5EJWA

Crystal structure of chromobox homolog 7 (cbx7) chromodomain with ms351
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
80
structure length
80
Chain Sequence
b'HHSSGLVPRGSHMELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEERDRASG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chromobox protein homolog 7
publication title Structure-Guided Discovery of Selective Antagonists for the Chromodomain of Polycomb Repressive Protein CBX7.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/inhibitor
total genus 21
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2015-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5ejwA00
4NW2A 1NAPA 1ZXTA 2K1BA 2MGSA 3I8ZA 1WTVA 4ZAIA 1WTPA 1Q3LA 1RTNA 2KEDA 4XDXA 2B2TC 2K05A 2KEEA 1QNKA 1MSHA 3Q6SA 1EIHA 4IURA 2M2LA 1VMPA 1BF4A 1U4RA 1HFNA 3N52A 1X3QA 3DEPA 1EIGA 4IUQA 4IUPA 2RSOA 5DNFA 5COYA 1XYIA 1DZ1A 2B2WA 4HSVA 3ONAB 2K01A 1DONA 3TZDA 1XX8A 4R9WA 2K28A 1MSGA 4HAEA 4MN3A 1RODA 3IL8A 5D65A 5EPLA 1EOTA 4DN4M 1G2SA 1U4LA 4ZLTF 1HHVA 4HCSA 4X3TA 3DEOA 1F9PA 1WD1A 1GUWA 4RA8A 1QE6A 2KOLA 1G2TA 2B2YC 2HCCA 5EKIA 1ICWA 1WTOA 2X6GA 2R3ZA 2HDLA 5CBEE 1DOKA 4R8IA 1WTRA 1SDFA 1HUNA 1E0BA 2N55A 4QUCA 1PFBA 4X3KA 5AFWA 1SSOA 2L1BA 5T1GA 2CVRA 4ZKCB 1JICA 2VXWA 1BO0A 1ILPA 1F2LA 1KNEA 1CA6A 1B50A 4CJ1B 1WTQA 1G91A 5T1IA 4ZK9B 2XIWA 2K04A 1JE4A 1F9QA 1RTOA 2NZ1D 4XT1B 5E4XA 1AP0A 5CBAE 2MJ8A 1HRJA 5EQ0A 1B3AA 1A15A 2KUMA 2X69A 4LMQD 3TN2A 2JYOA 2EPBA 3DM1A 1CA5A 1PLFA 5EPJA 3H91A 4O42A 2HUGA 2L11A 2L12A 2N88A 1PDQA 2HDMA 2Q8RE 4OIKA 2MP1A 1NR2A 3I90A 3MWYW 4RAUC 2J7ZA 3FDTA 2X6LA 3QO2A 3GV3A 1WVLA 1AZQA 1C8CA 2B2VC 1PFNA 2B2UC 2NYZD 2JP1A 1HFGA 4RWSC 1AZPA 1HUMA 1B2TA 1U4MA 3KUPA 4X3UA 1M8AA 1U4PA 1X32A 2B2YA 2L9HA 3D6WA 2RSNA 2FMMA 1F9RA 1EL0A 4OIJA 5EJWA 3SVMA 2RVLA 2FHTA 3HP3A 2KECA 3IFDA 2B2TA 4U68A 4MHEA 1WTXA 1RHPA 1BBXC 3P7JA 1X3PA 3KBXA 1CM9A 2HCIA 5D14A 3F2UA 2EOTA 1O80A 2BDNA 3G7LA 1BNZA 1IKMA 2EE1A 3GV6A 2DY8A 3MTSA 1O7ZA 5E4WC 1DOLA 3UI2A 2FFKB 1IL8A 1KNAA 4QUFA 2B2WC 2RA4A 4IUTA 4X3SA 1EQTA 3I91A 1MGSA 1O7YA 3I3CA 4CJ0B 1ILQA 2K03A 5CORA 1B53A 1TVXA 1ML0D 1IKLA 1ESRA 2FINB 1S4ZA 2IL8A 2KVMA 1PFMA 2NWGA 2SDFA 1VMCA 1G6ZA 1MI2A 2FJ2A 3LWEA 1NR4A 1NCVA 5JJZA 1HA6A 5EPKA 2Q8TA 2B2VA 3FPUB 4HEDA 1SAPA 2B2UA 3R93A 2D9UA 1WTWA 5CMDA 2H1EA 4XT3B 1RJTA 2L4NA 2MPMA 4IUUA 4CJ2C 4IUVA 1J8IA 1WD0A 2DY7A 4ZKBB 1F9SA 4UAIA 1J9OA 1LV9A 1DOMA 1B4OA 1QG7A
chains in the Genus database with same CATH superfamily
2G9HD 5JEAH 1EYGA 4DR7L 5CV7A 4ZAIA 1WTPA 3ERQA 2F4VL 2CQAA 1Q7YC 4P74A 3CPWA 2B63H 3SE0A 4N9TA 1E1TA 5C5MA 5I4DA 4R4OA 2CH4W 2QEXA 5K36G 5KIXA 5C6AA 4LFAQ 4HAEA 5A35A 5C3EH 3W5OA 1SE8A 1I6VC 5IYCG 4X65Q 3K7UC 1M4VA 4ID6A 4C3JB 1LT3D 4A3MB 1F2MA 1WTHA 3K7AH 3HOYH 3ER0A 1SYCA 5CBEE 4LF6Q 3T53B 3CF5A 4XYOA 3I4OA 4LJZC 1IYJB 1JWMD 4KD3A 4G4KA 2A6EC 3FEWX 3L9AX 4V0BA 3I4NB 1WCMG 1LO5D 3H0GB 4ZK9B 1IBLQ 3QIAA 1XTDA 1RTOA 1TWHB 1DCZA 3RMHA 2M9VA 4LFBL 5EQ0A 3TS2A 1H9KA 3F2BA 1D2BA 4LMQD 1N32Q 2IT1A 4K8JA 3MHBA 2N88A 3I55A 4A3JH 1W3SA 4Q5VA 2F0DA 1S40A 2PCFB 2QGQA 2WAQB 4A3BH 3HKSA 4RGTA 4RWSC 3DWPA 4BXXG 2A69D 1U4MA 1KHIA 2YTXA 4OWWB 5C0XI 4L5TA 2LS01 2EY1A 2K5DA 1EL0A 1JORA 2CWAA 5ELNA 2FMCA 3RR5A 3T13A 2JJQA 3KF8B 3P7JA 4QY7A 1YZ6A 4JI5Q 3LNNA 3G7LA 3QG1A 2CFMA 5C4XH 1IBKQ 2K5WA 4GZYC 3S17B 4QUFA 2RA4A 3PSIA 1CKNB 4CGYB 1DXMA 5J39A 2VY3A 5J22A 5JJIA 4A3GB 3TP5A 2MUYA 5CORA 4RG1A 1NE3A 1GUTA 4DF7A 2MNAA 1QCBD 2R92H 3VR4A 4JI7L 2EYPA 1FD7D 1JJGA 1MI2A 2FJ2A 1O7IA 1NCVA 2M00A 2B39A 3NELA 2B29A 2B63B 3QOLA 1Z6HA 4IPGA 4KI0A 1J8IA 5CV9A 3GTMH 5KRUA 3G48A 4DPGA 1PFSA 4JI8Q 5K5PA 2CW0C 5C3EB 2E2DC 1BBWA 4OX9L 4FF1A 4EQOA 3KF8A 1Y1VG 2F4IA 1V1OA 5DLQE 1M90C 1Q90A 3MEHA 4R4QA 3BYTB 1EUJA 3K7AB 3HOYB 4XQNA 4DV5L 4QB4A 1XYIA 1VQ4A 1U9RA 1CKNA 4OEMB 1X54A 1HR0Q 2R93H 5GROA 2UUBL 1NTGA 4LF5L 3J80i 1N33Q 1EOTA 3HOWH 1HQMC 1HHVA 3MEFA 3DEOA 3X3MA 1HCZA 4KJNA 1G2TA 1FJGL 4YCVA 1HQRD 3AFQA 1MD2D 1HNXQ 1EFWA 4R8IA 4BA2I 1KXLA 1VQAA 2QDLA 4Y52H 1SJED 4QUCA 4A3IG 3HGBA 1JICA 1ILPA 3S1RH 2PMZE 1I50H 2LMCB 4A3BB 1R4PB 2PW5A 2PZWA 2EYHA 1STBA 4NXNL 1S5DD 4JC0A 1WOCA 1B7YB 2JA8G 1R9TH 1Z9FA 1WVLA 1A62A 3K81C 1C8CA 1CHPD 2BDOA 1MIUA 4BY1B 3PUYA 2OEOA 4YIJA 3J81L 1B9NA 4DR2L 3EIVA 5C4XB 1AFPA 2L9HA 1QUQB 4UP8A 1LTBD 4FXGC 1X9NA 4IPDA 3HOZG 4QF4A 2KBNA 2OF1A 4MHEA 1VQMA 2R61A 2LXKA 2F0KA 1LTRD 1VQ9A 3I72A 2DNCA 1TWFB 2BDNA 4KY5A 4RFBA 3TBIB 3I56A 4LNQA 2F0PA 4FF3A 4PMWA 1JWUD 2Q2TA 3MFGA 3GTMB 2RHQB 4GKKL 3G6JB 5JAVA 4HIDA 3CCJA 3TSSA 2NWGA 3NBHB 2KHSA 3MC0B 3MXGA 3M4QA 2Q8TA 1GUNA 1VQBA 1ICFB 2B2UA 5IIFA 1SEBD 3BVZA 3P75A 3A54A 2KHJA 3QR8A 1QUQA 1PHJA 1F9SA 1LV9A 3I4MG 2R93B 4DAMA 2CCZA 1BR9A 3EN2A 3HOWB 4A4IA 1QNKA 2DJFC 2F0OA 3TEHB 4IUNA 1P8LA 4NPSA 2VZAA 1X65A 1YJ9A 2UXCQ 1DONA 4EQ5A 1MSGA 1LUZA 4YCWA 1GUOA 2BH8A 4A93H 2R7ZG 5EKKA 2WACA 4QQBX 3NBHA 3N6RA 1L0YB 1I50B 2E5LQ 4TVAB 1P16A 1TU2B 3W1GA 4LF7L 1TY0A 5J3BA 4JPBW 3D0FA 4GS3A 4IZ8A 3NTKA 1TWAH 5IGGA 3NSWA 3H6MA 4NXML 1VQEA 4X66Q 3VR2A 3F2CA 4NP5A 5DM73 4DR1L 3S1NH 1KRSA 2KQ3A 3D6CA 3K59A 5GQOA 1D5XC 3KLSX 4PNYA 1II3A 4OGQC 3CC4A 1D1KA 2VL6A 2G5DA 1DM0B 4LUOA 2HDMA 5JPNC 3U58A 3A8KE 4HMJA 4FO2A 4CDCC 1PH7A 2F4VQ 1EQRA 2HIXA 4OWXB 2NYZD 4XIGS 2JP1A 1HFGA 3HOVB 1X6OA 1Z7TA 4H7BA 3WOFA 1K0SA 3D4DA 3HP3A 1EWHA 1N36L 2R6GA 4MNOA 2F0SA 1GD7A 1RKNA 2HCIA 3C1EA 3PIO3 1LTSD 1NSNS 5C3WA 1STNA 2NN6I 4IUTA 1MGSA 4GNXC 3BDCA 1PV4A 3I3CA 1YNJD 4G7OC 1B53A 3PF5A 4GN4B 4P71A 2BH2A 4RGMA 1AEXA 1QZGA 4A3CH 3OIQA 3S24A 2EZVA 1HNZL 3A5ZB 4DUZQ 4XXEA 5KNDA 5E7NA 2QW7A 1KD1C 1QILA 4DV3Q 3QOJA 4LFBQ 1LYLA 2Y0SG 1V1QA 3B6YA 2YTYA 1CUKA 3J7AF 2JA5G 3NE5B 1UEBA 2C35B 1N9WA 5ELCA 1STHA 3A0JA 1FNWA 4B3MQ 2KEEA 1Q8IA 2RBMA 5IGDA 4A76A 4A93B 2PNHA 3L2PA 3Q6SA 1MSHA 1U4RA 4HIMA 3JAMc 4IUQA 1D5MC 1HZCA 5C0XJ 2NZOA 2AQ2B 1T5EA 1HZBA 2HIVA 4CKCA 3PO3G 1BCPD 5LMNL 1G2SA 2OTLA 1TWAB 4JI0L 3A8JE 4ILWA 1JB7A 2MO1A 4IOAA 4ME5A 3LX0A 4A3KH 3S1NB 4IPCA 2NBFA 1C7YA 4GLAC 4JI6L 2GN5A 1O7LA 2N55A 1Y8OB 4K8IA 1G91A 1D1IA 1CA6A 2IJ0A 3FKIG 3GDEA 2DN8A 3IRBA 5IODA 1I6HH 3J81j 2NZ1D 4OONA 1QJOA 3HOXH 3T1HL 1KTKA 2PZTA 1STGA 1GHKA 4M1UB 1A0IA 2VQFQ 4FXKC 2CKZB 2EXZA 3WWVA 2LFNA 4DKAC 4JI1Q 4G57A 1SROA 3PO2G 4OX9Q 4DK6C 3QO2A 3VR6A 1AZQA 4TSSA 2PI2E 3GTGB 4X3UA 3ULPA 1ET6A 2WB1B 5KEEA 4DV5Q 1E2VA 1L1OB 4DK3C 2E74C 2FHTA 3RLNA 2UUBQ 3Q22A 4HR7B 1XMQL 4LF5Q 4UHVA 2YTVA 3AYHB 5KYLA 3K5MA 1PRTD 1BNZA 1A63A 1IKMA 2OQ0A 3E9HA 4OXPA 2O5JC 4K0KQ 2K75A 5HURA 1FJGQ 2LXJA 4GKJQ 1Q82C 3H0GG 3J81i 1PTOH 2PPBC 1MHWC 4GOPB 2SNSA 1ILQA 3OMGA 3PGZA 3STBD 1IL2A 4B3RL 1IKLA 3ULJA 2FINB 4DGZA 5I9PA 4IJLA 4ZUJA 1KQSA 3KFUA 5I2XA 2LKVA 1S72A 4UP7A 3JC66 5D3IB 5EPKA 2ZJPA 1TWCH 1IBMQ 2CW0D 3CC2A 4IUUA 1W6JA 4ZKBB 3E9IA 1L1OA 4NXNQ 1NAPA 2Q2HA 3TZUA 3OWEB 3NBIA 5FJ8H 3NXWA 2Z6KA 2V1CC 1AN8A 3M3YH 3F8TA 4DXGA 1HR0W 2NTSA 4DR2Q 2UU9L 4R8NA 3HKZG 4IUPA 4A3KB 3BDOA 5COYA 2OTJA 1TS5A 3AMUA 1A3TA 1BDOA 1PA6A 1SRUA 4GOPA 1BCPF 4JCVE 4UPAA 3KDFB 5CR3A 1VQDA 4P73A 1U4LA 1Y1WH 4A3GG 1I6HB 2C9OA 3NQIA 1GUWA 1LACA 2B2YC 4IFDH 3HOXB 1NJIC 1C0AA 1EY7A 2B63G 2AWNA 1L0WA 1Q81C 1EEID 1YVCA 4CDEC 2F0GA 2A68C 4XQJA 4O1NA 2F0NA 1BXTA 3J80c 5C3EG 2RCNA 1PYWD 1EZ8A 4MIUA 4F8MA 5LL6S 3OYYA 1GUGA 1PLFA 4FNFA 3HOYG 4OIKA 1VS0A 1BQQT 4HN7A 2J7ZA 1TQOA 3KDFA 1VQCA 4DR6Q 1SYEA 5ISRA 4UDUC 2J4XA 2F0VA 3KUPA 3A5UA 4B3TL 4AQYL 4A3LG 4RCNA 2KA7A 1PTOB 3PUVA 5L37A 3GO5A 4QCLA 3PUWA 2IY5B 5EKLA 1SYFA 3Q24A 4DXFA 1JOOA 2VS1A 5M3MH 3GTPB 5E4WC 1TWCB 1B8AA 4P2CB 5IP9H 4A3JG 2ATWA 1G51A 2B2WC 4C3IH 4LF7Q 2Z1CA 1GOZA 3P1HA 2QCPX 3D4WA 4A3BG 1SN8A 4I7ZC 3S9WA 3G6EA 4JV5Q 1RIPA 1S4ZA 3R8BA 2HQLA 3JAME 3WDNA 3ND8A 1HA6A 1A3VA 1XMOQ 2VNUD 1CT1D 3M3YB 2H1EA 1NMFA 1NY4A 2K5QA 4IUVA 5FOBB 4K14A 1DOMA 1QVFA 1UUPA 5C4XG 2AKWB 4OELB 2K1BA 4LUVA 1Y1WB 2F0MA 2Z8LA 4B3SL 4YY3L 4IURA 1GM5A 2O5IC 3UE0A 3PUXA 2XWJB 2R92G 2MFIA 1DD2A 5IT9c 3PIP3 1EY4A 1EYCA 2PQEA 2JSOA 1YEZA 1EFID 4P75A 2I5MX 2NVYH 1N36Q 2N3SA 4ME3A 3RNUA 3FVQA 4X3TA 4LW1A 1VDZA 1V43A 3BZCA 2Y0SE 5AJ3L 1LABA 1X3EA 1T9HA 1YHQA 1A6XA 4WJ3M 4HJ7A 4YCUA 4G7ZC 2VB2X 4BA1I 3MA2B 1VQIA 1C48A 1PZKD 2AQ1B 1I4GA 1WJJA 2R93G 1HNZQ 5C4HA 3QB3A 5IGFA 3S14H 1CKOA 2ZTEA 2MJ8A 1KDAA 3HOWG 3GP7A 2EYMA 2PNRC 2OQKA 4H0LC 2EIFA 4QIWE 5C5LA 1GVPA 2MP1A 1PRTB 3MZ5A 3NENA 3FRPB 2C5CA 3S2HH 2B2VC 3HG9A 4IJHA 1PH2A 1LTGD 1B2TA 4JBJA 5M3MB 4YHHL 3KK7A 4NMZA 1F2YA 3L7ZC 4KLKA 1VQGA 1W6KA 4C3IB 5IGCA 3FMCA 4DV0Q 2A6HC 4C1NI 2NVTH 4X62L 5LMNQ 4DUYL 1SFOH 3NTHA 1E24A 1QVGA 1O80A 2EY5A 1EIYB 3DLLA 2TSSA 1GO3E 4JI0Q 4HIKA 4N8X1 2E2JH 5E3FA 1YITA 4ALPA 1FGUA 4MZ9A 5I6YA 1O7YA 4LWCA 4CJ0B 4BBRG 3M9BA 3VYSA 1SMXA 2K52A 1PZID 3GTJH 1VQOA 1Y69U 4OL7A 1G6ZA 1LTLA 1ZYRC 4R4IA 2F0UA 5IGBA 2XGTA 3RN2A 1SAPA 4AYBB 2EYFA 2E8GA 3T1HQ 3KJPA 3SDZA 5FO7B 5BR8L 3DWQA 3H09A 3SGIA 4ODGA 4BY1H 1B4OA 1RCVD 2NVYB 1D7QA 1Q3LA 1RD9D 1X3GA 2K05A 4HMIA 1D8LA 1OXUA 4O2DA 4K2LA 3CCVA 4LF8Q 1FYCA 4TKOB 1J6QA 3VYTA 1TWFH 4HJAA 3J80E 4DAPA 3U9OA 4DN4M 3PV0A 4C1NK 2MHVA 3ND9A 4JVZA 2PYKA 3S14B 4H13C 3K80C 2WAQE 3L0OA 5FLXE 1VQ6A 3CRLC 4JI3L 1DOKA 2F0IA 3BZDB 4B3RQ 1XJVA 1GJXA 1BO0A 1F2LA 1HTLD 1KLUD 2WV6D 3S2HB 3T1YL 5E4XA 3T16A 3HKZE 4N8FA 1VQKA 1B3AA 2RF4A 2IPKD 4A93G 1XNRL 3A74A 1B9MA 2VB3X 1YBYA 1ONLA 1EY9A 2L12A 2Q8RE 5EGTA 1NR2A 2UXDL 5HGQA 2NVTB 3FDTA 1VQ8A 3ITPA 1SFOB 3KBGA 3AQQA 1HZAA 1BBUA 4FVMA 5ELEA 4JI4L 1X32A 4BY7G 1XPOA 2E2JB 3K5NA 1ESFA 3K57A 2JA6H 3OW7A 3J7AV 5LMUL 4R1JA 4ZQ3A 1PMRA 2AHOB 4O0AA 3GTJB 3HRZC 1XTCD 3EROA 4CHTB 4KKUA 4DV2L 3GV6A 4M8AA 2DY8A 1O7ZA 1TXYA 1C9OA 3MXUA 1J5EL 3KJOA 1Z47A 1KLGD 1BUVT 1ML0D 5BN5A 3V2TA 4CKBA 1WCMH 2AUJD 2SDFA 4DR4L 5FO8B 2JK8A 1ET9A 1VMCA 2A73B 1N34L 2NB0A 4JW0A 1Q12A 4HEDA 1SBBB 3RD4A 3ZYYX 2MPMA 4PZ8A 4BBSH 4OO1I 1CQVA 3MFYA 3HOVH 2WB1G 2KENA 2Z9HA 3J81c 1M1KC 5JOBA 3FHWA 2B8FA 2F3VA 1IYVA 4A3FH 4BXXH 1SR3A 2M2LA 3NP8A 4I65A 4A3CG 4KMUC 4JBWA 1EIGA 4B3TQ 2R7DA 5DM63 3HOUH 4HSVA 2RKSA 3EJIA 1HNWQ 3TS0A 2L0CA 2VUMG 1RODA 5GAGC 4IO9A 3C2PA 3TRZA 2BA1A 1PH3A 1NUCA 4U673 4J6HA 3R2TA 4HSPA 1TS4A 4LFCL 3D3RA 1JJCB 4NDXA 3K5OA 3PIOA 1I94L 3MXPA 4EQPA 3BYYB 2AMCB 2CVRA 1V9PA 1LTID 1KNEA 4HTHA 2XIWA 1JE4A 3DWAA 4NKLA 3GTOH 2K4KA 3DXJC 4Q0FA 3J7YW 2WP8J 3H91A 3NTIA 2JA6B 3OSOA 1FL0A 3I90A 5F2DA 1EYAA 1NBWA 1EEFD 2B2UC 4B3SQ 1TS2A 5G3LD 1I4QA 1SXTA 5IP7H 5CV6A 2RVLA 1VQFA 2QEJC 1I4XA 3CPFA 4KV6A 5ELOA 4J15A 4QMGA 1WTXA 1TS3A 3X3NA 1WCMB 4L63B 4LK1C 2F0WA 2WKCA 2MO0A 2OWOA 4BBSB 4DR7Q 3ZJYC 3M7GA 1FGBD 2BCOA 4RKBA 3CMEA 1K8AC 3J7A5 3T56B 2H5XA 5M5XH 4A3IH 1W2BA 4C3HH 2K5VA 4WRDA 2WINB 3NEMA 4A3FB 3E0EA 1WTWA 1JR0D 2KCNA 3CQZH 3BVGA 1K8GA 4UY8C 2DY7A 3HOUB 1J9OA 3OTOL 3D31A 1QG7A 1A8VA 1F77A 3P20A 1EQVA 4IPHA 2JA8H 3GTGH 4DV7L 1ENCA 3H3VH 1ENAA 1B3QA 4G7HC 2ZXPA 2E76C 5J1ZA 4NB3A 4WJ4A 4YHHQ 5IYBG 3TP6A 5CYUA 4KKTA 4KHVA 1Y14B 3DUZA 1XX8A 2K28A 1UNSA 3UDXA 3BZKA 2F03A 4ZLTF 4HCSA 5TSSA 4DUYQ 1WD1A 5DEHA 3CCRA 2D0OA 3LGJA 1L0XB 2IX0A 3GTOB 2R3ZA 5FJ8G 2XSCA 3KLSA 1VF7A 1WTRA 1AE3A 2JEBI 4PMCA 2CHBD 1UAPA 4LF4L 3CXCA 1TIID 2D0PA 1Y1VB 2A69C 1JB3A 5CV8A 4KY6A 1CTMA 4X65L 1MJCA 3SK8A 5CGKA 1Y1WG 2KUMA 3TN2A 5BR8Q 1EY0A 4L6TB 4HJ8A 2L11A 4IFDG 2GA4B 2E75C 1IXRA 3S1MH 2A6ED 5M3FG 2DJGC 2RQXA 4L5RC 4PMBA 4JI2L 5G3LF 5EBCA 1U4PA 3A8IE 2K7VA 5CC4A 4OO1G 4JI7Q 1KAWA 1DGSA 5LMNW 1S5BD 1GHJA 3TREA 3IFDA 3IFTA 5M5XB 4A3IB 3PUZA 3BJUA 1IHZA 4C3HB 5C44H 3U4VA 1K8MA 2N78A 2CWPA 1ASYA 1AH9A 4RHRA 3KOJA 1VQLA 4ZYSA 2IX3A 2NVQH 5C0XH 3CQZB 1K3BC 4R4CA 1UWVA 5HY6A 4KN4C 1ZYRD 4RHSA 2WFWA 1XPUA 1ESRA 2JA8B 2B8GA 4RGOS 2EQSA 3EVQA 1FNUA 1PFMA 3BG3A 5FK9C 3OIPA 5KYIA 4X64L 4C3JG 3T1YQ 4A3MG 1OXSC 3BS1A 1OO9B 2F0TA 1JOKA 4MTKA 5CMDA 4F88A 2L4NA 2A5HA 5C4ZA 1WD0A 1HTPA 3I2ZA 4UAIA 1IBKL 2CQOA 5M3MG 1DOLA 2MQHA 5IP9G 1K8OA 3W1BA 5KNCA 3I4NG 1G291 5JVH3 1CZWA 4F7XA 5KGUA 1GKHA 4JI4Q 3K5LA 1DZ1A 4DV4L 1CSPA 5FLMH 3GTPH 4Y7NH 4JG2A 1I5FA 4ZRZA 2NVXB 5LMUQ 1BKBA 4ZCKA 2KCCA 2D62A 2WAQG 2VQEL 4DV2Q 1J5EQ 5M5WH 1JWSD 1SDFA 2WB1E 4AYBG 1Q46A 1E0BA 5FKAC 4X3KA 1ZEQX 2IWHA 1STAA 3K0XA 2ALYB 2UUCL 3S1MB 1PYBA 2L55A 4CKEA 2K50A 4UP9A 1PH5A 2AQ3B 1CZGA 1S5FD 1G6PA 1L2FA 1T5XD 3T4AC 3DM1A 3H15A 4IN3A 2HUGA 1PZJD 5JEAG 3O13A 5C44B 1YJNA 3GV3A 1GXDC 2A1AA 2EVBA 1PFNA 4JOIA 4GKKQ 1UEAB 1HUMA 4POFA 3I70A 4LAAA 2EY6A 1L1OC 1PH4A 2NVQB 1F9RA 4YWLA 3H3VC 4EQNA 3TQYA 3SK6A 1BBXC 3IAYA 2Z6KC 2EXDA 2F3WA 3PMFA 1FNVA 1YNXA 1CQFA 4LFCQ 1K9MC 2SNMA 4LUZA 1I94Q 2ID0A 5FLXL 4GOPC 1VCIA 3SHLA 2TMPA 2XNAC 3E3XA 2JA7H 2PZUA 3LWEA 1SYBA 2Z4IA 1O78A 5JJZA 4PQXA 4KY7A 1LM0A 4DV1L 2RCFA 4XT3B 4B08A 1EOVA 1RJTA 1YNNC 2Q2IA 4K5XA 3ULLA 4Y7NB 3CD6A 3PO2H 1DYQA 3V96A 1RTNA 4DNIA 4DV6L 3UDIA 1VMPA 1YHAA 5ELFA 4DK0A 1K83B 3R2IA 1F2ZA 4HJ5A 5M5WB 2ICIA 4NXMQ 4R9WA 3SR1A 1QNUA 4DR1Q 3EQLC 2YU9B 1Q1BA 1KC8C 2K5HA 2L5TA 4BY1G 1JQYD 4PZ6A 1QE6A 1BCPB 2RDHA 2HCCA 2XRSD 5EKIA 1GUSA 1H9RA 2JXMB 4C2MH 3CCLA 4LF9L 1HUNA 3L3OC 1PFBA 4KTAA 5JEAJ 1Y8NB 3UDGA 5IYDH 2VXWA 2IX1A 2UXCL 5A2QE 5T1IA 2ZTCA 2K04A 4IALA 4A3DH 1QZHA 3GTKH 2E5LL 1AW7A 4H44C 1YJWA 4O42A 3WOEA 5BN4A 3KYHC 1KDCA 4KD4A 4IQZA 3W3AA 1EIFA 1SMYC 1HPCA 1QWYA 2JN4A 3BU2A 3E5SA 3RLOA 1JT8A 1YNJC 2FMMA 4X66L 4OIJA 1PTOC 3A56A 2PW7A 2EYJA 5D14A 2Z4HA 3F2UA 3G4SA 2EOTA 3FKIB 2JA7B 3HZXA 1EY8A 3HFZB 3MTSA 3C46A 1CK1A 3NPPA 4ULLA 1ASZA 2DNEA 3EBEA 1SNCA 3I91A 3VA5A 5D3DA 2OCEA 2K03A 4APVA 2LSSA 4LF4Q 2F0QA 3PO2B 3GQBA 1STYA 4DR5L 2JA6G 2O2LD 4X6AH 2D9UA 2ZJRA 2NN6H 3S1QH 1BCPC 1H9JA 1B44D 3A7LA 4YWMA 1BOSA 2ZXRA 1OXVA 1EZ6A 1X56A 2ZXOA 2IHEA 4I7AA 1EIHA 1BF4A 4JI2Q 4JI6Q 4A3LH 3DEPA 4DUZL 2F0HA 4A3EH 3ONAB 1NNXA 1XNQL 4C2MB 1PVOA 4DV3L 2JQOA 4MN3A 1EU3A 1XPRA 5C4JH 3AFPA 2KJXA 4BBSG 1UE5A 5IOCA 3KLRA 1STEA 1VQNA 3TDQA 3HOVG 3M4YA 4B3ML 1EWIA 1YI2A 4A3DB 1S3OA 3GTKB 4A3FG 5C3XA 3H94A 3M85A 5I9OA 1CI3M 1H9SB 3S16H 5AFWA 3NWSA 4JYAL 3HOUG 3I73A 1I4PA 3RZOH 3OOCA 1LLRD 4X64Q 3UE1A 1CSQA 1HRJA 3HKZB 1XMQQ 4YWKA 2HT1A 4FP5D 2X69A 2JYOA 1VQ7A 4DFAA 1EQQA 2XRQD 3C3LA 3ERSX 1PRTC 1H95A 2EJFC 4XYQA 1AZPA 4B9XA 2KCMA 3IKJA 3AEVA 1Q86C 3STBC 4FDBA 5EJWA 4AYBE 4DV4Q 2KECA 2QF7A 3U4ZA 4U68A 2B2TA 3V05A 2PMZB 2UUAL 1H9SA 2VQFL 1TY2A 1X3PA 1CM9A 3TP8A 3OHXC 4ABNA 2EE1A 4JI1L 2HHHL 2VQEQ 3CKIB 2WIIB 3S15H 3CW2C 4XQQA 1U0LA 3S1QB 2K5NA 4QGUA 5CV4A 2KVMA 3RUZA 4C56C 1D6EC 5E1FA 2KCTA 3RLFA 1Y8PB 5IP7G 2UU9Q 3K6OA 3PF4A 2J0TD 2UUCQ 1WYDA 5K36H 2ZM6L 4EX5A 5HGTA 5IYCH 4K0KL 2ES2A 4A3EB 4GKJL 3BVMA 2MGSA 2BE5C 1WTVA 5C4JB 3EFXD 4RMFA 2B2TC 1YHBA 3OPOA 2SEBD 5JVG3 4FYDA 3W2DA 2K32A 4IFDI 4C3HG 1JE5A 4A3JB 1X3QA 4EGVA 4J8QA 1V8QA 1LT4D 3GTQH 5JJLA 1HZ9A 5IT9E 2A19A 2PO4A 2O4XA 2P5ZX 1IBML 3TZDA 3IL8A 3LWUA 3S16B 1C4QA 1CHQD 2YYZA 1A2TA 2HD3A 1F9PA 3CC7A 2KOLA 2NZHA 3RZOB 5DAUA 5EBDA 2D5DA 4AIMA 4BBRH 1KRTA 3SK4A 2F0LA 3OWFA 1D5ZC 1A2UA 4AQYQ 1WTQA 4DV1Q 4XT1B 4KK7A 1TR5A 2R92B 3Q0AA 3QWNA 2I07B 4MTNA 5EPJA 3NK9A 2CH4A 5LHY1 4DV6Q 2A68D 3NQTA 3RN5A 2ENBA 3S15B 3EA6A 3CCUA 2K33A 2L15A 4FF2A 1E2ZA 1LTTD 1RHPA 2XN9C 4RGNA 3UDFA 3CMAA 2UXBL 5NUCA 1HH2P 2ICEC 5FO9B 1N8RC 1IW7C 2R7FA 4OWTB 4DR6L 3UI2A 2I5LX 4A3KG 1LT6D 4X3SA 3VA7A 4EVOA 1K28A 1Y1VH 4GNXB 2ZJQA 1YIJA 1SNOA 1TVXA 4LF9Q 3U9SA 4YY3Q 3HS0C 3PQIA 1S5CD 2ASBA 1YNND 1SNQA 4KKSA 3F1ZA 3R93A 4IOCA 3NUCA 3HOXG 5C44G 4XTCS 1IZ6A 1LT5D 4CJ2C 5GAHC 1UE1A 1PH6A 3GTQB 3S1RB 5IWAL 1X55A 1SE2A 2I46A 3E6ZX 1OXXK 4NW2A 1ZXTA 5GAEC 1WI5A 2BA0A 4K5WA 5C0XG 4KHPL 4XDXA 1VQPA 4JV5L 5AJ3Q 3TP7A 1IYUA 2XTIA 1HFNA 2BOSA 1R9TB 4BY7H 1B1ZA 1XMOL 1RF2D 2GVBA 4DAVA 3CCQA 4GNXA 1VQHA 4BBRB 4L5QA 3VR5A 4KHZA 4RA8A 4AH6A 2B3GA 3K0YA 4FF4A 2F0EA 1SNDA 1Q1EA 4DR3L 1KL9A 3CCSA 2I0QA 4RKLA 2JA9A 3K58A 1SSOA 2WKDA 1V1PB 3A55A 5T1GA 5LL6X 1E22A 4CDDC 4CJ1B 5FLMG 5I2YA 4DR5Q 3HOZH 1FVIA 2IHFA 1HA5A 3R3OA 5JPMC 3GTLH 1TT2A 3J7ZC 4X62Q 3S2DH 2EDGA 3SEBA 3ICEA 4JK1C 1SMYD 3D8GA 4HCEA 3OMCA 3MVVA 3CCMA 3VYUA 1S5ED 1PTOD 1ZKOA 1CFMA 5IY0A 1I4HA 3KLWA 1JCKB 4WFN3 4ZUIA 2NVXH 3D6WA 2RSNA 3I4LA 4DA2A 3F2DA 4LFAL 1XNQQ 1RDPD 3M4OH 3JAML 2VUMH 3KF6B 3VDYA 1KIXA 1XWEA 3KBXA 1V1PA 1SYGA 4HJ9A 2FXQA 3I4MH 5ELDA 1IL8A 4LF6L 2XWBB 2OT2A 4P72A 2A6HD 4DV0L 1E7ZA 3DHQA 2N8NA 4K6LA 1IBLL 4JYAQ 4S3SA 2A74C 5A2QL 3FPUB 3TMEA 1H9MA 1PH9A 4BY7B 1MKHA 3M4PA 3CU7A 2QKIC 2R7ZH 1N32L 2Q2UA 3GD7A 1LTAD 1AP0A 2F0FA 3KF6A 1VQ5A 3A7AB 4F87A 1K3RA 2KEDA 3J81E 3FPPA 4JI3Q 4L8JA 1CKMA 1OTCA 1HJPA 1WFQA 2RSOA 2JA7G 3I7FA 4PZ7A 3URYA 4PV1C 1UE6A 1SYDA 4L5SA 2JEAI 4DK1A 4N9PA 2UUAQ 2PI2A 4FXDA 4JI5L 4WORA 3MAQA 4QL5A 1G8ZD 2LY7A 1XNRQ 2RDFA 2HHHQ 3HOZB 3RZDH 3CHBD 1WTOA 2JE6I 2X6GA 4KN7C 2HDLA 1QB5D 4J1MA 4C3IG 2UXDQ 3GTLB 1TWGH 3S2DB 4LF8L 1TKWB 2L1BA 4ZKCB 1UE7A 1B50A 3CCEA 2IW3A 1F9QA 4OHJA 2ZM6Q 4JBKA 3BDLA 4A75A 2HQEA 4JI8L 2EPBA 2EYOA 1Q8KA 1OXTA 3M4OB 2VUMB 3PCOB 1JOQA 1ENFA 1K83H 4RH6A 2F52A 2AUKA 2X6LA 5IGEA 2EY2A 4PG3A 1PTOF 3I4MB 3NHHA 5IYBH 2KHIA 4IFDJ 5IYDG 2B2YA 2YV5A 2YU9H 1HR0L 2ZTDA 4DR4Q 2E2HH 1BVSA 1MBYA 2K6AA 1N34Q 1N33L 4A3DG 1SLJA 2EJMA 1NMGA 5JJKA 4DNTB 3MXNB 2JA5H 3K8AA 4CDFC 1KDBA 2FFKB 3DM3A 1KNAA 1HNXL 2E2IH 1EQTA 4K6DA 2G9DA 2R7ZB 5H1SE 5M5YH 4GN3B 2XVSA 4E6IA 1PXUA 2D2CC 5M9OA 4POGA 4TRDA 1DJRD 1X3FA 5KNBA 3PO3H 1EY6A 3PIPA 2BE5D 3J80L 4DNRB 1EWCA 2N49A 1I3QH 3I8ZA 1PH1A 3Q23A 2PQAB 5M3FH 3E0JA 3CP0A 3MXNA 1JJ2A 3N52A 1U5KA 4HIOA 2SOBA 3RZDB 1E2WA 5DNFA 4OO1H 2B2WA 3FKIH 2NUCA 2VW9A 2K01A 1MJEA 1TWGB 1SE4A 1SJHD 3U50C 5EPLA 5D65A 1EYDA 2NN6G 1B70B 3VYRA 3AB9A 4RCOA 1VQJA 4K2KA 4JOIC 2UXBQ 4CBVA 5ELBA 1JMCA 5FLXc 2F1MA 1ICWA 1RL2A 2QDBA 2QILA 4Z9CB 2Q8IB 4R4TA 2ZT9C 1JC7A 1QVCA 3DMUA 1I4RA 2PQAA 5GADC 2I5HA 1HNWL 4A3EG 3CRKC 4BS9A 1SE3A 4C3JH 4H02A 4A3MH 3HEJA 2RHSB 3QJYA 4GN5A 5CBAE 1PRTF 2GVAA 1FR3A 4DAYB 5I6WA 1A15A 4V190 1R4QB 1CA5A 1A3UA 4B9WA 5IWAQ 3NWTA 2E2HB 3M7NA 1PDQA 1K0RA 4RAUC 4TQUS 3I4NH 3MWYW 3SK5A 3H0GH 3C1FA 4KHPQ 4WJWA 2Y0SB 2RDGA 2QA4A 1TWHH 2OXPA 1PYSB 3FP9A 2JA5B 1HXYD 1M8AA 1AE2A 2A8VA 2NTTA 2E2IB 3SVMA 4JBMA 1EU4A 2K14A 1PH8A 4DU9A 5IT9L 5M5YB 1IW7D 3OW2A 5IE8A 3G71A 2F0JA 2V4DA 3Q8DA 3D4RA 4GLXA 1SNPA 4K5VA 3OTOQ 3VR3A 4QJFA 3PO3B 1XXGA 2Z0SA 4QIWB 1KABA 4BWGB 1QOHA 3AU7A 4DR3Q 2H4OA 5EAYA 4DAYA 1E3PA 4DV7Q 1K73C 3T51B 3SXHA 2AWOA 2Z6BA 4KJOA 1I3QB 5CV5A 2IL8A 3CAMA 2EJGC 2DGYA 5M3FB 3JAMi 1NR4A 1E1OA 3H3VI 2EYLA 1SNMA 1VF5C 2B2VA 5BN3A 2F3IA 3S17H 1EY5A 1KAAA 4GLVB 4A3GH 2DUDA
chains in the Genus database with same CATH topology
2G9HD 5JEAH 5CV7A 4ZAIA 1WTPA 3ERQA 2CQAA 3SE0A 4N9TA 5C5MA 5I4DA 5K36G 5KIXA 5C6AA 4HAEA 5A35A 1I6VC 1M4VA 4ID6A 4C3JB 1LT3D 4A3MB 1F2MA 1SYCA 5CBEE 3T53B 4XYOA 4LJZC 1JWMD 4KD3A 4G4KA 2A6EC 3FEWX 3L9AX 4V0BA 3I4NB 1LO5D 3H0GB 4ZK9B 3QIAA 1RTOA 1TWHB 1DCZA 3RMHA 2M9VA 5EQ0A 1H9KA 1D2BA 4LMQD 2IT1A 4K8JA 3MHBA 2N88A 4Q5VA 2F0DA 2PCFB 2WAQB 4RWSC 4RGTA 3DWPA 2A69D 1U4MA 5C0XI 2LS01 2EY1A 2K5DA 1EL0A 1JORA 2FMCA 3T13A 3P7JA 3LNNA 3G7LA 3QG1A 2K5WA 4GZYC 3S17B 4QUFA 2RA4A 4CGYB 1DXMA 5J39A 5J22A 4A3GB 3TP5A 2MUYA 5CORA 4DF7A 1GUTA 1QCBD 3VR4A 2EYPA 1FD7D 1MI2A 2FJ2A 2M00A 1NCVA 2B39A 2B63B 3QOLA 1Z6HA 4KI0A 1J8IA 5CV9A 5KRUA 5K5PA 2CW0C 5C3EB 2E2DC 4FF1A 4EQOA 3KF8A 2F4IA 1V1OA 1Q90A 3MEHA 3BYTB 3K7AB 3HOYB 4XQNA 4QB4A 1XYIA 1U9RA 1EOTA 1HQMC 1HHVA 3DEOA 3X3MA 1HCZA 4KJNA 1G2TA 1HQRD 1MD2D 4R8IA 4BA2I 1SJED 4QUCA 3HGBA 1JICA 1ILPA 2LMCB 4A3BB 1R4PB 2PW5A 2PZWA 2EYHA 1STBA 1S5DD 1WVLA 1C8CA 4BY1B 1CHPD 2BDOA 3PUYA 2OEOA 4YIJA 3J81L 1B9NA 5C4XB 1AFPA 2L9HA 1LTBD 4FXGC 4QF4A 2OF1A 4MHEA 2R61A 2F0KA 1LTRD 3I72A 2DNCA 1TWFB 2BDNA 4KY5A 4RFBA 3TBIB 4FF3A 2F0PA 4PMWA 1JWUD 3MFGA 3GTMB 3G6JB 5JAVA 3TSSA 2NWGA 2KHSA 3MC0B 3MXGA 2Q8TA 1GUNA 2B2UA 5IIFA 1SEBD 3BVZA 3P75A 3A54A 1F9SA 1LV9A 2R93B 1BR9A 3HOWB 1QNKA 2F0OA 4IUNA 1DONA 1MSGA 1GUOA 5EKKA 2WACA 3NBHA 3N6RA 1L0YB 1I50B 1TU2B 1TY0A 4IZ8A 3NTKA 5IGGA 3NSWA 3H6MA 3VR2A 4NP5A 5DM73 2KQ3A 3K59A 3D6CA 1D5XC 3KLSX 4PNYA 1II3A 4OGQC 1D1KA 1DM0B 5JPNC 2HDMA 3A8KE 4HMJA 4FO2A 2NYZD 4XIGS 2JP1A 1HFGA 3HOVB 1Z7TA 4H7BA 3WOFA 3D4DA 3HP3A 1EWHA 2R6GA 2F0SA 1RKNA 2HCIA 3C1EA 3PIO3 1LTSD 1NSNS 5C3WA 1STNA 2NN6I 4IUTA 1MGSA 3BDCA 3I3CA 1YNJD 4G7OC 1B53A 4RGMA 1AEXA 3OIQA 2EZVA 4XXEA 5KNDA 1QILA 3QOJA 3J7AF 3NE5B 5ELCA 1STHA 1FNWA 2KEEA 1Q8IA 2RBMA 5IGDA 4A93B 1MSHA 3Q6SA 1U4RA 4IUQA 1D5MC 5C0XJ 2AQ2B 1T5EA 4CKCA 1BCPD 1G2SA 1TWAB 3A8JE 4ILWA 4ME5A 3LX0A 3S1NB 2NBFA 1O7LA 2N55A 1Y8OB 4K8IA 1G91A 1D1IA 1CA6A 2IJ0A 2DN8A 5IODA 2NZ1D 1QJOA 1KTKA 2PZTA 1STGA 1GHKA 4M1UB 4FXKC 2EXZA 2LFNA 4G57A 3QO2A 3VR6A 1AZQA 4TSSA 3GTGB 4X3UA 1ET6A 2WB1B 5KEEA 1E2VA 2E74C 2FHTA 3Q22A 4HR7B 5KYLA 3K5MA 1PRTD 1BNZA 1IKMA 2O5JC 5HURA 1PTOH 2PPBC 2SNSA 1ILQA 3OMGA 1IKLA 4DGZA 2FINB 5I9PA 4ZUJA 5I2XA 2LKVA 5D3IB 5EPKA 2CW0D 4IUUA 1W6JA 4ZKBB 1NAPA 3TZUA 3OWEB 3NBIA 3NXWA 1AN8A 4DXGA 2NTSA 4R8NA 4IUPA 4A3KB 3BDOA 5COYA 1TS5A 3AMUA 1A3TA 1BDOA 1BCPF 5CR3A 1U4LA 1I6HB 2C9OA 3NQIA 1GUWA 1LACA 2B2YC 4IFDH 3HOXB 1EY7A 2AWNA 1EEID 2F0GA 2A68C 4XQJA 4O1NA 2F0NA 1BXTA 1PYWD 1EZ8A 4MIUA 4F8MA 5LL6S 1GUGA 1PLFA 4FNFA 4OIKA 1BQQT 4HN7A 2J7ZA 1TQOA 1SYEA 5ISRA 4UDUC 2J4XA 2F0VA 3KUPA 4RCNA 2KA7A 1PTOB 3PUVA 3GO5A 4QCLA 3PUWA 5EKLA 1SYFA 3Q24A 4DXFA 1JOOA 3GTPB 5E4WC 1TWCB 4P2CB 2B2WC 2Z1CA 1GOZA 3P1HA 2QCPX 3D4WA 4I7ZC 3S9WA 1S4ZA 3R8BA 3JAME 3WDNA 3ND8A 1HA6A 1A3VA 2VNUD 1CT1D 3M3YB 2H1EA 2K5QA 4IUVA 5FOBB 4K14A 1DOMA 1UUPA 2K1BA 1Y1WB 2F0MA 2Z8LA 4IURA 2O5IC 3PUXA 2XWJB 1DD2A 3PIP3 1EY4A 1EYCA 2PQEA 2JSOA 1EFID 3FVQA 4X3TA 1VDZA 1V43A 1LABA 1A6XA 4G7ZC 2VB2X 4BA1I 3MA2B 1C48A 1PZKD 2AQ1B 1I4GA 5C4HA 3QB3A 5IGFA 2MJ8A 1KDAA 3GP7A 2EYMA 2PNRC 4H0LC 5C5LA 2MP1A 1PRTB 3MZ5A 3FRPB 2C5CA 2B2VC 3HG9A 1LTGD 1B2TA 5M3MB 3KK7A 4NMZA 1F2YA 3L7ZC 1W6KA 4C3IB 5IGCA 3FMCA 2A6HC 4C1NI 3NTHA 1O80A 2EY5A 2TSSA 5E3FA 5I6YA 1O7YA 4CJ0B 3VYSA 1PZID 1Y69U 4OL7A 1G6ZA 1ZYRC 5IGBA 2F0UA 1SAPA 4AYBB 2EYFA 3SDZA 5FO7B 3DWQA 3H09A 4ODGA 1B4OA 1RCVD 2NVYB 1Q3LA 1RD9D 2K05A 4HMIA 1OXUA 4K2LA 1FYCA 4TKOB 3VYTA 3J80E 4DAPA 3U9OA 4DN4M 3PV0A 4C1NK 2MHVA 3ND9A 2PYKA 3S14B 4H13C 5FLXE 3CRLC 1DOKA 2F0IA 3BZDB 1GJXA 1BO0A 1F2LA 1HTLD 1KLUD 2WV6D 3S2HB 5E4XA 3T16A 1B3AA 2IPKD 1B9MA 2VB3X 1ONLA 1EY9A 2L12A 2Q8RE 5EGTA 1NR2A 2NVTB 3FDTA 3ITPA 1SFOB 3KBGA 4FVMA 5ELEA 1X32A 2E2JB 3K5NA 1ESFA 3K57A 3OW7A 3J7AV 4ZQ3A 1PMRA 3GTJB 3HRZC 1XTCD 3EROA 4CHTB 4KKUA 3GV6A 4M8AA 2DY8A 1O7ZA 3MXUA 1Z47A 1KLGD 1BUVT 1ML0D 5BN5A 3V2TA 4CKBA 2AUJD 2SDFA 5FO8B 1ET9A 1VMCA 2A73B 2NB0A 1Q12A 4HEDA 1SBBB 3RD4A 3ZYYX 2MPMA 4OO1I 1CQVA 3MFYA 5JOBA 2B8FA 2F3VA 1IYVA 2M2LA 3NP8A 4I65A 4KMUC 4JBWA 1EIGA 5DM63 4HSVA 2RKSA 3EJIA 2L0CA 1RODA 3C2PA 2BA1A 1NUCA 4U673 4J6HA 3R2TA 4HSPA 1TS4A 3D3RA 4NDXA 3K5OA 3MXPA 4EQPA 3BYYB 2CVRA 1LTID 1KNEA 4HTHA 2XIWA 1JE4A 3DWAA 4NKLA 3DXJC 4Q0FA 3J7YW 2WP8J 3H91A 3NTIA 2JA6B 3OSOA 3I90A 5F2DA 1EYAA 1EEFD 2B2UC 1TS2A 5G3LD 1I4QA 1SXTA 5CV6A 2RVLA 2QEJC 1I4XA 4KV6A 1WTXA 4QMGA 1TS3A 3X3NA 1WCMB 4L63B 4LK1C 2F0WA 2WKCA 4BBSB 3M7GA 1FGBD 2BCOA 4RKBA 3T56B 4WRDA 2WINB 4A3FB 1WTWA 1JR0D 2KCNA 3BVGA 2DY7A 3HOUB 1J9OA 3D31A 1QG7A 1F77A 3P20A 1EQVA 1ENCA 1ENAA 4G7HC 2ZXPA 2E76C 5J1ZA 3TP6A 5CYUA 4KKTA 4KHVA 3DUZA 1XX8A 2K28A 1UNSA 2F03A 4ZLTF 4HCSA 5TSSA 1WD1A 5DEHA 1L0XB 2IX0A 3GTOB 2R3ZA 2XSCA 3KLSA 1VF7A 1WTRA 4PMCA 2JEBI 2CHBD 1UAPA 1TIID 1Y1VB 2A69C 1JB3A 5CV8A 4KY6A 1CTMA 3SK8A 5CGKA 2KUMA 3TN2A 1EY0A 4L6TB 2L11A 4IFDG 2GA4B 2E75C 2A6ED 2RQXA 4PMBA 5G3LF 5EBCA 1U4PA 3A8IE 2K7VA 5CC4A 4OO1G 1S5BD 1GHJA 3IFDA 3IFTA 5M5XB 4A3IB 3PUZA 1IHZA 4C3HB 1K8MA 4RHRA 4ZYSA 2IX3A 5C0XH 3CQZB 4KN4C 1ZYRD 4RHSA 2JA8B 1ESRA 2B8GA 4RGOS 3EVQA 1FNUA 1PFMA 3BG3A 5FK9C 3OIPA 5KYIA 4C3JG 1OXSC 3BS1A 1OO9B 2F0TA 1JOKA 5CMDA 4F88A 2L4NA 2A5HA 5C4ZA 1WD0A 1HTPA 4UAIA 1DOLA 1K8OA 5KNCA 1G291 5JVH3 1CZWA 4F7XA 5KGUA 3K5LA 1DZ1A 4ZRZA 2NVXB 2KCCA 2D62A 1JWSD 1SDFA 1E0BA 5FKAC 4X3KA 1ZEQX 2IWHA 1STAA 3S1MB 2L55A 4CKEA 2AQ3B 1CZGA 1S5FD 1T5XD 3T4AC 3DM1A 4IN3A 2HUGA 1PZJD 5JEAG 3O13A 5C44B 3GV3A 1GXDC 2EVBA 1PFNA 1UEAB 1HUMA 3I70A 4LAAA 2EY6A 2NVQB 1F9RA 3H3VC 4EQNA 3SK6A 1BBXC 3IAYA 2F3WA 3PMFA 1FNVA 1CQFA 2SNMA 2ID0A 5FLXL 1VCIA 3SHLA 2TMPA 2XNAC 2PZUA 3LWEA 1SYBA 2Z4IA 1O78A 5JJZA 4PQXA 4KY7A 4XT3B 4B08A 1RJTA 1YNNC 4K5XA 4Y7NB 1DYQA 3V96A 1RTNA 1VMPA 5ELFA 4DK0A 1K83B 3R2IA 1F2ZA 5M5WB 2ICIA 4R9WA 3SR1A 1QNUA 3EQLC 2YU9B 1Q1BA 2L5TA 1JQYD 1QE6A 1BCPB 2RDHA 2HCCA 2XRSD 5EKIA 1GUSA 1H9RA 2JXMB 1HUNA 3L3OC 1PFBA 4KTAA 5JEAJ 1Y8NB 2VXWA 2IX1A 5A2QE 5T1IA 2K04A 4IALA 1AW7A 4H44C 4O42A 5BN4A 3WOEA 1KDCA 4KD4A 4IQZA 3W3AA 1SMYC 1HPCA 1QWYA 3E5SA 1YNJC 2FMMA 4OIJA 1PTOC 3A56A 2PW7A 2EYJA 5D14A 2Z4HA 3F2UA 2EOTA 3FKIB 2JA7B 3HZXA 1EY8A 3MTSA 3C46A 1CK1A 3NPPA 4ULLA 2DNEA 3I91A 1SNCA 3VA5A 5D3DA 2K03A 2F0QA 3PO2B 3GQBA 1STYA 2O2LD 2D9UA 2NN6H 1BCPC 1H9JA 1B44D 3A7LA 1BOSA 2ZXRA 1OXVA 1EZ6A 2ZXOA 1EIHA 1BF4A 3DEPA 2F0HA 3ONAB 4C2MB 4MN3A 1EU3A 2KJXA 5IOCA 3KLRA 1STEA 3TDQA 3M4YA 4A3DB 3GTKB 5C3XA 3H94A 3M85A 5I9OA 1CI3M 1H9SB 5AFWA 3NWSA 3I73A 1I4PA 3OOCA 1LLRD 1HRJA 3HKZB 4FP5D 2X69A 2JYOA 4DFAA 2XRQD 3C3LA 1PRTC 2EJFC 4XYQA 1AZPA 4B9XA 3IKJA 5EJWA 2KECA 2QF7A 3V05A 4U68A 2B2TA 2PMZB 1H9SA 1TY2A 1X3PA 1CM9A 3TP8A 3OHXC 4ABNA 2EE1A 3CKIB 2WIIB 4XQQA 3S1QB 5CV4A 2KVMA 3RUZA 4C56C 1D6EC 5E1FA 3RLFA 1Y8PB 3K6OA 2J0TD 5K36H 5HGTA 4A3EB 3BVMA 2MGSA 2BE5C 1WTVA 5C4JB 3EFXD 2B2TC 3OPOA 2SEBD 5JVG3 4FYDA 3W2DA 2K32A 4IFDI 4C3HG 4A3JB 1X3QA 4EGVA 4J8QA 1V8QA 1LT4D 5IT9E 2PO4A 2O4XA 3TZDA 3IL8A 3LWUA 3S16B 1C4QA 1CHQD 2YYZA 1A2TA 1F9PA 2KOLA 3RZOB 5DAUA 5EBDA 2D5DA 3SK4A 2F0LA 3OWFA 1D5ZC 1A2UA 1WTQA 4XT1B 4KK7A 1TR5A 2R92B 3Q0AA 3QWNA 2I07B 5EPJA 3NK9A 5LHY1 2A68D 3NQTA 2ENBA 3S15B 3EA6A 2K33A 4FF2A 1E2ZA 1LTTD 1RHPA 2XN9C 4RGNA 5NUCA 2ICEC 5FO9B 1IW7C 3UI2A 1LT6D 4X3SA 3VA7A 4EVOA 1SNOA 1TVXA 3U9SA 3HS0C 1S5CD 1YNND 1SNQA 4KKSA 3R93A 3NUCA 4XTCS 1LT5D 4CJ2C 3GTQB 3S1RB 1SE2A 2I46A 3E6ZX 1OXXK 4NW2A 1ZXTA 2BA0A 4K5WA 5C0XG 4XDXA 3TP7A 1IYUA 1HFNA 2BOSA 1R9TB 1B1ZA 1RF2D 4DAVA 4BBRB 3VR5A 4KHZA 4RA8A 3K0YA 4FF4A 2F0EA 1SNDA 1Q1EA 4RKLA 3K58A 1SSOA 2WKDA 1V1PB 3A55A 5T1GA 5LL6X 4CJ1B 5I2YA 1HA5A 3R3OA 5JPMC 1TT2A 2EDGA 3SEBA 4JK1C 1SMYD 3D8GA 4HCEA 3OMCA 3MVVA 3VYUA 1S5ED 1PTOD 1ZKOA 1CFMA 1I4HA 1JCKB 4WFN3 4ZUIA 3D6WA 2RSNA 3I4LA 4DA2A 1RDPD 3JAML 1XWEA 3KBXA 1V1PA 1SYGA 5ELDA 1IL8A 2XWBB 2OT2A 2A6HD 3DHQA 4K6LA 4S3SA 2A74C 5A2QL 3FPUB 3TMEA 1H9MA 4BY7B 3CU7A 2QKIC 3GD7A 1LTAD 1AP0A 2F0FA 3A7AB 4F87A 2KEDA 3J81E 3FPPA 4L8JA 2RSOA 3URYA 4PV1C 1SYDA 2JEAI 4DK1A 4N9PA 4FXDA 4WORA 3MAQA 1G8ZD 2LY7A 2RDFA 3HOZB 3CHBD 1WTOA 2JE6I 2X6GA 4KN7C 2HDLA 1QB5D 4J1MA 4C3IG 3GTLB 3S2DB 1TKWB 2L1BA 4ZKCB 1B50A 2IW3A 1F9QA 4OHJA 3BDLA 2HQEA 2EPBA 2EYOA 1OXTA 3M4OB 2VUMB 1JOQA 1ENFA 4RH6A 2AUKA 2X6LA 5IGEA 2EY2A 1PTOF 3I4MB 3NHHA 4IFDJ 2B2YA 1MBYA 2K6AA 2EJMA 4DNTB 1KDBA 2FFKB 1KNAA 1EQTA 4K6DA 2G9DA 2R7ZB 2XVSA 4E6IA 1PXUA 2D2CC 5M9OA 4TRDA 1DJRD 5KNBA 1EY6A 2BE5D 3J80L 4DNRB 1EWCA 3I8ZA 3Q23A 3E0JA 3MXNA 3N52A 2SOBA 3RZDB 1E2WA 5DNFA 4OO1H 2B2WA 2NUCA 2K01A 1TWGB 1SE4A 1SJHD 5EPLA 5D65A 1EYDA 2NN6G 3VYRA 3AB9A 4RCOA 4K2KA 4CBVA 5ELBA 2F1MA 1ICWA 2QDBA 2QILA 4Z9CB 2Q8IB 2ZT9C 1JC7A 3DMUA 1I4RA 3CRKC 4BS9A 1SE3A 3HEJA 3QJYA 5CBAE 1PRTF 1FR3A 5I6WA 1A15A 4V190 1R4QB 1CA5A 1A3UA 4B9WA 3NWTA 2E2HB 3M7NA 1PDQA 4RAUC 4TQUS 3MWYW 3SK5A 3C1FA 4WJWA 2Y0SB 2RDGA 2OXPA 2JA5B 1HXYD 1M8AA 2NTTA 2E2IB 3SVMA 1EU4A 4DU9A 5IT9L 5M5YB 1IW7D 2F0JA 2V4DA 3D4RA 1SNPA 4K5VA 3VR3A 3PO3B 1XXGA 4QIWB 4BWGB 1KABA 1QOHA 3AU7A 2H4OA 4DAYA 3T51B 3SXHA 2AWOA 4KJOA 1I3QB 5CV5A 2IL8A 2EJGC 5M3FB 1NR4A 2EYLA 1SNMA 1VF5C 2B2VA 5BN3A 1EY5A 1KAAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NW2 A;  1NAP A;  1ZXT A;  2K1B A;  2MGS A;  3I8Z A;  1WTV A;  4ZAI A;  1WTP A;  1Q3L A;  1RTN A;  2KED A;  4XDX A;  2B2T C;  2K05 A;  2KEE A;  1QNK A;  1MSH A;  3Q6S A;  1EIH A;  4IUR A;  2M2L A;  1VMP A;  1BF4 A;  1U4R A;  1HFN A;  3N52 A;  1X3Q A;  3DEP A;  1EIG A;  4IUQ A;  4IUP A;  2RSO A;  5DNF A;  5COY A;  1XYI A;  1DZ1 A;  2B2W A;  4HSV A;  3ONA B;  2K01 A;  1DON A;  3TZD A;  1XX8 A;  4R9W A;  2K28 A;  1MSG A;  4HAE A;  4MN3 A;  1ROD A;  3IL8 A;  5D65 A;  5EPL A;  1EOT A;  4DN4 M;  1G2S A;  1U4L A;  4ZLT F;  1HHV A;  4HCS A;  4X3T A;  3DEO A;  1F9P A;  1WD1 A;  1GUW A;  4RA8 A;  1QE6 A;  2KOL A;  1G2T A;  2B2Y C;  2HCC A;  5EKI A;  1ICW A;  1WTO A;  2X6G A;  2R3Z A;  2HDL A;  5CBE E;  1DOK A;  4R8I A;  1WTR A;  1SDF A;  1HUN A;  1E0B A;  2N55 A;  4QUC A;  1PFB A;  4X3K A;  5AFW A;  1SSO A;  2L1B A;  5T1G A;  2CVR A;  4ZKC B;  1JIC A;  2VXW A;  1BO0 A;  1ILP A;  1F2L A;  1KNE A;  1CA6 A;  1B50 A;  4CJ1 B;  1WTQ A;  1G91 A;  5T1I A;  4ZK9 B;  2XIW A;  2K04 A;  1JE4 A;  1F9Q A;  1RTO A;  2NZ1 D;  4XT1 B;  5E4X A;  1AP0 A;  5CBA E;  2MJ8 A;  1HRJ A;  5EQ0 A;  1B3A A;  1A15 A;  2KUM A;  2X69 A;  4LMQ D;  3TN2 A;  2JYO A;  2EPB A;  3DM1 A;  1CA5 A;  1PLF A;  5EPJ A;  3H91 A;  4O42 A;  2HUG A;  2L11 A;  2L12 A;  2N88 A;  1PDQ A;  2HDM A;  2Q8R E;  4OIK A;  2MP1 A;  1NR2 A;  3I90 A;  3MWY W;  4RAU C;  2J7Z A;  3FDT A;  2X6L A;  3QO2 A;  3GV3 A;  1WVL A;  1AZQ A;  1C8C A;  2B2V C;  1PFN A;  2B2U C;  2NYZ D;  2JP1 A;  1HFG A;  4RWS C;  1AZP A;  1HUM A;  1B2T A;  1U4M A;  3KUP A;  4X3U A;  1M8A A;  1U4P A;  1X32 A;  2B2Y A;  2L9H A;  3D6W A;  2RSN A;  2FMM A;  1F9R A;  1EL0 A;  4OIJ A;  5EJW A;  3SVM A;  2RVL A;  2FHT A;  3HP3 A;  2KEC A;  3IFD A;  2B2T A;  4U68 A;  4MHE A;  1WTX A;  1RHP A;  1BBX C;  3P7J A;  1X3P A;  3KBX A;  1CM9 A;  2HCI A;  5D14 A;  3F2U A;  2EOT A;  1O80 A;  2BDN A;  3G7L A;  1BNZ A;  1IKM A;  2EE1 A;  3GV6 A;  2DY8 A;  3MTS A;  1O7Z A;  5E4W C;  1DOL A;  3UI2 A;  2FFK B;  1IL8 A;  1KNA A;  4QUF A;  2B2W C;  2RA4 A;  4IUT A;  4X3S A;  1EQT A;  3I91 A;  1MGS A;  1O7Y A;  3I3C A;  4CJ0 B;  1ILQ A;  2K03 A;  5COR A;  1B53 A;  1TVX A;  1ML0 D;  1IKL A;  1ESR A;  2FIN B;  1S4Z A;  2IL8 A;  2KVM A;  1PFM A;  2NWG A;  2SDF A;  1VMC A;  1G6Z A;  1MI2 A;  2FJ2 A;  3LWE A;  1NR4 A;  1NCV A;  5JJZ A;  1HA6 A;  5EPK A;  2Q8T A;  2B2V A;  3FPU B;  4HED A;  1SAP A;  2B2U A;  3R93 A;  2D9U A;  1WTW A;  5CMD A;  2H1E A;  4XT3 B;  1RJT A;  2L4N A;  2MPM A;  4IUU A;  4CJ2 C;  4IUV A;  1J8I A;  1WD0 A;  2DY7 A;  4ZKB B;  1F9S A;  4UAI A;  1J9O A;  1LV9 A;  1DOM A;  1B4O A;  1QG7 A; 
#chains in the Genus database with same CATH topology
 2G9H D;  5JEA H;  1EYG A;  4DR7 L;  5CV7 A;  4ZAI A;  1WTP A;  3ERQ A;  2F4V L;  2CQA A;  1Q7Y C;  4P74 A;  3CPW A;  2B63 H;  3SE0 A;  4N9T A;  1E1T A;  5C5M A;  5I4D A;  4R4O A;  2CH4 W;  2QEX A;  5K36 G;  5KIX A;  5C6A A;  4LFA Q;  4HAE A;  5A35 A;  5C3E H;  3W5O A;  1SE8 A;  1I6V C;  5IYC G;  4X65 Q;  3K7U C;  1M4V A;  4ID6 A;  4C3J B;  1LT3 D;  4A3M B;  1F2M A;  1WTH A;  3K7A H;  3HOY H;  3ER0 A;  1SYC A;  5CBE E;  4LF6 Q;  3T53 B;  3CF5 A;  4XYO A;  3I4O A;  4LJZ C;  1IYJ B;  1JWM D;  4KD3 A;  4G4K A;  2A6E C;  3FEW X;  3L9A X;  4V0B A;  3I4N B;  1WCM G;  1LO5 D;  3H0G B;  4ZK9 B;  1IBL Q;  3QIA A;  1XTD A;  1RTO A;  1TWH B;  1DCZ A;  3RMH A;  2M9V A;  4LFB L;  5EQ0 A;  3TS2 A;  1H9K A;  3F2B A;  1D2B A;  4LMQ D;  1N32 Q;  2IT1 A;  4K8J A;  3MHB A;  2N88 A;  3I55 A;  4A3J H;  1W3S A;  4Q5V A;  2F0D A;  1S40 A;  2PCF B;  2QGQ A;  2WAQ B;  4A3B H;  3HKS A;  4RGT A;  4RWS C;  3DWP A;  4BXX G;  2A69 D;  1U4M A;  1KHI A;  2YTX A;  4OWW B;  5C0X I;  4L5T A;  2LS0 1;  2EY1 A;  2K5D A;  1EL0 A;  1JOR A;  2CWA A;  5ELN A;  2FMC A;  3RR5 A;  3T13 A;  2JJQ A;  3KF8 B;  3P7J A;  4QY7 A;  1YZ6 A;  4JI5 Q;  3LNN A;  3G7L A;  3QG1 A;  2CFM A;  5C4X H;  1IBK Q;  2K5W A;  4GZY C;  3S17 B;  4QUF A;  2RA4 A;  3PSI A;  1CKN B;  4CGY B;  1DXM A;  5J39 A;  2VY3 A;  5J22 A;  5JJI A;  4A3G B;  3TP5 A;  2MUY A;  5COR A;  4RG1 A;  1NE3 A;  1GUT A;  4DF7 A;  2MNA A;  1QCB D;  2R92 H;  3VR4 A;  4JI7 L;  2EYP A;  1FD7 D;  1JJG A;  1MI2 A;  2FJ2 A;  1O7I A;  1NCV A;  2M00 A;  2B39 A;  3NEL A;  2B29 A;  2B63 B;  3QOL A;  1Z6H A;  4IPG A;  4KI0 A;  1J8I A;  5CV9 A;  3GTM H;  5KRU A;  3G48 A;  4DPG A;  1PFS A;  4JI8 Q;  5K5P A;  2CW0 C;  5C3E B;  2E2D C;  1BBW A;  4OX9 L;  4FF1 A;  4EQO A;  3KF8 A;  1Y1V G;  2F4I A;  1V1O A;  5DLQ E;  1M90 C;  1Q90 A;  3MEH A;  4R4Q A;  3BYT B;  1EUJ A;  3K7A B;  3HOY B;  4XQN A;  4DV5 L;  4QB4 A;  1XYI A;  1VQ4 A;  1U9R A;  1CKN A;  4OEM B;  1X54 A;  1HR0 Q;  2R93 H;  5GRO A;  2UUB L;  1NTG A;  4LF5 L;  3J80 i;  1N33 Q;  1EOT A;  3HOW H;  1HQM C;  1HHV A;  3MEF A;  3DEO A;  3X3M A;  1HCZ A;  4KJN A;  1G2T A;  1FJG L;  4YCV A;  1HQR D;  3AFQ A;  1MD2 D;  1HNX Q;  1EFW A;  4R8I A;  4BA2 I;  1KXL A;  1VQA A;  2QDL A;  4Y52 H;  1SJE D;  4QUC A;  4A3I G;  3HGB A;  1JIC A;  1ILP A;  3S1R H;  2PMZ E;  1I50 H;  2LMC B;  4A3B B;  1R4P B;  2PW5 A;  2PZW A;  2EYH A;  1STB A;  4NXN L;  1S5D D;  4JC0 A;  1WOC A;  1B7Y B;  2JA8 G;  1R9T H;  1Z9F A;  1WVL A;  1A62 A;  3K81 C;  1C8C A;  1CHP D;  2BDO A;  1MIU A;  4BY1 B;  3PUY A;  2OEO A;  4YIJ A;  3J81 L;  1B9N A;  4DR2 L;  3EIV A;  5C4X B;  1AFP A;  2L9H A;  1QUQ B;  4UP8 A;  1LTB D;  4FXG C;  1X9N A;  4IPD A;  3HOZ G;  4QF4 A;  2KBN A;  2OF1 A;  4MHE A;  1VQM A;  2R61 A;  2LXK A;  2F0K A;  1LTR D;  1VQ9 A;  3I72 A;  2DNC A;  1TWF B;  2BDN A;  4KY5 A;  4RFB A;  3TBI B;  3I56 A;  4LNQ A;  2F0P A;  4FF3 A;  4PMW A;  1JWU D;  2Q2T A;  3MFG A;  3GTM B;  2RHQ B;  4GKK L;  3G6J B;  5JAV A;  4HID A;  3CCJ A;  3TSS A;  2NWG A;  3NBH B;  2KHS A;  3MC0 B;  3MXG A;  3M4Q A;  2Q8T A;  1GUN A;  1VQB A;  1ICF B;  2B2U A;  5IIF A;  1SEB D;  3BVZ A;  3P75 A;  3A54 A;  2KHJ A;  3QR8 A;  1QUQ A;  1PHJ A;  1F9S A;  1LV9 A;  3I4M G;  2R93 B;  4DAM A;  2CCZ A;  1BR9 A;  3EN2 A;  3HOW B;  4A4I A;  1QNK A;  2DJF C;  2F0O A;  3TEH B;  4IUN A;  1P8L A;  4NPS A;  2VZA A;  1X65 A;  1YJ9 A;  2UXC Q;  1DON A;  4EQ5 A;  1MSG A;  1LUZ A;  4YCW A;  1GUO A;  2BH8 A;  4A93 H;  2R7Z G;  5EKK A;  2WAC A;  4QQB X;  3NBH A;  3N6R A;  1L0Y B;  1I50 B;  2E5L Q;  4TVA B;  1P16 A;  1TU2 B;  3W1G A;  4LF7 L;  1TY0 A;  5J3B A;  4JPB W;  3D0F A;  4GS3 A;  4IZ8 A;  3NTK A;  1TWA H;  5IGG A;  3NSW A;  3H6M A;  4NXM L;  1VQE A;  4X66 Q;  3VR2 A;  3F2C A;  4NP5 A;  5DM7 3;  4DR1 L;  3S1N H;  1KRS A;  2KQ3 A;  3D6C A;  3K59 A;  5GQO A;  1D5X C;  3KLS X;  4PNY A;  1II3 A;  4OGQ C;  3CC4 A;  1D1K A;  2VL6 A;  2G5D A;  1DM0 B;  4LUO A;  2HDM A;  5JPN C;  3U58 A;  3A8K E;  4HMJ A;  4FO2 A;  4CDC C;  1PH7 A;  2F4V Q;  1EQR A;  2HIX A;  4OWX B;  2NYZ D;  4XIG S;  2JP1 A;  1HFG A;  3HOV B;  1X6O A;  1Z7T A;  4H7B A;  3WOF A;  1K0S A;  3D4D A;  3HP3 A;  1EWH A;  1N36 L;  2R6G A;  4MNO A;  2F0S A;  1GD7 A;  1RKN A;  2HCI A;  3C1E A;  3PIO 3;  1LTS D;  1NSN S;  5C3W A;  1STN A;  2NN6 I;  4IUT A;  1MGS A;  4GNX C;  3BDC A;  1PV4 A;  3I3C A;  1YNJ D;  4G7O C;  1B53 A;  3PF5 A;  4GN4 B;  4P71 A;  2BH2 A;  4RGM A;  1AEX A;  1QZG A;  4A3C H;  3OIQ A;  3S24 A;  2EZV A;  1HNZ L;  3A5Z B;  4DUZ Q;  4XXE A;  5KND A;  5E7N A;  2QW7 A;  1KD1 C;  1QIL A;  4DV3 Q;  3QOJ A;  4LFB Q;  1LYL A;  2Y0S G;  1V1Q A;  3B6Y A;  2YTY A;  1CUK A;  3J7A F;  2JA5 G;  3NE5 B;  1UEB A;  2C35 B;  1N9W A;  5ELC A;  1STH A;  3A0J A;  1FNW A;  4B3M Q;  2KEE A;  1Q8I A;  2RBM A;  5IGD A;  4A76 A;  4A93 B;  2PNH A;  3L2P A;  3Q6S A;  1MSH A;  1U4R A;  4HIM A;  3JAM c;  4IUQ A;  1D5M C;  1HZC A;  5C0X J;  2NZO A;  2AQ2 B;  1T5E A;  1HZB A;  2HIV A;  4CKC A;  3PO3 G;  1BCP D;  5LMN L;  1G2S A;  2OTL A;  1TWA B;  4JI0 L;  3A8J E;  4ILW A;  1JB7 A;  2MO1 A;  4IOA A;  4ME5 A;  3LX0 A;  4A3K H;  3S1N B;  4IPC A;  2NBF A;  1C7Y A;  4GLA C;  4JI6 L;  2GN5 A;  1O7L A;  2N55 A;  1Y8O B;  4K8I A;  1G91 A;  1D1I A;  1CA6 A;  2IJ0 A;  3FKI G;  3GDE A;  2DN8 A;  3IRB A;  5IOD A;  1I6H H;  3J81 j;  2NZ1 D;  4OON A;  1QJO A;  3HOX H;  3T1H L;  1KTK A;  2PZT A;  1STG A;  1GHK A;  4M1U B;  1A0I A;  2VQF Q;  4FXK C;  2CKZ B;  2EXZ A;  3WWV A;  2LFN A;  4DKA C;  4JI1 Q;  4G57 A;  1SRO A;  3PO2 G;  4OX9 Q;  4DK6 C;  3QO2 A;  3VR6 A;  1AZQ A;  4TSS A;  2PI2 E;  3GTG B;  4X3U A;  3ULP A;  1ET6 A;  2WB1 B;  5KEE A;  4DV5 Q;  1E2V A;  1L1O B;  4DK3 C;  2E74 C;  2FHT A;  3RLN A;  2UUB Q;  3Q22 A;  4HR7 B;  1XMQ L;  4LF5 Q;  4UHV A;  2YTV A;  3AYH B;  5KYL A;  3K5M A;  1PRT D;  1BNZ A;  1A63 A;  1IKM A;  2OQ0 A;  3E9H A;  4OXP A;  2O5J C;  4K0K Q;  2K75 A;  5HUR A;  1FJG Q;  2LXJ A;  4GKJ Q;  1Q82 C;  3H0G G;  3J81 i;  1PTO H;  2PPB C;  1MHW C;  4GOP B;  2SNS A;  1ILQ A;  3OMG A;  3PGZ A;  3STB D;  1IL2 A;  4B3R L;  1IKL A;  3ULJ A;  2FIN B;  4DGZ A;  5I9P A;  4IJL A;  4ZUJ A;  1KQS A;  3KFU A;  5I2X A;  2LKV A;  1S72 A;  4UP7 A;  3JC6 6;  5D3I B;  5EPK A;  2ZJP A;  1TWC H;  1IBM Q;  2CW0 D;  3CC2 A;  4IUU A;  1W6J A;  4ZKB B;  3E9I A;  1L1O A;  4NXN Q;  1NAP A;  2Q2H A;  3TZU A;  3OWE B;  3NBI A;  5FJ8 H;  3NXW A;  2Z6K A;  2V1C C;  1AN8 A;  3M3Y H;  3F8T A;  4DXG A;  1HR0 W;  2NTS A;  4DR2 Q;  2UU9 L;  4R8N A;  3HKZ G;  4IUP A;  4A3K B;  3BDO A;  5COY A;  2OTJ A;  1TS5 A;  3AMU A;  1A3T A;  1BDO A;  1PA6 A;  1SRU A;  4GOP A;  1BCP F;  4JCV E;  4UPA A;  3KDF B;  5CR3 A;  1VQD A;  4P73 A;  1U4L A;  1Y1W H;  4A3G G;  1I6H B;  2C9O A;  3NQI A;  1GUW A;  1LAC A;  2B2Y C;  4IFD H;  3HOX B;  1NJI C;  1C0A A;  1EY7 A;  2B63 G;  2AWN A;  1L0W A;  1Q81 C;  1EEI D;  1YVC A;  4CDE C;  2F0G A;  2A68 C;  4XQJ A;  4O1N A;  2F0N A;  1BXT A;  3J80 c;  5C3E G;  2RCN A;  1PYW D;  1EZ8 A;  4MIU A;  4F8M A;  5LL6 S;  3OYY A;  1GUG A;  1PLF A;  4FNF A;  3HOY G;  4OIK A;  1VS0 A;  1BQQ T;  4HN7 A;  2J7Z A;  1TQO A;  3KDF A;  1VQC A;  4DR6 Q;  1SYE A;  5ISR A;  4UDU C;  2J4X A;  2F0V A;  3KUP A;  3A5U A;  4B3T L;  4AQY L;  4A3L G;  4RCN A;  2KA7 A;  1PTO B;  3PUV A;  5L37 A;  3GO5 A;  4QCL A;  3PUW A;  2IY5 B;  5EKL A;  1SYF A;  3Q24 A;  4DXF A;  1JOO A;  2VS1 A;  5M3M H;  3GTP B;  5E4W C;  1TWC B;  1B8A A;  4P2C B;  5IP9 H;  4A3J G;  2ATW A;  1G51 A;  2B2W C;  4C3I H;  4LF7 Q;  2Z1C A;  1GOZ A;  3P1H A;  2QCP X;  3D4W A;  4A3B G;  1SN8 A;  4I7Z C;  3S9W A;  3G6E A;  4JV5 Q;  1RIP A;  1S4Z A;  3R8B A;  2HQL A;  3JAM E;  3WDN A;  3ND8 A;  1HA6 A;  1A3V A;  1XMO Q;  2VNU D;  1CT1 D;  3M3Y B;  2H1E A;  1NMF A;  1NY4 A;  2K5Q A;  4IUV A;  5FOB B;  4K14 A;  1DOM A;  1QVF A;  1UUP A;  5C4X G;  2AKW B;  4OEL B;  2K1B A;  4LUV A;  1Y1W B;  2F0M A;  2Z8L A;  4B3S L;  4YY3 L;  4IUR A;  1GM5 A;  2O5I C;  3UE0 A;  3PUX A;  2XWJ B;  2R92 G;  2MFI A;  1DD2 A;  5IT9 c;  3PIP 3;  1EY4 A;  1EYC A;  2PQE A;  2JSO A;  1YEZ A;  1EFI D;  4P75 A;  2I5M X;  2NVY H;  1N36 Q;  2N3S A;  4ME3 A;  3RNU A;  3FVQ A;  4X3T A;  4LW1 A;  1VDZ A;  1V43 A;  3BZC A;  2Y0S E;  5AJ3 L;  1LAB A;  1X3E A;  1T9H A;  1YHQ A;  1A6X A;  4WJ3 M;  4HJ7 A;  4YCU A;  4G7Z C;  2VB2 X;  4BA1 I;  3MA2 B;  1VQI A;  1C48 A;  1PZK D;  2AQ1 B;  1I4G A;  1WJJ A;  2R93 G;  1HNZ Q;  5C4H A;  3QB3 A;  5IGF A;  3S14 H;  1CKO A;  2ZTE A;  2MJ8 A;  1KDA A;  3HOW G;  3GP7 A;  2EYM A;  2PNR C;  2OQK A;  4H0L C;  2EIF A;  4QIW E;  5C5L A;  1GVP A;  2MP1 A;  1PRT B;  3MZ5 A;  3NEN A;  3FRP B;  2C5C A;  3S2H H;  2B2V C;  3HG9 A;  4IJH A;  1PH2 A;  1LTG D;  1B2T A;  4JBJ A;  5M3M B;  4YHH L;  3KK7 A;  4NMZ A;  1F2Y A;  3L7Z C;  4KLK A;  1VQG A;  1W6K A;  4C3I B;  5IGC A;  3FMC A;  4DV0 Q;  2A6H C;  4C1N I;  2NVT H;  4X62 L;  5LMN Q;  4DUY L;  1SFO H;  3NTH A;  1E24 A;  1QVG A;  1O80 A;  2EY5 A;  1EIY B;  3DLL A;  2TSS A;  1GO3 E;  4JI0 Q;  4HIK A;  4N8X 1;  2E2J H;  5E3F A;  1YIT A;  4ALP A;  1FGU A;  4MZ9 A;  5I6Y A;  1O7Y A;  4LWC A;  4CJ0 B;  4BBR G;  3M9B A;  3VYS A;  1SMX A;  2K52 A;  1PZI D;  3GTJ H;  1VQO A;  1Y69 U;  4OL7 A;  1G6Z A;  1LTL A;  1ZYR C;  4R4I A;  2F0U A;  5IGB A;  2XGT A;  3RN2 A;  1SAP A;  4AYB B;  2EYF A;  2E8G A;  3T1H Q;  3KJP A;  3SDZ A;  5FO7 B;  5BR8 L;  3DWQ A;  3H09 A;  3SGI A;  4ODG A;  4BY1 H;  1B4O A;  1RCV D;  2NVY B;  1D7Q A;  1Q3L A;  1RD9 D;  1X3G A;  2K05 A;  4HMI A;  1D8L A;  1OXU A;  4O2D A;  4K2L A;  3CCV A;  4LF8 Q;  1FYC A;  4TKO B;  1J6Q A;  3VYT A;  1TWF H;  4HJA A;  3J80 E;  4DAP A;  3U9O A;  4DN4 M;  3PV0 A;  4C1N K;  2MHV A;  3ND9 A;  4JVZ A;  2PYK A;  3S14 B;  4H13 C;  3K80 C;  2WAQ E;  3L0O A;  5FLX E;  1VQ6 A;  3CRL C;  4JI3 L;  1DOK A;  2F0I A;  3BZD B;  4B3R Q;  1XJV A;  1GJX A;  1BO0 A;  1F2L A;  1HTL D;  1KLU D;  2WV6 D;  3S2H B;  3T1Y L;  5E4X A;  3T16 A;  3HKZ E;  4N8F A;  1VQK A;  1B3A A;  2RF4 A;  2IPK D;  4A93 G;  1XNR L;  3A74 A;  1B9M A;  2VB3 X;  1YBY A;  1ONL A;  1EY9 A;  2L12 A;  2Q8R E;  5EGT A;  1NR2 A;  2UXD L;  5HGQ A;  2NVT B;  3FDT A;  1VQ8 A;  3ITP A;  1SFO B;  3KBG A;  3AQQ A;  1HZA A;  1BBU A;  4FVM A;  5ELE A;  4JI4 L;  1X32 A;  4BY7 G;  1XPO A;  2E2J B;  3K5N A;  1ESF A;  3K57 A;  2JA6 H;  3OW7 A;  3J7A V;  5LMU L;  4R1J A;  4ZQ3 A;  1PMR A;  2AHO B;  4O0A A;  3GTJ B;  3HRZ C;  1XTC D;  3ERO A;  4CHT B;  4KKU A;  4DV2 L;  3GV6 A;  4M8A A;  2DY8 A;  1O7Z A;  1TXY A;  1C9O A;  3MXU A;  1J5E L;  3KJO A;  1Z47 A;  1KLG D;  1BUV T;  1ML0 D;  5BN5 A;  3V2T A;  4CKB A;  1WCM H;  2AUJ D;  2SDF A;  4DR4 L;  5FO8 B;  2JK8 A;  1ET9 A;  1VMC A;  2A73 B;  1N34 L;  2NB0 A;  4JW0 A;  1Q12 A;  4HED A;  1SBB B;  3RD4 A;  3ZYY X;  2MPM A;  4PZ8 A;  4BBS H;  4OO1 I;  1CQV A;  3MFY A;  3HOV H;  2WB1 G;  2KEN A;  2Z9H A;  3J81 c;  1M1K C;  5JOB A;  3FHW A;  2B8F A;  2F3V A;  1IYV A;  4A3F H;  4BXX H;  1SR3 A;  2M2L A;  3NP8 A;  4I65 A;  4A3C G;  4KMU C;  4JBW A;  1EIG A;  4B3T Q;  2R7D A;  5DM6 3;  3HOU H;  4HSV A;  2RKS A;  3EJI A;  1HNW Q;  3TS0 A;  2L0C A;  2VUM G;  1ROD A;  5GAG C;  4IO9 A;  3C2P A;  3TRZ A;  2BA1 A;  1PH3 A;  1NUC A;  4U67 3;  4J6H A;  3R2T A;  4HSP A;  1TS4 A;  4LFC L;  3D3R A;  1JJC B;  4NDX A;  3K5O A;  3PIO A;  1I94 L;  3MXP A;  4EQP A;  3BYY B;  2AMC B;  2CVR A;  1V9P A;  1LTI D;  1KNE A;  4HTH A;  2XIW A;  1JE4 A;  3DWA A;  4NKL A;  3GTO H;  2K4K A;  3DXJ C;  4Q0F A;  3J7Y W;  2WP8 J;  3H91 A;  3NTI A;  2JA6 B;  3OSO A;  1FL0 A;  3I90 A;  5F2D A;  1EYA A;  1NBW A;  1EEF D;  2B2U C;  4B3S Q;  1TS2 A;  5G3L D;  1I4Q A;  1SXT A;  5IP7 H;  5CV6 A;  2RVL A;  1VQF A;  2QEJ C;  1I4X A;  3CPF A;  4KV6 A;  5ELO A;  4J15 A;  4QMG A;  1WTX A;  1TS3 A;  3X3N A;  1WCM B;  4L63 B;  4LK1 C;  2F0W A;  2WKC A;  2MO0 A;  2OWO A;  4BBS B;  4DR7 Q;  3ZJY C;  3M7G A;  1FGB D;  2BCO A;  4RKB A;  3CME A;  1K8A C;  3J7A 5;  3T56 B;  2H5X A;  5M5X H;  4A3I H;  1W2B A;  4C3H H;  2K5V A;  4WRD A;  2WIN B;  3NEM A;  4A3F B;  3E0E A;  1WTW A;  1JR0 D;  2KCN A;  3CQZ H;  3BVG A;  1K8G A;  4UY8 C;  2DY7 A;  3HOU B;  1J9O A;  3OTO L;  3D31 A;  1QG7 A;  1A8V A;  1F77 A;  3P20 A;  1EQV A;  4IPH A;  2JA8 H;  3GTG H;  4DV7 L;  1ENC A;  3H3V H;  1ENA A;  1B3Q A;  4G7H C;  2ZXP A;  2E76 C;  5J1Z A;  4NB3 A;  4WJ4 A;  4YHH Q;  5IYB G;  3TP6 A;  5CYU A;  4KKT A;  4KHV A;  1Y14 B;  3DUZ A;  1XX8 A;  2K28 A;  1UNS A;  3UDX A;  3BZK A;  2F03 A;  4ZLT F;  4HCS A;  5TSS A;  4DUY Q;  1WD1 A;  5DEH A;  3CCR A;  2D0O A;  3LGJ A;  1L0X B;  2IX0 A;  3GTO B;  2R3Z A;  5FJ8 G;  2XSC A;  3KLS A;  1VF7 A;  1WTR A;  1AE3 A;  2JEB I;  4PMC A;  2CHB D;  1UAP A;  4LF4 L;  3CXC A;  1TII D;  2D0P A;  1Y1V B;  2A69 C;  1JB3 A;  5CV8 A;  4KY6 A;  1CTM A;  4X65 L;  1MJC A;  3SK8 A;  5CGK A;  1Y1W G;  2KUM A;  3TN2 A;  5BR8 Q;  1EY0 A;  4L6T B;  4HJ8 A;  2L11 A;  4IFD G;  2GA4 B;  2E75 C;  1IXR A;  3S1M H;  2A6E D;  5M3F G;  2DJG C;  2RQX A;  4L5R C;  4PMB A;  4JI2 L;  5G3L F;  5EBC A;  1U4P A;  3A8I E;  2K7V A;  5CC4 A;  4OO1 G;  4JI7 Q;  1KAW A;  1DGS A;  5LMN W;  1S5B D;  1GHJ A;  3TRE A;  3IFD A;  3IFT A;  5M5X B;  4A3I B;  3PUZ A;  3BJU A;  1IHZ A;  4C3H B;  5C44 H;  3U4V A;  1K8M A;  2N78 A;  2CWP A;  1ASY A;  1AH9 A;  4RHR A;  3KOJ A;  1VQL A;  4ZYS A;  2IX3 A;  2NVQ H;  5C0X H;  3CQZ B;  1K3B C;  4R4C A;  1UWV A;  5HY6 A;  4KN4 C;  1ZYR D;  4RHS A;  2WFW A;  1XPU A;  1ESR A;  2JA8 B;  2B8G A;  4RGO S;  2EQS A;  3EVQ A;  1FNU A;  1PFM A;  3BG3 A;  5FK9 C;  3OIP A;  5KYI A;  4X64 L;  4C3J G;  3T1Y Q;  4A3M G;  1OXS C;  3BS1 A;  1OO9 B;  2F0T A;  1JOK A;  4MTK A;  5CMD A;  4F88 A;  2L4N A;  2A5H A;  5C4Z A;  1WD0 A;  1HTP A;  3I2Z A;  4UAI A;  1IBK L;  2CQO A;  5M3M G;  1DOL A;  2MQH A;  5IP9 G;  1K8O A;  3W1B A;  5KNC A;  3I4N G;  1G29 1;  5JVH 3;  1CZW A;  4F7X A;  5KGU A;  1GKH A;  4JI4 Q;  3K5L A;  1DZ1 A;  4DV4 L;  1CSP A;  5FLM H;  3GTP H;  4Y7N H;  4JG2 A;  1I5F A;  4ZRZ A;  2NVX B;  5LMU Q;  1BKB A;  4ZCK A;  2KCC A;  2D62 A;  2WAQ G;  2VQE L;  4DV2 Q;  1J5E Q;  5M5W H;  1JWS D;  1SDF A;  2WB1 E;  4AYB G;  1Q46 A;  1E0B A;  5FKA C;  4X3K A;  1ZEQ X;  2IWH A;  1STA A;  3K0X A;  2ALY B;  2UUC L;  3S1M B;  1PYB A;  2L55 A;  4CKE A;  2K50 A;  4UP9 A;  1PH5 A;  2AQ3 B;  1CZG A;  1S5F D;  1G6P A;  1L2F A;  1T5X D;  3T4A C;  3DM1 A;  3H15 A;  4IN3 A;  2HUG A;  1PZJ D;  5JEA G;  3O13 A;  5C44 B;  1YJN A;  3GV3 A;  1GXD C;  2A1A A;  2EVB A;  1PFN A;  4JOI A;  4GKK Q;  1UEA B;  1HUM A;  4POF A;  3I70 A;  4LAA A;  2EY6 A;  1L1O C;  1PH4 A;  2NVQ B;  1F9R A;  4YWL A;  3H3V C;  4EQN A;  3TQY A;  3SK6 A;  1BBX C;  3IAY A;  2Z6K C;  2EXD A;  2F3W A;  3PMF A;  1FNV A;  1YNX A;  1CQF A;  4LFC Q;  1K9M C;  2SNM A;  4LUZ A;  1I94 Q;  2ID0 A;  5FLX L;  4GOP C;  1VCI A;  3SHL A;  2TMP A;  2XNA C;  3E3X A;  2JA7 H;  2PZU A;  3LWE A;  1SYB A;  2Z4I A;  1O78 A;  5JJZ A;  4PQX A;  4KY7 A;  1LM0 A;  4DV1 L;  2RCF A;  4XT3 B;  4B08 A;  1EOV A;  1RJT A;  1YNN C;  2Q2I A;  4K5X A;  3ULL A;  4Y7N B;  3CD6 A;  3PO2 H;  1DYQ A;  3V96 A;  1RTN A;  4DNI A;  4DV6 L;  3UDI A;  1VMP A;  1YHA A;  5ELF A;  4DK0 A;  1K83 B;  3R2I A;  1F2Z A;  4HJ5 A;  5M5W B;  2ICI A;  4NXM Q;  4R9W A;  3SR1 A;  1QNU A;  4DR1 Q;  3EQL C;  2YU9 B;  1Q1B A;  1KC8 C;  2K5H A;  2L5T A;  4BY1 G;  1JQY D;  4PZ6 A;  1QE6 A;  1BCP B;  2RDH A;  2HCC A;  2XRS D;  5EKI A;  1GUS A;  1H9R A;  2JXM B;  4C2M H;  3CCL A;  4LF9 L;  1HUN A;  3L3O C;  1PFB A;  4KTA A;  5JEA J;  1Y8N B;  3UDG A;  5IYD H;  2VXW A;  2IX1 A;  2UXC L;  5A2Q E;  5T1I A;  2ZTC A;  2K04 A;  4IAL A;  4A3D H;  1QZH A;  3GTK H;  2E5L L;  1AW7 A;  4H44 C;  1YJW A;  4O42 A;  3WOE A;  5BN4 A;  3KYH C;  1KDC A;  4KD4 A;  4IQZ A;  3W3A A;  1EIF A;  1SMY C;  1HPC A;  1QWY A;  2JN4 A;  3BU2 A;  3E5S A;  3RLO A;  1JT8 A;  1YNJ C;  2FMM A;  4X66 L;  4OIJ A;  1PTO C;  3A56 A;  2PW7 A;  2EYJ A;  5D14 A;  2Z4H A;  3F2U A;  3G4S A;  2EOT A;  3FKI B;  2JA7 B;  3HZX A;  1EY8 A;  3HFZ B;  3MTS A;  3C46 A;  1CK1 A;  3NPP A;  4ULL A;  1ASZ A;  2DNE A;  3EBE A;  1SNC A;  3I91 A;  3VA5 A;  5D3D A;  2OCE A;  2K03 A;  4APV A;  2LSS A;  4LF4 Q;  2F0Q A;  3PO2 B;  3GQB A;  1STY A;  4DR5 L;  2JA6 G;  2O2L D;  4X6A H;  2D9U A;  2ZJR A;  2NN6 H;  3S1Q H;  1BCP C;  1H9J A;  1B44 D;  3A7L A;  4YWM A;  1BOS A;  2ZXR A;  1OXV A;  1EZ6 A;  1X56 A;  2ZXO A;  2IHE A;  4I7A A;  1EIH A;  1BF4 A;  4JI2 Q;  4JI6 Q;  4A3L H;  3DEP A;  4DUZ L;  2F0H A;  4A3E H;  3ONA B;  1NNX A;  1XNQ L;  4C2M B;  1PVO A;  4DV3 L;  2JQO A;  4MN3 A;  1EU3 A;  1XPR A;  5C4J H;  3AFP A;  2KJX A;  4BBS G;  1UE5 A;  5IOC A;  3KLR A;  1STE A;  1VQN A;  3TDQ A;  3HOV G;  3M4Y A;  4B3M L;  1EWI A;  1YI2 A;  4A3D B;  1S3O A;  3GTK B;  4A3F G;  5C3X A;  3H94 A;  3M85 A;  5I9O A;  1CI3 M;  1H9S B;  3S16 H;  5AFW A;  3NWS A;  4JYA L;  3HOU G;  3I73 A;  1I4P A;  3RZO H;  3OOC A;  1LLR D;  4X64 Q;  3UE1 A;  1CSQ A;  1HRJ A;  3HKZ B;  1XMQ Q;  4YWK A;  2HT1 A;  4FP5 D;  2X69 A;  2JYO A;  1VQ7 A;  4DFA A;  1EQQ A;  2XRQ D;  3C3L A;  3ERS X;  1PRT C;  1H95 A;  2EJF C;  4XYQ A;  1AZP A;  4B9X A;  2KCM A;  3IKJ A;  3AEV A;  1Q86 C;  3STB C;  4FDB A;  5EJW A;  4AYB E;  4DV4 Q;  2KEC A;  2QF7 A;  3U4Z A;  4U68 A;  2B2T A;  3V05 A;  2PMZ B;  2UUA L;  1H9S A;  2VQF L;  1TY2 A;  1X3P A;  1CM9 A;  3TP8 A;  3OHX C;  4ABN A;  2EE1 A;  4JI1 L;  2HHH L;  2VQE Q;  3CKI B;  2WII B;  3S15 H;  3CW2 C;  4XQQ A;  1U0L A;  3S1Q B;  2K5N A;  4QGU A;  5CV4 A;  2KVM A;  3RUZ A;  4C56 C;  1D6E C;  5E1F A;  2KCT A;  3RLF A;  1Y8P B;  5IP7 G;  2UU9 Q;  3K6O A;  3PF4 A;  2J0T D;  2UUC Q;  1WYD A;  5K36 H;  2ZM6 L;  4EX5 A;  5HGT A;  5IYC H;  4K0K L;  2ES2 A;  4A3E B;  4GKJ L;  3BVM A;  2MGS A;  2BE5 C;  1WTV A;  5C4J B;  3EFX D;  4RMF A;  2B2T C;  1YHB A;  3OPO A;  2SEB D;  5JVG 3;  4FYD A;  3W2D A;  2K32 A;  4IFD I;  4C3H G;  1JE5 A;  4A3J B;  1X3Q A;  4EGV A;  4J8Q A;  1V8Q A;  1LT4 D;  3GTQ H;  5JJL A;  1HZ9 A;  5IT9 E;  2A19 A;  2PO4 A;  2O4X A;  2P5Z X;  1IBM L;  3TZD A;  3IL8 A;  3LWU A;  3S16 B;  1C4Q A;  1CHQ D;  2YYZ A;  1A2T A;  2HD3 A;  1F9P A;  3CC7 A;  2KOL A;  2NZH A;  3RZO B;  5DAU A;  5EBD A;  2D5D A;  4AIM A;  4BBR H;  1KRT A;  3SK4 A;  2F0L A;  3OWF A;  1D5Z C;  1A2U A;  4AQY Q;  1WTQ A;  4DV1 Q;  4XT1 B;  4KK7 A;  1TR5 A;  2R92 B;  3Q0A A;  3QWN A;  2I07 B;  4MTN A;  5EPJ A;  3NK9 A;  2CH4 A;  5LHY 1;  4DV6 Q;  2A68 D;  3NQT A;  3RN5 A;  2ENB A;  3S15 B;  3EA6 A;  3CCU A;  2K33 A;  2L15 A;  4FF2 A;  1E2Z A;  1LTT D;  1RHP A;  2XN9 C;  4RGN A;  3UDF A;  3CMA A;  2UXB L;  5NUC A;  1HH2 P;  2ICE C;  5FO9 B;  1N8R C;  1IW7 C;  2R7F A;  4OWT B;  4DR6 L;  3UI2 A;  2I5L X;  4A3K G;  1LT6 D;  4X3S A;  3VA7 A;  4EVO A;  1K28 A;  1Y1V H;  4GNX B;  2ZJQ A;  1YIJ A;  1SNO A;  1TVX A;  4LF9 Q;  3U9S A;  4YY3 Q;  3HS0 C;  3PQI A;  1S5C D;  2ASB A;  1YNN D;  1SNQ A;  4KKS A;  3F1Z A;  3R93 A;  4IOC A;  3NUC A;  3HOX G;  5C44 G;  4XTC S;  1IZ6 A;  1LT5 D;  4CJ2 C;  5GAH C;  1UE1 A;  1PH6 A;  3GTQ B;  3S1R B;  5IWA L;  1X55 A;  1SE2 A;  2I46 A;  3E6Z X;  1OXX K;  4NW2 A;  1ZXT A;  5GAE C;  1WI5 A;  2BA0 A;  4K5W A;  5C0X G;  4KHP L;  4XDX A;  1VQP A;  4JV5 L;  5AJ3 Q;  3TP7 A;  1IYU A;  2XTI A;  1HFN A;  2BOS A;  1R9T B;  4BY7 H;  1B1Z A;  1XMO L;  1RF2 D;  2GVB A;  4DAV A;  3CCQ A;  4GNX A;  1VQH A;  4BBR B;  4L5Q A;  3VR5 A;  4KHZ A;  4RA8 A;  4AH6 A;  2B3G A;  3K0Y A;  4FF4 A;  2F0E A;  1SND A;  1Q1E A;  4DR3 L;  1KL9 A;  3CCS A;  2I0Q A;  4RKL A;  2JA9 A;  3K58 A;  1SSO A;  2WKD A;  1V1P B;  3A55 A;  5T1G A;  5LL6 X;  1E22 A;  4CDD C;  4CJ1 B;  5FLM G;  5I2Y A;  4DR5 Q;  3HOZ H;  1FVI A;  2IHF A;  1HA5 A;  3R3O A;  5JPM C;  3GTL H;  1TT2 A;  3J7Z C;  4X62 Q;  3S2D H;  2EDG A;  3SEB A;  3ICE A;  4JK1 C;  1SMY D;  3D8G A;  4HCE A;  3OMC A;  3MVV A;  3CCM A;  3VYU A;  1S5E D;  1PTO D;  1ZKO A;  1CFM A;  5IY0 A;  1I4H A;  3KLW A;  1JCK B;  4WFN 3;  4ZUI A;  2NVX H;  3D6W A;  2RSN A;  3I4L A;  4DA2 A;  3F2D A;  4LFA L;  1XNQ Q;  1RDP D;  3M4O H;  3JAM L;  2VUM H;  3KF6 B;  3VDY A;  1KIX A;  1XWE A;  3KBX A;  1V1P A;  1SYG A;  4HJ9 A;  2FXQ A;  3I4M H;  5ELD A;  1IL8 A;  4LF6 L;  2XWB B;  2OT2 A;  4P72 A;  2A6H D;  4DV0 L;  1E7Z A;  3DHQ A;  2N8N A;  4K6L A;  1IBL L;  4JYA Q;  4S3S A;  2A74 C;  5A2Q L;  3FPU B;  3TME A;  1H9M A;  1PH9 A;  4BY7 B;  1MKH A;  3M4P A;  3CU7 A;  2QKI C;  2R7Z H;  1N32 L;  2Q2U A;  3GD7 A;  1LTA D;  1AP0 A;  2F0F A;  3KF6 A;  1VQ5 A;  3A7A B;  4F87 A;  1K3R A;  2KED A;  3J81 E;  3FPP A;  4JI3 Q;  4L8J A;  1CKM A;  1OTC A;  1HJP A;  1WFQ A;  2RSO A;  2JA7 G;  3I7F A;  4PZ7 A;  3URY A;  4PV1 C;  1UE6 A;  1SYD A;  4L5S A;  2JEA I;  4DK1 A;  4N9P A;  2UUA Q;  2PI2 A;  4FXD A;  4JI5 L;  4WOR A;  3MAQ A;  4QL5 A;  1G8Z D;  2LY7 A;  1XNR Q;  2RDF A;  2HHH Q;  3HOZ B;  3RZD H;  3CHB D;  1WTO A;  2JE6 I;  2X6G A;  4KN7 C;  2HDL A;  1QB5 D;  4J1M A;  4C3I G;  2UXD Q;  3GTL B;  1TWG H;  3S2D B;  4LF8 L;  1TKW B;  2L1B A;  4ZKC B;  1UE7 A;  1B50 A;  3CCE A;  2IW3 A;  1F9Q A;  4OHJ A;  2ZM6 Q;  4JBK A;  3BDL A;  4A75 A;  2HQE A;  4JI8 L;  2EPB A;  2EYO A;  1Q8K A;  1OXT A;  3M4O B;  2VUM B;  3PCO B;  1JOQ A;  1ENF A;  1K83 H;  4RH6 A;  2F52 A;  2AUK A;  2X6L A;  5IGE A;  2EY2 A;  4PG3 A;  1PTO F;  3I4M B;  3NHH A;  5IYB H;  2KHI A;  4IFD J;  5IYD G;  2B2Y A;  2YV5 A;  2YU9 H;  1HR0 L;  2ZTD A;  4DR4 Q;  2E2H H;  1BVS A;  1MBY A;  2K6A A;  1N34 Q;  1N33 L;  4A3D G;  1SLJ A;  2EJM A;  1NMG A;  5JJK A;  4DNT B;  3MXN B;  2JA5 H;  3K8A A;  4CDF C;  1KDB A;  2FFK B;  3DM3 A;  1KNA A;  1HNX L;  2E2I H;  1EQT A;  4K6D A;  2G9D A;  2R7Z B;  5H1S E;  5M5Y H;  4GN3 B;  2XVS A;  4E6I A;  1PXU A;  2D2C C;  5M9O A;  4POG A;  4TRD A;  1DJR D;  1X3F A;  5KNB A;  3PO3 H;  1EY6 A;  3PIP A;  2BE5 D;  3J80 L;  4DNR B;  1EWC A;  2N49 A;  1I3Q H;  3I8Z A;  1PH1 A;  3Q23 A;  2PQA B;  5M3F H;  3E0J A;  3CP0 A;  3MXN A;  1JJ2 A;  3N52 A;  1U5K A;  4HIO A;  2SOB A;  3RZD B;  1E2W A;  5DNF A;  4OO1 H;  2B2W A;  3FKI H;  2NUC A;  2VW9 A;  2K01 A;  1MJE A;  1TWG B;  1SE4 A;  1SJH D;  3U50 C;  5EPL A;  5D65 A;  1EYD A;  2NN6 G;  1B70 B;  3VYR A;  3AB9 A;  4RCO A;  1VQJ A;  4K2K A;  4JOI C;  2UXB Q;  4CBV A;  5ELB A;  1JMC A;  5FLX c;  2F1M A;  1ICW A;  1RL2 A;  2QDB A;  2QIL A;  4Z9C B;  2Q8I B;  4R4T A;  2ZT9 C;  1JC7 A;  1QVC A;  3DMU A;  1I4R A;  2PQA A;  5GAD C;  2I5H A;  1HNW L;  4A3E G;  3CRK C;  4BS9 A;  1SE3 A;  4C3J H;  4H02 A;  4A3M H;  3HEJ A;  2RHS B;  3QJY A;  4GN5 A;  5CBA E;  1PRT F;  2GVA A;  1FR3 A;  4DAY B;  5I6W A;  1A15 A;  4V19 0;  1R4Q B;  1CA5 A;  1A3U A;  4B9W A;  5IWA Q;  3NWT A;  2E2H B;  3M7N A;  1PDQ A;  1K0R A;  4RAU C;  4TQU S;  3I4N H;  3MWY W;  3SK5 A;  3H0G H;  3C1F A;  4KHP Q;  4WJW A;  2Y0S B;  2RDG A;  2QA4 A;  1TWH H;  2OXP A;  1PYS B;  3FP9 A;  2JA5 B;  1HXY D;  1M8A A;  1AE2 A;  2A8V A;  2NTT A;  2E2I B;  3SVM A;  4JBM A;  1EU4 A;  2K14 A;  1PH8 A;  4DU9 A;  5IT9 L;  5M5Y B;  1IW7 D;  3OW2 A;  5IE8 A;  3G71 A;  2F0J A;  2V4D A;  3Q8D A;  3D4R A;  4GLX A;  1SNP A;  4K5V A;  3OTO Q;  3VR3 A;  4QJF A;  3PO3 B;  1XXG A;  2Z0S A;  4QIW B;  1KAB A;  4BWG B;  1QOH A;  3AU7 A;  4DR3 Q;  2H4O A;  5EAY A;  4DAY A;  1E3P A;  4DV7 Q;  1K73 C;  3T51 B;  3SXH A;  2AWO A;  2Z6B A;  4KJO A;  1I3Q B;  5CV5 A;  2IL8 A;  3CAM A;  2EJG C;  2DGY A;  5M3F B;  3JAM i;  1NR4 A;  1E1O A;  3H3V I;  2EYL A;  1SNM A;  1VF5 C;  2B2V A;  5BN3 A;  2F3I A;  3S17 H;  1EY5 A;  1KAA A;  4GLV B;  4A3G H;  2DUD A; 
#chains in the Genus database with same CATH homology
 2G9H D;  5JEA H;  5CV7 A;  4ZAI A;  1WTP A;  3ERQ A;  2CQA A;  3SE0 A;  4N9T A;  5C5M A;  5I4D A;  5K36 G;  5KIX A;  5C6A A;  4HAE A;  5A35 A;  1I6V C;  1M4V A;  4ID6 A;  4C3J B;  1LT3 D;  4A3M B;  1F2M A;  1SYC A;  5CBE E;  3T53 B;  4XYO A;  4LJZ C;  1JWM D;  4KD3 A;  4G4K A;  2A6E C;  3FEW X;  3L9A X;  4V0B A;  3I4N B;  1LO5 D;  3H0G B;  4ZK9 B;  3QIA A;  1RTO A;  1TWH B;  1DCZ A;  3RMH A;  2M9V A;  5EQ0 A;  1H9K A;  1D2B A;  4LMQ D;  2IT1 A;  4K8J A;  3MHB A;  2N88 A;  4Q5V A;  2F0D A;  2PCF B;  2WAQ B;  4RWS C;  4RGT A;  3DWP A;  2A69 D;  1U4M A;  5C0X I;  2LS0 1;  2EY1 A;  2K5D A;  1EL0 A;  1JOR A;  2FMC A;  3T13 A;  3P7J A;  3LNN A;  3G7L A;  3QG1 A;  2K5W A;  4GZY C;  3S17 B;  4QUF A;  2RA4 A;  4CGY B;  1DXM A;  5J39 A;  5J22 A;  4A3G B;  3TP5 A;  2MUY A;  5COR A;  4DF7 A;  1GUT A;  1QCB D;  3VR4 A;  2EYP A;  1FD7 D;  1MI2 A;  2FJ2 A;  2M00 A;  1NCV A;  2B39 A;  2B63 B;  3QOL A;  1Z6H A;  4KI0 A;  1J8I A;  5CV9 A;  5KRU A;  5K5P A;  2CW0 C;  5C3E B;  2E2D C;  4FF1 A;  4EQO A;  3KF8 A;  2F4I A;  1V1O A;  1Q90 A;  3MEH A;  3BYT B;  3K7A B;  3HOY B;  4XQN A;  4QB4 A;  1XYI A;  1U9R A;  1EOT A;  1HQM C;  1HHV A;  3DEO A;  3X3M A;  1HCZ A;  4KJN A;  1G2T A;  1HQR D;  1MD2 D;  4R8I A;  4BA2 I;  1SJE D;  4QUC A;  3HGB A;  1JIC A;  1ILP A;  2LMC B;  4A3B B;  1R4P B;  2PW5 A;  2PZW A;  2EYH A;  1STB A;  1S5D D;  1WVL A;  1C8C A;  4BY1 B;  1CHP D;  2BDO A;  3PUY A;  2OEO A;  4YIJ A;  3J81 L;  1B9N A;  5C4X B;  1AFP A;  2L9H A;  1LTB D;  4FXG C;  4QF4 A;  2OF1 A;  4MHE A;  2R61 A;  2F0K A;  1LTR D;  3I72 A;  2DNC A;  1TWF B;  2BDN A;  4KY5 A;  4RFB A;  3TBI B;  4FF3 A;  2F0P A;  4PMW A;  1JWU D;  3MFG A;  3GTM B;  3G6J B;  5JAV A;  3TSS A;  2NWG A;  2KHS A;  3MC0 B;  3MXG A;  2Q8T A;  1GUN A;  2B2U A;  5IIF A;  1SEB D;  3BVZ A;  3P75 A;  3A54 A;  1F9S A;  1LV9 A;  2R93 B;  1BR9 A;  3HOW B;  1QNK A;  2F0O A;  4IUN A;  1DON A;  1MSG A;  1GUO A;  5EKK A;  2WAC A;  3NBH A;  3N6R A;  1L0Y B;  1I50 B;  1TU2 B;  1TY0 A;  4IZ8 A;  3NTK A;  5IGG A;  3NSW A;  3H6M A;  3VR2 A;  4NP5 A;  5DM7 3;  2KQ3 A;  3K59 A;  3D6C A;  1D5X C;  3KLS X;  4PNY A;  1II3 A;  4OGQ C;  1D1K A;  1DM0 B;  5JPN C;  2HDM A;  3A8K E;  4HMJ A;  4FO2 A;  2NYZ D;  4XIG S;  2JP1 A;  1HFG A;  3HOV B;  1Z7T A;  4H7B A;  3WOF A;  3D4D A;  3HP3 A;  1EWH A;  2R6G A;  2F0S A;  1RKN A;  2HCI A;  3C1E A;  3PIO 3;  1LTS D;  1NSN S;  5C3W A;  1STN A;  2NN6 I;  4IUT A;  1MGS A;  3BDC A;  3I3C A;  1YNJ D;  4G7O C;  1B53 A;  4RGM A;  1AEX A;  3OIQ A;  2EZV A;  4XXE A;  5KND A;  1QIL A;  3QOJ A;  3J7A F;  3NE5 B;  5ELC A;  1STH A;  1FNW A;  2KEE A;  1Q8I A;  2RBM A;  5IGD A;  4A93 B;  1MSH A;  3Q6S A;  1U4R A;  4IUQ A;  1D5M C;  5C0X J;  2AQ2 B;  1T5E A;  4CKC A;  1BCP D;  1G2S A;  1TWA B;  3A8J E;  4ILW A;  4ME5 A;  3LX0 A;  3S1N B;  2NBF A;  1O7L A;  2N55 A;  1Y8O B;  4K8I A;  1G91 A;  1D1I A;  1CA6 A;  2IJ0 A;  2DN8 A;  5IOD A;  2NZ1 D;  1QJO A;  1KTK A;  2PZT A;  1STG A;  1GHK A;  4M1U B;  4FXK C;  2EXZ A;  2LFN A;  4G57 A;  3QO2 A;  3VR6 A;  1AZQ A;  4TSS A;  3GTG B;  4X3U A;  1ET6 A;  2WB1 B;  5KEE A;  1E2V A;  2E74 C;  2FHT A;  3Q22 A;  4HR7 B;  5KYL A;  3K5M A;  1PRT D;  1BNZ A;  1IKM A;  2O5J C;  5HUR A;  1PTO H;  2PPB C;  2SNS A;  1ILQ A;  3OMG A;  1IKL A;  4DGZ A;  2FIN B;  5I9P A;  4ZUJ A;  5I2X A;  2LKV A;  5D3I B;  5EPK A;  2CW0 D;  4IUU A;  1W6J A;  4ZKB B;  1NAP A;  3TZU A;  3OWE B;  3NBI A;  3NXW A;  1AN8 A;  4DXG A;  2NTS A;  4R8N A;  4IUP A;  4A3K B;  3BDO A;  5COY A;  1TS5 A;  3AMU A;  1A3T A;  1BDO A;  1BCP F;  5CR3 A;  1U4L A;  1I6H B;  2C9O A;  3NQI A;  1GUW A;  1LAC A;  2B2Y C;  4IFD H;  3HOX B;  1EY7 A;  2AWN A;  1EEI D;  2F0G A;  2A68 C;  4XQJ A;  4O1N A;  2F0N A;  1BXT A;  1PYW D;  1EZ8 A;  4MIU A;  4F8M A;  5LL6 S;  1GUG A;  1PLF A;  4FNF A;  4OIK A;  1BQQ T;  4HN7 A;  2J7Z A;  1TQO A;  1SYE A;  5ISR A;  4UDU C;  2J4X A;  2F0V A;  3KUP A;  4RCN A;  2KA7 A;  1PTO B;  3PUV A;  3GO5 A;  4QCL A;  3PUW A;  5EKL A;  1SYF A;  3Q24 A;  4DXF A;  1JOO A;  3GTP B;  5E4W C;  1TWC B;  4P2C B;  2B2W C;  2Z1C A;  1GOZ A;  3P1H A;  2QCP X;  3D4W A;  4I7Z C;  3S9W A;  1S4Z A;  3R8B A;  3JAM E;  3WDN A;  3ND8 A;  1HA6 A;  1A3V A;  2VNU D;  1CT1 D;  3M3Y B;  2H1E A;  2K5Q A;  4IUV A;  5FOB B;  4K14 A;  1DOM A;  1UUP A;  2K1B A;  1Y1W B;  2F0M A;  2Z8L A;  4IUR A;  2O5I C;  3PUX A;  2XWJ B;  1DD2 A;  3PIP 3;  1EY4 A;  1EYC A;  2PQE A;  2JSO A;  1EFI D;  3FVQ A;  4X3T A;  1VDZ A;  1V43 A;  1LAB A;  1A6X A;  4G7Z C;  2VB2 X;  4BA1 I;  3MA2 B;  1C48 A;  1PZK D;  2AQ1 B;  1I4G A;  5C4H A;  3QB3 A;  5IGF A;  2MJ8 A;  1KDA A;  3GP7 A;  2EYM A;  2PNR C;  4H0L C;  5C5L A;  2MP1 A;  1PRT B;  3MZ5 A;  3FRP B;  2C5C A;  2B2V C;  3HG9 A;  1LTG D;  1B2T A;  5M3M B;  3KK7 A;  4NMZ A;  1F2Y A;  3L7Z C;  1W6K A;  4C3I B;  5IGC A;  3FMC A;  2A6H C;  4C1N I;  3NTH A;  1O80 A;  2EY5 A;  2TSS A;  5E3F A;  5I6Y A;  1O7Y A;  4CJ0 B;  3VYS A;  1PZI D;  1Y69 U;  4OL7 A;  1G6Z A;  1ZYR C;  5IGB A;  2F0U A;  1SAP A;  4AYB B;  2EYF A;  3SDZ A;  5FO7 B;  3DWQ A;  3H09 A;  4ODG A;  1B4O A;  1RCV D;  2NVY B;  1Q3L A;  1RD9 D;  2K05 A;  4HMI A;  1OXU A;  4K2L A;  1FYC A;  4TKO B;  3VYT A;  3J80 E;  4DAP A;  3U9O A;  4DN4 M;  3PV0 A;  4C1N K;  2MHV A;  3ND9 A;  2PYK A;  3S14 B;  4H13 C;  5FLX E;  3CRL C;  1DOK A;  2F0I A;  3BZD B;  1GJX A;  1BO0 A;  1F2L A;  1HTL D;  1KLU D;  2WV6 D;  3S2H B;  5E4X A;  3T16 A;  1B3A A;  2IPK D;  1B9M A;  2VB3 X;  1ONL A;  1EY9 A;  2L12 A;  2Q8R E;  5EGT A;  1NR2 A;  2NVT B;  3FDT A;  3ITP A;  1SFO B;  3KBG A;  4FVM A;  5ELE A;  1X32 A;  2E2J B;  3K5N A;  1ESF A;  3K57 A;  3OW7 A;  3J7A V;  4ZQ3 A;  1PMR A;  3GTJ B;  3HRZ C;  1XTC D;  3ERO A;  4CHT B;  4KKU A;  3GV6 A;  4M8A A;  2DY8 A;  1O7Z A;  3MXU A;  1Z47 A;  1KLG D;  1BUV T;  1ML0 D;  5BN5 A;  3V2T A;  4CKB A;  2AUJ D;  2SDF A;  5FO8 B;  1ET9 A;  1VMC A;  2A73 B;  2NB0 A;  1Q12 A;  4HED A;  1SBB B;  3RD4 A;  3ZYY X;  2MPM A;  4OO1 I;  1CQV A;  3MFY A;  5JOB A;  2B8F A;  2F3V A;  1IYV A;  2M2L A;  3NP8 A;  4I65 A;  4KMU C;  4JBW A;  1EIG A;  5DM6 3;  4HSV A;  2RKS A;  3EJI A;  2L0C A;  1ROD A;  3C2P A;  2BA1 A;  1NUC A;  4U67 3;  4J6H A;  3R2T A;  4HSP A;  1TS4 A;  3D3R A;  4NDX A;  3K5O A;  3MXP A;  4EQP A;  3BYY B;  2CVR A;  1LTI D;  1KNE A;  4HTH A;  2XIW A;  1JE4 A;  3DWA A;  4NKL A;  3DXJ C;  4Q0F A;  3J7Y W;  2WP8 J;  3H91 A;  3NTI A;  2JA6 B;  3OSO A;  3I90 A;  5F2D A;  1EYA A;  1EEF D;  2B2U C;  1TS2 A;  5G3L D;  1I4Q A;  1SXT A;  5CV6 A;  2RVL A;  2QEJ C;  1I4X A;  4KV6 A;  1WTX A;  4QMG A;  1TS3 A;  3X3N A;  1WCM B;  4L63 B;  4LK1 C;  2F0W A;  2WKC A;  4BBS B;  3M7G A;  1FGB D;  2BCO A;  4RKB A;  3T56 B;  4WRD A;  2WIN B;  4A3F B;  1WTW A;  1JR0 D;  2KCN A;  3BVG A;  2DY7 A;  3HOU B;  1J9O A;  3D31 A;  1QG7 A;  1F77 A;  3P20 A;  1EQV A;  1ENC A;  1ENA A;  4G7H C;  2ZXP A;  2E76 C;  5J1Z A;  3TP6 A;  5CYU A;  4KKT A;  4KHV A;  3DUZ A;  1XX8 A;  2K28 A;  1UNS A;  2F03 A;  4ZLT F;  4HCS A;  5TSS A;  1WD1 A;  5DEH A;  1L0X B;  2IX0 A;  3GTO B;  2R3Z A;  2XSC A;  3KLS A;  1VF7 A;  1WTR A;  4PMC A;  2JEB I;  2CHB D;  1UAP A;  1TII D;  1Y1V B;  2A69 C;  1JB3 A;  5CV8 A;  4KY6 A;  1CTM A;  3SK8 A;  5CGK A;  2KUM A;  3TN2 A;  1EY0 A;  4L6T B;  2L11 A;  4IFD G;  2GA4 B;  2E75 C;  2A6E D;  2RQX A;  4PMB A;  5G3L F;  5EBC A;  1U4P A;  3A8I E;  2K7V A;  5CC4 A;  4OO1 G;  1S5B D;  1GHJ A;  3IFD A;  3IFT A;  5M5X B;  4A3I B;  3PUZ A;  1IHZ A;  4C3H B;  1K8M A;  4RHR A;  4ZYS A;  2IX3 A;  5C0X H;  3CQZ B;  4KN4 C;  1ZYR D;  4RHS A;  2JA8 B;  1ESR A;  2B8G A;  4RGO S;  3EVQ A;  1FNU A;  1PFM A;  3BG3 A;  5FK9 C;  3OIP A;  5KYI A;  4C3J G;  1OXS C;  3BS1 A;  1OO9 B;  2F0T A;  1JOK A;  5CMD A;  4F88 A;  2L4N A;  2A5H A;  5C4Z A;  1WD0 A;  1HTP A;  4UAI A;  1DOL A;  1K8O A;  5KNC A;  1G29 1;  5JVH 3;  1CZW A;  4F7X A;  5KGU A;  3K5L A;  1DZ1 A;  4ZRZ A;  2NVX B;  2KCC A;  2D62 A;  1JWS D;  1SDF A;  1E0B A;  5FKA C;  4X3K A;  1ZEQ X;  2IWH A;  1STA A;  3S1M B;  2L55 A;  4CKE A;  2AQ3 B;  1CZG A;  1S5F D;  1T5X D;  3T4A C;  3DM1 A;  4IN3 A;  2HUG A;  1PZJ D;  5JEA G;  3O13 A;  5C44 B;  3GV3 A;  1GXD C;  2EVB A;  1PFN A;  1UEA B;  1HUM A;  3I70 A;  4LAA A;  2EY6 A;  2NVQ B;  1F9R A;  3H3V C;  4EQN A;  3SK6 A;  1BBX C;  3IAY A;  2F3W A;  3PMF A;  1FNV A;  1CQF A;  2SNM A;  2ID0 A;  5FLX L;  1VCI A;  3SHL A;  2TMP A;  2XNA C;  2PZU A;  3LWE A;  1SYB A;  2Z4I A;  1O78 A;  5JJZ A;  4PQX A;  4KY7 A;  4XT3 B;  4B08 A;  1RJT A;  1YNN C;  4K5X A;  4Y7N B;  1DYQ A;  3V96 A;  1RTN A;  1VMP A;  5ELF A;  4DK0 A;  1K83 B;  3R2I A;  1F2Z A;  5M5W B;  2ICI A;  4R9W A;  3SR1 A;  1QNU A;  3EQL C;  2YU9 B;  1Q1B A;  2L5T A;  1JQY D;  1QE6 A;  1BCP B;  2RDH A;  2HCC A;  2XRS D;  5EKI A;  1GUS A;  1H9R A;  2JXM B;  1HUN A;  3L3O C;  1PFB A;  4KTA A;  5JEA J;  1Y8N B;  2VXW A;  2IX1 A;  5A2Q E;  5T1I A;  2K04 A;  4IAL A;  1AW7 A;  4H44 C;  4O42 A;  5BN4 A;  3WOE A;  1KDC A;  4KD4 A;  4IQZ A;  3W3A A;  1SMY C;  1HPC A;  1QWY A;  3E5S A;  1YNJ C;  2FMM A;  4OIJ A;  1PTO C;  3A56 A;  2PW7 A;  2EYJ A;  5D14 A;  2Z4H A;  3F2U A;  2EOT A;  3FKI B;  2JA7 B;  3HZX A;  1EY8 A;  3MTS A;  3C46 A;  1CK1 A;  3NPP A;  4ULL A;  2DNE A;  3I91 A;  1SNC A;  3VA5 A;  5D3D A;  2K03 A;  2F0Q A;  3PO2 B;  3GQB A;  1STY A;  2O2L D;  2D9U A;  2NN6 H;  1BCP C;  1H9J A;  1B44 D;  3A7L A;  1BOS A;  2ZXR A;  1OXV A;  1EZ6 A;  2ZXO A;  1EIH A;  1BF4 A;  3DEP A;  2F0H A;  3ONA B;  4C2M B;  4MN3 A;  1EU3 A;  2KJX A;  5IOC A;  3KLR A;  1STE A;  3TDQ A;  3M4Y A;  4A3D B;  3GTK B;  5C3X A;  3H94 A;  3M85 A;  5I9O A;  1CI3 M;  1H9S B;  5AFW A;  3NWS A;  3I73 A;  1I4P A;  3OOC A;  1LLR D;  1HRJ A;  3HKZ B;  4FP5 D;  2X69 A;  2JYO A;  4DFA A;  2XRQ D;  3C3L A;  1PRT C;  2EJF C;  4XYQ A;  1AZP A;  4B9X A;  3IKJ A;  5EJW A;  2KEC A;  2QF7 A;  3V05 A;  4U68 A;  2B2T A;  2PMZ B;  1H9S A;  1TY2 A;  1X3P A;  1CM9 A;  3TP8 A;  3OHX C;  4ABN A;  2EE1 A;  3CKI B;  2WII B;  4XQQ A;  3S1Q B;  5CV4 A;  2KVM A;  3RUZ A;  4C56 C;  1D6E C;  5E1F A;  3RLF A;  1Y8P B;  3K6O A;  2J0T D;  5K36 H;  5HGT A;  4A3E B;  3BVM A;  2MGS A;  2BE5 C;  1WTV A;  5C4J B;  3EFX D;  2B2T C;  3OPO A;  2SEB D;  5JVG 3;  4FYD A;  3W2D A;  2K32 A;  4IFD I;  4C3H G;  4A3J B;  1X3Q A;  4EGV A;  4J8Q A;  1V8Q A;  1LT4 D;  5IT9 E;  2PO4 A;  2O4X A;  3TZD A;  3IL8 A;  3LWU A;  3S16 B;  1C4Q A;  1CHQ D;  2YYZ A;  1A2T A;  1F9P A;  2KOL A;  3RZO B;  5DAU A;  5EBD A;  2D5D A;  3SK4 A;  2F0L A;  3OWF A;  1D5Z C;  1A2U A;  1WTQ A;  4XT1 B;  4KK7 A;  1TR5 A;  2R92 B;  3Q0A A;  3QWN A;  2I07 B;  5EPJ A;  3NK9 A;  5LHY 1;  2A68 D;  3NQT A;  2ENB A;  3S15 B;  3EA6 A;  2K33 A;  4FF2 A;  1E2Z A;  1LTT D;  1RHP A;  2XN9 C;  4RGN A;  5NUC A;  2ICE C;  5FO9 B;  1IW7 C;  3UI2 A;  1LT6 D;  4X3S A;  3VA7 A;  4EVO A;  1SNO A;  1TVX A;  3U9S A;  3HS0 C;  1S5C D;  1YNN D;  1SNQ A;  4KKS A;  3R93 A;  3NUC A;  4XTC S;  1LT5 D;  4CJ2 C;  3GTQ B;  3S1R B;  1SE2 A;  2I46 A;  3E6Z X;  1OXX K;  4NW2 A;  1ZXT A;  2BA0 A;  4K5W A;  5C0X G;  4XDX A;  3TP7 A;  1IYU A;  1HFN A;  2BOS A;  1R9T B;  1B1Z A;  1RF2 D;  4DAV A;  4BBR B;  3VR5 A;  4KHZ A;  4RA8 A;  3K0Y A;  4FF4 A;  2F0E A;  1SND A;  1Q1E A;  4RKL A;  3K58 A;  1SSO A;  2WKD A;  1V1P B;  3A55 A;  5T1G A;  5LL6 X;  4CJ1 B;  5I2Y A;  1HA5 A;  3R3O A;  5JPM C;  1TT2 A;  2EDG A;  3SEB A;  4JK1 C;  1SMY D;  3D8G A;  4HCE A;  3OMC A;  3MVV A;  3VYU A;  1S5E D;  1PTO D;  1ZKO A;  1CFM A;  1I4H A;  1JCK B;  4WFN 3;  4ZUI A;  3D6W A;  2RSN A;  3I4L A;  4DA2 A;  1RDP D;  3JAM L;  1XWE A;  3KBX A;  1V1P A;  1SYG A;  5ELD A;  1IL8 A;  2XWB B;  2OT2 A;  2A6H D;  3DHQ A;  4K6L A;  4S3S A;  2A74 C;  5A2Q L;  3FPU B;  3TME A;  1H9M A;  4BY7 B;  3CU7 A;  2QKI C;  3GD7 A;  1LTA D;  1AP0 A;  2F0F A;  3A7A B;  4F87 A;  2KED A;  3J81 E;  3FPP A;  4L8J A;  2RSO A;  3URY A;  4PV1 C;  1SYD A;  2JEA I;  4DK1 A;  4N9P A;  4FXD A;  4WOR A;  3MAQ A;  1G8Z D;  2LY7 A;  2RDF A;  3HOZ B;  3CHB D;  1WTO A;  2JE6 I;  2X6G A;  4KN7 C;  2HDL A;  1QB5 D;  4J1M A;  4C3I G;  3GTL B;  3S2D B;  1TKW B;  2L1B A;  4ZKC B;  1B50 A;  2IW3 A;  1F9Q A;  4OHJ A;  3BDL A;  2HQE A;  2EPB A;  2EYO A;  1OXT A;  3M4O B;  2VUM B;  1JOQ A;  1ENF A;  4RH6 A;  2AUK A;  2X6L A;  5IGE A;  2EY2 A;  1PTO F;  3I4M B;  3NHH A;  4IFD J;  2B2Y A;  1MBY A;  2K6A A;  2EJM A;  4DNT B;  1KDB A;  2FFK B;  1KNA A;  1EQT A;  4K6D A;  2G9D A;  2R7Z B;  2XVS A;  4E6I A;  1PXU A;  2D2C C;  5M9O A;  4TRD A;  1DJR D;  5KNB A;  1EY6 A;  2BE5 D;  3J80 L;  4DNR B;  1EWC A;  3I8Z A;  3Q23 A;  3E0J A;  3MXN A;  3N52 A;  2SOB A;  3RZD B;  1E2W A;  5DNF A;  4OO1 H;  2B2W A;  2NUC A;  2K01 A;  1TWG B;  1SE4 A;  1SJH D;  5EPL A;  5D65 A;  1EYD A;  2NN6 G;  3VYR A;  3AB9 A;  4RCO A;  4K2K A;  4CBV A;  5ELB A;  2F1M A;  1ICW A;  2QDB A;  2QIL A;  4Z9C B;  2Q8I B;  2ZT9 C;  1JC7 A;  3DMU A;  1I4R A;  3CRK C;  4BS9 A;  1SE3 A;  3HEJ A;  3QJY A;  5CBA E;  1PRT F;  1FR3 A;  5I6W A;  1A15 A;  4V19 0;  1R4Q B;  1CA5 A;  1A3U A;  4B9W A;  3NWT A;  2E2H B;  3M7N A;  1PDQ A;  4RAU C;  4TQU S;  3MWY W;  3SK5 A;  3C1F A;  4WJW A;  2Y0S B;  2RDG A;  2OXP A;  2JA5 B;  1HXY D;  1M8A A;  2NTT A;  2E2I B;  3SVM A;  1EU4 A;  4DU9 A;  5IT9 L;  5M5Y B;  1IW7 D;  2F0J A;  2V4D A;  3D4R A;  1SNP A;  4K5V A;  3VR3 A;  3PO3 B;  1XXG A;  4QIW B;  4BWG B;  1KAB A;  1QOH A;  3AU7 A;  2H4O A;  4DAY A;  3T51 B;  3SXH A;  2AWO A;  4KJO A;  1I3Q B;  5CV5 A;  2IL8 A;  2EJG C;  5M3F B;  1NR4 A;  2EYL A;  1SNM A;  1VF5 C;  2B2V A;  5BN3 A;  1EY5 A;  1KAA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...