5EJWA

Crystal structure of chromobox homolog 7 (cbx7) chromodomain with ms351
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
80
structure length
80
Chain Sequence
HHSSGLVPRGSHMELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEERDRASG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Guided Discovery of Selective Antagonists for the Chromodomain of Polycomb Repressive Protein CBX7.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/inhibitor
molecule keywords Chromobox protein homolog 7
total genus 21
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2015-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5ejwA00
2NYZD 1MI2A 3R93A 2J7ZA 4MN3A 4R9WA 2FHTA 5EPJA 1EIHA 3F2UA 1EL0A 2MP1A 1MSGA 3HP3A 1B53A 2MJ8A 1F9PA 2EPBA 1WTOA 2X6GA 4CJ1B 1XYIA 2HCCA 1ESRA 1PLFA 1ML0D 5T1GA 1HUNA 5AFWA 1QE6A 1VMPA 5COYA 3TN2A 2K28A 2B2TC 2D9UA 2B2WC 3ONAB 4X3KA 1AZQA 2R3ZA 1RODA 1TVXA 3N52A 4IUPA 1WTRA 4ZK9B 2N55A 2BDNA 5DNFA 5E4XA 2CVRA 4IUVA 2B2VA 2L11A 4OIKA 1BF4A 1O80A 2KECA 4U68A 1NR2A 4R8IA 2B2YA 3KUPA 5T1IA 1JICA 1DOKA 2K05A 2RA4A 3I90A 3IL8A 4XT1B 5CORA 1U4MA 1IKLA 5EQ0A 4HSVA 2HCIA 4OIJA 1Q3LA 1E0BA 4RWSC 4CJ0B 2L1BA 1U4RA 1HUMA 1HFGA 3KBXA 1CA5A 1AP0A 1U4PA 1G2TA 1HFNA 4HCSA 3DM1A 2FMMA 4MHEA 2HUGA 4UAIA 1VMCA 4CJ2C 5EPLA 3GV6A 4ZKBB 1HA6A 2X6LA 1PFNA 3MWYW 1PDQA 2HDLA 3DEOA 3GV3A 4QUFA 1M8AA 1WTQA 2H1EA 2K1BA 1WTXA 2KUMA 5JJZA 1JE4A 1QNKA 3UI2A 1BBXC 1X3PA 4ZKCB 1X3QA 1ZXTA 1RTOA 1AZPA 2FFKB 2X69A 1G91A 2RVLA 2N88A 1O7YA 2K04A 1RTNA 2KVMA 5D65A 1U4LA 2IL8A 2RSNA 3TZDA 1C8CA 1GUWA 1NR4A 4QUCA 1F2LA 5E4WC 1B3AA 2M2LA 3I91A 2Q8TA 1EOTA 2NZ1D 5CBEE 1EQTA 1A15A 2L12A 3QO2A 3FPUB 4IURA 1CM9A 1QG7A 1DONA 2FJ2A 5EPKA 1LV9A 1CA6A 2EE1A 2FINB 1PFMA 1F9SA 2B2WA 2KEEA 1WD0A 1XX8A 4HAEA 3I8ZA 4XT3B 3Q6SA 1SSOA 1IKMA 1RHPA 1KNEA 1ICWA 2B2UA 2SDFA 2EOTA 1J8IA 1HHVA 3D6WA 1WTWA 1NCVA 1SAPA 4IUUA 4XDXA 2XIWA 5CBAE 1PFBA 4NW2A 2VXWA 4ZAIA 1WTVA 5EJWA 4RA8A 2K03A 3MTSA 5EKIA 1X32A 2KOLA 1B2TA 2HDMA 1MSHA 1DZ1A 3SVMA 1DOLA 2KEDA 1IL8A 2NWGA 2RSOA 4HEDA 1F9RA 4DN4M 1B4OA 2L9HA 3P7JA 4RAUC 1WTPA 4X3TA 4X3SA 1B50A 2MPMA 3IFDA 1J9OA 2B2UC 2K01A 3DEPA 4ZLTF 2Q8RE 1O7ZA 2B2YC 1SDFA 1DOMA 5CMDA 1BNZA 1F9QA 3FDTA 1HRJA 4X3UA 1G2SA 1ILQA 1ILPA 1S4ZA 1RJTA 2JYOA 1WVLA 2B2VC 1WD1A 4LMQD 5D14A 3I3CA 4IUQA 1EIGA 2MGSA 1G6ZA 2DY7A 3LWEA 4O42A 2JP1A 3G7LA 1KNAA 1NAPA 1MGSA 1BO0A 2B2TA 3H91A 2L4NA 2DY8A 4IUTA
chains in the Genus database with same CATH superfamily
4QGUA 4HIDA 2WIIB 3T16A 1MI2A 4G7HC 1EIHA 3L2PA 1R9TH 3HOZG 2K5WA 4TRDA 5C5LA 1MJCA 4EVOA 2X6GA 1IBMQ 1Q82C 5T1GA 1HUNA 3PSIA 1HCZA 1VQNA 3ONAB 4QIWB 1GM5A 4JYAL 3R8BA 4IUVA 2Q8IB 5FJ8G 3HOWH 2UXCQ 5K5PA 1N33L 3PUZA 3T1YL 1I5FA 3D4DA 4KHZA 2F0KA 3J80E 4KD3A 4F8MA 1HFNA 1EWIA 1EQQA 1VQ9A 4LF9Q 1WI5A 1UEBA 3S16B 3CQZH 4NXNL 3GTJB 1HNWQ 5IGEA 4JW0A 1LYLA 4GLVB 4ZKCB 5DM63 2PW5A 4HJ9A 2L5TA 2F3VA 3A74A 3I72A 1TY0A 2M00A 3GQBA 2JK8A 1ET6A 2BDOA 2N78A 2PZUA 2NN6G 2JQOA 2NVTH 3AFQA 1IBKL 3FPUB 4K0KQ 1YIJA 3NXWA 2R7ZB 2AQ1B 4EGVA 4IPHA 3ULPA 1X55A 4DAYB 3RZOH 4C3HG 1GUTA 2WFWA 3PUYA 3J80i 3KYHC 3A56A 2WKCA 1EYCA 4BBSH 1PRTC 3NTKA 4AYBG 5NUCA 1ICWA 5F2DA 4A3MH 5FLXE 1QB5D 4P71A 1KAWA 2E8GA 4C1NK 4OWTB 5M5YH 1Y1VH 4IOAA 3M7GA 1A63A 4DV0Q 3SVMA 3CW2C 3CHBD 4V190 4ZCKA 1PFSA 4R1JA 3A55A 2K4KA 1FNUA 1EY7A 1Y1VB 3VR3A 1VQMA 1YJ9A 1HR0L 1DOMA 1Z7TA 4NXMQ 1G2SA 3QWNA 2Z9HA 1JJGA 1H9SA 1JC7A 3PO3B 3TDQA 3D31A 2R93B 3ITPA 4A3IG 4C3IG 2B63H 1AZPA 1PTOB 2PI2E 2CCZA 5KYIA 2K5DA 3K0YA 2ATWA 3TS0A 2F0GA 1FNWA 2ICIA 2K5QA 3K5LA 2ZT9C 1PYSB 1B53A 3FP9A 4IPDA 4RHSA 5IP7H 4O0AA 1ESRA 3J7AF 3NQTA 3I56A 3K7AH 3KLRA 3AFPA 1BCPB 4KKUA 1JWMD 5KGUA 2IX1A 4N9TA 1TVXA 4O2DA 3G71A 1BCPC 4ZUJA 5C4XB 5A35A 3FPPA 3KOJA 1J5EL 1CQVA 2DJGC 1KTKA 3STBC 4HN7A 4G4KA 3UDIA 1I4PA 1E2WA 4KLKA 1UWVA 3A8KE 1ENAA 5CV7A 1S5BD 1VMCA 2E5LL 1SBBB 1PFNA 2I46A 3S2HB 3AU7A 1SYEA 2K1BA 2VUMH 2CWAA 2NVXH 1SNCA 1R9TB 3DWQA 3HKSA 4JI6L 3HOVH 4IZ8A 4K5VA 2LMCB 2PQAA 3CC2A 2A69D 4ULLA 3KFUA 1EOTA 4CDEC 1RF2D 1A62A 1D8LA 5J39A 1K0SA 2EE1A 2VQFQ 1WD0A 4YHHL 4BA2I 2JA6G 1SNQA 1I6VC 2ICEC 3VYRA 2OF1A 4PV1C 4IFDG 4P73A 1LTBD 5I2YA 1LTLA 4A3BB 3T51B 1IXRA 5EJWA 3CMAA 5FLXc 3KF6A 3S1NB 3HOZH 2IX0A 3URYA 1MSHA 1DZ1A 3U4ZA 4U673 1VDZA 4TQUS 2RHQB 1AH9A 1PH4A 1RDPD 2RSOA 4DV2L 5M3MG 5FO7B 4LAAA 4ZLTF 3I4MH 1VCIA 3J7A5 4JBJA 5M5XB 1I4GA 1WVLA 4YCUA 2B29A 1Q81C 3DUZA 4A3DB 1KLGD 2NYZD 1STYA 3H09A 3HOUB 4DR7L 1FYCA 4MN3A 5FK9C 3U9OA 1HZ9A 3VDYA 1M90C 4GKJQ 4A3KB 4GN5A 1XPRA 5ELCA 5FO8B 2Y0SG 5IGCA 3E9IA 2LKVA 4BY7G 1K3RA 4A3EH 4JV5L 4B3TL 1HH2P 2ZTEA 4H13C 3S1MH 4X6AH 3HS0C 2OEOA 1WTRA 3QB3A 4DNRB 1EEFD 2YYZA 4FNFA 2MQHA 2RCFA 4R8IA 4K5WA 1IBKQ 1BDOA 3SEBA 4A76A 1K8MA 4Y52H 2Z4IA 4NDXA 2AUJD 4B3RQ 4CJ0B 2RQXA 2GA4B 2XVSA 1AE2A 4A3GH 1G2TA 4LF7L 2D62A 4HCEA 4B08A 1XPUA 2JEBI 2KBNA 3PF4A 1EFWA 4QJFA 2HDLA 3DEOA 3PIOA 4YWLA 3KLSA 1QNKA 2HIVA 4A3DG 2YU9B 5IP9H 1IW7C 5EAYA 4C2MB 1KD1C 3NUCA 4NXML 1C7YA 1GUSA 3K8AA 5FKAC 1HQMC 3O13A 5M9OA 1EUJA 1NR4A 4TVAB 3SK5A 2R92H 2QEJC 2HQLA 1A2TA 1EYAA 2NBFA 2JA5G 4XXEA 1STBA 4DV0L 3JAML 1SE8A 1KRTA 4JI5Q 4HAEA 3GTJH 2GVBA 2V4DA 2SDFA 2VZAA 2KQ3A 1J8IA 1WTWA 3NWSA 1A2UA 2MNAA 2AUKA 4XDXA 4RCOA 1Q8IA 4A3KH 4J15A 2A6EC 1E1OA 1G6PA 1S5ED 2EY1A 4L5TA 4JC0A 5E1FA 4DK0A 5G3LF 2F4VL 3UDGA 4CDCC 4OX9L 3S1QH 4BWGB 3FDTA 1VQGA 4X62Q 2F0VA 3Q0AA 3D6CA 4J6HA 3MVVA 3CP0A 3BDCA 3VR2A 3KJOA 1CT1D 4JI2Q 1DM0B 5D3DA 3CCSA 3FVQA 4QB4A 1K8AC 4M1UB 5L37A 4RMFA 2WB1E 1CKOA 3TP8A 5JVG3 1AE3A 1D6EC 1EQVA 1VQIA 2EY5A 2ZJPA 3BDLA 4EQ5A 4GNXC 2UUCQ 3A5UA 4GKKQ 1PTOH 3DM3A 1IYVA 4OELB 4RGNA 3T1HQ 1N8RC 1MSGA 1AN8A 4QF4A 1F9PA 2PQEA 2WINB 1VMPA 2K28A 2MHVA 3LX0A 1WTHA 1A3UA 5JEAH 1L1OB 4DXGA 3OIQA 1YNND 1JICA 2C35B 3NBHB 3P1HA 5I4DA 3RNUA 2UXBQ 4OIJA 3Q23A 1ASZA 4XQQA 3GTPH 3BS1A 5HURA 1VQ4A 3V2TA 1TWFH 4PMWA 3RR5A 2E76C 3BU2A 3S15B 3SXHA 5M5XH 4JI8Q 1IBLL 2R7FA 2RBMA 2KCTA 4F7XA 3HOWG 1Y1WG 3MXUA 2X69A 3I73A 4FF2A 1O7YA 3BVMA 4I65A 1SN8A 2F0QA 3N6RA 4RKBA 4HJAA 2F4VQ 4K8IA 1EOVA 1H9KA 2XGTA 1IYUA 2EYLA 1I4HA 1IZ6A 1TWAH 1TWCH 1SLJA 3QO2A 1EY5A 2AWOA 4DR2L 4IOCA 2IW3A 3QG1A 3VA7A 3RLNA 2F0WA 2B3GA 2EYPA 5IYCG 2B2UA 5JJLA 1NCVA 1V1PA 3R3OA 5FOBB 3ICEA 1K9MC 5H1SE 2JSOA 1Q46A 4EQOA 1JORA 4BBRB 3EFXD 5I6WA 3S1NH 1DCZA 4KK7A 1WTPA 3UE0A 2MPMA 3IFDA 3MEHA 4KTAA 1VQPA 1JWSD 1HXYD 4OO1G 2R93G 4H0LC 3TP5A 3U4VA 1ONLA 3D8GA 3UE1A 5JEAJ 1VQFA 3IAYA 2IT1A 3VR5A 3UDFA 1YZ6A 2MGSA 4EQPA 4A75A 1OXUA 3NWTA 2HT1A 5C3EG 5C0XG 4DPGA 1ZYRD 2RDFA 3HGBA 2DNCA 2LY7A 4DAYA 5KNDA 4DAMA 4OHJA 4C2MH 1X56A 4KJOA 3J81j 3MFYA 4AQYQ 3HP3A 1PTOD 1WTOA 1X3FA 1STAA 5J1ZA 3GTGB 4QCLA 3GTKH 5AFWA 1VQLA 2QF7A 1EU3A 2F0JA 1AZQA 4ME5A 2R3ZA 4A3JH 2V1CC 1LTRD 4C3HB 1C0AA 1EU4A 1I6HB 4PZ8A 1SNMA 1Y14B 1NTGA 5EQ0A 3ERQA 4XT1B 5CORA 1AP0A 4GKJL 1X54A 1IL2A 1EY8A 2ZTCA 4DNIA 2XN9C 4HMJA 4LF4Q 3UDXA 1JJ2A 4R4IA 1FJGL 4DR1Q 1ENCA 4BY1G 5C44B 3L3OC 2J0TD 2R61A 3MWYW 2XWJB 1IHZA 4LFAQ 4DV7Q 2QEXA 3CCUA 2NVQH 2KHSA 5CYUA 4DV6L 4DF7A 4X62L 4DK6C 3RN5A 4MIUA 4I7AA 4JBWA 2F0FA 2QDBA 2Q2UA 4OONA 1I50H 2FMCA 4JK1C 2TMPA 1FR3A 3C1EA 3HG9A 2KEEA 3OW7A 3WDNA 5C6AA 5IT9E 3S17B 1OXSC 3MHBA 3D4WA 1A8VA 4DUYL 1NY4A 4FO2A 1SAPA 2VQFL 1VQ6A 4YY3L 3GTPB 1PFBA 4NW2A 1S5CD 1X32A 5C0XI 1O78A 1AEXA 1HA5A 3ZYYX 1Q1BA 1HNXQ 1LLRD 1X9NA 4RAUC 4DV7L 4X3TA 2E2IH 4L5QA 4PMCA 1VF7A 4XQNA 5JJKA 1LT5D 2AQ3B 4FDBA 3DXJC 4TSSA 2K14A 3K80C 4OO1I 2I5HA 4LFBL 1WJJA 1BR9A 1SMYD 3CXCA 1S3OA 3FKIB 4LF5Q 3CQZB 5KEEA 3KDFB 4IUQA 4MZ9A 4OWXB 2O5JC 3LWEA 3Q24A 1UNSA 1KNAA 2KHJA 3J7AV 5IGFA 4PNYA 4RH6A 2IX3A 3KJPA 3GP7A 5CV9A 2UXCL 4DAPA 3TZUA 3T13A 2F0OA 2OCEA 4UP8A 5C5MA 1B9MA 4JI1Q 3E6ZX 4B3RL 2EYHA 2ZJRA 5C4XG 1ASYA 4CJ1B 2K33A 1K8OA 1IYJB 2PNHA 3CU7A 2QILA 1LT4D 1NBWA 3BDOA 2AWNA 3A54A 4K14A 3OW2A 5KNBA 1JOKA 1XTDA 3BYYB 1E7ZA 3CRLC 4YWMA 4C1NI 3I4NB 1TIID 3R2TA 2IPKD 3SK4A 5IYBH 1HUMA 5I2XA 1VQOA 1FGBD 4KKTA 1UE6A 3DM1A 2FMMA 1VQ7A 2LS01 2HUGA 2UXDQ 3HOXB 4GNXA 1QCBD 4J1MA 3GTOH 3UI2A 4FF1A 4DR6Q 4XTCS 2O2LD 4KHPQ 3Q22A 1K3BC 4A3GB 4WFN3 4CKEA 4AQYL 3PO2B 1LT3D 2IL8A 3OYYA 1B3AA 2NVYB 2EJFC 3PUVA 3PO3H 4CDDC 1TY2A 1KABA 3NQIA 1BBWA 3T1YQ 1QG7A 5BR8L 1A3VA 1W6KA 1TS3A 4JI7Q 2GN5A 1LTSD 1YNJD 3OMGA 3I8ZA 5CC4A 2OTJA 2CQAA 2F1MA 3A0JA 2AKWB 1B70B 3TSSA 3E0EA 3K81C 2UUCL 4GKKL 2NTSA 2A74C 1K8GA 3W1BA 5DAUA 1IL8A 2RCNA 3VA5A 1S5FD 1SYCA 3L0OA 3CCRA 4NMZA 2K01A 1VQJA 3DEPA 1I94Q 2B2YC 5IWAQ 2F0MA 4X3UA 2EJGC 3HOUG 1ILPA 1S4ZA 4FF3A 2ZM6L 2B2VC 1I3QH 4XYQA 5GADC 5C44H 2F0EA 1RKNA 3CMEA 1H9MA 2JP1A 3F1ZA 2B2TA 3H91A 3RN2A 1QJOA 1JOOA 1GUGA 2LFNA 1EQRA 1LM0A 2JN4A 1G291 2UXBL 3QR8A 1OTCA 2L55A 2Q2TA 2CKZB 1YEZA 5EBDA 1XYIA 2PMZB 1LT6D 1DD2A 3H0GG 2RF4A 2B2WC 4ZRZA 3A8JE 5FLMG 4DV3Q 4DUZQ 4LK1C 4RGOS 2R92B 4I7ZC 1I94L 3OPOA 4R4QA 4WRDA 4BBRG 1U4RA 1GUNA 1HFGA 1SE3A 1XMQL 1BQQT 1GXDC 3S9WA 4HTHA 1RD9D 5I9PA 3PV0A 2IWHA 1PH8A 3I2ZA 1M8AA 1XNRL 1KDAA 4P72A 5KIXA 4AH6A 1KAAA 3S24A 3OWEB 2N8NA 2DUDA 3D3RA 2RDGA 2N88A 4JI1L 5ELDA 4A3CH 4A3LG 4FXKC 4JVZA 1B9NA 4DV4L 2M2LA 1TS4A 3RZDH 3LNNA 3K0XA 1HZBA 1VQBA 4A3DH 2NVTB 2FINB 2EY6A 1SFOH 1CHQD 1RHPA 1C9OA 4UY8C 1XNQQ 1TWAB 5K36G 2G9HD 2F0TA 2I07B 2XRQD 2K52A 3VYSA 1C4QA 1TWHB 3HOYB 5D3IB 1E2ZA 4ME3A 4X64Q 1N32Q 5IP7G 4APVA 1DGSA 1UAPA 2WB1B 4P74A 2K7VA 4X3SA 3IKJA 2DN8A 5C4ZA 1UEAB 1XNQL 3MAQA 3PIO3 4K6LA 1QZHA 2SOBA 1QUQB 4GOPB 4FF4A 3A5ZB 1N34L 1PYBA 1CSQA 3JAMi 3S15H 1T5EA 1Q86C 1G6ZA 5E3FA 1MGSA 2L4NA 4JOIA 2UU9L 2F0NA 3R93A 2NB0A 1T5XD 1Q90A 2P5ZX 4X66Q 2YU9H 4B3SL 1V8QA 3MC0B 1LACA 3CCQA 4L63B 4LFCQ 1Y1VG 4ILWA 1HQRD 4LUZA 1L2FA 2VUMG 1GUOA 4UHVA 1L1OC 5IYDH 4JOIC 4IUPA 5LMNL 1EIFA 1FL0A 2N55A 2PZWA 4HJ5A 2NTTA 2B2VA 2LXKA 4A3FG 1M1KC 4DR7Q 5T1IA 5KRUA 3NP8A 1J6QA 3H3VI 3NTIA 1WCMH 1CQFA 4RWSC 4DV5Q 1A3TA 3I4NH 1D5XC 3JC66 2UUBQ 3PF5A 2NZHA 5JAVA 2F0IA 4DV3L 4GLAC 4JI0L 5A2QL 3PGZA 3GV3A 1EWCA 1WTQA 1OXXK 1BBXC 1X3PA 1YITA 1WOCA 3SK6A 1K0RA 4UDUC 3E9HA 2VB2X 3STBD 2KVMA 1TWCB 4LF4L 4R4TA 2ALYB 5ELOA 1C8CA 5LMUQ 1CSPA 3I91A 3EROA 2O4XA 2E2HB 1VQAA 1KHIA 2CFMA 2E2DC 1MBYA 4IN3A 4LFAL 5GROA 2K5HA 2EXZA 4IALA 2EZVA 3CAMA 4LNQA 1HNZL 4DR1L 4Q5VA 2PW7A 1KNEA 5C44G 2KHIA 4JI0Q 2EOTA 1HHVA 3ZJYC 5IWAL 1LTAD 4IUUA 5J3BA 2CQOA 2IHFA 3KK7A 4FYDA 1NNXA 2NN6I 4RA8A 1B2TA 2JA6B 1H9JA 2HDMA 4C56C 2NVYH 4BY7H 1DOLA 4FP5D 4X65L 3W3AA 2NWGA 2LSSA 4DN4M 1STGA 4LUVA 2B39A 1BBUA 3CCVA 5JJIA 2B2UC 3IRBA 2ZJQA 4L8JA 5CMDA 2I0QA 1AFPA 1HRJA 2G9DA 1EWHA 1KIXA 4HIMA 3X3NA 4KMUC 3SE0A 4H44C 3T56B 1Q7YC 3BG3A 4A3GG 3PIPA 4GNXB 2TSSA 2AHOB 1TS2A 1D2BA 2E2JH 4BY1B 4L6TB 1QVFA 1E24A 1ZKOA 2JA7G 3JAMc 5CGKA 1QZGA 2OXPA 4CGYB 3KF8A 1E22A 1STEA 3N52A 1RL2A 1BVSA 1KRSA 1PZKD 2A6HC 2Z6KA 4MTKA 5E4XA 1BF4A 2IHEA 2Y0SE 1GJXA 2EYMA 5IODA 2D5DA 3S14B 3I90A 4OL7A 4HIKA 1Y8PB 1XMOL 1Q3LA 2AQ2B 4QL5A 2GVAA 3KBXA 3E0JA 3LWUA 1GO3E 2NZOA 2Y0SB 4IUNA 1HNZQ 2XNAC 2F3WA 3GV6A 2X6LA 4B9WA 5G3LD 3OSOA 1Z9FA 4K6DA 4R8NA 4QUFA 4A3KG 4OWWB 4DR2Q 4NB3A 1JE4A 3QJYA 1VF5C 1EYGA 1G91A 1B1ZA 4IFDI 3A7AB 2DNEA 1WYDA 4JI4L 1UE5A 2K5NA 1YBYA 1TR5A 1X6OA 4N9PA 4QUCA 5M5WH 3PIP3 5E4WC 5CBEE 2JA7B 1C48A 3PUXA 3MZ5A 4DR5L 2B8GA 1CM9A 3OIPA 5EGTA 4AYBE 1DONA 5EPKA 1S40A 1LV9A 3DWAA 1BUVT 3QOJA 3J80c 4QQBX 1IBLQ 2Q2HA 4HMIA 4N8X1 3SGIA 4G7OC 3ULLA 5I9OA 2YTXA 2YTYA 2ES2A 4BXXG 3CC4A 4GOPC 2NN6H 5ELNA 3TRZA 2B8FA 5LL6X 1SRUA 4JI8L 3PO2H 3A7LA 4K2KA 2R7ZH 2JA8G 4HR7B 2BE5D 1HR0W 2NUCA 4K0KL 4A3IH 4C3IH 2B63G 1LTID 4UP9A 1V1QA 5BN4A 2L9HA 3L9AX 1EY0A 3ULJA 1NE3A 2QKIC 1O7ZA 4KV6A 2A6HD 1JB3A 4YWKA 4P75A 2A1AA 4R4OA 2OTLA 4JI5L 3MXPA 5CV4A 3S1QB 1YJNA 4RCNA 3CF5A 3G7LA 4RGMA 4XIGS 2Z6BA 3LGJA 5FJ8H 2K75A 3OOCA 3CCLA 2J7ZA 3EQLC 2CHBD 2A68D 2KJXA 3ERSX 2WAQG 2CWPA 3GO5A 4ZUIA 2NVXB 2MP1A 3CD6A 2LXJA 1I3QB 1PVOA 1O7IA 3WOEA 4XYOA 1ML0D 3QOLA 1TT2A 2QW7A 5IGGA 1Q8KA 4CBVA 3NTHA 4ZK9B 3F8TA 1JR0D 3EVQA 4U68A 3K5NA 1TU2B 3B6YA 4NPSA 1DOKA 4FVMA 3U58A 3VYUA 4HSVA 4GZYC 1FD7D 4BA1I 1HTPA 1WCMB 5IGBA 3PUWA 1T9HA 1JCKB 1TQOA 4A3FB 4A3EG 3NELA 5GQOA 3HOZB 5CV8A 2OQKA 1R4QB 4HSPA 4HIOA 2BH8A 3HOWB 1EYDA 1Y1WB 1SMYC 2UUAQ 1GVPA 1L0WA 4GN3B 2A19A 3PQIA 1D7QA 2FFKB 4Y7NH 2ASBA 4DR4L 4IPGA 2XRSD 4CKBA 4JG2A 4F87A 3OMCA 1YNXA 2A68C 4HJ7A 2D0PA 4A93G 3SR1A 4LF6L 3R2IA 1ZEQX 5IGDA 3GTQB 4Y7NB 3NE5B 2R7DA 5M3FB 5JVH3 1FGUA 3CCEA 4C3JB 3HOVG 3ER0A 3CRKC 4DAVA 3VR4A 5LHY1 1CHPD 3EBEA 4TKOB 3I4MG 5C3EH 2VB3X 2XIWA 3KBGA 4LWCA 2PCFB 2PO4A 3S1MB 5KNCA 3S16H 3VYTA 2EYFA 3MEFA 1RIPA 3J81E 1YHBA 2KEDA 2JA6H 2VUMB 3OWFA 2Q8RE 3DHQA 1F9QA 2VY3A 3P75A 1B3QA 2Z4HA 3CCMA 2E74C 1LTGD 1CZWA 1WD1A 1W2BA 1NJIC 2HD3A 5IYCH 4YIJA 1N36L 2F3IA 5AJ3Q 1FNVA 3H6MA 3I7FA 4BY1H 2EPBA 4BS9A 2M9VA 5IIFA 1PLFA 5GAEC 2B2TC 2EQSA 2VL6A 3P20A 4DFAA 3X3MA 1RODA 2R93H 3M4PA 3RLOA 3CCJA 1XNRQ 3GTKB 2L15A 4LF8L 2XTIA 2R6GA 3KUPA 4DR5Q 2QDLA 4A3IB 1CTMA 2WV6D 5HY6A 2BA0A 4JI4Q 4C3HH 3H0GH 1SNOA 2L1BA 4B3ML 2H5XA 4HJ8A 5HGTA 4OGQC 5ISRA 2EXDA 1K73C 3CKIB 5FLMH 2Z8LA 4A3MG 1PXUA 3TS2A 1XXGA 1PDQA 3HFZB 4IPCA 3QIAA 5ELFA 3HRZC 4RHRA 4A3MB 1X3QA 1ZXTA 4G7ZC 3CPFA 4L5RC 2K6AA 4LUOA 1V1PB 2JXMB 5M5YB 1PH6A 1BKBA 1EZ8A 1U4LA 1L0YB 4RGTA 4EQNA 4A3JG 4JI7L 5BN3A 4IJHA 3I70A 4PZ6A 1EQTA 1SNDA 1Y69U 4IURA 3RD4A 2YV5A 2MUYA 1EY6A 4K8JA 3TBIB 4KKSA 1YI2A 4DV6Q 1TS5A 3Q6SA 1XWEA 2WKDA 4A3CG 1GOZA 1HR0Q 1I4XA 1LO5D 2C9OA 2NVQB 3WWVA 1CKMA 4V0BA 3DWPA 1AW7A 2RDHA 1ZYRC 1MJEA 2E2HH 1G8ZD 2PI2A 4DKAC 3GTMH 3DMUA 2DGYA 3P7JA 3M85A 2PPBC 1YVCA 2XSCA 1K83B 2WB1G 2KCCA 3K6OA 3NENA 2DJFC 3BZDB 4NKLA 4PQXA 3NSWA 1YNJC 5C4JH 3J81i 5D14A 2E2IB 5JPNC 3TP7A 4KN7C 1L1OA 1P8LA 1HZCA 1QOHA 4BBSG 5M3FH 4X65Q 4AYBB 4WJ3M 1S5DD 1RCVD 1UE1A 5JEAG 3NBHA 3W5OA 1I6HH 1MKHA 1EIYB 1PH3A 2F52A 2QA4A 5C3EB 4KY5A 3OTOQ 1VQHA 2MJ8A 3AB9A 4OXPA 2HCCA 3KF6B 3BJUA 3G4SA 2F0HA 1B8AA 2L11A 5AJ3L 1O80A 1U9RA 4DK3C 4DA2A 4P2CB 3S2DH 4ZQ3A 1KQSA 3S17H 4DGZA 4CHTB 3U50C 4YCVA 1E0BA 3FHWA 1M4VA 1JOQA 2OT2A 2ZTDA 1B7YB 3BVZA 4R4CA 3AMUA 1SJED 1VS0A 3FRPB 2CW0C 5KYLA 2ZXOA 1PH7A 3FEWX 2H4OA 1QVGA 4QIWE 2D2CC 4YY3Q 2KCNA 2G5DA 4B3TQ 2OWOA 2FXQA 1JT8A 1RTOA 3TEHB 3FMCA 3OHXC 1YHQA 4A3EB 1SNPA 4KHVA 3HOYH 2K50A 1V1OA 2EVBA 5M3MH 4M8AA 3M4YA 3HKZE 1YNNC 4DR3L 3AYHB 1XPOA 5BN5A 2UU9Q 1EFID 3NK9A 3RMHA 1TKWB 4A3BH 4XQJA 4LF8Q 2JEAI 3FKIG 1IKMA 1XMQQ 4IQZA 1W6JA 3GTGH 2VW9A 2F0SA 5E7NA 4X66L 3F2DA 2K03A 3MTSA 1GD7A 3TQYA 4OEMB 3KLSX 1B50A 4ODGA 4DR3Q 2BE5C 2F03A 1R4PB 2K32A 4KN4C 5LMNQ 5DEHA 1ILQA 2ENBA 1RJTA 1SROA 2JYOA 2HIXA 1EIGA 3DLLA 2DY7A 1CI3M 1X3EA 4IFDH 4LFCL 4F88A 4B3MQ 1D1KA 4BBRH 2Z6KC 3GTQH 2EY2A 4OO1H 1PTOC 2UUBL 2F0UA 3S1RH 2PZTA 3F2BA 4S3SA 2WAQE 5C3XA 3GD7A 2RKSA 3GTOB 1EL0A 4CDFC 5JPMC 1PZID 4DV5L 4PMBA 3PMFA 2WP8J 4JI2L 2KA7A 1N34Q 4RKLA 2I5LX 1DJRD 1W3SA 3TP6A 2R92G 4NXNQ 1HNWL 1ET9A 5GAGC 3HOXH 2RA4A 4ZYSA 1EEID 2HHHL 4DNTB 1S72A 1HPCA 4ID6A 2EIFA 1CA5A 1J5EQ 4ALPA 1OO9B 3K5OA 4MHEA 4UAIA 2B63B 4ZKBB 1LABA 1OXVA 1E1TA 1CKNA 1Z6HA 5I6YA 5DM73 1SE2A 4JBMA 1U0LA 1LUZA 3PCOB 3T1HL 3BYTB 1OXTA 1XTCD 1PH2A 1TWFB 3ND8A 1JB7A 1PYWD 1D1IA 1QILA 3NEMA 4KD4A 1A15A 4GLXA 3H3VH 1SMXA 4WORA 3C2PA 3M3YH 1PRTD 3CC7A 2ZM6Q 2EJMA 1X3GA 3IFTA 5EKKA 1GHKA 1NUCA 5M3FG 3GTLH 3WOFA 5EBCA 4ZAIA 4K5XA 4NP5A 1WTVA 3SK8A 2A5HA 5FO9B 4LF6Q 3G48A 1QWYA 4G57A 5IP9G 3JAME 2BOSA 1BXTA 4DXFA 2JA8B 1B4OA 3MXNB 1GUWA 1SJHD 1VQCA 1SDFA 3T53B 2PQAB 2JA5H 5IT9L 3J80L 2AMCB 3V96A 2VNUD 1U5KA 4LMQD 2UXDL 2VS1A 3GTMB 1BO0A 1WCMG 2Z1CA 1G51A 1BNZA 3GDEA 1N9WA 5K36H 3K57A 1PV4A 3W1GA 3BVGA 4DV1L 3F2UA 1CK1A 3KLWA 2Q2IA 2JA9A 3TMEA 4EX5A 4LFBQ 4KJNA 5IOCA 1Y1WH 1KLUD 3Q8DA 5IYBG 2K5VA 4Z9CB 5JOBA 2IY5B 1E3PA 5CR3A 1GHJA 1F2YA 3HZXA 3KDFA 4KY7A 4H02A 5DNFA 4LF9L 3HOYG 2CW0D 1YJWA 5A2QE 2A69C 1NR2A 4MNOA 3RZDB 4DV2Q 2K05A 5HGQA 4AIMA 5C4XH 1PH5A 3NPPA 1JE5A 2KCMA 2VQEQ 1JQYD 1HA6A 5EPLA 4JCVE 3NHHA 5J22A 3T4AC 3PO3G 4YCWA 4A3JB 1SFOB 2C5CA 4JV5Q 1NMGA 2F0DA 4Q0FA 1PMRA 4JBKA 2PMZE 2EYOA 2F4IA 2K04A 2PYKA 1VQKA 1RTNA 5D65A 4IFDJ 2RSNA 3K5MA 4LW1A 1Y8NB 2NZ1D 5DLQE 2HHHQ 1TWGH 5C0XJ 5C3WA 4WJ4A 4DK1A 2FJ2A 4C3JH 1F9SA 3H15A 4KHPL 4GN4B 1XX8A 3EN2A 1I4RA 2ZXRA 1IW7D 1TWGB 4BBSB 3H3VC 4A93H 1KL9A 1VQ8A 4A3LH 3MXGA 1MIUA 3E3XA 2KOLA 3E5SA 1UE7A 2N3SA 3D4RA 5BR8Q 4B9XA 1H95A 4UP7A 1H9RA 1HJPA 1SYBA 5IT9c 3S2HH 1J9OA 5EKLA 4JI3Q 1A0IA 1CFMA 1NMFA 3K58A 4LJZC 1K83H 4A4IA 4YHHQ 5TSSA 4RFBA 4A3FH 1KC8C 2JJQA 2UUAL 1A6XA 3U9SA 4GS3A 5JJZA 3RLFA 1CKNB 4R9WA 2FHTA 5EPJA 1BCPD 5LL6S 2HQEA 3TREA 4L5SA 4C3IB 3BZKA 1PTOF 1QNUA 4LF5L 3CPWA 5COYA 1BOSA 1EZ6A 2MFIA 1KDBA 2D9UA 5IY0A 3I55A 3G6JB 1P16A 4X3KA 5CV6A 2E5LQ 3M7NA 1CUKA 1LTTD 2BDNA 1MD2D 2RHSB 2CVRA 4JPBW 1SXTA 3MXNA 4OIKA 4POGA 4CKCA 2B2YA 4DV4Q 2D0OA 1U4MA 1IKLA 1Z47A 3OTOL 5C0XH 4JI3L 3HKZB 3AQQA 2A8VA 2E2JB 1E2VA 1I50B 1UUPA 1DYQA 2A6ED 2WACA 1X65A 1U4PA 2CH4W 5GAHC 1SE4A 2L0CA 4J8QA 4DUYQ 3C46A 5C4HA 4ABNA 1V9PA 1I4QA 2KUMA 1F77A 1STNA 2A73B 3I4OA 3EA6A 1K28A 2BCOA 4BY7B 2RVLA 3A8IE 2R7ZG 1JWUD 3L7ZC 1XJVA 3TZDA 3J7YW 1DXMA 1QUQA 4GOPA 3HKZG 4DUZL 2Q8TA 1PH9A 1VQEA 3C1FA 2F0LA 4PG3A 1WFQA 1TWHH 1PRTF 1CA6A 5M5WB 1PA6A 1SEBD 4XT3B 3M3YB 1CZGA 1KDCA 4FXDA 4K2LA 4JI6Q 3G6EA 1KXLA 2XWBB 5CBAE 3H94A 1F2ZA 5M3MB 4KI0A 1ESFA 4H7BA 2Z0SA 1SR3A 2N49A 3KF8B 4FXGC 2VQEL 5ELBA 2EYJA 4HEDA 4A3BG 1GKHA 3FKIH 3VR6A 2MO0A 2E75C 4JYAQ 2O5IC 2SNSA 3S14H 1V43A 4MTNA 3MFGA 1IBML 1Q12A 3I3CA 3RUZA 2CH4A 4O42A 5CV5A 4DV1Q 4IO9A 5IYDG 2ZXPA 1STHA 2QCPX 4IUTA 4DU9A 1Y8OB 2BH2A 3H0GB 1FJGQ 2SNMA 4QY7A 1XMOQ 1EY4A 1D5MC 1NSNS 3J81c 1BCPF 2EDGA 1QE6A 3I4NG 3TN2A 3J7ZC 5IE8A 3RZOB 3GTLB 1F2MA 1SYFA 2J4XA 3S1RB 2I5MX 1FVIA 1SYDA 4QMGA 2KECA 1QVCA 1ICFB 3IL8A 4B3SQ 5LMNW 2HCIA 3MA2B 3SHLA 3V05A 3NBIA 3SDZA 4C3JG 3HOVB 3W2DA 3K59A 1N36Q 2JA7H 4HCSA 4DR6L 4CJ2C 3M9BA 2H1EA 2ID0A 1WTXA 3D0FA 4UPAA 3HOXG 4O1NA 1PHJA 2PNRC 4WJWA 3C3LA 3M4QA 2WAQB 1N32L 2YTVA 2BA1A 2JE6I 1F2LA 2IJ0A 3F2CA 1D5ZC 5C4JB 1YHAA 1Q1EA 2L12A 3HOUH 4E6IA 2KENA 1PFMA 1JJCB 2B2WA 3J81L 1JMCA 1VQDA 3I4MB 1MHWC 3BZCA 1SSOA 3ND9A 3AEVA 4LF7Q 3K7AB 1O7LA 1EY9A 1B44D 1PRTB 3D6WA 1H9SB 1L0XB 1HZAA 2VXWA 1TXYA 2F0PA 4OX9Q 2SEBD 5EKIA 4POFA 4DR4Q 5FLXL 1HTLD 3EJIA 4PZ7A 4N8FA 1II3A 1SYGA 1VQ5A 1ENFA 1F9RA 3HEJA 2MO1A 5LMUL 4IJLA 3M4OH 2QGQA 4A93B 2JA5B 4KY6A 3K7UC 5ELEA 1N33Q 4BXXH 2OQ0A 1PH1A 3M4OB 3EIVA 3PO2G 1PZJD 2JA8H 1HNXL 1NAPA 3S2DB 4X64L 3I4LA 2DY8A 4RG1A
chains in the Genus database with same CATH topology
2WIIB 3T16A 1MI2A 4G7HC 1EIHA 2K5WA 4TRDA 5C5LA 4EVOA 2X6GA 5T1GA 1HUNA 1HCZA 3ONAB 4QIWB 3R8BA 4IUVA 2Q8IB 5K5PA 3PUZA 3D4DA 4KHZA 2F0KA 3J80E 4KD3A 4F8MA 1HFNA 3S16B 3GTJB 5IGEA 4ZKCB 5DM63 2PW5A 2L5TA 2F3VA 3I72A 1TY0A 2M00A 3GQBA 1ET6A 2BDOA 2PZUA 2NN6G 3FPUB 3NXWA 2R7ZB 2AQ1B 4EGVA 4C3HG 1GUTA 3PUYA 3A56A 2WKCA 1EYCA 1PRTC 3NTKA 5NUCA 1ICWA 5F2DA 5FLXE 1QB5D 4C1NK 3M7GA 3SVMA 3CHBD 4V190 3A55A 1FNUA 1EY7A 1Y1VB 3VR3A 1DOMA 1Z7TA 1G2SA 3QWNA 1H9SA 1JC7A 3PO3B 3TDQA 3D31A 2R93B 3ITPA 4C3IG 1AZPA 1PTOB 5KYIA 2K5DA 3K0YA 2F0GA 1FNWA 2ICIA 2K5QA 3K5LA 2ZT9C 1B53A 4RHSA 1ESRA 3J7AF 3NQTA 3KLRA 1BCPB 4KKUA 1JWMD 5KGUA 2IX1A 4N9TA 1TVXA 1BCPC 4ZUJA 5C4XB 5A35A 3FPPA 1CQVA 1KTKA 4HN7A 4G4KA 1I4PA 1E2WA 3A8KE 1ENAA 5CV7A 1S5BD 1VMCA 1SBBB 1PFNA 2I46A 3S2HB 3AU7A 1SYEA 2K1BA 1SNCA 1R9TB 3DWQA 4IZ8A 4K5VA 2LMCB 2A69D 4ULLA 1EOTA 1RF2D 5J39A 2EE1A 1WD0A 4BA2I 1SNQA 1I6VC 2ICEC 3VYRA 2OF1A 4PV1C 4IFDG 1LTBD 5I2YA 4A3BB 3T51B 5EJWA 3S1NB 2IX0A 3URYA 1MSHA 1DZ1A 4U673 1VDZA 4TQUS 1RDPD 2RSOA 5FO7B 4LAAA 4ZLTF 1VCIA 5M5XB 1I4GA 1WVLA 3DUZA 4A3DB 1KLGD 2NYZD 1STYA 3H09A 3HOUB 1FYCA 4MN3A 5FK9C 3U9OA 4A3KB 5ELCA 5FO8B 5IGCA 2LKVA 4H13C 3HS0C 2OEOA 1WTRA 3QB3A 4DNRB 1EEFD 2YYZA 4FNFA 4R8IA 4K5WA 1BDOA 3SEBA 1K8MA 2Z4IA 4NDXA 2AUJD 4CJ0B 2RQXA 2GA4B 2XVSA 1G2TA 2D62A 4HCEA 4B08A 2JEBI 2HDLA 3DEOA 3KLSA 1QNKA 2YU9B 1IW7C 4C2MB 3NUCA 1GUSA 5FKAC 1HQMC 3O13A 5M9OA 1NR4A 3SK5A 2QEJC 1A2TA 1EYAA 2NBFA 4XXEA 1STBA 3JAML 4HAEA 2V4DA 2SDFA 2KQ3A 1J8IA 1WTWA 3NWSA 1A2UA 2AUKA 4XDXA 4RCOA 1Q8IA 2A6EC 1S5ED 2EY1A 5E1FA 4DK0A 5G3LF 4BWGB 3FDTA 3Q0AA 2F0VA 3D6CA 4J6HA 3MVVA 3BDCA 3VR2A 1CT1D 1DM0B 5D3DA 3FVQA 4QB4A 4M1UB 3TP8A 5JVG3 1D6EC 1EQVA 2EY5A 3BDLA 1PTOH 1IYVA 4RGNA 1MSGA 1AN8A 4QF4A 1F9PA 2PQEA 2WINB 1VMPA 2K28A 2MHVA 3LX0A 1A3UA 5JEAH 4DXGA 3OIQA 1YNND 1JICA 3P1HA 5I4DA 4OIJA 3Q23A 4XQQA 3BS1A 5HURA 3V2TA 4PMWA 2E76C 3S15B 3SXHA 2RBMA 4F7XA 3MXUA 2X69A 3I73A 4FF2A 1O7YA 3BVMA 4I65A 2F0QA 3N6RA 4RKBA 4K8IA 1H9KA 1IYUA 2EYLA 1I4HA 3QO2A 1EY5A 2AWOA 2IW3A 3QG1A 3VA7A 2F0WA 2EYPA 2B2UA 1NCVA 1V1PA 3R3OA 5FOBB 2JSOA 4EQOA 1JORA 4BBRB 3EFXD 5I6WA 1DCZA 4KK7A 1WTPA 2MPMA 3IFDA 3MEHA 4KTAA 1JWSD 1HXYD 4OO1G 4H0LC 3TP5A 1ONLA 3D8GA 5JEAJ 3IAYA 2IT1A 3VR5A 4EQPA 2MGSA 1OXUA 3NWTA 5C0XG 1ZYRD 2RDFA 3HGBA 2DNCA 2LY7A 4DAYA 5KNDA 4OHJA 4KJOA 3MFYA 3HP3A 1PTOD 1WTOA 3GTGB 1STAA 5J1ZA 4QCLA 5AFWA 2QF7A 1EU3A 2F0JA 1AZQA 4ME5A 2R3ZA 1LTRD 4C3HB 1EU4A 1I6HB 1SNMA 1AP0A 5EQ0A 3ERQA 4XT1B 5CORA 1EY8A 2XN9C 4HMJA 1ENCA 5C44B 3L3OC 2J0TD 2R61A 3MWYW 2XWJB 1IHZA 2KHSA 5CYUA 4DF7A 4MIUA 4JBWA 2F0FA 2QDBA 2FMCA 4JK1C 2TMPA 1FR3A 3C1EA 3HG9A 2KEEA 3OW7A 3WDNA 5C6AA 5IT9E 3S17B 1OXSC 3MHBA 3D4WA 4FO2A 1SAPA 3GTPB 1PFBA 4NW2A 1S5CD 1X32A 5C0XI 1O78A 1AEXA 1HA5A 3ZYYX 1Q1BA 1LLRD 4RAUC 4X3TA 4PMCA 1VF7A 4XQNA 1LT5D 2AQ3B 3DXJC 4TSSA 4OO1I 1BR9A 1SMYD 3FKIB 3CQZB 5KEEA 4IUQA 2O5JC 3LWEA 3Q24A 1UNSA 1KNAA 3J7AV 5IGFA 4PNYA 4RH6A 2IX3A 3GP7A 5CV9A 4DAPA 3TZUA 3T13A 2F0OA 5C5MA 1B9MA 3E6ZX 2EYHA 4CJ1B 2K33A 1K8OA 3CU7A 2QILA 1LT4D 3BDOA 2AWNA 3A54A 4K14A 5KNBA 1JOKA 3BYYB 3CRLC 4C1NI 3I4NB 1TIID 3R2TA 2IPKD 3SK4A 1HUMA 5I2XA 1FGBD 4KKTA 3DM1A 2FMMA 2LS01 2HUGA 3HOXB 1QCBD 4J1MA 3UI2A 4FF1A 4XTCS 2O2LD 3Q22A 4A3GB 4WFN3 4CKEA 3PO2B 1LT3D 2IL8A 1B3AA 2NVYB 2EJFC 3PUVA 1TY2A 1KABA 3NQIA 1QG7A 1A3VA 1W6KA 1TS3A 1LTSD 1YNJD 3OMGA 3I8ZA 5CC4A 2CQAA 2F1MA 3TSSA 2NTSA 2A74C 5DAUA 1IL8A 3VA5A 1S5FD 1SYCA 4NMZA 2K01A 3DEPA 2B2YC 2F0MA 4X3UA 2EJGC 1ILPA 1S4ZA 4FF3A 2B2VC 4XYQA 2F0EA 1RKNA 1H9MA 2JP1A 2B2TA 3H91A 1QJOA 1JOOA 1GUGA 2LFNA 1G291 2L55A 5EBDA 1XYIA 2PMZB 1LT6D 1DD2A 2B2WC 4ZRZA 3A8JE 4LK1C 4RGOS 2R92B 4I7ZC 3OPOA 4WRDA 1U4RA 1GUNA 1HFGA 1SE3A 1BQQT 1GXDC 3S9WA 4HTHA 1RD9D 5I9PA 3PV0A 2IWHA 1M8AA 1KDAA 5KIXA 1KAAA 3OWEB 3D3RA 2RDGA 2N88A 5ELDA 4FXKC 1B9NA 2M2LA 1TS4A 3LNNA 2NVTB 2FINB 2EY6A 1CHQD 1RHPA 1TWAB 5K36G 2G9HD 2F0TA 2I07B 2XRQD 3VYSA 1C4QA 1TWHB 3HOYB 5D3IB 1E2ZA 2WB1B 1UAPA 2K7VA 4X3SA 3IKJA 2DN8A 5C4ZA 1UEAB 3MAQA 3PIO3 4K6LA 2SOBA 4FF4A 1T5EA 1G6ZA 5E3FA 1MGSA 2L4NA 2F0NA 3R93A 2NB0A 1T5XD 1Q90A 1V8QA 3MC0B 1LACA 4L63B 4ILWA 1HQRD 1GUOA 4IUPA 2N55A 2PZWA 2NTTA 2B2VA 5T1IA 5KRUA 3NP8A 3NTIA 1CQFA 4RWSC 1A3TA 1D5XC 5JAVA 2F0IA 5A2QL 3GV3A 1EWCA 1WTQA 1OXXK 1BBXC 1X3PA 3SK6A 4UDUC 2VB2X 2KVMA 1TWCB 1C8CA 3EROA 3I91A 2O4XA 2E2HB 2E2DC 1MBYA 4IN3A 2EXZA 4IALA 2EZVA 4Q5VA 2PW7A 1KNEA 2EOTA 1HHVA 1LTAD 4IUUA 3KK7A 4FYDA 2NN6I 4RA8A 1B2TA 2JA6B 1H9JA 2HDMA 4C56C 1DOLA 4FP5D 3W3AA 2NWGA 4DN4M 1STGA 2B39A 2B2UC 4L8JA 5CMDA 1AFPA 1HRJA 2G9DA 1EWHA 3X3NA 4KMUC 3SE0A 4H44C 3T56B 3BG3A 2TSSA 1TS2A 1D2BA 4BY1B 4L6TB 1ZKOA 5CGKA 2OXPA 4CGYB 3KF8A 1STEA 3N52A 1PZKD 2A6HC 5E4XA 1BF4A 1GJXA 2EYMA 5IODA 2D5DA 3S14B 3I90A 4OL7A 1Y8PB 1Q3LA 2AQ2B 3KBXA 3E0JA 3LWUA 2Y0SB 4IUNA 2XNAC 2F3WA 3GV6A 2X6LA 4B9WA 5G3LD 3OSOA 4K6DA 4R8NA 4QUFA 1JE4A 3QJYA 1VF5C 1G91A 1B1ZA 4IFDI 3A7AB 2DNEA 1TR5A 3PIP3 4N9PA 4QUCA 5E4WC 5CBEE 2JA7B 1C48A 3PUXA 3MZ5A 2B8GA 1CM9A 3OIPA 5EGTA 1DONA 5EPKA 1LV9A 3DWAA 1BUVT 3QOJA 4HMIA 4G7OC 5I9OA 2NN6H 2B8FA 5LL6X 3A7LA 4K2KA 4HR7B 2BE5D 2NUCA 1LTID 5BN4A 2L9HA 3L9AX 1EY0A 2QKIC 1O7ZA 4KV6A 2A6HD 1JB3A 3MXPA 5CV4A 3S1QB 4RCNA 3G7LA 4RGMA 4XIGS 3OOCA 2J7ZA 3EQLC 2CHBD 2A68D 2KJXA 3GO5A 4ZUIA 2NVXB 2MP1A 1I3QB 3WOEA 4XYOA 1ML0D 3QOLA 1TT2A 5IGGA 4CBVA 3NTHA 4ZK9B 1JR0D 3K5NA 3EVQA 4U68A 1TU2B 1DOKA 4FVMA 3VYUA 4HSVA 4GZYC 1FD7D 4BA1I 1HTPA 1WCMB 5IGBA 3PUWA 1TQOA 1JCKB 4A3FB 3HOZB 5CV8A 1R4QB 4HSPA 3HOWB 1EYDA 1Y1WB 1SMYC 2FFKB 2XRSD 4CKBA 4F87A 3OMCA 2A68C 3SR1A 3R2IA 1ZEQX 5IGDA 3GTQB 4Y7NB 3NE5B 5M3FB 5JVH3 4C3JB 4DAVA 3CRKC 3VR4A 5LHY1 1CHPD 4TKOB 2VB3X 2XIWA 3KBGA 2PCFB 2PO4A 3S1MB 5KNCA 3VYTA 2EYFA 3J81E 2KEDA 2VUMB 3OWFA 2Q8RE 3DHQA 1F9QA 3P75A 2Z4HA 2E74C 1LTGD 1CZWA 1WD1A 4YIJA 1FNVA 3H6MA 2EPBA 4BS9A 2M9VA 5IIFA 1PLFA 2B2TC 3P20A 4DFAA 3X3MA 1RODA 3GTKB 2R6GA 3KUPA 4A3IB 1CTMA 2WV6D 2BA0A 1SNOA 2L1BA 5HGTA 4OGQC 5ISRA 3CKIB 2Z8LA 1PXUA 1XXGA 1PDQA 5ELFA 3QIAA 3HRZC 4RHRA 4A3MB 1X3QA 1ZXTA 4G7ZC 2K6AA 1V1PB 2JXMB 5M5YB 1EZ8A 1U4LA 4EQNA 1L0YB 4RGTA 5BN3A 3I70A 1EQTA 1SNDA 1Y69U 4IURA 3RD4A 2MUYA 1EY6A 4K8JA 3TBIB 4KKSA 1TS5A 3Q6SA 1XWEA 2WKDA 1GOZA 1I4XA 1LO5D 2C9OA 2NVQB 4V0BA 3DWPA 1AW7A 2RDHA 1ZYRC 1G8ZD 3DMUA 3P7JA 3M85A 2PPBC 2XSCA 1K83B 3K6OA 2KCCA 3BZDB 4NKLA 4PQXA 3NSWA 1YNJC 5D14A 2E2IB 5JPNC 3TP7A 4KN7C 1QOHA 4AYBB 1S5DD 1RCVD 5JEAG 3NBHA 5C3EB 4KY5A 3AB9A 2MJ8A 2HCCA 2F0HA 2L11A 1O80A 1U9RA 4DA2A 4P2CB 4ZQ3A 4DGZA 4CHTB 1E0BA 1M4VA 1JOQA 2OT2A 3BVZA 3AMUA 1SJED 3FRPB 2CW0C 5KYLA 2ZXOA 3FEWX 2H4OA 2D2CC 2KCNA 1RTOA 3FMCA 3OHXC 4A3EB 1SNPA 4KHVA 1V1OA 2EVBA 4M8AA 3M4YA 1YNNC 5BN5A 1EFID 3NK9A 3RMHA 1TKWB 4XQJA 2JEAI 1IKMA 4IQZA 1W6JA 2F0SA 2K03A 3MTSA 3KLSX 1B50A 4ODGA 2BE5C 2F03A 1R4PB 2K32A 4KN4C 5DEHA 1ILQA 2ENBA 1RJTA 2JYOA 1EIGA 2DY7A 1CI3M 4IFDH 4F88A 1D1KA 2EY2A 4OO1H 1PTOC 2F0UA 2PZTA 4S3SA 5C3XA 3GD7A 2RKSA 3GTOB 1EL0A 5JPMC 1PZID 4PMBA 3PMFA 2WP8J 2KA7A 4RKLA 1DJRD 3TP6A 1ET9A 2RA4A 4ZYSA 1EEID 4DNTB 1HPCA 4ID6A 1CA5A 1OO9B 3K5OA 4MHEA 4UAIA 2B63B 4ZKBB 1LABA 1OXVA 1Z6HA 5I6YA 5DM73 1SE2A 3BYTB 1OXTA 1XTCD 1TWFB 3ND8A 1PYWD 1D1IA 1QILA 4KD4A 1A15A 4WORA 3C2PA 1PRTD 2EJMA 3IFTA 5EKKA 1GHKA 1NUCA 3WOFA 5EBCA 4ZAIA 4K5XA 4NP5A 1WTVA 3SK8A 2A5HA 5FO9B 4G57A 1QWYA 3JAME 2BOSA 1BXTA 4DXFA 2JA8B 1B4OA 1GUWA 1SJHD 1SDFA 3T53B 5IT9L 3J80L 3V96A 2VNUD 4LMQD 3GTMB 1BO0A 2Z1CA 1BNZA 5K36H 3K57A 3BVGA 3F2UA 1CK1A 3TMEA 4KJNA 5IOCA 1KLUD 4Z9CB 5JOBA 5CR3A 1GHJA 1F2YA 3HZXA 4KY7A 5DNFA 2CW0D 5A2QE 2A69C 1NR2A 3RZDB 2K05A 3NPPA 1JQYD 1HA6A 5EPLA 3NHHA 5J22A 3T4AC 4A3JB 1SFOB 2C5CA 2F0DA 4Q0FA 1PMRA 2EYOA 2F4IA 2K04A 2PYKA 1RTNA 5D65A 4IFDJ 2RSNA 3K5MA 1Y8NB 2NZ1D 5C0XJ 5C3WA 4DK1A 2FJ2A 1F9SA 1XX8A 1I4RA 2ZXRA 1IW7D 1TWGB 4BBSB 3H3VC 3MXGA 2KOLA 3E5SA 3D4RA 4B9XA 1H9RA 1SYBA 1J9OA 5EKLA 1CFMA 3K58A 4LJZC 5TSSA 4RFBA 1A6XA 3U9SA 5JJZA 3RLFA 4R9WA 2FHTA 5EPJA 1BCPD 5LL6S 2HQEA 4C3IB 1PTOF 1QNUA 5COYA 1BOSA 1EZ6A 1KDBA 2D9UA 3G6JB 5CV6A 4X3KA 3M7NA 1LTTD 2BDNA 1MD2D 2CVRA 1SXTA 3MXNA 4OIKA 4CKCA 2B2YA 1U4MA 1IKLA 1Z47A 5C0XH 3HKZB 2E2JB 1E2VA 1I50B 1UUPA 1DYQA 2A6ED 2WACA 1U4PA 1SE4A 2L0CA 4J8QA 3C46A 5C4HA 4ABNA 1I4QA 2KUMA 1F77A 1STNA 2A73B 3EA6A 2BCOA 4BY7B 2RVLA 3A8IE 1JWUD 3L7ZC 3TZDA 3J7YW 1DXMA 2Q8TA 3C1FA 2F0LA 1PRTF 1CA6A 5M5WB 1SEBD 4XT3B 3M3YB 1CZGA 1KDCA 4FXDA 4K2LA 2XWBB 5CBAE 3H94A 1F2ZA 5M3MB 4KI0A 1ESFA 4H7BA 4FXGC 5ELBA 2EYJA 4HEDA 3VR6A 2E75C 2O5IC 2SNSA 1V43A 3MFGA 1Q12A 3I3CA 3RUZA 4O42A 5CV5A 2ZXPA 1STHA 2QCPX 4IUTA 4DU9A 1Y8OB 3H0GB 2SNMA 1EY4A 1D5MC 1NSNS 1BCPF 2EDGA 1QE6A 3TN2A 3RZOB 3GTLB 1F2MA 1SYFA 2J4XA 3S1RB 1SYDA 4QMGA 2KECA 3IL8A 2HCIA 3MA2B 3SHLA 3V05A 3NBIA 3SDZA 4C3JG 3HOVB 3W2DA 3K59A 4HCSA 4CJ2C 2H1EA 2ID0A 1WTXA 4O1NA 2PNRC 4WJWA 3C3LA 2WAQB 2BA1A 2JE6I 1F2LA 2IJ0A 1D5ZC 5C4JB 1Q1EA 2L12A 4E6IA 1PFMA 2B2WA 3J81L 3I4MB 3ND9A 1SSOA 3K7AB 1O7LA 1EY9A 1B44D 1PRTB 3D6WA 1H9SB 1L0XB 2VXWA 2F0PA 2SEBD 5EKIA 5FLXL 1HTLD 3EJIA 1II3A 1SYGA 1ENFA 1F9RA 3HEJA 4A93B 2JA5B 4KY6A 5ELEA 3M4OB 1PZJD 1NAPA 3S2DB 3I4LA 2DY8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NYZ D;  1MI2 A;  3R93 A;  2J7Z A;  4MN3 A;  4R9W A;  2FHT A;  5EPJ A;  1EIH A;  3F2U A;  1EL0 A;  2MP1 A;  1MSG A;  3HP3 A;  1B53 A;  2MJ8 A;  1F9P A;  2EPB A;  1WTO A;  2X6G A;  4CJ1 B;  1XYI A;  2HCC A;  1ESR A;  1PLF A;  1ML0 D;  5T1G A;  1HUN A;  5AFW A;  1QE6 A;  1VMP A;  5COY A;  3TN2 A;  2K28 A;  2B2T C;  2D9U A;  2B2W C;  3ONA B;  4X3K A;  1AZQ A;  2R3Z A;  1ROD A;  1TVX A;  3N52 A;  4IUP A;  1WTR A;  4ZK9 B;  2N55 A;  2BDN A;  5DNF A;  5E4X A;  2CVR A;  4IUV A;  2B2V A;  2L11 A;  4OIK A;  1BF4 A;  1O80 A;  2KEC A;  4U68 A;  1NR2 A;  4R8I A;  2B2Y A;  3KUP A;  5T1I A;  1JIC A;  1DOK A;  2K05 A;  2RA4 A;  3I90 A;  3IL8 A;  4XT1 B;  5COR A;  1U4M A;  1IKL A;  5EQ0 A;  4HSV A;  2HCI A;  4OIJ A;  1Q3L A;  1E0B A;  4RWS C;  4CJ0 B;  2L1B A;  1U4R A;  1HUM A;  1HFG A;  3KBX A;  1CA5 A;  1AP0 A;  1U4P A;  1G2T A;  1HFN A;  4HCS A;  3DM1 A;  2FMM A;  4MHE A;  2HUG A;  4UAI A;  1VMC A;  4CJ2 C;  5EPL A;  3GV6 A;  4ZKB B;  1HA6 A;  2X6L A;  1PFN A;  3MWY W;  1PDQ A;  2HDL A;  3DEO A;  3GV3 A;  4QUF A;  1M8A A;  1WTQ A;  2H1E A;  2K1B A;  1WTX A;  2KUM A;  5JJZ A;  1JE4 A;  1QNK A;  3UI2 A;  1BBX C;  1X3P A;  4ZKC B;  1X3Q A;  1ZXT A;  1RTO A;  1AZP A;  2FFK B;  2X69 A;  1G91 A;  2RVL A;  2N88 A;  1O7Y A;  2K04 A;  1RTN A;  2KVM A;  5D65 A;  1U4L A;  2IL8 A;  2RSN A;  3TZD A;  1C8C A;  1GUW A;  1NR4 A;  4QUC A;  1F2L A;  5E4W C;  1B3A A;  2M2L A;  3I91 A;  2Q8T A;  1EOT A;  2NZ1 D;  5CBE E;  1EQT A;  1A15 A;  2L12 A;  3QO2 A;  3FPU B;  4IUR A;  1CM9 A;  1QG7 A;  1DON A;  2FJ2 A;  5EPK A;  1LV9 A;  1CA6 A;  2EE1 A;  2FIN B;  1PFM A;  1F9S A;  2B2W A;  2KEE A;  1WD0 A;  1XX8 A;  4HAE A;  3I8Z A;  4XT3 B;  3Q6S A;  1SSO A;  1IKM A;  1RHP A;  1KNE A;  1ICW A;  2B2U A;  2SDF A;  2EOT A;  1J8I A;  1HHV A;  3D6W A;  1WTW A;  1NCV A;  1SAP A;  4IUU A;  4XDX A;  2XIW A;  5CBA E;  1PFB A;  4NW2 A;  2VXW A;  4ZAI A;  1WTV A;  5EJW A;  4RA8 A;  2K03 A;  3MTS A;  5EKI A;  1X32 A;  2KOL A;  1B2T A;  2HDM A;  1MSH A;  1DZ1 A;  3SVM A;  1DOL A;  2KED A;  1IL8 A;  2NWG A;  2RSO A;  4HED A;  1F9R A;  4DN4 M;  1B4O A;  2L9H A;  3P7J A;  4RAU C;  1WTP A;  4X3T A;  4X3S A;  1B50 A;  2MPM A;  3IFD A;  1J9O A;  2B2U C;  2K01 A;  3DEP A;  4ZLT F;  2Q8R E;  1O7Z A;  2B2Y C;  1SDF A;  1DOM A;  5CMD A;  1BNZ A;  1F9Q A;  3FDT A;  1HRJ A;  4X3U A;  1G2S A;  1ILQ A;  1ILP A;  1S4Z A;  1RJT A;  2JYO A;  1WVL A;  2B2V C;  1WD1 A;  4LMQ D;  5D14 A;  3I3C A;  4IUQ A;  1EIG A;  2MGS A;  1G6Z A;  2DY7 A;  3LWE A;  4O42 A;  2JP1 A;  3G7L A;  1KNA A;  1NAP A;  1MGS A;  1BO0 A;  2B2T A;  3H91 A;  2L4N A;  2DY8 A;  4IUT A; 
#chains in the Genus database with same CATH topology
 4QGU A;  4HID A;  2WII B;  3T16 A;  1MI2 A;  4G7H C;  1EIH A;  3L2P A;  1R9T H;  3HOZ G;  2K5W A;  4TRD A;  5C5L A;  1MJC A;  4EVO A;  2X6G A;  1IBM Q;  1Q82 C;  5T1G A;  1HUN A;  3PSI A;  1HCZ A;  1VQN A;  3ONA B;  4QIW B;  1GM5 A;  4JYA L;  3R8B A;  4IUV A;  2Q8I B;  5FJ8 G;  3HOW H;  2UXC Q;  5K5P A;  1N33 L;  3PUZ A;  3T1Y L;  1I5F A;  3D4D A;  4KHZ A;  2F0K A;  3J80 E;  4KD3 A;  4F8M A;  1HFN A;  1EWI A;  1EQQ A;  1VQ9 A;  4LF9 Q;  1WI5 A;  1UEB A;  3S16 B;  3CQZ H;  4NXN L;  3GTJ B;  1HNW Q;  5IGE A;  4JW0 A;  1LYL A;  4GLV B;  4ZKC B;  5DM6 3;  2PW5 A;  4HJ9 A;  2L5T A;  2F3V A;  3A74 A;  3I72 A;  1TY0 A;  2M00 A;  3GQB A;  2JK8 A;  1ET6 A;  2BDO A;  2N78 A;  2PZU A;  2NN6 G;  2JQO A;  2NVT H;  3AFQ A;  1IBK L;  3FPU B;  4K0K Q;  1YIJ A;  3NXW A;  2R7Z B;  2AQ1 B;  4EGV A;  4IPH A;  3ULP A;  1X55 A;  4DAY B;  3RZO H;  4C3H G;  1GUT A;  2WFW A;  3PUY A;  3J80 i;  3KYH C;  3A56 A;  2WKC A;  1EYC A;  4BBS H;  1PRT C;  3NTK A;  4AYB G;  5NUC A;  1ICW A;  5F2D A;  4A3M H;  5FLX E;  1QB5 D;  4P71 A;  1KAW A;  2E8G A;  4C1N K;  4OWT B;  5M5Y H;  1Y1V H;  4IOA A;  3M7G A;  1A63 A;  4DV0 Q;  3SVM A;  3CW2 C;  3CHB D;  4V19 0;  4ZCK A;  1PFS A;  4R1J A;  3A55 A;  2K4K A;  1FNU A;  1EY7 A;  1Y1V B;  3VR3 A;  1VQM A;  1YJ9 A;  1HR0 L;  1DOM A;  1Z7T A;  4NXM Q;  1G2S A;  3QWN A;  2Z9H A;  1JJG A;  1H9S A;  1JC7 A;  3PO3 B;  3TDQ A;  3D31 A;  2R93 B;  3ITP A;  4A3I G;  4C3I G;  2B63 H;  1AZP A;  1PTO B;  2PI2 E;  2CCZ A;  5KYI A;  2K5D A;  3K0Y A;  2ATW A;  3TS0 A;  2F0G A;  1FNW A;  2ICI A;  2K5Q A;  3K5L A;  2ZT9 C;  1PYS B;  1B53 A;  3FP9 A;  4IPD A;  4RHS A;  5IP7 H;  4O0A A;  1ESR A;  3J7A F;  3NQT A;  3I56 A;  3K7A H;  3KLR A;  3AFP A;  1BCP B;  4KKU A;  1JWM D;  5KGU A;  2IX1 A;  4N9T A;  1TVX A;  4O2D A;  3G71 A;  1BCP C;  4ZUJ A;  5C4X B;  5A35 A;  3FPP A;  3KOJ A;  1J5E L;  1CQV A;  2DJG C;  1KTK A;  3STB C;  4HN7 A;  4G4K A;  3UDI A;  1I4P A;  1E2W A;  4KLK A;  1UWV A;  3A8K E;  1ENA A;  5CV7 A;  1S5B D;  1VMC A;  2E5L L;  1SBB B;  1PFN A;  2I46 A;  3S2H B;  3AU7 A;  1SYE A;  2K1B A;  2VUM H;  2CWA A;  2NVX H;  1SNC A;  1R9T B;  3DWQ A;  3HKS A;  4JI6 L;  3HOV H;  4IZ8 A;  4K5V A;  2LMC B;  2PQA A;  3CC2 A;  2A69 D;  4ULL A;  3KFU A;  1EOT A;  4CDE C;  1RF2 D;  1A62 A;  1D8L A;  5J39 A;  1K0S A;  2EE1 A;  2VQF Q;  1WD0 A;  4YHH L;  4BA2 I;  2JA6 G;  1SNQ A;  1I6V C;  2ICE C;  3VYR A;  2OF1 A;  4PV1 C;  4IFD G;  4P73 A;  1LTB D;  5I2Y A;  1LTL A;  4A3B B;  3T51 B;  1IXR A;  5EJW A;  3CMA A;  5FLX c;  3KF6 A;  3S1N B;  3HOZ H;  2IX0 A;  3URY A;  1MSH A;  1DZ1 A;  3U4Z A;  4U67 3;  1VDZ A;  4TQU S;  2RHQ B;  1AH9 A;  1PH4 A;  1RDP D;  2RSO A;  4DV2 L;  5M3M G;  5FO7 B;  4LAA A;  4ZLT F;  3I4M H;  1VCI A;  3J7A 5;  4JBJ A;  5M5X B;  1I4G A;  1WVL A;  4YCU A;  2B29 A;  1Q81 C;  3DUZ A;  4A3D B;  1KLG D;  2NYZ D;  1STY A;  3H09 A;  3HOU B;  4DR7 L;  1FYC A;  4MN3 A;  5FK9 C;  3U9O A;  1HZ9 A;  3VDY A;  1M90 C;  4GKJ Q;  4A3K B;  4GN5 A;  1XPR A;  5ELC A;  5FO8 B;  2Y0S G;  5IGC A;  3E9I A;  2LKV A;  4BY7 G;  1K3R A;  4A3E H;  4JV5 L;  4B3T L;  1HH2 P;  2ZTE A;  4H13 C;  3S1M H;  4X6A H;  3HS0 C;  2OEO A;  1WTR A;  3QB3 A;  4DNR B;  1EEF D;  2YYZ A;  4FNF A;  2MQH A;  2RCF A;  4R8I A;  4K5W A;  1IBK Q;  1BDO A;  3SEB A;  4A76 A;  1K8M A;  4Y52 H;  2Z4I A;  4NDX A;  2AUJ D;  4B3R Q;  4CJ0 B;  2RQX A;  2GA4 B;  2XVS A;  1AE2 A;  4A3G H;  1G2T A;  4LF7 L;  2D62 A;  4HCE A;  4B08 A;  1XPU A;  2JEB I;  2KBN A;  3PF4 A;  1EFW A;  4QJF A;  2HDL A;  3DEO A;  3PIO A;  4YWL A;  3KLS A;  1QNK A;  2HIV A;  4A3D G;  2YU9 B;  5IP9 H;  1IW7 C;  5EAY A;  4C2M B;  1KD1 C;  3NUC A;  4NXM L;  1C7Y A;  1GUS A;  3K8A A;  5FKA C;  1HQM C;  3O13 A;  5M9O A;  1EUJ A;  1NR4 A;  4TVA B;  3SK5 A;  2R92 H;  2QEJ C;  2HQL A;  1A2T A;  1EYA A;  2NBF A;  2JA5 G;  4XXE A;  1STB A;  4DV0 L;  3JAM L;  1SE8 A;  1KRT A;  4JI5 Q;  4HAE A;  3GTJ H;  2GVB A;  2V4D A;  2SDF A;  2VZA A;  2KQ3 A;  1J8I A;  1WTW A;  3NWS A;  1A2U A;  2MNA A;  2AUK A;  4XDX A;  4RCO A;  1Q8I A;  4A3K H;  4J15 A;  2A6E C;  1E1O A;  1G6P A;  1S5E D;  2EY1 A;  4L5T A;  4JC0 A;  5E1F A;  4DK0 A;  5G3L F;  2F4V L;  3UDG A;  4CDC C;  4OX9 L;  3S1Q H;  4BWG B;  3FDT A;  1VQG A;  4X62 Q;  2F0V A;  3Q0A A;  3D6C A;  4J6H A;  3MVV A;  3CP0 A;  3BDC A;  3VR2 A;  3KJO A;  1CT1 D;  4JI2 Q;  1DM0 B;  5D3D A;  3CCS A;  3FVQ A;  4QB4 A;  1K8A C;  4M1U B;  5L37 A;  4RMF A;  2WB1 E;  1CKO A;  3TP8 A;  5JVG 3;  1AE3 A;  1D6E C;  1EQV A;  1VQI A;  2EY5 A;  2ZJP A;  3BDL A;  4EQ5 A;  4GNX C;  2UUC Q;  3A5U A;  4GKK Q;  1PTO H;  3DM3 A;  1IYV A;  4OEL B;  4RGN A;  3T1H Q;  1N8R C;  1MSG A;  1AN8 A;  4QF4 A;  1F9P A;  2PQE A;  2WIN B;  1VMP A;  2K28 A;  2MHV A;  3LX0 A;  1WTH A;  1A3U A;  5JEA H;  1L1O B;  4DXG A;  3OIQ A;  1YNN D;  1JIC A;  2C35 B;  3NBH B;  3P1H A;  5I4D A;  3RNU A;  2UXB Q;  4OIJ A;  3Q23 A;  1ASZ A;  4XQQ A;  3GTP H;  3BS1 A;  5HUR A;  1VQ4 A;  3V2T A;  1TWF H;  4PMW A;  3RR5 A;  2E76 C;  3BU2 A;  3S15 B;  3SXH A;  5M5X H;  4JI8 Q;  1IBL L;  2R7F A;  2RBM A;  2KCT A;  4F7X A;  3HOW G;  1Y1W G;  3MXU A;  2X69 A;  3I73 A;  4FF2 A;  1O7Y A;  3BVM A;  4I65 A;  1SN8 A;  2F0Q A;  3N6R A;  4RKB A;  4HJA A;  2F4V Q;  4K8I A;  1EOV A;  1H9K A;  2XGT A;  1IYU A;  2EYL A;  1I4H A;  1IZ6 A;  1TWA H;  1TWC H;  1SLJ A;  3QO2 A;  1EY5 A;  2AWO A;  4DR2 L;  4IOC A;  2IW3 A;  3QG1 A;  3VA7 A;  3RLN A;  2F0W A;  2B3G A;  2EYP A;  5IYC G;  2B2U A;  5JJL A;  1NCV A;  1V1P A;  3R3O A;  5FOB B;  3ICE A;  1K9M C;  5H1S E;  2JSO A;  1Q46 A;  4EQO A;  1JOR A;  4BBR B;  3EFX D;  5I6W A;  3S1N H;  1DCZ A;  4KK7 A;  1WTP A;  3UE0 A;  2MPM A;  3IFD A;  3MEH A;  4KTA A;  1VQP A;  1JWS D;  1HXY D;  4OO1 G;  2R93 G;  4H0L C;  3TP5 A;  3U4V A;  1ONL A;  3D8G A;  3UE1 A;  5JEA J;  1VQF A;  3IAY A;  2IT1 A;  3VR5 A;  3UDF A;  1YZ6 A;  2MGS A;  4EQP A;  4A75 A;  1OXU A;  3NWT A;  2HT1 A;  5C3E G;  5C0X G;  4DPG A;  1ZYR D;  2RDF A;  3HGB A;  2DNC A;  2LY7 A;  4DAY A;  5KND A;  4DAM A;  4OHJ A;  4C2M H;  1X56 A;  4KJO A;  3J81 j;  3MFY A;  4AQY Q;  3HP3 A;  1PTO D;  1WTO A;  1X3F A;  1STA A;  5J1Z A;  3GTG B;  4QCL A;  3GTK H;  5AFW A;  1VQL A;  2QF7 A;  1EU3 A;  2F0J A;  1AZQ A;  4ME5 A;  2R3Z A;  4A3J H;  2V1C C;  1LTR D;  4C3H B;  1C0A A;  1EU4 A;  1I6H B;  4PZ8 A;  1SNM A;  1Y14 B;  1NTG A;  5EQ0 A;  3ERQ A;  4XT1 B;  5COR A;  1AP0 A;  4GKJ L;  1X54 A;  1IL2 A;  1EY8 A;  2ZTC A;  4DNI A;  2XN9 C;  4HMJ A;  4LF4 Q;  3UDX A;  1JJ2 A;  4R4I A;  1FJG L;  4DR1 Q;  1ENC A;  4BY1 G;  5C44 B;  3L3O C;  2J0T D;  2R61 A;  3MWY W;  2XWJ B;  1IHZ A;  4LFA Q;  4DV7 Q;  2QEX A;  3CCU A;  2NVQ H;  2KHS A;  5CYU A;  4DV6 L;  4DF7 A;  4X62 L;  4DK6 C;  3RN5 A;  4MIU A;  4I7A A;  4JBW A;  2F0F A;  2QDB A;  2Q2U A;  4OON A;  1I50 H;  2FMC A;  4JK1 C;  2TMP A;  1FR3 A;  3C1E A;  3HG9 A;  2KEE A;  3OW7 A;  3WDN A;  5C6A A;  5IT9 E;  3S17 B;  1OXS C;  3MHB A;  3D4W A;  1A8V A;  4DUY L;  1NY4 A;  4FO2 A;  1SAP A;  2VQF L;  1VQ6 A;  4YY3 L;  3GTP B;  1PFB A;  4NW2 A;  1S5C D;  1X32 A;  5C0X I;  1O78 A;  1AEX A;  1HA5 A;  3ZYY X;  1Q1B A;  1HNX Q;  1LLR D;  1X9N A;  4RAU C;  4DV7 L;  4X3T A;  2E2I H;  4L5Q A;  4PMC A;  1VF7 A;  4XQN A;  5JJK A;  1LT5 D;  2AQ3 B;  4FDB A;  3DXJ C;  4TSS A;  2K14 A;  3K80 C;  4OO1 I;  2I5H A;  4LFB L;  1WJJ A;  1BR9 A;  1SMY D;  3CXC A;  1S3O A;  3FKI B;  4LF5 Q;  3CQZ B;  5KEE A;  3KDF B;  4IUQ A;  4MZ9 A;  4OWX B;  2O5J C;  3LWE A;  3Q24 A;  1UNS A;  1KNA A;  2KHJ A;  3J7A V;  5IGF A;  4PNY A;  4RH6 A;  2IX3 A;  3KJP A;  3GP7 A;  5CV9 A;  2UXC L;  4DAP A;  3TZU A;  3T13 A;  2F0O A;  2OCE A;  4UP8 A;  5C5M A;  1B9M A;  4JI1 Q;  3E6Z X;  4B3R L;  2EYH A;  2ZJR A;  5C4X G;  1ASY A;  4CJ1 B;  2K33 A;  1K8O A;  1IYJ B;  2PNH A;  3CU7 A;  2QIL A;  1LT4 D;  1NBW A;  3BDO A;  2AWN A;  3A54 A;  4K14 A;  3OW2 A;  5KNB A;  1JOK A;  1XTD A;  3BYY B;  1E7Z A;  3CRL C;  4YWM A;  4C1N I;  3I4N B;  1TII D;  3R2T A;  2IPK D;  3SK4 A;  5IYB H;  1HUM A;  5I2X A;  1VQO A;  1FGB D;  4KKT A;  1UE6 A;  3DM1 A;  2FMM A;  1VQ7 A;  2LS0 1;  2HUG A;  2UXD Q;  3HOX B;  4GNX A;  1QCB D;  4J1M A;  3GTO H;  3UI2 A;  4FF1 A;  4DR6 Q;  4XTC S;  2O2L D;  4KHP Q;  3Q22 A;  1K3B C;  4A3G B;  4WFN 3;  4CKE A;  4AQY L;  3PO2 B;  1LT3 D;  2IL8 A;  3OYY A;  1B3A A;  2NVY B;  2EJF C;  3PUV A;  3PO3 H;  4CDD C;  1TY2 A;  1KAB A;  3NQI A;  1BBW A;  3T1Y Q;  1QG7 A;  5BR8 L;  1A3V A;  1W6K A;  1TS3 A;  4JI7 Q;  2GN5 A;  1LTS D;  1YNJ D;  3OMG A;  3I8Z A;  5CC4 A;  2OTJ A;  2CQA A;  2F1M A;  3A0J A;  2AKW B;  1B70 B;  3TSS A;  3E0E A;  3K81 C;  2UUC L;  4GKK L;  2NTS A;  2A74 C;  1K8G A;  3W1B A;  5DAU A;  1IL8 A;  2RCN A;  3VA5 A;  1S5F D;  1SYC A;  3L0O A;  3CCR A;  4NMZ A;  2K01 A;  1VQJ A;  3DEP A;  1I94 Q;  2B2Y C;  5IWA Q;  2F0M A;  4X3U A;  2EJG C;  3HOU G;  1ILP A;  1S4Z A;  4FF3 A;  2ZM6 L;  2B2V C;  1I3Q H;  4XYQ A;  5GAD C;  5C44 H;  2F0E A;  1RKN A;  3CME A;  1H9M A;  2JP1 A;  3F1Z A;  2B2T A;  3H91 A;  3RN2 A;  1QJO A;  1JOO A;  1GUG A;  2LFN A;  1EQR A;  1LM0 A;  2JN4 A;  1G29 1;  2UXB L;  3QR8 A;  1OTC A;  2L55 A;  2Q2T A;  2CKZ B;  1YEZ A;  5EBD A;  1XYI A;  2PMZ B;  1LT6 D;  1DD2 A;  3H0G G;  2RF4 A;  2B2W C;  4ZRZ A;  3A8J E;  5FLM G;  4DV3 Q;  4DUZ Q;  4LK1 C;  4RGO S;  2R92 B;  4I7Z C;  1I94 L;  3OPO A;  4R4Q A;  4WRD A;  4BBR G;  1U4R A;  1GUN A;  1HFG A;  1SE3 A;  1XMQ L;  1BQQ T;  1GXD C;  3S9W A;  4HTH A;  1RD9 D;  5I9P A;  3PV0 A;  2IWH A;  1PH8 A;  3I2Z A;  1M8A A;  1XNR L;  1KDA A;  4P72 A;  5KIX A;  4AH6 A;  1KAA A;  3S24 A;  3OWE B;  2N8N A;  2DUD A;  3D3R A;  2RDG A;  2N88 A;  4JI1 L;  5ELD A;  4A3C H;  4A3L G;  4FXK C;  4JVZ A;  1B9N A;  4DV4 L;  2M2L A;  1TS4 A;  3RZD H;  3LNN A;  3K0X A;  1HZB A;  1VQB A;  4A3D H;  2NVT B;  2FIN B;  2EY6 A;  1SFO H;  1CHQ D;  1RHP A;  1C9O A;  4UY8 C;  1XNQ Q;  1TWA B;  5K36 G;  2G9H D;  2F0T A;  2I07 B;  2XRQ D;  2K52 A;  3VYS A;  1C4Q A;  1TWH B;  3HOY B;  5D3I B;  1E2Z A;  4ME3 A;  4X64 Q;  1N32 Q;  5IP7 G;  4APV A;  1DGS A;  1UAP A;  2WB1 B;  4P74 A;  2K7V A;  4X3S A;  3IKJ A;  2DN8 A;  5C4Z A;  1UEA B;  1XNQ L;  3MAQ A;  3PIO 3;  4K6L A;  1QZH A;  2SOB A;  1QUQ B;  4GOP B;  4FF4 A;  3A5Z B;  1N34 L;  1PYB A;  1CSQ A;  3JAM i;  3S15 H;  1T5E A;  1Q86 C;  1G6Z A;  5E3F A;  1MGS A;  2L4N A;  4JOI A;  2UU9 L;  2F0N A;  3R93 A;  2NB0 A;  1T5X D;  1Q90 A;  2P5Z X;  4X66 Q;  2YU9 H;  4B3S L;  1V8Q A;  3MC0 B;  1LAC A;  3CCQ A;  4L63 B;  4LFC Q;  1Y1V G;  4ILW A;  1HQR D;  4LUZ A;  1L2F A;  2VUM G;  1GUO A;  4UHV A;  1L1O C;  5IYD H;  4JOI C;  4IUP A;  5LMN L;  1EIF A;  1FL0 A;  2N55 A;  2PZW A;  4HJ5 A;  2NTT A;  2B2V A;  2LXK A;  4A3F G;  1M1K C;  4DR7 Q;  5T1I A;  5KRU A;  3NP8 A;  1J6Q A;  3H3V I;  3NTI A;  1WCM H;  1CQF A;  4RWS C;  4DV5 Q;  1A3T A;  3I4N H;  1D5X C;  3JC6 6;  2UUB Q;  3PF5 A;  2NZH A;  5JAV A;  2F0I A;  4DV3 L;  4GLA C;  4JI0 L;  5A2Q L;  3PGZ A;  3GV3 A;  1EWC A;  1WTQ A;  1OXX K;  1BBX C;  1X3P A;  1YIT A;  1WOC A;  3SK6 A;  1K0R A;  4UDU C;  3E9H A;  2VB2 X;  3STB D;  2KVM A;  1TWC B;  4LF4 L;  4R4T A;  2ALY B;  5ELO A;  1C8C A;  5LMU Q;  1CSP A;  3I91 A;  3ERO A;  2O4X A;  2E2H B;  1VQA A;  1KHI A;  2CFM A;  2E2D C;  1MBY A;  4IN3 A;  4LFA L;  5GRO A;  2K5H A;  2EXZ A;  4IAL A;  2EZV A;  3CAM A;  4LNQ A;  1HNZ L;  4DR1 L;  4Q5V A;  2PW7 A;  1KNE A;  5C44 G;  2KHI A;  4JI0 Q;  2EOT A;  1HHV A;  3ZJY C;  5IWA L;  1LTA D;  4IUU A;  5J3B A;  2CQO A;  2IHF A;  3KK7 A;  4FYD A;  1NNX A;  2NN6 I;  4RA8 A;  1B2T A;  2JA6 B;  1H9J A;  2HDM A;  4C56 C;  2NVY H;  4BY7 H;  1DOL A;  4FP5 D;  4X65 L;  3W3A A;  2NWG A;  2LSS A;  4DN4 M;  1STG A;  4LUV A;  2B39 A;  1BBU A;  3CCV A;  5JJI A;  2B2U C;  3IRB A;  2ZJQ A;  4L8J A;  5CMD A;  2I0Q A;  1AFP A;  1HRJ A;  2G9D A;  1EWH A;  1KIX A;  4HIM A;  3X3N A;  4KMU C;  3SE0 A;  4H44 C;  3T56 B;  1Q7Y C;  3BG3 A;  4A3G G;  3PIP A;  4GNX B;  2TSS A;  2AHO B;  1TS2 A;  1D2B A;  2E2J H;  4BY1 B;  4L6T B;  1QVF A;  1E24 A;  1ZKO A;  2JA7 G;  3JAM c;  5CGK A;  1QZG A;  2OXP A;  4CGY B;  3KF8 A;  1E22 A;  1STE A;  3N52 A;  1RL2 A;  1BVS A;  1KRS A;  1PZK D;  2A6H C;  2Z6K A;  4MTK A;  5E4X A;  1BF4 A;  2IHE A;  2Y0S E;  1GJX A;  2EYM A;  5IOD A;  2D5D A;  3S14 B;  3I90 A;  4OL7 A;  4HIK A;  1Y8P B;  1XMO L;  1Q3L A;  2AQ2 B;  4QL5 A;  2GVA A;  3KBX A;  3E0J A;  3LWU A;  1GO3 E;  2NZO A;  2Y0S B;  4IUN A;  1HNZ Q;  2XNA C;  2F3W A;  3GV6 A;  2X6L A;  4B9W A;  5G3L D;  3OSO A;  1Z9F A;  4K6D A;  4R8N A;  4QUF A;  4A3K G;  4OWW B;  4DR2 Q;  4NB3 A;  1JE4 A;  3QJY A;  1VF5 C;  1EYG A;  1G91 A;  1B1Z A;  4IFD I;  3A7A B;  2DNE A;  1WYD A;  4JI4 L;  1UE5 A;  2K5N A;  1YBY A;  1TR5 A;  1X6O A;  4N9P A;  4QUC A;  5M5W H;  3PIP 3;  5E4W C;  5CBE E;  2JA7 B;  1C48 A;  3PUX A;  3MZ5 A;  4DR5 L;  2B8G A;  1CM9 A;  3OIP A;  5EGT A;  4AYB E;  1DON A;  5EPK A;  1S40 A;  1LV9 A;  3DWA A;  1BUV T;  3QOJ A;  3J80 c;  4QQB X;  1IBL Q;  2Q2H A;  4HMI A;  4N8X 1;  3SGI A;  4G7O C;  3ULL A;  5I9O A;  2YTX A;  2YTY A;  2ES2 A;  4BXX G;  3CC4 A;  4GOP C;  2NN6 H;  5ELN A;  3TRZ A;  2B8F A;  5LL6 X;  1SRU A;  4JI8 L;  3PO2 H;  3A7L A;  4K2K A;  2R7Z H;  2JA8 G;  4HR7 B;  2BE5 D;  1HR0 W;  2NUC A;  4K0K L;  4A3I H;  4C3I H;  2B63 G;  1LTI D;  4UP9 A;  1V1Q A;  5BN4 A;  2L9H A;  3L9A X;  1EY0 A;  3ULJ A;  1NE3 A;  2QKI C;  1O7Z A;  4KV6 A;  2A6H D;  1JB3 A;  4YWK A;  4P75 A;  2A1A A;  4R4O A;  2OTL A;  4JI5 L;  3MXP A;  5CV4 A;  3S1Q B;  1YJN A;  4RCN A;  3CF5 A;  3G7L A;  4RGM A;  4XIG S;  2Z6B A;  3LGJ A;  5FJ8 H;  2K75 A;  3OOC A;  3CCL A;  2J7Z A;  3EQL C;  2CHB D;  2A68 D;  2KJX A;  3ERS X;  2WAQ G;  2CWP A;  3GO5 A;  4ZUI A;  2NVX B;  2MP1 A;  3CD6 A;  2LXJ A;  1I3Q B;  1PVO A;  1O7I A;  3WOE A;  4XYO A;  1ML0 D;  3QOL A;  1TT2 A;  2QW7 A;  5IGG A;  1Q8K A;  4CBV A;  3NTH A;  4ZK9 B;  3F8T A;  1JR0 D;  3EVQ A;  4U68 A;  3K5N A;  1TU2 B;  3B6Y A;  4NPS A;  1DOK A;  4FVM A;  3U58 A;  3VYU A;  4HSV A;  4GZY C;  1FD7 D;  4BA1 I;  1HTP A;  1WCM B;  5IGB A;  3PUW A;  1T9H A;  1JCK B;  1TQO A;  4A3F B;  4A3E G;  3NEL A;  5GQO A;  3HOZ B;  5CV8 A;  2OQK A;  1R4Q B;  4HSP A;  4HIO A;  2BH8 A;  3HOW B;  1EYD A;  1Y1W B;  1SMY C;  2UUA Q;  1GVP A;  1L0W A;  4GN3 B;  2A19 A;  3PQI A;  1D7Q A;  2FFK B;  4Y7N H;  2ASB A;  4DR4 L;  4IPG A;  2XRS D;  4CKB A;  4JG2 A;  4F87 A;  3OMC A;  1YNX A;  2A68 C;  4HJ7 A;  2D0P A;  4A93 G;  3SR1 A;  4LF6 L;  3R2I A;  1ZEQ X;  5IGD A;  3GTQ B;  4Y7N B;  3NE5 B;  2R7D A;  5M3F B;  5JVH 3;  1FGU A;  3CCE A;  4C3J B;  3HOV G;  3ER0 A;  3CRK C;  4DAV A;  3VR4 A;  5LHY 1;  1CHP D;  3EBE A;  4TKO B;  3I4M G;  5C3E H;  2VB3 X;  2XIW A;  3KBG A;  4LWC A;  2PCF B;  2PO4 A;  3S1M B;  5KNC A;  3S16 H;  3VYT A;  2EYF A;  3MEF A;  1RIP A;  3J81 E;  1YHB A;  2KED A;  2JA6 H;  2VUM B;  3OWF A;  2Q8R E;  3DHQ A;  1F9Q A;  2VY3 A;  3P75 A;  1B3Q A;  2Z4H A;  3CCM A;  2E74 C;  1LTG D;  1CZW A;  1WD1 A;  1W2B A;  1NJI C;  2HD3 A;  5IYC H;  4YIJ A;  1N36 L;  2F3I A;  5AJ3 Q;  1FNV A;  3H6M A;  3I7F A;  4BY1 H;  2EPB A;  4BS9 A;  2M9V A;  5IIF A;  1PLF A;  5GAE C;  2B2T C;  2EQS A;  2VL6 A;  3P20 A;  4DFA A;  3X3M A;  1ROD A;  2R93 H;  3M4P A;  3RLO A;  3CCJ A;  1XNR Q;  3GTK B;  2L15 A;  4LF8 L;  2XTI A;  2R6G A;  3KUP A;  4DR5 Q;  2QDL A;  4A3I B;  1CTM A;  2WV6 D;  5HY6 A;  2BA0 A;  4JI4 Q;  4C3H H;  3H0G H;  1SNO A;  2L1B A;  4B3M L;  2H5X A;  4HJ8 A;  5HGT A;  4OGQ C;  5ISR A;  2EXD A;  1K73 C;  3CKI B;  5FLM H;  2Z8L A;  4A3M G;  1PXU A;  3TS2 A;  1XXG A;  1PDQ A;  3HFZ B;  4IPC A;  3QIA A;  5ELF A;  3HRZ C;  4RHR A;  4A3M B;  1X3Q A;  1ZXT A;  4G7Z C;  3CPF A;  4L5R C;  2K6A A;  4LUO A;  1V1P B;  2JXM B;  5M5Y B;  1PH6 A;  1BKB A;  1EZ8 A;  1U4L A;  1L0Y B;  4RGT A;  4EQN A;  4A3J G;  4JI7 L;  5BN3 A;  4IJH A;  3I70 A;  4PZ6 A;  1EQT A;  1SND A;  1Y69 U;  4IUR A;  3RD4 A;  2YV5 A;  2MUY A;  1EY6 A;  4K8J A;  3TBI B;  4KKS A;  1YI2 A;  4DV6 Q;  1TS5 A;  3Q6S A;  1XWE A;  2WKD A;  4A3C G;  1GOZ A;  1HR0 Q;  1I4X A;  1LO5 D;  2C9O A;  2NVQ B;  3WWV A;  1CKM A;  4V0B A;  3DWP A;  1AW7 A;  2RDH A;  1ZYR C;  1MJE A;  2E2H H;  1G8Z D;  2PI2 A;  4DKA C;  3GTM H;  3DMU A;  2DGY A;  3P7J A;  3M85 A;  2PPB C;  1YVC A;  2XSC A;  1K83 B;  2WB1 G;  2KCC A;  3K6O A;  3NEN A;  2DJF C;  3BZD B;  4NKL A;  4PQX A;  3NSW A;  1YNJ C;  5C4J H;  3J81 i;  5D14 A;  2E2I B;  5JPN C;  3TP7 A;  4KN7 C;  1L1O A;  1P8L A;  1HZC A;  1QOH A;  4BBS G;  5M3F H;  4X65 Q;  4AYB B;  4WJ3 M;  1S5D D;  1RCV D;  1UE1 A;  5JEA G;  3NBH A;  3W5O A;  1I6H H;  1MKH A;  1EIY B;  1PH3 A;  2F52 A;  2QA4 A;  5C3E B;  4KY5 A;  3OTO Q;  1VQH A;  2MJ8 A;  3AB9 A;  4OXP A;  2HCC A;  3KF6 B;  3BJU A;  3G4S A;  2F0H A;  1B8A A;  2L11 A;  5AJ3 L;  1O80 A;  1U9R A;  4DK3 C;  4DA2 A;  4P2C B;  3S2D H;  4ZQ3 A;  1KQS A;  3S17 H;  4DGZ A;  4CHT B;  3U50 C;  4YCV A;  1E0B A;  3FHW A;  1M4V A;  1JOQ A;  2OT2 A;  2ZTD A;  1B7Y B;  3BVZ A;  4R4C A;  3AMU A;  1SJE D;  1VS0 A;  3FRP B;  2CW0 C;  5KYL A;  2ZXO A;  1PH7 A;  3FEW X;  2H4O A;  1QVG A;  4QIW E;  2D2C C;  4YY3 Q;  2KCN A;  2G5D A;  4B3T Q;  2OWO A;  2FXQ A;  1JT8 A;  1RTO A;  3TEH B;  3FMC A;  3OHX C;  1YHQ A;  4A3E B;  1SNP A;  4KHV A;  3HOY H;  2K50 A;  1V1O A;  2EVB A;  5M3M H;  4M8A A;  3M4Y A;  3HKZ E;  1YNN C;  4DR3 L;  3AYH B;  1XPO A;  5BN5 A;  2UU9 Q;  1EFI D;  3NK9 A;  3RMH A;  1TKW B;  4A3B H;  4XQJ A;  4LF8 Q;  2JEA I;  3FKI G;  1IKM A;  1XMQ Q;  4IQZ A;  1W6J A;  3GTG H;  2VW9 A;  2F0S A;  5E7N A;  4X66 L;  3F2D A;  2K03 A;  3MTS A;  1GD7 A;  3TQY A;  4OEM B;  3KLS X;  1B50 A;  4ODG A;  4DR3 Q;  2BE5 C;  2F03 A;  1R4P B;  2K32 A;  4KN4 C;  5LMN Q;  5DEH A;  1ILQ A;  2ENB A;  1RJT A;  1SRO A;  2JYO A;  2HIX A;  1EIG A;  3DLL A;  2DY7 A;  1CI3 M;  1X3E A;  4IFD H;  4LFC L;  4F88 A;  4B3M Q;  1D1K A;  4BBR H;  2Z6K C;  3GTQ H;  2EY2 A;  4OO1 H;  1PTO C;  2UUB L;  2F0U A;  3S1R H;  2PZT A;  3F2B A;  4S3S A;  2WAQ E;  5C3X A;  3GD7 A;  2RKS A;  3GTO B;  1EL0 A;  4CDF C;  5JPM C;  1PZI D;  4DV5 L;  4PMB A;  3PMF A;  2WP8 J;  4JI2 L;  2KA7 A;  1N34 Q;  4RKL A;  2I5L X;  1DJR D;  1W3S A;  3TP6 A;  2R92 G;  4NXN Q;  1HNW L;  1ET9 A;  5GAG C;  3HOX H;  2RA4 A;  4ZYS A;  1EEI D;  2HHH L;  4DNT B;  1S72 A;  1HPC A;  4ID6 A;  2EIF A;  1CA5 A;  1J5E Q;  4ALP A;  1OO9 B;  3K5O A;  4MHE A;  4UAI A;  2B63 B;  4ZKB B;  1LAB A;  1OXV A;  1E1T A;  1CKN A;  1Z6H A;  5I6Y A;  5DM7 3;  1SE2 A;  4JBM A;  1U0L A;  1LUZ A;  3PCO B;  3T1H L;  3BYT B;  1OXT A;  1XTC D;  1PH2 A;  1TWF B;  3ND8 A;  1JB7 A;  1PYW D;  1D1I A;  1QIL A;  3NEM A;  4KD4 A;  1A15 A;  4GLX A;  3H3V H;  1SMX A;  4WOR A;  3C2P A;  3M3Y H;  1PRT D;  3CC7 A;  2ZM6 Q;  2EJM A;  1X3G A;  3IFT A;  5EKK A;  1GHK A;  1NUC A;  5M3F G;  3GTL H;  3WOF A;  5EBC A;  4ZAI A;  4K5X A;  4NP5 A;  1WTV A;  3SK8 A;  2A5H A;  5FO9 B;  4LF6 Q;  3G48 A;  1QWY A;  4G57 A;  5IP9 G;  3JAM E;  2BOS A;  1BXT A;  4DXF A;  2JA8 B;  1B4O A;  3MXN B;  1GUW A;  1SJH D;  1VQC A;  1SDF A;  3T53 B;  2PQA B;  2JA5 H;  5IT9 L;  3J80 L;  2AMC B;  3V96 A;  2VNU D;  1U5K A;  4LMQ D;  2UXD L;  2VS1 A;  3GTM B;  1BO0 A;  1WCM G;  2Z1C A;  1G51 A;  1BNZ A;  3GDE A;  1N9W A;  5K36 H;  3K57 A;  1PV4 A;  3W1G A;  3BVG A;  4DV1 L;  3F2U A;  1CK1 A;  3KLW A;  2Q2I A;  2JA9 A;  3TME A;  4EX5 A;  4LFB Q;  4KJN A;  5IOC A;  1Y1W H;  1KLU D;  3Q8D A;  5IYB G;  2K5V A;  4Z9C B;  5JOB A;  2IY5 B;  1E3P A;  5CR3 A;  1GHJ A;  1F2Y A;  3HZX A;  3KDF A;  4KY7 A;  4H02 A;  5DNF A;  4LF9 L;  3HOY G;  2CW0 D;  1YJW A;  5A2Q E;  2A69 C;  1NR2 A;  4MNO A;  3RZD B;  4DV2 Q;  2K05 A;  5HGQ A;  4AIM A;  5C4X H;  1PH5 A;  3NPP A;  1JE5 A;  2KCM A;  2VQE Q;  1JQY D;  1HA6 A;  5EPL A;  4JCV E;  3NHH A;  5J22 A;  3T4A C;  3PO3 G;  4YCW A;  4A3J B;  1SFO B;  2C5C A;  4JV5 Q;  1NMG A;  2F0D A;  4Q0F A;  1PMR A;  4JBK A;  2PMZ E;  2EYO A;  2F4I A;  2K04 A;  2PYK A;  1VQK A;  1RTN A;  5D65 A;  4IFD J;  2RSN A;  3K5M A;  4LW1 A;  1Y8N B;  2NZ1 D;  5DLQ E;  2HHH Q;  1TWG H;  5C0X J;  5C3W A;  4WJ4 A;  4DK1 A;  2FJ2 A;  4C3J H;  1F9S A;  3H15 A;  4KHP L;  4GN4 B;  1XX8 A;  3EN2 A;  1I4R A;  2ZXR A;  1IW7 D;  1TWG B;  4BBS B;  3H3V C;  4A93 H;  1KL9 A;  1VQ8 A;  4A3L H;  3MXG A;  1MIU A;  3E3X A;  2KOL A;  3E5S A;  1UE7 A;  2N3S A;  3D4R A;  5BR8 Q;  4B9X A;  1H95 A;  4UP7 A;  1H9R A;  1HJP A;  1SYB A;  5IT9 c;  3S2H H;  1J9O A;  5EKL A;  4JI3 Q;  1A0I A;  1CFM A;  1NMF A;  3K58 A;  4LJZ C;  1K83 H;  4A4I A;  4YHH Q;  5TSS A;  4RFB A;  4A3F H;  1KC8 C;  2JJQ A;  2UUA L;  1A6X A;  3U9S A;  4GS3 A;  5JJZ A;  3RLF A;  1CKN B;  4R9W A;  2FHT A;  5EPJ A;  1BCP D;  5LL6 S;  2HQE A;  3TRE A;  4L5S A;  4C3I B;  3BZK A;  1PTO F;  1QNU A;  4LF5 L;  3CPW A;  5COY A;  1BOS A;  1EZ6 A;  2MFI A;  1KDB A;  2D9U A;  5IY0 A;  3I55 A;  3G6J B;  1P16 A;  4X3K A;  5CV6 A;  2E5L Q;  3M7N A;  1CUK A;  1LTT D;  2BDN A;  1MD2 D;  2RHS B;  2CVR A;  4JPB W;  1SXT A;  3MXN A;  4OIK A;  4POG A;  4CKC A;  2B2Y A;  4DV4 Q;  2D0O A;  1U4M A;  1IKL A;  1Z47 A;  3OTO L;  5C0X H;  4JI3 L;  3HKZ B;  3AQQ A;  2A8V A;  2E2J B;  1E2V A;  1I50 B;  1UUP A;  1DYQ A;  2A6E D;  2WAC A;  1X65 A;  1U4P A;  2CH4 W;  5GAH C;  1SE4 A;  2L0C A;  4J8Q A;  4DUY Q;  3C46 A;  5C4H A;  4ABN A;  1V9P A;  1I4Q A;  2KUM A;  1F77 A;  1STN A;  2A73 B;  3I4O A;  3EA6 A;  1K28 A;  2BCO A;  4BY7 B;  2RVL A;  3A8I E;  2R7Z G;  1JWU D;  3L7Z C;  1XJV A;  3TZD A;  3J7Y W;  1DXM A;  1QUQ A;  4GOP A;  3HKZ G;  4DUZ L;  2Q8T A;  1PH9 A;  1VQE A;  3C1F A;  2F0L A;  4PG3 A;  1WFQ A;  1TWH H;  1PRT F;  1CA6 A;  5M5W B;  1PA6 A;  1SEB D;  4XT3 B;  3M3Y B;  1CZG A;  1KDC A;  4FXD A;  4K2L A;  4JI6 Q;  3G6E A;  1KXL A;  2XWB B;  5CBA E;  3H94 A;  1F2Z A;  5M3M B;  4KI0 A;  1ESF A;  4H7B A;  2Z0S A;  1SR3 A;  2N49 A;  3KF8 B;  4FXG C;  2VQE L;  5ELB A;  2EYJ A;  4HED A;  4A3B G;  1GKH A;  3FKI H;  3VR6 A;  2MO0 A;  2E75 C;  4JYA Q;  2O5I C;  2SNS A;  3S14 H;  1V43 A;  4MTN A;  3MFG A;  1IBM L;  1Q12 A;  3I3C A;  3RUZ A;  2CH4 A;  4O42 A;  5CV5 A;  4DV1 Q;  4IO9 A;  5IYD G;  2ZXP A;  1STH A;  2QCP X;  4IUT A;  4DU9 A;  1Y8O B;  2BH2 A;  3H0G B;  1FJG Q;  2SNM A;  4QY7 A;  1XMO Q;  1EY4 A;  1D5M C;  1NSN S;  3J81 c;  1BCP F;  2EDG A;  1QE6 A;  3I4N G;  3TN2 A;  3J7Z C;  5IE8 A;  3RZO B;  3GTL B;  1F2M A;  1SYF A;  2J4X A;  3S1R B;  2I5M X;  1FVI A;  1SYD A;  4QMG A;  2KEC A;  1QVC A;  1ICF B;  3IL8 A;  4B3S Q;  5LMN W;  2HCI A;  3MA2 B;  3SHL A;  3V05 A;  3NBI A;  3SDZ A;  4C3J G;  3HOV B;  3W2D A;  3K59 A;  1N36 Q;  2JA7 H;  4HCS A;  4DR6 L;  4CJ2 C;  3M9B A;  2H1E A;  2ID0 A;  1WTX A;  3D0F A;  4UPA A;  3HOX G;  4O1N A;  1PHJ A;  2PNR C;  4WJW A;  3C3L A;  3M4Q A;  2WAQ B;  1N32 L;  2YTV A;  2BA1 A;  2JE6 I;  1F2L A;  2IJ0 A;  3F2C A;  1D5Z C;  5C4J B;  1YHA A;  1Q1E A;  2L12 A;  3HOU H;  4E6I A;  2KEN A;  1PFM A;  1JJC B;  2B2W A;  3J81 L;  1JMC A;  1VQD A;  3I4M B;  1MHW C;  3BZC A;  1SSO A;  3ND9 A;  3AEV A;  4LF7 Q;  3K7A B;  1O7L A;  1EY9 A;  1B44 D;  1PRT B;  3D6W A;  1H9S B;  1L0X B;  1HZA A;  2VXW A;  1TXY A;  2F0P A;  4OX9 Q;  2SEB D;  5EKI A;  4POF A;  4DR4 Q;  5FLX L;  1HTL D;  3EJI A;  4PZ7 A;  4N8F A;  1II3 A;  1SYG A;  1VQ5 A;  1ENF A;  1F9R A;  3HEJ A;  2MO1 A;  5LMU L;  4IJL A;  3M4O H;  2QGQ A;  4A93 B;  2JA5 B;  4KY6 A;  3K7U C;  5ELE A;  1N33 Q;  4BXX H;  2OQ0 A;  1PH1 A;  3M4O B;  3EIV A;  3PO2 G;  1PZJ D;  2JA8 H;  1HNX L;  1NAP A;  3S2D B;  4X64 L;  3I4L A;  2DY8 A;  4RG1 A; 
#chains in the Genus database with same CATH homology
 2WII B;  3T16 A;  1MI2 A;  4G7H C;  1EIH A;  2K5W A;  4TRD A;  5C5L A;  4EVO A;  2X6G A;  5T1G A;  1HUN A;  1HCZ A;  3ONA B;  4QIW B;  3R8B A;  4IUV A;  2Q8I B;  5K5P A;  3PUZ A;  3D4D A;  4KHZ A;  2F0K A;  3J80 E;  4KD3 A;  4F8M A;  1HFN A;  3S16 B;  3GTJ B;  5IGE A;  4ZKC B;  5DM6 3;  2PW5 A;  2L5T A;  2F3V A;  3I72 A;  1TY0 A;  2M00 A;  3GQB A;  1ET6 A;  2BDO A;  2PZU A;  2NN6 G;  3FPU B;  3NXW A;  2R7Z B;  2AQ1 B;  4EGV A;  4C3H G;  1GUT A;  3PUY A;  3A56 A;  2WKC A;  1EYC A;  1PRT C;  3NTK A;  5NUC A;  1ICW A;  5F2D A;  5FLX E;  1QB5 D;  4C1N K;  3M7G A;  3SVM A;  3CHB D;  4V19 0;  3A55 A;  1FNU A;  1EY7 A;  1Y1V B;  3VR3 A;  1DOM A;  1Z7T A;  1G2S A;  3QWN A;  1H9S A;  1JC7 A;  3PO3 B;  3TDQ A;  3D31 A;  2R93 B;  3ITP A;  4C3I G;  1AZP A;  1PTO B;  5KYI A;  2K5D A;  3K0Y A;  2F0G A;  1FNW A;  2ICI A;  2K5Q A;  3K5L A;  2ZT9 C;  1B53 A;  4RHS A;  1ESR A;  3J7A F;  3NQT A;  3KLR A;  1BCP B;  4KKU A;  1JWM D;  5KGU A;  2IX1 A;  4N9T A;  1TVX A;  1BCP C;  4ZUJ A;  5C4X B;  5A35 A;  3FPP A;  1CQV A;  1KTK A;  4HN7 A;  4G4K A;  1I4P A;  1E2W A;  3A8K E;  1ENA A;  5CV7 A;  1S5B D;  1VMC A;  1SBB B;  1PFN A;  2I46 A;  3S2H B;  3AU7 A;  1SYE A;  2K1B A;  1SNC A;  1R9T B;  3DWQ A;  4IZ8 A;  4K5V A;  2LMC B;  2A69 D;  4ULL A;  1EOT A;  1RF2 D;  5J39 A;  2EE1 A;  1WD0 A;  4BA2 I;  1SNQ A;  1I6V C;  2ICE C;  3VYR A;  2OF1 A;  4PV1 C;  4IFD G;  1LTB D;  5I2Y A;  4A3B B;  3T51 B;  5EJW A;  3S1N B;  2IX0 A;  3URY A;  1MSH A;  1DZ1 A;  4U67 3;  1VDZ A;  4TQU S;  1RDP D;  2RSO A;  5FO7 B;  4LAA A;  4ZLT F;  1VCI A;  5M5X B;  1I4G A;  1WVL A;  3DUZ A;  4A3D B;  1KLG D;  2NYZ D;  1STY A;  3H09 A;  3HOU B;  1FYC A;  4MN3 A;  5FK9 C;  3U9O A;  4A3K B;  5ELC A;  5FO8 B;  5IGC A;  2LKV A;  4H13 C;  3HS0 C;  2OEO A;  1WTR A;  3QB3 A;  4DNR B;  1EEF D;  2YYZ A;  4FNF A;  4R8I A;  4K5W A;  1BDO A;  3SEB A;  1K8M A;  2Z4I A;  4NDX A;  2AUJ D;  4CJ0 B;  2RQX A;  2GA4 B;  2XVS A;  1G2T A;  2D62 A;  4HCE A;  4B08 A;  2JEB I;  2HDL A;  3DEO A;  3KLS A;  1QNK A;  2YU9 B;  1IW7 C;  4C2M B;  3NUC A;  1GUS A;  5FKA C;  1HQM C;  3O13 A;  5M9O A;  1NR4 A;  3SK5 A;  2QEJ C;  1A2T A;  1EYA A;  2NBF A;  4XXE A;  1STB A;  3JAM L;  4HAE A;  2V4D A;  2SDF A;  2KQ3 A;  1J8I A;  1WTW A;  3NWS A;  1A2U A;  2AUK A;  4XDX A;  4RCO A;  1Q8I A;  2A6E C;  1S5E D;  2EY1 A;  5E1F A;  4DK0 A;  5G3L F;  4BWG B;  3FDT A;  3Q0A A;  2F0V A;  3D6C A;  4J6H A;  3MVV A;  3BDC A;  3VR2 A;  1CT1 D;  1DM0 B;  5D3D A;  3FVQ A;  4QB4 A;  4M1U B;  3TP8 A;  5JVG 3;  1D6E C;  1EQV A;  2EY5 A;  3BDL A;  1PTO H;  1IYV A;  4RGN A;  1MSG A;  1AN8 A;  4QF4 A;  1F9P A;  2PQE A;  2WIN B;  1VMP A;  2K28 A;  2MHV A;  3LX0 A;  1A3U A;  5JEA H;  4DXG A;  3OIQ A;  1YNN D;  1JIC A;  3P1H A;  5I4D A;  4OIJ A;  3Q23 A;  4XQQ A;  3BS1 A;  5HUR A;  3V2T A;  4PMW A;  2E76 C;  3S15 B;  3SXH A;  2RBM A;  4F7X A;  3MXU A;  2X69 A;  3I73 A;  4FF2 A;  1O7Y A;  3BVM A;  4I65 A;  2F0Q A;  3N6R A;  4RKB A;  4K8I A;  1H9K A;  1IYU A;  2EYL A;  1I4H A;  3QO2 A;  1EY5 A;  2AWO A;  2IW3 A;  3QG1 A;  3VA7 A;  2F0W A;  2EYP A;  2B2U A;  1NCV A;  1V1P A;  3R3O A;  5FOB B;  2JSO A;  4EQO A;  1JOR A;  4BBR B;  3EFX D;  5I6W A;  1DCZ A;  4KK7 A;  1WTP A;  2MPM A;  3IFD A;  3MEH A;  4KTA A;  1JWS D;  1HXY D;  4OO1 G;  4H0L C;  3TP5 A;  1ONL A;  3D8G A;  5JEA J;  3IAY A;  2IT1 A;  3VR5 A;  4EQP A;  2MGS A;  1OXU A;  3NWT A;  5C0X G;  1ZYR D;  2RDF A;  3HGB A;  2DNC A;  2LY7 A;  4DAY A;  5KND A;  4OHJ A;  4KJO A;  3MFY A;  3HP3 A;  1PTO D;  1WTO A;  3GTG B;  1STA A;  5J1Z A;  4QCL A;  5AFW A;  2QF7 A;  1EU3 A;  2F0J A;  1AZQ A;  4ME5 A;  2R3Z A;  1LTR D;  4C3H B;  1EU4 A;  1I6H B;  1SNM A;  1AP0 A;  5EQ0 A;  3ERQ A;  4XT1 B;  5COR A;  1EY8 A;  2XN9 C;  4HMJ A;  1ENC A;  5C44 B;  3L3O C;  2J0T D;  2R61 A;  3MWY W;  2XWJ B;  1IHZ A;  2KHS A;  5CYU A;  4DF7 A;  4MIU A;  4JBW A;  2F0F A;  2QDB A;  2FMC A;  4JK1 C;  2TMP A;  1FR3 A;  3C1E A;  3HG9 A;  2KEE A;  3OW7 A;  3WDN A;  5C6A A;  5IT9 E;  3S17 B;  1OXS C;  3MHB A;  3D4W A;  4FO2 A;  1SAP A;  3GTP B;  1PFB A;  4NW2 A;  1S5C D;  1X32 A;  5C0X I;  1O78 A;  1AEX A;  1HA5 A;  3ZYY X;  1Q1B A;  1LLR D;  4RAU C;  4X3T A;  4PMC A;  1VF7 A;  4XQN A;  1LT5 D;  2AQ3 B;  3DXJ C;  4TSS A;  4OO1 I;  1BR9 A;  1SMY D;  3FKI B;  3CQZ B;  5KEE A;  4IUQ A;  2O5J C;  3LWE A;  3Q24 A;  1UNS A;  1KNA A;  3J7A V;  5IGF A;  4PNY A;  4RH6 A;  2IX3 A;  3GP7 A;  5CV9 A;  4DAP A;  3TZU A;  3T13 A;  2F0O A;  5C5M A;  1B9M A;  3E6Z X;  2EYH A;  4CJ1 B;  2K33 A;  1K8O A;  3CU7 A;  2QIL A;  1LT4 D;  3BDO A;  2AWN A;  3A54 A;  4K14 A;  5KNB A;  1JOK A;  3BYY B;  3CRL C;  4C1N I;  3I4N B;  1TII D;  3R2T A;  2IPK D;  3SK4 A;  1HUM A;  5I2X A;  1FGB D;  4KKT A;  3DM1 A;  2FMM A;  2LS0 1;  2HUG A;  3HOX B;  1QCB D;  4J1M A;  3UI2 A;  4FF1 A;  4XTC S;  2O2L D;  3Q22 A;  4A3G B;  4WFN 3;  4CKE A;  3PO2 B;  1LT3 D;  2IL8 A;  1B3A A;  2NVY B;  2EJF C;  3PUV A;  1TY2 A;  1KAB A;  3NQI A;  1QG7 A;  1A3V A;  1W6K A;  1TS3 A;  1LTS D;  1YNJ D;  3OMG A;  3I8Z A;  5CC4 A;  2CQA A;  2F1M A;  3TSS A;  2NTS A;  2A74 C;  5DAU A;  1IL8 A;  3VA5 A;  1S5F D;  1SYC A;  4NMZ A;  2K01 A;  3DEP A;  2B2Y C;  2F0M A;  4X3U A;  2EJG C;  1ILP A;  1S4Z A;  4FF3 A;  2B2V C;  4XYQ A;  2F0E A;  1RKN A;  1H9M A;  2JP1 A;  2B2T A;  3H91 A;  1QJO A;  1JOO A;  1GUG A;  2LFN A;  1G29 1;  2L55 A;  5EBD A;  1XYI A;  2PMZ B;  1LT6 D;  1DD2 A;  2B2W C;  4ZRZ A;  3A8J E;  4LK1 C;  4RGO S;  2R92 B;  4I7Z C;  3OPO A;  4WRD A;  1U4R A;  1GUN A;  1HFG A;  1SE3 A;  1BQQ T;  1GXD C;  3S9W A;  4HTH A;  1RD9 D;  5I9P A;  3PV0 A;  2IWH A;  1M8A A;  1KDA A;  5KIX A;  1KAA A;  3OWE B;  3D3R A;  2RDG A;  2N88 A;  5ELD A;  4FXK C;  1B9N A;  2M2L A;  1TS4 A;  3LNN A;  2NVT B;  2FIN B;  2EY6 A;  1CHQ D;  1RHP A;  1TWA B;  5K36 G;  2G9H D;  2F0T A;  2I07 B;  2XRQ D;  3VYS A;  1C4Q A;  1TWH B;  3HOY B;  5D3I B;  1E2Z A;  2WB1 B;  1UAP A;  2K7V A;  4X3S A;  3IKJ A;  2DN8 A;  5C4Z A;  1UEA B;  3MAQ A;  3PIO 3;  4K6L A;  2SOB A;  4FF4 A;  1T5E A;  1G6Z A;  5E3F A;  1MGS A;  2L4N A;  2F0N A;  3R93 A;  2NB0 A;  1T5X D;  1Q90 A;  1V8Q A;  3MC0 B;  1LAC A;  4L63 B;  4ILW A;  1HQR D;  1GUO A;  4IUP A;  2N55 A;  2PZW A;  2NTT A;  2B2V A;  5T1I A;  5KRU A;  3NP8 A;  3NTI A;  1CQF A;  4RWS C;  1A3T A;  1D5X C;  5JAV A;  2F0I A;  5A2Q L;  3GV3 A;  1EWC A;  1WTQ A;  1OXX K;  1BBX C;  1X3P A;  3SK6 A;  4UDU C;  2VB2 X;  2KVM A;  1TWC B;  1C8C A;  3ERO A;  3I91 A;  2O4X A;  2E2H B;  2E2D C;  1MBY A;  4IN3 A;  2EXZ A;  4IAL A;  2EZV A;  4Q5V A;  2PW7 A;  1KNE A;  2EOT A;  1HHV A;  1LTA D;  4IUU A;  3KK7 A;  4FYD A;  2NN6 I;  4RA8 A;  1B2T A;  2JA6 B;  1H9J A;  2HDM A;  4C56 C;  1DOL A;  4FP5 D;  3W3A A;  2NWG A;  4DN4 M;  1STG A;  2B39 A;  2B2U C;  4L8J A;  5CMD A;  1AFP A;  1HRJ A;  2G9D A;  1EWH A;  3X3N A;  4KMU C;  3SE0 A;  4H44 C;  3T56 B;  3BG3 A;  2TSS A;  1TS2 A;  1D2B A;  4BY1 B;  4L6T B;  1ZKO A;  5CGK A;  2OXP A;  4CGY B;  3KF8 A;  1STE A;  3N52 A;  1PZK D;  2A6H C;  5E4X A;  1BF4 A;  1GJX A;  2EYM A;  5IOD A;  2D5D A;  3S14 B;  3I90 A;  4OL7 A;  1Y8P B;  1Q3L A;  2AQ2 B;  3KBX A;  3E0J A;  3LWU A;  2Y0S B;  4IUN A;  2XNA C;  2F3W A;  3GV6 A;  2X6L A;  4B9W A;  5G3L D;  3OSO A;  4K6D A;  4R8N A;  4QUF A;  1JE4 A;  3QJY A;  1VF5 C;  1G91 A;  1B1Z A;  4IFD I;  3A7A B;  2DNE A;  1TR5 A;  3PIP 3;  4N9P A;  4QUC A;  5E4W C;  5CBE E;  2JA7 B;  1C48 A;  3PUX A;  3MZ5 A;  2B8G A;  1CM9 A;  3OIP A;  5EGT A;  1DON A;  5EPK A;  1LV9 A;  3DWA A;  1BUV T;  3QOJ A;  4HMI A;  4G7O C;  5I9O A;  2NN6 H;  2B8F A;  5LL6 X;  3A7L A;  4K2K A;  4HR7 B;  2BE5 D;  2NUC A;  1LTI D;  5BN4 A;  2L9H A;  3L9A X;  1EY0 A;  2QKI C;  1O7Z A;  4KV6 A;  2A6H D;  1JB3 A;  3MXP A;  5CV4 A;  3S1Q B;  4RCN A;  3G7L A;  4RGM A;  4XIG S;  3OOC A;  2J7Z A;  3EQL C;  2CHB D;  2A68 D;  2KJX A;  3GO5 A;  4ZUI A;  2NVX B;  2MP1 A;  1I3Q B;  3WOE A;  4XYO A;  1ML0 D;  3QOL A;  1TT2 A;  5IGG A;  4CBV A;  3NTH A;  4ZK9 B;  1JR0 D;  3K5N A;  3EVQ A;  4U68 A;  1TU2 B;  1DOK A;  4FVM A;  3VYU A;  4HSV A;  4GZY C;  1FD7 D;  4BA1 I;  1HTP A;  1WCM B;  5IGB A;  3PUW A;  1TQO A;  1JCK B;  4A3F B;  3HOZ B;  5CV8 A;  1R4Q B;  4HSP A;  3HOW B;  1EYD A;  1Y1W B;  1SMY C;  2FFK B;  2XRS D;  4CKB A;  4F87 A;  3OMC A;  2A68 C;  3SR1 A;  3R2I A;  1ZEQ X;  5IGD A;  3GTQ B;  4Y7N B;  3NE5 B;  5M3F B;  5JVH 3;  4C3J B;  4DAV A;  3CRK C;  3VR4 A;  5LHY 1;  1CHP D;  4TKO B;  2VB3 X;  2XIW A;  3KBG A;  2PCF B;  2PO4 A;  3S1M B;  5KNC A;  3VYT A;  2EYF A;  3J81 E;  2KED A;  2VUM B;  3OWF A;  2Q8R E;  3DHQ A;  1F9Q A;  3P75 A;  2Z4H A;  2E74 C;  1LTG D;  1CZW A;  1WD1 A;  4YIJ A;  1FNV A;  3H6M A;  2EPB A;  4BS9 A;  2M9V A;  5IIF A;  1PLF A;  2B2T C;  3P20 A;  4DFA A;  3X3M A;  1ROD A;  3GTK B;  2R6G A;  3KUP A;  4A3I B;  1CTM A;  2WV6 D;  2BA0 A;  1SNO A;  2L1B A;  5HGT A;  4OGQ C;  5ISR A;  3CKI B;  2Z8L A;  1PXU A;  1XXG A;  1PDQ A;  5ELF A;  3QIA A;  3HRZ C;  4RHR A;  4A3M B;  1X3Q A;  1ZXT A;  4G7Z C;  2K6A A;  1V1P B;  2JXM B;  5M5Y B;  1EZ8 A;  1U4L A;  4EQN A;  1L0Y B;  4RGT A;  5BN3 A;  3I70 A;  1EQT A;  1SND A;  1Y69 U;  4IUR A;  3RD4 A;  2MUY A;  1EY6 A;  4K8J A;  3TBI B;  4KKS A;  1TS5 A;  3Q6S A;  1XWE A;  2WKD A;  1GOZ A;  1I4X A;  1LO5 D;  2C9O A;  2NVQ B;  4V0B A;  3DWP A;  1AW7 A;  2RDH A;  1ZYR C;  1G8Z D;  3DMU A;  3P7J A;  3M85 A;  2PPB C;  2XSC A;  1K83 B;  3K6O A;  2KCC A;  3BZD B;  4NKL A;  4PQX A;  3NSW A;  1YNJ C;  5D14 A;  2E2I B;  5JPN C;  3TP7 A;  4KN7 C;  1QOH A;  4AYB B;  1S5D D;  1RCV D;  5JEA G;  3NBH A;  5C3E B;  4KY5 A;  3AB9 A;  2MJ8 A;  2HCC A;  2F0H A;  2L11 A;  1O80 A;  1U9R A;  4DA2 A;  4P2C B;  4ZQ3 A;  4DGZ A;  4CHT B;  1E0B A;  1M4V A;  1JOQ A;  2OT2 A;  3BVZ A;  3AMU A;  1SJE D;  3FRP B;  2CW0 C;  5KYL A;  2ZXO A;  3FEW X;  2H4O A;  2D2C C;  2KCN A;  1RTO A;  3FMC A;  3OHX C;  4A3E B;  1SNP A;  4KHV A;  1V1O A;  2EVB A;  4M8A A;  3M4Y A;  1YNN C;  5BN5 A;  1EFI D;  3NK9 A;  3RMH A;  1TKW B;  4XQJ A;  2JEA I;  1IKM A;  4IQZ A;  1W6J A;  2F0S A;  2K03 A;  3MTS A;  3KLS X;  1B50 A;  4ODG A;  2BE5 C;  2F03 A;  1R4P B;  2K32 A;  4KN4 C;  5DEH A;  1ILQ A;  2ENB A;  1RJT A;  2JYO A;  1EIG A;  2DY7 A;  1CI3 M;  4IFD H;  4F88 A;  1D1K A;  2EY2 A;  4OO1 H;  1PTO C;  2F0U A;  2PZT A;  4S3S A;  5C3X A;  3GD7 A;  2RKS A;  3GTO B;  1EL0 A;  5JPM C;  1PZI D;  4PMB A;  3PMF A;  2WP8 J;  2KA7 A;  4RKL A;  1DJR D;  3TP6 A;  1ET9 A;  2RA4 A;  4ZYS A;  1EEI D;  4DNT B;  1HPC A;  4ID6 A;  1CA5 A;  1OO9 B;  3K5O A;  4MHE A;  4UAI A;  2B63 B;  4ZKB B;  1LAB A;  1OXV A;  1Z6H A;  5I6Y A;  5DM7 3;  1SE2 A;  3BYT B;  1OXT A;  1XTC D;  1TWF B;  3ND8 A;  1PYW D;  1D1I A;  1QIL A;  4KD4 A;  1A15 A;  4WOR A;  3C2P A;  1PRT D;  2EJM A;  3IFT A;  5EKK A;  1GHK A;  1NUC A;  3WOF A;  5EBC A;  4ZAI A;  4K5X A;  4NP5 A;  1WTV A;  3SK8 A;  2A5H A;  5FO9 B;  4G57 A;  1QWY A;  3JAM E;  2BOS A;  1BXT A;  4DXF A;  2JA8 B;  1B4O A;  1GUW A;  1SJH D;  1SDF A;  3T53 B;  5IT9 L;  3J80 L;  3V96 A;  2VNU D;  4LMQ D;  3GTM B;  1BO0 A;  2Z1C A;  1BNZ A;  5K36 H;  3K57 A;  3BVG A;  3F2U A;  1CK1 A;  3TME A;  4KJN A;  5IOC A;  1KLU D;  4Z9C B;  5JOB A;  5CR3 A;  1GHJ A;  1F2Y A;  3HZX A;  4KY7 A;  5DNF A;  2CW0 D;  5A2Q E;  2A69 C;  1NR2 A;  3RZD B;  2K05 A;  3NPP A;  1JQY D;  1HA6 A;  5EPL A;  3NHH A;  5J22 A;  3T4A C;  4A3J B;  1SFO B;  2C5C A;  2F0D A;  4Q0F A;  1PMR A;  2EYO A;  2F4I A;  2K04 A;  2PYK A;  1RTN A;  5D65 A;  4IFD J;  2RSN A;  3K5M A;  1Y8N B;  2NZ1 D;  5C0X J;  5C3W A;  4DK1 A;  2FJ2 A;  1F9S A;  1XX8 A;  1I4R A;  2ZXR A;  1IW7 D;  1TWG B;  4BBS B;  3H3V C;  3MXG A;  2KOL A;  3E5S A;  3D4R A;  4B9X A;  1H9R A;  1SYB A;  1J9O A;  5EKL A;  1CFM A;  3K58 A;  4LJZ C;  5TSS A;  4RFB A;  1A6X A;  3U9S A;  5JJZ A;  3RLF A;  4R9W A;  2FHT A;  5EPJ A;  1BCP D;  5LL6 S;  2HQE A;  4C3I B;  1PTO F;  1QNU A;  5COY A;  1BOS A;  1EZ6 A;  1KDB A;  2D9U A;  3G6J B;  5CV6 A;  4X3K A;  3M7N A;  1LTT D;  2BDN A;  1MD2 D;  2CVR A;  1SXT A;  3MXN A;  4OIK A;  4CKC A;  2B2Y A;  1U4M A;  1IKL A;  1Z47 A;  5C0X H;  3HKZ B;  2E2J B;  1E2V A;  1I50 B;  1UUP A;  1DYQ A;  2A6E D;  2WAC A;  1U4P A;  1SE4 A;  2L0C A;  4J8Q A;  3C46 A;  5C4H A;  4ABN A;  1I4Q A;  2KUM A;  1F77 A;  1STN A;  2A73 B;  3EA6 A;  2BCO A;  4BY7 B;  2RVL A;  3A8I E;  1JWU D;  3L7Z C;  3TZD A;  3J7Y W;  1DXM A;  2Q8T A;  3C1F A;  2F0L A;  1PRT F;  1CA6 A;  5M5W B;  1SEB D;  4XT3 B;  3M3Y B;  1CZG A;  1KDC A;  4FXD A;  4K2L A;  2XWB B;  5CBA E;  3H94 A;  1F2Z A;  5M3M B;  4KI0 A;  1ESF A;  4H7B A;  4FXG C;  5ELB A;  2EYJ A;  4HED A;  3VR6 A;  2E75 C;  2O5I C;  2SNS A;  1V43 A;  3MFG A;  1Q12 A;  3I3C A;  3RUZ A;  4O42 A;  5CV5 A;  2ZXP A;  1STH A;  2QCP X;  4IUT A;  4DU9 A;  1Y8O B;  3H0G B;  2SNM A;  1EY4 A;  1D5M C;  1NSN S;  1BCP F;  2EDG A;  1QE6 A;  3TN2 A;  3RZO B;  3GTL B;  1F2M A;  1SYF A;  2J4X A;  3S1R B;  1SYD A;  4QMG A;  2KEC A;  3IL8 A;  2HCI A;  3MA2 B;  3SHL A;  3V05 A;  3NBI A;  3SDZ A;  4C3J G;  3HOV B;  3W2D A;  3K59 A;  4HCS A;  4CJ2 C;  2H1E A;  2ID0 A;  1WTX A;  4O1N A;  2PNR C;  4WJW A;  3C3L A;  2WAQ B;  2BA1 A;  2JE6 I;  1F2L A;  2IJ0 A;  1D5Z C;  5C4J B;  1Q1E A;  2L12 A;  4E6I A;  1PFM A;  2B2W A;  3J81 L;  3I4M B;  3ND9 A;  1SSO A;  3K7A B;  1O7L A;  1EY9 A;  1B44 D;  1PRT B;  3D6W A;  1H9S B;  1L0X B;  2VXW A;  2F0P A;  2SEB D;  5EKI A;  5FLX L;  1HTL D;  3EJI A;  1II3 A;  1SYG A;  1ENF A;  1F9R A;  3HEJ A;  4A93 B;  2JA5 B;  4KY6 A;  5ELE A;  3M4O B;  1PZJ D;  1NAP A;  3S2D B;  3I4L A;  2DY8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...