5EJWA

Crystal structure of chromobox homolog 7 (cbx7) chromodomain with ms351
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
80
structure length
80
Chain Sequence
HHSSGLVPRGSHMELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEERDRASG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chromobox protein homolog 7
publication title Structure-Guided Discovery of Selective Antagonists for the Chromodomain of Polycomb Repressive Protein CBX7.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/inhibitor
total genus 21
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2015-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5ejwA00
1E0BA 2B2YA 3MWYW 3N52A 1KNAA 2K04A 3I90A 3H91A 3P7JA 1EL0A 1DOMA 5EPJA 1DONA 2IL8A 1NCVA 2K01A 2X6LA 4ZKCB 4XT3B 1TVXA 2M2LA 2VXWA 1C8CA 1ILQA 1J9OA 3R93A 1IKMA 2FFKB 2BDNA 1RODA 4LMQD 5EPLA 2B2VA 1GUWA 1SDFA 5EQ0A 5E4XA 2FHTA 2FINB 2L11A 2X69A 1BO0A 3KBXA 4OIKA 4X3UA 2Q8TA 4X3TA 5T1IA 1HRJA 2MPMA 1WTQA 1WVLA 1AZQA 1WTPA 1F9QA 5D65A 1G2TA 2NYZD 2HUGA 2KECA 2RVLA 5D14A 4MN3A 1HFGA 4CJ2C 3I91A 5COYA 4HEDA 1BBXC 2KVMA 4UAIA 1MGSA 2R3ZA 5EKIA 3SVMA 1WD1A 1KNEA 5CORA 2B2UC 1NAPA 2K28A 1F9RA 1RHPA 1AZPA 1HUMA 2K05A 2KUMA 4IUPA 1J8IA 1O80A 1WTRA 2J7ZA 1JE4A 4RWSC 2FMMA 2NWGA 2KEDA 2FJ2A 1S4ZA 1XX8A 3HP3A 1PFNA 4ZLTF 1EQTA 1CA5A 1U4RA 1MSGA 2B2UA 2JYOA 3IFDA 1O7ZA 1B53A 2DY7A 3GV6A 2X6GA 1F9PA 3DM1A 2HDLA 1B3AA 1RTNA 2MJ8A 3MTSA 1Q3LA 5CBAE 5E4WC 1SSOA 1RJTA 1RTOA 1WTOA 2RSOA 1U4PA 1IL8A 1WTWA 1U4LA 1BNZA 1ESRA 5DNFA 2HCIA 5CMDA 3LWEA 2D9UA 5AFWA 1DOKA 1NR4A 1A15A 1PDQA 1B4OA 1ML0D 1EOTA 4QUFA 1WTVA 1X32A 2L4NA 4R9WA 1HUNA 3DEPA 2EOTA 1X3PA 4ZAIA 1LV9A 1VMPA 2NZ1D 1G91A 4ZK9B 2HCCA 2L12A 1F9SA 4XDXA 2RA4A 3QO2A 3D6WA 2RSNA 3KUPA 2K1BA 2B2TC 1U4MA 1M8AA 2KOLA 5CBEE 1EIHA 1F2LA 4HCSA 4HSVA 1DOLA 1PFBA 4DN4M 2B2YC 4CJ1B 4X3KA 2CVRA 3FDTA 3FPUB 3ONAB 2KEEA 5T1GA 4CJ0B 4R8IA 2HDMA 1B50A 4RA8A 2XIWA 1X3QA 2EPBA 4RAUC 5EJWA 3UI2A 1HA6A 1CM9A 3TZDA 3I3CA 1ILPA 4X3SA 3DEOA 1XYIA 1MI2A 2B2VC 2N55A 2MGSA 3IL8A 1G6ZA 4HAEA 2B2WC 3G7LA 1G2SA 2L1BA 2N88A 3TN2A 4IUQA 4ZKBB 1JICA 4IUUA 4IURA 1ICWA 1EIGA 1QG7A 4MHEA 1QE6A 1QNKA 4IUVA 2L9HA 1IKLA 1SAPA 1ZXTA 2JP1A 3GV3A 4NW2A 2Q8RE 4O42A 2B2WA 2H1EA 1VMCA 2MP1A 1HFNA 1AP0A 5JJZA 4OIJA 5EPKA 3Q6SA 1NR2A 3I8ZA 2EE1A 1HHVA 4QUCA 1MSHA 1PFMA 1WD0A 2DY8A 1CA6A 1PLFA 4IUTA 4U68A 1BF4A 4XT1B 1WTXA 3F2UA 2B2TA 2K03A 1DZ1A 1B2TA 1O7YA 2SDFA
chains in the Genus database with same CATH superfamily
3CCMA 2JEBI 3QOLA 1B9NA 1TVXA 4XT3B 1RKNA 5J39A 1HQRD 2XN9C 5G3LD 1IYJB 1ONLA 2A8VA 1BO0A 4HIDA 5IWAL 1YNNC 1N32L 4OONA 2WKDA 4PNYA 4NXNL 5D14A 4DV7Q 1LTBD 2R3ZA 2F0WA 1WD1A 4JK1C 3CCRA 1F9RA 3S2DH 2KUMA 4XTCS 1O80A 4EQOA 1YJWA 3QOJA 1S5BD 4LNQA 3MXNB 4HN7A 1VF7A 4DNRB 1UE5A 4DV1Q 1EY5A 4IFDI 1BR9A 4NDXA 5E3FA 3JAML 1PH8A 1RTOA 2KQ3A 3WWVA 1JR0D 1U4LA 1E2ZA 2OXPA 1S72A 4BBRB 2DGYA 4LWCA 1D5ZC 1ML0D 3PMFA 4QUFA 4YCWA 3GDEA 4B3TQ 4JI8Q 2JA8H 3M4OH 3BS1A 1I4XA 2BE5D 2VZAA 1F77A 4KMUC 3T1YL 2I07B 2BH8A 2WV6D 3RD4A 3FEWX 3S1QB 2SOBA 4TRDA 1WCMH 2B3GA 4Q5VA 1D1KA 3TP8A 5A35A 2AUKA 2R6GA 2EPBA 4BBSB 2K14A 2B39A 3V05A 1ZKOA 2NB0A 2F4VL 3DHQA 4GNXC 4L63B 1AEXA 2XWJB 2OTLA 2UUCL 4J15A 1QNKA 1YHQA 4QY7A 2ZTCA 3W1GA 1M4VA 4PZ7A 5EPKA 4N9PA 4JYAL 1NR2A 2UXDQ 3A5ZB 4FF4A 3D8GA 1EQRA 2ZTDA 3R2TA 5C0XJ 1EY8A 2DY8A 1MKHA 3PUWA 1NMFA 5CV7A 2PPBC 5IYDG 3I4OA 3KF6A 2I5HA 2A1AA 4HIMA 1O78A 4F8MA 1DOMA 5FLXL 4A76A 3H6MA 4P75A 4ZKCB 2YU9H 3PO2G 4GN4B 3VR5A 3D3RA 3GTMB 2UUAL 1RODA 1CZGA 3KLSA 5E4XA 4CHTB 1PH7A 3KBXA 2SNSA 4JOIA 3BVMA 4BBSG 1Q90A 2MPMA 4JI3Q 4A3BH 1NNXA 1VF5C 4EGVA 1Q86C 2Q2TA 3BZCA 4A3JB 1LT5D 5GROA 4KJOA 1YJ9A 3PUYA 4IQZA 5BN3A 2CW0C 2VB2X 1IBLL 4DV4Q 3K6OA 1N34L 3TP7A 4X65L 1B7YB 5CV8A 1I4HA 4P73A 5FLMH 2F4VQ 1V1PB 3DLLA 3I70A 1JT8A 1B44D 5FKAC 1KC8C 1CQVA 3GV6A 4ID6A 1GUTA 4NPSA 3H3VC 2MJ8A 3MTSA 2AUJD 4HMJA 1EU4A 3A55A 2NTTA 2F0PA 3KF8A 5DNFA 1CT1D 3S2HB 5IP7G 3CCVA 3G71A 3URYA 1TU2B 1X32A 5CGKA 5JJKA 4DR2L 3FP9A 5GAEC 1VMPA 3KDFA 4KV6A 2ZXOA 2HCCA 1SMXA 3VYRA 1H9JA 1XMQL 3IRBA 2B2TC 3HOUB 2YTXA 1HH2P 4G7ZC 2G5DA 4A3JG 2N3SA 3CQZH 3RNUA 3ONAB 2C5CA 2HHHQ 4R8IA 1I4GA 1JC7A 2O4XA 4R4QA 3N6RA 1U0LA 1RD9D 2QEJC 3HKZB 5GQOA 3TZDA 2B2VC 1K9MC 2A73B 1G2SA 4K2KA 3GTJB 3IFTA 1KABA 4X66L 4IUVA 3PO3H 1JE5A 1Q12A 5HURA 5JVG3 1N36Q 1SYCA 4DR1L 4AYBB 1HHVA 4B3SL 1UE7A 3E0EA 1HZAA 3NUCA 2B2TA 2K33A 3IKJA 1SLJA 4F87A 2EY5A 1JQYD 4K5WA 1T5EA 3P7JA 2E2IH 1STEA 1JJGA 1EEID 5LMUL 2JA5G 5M5YB 5M5XH 3BZDB 2GVBA 2B2VA 2PMZE 3SEBA 1VQKA 2Q8TA 1MHWC 3RN2A 2A6EC 2SEBD 5T1IA 1K3RA 3T13A 2K52A 4LFAQ 3D4RA 2VQEL 3CC4A 4XQJA 4BY1H 3HGBA 2JN4A 4KHVA 5DM73 1XNQL 1KRSA 3J7AV 5J22A 2O5IC 1PYWD 1SNPA 2VS1A 1LACA 1OXXK 1XX8A 3T56B 1FNUA 4AYBG 5FO7B 5JEAJ 1VQ7A 4MZ9A 1PHJA 1CSPA 3K8AA 4LUVA 2D0OA 4LF7L 3OWEB 1V8QA 3BZKA 1U4PA 2F1MA 4C3HH 1ENCA 3A0JA 3VA5A 3NQTA 4KD3A 1BBWA 2LKVA 1YI2A 2IX1A 4YY3Q 2MQHA 5M5WH 3OTOL 4OWTB 4UPAA 5IYBG 1SYFA 4KHPQ 1SJHD 4DAPA 4KY7A 4JI7Q 4NXMQ 4LFBL 1B70B 3QG1A 3PIP3 1E1OA 2CKZB 4IN3A 2JA8B 4TVAB 1JMCA 2K5DA 3M4OB 1TS3A 1D2BA 3A74A 3GTGB 3IAYA 3VR3A 2CVRA 3PSIA 1WCMB 1HTPA 3AEVA 5C3EB 3PV0A 1XTDA 1CFMA 2UXBQ 1E7ZA 2MGSA 3RZDH 1TT2A 4H02A 3FHWA 4LUZA 4A3CH 2E5LL 2L9HA 1UE6A 1NTGA 1OXSC 1X3EA 2Q8RE 4DNIA 1K0SA 5CYUA 3M7GA 1QCBD 2F52A 5I2XA 1DD2A 1N8RC 1L1OC 4IUTA 4U68A 5DLQE 2OF1A 2CQOA 3UE1A 3BDOA 3F2UA 2Q2IA 3JC66 1O7YA 4LAAA 1PZJD 5D3DA 3V96A 2J4XA 1EQQA 4DR6L 4CDCC 1KNAA 3CC2A 4QL5A 2JA8G 1SYDA 2ZJPA 2X6LA 2ZXRA 1VQPA 4LF6L 3GTKH 2BA0A 1ILQA 3R93A 3NTHA 2J0TD 5EPLA 1C4QA 2YU9B 1CI3M 5EQ0A 1VQFA 4DUYL 1WCMG 2ZJRA 1HNWQ 3NTKA 3W1BA 2Z6KC 1WTQA 3NXWA 1Y8NB 5C3EG 3NBIA 1G2TA 4A3KH 1PYSB 2EYMA 5KNCA 1G8ZD 3V2TA 1YNJD 2NVXH 4MN3A 5EKIA 3BDCA 5CORA 3MHBA 5C0XH 2K05A 4G7OC 1L1OA 1EUJA 5FO8B 1I3QH 2CCZA 4FDBA 3DWAA 3ERQA 1CA5A 1EQTA 3R3OA 2IJ0A 4QIWE 1MJEA 2V4DA 3KYHC 1X9NA 3ND9A 2RSOA 1OXUA 2KCNA 1QUQA 4MTNA 1IW7D 2HCIA 4ZYSA 3BVGA 1LLRD 2ZM6L 1HNZQ 2Z6KA 3OW2A 1MIUA 4RGOS 1P8LA 4CDFC 4YWKA 1UUPA 3BYTB 1EEFD 4J6HA 4XIGS 3S14H 4QCLA 3J81j 4IJLA 3FPUB 1LTAD 3STBD 4BBRH 1AN8A 1F2ZA 3CXCA 1XPUA 4IZ8A 5LMNW 1YBYA 1II3A 1PMRA 4JI0Q 3OMGA 4JI5Q 3NSWA 2JA6B 2NBFA 3G7LA 5FLMG 3VR6A 4BA2I 4YHHL 1QE6A 1VQOA 1QILA 3CHBD 3K7AH 4DAVA 3S1QH 1SEBD 2YYZA 3PO3B 4A3MH 5FJ8G 1XMOL 3MZ5A 1TIID 4DNTB 1YITA 1HXYD 4QF4A 1CA6A 1A8VA 3I73A 2F0TA 3EROA 1VQ8A 1YJNA 1EU3A 4B3RQ 4QGUA 1BCPC 3Q22A 1SNCA 4I7AA 4A3DH 2RDHA 1YNND 4KY6A 2L55A 5EPJA 5F2DA 1NCVA 4IUNA 1T9HA 4K0KL 4LF8L 2YV5A 2E2IB 2JJQA 1Q1BA 2H4OA 1HZ9A 1HPCA 3A7AB 4POGA 2L11A 4LUOA 1WJJA 5EKKA 1HRJA 4K6LA 2F3VA 3F8TA 4ODGA 5J3BA 1J5EL 4DV5Q 4C1NI 2PW5A 3KF6B 1SE4A 4UDUC 1HR0Q 1HFGA 3S17H 4DR3L 4OO1I 5COYA 4BY1B 1X54A 2DJGC 2WACA 4LF9L 2B2UC 4KY5A 4YWLA 4JI4L 4HJ5A 3PO3G 4DV6Q 4OHJA 5JPNC 4ZLTF 2Z4IA 3IFDA 1B53A 1X55A 3DM1A 1QNUA 4WJWA 1KRTA 5IGCA 2HDLA 3CKIB 4BS9A 4H44C 2B29A 2PYKA 3CW2C 3LWEA 1GUNA 4DK1A 3TEHB 1S5ED 1XJVA 1A3UA 5KRUA 2QILA 3X3MA 3ITPA 2EOTA 5M5WB 4IOAA 1F2MA 3CMAA 1PZKD 2NZ1D 2CWPA 1XNRL 1G91A 1X65A 2M00A 1VQHA 3KLSX 1KDCA 4XDXA 5ISRA 5C44H 4DV3L 2EYFA 4FYDA 3J80E 4BXXH 2XSCA 1PRTF 4BY1G 2F4IA 5JEAH 1TS5A 1YIJA 2Z4HA 3SGIA 3UDIA 2NVYB 1UEAB 1WFQA 2NUCA 3VA7A 3KDFB 5C5LA 2B2WC 2N88A 3J80c 3S1MH 5IP9H 1S3OA 3I56A 3RZDB 1IKLA 2EYHA 3SK4A 4P2CB 3HOUH 3OWFA 2H1EA 2UXCQ 1OXTA 1FNVA 4EVOA 1SR3A 2EE1A 4DV7L 2C35B 4C3HG 4WRDA 1GHKA 2CH4A 1WTXA 4MNOA 4OXPA 1E0BA 4KKSA 2K5QA 5C5MA 2K01A 5KYLA 5A2QE 1A63A 3J80i 4DV1L 2WKCA 2E74C 1PV4A 2QEXA 2EQSA 3O13A 2CW0D 3TREA 2ENBA 2Z9HA 3DM3A 1TR5A 1KHIA 2RCFA 1GM5A 5JVH3 3M3YB 1TS4A 3NPPA 2WAQE 1D5MC 1LTRD 3PF4A 4K8IA 4A3KB 4G57A 4B3TL 4JI8L 3A8JE 3HOXH 1FYCA 2UU9Q 2NVXB 2KHSA 3RUZA 1JORA 1JJCB 3A7LA 2ATWA 4IUPA 5M5YH 3L9AX 3U9SA 5IYBH 4L5RC 5KYIA 4DR5Q 4A3CG 1Q1EA 2FXQA 4RWSC 2FJ2A 5JAVA 2ID0A 1MSGA 1X3GA 4DV0Q 1I3QB 1DCZA 2X6GA 3PCOB 1SBBB 3TP6A 2DN8A 2XNAC 2LMCB 3HKSA 1AH9A 3FVQA 1CQFA 2A68C 3E9HA 4N9TA 1EOTA 4MIUA 3NK9A 2K5VA 1LUZA 3UE0A 3HOVB 3CCQA 2B8GA 5KEEA 3ULJA 3EVQA 1A2TA 5LMNQ 2WB1E 2UXDL 3CMEA 4ULLA 2RF4A 2F0KA 2KOLA 2EJGC 3H94A 4A3KG 4GKKQ 3I4NH 1PTOB 2HDMA 1TWFH 2JA9A 2XIWA 4RMFA 3S14B 4IPHA 3I2ZA 4PMCA 5C0XG 5AJ3Q 4PMWA 1WYDA 2JK8A 1GJXA 1MJCA 2YTYA 3TN2A 3LWUA 1ICWA 1EIGA 1QG7A 1ASYA 4I7ZC 4HJAA 1JB7A 3GTGH 1JCKB 2WINB 3TSSA 4NW2A 4JI3L 3K7AB 4OIJA 1H9RA 1H9SA 4A3MB 4DF7A 5JJLA 4RHRA 5C3EH 2A6HC 4DV4L 2SDFA 5M9OA 2A6ED 3SR1A 5KNDA 2IL8A 4JOIC 1GUSA 4A3DB 2B63H 3RLFA 1STGA 4JI2Q 1CHPD 4DUZQ 4LK1C 4KN4C 3MAQA 1LM0A 3NEMA 3E3XA 3AMUA 4GOPA 4A3EH 1WVLA 4WJ3M 3CP0A 1LO5D 4BBRG 3BDLA 2OT2A 3RMHA 1NMGA 5HGQA 4A3IH 1V43A 3D6CA 4ABNA 1EY7A 2L5TA 2OEOA 2Z6BA 3S17B 1RHPA 4JI1Q 5C3XA 1J8IA 2CWAA 2J7ZA 3CF5A 2NWGA 2F0SA 4UHVA 5IY0A 2EYLA 1PFNA 2MO0A 1D7QA 4DV2Q 2UUBQ 1DYQA 3BVZA 1K83H 4A3MG 3QWNA 4LJZC 1F9PA 2HHHL 1VS0A 2K6AA 5H1SE 3S1RH 1ET9A 1IL8A 3D4WA 4KK7A 1L1OB 4L5SA 3KJOA 4A3DG 4JPBW 4JC0A 2QKIC 4PV1C 2GA4B 1R9TH 1N36L 2NN6I 1SYGA 4DAMA 2F0HA 1TQOA 1LT4D 4CBVA 1M8AA 3PIOA 1QUQB 3QIAA 1NE3A 5FJ8H 5C44B 4CJ1B 4J1MA 4DK3C 3F2DA 1UAPA 1VQ4A 4F7XA 1CM9A 3I3CA 1Y69U 2EY2A 1STHA 1UWVA 2QA4A 1FNWA 3J7ZC 1I4PA 1CHQD 4MHEA 3U50C 3S1MB 2I0QA 3ICEA 1L0YB 3G6JB 1JWSD 4ILWA 4DAYA 3TBIB 4LFAL 2K4KA 3I72A 3GTOB 4KJNA 1CK1A 4P72A 4DXGA 1PLFA 2IHFA 1A2UA 4IPDA 4C56C 4IO9A 2JA6H 1D5XC 2PI2E 5BR8Q 1N33Q 1EQVA 4Y52H 2KHIA 1M1KC 1FGBD 1C8CA 3J80L 1IKMA 2Y0SB 2BDNA 5C44G 1OXVA 1I94Q 1KAWA 3H09A 3CC7A 3CCLA 4BXXG 4EQPA 1E1TA 5BN5A 5IGBA 3MEHA 4HR7B 5JEAG 3NTIA 2HUGA 4CKEA 4YY3L 1SE8A 4KHPL 3GTLH 4JI7L 3E0JA 3S9WA 2Q8IB 4NXML 1HUMA 4IFDJ 3HOXB 1K0RA 5IP9G 1VCIA 3J7A5 1JE4A 2PQEA 2KBNA 1KQSA 3GO5A 3HOUG 2ZTEA 4QQBX 3SK5A 2NZOA 2OCEA 1PFSA 2Z0SA 3NENA 1B3AA 2EXZA 1PTOC 3HKZG 2NVQH 2KA7A 1KLUD 4HJ9A 2BDOA 1WTWA 1BNZA 5A2QL 2UXBL 3PQIA 3UDGA 4G7HC 2IY5B 1HTLD 2Y0SG 4F88A 1BCPB 1STBA 1FD7D 1HR0W 2F0IA 4V0BA 1VQEA 2XTIA 2R93H 1SMYC 3VDYA 1XPRA 4FF2A 4DN4M 3FDTA 1E2WA 4PMBA 4CJ0B 1KDAA 3DMUA 1B50A 3SDZA 1X3QA 4JVZA 2LSSA 3K0YA 2RDGA 3HOXG 3I4NB 3R8BA 5G3LF 1TWFB 3I7FA 1ILPA 4FXDA 3FRPB 1IBKQ 4LFCQ 4IUQA 2O2LD 4DR7Q 1C48A 1HNWL 1SFOH 1B3QA 4X64Q 2JSOA 1XXGA 1SYEA 1BCPD 3MXNA 3OPOA 1WTHA 4JCVE 2PI2A 3I8ZA 1PFMA 2VQFQ 3SXHA 2NVYH 4XT1B 1SE3A 1X56A 1FJGQ 1RL2A 4OX9Q 4OWXB 2RBMA 1CKNA 1YEZA 1HZCA 2AQ1B 1MD2D 4LMQD 1UNSA 4P74A 1SDFA 4JV5Q 1KIXA 1NJIC 4OWWB 1I50B 3QB3A 2B63B 4YCUA 3T53B 4R4OA 3H3VH 3I4NG 1WTPA 1IYUA 4FO2A 2AWOA 1HNZL 4DU9A 3UDXA 4A3EB 3X3NA 1NBWA 1CUKA 4CJ2C 3I91A 2JEAI 4OO1H 4HEDA 4L6TB 4B3MQ 4A3IB 1KNEA 4FP5D 1LTID 3GD7A 5LL6S 2BH2A 3FKIH 1PH6A 5LHY1 2VY3A 3S16H 2GVAA 4KN7C 1O7ZA 4A3GH 3M3YH 1RTNA 2CQAA 3PUZA 1K83B 1ASZA 3MXPA 5I6YA 4JI0L 3S1RB 5DM63 2H5XA 4JI5L 1RIPA 4HIOA 4RGTA 4DFAA 1ZEQX 5FO9B 1VQAA 1YHBA 5DEHA 3VYUA 1Y1VB 1GKHA 2BA1A 1HUNA 4XYQA 4AYBE 2MNAA 1OO9B 4TSSA 4BWGB 2B63G 5JOBA 3K5NA 3C46A 1EWCA 4DXFA 2C9OA 1R9TB 2K5NA 1GUOA 4DR4Q 3QO2A 3D6WA 4WORA 2PNRC 2ZXPA 2K1BA 3E5SA 1HQMC 1OTCA 4B9WA 1F2LA 4HSVA 4FVMA 4A3EG 3K5MA 1Q82C 2B2YC 4X3KA 5T1GA 1G6PA 3MXGA 2PCFB 4A3IG 4RAUC 4B3RL 3K5OA 5EGTA 1S5CD 3UI2A 3MXUA 3JAME 3NELA 2IPKD 1SN8A 1EY6A 3HOVH 2L1BA 4RGMA 4A4IA 4IUUA 2VB3X 4CKBA 4RG1A 3BJUA 4JG2A 1D1IA 1RCVD 5JJZA 4UP9A 2IT1A 3CAMA 4X6AH 2F0OA 1PTOH 2N78A 4DV5L 2ZJQA 3SK8A 3RZOB 1HR0L 1AE3A 1MSHA 2QDLA 5K36H 3EA6A 1F2YA 1Y1VG 4XQQA 1L0XB 4FF1A 4OELB 3Q23A 1PH3A 3T51B 2B2YA 2TMPA 3MVVA 1GD7A 3BYYB 4DV6L 1KTKA 1VQNA 3S24A 3TS2A 1DXMA 2PNHA 3P20A 1SRUA 1SNOA 4HIKA 1H9SB 1VQLA 3HOWH 4GLXA 2X69A 2F0DA 4X3TA 1PRTC 3JAMi 4ZRZA 2IX0A 3HZXA 2RVLA 4UY8C 1JOKA 4FNFA 1BBXC 3AYHB 1DM0B 2K5HA 1BBUA 3J7AF 1KLGD 4LF5Q 3GTLB 1LT6D 4RCOA 1WTRA 2WAQB 3EBEA 3NWSA 5GADC 3TRZA 1HCZA 3A8KE 3D4DA 3DWPA 2JYOA 4IPCA 5FLXE 2A68D 1BKBA 1O7IA 4S3SA 2NVTH 2E2DC 1IBMQ 3LNNA 4R4CA 3PIO3 1EIFA 1WOCA 2FMCA 3G4SA 1V9PA 3WDNA 2NVQB 3K5LA 2JA6G 4M8AA 4U673 4RH6A 2EYPA 4KI0A 2AWNA 1JB3A 1HNXQ 1ET6A 3DEPA 1QWYA 1EY0A 4IOCA 2AQ3B 1LV9A 1HJPA 2UXCL 2CFMA 2ICEC 4DKAC 2EDGA 2JE6I 3C3LA 3PGZA 4PG3A 1CKMA 2VW9A 4AQYQ 4IFDH 3OOCA 4K5XA 1K8OA 5CBEE 4OGQC 4HCSA 1DOLA 2F03A 3TP5A 2R93B 5EJWA 1D6EC 1Y8OB 2JA7H 1KAAA 3B6YA 2D0PA 1A3TA 2K75A 2Z1CA 1IL2A 1KXLA 5IIFA 5TSSA 5ELCA 5CV5A 2WFWA 5JJIA 1SAPA 1ZXTA 2A6HD 3GP7A 1Q8KA 1TWAB 2MP1A 3CRLC 1SFOB 2E8GA 2XWBB 1Y1WB 1W3SA 3NP8A 4H0LC 3T4AC 3KF8B 2L15A 4QUCA 3C1EA 1TY0A 2PQAA 2UU9L 1PVOA 4NB3A 2KCTA 3NBHA 2R7DA 4DR5L 3N52A 2OQKA 3KK7A 1C9OA 3CPWA 1DONA 4A3LH 1QVFA 2M2LA 2VXWA 2Z8LA 4DV0L 1V1OA 3I4MH 2EVBA 4X62Q 2R7ZH 4K8JA 3T1HQ 3CPFA 3GTOH 2EIFA 2FHTA 2R93G 3CRKC 4QB4A 1F9QA 3OYYA 4C3IB 2EJFC 3K81C 1KL9A 2R92B 3CU7A 1W6KA 4UP8A 2TSSA 4UAIA 3S1NH 3SVMA 2ES2A 5IGDA 3SE0A 2K28A 1BCPF 1U9RA 4GS3A 5LMNL 5IE8A 1XTCD 3H15A 3FKIB 1H9MA 4JBJA 4DGZA 5E7NA 4R8NA 5KGUA 4GKKL 1Z6HA 3S16B 2AQ2B 4A3GB 1WTOA 2F3IA 1CKOA 3OHXC 5CMDA 5AJ3L 1S5DD 5C4XH 1DOKA 3WOFA 1LTTD 4DK0A 2QDBA 1A15A 5I4DA 3EFXD 3HRZC 3PIPA 2E2HB 1FL0A 3AFQA 1QZHA 4GKJQ 1STNA 1VDZA 2NN6H 3VYSA 1NY4A 4Y7NH 2L12A 5ELFA 1GO3E 1QZGA 4C3IG 1U4MA 2RKSA 3M4QA 4GLAC 5M3FH 1PYBA 3NQIA 1E3PA 1Z9FA 2KEEA 3AU7A 4C2MB 3I55A 1SROA 1J6QA 2KHJA 4EX5A 3K58A 1Z47A 4OO1G 1Y14B 4G4KA 3GQBA 3DWQA 4JBMA 5EKLA 4JI2L 5IGEA 4DUZL 4ZQ3A 3FKIG 4JI6Q 2XVSA 3LX0A 4CKCA 1E2VA 2Q2HA 5HY6A 1PA6A 4A3GG 2DNCA 2F0NA 4H7BA 3EN2A 1AP0A 4C1NK 2QW7A 1NSNS 3U58A 2V1CC 1P16A 3A5UA 1K8GA 3ND8A 4GN5A 1IZ6A 4JI1L 1DZ1A 3AQQA 4A75A 4ZUJA 4LF4Q 2ASBA 1W2BA 1SNDA 1STYA 4L5TA 3KJPA 5KIXA 4DV2L 4KKUA 2UUBL 1B8AA 2F0EA 4GOPC 1TWHH 1BOSA 1I6HH 4RHSA 4X3UA 2F0JA 3KOJA 1ZYRC 3ZYYX 1EIYB 3HOWB 4JBKA 1LTSD 5EAYA 4IPGA 2KECA 4HSPA 3S15H 3GTPH 4J8QA 4WFN3 1CKNB 3OSOA 5LL6X 1EYGA 3HOVG 1JWUD 2HIVA 1PTOD 2ICIA 3GTQB 1EFWA 3M85A 1QVCA 2A69C 2RHSB 4HMIA 3J81E 2LXJA 1I4QA 1EY9A 1EZ8A 1EFID 1I50H 1CSQA 1GOZA 2GN5A 3KFUA 3PO2B 3D0FA 2IWHA 4L5QA 1H9KA 2KCMA 4K2LA 5IODA 4BY7H 5E4WC 5K36G 3K7UC 3J81c 2NVTB 5IWAQ 1N32Q 2JXMB 2PMZB 1VQGA 1A0IA 1NR4A 2HD3A 4NXNQ 1SMYD 1Q81C 2HQLA 3KLRA 5ELOA 1FGUA 4POFA 3U4ZA 1LTGD 5ELEA 1PH9A 2ZT9C 3ERSX 5CV6A 1F9SA 3HOWG 2RA4A 5EBDA 1QVGA 4AIMA 4Z9CB 1JJ2A 3KLWA 4KLKA 1PH4A 3ULLA 3OMCA 1JOOA 5BR8L 2EYJA 3J81i 4K6DA 1N33L 1GXDC 1Y1VH 3WOEA 4V190 3EQLC 3DEOA 3L3OC 2EZVA 2JA7B 5C3WA 4KD4A 4NP5A 3HOYH 3W2DA 2E75C 4N8FA 3M4YA 3F2BA 1Y8PB 1PH5A 3J7YW 1I4RA 1I94L 1A62A 4GNXA 5GAGC 3T1YQ 2VUMH 2XRQD 4IALA 1E24A 2M9VA 4O2DA 2K03A 1L2FA 2K04A 1O7LA 3I90A 4K5VA 4DPGA 5M3MB 2L0CA 4A3FH 1PH2A 2KCCA 3M7NA 4XXEA 1QJOA 5JPMC 1UEBA 1VQBA 4IFDG 2UUCQ 3I4MB 3U4VA 3RZOH 2FINB 2R7ZB 1VQ5A 1SE2A 1T5XD 4BA1I 2A19A 2I5LX 1DGSA 1AZQA 2PO4A 5D65A 1C0AA 4JYAQ 2JA7G 1GUGA 2E76C 1QOHA 3TQYA 1JOQA 2AMCB 3S1NB 2OWOA 2KEDA 4IJHA 1N9WA 3HP3A 1EL0A 4L8JA 4EQ5A 2JA5B 2DY7A 2SNMA 2UUAQ 5IYCH 3K57A 5IT9E 4CDEC 5CBAE 4TKOB 2MHVA 2LY7A 1RJTA 2QCPX 1SJED 3CCEA 1BUVT 1LABA 2LS01 2D9UA 5AFWA 3TMEA 4PZ6A 5M3MG 1IBKL 4LFCL 4P71A 4DR7L 2R61A 5IT9c 2WP8J 2RQXA 5C4XB 5CR3A 4A3LG 1TWGB 4KKTA 4X64L 1K8AC 3HOZB 3MEFA 1ENAA 3I4MG 4R4TA 1VQCA 1IBLQ 1PZID 2R7ZG 1N34Q 4X65Q 4DK6C 2OQ0A 3KBGA 5I2YA 1IYVA 2R7FA 2VQFL 1EYCA 4Y7NB 5FOBB 2ALYB 3PF5A 1EIHA 3P1HA 1PRTB 3D31A 1EY4A 2BE5C 2B8FA 4QMGA 5M3FB 1FJGL 4OX9L 3AB9A 3Q0AA 2K7VA 1E22A 3FMCA 4C3JB 4QIWB 1SNMA 2HQEA 4XYOA 3HG9A 4HCEA 1DJRD 4ME5A 1PXUA 2QGQA 4IURA 4JV5L 1G291 1TY2A 1HZBA 4DR2Q 3C1FA 2XGTA 4Q0FA 2JQOA 1ENFA 1STAA 1XMQQ 5E1FA 1WD0A 4MTKA 2D5DA 4B3ML 1EZ6A 2D2CC 5C4XG 3SHLA 2F0LA 3M9BA 4OL7A 2N8NA 3HOZG 2G9HD 1EWHA 3TDQA 3H0GH 5C4JH 2PW7A 1PRTD 5C4ZA 5ELBA 3H91A 2NN6G 3S2DB 1WI5A 1TWAH 3CCUA 2F0MA 1Y1WH 1GUWA 3E9IA 4X66Q 3EIVA 3MA2B 5M3FG 1H95A 1TWHB 2PQAB 1D8LA 1I6HB 1AW7A 4C3JG 2NYZD 3NBHB 4K14A 3MFGA 1Q7YC 4N8X1 4DR1Q 4A93H 4B3SQ 1MBYA 4ALPA 1XPOA 1VQJA 3MC0B 3S15B 1Q8IA 2IHEA 4FF3A 4PZ8A 3GTPB 4DR4L 4RKBA 1S4ZA 3FPPA 3RN5A 5I6WA 5LMUQ 2O5JC 1K73C 2PZWA 1ESFA 2RDFA 2D62A 3HFZB 4C3IH 3T16A 1Q3LA 1SYBA 3P75A 1SSOA 2KJXA 2G9DA 2R92H 2K5WA 4BY7B 2VQEQ 1K3BC 2OTJA 1B4OA 1VQ9A 4KTAA 4R9WA 1XNQQ 5FK9C 1X3PA 2N49A 4OEMB 3CCSA 1Z7TA 3UDFA 1BVSA 3HS0C 4ZK9B 3L0OA 1JWMD 3HKZE 4NKLA 2RSNA 3RLNA 2NTSA 3KUPA 4H13C 2NZHA 4PQXA 4JW0A 2LFNA 1PTOF 5GAHC 4LF7Q 1HA5A 2Y0SE 3J81L 1HA6A 2E2HH 3M4PA 4RFBA 4RCNA 4HAEA 1TWCH 5CV4A 5KNBA 5CV9A 1RDPD 5NUCA 1L0WA 1GHJA 3OTOQ 3AFPA 2XRSD 1B9MA 1TXYA 3HOYB 3DXJC 2WIIB 4LFBQ 1VMCA 2E2JH 1G51A 3Q6SA 4C2MH 4BY7G 1R4QB 2MO1A 4KHZA 1FVIA 2VUMB 1ICFB 4EQNA 4A3BB 2KENA 4LF5L 1B2TA 5CC4A 1SNQA 2F3WA 1RF2D 2A74C 4JBWA 4CDDC 2IW3A 4LW1A 2BOSA 4FXKC 1J9OA 5I9OA 5L37A 1IHZA 2LXKA 4A3FB 1EOVA 2I46A 1IBML 2E5LQ 1V1PA 3I4LA 5ELNA 3JAMc 4HJ8A 1UE1A 1VQMA 1B1ZA 3OIQA 5HGTA 3QJYA 1I6VC 4YWMA 4E6IA 2I5MX 2EJMA 3PUXA 3RR5A 1HNXL 1S5FD 2KVMA 3RLOA 1MGSA 1C7YA 5BN4A 3HOYG 4DR6Q 2FMMA 3BG3A 4AQYL 2HT1A 4QJFA 1CZWA 4LF6Q 3F2CA 2VUMG 3ER0A 3K0XA 1A6XA 4GN3B 4A3BG 2EY6A 3A54A 3A8IE 4DUYQ 3CQZB 1ESRA 4WJ4A 2Q2UA 2AKWB 3OW7A 1PDQA 3GTQH 2P5ZX 5IYDH 1WTVA 3PUVA 4A3FG 1K28A 4YIJA 5EBCA 3PO2H 2IX3A 4DA2A 4FXGC 1LTLA 4GOPB 2DNEA 3TS0A 1M90C 1PFBA 3QR8A 4BBSH 1U5KA 3LGJA 4GZYC 4O0AA 4RA8A 1IXRA 1LYLA 3G6EA 1K8MA 4X3SA 5C6AA 1VQ6A 1XYIA 1V1QA 1S40A 5FLXc 2K50A 1BXTA 2K32A 1QB5D 3K59A 4X62L 4I65A 2ZM6Q 2VL6A 5IT9L 4ZKBB 3T1HL 3E6ZX 4R4IA 1BDOA 3U9OA 3GV3A 5M5XB 5IYCG 3W3AA 3H3VI 1AFPA 1VQDA 4B08A 2EXDA 1YVCA 4CGYB 2WB1B 3VR4A 2VNUD 3OIPA 3TZUA 5IP7H 1KDBA 2WAQG 4TQUS 3MWYW 1VQIA 3GTMH 1ZYRD 1PH1A 4GNXB 1AE2A 3H0GB 5C4JB 1XWEA 2PZUA 1TKWB 2FFKB 2F0FA 1A3VA 4ZCKA 4YHHQ 3C2PA 2F0QA 3VYTA 4OIKA 2RHQB 5D3IB 2PZTA 4A3JH 5K5PA 5C4HA 1NUCA 2A69D 1XMOQ 1R4PB 1Q46A 1YZ6A 4GLVB 1BQQT 4C3HB 5ELDA 4B9XA 4XQNA 1X6OA 4GKJL 4A93B 5M3MH 1NAPA 5C0XI 1AZPA 2MUYA 1YHAA 1YNJC 3R2IA 4DAYB 1U4RA 2B2UA 4K0KQ 4LF8Q 4YCVA 2RCNA 2EY1A 2WB1G 1SXTA 3S2HH 1EYDA 1LT3D 5I9PA 3SK6A 1TS2A 1J5EQ 2F0GA 3NE5B 3BU2A 2MFIA 3NWTA 4NMZA 4APVA 3H0GG 4ME3A 2F0VA 2L4NA 4DR3Q 4JI6L 5DAUA 1EWIA 5IGFA 1X3FA 2F0UA 4LF9Q 3L2PA 2CHBD 3CCJA 2JA5H 1EYAA 4ZAIA 4ZUIA 1IW7C 1Y1WG 4JI4Q 2DUDA 3W5OA 3A56A 1KD1C 4HJ7A 1GVPA 3F1ZA 3L7ZC 3ZJYC 4AH6A 3NHHA 4LF4L 4A93G 3EJIA 5IGGA 2EYOA 4HTHA 1MI2A 1TWGH 3DUZA 2N55A 3K80C 3GTJH 3IL8A 3ULPA 3HOZH 1G6ZA 3Q8DA 4O1NA 1JICA 3STBC 1CTMA 3MFYA 1TWCB 1FR3A 3GTKB 3Q24A 2YTVA 4R1JA 2AHOB 2JP1A 3HEJA 4O42A 2CH4W 4RGNA 2B2WA 1HFNA 1XNRQ 3G48A 3CD6A 2A5HA 3VR2A 4DV3Q 4M1UB 4UP7A 2R92G 2E2JB 4C3JH 2DJFC 2BCOA 1BF4A 1YNXA 2QF7A 1I5FA 2HIXA 5J1ZA 1W6JA 5IOCA 4RKLA
chains in the Genus database with same CATH topology
2JEBI 3QOLA 1B9NA 1TVXA 4XT3B 1RKNA 5J39A 1HQRD 2XN9C 5G3LD 1ONLA 1BO0A 1YNNC 2WKDA 4PNYA 5D14A 1LTBD 2R3ZA 2F0WA 1WD1A 4JK1C 1F9RA 2KUMA 4XTCS 1O80A 4EQOA 3QOJA 1S5BD 4HN7A 1VF7A 4DNRB 4IFDI 1EY5A 1BR9A 4NDXA 5E3FA 3JAML 1RTOA 2KQ3A 1JR0D 1U4LA 1E2ZA 2OXPA 4BBRB 1D5ZC 1ML0D 3PMFA 4QUFA 3BS1A 1I4XA 2BE5D 4KMUC 1F77A 2I07B 2WV6D 3RD4A 3FEWX 3S1QB 2SOBA 4TRDA 4Q5VA 1D1KA 3TP8A 5A35A 2AUKA 2R6GA 2EPBA 4BBSB 2B39A 3V05A 1ZKOA 2NB0A 3DHQA 4L63B 1AEXA 2XWJB 1QNKA 1M4VA 5EPKA 4N9PA 1NR2A 4FF4A 3D8GA 3R2TA 5C0XJ 1EY8A 2DY8A 3PUWA 5CV7A 2PPBC 1O78A 4F8MA 1DOMA 5FLXL 3H6MA 4ZKCB 3VR5A 3D3RA 3GTMB 1RODA 1CZGA 3KLSA 5E4XA 4CHTB 3KBXA 2SNSA 3BVMA 1Q90A 2MPMA 1VF5C 4EGVA 4A3JB 1LT5D 4KJOA 3PUYA 4IQZA 5BN3A 2CW0C 2VB2X 3K6OA 3TP7A 5CV8A 1I4HA 1V1PB 3I70A 1B44D 5FKAC 1CQVA 3GV6A 4ID6A 1GUTA 3H3VC 2MJ8A 3MTSA 2AUJD 4HMJA 1EU4A 3A55A 2NTTA 2F0PA 3KF8A 5DNFA 1CT1D 3S2HB 3URYA 1TU2B 1X32A 5CGKA 1VMPA 4KV6A 2ZXOA 2HCCA 3VYRA 1H9JA 2B2TC 3HOUB 4G7ZC 3ONAB 2C5CA 4R8IA 1I4GA 1JC7A 2O4XA 3N6RA 1RD9D 2QEJC 3HKZB 3TZDA 2B2VC 2A73B 1G2SA 4K2KA 3GTJB 3IFTA 1KABA 4IUVA 1Q12A 5HURA 5JVG3 1SYCA 4AYBB 1HHVA 3NUCA 2B2TA 2K33A 3IKJA 4F87A 2EY5A 4K5WA 1JQYD 1T5EA 3P7JA 1STEA 1EEID 5M5YB 3BZDB 2B2VA 3SEBA 2Q8TA 2A6EC 2SEBD 5T1IA 3T13A 3D4RA 4XQJA 3HGBA 4KHVA 5DM73 3J7AV 5J22A 2O5IC 1PYWD 1SNPA 1LACA 1OXXK 1XX8A 3T56B 1FNUA 5FO7B 5JEAJ 3OWEB 1V8QA 1U4PA 2F1MA 1ENCA 3VA5A 3NQTA 4KD3A 2LKVA 2IX1A 1SYFA 1SJHD 4DAPA 4KY7A 3QG1A 3PIP3 4IN3A 2JA8B 3M4OB 2K5DA 1TS3A 1D2BA 3GTGB 3IAYA 3VR3A 2CVRA 1WCMB 1HTPA 5C3EB 3PV0A 1CFMA 2MGSA 1TT2A 2L9HA 1OXSC 2Q8RE 5CYUA 3M7GA 1QCBD 5I2XA 1DD2A 4IUTA 4U68A 2OF1A 3BDOA 3F2UA 3V96A 1O7YA 4LAAA 1PZJD 5D3DA 2J4XA 1KNAA 1SYDA 2X6LA 2ZXRA 2BA0A 1ILQA 3R93A 3NTHA 2J0TD 5EPLA 1C4QA 2YU9B 1CI3M 5EQ0A 3NTKA 1WTQA 3NXWA 1Y8NB 3NBIA 1G2TA 2EYMA 5KNCA 1G8ZD 3V2TA 1YNJD 4MN3A 5EKIA 3BDCA 5CORA 3MHBA 5C0XH 2K05A 4G7OC 5FO8B 3DWAA 3ERQA 1CA5A 1EQTA 3R3OA 2IJ0A 2V4DA 3ND9A 2RSOA 1OXUA 2KCNA 4ZYSA 1IW7D 2HCIA 3BVGA 1LLRD 4RGOS 1UUPA 3BYTB 1EEFD 4J6HA 4XIGS 4QCLA 3FPUB 1LTAD 1AN8A 1F2ZA 4IZ8A 1II3A 1PMRA 3OMGA 3NSWA 2JA6B 2NBFA 3G7LA 3VR6A 4BA2I 1QE6A 1QILA 3CHBD 4DAVA 1SEBD 2YYZA 3PO3B 3MZ5A 1TIID 4DNTB 1HXYD 4QF4A 1CA6A 3I73A 2F0TA 3EROA 1EU3A 1BCPC 3Q22A 1SNCA 2RDHA 1YNND 4KY6A 2L55A 5EPJA 5F2DA 1NCVA 4IUNA 2E2IB 1Q1BA 2H4OA 3A7AB 1HPCA 2L11A 5EKKA 1HRJA 4K6LA 2F3VA 4ODGA 4C1NI 2PW5A 1SE4A 4UDUC 1HFGA 4OO1I 5COYA 4BY1B 2WACA 2B2UC 4KY5A 4OHJA 5JPNC 4ZLTF 2Z4IA 3IFDA 1B53A 3DM1A 1QNUA 4WJWA 5IGCA 2HDLA 3CKIB 4BS9A 4H44C 2PYKA 3LWEA 1GUNA 4DK1A 1S5ED 1A3UA 5KRUA 2QILA 3X3MA 3ITPA 2EOTA 5M5WB 1F2MA 1PZKD 2NZ1D 1G91A 2M00A 3KLSX 1KDCA 4XDXA 5ISRA 2EYFA 4FYDA 3J80E 2XSCA 1PRTF 2F4IA 5JEAH 1TS5A 2Z4HA 2NVYB 1UEAB 2NUCA 3VA7A 5C5LA 2B2WC 2N88A 3RZDB 1IKLA 2EYHA 3SK4A 4P2CB 3OWFA 2H1EA 1OXTA 1FNVA 4EVOA 2EE1A 4C3HG 4WRDA 1GHKA 1WTXA 1E0BA 4KKSA 2K5QA 5C5MA 2K01A 5KYLA 5A2QE 2WKCA 2E74C 3O13A 2CW0D 2ENBA 1TR5A 5JVH3 3M3YB 1TS4A 3NPPA 1D5MC 1LTRD 4K8IA 4A3KB 4G57A 3A8JE 1FYCA 2NVXB 2KHSA 3RUZA 1JORA 3A7LA 4IUPA 3L9AX 3U9SA 5KYIA 1Q1EA 4RWSC 2FJ2A 5JAVA 2ID0A 1MSGA 1I3QB 1DCZA 2X6GA 3TP6A 1SBBB 2DN8A 2XNAC 2LMCB 3FVQA 1CQFA 2A68C 4N9TA 1EOTA 4MIUA 3NK9A 3HOVB 2B8GA 5KEEA 3EVQA 1A2TA 4ULLA 2F0KA 2KOLA 2EJGC 3H94A 1PTOB 2HDMA 2XIWA 3S14B 4PMCA 5C0XG 4PMWA 1GJXA 3TN2A 3LWUA 1ICWA 1QG7A 1EIGA 4I7ZC 1JCKB 2WINB 3TSSA 4NW2A 3K7AB 4OIJA 1H9RA 1H9SA 4A3MB 4DF7A 4RHRA 2A6HC 2SDFA 5M9OA 2A6ED 3SR1A 5KNDA 2IL8A 1GUSA 4A3DB 3RLFA 1STGA 1CHPD 4LK1C 4KN4C 3MAQA 3AMUA 1WVLA 1LO5D 3BDLA 2OT2A 3RMHA 1V43A 3D6CA 4ABNA 1EY7A 2L5TA 2OEOA 3S17B 1RHPA 5C3XA 1J8IA 2J7ZA 2NWGA 2F0SA 2EYLA 1PFNA 1DYQA 3BVZA 3QWNA 4LJZC 1F9PA 2K6AA 1ET9A 1IL8A 3D4WA 4KK7A 2QKIC 4PV1C 2GA4B 2NN6I 1SYGA 2F0HA 1TQOA 1LT4D 4CBVA 1M8AA 3QIAA 5C44B 4CJ1B 4J1MA 1UAPA 4F7XA 1CM9A 3I3CA 1Y69U 2EY2A 1STHA 1FNWA 1I4PA 1CHQD 4MHEA 3S1MB 1L0YB 3G6JB 1JWSD 4ILWA 4DAYA 3TBIB 3I72A 3GTOB 4KJNA 1CK1A 4DXGA 1PLFA 1A2UA 4C56C 1D5XC 1EQVA 1FGBD 1C8CA 3J80L 1IKMA 2Y0SB 2BDNA 1OXVA 3H09A 4EQPA 5BN5A 5IGBA 3MEHA 4HR7B 5JEAG 3NTIA 2HUGA 4CKEA 3E0JA 3S9WA 2Q8IB 1HUMA 4IFDJ 3HOXB 1VCIA 1JE4A 2PQEA 3GO5A 3SK5A 1B3AA 2EXZA 1PTOC 2KA7A 1KLUD 2BDOA 1WTWA 1BNZA 5A2QL 4G7HC 1HTLD 4F88A 1BCPB 1STBA 1FD7D 2F0IA 4V0BA 1SMYC 4FF2A 4DN4M 3FDTA 1E2WA 4PMBA 4CJ0B 1KDAA 3DMUA 1B50A 3SDZA 1X3QA 3K0YA 2RDGA 3I4NB 3R8BA 5G3LF 1TWFB 1ILPA 4FXDA 3FRPB 4IUQA 2O2LD 1C48A 2JSOA 1XXGA 1SYEA 1BCPD 3MXNA 3OPOA 3I8ZA 1PFMA 3SXHA 4XT1B 1SE3A 2RBMA 2AQ1B 1MD2D 4LMQD 1UNSA 1SDFA 2B63B 1I50B 3QB3A 3T53B 1WTPA 1IYUA 4FO2A 2AWOA 4DU9A 4A3EB 3X3NA 4OO1H 4CJ2C 3I91A 2JEAI 4HEDA 4L6TB 4A3IB 1KNEA 4FP5D 1LTID 3GD7A 5LL6S 5LHY1 4KN7C 1O7ZA 1RTNA 2CQAA 3PUZA 1K83B 3MXPA 5I6YA 3S1RB 5DM63 4RGTA 4DFAA 1ZEQX 5FO9B 5DEHA 3VYUA 1Y1VB 2BA1A 1HUNA 4XYQA 1OO9B 4TSSA 4BWGB 5JOBA 3K5NA 3C46A 1EWCA 4DXFA 2C9OA 1R9TB 1GUOA 3QO2A 3D6WA 4WORA 2PNRC 2ZXPA 2K1BA 3E5SA 1HQMC 4B9WA 1F2LA 4HSVA 4FVMA 3K5MA 2B2YC 4X3KA 5T1GA 3MXGA 2PCFB 4RAUC 3K5OA 5EGTA 1S5CD 3UI2A 3MXUA 3JAME 2IPKD 1EY6A 2L1BA 4RGMA 4IUUA 2VB3X 4CKBA 1D1IA 1RCVD 5JJZA 2IT1A 2F0OA 1PTOH 3RZOB 3SK8A 1MSHA 5K36H 3EA6A 1F2YA 4XQQA 1L0XB 4FF1A 3Q23A 3T51B 2B2YA 2TMPA 3MVVA 3BYYB 1KTKA 1DXMA 3P20A 1SNOA 1H9SB 2X69A 2F0DA 4X3TA 1PRTC 4ZRZA 2IX0A 3HZXA 2RVLA 1JOKA 4FNFA 1BBXC 1DM0B 3J7AF 1KLGD 3GTLB 1LT6D 4RCOA 1WTRA 2WAQB 3NWSA 1HCZA 3A8KE 3D4DA 3DWPA 2JYOA 5FLXE 2A68D 4S3SA 2E2DC 3LNNA 3PIO3 2FMCA 3WDNA 2NVQB 3K5LA 4M8AA 4U673 2EYPA 4KI0A 2AWNA 1JB3A 1ET6A 3DEPA 1QWYA 1EY0A 2AQ3B 1LV9A 2ICEC 2EDGA 2JE6I 3C3LA 4IFDH 3OOCA 4K5XA 1K8OA 5CBEE 4OGQC 4HCSA 1DOLA 2F03A 3TP5A 2R93B 5EJWA 1D6EC 1Y8OB 1KAAA 1A3TA 2Z1CA 5IIFA 5TSSA 5ELCA 5CV5A 1SAPA 1ZXTA 2A6HD 3GP7A 1TWAB 2MP1A 3CRLC 1SFOB 1Y1WB 2XWBB 3NP8A 4H0LC 3T4AC 4QUCA 3C1EA 1TY0A 3NBHA 3N52A 3KK7A 1DONA 2M2LA 2VXWA 2Z8LA 1V1OA 2EVBA 4K8JA 2FHTA 3CRKC 4QB4A 1F9QA 4C3IB 2EJFC 2R92B 3CU7A 1W6KA 2TSSA 4UAIA 3SVMA 5IGDA 3SE0A 2K28A 1BCPF 1U9RA 1XTCD 3FKIB 1H9MA 4DGZA 5KGUA 4R8NA 1Z6HA 3S16B 2AQ2B 4A3GB 1WTOA 3OHXC 5CMDA 1S5DD 1DOKA 3WOFA 1LTTD 4DK0A 2QDBA 1A15A 5I4DA 3EFXD 3HRZC 2E2HB 1STNA 1VDZA 2NN6H 3VYSA 2L12A 5ELFA 4C3IG 1U4MA 2RKSA 3NQIA 2KEEA 3AU7A 4C2MB 3K58A 1Z47A 4OO1G 4G4KA 3GQBA 3DWQA 5EKLA 5IGEA 4ZQ3A 2XVSA 3LX0A 4CKCA 1E2VA 2DNCA 2F0NA 4H7BA 1AP0A 4C1NK 1NSNS 3ND8A 1DZ1A 4ZUJA 1SNDA 1STYA 5KIXA 4KKUA 2F0EA 1BOSA 4RHSA 4X3UA 2F0JA 1ZYRC 3ZYYX 3HOWB 1LTSD 2KECA 4HSPA 4J8QA 4WFN3 3OSOA 5LL6X 1JWUD 1PTOD 2ICIA 3GTQB 3M85A 2A69C 4HMIA 3J81E 1I4QA 1EY9A 1EZ8A 1EFID 1GOZA 3PO2B 2IWHA 1H9KA 4K2LA 5IODA 5E4WC 5K36G 2NVTB 2JXMB 2PMZB 1NR4A 1SMYD 3KLRA 1LTGD 5ELEA 2ZT9C 5CV6A 1F9SA 2RA4A 5EBDA 4Z9CB 3OMCA 1JOOA 2EYJA 4K6DA 1GXDC 3WOEA 4V190 3EQLC 3DEOA 3L3OC 2EZVA 2JA7B 5C3WA 4KD4A 4NP5A 3W2DA 2E75C 3M4YA 1Y8PB 3J7YW 1I4RA 2XRQD 4IALA 2M9VA 2K03A 2K04A 1O7LA 3I90A 4K5VA 5M3MB 2L0CA 2KCCA 3M7NA 4XXEA 1QJOA 5JPMC 4IFDG 3I4MB 2FINB 2R7ZB 1SE2A 1T5XD 4BA1I 1AZQA 2PO4A 5D65A 1GUGA 2E76C 1QOHA 1JOQA 3S1NB 2KEDA 3HP3A 1EL0A 4L8JA 2JA5B 2DY7A 2SNMA 3K57A 5IT9E 5CBAE 4TKOB 2MHVA 2LY7A 1RJTA 2QCPX 1SJED 1BUVT 1LABA 2LS01 2D9UA 5AFWA 3TMEA 2R61A 2WP8J 2RQXA 5C4XB 5CR3A 1TWGB 4KKTA 3HOZB 1ENAA 1PZID 3KBGA 5I2YA 1IYVA 1EYCA 4Y7NB 5FOBB 1EIHA 3P1HA 1PRTB 3D31A 1EY4A 2BE5C 2B8FA 4QMGA 5M3FB 3AB9A 3Q0AA 2K7VA 3FMCA 4C3JB 4QIWB 1SNMA 2HQEA 4XYOA 3HG9A 4HCEA 1DJRD 4ME5A 1PXUA 4IURA 1G291 1TY2A 3C1FA 4Q0FA 1ENFA 1STAA 5E1FA 1WD0A 2D5DA 1EZ6A 2D2CC 3SHLA 2F0LA 4OL7A 2G9HD 1EWHA 3TDQA 2PW7A 1PRTD 5C4ZA 5ELBA 3H91A 2NN6G 3S2DB 2F0MA 1GUWA 3MA2B 1TWHB 1I6HB 1AW7A 4C3JG 2NYZD 4K14A 3MFGA 1MBYA 3MC0B 3S15B 1Q8IA 4FF3A 3GTPB 4RKBA 1S4ZA 3FPPA 5I6WA 2O5JC 2PZWA 1ESFA 2RDFA 2D62A 3T16A 1Q3LA 1SYBA 3P75A 1SSOA 2KJXA 2G9DA 2K5WA 4BY7B 1B4OA 4KTAA 4R9WA 5FK9C 1X3PA 1Z7TA 3HS0C 4ZK9B 1JWMD 4NKLA 2RSNA 2NTSA 3KUPA 4H13C 4PQXA 2LFNA 1PTOF 1HA5A 3J81L 1HA6A 4RFBA 4RCNA 4HAEA 5CV4A 5KNBA 5CV9A 1RDPD 5NUCA 1GHJA 2XRSD 1B9MA 3HOYB 3DXJC 2WIIB 1VMCA 3Q6SA 1R4QB 4KHZA 2VUMB 4EQNA 4A3BB 1B2TA 5CC4A 1SNQA 2F3WA 1RF2D 2A74C 4JBWA 2IW3A 2BOSA 4FXKC 1J9OA 5I9OA 1IHZA 4A3FB 2I46A 1V1PA 3I4LA 1B1ZA 3OIQA 5HGTA 3QJYA 1I6VC 4E6IA 2EJMA 3PUXA 1S5FD 2KVMA 1MGSA 5BN4A 2FMMA 3BG3A 1CZWA 1A6XA 2EY6A 3A54A 3A8IE 3CQZB 1ESRA 3OW7A 1PDQA 1WTVA 3PUVA 4YIJA 5EBCA 2IX3A 4DA2A 4FXGC 2DNEA 1PFBA 4GZYC 4RA8A 1K8MA 4X3SA 5C6AA 1XYIA 1BXTA 2K32A 1QB5D 3K59A 4I65A 5IT9L 4ZKBB 3E6ZX 1BDOA 3U9OA 3GV3A 5M5XB 3W3AA 1AFPA 4B08A 4CGYB 2WB1B 3VR4A 2VNUD 3TZUA 3OIPA 4RKLA 1KDBA 4TQUS 3MWYW 1ZYRD 3H0GB 5C4JB 1XWEA 2PZUA 1TKWB 2FFKB 2F0FA 1A3VA 3C2PA 2F0QA 3VYTA 4OIKA 5D3IB 2PZTA 5K5PA 5C4HA 1NUCA 2A69D 1R4PB 1BQQT 4C3HB 5ELDA 4B9XA 4XQNA 4A93B 1NAPA 5C0XI 1AZPA 2MUYA 1YNJC 3R2IA 1U4RA 2B2UA 2EY1A 1SXTA 1EYDA 1LT3D 5I9PA 3SK6A 1TS2A 2F0GA 3NE5B 4NMZA 3NWTA 2F0VA 2L4NA 5DAUA 5IGFA 2F0UA 2CHBD 1EYAA 4ZAIA 4ZUIA 1IW7C 3A56A 3L7ZC 3NHHA 3EJIA 5IGGA 2EYOA 4HTHA 1MI2A 3DUZA 2N55A 3IL8A 1G6ZA 4O1NA 1JICA 1CTMA 3MFYA 1TWCB 1FR3A 3GTKB 3Q24A 2JP1A 3HEJA 4O42A 4RGNA 1HFNA 2B2WA 2A5HA 3VR2A 4M1UB 2E2JB 2BCOA 1BF4A 2QF7A 5J1ZA 1W6JA 5IOCA 4RH6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E0B A;  2B2Y A;  3MWY W;  3N52 A;  1KNA A;  2K04 A;  3I90 A;  3H91 A;  3P7J A;  1EL0 A;  1DOM A;  5EPJ A;  1DON A;  2IL8 A;  1NCV A;  2K01 A;  2X6L A;  4ZKC B;  4XT3 B;  1TVX A;  2M2L A;  2VXW A;  1C8C A;  1ILQ A;  1J9O A;  3R93 A;  1IKM A;  2FFK B;  2BDN A;  1ROD A;  4LMQ D;  5EPL A;  2B2V A;  1GUW A;  1SDF A;  5EQ0 A;  5E4X A;  2FHT A;  2FIN B;  2L11 A;  2X69 A;  1BO0 A;  3KBX A;  4OIK A;  4X3U A;  2Q8T A;  4X3T A;  5T1I A;  1HRJ A;  2MPM A;  1WTQ A;  1WVL A;  1AZQ A;  1WTP A;  1F9Q A;  5D65 A;  1G2T A;  2NYZ D;  2HUG A;  2KEC A;  2RVL A;  5D14 A;  4MN3 A;  1HFG A;  4CJ2 C;  3I91 A;  5COY A;  4HED A;  1BBX C;  2KVM A;  4UAI A;  1MGS A;  2R3Z A;  5EKI A;  3SVM A;  1WD1 A;  1KNE A;  5COR A;  2B2U C;  1NAP A;  2K28 A;  1F9R A;  1RHP A;  1AZP A;  1HUM A;  2K05 A;  2KUM A;  4IUP A;  1J8I A;  1O80 A;  1WTR A;  2J7Z A;  1JE4 A;  4RWS C;  2FMM A;  2NWG A;  2KED A;  2FJ2 A;  1S4Z A;  1XX8 A;  3HP3 A;  1PFN A;  4ZLT F;  1EQT A;  1CA5 A;  1U4R A;  1MSG A;  2B2U A;  2JYO A;  3IFD A;  1O7Z A;  1B53 A;  2DY7 A;  3GV6 A;  2X6G A;  1F9P A;  3DM1 A;  2HDL A;  1B3A A;  1RTN A;  2MJ8 A;  3MTS A;  1Q3L A;  5CBA E;  5E4W C;  1SSO A;  1RJT A;  1RTO A;  1WTO A;  2RSO A;  1U4P A;  1IL8 A;  1WTW A;  1U4L A;  1BNZ A;  1ESR A;  5DNF A;  2HCI A;  5CMD A;  3LWE A;  2D9U A;  5AFW A;  1DOK A;  1NR4 A;  1A15 A;  1PDQ A;  1B4O A;  1ML0 D;  1EOT A;  4QUF A;  1WTV A;  1X32 A;  2L4N A;  4R9W A;  1HUN A;  3DEP A;  2EOT A;  1X3P A;  4ZAI A;  1LV9 A;  1VMP A;  2NZ1 D;  1G91 A;  4ZK9 B;  2HCC A;  2L12 A;  1F9S A;  4XDX A;  2RA4 A;  3QO2 A;  3D6W A;  2RSN A;  3KUP A;  2K1B A;  2B2T C;  1U4M A;  1M8A A;  2KOL A;  5CBE E;  1EIH A;  1F2L A;  4HCS A;  4HSV A;  1DOL A;  1PFB A;  4DN4 M;  2B2Y C;  4CJ1 B;  4X3K A;  2CVR A;  3FDT A;  3FPU B;  3ONA B;  2KEE A;  5T1G A;  4CJ0 B;  4R8I A;  2HDM A;  1B50 A;  4RA8 A;  2XIW A;  1X3Q A;  2EPB A;  4RAU C;  5EJW A;  3UI2 A;  1HA6 A;  1CM9 A;  3TZD A;  3I3C A;  1ILP A;  4X3S A;  3DEO A;  1XYI A;  1MI2 A;  2B2V C;  2N55 A;  2MGS A;  3IL8 A;  1G6Z A;  4HAE A;  2B2W C;  3G7L A;  1G2S A;  2L1B A;  2N88 A;  3TN2 A;  4IUQ A;  4ZKB B;  1JIC A;  4IUU A;  4IUR A;  1ICW A;  1EIG A;  1QG7 A;  4MHE A;  1QE6 A;  1QNK A;  4IUV A;  2L9H A;  1IKL A;  1SAP A;  1ZXT A;  2JP1 A;  3GV3 A;  4NW2 A;  2Q8R E;  4O42 A;  2B2W A;  2H1E A;  1VMC A;  2MP1 A;  1HFN A;  1AP0 A;  5JJZ A;  4OIJ A;  5EPK A;  3Q6S A;  1NR2 A;  3I8Z A;  2EE1 A;  1HHV A;  4QUC A;  1MSH A;  1PFM A;  1WD0 A;  2DY8 A;  1CA6 A;  1PLF A;  4IUT A;  4U68 A;  1BF4 A;  4XT1 B;  1WTX A;  3F2U A;  2B2T A;  2K03 A;  1DZ1 A;  1B2T A;  1O7Y A;  2SDF A; 
#chains in the Genus database with same CATH topology
 3CCM A;  2JEB I;  3QOL A;  1B9N A;  1TVX A;  4XT3 B;  1RKN A;  5J39 A;  1HQR D;  2XN9 C;  5G3L D;  1IYJ B;  1ONL A;  2A8V A;  1BO0 A;  4HID A;  5IWA L;  1YNN C;  1N32 L;  4OON A;  2WKD A;  4PNY A;  4NXN L;  5D14 A;  4DV7 Q;  1LTB D;  2R3Z A;  2F0W A;  1WD1 A;  4JK1 C;  3CCR A;  1F9R A;  3S2D H;  2KUM A;  4XTC S;  1O80 A;  4EQO A;  1YJW A;  3QOJ A;  1S5B D;  4LNQ A;  3MXN B;  4HN7 A;  1VF7 A;  4DNR B;  1UE5 A;  4DV1 Q;  1EY5 A;  4IFD I;  1BR9 A;  4NDX A;  5E3F A;  3JAM L;  1PH8 A;  1RTO A;  2KQ3 A;  3WWV A;  1JR0 D;  1U4L A;  1E2Z A;  2OXP A;  1S72 A;  4BBR B;  2DGY A;  4LWC A;  1D5Z C;  1ML0 D;  3PMF A;  4QUF A;  4YCW A;  3GDE A;  4B3T Q;  4JI8 Q;  2JA8 H;  3M4O H;  3BS1 A;  1I4X A;  2BE5 D;  2VZA A;  1F77 A;  4KMU C;  3T1Y L;  2I07 B;  2BH8 A;  2WV6 D;  3RD4 A;  3FEW X;  3S1Q B;  2SOB A;  4TRD A;  1WCM H;  2B3G A;  4Q5V A;  1D1K A;  3TP8 A;  5A35 A;  2AUK A;  2R6G A;  2EPB A;  4BBS B;  2K14 A;  2B39 A;  3V05 A;  1ZKO A;  2NB0 A;  2F4V L;  3DHQ A;  4GNX C;  4L63 B;  1AEX A;  2XWJ B;  2OTL A;  2UUC L;  4J15 A;  1QNK A;  1YHQ A;  4QY7 A;  2ZTC A;  3W1G A;  1M4V A;  4PZ7 A;  5EPK A;  4N9P A;  4JYA L;  1NR2 A;  2UXD Q;  3A5Z B;  4FF4 A;  3D8G A;  1EQR A;  2ZTD A;  3R2T A;  5C0X J;  1EY8 A;  2DY8 A;  1MKH A;  3PUW A;  1NMF A;  5CV7 A;  2PPB C;  5IYD G;  3I4O A;  3KF6 A;  2I5H A;  2A1A A;  4HIM A;  1O78 A;  4F8M A;  1DOM A;  5FLX L;  4A76 A;  3H6M A;  4P75 A;  4ZKC B;  2YU9 H;  3PO2 G;  4GN4 B;  3VR5 A;  3D3R A;  3GTM B;  2UUA L;  1ROD A;  1CZG A;  3KLS A;  5E4X A;  4CHT B;  1PH7 A;  3KBX A;  2SNS A;  4JOI A;  3BVM A;  4BBS G;  1Q90 A;  2MPM A;  4JI3 Q;  4A3B H;  1NNX A;  1VF5 C;  4EGV A;  1Q86 C;  2Q2T A;  3BZC A;  4A3J B;  1LT5 D;  5GRO A;  4KJO A;  1YJ9 A;  3PUY A;  4IQZ A;  5BN3 A;  2CW0 C;  2VB2 X;  1IBL L;  4DV4 Q;  3K6O A;  1N34 L;  3TP7 A;  4X65 L;  1B7Y B;  5CV8 A;  1I4H A;  4P73 A;  5FLM H;  2F4V Q;  1V1P B;  3DLL A;  3I70 A;  1JT8 A;  1B44 D;  5FKA C;  1KC8 C;  1CQV A;  3GV6 A;  4ID6 A;  1GUT A;  4NPS A;  3H3V C;  2MJ8 A;  3MTS A;  2AUJ D;  4HMJ A;  1EU4 A;  3A55 A;  2NTT A;  2F0P A;  3KF8 A;  5DNF A;  1CT1 D;  3S2H B;  5IP7 G;  3CCV A;  3G71 A;  3URY A;  1TU2 B;  1X32 A;  5CGK A;  5JJK A;  4DR2 L;  3FP9 A;  5GAE C;  1VMP A;  3KDF A;  4KV6 A;  2ZXO A;  2HCC A;  1SMX A;  3VYR A;  1H9J A;  1XMQ L;  3IRB A;  2B2T C;  3HOU B;  2YTX A;  1HH2 P;  4G7Z C;  2G5D A;  4A3J G;  2N3S A;  3CQZ H;  3RNU A;  3ONA B;  2C5C A;  2HHH Q;  4R8I A;  1I4G A;  1JC7 A;  2O4X A;  4R4Q A;  3N6R A;  1U0L A;  1RD9 D;  2QEJ C;  3HKZ B;  5GQO A;  3TZD A;  2B2V C;  1K9M C;  2A73 B;  1G2S A;  4K2K A;  3GTJ B;  3IFT A;  1KAB A;  4X66 L;  4IUV A;  3PO3 H;  1JE5 A;  1Q12 A;  5HUR A;  5JVG 3;  1N36 Q;  1SYC A;  4DR1 L;  4AYB B;  1HHV A;  4B3S L;  1UE7 A;  3E0E A;  1HZA A;  3NUC A;  2B2T A;  2K33 A;  3IKJ A;  1SLJ A;  4F87 A;  2EY5 A;  1JQY D;  4K5W A;  1T5E A;  3P7J A;  2E2I H;  1STE A;  1JJG A;  1EEI D;  5LMU L;  2JA5 G;  5M5Y B;  5M5X H;  3BZD B;  2GVB A;  2B2V A;  2PMZ E;  3SEB A;  1VQK A;  2Q8T A;  1MHW C;  3RN2 A;  2A6E C;  2SEB D;  5T1I A;  1K3R A;  3T13 A;  2K52 A;  4LFA Q;  3D4R A;  2VQE L;  3CC4 A;  4XQJ A;  4BY1 H;  3HGB A;  2JN4 A;  4KHV A;  5DM7 3;  1XNQ L;  1KRS A;  3J7A V;  5J22 A;  2O5I C;  1PYW D;  1SNP A;  2VS1 A;  1LAC A;  1OXX K;  1XX8 A;  3T56 B;  1FNU A;  4AYB G;  5FO7 B;  5JEA J;  1VQ7 A;  4MZ9 A;  1PHJ A;  1CSP A;  3K8A A;  4LUV A;  2D0O A;  4LF7 L;  3OWE B;  1V8Q A;  3BZK A;  1U4P A;  2F1M A;  4C3H H;  1ENC A;  3A0J A;  3VA5 A;  3NQT A;  4KD3 A;  1BBW A;  2LKV A;  1YI2 A;  2IX1 A;  4YY3 Q;  2MQH A;  5M5W H;  3OTO L;  4OWT B;  4UPA A;  5IYB G;  1SYF A;  4KHP Q;  1SJH D;  4DAP A;  4KY7 A;  4JI7 Q;  4NXM Q;  4LFB L;  1B70 B;  3QG1 A;  3PIP 3;  1E1O A;  2CKZ B;  4IN3 A;  2JA8 B;  4TVA B;  1JMC A;  2K5D A;  3M4O B;  1TS3 A;  1D2B A;  3A74 A;  3GTG B;  3IAY A;  3VR3 A;  2CVR A;  3PSI A;  1WCM B;  1HTP A;  3AEV A;  5C3E B;  3PV0 A;  1XTD A;  1CFM A;  2UXB Q;  1E7Z A;  2MGS A;  3RZD H;  1TT2 A;  4H02 A;  3FHW A;  4LUZ A;  4A3C H;  2E5L L;  2L9H A;  1UE6 A;  1NTG A;  1OXS C;  1X3E A;  2Q8R E;  4DNI A;  1K0S A;  5CYU A;  3M7G A;  1QCB D;  2F52 A;  5I2X A;  1DD2 A;  1N8R C;  1L1O C;  4IUT A;  4U68 A;  5DLQ E;  2OF1 A;  2CQO A;  3UE1 A;  3BDO A;  3F2U A;  2Q2I A;  3JC6 6;  1O7Y A;  4LAA A;  1PZJ D;  5D3D A;  3V96 A;  2J4X A;  1EQQ A;  4DR6 L;  4CDC C;  1KNA A;  3CC2 A;  4QL5 A;  2JA8 G;  1SYD A;  2ZJP A;  2X6L A;  2ZXR A;  1VQP A;  4LF6 L;  3GTK H;  2BA0 A;  1ILQ A;  3R93 A;  3NTH A;  2J0T D;  5EPL A;  1C4Q A;  2YU9 B;  1CI3 M;  5EQ0 A;  1VQF A;  4DUY L;  1WCM G;  2ZJR A;  1HNW Q;  3NTK A;  3W1B A;  2Z6K C;  1WTQ A;  3NXW A;  1Y8N B;  5C3E G;  3NBI A;  1G2T A;  4A3K H;  1PYS B;  2EYM A;  5KNC A;  1G8Z D;  3V2T A;  1YNJ D;  2NVX H;  4MN3 A;  5EKI A;  3BDC A;  5COR A;  3MHB A;  5C0X H;  2K05 A;  4G7O C;  1L1O A;  1EUJ A;  5FO8 B;  1I3Q H;  2CCZ A;  4FDB A;  3DWA A;  3ERQ A;  1CA5 A;  1EQT A;  3R3O A;  2IJ0 A;  4QIW E;  1MJE A;  2V4D A;  3KYH C;  1X9N A;  3ND9 A;  2RSO A;  1OXU A;  2KCN A;  1QUQ A;  4MTN A;  1IW7 D;  2HCI A;  4ZYS A;  3BVG A;  1LLR D;  2ZM6 L;  1HNZ Q;  2Z6K A;  3OW2 A;  1MIU A;  4RGO S;  1P8L A;  4CDF C;  4YWK A;  1UUP A;  3BYT B;  1EEF D;  4J6H A;  4XIG S;  3S14 H;  4QCL A;  3J81 j;  4IJL A;  3FPU B;  1LTA D;  3STB D;  4BBR H;  1AN8 A;  1F2Z A;  3CXC A;  1XPU A;  4IZ8 A;  5LMN W;  1YBY A;  1II3 A;  1PMR A;  4JI0 Q;  3OMG A;  4JI5 Q;  3NSW A;  2JA6 B;  2NBF A;  3G7L A;  5FLM G;  3VR6 A;  4BA2 I;  4YHH L;  1QE6 A;  1VQO A;  1QIL A;  3CHB D;  3K7A H;  4DAV A;  3S1Q H;  1SEB D;  2YYZ A;  3PO3 B;  4A3M H;  5FJ8 G;  1XMO L;  3MZ5 A;  1TII D;  4DNT B;  1YIT A;  1HXY D;  4QF4 A;  1CA6 A;  1A8V A;  3I73 A;  2F0T A;  3ERO A;  1VQ8 A;  1YJN A;  1EU3 A;  4B3R Q;  4QGU A;  1BCP C;  3Q22 A;  1SNC A;  4I7A A;  4A3D H;  2RDH A;  1YNN D;  4KY6 A;  2L55 A;  5EPJ A;  5F2D A;  1NCV A;  4IUN A;  1T9H A;  4K0K L;  4LF8 L;  2YV5 A;  2E2I B;  2JJQ A;  1Q1B A;  2H4O A;  1HZ9 A;  1HPC A;  3A7A B;  4POG A;  2L11 A;  4LUO A;  1WJJ A;  5EKK A;  1HRJ A;  4K6L A;  2F3V A;  3F8T A;  4ODG A;  5J3B A;  1J5E L;  4DV5 Q;  4C1N I;  2PW5 A;  3KF6 B;  1SE4 A;  4UDU C;  1HR0 Q;  1HFG A;  3S17 H;  4DR3 L;  4OO1 I;  5COY A;  4BY1 B;  1X54 A;  2DJG C;  2WAC A;  4LF9 L;  2B2U C;  4KY5 A;  4YWL A;  4JI4 L;  4HJ5 A;  3PO3 G;  4DV6 Q;  4OHJ A;  5JPN C;  4ZLT F;  2Z4I A;  3IFD A;  1B53 A;  1X55 A;  3DM1 A;  1QNU A;  4WJW A;  1KRT A;  5IGC A;  2HDL A;  3CKI B;  4BS9 A;  4H44 C;  2B29 A;  2PYK A;  3CW2 C;  3LWE A;  1GUN A;  4DK1 A;  3TEH B;  1S5E D;  1XJV A;  1A3U A;  5KRU A;  2QIL A;  3X3M A;  3ITP A;  2EOT A;  5M5W B;  4IOA A;  1F2M A;  3CMA A;  1PZK D;  2NZ1 D;  2CWP A;  1XNR L;  1G91 A;  1X65 A;  2M00 A;  1VQH A;  3KLS X;  1KDC A;  4XDX A;  5ISR A;  5C44 H;  4DV3 L;  2EYF A;  4FYD A;  3J80 E;  4BXX H;  2XSC A;  1PRT F;  4BY1 G;  2F4I A;  5JEA H;  1TS5 A;  1YIJ A;  2Z4H A;  3SGI A;  3UDI A;  2NVY B;  1UEA B;  1WFQ A;  2NUC A;  3VA7 A;  3KDF B;  5C5L A;  2B2W C;  2N88 A;  3J80 c;  3S1M H;  5IP9 H;  1S3O A;  3I56 A;  3RZD B;  1IKL A;  2EYH A;  3SK4 A;  4P2C B;  3HOU H;  3OWF A;  2H1E A;  2UXC Q;  1OXT A;  1FNV A;  4EVO A;  1SR3 A;  2EE1 A;  4DV7 L;  2C35 B;  4C3H G;  4WRD A;  1GHK A;  2CH4 A;  1WTX A;  4MNO A;  4OXP A;  1E0B A;  4KKS A;  2K5Q A;  5C5M A;  2K01 A;  5KYL A;  5A2Q E;  1A63 A;  3J80 i;  4DV1 L;  2WKC A;  2E74 C;  1PV4 A;  2QEX A;  2EQS A;  3O13 A;  2CW0 D;  3TRE A;  2ENB A;  2Z9H A;  3DM3 A;  1TR5 A;  1KHI A;  2RCF A;  1GM5 A;  5JVH 3;  3M3Y B;  1TS4 A;  3NPP A;  2WAQ E;  1D5M C;  1LTR D;  3PF4 A;  4K8I A;  4A3K B;  4G57 A;  4B3T L;  4JI8 L;  3A8J E;  3HOX H;  1FYC A;  2UU9 Q;  2NVX B;  2KHS A;  3RUZ A;  1JOR A;  1JJC B;  3A7L A;  2ATW A;  4IUP A;  5M5Y H;  3L9A X;  3U9S A;  5IYB H;  4L5R C;  5KYI A;  4DR5 Q;  4A3C G;  1Q1E A;  2FXQ A;  4RWS C;  2FJ2 A;  5JAV A;  2ID0 A;  1MSG A;  1X3G A;  4DV0 Q;  1I3Q B;  1DCZ A;  2X6G A;  3PCO B;  1SBB B;  3TP6 A;  2DN8 A;  2XNA C;  2LMC B;  3HKS A;  1AH9 A;  3FVQ A;  1CQF A;  2A68 C;  3E9H A;  4N9T A;  1EOT A;  4MIU A;  3NK9 A;  2K5V A;  1LUZ A;  3UE0 A;  3HOV B;  3CCQ A;  2B8G A;  5KEE A;  3ULJ A;  3EVQ A;  1A2T A;  5LMN Q;  2WB1 E;  2UXD L;  3CME A;  4ULL A;  2RF4 A;  2F0K A;  2KOL A;  2EJG C;  3H94 A;  4A3K G;  4GKK Q;  3I4N H;  1PTO B;  2HDM A;  1TWF H;  2JA9 A;  2XIW A;  4RMF A;  3S14 B;  4IPH A;  3I2Z A;  4PMC A;  5C0X G;  5AJ3 Q;  4PMW A;  1WYD A;  2JK8 A;  1GJX A;  1MJC A;  2YTY A;  3TN2 A;  3LWU A;  1ICW A;  1EIG A;  1QG7 A;  1ASY A;  4I7Z C;  4HJA A;  1JB7 A;  3GTG H;  1JCK B;  2WIN B;  3TSS A;  4NW2 A;  4JI3 L;  3K7A B;  4OIJ A;  1H9R A;  1H9S A;  4A3M B;  4DF7 A;  5JJL A;  4RHR A;  5C3E H;  2A6H C;  4DV4 L;  2SDF A;  5M9O A;  2A6E D;  3SR1 A;  5KND A;  2IL8 A;  4JOI C;  1GUS A;  4A3D B;  2B63 H;  3RLF A;  1STG A;  4JI2 Q;  1CHP D;  4DUZ Q;  4LK1 C;  4KN4 C;  3MAQ A;  1LM0 A;  3NEM A;  3E3X A;  3AMU A;  4GOP A;  4A3E H;  1WVL A;  4WJ3 M;  3CP0 A;  1LO5 D;  4BBR G;  3BDL A;  2OT2 A;  3RMH A;  1NMG A;  5HGQ A;  4A3I H;  1V43 A;  3D6C A;  4ABN A;  1EY7 A;  2L5T A;  2OEO A;  2Z6B A;  3S17 B;  1RHP A;  4JI1 Q;  5C3X A;  1J8I A;  2CWA A;  2J7Z A;  3CF5 A;  2NWG A;  2F0S A;  4UHV A;  5IY0 A;  2EYL A;  1PFN A;  2MO0 A;  1D7Q A;  4DV2 Q;  2UUB Q;  1DYQ A;  3BVZ A;  1K83 H;  4A3M G;  3QWN A;  4LJZ C;  1F9P A;  2HHH L;  1VS0 A;  2K6A A;  5H1S E;  3S1R H;  1ET9 A;  1IL8 A;  3D4W A;  4KK7 A;  1L1O B;  4L5S A;  3KJO A;  4A3D G;  4JPB W;  4JC0 A;  2QKI C;  4PV1 C;  2GA4 B;  1R9T H;  1N36 L;  2NN6 I;  1SYG A;  4DAM A;  2F0H A;  1TQO A;  1LT4 D;  4CBV A;  1M8A A;  3PIO A;  1QUQ B;  3QIA A;  1NE3 A;  5FJ8 H;  5C44 B;  4CJ1 B;  4J1M A;  4DK3 C;  3F2D A;  1UAP A;  1VQ4 A;  4F7X A;  1CM9 A;  3I3C A;  1Y69 U;  2EY2 A;  1STH A;  1UWV A;  2QA4 A;  1FNW A;  3J7Z C;  1I4P A;  1CHQ D;  4MHE A;  3U50 C;  3S1M B;  2I0Q A;  3ICE A;  1L0Y B;  3G6J B;  1JWS D;  4ILW A;  4DAY A;  3TBI B;  4LFA L;  2K4K A;  3I72 A;  3GTO B;  4KJN A;  1CK1 A;  4P72 A;  4DXG A;  1PLF A;  2IHF A;  1A2U A;  4IPD A;  4C56 C;  4IO9 A;  2JA6 H;  1D5X C;  2PI2 E;  5BR8 Q;  1N33 Q;  1EQV A;  4Y52 H;  2KHI A;  1M1K C;  1FGB D;  1C8C A;  3J80 L;  1IKM A;  2Y0S B;  2BDN A;  5C44 G;  1OXV A;  1I94 Q;  1KAW A;  3H09 A;  3CC7 A;  3CCL A;  4BXX G;  4EQP A;  1E1T A;  5BN5 A;  5IGB A;  3MEH A;  4HR7 B;  5JEA G;  3NTI A;  2HUG A;  4CKE A;  4YY3 L;  1SE8 A;  4KHP L;  3GTL H;  4JI7 L;  3E0J A;  3S9W A;  2Q8I B;  4NXM L;  1HUM A;  4IFD J;  3HOX B;  1K0R A;  5IP9 G;  1VCI A;  3J7A 5;  1JE4 A;  2PQE A;  2KBN A;  1KQS A;  3GO5 A;  3HOU G;  2ZTE A;  4QQB X;  3SK5 A;  2NZO A;  2OCE A;  1PFS A;  2Z0S A;  3NEN A;  1B3A A;  2EXZ A;  1PTO C;  3HKZ G;  2NVQ H;  2KA7 A;  1KLU D;  4HJ9 A;  2BDO A;  1WTW A;  1BNZ A;  5A2Q L;  2UXB L;  3PQI A;  3UDG A;  4G7H C;  2IY5 B;  1HTL D;  2Y0S G;  4F88 A;  1BCP B;  1STB A;  1FD7 D;  1HR0 W;  2F0I A;  4V0B A;  1VQE A;  2XTI A;  2R93 H;  1SMY C;  3VDY A;  1XPR A;  4FF2 A;  4DN4 M;  3FDT A;  1E2W A;  4PMB A;  4CJ0 B;  1KDA A;  3DMU A;  1B50 A;  3SDZ A;  1X3Q A;  4JVZ A;  2LSS A;  3K0Y A;  2RDG A;  3HOX G;  3I4N B;  3R8B A;  5G3L F;  1TWF B;  3I7F A;  1ILP A;  4FXD A;  3FRP B;  1IBK Q;  4LFC Q;  4IUQ A;  2O2L D;  4DR7 Q;  1C48 A;  1HNW L;  1SFO H;  1B3Q A;  4X64 Q;  2JSO A;  1XXG A;  1SYE A;  1BCP D;  3MXN A;  3OPO A;  1WTH A;  4JCV E;  2PI2 A;  3I8Z A;  1PFM A;  2VQF Q;  3SXH A;  2NVY H;  4XT1 B;  1SE3 A;  1X56 A;  1FJG Q;  1RL2 A;  4OX9 Q;  4OWX B;  2RBM A;  1CKN A;  1YEZ A;  1HZC A;  2AQ1 B;  1MD2 D;  4LMQ D;  1UNS A;  4P74 A;  1SDF A;  4JV5 Q;  1KIX A;  1NJI C;  4OWW B;  1I50 B;  3QB3 A;  2B63 B;  4YCU A;  3T53 B;  4R4O A;  3H3V H;  3I4N G;  1WTP A;  1IYU A;  4FO2 A;  2AWO A;  1HNZ L;  4DU9 A;  3UDX A;  4A3E B;  3X3N A;  1NBW A;  1CUK A;  4CJ2 C;  3I91 A;  2JEA I;  4OO1 H;  4HED A;  4L6T B;  4B3M Q;  4A3I B;  1KNE A;  4FP5 D;  1LTI D;  3GD7 A;  5LL6 S;  2BH2 A;  3FKI H;  1PH6 A;  5LHY 1;  2VY3 A;  3S16 H;  2GVA A;  4KN7 C;  1O7Z A;  4A3G H;  3M3Y H;  1RTN A;  2CQA A;  3PUZ A;  1K83 B;  1ASZ A;  3MXP A;  5I6Y A;  4JI0 L;  3S1R B;  5DM6 3;  2H5X A;  4JI5 L;  1RIP A;  4HIO A;  4RGT A;  4DFA A;  1ZEQ X;  5FO9 B;  1VQA A;  1YHB A;  5DEH A;  3VYU A;  1Y1V B;  1GKH A;  2BA1 A;  1HUN A;  4XYQ A;  4AYB E;  2MNA A;  1OO9 B;  4TSS A;  4BWG B;  2B63 G;  5JOB A;  3K5N A;  3C46 A;  1EWC A;  4DXF A;  2C9O A;  1R9T B;  2K5N A;  1GUO A;  4DR4 Q;  3QO2 A;  3D6W A;  4WOR A;  2PNR C;  2ZXP A;  2K1B A;  3E5S A;  1HQM C;  1OTC A;  4B9W A;  1F2L A;  4HSV A;  4FVM A;  4A3E G;  3K5M A;  1Q82 C;  2B2Y C;  4X3K A;  5T1G A;  1G6P A;  3MXG A;  2PCF B;  4A3I G;  4RAU C;  4B3R L;  3K5O A;  5EGT A;  1S5C D;  3UI2 A;  3MXU A;  3JAM E;  3NEL A;  2IPK D;  1SN8 A;  1EY6 A;  3HOV H;  2L1B A;  4RGM A;  4A4I A;  4IUU A;  2VB3 X;  4CKB A;  4RG1 A;  3BJU A;  4JG2 A;  1D1I A;  1RCV D;  5JJZ A;  4UP9 A;  2IT1 A;  3CAM A;  4X6A H;  2F0O A;  1PTO H;  2N78 A;  4DV5 L;  2ZJQ A;  3SK8 A;  3RZO B;  1HR0 L;  1AE3 A;  1MSH A;  2QDL A;  5K36 H;  3EA6 A;  1F2Y A;  1Y1V G;  4XQQ A;  1L0X B;  4FF1 A;  4OEL B;  3Q23 A;  1PH3 A;  3T51 B;  2B2Y A;  2TMP A;  3MVV A;  1GD7 A;  3BYY B;  4DV6 L;  1KTK A;  1VQN A;  3S24 A;  3TS2 A;  1DXM A;  2PNH A;  3P20 A;  1SRU A;  1SNO A;  4HIK A;  1H9S B;  1VQL A;  3HOW H;  4GLX A;  2X69 A;  2F0D A;  4X3T A;  1PRT C;  3JAM i;  4ZRZ A;  2IX0 A;  3HZX A;  2RVL A;  4UY8 C;  1JOK A;  4FNF A;  1BBX C;  3AYH B;  1DM0 B;  2K5H A;  1BBU A;  3J7A F;  1KLG D;  4LF5 Q;  3GTL B;  1LT6 D;  4RCO A;  1WTR A;  2WAQ B;  3EBE A;  3NWS A;  5GAD C;  3TRZ A;  1HCZ A;  3A8K E;  3D4D A;  3DWP A;  2JYO A;  4IPC A;  5FLX E;  2A68 D;  1BKB A;  1O7I A;  4S3S A;  2NVT H;  2E2D C;  1IBM Q;  3LNN A;  4R4C A;  3PIO 3;  1EIF A;  1WOC A;  2FMC A;  3G4S A;  1V9P A;  3WDN A;  2NVQ B;  3K5L A;  2JA6 G;  4M8A A;  4U67 3;  4RH6 A;  2EYP A;  4KI0 A;  2AWN A;  1JB3 A;  1HNX Q;  1ET6 A;  3DEP A;  1QWY A;  1EY0 A;  4IOC A;  2AQ3 B;  1LV9 A;  1HJP A;  2UXC L;  2CFM A;  2ICE C;  4DKA C;  2EDG A;  2JE6 I;  3C3L A;  3PGZ A;  4PG3 A;  1CKM A;  2VW9 A;  4AQY Q;  4IFD H;  3OOC A;  4K5X A;  1K8O A;  5CBE E;  4OGQ C;  4HCS A;  1DOL A;  2F03 A;  3TP5 A;  2R93 B;  5EJW A;  1D6E C;  1Y8O B;  2JA7 H;  1KAA A;  3B6Y A;  2D0P A;  1A3T A;  2K75 A;  2Z1C A;  1IL2 A;  1KXL A;  5IIF A;  5TSS A;  5ELC A;  5CV5 A;  2WFW A;  5JJI A;  1SAP A;  1ZXT A;  2A6H D;  3GP7 A;  1Q8K A;  1TWA B;  2MP1 A;  3CRL C;  1SFO B;  2E8G A;  2XWB B;  1Y1W B;  1W3S A;  3NP8 A;  4H0L C;  3T4A C;  3KF8 B;  2L15 A;  4QUC A;  3C1E A;  1TY0 A;  2PQA A;  2UU9 L;  1PVO A;  4NB3 A;  2KCT A;  3NBH A;  2R7D A;  4DR5 L;  3N52 A;  2OQK A;  3KK7 A;  1C9O A;  3CPW A;  1DON A;  4A3L H;  1QVF A;  2M2L A;  2VXW A;  2Z8L A;  4DV0 L;  1V1O A;  3I4M H;  2EVB A;  4X62 Q;  2R7Z H;  4K8J A;  3T1H Q;  3CPF A;  3GTO H;  2EIF A;  2FHT A;  2R93 G;  3CRK C;  4QB4 A;  1F9Q A;  3OYY A;  4C3I B;  2EJF C;  3K81 C;  1KL9 A;  2R92 B;  3CU7 A;  1W6K A;  4UP8 A;  2TSS A;  4UAI A;  3S1N H;  3SVM A;  2ES2 A;  5IGD A;  3SE0 A;  2K28 A;  1BCP F;  1U9R A;  4GS3 A;  5LMN L;  5IE8 A;  1XTC D;  3H15 A;  3FKI B;  1H9M A;  4JBJ A;  4DGZ A;  5E7N A;  4R8N A;  5KGU A;  4GKK L;  1Z6H A;  3S16 B;  2AQ2 B;  4A3G B;  1WTO A;  2F3I A;  1CKO A;  3OHX C;  5CMD A;  5AJ3 L;  1S5D D;  5C4X H;  1DOK A;  3WOF A;  1LTT D;  4DK0 A;  2QDB A;  1A15 A;  5I4D A;  3EFX D;  3HRZ C;  3PIP A;  2E2H B;  1FL0 A;  3AFQ A;  1QZH A;  4GKJ Q;  1STN A;  1VDZ A;  2NN6 H;  3VYS A;  1NY4 A;  4Y7N H;  2L12 A;  5ELF A;  1GO3 E;  1QZG A;  4C3I G;  1U4M A;  2RKS A;  3M4Q A;  4GLA C;  5M3F H;  1PYB A;  3NQI A;  1E3P A;  1Z9F A;  2KEE A;  3AU7 A;  4C2M B;  3I55 A;  1SRO A;  1J6Q A;  2KHJ A;  4EX5 A;  3K58 A;  1Z47 A;  4OO1 G;  1Y14 B;  4G4K A;  3GQB A;  3DWQ A;  4JBM A;  5EKL A;  4JI2 L;  5IGE A;  4DUZ L;  4ZQ3 A;  3FKI G;  4JI6 Q;  2XVS A;  3LX0 A;  4CKC A;  1E2V A;  2Q2H A;  5HY6 A;  1PA6 A;  4A3G G;  2DNC A;  2F0N A;  4H7B A;  3EN2 A;  1AP0 A;  4C1N K;  2QW7 A;  1NSN S;  3U58 A;  2V1C C;  1P16 A;  3A5U A;  1K8G A;  3ND8 A;  4GN5 A;  1IZ6 A;  4JI1 L;  1DZ1 A;  3AQQ A;  4A75 A;  4ZUJ A;  4LF4 Q;  2ASB A;  1W2B A;  1SND A;  1STY A;  4L5T A;  3KJP A;  5KIX A;  4DV2 L;  4KKU A;  2UUB L;  1B8A A;  2F0E A;  4GOP C;  1TWH H;  1BOS A;  1I6H H;  4RHS A;  4X3U A;  2F0J A;  3KOJ A;  1ZYR C;  3ZYY X;  1EIY B;  3HOW B;  4JBK A;  1LTS D;  5EAY A;  4IPG A;  2KEC A;  4HSP A;  3S15 H;  3GTP H;  4J8Q A;  4WFN 3;  1CKN B;  3OSO A;  5LL6 X;  1EYG A;  3HOV G;  1JWU D;  2HIV A;  1PTO D;  2ICI A;  3GTQ B;  1EFW A;  3M85 A;  1QVC A;  2A69 C;  2RHS B;  4HMI A;  3J81 E;  2LXJ A;  1I4Q A;  1EY9 A;  1EZ8 A;  1EFI D;  1I50 H;  1CSQ A;  1GOZ A;  2GN5 A;  3KFU A;  3PO2 B;  3D0F A;  2IWH A;  4L5Q A;  1H9K A;  2KCM A;  4K2L A;  5IOD A;  4BY7 H;  5E4W C;  5K36 G;  3K7U C;  3J81 c;  2NVT B;  5IWA Q;  1N32 Q;  2JXM B;  2PMZ B;  1VQG A;  1A0I A;  1NR4 A;  2HD3 A;  4NXN Q;  1SMY D;  1Q81 C;  2HQL A;  3KLR A;  5ELO A;  1FGU A;  4POF A;  3U4Z A;  1LTG D;  5ELE A;  1PH9 A;  2ZT9 C;  3ERS X;  5CV6 A;  1F9S A;  3HOW G;  2RA4 A;  5EBD A;  1QVG A;  4AIM A;  4Z9C B;  1JJ2 A;  3KLW A;  4KLK A;  1PH4 A;  3ULL A;  3OMC A;  1JOO A;  5BR8 L;  2EYJ A;  3J81 i;  4K6D A;  1N33 L;  1GXD C;  1Y1V H;  3WOE A;  4V19 0;  3EQL C;  3DEO A;  3L3O C;  2EZV A;  2JA7 B;  5C3W A;  4KD4 A;  4NP5 A;  3HOY H;  3W2D A;  2E75 C;  4N8F A;  3M4Y A;  3F2B A;  1Y8P B;  1PH5 A;  3J7Y W;  1I4R A;  1I94 L;  1A62 A;  4GNX A;  5GAG C;  3T1Y Q;  2VUM H;  2XRQ D;  4IAL A;  1E24 A;  2M9V A;  4O2D A;  2K03 A;  1L2F A;  2K04 A;  1O7L A;  3I90 A;  4K5V A;  4DPG A;  5M3M B;  2L0C A;  4A3F H;  1PH2 A;  2KCC A;  3M7N A;  4XXE A;  1QJO A;  5JPM C;  1UEB A;  1VQB A;  4IFD G;  2UUC Q;  3I4M B;  3U4V A;  3RZO H;  2FIN B;  2R7Z B;  1VQ5 A;  1SE2 A;  1T5X D;  4BA1 I;  2A19 A;  2I5L X;  1DGS A;  1AZQ A;  2PO4 A;  5D65 A;  1C0A A;  4JYA Q;  2JA7 G;  1GUG A;  2E76 C;  1QOH A;  3TQY A;  1JOQ A;  2AMC B;  3S1N B;  2OWO A;  2KED A;  4IJH A;  1N9W A;  3HP3 A;  1EL0 A;  4L8J A;  4EQ5 A;  2JA5 B;  2DY7 A;  2SNM A;  2UUA Q;  5IYC H;  3K57 A;  5IT9 E;  4CDE C;  5CBA E;  4TKO B;  2MHV A;  2LY7 A;  1RJT A;  2QCP X;  1SJE D;  3CCE A;  1BUV T;  1LAB A;  2LS0 1;  2D9U A;  5AFW A;  3TME A;  4PZ6 A;  5M3M G;  1IBK L;  4LFC L;  4P71 A;  4DR7 L;  2R61 A;  5IT9 c;  2WP8 J;  2RQX A;  5C4X B;  5CR3 A;  4A3L G;  1TWG B;  4KKT A;  4X64 L;  1K8A C;  3HOZ B;  3MEF A;  1ENA A;  3I4M G;  4R4T A;  1VQC A;  1IBL Q;  1PZI D;  2R7Z G;  1N34 Q;  4X65 Q;  4DK6 C;  2OQ0 A;  3KBG A;  5I2Y A;  1IYV A;  2R7F A;  2VQF L;  1EYC A;  4Y7N B;  5FOB B;  2ALY B;  3PF5 A;  1EIH A;  3P1H A;  1PRT B;  3D31 A;  1EY4 A;  2BE5 C;  2B8F A;  4QMG A;  5M3F B;  1FJG L;  4OX9 L;  3AB9 A;  3Q0A A;  2K7V A;  1E22 A;  3FMC A;  4C3J B;  4QIW B;  1SNM A;  2HQE A;  4XYO A;  3HG9 A;  4HCE A;  1DJR D;  4ME5 A;  1PXU A;  2QGQ A;  4IUR A;  4JV5 L;  1G29 1;  1TY2 A;  1HZB A;  4DR2 Q;  3C1F A;  2XGT A;  4Q0F A;  2JQO A;  1ENF A;  1STA A;  1XMQ Q;  5E1F A;  1WD0 A;  4MTK A;  2D5D A;  4B3M L;  1EZ6 A;  2D2C C;  5C4X G;  3SHL A;  2F0L A;  3M9B A;  4OL7 A;  2N8N A;  3HOZ G;  2G9H D;  1EWH A;  3TDQ A;  3H0G H;  5C4J H;  2PW7 A;  1PRT D;  5C4Z A;  5ELB A;  3H91 A;  2NN6 G;  3S2D B;  1WI5 A;  1TWA H;  3CCU A;  2F0M A;  1Y1W H;  1GUW A;  3E9I A;  4X66 Q;  3EIV A;  3MA2 B;  5M3F G;  1H95 A;  1TWH B;  2PQA B;  1D8L A;  1I6H B;  1AW7 A;  4C3J G;  2NYZ D;  3NBH B;  4K14 A;  3MFG A;  1Q7Y C;  4N8X 1;  4DR1 Q;  4A93 H;  4B3S Q;  1MBY A;  4ALP A;  1XPO A;  1VQJ A;  3MC0 B;  3S15 B;  1Q8I A;  2IHE A;  4FF3 A;  4PZ8 A;  3GTP B;  4DR4 L;  4RKB A;  1S4Z A;  3FPP A;  3RN5 A;  5I6W A;  5LMU Q;  2O5J C;  1K73 C;  2PZW A;  1ESF A;  2RDF A;  2D62 A;  3HFZ B;  4C3I H;  3T16 A;  1Q3L A;  1SYB A;  3P75 A;  1SSO A;  2KJX A;  2G9D A;  2R92 H;  2K5W A;  4BY7 B;  2VQE Q;  1K3B C;  2OTJ A;  1B4O A;  1VQ9 A;  4KTA A;  4R9W A;  1XNQ Q;  5FK9 C;  1X3P A;  2N49 A;  4OEM B;  3CCS A;  1Z7T A;  3UDF A;  1BVS A;  3HS0 C;  4ZK9 B;  3L0O A;  1JWM D;  3HKZ E;  4NKL A;  2RSN A;  3RLN A;  2NTS A;  3KUP A;  4H13 C;  2NZH A;  4PQX A;  4JW0 A;  2LFN A;  1PTO F;  5GAH C;  4LF7 Q;  1HA5 A;  2Y0S E;  3J81 L;  1HA6 A;  2E2H H;  3M4P A;  4RFB A;  4RCN A;  4HAE A;  1TWC H;  5CV4 A;  5KNB A;  5CV9 A;  1RDP D;  5NUC A;  1L0W A;  1GHJ A;  3OTO Q;  3AFP A;  2XRS D;  1B9M A;  1TXY A;  3HOY B;  3DXJ C;  2WII B;  4LFB Q;  1VMC A;  2E2J H;  1G51 A;  3Q6S A;  4C2M H;  4BY7 G;  1R4Q B;  2MO1 A;  4KHZ A;  1FVI A;  2VUM B;  1ICF B;  4EQN A;  4A3B B;  2KEN A;  4LF5 L;  1B2T A;  5CC4 A;  1SNQ A;  2F3W A;  1RF2 D;  2A74 C;  4JBW A;  4CDD C;  2IW3 A;  4LW1 A;  2BOS A;  4FXK C;  1J9O A;  5I9O A;  5L37 A;  1IHZ A;  2LXK A;  4A3F B;  1EOV A;  2I46 A;  1IBM L;  2E5L Q;  1V1P A;  3I4L A;  5ELN A;  3JAM c;  4HJ8 A;  1UE1 A;  1VQM A;  1B1Z A;  3OIQ A;  5HGT A;  3QJY A;  1I6V C;  4YWM A;  4E6I A;  2I5M X;  2EJM A;  3PUX A;  3RR5 A;  1HNX L;  1S5F D;  2KVM A;  3RLO A;  1MGS A;  1C7Y A;  5BN4 A;  3HOY G;  4DR6 Q;  2FMM A;  3BG3 A;  4AQY L;  2HT1 A;  4QJF A;  1CZW A;  4LF6 Q;  3F2C A;  2VUM G;  3ER0 A;  3K0X A;  1A6X A;  4GN3 B;  4A3B G;  2EY6 A;  3A54 A;  3A8I E;  4DUY Q;  3CQZ B;  1ESR A;  4WJ4 A;  2Q2U A;  2AKW B;  3OW7 A;  1PDQ A;  3GTQ H;  2P5Z X;  5IYD H;  1WTV A;  3PUV A;  4A3F G;  1K28 A;  4YIJ A;  5EBC A;  3PO2 H;  2IX3 A;  4DA2 A;  4FXG C;  1LTL A;  4GOP B;  2DNE A;  3TS0 A;  1M90 C;  1PFB A;  3QR8 A;  4BBS H;  1U5K A;  3LGJ A;  4GZY C;  4O0A A;  4RA8 A;  1IXR A;  1LYL A;  3G6E A;  1K8M A;  4X3S A;  5C6A A;  1VQ6 A;  1XYI A;  1V1Q A;  1S40 A;  5FLX c;  2K50 A;  1BXT A;  2K32 A;  1QB5 D;  3K59 A;  4X62 L;  4I65 A;  2ZM6 Q;  2VL6 A;  5IT9 L;  4ZKB B;  3T1H L;  3E6Z X;  4R4I A;  1BDO A;  3U9O A;  3GV3 A;  5M5X B;  5IYC G;  3W3A A;  3H3V I;  1AFP A;  1VQD A;  4B08 A;  2EXD A;  1YVC A;  4CGY B;  2WB1 B;  3VR4 A;  2VNU D;  3OIP A;  3TZU A;  5IP7 H;  1KDB A;  2WAQ G;  4TQU S;  3MWY W;  1VQI A;  3GTM H;  1ZYR D;  1PH1 A;  4GNX B;  1AE2 A;  3H0G B;  5C4J B;  1XWE A;  2PZU A;  1TKW B;  2FFK B;  2F0F A;  1A3V A;  4ZCK A;  4YHH Q;  3C2P A;  2F0Q A;  3VYT A;  4OIK A;  2RHQ B;  5D3I B;  2PZT A;  4A3J H;  5K5P A;  5C4H A;  1NUC A;  2A69 D;  1XMO Q;  1R4P B;  1Q46 A;  1YZ6 A;  4GLV B;  1BQQ T;  4C3H B;  5ELD A;  4B9X A;  4XQN A;  1X6O A;  4GKJ L;  4A93 B;  5M3M H;  1NAP A;  5C0X I;  1AZP A;  2MUY A;  1YHA A;  1YNJ C;  3R2I A;  4DAY B;  1U4R A;  2B2U A;  4K0K Q;  4LF8 Q;  4YCV A;  2RCN A;  2EY1 A;  2WB1 G;  1SXT A;  3S2H H;  1EYD A;  1LT3 D;  5I9P A;  3SK6 A;  1TS2 A;  1J5E Q;  2F0G A;  3NE5 B;  3BU2 A;  2MFI A;  3NWT A;  4NMZ A;  4APV A;  3H0G G;  4ME3 A;  2F0V A;  2L4N A;  4DR3 Q;  4JI6 L;  5DAU A;  1EWI A;  5IGF A;  1X3F A;  2F0U A;  4LF9 Q;  3L2P A;  2CHB D;  3CCJ A;  2JA5 H;  1EYA A;  4ZAI A;  4ZUI A;  1IW7 C;  1Y1W G;  4JI4 Q;  2DUD A;  3W5O A;  3A56 A;  1KD1 C;  4HJ7 A;  1GVP A;  3F1Z A;  3L7Z C;  3ZJY C;  4AH6 A;  3NHH A;  4LF4 L;  4A93 G;  3EJI A;  5IGG A;  2EYO A;  4HTH A;  1MI2 A;  1TWG H;  3DUZ A;  2N55 A;  3K80 C;  3GTJ H;  3IL8 A;  3ULP A;  3HOZ H;  1G6Z A;  3Q8D A;  4O1N A;  1JIC A;  3STB C;  1CTM A;  3MFY A;  1TWC B;  1FR3 A;  3GTK B;  3Q24 A;  2YTV A;  4R1J A;  2AHO B;  2JP1 A;  3HEJ A;  4O42 A;  2CH4 W;  4RGN A;  2B2W A;  1HFN A;  1XNR Q;  3G48 A;  3CD6 A;  2A5H A;  3VR2 A;  4DV3 Q;  4M1U B;  4UP7 A;  2R92 G;  2E2J B;  4C3J H;  2DJF C;  2BCO A;  1BF4 A;  1YNX A;  2QF7 A;  1I5F A;  2HIX A;  5J1Z A;  1W6J A;  5IOC A;  4RKL A; 
#chains in the Genus database with same CATH homology
 2JEB I;  3QOL A;  1B9N A;  1TVX A;  4XT3 B;  1RKN A;  5J39 A;  1HQR D;  2XN9 C;  5G3L D;  1ONL A;  1BO0 A;  1YNN C;  2WKD A;  4PNY A;  5D14 A;  1LTB D;  2R3Z A;  2F0W A;  1WD1 A;  4JK1 C;  1F9R A;  2KUM A;  4XTC S;  1O80 A;  4EQO A;  3QOJ A;  1S5B D;  4HN7 A;  1VF7 A;  4DNR B;  4IFD I;  1EY5 A;  1BR9 A;  4NDX A;  5E3F A;  3JAM L;  1RTO A;  2KQ3 A;  1JR0 D;  1U4L A;  1E2Z A;  2OXP A;  4BBR B;  1D5Z C;  1ML0 D;  3PMF A;  4QUF A;  3BS1 A;  1I4X A;  2BE5 D;  4KMU C;  1F77 A;  2I07 B;  2WV6 D;  3RD4 A;  3FEW X;  3S1Q B;  2SOB A;  4TRD A;  4Q5V A;  1D1K A;  3TP8 A;  5A35 A;  2AUK A;  2R6G A;  2EPB A;  4BBS B;  2B39 A;  3V05 A;  1ZKO A;  2NB0 A;  3DHQ A;  4L63 B;  1AEX A;  2XWJ B;  1QNK A;  1M4V A;  5EPK A;  4N9P A;  1NR2 A;  4FF4 A;  3D8G A;  3R2T A;  5C0X J;  1EY8 A;  2DY8 A;  3PUW A;  5CV7 A;  2PPB C;  1O78 A;  4F8M A;  1DOM A;  5FLX L;  3H6M A;  4ZKC B;  3VR5 A;  3D3R A;  3GTM B;  1ROD A;  1CZG A;  3KLS A;  5E4X A;  4CHT B;  3KBX A;  2SNS A;  3BVM A;  1Q90 A;  2MPM A;  1VF5 C;  4EGV A;  4A3J B;  1LT5 D;  4KJO A;  3PUY A;  4IQZ A;  5BN3 A;  2CW0 C;  2VB2 X;  3K6O A;  3TP7 A;  5CV8 A;  1I4H A;  1V1P B;  3I70 A;  1B44 D;  5FKA C;  1CQV A;  3GV6 A;  4ID6 A;  1GUT A;  3H3V C;  2MJ8 A;  3MTS A;  2AUJ D;  4HMJ A;  1EU4 A;  3A55 A;  2NTT A;  2F0P A;  3KF8 A;  5DNF A;  1CT1 D;  3S2H B;  3URY A;  1TU2 B;  1X32 A;  5CGK A;  1VMP A;  4KV6 A;  2ZXO A;  2HCC A;  3VYR A;  1H9J A;  2B2T C;  3HOU B;  4G7Z C;  3ONA B;  2C5C A;  4R8I A;  1I4G A;  1JC7 A;  2O4X A;  3N6R A;  1RD9 D;  2QEJ C;  3HKZ B;  3TZD A;  2B2V C;  2A73 B;  1G2S A;  4K2K A;  3GTJ B;  3IFT A;  1KAB A;  4IUV A;  1Q12 A;  5HUR A;  5JVG 3;  1SYC A;  4AYB B;  1HHV A;  3NUC A;  2B2T A;  2K33 A;  3IKJ A;  4F87 A;  2EY5 A;  4K5W A;  1JQY D;  1T5E A;  3P7J A;  1STE A;  1EEI D;  5M5Y B;  3BZD B;  2B2V A;  3SEB A;  2Q8T A;  2A6E C;  2SEB D;  5T1I A;  3T13 A;  3D4R A;  4XQJ A;  3HGB A;  4KHV A;  5DM7 3;  3J7A V;  5J22 A;  2O5I C;  1PYW D;  1SNP A;  1LAC A;  1OXX K;  1XX8 A;  3T56 B;  1FNU A;  5FO7 B;  5JEA J;  3OWE B;  1V8Q A;  1U4P A;  2F1M A;  1ENC A;  3VA5 A;  3NQT A;  4KD3 A;  2LKV A;  2IX1 A;  1SYF A;  1SJH D;  4DAP A;  4KY7 A;  3QG1 A;  3PIP 3;  4IN3 A;  2JA8 B;  3M4O B;  2K5D A;  1TS3 A;  1D2B A;  3GTG B;  3IAY A;  3VR3 A;  2CVR A;  1WCM B;  1HTP A;  5C3E B;  3PV0 A;  1CFM A;  2MGS A;  1TT2 A;  2L9H A;  1OXS C;  2Q8R E;  5CYU A;  3M7G A;  1QCB D;  5I2X A;  1DD2 A;  4IUT A;  4U68 A;  2OF1 A;  3BDO A;  3F2U A;  3V96 A;  1O7Y A;  4LAA A;  1PZJ D;  5D3D A;  2J4X A;  1KNA A;  1SYD A;  2X6L A;  2ZXR A;  2BA0 A;  1ILQ A;  3R93 A;  3NTH A;  2J0T D;  5EPL A;  1C4Q A;  2YU9 B;  1CI3 M;  5EQ0 A;  3NTK A;  1WTQ A;  3NXW A;  1Y8N B;  3NBI A;  1G2T A;  2EYM A;  5KNC A;  1G8Z D;  3V2T A;  1YNJ D;  4MN3 A;  5EKI A;  3BDC A;  5COR A;  3MHB A;  5C0X H;  2K05 A;  4G7O C;  5FO8 B;  3DWA A;  3ERQ A;  1CA5 A;  1EQT A;  3R3O A;  2IJ0 A;  2V4D A;  3ND9 A;  2RSO A;  1OXU A;  2KCN A;  4ZYS A;  1IW7 D;  2HCI A;  3BVG A;  1LLR D;  4RGO S;  1UUP A;  3BYT B;  1EEF D;  4J6H A;  4XIG S;  4QCL A;  3FPU B;  1LTA D;  1AN8 A;  1F2Z A;  4IZ8 A;  1II3 A;  1PMR A;  3OMG A;  3NSW A;  2JA6 B;  2NBF A;  3G7L A;  3VR6 A;  4BA2 I;  1QE6 A;  1QIL A;  3CHB D;  4DAV A;  1SEB D;  2YYZ A;  3PO3 B;  3MZ5 A;  1TII D;  4DNT B;  1HXY D;  4QF4 A;  1CA6 A;  3I73 A;  2F0T A;  3ERO A;  1EU3 A;  1BCP C;  3Q22 A;  1SNC A;  2RDH A;  1YNN D;  4KY6 A;  2L55 A;  5EPJ A;  5F2D A;  1NCV A;  4IUN A;  2E2I B;  1Q1B A;  2H4O A;  3A7A B;  1HPC A;  2L11 A;  5EKK A;  1HRJ A;  4K6L A;  2F3V A;  4ODG A;  4C1N I;  2PW5 A;  1SE4 A;  4UDU C;  1HFG A;  4OO1 I;  5COY A;  4BY1 B;  2WAC A;  2B2U C;  4KY5 A;  4OHJ A;  5JPN C;  4ZLT F;  2Z4I A;  3IFD A;  1B53 A;  3DM1 A;  1QNU A;  4WJW A;  5IGC A;  2HDL A;  3CKI B;  4BS9 A;  4H44 C;  2PYK A;  3LWE A;  1GUN A;  4DK1 A;  1S5E D;  1A3U A;  5KRU A;  2QIL A;  3X3M A;  3ITP A;  2EOT A;  5M5W B;  1F2M A;  1PZK D;  2NZ1 D;  1G91 A;  2M00 A;  3KLS X;  1KDC A;  4XDX A;  5ISR A;  2EYF A;  4FYD A;  3J80 E;  2XSC A;  1PRT F;  2F4I A;  5JEA H;  1TS5 A;  2Z4H A;  2NVY B;  1UEA B;  2NUC A;  3VA7 A;  5C5L A;  2B2W C;  2N88 A;  3RZD B;  1IKL A;  2EYH A;  3SK4 A;  4P2C B;  3OWF A;  2H1E A;  1OXT A;  1FNV A;  4EVO A;  2EE1 A;  4C3H G;  4WRD A;  1GHK A;  1WTX A;  1E0B A;  4KKS A;  2K5Q A;  5C5M A;  2K01 A;  5KYL A;  5A2Q E;  2WKC A;  2E74 C;  3O13 A;  2CW0 D;  2ENB A;  1TR5 A;  5JVH 3;  3M3Y B;  1TS4 A;  3NPP A;  1D5M C;  1LTR D;  4K8I A;  4A3K B;  4G57 A;  3A8J E;  1FYC A;  2NVX B;  2KHS A;  3RUZ A;  1JOR A;  3A7L A;  4IUP A;  3L9A X;  3U9S A;  5KYI A;  1Q1E A;  4RWS C;  2FJ2 A;  5JAV A;  2ID0 A;  1MSG A;  1I3Q B;  1DCZ A;  2X6G A;  3TP6 A;  1SBB B;  2DN8 A;  2XNA C;  2LMC B;  3FVQ A;  1CQF A;  2A68 C;  4N9T A;  1EOT A;  4MIU A;  3NK9 A;  3HOV B;  2B8G A;  5KEE A;  3EVQ A;  1A2T A;  4ULL A;  2F0K A;  2KOL A;  2EJG C;  3H94 A;  1PTO B;  2HDM A;  2XIW A;  3S14 B;  4PMC A;  5C0X G;  4PMW A;  1GJX A;  3TN2 A;  3LWU A;  1ICW A;  1QG7 A;  1EIG A;  4I7Z C;  1JCK B;  2WIN B;  3TSS A;  4NW2 A;  3K7A B;  4OIJ A;  1H9R A;  1H9S A;  4A3M B;  4DF7 A;  4RHR A;  2A6H C;  2SDF A;  5M9O A;  2A6E D;  3SR1 A;  5KND A;  2IL8 A;  1GUS A;  4A3D B;  3RLF A;  1STG A;  1CHP D;  4LK1 C;  4KN4 C;  3MAQ A;  3AMU A;  1WVL A;  1LO5 D;  3BDL A;  2OT2 A;  3RMH A;  1V43 A;  3D6C A;  4ABN A;  1EY7 A;  2L5T A;  2OEO A;  3S17 B;  1RHP A;  5C3X A;  1J8I A;  2J7Z A;  2NWG A;  2F0S A;  2EYL A;  1PFN A;  1DYQ A;  3BVZ A;  3QWN A;  4LJZ C;  1F9P A;  2K6A A;  1ET9 A;  1IL8 A;  3D4W A;  4KK7 A;  2QKI C;  4PV1 C;  2GA4 B;  2NN6 I;  1SYG A;  2F0H A;  1TQO A;  1LT4 D;  4CBV A;  1M8A A;  3QIA A;  5C44 B;  4CJ1 B;  4J1M A;  1UAP A;  4F7X A;  1CM9 A;  3I3C A;  1Y69 U;  2EY2 A;  1STH A;  1FNW A;  1I4P A;  1CHQ D;  4MHE A;  3S1M B;  1L0Y B;  3G6J B;  1JWS D;  4ILW A;  4DAY A;  3TBI B;  3I72 A;  3GTO B;  4KJN A;  1CK1 A;  4DXG A;  1PLF A;  1A2U A;  4C56 C;  1D5X C;  1EQV A;  1FGB D;  1C8C A;  3J80 L;  1IKM A;  2Y0S B;  2BDN A;  1OXV A;  3H09 A;  4EQP A;  5BN5 A;  5IGB A;  3MEH A;  4HR7 B;  5JEA G;  3NTI A;  2HUG A;  4CKE A;  3E0J A;  3S9W A;  2Q8I B;  1HUM A;  4IFD J;  3HOX B;  1VCI A;  1JE4 A;  2PQE A;  3GO5 A;  3SK5 A;  1B3A A;  2EXZ A;  1PTO C;  2KA7 A;  1KLU D;  2BDO A;  1WTW A;  1BNZ A;  5A2Q L;  4G7H C;  1HTL D;  4F88 A;  1BCP B;  1STB A;  1FD7 D;  2F0I A;  4V0B A;  1SMY C;  4FF2 A;  4DN4 M;  3FDT A;  1E2W A;  4PMB A;  4CJ0 B;  1KDA A;  3DMU A;  1B50 A;  3SDZ A;  1X3Q A;  3K0Y A;  2RDG A;  3I4N B;  3R8B A;  5G3L F;  1TWF B;  1ILP A;  4FXD A;  3FRP B;  4IUQ A;  2O2L D;  1C48 A;  2JSO A;  1XXG A;  1SYE A;  1BCP D;  3MXN A;  3OPO A;  3I8Z A;  1PFM A;  3SXH A;  4XT1 B;  1SE3 A;  2RBM A;  2AQ1 B;  1MD2 D;  4LMQ D;  1UNS A;  1SDF A;  2B63 B;  1I50 B;  3QB3 A;  3T53 B;  1WTP A;  1IYU A;  4FO2 A;  2AWO A;  4DU9 A;  4A3E B;  3X3N A;  4OO1 H;  4CJ2 C;  3I91 A;  2JEA I;  4HED A;  4L6T B;  4A3I B;  1KNE A;  4FP5 D;  1LTI D;  3GD7 A;  5LL6 S;  5LHY 1;  4KN7 C;  1O7Z A;  1RTN A;  2CQA A;  3PUZ A;  1K83 B;  3MXP A;  5I6Y A;  3S1R B;  5DM6 3;  4RGT A;  4DFA A;  1ZEQ X;  5FO9 B;  5DEH A;  3VYU A;  1Y1V B;  2BA1 A;  1HUN A;  4XYQ A;  1OO9 B;  4TSS A;  4BWG B;  5JOB A;  3K5N A;  3C46 A;  1EWC A;  4DXF A;  2C9O A;  1R9T B;  1GUO A;  3QO2 A;  3D6W A;  4WOR A;  2PNR C;  2ZXP A;  2K1B A;  3E5S A;  1HQM C;  4B9W A;  1F2L A;  4HSV A;  4FVM A;  3K5M A;  2B2Y C;  4X3K A;  5T1G A;  3MXG A;  2PCF B;  4RAU C;  3K5O A;  5EGT A;  1S5C D;  3UI2 A;  3MXU A;  3JAM E;  2IPK D;  1EY6 A;  2L1B A;  4RGM A;  4IUU A;  2VB3 X;  4CKB A;  1D1I A;  1RCV D;  5JJZ A;  2IT1 A;  2F0O A;  1PTO H;  3RZO B;  3SK8 A;  1MSH A;  5K36 H;  3EA6 A;  1F2Y A;  4XQQ A;  1L0X B;  4FF1 A;  3Q23 A;  3T51 B;  2B2Y A;  2TMP A;  3MVV A;  3BYY B;  1KTK A;  1DXM A;  3P20 A;  1SNO A;  1H9S B;  2X69 A;  2F0D A;  4X3T A;  1PRT C;  4ZRZ A;  2IX0 A;  3HZX A;  2RVL A;  1JOK A;  4FNF A;  1BBX C;  1DM0 B;  3J7A F;  1KLG D;  3GTL B;  1LT6 D;  4RCO A;  1WTR A;  2WAQ B;  3NWS A;  1HCZ A;  3A8K E;  3D4D A;  3DWP A;  2JYO A;  5FLX E;  2A68 D;  4S3S A;  2E2D C;  3LNN A;  3PIO 3;  2FMC A;  3WDN A;  2NVQ B;  3K5L A;  4M8A A;  4U67 3;  2EYP A;  4KI0 A;  2AWN A;  1JB3 A;  1ET6 A;  3DEP A;  1QWY A;  1EY0 A;  2AQ3 B;  1LV9 A;  2ICE C;  2EDG A;  2JE6 I;  3C3L A;  4IFD H;  3OOC A;  4K5X A;  1K8O A;  5CBE E;  4OGQ C;  4HCS A;  1DOL A;  2F03 A;  3TP5 A;  2R93 B;  5EJW A;  1D6E C;  1Y8O B;  1KAA A;  1A3T A;  2Z1C A;  5IIF A;  5TSS A;  5ELC A;  5CV5 A;  1SAP A;  1ZXT A;  2A6H D;  3GP7 A;  1TWA B;  2MP1 A;  3CRL C;  1SFO B;  1Y1W B;  2XWB B;  3NP8 A;  4H0L C;  3T4A C;  4QUC A;  3C1E A;  1TY0 A;  3NBH A;  3N52 A;  3KK7 A;  1DON A;  2M2L A;  2VXW A;  2Z8L A;  1V1O A;  2EVB A;  4K8J A;  2FHT A;  3CRK C;  4QB4 A;  1F9Q A;  4C3I B;  2EJF C;  2R92 B;  3CU7 A;  1W6K A;  2TSS A;  4UAI A;  3SVM A;  5IGD A;  3SE0 A;  2K28 A;  1BCP F;  1U9R A;  1XTC D;  3FKI B;  1H9M A;  4DGZ A;  5KGU A;  4R8N A;  1Z6H A;  3S16 B;  2AQ2 B;  4A3G B;  1WTO A;  3OHX C;  5CMD A;  1S5D D;  1DOK A;  3WOF A;  1LTT D;  4DK0 A;  2QDB A;  1A15 A;  5I4D A;  3EFX D;  3HRZ C;  2E2H B;  1STN A;  1VDZ A;  2NN6 H;  3VYS A;  2L12 A;  5ELF A;  4C3I G;  1U4M A;  2RKS A;  3NQI A;  2KEE A;  3AU7 A;  4C2M B;  3K58 A;  1Z47 A;  4OO1 G;  4G4K A;  3GQB A;  3DWQ A;  5EKL A;  5IGE A;  4ZQ3 A;  2XVS A;  3LX0 A;  4CKC A;  1E2V A;  2DNC A;  2F0N A;  4H7B A;  1AP0 A;  4C1N K;  1NSN S;  3ND8 A;  1DZ1 A;  4ZUJ A;  1SND A;  1STY A;  5KIX A;  4KKU A;  2F0E A;  1BOS A;  4RHS A;  4X3U A;  2F0J A;  1ZYR C;  3ZYY X;  3HOW B;  1LTS D;  2KEC A;  4HSP A;  4J8Q A;  4WFN 3;  3OSO A;  5LL6 X;  1JWU D;  1PTO D;  2ICI A;  3GTQ B;  3M85 A;  2A69 C;  4HMI A;  3J81 E;  1I4Q A;  1EY9 A;  1EZ8 A;  1EFI D;  1GOZ A;  3PO2 B;  2IWH A;  1H9K A;  4K2L A;  5IOD A;  5E4W C;  5K36 G;  2NVT B;  2JXM B;  2PMZ B;  1NR4 A;  1SMY D;  3KLR A;  1LTG D;  5ELE A;  2ZT9 C;  5CV6 A;  1F9S A;  2RA4 A;  5EBD A;  4Z9C B;  3OMC A;  1JOO A;  2EYJ A;  4K6D A;  1GXD C;  3WOE A;  4V19 0;  3EQL C;  3DEO A;  3L3O C;  2EZV A;  2JA7 B;  5C3W A;  4KD4 A;  4NP5 A;  3W2D A;  2E75 C;  3M4Y A;  1Y8P B;  3J7Y W;  1I4R A;  2XRQ D;  4IAL A;  2M9V A;  2K03 A;  2K04 A;  1O7L A;  3I90 A;  4K5V A;  5M3M B;  2L0C A;  2KCC A;  3M7N A;  4XXE A;  1QJO A;  5JPM C;  4IFD G;  3I4M B;  2FIN B;  2R7Z B;  1SE2 A;  1T5X D;  4BA1 I;  1AZQ A;  2PO4 A;  5D65 A;  1GUG A;  2E76 C;  1QOH A;  1JOQ A;  3S1N B;  2KED A;  3HP3 A;  1EL0 A;  4L8J A;  2JA5 B;  2DY7 A;  2SNM A;  3K57 A;  5IT9 E;  5CBA E;  4TKO B;  2MHV A;  2LY7 A;  1RJT A;  2QCP X;  1SJE D;  1BUV T;  1LAB A;  2LS0 1;  2D9U A;  5AFW A;  3TME A;  2R61 A;  2WP8 J;  2RQX A;  5C4X B;  5CR3 A;  1TWG B;  4KKT A;  3HOZ B;  1ENA A;  1PZI D;  3KBG A;  5I2Y A;  1IYV A;  1EYC A;  4Y7N B;  5FOB B;  1EIH A;  3P1H A;  1PRT B;  3D31 A;  1EY4 A;  2BE5 C;  2B8F A;  4QMG A;  5M3F B;  3AB9 A;  3Q0A A;  2K7V A;  3FMC A;  4C3J B;  4QIW B;  1SNM A;  2HQE A;  4XYO A;  3HG9 A;  4HCE A;  1DJR D;  4ME5 A;  1PXU A;  4IUR A;  1G29 1;  1TY2 A;  3C1F A;  4Q0F A;  1ENF A;  1STA A;  5E1F A;  1WD0 A;  2D5D A;  1EZ6 A;  2D2C C;  3SHL A;  2F0L A;  4OL7 A;  2G9H D;  1EWH A;  3TDQ A;  2PW7 A;  1PRT D;  5C4Z A;  5ELB A;  3H91 A;  2NN6 G;  3S2D B;  2F0M A;  1GUW A;  3MA2 B;  1TWH B;  1I6H B;  1AW7 A;  4C3J G;  2NYZ D;  4K14 A;  3MFG A;  1MBY A;  3MC0 B;  3S15 B;  1Q8I A;  4FF3 A;  3GTP B;  4RKB A;  1S4Z A;  3FPP A;  5I6W A;  2O5J C;  2PZW A;  1ESF A;  2RDF A;  2D62 A;  3T16 A;  1Q3L A;  1SYB A;  3P75 A;  1SSO A;  2KJX A;  2G9D A;  2K5W A;  4BY7 B;  1B4O A;  4KTA A;  4R9W A;  5FK9 C;  1X3P A;  1Z7T A;  3HS0 C;  4ZK9 B;  1JWM D;  4NKL A;  2RSN A;  2NTS A;  3KUP A;  4H13 C;  4PQX A;  2LFN A;  1PTO F;  1HA5 A;  3J81 L;  1HA6 A;  4RFB A;  4RCN A;  4HAE A;  5CV4 A;  5KNB A;  5CV9 A;  1RDP D;  5NUC A;  1GHJ A;  2XRS D;  1B9M A;  3HOY B;  3DXJ C;  2WII B;  1VMC A;  3Q6S A;  1R4Q B;  4KHZ A;  2VUM B;  4EQN A;  4A3B B;  1B2T A;  5CC4 A;  1SNQ A;  2F3W A;  1RF2 D;  2A74 C;  4JBW A;  2IW3 A;  2BOS A;  4FXK C;  1J9O A;  5I9O A;  1IHZ A;  4A3F B;  2I46 A;  1V1P A;  3I4L A;  1B1Z A;  3OIQ A;  5HGT A;  3QJY A;  1I6V C;  4E6I A;  2EJM A;  3PUX A;  1S5F D;  2KVM A;  1MGS A;  5BN4 A;  2FMM A;  3BG3 A;  1CZW A;  1A6X A;  2EY6 A;  3A54 A;  3A8I E;  3CQZ B;  1ESR A;  3OW7 A;  1PDQ A;  1WTV A;  3PUV A;  4YIJ A;  5EBC A;  2IX3 A;  4DA2 A;  4FXG C;  2DNE A;  1PFB A;  4GZY C;  4RA8 A;  1K8M A;  4X3S A;  5C6A A;  1XYI A;  1BXT A;  2K32 A;  1QB5 D;  3K59 A;  4I65 A;  5IT9 L;  4ZKB B;  3E6Z X;  1BDO A;  3U9O A;  3GV3 A;  5M5X B;  3W3A A;  1AFP A;  4B08 A;  4CGY B;  2WB1 B;  3VR4 A;  2VNU D;  3TZU A;  3OIP A;  4RKL A;  1KDB A;  4TQU S;  3MWY W;  1ZYR D;  3H0G B;  5C4J B;  1XWE A;  2PZU A;  1TKW B;  2FFK B;  2F0F A;  1A3V A;  3C2P A;  2F0Q A;  3VYT A;  4OIK A;  5D3I B;  2PZT A;  5K5P A;  5C4H A;  1NUC A;  2A69 D;  1R4P B;  1BQQ T;  4C3H B;  5ELD A;  4B9X A;  4XQN A;  4A93 B;  1NAP A;  5C0X I;  1AZP A;  2MUY A;  1YNJ C;  3R2I A;  1U4R A;  2B2U A;  2EY1 A;  1SXT A;  1EYD A;  1LT3 D;  5I9P A;  3SK6 A;  1TS2 A;  2F0G A;  3NE5 B;  4NMZ A;  3NWT A;  2F0V A;  2L4N A;  5DAU A;  5IGF A;  2F0U A;  2CHB D;  1EYA A;  4ZAI A;  4ZUI A;  1IW7 C;  3A56 A;  3L7Z C;  3NHH A;  3EJI A;  5IGG A;  2EYO A;  4HTH A;  1MI2 A;  3DUZ A;  2N55 A;  3IL8 A;  1G6Z A;  4O1N A;  1JIC A;  1CTM A;  3MFY A;  1TWC B;  1FR3 A;  3GTK B;  3Q24 A;  2JP1 A;  3HEJ A;  4O42 A;  4RGN A;  1HFN A;  2B2W A;  2A5H A;  3VR2 A;  4M1U B;  2E2J B;  2BCO A;  1BF4 A;  2QF7 A;  5J1Z A;  1W6J A;  5IOC A;  4RH6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...