1VQFA

Gene v protein mutant with val 35 replaced by ile 35 and ile 47 replaced by val 47 (v35i, i47v)
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
86
structure length
86
Chain Sequence
MIKVEIKPSQAQFTTRSGVSRQGKPYSLNEQLCYIDLGNEYPVLVKVTLDEGQPAYAPGLYTVHLSSFKVGQFGSLMIDRLRLVPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords GENE V PROTEIN
publication title Context dependence of mutational effects in a protein: the crystal structures of the V35I, I47V and V35I/I47V gene V protein core mutants.
pubmed doi rcsb
source organism Enterobacteria phage f1
total genus 10
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 1996-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02303 Phage_DNA_bind Helix-destabilising protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1vqfA00
2D62A 1VQ6A 4GOPC 3OYYA 1PH8A 3HOYH 1JJCB 1QUQB 4WJ4A 2CFMA 1Q81C 2JA8G 3CW2C 5IWAL 1K0RA 1P16A 4NXML 3H3VH 2OWOA 2UUCQ 4OX9Q 4L5SA 2PNHA 4DV2Q 5GAGC 1ASZA 3UE0A 3GTLH 3T1HL 4C2MH 4IO9A 4DR6L 4IFDG 2RHSB 1L0WA 3G71A 3K7AH 3ULJA 3U4VA 3CCSA 4DR1Q 4GNXC 1JB7A 2OQ0A 1HNZQ 2XTIA 3ER0A 1TWCH 3A5UA 3S24A 4A3MG 2VY3A 1K73C 2E2JH 2Z6KA 4POGA 3M4OH 3CC2A 4QJFA 5C0XG 4GOPA 2C35B 2YV5A 1NJIC 2VS1A 4JI5L 4LF5Q 5IP9H 2NVYH 2CCZA 2VNUD 3CPWA 3M4QA 2E5LL 3CC4A 1XNQQ 5JEAG 4R4IA 1UE7A 2ZTEA 4ME3A 5EAYA 3M7NA 1EUJA 4A3LG 3HOXH 2R92G 3M3YH 1EOVA 2Q2HA 1IBML 3GTQH 3S2DH 3HOZH 1X56A 4GNXA 3J80c 4DV5Q 1KIXA 1K8GA 4JV5L 4DR7L 1PHJA 1XNRL 1X3GA 3KYHC 4BY1G 2WB1G 4BY7G 2JQOA 4LWCA 3JAMi 5M3MH 1L2FA 4IFDI 4OONA 1VQCA 5IYCG 3RN5A 4DV6Q 4LFCQ 2WAQG 1XMQQ 3PCOB 2CWPA 2OQKA 3KJOA 3NENA 3PIPA 3TS2A 1HNWL 2Z0SA 5C0XI 1WFQA 1BBUA 2VQEL 1LUZA 3JC66 1QZGA 1YHQA 3HOVG 3FKIG 2AWOA 4BBRH 4JI7L 1GVPA 1EWIA 1EQRA 2N49A 1P8LA 2JA6G 2WB1E 1JT8A 1YEZA 1VQJA 1HNXL 4QIWE 4JI8Q 4LFAQ 4BA1I 3HOUG 2Q2UA 1C9OA 1D7QA 2ZM6L 1CKMA 3HOYG 4IOAA 2JA8H 1VQ9A 2IHEA 2Q2TA 4A3EH 1SFOH 2MO1A 3BZKA 1V43A 3EN2A 3CCRA 4YHHQ 2JEBI 1PH3A 1U0LA 1HR0W 4GS3A 4HIDA 3PO2H 5LMNL 4K0KQ 4LFBQ 4DUZQ 1GD7A 1NMFA 5HY6A 4APVA 3I55A 2PI2A 3J81c 4DUYL 5M3FH 1Q82C 2K14A 1JMCA 1Q12A 3STBD 1Y14B 2UU9L 4JYAL 1VQFA 3FP9A 3KF6A 1FVIA 3PSIA 3W1GA 3RN2A 4JC0A 4GN4B 2HIVA 5FJ8G 4A3MH 4DNIA 1GKHA 3U50C 1IBKQ 1YJWA 4JBWA 2GVAA 4P73A 4LF8L 1TWHH 1N8RC 1PH9A 4O2DA 1VQPA 2H5XA 5AJ3Q 4A3GG 3DM3A 2I5HA 3GO5A 1V9PA 2A1AA 3F2DA 4LF9L 3CQZH 1M90C 3S2HH 2Q2IA 4A3DG 1KRTA 1YVCA 3S1NH 1VCIA 1I94L 5C44G 1TWGH 1GO3E 4AIMA 3J7ZC 4LF4Q 4JCVE 4AH6A 1XMOL 2ZTCA 2BA1A 3J80i 5LMUL 2E2IH 1U5KA 4B3ML 3HOZG 4GKJQ 1LYLA 2PQAA 2VZAA 4GKKQ 4DPGA 4NXNQ 4YWKA 1MKHA 2KENA 4QL5A 5GQOA 2OTLA 4BY7H 1N33L 2VQFL 1JJGA 2HIXA 3JAMc 3S14H 3RNUA 1YI2A 1PYSB 2WP8J 2K75A 4A3FG 4DKAC 4JI2L 1Q46A 1YHAA 1J5EL 2AKWB 3S17H 4B3SL 1S3OA 1QVCA 1AH9A 1AE2A 1K83H 4IPCA 5IYDG 4DV7L 1B8AA 1QUQA 5GAHC 4LF7Q 4HIOA 2F4VL 3FKIH 3T1YQ 2EIFA 2D0OA 3F8TA 4X62Q 5FLXc 1TWAH 4BA2I 1N36Q 3GTPH 1J6QA 4X65Q 2IY5B 1XPUA 1UWVA 2B29A 1Q8KA 2ZJQA 5BR8L 1Z9FA 3HOUH 3UDXA 2RF4A 2HT1A 4A3KH 2DUDA 2HHHL 1HR0Q 3KLWA 1YNXA 3K80C 2N8NA 1I6HH 1XTDA 4A3EG 5E7NA 2V1CC 2YTYA 3D31A 4X64L 2MFIA 2I0QA 3PO2G 5JJLA 2OCEA 5IY0A 4DR4Q 3J81i 3WWVA 4GLVB 4DV4Q 1TWFH 2QEXA 2B63G 5M3FG 3GDEA 4TQUS 3F2CA 3CCEA 1X6OA 2RCNA 3ZJYC 1WOCA 5FJ8H 3GTKH 1ASYA 1S40A 1FJGQ 2PMZE 4AQYQ 1VQKA 2I5MX 5IP7G 2UUBQ 1N34Q 3S1RH 1UE5A 3GTOH 1G291 3I2ZA 2MNAA 2ES2A 5H1SE 1WI5A 4DR5L 2IHFA 2ASBA 4A3GH 1XNQL 3OTOL 4L5RC 1X55A 1VQAA 1KC8C 4KHPQ 1X65A 4A3DH 1FL0A 3PO3G 2FXQA 2YTVA 1QZHA 1BVSA 3RLOA 1E22A 1SE8A 1SROA 5C44H 2UUAL 4DV5L 3T1HQ 4DR6Q 3DLLA 1RIPA 2CKZB 3BZCA 3CC7A 5LMNW 3I4NH 4JI1L 1N9WA 4QGUA 2ZJPA 3TQYA 1V1QA 1WJJA 4WJ3M 1UEBA 5DLQE 3L2PA 4YCVA 4A3BG 4XTCS 4DR2L 1JJ2A 1PA6A 1OXXK 3GTJH 2YTXA 4JI3L 5IE8A 4A3FH 4DR3Q 2UXCQ 4YWMA 1UE6A 2E5LQ 3AQQA 1A8VA 3E9HA 3E9IA 4OO1G 5IYDH 1Q7YC 4IJHA 4OWXB 5GADC 2UXBQ 3RLNA 1NE3A 2K52A 1Q1BA 4A3CH 4JV5Q 2VUMH 2R7ZH 2UXDQ 4JI8L 5HGQA 3CMEA 2PI2E 3CPFA 1RL2A 1XNRQ 1E7ZA 1PH4A 2WAQE 4A3IH 3LGJA 2NN6G 4A3KG 2K5NA 1L1OB 3A74A 4UPAA 4DV0Q 2BH2A 4IPDA 1UE1A 5M5YH 4YHHL 4K0KL 4GNXB 5M5WH 4BBSG 3STBC 2Y0SG 4EX5A 4DUZL 1IBLQ 4JI4Q 4LUOA 1HNWQ 4IJLA 1TXYA 3HOWG 3D0FA 4A75A 1Y1VG 3SGIA 2VQEQ 2ZTDA 2B63H 1EIFA 4JOIC 1E3PA 3S15H 2JJQA 3G6EA 4JI7Q 4JI6Q 4PZ7A 1CSQA 1VQOA 5C3EG 1N32L 4L5QA 1IZ6A 4XIGS 3CF5A 1WCMG 3HKSA 4OO1I 1SN8A 1KAWA 5IP7H 4DV1L 3KOJA 5C4JH 1HNXQ 2NVXH 1KXLA 1BKBA 4NB3A 3HKZG 2MQHA 1Q1EA 4X66L 4Y7NH 1T9HA 4OWTB 1E24A 4HJ7A 3PO3H 4B3RQ 1E1OA 4MNOA 3L7ZC 4LF4L 5LMNQ 5J3BA 3UDIA 3RZDH 5IT9c 4B3TL 4DUYQ 1PVOA 3CMAA 1KD1C 2UU9Q 3I4NG 1A63A 4JYAQ 4R1JA 1PH6A 4UP9A 4HJ5A 4A76A 3K7UC 2JA9A 4OWWB 1PH5A 1OXSC 4LF6Q 2BH8A 5FLMG 2R93H 4P72A 4A3BH 3H15A 4LF8Q 2I5LX 1SRUA 4Y52H 3PUYA 2VW9A 2A19A 4LW1A 3K0XA 3CCLA 1I5FA 2N78A 4R4TA 4GLXA 1O7IA 3ICEA 2K4KA 1CUKA 3VDYA 1LM0A 4LNQA 1HZBA 3AEVA 1FGUA 1Z47A 4FDBA 1SR3A 3RLFA 3CCJA 3T1YL 1S72A 1PH1A 1NMGA 1NY4A 3UDGA 1I94Q 1VQLA 3KFUA 1VQ5A 4GLAC 4JG2A 2KHIA 4P74A 2AHOB 4UP8A 4X65L 4R4QA 4IOCA 1XMOQ 1X9NA 1N36L 3I7FA 4IPHA 2VUMG 3RZOH 4A3CG 4YY3Q 1XPRA 2R7ZG 4A3JG 2NZHA 1LTLA 1Q86C 1OTCA 1YHBA 3RR5A 1GM5A 1SLJA 2GN5A 3AFQA 4A3IG 1VQIA 4PG3A 3F2BA 1N33Q 2VQFQ 5JJKA 1CKNB 4UP7A 2OTJA 4UY8C 4IPGA 1I50H 4JBJA 4KHZA 3M4PA 1HZ9A 4KI0A 2L15A 2UUCL 4OX9L 2JA5H 4JBKA 4DV2L 3HFZB 4BBSH 1VQHA 4JI0Q 1VQDA 4B3SQ 4DV4L 1H95A 3F1ZA 3PF5A 1IYJB 1X54A 1Y1WH 3HOWH 1Y1VH 2DGYA 4DV7Q 2JA7H 4YWLA 4QQBX 2F4VQ 1QVFA 3KDFB 4HIMA 4DR1L 3ULLA 1HNZL 1AE3A 4DV3Q 5C3EH 4AQYL 3K81C 2ZJRA 2K5VA 2R6GA 3CXCA 1WCMH 1K3RA 5C4XG 1N34L 4B3MQ 3NBHB 2AMCB 5BR8Q 1JE5A 1W2BA 1G51A 4DAMA 3CCQA 2D0PA 2HHHQ 3W1BA 1PV4A 3CP0A 4KHPL 3L0OA 4AYBG 5IWAQ 4JBMA 4H02A 2QGQA 4NXMQ 2WFWA 4X64Q 3EIVA 3S1MH 1VQMA 2IT1A 3TREA 1L1OC 1PFSA 2N3SA 4X6AH 1EYGA 4EQ5A 4DK3C 1HZCA 2NZOA 3S1QH 5FLMH 4TVAB 1CSPA 2R93G 2E8GA 3EBEA 2B3GA 3PGZA 4LFCL 4DV6L 1SMXA 3BU2A 4GN5A 4J15A 1XMQL 1KRSA 2BA0A 1K8AC 4JI5Q 4DR3L 2UXCL 4P75A 4AYBE 1NBWA 1CKOA 4DR5Q 4HIKA 3OTOQ 4POFA 1A0IA 3U58A 3H0GH 2UXBL 1L1OA 2R7FA 3CCVA 3E0EA 3PUZA 4GOPB 1X3EA 4KLKA 2UUAQ 2A8VA 1IBMQ 1C0AA 3J81j 2UXDL 3GD7A 4R4OA 4JI1Q 1VQNA 3I4MG 4A3JH 2GVBA 1XPOA 5ELOA 4LFAL 2QA4A 3PIOA 2JK8A 2IX0A 3TRZA 2LXKA 4DV0L 4DR2Q 2CQOA 1KQSA 3KF8B 3GTGH 3B6YA 1A62A 2ALYB 1D8LA 2JA5G 4JI3Q 1IBLL 4JI4L 1G6PA 4PZ6A 3I4OA 1B7YB 3UDFA 4LFBL 4PZ8A 4LUZA 2K5HA 4BXXG 4NPSA 1Y1WG 1NTGA 2F52A 5GROA 2JA7G 4ALPA 4JI6L 3AFPA 5IYBH 1R9TH 2R7DA 2KHJA 2AWNA 3G48A 3MEFA 1X3FA 1IBKL 1PYBA 4A93H 3GTMH 1BBWA 5C4XH 3S16H 3AYHB 2NVTH 5AJ3L 3ULPA 1YJNA 2YU9H 1KHIA 4DK6C 1YIJA 2ZM6Q 4C3HH 1VQGA 4P71A 3KJPA 3NEMA 2Y0SE 1I3QH 1OXTA 4B3RL 3ERSX 4RMFA 4R4CA 1B70B 1HJPA 4GN3B 3CCMA 3U4ZA 1EFWA 2EQSA 2KCMA 2NN6I 4JOIA 3NELA 4LF5L 5JJIA 1W3SA 4YCWA 4HJ9A 4PMWA 2JE6I 2KCTA 2ATWA 4GKJL 4A4IA 4GKKL 3PF4A 4NXNL 3PUWA 3TS0A 4LF6L 1N32Q 3CAMA 1VQ8A 3M9BA 4IFDJ 1VQBA 3HKZE 3UE1A 1PH7A 4DV1Q 1HZAA 3OW2A 1DGSA 1YBYA 5IP9G 3M85A 1QVGA 1XJVA 2VL6A 5M5XH 2LXJA 3Q8DA 4X66Q 1IL2A 1M1KC 3CD6A 3KF6B 4YCUA 4DAYB 5C0XJ 1MIUA 2HQLA 4OXPA 5ELNA 1OXUA 3BJUA 4LF9Q 4LF7L 1CKNA 2YYZA 3H0GG 4A3LH 3W5OA 4HJ8A 3HOXG 2MO0A 2R92H 4X62L 2K50A 4B3TQ 1OXVA 2F3IA 2EXDA 5JEAJ 3PUXA 1K9MC 1VS0A 4QY7A 5LMUQ 4YY3L 3H3VI 2IX1A 3I4MH 3G4SA 4HJAA 1EIYB 2ID0A 4BY1H 1PH2A 4O0AA 3FHWA 1VQEA 2JEAI 2XGTA 5M3MG 3TEHB 4MTNA 1E1TA 3KDFA 4C3IH 1HR0L 5IYCH 5K36G 1MJEA 1YITA 4C3JH 3A5ZB 1IXRA 1VQ7A 4MZ9A 4JI0L 4JI2Q 2LSSA 1YZ6A 1J5EQ 1MJCA 4DR4L 1HH2P 2PQAB 3MXNB 1C7YA 4BXXH 3HOVH 4BBRG 2KBNA 4LUVA 4RG1A 1KL9A 3CCUA 3PUVA 3IRBA 4DV3L 3PV0A 5IYBG 5GAEC 3K8AA 2RHQB 1VQ4A 2JA6H 4DR7Q 1FJGL 1YJ9A 2NVQH 1EQQA 3J7A5 2E2HH 3A0JA 4L5TA 4A93G 2UUBL 2Z6KC 1WYDA 2CWAA 3I56A
chains in the Genus database with same CATH superfamily
1VQ6A 3OYYA 1E2VA 2RSNA 4WJ4A 3HKZB 4DAPA 2JA8G 1TT2A 1LT4D 4BS9A 4OELB 3AU7A 4DV2Q 1ASZA 3GTLH 3BVGA 4IO9A 4DR6L 2KECA 2RHSB 3TSSA 4B9WA 3K7AH 1ZKOA 3ULJA 1O7YA 3DWQA 3CCSA 4DR1Q 1JB7A 2CVRA 3ER0A 1K73C 1CFMA 3FEWX 1A3TA 5C0XG 4GOPA 2C35B 2IW3A 1KLGD 2J0TD 5CV8A 5D14A 2MP1A 5A35A 5JEAG 4IUQA 2R61A 3M7NA 4KJOA 3OHXC 4A3LG 4DXGA 3KF8A 3GTQH 4QCLA 5LL6X 2SNSA 1LLRD 4XT3B 3KYHC 4BY1G 2HQEA 1B9MA 2ZXRA 4LK1C 4BY7G 2R7ZB 1F2YA 4A3JB 1L2FA 4C3IG 4OONA 4I7ZC 4LFCQ 2OQKA 3NENA 1B44D 2J4XA 1ZYRC 1LUZA 3JC66 3LWEA 1QZGA 3HOVG 3N52A 4BBRH 4JI7L 2AQ1B 2N49A 4ZYSA 5T1IA 4KKTA 1HNXL 2VXWA 4QIWE 3SHLA 4BA1I 1QNUA 2Q2UA 1C9OA 1CKMA 3HOYG 1SNDA 2G5DA 2IHEA 1VQ9A 2Q2TA 4RHSA 3VA5A 3CCRA 4YHHQ 3PO2H 1RDPD 3DWAA 1V8QA 1B3AA 4DUZQ 5HY6A 4DUYL 1JMCA 5M3FH 2FMMA 1Q12A 3NSWA 1FVIA 5CV6A 2WINB 1FGBD 4GN4B 4K5VA 4A3MH 4DNIA 1GKHA 1IBKQ 4P73A 2EDGA 1F2ZA 4XDXA 1PH9A 2H5XA 5D65A 5AJ3Q 2B2VC 4A3GG 3DM3A 2LKVA 5BN3A 3OWEB 2Q2IA 3NQTA 3I8ZA 4DK1A 1BCPC 1VCIA 1I94L 4WFN3 1GO3E 4QUCA 2WV6D 3J7ZC 2O5JC 1UUPA 1U5KA 4GKJQ 1A3VA 1HQMC 4NXNQ 1MKHA 3QIAA 1WTHA 2F0GA 3M4YA 4EQNA 2HIXA 3FPPA 2ZXPA 3WOFA 1AW7A 4A3FG 1RHPA 2B2YA 2AKWB 1NR2A 5KGUA 1K83H 5IYDG 3RD4A 5FO9B 2F4VL 3FKIH 3EQLC 2B2UC 2D0OA 4X62Q 5FLXc 4LMQD 1N36Q 4X65Q 5ISRA 1XPUA 2CH4W 1JWMD 2F3WA 3R2TA 1LT5D 4A3KH 2WACA 5FLXL 1HR0Q 3AMUA 3K80C 2EYJA 4QUFA 2XSCA 3D31A 1TKWB 3J80E 4KY6A 3EFXD 3J81i 3WWVA 4HCSA 2QEXA 4P2CB 2E74C 4C1NK 1CHQD 2F0MA 2RCNA 1FNVA 1WOCA 3BYYB 5K5PA 3PIO3 1FJGQ 2PMZE 1RF2D 4H0LC 2LY7A 2NYZD 1TWCB 2I5MX 5IP7G 1VQKA 1SYGA 1UE5A 5H1SE 4DR5L 1EZ6A 1VQAA 5ELEA 4A3DH 4KD3A 2YTVA 2FJ2A 1BVSA 1E22A 1SE8A 1D6EC 3H0GB 3T1HQ 1RIPA 3CC7A 4JI1L 2D9UA 3TQYA 2D5DA 3L2PA 2QDBA 4YCVA 3M7GA 2EJGC 1LT6D 3T13A 1V1OA 2Q8TA 3NK9A 3GTJH 4DR3Q 4YWMA 1A6XA 1QNKA 3K58A 3OIPA 3E9HA 3J7AF 1D1IA 1LTID 1NCVA 5GADC 4X3UA 1MBYA 4K8JA 3RLNA 3SVMA 4BWGB 1PTOB 4A3CH 2R7ZH 3CMEA 1PH4A 4A3IH 5I9OA 1L1OB 4DV0Q 1LV9A 1GUOA 4FXDA 4KJNA 1HNWQ 4OGQC 1TU2B 3D0FA 3SGIA 1TIID 4PMCA 2VQEQ 2B63H 1KDCA 1E3PA 4N9TA 2JJQA 3G6EA 3VR3A 3JAME 1Q3LA 1N32L 5C3EG 3CF5A 3DMUA 3HKSA 4OO1I 1BKBA 4ABNA 1MSHA 1EU3A 4OEMB 1Q1EA 1NAPA 4OWTB 3S2HB 5E4XA 4LF4L 2TMPA 5J3BA 3UDIA 3TP6A 3BVMA 4B3TL 2UU9Q 4ZRZA 4JYAQ 5JAVA 2BH8A 1EYCA 1PRTB 2KA7A 4LF8Q 4I7AA 1I4QA 5FO8B 1PXUA 5CR3A 2WAQB 3K6OA 2KVMA 3AEVA 1FGUA 1S72A 4OO1H 1SR3A 5FKAC 1VQ5A 1XMOQ 4DR7L 1JOKA 2PNRC 3IAYA 1TWAB 3TBIB 1Q86C 3GTPB 2K32A 2DY8A 2RDFA 1IW7D 3AFQA 4PG3A 2NN6H 1CKNB 4JBJA 4RH6A 4K8IA 1HZ9A 1SDFA 2L15A 2JSOA 1I6HB 1STEA 3HFZB 4B08A 4BBSH 1EYDA 4B3SQ 4DV4L 3SXHA 1IYJB 3OPOA 1Y1VH 2DGYA 4DV7Q 3KDFB 4HIMA 5DM73 1LTBD 4RAUC 4AQYL 2XWJB 4KMUC 2ZJRA 1AZQA 2DJGC 2F0TA 3GTKB 3KUPA 1M8AA 4DAMA 3S1RB 1V1PB 3W1BA 2HHHQ 1PV4A 5J1ZA 3L0OA 4AYBG 4X3TA 4X64Q 1H9KA 4N8FA 1WTXA 1VQMA 2IT1A 5I4DA 1HHVA 4X6AH 3FRPB 2F0FA 1LTGD 4G7OC 5FLMH 3A56A 1SMXA 4GN5A 1XMQL 2UXCL 1KLUD 1CKOA 4IUUA 4HIKA 1KABA 3I70A 1ENCA 4N9PA 3U58A 3H0GH 1L1OA 1EL0A 2UUAQ 4R4OA 3I4MG 1EYAA 2HD3A 1RTNA 4EGVA 1YNND 3EA6A 1DOMA 2HCIA 5K36H 4Q5VA 2NB0A 3TMEA 1G6PA 1A62A 2F0HA 5LL6S 4JI4L 2HCCA 5ELDA 4S3SA 1Y1WG 5GROA 3IL8A 3MFYA 4JI6L 5IYBH 5I6YA 2R7DA 1PYBA 1BBWA 1DCZA 3AYHB 1YJNA 3MWYW 3QJYA 1VQGA 2B2TA 1Z7TA 3KBGA 4B3RL 1EY7A 4R4CA 4GN3B 2BCOA 2Z6BA 3OMGA 3CCMA 1EFWA 2QEJC 3PO3B 3C1FA 1SE3A 4YCWA 1J8IA 4GKKL 2E2IB 3PUWA 5IGDA 4LF6L 3HRZC 3KLRA 2L5TA 2QKIC 3UE1A 4DV1Q 3OW2A 2OF1A 3Q23A 1XJVA 2RVLA 2LXJA 4X66Q 3Q6SA 3MXGA 4DAYB 4OXPA 5ELNA 1OXUA 2FFKB 3W2DA 1LO5D 3S17B 1CKNA 2YYZA 2K01A 4RCOA 4HJ8A 2MO0A 2K50A 1IW7C 1K28A 1L0XB 1VS0A 3S9WA 4YY3L 1WVLA 1EIYB 1SEBD 1VQEA 5EKLA 1BNZA 3KDFA 3VR4A 4FNFA 4JI2Q 2XIWA 1S4ZA 1YZ6A 4DR4L 1R4QB 1HH2P 2PQAB 1KTKA 4BXXH 2FMCA 4BBRG 1EQTA 1EY4A 3PV0A 2QILA 3A7AB 3K8AA 1VMPA 3A0JA 1PDQA 2UUBL 1GUTA 2JN4A 1WCMB 4K2KA 4GOPC 1JJCB 2VB2X 1Q81C 3GTOB 3CW2C 5KEEA 2OWOA 4OX9Q 3CKIB 5GAGC 3UE0A 2CQAA 2EYHA 1ILQA 1VDZA 3S1MB 2XNAC 1I4HA 1RCVD 3G71A 3O13A 1B2TA 2OQ0A 3I4NB 3A5UA 4A3MG 4KV6A 4POGA 2Z6KA 4J6HA 3CC2A 3ND8A 4CDFC 2VS1A 3S1QB 4JI5L 5IP9H 2PZWA 2VNUD 3CRKC 1Y8NB 1IKMA 2E5LL 3SE0A 2NTSA 4JK1C 2ZTEA 5EAYA 1MSGA 3IKJA 2LFNA 1G2SA 1EOVA 1X3QA 4LAAA 1IBML 3BG3A 2BDOA 2FHTA 4GNXA 3A8JE 1BOSA 3TZUA 1YNNC 4KHVA 1XNRL 2EY6A 3OMCA 2WB1G 1C48A 2VUMB 4LWCA 5M3MH 4XYOA 4IFDI 1VQCA 5IYCG 4DV6Q 1CT1D 2OXPA 3PCOB 4XT1B 4PV1C 4DAVA 4TRDA 2F0IA 1IYUA 2DNEA 4CBVA 1WFQA 4R9WA 3GQBA 3I72A 1U4LA 3FKIG 4ZCKA 4CHTB 1A15A 3S15B 2JA6G 2RSOA 1R9TB 5DM63 1XWEA 4JI8Q 4LFAQ 2F0EA 4C1NI 1SNOA 2M00A 5C4XB 2ZM6L 4K5XA 5C4JB 4IOAA 2ICIA 1TS4A 4A3EH 4Y7NB 3BZKA 1V43A 3EN2A 5G3LD 2JEBI 2XWBB 1GD7A 4APVA 2PI2A 3RZDB 1RJTA 1VQFA 1TS3A 3RN2A 4JC0A 1EWHA 2HIVA 5JOBA 4JBWA 2GVAA 1IKLA 4JVZA 1TWHH 2X69A 3A8IE 5EPKA 1L0YB 2I5HA 4LF9L 2B2YC 4A3DG 2P5ZX 1JWUD 4Z9CB 1EIHA 3V2TA 3VYUA 4JCVE 4PNYA 2E2IH 3HOZG 5LMUL 4HN7A 2PZTA 2PQAA 1O7LA 2VZAA 4DGZA 2NZ1D 2SDFA 2IX3A 1N33L 3SK6A 2F4IA 1J5EL 2C9OA 3S17H 1S3OA 1QVCA 2JA5B 4ME5A 1F9SA 1B8AA 3LX0A 4HIOA 1XTCD 4RHRA 1HXYD 3J7YW 5IGFA 1J6QA 1UWVA 2JA6B 2JYOA 2ZJQA 5BR8L 2E2HB 3NPPA 3HOUH 3M3YB 2DUDA 1NUCA 1GUSA 3P1HA 5E7NA 2Z4IA 2I0QA 3L9AX 2OCEA 5IY0A 4I65A 4UDUC 1Y69U 2B63G 2KQ3A 2L12A 5EJWA 3F2CA 3CCEA 1QB5D 1X6OA 1W6KA 3I73A 5FJ8H 1CK1A 4XYQA 2PYKA 4JPBW 2E2JB 2N55A 4PMBA 3GTOH 3I2ZA 3DEOA 1HQRD 1QE6A 3SK4A 3OTOL 3HZXA 1X55A 3MA2B 1KC8C 5C4ZA 4KHPQ 1I4PA 1B53A 1PTOD 1QZHA 5C44H 1PMRA 3BDOA 4DR6Q 2CKZB 3I4NH 3BZCA 3HOXB 4EVOA 1LABA 1N9WA 1K0SA 3I90A 4IQZA 1V1QA 1EFID 2E75C 4DR2L 1FD7D 2KCCA 1PYWD 5LHY1 1JJ2A 1EIGA 1OXXK 4JI3L 5IE8A 3J81E 1SYBA 1UE6A 2NTTA 3GTGB 1A8VA 2C5CA 4F88A 4OO1G 4G4KA 4C56C 4OWXB 2K5DA 3X3MA 1NE3A 4DXFA 1XXGA 2VUMH 2HUGA 2UXDQ 4XQJA 2X6LA 2PI2E 1JOOA 2NN6G 1BCPF 3OW7A 1MD2D 4IPDA 2RDHA 4YHHL 5M5YH 3MXUA 2JA8B 4BBSG 1IBLQ 5M9OA 4DUZL 1I3QB 1KNAA 4LUOA 1SFOB 1Y1VG 2ZTDA 3S15H 1VF7A 1PRTD 4JI7Q 2ENBA 1S5CD 1IZ6A 2PQEA 1BF4A 4FVMA 5C4JH 1HNXQ 2NVXH 5F2DA 3DUZA 4ODGA 2MQHA 3DM1A 4Y7NH 5KNDA 1E24A 1UAPA 1E1OA 4CDCC 4MNOA 3NTIA 3RZDH 5EBDA 5IT9c 2K04A 4DUYQ 1TWGB 4ILWA 1PH6A 4UP9A 1GUGA 4HJ5A 1PZJD 2JA9A 3QR8A 4L8JA 5FLMG 1ET9A 2R93H 4P72A 5IT9L 4BY1B 4A3BH 4BY7B 2G9HD 1QG7A 2VW9A 1KDBA 4C3IB 3CCLA 4GLXA 1O7IA 2O2LD 1H9RA 1CUKA 2EOTA 4K5WA 5EPLA 1Z47A 1NMGA 1I94Q 1Q90A 1STNA 1VQLA 1PZKD 3HOVB 2DN8A 4JG2A 4FXGC 2LS01 2AHOB 4X65L 1N36L 4IPHA 3FDTA 1CQFA 5KIXA 1LTLA 1OTCA 2B8GA 4H13C 3RR5A 2NVQB 5JJKA 4B9XA 1VQIA 4HSPA 4RKBA 3TP8A 2K1BA 3HOYB 1HTPA 2UUCL 2ZT9C 1HPCA 2JA5H 4JBKA 2QCPX 4JI0Q 4V190 4DA2A 2CW0D 3PF5A 3HOWH 2F4VQ 1JE4A 3VR6A 4F8MA 1HNZL 1LT3D 1TVXA 2R6GA 3E3XA 3K5NA 1DOKA 4G7HC 1KNEA 3NBHB 2AMCB 3M4OB 1IYVA 5ELBA 1JICA 4RWSC 1PTOC 2NVYB 4R8IA 4A3GB 1G8ZD 5IWAQ 4H02A 2QGQA 4NXMQ 4RGOS 3TREA 3FPUB 1L1OC 1PFSA 2N3SA 2QW7A 4ZLTF 3URYA 1CSPA 4FYDA 2E8GA 2B3GA 2A68D 3PGZA 3BU2A 3BVZA 2HDLA 2BA0A 4DR3L 4P75A 4DR5Q 4A3FB 4POFA 5T1GA 5CORA 4DFAA 1JR0D 2OT2A 3MC0B 1CHPD 1WD1A 2A8VA 3E0EA 3K5MA 1X3EA 5ELCA 4KK7A 4JI1Q 4A3JH 2GVBA 1XPOA 4J8QA 5ELOA 2QA4A 1BXTA 2JK8A 2EPBA 4HMIA 3TRZA 4DV0L 1ENFA 1UEAB 2B2WC 1KQSA 3GTGH 2B2TC 1GHKA 1PZID 4PZ6A 3I4OA 1WD0A 4LFBL 1PRTC 4PZ8A 3K5LA 4LUZA 2K5HA 4BXXG 4NPSA 1TY0A 4QF4A 5D3IB 2JA7G 2K28A 4NDXA 1X3FA 1GHJA 2PPBC 3D4WA 3D6CA 4J1MA 2A69D 3ULPA 4P71A 3VR5A 4CDDC 3KJPA 1AP0A 2Y0SE 4IZ8A 1I3QH 3P7JA 4F87A 4RMFA 1KAAA 1LTRD 3CQZB 1D1KA 2NN6I 4LF5L 3NELA 3S1NB 2ATWA 2JE6I 2KCTA 3PF4A 1G91A 1RKNA 4LJZC 1N32Q 1I6VC 3DEPA 4KKUA 2KEDA 3HKZE 5BN4A 2MHVA 5C0XH 4DF7A 4IFDJ 3C1EA 1PH7A 4M8AA 1HZAA 5IP9G 3X3NA 3M85A 3H91A 3DWPA 2VL6A 3CD6A 3Q8DA 3T16A 1IL2A 5JEAH 3KF6B 4YCUA 1I4RA 1E2ZA 2TSSA 4LF7L 4A3LH 4K14A 3W5OA 2XN9C 3HS0C 4B3TQ 1OXVA 1K9MC 2EXDA 3R93A 2E76C 1CTMA 2ID0A 3T4AC 4BY1H 3RZOB 2WIIB 5M3MG 3TEHB 4OIKA 4C3IH 1HRJA 3MEHA 1PLFA 1ESFA 1NNXA 1SBBB 2CW0C 1IXRA 1I50B 1S5BD 3MXNB 3U9SA 3T51B 1MI2A 3HOVH 1EY9A 4RG1A 1TWFB 3H09A 3CU7A 2RHQB 4DR7Q 2NVQH 1EQQA 5EQ0A 5JPMC 5C3EB 5KRUA 4A93G 2Z6KC 3I56A 2D62A 1F2LA 1ZXTA 3HOYH 1QUQB 2WKDA 4C3HG 2CFMA 1K0RA 1P16A 2KEEA 1CM9A 1QJOA 2PNHA 5IIFA 5JJZA 2CH4A 4IFDG 2FINB 3MHBA 2XRSD 4GNXC 2A68C 2OTJA 2XTIA 1TWCH 2VY3A 3M4OH 4QJFA 1F9QA 1NJIC 4MTKA 3FMCA 3SR1A 2MGSA 5C4HA 1DZ1A 2NVYH 3CPWA 1HFGA 3M4QA 3CC4A 3P20A 1XNQQ 4MHEA 4R4IA 1UE7A 4ME3A 3IFDA 2L55A 1EUJA 3VYRA 1EWCA 2R92G 1X56A 5FO7B 1K8GA 3J80c 4DV5Q 4JV5L 1SNQA 2D2CC 2JQOA 4KTAA 3JAMi 5EPJA 2Z1CA 2H4OA 3J80L 1XMQQ 1SYDA 4C3JG 2EYLA 4ULLA 1Z6HA 2KOLA 2B8FA 3Q24A 3MFGA 2QF7A 5C5MA 2Z0SA 5M5WB 4U68A 5E1FA 5A2QE 2AQ3B 1GVPA 1EQRA 1PTOH 5IOCA 1P8LA 2SOBA 2A69C 1JT8A 4CKEA 4QMGA 4MN3A 3NWSA 3HOUG 3GTMB 2B2WA 2NVTB 3NTHA 5FOBB 4C3HB 1SJED 1PH3A 2RQXA 1F77A 1E0BA 4GS3A 4K0KQ 5LMNL 4AYBB 4IALA 2K14A 1Y14B 1HA6A 4HTHA 5HURA 5JVG3 3KF6A 4RGNA 3D4RA 5FJ8G 1IHZA 4X3KA 2L11A 3V05A 3VYTA 1N8RC 4UHVA 1F9PA 2A6ED 1VQPA 1ICWA 3KK7A 3GO5A 1V9PA 2A1AA 3F2DA 3CQZH 3G7LA 3S2HH 1YVCA 3S1NH 5C44G 1H9MA 4AH6A 4B3ML 2ZTCA 1EQVA 4OHJA 1TS5A 3MXNA 4GKKQ 4YWKA 1STBA 2OTLA 4QL5A 5GQOA 3I4MB 4QB4A 3KLSX 2VQFL 1JJGA 2AQ2B 1HFNA 3JAMc 2K03A 3IFTA 1DOLA 3RNUA 1YI2A 1PYSB 2WP8J 4QIWB 2K75A 5JPNC 4JI2L 5COYA 4C3JB 1AH9A 1AE2A 3E5SA 4IPCA 3JAML 1QUQA 2JP1A 5GAHC 1V1PA 3T1YQ 1Y1WB 3LWUA 2EIFA 3TZDA 5BN5A 1B9NA 2Q8IB 4HMJA 1TWAH 3GTPH 2L1BA 3D4DA 2IY5B 3NBIA 2B29A 1K8OA 1Q8KA 2J7ZA 4L63B 3QWNA 1SAPA 2RF4A 1YNXA 1I6HH 2SNMA 2V1CC 2YTYA 5JJLA 3PO2G 4DR4Q 1XX8A 4ZAIA 1TWFH 5M3FG 4G7ZC 3GTLB 1WTPA 1FNUA 3NWTA 4CKCA 3OWFA 3K7AB 1SNMA 3GTKH 1ASYA 1JQYD 2UUBQ 1FR3A 5DNFA 1N34Q 3S1RH 2ES2A 1GUNA 2ASBA 2BOSA 2EY2A 4L5RC 1X65A 2FXQA 1EY6A 3RLOA 2EVBA 1CA6A 4MIUA 1SXTA 3DLLA 5LMNW 5D3DA 4QGUA 3GTQB 3A54A 4WJ3M 3SEBA 4CDEC 5DLQE 4A3BG 4FP5D 3CRLC 4XTCS 3EJIA 1PA6A 2BDNA 1TQOA 2E5LQ 3AQQA 4NMZA 4M1UB 3NUCA 5IODA 1Q7YC 4IJHA 5J39A 1TY2A 2UXBQ 1GJXA 4BBRB 1CZGA 1Q1BA 5I2YA 1PFBA 4JI8L 5HGQA 1XNRQ 1RL2A 2WAQE 4ZKBB 4A3KG 2PMZB 3A74A 4IN3A 4KY7A 3NE5B 5M5WH 3ONAB 2Y0SG 5ELFA 4RFBA 3HOWG 4A75A 4HAEA 1EIFA 1U4RA 5I6WA 5M3FB 4DAYA 1CSQA 4L5QA 2A6EC 5I2XA 1SN8A 1KAWA 3UI2A 4A3MB 3HKZG 2VB3X 3H6MA 1EY8A 4RGMA 4DK0A 2XRQD 5FLXE 1B50A 1QCBD 3PO3H 1DD2A 3L7ZC 5CMDA 2PW7A 1A2UA 4K6LA 3CMAA 1KD1C 2IJ0A 5L37A 1JC7A 4A76A 3K7UC 4IUPA 1PH5A 1OXSC 1M4VA 1X32A 4ID6A 3H3VC 4Y52H 2I5LX 2F0LA 2WB1B 1F2MA 3PUYA 2DNCA 2A19A 5CV7A 2N78A 2K4KA 4FF2A 1JCKB 1HZBA 3CCJA 4FDBA 1PH1A 1K83B 4G57A 4O1NA 3UDGA 3ND9A 3KFUA 1EEID 4GLAC 4UP8A 2EY1A 2KHIA 3FKIB 3WOEA 2EE1A 4R4QA 4A3CG 3I7FA 2X6GA 2R7ZG 4A3JG 1O7ZA 4F7XA 1PFNA 1GM5A 1SLJA 5HGTA 2GN5A 2JXMB 4A3IG 3F2BA 1N33Q 2L0CA 3OSOA 4KHZA 1D5MC 3M4PA 4KI0A 4DV2L 5AFWA 1VQHA 1VQDA 1H95A 3F1ZA 1X54A 1Y1WH 3BDCA 4QQBX 4YWLA 4ZK9B 2GA4B 4H7BA 1QVFA 4C2MB 4DR1L 2I46A 3ULLA 1AE3A 3R8BA 4DV3Q 1T5EA 4XXEA 2K5VA 3QG1A 1SNPA 1WCMH 1K3RA 1F9RA 4KN7C 5CV4A 2NUCA 5EGTA 5BR8Q 2F0PA 1G51A 3CCQA 2D0PA 3CP0A 4KHPL 2XVSA 4JBMA 2WFWA 3EIVA 3S1MH 1NR4A 3QB3A 4A3DB 1X3PA 3RMHA 5G3LF 3S2DB 3HOZB 2RA4A 5C3XA 1D2BA 1HZCA 4WORA 3S1QH 4TVAB 4LFCL 1KRSA 2ICEC 1QWYA 3A7LA 4AYBE 5FK9C 1D5ZC 2F3VA 3GTJB 3J7AV 1SSOA 3OTOQ 3D3RA 1A0IA 4HSVA 4TSSA 1B3QA 1S5ED 3AB9A 2R7FA 3CCVA 3PUZA 4KLKA 3I3CA 3BS1A 2F1MA 3J81j 2UXDL 1TS2A 3HG9A 1SYCA 2LXKA 4DR2Q 4A3IB 4ZUJA 1B4OA 3B6YA 3NP8A 4JI3Q 3E6ZX 1IBLL 5IGGA 4EQOA 2F52A 4ALPA 2B63B 2PZUA 1R9TH 4HR7B 3VYSA 2AWNA 4Q0FA 1IBKL 1U4PA 2O4XA 5C4XH 5AJ3L 1KDAA 1KHIA 3NHHA 3MTSA 3NEMA 3TP7A 1OXTA 1AEXA 1NSNS 1CI3M 1ZEQX 2EQSA 2EYMA 2H1EA 5KYIA 4GKJL 4HJ9A 4PMWA 4O42A 4A4IA 4NXNL 3CAMA 1VQ8A 3M9BA 1DXMA 4FF4A 4DN4M 3SDZA 1DGSA 1HUNA 3S14B 1JOQA 1SYEA 1UNSA 1MIUA 4XQQA 3BJUA 4ZQ3A 3H0GG 2A6HD 4X62L 2Z8LA 3PUXA 3H3VI 1GOZA 3TN2A 2N88A 1PTOF 3G4SA 3ERQA 1PH2A 2F0NA 5EBCA 2XGTA 2BE5D 2R3ZA 1HR0L 5IYCH 5K36G 1YITA 1A2TA 1JWSD 4N8X1 3A5ZB 1VQ7A 4MZ9A 4JI0L 3N6RA 1MHWC 2F0OA 3CHBD 4BBSB 2Z4HA 1KL9A 1Y1VB 3CCUA 3IRBA 5IYBG 3DHQA 2JA6H 1FJGL 1YJ9A 5CV9A 2E2HH 2KJXA 4JW0A 5IGEA 1WYDA 2CWAA 1AN8A 1BCPB 3M3YH 2KCNA 1PH8A 1WTWA 1K8MA 2RKSA 2PW5A 5IWAL 4NXML 5CBAE 5EKIA 3H3VH 2UUCQ 3BDLA 4L5SA 3MZ5A 3T1HL 4C2MH 1L0WA 2EYFA 3U4VA 1HNZQ 2E2JH 1CA5A 3S24A 1DONA 1J9OA 2YV5A 1PRTF 5IGCA 3OOCA 2F0VA 3TDQA 5KNBA 2CCZA 4KY5A 1GUWA 2F0DA 4K2LA 2EY5A 2V4DA 4FO2A 1BDOA 1ONLA 1FNWA 3MXPA 3HOXH 2Q2HA 3S2DH 3HOZH 3GV3A 4L6TB 1SE4A 1KIXA 4CJ1B 1PHJA 2MPMA 1WTQA 1X3GA 1AZPA 4KKSA 1H9SB 3EVQA 3RN5A 2WAQG 2CWPA 3KJOA 1B1ZA 3TS2A 3PIPA 1HNWL 2F0SA 3BYTB 5C0XI 1BBUA 1JB3A 1ICFB 4IUNA 2VQEL 1YHQA 2AWOA 4UAIA 1EWIA 4U673 3K57A 4KD4A 2WB1E 1VMCA 1YEZA 1VQJA 2F0JA 1D7QA 1TR5A 2JA8H 1SFOH 2MO1A 2SEBD 2ZXOA 1HR0W 1U0LA 4HIDA 5C5LA 4LFBQ 1YNJD 3I55A 1NMFA 4RA8A 4V0BA 3J81c 1Q82C 2UU9L 3STBD 2A5HA 4JYAL 4EQPA 3FP9A 3W1GA 3PSIA 1IL8A 1I4XA 3U50C 4RGTA 1YJWA 4LF8L 5KNCA 3J81L 2A74C 4O2DA 1G2TA 4CGYB 2A6HC 4NW2A 1M90C 2Z9HA 4CKBA 2EZVA 2M9VA 2K05A 1TWGH 4AIMA 4LF4Q 1XMOL 4LF5Q 3J80i 2BA1A 2K33A 3T56B 1EZ8A 1LYLA 1WTVA 2BE5C 1S5DD 2MJ8A 4DPGA 3QOLA 3VA7A 2KENA 3QO2A 4BY7H 2CHBD 2B2VA 3S14H 4DKAC 1Q46A 1YHAA 1R4PB 1LACA 3I4LA 4NP5A 3C46A 4B3SL 4WJWA 1II3A 1OO9B 1BQQT 3NBHA 3Q22A 4DV7L 3NTKA 4LF7Q 1T5XD 3F8TA 3KBXA 2JA7B 4BA2I 2F0QA 2MUYA 3L3OC 1Z9FA 1Y8OB 2M2LA 3UDXA 2HT1A 2HHHL 2PCFB 4OIJA 3KLWA 2N8NA 2OEOA 1XTDA 3T53B 4A3EG 3ITPA 4X64L 2MFIA 3A8KE 2AUJD 3LNNA 3W3AA 4GLVB 4DV4Q 1DM0B 2B2UA 3GDEA 4TQUS 4CJ0B 1DJRD 3ZJYC 3RUZA 1S40A 2F0KA 4AQYQ 2A73B 1G291 2MNAA 4KN4C 1WI5A 2IHFA 4A3GH 1XNQL 4RCNA 3EROA 4H44C 1H9SA 1FL0A 4HCEA 3PO3G 1K3BC 1SYFA 1SROA 2UUAL 3TP5A 4DV5L 5CYUA 2F0WA 2ZJPA 3GP7A 1WJJA 1UEBA 5E3FA 1STHA 5CBEE 1H9JA 3A55A 5M3MB 4NKLA 3MAQA 4FXKC 2YTXA 2B39A 4A3FH 5DAUA 2UXCQ 1EU4A 4FF3A 2WKCA 5CGKA 3U9OA 3E9IA 5IYDH 4WRDA 4E6IA 1BUVT 1A3UA 1RD9D 2K52A 3F2UA 1E2WA 4JV5Q 3CPFA 3HGBA 2AUKA 1E7ZA 1FYCA 1ET6A 3LGJA 4A93B 1D5XC 3S16B 2K5NA 4UPAA 2BH2A 4TKOB 2YU9B 1YNJC 1UE1A 2QDLA 4K0KL 4GNXB 3STBC 4EX5A 4A3EB 4JI4Q 2O5IC 4IJLA 1TXYA 4JOIC 3NXWA 3P75A 3KLSA 4JI6Q 2RDGA 4PZ7A 1VQOA 1RODA 1MGSA 1HTLD 4XIGS 1WCMG 5EKKA 5IP7H 4DV1L 3KOJA 1KXLA 4NB3A 1STYA 3QOJA 1TWHB 3D6WA 3Q0AA 4X66L 3R2IA 1T9HA 5M5XB 1ESRA 4HJ7A 4B3RQ 4FF1A 5LMNQ 2IL8A 1PVOA 1A63A 3I4NG 5JVH3 1C8CA 2R92B 4R1JA 5CC4A 1Q8IA 4OWWB 4LF6Q 1SE2A 1SMYD 3H15A 1SRUA 1CZWA 4DU9A 4LW1A 3K0XA 1O78A 1I5FA 4R4TA 3ICEA 4GZYC 1LTSD 1ILPA 3VDYA 1LM0A 4LNQA 3MVVA 3DXJC 5C6AA 5IGBA 3RLFA 4IUTA 3T1YL 1NY4A 1SNCA 5DEHA 3K5OA 1ENAA 1JORA 4P74A 4IOCA 1X9NA 4B3MQ 3RZOH 2VUMG 4YY3Q 1XPRA 2NZHA 1G6ZA 1YHBA 2VQFQ 4UP7A 1Y8PB 4IPGA 1I50H 4ZKCB 4UY8C 3HOUB 1WTOA 4OX9L 1HUMA 2EJMA 2L9HA 2DJFC 1S5FD 1LTTD 4OL7A 1RTOA 1VF5C 2JA7H 1WTRA 3VR2A 4X3SA 3H94A 5C3EH 3PMFA 3K81C 3CXCA 3NQIA 5C4XG 1N34L 1EY5A 1W2BA 1JE5A 1ML0D 3PIP3 2RBMA 2K5WA 2G9DA 2EXZA 1GXDC 3SK5A 1STGA 5C3WA 1QOHA 5C44B 4IURA 1HCZA 1EYGA 4EQ5A 1U9RA 2EYOA 2K7VA 4CJ2C 4DK3C 2NZOA 2R93G 4K6DA 3EBEA 4DV6L 4J15A 3C3LA 1K8AC 4JI5Q 2I07B 1QILA 1EEFD 1NBWA 5KYLA 1LTAD 3SK8A 4PQXA 1SJHD 2DY7A 3R3OA 4XQNA 2UXBL 5E4WC 2PO4A 4GOPB 5J22A 1IBMQ 2RCFA 1C0AA 1PFMA 1CQVA 3GD7A 1EY0A 4YIJA 1VQNA 2F0UA 4LFAL 3PIOA 1BBXC 2IX0A 2K5QA 1O80A 2EJFC 1BR9A 1BO0A 2CQOA 5IT9E 3KF8B 2IWHA 2ALYB 1D8LA 2JA5G 1B7YB 3UDFA 5M5YB 3PO2B 2K6AA 1NTGA 4DNRB 3AFPA 2Q8RE 3OIQA 1ZYRD 3K59A 4DNTB 1AFPA 2KHJA 3G48A 2HDMA 3MEFA 1XYIA 3K0YA 2NBFA 1W6JA 4A93H 3GTMH 3S16H 2NVTH 4ZUIA 2YU9H 1DYQA 2NVXB 2E2DC 4DK6C 1YIJA 2EYPA 4C3HH 2ZM6Q 5CV5A 1C4QA 5I9PA 3ERSX 2F03A 1B70B 1STAA 1HJPA 3V96A 3U4ZA 2KCMA 4JOIA 4IFDH 2KUMA 5JJIA 1W3SA 5TSSA 1SMYC 5NUCA 3G6JB 3TS0A 3WDNA 4RKLA 1VQBA 1YBYA 2KHSA 1QVGA 4A3BB 2R93B 5M5XH 3E0JA 1M1KC 5A2QL 5C0XJ 2HQLA 4LF9Q 4HEDA 3HOXG 2R92H 2LMCB 2F3IA 5JEAJ 1BCPD 4QY7A 5LMUQ 1EOTA 2IX1A 3I4MH 4HJAA 1U4MA 2JEAI 4O0AA 3FHWA 1HA5A 4MTNA 1E1TA 3HEJA 3FVQA 3PQIA 1MJEA 1I4GA 4C3JH 4A3KB 2LSSA 1J5EQ 1MJCA 3GV6A 4IUVA 3ZYYX 1C7YA 3BZDB 2Y0SB 2IPKD 2KBNA 4LUVA 3HOWB 3PUVA 4DV3L 2L4NA 4R8NA 3D8GA 3HP3A 5GAEC 1VQ4A 3I91A 3J7A5 2NWGA 4L5TA 1KRTA 3C2PA
chains in the Genus database with same CATH topology
2D62A 1VQ6A 4GOPC 3OYYA 1PH8A 3HOYH 1JJCB 1QUQB 4WJ4A 2CFMA 1Q81C 2JA8G 3CW2C 5IWAL 1K0RA 1P16A 4NXML 3H3VH 2OWOA 2UUCQ 4OX9Q 4L5SA 2PNHA 4DV2Q 5GAGC 1ASZA 3UE0A 3GTLH 3T1HL 4C2MH 4IO9A 4DR6L 4IFDG 2RHSB 1L0WA 3G71A 3K7AH 3ULJA 3U4VA 3CCSA 4DR1Q 4GNXC 1JB7A 2OQ0A 1HNZQ 2XTIA 3ER0A 1TWCH 3A5UA 3S24A 4A3MG 2VY3A 1K73C 2E2JH 2Z6KA 4POGA 3M4OH 3CC2A 4QJFA 5C0XG 4GOPA 2C35B 2YV5A 1NJIC 2VS1A 4JI5L 4LF5Q 5IP9H 2NVYH 2CCZA 2VNUD 3CPWA 3M4QA 2E5LL 3CC4A 1XNQQ 5JEAG 4R4IA 1UE7A 2ZTEA 4ME3A 5EAYA 3M7NA 1EUJA 4A3LG 3HOXH 2R92G 3M3YH 1EOVA 2Q2HA 1IBML 3GTQH 3S2DH 3HOZH 1X56A 4GNXA 3J80c 4DV5Q 1KIXA 1K8GA 4JV5L 4DR7L 1PHJA 1XNRL 1X3GA 3KYHC 4BY1G 2WB1G 4BY7G 2JQOA 4LWCA 3JAMi 5M3MH 1L2FA 4IFDI 4OONA 1VQCA 5IYCG 3RN5A 4DV6Q 4LFCQ 2WAQG 1XMQQ 3PCOB 2CWPA 2OQKA 3KJOA 3NENA 3PIPA 3TS2A 1HNWL 2Z0SA 5C0XI 1WFQA 1BBUA 2VQEL 1LUZA 3JC66 1QZGA 1YHQA 3HOVG 3FKIG 2AWOA 4BBRH 4JI7L 1GVPA 1EWIA 1EQRA 2N49A 1P8LA 2JA6G 2WB1E 1JT8A 1YEZA 1VQJA 1HNXL 4QIWE 4JI8Q 4LFAQ 4BA1I 3HOUG 2Q2UA 1C9OA 1D7QA 2ZM6L 1CKMA 3HOYG 4IOAA 2JA8H 1VQ9A 2IHEA 2Q2TA 4A3EH 1SFOH 2MO1A 3BZKA 1V43A 3EN2A 3CCRA 4YHHQ 2JEBI 1PH3A 1U0LA 1HR0W 4GS3A 4HIDA 3PO2H 5LMNL 4K0KQ 4LFBQ 4DUZQ 1GD7A 1NMFA 5HY6A 4APVA 3I55A 2PI2A 3J81c 4DUYL 5M3FH 1Q82C 2K14A 1JMCA 1Q12A 3STBD 1Y14B 2UU9L 4JYAL 1VQFA 3FP9A 3KF6A 1FVIA 3PSIA 3W1GA 3RN2A 4JC0A 4GN4B 2HIVA 5FJ8G 4A3MH 4DNIA 1GKHA 3U50C 1IBKQ 1YJWA 4JBWA 2GVAA 4P73A 4LF8L 1TWHH 1N8RC 1PH9A 4O2DA 1VQPA 2H5XA 5AJ3Q 4A3GG 3DM3A 2I5HA 3GO5A 1V9PA 2A1AA 3F2DA 4LF9L 3CQZH 1M90C 3S2HH 2Q2IA 4A3DG 1KRTA 1YVCA 3S1NH 1VCIA 1I94L 5C44G 1TWGH 1GO3E 4AIMA 3J7ZC 4LF4Q 4JCVE 4AH6A 1XMOL 2ZTCA 2BA1A 3J80i 5LMUL 2E2IH 1U5KA 4B3ML 3HOZG 4GKJQ 1LYLA 2PQAA 2VZAA 4GKKQ 4DPGA 4NXNQ 4YWKA 1MKHA 2KENA 4QL5A 5GQOA 2OTLA 4BY7H 1N33L 2VQFL 1JJGA 2HIXA 3JAMc 3S14H 3RNUA 1YI2A 1PYSB 2WP8J 2K75A 4A3FG 4DKAC 4JI2L 1Q46A 1YHAA 1J5EL 2AKWB 3S17H 4B3SL 1S3OA 1QVCA 1AH9A 1AE2A 1K83H 4IPCA 5IYDG 4DV7L 1B8AA 1QUQA 5GAHC 4LF7Q 4HIOA 2F4VL 3FKIH 3T1YQ 2EIFA 2D0OA 3F8TA 4X62Q 5FLXc 1TWAH 4BA2I 1N36Q 3GTPH 1J6QA 4X65Q 2IY5B 1XPUA 1UWVA 2B29A 1Q8KA 2ZJQA 5BR8L 1Z9FA 3HOUH 3UDXA 2RF4A 2HT1A 4A3KH 2DUDA 2HHHL 1HR0Q 3KLWA 1YNXA 3K80C 2N8NA 1I6HH 1XTDA 4A3EG 5E7NA 2V1CC 2YTYA 3D31A 4X64L 2MFIA 2I0QA 3PO2G 5JJLA 2OCEA 5IY0A 4DR4Q 3J81i 3WWVA 4GLVB 4DV4Q 1TWFH 2QEXA 2B63G 5M3FG 3GDEA 4TQUS 3F2CA 3CCEA 1X6OA 2RCNA 3ZJYC 1WOCA 5FJ8H 3GTKH 1ASYA 1S40A 1FJGQ 2PMZE 4AQYQ 1VQKA 2I5MX 5IP7G 2UUBQ 1N34Q 3S1RH 1UE5A 3GTOH 1G291 3I2ZA 2MNAA 2ES2A 5H1SE 1WI5A 4DR5L 2IHFA 2ASBA 4A3GH 1XNQL 3OTOL 4L5RC 1X55A 1VQAA 1KC8C 4KHPQ 1X65A 4A3DH 1FL0A 3PO3G 2FXQA 2YTVA 1QZHA 1BVSA 3RLOA 1E22A 1SE8A 1SROA 5C44H 2UUAL 4DV5L 3T1HQ 4DR6Q 3DLLA 1RIPA 2CKZB 3BZCA 3CC7A 5LMNW 3I4NH 4JI1L 1N9WA 4QGUA 2ZJPA 3TQYA 1V1QA 1WJJA 4WJ3M 1UEBA 5DLQE 3L2PA 4YCVA 4A3BG 4XTCS 4DR2L 1JJ2A 1PA6A 1OXXK 3GTJH 2YTXA 4JI3L 5IE8A 4A3FH 4DR3Q 2UXCQ 4YWMA 1UE6A 2E5LQ 3AQQA 1A8VA 3E9HA 3E9IA 4OO1G 5IYDH 1Q7YC 4IJHA 4OWXB 5GADC 2UXBQ 3RLNA 1NE3A 2K52A 1Q1BA 4A3CH 4JV5Q 2VUMH 2R7ZH 2UXDQ 4JI8L 5HGQA 3CMEA 2PI2E 3CPFA 1RL2A 1XNRQ 1E7ZA 1PH4A 2WAQE 4A3IH 3LGJA 2NN6G 4A3KG 2K5NA 1L1OB 3A74A 4UPAA 4DV0Q 2BH2A 4IPDA 1UE1A 5M5YH 4YHHL 4K0KL 4GNXB 5M5WH 4BBSG 3STBC 2Y0SG 4EX5A 4DUZL 1IBLQ 4JI4Q 4LUOA 1HNWQ 4IJLA 1TXYA 3HOWG 3D0FA 4A75A 1Y1VG 3SGIA 2VQEQ 2ZTDA 2B63H 1EIFA 4JOIC 1E3PA 3S15H 2JJQA 3G6EA 4JI7Q 4JI6Q 4PZ7A 1CSQA 1VQOA 5C3EG 1N32L 4L5QA 1IZ6A 4XIGS 3CF5A 1WCMG 3HKSA 4OO1I 1SN8A 1KAWA 5IP7H 4DV1L 3KOJA 5C4JH 1HNXQ 2NVXH 1KXLA 1BKBA 4NB3A 3HKZG 2MQHA 1Q1EA 4X66L 4Y7NH 1T9HA 4OWTB 1E24A 4HJ7A 3PO3H 4B3RQ 1E1OA 4MNOA 3L7ZC 4LF4L 5LMNQ 5J3BA 3UDIA 3RZDH 5IT9c 4B3TL 4DUYQ 1PVOA 3CMAA 1KD1C 2UU9Q 3I4NG 1A63A 4JYAQ 4R1JA 1PH6A 4UP9A 4HJ5A 4A76A 3K7UC 2JA9A 4OWWB 1PH5A 1OXSC 4LF6Q 2BH8A 5FLMG 2R93H 4P72A 4A3BH 3H15A 4LF8Q 2I5LX 1SRUA 4Y52H 3PUYA 2VW9A 2A19A 4LW1A 3K0XA 3CCLA 1I5FA 2N78A 4R4TA 4GLXA 1O7IA 3ICEA 2K4KA 1CUKA 3VDYA 1LM0A 4LNQA 1HZBA 3AEVA 1FGUA 1Z47A 4FDBA 1SR3A 3RLFA 3CCJA 3T1YL 1S72A 1PH1A 1NMGA 1NY4A 3UDGA 1I94Q 1VQLA 3KFUA 1VQ5A 4GLAC 4JG2A 2KHIA 4P74A 2AHOB 4UP8A 4X65L 4R4QA 4IOCA 1XMOQ 1X9NA 1N36L 3I7FA 4IPHA 2VUMG 3RZOH 4A3CG 4YY3Q 1XPRA 2R7ZG 4A3JG 2NZHA 1LTLA 1Q86C 1OTCA 1YHBA 3RR5A 1GM5A 1SLJA 2GN5A 3AFQA 4A3IG 1VQIA 4PG3A 3F2BA 1N33Q 2VQFQ 5JJKA 1CKNB 4UP7A 2OTJA 4UY8C 4IPGA 1I50H 4JBJA 4KHZA 3M4PA 1HZ9A 4KI0A 2L15A 2UUCL 4OX9L 2JA5H 4JBKA 4DV2L 3HFZB 4BBSH 1VQHA 4JI0Q 1VQDA 4B3SQ 4DV4L 1H95A 3F1ZA 3PF5A 1IYJB 1X54A 1Y1WH 3HOWH 1Y1VH 2DGYA 4DV7Q 2JA7H 4YWLA 4QQBX 2F4VQ 1QVFA 3KDFB 4HIMA 4DR1L 3ULLA 1HNZL 1AE3A 4DV3Q 5C3EH 4AQYL 3K81C 2ZJRA 2K5VA 2R6GA 3CXCA 1WCMH 1K3RA 5C4XG 1N34L 4B3MQ 3NBHB 2AMCB 5BR8Q 1JE5A 1W2BA 1G51A 4DAMA 3CCQA 2D0PA 2HHHQ 3W1BA 1PV4A 3CP0A 4KHPL 3L0OA 4AYBG 5IWAQ 4JBMA 4H02A 2QGQA 4NXMQ 2WFWA 4X64Q 3EIVA 3S1MH 1VQMA 2IT1A 3TREA 1L1OC 1PFSA 2N3SA 4X6AH 1EYGA 4EQ5A 4DK3C 1HZCA 2NZOA 3S1QH 5FLMH 4TVAB 1CSPA 2R93G 2E8GA 3EBEA 2B3GA 3PGZA 4LFCL 4DV6L 1SMXA 3BU2A 4GN5A 4J15A 1XMQL 1KRSA 2BA0A 1K8AC 4JI5Q 4DR3L 2UXCL 4P75A 4AYBE 1NBWA 1CKOA 4DR5Q 4HIKA 3OTOQ 4POFA 1A0IA 3U58A 3H0GH 2UXBL 1L1OA 2R7FA 3CCVA 3E0EA 3PUZA 4GOPB 1X3EA 4KLKA 2UUAQ 2A8VA 1IBMQ 1C0AA 3J81j 2UXDL 3GD7A 4R4OA 4JI1Q 1VQNA 3I4MG 4A3JH 2GVBA 1XPOA 5ELOA 4LFAL 2QA4A 3PIOA 2JK8A 2IX0A 3TRZA 2LXKA 4DV0L 4DR2Q 2CQOA 1KQSA 3KF8B 3GTGH 3B6YA 1A62A 2ALYB 1D8LA 2JA5G 4JI3Q 1IBLL 4JI4L 1G6PA 4PZ6A 3I4OA 1B7YB 3UDFA 4LFBL 4PZ8A 4LUZA 2K5HA 4BXXG 4NPSA 1Y1WG 1NTGA 2F52A 5GROA 2JA7G 4ALPA 4JI6L 3AFPA 5IYBH 1R9TH 2R7DA 2KHJA 2AWNA 3G48A 3MEFA 1X3FA 1IBKL 1PYBA 4A93H 3GTMH 1BBWA 5C4XH 3S16H 3AYHB 2NVTH 5AJ3L 3ULPA 1YJNA 2YU9H 1KHIA 4DK6C 1YIJA 2ZM6Q 4C3HH 1VQGA 4P71A 3KJPA 3NEMA 2Y0SE 1I3QH 1OXTA 4B3RL 3ERSX 4RMFA 4R4CA 1B70B 1HJPA 4GN3B 3CCMA 3U4ZA 1EFWA 2EQSA 2KCMA 2NN6I 4JOIA 3NELA 4LF5L 5JJIA 1W3SA 4YCWA 4HJ9A 4PMWA 2JE6I 2KCTA 2ATWA 4GKJL 4A4IA 4GKKL 3PF4A 4NXNL 3PUWA 3TS0A 4LF6L 1N32Q 3CAMA 1VQ8A 3M9BA 4IFDJ 1VQBA 3HKZE 3UE1A 1PH7A 4DV1Q 1HZAA 3OW2A 1DGSA 1YBYA 5IP9G 3M85A 1QVGA 1XJVA 2VL6A 5M5XH 2LXJA 3Q8DA 4X66Q 1IL2A 1M1KC 3CD6A 3KF6B 4YCUA 4DAYB 5C0XJ 1MIUA 2HQLA 4OXPA 5ELNA 1OXUA 3BJUA 4LF9Q 4LF7L 1CKNA 2YYZA 3H0GG 4A3LH 3W5OA 4HJ8A 3HOXG 2MO0A 2R92H 4X62L 2K50A 4B3TQ 1OXVA 2F3IA 2EXDA 5JEAJ 3PUXA 1K9MC 1VS0A 4QY7A 5LMUQ 4YY3L 3H3VI 2IX1A 3I4MH 3G4SA 4HJAA 1EIYB 2ID0A 4BY1H 1PH2A 4O0AA 3FHWA 1VQEA 2JEAI 2XGTA 5M3MG 3TEHB 4MTNA 1E1TA 3KDFA 4C3IH 1HR0L 5IYCH 5K36G 1MJEA 1YITA 4C3JH 3A5ZB 1IXRA 1VQ7A 4MZ9A 4JI0L 4JI2Q 2LSSA 1YZ6A 1J5EQ 1MJCA 4DR4L 1HH2P 2PQAB 3MXNB 1C7YA 4BXXH 3HOVH 4BBRG 2KBNA 4LUVA 4RG1A 1KL9A 3CCUA 3PUVA 3IRBA 4DV3L 3PV0A 5IYBG 5GAEC 3K8AA 2RHQB 1VQ4A 2JA6H 4DR7Q 1FJGL 1YJ9A 2NVQH 1EQQA 3J7A5 2E2HH 3A0JA 4L5TA 4A93G 2UUBL 2Z6KC 1WYDA 2CWAA 3I56A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D62 A;  1VQ6 A;  4GOP C;  3OYY A;  1PH8 A;  3HOY H;  1JJC B;  1QUQ B;  4WJ4 A;  2CFM A;  1Q81 C;  2JA8 G;  3CW2 C;  5IWA L;  1K0R A;  1P16 A;  4NXM L;  3H3V H;  2OWO A;  2UUC Q;  4OX9 Q;  4L5S A;  2PNH A;  4DV2 Q;  5GAG C;  1ASZ A;  3UE0 A;  3GTL H;  3T1H L;  4C2M H;  4IO9 A;  4DR6 L;  4IFD G;  2RHS B;  1L0W A;  3G71 A;  3K7A H;  3ULJ A;  3U4V A;  3CCS A;  4DR1 Q;  4GNX C;  1JB7 A;  2OQ0 A;  1HNZ Q;  2XTI A;  3ER0 A;  1TWC H;  3A5U A;  3S24 A;  4A3M G;  2VY3 A;  1K73 C;  2E2J H;  2Z6K A;  4POG A;  3M4O H;  3CC2 A;  4QJF A;  5C0X G;  4GOP A;  2C35 B;  2YV5 A;  1NJI C;  2VS1 A;  4JI5 L;  4LF5 Q;  5IP9 H;  2NVY H;  2CCZ A;  2VNU D;  3CPW A;  3M4Q A;  2E5L L;  3CC4 A;  1XNQ Q;  5JEA G;  4R4I A;  1UE7 A;  2ZTE A;  4ME3 A;  5EAY A;  3M7N A;  1EUJ A;  4A3L G;  3HOX H;  2R92 G;  3M3Y H;  1EOV A;  2Q2H A;  1IBM L;  3GTQ H;  3S2D H;  3HOZ H;  1X56 A;  4GNX A;  3J80 c;  4DV5 Q;  1KIX A;  1K8G A;  4JV5 L;  4DR7 L;  1PHJ A;  1XNR L;  1X3G A;  3KYH C;  4BY1 G;  2WB1 G;  4BY7 G;  2JQO A;  4LWC A;  3JAM i;  5M3M H;  1L2F A;  4IFD I;  4OON A;  1VQC A;  5IYC G;  3RN5 A;  4DV6 Q;  4LFC Q;  2WAQ G;  1XMQ Q;  3PCO B;  2CWP A;  2OQK A;  3KJO A;  3NEN A;  3PIP A;  3TS2 A;  1HNW L;  2Z0S A;  5C0X I;  1WFQ A;  1BBU A;  2VQE L;  1LUZ A;  3JC6 6;  1QZG A;  1YHQ A;  3HOV G;  3FKI G;  2AWO A;  4BBR H;  4JI7 L;  1GVP A;  1EWI A;  1EQR A;  2N49 A;  1P8L A;  2JA6 G;  2WB1 E;  1JT8 A;  1YEZ A;  1VQJ A;  1HNX L;  4QIW E;  4JI8 Q;  4LFA Q;  4BA1 I;  3HOU G;  2Q2U A;  1C9O A;  1D7Q A;  2ZM6 L;  1CKM A;  3HOY G;  4IOA A;  2JA8 H;  1VQ9 A;  2IHE A;  2Q2T A;  4A3E H;  1SFO H;  2MO1 A;  3BZK A;  1V43 A;  3EN2 A;  3CCR A;  4YHH Q;  2JEB I;  1PH3 A;  1U0L A;  1HR0 W;  4GS3 A;  4HID A;  3PO2 H;  5LMN L;  4K0K Q;  4LFB Q;  4DUZ Q;  1GD7 A;  1NMF A;  5HY6 A;  4APV A;  3I55 A;  2PI2 A;  3J81 c;  4DUY L;  5M3F H;  1Q82 C;  2K14 A;  1JMC A;  1Q12 A;  3STB D;  1Y14 B;  2UU9 L;  4JYA L;  1VQF A;  3FP9 A;  3KF6 A;  1FVI A;  3PSI A;  3W1G A;  3RN2 A;  4JC0 A;  4GN4 B;  2HIV A;  5FJ8 G;  4A3M H;  4DNI A;  1GKH A;  3U50 C;  1IBK Q;  1YJW A;  4JBW A;  2GVA A;  4P73 A;  4LF8 L;  1TWH H;  1N8R C;  1PH9 A;  4O2D A;  1VQP A;  2H5X A;  5AJ3 Q;  4A3G G;  3DM3 A;  2I5H A;  3GO5 A;  1V9P A;  2A1A A;  3F2D A;  4LF9 L;  3CQZ H;  1M90 C;  3S2H H;  2Q2I A;  4A3D G;  1KRT A;  1YVC A;  3S1N H;  1VCI A;  1I94 L;  5C44 G;  1TWG H;  1GO3 E;  4AIM A;  3J7Z C;  4LF4 Q;  4JCV E;  4AH6 A;  1XMO L;  2ZTC A;  2BA1 A;  3J80 i;  5LMU L;  2E2I H;  1U5K A;  4B3M L;  3HOZ G;  4GKJ Q;  1LYL A;  2PQA A;  2VZA A;  4GKK Q;  4DPG A;  4NXN Q;  4YWK A;  1MKH A;  2KEN A;  4QL5 A;  5GQO A;  2OTL A;  4BY7 H;  1N33 L;  2VQF L;  1JJG A;  2HIX A;  3JAM c;  3S14 H;  3RNU A;  1YI2 A;  1PYS B;  2WP8 J;  2K75 A;  4A3F G;  4DKA C;  4JI2 L;  1Q46 A;  1YHA A;  1J5E L;  2AKW B;  3S17 H;  4B3S L;  1S3O A;  1QVC A;  1AH9 A;  1AE2 A;  1K83 H;  4IPC A;  5IYD G;  4DV7 L;  1B8A A;  1QUQ A;  5GAH C;  4LF7 Q;  4HIO A;  2F4V L;  3FKI H;  3T1Y Q;  2EIF A;  2D0O A;  3F8T A;  4X62 Q;  5FLX c;  1TWA H;  4BA2 I;  1N36 Q;  3GTP H;  1J6Q A;  4X65 Q;  2IY5 B;  1XPU A;  1UWV A;  2B29 A;  1Q8K A;  2ZJQ A;  5BR8 L;  1Z9F A;  3HOU H;  3UDX A;  2RF4 A;  2HT1 A;  4A3K H;  2DUD A;  2HHH L;  1HR0 Q;  3KLW A;  1YNX A;  3K80 C;  2N8N A;  1I6H H;  1XTD A;  4A3E G;  5E7N A;  2V1C C;  2YTY A;  3D31 A;  4X64 L;  2MFI A;  2I0Q A;  3PO2 G;  5JJL A;  2OCE A;  5IY0 A;  4DR4 Q;  3J81 i;  3WWV A;  4GLV B;  4DV4 Q;  1TWF H;  2QEX A;  2B63 G;  5M3F G;  3GDE A;  4TQU S;  3F2C A;  3CCE A;  1X6O A;  2RCN A;  3ZJY C;  1WOC A;  5FJ8 H;  3GTK H;  1ASY A;  1S40 A;  1FJG Q;  2PMZ E;  4AQY Q;  1VQK A;  2I5M X;  5IP7 G;  2UUB Q;  1N34 Q;  3S1R H;  1UE5 A;  3GTO H;  1G29 1;  3I2Z A;  2MNA A;  2ES2 A;  5H1S E;  1WI5 A;  4DR5 L;  2IHF A;  2ASB A;  4A3G H;  1XNQ L;  3OTO L;  4L5R C;  1X55 A;  1VQA A;  1KC8 C;  4KHP Q;  1X65 A;  4A3D H;  1FL0 A;  3PO3 G;  2FXQ A;  2YTV A;  1QZH A;  1BVS A;  3RLO A;  1E22 A;  1SE8 A;  1SRO A;  5C44 H;  2UUA L;  4DV5 L;  3T1H Q;  4DR6 Q;  3DLL A;  1RIP A;  2CKZ B;  3BZC A;  3CC7 A;  5LMN W;  3I4N H;  4JI1 L;  1N9W A;  4QGU A;  2ZJP A;  3TQY A;  1V1Q A;  1WJJ A;  4WJ3 M;  1UEB A;  5DLQ E;  3L2P A;  4YCV A;  4A3B G;  4XTC S;  4DR2 L;  1JJ2 A;  1PA6 A;  1OXX K;  3GTJ H;  2YTX A;  4JI3 L;  5IE8 A;  4A3F H;  4DR3 Q;  2UXC Q;  4YWM A;  1UE6 A;  2E5L Q;  3AQQ A;  1A8V A;  3E9H A;  3E9I A;  4OO1 G;  5IYD H;  1Q7Y C;  4IJH A;  4OWX B;  5GAD C;  2UXB Q;  3RLN A;  1NE3 A;  2K52 A;  1Q1B A;  4A3C H;  4JV5 Q;  2VUM H;  2R7Z H;  2UXD Q;  4JI8 L;  5HGQ A;  3CME A;  2PI2 E;  3CPF A;  1RL2 A;  1XNR Q;  1E7Z A;  1PH4 A;  2WAQ E;  4A3I H;  3LGJ A;  2NN6 G;  4A3K G;  2K5N A;  1L1O B;  3A74 A;  4UPA A;  4DV0 Q;  2BH2 A;  4IPD A;  1UE1 A;  5M5Y H;  4YHH L;  4K0K L;  4GNX B;  5M5W H;  4BBS G;  3STB C;  2Y0S G;  4EX5 A;  4DUZ L;  1IBL Q;  4JI4 Q;  4LUO A;  1HNW Q;  4IJL A;  1TXY A;  3HOW G;  3D0F A;  4A75 A;  1Y1V G;  3SGI A;  2VQE Q;  2ZTD A;  2B63 H;  1EIF A;  4JOI C;  1E3P A;  3S15 H;  2JJQ A;  3G6E A;  4JI7 Q;  4JI6 Q;  4PZ7 A;  1CSQ A;  1VQO A;  5C3E G;  1N32 L;  4L5Q A;  1IZ6 A;  4XIG S;  3CF5 A;  1WCM G;  3HKS A;  4OO1 I;  1SN8 A;  1KAW A;  5IP7 H;  4DV1 L;  3KOJ A;  5C4J H;  1HNX Q;  2NVX H;  1KXL A;  1BKB A;  4NB3 A;  3HKZ G;  2MQH A;  1Q1E A;  4X66 L;  4Y7N H;  1T9H A;  4OWT B;  1E24 A;  4HJ7 A;  3PO3 H;  4B3R Q;  1E1O A;  4MNO A;  3L7Z C;  4LF4 L;  5LMN Q;  5J3B A;  3UDI A;  3RZD H;  5IT9 c;  4B3T L;  4DUY Q;  1PVO A;  3CMA A;  1KD1 C;  2UU9 Q;  3I4N G;  1A63 A;  4JYA Q;  4R1J A;  1PH6 A;  4UP9 A;  4HJ5 A;  4A76 A;  3K7U C;  2JA9 A;  4OWW B;  1PH5 A;  1OXS C;  4LF6 Q;  2BH8 A;  5FLM G;  2R93 H;  4P72 A;  4A3B H;  3H15 A;  4LF8 Q;  2I5L X;  1SRU A;  4Y52 H;  3PUY A;  2VW9 A;  2A19 A;  4LW1 A;  3K0X A;  3CCL A;  1I5F A;  2N78 A;  4R4T A;  4GLX A;  1O7I A;  3ICE A;  2K4K A;  1CUK A;  3VDY A;  1LM0 A;  4LNQ A;  1HZB A;  3AEV A;  1FGU A;  1Z47 A;  4FDB A;  1SR3 A;  3RLF A;  3CCJ A;  3T1Y L;  1S72 A;  1PH1 A;  1NMG A;  1NY4 A;  3UDG A;  1I94 Q;  1VQL A;  3KFU A;  1VQ5 A;  4GLA C;  4JG2 A;  2KHI A;  4P74 A;  2AHO B;  4UP8 A;  4X65 L;  4R4Q A;  4IOC A;  1XMO Q;  1X9N A;  1N36 L;  3I7F A;  4IPH A;  2VUM G;  3RZO H;  4A3C G;  4YY3 Q;  1XPR A;  2R7Z G;  4A3J G;  2NZH A;  1LTL A;  1Q86 C;  1OTC A;  1YHB A;  3RR5 A;  1GM5 A;  1SLJ A;  2GN5 A;  3AFQ A;  4A3I G;  1VQI A;  4PG3 A;  3F2B A;  1N33 Q;  2VQF Q;  5JJK A;  1CKN B;  4UP7 A;  2OTJ A;  4UY8 C;  4IPG A;  1I50 H;  4JBJ A;  4KHZ A;  3M4P A;  1HZ9 A;  4KI0 A;  2L15 A;  2UUC L;  4OX9 L;  2JA5 H;  4JBK A;  4DV2 L;  3HFZ B;  4BBS H;  1VQH A;  4JI0 Q;  1VQD A;  4B3S Q;  4DV4 L;  1H95 A;  3F1Z A;  3PF5 A;  1IYJ B;  1X54 A;  1Y1W H;  3HOW H;  1Y1V H;  2DGY A;  4DV7 Q;  2JA7 H;  4YWL A;  4QQB X;  2F4V Q;  1QVF A;  3KDF B;  4HIM A;  4DR1 L;  3ULL A;  1HNZ L;  1AE3 A;  4DV3 Q;  5C3E H;  4AQY L;  3K81 C;  2ZJR A;  2K5V A;  2R6G A;  3CXC A;  1WCM H;  1K3R A;  5C4X G;  1N34 L;  4B3M Q;  3NBH B;  2AMC B;  5BR8 Q;  1JE5 A;  1W2B A;  1G51 A;  4DAM A;  3CCQ A;  2D0P A;  2HHH Q;  3W1B A;  1PV4 A;  3CP0 A;  4KHP L;  3L0O A;  4AYB G;  5IWA Q;  4JBM A;  4H02 A;  2QGQ A;  4NXM Q;  2WFW A;  4X64 Q;  3EIV A;  3S1M H;  1VQM A;  2IT1 A;  3TRE A;  1L1O C;  1PFS A;  2N3S A;  4X6A H;  1EYG A;  4EQ5 A;  4DK3 C;  1HZC A;  2NZO A;  3S1Q H;  5FLM H;  4TVA B;  1CSP A;  2R93 G;  2E8G A;  3EBE A;  2B3G A;  3PGZ A;  4LFC L;  4DV6 L;  1SMX A;  3BU2 A;  4GN5 A;  4J15 A;  1XMQ L;  1KRS A;  2BA0 A;  1K8A C;  4JI5 Q;  4DR3 L;  2UXC L;  4P75 A;  4AYB E;  1NBW A;  1CKO A;  4DR5 Q;  4HIK A;  3OTO Q;  4POF A;  1A0I A;  3U58 A;  3H0G H;  2UXB L;  1L1O A;  2R7F A;  3CCV A;  3E0E A;  3PUZ A;  4GOP B;  1X3E A;  4KLK A;  2UUA Q;  2A8V A;  1IBM Q;  1C0A A;  3J81 j;  2UXD L;  3GD7 A;  4R4O A;  4JI1 Q;  1VQN A;  3I4M G;  4A3J H;  2GVB A;  1XPO A;  5ELO A;  4LFA L;  2QA4 A;  3PIO A;  2JK8 A;  2IX0 A;  3TRZ A;  2LXK A;  4DV0 L;  4DR2 Q;  2CQO A;  1KQS A;  3KF8 B;  3GTG H;  3B6Y A;  1A62 A;  2ALY B;  1D8L A;  2JA5 G;  4JI3 Q;  1IBL L;  4JI4 L;  1G6P A;  4PZ6 A;  3I4O A;  1B7Y B;  3UDF A;  4LFB L;  4PZ8 A;  4LUZ A;  2K5H A;  4BXX G;  4NPS A;  1Y1W G;  1NTG A;  2F52 A;  5GRO A;  2JA7 G;  4ALP A;  4JI6 L;  3AFP A;  5IYB H;  1R9T H;  2R7D A;  2KHJ A;  2AWN A;  3G48 A;  3MEF A;  1X3F A;  1IBK L;  1PYB A;  4A93 H;  3GTM H;  1BBW A;  5C4X H;  3S16 H;  3AYH B;  2NVT H;  5AJ3 L;  3ULP A;  1YJN A;  2YU9 H;  1KHI A;  4DK6 C;  1YIJ A;  2ZM6 Q;  4C3H H;  1VQG A;  4P71 A;  3KJP A;  3NEM A;  2Y0S E;  1I3Q H;  1OXT A;  4B3R L;  3ERS X;  4RMF A;  4R4C A;  1B70 B;  1HJP A;  4GN3 B;  3CCM A;  3U4Z A;  1EFW A;  2EQS A;  2KCM A;  2NN6 I;  4JOI A;  3NEL A;  4LF5 L;  5JJI A;  1W3S A;  4YCW A;  4HJ9 A;  4PMW A;  2JE6 I;  2KCT A;  2ATW A;  4GKJ L;  4A4I A;  4GKK L;  3PF4 A;  4NXN L;  3PUW A;  3TS0 A;  4LF6 L;  1N32 Q;  3CAM A;  1VQ8 A;  3M9B A;  4IFD J;  1VQB A;  3HKZ E;  3UE1 A;  1PH7 A;  4DV1 Q;  1HZA A;  3OW2 A;  1DGS A;  1YBY A;  5IP9 G;  3M85 A;  1QVG A;  1XJV A;  2VL6 A;  5M5X H;  2LXJ A;  3Q8D A;  4X66 Q;  1IL2 A;  1M1K C;  3CD6 A;  3KF6 B;  4YCU A;  4DAY B;  5C0X J;  1MIU A;  2HQL A;  4OXP A;  5ELN A;  1OXU A;  3BJU A;  4LF9 Q;  4LF7 L;  1CKN A;  2YYZ A;  3H0G G;  4A3L H;  3W5O A;  4HJ8 A;  3HOX G;  2MO0 A;  2R92 H;  4X62 L;  2K50 A;  4B3T Q;  1OXV A;  2F3I A;  2EXD A;  5JEA J;  3PUX A;  1K9M C;  1VS0 A;  4QY7 A;  5LMU Q;  4YY3 L;  3H3V I;  2IX1 A;  3I4M H;  3G4S A;  4HJA A;  1EIY B;  2ID0 A;  4BY1 H;  1PH2 A;  4O0A A;  3FHW A;  1VQE A;  2JEA I;  2XGT A;  5M3M G;  3TEH B;  4MTN A;  1E1T A;  3KDF A;  4C3I H;  1HR0 L;  5IYC H;  5K36 G;  1MJE A;  1YIT A;  4C3J H;  3A5Z B;  1IXR A;  1VQ7 A;  4MZ9 A;  4JI0 L;  4JI2 Q;  2LSS A;  1YZ6 A;  1J5E Q;  1MJC A;  4DR4 L;  1HH2 P;  2PQA B;  3MXN B;  1C7Y A;  4BXX H;  3HOV H;  4BBR G;  2KBN A;  4LUV A;  4RG1 A;  1KL9 A;  3CCU A;  3PUV A;  3IRB A;  4DV3 L;  3PV0 A;  5IYB G;  5GAE C;  3K8A A;  2RHQ B;  1VQ4 A;  2JA6 H;  4DR7 Q;  1FJG L;  1YJ9 A;  2NVQ H;  1EQQ A;  3J7A 5;  2E2H H;  3A0J A;  4L5T A;  4A93 G;  2UUB L;  2Z6K C;  1WYD A;  2CWA A;  3I56 A; 
#chains in the Genus database with same CATH topology
 1VQ6 A;  3OYY A;  1E2V A;  2RSN A;  4WJ4 A;  3HKZ B;  4DAP A;  2JA8 G;  1TT2 A;  1LT4 D;  4BS9 A;  4OEL B;  3AU7 A;  4DV2 Q;  1ASZ A;  3GTL H;  3BVG A;  4IO9 A;  4DR6 L;  2KEC A;  2RHS B;  3TSS A;  4B9W A;  3K7A H;  1ZKO A;  3ULJ A;  1O7Y A;  3DWQ A;  3CCS A;  4DR1 Q;  1JB7 A;  2CVR A;  3ER0 A;  1K73 C;  1CFM A;  3FEW X;  1A3T A;  5C0X G;  4GOP A;  2C35 B;  2IW3 A;  1KLG D;  2J0T D;  5CV8 A;  5D14 A;  2MP1 A;  5A35 A;  5JEA G;  4IUQ A;  2R61 A;  3M7N A;  4KJO A;  3OHX C;  4A3L G;  4DXG A;  3KF8 A;  3GTQ H;  4QCL A;  5LL6 X;  2SNS A;  1LLR D;  4XT3 B;  3KYH C;  4BY1 G;  2HQE A;  1B9M A;  2ZXR A;  4LK1 C;  4BY7 G;  2R7Z B;  1F2Y A;  4A3J B;  1L2F A;  4C3I G;  4OON A;  4I7Z C;  4LFC Q;  2OQK A;  3NEN A;  1B44 D;  2J4X A;  1ZYR C;  1LUZ A;  3JC6 6;  3LWE A;  1QZG A;  3HOV G;  3N52 A;  4BBR H;  4JI7 L;  2AQ1 B;  2N49 A;  4ZYS A;  5T1I A;  4KKT A;  1HNX L;  2VXW A;  4QIW E;  3SHL A;  4BA1 I;  1QNU A;  2Q2U A;  1C9O A;  1CKM A;  3HOY G;  1SND A;  2G5D A;  2IHE A;  1VQ9 A;  2Q2T A;  4RHS A;  3VA5 A;  3CCR A;  4YHH Q;  3PO2 H;  1RDP D;  3DWA A;  1V8Q A;  1B3A A;  4DUZ Q;  5HY6 A;  4DUY L;  1JMC A;  5M3F H;  2FMM A;  1Q12 A;  3NSW A;  1FVI A;  5CV6 A;  2WIN B;  1FGB D;  4GN4 B;  4K5V A;  4A3M H;  4DNI A;  1GKH A;  1IBK Q;  4P73 A;  2EDG A;  1F2Z A;  4XDX A;  1PH9 A;  2H5X A;  5D65 A;  5AJ3 Q;  2B2V C;  4A3G G;  3DM3 A;  2LKV A;  5BN3 A;  3OWE B;  2Q2I A;  3NQT A;  3I8Z A;  4DK1 A;  1BCP C;  1VCI A;  1I94 L;  4WFN 3;  1GO3 E;  4QUC A;  2WV6 D;  3J7Z C;  2O5J C;  1UUP A;  1U5K A;  4GKJ Q;  1A3V A;  1HQM C;  4NXN Q;  1MKH A;  3QIA A;  1WTH A;  2F0G A;  3M4Y A;  4EQN A;  2HIX A;  3FPP A;  2ZXP A;  3WOF A;  1AW7 A;  4A3F G;  1RHP A;  2B2Y A;  2AKW B;  1NR2 A;  5KGU A;  1K83 H;  5IYD G;  3RD4 A;  5FO9 B;  2F4V L;  3FKI H;  3EQL C;  2B2U C;  2D0O A;  4X62 Q;  5FLX c;  4LMQ D;  1N36 Q;  4X65 Q;  5ISR A;  1XPU A;  2CH4 W;  1JWM D;  2F3W A;  3R2T A;  1LT5 D;  4A3K H;  2WAC A;  5FLX L;  1HR0 Q;  3AMU A;  3K80 C;  2EYJ A;  4QUF A;  2XSC A;  3D31 A;  1TKW B;  3J80 E;  4KY6 A;  3EFX D;  3J81 i;  3WWV A;  4HCS A;  2QEX A;  4P2C B;  2E74 C;  4C1N K;  1CHQ D;  2F0M A;  2RCN A;  1FNV A;  1WOC A;  3BYY B;  5K5P A;  3PIO 3;  1FJG Q;  2PMZ E;  1RF2 D;  4H0L C;  2LY7 A;  2NYZ D;  1TWC B;  2I5M X;  5IP7 G;  1VQK A;  1SYG A;  1UE5 A;  5H1S E;  4DR5 L;  1EZ6 A;  1VQA A;  5ELE A;  4A3D H;  4KD3 A;  2YTV A;  2FJ2 A;  1BVS A;  1E22 A;  1SE8 A;  1D6E C;  3H0G B;  3T1H Q;  1RIP A;  3CC7 A;  4JI1 L;  2D9U A;  3TQY A;  2D5D A;  3L2P A;  2QDB A;  4YCV A;  3M7G A;  2EJG C;  1LT6 D;  3T13 A;  1V1O A;  2Q8T A;  3NK9 A;  3GTJ H;  4DR3 Q;  4YWM A;  1A6X A;  1QNK A;  3K58 A;  3OIP A;  3E9H A;  3J7A F;  1D1I A;  1LTI D;  1NCV A;  5GAD C;  4X3U A;  1MBY A;  4K8J A;  3RLN A;  3SVM A;  4BWG B;  1PTO B;  4A3C H;  2R7Z H;  3CME A;  1PH4 A;  4A3I H;  5I9O A;  1L1O B;  4DV0 Q;  1LV9 A;  1GUO A;  4FXD A;  4KJN A;  1HNW Q;  4OGQ C;  1TU2 B;  3D0F A;  3SGI A;  1TII D;  4PMC A;  2VQE Q;  2B63 H;  1KDC A;  1E3P A;  4N9T A;  2JJQ A;  3G6E A;  3VR3 A;  3JAM E;  1Q3L A;  1N32 L;  5C3E G;  3CF5 A;  3DMU A;  3HKS A;  4OO1 I;  1BKB A;  4ABN A;  1MSH A;  1EU3 A;  4OEM B;  1Q1E A;  1NAP A;  4OWT B;  3S2H B;  5E4X A;  4LF4 L;  2TMP A;  5J3B A;  3UDI A;  3TP6 A;  3BVM A;  4B3T L;  2UU9 Q;  4ZRZ A;  4JYA Q;  5JAV A;  2BH8 A;  1EYC A;  1PRT B;  2KA7 A;  4LF8 Q;  4I7A A;  1I4Q A;  5FO8 B;  1PXU A;  5CR3 A;  2WAQ B;  3K6O A;  2KVM A;  3AEV A;  1FGU A;  1S72 A;  4OO1 H;  1SR3 A;  5FKA C;  1VQ5 A;  1XMO Q;  4DR7 L;  1JOK A;  2PNR C;  3IAY A;  1TWA B;  3TBI B;  1Q86 C;  3GTP B;  2K32 A;  2DY8 A;  2RDF A;  1IW7 D;  3AFQ A;  4PG3 A;  2NN6 H;  1CKN B;  4JBJ A;  4RH6 A;  4K8I A;  1HZ9 A;  1SDF A;  2L15 A;  2JSO A;  1I6H B;  1STE A;  3HFZ B;  4B08 A;  4BBS H;  1EYD A;  4B3S Q;  4DV4 L;  3SXH A;  1IYJ B;  3OPO A;  1Y1V H;  2DGY A;  4DV7 Q;  3KDF B;  4HIM A;  5DM7 3;  1LTB D;  4RAU C;  4AQY L;  2XWJ B;  4KMU C;  2ZJR A;  1AZQ A;  2DJG C;  2F0T A;  3GTK B;  3KUP A;  1M8A A;  4DAM A;  3S1R B;  1V1P B;  3W1B A;  2HHH Q;  1PV4 A;  5J1Z A;  3L0O A;  4AYB G;  4X3T A;  4X64 Q;  1H9K A;  4N8F A;  1WTX A;  1VQM A;  2IT1 A;  5I4D A;  1HHV A;  4X6A H;  3FRP B;  2F0F A;  1LTG D;  4G7O C;  5FLM H;  3A56 A;  1SMX A;  4GN5 A;  1XMQ L;  2UXC L;  1KLU D;  1CKO A;  4IUU A;  4HIK A;  1KAB A;  3I70 A;  1ENC A;  4N9P A;  3U58 A;  3H0G H;  1L1O A;  1EL0 A;  2UUA Q;  4R4O A;  3I4M G;  1EYA A;  2HD3 A;  1RTN A;  4EGV A;  1YNN D;  3EA6 A;  1DOM A;  2HCI A;  5K36 H;  4Q5V A;  2NB0 A;  3TME A;  1G6P A;  1A62 A;  2F0H A;  5LL6 S;  4JI4 L;  2HCC A;  5ELD A;  4S3S A;  1Y1W G;  5GRO A;  3IL8 A;  3MFY A;  4JI6 L;  5IYB H;  5I6Y A;  2R7D A;  1PYB A;  1BBW A;  1DCZ A;  3AYH B;  1YJN A;  3MWY W;  3QJY A;  1VQG A;  2B2T A;  1Z7T A;  3KBG A;  4B3R L;  1EY7 A;  4R4C A;  4GN3 B;  2BCO A;  2Z6B A;  3OMG A;  3CCM A;  1EFW A;  2QEJ C;  3PO3 B;  3C1F A;  1SE3 A;  4YCW A;  1J8I A;  4GKK L;  2E2I B;  3PUW A;  5IGD A;  4LF6 L;  3HRZ C;  3KLR A;  2L5T A;  2QKI C;  3UE1 A;  4DV1 Q;  3OW2 A;  2OF1 A;  3Q23 A;  1XJV A;  2RVL A;  2LXJ A;  4X66 Q;  3Q6S A;  3MXG A;  4DAY B;  4OXP A;  5ELN A;  1OXU A;  2FFK B;  3W2D A;  1LO5 D;  3S17 B;  1CKN A;  2YYZ A;  2K01 A;  4RCO A;  4HJ8 A;  2MO0 A;  2K50 A;  1IW7 C;  1K28 A;  1L0X B;  1VS0 A;  3S9W A;  4YY3 L;  1WVL A;  1EIY B;  1SEB D;  1VQE A;  5EKL A;  1BNZ A;  3KDF A;  3VR4 A;  4FNF A;  4JI2 Q;  2XIW A;  1S4Z A;  1YZ6 A;  4DR4 L;  1R4Q B;  1HH2 P;  2PQA B;  1KTK A;  4BXX H;  2FMC A;  4BBR G;  1EQT A;  1EY4 A;  3PV0 A;  2QIL A;  3A7A B;  3K8A A;  1VMP A;  3A0J A;  1PDQ A;  2UUB L;  1GUT A;  2JN4 A;  1WCM B;  4K2K A;  4GOP C;  1JJC B;  2VB2 X;  1Q81 C;  3GTO B;  3CW2 C;  5KEE A;  2OWO A;  4OX9 Q;  3CKI B;  5GAG C;  3UE0 A;  2CQA A;  2EYH A;  1ILQ A;  1VDZ A;  3S1M B;  2XNA C;  1I4H A;  1RCV D;  3G71 A;  3O13 A;  1B2T A;  2OQ0 A;  3I4N B;  3A5U A;  4A3M G;  4KV6 A;  4POG A;  2Z6K A;  4J6H A;  3CC2 A;  3ND8 A;  4CDF C;  2VS1 A;  3S1Q B;  4JI5 L;  5IP9 H;  2PZW A;  2VNU D;  3CRK C;  1Y8N B;  1IKM A;  2E5L L;  3SE0 A;  2NTS A;  4JK1 C;  2ZTE A;  5EAY A;  1MSG A;  3IKJ A;  2LFN A;  1G2S A;  1EOV A;  1X3Q A;  4LAA A;  1IBM L;  3BG3 A;  2BDO A;  2FHT A;  4GNX A;  3A8J E;  1BOS A;  3TZU A;  1YNN C;  4KHV A;  1XNR L;  2EY6 A;  3OMC A;  2WB1 G;  1C48 A;  2VUM B;  4LWC A;  5M3M H;  4XYO A;  4IFD I;  1VQC A;  5IYC G;  4DV6 Q;  1CT1 D;  2OXP A;  3PCO B;  4XT1 B;  4PV1 C;  4DAV A;  4TRD A;  2F0I A;  1IYU A;  2DNE A;  4CBV A;  1WFQ A;  4R9W A;  3GQB A;  3I72 A;  1U4L A;  3FKI G;  4ZCK A;  4CHT B;  1A15 A;  3S15 B;  2JA6 G;  2RSO A;  1R9T B;  5DM6 3;  1XWE A;  4JI8 Q;  4LFA Q;  2F0E A;  4C1N I;  1SNO A;  2M00 A;  5C4X B;  2ZM6 L;  4K5X A;  5C4J B;  4IOA A;  2ICI A;  1TS4 A;  4A3E H;  4Y7N B;  3BZK A;  1V43 A;  3EN2 A;  5G3L D;  2JEB I;  2XWB B;  1GD7 A;  4APV A;  2PI2 A;  3RZD B;  1RJT A;  1VQF A;  1TS3 A;  3RN2 A;  4JC0 A;  1EWH A;  2HIV A;  5JOB A;  4JBW A;  2GVA A;  1IKL A;  4JVZ A;  1TWH H;  2X69 A;  3A8I E;  5EPK A;  1L0Y B;  2I5H A;  4LF9 L;  2B2Y C;  4A3D G;  2P5Z X;  1JWU D;  4Z9C B;  1EIH A;  3V2T A;  3VYU A;  4JCV E;  4PNY A;  2E2I H;  3HOZ G;  5LMU L;  4HN7 A;  2PZT A;  2PQA A;  1O7L A;  2VZA A;  4DGZ A;  2NZ1 D;  2SDF A;  2IX3 A;  1N33 L;  3SK6 A;  2F4I A;  1J5E L;  2C9O A;  3S17 H;  1S3O A;  1QVC A;  2JA5 B;  4ME5 A;  1F9S A;  1B8A A;  3LX0 A;  4HIO A;  1XTC D;  4RHR A;  1HXY D;  3J7Y W;  5IGF A;  1J6Q A;  1UWV A;  2JA6 B;  2JYO A;  2ZJQ A;  5BR8 L;  2E2H B;  3NPP A;  3HOU H;  3M3Y B;  2DUD A;  1NUC A;  1GUS A;  3P1H A;  5E7N A;  2Z4I A;  2I0Q A;  3L9A X;  2OCE A;  5IY0 A;  4I65 A;  4UDU C;  1Y69 U;  2B63 G;  2KQ3 A;  2L12 A;  5EJW A;  3F2C A;  3CCE A;  1QB5 D;  1X6O A;  1W6K A;  3I73 A;  5FJ8 H;  1CK1 A;  4XYQ A;  2PYK A;  4JPB W;  2E2J B;  2N55 A;  4PMB A;  3GTO H;  3I2Z A;  3DEO A;  1HQR D;  1QE6 A;  3SK4 A;  3OTO L;  3HZX A;  1X55 A;  3MA2 B;  1KC8 C;  5C4Z A;  4KHP Q;  1I4P A;  1B53 A;  1PTO D;  1QZH A;  5C44 H;  1PMR A;  3BDO A;  4DR6 Q;  2CKZ B;  3I4N H;  3BZC A;  3HOX B;  4EVO A;  1LAB A;  1N9W A;  1K0S A;  3I90 A;  4IQZ A;  1V1Q A;  1EFI D;  2E75 C;  4DR2 L;  1FD7 D;  2KCC A;  1PYW D;  5LHY 1;  1JJ2 A;  1EIG A;  1OXX K;  4JI3 L;  5IE8 A;  3J81 E;  1SYB A;  1UE6 A;  2NTT A;  3GTG B;  1A8V A;  2C5C A;  4F88 A;  4OO1 G;  4G4K A;  4C56 C;  4OWX B;  2K5D A;  3X3M A;  1NE3 A;  4DXF A;  1XXG A;  2VUM H;  2HUG A;  2UXD Q;  4XQJ A;  2X6L A;  2PI2 E;  1JOO A;  2NN6 G;  1BCP F;  3OW7 A;  1MD2 D;  4IPD A;  2RDH A;  4YHH L;  5M5Y H;  3MXU A;  2JA8 B;  4BBS G;  1IBL Q;  5M9O A;  4DUZ L;  1I3Q B;  1KNA A;  4LUO A;  1SFO B;  1Y1V G;  2ZTD A;  3S15 H;  1VF7 A;  1PRT D;  4JI7 Q;  2ENB A;  1S5C D;  1IZ6 A;  2PQE A;  1BF4 A;  4FVM A;  5C4J H;  1HNX Q;  2NVX H;  5F2D A;  3DUZ A;  4ODG A;  2MQH A;  3DM1 A;  4Y7N H;  5KND A;  1E24 A;  1UAP A;  1E1O A;  4CDC C;  4MNO A;  3NTI A;  3RZD H;  5EBD A;  5IT9 c;  2K04 A;  4DUY Q;  1TWG B;  4ILW A;  1PH6 A;  4UP9 A;  1GUG A;  4HJ5 A;  1PZJ D;  2JA9 A;  3QR8 A;  4L8J A;  5FLM G;  1ET9 A;  2R93 H;  4P72 A;  5IT9 L;  4BY1 B;  4A3B H;  4BY7 B;  2G9H D;  1QG7 A;  2VW9 A;  1KDB A;  4C3I B;  3CCL A;  4GLX A;  1O7I A;  2O2L D;  1H9R A;  1CUK A;  2EOT A;  4K5W A;  5EPL A;  1Z47 A;  1NMG A;  1I94 Q;  1Q90 A;  1STN A;  1VQL A;  1PZK D;  3HOV B;  2DN8 A;  4JG2 A;  4FXG C;  2LS0 1;  2AHO B;  4X65 L;  1N36 L;  4IPH A;  3FDT A;  1CQF A;  5KIX A;  1LTL A;  1OTC A;  2B8G A;  4H13 C;  3RR5 A;  2NVQ B;  5JJK A;  4B9X A;  1VQI A;  4HSP A;  4RKB A;  3TP8 A;  2K1B A;  3HOY B;  1HTP A;  2UUC L;  2ZT9 C;  1HPC A;  2JA5 H;  4JBK A;  2QCP X;  4JI0 Q;  4V19 0;  4DA2 A;  2CW0 D;  3PF5 A;  3HOW H;  2F4V Q;  1JE4 A;  3VR6 A;  4F8M A;  1HNZ L;  1LT3 D;  1TVX A;  2R6G A;  3E3X A;  3K5N A;  1DOK A;  4G7H C;  1KNE A;  3NBH B;  2AMC B;  3M4O B;  1IYV A;  5ELB A;  1JIC A;  4RWS C;  1PTO C;  2NVY B;  4R8I A;  4A3G B;  1G8Z D;  5IWA Q;  4H02 A;  2QGQ A;  4NXM Q;  4RGO S;  3TRE A;  3FPU B;  1L1O C;  1PFS A;  2N3S A;  2QW7 A;  4ZLT F;  3URY A;  1CSP A;  4FYD A;  2E8G A;  2B3G A;  2A68 D;  3PGZ A;  3BU2 A;  3BVZ A;  2HDL A;  2BA0 A;  4DR3 L;  4P75 A;  4DR5 Q;  4A3F B;  4POF A;  5T1G A;  5COR A;  4DFA A;  1JR0 D;  2OT2 A;  3MC0 B;  1CHP D;  1WD1 A;  2A8V A;  3E0E A;  3K5M A;  1X3E A;  5ELC A;  4KK7 A;  4JI1 Q;  4A3J H;  2GVB A;  1XPO A;  4J8Q A;  5ELO A;  2QA4 A;  1BXT A;  2JK8 A;  2EPB A;  4HMI A;  3TRZ A;  4DV0 L;  1ENF A;  1UEA B;  2B2W C;  1KQS A;  3GTG H;  2B2T C;  1GHK A;  1PZI D;  4PZ6 A;  3I4O A;  1WD0 A;  4LFB L;  1PRT C;  4PZ8 A;  3K5L A;  4LUZ A;  2K5H A;  4BXX G;  4NPS A;  1TY0 A;  4QF4 A;  5D3I B;  2JA7 G;  2K28 A;  4NDX A;  1X3F A;  1GHJ A;  2PPB C;  3D4W A;  3D6C A;  4J1M A;  2A69 D;  3ULP A;  4P71 A;  3VR5 A;  4CDD C;  3KJP A;  1AP0 A;  2Y0S E;  4IZ8 A;  1I3Q H;  3P7J A;  4F87 A;  4RMF A;  1KAA A;  1LTR D;  3CQZ B;  1D1K A;  2NN6 I;  4LF5 L;  3NEL A;  3S1N B;  2ATW A;  2JE6 I;  2KCT A;  3PF4 A;  1G91 A;  1RKN A;  4LJZ C;  1N32 Q;  1I6V C;  3DEP A;  4KKU A;  2KED A;  3HKZ E;  5BN4 A;  2MHV A;  5C0X H;  4DF7 A;  4IFD J;  3C1E A;  1PH7 A;  4M8A A;  1HZA A;  5IP9 G;  3X3N A;  3M85 A;  3H91 A;  3DWP A;  2VL6 A;  3CD6 A;  3Q8D A;  3T16 A;  1IL2 A;  5JEA H;  3KF6 B;  4YCU A;  1I4R A;  1E2Z A;  2TSS A;  4LF7 L;  4A3L H;  4K14 A;  3W5O A;  2XN9 C;  3HS0 C;  4B3T Q;  1OXV A;  1K9M C;  2EXD A;  3R93 A;  2E76 C;  1CTM A;  2ID0 A;  3T4A C;  4BY1 H;  3RZO B;  2WII B;  5M3M G;  3TEH B;  4OIK A;  4C3I H;  1HRJ A;  3MEH A;  1PLF A;  1ESF A;  1NNX A;  1SBB B;  2CW0 C;  1IXR A;  1I50 B;  1S5B D;  3MXN B;  3U9S A;  3T51 B;  1MI2 A;  3HOV H;  1EY9 A;  4RG1 A;  1TWF B;  3H09 A;  3CU7 A;  2RHQ B;  4DR7 Q;  2NVQ H;  1EQQ A;  5EQ0 A;  5JPM C;  5C3E B;  5KRU A;  4A93 G;  2Z6K C;  3I56 A;  2D62 A;  1F2L A;  1ZXT A;  3HOY H;  1QUQ B;  2WKD A;  4C3H G;  2CFM A;  1K0R A;  1P16 A;  2KEE A;  1CM9 A;  1QJO A;  2PNH A;  5IIF A;  5JJZ A;  2CH4 A;  4IFD G;  2FIN B;  3MHB A;  2XRS D;  4GNX C;  2A68 C;  2OTJ A;  2XTI A;  1TWC H;  2VY3 A;  3M4O H;  4QJF A;  1F9Q A;  1NJI C;  4MTK A;  3FMC A;  3SR1 A;  2MGS A;  5C4H A;  1DZ1 A;  2NVY H;  3CPW A;  1HFG A;  3M4Q A;  3CC4 A;  3P20 A;  1XNQ Q;  4MHE A;  4R4I A;  1UE7 A;  4ME3 A;  3IFD A;  2L55 A;  1EUJ A;  3VYR A;  1EWC A;  2R92 G;  1X56 A;  5FO7 B;  1K8G A;  3J80 c;  4DV5 Q;  4JV5 L;  1SNQ A;  2D2C C;  2JQO A;  4KTA A;  3JAM i;  5EPJ A;  2Z1C A;  2H4O A;  3J80 L;  1XMQ Q;  1SYD A;  4C3J G;  2EYL A;  4ULL A;  1Z6H A;  2KOL A;  2B8F A;  3Q24 A;  3MFG A;  2QF7 A;  5C5M A;  2Z0S A;  5M5W B;  4U68 A;  5E1F A;  5A2Q E;  2AQ3 B;  1GVP A;  1EQR A;  1PTO H;  5IOC A;  1P8L A;  2SOB A;  2A69 C;  1JT8 A;  4CKE A;  4QMG A;  4MN3 A;  3NWS A;  3HOU G;  3GTM B;  2B2W A;  2NVT B;  3NTH A;  5FOB B;  4C3H B;  1SJE D;  1PH3 A;  2RQX A;  1F77 A;  1E0B A;  4GS3 A;  4K0K Q;  5LMN L;  4AYB B;  4IAL A;  2K14 A;  1Y14 B;  1HA6 A;  4HTH A;  5HUR A;  5JVG 3;  3KF6 A;  4RGN A;  3D4R A;  5FJ8 G;  1IHZ A;  4X3K A;  2L11 A;  3V05 A;  3VYT A;  1N8R C;  4UHV A;  1F9P A;  2A6E D;  1VQP A;  1ICW A;  3KK7 A;  3GO5 A;  1V9P A;  2A1A A;  3F2D A;  3CQZ H;  3G7L A;  3S2H H;  1YVC A;  3S1N H;  5C44 G;  1H9M A;  4AH6 A;  4B3M L;  2ZTC A;  1EQV A;  4OHJ A;  1TS5 A;  3MXN A;  4GKK Q;  4YWK A;  1STB A;  2OTL A;  4QL5 A;  5GQO A;  3I4M B;  4QB4 A;  3KLS X;  2VQF L;  1JJG A;  2AQ2 B;  1HFN A;  3JAM c;  2K03 A;  3IFT A;  1DOL A;  3RNU A;  1YI2 A;  1PYS B;  2WP8 J;  4QIW B;  2K75 A;  5JPN C;  4JI2 L;  5COY A;  4C3J B;  1AH9 A;  1AE2 A;  3E5S A;  4IPC A;  3JAM L;  1QUQ A;  2JP1 A;  5GAH C;  1V1P A;  3T1Y Q;  1Y1W B;  3LWU A;  2EIF A;  3TZD A;  5BN5 A;  1B9N A;  2Q8I B;  4HMJ A;  1TWA H;  3GTP H;  2L1B A;  3D4D A;  2IY5 B;  3NBI A;  2B29 A;  1K8O A;  1Q8K A;  2J7Z A;  4L63 B;  3QWN A;  1SAP A;  2RF4 A;  1YNX A;  1I6H H;  2SNM A;  2V1C C;  2YTY A;  5JJL A;  3PO2 G;  4DR4 Q;  1XX8 A;  4ZAI A;  1TWF H;  5M3F G;  4G7Z C;  3GTL B;  1WTP A;  1FNU A;  3NWT A;  4CKC A;  3OWF A;  3K7A B;  1SNM A;  3GTK H;  1ASY A;  1JQY D;  2UUB Q;  1FR3 A;  5DNF A;  1N34 Q;  3S1R H;  2ES2 A;  1GUN A;  2ASB A;  2BOS A;  2EY2 A;  4L5R C;  1X65 A;  2FXQ A;  1EY6 A;  3RLO A;  2EVB A;  1CA6 A;  4MIU A;  1SXT A;  3DLL A;  5LMN W;  5D3D A;  4QGU A;  3GTQ B;  3A54 A;  4WJ3 M;  3SEB A;  4CDE C;  5DLQ E;  4A3B G;  4FP5 D;  3CRL C;  4XTC S;  3EJI A;  1PA6 A;  2BDN A;  1TQO A;  2E5L Q;  3AQQ A;  4NMZ A;  4M1U B;  3NUC A;  5IOD A;  1Q7Y C;  4IJH A;  5J39 A;  1TY2 A;  2UXB Q;  1GJX A;  4BBR B;  1CZG A;  1Q1B A;  5I2Y A;  1PFB A;  4JI8 L;  5HGQ A;  1XNR Q;  1RL2 A;  2WAQ E;  4ZKB B;  4A3K G;  2PMZ B;  3A74 A;  4IN3 A;  4KY7 A;  3NE5 B;  5M5W H;  3ONA B;  2Y0S G;  5ELF A;  4RFB A;  3HOW G;  4A75 A;  4HAE A;  1EIF A;  1U4R A;  5I6W A;  5M3F B;  4DAY A;  1CSQ A;  4L5Q A;  2A6E C;  5I2X A;  1SN8 A;  1KAW A;  3UI2 A;  4A3M B;  3HKZ G;  2VB3 X;  3H6M A;  1EY8 A;  4RGM A;  4DK0 A;  2XRQ D;  5FLX E;  1B50 A;  1QCB D;  3PO3 H;  1DD2 A;  3L7Z C;  5CMD A;  2PW7 A;  1A2U A;  4K6L A;  3CMA A;  1KD1 C;  2IJ0 A;  5L37 A;  1JC7 A;  4A76 A;  3K7U C;  4IUP A;  1PH5 A;  1OXS C;  1M4V A;  1X32 A;  4ID6 A;  3H3V C;  4Y52 H;  2I5L X;  2F0L A;  2WB1 B;  1F2M A;  3PUY A;  2DNC A;  2A19 A;  5CV7 A;  2N78 A;  2K4K A;  4FF2 A;  1JCK B;  1HZB A;  3CCJ A;  4FDB A;  1PH1 A;  1K83 B;  4G57 A;  4O1N A;  3UDG A;  3ND9 A;  3KFU A;  1EEI D;  4GLA C;  4UP8 A;  2EY1 A;  2KHI A;  3FKI B;  3WOE A;  2EE1 A;  4R4Q A;  4A3C G;  3I7F A;  2X6G A;  2R7Z G;  4A3J G;  1O7Z A;  4F7X A;  1PFN A;  1GM5 A;  1SLJ A;  5HGT A;  2GN5 A;  2JXM B;  4A3I G;  3F2B A;  1N33 Q;  2L0C A;  3OSO A;  4KHZ A;  1D5M C;  3M4P A;  4KI0 A;  4DV2 L;  5AFW A;  1VQH A;  1VQD A;  1H95 A;  3F1Z A;  1X54 A;  1Y1W H;  3BDC A;  4QQB X;  4YWL A;  4ZK9 B;  2GA4 B;  4H7B A;  1QVF A;  4C2M B;  4DR1 L;  2I46 A;  3ULL A;  1AE3 A;  3R8B A;  4DV3 Q;  1T5E A;  4XXE A;  2K5V A;  3QG1 A;  1SNP A;  1WCM H;  1K3R A;  1F9R A;  4KN7 C;  5CV4 A;  2NUC A;  5EGT A;  5BR8 Q;  2F0P A;  1G51 A;  3CCQ A;  2D0P A;  3CP0 A;  4KHP L;  2XVS A;  4JBM A;  2WFW A;  3EIV A;  3S1M H;  1NR4 A;  3QB3 A;  4A3D B;  1X3P A;  3RMH A;  5G3L F;  3S2D B;  3HOZ B;  2RA4 A;  5C3X A;  1D2B A;  1HZC A;  4WOR A;  3S1Q H;  4TVA B;  4LFC L;  1KRS A;  2ICE C;  1QWY A;  3A7L A;  4AYB E;  5FK9 C;  1D5Z C;  2F3V A;  3GTJ B;  3J7A V;  1SSO A;  3OTO Q;  3D3R A;  1A0I A;  4HSV A;  4TSS A;  1B3Q A;  1S5E D;  3AB9 A;  2R7F A;  3CCV A;  3PUZ A;  4KLK A;  3I3C A;  3BS1 A;  2F1M A;  3J81 j;  2UXD L;  1TS2 A;  3HG9 A;  1SYC A;  2LXK A;  4DR2 Q;  4A3I B;  4ZUJ A;  1B4O A;  3B6Y A;  3NP8 A;  4JI3 Q;  3E6Z X;  1IBL L;  5IGG A;  4EQO A;  2F52 A;  4ALP A;  2B63 B;  2PZU A;  1R9T H;  4HR7 B;  3VYS A;  2AWN A;  4Q0F A;  1IBK L;  1U4P A;  2O4X A;  5C4X H;  5AJ3 L;  1KDA A;  1KHI A;  3NHH A;  3MTS A;  3NEM A;  3TP7 A;  1OXT A;  1AEX A;  1NSN S;  1CI3 M;  1ZEQ X;  2EQS A;  2EYM A;  2H1E A;  5KYI A;  4GKJ L;  4HJ9 A;  4PMW A;  4O42 A;  4A4I A;  4NXN L;  3CAM A;  1VQ8 A;  3M9B A;  1DXM A;  4FF4 A;  4DN4 M;  3SDZ A;  1DGS A;  1HUN A;  3S14 B;  1JOQ A;  1SYE A;  1UNS A;  1MIU A;  4XQQ A;  3BJU A;  4ZQ3 A;  3H0G G;  2A6H D;  4X62 L;  2Z8L A;  3PUX A;  3H3V I;  1GOZ A;  3TN2 A;  2N88 A;  1PTO F;  3G4S A;  3ERQ A;  1PH2 A;  2F0N A;  5EBC A;  2XGT A;  2BE5 D;  2R3Z A;  1HR0 L;  5IYC H;  5K36 G;  1YIT A;  1A2T A;  1JWS D;  4N8X 1;  3A5Z B;  1VQ7 A;  4MZ9 A;  4JI0 L;  3N6R A;  1MHW C;  2F0O A;  3CHB D;  4BBS B;  2Z4H A;  1KL9 A;  1Y1V B;  3CCU A;  3IRB A;  5IYB G;  3DHQ A;  2JA6 H;  1FJG L;  1YJ9 A;  5CV9 A;  2E2H H;  2KJX A;  4JW0 A;  5IGE A;  1WYD A;  2CWA A;  1AN8 A;  1BCP B;  3M3Y H;  2KCN A;  1PH8 A;  1WTW A;  1K8M A;  2RKS A;  2PW5 A;  5IWA L;  4NXM L;  5CBA E;  5EKI A;  3H3V H;  2UUC Q;  3BDL A;  4L5S A;  3MZ5 A;  3T1H L;  4C2M H;  1L0W A;  2EYF A;  3U4V A;  1HNZ Q;  2E2J H;  1CA5 A;  3S24 A;  1DON A;  1J9O A;  2YV5 A;  1PRT F;  5IGC A;  3OOC A;  2F0V A;  3TDQ A;  5KNB A;  2CCZ A;  4KY5 A;  1GUW A;  2F0D A;  4K2L A;  2EY5 A;  2V4D A;  4FO2 A;  1BDO A;  1ONL A;  1FNW A;  3MXP A;  3HOX H;  2Q2H A;  3S2D H;  3HOZ H;  3GV3 A;  4L6T B;  1SE4 A;  1KIX A;  4CJ1 B;  1PHJ A;  2MPM A;  1WTQ A;  1X3G A;  1AZP A;  4KKS A;  1H9S B;  3EVQ A;  3RN5 A;  2WAQ G;  2CWP A;  3KJO A;  1B1Z A;  3TS2 A;  3PIP A;  1HNW L;  2F0S A;  3BYT B;  5C0X I;  1BBU A;  1JB3 A;  1ICF B;  4IUN A;  2VQE L;  1YHQ A;  2AWO A;  4UAI A;  1EWI A;  4U67 3;  3K57 A;  4KD4 A;  2WB1 E;  1VMC A;  1YEZ A;  1VQJ A;  2F0J A;  1D7Q A;  1TR5 A;  2JA8 H;  1SFO H;  2MO1 A;  2SEB D;  2ZXO A;  1HR0 W;  1U0L A;  4HID A;  5C5L A;  4LFB Q;  1YNJ D;  3I55 A;  1NMF A;  4RA8 A;  4V0B A;  3J81 c;  1Q82 C;  2UU9 L;  3STB D;  2A5H A;  4JYA L;  4EQP A;  3FP9 A;  3W1G A;  3PSI A;  1IL8 A;  1I4X A;  3U50 C;  4RGT A;  1YJW A;  4LF8 L;  5KNC A;  3J81 L;  2A74 C;  4O2D A;  1G2T A;  4CGY B;  2A6H C;  4NW2 A;  1M90 C;  2Z9H A;  4CKB A;  2EZV A;  2M9V A;  2K05 A;  1TWG H;  4AIM A;  4LF4 Q;  1XMO L;  4LF5 Q;  3J80 i;  2BA1 A;  2K33 A;  3T56 B;  1EZ8 A;  1LYL A;  1WTV A;  2BE5 C;  1S5D D;  2MJ8 A;  4DPG A;  3QOL A;  3VA7 A;  2KEN A;  3QO2 A;  4BY7 H;  2CHB D;  2B2V A;  3S14 H;  4DKA C;  1Q46 A;  1YHA A;  1R4P B;  1LAC A;  3I4L A;  4NP5 A;  3C46 A;  4B3S L;  4WJW A;  1II3 A;  1OO9 B;  1BQQ T;  3NBH A;  3Q22 A;  4DV7 L;  3NTK A;  4LF7 Q;  1T5X D;  3F8T A;  3KBX A;  2JA7 B;  4BA2 I;  2F0Q A;  2MUY A;  3L3O C;  1Z9F A;  1Y8O B;  2M2L A;  3UDX A;  2HT1 A;  2HHH L;  2PCF B;  4OIJ A;  3KLW A;  2N8N A;  2OEO A;  1XTD A;  3T53 B;  4A3E G;  3ITP A;  4X64 L;  2MFI A;  3A8K E;  2AUJ D;  3LNN A;  3W3A A;  4GLV B;  4DV4 Q;  1DM0 B;  2B2U A;  3GDE A;  4TQU S;  4CJ0 B;  1DJR D;  3ZJY C;  3RUZ A;  1S40 A;  2F0K A;  4AQY Q;  2A73 B;  1G29 1;  2MNA A;  4KN4 C;  1WI5 A;  2IHF A;  4A3G H;  1XNQ L;  4RCN A;  3ERO A;  4H44 C;  1H9S A;  1FL0 A;  4HCE A;  3PO3 G;  1K3B C;  1SYF A;  1SRO A;  2UUA L;  3TP5 A;  4DV5 L;  5CYU A;  2F0W A;  2ZJP A;  3GP7 A;  1WJJ A;  1UEB A;  5E3F A;  1STH A;  5CBE E;  1H9J A;  3A55 A;  5M3M B;  4NKL A;  3MAQ A;  4FXK C;  2YTX A;  2B39 A;  4A3F H;  5DAU A;  2UXC Q;  1EU4 A;  4FF3 A;  2WKC A;  5CGK A;  3U9O A;  3E9I A;  5IYD H;  4WRD A;  4E6I A;  1BUV T;  1A3U A;  1RD9 D;  2K52 A;  3F2U A;  1E2W A;  4JV5 Q;  3CPF A;  3HGB A;  2AUK A;  1E7Z A;  1FYC A;  1ET6 A;  3LGJ A;  4A93 B;  1D5X C;  3S16 B;  2K5N A;  4UPA A;  2BH2 A;  4TKO B;  2YU9 B;  1YNJ C;  1UE1 A;  2QDL A;  4K0K L;  4GNX B;  3STB C;  4EX5 A;  4A3E B;  4JI4 Q;  2O5I C;  4IJL A;  1TXY A;  4JOI C;  3NXW A;  3P75 A;  3KLS A;  4JI6 Q;  2RDG A;  4PZ7 A;  1VQO A;  1ROD A;  1MGS A;  1HTL D;  4XIG S;  1WCM G;  5EKK A;  5IP7 H;  4DV1 L;  3KOJ A;  1KXL A;  4NB3 A;  1STY A;  3QOJ A;  1TWH B;  3D6W A;  3Q0A A;  4X66 L;  3R2I A;  1T9H A;  5M5X B;  1ESR A;  4HJ7 A;  4B3R Q;  4FF1 A;  5LMN Q;  2IL8 A;  1PVO A;  1A63 A;  3I4N G;  5JVH 3;  1C8C A;  2R92 B;  4R1J A;  5CC4 A;  1Q8I A;  4OWW B;  4LF6 Q;  1SE2 A;  1SMY D;  3H15 A;  1SRU A;  1CZW A;  4DU9 A;  4LW1 A;  3K0X A;  1O78 A;  1I5F A;  4R4T A;  3ICE A;  4GZY C;  1LTS D;  1ILP A;  3VDY A;  1LM0 A;  4LNQ A;  3MVV A;  3DXJ C;  5C6A A;  5IGB A;  3RLF A;  4IUT A;  3T1Y L;  1NY4 A;  1SNC A;  5DEH A;  3K5O A;  1ENA A;  1JOR A;  4P74 A;  4IOC A;  1X9N A;  4B3M Q;  3RZO H;  2VUM G;  4YY3 Q;  1XPR A;  2NZH A;  1G6Z A;  1YHB A;  2VQF Q;  4UP7 A;  1Y8P B;  4IPG A;  1I50 H;  4ZKC B;  4UY8 C;  3HOU B;  1WTO A;  4OX9 L;  1HUM A;  2EJM A;  2L9H A;  2DJF C;  1S5F D;  1LTT D;  4OL7 A;  1RTO A;  1VF5 C;  2JA7 H;  1WTR A;  3VR2 A;  4X3S A;  3H94 A;  5C3E H;  3PMF A;  3K81 C;  3CXC A;  3NQI A;  5C4X G;  1N34 L;  1EY5 A;  1W2B A;  1JE5 A;  1ML0 D;  3PIP 3;  2RBM A;  2K5W A;  2G9D A;  2EXZ A;  1GXD C;  3SK5 A;  1STG A;  5C3W A;  1QOH A;  5C44 B;  4IUR A;  1HCZ A;  1EYG A;  4EQ5 A;  1U9R A;  2EYO A;  2K7V A;  4CJ2 C;  4DK3 C;  2NZO A;  2R93 G;  4K6D A;  3EBE A;  4DV6 L;  4J15 A;  3C3L A;  1K8A C;  4JI5 Q;  2I07 B;  1QIL A;  1EEF D;  1NBW A;  5KYL A;  1LTA D;  3SK8 A;  4PQX A;  1SJH D;  2DY7 A;  3R3O A;  4XQN A;  2UXB L;  5E4W C;  2PO4 A;  4GOP B;  5J22 A;  1IBM Q;  2RCF A;  1C0A A;  1PFM A;  1CQV A;  3GD7 A;  1EY0 A;  4YIJ A;  1VQN A;  2F0U A;  4LFA L;  3PIO A;  1BBX C;  2IX0 A;  2K5Q A;  1O80 A;  2EJF C;  1BR9 A;  1BO0 A;  2CQO A;  5IT9 E;  3KF8 B;  2IWH A;  2ALY B;  1D8L A;  2JA5 G;  1B7Y B;  3UDF A;  5M5Y B;  3PO2 B;  2K6A A;  1NTG A;  4DNR B;  3AFP A;  2Q8R E;  3OIQ A;  1ZYR D;  3K59 A;  4DNT B;  1AFP A;  2KHJ A;  3G48 A;  2HDM A;  3MEF A;  1XYI A;  3K0Y A;  2NBF A;  1W6J A;  4A93 H;  3GTM H;  3S16 H;  2NVT H;  4ZUI A;  2YU9 H;  1DYQ A;  2NVX B;  2E2D C;  4DK6 C;  1YIJ A;  2EYP A;  4C3H H;  2ZM6 Q;  5CV5 A;  1C4Q A;  5I9P A;  3ERS X;  2F03 A;  1B70 B;  1STA A;  1HJP A;  3V96 A;  3U4Z A;  2KCM A;  4JOI A;  4IFD H;  2KUM A;  5JJI A;  1W3S A;  5TSS A;  1SMY C;  5NUC A;  3G6J B;  3TS0 A;  3WDN A;  4RKL A;  1VQB A;  1YBY A;  2KHS A;  1QVG A;  4A3B B;  2R93 B;  5M5X H;  3E0J A;  1M1K C;  5A2Q L;  5C0X J;  2HQL A;  4LF9 Q;  4HED A;  3HOX G;  2R92 H;  2LMC B;  2F3I A;  5JEA J;  1BCP D;  4QY7 A;  5LMU Q;  1EOT A;  2IX1 A;  3I4M H;  4HJA A;  1U4M A;  2JEA I;  4O0A A;  3FHW A;  1HA5 A;  4MTN A;  1E1T A;  3HEJ A;  3FVQ A;  3PQI A;  1MJE A;  1I4G A;  4C3J H;  4A3K B;  2LSS A;  1J5E Q;  1MJC A;  3GV6 A;  4IUV A;  3ZYY X;  1C7Y A;  3BZD B;  2Y0S B;  2IPK D;  2KBN A;  4LUV A;  3HOW B;  3PUV A;  4DV3 L;  2L4N A;  4R8N A;  3D8G A;  3HP3 A;  5GAE C;  1VQ4 A;  3I91 A;  3J7A 5;  2NWG A;  4L5T A;  1KRT A;  3C2P A; 
#chains in the Genus database with same CATH homology
 2D62 A;  1VQ6 A;  4GOP C;  3OYY A;  1PH8 A;  3HOY H;  1JJC B;  1QUQ B;  4WJ4 A;  2CFM A;  1Q81 C;  2JA8 G;  3CW2 C;  5IWA L;  1K0R A;  1P16 A;  4NXM L;  3H3V H;  2OWO A;  2UUC Q;  4OX9 Q;  4L5S A;  2PNH A;  4DV2 Q;  5GAG C;  1ASZ A;  3UE0 A;  3GTL H;  3T1H L;  4C2M H;  4IO9 A;  4DR6 L;  4IFD G;  2RHS B;  1L0W A;  3G71 A;  3K7A H;  3ULJ A;  3U4V A;  3CCS A;  4DR1 Q;  4GNX C;  1JB7 A;  2OQ0 A;  1HNZ Q;  2XTI A;  3ER0 A;  1TWC H;  3A5U A;  3S24 A;  4A3M G;  2VY3 A;  1K73 C;  2E2J H;  2Z6K A;  4POG A;  3M4O H;  3CC2 A;  4QJF A;  5C0X G;  4GOP A;  2C35 B;  2YV5 A;  1NJI C;  2VS1 A;  4JI5 L;  4LF5 Q;  5IP9 H;  2NVY H;  2CCZ A;  2VNU D;  3CPW A;  3M4Q A;  2E5L L;  3CC4 A;  1XNQ Q;  5JEA G;  4R4I A;  1UE7 A;  2ZTE A;  4ME3 A;  5EAY A;  3M7N A;  1EUJ A;  4A3L G;  3HOX H;  2R92 G;  3M3Y H;  1EOV A;  2Q2H A;  1IBM L;  3GTQ H;  3S2D H;  3HOZ H;  1X56 A;  4GNX A;  3J80 c;  4DV5 Q;  1KIX A;  1K8G A;  4JV5 L;  4DR7 L;  1PHJ A;  1XNR L;  1X3G A;  3KYH C;  4BY1 G;  2WB1 G;  4BY7 G;  2JQO A;  4LWC A;  3JAM i;  5M3M H;  1L2F A;  4IFD I;  4OON A;  1VQC A;  5IYC G;  3RN5 A;  4DV6 Q;  4LFC Q;  2WAQ G;  1XMQ Q;  3PCO B;  2CWP A;  2OQK A;  3KJO A;  3NEN A;  3PIP A;  3TS2 A;  1HNW L;  2Z0S A;  5C0X I;  1WFQ A;  1BBU A;  2VQE L;  1LUZ A;  3JC6 6;  1QZG A;  1YHQ A;  3HOV G;  3FKI G;  2AWO A;  4BBR H;  4JI7 L;  1GVP A;  1EWI A;  1EQR A;  2N49 A;  1P8L A;  2JA6 G;  2WB1 E;  1JT8 A;  1YEZ A;  1VQJ A;  1HNX L;  4QIW E;  4JI8 Q;  4LFA Q;  4BA1 I;  3HOU G;  2Q2U A;  1C9O A;  1D7Q A;  2ZM6 L;  1CKM A;  3HOY G;  4IOA A;  2JA8 H;  1VQ9 A;  2IHE A;  2Q2T A;  4A3E H;  1SFO H;  2MO1 A;  3BZK A;  1V43 A;  3EN2 A;  3CCR A;  4YHH Q;  2JEB I;  1PH3 A;  1U0L A;  1HR0 W;  4GS3 A;  4HID A;  3PO2 H;  5LMN L;  4K0K Q;  4LFB Q;  4DUZ Q;  1GD7 A;  1NMF A;  5HY6 A;  4APV A;  3I55 A;  2PI2 A;  3J81 c;  4DUY L;  5M3F H;  1Q82 C;  2K14 A;  1JMC A;  1Q12 A;  3STB D;  1Y14 B;  2UU9 L;  4JYA L;  1VQF A;  3FP9 A;  3KF6 A;  1FVI A;  3PSI A;  3W1G A;  3RN2 A;  4JC0 A;  4GN4 B;  2HIV A;  5FJ8 G;  4A3M H;  4DNI A;  1GKH A;  3U50 C;  1IBK Q;  1YJW A;  4JBW A;  2GVA A;  4P73 A;  4LF8 L;  1TWH H;  1N8R C;  1PH9 A;  4O2D A;  1VQP A;  2H5X A;  5AJ3 Q;  4A3G G;  3DM3 A;  2I5H A;  3GO5 A;  1V9P A;  2A1A A;  3F2D A;  4LF9 L;  3CQZ H;  1M90 C;  3S2H H;  2Q2I A;  4A3D G;  1KRT A;  1YVC A;  3S1N H;  1VCI A;  1I94 L;  5C44 G;  1TWG H;  1GO3 E;  4AIM A;  3J7Z C;  4LF4 Q;  4JCV E;  4AH6 A;  1XMO L;  2ZTC A;  2BA1 A;  3J80 i;  5LMU L;  2E2I H;  1U5K A;  4B3M L;  3HOZ G;  4GKJ Q;  1LYL A;  2PQA A;  2VZA A;  4GKK Q;  4DPG A;  4NXN Q;  4YWK A;  1MKH A;  2KEN A;  4QL5 A;  5GQO A;  2OTL A;  4BY7 H;  1N33 L;  2VQF L;  1JJG A;  2HIX A;  3JAM c;  3S14 H;  3RNU A;  1YI2 A;  1PYS B;  2WP8 J;  2K75 A;  4A3F G;  4DKA C;  4JI2 L;  1Q46 A;  1YHA A;  1J5E L;  2AKW B;  3S17 H;  4B3S L;  1S3O A;  1QVC A;  1AH9 A;  1AE2 A;  1K83 H;  4IPC A;  5IYD G;  4DV7 L;  1B8A A;  1QUQ A;  5GAH C;  4LF7 Q;  4HIO A;  2F4V L;  3FKI H;  3T1Y Q;  2EIF A;  2D0O A;  3F8T A;  4X62 Q;  5FLX c;  1TWA H;  4BA2 I;  1N36 Q;  3GTP H;  1J6Q A;  4X65 Q;  2IY5 B;  1XPU A;  1UWV A;  2B29 A;  1Q8K A;  2ZJQ A;  5BR8 L;  1Z9F A;  3HOU H;  3UDX A;  2RF4 A;  2HT1 A;  4A3K H;  2DUD A;  2HHH L;  1HR0 Q;  3KLW A;  1YNX A;  3K80 C;  2N8N A;  1I6H H;  1XTD A;  4A3E G;  5E7N A;  2V1C C;  2YTY A;  3D31 A;  4X64 L;  2MFI A;  2I0Q A;  3PO2 G;  5JJL A;  2OCE A;  5IY0 A;  4DR4 Q;  3J81 i;  3WWV A;  4GLV B;  4DV4 Q;  1TWF H;  2QEX A;  2B63 G;  5M3F G;  3GDE A;  4TQU S;  3F2C A;  3CCE A;  1X6O A;  2RCN A;  3ZJY C;  1WOC A;  5FJ8 H;  3GTK H;  1ASY A;  1S40 A;  1FJG Q;  2PMZ E;  4AQY Q;  1VQK A;  2I5M X;  5IP7 G;  2UUB Q;  1N34 Q;  3S1R H;  1UE5 A;  3GTO H;  1G29 1;  3I2Z A;  2MNA A;  2ES2 A;  5H1S E;  1WI5 A;  4DR5 L;  2IHF A;  2ASB A;  4A3G H;  1XNQ L;  3OTO L;  4L5R C;  1X55 A;  1VQA A;  1KC8 C;  4KHP Q;  1X65 A;  4A3D H;  1FL0 A;  3PO3 G;  2FXQ A;  2YTV A;  1QZH A;  1BVS A;  3RLO A;  1E22 A;  1SE8 A;  1SRO A;  5C44 H;  2UUA L;  4DV5 L;  3T1H Q;  4DR6 Q;  3DLL A;  1RIP A;  2CKZ B;  3BZC A;  3CC7 A;  5LMN W;  3I4N H;  4JI1 L;  1N9W A;  4QGU A;  2ZJP A;  3TQY A;  1V1Q A;  1WJJ A;  4WJ3 M;  1UEB A;  5DLQ E;  3L2P A;  4YCV A;  4A3B G;  4XTC S;  4DR2 L;  1JJ2 A;  1PA6 A;  1OXX K;  3GTJ H;  2YTX A;  4JI3 L;  5IE8 A;  4A3F H;  4DR3 Q;  2UXC Q;  4YWM A;  1UE6 A;  2E5L Q;  3AQQ A;  1A8V A;  3E9H A;  3E9I A;  4OO1 G;  5IYD H;  1Q7Y C;  4IJH A;  4OWX B;  5GAD C;  2UXB Q;  3RLN A;  1NE3 A;  2K52 A;  1Q1B A;  4A3C H;  4JV5 Q;  2VUM H;  2R7Z H;  2UXD Q;  4JI8 L;  5HGQ A;  3CME A;  2PI2 E;  3CPF A;  1RL2 A;  1XNR Q;  1E7Z A;  1PH4 A;  2WAQ E;  4A3I H;  3LGJ A;  2NN6 G;  4A3K G;  2K5N A;  1L1O B;  3A74 A;  4UPA A;  4DV0 Q;  2BH2 A;  4IPD A;  1UE1 A;  5M5Y H;  4YHH L;  4K0K L;  4GNX B;  5M5W H;  4BBS G;  3STB C;  2Y0S G;  4EX5 A;  4DUZ L;  1IBL Q;  4JI4 Q;  4LUO A;  1HNW Q;  4IJL A;  1TXY A;  3HOW G;  3D0F A;  4A75 A;  1Y1V G;  3SGI A;  2VQE Q;  2ZTD A;  2B63 H;  1EIF A;  4JOI C;  1E3P A;  3S15 H;  2JJQ A;  3G6E A;  4JI7 Q;  4JI6 Q;  4PZ7 A;  1CSQ A;  1VQO A;  5C3E G;  1N32 L;  4L5Q A;  1IZ6 A;  4XIG S;  3CF5 A;  1WCM G;  3HKS A;  4OO1 I;  1SN8 A;  1KAW A;  5IP7 H;  4DV1 L;  3KOJ A;  5C4J H;  1HNX Q;  2NVX H;  1KXL A;  1BKB A;  4NB3 A;  3HKZ G;  2MQH A;  1Q1E A;  4X66 L;  4Y7N H;  1T9H A;  4OWT B;  1E24 A;  4HJ7 A;  3PO3 H;  4B3R Q;  1E1O A;  4MNO A;  3L7Z C;  4LF4 L;  5LMN Q;  5J3B A;  3UDI A;  3RZD H;  5IT9 c;  4B3T L;  4DUY Q;  1PVO A;  3CMA A;  1KD1 C;  2UU9 Q;  3I4N G;  1A63 A;  4JYA Q;  4R1J A;  1PH6 A;  4UP9 A;  4HJ5 A;  4A76 A;  3K7U C;  2JA9 A;  4OWW B;  1PH5 A;  1OXS C;  4LF6 Q;  2BH8 A;  5FLM G;  2R93 H;  4P72 A;  4A3B H;  3H15 A;  4LF8 Q;  2I5L X;  1SRU A;  4Y52 H;  3PUY A;  2VW9 A;  2A19 A;  4LW1 A;  3K0X A;  3CCL A;  1I5F A;  2N78 A;  4R4T A;  4GLX A;  1O7I A;  3ICE A;  2K4K A;  1CUK A;  3VDY A;  1LM0 A;  4LNQ A;  1HZB A;  3AEV A;  1FGU A;  1Z47 A;  4FDB A;  1SR3 A;  3RLF A;  3CCJ A;  3T1Y L;  1S72 A;  1PH1 A;  1NMG A;  1NY4 A;  3UDG A;  1I94 Q;  1VQL A;  3KFU A;  1VQ5 A;  4GLA C;  4JG2 A;  2KHI A;  4P74 A;  2AHO B;  4UP8 A;  4X65 L;  4R4Q A;  4IOC A;  1XMO Q;  1X9N A;  1N36 L;  3I7F A;  4IPH A;  2VUM G;  3RZO H;  4A3C G;  4YY3 Q;  1XPR A;  2R7Z G;  4A3J G;  2NZH A;  1LTL A;  1Q86 C;  1OTC A;  1YHB A;  3RR5 A;  1GM5 A;  1SLJ A;  2GN5 A;  3AFQ A;  4A3I G;  1VQI A;  4PG3 A;  3F2B A;  1N33 Q;  2VQF Q;  5JJK A;  1CKN B;  4UP7 A;  2OTJ A;  4UY8 C;  4IPG A;  1I50 H;  4JBJ A;  4KHZ A;  3M4P A;  1HZ9 A;  4KI0 A;  2L15 A;  2UUC L;  4OX9 L;  2JA5 H;  4JBK A;  4DV2 L;  3HFZ B;  4BBS H;  1VQH A;  4JI0 Q;  1VQD A;  4B3S Q;  4DV4 L;  1H95 A;  3F1Z A;  3PF5 A;  1IYJ B;  1X54 A;  1Y1W H;  3HOW H;  1Y1V H;  2DGY A;  4DV7 Q;  2JA7 H;  4YWL A;  4QQB X;  2F4V Q;  1QVF A;  3KDF B;  4HIM A;  4DR1 L;  3ULL A;  1HNZ L;  1AE3 A;  4DV3 Q;  5C3E H;  4AQY L;  3K81 C;  2ZJR A;  2K5V A;  2R6G A;  3CXC A;  1WCM H;  1K3R A;  5C4X G;  1N34 L;  4B3M Q;  3NBH B;  2AMC B;  5BR8 Q;  1JE5 A;  1W2B A;  1G51 A;  4DAM A;  3CCQ A;  2D0P A;  2HHH Q;  3W1B A;  1PV4 A;  3CP0 A;  4KHP L;  3L0O A;  4AYB G;  5IWA Q;  4JBM A;  4H02 A;  2QGQ A;  4NXM Q;  2WFW A;  4X64 Q;  3EIV A;  3S1M H;  1VQM A;  2IT1 A;  3TRE A;  1L1O C;  1PFS A;  2N3S A;  4X6A H;  1EYG A;  4EQ5 A;  4DK3 C;  1HZC A;  2NZO A;  3S1Q H;  5FLM H;  4TVA B;  1CSP A;  2R93 G;  2E8G A;  3EBE A;  2B3G A;  3PGZ A;  4LFC L;  4DV6 L;  1SMX A;  3BU2 A;  4GN5 A;  4J15 A;  1XMQ L;  1KRS A;  2BA0 A;  1K8A C;  4JI5 Q;  4DR3 L;  2UXC L;  4P75 A;  4AYB E;  1NBW A;  1CKO A;  4DR5 Q;  4HIK A;  3OTO Q;  4POF A;  1A0I A;  3U58 A;  3H0G H;  2UXB L;  1L1O A;  2R7F A;  3CCV A;  3E0E A;  3PUZ A;  4GOP B;  1X3E A;  4KLK A;  2UUA Q;  2A8V A;  1IBM Q;  1C0A A;  3J81 j;  2UXD L;  3GD7 A;  4R4O A;  4JI1 Q;  1VQN A;  3I4M G;  4A3J H;  2GVB A;  1XPO A;  5ELO A;  4LFA L;  2QA4 A;  3PIO A;  2JK8 A;  2IX0 A;  3TRZ A;  2LXK A;  4DV0 L;  4DR2 Q;  2CQO A;  1KQS A;  3KF8 B;  3GTG H;  3B6Y A;  1A62 A;  2ALY B;  1D8L A;  2JA5 G;  4JI3 Q;  1IBL L;  4JI4 L;  1G6P A;  4PZ6 A;  3I4O A;  1B7Y B;  3UDF A;  4LFB L;  4PZ8 A;  4LUZ A;  2K5H A;  4BXX G;  4NPS A;  1Y1W G;  1NTG A;  2F52 A;  5GRO A;  2JA7 G;  4ALP A;  4JI6 L;  3AFP A;  5IYB H;  1R9T H;  2R7D A;  2KHJ A;  2AWN A;  3G48 A;  3MEF A;  1X3F A;  1IBK L;  1PYB A;  4A93 H;  3GTM H;  1BBW A;  5C4X H;  3S16 H;  3AYH B;  2NVT H;  5AJ3 L;  3ULP A;  1YJN A;  2YU9 H;  1KHI A;  4DK6 C;  1YIJ A;  2ZM6 Q;  4C3H H;  1VQG A;  4P71 A;  3KJP A;  3NEM A;  2Y0S E;  1I3Q H;  1OXT A;  4B3R L;  3ERS X;  4RMF A;  4R4C A;  1B70 B;  1HJP A;  4GN3 B;  3CCM A;  3U4Z A;  1EFW A;  2EQS A;  2KCM A;  2NN6 I;  4JOI A;  3NEL A;  4LF5 L;  5JJI A;  1W3S A;  4YCW A;  4HJ9 A;  4PMW A;  2JE6 I;  2KCT A;  2ATW A;  4GKJ L;  4A4I A;  4GKK L;  3PF4 A;  4NXN L;  3PUW A;  3TS0 A;  4LF6 L;  1N32 Q;  3CAM A;  1VQ8 A;  3M9B A;  4IFD J;  1VQB A;  3HKZ E;  3UE1 A;  1PH7 A;  4DV1 Q;  1HZA A;  3OW2 A;  1DGS A;  1YBY A;  5IP9 G;  3M85 A;  1QVG A;  1XJV A;  2VL6 A;  5M5X H;  2LXJ A;  3Q8D A;  4X66 Q;  1IL2 A;  1M1K C;  3CD6 A;  3KF6 B;  4YCU A;  4DAY B;  5C0X J;  1MIU A;  2HQL A;  4OXP A;  5ELN A;  1OXU A;  3BJU A;  4LF9 Q;  4LF7 L;  1CKN A;  2YYZ A;  3H0G G;  4A3L H;  3W5O A;  4HJ8 A;  3HOX G;  2MO0 A;  2R92 H;  4X62 L;  2K50 A;  4B3T Q;  1OXV A;  2F3I A;  2EXD A;  5JEA J;  3PUX A;  1K9M C;  1VS0 A;  4QY7 A;  5LMU Q;  4YY3 L;  3H3V I;  2IX1 A;  3I4M H;  3G4S A;  4HJA A;  1EIY B;  2ID0 A;  4BY1 H;  1PH2 A;  4O0A A;  3FHW A;  1VQE A;  2JEA I;  2XGT A;  5M3M G;  3TEH B;  4MTN A;  1E1T A;  3KDF A;  4C3I H;  1HR0 L;  5IYC H;  5K36 G;  1MJE A;  1YIT A;  4C3J H;  3A5Z B;  1IXR A;  1VQ7 A;  4MZ9 A;  4JI0 L;  4JI2 Q;  2LSS A;  1YZ6 A;  1J5E Q;  1MJC A;  4DR4 L;  1HH2 P;  2PQA B;  3MXN B;  1C7Y A;  4BXX H;  3HOV H;  4BBR G;  2KBN A;  4LUV A;  4RG1 A;  1KL9 A;  3CCU A;  3PUV A;  3IRB A;  4DV3 L;  3PV0 A;  5IYB G;  5GAE C;  3K8A A;  2RHQ B;  1VQ4 A;  2JA6 H;  4DR7 Q;  1FJG L;  1YJ9 A;  2NVQ H;  1EQQ A;  3J7A 5;  2E2H H;  3A0J A;  4L5T A;  4A93 G;  2UUB L;  2Z6K C;  1WYD A;  2CWA A;  3I56 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...