5HGTA

Crystal structure of staphylococcal nuclease variant delta+phs l25k/i92t at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKKMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYTYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS L25K/I92T at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5hgtA00
2OXPA 4N9TA 1EQVA 1KDCA 3R3OA 2KHSA 3TP7A 3ITPA 5CV8A 3BDLA 2WACA 3SXHA 1EZ6A 4WRDA 5IIFA 5IGFA 4EQOA 1EYAA 4NKLA 2RDFA 3SK8A 3P1HA 5IGEA 1RKNA 3OSOA 2PQEA 4K8JA 1KDBA 1EZ8A 2F0VA 2OEOA 4IUNA 1SYFA 4LAAA 3TP8A 4ZUIA 1KDAA 1STAA 2PW7A 4RKLA 5J1ZA 4S3SA 3RUZA 5IODA 3PMFA 2EYHA 4KTAA 2F0WA 4HMJA 4B9WA 3C1FA 2M00A 3ERQA 3TMEA 3OMGA 3MHBA 4K2LA 5J22A 3NHHA 1A3UA 3D8GA 4HMIA 4K5VA 2NUCA 4K5XA 4IALA 4YIJA 5K5PA 5KYLA 3U9OA 4DFAA 5KEEA 5F2DA 3TP6A 3S9WA 1NUCA 4F8MA 4KV6A 2SOBA 1SNCA 5C5MA 2F0SA 5EGTA 5CV4A 5JOBA 2RKSA 5EKLA 2F0TA 4NP5A 1EYDA 1ENCA 4NMZA 4OL7A 1SNOA 5CC4A 5KIXA 3NP8A 5ISRA 1JOOA 4J6HA 3DHQA 2PZUA 1F2ZA 1JOQA 4ZQ3A 2LKVA 2SNMA 4K6DA 2EYLA 2RBMA 4KD3A 4PMBA 3MZ5A 5C5LA 2EYOA 2EYPA 5C6AA 2PW5A 3P75A 3SHLA 1EY0A 3D6CA 3MVVA 4QMGA 3T16A 1JORA 2HQEA 3NUCA 3SK6A 5E1FA 1STYA 4PNYA 5IGDA 4KY7A 5I9OA 5KYIA 1STBA 2F0FA 3EROA 1ENAA 4ME5A 3MEHA 3EJIA 4K14A 4KHVA 5EKKA 1JOKA 2PZTA 4H7BA 5HURA 3TP5A 5C4HA 2F0UA 5I6YA 1TQOA 3MXPA 3D4DA 3D4WA 3DMUA 3OMCA 2F0NA 2EY6A 2EY5A 4E6IA 2F0MA 2F0EA 1EY5A 5CGKA 4B9XA 4IZ8A 4EQPA 2SNSA 3H6MA 1SNDA 4KY5A 3C1EA 3BDCA 2KQ3A 5DAUA 4TRDA 1F2MA 5IGBA 3SK5A 2F0QA 2PYKA 5CV9A 1STNA 1SYEA 1U9RA 3QB3A 2EYMA 3LX0A 4K8IA 1II3A 4ODGA 1SYCA 3E5SA 1A2UA 1SNMA 5I6WA 4G57A 1A3VA 5J39A 5HGTA 4HTHA 2F3WA 2F0DA 4QB4A 5E3FA 3SK4A 4DU9A 1SNPA 2O4XA 4MIUA 2F0JA 4J1MA 5I9PA 2F3VA 4KD4A 4KY6A 4N9PA 5IGGA 4DGZA 4QF4A 5CV5A 2EYJA 1IHZA 2EY2A 1EY9A 2OF1A 1KABA 1SYGA 2F0IA 4I65A 3HZXA 3QOLA 4WORA 4DF7A 2F0GA 2PZWA 4F7XA 4KJOA 1KAAA 2EYFA 1NSNS 5KRUA 4KJNA 1EYCA 2F0HA 2F0KA 3QOJA 3NK9A 1SNQA 4R8NA 5NUCA 5C3XA 2EY1A 4RKBA 3OWFA 4EVOA 1A2TA 1EY6A 4ID6A 1SYDA 1SYBA 2ENBA 4PMCA 4EQNA 5C3WA 5IGCA 1A3TA 1EY7A 5C4ZA 5KGUA 5DEHA 2QDBA 4K5WA 1AEXA 1STHA 3NQTA 4NDXA 5JAVA 5CV6A 1TR5A 1TT2A 5M9OA 1F2YA 3HEJA 4ZUJA 3SR1A 3V2TA 1EY4A 3VA5A 1STGA 2EXZA 4K2KA 5CR3A 2F0LA 3EVQA 5CV7A 2F0PA 2F0OA 3NXWA 3T13A 1EY8A 5IOCA
chains in the Genus database with same CATH superfamily
4FVMA 2F03A 1X3EA 3NEMA 2KHSA 4UHVA 4IFDJ 2LXKA 1O80A 1BCPD 3MC0B 3PIP3 2RDGA 3FDTA 2PO4A 1LUZA 3W1GA 4IQZA 1SYFA 3M4OB 2B2WC 2JYOA 1VQ6A 1EFID 3K81C 2MFIA 3B6YA 4RGNA 4AYBG 4PG3A 3IAYA 4BBSB 2L4NA 1A3UA 4HMIA 3HOYB 1Z47A 4CJ0B 2Z4HA 1K28A 3TN2A 3UE0A 3VR5A 2UUCL 3TEHB 1GUWA 2QDLA 1S72A 4A3IG 1P8LA 3QG1A 1V1QA 2J0TD 2SOBA 4A3MG 2RKSA 1M1KC 4HSPA 2RSOA 1MI2A 1E3PA 3CAMA 4A3DB 2J4XA 1F2ZA 4XDXA 1PA6A 1E22A 1UE5A 4DR2L 3TQYA 5FLXE 3EFXD 1X55A 4JI7Q 1BO0A 3R93A 3O13A 1STBA 4DUYQ 4X66Q 3T1HL 2C9OA 3S1RH 2E2DC 2F0EA 5GAGC 3FPPA 2SNSA 1Y1WG 4DA2A 2XVSA 2DNCA 4TRDA 4H02A 5DM73 2Q2IA 5I2YA 3CRKC 1II3A 4ILWA 1PXUA 4DUZQ 2DJGC 1A2UA 1SNMA 5I6WA 1WYDA 2Z6KA 2JA7B 2X6LA 3F2BA 1TS3A 1Q1EA 1SEBD 5LMUQ 1D5ZC 2R92H 2I5LX 1TS4A 4C3JH 3CCLA 1OXXK 4DAPA 3GTMH 2JA6B 1K73C 1SMYC 4P73A 5NUCA 1SNQA 4ZAIA 3ERSX 1DXMA 1XYIA 1JC7A 4JBWA 4ID6A 3PO3H 4HCSA 5JAVA 5KNCA 2AMCB 4A3MH 1CI3M 3HOZG 1EOVA 2F0LA 3ZJYC 4YCWA 4XQJA 4CBVA 4B3MQ 4DV3L 1M90C 3PO2G 5BN4A 3VDYA 2Q8RE 4CGYB 3CXCA 3CCSA 4UP8A 4OIJA 1X3PA 1WTOA 3P7JA 5J1ZA 1YBYA 1OXVA 2H1EA 2PI2E 1S5DD 4A93B 4AQYL 1TS2A 3S1QH 3VR3A 1VQKA 2JA5H 1WFQA 3NQIA 1PH4A 3A0JA 4MHEA 1VQIA 1YEZA 3I4LA 1PFMA 3K58A 1JE4A 4L5RC 3HGBA 1SFOH 3OTOL 4NPSA 2VQFQ 4CHTB 2B39A 1SE4A 4R9WA 4LF9L 2JN4A 1VQDA 2VZAA 4FP5D 4Y7NH 5FJ8H 2EJMA 5FLMG 1JT8A 2ICEC 1STYA 1YNNC 1I6HH 2F0FA 1YNJC 2MO0A 2R7ZG 4BXXG 1WCMG 2YU9B 4A3LG 2CH4W 1UNSA 4KN7C 4E6IA 4XYQA 4JVZA 1N36Q 1J8IA 3H6MA 2H4OA 1EWCA 2K1BA 3CC4A 1NR2A 4Z9CB 4IUQA 1GUTA 2KBNA 4ABNA 4YHHL 4HJAA 1PRTF 3BVMA 1PH7A 4K8IA 1K8GA 3W5OA 1M8AA 2Q8IB 1XNRL 4FDBA 3S16B 5HGTA 2CW0C 2A6ED 5EBCA 3ND8A 4A3BH 4A4IA 4O1NA 5EPJA 4FF1A 1KABA 1KAWA 3CCQA 1DONA 3HOWG 3BYTB 1A15A 3NWSA 3GTJH 1TT2A 3IL8A 1SSOA 1WCMB 2TSSA 2ZT9C 4GN4B 1KDCA 3R3OA 3E3XA 2B8GA 5IYCG 4EQ5A 1J5EL 3SGIA 4B3TQ 1MBYA 4UP7A 4IPHA 1IL2A 3HKZB 3W3AA 3BVZA 3KLRA 4JI0L 1F9QA 3ER0A 3ICEA 3KJOA 1EZ8A 1C8CA 1ZYRC 1L0WA 4C3IH 4RGTA 1PDQA 3CCEA 4R1JA 5M5YH 5T1GA 2F0WA 3I91A 1K0SA 1GHJA 3TMEA 2DY8A 1H9JA 4FF4A 5JPNC 4OHJA 3GTQH 2E2IH 2Q2UA 1KLUD 4BBRH 4OO1G 5JJZA 5DM63 5C44H 2YTVA 4A3EH 4A3CG 4RGOS 1FL0A 1QG7A 3C46A 2VXWA 2OTLA 1AE2A 3MZ5A 3S17B 4DV0L 2HUGA 5IE8A 5IP9G 5JPMC 3NUCA 3PO3B 2ZJRA 4GOPB 2B8FA 4DNIA 1LABA 2L15A 3I4NB 5IYBG 2IHFA 2KHIA 1WI5A 4ME3A 1JQYD 1HNZL 3CKIB 2M9VA 2AQ1B 2R7ZB 4LF7L 1TWHB 1XPOA 3BZCA 1TWCH 2FINB 3KDFA 4RGMA 1DYQA 1LTAD 2NZ1D 4TVAB 3UI2A 1SMYD 4GN3B 5D3IB 1YJWA 3S1QB 1T9HA 2NWGA 4A93H 1A63A 1RTOA 1LTRD 1JR0D 2F3VA 2G9DA 2EY2A 1IKMA 4WORA 3QOLA 2D0PA 2V4DA 4GNXB 2RQXA 1PTOB 1GXDC 2PZWA 1YJNA 3CPFA 3S1RB 1BXTA 1NSNS 1H9SA 1SE2A 2D62A 1NCVA 2FMMA 1QNUA 4IFDG 1SYBA 4JYAQ 1FNUA 1I4HA 1LLRD 1CZWA 4A3LH 5C4ZA 2G9HD 5DEHA 5ELOA 5LMNQ 3D3RA 4A3EG 4OXPA 4ZUJA 3PIOA 2PNRC 1LYLA 4JI7L 3EBEA 1EUJA 3GTLB 4KLKA 4N9TA 5AJ3L 1KRTA 2CW0D 1EYGA 3BDLA 1R4QB 5IIFA 1LT3D 4GLVB 2F1MA 2NVYH 2RDFA 1SJED 1W3SA 2JA6H 1S40A 1D1KA 4C3JB 1V1PB 5I4DA 3C3LA 2ATWA 4B9WA 3FKIG 5I2XA 4A3EB 1KRSA 4RWSC 2QA4A 2ICIA 2E2HH 1O7YA 4CKEA 1IBMQ 4A3IB 2HCIA 1X65A 4IALA 4BY7H 1CA5A 2B2VC 3G71A 5C3EB 3DXJC 1YITA 1MGSA 4L5QA 3J80L 5C4XH 3CMEA 4DR3Q 1IKLA 5FLXL 3FKIB 1ZEQX 1DM0B 2BH8A 1IW7D 1EQQA 3PCOB 4UPAA 1JOOA 5C0XH 1KC8C 4LFCL 2LKVA 3J7AV 1XMOL 3A55A 4Q5VA 5ELBA 4WJ3M 1U4PA 2UUCQ 4DV0Q 3U4VA 1V43A 5CORA 2K28A 1BNZA 1RDPD 3EROA 5GAEC 1F2LA 1I50H 3H0GG 2CWPA 4LK1C 2BA0A 3G48A 5EJWA 2HD3A 2DNEA 2R92G 1D5XC 2EY5A 2NVQH 3R8BA 5IYDG 3RNUA 3HOVG 3NTHA 4DAYA 3S15B 4FF2A 1FR3A 3K5MA 1GUOA 1HJPA 4WJWA 4X65L 1U9RA 1DZ1A 5G3LF 5IT9L 2YV5A 2Y0SE 4GOPC 1LTTD 4DV7Q 4DR2Q 4ZK9B 4O0AA 4QB4A 1I3QB 4X6AH 2A5HA 4KY6A 1XNRQ 4DAYB 4RMFA 4QJFA 4UY8C 3PO3G 2F4VL 1HTLD 2QW7A 4AYBE 1J5EQ 4X3UA 4C1NK 1EYCA 1D1IA 2WIIB 2JSOA 2A73B 4CKBA 1CKMA 2WFWA 3PV0A 4K5WA 4NXNL 1LTBD 1S3OA 3URYA 3AFPA 1TR5A 4V0BA 3HEJA 1A62A 4AIMA 2DN8A 1I4PA 1VQ7A 1Y8PB 4JI1L 1WTHA 1NE3A 3TP7A 3J7A5 3ITPA 2ID0A 3L9AX 4EQOA 1I6HB 3D6WA 4APVA 3EA6A 1EFWA 3BS1A 1UEAB 4EGVA 1EEFD 1FJGQ 4QIWE 3TZUA 1SFOB 2C5CA 4S3SA 4F87A 4DV7L 2IL8A 4K2LA 2NB0A 1G291 3KLSA 1U4RA 3D8GA 2NN6H 5ELFA 5KYLA 2EQSA 3IFTA 3K8AA 3S15H 4DV2L 5JJKA 1ZYRD 1SNCA 1J9OA 5EGTA 4PQXA 2F0TA 5AJ3Q 3OW2A 4BS9A 1QZGA 4C3HG 2CQOA 1HZAA 1A0IA 1GO3E 1SNOA 1ET9A 5KIXA 1VMCA 4ZCKA 1QVCA 1HTPA 2XIWA 1KXLA 3D6CA 4IOAA 2HQEA 1QJOA 2R93H 1SRUA 4A3JH 3G4SA 1ZXTA 2VNUD 4HIMA 3BVGA 1T5EA 5HURA 3PGZA 2A6EC 4A3DG 5C4HA 4GKKL 3FKIH 3DMUA 4JOIA 2VQFL 2Y0SB 4R4OA 2ASBA 3KF6A 2KQ3A 1VQLA 2N3SA 1VQOA 2XGTA 2IHEA 2LMCB 2VY3A 4P74A 1SBBB 3FPUB 1PH2A 3T4AC 2ES2A 5C4XB 4A3GH 1N8RC 1CQFA 1ILPA 4JBJA 2GVAA 3IRBA 4IPCA 2B29A 5E3FA 2EVBA 2OTJA 1LT5D 1PVOA 4MIUA 1E2VA 1JJGA 5CBAE 2L11A 2A68C 3KLSX 2UUBL 1LTID 4DR4Q 3QR8A 3PUXA 2GN5A 1PH8A 4WJ4A 3JC66 3QOJA 1TKWB 2Z1CA 1VQ5A 1N33L 2UXCL 1EY6A 1EQRA 4LFAL 2B2TA 1IBML 1G51A 1BCPC 1PYSB 2EXZA 5IYBH 4QIWB 3S2DB 2VS1A 1K8MA 4DR5L 4YWMA 4NXMQ 2NZOA 4OX9Q 1L1OA 3HOXB 3P1HA 3QJYA 3OSOA 3FMCA 4IUNA 1X56A 5EKIA 3TP8A 3M7GA 3DM1A 1STAA 5E4WC 2EZVA 4KTAA 1DOKA 1HR0L 4TKOB 3I4OA 2EIFA 2L9HA 2VB3X 1Q12A 1H9MA 3JAMi 3A74A 4L63B 1B3AA 5IWAQ 1WTRA 3CRLC 5FK9C 2I46A 4FO2A 4AH6A 3CPWA 2E2HB 3J7AF 5K36H 1HNZQ 4A3GB 1G2TA 4A3KG 4B08A 1K3BC 2NVTB 2DY7A 3J7ZC 3DHQA 4XT1B 3NE5B 1DJRD 3AQQA 4R4IA 5C6AA 1SR3A 4A76A 4JG2A 2EXDA 1K8OA 3P75A 3MXGA 4RHSA 4DR1Q 1BBUA 4ULLA 2BE5D 1BVSA 4B3SQ 4KY7A 2QEJC 1AW7A 4DR5Q 3DWAA 5I6YA 3J81E 1FVIA 3NBIA 1VQEA 4IO9A 3TSSA 3I2ZA 3RZDH 2Z8LA 1FGUA 1Z6HA 3GDEA 4JW0A 4CJ1B 2O5JC 3SK5A 2E2IB 1EWHA 1CM9A 3X3NA 4GKJQ 1IYVA 4HEDA 1KIXA 1AP0A 3S2HB 4YHHQ 2XNAC 2JA5G 5IT9E 2ZTDA 5M5YB 1CUKA 1HR0Q 4HTHA 1I4QA 1TY2A 5IYCH 1B4OA 2F0JA 1VQFA 4R4QA 2E75C 3UDIA 3K6OA 4QF4A 3U4ZA 3KF6B 2JA7G 1WTPA 1EY9A 1SYGA 1C4QA 2F0GA 1YNXA 2EYFA 1PLFA 4GKJL 2R93G 4HN7A 1PZKD 1Q3LA 4DR7L 2E2JH 1UWVA 2CWAA 4KHZA 4RKBA 4PMCA 5GAHC 4YCVA 4X62L 2K7VA 1VQAA 4YWKA 4ZRZA 3K59A 4IOCA 2WAQG 4HSVA 3VA5A 1STGA 2I5HA 4CJ2C 1PH5A 3UDGA 1C9OA 1KNAA 4EX5A 4B3SL 4YY3Q 1JCKB 4WRDA 2QILA 2D9UA 5G3LD 1Y1VH 1NY4A 2RDHA 4A3FG 4B3TL 1M4VA 4RG1A 2F0VA 3KFUA 4DR3L 4XQNA 4I7ZC 3RUZA 3V96A 2KCNA 3PMFA 1PRTC 2DGYA 3MHBA 3F2CA 3S14B 2CVRA 1HZ9A 4I7AA 2NUCA 5BR8Q 2ZXOA 4LF8Q 4DFAA 3NTIA 2L5TA 3HOYG 4F8MA 2FMCA 5HY6A 4DR6L 4C2MH 1B44D 2KEEA 4XXEA 3H91A 1UE7A 4JI2L 1AFPA 3HOZB 3FEWX 1UAPA 3NBHB 1GOZA 2PPBC 1SN8A 3HOUH 4IPDA 2B2UA 2D0OA 4QMGA 2UUAL 3U50C 1E7ZA 1QUQA 2I07B 1IBKQ 1OXSC 4K14A 1SAPA 1HUNA 1EY5A 4CDDC 4Y7NB 2B63G 5M3FG 3VYRA 3QIAA 4KY5A 1G91A 1EIFA 2K32A 2MJ8A 4NW2A 4OGQC 3I4NG 3W2DA 4DNTB 3S14H 1H9SB 2R7DA 1LM0A 2EJGC 1A3VA 5J39A 1VQJA 4A3KH 4DV4Q 3MXNB 1HZCA 2GVBA 2Q2HA 1UEBA 4A3KB 2KJXA 1YIJA 1N34L 3CCUA 4BBSH 1YI2A 2F0HA 1O78A 1Y1WH 4R8NA 1K8AC 1MJCA 4DV1Q 4A3JB 1I50B 3PQIA 4CDFC 5C3WA 1DD2A 3WWVA 1TVXA 2QDBA 1AZQA 1Q1BA 1STHA 3GTOH 3Q24A 2B2TC 2NVYB 1LTGD 2BH2A 1EY4A 3RMHA 2E8GA 3T13A 2KOLA 4QY7A 1IYJB 3Q8DA 2YYZA 3GTGH 1ICWA 1RF2D 4F88A 4LNQA 2X69A 3GTMB 5H1SE 3SK8A 1E24A 3F2DA 1XTCD 5C0XJ 4C2MB 4AQYQ 4G7HC 2MO1A 3IFDA 2JA7H 1Z9FA 2XWBB 2NZHA 2JA8B 3ULLA 4U68A 1DCZA 2YTYA 5DLQE 2D5DA 2A69C 2UXDQ 1CTMA 3VYTA 4C3HB 1HR0W 5F2DA 1HRJA 4N8FA 4DV4L 2QEXA 4JOIC 3DUZA 2HHHL 2XWJB 3GV6A 1YVCA 1HCZA 3A5UA 4J6HA 5LMNL 3H15A 4OEMB 4PMBA 1IW7C 2PW5A 1HH2P 3BJUA 5CBEE 5EPKA 4LFBL 2X6GA 4QCLA 4DK1A 1QB5D 5E1FA 2HIVA 1JOKA 4BY7G 3TP5A 3Q6SA 1MKHA 4A3MB 5C4XG 1LT4D 4X62Q 3DEOA 3LGJA 4DV6Q 2MQHA 2BDNA 2PYKA 4DN4M 1FNVA 4ZLTF 3HOYH 1QUQB 1BR9A 1R4PB 2VL6A 1JMCA 1N32Q 4AYBB 2KCCA 4BY7B 2WAQE 3CCMA 1CZGA 4LF7Q 4KD4A 4K0KQ 1S5CD 4LJZC 1L1OB 4V190 1HNXL 1PH6A 4KMUC 1YZ6A 1B3QA 1KAAA 4POGA 3RZDB 5HGQA 3SDZA 2NTTA 5EPLA 5C3XA 4DXGA 1OO9B 1GHKA 3TDQA 1S5ED 2TMPA 3CQZB 4DV6L 1KHIA 4DPGA 3HOUB 1K9MC 3RR5A 3Q23A 2A1AA 4LF6Q 2AQ3B 3H0GH 2GA4B 3PIPA 5EBDA 4JI6Q 5D14A 2LXJA 5ELEA 4PZ8A 4LF5L 1TY0A 4L5TA 2ALYB 3G7LA 3M4PA 1BQQT 4JK1C 4LWCA 1PRTD 3ULPA 1AE3A 5A2QL 1F77A 5C3EH 4RH6A 3K5NA 2EYHA 1CSPA 3C1FA 5C44G 3ERQA 4QL5A 5M5WH 1QZHA 4K5VA 3A8KE 2QKIC 1JWSD 2AHOB 4OO1H 4P2CB 4HAEA 3K80C 1HXYD 1WJJA 4OX9L 1HNWL 2IW3A 2VQEL 2EPBA 3M3YB 1WTVA 1Z7TA 1LTLA 5CC4A 2HHHQ 1F9PA 2IT1A 3F1ZA 5ISRA 3GTLH 2A19A 2L12A 1JOQA 1H9RA 2SNMA 4K6DA 2ZTEA 2EYPA 2ZXPA 2VUMG 5IP9H 3Q0AA 3M4QA 1IBLQ 3A8IE 3MVVA 2JP1A 1BBWA 2KA7A 4IJLA 2UXCQ 3TRZA 3TZDA 5EQ0A 1WTQA 3CC2A 2JA9A 5ELDA 2WKCA 3GO5A 1QVGA 1TIID 2PZTA 1EU4A 4H7BA 1D2BA 2F0UA 3A8JE 3BU2A 3OMCA 2QCPX 1VQHA 4R4CA 3MAQA 2IX0A 5K36G 4LFCQ 2VQEQ 2N78A 4PZ7A 1QNKA 4DV5L 3BDCA 4C3HH 5IGBA 3AEVA 1STNA 1Q81C 3ULJA 1AZPA 1ASZA 2BOSA 2KVMA 1XNQQ 1LO5D 5IT9c 1H9KA 1K83H 4DR1L 1PTOC 1AN8A 5CYUA 3FVQA 1C0AA 1FYCA 3J81i 2HCCA 2NN6G 4BBRB 4QUCA 5M3MB 5LL6X 2B2WA 1O7ZA 2O4XA 4XQQA 1E2ZA 1KL9A 1YHAA 1ILQA 2RF4A 2BE5C 2B2YC 4DF7A 4HIOA 2N88A 4GOPA 1JICA 4PV1C 1EWIA 3J81L 2F0KA 5COYA 1GD7A 5A35A 2OQ0A 2ZM6Q 4MZ9A 3EQLC 4U673 2RHQB 3I3CA 1QVFA 3CD6A 3KUPA 4LMQD 5LMUL 3OYYA 3GTGB 5M9OA 3VYSA 3V2TA 3MA2B 1PH1A 3HKZG 4GN5A 2F0PA 2F0OA 4X66L 5C3EG 3T1HQ 3HRZC 2OWOA 5AFWA 1X3FA 3AU7A 2AUKA 4KN4C 3STBD 1TWFB 1TWAB 1UUPA 3F2UA 1QWYA 2AKWB 5JEAJ 3K0XA 2PQEA 1L2FA 2IPKD 1PH9A 3I7FA 1PHJA 4RKLA 5D3DA 1YNJD 2IX1A 2I5MX 2NN6I 3S1NB 1B9NA 1EQTA 1JWMD 2B2UC 2AWOA 5LHY1 3I90A 3KYHC 3S16H 2JEBI 3A54A 2R92B 3KBXA 4J15A 1PFBA 3E6ZX 4O42A 1PH3A 2ZJPA 2UU9L 1MSGA 3J81c 3OIQA 4OL7A 4P71A 2K04A 2B3GA 1GM5A 3RLFA 4Q0FA 1JJ2A 2R7ZH 2WINB 2XSCA 1BKBA 1RHPA 1WCMH 5C5LA 2EYOA 1D7QA 3NTKA 3CP0A 3T16A 3H94A 2BDOA 1BCPF 4R8IA 1WD0A 4G4KA 4ZYSA 1V1PA 4KHVA 3T51B 1VQNA 1I4XA 3D4RA 4DV5Q 2ZJQA 3MEFA 2E5LL 2UUBQ 1U0LA 2K52A 4JI8L 3K57A 2E76C 3STBC 3K0YA 3OPOA 3Q22A 3I70A 2LFNA 3UE1A 3HOUG 1KNEA 3KF8B 3LNNA 3KJPA 3TREA 3E5SA 4C3JG 1XJVA 1KD1C 2CH4A 1LACA 1G6ZA 1X6OA 3I4MB 1NJIC 3SK4A 1CKNB 4JI8Q 3OTOQ 5FO7B 3BDOA 3CW2C 1IHZA 4A3GG 2WB1G 2IWHA 4KJOA 2FFKB 4ZKCB 4RCOA 3AFQA 4X65Q 4FNFA 2EY1A 2XN9C 4JI0Q 3H3VH 2R61A 1A2TA 2RA4A 1SYDA 4JC0A 3HOVB 1X54A 1OXTA 4JI1Q 2K5VA 1PTOF 1HPCA 1TS5A 4UDUC 4LF4Q 1FJGL 1PTOH 3DWQA 1MSHA 4JI6L 5FLMH 2K05A 5IGEA 1VQ9A 3T56B 1CK1A 4MTKA 1N36L 4TQUS 4IUPA 4BA2I 3L7ZC 1CSQA 4IFDI 4GLXA 1CT1D 1XPUA 1XPRA 1ASYA 5J3BA 4K5XA 3U9OA 5E7NA 2IJ0A 5FO8B 2YTXA 3FP9A 5JJIA 1WD1A 2IX3A 4KV6A 1TWHH 1VF5C 1ENCA 3I73A 2MHVA 4H0LC 2HT1A 4JYAL 1SE8A 4QGUA 4KKSA 2JXMB 3PSIA 1P16A 3PO2H 4JV5L 5IGDA 1ICFB 4LF4L 2NVTH 4TSSA 3PF4A 3W1BA 3GTOB 1HHVA 5CGKA 2ZM6L 4B9XA 4IZ8A 1L1OC 4EQPA 1SE3A 1KTKA 1SNDA 3I55A 1RCVD 3EN2A 4BWGB 3S1MB 1FNWA 2O2LD 1C7YA 4DR7Q 5M3MH 2BCOA 4KHPQ 2V1CC 4FYDA 2AQ2B 4LF9Q 5IYDH 4QUFA 4G57A 5T1IA 1HFNA 4FXGC 3S1NH 1IXRA 1HFGA 3WDNA 1B9MA 4J1MA 4YWLA 1YHQA 4RAUC 2EYJA 1EIYB 1IL8A 2QGQA 4DK0A 5C0XI 2OF1A 2F0IA 1G6PA 3HZXA 4B3ML 1XWEA 3KF8A 4KHPL 4LW1A 4BBSG 1W6KA 4ALPA 4A3FH 1XMQL 3PUWA 5IY0A 2KECA 2K4KA 2ENBA 1VQPA 2ZXRA 2JQOA 1VF7A 3HOVH 1CA6A 1X3QA 1NTGA 1F2YA 4JPBW 4MNOA 2D2CC 3EVQA 3NXWA 4OIKA 1J6QA 1EY8A 2UU9Q 1FD7D 3VR2A 4DAVA 5BR8L 4X3KA 2N8NA 4XYOA 1EZ6A 1D5MC 4DKAC 5M3FH 3M85A 5M5XB 3CQZH 4IPGA 4K8JA 2CQAA 3BYYB 2PQAB 3MWYW 4JI3L 2F3IA 1XMOQ 1BF4A 1KDAA 3MFYA 2Z4IA 3KOJA 4WFN3 3I4MG 2J7ZA 2L1BA 4Y52H 3OMGA 1NR4A 2DJFC 5IWAL 4DV2Q 2UUAQ 4FF3A 2K5DA 5ELNA 4K6LA 2E74C 3TP6A 4C3IB 3NWTA 5JOBA 3KK7A 3QWNA 1DOMA 1HQRD 1MJEA 1PFNA 3NP8A 1OTCA 1ONLA 3CF5A 4KKUA 3NENA 2I0QA 2EYLA 2RBMA 4KD3A 3VA7A 2NTSA 3KDFB 2K14A 3SK6A 4JV5Q 2CHBD 2MP1A 3MEHA 3H09A 2R93B 4A3FB 4C3IG 1I6VC 3H3VI 1VQBA 3D4DA 3CCRA 1B70B 2F0MA 4KI0A 2XRQD 3CMAA 1Y1VG 1PZID 5DAUA 2E2JB 1E0BA 1FGBD 1UE1A 2WAQB 4C1NI 4BBRG 3VR4A 2JA5B 2NVXH 3MTSA 1SYCA 1U5KA 4XIGS 4LUOA 4LF8L 4QQBX 2F3WA 2F0DA 1SNPA 4NXNQ 4K0KL 3BZDB 3K5OA 3C2PA 2HQLA 4N9PA 3DEPA 4DGZA 2JK8A 2Q2TA 1WTXA 3AMUA 3S2HH 1EU3A 3A7LA 2K01A 1VMPA 3JAML 1I5FA 1TWAH 1EOTA 1TWFH 2Z6KC 2EDGA 4HJ8A 1E1OA 2JJQA 4X64L 5FJ8G 2L55A 4EQNA 5IGCA 3OWEB 3JAMc 4A3BG 2IY5B 4HJ5A 2VW9A 1XX8A 2F52A 4LUZA 1RD9D 3S17H 4LFAQ 1X9NA 5CV7A 2JA6G 1EEID 1F9RA 3QO2A 1TWGB 1Q46A 2LS01 5IOCA 1DOLA 2UXDL 3TS2A 4GZYC 1NNXA 1PRTB 1EYAA 3M9BA 2K5WA 4NKLA 4BY1G 3TS0A 1PYBA 2F4VQ 1VQ8A 1B53A 4LAAA 2MGSA 4ZUIA 3GTQB 1VCIA 1SROA 3GQBA 1S5BD 1DGSA 2EOTA 3HOWB 1W2BA 4X64Q 2M00A 2HDMA 1TU2B 1JJCB 1XNQL 3P20A 3RN2A 1I3QH 1HQMC 1S4ZA 2UXBQ 3N52A 2R7FA 1KLGD 5A2QE 1ET6A 1GKHA 1EYDA 3SE0A 1RODA 1NAPA 2E5LQ 2B2VA 4OONA 4JI5Q 1W6JA 2P5ZX 5JVH3 1N32L 4HJ7A 4JBKA 2Q8TA 3RD4A 2MNAA 3L2PA 5LMNW 3S2DH 3EJIA 2PQAA 1L0YB 1JE5A 1A6XA 2B63H 1BDOA 4RA8A 3HS0C 1B1ZA 4PZ6A 4A3JG 4O2DA 1GJXA 2BA1A 3U9SA 5IP7H 2CCZA 5FLXc 1SYEA 2JEAI 4GNXC 3G6EA 2WB1B 2HDLA 1WOCA 3CC7A 1Q86C 2K33A 2EJFC 2VB2X 1K83B 1UE6A 4BXXH 1PFSA 3ONAB 5FO9B 1IBKL 2MPMA 2R6GA 1YJ9A 2PI2A 4IUVA 4DV1L 1Y14B 5JEAH 2R3ZA 4KJNA 2JA8G 5LL6S 4CDCC 1I4RA 1WTWA 2NVXB 2F4IA 3GTKB 3FHWA 3K7AB 4EVOA 4LFBQ 1BBXC 3DM3A 4JI5L 1JB7A 1Q8KA 2NVQB 1EIGA 3HOZH 1RL2A 4F7XA 4IN3A 1HUMA 2PCFB 3J80c 2ZTCA 2WACA 3PIO3 2C35B 4N8X1 3TBIB 2WKDA 3FRPB 4L5SA 2PMZB 1Q8IA 4DV3Q 2CKZB 1KDBA 1MHWC 2PW7A 1I94L 3GTKH 1Y8NB 4A3DH 4HMJA 1N33Q 3ND9A 4IUUA 3RZOH 4RCNA 1BOSA 1GUSA 5J22A 1K3RA 1EIHA 1VQCA 2Z0SA 5CMDA 2RVLA 5KEEA 3S1MH 2SDFA 1XXGA 3E9IA 3GP7A 3M7NA 4DR4L 5FKAC 5IP7G 2K5QA 4NB3A 2UXBL 1EL0A 4XT3B 5GROA 4M8AA 1CQVA 2LSSA 2F0SA 3I4MH 1G2SA 3KBGA 4NMZA 3K5LA 3HOXH 2K03A 2EE1A 2PNHA 3RLNA 3U58A 4DAMA 4PNYA 4DUZL 5M3FB 3NBHA 5JEAG 4YY3L 4ME5A 5EKKA 1N34Q 1ESFA 3H0GB 2F0NA 4GS3A 2EY6A 3HKSA 3JAME 1BUVT 1YHBA 2A8VA 1PTOD 3VR6A 4UAIA 3A7AB 3CU7A 3NELA 1L0XB 3D0FA 4B3RQ 4KK7A 3GD7A 2AUJD 2EYMA 3LX0A 3KLWA 3SVMA 2KUMA 4GNXA 2K75A 1O7LA 3OOCA 2G5DA 2XTIA 3NPPA 3T1YQ 2M2LA 3HP3A 5E4XA 4IFDH 1IZ6A 1SDFA 1Y8OB 1SMXA 4I65A 1HA6A 2SEBD 3J80E 1X32A 4HIKA 3NK9A 1MIUA 3NSWA 1A3TA 1EY7A 4LF6L 3MFGA 1TWCB 4NDXA 3HKZE 5CV6A 4A93G 3SR1A 2PMZE 1B7YB 4C56C 1RJTA 2A68D 5KGUA 3UDXA 4OWWB 3I4NH 4X3TA 3RLOA 2CFMA 5IGFA 3M3YH 1N9WA 3PUZA 3WOEA 2KENA 1RKNA 2XRSD 2OEOA 1LV9A 2RCFA 1AH9A 1R9TH 5IODA 1NMGA 1V8QA 5KNDA 1U4MA 4G7OC 3OHXC 3T1YL 2O5IC 3EIVA 3NHHA 4MTNA 4IJHA 2JA8H 3AB9A 1XTDA 4OELB 1CHPD 4A3IH 3UDFA 3T53B 2WP8J 2A69D 3S9WA 1G8ZD 3H3VC 1V1OA 5CV4A 4H44C 5EKLA 1KQSA 4A3CH 2YU9H 2N49A 1WVLA 1PMRA 4KKTA 2Z9HA 2VUMB 5JVG3 4JI3Q 2LY7A 4IUTA 3GTPB 2RHSB 1H95A 4X3SA 1YNND 4LUVA 3OW7A 1EY0A 1JORA 4RFBA 1PV4A 1HA5A 3J7YW 3GTPH 1MD2D 2K5HA 1ENAA 1QOHA 1U4LA 2RCNA 5C4JB 4P72A 3MXPA 3D4WA 1CKNA 3J80i 3BG3A 5BN5A 1Y1WB 4BY1H 1T5XD 4FXDA 2B2YA 3MXUA 1LTSD 4JI4L 2WV6D 3OIPA 5KNBA 2QF7A 1NMFA 4DK3C 3C1EA 1HNWQ 3IKJA 1IYUA 2A6HC 4GLAC 4XTCS 3VYUA 2F0QA 4CDEC 1VQ4A 1IBLL 2OCEA 5BN3A 4HIDA 5EAYA 5GADC 3AYHB 4IURA 1X3GA 1NBWA 4R4TA 1V9PA 3HOXG 4DU9A 2L0CA 1R9TB 4HR7B 2KCMA 4JI4Q 5CV5A 4RHRA 1E1TA 1I4GA 1JB3A 1PYWD 5TSSA 4OWTB 1O7IA 4M1UB 5M5WB 1S5FD 4YCUA 1XMQQ 3DWPA 4OWXB 2KEDA 1GVPA 3M4YA 4CKCA 2NYZD 3OWFA 1QILA 5C0XG 4G7ZC 3M4OH 5C4JH 2K5NA 3L0OA 2Y0SG 1I94Q 4JCVE 3GV3A 2KCTA 4BY1B 4JBMA 1TWGH 4K2KA 5CR3A 4A75A 3WOFA 1D6EC 2JE6I 1LT6D 3K7AH 1EQVA 2OXPA 2FHTA 3I8ZA 3BZKA 3PF5A 2VUMH 3SXHA 5CV8A 3D31A 1STEA 3K7UC 1CFMA 1SLJA 4BA1I 1BCPB 1VQGA 4NXML 1Y69U 3CCJA 1ZKOA 1CKOA 4A3BB 2A74C 1B8AA 4DXFA 1GUNA 4DUYL 5DNFA 3I72A 2NBFA 4YIJA 2K50A 5K5PA 3E0EA 1E2WA 3CCVA 1RIPA 4P75A 1RTNA 2AWNA 3G6JB 2FJ2A 1NUCA 1Q90A 5C5MA 4PMWA 3RZOB 4FXKC 4DNRB 4UP9A 2HIXA 4JI2Q 3A56A 1QE6A 4NP5A 4DK6C 1B50A 2OT2A 3L3OC 5M5XH 4HCEA 5JJLA 3ZYYX 1HZBA 2PZUA 3PUYA 4ZQ3A 1ML0D 1VS0A 3HFZB 4L6TB 4MN3A 4POFA 1A8VA 3SHLA 1ESRA 3J81j 3A5ZB 1Y1VB 2N55A 2OQKA 4HJ9A 1CHQD 5I9OA 5KYIA 5GQOA 3LWUA 4ZKBB 3SEBA 1TQOA 3GTJB 3E0JA 4H13C 2DUDA 2WB1E 3F8TA 4DR6Q 3R2IA 1VQMA 3MXNA 1Q7YC 4L8JA 3HG9A 5L37A 1F2MA 3X3MA 1HNXQ 5CV9A 3QB3A 5ELCA 1PZJD 4ODGA 1JWUD 1QCBD 4B3RL 1C48A 5C44B 2MUYA 4OO1I 2Z6BA 1Q82C 4J8QA 5I9PA 1D8LA 1GUGA 3HOWH 5IGGA 1SXTA 2A6HD 1ENFA 3LWEA 3PUVA 3I56A 3CHBD 3DLLA 3S24A 4GKKQ 3R2TA 1K0RA 1F9SA 4LF5Q 2FXQA 5FOBB 5D65A 5KRUA 1TXYA 2K6AA 2H5XA 5M3MG 1SJHD 2B63B 1AEXA 3NQTA 2RSNA 3E9HA 1B2TA 1OXUA 3V05A 1VDZA 2KHJA 3N6RA 3PO2B 3RN5A
chains in the Genus database with same CATH topology
4FVMA 2F03A 2KHSA 4IFDJ 1O80A 1BCPD 3MC0B 3PIP3 2RDGA 3FDTA 2PO4A 4IQZA 1SYFA 3M4OB 2B2WC 2JYOA 1EFID 4RGNA 3IAYA 4BBSB 2L4NA 1A3UA 4HMIA 3HOYB 1Z47A 4CJ0B 2Z4HA 3VR5A 3TN2A 1GUWA 3QG1A 2SOBA 2J0TD 2RKSA 4HSPA 2RSOA 1MI2A 4A3DB 2J4XA 1F2ZA 4XDXA 5FLXE 3EFXD 1BO0A 3R93A 3O13A 1STBA 2C9OA 2E2DC 2F0EA 3FPPA 2SNSA 4DA2A 2XVSA 2DNCA 4TRDA 5DM73 5I2YA 3CRKC 1II3A 4ILWA 1PXUA 1A2UA 1SNMA 5I6WA 2JA7B 2X6LA 1TS3A 1Q1EA 1SEBD 1D5ZC 1TS4A 1OXXK 4DAPA 2JA6B 1SMYC 5NUCA 1SNQA 4ZAIA 1DXMA 1XYIA 1JC7A 4JBWA 4ID6A 4HCSA 5JAVA 5KNCA 1CI3M 2F0LA 4XQJA 4CBVA 5BN4A 2Q8RE 4CGYB 4OIJA 1X3PA 1WTOA 3P7JA 5J1ZA 1OXVA 2H1EA 1S5DD 4A93B 1TS2A 3VR3A 3NQIA 4MHEA 3I4LA 1PFMA 3K58A 1JE4A 3HGBA 4CHTB 2B39A 1SE4A 4R9WA 4FP5D 2EJMA 2ICEC 1STYA 1YNNC 2F0FA 1YNJC 2YU9B 1UNSA 4KN7C 4E6IA 4XYQA 1J8IA 3H6MA 2H4OA 1EWCA 2K1BA 1NR2A 4Z9CB 4IUQA 1GUTA 4ABNA 1PRTF 3BVMA 4K8IA 1M8AA 2Q8IB 3S16B 5HGTA 2CW0C 2A6ED 5EBCA 3ND8A 4O1NA 5EPJA 4FF1A 1KABA 1DONA 3BYTB 1A15A 3NWSA 1TT2A 3IL8A 1SSOA 1WCMB 2TSSA 2ZT9C 1KDCA 3R3OA 2B8GA 1MBYA 3HKZB 3W3AA 3BVZA 3KLRA 1F9QA 1C8CA 1EZ8A 1ZYRC 4RGTA 1PDQA 5T1GA 2F0WA 3I91A 1GHJA 3TMEA 2DY8A 1H9JA 4FF4A 5JPNC 4OHJA 1KLUD 4OO1G 5JJZA 5DM63 4RGOS 1QG7A 3C46A 2VXWA 3S17B 3MZ5A 2HUGA 5JPMC 3NUCA 3PO3B 2B8FA 1LABA 3I4NB 1JQYD 3CKIB 2M9VA 2AQ1B 2R7ZB 1TWHB 2FINB 4RGMA 1DYQA 1LTAD 2NZ1D 3UI2A 1SMYD 5D3IB 3S1QB 2NWGA 1RTOA 1LTRD 1JR0D 2F3VA 2G9DA 2EY2A 1IKMA 4WORA 3QOLA 2V4DA 2RQXA 1PTOB 1GXDC 2PZWA 3S1RB 1BXTA 1NSNS 1H9SA 1SE2A 2D62A 1NCVA 2FMMA 1QNUA 4IFDG 1SYBA 1FNUA 1I4HA 1LLRD 1CZWA 5C4ZA 2G9HD 5DEHA 3D3RA 4ZUJA 2PNRC 3GTLB 4N9TA 2CW0D 3BDLA 1R4QB 5IIFA 1LT3D 2F1MA 2RDFA 1SJED 1D1KA 4C3JB 1V1PB 5I4DA 3C3LA 4B9WA 5I2XA 4A3EB 4RWSC 2ICIA 1O7YA 4CKEA 4A3IB 2HCIA 4IALA 1CA5A 2B2VC 5C3EB 3DXJC 1MGSA 3J80L 1IKLA 5FLXL 3FKIB 1ZEQX 1DM0B 1IW7D 1JOOA 5C0XH 2LKVA 3J7AV 3A55A 4Q5VA 5ELBA 1U4PA 1V43A 5CORA 2K28A 1BNZA 1RDPD 3EROA 1F2LA 4LK1C 2BA0A 5EJWA 2DNEA 1D5XC 2EY5A 3R8BA 3NTHA 4DAYA 3S15B 4FF2A 1FR3A 3K5MA 1GUOA 4WJWA 1U9RA 1DZ1A 5G3LF 5IT9L 1LTTD 4ZK9B 4QB4A 1I3QB 2A5HA 4KY6A 1HTLD 4X3UA 4C1NK 1EYCA 1D1IA 2WIIB 2JSOA 2A73B 4CKBA 3PV0A 4K5WA 1LTBD 3URYA 1TR5A 4V0BA 3HEJA 2DN8A 1I4PA 1Y8PB 3TP7A 3ITPA 2ID0A 3L9AX 4EQOA 1I6HB 3D6WA 3EA6A 3BS1A 1UEAB 4EGVA 1EEFD 3TZUA 1SFOB 2C5CA 4S3SA 4F87A 2IL8A 4K2LA 2NB0A 1G291 3KLSA 1U4RA 3D8GA 2NN6H 5ELFA 5KYLA 3IFTA 1ZYRD 1SNCA 1J9OA 5EGTA 4PQXA 2F0TA 4BS9A 4C3HG 1SNOA 5KIXA 1ET9A 1VMCA 1HTPA 2XIWA 3D6CA 2HQEA 1QJOA 1ZXTA 2VNUD 3BVGA 1T5EA 5HURA 2A6EC 5C4HA 3DMUA 2Y0SB 2KQ3A 2LMCB 1SBBB 3FPUB 3T4AC 5C4XB 1CQFA 1ILPA 5E3FA 2EVBA 1LT5D 4MIUA 1E2VA 5CBAE 2L11A 2A68C 3KLSX 1LTID 3PUXA 3QOJA 1TKWB 2Z1CA 1EY6A 2B2TA 1BCPC 2EXZA 4QIWB 3S2DB 1K8MA 3HOXB 3P1HA 3QJYA 3OSOA 3FMCA 4IUNA 5EKIA 3TP8A 3M7GA 3DM1A 1STAA 5E4WC 2EZVA 4KTAA 1DOKA 4TKOB 2L9HA 2VB3X 1Q12A 1H9MA 4L63B 1B3AA 1WTRA 3CRLC 5FK9C 2I46A 4FO2A 2E2HB 3J7AF 5K36H 4A3GB 1G2TA 4B08A 2NVTB 2DY7A 3DHQA 4XT1B 3NE5B 1DJRD 5C6AA 1K8OA 3P75A 3MXGA 4RHSA 4ULLA 2BE5D 4KY7A 2QEJC 1AW7A 3DWAA 5I6YA 3J81E 3NBIA 3TSSA 2Z8LA 1Z6HA 4CJ1B 2O5JC 3SK5A 2E2IB 1EWHA 1CM9A 3X3NA 1IYVA 4HEDA 1AP0A 3S2HB 2XNAC 5IT9E 5M5YB 4HTHA 1I4QA 1TY2A 1B4OA 2F0JA 2E75C 3K6OA 4QF4A 1WTPA 1EY9A 1SYGA 1C4QA 2F0GA 2EYFA 1PLFA 4HN7A 1PZKD 1Q3LA 4KHZA 4RKBA 4PMCA 2K7VA 4ZRZA 3K59A 4HSVA 3VA5A 1STGA 4CJ2C 1KNAA 1JCKB 4WRDA 2QILA 2D9UA 5G3LD 2RDHA 1M4VA 2F0VA 4XQNA 4I7ZC 3RUZA 3V96A 2KCNA 3PMFA 1PRTC 3MHBA 3S14B 2CVRA 2NUCA 2ZXOA 4DFAA 3NTIA 2L5TA 4F8MA 2FMCA 1B44D 2KEEA 4XXEA 3H91A 1AFPA 3HOZB 3FEWX 1UAPA 1GOZA 2PPBC 2B2UA 4QMGA 2I07B 1OXSC 4K14A 1SAPA 1HUNA 1EY5A 4Y7NB 3VYRA 3QIAA 4KY5A 1G91A 2K32A 2MJ8A 4NW2A 4OGQC 3W2DA 4DNTB 1H9SB 2EJGC 1A3VA 5J39A 4A3KB 2KJXA 2F0HA 1O78A 4R8NA 4A3JB 1I50B 5C3WA 1DD2A 1TVXA 2QDBA 1AZQA 1Q1BA 1STHA 3Q24A 2B2TC 2NVYB 1LTGD 1EY4A 3RMHA 3T13A 2KOLA 2YYZA 1ICWA 1RF2D 4F88A 2X69A 3GTMB 3SK8A 1XTCD 5C0XJ 4C2MB 4G7HC 3IFDA 2XWBB 2JA8B 4U68A 1DCZA 2D5DA 2A69C 1CTMA 3VYTA 4C3HB 5F2DA 1HRJA 3DUZA 2XWJB 3GV6A 1HCZA 4J6HA 4PMBA 1IW7C 2PW5A 5CBEE 5EPKA 2X6GA 4QCLA 4DK1A 1QB5D 5E1FA 1JOKA 3TP5A 3Q6SA 4A3MB 1LT4D 3DEOA 2BDNA 2PYKA 4DN4M 1FNVA 4ZLTF 1BR9A 1R4PB 4AYBB 2KCCA 4BY7B 1CZGA 4KD4A 1S5CD 4LJZC 4V190 4KMUC 1KAAA 3RZDB 3SDZA 2NTTA 5EPLA 5C3XA 4DXGA 1OO9B 1GHKA 3TDQA 1S5ED 2TMPA 3CQZB 3HOUB 3Q23A 2AQ3B 2GA4B 5EBDA 5D14A 5ELEA 1TY0A 3G7LA 1BQQT 4JK1C 1PRTD 5A2QL 1F77A 4RH6A 3K5NA 2EYHA 3C1FA 3ERQA 4K5VA 3A8KE 2QKIC 1JWSD 4OO1H 4P2CB 4HAEA 1HXYD 2IW3A 2EPBA 3M3YB 1WTVA 1Z7TA 5CC4A 1F9PA 2IT1A 5ISRA 2L12A 1JOQA 1H9RA 2SNMA 4K6DA 2EYPA 2ZXPA 3Q0AA 3A8IE 3MVVA 2JP1A 2KA7A 3TZDA 5EQ0A 1WTQA 5ELDA 2WKCA 3GO5A 1TIID 2PZTA 1EU4A 4H7BA 1D2BA 2F0UA 3A8JE 3OMCA 2QCPX 3MAQA 2IX0A 5K36G 1QNKA 3BDCA 5IGBA 1STNA 1AZPA 2BOSA 2KVMA 1LO5D 1H9KA 1PTOC 1AN8A 5CYUA 3FVQA 1FYCA 2HCCA 2NN6G 4BBRB 4QUCA 5M3MB 5LL6X 2B2WA 1O7ZA 2O4XA 4XQQA 1E2ZA 1ILQA 2BE5C 2B2YC 4DF7A 2N88A 1JICA 4PV1C 3J81L 2F0KA 5COYA 5A35A 3EQLC 4U673 3I3CA 3KUPA 4LMQD 3GTGB 5M9OA 3VYSA 3V2TA 3MA2B 2F0PA 2F0OA 3HRZC 5AFWA 3AU7A 2AUKA 4KN4C 1TWFB 1TWAB 1UUPA 3F2UA 1QWYA 5JEAJ 2PQEA 2IPKD 4RKLA 5D3DA 1YNJD 2IX1A 2NN6I 3S1NB 1B9NA 1EQTA 1JWMD 2B2UC 2AWOA 5LHY1 3I90A 2JEBI 3A54A 2R92B 3KBXA 1PFBA 3E6ZX 4O42A 1MSGA 3OIQA 4OL7A 2K04A 3RLFA 4Q0FA 2WINB 2XSCA 1RHPA 5C5LA 2EYOA 3NTKA 3T16A 3H94A 2BDOA 1BCPF 1WD0A 4R8IA 4G4KA 4ZYSA 1V1PA 4KHVA 3T51B 1I4XA 3D4RA 3K57A 2E76C 3K0YA 3OPOA 3Q22A 3I70A 2LFNA 1KNEA 3LNNA 3E5SA 4C3JG 1LACA 1G6ZA 3I4MB 3SK4A 5FO7B 3BDOA 1IHZA 2IWHA 4KJOA 2FFKB 4ZKCB 4RCOA 4FNFA 2EY1A 2XN9C 2R61A 1A2TA 2RA4A 1SYDA 3HOVB 1OXTA 1PTOF 1HPCA 1TS5A 4UDUC 1PTOH 3DWQA 1MSHA 2K05A 5IGEA 3T56B 1CK1A 4TQUS 4IUPA 4BA2I 3L7ZC 4IFDI 1CT1D 4K5XA 3U9OA 2IJ0A 5FO8B 1WD1A 2IX3A 4KV6A 1VF5C 1ENCA 3I73A 2MHVA 4H0LC 4KKSA 2JXMB 5IGDA 4TSSA 3GTOB 1HHVA 5CGKA 4B9XA 4IZ8A 4EQPA 1SE3A 1KTKA 1SNDA 1RCVD 3S1MB 4BWGB 1FNWA 2O2LD 2BCOA 4FYDA 2AQ2B 4QUFA 4G57A 5T1IA 1HFNA 4FXGC 1HFGA 3WDNA 1B9MA 4J1MA 4RAUC 2EYJA 1IL8A 4DK0A 5C0XI 2OF1A 2F0IA 3HZXA 1XWEA 3KF8A 1W6KA 3PUWA 2KECA 2ENBA 2ZXRA 1VF7A 1CA6A 1X3QA 1F2YA 2D2CC 3EVQA 3NXWA 4OIKA 1EY8A 1FD7D 3VR2A 4DAVA 4X3KA 4XYOA 1EZ6A 1D5MC 3M85A 5M5XB 4K8JA 2CQAA 3BYYB 3MWYW 1BF4A 1KDAA 3MFYA 2Z4IA 4WFN3 2J7ZA 2L1BA 3OMGA 1NR4A 4FF3A 2K5DA 4K6LA 2E74C 3TP6A 4C3IB 3NWTA 5JOBA 3KK7A 3QWNA 1DOMA 1HQRD 1PFNA 3NP8A 1ONLA 4KKUA 2EYLA 2RBMA 4KD3A 3VA7A 2NTSA 3SK6A 2CHBD 2MP1A 3MEHA 3H09A 2R93B 4A3FB 4C3IG 1I6VC 3D4DA 4KI0A 2F0MA 2XRQD 1PZID 5DAUA 2E2JB 1E0BA 1FGBD 2WAQB 4C1NI 3VR4A 2JA5B 3MTSA 1SYCA 4XIGS 2F3WA 2F0DA 1SNPA 3BZDB 3K5OA 3C2PA 4N9PA 3DEPA 4DGZA 1WTXA 3AMUA 1EU3A 3A7LA 2K01A 1VMPA 3JAML 1EOTA 2EDGA 2L55A 4EQNA 5IGCA 3OWEB 1XX8A 1RD9D 5CV7A 1EEID 1F9RA 3QO2A 1TWGB 5IOCA 2LS01 1DOLA 4GZYC 1PRTB 1EYAA 2K5WA 4NKLA 1B53A 4LAAA 2MGSA 4ZUIA 3GTQB 1VCIA 3GQBA 1S5BD 2EOTA 3HOWB 2M00A 2HDMA 1TU2B 3P20A 1HQMC 1S4ZA 3N52A 1KLGD 5A2QE 1ET6A 1EYDA 3SE0A 1RODA 1NAPA 2B2VA 1W6JA 5JVH3 2Q8TA 3RD4A 3EJIA 1L0YB 1A6XA 1BDOA 4RA8A 3HS0C 1B1ZA 1GJXA 2BA1A 3U9SA 1SYEA 2JEAI 2WB1B 2HDLA 2K33A 2EJFC 2VB2X 1K83B 3ONAB 5FO9B 2MPMA 2R6GA 4IUVA 5JEAH 2R3ZA 4KJNA 5LL6S 1WTWA 1I4RA 2NVXB 2F4IA 3GTKB 4EVOA 3K7AB 1BBXC 2NVQB 1EIGA 4F7XA 4IN3A 1HUMA 2PCFB 2WACA 3PIO3 3TBIB 2WKDA 3FRPB 2PMZB 1Q8IA 1KDBA 2PW7A 1Y8NB 4HMJA 3ND9A 4IUUA 4RCNA 1BOSA 1GUSA 5J22A 1EIHA 5CMDA 2RVLA 5KEEA 2SDFA 3M7NA 1XXGA 3GP7A 5FKAC 2K5QA 1EL0A 4XT3B 4M8AA 1CQVA 2F0SA 1G2SA 3KBGA 4NMZA 3K5LA 2K03A 2EE1A 4PNYA 5M3FB 3NBHA 5JEAG 4ME5A 5EKKA 1ESFA 3H0GB 2F0NA 2EY6A 3JAME 1BUVT 1PTOD 3VR6A 4UAIA 3A7AB 3CU7A 1L0XB 4KK7A 3GD7A 2AUJD 2EYMA 3LX0A 3SVMA 2KUMA 1O7LA 3OOCA 3NPPA 2M2LA 3HP3A 5E4XA 4IFDH 1SDFA 1Y8OB 4I65A 1HA6A 2SEBD 3J80E 1X32A 3NK9A 3NSWA 1A3TA 1EY7A 3MFGA 1TWCB 4NDXA 5CV6A 3SR1A 4C56C 1RJTA 2A68D 5KGUA 4X3TA 5IGFA 3PUZA 3WOEA 1RKNA 2XRSD 2OEOA 1LV9A 5IODA 1V8QA 5KNDA 1U4MA 4G7OC 3OHXC 2O5IC 3NHHA 3AB9A 1CHPD 3T53B 2WP8J 2A69D 3S9WA 1G8ZD 3H3VC 1V1OA 5CV4A 4H44C 5EKLA 1WVLA 1PMRA 4KKTA 2VUMB 5JVG3 2LY7A 4IUTA 3GTPB 4X3SA 1YNND 3OW7A 1EY0A 1JORA 4RFBA 1HA5A 3J7YW 1MD2D 1ENAA 1QOHA 1U4LA 5C4JB 3MXPA 3D4WA 3BG3A 5BN5A 1Y1WB 1T5XD 4FXDA 2B2YA 3MXUA 1LTSD 2WV6D 3OIPA 5KNBA 2QF7A 3C1EA 3IKJA 1IYUA 2A6HC 4XTCS 3VYUA 2F0QA 5BN3A 4IURA 4DU9A 2L0CA 1R9TB 4HR7B 5CV5A 4RHRA 1I4GA 1JB3A 1PYWD 5TSSA 4M1UB 5M5WB 1S5FD 3DWPA 2KEDA 3M4YA 4CKCA 2NYZD 3OWFA 1QILA 5C0XG 4G7ZC 3GV3A 4BY1B 4K2KA 5CR3A 3WOFA 1D6EC 2JE6I 1LT6D 1EQVA 2OXPA 2FHTA 3I8ZA 3SXHA 5CV8A 3D31A 1STEA 1CFMA 4BA1I 1BCPB 1Y69U 1ZKOA 4A3BB 2A74C 4DXFA 1GUNA 5DNFA 3I72A 2NBFA 4YIJA 5K5PA 1E2WA 1RTNA 2AWNA 3G6JB 2FJ2A 1NUCA 1Q90A 5C5MA 4PMWA 3RZOB 4FXKC 4DNRB 3A56A 1QE6A 4NP5A 1B50A 2OT2A 3L3OC 4HCEA 3ZYYX 2PZUA 3PUYA 4ZQ3A 1ML0D 4L6TB 4MN3A 3SHLA 1ESRA 1Y1VB 2N55A 1CHQD 5I9OA 5KYIA 3LWUA 4ZKBB 3SEBA 1TQOA 3GTJB 3E0JA 4H13C 3R2IA 3MXNA 4L8JA 3HG9A 1F2MA 3X3MA 5CV9A 3QB3A 5ELCA 1PZJD 4ODGA 1JWUD 1QCBD 1C48A 5C44B 2MUYA 4OO1I 4J8QA 5I9PA 1GUGA 5IGGA 1SXTA 2A6HD 1ENFA 3LWEA 3PUVA 3CHBD 3R2TA 1F9SA 5FOBB 5D65A 5KRUA 2K6AA 1SJHD 2B63B 1AEXA 3NQTA 2RSNA 1B2TA 1OXUA 3V05A 1VDZA 3PO2B 3N6RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OXP A;  4N9T A;  1EQV A;  1KDC A;  3R3O A;  2KHS A;  3TP7 A;  3ITP A;  5CV8 A;  3BDL A;  2WAC A;  3SXH A;  1EZ6 A;  4WRD A;  5IIF A;  5IGF A;  4EQO A;  1EYA A;  4NKL A;  2RDF A;  3SK8 A;  3P1H A;  5IGE A;  1RKN A;  3OSO A;  2PQE A;  4K8J A;  1KDB A;  1EZ8 A;  2F0V A;  2OEO A;  4IUN A;  1SYF A;  4LAA A;  3TP8 A;  4ZUI A;  1KDA A;  1STA A;  2PW7 A;  4RKL A;  5J1Z A;  4S3S A;  3RUZ A;  5IOD A;  3PMF A;  2EYH A;  4KTA A;  2F0W A;  4HMJ A;  4B9W A;  3C1F A;  2M00 A;  3ERQ A;  3TME A;  3OMG A;  3MHB A;  4K2L A;  5J22 A;  3NHH A;  1A3U A;  3D8G A;  4HMI A;  4K5V A;  2NUC A;  4K5X A;  4IAL A;  4YIJ A;  5K5P A;  5KYL A;  3U9O A;  4DFA A;  5KEE A;  5F2D A;  3TP6 A;  3S9W A;  1NUC A;  4F8M A;  4KV6 A;  2SOB A;  1SNC A;  5C5M A;  2F0S A;  5EGT A;  5CV4 A;  5JOB A;  2RKS A;  5EKL A;  2F0T A;  4NP5 A;  1EYD A;  1ENC A;  4NMZ A;  4OL7 A;  1SNO A;  5CC4 A;  5KIX A;  3NP8 A;  5ISR A;  1JOO A;  4J6H A;  3DHQ A;  2PZU A;  1F2Z A;  1JOQ A;  4ZQ3 A;  2LKV A;  2SNM A;  4K6D A;  2EYL A;  2RBM A;  4KD3 A;  4PMB A;  3MZ5 A;  5C5L A;  2EYO A;  2EYP A;  5C6A A;  2PW5 A;  3P75 A;  3SHL A;  1EY0 A;  3D6C A;  3MVV A;  4QMG A;  3T16 A;  1JOR A;  2HQE A;  3NUC A;  3SK6 A;  5E1F A;  1STY A;  4PNY A;  5IGD A;  4KY7 A;  5I9O A;  5KYI A;  1STB A;  2F0F A;  3ERO A;  1ENA A;  4ME5 A;  3MEH A;  3EJI A;  4K14 A;  4KHV A;  5EKK A;  1JOK A;  2PZT A;  4H7B A;  5HUR A;  3TP5 A;  5C4H A;  2F0U A;  5I6Y A;  1TQO A;  3MXP A;  3D4D A;  3D4W A;  3DMU A;  3OMC A;  2F0N A;  2EY6 A;  2EY5 A;  4E6I A;  2F0M A;  2F0E A;  1EY5 A;  5CGK A;  4B9X A;  4IZ8 A;  4EQP A;  2SNS A;  3H6M A;  1SND A;  4KY5 A;  3C1E A;  3BDC A;  2KQ3 A;  5DAU A;  4TRD A;  1F2M A;  5IGB A;  3SK5 A;  2F0Q A;  2PYK A;  5CV9 A;  1STN A;  1SYE A;  1U9R A;  3QB3 A;  2EYM A;  3LX0 A;  4K8I A;  1II3 A;  4ODG A;  1SYC A;  3E5S A;  1A2U A;  1SNM A;  5I6W A;  4G57 A;  1A3V A;  5J39 A;  5HGT A;  4HTH A;  2F3W A;  2F0D A;  4QB4 A;  5E3F A;  3SK4 A;  4DU9 A;  1SNP A;  2O4X A;  4MIU A;  2F0J A;  4J1M A;  5I9P A;  2F3V A;  4KD4 A;  4KY6 A;  4N9P A;  5IGG A;  4DGZ A;  4QF4 A;  5CV5 A;  2EYJ A;  1IHZ A;  2EY2 A;  1EY9 A;  2OF1 A;  1KAB A;  1SYG A;  2F0I A;  4I65 A;  3HZX A;  3QOL A;  4WOR A;  4DF7 A;  2F0G A;  2PZW A;  4F7X A;  4KJO A;  1KAA A;  2EYF A;  1NSN S;  5KRU A;  4KJN A;  1EYC A;  2F0H A;  2F0K A;  3QOJ A;  3NK9 A;  1SNQ A;  4R8N A;  5NUC A;  5C3X A;  2EY1 A;  4RKB A;  3OWF A;  4EVO A;  1A2T A;  1EY6 A;  4ID6 A;  1SYD A;  1SYB A;  2ENB A;  4PMC A;  4EQN A;  5C3W A;  5IGC A;  1A3T A;  1EY7 A;  5C4Z A;  5KGU A;  5DEH A;  2QDB A;  4K5W A;  1AEX A;  1STH A;  3NQT A;  4NDX A;  5JAV A;  5CV6 A;  1TR5 A;  1TT2 A;  5M9O A;  1F2Y A;  3HEJ A;  4ZUJ A;  3SR1 A;  3V2T A;  1EY4 A;  3VA5 A;  1STG A;  2EXZ A;  4K2K A;  5CR3 A;  2F0L A;  3EVQ A;  5CV7 A;  2F0P A;  2F0O A;  3NXW A;  3T13 A;  1EY8 A;  5IOC A; 
#chains in the Genus database with same CATH topology
 4FVM A;  2F03 A;  1X3E A;  3NEM A;  2KHS A;  4UHV A;  4IFD J;  2LXK A;  1O80 A;  1BCP D;  3MC0 B;  3PIP 3;  2RDG A;  3FDT A;  2PO4 A;  1LUZ A;  3W1G A;  4IQZ A;  1SYF A;  3M4O B;  2B2W C;  2JYO A;  1VQ6 A;  1EFI D;  3K81 C;  2MFI A;  3B6Y A;  4RGN A;  4AYB G;  4PG3 A;  3IAY A;  4BBS B;  2L4N A;  1A3U A;  4HMI A;  3HOY B;  1Z47 A;  4CJ0 B;  2Z4H A;  1K28 A;  3TN2 A;  3UE0 A;  3VR5 A;  2UUC L;  3TEH B;  1GUW A;  2QDL A;  1S72 A;  4A3I G;  1P8L A;  3QG1 A;  1V1Q A;  2J0T D;  2SOB A;  4A3M G;  2RKS A;  1M1K C;  4HSP A;  2RSO A;  1MI2 A;  1E3P A;  3CAM A;  4A3D B;  2J4X A;  1F2Z A;  4XDX A;  1PA6 A;  1E22 A;  1UE5 A;  4DR2 L;  3TQY A;  5FLX E;  3EFX D;  1X55 A;  4JI7 Q;  1BO0 A;  3R93 A;  3O13 A;  1STB A;  4DUY Q;  4X66 Q;  3T1H L;  2C9O A;  3S1R H;  2E2D C;  2F0E A;  5GAG C;  3FPP A;  2SNS A;  1Y1W G;  4DA2 A;  2XVS A;  2DNC A;  4TRD A;  4H02 A;  5DM7 3;  2Q2I A;  5I2Y A;  3CRK C;  1II3 A;  4ILW A;  1PXU A;  4DUZ Q;  2DJG C;  1A2U A;  1SNM A;  5I6W A;  1WYD A;  2Z6K A;  2JA7 B;  2X6L A;  3F2B A;  1TS3 A;  1Q1E A;  1SEB D;  5LMU Q;  1D5Z C;  2R92 H;  2I5L X;  1TS4 A;  4C3J H;  3CCL A;  1OXX K;  4DAP A;  3GTM H;  2JA6 B;  1K73 C;  1SMY C;  4P73 A;  5NUC A;  1SNQ A;  4ZAI A;  3ERS X;  1DXM A;  1XYI A;  1JC7 A;  4JBW A;  4ID6 A;  3PO3 H;  4HCS A;  5JAV A;  5KNC A;  2AMC B;  4A3M H;  1CI3 M;  3HOZ G;  1EOV A;  2F0L A;  3ZJY C;  4YCW A;  4XQJ A;  4CBV A;  4B3M Q;  4DV3 L;  1M90 C;  3PO2 G;  5BN4 A;  3VDY A;  2Q8R E;  4CGY B;  3CXC A;  3CCS A;  4UP8 A;  4OIJ A;  1X3P A;  1WTO A;  3P7J A;  5J1Z A;  1YBY A;  1OXV A;  2H1E A;  2PI2 E;  1S5D D;  4A93 B;  4AQY L;  1TS2 A;  3S1Q H;  3VR3 A;  1VQK A;  2JA5 H;  1WFQ A;  3NQI A;  1PH4 A;  3A0J A;  4MHE A;  1VQI A;  1YEZ A;  3I4L A;  1PFM A;  3K58 A;  1JE4 A;  4L5R C;  3HGB A;  1SFO H;  3OTO L;  4NPS A;  2VQF Q;  4CHT B;  2B39 A;  1SE4 A;  4R9W A;  4LF9 L;  2JN4 A;  1VQD A;  2VZA A;  4FP5 D;  4Y7N H;  5FJ8 H;  2EJM A;  5FLM G;  1JT8 A;  2ICE C;  1STY A;  1YNN C;  1I6H H;  2F0F A;  1YNJ C;  2MO0 A;  2R7Z G;  4BXX G;  1WCM G;  2YU9 B;  4A3L G;  2CH4 W;  1UNS A;  4KN7 C;  4E6I A;  4XYQ A;  4JVZ A;  1N36 Q;  1J8I A;  3H6M A;  2H4O A;  1EWC A;  2K1B A;  3CC4 A;  1NR2 A;  4Z9C B;  4IUQ A;  1GUT A;  2KBN A;  4ABN A;  4YHH L;  4HJA A;  1PRT F;  3BVM A;  1PH7 A;  4K8I A;  1K8G A;  3W5O A;  1M8A A;  2Q8I B;  1XNR L;  4FDB A;  3S16 B;  5HGT A;  2CW0 C;  2A6E D;  5EBC A;  3ND8 A;  4A3B H;  4A4I A;  4O1N A;  5EPJ A;  4FF1 A;  1KAB A;  1KAW A;  3CCQ A;  1DON A;  3HOW G;  3BYT B;  1A15 A;  3NWS A;  3GTJ H;  1TT2 A;  3IL8 A;  1SSO A;  1WCM B;  2TSS A;  2ZT9 C;  4GN4 B;  1KDC A;  3R3O A;  3E3X A;  2B8G A;  5IYC G;  4EQ5 A;  1J5E L;  3SGI A;  4B3T Q;  1MBY A;  4UP7 A;  4IPH A;  1IL2 A;  3HKZ B;  3W3A A;  3BVZ A;  3KLR A;  4JI0 L;  1F9Q A;  3ER0 A;  3ICE A;  3KJO A;  1EZ8 A;  1C8C A;  1ZYR C;  1L0W A;  4C3I H;  4RGT A;  1PDQ A;  3CCE A;  4R1J A;  5M5Y H;  5T1G A;  2F0W A;  3I91 A;  1K0S A;  1GHJ A;  3TME A;  2DY8 A;  1H9J A;  4FF4 A;  5JPN C;  4OHJ A;  3GTQ H;  2E2I H;  2Q2U A;  1KLU D;  4BBR H;  4OO1 G;  5JJZ A;  5DM6 3;  5C44 H;  2YTV A;  4A3E H;  4A3C G;  4RGO S;  1FL0 A;  1QG7 A;  3C46 A;  2VXW A;  2OTL A;  1AE2 A;  3MZ5 A;  3S17 B;  4DV0 L;  2HUG A;  5IE8 A;  5IP9 G;  5JPM C;  3NUC A;  3PO3 B;  2ZJR A;  4GOP B;  2B8F A;  4DNI A;  1LAB A;  2L15 A;  3I4N B;  5IYB G;  2IHF A;  2KHI A;  1WI5 A;  4ME3 A;  1JQY D;  1HNZ L;  3CKI B;  2M9V A;  2AQ1 B;  2R7Z B;  4LF7 L;  1TWH B;  1XPO A;  3BZC A;  1TWC H;  2FIN B;  3KDF A;  4RGM A;  1DYQ A;  1LTA D;  2NZ1 D;  4TVA B;  3UI2 A;  1SMY D;  4GN3 B;  5D3I B;  1YJW A;  3S1Q B;  1T9H A;  2NWG A;  4A93 H;  1A63 A;  1RTO A;  1LTR D;  1JR0 D;  2F3V A;  2G9D A;  2EY2 A;  1IKM A;  4WOR A;  3QOL A;  2D0P A;  2V4D A;  4GNX B;  2RQX A;  1PTO B;  1GXD C;  2PZW A;  1YJN A;  3CPF A;  3S1R B;  1BXT A;  1NSN S;  1H9S A;  1SE2 A;  2D62 A;  1NCV A;  2FMM A;  1QNU A;  4IFD G;  1SYB A;  4JYA Q;  1FNU A;  1I4H A;  1LLR D;  1CZW A;  4A3L H;  5C4Z A;  2G9H D;  5DEH A;  5ELO A;  5LMN Q;  3D3R A;  4A3E G;  4OXP A;  4ZUJ A;  3PIO A;  2PNR C;  1LYL A;  4JI7 L;  3EBE A;  1EUJ A;  3GTL B;  4KLK A;  4N9T A;  5AJ3 L;  1KRT A;  2CW0 D;  1EYG A;  3BDL A;  1R4Q B;  5IIF A;  1LT3 D;  4GLV B;  2F1M A;  2NVY H;  2RDF A;  1SJE D;  1W3S A;  2JA6 H;  1S40 A;  1D1K A;  4C3J B;  1V1P B;  5I4D A;  3C3L A;  2ATW A;  4B9W A;  3FKI G;  5I2X A;  4A3E B;  1KRS A;  4RWS C;  2QA4 A;  2ICI A;  2E2H H;  1O7Y A;  4CKE A;  1IBM Q;  4A3I B;  2HCI A;  1X65 A;  4IAL A;  4BY7 H;  1CA5 A;  2B2V C;  3G71 A;  5C3E B;  3DXJ C;  1YIT A;  1MGS A;  4L5Q A;  3J80 L;  5C4X H;  3CME A;  4DR3 Q;  1IKL A;  5FLX L;  3FKI B;  1ZEQ X;  1DM0 B;  2BH8 A;  1IW7 D;  1EQQ A;  3PCO B;  4UPA A;  1JOO A;  5C0X H;  1KC8 C;  4LFC L;  2LKV A;  3J7A V;  1XMO L;  3A55 A;  4Q5V A;  5ELB A;  4WJ3 M;  1U4P A;  2UUC Q;  4DV0 Q;  3U4V A;  1V43 A;  5COR A;  2K28 A;  1BNZ A;  1RDP D;  3ERO A;  5GAE C;  1F2L A;  1I50 H;  3H0G G;  2CWP A;  4LK1 C;  2BA0 A;  3G48 A;  5EJW A;  2HD3 A;  2DNE A;  2R92 G;  1D5X C;  2EY5 A;  2NVQ H;  3R8B A;  5IYD G;  3RNU A;  3HOV G;  3NTH A;  4DAY A;  3S15 B;  4FF2 A;  1FR3 A;  3K5M A;  1GUO A;  1HJP A;  4WJW A;  4X65 L;  1U9R A;  1DZ1 A;  5G3L F;  5IT9 L;  2YV5 A;  2Y0S E;  4GOP C;  1LTT D;  4DV7 Q;  4DR2 Q;  4ZK9 B;  4O0A A;  4QB4 A;  1I3Q B;  4X6A H;  2A5H A;  4KY6 A;  1XNR Q;  4DAY B;  4RMF A;  4QJF A;  4UY8 C;  3PO3 G;  2F4V L;  1HTL D;  2QW7 A;  4AYB E;  1J5E Q;  4X3U A;  4C1N K;  1EYC A;  1D1I A;  2WII B;  2JSO A;  2A73 B;  4CKB A;  1CKM A;  2WFW A;  3PV0 A;  4K5W A;  4NXN L;  1LTB D;  1S3O A;  3URY A;  3AFP A;  1TR5 A;  4V0B A;  3HEJ A;  1A62 A;  4AIM A;  2DN8 A;  1I4P A;  1VQ7 A;  1Y8P B;  4JI1 L;  1WTH A;  1NE3 A;  3TP7 A;  3J7A 5;  3ITP A;  2ID0 A;  3L9A X;  4EQO A;  1I6H B;  3D6W A;  4APV A;  3EA6 A;  1EFW A;  3BS1 A;  1UEA B;  4EGV A;  1EEF D;  1FJG Q;  4QIW E;  3TZU A;  1SFO B;  2C5C A;  4S3S A;  4F87 A;  4DV7 L;  2IL8 A;  4K2L A;  2NB0 A;  1G29 1;  3KLS A;  1U4R A;  3D8G A;  2NN6 H;  5ELF A;  5KYL A;  2EQS A;  3IFT A;  3K8A A;  3S15 H;  4DV2 L;  5JJK A;  1ZYR D;  1SNC A;  1J9O A;  5EGT A;  4PQX A;  2F0T A;  5AJ3 Q;  3OW2 A;  4BS9 A;  1QZG A;  4C3H G;  2CQO A;  1HZA A;  1A0I A;  1GO3 E;  1SNO A;  1ET9 A;  5KIX A;  1VMC A;  4ZCK A;  1QVC A;  1HTP A;  2XIW A;  1KXL A;  3D6C A;  4IOA A;  2HQE A;  1QJO A;  2R93 H;  1SRU A;  4A3J H;  3G4S A;  1ZXT A;  2VNU D;  4HIM A;  3BVG A;  1T5E A;  5HUR A;  3PGZ A;  2A6E C;  4A3D G;  5C4H A;  4GKK L;  3FKI H;  3DMU A;  4JOI A;  2VQF L;  2Y0S B;  4R4O A;  2ASB A;  3KF6 A;  2KQ3 A;  1VQL A;  2N3S A;  1VQO A;  2XGT A;  2IHE A;  2LMC B;  2VY3 A;  4P74 A;  1SBB B;  3FPU B;  1PH2 A;  3T4A C;  2ES2 A;  5C4X B;  4A3G H;  1N8R C;  1CQF A;  1ILP A;  4JBJ A;  2GVA A;  3IRB A;  4IPC A;  2B29 A;  5E3F A;  2EVB A;  2OTJ A;  1LT5 D;  1PVO A;  4MIU A;  1E2V A;  1JJG A;  5CBA E;  2L11 A;  2A68 C;  3KLS X;  2UUB L;  1LTI D;  4DR4 Q;  3QR8 A;  3PUX A;  2GN5 A;  1PH8 A;  4WJ4 A;  3JC6 6;  3QOJ A;  1TKW B;  2Z1C A;  1VQ5 A;  1N33 L;  2UXC L;  1EY6 A;  1EQR A;  4LFA L;  2B2T A;  1IBM L;  1G51 A;  1BCP C;  1PYS B;  2EXZ A;  5IYB H;  4QIW B;  3S2D B;  2VS1 A;  1K8M A;  4DR5 L;  4YWM A;  4NXM Q;  2NZO A;  4OX9 Q;  1L1O A;  3HOX B;  3P1H A;  3QJY A;  3OSO A;  3FMC A;  4IUN A;  1X56 A;  5EKI A;  3TP8 A;  3M7G A;  3DM1 A;  1STA A;  5E4W C;  2EZV A;  4KTA A;  1DOK A;  1HR0 L;  4TKO B;  3I4O A;  2EIF A;  2L9H A;  2VB3 X;  1Q12 A;  1H9M A;  3JAM i;  3A74 A;  4L63 B;  1B3A A;  5IWA Q;  1WTR A;  3CRL C;  5FK9 C;  2I46 A;  4FO2 A;  4AH6 A;  3CPW A;  2E2H B;  3J7A F;  5K36 H;  1HNZ Q;  4A3G B;  1G2T A;  4A3K G;  4B08 A;  1K3B C;  2NVT B;  2DY7 A;  3J7Z C;  3DHQ A;  4XT1 B;  3NE5 B;  1DJR D;  3AQQ A;  4R4I A;  5C6A A;  1SR3 A;  4A76 A;  4JG2 A;  2EXD A;  1K8O A;  3P75 A;  3MXG A;  4RHS A;  4DR1 Q;  1BBU A;  4ULL A;  2BE5 D;  1BVS A;  4B3S Q;  4KY7 A;  2QEJ C;  1AW7 A;  4DR5 Q;  3DWA A;  5I6Y A;  3J81 E;  1FVI A;  3NBI A;  1VQE A;  4IO9 A;  3TSS A;  3I2Z A;  3RZD H;  2Z8L A;  1FGU A;  1Z6H A;  3GDE A;  4JW0 A;  4CJ1 B;  2O5J C;  3SK5 A;  2E2I B;  1EWH A;  1CM9 A;  3X3N A;  4GKJ Q;  1IYV A;  4HED A;  1KIX A;  1AP0 A;  3S2H B;  4YHH Q;  2XNA C;  2JA5 G;  5IT9 E;  2ZTD A;  5M5Y B;  1CUK A;  1HR0 Q;  4HTH A;  1I4Q A;  1TY2 A;  5IYC H;  1B4O A;  2F0J A;  1VQF A;  4R4Q A;  2E75 C;  3UDI A;  3K6O A;  4QF4 A;  3U4Z A;  3KF6 B;  2JA7 G;  1WTP A;  1EY9 A;  1SYG A;  1C4Q A;  2F0G A;  1YNX A;  2EYF A;  1PLF A;  4GKJ L;  2R93 G;  4HN7 A;  1PZK D;  1Q3L A;  4DR7 L;  2E2J H;  1UWV A;  2CWA A;  4KHZ A;  4RKB A;  4PMC A;  5GAH C;  4YCV A;  4X62 L;  2K7V A;  1VQA A;  4YWK A;  4ZRZ A;  3K59 A;  4IOC A;  2WAQ G;  4HSV A;  3VA5 A;  1STG A;  2I5H A;  4CJ2 C;  1PH5 A;  3UDG A;  1C9O A;  1KNA A;  4EX5 A;  4B3S L;  4YY3 Q;  1JCK B;  4WRD A;  2QIL A;  2D9U A;  5G3L D;  1Y1V H;  1NY4 A;  2RDH A;  4A3F G;  4B3T L;  1M4V A;  4RG1 A;  2F0V A;  3KFU A;  4DR3 L;  4XQN A;  4I7Z C;  3RUZ A;  3V96 A;  2KCN A;  3PMF A;  1PRT C;  2DGY A;  3MHB A;  3F2C A;  3S14 B;  2CVR A;  1HZ9 A;  4I7A A;  2NUC A;  5BR8 Q;  2ZXO A;  4LF8 Q;  4DFA A;  3NTI A;  2L5T A;  3HOY G;  4F8M A;  2FMC A;  5HY6 A;  4DR6 L;  4C2M H;  1B44 D;  2KEE A;  4XXE A;  3H91 A;  1UE7 A;  4JI2 L;  1AFP A;  3HOZ B;  3FEW X;  1UAP A;  3NBH B;  1GOZ A;  2PPB C;  1SN8 A;  3HOU H;  4IPD A;  2B2U A;  2D0O A;  4QMG A;  2UUA L;  3U50 C;  1E7Z A;  1QUQ A;  2I07 B;  1IBK Q;  1OXS C;  4K14 A;  1SAP A;  1HUN A;  1EY5 A;  4CDD C;  4Y7N B;  2B63 G;  5M3F G;  3VYR A;  3QIA A;  4KY5 A;  1G91 A;  1EIF A;  2K32 A;  2MJ8 A;  4NW2 A;  4OGQ C;  3I4N G;  3W2D A;  4DNT B;  3S14 H;  1H9S B;  2R7D A;  1LM0 A;  2EJG C;  1A3V A;  5J39 A;  1VQJ A;  4A3K H;  4DV4 Q;  3MXN B;  1HZC A;  2GVB A;  2Q2H A;  1UEB A;  4A3K B;  2KJX A;  1YIJ A;  1N34 L;  3CCU A;  4BBS H;  1YI2 A;  2F0H A;  1O78 A;  1Y1W H;  4R8N A;  1K8A C;  1MJC A;  4DV1 Q;  4A3J B;  1I50 B;  3PQI A;  4CDF C;  5C3W A;  1DD2 A;  3WWV A;  1TVX A;  2QDB A;  1AZQ A;  1Q1B A;  1STH A;  3GTO H;  3Q24 A;  2B2T C;  2NVY B;  1LTG D;  2BH2 A;  1EY4 A;  3RMH A;  2E8G A;  3T13 A;  2KOL A;  4QY7 A;  1IYJ B;  3Q8D A;  2YYZ A;  3GTG H;  1ICW A;  1RF2 D;  4F88 A;  4LNQ A;  2X69 A;  3GTM B;  5H1S E;  3SK8 A;  1E24 A;  3F2D A;  1XTC D;  5C0X J;  4C2M B;  4AQY Q;  4G7H C;  2MO1 A;  3IFD A;  2JA7 H;  1Z9F A;  2XWB B;  2NZH A;  2JA8 B;  3ULL A;  4U68 A;  1DCZ A;  2YTY A;  5DLQ E;  2D5D A;  2A69 C;  2UXD Q;  1CTM A;  3VYT A;  4C3H B;  1HR0 W;  5F2D A;  1HRJ A;  4N8F A;  4DV4 L;  2QEX A;  4JOI C;  3DUZ A;  2HHH L;  2XWJ B;  3GV6 A;  1YVC A;  1HCZ A;  3A5U A;  4J6H A;  5LMN L;  3H15 A;  4OEM B;  4PMB A;  1IW7 C;  2PW5 A;  1HH2 P;  3BJU A;  5CBE E;  5EPK A;  4LFB L;  2X6G A;  4QCL A;  4DK1 A;  1QB5 D;  5E1F A;  2HIV A;  1JOK A;  4BY7 G;  3TP5 A;  3Q6S A;  1MKH A;  4A3M B;  5C4X G;  1LT4 D;  4X62 Q;  3DEO A;  3LGJ A;  4DV6 Q;  2MQH A;  2BDN A;  2PYK A;  4DN4 M;  1FNV A;  4ZLT F;  3HOY H;  1QUQ B;  1BR9 A;  1R4P B;  2VL6 A;  1JMC A;  1N32 Q;  4AYB B;  2KCC A;  4BY7 B;  2WAQ E;  3CCM A;  1CZG A;  4LF7 Q;  4KD4 A;  4K0K Q;  1S5C D;  4LJZ C;  1L1O B;  4V19 0;  1HNX L;  1PH6 A;  4KMU C;  1YZ6 A;  1B3Q A;  1KAA A;  4POG A;  3RZD B;  5HGQ A;  3SDZ A;  2NTT A;  5EPL A;  5C3X A;  4DXG A;  1OO9 B;  1GHK A;  3TDQ A;  1S5E D;  2TMP A;  3CQZ B;  4DV6 L;  1KHI A;  4DPG A;  3HOU B;  1K9M C;  3RR5 A;  3Q23 A;  2A1A A;  4LF6 Q;  2AQ3 B;  3H0G H;  2GA4 B;  3PIP A;  5EBD A;  4JI6 Q;  5D14 A;  2LXJ A;  5ELE A;  4PZ8 A;  4LF5 L;  1TY0 A;  4L5T A;  2ALY B;  3G7L A;  3M4P A;  1BQQ T;  4JK1 C;  4LWC A;  1PRT D;  3ULP A;  1AE3 A;  5A2Q L;  1F77 A;  5C3E H;  4RH6 A;  3K5N A;  2EYH A;  1CSP A;  3C1F A;  5C44 G;  3ERQ A;  4QL5 A;  5M5W H;  1QZH A;  4K5V A;  3A8K E;  2QKI C;  1JWS D;  2AHO B;  4OO1 H;  4P2C B;  4HAE A;  3K80 C;  1HXY D;  1WJJ A;  4OX9 L;  1HNW L;  2IW3 A;  2VQE L;  2EPB A;  3M3Y B;  1WTV A;  1Z7T A;  1LTL A;  5CC4 A;  2HHH Q;  1F9P A;  2IT1 A;  3F1Z A;  5ISR A;  3GTL H;  2A19 A;  2L12 A;  1JOQ A;  1H9R A;  2SNM A;  4K6D A;  2ZTE A;  2EYP A;  2ZXP A;  2VUM G;  5IP9 H;  3Q0A A;  3M4Q A;  1IBL Q;  3A8I E;  3MVV A;  2JP1 A;  1BBW A;  2KA7 A;  4IJL A;  2UXC Q;  3TRZ A;  3TZD A;  5EQ0 A;  1WTQ A;  3CC2 A;  2JA9 A;  5ELD A;  2WKC A;  3GO5 A;  1QVG A;  1TII D;  2PZT A;  1EU4 A;  4H7B A;  1D2B A;  2F0U A;  3A8J E;  3BU2 A;  3OMC A;  2QCP X;  1VQH A;  4R4C A;  3MAQ A;  2IX0 A;  5K36 G;  4LFC Q;  2VQE Q;  2N78 A;  4PZ7 A;  1QNK A;  4DV5 L;  3BDC A;  4C3H H;  5IGB A;  3AEV A;  1STN A;  1Q81 C;  3ULJ A;  1AZP A;  1ASZ A;  2BOS A;  2KVM A;  1XNQ Q;  1LO5 D;  5IT9 c;  1H9K A;  1K83 H;  4DR1 L;  1PTO C;  1AN8 A;  5CYU A;  3FVQ A;  1C0A A;  1FYC A;  3J81 i;  2HCC A;  2NN6 G;  4BBR B;  4QUC A;  5M3M B;  5LL6 X;  2B2W A;  1O7Z A;  2O4X A;  4XQQ A;  1E2Z A;  1KL9 A;  1YHA A;  1ILQ A;  2RF4 A;  2BE5 C;  2B2Y C;  4DF7 A;  4HIO A;  2N88 A;  4GOP A;  1JIC A;  4PV1 C;  1EWI A;  3J81 L;  2F0K A;  5COY A;  1GD7 A;  5A35 A;  2OQ0 A;  2ZM6 Q;  4MZ9 A;  3EQL C;  4U67 3;  2RHQ B;  3I3C A;  1QVF A;  3CD6 A;  3KUP A;  4LMQ D;  5LMU L;  3OYY A;  3GTG B;  5M9O A;  3VYS A;  3V2T A;  3MA2 B;  1PH1 A;  3HKZ G;  4GN5 A;  2F0P A;  2F0O A;  4X66 L;  5C3E G;  3T1H Q;  3HRZ C;  2OWO A;  5AFW A;  1X3F A;  3AU7 A;  2AUK A;  4KN4 C;  3STB D;  1TWF B;  1TWA B;  1UUP A;  3F2U A;  1QWY A;  2AKW B;  5JEA J;  3K0X A;  2PQE A;  1L2F A;  2IPK D;  1PH9 A;  3I7F A;  1PHJ A;  4RKL A;  5D3D A;  1YNJ D;  2IX1 A;  2I5M X;  2NN6 I;  3S1N B;  1B9N A;  1EQT A;  1JWM D;  2B2U C;  2AWO A;  5LHY 1;  3I90 A;  3KYH C;  3S16 H;  2JEB I;  3A54 A;  2R92 B;  3KBX A;  4J15 A;  1PFB A;  3E6Z X;  4O42 A;  1PH3 A;  2ZJP A;  2UU9 L;  1MSG A;  3J81 c;  3OIQ A;  4OL7 A;  4P71 A;  2K04 A;  2B3G A;  1GM5 A;  3RLF A;  4Q0F A;  1JJ2 A;  2R7Z H;  2WIN B;  2XSC A;  1BKB A;  1RHP A;  1WCM H;  5C5L A;  2EYO A;  1D7Q A;  3NTK A;  3CP0 A;  3T16 A;  3H94 A;  2BDO A;  1BCP F;  4R8I A;  1WD0 A;  4G4K A;  4ZYS A;  1V1P A;  4KHV A;  3T51 B;  1VQN A;  1I4X A;  3D4R A;  4DV5 Q;  2ZJQ A;  3MEF A;  2E5L L;  2UUB Q;  1U0L A;  2K52 A;  4JI8 L;  3K57 A;  2E76 C;  3STB C;  3K0Y A;  3OPO A;  3Q22 A;  3I70 A;  2LFN A;  3UE1 A;  3HOU G;  1KNE A;  3KF8 B;  3LNN A;  3KJP A;  3TRE A;  3E5S A;  4C3J G;  1XJV A;  1KD1 C;  2CH4 A;  1LAC A;  1G6Z A;  1X6O A;  3I4M B;  1NJI C;  3SK4 A;  1CKN B;  4JI8 Q;  3OTO Q;  5FO7 B;  3BDO A;  3CW2 C;  1IHZ A;  4A3G G;  2WB1 G;  2IWH A;  4KJO A;  2FFK B;  4ZKC B;  4RCO A;  3AFQ A;  4X65 Q;  4FNF A;  2EY1 A;  2XN9 C;  4JI0 Q;  3H3V H;  2R61 A;  1A2T A;  2RA4 A;  1SYD A;  4JC0 A;  3HOV B;  1X54 A;  1OXT A;  4JI1 Q;  2K5V A;  1PTO F;  1HPC A;  1TS5 A;  4UDU C;  4LF4 Q;  1FJG L;  1PTO H;  3DWQ A;  1MSH A;  4JI6 L;  5FLM H;  2K05 A;  5IGE A;  1VQ9 A;  3T56 B;  1CK1 A;  4MTK A;  1N36 L;  4TQU S;  4IUP A;  4BA2 I;  3L7Z C;  1CSQ A;  4IFD I;  4GLX A;  1CT1 D;  1XPU A;  1XPR A;  1ASY A;  5J3B A;  4K5X A;  3U9O A;  5E7N A;  2IJ0 A;  5FO8 B;  2YTX A;  3FP9 A;  5JJI A;  1WD1 A;  2IX3 A;  4KV6 A;  1TWH H;  1VF5 C;  1ENC A;  3I73 A;  2MHV A;  4H0L C;  2HT1 A;  4JYA L;  1SE8 A;  4QGU A;  4KKS A;  2JXM B;  3PSI A;  1P16 A;  3PO2 H;  4JV5 L;  5IGD A;  1ICF B;  4LF4 L;  2NVT H;  4TSS A;  3PF4 A;  3W1B A;  3GTO B;  1HHV A;  5CGK A;  2ZM6 L;  4B9X A;  4IZ8 A;  1L1O C;  4EQP A;  1SE3 A;  1KTK A;  1SND A;  3I55 A;  1RCV D;  3EN2 A;  4BWG B;  3S1M B;  1FNW A;  2O2L D;  1C7Y A;  4DR7 Q;  5M3M H;  2BCO A;  4KHP Q;  2V1C C;  4FYD A;  2AQ2 B;  4LF9 Q;  5IYD H;  4QUF A;  4G57 A;  5T1I A;  1HFN A;  4FXG C;  3S1N H;  1IXR A;  1HFG A;  3WDN A;  1B9M A;  4J1M A;  4YWL A;  1YHQ A;  4RAU C;  2EYJ A;  1EIY B;  1IL8 A;  2QGQ A;  4DK0 A;  5C0X I;  2OF1 A;  2F0I A;  1G6P A;  3HZX A;  4B3M L;  1XWE A;  3KF8 A;  4KHP L;  4LW1 A;  4BBS G;  1W6K A;  4ALP A;  4A3F H;  1XMQ L;  3PUW A;  5IY0 A;  2KEC A;  2K4K A;  2ENB A;  1VQP A;  2ZXR A;  2JQO A;  1VF7 A;  3HOV H;  1CA6 A;  1X3Q A;  1NTG A;  1F2Y A;  4JPB W;  4MNO A;  2D2C C;  3EVQ A;  3NXW A;  4OIK A;  1J6Q A;  1EY8 A;  2UU9 Q;  1FD7 D;  3VR2 A;  4DAV A;  5BR8 L;  4X3K A;  2N8N A;  4XYO A;  1EZ6 A;  1D5M C;  4DKA C;  5M3F H;  3M85 A;  5M5X B;  3CQZ H;  4IPG A;  4K8J A;  2CQA A;  3BYY B;  2PQA B;  3MWY W;  4JI3 L;  2F3I A;  1XMO Q;  1BF4 A;  1KDA A;  3MFY A;  2Z4I A;  3KOJ A;  4WFN 3;  3I4M G;  2J7Z A;  2L1B A;  4Y52 H;  3OMG A;  1NR4 A;  2DJF C;  5IWA L;  4DV2 Q;  2UUA Q;  4FF3 A;  2K5D A;  5ELN A;  4K6L A;  2E74 C;  3TP6 A;  4C3I B;  3NWT A;  5JOB A;  3KK7 A;  3QWN A;  1DOM A;  1HQR D;  1MJE A;  1PFN A;  3NP8 A;  1OTC A;  1ONL A;  3CF5 A;  4KKU A;  3NEN A;  2I0Q A;  2EYL A;  2RBM A;  4KD3 A;  3VA7 A;  2NTS A;  3KDF B;  2K14 A;  3SK6 A;  4JV5 Q;  2CHB D;  2MP1 A;  3MEH A;  3H09 A;  2R93 B;  4A3F B;  4C3I G;  1I6V C;  3H3V I;  1VQB A;  3D4D A;  3CCR A;  1B70 B;  2F0M A;  4KI0 A;  2XRQ D;  3CMA A;  1Y1V G;  1PZI D;  5DAU A;  2E2J B;  1E0B A;  1FGB D;  1UE1 A;  2WAQ B;  4C1N I;  4BBR G;  3VR4 A;  2JA5 B;  2NVX H;  3MTS A;  1SYC A;  1U5K A;  4XIG S;  4LUO A;  4LF8 L;  4QQB X;  2F3W A;  2F0D A;  1SNP A;  4NXN Q;  4K0K L;  3BZD B;  3K5O A;  3C2P A;  2HQL A;  4N9P A;  3DEP A;  4DGZ A;  2JK8 A;  2Q2T A;  1WTX A;  3AMU A;  3S2H H;  1EU3 A;  3A7L A;  2K01 A;  1VMP A;  3JAM L;  1I5F A;  1TWA H;  1EOT A;  1TWF H;  2Z6K C;  2EDG A;  4HJ8 A;  1E1O A;  2JJQ A;  4X64 L;  5FJ8 G;  2L55 A;  4EQN A;  5IGC A;  3OWE B;  3JAM c;  4A3B G;  2IY5 B;  4HJ5 A;  2VW9 A;  1XX8 A;  2F52 A;  4LUZ A;  1RD9 D;  3S17 H;  4LFA Q;  1X9N A;  5CV7 A;  2JA6 G;  1EEI D;  1F9R A;  3QO2 A;  1TWG B;  1Q46 A;  2LS0 1;  5IOC A;  1DOL A;  2UXD L;  3TS2 A;  4GZY C;  1NNX A;  1PRT B;  1EYA A;  3M9B A;  2K5W A;  4NKL A;  4BY1 G;  3TS0 A;  1PYB A;  2F4V Q;  1VQ8 A;  1B53 A;  4LAA A;  2MGS A;  4ZUI A;  3GTQ B;  1VCI A;  1SRO A;  3GQB A;  1S5B D;  1DGS A;  2EOT A;  3HOW B;  1W2B A;  4X64 Q;  2M00 A;  2HDM A;  1TU2 B;  1JJC B;  1XNQ L;  3P20 A;  3RN2 A;  1I3Q H;  1HQM C;  1S4Z A;  2UXB Q;  3N52 A;  2R7F A;  1KLG D;  5A2Q E;  1ET6 A;  1GKH A;  1EYD A;  3SE0 A;  1ROD A;  1NAP A;  2E5L Q;  2B2V A;  4OON A;  4JI5 Q;  1W6J A;  2P5Z X;  5JVH 3;  1N32 L;  4HJ7 A;  4JBK A;  2Q8T A;  3RD4 A;  2MNA A;  3L2P A;  5LMN W;  3S2D H;  3EJI A;  2PQA A;  1L0Y B;  1JE5 A;  1A6X A;  2B63 H;  1BDO A;  4RA8 A;  3HS0 C;  1B1Z A;  4PZ6 A;  4A3J G;  4O2D A;  1GJX A;  2BA1 A;  3U9S A;  5IP7 H;  2CCZ A;  5FLX c;  1SYE A;  2JEA I;  4GNX C;  3G6E A;  2WB1 B;  2HDL A;  1WOC A;  3CC7 A;  1Q86 C;  2K33 A;  2EJF C;  2VB2 X;  1K83 B;  1UE6 A;  4BXX H;  1PFS A;  3ONA B;  5FO9 B;  1IBK L;  2MPM A;  2R6G A;  1YJ9 A;  2PI2 A;  4IUV A;  4DV1 L;  1Y14 B;  5JEA H;  2R3Z A;  4KJN A;  2JA8 G;  5LL6 S;  4CDC C;  1I4R A;  1WTW A;  2NVX B;  2F4I A;  3GTK B;  3FHW A;  3K7A B;  4EVO A;  4LFB Q;  1BBX C;  3DM3 A;  4JI5 L;  1JB7 A;  1Q8K A;  2NVQ B;  1EIG A;  3HOZ H;  1RL2 A;  4F7X A;  4IN3 A;  1HUM A;  2PCF B;  3J80 c;  2ZTC A;  2WAC A;  3PIO 3;  2C35 B;  4N8X 1;  3TBI B;  2WKD A;  3FRP B;  4L5S A;  2PMZ B;  1Q8I A;  4DV3 Q;  2CKZ B;  1KDB A;  1MHW C;  2PW7 A;  1I94 L;  3GTK H;  1Y8N B;  4A3D H;  4HMJ A;  1N33 Q;  3ND9 A;  4IUU A;  3RZO H;  4RCN A;  1BOS A;  1GUS A;  5J22 A;  1K3R A;  1EIH A;  1VQC A;  2Z0S A;  5CMD A;  2RVL A;  5KEE A;  3S1M H;  2SDF A;  1XXG A;  3E9I A;  3GP7 A;  3M7N A;  4DR4 L;  5FKA C;  5IP7 G;  2K5Q A;  4NB3 A;  2UXB L;  1EL0 A;  4XT3 B;  5GRO A;  4M8A A;  1CQV A;  2LSS A;  2F0S A;  3I4M H;  1G2S A;  3KBG A;  4NMZ A;  3K5L A;  3HOX H;  2K03 A;  2EE1 A;  2PNH A;  3RLN A;  3U58 A;  4DAM A;  4PNY A;  4DUZ L;  5M3F B;  3NBH A;  5JEA G;  4YY3 L;  4ME5 A;  5EKK A;  1N34 Q;  1ESF A;  3H0G B;  2F0N A;  4GS3 A;  2EY6 A;  3HKS A;  3JAM E;  1BUV T;  1YHB A;  2A8V A;  1PTO D;  3VR6 A;  4UAI A;  3A7A B;  3CU7 A;  3NEL A;  1L0X B;  3D0F A;  4B3R Q;  4KK7 A;  3GD7 A;  2AUJ D;  2EYM A;  3LX0 A;  3KLW A;  3SVM A;  2KUM A;  4GNX A;  2K75 A;  1O7L A;  3OOC A;  2G5D A;  2XTI A;  3NPP A;  3T1Y Q;  2M2L A;  3HP3 A;  5E4X A;  4IFD H;  1IZ6 A;  1SDF A;  1Y8O B;  1SMX A;  4I65 A;  1HA6 A;  2SEB D;  3J80 E;  1X32 A;  4HIK A;  3NK9 A;  1MIU A;  3NSW A;  1A3T A;  1EY7 A;  4LF6 L;  3MFG A;  1TWC B;  4NDX A;  3HKZ E;  5CV6 A;  4A93 G;  3SR1 A;  2PMZ E;  1B7Y B;  4C56 C;  1RJT A;  2A68 D;  5KGU A;  3UDX A;  4OWW B;  3I4N H;  4X3T A;  3RLO A;  2CFM A;  5IGF A;  3M3Y H;  1N9W A;  3PUZ A;  3WOE A;  2KEN A;  1RKN A;  2XRS D;  2OEO A;  1LV9 A;  2RCF A;  1AH9 A;  1R9T H;  5IOD A;  1NMG A;  1V8Q A;  5KND A;  1U4M A;  4G7O C;  3OHX C;  3T1Y L;  2O5I C;  3EIV A;  3NHH A;  4MTN A;  4IJH A;  2JA8 H;  3AB9 A;  1XTD A;  4OEL B;  1CHP D;  4A3I H;  3UDF A;  3T53 B;  2WP8 J;  2A69 D;  3S9W A;  1G8Z D;  3H3V C;  1V1O A;  5CV4 A;  4H44 C;  5EKL A;  1KQS A;  4A3C H;  2YU9 H;  2N49 A;  1WVL A;  1PMR A;  4KKT A;  2Z9H A;  2VUM B;  5JVG 3;  4JI3 Q;  2LY7 A;  4IUT A;  3GTP B;  2RHS B;  1H95 A;  4X3S A;  1YNN D;  4LUV A;  3OW7 A;  1EY0 A;  1JOR A;  4RFB A;  1PV4 A;  1HA5 A;  3J7Y W;  3GTP H;  1MD2 D;  2K5H A;  1ENA A;  1QOH A;  1U4L A;  2RCN A;  5C4J B;  4P72 A;  3MXP A;  3D4W A;  1CKN A;  3J80 i;  3BG3 A;  5BN5 A;  1Y1W B;  4BY1 H;  1T5X D;  4FXD A;  2B2Y A;  3MXU A;  1LTS D;  4JI4 L;  2WV6 D;  3OIP A;  5KNB A;  2QF7 A;  1NMF A;  4DK3 C;  3C1E A;  1HNW Q;  3IKJ A;  1IYU A;  2A6H C;  4GLA C;  4XTC S;  3VYU A;  2F0Q A;  4CDE C;  1VQ4 A;  1IBL L;  2OCE A;  5BN3 A;  4HID A;  5EAY A;  5GAD C;  3AYH B;  4IUR A;  1X3G A;  1NBW A;  4R4T A;  1V9P A;  3HOX G;  4DU9 A;  2L0C A;  1R9T B;  4HR7 B;  2KCM A;  4JI4 Q;  5CV5 A;  4RHR A;  1E1T A;  1I4G A;  1JB3 A;  1PYW D;  5TSS A;  4OWT B;  1O7I A;  4M1U B;  5M5W B;  1S5F D;  4YCU A;  1XMQ Q;  3DWP A;  4OWX B;  2KED A;  1GVP A;  3M4Y A;  4CKC A;  2NYZ D;  3OWF A;  1QIL A;  5C0X G;  4G7Z C;  3M4O H;  5C4J H;  2K5N A;  3L0O A;  2Y0S G;  1I94 Q;  4JCV E;  3GV3 A;  2KCT A;  4BY1 B;  4JBM A;  1TWG H;  4K2K A;  5CR3 A;  4A75 A;  3WOF A;  1D6E C;  2JE6 I;  1LT6 D;  3K7A H;  1EQV A;  2OXP A;  2FHT A;  3I8Z A;  3BZK A;  3PF5 A;  2VUM H;  3SXH A;  5CV8 A;  3D31 A;  1STE A;  3K7U C;  1CFM A;  1SLJ A;  4BA1 I;  1BCP B;  1VQG A;  4NXM L;  1Y69 U;  3CCJ A;  1ZKO A;  1CKO A;  4A3B B;  2A74 C;  1B8A A;  4DXF A;  1GUN A;  4DUY L;  5DNF A;  3I72 A;  2NBF A;  4YIJ A;  2K50 A;  5K5P A;  3E0E A;  1E2W A;  3CCV A;  1RIP A;  4P75 A;  1RTN A;  2AWN A;  3G6J B;  2FJ2 A;  1NUC A;  1Q90 A;  5C5M A;  4PMW A;  3RZO B;  4FXK C;  4DNR B;  4UP9 A;  2HIX A;  4JI2 Q;  3A56 A;  1QE6 A;  4NP5 A;  4DK6 C;  1B50 A;  2OT2 A;  3L3O C;  5M5X H;  4HCE A;  5JJL A;  3ZYY X;  1HZB A;  2PZU A;  3PUY A;  4ZQ3 A;  1ML0 D;  1VS0 A;  3HFZ B;  4L6T B;  4MN3 A;  4POF A;  1A8V A;  3SHL A;  1ESR A;  3J81 j;  3A5Z B;  1Y1V B;  2N55 A;  2OQK A;  4HJ9 A;  1CHQ D;  5I9O A;  5KYI A;  5GQO A;  3LWU A;  4ZKB B;  3SEB A;  1TQO A;  3GTJ B;  3E0J A;  4H13 C;  2DUD A;  2WB1 E;  3F8T A;  4DR6 Q;  3R2I A;  1VQM A;  3MXN A;  1Q7Y C;  4L8J A;  3HG9 A;  5L37 A;  1F2M A;  3X3M A;  1HNX Q;  5CV9 A;  3QB3 A;  5ELC A;  1PZJ D;  4ODG A;  1JWU D;  1QCB D;  4B3R L;  1C48 A;  5C44 B;  2MUY A;  4OO1 I;  2Z6B A;  1Q82 C;  4J8Q A;  5I9P A;  1D8L A;  1GUG A;  3HOW H;  5IGG A;  1SXT A;  2A6H D;  1ENF A;  3LWE A;  3PUV A;  3I56 A;  3CHB D;  3DLL A;  3S24 A;  4GKK Q;  3R2T A;  1K0R A;  1F9S A;  4LF5 Q;  2FXQ A;  5FOB B;  5D65 A;  5KRU A;  1TXY A;  2K6A A;  2H5X A;  5M3M G;  1SJH D;  2B63 B;  1AEX A;  3NQT A;  2RSN A;  3E9H A;  1B2T A;  1OXU A;  3V05 A;  1VDZ A;  2KHJ A;  3N6R A;  3PO2 B;  3RN5 A; 
#chains in the Genus database with same CATH homology
 4FVM A;  2F03 A;  2KHS A;  4IFD J;  1O80 A;  1BCP D;  3MC0 B;  3PIP 3;  2RDG A;  3FDT A;  2PO4 A;  4IQZ A;  1SYF A;  3M4O B;  2B2W C;  2JYO A;  1EFI D;  4RGN A;  3IAY A;  4BBS B;  2L4N A;  1A3U A;  4HMI A;  3HOY B;  1Z47 A;  4CJ0 B;  2Z4H A;  3VR5 A;  3TN2 A;  1GUW A;  3QG1 A;  2SOB A;  2J0T D;  2RKS A;  4HSP A;  2RSO A;  1MI2 A;  4A3D B;  2J4X A;  1F2Z A;  4XDX A;  5FLX E;  3EFX D;  1BO0 A;  3R93 A;  3O13 A;  1STB A;  2C9O A;  2E2D C;  2F0E A;  3FPP A;  2SNS A;  4DA2 A;  2XVS A;  2DNC A;  4TRD A;  5DM7 3;  5I2Y A;  3CRK C;  1II3 A;  4ILW A;  1PXU A;  1A2U A;  1SNM A;  5I6W A;  2JA7 B;  2X6L A;  1TS3 A;  1Q1E A;  1SEB D;  1D5Z C;  1TS4 A;  1OXX K;  4DAP A;  2JA6 B;  1SMY C;  5NUC A;  1SNQ A;  4ZAI A;  1DXM A;  1XYI A;  1JC7 A;  4JBW A;  4ID6 A;  4HCS A;  5JAV A;  5KNC A;  1CI3 M;  2F0L A;  4XQJ A;  4CBV A;  5BN4 A;  2Q8R E;  4CGY B;  4OIJ A;  1X3P A;  1WTO A;  3P7J A;  5J1Z A;  1OXV A;  2H1E A;  1S5D D;  4A93 B;  1TS2 A;  3VR3 A;  3NQI A;  4MHE A;  3I4L A;  1PFM A;  3K58 A;  1JE4 A;  3HGB A;  4CHT B;  2B39 A;  1SE4 A;  4R9W A;  4FP5 D;  2EJM A;  2ICE C;  1STY A;  1YNN C;  2F0F A;  1YNJ C;  2YU9 B;  1UNS A;  4KN7 C;  4E6I A;  4XYQ A;  1J8I A;  3H6M A;  2H4O A;  1EWC A;  2K1B A;  1NR2 A;  4Z9C B;  4IUQ A;  1GUT A;  4ABN A;  1PRT F;  3BVM A;  4K8I A;  1M8A A;  2Q8I B;  3S16 B;  5HGT A;  2CW0 C;  2A6E D;  5EBC A;  3ND8 A;  4O1N A;  5EPJ A;  4FF1 A;  1KAB A;  1DON A;  3BYT B;  1A15 A;  3NWS A;  1TT2 A;  3IL8 A;  1SSO A;  1WCM B;  2TSS A;  2ZT9 C;  1KDC A;  3R3O A;  2B8G A;  1MBY A;  3HKZ B;  3W3A A;  3BVZ A;  3KLR A;  1F9Q A;  1C8C A;  1EZ8 A;  1ZYR C;  4RGT A;  1PDQ A;  5T1G A;  2F0W A;  3I91 A;  1GHJ A;  3TME A;  2DY8 A;  1H9J A;  4FF4 A;  5JPN C;  4OHJ A;  1KLU D;  4OO1 G;  5JJZ A;  5DM6 3;  4RGO S;  1QG7 A;  3C46 A;  2VXW A;  3S17 B;  3MZ5 A;  2HUG A;  5JPM C;  3NUC A;  3PO3 B;  2B8F A;  1LAB A;  3I4N B;  1JQY D;  3CKI B;  2M9V A;  2AQ1 B;  2R7Z B;  1TWH B;  2FIN B;  4RGM A;  1DYQ A;  1LTA D;  2NZ1 D;  3UI2 A;  1SMY D;  5D3I B;  3S1Q B;  2NWG A;  1RTO A;  1LTR D;  1JR0 D;  2F3V A;  2G9D A;  2EY2 A;  1IKM A;  4WOR A;  3QOL A;  2V4D A;  2RQX A;  1PTO B;  1GXD C;  2PZW A;  3S1R B;  1BXT A;  1NSN S;  1H9S A;  1SE2 A;  2D62 A;  1NCV A;  2FMM A;  1QNU A;  4IFD G;  1SYB A;  1FNU A;  1I4H A;  1LLR D;  1CZW A;  5C4Z A;  2G9H D;  5DEH A;  3D3R A;  4ZUJ A;  2PNR C;  3GTL B;  4N9T A;  2CW0 D;  3BDL A;  1R4Q B;  5IIF A;  1LT3 D;  2F1M A;  2RDF A;  1SJE D;  1D1K A;  4C3J B;  1V1P B;  5I4D A;  3C3L A;  4B9W A;  5I2X A;  4A3E B;  4RWS C;  2ICI A;  1O7Y A;  4CKE A;  4A3I B;  2HCI A;  4IAL A;  1CA5 A;  2B2V C;  5C3E B;  3DXJ C;  1MGS A;  3J80 L;  1IKL A;  5FLX L;  3FKI B;  1ZEQ X;  1DM0 B;  1IW7 D;  1JOO A;  5C0X H;  2LKV A;  3J7A V;  3A55 A;  4Q5V A;  5ELB A;  1U4P A;  1V43 A;  5COR A;  2K28 A;  1BNZ A;  1RDP D;  3ERO A;  1F2L A;  4LK1 C;  2BA0 A;  5EJW A;  2DNE A;  1D5X C;  2EY5 A;  3R8B A;  3NTH A;  4DAY A;  3S15 B;  4FF2 A;  1FR3 A;  3K5M A;  1GUO A;  4WJW A;  1U9R A;  1DZ1 A;  5G3L F;  5IT9 L;  1LTT D;  4ZK9 B;  4QB4 A;  1I3Q B;  2A5H A;  4KY6 A;  1HTL D;  4X3U A;  4C1N K;  1EYC A;  1D1I A;  2WII B;  2JSO A;  2A73 B;  4CKB A;  3PV0 A;  4K5W A;  1LTB D;  3URY A;  1TR5 A;  4V0B A;  3HEJ A;  2DN8 A;  1I4P A;  1Y8P B;  3TP7 A;  3ITP A;  2ID0 A;  3L9A X;  4EQO A;  1I6H B;  3D6W A;  3EA6 A;  3BS1 A;  1UEA B;  4EGV A;  1EEF D;  3TZU A;  1SFO B;  2C5C A;  4S3S A;  4F87 A;  2IL8 A;  4K2L A;  2NB0 A;  1G29 1;  3KLS A;  1U4R A;  3D8G A;  2NN6 H;  5ELF A;  5KYL A;  3IFT A;  1ZYR D;  1SNC A;  1J9O A;  5EGT A;  4PQX A;  2F0T A;  4BS9 A;  4C3H G;  1SNO A;  5KIX A;  1ET9 A;  1VMC A;  1HTP A;  2XIW A;  3D6C A;  2HQE A;  1QJO A;  1ZXT A;  2VNU D;  3BVG A;  1T5E A;  5HUR A;  2A6E C;  5C4H A;  3DMU A;  2Y0S B;  2KQ3 A;  2LMC B;  1SBB B;  3FPU B;  3T4A C;  5C4X B;  1CQF A;  1ILP A;  5E3F A;  2EVB A;  1LT5 D;  4MIU A;  1E2V A;  5CBA E;  2L11 A;  2A68 C;  3KLS X;  1LTI D;  3PUX A;  3QOJ A;  1TKW B;  2Z1C A;  1EY6 A;  2B2T A;  1BCP C;  2EXZ A;  4QIW B;  3S2D B;  1K8M A;  3HOX B;  3P1H A;  3QJY A;  3OSO A;  3FMC A;  4IUN A;  5EKI A;  3TP8 A;  3M7G A;  3DM1 A;  1STA A;  5E4W C;  2EZV A;  4KTA A;  1DOK A;  4TKO B;  2L9H A;  2VB3 X;  1Q12 A;  1H9M A;  4L63 B;  1B3A A;  1WTR A;  3CRL C;  5FK9 C;  2I46 A;  4FO2 A;  2E2H B;  3J7A F;  5K36 H;  4A3G B;  1G2T A;  4B08 A;  2NVT B;  2DY7 A;  3DHQ A;  4XT1 B;  3NE5 B;  1DJR D;  5C6A A;  1K8O A;  3P75 A;  3MXG A;  4RHS A;  4ULL A;  2BE5 D;  4KY7 A;  2QEJ C;  1AW7 A;  3DWA A;  5I6Y A;  3J81 E;  3NBI A;  3TSS A;  2Z8L A;  1Z6H A;  4CJ1 B;  2O5J C;  3SK5 A;  2E2I B;  1EWH A;  1CM9 A;  3X3N A;  1IYV A;  4HED A;  1AP0 A;  3S2H B;  2XNA C;  5IT9 E;  5M5Y B;  4HTH A;  1I4Q A;  1TY2 A;  1B4O A;  2F0J A;  2E75 C;  3K6O A;  4QF4 A;  1WTP A;  1EY9 A;  1SYG A;  1C4Q A;  2F0G A;  2EYF A;  1PLF A;  4HN7 A;  1PZK D;  1Q3L A;  4KHZ A;  4RKB A;  4PMC A;  2K7V A;  4ZRZ A;  3K59 A;  4HSV A;  3VA5 A;  1STG A;  4CJ2 C;  1KNA A;  1JCK B;  4WRD A;  2QIL A;  2D9U A;  5G3L D;  2RDH A;  1M4V A;  2F0V A;  4XQN A;  4I7Z C;  3RUZ A;  3V96 A;  2KCN A;  3PMF A;  1PRT C;  3MHB A;  3S14 B;  2CVR A;  2NUC A;  2ZXO A;  4DFA A;  3NTI A;  2L5T A;  4F8M A;  2FMC A;  1B44 D;  2KEE A;  4XXE A;  3H91 A;  1AFP A;  3HOZ B;  3FEW X;  1UAP A;  1GOZ A;  2PPB C;  2B2U A;  4QMG A;  2I07 B;  1OXS C;  4K14 A;  1SAP A;  1HUN A;  1EY5 A;  4Y7N B;  3VYR A;  3QIA A;  4KY5 A;  1G91 A;  2K32 A;  2MJ8 A;  4NW2 A;  4OGQ C;  3W2D A;  4DNT B;  1H9S B;  2EJG C;  1A3V A;  5J39 A;  4A3K B;  2KJX A;  2F0H A;  1O78 A;  4R8N A;  4A3J B;  1I50 B;  5C3W A;  1DD2 A;  1TVX A;  2QDB A;  1AZQ A;  1Q1B A;  1STH A;  3Q24 A;  2B2T C;  2NVY B;  1LTG D;  1EY4 A;  3RMH A;  3T13 A;  2KOL A;  2YYZ A;  1ICW A;  1RF2 D;  4F88 A;  2X69 A;  3GTM B;  3SK8 A;  1XTC D;  5C0X J;  4C2M B;  4G7H C;  3IFD A;  2XWB B;  2JA8 B;  4U68 A;  1DCZ A;  2D5D A;  2A69 C;  1CTM A;  3VYT A;  4C3H B;  5F2D A;  1HRJ A;  3DUZ A;  2XWJ B;  3GV6 A;  1HCZ A;  4J6H A;  4PMB A;  1IW7 C;  2PW5 A;  5CBE E;  5EPK A;  2X6G A;  4QCL A;  4DK1 A;  1QB5 D;  5E1F A;  1JOK A;  3TP5 A;  3Q6S A;  4A3M B;  1LT4 D;  3DEO A;  2BDN A;  2PYK A;  4DN4 M;  1FNV A;  4ZLT F;  1BR9 A;  1R4P B;  4AYB B;  2KCC A;  4BY7 B;  1CZG A;  4KD4 A;  1S5C D;  4LJZ C;  4V19 0;  4KMU C;  1KAA A;  3RZD B;  3SDZ A;  2NTT A;  5EPL A;  5C3X A;  4DXG A;  1OO9 B;  1GHK A;  3TDQ A;  1S5E D;  2TMP A;  3CQZ B;  3HOU B;  3Q23 A;  2AQ3 B;  2GA4 B;  5EBD A;  5D14 A;  5ELE A;  1TY0 A;  3G7L A;  1BQQ T;  4JK1 C;  1PRT D;  5A2Q L;  1F77 A;  4RH6 A;  3K5N A;  2EYH A;  3C1F A;  3ERQ A;  4K5V A;  3A8K E;  2QKI C;  1JWS D;  4OO1 H;  4P2C B;  4HAE A;  1HXY D;  2IW3 A;  2EPB A;  3M3Y B;  1WTV A;  1Z7T A;  5CC4 A;  1F9P A;  2IT1 A;  5ISR A;  2L12 A;  1JOQ A;  1H9R A;  2SNM A;  4K6D A;  2EYP A;  2ZXP A;  3Q0A A;  3A8I E;  3MVV A;  2JP1 A;  2KA7 A;  3TZD A;  5EQ0 A;  1WTQ A;  5ELD A;  2WKC A;  3GO5 A;  1TII D;  2PZT A;  1EU4 A;  4H7B A;  1D2B A;  2F0U A;  3A8J E;  3OMC A;  2QCP X;  3MAQ A;  2IX0 A;  5K36 G;  1QNK A;  3BDC A;  5IGB A;  1STN A;  1AZP A;  2BOS A;  2KVM A;  1LO5 D;  1H9K A;  1PTO C;  1AN8 A;  5CYU A;  3FVQ A;  1FYC A;  2HCC A;  2NN6 G;  4BBR B;  4QUC A;  5M3M B;  5LL6 X;  2B2W A;  1O7Z A;  2O4X A;  4XQQ A;  1E2Z A;  1ILQ A;  2BE5 C;  2B2Y C;  4DF7 A;  2N88 A;  1JIC A;  4PV1 C;  3J81 L;  2F0K A;  5COY A;  5A35 A;  3EQL C;  4U67 3;  3I3C A;  3KUP A;  4LMQ D;  3GTG B;  5M9O A;  3VYS A;  3V2T A;  3MA2 B;  2F0P A;  2F0O A;  3HRZ C;  5AFW A;  3AU7 A;  2AUK A;  4KN4 C;  1TWF B;  1TWA B;  1UUP A;  3F2U A;  1QWY A;  5JEA J;  2PQE A;  2IPK D;  4RKL A;  5D3D A;  1YNJ D;  2IX1 A;  2NN6 I;  3S1N B;  1B9N A;  1EQT A;  1JWM D;  2B2U C;  2AWO A;  5LHY 1;  3I90 A;  2JEB I;  3A54 A;  2R92 B;  3KBX A;  1PFB A;  3E6Z X;  4O42 A;  1MSG A;  3OIQ A;  4OL7 A;  2K04 A;  3RLF A;  4Q0F A;  2WIN B;  2XSC A;  1RHP A;  5C5L A;  2EYO A;  3NTK A;  3T16 A;  3H94 A;  2BDO A;  1BCP F;  1WD0 A;  4R8I A;  4G4K A;  4ZYS A;  1V1P A;  4KHV A;  3T51 B;  1I4X A;  3D4R A;  3K57 A;  2E76 C;  3K0Y A;  3OPO A;  3Q22 A;  3I70 A;  2LFN A;  1KNE A;  3LNN A;  3E5S A;  4C3J G;  1LAC A;  1G6Z A;  3I4M B;  3SK4 A;  5FO7 B;  3BDO A;  1IHZ A;  2IWH A;  4KJO A;  2FFK B;  4ZKC B;  4RCO A;  4FNF A;  2EY1 A;  2XN9 C;  2R61 A;  1A2T A;  2RA4 A;  1SYD A;  3HOV B;  1OXT A;  1PTO F;  1HPC A;  1TS5 A;  4UDU C;  1PTO H;  3DWQ A;  1MSH A;  2K05 A;  5IGE A;  3T56 B;  1CK1 A;  4TQU S;  4IUP A;  4BA2 I;  3L7Z C;  4IFD I;  1CT1 D;  4K5X A;  3U9O A;  2IJ0 A;  5FO8 B;  1WD1 A;  2IX3 A;  4KV6 A;  1VF5 C;  1ENC A;  3I73 A;  2MHV A;  4H0L C;  4KKS A;  2JXM B;  5IGD A;  4TSS A;  3GTO B;  1HHV A;  5CGK A;  4B9X A;  4IZ8 A;  4EQP A;  1SE3 A;  1KTK A;  1SND A;  1RCV D;  3S1M B;  4BWG B;  1FNW A;  2O2L D;  2BCO A;  4FYD A;  2AQ2 B;  4QUF A;  4G57 A;  5T1I A;  1HFN A;  4FXG C;  1HFG A;  3WDN A;  1B9M A;  4J1M A;  4RAU C;  2EYJ A;  1IL8 A;  4DK0 A;  5C0X I;  2OF1 A;  2F0I A;  3HZX A;  1XWE A;  3KF8 A;  1W6K A;  3PUW A;  2KEC A;  2ENB A;  2ZXR A;  1VF7 A;  1CA6 A;  1X3Q A;  1F2Y A;  2D2C C;  3EVQ A;  3NXW A;  4OIK A;  1EY8 A;  1FD7 D;  3VR2 A;  4DAV A;  4X3K A;  4XYO A;  1EZ6 A;  1D5M C;  3M85 A;  5M5X B;  4K8J A;  2CQA A;  3BYY B;  3MWY W;  1BF4 A;  1KDA A;  3MFY A;  2Z4I A;  4WFN 3;  2J7Z A;  2L1B A;  3OMG A;  1NR4 A;  4FF3 A;  2K5D A;  4K6L A;  2E74 C;  3TP6 A;  4C3I B;  3NWT A;  5JOB A;  3KK7 A;  3QWN A;  1DOM A;  1HQR D;  1PFN A;  3NP8 A;  1ONL A;  4KKU A;  2EYL A;  2RBM A;  4KD3 A;  3VA7 A;  2NTS A;  3SK6 A;  2CHB D;  2MP1 A;  3MEH A;  3H09 A;  2R93 B;  4A3F B;  4C3I G;  1I6V C;  3D4D A;  4KI0 A;  2F0M A;  2XRQ D;  1PZI D;  5DAU A;  2E2J B;  1E0B A;  1FGB D;  2WAQ B;  4C1N I;  3VR4 A;  2JA5 B;  3MTS A;  1SYC A;  4XIG S;  2F3W A;  2F0D A;  1SNP A;  3BZD B;  3K5O A;  3C2P A;  4N9P A;  3DEP A;  4DGZ A;  1WTX A;  3AMU A;  1EU3 A;  3A7L A;  2K01 A;  1VMP A;  3JAM L;  1EOT A;  2EDG A;  2L55 A;  4EQN A;  5IGC A;  3OWE B;  1XX8 A;  1RD9 D;  5CV7 A;  1EEI D;  1F9R A;  3QO2 A;  1TWG B;  5IOC A;  2LS0 1;  1DOL A;  4GZY C;  1PRT B;  1EYA A;  2K5W A;  4NKL A;  1B53 A;  4LAA A;  2MGS A;  4ZUI A;  3GTQ B;  1VCI A;  3GQB A;  1S5B D;  2EOT A;  3HOW B;  2M00 A;  2HDM A;  1TU2 B;  3P20 A;  1HQM C;  1S4Z A;  3N52 A;  1KLG D;  5A2Q E;  1ET6 A;  1EYD A;  3SE0 A;  1ROD A;  1NAP A;  2B2V A;  1W6J A;  5JVH 3;  2Q8T A;  3RD4 A;  3EJI A;  1L0Y B;  1A6X A;  1BDO A;  4RA8 A;  3HS0 C;  1B1Z A;  1GJX A;  2BA1 A;  3U9S A;  1SYE A;  2JEA I;  2WB1 B;  2HDL A;  2K33 A;  2EJF C;  2VB2 X;  1K83 B;  3ONA B;  5FO9 B;  2MPM A;  2R6G A;  4IUV A;  5JEA H;  2R3Z A;  4KJN A;  5LL6 S;  1WTW A;  1I4R A;  2NVX B;  2F4I A;  3GTK B;  4EVO A;  3K7A B;  1BBX C;  2NVQ B;  1EIG A;  4F7X A;  4IN3 A;  1HUM A;  2PCF B;  2WAC A;  3PIO 3;  3TBI B;  2WKD A;  3FRP B;  2PMZ B;  1Q8I A;  1KDB A;  2PW7 A;  1Y8N B;  4HMJ A;  3ND9 A;  4IUU A;  4RCN A;  1BOS A;  1GUS A;  5J22 A;  1EIH A;  5CMD A;  2RVL A;  5KEE A;  2SDF A;  3M7N A;  1XXG A;  3GP7 A;  5FKA C;  2K5Q A;  1EL0 A;  4XT3 B;  4M8A A;  1CQV A;  2F0S A;  1G2S A;  3KBG A;  4NMZ A;  3K5L A;  2K03 A;  2EE1 A;  4PNY A;  5M3F B;  3NBH A;  5JEA G;  4ME5 A;  5EKK A;  1ESF A;  3H0G B;  2F0N A;  2EY6 A;  3JAM E;  1BUV T;  1PTO D;  3VR6 A;  4UAI A;  3A7A B;  3CU7 A;  1L0X B;  4KK7 A;  3GD7 A;  2AUJ D;  2EYM A;  3LX0 A;  3SVM A;  2KUM A;  1O7L A;  3OOC A;  3NPP A;  2M2L A;  3HP3 A;  5E4X A;  4IFD H;  1SDF A;  1Y8O B;  4I65 A;  1HA6 A;  2SEB D;  3J80 E;  1X32 A;  3NK9 A;  3NSW A;  1A3T A;  1EY7 A;  3MFG A;  1TWC B;  4NDX A;  5CV6 A;  3SR1 A;  4C56 C;  1RJT A;  2A68 D;  5KGU A;  4X3T A;  5IGF A;  3PUZ A;  3WOE A;  1RKN A;  2XRS D;  2OEO A;  1LV9 A;  5IOD A;  1V8Q A;  5KND A;  1U4M A;  4G7O C;  3OHX C;  2O5I C;  3NHH A;  3AB9 A;  1CHP D;  3T53 B;  2WP8 J;  2A69 D;  3S9W A;  1G8Z D;  3H3V C;  1V1O A;  5CV4 A;  4H44 C;  5EKL A;  1WVL A;  1PMR A;  4KKT A;  2VUM B;  5JVG 3;  2LY7 A;  4IUT A;  3GTP B;  4X3S A;  1YNN D;  3OW7 A;  1EY0 A;  1JOR A;  4RFB A;  1HA5 A;  3J7Y W;  1MD2 D;  1ENA A;  1QOH A;  1U4L A;  5C4J B;  3MXP A;  3D4W A;  3BG3 A;  5BN5 A;  1Y1W B;  1T5X D;  4FXD A;  2B2Y A;  3MXU A;  1LTS D;  2WV6 D;  3OIP A;  5KNB A;  2QF7 A;  3C1E A;  3IKJ A;  1IYU A;  2A6H C;  4XTC S;  3VYU A;  2F0Q A;  5BN3 A;  4IUR A;  4DU9 A;  2L0C A;  1R9T B;  4HR7 B;  5CV5 A;  4RHR A;  1I4G A;  1JB3 A;  1PYW D;  5TSS A;  4M1U B;  5M5W B;  1S5F D;  3DWP A;  2KED A;  3M4Y A;  4CKC A;  2NYZ D;  3OWF A;  1QIL A;  5C0X G;  4G7Z C;  3GV3 A;  4BY1 B;  4K2K A;  5CR3 A;  3WOF A;  1D6E C;  2JE6 I;  1LT6 D;  1EQV A;  2OXP A;  2FHT A;  3I8Z A;  3SXH A;  5CV8 A;  3D31 A;  1STE A;  1CFM A;  4BA1 I;  1BCP B;  1Y69 U;  1ZKO A;  4A3B B;  2A74 C;  4DXF A;  1GUN A;  5DNF A;  3I72 A;  2NBF A;  4YIJ A;  5K5P A;  1E2W A;  1RTN A;  2AWN A;  3G6J B;  2FJ2 A;  1NUC A;  1Q90 A;  5C5M A;  4PMW A;  3RZO B;  4FXK C;  4DNR B;  3A56 A;  1QE6 A;  4NP5 A;  1B50 A;  2OT2 A;  3L3O C;  4HCE A;  3ZYY X;  2PZU A;  3PUY A;  4ZQ3 A;  1ML0 D;  4L6T B;  4MN3 A;  3SHL A;  1ESR A;  1Y1V B;  2N55 A;  1CHQ D;  5I9O A;  5KYI A;  3LWU A;  4ZKB B;  3SEB A;  1TQO A;  3GTJ B;  3E0J A;  4H13 C;  3R2I A;  3MXN A;  4L8J A;  3HG9 A;  1F2M A;  3X3M A;  5CV9 A;  3QB3 A;  5ELC A;  1PZJ D;  4ODG A;  1JWU D;  1QCB D;  1C48 A;  5C44 B;  2MUY A;  4OO1 I;  4J8Q A;  5I9P A;  1GUG A;  5IGG A;  1SXT A;  2A6H D;  1ENF A;  3LWE A;  3PUV A;  3CHB D;  3R2T A;  1F9S A;  5FOB B;  5D65 A;  5KRU A;  2K6A A;  1SJH D;  2B63 B;  1AEX A;  3NQT A;  2RSN A;  1B2T A;  1OXU A;  3V05 A;  1VDZ A;  3PO2 B;  3N6R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...