5C3WA

Crystal structure of staphylococcal nuclease variant delta+phs v66h at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMHENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS V66H at cryogenic temperature
rcsb
source organism Staphylococcus aureus
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5c3wA00
1SYEA 3EJIA 2EY5A 3D4WA 1A2UA 1SNQA 1KAAA 2ENBA 2EY2A 3MXPA 3OMGA 4R8NA 5CV5A 5C3WA 5IGDA 2F0WA 5EGTA 1JOOA 2O4XA 5F2DA 3SK4A 3S9WA 1A3TA 4K2KA 2F0OA 3BDCA 2PZUA 2F0QA 2EYJA 3SK5A 4F8MA 3NHHA 3QOLA 4NKLA 3ITPA 1NSNS 2EYOA 4K2LA 4QF4A 5CV4A 2EY6A 5I6YA 3R3OA 1NUCA 4IUNA 5KYLA 4KY5A 4N9TA 4YIJA 2OEOA 4I65A 1JOKA 1SNCA 5C5LA 2M00A 1F2YA 3D4DA 5CR3A 5C3XA 3SR1A 4K5WA 3QB3A 2F3WA 4KJOA 3RUZA 5M9OA 4HMIA 4ZUIA 2OXPA 5CV7A 3NUCA 1STAA 3PMFA 2F0NA 5JOBA 4KTAA 3SK8A 1EY5A 1EY9A 1F2ZA 3BDLA 2PZWA 2F0PA 4QMGA 5I6WA 2SOBA 4HTHA 1EZ6A 2KQ3A 5J1ZA 1JORA 4G57A 4B9WA 4F7XA 3P75A 5J22A 4NDXA 1TT2A 2HQEA 3P1HA 4HMJA 5KGUA 1KDBA 3D6CA 4K8IA 4KJNA 5E1FA 1SYDA 4J6HA 1ENCA 3HEJA 4ZQ3A 5EKLA 5CV9A 5KRUA 2PW5A 1IHZA 1SYCA 4EQOA 5CV6A 2EYLA 1RKNA 5IGBA 4K6DA 3DMUA 3OSOA 5IIFA 2PYKA 5IODA 2RKSA 4PMBA 3NK9A 3C1EA 4PNYA 3QOJA 3C1FA 5DEHA 5IGEA 5CV8A 2PZTA 3OWFA 1EQVA 2EY1A 2F0DA 3TP6A 2F0FA 2LKVA 4KHVA 1JOQA 4J1MA 2PW7A 2F0GA 2F0MA 4IALA 2F0LA 3V2TA 2WACA 2RBMA 2EYPA 4DFAA 5I9PA 5E3FA 5HGTA 1SYFA 2NUCA 4LAAA 4KD3A 1KDAA 2F0TA 2EYMA 1II3A 2EYHA 4NP5A 4E6IA 1EZ8A 3ERQA 4EVOA 3TMEA 2F0EA 1A2TA 3E5SA 4EQNA 3SK6A 5IGFA 2F3VA 4WRDA 3DHQA 4IZ8A 5ISRA 1EY7A 2F0SA 3MVVA 4WORA 5C6AA 4RKBA 5CGKA 1F2MA 2KHSA 4K5VA 2QDBA 5HURA 2SNMA 4QB4A 5KYIA 1SNOA 4KD4A 2F0VA 1EYDA 4PMCA 2EXZA 4DU9A 3OMCA 1STHA 1EY4A 5C5MA 4K5XA 1A3UA 4KY7A 4KY6A 1SNPA 5IOCA 4ODGA 2F0JA 1TQOA 3NXWA 5C4ZA 5K5PA 1SNMA 3T13A 1KABA 1STGA 3H6MA 4DF7A 5CC4A 5KEEA 3EVQA 4DGZA 1STYA 4RKLA 1KDCA 4MIUA 5IGCA 4EQPA 3MEHA 3MHBA 4KV6A 3NP8A 1EY6A 1SYGA 1EY0A 1TR5A 1STNA 4ID6A 5DAUA 4K8JA 2F0KA 4H7BA 5EKKA 2SNSA 3T16A 5C4HA 5KIXA 1SNDA 4N9PA 3EROA 3LX0A 1SYBA 3D8GA 3NQTA 2F0IA 3U9OA 4B9XA 2RDFA 4ME5A 1STBA 1A3VA 2PQEA 3HZXA 3SHLA 2EYFA 5J39A 1ENAA 3MZ5A 4NMZA 3VA5A 4K14A 5NUCA 4S3SA 3TP5A 1EYCA 5I9OA 1EYAA 4ZUJA 3SXHA 5IGGA 5JAVA 3TP7A 1EY8A 3TP8A 2OF1A 4TRDA 4OL7A 2F0UA 2F0HA 1AEXA 1U9RA
chains in the Genus database with same CATH superfamily
1GUTA 1HR0W 4DR4Q 2EY2A 2ID0A 4DNRB 1BCPF 2F0WA 3K0YA 4GKKQ 4IFDJ 1AN8A 4DR3Q 5DM63 4ZK9B 3K59A 4ZKCB 4KI0A 3URYA 2F0QA 4F8MA 4GNXA 1DD2A 3NHHA 2QEXA 3DWAA 2EY6A 2L12A 2O2LD 4KY5A 3AEVA 2XNAC 1EWIA 4NXML 3AFPA 4B3SQ 2CFMA 2D9UA 4C3IH 4HJ9A 3HOUG 3IRBA 2XTIA 2XWBB 2MQHA 4FXKC 4K5WA 2IY5B 3C2PA 4OXPA 3GTLH 3S14H 5M9OA 1ESRA 5JJIA 4R4QA 2JA5G 2AKWB 1IBMQ 1B44D 1BOSA 1I6VC 3SE0A 4HTHA 2B3GA 3ER0A 2A6HC 1JORA 4DXGA 2MPMA 2K33A 1I6HB 2L11A 5G3LD 1JWSD 3QO2A 4YY3L 2CW0C 3AMUA 2JA8B 5LMNW 5IGEA 1FD7D 3DEPA 5COYA 1JJCB 1XMOL 2MHVA 5JEAG 2F0MA 2NVXH 2UXBQ 1EOTA 2RBMA 4GNXC 3PIP3 5M5YH 3A74A 2E2JB 1IW7C 4EQNA 4LUZA 1BKBA 5CYUA 1D5MC 4DV3Q 1TS5A 5C6AA 4IOCA 3FKIG 3G6EA 1PRTC 3FRPB 2E8GA 1EYDA 1A8VA 4OWTB 4K5XA 4KLKA 1SNPA 5IOCA 3CU7A 4TSSA 5EPJA 3H6MA 3QJYA 2MGSA 2M9VA 4LF8Q 3T16A 3I90A 1PH6A 1K8AC 4JI8Q 1IXRA 4AYBG 1EOVA 1EQQA 2IHFA 4CDEC 1SFOB 4B08A 3VR3A 2NZHA 3ULJA 3BYYB 3GTGB 3K7AH 4QY7A 1PRTF 1XX8A 4ZUJA 3JAML 5NUCA 1FJGQ 3D4WA 3HOWB 4R8NA 2E5LQ 1HJPA 3BVGA 1B2TA 3W2DA 1PH5A 4DV5Q 2BCOA 3E0EA 5IT9L 4C3IG 1XPUA 5JEAJ 2PO4A 1NR4A 3MWYW 4JI2Q 2L1BA 2F0OA 1DZ1A 3S1RB 1SN8A 3S16H 4K2LA 1C9OA 1VQIA 1B50A 3HOVG 4OIKA 1T9HA 1RCVD 1G6ZA 3KFUA 5C5LA 1VQ5A 1VQGA 3I2ZA 2X69A 4C1NI 3PMFA 2PZWA 2WFWA 3Q8DA 1T5XD 3OWEB 4NPSA 4G57A 3U50C 1TWHH 3I4OA 3NBIA 1KDBA 4DPGA 2N55A 1VQEA 3HEJA 4OGQC 1M1KC 3KLRA 1QE6A 1LUZA 2L4NA 1YNJC 5D3IB 2LS01 3C1EA 2E2HH 3J7A5 1HNXL 1V1OA 5EPLA 3EFXD 2I5MX 4FVMA 2WACA 1X3GA 4CDDC 3GTPH 2NUCA 2RSOA 1PH9A 4A3EB 1DJRD 2JQOA 3TSSA 1II3A 4E6IA 2GVBA 2ZJQA 1XNQL 3SK6A 1NAPA 1YHQA 3OOCA 4NXNL 5HURA 4QB4A 2F3IA 1X32A 2XSCA 3VR6A 3M3YH 1LTID 3RZDH 1ZYRC 4DU9A 2I5LX 5C3EH 1SLJA 2VUMH 4ODGA 1EU4A 1U4MA 4FF1A 4UHVA 1Z9FA 3IFDA 2EIFA 2KJXA 4HIDA 3T56B 4HJ8A 2IHEA 4L63B 2NVTB 1STNA 5IT9c 4H7BA 2WP8J 3GTMH 3PQIA 3X3NA 1XNRQ 1SYBA 2VB3X 1B70B 1STBA 3I4NG 1B53A 3FKIB 4S3SA 1GVPA 2ZXRA 5JVG3 1EY8A 5LL6S 1J8IA 1JWUD 4LMQD 3S1MB 3OMGA 2NN6H 4RCNA 5C4JH 5IT9E 4OWXB 3GTJH 1N36Q 1BR9A 3T1HL 4GKJQ 1DOMA 3DM1A 1B8AA 3NEMA 3A5ZB 4DV7Q 4AYBB 4YCUA 2MNAA 1Q82C 1JT8A 3C3LA 1WI5A 3J80E 2VQFQ 1WTOA 4BY7G 1D1KA 4V190 1TVXA 2F3WA 1RTNA 4RHSA 2R92H 4ZUIA 2OXPA 2NZ1D 3N52A 2B63G 3PIO3 4DK0A 1XTCD 1DONA 2PNHA 5E7NA 2WKDA 4GN4B 4A3JH 3KOJA 1C4QA 2JSOA 4DV0L 1IBKQ 4K8IA 1WD1A 2N49A 1ASZA 2ALYB 4PG3A 3K80C 4JV5L 1IBLL 4LFAL 1KTKA 4IN3A 4IPCA 1LACA 2DJFC 4R4TA 3BZCA 4JYAL 3HOVB 2FXQA 1PV4A 5G3LF 2PW7A 1Q86C 1UEBA 1ML0D 4ZCKA 4RGNA 1GUNA 2KVMA 4U673 2JJQA 1SYFA 4IUPA 4LAAA 1PHJA 4B3MQ 2EYMA 5C3EG 1WVLA 1K3BC 4O42A 1X3FA 3NENA 4DR5L 1M8AA 4RFBA 3PUWA 1VQLA 3S17B 4X3SA 5L37A 1RJTA 2WINB 3WOEA 5M5YB 1WTXA 4B3RL 4PMCA 2EXZA 2VQEL 2ZTCA 3S2DB 3TN2A 1AP0A 3A7AB 4JCVE 3AU7A 3K6OA 1KHIA 3T1YQ 1SNMA 3T13A 2PI2E 3H91A 2FHTA 2LFNA 2AHOB 1BXTA 4JW0A 4EQPA 3MHBA 1N33L 4KV6A 4K8JA 1JICA 1L0YB 3AFQA 4BWGB 1X3EA 1PH2A 4HCSA 1NR2A 1IYUA 4JG2A 2RQXA 1VQ8A 2KOLA 3PO3B 1V8QA 4A3FH 3NTHA 1LO5D 4LFCL 2NWGA 5JJKA 1WD0A 2YU9B 1HZBA 3SK5A 2EY5A 4FF4A 3GP7A 1GJXA 2IT1A 5ELFA 2HCIA 1S5BD 2EPBA 1YEZA 1LTBD 1I4PA 4OX9L 2MFIA 4K2KA 1OXUA 1I4HA 2J0TD 2PZUA 1HNZL 4RGOS 4LF5Q 2F4VQ 4L5TA 4NW2A 1ZEQX 3NELA 3VYTA 4GOPB 1O7LA 1MKHA 5A35A 3BU2A 4A3JG 4JBMA 4MTKA 2QILA 3MAQA 2ZTDA 1TWCB 3I4NB 3SDZA 4XDXA 3RUZA 2EQSA 2PQAB 4HMIA 5CV7A 2F0NA 4IUTA 2QKIC 3VYRA 1LT6D 5E4XA 1X54A 1Y14B 1NMGA 1EQRA 1MBYA 1CKOA 3VR2A 4IPDA 4GOPA 4EQOA 2EYLA 3OW7A 3ZYYX 4BA1I 3OSOA 3TQYA 2PMZB 2G9HD 1HZCA 1EWCA 3D3RA 1Z6HA 2F0DA 1KL9A 4BY7B 5T1IA 2NB0A 1K8GA 2PQAA 4JI4L 1I6HH 5KNBA 2JA8H 1Q90A 2K05A 4DFAA 2CH4W 2B63B 1EQTA 4JOIA 2K01A 2K4KA 3LNNA 4WRDA 5ISRA 1BBXC 2ASBA 3GTQB 1PFNA 4K5VA 3S2HB 3GTPB 3JC66 2E2JH 2QGQA 4JPBW 4IQZA 1I94L 4J8QA 2C35B 4DA2A 1C48A 3NWTA 1TWFB 1YBYA 4A3CH 3TZDA 4MIUA 4UP7A 4RGMA 3AB9A 4CDFC 2UUBQ 4GOPC 1GUWA 1IL2A 5IWAQ 3RZDB 4BBRG 1BBWA 5C3EB 4BXXG 1HR0L 4DAYB 3M85A 3STBD 4CJ1B 1K8MA 4AIMA 4IPHA 1PH3A 1KRTA 3W1BA 2GN5A 4K14A 3A0JA 4H44C 1N9WA 1EYCA 4BY1H 4LF6Q 2C9OA 2F0HA 4X66Q 2ZM6L 3I91A 1A63A 4JOIC 1S4ZA 4GLAC 1B7YB 3M4YA 1GM5A 3GTGH 3NWSA 1ILPA 1QNUA 1E24A 2A8VA 3IFTA 3KDFB 5C0XI 1V1PB 3VYSA 3ITPA 5AJ3L 3EN2A 1L2FA 3HOWH 4DAYA 4OONA 1JE5A 4DAPA 2N3SA 3CC2A 1RHPA 3RMHA 3GTJB 4LF4Q 2F52A 1G6PA 3S1RH 3H15A 2SDFA 3HOXH 1MGSA 3NE5B 3NUCA 1EY9A 1F2ZA 4PZ8A 4U68A 2F0PA 5LMNL 1XPOA 4LNQA 2BDOA 1PZKD 3KDFA 1V1PA 3R93A 1Q46A 3S1QB 3CAMA 1N32L 1JC7A 5HGQA 4R4CA 1KC8C 4DAMA 4RCOA 2K75A 4A3JB 4IFDI 3M4QA 3Q6SA 4HSVA 2MO1A 3D0FA 2K50A 3BDOA 4C3JG 3U9SA 2B2VA 3GQBA 4LJZC 4IUUA 3M7GA 4ABNA 4NXMQ 3ERQA 1QCBD 3H3VC 4HIKA 2CVRA 1CSPA 2HIVA 3K58A 3KJOA 4A3EH 1Y1VG 4DK1A 1ZXTA 3O13A 2B2WA 1KXLA 3LWUA 2KUMA 4KY7A 4KY6A 4DR2Q 1JB7A 3NXWA 3MFYA 2IX0A 4G4KA 1XXGA 3CCMA 4YY3Q 3EVQA 4BY1G 4X64L 4P73A 2FMMA 4ZRZA 3FVQA 3A55A 2EZVA 4P74A 1CT1D 2K6AA 5IYCH 3RN5A 2EDGA 4N9PA 4J15A 3LX0A 1XMOQ 2XIWA 3KLSA 5J39A 2VW9A 1ENAA 2XVSA 2RDHA 4JC0A 1NMFA 2B2VC 2JXMB 2ZJPA 2NVTH 3TP8A 1VQNA 3L9AX 3HOWG 2ICEC 4POFA 4HJ5A 1SNQA 2D5DA 3FHWA 3TS0A 2C5CA 4OHJA 2KHIA 3FKIH 2MUYA 3RNUA 1TS3A 4FDBA 3BDCA 2UUAL 3W1GA 3HOXG 5GROA 3S1MH 3R2TA 1GUGA 2B2WC 4BBRB 4IUQA 1WOCA 5GAHC 4YCVA 2OTJA 3FPPA 4I65A 1P8LA 2QF7A 5CR3A 1DYQA 2QA4A 1LTGD 5EJWA 2BH2A 2ZXOA 3T4AC 1U4RA 4IOAA 4A3BG 1Y69U 4JI6L 1SROA 1VQAA 1X65A 5J3BA 3RD4A 1H9JA 5EKLA 2AQ3B 2IPKD 5CV9A 1QZHA 1PZJD 1OTCA 4JI3L 1QWYA 1SE3A 3HOZG 1Q1BA 3A54A 2RDGA 1WCMB 1X3PA 1D2BA 4A3EG 3VR4A 2TSSA 3K5MA 5EBDA 1OXTA 5D14A 1VQPA 2F0TA 3HOVH 1CZWA 4NP5A 2ZXPA 3M4PA 4A3KH 3J80i 4IZ8A 2CHBD 4WORA 1F9PA 1MIUA 1RF2D 3I70A 2IX1A 1SAPA 5IYCG 3STBC 4HIOA 4ULLA 1G8ZD 1PH1A 1XPRA 4A3IH 1CI3M 1KIXA 2KCTA 3A7LA 1E1OA 1I3QB 1K0SA 1SE4A 4UY8C 3S17H 4IJLA 4DNTB 2KCNA 3GV3A 4C3JB 1WTQA 5EKKA 3S2DH 4A3GG 1HNXQ 1SSOA 4CBVA 3L7ZC 3NQTA 1ONLA 4DK3C 3NPPA 3BZDB 3PGZA 3TP5A 4QCLA 1Y1VB 3KK7A 2UXCL 1LTTD 3EJIA 5C3WA 4DN4M 1EIHA 2PNRC 3MXUA 5EGTA 3PO3H 3SEBA 4NXNQ 2Y0SE 3E6ZX 1Q3LA 4RGTA 2X6LA 2K5QA 4IUVA 4BY1B 2YU9H 4DK6C 4QF4A 5FO9B 4XT1B 3K5NA 5M3FB 3IAYA 4FF2A 5FLXc 2IL8A 2RHSB 3FDTA 3K7UC 4UAIA 1SNCA 4JI1L 1PTOB 1J6QA 1QG7A 1D6EC 3PF4A 2DUDA 5A2QL 4DV4L 5C44H 1YITA 1FNUA 3S1NH 3E9IA 2WV6D 1K83B 2K14A 1TWCH 5J22A 3I4NH 4KK7A 1QUQB 4L5QA 5FLXE 1PYBA 4QUCA 5I4DA 4DR4L 1FGBD 1XJVA 4XYQA 4J6HA 3HOXB 4DR3L 2CKZB 4DR7L 2WKCA 2HIXA 2SEBD 2VB2X 2Z0SA 4A3KG 2KBNA 3T1HQ 1JMCA 3TRZA 3J80L 1I4QA 3CCLA 4XXEA 1FNWA 3CPWA 5HGTA 4DR6L 2EYHA 1EZ8A 4A3BB 3HS0C 4LUVA 4A3IG 1I4GA 3E5SA 1QUQA 2QEJC 3VR5A 5JPMC 4BY7H 1WYDA 4XIGS 2GVAA 2IX3A 3CCUA 2FMCA 5KYIA 5GAEC 2B63H 1STEA 4OO1H 3K8AA 2F0VA 1NCVA 3UDGA 3J7ZC 3I72A 3HOZB 5LMUQ 1S5ED 2LMCB 3GTQH 1MHWC 3S2HH 1RODA 2Q8RE 4KHZA 3G4SA 1IBLQ 4LFAQ 4JV5Q 5JVH3 5BR8L 4JYAQ 4MNOA 3OIQA 1EY6A 2PI2A 4ID6A 2WB1E 5AFWA 2B8GA 1TWFH 2IJ0A 3PO3G 4ME5A 1PTOC 1WTHA 4EQ5A 1GXDC 5FLMG 1CA6A 3L3OC 5T1GA 2K5NA 4DV3L 4KN4C 4OL7A 4DR5Q 1WTWA 3KF8B 1LV9A 2JA7G 3H3VH 1KNEA 4H13C 5ELEA 1VF7A 3CQZB 1PFBA 4P75A 3SK4A 2JEAI 2LY7A 3U58A 1A3TA 1SMYD 1WTPA 4TKOB 4B3RQ 2DY8A 2VQEQ 2EYJA 1VCIA 5C44G 3D4RA 4A3GB 2J7ZA 3VYUA 2CH4A 2J4XA 2HDLA 4JBJA 2E76C 1F2YA 1S3OA 4JI8L 1N33Q 5A2QE 3DUZA 2EJGC 1G291 2JE6I 4RAUC 1O78A 3KF8A 1CSQA 2WIIB 1GUSA 3J80c 5TSSA 2X6GA 5J1ZA 2BOSA 1FJGL 1TT2A 2BE5D 3D6CA 3J81j 2E5LL 3WWVA 4GZYC 2ES2A 1S72A 1Q1EA 1UNSA 2Z4HA 1IHZA 2K04A 1M90C 1RKNA 2ICIA 3DMUA 2HQLA 1L0WA 4OX9Q 4YWKA 1EUJA 5GADC 3TP6A 3OWFA 1B9MA 1HNZQ 1JB3A 4RH6A 3GTOH 3I4MH 3S1QH 1S5DD 3OYYA 4BS9A 3TEHB 4CKBA 4OO1G 4HIMA 4R9WA 1ICFB 4YCWA 2KENA 3F2UA 3MEFA 1GD7A 3CD6A 1IL8A 5M5WB 2AWOA 1A6XA 3CCJA 2MO0A 1A15A 1W3SA 1LTAD 1KD1C 2RA4A 1VQFA 4ILWA 1FR3A 3PUXA 4A3KB 2HUGA 2F4IA 3HKZE 1H9MA 1C7YA 2VNUD 1ESFA 1STYA 2Z4IA 1RIPA 4XQNA 1SYGA 1EY0A 1TR5A 2NN6I 2R93H 1R4PB 3H09A 4A3IB 4DR1L 4FP5D 2ZTEA 3D8GA 3U9OA 1G2TA 2PQEA 2DNEA 2B29A 3F1ZA 3QG1A 5I9OA 1O80A 1UWVA 2K32A 5IP7H 5IYDH 1SE2A 5C3XA 5C5MA 3PF5A 1F2LA 1QB5D 3CKIB 2Z9HA 1GO3E 2TMPA 1VQ7A 3CP0A 2O4XA 1HHVA 3S15B 4CKEA 4QGUA 4GLXA 1PYWD 2NVYH 4LF7Q 2N8NA 3CCEA 1VQBA 1QILA 1NTGA 1J9OA 1I94Q 3R3OA 3BVMA 1IYVA 5KYLA 2JA6B 1DOLA 2L9HA 4V0BA 4HCEA 3H0GH 1U0LA 1QNKA 4C2MH 1N34L 3KLSX 3MXGA 3Q22A 1EIGA 2AQ2B 1ASYA 1EFWA 1HR0Q 4BBRH 1SXTA 5JOBA 1FL0A 4BXXH 2JA7B 4MZ9A 3J81i 2FFKB 3CCVA 1UEAB 1BO0A 3P75A 2HQEA 3I4MG 3RR5A 1AZQA 3E0JA 2JN4A 4Q0FA 2XGTA 1YJ9A 2ZM6Q 1EL0A 3QR8A 4PQXA 5CV6A 3M9BA 5C44B 3Q24A 4GKJL 2RKSA 2KHJA 4O1NA 3S1NB 4PNYA 1DM0B 3I4LA 4R8IA 4K0KL 4YWLA 3LWEA 3CMAA 1YJWA 5AJ3Q 4OWWB 2YTVA 4FXGC 3IKJA 1D5ZC 5E3FA 1HQMC 2AUJD 1KDAA 3OTOL 5IYBH 2B39A 3W5OA 3UDFA 1WCMH 4HAEA 4HJ7A 1HTLD 4R4OA 1L0XB 3CRKC 4Q5VA 1P16A 1EU3A 2OQKA 2R93G 3J7AV 3EQLC 1VF5C 4LK1C 1E2WA 2F0JA 3HFZB 4ME3A 4P72A 5K5PA 1N32Q 3CXCA 4DF7A 1K3RA 3K5OA 3MTSA 2QCPX 5IP7G 5IYDG 3HOYG 4IJHA 5FKAC 2F0KA 4QL5A 4A3MB 4OEMB 1I3QH 1SMYC 4B9XA 2L55A 3D31A 4DUZL 2H5XA 4C3JH 4NMZA 3ND8A 1WFQA 2GA4B 2E75C 1IKMA 1BDOA 5CBEE 1AEXA 3V96A 5IGDA 3G71A 1J5EL 1BVSA 1F9QA 3R2IA 4XQQA 3H0GG 4IPGA 4FYDA 3DEOA 5FJ8H 4XYOA 2RSNA 1Y1VH 2UXDL 3N6RA 1NUCA 4LF9L 4IUNA 2BE5C 3J81L 1K8OA 4LFBL 2Q2TA 1JOKA 5KNCA 4X64Q 1B4OA 2R7DA 1A62A 1MJEA 3SVMA 4HSPA 2A68D 1HNWL 1AH9A 1LLRD 5M3FH 5C4XG 1SEBD 1SR3A 5LHY1 2UUCL 1G51A 2R7FA 1PTOH 5I2YA 2D2CC 5E1FA 2WB1G 2L5TA 2WAQE 1B1ZA 2I0QA 4X65L 1SYCA 4JBKA 5IGBA 5IYBG 1K83H 2HHHL 4PMBA 1Y8PB 1PZID 2EE1A 1LT5D 3C1FA 4ALPA 2PZTA 1JOQA 1WCMG 2F0FA 3T51B 4KHVA 1VQ9A 2UUAQ 1HRJA 4PMWA 1JCKB 3F2DA 1SJHD 1LABA 2EYPA 1F9SA 3GTKB 1U4LA 4BBSG 3MC0B 2PCFB 3IL8A 3DWQA 1EY7A 3GTOB 3I4MB 4X62L 1I5FA 1PDQA 2QDBA 3CPFA 3U4VA 1VQOA 2M2LA 4JI6Q 4A3BH 3SGIA 3MFGA 2CCZA 4FXDA 1BQQT 1CHPD 1I50H 1E2ZA 1KABA 5CC4A 1PH7A 4JI3Q 3CF5A 2CQAA 4RKLA 4RG1A 1BBUA 3NP8A 4ZKBB 2Y0SB 1MSHA 2SNSA 1PLFA 2VY3A 2XRQD 4L8JA 3HOZH 4C3HH 2NTSA 3BZKA 3ND9A 4HR7B 3RLFA 5FJ8G 3SHLA 1DCZA 3J81c 1V1QA 1AE3A 2XWJB 2R93B 2Q2HA 3X3MA 4HN7A 2AWNA 1KLUD 1E22A 4M1UB 5DNFA 3ERSX 1R9TH 2DN8A 1MI2A 4KN7C 1FVIA 1DOKA 2OT2A 1LT4D 3NTKA 3QOLA 4NKLA 5M3FG 1NSNS 3HOYB 3J81E 2B2YA 4RA8A 3CQZH 2Q8IB 2DJGC 4YHHL 1TY0A 4N9TA 3RN2A 1JR0D 2AUKA 5IWAL 1QJOA 1NBWA 4IFDG 2NVYB 3HRZC 1Y1WB 2MJ8A 4A3GH 3HKZG 3BDLA 1SJED 1ET6A 2V1CC 4LF6L 1EZ6A 1TIID 1EIYB 2K52A 2KA7A 4MHEA 2A73B 3H0GB 4UDUC 1PVOA 2NYZD 2YTXA 1PTOD 4C2MB 4F87A 5KRUA 2UXCQ 1HA5A 4A4IA 2PW5A 2ATWA 1G91A 3HG9A 3PUZA 2B2UA 2UU9L 2YV5A 5FO7B 5FOBB 3TBIB 5ELNA 4WJ3M 2EXDA 2D0OA 3V2TA 1CKNB 3A8KE 5C4XB 2XN9C 1D7QA 2B2YC 4JI1Q 3TMEA 4FNFA 4I7ZC 4JI0L 5CORA 5H1SE 4Y52H 1YZ6A 4ZAIA 1XTDA 5FLXL 2WB1B 3K5LA 4DV4Q 2BA1A 4TVAB 2NBFA 5FK9C 3NTIA 4JI5L 1R4QB 1Y8NB 4R4IA 4IO9A 4L5RC 4UPAA 1EY4A 4C3HG 1A3UA 2BH8A 1OXVA 3GO5A 5M5WH 3VDYA 4AQYL 2G9DA 4GLVB 1CKNA 1TKWB 4DR7Q 3I8ZA 2RCNA 4DUYL 4KKTA 3JAMi 2B2UC 5KIXA 4BBSB 2E2DC 1QVCA 4CDCC 1ET9A 1K73C 1D8LA 3Q0AA 4DV6L 1A3VA 3GD7A 3HZXA 4L5SA 2EYFA 4DR6Q 1FGUA 5M5XB 2JEBI 1F9RA 3TP7A 2R7ZG 3DWPA 1JJGA 1XYIA 3MXPA 1A2UA 1DGSA 4A93B 2JK8A 4JI7L 1X9NA 3M7NA 3D6WA 2A68C 2O5JC 2JP1A 3NQIA 1K28A 4B3TL 3LGJA 1A0IA 1TXYA 4DR2L 2KECA 5I6YA 4M8AA 4HJAA 2DGYA 2RHQB 3RLOA 5D65A 3S15H 4F88A 1K0RA 3CHBD 5JJLA 5BR8Q 3TDQA 3F8TA 2DNCA 1EYGA 2QW7A 4A3DH 1XNQQ 1LYLA 2AMCB 4I7AA 1KRSA 3SK8A 2NVQB 1EY5A 5DLQE 3GV6A 1XMQL 2JA6H 4KHPL 2B8FA 4B9WA 1PA6A 2F03A 3UDIA 2Z8LA 5DM73 4C56C 4HMJA 2HDMA 1YHBA 5FLMH 1ZKOA 2V4DA 1N8RC 2RVLA 1CHQD 1NY4A 5EQ0A 2VL6A 2JA7H 4DV2L 1NE3A 4KKSA 5M3MH 3V05A 1EQVA 2F0GA 2A19A 3KUPA 1E0BA 1IYJB 1GHKA 4DV1L 3HKZB 1UE5A 1WJJA 2JYOA 2F0EA 3EIVA 1HFNA 1YVCA 1HFGA 5GQOA 5IGFA 5IE8A 3L0OA 1QVFA 4GKKL 1UAPA 4QIWE 1PH4A 1QZGA 1CK1A 1EWHA 1HXYD 2CWAA 2EOTA 2VXWA 1NNXA 3G48A 5HY6A 1SE8A 2K5HA 3KBXA 4B3SL 4O2DA 4X3UA 4DNIA 1UE6A 5ELDA 3DXJC 2WAQG 1AW7A 1PFMA 1FNVA 1IBML 1I50B 1Q8IA 2Z1CA 2BA0A 1B9NA 1HQRD 1GKHA 4TRDA 3RZOB 3KYHC 3UI2A 4KJNA 4DV0Q 4A3MH 4ZYSA 3ONAB 4UP9A 5BN5A 4C3HB 1DXMA 1RL2A 5IP9H 3S9WA 1OXSC 2KEDA 1SMXA 2VZAA 2E2IH 3AQQA 3A5UA 4A3DG 1KQSA 2EYOA 2UXBL 3U4ZA 3TZUA 2JA6G 1X3QA 2M00A 4G7ZC 2CWPA 1R9TB 1YIJA 2EJMA 3QB3A 3HOUB 3OW2A 2EJFC 4DR1Q 1CUKA 1STAA 1ILQA 1W6KA 2E74C 2F1MA 3L2PA 3PO2H 1S5FD 2R7ZB 2I5HA 2JA5B 1X56A 5M3MG 2I46A 2KQ3A 4CGYB 5KGUA 4DXFA 1V9PA 1SYDA 1AFPA 1CA5A 1TWAB 2RCFA 1U5KA 4LF8L 3CW2C 4IURA 1PTOF 4QUFA 5CV8A 2EY1A 4JVZA 2K5WA 2Z6BA 3JAMc 2FINB 4OO1I 1YHAA 1SBBB 1H9RA 1CQFA 4RHRA 4X3KA 1LTRD 4KMUC 1WTRA 3M4OB 4P71A 2CQOA 4H0LC 4LFCQ 1N34Q 4CHTB 3FPUB 1TS4A 3CMEA 1JQYD 1KAWA 1YNXA 4DV5L 1K9MC 2KCMA 1QOHA 3JAME 4Y7NB 3GTKH 4A3LH 4JI2L 3OMCA 3HGBA 1KNAA 5BN4A 1TQOA 4C1NK 3I3CA 3CC4A 1STGA 4POGA 1B3AA 1V43A 4UP8A 1KDCA 2B2TA 5IGCA 1TWGB 4G7OC 5DAUA 3WDNA 3H3VI 1VMPA 4A3MG 5C4HA 1LTSD 4K0KQ 2OWOA 5IP9G 2H4OA 5EBCA 5ELBA 1UUPA 1TU2B 2FJ2A 1H9KA 3QWNA 1CM9A 4GS3A 3OTOQ 3SXHA 1QVGA 1SYEA 2HD3A 1RDPD 3AYHB 2ENBA 5CV5A 3PIPA 2O5IC 2OTLA 1ENFA 1O7IA 3W3AA 1JOOA 3ULPA 2HT1A 1E7ZA 4PZ7A 1Q81C 1CQVA 4C3IB 1LT3D 1YNND 3RLNA 5LMUL 3GTLB 3S14B 3PO2G 1HZAA 2LSSA 3ZJYC 1HUMA 2WAQB 4JI4Q 1HA6A 3K81C 2DY7A 2MP1A 5I2XA 3D4DA 2KEEA 3A56A 1VDZA 2R61A 2VS1A 3ULLA 3P20A 1C8CA 3HOYH 1D1IA 4HEDA 2B2TC 1PFSA 1CZGA 5I6WA 4KTAA 1EFID 1FYCA 1F77A 4CKCA 4YWMA 4DUZQ 1RTOA 4F7XA 2VUMG 4OELB 1Y1WH 1E3PA 1ENCA 4A3DB 4JK1C 4G7HC 2NVXB 1BUVT 1EIFA 1J5EQ 4K6DA 4RWSC 3HKSA 3PUVA 1IZ6A 2R3ZA 2A5HA 3BYTB 3NK9A 3QOJA 1L1OB 2YTYA 2OQ0A 1MSGA 3CCQA 4J1MA 1XNRL 2UXDQ 1LTLA 4GN3B 4A3LG 4LF9Q 4KD3A 4LFBQ 1HTPA 5M3MB 2LXKA 2OCEA 2NN6G 3UDXA 3ICEA 2F0SA 3MVVA 1RD9D 1D5XC 5CMDA 1HNWQ 2KHSA 4R1JA 4WJ4A 2H1EA 1S40A 1N36L 5C4XH 2UUCQ 4KD4A 3NBHB 1STHA 1L1OA 4N8FA 4DV7L 1G2SA 1OO9B 4X65Q 1HCZA 3A8IE 5KEEA 2VQFL 3K7AB 2A69D 2Y0SG 2HHHQ 2R92G 2AQ1B 1VQKA 1CKMA 3CC7A 1VQJA 1SNDA 1Q7YC 2K28A 1H9SB 2F0IA 1EEID 5JJZA 4X6AH 1Q8KA 4Z9CB 2A1AA 4FO2A 4XQJA 3BVZA 3MXNB 3R8BA 1ICWA 2K1BA 1BCPD 3GDEA 5LMNQ 5IGGA 1EYAA 4LW1A 4NB3A 1IBKL 1VS0A 3NBHA 4BBSH 3EROA 3S16B 2D62A 1JE4A 4JBWA 4X62Q 1BNZA 2I07B 5F2DA 3OHXC 4ZLTF 5M5XH 3BS1A 2Q8TA 5IY0A 1VQMA 2RF4A 4KKUA 1GUOA 3Q23A 5CV4A 4A93H 3I73A 1H9SA 2A6ED 1E2VA 1L1OC 4B3ML 5K36H 3MXNA 3VA7A 4CJ0B 1TWHB 1Y1WG 2E2IB 4DAVA 4A75A 1W2BA 4OIJA 5C0XH 3EBEA 2KCCA 5E4WC 2L0CA 4MTNA 2K5VA 2P5ZX 2E2HB 4EX5A 4AYBE 3UE0A 4ZQ3A 1PMRA 2A74C 4RMFA 2N88A 3T1YL 1HUNA 2NVQH 2NZOA 3PO2B 1JWMD 1MJCA 2PYKA 5IODA 4LF7L 4LWCA 5EKIA 1CTMA 1VQ6A 2LKVA 2A6HD 2F0LA 1UE1A 3HP3A 5KNDA 4A3FG 3CCRA 3CCSA 1UE7A 3PUYA 4YHHQ 3F2CA 4APVA 3M3YB 4EVOA 1A2TA 1VQDA 1PXUA 2CW0D 2G5DA 3PV0A 3DHQA 2VUMB 1Z47A 3S24A 5CGKA 4IFDH 3QIAA 4QJFA 2PPBC 4DKAC 2QDLA 1SNOA 2F4VL 3I55A 4LF5L 3TREA 1X6OA 3PIOA 3BJUA 3T53B 3BG3A 3GTMB 1SFOH 1LM0A 5C4ZA 2NTTA 1SRUA 1KLGD 4XTCS 1IW7D 3KJPA 1B3QA 4DGZA 2UU9Q 2IW3A 3EA6A 5CBAE 2N78A 1PRTD 5FO8B 1HH2P 3G7LA 3H94A 5C4JB 3TS2A 1YNNC 2HCCA 1VQ4A 3F2BA 2LXJA 3DM3A 3VA5A 1XWEA 3A8JE 1AZPA 1I4RA 3FP9A 4PV1C 5JAVA 4X3TA 2OF1A 2F0UA 5EAYA 2JA9A 5DEHA 4A93G 4JI0Q 3KLWA 3I7FA 1KAAA 1BF4A 2Q2UA 5K36G 3FEWX 2Q2IA 3FMCA 1BCPB 1T5EA 3P7JA 4TQUS 4JI5Q 3J7YW 1CFMA 4L6TB 3E9HA 3RZOH 4CJ2C 2JA8G 5C0XG 2R92B 1E1TA 1Q12A 3OIPA 1GHJA 1VQHA 2L15A 1H95A 3KF6B 3K57A 4AQYQ 3B6YA 3E3XA 3UE1A 1HZ9A 4YIJA 3I56A 2OEOA 4WFN3 5ELOA 3SR1A 4DUYQ 4EGVA 2D0PA 4KJOA 3C46A 4MN3A 1TS2A 4PZ6A 3K0XA 4QMGA 4DV6Q 5EPKA 2SOBA 4LUOA 5ELCA 1PH8A 4NDXA 3P1HA 4GN5A 3J7AF 3WOFA 3HOUH 4A76A 4A3CG 2R7ZH 2JA5H 4JI7Q 3KF6A 1W6JA 1JJ2A 1MD2D 5IIFA 1Z7TA 2UUBL 1Y8OB 4QIWB 5JPNC 5BN3A 1NJIC 3NSWA 1O7ZA 1S5CD 4B3TQ 2ZT9C 3MA2B 1TWAH 4IALA 5D3DA 1VMCA 3KBGA 1M4VA 2K5DA 2Z6KA 1YJNA 5I9PA 1SDFA 1WTVA 3CRLC 3PSIA 1PYSB 4X66L 4XT3B 2K7VA 2F3VA 1YNJD 2A69C 4WJWA 4RKBA 1F2MA 5JEAH 4BA2I 2PMZE 2SNMA 1EEFD 1VQCA 4N8X1 1XMQQ 2ZJRA 5C0XJ 3M4OH 2EVBA 4KHPQ 1C0AA 3PCOB 1IKLA 1BCPC 2R6GA 4AH6A 2K03A 1AE2A 4Y7NH 4K6LA 4DV2Q 2BDNA 4A3FB 4LF4L 3MEHA 1X55A 1HPCA 4P2CB 2XRSD 3G6JB 4GNXB 4O0AA 1YI2A 2IWHA 5GAGC 4FF3A 3DLLA 1O7YA 1ZYRD 1U4PA 5LL6X 2RDFA 1GOZA 3MZ5A 4H02A 1OXXK 1TWGH 4DV1Q 2Z6KC 4QQBX 1PRTB 1TY2A 2A6EC 1I4XA 2YYZA 3OPOA 1U9RA
chains in the Genus database with same CATH topology
1GUTA 2EY2A 2ID0A 4DNRB 1BCPF 2F0WA 3K0YA 4IFDJ 1AN8A 5DM63 4ZK9B 3K59A 4ZKCB 4KI0A 3URYA 2F0QA 4F8MA 1DD2A 3NHHA 3DWAA 2EY6A 2L12A 2O2LD 4KY5A 2XNAC 2D9UA 2XWBB 4FXKC 4K5WA 3C2PA 5M9OA 1ESRA 1B44D 1BOSA 1I6VC 3SE0A 4HTHA 2A6HC 1JORA 4DXGA 2MPMA 2K33A 1I6HB 2L11A 5G3LD 1JWSD 3QO2A 3AMUA 2CW0C 2JA8B 5IGEA 1FD7D 3DEPA 5COYA 2MHVA 5JEAG 2F0MA 1EOTA 2RBMA 3PIP3 2E2JB 1IW7C 4EQNA 5CYUA 1D5MC 1TS5A 5C6AA 1PRTC 3FRPB 1EYDA 4K5XA 1SNPA 5IOCA 3CU7A 4TSSA 5EPJA 3H6MA 3QJYA 2MGSA 2M9VA 3T16A 3I90A 1SFOB 4B08A 3VR3A 3BYYB 3GTGB 1PRTF 1XX8A 4ZUJA 3JAML 5NUCA 3D4WA 3HOWB 4R8NA 1B2TA 3BVGA 3W2DA 2BCOA 5IT9L 4C3IG 5JEAJ 2PO4A 1NR4A 3MWYW 2L1BA 2F0OA 1DZ1A 3S1RB 4K2LA 1B50A 4OIKA 1RCVD 1G6ZA 5C5LA 2X69A 4C1NI 3PMFA 2PZWA 1T5XD 3OWEB 4G57A 3NBIA 1KDBA 2N55A 3HEJA 4OGQC 3KLRA 1QE6A 2L4NA 1YNJC 5D3IB 2LS01 3C1EA 1V1OA 5EPLA 3EFXD 4FVMA 2WACA 2NUCA 2RSOA 4A3EB 1DJRD 3TSSA 1II3A 4E6IA 3SK6A 1NAPA 3OOCA 5HURA 4QB4A 1X32A 2XSCA 3VR6A 1LTID 1ZYRC 4DU9A 4ODGA 1EU4A 1U4MA 4FF1A 3IFDA 2KJXA 3T56B 4L63B 2NVTB 1STNA 4H7BA 2WP8J 3X3NA 1SYBA 2VB3X 1STBA 1B53A 3FKIB 4S3SA 2ZXRA 5JVG3 1EY8A 5LL6S 1J8IA 1JWUD 4LMQD 3S1MB 3OMGA 2NN6H 4RCNA 5IT9E 1BR9A 1DOMA 3DM1A 4AYBB 3C3LA 3J80E 1WTOA 1D1KA 4V190 1TVXA 2F3WA 1RTNA 4RHSA 4ZUIA 2OXPA 2NZ1D 3N52A 3PIO3 4DK0A 1XTCD 1DONA 2WKDA 1C4QA 2JSOA 4K8IA 1WD1A 1KTKA 4IN3A 1LACA 3HOVB 5G3LF 2PW7A 1ML0D 4RGNA 1GUNA 2KVMA 4U673 1SYFA 4IUPA 4LAAA 2EYMA 1WVLA 4O42A 1M8AA 4RFBA 3PUWA 3S17B 4X3SA 1RJTA 2WINB 3WOEA 5M5YB 1WTXA 4PMCA 2EXZA 3S2DB 3TN2A 1AP0A 3A7AB 3AU7A 3K6OA 1SNMA 3T13A 3H91A 2FHTA 2LFNA 1BXTA 4EQPA 3MHBA 4KV6A 4K8JA 1JICA 1L0YB 4BWGB 4HCSA 1NR2A 1IYUA 2RQXA 2KOLA 3PO3B 1V8QA 3NTHA 1LO5D 2NWGA 1WD0A 2YU9B 3SK5A 2EY5A 4FF4A 3GP7A 1GJXA 2IT1A 5ELFA 2HCIA 1S5BD 2EPBA 1LTBD 1I4PA 4K2KA 1OXUA 1I4HA 2J0TD 2PZUA 4RGOS 4NW2A 1ZEQX 3VYTA 1O7LA 5A35A 2QILA 3MAQA 1TWCB 3I4NB 3SDZA 4XDXA 3RUZA 4HMIA 5CV7A 2F0NA 4IUTA 2QKIC 3VYRA 1LT6D 5E4XA 1MBYA 3VR2A 4EQOA 2EYLA 3OW7A 3ZYYX 4BA1I 3OSOA 2PMZB 2G9HD 1EWCA 3D3RA 1Z6HA 2F0DA 4BY7B 5T1IA 2NB0A 5KNBA 1Q90A 2K05A 4DFAA 2B63B 1EQTA 2K01A 3LNNA 4WRDA 5ISRA 1BBXC 3GTQB 1PFNA 4K5VA 3S2HB 3GTPB 4IQZA 4J8QA 4DA2A 1C48A 3NWTA 1TWFB 3TZDA 4MIUA 4RGMA 3AB9A 1GUWA 3RZDB 5C3EB 3M85A 4CJ1B 1K8MA 4K14A 4H44C 1EYCA 2C9OA 2F0HA 3I91A 1S4ZA 3M4YA 3NWSA 1ILPA 1QNUA 3IFTA 5C0XI 1V1PB 3VYSA 3ITPA 4DAYA 4DAPA 1RHPA 3RMHA 3GTJB 2SDFA 1MGSA 3NE5B 3NUCA 1EY9A 1F2ZA 4U68A 2F0PA 2BDOA 1PZKD 1V1PA 3R93A 3S1QB 1JC7A 4RCOA 4A3JB 4IFDI 3Q6SA 4HSVA 3BDOA 4C3JG 3U9SA 2B2VA 3GQBA 4LJZC 4IUUA 3M7GA 4ABNA 3ERQA 1QCBD 3H3VC 2CVRA 3K58A 4DK1A 1ZXTA 3O13A 2B2WA 3LWUA 2KUMA 4KY7A 4KY6A 3NXWA 3MFYA 2IX0A 4G4KA 1XXGA 3EVQA 2FMMA 4ZRZA 3FVQA 3A55A 2EZVA 1CT1D 2K6AA 2EDGA 4N9PA 3LX0A 2XIWA 3KLSA 5J39A 1ENAA 2XVSA 2RDHA 2JXMB 2B2VC 3TP8A 3L9AX 2ICEC 1SNQA 2D5DA 2C5CA 4OHJA 2MUYA 1TS3A 3BDCA 3R2TA 1GUGA 2B2WC 4BBRB 4IUQA 3FPPA 4I65A 2QF7A 5CR3A 1DYQA 1LTGD 5EJWA 2ZXOA 3T4AC 1U4RA 1Y69U 3RD4A 1H9JA 5EKLA 2AQ3B 2IPKD 5CV9A 1PZJD 1QWYA 1SE3A 1Q1BA 3A54A 2RDGA 1WCMB 1X3PA 1D2BA 3VR4A 2TSSA 3K5MA 5EBDA 1OXTA 5D14A 2F0TA 1CZWA 4NP5A 2ZXPA 4IZ8A 2CHBD 4WORA 1F9PA 1RF2D 3I70A 2IX1A 1SAPA 4ULLA 1G8ZD 1CI3M 3A7LA 1I3QB 1SE4A 4DNTB 2KCNA 3GV3A 4C3JB 1WTQA 5EKKA 1SSOA 4CBVA 3L7ZC 3NQTA 1ONLA 3NPPA 3BZDB 3TP5A 4QCLA 1Y1VB 3KK7A 1LTTD 3EJIA 5C3WA 4DN4M 1EIHA 2PNRC 3MXUA 5EGTA 3SEBA 3E6ZX 1Q3LA 4RGTA 2X6LA 2K5QA 4IUVA 4BY1B 4QF4A 5FO9B 4XT1B 3K5NA 5M3FB 3IAYA 4FF2A 2IL8A 3FDTA 4UAIA 1SNCA 1PTOB 1QG7A 1D6EC 5A2QL 1FNUA 2WV6D 1K83B 5J22A 4KK7A 5FLXE 4QUCA 5I4DA 1FGBD 4XYQA 4J6HA 3HOXB 2WKCA 2SEBD 2VB2X 3J80L 1I4QA 4XXEA 1FNWA 5HGTA 2EYHA 1EZ8A 4A3BB 3HS0C 1I4GA 3E5SA 2QEJC 3VR5A 5JPMC 4XIGS 2IX3A 2FMCA 5KYIA 1STEA 4OO1H 2F0VA 1NCVA 3I72A 3HOZB 1S5ED 2LMCB 1RODA 2Q8RE 4KHZA 5JVH3 3OIQA 1EY6A 4ID6A 5AFWA 2B8GA 2IJ0A 4ME5A 1PTOC 1GXDC 1CA6A 3L3OC 5T1GA 4KN4C 4OL7A 1WTWA 1LV9A 1KNEA 4H13C 5ELEA 1VF7A 3CQZB 1PFBA 3SK4A 2JEAI 2LY7A 1A3TA 1SMYD 1WTPA 4TKOB 2DY8A 2EYJA 1VCIA 3D4RA 4A3GB 2J7ZA 3VYUA 2J4XA 2HDLA 2E76C 1F2YA 5A2QE 3DUZA 2EJGC 1G291 2JE6I 4RAUC 1O78A 3KF8A 2WIIB 1GUSA 5TSSA 2X6GA 5J1ZA 2BOSA 1TT2A 2BE5D 3D6CA 4GZYC 1Q1EA 1UNSA 2Z4HA 1IHZA 2K04A 1RKNA 2ICIA 3DMUA 3TP6A 3OWFA 1B9MA 1JB3A 4RH6A 1S5DD 4BS9A 4CKBA 4OO1G 4R9WA 3F2UA 1IL8A 5M5WB 2AWOA 1A6XA 1A15A 1LTAD 2RA4A 4ILWA 1FR3A 3PUXA 4A3KB 2HUGA 2F4IA 1H9MA 2VNUD 1ESFA 1STYA 2Z4IA 4XQNA 1SYGA 1EY0A 1TR5A 2NN6I 1R4PB 3H09A 4A3IB 4FP5D 3D8GA 3U9OA 1G2TA 2PQEA 2DNEA 3QG1A 5I9OA 1O80A 2K32A 1SE2A 5C3XA 5C5MA 1F2LA 1QB5D 3CKIB 2TMPA 2O4XA 1HHVA 3S15B 4CKEA 1PYWD 1QILA 1J9OA 3R3OA 3BVMA 1IYVA 5KYLA 2JA6B 1DOLA 2L9HA 4V0BA 4HCEA 1QNKA 3KLSX 3MXGA 3Q22A 1EIGA 2AQ2B 1SXTA 5JOBA 2JA7B 2FFKB 1UEAB 1BO0A 3P75A 2HQEA 1AZQA 3E0JA 4Q0FA 1EL0A 4PQXA 5CV6A 5C44B 3Q24A 2RKSA 4O1NA 3S1NB 4PNYA 1DM0B 3I4LA 4R8IA 3LWEA 4FXGC 3IKJA 1D5ZC 5E3FA 1HQMC 2AUJD 1KDAA 2B39A 4HAEA 1HTLD 1L0XB 3CRKC 4Q5VA 1EU3A 3J7AV 3EQLC 1VF5C 4LK1C 1E2WA 2F0JA 5K5PA 4DF7A 3K5OA 3MTSA 2QCPX 5FKAC 2F0KA 4A3MB 1SMYC 4B9XA 2L55A 3D31A 4NMZA 3ND8A 2GA4B 2E75C 1IKMA 1BDOA 5CBEE 1AEXA 3V96A 5IGDA 1F9QA 3R2IA 4XQQA 4FYDA 3DEOA 4XYOA 2RSNA 3N6RA 1NUCA 4IUNA 2BE5C 3J81L 1K8OA 1JOKA 5KNCA 1B4OA 3SVMA 4HSPA 2A68D 1LLRD 1SEBD 5LHY1 1PTOH 5I2YA 2D2CC 5E1FA 2L5TA 1B1ZA 1SYCA 5IGBA 4PMBA 1Y8PB 1PZID 2EE1A 1LT5D 3C1FA 2PZTA 1JOQA 3T51B 2F0FA 4KHVA 1HRJA 4PMWA 1JCKB 1SJHD 1LABA 2EYPA 1F9SA 3GTKB 1U4LA 3MC0B 2PCFB 3IL8A 3DWQA 1EY7A 3GTOB 3I4MB 2QDBA 1PDQA 2M2LA 3MFGA 4FXDA 1BQQT 1CHPD 1E2ZA 1KABA 5CC4A 2CQAA 4RKLA 3NP8A 4ZKBB 2Y0SB 1MSHA 2SNSA 1PLFA 2XRQD 4L8JA 2NTSA 3ND9A 4HR7B 3RLFA 3SHLA 1DCZA 2XWJB 2R93B 3X3MA 4HN7A 2AWNA 1KLUD 4M1UB 5DNFA 2DN8A 1MI2A 4KN7C 1DOKA 2OT2A 1LT4D 3NTKA 3QOLA 4NKLA 3HOYB 1NSNS 3J81E 2B2YA 4RA8A 2Q8IB 1TY0A 4N9TA 1JR0D 2AUKA 1QJOA 4IFDG 2NVYB 3HRZC 1Y1WB 2MJ8A 3BDLA 1SJED 1ET6A 1EZ6A 1TIID 2KA7A 4MHEA 2A73B 3H0GB 4UDUC 2NYZD 1PTOD 4C2MB 4F87A 5KRUA 1HA5A 2PW5A 1G91A 3HG9A 3PUZA 2B2UA 5FO7B 5FOBB 3TBIB 3V2TA 3A8KE 5C4XB 2XN9C 2B2YC 3TMEA 4FNFA 4I7ZC 5CORA 4ZAIA 5FLXL 2WB1B 3K5LA 2BA1A 2NBFA 5FK9C 3NTIA 1R4QB 1Y8NB 1EY4A 4C3HG 1A3UA 1OXVA 3GO5A 2G9DA 1TKWB 3I8ZA 4KKTA 2B2UC 5KIXA 4BBSB 2E2DC 1ET9A 3Q0AA 1A3VA 3GD7A 3HZXA 2EYFA 5M5XB 2JEBI 1F9RA 3TP7A 3DWPA 1XYIA 3MXPA 1A2UA 4A93B 3M7NA 3D6WA 2A68C 2O5JC 2JP1A 3NQIA 2KECA 5I6YA 4M8AA 5D65A 4F88A 3CHBD 3TDQA 2DNCA 3SK8A 2NVQB 1EY5A 3GV6A 2B8FA 4B9WA 2F03A 2Z8LA 5DM73 4C56C 4HMJA 2HDMA 1ZKOA 2V4DA 2RVLA 1CHQD 5EQ0A 4KKSA 3V05A 1EQVA 2F0GA 3KUPA 1E0BA 1GHKA 3HKZB 2JYOA 2F0EA 1HFNA 1HFGA 5IGFA 1UAPA 1CK1A 1EWHA 1HXYD 2EOTA 2VXWA 3KBXA 4X3UA 5ELDA 3DXJC 1AW7A 1PFMA 1FNVA 1I50B 1Q8IA 2Z1CA 2BA0A 1B9NA 1HQRD 4TRDA 3RZOB 3UI2A 4KJNA 4ZYSA 3ONAB 5BN5A 4C3HB 1DXMA 3S9WA 1OXSC 2KEDA 2EYOA 3TZUA 1X3QA 2M00A 4G7ZC 1R9TB 2EJMA 3QB3A 3HOUB 2EJFC 1STAA 2F1MA 1ILQA 1W6KA 2E74C 2R7ZB 1S5FD 2JA5B 2I46A 2KQ3A 4CGYB 5KGUA 4DXFA 1SYDA 1AFPA 1CA5A 1TWAB 4IURA 1PTOF 4QUFA 5CV8A 2EY1A 2K5WA 2FINB 4OO1I 1SBBB 1H9RA 1CQFA 4RHRA 4X3KA 1LTRD 4KMUC 1WTRA 3M4OB 4H0LC 4CHTB 3FPUB 1TS4A 1JQYD 1QOHA 3JAME 4Y7NB 3OMCA 3HGBA 1KNAA 5BN4A 1TQOA 4C1NK 3I3CA 1STGA 1B3AA 1V43A 1KDCA 2B2TA 5IGCA 1TWGB 4G7OC 5DAUA 3WDNA 1VMPA 5C4HA 1LTSD 2H4OA 5EBCA 5ELBA 1UUPA 1TU2B 2FJ2A 1H9KA 3QWNA 1CM9A 3SXHA 1SYEA 1RDPD 2ENBA 5CV5A 2O5IC 1ENFA 3W3AA 1JOOA 1CQVA 4C3IB 1LT3D 1YNND 3GTLB 3S14B 1HUMA 2WAQB 1HA6A 2DY7A 2MP1A 5I2XA 3D4DA 2KEEA 3A56A 1VDZA 2R61A 1C8CA 3P20A 1D1IA 4HEDA 2B2TC 1CZGA 5I6WA 4KTAA 1EFID 1FYCA 1F77A 4CKCA 1RTOA 4F7XA 1ENCA 4A3DB 4JK1C 4G7HC 2NVXB 1BUVT 4K6DA 4RWSC 3PUVA 2R3ZA 2A5HA 3BYTB 3NK9A 3QOJA 1MSGA 4J1MA 4KD3A 1HTPA 5M3MB 2NN6G 2F0SA 3MVVA 1RD9D 1D5XC 5CMDA 2KHSA 2H1EA 4KD4A 1STHA 1G2SA 1OO9B 1HCZA 3A8IE 5KEEA 3K7AB 2A69D 2AQ1B 1SNDA 2K28A 1H9SB 2F0IA 1EEID 5JJZA 4Z9CB 4FO2A 4XQJA 3BVZA 3R8BA 1ICWA 2K1BA 1BCPD 5IGGA 1EYAA 3NBHA 3EROA 3S16B 2D62A 1JE4A 4JBWA 1BNZA 2I07B 5F2DA 3OHXC 4ZLTF 3BS1A 2Q8TA 4KKUA 1GUOA 3Q23A 5CV4A 3I73A 1H9SA 2A6ED 1E2VA 5K36H 3MXNA 3VA7A 4CJ0B 1TWHB 2E2IB 4DAVA 4OIJA 5C0XH 2KCCA 5E4WC 2L0CA 2E2HB 4ZQ3A 1PMRA 2A74C 2N88A 1HUNA 3PO2B 1JWMD 2PYKA 5IODA 5EKIA 1CTMA 2LKVA 2A6HD 2F0LA 3HP3A 5KNDA 3PUYA 3M3YB 4EVOA 1A2TA 2CW0D 1PXUA 3PV0A 3DHQA 2VUMB 1Z47A 5CGKA 4IFDH 3QIAA 2PPBC 1SNOA 3T53B 3BG3A 3GTMB 5C4ZA 2NTTA 1KLGD 4XTCS 1IW7D 4DGZA 2IW3A 3EA6A 5CBAE 1PRTD 5FO8B 3G7LA 3H94A 5C4JB 1YNNC 2HCCA 3VA5A 1XWEA 3A8JE 1AZPA 1I4RA 4PV1C 5JAVA 4X3TA 2OF1A 2F0UA 5DEHA 1KAAA 1BF4A 5K36G 3FEWX 1BCPB 3FMCA 1T5EA 3P7JA 4TQUS 3J7YW 1CFMA 4L6TB 4CJ2C 5C0XG 2R92B 1Q12A 1GHJA 3OIPA 3K57A 4YIJA 2OEOA 4WFN3 3SR1A 4EGVA 4KJOA 3C46A 4MN3A 1TS2A 4QMGA 5EPKA 2SOBA 5ELCA 4NDXA 3P1HA 3J7AF 3WOFA 1W6JA 1MD2D 5IIFA 1Z7TA 1Y8OB 4QIWB 5JPNC 5BN3A 3NSWA 1O7ZA 1S5CD 2ZT9C 3MA2B 4IALA 5D3DA 1VMCA 3KBGA 1M4VA 2K5DA 5I9PA 1SDFA 1WTVA 3CRLC 4XT3B 2K7VA 2F3VA 1YNJD 2A69C 4WJWA 4RKBA 1F2MA 5JEAH 4BA2I 2SNMA 1EEFD 5C0XJ 2EVBA 1IKLA 1BCPC 2R6GA 2K03A 4K6LA 2BDNA 4A3FB 3MEHA 1HPCA 4P2CB 2XRSD 3G6JB 2IWHA 4FF3A 1O7YA 1ZYRD 1U4PA 5LL6X 2RDFA 1GOZA 3MZ5A 1OXXK 1PRTB 1TY2A 2A6EC 1I4XA 2YYZA 3OPOA 1U9RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SYE A;  3EJI A;  2EY5 A;  3D4W A;  1A2U A;  1SNQ A;  1KAA A;  2ENB A;  2EY2 A;  3MXP A;  3OMG A;  4R8N A;  5CV5 A;  5C3W A;  5IGD A;  2F0W A;  5EGT A;  1JOO A;  2O4X A;  5F2D A;  3SK4 A;  3S9W A;  1A3T A;  4K2K A;  2F0O A;  3BDC A;  2PZU A;  2F0Q A;  2EYJ A;  3SK5 A;  4F8M A;  3NHH A;  3QOL A;  4NKL A;  3ITP A;  1NSN S;  2EYO A;  4K2L A;  4QF4 A;  5CV4 A;  2EY6 A;  5I6Y A;  3R3O A;  1NUC A;  4IUN A;  5KYL A;  4KY5 A;  4N9T A;  4YIJ A;  2OEO A;  4I65 A;  1JOK A;  1SNC A;  5C5L A;  2M00 A;  1F2Y A;  3D4D A;  5CR3 A;  5C3X A;  3SR1 A;  4K5W A;  3QB3 A;  2F3W A;  4KJO A;  3RUZ A;  5M9O A;  4HMI A;  4ZUI A;  2OXP A;  5CV7 A;  3NUC A;  1STA A;  3PMF A;  2F0N A;  5JOB A;  4KTA A;  3SK8 A;  1EY5 A;  1EY9 A;  1F2Z A;  3BDL A;  2PZW A;  2F0P A;  4QMG A;  5I6W A;  2SOB A;  4HTH A;  1EZ6 A;  2KQ3 A;  5J1Z A;  1JOR A;  4G57 A;  4B9W A;  4F7X A;  3P75 A;  5J22 A;  4NDX A;  1TT2 A;  2HQE A;  3P1H A;  4HMJ A;  5KGU A;  1KDB A;  3D6C A;  4K8I A;  4KJN A;  5E1F A;  1SYD A;  4J6H A;  1ENC A;  3HEJ A;  4ZQ3 A;  5EKL A;  5CV9 A;  5KRU A;  2PW5 A;  1IHZ A;  1SYC A;  4EQO A;  5CV6 A;  2EYL A;  1RKN A;  5IGB A;  4K6D A;  3DMU A;  3OSO A;  5IIF A;  2PYK A;  5IOD A;  2RKS A;  4PMB A;  3NK9 A;  3C1E A;  4PNY A;  3QOJ A;  3C1F A;  5DEH A;  5IGE A;  5CV8 A;  2PZT A;  3OWF A;  1EQV A;  2EY1 A;  2F0D A;  3TP6 A;  2F0F A;  2LKV A;  4KHV A;  1JOQ A;  4J1M A;  2PW7 A;  2F0G A;  2F0M A;  4IAL A;  2F0L A;  3V2T A;  2WAC A;  2RBM A;  2EYP A;  4DFA A;  5I9P A;  5E3F A;  5HGT A;  1SYF A;  2NUC A;  4LAA A;  4KD3 A;  1KDA A;  2F0T A;  2EYM A;  1II3 A;  2EYH A;  4NP5 A;  4E6I A;  1EZ8 A;  3ERQ A;  4EVO A;  3TME A;  2F0E A;  1A2T A;  3E5S A;  4EQN A;  3SK6 A;  5IGF A;  2F3V A;  4WRD A;  3DHQ A;  4IZ8 A;  5ISR A;  1EY7 A;  2F0S A;  3MVV A;  4WOR A;  5C6A A;  4RKB A;  5CGK A;  1F2M A;  2KHS A;  4K5V A;  2QDB A;  5HUR A;  2SNM A;  4QB4 A;  5KYI A;  1SNO A;  4KD4 A;  2F0V A;  1EYD A;  4PMC A;  2EXZ A;  4DU9 A;  3OMC A;  1STH A;  1EY4 A;  5C5M A;  4K5X A;  1A3U A;  4KY7 A;  4KY6 A;  1SNP A;  5IOC A;  4ODG A;  2F0J A;  1TQO A;  3NXW A;  5C4Z A;  5K5P A;  1SNM A;  3T13 A;  1KAB A;  1STG A;  3H6M A;  4DF7 A;  5CC4 A;  5KEE A;  3EVQ A;  4DGZ A;  1STY A;  4RKL A;  1KDC A;  4MIU A;  5IGC A;  4EQP A;  3MEH A;  3MHB A;  4KV6 A;  3NP8 A;  1EY6 A;  1SYG A;  1EY0 A;  1TR5 A;  1STN A;  4ID6 A;  5DAU A;  4K8J A;  2F0K A;  4H7B A;  5EKK A;  2SNS A;  3T16 A;  5C4H A;  5KIX A;  1SND A;  4N9P A;  3ERO A;  3LX0 A;  1SYB A;  3D8G A;  3NQT A;  2F0I A;  3U9O A;  4B9X A;  2RDF A;  4ME5 A;  1STB A;  1A3V A;  2PQE A;  3HZX A;  3SHL A;  2EYF A;  5J39 A;  1ENA A;  3MZ5 A;  4NMZ A;  3VA5 A;  4K14 A;  5NUC A;  4S3S A;  3TP5 A;  1EYC A;  5I9O A;  1EYA A;  4ZUJ A;  3SXH A;  5IGG A;  5JAV A;  3TP7 A;  1EY8 A;  3TP8 A;  2OF1 A;  4TRD A;  4OL7 A;  2F0U A;  2F0H A;  1AEX A;  1U9R A; 
#chains in the Genus database with same CATH topology
 1GUT A;  1HR0 W;  4DR4 Q;  2EY2 A;  2ID0 A;  4DNR B;  1BCP F;  2F0W A;  3K0Y A;  4GKK Q;  4IFD J;  1AN8 A;  4DR3 Q;  5DM6 3;  4ZK9 B;  3K59 A;  4ZKC B;  4KI0 A;  3URY A;  2F0Q A;  4F8M A;  4GNX A;  1DD2 A;  3NHH A;  2QEX A;  3DWA A;  2EY6 A;  2L12 A;  2O2L D;  4KY5 A;  3AEV A;  2XNA C;  1EWI A;  4NXM L;  3AFP A;  4B3S Q;  2CFM A;  2D9U A;  4C3I H;  4HJ9 A;  3HOU G;  3IRB A;  2XTI A;  2XWB B;  2MQH A;  4FXK C;  4K5W A;  2IY5 B;  3C2P A;  4OXP A;  3GTL H;  3S14 H;  5M9O A;  1ESR A;  5JJI A;  4R4Q A;  2JA5 G;  2AKW B;  1IBM Q;  1B44 D;  1BOS A;  1I6V C;  3SE0 A;  4HTH A;  2B3G A;  3ER0 A;  2A6H C;  1JOR A;  4DXG A;  2MPM A;  2K33 A;  1I6H B;  2L11 A;  5G3L D;  1JWS D;  3QO2 A;  4YY3 L;  2CW0 C;  3AMU A;  2JA8 B;  5LMN W;  5IGE A;  1FD7 D;  3DEP A;  5COY A;  1JJC B;  1XMO L;  2MHV A;  5JEA G;  2F0M A;  2NVX H;  2UXB Q;  1EOT A;  2RBM A;  4GNX C;  3PIP 3;  5M5Y H;  3A74 A;  2E2J B;  1IW7 C;  4EQN A;  4LUZ A;  1BKB A;  5CYU A;  1D5M C;  4DV3 Q;  1TS5 A;  5C6A A;  4IOC A;  3FKI G;  3G6E A;  1PRT C;  3FRP B;  2E8G A;  1EYD A;  1A8V A;  4OWT B;  4K5X A;  4KLK A;  1SNP A;  5IOC A;  3CU7 A;  4TSS A;  5EPJ A;  3H6M A;  3QJY A;  2MGS A;  2M9V A;  4LF8 Q;  3T16 A;  3I90 A;  1PH6 A;  1K8A C;  4JI8 Q;  1IXR A;  4AYB G;  1EOV A;  1EQQ A;  2IHF A;  4CDE C;  1SFO B;  4B08 A;  3VR3 A;  2NZH A;  3ULJ A;  3BYY B;  3GTG B;  3K7A H;  4QY7 A;  1PRT F;  1XX8 A;  4ZUJ A;  3JAM L;  5NUC A;  1FJG Q;  3D4W A;  3HOW B;  4R8N A;  2E5L Q;  1HJP A;  3BVG A;  1B2T A;  3W2D A;  1PH5 A;  4DV5 Q;  2BCO A;  3E0E A;  5IT9 L;  4C3I G;  1XPU A;  5JEA J;  2PO4 A;  1NR4 A;  3MWY W;  4JI2 Q;  2L1B A;  2F0O A;  1DZ1 A;  3S1R B;  1SN8 A;  3S16 H;  4K2L A;  1C9O A;  1VQI A;  1B50 A;  3HOV G;  4OIK A;  1T9H A;  1RCV D;  1G6Z A;  3KFU A;  5C5L A;  1VQ5 A;  1VQG A;  3I2Z A;  2X69 A;  4C1N I;  3PMF A;  2PZW A;  2WFW A;  3Q8D A;  1T5X D;  3OWE B;  4NPS A;  4G57 A;  3U50 C;  1TWH H;  3I4O A;  3NBI A;  1KDB A;  4DPG A;  2N55 A;  1VQE A;  3HEJ A;  4OGQ C;  1M1K C;  3KLR A;  1QE6 A;  1LUZ A;  2L4N A;  1YNJ C;  5D3I B;  2LS0 1;  3C1E A;  2E2H H;  3J7A 5;  1HNX L;  1V1O A;  5EPL A;  3EFX D;  2I5M X;  4FVM A;  2WAC A;  1X3G A;  4CDD C;  3GTP H;  2NUC A;  2RSO A;  1PH9 A;  4A3E B;  1DJR D;  2JQO A;  3TSS A;  1II3 A;  4E6I A;  2GVB A;  2ZJQ A;  1XNQ L;  3SK6 A;  1NAP A;  1YHQ A;  3OOC A;  4NXN L;  5HUR A;  4QB4 A;  2F3I A;  1X32 A;  2XSC A;  3VR6 A;  3M3Y H;  1LTI D;  3RZD H;  1ZYR C;  4DU9 A;  2I5L X;  5C3E H;  1SLJ A;  2VUM H;  4ODG A;  1EU4 A;  1U4M A;  4FF1 A;  4UHV A;  1Z9F A;  3IFD A;  2EIF A;  2KJX A;  4HID A;  3T56 B;  4HJ8 A;  2IHE A;  4L63 B;  2NVT B;  1STN A;  5IT9 c;  4H7B A;  2WP8 J;  3GTM H;  3PQI A;  3X3N A;  1XNR Q;  1SYB A;  2VB3 X;  1B70 B;  1STB A;  3I4N G;  1B53 A;  3FKI B;  4S3S A;  1GVP A;  2ZXR A;  5JVG 3;  1EY8 A;  5LL6 S;  1J8I A;  1JWU D;  4LMQ D;  3S1M B;  3OMG A;  2NN6 H;  4RCN A;  5C4J H;  5IT9 E;  4OWX B;  3GTJ H;  1N36 Q;  1BR9 A;  3T1H L;  4GKJ Q;  1DOM A;  3DM1 A;  1B8A A;  3NEM A;  3A5Z B;  4DV7 Q;  4AYB B;  4YCU A;  2MNA A;  1Q82 C;  1JT8 A;  3C3L A;  1WI5 A;  3J80 E;  2VQF Q;  1WTO A;  4BY7 G;  1D1K A;  4V19 0;  1TVX A;  2F3W A;  1RTN A;  4RHS A;  2R92 H;  4ZUI A;  2OXP A;  2NZ1 D;  3N52 A;  2B63 G;  3PIO 3;  4DK0 A;  1XTC D;  1DON A;  2PNH A;  5E7N A;  2WKD A;  4GN4 B;  4A3J H;  3KOJ A;  1C4Q A;  2JSO A;  4DV0 L;  1IBK Q;  4K8I A;  1WD1 A;  2N49 A;  1ASZ A;  2ALY B;  4PG3 A;  3K80 C;  4JV5 L;  1IBL L;  4LFA L;  1KTK A;  4IN3 A;  4IPC A;  1LAC A;  2DJF C;  4R4T A;  3BZC A;  4JYA L;  3HOV B;  2FXQ A;  1PV4 A;  5G3L F;  2PW7 A;  1Q86 C;  1UEB A;  1ML0 D;  4ZCK A;  4RGN A;  1GUN A;  2KVM A;  4U67 3;  2JJQ A;  1SYF A;  4IUP A;  4LAA A;  1PHJ A;  4B3M Q;  2EYM A;  5C3E G;  1WVL A;  1K3B C;  4O42 A;  1X3F A;  3NEN A;  4DR5 L;  1M8A A;  4RFB A;  3PUW A;  1VQL A;  3S17 B;  4X3S A;  5L37 A;  1RJT A;  2WIN B;  3WOE A;  5M5Y B;  1WTX A;  4B3R L;  4PMC A;  2EXZ A;  2VQE L;  2ZTC A;  3S2D B;  3TN2 A;  1AP0 A;  3A7A B;  4JCV E;  3AU7 A;  3K6O A;  1KHI A;  3T1Y Q;  1SNM A;  3T13 A;  2PI2 E;  3H91 A;  2FHT A;  2LFN A;  2AHO B;  1BXT A;  4JW0 A;  4EQP A;  3MHB A;  1N33 L;  4KV6 A;  4K8J A;  1JIC A;  1L0Y B;  3AFQ A;  4BWG B;  1X3E A;  1PH2 A;  4HCS A;  1NR2 A;  1IYU A;  4JG2 A;  2RQX A;  1VQ8 A;  2KOL A;  3PO3 B;  1V8Q A;  4A3F H;  3NTH A;  1LO5 D;  4LFC L;  2NWG A;  5JJK A;  1WD0 A;  2YU9 B;  1HZB A;  3SK5 A;  2EY5 A;  4FF4 A;  3GP7 A;  1GJX A;  2IT1 A;  5ELF A;  2HCI A;  1S5B D;  2EPB A;  1YEZ A;  1LTB D;  1I4P A;  4OX9 L;  2MFI A;  4K2K A;  1OXU A;  1I4H A;  2J0T D;  2PZU A;  1HNZ L;  4RGO S;  4LF5 Q;  2F4V Q;  4L5T A;  4NW2 A;  1ZEQ X;  3NEL A;  3VYT A;  4GOP B;  1O7L A;  1MKH A;  5A35 A;  3BU2 A;  4A3J G;  4JBM A;  4MTK A;  2QIL A;  3MAQ A;  2ZTD A;  1TWC B;  3I4N B;  3SDZ A;  4XDX A;  3RUZ A;  2EQS A;  2PQA B;  4HMI A;  5CV7 A;  2F0N A;  4IUT A;  2QKI C;  3VYR A;  1LT6 D;  5E4X A;  1X54 A;  1Y14 B;  1NMG A;  1EQR A;  1MBY A;  1CKO A;  3VR2 A;  4IPD A;  4GOP A;  4EQO A;  2EYL A;  3OW7 A;  3ZYY X;  4BA1 I;  3OSO A;  3TQY A;  2PMZ B;  2G9H D;  1HZC A;  1EWC A;  3D3R A;  1Z6H A;  2F0D A;  1KL9 A;  4BY7 B;  5T1I A;  2NB0 A;  1K8G A;  2PQA A;  4JI4 L;  1I6H H;  5KNB A;  2JA8 H;  1Q90 A;  2K05 A;  4DFA A;  2CH4 W;  2B63 B;  1EQT A;  4JOI A;  2K01 A;  2K4K A;  3LNN A;  4WRD A;  5ISR A;  1BBX C;  2ASB A;  3GTQ B;  1PFN A;  4K5V A;  3S2H B;  3GTP B;  3JC6 6;  2E2J H;  2QGQ A;  4JPB W;  4IQZ A;  1I94 L;  4J8Q A;  2C35 B;  4DA2 A;  1C48 A;  3NWT A;  1TWF B;  1YBY A;  4A3C H;  3TZD A;  4MIU A;  4UP7 A;  4RGM A;  3AB9 A;  4CDF C;  2UUB Q;  4GOP C;  1GUW A;  1IL2 A;  5IWA Q;  3RZD B;  4BBR G;  1BBW A;  5C3E B;  4BXX G;  1HR0 L;  4DAY B;  3M85 A;  3STB D;  4CJ1 B;  1K8M A;  4AIM A;  4IPH A;  1PH3 A;  1KRT A;  3W1B A;  2GN5 A;  4K14 A;  3A0J A;  4H44 C;  1N9W A;  1EYC A;  4BY1 H;  4LF6 Q;  2C9O A;  2F0H A;  4X66 Q;  2ZM6 L;  3I91 A;  1A63 A;  4JOI C;  1S4Z A;  4GLA C;  1B7Y B;  3M4Y A;  1GM5 A;  3GTG H;  3NWS A;  1ILP A;  1QNU A;  1E24 A;  2A8V A;  3IFT A;  3KDF B;  5C0X I;  1V1P B;  3VYS A;  3ITP A;  5AJ3 L;  3EN2 A;  1L2F A;  3HOW H;  4DAY A;  4OON A;  1JE5 A;  4DAP A;  2N3S A;  3CC2 A;  1RHP A;  3RMH A;  3GTJ B;  4LF4 Q;  2F52 A;  1G6P A;  3S1R H;  3H15 A;  2SDF A;  3HOX H;  1MGS A;  3NE5 B;  3NUC A;  1EY9 A;  1F2Z A;  4PZ8 A;  4U68 A;  2F0P A;  5LMN L;  1XPO A;  4LNQ A;  2BDO A;  1PZK D;  3KDF A;  1V1P A;  3R93 A;  1Q46 A;  3S1Q B;  3CAM A;  1N32 L;  1JC7 A;  5HGQ A;  4R4C A;  1KC8 C;  4DAM A;  4RCO A;  2K75 A;  4A3J B;  4IFD I;  3M4Q A;  3Q6S A;  4HSV A;  2MO1 A;  3D0F A;  2K50 A;  3BDO A;  4C3J G;  3U9S A;  2B2V A;  3GQB A;  4LJZ C;  4IUU A;  3M7G A;  4ABN A;  4NXM Q;  3ERQ A;  1QCB D;  3H3V C;  4HIK A;  2CVR A;  1CSP A;  2HIV A;  3K58 A;  3KJO A;  4A3E H;  1Y1V G;  4DK1 A;  1ZXT A;  3O13 A;  2B2W A;  1KXL A;  3LWU A;  2KUM A;  4KY7 A;  4KY6 A;  4DR2 Q;  1JB7 A;  3NXW A;  3MFY A;  2IX0 A;  4G4K A;  1XXG A;  3CCM A;  4YY3 Q;  3EVQ A;  4BY1 G;  4X64 L;  4P73 A;  2FMM A;  4ZRZ A;  3FVQ A;  3A55 A;  2EZV A;  4P74 A;  1CT1 D;  2K6A A;  5IYC H;  3RN5 A;  2EDG A;  4N9P A;  4J15 A;  3LX0 A;  1XMO Q;  2XIW A;  3KLS A;  5J39 A;  2VW9 A;  1ENA A;  2XVS A;  2RDH A;  4JC0 A;  1NMF A;  2B2V C;  2JXM B;  2ZJP A;  2NVT H;  3TP8 A;  1VQN A;  3L9A X;  3HOW G;  2ICE C;  4POF A;  4HJ5 A;  1SNQ A;  2D5D A;  3FHW A;  3TS0 A;  2C5C A;  4OHJ A;  2KHI A;  3FKI H;  2MUY A;  3RNU A;  1TS3 A;  4FDB A;  3BDC A;  2UUA L;  3W1G A;  3HOX G;  5GRO A;  3S1M H;  3R2T A;  1GUG A;  2B2W C;  4BBR B;  4IUQ A;  1WOC A;  5GAH C;  4YCV A;  2OTJ A;  3FPP A;  4I65 A;  1P8L A;  2QF7 A;  5CR3 A;  1DYQ A;  2QA4 A;  1LTG D;  5EJW A;  2BH2 A;  2ZXO A;  3T4A C;  1U4R A;  4IOA A;  4A3B G;  1Y69 U;  4JI6 L;  1SRO A;  1VQA A;  1X65 A;  5J3B A;  3RD4 A;  1H9J A;  5EKL A;  2AQ3 B;  2IPK D;  5CV9 A;  1QZH A;  1PZJ D;  1OTC A;  4JI3 L;  1QWY A;  1SE3 A;  3HOZ G;  1Q1B A;  3A54 A;  2RDG A;  1WCM B;  1X3P A;  1D2B A;  4A3E G;  3VR4 A;  2TSS A;  3K5M A;  5EBD A;  1OXT A;  5D14 A;  1VQP A;  2F0T A;  3HOV H;  1CZW A;  4NP5 A;  2ZXP A;  3M4P A;  4A3K H;  3J80 i;  4IZ8 A;  2CHB D;  4WOR A;  1F9P A;  1MIU A;  1RF2 D;  3I70 A;  2IX1 A;  1SAP A;  5IYC G;  3STB C;  4HIO A;  4ULL A;  1G8Z D;  1PH1 A;  1XPR A;  4A3I H;  1CI3 M;  1KIX A;  2KCT A;  3A7L A;  1E1O A;  1I3Q B;  1K0S A;  1SE4 A;  4UY8 C;  3S17 H;  4IJL A;  4DNT B;  2KCN A;  3GV3 A;  4C3J B;  1WTQ A;  5EKK A;  3S2D H;  4A3G G;  1HNX Q;  1SSO A;  4CBV A;  3L7Z C;  3NQT A;  1ONL A;  4DK3 C;  3NPP A;  3BZD B;  3PGZ A;  3TP5 A;  4QCL A;  1Y1V B;  3KK7 A;  2UXC L;  1LTT D;  3EJI A;  5C3W A;  4DN4 M;  1EIH A;  2PNR C;  3MXU A;  5EGT A;  3PO3 H;  3SEB A;  4NXN Q;  2Y0S E;  3E6Z X;  1Q3L A;  4RGT A;  2X6L A;  2K5Q A;  4IUV A;  4BY1 B;  2YU9 H;  4DK6 C;  4QF4 A;  5FO9 B;  4XT1 B;  3K5N A;  5M3F B;  3IAY A;  4FF2 A;  5FLX c;  2IL8 A;  2RHS B;  3FDT A;  3K7U C;  4UAI A;  1SNC A;  4JI1 L;  1PTO B;  1J6Q A;  1QG7 A;  1D6E C;  3PF4 A;  2DUD A;  5A2Q L;  4DV4 L;  5C44 H;  1YIT A;  1FNU A;  3S1N H;  3E9I A;  2WV6 D;  1K83 B;  2K14 A;  1TWC H;  5J22 A;  3I4N H;  4KK7 A;  1QUQ B;  4L5Q A;  5FLX E;  1PYB A;  4QUC A;  5I4D A;  4DR4 L;  1FGB D;  1XJV A;  4XYQ A;  4J6H A;  3HOX B;  4DR3 L;  2CKZ B;  4DR7 L;  2WKC A;  2HIX A;  2SEB D;  2VB2 X;  2Z0S A;  4A3K G;  2KBN A;  3T1H Q;  1JMC A;  3TRZ A;  3J80 L;  1I4Q A;  3CCL A;  4XXE A;  1FNW A;  3CPW A;  5HGT A;  4DR6 L;  2EYH A;  1EZ8 A;  4A3B B;  3HS0 C;  4LUV A;  4A3I G;  1I4G A;  3E5S A;  1QUQ A;  2QEJ C;  3VR5 A;  5JPM C;  4BY7 H;  1WYD A;  4XIG S;  2GVA A;  2IX3 A;  3CCU A;  2FMC A;  5KYI A;  5GAE C;  2B63 H;  1STE A;  4OO1 H;  3K8A A;  2F0V A;  1NCV A;  3UDG A;  3J7Z C;  3I72 A;  3HOZ B;  5LMU Q;  1S5E D;  2LMC B;  3GTQ H;  1MHW C;  3S2H H;  1ROD A;  2Q8R E;  4KHZ A;  3G4S A;  1IBL Q;  4LFA Q;  4JV5 Q;  5JVH 3;  5BR8 L;  4JYA Q;  4MNO A;  3OIQ A;  1EY6 A;  2PI2 A;  4ID6 A;  2WB1 E;  5AFW A;  2B8G A;  1TWF H;  2IJ0 A;  3PO3 G;  4ME5 A;  1PTO C;  1WTH A;  4EQ5 A;  1GXD C;  5FLM G;  1CA6 A;  3L3O C;  5T1G A;  2K5N A;  4DV3 L;  4KN4 C;  4OL7 A;  4DR5 Q;  1WTW A;  3KF8 B;  1LV9 A;  2JA7 G;  3H3V H;  1KNE A;  4H13 C;  5ELE A;  1VF7 A;  3CQZ B;  1PFB A;  4P75 A;  3SK4 A;  2JEA I;  2LY7 A;  3U58 A;  1A3T A;  1SMY D;  1WTP A;  4TKO B;  4B3R Q;  2DY8 A;  2VQE Q;  2EYJ A;  1VCI A;  5C44 G;  3D4R A;  4A3G B;  2J7Z A;  3VYU A;  2CH4 A;  2J4X A;  2HDL A;  4JBJ A;  2E76 C;  1F2Y A;  1S3O A;  4JI8 L;  1N33 Q;  5A2Q E;  3DUZ A;  2EJG C;  1G29 1;  2JE6 I;  4RAU C;  1O78 A;  3KF8 A;  1CSQ A;  2WII B;  1GUS A;  3J80 c;  5TSS A;  2X6G A;  5J1Z A;  2BOS A;  1FJG L;  1TT2 A;  2BE5 D;  3D6C A;  3J81 j;  2E5L L;  3WWV A;  4GZY C;  2ES2 A;  1S72 A;  1Q1E A;  1UNS A;  2Z4H A;  1IHZ A;  2K04 A;  1M90 C;  1RKN A;  2ICI A;  3DMU A;  2HQL A;  1L0W A;  4OX9 Q;  4YWK A;  1EUJ A;  5GAD C;  3TP6 A;  3OWF A;  1B9M A;  1HNZ Q;  1JB3 A;  4RH6 A;  3GTO H;  3I4M H;  3S1Q H;  1S5D D;  3OYY A;  4BS9 A;  3TEH B;  4CKB A;  4OO1 G;  4HIM A;  4R9W A;  1ICF B;  4YCW A;  2KEN A;  3F2U A;  3MEF A;  1GD7 A;  3CD6 A;  1IL8 A;  5M5W B;  2AWO A;  1A6X A;  3CCJ A;  2MO0 A;  1A15 A;  1W3S A;  1LTA D;  1KD1 C;  2RA4 A;  1VQF A;  4ILW A;  1FR3 A;  3PUX A;  4A3K B;  2HUG A;  2F4I A;  3HKZ E;  1H9M A;  1C7Y A;  2VNU D;  1ESF A;  1STY A;  2Z4I A;  1RIP A;  4XQN A;  1SYG A;  1EY0 A;  1TR5 A;  2NN6 I;  2R93 H;  1R4P B;  3H09 A;  4A3I B;  4DR1 L;  4FP5 D;  2ZTE A;  3D8G A;  3U9O A;  1G2T A;  2PQE A;  2DNE A;  2B29 A;  3F1Z A;  3QG1 A;  5I9O A;  1O80 A;  1UWV A;  2K32 A;  5IP7 H;  5IYD H;  1SE2 A;  5C3X A;  5C5M A;  3PF5 A;  1F2L A;  1QB5 D;  3CKI B;  2Z9H A;  1GO3 E;  2TMP A;  1VQ7 A;  3CP0 A;  2O4X A;  1HHV A;  3S15 B;  4CKE A;  4QGU A;  4GLX A;  1PYW D;  2NVY H;  4LF7 Q;  2N8N A;  3CCE A;  1VQB A;  1QIL A;  1NTG A;  1J9O A;  1I94 Q;  3R3O A;  3BVM A;  1IYV A;  5KYL A;  2JA6 B;  1DOL A;  2L9H A;  4V0B A;  4HCE A;  3H0G H;  1U0L A;  1QNK A;  4C2M H;  1N34 L;  3KLS X;  3MXG A;  3Q22 A;  1EIG A;  2AQ2 B;  1ASY A;  1EFW A;  1HR0 Q;  4BBR H;  1SXT A;  5JOB A;  1FL0 A;  4BXX H;  2JA7 B;  4MZ9 A;  3J81 i;  2FFK B;  3CCV A;  1UEA B;  1BO0 A;  3P75 A;  2HQE A;  3I4M G;  3RR5 A;  1AZQ A;  3E0J A;  2JN4 A;  4Q0F A;  2XGT A;  1YJ9 A;  2ZM6 Q;  1EL0 A;  3QR8 A;  4PQX A;  5CV6 A;  3M9B A;  5C44 B;  3Q24 A;  4GKJ L;  2RKS A;  2KHJ A;  4O1N A;  3S1N B;  4PNY A;  1DM0 B;  3I4L A;  4R8I A;  4K0K L;  4YWL A;  3LWE A;  3CMA A;  1YJW A;  5AJ3 Q;  4OWW B;  2YTV A;  4FXG C;  3IKJ A;  1D5Z C;  5E3F A;  1HQM C;  2AUJ D;  1KDA A;  3OTO L;  5IYB H;  2B39 A;  3W5O A;  3UDF A;  1WCM H;  4HAE A;  4HJ7 A;  1HTL D;  4R4O A;  1L0X B;  3CRK C;  4Q5V A;  1P16 A;  1EU3 A;  2OQK A;  2R93 G;  3J7A V;  3EQL C;  1VF5 C;  4LK1 C;  1E2W A;  2F0J A;  3HFZ B;  4ME3 A;  4P72 A;  5K5P A;  1N32 Q;  3CXC A;  4DF7 A;  1K3R A;  3K5O A;  3MTS A;  2QCP X;  5IP7 G;  5IYD G;  3HOY G;  4IJH A;  5FKA C;  2F0K A;  4QL5 A;  4A3M B;  4OEM B;  1I3Q H;  1SMY C;  4B9X A;  2L55 A;  3D31 A;  4DUZ L;  2H5X A;  4C3J H;  4NMZ A;  3ND8 A;  1WFQ A;  2GA4 B;  2E75 C;  1IKM A;  1BDO A;  5CBE E;  1AEX A;  3V96 A;  5IGD A;  3G71 A;  1J5E L;  1BVS A;  1F9Q A;  3R2I A;  4XQQ A;  3H0G G;  4IPG A;  4FYD A;  3DEO A;  5FJ8 H;  4XYO A;  2RSN A;  1Y1V H;  2UXD L;  3N6R A;  1NUC A;  4LF9 L;  4IUN A;  2BE5 C;  3J81 L;  1K8O A;  4LFB L;  2Q2T A;  1JOK A;  5KNC A;  4X64 Q;  1B4O A;  2R7D A;  1A62 A;  1MJE A;  3SVM A;  4HSP A;  2A68 D;  1HNW L;  1AH9 A;  1LLR D;  5M3F H;  5C4X G;  1SEB D;  1SR3 A;  5LHY 1;  2UUC L;  1G51 A;  2R7F A;  1PTO H;  5I2Y A;  2D2C C;  5E1F A;  2WB1 G;  2L5T A;  2WAQ E;  1B1Z A;  2I0Q A;  4X65 L;  1SYC A;  4JBK A;  5IGB A;  5IYB G;  1K83 H;  2HHH L;  4PMB A;  1Y8P B;  1PZI D;  2EE1 A;  1LT5 D;  3C1F A;  4ALP A;  2PZT A;  1JOQ A;  1WCM G;  2F0F A;  3T51 B;  4KHV A;  1VQ9 A;  2UUA Q;  1HRJ A;  4PMW A;  1JCK B;  3F2D A;  1SJH D;  1LAB A;  2EYP A;  1F9S A;  3GTK B;  1U4L A;  4BBS G;  3MC0 B;  2PCF B;  3IL8 A;  3DWQ A;  1EY7 A;  3GTO B;  3I4M B;  4X62 L;  1I5F A;  1PDQ A;  2QDB A;  3CPF A;  3U4V A;  1VQO A;  2M2L A;  4JI6 Q;  4A3B H;  3SGI A;  3MFG A;  2CCZ A;  4FXD A;  1BQQ T;  1CHP D;  1I50 H;  1E2Z A;  1KAB A;  5CC4 A;  1PH7 A;  4JI3 Q;  3CF5 A;  2CQA A;  4RKL A;  4RG1 A;  1BBU A;  3NP8 A;  4ZKB B;  2Y0S B;  1MSH A;  2SNS A;  1PLF A;  2VY3 A;  2XRQ D;  4L8J A;  3HOZ H;  4C3H H;  2NTS A;  3BZK A;  3ND9 A;  4HR7 B;  3RLF A;  5FJ8 G;  3SHL A;  1DCZ A;  3J81 c;  1V1Q A;  1AE3 A;  2XWJ B;  2R93 B;  2Q2H A;  3X3M A;  4HN7 A;  2AWN A;  1KLU D;  1E22 A;  4M1U B;  5DNF A;  3ERS X;  1R9T H;  2DN8 A;  1MI2 A;  4KN7 C;  1FVI A;  1DOK A;  2OT2 A;  1LT4 D;  3NTK A;  3QOL A;  4NKL A;  5M3F G;  1NSN S;  3HOY B;  3J81 E;  2B2Y A;  4RA8 A;  3CQZ H;  2Q8I B;  2DJG C;  4YHH L;  1TY0 A;  4N9T A;  3RN2 A;  1JR0 D;  2AUK A;  5IWA L;  1QJO A;  1NBW A;  4IFD G;  2NVY B;  3HRZ C;  1Y1W B;  2MJ8 A;  4A3G H;  3HKZ G;  3BDL A;  1SJE D;  1ET6 A;  2V1C C;  4LF6 L;  1EZ6 A;  1TII D;  1EIY B;  2K52 A;  2KA7 A;  4MHE A;  2A73 B;  3H0G B;  4UDU C;  1PVO A;  2NYZ D;  2YTX A;  1PTO D;  4C2M B;  4F87 A;  5KRU A;  2UXC Q;  1HA5 A;  4A4I A;  2PW5 A;  2ATW A;  1G91 A;  3HG9 A;  3PUZ A;  2B2U A;  2UU9 L;  2YV5 A;  5FO7 B;  5FOB B;  3TBI B;  5ELN A;  4WJ3 M;  2EXD A;  2D0O A;  3V2T A;  1CKN B;  3A8K E;  5C4X B;  2XN9 C;  1D7Q A;  2B2Y C;  4JI1 Q;  3TME A;  4FNF A;  4I7Z C;  4JI0 L;  5COR A;  5H1S E;  4Y52 H;  1YZ6 A;  4ZAI A;  1XTD A;  5FLX L;  2WB1 B;  3K5L A;  4DV4 Q;  2BA1 A;  4TVA B;  2NBF A;  5FK9 C;  3NTI A;  4JI5 L;  1R4Q B;  1Y8N B;  4R4I A;  4IO9 A;  4L5R C;  4UPA A;  1EY4 A;  4C3H G;  1A3U A;  2BH8 A;  1OXV A;  3GO5 A;  5M5W H;  3VDY A;  4AQY L;  2G9D A;  4GLV B;  1CKN A;  1TKW B;  4DR7 Q;  3I8Z A;  2RCN A;  4DUY L;  4KKT A;  3JAM i;  2B2U C;  5KIX A;  4BBS B;  2E2D C;  1QVC A;  4CDC C;  1ET9 A;  1K73 C;  1D8L A;  3Q0A A;  4DV6 L;  1A3V A;  3GD7 A;  3HZX A;  4L5S A;  2EYF A;  4DR6 Q;  1FGU A;  5M5X B;  2JEB I;  1F9R A;  3TP7 A;  2R7Z G;  3DWP A;  1JJG A;  1XYI A;  3MXP A;  1A2U A;  1DGS A;  4A93 B;  2JK8 A;  4JI7 L;  1X9N A;  3M7N A;  3D6W A;  2A68 C;  2O5J C;  2JP1 A;  3NQI A;  1K28 A;  4B3T L;  3LGJ A;  1A0I A;  1TXY A;  4DR2 L;  2KEC A;  5I6Y A;  4M8A A;  4HJA A;  2DGY A;  2RHQ B;  3RLO A;  5D65 A;  3S15 H;  4F88 A;  1K0R A;  3CHB D;  5JJL A;  5BR8 Q;  3TDQ A;  3F8T A;  2DNC A;  1EYG A;  2QW7 A;  4A3D H;  1XNQ Q;  1LYL A;  2AMC B;  4I7A A;  1KRS A;  3SK8 A;  2NVQ B;  1EY5 A;  5DLQ E;  3GV6 A;  1XMQ L;  2JA6 H;  4KHP L;  2B8F A;  4B9W A;  1PA6 A;  2F03 A;  3UDI A;  2Z8L A;  5DM7 3;  4C56 C;  4HMJ A;  2HDM A;  1YHB A;  5FLM H;  1ZKO A;  2V4D A;  1N8R C;  2RVL A;  1CHQ D;  1NY4 A;  5EQ0 A;  2VL6 A;  2JA7 H;  4DV2 L;  1NE3 A;  4KKS A;  5M3M H;  3V05 A;  1EQV A;  2F0G A;  2A19 A;  3KUP A;  1E0B A;  1IYJ B;  1GHK A;  4DV1 L;  3HKZ B;  1UE5 A;  1WJJ A;  2JYO A;  2F0E A;  3EIV A;  1HFN A;  1YVC A;  1HFG A;  5GQO A;  5IGF A;  5IE8 A;  3L0O A;  1QVF A;  4GKK L;  1UAP A;  4QIW E;  1PH4 A;  1QZG A;  1CK1 A;  1EWH A;  1HXY D;  2CWA A;  2EOT A;  2VXW A;  1NNX A;  3G48 A;  5HY6 A;  1SE8 A;  2K5H A;  3KBX A;  4B3S L;  4O2D A;  4X3U A;  4DNI A;  1UE6 A;  5ELD A;  3DXJ C;  2WAQ G;  1AW7 A;  1PFM A;  1FNV A;  1IBM L;  1I50 B;  1Q8I A;  2Z1C A;  2BA0 A;  1B9N A;  1HQR D;  1GKH A;  4TRD A;  3RZO B;  3KYH C;  3UI2 A;  4KJN A;  4DV0 Q;  4A3M H;  4ZYS A;  3ONA B;  4UP9 A;  5BN5 A;  4C3H B;  1DXM A;  1RL2 A;  5IP9 H;  3S9W A;  1OXS C;  2KED A;  1SMX A;  2VZA A;  2E2I H;  3AQQ A;  3A5U A;  4A3D G;  1KQS A;  2EYO A;  2UXB L;  3U4Z A;  3TZU A;  2JA6 G;  1X3Q A;  2M00 A;  4G7Z C;  2CWP A;  1R9T B;  1YIJ A;  2EJM A;  3QB3 A;  3HOU B;  3OW2 A;  2EJF C;  4DR1 Q;  1CUK A;  1STA A;  1ILQ A;  1W6K A;  2E74 C;  2F1M A;  3L2P A;  3PO2 H;  1S5F D;  2R7Z B;  2I5H A;  2JA5 B;  1X56 A;  5M3M G;  2I46 A;  2KQ3 A;  4CGY B;  5KGU A;  4DXF A;  1V9P A;  1SYD A;  1AFP A;  1CA5 A;  1TWA B;  2RCF A;  1U5K A;  4LF8 L;  3CW2 C;  4IUR A;  1PTO F;  4QUF A;  5CV8 A;  2EY1 A;  4JVZ A;  2K5W A;  2Z6B A;  3JAM c;  2FIN B;  4OO1 I;  1YHA A;  1SBB B;  1H9R A;  1CQF A;  4RHR A;  4X3K A;  1LTR D;  4KMU C;  1WTR A;  3M4O B;  4P71 A;  2CQO A;  4H0L C;  4LFC Q;  1N34 Q;  4CHT B;  3FPU B;  1TS4 A;  3CME A;  1JQY D;  1KAW A;  1YNX A;  4DV5 L;  1K9M C;  2KCM A;  1QOH A;  3JAM E;  4Y7N B;  3GTK H;  4A3L H;  4JI2 L;  3OMC A;  3HGB A;  1KNA A;  5BN4 A;  1TQO A;  4C1N K;  3I3C A;  3CC4 A;  1STG A;  4POG A;  1B3A A;  1V43 A;  4UP8 A;  1KDC A;  2B2T A;  5IGC A;  1TWG B;  4G7O C;  5DAU A;  3WDN A;  3H3V I;  1VMP A;  4A3M G;  5C4H A;  1LTS D;  4K0K Q;  2OWO A;  5IP9 G;  2H4O A;  5EBC A;  5ELB A;  1UUP A;  1TU2 B;  2FJ2 A;  1H9K A;  3QWN A;  1CM9 A;  4GS3 A;  3OTO Q;  3SXH A;  1QVG A;  1SYE A;  2HD3 A;  1RDP D;  3AYH B;  2ENB A;  5CV5 A;  3PIP A;  2O5I C;  2OTL A;  1ENF A;  1O7I A;  3W3A A;  1JOO A;  3ULP A;  2HT1 A;  1E7Z A;  4PZ7 A;  1Q81 C;  1CQV A;  4C3I B;  1LT3 D;  1YNN D;  3RLN A;  5LMU L;  3GTL B;  3S14 B;  3PO2 G;  1HZA A;  2LSS A;  3ZJY C;  1HUM A;  2WAQ B;  4JI4 Q;  1HA6 A;  3K81 C;  2DY7 A;  2MP1 A;  5I2X A;  3D4D A;  2KEE A;  3A56 A;  1VDZ A;  2R61 A;  2VS1 A;  3ULL A;  3P20 A;  1C8C A;  3HOY H;  1D1I A;  4HED A;  2B2T C;  1PFS A;  1CZG A;  5I6W A;  4KTA A;  1EFI D;  1FYC A;  1F77 A;  4CKC A;  4YWM A;  4DUZ Q;  1RTO A;  4F7X A;  2VUM G;  4OEL B;  1Y1W H;  1E3P A;  1ENC A;  4A3D B;  4JK1 C;  4G7H C;  2NVX B;  1BUV T;  1EIF A;  1J5E Q;  4K6D A;  4RWS C;  3HKS A;  3PUV A;  1IZ6 A;  2R3Z A;  2A5H A;  3BYT B;  3NK9 A;  3QOJ A;  1L1O B;  2YTY A;  2OQ0 A;  1MSG A;  3CCQ A;  4J1M A;  1XNR L;  2UXD Q;  1LTL A;  4GN3 B;  4A3L G;  4LF9 Q;  4KD3 A;  4LFB Q;  1HTP A;  5M3M B;  2LXK A;  2OCE A;  2NN6 G;  3UDX A;  3ICE A;  2F0S A;  3MVV A;  1RD9 D;  1D5X C;  5CMD A;  1HNW Q;  2KHS A;  4R1J A;  4WJ4 A;  2H1E A;  1S40 A;  1N36 L;  5C4X H;  2UUC Q;  4KD4 A;  3NBH B;  1STH A;  1L1O A;  4N8F A;  4DV7 L;  1G2S A;  1OO9 B;  4X65 Q;  1HCZ A;  3A8I E;  5KEE A;  2VQF L;  3K7A B;  2A69 D;  2Y0S G;  2HHH Q;  2R92 G;  2AQ1 B;  1VQK A;  1CKM A;  3CC7 A;  1VQJ A;  1SND A;  1Q7Y C;  2K28 A;  1H9S B;  2F0I A;  1EEI D;  5JJZ A;  4X6A H;  1Q8K A;  4Z9C B;  2A1A A;  4FO2 A;  4XQJ A;  3BVZ A;  3MXN B;  3R8B A;  1ICW A;  2K1B A;  1BCP D;  3GDE A;  5LMN Q;  5IGG A;  1EYA A;  4LW1 A;  4NB3 A;  1IBK L;  1VS0 A;  3NBH A;  4BBS H;  3ERO A;  3S16 B;  2D62 A;  1JE4 A;  4JBW A;  4X62 Q;  1BNZ A;  2I07 B;  5F2D A;  3OHX C;  4ZLT F;  5M5X H;  3BS1 A;  2Q8T A;  5IY0 A;  1VQM A;  2RF4 A;  4KKU A;  1GUO A;  3Q23 A;  5CV4 A;  4A93 H;  3I73 A;  1H9S A;  2A6E D;  1E2V A;  1L1O C;  4B3M L;  5K36 H;  3MXN A;  3VA7 A;  4CJ0 B;  1TWH B;  1Y1W G;  2E2I B;  4DAV A;  4A75 A;  1W2B A;  4OIJ A;  5C0X H;  3EBE A;  2KCC A;  5E4W C;  2L0C A;  4MTN A;  2K5V A;  2P5Z X;  2E2H B;  4EX5 A;  4AYB E;  3UE0 A;  4ZQ3 A;  1PMR A;  2A74 C;  4RMF A;  2N88 A;  3T1Y L;  1HUN A;  2NVQ H;  2NZO A;  3PO2 B;  1JWM D;  1MJC A;  2PYK A;  5IOD A;  4LF7 L;  4LWC A;  5EKI A;  1CTM A;  1VQ6 A;  2LKV A;  2A6H D;  2F0L A;  1UE1 A;  3HP3 A;  5KND A;  4A3F G;  3CCR A;  3CCS A;  1UE7 A;  3PUY A;  4YHH Q;  3F2C A;  4APV A;  3M3Y B;  4EVO A;  1A2T A;  1VQD A;  1PXU A;  2CW0 D;  2G5D A;  3PV0 A;  3DHQ A;  2VUM B;  1Z47 A;  3S24 A;  5CGK A;  4IFD H;  3QIA A;  4QJF A;  2PPB C;  4DKA C;  2QDL A;  1SNO A;  2F4V L;  3I55 A;  4LF5 L;  3TRE A;  1X6O A;  3PIO A;  3BJU A;  3T53 B;  3BG3 A;  3GTM B;  1SFO H;  1LM0 A;  5C4Z A;  2NTT A;  1SRU A;  1KLG D;  4XTC S;  1IW7 D;  3KJP A;  1B3Q A;  4DGZ A;  2UU9 Q;  2IW3 A;  3EA6 A;  5CBA E;  2N78 A;  1PRT D;  5FO8 B;  1HH2 P;  3G7L A;  3H94 A;  5C4J B;  3TS2 A;  1YNN C;  2HCC A;  1VQ4 A;  3F2B A;  2LXJ A;  3DM3 A;  3VA5 A;  1XWE A;  3A8J E;  1AZP A;  1I4R A;  3FP9 A;  4PV1 C;  5JAV A;  4X3T A;  2OF1 A;  2F0U A;  5EAY A;  2JA9 A;  5DEH A;  4A93 G;  4JI0 Q;  3KLW A;  3I7F A;  1KAA A;  1BF4 A;  2Q2U A;  5K36 G;  3FEW X;  2Q2I A;  3FMC A;  1BCP B;  1T5E A;  3P7J A;  4TQU S;  4JI5 Q;  3J7Y W;  1CFM A;  4L6T B;  3E9H A;  3RZO H;  4CJ2 C;  2JA8 G;  5C0X G;  2R92 B;  1E1T A;  1Q12 A;  3OIP A;  1GHJ A;  1VQH A;  2L15 A;  1H95 A;  3KF6 B;  3K57 A;  4AQY Q;  3B6Y A;  3E3X A;  3UE1 A;  1HZ9 A;  4YIJ A;  3I56 A;  2OEO A;  4WFN 3;  5ELO A;  3SR1 A;  4DUY Q;  4EGV A;  2D0P A;  4KJO A;  3C46 A;  4MN3 A;  1TS2 A;  4PZ6 A;  3K0X A;  4QMG A;  4DV6 Q;  5EPK A;  2SOB A;  4LUO A;  5ELC A;  1PH8 A;  4NDX A;  3P1H A;  4GN5 A;  3J7A F;  3WOF A;  3HOU H;  4A76 A;  4A3C G;  2R7Z H;  2JA5 H;  4JI7 Q;  3KF6 A;  1W6J A;  1JJ2 A;  1MD2 D;  5IIF A;  1Z7T A;  2UUB L;  1Y8O B;  4QIW B;  5JPN C;  5BN3 A;  1NJI C;  3NSW A;  1O7Z A;  1S5C D;  4B3T Q;  2ZT9 C;  3MA2 B;  1TWA H;  4IAL A;  5D3D A;  1VMC A;  3KBG A;  1M4V A;  2K5D A;  2Z6K A;  1YJN A;  5I9P A;  1SDF A;  1WTV A;  3CRL C;  3PSI A;  1PYS B;  4X66 L;  4XT3 B;  2K7V A;  2F3V A;  1YNJ D;  2A69 C;  4WJW A;  4RKB A;  1F2M A;  5JEA H;  4BA2 I;  2PMZ E;  2SNM A;  1EEF D;  1VQC A;  4N8X 1;  1XMQ Q;  2ZJR A;  5C0X J;  3M4O H;  2EVB A;  4KHP Q;  1C0A A;  3PCO B;  1IKL A;  1BCP C;  2R6G A;  4AH6 A;  2K03 A;  1AE2 A;  4Y7N H;  4K6L A;  4DV2 Q;  2BDN A;  4A3F B;  4LF4 L;  3MEH A;  1X55 A;  1HPC A;  4P2C B;  2XRS D;  3G6J B;  4GNX B;  4O0A A;  1YI2 A;  2IWH A;  5GAG C;  4FF3 A;  3DLL A;  1O7Y A;  1ZYR D;  1U4P A;  5LL6 X;  2RDF A;  1GOZ A;  3MZ5 A;  4H02 A;  1OXX K;  1TWG H;  4DV1 Q;  2Z6K C;  4QQB X;  1PRT B;  1TY2 A;  2A6E C;  1I4X A;  2YYZ A;  3OPO A;  1U9R A; 
#chains in the Genus database with same CATH homology
 1GUT A;  2EY2 A;  2ID0 A;  4DNR B;  1BCP F;  2F0W A;  3K0Y A;  4IFD J;  1AN8 A;  5DM6 3;  4ZK9 B;  3K59 A;  4ZKC B;  4KI0 A;  3URY A;  2F0Q A;  4F8M A;  1DD2 A;  3NHH A;  3DWA A;  2EY6 A;  2L12 A;  2O2L D;  4KY5 A;  2XNA C;  2D9U A;  2XWB B;  4FXK C;  4K5W A;  3C2P A;  5M9O A;  1ESR A;  1B44 D;  1BOS A;  1I6V C;  3SE0 A;  4HTH A;  2A6H C;  1JOR A;  4DXG A;  2MPM A;  2K33 A;  1I6H B;  2L11 A;  5G3L D;  1JWS D;  3QO2 A;  3AMU A;  2CW0 C;  2JA8 B;  5IGE A;  1FD7 D;  3DEP A;  5COY A;  2MHV A;  5JEA G;  2F0M A;  1EOT A;  2RBM A;  3PIP 3;  2E2J B;  1IW7 C;  4EQN A;  5CYU A;  1D5M C;  1TS5 A;  5C6A A;  1PRT C;  3FRP B;  1EYD A;  4K5X A;  1SNP A;  5IOC A;  3CU7 A;  4TSS A;  5EPJ A;  3H6M A;  3QJY A;  2MGS A;  2M9V A;  3T16 A;  3I90 A;  1SFO B;  4B08 A;  3VR3 A;  3BYY B;  3GTG B;  1PRT F;  1XX8 A;  4ZUJ A;  3JAM L;  5NUC A;  3D4W A;  3HOW B;  4R8N A;  1B2T A;  3BVG A;  3W2D A;  2BCO A;  5IT9 L;  4C3I G;  5JEA J;  2PO4 A;  1NR4 A;  3MWY W;  2L1B A;  2F0O A;  1DZ1 A;  3S1R B;  4K2L A;  1B50 A;  4OIK A;  1RCV D;  1G6Z A;  5C5L A;  2X69 A;  4C1N I;  3PMF A;  2PZW A;  1T5X D;  3OWE B;  4G57 A;  3NBI A;  1KDB A;  2N55 A;  3HEJ A;  4OGQ C;  3KLR A;  1QE6 A;  2L4N A;  1YNJ C;  5D3I B;  2LS0 1;  3C1E A;  1V1O A;  5EPL A;  3EFX D;  4FVM A;  2WAC A;  2NUC A;  2RSO A;  4A3E B;  1DJR D;  3TSS A;  1II3 A;  4E6I A;  3SK6 A;  1NAP A;  3OOC A;  5HUR A;  4QB4 A;  1X32 A;  2XSC A;  3VR6 A;  1LTI D;  1ZYR C;  4DU9 A;  4ODG A;  1EU4 A;  1U4M A;  4FF1 A;  3IFD A;  2KJX A;  3T56 B;  4L63 B;  2NVT B;  1STN A;  4H7B A;  2WP8 J;  3X3N A;  1SYB A;  2VB3 X;  1STB A;  1B53 A;  3FKI B;  4S3S A;  2ZXR A;  5JVG 3;  1EY8 A;  5LL6 S;  1J8I A;  1JWU D;  4LMQ D;  3S1M B;  3OMG A;  2NN6 H;  4RCN A;  5IT9 E;  1BR9 A;  1DOM A;  3DM1 A;  4AYB B;  3C3L A;  3J80 E;  1WTO A;  1D1K A;  4V19 0;  1TVX A;  2F3W A;  1RTN A;  4RHS A;  4ZUI A;  2OXP A;  2NZ1 D;  3N52 A;  3PIO 3;  4DK0 A;  1XTC D;  1DON A;  2WKD A;  1C4Q A;  2JSO A;  4K8I A;  1WD1 A;  1KTK A;  4IN3 A;  1LAC A;  3HOV B;  5G3L F;  2PW7 A;  1ML0 D;  4RGN A;  1GUN A;  2KVM A;  4U67 3;  1SYF A;  4IUP A;  4LAA A;  2EYM A;  1WVL A;  4O42 A;  1M8A A;  4RFB A;  3PUW A;  3S17 B;  4X3S A;  1RJT A;  2WIN B;  3WOE A;  5M5Y B;  1WTX A;  4PMC A;  2EXZ A;  3S2D B;  3TN2 A;  1AP0 A;  3A7A B;  3AU7 A;  3K6O A;  1SNM A;  3T13 A;  3H91 A;  2FHT A;  2LFN A;  1BXT A;  4EQP A;  3MHB A;  4KV6 A;  4K8J A;  1JIC A;  1L0Y B;  4BWG B;  4HCS A;  1NR2 A;  1IYU A;  2RQX A;  2KOL A;  3PO3 B;  1V8Q A;  3NTH A;  1LO5 D;  2NWG A;  1WD0 A;  2YU9 B;  3SK5 A;  2EY5 A;  4FF4 A;  3GP7 A;  1GJX A;  2IT1 A;  5ELF A;  2HCI A;  1S5B D;  2EPB A;  1LTB D;  1I4P A;  4K2K A;  1OXU A;  1I4H A;  2J0T D;  2PZU A;  4RGO S;  4NW2 A;  1ZEQ X;  3VYT A;  1O7L A;  5A35 A;  2QIL A;  3MAQ A;  1TWC B;  3I4N B;  3SDZ A;  4XDX A;  3RUZ A;  4HMI A;  5CV7 A;  2F0N A;  4IUT A;  2QKI C;  3VYR A;  1LT6 D;  5E4X A;  1MBY A;  3VR2 A;  4EQO A;  2EYL A;  3OW7 A;  3ZYY X;  4BA1 I;  3OSO A;  2PMZ B;  2G9H D;  1EWC A;  3D3R A;  1Z6H A;  2F0D A;  4BY7 B;  5T1I A;  2NB0 A;  5KNB A;  1Q90 A;  2K05 A;  4DFA A;  2B63 B;  1EQT A;  2K01 A;  3LNN A;  4WRD A;  5ISR A;  1BBX C;  3GTQ B;  1PFN A;  4K5V A;  3S2H B;  3GTP B;  4IQZ A;  4J8Q A;  4DA2 A;  1C48 A;  3NWT A;  1TWF B;  3TZD A;  4MIU A;  4RGM A;  3AB9 A;  1GUW A;  3RZD B;  5C3E B;  3M85 A;  4CJ1 B;  1K8M A;  4K14 A;  4H44 C;  1EYC A;  2C9O A;  2F0H A;  3I91 A;  1S4Z A;  3M4Y A;  3NWS A;  1ILP A;  1QNU A;  3IFT A;  5C0X I;  1V1P B;  3VYS A;  3ITP A;  4DAY A;  4DAP A;  1RHP A;  3RMH A;  3GTJ B;  2SDF A;  1MGS A;  3NE5 B;  3NUC A;  1EY9 A;  1F2Z A;  4U68 A;  2F0P A;  2BDO A;  1PZK D;  1V1P A;  3R93 A;  3S1Q B;  1JC7 A;  4RCO A;  4A3J B;  4IFD I;  3Q6S A;  4HSV A;  3BDO A;  4C3J G;  3U9S A;  2B2V A;  3GQB A;  4LJZ C;  4IUU A;  3M7G A;  4ABN A;  3ERQ A;  1QCB D;  3H3V C;  2CVR A;  3K58 A;  4DK1 A;  1ZXT A;  3O13 A;  2B2W A;  3LWU A;  2KUM A;  4KY7 A;  4KY6 A;  3NXW A;  3MFY A;  2IX0 A;  4G4K A;  1XXG A;  3EVQ A;  2FMM A;  4ZRZ A;  3FVQ A;  3A55 A;  2EZV A;  1CT1 D;  2K6A A;  2EDG A;  4N9P A;  3LX0 A;  2XIW A;  3KLS A;  5J39 A;  1ENA A;  2XVS A;  2RDH A;  2JXM B;  2B2V C;  3TP8 A;  3L9A X;  2ICE C;  1SNQ A;  2D5D A;  2C5C A;  4OHJ A;  2MUY A;  1TS3 A;  3BDC A;  3R2T A;  1GUG A;  2B2W C;  4BBR B;  4IUQ A;  3FPP A;  4I65 A;  2QF7 A;  5CR3 A;  1DYQ A;  1LTG D;  5EJW A;  2ZXO A;  3T4A C;  1U4R A;  1Y69 U;  3RD4 A;  1H9J A;  5EKL A;  2AQ3 B;  2IPK D;  5CV9 A;  1PZJ D;  1QWY A;  1SE3 A;  1Q1B A;  3A54 A;  2RDG A;  1WCM B;  1X3P A;  1D2B A;  3VR4 A;  2TSS A;  3K5M A;  5EBD A;  1OXT A;  5D14 A;  2F0T A;  1CZW A;  4NP5 A;  2ZXP A;  4IZ8 A;  2CHB D;  4WOR A;  1F9P A;  1RF2 D;  3I70 A;  2IX1 A;  1SAP A;  4ULL A;  1G8Z D;  1CI3 M;  3A7L A;  1I3Q B;  1SE4 A;  4DNT B;  2KCN A;  3GV3 A;  4C3J B;  1WTQ A;  5EKK A;  1SSO A;  4CBV A;  3L7Z C;  3NQT A;  1ONL A;  3NPP A;  3BZD B;  3TP5 A;  4QCL A;  1Y1V B;  3KK7 A;  1LTT D;  3EJI A;  5C3W A;  4DN4 M;  1EIH A;  2PNR C;  3MXU A;  5EGT A;  3SEB A;  3E6Z X;  1Q3L A;  4RGT A;  2X6L A;  2K5Q A;  4IUV A;  4BY1 B;  4QF4 A;  5FO9 B;  4XT1 B;  3K5N A;  5M3F B;  3IAY A;  4FF2 A;  2IL8 A;  3FDT A;  4UAI A;  1SNC A;  1PTO B;  1QG7 A;  1D6E C;  5A2Q L;  1FNU A;  2WV6 D;  1K83 B;  5J22 A;  4KK7 A;  5FLX E;  4QUC A;  5I4D A;  1FGB D;  4XYQ A;  4J6H A;  3HOX B;  2WKC A;  2SEB D;  2VB2 X;  3J80 L;  1I4Q A;  4XXE A;  1FNW A;  5HGT A;  2EYH A;  1EZ8 A;  4A3B B;  3HS0 C;  1I4G A;  3E5S A;  2QEJ C;  3VR5 A;  5JPM C;  4XIG S;  2IX3 A;  2FMC A;  5KYI A;  1STE A;  4OO1 H;  2F0V A;  1NCV A;  3I72 A;  3HOZ B;  1S5E D;  2LMC B;  1ROD A;  2Q8R E;  4KHZ A;  5JVH 3;  3OIQ A;  1EY6 A;  4ID6 A;  5AFW A;  2B8G A;  2IJ0 A;  4ME5 A;  1PTO C;  1GXD C;  1CA6 A;  3L3O C;  5T1G A;  4KN4 C;  4OL7 A;  1WTW A;  1LV9 A;  1KNE A;  4H13 C;  5ELE A;  1VF7 A;  3CQZ B;  1PFB A;  3SK4 A;  2JEA I;  2LY7 A;  1A3T A;  1SMY D;  1WTP A;  4TKO B;  2DY8 A;  2EYJ A;  1VCI A;  3D4R A;  4A3G B;  2J7Z A;  3VYU A;  2J4X A;  2HDL A;  2E76 C;  1F2Y A;  5A2Q E;  3DUZ A;  2EJG C;  1G29 1;  2JE6 I;  4RAU C;  1O78 A;  3KF8 A;  2WII B;  1GUS A;  5TSS A;  2X6G A;  5J1Z A;  2BOS A;  1TT2 A;  2BE5 D;  3D6C A;  4GZY C;  1Q1E A;  1UNS A;  2Z4H A;  1IHZ A;  2K04 A;  1RKN A;  2ICI A;  3DMU A;  3TP6 A;  3OWF A;  1B9M A;  1JB3 A;  4RH6 A;  1S5D D;  4BS9 A;  4CKB A;  4OO1 G;  4R9W A;  3F2U A;  1IL8 A;  5M5W B;  2AWO A;  1A6X A;  1A15 A;  1LTA D;  2RA4 A;  4ILW A;  1FR3 A;  3PUX A;  4A3K B;  2HUG A;  2F4I A;  1H9M A;  2VNU D;  1ESF A;  1STY A;  2Z4I A;  4XQN A;  1SYG A;  1EY0 A;  1TR5 A;  2NN6 I;  1R4P B;  3H09 A;  4A3I B;  4FP5 D;  3D8G A;  3U9O A;  1G2T A;  2PQE A;  2DNE A;  3QG1 A;  5I9O A;  1O80 A;  2K32 A;  1SE2 A;  5C3X A;  5C5M A;  1F2L A;  1QB5 D;  3CKI B;  2TMP A;  2O4X A;  1HHV A;  3S15 B;  4CKE A;  1PYW D;  1QIL A;  1J9O A;  3R3O A;  3BVM A;  1IYV A;  5KYL A;  2JA6 B;  1DOL A;  2L9H A;  4V0B A;  4HCE A;  1QNK A;  3KLS X;  3MXG A;  3Q22 A;  1EIG A;  2AQ2 B;  1SXT A;  5JOB A;  2JA7 B;  2FFK B;  1UEA B;  1BO0 A;  3P75 A;  2HQE A;  1AZQ A;  3E0J A;  4Q0F A;  1EL0 A;  4PQX A;  5CV6 A;  5C44 B;  3Q24 A;  2RKS A;  4O1N A;  3S1N B;  4PNY A;  1DM0 B;  3I4L A;  4R8I A;  3LWE A;  4FXG C;  3IKJ A;  1D5Z C;  5E3F A;  1HQM C;  2AUJ D;  1KDA A;  2B39 A;  4HAE A;  1HTL D;  1L0X B;  3CRK C;  4Q5V A;  1EU3 A;  3J7A V;  3EQL C;  1VF5 C;  4LK1 C;  1E2W A;  2F0J A;  5K5P A;  4DF7 A;  3K5O A;  3MTS A;  2QCP X;  5FKA C;  2F0K A;  4A3M B;  1SMY C;  4B9X A;  2L55 A;  3D31 A;  4NMZ A;  3ND8 A;  2GA4 B;  2E75 C;  1IKM A;  1BDO A;  5CBE E;  1AEX A;  3V96 A;  5IGD A;  1F9Q A;  3R2I A;  4XQQ A;  4FYD A;  3DEO A;  4XYO A;  2RSN A;  3N6R A;  1NUC A;  4IUN A;  2BE5 C;  3J81 L;  1K8O A;  1JOK A;  5KNC A;  1B4O A;  3SVM A;  4HSP A;  2A68 D;  1LLR D;  1SEB D;  5LHY 1;  1PTO H;  5I2Y A;  2D2C C;  5E1F A;  2L5T A;  1B1Z A;  1SYC A;  5IGB A;  4PMB A;  1Y8P B;  1PZI D;  2EE1 A;  1LT5 D;  3C1F A;  2PZT A;  1JOQ A;  3T51 B;  2F0F A;  4KHV A;  1HRJ A;  4PMW A;  1JCK B;  1SJH D;  1LAB A;  2EYP A;  1F9S A;  3GTK B;  1U4L A;  3MC0 B;  2PCF B;  3IL8 A;  3DWQ A;  1EY7 A;  3GTO B;  3I4M B;  2QDB A;  1PDQ A;  2M2L A;  3MFG A;  4FXD A;  1BQQ T;  1CHP D;  1E2Z A;  1KAB A;  5CC4 A;  2CQA A;  4RKL A;  3NP8 A;  4ZKB B;  2Y0S B;  1MSH A;  2SNS A;  1PLF A;  2XRQ D;  4L8J A;  2NTS A;  3ND9 A;  4HR7 B;  3RLF A;  3SHL A;  1DCZ A;  2XWJ B;  2R93 B;  3X3M A;  4HN7 A;  2AWN A;  1KLU D;  4M1U B;  5DNF A;  2DN8 A;  1MI2 A;  4KN7 C;  1DOK A;  2OT2 A;  1LT4 D;  3NTK A;  3QOL A;  4NKL A;  3HOY B;  1NSN S;  3J81 E;  2B2Y A;  4RA8 A;  2Q8I B;  1TY0 A;  4N9T A;  1JR0 D;  2AUK A;  1QJO A;  4IFD G;  2NVY B;  3HRZ C;  1Y1W B;  2MJ8 A;  3BDL A;  1SJE D;  1ET6 A;  1EZ6 A;  1TII D;  2KA7 A;  4MHE A;  2A73 B;  3H0G B;  4UDU C;  2NYZ D;  1PTO D;  4C2M B;  4F87 A;  5KRU A;  1HA5 A;  2PW5 A;  1G91 A;  3HG9 A;  3PUZ A;  2B2U A;  5FO7 B;  5FOB B;  3TBI B;  3V2T A;  3A8K E;  5C4X B;  2XN9 C;  2B2Y C;  3TME A;  4FNF A;  4I7Z C;  5COR A;  4ZAI A;  5FLX L;  2WB1 B;  3K5L A;  2BA1 A;  2NBF A;  5FK9 C;  3NTI A;  1R4Q B;  1Y8N B;  1EY4 A;  4C3H G;  1A3U A;  1OXV A;  3GO5 A;  2G9D A;  1TKW B;  3I8Z A;  4KKT A;  2B2U C;  5KIX A;  4BBS B;  2E2D C;  1ET9 A;  3Q0A A;  1A3V A;  3GD7 A;  3HZX A;  2EYF A;  5M5X B;  2JEB I;  1F9R A;  3TP7 A;  3DWP A;  1XYI A;  3MXP A;  1A2U A;  4A93 B;  3M7N A;  3D6W A;  2A68 C;  2O5J C;  2JP1 A;  3NQI A;  2KEC A;  5I6Y A;  4M8A A;  5D65 A;  4F88 A;  3CHB D;  3TDQ A;  2DNC A;  3SK8 A;  2NVQ B;  1EY5 A;  3GV6 A;  2B8F A;  4B9W A;  2F03 A;  2Z8L A;  5DM7 3;  4C56 C;  4HMJ A;  2HDM A;  1ZKO A;  2V4D A;  2RVL A;  1CHQ D;  5EQ0 A;  4KKS A;  3V05 A;  1EQV A;  2F0G A;  3KUP A;  1E0B A;  1GHK A;  3HKZ B;  2JYO A;  2F0E A;  1HFN A;  1HFG A;  5IGF A;  1UAP A;  1CK1 A;  1EWH A;  1HXY D;  2EOT A;  2VXW A;  3KBX A;  4X3U A;  5ELD A;  3DXJ C;  1AW7 A;  1PFM A;  1FNV A;  1I50 B;  1Q8I A;  2Z1C A;  2BA0 A;  1B9N A;  1HQR D;  4TRD A;  3RZO B;  3UI2 A;  4KJN A;  4ZYS A;  3ONA B;  5BN5 A;  4C3H B;  1DXM A;  3S9W A;  1OXS C;  2KED A;  2EYO A;  3TZU A;  1X3Q A;  2M00 A;  4G7Z C;  1R9T B;  2EJM A;  3QB3 A;  3HOU B;  2EJF C;  1STA A;  2F1M A;  1ILQ A;  1W6K A;  2E74 C;  2R7Z B;  1S5F D;  2JA5 B;  2I46 A;  2KQ3 A;  4CGY B;  5KGU A;  4DXF A;  1SYD A;  1AFP A;  1CA5 A;  1TWA B;  4IUR A;  1PTO F;  4QUF A;  5CV8 A;  2EY1 A;  2K5W A;  2FIN B;  4OO1 I;  1SBB B;  1H9R A;  1CQF A;  4RHR A;  4X3K A;  1LTR D;  4KMU C;  1WTR A;  3M4O B;  4H0L C;  4CHT B;  3FPU B;  1TS4 A;  1JQY D;  1QOH A;  3JAM E;  4Y7N B;  3OMC A;  3HGB A;  1KNA A;  5BN4 A;  1TQO A;  4C1N K;  3I3C A;  1STG A;  1B3A A;  1V43 A;  1KDC A;  2B2T A;  5IGC A;  1TWG B;  4G7O C;  5DAU A;  3WDN A;  1VMP A;  5C4H A;  1LTS D;  2H4O A;  5EBC A;  5ELB A;  1UUP A;  1TU2 B;  2FJ2 A;  1H9K A;  3QWN A;  1CM9 A;  3SXH A;  1SYE A;  1RDP D;  2ENB A;  5CV5 A;  2O5I C;  1ENF A;  3W3A A;  1JOO A;  1CQV A;  4C3I B;  1LT3 D;  1YNN D;  3GTL B;  3S14 B;  1HUM A;  2WAQ B;  1HA6 A;  2DY7 A;  2MP1 A;  5I2X A;  3D4D A;  2KEE A;  3A56 A;  1VDZ A;  2R61 A;  1C8C A;  3P20 A;  1D1I A;  4HED A;  2B2T C;  1CZG A;  5I6W A;  4KTA A;  1EFI D;  1FYC A;  1F77 A;  4CKC A;  1RTO A;  4F7X A;  1ENC A;  4A3D B;  4JK1 C;  4G7H C;  2NVX B;  1BUV T;  4K6D A;  4RWS C;  3PUV A;  2R3Z A;  2A5H A;  3BYT B;  3NK9 A;  3QOJ A;  1MSG A;  4J1M A;  4KD3 A;  1HTP A;  5M3M B;  2NN6 G;  2F0S A;  3MVV A;  1RD9 D;  1D5X C;  5CMD A;  2KHS A;  2H1E A;  4KD4 A;  1STH A;  1G2S A;  1OO9 B;  1HCZ A;  3A8I E;  5KEE A;  3K7A B;  2A69 D;  2AQ1 B;  1SND A;  2K28 A;  1H9S B;  2F0I A;  1EEI D;  5JJZ A;  4Z9C B;  4FO2 A;  4XQJ A;  3BVZ A;  3R8B A;  1ICW A;  2K1B A;  1BCP D;  5IGG A;  1EYA A;  3NBH A;  3ERO A;  3S16 B;  2D62 A;  1JE4 A;  4JBW A;  1BNZ A;  2I07 B;  5F2D A;  3OHX C;  4ZLT F;  3BS1 A;  2Q8T A;  4KKU A;  1GUO A;  3Q23 A;  5CV4 A;  3I73 A;  1H9S A;  2A6E D;  1E2V A;  5K36 H;  3MXN A;  3VA7 A;  4CJ0 B;  1TWH B;  2E2I B;  4DAV A;  4OIJ A;  5C0X H;  2KCC A;  5E4W C;  2L0C A;  2E2H B;  4ZQ3 A;  1PMR A;  2A74 C;  2N88 A;  1HUN A;  3PO2 B;  1JWM D;  2PYK A;  5IOD A;  5EKI A;  1CTM A;  2LKV A;  2A6H D;  2F0L A;  3HP3 A;  5KND A;  3PUY A;  3M3Y B;  4EVO A;  1A2T A;  2CW0 D;  1PXU A;  3PV0 A;  3DHQ A;  2VUM B;  1Z47 A;  5CGK A;  4IFD H;  3QIA A;  2PPB C;  1SNO A;  3T53 B;  3BG3 A;  3GTM B;  5C4Z A;  2NTT A;  1KLG D;  4XTC S;  1IW7 D;  4DGZ A;  2IW3 A;  3EA6 A;  5CBA E;  1PRT D;  5FO8 B;  3G7L A;  3H94 A;  5C4J B;  1YNN C;  2HCC A;  3VA5 A;  1XWE A;  3A8J E;  1AZP A;  1I4R A;  4PV1 C;  5JAV A;  4X3T A;  2OF1 A;  2F0U A;  5DEH A;  1KAA A;  1BF4 A;  5K36 G;  3FEW X;  1BCP B;  3FMC A;  1T5E A;  3P7J A;  4TQU S;  3J7Y W;  1CFM A;  4L6T B;  4CJ2 C;  5C0X G;  2R92 B;  1Q12 A;  1GHJ A;  3OIP A;  3K57 A;  4YIJ A;  2OEO A;  4WFN 3;  3SR1 A;  4EGV A;  4KJO A;  3C46 A;  4MN3 A;  1TS2 A;  4QMG A;  5EPK A;  2SOB A;  5ELC A;  4NDX A;  3P1H A;  3J7A F;  3WOF A;  1W6J A;  1MD2 D;  5IIF A;  1Z7T A;  1Y8O B;  4QIW B;  5JPN C;  5BN3 A;  3NSW A;  1O7Z A;  1S5C D;  2ZT9 C;  3MA2 B;  4IAL A;  5D3D A;  1VMC A;  3KBG A;  1M4V A;  2K5D A;  5I9P A;  1SDF A;  1WTV A;  3CRL C;  4XT3 B;  2K7V A;  2F3V A;  1YNJ D;  2A69 C;  4WJW A;  4RKB A;  1F2M A;  5JEA H;  4BA2 I;  2SNM A;  1EEF D;  5C0X J;  2EVB A;  1IKL A;  1BCP C;  2R6G A;  2K03 A;  4K6L A;  2BDN A;  4A3F B;  3MEH A;  1HPC A;  4P2C B;  2XRS D;  3G6J B;  2IWH A;  4FF3 A;  1O7Y A;  1ZYR D;  1U4P A;  5LL6 X;  2RDF A;  1GOZ A;  3MZ5 A;  1OXX K;  1PRT B;  1TY2 A;  2A6E C;  1I4X A;  2YYZ A;  3OPO A;  1U9R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...