1VQFA

Gene v protein mutant with val 35 replaced by ile 35 and ile 47 replaced by val 47 (v35i, i47v)
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
86
structure length
86
Chain Sequence
MIKVEIKPSQAQFTTRSGVSRQGKPYSLNEQLCYIDLGNEYPVLVKVTLDEGQPAYAPGLYTVHLSSFKVGQFGSLMIDRLRLVPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GENE V PROTEIN
publication title Context dependence of mutational effects in a protein: the crystal structures of the V35I, I47V and V35I/I47V gene V protein core mutants.
pubmed doi rcsb
source organism Enterobacteria phage f1
molecule tags Dna binding protein
total genus 10
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 1996-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02303 Phage_DNA_bind Helix-destabilising protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1vqfA00
3M9BA 1Y1WH 1Q1BA 1FL0A 1YIJA 3RN2A 1EQQA 4DR5Q 1G51A 3CAMA 4JI1L 4YY3Q 1Q46A 1PH5A 3GDEA 1X9NA 4DR1Q 4BA2I 4QY7A 5GQOA 5M5XH 4B3ML 3GTMH 4UP7A 3FKIH 4BY7G 3OW2A 1QVGA 3PCOB 1N32L 4GKKL 3K8AA 3CMEA 1X56A 3Q8DA 4IJHA 4DPGA 3D0FA 1GO3E 1RL2A 2WFWA 1YHQA 1M1KC 1FJGQ 3NEMA 3UDGA 5GROA 4BBRG 2KENA 4JI5L 5EAYA 4DV1Q 3CCLA 4C3IH 4B3RL 3H15A 3G48A 1Z47A 3NBHB 1VS0A 1B8AA 4NXMQ 4GN5A 3H0GG 1R9TH 3CF5A 4JI8Q 5IYCH 1GKHA 3PF5A 4A3DG 4IOCA 1KXLA 4MTNA 4Y7NH 4A3GH 2JK8A 1WOCA 5GADC 1XMQQ 1TWHH 2NN6I 1UE7A 4JI7L 2RCNA 1XMOQ 4DR5L 1PYSB 1X54A 4HIKA 3BJUA 2Z0SA 2RHSB 4YY3L 5IP7G 3RNUA 3CC2A 3EN2A 1IXRA 3F2DA 2WAQE 4APVA 1QUQA 4RMFA 4DR1L 1CSQA 4P75A 3HOVH 5C44G 1C0AA 3CCSA 1PA6A 4DR2Q 4DK6C 1PH4A 4IPHA 5IP9H 2L15A 4OXPA 1WCMH 4GS3A 4A3EG 1YJWA 2E5LL 2ES2A 1PH3A 1H95A 1VQ4A 4A3FG 1YI2A 3H3VI 4JCVE 1EFWA 4DV1L 4OX9L 2F4VL 1J6QA 3F8TA 3SGIA 3PUXA 1EWIA 4IPDA 4X65Q 4X64Q 1G291 1XJVA 1J5EQ 4LF7Q 1CKNB 4IPGA 5H1SE 2JA7G 3GTPH 2VNUD 1VQFA 3J81i 5HGQA 1Y1WG 3GTOH 4UP9A 1IZ6A 2R93H 3S1NH 1CKOA 3KF6B 3LGJA 1HZAA 1EQRA 1X65A 3I4OA 3J80c 4X6AH 1XMOL 1B7YB 1B70B 3CCQA 3PUVA 2RHQB 3F1ZA 5GAGC 4HIDA 4DR6Q 4LFAQ 4IFDJ 2IY5B 4A3CH 1IL2A 1I50H 1W3SA 3S24A 1P8LA 5E7NA 2B63H 3EIVA 4FDBA 4QIWE 4DV4Q 3I2ZA 1YHAA 1YVCA 3CCVA 1YNXA 2I5HA 5LMNW 1KD1C 4P72A 2E2HH 3S15H 2KBNA 3KF6A 4RG1A 2E2JH 1V43A 1KRSA 3GTJH 3RN5A 1IBKQ 3PUZA 1I3QH 4JG2A 1HZBA 3TQYA 5C0XJ 3ULPA 4JI0Q 1A62A 3W5OA 3B6YA 4OWWB 2JJQA 5IY0A 2K5NA 4X65L 3UDXA 3U58A 1XPOA 5IYCG 4X64L 1K8AC 3HOUH 5IT9c 4LNQA 2MQHA 3TREA 5JEAG 2HQLA 1M90C 1IBLL 4KHZA 4A3GG 1N36Q 2YU9H 4GLAC 4B3SQ 1VQDA 2HIVA 2CKZB 3TS2A 1VQNA 3M4QA 4ME3A 4DNIA 3JC66 4DV2L 4LF8Q 2N8NA 4HJ8A 2JA8G 3F2BA 4HJ5A 1HJPA 3S1RH 3HOVG 3S1QH 4DR6L 4LFAL 4DV0Q 3E0EA 3PUYA 1UE1A 1VQ9A 4GLXA 4R4TA 5IP9G 2EIFA 3K81C 2IHEA 3CPFA 5M3FH 4DV4L 2MO1A 2NVTH 1HR0Q 1Q1EA 3HKZG 2YTVA 4PZ8A 4R1JA 2ZM6Q 2WB1G 1KC8C 1WI5A 3KF8B 1HZ9A 4JBWA 1K83H 3UDFA 3GTLH 3FHWA 3PGZA 4X62L 1HNWQ 4LF9Q 1TWAH 2N78A 1MIUA 3U4ZA 4JI0L 1HNXQ 4DV6Q 4UPAA 3UE1A 4GOPA 1MJEA 2VL6A 2H5XA 4POGA 4DV3Q 4YWMA 2UXDL 1E3PA 5IYBH 2R93G 2UUBQ 3E9HA 5FLXc 4B3SL 4LF4L 4P74A 5M3MH 3CC7A 4JBKA 4LF8L 1T9HA 1E22A 3HOZG 2ID0A 4IO9A 4A3CG 1OXXK 1PV4A 4JI4Q 2VY3A 2GN5A 3GO5A 5AJ3L 4DV0L 4IPCA 4JI3Q 3PO2H 4UY8C 3HOXH 1Q12A 2I5MX 4EQ5A 1K73C 2CQOA 4YHHQ 1Q86C 1PH2A 4OO1I 1HR0L 4QQBX 2ZM6L 3J7ZC 3PIOA 1YHBA 3RLOA 3L2PA 3T1YQ 2UXCL 3GTKH 5C4XG 4JYAQ 3J81j 1SROA 2E8GA 1VQLA 1WJJA 3J7A5 2GVBA 3UE0A 4DK3C 3D31A 2HIXA 1ASYA 3STBD 2IT1A 1HNXL 2D0PA 4OONA 4DV6L 4JOIC 1JE5A 2D62A 3KDFA 3HKZE 4BY1H 2UXBL 2WB1E 4BA1I 2Q2TA 2RF4A 4DV3L 1QUQB 2LXKA 1A0IA 2C35B 1VQAA 4KLKA 5IWAL 3UDIA 4B3TL 4NXNQ 1VQEA 1Q8KA 3PIPA 4WJ4A 3A74A 2JA5G 4JC0A 1X6OA 4A3JH 3S1MH 4X66Q 4JI4L 1N8RC 4L5TA 4A3LG 2AWNA 5M3FG 4JI3L 2VQFQ 4Y52H 1VQHA 1GD7A 1GM5A 4A3BG 4KHPQ 5DLQE 1VQCA 3I7FA 4DAYB 4YHHL 1N34Q 3PO3G 1Q7YC 3M3YH 4JBMA 3CCEA 4QL5A 3T1YL 4GKJQ 4GN4B 1KIXA 4JYAL 4GNXA 3K0XA 4BXXH 1LM0A 1FJGL 1TWFH 1I5FA 1XNRQ 1AE3A 2D0OA 1V9PA 2K5VA 1YZ6A 2KHIA 2F3IA 5IYBG 1KRTA 2BA0A 4DUZQ 1D8LA 1Y1VH 2EXDA 4LUOA 1PH1A 3NENA 3CXCA 5M5WH 3TEHB 3KJOA 1KHIA 1PHJA 5M3MG 2PI2A 4DV7Q 4QJFA 1NJIC 1JMCA 2AKWB 4GLVB 4NXML 4A4IA 4JI8L 4JV5Q 1DGSA 5FJ8H 4NXNL 5J3BA 2ZTEA 3CCMA 1TWGH 3I4NH 3BZKA 2XTIA 1VCIA 2KCMA 3OYYA 1XMQL 2QEXA 5JEAJ 1E1TA 4DR7Q 1CKMA 4YWLA 2YYZA 4X66L 1FGUA 3HOXG 4A93H 5M5YH 1ASZA 2QGQA 2R7DA 2VQFL 1VQBA 2E2IH 3FKIG 4YWKA 4YCWA 3G4SA 2JE6I 3CW2C 3I56A 2ZJPA 1X3EA 1N33Q 3T1HQ 2VUMH 1N34L 3I4MH 4NPSA 3CMAA 4DR2L 3AFQA 2R92H 2ASBA 4GKJL 1E7ZA 2MNAA 3OTOQ 4O0AA 2ZJRA 4OO1G 2MO0A 1XNRL 4BY1G 2R7ZH 1VQOA 1I6HH 4ALPA 2JA9A 2Z6KC 1L1OC 1QVCA 2N49A 1WYDA 1XTDA 1TXYA 3TS0A 3PF4A 1IBMQ 2I0QA 3AQQA 4JI2Q 2OTLA 4YCUA 1J5EL 4DV7L 4LF7L 3CC4A 4JV5L 1S72A 1VQ5A 2JEBI 2EQSA 2PQAA 1MJCA 2FXQA 4LUZA 2CWAA 2Q2UA 2K4KA 4DR7L 4A76A 3S2HH 2VS1A 2AWOA 2PNHA 2HHHQ 1KAWA 4BY7H 4GOPB 4A75A 3RLNA 3AFPA 3G6EA 3T1HL 4BXXG 4DR3Q 1WCMG 5JJIA 3CCUA 1YJNA 3A5ZB 1E24A 1SRUA 1BBWA 2YV5A 3OTOL 1YITA 2YTYA 4R4IA 3CPWA 3CQZH 1VQ8A 1IBKL 2CWPA 3GTGH 4K0KQ 1P16A 2AHOB 2ZTDA 4DV5Q 3CCJA 5K36G 3ERSX 4JI2L 4LFCQ 1SFOH 5FJ8G 4C2MH 2Y0SG 4LFBQ 1V1QA 1U0LA 3I4NG 4JI1Q 4AQYQ 1N36L 4XTCS 2CCZA 4H02A 3PUWA 1RIPA 2UUCQ 3M85A 4A93G 3J81c 2A19A 5C0XG 5ELNA 4PZ6A 4HJAA 1NTGA 1N32Q 2B63G 2VUMG 3I4MG 4GKKQ 2HHHL 1UWVA 2K14A 3JAMc 1XNQQ 1X3GA 1GVPA 4DR4Q 2R92G 3KDFB 4P73A 2V1CC 2Q2HA 2K50A 2QA4A 2LXJA 4HJ7A 2OQ0A 3RR5A 3GTQH 2R7ZG 4WJ3M 3M7NA 1IYJB 1JJGA 1VQMA 2IX1A 1Z9FA 2PI2E 4PG3A 3W1GA 1HNWL 1I94Q 4LF9L 2OWOA 1AH9A 3G71A 3HOUG 3E9IA 1A63A 4OWXB 3J80i 3ULLA 4DV5L 2JA6H 2JA7H 2OQKA 3M4PA 5C3EH 1K8GA 3FP9A 4LFCL 1W2BA 4UP8A 1HR0W 1PH9A 4JI7Q 3DM3A 4LFBL 4JI6Q 4P71A 4AQYL 4A3MH 2UUBL 2PMZE 1VQKA 2A8VA 2UUCL 4DAMA 3W1BA 2ZTCA 3AEVA 1SN8A 1PH7A 2NZOA 4GNXB 2ATWA 4PMWA 1MKHA 2JQOA 2ZJQA 2K5HA 2Y0SE 2VQEQ 1PYBA 1QZHA 1XNQL 3WWVA 1X3FA 2E5LQ 4DR4L 3EBEA 2LSSA 3MXNB 4A3IH 4NB3A 3STBC 1OXTA 4KI0A 2NZHA 2F4VQ 4OX9Q 1LTLA 3BU2A 3RLFA 4L5SA 5GAHC 1JJCB 4QGUA 1PH6A 2UUAQ 4IFDI 3NELA 1I94L 4O2DA 1O7IA 1JB7A 2DGYA 1NY4A 4LF5Q 2A1AA 2R7FA 4DKAC 5IYDH 1K0RA 3ZJYC 1XPRA 1UE6A 1HNZQ 2F52A 5LMNQ 1K3RA 3K7UC 1KQSA 1PVOA 2KHJA 4JI6L 1UE5A 2N3SA 2NVXH 3HKSA 5JJLA 1WFQA 4EX5A 3PV0A 5C0XI 1CUKA 2GVAA 1YJ9A 5IE8A 1SR3A 2K52A 1Y14B 2IHFA 2NVYH 3HOYH 3PO2G 4BBSH 3F2CA 3BZCA 3ER0A 4TQUS 4AYBG 2VQEL 3HOWH 1LYLA 1NMGA 1SMXA 2BH8A 3IRBA 3A0JA 2MFIA 2AMCB 2JA8H 4J15A 3S16H 4KHPL 2OTJA 3U4VA 1E1OA 1LUZA 1N9WA 4XIGS 1QVFA 4GOPC 2NVQH 1VQ6A 1OXUA 4L5RC 1FVIA 2BA1A 2BH2A 3MEFA 5GAEC 4IJLA 3K7AH 4GN3B 3L0OA 4AH6A 2UUAL 5ELOA 2PQAB 1KL9A 4MNOA 1SLJA 1IBLQ 3CP0A 1PFSA 5C3EG 1S40A 2JA6G 2ALYB 1U5KA 4HJ9A 1JT8A 5FLMH 1BVSA 2Q2IA 3KJPA 4LW1A 1JJ2A 4LF5L 3H3VH 3ICEA 2JEAI 4A3MG 4JOIA 4DUZL 3JAMi 1HNZL 1PH8A 4DV2Q 5LMNL 1UEBA 4DUYQ 4A3KH 2DUDA 5BR8Q 2B29A 3VDYA 1OXVA 2WP8J 1K9MC 2VZAA 3HOZH 4A3JG 3K80C 3RZOH 1CKNA 4LWCA 1L0WA 3CCRA 1A8VA 2VW9A 1AE2A 1VQGA 4R4OA 4R4QA 5LMUQ 1XPUA 4A3IG 3CD6A 1EYGA 5HY6A 4HIMA 3DLLA 1BKBA 4X62Q 2UU9Q 3TRZA 3PSIA 3KYHC 5C4XH 1N33L 4LF6Q 2OCEA 4OWTB 4AYBE 3A5UA 4IOAA 4BBRH 2K75A 1EIYB 1EIFA 5IYDG 1YBYA 2XGTA 4C3JH 1EOVA 3S14H 1HH2P 3KOJA 3RZDH 2UXDQ 1Y1VG 1C9OA 3GD7A 4LF4Q 4IFDG 3S2DH 3H0GH 1VQPA 1IBML 4DUYL 1NMFA 4A3DH 1SE8A 1OTCA 1NBWA 5BR8L 2JA5H 4PZ7A 3AYHB 5AJ3Q 3HOYG 3M4OH 1TWCH 4BBSG 2NN6G 4AIMA 3HFZB 1VQJA 1G6PA 3HOWG 2HT1A 5IP7H 4A3LH 2CFMA 5LMUL 4B3MQ 3KLWA 2B3GA 1C7YA 4A3BH 3L7ZC 1S3OA 1OXSC 1VQ7A 3ULJA 4GNXC 1EUJA 2UXCQ 4MZ9A 5C44H 3PO3H 4LUVA 1L1OB 2UU9L 4POFA 2YTXA 2I5LX 1BBUA 1HZCA 3U50C 4LF6L 1CSPA 4DR3L 2KCTA 4R4CA 4A3EH 1VQIA 4JI5Q 5JJKA 2IX0A 2UXBQ 5FLMG 4C3HH 4A3FH 1NE3A 1D7QA 3KFUA 4B3RQ 1QZGA 3S17H 4JBJA 2R6GA 3I55A 1L2FA 5IWAQ 2WAQG 4HIOA 4A3KG 4B3TQ 4K0KL 1Q82C 2Z6KA 4YCVA 1L1OA 1YEZA 4TVAB 5C4JH 1Q81C 1X55A 4L5QA
chains in the Genus database with same CATH superfamily
3M9BA 1Q1BA 2F0SA 1EQQA 4DR5Q 4N8X1 1S5FD 4MHEA 1X9NA 2ZXRA 4PMCA 4X3KA 1UUPA 4BY7G 1QVGA 4NKLA 3K8AA 1GO3E 2QW7A 1YHQA 1M1KC 4BBRG 1D5ZC 5IT9E 4FF1A 4JI5L 4QUFA 4DV1Q 4C3IH 4B3RL 3NBHB 4NXMQ 1VS0A 4KKTA 3H0GG 5IYCH 1DONA 1O80A 1BO0A 3I3CA 4A3DG 1ET9A 5GADC 2F0QA 1TWHH 1TQOA 4JI7L 1PYSB 5C5LA 1U4RA 2RHSB 5KGUA 4YY3L 4IN3A 4PNYA 1KLUD 4DR1L 3K5LA 2IJ0A 1PA6A 2NVYB 4DAPA 4RHRA 4DK6C 1PH4A 2JSOA 4FO2A 4A3EG 1YJWA 4CKCA 1H95A 1JWSD 4IURA 2JA8B 3MXPA 4OX9L 2NVQB 3WOEA 3F8TA 1EWIA 2HQEA 1DOKA 1X3PA 2VNUD 4LF7Q 2JA7G 5K36H 1VQFA 2F0DA 3GTOB 1A6XA 3S1NH 1EZ6A 1CKOA 4Z9CB 3KF6B 1CFMA 3I4OA 3PUVA 2RHQB 4DR6Q 1JE4A 1XX8A 3FRPB 1IL2A 3SK4A 1O7LA 4FDBA 1PRTD 1I4GA 1YHAA 1YVCA 4L8JA 1STBA 3NXWA 5CV8A 5LMNW 2E2DC 1C8CA 2E2HH 2KBNA 3KF6A 2E2JH 1DOLA 1V43A 1KRSA 1Z6HA 1HZBA 5C0XJ 4JI0Q 1A62A 3W5OA 4OWWB 2JJQA 2E74C 1XPOA 1Y8NB 4LNQA 1ESRA 1EEFD 4RGTA 4B3SQ 3MTSA 2YU9B 1QG7A 2P5ZX 5EQ0A 5D14A 3NE5B 4ME3A 2BE5C 4M8AA 1I4QA 4LF8Q 1X32A 2N8NA 3S1RH 1FYCA 2WIIB 1UE1A 3K58A 2IHEA 2YTVA 2WB1G 1KC8C 2FFKB 2PW7A 1HZ9A 4JBWA 2VB2X 3GTLB 4X62L 1HNWQ 4LF9Q 4RGOS 5C5MA 4GZYC 1MIUA 1HNXQ 3UE1A 3EFXD 4GOPA 4A3EB 4DV3Q 4ILWA 2UXDL 1TS2A 2L1BA 3S17B 2UUBQ 2KEEA 4XQQA 3JAML 5M3MH 3K5OA 1AZPA 4IO9A 2O4XA 5F2DA 4JI4Q 1PTOC 3GO5A 5AJ3L 3WOFA 4JI3Q 3PO2H 2O5IC 4UY8C 3HOXH 1Q12A 1JOKA 2K01A 4NDXA 4EQ5A 1II3A 1QB5D 1PH2A 3GTMB 3RLOA 2UXCL 3BYTB 5CC4A 2CH4A 2E8GA 1OO9B 2NBFA 2MGSA 5CMDA 1ASYA 2D0PA 2E75C 4EVOA 1JE5A 2D62A 4ZQ3A 2UXBL 1UEAB 4NMZA 3UDIA 1O7ZA 1EU3A 3I4LA 4B3TL 3W2DA 3PIPA 2JA5G 4JC0A 3S1MH 5CYUA 4HAEA 2LS01 1EZ8A 4Y52H 2AQ3B 1VQHA 1GD7A 1K28A 1GM5A 2F0HA 5DLQE 4IUQA 3I7FA 4BS9A 1Q7YC 2NWGA 3G7LA 1CTMA 4KD4A 2MUYA 2Z1CA 1HTLD 5EKIA 5M9OA 4FYDA 3M3YB 3K0XA 1LM0A 1RF2D 1FJGL 1BCPB 1AE3A 4DXGA 1LT3D 2WB1B 2O2LD 3FPUB 3NENA 2SNSA 3KJOA 1EWHA 1PHJA 4IUNA 1JMCA 3J81E 3GTPB 4NXNL 2SOBA 1PXUA 3OYYA 3VA7A 1HUNA 5JEAJ 4FXDA 1CKMA 1EEID 1SSOA 5KIXA 1VQBA 5C0XH 4ZYSA 4YCWA 3CW2C 1N33Q 1N34L 2B63B 4NPSA 3CMAA 3K5MA 3AB9A 4O0AA 3S15B 3OHXC 2MO0A 1XNRL 4ALPA 1Q8IA 2L11A 1IBMQ 3AQQA 4JI2Q 3MWYW 1J5EL 1B9MA 1PZJD 2MJ8A 3CC4A 3MHBA 4JV5L 2RDFA 1S72A 1VQ5A 2PQAA 2FXQA 4LUZA 2CWAA 3C1EA 3K6OA 1KDCA 4DR7L 4K5WA 4E6IA 4A76A 1WD1A 1Q3LA 2VS1A 4OL7A 4X3TA 2AWOA 5IT9L 2PNHA 2HHHQ 3S1QB 1ENFA 4A75A 3RLNA 4BXXG 4DR3Q 3QO2A 3CCUA 5IGGA 2NVTB 1SRUA 5ELDA 3LX0A 2RKSA 1HTPA 2YTYA 4RWSC 4R4IA 1RTNA 3CPWA 1IBKL 2CWPA 1TWAB 4DV5Q 2AHOB 5K36G 3NQIA 5A2QE 3D4DA 4LFCQ 5FJ8G 2WKDA 4K5XA 4C2MH 1W6KA 1LTID 2EYHA 4XYQA 2TMPA 3VYTA 5D3IB 4DF7A 2N55A 2EJMA 4GKKQ 1XNQQ 3JAMc 2K14A 4RHSA 5JPNC 1GUSA 1EU4A 2KCCA 3KDFB 4AYBB 2V1CC 4OGQC 4HJ7A 2X69A 1JJGA 2PI2E 3W1GA 1R4QB 5CV6A 2Q8RE 3G71A 1Y69U 4G7OC 2KQ3A 2AQ1B 3FP9A 1HR0W 1PH9A 3DM3A 4FP5D 4P71A 4A3MB 1BCPF 3W1BA 2ZTCA 1NSNS 4M1UB 2NZOA 4GNXB 4F88A 4A3JB 2Y0SE 1PYBA 3WWVA 4DR4L 3ND8A 1O78A 2SNMA 1ILQA 1EWCA 2LSSA 2LFNA 1WVLA 2EYMA 4A3IB 2F4VQ 2EJFC 5KYIA 2RCFA 1QCBD 3NELA 1EY6A 2XWJB 1NY4A 5JEAH 1PZID 1CM9A 1UE6A 1Y8OB 4ZRZA 2HCIA 2PMZB 3K7UC 5LMNQ 1KQSA 1S4ZA 1K0SA 5JJLA 5C0XI 3PV0A 1T5EA 1CUKA 3E0JA 3OIQA 1PFNA 4IUTA 1GHJA 1SR3A 2NVYH 4LMQD 3PO2G 3HOYB 3BZCA 3CHBD 1SMXA 3IRBA 3A0JA 3J7YW 3D6WA 2JA8H 4KHPL 4J15A 2E2IB 3U4VA 3A7AB 3S16B 2LY7A 4XIGS 3DXJC 4GOPC 2NVQH 1VQ6A 2VXWA 2BH2A 2BA1A 3MEFA 4GN3B 4FF3A 3KLSA 4JPBW 4AH6A 2UUAL 5ELOA 4F87A 3J80L 1IBLQ 5C3EG 1JT8A 2ALYB 1EYAA 3BDOA 5FLMH 1JJ2A 2RQXA 4P2CB 4JOIA 1HNZL 1PH8A 1K3BC 1SNPA 2AQ2B 2DUDA 5BR8Q 2B29A 3VDYA 2AUJD 1EY8A 1K8MA 2HCCA 1A3VA 1L0WA 5KEEA 1A8VA 3IFTA 5EJWA 1AE2A 1VQGA 2IPKD 3CD6A 4HIMA 1C4QA 1CHPD 4XT1B 5NUCA 2WACA 3KYHC 5EPJA 2L4NA 4ZUJA 5CBAE 4IOAA 4BBRH 1ICWA 5IYDG 1YBYA 2XGTA 1SYCA 4LF4Q 1EQVA 3H0GH 4DUYL 5L37A 3DWPA 4A3DH 1SE8A 1UNSA 4PZ7A 2NN6G 4AIMA 1ZXTA 3HFZB 2L12A 1XWEA 5EBCA 2EYPA 1D5MC 3MC0B 5AFWA 4MZ9A 1L1OB 2A6ED 1GUNA 4A3EH 5JJKA 1VQIA 3A8IE 1WTVA 3GTQB 5C3WA 3S17H 1TR5A 4PMBA 4K6DA 4B9WA 1L2FA 5IWAQ 2WAQG 4HIOA 4A3KG 4K0KL 1BCPD 2F0JA 4YCVA 1L1OA 1Q81C 1X55A 3PMFA 2QDBA 4K6LA 5C3EB 2FMCA 1SMYC 1G51A 2F0FA 1EYDA 1PLFA 2K5QA 2A69D 1Q46A 4BA2I 4B3ML 4N8FA 2HDMA 3GTMH 3VR5A 4DK1A 3OW2A 3ZYYX 2PW5A 3CMEA 4IJHA 3T4AC 4JVZA 4DPGA 3SR1A 2WFWA 2WINB 5C6AA 3NEMA 4DNRB 2ZT9C 1B3QA 5EAYA 3K0YA 1B50A 1MSHA 3H15A 1B8AA 3V2TA 3F2UA 3I90A 4JI8Q 1GKHA 2ZXOA 4EQPA 3PF5A 1KXLA 4MTNA 2XWBB 5K5PA 1XMQQ 1S5DD 4KKUA 1PTOB 2RCNA 4DR5L 2KECA 1EL0A 1LO5D 2Z0SA 5IP7G 3CC2A 1IYVA 1M8AA 1SDFA 3Q23A 1CSQA 2LMCB 3U9SA 4CBVA 3CCSA 1C0AA 1HRJA 4C1NK 4IPHA 4WFN3 4OXPA 3PIO3 5KNDA 2ES2A 1PH3A 3OIPA 5JAVA 3HKZB 3DEOA 5COYA 1YI2A 2WKCA 1EFWA 4DV1L 3DWQA 3SGIA 4X65Q 2F0VA 5FLXE 1Q90A 3QWNA 4X64Q 1G291 4DK0A 4IPGA 3GTPH 2EY1A 3R3OA 4G7HC 1HZAA 1HQMC 1X65A 3J80c 1EOTA 1B7YB 2WAQB 4A3KB 1YNJC 5GAGC 4XXEA 2K05A 1W3SA 1V1PA 2B63H 2GA4B 3DHQA 5E7NA 3EIVA 1ENAA 4QIWE 1SJED 3CCVA 4P72A 3S15H 2Q8TA 2A6HD 1SNQA 2L5TA 3PUZA 2NZ1D 3TQYA 1I3QB 3ULPA 5C4XB 2RDGA 4L63B 2K33A 1EY5A 2MQHA 2K7VA 5JEAG 4A3GG 3T16A 3RUZA 1N36Q 1VQDA 2HIVA 3VYSA 2CW0C 3TS2A 3M4QA 3QG1A 2QDLA 3SK8A 1C48A 1HCZA 3F2BA 4HJ5A 5KRUA 2ICEC 3S1QH 4DR6L 4DA2A 4DV0Q 5EPLA 4EQOA 4I7AA 3I8ZA 4DAVA 2F0OA 2NVTH 1TS4A 4TSSA 1HR0Q 2JA8G 1WI5A 2G9HD 3PO3B 2QKIC 4KK7A 5DEHA 1TWAH 3U4ZA 1STGA 2M00A 1CK1A 1RCVD 4JI0L 1MJEA 2VL6A 4YWMA 1E3PA 2R93G 4KMUC 4B3SL 1KAAA 1S5CD 3OMCA 4LF8L 1T9HA 2JXMB 3SK5A 1HQRD 4A3CG 3P75A 5C4HA 4O42A 3ND9A 4EGVA 1K73C 4YHHQ 1Q86C 2EY5A 1L0XB 1PTOF 3FKIB 1YHBA 3T1YQ 1FD7D 3J81j 1VQLA 1HA5A 1IW7C 1WJJA 2GVBA 3UE0A 4DK3C 3K5NA 2HIXA 3STBD 1HNXL 4OONA 4JOIC 5CV4A 2SEBD 2WB1E 2RF4A 4DV3L 2KJXA 1ML0D 1VQEA 4WJ4A 3A74A 4A3GB 5FO9B 1AFPA 4A3JH 3H3VC 2K6AA 3DWAA 4X66Q 4JI4L 1N8RC 4JI3L 1VF5C 1VQCA 3OWEB 4CDDC 2EYJA 4KTAA 4JBMA 4QL5A 4GN4B 4BXXH 3T56B 3TZDA 2FJ2A 1I5FA 1TWFB 2D0OA 1V9PA 2F3IA 1GUOA 2K5DA 2BA0A 1D8LA 1A2UA 2EXDA 1PH1A 1CZWA 3CXCA 1B4OA 1KHIA 4DV7Q 4GLVB 2FMMA 5EKLA 1LT6D 1DGSA 3Q0AA 5FJ8H 5C4ZA 2ZTEA 1STHA 2XTIA 2R93B 4WORA 2K04A 2E2IH 2I46A 1NNXA 3A8JE 3G4SA 1NR2A 4DR2L 4KY7A 4NW2A 4L6TB 1I4HA 4C1NI 2R92B 2MNAA 3OTOQ 1ZYRD 1KLGD 4BY1G 2JA9A 4R8NA 3GTJB 5I6WA 1AW7A 4V0BA 3Q24A 1L1OC 2EDGA 1WTOA 1WYDA 3TS0A 3BVMA 2L55A 4HSPA 4RCOA 4XQNA 2EQSA 1PRTC 1V8QA 2K4KA 3VYRA 2Q2UA 2PZWA 1NAPA 4GOPB 1TU2B 1E2WA 2K28A 3S9WA 4YIJA 3OSOA 1K83B 3TP8A 2B39A 3EQLC 1M4VA 2ZTDA 3CCJA 4N9PA 4JI2L 2TSSA 1SFOH 3ITPA 4HMIA 4HCSA 2EYOA 1V1QA 4LFBQ 3I4NG 2CCZA 3L3OC 5FKAC 4A93G 4QUCA 1LTRD 1STAA 1NTGA 4S3SA 2B63G 3I4MG 4HN7A 1UWVA 2HHHL 1CHQD 1KNAA 5FLXL 2QA4A 2K50A 2LXJA 5KNBA 3GTQH 2Z9HA 2R7ZG 2IW3A 5EKKA 3M7NA 3D3RA 1G91A 1DD2A 3W3AA 4ZKCB 3EJIA 3E9IA 2PPBC 4OWXB 3J80i 3ULLA 4DV5L 2OQKA 3D4WA 3M4PA 3BYYB 5C3EH 4KD3A 1K8GA 4LFCL 4BY1B 4K14A 1W2BA 4JI7Q 1V1OA 2PMZE 2F3WA 1VQKA 1SBBB 3AEVA 1RHPA 1D6EC 3A7LA 4PMWA 2JQOA 1STEA 2ZJQA 2K5HA 2V4DA 2VQEQ 1XNQL 1EFID 1X3FA 1Y8PB 1DYQA 2EYFA 1OXTA 4KI0A 1S5ED 1PZKD 4OX9Q 1LTLA 4L5SA 3C1FA 1RTOA 1JJCB 4QGUA 1LTSD 1SE4A 4O2DA 4J8QA 1IL8A 4QMGA 4LF5Q 2A1AA 2R7FA 4WJWA 1D5XC 3VA5A 5IYDH 2CHBD 1F2ZA 3ZJYC 4BWGB 1PTOH 2F52A 3BDLA 1K3RA 1Y1VB 1PVOA 2KHJA 5M5WB 3CU7A 3HKSA 2O5JC 1RDPD 2GVAA 1YJ9A 2R61A 1EQTA 2IHFA 5DM73 3I4NB 2NN6H 3ER0A 4K8IA 4AYBG 1L0YB 4A93B 1LYLA 5M5YB 1NMGA 2BH8A 2MFIA 3KLSX 4RKLA 1E1OA 1SAPA 1LUZA 1N9WA 1QVFA 3I4MB 1MD2D 1F9QA 1AZQA 4IJLA 3L0OA 2PQAB 4MNOA 1S40A 1U5KA 2XNAC 5J22A 4HJ9A 2R7ZB 4LW1A 1E0BA 4A3MG 4DUZL 3PIP3 5LMNL 4A3KH 4G7ZC 1OXVA 1K9MC 4A3JG 3K80C 4ME5A 1CKNA 4LWCA 3CCRA 4R4OA 4DNTB 4KJNA 4A3IG 3QJYA 1B44D 1BKBA 4X62Q 2PZTA 2UU9Q 3TRZA 4G57A 5C4XH 3N6RA 4LF6Q 3FEWX 2OCEA 2J0TD 3I70A 4FF4A 3ONAB 2UXDQ 2VB3X 3KOJA 3GD7A 2PQEA 2ZXPA 4RH6A 4FF2A 3GTGB 3J7AF 3S2DB 1A2TA 1NMFA 1F2YA 3P7JA 5BR8L 1CZGA 2IWHA 3AYHB 5AJ3Q 3HOYG 4K2KA 3M4OB 3MEHA 1G6PA 1H9JA 3OOCA 3BVZA 2HT1A 3HOWG 5IP7H 4A3LH 2CFMA 3Q6SA 1JCKB 2B3GA 3KLWA 1C7YA 3VYUA 1S3OA 3ULJA 1T5XD 2UXCQ 3HEJA 3PO3H 4LUVA 4OHJA 4POFA 1WTQA 4B08A 1BBUA 1HZCA 2NTSA 1LTGD 2KCTA 3TMEA 2UXBQ 1SE2A 1D7QA 1S5BD 4JBJA 3I55A 3TDQA 3KF8A 4B3TQ 3A56A 2Z6KA 3SHLA 5C4JB 4L5QA 5E4XA 1YIJA 1FL0A 5I9PA 4QCLA 1XXGA 4JI1L 2SDFA 1PH5A 3GDEA 2KEDA 5GQOA 4UP7A 3L9AX 3FKIH 2BCOA 5CV5A 3TP7A 3PCOB 2RBMA 2DJFC 1N32L 3D4RA 3NTIA 4CHTB 1X56A 2NB0A 3Q8DA 1FJGQ 1B1ZA 3D0FA 3QB3A 2NYZD 3EROA 2Z8LA 3TZUA 2KENA 4OO1H 2PNRC 4C3JG 2F4IA 3CCLA 1MSGA 2XN9C 1Z47A 2MPMA 3G48A 4GN5A 4OIKA 3CF5A 5IGDA 3MA2B 2NTTA 1STNA 2J4XA 4A3GH 2JK8A 2DJGC 4XYOA 2NN6I 1UE7A 1A15A 1XMOQ 3NP8A 1IKLA 3BJUA 3BZDB 5ELEA 3KBXA 2NVXB 3EN2A 1IXRA 2WAQE 1QUQA 4P75A 4HMJA 1LABA 5C44G 4DXFA 3LWUA 2L15A 3CRKC 3HOWB 3HZXA 4GS3A 3LNNA 2EY6A 2E5LL 1U4PA 1VQ4A 2QCPX 4A3FG 3E3XA 4IPDA 5J39A 3TSSA 1XJVA 1J5EQ 3M7GA 5H1SE 2F0EA 4CDEC 5HGQA 3TP5A 1Y1WG 3GTOH 2C9OA 1DXMA 1IZ6A 2R93H 2Z6BA 1EQRA 3AMUA 1ZEQX 1B70B 3RMHA 3F1ZA 4QB4A 2A68D 4HIDA 1BQQT 4LFAQ 4IFDJ 4A3CH 3HOZB 3RZOB 1P8LA 3A8KE 4DV4Q 3I2ZA 3D6CA 2EYLA 2E2HB 5A35A 4RG1A 3RN5A 3GTJH 4UDUC 1IBKQ 3K59A 2RSOA 2K5NA 4X65L 3UDXA 4X64L 5IT9c 3TREA 1DOMA 4CGYB 2HQLA 5FO8B 4KHZA 4C3JB 1JOOA 5I9OA 2YU9H 4GLAC 3MZ5A 4RKBA 4DNIA 3JC66 4DV2L 4J6HA 1HUMA 2JN4A 4HJ8A 3HOVG 1YNND 2QF7A 3E0EA 3PUYA 1VQ9A 1BXTA 4GLXA 3NWSA 5IP9G 2EIFA 3CPFA 2MO1A 2RA4A 3HKZG 2ZM6Q 4A3BB 3MXUA 3GTLH 3UDFA 1K83H 3FHWA 3PGZA 5C44B 3VR2A 3GV3A 2N78A 3J7AV 4DV6Q 4UPAA 3QOJA 3KUPA 3J81L 2H5XA 1SYGA 4KN4C 4A3FB 4C3HB 1CQFA 1CQVA 4X3SA 2QEJC 4P74A 1PRTB 4JBKA 1SMYD 1JB3A 1Y1WB 1I6VC 1PV4A 4DV0L 4IPCA 2A6EC 3WDNA 1B3AA 1DM0B 2PCFB 5M5XB 4OO1I 1HR0L 4QQBX 3NUCA 3J7ZC 3PIOA 5C4XG 4JYAQ 2D2CC 4G4KA 4H0LC 2IT1A 1ENCA 4BY1H 2Q2TA 2AUKA 1LTAD 1H9MA 1HPCA 2LXKA 2A69C 1R9TB 3HGBA 2B2TA 1FR3A 1LLRD 4Y7NB 1WTPA 2NUCA 4L5TA 2OT2A 2AWNA 5M3FG 4A3LG 2VQFQ 3DMUA 4KHPQ 1AN8A 3OPOA 4DAYB 2KOLA 2N88A 4HCEA 4YHHL 3PO3G 3HOVB 1JR0D 1LT4D 1UAPA 3M3YH 4HSVA 3CCEA 3T1YL 4ULLA 4GKJQ 1KIXA 3MXGA 4KKSA 2KUMA 1WCMB 1SNDA 5A2QL 2G5DA 2KHIA 5IYBG 1KRTA 4RGMA 5ELCA 3MXNA 1Y1VH 4DAYA 5M5WH 4IFDH 4NXML 1AEXA 2PI2A 4QJFA 1V1PB 1F2LA 4I65A 5J3BA 3FDTA 1EY0A 2Y0SB 3I4NH 3H94A 3JAME 2QEXA 2E76C 4X66L 4A93H 5M5YH 2OF1A 1W6JA 5CBEE 3FKIG 3CRLC 2JE6I 3I56A 2B2VA 2ZJPA 2WV6D 1GUWA 1I50B 3T1HQ 3I4MH 3NBIA 5KNCA 1GOZA 3R8BA 1B9NA 2ASBA 2MHVA 1E7ZA 1AP0A 4OO1G 1VDZA 2XRQD 2R7ZH 3HP3A 4ZAIA 1HHVA 2Z6KC 3DEPA 2N49A 1TXYA 3PF4A 2I0QA 2OXPA 2OTLA 1QOHA 5IIFA 3HOUB 4DV7L 4LF7L 3SEBA 3M4YA 2F0WA 3GQBA 3C3LA 1BUVT 4ZKBB 5CGKA 4UAIA 1HFGA 4J1MA 5T1IA 1BR9A 3RD4A 1SNMA 2A6HC 2F0UA 4H44C 1G6ZA 4KY5A 1K8OA 1PRTF 3AFPA 1JWMD 5JJIA 5M3FB 1BBWA 1SNOA 2L9HA 4CDCC 3OTOL 2B2YA 2PYKA 1VQ8A 1ET6A 3GTGH 4K0KQ 1P16A 3T13A 1HA6A 1H9RA 4OEMB 1X3QA 1XTCD 4KV6A 2DNCA 1KDAA 3OW7A 1JC7A 1U0LA 4C2MB 4AQYQ 2M9VA 4H02A 3PUWA 1RIPA 2UUCQ 1QILA 4WRDA 3M85A 3VR6A 3J81c 2BDNA 2A19A 3GP7A 4LJZC 4PZ6A 5C3XA 1H9SA 3X3NA 2VUMG 1X3GA 5G3LF 1MGSA 1GVPA 2R92G 4FXKC 1IYJB 1VQMA 2IX1A 3GTKB 1QE6A 2CVRA 4PG3A 1I94Q 4LF9L 2OWOA 1HNWL 2FINB 1KDBA 3C46A 3ERQA 2K32A 3GV6A 1SEBD 4RCNA 4LFBL 1TVXA 4X3UA 4JI6Q 4A3MH 2UUBL 3EA6A 3C2PA 2A8VA 2EXZA 4DAMA 4KHVA 1MI2A 1SN8A 1MKHA 4DFAA 5LL6S 2D9UA 1QZHA 4ZCKA 1WTRA 3EBEA 4A3IH 3E6ZX 4NB3A 3STBC 4C56C 4CJ2C 5JJZA 2NZHA 1SNCA 2CH4W 3BU2A 3RLFA 2OEOA 5GAHC 1SJHD 4IUVA 1PH6A 4IFDI 3BVGA 1O7IA 3FMCA 1JB7A 2DGYA 2F0NA 4PQXA 1K0RA 4ZUIA 2A74C 2N3SA 1F9SA 3O13A 2NVXH 1F9PA 1WFQA 4EX5A 3NBHA 4MTKA 5EPKA 5LL6X 1TWGB 3HOYH 3KLRA 3F2CA 4TQUS 2VQEL 4CKBA 3HOWH 1J8IA 1A3UA 1STYA 2AMCB 3S16H 2OTJA 2VUMB 4L5RC 1FVIA 5GAEC 2EOTA 5BN4A 2JA6G 1KL9A 2DY7A 2A73B 1I6HB 1BVSA 2Q2IA 3SDZA 4LF5L 3ICEA 3H3VH 2JEAI 3K57A 4KJOA 1UEBA 2DY8A 4MN3A 3HOZH 3RZOH 1TY0A 1EIGA 1RKNA 2BE5D 3FPPA 3URYA 5LMUQ 2XIWA 3S2HB 1EYGA 2XRSD 5I4DA 1ZYRC 4BY7B 1WTHA 3PSIA 3VR3A 1N33L 3NTHA 3P1HA 4OWTB 3VR4A 1D1KA 3TN2A 4AYBE 3SE0A 1RJTA 4BBRB 4C3JH 1B53A 1HH2P 5IODA 4IALA 3CQZB 1Y1VG 1C9OA 2B2TC 4IFDG 3BDCA 1VQPA 1IBML 3H0GB 5FK9C 2KVMA 4A3DB 3MFYA 4BBSG 4QIWB 3IKJA 4IZ8A 5G3LD 1GXDC 2EVBA 4A3BH 3L7ZC 1OXSC 5FO7B 1I4XA 1PTOD 5C44H 4U68A 2UU9L 2G9DA 2YTXA 5CV9A 1DJRD 2Z4IA 4LF6L 4DR3L 4JI5Q 4R4CA 4O1NA 2F0TA 2IX0A 4A3FH 4C3HH 1NE3A 3KFUA 4B3RQ 2EE1A 1QZGA 3SVMA 1HFNA 3NK9A 3J80E 1YEZA 2JA7B 4Q5VA 2JA6B 1Y1WH 3RN2A 2DNEA 2XVSA 3CAMA 4YY3Q 4OELB 2B2VC 4DR1Q 3IL8A 4QY7A 5M5XH 2K5WA 2IL8A 2HUGA 5HGTA 1MHWC 3R2TA 1SYEA 4GKKL 5IGCA 1RL2A 1TT2A 3NSWA 1U4LA 5LHY1 3UDGA 5GROA 1WTWA 1RD9D 1VMCA 1QWYA 4RA8A 1EY7A 5T1GA 1R9TH 4IOCA 4H13C 1R4PB 4DU9A 4Y7NH 1WOCA 1A3TA 1X54A 4HIKA 3RNUA 3PQIA 3F2DA 4APVA 4RMFA 3MAQA 3HOVH 2BOSA 1GHKA 1KABA 4DR2Q 4BBSB 5IP9H 4CDFC 2B2YC 3BG3A 1WCMH 4KY6A 1LT5D 5JVG3 4K5VA 2F03A 3H3VI 4JCVE 4N9TA 2F4VL 1J6QA 3PUXA 2KHSA 2KCNA 4JK1C 1GJXA 3K7AB 1VF7A 3H09A 1CKNB 4F7XA 2B2WA 3G6JB 3J81i 4I7ZC 1IHZA 1EY9A 4UP9A 1JICA 4EQNA 3LGJA 3D8GA 4X6AH 1XMOL 1ICFB 3CCQA 1G2TA 2B8FA 4QF4A 3A54A 1E2VA 4IUUA 4OIJA 2IY5B 1I50H 2PZUA 3S24A 1TS3A 4LK1C 1YNXA 2I5HA 1KD1C 5DM63 1NUCA 4HTHA 3I73A 1PYWD 3OMGA 1KTKA 4C3IG 1I3QH 4JG2A 1SYBA 3DM1A 5D65A 2FHTA 3B6YA 1GUGA 3R93A 5IY0A 3U58A 5IYCG 1K8AC 3HOUH 2EZVA 1M90C 1IBLL 2J7ZA 3S14B 1IYUA 3RZDB 1ILPA 2CKZB 1VQNA 1BF4A 1HJPA 2F3VA 2JA5B 4LFAL 1LTTD 1TWCB 1BDOA 1QNUA 4R4TA 1Z7TA 3K81C 2C5CA 5M3FH 4DV4L 5ELBA 5I2XA 1Q1EA 4PZ8A 4R1JA 3KF8B 3CKIB 1HXYD 2B2UA 3NTKA 2K1BA 2QILA 1EY4A 4POGA 1SYFA 5IYBH 1LTBD 3IAYA 3E9HA 3FVQA 2MP1A 5FLXc 4LF4L 2ENBA 3CC7A 4UHVA 2EJGC 1E22A 2ICIA 4PV1C 2ID0A 3HOZG 1IKMA 1OXXK 4F8MA 2VY3A 2GN5A 1EYCA 2I5MX 5DNFA 1JOQA 2CQOA 1QNKA 4FVMA 1G8ZD 3QR8A 2ZM6L 3L2PA 4HR7B 3GTKH 5EGTA 2Z4HA 1SROA 3QOLA 1LV9A 1FNVA 3J7A5 3D31A 4RGNA 3T51B 4DV6L 3KDFA 1FNUA 3HKZE 4BA1I 4C3IB 1QUQB 1TY2A 1A0IA 1PFBA 2C35B 1LACA 1VQAA 4KLKA 1D1IA 5IWAL 4NXNQ 1Q8KA 1PFMA 2A5HA 3I91A 2KA7A 1X6OA 5J1ZA 1WTXA 1GUTA 5I2YA 1JWUD 1TWHB 2F0PA 2M2LA 4ZK9B 2LKVA 4A3BG 2EY2A 1EIHA 1N34Q 4ID6A 4FNFA 4JYAL 4GNXA 2F0MA 1TWFH 4NP5A 1XNRQ 4C3HG 2K5VA 1YZ6A 5E4WC 1TKWB 4DUZQ 1ESFA 3E5SA 3NWTA 4LUOA 5IGFA 3TEHB 1QJOA 5M3MG 1NJIC 2AKWB 5D3DA 3X3MA 4A4IA 4JI8L 4JV5Q 3CCMA 1TWGH 3BZKA 1XMQL 1VCIA 2KCMA 3S1NB 1E1TA 4DR7Q 4YWLA 2YYZA 3HOXG 1FGUA 1ASZA 2IX3A 2QGQA 3KBGA 2R7DA 2VQFL 1F9RA 4YWKA 5JPMC 4IQZA 1X3EA 2VUMH 4IUPA 3AFQA 2R92H 1VMPA 4GKJL 4DGZA 1KNEA 3V05A 2B8GA 2ZJRA 3NQTA 3N52A 2E2JB 1I6HH 1VQOA 4TKOB 4MIUA 1QVCA 1XTDA 1DZ1A 3SXHA 3HG9A 4YCUA 3NHHA 3HRZC 2A68C 2HD3A 5CR3A 5IGBA 2JEBI 1MJCA 1CA6A 5CV7A 1U9RA 4CKEA 1SXTA 1CA5A 5JOBA 1ZKOA 3S2HH 1JORA 3S1RB 1KAWA 2X6GA 4BY7H 3R2IA 3V96A 1E2ZA 3G6EA 3T1HL 2K03A 1WCMG 1YJNA 3A5ZB 1E24A 2YV5A 1YITA 1PMRA 3CQZH 1CI3M 2H4OA 1NR4A 3ERSX 3OWFA 1SFOB 1I4PA 2Y0SG 3H91A 1YNNC 4JI1Q 1N36L 4XTCS 3I72A 1PDQA 4R9WA 2PO4A 3P20A 5M3MB 1CT1D 5C0XG 1H9KA 2BDOA 5ELNA 5I6YA 4HJAA 2RSNA 1N32Q 3MFGA 1SE3A 4DR4Q 3PO2B 4P73A 1DCZA 3HOXB 2Q2HA 5HURA 1WD0A 2JYOA 2OQ0A 3RR5A 4WJ3M 4H7BA 2F1MA 1Z9FA 1RODA 2B2WC 1AH9A 5E3FA 1J9OA 3U9OA 3HOUG 1A63A 2JA7H 1BCPC 2JA6H 5IGEA 2L0CA 4JW0A 5BN5A 4UP8A 2DN8A 4AQYL 4V190 2UUCL 1PH7A 4RAUC 4R8IA 2ATWA 3EVQA 3BS1A 3DUZA 3S1MB 2F0IA 4ZLTF 2E5LQ 3MXNB 2H1EA 4ODGA 3Q22A 2R3ZA 4LAAA 1O7YA 1G2SA 2UUAQ 3TBIB 1I94L 1F77A 5FOBB 4FXGC 4DKAC 4DN4M 1XPRA 1HNZQ 1B2TA 1TIID 4JI6L 1UE5A 3QIAA 4XT3B 1JQYD 1BBXC 2F0GA 5TSSA 5IE8A 2K52A 1Y14B 2I07B 4CJ0B 4BBSH 3UI2A 1YNJD 4ABNA 2B2UC 1ONLA 4U673 2F0KA 2X6LA 3T53B 1OXUA 3SK6A 3K7AH 1SLJA 3CP0A 1PFSA 3A55A 3KK7A 3NPPA 2HDLA 3KJPA 3IFDA 2EPBA 3HS0C 3JAMi 2RVLA 4DUYQ 4DV2Q 5IOCA 1TS5A 3TP6A 2WP8J 2VZAA 1SYDA 1NCVA 2CW0D 2VW9A 3LWEA 4R4QA 1MBYA 4TRDA 4XDXA 1XPUA 2CQAA 5HY6A 3DLLA 1U4MA 1BNZA 5ELFA 5CORA 2JP1A 4Q0FA 3A5UA 2K75A 1EIYB 1EIFA 5DAUA 3H6MA 4K2LA 1EOVA 3S14H 2RDHA 4HEDA 3AU7A 3RZDH 5E1FA 1FNWA 1XYIA 3MVVA 3S2DH 4KN7C 1H9SB 1F2MA 1FGBD 2D5DA 4B9XA 1OTCA 1NBWA 2JA5H 1D2BA 3M4OH 1TWCH 4K8JA 1VQJA 2Q8IB 1BOSA 5LMUL 4B3MQ 1VQ7A 5JVH3 4GNXC 1EUJA 2F0LA 2XSCA 1I4RA 5BN3A 2I5LX 3U50C 4RFBA 1CSPA 4XQJA 5ISRA 5FLMG 5KYLA 2R6GA 1IW7D 1Q82C 4CJ1B 5C4JH 5EBDA 4TVAB
chains in the Genus database with same CATH topology
3M9BA 1Y1WH 1Q1BA 1FL0A 1YIJA 3RN2A 1EQQA 4DR5Q 1G51A 3CAMA 4JI1L 4YY3Q 1Q46A 1PH5A 3GDEA 1X9NA 4DR1Q 4BA2I 4QY7A 5GQOA 5M5XH 4B3ML 3GTMH 4UP7A 3FKIH 4BY7G 3OW2A 1QVGA 3PCOB 1N32L 4GKKL 3K8AA 3CMEA 1X56A 3Q8DA 4IJHA 4DPGA 3D0FA 1GO3E 1RL2A 2WFWA 1YHQA 1M1KC 1FJGQ 3NEMA 3UDGA 5GROA 4BBRG 2KENA 4JI5L 5EAYA 4DV1Q 3CCLA 4C3IH 4B3RL 3H15A 3G48A 1Z47A 3NBHB 1VS0A 1B8AA 4NXMQ 4GN5A 3H0GG 1R9TH 3CF5A 4JI8Q 5IYCH 1GKHA 3PF5A 4A3DG 4IOCA 1KXLA 4MTNA 4Y7NH 4A3GH 2JK8A 1WOCA 5GADC 1XMQQ 1TWHH 2NN6I 1UE7A 4JI7L 2RCNA 1XMOQ 4DR5L 1PYSB 1X54A 4HIKA 3BJUA 2Z0SA 2RHSB 4YY3L 5IP7G 3RNUA 3CC2A 3EN2A 1IXRA 3F2DA 2WAQE 4APVA 1QUQA 4RMFA 4DR1L 1CSQA 4P75A 3HOVH 5C44G 1C0AA 3CCSA 1PA6A 4DR2Q 4DK6C 1PH4A 4IPHA 5IP9H 2L15A 4OXPA 1WCMH 4GS3A 4A3EG 1YJWA 2E5LL 2ES2A 1PH3A 1H95A 1VQ4A 4A3FG 1YI2A 3H3VI 4JCVE 1EFWA 4DV1L 4OX9L 2F4VL 1J6QA 3F8TA 3SGIA 3PUXA 1EWIA 4IPDA 4X65Q 4X64Q 1G291 1XJVA 1J5EQ 4LF7Q 1CKNB 4IPGA 5H1SE 2JA7G 3GTPH 2VNUD 1VQFA 3J81i 5HGQA 1Y1WG 3GTOH 4UP9A 1IZ6A 2R93H 3S1NH 1CKOA 3KF6B 3LGJA 1HZAA 1EQRA 1X65A 3I4OA 3J80c 4X6AH 1XMOL 1B7YB 1B70B 3CCQA 3PUVA 2RHQB 3F1ZA 5GAGC 4HIDA 4DR6Q 4LFAQ 4IFDJ 2IY5B 4A3CH 1IL2A 1I50H 1W3SA 3S24A 1P8LA 5E7NA 2B63H 3EIVA 4FDBA 4QIWE 4DV4Q 3I2ZA 1YHAA 1YVCA 3CCVA 1YNXA 2I5HA 5LMNW 1KD1C 4P72A 2E2HH 3S15H 2KBNA 3KF6A 4RG1A 2E2JH 1V43A 1KRSA 3GTJH 3RN5A 1IBKQ 3PUZA 1I3QH 4JG2A 1HZBA 3TQYA 5C0XJ 3ULPA 4JI0Q 1A62A 3W5OA 3B6YA 4OWWB 2JJQA 5IY0A 2K5NA 4X65L 3UDXA 3U58A 1XPOA 5IYCG 4X64L 1K8AC 3HOUH 5IT9c 4LNQA 2MQHA 3TREA 5JEAG 2HQLA 1M90C 1IBLL 4KHZA 4A3GG 1N36Q 2YU9H 4GLAC 4B3SQ 1VQDA 2HIVA 2CKZB 3TS2A 1VQNA 3M4QA 4ME3A 4DNIA 3JC66 4DV2L 4LF8Q 2N8NA 4HJ8A 2JA8G 3F2BA 4HJ5A 1HJPA 3S1RH 3HOVG 3S1QH 4DR6L 4LFAL 4DV0Q 3E0EA 3PUYA 1UE1A 1VQ9A 4GLXA 4R4TA 5IP9G 2EIFA 3K81C 2IHEA 3CPFA 5M3FH 4DV4L 2MO1A 2NVTH 1HR0Q 1Q1EA 3HKZG 2YTVA 4PZ8A 4R1JA 2ZM6Q 2WB1G 1KC8C 1WI5A 3KF8B 1HZ9A 4JBWA 1K83H 3UDFA 3GTLH 3FHWA 3PGZA 4X62L 1HNWQ 4LF9Q 1TWAH 2N78A 1MIUA 3U4ZA 4JI0L 1HNXQ 4DV6Q 4UPAA 3UE1A 4GOPA 1MJEA 2VL6A 2H5XA 4POGA 4DV3Q 4YWMA 2UXDL 1E3PA 5IYBH 2R93G 2UUBQ 3E9HA 5FLXc 4B3SL 4LF4L 4P74A 5M3MH 3CC7A 4JBKA 4LF8L 1T9HA 1E22A 3HOZG 2ID0A 4IO9A 4A3CG 1OXXK 1PV4A 4JI4Q 2VY3A 2GN5A 3GO5A 5AJ3L 4DV0L 4IPCA 4JI3Q 3PO2H 4UY8C 3HOXH 1Q12A 2I5MX 4EQ5A 1K73C 2CQOA 4YHHQ 1Q86C 1PH2A 4OO1I 1HR0L 4QQBX 2ZM6L 3J7ZC 3PIOA 1YHBA 3RLOA 3L2PA 3T1YQ 2UXCL 3GTKH 5C4XG 4JYAQ 3J81j 1SROA 2E8GA 1VQLA 1WJJA 3J7A5 2GVBA 3UE0A 4DK3C 3D31A 2HIXA 1ASYA 3STBD 2IT1A 1HNXL 2D0PA 4OONA 4DV6L 4JOIC 1JE5A 2D62A 3KDFA 3HKZE 4BY1H 2UXBL 2WB1E 4BA1I 2Q2TA 2RF4A 4DV3L 1QUQB 2LXKA 1A0IA 2C35B 1VQAA 4KLKA 5IWAL 3UDIA 4B3TL 4NXNQ 1VQEA 1Q8KA 3PIPA 4WJ4A 3A74A 2JA5G 4JC0A 1X6OA 4A3JH 3S1MH 4X66Q 4JI4L 1N8RC 4L5TA 4A3LG 2AWNA 5M3FG 4JI3L 2VQFQ 4Y52H 1VQHA 1GD7A 1GM5A 4A3BG 4KHPQ 5DLQE 1VQCA 3I7FA 4DAYB 4YHHL 1N34Q 3PO3G 1Q7YC 3M3YH 4JBMA 3CCEA 4QL5A 3T1YL 4GKJQ 4GN4B 1KIXA 4JYAL 4GNXA 3K0XA 4BXXH 1LM0A 1FJGL 1TWFH 1I5FA 1XNRQ 1AE3A 2D0OA 1V9PA 2K5VA 1YZ6A 2KHIA 2F3IA 5IYBG 1KRTA 2BA0A 4DUZQ 1D8LA 1Y1VH 2EXDA 4LUOA 1PH1A 3NENA 3CXCA 5M5WH 3TEHB 3KJOA 1KHIA 1PHJA 5M3MG 2PI2A 4DV7Q 4QJFA 1NJIC 1JMCA 2AKWB 4GLVB 4NXML 4A4IA 4JI8L 4JV5Q 1DGSA 5FJ8H 4NXNL 5J3BA 2ZTEA 3CCMA 1TWGH 3I4NH 3BZKA 2XTIA 1VCIA 2KCMA 3OYYA 1XMQL 2QEXA 5JEAJ 1E1TA 4DR7Q 1CKMA 4YWLA 2YYZA 4X66L 1FGUA 3HOXG 4A93H 5M5YH 1ASZA 2QGQA 2R7DA 2VQFL 1VQBA 2E2IH 3FKIG 4YWKA 4YCWA 3G4SA 2JE6I 3CW2C 3I56A 2ZJPA 1X3EA 1N33Q 3T1HQ 2VUMH 1N34L 3I4MH 4NPSA 3CMAA 4DR2L 3AFQA 2R92H 2ASBA 4GKJL 1E7ZA 2MNAA 3OTOQ 4O0AA 2ZJRA 4OO1G 2MO0A 1XNRL 4BY1G 2R7ZH 1VQOA 1I6HH 4ALPA 2JA9A 2Z6KC 1L1OC 1QVCA 2N49A 1WYDA 1XTDA 1TXYA 3TS0A 3PF4A 1IBMQ 2I0QA 3AQQA 4JI2Q 2OTLA 4YCUA 1J5EL 4DV7L 4LF7L 3CC4A 4JV5L 1S72A 1VQ5A 2JEBI 2EQSA 2PQAA 1MJCA 2FXQA 4LUZA 2CWAA 2Q2UA 2K4KA 4DR7L 4A76A 3S2HH 2VS1A 2AWOA 2PNHA 2HHHQ 1KAWA 4BY7H 4GOPB 4A75A 3RLNA 3AFPA 3G6EA 3T1HL 4BXXG 4DR3Q 1WCMG 5JJIA 3CCUA 1YJNA 3A5ZB 1E24A 1SRUA 1BBWA 2YV5A 3OTOL 1YITA 2YTYA 4R4IA 3CPWA 3CQZH 1VQ8A 1IBKL 2CWPA 3GTGH 4K0KQ 1P16A 2AHOB 2ZTDA 4DV5Q 3CCJA 5K36G 3ERSX 4JI2L 4LFCQ 1SFOH 5FJ8G 4C2MH 2Y0SG 4LFBQ 1V1QA 1U0LA 3I4NG 4JI1Q 4AQYQ 1N36L 4XTCS 2CCZA 4H02A 3PUWA 1RIPA 2UUCQ 3M85A 4A93G 3J81c 2A19A 5C0XG 5ELNA 4PZ6A 4HJAA 1NTGA 1N32Q 2B63G 2VUMG 3I4MG 4GKKQ 2HHHL 1UWVA 2K14A 3JAMc 1XNQQ 1X3GA 1GVPA 4DR4Q 2R92G 3KDFB 4P73A 2V1CC 2Q2HA 2K50A 2QA4A 2LXJA 4HJ7A 2OQ0A 3RR5A 3GTQH 2R7ZG 4WJ3M 3M7NA 1IYJB 1JJGA 1VQMA 2IX1A 1Z9FA 2PI2E 4PG3A 3W1GA 1HNWL 1I94Q 4LF9L 2OWOA 1AH9A 3G71A 3HOUG 3E9IA 1A63A 4OWXB 3J80i 3ULLA 4DV5L 2JA6H 2JA7H 2OQKA 3M4PA 5C3EH 1K8GA 3FP9A 4LFCL 1W2BA 4UP8A 1HR0W 1PH9A 4JI7Q 3DM3A 4LFBL 4JI6Q 4P71A 4AQYL 4A3MH 2UUBL 2PMZE 1VQKA 2A8VA 2UUCL 4DAMA 3W1BA 2ZTCA 3AEVA 1SN8A 1PH7A 2NZOA 4GNXB 2ATWA 4PMWA 1MKHA 2JQOA 2ZJQA 2K5HA 2Y0SE 2VQEQ 1PYBA 1QZHA 1XNQL 3WWVA 1X3FA 2E5LQ 4DR4L 3EBEA 2LSSA 3MXNB 4A3IH 4NB3A 3STBC 1OXTA 4KI0A 2NZHA 2F4VQ 4OX9Q 1LTLA 3BU2A 3RLFA 4L5SA 5GAHC 1JJCB 4QGUA 1PH6A 2UUAQ 4IFDI 3NELA 1I94L 4O2DA 1O7IA 1JB7A 2DGYA 1NY4A 4LF5Q 2A1AA 2R7FA 4DKAC 5IYDH 1K0RA 3ZJYC 1XPRA 1UE6A 1HNZQ 2F52A 5LMNQ 1K3RA 3K7UC 1KQSA 1PVOA 2KHJA 4JI6L 1UE5A 2N3SA 2NVXH 3HKSA 5JJLA 1WFQA 4EX5A 3PV0A 5C0XI 1CUKA 2GVAA 1YJ9A 5IE8A 1SR3A 2K52A 1Y14B 2IHFA 2NVYH 3HOYH 3PO2G 4BBSH 3F2CA 3BZCA 3ER0A 4TQUS 4AYBG 2VQEL 3HOWH 1LYLA 1NMGA 1SMXA 2BH8A 3IRBA 3A0JA 2MFIA 2AMCB 2JA8H 4J15A 3S16H 4KHPL 2OTJA 3U4VA 1E1OA 1LUZA 1N9WA 4XIGS 1QVFA 4GOPC 2NVQH 1VQ6A 1OXUA 4L5RC 1FVIA 2BA1A 2BH2A 3MEFA 5GAEC 4IJLA 3K7AH 4GN3B 3L0OA 4AH6A 2UUAL 5ELOA 2PQAB 1KL9A 4MNOA 1SLJA 1IBLQ 3CP0A 1PFSA 5C3EG 1S40A 2JA6G 2ALYB 1U5KA 4HJ9A 1JT8A 5FLMH 1BVSA 2Q2IA 3KJPA 4LW1A 1JJ2A 4LF5L 3H3VH 3ICEA 2JEAI 4A3MG 4JOIA 4DUZL 3JAMi 1HNZL 1PH8A 4DV2Q 5LMNL 1UEBA 4DUYQ 4A3KH 2DUDA 5BR8Q 2B29A 3VDYA 1OXVA 2WP8J 1K9MC 2VZAA 3HOZH 4A3JG 3K80C 3RZOH 1CKNA 4LWCA 1L0WA 3CCRA 1A8VA 2VW9A 1AE2A 1VQGA 4R4OA 4R4QA 5LMUQ 1XPUA 4A3IG 3CD6A 1EYGA 5HY6A 4HIMA 3DLLA 1BKBA 4X62Q 2UU9Q 3TRZA 3PSIA 3KYHC 5C4XH 1N33L 4LF6Q 2OCEA 4OWTB 4AYBE 3A5UA 4IOAA 4BBRH 2K75A 1EIYB 1EIFA 5IYDG 1YBYA 2XGTA 4C3JH 1EOVA 3S14H 1HH2P 3KOJA 3RZDH 2UXDQ 1Y1VG 1C9OA 3GD7A 4LF4Q 4IFDG 3S2DH 3H0GH 1VQPA 1IBML 4DUYL 1NMFA 4A3DH 1SE8A 1OTCA 1NBWA 5BR8L 2JA5H 4PZ7A 3AYHB 5AJ3Q 3HOYG 3M4OH 1TWCH 4BBSG 2NN6G 4AIMA 3HFZB 1VQJA 1G6PA 3HOWG 2HT1A 5IP7H 4A3LH 2CFMA 5LMUL 4B3MQ 3KLWA 2B3GA 1C7YA 4A3BH 3L7ZC 1S3OA 1OXSC 1VQ7A 3ULJA 4GNXC 1EUJA 2UXCQ 4MZ9A 5C44H 3PO3H 4LUVA 1L1OB 2UU9L 4POFA 2YTXA 2I5LX 1BBUA 1HZCA 3U50C 4LF6L 1CSPA 4DR3L 2KCTA 4R4CA 4A3EH 1VQIA 4JI5Q 5JJKA 2IX0A 2UXBQ 5FLMG 4C3HH 4A3FH 1NE3A 1D7QA 3KFUA 4B3RQ 1QZGA 3S17H 4JBJA 2R6GA 3I55A 1L2FA 5IWAQ 2WAQG 4HIOA 4A3KG 4B3TQ 4K0KL 1Q82C 2Z6KA 4YCVA 1L1OA 1YEZA 4TVAB 5C4JH 1Q81C 1X55A 4L5QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M9B A;  1Y1W H;  1Q1B A;  1FL0 A;  1YIJ A;  3RN2 A;  1EQQ A;  4DR5 Q;  1G51 A;  3CAM A;  4JI1 L;  4YY3 Q;  1Q46 A;  1PH5 A;  3GDE A;  1X9N A;  4DR1 Q;  4BA2 I;  4QY7 A;  5GQO A;  5M5X H;  4B3M L;  3GTM H;  4UP7 A;  3FKI H;  4BY7 G;  3OW2 A;  1QVG A;  3PCO B;  1N32 L;  4GKK L;  3K8A A;  3CME A;  1X56 A;  3Q8D A;  4IJH A;  4DPG A;  3D0F A;  1GO3 E;  1RL2 A;  2WFW A;  1YHQ A;  1M1K C;  1FJG Q;  3NEM A;  3UDG A;  5GRO A;  4BBR G;  2KEN A;  4JI5 L;  5EAY A;  4DV1 Q;  3CCL A;  4C3I H;  4B3R L;  3H15 A;  3G48 A;  1Z47 A;  3NBH B;  1VS0 A;  1B8A A;  4NXM Q;  4GN5 A;  3H0G G;  1R9T H;  3CF5 A;  4JI8 Q;  5IYC H;  1GKH A;  3PF5 A;  4A3D G;  4IOC A;  1KXL A;  4MTN A;  4Y7N H;  4A3G H;  2JK8 A;  1WOC A;  5GAD C;  1XMQ Q;  1TWH H;  2NN6 I;  1UE7 A;  4JI7 L;  2RCN A;  1XMO Q;  4DR5 L;  1PYS B;  1X54 A;  4HIK A;  3BJU A;  2Z0S A;  2RHS B;  4YY3 L;  5IP7 G;  3RNU A;  3CC2 A;  3EN2 A;  1IXR A;  3F2D A;  2WAQ E;  4APV A;  1QUQ A;  4RMF A;  4DR1 L;  1CSQ A;  4P75 A;  3HOV H;  5C44 G;  1C0A A;  3CCS A;  1PA6 A;  4DR2 Q;  4DK6 C;  1PH4 A;  4IPH A;  5IP9 H;  2L15 A;  4OXP A;  1WCM H;  4GS3 A;  4A3E G;  1YJW A;  2E5L L;  2ES2 A;  1PH3 A;  1H95 A;  1VQ4 A;  4A3F G;  1YI2 A;  3H3V I;  4JCV E;  1EFW A;  4DV1 L;  4OX9 L;  2F4V L;  1J6Q A;  3F8T A;  3SGI A;  3PUX A;  1EWI A;  4IPD A;  4X65 Q;  4X64 Q;  1G29 1;  1XJV A;  1J5E Q;  4LF7 Q;  1CKN B;  4IPG A;  5H1S E;  2JA7 G;  3GTP H;  2VNU D;  1VQF A;  3J81 i;  5HGQ A;  1Y1W G;  3GTO H;  4UP9 A;  1IZ6 A;  2R93 H;  3S1N H;  1CKO A;  3KF6 B;  3LGJ A;  1HZA A;  1EQR A;  1X65 A;  3I4O A;  3J80 c;  4X6A H;  1XMO L;  1B7Y B;  1B70 B;  3CCQ A;  3PUV A;  2RHQ B;  3F1Z A;  5GAG C;  4HID A;  4DR6 Q;  4LFA Q;  4IFD J;  2IY5 B;  4A3C H;  1IL2 A;  1I50 H;  1W3S A;  3S24 A;  1P8L A;  5E7N A;  2B63 H;  3EIV A;  4FDB A;  4QIW E;  4DV4 Q;  3I2Z A;  1YHA A;  1YVC A;  3CCV A;  1YNX A;  2I5H A;  5LMN W;  1KD1 C;  4P72 A;  2E2H H;  3S15 H;  2KBN A;  3KF6 A;  4RG1 A;  2E2J H;  1V43 A;  1KRS A;  3GTJ H;  3RN5 A;  1IBK Q;  3PUZ A;  1I3Q H;  4JG2 A;  1HZB A;  3TQY A;  5C0X J;  3ULP A;  4JI0 Q;  1A62 A;  3W5O A;  3B6Y A;  4OWW B;  2JJQ A;  5IY0 A;  2K5N A;  4X65 L;  3UDX A;  3U58 A;  1XPO A;  5IYC G;  4X64 L;  1K8A C;  3HOU H;  5IT9 c;  4LNQ A;  2MQH A;  3TRE A;  5JEA G;  2HQL A;  1M90 C;  1IBL L;  4KHZ A;  4A3G G;  1N36 Q;  2YU9 H;  4GLA C;  4B3S Q;  1VQD A;  2HIV A;  2CKZ B;  3TS2 A;  1VQN A;  3M4Q A;  4ME3 A;  4DNI A;  3JC6 6;  4DV2 L;  4LF8 Q;  2N8N A;  4HJ8 A;  2JA8 G;  3F2B A;  4HJ5 A;  1HJP A;  3S1R H;  3HOV G;  3S1Q H;  4DR6 L;  4LFA L;  4DV0 Q;  3E0E A;  3PUY A;  1UE1 A;  1VQ9 A;  4GLX A;  4R4T A;  5IP9 G;  2EIF A;  3K81 C;  2IHE A;  3CPF A;  5M3F H;  4DV4 L;  2MO1 A;  2NVT H;  1HR0 Q;  1Q1E A;  3HKZ G;  2YTV A;  4PZ8 A;  4R1J A;  2ZM6 Q;  2WB1 G;  1KC8 C;  1WI5 A;  3KF8 B;  1HZ9 A;  4JBW A;  1K83 H;  3UDF A;  3GTL H;  3FHW A;  3PGZ A;  4X62 L;  1HNW Q;  4LF9 Q;  1TWA H;  2N78 A;  1MIU A;  3U4Z A;  4JI0 L;  1HNX Q;  4DV6 Q;  4UPA A;  3UE1 A;  4GOP A;  1MJE A;  2VL6 A;  2H5X A;  4POG A;  4DV3 Q;  4YWM A;  2UXD L;  1E3P A;  5IYB H;  2R93 G;  2UUB Q;  3E9H A;  5FLX c;  4B3S L;  4LF4 L;  4P74 A;  5M3M H;  3CC7 A;  4JBK A;  4LF8 L;  1T9H A;  1E22 A;  3HOZ G;  2ID0 A;  4IO9 A;  4A3C G;  1OXX K;  1PV4 A;  4JI4 Q;  2VY3 A;  2GN5 A;  3GO5 A;  5AJ3 L;  4DV0 L;  4IPC A;  4JI3 Q;  3PO2 H;  4UY8 C;  3HOX H;  1Q12 A;  2I5M X;  4EQ5 A;  1K73 C;  2CQO A;  4YHH Q;  1Q86 C;  1PH2 A;  4OO1 I;  1HR0 L;  4QQB X;  2ZM6 L;  3J7Z C;  3PIO A;  1YHB A;  3RLO A;  3L2P A;  3T1Y Q;  2UXC L;  3GTK H;  5C4X G;  4JYA Q;  3J81 j;  1SRO A;  2E8G A;  1VQL A;  1WJJ A;  3J7A 5;  2GVB A;  3UE0 A;  4DK3 C;  3D31 A;  2HIX A;  1ASY A;  3STB D;  2IT1 A;  1HNX L;  2D0P A;  4OON A;  4DV6 L;  4JOI C;  1JE5 A;  2D62 A;  3KDF A;  3HKZ E;  4BY1 H;  2UXB L;  2WB1 E;  4BA1 I;  2Q2T A;  2RF4 A;  4DV3 L;  1QUQ B;  2LXK A;  1A0I A;  2C35 B;  1VQA A;  4KLK A;  5IWA L;  3UDI A;  4B3T L;  4NXN Q;  1VQE A;  1Q8K A;  3PIP A;  4WJ4 A;  3A74 A;  2JA5 G;  4JC0 A;  1X6O A;  4A3J H;  3S1M H;  4X66 Q;  4JI4 L;  1N8R C;  4L5T A;  4A3L G;  2AWN A;  5M3F G;  4JI3 L;  2VQF Q;  4Y52 H;  1VQH A;  1GD7 A;  1GM5 A;  4A3B G;  4KHP Q;  5DLQ E;  1VQC A;  3I7F A;  4DAY B;  4YHH L;  1N34 Q;  3PO3 G;  1Q7Y C;  3M3Y H;  4JBM A;  3CCE A;  4QL5 A;  3T1Y L;  4GKJ Q;  4GN4 B;  1KIX A;  4JYA L;  4GNX A;  3K0X A;  4BXX H;  1LM0 A;  1FJG L;  1TWF H;  1I5F A;  1XNR Q;  1AE3 A;  2D0O A;  1V9P A;  2K5V A;  1YZ6 A;  2KHI A;  2F3I A;  5IYB G;  1KRT A;  2BA0 A;  4DUZ Q;  1D8L A;  1Y1V H;  2EXD A;  4LUO A;  1PH1 A;  3NEN A;  3CXC A;  5M5W H;  3TEH B;  3KJO A;  1KHI A;  1PHJ A;  5M3M G;  2PI2 A;  4DV7 Q;  4QJF A;  1NJI C;  1JMC A;  2AKW B;  4GLV B;  4NXM L;  4A4I A;  4JI8 L;  4JV5 Q;  1DGS A;  5FJ8 H;  4NXN L;  5J3B A;  2ZTE A;  3CCM A;  1TWG H;  3I4N H;  3BZK A;  2XTI A;  1VCI A;  2KCM A;  3OYY A;  1XMQ L;  2QEX A;  5JEA J;  1E1T A;  4DR7 Q;  1CKM A;  4YWL A;  2YYZ A;  4X66 L;  1FGU A;  3HOX G;  4A93 H;  5M5Y H;  1ASZ A;  2QGQ A;  2R7D A;  2VQF L;  1VQB A;  2E2I H;  3FKI G;  4YWK A;  4YCW A;  3G4S A;  2JE6 I;  3CW2 C;  3I56 A;  2ZJP A;  1X3E A;  1N33 Q;  3T1H Q;  2VUM H;  1N34 L;  3I4M H;  4NPS A;  3CMA A;  4DR2 L;  3AFQ A;  2R92 H;  2ASB A;  4GKJ L;  1E7Z A;  2MNA A;  3OTO Q;  4O0A A;  2ZJR A;  4OO1 G;  2MO0 A;  1XNR L;  4BY1 G;  2R7Z H;  1VQO A;  1I6H H;  4ALP A;  2JA9 A;  2Z6K C;  1L1O C;  1QVC A;  2N49 A;  1WYD A;  1XTD A;  1TXY A;  3TS0 A;  3PF4 A;  1IBM Q;  2I0Q A;  3AQQ A;  4JI2 Q;  2OTL A;  4YCU A;  1J5E L;  4DV7 L;  4LF7 L;  3CC4 A;  4JV5 L;  1S72 A;  1VQ5 A;  2JEB I;  2EQS A;  2PQA A;  1MJC A;  2FXQ A;  4LUZ A;  2CWA A;  2Q2U A;  2K4K A;  4DR7 L;  4A76 A;  3S2H H;  2VS1 A;  2AWO A;  2PNH A;  2HHH Q;  1KAW A;  4BY7 H;  4GOP B;  4A75 A;  3RLN A;  3AFP A;  3G6E A;  3T1H L;  4BXX G;  4DR3 Q;  1WCM G;  5JJI A;  3CCU A;  1YJN A;  3A5Z B;  1E24 A;  1SRU A;  1BBW A;  2YV5 A;  3OTO L;  1YIT A;  2YTY A;  4R4I A;  3CPW A;  3CQZ H;  1VQ8 A;  1IBK L;  2CWP A;  3GTG H;  4K0K Q;  1P16 A;  2AHO B;  2ZTD A;  4DV5 Q;  3CCJ A;  5K36 G;  3ERS X;  4JI2 L;  4LFC Q;  1SFO H;  5FJ8 G;  4C2M H;  2Y0S G;  4LFB Q;  1V1Q A;  1U0L A;  3I4N G;  4JI1 Q;  4AQY Q;  1N36 L;  4XTC S;  2CCZ A;  4H02 A;  3PUW A;  1RIP A;  2UUC Q;  3M85 A;  4A93 G;  3J81 c;  2A19 A;  5C0X G;  5ELN A;  4PZ6 A;  4HJA A;  1NTG A;  1N32 Q;  2B63 G;  2VUM G;  3I4M G;  4GKK Q;  2HHH L;  1UWV A;  2K14 A;  3JAM c;  1XNQ Q;  1X3G A;  1GVP A;  4DR4 Q;  2R92 G;  3KDF B;  4P73 A;  2V1C C;  2Q2H A;  2K50 A;  2QA4 A;  2LXJ A;  4HJ7 A;  2OQ0 A;  3RR5 A;  3GTQ H;  2R7Z G;  4WJ3 M;  3M7N A;  1IYJ B;  1JJG A;  1VQM A;  2IX1 A;  1Z9F A;  2PI2 E;  4PG3 A;  3W1G A;  1HNW L;  1I94 Q;  4LF9 L;  2OWO A;  1AH9 A;  3G71 A;  3HOU G;  3E9I A;  1A63 A;  4OWX B;  3J80 i;  3ULL A;  4DV5 L;  2JA6 H;  2JA7 H;  2OQK A;  3M4P A;  5C3E H;  1K8G A;  3FP9 A;  4LFC L;  1W2B A;  4UP8 A;  1HR0 W;  1PH9 A;  4JI7 Q;  3DM3 A;  4LFB L;  4JI6 Q;  4P71 A;  4AQY L;  4A3M H;  2UUB L;  2PMZ E;  1VQK A;  2A8V A;  2UUC L;  4DAM A;  3W1B A;  2ZTC A;  3AEV A;  1SN8 A;  1PH7 A;  2NZO A;  4GNX B;  2ATW A;  4PMW A;  1MKH A;  2JQO A;  2ZJQ A;  2K5H A;  2Y0S E;  2VQE Q;  1PYB A;  1QZH A;  1XNQ L;  3WWV A;  1X3F A;  2E5L Q;  4DR4 L;  3EBE A;  2LSS A;  3MXN B;  4A3I H;  4NB3 A;  3STB C;  1OXT A;  4KI0 A;  2NZH A;  2F4V Q;  4OX9 Q;  1LTL A;  3BU2 A;  3RLF A;  4L5S A;  5GAH C;  1JJC B;  4QGU A;  1PH6 A;  2UUA Q;  4IFD I;  3NEL A;  1I94 L;  4O2D A;  1O7I A;  1JB7 A;  2DGY A;  1NY4 A;  4LF5 Q;  2A1A A;  2R7F A;  4DKA C;  5IYD H;  1K0R A;  3ZJY C;  1XPR A;  1UE6 A;  1HNZ Q;  2F52 A;  5LMN Q;  1K3R A;  3K7U C;  1KQS A;  1PVO A;  2KHJ A;  4JI6 L;  1UE5 A;  2N3S A;  2NVX H;  3HKS A;  5JJL A;  1WFQ A;  4EX5 A;  3PV0 A;  5C0X I;  1CUK A;  2GVA A;  1YJ9 A;  5IE8 A;  1SR3 A;  2K52 A;  1Y14 B;  2IHF A;  2NVY H;  3HOY H;  3PO2 G;  4BBS H;  3F2C A;  3BZC A;  3ER0 A;  4TQU S;  4AYB G;  2VQE L;  3HOW H;  1LYL A;  1NMG A;  1SMX A;  2BH8 A;  3IRB A;  3A0J A;  2MFI A;  2AMC B;  2JA8 H;  4J15 A;  3S16 H;  4KHP L;  2OTJ A;  3U4V A;  1E1O A;  1LUZ A;  1N9W A;  4XIG S;  1QVF A;  4GOP C;  2NVQ H;  1VQ6 A;  1OXU A;  4L5R C;  1FVI A;  2BA1 A;  2BH2 A;  3MEF A;  5GAE C;  4IJL A;  3K7A H;  4GN3 B;  3L0O A;  4AH6 A;  2UUA L;  5ELO A;  2PQA B;  1KL9 A;  4MNO A;  1SLJ A;  1IBL Q;  3CP0 A;  1PFS A;  5C3E G;  1S40 A;  2JA6 G;  2ALY B;  1U5K A;  4HJ9 A;  1JT8 A;  5FLM H;  1BVS A;  2Q2I A;  3KJP A;  4LW1 A;  1JJ2 A;  4LF5 L;  3H3V H;  3ICE A;  2JEA I;  4A3M G;  4JOI A;  4DUZ L;  3JAM i;  1HNZ L;  1PH8 A;  4DV2 Q;  5LMN L;  1UEB A;  4DUY Q;  4A3K H;  2DUD A;  5BR8 Q;  2B29 A;  3VDY A;  1OXV A;  2WP8 J;  1K9M C;  2VZA A;  3HOZ H;  4A3J G;  3K80 C;  3RZO H;  1CKN A;  4LWC A;  1L0W A;  3CCR A;  1A8V A;  2VW9 A;  1AE2 A;  1VQG A;  4R4O A;  4R4Q A;  5LMU Q;  1XPU A;  4A3I G;  3CD6 A;  1EYG A;  5HY6 A;  4HIM A;  3DLL A;  1BKB A;  4X62 Q;  2UU9 Q;  3TRZ A;  3PSI A;  3KYH C;  5C4X H;  1N33 L;  4LF6 Q;  2OCE A;  4OWT B;  4AYB E;  3A5U A;  4IOA A;  4BBR H;  2K75 A;  1EIY B;  1EIF A;  5IYD G;  1YBY A;  2XGT A;  4C3J H;  1EOV A;  3S14 H;  1HH2 P;  3KOJ A;  3RZD H;  2UXD Q;  1Y1V G;  1C9O A;  3GD7 A;  4LF4 Q;  4IFD G;  3S2D H;  3H0G H;  1VQP A;  1IBM L;  4DUY L;  1NMF A;  4A3D H;  1SE8 A;  1OTC A;  1NBW A;  5BR8 L;  2JA5 H;  4PZ7 A;  3AYH B;  5AJ3 Q;  3HOY G;  3M4O H;  1TWC H;  4BBS G;  2NN6 G;  4AIM A;  3HFZ B;  1VQJ A;  1G6P A;  3HOW G;  2HT1 A;  5IP7 H;  4A3L H;  2CFM A;  5LMU L;  4B3M Q;  3KLW A;  2B3G A;  1C7Y A;  4A3B H;  3L7Z C;  1S3O A;  1OXS C;  1VQ7 A;  3ULJ A;  4GNX C;  1EUJ A;  2UXC Q;  4MZ9 A;  5C44 H;  3PO3 H;  4LUV A;  1L1O B;  2UU9 L;  4POF A;  2YTX A;  2I5L X;  1BBU A;  1HZC A;  3U50 C;  4LF6 L;  1CSP A;  4DR3 L;  2KCT A;  4R4C A;  4A3E H;  1VQI A;  4JI5 Q;  5JJK A;  2IX0 A;  2UXB Q;  5FLM G;  4C3H H;  4A3F H;  1NE3 A;  1D7Q A;  3KFU A;  4B3R Q;  1QZG A;  3S17 H;  4JBJ A;  2R6G A;  3I55 A;  1L2F A;  5IWA Q;  2WAQ G;  4HIO A;  4A3K G;  4B3T Q;  4K0K L;  1Q82 C;  2Z6K A;  4YCV A;  1L1O A;  1YEZ A;  4TVA B;  5C4J H;  1Q81 C;  1X55 A;  4L5Q A; 
#chains in the Genus database with same CATH topology
 3M9B A;  1Q1B A;  2F0S A;  1EQQ A;  4DR5 Q;  4N8X 1;  1S5F D;  4MHE A;  1X9N A;  2ZXR A;  4PMC A;  4X3K A;  1UUP A;  4BY7 G;  1QVG A;  4NKL A;  3K8A A;  1GO3 E;  2QW7 A;  1YHQ A;  1M1K C;  4BBR G;  1D5Z C;  5IT9 E;  4FF1 A;  4JI5 L;  4QUF A;  4DV1 Q;  4C3I H;  4B3R L;  3NBH B;  4NXM Q;  1VS0 A;  4KKT A;  3H0G G;  5IYC H;  1DON A;  1O80 A;  1BO0 A;  3I3C A;  4A3D G;  1ET9 A;  5GAD C;  2F0Q A;  1TWH H;  1TQO A;  4JI7 L;  1PYS B;  5C5L A;  1U4R A;  2RHS B;  5KGU A;  4YY3 L;  4IN3 A;  4PNY A;  1KLU D;  4DR1 L;  3K5L A;  2IJ0 A;  1PA6 A;  2NVY B;  4DAP A;  4RHR A;  4DK6 C;  1PH4 A;  2JSO A;  4FO2 A;  4A3E G;  1YJW A;  4CKC A;  1H95 A;  1JWS D;  4IUR A;  2JA8 B;  3MXP A;  4OX9 L;  2NVQ B;  3WOE A;  3F8T A;  1EWI A;  2HQE A;  1DOK A;  1X3P A;  2VNU D;  4LF7 Q;  2JA7 G;  5K36 H;  1VQF A;  2F0D A;  3GTO B;  1A6X A;  3S1N H;  1EZ6 A;  1CKO A;  4Z9C B;  3KF6 B;  1CFM A;  3I4O A;  3PUV A;  2RHQ B;  4DR6 Q;  1JE4 A;  1XX8 A;  3FRP B;  1IL2 A;  3SK4 A;  1O7L A;  4FDB A;  1PRT D;  1I4G A;  1YHA A;  1YVC A;  4L8J A;  1STB A;  3NXW A;  5CV8 A;  5LMN W;  2E2D C;  1C8C A;  2E2H H;  2KBN A;  3KF6 A;  2E2J H;  1DOL A;  1V43 A;  1KRS A;  1Z6H A;  1HZB A;  5C0X J;  4JI0 Q;  1A62 A;  3W5O A;  4OWW B;  2JJQ A;  2E74 C;  1XPO A;  1Y8N B;  4LNQ A;  1ESR A;  1EEF D;  4RGT A;  4B3S Q;  3MTS A;  2YU9 B;  1QG7 A;  2P5Z X;  5EQ0 A;  5D14 A;  3NE5 B;  4ME3 A;  2BE5 C;  4M8A A;  1I4Q A;  4LF8 Q;  1X32 A;  2N8N A;  3S1R H;  1FYC A;  2WII B;  1UE1 A;  3K58 A;  2IHE A;  2YTV A;  2WB1 G;  1KC8 C;  2FFK B;  2PW7 A;  1HZ9 A;  4JBW A;  2VB2 X;  3GTL B;  4X62 L;  1HNW Q;  4LF9 Q;  4RGO S;  5C5M A;  4GZY C;  1MIU A;  1HNX Q;  3UE1 A;  3EFX D;  4GOP A;  4A3E B;  4DV3 Q;  4ILW A;  2UXD L;  1TS2 A;  2L1B A;  3S17 B;  2UUB Q;  2KEE A;  4XQQ A;  3JAM L;  5M3M H;  3K5O A;  1AZP A;  4IO9 A;  2O4X A;  5F2D A;  4JI4 Q;  1PTO C;  3GO5 A;  5AJ3 L;  3WOF A;  4JI3 Q;  3PO2 H;  2O5I C;  4UY8 C;  3HOX H;  1Q12 A;  1JOK A;  2K01 A;  4NDX A;  4EQ5 A;  1II3 A;  1QB5 D;  1PH2 A;  3GTM B;  3RLO A;  2UXC L;  3BYT B;  5CC4 A;  2CH4 A;  2E8G A;  1OO9 B;  2NBF A;  2MGS A;  5CMD A;  1ASY A;  2D0P A;  2E75 C;  4EVO A;  1JE5 A;  2D62 A;  4ZQ3 A;  2UXB L;  1UEA B;  4NMZ A;  3UDI A;  1O7Z A;  1EU3 A;  3I4L A;  4B3T L;  3W2D A;  3PIP A;  2JA5 G;  4JC0 A;  3S1M H;  5CYU A;  4HAE A;  2LS0 1;  1EZ8 A;  4Y52 H;  2AQ3 B;  1VQH A;  1GD7 A;  1K28 A;  1GM5 A;  2F0H A;  5DLQ E;  4IUQ A;  3I7F A;  4BS9 A;  1Q7Y C;  2NWG A;  3G7L A;  1CTM A;  4KD4 A;  2MUY A;  2Z1C A;  1HTL D;  5EKI A;  5M9O A;  4FYD A;  3M3Y B;  3K0X A;  1LM0 A;  1RF2 D;  1FJG L;  1BCP B;  1AE3 A;  4DXG A;  1LT3 D;  2WB1 B;  2O2L D;  3FPU B;  3NEN A;  2SNS A;  3KJO A;  1EWH A;  1PHJ A;  4IUN A;  1JMC A;  3J81 E;  3GTP B;  4NXN L;  2SOB A;  1PXU A;  3OYY A;  3VA7 A;  1HUN A;  5JEA J;  4FXD A;  1CKM A;  1EEI D;  1SSO A;  5KIX A;  1VQB A;  5C0X H;  4ZYS A;  4YCW A;  3CW2 C;  1N33 Q;  1N34 L;  2B63 B;  4NPS A;  3CMA A;  3K5M A;  3AB9 A;  4O0A A;  3S15 B;  3OHX C;  2MO0 A;  1XNR L;  4ALP A;  1Q8I A;  2L11 A;  1IBM Q;  3AQQ A;  4JI2 Q;  3MWY W;  1J5E L;  1B9M A;  1PZJ D;  2MJ8 A;  3CC4 A;  3MHB A;  4JV5 L;  2RDF A;  1S72 A;  1VQ5 A;  2PQA A;  2FXQ A;  4LUZ A;  2CWA A;  3C1E A;  3K6O A;  1KDC A;  4DR7 L;  4K5W A;  4E6I A;  4A76 A;  1WD1 A;  1Q3L A;  2VS1 A;  4OL7 A;  4X3T A;  2AWO A;  5IT9 L;  2PNH A;  2HHH Q;  3S1Q B;  1ENF A;  4A75 A;  3RLN A;  4BXX G;  4DR3 Q;  3QO2 A;  3CCU A;  5IGG A;  2NVT B;  1SRU A;  5ELD A;  3LX0 A;  2RKS A;  1HTP A;  2YTY A;  4RWS C;  4R4I A;  1RTN A;  3CPW A;  1IBK L;  2CWP A;  1TWA B;  4DV5 Q;  2AHO B;  5K36 G;  3NQI A;  5A2Q E;  3D4D A;  4LFC Q;  5FJ8 G;  2WKD A;  4K5X A;  4C2M H;  1W6K A;  1LTI D;  2EYH A;  4XYQ A;  2TMP A;  3VYT A;  5D3I B;  4DF7 A;  2N55 A;  2EJM A;  4GKK Q;  1XNQ Q;  3JAM c;  2K14 A;  4RHS A;  5JPN C;  1GUS A;  1EU4 A;  2KCC A;  3KDF B;  4AYB B;  2V1C C;  4OGQ C;  4HJ7 A;  2X69 A;  1JJG A;  2PI2 E;  3W1G A;  1R4Q B;  5CV6 A;  2Q8R E;  3G71 A;  1Y69 U;  4G7O C;  2KQ3 A;  2AQ1 B;  3FP9 A;  1HR0 W;  1PH9 A;  3DM3 A;  4FP5 D;  4P71 A;  4A3M B;  1BCP F;  3W1B A;  2ZTC A;  1NSN S;  4M1U B;  2NZO A;  4GNX B;  4F88 A;  4A3J B;  2Y0S E;  1PYB A;  3WWV A;  4DR4 L;  3ND8 A;  1O78 A;  2SNM A;  1ILQ A;  1EWC A;  2LSS A;  2LFN A;  1WVL A;  2EYM A;  4A3I B;  2F4V Q;  2EJF C;  5KYI A;  2RCF A;  1QCB D;  3NEL A;  1EY6 A;  2XWJ B;  1NY4 A;  5JEA H;  1PZI D;  1CM9 A;  1UE6 A;  1Y8O B;  4ZRZ A;  2HCI A;  2PMZ B;  3K7U C;  5LMN Q;  1KQS A;  1S4Z A;  1K0S A;  5JJL A;  5C0X I;  3PV0 A;  1T5E A;  1CUK A;  3E0J A;  3OIQ A;  1PFN A;  4IUT A;  1GHJ A;  1SR3 A;  2NVY H;  4LMQ D;  3PO2 G;  3HOY B;  3BZC A;  3CHB D;  1SMX A;  3IRB A;  3A0J A;  3J7Y W;  3D6W A;  2JA8 H;  4KHP L;  4J15 A;  2E2I B;  3U4V A;  3A7A B;  3S16 B;  2LY7 A;  4XIG S;  3DXJ C;  4GOP C;  2NVQ H;  1VQ6 A;  2VXW A;  2BH2 A;  2BA1 A;  3MEF A;  4GN3 B;  4FF3 A;  3KLS A;  4JPB W;  4AH6 A;  2UUA L;  5ELO A;  4F87 A;  3J80 L;  1IBL Q;  5C3E G;  1JT8 A;  2ALY B;  1EYA A;  3BDO A;  5FLM H;  1JJ2 A;  2RQX A;  4P2C B;  4JOI A;  1HNZ L;  1PH8 A;  1K3B C;  1SNP A;  2AQ2 B;  2DUD A;  5BR8 Q;  2B29 A;  3VDY A;  2AUJ D;  1EY8 A;  1K8M A;  2HCC A;  1A3V A;  1L0W A;  5KEE A;  1A8V A;  3IFT A;  5EJW A;  1AE2 A;  1VQG A;  2IPK D;  3CD6 A;  4HIM A;  1C4Q A;  1CHP D;  4XT1 B;  5NUC A;  2WAC A;  3KYH C;  5EPJ A;  2L4N A;  4ZUJ A;  5CBA E;  4IOA A;  4BBR H;  1ICW A;  5IYD G;  1YBY A;  2XGT A;  1SYC A;  4LF4 Q;  1EQV A;  3H0G H;  4DUY L;  5L37 A;  3DWP A;  4A3D H;  1SE8 A;  1UNS A;  4PZ7 A;  2NN6 G;  4AIM A;  1ZXT A;  3HFZ B;  2L12 A;  1XWE A;  5EBC A;  2EYP A;  1D5M C;  3MC0 B;  5AFW A;  4MZ9 A;  1L1O B;  2A6E D;  1GUN A;  4A3E H;  5JJK A;  1VQI A;  3A8I E;  1WTV A;  3GTQ B;  5C3W A;  3S17 H;  1TR5 A;  4PMB A;  4K6D A;  4B9W A;  1L2F A;  5IWA Q;  2WAQ G;  4HIO A;  4A3K G;  4K0K L;  1BCP D;  2F0J A;  4YCV A;  1L1O A;  1Q81 C;  1X55 A;  3PMF A;  2QDB A;  4K6L A;  5C3E B;  2FMC A;  1SMY C;  1G51 A;  2F0F A;  1EYD A;  1PLF A;  2K5Q A;  2A69 D;  1Q46 A;  4BA2 I;  4B3M L;  4N8F A;  2HDM A;  3GTM H;  3VR5 A;  4DK1 A;  3OW2 A;  3ZYY X;  2PW5 A;  3CME A;  4IJH A;  3T4A C;  4JVZ A;  4DPG A;  3SR1 A;  2WFW A;  2WIN B;  5C6A A;  3NEM A;  4DNR B;  2ZT9 C;  1B3Q A;  5EAY A;  3K0Y A;  1B50 A;  1MSH A;  3H15 A;  1B8A A;  3V2T A;  3F2U A;  3I90 A;  4JI8 Q;  1GKH A;  2ZXO A;  4EQP A;  3PF5 A;  1KXL A;  4MTN A;  2XWB B;  5K5P A;  1XMQ Q;  1S5D D;  4KKU A;  1PTO B;  2RCN A;  4DR5 L;  2KEC A;  1EL0 A;  1LO5 D;  2Z0S A;  5IP7 G;  3CC2 A;  1IYV A;  1M8A A;  1SDF A;  3Q23 A;  1CSQ A;  2LMC B;  3U9S A;  4CBV A;  3CCS A;  1C0A A;  1HRJ A;  4C1N K;  4IPH A;  4WFN 3;  4OXP A;  3PIO 3;  5KND A;  2ES2 A;  1PH3 A;  3OIP A;  5JAV A;  3HKZ B;  3DEO A;  5COY A;  1YI2 A;  2WKC A;  1EFW A;  4DV1 L;  3DWQ A;  3SGI A;  4X65 Q;  2F0V A;  5FLX E;  1Q90 A;  3QWN A;  4X64 Q;  1G29 1;  4DK0 A;  4IPG A;  3GTP H;  2EY1 A;  3R3O A;  4G7H C;  1HZA A;  1HQM C;  1X65 A;  3J80 c;  1EOT A;  1B7Y B;  2WAQ B;  4A3K B;  1YNJ C;  5GAG C;  4XXE A;  2K05 A;  1W3S A;  1V1P A;  2B63 H;  2GA4 B;  3DHQ A;  5E7N A;  3EIV A;  1ENA A;  4QIW E;  1SJE D;  3CCV A;  4P72 A;  3S15 H;  2Q8T A;  2A6H D;  1SNQ A;  2L5T A;  3PUZ A;  2NZ1 D;  3TQY A;  1I3Q B;  3ULP A;  5C4X B;  2RDG A;  4L63 B;  2K33 A;  1EY5 A;  2MQH A;  2K7V A;  5JEA G;  4A3G G;  3T16 A;  3RUZ A;  1N36 Q;  1VQD A;  2HIV A;  3VYS A;  2CW0 C;  3TS2 A;  3M4Q A;  3QG1 A;  2QDL A;  3SK8 A;  1C48 A;  1HCZ A;  3F2B A;  4HJ5 A;  5KRU A;  2ICE C;  3S1Q H;  4DR6 L;  4DA2 A;  4DV0 Q;  5EPL A;  4EQO A;  4I7A A;  3I8Z A;  4DAV A;  2F0O A;  2NVT H;  1TS4 A;  4TSS A;  1HR0 Q;  2JA8 G;  1WI5 A;  2G9H D;  3PO3 B;  2QKI C;  4KK7 A;  5DEH A;  1TWA H;  3U4Z A;  1STG A;  2M00 A;  1CK1 A;  1RCV D;  4JI0 L;  1MJE A;  2VL6 A;  4YWM A;  1E3P A;  2R93 G;  4KMU C;  4B3S L;  1KAA A;  1S5C D;  3OMC A;  4LF8 L;  1T9H A;  2JXM B;  3SK5 A;  1HQR D;  4A3C G;  3P75 A;  5C4H A;  4O42 A;  3ND9 A;  4EGV A;  1K73 C;  4YHH Q;  1Q86 C;  2EY5 A;  1L0X B;  1PTO F;  3FKI B;  1YHB A;  3T1Y Q;  1FD7 D;  3J81 j;  1VQL A;  1HA5 A;  1IW7 C;  1WJJ A;  2GVB A;  3UE0 A;  4DK3 C;  3K5N A;  2HIX A;  3STB D;  1HNX L;  4OON A;  4JOI C;  5CV4 A;  2SEB D;  2WB1 E;  2RF4 A;  4DV3 L;  2KJX A;  1ML0 D;  1VQE A;  4WJ4 A;  3A74 A;  4A3G B;  5FO9 B;  1AFP A;  4A3J H;  3H3V C;  2K6A A;  3DWA A;  4X66 Q;  4JI4 L;  1N8R C;  4JI3 L;  1VF5 C;  1VQC A;  3OWE B;  4CDD C;  2EYJ A;  4KTA A;  4JBM A;  4QL5 A;  4GN4 B;  4BXX H;  3T56 B;  3TZD A;  2FJ2 A;  1I5F A;  1TWF B;  2D0O A;  1V9P A;  2F3I A;  1GUO A;  2K5D A;  2BA0 A;  1D8L A;  1A2U A;  2EXD A;  1PH1 A;  1CZW A;  3CXC A;  1B4O A;  1KHI A;  4DV7 Q;  4GLV B;  2FMM A;  5EKL A;  1LT6 D;  1DGS A;  3Q0A A;  5FJ8 H;  5C4Z A;  2ZTE A;  1STH A;  2XTI A;  2R93 B;  4WOR A;  2K04 A;  2E2I H;  2I46 A;  1NNX A;  3A8J E;  3G4S A;  1NR2 A;  4DR2 L;  4KY7 A;  4NW2 A;  4L6T B;  1I4H A;  4C1N I;  2R92 B;  2MNA A;  3OTO Q;  1ZYR D;  1KLG D;  4BY1 G;  2JA9 A;  4R8N A;  3GTJ B;  5I6W A;  1AW7 A;  4V0B A;  3Q24 A;  1L1O C;  2EDG A;  1WTO A;  1WYD A;  3TS0 A;  3BVM A;  2L55 A;  4HSP A;  4RCO A;  4XQN A;  2EQS A;  1PRT C;  1V8Q A;  2K4K A;  3VYR A;  2Q2U A;  2PZW A;  1NAP A;  4GOP B;  1TU2 B;  1E2W A;  2K28 A;  3S9W A;  4YIJ A;  3OSO A;  1K83 B;  3TP8 A;  2B39 A;  3EQL C;  1M4V A;  2ZTD A;  3CCJ A;  4N9P A;  4JI2 L;  2TSS A;  1SFO H;  3ITP A;  4HMI A;  4HCS A;  2EYO A;  1V1Q A;  4LFB Q;  3I4N G;  2CCZ A;  3L3O C;  5FKA C;  4A93 G;  4QUC A;  1LTR D;  1STA A;  1NTG A;  4S3S A;  2B63 G;  3I4M G;  4HN7 A;  1UWV A;  2HHH L;  1CHQ D;  1KNA A;  5FLX L;  2QA4 A;  2K50 A;  2LXJ A;  5KNB A;  3GTQ H;  2Z9H A;  2R7Z G;  2IW3 A;  5EKK A;  3M7N A;  3D3R A;  1G91 A;  1DD2 A;  3W3A A;  4ZKC B;  3EJI A;  3E9I A;  2PPB C;  4OWX B;  3J80 i;  3ULL A;  4DV5 L;  2OQK A;  3D4W A;  3M4P A;  3BYY B;  5C3E H;  4KD3 A;  1K8G A;  4LFC L;  4BY1 B;  4K14 A;  1W2B A;  4JI7 Q;  1V1O A;  2PMZ E;  2F3W A;  1VQK A;  1SBB B;  3AEV A;  1RHP A;  1D6E C;  3A7L A;  4PMW A;  2JQO A;  1STE A;  2ZJQ A;  2K5H A;  2V4D A;  2VQE Q;  1XNQ L;  1EFI D;  1X3F A;  1Y8P B;  1DYQ A;  2EYF A;  1OXT A;  4KI0 A;  1S5E D;  1PZK D;  4OX9 Q;  1LTL A;  4L5S A;  3C1F A;  1RTO A;  1JJC B;  4QGU A;  1LTS D;  1SE4 A;  4O2D A;  4J8Q A;  1IL8 A;  4QMG A;  4LF5 Q;  2A1A A;  2R7F A;  4WJW A;  1D5X C;  3VA5 A;  5IYD H;  2CHB D;  1F2Z A;  3ZJY C;  4BWG B;  1PTO H;  2F52 A;  3BDL A;  1K3R A;  1Y1V B;  1PVO A;  2KHJ A;  5M5W B;  3CU7 A;  3HKS A;  2O5J C;  1RDP D;  2GVA A;  1YJ9 A;  2R61 A;  1EQT A;  2IHF A;  5DM7 3;  3I4N B;  2NN6 H;  3ER0 A;  4K8I A;  4AYB G;  1L0Y B;  4A93 B;  1LYL A;  5M5Y B;  1NMG A;  2BH8 A;  2MFI A;  3KLS X;  4RKL A;  1E1O A;  1SAP A;  1LUZ A;  1N9W A;  1QVF A;  3I4M B;  1MD2 D;  1F9Q A;  1AZQ A;  4IJL A;  3L0O A;  2PQA B;  4MNO A;  1S40 A;  1U5K A;  2XNA C;  5J22 A;  4HJ9 A;  2R7Z B;  4LW1 A;  1E0B A;  4A3M G;  4DUZ L;  3PIP 3;  5LMN L;  4A3K H;  4G7Z C;  1OXV A;  1K9M C;  4A3J G;  3K80 C;  4ME5 A;  1CKN A;  4LWC A;  3CCR A;  4R4O A;  4DNT B;  4KJN A;  4A3I G;  3QJY A;  1B44 D;  1BKB A;  4X62 Q;  2PZT A;  2UU9 Q;  3TRZ A;  4G57 A;  5C4X H;  3N6R A;  4LF6 Q;  3FEW X;  2OCE A;  2J0T D;  3I70 A;  4FF4 A;  3ONA B;  2UXD Q;  2VB3 X;  3KOJ A;  3GD7 A;  2PQE A;  2ZXP A;  4RH6 A;  4FF2 A;  3GTG B;  3J7A F;  3S2D B;  1A2T A;  1NMF A;  1F2Y A;  3P7J A;  5BR8 L;  1CZG A;  2IWH A;  3AYH B;  5AJ3 Q;  3HOY G;  4K2K A;  3M4O B;  3MEH A;  1G6P A;  1H9J A;  3OOC A;  3BVZ A;  2HT1 A;  3HOW G;  5IP7 H;  4A3L H;  2CFM A;  3Q6S A;  1JCK B;  2B3G A;  3KLW A;  1C7Y A;  3VYU A;  1S3O A;  3ULJ A;  1T5X D;  2UXC Q;  3HEJ A;  3PO3 H;  4LUV A;  4OHJ A;  4POF A;  1WTQ A;  4B08 A;  1BBU A;  1HZC A;  2NTS A;  1LTG D;  2KCT A;  3TME A;  2UXB Q;  1SE2 A;  1D7Q A;  1S5B D;  4JBJ A;  3I55 A;  3TDQ A;  3KF8 A;  4B3T Q;  3A56 A;  2Z6K A;  3SHL A;  5C4J B;  4L5Q A;  5E4X A;  1YIJ A;  1FL0 A;  5I9P A;  4QCL A;  1XXG A;  4JI1 L;  2SDF A;  1PH5 A;  3GDE A;  2KED A;  5GQO A;  4UP7 A;  3L9A X;  3FKI H;  2BCO A;  5CV5 A;  3TP7 A;  3PCO B;  2RBM A;  2DJF C;  1N32 L;  3D4R A;  3NTI A;  4CHT B;  1X56 A;  2NB0 A;  3Q8D A;  1FJG Q;  1B1Z A;  3D0F A;  3QB3 A;  2NYZ D;  3ERO A;  2Z8L A;  3TZU A;  2KEN A;  4OO1 H;  2PNR C;  4C3J G;  2F4I A;  3CCL A;  1MSG A;  2XN9 C;  1Z47 A;  2MPM A;  3G48 A;  4GN5 A;  4OIK A;  3CF5 A;  5IGD A;  3MA2 B;  2NTT A;  1STN A;  2J4X A;  4A3G H;  2JK8 A;  2DJG C;  4XYO A;  2NN6 I;  1UE7 A;  1A15 A;  1XMO Q;  3NP8 A;  1IKL A;  3BJU A;  3BZD B;  5ELE A;  3KBX A;  2NVX B;  3EN2 A;  1IXR A;  2WAQ E;  1QUQ A;  4P75 A;  4HMJ A;  1LAB A;  5C44 G;  4DXF A;  3LWU A;  2L15 A;  3CRK C;  3HOW B;  3HZX A;  4GS3 A;  3LNN A;  2EY6 A;  2E5L L;  1U4P A;  1VQ4 A;  2QCP X;  4A3F G;  3E3X A;  4IPD A;  5J39 A;  3TSS A;  1XJV A;  1J5E Q;  3M7G A;  5H1S E;  2F0E A;  4CDE C;  5HGQ A;  3TP5 A;  1Y1W G;  3GTO H;  2C9O A;  1DXM A;  1IZ6 A;  2R93 H;  2Z6B A;  1EQR A;  3AMU A;  1ZEQ X;  1B70 B;  3RMH A;  3F1Z A;  4QB4 A;  2A68 D;  4HID A;  1BQQ T;  4LFA Q;  4IFD J;  4A3C H;  3HOZ B;  3RZO B;  1P8L A;  3A8K E;  4DV4 Q;  3I2Z A;  3D6C A;  2EYL A;  2E2H B;  5A35 A;  4RG1 A;  3RN5 A;  3GTJ H;  4UDU C;  1IBK Q;  3K59 A;  2RSO A;  2K5N A;  4X65 L;  3UDX A;  4X64 L;  5IT9 c;  3TRE A;  1DOM A;  4CGY B;  2HQL A;  5FO8 B;  4KHZ A;  4C3J B;  1JOO A;  5I9O A;  2YU9 H;  4GLA C;  3MZ5 A;  4RKB A;  4DNI A;  3JC6 6;  4DV2 L;  4J6H A;  1HUM A;  2JN4 A;  4HJ8 A;  3HOV G;  1YNN D;  2QF7 A;  3E0E A;  3PUY A;  1VQ9 A;  1BXT A;  4GLX A;  3NWS A;  5IP9 G;  2EIF A;  3CPF A;  2MO1 A;  2RA4 A;  3HKZ G;  2ZM6 Q;  4A3B B;  3MXU A;  3GTL H;  3UDF A;  1K83 H;  3FHW A;  3PGZ A;  5C44 B;  3VR2 A;  3GV3 A;  2N78 A;  3J7A V;  4DV6 Q;  4UPA A;  3QOJ A;  3KUP A;  3J81 L;  2H5X A;  1SYG A;  4KN4 C;  4A3F B;  4C3H B;  1CQF A;  1CQV A;  4X3S A;  2QEJ C;  4P74 A;  1PRT B;  4JBK A;  1SMY D;  1JB3 A;  1Y1W B;  1I6V C;  1PV4 A;  4DV0 L;  4IPC A;  2A6E C;  3WDN A;  1B3A A;  1DM0 B;  2PCF B;  5M5X B;  4OO1 I;  1HR0 L;  4QQB X;  3NUC A;  3J7Z C;  3PIO A;  5C4X G;  4JYA Q;  2D2C C;  4G4K A;  4H0L C;  2IT1 A;  1ENC A;  4BY1 H;  2Q2T A;  2AUK A;  1LTA D;  1H9M A;  1HPC A;  2LXK A;  2A69 C;  1R9T B;  3HGB A;  2B2T A;  1FR3 A;  1LLR D;  4Y7N B;  1WTP A;  2NUC A;  4L5T A;  2OT2 A;  2AWN A;  5M3F G;  4A3L G;  2VQF Q;  3DMU A;  4KHP Q;  1AN8 A;  3OPO A;  4DAY B;  2KOL A;  2N88 A;  4HCE A;  4YHH L;  3PO3 G;  3HOV B;  1JR0 D;  1LT4 D;  1UAP A;  3M3Y H;  4HSV A;  3CCE A;  3T1Y L;  4ULL A;  4GKJ Q;  1KIX A;  3MXG A;  4KKS A;  2KUM A;  1WCM B;  1SND A;  5A2Q L;  2G5D A;  2KHI A;  5IYB G;  1KRT A;  4RGM A;  5ELC A;  3MXN A;  1Y1V H;  4DAY A;  5M5W H;  4IFD H;  4NXM L;  1AEX A;  2PI2 A;  4QJF A;  1V1P B;  1F2L A;  4I65 A;  5J3B A;  3FDT A;  1EY0 A;  2Y0S B;  3I4N H;  3H94 A;  3JAM E;  2QEX A;  2E76 C;  4X66 L;  4A93 H;  5M5Y H;  2OF1 A;  1W6J A;  5CBE E;  3FKI G;  3CRL C;  2JE6 I;  3I56 A;  2B2V A;  2ZJP A;  2WV6 D;  1GUW A;  1I50 B;  3T1H Q;  3I4M H;  3NBI A;  5KNC A;  1GOZ A;  3R8B A;  1B9N A;  2ASB A;  2MHV A;  1E7Z A;  1AP0 A;  4OO1 G;  1VDZ A;  2XRQ D;  2R7Z H;  3HP3 A;  4ZAI A;  1HHV A;  2Z6K C;  3DEP A;  2N49 A;  1TXY A;  3PF4 A;  2I0Q A;  2OXP A;  2OTL A;  1QOH A;  5IIF A;  3HOU B;  4DV7 L;  4LF7 L;  3SEB A;  3M4Y A;  2F0W A;  3GQB A;  3C3L A;  1BUV T;  4ZKB B;  5CGK A;  4UAI A;  1HFG A;  4J1M A;  5T1I A;  1BR9 A;  3RD4 A;  1SNM A;  2A6H C;  2F0U A;  4H44 C;  1G6Z A;  4KY5 A;  1K8O A;  1PRT F;  3AFP A;  1JWM D;  5JJI A;  5M3F B;  1BBW A;  1SNO A;  2L9H A;  4CDC C;  3OTO L;  2B2Y A;  2PYK A;  1VQ8 A;  1ET6 A;  3GTG H;  4K0K Q;  1P16 A;  3T13 A;  1HA6 A;  1H9R A;  4OEM B;  1X3Q A;  1XTC D;  4KV6 A;  2DNC A;  1KDA A;  3OW7 A;  1JC7 A;  1U0L A;  4C2M B;  4AQY Q;  2M9V A;  4H02 A;  3PUW A;  1RIP A;  2UUC Q;  1QIL A;  4WRD A;  3M85 A;  3VR6 A;  3J81 c;  2BDN A;  2A19 A;  3GP7 A;  4LJZ C;  4PZ6 A;  5C3X A;  1H9S A;  3X3N A;  2VUM G;  1X3G A;  5G3L F;  1MGS A;  1GVP A;  2R92 G;  4FXK C;  1IYJ B;  1VQM A;  2IX1 A;  3GTK B;  1QE6 A;  2CVR A;  4PG3 A;  1I94 Q;  4LF9 L;  2OWO A;  1HNW L;  2FIN B;  1KDB A;  3C46 A;  3ERQ A;  2K32 A;  3GV6 A;  1SEB D;  4RCN A;  4LFB L;  1TVX A;  4X3U A;  4JI6 Q;  4A3M H;  2UUB L;  3EA6 A;  3C2P A;  2A8V A;  2EXZ A;  4DAM A;  4KHV A;  1MI2 A;  1SN8 A;  1MKH A;  4DFA A;  5LL6 S;  2D9U A;  1QZH A;  4ZCK A;  1WTR A;  3EBE A;  4A3I H;  3E6Z X;  4NB3 A;  3STB C;  4C56 C;  4CJ2 C;  5JJZ A;  2NZH A;  1SNC A;  2CH4 W;  3BU2 A;  3RLF A;  2OEO A;  5GAH C;  1SJH D;  4IUV A;  1PH6 A;  4IFD I;  3BVG A;  1O7I A;  3FMC A;  1JB7 A;  2DGY A;  2F0N A;  4PQX A;  1K0R A;  4ZUI A;  2A74 C;  2N3S A;  1F9S A;  3O13 A;  2NVX H;  1F9P A;  1WFQ A;  4EX5 A;  3NBH A;  4MTK A;  5EPK A;  5LL6 X;  1TWG B;  3HOY H;  3KLR A;  3F2C A;  4TQU S;  2VQE L;  4CKB A;  3HOW H;  1J8I A;  1A3U A;  1STY A;  2AMC B;  3S16 H;  2OTJ A;  2VUM B;  4L5R C;  1FVI A;  5GAE C;  2EOT A;  5BN4 A;  2JA6 G;  1KL9 A;  2DY7 A;  2A73 B;  1I6H B;  1BVS A;  2Q2I A;  3SDZ A;  4LF5 L;  3ICE A;  3H3V H;  2JEA I;  3K57 A;  4KJO A;  1UEB A;  2DY8 A;  4MN3 A;  3HOZ H;  3RZO H;  1TY0 A;  1EIG A;  1RKN A;  2BE5 D;  3FPP A;  3URY A;  5LMU Q;  2XIW A;  3S2H B;  1EYG A;  2XRS D;  5I4D A;  1ZYR C;  4BY7 B;  1WTH A;  3PSI A;  3VR3 A;  1N33 L;  3NTH A;  3P1H A;  4OWT B;  3VR4 A;  1D1K A;  3TN2 A;  4AYB E;  3SE0 A;  1RJT A;  4BBR B;  4C3J H;  1B53 A;  1HH2 P;  5IOD A;  4IAL A;  3CQZ B;  1Y1V G;  1C9O A;  2B2T C;  4IFD G;  3BDC A;  1VQP A;  1IBM L;  3H0G B;  5FK9 C;  2KVM A;  4A3D B;  3MFY A;  4BBS G;  4QIW B;  3IKJ A;  4IZ8 A;  5G3L D;  1GXD C;  2EVB A;  4A3B H;  3L7Z C;  1OXS C;  5FO7 B;  1I4X A;  1PTO D;  5C44 H;  4U68 A;  2UU9 L;  2G9D A;  2YTX A;  5CV9 A;  1DJR D;  2Z4I A;  4LF6 L;  4DR3 L;  4JI5 Q;  4R4C A;  4O1N A;  2F0T A;  2IX0 A;  4A3F H;  4C3H H;  1NE3 A;  3KFU A;  4B3R Q;  2EE1 A;  1QZG A;  3SVM A;  1HFN A;  3NK9 A;  3J80 E;  1YEZ A;  2JA7 B;  4Q5V A;  2JA6 B;  1Y1W H;  3RN2 A;  2DNE A;  2XVS A;  3CAM A;  4YY3 Q;  4OEL B;  2B2V C;  4DR1 Q;  3IL8 A;  4QY7 A;  5M5X H;  2K5W A;  2IL8 A;  2HUG A;  5HGT A;  1MHW C;  3R2T A;  1SYE A;  4GKK L;  5IGC A;  1RL2 A;  1TT2 A;  3NSW A;  1U4L A;  5LHY 1;  3UDG A;  5GRO A;  1WTW A;  1RD9 D;  1VMC A;  1QWY A;  4RA8 A;  1EY7 A;  5T1G A;  1R9T H;  4IOC A;  4H13 C;  1R4P B;  4DU9 A;  4Y7N H;  1WOC A;  1A3T A;  1X54 A;  4HIK A;  3RNU A;  3PQI A;  3F2D A;  4APV A;  4RMF A;  3MAQ A;  3HOV H;  2BOS A;  1GHK A;  1KAB A;  4DR2 Q;  4BBS B;  5IP9 H;  4CDF C;  2B2Y C;  3BG3 A;  1WCM H;  4KY6 A;  1LT5 D;  5JVG 3;  4K5V A;  2F03 A;  3H3V I;  4JCV E;  4N9T A;  2F4V L;  1J6Q A;  3PUX A;  2KHS A;  2KCN A;  4JK1 C;  1GJX A;  3K7A B;  1VF7 A;  3H09 A;  1CKN B;  4F7X A;  2B2W A;  3G6J B;  3J81 i;  4I7Z C;  1IHZ A;  1EY9 A;  4UP9 A;  1JIC A;  4EQN A;  3LGJ A;  3D8G A;  4X6A H;  1XMO L;  1ICF B;  3CCQ A;  1G2T A;  2B8F A;  4QF4 A;  3A54 A;  1E2V A;  4IUU A;  4OIJ A;  2IY5 B;  1I50 H;  2PZU A;  3S24 A;  1TS3 A;  4LK1 C;  1YNX A;  2I5H A;  1KD1 C;  5DM6 3;  1NUC A;  4HTH A;  3I73 A;  1PYW D;  3OMG A;  1KTK A;  4C3I G;  1I3Q H;  4JG2 A;  1SYB A;  3DM1 A;  5D65 A;  2FHT A;  3B6Y A;  1GUG A;  3R93 A;  5IY0 A;  3U58 A;  5IYC G;  1K8A C;  3HOU H;  2EZV A;  1M90 C;  1IBL L;  2J7Z A;  3S14 B;  1IYU A;  3RZD B;  1ILP A;  2CKZ B;  1VQN A;  1BF4 A;  1HJP A;  2F3V A;  2JA5 B;  4LFA L;  1LTT D;  1TWC B;  1BDO A;  1QNU A;  4R4T A;  1Z7T A;  3K81 C;  2C5C A;  5M3F H;  4DV4 L;  5ELB A;  5I2X A;  1Q1E A;  4PZ8 A;  4R1J A;  3KF8 B;  3CKI B;  1HXY D;  2B2U A;  3NTK A;  2K1B A;  2QIL A;  1EY4 A;  4POG A;  1SYF A;  5IYB H;  1LTB D;  3IAY A;  3E9H A;  3FVQ A;  2MP1 A;  5FLX c;  4LF4 L;  2ENB A;  3CC7 A;  4UHV A;  2EJG C;  1E22 A;  2ICI A;  4PV1 C;  2ID0 A;  3HOZ G;  1IKM A;  1OXX K;  4F8M A;  2VY3 A;  2GN5 A;  1EYC A;  2I5M X;  5DNF A;  1JOQ A;  2CQO A;  1QNK A;  4FVM A;  1G8Z D;  3QR8 A;  2ZM6 L;  3L2P A;  4HR7 B;  3GTK H;  5EGT A;  2Z4H A;  1SRO A;  3QOL A;  1LV9 A;  1FNV A;  3J7A 5;  3D31 A;  4RGN A;  3T51 B;  4DV6 L;  3KDF A;  1FNU A;  3HKZ E;  4BA1 I;  4C3I B;  1QUQ B;  1TY2 A;  1A0I A;  1PFB A;  2C35 B;  1LAC A;  1VQA A;  4KLK A;  1D1I A;  5IWA L;  4NXN Q;  1Q8K A;  1PFM A;  2A5H A;  3I91 A;  2KA7 A;  1X6O A;  5J1Z A;  1WTX A;  1GUT A;  5I2Y A;  1JWU D;  1TWH B;  2F0P A;  2M2L A;  4ZK9 B;  2LKV A;  4A3B G;  2EY2 A;  1EIH A;  1N34 Q;  4ID6 A;  4FNF A;  4JYA L;  4GNX A;  2F0M A;  1TWF H;  4NP5 A;  1XNR Q;  4C3H G;  2K5V A;  1YZ6 A;  5E4W C;  1TKW B;  4DUZ Q;  1ESF A;  3E5S A;  3NWT A;  4LUO A;  5IGF A;  3TEH B;  1QJO A;  5M3M G;  1NJI C;  2AKW B;  5D3D A;  3X3M A;  4A4I A;  4JI8 L;  4JV5 Q;  3CCM A;  1TWG H;  3BZK A;  1XMQ L;  1VCI A;  2KCM A;  3S1N B;  1E1T A;  4DR7 Q;  4YWL A;  2YYZ A;  3HOX G;  1FGU A;  1ASZ A;  2IX3 A;  2QGQ A;  3KBG A;  2R7D A;  2VQF L;  1F9R A;  4YWK A;  5JPM C;  4IQZ A;  1X3E A;  2VUM H;  4IUP A;  3AFQ A;  2R92 H;  1VMP A;  4GKJ L;  4DGZ A;  1KNE A;  3V05 A;  2B8G A;  2ZJR A;  3NQT A;  3N52 A;  2E2J B;  1I6H H;  1VQO A;  4TKO B;  4MIU A;  1QVC A;  1XTD A;  1DZ1 A;  3SXH A;  3HG9 A;  4YCU A;  3NHH A;  3HRZ C;  2A68 C;  2HD3 A;  5CR3 A;  5IGB A;  2JEB I;  1MJC A;  1CA6 A;  5CV7 A;  1U9R A;  4CKE A;  1SXT A;  1CA5 A;  5JOB A;  1ZKO A;  3S2H H;  1JOR A;  3S1R B;  1KAW A;  2X6G A;  4BY7 H;  3R2I A;  3V96 A;  1E2Z A;  3G6E A;  3T1H L;  2K03 A;  1WCM G;  1YJN A;  3A5Z B;  1E24 A;  2YV5 A;  1YIT A;  1PMR A;  3CQZ H;  1CI3 M;  2H4O A;  1NR4 A;  3ERS X;  3OWF A;  1SFO B;  1I4P A;  2Y0S G;  3H91 A;  1YNN C;  4JI1 Q;  1N36 L;  4XTC S;  3I72 A;  1PDQ A;  4R9W A;  2PO4 A;  3P20 A;  5M3M B;  1CT1 D;  5C0X G;  1H9K A;  2BDO A;  5ELN A;  5I6Y A;  4HJA A;  2RSN A;  1N32 Q;  3MFG A;  1SE3 A;  4DR4 Q;  3PO2 B;  4P73 A;  1DCZ A;  3HOX B;  2Q2H A;  5HUR A;  1WD0 A;  2JYO A;  2OQ0 A;  3RR5 A;  4WJ3 M;  4H7B A;  2F1M A;  1Z9F A;  1ROD A;  2B2W C;  1AH9 A;  5E3F A;  1J9O A;  3U9O A;  3HOU G;  1A63 A;  2JA7 H;  1BCP C;  2JA6 H;  5IGE A;  2L0C A;  4JW0 A;  5BN5 A;  4UP8 A;  2DN8 A;  4AQY L;  4V19 0;  2UUC L;  1PH7 A;  4RAU C;  4R8I A;  2ATW A;  3EVQ A;  3BS1 A;  3DUZ A;  3S1M B;  2F0I A;  4ZLT F;  2E5L Q;  3MXN B;  2H1E A;  4ODG A;  3Q22 A;  2R3Z A;  4LAA A;  1O7Y A;  1G2S A;  2UUA Q;  3TBI B;  1I94 L;  1F77 A;  5FOB B;  4FXG C;  4DKA C;  4DN4 M;  1XPR A;  1HNZ Q;  1B2T A;  1TII D;  4JI6 L;  1UE5 A;  3QIA A;  4XT3 B;  1JQY D;  1BBX C;  2F0G A;  5TSS A;  5IE8 A;  2K52 A;  1Y14 B;  2I07 B;  4CJ0 B;  4BBS H;  3UI2 A;  1YNJ D;  4ABN A;  2B2U C;  1ONL A;  4U67 3;  2F0K A;  2X6L A;  3T53 B;  1OXU A;  3SK6 A;  3K7A H;  1SLJ A;  3CP0 A;  1PFS A;  3A55 A;  3KK7 A;  3NPP A;  2HDL A;  3KJP A;  3IFD A;  2EPB A;  3HS0 C;  3JAM i;  2RVL A;  4DUY Q;  4DV2 Q;  5IOC A;  1TS5 A;  3TP6 A;  2WP8 J;  2VZA A;  1SYD A;  1NCV A;  2CW0 D;  2VW9 A;  3LWE A;  4R4Q A;  1MBY A;  4TRD A;  4XDX A;  1XPU A;  2CQA A;  5HY6 A;  3DLL A;  1U4M A;  1BNZ A;  5ELF A;  5COR A;  2JP1 A;  4Q0F A;  3A5U A;  2K75 A;  1EIY B;  1EIF A;  5DAU A;  3H6M A;  4K2L A;  1EOV A;  3S14 H;  2RDH A;  4HED A;  3AU7 A;  3RZD H;  5E1F A;  1FNW A;  1XYI A;  3MVV A;  3S2D H;  4KN7 C;  1H9S B;  1F2M A;  1FGB D;  2D5D A;  4B9X A;  1OTC A;  1NBW A;  2JA5 H;  1D2B A;  3M4O H;  1TWC H;  4K8J A;  1VQJ A;  2Q8I B;  1BOS A;  5LMU L;  4B3M Q;  1VQ7 A;  5JVH 3;  4GNX C;  1EUJ A;  2F0L A;  2XSC A;  1I4R A;  5BN3 A;  2I5L X;  3U50 C;  4RFB A;  1CSP A;  4XQJ A;  5ISR A;  5FLM G;  5KYL A;  2R6G A;  1IW7 D;  1Q82 C;  4CJ1 B;  5C4J H;  5EBD A;  4TVA B; 
#chains in the Genus database with same CATH homology
 3M9B A;  1Y1W H;  1Q1B A;  1FL0 A;  1YIJ A;  3RN2 A;  1EQQ A;  4DR5 Q;  1G51 A;  3CAM A;  4JI1 L;  4YY3 Q;  1Q46 A;  1PH5 A;  3GDE A;  1X9N A;  4DR1 Q;  4BA2 I;  4QY7 A;  5GQO A;  5M5X H;  4B3M L;  3GTM H;  4UP7 A;  3FKI H;  4BY7 G;  3OW2 A;  1QVG A;  3PCO B;  1N32 L;  4GKK L;  3K8A A;  3CME A;  1X56 A;  3Q8D A;  4IJH A;  4DPG A;  3D0F A;  1GO3 E;  1RL2 A;  2WFW A;  1YHQ A;  1M1K C;  1FJG Q;  3NEM A;  3UDG A;  5GRO A;  4BBR G;  2KEN A;  4JI5 L;  5EAY A;  4DV1 Q;  3CCL A;  4C3I H;  4B3R L;  3H15 A;  3G48 A;  1Z47 A;  3NBH B;  1VS0 A;  1B8A A;  4NXM Q;  4GN5 A;  3H0G G;  1R9T H;  3CF5 A;  4JI8 Q;  5IYC H;  1GKH A;  3PF5 A;  4A3D G;  4IOC A;  1KXL A;  4MTN A;  4Y7N H;  4A3G H;  2JK8 A;  1WOC A;  5GAD C;  1XMQ Q;  1TWH H;  2NN6 I;  1UE7 A;  4JI7 L;  2RCN A;  1XMO Q;  4DR5 L;  1PYS B;  1X54 A;  4HIK A;  3BJU A;  2Z0S A;  2RHS B;  4YY3 L;  5IP7 G;  3RNU A;  3CC2 A;  3EN2 A;  1IXR A;  3F2D A;  2WAQ E;  4APV A;  1QUQ A;  4RMF A;  4DR1 L;  1CSQ A;  4P75 A;  3HOV H;  5C44 G;  1C0A A;  3CCS A;  1PA6 A;  4DR2 Q;  4DK6 C;  1PH4 A;  4IPH A;  5IP9 H;  2L15 A;  4OXP A;  1WCM H;  4GS3 A;  4A3E G;  1YJW A;  2E5L L;  2ES2 A;  1PH3 A;  1H95 A;  1VQ4 A;  4A3F G;  1YI2 A;  3H3V I;  4JCV E;  1EFW A;  4DV1 L;  4OX9 L;  2F4V L;  1J6Q A;  3F8T A;  3SGI A;  3PUX A;  1EWI A;  4IPD A;  4X65 Q;  4X64 Q;  1G29 1;  1XJV A;  1J5E Q;  4LF7 Q;  1CKN B;  4IPG A;  5H1S E;  2JA7 G;  3GTP H;  2VNU D;  1VQF A;  3J81 i;  5HGQ A;  1Y1W G;  3GTO H;  4UP9 A;  1IZ6 A;  2R93 H;  3S1N H;  1CKO A;  3KF6 B;  3LGJ A;  1HZA A;  1EQR A;  1X65 A;  3I4O A;  3J80 c;  4X6A H;  1XMO L;  1B7Y B;  1B70 B;  3CCQ A;  3PUV A;  2RHQ B;  3F1Z A;  5GAG C;  4HID A;  4DR6 Q;  4LFA Q;  4IFD J;  2IY5 B;  4A3C H;  1IL2 A;  1I50 H;  1W3S A;  3S24 A;  1P8L A;  5E7N A;  2B63 H;  3EIV A;  4FDB A;  4QIW E;  4DV4 Q;  3I2Z A;  1YHA A;  1YVC A;  3CCV A;  1YNX A;  2I5H A;  5LMN W;  1KD1 C;  4P72 A;  2E2H H;  3S15 H;  2KBN A;  3KF6 A;  4RG1 A;  2E2J H;  1V43 A;  1KRS A;  3GTJ H;  3RN5 A;  1IBK Q;  3PUZ A;  1I3Q H;  4JG2 A;  1HZB A;  3TQY A;  5C0X J;  3ULP A;  4JI0 Q;  1A62 A;  3W5O A;  3B6Y A;  4OWW B;  2JJQ A;  5IY0 A;  2K5N A;  4X65 L;  3UDX A;  3U58 A;  1XPO A;  5IYC G;  4X64 L;  1K8A C;  3HOU H;  5IT9 c;  4LNQ A;  2MQH A;  3TRE A;  5JEA G;  2HQL A;  1M90 C;  1IBL L;  4KHZ A;  4A3G G;  1N36 Q;  2YU9 H;  4GLA C;  4B3S Q;  1VQD A;  2HIV A;  2CKZ B;  3TS2 A;  1VQN A;  3M4Q A;  4ME3 A;  4DNI A;  3JC6 6;  4DV2 L;  4LF8 Q;  2N8N A;  4HJ8 A;  2JA8 G;  3F2B A;  4HJ5 A;  1HJP A;  3S1R H;  3HOV G;  3S1Q H;  4DR6 L;  4LFA L;  4DV0 Q;  3E0E A;  3PUY A;  1UE1 A;  1VQ9 A;  4GLX A;  4R4T A;  5IP9 G;  2EIF A;  3K81 C;  2IHE A;  3CPF A;  5M3F H;  4DV4 L;  2MO1 A;  2NVT H;  1HR0 Q;  1Q1E A;  3HKZ G;  2YTV A;  4PZ8 A;  4R1J A;  2ZM6 Q;  2WB1 G;  1KC8 C;  1WI5 A;  3KF8 B;  1HZ9 A;  4JBW A;  1K83 H;  3UDF A;  3GTL H;  3FHW A;  3PGZ A;  4X62 L;  1HNW Q;  4LF9 Q;  1TWA H;  2N78 A;  1MIU A;  3U4Z A;  4JI0 L;  1HNX Q;  4DV6 Q;  4UPA A;  3UE1 A;  4GOP A;  1MJE A;  2VL6 A;  2H5X A;  4POG A;  4DV3 Q;  4YWM A;  2UXD L;  1E3P A;  5IYB H;  2R93 G;  2UUB Q;  3E9H A;  5FLX c;  4B3S L;  4LF4 L;  4P74 A;  5M3M H;  3CC7 A;  4JBK A;  4LF8 L;  1T9H A;  1E22 A;  3HOZ G;  2ID0 A;  4IO9 A;  4A3C G;  1OXX K;  1PV4 A;  4JI4 Q;  2VY3 A;  2GN5 A;  3GO5 A;  5AJ3 L;  4DV0 L;  4IPC A;  4JI3 Q;  3PO2 H;  4UY8 C;  3HOX H;  1Q12 A;  2I5M X;  4EQ5 A;  1K73 C;  2CQO A;  4YHH Q;  1Q86 C;  1PH2 A;  4OO1 I;  1HR0 L;  4QQB X;  2ZM6 L;  3J7Z C;  3PIO A;  1YHB A;  3RLO A;  3L2P A;  3T1Y Q;  2UXC L;  3GTK H;  5C4X G;  4JYA Q;  3J81 j;  1SRO A;  2E8G A;  1VQL A;  1WJJ A;  3J7A 5;  2GVB A;  3UE0 A;  4DK3 C;  3D31 A;  2HIX A;  1ASY A;  3STB D;  2IT1 A;  1HNX L;  2D0P A;  4OON A;  4DV6 L;  4JOI C;  1JE5 A;  2D62 A;  3KDF A;  3HKZ E;  4BY1 H;  2UXB L;  2WB1 E;  4BA1 I;  2Q2T A;  2RF4 A;  4DV3 L;  1QUQ B;  2LXK A;  1A0I A;  2C35 B;  1VQA A;  4KLK A;  5IWA L;  3UDI A;  4B3T L;  4NXN Q;  1VQE A;  1Q8K A;  3PIP A;  4WJ4 A;  3A74 A;  2JA5 G;  4JC0 A;  1X6O A;  4A3J H;  3S1M H;  4X66 Q;  4JI4 L;  1N8R C;  4L5T A;  4A3L G;  2AWN A;  5M3F G;  4JI3 L;  2VQF Q;  4Y52 H;  1VQH A;  1GD7 A;  1GM5 A;  4A3B G;  4KHP Q;  5DLQ E;  1VQC A;  3I7F A;  4DAY B;  4YHH L;  1N34 Q;  3PO3 G;  1Q7Y C;  3M3Y H;  4JBM A;  3CCE A;  4QL5 A;  3T1Y L;  4GKJ Q;  4GN4 B;  1KIX A;  4JYA L;  4GNX A;  3K0X A;  4BXX H;  1LM0 A;  1FJG L;  1TWF H;  1I5F A;  1XNR Q;  1AE3 A;  2D0O A;  1V9P A;  2K5V A;  1YZ6 A;  2KHI A;  2F3I A;  5IYB G;  1KRT A;  2BA0 A;  4DUZ Q;  1D8L A;  1Y1V H;  2EXD A;  4LUO A;  1PH1 A;  3NEN A;  3CXC A;  5M5W H;  3TEH B;  3KJO A;  1KHI A;  1PHJ A;  5M3M G;  2PI2 A;  4DV7 Q;  4QJF A;  1NJI C;  1JMC A;  2AKW B;  4GLV B;  4NXM L;  4A4I A;  4JI8 L;  4JV5 Q;  1DGS A;  5FJ8 H;  4NXN L;  5J3B A;  2ZTE A;  3CCM A;  1TWG H;  3I4N H;  3BZK A;  2XTI A;  1VCI A;  2KCM A;  3OYY A;  1XMQ L;  2QEX A;  5JEA J;  1E1T A;  4DR7 Q;  1CKM A;  4YWL A;  2YYZ A;  4X66 L;  1FGU A;  3HOX G;  4A93 H;  5M5Y H;  1ASZ A;  2QGQ A;  2R7D A;  2VQF L;  1VQB A;  2E2I H;  3FKI G;  4YWK A;  4YCW A;  3G4S A;  2JE6 I;  3CW2 C;  3I56 A;  2ZJP A;  1X3E A;  1N33 Q;  3T1H Q;  2VUM H;  1N34 L;  3I4M H;  4NPS A;  3CMA A;  4DR2 L;  3AFQ A;  2R92 H;  2ASB A;  4GKJ L;  1E7Z A;  2MNA A;  3OTO Q;  4O0A A;  2ZJR A;  4OO1 G;  2MO0 A;  1XNR L;  4BY1 G;  2R7Z H;  1VQO A;  1I6H H;  4ALP A;  2JA9 A;  2Z6K C;  1L1O C;  1QVC A;  2N49 A;  1WYD A;  1XTD A;  1TXY A;  3TS0 A;  3PF4 A;  1IBM Q;  2I0Q A;  3AQQ A;  4JI2 Q;  2OTL A;  4YCU A;  1J5E L;  4DV7 L;  4LF7 L;  3CC4 A;  4JV5 L;  1S72 A;  1VQ5 A;  2JEB I;  2EQS A;  2PQA A;  1MJC A;  2FXQ A;  4LUZ A;  2CWA A;  2Q2U A;  2K4K A;  4DR7 L;  4A76 A;  3S2H H;  2VS1 A;  2AWO A;  2PNH A;  2HHH Q;  1KAW A;  4BY7 H;  4GOP B;  4A75 A;  3RLN A;  3AFP A;  3G6E A;  3T1H L;  4BXX G;  4DR3 Q;  1WCM G;  5JJI A;  3CCU A;  1YJN A;  3A5Z B;  1E24 A;  1SRU A;  1BBW A;  2YV5 A;  3OTO L;  1YIT A;  2YTY A;  4R4I A;  3CPW A;  3CQZ H;  1VQ8 A;  1IBK L;  2CWP A;  3GTG H;  4K0K Q;  1P16 A;  2AHO B;  2ZTD A;  4DV5 Q;  3CCJ A;  5K36 G;  3ERS X;  4JI2 L;  4LFC Q;  1SFO H;  5FJ8 G;  4C2M H;  2Y0S G;  4LFB Q;  1V1Q A;  1U0L A;  3I4N G;  4JI1 Q;  4AQY Q;  1N36 L;  4XTC S;  2CCZ A;  4H02 A;  3PUW A;  1RIP A;  2UUC Q;  3M85 A;  4A93 G;  3J81 c;  2A19 A;  5C0X G;  5ELN A;  4PZ6 A;  4HJA A;  1NTG A;  1N32 Q;  2B63 G;  2VUM G;  3I4M G;  4GKK Q;  2HHH L;  1UWV A;  2K14 A;  3JAM c;  1XNQ Q;  1X3G A;  1GVP A;  4DR4 Q;  2R92 G;  3KDF B;  4P73 A;  2V1C C;  2Q2H A;  2K50 A;  2QA4 A;  2LXJ A;  4HJ7 A;  2OQ0 A;  3RR5 A;  3GTQ H;  2R7Z G;  4WJ3 M;  3M7N A;  1IYJ B;  1JJG A;  1VQM A;  2IX1 A;  1Z9F A;  2PI2 E;  4PG3 A;  3W1G A;  1HNW L;  1I94 Q;  4LF9 L;  2OWO A;  1AH9 A;  3G71 A;  3HOU G;  3E9I A;  1A63 A;  4OWX B;  3J80 i;  3ULL A;  4DV5 L;  2JA6 H;  2JA7 H;  2OQK A;  3M4P A;  5C3E H;  1K8G A;  3FP9 A;  4LFC L;  1W2B A;  4UP8 A;  1HR0 W;  1PH9 A;  4JI7 Q;  3DM3 A;  4LFB L;  4JI6 Q;  4P71 A;  4AQY L;  4A3M H;  2UUB L;  2PMZ E;  1VQK A;  2A8V A;  2UUC L;  4DAM A;  3W1B A;  2ZTC A;  3AEV A;  1SN8 A;  1PH7 A;  2NZO A;  4GNX B;  2ATW A;  4PMW A;  1MKH A;  2JQO A;  2ZJQ A;  2K5H A;  2Y0S E;  2VQE Q;  1PYB A;  1QZH A;  1XNQ L;  3WWV A;  1X3F A;  2E5L Q;  4DR4 L;  3EBE A;  2LSS A;  3MXN B;  4A3I H;  4NB3 A;  3STB C;  1OXT A;  4KI0 A;  2NZH A;  2F4V Q;  4OX9 Q;  1LTL A;  3BU2 A;  3RLF A;  4L5S A;  5GAH C;  1JJC B;  4QGU A;  1PH6 A;  2UUA Q;  4IFD I;  3NEL A;  1I94 L;  4O2D A;  1O7I A;  1JB7 A;  2DGY A;  1NY4 A;  4LF5 Q;  2A1A A;  2R7F A;  4DKA C;  5IYD H;  1K0R A;  3ZJY C;  1XPR A;  1UE6 A;  1HNZ Q;  2F52 A;  5LMN Q;  1K3R A;  3K7U C;  1KQS A;  1PVO A;  2KHJ A;  4JI6 L;  1UE5 A;  2N3S A;  2NVX H;  3HKS A;  5JJL A;  1WFQ A;  4EX5 A;  3PV0 A;  5C0X I;  1CUK A;  2GVA A;  1YJ9 A;  5IE8 A;  1SR3 A;  2K52 A;  1Y14 B;  2IHF A;  2NVY H;  3HOY H;  3PO2 G;  4BBS H;  3F2C A;  3BZC A;  3ER0 A;  4TQU S;  4AYB G;  2VQE L;  3HOW H;  1LYL A;  1NMG A;  1SMX A;  2BH8 A;  3IRB A;  3A0J A;  2MFI A;  2AMC B;  2JA8 H;  4J15 A;  3S16 H;  4KHP L;  2OTJ A;  3U4V A;  1E1O A;  1LUZ A;  1N9W A;  4XIG S;  1QVF A;  4GOP C;  2NVQ H;  1VQ6 A;  1OXU A;  4L5R C;  1FVI A;  2BA1 A;  2BH2 A;  3MEF A;  5GAE C;  4IJL A;  3K7A H;  4GN3 B;  3L0O A;  4AH6 A;  2UUA L;  5ELO A;  2PQA B;  1KL9 A;  4MNO A;  1SLJ A;  1IBL Q;  3CP0 A;  1PFS A;  5C3E G;  1S40 A;  2JA6 G;  2ALY B;  1U5K A;  4HJ9 A;  1JT8 A;  5FLM H;  1BVS A;  2Q2I A;  3KJP A;  4LW1 A;  1JJ2 A;  4LF5 L;  3H3V H;  3ICE A;  2JEA I;  4A3M G;  4JOI A;  4DUZ L;  3JAM i;  1HNZ L;  1PH8 A;  4DV2 Q;  5LMN L;  1UEB A;  4DUY Q;  4A3K H;  2DUD A;  5BR8 Q;  2B29 A;  3VDY A;  1OXV A;  2WP8 J;  1K9M C;  2VZA A;  3HOZ H;  4A3J G;  3K80 C;  3RZO H;  1CKN A;  4LWC A;  1L0W A;  3CCR A;  1A8V A;  2VW9 A;  1AE2 A;  1VQG A;  4R4O A;  4R4Q A;  5LMU Q;  1XPU A;  4A3I G;  3CD6 A;  1EYG A;  5HY6 A;  4HIM A;  3DLL A;  1BKB A;  4X62 Q;  2UU9 Q;  3TRZ A;  3PSI A;  3KYH C;  5C4X H;  1N33 L;  4LF6 Q;  2OCE A;  4OWT B;  4AYB E;  3A5U A;  4IOA A;  4BBR H;  2K75 A;  1EIY B;  1EIF A;  5IYD G;  1YBY A;  2XGT A;  4C3J H;  1EOV A;  3S14 H;  1HH2 P;  3KOJ A;  3RZD H;  2UXD Q;  1Y1V G;  1C9O A;  3GD7 A;  4LF4 Q;  4IFD G;  3S2D H;  3H0G H;  1VQP A;  1IBM L;  4DUY L;  1NMF A;  4A3D H;  1SE8 A;  1OTC A;  1NBW A;  5BR8 L;  2JA5 H;  4PZ7 A;  3AYH B;  5AJ3 Q;  3HOY G;  3M4O H;  1TWC H;  4BBS G;  2NN6 G;  4AIM A;  3HFZ B;  1VQJ A;  1G6P A;  3HOW G;  2HT1 A;  5IP7 H;  4A3L H;  2CFM A;  5LMU L;  4B3M Q;  3KLW A;  2B3G A;  1C7Y A;  4A3B H;  3L7Z C;  1S3O A;  1OXS C;  1VQ7 A;  3ULJ A;  4GNX C;  1EUJ A;  2UXC Q;  4MZ9 A;  5C44 H;  3PO3 H;  4LUV A;  1L1O B;  2UU9 L;  4POF A;  2YTX A;  2I5L X;  1BBU A;  1HZC A;  3U50 C;  4LF6 L;  1CSP A;  4DR3 L;  2KCT A;  4R4C A;  4A3E H;  1VQI A;  4JI5 Q;  5JJK A;  2IX0 A;  2UXB Q;  5FLM G;  4C3H H;  4A3F H;  1NE3 A;  1D7Q A;  3KFU A;  4B3R Q;  1QZG A;  3S17 H;  4JBJ A;  2R6G A;  3I55 A;  1L2F A;  5IWA Q;  2WAQ G;  4HIO A;  4A3K G;  4B3T Q;  4K0K L;  1Q82 C;  2Z6K A;  4YCV A;  1L1O A;  1YEZ A;  4TVA B;  5C4J H;  1Q81 C;  1X55 A;  4L5Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...