;  1HCZ A;  2PQA A;  1RCV D;  2Z4I A;  5I2Y A;  1ICW A;  1BQQ T;  3ULP A;  4LK1 C;  4I7Z C;  3M7N A;  5LMU L;  3VDY A;  1VQO A;  4YCV A;  1PZI D;  1SAP A;  2UUB Q;  2EXD A;  4HMJ A;  1BCP C;  2EJG C;  1VQN A;  3L3O C;  1UAP A;  2XIW A;  2EPB A;  5CV8 A;  1HFN A;  5IWA Q;  2QEX A;  2CW0 D;  3FKI H;  3QWN A;  2QDL A;  1JJC B;  3RZO B;  5JPM C;  3D31 A;  1WCM H;  1SRO A;  4H02 A;  2M9V A;  1ET6 A;  3J7A 5;  3KOJ A;  3PUY A;  1WJJ A;  1A0I A;  1IZ6 A;  1PFM A;  2J0T D;  3MTS A;  4ODG A;  3DM1 A;  1H9J A;  3S15 B;  1OXV A;  4RKL A;  4A3M G;  3M3Y H;  4H0L C;  3HGB A;  1MD2 D;  1SE8 A;  2R7Z B;  1PRT B;  2F52 A;  2B63 H;  3RUZ A;  1PTO C;  1G91 A;  1YJW A;  1I5F A;  3BU2 A;  4X62 L;  4A3E B;  1LTT D;  4QB4 A;  5JEA H;  5BR8 L;  5K36 H;  5M5X B;  1Q46 A;  1XMO L;  1F9Q A;  1GXD C;  4WFN 3;  1HR0 W;  2R6G A;  4RAU C;  4DV0 Q;  5M3M G;  2YU9 H;  1LTL A;  1PH1 A;  1TU2 B;  2Z9H A;  3K81 C;  1QNU A;  1G6Z A;  2EVB A;  2VUM B;  5I2X A;  5IYD H;  4KN4 C;  1VQF A;  1TWA H;  3J81 c;  1SYG A;  1BUV T;  2JJQ A;  3HOV H;  3S1N H;  2HCC A;  1R4Q B;  1FL0 A;  3HOX B;  1K0S A;  2XTI A;  3HFZ B;  3C3L A;  4HSV A;  3EBE A;  1E3P A;  3S14 H;  1DON A;  3VA5 A;  4FVM A;  1N9W A;  1D1I A;  1RIP A;  4XT1 B;  1R4P B;  3I73 A;  1D8L A;  4NP5 A;  1GD7 A;  1TWF H;  3KLS X;  2NUC A;  4PV1 C;  3TP7 A;  3J81 j;  2NTS A;  3CKI B;  3F8T A;  3A0J A;  2X6L A;  3SEB A;  4V19 0;  3SGI A;  2K5V A;  3QOL A;  3I3C A;  5CBA E;  1TWH H;  2R93 B;  5KNC A;  4K5W A;  1HA5 A;  2Z4H A;  5EQ0 A;  5CMD A;  3RZD H;  2PPB C;  3AQQ A;  1EZ8 A;  1SXT A;  2SEB D;  4R4C A;  2UXB L;  3NTK A;  3PV0 A;  5COR A;  4DK6 C;  3SK6 A;  3MXN B;  3UDF A;  2B2Y A;  1JCK B;  4DR1 Q;  1F2M A;  1VDZ A;  5JAV A;  5LHY 1;  2E5L L;  3KFU A;  2EIF A;  3VR2 A;  2E76 C;  4KTA A;  3T56 B;  3M4Y A;  4DV1 Q;  3K8A A;  1WTP A;  3CCQ A;  2RVL A;  3DHQ A;  1KNA A;  1MJC A;  2OCE A;  5DNF A;  4OEM B;  2MO1 A;  4BXX G;  5FO9 B;  2NVT B;  1GUS A;  2K33 A;  1LLR D;  1TS5 A;  1VQM A;  2F0M A;  1LTA D;  4DR4 L;  3EIV A;  2E75 C;  5DAU A;  4JI3 Q;  1ILQ A;  4PMB A;  1WD0 A;  1KDA A;  4J15 A;  2WII B;  5CV4 A;  1KQS A;  4IOC A;  4JI5 L;  2JA5 G;  1B53 A;  3UE0 A;  3QG1 A;  1UNS A;  4KD3 A;  2UUC L;  4ME3 A;  1SMY D;  4ZUJ A;  2KOL A;  4ZRZ A;  1B1Z A;  1S5F D;  4RA8 A;  2HHH Q;  3KJO A;  3T1Y L;  5EGT A;  5AFW A;  3CU7 A;  4GNX C;  1XXG A;  2Y0S E;  1PH5 A;  1HH2 P;  1Y1V B;  4LF4 Q;  3LX0 A;  4FO2 A;  1D7Q A;  3CP0 A;  1Y8P B;  2F0L A;  4DU9 A;  1FNV A;  2N3S A;  3PF4 A;  2N49 A;  1HZB A;  1EOT A;  3FP9 A;  4A3F G;  1Q90 A;  1HJP A;  4HIO A;  2MFI A;  3GDE A;  1E2W A;  2CVR A;  1CKM A;  3PUV A;  2CKZ B;  4C3I G;  1JR0 D;  3QIA A;  1PH6 A;  2NZ1 D;  1EYC A;  4YWK A;  4P75 A;  2E2D C;  1HRJ A;  1HXY D;  1AN8 A;  4ZUI A;  2EJF C;  3VR4 A;  2A6H D;  1XWE A;  3E6Z X;  3E3X A;  3HG9 A;  4L6T B;  5IGG A;  1DZ1 A;  2UXD L;  4BBR B;  5KEE A;  1QIL A;  1B70 B;  2Z6B A;  2A74 C;  4EQP A;  1QZH A;  4DR3 L;  4LF9 L;  5C0X G;  1EQR A;  4DNT B;  1JWU D;  2WFW A;  4IUN A;  4LF7 L;  4G7H C;  2H5X A;  3OTO L;  3Q6S A;  3CME A;  1VF7 A;  2VQE L;  2I5H A;  1N34 Q;  3GTQ B;  4A3M H;  2KEC A;  3OMG A;  2KHI A;  4HTH A;  3KF8 A;  4DUZ L;  2K5D A;  1F2L A;  4NW2 A;  3KDF A;  3S1Q B;  2NVQ B;  3HOU G;  4A3G G;  3DMU A;  4DV7 Q;  3K6O A;  4CGY B;  5G3L F;  4L8J A;  5FO7 B;  2DNE A;  1B44 D;  2B2V A;  1ASY A;  2ZM6 Q;  2K6A A;  5EBC A;  4KD4 A;  2JA9 A;  4YWL A;  3HKZ G;  3FPU B;  4X65 Q;  5CC4 A;  4JV5 L;  1TWG H;  5M3M H;  5DLQ E;  1XPO A;  3CHB D;  3BVG A;  3HEJ A;  4JPB W;  1V43 A;  1HHV A;  4N9P A;  2NB0 A;  2ICI A;  3LWU A;  1Q8I A;  2VQF L;  2BA1 A;  4OWX B;  1XPR A;  2ZTD A;  2KVM A;  3W2D A;  4ZAI A;  3TP8 A;  4KKT A;  4XYO A;  1KLG D;  3MFY A;  1Z9F A;  1I6V C;  3TDQ A;  1Q1B A;  3EQL C;  1HNW L;  4QGU A;  5J39 A;  1OO9 B;  4JYA L;  4R4Q A;  2KEN A;  2K52 A;  1T5E A;  3GTP H;  1R9T B;  1VMC A;  3PIO A;  4IFD J;  2JA7 B;  4LW1 A;  1QVC A;  2XVS A;  3AB9 A;  5CR3 A;  3GTG H;  4XT3 B;  1FR3 A;  4OO1 G;  1YNJ C;  1BR9 A;  5IT9 L;  1KXL A;  5D14 A;  3EJI A;  3RZD B;  1HNX L;  4JOI C;  4HED A;  1PH4 A;  1EFI D;  3KJP A;  4M1U B;  1Y1W B;  4CJ0 B;  1A2U A;  3HZX A;  4U68 A;  1EWH A;  4Y52 H;  1XNR Q;  3Q8D A;  2L55 A;  1AZP A;  4BXX H;  1PFS A;  1L2F A;  1A15 A;  1WFQ A;  4LUZ A;  4DR2 Q;  2UXC Q;  1GJX A;  1K8O A;  2G9H D;  1H9K A;  3UDG A;  1NY4 A;  1EY8 A;  2AQ2 B;  1ENC A;  1LAC A;  1K28 A;  1BBU A;  1N8R C;  2B2T A;  3H3V C;  5D65 A;  2N78 A;  4KKS A;  4N8F A;  2JA5 H;  3DWP A;  1OTC A;  4C3J H;  2LMC B;  1MSG A;  3SR1 A;  1PRT C;  1HFG A;  3DEP A;  1XTD A;  4QCL A;  1XMQ Q;  3VR5 A;  3UDI A;  5J22 A;  2F0D A;  2IL8 A;  3U58 A;  3A8K E;  5A2Q E;  2QCP X;  3TZU A;  3UDX A;  5FLX c;  1E0B A;  2L4N A;  1JOK A;  1X3P A;  5EBD A;  3P1H A;  1BKB A;  1SLJ A;  1FVI A;  3IL8 A;  4QMG A;  4A3F H;  1A8V A;  2B2U A;  1BOS A;  3EVQ A;  4C3I H;  1M90 C;  4UHV A;  2F4V Q;  4GN4 B;  1CSQ A;  5IGF A;  4X64 Q;  5AJ3 Q;  2UUB L;  2F3I A;  2KQ3 A;  4DV5 L;  1F9S A;  3PGZ A;  4QIW B;  5JEA J;  4N8X 1;  1IKM A;  2FIN B;  1ONL A;  3S2H H;  1EU4 A;  1FNW A;  2O5J C;  1PTO B;  2K01 A;  2PMZ B;  1X54 A;  4L5Q A;  3TRZ A;  3TS2 A;  1II3 A;  4O0A A;  4B3R L;  5I9P A;  1RDP D;  3VYS A;  4MIU A;  4N9T A;  4DXG A;  3TSS A;  4IZ8 A;  4UPA A;  3B6Y A;  3I4N G;  4KY7 A;  1O7I A;  5C0X H;  2IPK D;  2F0O A;  1FGU A;  4EX5 A;  2NN6 G;  2Z6K A;  4GOP A;  4K8J A;  1STB A;  1JB3 A;  3PIO 3;  2F0G A;  3ND8 A;  4POG A;  2B2W C;  1PFN A;  1C4Q A;  3K0X A;  3K59 A;  3CW2 C;  4LWC A;  2HIX A;  3M4O H;  1RL2 A;  3GTO B;  4BBS B;  1EUJ A;  1IYJ B;  3IKJ A;  3M4Q A;  3I4M B;  1IBM L;  3D0F A;  3K7U C;  4A3C G;  1TQO A;  3FMC A;  3HOU H;  5C3E B;  3Q23 A;  2R92 G;  4A3G H;  1D1K A;  2V1C C;  3PF5 A;  2Q2T A;  1ROD A;  1A3T A;  1OXT A;  3A5U A;  2Q2U A;  2K75 A;  1ZXT A;  2UU9 Q;  4LFB Q;  3FDT A;  3T53 B;  1LTS D;  2DNC A;  4H7B A;  3BZK A;  1K83 B;  1LUZ A;  4X66 Q;  3DWQ A;  1GOZ A;  4ME5 A;  2ENB A;  1GM5 A;  1KLU D;  3I2Z A;  1EOV A;  3J7Y W;  1AW7 A;  4YHH L;  2EYJ A;  4A3J G;  3I70 A;  1KAA A;  5D3D A;  4JI0 Q;  2E8G A;  3NEL A;  1QJO A;  3K7A H;  4AQY Q;  4AYB B;  3BDC A;  5BN5 A;  2OT2 A;  5C4X B;  1CKN B;  4X6A H;  4PZ7 A;  2D5D A;  4FNF A;  3G71 A;  2D2C C;  3GD7 A;  4GKJ Q;  4OO1 H;  4GN5 A;  4DV1 L;  1FJG Q;  2AQ3 B;  2Q8T A;  1BNZ A;  4CJ2 C;  1CK1 A;  4LF6 Q;  3AFQ A;  3S17 H;  1F9R A;  2F0W A;  4BWG B;  4WJ3 M;  4NB3 A;  4R9W A;  5KYL A;  1STG A;  2JQO A;  1G2S A;  4CHT B;  3OOC A;  4KY6 A;  4C1N I;  4JI6 L;  2IX0 A;  3TN2 A;  4LNQ A;  4GLA C;  3OIQ A;  2WB1 E;  5M5Y H;  4KHV A;  1TS3 A;  2CWP A;  4XQQ A;  3J80 L;  2WV6 D;  1N32 Q;  4ZCK A;  1M4V A;  1VQH A;  4C56 C;  3SVM A;  2FFK B;  1E1T A;  2K04 A;  4NPS A;  1SJH D;  2P5Z X;  3DUZ A;  1SYC A;  3PO3 G;  5C4Z A;  3HOY B;  1O7Y A;  2PNR C;  4C3J B;  4XYQ A;  4DV2 L;  2JEB I;  1NTG A;  3BYT B;  1CHQ D;  3Q0A A;  2LS0 1;  1HA6 A;  3C1E A;  2A19 A;  4ID6 A;  4LF8 Q;  1I6H H;  4G7O C;  1B8A A;  2AWN A;  1HR0 Q;  1U4R A;  2RSO A;  4CBV A;  3QB3 A;  2K5H A;  5ELN A;  3OW2 A;  1IL2 A;  1B3Q A;  1EY6 A;  2YTX A;  1SRU A;  2DJG C;  3JAM L;  2RHS B;  2BE5 D;  2B2Y C;  2F0Q A;  3I7F A;  3F2U A;  2MUY A;  3URY A;  2CWA A;  2OF1 A;  1H9M A;  5ELB A;  1RHP A;  1O7L A;  2VB3 X;  1RD9 D;  4IPC A;  4IFD I;  3MZ5 A;  5FJ8 G;  2NVY B;  4L5R C;  2LFN A;  1JWS D;  2R3Z A;  5C5L A;  1I4R A;  5FO8 B;  4KI0 A;  3TEH B;  5E1F A;  2MQH A;  3V05 A;  4F87 A;  3SK5 A;  3GTJ H;  1JJ2 A;  1STY A;  2I46 A;  4FF1 A;  1Y8O B;  5H1S E;  4B3M Q;  4S3S A;  4JBK A;  4PZ6 A;  4KHP Q;  1SND A;  3CQZ H;  3MA2 B;  3I4N H;  4O2D A;  1VQ5 A;  1V1P A;  5JPN C;  5T1I A;  1O7Z A;  5HGQ A;  1S4Z A;  2NN6 H;  2L5T A;  4A3D B;  4GS3 A;  4QJF A;  3GTK H;  1EIG A;  1ILP A;  1J6Q A;  2LY7 A;  3KF6 A;  1NSN S;  5IP9 G;  1C8C A;  5ELE A;  1ENF A;  4LJZ C;  2CQA A;  4B9X A;  4NXM Q;  3M4P A;  4Y7N H;  2RCN A;  4DV4 L;  3CCU A;  2CQO A;  3IFT A;  5LMN Q;  5LL6 S;  4NXN L;  3M4O B;  3AFP A;  5GAH C;  4RKB A;  4FF3 A;  4LFA Q;  3RD4 A;  3G48 A;  4EQ5 A;  4A3C H;  4M8A A;  4JCV E;  2F0F A;  2R92 H;  1LTB D;  1MJE A;  2JA6 G;  3D8G A;  2NYZ D;  3HOZ G;  1SFO B;  1IKL A;  1Q1E A;  2DGY A;  3L9A X;  5EKL A;  3CCV A;  2XRQ D;  2MPM A;  2AMC B;  2JA8 B;  1VQ4 A;  5ELC A;  3A8I E;  4MTN A;  1S5D D;  3VA7 A;  5E4W C;  3FVQ A;  3STB C;  1OXU A;  1BVS A;  1ZYR D;  3MVV A;  4C2M B;  4A3J H;  4A3K B;  1N33 Q;  3Q24 A;  2WAQ E;  3CCR A;  4HJA A;  4C3H B;  4IJH A;  5M3F G;  2E2J B;  3NHH A;  3N6R A;  1QOH A;  2KED A;  5JJL A;  1I4P A;  3AMU A;  1IL8 A;  4A3B B;  2JEA I;  2F0S A;  2DUD A;  3NUC A;  1SYF A;  2F0N A;  2Y0S G;  1SSO A;  3L7Z C;  1QVG A;  4GN3 B;  4CKB A;  3DWA A;  1KC8 C;  3ERO A;  1KDB A;  4IPH A;  1I50 B;  2LKV A;  2R61 A;  2RSN A;  1W6K A;  1SDF A;  1SYB A;  5EPK A;  1B7Y B;  4KKU A;  1DJR D;  1RF2 D;  1YNN D;  1L0W A;  4O1N A;  2UUA L;  1X3E A;  2AHO B;  1IYV A;  3CPF A;  4LFC L;  1MSH A;  2XSC A;  2WP8 J;  1UE5 A;  1LTR D;  3NWT A;  4DAY A;  2ASB A;  1LV9 A;  1G6P A;  1EYG A;  3CRK C;  1QG7 A;  3TP5 A;  4JI2 L;  3E9I A;  3H0G G;  1YEZ A;  2H1E A;  3EN2 A;  4AH6 A;  2KCM A;  5GRO A;  4MHE A;  5C44 G;  4JVZ A;  2A5H A;  4UAI A;  1PZK D;  3PO3 H;  4EQO A;  4A93 H;  4R8N A;  1DOL A;  1IBK Q;  2MNA A;  1ET9 A;  1HQR D;  3SXH A;  2SNM A;  3AEV A;  1YHQ A;  1HNZ L;  4LF5 Q;  2EE1 A;  3F2D A;  3S16 B;  4A76 A;  4JI7 Q;  4I65 A;  3QOJ A;  4XQN A;  2F4V L;  1N36 L;  1CHP D;  1HTP A;  1WI5 A;  4TQU S;  1V1P B;  3KLW A;  2NVX H;  3K0Y A;  2WB1 B;  4J6H A;  4B3T Q;  3E5S A;  4OX9 L;  3I55 A;  1KRS A;  2QDB A;  4DR6 L;  2IX1 A;  3KF6 B;  2HDM A;  5C4J B;  2F4I A;  1QUQ A;  4RCN A;  1LT6 D;  4JC0 A;  2K14 A;  1KRT A;  4DR5 L;  1EU3 A;  3W1B A;  5FJ8 H;  1H9S A;  4DV3 L;  3PO2 G;  2A6E D;  2CCZ A;  1K0R A;  2PQA B;  5JOB A;  4QIW E;  3ND9 A;  5ELF A;  3N52 A;  1IHZ A;  1EWI A;  2B2T C;  1HUN A;  2E2I H;  1WTO A;  2QIL A;  1NMG A;  1KL9 A;  5D3I B;  2PMZ E;  4BY7 G;  4PG3 A;  4ZK9 B;  4B3S L;  2E74 C;  5JJZ A;  1EL0 A;  1X3Q A;  4IPD A;  5IP9 H;  5IE8 A;  3PMF A;  3PUZ A;  1MI2 A;  4RGM A;  4YCU A;  4ZQ3 A;  2G5D A;  1VQ9 A;  2HD3 A;  1K8G A;  4A3I B;  1I4H A;  4PMW A;  3NBI A;  1AE2 A;  4DAP A;  4YY3 L;  2UU9 L;  3A74 A;  2B29 A;  3HOW B;  3NBH A;  2B2U C;  3D3R A;  3T4A C;  2JA6 H;  5E7N A;  1X55 A;  3H94 A;  5IT9 E;  2ZTC A;  4JI1 L;  3HOZ H;  1J9O A;  4IN3 A;  4DNI A;  4HIM A;  1NR2 A;  1F2Y A;  4FP5 D;  1C0A A;  2VNU D;  3SK8 A;  4K2L A;  3H6M A;  4ZKC B;  3MFG A;  5BN4 A;  1I4X A;  1SBB B;  1AFP A;  1YIJ A;  2XGT A;  1PH3 A;  1SNC A;  1CKO A;  1I4Q A;  1I3Q H;  4AQY L;  4JBW A;  1V9P A;  1B9N A;  4ILW A;  3PSI A;  1RTO A;  3NP8 A;  3R93 A;  3S9W A;  3FKI B;  1J5E Q;  3S1R H;  1XYI A;  4GOP C;  2Z6K C;  2K7V A;  1EQV A;  5M3F H;  3ZYY X;  4CKE A;  2N55 A;  1WCM B;  1C9O A;  2IHE A;  2BDN A;  3BVZ A;  2GVA A;  3PIP 3;  2PI2 A;  2D0P A;  4PMC A;  4QQB X;  1VQA A;  4K2K A;  3VR3 A;  4YWM A;  1STA A;  3M3Y B;  1IBL L;  3NWS A;  4AYB E;  3W1G A;  4HCS A;  2F0T A;  5GAG C;  4ZLT F;  4HN7 A;  4BY1 G;  2B63 B;  1EYD A;  2IW3 A;  4WRD A;  1N32 L;  1NCV A;  1LYL A;  2PCF B;  2GN5 A;  2AUK A;  3ICE A;  4JK1 C;  1L1O A;  2TSS A;  2KBN A;  1H95 A;  2WAQ B;  1EY9 A;  3DXJ C;  2YU9 B;  4IUV A;  5EKI A;  4JI4 L;  2Z1C A;  2XNA C;  1D5Z C;  1SR3 A;  4K14 A;  4PQX A;  3D4D A;  1WTW A;  3H0G H;  2A6H C;  2ALY B;  2KHJ A;  2X69 A;  1TWA B;  5C4H A;  5C44 H;  2CHB D;  3GTL H;  3HOV B;  3S1N B;  3G7L A;  2O5I C;  1H9S B;  5GAE C;  4HSP A;  3D6W A;  4HJ9 A;  3I56 A;  3S14 B;  2EYM A;  4FXG C;  4A93 B;  4IJL A;  4FF4 A;  3U9O A;  1VQI A;  3E0J A;  1TWF B;  5LMU Q;  3NXW A;  4DF7 A;  1PRT D;  1YBY A;  1STN A;  4OWT B;  2E2H H;  1UE6 A;  1HPC A;  1TWH B;  3MHB A;  2EJM A;  2RBM A;  1QE6 A;  3S2D H;  2YTY A;  3OIP A;  5IP7 G;  3FHW A;  1FYC A;  1VQD A;  2RQX A;  1OXS C;  1CTM A;  3MC0 B;  4DNR B;  1PH9 A;  1J8I A;  3MXG A;  3T1H L;  1JOQ A;  4MN3 A;  4F8M A;  2CH4 A;  4DUY Q;  1K73 C;  2R7Z G;  3G4S A;  3S1M H;  1VS0 A;  2HIV A;  1XNQ L;  3KLR A;  1E1O A;  3F1Z A;  1Q7Y C;  5IOD A;  3PO2 H;  1NMF A;  4GKK L;  4IUP A;  4G4K A;  2A73 B;  4A3E G;  3TS0 A;  4DAM A;  2ZJQ A;  1WTX A;  3HRZ C;  2KCN A;  4MZ9 A;  4G57 A;  4DKA C;  1A6X A;  1WTV A;  4BY7 H;  4NXM L;  1S40 A;  1Q8K A;  1LT3 D;  2EQS A;  4P74 A;  5LMN L;  4X62 Q;  5HUR A;  2FXQ A;  2VUM G;  1T9H A;  4LFA L;  1U0L A;  1WD1 A;  5KYI A;  1TT2 A;  3FRP B;  1XMO Q;  3A7A B;  1E22 A;  3HOX G;  4DV6 L;  1V1O A;  3K58 A;  2F1M A;  1EY7 A;  3KLS A;  3J7A V;  2PQE A;  2ZXR A;  1HZC A;  4OHJ A;  2VL6 A;  1KIX A;  1JT8 A;  1DD2 A;  4GNX A;  5C6A A;  2R93 G;  2HT1 A;  4ULL A;  5IWA L;  2L12 A;  3KF8 B;  1N33 L;  4UP9 A;  1FD7 D;  3GV3 A;  4HR7 B;  5CGK A;  3KDF B;  1SN8 A;  2D62 A;  1D6E C;  1U4P A;  1ZEQ X;  1TS4 A;  1TXY A;  2N8N A;  3J80 E;  2HUG A;  2QF7 A;  1VQ6 A;  4GZY C;  1NAP A;  1QCB D;  3JC6 6;  3CAM A;  2E5L Q;  2F0E A;  1WYD A;  3TZD A;  1CQV A;  1VF5 C;  3J81 L;  1FNU A;  1KTK A;  1BBW A;  3QO2 A;  2D0O A;  5EKK A;  1W6J A;  3I91 A;  1U9R A;  3X3N A;  3L0O A;  1X6O A;  4L5T A;  1B3A A;  1Q12 A;  4DR7 Q;  1IW7 D;  2YYZ A;  2IX3 A;  2A68 D;  3E0E A;  4R1J A;  5CV6 A;  3A54 A;  1MBY A;  4A3M B;  4L5S A;  4DR4 Q;  2BDO A;  2MO0 A;  1JB7 A;  4FF2 A;  2AKW B;  3U4Z A;  4DV0 L;  1BF4 A;  4BY1 H;  1TWC H;  1TKW B;  3UE1 A;  2ZTE A;  2VS1 A;  1BCP F;  4JI5 Q;  3H3V I;  1Y1V G;  3KBG A;  2UUC Q;  1ESF A;  1JOO A;  1PYS B;  5K5P A;  4IFD G;  1C48 A;  3JAM E;  3V2T A;  2I07 B;  1YJN A;  1MIU A;  1YNX A;  3J80 i;  4HJ7 A;  3GTM H;  2HQL A;  2V4D A;  3R3O A;  3OSO A;  1TWG B;  4E6I A;  5M3M B;  3T1Y Q;  1JC7 A;  4DPG A;  1IBK L;  4UP8 A;  1WTH A;  3OHX C;  2AWO A;  2YTV A;  4HMI A;  1PH7 A;  2K5N A;  4JBM A;  4X3S A;  4MNO A;  2SDF A;  4CJ1 B;  3NTI A;  4KHZ A;  1PA6 A;  4IUQ A;  4YCW A;  1NNX A;  5KIX A;  4BBR G;  1PTO F;  5EAY A;  2TMP A;  4DR1 L;  3CF5 A;  2F0P A;  2JYO A;  2M2L A;  3BS1 A;  3GTP B;  3I90 A;  3RZO H;  3EFX D;  4JW0 A;  2F0J A;  3GTG B;  2HCI A;  4R4O A;  5IGD A;  3R2I A;  4L63 B;  1LT4 D;  5C3W A;  3H15 A;  2OWO A;  3JAM i;  4IUR A;  2UXD Q;  1GVP A;  4DK0 A;  1PDQ A;  5IP7 H;  3S15 H;  3J7A F;  5GQO A;  4JI3 L;  3NE5 B;  3H91 A;  4DK3 C;  4DR3 Q;  4LF9 Q;  2RCF A;  1VQ8 A;  2R7Z H;  1GKH A;  1NR4 A;  3CC4 A;  3CCE A;  2I5M X;  3TBI B;  1PH2 A;  3M7G A;  1F9P A;  2G9D A;  1CUK A;  4R4T A;  1D5X C;  4JOI A;  2R7F A;  3OTO Q;  4A3E H;  3CD6 A;  1GO3 E;  2A69 D;  5A35 A;  5M5X H;  2HHH L;  2KUM A;  1Y14 B;  1Z47 A;  4DUZ Q;  2ZJR A;  2PO4 A;  2JA5 B;  4O42 A;  4LF4 L;  5C5M A;  1PYW D;  4AIM A;  1GUO A;  3LNN A;  2VUM H;  2H4O A;  3CCL A;  4WJW A;  1DYQ A;  3RLF A;  2F03 A;  3SDZ A;  1SE2 A;  2K4K A;  2QGQ A;  4JV5 Q;  1Q3L A;  3CMA A;  4LMQ D;  4LUV A;  4GOP B;  1K3R A;  4X3K A;  4NMZ A;  2EYF A;  1RTN A;  3VYR A;  4A3F B;  5IYC G;  2VQF Q;  3I4O A;  4C3I B;  2EYL A;  2JA7 G;  1HZ9 A;  1RJT A;  2R93 H;  2F3W A;  1PV4 A;  1QNK A;  2WAC A;  2DY8 A;  1SE4 A;  4U67 3;  1HNW Q;  3S2H B;  5ISR A;  1SYE A;  2YV5 A;  1X56 A;  3ZJY C;  3A8J E;  3BYY B;  3A5Z B;  1Y1W G;  4GLV B;  1LT5 D;  1MHW C;  1BCP D;  1JE4 A;  2EYO A;  3RLO A;  2NVT H;  1HNX Q;  4PNY A;  1N34 L;  2NZH A;  3STB D;  2EY1 A;  3OMC A;  1VQG A;  2KHS A;  3BDL A;  2O2L D;  1CQF A;  5FKA C;  2F0K A;  2K50 A;  4KK7 A;  1VQE A;  4UDU C;  1B50 A;  4DV7 L;  1MKH A;  3WDN A;  1EY4 A;  2ZM6 L;  1C7Y A;  1Z7T A;  1RKN A;  4X65 L;  3NPP A;  5IT9 c;  3GO5 A;  3CCS A;  3MXN A;  3HOU B;  2B2W A;  4A3G B;  1Y1V H;  4IFD H;  3SE0 A;  1AE3 A;  1JIC A;  1PTO D;  3K57 A;  3HKZ B;  3NQI A;  2KEE A;  3NEM A;  2J7Z A;  1YJ9 A;  1NE3 A;  5J3B A;  1GUN A;  1SNQ A;  1S5E D;  3ONA B;  1CZW A;  2KCC A;  1A3V A;  1CT1 D;  3A56 A;  5KRU A;  1SJE D;  1CA5 A;  1EY0 A;  3AU7 A;  5M9O A;  3R8B A;  4DAV A;  1E2Z A;  2Q2I A;  4EQN A;  2KCT A;  1PMR A;  2IJ0 A;  1QWY A;  2SOB A;  1PYB A;  1I4G A;  4DV5 Q;  4BBR H;  5IGE A;  3K7A B;  4CDF C;  1P8L A;  1VCI A;  4B9W A;  4TVA B;  1EZ6 A;  1HUM A;  5JJI A;  4QY7 A;  3BDO A;  5I6Y A;  3IAY A;  4HIK A;  2DN8 A;  1XNR L;  1IYU A;  4B3R Q;  5IYB G;  2FJ2 A;  4DUY L;  2MHV A;  5M5W H;  2BH8 A;  2UXC L;  4DR2 L;  1AH9 A;  1QZG A;  3C1F A;  3S17 B;  4JI8 Q;  3AYH B;  2B2V C;  5FK9 C;  2VXW A;  3GTQ H;  1EFW A;  5J1Z A;  5FLX L;  4BBS G;  3C2P A;  3M85 A;  1ESR A;  3I4M G;  1L1O C;  3V96 A;  3HKS A;  5M5Y B;  2DJF C;  3S1Q H;  1GUW A;  4Q0F A;  3TQY A;  2NVQ H;  3T16 A;  5C3E G;  5FLM G;  1ENA A;  4KN7 C;  3UI2 A;  4RCO A;  2PW5 A;  3LWE A;  4XXE A;  2XN9 C;  1EIH A;  2RDF A;  2K05 A;  4OL7 A;  2ZXO A;  2I0Q A;  2ZXP A;  1XMQ L;  3SK4 A;  3DLL A;  3RN2 A;  1IBM Q;  3OWE B;  3IFD A;  1KAW A;  5C0X J;  1ZYR C;  1XJV A;  1JMC A;  2CW0 C;  2X6G A;  3NEN A;  4H13 C;  1PHJ A;  2A1A A;  3A7L A;  5AJ3 L;  5ELO A;  4X64 L;  1W3S A;  1ZKO A;  1I6H B;  4RH6 A;  1TY0 A;  3TRE A;  2BH2 A;  3PIP A;  1Q81 C;  4A3L G;  4AYB G;  1KAB A;  4OWW B;  1DCZ A;  4YHH Q;  3RN5 A;  5IYC H;  5C4X G;  1LTI D;  1R9T H;  1E7Z A;  5BN3 A;  2JA7 H;  1EEI D;  1D5M C;  2PZT A;  4FXD A;  4UP7 A;  3VYT A;  2C35 B;  2LXK A;  3K5O A;  2B3G A;  1EWC A;  5JJK A;  1AP0 A;  4ZYS A;  2Z8L A;  3ULJ A;  3G6E A;  1YNN C;  4RMF A;  2PZU A;  4K0K Q;  1PRT F;  1IXR A;  2BCO A;  2PI2 E;  4OEL B;  3GTJ B;  1Y1W H;  5C3X A;  1GHK A;  1SEB D;  2IHF A;  2HDL A;  1KNE A;  2F0V A;  3S24 A;  5JVG 3;  2CH4 W;  2VW9 A;  1K3B C;  3CQZ B;  1K8M A;  3I4N B;  1EIF A;  1TII D;  5LMN W;  3W5O A;  4DR7 L;  4RGN A;  5KNB A;  2HQE A;  2IY5 B;  4IAL A;  1B4O A;  2AQ1 B;  3GTK B;  2K5Q A;  1WOC A;  2JK8 A;  5ELD A;  4JI6 Q;  4K8I A;  2F0H A;  4F88 A;  2PW7 A;  1VQJ A;  2XWB B;  3HOY G;  4Y7N B;  1GHJ A;  1PFB A;  2N88 A;  2MJ8 A;  3NSW A;  2LSS A;  4C3J G;  4LFB L;  3BZC A;  1VQ7 A;  1YIT A;  1YVC A;  1NBW A;  1Q86 C;  5HY6 A;  4LUO A;  5CV5 A;  4X66 L;  2R92 B;  1TY2 A;  5EJW A;  3CCJ A;  4IPG A;  3TP6 A;  1X32 A;  4DV2 Q;  4JI0 L;  5IIF A;  1XPU A;  1QVF A;  4A75 A;  1H9R A;  5GAD C;  3J80 c;  1WTR A;  3E9H A;  1CFM A;  4OON A;  4JG2 A;  2RDG A;  2A6E C;  5KND A;  1VQP A;  2DY7 A;  4A3J B;  2BOS A;  4KJO A;  1UE1 A;  1PTO H;  4XIG S;  4DAY B;  4X3T A;  4GKJ L;  4RG1 A;  1FJG L;  1SMY C;  1STH A;  4LF6 L;  2EXZ A;  1PH8 A;  1A63 A;  3PCO B;  1BDO A;  3WOE A;  3D4R A;  4A3D G;  5IGC A;  2OTJ A;  1JE5 A;  1GUG A;  1LM0 A;  2EYH A;  3D6C A;  1TR5 A;  5IYB H;  4YIJ A;  1UUP A;  5FOB B;  1WVL A;  5M5W B;  3JAM c;  1YNJ D;  4P71 A;  3GTO H;  1GUT A;  4BBS H;  3OYY A;  3I4M H;  2L9H A;  4ALP A;  3QR8 A;  1K9M C;  1F2Z A;  2EYP A;  2VB2 X;  4KV6 A;  2BA0 A;  5C3E H;  5FLM H;  2OEO A;  4K6L A;  3PUX A;  5CV7 A;  2I5L X;  4KMU C;  2K1B A;  2ID0 A;  1QUQ B;  3VR6 A;  4DV4 Q;  3J7Z C;  1WTQ A;  1HZA A;  4TKO B;  4NXN Q;  4GLX A;  1X3F A;  2PZW A;  3M9B A;  4FXK C;  1I94 Q;  1SE3 A;  4LF8 L;  4MTK A;  2JA8 G;  5NUC A;  1HR0 L;  3PO3 B;  1K83 H;  2JE6 I;  2JXM B;  2B39 A;  4OIK A;  1W2B A;  3NTH A;  3K80 C;  5IGB A;  1AEX A;  5DM7 3;  1U5K A;  1K8A C;  4WJ4 A;  4A3K G;  2D9U A;  1YI2 A;  2R7D A;  3DM3 A;  4ZKB B;  4DXF A;  1V8Q A;  3J81 E;  1XTC D;  1ML0 D;  3OPO A;  4J8Q A;  4C1N K;  4XDX A;  4C3H G;  4Q5V A;  2NVX B;  4A3L H;  1M1K C;  1UE7 A;  3PQI A;  3ITP A;  3RLN A;  1TVX A;  2QKI C;  5C4X H;  4DGZ A;  5DEH A;  3CPW A;  4A3B G;  1KD1 C;  4TSS A;  4ABN A;  1VQK A;  2OTL A;  3FPP A;  4B3M L;  3EA6 A;  4J1M A;  5I6W A;  4KHP L;  2PNH A;  4XQJ A;  4TRD A;  3NBH B;  3U50 C;  2NZO A;  2ICE C;  2EDG A;  1PLF A;  5CYU A;  2GA4 B;  4DK1 A;  2QW7 A;  3RNU A;  3C46 A;  1PZJ D;  2L1B A;  4NKL A;  1L0Y B;  2PYK A;  3F2C A;  5L37 A;  1S5B D;  4DN4 M;  1PXU A;  2JP1 A;  3Q22 A;  2E2I B;  1NJI C;  3IRB A;  5HGT A;  5F2D A;  1CZG A;  5DM6 3;  4CKC A;  2NTT A;  1DOM A;  1OXX K;  5BR8 Q;  3J81 i;  1XX8 A;  4P2C B;  2C9O A;  2UUA Q;  2K5W A;  1PVO A;  2Z0S A;  2ES2 A;  1CKN A;  4LFC Q;  2K28 A;  3BG3 A;  4CDD C;  3HOY H;  3NK9 A;  3ER0 A;  4H44 C;  1KDC A;  2OQK A;  3F2B A;  2XWJ B;  3G6J B;  4DA2 A;  2FMM A;  5COY A;  2LXJ A;  3GQB A;  1DXM A;  1BCP B;  5C0X I;  4R8I A;  2L15 A;  1SNO A;  4JI2 Q;  3I72 A;  4IOA A;  3R2T A;  1LO5 D;  3MWY W;  1EQT A;  1FGB D;  2JA6 B;  4RGO S;  4V0B A;  4RWS C;  3O13 A;  4I7A A;  4UY8 C;  5E3F A;  3KUP A;  1T5X D;  3HOZ B;  1B9M A;  5IOC A;  2WB1 G;  1HNZ Q;  3K5M A;  4EGV A;  1P16 A;  2RKS A;  5JVH 3;  3MEF A;  3KK7 A;  1NUC A;  4P72 A;  3H09 A;  2ZJP A;  2J4X A;  4RFB A;  1N36 Q;  1O78 A;  3HKZ E;  4APV A;  3L2P A;  4X3U A;  1I3Q B;  2NVY H;  1L1O B;  1SMX A;  2UXB Q;  4OX9 Q;  1BXT A;  2MGS A;  2ZT9 C;  4DR6 Q;  4DFA A;  3S1R B;  1BBX C;  5LL6 X;  1CI3 M;  4KY5 A;  1U4L A;  5M3F B;  2IT1 A;  4DR5 Q;  1E2V A;  2Q8R E;  1VQB A;  3FEW X;  4JI8 L;  2EZV A;  4IUT A;  4F7X A;  4DV3 Q;  1JWM D;  2Y0S B;  5G3L D;  4A3D H;  1VQC A;  1S5C D;  4HAE A;  1G2T A;  2QEJ C;  1V1Q A;  1L0X B;  4HCE A;  3GV6 A;  2XRS D;  5T1G A;  1TS2 A;  1E24 A;  3CRL C;  4RGT A;  4HID A;  1Z6H A;  3I4L A;  4A3I G;  4B3S Q;  1YZ6 A;  2F0I A;  4HJ8 A;  1VQL A;  2WKD A;  3TME A;  5E4X A;  1A2T A;  4P73 A;  3HOW G;  4K6D A;  4OO1 I;  2F3V A;  1G8Z D;  1DOK A;  3BJU A;  4BA1 I;  2C5C A;  1CM9 A;  3WOF A;  4QL5 A;  1SFO H;  4LF5 L;  3W3A A;  5CV9 A;  2OXP A;  3H0G B;  2CFM A;  1SNM A;  3OWF A;  5TSS A;  4YY3 Q;  1JJG A;  3GTL B;  5C44 B;  4JI7 L;  4EVO A;  1HTL D;  3K5L A;  2JA8 H;  2AUJ D;  3ULL A;  4CDC C;  1D2B A;  3D4W A;  3HP3 A;  2A8V A;  3PUW A;  1S72 A;  4B3T L;  3BVM A;  4JI1 Q;  4C2M H;  4A3K H;  1HQM C;  4WOR A;  3ERS X;  1CA6 A;  1BO0 A;  3FKI G;  3P7J A;  2L0C A;  2E2H B;  1EQQ A;  3MAQ A;  4A4I A;  5KGU A;  4C3H H;  2RF4 A;  4OGQ C;  1X9N A;  1IW7 C;  2E2J H;  5A2Q L;  2A68 C;  1WCM G;  3U4V A;  2K32 A;  5CBE E;  3H3V H;  3OW7 A;  3S2D B;  4QF4 A;  4IQZ A;  4A3B H;  3I8Z A;  3LGJ A;  4K0K L;  1G29 1;  2NBF A;  2ATW A;  3CXC A;  3T51 B;  4Z9C B;  4IO9 A;  2VZA A;  1I50 H;  1ASZ A;  2RDH A;  3S1M B;  4LF7 Q;  3MXU A;  3QJY A;  1STE A;  2KJX A;  5IY0 A;  2B63 G;  2O4X A;  1AZQ A;  3PO2 B;  3ERQ A;  2FHT A;  2Q2H A;  2VQE Q;  2B8F A;  4GNX B;  3BZD B;  3X3M A;  4CDE C;  5JEA G;  1MGS A;  5K36 G;  1IBL Q;  3CC2 A;  4K5X A;  1Y8N B;  5EPJ A;  3A55 A;  1S3O A;  2OQ0 A;  2WAQ G;  4BY7 B;  2B8G A;  2NWG A;  2M00 A;  3P75 A;  4IUU A;  1UWV A;  2KA7 A;  3RR5 A;  4OIJ A;  1Y69 U;  3MXP A;  1O80 A;  5IYD G;  1A3U A;  3HOX H;  1SNP A;  4RHS A;  1YHB A;  3HOV G;  3WWV A;  4BS9 A;  1M8A A;  4R4I A;  1YHA A;  5EPL A;  4A93 G;  4FDB A;  4JI4 Q;  1JQY D;  2JN4 A;  2EOT A;  4JBJ A;  2NN6 I;  4LAA A;  4QUF A;  3S16 H;  1CSP A;  1DGS A;  2L11 A;  1JOR A;  4G7Z C;  3RMH A;  1UEA B;  3K5N A;  1X65 A;  5I9O A;  1EEF D;  3DEO A;  3CC7 A;  2RA4 A;  2IWH A;  1VMP A;  3SHL A;  4JYA Q;  1J5E L;  5FLX E;  5C4J H;  3KBX A;  4KJN A;  2QA4 A;  3P20 A;  4PZ8 A;  2MP1 A;  1EIY B;  4FYD A;  4HJ5 A;  2EY2 A;  1U4M A;  2Q8I B;  2GVB A;  4K5V A;  2A69 C;  4B08 A;  2WIN B;  3U9S A;  3NQT A;  3HS0 C;  1EY5 A;  3T1H Q;  4XTC S;  1UEB A;  4POF A;  1XNQ Q; 
#chains in the Genus database with same CATH homology
 3G6E A;  1OXT A;  3A5U A;  2Q2U A;  2K75 A;  1Q82 C;  4RMF A;  1VQI A;  2UU9 Q;  3KYH C;  4K0K Q;  4LFB Q;  1IXR A;  2PI2 E;  5LMU Q;  4GKK Q;  1Y1W H;  1YBY A;  2E2H H;  4OWT B;  1UE6 A;  2IHF A;  4OXP A;  3BZK A;  1G51 A;  1KHI A;  3CCM A;  2RHQ B;  1LUZ A;  4X66 Q;  3S24 A;  1X3G A;  2VW9 A;  1GM5 A;  3I2Z A;  1EOV A;  3S2D H;  1EIF A;  5LMN W;  2YTY A;  4KLK A;  3W5O A;  4YHH L;  4A3I H;  4BA2 I;  4DR7 L;  5IP7 G;  2IY5 B;  3FHW A;  4A3J G;  1VQD A;  4JI0 Q;  1WOC A;  1OXS C;  2JK8 A;  2VY3 A;  3HOW H;  1I94 L;  1PH9 A;  3T1H L;  2E8G A;  4JI6 Q;  1A62 A;  4DUY Q;  3NEL A;  4DV6 Q;  2PQA A;  3G4S A;  1K73 C;  1VS0 A;  2HIV A;  1VQJ A;  1XNQ L;  3S1M H;  1E1O A;  3K7A H;  4AQY Q;  3ULP A;  3HOY G;  3F1Z A;  1Q7Y C;  3PO2 H;  2LSS A;  4LFB L;  1NMF A;  3M7N A;  1CKN B;  4GKK L;  5LMU L;  3BZC A;  3VDY A;  4PZ7 A;  4YCV A;  4A3E G;  1VQO A;  3TS0 A;  1YIT A;  1VQ7 A;  1YVC A;  4X6A H;  1NBW A;  3G71 A;  1Q86 C;  4DAM A;  5HY6 A;  4LUO A;  2ZJQ A;  3GD7 A;  4GKJ Q;  2UUB Q;  2EXD A;  4GN5 A;  4X66 L;  4MZ9 A;  4DV1 L;  1FJG Q;  1VQN A;  4DKA C;  4BY7 H;  3CCJ A;  1S40 A;  4LF6 Q;  3AFQ A;  4NXM L;  3S17 H;  1Q8K A;  4IPG A;  4WJ3 M;  5IWA Q;  4NB3 A;  2EQS A;  2QEX A;  4P74 A;  5LMN L;  4X62 Q;  2FXQ A;  3FKI H;  4DV2 Q;  4JI0 L;  2VUM G;  1XPU A;  1T9H A;  1QVF A;  2JQO A;  4LFA L;  1U0L A;  4A75 A;  5GAD C;  1JJC B;  3J80 c;  4JI6 L;  2IX0 A;  1XMO Q;  4LNQ A;  4GLA C;  1E22 A;  2WB1 E;  5M5Y H;  3HOX G;  3E9H A;  3D31 A;  4DV6 L;  1WCM H;  1SRO A;  4H02 A;  2CWP A;  4OON A;  4JG2 A;  1N32 Q;  3J7A 5;  1VQH A;  3KOJ A;  3PUY A;  1VQP A;  1WJJ A;  1A0I A;  1IZ6 A;  1UE1 A;  1OXV A;  4XIG S;  4A3M G;  3M3Y H;  1HZC A;  4DAY B;  4GKJ L;  2VL6 A;  1E1T A;  4RG1 A;  1KIX A;  1SE8 A;  1JT8 A;  4NPS A;  1FJG L;  4GNX A;  3PO3 G;  2F52 A;  4LF6 L;  2R93 G;  2B63 H;  2HT1 A;  5IWA L;  1PH8 A;  1YJW A;  3PCO B;  1A63 A;  1I5F A;  3BU2 A;  3KF8 B;  4X62 L;  4DV2 L;  2JEB I;  1N33 L;  1NTG A;  4UP9 A;  5BR8 L;  3KDF B;  4A3D G;  2A19 A;  2OTJ A;  1JE5 A;  1LM0 A;  1SN8 A;  5IYB H;  1Q46 A;  1XMO L;  1HR0 W;  2D62 A;  4LF8 Q;  1I6H H;  2R6G A;  1B8A A;  2AWN A;  1TXY A;  4DV0 Q;  1HR0 Q;  5M3M G;  2YU9 H;  2N8N A;  1LTL A;  1PH1 A;  3JAM c;  3K81 C;  1VQ6 A;  4P71 A;  2K5H A;  5ELN A;  3OW2 A;  1IL2 A;  5IYD H;  3GTO H;  2YTX A;  4BBS H;  1SRU A;  1VQF A;  1TWA H;  2RHS B;  3J81 c;  3OYY A;  3JC6 6;  2JJQ A;  3CAM A;  3HOV H;  3I7F A;  3I4M H;  3S1N H;  2E5L Q;  1WYD A;  4ALP A;  1FL0 A;  2CWA A;  2XTI A;  1K9M C;  3HFZ B;  1BBW A;  1E3P A;  3EBE A;  2BA0 A;  5C3E H;  2D0O A;  5FLM H;  3S14 H;  3PUX A;  1N9W A;  2I5L X;  1X6O A;  3L0O A;  4IPC A;  4L5T A;  2ID0 A;  1QUQ B;  1Q12 A;  1RIP A;  5FJ8 G;  4DR7 Q;  4IFD I;  2YYZ A;  4L5R C;  4DV4 Q;  3J7Z C;  3E0E A;  1HZA A;  4R1J A;  1D8L A;  1GD7 A;  1TWF H;  4KI0 A;  3TEH B;  1X3F A;  2MQH A;  3M9B A;  3GTJ H;  4GLX A;  3J81 j;  4L5S A;  1JJ2 A;  1I94 Q;  4DR4 Q;  4LF8 L;  2MO0 A;  3A0J A;  3F8T A;  1JB7 A;  3SGI A;  2K5V A;  2JA8 G;  5H1S E;  2AKW B;  3U4Z A;  4DV0 L;  1HR0 L;  1PVO A;  4B3M Q;  1K83 H;  1TWH H;  1TWC H;  3UE1 A;  4BY1 H;  4JBK A;  2JE6 I;  4PZ6 A;  3RZD H;  2ZTE A;  4KHP Q;  2VS1 A;  3CQZ H;  4JI5 Q;  3AQQ A;  1W2B A;  3H3V I;  3I4N H;  3K80 C;  1Y1V G;  4O2D A;  1VQ5 A;  1U5K A;  1K8A C;  2UUC Q;  1PYS B;  4R4C A;  4IFD G;  2UXB L;  3PV0 A;  4DK6 C;  5HGQ A;  4WJ4 A;  3MXN B;  4A3K G;  3UDF A;  1YI2 A;  4GS3 A;  4QJF A;  3GTK H;  4DR1 Q;  2R7D A;  3DM3 A;  1YJN A;  1MIU A;  2E5L L;  1J6Q A;  3KFU A;  2EIF A;  1YNX A;  3J80 i;  4HJ7 A;  3GTM H;  2HQL A;  3KF6 A;  3T1Y Q;  5IP9 G;  4DV1 Q;  3K8A A;  4DPG A;  3CCQ A;  4UP8 A;  1IBK L;  4NXM Q;  3M4P A;  2AWO A;  4Y7N H;  2RCN A;  2YTV A;  1M1K C;  4A3L H;  1MJC A;  1UE7 A;  2OCE A;  1PH7 A;  2K5N A;  4DV4 L;  2MO1 A;  3CCU A;  4JBM A;  3RLN A;  2CQO A;  4BXX G;  5LMN Q;  3CPW A;  5C4X H;  1VQM A;  4NXN L;  3AFP A;  5GAH C;  4A3B G;  4DR4 L;  1KD1 C;  4LFA Q;  4MNO A;  3EIV A;  3G48 A;  4EQ5 A;  4JI3 Q;  4A3C H;  4JCV E;  1VQK A;  2OTL A;  4KHZ A;  1PA6 A;  4B3M L;  4J15 A;  2R92 H;  4KHP L;  4YCW A;  1MJE A;  1KQS A;  2PNH A;  4IOC A;  2JA6 G;  4JI5 L;  2JA5 G;  3UE0 A;  4BBR G;  3NBH B;  3U50 C;  4ME3 A;  2NZO A;  2UUC L;  5EAY A;  3HOZ G;  1Q1E A;  2DGY A;  3CCV A;  3RNU A;  4DR1 L;  3CF5 A;  2AMC B;  3F2C A;  2HHH Q;  3RZO H;  1VQ4 A;  3KJO A;  3T1Y L;  4R4O A;  4GNX C;  2Y0S E;  4MTN A;  1NJI C;  3H15 A;  3IRB A;  1PH5 A;  1HH2 P;  3STB C;  3JAM i;  2OWO A;  4LF4 Q;  2UXD Q;  1D7Q A;  3CP0 A;  1OXU A;  1GVP A;  1BVS A;  5IP7 H;  2N3S A;  3PF4 A;  4A3J H;  1N33 Q;  2N49 A;  1OXX K;  3S15 H;  5BR8 Q;  5GQO A;  1HZB A;  2WAQ E;  4JI3 L;  3J81 i;  4DK3 C;  3FP9 A;  4DR3 Q;  4A3F G;  2UUA Q;  1VQ8 A;  1HJP A;  3CCR A;  4HIO A;  2MFI A;  3GDE A;  3PUV A;  4LF9 Q;  1CKM A;  2Z0S A;  1GKH A;  2CKZ B;  4HJA A;  1CKN A;  2ES2 A;  3CCE A;  2I5M X;  3CC4 A;  4IJH A;  4LFC Q;  5M3F G;  3HOY H;  3ER0 A;  1PH6 A;  1PH2 A;  2OQK A;  4R4T A;  1CUK A;  3F2B A;  5JJL A;  4JOI A;  2R7F A;  3OTO Q;  4YWK A;  4A3E H;  3CD6 A;  1GO3 E;  4P75 A;  2LXJ A;  2JEA I;  5C0X I;  2DUD A;  1QVG A;  2L15 A;  2Y0S G;  3L7Z C;  4JI2 Q;  4IOA A;  5M5X H;  2HHH L;  4GN3 B;  1Y14 B;  1Z47 A;  1KC8 C;  4DUZ Q;  2ZJR A;  4IPH A;  4UY8 C;  4LF4 L;  2UXD L;  3PF5 A;  4AIM A;  2VUM H;  1B70 B;  2WB1 G;  1B7Y B;  1HNZ Q;  2R7Z H;  3CCL A;  1P16 A;  3RLF A;  1L0W A;  1QZH A;  4DR3 L;  4LF9 L;  2UUA L;  1X3E A;  5C0X G;  2K4K A;  2AHO B;  1EQR A;  3MEF A;  3CPF A;  4LFC L;  2QGQ A;  4JV5 Q;  4P72 A;  2WP8 J;  2WFW A;  1UE5 A;  3CMA A;  2ZJP A;  1N36 Q;  4LUV A;  4LF7 L;  3HKZ E;  4APV A;  3L2P A;  4GOP B;  1K3R A;  2ASB A;  2H5X A;  2NVY H;  1L1O B;  3OTO L;  1SMX A;  2UXB Q;  1EYG A;  1G6P A;  3CME A;  4OX9 Q;  2VQE L;  2I5H A;  1N34 Q;  4JI2 L;  3E9I A;  4DR6 Q;  4A3M H;  3H0G G;  1YEZ A;  5IYC G;  2VQF Q;  3EN2 A;  2KHI A;  3I4O A;  2KCM A;  5GRO A;  4AH6 A;  5C44 G;  2JA7 G;  4DUZ L;  1HZ9 A;  3PO3 H;  2R93 H;  4A93 H;  2IT1 A;  3KDF A;  1IBK Q;  2MNA A;  4DR5 Q;  1PV4 A;  1VQB A;  3HOU G;  4A3G G;  4JI8 L;  4DV7 Q;  3AEV A;  1YHQ A;  4DV3 Q;  1HNW Q;  1HNZ L;  1ASY A;  4LF5 Q;  2ZM6 Q;  4A3D H;  2YV5 A;  1X56 A;  3ZJY C;  3F2D A;  1VQC A;  2JA9 A;  4YWL A;  3A5Z B;  3HKZ G;  4X65 Q;  4A76 A;  4JI7 Q;  4JV5 L;  1V1Q A;  1Y1W G;  1TWG H;  2F4V L;  5M3M H;  1N36 L;  4GLV B;  5DLQ E;  1WI5 A;  1XPO A;  4TQU S;  3KLW A;  2NVX H;  1V43 A;  1E24 A;  3RLO A;  2NVT H;  4B3T Q;  1HNX Q;  4OX9 L;  4HID A;  3I55 A;  1KRS A;  1N34 L;  4A3I G;  4B3S Q;  4DR6 L;  2NZH A;  1YZ6 A;  3STB D;  2IX1 A;  3KF6 B;  2VQF L;  4HJ8 A;  1VQL A;  1VQG A;  1QUQ A;  2BA1 A;  4OWX B;  1XPR A;  2ZTD A;  4P73 A;  3HOW G;  4OO1 I;  4JC0 A;  2K50 A;  1VQE A;  2K14 A;  1KRT A;  2R7Z G;  4DR5 L;  3BJU A;  3W1B A;  1Z9F A;  4BA1 I;  5FJ8 H;  4DV7 L;  1MKH A;  1Q1B A;  4QL5 A;  4DV3 L;  1SFO H;  1HNW L;  4QGU A;  4LF5 L;  2ZM6 L;  3PO2 G;  4JYA L;  4R4Q A;  1C7Y A;  2CCZ A;  2KEN A;  2K52 A;  2CFM A;  1K0R A;  4YY3 Q;  2PQA B;  1JJG A;  3GTP H;  4QIW E;  4X65 L;  4JI7 L;  3PIO A;  2JA8 H;  4IFD J;  3ULL A;  4LW1 A;  1QVC A;  5IT9 c;  4NXN Q;  1EWI A;  3GO5 A;  3GTG H;  3CCS A;  2A8V A;  2E2I H;  4OO1 G;  1NMG A;  3PUW A;  1KL9 A;  1S72 A;  1KXL A;  1Y1V H;  2PMZ E;  4B3T L;  1HNX L;  4JI1 Q;  4BY7 G;  4JOI C;  4PG3 A;  4C2M H;  4A3K H;  4B3S L;  1AE3 A;  3ERS X;  1PH4 A;  3FKI G;  3KJP A;  3NEM A;  1XNQ Q;  4IPD A;  5IP9 H;  1YJ9 A;  1EQQ A;  4A4I A;  1NE3 A;  5IE8 A;  5J3B A;  4Y52 H;  1XNR Q;  3Q8D A;  4C3H H;  2RF4 A;  1X9N A;  2E2J H;  3PUZ A;  1WCM G;  4BXX H;  1PFS A;  1L2F A;  4YCU A;  1WFQ A;  4LUZ A;  4DR2 Q;  3U4V A;  1VQ9 A;  3H3V H;  2UXC Q;  1K8G A;  4PMW A;  3UDG A;  1AE2 A;  4A3B H;  1NY4 A;  3LGJ A;  4YY3 L;  2UU9 L;  4K0K L;  1G29 1;  3A74 A;  2ATW A;  2B29 A;  1BBU A;  2Q2I A;  3CXC A;  2KCT A;  4IO9 A;  1N8R C;  2VZA A;  2JA6 H;  2N78 A;  1PYB A;  1I50 H;  5E7N A;  1X55 A;  1ASZ A;  2JA5 H;  4LF7 Q;  4DV5 Q;  2ZTC A;  4BBR H;  1OTC A;  4JI1 L;  4C3J H;  1P8L A;  5IY0 A;  3HOZ H;  1VCI A;  2B63 G;  4DNI A;  4HIM A;  2Q2H A;  4TVA B;  2VQE Q;  4GNX B;  1C0A A;  5JJI A;  4QY7 A;  2VNU D;  1XTD A;  5JEA G;  4HIK A;  1XMQ Q;  5K36 G;  3UDI A;  1XNR L;  1IBL Q;  3CC2 A;  4B3R Q;  5IYB G;  1YIJ A;  2XGT A;  1PH3 A;  1CKO A;  3U58 A;  4DUY L;  5M5W H;  1S3O A;  2BH8 A;  2OQ0 A;  2WAQ G;  2UXC L;  4DR2 L;  1AH9 A;  1QZG A;  1I3Q H;  3UDX A;  4JBW A;  1V9P A;  4AQY L;  4JI8 Q;  5FLX c;  3AYH B;  3PSI A;  1BKB A;  1SLJ A;  1FVI A;  1UWV A;  3RR5 A;  3GTQ H;  1J5E Q;  1EFW A;  5IYD G;  3S1R H;  4A3F H;  4BBS G;  1A8V A;  3HOX H;  4GOP C;  2Z6K C;  3M85 A;  1YHB A;  4C3I H;  1M90 C;  3HOV G;  1L1O C;  3I4M G;  5M3F H;  2F4V Q;  3HKS A;  1CSQ A;  4GN4 B;  3WWV A;  4X64 Q;  5AJ3 Q;  2UUB L;  2F3I A;  3S1Q H;  4DV5 L;  3TQY A;  1C9O A;  2IHE A;  3PGZ A;  5JEA J;  4R4I A;  1YHA A;  5C3E G;  2NVQ H;  4FDB A;  5FLM G;  4JI4 Q;  4A93 G;  2GVA A;  2PI2 A;  2D0P A;  4JBJ A;  3S2H H;  2NN6 I;  4QQB X;  1VQA A;  2I0Q A;  1XMQ L;  2Q2T A;  3S16 H;  1CSP A;  1DGS A;  1X54 A;  4L5Q A;  4YWM A;  3TRZ A;  3TS2 A;  1IBL L;  4O0A A;  4AYB E;  4B3R L;  3DLL A;  3RN2 A;  1IBM Q;  3W1G A;  1KAW A;  5GAG C;  5C0X J;  4BY1 G;  1X65 A;  1XJV A;  1JMC A;  1N32 L;  4UPA A;  3B6Y A;  3CC7 A;  3I4N G;  4JYA Q;  1O7I A;  1J5E L;  1LYL A;  3NEN A;  1PHJ A;  2GN5 A;  1FGU A;  4EX5 A;  2A1A A;  2NN6 G;  2Z6K A;  5C4J H;  4GOP A;  3ICE A;  2QA4 A;  1L1O A;  4PZ8 A;  5AJ3 L;  5ELO A;  4X64 L;  1W3S A;  1EIY B;  2KBN A;  3TRE A;  1H95 A;  4HJ5 A;  4POG A;  4JI4 L;  3K0X A;  2BH2 A;  3CW2 C;  2GVB A;  3PIP A;  1Q81 C;  4LWC A;  1SR3 A;  2HIX A;  4A3L G;  3M4O H;  4AYB G;  4OWW B;  4YHH Q;  1RL2 A;  3H0G H;  3RN5 A;  5IYC H;  1EUJ A;  2ALY B;  2KHJ A;  5C4X G;  1IYJ B;  5C44 H;  1R9T H;  3GTL H;  1E7Z A;  3M4Q A;  2JA7 H;  1IBM L;  3D0F A;  4UP7 A;  3K7U C;  4A3C G;  5GAE C;  3T1H Q;  2C35 B;  2LXK A;  4HJ9 A;  2B3G A;  4XTC S;  5JJK A;  3I56 A;  1UEB A;  4POF A;  2R92 G;  3HOU H;  4A3G H;  4IJL A;  2V1C C;  3ULJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...