5C3WA

Crystal structure of staphylococcal nuclease variant delta+phs v66h at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMHENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS V66H at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5c3wA00
4OL7A 1RKNA 3EROA 4ZQ3A 1IHZA 5IODA 1EZ6A 3NUCA 3TMEA 3QB3A 3HZXA 4KJNA 4NP5A 4WORA 1STYA 3TP8A 5M9OA 4IALA 1EYDA 1F2MA 4K8IA 4KTAA 2LKVA 5CV7A 1SYFA 3TP7A 5C3XA 1SYCA 2EY5A 2QDBA 3EVQA 3NXWA 1KABA 3RUZA 3NP8A 3OMCA 1SYDA 2RBMA 4K8JA 4DFAA 1A3TA 2F0QA 1II3A 3ITPA 3MHBA 3MEHA 5C5MA 2M00A 5KYIA 3MXPA 4LAAA 2PZUA 4G57A 3SK8A 4N9TA 1A2UA 2F0OA 2F0NA 2PQEA 2F0PA 4KY5A 4J1MA 4TRDA 4F7XA 5K5PA 4DF7A 5IGGA 3PMFA 3SR1A 5C5LA 5CV4A 1TQOA 4ZUIA 3T13A 5HGTA 1EY8A 1EY7A 1SNCA 2SNMA 5IOCA 1EYCA 4PMBA 3E5SA 4ID6A 5E3FA 1SNOA 5IGBA 1AEXA 4ZUJA 4R8NA 3EJIA 4ODGA 1STAA 2EYFA 3SXHA 2F0MA 2HQEA 5DAUA 5J22A 2EY2A 4QMGA 1U9RA 2KQ3A 5I6YA 4WRDA 2F0DA 1A2TA 2RDFA 2EYHA 3MVVA 2F0EA 3NQTA 4KY7A 4QF4A 5EKLA 5NUCA 4NKLA 3D4WA 2PW7A 3HEJA 4EQPA 2PYKA 5C4HA 5E1FA 1EY6A 1KDBA 4NMZA 5IGEA 4N9PA 2ENBA 3BDLA 5HURA 1JOQA 5C3WA 1A3VA 1JORA 2F3WA 4B9WA 2PZWA 1EY4A 5C4ZA 3T16A 1SNQA 4YIJA 5CV9A 4HMIA 4K5VA 1STGA 1EY9A 4IUNA 3OWFA 3P75A 5DEHA 2WACA 3SK5A 1EZ8A 1KDCA 4K6DA 2EYJA 2OXPA 4K14A 4RKBA 3U9OA 2O4XA 4DGZA 3DHQA 4KV6A 2PW5A 4NDXA 3TP6A 4DU9A 5I6WA 5IGFA 3D4DA 3BDCA 5CR3A 5ISRA 3V2TA 2OEOA 2F0IA 3H6MA 3SK4A 2F0TA 5EKKA 4EQOA 4KD3A 2EYMA 4RKLA 3SHLA 3LX0A 5CV8A 4S3SA 1KDAA 3NHHA 4F8MA 2F3VA 3TP5A 1SYGA 5JOBA 1F2YA 1JOOA 2PZTA 3OMGA 2EYOA 4EQNA 5EGTA 2OF1A 5I9OA 5KIXA 2F0VA 4PNYA 5IIFA 2F0SA 4PMCA 1SNPA 5JAVA 3P1HA 5CC4A 3SK6A 1EQVA 2EYLA 2F0GA 2EXZA 1STNA 2F0UA 4KJOA 5CV5A 4KY6A 1KAAA 3DMUA 4K2KA 1ENCA 4K5XA 4H7BA 3C1FA 1SNMA 2SOBA 4J6HA 1TR5A 3QOLA 4EVOA 5IGCA 4I65A 2F0WA 1JOKA 2EY6A 2F0KA 2RKSA 3QOJA 3D6CA 5J1ZA 5IGDA 5J39A 3NK9A 2F0HA 3VA5A 5KYLA 1ENAA 1EY5A 4K2LA 5I9PA 4HTHA 4ME5A 3S9WA 1EY0A 2F0JA 2SNSA 3ERQA 4HMJA 4KHVA 4MIUA 4QB4A 5KGUA 4IZ8A 5KRUA 4KD4A 1F2ZA 5KEEA 2F0FA 4E6IA 4K5WA 3OSOA 5CV6A 2EY1A 5CGKA 1NUCA 1EYAA 2EYPA 1TT2A 2F0LA 2NUCA 5F2DA 1SNDA 1STBA 1STHA 4B9XA 5C6AA 1NSNS 3C1EA 3MZ5A 1A3UA 2KHSA 1SYBA 3R3OA 3D8GA 1SYEA
chains in the Genus database with same CATH superfamily
2MQHA 5IYCG 1HZBA 2RVLA 4P74A 2WAQE 4NP5A 1PH5A 4OEMB 4F87A 5IT9L 2BCOA 2A19A 4HSVA 5JEAJ 5M5YH 2JQOA 1T5EA 3DLLA 3MXPA 3SK8A 4LMQD 2DY8A 4IJHA 2R7ZH 1IYUA 2A74C 4FF4A 2B2UC 4ID6A 3GV3A 1GJXA 4HCEA 4TVAB 1V43A 1LACA 2EY2A 1YHQA 4YHHQ 3AMUA 1IXRA 4KI0A 2ZM6L 5FLXL 3PIOA 1EUJA 2K01A 2L12A 1N34Q 2PQAA 3JAME 3OYYA 3STBD 5ELDA 3E9IA 4QIWB 4XQNA 1PDQA 1LTRD 3M7GA 5T1GA 3GTMB 4IFDJ 3PO2G 1U0LA 5JEAH 3TEHB 3SK5A 3BDOA 1S5CD 3HGBA 3U9OA 2O4XA 4DGZA 1DOLA 3S16H 3FKIG 1Q86C 3HOVG 1PA6A 2F0IA 1FNUA 1VMPA 2EXDA 1IW7D 1B1ZA 1AE2A 4FVMA 4LJZC 2JP1A 1L0WA 1JJ2A 3T4AC 5D65A 4R4IA 3IFDA 4X64Q 2F0VA 2Z6KC 1UE1A 3KDFB 2P5ZX 3ZJYC 1FL0A 5A2QL 1KXLA 4PMWA 3A5ZB 4MNOA 1JB3A 1YNND 1P16A 1X3GA 4C3HH 2L4NA 4B3RL 1WTHA 3ONAB 3CRLC 4IZ8A 2NVTB 1F2ZA 1YVCA 2L15A 1BXTA 1CA5A 3HOUG 1DONA 4A3GH 1K8GA 3L9AX 1VQCA 3CMAA 1NJIC 1LT5D 1TKWB 5E7NA 2H4OA 1NMFA 1STEA 3RUZA 3M4PA 1YIJA 4DR3Q 2GN5A 3R2TA 5C5MA 4X3TA 3RLOA 1NBWA 5JVG3 3KUPA 3M3YB 2N78A 1AN8A 1TQOA 2ZTEA 4ZUIA 1CKNB 1PZID 5IOCA 3CF5A 4GOPC 5D14A 4ZUJA 4ALPA 2K4KA 4MTNA 4BA1I 2FXQA 2JA8G 2K75A 3NELA 2BA1A 5KNBA 2JK8A 1U9RA 1PH6A 2RCNA 4RMFA 4RAUC 4GLXA 1Y1WH 1XMQQ 1QZGA 4NKLA 2H1EA 5L37A 2F4VQ 2VW9A 1LLRD 3ULPA 2IHFA 1K8MA 3DWAA 1Q8KA 5C3WA 4R4CA 5H1SE 5IE8A 2O5JC 4DR7L 4IUNA 3L0OA 2PCFB 3K0XA 1KDCA 2PO4A 4UAIA 1PTOC 4NPSA 2E75C 4OWTB 2OQ0A 3DWPA 2RCFA 2A6HD 2AQ1B 5EKKA 1PTOF 4BBRG 4JI2Q 4IPCA 4OIJA 3OMGA 4CDFC 2PZTA 2PI2A 3IFTA 4DR7Q 1E2VA 3BVMA 3GTMH 1RIPA 4PNYA 2OTLA 4R4TA 1A8VA 1QVCA 3NPPA 2Z0SA 3KF6A 1S5DD 1I4GA 4DK1A 1FYCA 1YHBA 4KJOA 3HOZH 4KY6A 1YHAA 1ENCA 3S16B 1SNMA 1Q7YC 1SDFA 4A3IH 5BR8Q 2UUAL 1LABA 2BOSA 5J39A 4DK6C 1VQDA 4RGTA 2B2VA 4JPBW 4NXMQ 3Q24A 5KGUA 1KRSA 4JI6L 1HR0W 3F8TA 3T53B 3NENA 2K33A 1TT2A 2R6GA 3KFUA 2K04A 3Q6SA 4OX9L 3I70A 2D0PA 4H44C 1HQRD 4N8FA 1KL9A 5BR8L 4B3TL 3TMEA 4L8JA 3BJUA 1KNAA 1UEAB 1PHJA 2GVBA 2N88A 3S24A 1D1KA 2IHEA 3PO3G 3RZDH 5CMDA 4DUZL 3OMCA 1TWGH 3V96A 1SYDA 4YY3L 3MFYA 4K8JA 2YV5A 1DYQA 2IWHA 5K36H 3MEHA 4YCUA 4A3GB 2G9HD 1QG7A 2BDNA 3K5OA 4B3SQ 2V4DA 4LFBQ 1TS5A 1SR3A 2QCPX 2SEBD 3C2PA 1QWYA 5I6YA 4RA8A 1Y14B 4CJ2C 3NQIA 2WB1G 4UP9A 1G8ZD 3KLSX 4KHPL 4X6AH 3ULLA 5BN4A 2Q2TA 1SBBB 1D7QA 3E9HA 1CUKA 4A3JH 4HJAA 3S17H 4ZYSA 1LO5D 1K8OA 4TKOB 3G6JB 3DM3A 4IOAA 1CHQD 1OTCA 4DR1L 3TP6A 3MAQA 3HS0C 1X3QA 2XVSA 1Y1WB 2IL8A 2UUBQ 4A76A 3C3LA 3LX0A 4DV1L 2RDGA 3RD4A 5KNCA 4DR4L 1CA6A 1HNXQ 1PRTB 3VR6A 1EFID 2E2DC 4QL5A 1U4RA 1D8LA 4JVZA 3P1HA 1A6XA 5TSSA 2KBNA 3HKZE 2L0CA 5CV5A 2NVYB 1KNEA 2CWPA 2Z6KA 1LTAD 1QUQB 1FGUA 2K1BA 2R3ZA 3DWQA 1X6OA 1X65A 4O2DA 1LT4D 4DPGA 3G71A 3AB9A 1QUQA 4BXXG 1AZQA 4GZYC 4MIUA 4KKSA 2JA6G 1E7ZA 2D5DA 3KLWA 4V190 3E0JA 1XNRL 2VB2X 3A8JE 2VUMB 1PRTF 3H0GG 3I91A 4DUZQ 1JE5A 1BBWA 3J80c 3C1EA 1WTWA 5D3IB 2K5QA 1IL2A 3HOZB 2LSSA 4BA2I 4IURA 1IHZA 3MXGA 4A3IB 2BH8A 4B3SL 1MKHA 4LFBL 4WORA 1VQJA 2DY7A 1LUZA 3EIVA 2OTJA 2NZ1D 3BYYB 1LV9A 2H5XA 4DFAA 1A3TA 1LTBD 4OO1I 2B2UA 3HP3A 2G9DA 3GQBA 5M3MG 3TS0A 4RFBA 3FEWX 1GVPA 1JMCA 1FGBD 1SNCA 3S1MB 1N32Q 4UHVA 1NNXA 1EYCA 2JA5H 1XPOA 1AEXA 3EJIA 1CSQA 1I5FA 4DV7Q 3Q22A 5CORA 1P8LA 3W5OA 3RZDB 1EU3A 4CDEC 2KJXA 2EYHA 2LXJA 4DR5L 1LTSD 1TWGB 1ESRA 3BS1A 4L6TB 5K36G 2EE1A 1ET6A 5HURA 4KMUC 1U4PA 4QGUA 4A3FG 2VQFL 1LM0A 1JORA 3H09A 2IX0A 3TSSA 3HKZG 4RCNA 2B3GA 3UE0A 3CCLA 1HZAA 2EYJA 1PYWD 1LT3D 1ESFA 3LWUA 5IGFA 5EBDA 3S2DB 1EU4A 4LF5Q 1N34L 2F52A 4AQYQ 1A63A 1MGSA 4A3DG 1Y1VH 5GROA 1K3RA 3CU7A 4S3SA 2NVQH 2UXBQ 3TP5A 3QIAA 1FR3A 2I5HA 5I9OA 5GAGC 1XNRQ 4A3JB 3BVZA 3S17B 3S1NB 4K0KL 3TBIB 1I4QA 4EVOA 3I4MG 1AP0A 3PIPA 5IGDA 3M85A 2HDLA 4TQUS 1IBKQ 1J5EL 1ASYA 4JV5Q 1C8CA 3N6RA 1MSGA 3KF6B 3OW7A 1WTXA 2UXDQ 5A2QE 4I7ZC 1EYAA 3ER0A 4ABNA 1Q8IA 3A8KE 3QB3A 1B2TA 2NVYH 1I4XA 1RKNA 3HOYB 1GHJA 4H0LC 2CFMA 4FDBA 4GS3A 4DA2A 4WFN3 2OWOA 3AFPA 3TZDA 1M1KC 3RLNA 2A6EC 2LKVA 2BE5D 4DAYA 4L5SA 2UXDL 4DR3L 1B50A 1DXMA 1E1OA 4ZKCB 2VUMH 1H9SA 3JAMc 5ELBA 5EBCA 4KY5A 1R9TH 4RHRA 3SR1A 3EBEA 2HDMA 3H91A 2NVXH 3T13A 4UDUC 1LTTD 2NN6G 1VQ4A 1V1QA 2I5LX 2OT2A 2XTIA 3GP7A 5FLMG 3M7NA 4QMGA 2K5HA 2E2IH 3M4OH 4B3ML 4CKCA 4QF4A 5EKLA 2PW7A 2BE5C 1EY6A 1PH7A 2FMCA 5DM63 4BY7G 1BF4A 5ELCA 2L11A 3OWEB 4IPDA 3S1MH 1I94Q 2JJQA 3I4OA 3OWFA 1C7YA 4GNXA 2JA5B 3CXCA 2E8GA 3PUVA 4A3IG 3BZDB 1L2FA 1EEFD 3I72A 1CZGA 2PW5A 3V2TA 4DV4L 4PG3A 3L3OC 1IYJB 4EQOA 4GOPA 4JI3L 4JBMA 3K5LA 1EWIA 1ASZA 3SDZA 4A3LG 4EQNA 4YWKA 1BCPB 2A73B 5BN3A 5FKAC 5KIXA 4IOCA 1IZ6A 1PH2A 1JWUD 4GKJL 5CC4A 5ELNA 3SK6A 2DNCA 2EYLA 1NCVA 3VDYA 2ATWA 3DXJC 1E24A 3OTOL 5C0XH 1F77A 3DMUA 1YBYA 3S2DH 1J8IA 4HCSA 4PZ8A 1W2BA 3F2DA 4FP5D 5CYUA 1PVOA 1Y1VB 1GM5A 1XWEA 3OOCA 3J7AF 2NVQB 4GLAC 3E6ZX 3KDFA 5CGKA 4KN7C 4GKJQ 4LF8Q 4X62Q 1D1IA 1STBA 2LS01 3S1NH 3OTOQ 2B2WC 1SYBA 2AQ2B 1KQSA 1VQAA 3STBC 3KJPA 3NUCA 5FO7B 1Q3LA 1SJHD 3A54A 2F1MA 2MO0A 3K0YA 3UDIA 1UE6A 2G5DA 2JA6H 2WIIB 1SMXA 3CP0A 4DV5Q 4A3CH 1I4PA 1XXGA 4JI6Q 5M5XB 4GLVB 4KKTA 1V9PA 1II3A 2AMCB 3BU2A 3ICEA 4LAAA 3T1YL 2F4VL 3CPFA 3S15B 3PO3H 3F1ZA 1MBYA 4HR7B 5I2YA 3PMFA 4JBWA 4GKKQ 3HOYH 2D0OA 1VQKA 1CFMA 1EY8A 1SSOA 4KLKA 4OWXB 1HXYD 4ODGA 3WDNA 4KK7A 1O7YA 1JE4A 1K83H 3D6WA 3J7A5 1A2TA 1G91A 4X65L 1MJEA 1R4PB 2Y0SG 5C4HA 4WJWA 4M8AA 2R92G 1D5XC 5IP9G 3R2IA 3CAMA 4JI2L 1WTVA 1R9TB 1TWCB 2NVXB 2XWJB 4YIJA 4EQ5A 5FLMH 1C4QA 1XJVA 2YTVA 5CBAE 1GOZA 4APVA 5IYCH 2Q2UA 1QNKA 4H02A 4DU9A 2NB0A 2E2IB 2B2YA 3M4OB 5M3FB 1C0AA 1LYLA 2F0TA 2EIFA 3HG9A 5LMUL 2MJ8A 3NHHA 3J81c 1F2YA 5IYBG 1HNXL 4LW1A 1SE2A 3HKZB 1B9NA 2F4IA 4IFDI 1U4MA 4XIGS 1TIID 3FKIH 1BCPC 3G6EA 2R92B 4H7BA 4RGOS 3A5UA 2HHHL 2NBFA 3MTSA 4DV1Q 5KYLA 4OXPA 2WKDA 1KIXA 3CCJA 1B3AA 2D62A 4KD4A 1WTQA 2F0FA 3DUZA 2OQKA 4CJ1B 1HR0L 3IL8A 3IRBA 1AFPA 1A3UA 2I07B 4G4KA 1G51A 2C5CA 3PF5A 4MZ9A 3GD7A 3OHXC 2EQSA 3ULJA 1HJPA 1Y8PB 1EYDA 4UY8C 2RHSB 1EYGA 1BVSA 5FJ8H 2F03A 1VQOA 1MIUA 2NN6I 3VR2A 1JCKB 4UPAA 1SMYD 1QB5D 1WD0A 3K5MA 4KHPQ 3U58A 4DAPA 5K5PA 4J1MA 2Z8LA 4A3KH 5IGGA 4Y52H 1SLJA 5D3DA 4JBJA 4C56C 1MHWC 2JA6B 4IN3A 5C44B 1VF5C 3CCMA 4OGQC 5GQOA 3OPOA 2BA0A 4PQXA 3GTGH 3I4LA 5M5XH 3NQTA 2B8GA 1YJWA 2UUBL 4EX5A 1S5ED 4C1NK 3S15H 1HNWQ 1WTRA 3PO3B 1NR2A 5FJ8G 1Z6HA 1EY4A 4U68A 4A3BG 2B2TA 1YNJD 4FO2A 3EQLC 1EZ8A 1F9RA 2WFWA 1A0IA 1TY2A 3DHQA 5I6WA 1K83B 4NXNQ 2KCCA 4R9WA 2I46A 5EAYA 3UE1A 1VCIA 1Y1WG 3H6MA 3RNUA 3SEBA 1L1OC 3K59A 1D5ZC 2QF7A 5GADC 2Q8IB 2EYOA 1HFGA 1TWCH 4JW0A 1XX8A 2B2WA 3QWNA 2JA7G 3PCOB 2NYZD 2F0GA 3A7LA 3J80E 1DJRD 1STNA 2N3SA 5JPMC 4K2KA 3MFGA 3UDFA 4I65A 1TVXA 2JA9A 4A4IA 5M3FH 1JOKA 4AQYL 3RN2A 1BUVT 2RKSA 4HAEA 4B3RQ 3URYA 2UXCL 5AFWA 3VYSA 2ZXOA 2FJ2A 1X55A 4RG1A 1B8AA 2F0LA 4C3JG 2Z6BA 1UUPA 1UWVA 2E76C 3FKIB 1SJED 3I56A 2R92H 1OXSC 1EWHA 2ZJQA 3BZCA 1VQMA 4HIOA 2DUDA 1K28A 3TP8A 4HJ7A 3F2BA 1I50H 1TWFH 2B2YC 3T56B 2BDOA 3EVQA 1KABA 4DR5Q 1MSHA 2Q8TA 4JYAL 2K32A 2WB1E 3ITPA 3GTJH 2IT1A 4BY1G 2K5VA 3PUYA 2ZJRA 2XN9C 2QDLA 2F0PA 4C2MB 3CD6A 4LF4L 2VUMG 2CWAA 5C44G 2DJGC 2HQLA 4CBVA 1YNNC 2XSCA 4IUPA 2TSSA 2EYFA 2JE6I 2JSOA 4K6LA 4DV0Q 5IP7G 1Y1VG 3QR8A 5HY6A 1PH4A 1EEID 3NTKA 1QVGA 4LUVA 3KOJA 3C46A 5FO9B 4G7ZC 5IGEA 4LF7Q 2CW0C 3L2PA 2F3WA 2KCNA 4A3KB 1E0BA 1EL0A 2VB3X 5CV9A 4A3JG 1GUTA 4C1NI 5LL6S 3I90A 3UDGA 1S72A 1V1PB 5C44H 2YU9H 2LY7A 3A7AB 1KHIA 2LXKA 3GTGB 4AYBB 4Q5VA 1B7YB 2OEOA 1ZKOA 2PMZE 4PZ6A 2WV6D 3W2DA 1VQPA 3O13A 1PH3A 4LF7L 4KD3A 1KDAA 4JG2A 4JI4L 3I7FA 3ND9A 4P71A 2E2JH 4M1UB 3SE0A 4X66L 3HFZB 2F0SA 3PV0A 4C3IG 1NMGA 2GVAA 5FLXc 1WTPA 2PQAB 2QGQA 1WD1A 2B63G 3K6OA 3QOLA 4DV4Q 2EY6A 2QILA 4I7AA 2D2CC 2QW7A 5J1ZA 5DM73 3CW2C 1EY5A 4NXML 4OO1H 5I9PA 3NWTA 2WAQG 3U50C 4JI7Q 4LF8L 1RTNA 1QJOA 1HUNA 2A68D 1PYBA 4JYAQ 5T1IA 3W3AA 1B3QA 4B9XA 4L5QA 4DAYB 3QG1A 4OX9Q 1D2BA 4OL7A 4P75A 4DKAC 1K8AC 1EQRA 1VQ7A 1ET9A 2K52A 3J81E 3TDQA 1QVFA 2A6HC 4C3IB 5FO8B 4DXGA 3B6YA 4IUVA 3ND8A 2X69A 1K0SA 2KENA 4X62L 4GNXC 1TS4A 4YWLA 4OO1G 2N49A 3KBXA 1CKMA 4G57A 4N9TA 4DAMA 2RHQB 3GTKB 1A62A 1OXUA 3KJOA 5C4JB 4CDCC 1L1OA 1HUMA 4ZLTF 4DV5L 4A3DB 1WOCA 5DAUA 3NE5B 1FJGQ 3A56A 1GO3E 1GUNA 1I50B 1TU2B 1TWFB 2LFNA 3RLFA 1RF2D 4AH6A 1PZKD 1CI3M 2TMPA 2B8FA 4ZCKA 1CKNA 3D4WA 3S2HB 4BY7B 2CHBD 2PYKA 5E1FA 4N9PA 1N8RC 2KCMA 3GTJB 3BDLA 2Y0SB 1G6PA 2JN4A 4DNTB 4XT1B 4C2MH 4DUYL 2AWNA 1FD7D 2XGTA 4RHSA 3T16A 3PO2H 1W6JA 2Z9HA 1JJCB 3I4NB 2R61A 3P75A 4X66Q 5LHY1 1XMOL 2QA4A 3AEVA 2OXPA 3TREA 3MXUA 4NDXA 4OONA 1GXDC 1PFSA 3HRZC 2ICEC 4DV3Q 4FF2A 4DR1Q 2DGYA 5ISRA 2MUYA 2HT1A 1HNZL 3LGJA 5JJIA 3N52A 1VQIA 2ES2A 3J81j 1JQYD 2CW0D 1VQ5A 1VS0A 1UE5A 3TRZA 2IY5B 3K7UC 3KF8B 1EIFA 1V8QA 4XXEA 1KLUD 4JI7L 3I4NG 4DR6L 5M3MB 4JI8L 1XMOQ 2QEXA 3I2ZA 1U5KA 4IFDG 4GNXB 2F0UA 1VMCA 2NWGA 2YU9B 3FMCA 5HGQA 1RODA 5EPJA 2SOBA 1H9RA 1BNZA 5IGCA 1Y8NB 1JT8A 3AFQA 3QOJA 3TN2A 2Q2IA 1E1TA 1TY0A 3ERQA 4CJ0B 4P2CB 1E2ZA 3RN5A 4JI0Q 2E2JB 1PTOB 4JI5Q 1DD2A 1Q1BA 1HQMC 1HA5A 3KYHC 1SE8A 1SNDA 4HEDA 3D8GA 4DV6L 1PZJD 3EROA 1N36L 4Q0FA 1W3SA 3FRPB 2R7FA 2IJ0A 3HZXA 1IBLL 1H95A 5M9OA 1ZEQX 3QJYA 3NXWA 1H9MA 1WTOA 2NTSA 2X6LA 2RBMA 3AU7A 1JICA 3MHBA 2MGSA 3HOZG 4PZ7A 3VYRA 2IW3A 3FDTA 1N33L 2Q8RE 4HIKA 1X32A 1CT1D 2CQOA 1O78A 3J81L 3HOUB 5EPLA 4JC0A 2AHOB 1X3PA 4IUUA 3E5SA 4KKUA 3DEOA 1Q46A 5GAEC 4C3IH 2HQEA 5J22A 1CM9A 5IYBH 4GN4B 3HEJA 3K7AB 1EOTA 2EZVA 1Q81C 2VQFQ 3GTKH 1D6EC 4V0BA 1KD1C 5C4JH 1Q90A 2EPBA 4K5VA 1MI2A 1EY9A 4JI8Q 4K6DA 1TS2A 1O7LA 3CQZB 4A3DH 3UI2A 1HTPA 1HZ9A 1O80A 1SMYC 1BBUA 1IBMQ 5JPNC 4OWWB 3MXNA 4NB3A 4BY7H 3CCRA 3S2HH 3LNNA 2UXBL 2R7DA 4DR4Q 4A3LH 5EKIA 2OF1A 3PO2B 4YCWA 3I4NH 1K9MC 4EGVA 5IWAQ 4K0KQ 3AQQA 5EQ0A 2EXZA 4LF9L 3H3VH 2Z1CA 1OO9B 4K5XA 4ZRZA 3EN2A 4A3EB 3GTPB 4IJLA 4YCVA 1CSPA 3PUZA 4LFAQ 2RSNA 3J81i 3CC7A 1J5EQ 5C3EH 1IBLQ 1HTLD 4ME5A 3OW2A 1NR4A 3ERSX 2O2LD 2DJFC 4JBKA 4E6IA 3H3VC 3OSOA 4QUCA 2EY1A 3H3VI 5M3MH 2Z4HA 4LFCQ 1STHA 4L5TA 3P7JA 5E3FA 1Z9FA 4IPGA 4OHJA 3TZUA 2ZJPA 1I6VC 1PXUA 1EZ6A 2RA4A 3VR4A 2KOLA 4PV1C 4HJ9A 1F2MA 3PQIA 4Y7NB 1L0XB 3HOWH 1SYCA 4OELB 2EY5A 2QDBA 1PTOH 4RGNA 1VQLA 4IPHA 1E22A 3RMHA 4LK1C 1H9JA 2F0OA 5E4WC 3TQYA 4LF4Q 1WYDA 1ZYRD 1K0RA 1QZHA 1EY7A 3M9BA 2B29A 1DZ1A 4YHHL 1HCZA 3MC0B 4HSPA 1B53A 4ZAIA 2DNEA 1EFWA 2F0DA 2YTYA 3U4VA 4IUQA 3FPPA 1GHKA 1BCPD 4KY7A 2RDHA 5AJ3Q 1HPCA 2ENBA 1PH8A 3BYTB 3J7ZC 3CCSA 3BZKA 2ZTCA 3HOUH 3CRKC 4HJ5A 1STGA 2HIXA 2MP1A 2WACA 5E4XA 3F2UA 5I2XA 1RHPA 4G7OC 4FXDA 4KV6A 4HJ8A 4LF9Q 3I73A 3FVQA 5AJ3L 3CPWA 2R93G 2C9OA 3K7AH 4MTKA 5IP9H 1S4ZA 3H0GB 4RKLA 1QE6A 3S1RH 1RCVD 4A3MG 2RSOA 3CKIB 4JI3Q 1J6QA 5EPKA 4J15A 3CCEA 4NW2A 3JAML 4B08A 4X64L 1SNPA 4CHTB 1VQFA 1PFMA 3QO2A 3CQZH 3PIO3 2V1CC 3SVMA 1CZWA 1CK1A 1TXYA 2UUAQ 1PRTC 1UEBA 1VQEA 2L1BA 1PRTD 2F0HA 3NK9A 2ASBA 2JA8B 4JI4Q 2VNUD 2KA7A 1EQQA 1L0YB 4FXGC 3PIP3 5CV6A 5G3LD 1UNSA 1ICFB 1WJJA 4Z9CB 4BY1B 4G7HC 3HOVH 3RZOB 5IT9c 2VS1A 1B4OA 4A3EH 5JJLA 3GTPH 1V1OA 1PV4A 2K5NA 3M4QA 1XNQL 4JK1C 1W6KA 2XIWA 1BR9A 1STYA 4O42A 5C3EB 3U4ZA 4BBSB 1SYFA 3M4YA 3HOXG 3TS2A 1QOHA 1KRTA 4POFA 2A1AA 1AE3A 2R93B 4RWSC 5IY0A 5CBEE 3LWEA 3L7ZC 4BWGB 5CV4A 4F88A 1VQ8A 3A74A 3DM1A 4GKKL 3PGZA 4YWMA 1BQQT 2WAQB 1FJGL 1FNWA 3D3RA 3HOWB 1G291 1BKBA 2KQ3A 4Y7NH 3D0FA 3VYUA 3NWSA 1WI5A 1Y8OB 3OIQA 1IL8A 4EQPA 3I55A 1KDBA 4NMZA 1PTOD 3CCQA 2E5LL 1Q82C 3CCVA 2L5TA 2RF4A 1DOMA 2PZWA 5C3EG 4RCOA 3E3XA 4A3BH 4H13C 2AQ3B 4JI1Q 1SE3A 3GV6A 5DEHA 5ELEA 1I4RA 1SE4A 4K14A 4XQQA 2CH4A 4U673 1RTOA 5DLQE 1ML0D 2ALYB 4A75A 3S1QH 2JEAI 1A15A 5LMUQ 2JXMB 2UUCQ 2A8VA 1ZXTA 1CQVA 2Y0SE 2FMMA 2NN6H 1C9OA 2Q2HA 2D9UA 5JVH3 4A3KG 1SROA 2KVMA 1YEZA 1LTGD 1PH1A 4LF6Q 1HNZQ 1EOVA 4DXFA 4DR2Q 4HN7A 3H0GH 4TSSA 4AYBG 3T1HQ 3S1RB 5COYA 3A0JA 1SAPA 2F0JA 4ILWA 1KLGD 1O7ZA 1IKLA 2C35B 2ZT9C 4A3MB 1RDPD 1MD2D 2XRQD 4MN3A 1NUCA 5C6AA 2JA7H 1H9KA 4DV6Q 1TWHH 4A3EG 3D4RA 4AYBE 2HD3A 4R4QA 2JYOA 3MXNB 4B3TQ 2PMZB 2SDFA 2JA8H 4IALA 4K8IA 5JJZA 4JOIC 4XYQA 4KN4C 4A3FB 1PFBA 1UAPA 3PUXA 4WJ3M 1QILA 2VQEL 3MEFA 1VQHA 4HIDA 1XPRA 5C0XG 1BDOA 5KYIA 1F9SA 4BY1H 2E5LQ 2K6AA 2F0NA 4TRDA 2NZHA 3HOVB 3RZOH 1I3QB 3S14H 5HGTA 2EJFC 1ILPA 4GOPB 1N32L 4LNQA 4R8NA 5ELFA 1STAA 5C0XI 2A69C 1S5FD 3KBGA 4GN3B 4DV7L 1RJTA 4DV2L 4BBSH 1JR0D 4X65Q 2I5MX 1U4LA 4OIKA 1JWMD 4HIMA 1CQFA 4AIMA 2B2TC 2CH4W 2R93H 3KLSA 3Q23A 1HNWL 2WP8J 4HMIA 1SXTA 2DN8A 3EA6A 1SFOH 1OXXK 2EJMA 1AZPA 1X54A 1DOKA 3GTQB 1LTLA 2EVBA 1T5XD 2XNAC 1YJ9A 4LF6L 2K5DA 2ZXPA 2YTXA 3SK4A 3JAMi 3ZYYX 2KUMA 2EYMA 3BVGA 3SHLA 1HA6A 1TWAH 3T1HL 3HOXB 1LTID 1HZCA 1SYGA 2F3VA 1IKMA 2FFKB 1JOOA 1SEBD 4JI5L 1YI2A 4A3BB 3VYTA 4PMCA 5M5WH 1S3OA 4UP8A 1HRJA 1JWSD 3GTOH 1IBML 1GD7A 4J6HA 4ME3A 1VQ6A 5C4XG 4QCLA 2F0KA 5LMNW 3S1QB 3D6CA 3Q8DA 4QQBX 3KLRA 2JEBI 1Z7TA 4QB4A 1I4HA 1OXTA 4JV5L 2EOTA 5KRUA 3R8BA 1PH9A 2R7ZG 2EYPA 2NUCA 2VQEQ 1WCMH 3MZ5A 3F2CA 1EIHA 2KHSA 2Z4IA 1VQBA 1SYEA 2RQXA 2MO1A 5NUCA 3MWYW 4ZQ3A 2B2VC 2MFIA 4DK3C 3PSIA 3CCUA 3Q0AA 2B63B 1O7IA 1VQGA 3HKSA 1AH9A 3PF4A 2FHTA 4XQJA 4A3CG 1X9NA 2HUGA 5I4DA 1GUWA 4ULLA 4DV2Q 2LMCB 4KHZA 4A3MH 3G48A 1X56A 1B44D 5C4XB 4LFCL 1TS3A 1NE3A 2F0QA 2EJGC 2M00A 2JA7B 4FXKC 3E0EA 2J0TD 2IPKD 3OIPA 2PQEA 3UDXA 4F7XA 4QIWE 4UP7A 1TWHB 3NEMA 2XWBB 1YNJC 2O5IC 5IGBA 1Y69U 2IX1A 3MA2B 3SXHA 2F0MA 2N55A 1V1PA 1G2TA 1MJCA 4DV0L 4WRDA 4A3FH 3MVVA 1E3PA 1KAWA 2J7ZA 4B3MQ 2ZM6Q 5LMNQ 3DEPA 3X3NA 4CGYB 4X3KA 3G4SA 1JOQA 3IAYA 1A3VA 1X3FA 2WB1B 1I3QH 2KEDA 2E2HB 1VF7A 2KEEA 3S14B 1SNQA 3SGIA 4QJFA 4ZK9B 3W1BA 3VR3A 1I94L 2CVRA 1YJNA 5IWAL 3EFXD 1VQNA 3RR5A 4JOIA 4NXNL 4DN4M 4L63B 5JJKA 3VA7A 5IYDH 5CR3A 5LMNL 2WINB 1G2SA 5A35A 1Q12A 4LF5L 3KK7A 4FF3A 4LFAL 1NTGA 2CKZB 3FP9A 2UU9L 2JA5G 5EGTA 4FF1A 2PNRC 1N9WA 5IIFA 2NTTA 1OXVA 1SFOB 4O0AA 3V05A 4L5RC 1NY4A 3GTQH 1AW7A 1BBXC 1ENFA 1SRUA 2VZAA 3C1FA 2J4XA 1F2LA 4LWCA 3VA5A 4BXXH 1ENAA 1TWAB 4K2LA 2UXCQ 3FPUB 3HOXH 2QEJC 3FHWA 2L9HA 4KHVA 4IO9A 1IBKL 3NBIA 3K58A 1EQTA 5KEEA 3WOFA 2N8NA 4K5WA 4DNRB 5M5WB 1WVLA 5F2DA 5C0XJ 1CKOA 2A6ED 1WCMG 3GTOB 3I3CA 4MHEA 1GUGA 5IODA 4ZKBB 1EWCA 3NTIA 3R93A 1XTDA 4GN5A 4WJ4A 4KTAA 3HOWG 2HCIA 5C3XA 2HIVA 4P72A 3NP8A 2IX3A 1ONLA 2ZTDA 1F9QA 3HOYG 1XMQL 3WOEA 1I6HB 2A69D 3CHBD 3WWVA 3NTHA 1WCMB 3J7AV 1A2UA 3CC2A 2VXWA 1H9SB 2EDGA 1NAPA 1ILQA 5C5LA 1EIYB 4QUFA 2SNMA 4XT3B 1LT6D 1PMRA 2M2LA 2MPMA 3NBHA 2B63H 5FK9C 4IFDH 1SNOA 1B70B 2K7VA 1X3EA 4A93H 4BBRH 3H15A 2K50A 1Z47A 2RDFA 2AUJD 3I4MB 4X3UA 4C3JH 4YY3Q 2F0EA 1FVIA 5C4XH 1IYVA 2YYZA 1QNUA 1Q1EA 4DUYQ 2E74C 4X3SA 2L55A 1J9OA 3VR5A 2ICIA 4DNIA 2UU9Q 3K80C 4JI1L 3K81C 1GUOA 3NSWA 1DGSA 4CKBA 5FLXE 1JC7A 4DV3L 1RD9D 2AWOA 4LUOA 3IKJA 2PPBC 2PNHA 3J7YW 2ZXRA 3D4DA 5J3BA 5M3FG 1KC8C 2UUCL 3BG3A 3W1GA 4IQZA 1C48A 5EJWA 5CV8A 2B39A 4F8MA 5JOBA 3K57A 1B9MA 2E2HH 2CQAA 1HFNA 1CHPD 5JAVA 5IP7H 3GTLH 4DR6Q 1BOSA 1EQVA 4CKEA 2KHIA 3A8IE 5IYDG 1GKHA 1FNVA 1KAAA 5IT9E 1TR5A 2VY3A 5ELOA 2F0WA 2KECA 2QKIC 3T51B 2HHHQ 2MHVA 4BBSG 1XNQQ 3PUWA 1ZYRC 1JB7A 2SNSA 2I0QA 1PFNA 3J80L 5M5YB 1XTCD 4R8IA 1CTMA 2K03A 4FNFA 1GUSA 3CMEA 3GO5A 1R4QB 4BS9A 3I8ZA 3NBHB 4A93G 2R7ZB 1N36Q 5BN5A 4DR2L 3G7LA 1BCPF 2WKCA 4KJNA 1M8AA 5LL6X 4DAVA 1YNXA 2CCZA 2X6GA 2OCEA 2KCTA 1KTKA 4IUTA 5CV7A 3TP7A 4CDDC 1RL2A 1WFQA 3J80i 2BH2A 1F9PA 1N33Q 1D5MC 4RGMA 1QCBD 2PI2E 4POGA 2PZUA 5C4ZA 4J8QA 3K5NA 3GDEA 3T1YQ 4C3HG 4DF7A 4XDXA 1PLFA 4PMBA 5JEAG 1HH2P 4LUZA 1EIGA 4P73A 4R1JA 1M4VA 1I6HH 1PYSB 2XRSD 1IW7C 5FOBB 1JJGA 3X3MA 2M9VA 4B9WA 1YZ6A 2K5WA 3H94A 4R4OA 2K14A 1DCZA 1SN8A 1DM0B 1UE7A 3CC4A 1XPUA 4RKBA 4A93B 4BBRB 3P20A 2MNAA 1XYIA 3D31A 3BDCA 1VDZA 4C3HB 3I4MH 3U9SA 4C3JB 2K05A 2KHJA 4XTCS 5G3LF 1HHVA 4FYDA 2GA4B 2HCCA 1BO0A 2NVTH 2AKWB 4XYOA 1M90C 4O1NA 1T9HA 2FINB 2VL6A 1S40A 4A3GG 4QY7A 2ID0A 4RH6A 3K8AA 3KF8A 1L1OB 1G6ZA 5KNDA 4HTHA 3S9WA 1EY0A 4HMJA 4JI0L 3AYHB 1YITA 1S5BD 2A5HA 2NZOA 2F3IA 3A55A 3JC66 1VQ9A 2K28A 1HR0Q 5DNFA 4JCVE 4DK0A 2A68C 1E2WA 2AUKA 5GAHC 1ICWA 3GTLB 1NSNS 1K73C 1K3BC 3R3OA 3M3YH 4N8X1
chains in the Genus database with same CATH topology
2RVLA 4NP5A 4F87A 5IT9L 2BCOA 4HSVA 5JEAJ 1T5EA 3MXPA 3SK8A 4LMQD 2DY8A 1IYUA 2A74C 4FF4A 2B2UC 4ID6A 3GV3A 1GJXA 4HCEA 1V43A 1LACA 2EY2A 3AMUA 4KI0A 5FLXL 2K01A 2L12A 3JAME 5ELDA 4QIWB 4XQNA 1PDQA 1LTRD 3M7GA 5T1GA 3GTMB 4IFDJ 5JEAH 3SK5A 3BDOA 1S5CD 3HGBA 3U9OA 2O4XA 4DGZA 1DOLA 2F0IA 1FNUA 1VMPA 1IW7D 1B1ZA 4FVMA 4LJZC 2JP1A 3T4AC 5D65A 3IFDA 2F0VA 5A2QL 4PMWA 1JB3A 1YNND 2L4NA 3ONAB 3CRLC 4IZ8A 2NVTB 1F2ZA 1CA5A 1BXTA 1DONA 3L9AX 1LT5D 1TKWB 2H4OA 3RUZA 1STEA 3R2TA 5C5MA 4X3TA 5JVG3 3KUPA 3M3YB 1AN8A 1TQOA 4ZUIA 1PZID 5IOCA 5D14A 4ZUJA 4BA1I 2BA1A 5KNBA 1U9RA 4RAUC 4NKLA 2H1EA 1LLRD 1K8MA 3DWAA 5C3WA 2O5JC 4IUNA 2PCFB 1KDCA 2PO4A 4UAIA 1PTOC 2E75C 3DWPA 2A6HD 2AQ1B 5EKKA 1PTOF 4OIJA 3OMGA 2PZTA 3IFTA 1E2VA 3BVMA 4PNYA 3NPPA 1S5DD 1I4GA 4DK1A 1FYCA 4KJOA 4KY6A 1ENCA 3S16B 1SNMA 1SDFA 1LABA 2BOSA 5J39A 4RGTA 2B2VA 3Q24A 5KGUA 3T53B 2K33A 1TT2A 2R6GA 2K04A 3Q6SA 3I70A 4H44C 1HQRD 3TMEA 4L8JA 1KNAA 1UEAB 2N88A 1D1KA 5CMDA 3OMCA 3V96A 1SYDA 3MFYA 4K8JA 2IWHA 1DYQA 5K36H 3MEHA 4A3GB 2G9HD 1QG7A 2BDNA 3K5OA 2V4DA 1TS5A 2QCPX 2SEBD 3C2PA 1QWYA 5I6YA 4RA8A 4CJ2C 3NQIA 1G8ZD 3KLSX 5BN4A 1SBBB 4ZYSA 1LO5D 1K8OA 4TKOB 3G6JB 1CHQD 3TP6A 3MAQA 3HS0C 1X3QA 2XVSA 1Y1WB 2IL8A 3C3LA 3LX0A 2RDGA 3RD4A 5KNCA 1CA6A 1PRTB 3VR6A 1EFID 2E2DC 1U4RA 1A6XA 3P1HA 5TSSA 2L0CA 5CV5A 2NVYB 1KNEA 1LTAD 2K1BA 2R3ZA 3DWQA 1LT4D 3AB9A 1AZQA 4GZYC 4MIUA 4KKSA 2D5DA 4V190 3E0JA 2VB2X 3A8JE 2VUMB 1PRTF 3I91A 3C1EA 1WTWA 5D3IB 2K5QA 3HOZB 4BA2I 4IURA 1IHZA 3MXGA 4A3IB 4WORA 2DY7A 2NZ1D 3BYYB 1LV9A 4DFAA 1A3TA 1LTBD 4OO1I 2B2UA 3HP3A 2G9DA 3GQBA 4RFBA 3FEWX 1FGBD 1SNCA 3S1MB 1EYCA 1AEXA 3EJIA 3Q22A 5CORA 3RZDB 1EU3A 2KJXA 2EYHA 1LTSD 1TWGB 1ESRA 3BS1A 4L6TB 5K36G 2EE1A 1ET6A 5HURA 4KMUC 1U4PA 1JORA 3H09A 2IX0A 3TSSA 4RCNA 2EYJA 1PYWD 1LT3D 1ESFA 3LWUA 5IGFA 5EBDA 3S2DB 1EU4A 1MGSA 3CU7A 4S3SA 3TP5A 3QIAA 1FR3A 5I9OA 4A3JB 3BVZA 3S17B 3S1NB 3TBIB 1I4QA 4EVOA 1AP0A 5IGDA 3M85A 2HDLA 4TQUS 1C8CA 1MSGA 3N6RA 3OW7A 1WTXA 5A2QE 4I7ZC 1EYAA 4ABNA 1Q8IA 3A8KE 3QB3A 1B2TA 1I4XA 1RKNA 3HOYB 1GHJA 4H0LC 4DA2A 4WFN3 3TZDA 2A6EC 2LKVA 2BE5D 4DAYA 1B50A 1DXMA 4ZKCB 1H9SA 5ELBA 5EBCA 4KY5A 4RHRA 3SR1A 2HDMA 3H91A 3T13A 4UDUC 1LTTD 2NN6G 2OT2A 3GP7A 3M7NA 4QMGA 4CKCA 4QF4A 5EKLA 2PW7A 2BE5C 1EY6A 2FMCA 5DM63 1BF4A 5ELCA 2L11A 3OWEB 3OWFA 2JA5B 3PUVA 3BZDB 1EEFD 3I72A 1CZGA 2PW5A 3V2TA 3L3OC 4EQOA 3K5LA 3SDZA 4EQNA 1BCPB 2A73B 5BN3A 5FKAC 5KIXA 1JWUD 5CC4A 3SK6A 2DNCA 2EYLA 1NCVA 3DXJC 5C0XH 1F77A 3DMUA 1J8IA 4HCSA 4FP5D 5CYUA 1Y1VB 1XWEA 3OOCA 3J7AF 2NVQB 3E6ZX 5CGKA 4KN7C 1D1IA 1STBA 2LS01 2B2WC 1SYBA 2AQ2B 3NUCA 5FO7B 1Q3LA 1SJHD 3A54A 2F1MA 3K0YA 2WIIB 1I4PA 1XXGA 5M5XB 4KKTA 1II3A 4LAAA 3S15B 1MBYA 4HR7B 5I2YA 3PMFA 4JBWA 1CFMA 1EY8A 1SSOA 1HXYD 4ODGA 3WDNA 4KK7A 1O7YA 1JE4A 3D6WA 1A2TA 1G91A 1R4PB 5C4HA 4WJWA 4M8AA 1D5XC 3R2IA 1WTVA 1R9TB 1TWCB 2NVXB 2XWJB 4YIJA 1C4QA 5CBAE 1GOZA 1QNKA 4DU9A 2NB0A 2E2IB 2B2YA 3M4OB 5M3FB 2F0TA 3HG9A 2MJ8A 3NHHA 1F2YA 1SE2A 3HKZB 1B9NA 2F4IA 4IFDI 1U4MA 4XIGS 1TIID 1BCPC 2R92B 4H7BA 4RGOS 2NBFA 3MTSA 5KYLA 2WKDA 1B3AA 2D62A 4KD4A 1WTQA 2F0FA 3DUZA 4CJ1B 3IL8A 1AFPA 1A3UA 2I07B 4G4KA 2C5CA 3GD7A 3OHXC 1Y8PB 1EYDA 2F03A 2NN6I 3VR2A 1JCKB 1SMYD 1QB5D 1WD0A 3K5MA 4DAPA 5K5PA 4J1MA 2Z8LA 5IGGA 5D3DA 4C56C 2JA6B 4IN3A 5C44B 1VF5C 4OGQC 3OPOA 2BA0A 4PQXA 3I4LA 3NQTA 2B8GA 1S5ED 4C1NK 1WTRA 3PO3B 1NR2A 1Z6HA 1EY4A 4U68A 2B2TA 1YNJD 4FO2A 3EQLC 1EZ8A 1F9RA 1TY2A 3DHQA 5I6WA 1K83B 2KCCA 4R9WA 2I46A 1VCIA 3H6MA 3SEBA 3K59A 1D5ZC 2QF7A 2Q8IB 2EYOA 1HFGA 1XX8A 2B2WA 3QWNA 2NYZD 2F0GA 3J80E 3A7LA 1DJRD 1STNA 5JPMC 4K2KA 3MFGA 1TVXA 4I65A 1JOKA 1BUVT 2RKSA 4HAEA 3URYA 5AFWA 3VYSA 2ZXOA 2FJ2A 2F0LA 4C3JG 1UUPA 2E76C 3FKIB 1SJED 1OXSC 1EWHA 3TP8A 2B2YC 3T56B 2BDOA 3EVQA 1KABA 1MSHA 2Q8TA 2K32A 3ITPA 2IT1A 3PUYA 2XN9C 2F0PA 4C2MB 4CBVA 1YNNC 2XSCA 4IUPA 2TSSA 2EYFA 2JE6I 2JSOA 4K6LA 1EEID 3NTKA 3C46A 4G7ZC 5FO9B 5IGEA 2CW0C 2F3WA 4A3KB 2KCNA 1E0BA 1EL0A 2VB3X 5CV9A 1GUTA 4C1NI 5LL6S 3I90A 1V1PB 2LY7A 3A7AB 3GTGB 4AYBB 4Q5VA 2OEOA 1ZKOA 2WV6D 3W2DA 3O13A 4KD3A 1KDAA 3ND9A 4M1UB 3SE0A 2F0SA 3PV0A 4C3IG 1WTPA 1WD1A 3K6OA 3QOLA 2EY6A 2QILA 2D2CC 5J1ZA 5DM73 1EY5A 4OO1H 5I9PA 3NWTA 1RTNA 1QJOA 1HUNA 2A68D 5T1IA 3W3AA 4B9XA 3QG1A 1D2BA 4OL7A 1ET9A 3J81E 3TDQA 2A6HC 4C3IB 5FO8B 4DXGA 4IUVA 3ND8A 2X69A 1TS4A 4OO1G 3KBXA 4G57A 4N9TA 3GTKB 1OXUA 5C4JB 1HUMA 4ZLTF 4A3DB 5DAUA 3NE5B 3A56A 1GUNA 1I50B 1TU2B 1TWFB 2LFNA 3RLFA 1RF2D 1PZKD 1CI3M 2TMPA 2B8FA 3D4WA 4BY7B 3S2HB 2CHBD 2PYKA 5E1FA 4N9PA 3GTJB 3BDLA 2Y0SB 4DNTB 4XT1B 2AWNA 1FD7D 4RHSA 3T16A 1W6JA 3I4NB 2R61A 3P75A 5LHY1 2OXPA 3MXUA 4NDXA 4FF2A 1GXDC 3HRZC 2ICEC 5ISRA 2MUYA 3N52A 1JQYD 2CW0D 1V8QA 4XXEA 1KLUD 5M3MB 4IFDG 2F0UA 1VMCA 2NWGA 2YU9B 3FMCA 1RODA 5EPJA 2SOBA 1H9RA 1BNZA 5IGCA 1Y8NB 3QOJA 3TN2A 1TY0A 3ERQA 4CJ0B 4P2CB 1E2ZA 2E2JB 1PTOB 1DD2A 1Q1BA 1HQMC 1HA5A 1SNDA 4HEDA 3D8GA 1PZJD 3EROA 4Q0FA 3FRPB 2IJ0A 3HZXA 5M9OA 1ZEQX 3QJYA 3NXWA 1H9MA 1WTOA 2NTSA 2X6LA 2RBMA 3AU7A 1JICA 3MHBA 2MGSA 3VYRA 2IW3A 3FDTA 2Q8RE 1X32A 1CT1D 3J81L 1O78A 3HOUB 5EPLA 1X3PA 4IUUA 3E5SA 4KKUA 3DEOA 2HQEA 5J22A 1CM9A 3HEJA 3K7AB 1EOTA 2EZVA 1D6EC 4V0BA 1Q90A 2EPBA 4K5VA 1MI2A 1EY9A 4K6DA 1TS2A 1O7LA 3CQZB 3UI2A 1HTPA 1O80A 1SMYC 5JPNC 3MXNA 3LNNA 5EKIA 2OF1A 3PO2B 4EGVA 5EQ0A 2EXZA 4A3EB 2Z1CA 1OO9B 4K5XA 4ZRZA 3GTPB 3PUZA 2RSNA 1HTLD 4ME5A 1NR4A 2O2LD 3H3VC 4E6IA 3OSOA 4QUCA 2EY1A 2Z4HA 1STHA 3P7JA 5E3FA 4OHJA 3TZUA 1I6VC 1PXUA 1EZ6A 2RA4A 3VR4A 2KOLA 4PV1C 1F2MA 4Y7NB 1L0XB 1SYCA 2EY5A 2QDBA 1PTOH 4RGNA 3RMHA 4LK1C 1H9JA 2F0OA 5E4WC 1ZYRD 1EY7A 1DZ1A 1HCZA 3MC0B 4HSPA 1B53A 4ZAIA 2DNEA 2F0DA 4IUQA 3FPPA 1GHKA 1BCPD 4KY7A 2RDHA 1HPCA 2ENBA 3BYTB 3CRKC 1STGA 2MP1A 2WACA 5E4XA 3F2UA 5I2XA 1RHPA 4G7OC 4FXDA 4KV6A 3I73A 3FVQA 2C9OA 1S4ZA 3H0GB 4RKLA 1QE6A 1RCVD 2RSOA 3CKIB 5EPKA 4NW2A 3JAML 4B08A 1SNPA 4CHTB 1PFMA 3QO2A 3PIO3 3SVMA 1CZWA 1CK1A 1PRTC 2L1BA 1PRTD 2F0HA 3NK9A 2JA8B 2VNUD 2KA7A 1L0YB 4FXGC 3PIP3 5CV6A 5G3LD 1UNSA 4Z9CB 4BY1B 4G7HC 3RZOB 1B4OA 1V1OA 4JK1C 1W6KA 2XIWA 1BR9A 1STYA 4O42A 5C3EB 4BBSB 1SYFA 3M4YA 1QOHA 2R93B 4RWSC 5CBEE 3LWEA 3L7ZC 4BWGB 5CV4A 4F88A 3DM1A 1BQQT 2WAQB 1FNWA 3D3RA 3HOWB 1G291 2KQ3A 3VYUA 3NWSA 1Y8OB 3OIQA 1IL8A 4EQPA 1KDBA 4NMZA 1PTOD 2L5TA 1DOMA 2PZWA 4RCOA 2AQ3B 1SE3A 3GV6A 5DEHA 5ELEA 1I4RA 1SE4A 4K14A 4XQQA 4U673 1RTOA 1ML0D 2JEAI 1A15A 2JXMB 1ZXTA 1CQVA 2FMMA 2NN6H 2D9UA 5JVH3 2KVMA 1LTGD 4DXFA 4HN7A 4TSSA 3S1RB 5COYA 1SAPA 2F0JA 4ILWA 1KLGD 1O7ZA 1IKLA 2ZT9C 4A3MB 1RDPD 1MD2D 2XRQD 4MN3A 1NUCA 5C6AA 1H9KA 3D4RA 2JYOA 2PMZB 2SDFA 4IALA 4K8IA 5JJZA 4XYQA 4KN4C 4A3FB 1PFBA 1UAPA 3PUXA 1QILA 5C0XG 1BDOA 5KYIA 1F9SA 2K6AA 2F0NA 4TRDA 3HOVB 1I3QB 5HGTA 2EJFC 1ILPA 4R8NA 5ELFA 1STAA 5C0XI 2A69C 1S5FD 3KBGA 1RJTA 1JR0D 1U4LA 4OIKA 1JWMD 1CQFA 2B2TC 3KLSA 3Q23A 2WP8J 4HMIA 1SXTA 2DN8A 3EA6A 1AZPA 1OXXK 2EJMA 1DOKA 3GTQB 2EVBA 1T5XD 2XNAC 2K5DA 2ZXPA 3SK4A 3ZYYX 2KUMA 2EYMA 3BVGA 3SHLA 1HA6A 3HOXB 1LTID 2F3VA 1SYGA 1IKMA 2FFKB 1JOOA 1SEBD 4A3BB 3VYTA 4PMCA 1HRJA 1JWSD 4J6HA 4QCLA 2F0KA 3S1QB 3D6CA 3KLRA 2JEBI 1Z7TA 4QB4A 1I4HA 1OXTA 2EOTA 5KRUA 3R8BA 2EYPA 2NUCA 3MZ5A 1EIHA 2KHSA 2Z4IA 1SYEA 2RQXA 5NUCA 3MWYW 4ZQ3A 2B2VC 3Q0AA 2B63B 2FHTA 4XQJA 2HUGA 5I4DA 1GUWA 4ULLA 2LMCB 4KHZA 1B44D 5C4XB 1TS3A 2F0QA 2EJGC 2M00A 2JA7B 4FXKC 2J0TD 2IPKD 3OIPA 2PQEA 4F7XA 1TWHB 2XWBB 1YNJC 2O5IC 5IGBA 1Y69U 2IX1A 3MA2B 3SXHA 2F0MA 2N55A 1V1PA 1G2TA 4WRDA 3MVVA 2J7ZA 3DEPA 3X3NA 4CGYB 4X3KA 1JOQA 3IAYA 1A3VA 2WB1B 2KEDA 2E2HB 1VF7A 2KEEA 3S14B 1SNQA 4ZK9B 3VR3A 2CVRA 3EFXD 4DN4M 4L63B 3VA7A 5CR3A 2WINB 1G2SA 5A35A 1Q12A 4FF3A 3KK7A 5EGTA 4FF1A 2PNRC 5IIFA 2NTTA 1OXVA 1SFOB 3V05A 1AW7A 1BBXC 1ENFA 3C1FA 2J4XA 1F2LA 3VA5A 1ENAA 1TWAB 4K2LA 3FPUB 2QEJC 2L9HA 4KHVA 3NBIA 3K58A 1EQTA 5KEEA 3WOFA 4K5WA 4DNRB 5M5WB 1WVLA 5F2DA 5C0XJ 2A6ED 3GTOB 3I3CA 4MHEA 1GUGA 5IODA 4ZKBB 1EWCA 3NTIA 3R93A 4KTAA 2HCIA 5C3XA 3NP8A 2IX3A 1ONLA 1F9QA 3WOEA 1I6HB 2A69D 3CHBD 3NTHA 1WCMB 3J7AV 1A2UA 2VXWA 1H9SB 2EDGA 1NAPA 1ILQA 5C5LA 4QUFA 2SNMA 4XT3B 1LT6D 1PMRA 2M2LA 2MPMA 3NBHA 4IFDH 5FK9C 1SNOA 2K7VA 1Z47A 2RDFA 2AUJD 3I4MB 4X3UA 2F0EA 1IYVA 2YYZA 1QNUA 1Q1EA 2E74C 4X3SA 2L55A 1J9OA 3VR5A 2ICIA 1GUOA 3NSWA 4CKBA 5FLXE 1JC7A 1RD9D 2AWOA 3IKJA 2PPBC 3J7YW 2ZXRA 3D4DA 3BG3A 4IQZA 1C48A 5EJWA 5CV8A 2B39A 4F8MA 5JOBA 3K57A 1B9MA 2CQAA 1HFNA 1CHPD 5JAVA 1BOSA 1EQVA 4CKEA 3A8IE 1FNVA 1KAAA 5IT9E 1TR5A 2F0WA 2KECA 2QKIC 3T51B 2MHVA 3PUWA 1ZYRC 2SNSA 1PFNA 3J80L 5M5YB 1XTCD 4R8IA 1CTMA 2K03A 4FNFA 1GUSA 3GO5A 1R4QB 4BS9A 3I8ZA 2R7ZB 5BN5A 3G7LA 1BCPF 2WKCA 4KJNA 1M8AA 5LL6X 4DAVA 2X6GA 1KTKA 4IUTA 5CV7A 3TP7A 1F9PA 1D5MC 4RGMA 1QCBD 5C4ZA 2PZUA 3K5NA 4J8QA 4C3HG 4DF7A 4XDXA 1PLFA 4PMBA 5JEAG 1EIGA 1M4VA 2XRSD 1IW7C 5FOBB 3X3MA 2M9VA 4B9WA 2K5WA 3H94A 1DCZA 1DM0B 4RKBA 4A93B 4BBRB 3P20A 1XYIA 3D31A 3BDCA 1VDZA 4C3HB 3U9SA 4C3JB 2K05A 4XTCS 5G3LF 1HHVA 4FYDA 2GA4B 2HCCA 1BO0A 4XYOA 4O1NA 2FINB 2ID0A 4RH6A 3KF8A 1G6ZA 5KNDA 4HTHA 3S9WA 1EY0A 4HMJA 1S5BD 2A5HA 3A55A 2K28A 5DNFA 4DK0A 2A68C 1E2WA 2AUKA 1ICWA 3GTLB 1NSNS 3R3OA 4H13C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OL7 A;  1RKN A;  3ERO A;  4ZQ3 A;  1IHZ A;  5IOD A;  1EZ6 A;  3NUC A;  3TME A;  3QB3 A;  3HZX A;  4KJN A;  4NP5 A;  4WOR A;  1STY A;  3TP8 A;  5M9O A;  4IAL A;  1EYD A;  1F2M A;  4K8I A;  4KTA A;  2LKV A;  5CV7 A;  1SYF A;  3TP7 A;  5C3X A;  1SYC A;  2EY5 A;  2QDB A;  3EVQ A;  3NXW A;  1KAB A;  3RUZ A;  3NP8 A;  3OMC A;  1SYD A;  2RBM A;  4K8J A;  4DFA A;  1A3T A;  2F0Q A;  1II3 A;  3ITP A;  3MHB A;  3MEH A;  5C5M A;  2M00 A;  5KYI A;  3MXP A;  4LAA A;  2PZU A;  4G57 A;  3SK8 A;  4N9T A;  1A2U A;  2F0O A;  2F0N A;  2PQE A;  2F0P A;  4KY5 A;  4J1M A;  4TRD A;  4F7X A;  5K5P A;  4DF7 A;  5IGG A;  3PMF A;  3SR1 A;  5C5L A;  5CV4 A;  1TQO A;  4ZUI A;  3T13 A;  5HGT A;  1EY8 A;  1EY7 A;  1SNC A;  2SNM A;  5IOC A;  1EYC A;  4PMB A;  3E5S A;  4ID6 A;  5E3F A;  1SNO A;  5IGB A;  1AEX A;  4ZUJ A;  4R8N A;  3EJI A;  4ODG A;  1STA A;  2EYF A;  3SXH A;  2F0M A;  2HQE A;  5DAU A;  5J22 A;  2EY2 A;  4QMG A;  1U9R A;  2KQ3 A;  5I6Y A;  4WRD A;  2F0D A;  1A2T A;  2RDF A;  2EYH A;  3MVV A;  2F0E A;  3NQT A;  4KY7 A;  4QF4 A;  5EKL A;  5NUC A;  4NKL A;  3D4W A;  2PW7 A;  3HEJ A;  4EQP A;  2PYK A;  5C4H A;  5E1F A;  1EY6 A;  1KDB A;  4NMZ A;  5IGE A;  4N9P A;  2ENB A;  3BDL A;  5HUR A;  1JOQ A;  5C3W A;  1A3V A;  1JOR A;  2F3W A;  4B9W A;  2PZW A;  1EY4 A;  5C4Z A;  3T16 A;  1SNQ A;  4YIJ A;  5CV9 A;  4HMI A;  4K5V A;  1STG A;  1EY9 A;  4IUN A;  3OWF A;  3P75 A;  5DEH A;  2WAC A;  3SK5 A;  1EZ8 A;  1KDC A;  4K6D A;  2EYJ A;  2OXP A;  4K14 A;  4RKB A;  3U9O A;  2O4X A;  4DGZ A;  3DHQ A;  4KV6 A;  2PW5 A;  4NDX A;  3TP6 A;  4DU9 A;  5I6W A;  5IGF A;  3D4D A;  3BDC A;  5CR3 A;  5ISR A;  3V2T A;  2OEO A;  2F0I A;  3H6M A;  3SK4 A;  2F0T A;  5EKK A;  4EQO A;  4KD3 A;  2EYM A;  4RKL A;  3SHL A;  3LX0 A;  5CV8 A;  4S3S A;  1KDA A;  3NHH A;  4F8M A;  2F3V A;  3TP5 A;  1SYG A;  5JOB A;  1F2Y A;  1JOO A;  2PZT A;  3OMG A;  2EYO A;  4EQN A;  5EGT A;  2OF1 A;  5I9O A;  5KIX A;  2F0V A;  4PNY A;  5IIF A;  2F0S A;  4PMC A;  1SNP A;  5JAV A;  3P1H A;  5CC4 A;  3SK6 A;  1EQV A;  2EYL A;  2F0G A;  2EXZ A;  1STN A;  2F0U A;  4KJO A;  5CV5 A;  4KY6 A;  1KAA A;  3DMU A;  4K2K A;  1ENC A;  4K5X A;  4H7B A;  3C1F A;  1SNM A;  2SOB A;  4J6H A;  1TR5 A;  3QOL A;  4EVO A;  5IGC A;  4I65 A;  2F0W A;  1JOK A;  2EY6 A;  2F0K A;  2RKS A;  3QOJ A;  3D6C A;  5J1Z A;  5IGD A;  5J39 A;  3NK9 A;  2F0H A;  3VA5 A;  5KYL A;  1ENA A;  1EY5 A;  4K2L A;  5I9P A;  4HTH A;  4ME5 A;  3S9W A;  1EY0 A;  2F0J A;  2SNS A;  3ERQ A;  4HMJ A;  4KHV A;  4MIU A;  4QB4 A;  5KGU A;  4IZ8 A;  5KRU A;  4KD4 A;  1F2Z A;  5KEE A;  2F0F A;  4E6I A;  4K5W A;  3OSO A;  5CV6 A;  2EY1 A;  5CGK A;  1NUC A;  1EYA A;  2EYP A;  1TT2 A;  2F0L A;  2NUC A;  5F2D A;  1SND A;  1STB A;  1STH A;  4B9X A;  5C6A A;  1NSN S;  3C1E A;  3MZ5 A;  1A3U A;  2KHS A;  1SYB A;  3R3O A;  3D8G A;  1SYE A; 
#chains in the Genus database with same CATH topology
 2MQH A;  5IYC G;  1HZB A;  2RVL A;  4P74 A;  2WAQ E;  4NP5 A;  1PH5 A;  4OEM B;  4F87 A;  5IT9 L;  2BCO A;  2A19 A;  4HSV A;  5JEA J;  5M5Y H;  2JQO A;  1T5E A;  3DLL A;  3MXP A;  3SK8 A;  4LMQ D;  2DY8 A;  4IJH A;  2R7Z H;  1IYU A;  2A74 C;  4FF4 A;  2B2U C;  4ID6 A;  3GV3 A;  1GJX A;  4HCE A;  4TVA B;  1V43 A;  1LAC A;  2EY2 A;  1YHQ A;  4YHH Q;  3AMU A;  1IXR A;  4KI0 A;  2ZM6 L;  5FLX L;  3PIO A;  1EUJ A;  2K01 A;  2L12 A;  1N34 Q;  2PQA A;  3JAM E;  3OYY A;  3STB D;  5ELD A;  3E9I A;  4QIW B;  4XQN A;  1PDQ A;  1LTR D;  3M7G A;  5T1G A;  3GTM B;  4IFD J;  3PO2 G;  1U0L A;  5JEA H;  3TEH B;  3SK5 A;  3BDO A;  1S5C D;  3HGB A;  3U9O A;  2O4X A;  4DGZ A;  1DOL A;  3S16 H;  3FKI G;  1Q86 C;  3HOV G;  1PA6 A;  2F0I A;  1FNU A;  1VMP A;  2EXD A;  1IW7 D;  1B1Z A;  1AE2 A;  4FVM A;  4LJZ C;  2JP1 A;  1L0W A;  1JJ2 A;  3T4A C;  5D65 A;  4R4I A;  3IFD A;  4X64 Q;  2F0V A;  2Z6K C;  1UE1 A;  3KDF B;  2P5Z X;  3ZJY C;  1FL0 A;  5A2Q L;  1KXL A;  4PMW A;  3A5Z B;  4MNO A;  1JB3 A;  1YNN D;  1P16 A;  1X3G A;  4C3H H;  2L4N A;  4B3R L;  1WTH A;  3ONA B;  3CRL C;  4IZ8 A;  2NVT B;  1F2Z A;  1YVC A;  2L15 A;  1BXT A;  1CA5 A;  3HOU G;  1DON A;  4A3G H;  1K8G A;  3L9A X;  1VQC A;  3CMA A;  1NJI C;  1LT5 D;  1TKW B;  5E7N A;  2H4O A;  1NMF A;  1STE A;  3RUZ A;  3M4P A;  1YIJ A;  4DR3 Q;  2GN5 A;  3R2T A;  5C5M A;  4X3T A;  3RLO A;  1NBW A;  5JVG 3;  3KUP A;  3M3Y B;  2N78 A;  1AN8 A;  1TQO A;  2ZTE A;  4ZUI A;  1CKN B;  1PZI D;  5IOC A;  3CF5 A;  4GOP C;  5D14 A;  4ZUJ A;  4ALP A;  2K4K A;  4MTN A;  4BA1 I;  2FXQ A;  2JA8 G;  2K75 A;  3NEL A;  2BA1 A;  5KNB A;  2JK8 A;  1U9R A;  1PH6 A;  2RCN A;  4RMF A;  4RAU C;  4GLX A;  1Y1W H;  1XMQ Q;  1QZG A;  4NKL A;  2H1E A;  5L37 A;  2F4V Q;  2VW9 A;  1LLR D;  3ULP A;  2IHF A;  1K8M A;  3DWA A;  1Q8K A;  5C3W A;  4R4C A;  5H1S E;  5IE8 A;  2O5J C;  4DR7 L;  4IUN A;  3L0O A;  2PCF B;  3K0X A;  1KDC A;  2PO4 A;  4UAI A;  1PTO C;  4NPS A;  2E75 C;  4OWT B;  2OQ0 A;  3DWP A;  2RCF A;  2A6H D;  2AQ1 B;  5EKK A;  1PTO F;  4BBR G;  4JI2 Q;  4IPC A;  4OIJ A;  3OMG A;  4CDF C;  2PZT A;  2PI2 A;  3IFT A;  4DR7 Q;  1E2V A;  3BVM A;  3GTM H;  1RIP A;  4PNY A;  2OTL A;  4R4T A;  1A8V A;  1QVC A;  3NPP A;  2Z0S A;  3KF6 A;  1S5D D;  1I4G A;  4DK1 A;  1FYC A;  1YHB A;  4KJO A;  3HOZ H;  4KY6 A;  1YHA A;  1ENC A;  3S16 B;  1SNM A;  1Q7Y C;  1SDF A;  4A3I H;  5BR8 Q;  2UUA L;  1LAB A;  2BOS A;  5J39 A;  4DK6 C;  1VQD A;  4RGT A;  2B2V A;  4JPB W;  4NXM Q;  3Q24 A;  5KGU A;  1KRS A;  4JI6 L;  1HR0 W;  3F8T A;  3T53 B;  3NEN A;  2K33 A;  1TT2 A;  2R6G A;  3KFU A;  2K04 A;  3Q6S A;  4OX9 L;  3I70 A;  2D0P A;  4H44 C;  1HQR D;  4N8F A;  1KL9 A;  5BR8 L;  4B3T L;  3TME A;  4L8J A;  3BJU A;  1KNA A;  1UEA B;  1PHJ A;  2GVB A;  2N88 A;  3S24 A;  1D1K A;  2IHE A;  3PO3 G;  3RZD H;  5CMD A;  4DUZ L;  3OMC A;  1TWG H;  3V96 A;  1SYD A;  4YY3 L;  3MFY A;  4K8J A;  2YV5 A;  1DYQ A;  2IWH A;  5K36 H;  3MEH A;  4YCU A;  4A3G B;  2G9H D;  1QG7 A;  2BDN A;  3K5O A;  4B3S Q;  2V4D A;  4LFB Q;  1TS5 A;  1SR3 A;  2QCP X;  2SEB D;  3C2P A;  1QWY A;  5I6Y A;  4RA8 A;  1Y14 B;  4CJ2 C;  3NQI A;  2WB1 G;  4UP9 A;  1G8Z D;  3KLS X;  4KHP L;  4X6A H;  3ULL A;  5BN4 A;  2Q2T A;  1SBB B;  1D7Q A;  3E9H A;  1CUK A;  4A3J H;  4HJA A;  3S17 H;  4ZYS A;  1LO5 D;  1K8O A;  4TKO B;  3G6J B;  3DM3 A;  4IOA A;  1CHQ D;  1OTC A;  4DR1 L;  3TP6 A;  3MAQ A;  3HS0 C;  1X3Q A;  2XVS A;  1Y1W B;  2IL8 A;  2UUB Q;  4A76 A;  3C3L A;  3LX0 A;  4DV1 L;  2RDG A;  3RD4 A;  5KNC A;  4DR4 L;  1CA6 A;  1HNX Q;  1PRT B;  3VR6 A;  1EFI D;  2E2D C;  4QL5 A;  1U4R A;  1D8L A;  4JVZ A;  3P1H A;  1A6X A;  5TSS A;  2KBN A;  3HKZ E;  2L0C A;  5CV5 A;  2NVY B;  1KNE A;  2CWP A;  2Z6K A;  1LTA D;  1QUQ B;  1FGU A;  2K1B A;  2R3Z A;  3DWQ A;  1X6O A;  1X65 A;  4O2D A;  1LT4 D;  4DPG A;  3G71 A;  3AB9 A;  1QUQ A;  4BXX G;  1AZQ A;  4GZY C;  4MIU A;  4KKS A;  2JA6 G;  1E7Z A;  2D5D A;  3KLW A;  4V19 0;  3E0J A;  1XNR L;  2VB2 X;  3A8J E;  2VUM B;  1PRT F;  3H0G G;  3I91 A;  4DUZ Q;  1JE5 A;  1BBW A;  3J80 c;  3C1E A;  1WTW A;  5D3I B;  2K5Q A;  1IL2 A;  3HOZ B;  2LSS A;  4BA2 I;  4IUR A;  1IHZ A;  3MXG A;  4A3I B;  2BH8 A;  4B3S L;  1MKH A;  4LFB L;  4WOR A;  1VQJ A;  2DY7 A;  1LUZ A;  3EIV A;  2OTJ A;  2NZ1 D;  3BYY B;  1LV9 A;  2H5X A;  4DFA A;  1A3T A;  1LTB D;  4OO1 I;  2B2U A;  3HP3 A;  2G9D A;  3GQB A;  5M3M G;  3TS0 A;  4RFB A;  3FEW X;  1GVP A;  1JMC A;  1FGB D;  1SNC A;  3S1M B;  1N32 Q;  4UHV A;  1NNX A;  1EYC A;  2JA5 H;  1XPO A;  1AEX A;  3EJI A;  1CSQ A;  1I5F A;  4DV7 Q;  3Q22 A;  5COR A;  1P8L A;  3W5O A;  3RZD B;  1EU3 A;  4CDE C;  2KJX A;  2EYH A;  2LXJ A;  4DR5 L;  1LTS D;  1TWG B;  1ESR A;  3BS1 A;  4L6T B;  5K36 G;  2EE1 A;  1ET6 A;  5HUR A;  4KMU C;  1U4P A;  4QGU A;  4A3F G;  2VQF L;  1LM0 A;  1JOR A;  3H09 A;  2IX0 A;  3TSS A;  3HKZ G;  4RCN A;  2B3G A;  3UE0 A;  3CCL A;  1HZA A;  2EYJ A;  1PYW D;  1LT3 D;  1ESF A;  3LWU A;  5IGF A;  5EBD A;  3S2D B;  1EU4 A;  4LF5 Q;  1N34 L;  2F52 A;  4AQY Q;  1A63 A;  1MGS A;  4A3D G;  1Y1V H;  5GRO A;  1K3R A;  3CU7 A;  4S3S A;  2NVQ H;  2UXB Q;  3TP5 A;  3QIA A;  1FR3 A;  2I5H A;  5I9O A;  5GAG C;  1XNR Q;  4A3J B;  3BVZ A;  3S17 B;  3S1N B;  4K0K L;  3TBI B;  1I4Q A;  4EVO A;  3I4M G;  1AP0 A;  3PIP A;  5IGD A;  3M85 A;  2HDL A;  4TQU S;  1IBK Q;  1J5E L;  1ASY A;  4JV5 Q;  1C8C A;  3N6R A;  1MSG A;  3KF6 B;  3OW7 A;  1WTX A;  2UXD Q;  5A2Q E;  4I7Z C;  1EYA A;  3ER0 A;  4ABN A;  1Q8I A;  3A8K E;  3QB3 A;  1B2T A;  2NVY H;  1I4X A;  1RKN A;  3HOY B;  1GHJ A;  4H0L C;  2CFM A;  4FDB A;  4GS3 A;  4DA2 A;  4WFN 3;  2OWO A;  3AFP A;  3TZD A;  1M1K C;  3RLN A;  2A6E C;  2LKV A;  2BE5 D;  4DAY A;  4L5S A;  2UXD L;  4DR3 L;  1B50 A;  1DXM A;  1E1O A;  4ZKC B;  2VUM H;  1H9S A;  3JAM c;  5ELB A;  5EBC A;  4KY5 A;  1R9T H;  4RHR A;  3SR1 A;  3EBE A;  2HDM A;  3H91 A;  2NVX H;  3T13 A;  4UDU C;  1LTT D;  2NN6 G;  1VQ4 A;  1V1Q A;  2I5L X;  2OT2 A;  2XTI A;  3GP7 A;  5FLM G;  3M7N A;  4QMG A;  2K5H A;  2E2I H;  3M4O H;  4B3M L;  4CKC A;  4QF4 A;  5EKL A;  2PW7 A;  2BE5 C;  1EY6 A;  1PH7 A;  2FMC A;  5DM6 3;  4BY7 G;  1BF4 A;  5ELC A;  2L11 A;  3OWE B;  4IPD A;  3S1M H;  1I94 Q;  2JJQ A;  3I4O A;  3OWF A;  1C7Y A;  4GNX A;  2JA5 B;  3CXC A;  2E8G A;  3PUV A;  4A3I G;  3BZD B;  1L2F A;  1EEF D;  3I72 A;  1CZG A;  2PW5 A;  3V2T A;  4DV4 L;  4PG3 A;  3L3O C;  1IYJ B;  4EQO A;  4GOP A;  4JI3 L;  4JBM A;  3K5L A;  1EWI A;  1ASZ A;  3SDZ A;  4A3L G;  4EQN A;  4YWK A;  1BCP B;  2A73 B;  5BN3 A;  5FKA C;  5KIX A;  4IOC A;  1IZ6 A;  1PH2 A;  1JWU D;  4GKJ L;  5CC4 A;  5ELN A;  3SK6 A;  2DNC A;  2EYL A;  1NCV A;  3VDY A;  2ATW A;  3DXJ C;  1E24 A;  3OTO L;  5C0X H;  1F77 A;  3DMU A;  1YBY A;  3S2D H;  1J8I A;  4HCS A;  4PZ8 A;  1W2B A;  3F2D A;  4FP5 D;  5CYU A;  1PVO A;  1Y1V B;  1GM5 A;  1XWE A;  3OOC A;  3J7A F;  2NVQ B;  4GLA C;  3E6Z X;  3KDF A;  5CGK A;  4KN7 C;  4GKJ Q;  4LF8 Q;  4X62 Q;  1D1I A;  1STB A;  2LS0 1;  3S1N H;  3OTO Q;  2B2W C;  1SYB A;  2AQ2 B;  1KQS A;  1VQA A;  3STB C;  3KJP A;  3NUC A;  5FO7 B;  1Q3L A;  1SJH D;  3A54 A;  2F1M A;  2MO0 A;  3K0Y A;  3UDI A;  1UE6 A;  2G5D A;  2JA6 H;  2WII B;  1SMX A;  3CP0 A;  4DV5 Q;  4A3C H;  1I4P A;  1XXG A;  4JI6 Q;  5M5X B;  4GLV B;  4KKT A;  1V9P A;  1II3 A;  2AMC B;  3BU2 A;  3ICE A;  4LAA A;  3T1Y L;  2F4V L;  3CPF A;  3S15 B;  3PO3 H;  3F1Z A;  1MBY A;  4HR7 B;  5I2Y A;  3PMF A;  4JBW A;  4GKK Q;  3HOY H;  2D0O A;  1VQK A;  1CFM A;  1EY8 A;  1SSO A;  4KLK A;  4OWX B;  1HXY D;  4ODG A;  3WDN A;  4KK7 A;  1O7Y A;  1JE4 A;  1K83 H;  3D6W A;  3J7A 5;  1A2T A;  1G91 A;  4X65 L;  1MJE A;  1R4P B;  2Y0S G;  5C4H A;  4WJW A;  4M8A A;  2R92 G;  1D5X C;  5IP9 G;  3R2I A;  3CAM A;  4JI2 L;  1WTV A;  1R9T B;  1TWC B;  2NVX B;  2XWJ B;  4YIJ A;  4EQ5 A;  5FLM H;  1C4Q A;  1XJV A;  2YTV A;  5CBA E;  1GOZ A;  4APV A;  5IYC H;  2Q2U A;  1QNK A;  4H02 A;  4DU9 A;  2NB0 A;  2E2I B;  2B2Y A;  3M4O B;  5M3F B;  1C0A A;  1LYL A;  2F0T A;  2EIF A;  3HG9 A;  5LMU L;  2MJ8 A;  3NHH A;  3J81 c;  1F2Y A;  5IYB G;  1HNX L;  4LW1 A;  1SE2 A;  3HKZ B;  1B9N A;  2F4I A;  4IFD I;  1U4M A;  4XIG S;  1TII D;  3FKI H;  1BCP C;  3G6E A;  2R92 B;  4H7B A;  4RGO S;  3A5U A;  2HHH L;  2NBF A;  3MTS A;  4DV1 Q;  5KYL A;  4OXP A;  2WKD A;  1KIX A;  3CCJ A;  1B3A A;  2D62 A;  4KD4 A;  1WTQ A;  2F0F A;  3DUZ A;  2OQK A;  4CJ1 B;  1HR0 L;  3IL8 A;  3IRB A;  1AFP A;  1A3U A;  2I07 B;  4G4K A;  1G51 A;  2C5C A;  3PF5 A;  4MZ9 A;  3GD7 A;  3OHX C;  2EQS A;  3ULJ A;  1HJP A;  1Y8P B;  1EYD A;  4UY8 C;  2RHS B;  1EYG A;  1BVS A;  5FJ8 H;  2F03 A;  1VQO A;  1MIU A;  2NN6 I;  3VR2 A;  1JCK B;  4UPA A;  1SMY D;  1QB5 D;  1WD0 A;  3K5M A;  4KHP Q;  3U58 A;  4DAP A;  5K5P A;  4J1M A;  2Z8L A;  4A3K H;  5IGG A;  4Y52 H;  1SLJ A;  5D3D A;  4JBJ A;  4C56 C;  1MHW C;  2JA6 B;  4IN3 A;  5C44 B;  1VF5 C;  3CCM A;  4OGQ C;  5GQO A;  3OPO A;  2BA0 A;  4PQX A;  3GTG H;  3I4L A;  5M5X H;  3NQT A;  2B8G A;  1YJW A;  2UUB L;  4EX5 A;  1S5E D;  4C1N K;  3S15 H;  1HNW Q;  1WTR A;  3PO3 B;  1NR2 A;  5FJ8 G;  1Z6H A;  1EY4 A;  4U68 A;  4A3B G;  2B2T A;  1YNJ D;  4FO2 A;  3EQL C;  1EZ8 A;  1F9R A;  2WFW A;  1A0I A;  1TY2 A;  3DHQ A;  5I6W A;  1K83 B;  4NXN Q;  2KCC A;  4R9W A;  2I46 A;  5EAY A;  3UE1 A;  1VCI A;  1Y1W G;  3H6M A;  3RNU A;  3SEB A;  1L1O C;  3K59 A;  1D5Z C;  2QF7 A;  5GAD C;  2Q8I B;  2EYO A;  1HFG A;  1TWC H;  4JW0 A;  1XX8 A;  2B2W A;  3QWN A;  2JA7 G;  3PCO B;  2NYZ D;  2F0G A;  3A7L A;  3J80 E;  1DJR D;  1STN A;  2N3S A;  5JPM C;  4K2K A;  3MFG A;  3UDF A;  4I65 A;  1TVX A;  2JA9 A;  4A4I A;  5M3F H;  1JOK A;  4AQY L;  3RN2 A;  1BUV T;  2RKS A;  4HAE A;  4B3R Q;  3URY A;  2UXC L;  5AFW A;  3VYS A;  2ZXO A;  2FJ2 A;  1X55 A;  4RG1 A;  1B8A A;  2F0L A;  4C3J G;  2Z6B A;  1UUP A;  1UWV A;  2E76 C;  3FKI B;  1SJE D;  3I56 A;  2R92 H;  1OXS C;  1EWH A;  2ZJQ A;  3BZC A;  1VQM A;  4HIO A;  2DUD A;  1K28 A;  3TP8 A;  4HJ7 A;  3F2B A;  1I50 H;  1TWF H;  2B2Y C;  3T56 B;  2BDO A;  3EVQ A;  1KAB A;  4DR5 Q;  1MSH A;  2Q8T A;  4JYA L;  2K32 A;  2WB1 E;  3ITP A;  3GTJ H;  2IT1 A;  4BY1 G;  2K5V A;  3PUY A;  2ZJR A;  2XN9 C;  2QDL A;  2F0P A;  4C2M B;  3CD6 A;  4LF4 L;  2VUM G;  2CWA A;  5C44 G;  2DJG C;  2HQL A;  4CBV A;  1YNN C;  2XSC A;  4IUP A;  2TSS A;  2EYF A;  2JE6 I;  2JSO A;  4K6L A;  4DV0 Q;  5IP7 G;  1Y1V G;  3QR8 A;  5HY6 A;  1PH4 A;  1EEI D;  3NTK A;  1QVG A;  4LUV A;  3KOJ A;  3C46 A;  5FO9 B;  4G7Z C;  5IGE A;  4LF7 Q;  2CW0 C;  3L2P A;  2F3W A;  2KCN A;  4A3K B;  1E0B A;  1EL0 A;  2VB3 X;  5CV9 A;  4A3J G;  1GUT A;  4C1N I;  5LL6 S;  3I90 A;  3UDG A;  1S72 A;  1V1P B;  5C44 H;  2YU9 H;  2LY7 A;  3A7A B;  1KHI A;  2LXK A;  3GTG B;  4AYB B;  4Q5V A;  1B7Y B;  2OEO A;  1ZKO A;  2PMZ E;  4PZ6 A;  2WV6 D;  3W2D A;  1VQP A;  3O13 A;  1PH3 A;  4LF7 L;  4KD3 A;  1KDA A;  4JG2 A;  4JI4 L;  3I7F A;  3ND9 A;  4P71 A;  2E2J H;  4M1U B;  3SE0 A;  4X66 L;  3HFZ B;  2F0S A;  3PV0 A;  4C3I G;  1NMG A;  2GVA A;  5FLX c;  1WTP A;  2PQA B;  2QGQ A;  1WD1 A;  2B63 G;  3K6O A;  3QOL A;  4DV4 Q;  2EY6 A;  2QIL A;  4I7A A;  2D2C C;  2QW7 A;  5J1Z A;  5DM7 3;  3CW2 C;  1EY5 A;  4NXM L;  4OO1 H;  5I9P A;  3NWT A;  2WAQ G;  3U50 C;  4JI7 Q;  4LF8 L;  1RTN A;  1QJO A;  1HUN A;  2A68 D;  1PYB A;  4JYA Q;  5T1I A;  3W3A A;  1B3Q A;  4B9X A;  4L5Q A;  4DAY B;  3QG1 A;  4OX9 Q;  1D2B A;  4OL7 A;  4P75 A;  4DKA C;  1K8A C;  1EQR A;  1VQ7 A;  1ET9 A;  2K52 A;  3J81 E;  3TDQ A;  1QVF A;  2A6H C;  4C3I B;  5FO8 B;  4DXG A;  3B6Y A;  4IUV A;  3ND8 A;  2X69 A;  1K0S A;  2KEN A;  4X62 L;  4GNX C;  1TS4 A;  4YWL A;  4OO1 G;  2N49 A;  3KBX A;  1CKM A;  4G57 A;  4N9T A;  4DAM A;  2RHQ B;  3GTK B;  1A62 A;  1OXU A;  3KJO A;  5C4J B;  4CDC C;  1L1O A;  1HUM A;  4ZLT F;  4DV5 L;  4A3D B;  1WOC A;  5DAU A;  3NE5 B;  1FJG Q;  3A56 A;  1GO3 E;  1GUN A;  1I50 B;  1TU2 B;  1TWF B;  2LFN A;  3RLF A;  1RF2 D;  4AH6 A;  1PZK D;  1CI3 M;  2TMP A;  2B8F A;  4ZCK A;  1CKN A;  3D4W A;  3S2H B;  4BY7 B;  2CHB D;  2PYK A;  5E1F A;  4N9P A;  1N8R C;  2KCM A;  3GTJ B;  3BDL A;  2Y0S B;  1G6P A;  2JN4 A;  4DNT B;  4XT1 B;  4C2M H;  4DUY L;  2AWN A;  1FD7 D;  2XGT A;  4RHS A;  3T16 A;  3PO2 H;  1W6J A;  2Z9H A;  1JJC B;  3I4N B;  2R61 A;  3P75 A;  4X66 Q;  5LHY 1;  1XMO L;  2QA4 A;  3AEV A;  2OXP A;  3TRE A;  3MXU A;  4NDX A;  4OON A;  1GXD C;  1PFS A;  3HRZ C;  2ICE C;  4DV3 Q;  4FF2 A;  4DR1 Q;  2DGY A;  5ISR A;  2MUY A;  2HT1 A;  1HNZ L;  3LGJ A;  5JJI A;  3N52 A;  1VQI A;  2ES2 A;  3J81 j;  1JQY D;  2CW0 D;  1VQ5 A;  1VS0 A;  1UE5 A;  3TRZ A;  2IY5 B;  3K7U C;  3KF8 B;  1EIF A;  1V8Q A;  4XXE A;  1KLU D;  4JI7 L;  3I4N G;  4DR6 L;  5M3M B;  4JI8 L;  1XMO Q;  2QEX A;  3I2Z A;  1U5K A;  4IFD G;  4GNX B;  2F0U A;  1VMC A;  2NWG A;  2YU9 B;  3FMC A;  5HGQ A;  1ROD A;  5EPJ A;  2SOB A;  1H9R A;  1BNZ A;  5IGC A;  1Y8N B;  1JT8 A;  3AFQ A;  3QOJ A;  3TN2 A;  2Q2I A;  1E1T A;  1TY0 A;  3ERQ A;  4CJ0 B;  4P2C B;  1E2Z A;  3RN5 A;  4JI0 Q;  2E2J B;  1PTO B;  4JI5 Q;  1DD2 A;  1Q1B A;  1HQM C;  1HA5 A;  3KYH C;  1SE8 A;  1SND A;  4HED A;  3D8G A;  4DV6 L;  1PZJ D;  3ERO A;  1N36 L;  4Q0F A;  1W3S A;  3FRP B;  2R7F A;  2IJ0 A;  3HZX A;  1IBL L;  1H95 A;  5M9O A;  1ZEQ X;  3QJY A;  3NXW A;  1H9M A;  1WTO A;  2NTS A;  2X6L A;  2RBM A;  3AU7 A;  1JIC A;  3MHB A;  2MGS A;  3HOZ G;  4PZ7 A;  3VYR A;  2IW3 A;  3FDT A;  1N33 L;  2Q8R E;  4HIK A;  1X32 A;  1CT1 D;  2CQO A;  1O78 A;  3J81 L;  3HOU B;  5EPL A;  4JC0 A;  2AHO B;  1X3P A;  4IUU A;  3E5S A;  4KKU A;  3DEO A;  1Q46 A;  5GAE C;  4C3I H;  2HQE A;  5J22 A;  1CM9 A;  5IYB H;  4GN4 B;  3HEJ A;  3K7A B;  1EOT A;  2EZV A;  1Q81 C;  2VQF Q;  3GTK H;  1D6E C;  4V0B A;  1KD1 C;  5C4J H;  1Q90 A;  2EPB A;  4K5V A;  1MI2 A;  1EY9 A;  4JI8 Q;  4K6D A;  1TS2 A;  1O7L A;  3CQZ B;  4A3D H;  3UI2 A;  1HTP A;  1HZ9 A;  1O80 A;  1SMY C;  1BBU A;  1IBM Q;  5JPN C;  4OWW B;  3MXN A;  4NB3 A;  4BY7 H;  3CCR A;  3S2H H;  3LNN A;  2UXB L;  2R7D A;  4DR4 Q;  4A3L H;  5EKI A;  2OF1 A;  3PO2 B;  4YCW A;  3I4N H;  1K9M C;  4EGV A;  5IWA Q;  4K0K Q;  3AQQ A;  5EQ0 A;  2EXZ A;  4LF9 L;  3H3V H;  2Z1C A;  1OO9 B;  4K5X A;  4ZRZ A;  3EN2 A;  4A3E B;  3GTP B;  4IJL A;  4YCV A;  1CSP A;  3PUZ A;  4LFA Q;  2RSN A;  3J81 i;  3CC7 A;  1J5E Q;  5C3E H;  1IBL Q;  1HTL D;  4ME5 A;  3OW2 A;  1NR4 A;  3ERS X;  2O2L D;  2DJF C;  4JBK A;  4E6I A;  3H3V C;  3OSO A;  4QUC A;  2EY1 A;  3H3V I;  5M3M H;  2Z4H A;  4LFC Q;  1STH A;  4L5T A;  3P7J A;  5E3F A;  1Z9F A;  4IPG A;  4OHJ A;  3TZU A;  2ZJP A;  1I6V C;  1PXU A;  1EZ6 A;  2RA4 A;  3VR4 A;  2KOL A;  4PV1 C;  4HJ9 A;  1F2M A;  3PQI A;  4Y7N B;  1L0X B;  3HOW H;  1SYC A;  4OEL B;  2EY5 A;  2QDB A;  1PTO H;  4RGN A;  1VQL A;  4IPH A;  1E22 A;  3RMH A;  4LK1 C;  1H9J A;  2F0O A;  5E4W C;  3TQY A;  4LF4 Q;  1WYD A;  1ZYR D;  1K0R A;  1QZH A;  1EY7 A;  3M9B A;  2B29 A;  1DZ1 A;  4YHH L;  1HCZ A;  3MC0 B;  4HSP A;  1B53 A;  4ZAI A;  2DNE A;  1EFW A;  2F0D A;  2YTY A;  3U4V A;  4IUQ A;  3FPP A;  1GHK A;  1BCP D;  4KY7 A;  2RDH A;  5AJ3 Q;  1HPC A;  2ENB A;  1PH8 A;  3BYT B;  3J7Z C;  3CCS A;  3BZK A;  2ZTC A;  3HOU H;  3CRK C;  4HJ5 A;  1STG A;  2HIX A;  2MP1 A;  2WAC A;  5E4X A;  3F2U A;  5I2X A;  1RHP A;  4G7O C;  4FXD A;  4KV6 A;  4HJ8 A;  4LF9 Q;  3I73 A;  3FVQ A;  5AJ3 L;  3CPW A;  2R93 G;  2C9O A;  3K7A H;  4MTK A;  5IP9 H;  1S4Z A;  3H0G B;  4RKL A;  1QE6 A;  3S1R H;  1RCV D;  4A3M G;  2RSO A;  3CKI B;  4JI3 Q;  1J6Q A;  5EPK A;  4J15 A;  3CCE A;  4NW2 A;  3JAM L;  4B08 A;  4X64 L;  1SNP A;  4CHT B;  1VQF A;  1PFM A;  3QO2 A;  3CQZ H;  3PIO 3;  2V1C C;  3SVM A;  1CZW A;  1CK1 A;  1TXY A;  2UUA Q;  1PRT C;  1UEB A;  1VQE A;  2L1B A;  1PRT D;  2F0H A;  3NK9 A;  2ASB A;  2JA8 B;  4JI4 Q;  2VNU D;  2KA7 A;  1EQQ A;  1L0Y B;  4FXG C;  3PIP 3;  5CV6 A;  5G3L D;  1UNS A;  1ICF B;  1WJJ A;  4Z9C B;  4BY1 B;  4G7H C;  3HOV H;  3RZO B;  5IT9 c;  2VS1 A;  1B4O A;  4A3E H;  5JJL A;  3GTP H;  1V1O A;  1PV4 A;  2K5N A;  3M4Q A;  1XNQ L;  4JK1 C;  1W6K A;  2XIW A;  1BR9 A;  1STY A;  4O42 A;  5C3E B;  3U4Z A;  4BBS B;  1SYF A;  3M4Y A;  3HOX G;  3TS2 A;  1QOH A;  1KRT A;  4POF A;  2A1A A;  1AE3 A;  2R93 B;  4RWS C;  5IY0 A;  5CBE E;  3LWE A;  3L7Z C;  4BWG B;  5CV4 A;  4F88 A;  1VQ8 A;  3A74 A;  3DM1 A;  4GKK L;  3PGZ A;  4YWM A;  1BQQ T;  2WAQ B;  1FJG L;  1FNW A;  3D3R A;  3HOW B;  1G29 1;  1BKB A;  2KQ3 A;  4Y7N H;  3D0F A;  3VYU A;  3NWS A;  1WI5 A;  1Y8O B;  3OIQ A;  1IL8 A;  4EQP A;  3I55 A;  1KDB A;  4NMZ A;  1PTO D;  3CCQ A;  2E5L L;  1Q82 C;  3CCV A;  2L5T A;  2RF4 A;  1DOM A;  2PZW A;  5C3E G;  4RCO A;  3E3X A;  4A3B H;  4H13 C;  2AQ3 B;  4JI1 Q;  1SE3 A;  3GV6 A;  5DEH A;  5ELE A;  1I4R A;  1SE4 A;  4K14 A;  4XQQ A;  2CH4 A;  4U67 3;  1RTO A;  5DLQ E;  1ML0 D;  2ALY B;  4A75 A;  3S1Q H;  2JEA I;  1A15 A;  5LMU Q;  2JXM B;  2UUC Q;  2A8V A;  1ZXT A;  1CQV A;  2Y0S E;  2FMM A;  2NN6 H;  1C9O A;  2Q2H A;  2D9U A;  5JVH 3;  4A3K G;  1SRO A;  2KVM A;  1YEZ A;  1LTG D;  1PH1 A;  4LF6 Q;  1HNZ Q;  1EOV A;  4DXF A;  4DR2 Q;  4HN7 A;  3H0G H;  4TSS A;  4AYB G;  3T1H Q;  3S1R B;  5COY A;  3A0J A;  1SAP A;  2F0J A;  4ILW A;  1KLG D;  1O7Z A;  1IKL A;  2C35 B;  2ZT9 C;  4A3M B;  1RDP D;  1MD2 D;  2XRQ D;  4MN3 A;  1NUC A;  5C6A A;  2JA7 H;  1H9K A;  4DV6 Q;  1TWH H;  4A3E G;  3D4R A;  4AYB E;  2HD3 A;  4R4Q A;  2JYO A;  3MXN B;  4B3T Q;  2PMZ B;  2SDF A;  2JA8 H;  4IAL A;  4K8I A;  5JJZ A;  4JOI C;  4XYQ A;  4KN4 C;  4A3F B;  1PFB A;  1UAP A;  3PUX A;  4WJ3 M;  1QIL A;  2VQE L;  3MEF A;  1VQH A;  4HID A;  1XPR A;  5C0X G;  1BDO A;  5KYI A;  1F9S A;  4BY1 H;  2E5L Q;  2K6A A;  2F0N A;  4TRD A;  2NZH A;  3HOV B;  3RZO H;  1I3Q B;  3S14 H;  5HGT A;  2EJF C;  1ILP A;  4GOP B;  1N32 L;  4LNQ A;  4R8N A;  5ELF A;  1STA A;  5C0X I;  2A69 C;  1S5F D;  3KBG A;  4GN3 B;  4DV7 L;  1RJT A;  4DV2 L;  4BBS H;  1JR0 D;  4X65 Q;  2I5M X;  1U4L A;  4OIK A;  1JWM D;  4HIM A;  1CQF A;  4AIM A;  2B2T C;  2CH4 W;  2R93 H;  3KLS A;  3Q23 A;  1HNW L;  2WP8 J;  4HMI A;  1SXT A;  2DN8 A;  3EA6 A;  1SFO H;  1OXX K;  2EJM A;  1AZP A;  1X54 A;  1DOK A;  3GTQ B;  1LTL A;  2EVB A;  1T5X D;  2XNA C;  1YJ9 A;  4LF6 L;  2K5D A;  2ZXP A;  2YTX A;  3SK4 A;  3JAM i;  3ZYY X;  2KUM A;  2EYM A;  3BVG A;  3SHL A;  1HA6 A;  1TWA H;  3T1H L;  3HOX B;  1LTI D;  1HZC A;  1SYG A;  2F3V A;  1IKM A;  2FFK B;  1JOO A;  1SEB D;  4JI5 L;  1YI2 A;  4A3B B;  3VYT A;  4PMC A;  5M5W H;  1S3O A;  4UP8 A;  1HRJ A;  1JWS D;  3GTO H;  1IBM L;  1GD7 A;  4J6H A;  4ME3 A;  1VQ6 A;  5C4X G;  4QCL A;  2F0K A;  5LMN W;  3S1Q B;  3D6C A;  3Q8D A;  4QQB X;  3KLR A;  2JEB I;  1Z7T A;  4QB4 A;  1I4H A;  1OXT A;  4JV5 L;  2EOT A;  5KRU A;  3R8B A;  1PH9 A;  2R7Z G;  2EYP A;  2NUC A;  2VQE Q;  1WCM H;  3MZ5 A;  3F2C A;  1EIH A;  2KHS A;  2Z4I A;  1VQB A;  1SYE A;  2RQX A;  2MO1 A;  5NUC A;  3MWY W;  4ZQ3 A;  2B2V C;  2MFI A;  4DK3 C;  3PSI A;  3CCU A;  3Q0A A;  2B63 B;  1O7I A;  1VQG A;  3HKS A;  1AH9 A;  3PF4 A;  2FHT A;  4XQJ A;  4A3C G;  1X9N A;  2HUG A;  5I4D A;  1GUW A;  4ULL A;  4DV2 Q;  2LMC B;  4KHZ A;  4A3M H;  3G48 A;  1X56 A;  1B44 D;  5C4X B;  4LFC L;  1TS3 A;  1NE3 A;  2F0Q A;  2EJG C;  2M00 A;  2JA7 B;  4FXK C;  3E0E A;  2J0T D;  2IPK D;  3OIP A;  2PQE A;  3UDX A;  4F7X A;  4QIW E;  4UP7 A;  1TWH B;  3NEM A;  2XWB B;  1YNJ C;  2O5I C;  5IGB A;  1Y69 U;  2IX1 A;  3MA2 B;  3SXH A;  2F0M A;  2N55 A;  1V1P A;  1G2T A;  1MJC A;  4DV0 L;  4WRD A;  4A3F H;  3MVV A;  1E3P A;  1KAW A;  2J7Z A;  4B3M Q;  2ZM6 Q;  5LMN Q;  3DEP A;  3X3N A;  4CGY B;  4X3K A;  3G4S A;  1JOQ A;  3IAY A;  1A3V A;  1X3F A;  2WB1 B;  1I3Q H;  2KED A;  2E2H B;  1VF7 A;  2KEE A;  3S14 B;  1SNQ A;  3SGI A;  4QJF A;  4ZK9 B;  3W1B A;  3VR3 A;  1I94 L;  2CVR A;  1YJN A;  5IWA L;  3EFX D;  1VQN A;  3RR5 A;  4JOI A;  4NXN L;  4DN4 M;  4L63 B;  5JJK A;  3VA7 A;  5IYD H;  5CR3 A;  5LMN L;  2WIN B;  1G2S A;  5A35 A;  1Q12 A;  4LF5 L;  3KK7 A;  4FF3 A;  4LFA L;  1NTG A;  2CKZ B;  3FP9 A;  2UU9 L;  2JA5 G;  5EGT A;  4FF1 A;  2PNR C;  1N9W A;  5IIF A;  2NTT A;  1OXV A;  1SFO B;  4O0A A;  3V05 A;  4L5R C;  1NY4 A;  3GTQ H;  1AW7 A;  1BBX C;  1ENF A;  1SRU A;  2VZA A;  3C1F A;  2J4X A;  1F2L A;  4LWC A;  3VA5 A;  4BXX H;  1ENA A;  1TWA B;  4K2L A;  2UXC Q;  3FPU B;  3HOX H;  2QEJ C;  3FHW A;  2L9H A;  4KHV A;  4IO9 A;  1IBK L;  3NBI A;  3K58 A;  1EQT A;  5KEE A;  3WOF A;  2N8N A;  4K5W A;  4DNR B;  5M5W B;  1WVL A;  5F2D A;  5C0X J;  1CKO A;  2A6E D;  1WCM G;  3GTO B;  3I3C A;  4MHE A;  1GUG A;  5IOD A;  4ZKB B;  1EWC A;  3NTI A;  3R93 A;  1XTD A;  4GN5 A;  4WJ4 A;  4KTA A;  3HOW G;  2HCI A;  5C3X A;  2HIV A;  4P72 A;  3NP8 A;  2IX3 A;  1ONL A;  2ZTD A;  1F9Q A;  3HOY G;  1XMQ L;  3WOE A;  1I6H B;  2A69 D;  3CHB D;  3WWV A;  3NTH A;  1WCM B;  3J7A V;  1A2U A;  3CC2 A;  2VXW A;  1H9S B;  2EDG A;  1NAP A;  1ILQ A;  5C5L A;  1EIY B;  4QUF A;  2SNM A;  4XT3 B;  1LT6 D;  1PMR A;  2M2L A;  2MPM A;  3NBH A;  2B63 H;  5FK9 C;  4IFD H;  1SNO A;  1B70 B;  2K7V A;  1X3E A;  4A93 H;  4BBR H;  3H15 A;  2K50 A;  1Z47 A;  2RDF A;  2AUJ D;  3I4M B;  4X3U A;  4C3J H;  4YY3 Q;  2F0E A;  1FVI A;  5C4X H;  1IYV A;  2YYZ A;  1QNU A;  1Q1E A;  4DUY Q;  2E74 C;  4X3S A;  2L55 A;  1J9O A;  3VR5 A;  2ICI A;  4DNI A;  2UU9 Q;  3K80 C;  4JI1 L;  3K81 C;  1GUO A;  3NSW A;  1DGS A;  4CKB A;  5FLX E;  1JC7 A;  4DV3 L;  1RD9 D;  2AWO A;  4LUO A;  3IKJ A;  2PPB C;  2PNH A;  3J7Y W;  2ZXR A;  3D4D A;  5J3B A;  5M3F G;  1KC8 C;  2UUC L;  3BG3 A;  3W1G A;  4IQZ A;  1C48 A;  5EJW A;  5CV8 A;  2B39 A;  4F8M A;  5JOB A;  3K57 A;  1B9M A;  2E2H H;  2CQA A;  1HFN A;  1CHP D;  5JAV A;  5IP7 H;  3GTL H;  4DR6 Q;  1BOS A;  1EQV A;  4CKE A;  2KHI A;  3A8I E;  5IYD G;  1GKH A;  1FNV A;  1KAA A;  5IT9 E;  1TR5 A;  2VY3 A;  5ELO A;  2F0W A;  2KEC A;  2QKI C;  3T51 B;  2HHH Q;  2MHV A;  4BBS G;  1XNQ Q;  3PUW A;  1ZYR C;  1JB7 A;  2SNS A;  2I0Q A;  1PFN A;  3J80 L;  5M5Y B;  1XTC D;  4R8I A;  1CTM A;  2K03 A;  4FNF A;  1GUS A;  3CME A;  3GO5 A;  1R4Q B;  4BS9 A;  3I8Z A;  3NBH B;  4A93 G;  2R7Z B;  1N36 Q;  5BN5 A;  4DR2 L;  3G7L A;  1BCP F;  2WKC A;  4KJN A;  1M8A A;  5LL6 X;  4DAV A;  1YNX A;  2CCZ A;  2X6G A;  2OCE A;  2KCT A;  1KTK A;  4IUT A;  5CV7 A;  3TP7 A;  4CDD C;  1RL2 A;  1WFQ A;  3J80 i;  2BH2 A;  1F9P A;  1N33 Q;  1D5M C;  4RGM A;  1QCB D;  2PI2 E;  4POG A;  2PZU A;  5C4Z A;  4J8Q A;  3K5N A;  3GDE A;  3T1Y Q;  4C3H G;  4DF7 A;  4XDX A;  1PLF A;  4PMB A;  5JEA G;  1HH2 P;  4LUZ A;  1EIG A;  4P73 A;  4R1J A;  1M4V A;  1I6H H;  1PYS B;  2XRS D;  1IW7 C;  5FOB B;  1JJG A;  3X3M A;  2M9V A;  4B9W A;  1YZ6 A;  2K5W A;  3H94 A;  4R4O A;  2K14 A;  1DCZ A;  1SN8 A;  1DM0 B;  1UE7 A;  3CC4 A;  1XPU A;  4RKB A;  4A93 B;  4BBR B;  3P20 A;  2MNA A;  1XYI A;  3D31 A;  3BDC A;  1VDZ A;  4C3H B;  3I4M H;  3U9S A;  4C3J B;  2K05 A;  2KHJ A;  4XTC S;  5G3L F;  1HHV A;  4FYD A;  2GA4 B;  2HCC A;  1BO0 A;  2NVT H;  2AKW B;  4XYO A;  1M90 C;  4O1N A;  1T9H A;  2FIN B;  2VL6 A;  1S40 A;  4A3G G;  4QY7 A;  2ID0 A;  4RH6 A;  3K8A A;  3KF8 A;  1L1O B;  1G6Z A;  5KND A;  4HTH A;  3S9W A;  1EY0 A;  4HMJ A;  4JI0 L;  3AYH B;  1YIT A;  1S5B D;  2A5H A;  2NZO A;  2F3I A;  3A55 A;  3JC6 6;  1VQ9 A;  2K28 A;  1HR0 Q;  5DNF A;  4JCV E;  4DK0 A;  2A68 C;  1E2W A;  2AUK A;  5GAH C;  1ICW A;  3GTL B;  1NSN S;  1K73 C;  1K3B C;  3R3O A;  3M3Y H;  4N8X 1; 
#chains in the Genus database with same CATH homology
 2RVL A;  4NP5 A;  4F87 A;  5IT9 L;  2BCO A;  4HSV A;  5JEA J;  1T5E A;  3MXP A;  3SK8 A;  4LMQ D;  2DY8 A;  1IYU A;  2A74 C;  4FF4 A;  2B2U C;  4ID6 A;  3GV3 A;  1GJX A;  4HCE A;  1V43 A;  1LAC A;  2EY2 A;  3AMU A;  4KI0 A;  5FLX L;  2K01 A;  2L12 A;  3JAM E;  5ELD A;  4QIW B;  4XQN A;  1PDQ A;  1LTR D;  3M7G A;  5T1G A;  3GTM B;  4IFD J;  5JEA H;  3SK5 A;  3BDO A;  1S5C D;  3HGB A;  3U9O A;  2O4X A;  4DGZ A;  1DOL A;  2F0I A;  1FNU A;  1VMP A;  1IW7 D;  1B1Z A;  4FVM A;  4LJZ C;  2JP1 A;  3T4A C;  5D65 A;  3IFD A;  2F0V A;  5A2Q L;  4PMW A;  1JB3 A;  1YNN D;  2L4N A;  3ONA B;  3CRL C;  4IZ8 A;  2NVT B;  1F2Z A;  1CA5 A;  1BXT A;  1DON A;  3L9A X;  1LT5 D;  1TKW B;  2H4O A;  3RUZ A;  1STE A;  3R2T A;  5C5M A;  4X3T A;  5JVG 3;  3KUP A;  3M3Y B;  1AN8 A;  1TQO A;  4ZUI A;  1PZI D;  5IOC A;  5D14 A;  4ZUJ A;  4BA1 I;  2BA1 A;  5KNB A;  1U9R A;  4RAU C;  4NKL A;  2H1E A;  1LLR D;  1K8M A;  3DWA A;  5C3W A;  2O5J C;  4IUN A;  2PCF B;  1KDC A;  2PO4 A;  4UAI A;  1PTO C;  2E75 C;  3DWP A;  2A6H D;  2AQ1 B;  5EKK A;  1PTO F;  4OIJ A;  3OMG A;  2PZT A;  3IFT A;  1E2V A;  3BVM A;  4PNY A;  3NPP A;  1S5D D;  1I4G A;  4DK1 A;  1FYC A;  4KJO A;  4KY6 A;  1ENC A;  3S16 B;  1SNM A;  1SDF A;  1LAB A;  2BOS A;  5J39 A;  4RGT A;  2B2V A;  3Q24 A;  5KGU A;  3T53 B;  2K33 A;  1TT2 A;  2R6G A;  2K04 A;  3Q6S A;  3I70 A;  4H44 C;  1HQR D;  3TME A;  4L8J A;  1KNA A;  1UEA B;  2N88 A;  1D1K A;  5CMD A;  3OMC A;  3V96 A;  1SYD A;  3MFY A;  4K8J A;  2IWH A;  1DYQ A;  5K36 H;  3MEH A;  4A3G B;  2G9H D;  1QG7 A;  2BDN A;  3K5O A;  2V4D A;  1TS5 A;  2QCP X;  2SEB D;  3C2P A;  1QWY A;  5I6Y A;  4RA8 A;  4CJ2 C;  3NQI A;  1G8Z D;  3KLS X;  5BN4 A;  1SBB B;  4ZYS A;  1LO5 D;  1K8O A;  4TKO B;  3G6J B;  1CHQ D;  3TP6 A;  3MAQ A;  3HS0 C;  1X3Q A;  2XVS A;  1Y1W B;  2IL8 A;  3C3L A;  3LX0 A;  2RDG A;  3RD4 A;  5KNC A;  1CA6 A;  1PRT B;  3VR6 A;  1EFI D;  2E2D C;  1U4R A;  1A6X A;  3P1H A;  5TSS A;  2L0C A;  5CV5 A;  2NVY B;  1KNE A;  1LTA D;  2K1B A;  2R3Z A;  3DWQ A;  1LT4 D;  3AB9 A;  1AZQ A;  4GZY C;  4MIU A;  4KKS A;  2D5D A;  4V19 0;  3E0J A;  2VB2 X;  3A8J E;  2VUM B;  1PRT F;  3I91 A;  3C1E A;  1WTW A;  5D3I B;  2K5Q A;  3HOZ B;  4BA2 I;  4IUR A;  1IHZ A;  3MXG A;  4A3I B;  4WOR A;  2DY7 A;  2NZ1 D;  3BYY B;  1LV9 A;  4DFA A;  1A3T A;  1LTB D;  4OO1 I;  2B2U A;  3HP3 A;  2G9D A;  3GQB A;  4RFB A;  3FEW X;  1FGB D;  1SNC A;  3S1M B;  1EYC A;  1AEX A;  3EJI A;  3Q22 A;  5COR A;  3RZD B;  1EU3 A;  2KJX A;  2EYH A;  1LTS D;  1TWG B;  1ESR A;  3BS1 A;  4L6T B;  5K36 G;  2EE1 A;  1ET6 A;  5HUR A;  4KMU C;  1U4P A;  1JOR A;  3H09 A;  2IX0 A;  3TSS A;  4RCN A;  2EYJ A;  1PYW D;  1LT3 D;  1ESF A;  3LWU A;  5IGF A;  5EBD A;  3S2D B;  1EU4 A;  1MGS A;  3CU7 A;  4S3S A;  3TP5 A;  3QIA A;  1FR3 A;  5I9O A;  4A3J B;  3BVZ A;  3S17 B;  3S1N B;  3TBI B;  1I4Q A;  4EVO A;  1AP0 A;  5IGD A;  3M85 A;  2HDL A;  4TQU S;  1C8C A;  1MSG A;  3N6R A;  3OW7 A;  1WTX A;  5A2Q E;  4I7Z C;  1EYA A;  4ABN A;  1Q8I A;  3A8K E;  3QB3 A;  1B2T A;  1I4X A;  1RKN A;  3HOY B;  1GHJ A;  4H0L C;  4DA2 A;  4WFN 3;  3TZD A;  2A6E C;  2LKV A;  2BE5 D;  4DAY A;  1B50 A;  1DXM A;  4ZKC B;  1H9S A;  5ELB A;  5EBC A;  4KY5 A;  4RHR A;  3SR1 A;  2HDM A;  3H91 A;  3T13 A;  4UDU C;  1LTT D;  2NN6 G;  2OT2 A;  3GP7 A;  3M7N A;  4QMG A;  4CKC A;  4QF4 A;  5EKL A;  2PW7 A;  2BE5 C;  1EY6 A;  2FMC A;  5DM6 3;  1BF4 A;  5ELC A;  2L11 A;  3OWE B;  3OWF A;  2JA5 B;  3PUV A;  3BZD B;  1EEF D;  3I72 A;  1CZG A;  2PW5 A;  3V2T A;  3L3O C;  4EQO A;  3K5L A;  3SDZ A;  4EQN A;  1BCP B;  2A73 B;  5BN3 A;  5FKA C;  5KIX A;  1JWU D;  5CC4 A;  3SK6 A;  2DNC A;  2EYL A;  1NCV A;  3DXJ C;  5C0X H;  1F77 A;  3DMU A;  1J8I A;  4HCS A;  4FP5 D;  5CYU A;  1Y1V B;  1XWE A;  3OOC A;  3J7A F;  2NVQ B;  3E6Z X;  5CGK A;  4KN7 C;  1D1I A;  1STB A;  2LS0 1;  2B2W C;  1SYB A;  2AQ2 B;  3NUC A;  5FO7 B;  1Q3L A;  1SJH D;  3A54 A;  2F1M A;  3K0Y A;  2WII B;  1I4P A;  1XXG A;  5M5X B;  4KKT A;  1II3 A;  4LAA A;  3S15 B;  1MBY A;  4HR7 B;  5I2Y A;  3PMF A;  4JBW A;  1CFM A;  1EY8 A;  1SSO A;  1HXY D;  4ODG A;  3WDN A;  4KK7 A;  1O7Y A;  1JE4 A;  3D6W A;  1A2T A;  1G91 A;  1R4P B;  5C4H A;  4WJW A;  4M8A A;  1D5X C;  3R2I A;  1WTV A;  1R9T B;  1TWC B;  2NVX B;  2XWJ B;  4YIJ A;  1C4Q A;  5CBA E;  1GOZ A;  1QNK A;  4DU9 A;  2NB0 A;  2E2I B;  2B2Y A;  3M4O B;  5M3F B;  2F0T A;  3HG9 A;  2MJ8 A;  3NHH A;  1F2Y A;  1SE2 A;  3HKZ B;  1B9N A;  2F4I A;  4IFD I;  1U4M A;  4XIG S;  1TII D;  1BCP C;  2R92 B;  4H7B A;  4RGO S;  2NBF A;  3MTS A;  5KYL A;  2WKD A;  1B3A A;  2D62 A;  4KD4 A;  1WTQ A;  2F0F A;  3DUZ A;  4CJ1 B;  3IL8 A;  1AFP A;  1A3U A;  2I07 B;  4G4K A;  2C5C A;  3GD7 A;  3OHX C;  1Y8P B;  1EYD A;  2F03 A;  2NN6 I;  3VR2 A;  1JCK B;  1SMY D;  1QB5 D;  1WD0 A;  3K5M A;  4DAP A;  5K5P A;  4J1M A;  2Z8L A;  5IGG A;  5D3D A;  4C56 C;  2JA6 B;  4IN3 A;  5C44 B;  1VF5 C;  4OGQ C;  3OPO A;  2BA0 A;  4PQX A;  3I4L A;  3NQT A;  2B8G A;  1S5E D;  4C1N K;  1WTR A;  3PO3 B;  1NR2 A;  1Z6H A;  1EY4 A;  4U68 A;  2B2T A;  1YNJ D;  4FO2 A;  3EQL C;  1EZ8 A;  1F9R A;  1TY2 A;  3DHQ A;  5I6W A;  1K83 B;  2KCC A;  4R9W A;  2I46 A;  1VCI A;  3H6M A;  3SEB A;  3K59 A;  1D5Z C;  2QF7 A;  2Q8I B;  2EYO A;  1HFG A;  1XX8 A;  2B2W A;  3QWN A;  2NYZ D;  2F0G A;  3J80 E;  3A7L A;  1DJR D;  1STN A;  5JPM C;  4K2K A;  3MFG A;  1TVX A;  4I65 A;  1JOK A;  1BUV T;  2RKS A;  4HAE A;  3URY A;  5AFW A;  3VYS A;  2ZXO A;  2FJ2 A;  2F0L A;  4C3J G;  1UUP A;  2E76 C;  3FKI B;  1SJE D;  1OXS C;  1EWH A;  3TP8 A;  2B2Y C;  3T56 B;  2BDO A;  3EVQ A;  1KAB A;  1MSH A;  2Q8T A;  2K32 A;  3ITP A;  2IT1 A;  3PUY A;  2XN9 C;  2F0P A;  4C2M B;  4CBV A;  1YNN C;  2XSC A;  4IUP A;  2TSS A;  2EYF A;  2JE6 I;  2JSO A;  4K6L A;  1EEI D;  3NTK A;  3C46 A;  4G7Z C;  5FO9 B;  5IGE A;  2CW0 C;  2F3W A;  4A3K B;  2KCN A;  1E0B A;  1EL0 A;  2VB3 X;  5CV9 A;  1GUT A;  4C1N I;  5LL6 S;  3I90 A;  1V1P B;  2LY7 A;  3A7A B;  3GTG B;  4AYB B;  4Q5V A;  2OEO A;  1ZKO A;  2WV6 D;  3W2D A;  3O13 A;  4KD3 A;  1KDA A;  3ND9 A;  4M1U B;  3SE0 A;  2F0S A;  3PV0 A;  4C3I G;  1WTP A;  1WD1 A;  3K6O A;  3QOL A;  2EY6 A;  2QIL A;  2D2C C;  5J1Z A;  5DM7 3;  1EY5 A;  4OO1 H;  5I9P A;  3NWT A;  1RTN A;  1QJO A;  1HUN A;  2A68 D;  5T1I A;  3W3A A;  4B9X A;  3QG1 A;  1D2B A;  4OL7 A;  1ET9 A;  3J81 E;  3TDQ A;  2A6H C;  4C3I B;  5FO8 B;  4DXG A;  4IUV A;  3ND8 A;  2X69 A;  1TS4 A;  4OO1 G;  3KBX A;  4G57 A;  4N9T A;  3GTK B;  1OXU A;  5C4J B;  1HUM A;  4ZLT F;  4A3D B;  5DAU A;  3NE5 B;  3A56 A;  1GUN A;  1I50 B;  1TU2 B;  1TWF B;  2LFN A;  3RLF A;  1RF2 D;  1PZK D;  1CI3 M;  2TMP A;  2B8F A;  3D4W A;  4BY7 B;  3S2H B;  2CHB D;  2PYK A;  5E1F A;  4N9P A;  3GTJ B;  3BDL A;  2Y0S B;  4DNT B;  4XT1 B;  2AWN A;  1FD7 D;  4RHS A;  3T16 A;  1W6J A;  3I4N B;  2R61 A;  3P75 A;  5LHY 1;  2OXP A;  3MXU A;  4NDX A;  4FF2 A;  1GXD C;  3HRZ C;  2ICE C;  5ISR A;  2MUY A;  3N52 A;  1JQY D;  2CW0 D;  1V8Q A;  4XXE A;  1KLU D;  5M3M B;  4IFD G;  2F0U A;  1VMC A;  2NWG A;  2YU9 B;  3FMC A;  1ROD A;  5EPJ A;  2SOB A;  1H9R A;  1BNZ A;  5IGC A;  1Y8N B;  3QOJ A;  3TN2 A;  1TY0 A;  3ERQ A;  4CJ0 B;  4P2C B;  1E2Z A;  2E2J B;  1PTO B;  1DD2 A;  1Q1B A;  1HQM C;  1HA5 A;  1SND A;  4HED A;  3D8G A;  1PZJ D;  3ERO A;  4Q0F A;  3FRP B;  2IJ0 A;  3HZX A;  5M9O A;  1ZEQ X;  3QJY A;  3NXW A;  1H9M A;  1WTO A;  2NTS A;  2X6L A;  2RBM A;  3AU7 A;  1JIC A;  3MHB A;  2MGS A;  3VYR A;  2IW3 A;  3FDT A;  2Q8R E;  1X32 A;  1CT1 D;  3J81 L;  1O78 A;  3HOU B;  5EPL A;  1X3P A;  4IUU A;  3E5S A;  4KKU A;  3DEO A;  2HQE A;  5J22 A;  1CM9 A;  3HEJ A;  3K7A B;  1EOT A;  2EZV A;  1D6E C;  4V0B A;  1Q90 A;  2EPB A;  4K5V A;  1MI2 A;  1EY9 A;  4K6D A;  1TS2 A;  1O7L A;  3CQZ B;  3UI2 A;  1HTP A;  1O80 A;  1SMY C;  5JPN C;  3MXN A;  3LNN A;  5EKI A;  2OF1 A;  3PO2 B;  4EGV A;  5EQ0 A;  2EXZ A;  4A3E B;  2Z1C A;  1OO9 B;  4K5X A;  4ZRZ A;  3GTP B;  3PUZ A;  2RSN A;  1HTL D;  4ME5 A;  1NR4 A;  2O2L D;  3H3V C;  4E6I A;  3OSO A;  4QUC A;  2EY1 A;  2Z4H A;  1STH A;  3P7J A;  5E3F A;  4OHJ A;  3TZU A;  1I6V C;  1PXU A;  1EZ6 A;  2RA4 A;  3VR4 A;  2KOL A;  4PV1 C;  1F2M A;  4Y7N B;  1L0X B;  1SYC A;  2EY5 A;  2QDB A;  1PTO H;  4RGN A;  3RMH A;  4LK1 C;  1H9J A;  2F0O A;  5E4W C;  1ZYR D;  1EY7 A;  1DZ1 A;  1HCZ A;  3MC0 B;  4HSP A;  1B53 A;  4ZAI A;  2DNE A;  2F0D A;  4IUQ A;  3FPP A;  1GHK A;  1BCP D;  4KY7 A;  2RDH A;  1HPC A;  2ENB A;  3BYT B;  3CRK C;  1STG A;  2MP1 A;  2WAC A;  5E4X A;  3F2U A;  5I2X A;  1RHP A;  4G7O C;  4FXD A;  4KV6 A;  3I73 A;  3FVQ A;  2C9O A;  1S4Z A;  3H0G B;  4RKL A;  1QE6 A;  1RCV D;  2RSO A;  3CKI B;  5EPK A;  4NW2 A;  3JAM L;  4B08 A;  1SNP A;  4CHT B;  1PFM A;  3QO2 A;  3PIO 3;  3SVM A;  1CZW A;  1CK1 A;  1PRT C;  2L1B A;  1PRT D;  2F0H A;  3NK9 A;  2JA8 B;  2VNU D;  2KA7 A;  1L0Y B;  4FXG C;  3PIP 3;  5CV6 A;  5G3L D;  1UNS A;  4Z9C B;  4BY1 B;  4G7H C;  3RZO B;  1B4O A;  1V1O A;  4JK1 C;  1W6K A;  2XIW A;  1BR9 A;  1STY A;  4O42 A;  5C3E B;  4BBS B;  1SYF A;  3M4Y A;  1QOH A;  2R93 B;  4RWS C;  5CBE E;  3LWE A;  3L7Z C;  4BWG B;  5CV4 A;  4F88 A;  3DM1 A;  1BQQ T;  2WAQ B;  1FNW A;  3D3R A;  3HOW B;  1G29 1;  2KQ3 A;  3VYU A;  3NWS A;  1Y8O B;  3OIQ A;  1IL8 A;  4EQP A;  1KDB A;  4NMZ A;  1PTO D;  2L5T A;  1DOM A;  2PZW A;  4RCO A;  2AQ3 B;  1SE3 A;  3GV6 A;  5DEH A;  5ELE A;  1I4R A;  1SE4 A;  4K14 A;  4XQQ A;  4U67 3;  1RTO A;  1ML0 D;  2JEA I;  1A15 A;  2JXM B;  1ZXT A;  1CQV A;  2FMM A;  2NN6 H;  2D9U A;  5JVH 3;  2KVM A;  1LTG D;  4DXF A;  4HN7 A;  4TSS A;  3S1R B;  5COY A;  1SAP A;  2F0J A;  4ILW A;  1KLG D;  1O7Z A;  1IKL A;  2ZT9 C;  4A3M B;  1RDP D;  1MD2 D;  2XRQ D;  4MN3 A;  1NUC A;  5C6A A;  1H9K A;  3D4R A;  2JYO A;  2PMZ B;  2SDF A;  4IAL A;  4K8I A;  5JJZ A;  4XYQ A;  4KN4 C;  4A3F B;  1PFB A;  1UAP A;  3PUX A;  1QIL A;  5C0X G;  1BDO A;  5KYI A;  1F9S A;  2K6A A;  2F0N A;  4TRD A;  3HOV B;  1I3Q B;  5HGT A;  2EJF C;  1ILP A;  4R8N A;  5ELF A;  1STA A;  5C0X I;  2A69 C;  1S5F D;  3KBG A;  1RJT A;  1JR0 D;  1U4L A;  4OIK A;  1JWM D;  1CQF A;  2B2T C;  3KLS A;  3Q23 A;  2WP8 J;  4HMI A;  1SXT A;  2DN8 A;  3EA6 A;  1AZP A;  1OXX K;  2EJM A;  1DOK A;  3GTQ B;  2EVB A;  1T5X D;  2XNA C;  2K5D A;  2ZXP A;  3SK4 A;  3ZYY X;  2KUM A;  2EYM A;  3BVG A;  3SHL A;  1HA6 A;  3HOX B;  1LTI D;  2F3V A;  1SYG A;  1IKM A;  2FFK B;  1JOO A;  1SEB D;  4A3B B;  3VYT A;  4PMC A;  1HRJ A;  1JWS D;  4J6H A;  4QCL A;  2F0K A;  3S1Q B;  3D6C A;  3KLR A;  2JEB I;  1Z7T A;  4QB4 A;  1I4H A;  1OXT A;  2EOT A;  5KRU A;  3R8B A;  2EYP A;  2NUC A;  3MZ5 A;  1EIH A;  2KHS A;  2Z4I A;  1SYE A;  2RQX A;  5NUC A;  3MWY W;  4ZQ3 A;  2B2V C;  3Q0A A;  2B63 B;  2FHT A;  4XQJ A;  2HUG A;  5I4D A;  1GUW A;  4ULL A;  2LMC B;  4KHZ A;  1B44 D;  5C4X B;  1TS3 A;  2F0Q A;  2EJG C;  2M00 A;  2JA7 B;  4FXK C;  2J0T D;  2IPK D;  3OIP A;  2PQE A;  4F7X A;  1TWH B;  2XWB B;  1YNJ C;  2O5I C;  5IGB A;  1Y69 U;  2IX1 A;  3MA2 B;  3SXH A;  2F0M A;  2N55 A;  1V1P A;  1G2T A;  4WRD A;  3MVV A;  2J7Z A;  3DEP A;  3X3N A;  4CGY B;  4X3K A;  1JOQ A;  3IAY A;  1A3V A;  2WB1 B;  2KED A;  2E2H B;  1VF7 A;  2KEE A;  3S14 B;  1SNQ A;  4ZK9 B;  3VR3 A;  2CVR A;  3EFX D;  4DN4 M;  4L63 B;  3VA7 A;  5CR3 A;  2WIN B;  1G2S A;  5A35 A;  1Q12 A;  4FF3 A;  3KK7 A;  5EGT A;  4FF1 A;  2PNR C;  5IIF A;  2NTT A;  1OXV A;  1SFO B;  3V05 A;  1AW7 A;  1BBX C;  1ENF A;  3C1F A;  2J4X A;  1F2L A;  3VA5 A;  1ENA A;  1TWA B;  4K2L A;  3FPU B;  2QEJ C;  2L9H A;  4KHV A;  3NBI A;  3K58 A;  1EQT A;  5KEE A;  3WOF A;  4K5W A;  4DNR B;  5M5W B;  1WVL A;  5F2D A;  5C0X J;  2A6E D;  3GTO B;  3I3C A;  4MHE A;  1GUG A;  5IOD A;  4ZKB B;  1EWC A;  3NTI A;  3R93 A;  4KTA A;  2HCI A;  5C3X A;  3NP8 A;  2IX3 A;  1ONL A;  1F9Q A;  3WOE A;  1I6H B;  2A69 D;  3CHB D;  3NTH A;  1WCM B;  3J7A V;  1A2U A;  2VXW A;  1H9S B;  2EDG A;  1NAP A;  1ILQ A;  5C5L A;  4QUF A;  2SNM A;  4XT3 B;  1LT6 D;  1PMR A;  2M2L A;  2MPM A;  3NBH A;  4IFD H;  5FK9 C;  1SNO A;  2K7V A;  1Z47 A;  2RDF A;  2AUJ D;  3I4M B;  4X3U A;  2F0E A;  1IYV A;  2YYZ A;  1QNU A;  1Q1E A;  2E74 C;  4X3S A;  2L55 A;  1J9O A;  3VR5 A;  2ICI A;  1GUO A;  3NSW A;  4CKB A;  5FLX E;  1JC7 A;  1RD9 D;  2AWO A;  3IKJ A;  2PPB C;  3J7Y W;  2ZXR A;  3D4D A;  3BG3 A;  4IQZ A;  1C48 A;  5EJW A;  5CV8 A;  2B39 A;  4F8M A;  5JOB A;  3K57 A;  1B9M A;  2CQA A;  1HFN A;  1CHP D;  5JAV A;  1BOS A;  1EQV A;  4CKE A;  3A8I E;  1FNV A;  1KAA A;  5IT9 E;  1TR5 A;  2F0W A;  2KEC A;  2QKI C;  3T51 B;  2MHV A;  3PUW A;  1ZYR C;  2SNS A;  1PFN A;  3J80 L;  5M5Y B;  1XTC D;  4R8I A;  1CTM A;  2K03 A;  4FNF A;  1GUS A;  3GO5 A;  1R4Q B;  4BS9 A;  3I8Z A;  2R7Z B;  5BN5 A;  3G7L A;  1BCP F;  2WKC A;  4KJN A;  1M8A A;  5LL6 X;  4DAV A;  2X6G A;  1KTK A;  4IUT A;  5CV7 A;  3TP7 A;  1F9P A;  1D5M C;  4RGM A;  1QCB D;  5C4Z A;  2PZU A;  3K5N A;  4J8Q A;  4C3H G;  4DF7 A;  4XDX A;  1PLF A;  4PMB A;  5JEA G;  1EIG A;  1M4V A;  2XRS D;  1IW7 C;  5FOB B;  3X3M A;  2M9V A;  4B9W A;  2K5W A;  3H94 A;  1DCZ A;  1DM0 B;  4RKB A;  4A93 B;  4BBR B;  3P20 A;  1XYI A;  3D31 A;  3BDC A;  1VDZ A;  4C3H B;  3U9S A;  4C3J B;  2K05 A;  4XTC S;  5G3L F;  1HHV A;  4FYD A;  2GA4 B;  2HCC A;  1BO0 A;  4XYO A;  4O1N A;  2FIN B;  2ID0 A;  4RH6 A;  3KF8 A;  1G6Z A;  5KND A;  4HTH A;  3S9W A;  1EY0 A;  4HMJ A;  1S5B D;  2A5H A;  3A55 A;  2K28 A;  5DNF A;  4DK0 A;  2A68 C;  1E2W A;  2AUK A;  1ICW A;  3GTL B;  1NSN S;  3R3O A;  4H13 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...