5C3WA

Crystal structure of staphylococcal nuclease variant delta+phs v66h at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMHENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS V66H at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5c3wA00
2PW7A 3NHHA 1A2TA 2SOBA 4ZQ3A 4EQNA 4N9PA 1A2UA 2RBMA 1STNA 2F0NA 3ITPA 3MHBA 2F0VA 4K2LA 2F0SA 5CV8A 5CR3A 2F0WA 2M00A 1RKNA 3LX0A 3QOLA 2F0LA 3OMGA 2NUCA 1NSNS 2EY1A 4KTAA 1STHA 4OL7A 5IGEA 2OF1A 4QF4A 1EYCA 5DAUA 5KGUA 4IZ8A 4LAAA 1F2ZA 2PW5A 3MZ5A 5HURA 1EY0A 3S9WA 3BDCA 4F7XA 4RKLA 3P75A 2F0OA 2PQEA 1EY5A 3EROA 4WRDA 3TP6A 3H6MA 5EGTA 3U9OA 4DU9A 4EVOA 2F0PA 5C6AA 5J39A 3DMUA 2EYFA 5KEEA 5KYLA 4YIJA 3SR1A 1EZ6A 1II3A 1STGA 5CV7A 2WACA 5KYIA 4K5VA 3ERQA 1JOKA 5NUCA 5KRUA 4PNYA 3SHLA 1EYDA 5K5PA 3NQTA 3SK8A 4K14A 2F0UA 3OMCA 2KHSA 1EY9A 2EY5A 2PYKA 4H7BA 4ZUIA 3RUZA 4F8MA 3HEJA 1KABA 1NUCA 3QB3A 5J1ZA 3HZXA 2PZUA 3SK6A 4QB4A 1AEXA 4EQPA 3D4DA 1TT2A 3TP8A 3TMEA 1STBA 1EY7A 5C3XA 3V2TA 5I6YA 3BDLA 3OWFA 4DGZA 5JAVA 1KDAA 5CGKA 5IGDA 2F3WA 2F0HA 2OEOA 3D4WA 1STAA 2SNSA 4E6IA 5IGGA 1EY8A 4K5WA 4K6DA 3MEHA 4K5XA 4KY6A 1SYEA 3DHQA 4QMGA 1ENCA 5IOCA 1SNQA 3EVQA 5I9OA 2F0TA 4KD3A 2RDFA 3TP7A 4ID6A 5C3WA 4WORA 1SNMA 2EYJA 2F0QA 1EQVA 2OXPA 2RKSA 4PMBA 4RKBA 5E1FA 1SYBA 5JOBA 3E5SA 4DF7A 5C4ZA 3NP8A 4NP5A 4IUNA 5C4HA 1EZ8A 5I9PA 4G57A 2EYMA 4KD4A 4J6HA 3VA5A 5J22A 4KJOA 1IHZA 1ENAA 3SK4A 1A3VA 4HMIA 4I65A 5M9OA 5CV6A 2PZWA 2O4XA 2EY6A 5KIXA 5HGTA 1A3UA 4ODGA 3P1HA 5IODA 3PMFA 4K2KA 1SNCA 2F0GA 3QOJA 2KQ3A 3SXHA 1JORA 2F0JA 1SYDA 1SYFA 2QDBA 3C1EA 3D8GA 1JOOA 4NKLA 2SNMA 3OSOA 5CC4A 4EQOA 2F3VA 5I6WA 4ME5A 1SNOA 2F0FA 4MIUA 4N9TA 5IGCA 1JOQA 1SNDA 3NUCA 1KAAA 5DEHA 4KY7A 4R8NA 5CV9A 3SK5A 4KV6A 1F2MA 1KDCA 2EYLA 3C1FA 4ZUJA 1KDBA 1EYAA 1SYCA 5ISRA 2ENBA 5EKLA 2EY2A 1TR5A 2EYOA 2F0DA 3NXWA 5EKKA 5C5LA 1EY4A 2F0EA 3T13A 5CV5A 1TQOA 4S3SA 4B9XA 4B9WA 1EY6A 4NDXA 3MXPA 5E3FA 5C5MA 4PMCA 3R3OA 2PZTA 1A3TA 1SNPA 4KJNA 3TP5A 3MVVA 4KHVA 4NMZA 4K8IA 1STYA 2EYPA 3NK9A 4HTHA 5IGFA 5IGBA 1U9RA 5F2DA 1SYGA 2F0KA 5IIFA 2HQEA 4HMJA 2LKVA 4DFAA 4TRDA 2F0IA 4K8JA 4KY5A 3T16A 3EJIA 2EYHA 2EXZA 4J1MA 3D6CA 2F0MA 1F2YA 5CV4A 4IALA
chains in the Genus database with same CATH superfamily
1EL0A 5C4JH 4GKKQ 2X6LA 2F0VA 1X6OA 4A3DB 3EN2A 4KTAA 3J80i 2LY7A 4O2DA 2RA4A 4DV7Q 4YWKA 3S9WA 4DU9A 1PH7A 2K03A 4BXXH 1N32L 2K5QA 2CQOA 3C46A 1YHQA 4JI1L 3T56B 2VQEQ 3ERQA 2HUGA 1RHPA 5K5PA 1CQFA 2B63H 1D1IA 1ASZA 3S2DB 1LTLA 2UUCL 1J5EL 4L6TB 3BVGA 2B29A 1KDAA 3S17H 3KFUA 2ID0A 4L5QA 2O5JC 2L4NA 4DR5L 3J80c 4HCSA 1FYCA 4X66L 2ALYB 1OTCA 4LFBQ 4WJ4A 5IYBH 1LUZA 1T9HA 1N34L 4C3IB 3PUXA 3MTSA 5E1FA 3HOUH 4R4TA 4NP5A 3R2IA 1E7ZA 1IHZA 3HKZE 1YEZA 2PZWA 2R92H 1IL2A 5IODA 2XRQD 3GTPB 2CWPA 1ZYRC 4A3GG 4POFA 3H0GG 3MXUA 4A3LH 4EQOA 2I5HA 3Q8DA 4NB3A 3BJUA 5D14A 3R2TA 2C9OA 1JJ2A 1TY0A 2F03A 4R8IA 1E2ZA 1EYAA 2CVRA 4C3JH 4X64L 2EY2A 1TR5A 1B3AA 4DV0Q 1L0YB 5C5LA 1HFNA 2K5VA 5AJ3L 3I73A 1K8MA 4NDXA 4GS3A 4KJNA 2F3IA 4R4IA 3DWAA 2VNUD 1GHJA 1PTOB 1OXUA 1TWHB 1IKLA 2LKVA 1RTOA 2XNAC 4RH6A 2EYHA 4DR3L 1BR9A 2SOBA 4ZQ3A 2ZTEA 1JQYD 4LJZC 2RBMA 4LF5Q 5CV8A 4GLVB 2B63G 2VQFQ 3PIO3 1Y1WH 1F2LA 4QY7A 4RKLA 3P75A 4WJWA 4FF2A 1H9MA 2D9UA 2XWJB 1U4RA 3M3YB 1CKNA 1B4OA 2K50A 1N8RC 4XDXA 3T1HL 3A5ZB 4DV0L 2DGYA 1LV9A 4N8X1 3VYRA 3D31A 1TWGH 1ICWA 4JYAL 2F0UA 1E1OA 3S14B 2IJ0A 3QB3A 1YIJA 4DAYB 2NB0A 1I6VC 3MWYW 4FYDA 2JSOA 1VDZA 3K7AH 1RODA 2NBFA 5I6YA 3S1RB 2F0HA 4DAVA 2CCZA 3HOWG 2Z4HA 1F77A 2K5NA 3J81c 3UDFA 1FVIA 1XTCD 4JCVE 2JA8H 2I5LX 3JAML 1L0WA 4DNRB 2XTIA 5IT9c 3CCQA 4G57A 2EYMA 2NVTB 4KD4A 4HJ7A 1SE4A 5D3IB 1YVCA 1F9SA 5CYUA 1LO5D 5AFWA 1KTKA 2B2TC 1JORA 2WB1B 2ZXOA 1SJED 3ER0A 3UE0A 4IUUA 3U4VA 1XNRQ 1ZYRD 1SMXA 4ME5A 1JOQA 1JC7A 1MSHA 1KAAA 2ZXPA 1E3PA 1SJHD 5GAHC 1YJ9A 3PUYA 2EJMA 3GV3A 1YHBA 3GD7A 4IUPA 4A3CG 1Q81C 3NEMA 2AQ1B 2O5IC 1GUSA 3AU7A 4S3SA 4YCWA 2PZTA 1A3TA 1VQ9A 4BBSB 2A5HA 4JI5Q 1X32A 3ND8A 5IGBA 4QJFA 2K05A 2B2TA 5BR8L 2ASBA 5C4XB 4DK0A 4A93B 2L1BA 3PGZA 2A6HC 1E2WA 4GLAC 2F0LA 1TWGB 1GUTA 2A6EC 1EIYB 1XPUA 5C3EB 1ET9A 3QO2A 2N88A 1FNWA 3BDCA 2HCIA 1BNZA 2F0OA 2K32A 1EIGA 4DXFA 1D2BA 2UXBQ 4CKCA 1XMOL 1K8AC 1V8QA 2EOTA 1NJIC 3A56A 1UE1A 2JA8G 1ZXTA 2B3GA 4L63B 2R93G 1KABA 2PZUA 2LFNA 2E5LL 4C1NI 3CPWA 1PDQA 4CDDC 3BDLA 4DGZA 3PUVA 2RHQB 1PH6A 4JI4L 4GNXB 4FF4A 3DXJC 3CCUA 2XVSA 3GV6A 4MTKA 3PO2G 4KD3A 1I6HH 4JOIA 4A3IB 2UXDQ 1HA6A 2A74C 3MC0B 1CSPA 4PMBA 2R7ZG 3JAMi 1PTOH 4CHTB 1Y1VH 3TSSA 4QUFA 5IY0A 4Y7NH 3PO3G 3RLOA 4RGNA 4RGOS 4HMIA 2UXDL 1T5XD 5FLXE 1GHKA 1WTXA 4Z9CB 4A3BB 5IYCG 1EU4A 4B3TL 3PO2H 1SYFA 3D8GA 3CAMA 2OWOA 5AJ3Q 2OTJA 4RFBA 2WB1G 4M8AA 2R3ZA 5DM73 2YU9B 1HR0Q 3TN2A 2L0CA 2E5LQ 1AP0A 3K5LA 4UY8C 3M3YH 1I5FA 2KA7A 3NTKA 3GTPH 1H9SB 1QG7A 1B8AA 1SSOA 3G48A 4RA8A 2RHSB 3K8AA 2KCCA 2JA5H 1UE7A 4A3FH 3MXPA 1HTLD 3E6ZX 2OT2A 5IIFA 4UHVA 1B53A 1S5FD 5GAGC 1BF4A 5JEAH 2YTVA 3IL8A 3T16A 1SRUA 4QL5A 3RZOH 4KKSA 3KJPA 1ILPA 1A2TA 3ULJA 3L3OC 4N9PA 1HQMC 1PFSA 4HSPA 3S24A 2JA5B 2F0SA 5EKIA 2IX1A 2KOLA 2M00A 2B63B 4AYBB 4OL7A 3QR8A 3WOFA 5I2XA 3Q22A 1EYCA 2BH8A 4QIWB 2OTLA 4O42A 5FKAC 1V1PB 5HY6A 2ICIA 2JA7G 1I3QB 4KN7C 4CJ2C 1D5MC 5KRUA 4RMFA 1SE3A 5M5YH 4JPBW 3GTQB 2Z9HA 5BN5A 3CCRA 1HHVA 4AH6A 3RUZA 4H7BA 1G51A 1PLFA 2HDMA 1AEXA 3TDQA 2MUYA 1TT2A 4DR3Q 5KNBA 1BOSA 4Y7NB 2OQKA 2OEOA 4A3JG 3FDTA 2VB2X 3ULLA 3VYTA 3I56A 2LXJA 4A3BH 1SYEA 3QWNA 2B8GA 2KENA 1PH9A 4JI4Q 3M4OB 4POGA 2IWHA 5IT9L 2L11A 4A93H 3L7ZC 1QZHA 3PSIA 1M8AA 1WJJA 5J3BA 4HJAA 4R9WA 1BDOA 3K81C 1XX8A 3M4PA 4DV3L 2E8GA 1AE2A 2JEBI 1EOTA 1MJEA 2KCTA 2F0GA 3Q0AA 4JVZA 3S1QH 4P2CB 4GN5A 2I46A 4PG3A 3UDXA 4DV5L 1WTWA 1W2BA 5IYCH 4HIOA 3M7GA 1PRTD 3STBC 4YHHQ 3KK7A 3GP7A 2D0PA 1CZWA 4IPCA 1DOKA 4KY7A 1F2MA 2EYLA 1KDBA 2G5DA 3HS0C 5JJZA 4AYBE 2PCFB 4HJ8A 3RMHA 3NXWA 2ZXRA 4HIKA 3AEVA 3F2BA 3VYSA 3UI2A 2ZM6L 1YBYA 4OHJA 4YWLA 3BS1A 3GTOH 1IBLQ 3MVVA 1KQSA 4NXMQ 4C56C 1PV4A 2K5WA 1WTOA 2YYZA 3URYA 1IBLL 2CH4W 4A3LG 1CQVA 4OWXB 1CKNB 3SEBA 1IBMQ 5TSSA 1Y1WG 4YCUA 3FHWA 2B2YC 3J7YW 3SDZA 3S16H 1IBML 2K14A 2ES2A 3GTOB 1NSNS 2R7DA 3KLWA 4PZ7A 4LAAA 3C2PA 4L5RC 1EY0A 2BOSA 2XN9C 3H6MA 4A3JH 2JA5G 1BBUA 1DM0B 1VQFA 1HCZA 1TS3A 2G9DA 2WACA 4FXKC 3CF5A 1PH3A 3GO5A 4BBSG 2HHHL 3S1NB 2H1EA 3IRBA 3K5OA 3LNNA 4ZUIA 5GQOA 3FP9A 1HPCA 4C3HB 2K52A 1V9PA 1MHWC 4A3EB 2Q2TA 1X3GA 2Q8RE 3A54A 3RNUA 4GN4B 4X62L 1FGUA 1STAA 5C3EH 1X3QA 1LT5D 2ZT9C 4JI5L 4XQNA 3TP7A 4ID6A 3N52A 1NAPA 2A8VA 1R9TB 1DGSA 3QG1A 4LUZA 2KEEA 5I9PA 3NP8A 5JVH3 2N55A 2K33A 3HOUB 5K36G 1PH2A 1ENAA 3ZYYX 3GDEA 4KMUC 5IP7G 3D6WA 1BKBA 2EY6A 1FNVA 4IURA 5G3LF 2WAQB 4XTCS 4DNIA 1A0IA 2PO4A 2XIWA 3I3CA 1JOOA 1X56A 4R1JA 2XGTA 1BCPF 1Y1VB 2IPKD 5I6WA 1PFNA 2WFWA 5M3FG 1YITA 2Z6KA 3UDGA 4BY1H 5C0XG 3K80C 5FLMG 1CTMA 5DEHA 4DUZL 3AMUA 4RHRA 3BYTB 4JI6L 1KDCA 5E4WC 1GM5A 1LT6D 5KNDA 4DV4Q 4JI2L 3A7LA 4OO1H 3PO2B 1DXMA 2F0DA 1GUOA 1W6JA 2M2LA 3KLSA 2KHJA 5EKKA 3ULPA 1G6ZA 1CHPD 1JICA 2JA7H 1QILA 1PRTB 1STYA 3NK9A 5IGFA 4C3HG 4BWGB 1SYGA 1H9JA 3WWVA 1CKMA 4CGYB 3RLFA 3EJIA 3OWEB 1O7IA 1M4VA 1Q82C 4FVMA 1C0AA 3AFPA 4EGVA 1UE6A 1G91A 1K3RA 1A2UA 5JVG3 1I50H 1K0RA 4X64Q 3I8ZA 4HN7A 2AKWB 2Z4IA 5C4HA 2RCNA 4IPHA 3S17B 3S1NH 3TRZA 1VQCA 5C3EG 3D0FA 1EEFD 2KCNA 4GZYC 1RL2A 1YNND 2V1CC 1M1KC 3A0JA 2I5MX 1BQQT 1VQ4A 4JI7Q 5KEEA 1YI2A 5KYLA 1PHJA 1H9SA 2Y0SG 3HG9A 1XJVA 5CBAE 1XYIA 4PNYA 3KBGA 2B2WA 1JJCB 2LMCB 2PYKA 2K01A 1OXTA 4LNQA 4AQYL 4C3HH 2NVQH 1OO9B 3G6JB 4CKEA 4YY3L 1C8CA 2F3WA 2Q2IA 1JWUD 3D4WA 3QIAA 2DUDA 1LTID 5C44H 4QMGA 3OYYA 4HR7B 3K58A 5T1IA 5C3WA 4JW0A 4X65Q 2OXPA 1EQVA 4AQYQ 2CH4A 4B3RL 4X65L 2L9HA 3KF8A 3CCJA 2RQXA 1IKMA 4JI6Q 4IOAA 3I2ZA 1KRSA 2G9HD 4FO2A 1HZCA 1TIID 1PTOD 1SYDA 5CC4A 3C1EA 1QNKA 2VZAA 1HNWQ 1SMYC 4G7OC 2A1AA 2SDFA 3S1QB 1SNOA 2M9VA 3H91A 3NUCA 3PO3H 4JI3L 1PYBA 1LTRD 4KV6A 2K7VA 4ZRZA 2BE5D 2JQOA 5M3FH 2A19A 2RVLA 4PV1C 5FLMH 1SFOB 4GKJQ 3TBIB 2HCCA 5CV5A 1H9RA 2BH2A 5EPJA 1KHIA 1LACA 1N34Q 4C1NK 2F52A 3W3AA 1CZGA 4DR4L 3HOYH 2Y0SE 4K6LA 4HMJA 1KLUD 3OPOA 1HXYD 4TRDA 1IBKQ 1QB5D 4BBRG 1UEAB 4DV1Q 3JAMc 4A3CH 4ILWA 4JV5Q 1SFOH 2QF7A 3G71A 3TQYA 2VUMH 4FXGC 1F9PA 4DUZQ 2DN8A 3ONAB 1TWFB 1CA6A 4LF6Q 4JOIC 5FJ8H 4F7XA 5FO9B 3U9OA 4EVOA 3U58A 2LXKA 4GKJL 5KYIA 1II3A 4ZCKA 4H44C 3W2DA 1V1QA 1QUQB 3NQTA 2IHEA 4ZYSA 1RIPA 4HIMA 4K14A 3OMCA 1L1OA 3FKIG 4R4QA 4O1NA 3GTKB 1PYSB 4TKOB 3TP8A 1Y1VG 1G6PA 1EY7A 1VQ5A 3PUWA 4OWWB 5CGKA 1LTSD 1HTPA 3C3LA 3E3XA 2PPBC 3S2HB 2WAQG 2NVYB 4G7ZC 4KY6A 2DJGC 2R92B 3CCEA 1VQLA 2RDFA 4YY3Q 3NTIA 1CUKA 2RKSA 1RDPD 2ZTCA 1Q8KA 5C4JB 2QA4A 4IUNA 2E2HB 2PMZB 4KJOA 1LTBD 2MHVA 2VB3X 2FFKB 1B50A 4A3IG 1LTGD 3AB9A 1FGBD 3DUZA 1C7YA 1VQMA 1YJNA 3EQLC 1NMGA 2E2HH 1WTHA 2F0FA 1PZJD 3IAYA 1R9TH 3Q6SA 2UUBQ 1HQRD 3V96A 5ISRA 5G3LD 1O78A 2FJ2A 1BCPC 1A6XA 1OXVA 4LUOA 3KF6B 1RD9D 1HNWL 4BXXG 1Q1BA 4XQJA 4X3KA 1AH9A 1SNPA 1H95A 4NPSA 4DAYA 3S2DH 1Q86C 1L1OC 3HRZC 2D2CC 2WINB 3CCMA 4C3IH 1B7YB 4KY5A 1SXTA 2O2LD 2FHTA 1C4QA 3MZ5A 5IP9H 3CP0A 1F2YA 3NQIA 1J5EQ 4BY1B 1DZ1A 1GXDC 5CBEE 2JE6I 1VQOA 4L5SA 2B2UA 1WOCA 1FJGQ 2EE1A 1AN8A 4JI2Q 4DV4L 4A93G 3J81i 1UAPA 4OO1G 5C4XG 4MTNA 1X3FA 1V43A 1VCIA 1VQGA 4KN4C 2SEBD 1Z7TA 4ZLTF 2JA7B 1Y8NB 3NWSA 2LS01 1EY5A 1IYJB 4YWMA 3CCLA 1OXSC 1O7ZA 2F1MA 4XYQA 3J7AV 2HIXA 3T1YL 5KNCA 3AYHB 3KF8B 2RDHA 2K4KA 3F2DA 3SHLA 4DPGA 4GOPB 1BBXC 4NXNQ 2NVXH 4BBRH 4JI0L 2YTYA 4LF9L 1Q7YC 4KLKA 3H94A 3TMEA 4OXPA 1W6KA 3HKZG 1B70B 1ET6A 1I4XA 3CRKC 1HNZL 3CHBD 1DOLA 5FK9C 2EVBA 1HR0W 3MEHA 5IOCA 1SR3A 5LHY1 2F0TA 3PIPA 3A7AB 1G8ZD 4CDCC 3J81L 1VQEA 3MXNA 4DF7A 5EQ0A 4I7ZC 4BS9A 1MD2D 2Q2HA 3GQBA 2RCFA 3R93A 3I4LA 3SK4A 3S15B 2E2IB 1GO3E 5LMUQ 1VMPA 1SNCA 1SMYD 2PQAA 1BVSA 1F9QA 4A3JB 3OSOA 1PH4A 4A3MB 3OW7A 1NE3A 3H3VI 2B39A 1JWMD 4UDUC 2P5ZX 5ELEA 1QZGA 4R8NA 4XYOA 3CC2A 2GVAA 3GTQH 3P20A 4Q0FA 1XPRA 3HOUG 5T1GA 5LMNW 2EYOA 1X3EA 3E0EA 1QJOA 3M4YA 1DCZA 3OW2A 3HOWB 2KEDA 1O80A 2F0EA 2EJGC 1BBWA 4JK1C 3HKZB 3DWPA 1LABA 4IFDI 3O13A 4RHSA 4LFAQ 2IW3A 1VS0A 2B2UC 3BYYB 2AQ3B 1PH8A 1ZKOA 3GTLB 5A2QE 2L12A 1Q46A 2R93H 2PMZE 3S16B 1GD7A 5BN3A 4EQNA 2ICEC 4HIDA 4DR1L 1IZ6A 2BCOA 2JA8B 1IBKL 4DN4M 5IP9G 1RKNA 3LX0A 1WD1A 4C3JG 4HJ9A 1L2FA 1CFMA 1B9MA 4QF4A 5DAUA 1F2ZA 4X62Q 1KXLA 2C35B 3LGJA 1XXGA 4K0KL 4ABNA 3Q23A 3CKIB 4DV2Q 1ONLA 1YNJD 3I72A 4LFCQ 1FNUA 3GTGH 2CW0D 2VQFL 2A68C 3HOXH 2EY5A 4JI3Q 2KBNA 2HHHQ 4N8FA 3HEJA 3CD6A 3K7AB 2NZHA 3TS2A 2CW0C 2QGQA 4DR7L 3TS0A 2BE5C 1P16A 4DR2Q 5GROA 5C3XA 4DAMA 3S14H 4J8QA 1K8GA 2PI2E 1YZ6A 2E2JH 4E6IA 3GTJH 3I4MG 4A3GB 4MNOA 1H9KA 2ZJRA 5I9OA 3CXCA 1MBYA 1I3QH 2NZOA 1E24A 4WORA 1Z6HA 4ZKCB 4P74A 2EYJA 2F0QA 2R7FA 4XXEA 2YU9H 5H1SE 5C0XH 1CK1A 3CU7A 2BDOA 5CV6A 1MGSA 1SBBB 1MIUA 1VQIA 4LK1C 2L15A 1Y8PB 3F1ZA 1PRTF 3PF4A 2TMPA 2KHIA 1WCMG 3PMFA 4IUQA 3WDNA 4NXML 2IT1A 5FLXc 1TS4A 1L1OB 3MXNB 3K0XA 1SNDA 2ZJQA 5K36H 1RF2D 1WTRA 1LT3D 3ERSX 1TU2B 2VUMB 1EQQA 1ML0D 3X3MA 5D3DA 1E1TA 3H0GH 3M9BA 1XNRL 4PMWA 2NTSA 3FRPB 4LF8Q 2Z0SA 3DM3A 5FO8B 4HTHA 3CPFA 5F2DA 2J0TD 4IFDH 3X3NA 1Y14B 4HCEA 1Q12A 4P71A 3I4NG 3G6EA 2EXZA 3MXGA 1VQAA 3I4OA 4IALA 5C0XI 4DR6L 3JC66 1CKOA 1EU3A 2F0NA 1T5EA 3H09A 1QCBD 2NTTA 3EA6A 2XRSD 2EY1A 4P72A 5IGEA 2A69D 2H4OA 3I4MH 1S72A 4IZ8A 1MI2A 4DR4Q 4IFDG 1E0BA 3I7FA 3KLRA 3CC7A 4C2MB 3T1HQ 1QVGA 2FMMA 1RTNA 1SEBD 4A3DG 1GVPA 4F88A 4KKTA 4GNXA 5J39A 4DV7L 3RN5A 4V190 1GKHA 2NVYH 3T51B 4HEDA 4RG1A 5IT9E 2MO1A 1KL9A 3UDIA 1EY9A 3KUPA 3K7UC 3T53B 4A75A 2HIVA 3VR3A 3T1YQ 4JI1Q 3D4DA 1TY2A 1N32Q 1AW7A 3HOXG 3OWFA 5CMDA 5GADC 4OWTB 1X3PA 1MSGA 2IX3A 1FR3A 4BY7G 1SE8A 3EBEA 4A3GH 3AFQA 5FO7B 3NELA 4IUVA 3CW2C 4O0AA 2DNCA 1EWHA 1Y69U 2MQHA 5LL6S 4JV5L 3CCVA 1QWYA 1NR2A 2NVXB 4LWCA 1Y8OB 1UNSA 3PQIA 4JC0A 3RD4A 1SN8A 3U50C 3L2PA 1TWFH 5HGTA 4J15A 1A3UA 3CQZB 1XWEA 4YHHL 1C48A 5ELNA 3G4SA 1HNZQ 1U5KA 1IYVA 1LM0A 4DR2L 3E9HA 3HOXB 1K3BC 3J81E 2VW9A 1NTGA 3FPUB 2E74C 2JN4A 2QEXA 3PUZA 3A55A 5C4XH 3GTGB 3VR2A 4GNXC 3PO3B 1SYCA 1K83H 3HKSA 1JB3A 1PA6A 1HJPA 1VQKA 2JP1A 1XMOQ 1EY4A 3S15H 4UPAA 5M5WB 3HOVH 4C3IG 1N36Q 5C5MA 2LSSA 3TP5A 4CDFC 4K8IA 1HZ9A 1MKHA 2F0KA 4CJ0B 2UU9L 3J7ZC 4X6AH 1HUNA 4J1MA 4B3RQ 4KHPQ 5EBCA 1U4LA 1HA5A 2PW7A 4PQXA 5JEAJ 2R93B 3MHBA 3RZDB 1PH1A 4B3SL 5CR3A 3PCOB 1VQBA 2BA1A 2F0WA 3QOLA 5IE8A 3I4NB 4RCNA 2K04A 2OF1A 2PI2A 3VR6A 4A3KB 1Y1WB 1W3SA 4HAEA 1P8LA 2PQEA 3EROA 5EGTA 2E75C 1TWCH 4YIJA 4P73A 1JE5A 2K28A 4IN3A 2AWNA 1CHQD 1BO0A 2VUMG 2JA6B 2JJQA 3PIOA 4FNFA 1UEBA 4L8JA 1NUCA 2FMCA 4QB4A 1VQNA 1SDFA 2I07B 4QGUA 5LMNQ 1VF5C 2UUAL 4OIKA 2EIFA 2E2IH 4LF6L 3I70A 1TXYA 4QIWE 1I4HA 1WCMB 2AHOB 4K6DA 4K5XA 3RLNA 3T4AC 4DK3C 1GUGA 4GOPA 1NNXA 1G291 3D4RA 4OEMB 4DXGA 2FINB 4JG2A 1U4MA 5LMNL 2JEAI 4DA2A 2MJ8A 1N33Q 1EZ8A 2UXCQ 3S1MH 5J22A 1NCVA 2QKIC 4DV1L 1EOVA 1Q3LA 3L0OA 3H15A 4JBKA 2NN6H 2KCMA 1M90C 4LUVA 3NE5B 3P1HA 3MFGA 5EAYA 4RWSC 5L37A 1KNEA 3J80L 1NMFA 2HQLA 4A3FG 1JB7A 1EQTA 4KHZA 3K59A 1A63A 4DAPA 3NTHA 1DOMA 1K8OA 4NXNL 1ESRA 5D65A 5JPNC 4QQBX 1CA5A 3BZCA 1F9RA 1SAPA 2B2VA 3FEWX 4G4KA 1EEID 4KHPL 2DNEA 2HT1A 1Q1EA 1WYDA 4ME3A 4JI8L 4DFAA 4AIMA 1N36L 1E22A 1ASYA 2F4VQ 3LWEA 2ZM6Q 5M5XH 3HP3A 3RZDH 1CI3M 2CQAA 3FKIH 1VQ8A 3NHHA 4DNTB 1DONA 3W5OA 3SE0A 2UU9Q 1YHAA 1JR0D 2AWOA 2OQ0A 3OTOQ 2OCEA 4JI7L 1HRJA 1D1KA 1XNQQ 4EX5A 5C6AA 2NVQB 1K9MC 4GLXA 1PVOA 1I94Q 3DMUA 2EYFA 1GOZA 4C2MH 3CCSA 1STGA 4K5VA 4MZ9A 1UWVA 3CMEA 5NUCA 1PH5A 5C0XJ 1AE3A 1VQ7A 1EYDA 1YNXA 5DM63 1JWSD 4LF7L 4IJLA 4LFCL 2VL6A 3SK6A 2HD3A 4RGTA 1BUVT 4IUTA 4DR6Q 2UXBL 5DLQE 5FLXL 4UP7A 1SROA 5JEAG 4CKBA 4A3EH 1WTPA 1EY8A 3EIVA 4K5WA 2V4DA 3A5UA 1EQRA 2KJXA 3DEPA 1VQDA 3MA2B 1QUQA 4ALPA 1NY4A 2IL8A 2C5CA 3KJOA 3P7JA 1SNMA 4ZAIA 4DR1Q 1ENFA 1VF7A 5C4ZA 2UUAQ 1UE5A 4B3ML 1QOHA 4V0BA 1O7LA 5FOBB 3GTKH 5ELOA 5CORA 3S2HH 5IWAL 1VQHA 2KQ3A 2F0JA 3I4NH 2EDGA 4NKLA 4UAIA 3BDOA 2PQAB 4OONA 2NVTH 4APVA 3U4ZA 4A3KH 1TWCB 1PFMA 3CMAA 2IY5B 5ELFA 1QNUA 4DKAC 2JA6H 4QCLA 4IPDA 2YV5A 1BCPB 2Q8TA 2A68D 2F4IA 3F2UA 4XT3B 4B9XA 2NYZD 4OX9L 1J8IA 1D5ZC 2KECA 2CFMA 2R92G 5M3MG 2N3SA 3PV0A 3I4MB 2MNAA 1Z9FA 4DV3Q 2ATWA 4DV6Q 3VR5A 2MPMA 1AFPA 4OX9Q 2Y0SB 2N78A 1A8VA 1SE2A 3BG3A 1KAWA 5BN4A 3FKIB 4JI0Q 2RDGA 1CT1D 3DWQA 4BBSH 2XSCA 3HOZB 2DY8A 4DV6L 4JYAQ 3OMGA 2NUCA 1STHA 3FMCA 1J6QA 2K6AA 1KLGD 3H3VH 1WFQA 4DK1A 3A8JE 4KK7A 2R61A 3STBD 4R4CA 2ZTDA 2Q2UA 4EQ5A 1U0LA 3RR5A 5JJKA 4ZKBB 5JJIA 1JOKA 1VQJA 4NW2A 4RGMA 2EZVA 2K5DA 3F2CA 1B3QA 1PRTC 3J7A5 4F8MA 5M5YB 2NWGA 3K5NA 3HOWH 2Z1CA 3KLSX 4KI0A 4H0LC 1D6EC 3V2TA 2RF4A 2EJFC 2B2VC 4YCVA 2AQ2B 1AZPA 1O7YA 3BZDB 3E0JA 2WP8J 4H02A 2AUKA 3BU2A 4X3SA 1S5CD 3HGBA 2KVMA 4A3MG 5A35A 1HH2P 1FJGL 4RKBA 4LF5L 3CRLC 4FF3A 3VYUA 1SYBA 1SLJA 1S40A 1K73C 4GKKL 4RCOA 3K5MA 2Z8LA 4DUYQ 4LF7Q 4LW1A 2I0QA 4I65A 1I4QA 1WD0A 4KKUA 2MP1A 1YNNC 1DJRD 3KOJA 4U673 5C44B 3G7LA 4K2KA 5C44G 5IYBG 1GUNA 3SXHA 3TREA 5IYDH 3HOVB 3TZUA 4WFN3 1Q8IA 1TKWB 2K5HA 3S1MB 3K0YA 4LF4Q 4A3EG 4BY7B 1EYGA 2ZJPA 2UUBL 2PNRC 4CDEC 4ZUJA 1PZKD 4F87A 5EKLA 2BA0A 1GUWA 4LF4L 3A8KE 5IYDG 3T13A 1HUMA 2K75A 2D5DA 4L5TA 4PMCA 3R3OA 1K0SA 4KHVA 4NMZA 4DK6C 3D3RA 1U9RA 2MO0A 4LF8L 3BVZA 1VQPA 3AQQA 2HQEA 2QDLA 4DUYL 1PMRA 3LWUA 2F0MA 4IOCA 4QUCA 1EUJA 2QW7A 1S5ED 1NR4A 1GJXA 3VR4A 1VQ6A 2VS1A 4X66Q 2RSNA 1KD1C 1LTTD 1RCVD 2CKZB 5HURA 4BY1G 1WI5A 3I55A 5M5XB 2IHFA 3OIPA 5IGCA 3HOZG 1B1ZA 4G7HC 1X55A 3I90A 2CHBD 4JBWA 1I6HB 5CV7A 2L5TA 1X9NA 1EIFA 5E7NA 4A3IH 1DYQA 3OHXC 1YNJC 2KHSA 4B3SQ 4H13C 3FVQA 5J1ZA 4UP9A 1QVCA 1R4QB 2GN5A 4Q5VA 4EQPA 1N33L 1D7QA 1ICFB 4A3DH 5FJ8G 4OELB 1B44D 5IGDA 5IGGA 1XPOA 1ILQA 1UUPA 4PZ6A 1SNQA 1JMCA 3EVQA 1RJTA 2R6GA 1QVFA 3E5SA 3GTMH 3A74A 4LF9Q 5JPMC 3VA5A 4OO1I 1A15A 1K28A 2X69A 4MHEA 4FXDA 5LL6X 3ZJYC 1LT4D 3HOZH 1IW7C 5M3MH 2O4XA 5KIXA 4OIJA 5M3FB 4LFBL 4IJHA 5ELBA 1XMQQ 4UP8A 1JE4A 4A76A 2E2DC 3QOJA 1WTVA 3NBHA 1KC8C 3HOVG 2A69C 1DD2A 1XNQL 5ELCA 3GTLH 3HFZB 1EFWA 3GTMB 4MIUA 4CBVA 2X6GA 2VY3A 1EIHA 3L9AX 1S5DD 1S5BD 1G2TA 4A4IA 4B9WA 1EY6A 4WJ3M 2WKCA 3IKJA 3KYHC 2EXDA 2MGSA 3Q24A 4AYBG 1IL8A 3M85A 5EBDA 1Q90A 2MFIA 5I2YA 1B2TA 5COYA 4PZ8A 2J4XA 3I91A 4B3MQ 1LTAD 2QCPX 3NWTA 4K2LA 1STNA 2FXQA 3KF6A 4C3JB 1R4PB 2DJFC 1LYLA 3TZDA 2AMCB 1E2VA 1KRTA 2WAQE 2XWBB 2WIIB 5KGUA 3HOYG 4BY7H 4X3TA 4I7AA 3J7AF 4DV2L 4A3MH 3NENA 3R8BA 2DY7A 1VMCA 3SR1A 1KNAA 3HOYB 3KDFB 1IXRA 5LMUL 1Z47A 2D0OA 3KBXA 4IO9A 3PIP3 1AZQA 3RN2A 2QEJC 1D8LA 2Q8IB 3HZXA 1FD7D 3DEOA 2R7ZH 2UXCL 1J9OA 1BXTA 3CQZH 1JT8A 2K1BA 3MEFA 4BBRB 4A3FB 4K0KQ 4HSVA 5BR8Q 2SNSA 1C9OA 4JI8Q 4FF1A 4B3TQ 1EFID 5M3MB 3DHQA 1ENCA 2NN6I 1FL0A 4MN3A 4B08A 1WTQA 3E9IA 4BA1I 2J7ZA 1HFGA 4JBJA 3JAME 2KUMA 2UUCQ 2NZ1D 4J6HA 2JK8A 2N8NA 2F4VL 4XIGS 3KDFA 3H0GB 4ULLA 5M9OA 1OXXK 1TWAB 1I4RA 4DR5Q 4ODGA 4LFAL 4BA2I 3UE1A 2VQEL 4A3BG 4JBMA 1G2SA 2HDLA 1L0XB 2SNMA 3U9SA 4M1UB 1PTOC 3WOEA 3N6RA 5I4DA 3DM1A 3ND9A 4N9TA 1X54A 2PNHA 3SK5A 4GOPC 2EQSA 1TWHH 3OOCA 2A73B 4GN3B 3W1GA 4TVAB 3H3VC 3W1BA 3GTJB 1V1PA 4U68A 4IFDJ 3NBHB 1TQOA 2Z6KC 4TSSA 3DLLA 4FDBA 1CSQA 5JJLA 2H5XA 5E3FA 2Z6BA 5EPLA 4ZK9B 1QE6A 2B8FA 4A3KG 3EFXD 1U4PA 5GAEC 1WCMH 1A62A 1I4GA 4XT1B 1PFBA 2WB1E 4K8JA 1ZEQX 2JA6G 3D6CA 2IX0A 5CV4A 4Y52H 3RZOB 5HGQA 1I4PA 3ITPA 3IFDA 1MJCA 3MFYA 2CWAA 1I50B 2B2WC 2EPBA 2A6HD 3F8TA 2PW5A 1D5XC 4FP5D 1HR0L 1IW7D 1I94L 3TP6A 4WRDA 2QILA 4LMQD 5A2QL 2F0PA 1PXUA 3BZKA 1EZ6A 2TSSA 5EJWA 4RAUC 3A8IE 1EWIA 1STEA 3SK8A 1BCPD 5IP7H 1TVXA 3K6OA 5ELDA 3ICEA 1WVLA 1STBA 3NSWA 5DNFA 5JAVA 2JA9A 2B2YA 3TEHB 3IFTA 3OTOL 4X3UA 4R4OA 5IWAQ 1N9WA 3CC4A 4IPGA 3M4QA 3VDYA 4TQUS 1NBWA 2GA4B 2BDNA 1XTDA 1TS5A 5JOBA 3FPPA 1KIXA 1EWCA 4DR7Q 1HZBA 3J81j 1TS2A 1HZAA 1TWAH 2A6ED 2N49A 1X65A 2WKDA 1S4ZA 2E2JB 1A3VA 3M7NA 1PZID 1ESFA 4OGQC 1V1OA 2GVBA 3B6YA 3SGIA 4DV5Q 2QDBA 1JJGA 1PYWD 5EPKA 4CJ1B 1S3OA 3BVMA 2NN6G 1YJWA 2F3VA 3K57A 2WV6D 1HNXQ 1JCKB 3NBIA 3J80E 2L55A 1K83B 3NPPA 1IYUA 3VA7A 4IQZA 5CV9A 2RSOA 4XQQA 5E4XA 3C1FA 1LLRD 3QJYA 3V05A 1PTOF 5M5WH 2ENBA 3SVMA 1HNXL 2R7ZB 3S1RH 2VXWA 1CM9A 2E76C 2AUJD 4HJ5A 1XMQL 2EYPA 2JXMB 2D62A 2JYOA 4P75A 3MAQA 2YTXA 3M4OH 2F0IA 3OIQA 3PF5A 1B9NA
chains in the Genus database with same CATH topology
1EL0A 2X6LA 2F0VA 4A3DB 4KTAA 2LY7A 2RA4A 3S9WA 4DU9A 2K03A 2K5QA 3C46A 3T56B 3ERQA 2HUGA 1RHPA 5K5PA 1CQFA 1D1IA 3S2DB 4L6TB 3BVGA 1KDAA 2ID0A 2O5JC 2L4NA 4HCSA 1FYCA 4C3IB 3PUXA 3MTSA 5E1FA 4NP5A 3R2IA 1IHZA 2PZWA 5IODA 2XRQD 3GTPB 1ZYRC 3MXUA 4EQOA 5D14A 3R2TA 2C9OA 1TY0A 2F03A 4R8IA 1E2ZA 1EYAA 2CVRA 2EY2A 1TR5A 1B3AA 1L0YB 5C5LA 1HFNA 3I73A 1K8MA 4NDXA 4KJNA 3DWAA 2VNUD 1GHJA 1PTOB 1OXUA 1TWHB 1IKLA 2LKVA 1RTOA 2XNAC 4RH6A 2EYHA 1BR9A 2SOBA 4ZQ3A 1JQYD 4LJZC 2RBMA 5CV8A 3PIO3 1F2LA 4RKLA 3P75A 4WJWA 4FF2A 1H9MA 2D9UA 2XWJB 1U4RA 3M3YB 1B4OA 4XDXA 1LV9A 3VYRA 3D31A 1ICWA 2F0UA 3S14B 2IJ0A 3QB3A 2NB0A 1I6VC 3MWYW 4FYDA 2JSOA 1VDZA 1RODA 2NBFA 5I6YA 3S1RB 2F0HA 4DAVA 2Z4HA 1F77A 1XTCD 3JAML 4DNRB 4G57A 2EYMA 2NVTB 4KD4A 1SE4A 5D3IB 1F9SA 5CYUA 1LO5D 5AFWA 1KTKA 2B2TC 1JORA 2WB1B 2ZXOA 1SJED 4IUUA 1ZYRD 4ME5A 1JOQA 1JC7A 1MSHA 1KAAA 2ZXPA 1SJHD 3PUYA 2EJMA 3GV3A 3GD7A 4IUPA 2AQ1B 2O5IC 1GUSA 3AU7A 4S3SA 2PZTA 1A3TA 4BBSB 2A5HA 1X32A 3ND8A 5IGBA 2K05A 2B2TA 5C4XB 4DK0A 4A93B 2L1BA 2A6HC 1E2WA 2F0LA 1TWGB 1GUTA 2A6EC 5C3EB 1ET9A 3QO2A 2N88A 1FNWA 3BDCA 2HCIA 1BNZA 2F0OA 2K32A 1EIGA 4DXFA 1D2BA 4CKCA 1V8QA 2EOTA 3A56A 1ZXTA 4L63B 1KABA 2PZUA 2LFNA 4C1NI 1PDQA 3BDLA 4DGZA 3PUVA 4FF4A 3DXJC 2XVSA 3GV6A 4KD3A 4A3IB 1HA6A 2A74C 3MC0B 4PMBA 1PTOH 4CHTB 3TSSA 4QUFA 4RGNA 4RGOS 4HMIA 1T5XD 5FLXE 1GHKA 1WTXA 4Z9CB 4A3BB 1EU4A 1SYFA 3D8GA 4RFBA 4M8AA 2R3ZA 5DM73 2YU9B 3TN2A 2L0CA 1AP0A 3K5LA 2KA7A 3NTKA 1H9SB 1QG7A 1SSOA 4RA8A 2KCCA 3MXPA 1HTLD 3E6ZX 2OT2A 5IIFA 1B53A 1S5FD 1BF4A 5JEAH 3IL8A 3T16A 4KKSA 1ILPA 1A2TA 3L3OC 4N9PA 1HQMC 4HSPA 2JA5B 2F0SA 5EKIA 2IX1A 2KOLA 2M00A 2B63B 4AYBB 4OL7A 3WOFA 5I2XA 3Q22A 1EYCA 4QIWB 4O42A 5FKAC 1V1PB 2ICIA 1I3QB 4KN7C 4CJ2C 1D5MC 5KRUA 1SE3A 3GTQB 5BN5A 1HHVA 3RUZA 4H7BA 1PLFA 2HDMA 1AEXA 3TDQA 2MUYA 1TT2A 5KNBA 1BOSA 4Y7NB 2OEOA 3FDTA 2VB2X 3VYTA 1SYEA 3QWNA 2B8GA 3M4OB 2IWHA 5IT9L 2L11A 3L7ZC 1M8AA 4R9WA 1BDOA 1XX8A 2JEBI 1EOTA 2F0GA 3Q0AA 4P2CB 2I46A 1WTWA 3M7GA 1PRTD 3KK7A 3GP7A 1CZWA 1DOKA 4KY7A 1F2MA 2EYLA 1KDBA 3HS0C 5JJZA 2PCFB 3RMHA 3NXWA 2ZXRA 3VYSA 3UI2A 4OHJA 3BS1A 3MVVA 4C56C 2K5WA 1WTOA 2YYZA 3URYA 1CQVA 3SEBA 5TSSA 2B2YC 3J7YW 3SDZA 3GTOB 1NSNS 4LAAA 3C2PA 1EY0A 2BOSA 2XN9C 3H6MA 1DM0B 1HCZA 1TS3A 2G9DA 2WACA 4FXKC 3GO5A 3S1NB 2H1EA 3K5OA 3LNNA 4ZUIA 1HPCA 4C3HB 4A3EB 2Q8RE 3A54A 1STAA 1X3QA 1LT5D 2ZT9C 4XQNA 3TP7A 4ID6A 3N52A 1NAPA 1R9TB 3QG1A 2KEEA 5I9PA 3NP8A 5JVH3 2N55A 2K33A 3HOUB 5K36G 1ENAA 3ZYYX 4KMUC 3D6WA 2EY6A 1FNVA 4IURA 5G3LF 2WAQB 4XTCS 2PO4A 2XIWA 3I3CA 1JOOA 1BCPF 1Y1VB 2IPKD 5I6WA 1PFNA 5C0XG 1CTMA 5DEHA 3AMUA 4RHRA 3BYTB 1KDCA 5E4WC 1LT6D 5KNDA 3A7LA 4OO1H 3PO2B 1DXMA 2F0DA 1GUOA 1W6JA 2M2LA 3KLSA 5EKKA 1G6ZA 1CHPD 1JICA 1QILA 1PRTB 1STYA 3NK9A 5IGFA 4C3HG 4BWGB 1SYGA 1H9JA 4CGYB 3RLFA 3EJIA 3OWEB 1M4VA 4FVMA 4EGVA 1G91A 1A2UA 5JVG3 3I8ZA 4HN7A 2Z4IA 5C4HA 3S17B 1EEFD 2KCNA 4GZYC 1YNND 1BQQT 5KEEA 5KYLA 1H9SA 3HG9A 1XYIA 5CBAE 4PNYA 3KBGA 2B2WA 2LMCB 2PYKA 2K01A 1OXTA 1OO9B 3G6JB 4CKEA 1C8CA 2F3WA 1JWUD 3D4WA 3QIAA 1LTID 4QMGA 4HR7B 3K58A 5T1IA 5C3WA 2OXPA 1EQVA 2L9HA 3KF8A 2RQXA 1IKMA 2G9HD 4FO2A 1TIID 1PTOD 1SYDA 5CC4A 3C1EA 1QNKA 1SMYC 4G7OC 2SDFA 3S1QB 1SNOA 2M9VA 3H91A 3NUCA 1LTRD 4KV6A 2K7VA 4ZRZA 2BE5D 2RVLA 4PV1C 1SFOB 3TBIB 2HCCA 5CV5A 1H9RA 5EPJA 1LACA 4C1NK 3W3AA 1CZGA 4K6LA 4HMJA 1KLUD 3OPOA 1HXYD 4TRDA 1QB5D 1UEAB 4ILWA 2QF7A 4FXGC 1F9PA 2DN8A 3ONAB 1TWFB 1CA6A 4F7XA 5FO9B 3U9OA 4EVOA 5KYIA 1II3A 4H44C 3W2DA 3NQTA 4ZYSA 4K14A 3OMCA 4O1NA 3GTKB 4TKOB 3TP8A 1EY7A 3PUWA 5CGKA 1LTSD 1HTPA 3C3LA 2PPBC 3S2HB 2NVYB 4G7ZC 4KY6A 2R92B 2RDFA 3NTIA 2RKSA 1RDPD 5C4JB 4IUNA 2E2HB 2PMZB 4KJOA 1LTBD 2MHVA 2VB3X 2FFKB 1B50A 1LTGD 3AB9A 1FGBD 3DUZA 3EQLC 2F0FA 1PZJD 3IAYA 3Q6SA 1HQRD 3V96A 5ISRA 5G3LD 1O78A 2FJ2A 1BCPC 1A6XA 1OXVA 1RD9D 1Q1BA 4XQJA 4X3KA 1SNPA 4DAYA 3HRZC 2D2CC 2WINB 4KY5A 1SXTA 2O2LD 2FHTA 1C4QA 3MZ5A 4BY1B 1F2YA 3NQIA 1DZ1A 1GXDC 5CBEE 2JE6I 2B2UA 2EE1A 1AN8A 1UAPA 4OO1G 1V43A 1VCIA 4KN4C 2SEBD 1Z7TA 4ZLTF 2JA7B 1Y8NB 3NWSA 2LS01 1EY5A 4XYQA 1O7ZA 1OXSC 2F1MA 3J7AV 5KNCA 2RDHA 3SHLA 1BBXC 3H94A 3TMEA 1W6KA 1ET6A 1I4XA 3CRKC 3CHBD 1DOLA 5FK9C 2EVBA 3MEHA 5IOCA 5LHY1 2F0TA 3J81L 1G8ZD 3A7AB 3MXNA 4DF7A 5EQ0A 4I7ZC 4BS9A 1MD2D 3GQBA 3R93A 3I4LA 3SK4A 3S15B 2E2IB 1VMPA 1SNCA 1SMYD 1F9QA 4A3JB 3OSOA 4A3MB 3OW7A 2B39A 1JWMD 4UDUC 5ELEA 4R8NA 4XYOA 3P20A 4Q0FA 5T1GA 2EYOA 3M4YA 1QJOA 1DCZA 3HOWB 2KEDA 1O80A 2F0EA 2EJGC 4JK1C 3HKZB 3DWPA 1LABA 4IFDI 3O13A 4RHSA 2IW3A 2B2UC 3BYYB 2AQ3B 1ZKOA 3GTLB 5A2QE 2L12A 3S16B 5BN3A 4EQNA 2ICEC 2BCOA 2JA8B 4DN4M 1RKNA 3LX0A 1WD1A 4C3JG 1CFMA 1B9MA 4QF4A 5DAUA 1F2ZA 1XXGA 4ABNA 3Q23A 3CKIB 1ONLA 1YNJD 3I72A 1FNUA 2CW0D 2A68C 2EY5A 3HEJA 3K7AB 2CW0C 2BE5C 5C3XA 4J8QA 4E6IA 4A3GB 1H9KA 5I9OA 1MBYA 4WORA 1Z6HA 4ZKCB 2EYJA 2F0QA 4XXEA 5C0XH 1CK1A 3CU7A 2BDOA 5CV6A 1MGSA 1SBBB 4LK1C 1Y8PB 1PRTF 2TMPA 3PMFA 4IUQA 3WDNA 2IT1A 1TS4A 1SNDA 5K36H 1RF2D 1WTRA 1LT3D 1TU2B 2VUMB 1ML0D 3X3MA 5D3DA 4PMWA 2NTSA 3FRPB 5FO8B 4HTHA 5F2DA 2J0TD 4IFDH 3X3NA 4HCEA 1Q12A 2EXZA 3MXGA 5C0XI 4IALA 1EU3A 2F0NA 1T5EA 3H09A 1QCBD 2NTTA 3EA6A 2XRSD 2EY1A 5IGEA 2A69D 2H4OA 4IFDG 4IZ8A 1MI2A 1E0BA 3KLRA 4C2MB 2FMMA 1RTNA 1SEBD 4F88A 4KKTA 5J39A 4V190 3T51B 4HEDA 5IT9E 1EY9A 3KUPA 3T53B 3VR3A 3D4DA 1TY2A 1AW7A 3OWFA 5CMDA 1X3PA 1MSGA 2IX3A 1FR3A 5FO7B 4IUVA 2DNCA 1EWHA 1Y69U 5LL6S 1QWYA 1NR2A 2NVXB 1Y8OB 1UNSA 3RD4A 5HGTA 1A3UA 3CQZB 1XWEA 1C48A 1IYVA 3HOXB 3J81E 3FPUB 2E74C 3PUZA 3A55A 3GTGB 3VR2A 3PO3B 1SYCA 1JB3A 2JP1A 1EY4A 5M5WB 4C3IG 5C5MA 3TP5A 4K8IA 2F0KA 4CJ0B 1HUNA 4J1MA 5EBCA 1U4LA 1HA5A 2PW7A 4PQXA 5JEAJ 2R93B 3MHBA 3RZDB 5CR3A 3I4NB 2F0WA 2BA1A 3QOLA 4RCNA 2K04A 2OF1A 3VR6A 4A3KB 1Y1WB 4HAEA 2PQEA 3EROA 5EGTA 2E75C 4YIJA 2K28A 4IN3A 2AWNA 1CHQD 1BO0A 2JA6B 4FNFA 4L8JA 1NUCA 2FMCA 4QB4A 1SDFA 2I07B 1VF5C 4OIKA 3T4AC 3I70A 1I4HA 1WCMB 4K6DA 4K5XA 1GUGA 1G291 3D4RA 4DXGA 2FINB 1U4MA 2JEAI 4DA2A 2MJ8A 1EZ8A 5J22A 1NCVA 2QKIC 1Q3LA 2NN6H 3NE5B 3P1HA 3MFGA 4RWSC 1KNEA 3J80L 1EQTA 4KHZA 3K59A 4DAPA 3NTHA 1DOMA 1K8OA 1ESRA 5D65A 5JPNC 1CA5A 1F9RA 1SAPA 2B2VA 3FEWX 4G4KA 1EEID 2DNEA 1Q1EA 4DFAA 3LWEA 3HP3A 1CI3M 2CQAA 3NHHA 4DNTB 1DONA 3SE0A 1JR0D 2AWOA 1HRJA 1D1KA 5C6AA 2NVQB 3DMUA 2EYFA 1GOZA 1STGA 4K5VA 5NUCA 5C0XJ 1EYDA 5DM63 1JWSD 3SK6A 4RGTA 1BUVT 4IUTA 5FLXL 5JEAG 4CKBA 1WTPA 1EY8A 4K5WA 2V4DA 2KJXA 3DEPA 3MA2B 2IL8A 2C5CA 3P7JA 1SNMA 4ZAIA 5C4ZA 1ENFA 1VF7A 1QOHA 4V0BA 1O7LA 5FOBB 5CORA 2KQ3A 2F0JA 2EDGA 4NKLA 4UAIA 3BDOA 1TWCB 1PFMA 5ELFA 1QNUA 4QCLA 1BCPB 2Q8TA 2A68D 2F4IA 3F2UA 4XT3B 4B9XA 2NYZD 1J8IA 1D5ZC 2KECA 3PV0A 3I4MB 3VR5A 2MPMA 1AFPA 2Y0SB 1SE2A 3BG3A 5BN4A 3FKIB 2RDGA 1CT1D 3DWQA 2XSCA 3HOZB 2DY8A 3OMGA 2NUCA 1STHA 3FMCA 2K6AA 1KLGD 4DK1A 3A8JE 4KK7A 2R61A 4ZKBB 1JOKA 4NW2A 4RGMA 2EZVA 2K5DA 1PRTC 4F8MA 5M5YB 2NWGA 3K5NA 2Z1CA 3KLSX 4KI0A 4H0LC 1D6EC 3V2TA 2EJFC 2B2VC 2AQ2B 1AZPA 1O7YA 3BZDB 3E0JA 2WP8J 2AUKA 4X3SA 1S5CD 3HGBA 2KVMA 5A35A 4RKBA 4FF3A 3CRLC 3VYUA 1SYBA 4RCOA 3K5MA 2Z8LA 4I65A 1I4QA 1WD0A 4KKUA 2MP1A 1YNNC 1DJRD 4U673 5C44B 3G7LA 4K2KA 1GUNA 3SXHA 3HOVB 3TZUA 4WFN3 1Q8IA 1TKWB 3S1MB 3K0YA 4BY7B 2PNRC 4ZUJA 1PZKD 4F87A 5EKLA 2BA0A 1GUWA 3A8KE 3T13A 1HUMA 2D5DA 4PMCA 3R3OA 4KHVA 4NMZA 3D3RA 1U9RA 3BVZA 2HQEA 1PMRA 3LWUA 2F0MA 4QUCA 1S5ED 1NR4A 1GJXA 3VR4A 2RSNA 1LTTD 1RCVD 5HURA 5M5XB 3OIPA 5IGCA 1B1ZA 4G7HC 3I90A 4JBWA 2CHBD 1I6HB 5CV7A 2L5TA 1DYQA 3OHXC 1YNJC 2KHSA 4H13C 3FVQA 5J1ZA 1R4QB 4Q5VA 4EQPA 1B44D 5IGDA 5IGGA 1ILQA 1UUPA 1SNQA 3EVQA 1RJTA 2R6GA 3E5SA 5JPMC 3VA5A 4OO1I 1A15A 4MHEA 2X69A 4FXDA 5LL6X 1LT4D 1IW7C 2O4XA 5KIXA 4OIJA 5M3FB 5ELBA 1JE4A 2E2DC 3QOJA 1WTVA 3NBHA 2A69C 1DD2A 5ELCA 3GTMB 4MIUA 4CBVA 2X6GA 1EIHA 3L9AX 1S5DD 1S5BD 1G2TA 4B9WA 1EY6A 2WKCA 3IKJA 2MGSA 3Q24A 1IL8A 3M85A 5EBDA 1Q90A 5I2YA 1B2TA 5COYA 2J4XA 3I91A 1LTAD 2QCPX 3NWTA 4K2LA 1STNA 4C3JB 1R4PB 3TZDA 1E2VA 2XWBB 2WIIB 5KGUA 4X3TA 3J7AF 3R8BA 2DY7A 1VMCA 3SR1A 1KNAA 3HOYB 1Z47A 3KBXA 3PIP3 1AZQA 2QEJC 2Q8IB 3HZXA 1FD7D 3DEOA 1J9OA 1BXTA 2K1BA 4BBRB 4A3FB 4HSVA 2SNSA 4FF1A 1EFID 5M3MB 3DHQA 1ENCA 2NN6I 4MN3A 4B08A 1WTQA 4BA1I 2J7ZA 1HFGA 3JAME 2KUMA 2NZ1D 4J6HA 4XIGS 3H0GB 4ULLA 5M9OA 1OXXK 1TWAB 1I4RA 4ODGA 4BA2I 1G2SA 2HDLA 1L0XB 2SNMA 3U9SA 4M1UB 1PTOC 3WOEA 3N6RA 5I4DA 3DM1A 3ND9A 4N9TA 3SK5A 3OOCA 2A73B 3H3VC 3GTJB 1V1PA 4U68A 4IFDJ 1TQOA 4TSSA 5E3FA 5EPLA 4ZK9B 1QE6A 2B8FA 3EFXD 1U4PA 1I4GA 4XT1B 1PFBA 4K8JA 1ZEQX 3D6CA 2IX0A 5CV4A 3RZOB 1I4PA 3ITPA 3IFDA 3MFYA 1I50B 2B2WC 2EPBA 2A6HD 2PW5A 1D5XC 4FP5D 1IW7D 3TP6A 4WRDA 2QILA 4LMQD 5A2QL 2F0PA 1PXUA 1EZ6A 2TSSA 5EJWA 4RAUC 3A8IE 1STEA 3SK8A 1BCPD 1TVXA 3K6OA 5ELDA 1WVLA 1STBA 3NSWA 5DNFA 5JAVA 2B2YA 3IFTA 4X3UA 4TQUS 2GA4B 2BDNA 1TS5A 5JOBA 3FPPA 1EWCA 1TS2A 2A6ED 2WKDA 1S4ZA 2E2JB 1A3VA 3M7NA 1PZID 1ESFA 4OGQC 1V1OA 2QDBA 1PYWD 5EPKA 4CJ1B 3BVMA 2NN6G 2F3VA 3K57A 2WV6D 1JCKB 3NBIA 3J80E 2L55A 1K83B 3VA7A 3NPPA 1IYUA 4IQZA 5CV9A 2RSOA 4XQQA 5E4XA 3C1FA 1LLRD 3QJYA 3V05A 1PTOF 2ENBA 3SVMA 2R7ZB 2VXWA 1CM9A 2E76C 2AUJD 2EYPA 2JXMB 2D62A 2JYOA 3MAQA 2F0IA 3OIQA 1B9NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PW7 A;  3NHH A;  1A2T A;  2SOB A;  4ZQ3 A;  4EQN A;  4N9P A;  1A2U A;  2RBM A;  1STN A;  2F0N A;  3ITP A;  3MHB A;  2F0V A;  4K2L A;  2F0S A;  5CV8 A;  5CR3 A;  2F0W A;  2M00 A;  1RKN A;  3LX0 A;  3QOL A;  2F0L A;  3OMG A;  2NUC A;  1NSN S;  2EY1 A;  4KTA A;  1STH A;  4OL7 A;  5IGE A;  2OF1 A;  4QF4 A;  1EYC A;  5DAU A;  5KGU A;  4IZ8 A;  4LAA A;  1F2Z A;  2PW5 A;  3MZ5 A;  5HUR A;  1EY0 A;  3S9W A;  3BDC A;  4F7X A;  4RKL A;  3P75 A;  2F0O A;  2PQE A;  1EY5 A;  3ERO A;  4WRD A;  3TP6 A;  3H6M A;  5EGT A;  3U9O A;  4DU9 A;  4EVO A;  2F0P A;  5C6A A;  5J39 A;  3DMU A;  2EYF A;  5KEE A;  5KYL A;  4YIJ A;  3SR1 A;  1EZ6 A;  1II3 A;  1STG A;  5CV7 A;  2WAC A;  5KYI A;  4K5V A;  3ERQ A;  1JOK A;  5NUC A;  5KRU A;  4PNY A;  3SHL A;  1EYD A;  5K5P A;  3NQT A;  3SK8 A;  4K14 A;  2F0U A;  3OMC A;  2KHS A;  1EY9 A;  2EY5 A;  2PYK A;  4H7B A;  4ZUI A;  3RUZ A;  4F8M A;  3HEJ A;  1KAB A;  1NUC A;  3QB3 A;  5J1Z A;  3HZX A;  2PZU A;  3SK6 A;  4QB4 A;  1AEX A;  4EQP A;  3D4D A;  1TT2 A;  3TP8 A;  3TME A;  1STB A;  1EY7 A;  5C3X A;  3V2T A;  5I6Y A;  3BDL A;  3OWF A;  4DGZ A;  5JAV A;  1KDA A;  5CGK A;  5IGD A;  2F3W A;  2F0H A;  2OEO A;  3D4W A;  1STA A;  2SNS A;  4E6I A;  5IGG A;  1EY8 A;  4K5W A;  4K6D A;  3MEH A;  4K5X A;  4KY6 A;  1SYE A;  3DHQ A;  4QMG A;  1ENC A;  5IOC A;  1SNQ A;  3EVQ A;  5I9O A;  2F0T A;  4KD3 A;  2RDF A;  3TP7 A;  4ID6 A;  5C3W A;  4WOR A;  1SNM A;  2EYJ A;  2F0Q A;  1EQV A;  2OXP A;  2RKS A;  4PMB A;  4RKB A;  5E1F A;  1SYB A;  5JOB A;  3E5S A;  4DF7 A;  5C4Z A;  3NP8 A;  4NP5 A;  4IUN A;  5C4H A;  1EZ8 A;  5I9P A;  4G57 A;  2EYM A;  4KD4 A;  4J6H A;  3VA5 A;  5J22 A;  4KJO A;  1IHZ A;  1ENA A;  3SK4 A;  1A3V A;  4HMI A;  4I65 A;  5M9O A;  5CV6 A;  2PZW A;  2O4X A;  2EY6 A;  5KIX A;  5HGT A;  1A3U A;  4ODG A;  3P1H A;  5IOD A;  3PMF A;  4K2K A;  1SNC A;  2F0G A;  3QOJ A;  2KQ3 A;  3SXH A;  1JOR A;  2F0J A;  1SYD A;  1SYF A;  2QDB A;  3C1E A;  3D8G A;  1JOO A;  4NKL A;  2SNM A;  3OSO A;  5CC4 A;  4EQO A;  2F3V A;  5I6W A;  4ME5 A;  1SNO A;  2F0F A;  4MIU A;  4N9T A;  5IGC A;  1JOQ A;  1SND A;  3NUC A;  1KAA A;  5DEH A;  4KY7 A;  4R8N A;  5CV9 A;  3SK5 A;  4KV6 A;  1F2M A;  1KDC A;  2EYL A;  3C1F A;  4ZUJ A;  1KDB A;  1EYA A;  1SYC A;  5ISR A;  2ENB A;  5EKL A;  2EY2 A;  1TR5 A;  2EYO A;  2F0D A;  3NXW A;  5EKK A;  5C5L A;  1EY4 A;  2F0E A;  3T13 A;  5CV5 A;  1TQO A;  4S3S A;  4B9X A;  4B9W A;  1EY6 A;  4NDX A;  3MXP A;  5E3F A;  5C5M A;  4PMC A;  3R3O A;  2PZT A;  1A3T A;  1SNP A;  4KJN A;  3TP5 A;  3MVV A;  4KHV A;  4NMZ A;  4K8I A;  1STY A;  2EYP A;  3NK9 A;  4HTH A;  5IGF A;  5IGB A;  1U9R A;  5F2D A;  1SYG A;  2F0K A;  5IIF A;  2HQE A;  4HMJ A;  2LKV A;  4DFA A;  4TRD A;  2F0I A;  4K8J A;  4KY5 A;  3T16 A;  3EJI A;  2EYH A;  2EXZ A;  4J1M A;  3D6C A;  2F0M A;  1F2Y A;  5CV4 A;  4IAL A; 
#chains in the Genus database with same CATH topology
 1EL0 A;  5C4J H;  4GKK Q;  2X6L A;  2F0V A;  1X6O A;  4A3D B;  3EN2 A;  4KTA A;  3J80 i;  2LY7 A;  4O2D A;  2RA4 A;  4DV7 Q;  4YWK A;  3S9W A;  4DU9 A;  1PH7 A;  2K03 A;  4BXX H;  1N32 L;  2K5Q A;  2CQO A;  3C46 A;  1YHQ A;  4JI1 L;  3T56 B;  2VQE Q;  3ERQ A;  2HUG A;  1RHP A;  5K5P A;  1CQF A;  2B63 H;  1D1I A;  1ASZ A;  3S2D B;  1LTL A;  2UUC L;  1J5E L;  4L6T B;  3BVG A;  2B29 A;  1KDA A;  3S17 H;  3KFU A;  2ID0 A;  4L5Q A;  2O5J C;  2L4N A;  4DR5 L;  3J80 c;  4HCS A;  1FYC A;  4X66 L;  2ALY B;  1OTC A;  4LFB Q;  4WJ4 A;  5IYB H;  1LUZ A;  1T9H A;  1N34 L;  4C3I B;  3PUX A;  3MTS A;  5E1F A;  3HOU H;  4R4T A;  4NP5 A;  3R2I A;  1E7Z A;  1IHZ A;  3HKZ E;  1YEZ A;  2PZW A;  2R92 H;  1IL2 A;  5IOD A;  2XRQ D;  3GTP B;  2CWP A;  1ZYR C;  4A3G G;  4POF A;  3H0G G;  3MXU A;  4A3L H;  4EQO A;  2I5H A;  3Q8D A;  4NB3 A;  3BJU A;  5D14 A;  3R2T A;  2C9O A;  1JJ2 A;  1TY0 A;  2F03 A;  4R8I A;  1E2Z A;  1EYA A;  2CVR A;  4C3J H;  4X64 L;  2EY2 A;  1TR5 A;  1B3A A;  4DV0 Q;  1L0Y B;  5C5L A;  1HFN A;  2K5V A;  5AJ3 L;  3I73 A;  1K8M A;  4NDX A;  4GS3 A;  4KJN A;  2F3I A;  4R4I A;  3DWA A;  2VNU D;  1GHJ A;  1PTO B;  1OXU A;  1TWH B;  1IKL A;  2LKV A;  1RTO A;  2XNA C;  4RH6 A;  2EYH A;  4DR3 L;  1BR9 A;  2SOB A;  4ZQ3 A;  2ZTE A;  1JQY D;  4LJZ C;  2RBM A;  4LF5 Q;  5CV8 A;  4GLV B;  2B63 G;  2VQF Q;  3PIO 3;  1Y1W H;  1F2L A;  4QY7 A;  4RKL A;  3P75 A;  4WJW A;  4FF2 A;  1H9M A;  2D9U A;  2XWJ B;  1U4R A;  3M3Y B;  1CKN A;  1B4O A;  2K50 A;  1N8R C;  4XDX A;  3T1H L;  3A5Z B;  4DV0 L;  2DGY A;  1LV9 A;  4N8X 1;  3VYR A;  3D31 A;  1TWG H;  1ICW A;  4JYA L;  2F0U A;  1E1O A;  3S14 B;  2IJ0 A;  3QB3 A;  1YIJ A;  4DAY B;  2NB0 A;  1I6V C;  3MWY W;  4FYD A;  2JSO A;  1VDZ A;  3K7A H;  1ROD A;  2NBF A;  5I6Y A;  3S1R B;  2F0H A;  4DAV A;  2CCZ A;  3HOW G;  2Z4H A;  1F77 A;  2K5N A;  3J81 c;  3UDF A;  1FVI A;  1XTC D;  4JCV E;  2JA8 H;  2I5L X;  3JAM L;  1L0W A;  4DNR B;  2XTI A;  5IT9 c;  3CCQ A;  4G57 A;  2EYM A;  2NVT B;  4KD4 A;  4HJ7 A;  1SE4 A;  5D3I B;  1YVC A;  1F9S A;  5CYU A;  1LO5 D;  5AFW A;  1KTK A;  2B2T C;  1JOR A;  2WB1 B;  2ZXO A;  1SJE D;  3ER0 A;  3UE0 A;  4IUU A;  3U4V A;  1XNR Q;  1ZYR D;  1SMX A;  4ME5 A;  1JOQ A;  1JC7 A;  1MSH A;  1KAA A;  2ZXP A;  1E3P A;  1SJH D;  5GAH C;  1YJ9 A;  3PUY A;  2EJM A;  3GV3 A;  1YHB A;  3GD7 A;  4IUP A;  4A3C G;  1Q81 C;  3NEM A;  2AQ1 B;  2O5I C;  1GUS A;  3AU7 A;  4S3S A;  4YCW A;  2PZT A;  1A3T A;  1VQ9 A;  4BBS B;  2A5H A;  4JI5 Q;  1X32 A;  3ND8 A;  5IGB A;  4QJF A;  2K05 A;  2B2T A;  5BR8 L;  2ASB A;  5C4X B;  4DK0 A;  4A93 B;  2L1B A;  3PGZ A;  2A6H C;  1E2W A;  4GLA C;  2F0L A;  1TWG B;  1GUT A;  2A6E C;  1EIY B;  1XPU A;  5C3E B;  1ET9 A;  3QO2 A;  2N88 A;  1FNW A;  3BDC A;  2HCI A;  1BNZ A;  2F0O A;  2K32 A;  1EIG A;  4DXF A;  1D2B A;  2UXB Q;  4CKC A;  1XMO L;  1K8A C;  1V8Q A;  2EOT A;  1NJI C;  3A56 A;  1UE1 A;  2JA8 G;  1ZXT A;  2B3G A;  4L63 B;  2R93 G;  1KAB A;  2PZU A;  2LFN A;  2E5L L;  4C1N I;  3CPW A;  1PDQ A;  4CDD C;  3BDL A;  4DGZ A;  3PUV A;  2RHQ B;  1PH6 A;  4JI4 L;  4GNX B;  4FF4 A;  3DXJ C;  3CCU A;  2XVS A;  3GV6 A;  4MTK A;  3PO2 G;  4KD3 A;  1I6H H;  4JOI A;  4A3I B;  2UXD Q;  1HA6 A;  2A74 C;  3MC0 B;  1CSP A;  4PMB A;  2R7Z G;  3JAM i;  1PTO H;  4CHT B;  1Y1V H;  3TSS A;  4QUF A;  5IY0 A;  4Y7N H;  3PO3 G;  3RLO A;  4RGN A;  4RGO S;  4HMI A;  2UXD L;  1T5X D;  5FLX E;  1GHK A;  1WTX A;  4Z9C B;  4A3B B;  5IYC G;  1EU4 A;  4B3T L;  3PO2 H;  1SYF A;  3D8G A;  3CAM A;  2OWO A;  5AJ3 Q;  2OTJ A;  4RFB A;  2WB1 G;  4M8A A;  2R3Z A;  5DM7 3;  2YU9 B;  1HR0 Q;  3TN2 A;  2L0C A;  2E5L Q;  1AP0 A;  3K5L A;  4UY8 C;  3M3Y H;  1I5F A;  2KA7 A;  3NTK A;  3GTP H;  1H9S B;  1QG7 A;  1B8A A;  1SSO A;  3G48 A;  4RA8 A;  2RHS B;  3K8A A;  2KCC A;  2JA5 H;  1UE7 A;  4A3F H;  3MXP A;  1HTL D;  3E6Z X;  2OT2 A;  5IIF A;  4UHV A;  1B53 A;  1S5F D;  5GAG C;  1BF4 A;  5JEA H;  2YTV A;  3IL8 A;  3T16 A;  1SRU A;  4QL5 A;  3RZO H;  4KKS A;  3KJP A;  1ILP A;  1A2T A;  3ULJ A;  3L3O C;  4N9P A;  1HQM C;  1PFS A;  4HSP A;  3S24 A;  2JA5 B;  2F0S A;  5EKI A;  2IX1 A;  2KOL A;  2M00 A;  2B63 B;  4AYB B;  4OL7 A;  3QR8 A;  3WOF A;  5I2X A;  3Q22 A;  1EYC A;  2BH8 A;  4QIW B;  2OTL A;  4O42 A;  5FKA C;  1V1P B;  5HY6 A;  2ICI A;  2JA7 G;  1I3Q B;  4KN7 C;  4CJ2 C;  1D5M C;  5KRU A;  4RMF A;  1SE3 A;  5M5Y H;  4JPB W;  3GTQ B;  2Z9H A;  5BN5 A;  3CCR A;  1HHV A;  4AH6 A;  3RUZ A;  4H7B A;  1G51 A;  1PLF A;  2HDM A;  1AEX A;  3TDQ A;  2MUY A;  1TT2 A;  4DR3 Q;  5KNB A;  1BOS A;  4Y7N B;  2OQK A;  2OEO A;  4A3J G;  3FDT A;  2VB2 X;  3ULL A;  3VYT A;  3I56 A;  2LXJ A;  4A3B H;  1SYE A;  3QWN A;  2B8G A;  2KEN A;  1PH9 A;  4JI4 Q;  3M4O B;  4POG A;  2IWH A;  5IT9 L;  2L11 A;  4A93 H;  3L7Z C;  1QZH A;  3PSI A;  1M8A A;  1WJJ A;  5J3B A;  4HJA A;  4R9W A;  1BDO A;  3K81 C;  1XX8 A;  3M4P A;  4DV3 L;  2E8G A;  1AE2 A;  2JEB I;  1EOT A;  1MJE A;  2KCT A;  2F0G A;  3Q0A A;  4JVZ A;  3S1Q H;  4P2C B;  4GN5 A;  2I46 A;  4PG3 A;  3UDX A;  4DV5 L;  1WTW A;  1W2B A;  5IYC H;  4HIO A;  3M7G A;  1PRT D;  3STB C;  4YHH Q;  3KK7 A;  3GP7 A;  2D0P A;  1CZW A;  4IPC A;  1DOK A;  4KY7 A;  1F2M A;  2EYL A;  1KDB A;  2G5D A;  3HS0 C;  5JJZ A;  4AYB E;  2PCF B;  4HJ8 A;  3RMH A;  3NXW A;  2ZXR A;  4HIK A;  3AEV A;  3F2B A;  3VYS A;  3UI2 A;  2ZM6 L;  1YBY A;  4OHJ A;  4YWL A;  3BS1 A;  3GTO H;  1IBL Q;  3MVV A;  1KQS A;  4NXM Q;  4C56 C;  1PV4 A;  2K5W A;  1WTO A;  2YYZ A;  3URY A;  1IBL L;  2CH4 W;  4A3L G;  1CQV A;  4OWX B;  1CKN B;  3SEB A;  1IBM Q;  5TSS A;  1Y1W G;  4YCU A;  3FHW A;  2B2Y C;  3J7Y W;  3SDZ A;  3S16 H;  1IBM L;  2K14 A;  2ES2 A;  3GTO B;  1NSN S;  2R7D A;  3KLW A;  4PZ7 A;  4LAA A;  3C2P A;  4L5R C;  1EY0 A;  2BOS A;  2XN9 C;  3H6M A;  4A3J H;  2JA5 G;  1BBU A;  1DM0 B;  1VQF A;  1HCZ A;  1TS3 A;  2G9D A;  2WAC A;  4FXK C;  3CF5 A;  1PH3 A;  3GO5 A;  4BBS G;  2HHH L;  3S1N B;  2H1E A;  3IRB A;  3K5O A;  3LNN A;  4ZUI A;  5GQO A;  3FP9 A;  1HPC A;  4C3H B;  2K52 A;  1V9P A;  1MHW C;  4A3E B;  2Q2T A;  1X3G A;  2Q8R E;  3A54 A;  3RNU A;  4GN4 B;  4X62 L;  1FGU A;  1STA A;  5C3E H;  1X3Q A;  1LT5 D;  2ZT9 C;  4JI5 L;  4XQN A;  3TP7 A;  4ID6 A;  3N52 A;  1NAP A;  2A8V A;  1R9T B;  1DGS A;  3QG1 A;  4LUZ A;  2KEE A;  5I9P A;  3NP8 A;  5JVH 3;  2N55 A;  2K33 A;  3HOU B;  5K36 G;  1PH2 A;  1ENA A;  3ZYY X;  3GDE A;  4KMU C;  5IP7 G;  3D6W A;  1BKB A;  2EY6 A;  1FNV A;  4IUR A;  5G3L F;  2WAQ B;  4XTC S;  4DNI A;  1A0I A;  2PO4 A;  2XIW A;  3I3C A;  1JOO A;  1X56 A;  4R1J A;  2XGT A;  1BCP F;  1Y1V B;  2IPK D;  5I6W A;  1PFN A;  2WFW A;  5M3F G;  1YIT A;  2Z6K A;  3UDG A;  4BY1 H;  5C0X G;  3K80 C;  5FLM G;  1CTM A;  5DEH A;  4DUZ L;  3AMU A;  4RHR A;  3BYT B;  4JI6 L;  1KDC A;  5E4W C;  1GM5 A;  1LT6 D;  5KND A;  4DV4 Q;  4JI2 L;  3A7L A;  4OO1 H;  3PO2 B;  1DXM A;  2F0D A;  1GUO A;  1W6J A;  2M2L A;  3KLS A;  2KHJ A;  5EKK A;  3ULP A;  1G6Z A;  1CHP D;  1JIC A;  2JA7 H;  1QIL A;  1PRT B;  1STY A;  3NK9 A;  5IGF A;  4C3H G;  4BWG B;  1SYG A;  1H9J A;  3WWV A;  1CKM A;  4CGY B;  3RLF A;  3EJI A;  3OWE B;  1O7I A;  1M4V A;  1Q82 C;  4FVM A;  1C0A A;  3AFP A;  4EGV A;  1UE6 A;  1G91 A;  1K3R A;  1A2U A;  5JVG 3;  1I50 H;  1K0R A;  4X64 Q;  3I8Z A;  4HN7 A;  2AKW B;  2Z4I A;  5C4H A;  2RCN A;  4IPH A;  3S17 B;  3S1N H;  3TRZ A;  1VQC A;  5C3E G;  3D0F A;  1EEF D;  2KCN A;  4GZY C;  1RL2 A;  1YNN D;  2V1C C;  1M1K C;  3A0J A;  2I5M X;  1BQQ T;  1VQ4 A;  4JI7 Q;  5KEE A;  1YI2 A;  5KYL A;  1PHJ A;  1H9S A;  2Y0S G;  3HG9 A;  1XJV A;  5CBA E;  1XYI A;  4PNY A;  3KBG A;  2B2W A;  1JJC B;  2LMC B;  2PYK A;  2K01 A;  1OXT A;  4LNQ A;  4AQY L;  4C3H H;  2NVQ H;  1OO9 B;  3G6J B;  4CKE A;  4YY3 L;  1C8C A;  2F3W A;  2Q2I A;  1JWU D;  3D4W A;  3QIA A;  2DUD A;  1LTI D;  5C44 H;  4QMG A;  3OYY A;  4HR7 B;  3K58 A;  5T1I A;  5C3W A;  4JW0 A;  4X65 Q;  2OXP A;  1EQV A;  4AQY Q;  2CH4 A;  4B3R L;  4X65 L;  2L9H A;  3KF8 A;  3CCJ A;  2RQX A;  1IKM A;  4JI6 Q;  4IOA A;  3I2Z A;  1KRS A;  2G9H D;  4FO2 A;  1HZC A;  1TII D;  1PTO D;  1SYD A;  5CC4 A;  3C1E A;  1QNK A;  2VZA A;  1HNW Q;  1SMY C;  4G7O C;  2A1A A;  2SDF A;  3S1Q B;  1SNO A;  2M9V A;  3H91 A;  3NUC A;  3PO3 H;  4JI3 L;  1PYB A;  1LTR D;  4KV6 A;  2K7V A;  4ZRZ A;  2BE5 D;  2JQO A;  5M3F H;  2A19 A;  2RVL A;  4PV1 C;  5FLM H;  1SFO B;  4GKJ Q;  3TBI B;  2HCC A;  5CV5 A;  1H9R A;  2BH2 A;  5EPJ A;  1KHI A;  1LAC A;  1N34 Q;  4C1N K;  2F52 A;  3W3A A;  1CZG A;  4DR4 L;  3HOY H;  2Y0S E;  4K6L A;  4HMJ A;  1KLU D;  3OPO A;  1HXY D;  4TRD A;  1IBK Q;  1QB5 D;  4BBR G;  1UEA B;  4DV1 Q;  3JAM c;  4A3C H;  4ILW A;  4JV5 Q;  1SFO H;  2QF7 A;  3G71 A;  3TQY A;  2VUM H;  4FXG C;  1F9P A;  4DUZ Q;  2DN8 A;  3ONA B;  1TWF B;  1CA6 A;  4LF6 Q;  4JOI C;  5FJ8 H;  4F7X A;  5FO9 B;  3U9O A;  4EVO A;  3U58 A;  2LXK A;  4GKJ L;  5KYI A;  1II3 A;  4ZCK A;  4H44 C;  3W2D A;  1V1Q A;  1QUQ B;  3NQT A;  2IHE A;  4ZYS A;  1RIP A;  4HIM A;  4K14 A;  3OMC A;  1L1O A;  3FKI G;  4R4Q A;  4O1N A;  3GTK B;  1PYS B;  4TKO B;  3TP8 A;  1Y1V G;  1G6P A;  1EY7 A;  1VQ5 A;  3PUW A;  4OWW B;  5CGK A;  1LTS D;  1HTP A;  3C3L A;  3E3X A;  2PPB C;  3S2H B;  2WAQ G;  2NVY B;  4G7Z C;  4KY6 A;  2DJG C;  2R92 B;  3CCE A;  1VQL A;  2RDF A;  4YY3 Q;  3NTI A;  1CUK A;  2RKS A;  1RDP D;  2ZTC A;  1Q8K A;  5C4J B;  2QA4 A;  4IUN A;  2E2H B;  2PMZ B;  4KJO A;  1LTB D;  2MHV A;  2VB3 X;  2FFK B;  1B50 A;  4A3I G;  1LTG D;  3AB9 A;  1FGB D;  3DUZ A;  1C7Y A;  1VQM A;  1YJN A;  3EQL C;  1NMG A;  2E2H H;  1WTH A;  2F0F A;  1PZJ D;  3IAY A;  1R9T H;  3Q6S A;  2UUB Q;  1HQR D;  3V96 A;  5ISR A;  5G3L D;  1O78 A;  2FJ2 A;  1BCP C;  1A6X A;  1OXV A;  4LUO A;  3KF6 B;  1RD9 D;  1HNW L;  4BXX G;  1Q1B A;  4XQJ A;  4X3K A;  1AH9 A;  1SNP A;  1H95 A;  4NPS A;  4DAY A;  3S2D H;  1Q86 C;  1L1O C;  3HRZ C;  2D2C C;  2WIN B;  3CCM A;  4C3I H;  1B7Y B;  4KY5 A;  1SXT A;  2O2L D;  2FHT A;  1C4Q A;  3MZ5 A;  5IP9 H;  3CP0 A;  1F2Y A;  3NQI A;  1J5E Q;  4BY1 B;  1DZ1 A;  1GXD C;  5CBE E;  2JE6 I;  1VQO A;  4L5S A;  2B2U A;  1WOC A;  1FJG Q;  2EE1 A;  1AN8 A;  4JI2 Q;  4DV4 L;  4A93 G;  3J81 i;  1UAP A;  4OO1 G;  5C4X G;  4MTN A;  1X3F A;  1V43 A;  1VCI A;  1VQG A;  4KN4 C;  2SEB D;  1Z7T A;  4ZLT F;  2JA7 B;  1Y8N B;  3NWS A;  2LS0 1;  1EY5 A;  1IYJ B;  4YWM A;  3CCL A;  1OXS C;  1O7Z A;  2F1M A;  4XYQ A;  3J7A V;  2HIX A;  3T1Y L;  5KNC A;  3AYH B;  3KF8 B;  2RDH A;  2K4K A;  3F2D A;  3SHL A;  4DPG A;  4GOP B;  1BBX C;  4NXN Q;  2NVX H;  4BBR H;  4JI0 L;  2YTY A;  4LF9 L;  1Q7Y C;  4KLK A;  3H94 A;  3TME A;  4OXP A;  1W6K A;  3HKZ G;  1B70 B;  1ET6 A;  1I4X A;  3CRK C;  1HNZ L;  3CHB D;  1DOL A;  5FK9 C;  2EVB A;  1HR0 W;  3MEH A;  5IOC A;  1SR3 A;  5LHY 1;  2F0T A;  3PIP A;  3A7A B;  1G8Z D;  4CDC C;  3J81 L;  1VQE A;  3MXN A;  4DF7 A;  5EQ0 A;  4I7Z C;  4BS9 A;  1MD2 D;  2Q2H A;  3GQB A;  2RCF A;  3R93 A;  3I4L A;  3SK4 A;  3S15 B;  2E2I B;  1GO3 E;  5LMU Q;  1VMP A;  1SNC A;  1SMY D;  2PQA A;  1BVS A;  1F9Q A;  4A3J B;  3OSO A;  1PH4 A;  4A3M B;  3OW7 A;  1NE3 A;  3H3V I;  2B39 A;  1JWM D;  4UDU C;  2P5Z X;  5ELE A;  1QZG A;  4R8N A;  4XYO A;  3CC2 A;  2GVA A;  3GTQ H;  3P20 A;  4Q0F A;  1XPR A;  3HOU G;  5T1G A;  5LMN W;  2EYO A;  1X3E A;  3E0E A;  1QJO A;  3M4Y A;  1DCZ A;  3OW2 A;  3HOW B;  2KED A;  1O80 A;  2F0E A;  2EJG C;  1BBW A;  4JK1 C;  3HKZ B;  3DWP A;  1LAB A;  4IFD I;  3O13 A;  4RHS A;  4LFA Q;  2IW3 A;  1VS0 A;  2B2U C;  3BYY B;  2AQ3 B;  1PH8 A;  1ZKO A;  3GTL B;  5A2Q E;  2L12 A;  1Q46 A;  2R93 H;  2PMZ E;  3S16 B;  1GD7 A;  5BN3 A;  4EQN A;  2ICE C;  4HID A;  4DR1 L;  1IZ6 A;  2BCO A;  2JA8 B;  1IBK L;  4DN4 M;  5IP9 G;  1RKN A;  3LX0 A;  1WD1 A;  4C3J G;  4HJ9 A;  1L2F A;  1CFM A;  1B9M A;  4QF4 A;  5DAU A;  1F2Z A;  4X62 Q;  1KXL A;  2C35 B;  3LGJ A;  1XXG A;  4K0K L;  4ABN A;  3Q23 A;  3CKI B;  4DV2 Q;  1ONL A;  1YNJ D;  3I72 A;  4LFC Q;  1FNU A;  3GTG H;  2CW0 D;  2VQF L;  2A68 C;  3HOX H;  2EY5 A;  4JI3 Q;  2KBN A;  2HHH Q;  4N8F A;  3HEJ A;  3CD6 A;  3K7A B;  2NZH A;  3TS2 A;  2CW0 C;  2QGQ A;  4DR7 L;  3TS0 A;  2BE5 C;  1P16 A;  4DR2 Q;  5GRO A;  5C3X A;  4DAM A;  3S14 H;  4J8Q A;  1K8G A;  2PI2 E;  1YZ6 A;  2E2J H;  4E6I A;  3GTJ H;  3I4M G;  4A3G B;  4MNO A;  1H9K A;  2ZJR A;  5I9O A;  3CXC A;  1MBY A;  1I3Q H;  2NZO A;  1E24 A;  4WOR A;  1Z6H A;  4ZKC B;  4P74 A;  2EYJ A;  2F0Q A;  2R7F A;  4XXE A;  2YU9 H;  5H1S E;  5C0X H;  1CK1 A;  3CU7 A;  2BDO A;  5CV6 A;  1MGS A;  1SBB B;  1MIU A;  1VQI A;  4LK1 C;  2L15 A;  1Y8P B;  3F1Z A;  1PRT F;  3PF4 A;  2TMP A;  2KHI A;  1WCM G;  3PMF A;  4IUQ A;  3WDN A;  4NXM L;  2IT1 A;  5FLX c;  1TS4 A;  1L1O B;  3MXN B;  3K0X A;  1SND A;  2ZJQ A;  5K36 H;  1RF2 D;  1WTR A;  1LT3 D;  3ERS X;  1TU2 B;  2VUM B;  1EQQ A;  1ML0 D;  3X3M A;  5D3D A;  1E1T A;  3H0G H;  3M9B A;  1XNR L;  4PMW A;  2NTS A;  3FRP B;  4LF8 Q;  2Z0S A;  3DM3 A;  5FO8 B;  4HTH A;  3CPF A;  5F2D A;  2J0T D;  4IFD H;  3X3N A;  1Y14 B;  4HCE A;  1Q12 A;  4P71 A;  3I4N G;  3G6E A;  2EXZ A;  3MXG A;  1VQA A;  3I4O A;  4IAL A;  5C0X I;  4DR6 L;  3JC6 6;  1CKO A;  1EU3 A;  2F0N A;  1T5E A;  3H09 A;  1QCB D;  2NTT A;  3EA6 A;  2XRS D;  2EY1 A;  4P72 A;  5IGE A;  2A69 D;  2H4O A;  3I4M H;  1S72 A;  4IZ8 A;  1MI2 A;  4DR4 Q;  4IFD G;  1E0B A;  3I7F A;  3KLR A;  3CC7 A;  4C2M B;  3T1H Q;  1QVG A;  2FMM A;  1RTN A;  1SEB D;  4A3D G;  1GVP A;  4F88 A;  4KKT A;  4GNX A;  5J39 A;  4DV7 L;  3RN5 A;  4V19 0;  1GKH A;  2NVY H;  3T51 B;  4HED A;  4RG1 A;  5IT9 E;  2MO1 A;  1KL9 A;  3UDI A;  1EY9 A;  3KUP A;  3K7U C;  3T53 B;  4A75 A;  2HIV A;  3VR3 A;  3T1Y Q;  4JI1 Q;  3D4D A;  1TY2 A;  1N32 Q;  1AW7 A;  3HOX G;  3OWF A;  5CMD A;  5GAD C;  4OWT B;  1X3P A;  1MSG A;  2IX3 A;  1FR3 A;  4BY7 G;  1SE8 A;  3EBE A;  4A3G H;  3AFQ A;  5FO7 B;  3NEL A;  4IUV A;  3CW2 C;  4O0A A;  2DNC A;  1EWH A;  1Y69 U;  2MQH A;  5LL6 S;  4JV5 L;  3CCV A;  1QWY A;  1NR2 A;  2NVX B;  4LWC A;  1Y8O B;  1UNS A;  3PQI A;  4JC0 A;  3RD4 A;  1SN8 A;  3U50 C;  3L2P A;  1TWF H;  5HGT A;  4J15 A;  1A3U A;  3CQZ B;  1XWE A;  4YHH L;  1C48 A;  5ELN A;  3G4S A;  1HNZ Q;  1U5K A;  1IYV A;  1LM0 A;  4DR2 L;  3E9H A;  3HOX B;  1K3B C;  3J81 E;  2VW9 A;  1NTG A;  3FPU B;  2E74 C;  2JN4 A;  2QEX A;  3PUZ A;  3A55 A;  5C4X H;  3GTG B;  3VR2 A;  4GNX C;  3PO3 B;  1SYC A;  1K83 H;  3HKS A;  1JB3 A;  1PA6 A;  1HJP A;  1VQK A;  2JP1 A;  1XMO Q;  1EY4 A;  3S15 H;  4UPA A;  5M5W B;  3HOV H;  4C3I G;  1N36 Q;  5C5M A;  2LSS A;  3TP5 A;  4CDF C;  4K8I A;  1HZ9 A;  1MKH A;  2F0K A;  4CJ0 B;  2UU9 L;  3J7Z C;  4X6A H;  1HUN A;  4J1M A;  4B3R Q;  4KHP Q;  5EBC A;  1U4L A;  1HA5 A;  2PW7 A;  4PQX A;  5JEA J;  2R93 B;  3MHB A;  3RZD B;  1PH1 A;  4B3S L;  5CR3 A;  3PCO B;  1VQB A;  2BA1 A;  2F0W A;  3QOL A;  5IE8 A;  3I4N B;  4RCN A;  2K04 A;  2OF1 A;  2PI2 A;  3VR6 A;  4A3K B;  1Y1W B;  1W3S A;  4HAE A;  1P8L A;  2PQE A;  3ERO A;  5EGT A;  2E75 C;  1TWC H;  4YIJ A;  4P73 A;  1JE5 A;  2K28 A;  4IN3 A;  2AWN A;  1CHQ D;  1BO0 A;  2VUM G;  2JA6 B;  2JJQ A;  3PIO A;  4FNF A;  1UEB A;  4L8J A;  1NUC A;  2FMC A;  4QB4 A;  1VQN A;  1SDF A;  2I07 B;  4QGU A;  5LMN Q;  1VF5 C;  2UUA L;  4OIK A;  2EIF A;  2E2I H;  4LF6 L;  3I70 A;  1TXY A;  4QIW E;  1I4H A;  1WCM B;  2AHO B;  4K6D A;  4K5X A;  3RLN A;  3T4A C;  4DK3 C;  1GUG A;  4GOP A;  1NNX A;  1G29 1;  3D4R A;  4OEM B;  4DXG A;  2FIN B;  4JG2 A;  1U4M A;  5LMN L;  2JEA I;  4DA2 A;  2MJ8 A;  1N33 Q;  1EZ8 A;  2UXC Q;  3S1M H;  5J22 A;  1NCV A;  2QKI C;  4DV1 L;  1EOV A;  1Q3L A;  3L0O A;  3H15 A;  4JBK A;  2NN6 H;  2KCM A;  1M90 C;  4LUV A;  3NE5 B;  3P1H A;  3MFG A;  5EAY A;  4RWS C;  5L37 A;  1KNE A;  3J80 L;  1NMF A;  2HQL A;  4A3F G;  1JB7 A;  1EQT A;  4KHZ A;  3K59 A;  1A63 A;  4DAP A;  3NTH A;  1DOM A;  1K8O A;  4NXN L;  1ESR A;  5D65 A;  5JPN C;  4QQB X;  1CA5 A;  3BZC A;  1F9R A;  1SAP A;  2B2V A;  3FEW X;  4G4K A;  1EEI D;  4KHP L;  2DNE A;  2HT1 A;  1Q1E A;  1WYD A;  4ME3 A;  4JI8 L;  4DFA A;  4AIM A;  1N36 L;  1E22 A;  1ASY A;  2F4V Q;  3LWE A;  2ZM6 Q;  5M5X H;  3HP3 A;  3RZD H;  1CI3 M;  2CQA A;  3FKI H;  1VQ8 A;  3NHH A;  4DNT B;  1DON A;  3W5O A;  3SE0 A;  2UU9 Q;  1YHA A;  1JR0 D;  2AWO A;  2OQ0 A;  3OTO Q;  2OCE A;  4JI7 L;  1HRJ A;  1D1K A;  1XNQ Q;  4EX5 A;  5C6A A;  2NVQ B;  1K9M C;  4GLX A;  1PVO A;  1I94 Q;  3DMU A;  2EYF A;  1GOZ A;  4C2M H;  3CCS A;  1STG A;  4K5V A;  4MZ9 A;  1UWV A;  3CME A;  5NUC A;  1PH5 A;  5C0X J;  1AE3 A;  1VQ7 A;  1EYD A;  1YNX A;  5DM6 3;  1JWS D;  4LF7 L;  4IJL A;  4LFC L;  2VL6 A;  3SK6 A;  2HD3 A;  4RGT A;  1BUV T;  4IUT A;  4DR6 Q;  2UXB L;  5DLQ E;  5FLX L;  4UP7 A;  1SRO A;  5JEA G;  4CKB A;  4A3E H;  1WTP A;  1EY8 A;  3EIV A;  4K5W A;  2V4D A;  3A5U A;  1EQR A;  2KJX A;  3DEP A;  1VQD A;  3MA2 B;  1QUQ A;  4ALP A;  1NY4 A;  2IL8 A;  2C5C A;  3KJO A;  3P7J A;  1SNM A;  4ZAI A;  4DR1 Q;  1ENF A;  1VF7 A;  5C4Z A;  2UUA Q;  1UE5 A;  4B3M L;  1QOH A;  4V0B A;  1O7L A;  5FOB B;  3GTK H;  5ELO A;  5COR A;  3S2H H;  5IWA L;  1VQH A;  2KQ3 A;  2F0J A;  3I4N H;  2EDG A;  4NKL A;  4UAI A;  3BDO A;  2PQA B;  4OON A;  2NVT H;  4APV A;  3U4Z A;  4A3K H;  1TWC B;  1PFM A;  3CMA A;  2IY5 B;  5ELF A;  1QNU A;  4DKA C;  2JA6 H;  4QCL A;  4IPD A;  2YV5 A;  1BCP B;  2Q8T A;  2A68 D;  2F4I A;  3F2U A;  4XT3 B;  4B9X A;  2NYZ D;  4OX9 L;  1J8I A;  1D5Z C;  2KEC A;  2CFM A;  2R92 G;  5M3M G;  2N3S A;  3PV0 A;  3I4M B;  2MNA A;  1Z9F A;  4DV3 Q;  2ATW A;  4DV6 Q;  3VR5 A;  2MPM A;  1AFP A;  4OX9 Q;  2Y0S B;  2N78 A;  1A8V A;  1SE2 A;  3BG3 A;  1KAW A;  5BN4 A;  3FKI B;  4JI0 Q;  2RDG A;  1CT1 D;  3DWQ A;  4BBS H;  2XSC A;  3HOZ B;  2DY8 A;  4DV6 L;  4JYA Q;  3OMG A;  2NUC A;  1STH A;  3FMC A;  1J6Q A;  2K6A A;  1KLG D;  3H3V H;  1WFQ A;  4DK1 A;  3A8J E;  4KK7 A;  2R61 A;  3STB D;  4R4C A;  2ZTD A;  2Q2U A;  4EQ5 A;  1U0L A;  3RR5 A;  5JJK A;  4ZKB B;  5JJI A;  1JOK A;  1VQJ A;  4NW2 A;  4RGM A;  2EZV A;  2K5D A;  3F2C A;  1B3Q A;  1PRT C;  3J7A 5;  4F8M A;  5M5Y B;  2NWG A;  3K5N A;  3HOW H;  2Z1C A;  3KLS X;  4KI0 A;  4H0L C;  1D6E C;  3V2T A;  2RF4 A;  2EJF C;  2B2V C;  4YCV A;  2AQ2 B;  1AZP A;  1O7Y A;  3BZD B;  3E0J A;  2WP8 J;  4H02 A;  2AUK A;  3BU2 A;  4X3S A;  1S5C D;  3HGB A;  2KVM A;  4A3M G;  5A35 A;  1HH2 P;  1FJG L;  4RKB A;  4LF5 L;  3CRL C;  4FF3 A;  3VYU A;  1SYB A;  1SLJ A;  1S40 A;  1K73 C;  4GKK L;  4RCO A;  3K5M A;  2Z8L A;  4DUY Q;  4LF7 Q;  4LW1 A;  2I0Q A;  4I65 A;  1I4Q A;  1WD0 A;  4KKU A;  2MP1 A;  1YNN C;  1DJR D;  3KOJ A;  4U67 3;  5C44 B;  3G7L A;  4K2K A;  5C44 G;  5IYB G;  1GUN A;  3SXH A;  3TRE A;  5IYD H;  3HOV B;  3TZU A;  4WFN 3;  1Q8I A;  1TKW B;  2K5H A;  3S1M B;  3K0Y A;  4LF4 Q;  4A3E G;  4BY7 B;  1EYG A;  2ZJP A;  2UUB L;  2PNR C;  4CDE C;  4ZUJ A;  1PZK D;  4F87 A;  5EKL A;  2BA0 A;  1GUW A;  4LF4 L;  3A8K E;  5IYD G;  3T13 A;  1HUM A;  2K75 A;  2D5D A;  4L5T A;  4PMC A;  3R3O A;  1K0S A;  4KHV A;  4NMZ A;  4DK6 C;  3D3R A;  1U9R A;  2MO0 A;  4LF8 L;  3BVZ A;  1VQP A;  3AQQ A;  2HQE A;  2QDL A;  4DUY L;  1PMR A;  3LWU A;  2F0M A;  4IOC A;  4QUC A;  1EUJ A;  2QW7 A;  1S5E D;  1NR4 A;  1GJX A;  3VR4 A;  1VQ6 A;  2VS1 A;  4X66 Q;  2RSN A;  1KD1 C;  1LTT D;  1RCV D;  2CKZ B;  5HUR A;  4BY1 G;  1WI5 A;  3I55 A;  5M5X B;  2IHF A;  3OIP A;  5IGC A;  3HOZ G;  1B1Z A;  4G7H C;  1X55 A;  3I90 A;  2CHB D;  4JBW A;  1I6H B;  5CV7 A;  2L5T A;  1X9N A;  1EIF A;  5E7N A;  4A3I H;  1DYQ A;  3OHX C;  1YNJ C;  2KHS A;  4B3S Q;  4H13 C;  3FVQ A;  5J1Z A;  4UP9 A;  1QVC A;  1R4Q B;  2GN5 A;  4Q5V A;  4EQP A;  1N33 L;  1D7Q A;  1ICF B;  4A3D H;  5FJ8 G;  4OEL B;  1B44 D;  5IGD A;  5IGG A;  1XPO A;  1ILQ A;  1UUP A;  4PZ6 A;  1SNQ A;  1JMC A;  3EVQ A;  1RJT A;  2R6G A;  1QVF A;  3E5S A;  3GTM H;  3A74 A;  4LF9 Q;  5JPM C;  3VA5 A;  4OO1 I;  1A15 A;  1K28 A;  2X69 A;  4MHE A;  4FXD A;  5LL6 X;  3ZJY C;  1LT4 D;  3HOZ H;  1IW7 C;  5M3M H;  2O4X A;  5KIX A;  4OIJ A;  5M3F B;  4LFB L;  4IJH A;  5ELB A;  1XMQ Q;  4UP8 A;  1JE4 A;  4A76 A;  2E2D C;  3QOJ A;  1WTV A;  3NBH A;  1KC8 C;  3HOV G;  2A69 C;  1DD2 A;  1XNQ L;  5ELC A;  3GTL H;  3HFZ B;  1EFW A;  3GTM B;  4MIU A;  4CBV A;  2X6G A;  2VY3 A;  1EIH A;  3L9A X;  1S5D D;  1S5B D;  1G2T A;  4A4I A;  4B9W A;  1EY6 A;  4WJ3 M;  2WKC A;  3IKJ A;  3KYH C;  2EXD A;  2MGS A;  3Q24 A;  4AYB G;  1IL8 A;  3M85 A;  5EBD A;  1Q90 A;  2MFI A;  5I2Y A;  1B2T A;  5COY A;  4PZ8 A;  2J4X A;  3I91 A;  4B3M Q;  1LTA D;  2QCP X;  3NWT A;  4K2L A;  1STN A;  2FXQ A;  3KF6 A;  4C3J B;  1R4P B;  2DJF C;  1LYL A;  3TZD A;  2AMC B;  1E2V A;  1KRT A;  2WAQ E;  2XWB B;  2WII B;  5KGU A;  3HOY G;  4BY7 H;  4X3T A;  4I7A A;  3J7A F;  4DV2 L;  4A3M H;  3NEN A;  3R8B A;  2DY7 A;  1VMC A;  3SR1 A;  1KNA A;  3HOY B;  3KDF B;  1IXR A;  5LMU L;  1Z47 A;  2D0O A;  3KBX A;  4IO9 A;  3PIP 3;  1AZQ A;  3RN2 A;  2QEJ C;  1D8L A;  2Q8I B;  3HZX A;  1FD7 D;  3DEO A;  2R7Z H;  2UXC L;  1J9O A;  1BXT A;  3CQZ H;  1JT8 A;  2K1B A;  3MEF A;  4BBR B;  4A3F B;  4K0K Q;  4HSV A;  5BR8 Q;  2SNS A;  1C9O A;  4JI8 Q;  4FF1 A;  4B3T Q;  1EFI D;  5M3M B;  3DHQ A;  1ENC A;  2NN6 I;  1FL0 A;  4MN3 A;  4B08 A;  1WTQ A;  3E9I A;  4BA1 I;  2J7Z A;  1HFG A;  4JBJ A;  3JAM E;  2KUM A;  2UUC Q;  2NZ1 D;  4J6H A;  2JK8 A;  2N8N A;  2F4V L;  4XIG S;  3KDF A;  3H0G B;  4ULL A;  5M9O A;  1OXX K;  1TWA B;  1I4R A;  4DR5 Q;  4ODG A;  4LFA L;  4BA2 I;  3UE1 A;  2VQE L;  4A3B G;  4JBM A;  1G2S A;  2HDL A;  1L0X B;  2SNM A;  3U9S A;  4M1U B;  1PTO C;  3WOE A;  3N6R A;  5I4D A;  3DM1 A;  3ND9 A;  4N9T A;  1X54 A;  2PNH A;  3SK5 A;  4GOP C;  2EQS A;  1TWH H;  3OOC A;  2A73 B;  4GN3 B;  3W1G A;  4TVA B;  3H3V C;  3W1B A;  3GTJ B;  1V1P A;  4U68 A;  4IFD J;  3NBH B;  1TQO A;  2Z6K C;  4TSS A;  3DLL A;  4FDB A;  1CSQ A;  5JJL A;  2H5X A;  5E3F A;  2Z6B A;  5EPL A;  4ZK9 B;  1QE6 A;  2B8F A;  4A3K G;  3EFX D;  1U4P A;  5GAE C;  1WCM H;  1A62 A;  1I4G A;  4XT1 B;  1PFB A;  2WB1 E;  4K8J A;  1ZEQ X;  2JA6 G;  3D6C A;  2IX0 A;  5CV4 A;  4Y52 H;  3RZO B;  5HGQ A;  1I4P A;  3ITP A;  3IFD A;  1MJC A;  3MFY A;  2CWA A;  1I50 B;  2B2W C;  2EPB A;  2A6H D;  3F8T A;  2PW5 A;  1D5X C;  4FP5 D;  1HR0 L;  1IW7 D;  1I94 L;  3TP6 A;  4WRD A;  2QIL A;  4LMQ D;  5A2Q L;  2F0P A;  1PXU A;  3BZK A;  1EZ6 A;  2TSS A;  5EJW A;  4RAU C;  3A8I E;  1EWI A;  1STE A;  3SK8 A;  1BCP D;  5IP7 H;  1TVX A;  3K6O A;  5ELD A;  3ICE A;  1WVL A;  1STB A;  3NSW A;  5DNF A;  5JAV A;  2JA9 A;  2B2Y A;  3TEH B;  3IFT A;  3OTO L;  4X3U A;  4R4O A;  5IWA Q;  1N9W A;  3CC4 A;  4IPG A;  3M4Q A;  3VDY A;  4TQU S;  1NBW A;  2GA4 B;  2BDN A;  1XTD A;  1TS5 A;  5JOB A;  3FPP A;  1KIX A;  1EWC A;  4DR7 Q;  1HZB A;  3J81 j;  1TS2 A;  1HZA A;  1TWA H;  2A6E D;  2N49 A;  1X65 A;  2WKD A;  1S4Z A;  2E2J B;  1A3V A;  3M7N A;  1PZI D;  1ESF A;  4OGQ C;  1V1O A;  2GVB A;  3B6Y A;  3SGI A;  4DV5 Q;  2QDB A;  1JJG A;  1PYW D;  5EPK A;  4CJ1 B;  1S3O A;  3BVM A;  2NN6 G;  1YJW A;  2F3V A;  3K57 A;  2WV6 D;  1HNX Q;  1JCK B;  3NBI A;  3J80 E;  2L55 A;  1K83 B;  3NPP A;  1IYU A;  3VA7 A;  4IQZ A;  5CV9 A;  2RSO A;  4XQQ A;  5E4X A;  3C1F A;  1LLR D;  3QJY A;  3V05 A;  1PTO F;  5M5W H;  2ENB A;  3SVM A;  1HNX L;  2R7Z B;  3S1R H;  2VXW A;  1CM9 A;  2E76 C;  2AUJ D;  4HJ5 A;  1XMQ L;  2EYP A;  2JXM B;  2D62 A;  2JYO A;  4P75 A;  3MAQ A;  2YTX A;  3M4O H;  2F0I A;  3OIQ A;  3PF5 A;  1B9N A; 
#chains in the Genus database with same CATH homology
 1EL0 A;  2X6L A;  2F0V A;  4A3D B;  4KTA A;  2LY7 A;  2RA4 A;  3S9W A;  4DU9 A;  2K03 A;  2K5Q A;  3C46 A;  3T56 B;  3ERQ A;  2HUG A;  1RHP A;  5K5P A;  1CQF A;  1D1I A;  3S2D B;  4L6T B;  3BVG A;  1KDA A;  2ID0 A;  2O5J C;  2L4N A;  4HCS A;  1FYC A;  4C3I B;  3PUX A;  3MTS A;  5E1F A;  4NP5 A;  3R2I A;  1IHZ A;  2PZW A;  5IOD A;  2XRQ D;  3GTP B;  1ZYR C;  3MXU A;  4EQO A;  5D14 A;  3R2T A;  2C9O A;  1TY0 A;  2F03 A;  4R8I A;  1E2Z A;  1EYA A;  2CVR A;  2EY2 A;  1TR5 A;  1B3A A;  1L0Y B;  5C5L A;  1HFN A;  3I73 A;  1K8M A;  4NDX A;  4KJN A;  3DWA A;  2VNU D;  1GHJ A;  1PTO B;  1OXU A;  1TWH B;  1IKL A;  2LKV A;  1RTO A;  2XNA C;  4RH6 A;  2EYH A;  1BR9 A;  2SOB A;  4ZQ3 A;  1JQY D;  4LJZ C;  2RBM A;  5CV8 A;  3PIO 3;  1F2L A;  4RKL A;  3P75 A;  4WJW A;  4FF2 A;  1H9M A;  2D9U A;  2XWJ B;  1U4R A;  3M3Y B;  1B4O A;  4XDX A;  1LV9 A;  3VYR A;  3D31 A;  1ICW A;  2F0U A;  3S14 B;  2IJ0 A;  3QB3 A;  2NB0 A;  1I6V C;  3MWY W;  4FYD A;  2JSO A;  1VDZ A;  1ROD A;  2NBF A;  5I6Y A;  3S1R B;  2F0H A;  4DAV A;  2Z4H A;  1F77 A;  1XTC D;  3JAM L;  4DNR B;  4G57 A;  2EYM A;  2NVT B;  4KD4 A;  1SE4 A;  5D3I B;  1F9S A;  5CYU A;  1LO5 D;  5AFW A;  1KTK A;  2B2T C;  1JOR A;  2WB1 B;  2ZXO A;  1SJE D;  4IUU A;  1ZYR D;  4ME5 A;  1JOQ A;  1JC7 A;  1MSH A;  1KAA A;  2ZXP A;  1SJH D;  3PUY A;  2EJM A;  3GV3 A;  3GD7 A;  4IUP A;  2AQ1 B;  2O5I C;  1GUS A;  3AU7 A;  4S3S A;  2PZT A;  1A3T A;  4BBS B;  2A5H A;  1X32 A;  3ND8 A;  5IGB A;  2K05 A;  2B2T A;  5C4X B;  4DK0 A;  4A93 B;  2L1B A;  2A6H C;  1E2W A;  2F0L A;  1TWG B;  1GUT A;  2A6E C;  5C3E B;  1ET9 A;  3QO2 A;  2N88 A;  1FNW A;  3BDC A;  2HCI A;  1BNZ A;  2F0O A;  2K32 A;  1EIG A;  4DXF A;  1D2B A;  4CKC A;  1V8Q A;  2EOT A;  3A56 A;  1ZXT A;  4L63 B;  1KAB A;  2PZU A;  2LFN A;  4C1N I;  1PDQ A;  3BDL A;  4DGZ A;  3PUV A;  4FF4 A;  3DXJ C;  2XVS A;  3GV6 A;  4KD3 A;  4A3I B;  1HA6 A;  2A74 C;  3MC0 B;  4PMB A;  1PTO H;  4CHT B;  3TSS A;  4QUF A;  4RGN A;  4RGO S;  4HMI A;  1T5X D;  5FLX E;  1GHK A;  1WTX A;  4Z9C B;  4A3B B;  1EU4 A;  1SYF A;  3D8G A;  4RFB A;  4M8A A;  2R3Z A;  5DM7 3;  2YU9 B;  3TN2 A;  2L0C A;  1AP0 A;  3K5L A;  2KA7 A;  3NTK A;  1H9S B;  1QG7 A;  1SSO A;  4RA8 A;  2KCC A;  3MXP A;  1HTL D;  3E6Z X;  2OT2 A;  5IIF A;  1B53 A;  1S5F D;  1BF4 A;  5JEA H;  3IL8 A;  3T16 A;  4KKS A;  1ILP A;  1A2T A;  3L3O C;  4N9P A;  1HQM C;  4HSP A;  2JA5 B;  2F0S A;  5EKI A;  2IX1 A;  2KOL A;  2M00 A;  2B63 B;  4AYB B;  4OL7 A;  3WOF A;  5I2X A;  3Q22 A;  1EYC A;  4QIW B;  4O42 A;  5FKA C;  1V1P B;  2ICI A;  1I3Q B;  4KN7 C;  4CJ2 C;  1D5M C;  5KRU A;  1SE3 A;  3GTQ B;  5BN5 A;  1HHV A;  3RUZ A;  4H7B A;  1PLF A;  2HDM A;  1AEX A;  3TDQ A;  2MUY A;  1TT2 A;  5KNB A;  1BOS A;  4Y7N B;  2OEO A;  3FDT A;  2VB2 X;  3VYT A;  1SYE A;  3QWN A;  2B8G A;  3M4O B;  2IWH A;  5IT9 L;  2L11 A;  3L7Z C;  1M8A A;  4R9W A;  1BDO A;  1XX8 A;  2JEB I;  1EOT A;  2F0G A;  3Q0A A;  4P2C B;  2I46 A;  1WTW A;  3M7G A;  1PRT D;  3KK7 A;  3GP7 A;  1CZW A;  1DOK A;  4KY7 A;  1F2M A;  2EYL A;  1KDB A;  3HS0 C;  5JJZ A;  2PCF B;  3RMH A;  3NXW A;  2ZXR A;  3VYS A;  3UI2 A;  4OHJ A;  3BS1 A;  3MVV A;  4C56 C;  2K5W A;  1WTO A;  2YYZ A;  3URY A;  1CQV A;  3SEB A;  5TSS A;  2B2Y C;  3J7Y W;  3SDZ A;  3GTO B;  1NSN S;  4LAA A;  3C2P A;  1EY0 A;  2BOS A;  2XN9 C;  3H6M A;  1DM0 B;  1HCZ A;  1TS3 A;  2G9D A;  2WAC A;  4FXK C;  3GO5 A;  3S1N B;  2H1E A;  3K5O A;  3LNN A;  4ZUI A;  1HPC A;  4C3H B;  4A3E B;  2Q8R E;  3A54 A;  1STA A;  1X3Q A;  1LT5 D;  2ZT9 C;  4XQN A;  3TP7 A;  4ID6 A;  3N52 A;  1NAP A;  1R9T B;  3QG1 A;  2KEE A;  5I9P A;  3NP8 A;  5JVH 3;  2N55 A;  2K33 A;  3HOU B;  5K36 G;  1ENA A;  3ZYY X;  4KMU C;  3D6W A;  2EY6 A;  1FNV A;  4IUR A;  5G3L F;  2WAQ B;  4XTC S;  2PO4 A;  2XIW A;  3I3C A;  1JOO A;  1BCP F;  1Y1V B;  2IPK D;  5I6W A;  1PFN A;  5C0X G;  1CTM A;  5DEH A;  3AMU A;  4RHR A;  3BYT B;  1KDC A;  5E4W C;  1LT6 D;  5KND A;  3A7L A;  4OO1 H;  3PO2 B;  1DXM A;  2F0D A;  1GUO A;  1W6J A;  2M2L A;  3KLS A;  5EKK A;  1G6Z A;  1CHP D;  1JIC A;  1QIL A;  1PRT B;  1STY A;  3NK9 A;  5IGF A;  4C3H G;  4BWG B;  1SYG A;  1H9J A;  4CGY B;  3RLF A;  3EJI A;  3OWE B;  1M4V A;  4FVM A;  4EGV A;  1G91 A;  1A2U A;  5JVG 3;  3I8Z A;  4HN7 A;  2Z4I A;  5C4H A;  3S17 B;  1EEF D;  2KCN A;  4GZY C;  1YNN D;  1BQQ T;  5KEE A;  5KYL A;  1H9S A;  3HG9 A;  1XYI A;  5CBA E;  4PNY A;  3KBG A;  2B2W A;  2LMC B;  2PYK A;  2K01 A;  1OXT A;  1OO9 B;  3G6J B;  4CKE A;  1C8C A;  2F3W A;  1JWU D;  3D4W A;  3QIA A;  1LTI D;  4QMG A;  4HR7 B;  3K58 A;  5T1I A;  5C3W A;  2OXP A;  1EQV A;  2L9H A;  3KF8 A;  2RQX A;  1IKM A;  2G9H D;  4FO2 A;  1TII D;  1PTO D;  1SYD A;  5CC4 A;  3C1E A;  1QNK A;  1SMY C;  4G7O C;  2SDF A;  3S1Q B;  1SNO A;  2M9V A;  3H91 A;  3NUC A;  1LTR D;  4KV6 A;  2K7V A;  4ZRZ A;  2BE5 D;  2RVL A;  4PV1 C;  1SFO B;  3TBI B;  2HCC A;  5CV5 A;  1H9R A;  5EPJ A;  1LAC A;  4C1N K;  3W3A A;  1CZG A;  4K6L A;  4HMJ A;  1KLU D;  3OPO A;  1HXY D;  4TRD A;  1QB5 D;  1UEA B;  4ILW A;  2QF7 A;  4FXG C;  1F9P A;  2DN8 A;  3ONA B;  1TWF B;  1CA6 A;  4F7X A;  5FO9 B;  3U9O A;  4EVO A;  5KYI A;  1II3 A;  4H44 C;  3W2D A;  3NQT A;  4ZYS A;  4K14 A;  3OMC A;  4O1N A;  3GTK B;  4TKO B;  3TP8 A;  1EY7 A;  3PUW A;  5CGK A;  1LTS D;  1HTP A;  3C3L A;  2PPB C;  3S2H B;  2NVY B;  4G7Z C;  4KY6 A;  2R92 B;  2RDF A;  3NTI A;  2RKS A;  1RDP D;  5C4J B;  4IUN A;  2E2H B;  2PMZ B;  4KJO A;  1LTB D;  2MHV A;  2VB3 X;  2FFK B;  1B50 A;  1LTG D;  3AB9 A;  1FGB D;  3DUZ A;  3EQL C;  2F0F A;  1PZJ D;  3IAY A;  3Q6S A;  1HQR D;  3V96 A;  5ISR A;  5G3L D;  1O78 A;  2FJ2 A;  1BCP C;  1A6X A;  1OXV A;  1RD9 D;  1Q1B A;  4XQJ A;  4X3K A;  1SNP A;  4DAY A;  3HRZ C;  2D2C C;  2WIN B;  4KY5 A;  1SXT A;  2O2L D;  2FHT A;  1C4Q A;  3MZ5 A;  4BY1 B;  1F2Y A;  3NQI A;  1DZ1 A;  1GXD C;  5CBE E;  2JE6 I;  2B2U A;  2EE1 A;  1AN8 A;  1UAP A;  4OO1 G;  1V43 A;  1VCI A;  4KN4 C;  2SEB D;  1Z7T A;  4ZLT F;  2JA7 B;  1Y8N B;  3NWS A;  2LS0 1;  1EY5 A;  4XYQ A;  1O7Z A;  1OXS C;  2F1M A;  3J7A V;  5KNC A;  2RDH A;  3SHL A;  1BBX C;  3H94 A;  3TME A;  1W6K A;  1ET6 A;  1I4X A;  3CRK C;  3CHB D;  1DOL A;  5FK9 C;  2EVB A;  3MEH A;  5IOC A;  5LHY 1;  2F0T A;  3J81 L;  1G8Z D;  3A7A B;  3MXN A;  4DF7 A;  5EQ0 A;  4I7Z C;  4BS9 A;  1MD2 D;  3GQB A;  3R93 A;  3I4L A;  3SK4 A;  3S15 B;  2E2I B;  1VMP A;  1SNC A;  1SMY D;  1F9Q A;  4A3J B;  3OSO A;  4A3M B;  3OW7 A;  2B39 A;  1JWM D;  4UDU C;  5ELE A;  4R8N A;  4XYO A;  3P20 A;  4Q0F A;  5T1G A;  2EYO A;  3M4Y A;  1QJO A;  1DCZ A;  3HOW B;  2KED A;  1O80 A;  2F0E A;  2EJG C;  4JK1 C;  3HKZ B;  3DWP A;  1LAB A;  4IFD I;  3O13 A;  4RHS A;  2IW3 A;  2B2U C;  3BYY B;  2AQ3 B;  1ZKO A;  3GTL B;  5A2Q E;  2L12 A;  3S16 B;  5BN3 A;  4EQN A;  2ICE C;  2BCO A;  2JA8 B;  4DN4 M;  1RKN A;  3LX0 A;  1WD1 A;  4C3J G;  1CFM A;  1B9M A;  4QF4 A;  5DAU A;  1F2Z A;  1XXG A;  4ABN A;  3Q23 A;  3CKI B;  1ONL A;  1YNJ D;  3I72 A;  1FNU A;  2CW0 D;  2A68 C;  2EY5 A;  3HEJ A;  3K7A B;  2CW0 C;  2BE5 C;  5C3X A;  4J8Q A;  4E6I A;  4A3G B;  1H9K A;  5I9O A;  1MBY A;  4WOR A;  1Z6H A;  4ZKC B;  2EYJ A;  2F0Q A;  4XXE A;  5C0X H;  1CK1 A;  3CU7 A;  2BDO A;  5CV6 A;  1MGS A;  1SBB B;  4LK1 C;  1Y8P B;  1PRT F;  2TMP A;  3PMF A;  4IUQ A;  3WDN A;  2IT1 A;  1TS4 A;  1SND A;  5K36 H;  1RF2 D;  1WTR A;  1LT3 D;  1TU2 B;  2VUM B;  1ML0 D;  3X3M A;  5D3D A;  4PMW A;  2NTS A;  3FRP B;  5FO8 B;  4HTH A;  5F2D A;  2J0T D;  4IFD H;  3X3N A;  4HCE A;  1Q12 A;  2EXZ A;  3MXG A;  5C0X I;  4IAL A;  1EU3 A;  2F0N A;  1T5E A;  3H09 A;  1QCB D;  2NTT A;  3EA6 A;  2XRS D;  2EY1 A;  5IGE A;  2A69 D;  2H4O A;  4IFD G;  4IZ8 A;  1MI2 A;  1E0B A;  3KLR A;  4C2M B;  2FMM A;  1RTN A;  1SEB D;  4F88 A;  4KKT A;  5J39 A;  4V19 0;  3T51 B;  4HED A;  5IT9 E;  1EY9 A;  3KUP A;  3T53 B;  3VR3 A;  3D4D A;  1TY2 A;  1AW7 A;  3OWF A;  5CMD A;  1X3P A;  1MSG A;  2IX3 A;  1FR3 A;  5FO7 B;  4IUV A;  2DNC A;  1EWH A;  1Y69 U;  5LL6 S;  1QWY A;  1NR2 A;  2NVX B;  1Y8O B;  1UNS A;  3RD4 A;  5HGT A;  1A3U A;  3CQZ B;  1XWE A;  1C48 A;  1IYV A;  3HOX B;  3J81 E;  3FPU B;  2E74 C;  3PUZ A;  3A55 A;  3GTG B;  3VR2 A;  3PO3 B;  1SYC A;  1JB3 A;  2JP1 A;  1EY4 A;  5M5W B;  4C3I G;  5C5M A;  3TP5 A;  4K8I A;  2F0K A;  4CJ0 B;  1HUN A;  4J1M A;  5EBC A;  1U4L A;  1HA5 A;  2PW7 A;  4PQX A;  5JEA J;  2R93 B;  3MHB A;  3RZD B;  5CR3 A;  3I4N B;  2F0W A;  2BA1 A;  3QOL A;  4RCN A;  2K04 A;  2OF1 A;  3VR6 A;  4A3K B;  1Y1W B;  4HAE A;  2PQE A;  3ERO A;  5EGT A;  2E75 C;  4YIJ A;  2K28 A;  4IN3 A;  2AWN A;  1CHQ D;  1BO0 A;  2JA6 B;  4FNF A;  4L8J A;  1NUC A;  2FMC A;  4QB4 A;  1SDF A;  2I07 B;  1VF5 C;  4OIK A;  3T4A C;  3I70 A;  1I4H A;  1WCM B;  4K6D A;  4K5X A;  1GUG A;  1G29 1;  3D4R A;  4DXG A;  2FIN B;  1U4M A;  2JEA I;  4DA2 A;  2MJ8 A;  1EZ8 A;  5J22 A;  1NCV A;  2QKI C;  1Q3L A;  2NN6 H;  3NE5 B;  3P1H A;  3MFG A;  4RWS C;  1KNE A;  3J80 L;  1EQT A;  4KHZ A;  3K59 A;  4DAP A;  3NTH A;  1DOM A;  1K8O A;  1ESR A;  5D65 A;  5JPN C;  1CA5 A;  1F9R A;  1SAP A;  2B2V A;  3FEW X;  4G4K A;  1EEI D;  2DNE A;  1Q1E A;  4DFA A;  3LWE A;  3HP3 A;  1CI3 M;  2CQA A;  3NHH A;  4DNT B;  1DON A;  3SE0 A;  1JR0 D;  2AWO A;  1HRJ A;  1D1K A;  5C6A A;  2NVQ B;  3DMU A;  2EYF A;  1GOZ A;  1STG A;  4K5V A;  5NUC A;  5C0X J;  1EYD A;  5DM6 3;  1JWS D;  3SK6 A;  4RGT A;  1BUV T;  4IUT A;  5FLX L;  5JEA G;  4CKB A;  1WTP A;  1EY8 A;  4K5W A;  2V4D A;  2KJX A;  3DEP A;  3MA2 B;  2IL8 A;  2C5C A;  3P7J A;  1SNM A;  4ZAI A;  5C4Z A;  1ENF A;  1VF7 A;  1QOH A;  4V0B A;  1O7L A;  5FOB B;  5COR A;  2KQ3 A;  2F0J A;  2EDG A;  4NKL A;  4UAI A;  3BDO A;  1TWC B;  1PFM A;  5ELF A;  1QNU A;  4QCL A;  1BCP B;  2Q8T A;  2A68 D;  2F4I A;  3F2U A;  4XT3 B;  4B9X A;  2NYZ D;  1J8I A;  1D5Z C;  2KEC A;  3PV0 A;  3I4M B;  3VR5 A;  2MPM A;  1AFP A;  2Y0S B;  1SE2 A;  3BG3 A;  5BN4 A;  3FKI B;  2RDG A;  1CT1 D;  3DWQ A;  2XSC A;  3HOZ B;  2DY8 A;  3OMG A;  2NUC A;  1STH A;  3FMC A;  2K6A A;  1KLG D;  4DK1 A;  3A8J E;  4KK7 A;  2R61 A;  4ZKB B;  1JOK A;  4NW2 A;  4RGM A;  2EZV A;  2K5D A;  1PRT C;  4F8M A;  5M5Y B;  2NWG A;  3K5N A;  2Z1C A;  3KLS X;  4KI0 A;  4H0L C;  1D6E C;  3V2T A;  2EJF C;  2B2V C;  2AQ2 B;  1AZP A;  1O7Y A;  3BZD B;  3E0J A;  2WP8 J;  2AUK A;  4X3S A;  1S5C D;  3HGB A;  2KVM A;  5A35 A;  4RKB A;  4FF3 A;  3CRL C;  3VYU A;  1SYB A;  4RCO A;  3K5M A;  2Z8L A;  4I65 A;  1I4Q A;  1WD0 A;  4KKU A;  2MP1 A;  1YNN C;  1DJR D;  4U67 3;  5C44 B;  3G7L A;  4K2K A;  1GUN A;  3SXH A;  3HOV B;  3TZU A;  4WFN 3;  1Q8I A;  1TKW B;  3S1M B;  3K0Y A;  4BY7 B;  2PNR C;  4ZUJ A;  1PZK D;  4F87 A;  5EKL A;  2BA0 A;  1GUW A;  3A8K E;  3T13 A;  1HUM A;  2D5D A;  4PMC A;  3R3O A;  4KHV A;  4NMZ A;  3D3R A;  1U9R A;  3BVZ A;  2HQE A;  1PMR A;  3LWU A;  2F0M A;  4QUC A;  1S5E D;  1NR4 A;  1GJX A;  3VR4 A;  2RSN A;  1LTT D;  1RCV D;  5HUR A;  5M5X B;  3OIP A;  5IGC A;  1B1Z A;  4G7H C;  3I90 A;  4JBW A;  2CHB D;  1I6H B;  5CV7 A;  2L5T A;  1DYQ A;  3OHX C;  1YNJ C;  2KHS A;  4H13 C;  3FVQ A;  5J1Z A;  1R4Q B;  4Q5V A;  4EQP A;  1B44 D;  5IGD A;  5IGG A;  1ILQ A;  1UUP A;  1SNQ A;  3EVQ A;  1RJT A;  2R6G A;  3E5S A;  5JPM C;  3VA5 A;  4OO1 I;  1A15 A;  4MHE A;  2X69 A;  4FXD A;  5LL6 X;  1LT4 D;  1IW7 C;  2O4X A;  5KIX A;  4OIJ A;  5M3F B;  5ELB A;  1JE4 A;  2E2D C;  3QOJ A;  1WTV A;  3NBH A;  2A69 C;  1DD2 A;  5ELC A;  3GTM B;  4MIU A;  4CBV A;  2X6G A;  1EIH A;  3L9A X;  1S5D D;  1S5B D;  1G2T A;  4B9W A;  1EY6 A;  2WKC A;  3IKJ A;  2MGS A;  3Q24 A;  1IL8 A;  3M85 A;  5EBD A;  1Q90 A;  5I2Y A;  1B2T A;  5COY A;  2J4X A;  3I91 A;  1LTA D;  2QCP X;  3NWT A;  4K2L A;  1STN A;  4C3J B;  1R4P B;  3TZD A;  1E2V A;  2XWB B;  2WII B;  5KGU A;  4X3T A;  3J7A F;  3R8B A;  2DY7 A;  1VMC A;  3SR1 A;  1KNA A;  3HOY B;  1Z47 A;  3KBX A;  3PIP 3;  1AZQ A;  2QEJ C;  2Q8I B;  3HZX A;  1FD7 D;  3DEO A;  1J9O A;  1BXT A;  2K1B A;  4BBR B;  4A3F B;  4HSV A;  2SNS A;  4FF1 A;  1EFI D;  5M3M B;  3DHQ A;  1ENC A;  2NN6 I;  4MN3 A;  4B08 A;  1WTQ A;  4BA1 I;  2J7Z A;  1HFG A;  3JAM E;  2KUM A;  2NZ1 D;  4J6H A;  4XIG S;  3H0G B;  4ULL A;  5M9O A;  1OXX K;  1TWA B;  1I4R A;  4ODG A;  4BA2 I;  1G2S A;  2HDL A;  1L0X B;  2SNM A;  3U9S A;  4M1U B;  1PTO C;  3WOE A;  3N6R A;  5I4D A;  3DM1 A;  3ND9 A;  4N9T A;  3SK5 A;  3OOC A;  2A73 B;  3H3V C;  3GTJ B;  1V1P A;  4U68 A;  4IFD J;  1TQO A;  4TSS A;  5E3F A;  5EPL A;  4ZK9 B;  1QE6 A;  2B8F A;  3EFX D;  1U4P A;  1I4G A;  4XT1 B;  1PFB A;  4K8J A;  1ZEQ X;  3D6C A;  2IX0 A;  5CV4 A;  3RZO B;  1I4P A;  3ITP A;  3IFD A;  3MFY A;  1I50 B;  2B2W C;  2EPB A;  2A6H D;  2PW5 A;  1D5X C;  4FP5 D;  1IW7 D;  3TP6 A;  4WRD A;  2QIL A;  4LMQ D;  5A2Q L;  2F0P A;  1PXU A;  1EZ6 A;  2TSS A;  5EJW A;  4RAU C;  3A8I E;  1STE A;  3SK8 A;  1BCP D;  1TVX A;  3K6O A;  5ELD A;  1WVL A;  1STB A;  3NSW A;  5DNF A;  5JAV A;  2B2Y A;  3IFT A;  4X3U A;  4TQU S;  2GA4 B;  2BDN A;  1TS5 A;  5JOB A;  3FPP A;  1EWC A;  1TS2 A;  2A6E D;  2WKD A;  1S4Z A;  2E2J B;  1A3V A;  3M7N A;  1PZI D;  1ESF A;  4OGQ C;  1V1O A;  2QDB A;  1PYW D;  5EPK A;  4CJ1 B;  3BVM A;  2NN6 G;  2F3V A;  3K57 A;  2WV6 D;  1JCK B;  3NBI A;  3J80 E;  2L55 A;  1K83 B;  3VA7 A;  3NPP A;  1IYU A;  4IQZ A;  5CV9 A;  2RSO A;  4XQQ A;  5E4X A;  3C1F A;  1LLR D;  3QJY A;  3V05 A;  1PTO F;  2ENB A;  3SVM A;  2R7Z B;  2VXW A;  1CM9 A;  2E76 C;  2AUJ D;  2EYP A;  2JXM B;  2D62 A;  2JYO A;  3MAQ A;  2F0I A;  3OIQ A;  1B9N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...