5HGTA

Crystal structure of staphylococcal nuclease variant delta+phs l25k/i92t at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
b'LHKEPATLIKAIDGDTVKKMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYTYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS L25K/I92T at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5hgtA00
3BDLA 5CV6A 3D6CA 3NHHA 3OMCA 3D4WA 1EY6A 3C1FA 2F0SA 4K5XA 4K8JA 1RKNA 4ID6A 1AEXA 2F0UA 3P75A 4K8IA 2F0GA 4ZUIA 5E1FA 2F0MA 1F2MA 1A2UA 4F8MA 5IOCA 3NXWA 3MEHA 5IGCA 3OWFA 2F0EA 4K2KA 4WRDA 1EY8A 3ERQA 2EYMA 2M00A 3SK6A 5C4ZA 2EXZA 4KHVA 3QOJA 5CC4A 5IGBA 2PW7A 3VA5A 4E6IA 1EY7A 4EQOA 4F7XA 5M9OA 2EY2A 2EY6A 4IUNA 4EVOA 1SNCA 5E3FA 2F3WA 1STHA 2ENBA 4G57A 2F0OA 3H6MA 1KDAA 2F0FA 3TP7A 5C6AA 5CV5A 3SK4A 5KGUA 4K5VA 4QMGA 1A3VA 3LX0A 5CR3A 1KDCA 3HZXA 3NUCA 5CV8A 3MZ5A 3U9OA 2EYPA 2RKSA 4DGZA 5EKLA 1A2TA 4QF4A 3RUZA 4PMBA 1EZ6A 3TP8A 2WACA 1JOKA 2PZWA 3DHQA 4K2LA 3DMUA 5IGDA 2SOBA 5KYIA 1TR5A 1IHZA 2PZTA 5I6YA 4DU9A 4KJNA 1SYBA 2PZUA 5C3WA 4KV6A 4PMCA 3MVVA 2O4XA 3NK9A 5I6WA 4B9XA 4ZUJA 5JOBA 2KQ3A 2PQEA 4KY6A 2EYHA 1TQOA 5CV7A 3SXHA 3PMFA 2F3VA 1KDBA 5CV4A 2F0PA 1EZ8A 3MXPA 2EYJA 5IODA 1EYCA 3QOLA 3MHBA 1EQVA 4NP5A 4N9PA 3R3OA 2EY1A 5I9PA 3D8GA 5J22A 4NKLA 4S3SA 4I65A 1EYDA 1SYDA 2F0HA 4TRDA 3T16A 5C4HA 3OSOA 4N9TA 2LKVA 5J1ZA 1II3A 2OXPA 4LAAA 4WORA 5CGKA 2F0TA 2F0WA 3HEJA 2SNMA 5KEEA 1EY5A 1SNPA 3P1HA 5HURA 2EY5A 3ITPA 4KD4A 5EKKA 1SNOA 4RKLA 4PNYA 4RKBA 5EGTA 1SYGA 1KAAA 2F0IA 5ISRA 4MIUA 5C5MA 4KY7A 1NSNS 3EVQA 5C5LA 2SNSA 1STGA 1EYAA 2HQEA 4KTAA 3D4DA 4DFAA 4J1MA 4R8NA 4ODGA 1SYEA 1SNDA 2F0VA 3SR1A 2OF1A 4EQNA 2F0QA 3NQTA 4HMJA 2F0NA 4K14A 4K6DA 4NDXA 5K5PA 1EY9A 4K5WA 4KD3A 2F0KA 5IGEA 5NUCA 5DAUA 1STBA 4QB4A 2RDFA 3NP8A 3SHLA 1TT2A 3QB3A 5IIFA 1F2ZA 4KY5A 1SNMA 1JOQA 2F0DA 1KABA 1STYA 5HGTA 1JORA 3C1EA 2RBMA 5C3XA 3BDCA 4YIJA 1ENAA 4IALA 5F2DA 3EROA 2F0LA 4EQPA 5J39A 5JAVA 4ME5A 1STAA 4J6HA 1EY0A 3S9WA 2EYOA 4HMIA 5CV9A 3SK8A 2OEOA 4OL7A 1STNA 1U9RA 2KHSA 2F0JA 4B9WA 5KIXA 1A3TA 2PYKA 1F2YA 1EY4A 5I9OA 4IZ8A 3OMGA 1SNQA 3EJIA 3TMEA 4NMZA 5DEHA 5IGFA 4H7BA 5KYLA 2EYFA 4ZQ3A 3E5SA 1NUCA 3SK5A 2EYLA 2PW5A 3TP5A 3T13A 1A3UA 1ENCA 4DF7A 4HTHA 1SYFA 3TP6A 2NUCA 5KRUA 3V2TA 5IGGA 1JOOA 2QDBA 4KJOA 1SYCA
chains in the Genus database with same CATH superfamily
3HOVB 4BY7H 1H95A 3OMCA 1CZWA 2ICEC 2AWOA 2C5CA 5LL6S 3TREA 1WFQA 5FO9B 4ID6A 3FKIH 4ZUIA 4HIOA 1WTQA 4F8MA 4H44C 2F0EA 2VL6A 4WJ4A 2M00A 1NAPA 5IGBA 5G3LD 3K7AH 2NTSA 4G7ZC 2WIIB 3D6WA 1IBLQ 5E3FA 4Y52H 1U5KA 3OYYA 1X3FA 3H91A 3M85A 4OWWB 2UU9Q 3H94A 2B8FA 1SFOB 4NXNQ 1N36Q 1UEBA 1G51A 1XNQQ 2ZXPA 1PVOA 1C7YA 2Z6KC 3GTQB 5C4XB 2F1MA 1PRTF 5JJZA 2C9OA 4OXPA 4DAVA 2QDLA 1LO5D 2KENA 2B2WC 1CSQA 3MVVA 3S2DH 1TY2A 3UDFA 3DM1A 1JB7A 2JP1A 3U50C 4BXXH 1D2BA 3U58A 3MHBA 2ZM6Q 2NVXB 4CJ2C 1VMPA 1Q86C 1CKMA 1H9SB 1H9SA 2AWNA 1B44D 2I07B 3ND8A 1SAPA 2K28A 4HCSA 4A3DB 2WAQG 4A3JG 1CUKA 2KEDA 1K28A 2PO4A 1QZGA 3MWYW 2JA6B 1BF4A 3SR1A 4YCWA 3HKSA 3NQTA 2J4XA 1G2SA 4GN4B 3PIPA 2DJGC 3FPPA 4DV1L 5NUCA 2SEBD 2IPKD 3QG1A 4NW2A 2HCCA 4V190 1STYA 2NBFA 3AB9A 4MTNA 1Z47A 4IFDJ 1A62A 1Y1VB 3I4NB 1I6VC 4FP5D 1YZ6A 3SK8A 4L8JA 5BN5A 2VB2X 1BCPC 2Y0SG 3A5ZB 5I9OA 3T51B 3CCLA 3J81j 1B9MA 4DXFA 1IL8A 2QILA 3RD4A 4GOPA 4GOPB 3EA6A 2XNAC 1R4PB 1NCVA 1KRTA 1Y1WG 4DR7Q 5I2YA 1V8QA 4A3KB 1SLJA 1JJ2A 3GTKB 4LF5L 2N3SA 4K8IA 4A3DG 1F2MA 3STBD 4DUZQ 3ULPA 3I72A 3DWPA 2C35B 1CSPA 4XYQA 2EJGC 1EOVA 3TS2A 2B29A 5M5WB 2R7ZB 1T5EA 2ID0A 3PQIA 2ASBA 3KLRA 4J15A 4YCVA 4HJ5A 5KGUA 1KL9A 3PO3B 1F9QA 4TVAB 1EIFA 3PUZA 1HR0L 4OX9Q 3CCQA 1KLGD 3SEBA 1UE5A 4KHZA 5GROA 1CQFA 1IW7D 1DOLA 4U68A 2ES2A 3K57A 3H3VH 1UWVA 1KDBA 5IWAL 1KNEA 3A74A 4DR5L 4LF6L 2BA1A 4ZCKA 5LHY1 3MXNB 3MXNA 1JWSD 4NKLA 3D4RA 4H13C 2K04A 1SMYC 3DEOA 3HOZH 4X66L 2BOSA 2CQOA 5GADC 3S1RB 2WKDA 3KUPA 1X6OA 3TS0A 3KK7A 1X54A 4NDXA 3H3VC 2E75C 3HOXH 3MC0B 1HPCA 5GAEC 4IJHA 2PI2A 4LF4Q 3PUYA 5M3MB 1OTCA 1VQ6A 1VQ9A 4PMWA 1Y8NB 3MA2B 4A4IA 3EROA 4R4QA 4PZ6A 4DV5Q 3CF5A 1YNNC 3K7UC 4FO2A 1PH4A 4AYBE 2KCMA 2OQKA 2F0JA 1TY0A 1A3TA 1I6HB 4N8FA 4KN4C 1EY4A 4IZ8A 1QZHA 1S5FD 3CCJA 1BBWA 4A3MB 4R9WA 1SYFA 1E2WA 1TWFH 5A35A 3GTJB 4JV5Q 2EQSA 5M5YB 2NVYB 4KKSA 5TSSA 3ERSX 1EQRA 4OO1H 2OWOA 2F3IA 4K8JA 2A8VA 4EX5A 1HFNA 4GLVB 4C3JH 2NVQH 3J80E 2FJ2A 3K80C 3RN5A 4A3GG 3RLFA 5IP7H 4CDDC 4C3IH 5M9OA 2EOTA 4GKKQ 1GO3E 2H1EA 2ENBA 2A5HA 3J81L 1E2ZA 3H6MA 3I3CA 1CI3M 3GTMH 2NZHA 1LTSD 1E1TA 5ELFA 4FF2A 4QF4A 2IX0A 4QY7A 1QVGA 1LM0A 1YITA 4APVA 3HOUG 3RR5A 1U4RA 4DU9A 2NN6H 1I50B 4LUOA 1DD2A 3FVQA 5K36G 1MKHA 3NK9A 3L2PA 2NB0A 5CV7A 3PMFA 2J0TD 1SEBD 3LNNA 4LF7L 1CQVA 4YWMA 2UUCL 4ZRZA 5IODA 2WV6D 3I4MH 5LMUQ 5I9PA 1TWCB 3NELA 1JE4A 4N9TA 4JK1C 4A3BB 1ONLA 3S2HB 1RTNA 4X3SA 3U9SA 4MIUA 1WCMB 3HG9A 1EYAA 1UUPA 4TKOB 3F8TA 2XWJB 3PF4A 1B3AA 1SYEA 5T1GA 5FO7B 2F0NA 2K75A 3ULLA 1LTTD 3TN2A 2LS01 4B3TQ 4QJFA 3NP8A 2ZTEA 2MGSA 2WKCA 3M4PA 4JI6Q 1HH2P 5FO8B 2Q8RE 4BBRB 1M90C 1TWGB 4KMUC 2HHHL 2O2LD 1I4QA 2WB1G 2Q2TA 3IAYA 5C3EH 1GUNA 1B50A 3K0YA 3KBGA 3S14H 3HFZB 3EJIA 3TMEA 1H9MA 5FK9C 2XIWA 2EYFA 3EFXD 3L0OA 2F4VQ 2I5LX 5KRUA 1AN8A 3C2PA 2XRSD 4LWCA 2VXWA 5LL6X 2KECA 2I5HA 1E24A 4DK3C 3T1HL 3M7NA 4JI7L 1OXSC 1Q82C 3O13A 1ASZA 3CW2C 5C0XH 3KDFA 3KDFB 1MHWC 4EQOA 1EY7A 2FMMA 1EIHA 1PRTC 4JYAL 4R4CA 3HOXG 1AZQA 5EBCA 1PFSA 4HIDA 3CC4A 5CR3A 3U9OA 3K8AA 2EXDA 1I4GA 2RQXA 3MAQA 2A6HC 5GAGC 4X64L 3S1QH 3GTOH 5IGDA 2R92B 2JEBI 2K6AA 1C9OA 2F4IA 1LTGD 1Q3LA 1UAPA 2MJ8A 2O4XA 2AUJD 1RIPA 4MNOA 1O78A 2Q8TA 4JI3Q 2F0PA 4HJ8A 4A75A 1GKHA 1EL0A 2ZJPA 4S3SA 2F0HA 1PH1A 1W6JA 4GNXC 2F0WA 4OO1G 1XJVA 4PV1C 1SNPA 3D0FA 1SE8A 4JI1Q 4OWXB 3ICEA 4RKLA 4C3JG 4B3SL 4IUQA 1HZ9A 1YNJC 1I4HA 2LY7A 5JPNC 2E8GA 4LFBL 1STGA 3QWNA 5IP7G 4C3IG 4ODGA 5DNFA 1Q90A 4DR1Q 1WTWA 4DV4L 4XQQA 4EQNA 2NYZD 1VQ8A 2I5MX 4KD3A 2F0KA 5IGEA 2HQLA 2TSSA 4L5TA 1T5XD 2B2TA 1EWHA 5IYDH 4DR2L 1JORA 2RBMA 1QWYA 4DR4Q 2F0LA 2YU9H 1R9TH 4J6HA 3R2TA 4EQ5A 5CV9A 5DM63 4YY3L 4LFCL 4C56C 1C48A 2JA7B 4A93B 4Y7NB 1PMRA 3EIVA 3K6OA 3OTOL 2B63H 2VQFL 2K03A 1TS5A 1O7LA 5M5XB 2JN4A 4ZQ3A 4YWLA 1Q1BA 1W3SA 4OWTB 3PF5A 1HR0W 2J7ZA 3PO2B 4OEMB 3D6CA 2JE6I 4IFDH 1EY6A 3TSSA 2B2YA 2ZXOA 5C44B 4K5XA 1RKNA 4DK1A 4A3FB 2E76C 4K2KA 4BWGB 3DWAA 3CXCA 3RZOH 3S1MH 3HKZE 1PXUA 4JW0A 1J5EL 1AW7A 3PIP3 5COYA 2F0FA 4K5VA 4UDUC 1X3GA 1KDCA 4KN7C 5LMNL 4K6LA 4QIWB 2FXQA 4UP9A 2RA4A 3HOWB 2EJFC 3CCRA 1S5ED 1TR5A 4LW1A 2XSCA 1FL0A 5C3EG 3PSIA 4JI5L 5I6WA 1LABA 4A3IH 1E22A 2K50A 5IT9L 2R93B 2B2UA 4C2MB 1PA6A 3CU7A 1N8RC 1S4ZA 4NP5A 3GV3A 2QA4A 3HOVH 4MTKA 2DN8A 3HEJA 4C3HH 1YBYA 4BBSG 5C0XG 2DNCA 1I94Q 4CDCC 3D4DA 2PMZE 3CCMA 4HEDA 1XMQL 1CA5A 3M7GA 4YHHQ 1QVCA 1SXTA 2KJXA 4ME3A 1N36L 5K5PA 2KOLA 3PIO3 4B08A 3SVMA 4A3LG 4P75A 1LACA 4RHSA 2IWHA 3I4LA 3N52A 1W6KA 1YJ9A 2JQOA 4DR6Q 1HUMA 2NWGA 1JR0D 2BA0A 1GJXA 1TWHB 1STEA 2EYOA 5C4XH 3OWEB 1IL2A 3GQBA 3M4QA 2NZ1D 3R8BA 1VQLA 3T1YL 1BCPD 2N88A 2E5LL 2UXBQ 4QCLA 3KYHC 1PTOF 3CPFA 3SK5A 4FF3A 1VQEA 3I91A 1Z6HA 3HOYG 4JI4L 3TP6A 2UXDL 3RLOA 4GKJQ 1DYQA 1SBBB 2CKZB 1HNXL 5I2XA 1AE2A 4HSVA 1EFWA 1EYGA 3VR2A 1HTLD 4IOAA 1B2TA 4GN5A 4ZLTF 2JA6H 1Y14B 3SK6A 1OXVA 5CC4A 2EYMA 3KJPA 3H15A 1KIXA 3J7YW 2TMPA 4DNRB 4XT3B 2FINB 3WWVA 1DJRD 2OT2A 4AH6A 3NPPA 2F3WA 5J3BA 2BE5C 5BR8L 1NJIC 2XN9C 1SROA 3J81c 5IYDG 2R7FA 3LX0A 1LTID 4DV3L 2HIXA 2LSSA 4GS3A 1UNSA 5EKIA 1Y1VH 2K7VA 3ONAB 1J9OA 2QGQA 3I4NH 3TRZA 1PFBA 1TVXA 3BYTB 4AYBG 3FMCA 1HNWL 2WAQB 3PCOB 2VUMG 4A3JB 1CHPD 5C3WA 2B63G 1K8MA 4OHJA 2VQEL 3SDZA 4CBVA 4B9XA 1UE7A 4UP8A 1N34Q 3KLSA 1TQOA 4BY1H 1J6QA 4DV0L 1N32Q 1ICFB 3TZUA 3CMEA 1HUNA 1XNRQ 5ELDA 4CKCA 4FDBA 2R3ZA 3LGJA 4A3KH 4IFDG 1SMYD 4FXGC 3AFQA 1EY5A 3VYTA 1SR3A 1TIID 2XGTA 1NBWA 1HTPA 3M4OH 1NSNS 4X62L 2Y0SB 2OCEA 1QUQB 1LUZA 1QUQA 2OF1A 3DEPA 3F2BA 2R7ZH 4K6DA 2RCNA 1EWCA 3KLWA 3BYYB 4GOPC 2IY5B 1SE2A 1Y1WB 4HR7B 3PO3H 1K9MC 1JOQA 4B3ML 3NBHA 4JI8Q 1PLFA 5J39A 4XIGS 1EU4A 1TKWB 1YNND 4F88A 3S9WA 1IYUA 2M2LA 3C46A 5IYBH 1TXYA 1UEAB 3FP9A 1OO9B 1LT4D 1BVSA 4A3IG 5IP9H 3G6JB 3DWQA 1RL2A 2MQHA 3MTSA 5AJ3Q 4RCNA 4J1MA 4KK7A 1GUSA 3NHHA 4C3HG 1CKOA 2EPBA 3RNUA 3NTKA 3S1RH 3PUXA 2LXJA 5D65A 3A54A 5E1FA 3NBIA 3A8JE 3BDOA 1T9HA 3QOJA 4XQJA 2EY6A 4RHRA 4FNFA 1SNCA 4ZKBB 3J7AF 3HS0C 1BBUA 2Z4IA 3VA7A 5C6AA 4JI2L 1RD9D 1QNUA 2I0QA 1TS3A 3R2IA 2RKSA 4XDXA 5EKLA 3CD6A 5KNBA 1VQMA 2LXKA 2Z6KA 2Z0SA 2PZWA 3FKIB 2XRQD 5IYCH 2B2WA 1I6HH 4ZAIA 4DPGA 2PQEA 2L4NA 2MO0A 4A3MH 2CW0C 1H9KA 3PIOA 2D62A 3GTJH 4LNQA 2H5XA 2QCPX 4I65A 2HDMA 5C4HA 4TRDA 3CQZH 1IBKL 4LF8L 2KBNA 1MGSA 5J1ZA 2JA5H 2K5HA 1VQFA 5HURA 1YIJA 1GUOA 1GUGA 4PNYA 2L1BA 2NZOA 3S24A 1D1IA 1RF2D 1G91A 1QCBD 4B3RL 3F2CA 4X65L 2RDHA 1B70B 4KLKA 2R7DA 1P8LA 1YHQA 4QB4A 1O7ZA 5CORA 1TU2B 2X69A 5A2QL 5FJ8H 2YYZA 4LMQD 4BY7G 2IX1A 4A76A 3C1EA 1ZKOA 3DUZA 1ZEQX 3AU7A 4EQPA 3PV0A 5ELNA 4HMIA 3FKIG 4G7HC 1I50H 3NTHA 4KI0A 1BCPB 3QIAA 2KCCA 2K5QA 3T4AC 3LWEA 1AZPA 4A3GB 2EDGA 2YTVA 4BY1G 5DEHA 4H0LC 3TP5A 3U4ZA 1WD1A 1N33L 2N78A 5ELEA 1YNXA 1L1OB 1L1OA 1TWCH 2VZAA 1ET6A 4KKTA 1B8AA 2XWBB 5LMNW 4LF9L 4A3BH 2GVBA 1O7YA 4IUVA 4DV1Q 3S2HH 2F0SA 3HRZC 2EZVA 3BZCA 3P75A 3HOUB 1Q8KA 2WFWA 1UE1A 1WCMH 3MEHA 4XTCS 2IX3A 1EY8A 3GP7A 5CBAE 2ZT9C 3VA5A 1PRTD 1VQOA 4BXXG 3P7JA 2WINB 4G57A 1KDAA 5CV5A 5CV8A 3BU2A 1A2TA 2A6HD 4GN3B 2A68C 3H09A 3H0GH 3TP8A 3P20A 4IUUA 4LUZA 3J7A5 1TWGH 2CHBD 4KJNA 1LLRD 3CAMA 1DXMA 1JB3A 4LF5Q 4PMCA 5FLXE 1PYBA 5IP9G 5AFWA 1CM9A 1WTHA 3Q0AA 3J80c 3J80i 2MP1A 2FHTA 5IT9c 1WTOA 2L55A 2G9DA 2JSOA 2AUKA 1PTOH 4I7AA 5GQOA 1K8OA 1V1QA 1CKNB 1CKNA 1S5BD 4TQUS 2DY8A 1SRUA 1D5ZC 2RHQB 1HA5A 2K33A 5ISRA 1YNJD 1GUTA 1HR0Q 4NXML 2SNSA 2WB1B 3HKZG 5C4JH 1SNDA 1UE6A 2DNEA 4DK0A 2F0QA 1EIYB 1HQMC 2ICIA 4C1NK 3NENA 1GHKA 1I3QH 2A69D 3BZDB 1JMCA 2F0DA 1PTOC 5IWAQ 1FD7D 4JI0Q 4LF6Q 4RGNA 4Q5VA 1TWAB 1C4QA 3D31A 2R92H 1PHJA 5D14A 1EOTA 4UPAA 4KHPQ 4B9WA 4X66Q 4DV7L 4K0KQ 1IYJB 2FFKB 1B4OA 4CDEC 1D1KA 1OXTA 5KYLA 3S1NB 3NTIA 3HOXB 2DJFC 1Y8OB 3G4SA 4AQYL 4KJOA 1YJNA 2JA5G 2OTLA 3PUWA 2RSOA 1NMFA 5D3IB 5M3FH 4RG1A 3E3XA 4DV6L 3J7AV 3N6RA 3BG3A 5E4WC 3VR5A 2F0MA 1E7ZA 4N8X1 1GHJA 3OIPA 3K0XA 3D3RA 3W1GA 2UUBL 3TEHB 2OTJA 4DR4L 1HNZL 3TP7A 3GTGB 3K59A 5FJ8G 4A3EH 4CJ1B 1BR9A 3HOZG 1F9PA 1FJGQ 1SDFA 2WACA 2SOBA 3NSWA 2EE1A 2PZTA 1BDOA 4C3JB 1QVFA 3KF6A 3KF6B 2NVQB 1L0YB 2JA7H 1VQDA 2Z4HA 3VR3A 4C3IB 3FPUB 5C0XI 2MPMA 4XXEA 1ML0D 4G4KA 4O2DA 4XQNA 4DV2L 4KKUA 2EJMA 3QR8A 3GTMB 1G291 2EY1A 5ELOA 5J22A 3UDIA 1LV9A 3AMUA 3OSOA 1X3EA 3UE1A 4WORA 1C8CA 2SNMA 3CCUA 3AFPA 4ILWA 4DAMA 1W2BA 1S40A 1PFMA 3T53B 1SSOA 5KNDA 4KY7A 1ESFA 3S16H 4JOIA 1K3RA 1H9RA 1NY4A 1HA6A 1KAWA 4IQZA 2IJ0A 4A3CH 4PZ7A 3Q24A 2RHSB 4FYDA 2AQ1B 4HCEA 3GTPB 4L6TB 4CKEA 3PUVA 1G6PA 1D5MC 4OONA 4BA1I 1A6XA 2JA9A 3IRBA 4LF7Q 2UUCQ 1VQHA 1PH5A 4DUYL 3H0GG 3HOWH 4WFN3 1QE6A 5JAVA 1SE4A 2M9VA 4RGMA 3I90A 1QILA 1IBML 3OW7A 2X6LA 1MSHA 3I56A 5KIXA 1SJED 1KNAA 2KEEA 1WTVA 2UUAL 1XMOL 4F87A 4LFAL 2K01A 3T56B 4RA8A 1MJCA 2R93H 4C2MH 1PZID 2NUCA 5FKAC 1SYCA 1PZJD 2A69C 4JPBW 4Z9CB 3C1FA 2E2JH 4L5RC 5E7NA 1P16A 1V1OA 2NN6G 4DR3L 2V1CC 3I55A 5ELCA 5C3EB 4HIKA 1B1ZA 4KHVA 1LTLA 2BE5D 2B2UC 1BNZA 2CWPA 1WJJA 3I4MG 2GA4B 4RGTA 2ZJQA 1FNVA 3TDQA 2HUGA 1EUJA 2F52A 3A8KE 2ZTDA 1H9JA 1BXTA 3L3OC 4IN3A 2AQ3B 5KNCA 1TWHH 5G3LF 3CPWA 1OXXK 4CDFC 3A8IE 4HAEA 1SJHD 5E4XA 5EJWA 5I6YA 2JA8H 4BBSB 3RZDB 1GOZA 1HXYD 4KV6A 3T1HQ 4JI7Q 3V05A 2L15A 4ZUJA 4DAYA 4DAYB 4KY6A 2UXCL 3A7LA 3IFTA 3URYA 2EYJA 2PI2E 1EWIA 2CH4A 1NR4A 4GNXB 4GNXA 4JYAQ 4LAAA 4RH6A 5M3FG 3J7ZC 1A0IA 1HCZA 4CJ0B 1KHIA 2AQ2B 2HQEA 3C3LA 2IW3A 3MEFA 4R8NA 1U4PA 2DY7A 2SDFA 1WOCA 3J80L 5FLXL 3IKJA 1XYIA 3ND9A 1RCVD 4ULLA 5FOBB 3OW2A 3QJYA 3HOYB 5D3DA 2E2HB 4A3EG 2RDFA 3QB3A 2N8NA 4LK1C 4GLXA 1QJOA 3GTLB 2K5WA 3K58A 3GO5A 4OL7A 2A19A 5CBEE 2JEAI 1VQBA 1IBLL 1DONA 2Z9HA 4X6AH 2A74C 2VNUD 5IGFA 5DM73 2UU9L 4FF1A 1M8AA 4NXNL 1L2FA 4LFBQ 1A3UA 1VQ5A 1Q46A 2B8GA 2O5JC 3K81C 1XNQL 3V2TA 1TS2A 4DV4Q 1FR3A 1NR2A 1JOKA 1PH6A 1SFOH 3OIQA 2ZTCA 2E2IB 1V43A 2F0UA 4DR2Q 3GTQH 2BCOA 4AYBB 2NTTA 2VUMB 1K83B 2B63B 3NEMA 1JE5A 4A3CG 4X3TA 2ZM6L 1DZ1A 1EU3A 4LFCQ 2YTYA 3L9AX 1DM0B 2CCZA 2VY3A 3OTOQ 3W5OA 2F0OA 4CGYB 2NVXH 1YJWA 3SK4A 1Y1WH 4P2CB 4UP7A 2G5DA 2QW7A 1QB5D 1ZXTA 2HD3A 2XTIA 2YV5A 3MXGA 4A3DH 4DK6C 1I4PA 1EQTA 3AEVA 3NE5B 2L5TA 3S1MB 1KQSA 3S15B 1FNUA 2KQ3A 2D9UA 1PV4A 1L0XB 1VQJA 3JAME 2Q2UA 1EEID 2IHEA 2CW0D 2F3VA 4P74A 5CV4A 4RGOS 1EYCA 3JAMi 2HT1A 3ZJYC 1J5EQ 1WYDA 5CGKA 2LKVA 2MHVA 1X56A 2BH8A 1ZYRC 1I4RA 3CC2A 2A73B 4LJZC 1JWMD 2VW9A 3MFGA 1J8IA 1MD2D 1CHQD 5LMNQ 1AP0A 3DXJC 2LFNA 3G7LA 1XX8A 1VQCA 2F0VA 3J81E 4A3IB 1ILPA 1A63A 4HIMA 4DR7L 3U4VA 1WVLA 2AHOB 4JI5Q 4J8QA 1U4MA 1PYSB 2B2VA 1SNMA 1FNWA 4P73A 4C3HB 5C3XA 4YIJA 1ENAA 3AYHB 5F2DA 4DUZL 1KXLA 2XVSA 3GTKH 1STAA 3E0JA 2L0CA 2JA8G 4RAUC 5JVH3 5I4DA 2PYKA 3TZDA 3E0EA 4HJ7A 1VDZA 2X6GA 3TBIB 5M5WH 2EYLA 1ILQA 1ENCA 1JJGA 5L37A 1PYWD 1XMQQ 4OX9L 5IGGA 1JOOA 2K32A 1QOHA 2D2CC 2BH2A 2GVAA 1VF5C 3NBHB 4XT1B 1B53A 4O1NA 4FXDA 2PNRC 1D7QA 1GM5A 1KRSA 3FHWA 2NVTB 3SGIA 4IOCA 1LT3D 1V9PA 1FGUA 2MFIA 4E6IA 2YTXA 3RLNA 3M3YB 3T1YQ 4P71A 2E5LQ 5JEAJ 2D0PA 1XXGA 3UDGA 1PFNA 1JICA 3NUCA 3HOVG 3EBEA 3S17B 2A6EC 4JI4Q 1PDQA 2A68D 3A56A 4POFA 2UXDQ 1LTRD 2HCIA 3OOCA 1HQRD 3CCEA 3DM3A 1XPUA 2KVMA 4UY8C 3G6EA 3I4OA 1GD7A 3I8ZA 1HNXQ 3CCVA 4A3GH 1I4XA 4OIKA 4LF4L 2IL8A 3NQIA 3BVZA 1B3QA 1EQVA 1FYCA 4DV5L 4NPSA 3D8GA 5M3MH 3VYUA 2CH4W 1MBYA 4BY7B 5BR8Q 3A5UA 1LT6D 3A0JA 4HN7A 3UE0A 4YCUA 3P1HA 3Q22A 2QKIC 4C1NI 4DV3Q 5CMDA 3HOUH 5C4XG 3BJUA 5EGTA 1QNKA 2RF4A 2PNHA 1MI2A 4DFAA 3A7AB 5K36H 1HNWQ 4JV5L 4BY1B 3K7AB 4R4IA 2VQEQ 1EY9A 1E0BA 1SE3A 1VF7A 2JK8A 4JVZA 5HGQA 4O0AA 4IJLA 1L1OC 2Q2HA 1QG7A 1F2ZA 4DV0Q 1PTOD 1KABA 2NVYH 5M5YH 1X3PA 2GN5A 1RODA 2ZXRA 4GLAC 4QUCA 2N49A 3R93A 3Q23A 3AQQA 3HGBA 1STNA 3M4OB 4X3KA 1AH9A 5DLQE 4GKKL 4IO9A 2JA6G 4LUVA 2Q2IA 3Q8DA 3S2DB 1HZCA 5EPJA 1U0LA 1N9WA 3E5SA 4X62Q 1MSGA 1IXRA 1X9NA 3F1ZA 1VQNA 1F9SA 3M4YA 5EAYA 3H3VI 1EIGA 3VR4A 4L63B 4QIWE 2KHJA 3D4WA 2RCFA 3WOFA 1Y1VG 3I4NG 1HHVA 1D8LA 5JPMC 1WTPA 4B3MQ 1RJTA 2LMCB 4UHVA 2KCTA 2MO1A 4MHEA 2EXZA 2WP8J 5LMUL 1K8GA 1MIUA 4EVOA 4JI0L 1DOKA 3TQYA 4JCVE 4GZYC 3RMHA 4DA2A 4A3KG 2EYPA 1EQQA 2RSNA 4KHPL 3E9HA 3CRLC 2CWAA 1Y69U 4DAPA 1M4VA 4QQBX 4K0KL 1TWAH 2FMCA 4POGA 4V0BA 3IFDA 1E1OA 2JJQA 4JBMA 1RHPA 4OGQC 1BBXC 3HKZB 4B3TL 5JOBA 2R7ZG 1KD1C 4RMFA 3L7ZC 5JVG3 3S1NH 4DNTB 1EZ8A 3QOLA 3CRKC 3Q6SA 4JI6L 3PO3G 1K0SA 1IYVA 2QF7A 2IT1A 4X3UA 1IKLA 1EFID 2HIVA 4DN4M 3K5OA 4JI2Q 2EY5A 5JJIA 1SNOA 3M9BA 4BBRH 1YHAA 4M1UB 5IYBG 3FEWX 4HSPA 4OO1I 4OELB 2BDOA 2F4VL 3VR6A 4CKBA 4O42A 3VYRA 5FLXc 3JAML 1FGBD 4K5WA 2ZJRA 1FJGL 3GTGH 5DAUA 1STBA 2KUMA 1TT2A 1XWEA 1S72A 3CQZB 3VDYA 2JXMB 2K52A 2JA5B 2BDNA 4ZK9B 1O7IA 2DUDA 3BDCA 1LYLA 4IALA 3KFUA 1IBKQ 3A55A 4LF8Q 1JC7A 1AFPA 2RDGA 3GV6A 1PZKD 1F2YA 2JYOA 3OMGA 2N55A 5IT9E 2NN6I 2PMZB 4NMZA 2QEXA 3CCSA 4UAIA 2CVRA 2Z8LA 4B3RQ 5M3MG 1XPOA 4X65Q 1VQ4A 3BDLA 2E2DC 4HJ9A 4DR5Q 4BA2I 2G9HD 3NWSA 5ELBA 1NE3A 3HOZB 4JBJA 3ER0A 2V4DA 1YI2A 2F0GA 3CC7A 2WAQE 5IYCG 4NB3A 3STBC 3W3AA 4JI3L 3GD7A 2PW7A 5CYUA 4IUNA 2F03A 4A3MG 3GTPH 1STHA 1ET9A 4MN3A 1L0WA 4JI1L 4ALPA 3I73A 1LTAD 1XTDA 1S3OA 3MZ5A 4IPHA 4DGZA 3RUZA 4PMBA 1N33Q 1EZ6A 3DHQA 4K2LA 2L11A 3DMUA 4LF9Q 2K14A 1Q8IA 2B39A 3B6YA 4DR1L 1SYBA 2PZUA 4JOIC 1CT1D 2Y0SE 3BZKA 3K5MA 1IW7C 2EYHA 1HZBA 1DOMA 4JBKA 1E3PA 4FF4A 5GAHC 1TWFB 4N9PA 3R3OA 1VQ7A 1EYDA 1SYDA 1X3QA 1X55A 3E6ZX 4BS9A 1NTGA 2F0TA 3H0GB 5KEEA 5H1SE 2K5VA 4PG3A 1YEZA 4RKBA 3W2DA 5C5MA 3WOEA 3CMAA 3KBXA 5C5LA 4A93H 1X32A 4Y7NH 4KTAA 1K73C 1HRJA 1HFGA 3FDTA 3ULJA 1DGSA 3DLLA 5M5XH 2Z6BA 4PZ8A 1FVIA 1JWUD 1JCKB 1LT5D 1Y8PB 3PGZA 3RN2A 1ICWA 1RTOA 2K5NA 1PTOB 5EQ0A 2ALYB 1PH2A 2B2TC 1JQYD 4A3BG 3PO2H 2K4KA 4U673 1M1KC 2E74C 5C44H 1JJCB 1IZ6A 1EEFD 4BBSH 1F9RA 2HDLA 4A3FH 3RZDH 1WCMG 2Q8IB 5C4JB 3I2ZA 3MXUA 1SNQA 1D6EC 1LTBD 4DNIA 4HJAA 1WTXA 4NXMQ 5FLMH 2KCNA 4XYOA 3T13A 1SMXA 1A8VA 4A3LH 1PH9A 1HZAA 4JG2A 1VS0A 1I3QB 2AKWB 3I4MB 5EPKA 2KHIA 5CV6A 3ZYYX 3KF8A 3KF8B 1BCPF 4R1JA 1NNXA 5EBDA 3W1BA 3MFYA 2K1BA 2B2YC 4BBRG 1WTRA 1PH7A 2IHFA 4MZ9A 1A2UA 5IGCA 4IURA 3OWFA 1Z7TA 5EPLA 1Q7YC 5T1IA 4F7XA 1WI5A 2CQAA 3SE0A 4DV7Q 1F77A 1YHBA 3G71A 3HOYH 5IY0A 1WD0A 2E2HH 2K5DA 4TSSA 1CFMA 4IUPA 1V1PA 1V1PB 3F2DA 3GTLH 5M3FB 1HJPA 1MJEA 4AQYQ 1I94L 1BOSA 4M8AA 1Q81C 4Q0FA 1PH3A 1B9NA 1G8ZD 1CK1A 4IPDA 4YHHL 1BUVT 4IPGA 1Q12A 1VMCA 4DV6Q 3X3MA 2PPBC 3S14B 3NWTA 1PRTB 3CHBD 2HHHQ 1GUWA 4DR6L 5JEAH 1G6ZA 1F2LA 2Z1CA 2UUBQ 3V96A 4A3EB 4L5QA 1E2VA 1ZYRD 3VYSA 1HNZQ 3CKIB 1S5DD 1I5FA 2E2IH 3EN2A 3ITPA 1IKMA 2R61A 2EIFA 2R92G 4FVMA 4AIMA 2UXBL 4IFDI 2VUMH 1U4LA 3BVGA 2PCFB 1K83H 3EVQA 3CP0A 4P72A 4WJ3M 1CTMA 1DCZA 4GKJL 2VB3X 4EGVA 1OXUA 1XPRA 4ABNA 1KC8C 2L12A 4RCOA 2AMCB 4R4OA 4ZYSA 1CZGA 3SHLA 4I7ZC 3WDNA 5HGTA 4DV2Q 1Q1EA 2K05A 2R6GA 2I46A 3S1QB 3GTOB 2OEOA 3EQLC 3S16B 4JBWA 3K5LA 3BS1A 4X64Q 1K3BC 3S15H 2B3GA 4H7BA 1NUCA 2PW5A 1S5CD 4DF7A 4RFBA 2ATWA 1TS4A 3SXHA 2O5IC 1KLUD 3F2UA 1JT8A 1AEXA 3OPOA 4DUYQ 1N34L 5IOCA 5IE8A 4A3JH 2JA7G 4A93G 3NXWA 4QGUA 4WRDA 1N32L 3ERQA 5C4ZA 1XNRL 1IBMQ 4B3SQ 1XTCD 2EY2A 3I70A 4R4TA 2RVLA 4WJWA 5A2QE 2UUAQ 1XMOQ 4DXGA 2A1AA 4LFAQ 3KOJA 4QMGA 1A3VA 4RWSC 3HZXA 3PO2G 2A6ED 3JC66 5JJKA 2CFMA 5JJLA 5C44G 2E2JB 2YU9B 1R9TB 1VCIA 1R4QB 5KYIA 4A3FG 1IHZA 1SN8A 1VQIA 3UI2A 4ZKCB 4QL5A 3BVMA 1RDPD 2WB1E 1BQQT 2DGYA 2D0OA 5FLMG 4DR3Q 4FXKC 4IUTA 4YY3Q 4G7OC 3G48A 2EVBA 3GDEA 3MXPA 5HY6A 5BN3A 2VQFQ 2VS1A 4JI8L 1A15A 1ESRA 2B2VC 4L5SA 3T16A 3LWUA 1II3A 2L9HA 2OXPA 3I7FA 3HOWG 4CHTB 3E9IA 2OQ0A 2H4OA 4KD4A 4QUFA 1O80A 4PQXA 5EKKA 4R8IA 2NVTH 1C0AA 1SYGA 1BO0A 1KAAA 2F0IA 3HP3A 2JA8B 3KLSX 1GXDC 2P5ZX 3K5NA 1CA6A 1PH8A 3RZOB 1ENFA 1NMGA 1AE3A 3M3YH 5AJ3L 1K0RA 3QO2A 2PQAA 2PQAB 4HMJA 2R93G 4K14A 1BKBA 3FRPB 2QEJC 1YVCA 3JAMc 1KTKA 3IL8A 2UXCQ 5IIFA 4KY5A 3OHXC 1B7YB 3S17H 2MUYA 4DKAC 3KJOA 4ME5A 1EY0A 4H02A 1X65A 1Z9FA 1VQGA 1VQAA 4JC0A 1U9RA 4IPCA 2KHSA 2D5DA 1D5XC 2MNAA 5BN4A 3UDXA 1GVPA 5C0XJ 4OIJA 1VQKA 1K8AC 3X3NA 1ASYA 5JEAG 1G2TA 1VQPA 4HTHA 3J81i 4YWKA 2KA7A 2QDBA
chains in the Genus database with same CATH topology
3HOVB 3OMCA 1CZWA 2ICEC 2AWOA 2C5CA 5LL6S 5FO9B 4ID6A 4ZUIA 1WTQA 4F8MA 4H44C 2F0EA 2M00A 1NAPA 5IGBA 5G3LD 2NTSA 4G7ZC 2WIIB 3D6WA 5E3FA 3H91A 3M85A 3H94A 2B8FA 1SFOB 2ZXPA 3GTQB 5C4XB 2F1MA 1PRTF 5JJZA 2C9OA 4DAVA 1LO5D 2B2WC 3MVVA 1TY2A 3DM1A 2JP1A 1D2BA 3MHBA 2NVXB 4CJ2C 1VMPA 2I07B 1H9SB 1H9SA 2AWNA 1B44D 3ND8A 1SAPA 2K28A 4HCSA 4A3DB 2PO4A 2KEDA 3MWYW 2JA6B 1BF4A 3SR1A 3NQTA 2J4XA 1G2SA 3FPPA 5NUCA 2SEBD 2IPKD 4NW2A 3QG1A 2HCCA 4V190 1STYA 2NBFA 3AB9A 1Z47A 4IFDJ 1Y1VB 3I4NB 1I6VC 4FP5D 3SK8A 4L8JA 5BN5A 2VB2X 1BCPC 5I9OA 3T51B 1B9MA 4DXFA 1IL8A 2QILA 3RD4A 3EA6A 2XNAC 1R4PB 1NCVA 5I2YA 1V8QA 4A3KB 3GTKB 4K8IA 1F2MA 3I72A 3DWPA 4XYQA 2EJGC 5M5WB 2R7ZB 1T5EA 2ID0A 3KLRA 5KGUA 3PO3B 1F9QA 3PUZA 1KLGD 3SEBA 4KHZA 1CQFA 1IW7D 1DOLA 4U68A 3K57A 1KDBA 1KNEA 2BA1A 5LHY1 3MXNA 1JWSD 4NKLA 3D4RA 4H13C 2K04A 1SMYC 3DEOA 2BOSA 3S1RB 2WKDA 3KUPA 3KK7A 4NDXA 3H3VC 2E75C 3MC0B 1HPCA 3PUYA 5M3MB 4PMWA 1Y8NB 3MA2B 3EROA 1YNNC 4FO2A 2F0JA 1TY0A 1A3TA 1I6HB 4KN4C 1EY4A 4IZ8A 1S5FD 4A3MB 4R9WA 1SYFA 1E2WA 5A35A 3GTJB 5M5YB 2NVYB 4KKSA 5TSSA 4OO1H 4K8JA 1HFNA 3J80E 2FJ2A 3RLFA 5M9OA 2EOTA 2H1EA 2ENBA 2A5HA 3J81L 1E2ZA 3H6MA 3I3CA 1CI3M 1LTSD 5ELFA 4FF2A 4QF4A 2IX0A 1U4RA 4DU9A 2NN6H 1I50B 1DD2A 3FVQA 5K36G 3NK9A 2NB0A 5CV7A 3PMFA 2J0TD 1SEBD 3LNNA 1CQVA 4ZRZA 5IODA 2WV6D 5I9PA 1TWCB 1JE4A 4N9TA 4JK1C 4A3BB 1ONLA 3S2HB 1RTNA 4X3SA 3U9SA 4MIUA 1WCMB 3HG9A 1EYAA 1UUPA 4TKOB 2XWJB 1B3AA 1SYEA 5T1GA 5FO7B 2F0NA 1LTTD 3TN2A 2LS01 3NP8A 2MGSA 2WKCA 5FO8B 2Q8RE 4BBRB 1TWGB 4KMUC 2O2LD 1I4QA 3IAYA 1B50A 1GUNA 3K0YA 3KBGA 3EJIA 3TMEA 1H9MA 5FK9C 2XIWA 2EYFA 3EFXD 5KRUA 1AN8A 3C2PA 2XRSD 2VXWA 5LL6X 2KECA 3M7NA 1OXSC 3O13A 5C0XH 4EQOA 1EY7A 2FMMA 1EIHA 1PRTC 1AZQA 5EBCA 5CR3A 3U9OA 1I4GA 2RQXA 3MAQA 2A6HC 5IGDA 2R92B 2JEBI 2K6AA 2F4IA 1LTGD 1Q3LA 1UAPA 2MJ8A 2O4XA 2AUJD 1O78A 2Q8TA 2F0PA 1EL0A 4S3SA 2F0HA 1W6JA 2F0WA 4OO1G 4PV1C 1SNPA 4RKLA 4C3JG 4IUQA 1YNJC 1I4HA 2LY7A 5JPNC 1STGA 3QWNA 4C3IG 4ODGA 5DNFA 1Q90A 1WTWA 4XQQA 4EQNA 2NYZD 4KD3A 2F0KA 5IGEA 2TSSA 1T5XD 2B2TA 1EWHA 1JORA 2RBMA 1QWYA 2F0LA 4J6HA 3R2TA 5CV9A 5DM63 4C56C 1C48A 2JA7B 4A93B 4Y7NB 1PMRA 3K6OA 2K03A 1TS5A 1O7LA 5M5XB 4ZQ3A 1Q1BA 2J7ZA 3PO2B 3D6CA 2JE6I 4IFDH 1EY6A 3TSSA 2B2YA 2ZXOA 5C44B 4K5XA 1RKNA 4DK1A 4A3FB 2E76C 4K2KA 4BWGB 3DWAA 1PXUA 1AW7A 3PIP3 5COYA 2F0FA 4K5VA 4UDUC 1KDCA 4KN7C 4K6LA 4QIWB 2RA4A 3HOWB 2EJFC 1S5ED 1TR5A 2XSCA 5I6WA 1LABA 5IT9L 2R93B 2B2UA 4C2MB 3CU7A 1S4ZA 4NP5A 3GV3A 2DN8A 3HEJA 5C0XG 2DNCA 3D4DA 1CA5A 4HEDA 3M7GA 1SXTA 2KJXA 5K5PA 2KOLA 3PIO3 4B08A 3SVMA 1LACA 4RHSA 2IWHA 3I4LA 3N52A 1W6KA 1HUMA 2NWGA 1JR0D 2BA0A 1GJXA 1TWHB 1STEA 2EYOA 3OWEB 3GQBA 3R8BA 2NZ1D 1BCPD 2N88A 4QCLA 1PTOF 3SK5A 4FF3A 3I91A 1Z6HA 3TP6A 1DYQA 1SBBB 5I2XA 4HSVA 3VR2A 1HTLD 1B2TA 4ZLTF 3SK6A 1OXVA 5CC4A 2EYMA 3J7YW 2TMPA 4DNRB 4XT3B 2FINB 1DJRD 2OT2A 3NPPA 2F3WA 2BE5C 2XN9C 3LX0A 1LTID 1UNSA 5EKIA 2K7VA 3ONAB 1J9OA 1PFBA 1TVXA 3BYTB 3FMCA 2WAQB 4A3JB 1CHPD 5C3WA 1K8MA 4OHJA 3SDZA 4CBVA 4B9XA 3KLSA 1TQOA 3TZUA 1HUNA 5ELDA 4CKCA 2R3ZA 4IFDG 1SMYD 4FXGC 1EY5A 3VYTA 1TIID 1HTPA 1NSNS 2Y0SB 2OF1A 3DEPA 4K6DA 1EWCA 3BYYB 1SE2A 1Y1WB 4HR7B 1JOQA 3NBHA 5J39A 1PLFA 4XIGS 1EU4A 1TKWB 1YNND 4F88A 3S9WA 1IYUA 2M2LA 3C46A 1UEAB 1OO9B 1LT4D 3G6JB 3DWQA 3MTSA 4RCNA 4J1MA 4KK7A 1GUSA 3NHHA 4C3HG 2EPBA 3NTKA 3PUXA 5D65A 3A54A 5E1FA 3NBIA 3A8JE 3BDOA 3QOJA 4XQJA 2EY6A 4RHRA 4FNFA 1SNCA 4ZKBB 3J7AF 3HS0C 2Z4IA 3VA7A 5C6AA 1RD9D 1QNUA 1TS3A 3R2IA 2RKSA 4XDXA 5EKLA 5KNBA 2PZWA 3FKIB 2XRQD 2B2WA 4ZAIA 2PQEA 2L4NA 2CW0C 1H9KA 2D62A 2QCPX 4I65A 2HDMA 5C4HA 4TRDA 1MGSA 5J1ZA 5HURA 1GUOA 1GUGA 4PNYA 2L1BA 1D1IA 1RF2D 1G91A 1QCBD 2RDHA 4QB4A 1O7ZA 5CORA 1TU2B 2X69A 5A2QL 2YYZA 4LMQD 2IX1A 3C1EA 1ZKOA 3DUZA 1ZEQX 3AU7A 4EQPA 3PV0A 4HMIA 4G7HC 3NTHA 4KI0A 1BCPB 3QIAA 2KCCA 2K5QA 3T4AC 3LWEA 1AZPA 4A3GB 2EDGA 5DEHA 4H0LC 3TP5A 1WD1A 5ELEA 1ET6A 4KKTA 2XWBB 1O7YA 4IUVA 2F0SA 3HRZC 2EZVA 3P75A 3HOUB 3MEHA 4XTCS 2IX3A 1EY8A 3GP7A 5CBAE 2ZT9C 3VA5A 1PRTD 3P7JA 2WINB 4G57A 1KDAA 5CV5A 5CV8A 1A2TA 2A6HD 2A68C 3H09A 3TP8A 3P20A 4IUUA 2CHBD 4KJNA 1LLRD 1DXMA 1JB3A 4PMCA 5FLXE 5AFWA 1CM9A 3Q0AA 2MP1A 2FHTA 1WTOA 2L55A 2G9DA 2JSOA 2AUKA 1PTOH 1K8OA 1S5BD 4TQUS 2DY8A 1D5ZC 1HA5A 2K33A 5ISRA 1YNJD 1GUTA 2SNSA 2WB1B 1SNDA 2DNEA 4DK0A 2F0QA 1HQMC 2ICIA 4C1NK 1GHKA 2A69D 3BZDB 2F0DA 1PTOC 1FD7D 4RGNA 4Q5VA 1TWAB 1C4QA 3D31A 5D14A 1EOTA 4B9WA 2FFKB 1B4OA 1D1KA 1OXTA 5KYLA 3S1NB 3NTIA 3HOXB 1Y8OB 4KJOA 3PUWA 2RSOA 5D3IB 3J7AV 3N6RA 3BG3A 5E4WC 3VR5A 2F0MA 1GHJA 3OIPA 3D3RA 3TP7A 3GTGB 3K59A 4CJ1B 1BR9A 1F9PA 1SDFA 2WACA 2SOBA 3NSWA 2EE1A 2PZTA 1BDOA 4C3JB 2NVQB 1L0YB 2Z4HA 3VR3A 4C3IB 3FPUB 5C0XI 2MPMA 4XXEA 1ML0D 4G4KA 4XQNA 4KKUA 2EJMA 3GTMB 1G291 2EY1A 5J22A 1LV9A 3AMUA 3OSOA 4WORA 1C8CA 2SNMA 4ILWA 1PFMA 3T53B 1SSOA 5KNDA 4KY7A 1ESFA 1H9RA 1HA6A 4IQZA 2IJ0A 3Q24A 4FYDA 2AQ1B 4HCEA 3GTPB 4CKEA 4L6TB 3PUVA 1D5MC 4BA1I 1A6XA 4WFN3 1QE6A 5JAVA 1SE4A 2M9VA 4RGMA 3I90A 1QILA 3OW7A 2X6LA 1MSHA 5KIXA 1SJED 1KNAA 2KEEA 1WTVA 4F87A 2K01A 3T56B 4RA8A 1PZID 2NUCA 5FKAC 1SYCA 1PZJD 2A69C 4Z9CB 3C1FA 1V1OA 2NN6G 5ELCA 5C3EB 1B1ZA 4KHVA 2BE5D 2B2UC 1BNZA 2GA4B 4RGTA 1FNVA 3TDQA 2HUGA 3A8KE 1H9JA 1BXTA 3L3OC 5KNCA 2AQ3B 4IN3A 5G3LF 1OXXK 3A8IE 4HAEA 1SJHD 5E4XA 5EJWA 5I6YA 4BBSB 3RZDB 1GOZA 1HXYD 4KV6A 3V05A 4ZUJA 4DAYA 4KY6A 3A7LA 3IFTA 3URYA 2EYJA 1NR4A 4LAAA 4RH6A 1HCZA 4CJ0B 2AQ2B 2HQEA 3C3LA 2IW3A 4R8NA 1U4PA 2DY7A 2SDFA 3J80L 5FLXL 3IKJA 1XYIA 3ND9A 1RCVD 4ULLA 5FOBB 3QJYA 3HOYB 5D3DA 2E2HB 2RDFA 3QB3A 4LK1C 1QJOA 3GTLB 2K5WA 3K58A 3GO5A 4OL7A 5CBEE 2JEAI 1DONA 2A74C 2VNUD 5IGFA 5DM73 4FF1A 1M8AA 1A3UA 2B8GA 2O5JC 3V2TA 1TS2A 1FR3A 1NR2A 1JOKA 3OIQA 2E2IB 1V43A 2F0UA 2BCOA 4AYBB 2NTTA 2VUMB 1K83B 2B63B 4X3TA 1DZ1A 1EU3A 3L9AX 1DM0B 2F0OA 4CGYB 3SK4A 4P2CB 1QB5D 1ZXTA 3MXGA 1I4PA 1EQTA 3NE5B 2L5TA 3S1MB 3S15B 1FNUA 2KQ3A 2D9UA 1L0XB 3JAME 1EEID 2CW0D 2F3VA 5CV4A 4RGOS 1EYCA 5CGKA 2LKVA 2MHVA 1ZYRC 1I4RA 2A73B 4LJZC 1JWMD 3MFGA 1J8IA 1MD2D 1CHQD 1AP0A 3DXJC 2LFNA 3G7LA 1XX8A 2F0VA 3J81E 4A3IB 1ILPA 1WVLA 4J8QA 1U4MA 2B2VA 1SNMA 1FNWA 4C3HB 5C3XA 4YIJA 1ENAA 5F2DA 2XVSA 1STAA 3E0JA 2L0CA 4RAUC 5JVH3 5I4DA 2PYKA 3TZDA 1VDZA 2X6GA 3TBIB 2EYLA 1ILQA 1ENCA 1PYWD 5IGGA 1JOOA 2K32A 1QOHA 2D2CC 1VF5C 4XT1B 1B53A 4O1NA 4FXDA 2PNRC 2NVTB 1LT3D 4E6IA 3M3YB 5JEAJ 1XXGA 1PFNA 1JICA 3NUCA 3S17B 2A6EC 1PDQA 2A68D 3A56A 1LTRD 2HCIA 3OOCA 1HQRD 2KVMA 3I8ZA 1I4XA 4OIKA 2IL8A 3NQIA 3BVZA 1EQVA 1FYCA 3D8GA 3VYUA 1MBYA 4BY7B 1LT6D 4HN7A 3Q22A 3P1HA 2QKIC 4C1NI 5CMDA 5EGTA 1QNKA 1MI2A 4DFAA 3A7AB 5K36H 4BY1B 3K7AB 1EY9A 1E0BA 1SE3A 1VF7A 1QG7A 1F2ZA 1PTOD 1KABA 1X3PA 1RODA 2ZXRA 4QUCA 3R93A 3Q23A 3HGBA 1STNA 3M4OB 4X3KA 3S2DB 5EPJA 3E5SA 1MSGA 1F9SA 3M4YA 1EIGA 3VR4A 4L63B 3D4WA 3WOFA 1HHVA 5JPMC 1WTPA 1RJTA 2LMCB 4MHEA 2EXZA 2WP8J 4EVOA 1DOKA 4GZYC 3RMHA 4DA2A 2EYPA 2RSNA 3CRLC 1Y69U 4DAPA 1M4VA 2FMCA 4V0BA 3IFDA 1RHPA 4OGQC 1BBXC 3HKZB 5JOBA 3L7ZC 5JVG3 4DNTB 1EZ8A 3QOLA 3CRKC 3Q6SA 1IYVA 2QF7A 2IT1A 4X3UA 1IKLA 1EFID 4DN4M 3K5OA 2EY5A 1SNOA 4M1UB 3FEWX 4HSPA 4OO1I 2BDOA 3VR6A 4CKBA 4O42A 3VYRA 3JAML 1FGBD 4K5WA 5DAUA 1STBA 2KUMA 1TT2A 1XWEA 3CQZB 2JXMB 2JA5B 2BDNA 4ZK9B 3BDCA 4IALA 3A55A 1JC7A 1AFPA 2RDGA 3GV6A 1PZKD 1F2YA 2JYOA 3OMGA 2N55A 5IT9E 2NN6I 2PMZB 4NMZA 4UAIA 2CVRA 2Z8LA 3BDLA 2E2DC 4BA2I 2G9HD 3NWSA 5ELBA 3HOZB 2V4DA 2F0GA 3W3AA 3GD7A 2PW7A 5CYUA 4IUNA 2F03A 1STHA 1ET9A 4MN3A 1LTAD 3I73A 3MZ5A 4DGZA 3RUZA 4PMBA 1EZ6A 3DHQA 4K2LA 2L11A 3DMUA 1Q8IA 2B39A 1SYBA 2PZUA 1CT1D 3K5MA 1IW7C 2EYHA 1DOMA 4FF4A 1TWFB 4N9PA 3R3OA 1EYDA 1SYDA 1X3QA 3E6ZX 4BS9A 2F0TA 3H0GB 5KEEA 4RKBA 3W2DA 5C5MA 3WOEA 3KBXA 5C5LA 1X32A 4KTAA 1HRJA 1HFGA 3FDTA 1JWUD 1JCKB 1LT5D 1Y8PB 1ICWA 1RTOA 1PTOB 5EQ0A 2B2TC 1JQYD 4U673 2E74C 1EEFD 1F9RA 2HDLA 2Q8IB 5C4JB 3MXUA 1SNQA 1D6EC 1LTBD 1WTXA 2KCNA 4XYOA 3T13A 1I3QB 3I4MB 5EPKA 5CV6A 3ZYYX 3KF8A 1BCPF 5EBDA 3MFYA 2K1BA 2B2YC 1WTRA 1A2UA 5IGCA 4IURA 3OWFA 1Z7TA 5EPLA 5T1IA 4F7XA 2CQAA 3SE0A 1F77A 1WD0A 2K5DA 4TSSA 1CFMA 4IUPA 1V1PA 1V1PB 5M3FB 1BOSA 4M8AA 4Q0FA 1B9NA 1G8ZD 1CK1A 1BUVT 1Q12A 1VMCA 3X3MA 2PPBC 3S14B 3NWTA 1PRTB 3CHBD 1GUWA 5JEAH 1G6ZA 1F2LA 2Z1CA 3V96A 4A3EB 1E2VA 1ZYRD 3VYSA 3CKIB 1S5DD 1IKMA 3ITPA 2R61A 4FVMA 4IFDI 1U4LA 3BVGA 2PCFB 3EVQA 1CTMA 1DCZA 2VB3X 4EGVA 1OXUA 4ABNA 2L12A 4RCOA 4ZYSA 1CZGA 3SHLA 4I7ZC 3WDNA 5HGTA 1Q1EA 2K05A 2R6GA 2I46A 3S1QB 3GTOB 2OEOA 3EQLC 3S16B 4JBWA 3K5LA 3BS1A 4H7BA 1NUCA 2PW5A 1S5CD 4DF7A 4RFBA 1TS4A 3SXHA 2O5IC 1KLUD 3F2UA 1AEXA 3OPOA 5IOCA 3NXWA 4WRDA 3ERQA 5C4ZA 1XTCD 2EY2A 3I70A 2RVLA 4WJWA 5A2QE 4DXGA 4QMGA 1A3VA 4RWSC 3HZXA 2A6ED 2E2JB 2YU9B 1R9TB 1VCIA 1R4QB 5KYIA 1IHZA 4ZKCB 3UI2A 3BVMA 1RDPD 1BQQT 4FXKC 4IUTA 4G7OC 2EVBA 3MXPA 5BN3A 1A15A 1ESRA 2B2VC 3T16A 3LWUA 1II3A 2L9HA 2OXPA 4CHTB 2H4OA 4KD4A 4QUFA 1O80A 4PQXA 5EKKA 4R8IA 1SYGA 1BO0A 1KAAA 2F0IA 3HP3A 2JA8B 3KLSX 1GXDC 3K5NA 1CA6A 3RZOB 1ENFA 3QO2A 4HMJA 4K14A 3FRPB 2QEJC 1KTKA 3IL8A 5IIFA 4KY5A 3OHXC 2MUYA 4ME5A 1EY0A 1U9RA 2KHSA 2D5DA 1D5XC 5BN4A 5C0XJ 4OIJA 3X3NA 5JEAG 1G2TA 4HTHA 2KA7A 2QDBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BDL A;  5CV6 A;  3D6C A;  3NHH A;  3OMC A;  3D4W A;  1EY6 A;  3C1F A;  2F0S A;  4K5X A;  4K8J A;  1RKN A;  4ID6 A;  1AEX A;  2F0U A;  3P75 A;  4K8I A;  2F0G A;  4ZUI A;  5E1F A;  2F0M A;  1F2M A;  1A2U A;  4F8M A;  5IOC A;  3NXW A;  3MEH A;  5IGC A;  3OWF A;  2F0E A;  4K2K A;  4WRD A;  1EY8 A;  3ERQ A;  2EYM A;  2M00 A;  3SK6 A;  5C4Z A;  2EXZ A;  4KHV A;  3QOJ A;  5CC4 A;  5IGB A;  2PW7 A;  3VA5 A;  4E6I A;  1EY7 A;  4EQO A;  4F7X A;  5M9O A;  2EY2 A;  2EY6 A;  4IUN A;  4EVO A;  1SNC A;  5E3F A;  2F3W A;  1STH A;  2ENB A;  4G57 A;  2F0O A;  3H6M A;  1KDA A;  2F0F A;  3TP7 A;  5C6A A;  5CV5 A;  3SK4 A;  5KGU A;  4K5V A;  4QMG A;  1A3V A;  3LX0 A;  5CR3 A;  1KDC A;  3HZX A;  3NUC A;  5CV8 A;  3MZ5 A;  3U9O A;  2EYP A;  2RKS A;  4DGZ A;  5EKL A;  1A2T A;  4QF4 A;  3RUZ A;  4PMB A;  1EZ6 A;  3TP8 A;  2WAC A;  1JOK A;  2PZW A;  3DHQ A;  4K2L A;  3DMU A;  5IGD A;  2SOB A;  5KYI A;  1TR5 A;  1IHZ A;  2PZT A;  5I6Y A;  4DU9 A;  4KJN A;  1SYB A;  2PZU A;  5C3W A;  4KV6 A;  4PMC A;  3MVV A;  2O4X A;  3NK9 A;  5I6W A;  4B9X A;  4ZUJ A;  5JOB A;  2KQ3 A;  2PQE A;  4KY6 A;  2EYH A;  1TQO A;  5CV7 A;  3SXH A;  3PMF A;  2F3V A;  1KDB A;  5CV4 A;  2F0P A;  1EZ8 A;  3MXP A;  2EYJ A;  5IOD A;  1EYC A;  3QOL A;  3MHB A;  1EQV A;  4NP5 A;  4N9P A;  3R3O A;  2EY1 A;  5I9P A;  3D8G A;  5J22 A;  4NKL A;  4S3S A;  4I65 A;  1EYD A;  1SYD A;  2F0H A;  4TRD A;  3T16 A;  5C4H A;  3OSO A;  4N9T A;  2LKV A;  5J1Z A;  1II3 A;  2OXP A;  4LAA A;  4WOR A;  5CGK A;  2F0T A;  2F0W A;  3HEJ A;  2SNM A;  5KEE A;  1EY5 A;  1SNP A;  3P1H A;  5HUR A;  2EY5 A;  3ITP A;  4KD4 A;  5EKK A;  1SNO A;  4RKL A;  4PNY A;  4RKB A;  5EGT A;  1SYG A;  1KAA A;  2F0I A;  5ISR A;  4MIU A;  5C5M A;  4KY7 A;  1NSN S;  3EVQ A;  5C5L A;  2SNS A;  1STG A;  1EYA A;  2HQE A;  4KTA A;  3D4D A;  4DFA A;  4J1M A;  4R8N A;  4ODG A;  1SYE A;  1SND A;  2F0V A;  3SR1 A;  2OF1 A;  4EQN A;  2F0Q A;  3NQT A;  4HMJ A;  2F0N A;  4K14 A;  4K6D A;  4NDX A;  5K5P A;  1EY9 A;  4K5W A;  4KD3 A;  2F0K A;  5IGE A;  5NUC A;  5DAU A;  1STB A;  4QB4 A;  2RDF A;  3NP8 A;  3SHL A;  1TT2 A;  3QB3 A;  5IIF A;  1F2Z A;  4KY5 A;  1SNM A;  1JOQ A;  2F0D A;  1KAB A;  1STY A;  5HGT A;  1JOR A;  3C1E A;  2RBM A;  5C3X A;  3BDC A;  4YIJ A;  1ENA A;  4IAL A;  5F2D A;  3ERO A;  2F0L A;  4EQP A;  5J39 A;  5JAV A;  4ME5 A;  1STA A;  4J6H A;  1EY0 A;  3S9W A;  2EYO A;  4HMI A;  5CV9 A;  3SK8 A;  2OEO A;  4OL7 A;  1STN A;  1U9R A;  2KHS A;  2F0J A;  4B9W A;  5KIX A;  1A3T A;  2PYK A;  1F2Y A;  1EY4 A;  5I9O A;  4IZ8 A;  3OMG A;  1SNQ A;  3EJI A;  3TME A;  4NMZ A;  5DEH A;  5IGF A;  4H7B A;  5KYL A;  2EYF A;  4ZQ3 A;  3E5S A;  1NUC A;  3SK5 A;  2EYL A;  2PW5 A;  3TP5 A;  3T13 A;  1A3U A;  1ENC A;  4DF7 A;  4HTH A;  1SYF A;  3TP6 A;  2NUC A;  5KRU A;  3V2T A;  5IGG A;  1JOO A;  2QDB A;  4KJO A;  1SYC A; 
#chains in the Genus database with same CATH topology
 3HOV B;  4BY7 H;  1H95 A;  3OMC A;  1CZW A;  2ICE C;  2AWO A;  2C5C A;  5LL6 S;  3TRE A;  1WFQ A;  5FO9 B;  4ID6 A;  3FKI H;  4ZUI A;  4HIO A;  1WTQ A;  4F8M A;  4H44 C;  2F0E A;  2VL6 A;  4WJ4 A;  2M00 A;  1NAP A;  5IGB A;  5G3L D;  3K7A H;  2NTS A;  4G7Z C;  2WII B;  3D6W A;  1IBL Q;  5E3F A;  4Y52 H;  1U5K A;  3OYY A;  1X3F A;  3H91 A;  3M85 A;  4OWW B;  2UU9 Q;  3H94 A;  2B8F A;  1SFO B;  4NXN Q;  1N36 Q;  1UEB A;  1G51 A;  1XNQ Q;  2ZXP A;  1PVO A;  1C7Y A;  2Z6K C;  3GTQ B;  5C4X B;  2F1M A;  1PRT F;  5JJZ A;  2C9O A;  4OXP A;  4DAV A;  2QDL A;  1LO5 D;  2KEN A;  2B2W C;  1CSQ A;  3MVV A;  3S2D H;  1TY2 A;  3UDF A;  3DM1 A;  1JB7 A;  2JP1 A;  3U50 C;  4BXX H;  1D2B A;  3U58 A;  3MHB A;  2ZM6 Q;  2NVX B;  4CJ2 C;  1VMP A;  1Q86 C;  1CKM A;  1H9S B;  1H9S A;  2AWN A;  1B44 D;  2I07 B;  3ND8 A;  1SAP A;  2K28 A;  4HCS A;  4A3D B;  2WAQ G;  4A3J G;  1CUK A;  2KED A;  1K28 A;  2PO4 A;  1QZG A;  3MWY W;  2JA6 B;  1BF4 A;  3SR1 A;  4YCW A;  3HKS A;  3NQT A;  2J4X A;  1G2S A;  4GN4 B;  3PIP A;  2DJG C;  3FPP A;  4DV1 L;  5NUC A;  2SEB D;  2IPK D;  3QG1 A;  4NW2 A;  2HCC A;  4V19 0;  1STY A;  2NBF A;  3AB9 A;  4MTN A;  1Z47 A;  4IFD J;  1A62 A;  1Y1V B;  3I4N B;  1I6V C;  4FP5 D;  1YZ6 A;  3SK8 A;  4L8J A;  5BN5 A;  2VB2 X;  1BCP C;  2Y0S G;  3A5Z B;  5I9O A;  3T51 B;  3CCL A;  3J81 j;  1B9M A;  4DXF A;  1IL8 A;  2QIL A;  3RD4 A;  4GOP A;  4GOP B;  3EA6 A;  2XNA C;  1R4P B;  1NCV A;  1KRT A;  1Y1W G;  4DR7 Q;  5I2Y A;  1V8Q A;  4A3K B;  1SLJ A;  1JJ2 A;  3GTK B;  4LF5 L;  2N3S A;  4K8I A;  4A3D G;  1F2M A;  3STB D;  4DUZ Q;  3ULP A;  3I72 A;  3DWP A;  2C35 B;  1CSP A;  4XYQ A;  2EJG C;  1EOV A;  3TS2 A;  2B29 A;  5M5W B;  2R7Z B;  1T5E A;  2ID0 A;  3PQI A;  2ASB A;  3KLR A;  4J15 A;  4YCV A;  4HJ5 A;  5KGU A;  1KL9 A;  3PO3 B;  1F9Q A;  4TVA B;  1EIF A;  3PUZ A;  1HR0 L;  4OX9 Q;  3CCQ A;  1KLG D;  3SEB A;  1UE5 A;  4KHZ A;  5GRO A;  1CQF A;  1IW7 D;  1DOL A;  4U68 A;  2ES2 A;  3K57 A;  3H3V H;  1UWV A;  1KDB A;  5IWA L;  1KNE A;  3A74 A;  4DR5 L;  4LF6 L;  2BA1 A;  4ZCK A;  5LHY 1;  3MXN B;  3MXN A;  1JWS D;  4NKL A;  3D4R A;  4H13 C;  2K04 A;  1SMY C;  3DEO A;  3HOZ H;  4X66 L;  2BOS A;  2CQO A;  5GAD C;  3S1R B;  2WKD A;  3KUP A;  1X6O A;  3TS0 A;  3KK7 A;  1X54 A;  4NDX A;  3H3V C;  2E75 C;  3HOX H;  3MC0 B;  1HPC A;  5GAE C;  4IJH A;  2PI2 A;  4LF4 Q;  3PUY A;  5M3M B;  1OTC A;  1VQ6 A;  1VQ9 A;  4PMW A;  1Y8N B;  3MA2 B;  4A4I A;  3ERO A;  4R4Q A;  4PZ6 A;  4DV5 Q;  3CF5 A;  1YNN C;  3K7U C;  4FO2 A;  1PH4 A;  4AYB E;  2KCM A;  2OQK A;  2F0J A;  1TY0 A;  1A3T A;  1I6H B;  4N8F A;  4KN4 C;  1EY4 A;  4IZ8 A;  1QZH A;  1S5F D;  3CCJ A;  1BBW A;  4A3M B;  4R9W A;  1SYF A;  1E2W A;  1TWF H;  5A35 A;  3GTJ B;  4JV5 Q;  2EQS A;  5M5Y B;  2NVY B;  4KKS A;  5TSS A;  3ERS X;  1EQR A;  4OO1 H;  2OWO A;  2F3I A;  4K8J A;  2A8V A;  4EX5 A;  1HFN A;  4GLV B;  4C3J H;  2NVQ H;  3J80 E;  2FJ2 A;  3K80 C;  3RN5 A;  4A3G G;  3RLF A;  5IP7 H;  4CDD C;  4C3I H;  5M9O A;  2EOT A;  4GKK Q;  1GO3 E;  2H1E A;  2ENB A;  2A5H A;  3J81 L;  1E2Z A;  3H6M A;  3I3C A;  1CI3 M;  3GTM H;  2NZH A;  1LTS D;  1E1T A;  5ELF A;  4FF2 A;  4QF4 A;  2IX0 A;  4QY7 A;  1QVG A;  1LM0 A;  1YIT A;  4APV A;  3HOU G;  3RR5 A;  1U4R A;  4DU9 A;  2NN6 H;  1I50 B;  4LUO A;  1DD2 A;  3FVQ A;  5K36 G;  1MKH A;  3NK9 A;  3L2P A;  2NB0 A;  5CV7 A;  3PMF A;  2J0T D;  1SEB D;  3LNN A;  4LF7 L;  1CQV A;  4YWM A;  2UUC L;  4ZRZ A;  5IOD A;  2WV6 D;  3I4M H;  5LMU Q;  5I9P A;  1TWC B;  3NEL A;  1JE4 A;  4N9T A;  4JK1 C;  4A3B B;  1ONL A;  3S2H B;  1RTN A;  4X3S A;  3U9S A;  4MIU A;  1WCM B;  3HG9 A;  1EYA A;  1UUP A;  4TKO B;  3F8T A;  2XWJ B;  3PF4 A;  1B3A A;  1SYE A;  5T1G A;  5FO7 B;  2F0N A;  2K75 A;  3ULL A;  1LTT D;  3TN2 A;  2LS0 1;  4B3T Q;  4QJF A;  3NP8 A;  2ZTE A;  2MGS A;  2WKC A;  3M4P A;  4JI6 Q;  1HH2 P;  5FO8 B;  2Q8R E;  4BBR B;  1M90 C;  1TWG B;  4KMU C;  2HHH L;  2O2L D;  1I4Q A;  2WB1 G;  2Q2T A;  3IAY A;  5C3E H;  1GUN A;  1B50 A;  3K0Y A;  3KBG A;  3S14 H;  3HFZ B;  3EJI A;  3TME A;  1H9M A;  5FK9 C;  2XIW A;  2EYF A;  3EFX D;  3L0O A;  2F4V Q;  2I5L X;  5KRU A;  1AN8 A;  3C2P A;  2XRS D;  4LWC A;  2VXW A;  5LL6 X;  2KEC A;  2I5H A;  1E24 A;  4DK3 C;  3T1H L;  3M7N A;  4JI7 L;  1OXS C;  1Q82 C;  3O13 A;  1ASZ A;  3CW2 C;  5C0X H;  3KDF A;  3KDF B;  1MHW C;  4EQO A;  1EY7 A;  2FMM A;  1EIH A;  1PRT C;  4JYA L;  4R4C A;  3HOX G;  1AZQ A;  5EBC A;  1PFS A;  4HID A;  3CC4 A;  5CR3 A;  3U9O A;  3K8A A;  2EXD A;  1I4G A;  2RQX A;  3MAQ A;  2A6H C;  5GAG C;  4X64 L;  3S1Q H;  3GTO H;  5IGD A;  2R92 B;  2JEB I;  2K6A A;  1C9O A;  2F4I A;  1LTG D;  1Q3L A;  1UAP A;  2MJ8 A;  2O4X A;  2AUJ D;  1RIP A;  4MNO A;  1O78 A;  2Q8T A;  4JI3 Q;  2F0P A;  4HJ8 A;  4A75 A;  1GKH A;  1EL0 A;  2ZJP A;  4S3S A;  2F0H A;  1PH1 A;  1W6J A;  4GNX C;  2F0W A;  4OO1 G;  1XJV A;  4PV1 C;  1SNP A;  3D0F A;  1SE8 A;  4JI1 Q;  4OWX B;  3ICE A;  4RKL A;  4C3J G;  4B3S L;  4IUQ A;  1HZ9 A;  1YNJ C;  1I4H A;  2LY7 A;  5JPN C;  2E8G A;  4LFB L;  1STG A;  3QWN A;  5IP7 G;  4C3I G;  4ODG A;  5DNF A;  1Q90 A;  4DR1 Q;  1WTW A;  4DV4 L;  4XQQ A;  4EQN A;  2NYZ D;  1VQ8 A;  2I5M X;  4KD3 A;  2F0K A;  5IGE A;  2HQL A;  2TSS A;  4L5T A;  1T5X D;  2B2T A;  1EWH A;  5IYD H;  4DR2 L;  1JOR A;  2RBM A;  1QWY A;  4DR4 Q;  2F0L A;  2YU9 H;  1R9T H;  4J6H A;  3R2T A;  4EQ5 A;  5CV9 A;  5DM6 3;  4YY3 L;  4LFC L;  4C56 C;  1C48 A;  2JA7 B;  4A93 B;  4Y7N B;  1PMR A;  3EIV A;  3K6O A;  3OTO L;  2B63 H;  2VQF L;  2K03 A;  1TS5 A;  1O7L A;  5M5X B;  2JN4 A;  4ZQ3 A;  4YWL A;  1Q1B A;  1W3S A;  4OWT B;  3PF5 A;  1HR0 W;  2J7Z A;  3PO2 B;  4OEM B;  3D6C A;  2JE6 I;  4IFD H;  1EY6 A;  3TSS A;  2B2Y A;  2ZXO A;  5C44 B;  4K5X A;  1RKN A;  4DK1 A;  4A3F B;  2E76 C;  4K2K A;  4BWG B;  3DWA A;  3CXC A;  3RZO H;  3S1M H;  3HKZ E;  1PXU A;  4JW0 A;  1J5E L;  1AW7 A;  3PIP 3;  5COY A;  2F0F A;  4K5V A;  4UDU C;  1X3G A;  1KDC A;  4KN7 C;  5LMN L;  4K6L A;  4QIW B;  2FXQ A;  4UP9 A;  2RA4 A;  3HOW B;  2EJF C;  3CCR A;  1S5E D;  1TR5 A;  4LW1 A;  2XSC A;  1FL0 A;  5C3E G;  3PSI A;  4JI5 L;  5I6W A;  1LAB A;  4A3I H;  1E22 A;  2K50 A;  5IT9 L;  2R93 B;  2B2U A;  4C2M B;  1PA6 A;  3CU7 A;  1N8R C;  1S4Z A;  4NP5 A;  3GV3 A;  2QA4 A;  3HOV H;  4MTK A;  2DN8 A;  3HEJ A;  4C3H H;  1YBY A;  4BBS G;  5C0X G;  2DNC A;  1I94 Q;  4CDC C;  3D4D A;  2PMZ E;  3CCM A;  4HED A;  1XMQ L;  1CA5 A;  3M7G A;  4YHH Q;  1QVC A;  1SXT A;  2KJX A;  4ME3 A;  1N36 L;  5K5P A;  2KOL A;  3PIO 3;  4B08 A;  3SVM A;  4A3L G;  4P75 A;  1LAC A;  4RHS A;  2IWH A;  3I4L A;  3N52 A;  1W6K A;  1YJ9 A;  2JQO A;  4DR6 Q;  1HUM A;  2NWG A;  1JR0 D;  2BA0 A;  1GJX A;  1TWH B;  1STE A;  2EYO A;  5C4X H;  3OWE B;  1IL2 A;  3GQB A;  3M4Q A;  2NZ1 D;  3R8B A;  1VQL A;  3T1Y L;  1BCP D;  2N88 A;  2E5L L;  2UXB Q;  4QCL A;  3KYH C;  1PTO F;  3CPF A;  3SK5 A;  4FF3 A;  1VQE A;  3I91 A;  1Z6H A;  3HOY G;  4JI4 L;  3TP6 A;  2UXD L;  3RLO A;  4GKJ Q;  1DYQ A;  1SBB B;  2CKZ B;  1HNX L;  5I2X A;  1AE2 A;  4HSV A;  1EFW A;  1EYG A;  3VR2 A;  1HTL D;  4IOA A;  1B2T A;  4GN5 A;  4ZLT F;  2JA6 H;  1Y14 B;  3SK6 A;  1OXV A;  5CC4 A;  2EYM A;  3KJP A;  3H15 A;  1KIX A;  3J7Y W;  2TMP A;  4DNR B;  4XT3 B;  2FIN B;  3WWV A;  1DJR D;  2OT2 A;  4AH6 A;  3NPP A;  2F3W A;  5J3B A;  2BE5 C;  5BR8 L;  1NJI C;  2XN9 C;  1SRO A;  3J81 c;  5IYD G;  2R7F A;  3LX0 A;  1LTI D;  4DV3 L;  2HIX A;  2LSS A;  4GS3 A;  1UNS A;  5EKI A;  1Y1V H;  2K7V A;  3ONA B;  1J9O A;  2QGQ A;  3I4N H;  3TRZ A;  1PFB A;  1TVX A;  3BYT B;  4AYB G;  3FMC A;  1HNW L;  2WAQ B;  3PCO B;  2VUM G;  4A3J B;  1CHP D;  5C3W A;  2B63 G;  1K8M A;  4OHJ A;  2VQE L;  3SDZ A;  4CBV A;  4B9X A;  1UE7 A;  4UP8 A;  1N34 Q;  3KLS A;  1TQO A;  4BY1 H;  1J6Q A;  4DV0 L;  1N32 Q;  1ICF B;  3TZU A;  3CME A;  1HUN A;  1XNR Q;  5ELD A;  4CKC A;  4FDB A;  2R3Z A;  3LGJ A;  4A3K H;  4IFD G;  1SMY D;  4FXG C;  3AFQ A;  1EY5 A;  3VYT A;  1SR3 A;  1TII D;  2XGT A;  1NBW A;  1HTP A;  3M4O H;  1NSN S;  4X62 L;  2Y0S B;  2OCE A;  1QUQ B;  1LUZ A;  1QUQ A;  2OF1 A;  3DEP A;  3F2B A;  2R7Z H;  4K6D A;  2RCN A;  1EWC A;  3KLW A;  3BYY B;  4GOP C;  2IY5 B;  1SE2 A;  1Y1W B;  4HR7 B;  3PO3 H;  1K9M C;  1JOQ A;  4B3M L;  3NBH A;  4JI8 Q;  1PLF A;  5J39 A;  4XIG S;  1EU4 A;  1TKW B;  1YNN D;  4F88 A;  3S9W A;  1IYU A;  2M2L A;  3C46 A;  5IYB H;  1TXY A;  1UEA B;  3FP9 A;  1OO9 B;  1LT4 D;  1BVS A;  4A3I G;  5IP9 H;  3G6J B;  3DWQ A;  1RL2 A;  2MQH A;  3MTS A;  5AJ3 Q;  4RCN A;  4J1M A;  4KK7 A;  1GUS A;  3NHH A;  4C3H G;  1CKO A;  2EPB A;  3RNU A;  3NTK A;  3S1R H;  3PUX A;  2LXJ A;  5D65 A;  3A54 A;  5E1F A;  3NBI A;  3A8J E;  3BDO A;  1T9H A;  3QOJ A;  4XQJ A;  2EY6 A;  4RHR A;  4FNF A;  1SNC A;  4ZKB B;  3J7A F;  3HS0 C;  1BBU A;  2Z4I A;  3VA7 A;  5C6A A;  4JI2 L;  1RD9 D;  1QNU A;  2I0Q A;  1TS3 A;  3R2I A;  2RKS A;  4XDX A;  5EKL A;  3CD6 A;  5KNB A;  1VQM A;  2LXK A;  2Z6K A;  2Z0S A;  2PZW A;  3FKI B;  2XRQ D;  5IYC H;  2B2W A;  1I6H H;  4ZAI A;  4DPG A;  2PQE A;  2L4N A;  2MO0 A;  4A3M H;  2CW0 C;  1H9K A;  3PIO A;  2D62 A;  3GTJ H;  4LNQ A;  2H5X A;  2QCP X;  4I65 A;  2HDM A;  5C4H A;  4TRD A;  3CQZ H;  1IBK L;  4LF8 L;  2KBN A;  1MGS A;  5J1Z A;  2JA5 H;  2K5H A;  1VQF A;  5HUR A;  1YIJ A;  1GUO A;  1GUG A;  4PNY A;  2L1B A;  2NZO A;  3S24 A;  1D1I A;  1RF2 D;  1G91 A;  1QCB D;  4B3R L;  3F2C A;  4X65 L;  2RDH A;  1B70 B;  4KLK A;  2R7D A;  1P8L A;  1YHQ A;  4QB4 A;  1O7Z A;  5COR A;  1TU2 B;  2X69 A;  5A2Q L;  5FJ8 H;  2YYZ A;  4LMQ D;  4BY7 G;  2IX1 A;  4A76 A;  3C1E A;  1ZKO A;  3DUZ A;  1ZEQ X;  3AU7 A;  4EQP A;  3PV0 A;  5ELN A;  4HMI A;  3FKI G;  4G7H C;  1I50 H;  3NTH A;  4KI0 A;  1BCP B;  3QIA A;  2KCC A;  2K5Q A;  3T4A C;  3LWE A;  1AZP A;  4A3G B;  2EDG A;  2YTV A;  4BY1 G;  5DEH A;  4H0L C;  3TP5 A;  3U4Z A;  1WD1 A;  1N33 L;  2N78 A;  5ELE A;  1YNX A;  1L1O B;  1L1O A;  1TWC H;  2VZA A;  1ET6 A;  4KKT A;  1B8A A;  2XWB B;  5LMN W;  4LF9 L;  4A3B H;  2GVB A;  1O7Y A;  4IUV A;  4DV1 Q;  3S2H H;  2F0S A;  3HRZ C;  2EZV A;  3BZC A;  3P75 A;  3HOU B;  1Q8K A;  2WFW A;  1UE1 A;  1WCM H;  3MEH A;  4XTC S;  2IX3 A;  1EY8 A;  3GP7 A;  5CBA E;  2ZT9 C;  3VA5 A;  1PRT D;  1VQO A;  4BXX G;  3P7J A;  2WIN B;  4G57 A;  1KDA A;  5CV5 A;  5CV8 A;  3BU2 A;  1A2T A;  2A6H D;  4GN3 B;  2A68 C;  3H09 A;  3H0G H;  3TP8 A;  3P20 A;  4IUU A;  4LUZ A;  3J7A 5;  1TWG H;  2CHB D;  4KJN A;  1LLR D;  3CAM A;  1DXM A;  1JB3 A;  4LF5 Q;  4PMC A;  5FLX E;  1PYB A;  5IP9 G;  5AFW A;  1CM9 A;  1WTH A;  3Q0A A;  3J80 c;  3J80 i;  2MP1 A;  2FHT A;  5IT9 c;  1WTO A;  2L55 A;  2G9D A;  2JSO A;  2AUK A;  1PTO H;  4I7A A;  5GQO A;  1K8O A;  1V1Q A;  1CKN B;  1CKN A;  1S5B D;  4TQU S;  2DY8 A;  1SRU A;  1D5Z C;  2RHQ B;  1HA5 A;  2K33 A;  5ISR A;  1YNJ D;  1GUT A;  1HR0 Q;  4NXM L;  2SNS A;  2WB1 B;  3HKZ G;  5C4J H;  1SND A;  1UE6 A;  2DNE A;  4DK0 A;  2F0Q A;  1EIY B;  1HQM C;  2ICI A;  4C1N K;  3NEN A;  1GHK A;  1I3Q H;  2A69 D;  3BZD B;  1JMC A;  2F0D A;  1PTO C;  5IWA Q;  1FD7 D;  4JI0 Q;  4LF6 Q;  4RGN A;  4Q5V A;  1TWA B;  1C4Q A;  3D31 A;  2R92 H;  1PHJ A;  5D14 A;  1EOT A;  4UPA A;  4KHP Q;  4B9W A;  4X66 Q;  4DV7 L;  4K0K Q;  1IYJ B;  2FFK B;  1B4O A;  4CDE C;  1D1K A;  1OXT A;  5KYL A;  3S1N B;  3NTI A;  3HOX B;  2DJF C;  1Y8O B;  3G4S A;  4AQY L;  4KJO A;  1YJN A;  2JA5 G;  2OTL A;  3PUW A;  2RSO A;  1NMF A;  5D3I B;  5M3F H;  4RG1 A;  3E3X A;  4DV6 L;  3J7A V;  3N6R A;  3BG3 A;  5E4W C;  3VR5 A;  2F0M A;  1E7Z A;  4N8X 1;  1GHJ A;  3OIP A;  3K0X A;  3D3R A;  3W1G A;  2UUB L;  3TEH B;  2OTJ A;  4DR4 L;  1HNZ L;  3TP7 A;  3GTG B;  3K59 A;  5FJ8 G;  4A3E H;  4CJ1 B;  1BR9 A;  3HOZ G;  1F9P A;  1FJG Q;  1SDF A;  2WAC A;  2SOB A;  3NSW A;  2EE1 A;  2PZT A;  1BDO A;  4C3J B;  1QVF A;  3KF6 A;  3KF6 B;  2NVQ B;  1L0Y B;  2JA7 H;  1VQD A;  2Z4H A;  3VR3 A;  4C3I B;  3FPU B;  5C0X I;  2MPM A;  4XXE A;  1ML0 D;  4G4K A;  4O2D A;  4XQN A;  4DV2 L;  4KKU A;  2EJM A;  3QR8 A;  3GTM B;  1G29 1;  2EY1 A;  5ELO A;  5J22 A;  3UDI A;  1LV9 A;  3AMU A;  3OSO A;  1X3E A;  3UE1 A;  4WOR A;  1C8C A;  2SNM A;  3CCU A;  3AFP A;  4ILW A;  4DAM A;  1W2B A;  1S40 A;  1PFM A;  3T53 B;  1SSO A;  5KND A;  4KY7 A;  1ESF A;  3S16 H;  4JOI A;  1K3R A;  1H9R A;  1NY4 A;  1HA6 A;  1KAW A;  4IQZ A;  2IJ0 A;  4A3C H;  4PZ7 A;  3Q24 A;  2RHS B;  4FYD A;  2AQ1 B;  4HCE A;  3GTP B;  4L6T B;  4CKE A;  3PUV A;  1G6P A;  1D5M C;  4OON A;  4BA1 I;  1A6X A;  2JA9 A;  3IRB A;  4LF7 Q;  2UUC Q;  1VQH A;  1PH5 A;  4DUY L;  3H0G G;  3HOW H;  4WFN 3;  1QE6 A;  5JAV A;  1SE4 A;  2M9V A;  4RGM A;  3I90 A;  1QIL A;  1IBM L;  3OW7 A;  2X6L A;  1MSH A;  3I56 A;  5KIX A;  1SJE D;  1KNA A;  2KEE A;  1WTV A;  2UUA L;  1XMO L;  4F87 A;  4LFA L;  2K01 A;  3T56 B;  4RA8 A;  1MJC A;  2R93 H;  4C2M H;  1PZI D;  2NUC A;  5FKA C;  1SYC A;  1PZJ D;  2A69 C;  4JPB W;  4Z9C B;  3C1F A;  2E2J H;  4L5R C;  5E7N A;  1P16 A;  1V1O A;  2NN6 G;  4DR3 L;  2V1C C;  3I55 A;  5ELC A;  5C3E B;  4HIK A;  1B1Z A;  4KHV A;  1LTL A;  2BE5 D;  2B2U C;  1BNZ A;  2CWP A;  1WJJ A;  3I4M G;  2GA4 B;  4RGT A;  2ZJQ A;  1FNV A;  3TDQ A;  2HUG A;  1EUJ A;  2F52 A;  3A8K E;  2ZTD A;  1H9J A;  1BXT A;  3L3O C;  4IN3 A;  2AQ3 B;  5KNC A;  1TWH H;  5G3L F;  3CPW A;  1OXX K;  4CDF C;  3A8I E;  4HAE A;  1SJH D;  5E4X A;  5EJW A;  5I6Y A;  2JA8 H;  4BBS B;  3RZD B;  1GOZ A;  1HXY D;  4KV6 A;  3T1H Q;  4JI7 Q;  3V05 A;  2L15 A;  4ZUJ A;  4DAY A;  4DAY B;  4KY6 A;  2UXC L;  3A7L A;  3IFT A;  3URY A;  2EYJ A;  2PI2 E;  1EWI A;  2CH4 A;  1NR4 A;  4GNX B;  4GNX A;  4JYA Q;  4LAA A;  4RH6 A;  5M3F G;  3J7Z C;  1A0I A;  1HCZ A;  4CJ0 B;  1KHI A;  2AQ2 B;  2HQE A;  3C3L A;  2IW3 A;  3MEF A;  4R8N A;  1U4P A;  2DY7 A;  2SDF A;  1WOC A;  3J80 L;  5FLX L;  3IKJ A;  1XYI A;  3ND9 A;  1RCV D;  4ULL A;  5FOB B;  3OW2 A;  3QJY A;  3HOY B;  5D3D A;  2E2H B;  4A3E G;  2RDF A;  3QB3 A;  2N8N A;  4LK1 C;  4GLX A;  1QJO A;  3GTL B;  2K5W A;  3K58 A;  3GO5 A;  4OL7 A;  2A19 A;  5CBE E;  2JEA I;  1VQB A;  1IBL L;  1DON A;  2Z9H A;  4X6A H;  2A74 C;  2VNU D;  5IGF A;  5DM7 3;  2UU9 L;  4FF1 A;  1M8A A;  4NXN L;  1L2F A;  4LFB Q;  1A3U A;  1VQ5 A;  1Q46 A;  2B8G A;  2O5J C;  3K81 C;  1XNQ L;  3V2T A;  1TS2 A;  4DV4 Q;  1FR3 A;  1NR2 A;  1JOK A;  1PH6 A;  1SFO H;  3OIQ A;  2ZTC A;  2E2I B;  1V43 A;  2F0U A;  4DR2 Q;  3GTQ H;  2BCO A;  4AYB B;  2NTT A;  2VUM B;  1K83 B;  2B63 B;  3NEM A;  1JE5 A;  4A3C G;  4X3T A;  2ZM6 L;  1DZ1 A;  1EU3 A;  4LFC Q;  2YTY A;  3L9A X;  1DM0 B;  2CCZ A;  2VY3 A;  3OTO Q;  3W5O A;  2F0O A;  4CGY B;  2NVX H;  1YJW A;  3SK4 A;  1Y1W H;  4P2C B;  4UP7 A;  2G5D A;  2QW7 A;  1QB5 D;  1ZXT A;  2HD3 A;  2XTI A;  2YV5 A;  3MXG A;  4A3D H;  4DK6 C;  1I4P A;  1EQT A;  3AEV A;  3NE5 B;  2L5T A;  3S1M B;  1KQS A;  3S15 B;  1FNU A;  2KQ3 A;  2D9U A;  1PV4 A;  1L0X B;  1VQJ A;  3JAM E;  2Q2U A;  1EEI D;  2IHE A;  2CW0 D;  2F3V A;  4P74 A;  5CV4 A;  4RGO S;  1EYC A;  3JAM i;  2HT1 A;  3ZJY C;  1J5E Q;  1WYD A;  5CGK A;  2LKV A;  2MHV A;  1X56 A;  2BH8 A;  1ZYR C;  1I4R A;  3CC2 A;  2A73 B;  4LJZ C;  1JWM D;  2VW9 A;  3MFG A;  1J8I A;  1MD2 D;  1CHQ D;  5LMN Q;  1AP0 A;  3DXJ C;  2LFN A;  3G7L A;  1XX8 A;  1VQC A;  2F0V A;  3J81 E;  4A3I B;  1ILP A;  1A63 A;  4HIM A;  4DR7 L;  3U4V A;  1WVL A;  2AHO B;  4JI5 Q;  4J8Q A;  1U4M A;  1PYS B;  2B2V A;  1SNM A;  1FNW A;  4P73 A;  4C3H B;  5C3X A;  4YIJ A;  1ENA A;  3AYH B;  5F2D A;  4DUZ L;  1KXL A;  2XVS A;  3GTK H;  1STA A;  3E0J A;  2L0C A;  2JA8 G;  4RAU C;  5JVH 3;  5I4D A;  2PYK A;  3TZD A;  3E0E A;  4HJ7 A;  1VDZ A;  2X6G A;  3TBI B;  5M5W H;  2EYL A;  1ILQ A;  1ENC A;  1JJG A;  5L37 A;  1PYW D;  1XMQ Q;  4OX9 L;  5IGG A;  1JOO A;  2K32 A;  1QOH A;  2D2C C;  2BH2 A;  2GVA A;  1VF5 C;  3NBH B;  4XT1 B;  1B53 A;  4O1N A;  4FXD A;  2PNR C;  1D7Q A;  1GM5 A;  1KRS A;  3FHW A;  2NVT B;  3SGI A;  4IOC A;  1LT3 D;  1V9P A;  1FGU A;  2MFI A;  4E6I A;  2YTX A;  3RLN A;  3M3Y B;  3T1Y Q;  4P71 A;  2E5L Q;  5JEA J;  2D0P A;  1XXG A;  3UDG A;  1PFN A;  1JIC A;  3NUC A;  3HOV G;  3EBE A;  3S17 B;  2A6E C;  4JI4 Q;  1PDQ A;  2A68 D;  3A56 A;  4POF A;  2UXD Q;  1LTR D;  2HCI A;  3OOC A;  1HQR D;  3CCE A;  3DM3 A;  1XPU A;  2KVM A;  4UY8 C;  3G6E A;  3I4O A;  1GD7 A;  3I8Z A;  1HNX Q;  3CCV A;  4A3G H;  1I4X A;  4OIK A;  4LF4 L;  2IL8 A;  3NQI A;  3BVZ A;  1B3Q A;  1EQV A;  1FYC A;  4DV5 L;  4NPS A;  3D8G A;  5M3M H;  3VYU A;  2CH4 W;  1MBY A;  4BY7 B;  5BR8 Q;  3A5U A;  1LT6 D;  3A0J A;  4HN7 A;  3UE0 A;  4YCU A;  3P1H A;  3Q22 A;  2QKI C;  4C1N I;  4DV3 Q;  5CMD A;  3HOU H;  5C4X G;  3BJU A;  5EGT A;  1QNK A;  2RF4 A;  2PNH A;  1MI2 A;  4DFA A;  3A7A B;  5K36 H;  1HNW Q;  4JV5 L;  4BY1 B;  3K7A B;  4R4I A;  2VQE Q;  1EY9 A;  1E0B A;  1SE3 A;  1VF7 A;  2JK8 A;  4JVZ A;  5HGQ A;  4O0A A;  4IJL A;  1L1O C;  2Q2H A;  1QG7 A;  1F2Z A;  4DV0 Q;  1PTO D;  1KAB A;  2NVY H;  5M5Y H;  1X3P A;  2GN5 A;  1ROD A;  2ZXR A;  4GLA C;  4QUC A;  2N49 A;  3R93 A;  3Q23 A;  3AQQ A;  3HGB A;  1STN A;  3M4O B;  4X3K A;  1AH9 A;  5DLQ E;  4GKK L;  4IO9 A;  2JA6 G;  4LUV A;  2Q2I A;  3Q8D A;  3S2D B;  1HZC A;  5EPJ A;  1U0L A;  1N9W A;  3E5S A;  4X62 Q;  1MSG A;  1IXR A;  1X9N A;  3F1Z A;  1VQN A;  1F9S A;  3M4Y A;  5EAY A;  3H3V I;  1EIG A;  3VR4 A;  4L63 B;  4QIW E;  2KHJ A;  3D4W A;  2RCF A;  3WOF A;  1Y1V G;  3I4N G;  1HHV A;  1D8L A;  5JPM C;  1WTP A;  4B3M Q;  1RJT A;  2LMC B;  4UHV A;  2KCT A;  2MO1 A;  4MHE A;  2EXZ A;  2WP8 J;  5LMU L;  1K8G A;  1MIU A;  4EVO A;  4JI0 L;  1DOK A;  3TQY A;  4JCV E;  4GZY C;  3RMH A;  4DA2 A;  4A3K G;  2EYP A;  1EQQ A;  2RSN A;  4KHP L;  3E9H A;  3CRL C;  2CWA A;  1Y69 U;  4DAP A;  1M4V A;  4QQB X;  4K0K L;  1TWA H;  2FMC A;  4POG A;  4V0B A;  3IFD A;  1E1O A;  2JJQ A;  4JBM A;  1RHP A;  4OGQ C;  1BBX C;  3HKZ B;  4B3T L;  5JOB A;  2R7Z G;  1KD1 C;  4RMF A;  3L7Z C;  5JVG 3;  3S1N H;  4DNT B;  1EZ8 A;  3QOL A;  3CRK C;  3Q6S A;  4JI6 L;  3PO3 G;  1K0S A;  1IYV A;  2QF7 A;  2IT1 A;  4X3U A;  1IKL A;  1EFI D;  2HIV A;  4DN4 M;  3K5O A;  4JI2 Q;  2EY5 A;  5JJI A;  1SNO A;  3M9B A;  4BBR H;  1YHA A;  4M1U B;  5IYB G;  3FEW X;  4HSP A;  4OO1 I;  4OEL B;  2BDO A;  2F4V L;  3VR6 A;  4CKB A;  4O42 A;  3VYR A;  5FLX c;  3JAM L;  1FGB D;  4K5W A;  2ZJR A;  1FJG L;  3GTG H;  5DAU A;  1STB A;  2KUM A;  1TT2 A;  1XWE A;  1S72 A;  3CQZ B;  3VDY A;  2JXM B;  2K52 A;  2JA5 B;  2BDN A;  4ZK9 B;  1O7I A;  2DUD A;  3BDC A;  1LYL A;  4IAL A;  3KFU A;  1IBK Q;  3A55 A;  4LF8 Q;  1JC7 A;  1AFP A;  2RDG A;  3GV6 A;  1PZK D;  1F2Y A;  2JYO A;  3OMG A;  2N55 A;  5IT9 E;  2NN6 I;  2PMZ B;  4NMZ A;  2QEX A;  3CCS A;  4UAI A;  2CVR A;  2Z8L A;  4B3R Q;  5M3M G;  1XPO A;  4X65 Q;  1VQ4 A;  3BDL A;  2E2D C;  4HJ9 A;  4DR5 Q;  4BA2 I;  2G9H D;  3NWS A;  5ELB A;  1NE3 A;  3HOZ B;  4JBJ A;  3ER0 A;  2V4D A;  1YI2 A;  2F0G A;  3CC7 A;  2WAQ E;  5IYC G;  4NB3 A;  3STB C;  3W3A A;  4JI3 L;  3GD7 A;  2PW7 A;  5CYU A;  4IUN A;  2F03 A;  4A3M G;  3GTP H;  1STH A;  1ET9 A;  4MN3 A;  1L0W A;  4JI1 L;  4ALP A;  3I73 A;  1LTA D;  1XTD A;  1S3O A;  3MZ5 A;  4IPH A;  4DGZ A;  3RUZ A;  4PMB A;  1N33 Q;  1EZ6 A;  3DHQ A;  4K2L A;  2L11 A;  3DMU A;  4LF9 Q;  2K14 A;  1Q8I A;  2B39 A;  3B6Y A;  4DR1 L;  1SYB A;  2PZU A;  4JOI C;  1CT1 D;  2Y0S E;  3BZK A;  3K5M A;  1IW7 C;  2EYH A;  1HZB A;  1DOM A;  4JBK A;  1E3P A;  4FF4 A;  5GAH C;  1TWF B;  4N9P A;  3R3O A;  1VQ7 A;  1EYD A;  1SYD A;  1X3Q A;  1X55 A;  3E6Z X;  4BS9 A;  1NTG A;  2F0T A;  3H0G B;  5KEE A;  5H1S E;  2K5V A;  4PG3 A;  1YEZ A;  4RKB A;  3W2D A;  5C5M A;  3WOE A;  3CMA A;  3KBX A;  5C5L A;  4A93 H;  1X32 A;  4Y7N H;  4KTA A;  1K73 C;  1HRJ A;  1HFG A;  3FDT A;  3ULJ A;  1DGS A;  3DLL A;  5M5X H;  2Z6B A;  4PZ8 A;  1FVI A;  1JWU D;  1JCK B;  1LT5 D;  1Y8P B;  3PGZ A;  3RN2 A;  1ICW A;  1RTO A;  2K5N A;  1PTO B;  5EQ0 A;  2ALY B;  1PH2 A;  2B2T C;  1JQY D;  4A3B G;  3PO2 H;  2K4K A;  4U67 3;  1M1K C;  2E74 C;  5C44 H;  1JJC B;  1IZ6 A;  1EEF D;  4BBS H;  1F9R A;  2HDL A;  4A3F H;  3RZD H;  1WCM G;  2Q8I B;  5C4J B;  3I2Z A;  3MXU A;  1SNQ A;  1D6E C;  1LTB D;  4DNI A;  4HJA A;  1WTX A;  4NXM Q;  5FLM H;  2KCN A;  4XYO A;  3T13 A;  1SMX A;  1A8V A;  4A3L H;  1PH9 A;  1HZA A;  4JG2 A;  1VS0 A;  1I3Q B;  2AKW B;  3I4M B;  5EPK A;  2KHI A;  5CV6 A;  3ZYY X;  3KF8 A;  3KF8 B;  1BCP F;  4R1J A;  1NNX A;  5EBD A;  3W1B A;  3MFY A;  2K1B A;  2B2Y C;  4BBR G;  1WTR A;  1PH7 A;  2IHF A;  4MZ9 A;  1A2U A;  5IGC A;  4IUR A;  3OWF A;  1Z7T A;  5EPL A;  1Q7Y C;  5T1I A;  4F7X A;  1WI5 A;  2CQA A;  3SE0 A;  4DV7 Q;  1F77 A;  1YHB A;  3G71 A;  3HOY H;  5IY0 A;  1WD0 A;  2E2H H;  2K5D A;  4TSS A;  1CFM A;  4IUP A;  1V1P A;  1V1P B;  3F2D A;  3GTL H;  5M3F B;  1HJP A;  1MJE A;  4AQY Q;  1I94 L;  1BOS A;  4M8A A;  1Q81 C;  4Q0F A;  1PH3 A;  1B9N A;  1G8Z D;  1CK1 A;  4IPD A;  4YHH L;  1BUV T;  4IPG A;  1Q12 A;  1VMC A;  4DV6 Q;  3X3M A;  2PPB C;  3S14 B;  3NWT A;  1PRT B;  3CHB D;  2HHH Q;  1GUW A;  4DR6 L;  5JEA H;  1G6Z A;  1F2L A;  2Z1C A;  2UUB Q;  3V96 A;  4A3E B;  4L5Q A;  1E2V A;  1ZYR D;  3VYS A;  1HNZ Q;  3CKI B;  1S5D D;  1I5F A;  2E2I H;  3EN2 A;  3ITP A;  1IKM A;  2R61 A;  2EIF A;  2R92 G;  4FVM A;  4AIM A;  2UXB L;  4IFD I;  2VUM H;  1U4L A;  3BVG A;  2PCF B;  1K83 H;  3EVQ A;  3CP0 A;  4P72 A;  4WJ3 M;  1CTM A;  1DCZ A;  4GKJ L;  2VB3 X;  4EGV A;  1OXU A;  1XPR A;  4ABN A;  1KC8 C;  2L12 A;  4RCO A;  2AMC B;  4R4O A;  4ZYS A;  1CZG A;  3SHL A;  4I7Z C;  3WDN A;  5HGT A;  4DV2 Q;  1Q1E A;  2K05 A;  2R6G A;  2I46 A;  3S1Q B;  3GTO B;  2OEO A;  3EQL C;  3S16 B;  4JBW A;  3K5L A;  3BS1 A;  4X64 Q;  1K3B C;  3S15 H;  2B3G A;  4H7B A;  1NUC A;  2PW5 A;  1S5C D;  4DF7 A;  4RFB A;  2ATW A;  1TS4 A;  3SXH A;  2O5I C;  1KLU D;  3F2U A;  1JT8 A;  1AEX A;  3OPO A;  4DUY Q;  1N34 L;  5IOC A;  5IE8 A;  4A3J H;  2JA7 G;  4A93 G;  3NXW A;  4QGU A;  4WRD A;  1N32 L;  3ERQ A;  5C4Z A;  1XNR L;  1IBM Q;  4B3S Q;  1XTC D;  2EY2 A;  3I70 A;  4R4T A;  2RVL A;  4WJW A;  5A2Q E;  2UUA Q;  1XMO Q;  4DXG A;  2A1A A;  4LFA Q;  3KOJ A;  4QMG A;  1A3V A;  4RWS C;  3HZX A;  3PO2 G;  2A6E D;  3JC6 6;  5JJK A;  2CFM A;  5JJL A;  5C44 G;  2E2J B;  2YU9 B;  1R9T B;  1VCI A;  1R4Q B;  5KYI A;  4A3F G;  1IHZ A;  1SN8 A;  1VQI A;  3UI2 A;  4ZKC B;  4QL5 A;  3BVM A;  1RDP D;  2WB1 E;  1BQQ T;  2DGY A;  2D0O A;  5FLM G;  4DR3 Q;  4FXK C;  4IUT A;  4YY3 Q;  4G7O C;  3G48 A;  2EVB A;  3GDE A;  3MXP A;  5HY6 A;  5BN3 A;  2VQF Q;  2VS1 A;  4JI8 L;  1A15 A;  1ESR A;  2B2V C;  4L5S A;  3T16 A;  3LWU A;  1II3 A;  2L9H A;  2OXP A;  3I7F A;  3HOW G;  4CHT B;  3E9I A;  2OQ0 A;  2H4O A;  4KD4 A;  4QUF A;  1O80 A;  4PQX A;  5EKK A;  4R8I A;  2NVT H;  1C0A A;  1SYG A;  1BO0 A;  1KAA A;  2F0I A;  3HP3 A;  2JA8 B;  3KLS X;  1GXD C;  2P5Z X;  3K5N A;  1CA6 A;  1PH8 A;  3RZO B;  1ENF A;  1NMG A;  1AE3 A;  3M3Y H;  5AJ3 L;  1K0R A;  3QO2 A;  2PQA A;  2PQA B;  4HMJ A;  2R93 G;  4K14 A;  1BKB A;  3FRP B;  2QEJ C;  1YVC A;  3JAM c;  1KTK A;  3IL8 A;  2UXC Q;  5IIF A;  4KY5 A;  3OHX C;  1B7Y B;  3S17 H;  2MUY A;  4DKA C;  3KJO A;  4ME5 A;  1EY0 A;  4H02 A;  1X65 A;  1Z9F A;  1VQG A;  1VQA A;  4JC0 A;  1U9R A;  4IPC A;  2KHS A;  2D5D A;  1D5X C;  2MNA A;  5BN4 A;  3UDX A;  1GVP A;  5C0X J;  4OIJ A;  1VQK A;  1K8A C;  3X3N A;  1ASY A;  5JEA G;  1G2T A;  1VQP A;  4HTH A;  3J81 i;  4YWK A;  2KA7 A;  2QDB A; 
#chains in the Genus database with same CATH homology
 3HOV B;  3OMC A;  1CZW A;  2ICE C;  2AWO A;  2C5C A;  5LL6 S;  5FO9 B;  4ID6 A;  4ZUI A;  1WTQ A;  4F8M A;  4H44 C;  2F0E A;  2M00 A;  1NAP A;  5IGB A;  5G3L D;  2NTS A;  4G7Z C;  2WII B;  3D6W A;  5E3F A;  3H91 A;  3M85 A;  3H94 A;  2B8F A;  1SFO B;  2ZXP A;  3GTQ B;  5C4X B;  2F1M A;  1PRT F;  5JJZ A;  2C9O A;  4DAV A;  1LO5 D;  2B2W C;  3MVV A;  1TY2 A;  3DM1 A;  2JP1 A;  1D2B A;  3MHB A;  2NVX B;  4CJ2 C;  1VMP A;  2I07 B;  1H9S B;  1H9S A;  2AWN A;  1B44 D;  3ND8 A;  1SAP A;  2K28 A;  4HCS A;  4A3D B;  2PO4 A;  2KED A;  3MWY W;  2JA6 B;  1BF4 A;  3SR1 A;  3NQT A;  2J4X A;  1G2S A;  3FPP A;  5NUC A;  2SEB D;  2IPK D;  4NW2 A;  3QG1 A;  2HCC A;  4V19 0;  1STY A;  2NBF A;  3AB9 A;  1Z47 A;  4IFD J;  1Y1V B;  3I4N B;  1I6V C;  4FP5 D;  3SK8 A;  4L8J A;  5BN5 A;  2VB2 X;  1BCP C;  5I9O A;  3T51 B;  1B9M A;  4DXF A;  1IL8 A;  2QIL A;  3RD4 A;  3EA6 A;  2XNA C;  1R4P B;  1NCV A;  5I2Y A;  1V8Q A;  4A3K B;  3GTK B;  4K8I A;  1F2M A;  3I72 A;  3DWP A;  4XYQ A;  2EJG C;  5M5W B;  2R7Z B;  1T5E A;  2ID0 A;  3KLR A;  5KGU A;  3PO3 B;  1F9Q A;  3PUZ A;  1KLG D;  3SEB A;  4KHZ A;  1CQF A;  1IW7 D;  1DOL A;  4U68 A;  3K57 A;  1KDB A;  1KNE A;  2BA1 A;  5LHY 1;  3MXN A;  1JWS D;  4NKL A;  3D4R A;  4H13 C;  2K04 A;  1SMY C;  3DEO A;  2BOS A;  3S1R B;  2WKD A;  3KUP A;  3KK7 A;  4NDX A;  3H3V C;  2E75 C;  3MC0 B;  1HPC A;  3PUY A;  5M3M B;  4PMW A;  1Y8N B;  3MA2 B;  3ERO A;  1YNN C;  4FO2 A;  2F0J A;  1TY0 A;  1A3T A;  1I6H B;  4KN4 C;  1EY4 A;  4IZ8 A;  1S5F D;  4A3M B;  4R9W A;  1SYF A;  1E2W A;  5A35 A;  3GTJ B;  5M5Y B;  2NVY B;  4KKS A;  5TSS A;  4OO1 H;  4K8J A;  1HFN A;  3J80 E;  2FJ2 A;  3RLF A;  5M9O A;  2EOT A;  2H1E A;  2ENB A;  2A5H A;  3J81 L;  1E2Z A;  3H6M A;  3I3C A;  1CI3 M;  1LTS D;  5ELF A;  4FF2 A;  4QF4 A;  2IX0 A;  1U4R A;  4DU9 A;  2NN6 H;  1I50 B;  1DD2 A;  3FVQ A;  5K36 G;  3NK9 A;  2NB0 A;  5CV7 A;  3PMF A;  2J0T D;  1SEB D;  3LNN A;  1CQV A;  4ZRZ A;  5IOD A;  2WV6 D;  5I9P A;  1TWC B;  1JE4 A;  4N9T A;  4JK1 C;  4A3B B;  1ONL A;  3S2H B;  1RTN A;  4X3S A;  3U9S A;  4MIU A;  1WCM B;  3HG9 A;  1EYA A;  1UUP A;  4TKO B;  2XWJ B;  1B3A A;  1SYE A;  5T1G A;  5FO7 B;  2F0N A;  1LTT D;  3TN2 A;  2LS0 1;  3NP8 A;  2MGS A;  2WKC A;  5FO8 B;  2Q8R E;  4BBR B;  1TWG B;  4KMU C;  2O2L D;  1I4Q A;  3IAY A;  1B50 A;  1GUN A;  3K0Y A;  3KBG A;  3EJI A;  3TME A;  1H9M A;  5FK9 C;  2XIW A;  2EYF A;  3EFX D;  5KRU A;  1AN8 A;  3C2P A;  2XRS D;  2VXW A;  5LL6 X;  2KEC A;  3M7N A;  1OXS C;  3O13 A;  5C0X H;  4EQO A;  1EY7 A;  2FMM A;  1EIH A;  1PRT C;  1AZQ A;  5EBC A;  5CR3 A;  3U9O A;  1I4G A;  2RQX A;  3MAQ A;  2A6H C;  5IGD A;  2R92 B;  2JEB I;  2K6A A;  2F4I A;  1LTG D;  1Q3L A;  1UAP A;  2MJ8 A;  2O4X A;  2AUJ D;  1O78 A;  2Q8T A;  2F0P A;  1EL0 A;  4S3S A;  2F0H A;  1W6J A;  2F0W A;  4OO1 G;  4PV1 C;  1SNP A;  4RKL A;  4C3J G;  4IUQ A;  1YNJ C;  1I4H A;  2LY7 A;  5JPN C;  1STG A;  3QWN A;  4C3I G;  4ODG A;  5DNF A;  1Q90 A;  1WTW A;  4XQQ A;  4EQN A;  2NYZ D;  4KD3 A;  2F0K A;  5IGE A;  2TSS A;  1T5X D;  2B2T A;  1EWH A;  1JOR A;  2RBM A;  1QWY A;  2F0L A;  4J6H A;  3R2T A;  5CV9 A;  5DM6 3;  4C56 C;  1C48 A;  2JA7 B;  4A93 B;  4Y7N B;  1PMR A;  3K6O A;  2K03 A;  1TS5 A;  1O7L A;  5M5X B;  4ZQ3 A;  1Q1B A;  2J7Z A;  3PO2 B;  3D6C A;  2JE6 I;  4IFD H;  1EY6 A;  3TSS A;  2B2Y A;  2ZXO A;  5C44 B;  4K5X A;  1RKN A;  4DK1 A;  4A3F B;  2E76 C;  4K2K A;  4BWG B;  3DWA A;  1PXU A;  1AW7 A;  3PIP 3;  5COY A;  2F0F A;  4K5V A;  4UDU C;  1KDC A;  4KN7 C;  4K6L A;  4QIW B;  2RA4 A;  3HOW B;  2EJF C;  1S5E D;  1TR5 A;  2XSC A;  5I6W A;  1LAB A;  5IT9 L;  2R93 B;  2B2U A;  4C2M B;  3CU7 A;  1S4Z A;  4NP5 A;  3GV3 A;  2DN8 A;  3HEJ A;  5C0X G;  2DNC A;  3D4D A;  1CA5 A;  4HED A;  3M7G A;  1SXT A;  2KJX A;  5K5P A;  2KOL A;  3PIO 3;  4B08 A;  3SVM A;  1LAC A;  4RHS A;  2IWH A;  3I4L A;  3N52 A;  1W6K A;  1HUM A;  2NWG A;  1JR0 D;  2BA0 A;  1GJX A;  1TWH B;  1STE A;  2EYO A;  3OWE B;  3GQB A;  3R8B A;  2NZ1 D;  1BCP D;  2N88 A;  4QCL A;  1PTO F;  3SK5 A;  4FF3 A;  3I91 A;  1Z6H A;  3TP6 A;  1DYQ A;  1SBB B;  5I2X A;  4HSV A;  3VR2 A;  1HTL D;  1B2T A;  4ZLT F;  3SK6 A;  1OXV A;  5CC4 A;  2EYM A;  3J7Y W;  2TMP A;  4DNR B;  4XT3 B;  2FIN B;  1DJR D;  2OT2 A;  3NPP A;  2F3W A;  2BE5 C;  2XN9 C;  3LX0 A;  1LTI D;  1UNS A;  5EKI A;  2K7V A;  3ONA B;  1J9O A;  1PFB A;  1TVX A;  3BYT B;  3FMC A;  2WAQ B;  4A3J B;  1CHP D;  5C3W A;  1K8M A;  4OHJ A;  3SDZ A;  4CBV A;  4B9X A;  3KLS A;  1TQO A;  3TZU A;  1HUN A;  5ELD A;  4CKC A;  2R3Z A;  4IFD G;  1SMY D;  4FXG C;  1EY5 A;  3VYT A;  1TII D;  1HTP A;  1NSN S;  2Y0S B;  2OF1 A;  3DEP A;  4K6D A;  1EWC A;  3BYY B;  1SE2 A;  1Y1W B;  4HR7 B;  1JOQ A;  3NBH A;  5J39 A;  1PLF A;  4XIG S;  1EU4 A;  1TKW B;  1YNN D;  4F88 A;  3S9W A;  1IYU A;  2M2L A;  3C46 A;  1UEA B;  1OO9 B;  1LT4 D;  3G6J B;  3DWQ A;  3MTS A;  4RCN A;  4J1M A;  4KK7 A;  1GUS A;  3NHH A;  4C3H G;  2EPB A;  3NTK A;  3PUX A;  5D65 A;  3A54 A;  5E1F A;  3NBI A;  3A8J E;  3BDO A;  3QOJ A;  4XQJ A;  2EY6 A;  4RHR A;  4FNF A;  1SNC A;  4ZKB B;  3J7A F;  3HS0 C;  2Z4I A;  3VA7 A;  5C6A A;  1RD9 D;  1QNU A;  1TS3 A;  3R2I A;  2RKS A;  4XDX A;  5EKL A;  5KNB A;  2PZW A;  3FKI B;  2XRQ D;  2B2W A;  4ZAI A;  2PQE A;  2L4N A;  2CW0 C;  1H9K A;  2D62 A;  2QCP X;  4I65 A;  2HDM A;  5C4H A;  4TRD A;  1MGS A;  5J1Z A;  5HUR A;  1GUO A;  1GUG A;  4PNY A;  2L1B A;  1D1I A;  1RF2 D;  1G91 A;  1QCB D;  2RDH A;  4QB4 A;  1O7Z A;  5COR A;  1TU2 B;  2X69 A;  5A2Q L;  2YYZ A;  4LMQ D;  2IX1 A;  3C1E A;  1ZKO A;  3DUZ A;  1ZEQ X;  3AU7 A;  4EQP A;  3PV0 A;  4HMI A;  4G7H C;  3NTH A;  4KI0 A;  1BCP B;  3QIA A;  2KCC A;  2K5Q A;  3T4A C;  3LWE A;  1AZP A;  4A3G B;  2EDG A;  5DEH A;  4H0L C;  3TP5 A;  1WD1 A;  5ELE A;  1ET6 A;  4KKT A;  2XWB B;  1O7Y A;  4IUV A;  2F0S A;  3HRZ C;  2EZV A;  3P75 A;  3HOU B;  3MEH A;  4XTC S;  2IX3 A;  1EY8 A;  3GP7 A;  5CBA E;  2ZT9 C;  3VA5 A;  1PRT D;  3P7J A;  2WIN B;  4G57 A;  1KDA A;  5CV5 A;  5CV8 A;  1A2T A;  2A6H D;  2A68 C;  3H09 A;  3TP8 A;  3P20 A;  4IUU A;  2CHB D;  4KJN A;  1LLR D;  1DXM A;  1JB3 A;  4PMC A;  5FLX E;  5AFW A;  1CM9 A;  3Q0A A;  2MP1 A;  2FHT A;  1WTO A;  2L55 A;  2G9D A;  2JSO A;  2AUK A;  1PTO H;  1K8O A;  1S5B D;  4TQU S;  2DY8 A;  1D5Z C;  1HA5 A;  2K33 A;  5ISR A;  1YNJ D;  1GUT A;  2SNS A;  2WB1 B;  1SND A;  2DNE A;  4DK0 A;  2F0Q A;  1HQM C;  2ICI A;  4C1N K;  1GHK A;  2A69 D;  3BZD B;  2F0D A;  1PTO C;  1FD7 D;  4RGN A;  4Q5V A;  1TWA B;  1C4Q A;  3D31 A;  5D14 A;  1EOT A;  4B9W A;  2FFK B;  1B4O A;  1D1K A;  1OXT A;  5KYL A;  3S1N B;  3NTI A;  3HOX B;  1Y8O B;  4KJO A;  3PUW A;  2RSO A;  5D3I B;  3J7A V;  3N6R A;  3BG3 A;  5E4W C;  3VR5 A;  2F0M A;  1GHJ A;  3OIP A;  3D3R A;  3TP7 A;  3GTG B;  3K59 A;  4CJ1 B;  1BR9 A;  1F9P A;  1SDF A;  2WAC A;  2SOB A;  3NSW A;  2EE1 A;  2PZT A;  1BDO A;  4C3J B;  2NVQ B;  1L0Y B;  2Z4H A;  3VR3 A;  4C3I B;  3FPU B;  5C0X I;  2MPM A;  4XXE A;  1ML0 D;  4G4K A;  4XQN A;  4KKU A;  2EJM A;  3GTM B;  1G29 1;  2EY1 A;  5J22 A;  1LV9 A;  3AMU A;  3OSO A;  4WOR A;  1C8C A;  2SNM A;  4ILW A;  1PFM A;  3T53 B;  1SSO A;  5KND A;  4KY7 A;  1ESF A;  1H9R A;  1HA6 A;  4IQZ A;  2IJ0 A;  3Q24 A;  4FYD A;  2AQ1 B;  4HCE A;  3GTP B;  4CKE A;  4L6T B;  3PUV A;  1D5M C;  4BA1 I;  1A6X A;  4WFN 3;  1QE6 A;  5JAV A;  1SE4 A;  2M9V A;  4RGM A;  3I90 A;  1QIL A;  3OW7 A;  2X6L A;  1MSH A;  5KIX A;  1SJE D;  1KNA A;  2KEE A;  1WTV A;  4F87 A;  2K01 A;  3T56 B;  4RA8 A;  1PZI D;  2NUC A;  5FKA C;  1SYC A;  1PZJ D;  2A69 C;  4Z9C B;  3C1F A;  1V1O A;  2NN6 G;  5ELC A;  5C3E B;  1B1Z A;  4KHV A;  2BE5 D;  2B2U C;  1BNZ A;  2GA4 B;  4RGT A;  1FNV A;  3TDQ A;  2HUG A;  3A8K E;  1H9J A;  1BXT A;  3L3O C;  5KNC A;  2AQ3 B;  4IN3 A;  5G3L F;  1OXX K;  3A8I E;  4HAE A;  1SJH D;  5E4X A;  5EJW A;  5I6Y A;  4BBS B;  3RZD B;  1GOZ A;  1HXY D;  4KV6 A;  3V05 A;  4ZUJ A;  4DAY A;  4KY6 A;  3A7L A;  3IFT A;  3URY A;  2EYJ A;  1NR4 A;  4LAA A;  4RH6 A;  1HCZ A;  4CJ0 B;  2AQ2 B;  2HQE A;  3C3L A;  2IW3 A;  4R8N A;  1U4P A;  2DY7 A;  2SDF A;  3J80 L;  5FLX L;  3IKJ A;  1XYI A;  3ND9 A;  1RCV D;  4ULL A;  5FOB B;  3QJY A;  3HOY B;  5D3D A;  2E2H B;  2RDF A;  3QB3 A;  4LK1 C;  1QJO A;  3GTL B;  2K5W A;  3K58 A;  3GO5 A;  4OL7 A;  5CBE E;  2JEA I;  1DON A;  2A74 C;  2VNU D;  5IGF A;  5DM7 3;  4FF1 A;  1M8A A;  1A3U A;  2B8G A;  2O5J C;  3V2T A;  1TS2 A;  1FR3 A;  1NR2 A;  1JOK A;  3OIQ A;  2E2I B;  1V43 A;  2F0U A;  2BCO A;  4AYB B;  2NTT A;  2VUM B;  1K83 B;  2B63 B;  4X3T A;  1DZ1 A;  1EU3 A;  3L9A X;  1DM0 B;  2F0O A;  4CGY B;  3SK4 A;  4P2C B;  1QB5 D;  1ZXT A;  3MXG A;  1I4P A;  1EQT A;  3NE5 B;  2L5T A;  3S1M B;  3S15 B;  1FNU A;  2KQ3 A;  2D9U A;  1L0X B;  3JAM E;  1EEI D;  2CW0 D;  2F3V A;  5CV4 A;  4RGO S;  1EYC A;  5CGK A;  2LKV A;  2MHV A;  1ZYR C;  1I4R A;  2A73 B;  4LJZ C;  1JWM D;  3MFG A;  1J8I A;  1MD2 D;  1CHQ D;  1AP0 A;  3DXJ C;  2LFN A;  3G7L A;  1XX8 A;  2F0V A;  3J81 E;  4A3I B;  1ILP A;  1WVL A;  4J8Q A;  1U4M A;  2B2V A;  1SNM A;  1FNW A;  4C3H B;  5C3X A;  4YIJ A;  1ENA A;  5F2D A;  2XVS A;  1STA A;  3E0J A;  2L0C A;  4RAU C;  5JVH 3;  5I4D A;  2PYK A;  3TZD A;  1VDZ A;  2X6G A;  3TBI B;  2EYL A;  1ILQ A;  1ENC A;  1PYW D;  5IGG A;  1JOO A;  2K32 A;  1QOH A;  2D2C C;  1VF5 C;  4XT1 B;  1B53 A;  4O1N A;  4FXD A;  2PNR C;  2NVT B;  1LT3 D;  4E6I A;  3M3Y B;  5JEA J;  1XXG A;  1PFN A;  1JIC A;  3NUC A;  3S17 B;  2A6E C;  1PDQ A;  2A68 D;  3A56 A;  1LTR D;  2HCI A;  3OOC A;  1HQR D;  2KVM A;  3I8Z A;  1I4X A;  4OIK A;  2IL8 A;  3NQI A;  3BVZ A;  1EQV A;  1FYC A;  3D8G A;  3VYU A;  1MBY A;  4BY7 B;  1LT6 D;  4HN7 A;  3Q22 A;  3P1H A;  2QKI C;  4C1N I;  5CMD A;  5EGT A;  1QNK A;  1MI2 A;  4DFA A;  3A7A B;  5K36 H;  4BY1 B;  3K7A B;  1EY9 A;  1E0B A;  1SE3 A;  1VF7 A;  1QG7 A;  1F2Z A;  1PTO D;  1KAB A;  1X3P A;  1ROD A;  2ZXR A;  4QUC A;  3R93 A;  3Q23 A;  3HGB A;  1STN A;  3M4O B;  4X3K A;  3S2D B;  5EPJ A;  3E5S A;  1MSG A;  1F9S A;  3M4Y A;  1EIG A;  3VR4 A;  4L63 B;  3D4W A;  3WOF A;  1HHV A;  5JPM C;  1WTP A;  1RJT A;  2LMC B;  4MHE A;  2EXZ A;  2WP8 J;  4EVO A;  1DOK A;  4GZY C;  3RMH A;  4DA2 A;  2EYP A;  2RSN A;  3CRL C;  1Y69 U;  4DAP A;  1M4V A;  2FMC A;  4V0B A;  3IFD A;  1RHP A;  4OGQ C;  1BBX C;  3HKZ B;  5JOB A;  3L7Z C;  5JVG 3;  4DNT B;  1EZ8 A;  3QOL A;  3CRK C;  3Q6S A;  1IYV A;  2QF7 A;  2IT1 A;  4X3U A;  1IKL A;  1EFI D;  4DN4 M;  3K5O A;  2EY5 A;  1SNO A;  4M1U B;  3FEW X;  4HSP A;  4OO1 I;  2BDO A;  3VR6 A;  4CKB A;  4O42 A;  3VYR A;  3JAM L;  1FGB D;  4K5W A;  5DAU A;  1STB A;  2KUM A;  1TT2 A;  1XWE A;  3CQZ B;  2JXM B;  2JA5 B;  2BDN A;  4ZK9 B;  3BDC A;  4IAL A;  3A55 A;  1JC7 A;  1AFP A;  2RDG A;  3GV6 A;  1PZK D;  1F2Y A;  2JYO A;  3OMG A;  2N55 A;  5IT9 E;  2NN6 I;  2PMZ B;  4NMZ A;  4UAI A;  2CVR A;  2Z8L A;  3BDL A;  2E2D C;  4BA2 I;  2G9H D;  3NWS A;  5ELB A;  3HOZ B;  2V4D A;  2F0G A;  3W3A A;  3GD7 A;  2PW7 A;  5CYU A;  4IUN A;  2F03 A;  1STH A;  1ET9 A;  4MN3 A;  1LTA D;  3I73 A;  3MZ5 A;  4DGZ A;  3RUZ A;  4PMB A;  1EZ6 A;  3DHQ A;  4K2L A;  2L11 A;  3DMU A;  1Q8I A;  2B39 A;  1SYB A;  2PZU A;  1CT1 D;  3K5M A;  1IW7 C;  2EYH A;  1DOM A;  4FF4 A;  1TWF B;  4N9P A;  3R3O A;  1EYD A;  1SYD A;  1X3Q A;  3E6Z X;  4BS9 A;  2F0T A;  3H0G B;  5KEE A;  4RKB A;  3W2D A;  5C5M A;  3WOE A;  3KBX A;  5C5L A;  1X32 A;  4KTA A;  1HRJ A;  1HFG A;  3FDT A;  1JWU D;  1JCK B;  1LT5 D;  1Y8P B;  1ICW A;  1RTO A;  1PTO B;  5EQ0 A;  2B2T C;  1JQY D;  4U67 3;  2E74 C;  1EEF D;  1F9R A;  2HDL A;  2Q8I B;  5C4J B;  3MXU A;  1SNQ A;  1D6E C;  1LTB D;  1WTX A;  2KCN A;  4XYO A;  3T13 A;  1I3Q B;  3I4M B;  5EPK A;  5CV6 A;  3ZYY X;  3KF8 A;  1BCP F;  5EBD A;  3MFY A;  2K1B A;  2B2Y C;  1WTR A;  1A2U A;  5IGC A;  4IUR A;  3OWF A;  1Z7T A;  5EPL A;  5T1I A;  4F7X A;  2CQA A;  3SE0 A;  1F77 A;  1WD0 A;  2K5D A;  4TSS A;  1CFM A;  4IUP A;  1V1P A;  1V1P B;  5M3F B;  1BOS A;  4M8A A;  4Q0F A;  1B9N A;  1G8Z D;  1CK1 A;  1BUV T;  1Q12 A;  1VMC A;  3X3M A;  2PPB C;  3S14 B;  3NWT A;  1PRT B;  3CHB D;  1GUW A;  5JEA H;  1G6Z A;  1F2L A;  2Z1C A;  3V96 A;  4A3E B;  1E2V A;  1ZYR D;  3VYS A;  3CKI B;  1S5D D;  1IKM A;  3ITP A;  2R61 A;  4FVM A;  4IFD I;  1U4L A;  3BVG A;  2PCF B;  3EVQ A;  1CTM A;  1DCZ A;  2VB3 X;  4EGV A;  1OXU A;  4ABN A;  2L12 A;  4RCO A;  4ZYS A;  1CZG A;  3SHL A;  4I7Z C;  3WDN A;  5HGT A;  1Q1E A;  2K05 A;  2R6G A;  2I46 A;  3S1Q B;  3GTO B;  2OEO A;  3EQL C;  3S16 B;  4JBW A;  3K5L A;  3BS1 A;  4H7B A;  1NUC A;  2PW5 A;  1S5C D;  4DF7 A;  4RFB A;  1TS4 A;  3SXH A;  2O5I C;  1KLU D;  3F2U A;  1AEX A;  3OPO A;  5IOC A;  3NXW A;  4WRD A;  3ERQ A;  5C4Z A;  1XTC D;  2EY2 A;  3I70 A;  2RVL A;  4WJW A;  5A2Q E;  4DXG A;  4QMG A;  1A3V A;  4RWS C;  3HZX A;  2A6E D;  2E2J B;  2YU9 B;  1R9T B;  1VCI A;  1R4Q B;  5KYI A;  1IHZ A;  4ZKC B;  3UI2 A;  3BVM A;  1RDP D;  1BQQ T;  4FXK C;  4IUT A;  4G7O C;  2EVB A;  3MXP A;  5BN3 A;  1A15 A;  1ESR A;  2B2V C;  3T16 A;  3LWU A;  1II3 A;  2L9H A;  2OXP A;  4CHT B;  2H4O A;  4KD4 A;  4QUF A;  1O80 A;  4PQX A;  5EKK A;  4R8I A;  1SYG A;  1BO0 A;  1KAA A;  2F0I A;  3HP3 A;  2JA8 B;  3KLS X;  1GXD C;  3K5N A;  1CA6 A;  3RZO B;  1ENF A;  3QO2 A;  4HMJ A;  4K14 A;  3FRP B;  2QEJ C;  1KTK A;  3IL8 A;  5IIF A;  4KY5 A;  3OHX C;  2MUY A;  4ME5 A;  1EY0 A;  1U9R A;  2KHS A;  2D5D A;  1D5X C;  5BN4 A;  5C0X J;  4OIJ A;  3X3N A;  5JEA G;  1G2T A;  4HTH A;  2KA7 A;  2QDB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...