5EJWA

Crystal structure of chromobox homolog 7 (cbx7) chromodomain with ms351
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
80
structure length
80
Chain Sequence
HHSSGLVPRGSHMELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEERDRASG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/inhibitor
molecule keywords Chromobox protein homolog 7
publication title Structure-Guided Discovery of Selective Antagonists for the Chromodomain of Polycomb Repressive Protein CBX7.
pubmed doi rcsb
source organism Mus musculus
total genus 21
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2015-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5ejwA00
1TVXA 3D6WA 3I90A 1JICA 2K01A 3LWEA 2HUGA 1CA6A 1X32A 1SDFA 1PFNA 2NWGA 1DOMA 1KNEA 1QNKA 4UAIA 4XDXA 1HRJA 1RODA 4RA8A 3IL8A 4XT3B 2KEDA 3ONAB 4HSVA 1PFBA 1SAPA 4MHEA 4CJ0B 1VMPA 3GV3A 2VXWA 2B2TA 2HCCA 2KEEA 1U4PA 3N52A 1B2TA 2B2TC 1F2LA 1XYIA 3FDTA 4HCSA 1J8IA 1PFMA 1MI2A 3DEOA 1AP0A 2RVLA 1NAPA 1RTNA 2H1EA 1F9RA 5COYA 2JP1A 2L11A 1WTVA 1WD1A 1EIHA 1F9SA 4X3SA 4CJ1B 2FMMA 2KVMA 4ZKCB 2SDFA 1EL0A 1G2TA 1BNZA 1QE6A 4X3TA 2RSNA 2L4NA 1M8AA 1HA6A 3P7JA 1AZQA 4DN4M 1DZ1A 4NW2A 1F9QA 2D9UA 2J7ZA 2JYOA 4IUPA 1G2SA 1RTOA 3I91A 2X6GA 3TZDA 1RJTA 3IFDA 5EJWA 1U4MA 1F9PA 1CM9A 1ICWA 2BDNA 2FINB 2X6LA 5CBAE 2DY7A 5EPJA 1ZXTA 1B4OA 1IKLA 2N88A 2K05A 1DONA 3KBXA 4IUVA 1HUMA 1JE4A 1SSOA 1MSGA 4RWSC 4MN3A 5D65A 1EIGA 2NZ1D 3QO2A 3SVMA 1LV9A 4RAUC 1WTWA 2B2VA 4ZAIA 2FFKB 4IUUA 2B2VC 2DY8A 2MP1A 4ZLTF 1PLFA 1WTQA 1O7YA 2B2UA 4IUTA 5EKIA 4LMQD 4QUCA 4X3UA 4ZKBB 2B2UC 1ILPA 5E4XA 1DOLA 1U4LA 3UI2A 2Q8TA 1GUWA 1HFNA 1X3PA 2EPBA 3F2UA 1HUNA 1QG7A 2B2YA 2N55A 4HEDA 1G91A 5JJZA 5D14A 2B2YC 2K28A 1C8CA 2KUMA 1HHVA 5EPKA 1G6ZA 1NR2A 1KNAA 2KECA 1XX8A 1PDQA 2Q8RE 4IUQA 4OIKA 4OIJA 1EQTA 3KUPA 1U4RA 1E0BA 2K03A 2M2LA 1Q3LA 1WTOA 2HDMA 3MWYW 1NCVA 4O42A 4CJ2C 1ESRA 5CMDA 2HCIA 1ILQA 1O80A 1J9OA 1BO0A 5DNFA 1WD0A 2B2WA 1O7ZA 1S4ZA 2B2WC 1X3QA 1B3AA 2XIWA 2NYZD 1B53A 3R93A 2EOTA 1IKMA 3I8ZA 2CVRA 5AFWA 1IL8A 3DM1A 1BBXC 2L12A 4HAEA 2MGSA 4IURA 1AZPA 1MGSA 2K1BA 1A15A 2MPMA 5CORA 4R8IA 3TN2A 3GV6A 2K04A 4XT1B 3H91A 5T1IA 5T1GA 1VMCA 2FJ2A 3G7LA 3Q6SA 2L1BA 5EPLA 3I3CA 1WTPA 2X69A 4X3KA 2EE1A 3FPUB 2R3ZA 4QUFA 1WTXA 2IL8A 4U68A 1EOTA 1CA5A 4R9WA 3MTSA 1NR4A 5EQ0A 3HP3A 2RSOA 1DOKA 3DEPA 4ZK9B 5E4WC 1MSHA 1B50A 1HFGA 1RHPA 1BF4A 1WVLA 1ML0D 2HDLA 5CBEE 2FHTA 1WTRA 2KOLA 2L9HA 2MJ8A 2RA4A
chains in the Genus database with same CATH superfamily
3K8AA 1LT3D 2K5DA 1KXLA 3STBC 3A5ZB 4KHZA 4YHHQ 1TWGB 4KI0A 2ENBA 1OXTA 4EQPA 1DOMA 3PMFA 3T1YL 1BXTA 4F87A 4IOAA 3ONAB 4P73A 2WV6D 3TP6A 4JI1Q 3R8BA 4R4CA 4OX9L 1W6JA 1NY4A 2KEEA 3OOCA 1WJJA 3K5OA 4RKBA 2OCEA 5IP7H 4LNQA 1F9SA 5EBDA 3S17B 4KD4A 3ER0A 5ELOA 3EROA 5C4JB 4FDBA 3KDFB 3PGZA 2JQOA 1DCZA 4X66L 1HNXL 4C1NK 3F1ZA 3RNUA 1ICWA 1SE8A 2J0TD 2KA7A 4KHVA 5IOCA 2F3VA 4OGQC 2MFIA 1JE4A 4R8NA 4ODGA 4DV7Q 3NWTA 4H44C 2FFKB 2A5HA 3S9WA 3T1HL 1YJNA 3EN2A 3RZOB 3AFPA 4JI7L 4ZKBB 4QL5A 3C1FA 1H9MA 5EKLA 1JORA 1N36L 2PZWA 1N34Q 1ENFA 2JA5G 1TWFB 1I6VC 3SK5A 4FP5D 4HIMA 3D0FA 5C0XJ 1LT4D 1PHJA 2JXMB 1VQ7A 5LMUL 1V1OA 4A3FG 5C4XH 1PH2A 2EY2A 3NUCA 3CCMA 1V1PA 4YCWA 5C0XG 1IL8A 5KNDA 3DM1A 5GAGC 1TU2B 2FXQA 1B3QA 4K8IA 2L15A 1D5ZC 1UE7A 2PQEA 1TY0A 3Q22A 5JPNC 1NUCA 3CKIB 3FEWX 3VA7A 1PZJD 1VS0A 3H3VI 3OSOA 1YNND 5M3MH 4H0LC 4DV2Q 3I55A 1DOKA 3QOJA 2WACA 1CKMA 3O13A 1EOVA 3DMUA 2HDLA 1V1QA 3A74A 5CBEE 2AQ3B 4A93H 4S3SA 1EQQA 1F2ZA 5KYLA 3J81c 4A3FH 3U58A 5C44B 4OONA 1RODA 2J4XA 1CK1A 3IL8A 1HNWL 3OWFA 4K0KQ 4HSVA 2JN4A 2E8GA 1X6OA 2DNEA 4FXKC 4DV1L 4RGOS 2B2TC 4IPCA 2MHVA 2RVLA 3UE1A 3CMAA 3KLSA 2H4OA 1NMGA 1TS4A 2CW0C 4P75A 4G7OC 1E7ZA 1L2FA 2A74C 1VQHA 4QIWE 4DAYA 3CW2C 2DUDA 3M7GA 1CQVA 4GKJQ 1MHWC 1EZ6A 3TZDA 3MXPA 2XVSA 5K5PA 4JI2L 4IALA 3CCEA 4EQ5A 1R9TH 1B4OA 2UUAL 4JC0A 1JWUD 4P2CB 4HIOA 1XPOA 1OXUA 1CZWA 4ILWA 5D65A 4DKAC 3MAQA 1UE1A 2ZXRA 3L9AX 4A3MG 1HTPA 1JR0D 2YTVA 1Z6HA 2VQFQ 5FLXE 1U4LA 4HJAA 2I5HA 3UDIA 4A3GH 2CKZB 3K81C 3MXUA 1VQOA 4WFN3 3CCJA 4ID6A 2K28A 3FKIB 1NR2A 1KNAA 1MKHA 1YJ9A 3PUVA 1U4RA 2DJFC 3DWPA 2F0KA 1K9MC 2K52A 2F0LA 1I50H 1PRTD 2DJGC 4P74A 2EOTA 1FR3A 4JBKA 2O5IC 4GKKQ 4JI5Q 3HG9A 1HR0Q 4JI6L 2ID0A 1YZ6A 3VYSA 2Q2HA 5D3DA 1I4XA 1JWSD 3TZUA 1VQPA 3H09A 1TS3A 5IY0A 4A3MH 4JI0L 2ATWA 1Y1VH 4QMGA 4TSSA 1H9JA 3VYUA 2ICIA 4R9WA 1LO5D 2F0UA 1D8LA 1R4PB 5ELEA 3HP3A 4A3CG 4RFBA 4CHTB 1NE3A 2ZXPA 3NENA 2HT1A 1BDOA 1LACA 1YHQA 2EY5A 5ELNA 4DNRB 3S2HH 3OW7A 1I3QH 3GTOB 1ZYRD 5FO7B 3GD7A 1X3EA 4DUZQ 4LUVA 3H0GG 1EZ8A 2CQOA 3RZDB 5CV7A 3G48A 4DR1Q 3H6MA 4DR4L 3RN2A 2PPBC 3GTQH 1VQLA 4LFCQ 2A6ED 4C3IB 1JC7A 4A3EG 3ERSX 1PFMA 4ALPA 5A35A 4JI8Q 2WB1G 1XNQQ 1SNDA 4DV5L 4K6LA 2ZJPA 1WD1A 3S1MB 4RGMA 3HOXB 3I72A 1WCMB 1N33L 4OXPA 1SYDA 3SK6A 1B70B 3I4NH 2AQ1B 5FO8B 4DR3L 3CC2A 1XTCD 4A3CH 5A2QE 1D5MC 2BE5D 3IFDA 1R4QB 4JPBW 2HD3A 5DLQE 1ZXTA 2QDBA 4DR7L 1IKLA 5NUCA 1YHAA 4K8JA 2VB2X 4MN3A 3SVMA 5JJLA 2PNRC 3A7AB 3TP5A 4IOCA 4F88A 4JOIA 4B9WA 3H0GH 1VQKA 4LMQD 1JJCB 4QUCA 2OWOA 2XRQD 3L0OA 3CC4A 2QILA 4HJ8A 3VYTA 1K28A 1VF7A 4GN4B 2A8VA 1F2MA 2R92G 4LF7Q 3J80i 5G3LF 1ENAA 1TS2A 4HMJA 5EPKA 2SNSA 4C56C 2KECA 5LHY1 2OEOA 5FOBB 2IWHA 4AQYL 5FLXc 1ESRA 1STNA 4FO2A 2QKIC 5IYBH 1ZEQX 3MXNA 1NBWA 3ND8A 3J80E 4K2KA 2F0VA 3LWUA 1BBXC 1PH4A 1E24A 4YCVA 2AMCB 3PUZA 4B3RL 3J81j 4GNXA 5E3FA 4ZYSA 4KMUC 1AE2A 1PH1A 2A68C 5EPLA 3DM3A 3H94A 3MXNB 3M4OB 1VCIA 1Y14B 4JV5L 1EIFA 4WRDA 1EOTA 4LAAA 1IW7C 2K4KA 2SNMA 2LKVA 5M5XB 1UE6A 1MIUA 3I70A 4LF9Q 2ZM6L 1I5FA 1B50A 1RHPA 1BF4A 1IHZA 2XWBB 4GNXB 1MJEA 1KDBA 4BBSG 5M5WB 2WAQB 2K32A 4FVMA 5C4HA 1EEFD 2VZAA 1VQ8A 3A55A 4YWKA 2B39A 4LF5Q 1HRJA 3BYTB 1KIXA 1D6EC 5CV6A 1K8OA 4UP9A 3PQIA 3W2DA 3EIVA 3KLRA 4KKSA 3S15H 1U5KA 4G57A 2E2DC 1AEXA 3CHBD 1QWYA 2PW7A 1MI2A 1L0WA 1AP0A 2RBMA 1F9RA 1JOKA 2JP1A 2QF7A 5KIXA 1FJGQ 3CPFA 1LTAD 2A1AA 3OTOL 3OW2A 3K7AH 1QE6A 4NKLA 3GDEA 3GO5A 5IGFA 4A3KG 3NTKA 5J22A 2F0HA 5FJ8G 4KD3A 3BG3A 5IGGA 2PZTA 3T1YQ 4C3HH 2IY5B 1F9PA 4N8FA 4BBSH 2MO0A 1C9OA 2N88A 4LF6L 2BE5C 1HUMA 4DU9A 1MSGA 3MA2B 2OQKA 4A3JG 1HA5A 3QOLA 4IUUA 4A3DH 3BVMA 4ZLTF 1SRUA 5TSSA 3F2CA 2IPKD 2AUKA 2G9DA 4H02A 4CDCC 5C0XI 2R7ZG 4FYDA 2F4IA 1FD7D 4JW0A 1VQFA 2CWPA 3SXHA 4X66Q 1HNXQ 2B2YA 2B8FA 3OMGA 4G7ZC 5I4DA 2E2HH 1Q3LA 3E9HA 3QB3A 3MWYW 1KDAA 3VDYA 4DUYL 3K7UC 1TWAB 4IQZA 3EBEA 2Q2IA 5FJ8H 1S72A 1IBLL 1IKMA 3A56A 3T1HQ 1OXSC 3MEFA 2KBNA 3CPWA 3C1EA 4JI7Q 1MD2D 4UP7A 1S3OA 2MPMA 5CV9A 4NXML 2JEAI 3GV6A 3S2DH 2K5NA 5M3FG 3GP7A 1C4QA 2LXKA 3HOWH 1N36Q 5T1GA 4A3JH 4GLAC 1PV4A 3M4PA 3I4MG 5C5LA 4L5RC 1KC8C 2OTLA 3HOUG 4RGNA 3CRKC 3K58A 4Y52H 1SROA 2E2IB 3W1GA 1NR4A 2R7ZH 4A3IB 1CKNA 5LMUQ 3ZYYX 3PO3H 3E0EA 5ELCA 3VR5A 1G291 5GAHC 3RD4A 4MTNA 1A3UA 4HSPA 2F0IA 3J81L 1ASZA 2JA7G 3KOJA 1Y8OB 5GQOA 4A76A 4NP5A 2RDFA 3J7A5 3CCSA 2F0GA 1EFID 3CU7A 5LMNL 1GHJA 4DXGA 3J7ZC 1NTGA 1CHPD 4YWLA 3N6RA 5DM73 4WJ4A 1AFPA 1PYBA 3N52A 1U4PA 4N8X1 2JA8B 4RHSA 1HZCA 1E22A 1TT2A 1HXYD 2P5ZX 3I4MH 4CJ1B 2I46A 4HTHA 3EQLC 3NELA 4KHPL 2C35B 4RHRA 1G2SA 3G71A 1M4VA 3GTMB 3QIAA 3GTKH 1HNWQ 5HY6A 1PH6A 1K3RA 3Q23A 1RF2D 4IZ8A 4DV1Q 1EIGA 1Y1WB 4WORA 2Y0SB 3J7AF 3FRPB 4A3BG 1VQ5A 4TQUS 1PTOH 1YITA 1DOLA 2VUMH 4B9XA 1OTCA 3CCRA 1RCVD 4CDFC 5FLMG 2B63B 4MTKA 1T9HA 2BH2A 1EWHA 4JI2Q 4HMIA 2M2LA 1NSNS 2UUAQ 2D0PA 3TBIB 1KL9A 5CMDA 3G6EA 1K3BC 1D7QA 1BO0A 4ZCKA 3TREA 1CKOA 5C3XA 2E2JH 1QVGA 3HFZB 1AZPA 5I6WA 2VL6A 3A0JA 2QCPX 5CORA 3H91A 3J7AV 1PTOC 1C48A 1VMCA 4RG1A 1UNSA 1STHA 3HOZG 1FVIA 3CCQA 1SMXA 1XNRL 5C4ZA 2A73B 3TEHB 1P8LA 4Y7NH 1DYQA 2WAQE 3P75A 5GROA 1W3SA 3CRLC 4DV0L 1TWHB 4KV6A 3KF8A 3J7YW 2CCZA 1DD2A 4L63B 2K33A 1O7LA 4HN7A 2KOLA 3AQQA 2MJ8A 4RMFA 1A62A 4JI6Q 2PI2E 3U50C 3JAMi 1YBYA 5BN5A 3CAMA 4DNIA 4BS9A 4C3JB 4JI0Q 1A63A 1HJPA 3A8JE 1PA6A 1CHQD 4MHEA 1Q81C 4BY7G 3JAME 5C4XB 3HOYG 2B2TA 4J8QA 1VQEA 4L5TA 1VQ9A 4KJNA 2JA6G 2R93G 4OO1G 2WINB 4EQOA 2PO4A 1AZQA 2JA9A 2JE6I 2N8NA 2PNHA 2IHFA 3I2ZA 3PIPA 2KQ3A 3S16H 1CSPA 5I2YA 1VQNA 5CBAE 1F2YA 5EPJA 5M3MB 2LY7A 1VQ6A 4GS3A 1BCPC 5F2DA 2L55A 2K05A 4EVOA 4DR4Q 2XSCA 1RDPD 1JJ2A 3C2PA 5IWAL 2NVXH 1JMCA 4YY3L 3P20A 1RL2A 4A93B 1KRTA 4LW1A 3ULLA 3M4QA 4DV5Q 3KYHC 4GOPC 4ZUIA 2KCCA 3HOVG 4YWMA 1N33Q 2GVAA 4DR3Q 2GVBA 1STAA 1I4HA 5I9PA 3RN5A 4DXFA 1PYWD 1WTHA 1SMYC 2JA6H 4IFDG 4Q5VA 5C3WA 2K03A 4DR7Q 2UU9L 1J8IA 4K2LA 4JI3L 1O80A 5JJIA 1B7YB 1J9OA 1V43A 5L37A 1JOOA 1S4ZA 1SNQA 3CF5A 1H9RA 2YYZA 4RCOA 1DXMA 3WWVA 3W3AA 4CGYB 3S1RH 1LTGD 2KJXA 2UXDL 1IXRA 4GLVB 1R9TB 4EX5A 1UAPA 3T56B 2X69A 3PF4A 3SE0A 3L7ZC 1QJOA 4AQYQ 2XGTA 4J1MA 4YCUA 3MXGA 1GVPA 2OQ0A 1XWEA 5IGBA 4K14A 3DLLA 1K73C 3LX0A 2H5XA 1WVLA 4A3GB 2HQLA 4GN3B 4DK1A 2FHTA 1PH9A 4B3RQ 1QZHA 1PMRA 1CI3M 5I2XA 1G51A 1HCZA 4UHVA 3HRZC 1XPUA 1X54A 2N49A 2A6HC 4POGA 2EYFA 1I50B 4JV5Q 1A8VA 1V1PB 1WFQA 1S5CD 2IJ0A 4JK1C 1AH9A 4Q0FA 5C3EB 4FNFA 3TDQA 1EYAA 2ZM6Q 1O7IA 2LSSA 3TP7A 2FMMA 2JA5H 4ZKCB 4FXGC 2EY6A 2VB3X 1XXGA 2ZTEA 1F9QA 1Y1VB 4IUPA 2WP8J 1RTOA 5E1FA 3QG1A 2CHBD 2X6LA 5C0XH 1GM5A 3OPOA 3W1BA 4GZYC 3M4YA 2Y0SE 1DM0B 1HZBA 4R4OA 1LV9A 4PNYA 4DK6C 5ELFA 1WTWA 4FXDA 2NN6G 2UXBL 1KTKA 4I7AA 3ITPA 3S2HB 3CCUA 1I3QB 1NMFA 3OTOQ 3T13A 1GJXA 3AEVA 2C5CA 3S1NB 1EWCA 1HFNA 3K0YA 3HS0C 1LTBD 5CV4A 2ALYB 3E0JA 4DAMA 2IHEA 2Q8RE 1HTLD 3VYRA 4NMZA 3GTQB 3S24A 4CJ2C 2K50A 4DA2A 3KLSX 4EGVA 4LF6Q 5ELBA 1O7ZA 2RHQB 4IO9A 4P72A 4NXNL 4DAYB 3I8ZA 4KN4C 2KHIA 3A54A 5CV8A 3I4NB 2TMPA 3DHQA 4R8IA 3BYYB 4R4QA 1H9SA 2K14A 5BN3A 1HPCA 3URYA 3PO2B 2NN6H 3OHXC 4TKOB 4O0AA 3KF6A 1EYCA 2EE1A 2G5DA 4C1NI 5HGTA 2HIVA 4DUYQ 3KLWA 5IIFA 5DM63 2DGYA 5IGCA 2F0WA 1KABA 1WI5A 5E4WC 1IBLQ 2ZTDA 1FGUA 5C44G 1SYEA 1ZKOA 4CKEA 1Q1EA 3V05A 4NXMQ 1PH7A 4BA1I 1S5FD 2EZVA 3NTIA 1CA6A 1X32A 4UAIA 1QNKA 3VR4A 3GTJH 1RKNA 3M85A 2IX3A 1CUKA 4NPSA 5KGUA 4I65A 1ET9A 3SHLA 2IX0A 3HGBA 5M9OA 2Z6KC 5IYDG 1F2LA 2EVBA 3FDTA 1EWIA 1D1IA 3R3OA 5GAEC 5BR8L 2E74C 1WTVA 2NVQH 1YNNC 1UEAB 4B3ML 3K80C 1Q8IA 4HIDA 1PH8A 1SE2A 5LL6X 2F0DA 4KK7A 2J7ZA 3BU2A 4R1JA 1Q46A 2YTYA 5LMNQ 5C44H 2A19A 3NWSA 1N32L 3D4DA 1TS5A 3UDGA 1DONA 1E2VA 4CDEC 4DK0A 3M7NA 1FNUA 2EYPA 1C0AA 2NZ1D 3I7FA 1A3TA 1SBBB 4RCNA 1VQAA 1V9PA 3FKIG 4PV1C 4BY1B 3ULJA 2I0QA 5E4XA 1L0XB 4GLXA 1SYCA 4KHPQ 3F2UA 2MUYA 2XWJB 5JJZA 4LUZA 1C8CA 1D5XC 4FF4A 1G6ZA 2D0OA 5DNFA 2RDHA 1D2BA 3RLOA 1NCVA 5I6YA 4K5WA 4L8JA 4XIGS 4ZRZA 4APVA 3K7AB 2NZHA 3ULPA 3LGJA 1S40A 3BS1A 3CQZH 3AMUA 5KEEA 1ESFA 1IZ6A 1VQ4A 4C3HB 5T1IA 4PG3A 1CT1D 2FJ2A 4BBSB 1SYFA 4A3EH 3AU7A 1SJHD 3ERQA 2XRSD 3AFQA 3E3XA 1HNZL 2O2LD 2PZUA 4KLKA 1Q82C 4A3DB 1QUQA 1SR3A 4PMCA 3QR8A 3SGIA 1VQDA 3E9IA 2BOSA 1EYDA 3PV0A 3RLNA 3T16A 3TS2A 1GHKA 4HCEA 4B3SL 1I6HH 1PRTC 4TRDA 4OO1I 1G6PA 5IODA 3SK4A 3ICEA 2SOBA 1IYUA 4C3IG 4QGUA 1KNEA 2R61A 2Z1CA 3U9OA 1W2BA 4RA8A 4AYBB 2ZTCA 1SFOB 1PXUA 2KEDA 1LTSD 1FL0A 3HOXG 2YTXA 1WCMG 1B8AA 2VXWA 4LFAL 1XNRQ 4OWTB 1EU3A 2NVYH 3FMCA 1UWVA 2R92H 3MEHA 4DV0Q 5D3IB 3KJPA 3S2DB 2KVMA 4JBWA 4LF4L 2ZJRA 2Q2UA 3HOWB 1BBWA 2YU9B 5JAVA 2RQXA 2NVTB 2GN5A 1YI2A 1L0YB 5AJ3L 1H9KA 1LTID 2Z6BA 4L5SA 1ZYRC 3PO3B 1GUNA 2V1CC 3KBXA 4KY5A 1SNPA 4JI4L 4RWSC 4IFDI 1JJGA 3K5LA 3K57A 1FNWA 4QJFA 2DY8A 1WTQA 2A69D 4IUTA 1XMQL 2A6EC 3HOXH 3UI2A 1XMOL 4K5XA 1WCMH 1GUWA 4F8MA 3QWNA 2QDLA 4HEDA 1SN8A 1YHBA 2KUMA 1FYCA 2R7FA 3KFUA 3G4SA 3I4OA 3KUPA 4FF1A 1E0BA 1HA6A 1JWMD 1YNJD 5IWAQ 3SEBA 4YY3Q 3H15A 5G3LD 2MNAA 4JBJA 3RUZA 1X3GA 1GO3E 1II3A 4G7HC 2F0EA 2BA0A 3GTKB 3G7LA 2L1BA 2F3IA 3HKZB 2F0FA 3X3MA 1VDZA 2CH4W 1K8GA 1Z9FA 1WTXA 2UU9Q 2WAQG 5M5YB 3MTSA 4JI3Q 4FF2A 4LK1C 2EJGC 1BCPF 4A3KH 1E2ZA 1BVSA 2VUMB 2EYJA 2ES2A 1PZKD 2F52A 4K5VA 3RR5A 1ET6A 2HQEA 1EFWA 3D6WA 4HIKA 5IP9G 5JPMC 3U4ZA 3PIO3 2UXDQ 4WJ3M 1STGA 1I4RA 3J80c 1I4QA 4XXEA 4JCVE 4V190 2CQAA 2LXJA 1I4GA 3M4OH 2XN9C 2E2JB 2HCCA 3DEOA 1JOQA 1NAPA 1WOCA 2K5VA 2ICEC 2PMZB 5FKAC 4XQQA 5M5XH 5GADC 2BH8A 1EIHA 3IFTA 4PQXA 2NN6I 1VQGA 4KN7C 2AWOA 1EY6A 2CFMA 3A8KE 3TP8A 2D62A 5KYIA 2JYOA 3M3YH 2MO1A 1X55A 1CM9A 2FINB 1CKNB 1Q7YC 1TWCB 2M9VA 2OXPA 1PFSA 1G8ZD 1IYVA 5M3FH 2Q2TA 2QA4A 3NSWA 4GOPA 1K8AC 4DFAA 2Q8IB 1O7YA 1Y8PB 4X3UA 2D5DA 3HOUH 2VQEL 1ILPA 2B8GA 2EJFC 1BCPB 4HJ9A 3GTPH 4KY6A 4B3TL 3EFXD 4BBRB 1X3FA 2HIXA 5D14A 4OIJA 1XX8A 3DXJC 1BNZA 4QCLA 4C2MB 2F0SA 2AQ2B 2HCIA 1DJRD 3CD6A 1TY2A 3F8TA 2JA7H 1AE3A 5IT9E 1B53A 4IPDA 3I56A 3R93A 1LABA 1LLRD 3STBD 2UXBQ 4LF8L 2L5TA 1JE5A 5EKKA 4JYAL 4IURA 1GUSA 4QB4A 2F0QA 1H95A 1UUPA 1SEBD 3S16B 4X62L 1GOZA 4A3IG 3LNNA 4DR2L 2JK8A 5HURA 4V0BA 3WOFA 2E5LL 1VQIA 4QUFA 1K0RA 2NVXB 1XJVA 4KKUA 3K59A 1T5EA 1B44D 3SK8A 5EQ0A 2BA1A 3DEPA 3NBHA 1PH3A 3GTLH 2K5WA 1TWAH 4NXNQ 2IT1A 1N8RC 2IW3A 1ML0D 3S1QH 3I73A 1L1OC 4DV3L 3I90A 1J6QA 2HHHL 2JA8G 4AYBE 1S5DD 4IJLA 4XDXA 4IUNA 1CZGA 5EAYA 3NBHB 2JEBI 1X9NA 1SXTA 5J39A 3KK7A 4A3BH 4CJ0B 4QY7A 3PUWA 1EEID 2NTSA 1EQVA 2UUBL 1JQYD 5JVG3 3VR6A 4A3IH 5FLMH 3KJOA 1UE5A 1OXVA 3V2TA 3S1RB 5J1ZA 2ZT9C 1U9RA 4MNOA 3TRZA 3D6CA 2DNCA 2F0JA 2QEJC 1M8AA 4DN4M 2C9OA 1K0SA 4LUOA 2EYOA 4U673 1Y1WG 3PCOB 2Y0SG 3D4RA 3KF8B 1YNXA 1CFMA 4LFBL 4RAUC 2SEBD 1B9NA 4KY7A 4UP8A 2JA8H 1TIID 2B63G 5BR8Q 2RKSA 4X64L 3T4AC 1KAWA 4B3MQ 3HOZH 2B2UC 2F0OA 5C6AA 2AKWB 5CGKA 2V4DA 3HEJA 4X6AH 2K6AA 3BVGA 5LMNW 2WKDA 1Q12A 2F03A 1LT6D 1EQTA 1N32Q 1PZID 1KLGD 3J81E 2BCOA 1JB7A 1BR9A 3TMEA 1SE4A 2NYZD 3GTGH 2JA5B 2RDGA 2CVRA 1Y1WH 1VQJA 2GA4B 4H7BA 2MGSA 2ASBA 2VS1A 1WYDA 2K1BA 4BY7H 3R2IA 3FPPA 4R4TA 4A3FB 3HKZE 4RKLA 1PH5A 3HOYH 4IFDJ 3X3NA 3BZKA 5IT9c 2JSOA 2B63H 3KDFA 4HJ7A 4A75A 4ME5A 2R93H 4OO1H 5FLXL 3HZXA 2IL8A 1LM0A 3F2DA 4QQBX 3RMHA 2CW0D 1W6KA 2RSOA 2B29A 4HJ5A 4JBMA 1EY8A 1QILA 4C3JG 1STBA 5H1SE 1Q8KA 1TVXA 5C4XG 1QVFA 5HGQA 2F0MA 1B1ZA 3NK9A 4B08A 4ME3A 5FO9B 4ZUJA 4IJHA 1HNZQ 4A3LG 3HOVH 3U4VA 2Z6KA 1B2TA 2PMZE 2I5MX 1XYIA 2F4VL 3PIP3 2YV5A 3R2TA 2K75A 1Y69U 4F7XA 3NQTA 4X3SA 1MBYA 4B3SQ 4IFDH 3NPPA 1TWHH 5M3MG 1Q90A 3DWQA 1XPRA 1A6XA 1K83H 1A2TA 1GD7A 1LTRD 2D9UA 1JCKB 1EU4A 1EY5A 3VR3A 3PUYA 1U4MA 4MIUA 4A93G 4C3JH 2N78A 4BXXG 3S14H 1TKWB 4LFAQ 4X65L 1P16A 3QO2A 1STEA 3FVQA 1IBML 2B2VC 1U0LA 4LF4Q 3G6JB 2Q8TA 4A3LH 3EJIA 3GTJB 3JAMc 1PRTF 4A3MB 2N55A 5IGEA 2R7DA 2EYHA 5AJ3Q 3TN2A 1TWGH 4IUQA 4IPGA 1WTOA 5ISRA 1SNMA 4O42A 4JI4Q 1J5EL 1I94L 3EVQA 2B2WC 4LJZC 2XIWA 2NVQB 3BDLA 1HZAA 5A2QL 2UXCL 2KCTA 1M90C 4DR6L 1XMQQ 4BXXH 1XMOQ 2N3SA 4DK3C 3S17H 2KENA 2NB0A 1JT8A 5ELDA 5C4JH 4Z9CB 1F77A 4X3KA 3C3LA 3IRBA 3FPUB 4I7ZC 4O1NA 4A3GG 1LUZA 3D3RA 5J3BA 4K6DA 2Z8LA 2I5LX 1RIPA 3T53B 3TQYA 4DV4L 1C7YA 1IBKL 3Q6SA 2L9HA 2RA4A 3RZOH 1PVOA 2TSSA 1VQMA 1JICA 2UUCL 3DWAA 4H13C 2HUGA 2L0CA 4DNTB 3J80L 1ONLA 3B6YA 1PFNA 1EIYB 1YVCA 5C3EG 3NBIA 3NXWA 3GV3A 3OYYA 2CH4A 1PRTB 1TWFH 4PZ7A 4UDUC 3WOEA 1RD9D 4M8AA 1HH2P 1BUVT 3K6OA 1Y1VG 3H0GB 1H9SB 2L11A 3CQZB 1QNUA 4PZ6A 4CDDC 5JJKA 2SDFA 1EL0A 3D8GA 3BJUA 3DUZA 3KF6B 1E1TA 3P7JA 4A3EB 1PYSB 2BDOA 4DR5L 3UE0A 2R6GA 2WB1B 3VA5A 1RJTA 2F3WA 4JVZA 4QF4A 1CQFA 5C5MA 5JVH3 1AN8A 1GUOA 4IUVA 1SSOA 2DN8A 1VQCA 1HQRD 3V96A 1N9WA 2QW7A 1I6HB 3M9BA 1JB3A 2XNAC 5C3EH 3RLFA 1PLFA 2A68D 2RCFA 1EYGA 2F0NA 2VY3A 3PUXA 2K7VA 1CSQA 1LTTD 2F0PA 1HUNA 1IW7D 3K0XA 1GUTA 1SYBA 3AYHB 2PW5A 1PDQA 2IX1A 3CC7A 4E6IA 2NVYB 3I4NG 4AH6A 4FF3A 5CYUA 3NQIA 2K5QA 3K5MA 2R92B 4DV6L 3PO2G 2RCNA 1GUGA 2L12A 4GN5A 4HAEA 5EGTA 1MGSA 2VQEQ 4OWWB 2LS01 2K04A 3P1HA 4CBVA 4B3TQ 1SJED 4YHHL 3S1NH 1BKBA 5IYDH 3I3CA 3JC66 1WTPA 2EIFA 1E1OA 3S15B 4JI1L 3K5NA 4NB3A 5IE8A 4BWGB 3VR2A 1A0IA 4LF8Q 1Y8NB 4JYAQ 2FMCA 4M1UB 5IYBG 4X62Q 2ZXOA 4L5QA 3LWEA 3BDCA 2NWGA 4DR2Q 4YIJA 3MFGA 3PO2H 3CP0A 2E5LQ 4L6TB 1SAPA 3FKIH 1STYA 4UPAA 1KAAA 1KRSA 2WKCA 4HCSA 1YJWA 4DV7L 1IYJB 1B9MA 2M00A 1ASYA 2NBFA 3TS0A 2KCMA 2ZJQA 5CV5A 3MZ5A 4DV3Q 1YEZA 1Q86C 3IKJA 3D31A 2HHHQ 3OIPA 3E5SA 2X6GA 3I91A 4IN3A 1N34L 1O78A 5EJWA 2E2HB 2EQSA 1V8QA 2CWAA 1QUQB 4XYQA 3W5OA 2E75C 3CXCA 4A3KB 4BY1G 4CKBA 1SNCA 3OWEB 2EXDA 2UUBQ 3MVVA 1D1KA 1QCBD 2MP1A 2LFNA 1VQBA 2EJMA 1T5XD 4DGZA 3PSIA 1MJCA 4IPHA 4A3JB 2EPBA 2E76C 1QG7A 1SLJA 1G91A 1HHVA 3L2PA 3GTOH 4JG2A 1PTOF 2PCFB 4HR7B 1VF5C 1Z7TA 2KCNA 2HDMA 2R7ZB 3UDFA 2PI2A 4PMWA 3U9SA 1ILQA 4KKTA 4DV2L 3RZDH 2Z4HA 1BOSA 4LFBQ 4C3HG 4J6HA 3F2BA 2Z4IA 5AFWA 4C3IH 4OHJA 1S5BD 1KQSA 1KHIA 4X64Q 5DEHA 1EY4A 3M3YB 4BY1H 3S1MH 1ENCA 1NNXA 2NUCA 5IT9L 3E6ZX 4A3DG 3MC0B 1HQMC 4K0KL 1XTDA 1SYGA 5M3FB 3PIOA 3PF5A 3I4MB 4DPGA 1EY7A 1X56A 4OL7A 1HFGA 3HOUB 1BQQT 3BZDB 2QGQA 4AYBG 1LT5D 3GTPB 4ULLA 1L1OA 3Q0AA 4R4IA 4GKJL 5KRUA 1QVCA 1SDFA 4ZQ3A 4XT3B 1PFBA 1VMPA 4OX9Q 2JA7B 3HOWG 2LMCB 3A7LA 1L1OB 1BBUA 1Z47A 3FHWA 4OEMB 4DF7A 2H1EA 1PTOB 5DAUA 1K8MA 2VQFL 4X3TA 2KHJA 2OTJA 2VNUD 2WB1E 3SDZA 3PO3G 1DZ1A 1EQRA 3UDXA 2RHSB 5KNBA 4ABNA 2DY7A 3QJYA 1AW7A 2AUJD 1SFOH 3GTLB 2EXZA 2MQHA 1FNVA 2F4VQ 3T51B 1FGBD 4ZAIA 3S1QB 4WJWA 1PTOD 4A4IA 1QOHA 1S5ED 1KD1C 3H3VH 4GKKL 4JOIC 2B2UA 4JI5L 2O4XA 1HR0L 4J15A 1A3VA 2JJQA 3JAML 4NDXA 5M5WH 1LYLA 4N9TA 1EUJA 2YU9H 4A3BB 5IGDA 3C46A 2NVTH 3AB9A 4CKCA 1QB5D 1TQOA 4OIKA 1CA5A 2EY1A 1I4PA 3MFYA 4LWCA 1X65A 2F0TA 4X65Q 4Y7NB 5FK9C 1WD0A 5JEAJ 4XQNA 4KTAA 5IP9H 1DGSA 1IBMQ 3HKZG 4O2DA 1CTMA 1TR5A 5JEAG 3OMCA 1A15A 5IYCG 4KJOA 3H3VC 2Z0SA 1OXXK 3KBGA 2A69C 4OELB 4GNXC 4DUZL 2B3GA 3FP9A 1E3PA 4XTCS 1KLUD 4AIMA 2VUMG 4GOPB 4PZ8A 4DR1L 1J5EQ 4LFCL 1I94Q 1IL2A 4RH6A 1QZGA 4JI8L 3HOZB 1XNQL 2UXCQ 2OT2A 4DAVA 1Q1BA 4G4KA 1SE3A 3GQBA 1YNJC 1OO9B 4DR6Q 1WTRA 3NTHA 4POFA 1BCPD 2K01A 5E7NA 1HZ9A 4RGTA 3NP8A 1LTLA 2WIIB 3A5UA 5EBCA 5JEAH 2EDGA 5IYCH 5LL6S 3GTGB 3IAYA 5M5YH 3EA6A 1RTNA 3SR1A 5COYA 4BY7B 3BVZA 4DV4Q 3Q8DA 1G2TA 3OIQA 1SMYD 1IBKQ 3HOYB 2RSNA 5I9OA 2D2CC 2L4NA 2G9HD 5CR3A 4NW2A 2UUCQ 5K36G 4QIWB 2JA6B 2R93B 4LF7L 1A2UA 2BDNA 3NE5B 2QEXA 2I07B 4N9PA 3MHBA 1UEBA 4OWXB 4EQNA 2Z9HA 2KHSA 1YIJA 2E2IH 2B2VA 2RF4A 3L3OC 4BBRG 2WFWA 4P71A 3A8IE 1GXDC 5EKIA 1SNOA 1ICFB 2XTIA 1X3PA 1NJIC 4XYOA 4DR5Q 3CCVA 4MZ9A 1TXYA 2B2YC 4PMBA 3HOVB 2EYMA 3CMEA 2EYLA 2OF1A 1TWCH 2PYKA 3I4LA 3WDNA 2B2WA 2F1MA 1X3QA 1B3AA 2NTTA 4UY8C 4LF9L 5K36H 4DAPA 1HR0W 2O5JC 1E2WA 3CCLA 1K83B 2AHOB 2PQAA 2A6HD 3D4WA 3NHHA 4XT1B 3BDOA 5BN4A 3J81i 1M1KC 2K5HA 4TVAB 4LF5L 3NEMA 5IP7G 3Q24A 5JOBA 3ZJYC 4BBRH 3S14B 3ND9A 2R3ZA 4XQJA 4U68A 5KNCA 3GTMH 1EY0A 2PQAB 4C2MH 3TSSA 2AWNA 4DV6Q 4ZK9B 1KDCA 1MSHA 2VW9A 1GKHA 2NZOA 1FJGL 3BZCA 1EY9A 3HKSA 4BA2I 5CC4A
chains in the Genus database with same CATH topology
1LT3D 2K5DA 4KHZA 1TWGB 4KI0A 2ENBA 1OXTA 4EQPA 1DOMA 3PMFA 1BXTA 4F87A 3ONAB 2WV6D 3TP6A 3R8BA 1W6JA 3OOCA 2KEEA 3K5OA 4RKBA 1F9SA 5EBDA 3S17B 4KD4A 3EROA 5C4JB 1DCZA 4C1NK 1ICWA 2J0TD 2KA7A 4KHVA 5IOCA 2F3VA 4OGQC 1JE4A 4R8NA 4ODGA 3NWTA 4H44C 2FFKB 2A5HA 3S9WA 3RZOB 4ZKBB 3C1FA 1H9MA 5EKLA 1JORA 2PZWA 1ENFA 1TWFB 1I6VC 3SK5A 4FP5D 5C0XJ 1LT4D 2JXMB 1V1OA 2EY2A 3NUCA 1V1PA 5C0XG 1IL8A 5KNDA 3DM1A 1TU2B 4K8IA 1D5ZC 2PQEA 1TY0A 3Q22A 5JPNC 1NUCA 3CKIB 3FEWX 3VA7A 1PZJD 3OSOA 1YNND 4H0LC 1DOKA 3QOJA 2WACA 3O13A 3DMUA 2HDLA 5CBEE 2AQ3B 4S3SA 1F2ZA 5KYLA 5C44B 1RODA 2J4XA 1CK1A 3IL8A 3OWFA 4HSVA 4FXKC 2DNEA 4RGOS 2B2TC 2MHVA 2RVLA 3KLSA 2H4OA 1TS4A 2CW0C 4G7OC 2A74C 4DAYA 3M7GA 1CQVA 1EZ6A 3TZDA 3MXPA 2XVSA 5K5PA 4IALA 1B4OA 1JWUD 4P2CB 1OXUA 1CZWA 4ILWA 5D65A 3MAQA 2ZXRA 3L9AX 1HTPA 1JR0D 1Z6HA 5FLXE 1U4LA 3MXUA 4WFN3 4ID6A 2K28A 3FKIB 1NR2A 1KNAA 3PUVA 1U4RA 3DWPA 2F0KA 2F0LA 1PRTD 2EOTA 1FR3A 2O5IC 3HG9A 2ID0A 3VYSA 5D3DA 1I4XA 1JWSD 3TZUA 3H09A 1TS3A 4QMGA 4TSSA 1H9JA 3VYUA 2ICIA 4R9WA 1LO5D 2F0UA 1R4PB 5ELEA 3HP3A 4RFBA 4CHTB 2ZXPA 1BDOA 1LACA 2EY5A 4DNRB 3OW7A 3GTOB 1ZYRD 5FO7B 3GD7A 1EZ8A 3RZDB 5CV7A 3H6MA 2PPBC 2A6ED 4C3IB 1JC7A 1PFMA 5A35A 1SNDA 4K6LA 1WD1A 3S1MB 4RGMA 3HOXB 3I72A 1WCMB 1SYDA 3SK6A 2AQ1B 5FO8B 1XTCD 5A2QE 1D5MC 2BE5D 3IFDA 1R4QB 1ZXTA 2QDBA 1IKLA 5NUCA 4K8JA 2VB2X 4MN3A 3SVMA 2PNRC 3A7AB 3TP5A 4F88A 4B9WA 4LMQD 4QUCA 2XRQD 2QILA 3VYTA 1VF7A 1F2MA 5G3LF 5EPKA 1ENAA 1TS2A 4C56C 2SNSA 4HMJA 2KECA 5LHY1 2OEOA 5FOBB 2IWHA 1ESRA 1STNA 4FO2A 2QKIC 1ZEQX 3MXNA 3ND8A 3J80E 4K2KA 2F0VA 3LWUA 1BBXC 3PUZA 5E3FA 4ZYSA 4KMUC 2A68C 5EPLA 3H94A 3M4OB 1VCIA 4WRDA 1EOTA 4LAAA 1IW7C 2SNMA 2LKVA 5M5XB 3I70A 1B50A 1RHPA 1BF4A 1IHZA 2XWBB 1KDBA 5M5WB 2WAQB 2K32A 4FVMA 5C4HA 1EEFD 3A55A 2B39A 1HRJA 3BYTB 1D6EC 5CV6A 1K8OA 3W2DA 3KLRA 4KKSA 2E2DC 1AEXA 4G57A 3CHBD 1QWYA 2PW7A 1MI2A 1AP0A 2RBMA 1F9RA 1JOKA 2JP1A 2QF7A 5KIXA 1LTAD 4NKLA 1QE6A 5IGFA 3GO5A 3NTKA 5J22A 2F0HA 4KD3A 3BG3A 5IGGA 2PZTA 1F9PA 2N88A 2BE5C 1HUMA 4DU9A 1MSGA 3MA2B 1HA5A 3QOLA 4IUUA 3BVMA 4ZLTF 5TSSA 2IPKD 2AUKA 2G9DA 5C0XI 4FYDA 2F4IA 1FD7D 3SXHA 2B2YA 2B8FA 3OMGA 4G7ZC 5I4DA 1Q3LA 3QB3A 3MWYW 1KDAA 1TWAB 4IQZA 1IKMA 3A56A 1OXSC 3C1EA 1MD2D 2MPMA 5CV9A 2JEAI 3GV6A 3GP7A 1C4QA 5T1GA 5C5LA 4RGNA 3CRKC 3K58A 2E2IB 1NR4A 4A3IB 3ZYYX 5ELCA 3VR5A 1G291 3RD4A 1A3UA 4HSPA 2F0IA 3J81L 1Y8OB 4NP5A 2RDFA 2F0GA 1EFID 3CU7A 1GHJA 4DXGA 1CHPD 3N6RA 5DM73 1AFPA 3N52A 1U4PA 2JA8B 4RHSA 1TT2A 1HXYD 4CJ1B 2I46A 4HTHA 3EQLC 4RHRA 1G2SA 1M4VA 3GTMB 3QIAA 3Q23A 1RF2D 4IZ8A 1EIGA 1Y1WB 4WORA 2Y0SB 3J7AF 3FRPB 4TQUS 1PTOH 1DOLA 4B9XA 1RCVD 2B63B 1EWHA 4HMIA 2M2LA 1NSNS 3TBIB 5CMDA 1BO0A 5C3XA 1AZPA 5I6WA 5CORA 2QCPX 3H91A 3J7AV 1PTOC 1C48A 1VMCA 1UNSA 1STHA 5C4ZA 2A73B 1DYQA 3P75A 3CRLC 1TWHB 4KV6A 3KF8A 3J7YW 1DD2A 4L63B 2K33A 1O7LA 4HN7A 2KOLA 2MJ8A 5BN5A 4BS9A 4C3JB 3A8JE 1CHQD 4MHEA 3JAME 5C4XB 2B2TA 4J8QA 4KJNA 4OO1G 2WINB 4EQOA 2PO4A 1AZQA 2JE6I 2KQ3A 5I2YA 5CBAE 1F2YA 5EPJA 5M3MB 2LY7A 1BCPC 5F2DA 2L55A 2K05A 4EVOA 2XSCA 1RDPD 3C2PA 3P20A 4A93B 4ZUIA 2KCCA 1STAA 1I4HA 5I9PA 4DXFA 1PYWD 1SMYC 4IFDG 4Q5VA 5C3WA 2K03A 1J8IA 4K2LA 1O80A 1J9OA 1V43A 1JOOA 1S4ZA 1SNQA 1H9RA 2YYZA 4RCOA 1DXMA 3W3AA 4CGYB 1LTGD 2KJXA 1R9TB 1UAPA 3T56B 2X69A 3SE0A 3L7ZC 1QJOA 4J1MA 3MXGA 1XWEA 5IGBA 4K14A 3LX0A 1WVLA 4A3GB 4DK1A 2FHTA 1PMRA 1CI3M 5I2XA 1HCZA 3HRZC 2A6HC 2EYFA 1I50B 1V1PB 1S5CD 2IJ0A 4JK1C 4Q0FA 5C3EB 4FNFA 3TDQA 1EYAA 3TP7A 2FMMA 4ZKCB 4FXGC 2EY6A 2VB3X 1XXGA 1F9QA 1Y1VB 4IUPA 2WP8J 1RTOA 5E1FA 3QG1A 2CHBD 2X6LA 5C0XH 3OPOA 4GZYC 3M4YA 1DM0B 1LV9A 4PNYA 1WTWA 5ELFA 4FXDA 2NN6G 1KTKA 3ITPA 3S2HB 1I3QB 3T13A 1GJXA 2C5CA 3S1NB 1EWCA 1HFNA 3K0YA 3HS0C 1LTBD 5CV4A 3E0JA 2Q8RE 1HTLD 3VYRA 4NMZA 3GTQB 4CJ2C 4DA2A 3KLSX 4EGVA 5ELBA 1O7ZA 3I8ZA 4KN4C 3A54A 5CV8A 3I4NB 2TMPA 3DHQA 4R8IA 3BYYB 1H9SA 5BN3A 1HPCA 3URYA 3PO2B 2NN6H 3OHXC 4TKOB 1EYCA 2EE1A 4C1NI 5HGTA 5IIFA 5DM63 5IGCA 2F0WA 1KABA 5E4WC 1SYEA 1ZKOA 4CKEA 1Q1EA 3V05A 4BA1I 1S5FD 2EZVA 3NTIA 1CA6A 1X32A 4UAIA 1QNKA 3VR4A 1RKNA 3M85A 2IX3A 5KGUA 4I65A 1ET9A 3SHLA 2IX0A 3HGBA 5M9OA 1F2LA 2EVBA 3FDTA 1D1IA 3R3OA 2E74C 1WTVA 1YNNC 1UEAB 1Q8IA 1SE2A 5LL6X 2F0DA 4KK7A 2J7ZA 3NWSA 3D4DA 1TS5A 1DONA 1E2VA 4DK0A 3M7NA 1FNUA 2EYPA 2NZ1D 1A3TA 1SBBB 4RCNA 4PV1C 4BY1B 5E4XA 1L0XB 1SYCA 3F2UA 2MUYA 2XWJB 5JJZA 1C8CA 1D5XC 4FF4A 1G6ZA 5DNFA 2RDHA 1D2BA 1NCVA 5I6YA 4K5WA 4L8JA 4XIGS 4ZRZA 3K7AB 3BS1A 3AMUA 5KEEA 1ESFA 4C3HB 5T1IA 1CT1D 2FJ2A 4BBSB 1SYFA 3AU7A 1SJHD 3ERQA 2XRSD 2O2LD 2PZUA 4A3DB 4PMCA 2BOSA 1EYDA 3PV0A 3T16A 1GHKA 4HCEA 1PRTC 4TRDA 4OO1I 5IODA 3SK4A 2SOBA 1IYUA 4C3IG 1KNEA 2R61A 2Z1CA 3U9OA 4RA8A 4AYBB 1SFOB 1PXUA 2KEDA 1LTSD 2VXWA 1EU3A 3FMCA 3MEHA 5D3IB 3S2DB 2KVMA 4JBWA 3HOWB 2YU9B 5JAVA 2RQXA 2NVTB 1L0YB 1H9KA 1LTID 1ZYRC 3PO3B 1GUNA 4KY5A 3KBXA 4IFDI 1SNPA 4RWSC 3K5LA 3K57A 1FNWA 2DY8A 1WTQA 2A69D 4IUTA 2A6EC 3UI2A 4K5XA 1GUWA 4F8MA 3QWNA 4HEDA 2KUMA 1FYCA 3KUPA 4FF1A 1E0BA 1HA6A 1JWMD 1YNJD 3SEBA 5G3LD 3RUZA 1II3A 4G7HC 2F0EA 2BA0A 3GTKB 3G7LA 2L1BA 3HKZB 2F0FA 3X3MA 1VDZA 1WTXA 5M5YB 3MTSA 4FF2A 4LK1C 2EJGC 1BCPF 1E2ZA 2VUMB 2EYJA 1PZKD 4K5VA 1ET6A 2HQEA 3D6WA 5JPMC 3PIO3 1STGA 1I4RA 1I4QA 4XXEA 4V190 2CQAA 1I4GA 2XN9C 2E2JB 2HCCA 3DEOA 1JOQA 1NAPA 2PMZB 2ICEC 5FKAC 4XQQA 1EIHA 3IFTA 4PQXA 2NN6I 4KN7C 2AWOA 1EY6A 3A8KE 3TP8A 2D62A 5KYIA 2JYOA 1CM9A 2FINB 1TWCB 2M9VA 2OXPA 1G8ZD 1IYVA 3NSWA 4DFAA 2Q8IB 1O7YA 1Y8PB 4X3UA 2D5DA 1ILPA 2B8GA 2EJFC 1BCPB 4KY6A 3EFXD 4BBRB 5D14A 4OIJA 1XX8A 3DXJC 1BNZA 4QCLA 4C2MB 2F0SA 2AQ2B 2HCIA 1DJRD 1TY2A 5IT9E 1B53A 3R93A 1LABA 1LLRD 2L5TA 5EKKA 4IURA 1GUSA 4QB4A 2F0QA 1UUPA 1SEBD 3S16B 1GOZA 3LNNA 5HURA 4V0BA 3WOFA 4QUFA 2NVXB 4KKUA 3K59A 1T5EA 1B44D 3SK8A 5EQ0A 2BA1A 3DEPA 3NBHA 2K5WA 2IT1A 2IW3A 1ML0D 3I73A 3I90A 1S5DD 4XDXA 4IUNA 1CZGA 2JEBI 1SXTA 5J39A 3KK7A 4CJ0B 3PUWA 1EEID 2NTSA 1EQVA 1JQYD 5JVG3 3VR6A 1OXVA 3V2TA 3S1RB 5J1ZA 2ZT9C 1U9RA 3D6CA 2DNCA 2F0JA 2QEJC 1M8AA 4DN4M 2C9OA 2EYOA 4U673 3D4RA 1CFMA 4RAUC 2SEBD 1B9NA 4KY7A 1TIID 2RKSA 3T4AC 2B2UC 2F0OA 5C6AA 5CGKA 2V4DA 3HEJA 2K6AA 3BVGA 2WKDA 1Q12A 2F03A 1LT6D 1EQTA 1PZID 1KLGD 3J81E 2BCOA 1BR9A 3TMEA 1SE4A 2NYZD 2JA5B 2RDGA 2CVRA 2GA4B 4H7BA 2MGSA 2K1BA 3R2IA 3FPPA 4A3FB 4RKLA 4IFDJ 3X3NA 2JSOA 4ME5A 4OO1H 5FLXL 3HZXA 2IL8A 3RMHA 2CW0D 1W6KA 2RSOA 1EY8A 1QILA 4C3JG 1STBA 1TVXA 2F0MA 1B1ZA 3NK9A 4B08A 5FO9B 4ZUJA 1B2TA 1XYIA 3PIP3 3R2TA 1Y69U 4F7XA 3NQTA 4X3SA 1MBYA 4IFDH 3NPPA 1Q90A 3DWQA 1A6XA 1A2TA 1LTRD 2D9UA 1JCKB 1EU4A 1EY5A 3VR3A 3PUYA 1U4MA 4MIUA 1TKWB 3QO2A 1STEA 3FVQA 2B2VC 3G6JB 2Q8TA 3EJIA 3GTJB 1PRTF 4A3MB 2N55A 5IGEA 2EYHA 3TN2A 4IUQA 1WTOA 5ISRA 1SNMA 4O42A 3EVQA 2B2WC 4LJZC 2XIWA 2NVQB 3BDLA 5A2QL 2NB0A 5ELDA 4Z9CB 1F77A 4X3KA 3C3LA 3FPUB 4I7ZC 4O1NA 3D3RA 4K6DA 2Z8LA 3T53B 3Q6SA 2L9HA 2RA4A 2TSSA 1JICA 3DWAA 4H13C 2HUGA 2L0CA 4DNTB 3J80L 1ONLA 1PFNA 3NBIA 3NXWA 3GV3A 1PRTB 4UDUC 3WOEA 1RD9D 4M8AA 1BUVT 3K6OA 3H0GB 1H9SB 2L11A 3CQZB 1QNUA 2SDFA 1EL0A 3D8GA 3DUZA 3P7JA 4A3EB 2BDOA 2R6GA 2WB1B 3VA5A 1RJTA 2F3WA 4QF4A 1CQFA 5C5MA 5JVH3 1AN8A 1GUOA 4IUVA 1SSOA 2DN8A 1HQRD 3V96A 1I6HB 1JB3A 2XNAC 3RLFA 1PLFA 2A68D 2F0NA 3PUXA 2K7VA 1LTTD 2F0PA 1HUNA 1IW7D 1GUTA 1SYBA 2PW5A 1PDQA 2IX1A 4E6IA 2NVYB 4FF3A 5CYUA 3NQIA 2K5QA 3K5MA 2R92B 1GUGA 2L12A 4HAEA 5EGTA 1MGSA 2LS01 2K04A 3P1HA 4CBVA 1SJED 3I3CA 1WTPA 3S15B 3K5NA 4BWGB 3VR2A 1Y8NB 2FMCA 4M1UB 2ZXOA 3LWEA 3BDCA 2NWGA 4YIJA 3MFGA 4L6TB 1SAPA 1STYA 1KAAA 2WKCA 4HCSA 1B9MA 2M00A 2NBFA 5CV5A 3MZ5A 3IKJA 3D31A 3OIPA 3E5SA 2X6GA 3I91A 4IN3A 1O78A 5EJWA 2E2HB 1V8QA 4XYQA 2E75C 4A3KB 4CKBA 1SNCA 3OWEB 3MVVA 1D1KA 1QCBD 2MP1A 2LFNA 2EJMA 1T5XD 4DGZA 4A3JB 2EPBA 2E76C 1QG7A 1G91A 1HHVA 1PTOF 2PCFB 4HR7B 1VF5C 1Z7TA 2KCNA 2HDMA 2R7ZB 4PMWA 3U9SA 1ILQA 4KKTA 2Z4HA 1BOSA 4C3HG 4J6HA 2Z4IA 5AFWA 4OHJA 1S5BD 5DEHA 1EY4A 3M3YB 1ENCA 2NUCA 5IT9L 3E6ZX 3MC0B 1HQMC 1SYGA 5M3FB 3I4MB 1EY7A 4OL7A 1HFGA 3HOUB 1BQQT 3BZDB 1LT5D 3GTPB 4ULLA 3Q0AA 5KRUA 1SDFA 4ZQ3A 4XT3B 1PFBA 1VMPA 2JA7B 2LMCB 3A7LA 1Z47A 4DF7A 2H1EA 1PTOB 5DAUA 1K8MA 4X3TA 2VNUD 3SDZA 1DZ1A 5KNBA 4ABNA 2DY7A 3QJYA 1AW7A 2AUJD 3GTLB 2EXZA 1FNVA 3T51B 1FGBD 4ZAIA 3S1QB 4WJWA 1PTOD 1QOHA 1S5ED 2B2UA 2O4XA 1A3VA 3JAML 4NDXA 4N9TA 4A3BB 5IGDA 3C46A 3AB9A 4CKCA 1QB5D 1TQOA 4OIKA 1CA5A 2EY1A 1I4PA 3MFYA 2F0TA 4Y7NB 5FK9C 1WD0A 5JEAJ 4XQNA 4KTAA 1CTMA 1TR5A 5JEAG 3OMCA 1A15A 4KJOA 3H3VC 1OXXK 3KBGA 2A69C 4XTCS 1KLUD 4RH6A 3HOZB 2OT2A 4DAVA 1Q1BA 4G4KA 1SE3A 3GQBA 1YNJC 1OO9B 1WTRA 3NTHA 1BCPD 2K01A 4RGTA 3NP8A 2WIIB 5EBCA 5JEAH 2EDGA 5LL6S 3GTGB 3IAYA 3EA6A 1RTNA 3SR1A 5COYA 4BY7B 3BVZA 1G2TA 3OIQA 1SMYD 3HOYB 2RSNA 5I9OA 2D2CC 2L4NA 2G9HD 5CR3A 4NW2A 5K36G 4QIWB 2JA6B 2R93B 1A2UA 2BDNA 3NE5B 2I07B 4N9PA 3MHBA 4EQNA 2KHSA 2B2VA 3L3OC 3A8IE 1GXDC 5EKIA 1SNOA 1X3PA 4XYOA 2B2YC 4PMBA 3HOVB 2EYMA 2EYLA 2OF1A 2PYKA 3I4LA 3WDNA 2B2WA 2F1MA 1X3QA 1B3AA 2NTTA 5K36H 4DAPA 2O5JC 1E2WA 1K83B 2A6HD 3D4WA 3NHHA 4XT1B 3BDOA 5BN4A 3Q24A 5JOBA 3S14B 3ND9A 2R3ZA 4XQJA 4U68A 5KNCA 1EY0A 3TSSA 2AWNA 4ZK9B 1KDCA 1MSHA 4BA2I 1EY9A 5CC4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TVX A;  3D6W A;  3I90 A;  1JIC A;  2K01 A;  3LWE A;  2HUG A;  1CA6 A;  1X32 A;  1SDF A;  1PFN A;  2NWG A;  1DOM A;  1KNE A;  1QNK A;  4UAI A;  4XDX A;  1HRJ A;  1ROD A;  4RA8 A;  3IL8 A;  4XT3 B;  2KED A;  3ONA B;  4HSV A;  1PFB A;  1SAP A;  4MHE A;  4CJ0 B;  1VMP A;  3GV3 A;  2VXW A;  2B2T A;  2HCC A;  2KEE A;  1U4P A;  3N52 A;  1B2T A;  2B2T C;  1F2L A;  1XYI A;  3FDT A;  4HCS A;  1J8I A;  1PFM A;  1MI2 A;  3DEO A;  1AP0 A;  2RVL A;  1NAP A;  1RTN A;  2H1E A;  1F9R A;  5COY A;  2JP1 A;  2L11 A;  1WTV A;  1WD1 A;  1EIH A;  1F9S A;  4X3S A;  4CJ1 B;  2FMM A;  2KVM A;  4ZKC B;  2SDF A;  1EL0 A;  1G2T A;  1BNZ A;  1QE6 A;  4X3T A;  2RSN A;  2L4N A;  1M8A A;  1HA6 A;  3P7J A;  1AZQ A;  4DN4 M;  1DZ1 A;  4NW2 A;  1F9Q A;  2D9U A;  2J7Z A;  2JYO A;  4IUP A;  1G2S A;  1RTO A;  3I91 A;  2X6G A;  3TZD A;  1RJT A;  3IFD A;  5EJW A;  1U4M A;  1F9P A;  1CM9 A;  1ICW A;  2BDN A;  2FIN B;  2X6L A;  5CBA E;  2DY7 A;  5EPJ A;  1ZXT A;  1B4O A;  1IKL A;  2N88 A;  2K05 A;  1DON A;  3KBX A;  4IUV A;  1HUM A;  1JE4 A;  1SSO A;  1MSG A;  4RWS C;  4MN3 A;  5D65 A;  1EIG A;  2NZ1 D;  3QO2 A;  3SVM A;  1LV9 A;  4RAU C;  1WTW A;  2B2V A;  4ZAI A;  2FFK B;  4IUU A;  2B2V C;  2DY8 A;  2MP1 A;  4ZLT F;  1PLF A;  1WTQ A;  1O7Y A;  2B2U A;  4IUT A;  5EKI A;  4LMQ D;  4QUC A;  4X3U A;  4ZKB B;  2B2U C;  1ILP A;  5E4X A;  1DOL A;  1U4L A;  3UI2 A;  2Q8T A;  1GUW A;  1HFN A;  1X3P A;  2EPB A;  3F2U A;  1HUN A;  1QG7 A;  2B2Y A;  2N55 A;  4HED A;  1G91 A;  5JJZ A;  5D14 A;  2B2Y C;  2K28 A;  1C8C A;  2KUM A;  1HHV A;  5EPK A;  1G6Z A;  1NR2 A;  1KNA A;  2KEC A;  1XX8 A;  1PDQ A;  2Q8R E;  4IUQ A;  4OIK A;  4OIJ A;  1EQT A;  3KUP A;  1U4R A;  1E0B A;  2K03 A;  2M2L A;  1Q3L A;  1WTO A;  2HDM A;  3MWY W;  1NCV A;  4O42 A;  4CJ2 C;  1ESR A;  5CMD A;  2HCI A;  1ILQ A;  1O80 A;  1J9O A;  1BO0 A;  5DNF A;  1WD0 A;  2B2W A;  1O7Z A;  1S4Z A;  2B2W C;  1X3Q A;  1B3A A;  2XIW A;  2NYZ D;  1B53 A;  3R93 A;  2EOT A;  1IKM A;  3I8Z A;  2CVR A;  5AFW A;  1IL8 A;  3DM1 A;  1BBX C;  2L12 A;  4HAE A;  2MGS A;  4IUR A;  1AZP A;  1MGS A;  2K1B A;  1A15 A;  2MPM A;  5COR A;  4R8I A;  3TN2 A;  3GV6 A;  2K04 A;  4XT1 B;  3H91 A;  5T1I A;  5T1G A;  1VMC A;  2FJ2 A;  3G7L A;  3Q6S A;  2L1B A;  5EPL A;  3I3C A;  1WTP A;  2X69 A;  4X3K A;  2EE1 A;  3FPU B;  2R3Z A;  4QUF A;  1WTX A;  2IL8 A;  4U68 A;  1EOT A;  1CA5 A;  4R9W A;  3MTS A;  1NR4 A;  5EQ0 A;  3HP3 A;  2RSO A;  1DOK A;  3DEP A;  4ZK9 B;  5E4W C;  1MSH A;  1B50 A;  1HFG A;  1RHP A;  1BF4 A;  1WVL A;  1ML0 D;  2HDL A;  5CBE E;  2FHT A;  1WTR A;  2KOL A;  2L9H A;  2MJ8 A;  2RA4 A; 
#chains in the Genus database with same CATH topology
 3K8A A;  1LT3 D;  2K5D A;  1KXL A;  3STB C;  3A5Z B;  4KHZ A;  4YHH Q;  1TWG B;  4KI0 A;  2ENB A;  1OXT A;  4EQP A;  1DOM A;  3PMF A;  3T1Y L;  1BXT A;  4F87 A;  4IOA A;  3ONA B;  4P73 A;  2WV6 D;  3TP6 A;  4JI1 Q;  3R8B A;  4R4C A;  4OX9 L;  1W6J A;  1NY4 A;  2KEE A;  3OOC A;  1WJJ A;  3K5O A;  4RKB A;  2OCE A;  5IP7 H;  4LNQ A;  1F9S A;  5EBD A;  3S17 B;  4KD4 A;  3ER0 A;  5ELO A;  3ERO A;  5C4J B;  4FDB A;  3KDF B;  3PGZ A;  2JQO A;  1DCZ A;  4X66 L;  1HNX L;  4C1N K;  3F1Z A;  3RNU A;  1ICW A;  1SE8 A;  2J0T D;  2KA7 A;  4KHV A;  5IOC A;  2F3V A;  4OGQ C;  2MFI A;  1JE4 A;  4R8N A;  4ODG A;  4DV7 Q;  3NWT A;  4H44 C;  2FFK B;  2A5H A;  3S9W A;  3T1H L;  1YJN A;  3EN2 A;  3RZO B;  3AFP A;  4JI7 L;  4ZKB B;  4QL5 A;  3C1F A;  1H9M A;  5EKL A;  1JOR A;  1N36 L;  2PZW A;  1N34 Q;  1ENF A;  2JA5 G;  1TWF B;  1I6V C;  3SK5 A;  4FP5 D;  4HIM A;  3D0F A;  5C0X J;  1LT4 D;  1PHJ A;  2JXM B;  1VQ7 A;  5LMU L;  1V1O A;  4A3F G;  5C4X H;  1PH2 A;  2EY2 A;  3NUC A;  3CCM A;  1V1P A;  4YCW A;  5C0X G;  1IL8 A;  5KND A;  3DM1 A;  5GAG C;  1TU2 B;  2FXQ A;  1B3Q A;  4K8I A;  2L15 A;  1D5Z C;  1UE7 A;  2PQE A;  1TY0 A;  3Q22 A;  5JPN C;  1NUC A;  3CKI B;  3FEW X;  3VA7 A;  1PZJ D;  1VS0 A;  3H3V I;  3OSO A;  1YNN D;  5M3M H;  4H0L C;  4DV2 Q;  3I55 A;  1DOK A;  3QOJ A;  2WAC A;  1CKM A;  3O13 A;  1EOV A;  3DMU A;  2HDL A;  1V1Q A;  3A74 A;  5CBE E;  2AQ3 B;  4A93 H;  4S3S A;  1EQQ A;  1F2Z A;  5KYL A;  3J81 c;  4A3F H;  3U58 A;  5C44 B;  4OON A;  1ROD A;  2J4X A;  1CK1 A;  3IL8 A;  1HNW L;  3OWF A;  4K0K Q;  4HSV A;  2JN4 A;  2E8G A;  1X6O A;  2DNE A;  4FXK C;  4DV1 L;  4RGO S;  2B2T C;  4IPC A;  2MHV A;  2RVL A;  3UE1 A;  3CMA A;  3KLS A;  2H4O A;  1NMG A;  1TS4 A;  2CW0 C;  4P75 A;  4G7O C;  1E7Z A;  1L2F A;  2A74 C;  1VQH A;  4QIW E;  4DAY A;  3CW2 C;  2DUD A;  3M7G A;  1CQV A;  4GKJ Q;  1MHW C;  1EZ6 A;  3TZD A;  3MXP A;  2XVS A;  5K5P A;  4JI2 L;  4IAL A;  3CCE A;  4EQ5 A;  1R9T H;  1B4O A;  2UUA L;  4JC0 A;  1JWU D;  4P2C B;  4HIO A;  1XPO A;  1OXU A;  1CZW A;  4ILW A;  5D65 A;  4DKA C;  3MAQ A;  1UE1 A;  2ZXR A;  3L9A X;  4A3M G;  1HTP A;  1JR0 D;  2YTV A;  1Z6H A;  2VQF Q;  5FLX E;  1U4L A;  4HJA A;  2I5H A;  3UDI A;  4A3G H;  2CKZ B;  3K81 C;  3MXU A;  1VQO A;  4WFN 3;  3CCJ A;  4ID6 A;  2K28 A;  3FKI B;  1NR2 A;  1KNA A;  1MKH A;  1YJ9 A;  3PUV A;  1U4R A;  2DJF C;  3DWP A;  2F0K A;  1K9M C;  2K52 A;  2F0L A;  1I50 H;  1PRT D;  2DJG C;  4P74 A;  2EOT A;  1FR3 A;  4JBK A;  2O5I C;  4GKK Q;  4JI5 Q;  3HG9 A;  1HR0 Q;  4JI6 L;  2ID0 A;  1YZ6 A;  3VYS A;  2Q2H A;  5D3D A;  1I4X A;  1JWS D;  3TZU A;  1VQP A;  3H09 A;  1TS3 A;  5IY0 A;  4A3M H;  4JI0 L;  2ATW A;  1Y1V H;  4QMG A;  4TSS A;  1H9J A;  3VYU A;  2ICI A;  4R9W A;  1LO5 D;  2F0U A;  1D8L A;  1R4P B;  5ELE A;  3HP3 A;  4A3C G;  4RFB A;  4CHT B;  1NE3 A;  2ZXP A;  3NEN A;  2HT1 A;  1BDO A;  1LAC A;  1YHQ A;  2EY5 A;  5ELN A;  4DNR B;  3S2H H;  3OW7 A;  1I3Q H;  3GTO B;  1ZYR D;  5FO7 B;  3GD7 A;  1X3E A;  4DUZ Q;  4LUV A;  3H0G G;  1EZ8 A;  2CQO A;  3RZD B;  5CV7 A;  3G48 A;  4DR1 Q;  3H6M A;  4DR4 L;  3RN2 A;  2PPB C;  3GTQ H;  1VQL A;  4LFC Q;  2A6E D;  4C3I B;  1JC7 A;  4A3E G;  3ERS X;  1PFM A;  4ALP A;  5A35 A;  4JI8 Q;  2WB1 G;  1XNQ Q;  1SND A;  4DV5 L;  4K6L A;  2ZJP A;  1WD1 A;  3S1M B;  4RGM A;  3HOX B;  3I72 A;  1WCM B;  1N33 L;  4OXP A;  1SYD A;  3SK6 A;  1B70 B;  3I4N H;  2AQ1 B;  5FO8 B;  4DR3 L;  3CC2 A;  1XTC D;  4A3C H;  5A2Q E;  1D5M C;  2BE5 D;  3IFD A;  1R4Q B;  4JPB W;  2HD3 A;  5DLQ E;  1ZXT A;  2QDB A;  4DR7 L;  1IKL A;  5NUC A;  1YHA A;  4K8J A;  2VB2 X;  4MN3 A;  3SVM A;  5JJL A;  2PNR C;  3A7A B;  3TP5 A;  4IOC A;  4F88 A;  4JOI A;  4B9W A;  3H0G H;  1VQK A;  4LMQ D;  1JJC B;  4QUC A;  2OWO A;  2XRQ D;  3L0O A;  3CC4 A;  2QIL A;  4HJ8 A;  3VYT A;  1K28 A;  1VF7 A;  4GN4 B;  2A8V A;  1F2M A;  2R92 G;  4LF7 Q;  3J80 i;  5G3L F;  1ENA A;  1TS2 A;  4HMJ A;  5EPK A;  2SNS A;  4C56 C;  2KEC A;  5LHY 1;  2OEO A;  5FOB B;  2IWH A;  4AQY L;  5FLX c;  1ESR A;  1STN A;  4FO2 A;  2QKI C;  5IYB H;  1ZEQ X;  3MXN A;  1NBW A;  3ND8 A;  3J80 E;  4K2K A;  2F0V A;  3LWU A;  1BBX C;  1PH4 A;  1E24 A;  4YCV A;  2AMC B;  3PUZ A;  4B3R L;  3J81 j;  4GNX A;  5E3F A;  4ZYS A;  4KMU C;  1AE2 A;  1PH1 A;  2A68 C;  5EPL A;  3DM3 A;  3H94 A;  3MXN B;  3M4O B;  1VCI A;  1Y14 B;  4JV5 L;  1EIF A;  4WRD A;  1EOT A;  4LAA A;  1IW7 C;  2K4K A;  2SNM A;  2LKV A;  5M5X B;  1UE6 A;  1MIU A;  3I70 A;  4LF9 Q;  2ZM6 L;  1I5F A;  1B50 A;  1RHP A;  1BF4 A;  1IHZ A;  2XWB B;  4GNX B;  1MJE A;  1KDB A;  4BBS G;  5M5W B;  2WAQ B;  2K32 A;  4FVM A;  5C4H A;  1EEF D;  2VZA A;  1VQ8 A;  3A55 A;  4YWK A;  2B39 A;  4LF5 Q;  1HRJ A;  3BYT B;  1KIX A;  1D6E C;  5CV6 A;  1K8O A;  4UP9 A;  3PQI A;  3W2D A;  3EIV A;  3KLR A;  4KKS A;  3S15 H;  1U5K A;  4G57 A;  2E2D C;  1AEX A;  3CHB D;  1QWY A;  2PW7 A;  1MI2 A;  1L0W A;  1AP0 A;  2RBM A;  1F9R A;  1JOK A;  2JP1 A;  2QF7 A;  5KIX A;  1FJG Q;  3CPF A;  1LTA D;  2A1A A;  3OTO L;  3OW2 A;  3K7A H;  1QE6 A;  4NKL A;  3GDE A;  3GO5 A;  5IGF A;  4A3K G;  3NTK A;  5J22 A;  2F0H A;  5FJ8 G;  4KD3 A;  3BG3 A;  5IGG A;  2PZT A;  3T1Y Q;  4C3H H;  2IY5 B;  1F9P A;  4N8F A;  4BBS H;  2MO0 A;  1C9O A;  2N88 A;  4LF6 L;  2BE5 C;  1HUM A;  4DU9 A;  1MSG A;  3MA2 B;  2OQK A;  4A3J G;  1HA5 A;  3QOL A;  4IUU A;  4A3D H;  3BVM A;  4ZLT F;  1SRU A;  5TSS A;  3F2C A;  2IPK D;  2AUK A;  2G9D A;  4H02 A;  4CDC C;  5C0X I;  2R7Z G;  4FYD A;  2F4I A;  1FD7 D;  4JW0 A;  1VQF A;  2CWP A;  3SXH A;  4X66 Q;  1HNX Q;  2B2Y A;  2B8F A;  3OMG A;  4G7Z C;  5I4D A;  2E2H H;  1Q3L A;  3E9H A;  3QB3 A;  3MWY W;  1KDA A;  3VDY A;  4DUY L;  3K7U C;  1TWA B;  4IQZ A;  3EBE A;  2Q2I A;  5FJ8 H;  1S72 A;  1IBL L;  1IKM A;  3A56 A;  3T1H Q;  1OXS C;  3MEF A;  2KBN A;  3CPW A;  3C1E A;  4JI7 Q;  1MD2 D;  4UP7 A;  1S3O A;  2MPM A;  5CV9 A;  4NXM L;  2JEA I;  3GV6 A;  3S2D H;  2K5N A;  5M3F G;  3GP7 A;  1C4Q A;  2LXK A;  3HOW H;  1N36 Q;  5T1G A;  4A3J H;  4GLA C;  1PV4 A;  3M4P A;  3I4M G;  5C5L A;  4L5R C;  1KC8 C;  2OTL A;  3HOU G;  4RGN A;  3CRK C;  3K58 A;  4Y52 H;  1SRO A;  2E2I B;  3W1G A;  1NR4 A;  2R7Z H;  4A3I B;  1CKN A;  5LMU Q;  3ZYY X;  3PO3 H;  3E0E A;  5ELC A;  3VR5 A;  1G29 1;  5GAH C;  3RD4 A;  4MTN A;  1A3U A;  4HSP A;  2F0I A;  3J81 L;  1ASZ A;  2JA7 G;  3KOJ A;  1Y8O B;  5GQO A;  4A76 A;  4NP5 A;  2RDF A;  3J7A 5;  3CCS A;  2F0G A;  1EFI D;  3CU7 A;  5LMN L;  1GHJ A;  4DXG A;  3J7Z C;  1NTG A;  1CHP D;  4YWL A;  3N6R A;  5DM7 3;  4WJ4 A;  1AFP A;  1PYB A;  3N52 A;  1U4P A;  4N8X 1;  2JA8 B;  4RHS A;  1HZC A;  1E22 A;  1TT2 A;  1HXY D;  2P5Z X;  3I4M H;  4CJ1 B;  2I46 A;  4HTH A;  3EQL C;  3NEL A;  4KHP L;  2C35 B;  4RHR A;  1G2S A;  3G71 A;  1M4V A;  3GTM B;  3QIA A;  3GTK H;  1HNW Q;  5HY6 A;  1PH6 A;  1K3R A;  3Q23 A;  1RF2 D;  4IZ8 A;  4DV1 Q;  1EIG A;  1Y1W B;  4WOR A;  2Y0S B;  3J7A F;  3FRP B;  4A3B G;  1VQ5 A;  4TQU S;  1PTO H;  1YIT A;  1DOL A;  2VUM H;  4B9X A;  1OTC A;  3CCR A;  1RCV D;  4CDF C;  5FLM G;  2B63 B;  4MTK A;  1T9H A;  2BH2 A;  1EWH A;  4JI2 Q;  4HMI A;  2M2L A;  1NSN S;  2UUA Q;  2D0P A;  3TBI B;  1KL9 A;  5CMD A;  3G6E A;  1K3B C;  1D7Q A;  1BO0 A;  4ZCK A;  3TRE A;  1CKO A;  5C3X A;  2E2J H;  1QVG A;  3HFZ B;  1AZP A;  5I6W A;  2VL6 A;  3A0J A;  2QCP X;  5COR A;  3H91 A;  3J7A V;  1PTO C;  1C48 A;  1VMC A;  4RG1 A;  1UNS A;  1STH A;  3HOZ G;  1FVI A;  3CCQ A;  1SMX A;  1XNR L;  5C4Z A;  2A73 B;  3TEH B;  1P8L A;  4Y7N H;  1DYQ A;  2WAQ E;  3P75 A;  5GRO A;  1W3S A;  3CRL C;  4DV0 L;  1TWH B;  4KV6 A;  3KF8 A;  3J7Y W;  2CCZ A;  1DD2 A;  4L63 B;  2K33 A;  1O7L A;  4HN7 A;  2KOL A;  3AQQ A;  2MJ8 A;  4RMF A;  1A62 A;  4JI6 Q;  2PI2 E;  3U50 C;  3JAM i;  1YBY A;  5BN5 A;  3CAM A;  4DNI A;  4BS9 A;  4C3J B;  4JI0 Q;  1A63 A;  1HJP A;  3A8J E;  1PA6 A;  1CHQ D;  4MHE A;  1Q81 C;  4BY7 G;  3JAM E;  5C4X B;  3HOY G;  2B2T A;  4J8Q A;  1VQE A;  4L5T A;  1VQ9 A;  4KJN A;  2JA6 G;  2R93 G;  4OO1 G;  2WIN B;  4EQO A;  2PO4 A;  1AZQ A;  2JA9 A;  2JE6 I;  2N8N A;  2PNH A;  2IHF A;  3I2Z A;  3PIP A;  2KQ3 A;  3S16 H;  1CSP A;  5I2Y A;  1VQN A;  5CBA E;  1F2Y A;  5EPJ A;  5M3M B;  2LY7 A;  1VQ6 A;  4GS3 A;  1BCP C;  5F2D A;  2L55 A;  2K05 A;  4EVO A;  4DR4 Q;  2XSC A;  1RDP D;  1JJ2 A;  3C2P A;  5IWA L;  2NVX H;  1JMC A;  4YY3 L;  3P20 A;  1RL2 A;  4A93 B;  1KRT A;  4LW1 A;  3ULL A;  3M4Q A;  4DV5 Q;  3KYH C;  4GOP C;  4ZUI A;  2KCC A;  3HOV G;  4YWM A;  1N33 Q;  2GVA A;  4DR3 Q;  2GVB A;  1STA A;  1I4H A;  5I9P A;  3RN5 A;  4DXF A;  1PYW D;  1WTH A;  1SMY C;  2JA6 H;  4IFD G;  4Q5V A;  5C3W A;  2K03 A;  4DR7 Q;  2UU9 L;  1J8I A;  4K2L A;  4JI3 L;  1O80 A;  5JJI A;  1B7Y B;  1J9O A;  1V43 A;  5L37 A;  1JOO A;  1S4Z A;  1SNQ A;  3CF5 A;  1H9R A;  2YYZ A;  4RCO A;  1DXM A;  3WWV A;  3W3A A;  4CGY B;  3S1R H;  1LTG D;  2KJX A;  2UXD L;  1IXR A;  4GLV B;  1R9T B;  4EX5 A;  1UAP A;  3T56 B;  2X69 A;  3PF4 A;  3SE0 A;  3L7Z C;  1QJO A;  4AQY Q;  2XGT A;  4J1M A;  4YCU A;  3MXG A;  1GVP A;  2OQ0 A;  1XWE A;  5IGB A;  4K14 A;  3DLL A;  1K73 C;  3LX0 A;  2H5X A;  1WVL A;  4A3G B;  2HQL A;  4GN3 B;  4DK1 A;  2FHT A;  1PH9 A;  4B3R Q;  1QZH A;  1PMR A;  1CI3 M;  5I2X A;  1G51 A;  1HCZ A;  4UHV A;  3HRZ C;  1XPU A;  1X54 A;  2N49 A;  2A6H C;  4POG A;  2EYF A;  1I50 B;  4JV5 Q;  1A8V A;  1V1P B;  1WFQ A;  1S5C D;  2IJ0 A;  4JK1 C;  1AH9 A;  4Q0F A;  5C3E B;  4FNF A;  3TDQ A;  1EYA A;  2ZM6 Q;  1O7I A;  2LSS A;  3TP7 A;  2FMM A;  2JA5 H;  4ZKC B;  4FXG C;  2EY6 A;  2VB3 X;  1XXG A;  2ZTE A;  1F9Q A;  1Y1V B;  4IUP A;  2WP8 J;  1RTO A;  5E1F A;  3QG1 A;  2CHB D;  2X6L A;  5C0X H;  1GM5 A;  3OPO A;  3W1B A;  4GZY C;  3M4Y A;  2Y0S E;  1DM0 B;  1HZB A;  4R4O A;  1LV9 A;  4PNY A;  4DK6 C;  5ELF A;  1WTW A;  4FXD A;  2NN6 G;  2UXB L;  1KTK A;  4I7A A;  3ITP A;  3S2H B;  3CCU A;  1I3Q B;  1NMF A;  3OTO Q;  3T13 A;  1GJX A;  3AEV A;  2C5C A;  3S1N B;  1EWC A;  1HFN A;  3K0Y A;  3HS0 C;  1LTB D;  5CV4 A;  2ALY B;  3E0J A;  4DAM A;  2IHE A;  2Q8R E;  1HTL D;  3VYR A;  4NMZ A;  3GTQ B;  3S24 A;  4CJ2 C;  2K50 A;  4DA2 A;  3KLS X;  4EGV A;  4LF6 Q;  5ELB A;  1O7Z A;  2RHQ B;  4IO9 A;  4P72 A;  4NXN L;  4DAY B;  3I8Z A;  4KN4 C;  2KHI A;  3A54 A;  5CV8 A;  3I4N B;  2TMP A;  3DHQ A;  4R8I A;  3BYY B;  4R4Q A;  1H9S A;  2K14 A;  5BN3 A;  1HPC A;  3URY A;  3PO2 B;  2NN6 H;  3OHX C;  4TKO B;  4O0A A;  3KF6 A;  1EYC A;  2EE1 A;  2G5D A;  4C1N I;  5HGT A;  2HIV A;  4DUY Q;  3KLW A;  5IIF A;  5DM6 3;  2DGY A;  5IGC A;  2F0W A;  1KAB A;  1WI5 A;  5E4W C;  1IBL Q;  2ZTD A;  1FGU A;  5C44 G;  1SYE A;  1ZKO A;  4CKE A;  1Q1E A;  3V05 A;  4NXM Q;  1PH7 A;  4BA1 I;  1S5F D;  2EZV A;  3NTI A;  1CA6 A;  1X32 A;  4UAI A;  1QNK A;  3VR4 A;  3GTJ H;  1RKN A;  3M85 A;  2IX3 A;  1CUK A;  4NPS A;  5KGU A;  4I65 A;  1ET9 A;  3SHL A;  2IX0 A;  3HGB A;  5M9O A;  2Z6K C;  5IYD G;  1F2L A;  2EVB A;  3FDT A;  1EWI A;  1D1I A;  3R3O A;  5GAE C;  5BR8 L;  2E74 C;  1WTV A;  2NVQ H;  1YNN C;  1UEA B;  4B3M L;  3K80 C;  1Q8I A;  4HID A;  1PH8 A;  1SE2 A;  5LL6 X;  2F0D A;  4KK7 A;  2J7Z A;  3BU2 A;  4R1J A;  1Q46 A;  2YTY A;  5LMN Q;  5C44 H;  2A19 A;  3NWS A;  1N32 L;  3D4D A;  1TS5 A;  3UDG A;  1DON A;  1E2V A;  4CDE C;  4DK0 A;  3M7N A;  1FNU A;  2EYP A;  1C0A A;  2NZ1 D;  3I7F A;  1A3T A;  1SBB B;  4RCN A;  1VQA A;  1V9P A;  3FKI G;  4PV1 C;  4BY1 B;  3ULJ A;  2I0Q A;  5E4X A;  1L0X B;  4GLX A;  1SYC A;  4KHP Q;  3F2U A;  2MUY A;  2XWJ B;  5JJZ A;  4LUZ A;  1C8C A;  1D5X C;  4FF4 A;  1G6Z A;  2D0O A;  5DNF A;  2RDH A;  1D2B A;  3RLO A;  1NCV A;  5I6Y A;  4K5W A;  4L8J A;  4XIG S;  4ZRZ A;  4APV A;  3K7A B;  2NZH A;  3ULP A;  3LGJ A;  1S40 A;  3BS1 A;  3CQZ H;  3AMU A;  5KEE A;  1ESF A;  1IZ6 A;  1VQ4 A;  4C3H B;  5T1I A;  4PG3 A;  1CT1 D;  2FJ2 A;  4BBS B;  1SYF A;  4A3E H;  3AU7 A;  1SJH D;  3ERQ A;  2XRS D;  3AFQ A;  3E3X A;  1HNZ L;  2O2L D;  2PZU A;  4KLK A;  1Q82 C;  4A3D B;  1QUQ A;  1SR3 A;  4PMC A;  3QR8 A;  3SGI A;  1VQD A;  3E9I A;  2BOS A;  1EYD A;  3PV0 A;  3RLN A;  3T16 A;  3TS2 A;  1GHK A;  4HCE A;  4B3S L;  1I6H H;  1PRT C;  4TRD A;  4OO1 I;  1G6P A;  5IOD A;  3SK4 A;  3ICE A;  2SOB A;  1IYU A;  4C3I G;  4QGU A;  1KNE A;  2R61 A;  2Z1C A;  3U9O A;  1W2B A;  4RA8 A;  4AYB B;  2ZTC A;  1SFO B;  1PXU A;  2KED A;  1LTS D;  1FL0 A;  3HOX G;  2YTX A;  1WCM G;  1B8A A;  2VXW A;  4LFA L;  1XNR Q;  4OWT B;  1EU3 A;  2NVY H;  3FMC A;  1UWV A;  2R92 H;  3MEH A;  4DV0 Q;  5D3I B;  3KJP A;  3S2D B;  2KVM A;  4JBW A;  4LF4 L;  2ZJR A;  2Q2U A;  3HOW B;  1BBW A;  2YU9 B;  5JAV A;  2RQX A;  2NVT B;  2GN5 A;  1YI2 A;  1L0Y B;  5AJ3 L;  1H9K A;  1LTI D;  2Z6B A;  4L5S A;  1ZYR C;  3PO3 B;  1GUN A;  2V1C C;  3KBX A;  4KY5 A;  1SNP A;  4JI4 L;  4RWS C;  4IFD I;  1JJG A;  3K5L A;  3K57 A;  1FNW A;  4QJF A;  2DY8 A;  1WTQ A;  2A69 D;  4IUT A;  1XMQ L;  2A6E C;  3HOX H;  3UI2 A;  1XMO L;  4K5X A;  1WCM H;  1GUW A;  4F8M A;  3QWN A;  2QDL A;  4HED A;  1SN8 A;  1YHB A;  2KUM A;  1FYC A;  2R7F A;  3KFU A;  3G4S A;  3I4O A;  3KUP A;  4FF1 A;  1E0B A;  1HA6 A;  1JWM D;  1YNJ D;  5IWA Q;  3SEB A;  4YY3 Q;  3H15 A;  5G3L D;  2MNA A;  4JBJ A;  3RUZ A;  1X3G A;  1GO3 E;  1II3 A;  4G7H C;  2F0E A;  2BA0 A;  3GTK B;  3G7L A;  2L1B A;  2F3I A;  3HKZ B;  2F0F A;  3X3M A;  1VDZ A;  2CH4 W;  1K8G A;  1Z9F A;  1WTX A;  2UU9 Q;  2WAQ G;  5M5Y B;  3MTS A;  4JI3 Q;  4FF2 A;  4LK1 C;  2EJG C;  1BCP F;  4A3K H;  1E2Z A;  1BVS A;  2VUM B;  2EYJ A;  2ES2 A;  1PZK D;  2F52 A;  4K5V A;  3RR5 A;  1ET6 A;  2HQE A;  1EFW A;  3D6W A;  4HIK A;  5IP9 G;  5JPM C;  3U4Z A;  3PIO 3;  2UXD Q;  4WJ3 M;  1STG A;  1I4R A;  3J80 c;  1I4Q A;  4XXE A;  4JCV E;  4V19 0;  2CQA A;  2LXJ A;  1I4G A;  3M4O H;  2XN9 C;  2E2J B;  2HCC A;  3DEO A;  1JOQ A;  1NAP A;  1WOC A;  2K5V A;  2ICE C;  2PMZ B;  5FKA C;  4XQQ A;  5M5X H;  5GAD C;  2BH8 A;  1EIH A;  3IFT A;  4PQX A;  2NN6 I;  1VQG A;  4KN7 C;  2AWO A;  1EY6 A;  2CFM A;  3A8K E;  3TP8 A;  2D62 A;  5KYI A;  2JYO A;  3M3Y H;  2MO1 A;  1X55 A;  1CM9 A;  2FIN B;  1CKN B;  1Q7Y C;  1TWC B;  2M9V A;  2OXP A;  1PFS A;  1G8Z D;  1IYV A;  5M3F H;  2Q2T A;  2QA4 A;  3NSW A;  4GOP A;  1K8A C;  4DFA A;  2Q8I B;  1O7Y A;  1Y8P B;  4X3U A;  2D5D A;  3HOU H;  2VQE L;  1ILP A;  2B8G A;  2EJF C;  1BCP B;  4HJ9 A;  3GTP H;  4KY6 A;  4B3T L;  3EFX D;  4BBR B;  1X3F A;  2HIX A;  5D14 A;  4OIJ A;  1XX8 A;  3DXJ C;  1BNZ A;  4QCL A;  4C2M B;  2F0S A;  2AQ2 B;  2HCI A;  1DJR D;  3CD6 A;  1TY2 A;  3F8T A;  2JA7 H;  1AE3 A;  5IT9 E;  1B53 A;  4IPD A;  3I56 A;  3R93 A;  1LAB A;  1LLR D;  3STB D;  2UXB Q;  4LF8 L;  2L5T A;  1JE5 A;  5EKK A;  4JYA L;  4IUR A;  1GUS A;  4QB4 A;  2F0Q A;  1H95 A;  1UUP A;  1SEB D;  3S16 B;  4X62 L;  1GOZ A;  4A3I G;  3LNN A;  4DR2 L;  2JK8 A;  5HUR A;  4V0B A;  3WOF A;  2E5L L;  1VQI A;  4QUF A;  1K0R A;  2NVX B;  1XJV A;  4KKU A;  3K59 A;  1T5E A;  1B44 D;  3SK8 A;  5EQ0 A;  2BA1 A;  3DEP A;  3NBH A;  1PH3 A;  3GTL H;  2K5W A;  1TWA H;  4NXN Q;  2IT1 A;  1N8R C;  2IW3 A;  1ML0 D;  3S1Q H;  3I73 A;  1L1O C;  4DV3 L;  3I90 A;  1J6Q A;  2HHH L;  2JA8 G;  4AYB E;  1S5D D;  4IJL A;  4XDX A;  4IUN A;  1CZG A;  5EAY A;  3NBH B;  2JEB I;  1X9N A;  1SXT A;  5J39 A;  3KK7 A;  4A3B H;  4CJ0 B;  4QY7 A;  3PUW A;  1EEI D;  2NTS A;  1EQV A;  2UUB L;  1JQY D;  5JVG 3;  3VR6 A;  4A3I H;  5FLM H;  3KJO A;  1UE5 A;  1OXV A;  3V2T A;  3S1R B;  5J1Z A;  2ZT9 C;  1U9R A;  4MNO A;  3TRZ A;  3D6C A;  2DNC A;  2F0J A;  2QEJ C;  1M8A A;  4DN4 M;  2C9O A;  1K0S A;  4LUO A;  2EYO A;  4U67 3;  1Y1W G;  3PCO B;  2Y0S G;  3D4R A;  3KF8 B;  1YNX A;  1CFM A;  4LFB L;  4RAU C;  2SEB D;  1B9N A;  4KY7 A;  4UP8 A;  2JA8 H;  1TII D;  2B63 G;  5BR8 Q;  2RKS A;  4X64 L;  3T4A C;  1KAW A;  4B3M Q;  3HOZ H;  2B2U C;  2F0O A;  5C6A A;  2AKW B;  5CGK A;  2V4D A;  3HEJ A;  4X6A H;  2K6A A;  3BVG A;  5LMN W;  2WKD A;  1Q12 A;  2F03 A;  1LT6 D;  1EQT A;  1N32 Q;  1PZI D;  1KLG D;  3J81 E;  2BCO A;  1JB7 A;  1BR9 A;  3TME A;  1SE4 A;  2NYZ D;  3GTG H;  2JA5 B;  2RDG A;  2CVR A;  1Y1W H;  1VQJ A;  2GA4 B;  4H7B A;  2MGS A;  2ASB A;  2VS1 A;  1WYD A;  2K1B A;  4BY7 H;  3R2I A;  3FPP A;  4R4T A;  4A3F B;  3HKZ E;  4RKL A;  1PH5 A;  3HOY H;  4IFD J;  3X3N A;  3BZK A;  5IT9 c;  2JSO A;  2B63 H;  3KDF A;  4HJ7 A;  4A75 A;  4ME5 A;  2R93 H;  4OO1 H;  5FLX L;  3HZX A;  2IL8 A;  1LM0 A;  3F2D A;  4QQB X;  3RMH A;  2CW0 D;  1W6K A;  2RSO A;  2B29 A;  4HJ5 A;  4JBM A;  1EY8 A;  1QIL A;  4C3J G;  1STB A;  5H1S E;  1Q8K A;  1TVX A;  5C4X G;  1QVF A;  5HGQ A;  2F0M A;  1B1Z A;  3NK9 A;  4B08 A;  4ME3 A;  5FO9 B;  4ZUJ A;  4IJH A;  1HNZ Q;  4A3L G;  3HOV H;  3U4V A;  2Z6K A;  1B2T A;  2PMZ E;  2I5M X;  1XYI A;  2F4V L;  3PIP 3;  2YV5 A;  3R2T A;  2K75 A;  1Y69 U;  4F7X A;  3NQT A;  4X3S A;  1MBY A;  4B3S Q;  4IFD H;  3NPP A;  1TWH H;  5M3M G;  1Q90 A;  3DWQ A;  1XPR A;  1A6X A;  1K83 H;  1A2T A;  1GD7 A;  1LTR D;  2D9U A;  1JCK B;  1EU4 A;  1EY5 A;  3VR3 A;  3PUY A;  1U4M A;  4MIU A;  4A93 G;  4C3J H;  2N78 A;  4BXX G;  3S14 H;  1TKW B;  4LFA Q;  4X65 L;  1P16 A;  3QO2 A;  1STE A;  3FVQ A;  1IBM L;  2B2V C;  1U0L A;  4LF4 Q;  3G6J B;  2Q8T A;  4A3L H;  3EJI A;  3GTJ B;  3JAM c;  1PRT F;  4A3M B;  2N55 A;  5IGE A;  2R7D A;  2EYH A;  5AJ3 Q;  3TN2 A;  1TWG H;  4IUQ A;  4IPG A;  1WTO A;  5ISR A;  1SNM A;  4O42 A;  4JI4 Q;  1J5E L;  1I94 L;  3EVQ A;  2B2W C;  4LJZ C;  2XIW A;  2NVQ B;  3BDL A;  1HZA A;  5A2Q L;  2UXC L;  2KCT A;  1M90 C;  4DR6 L;  1XMQ Q;  4BXX H;  1XMO Q;  2N3S A;  4DK3 C;  3S17 H;  2KEN A;  2NB0 A;  1JT8 A;  5ELD A;  5C4J H;  4Z9C B;  1F77 A;  4X3K A;  3C3L A;  3IRB A;  3FPU B;  4I7Z C;  4O1N A;  4A3G G;  1LUZ A;  3D3R A;  5J3B A;  4K6D A;  2Z8L A;  2I5L X;  1RIP A;  3T53 B;  3TQY A;  4DV4 L;  1C7Y A;  1IBK L;  3Q6S A;  2L9H A;  2RA4 A;  3RZO H;  1PVO A;  2TSS A;  1VQM A;  1JIC A;  2UUC L;  3DWA A;  4H13 C;  2HUG A;  2L0C A;  4DNT B;  3J80 L;  1ONL A;  3B6Y A;  1PFN A;  1EIY B;  1YVC A;  5C3E G;  3NBI A;  3NXW A;  3GV3 A;  3OYY A;  2CH4 A;  1PRT B;  1TWF H;  4PZ7 A;  4UDU C;  3WOE A;  1RD9 D;  4M8A A;  1HH2 P;  1BUV T;  3K6O A;  1Y1V G;  3H0G B;  1H9S B;  2L11 A;  3CQZ B;  1QNU A;  4PZ6 A;  4CDD C;  5JJK A;  2SDF A;  1EL0 A;  3D8G A;  3BJU A;  3DUZ A;  3KF6 B;  1E1T A;  3P7J A;  4A3E B;  1PYS B;  2BDO A;  4DR5 L;  3UE0 A;  2R6G A;  2WB1 B;  3VA5 A;  1RJT A;  2F3W A;  4JVZ A;  4QF4 A;  1CQF A;  5C5M A;  5JVH 3;  1AN8 A;  1GUO A;  4IUV A;  1SSO A;  2DN8 A;  1VQC A;  1HQR D;  3V96 A;  1N9W A;  2QW7 A;  1I6H B;  3M9B A;  1JB3 A;  2XNA C;  5C3E H;  3RLF A;  1PLF A;  2A68 D;  2RCF A;  1EYG A;  2F0N A;  2VY3 A;  3PUX A;  2K7V A;  1CSQ A;  1LTT D;  2F0P A;  1HUN A;  1IW7 D;  3K0X A;  1GUT A;  1SYB A;  3AYH B;  2PW5 A;  1PDQ A;  2IX1 A;  3CC7 A;  4E6I A;  2NVY B;  3I4N G;  4AH6 A;  4FF3 A;  5CYU A;  3NQI A;  2K5Q A;  3K5M A;  2R92 B;  4DV6 L;  3PO2 G;  2RCN A;  1GUG A;  2L12 A;  4GN5 A;  4HAE A;  5EGT A;  1MGS A;  2VQE Q;  4OWW B;  2LS0 1;  2K04 A;  3P1H A;  4CBV A;  4B3T Q;  1SJE D;  4YHH L;  3S1N H;  1BKB A;  5IYD H;  3I3C A;  3JC6 6;  1WTP A;  2EIF A;  1E1O A;  3S15 B;  4JI1 L;  3K5N A;  4NB3 A;  5IE8 A;  4BWG B;  3VR2 A;  1A0I A;  4LF8 Q;  1Y8N B;  4JYA Q;  2FMC A;  4M1U B;  5IYB G;  4X62 Q;  2ZXO A;  4L5Q A;  3LWE A;  3BDC A;  2NWG A;  4DR2 Q;  4YIJ A;  3MFG A;  3PO2 H;  3CP0 A;  2E5L Q;  4L6T B;  1SAP A;  3FKI H;  1STY A;  4UPA A;  1KAA A;  1KRS A;  2WKC A;  4HCS A;  1YJW A;  4DV7 L;  1IYJ B;  1B9M A;  2M00 A;  1ASY A;  2NBF A;  3TS0 A;  2KCM A;  2ZJQ A;  5CV5 A;  3MZ5 A;  4DV3 Q;  1YEZ A;  1Q86 C;  3IKJ A;  3D31 A;  2HHH Q;  3OIP A;  3E5S A;  2X6G A;  3I91 A;  4IN3 A;  1N34 L;  1O78 A;  5EJW A;  2E2H B;  2EQS A;  1V8Q A;  2CWA A;  1QUQ B;  4XYQ A;  3W5O A;  2E75 C;  3CXC A;  4A3K B;  4BY1 G;  4CKB A;  1SNC A;  3OWE B;  2EXD A;  2UUB Q;  3MVV A;  1D1K A;  1QCB D;  2MP1 A;  2LFN A;  1VQB A;  2EJM A;  1T5X D;  4DGZ A;  3PSI A;  1MJC A;  4IPH A;  4A3J B;  2EPB A;  2E76 C;  1QG7 A;  1SLJ A;  1G91 A;  1HHV A;  3L2P A;  3GTO H;  4JG2 A;  1PTO F;  2PCF B;  4HR7 B;  1VF5 C;  1Z7T A;  2KCN A;  2HDM A;  2R7Z B;  3UDF A;  2PI2 A;  4PMW A;  3U9S A;  1ILQ A;  4KKT A;  4DV2 L;  3RZD H;  2Z4H A;  1BOS A;  4LFB Q;  4C3H G;  4J6H A;  3F2B A;  2Z4I A;  5AFW A;  4C3I H;  4OHJ A;  1S5B D;  1KQS A;  1KHI A;  4X64 Q;  5DEH A;  1EY4 A;  3M3Y B;  4BY1 H;  3S1M H;  1ENC A;  1NNX A;  2NUC A;  5IT9 L;  3E6Z X;  4A3D G;  3MC0 B;  1HQM C;  4K0K L;  1XTD A;  1SYG A;  5M3F B;  3PIO A;  3PF5 A;  3I4M B;  4DPG A;  1EY7 A;  1X56 A;  4OL7 A;  1HFG A;  3HOU B;  1BQQ T;  3BZD B;  2QGQ A;  4AYB G;  1LT5 D;  3GTP B;  4ULL A;  1L1O A;  3Q0A A;  4R4I A;  4GKJ L;  5KRU A;  1QVC A;  1SDF A;  4ZQ3 A;  4XT3 B;  1PFB A;  1VMP A;  4OX9 Q;  2JA7 B;  3HOW G;  2LMC B;  3A7L A;  1L1O B;  1BBU A;  1Z47 A;  3FHW A;  4OEM B;  4DF7 A;  2H1E A;  1PTO B;  5DAU A;  1K8M A;  2VQF L;  4X3T A;  2KHJ A;  2OTJ A;  2VNU D;  2WB1 E;  3SDZ A;  3PO3 G;  1DZ1 A;  1EQR A;  3UDX A;  2RHS B;  5KNB A;  4ABN A;  2DY7 A;  3QJY A;  1AW7 A;  2AUJ D;  1SFO H;  3GTL B;  2EXZ A;  2MQH A;  1FNV A;  2F4V Q;  3T51 B;  1FGB D;  4ZAI A;  3S1Q B;  4WJW A;  1PTO D;  4A4I A;  1QOH A;  1S5E D;  1KD1 C;  3H3V H;  4GKK L;  4JOI C;  2B2U A;  4JI5 L;  2O4X A;  1HR0 L;  4J15 A;  1A3V A;  2JJQ A;  3JAM L;  4NDX A;  5M5W H;  1LYL A;  4N9T A;  1EUJ A;  2YU9 H;  4A3B B;  5IGD A;  3C46 A;  2NVT H;  3AB9 A;  4CKC A;  1QB5 D;  1TQO A;  4OIK A;  1CA5 A;  2EY1 A;  1I4P A;  3MFY A;  4LWC A;  1X65 A;  2F0T A;  4X65 Q;  4Y7N B;  5FK9 C;  1WD0 A;  5JEA J;  4XQN A;  4KTA A;  5IP9 H;  1DGS A;  1IBM Q;  3HKZ G;  4O2D A;  1CTM A;  1TR5 A;  5JEA G;  3OMC A;  1A15 A;  5IYC G;  4KJO A;  3H3V C;  2Z0S A;  1OXX K;  3KBG A;  2A69 C;  4OEL B;  4GNX C;  4DUZ L;  2B3G A;  3FP9 A;  1E3P A;  4XTC S;  1KLU D;  4AIM A;  2VUM G;  4GOP B;  4PZ8 A;  4DR1 L;  1J5E Q;  4LFC L;  1I94 Q;  1IL2 A;  4RH6 A;  1QZG A;  4JI8 L;  3HOZ B;  1XNQ L;  2UXC Q;  2OT2 A;  4DAV A;  1Q1B A;  4G4K A;  1SE3 A;  3GQB A;  1YNJ C;  1OO9 B;  4DR6 Q;  1WTR A;  3NTH A;  4POF A;  1BCP D;  2K01 A;  5E7N A;  1HZ9 A;  4RGT A;  3NP8 A;  1LTL A;  2WII B;  3A5U A;  5EBC A;  5JEA H;  2EDG A;  5IYC H;  5LL6 S;  3GTG B;  3IAY A;  5M5Y H;  3EA6 A;  1RTN A;  3SR1 A;  5COY A;  4BY7 B;  3BVZ A;  4DV4 Q;  3Q8D A;  1G2T A;  3OIQ A;  1SMY D;  1IBK Q;  3HOY B;  2RSN A;  5I9O A;  2D2C C;  2L4N A;  2G9H D;  5CR3 A;  4NW2 A;  2UUC Q;  5K36 G;  4QIW B;  2JA6 B;  2R93 B;  4LF7 L;  1A2U A;  2BDN A;  3NE5 B;  2QEX A;  2I07 B;  4N9P A;  3MHB A;  1UEB A;  4OWX B;  4EQN A;  2Z9H A;  2KHS A;  1YIJ A;  2E2I H;  2B2V A;  2RF4 A;  3L3O C;  4BBR G;  2WFW A;  4P71 A;  3A8I E;  1GXD C;  5EKI A;  1SNO A;  1ICF B;  2XTI A;  1X3P A;  1NJI C;  4XYO A;  4DR5 Q;  3CCV A;  4MZ9 A;  1TXY A;  2B2Y C;  4PMB A;  3HOV B;  2EYM A;  3CME A;  2EYL A;  2OF1 A;  1TWC H;  2PYK A;  3I4L A;  3WDN A;  2B2W A;  2F1M A;  1X3Q A;  1B3A A;  2NTT A;  4UY8 C;  4LF9 L;  5K36 H;  4DAP A;  1HR0 W;  2O5J C;  1E2W A;  3CCL A;  1K83 B;  2AHO B;  2PQA A;  2A6H D;  3D4W A;  3NHH A;  4XT1 B;  3BDO A;  5BN4 A;  3J81 i;  1M1K C;  2K5H A;  4TVA B;  4LF5 L;  3NEM A;  5IP7 G;  3Q24 A;  5JOB A;  3ZJY C;  4BBR H;  3S14 B;  3ND9 A;  2R3Z A;  4XQJ A;  4U68 A;  5KNC A;  3GTM H;  1EY0 A;  2PQA B;  4C2M H;  3TSS A;  2AWN A;  4DV6 Q;  4ZK9 B;  1KDC A;  1MSH A;  2VW9 A;  1GKH A;  2NZO A;  1FJG L;  3BZC A;  1EY9 A;  3HKS A;  4BA2 I;  5CC4 A; 
#chains in the Genus database with same CATH homology
 1LT3 D;  2K5D A;  4KHZ A;  1TWG B;  4KI0 A;  2ENB A;  1OXT A;  4EQP A;  1DOM A;  3PMF A;  1BXT A;  4F87 A;  3ONA B;  2WV6 D;  3TP6 A;  3R8B A;  1W6J A;  3OOC A;  2KEE A;  3K5O A;  4RKB A;  1F9S A;  5EBD A;  3S17 B;  4KD4 A;  3ERO A;  5C4J B;  1DCZ A;  4C1N K;  1ICW A;  2J0T D;  2KA7 A;  4KHV A;  5IOC A;  2F3V A;  4OGQ C;  1JE4 A;  4R8N A;  4ODG A;  3NWT A;  4H44 C;  2FFK B;  2A5H A;  3S9W A;  3RZO B;  4ZKB B;  3C1F A;  1H9M A;  5EKL A;  1JOR A;  2PZW A;  1ENF A;  1TWF B;  1I6V C;  3SK5 A;  4FP5 D;  5C0X J;  1LT4 D;  2JXM B;  1V1O A;  2EY2 A;  3NUC A;  1V1P A;  5C0X G;  1IL8 A;  5KND A;  3DM1 A;  1TU2 B;  4K8I A;  1D5Z C;  2PQE A;  1TY0 A;  3Q22 A;  5JPN C;  1NUC A;  3CKI B;  3FEW X;  3VA7 A;  1PZJ D;  3OSO A;  1YNN D;  4H0L C;  1DOK A;  3QOJ A;  2WAC A;  3O13 A;  3DMU A;  2HDL A;  5CBE E;  2AQ3 B;  4S3S A;  1F2Z A;  5KYL A;  5C44 B;  1ROD A;  2J4X A;  1CK1 A;  3IL8 A;  3OWF A;  4HSV A;  4FXK C;  2DNE A;  4RGO S;  2B2T C;  2MHV A;  2RVL A;  3KLS A;  2H4O A;  1TS4 A;  2CW0 C;  4G7O C;  2A74 C;  4DAY A;  3M7G A;  1CQV A;  1EZ6 A;  3TZD A;  3MXP A;  2XVS A;  5K5P A;  4IAL A;  1B4O A;  1JWU D;  4P2C B;  1OXU A;  1CZW A;  4ILW A;  5D65 A;  3MAQ A;  2ZXR A;  3L9A X;  1HTP A;  1JR0 D;  1Z6H A;  5FLX E;  1U4L A;  3MXU A;  4WFN 3;  4ID6 A;  2K28 A;  3FKI B;  1NR2 A;  1KNA A;  3PUV A;  1U4R A;  3DWP A;  2F0K A;  2F0L A;  1PRT D;  2EOT A;  1FR3 A;  2O5I C;  3HG9 A;  2ID0 A;  3VYS A;  5D3D A;  1I4X A;  1JWS D;  3TZU A;  3H09 A;  1TS3 A;  4QMG A;  4TSS A;  1H9J A;  3VYU A;  2ICI A;  4R9W A;  1LO5 D;  2F0U A;  1R4P B;  5ELE A;  3HP3 A;  4RFB A;  4CHT B;  2ZXP A;  1BDO A;  1LAC A;  2EY5 A;  4DNR B;  3OW7 A;  3GTO B;  1ZYR D;  5FO7 B;  3GD7 A;  1EZ8 A;  3RZD B;  5CV7 A;  3H6M A;  2PPB C;  2A6E D;  4C3I B;  1JC7 A;  1PFM A;  5A35 A;  1SND A;  4K6L A;  1WD1 A;  3S1M B;  4RGM A;  3HOX B;  3I72 A;  1WCM B;  1SYD A;  3SK6 A;  2AQ1 B;  5FO8 B;  1XTC D;  5A2Q E;  1D5M C;  2BE5 D;  3IFD A;  1R4Q B;  1ZXT A;  2QDB A;  1IKL A;  5NUC A;  4K8J A;  2VB2 X;  4MN3 A;  3SVM A;  2PNR C;  3A7A B;  3TP5 A;  4F88 A;  4B9W A;  4LMQ D;  4QUC A;  2XRQ D;  2QIL A;  3VYT A;  1VF7 A;  1F2M A;  5G3L F;  5EPK A;  1ENA A;  1TS2 A;  4C56 C;  2SNS A;  4HMJ A;  2KEC A;  5LHY 1;  2OEO A;  5FOB B;  2IWH A;  1ESR A;  1STN A;  4FO2 A;  2QKI C;  1ZEQ X;  3MXN A;  3ND8 A;  3J80 E;  4K2K A;  2F0V A;  3LWU A;  1BBX C;  3PUZ A;  5E3F A;  4ZYS A;  4KMU C;  2A68 C;  5EPL A;  3H94 A;  3M4O B;  1VCI A;  4WRD A;  1EOT A;  4LAA A;  1IW7 C;  2SNM A;  2LKV A;  5M5X B;  3I70 A;  1B50 A;  1RHP A;  1BF4 A;  1IHZ A;  2XWB B;  1KDB A;  5M5W B;  2WAQ B;  2K32 A;  4FVM A;  5C4H A;  1EEF D;  3A55 A;  2B39 A;  1HRJ A;  3BYT B;  1D6E C;  5CV6 A;  1K8O A;  3W2D A;  3KLR A;  4KKS A;  2E2D C;  1AEX A;  4G57 A;  3CHB D;  1QWY A;  2PW7 A;  1MI2 A;  1AP0 A;  2RBM A;  1F9R A;  1JOK A;  2JP1 A;  2QF7 A;  5KIX A;  1LTA D;  4NKL A;  1QE6 A;  5IGF A;  3GO5 A;  3NTK A;  5J22 A;  2F0H A;  4KD3 A;  3BG3 A;  5IGG A;  2PZT A;  1F9P A;  2N88 A;  2BE5 C;  1HUM A;  4DU9 A;  1MSG A;  3MA2 B;  1HA5 A;  3QOL A;  4IUU A;  3BVM A;  4ZLT F;  5TSS A;  2IPK D;  2AUK A;  2G9D A;  5C0X I;  4FYD A;  2F4I A;  1FD7 D;  3SXH A;  2B2Y A;  2B8F A;  3OMG A;  4G7Z C;  5I4D A;  1Q3L A;  3QB3 A;  3MWY W;  1KDA A;  1TWA B;  4IQZ A;  1IKM A;  3A56 A;  1OXS C;  3C1E A;  1MD2 D;  2MPM A;  5CV9 A;  2JEA I;  3GV6 A;  3GP7 A;  1C4Q A;  5T1G A;  5C5L A;  4RGN A;  3CRK C;  3K58 A;  2E2I B;  1NR4 A;  4A3I B;  3ZYY X;  5ELC A;  3VR5 A;  1G29 1;  3RD4 A;  1A3U A;  4HSP A;  2F0I A;  3J81 L;  1Y8O B;  4NP5 A;  2RDF A;  2F0G A;  1EFI D;  3CU7 A;  1GHJ A;  4DXG A;  1CHP D;  3N6R A;  5DM7 3;  1AFP A;  3N52 A;  1U4P A;  2JA8 B;  4RHS A;  1TT2 A;  1HXY D;  4CJ1 B;  2I46 A;  4HTH A;  3EQL C;  4RHR A;  1G2S A;  1M4V A;  3GTM B;  3QIA A;  3Q23 A;  1RF2 D;  4IZ8 A;  1EIG A;  1Y1W B;  4WOR A;  2Y0S B;  3J7A F;  3FRP B;  4TQU S;  1PTO H;  1DOL A;  4B9X A;  1RCV D;  2B63 B;  1EWH A;  4HMI A;  2M2L A;  1NSN S;  3TBI B;  5CMD A;  1BO0 A;  5C3X A;  1AZP A;  5I6W A;  5COR A;  2QCP X;  3H91 A;  3J7A V;  1PTO C;  1C48 A;  1VMC A;  1UNS A;  1STH A;  5C4Z A;  2A73 B;  1DYQ A;  3P75 A;  3CRL C;  1TWH B;  4KV6 A;  3KF8 A;  3J7Y W;  1DD2 A;  4L63 B;  2K33 A;  1O7L A;  4HN7 A;  2KOL A;  2MJ8 A;  5BN5 A;  4BS9 A;  4C3J B;  3A8J E;  1CHQ D;  4MHE A;  3JAM E;  5C4X B;  2B2T A;  4J8Q A;  4KJN A;  4OO1 G;  2WIN B;  4EQO A;  2PO4 A;  1AZQ A;  2JE6 I;  2KQ3 A;  5I2Y A;  5CBA E;  1F2Y A;  5EPJ A;  5M3M B;  2LY7 A;  1BCP C;  5F2D A;  2L55 A;  2K05 A;  4EVO A;  2XSC A;  1RDP D;  3C2P A;  3P20 A;  4A93 B;  4ZUI A;  2KCC A;  1STA A;  1I4H A;  5I9P A;  4DXF A;  1PYW D;  1SMY C;  4IFD G;  4Q5V A;  5C3W A;  2K03 A;  1J8I A;  4K2L A;  1O80 A;  1J9O A;  1V43 A;  1JOO A;  1S4Z A;  1SNQ A;  1H9R A;  2YYZ A;  4RCO A;  1DXM A;  3W3A A;  4CGY B;  1LTG D;  2KJX A;  1R9T B;  1UAP A;  3T56 B;  2X69 A;  3SE0 A;  3L7Z C;  1QJO A;  4J1M A;  3MXG A;  1XWE A;  5IGB A;  4K14 A;  3LX0 A;  1WVL A;  4A3G B;  4DK1 A;  2FHT A;  1PMR A;  1CI3 M;  5I2X A;  1HCZ A;  3HRZ C;  2A6H C;  2EYF A;  1I50 B;  1V1P B;  1S5C D;  2IJ0 A;  4JK1 C;  4Q0F A;  5C3E B;  4FNF A;  3TDQ A;  1EYA A;  3TP7 A;  2FMM A;  4ZKC B;  4FXG C;  2EY6 A;  2VB3 X;  1XXG A;  1F9Q A;  1Y1V B;  4IUP A;  2WP8 J;  1RTO A;  5E1F A;  3QG1 A;  2CHB D;  2X6L A;  5C0X H;  3OPO A;  4GZY C;  3M4Y A;  1DM0 B;  1LV9 A;  4PNY A;  1WTW A;  5ELF A;  4FXD A;  2NN6 G;  1KTK A;  3ITP A;  3S2H B;  1I3Q B;  3T13 A;  1GJX A;  2C5C A;  3S1N B;  1EWC A;  1HFN A;  3K0Y A;  3HS0 C;  1LTB D;  5CV4 A;  3E0J A;  2Q8R E;  1HTL D;  3VYR A;  4NMZ A;  3GTQ B;  4CJ2 C;  4DA2 A;  3KLS X;  4EGV A;  5ELB A;  1O7Z A;  3I8Z A;  4KN4 C;  3A54 A;  5CV8 A;  3I4N B;  2TMP A;  3DHQ A;  4R8I A;  3BYY B;  1H9S A;  5BN3 A;  1HPC A;  3URY A;  3PO2 B;  2NN6 H;  3OHX C;  4TKO B;  1EYC A;  2EE1 A;  4C1N I;  5HGT A;  5IIF A;  5DM6 3;  5IGC A;  2F0W A;  1KAB A;  5E4W C;  1SYE A;  1ZKO A;  4CKE A;  1Q1E A;  3V05 A;  4BA1 I;  1S5F D;  2EZV A;  3NTI A;  1CA6 A;  1X32 A;  4UAI A;  1QNK A;  3VR4 A;  1RKN A;  3M85 A;  2IX3 A;  5KGU A;  4I65 A;  1ET9 A;  3SHL A;  2IX0 A;  3HGB A;  5M9O A;  1F2L A;  2EVB A;  3FDT A;  1D1I A;  3R3O A;  2E74 C;  1WTV A;  1YNN C;  1UEA B;  1Q8I A;  1SE2 A;  5LL6 X;  2F0D A;  4KK7 A;  2J7Z A;  3NWS A;  3D4D A;  1TS5 A;  1DON A;  1E2V A;  4DK0 A;  3M7N A;  1FNU A;  2EYP A;  2NZ1 D;  1A3T A;  1SBB B;  4RCN A;  4PV1 C;  4BY1 B;  5E4X A;  1L0X B;  1SYC A;  3F2U A;  2MUY A;  2XWJ B;  5JJZ A;  1C8C A;  1D5X C;  4FF4 A;  1G6Z A;  5DNF A;  2RDH A;  1D2B A;  1NCV A;  5I6Y A;  4K5W A;  4L8J A;  4XIG S;  4ZRZ A;  3K7A B;  3BS1 A;  3AMU A;  5KEE A;  1ESF A;  4C3H B;  5T1I A;  1CT1 D;  2FJ2 A;  4BBS B;  1SYF A;  3AU7 A;  1SJH D;  3ERQ A;  2XRS D;  2O2L D;  2PZU A;  4A3D B;  4PMC A;  2BOS A;  1EYD A;  3PV0 A;  3T16 A;  1GHK A;  4HCE A;  1PRT C;  4TRD A;  4OO1 I;  5IOD A;  3SK4 A;  2SOB A;  1IYU A;  4C3I G;  1KNE A;  2R61 A;  2Z1C A;  3U9O A;  4RA8 A;  4AYB B;  1SFO B;  1PXU A;  2KED A;  1LTS D;  2VXW A;  1EU3 A;  3FMC A;  3MEH A;  5D3I B;  3S2D B;  2KVM A;  4JBW A;  3HOW B;  2YU9 B;  5JAV A;  2RQX A;  2NVT B;  1L0Y B;  1H9K A;  1LTI D;  1ZYR C;  3PO3 B;  1GUN A;  4KY5 A;  3KBX A;  4IFD I;  1SNP A;  4RWS C;  3K5L A;  3K57 A;  1FNW A;  2DY8 A;  1WTQ A;  2A69 D;  4IUT A;  2A6E C;  3UI2 A;  4K5X A;  1GUW A;  4F8M A;  3QWN A;  4HED A;  2KUM A;  1FYC A;  3KUP A;  4FF1 A;  1E0B A;  1HA6 A;  1JWM D;  1YNJ D;  3SEB A;  5G3L D;  3RUZ A;  1II3 A;  4G7H C;  2F0E A;  2BA0 A;  3GTK B;  3G7L A;  2L1B A;  3HKZ B;  2F0F A;  3X3M A;  1VDZ A;  1WTX A;  5M5Y B;  3MTS A;  4FF2 A;  4LK1 C;  2EJG C;  1BCP F;  1E2Z A;  2VUM B;  2EYJ A;  1PZK D;  4K5V A;  1ET6 A;  2HQE A;  3D6W A;  5JPM C;  3PIO 3;  1STG A;  1I4R A;  1I4Q A;  4XXE A;  4V19 0;  2CQA A;  1I4G A;  2XN9 C;  2E2J B;  2HCC A;  3DEO A;  1JOQ A;  1NAP A;  2PMZ B;  2ICE C;  5FKA C;  4XQQ A;  1EIH A;  3IFT A;  4PQX A;  2NN6 I;  4KN7 C;  2AWO A;  1EY6 A;  3A8K E;  3TP8 A;  2D62 A;  5KYI A;  2JYO A;  1CM9 A;  2FIN B;  1TWC B;  2M9V A;  2OXP A;  1G8Z D;  1IYV A;  3NSW A;  4DFA A;  2Q8I B;  1O7Y A;  1Y8P B;  4X3U A;  2D5D A;  1ILP A;  2B8G A;  2EJF C;  1BCP B;  4KY6 A;  3EFX D;  4BBR B;  5D14 A;  4OIJ A;  1XX8 A;  3DXJ C;  1BNZ A;  4QCL A;  4C2M B;  2F0S A;  2AQ2 B;  2HCI A;  1DJR D;  1TY2 A;  5IT9 E;  1B53 A;  3R93 A;  1LAB A;  1LLR D;  2L5T A;  5EKK A;  4IUR A;  1GUS A;  4QB4 A;  2F0Q A;  1UUP A;  1SEB D;  3S16 B;  1GOZ A;  3LNN A;  5HUR A;  4V0B A;  3WOF A;  4QUF A;  2NVX B;  4KKU A;  3K59 A;  1T5E A;  1B44 D;  3SK8 A;  5EQ0 A;  2BA1 A;  3DEP A;  3NBH A;  2K5W A;  2IT1 A;  2IW3 A;  1ML0 D;  3I73 A;  3I90 A;  1S5D D;  4XDX A;  4IUN A;  1CZG A;  2JEB I;  1SXT A;  5J39 A;  3KK7 A;  4CJ0 B;  3PUW A;  1EEI D;  2NTS A;  1EQV A;  1JQY D;  5JVG 3;  3VR6 A;  1OXV A;  3V2T A;  3S1R B;  5J1Z A;  2ZT9 C;  1U9R A;  3D6C A;  2DNC A;  2F0J A;  2QEJ C;  1M8A A;  4DN4 M;  2C9O A;  2EYO A;  4U67 3;  3D4R A;  1CFM A;  4RAU C;  2SEB D;  1B9N A;  4KY7 A;  1TII D;  2RKS A;  3T4A C;  2B2U C;  2F0O A;  5C6A A;  5CGK A;  2V4D A;  3HEJ A;  2K6A A;  3BVG A;  2WKD A;  1Q12 A;  2F03 A;  1LT6 D;  1EQT A;  1PZI D;  1KLG D;  3J81 E;  2BCO A;  1BR9 A;  3TME A;  1SE4 A;  2NYZ D;  2JA5 B;  2RDG A;  2CVR A;  2GA4 B;  4H7B A;  2MGS A;  2K1B A;  3R2I A;  3FPP A;  4A3F B;  4RKL A;  4IFD J;  3X3N A;  2JSO A;  4ME5 A;  4OO1 H;  5FLX L;  3HZX A;  2IL8 A;  3RMH A;  2CW0 D;  1W6K A;  2RSO A;  1EY8 A;  1QIL A;  4C3J G;  1STB A;  1TVX A;  2F0M A;  1B1Z A;  3NK9 A;  4B08 A;  5FO9 B;  4ZUJ A;  1B2T A;  1XYI A;  3PIP 3;  3R2T A;  1Y69 U;  4F7X A;  3NQT A;  4X3S A;  1MBY A;  4IFD H;  3NPP A;  1Q90 A;  3DWQ A;  1A6X A;  1A2T A;  1LTR D;  2D9U A;  1JCK B;  1EU4 A;  1EY5 A;  3VR3 A;  3PUY A;  1U4M A;  4MIU A;  1TKW B;  3QO2 A;  1STE A;  3FVQ A;  2B2V C;  3G6J B;  2Q8T A;  3EJI A;  3GTJ B;  1PRT F;  4A3M B;  2N55 A;  5IGE A;  2EYH A;  3TN2 A;  4IUQ A;  1WTO A;  5ISR A;  1SNM A;  4O42 A;  3EVQ A;  2B2W C;  4LJZ C;  2XIW A;  2NVQ B;  3BDL A;  5A2Q L;  2NB0 A;  5ELD A;  4Z9C B;  1F77 A;  4X3K A;  3C3L A;  3FPU B;  4I7Z C;  4O1N A;  3D3R A;  4K6D A;  2Z8L A;  3T53 B;  3Q6S A;  2L9H A;  2RA4 A;  2TSS A;  1JIC A;  3DWA A;  4H13 C;  2HUG A;  2L0C A;  4DNT B;  3J80 L;  1ONL A;  1PFN A;  3NBI A;  3NXW A;  3GV3 A;  1PRT B;  4UDU C;  3WOE A;  1RD9 D;  4M8A A;  1BUV T;  3K6O A;  3H0G B;  1H9S B;  2L11 A;  3CQZ B;  1QNU A;  2SDF A;  1EL0 A;  3D8G A;  3DUZ A;  3P7J A;  4A3E B;  2BDO A;  2R6G A;  2WB1 B;  3VA5 A;  1RJT A;  2F3W A;  4QF4 A;  1CQF A;  5C5M A;  5JVH 3;  1AN8 A;  1GUO A;  4IUV A;  1SSO A;  2DN8 A;  1HQR D;  3V96 A;  1I6H B;  1JB3 A;  2XNA C;  3RLF A;  1PLF A;  2A68 D;  2F0N A;  3PUX A;  2K7V A;  1LTT D;  2F0P A;  1HUN A;  1IW7 D;  1GUT A;  1SYB A;  2PW5 A;  1PDQ A;  2IX1 A;  4E6I A;  2NVY B;  4FF3 A;  5CYU A;  3NQI A;  2K5Q A;  3K5M A;  2R92 B;  1GUG A;  2L12 A;  4HAE A;  5EGT A;  1MGS A;  2LS0 1;  2K04 A;  3P1H A;  4CBV A;  1SJE D;  3I3C A;  1WTP A;  3S15 B;  3K5N A;  4BWG B;  3VR2 A;  1Y8N B;  2FMC A;  4M1U B;  2ZXO A;  3LWE A;  3BDC A;  2NWG A;  4YIJ A;  3MFG A;  4L6T B;  1SAP A;  1STY A;  1KAA A;  2WKC A;  4HCS A;  1B9M A;  2M00 A;  2NBF A;  5CV5 A;  3MZ5 A;  3IKJ A;  3D31 A;  3OIP A;  3E5S A;  2X6G A;  3I91 A;  4IN3 A;  1O78 A;  5EJW A;  2E2H B;  1V8Q A;  4XYQ A;  2E75 C;  4A3K B;  4CKB A;  1SNC A;  3OWE B;  3MVV A;  1D1K A;  1QCB D;  2MP1 A;  2LFN A;  2EJM A;  1T5X D;  4DGZ A;  4A3J B;  2EPB A;  2E76 C;  1QG7 A;  1G91 A;  1HHV A;  1PTO F;  2PCF B;  4HR7 B;  1VF5 C;  1Z7T A;  2KCN A;  2HDM A;  2R7Z B;  4PMW A;  3U9S A;  1ILQ A;  4KKT A;  2Z4H A;  1BOS A;  4C3H G;  4J6H A;  2Z4I A;  5AFW A;  4OHJ A;  1S5B D;  5DEH A;  1EY4 A;  3M3Y B;  1ENC A;  2NUC A;  5IT9 L;  3E6Z X;  3MC0 B;  1HQM C;  1SYG A;  5M3F B;  3I4M B;  1EY7 A;  4OL7 A;  1HFG A;  3HOU B;  1BQQ T;  3BZD B;  1LT5 D;  3GTP B;  4ULL A;  3Q0A A;  5KRU A;  1SDF A;  4ZQ3 A;  4XT3 B;  1PFB A;  1VMP A;  2JA7 B;  2LMC B;  3A7L A;  1Z47 A;  4DF7 A;  2H1E A;  1PTO B;  5DAU A;  1K8M A;  4X3T A;  2VNU D;  3SDZ A;  1DZ1 A;  5KNB A;  4ABN A;  2DY7 A;  3QJY A;  1AW7 A;  2AUJ D;  3GTL B;  2EXZ A;  1FNV A;  3T51 B;  1FGB D;  4ZAI A;  3S1Q B;  4WJW A;  1PTO D;  1QOH A;  1S5E D;  2B2U A;  2O4X A;  1A3V A;  3JAM L;  4NDX A;  4N9T A;  4A3B B;  5IGD A;  3C46 A;  3AB9 A;  4CKC A;  1QB5 D;  1TQO A;  4OIK A;  1CA5 A;  2EY1 A;  1I4P A;  3MFY A;  2F0T A;  4Y7N B;  5FK9 C;  1WD0 A;  5JEA J;  4XQN A;  4KTA A;  1CTM A;  1TR5 A;  5JEA G;  3OMC A;  1A15 A;  4KJO A;  3H3V C;  1OXX K;  3KBG A;  2A69 C;  4XTC S;  1KLU D;  4RH6 A;  3HOZ B;  2OT2 A;  4DAV A;  1Q1B A;  4G4K A;  1SE3 A;  3GQB A;  1YNJ C;  1OO9 B;  1WTR A;  3NTH A;  1BCP D;  2K01 A;  4RGT A;  3NP8 A;  2WII B;  5EBC A;  5JEA H;  2EDG A;  5LL6 S;  3GTG B;  3IAY A;  3EA6 A;  1RTN A;  3SR1 A;  5COY A;  4BY7 B;  3BVZ A;  1G2T A;  3OIQ A;  1SMY D;  3HOY B;  2RSN A;  5I9O A;  2D2C C;  2L4N A;  2G9H D;  5CR3 A;  4NW2 A;  5K36 G;  4QIW B;  2JA6 B;  2R93 B;  1A2U A;  2BDN A;  3NE5 B;  2I07 B;  4N9P A;  3MHB A;  4EQN A;  2KHS A;  2B2V A;  3L3O C;  3A8I E;  1GXD C;  5EKI A;  1SNO A;  1X3P A;  4XYO A;  2B2Y C;  4PMB A;  3HOV B;  2EYM A;  2EYL A;  2OF1 A;  2PYK A;  3I4L A;  3WDN A;  2B2W A;  2F1M A;  1X3Q A;  1B3A A;  2NTT A;  5K36 H;  4DAP A;  2O5J C;  1E2W A;  1K83 B;  2A6H D;  3D4W A;  3NHH A;  4XT1 B;  3BDO A;  5BN4 A;  3Q24 A;  5JOB A;  3S14 B;  3ND9 A;  2R3Z A;  4XQJ A;  4U68 A;  5KNC A;  1EY0 A;  3TSS A;  2AWN A;  4ZK9 B;  1KDC A;  1MSH A;  4BA2 I;  1EY9 A;  5CC4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...