5HGTA

Crystal structure of staphylococcal nuclease variant delta+phs l25k/i92t at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKKMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYTYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS L25K/I92T at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5hgtA00
3OWFA 3TP7A 4KJNA 2F0LA 3ERQA 4RKBA 1EY7A 5KYIA 2RDFA 2RKSA 4KV6A 2EY1A 5E1FA 5C5LA 5DEHA 4PMBA 4KHVA 4NKLA 1KAAA 2PQEA 1EY4A 3P1HA 3SR1A 1EYAA 2HQEA 3TP6A 4S3SA 1A3TA 2EYJA 1SNMA 4MIUA 1JOQA 1KDAA 1EY8A 1A3VA 2PW7A 3MEHA 4J1MA 4K14A 3SK8A 1F2MA 5C4HA 2F0JA 5I9OA 1EY5A 5IOCA 3OSOA 3NHHA 2LKVA 1SNOA 5CR3A 4IZ8A 5J22A 2EYPA 3DMUA 5DAUA 4HMJA 5CV6A 4IALA 4K8IA 1II3A 5I6YA 5J1ZA 4WORA 3SK6A 4K2LA 3QB3A 5C3WA 5JAVA 1A2UA 1AEXA 3T16A 4NP5A 4K8JA 3RUZA 3QOJA 3C1FA 3D6CA 5IGFA 3E5SA 3D4DA 4K6DA 5CV5A 3T13A 1U9RA 5I6WA 3TP8A 1KDCA 5HGTA 1F2ZA 3HZXA 4LAAA 2F0SA 5KIXA 3MVVA 4N9TA 4QF4A 2OXPA 1TR5A 2OF1A 5NUCA 4EVOA 1EZ6A 5CV4A 1JORA 3EVQA 4B9WA 2F0FA 4QMGA 5JOBA 2SOBA 4PNYA 3V2TA 1A3UA 2F0DA 2QDBA 4F8MA 5IODA 1STGA 4ZUJA 4I65A 5IGGA 4G57A 5IGDA 1KDBA 5EGTA 3SXHA 1STHA 2F0PA 4OL7A 2OEOA 4QB4A 4KD3A 2EY6A 4ME5A 1TQOA 5CV9A 5CV8A 3TMEA 2RBMA 4EQPA 5CGKA 4KY5A 4RKLA 1SYGA 2EYLA 4KY6A 4NDXA 2F0QA 1SNDA 4HTHA 4DFAA 2WACA 2F0EA 4PMCA 5EKLA 3SK4A 4N9PA 2F3VA 5CC4A 3OMCA 3C1EA 3SK5A 3LX0A 3MXPA 4ODGA 3NXWA 1A2TA 5J39A 3HEJA 5IGCA 4R8NA 2PZWA 4KTAA 1EQVA 4E6IA 4EQOA 5IGEA 4DGZA 3H6MA 5C6AA 2O4XA 3D4WA 4EQNA 2NUCA 1EY9A 1SYEA 1STBA 1JOOA 4K2KA 3NP8A 4KD4A 3TP5A 4J6HA 2F0NA 5ISRA 3R3OA 5EKKA 2F0UA 3U9OA 4B9XA 5KRUA 1SYBA 2KQ3A 2PZUA 3EROA 3S9WA 4H7BA 4HMIA 5CV7A 3VA5A 2F0VA 3DHQA 2EYMA 3MHBA 5IGBA 1SYDA 1EZ8A 1EYCA 5E3FA 2ENBA 1EY0A 2F0GA 2EY5A 3BDCA 2F0MA 4KJOA 5IIFA 2EY2A 4ZQ3A 5C3XA 1EYDA 5C4ZA 5K5PA 2EYOA 4NMZA 1IHZA 4ZUIA 5KEEA 2PW5A 2SNMA 2F0IA 2F0HA 3ITPA 5F2DA 2EYHA 1ENAA 1EY6A 4TRDA 5KGUA 3D8GA 3EJIA 3MZ5A 5I9PA 4K5VA 1NSNS 1SNCA 4DU9A 1F2YA 1TT2A 4K5XA 4KY7A 4DF7A 4IUNA 2F0TA 1SYFA 1STNA 1STAA 3SHLA 4K5WA 1STYA 2F0KA 2PZTA 4WRDA 1SNPA 2F0OA 2SNSA 1SNQA 3NK9A 2EYFA 2EXZA 3NQTA 1NUCA 3NUCA 3QOLA 4F7XA 2PYKA 5HURA 3BDLA 2F3WA 1ENCA 3P75A 5KYLA 1RKNA 2F0WA 3PMFA 1KABA 3OMGA 1JOKA 4ID6A 2KHSA 4YIJA 5M9OA 5C5MA 2M00A 1SYCA
chains in the Genus database with same CATH superfamily
1W3SA 1NBWA 4FNFA 4CDCC 1PTOF 4YHHL 1T9HA 2EY1A 2ZTCA 4M1UB 1AZPA 3JAML 2PQEA 5E4XA 3LGJA 1DGSA 4GN4B 1LTID 5DLQE 2CVRA 3UDIA 1KDAA 2AQ2B 2ICIA 3SK8A 5IOCA 4BY1B 3GTJH 3GTLB 2Y0SB 1FVIA 4XTCS 1PTOD 1C7YA 4ABNA 2IL8A 3HOYH 4DXGA 4MHEA 3QB3A 4C3JH 3BZCA 5C4XH 5C44B 5AJ3L 1ZXTA 1Q1BA 1TS3A 2CH4A 1P8LA 3HZXA 4GLXA 4DV1L 3GV6A 1LTTD 3ERSX 3EVQA 3HKZB 1B9MA 1V1PA 3C46A 1XXGA 5GAHC 4QY7A 1IW7D 1STGA 1VQHA 4XQQA 4I7ZC 4Y7NH 4KD3A 4GKJL 1NR2A 5JJIA 1DCZA 3TQYA 2EJGC 3RLNA 2BOSA 1YITA 3T1HQ 4H13C 5J39A 4KN7C 2JJQA 3SVMA 2C35B 4JI2Q 4LF5L 3CKIB 1PRTC 3VR2A 5LMNQ 1STBA 2K6AA 3TP5A 2LMCB 1D1IA 1CZGA 3A8KE 4XT3B 1HR0Q 1GUWA 5FLXL 1PZKD 4FXKC 4CKBA 2ENBA 5C3EB 2ATWA 4ZQ3A 1VMCA 5FLXE 3MTSA 1KNAA 4DAVA 3JAMc 1JE4A 3N6RA 3D8GA 1G8ZD 1GUNA 1Y14B 5JPNC 1F2YA 1RD9D 4RCOA 4IUNA 2Q8TA 1FJGL 1STNA 4UP7A 5M3MB 3EIVA 1KNEA 3S1QB 4A93B 1CM9A 3IL8A 1MKHA 4DV1Q 1VQ8A 2BDOA 4YWMA 4DR3Q 2ZT9C 3CD6A 5IP7G 5JJKA 4C2MH 1M1KC 2GVBA 3WOEA 1HNZL 3KDFA 1YJWA 4GKJQ 1D6EC 3E0JA 1HFNA 1X3FA 2L11A 1L0XB 4FO2A 1Y8NB 3CMAA 4BY7B 1QNKA 4K14A 1I3QB 2L1BA 3OSOA 4Q0FA 2MGSA 4EX5A 1EOTA 2I5LX 3U4ZA 4LF5Q 3TRZA 1GJXA 4JPBW 3T16A 2D0OA 4A3BB 3K5NA 1TVXA 1YNXA 3BZKA 3E0EA 3KF6A 3MAQA 1I6HB 1STEA 5CV5A 3CQZH 1VCIA 5M5WB 2JK8A 1UE7A 1DM0B 2R3ZA 1UEBA 1AFPA 4JI1L 1EEID 1KLGD 2AQ3B 2B8GA 2JA6H 1YBYA 1H9SA 1SFOB 1KDBA 3VR4A 3CC2A 1HA5A 4QB4A 4OHJA 5JVG3 5FLXc 1EIYB 5K36H 1OXXK 3VA7A 1GUSA 4IFDI 1VQLA 1H95A 4FF3A 4ZCKA 4LMQD 3H91A 3I4NH 2DNEA 1SMYC 3D4WA 2A1AA 1GXDC 1K8MA 5EBCA 3J7A5 4A4IA 3OYYA 4KD4A 3N52A 3M7GA 4JW0A 1Q7YC 2JA8G 3AMUA 3GTKH 5IP9G 4OX9Q 3GV3A 3PUZA 1EQRA 5IIFA 2WKDA 4O42A 5JEAG 1UUPA 5JVH3 4TKOB 2FMMA 3I4MH 3PO2H 2A74C 1WTOA 4OEMB 1L1OB 3Q0AA 4A3KG 1QUQA 4B3TL 1TIID 1WD1A 4G7OC 5HGQA 4RGOS 4RGMA 2K5VA 2R93H 1AW7A 1E7ZA 1TWGH 4CJ0B 2FXQA 2F4IA 1I4PA 1JOKA 3OMGA 2KHSA 4ZLTF 2K32A 4K0KQ 1BCPB 2H5XA 3HOZH 1PYBA 4DR2Q 4BBSB 2L55A 2RDFA 1VQ5A 1FL0A 2JXMB 2UXDL 5COYA 1SLJA 2XIWA 1CK1A 3HOVG 2AHOB 4LF6L 3S16H 2WB1B 4IJLA 1JJGA 3MXNA 4KI0A 2HQEA 2I5HA 5M5YH 2KCCA 1WTQA 5I9OA 3KJPA 5KNDA 1XMQL 5EKIA 2JA5H 1HZ9A 3OHXC 1A2UA 3FKIB 1DONA 4YWLA 3NTIA 2B2TC 4GKKQ 2L9HA 4DKAC 4A3FH 1PH8A 1JE5A 2RQXA 3H0GG 1E2VA 5C0XG 1H9MA 2VW9A 1G6ZA 1P16A 2F0DA 4DV5Q 1J6QA 5IODA 5IGDA 1C48A 3PF5A 2IT1A 3RZOH 2F0PA 4OO1I 2DGYA 2A5HA 4DV6L 1Z7TA 2R92B 3UDXA 1L2FA 3M3YH 2XVSA 1QWYA 1TWFH 3S2DH 1WCMG 2B2UC 3I4LA 3SK5A 1HA6A 5EJWA 4DR6Q 2E2HB 1RDPD 1XYIA 1OXUA 4B3MQ 2GA4B 1LLRD 1JB3A 4BBRG 2XN9C 1B2TA 5TSSA 2E2IH 4PQXA 4ZK9B 5IWAL 2HCIA 1SBBB 1EYCA 4A3DB 2EY5A 3IAYA 4R1JA 1X55A 5CORA 1HFGA 4MZ9A 5GAEC 3S15B 1EWCA 3OIQA 1SMXA 2CFMA 2F0HA 3SEBA 3PIP3 2NVYH 4HJ5A 1ZKOA 4KKTA 4C3HG 4A75A 1TT2A 1S4ZA 2F0TA 1SYFA 3PCOB 4QJFA 4WRDA 1BCPF 3CCUA 1HNWQ 1SNQA 4FF4A 1YHQA 1RKNA 2M9VA 3AFQA 5M3FH 3GTQH 4CKCA 3J7AV 4RGTA 4A3JH 1N34Q 2RSOA 4DAYA 4UHVA 1FNWA 1U4RA 3S17B 1BCPD 5GADC 3P1HA 4DV6Q 2B63G 1EU3A 1X3QA 3TP6A 2IHFA 1R4QB 1JOQA 5CBEE 3HOWB 1FGBD 1A15A 1ONLA 5L37A 3BVMA 3A8JE 5CV6A 4IPCA 3ULJA 3O13A 1JMCA 1VQAA 4F87A 1Y1VB 3PUXA 4KKSA 1X6OA 3H15A 1L0YB 4HN7A 4N9TA 4BS9A 2ZM6L 2E2DC 2B2VA 2UUAL 1J5EL 2XGTA 1MHWC 2IX1A 1QJOA 3DWAA 1Q8IA 3RZDH 1AE3A 4KLKA 4LF9L 2DJGC 2EYLA 3UE1A 5I2XA 4BY1G 4PMCA 5ELDA 1ML0D 2Y0SG 3DWPA 5CC4A 3HOXB 2G9HD 1A2TA 5IGCA 2Z4IA 4R8NA 2Q2TA 1IW7C 4E6IA 5C44G 1E0BA 4HSPA 3JC66 1U0LA 3M4PA 3HKZG 1WTVA 1MJCA 3H3VC 1BNZA 1HTPA 1BKBA 4JI4L 1D5ZC 1UE6A 2EYOA 1PYSB 1UAPA 5KEEA 3HKSA 4KHZA 2EPBA 3GTOH 1UEAB 1BUVT 5LMUQ 3Q22A 1X54A 4PZ8A 4DF7A 4LWCA 2Y0SE 1STAA 4L5QA 1QNUA 3GTPB 1R9TH 1K3RA 4A3GG 1JJ2A 2PYKA 1N36L 4XIGS 1NTGA 3CF5A 4HIOA 1UE5A 1GVPA 1N32L 2UUAQ 2EOTA 1YJ9A 1J5EQ 3J80i 1SN8A 1I94L 1BQQT 2RKSA 1LT5D 2MP1A 4N8X1 2UUBQ 2NVQH 1CI3M 4PMBA 1HNXL 3CAMA 3HKZE 2QDLA 5C3EG 2AQ1B 1WOCA 2ID0A 4X64Q 2AKWB 2QEXA 4LFCL 4HR7B 3K6OA 2EYJA 1PFMA 1SR3A 1TS5A 4UP9A 4HIMA 1D5XC 1EY5A 5IYBG 2KEDA 3DMUA 2EQSA 4RWSC 4GNXC 4K8IA 4DV3L 5M3MG 3GTGB 5J1ZA 2VQEL 1QZGA 1CFMA 4A93G 1B1ZA 1SRUA 5C3WA 1AEXA 1TWAB 4OELB 3I2ZA 4B3RQ 3D6CA 3D4DA 4A76A 5D3DA 5E4WC 2KCMA 5FO9B 4YY3L 3ULPA 3VYTA 2HHHQ 3L0OA 1PH4A 2K5NA 5DNFA 2Z6KC 1LTRD 4DK3C 2IJ0A 3OOCA 1A3UA 4C1NK 5IP7H 4QUFA 3SXHA 3MFYA 2CQOA 4BA2I 5CV8A 1HZCA 3OTOQ 1YJNA 3NWSA 1VQ4A 2RHSB 1CSPA 5GROA 5EKLA 3SK4A 4IURA 3VR3A 4GN3B 1I4GA 3DWQA 3S17H 2YTVA 1HQMC 4P2CB 1CZWA 3MXUA 1YNND 2KOLA 4DV7Q 1B7YB 3J7AF 1N32Q 3ND8A 4A3BG 3BU2A 3H6MA 5FOBB 5C6AA 2O4XA 5FO8B 1XMOL 2NUCA 1Q82C 2NTTA 4I7AA 1YIJA 2KA7A 3R3OA 3X3MA 1EFWA 4HJ7A 4XDXA 2BA0A 1LYLA 5IGBA 1LTAD 3BZDB 1QE6A 1BBXC 5K5PA 4FYDA 3CRKC 4ILWA 4FDBA 1A8VA 4KK7A 4GOPC 2JA9A 2C9OA 2SNMA 2R61A 1WTHA 1TWCB 4DV3Q 5KNBA 3FEWX 1NSNS 2QF7A 4K5VA 2VQEQ 1TWHH 2YTYA 1V1QA 5T1GA 3I55A 3BVGA 3X3NA 1JT8A 4A3LG 1BOSA 4DR1L 2EXZA 3A55A 3D3RA 4F7XA 3QOLA 3WDNA 5C4JB 4DA2A 1PV4A 4QL5A 2M2LA 3Q24A 2J7ZA 1DYQA 1GOZA 2NBFA 3U4VA 1EY7A 1X56A 4YCVA 1DOMA 2JA8H 3DM3A 2K04A 2MJ8A 1KLUD 2OT2A 3I56A 5IP9H 4F88A 2EZVA 1EWHA 1HJPA 2NVTB 2YU9H 3ZJYC 2OTLA 1EY8A 1A62A 4IO9A 5JEAH 4EQ5A 3S14B 1S40A 2ZTDA 3AEVA 4IZ8A 4V0BA 5DAUA 3F2UA 4GNXB 3F8TA 1JC7A 4PMWA 3OWEB 4YCUA 4LF7Q 3PUVA 1XMOQ 1HCZA 3L7ZC 4KHPQ 2B2WA 4X3SA 4A3KH 1VQ6A 3S1MB 1XTCD 1IBKL 5IGFA 1CT1D 1LT6D 3KFUA 4DR7L 4BBSG 3IFDA 4LFBQ 2CWAA 1MSGA 2EJFC 3JAME 1I6VC 2WB1G 4ZUJA 5IGGA 1STHA 1B53A 3HOVH 1TQOA 3NTKA 3VR5A 3EN2A 2MHVA 4KY5A 1FNUA 2WIIB 4TVAB 1KHIA 1QZHA 4DR1Q 3R93A 1WJJA 3LX0A 4JYAL 1T5XD 4IQZA 1SAPA 1D5MC 4H0LC 4OGQC 3A8IE 4X6AH 1HZBA 3FKIG 1KXLA 2Q8IB 3NPPA 2HCCA 1DZ1A 4AQYL 1EY9A 2DUDA 1TS4A 3HOUB 4FP5D 1K3BC 2PMZB 4JBMA 2PZUA 3EROA 4H7BA 2IPKD 1K83B 1LTGD 3VA5A 5LHY1 5D14A 3LWEA 1SYDA 2E76C 3H0GH 1HXYD 3FHWA 3F2CA 5C0XH 4DV4L 1PA6A 3EQLC 4GOPB 5CMDA 3M9BA 1HUNA 2F4VQ 2WB1E 1VQIA 3ITPA 4RHSA 2R92G 2PO4A 1PTOH 1V1OA 4A3GB 5H1SE 1PFBA 3SHLA 4IUQA 4QGUA 3NK9A 4YHHQ 5T1IA 3NQTA 1NUCA 1WCMH 3VYSA 3PO3B 4DR7Q 1MIUA 2XSCA 3D31A 2HQLA 3K57A 3NBHB 2PNHA 1C8CA 3W3AA 4JK1C 1EQQA 2A6HC 4DUZL 2D9UA 5GAGC 1HQRD 2ICEC 4WJ4A 5FJ8G 2JEAI 4BBRH 4A3DG 1XNQL 2D0PA 3W1BA 4X3UA 2RA4A 4X62L 1L1OC 2K5QA 3D0FA 4POGA 2BCOA 1HH2P 1YZ6A 2KVMA 5EPKA 5AJ3Q 2L15A 4NB3A 5BR8L 1AE2A 2MUYA 4IFDJ 4A3EB 3T1YL 1IBML 3J81j 4C3HH 1BCPC 1QVFA 1VQKA 1X3GA 1D2BA 2KCTA 2UXCL 2AWNA 3ND9A 3A7AB 1NR4A 1F9PA 1VQEA 4GZYC 1HPCA 2NZ1D 3BJUA 4QIWB 2EDGA 2QDBA 1HTLD 4DUYL 4I65A 2OEOA 4ME5A 3TREA 4FXDA 4RKLA 4DFAA 3HOWG 2B63H 3C1EA 1OO9B 1QB5D 3FRPB 4NPSA 3PSIA 4OIJA 4ODGA 3HEJA 4HSVA 4CDFC 4ZYSA 1L1OA 4YWKA 1MJEA 2XRQD 1I4HA 1YVCA 3JAMi 4DUZQ 1B4OA 1PFNA 5ELOA 1Y1VG 2N88A 4DR5L 2JA7B 2R7ZH 2B2YC 1RF2D 3NTHA 2NVXH 2HIVA 4JOIC 2HD3A 1XNQQ 3A0JA 1E22A 3DEPA 4A3MB 2K28A 5ELNA 2EYMA 4X62Q 1K73C 1H9RA 2R6GA 3J7ZC 1FJGQ 3T53B 1BR9A 3K5MA 2PW5A 1K0SA 3U9SA 1Z47A 1IYJB 2MO0A 4O0AA 2Q8RE 1SE8A 2HDMA 3WOFA 3HOXG 3PIPA 3T1YQ 1UE1A 5JPMC 1CKNB 2E75C 4BY1H 1PZID 5KNCA 3GTLH 5M5XB 2SNSA 3M4OB 2EYFA 1V8QA 1PLFA 2RDGA 4R4OA 1HNZQ 3G4SA 2F0WA 5FLMG 2E2JB 3RLFA 5ISRA 3TP7A 3S2HB 1H9KA 5C44H 3GTMB 3NQIA 2JE6I 2E74C 5BN4A 4G4KA 5E1FA 4FF2A 4KHVA 3CCJA 4H44C 1KRTA 1KAAA 2Q2HA 4UP8A 3KUPA 1LTLA 1R4PB 2KECA 2L12A 3PUWA 4U68A 4S3SA 4PV1C 1CHPD 1F2MA 5GQOA 2BE5D 1Q12A 2MPMA 1O78A 1SNOA 4RAUC 2MNAA 3GD7A 3IKJA 4B3SL 4IOAA 2Z9HA 1FD7D 1O7IA 5EPLA 4JI1Q 5HY6A 2WAQG 3C1FA 3E5SA 5IY0A 4A3GH 3I8ZA 3K7AB 3URYA 2DNCA 1ESRA 5NUCA 2OF1A 2H4OA 5CV4A 2EXDA 4B9WA 2DY8A 2SOBA 1QVGA 4F8MA 3BS1A 2F52A 1Y1WB 1D8LA 4X3KA 3CCSA 1SJED 1KRSA 1SYGA 5C3EH 4HIKA 3UE0A 3QR8A 4CJ2C 2B3GA 3HS0C 3CXCA 1C4QA 4R4QA 1A0IA 1PYWD 2PI2E 4R4TA 4NXML 1XPOA 5IYBH 2QW7A 2Q2IA 1F9SA 3NWTA 2GN5A 4C3JG 3NENA 4C3IB 1EOVA 5M3MH 3S1QH 4A93H 1U4MA 1JOOA 4UAIA 3S1NB 2WAQE 2P5ZX 3A56A 2E5LL 1CQFA 5FK9C 1BBUA 4POFA 1K8OA 2Z8LA 3H94A 4HMIA 2UUCL 1YNNC 4G7ZC 4X66L 3J81L 5EAYA 1L0WA 1EYDA 1WFQA 4B3TQ 2QILA 3C3LA 4TRDA 2K14A 2ZJQA 3KF8B 1TKWB 5A2QL 4BY7H 2IX3A 1SE3A 2VZAA 3RLOA 1I3QH 1V9PA 2LS01 4DPGA 1O7LA 2UXDQ 3BYYB 4FXGC 5E7NA 5IYCH 4ZKBB 3ULLA 3DM1A 4LF6Q 1J9OA 1SDFA 4A3BH 3EFXD 1I50B 3K5OA 1WTWA 1I6HH 2B2TA 2VUMG 2A68D 4CBVA 2N55A 1XMQQ 4DAMA 5M5WH 1ET9A 1JJCB 3Q23A 4NKLA 4JBKA 2A6HD 1BF4A 1B3AA 4JI3L 3IFTA 2K33A 1SFOH 3VYUA 3OW2A 2NWGA 1EUJA 4DNRB 5CR3A 3K0XA 3J80L 1G51A 2EYPA 4IUVA 4PZ6A 1PH3A 3D4RA 2VQFL 1BDOA 3ZYYX 3G6JB 2C5CA 4G7HC 2B2UA 4R4CA 4A3LH 4ULLA 1N33L 3T13A 1F77A 1K28A 3I3CA 1F2ZA 3CU7A 2V1CC 1PFSA 4X66Q 1V43A 3UDGA 2BH8A 3Q6SA 3TZUA 1OTCA 1JORA 3KLWA 1DOLA 5I2YA 2NB0A 2KENA 1KC8C 1EL0A 1LUZA 1M8AA 3D6WA 2I0QA 2F0QA 1SNDA 4DXFA 1CKMA 4OONA 3J81c 2K01A 2F3VA 3RR5A 2E8GA 2FJ2A 3HP3A 1M4VA 1DD2A 5IWAQ 3NEMA 1SSOA 3S24A 3MFGA 5JJZA 1QVCA 4K2KA 3NP8A 3I91A 2N8NA 1O80A 4JBJA 5EKKA 2Z4HA 1SE2A 1A63A 1ZYRD 1TU2B 3DHQA 4BBSH 1KL9A 4JI3Q 4EGVA 4V190 4GS3A 4ZUIA 2A69D 3E6ZX 5K36G 2VS1A 4OXPA 2VQFQ 3TSSA 3G71A 4K5XA 4JVZA 1CA5A 2PZTA 1JWSD 3F1ZA 1N33Q 5A35A 3NUCA 4WJ3M 3I4NG 2NN6G 2EE1A 1NJIC 3K0YA 4ZAIA 3FKIH 1K8GA 2F0LA 5AFWA 3HRZC 3HOUG 3UDFA 4DAYB 3M7NA 1Y69U 4XQNA 3S1RB 4RG1A 3STBD 2FMCA 4IUUA 2KHIA 1G291 3SR1A 5FO7B 2A8VA 1EIHA 3LNNA 1A3TA 1MI2A 3MEHA 2PW7A 1CKOA 1XPRA 2O5IC 1LM0A 3I4MG 3NHHA 2ES2A 3M85A 2R92H 2WAQB 4B08A 4PG3A 2ZM6Q 3CCQA 1EIGA 2X69A 4R9WA 2RCNA 3PO3G 1QCBD 3CHBD 5JAVA 4A3IB 1SJHD 1MD2D 1YHBA 2R93G 3QOJA 2E2HH 2JN4A 4RA8A 1KDCA 3DEOA 4LF9Q 3BG3A 1LACA 5DM63 3GO5A 1EZ6A 4CHTB 2F0FA 1Q86C 2PMZE 5I4DA 4P71A 1LV9A 1U4PA 1W2BA 3OIPA 3GTJB 4R8IA 1JB7A 2D5DA 4A3DH 3S15H 2F0EA 1NMGA 1RTNA 1PH6A 5G3LF 3CP0A 1TS2A 2LXKA 4C3JB 1M90C 1IBLL 3P20A 4A3EG 5C4XB 1S5CD 2OQKA 1EFID 5CYUA 2A6ED 4IUPA 4KTAA 1G91A 4RFBA 4JI4Q 4P75A 4A3FG 3K59A 4MTNA 1UWVA 3CW2C 1YNJC 1MSHA 5G3LD 3HFZB 1ZEQX 4ZKCB 5CV7A 5FKAC 5LMNW 2F0VA 3CCMA 4Y7NB 2CKZB 2F0GA 1EY0A 4PZ7A 4JV5L 2RSNA 1RL2A 5JJLA 5C4ZA 2YTXA 4L5TA 1IHZA 1PHJA 2Q2UA 2A19A 1HR0W 3R8BA 2F0IA 3PV0A 1N36Q 5C0XI 1RJTA 3V96A 4XYOA 3HOWH 1GM5A 2Z0SA 4GLAC 1I94Q 1EWIA 2F0OA 2MFIA 1FGUA 4XXEA 4GNXA 2VUMB 1HNXQ 4U673 4YIJA 5EBDA 2JA7G 3RD4A 4X3TA 4LFCQ 5KYIA 1Y1VH 2DJFC 3IRBA 4LW1A 4L5RC 4A3MG 4IFDG 2X6GA 1A6XA 2JSOA 3CCVA 3TBIB 3TZDA 1KQSA 2WV6D 4QIWE 1B70B 1RIPA 1E2ZA 1ENFA 2Z6KA 1AP0A 1CUKA 1EYAA 1VQDA 1XTDA 1SNMA 2RHQB 1XX8A 4JG2A 1RHPA 4BXXG 1IBLQ 1PH2A 2ZXPA 3GQBA 1IYUA 1WTXA 1ILPA 4IPGA 4YY3Q 4XT1B 1LO5D 3HOXH 4ALPA 2B29A 4GN5A 4HEDA 1OXSC 4KN4C 3H3VI 4K8JA 1B3QA 2ZJRA 4C2MB 1YEZA 3MEFA 5HGTA 4QCLA 4LAAA 3PQIA 3SGIA 1S3OA 2BE5C 3MVVA 4A3JG 1W6KA 1JQYD 4PNYA 2K4KA 3OPOA 3V2TA 3K7UC 2ALYB 4YCWA 3VR6A 4OL7A 3EBEA 5CGKA 4C56C 3MC0B 4NDXA 4GOPA 3OMCA 1GUOA 1Q81C 1EIFA 3NXWA 2HT1A 1BVSA 2K03A 1EQTA 4QUCA 3CQZB 1J8IA 3GTPH 1K0RA 2VL6A 2CW0D 4CKEA 3T1HL 1U5KA 1X3PA 2KBNA 2TSSA 3NBHA 2JA6B 4JI2L 1EZ8A 1G2TA 2RVLA 1C9OA 3NBIA 2F0MA 5LMNL 2EY2A 4L5SA 1H9JA 1Y1WG 2NTSA 4CDDC 1S72A 1NAPA 2WFWA 1XJVA 1WTRA 5IYDG 1HR0L 1VQFA 3MZ5A 1D7QA 1Z9FA 1EU4A 3I4NB 3I90A 3KK7A 4K5WA 3L9AX 1JCKB 4L8JA 4C3IG 3DUZA 2ASBA 2BH2A 1ENCA 3GTGH 3GTKB 3A54A 3PUYA 2D62A 4OO1G 1DXMA 1TWAH 1JICA 1RODA 4IPDA 2R7FA 2HDLA 3OW7A 3B6YA 1PH7A 3CCEA 2BDNA 1MGSA 3J7YW 5ELFA 1XWEA 1AH9A 3I4MB 4LF4L 3PO2B 2PQAB 4DR3L 1Q8KA 3V05A 4MIUA 5C4HA 4RGNA 4LFAL 1IBKQ 2NN6I 2OTJA 4JI7L 5ELCA 2A68C 4HCEA 3A5ZB 1VQ7A 2AMCB 4KMUC 2R93B 1TWGB 3SK6A 1B9NA 3I73A 5D3IB 1IYVA 3HOZB 3KYHC 1LTSD 3SDZA 5DM73 3PIO3 2IX0A 3QJYA 3S16B 2OXPA 2Z1CA 4OWWB 1JR0D 3ER0A 5JOBA 2VUMH 1O7ZA 5J3BA 5M5YB 4JYAQ 4G57A 5EGTA 1NCVA 3H3VH 2EY6A 5J22A 4EQPA 4CGYB 4KY6A 1TY0A 2KEEA 2JA5B 4AQYQ 4XYQA 3CC7A 4JBWA 1TWCH 4RMFA 3KJOA 3NE5B 4A3FB 1KD1C 3QIAA 1CKNA 2B39A 4DV4Q 4EQNA 1V1PB 5C4JH 3AYHB 1KAWA 1DJRD 2LY7A 2CHBD 5EPJA 3U9OA 2VB2X 4LF4Q 4UY8C 1S5DD 3RZOB 4X65L 4XQJA 3I7FA 3KLSA 4RHRA 3KOJA 4LFAQ 4NMZA 3BYTB 1YNJD 3NSWA 4JI7Q 1LTBD 3M3YB 5ELEA 1TWFB 3S2DB 2OWOA 2XWBB 4DNTB 4OX9L 2NVTH 1SNCA 2IHEA 4LF8L 1ZYRC 1HUMA 1S5BD 3R2IA 2CQAA 1E1OA 1STYA 3T51B 3S14H 1PDQA 2O2LD 1VMPA 3C2PA 2FINB 3TN2A 3BDLA 1ASZA 5KYLA 2A69C 1IKMA 2E2IB 5C5MA 2M00A 4TQUS 3S1MH 2I5MX 4AYBB 1IKLA 2ZXOA 1Q1EA 2LFNA 5C5LA 2ZTEA 2QKIC 5BR8Q 1D1KA 2EJMA 1E2WA 4K0KL 4L6TB 1IBMQ 2NVYB 1LABA 4DR2L 4LUVA 4DK6C 1F9QA 1A3VA 2UXCQ 2LKVA 5BN3A 3L2PA 4HMJA 4IALA 2B8FA 3STBC 2AWOA 1GKHA 1VQJA 2KUMA 3GDEA 2GVAA 4A3CG 1SE4A 5M3FB 3GTQB 3I70A 4A3JB 1VQ9A 2XNAC 4DUYQ 1ASYA 2N3SA 5I6WA 3KDFB 2H1EA 4Z9CB 2F0SA 2NN6H 2G9DA 1TR5A 1PRTB 4EVOA 4X65Q 4FVMA 4DK0A 1E24A 2B2YA 1NY4A 3HOUH 2UXBL 3VDYA 4GKKL 3CRLC 4JOIA 1K83H 3TMEA 2LXJA 3BDOA 2RBMA 4LF8Q 2OCEA 2WKCA 2WACA 1CTMA 4N9PA 4DR5Q 4DR4L 1VQOA 2A73B 4DV5L 1DOKA 3KF6B 3KF8A 4A3IG 4K6LA 2K52A 2JP1A 2DN8A 4TSSA 3FP9A 4UPAA 4C1NI 3PO3H 3LWUA 2KHJA 1PVOA 1H9SB 2KQ3A 4DR6L 2NYZD 1FR3A 4B3ML 3DXJC 3RZDB 1BXTA 1OXVA 2A6EC 1Y8OB 1QILA 4NW2A 1IL2A 3KBGA 2L5TA 2D2CC 1HRJA 3FVQA 3FDTA 5F2DA 1ENAA 5EQ0A 3HOYG 4BA1I 4MNOA 2I07B 4MN3A 4BWGB 4HJ8A 1Q90A 1SEBD 3CPFA 5C4XG 3FPUB 1SNPA 2K1BA 5ELBA 4DV0L 1XPUA 1VQMA 1WVLA 2K75A 1JWUD 1GHKA 3P75A 4A3EH 3R2TA 1WYDA 3OWFA 3ERQA 4RKBA 1IXRA 1EEFD 2UXBQ 1HNWL 3QO2A 3QG1A 1I4RA 1FNVA 3J81E 3MXGA 1EY4A 5IT9L 4B3SQ 1E1TA 3GTOB 2HIXA 3RMHA 4WFN3 1RTOA 4DR4Q 1N34L 5IT9E 1BO0A 1QUQB 2QEJC 4R4IA 2RDHA 5A2QE 2YYZA 3K81C 1B8AA 1R9TB 1VF7A 3A5UA 2UU9L 2HUGA 5I6YA 3TS2A 4IN3A 2WINB 1PRTF 4M8AA 3UI2A 2FFKB 4K6DA 1QG7A 3TP8A 4L63B 4O1NA 2VXWA 2NVQB 5KIXA 1I4XA 1JWMD 2KJXA 4QF4A 3SE0A 2JA7H 3MXNB 4LUZA 1W6JA 1EYGA 3KBXA 1YHAA 4OIKA 4IFDH 4A3MH 4NXMQ 5CV9A 1S5FD 3E3XA 3L3OC 1PH9A 1PRTD 3ONAB 1KTKA 1PXUA 3J80E 4DV0Q 3TS0A 2QGQA 2FHTA 2E5LQ 2SEBD 3A7LA 4BXXH 2RF4A 2UUCQ 1EQVA 5BN5A 5M5XH 2F3IA 3M4OH 2B2VC 2EVBA 3H09A 1Q3LA 3TEHB 4J6HA 2F0NA 4DNIA 2F03A 4HIDA 2F0UA 2E2JH 1X9NA 4N8FA 1SYBA 4ZRZA 3S9WA 1CHQD 1GO3E 3S2HH 3GTMH 1Z6HA 3K58A 2DY7A 5E3FA 3WWVA 3CC4A 2VNUD 2IWHA 1G6PA 1NNXA 3MA2B 1VQNA 2CW0C 2UU9Q 4IOCA 2EYHA 3NELA 3EA6A 2TMPA 5IT9c 3EJIA 2PI2A 1HZAA 4KY7A 4JC0A 2AUKA 2F0KA 4JI5L 2VB3X 3T4AC 3RNUA 4HJAA 1LT4D 5LMUL 5JEAJ 1KABA 3AB9A 4LNQA 1SXTA 3TDQA 1N9WA 2R7ZG 4KJNA 1PH1A 2JA6G 2MO1A 1U4LA 4AH6A 3K7AH 3BVZA 3VYRA 4IPHA 1N8RC 3CCRA 2K05A 1WI5A 1ICFB 3U50C 1PTOC 1PZJD 1UNSA 1VF5C 2SDFA 1CSQA 1TWHB 4HCSA 3W2DA 4J1MA 2XWJB 3CPWA 1Y1WH 2UUBL 3AU7A 3U58A 1X65A 3GP7A 2CH4W 2K5DA 1FYCA 3J80c 4JI6L 5IYDH 1II3A 4X64L 1ET6A 2X6LA 1HHVA 2JYOA 1CQVA 2JEBI 3RUZA 3AQQA 4IJHA 3J81i 2YV5A 4J8QA 1U9RA 4C3IH 1WTPA 1E3PA 1S5ED 2JA8B 2JQOA 3E9IA 3S1NH 4OO1H 1SROA 4QMGA 2CWPA 2J4XA 4HJ9A 2YU9B 4LUOA 4B3RL 3P7JA 1SMYD 3PO2G 4NXNL 2K7VA 1IZ6A 4OWXB 5IE8A 2HHHL 1F9RA 2G5DA 4LK1C 2VY3A 3PGZA 4Q5VA 4JI5Q 5C0XJ 4DK1A 4A3KB 5LL6S 4JCVE 1F2LA 3HGBA 2PZWA 3OTOL 3CMEA 5IGEA 4HAEA 3HOZG 4RH6A 1BBWA 1SYEA 1TY2A 3CCLA 4AIMA 2K50A 1ICWA 1K8AC 4B9XA 2L0CA 5KRUA 1O7YA 4DV7L 2LSSA 4DN4M 1I50H 2IW3A 3I4OA 5FJ8H 1X3EA 3HOVB 1QOHA 3BDCA 1TXYA 3KLSX 5C3XA 4Y52H 1VQCA 3HOYB 2PCFB 3M4QA 4JI8L 2EIFA 2R7DA 4JI6Q 4J15A 2JA5G 5I9PA 2O5JC 2RCFA 3F2DA 2K5WA 5LL6X 3K8AA 1VS0A 4O2DA 2N49A 4JI0L 3G6EA 5HURA 2F3WA 4CJ1B 4ID6A 3AFPA 1SYCA 4LJZC 1B44D 3H0GB 1AZQA 2XRSD 4KV6A 1PH5A 3KLRA 4NXNQ 5DEHA 2NZHA 3E9HA 1PTOB 1XNRL 1RCVD 2KCNA 2Z6BA 1NMFA 2F0JA 3QWNA 3I72A 2ZXRA 1X32A 4CDEC 4BY7G 5D65A 1WCMB 1ILQA 2WP8J 4WORA 1IL8A 4DV2L 1B50A 4K2LA 3W5OA 4NP5A 4OWTB 3FMCA 5IYCG 1VQGA 3W1GA 2PNRC 2K5HA 4AYBG 3T56B 1AN8A 4BBRB 4LF7L 3PIOA 3HG9A 4WJWA 2BA1A 2MQHA 3A74A 4KHPL 4KKUA 1KIXA 1PMRA 3PF4A 2L4NA 2QCPX 4APVA 1ESFA 4JI8Q 4UDUC 4GLVB 2NZOA 2CCZA 4LFBL 1LT3D 4HTHA 3MWYW 1CA6A 2N78A 1MBYA 4DAPA 1I4QA 2AUJD 4C3HB 3ICEA 2B2WC 1GUTA 4JI0Q 2F1MA 3MXPA 3DLLA 1Q46A 4MTKA 4RCNA 2IY5B 1VQBA 1GHJA 5M3FG 4EQOA 4DGZA 2PPBC 3F2BA 3Q8DA 5FLMH 2XTIA 4JV5Q 1Y8PB 4A3CH 2V4DA 4P74A 2OQ0A 4QQBX 4AYBE 1VQPA 4ME3A 1T5EA 3K80C 1K9MC 3MHBA 4P72A 1XNRQ 4KJOA 4IUTA 3S1RH 1GUGA 4H02A 2B63B 1C0AA 3M4YA 1VDZA 5CBAE 1WD0A 1I5FA 1G2SA 3RN2A 1EY6A 5KGUA 2QA4A 1YI2A 3FPPA 4DU9A 1OXTA 2PQAA 4DV2Q 2J0TD 3K5LA 4FF1A 3G48A 3RN5A 2ZJPA 2F4VL 2R7ZB 4P73A 3G7LA 1NE3A 2I46A 5M9OA 3PMFA 2NVXB 1GD7A 4A3IH
chains in the Genus database with same CATH topology
4FNFA 1PTOF 2EY1A 4M1UB 1AZPA 3JAML 2PQEA 5E4XA 1LTID 2CVRA 1KDAA 2AQ2B 2ICIA 3SK8A 5IOCA 4BY1B 3GTLB 2Y0SB 4XTCS 1PTOD 4ABNA 2IL8A 4DXGA 4MHEA 3QB3A 5C44B 1ZXTA 1Q1BA 1TS3A 3HZXA 3GV6A 1LTTD 3HKZB 3EVQA 1B9MA 1V1PA 3C46A 1XXGA 1IW7D 1STGA 4XQQA 4I7ZC 4KD3A 1NR2A 1DCZA 2EJGC 2BOSA 4H13C 5J39A 4KN7C 3SVMA 3CKIB 1PRTC 3VR2A 1STBA 2K6AA 3TP5A 2LMCB 1D1IA 1CZGA 3A8KE 4XT3B 1GUWA 5FLXL 1PZKD 4FXKC 4CKBA 2ENBA 5C3EB 4ZQ3A 1VMCA 5FLXE 3MTSA 1KNAA 4DAVA 1JE4A 3N6RA 3D8GA 1G8ZD 5JPNC 1GUNA 1F2YA 1RD9D 4RCOA 4IUNA 2Q8TA 1STNA 5M3MB 1KNEA 3S1QB 4A93B 1CM9A 3IL8A 2BDOA 2ZT9C 3WOEA 1D6EC 3E0JA 1HFNA 2L11A 1L0XB 4FO2A 1Y8NB 4BY7B 1QNKA 4K14A 1I3QB 2L1BA 3OSOA 4Q0FA 2MGSA 1EOTA 1GJXA 3T16A 4A3BB 3K5NA 1TVXA 1I6HB 3MAQA 1STEA 5CV5A 1VCIA 5M5WB 1DM0B 2R3ZA 1AFPA 1EEID 1KLGD 2AQ3B 2B8GA 1H9SA 1SFOB 1KDBA 3VR4A 4QB4A 1HA5A 4OHJA 5JVG3 5K36H 1OXXK 3VA7A 1GUSA 4IFDI 4FF3A 4LMQD 3H91A 2DNEA 1SMYC 3D4WA 1GXDC 1K8MA 5EBCA 4KD4A 3N52A 3M7GA 3AMUA 3GV3A 3PUZA 5IIFA 2WKDA 4O42A 5JEAG 1UUPA 5JVH3 4TKOB 2FMMA 2A74C 1WTOA 3Q0AA 1TIID 1WD1A 4G7OC 4RGOS 4RGMA 1AW7A 4CJ0B 2F4IA 4ZLTF 1I4PA 1JOKA 2KHSA 3OMGA 2K32A 1BCPB 4BBSB 2L55A 2RDFA 2JXMB 5COYA 2XIWA 1CK1A 2WB1B 3MXNA 4KI0A 2HQEA 2KCCA 1WTQA 5I9OA 5KNDA 5EKIA 3OHXC 1A2UA 3FKIB 1DONA 3NTIA 2B2TC 2L9HA 2RQXA 1E2VA 5C0XG 1H9MA 1G6ZA 2F0DA 5IODA 5IGDA 1C48A 2IT1A 2F0PA 4OO1I 2A5HA 1Z7TA 2R92B 2XVSA 1QWYA 3I4LA 2B2UC 3SK5A 1HA6A 5EJWA 2E2HB 1RDPD 1XYIA 1OXUA 2GA4B 1LLRD 1JB3A 2XN9C 1B2TA 5TSSA 4PQXA 4ZK9B 2HCIA 1SBBB 1EYCA 4A3DB 2EY5A 3IAYA 5CORA 1HFGA 3S15B 1EWCA 3OIQA 2F0HA 3SEBA 3PIP3 1ZKOA 4KKTA 4C3HG 1TT2A 1S4ZA 2F0TA 1SYFA 4WRDA 1BCPF 1SNQA 4FF4A 1RKNA 2M9VA 4CKCA 3J7AV 4RGTA 2RSOA 4DAYA 1FNWA 1U4RA 3S17B 1BCPD 3P1HA 1EU3A 1X3QA 3TP6A 1R4QB 1JOQA 5CBEE 3HOWB 1FGBD 1A15A 1ONLA 3BVMA 3A8JE 5CV6A 3O13A 4F87A 1Y1VB 3PUXA 4KKSA 1L0YB 4HN7A 4N9TA 4BS9A 2E2DC 2B2VA 2IX1A 1QJOA 3DWAA 1Q8IA 2EYLA 5I2XA 4PMCA 5ELDA 1ML0D 3DWPA 5CC4A 3HOXB 2G9HD 1A2TA 5IGCA 2Z4IA 4R8NA 1IW7C 4E6IA 1E0BA 4HSPA 1WTVA 3H3VC 1BNZA 1HTPA 1D5ZC 2EYOA 5KEEA 1UAPA 4KHZA 2EPBA 1UEAB 1BUVT 3Q22A 4DF7A 1STAA 1QNUA 3GTPB 2PYKA 4XIGS 2EOTA 1BQQT 2RKSA 1LT5D 2MP1A 1CI3M 4PMBA 2AQ1B 2ID0A 4HR7B 3K6OA 2EYJA 1PFMA 1TS5A 1D5XC 1EY5A 2KEDA 3DMUA 4RWSC 4K8IA 3GTGB 5J1ZA 1CFMA 1B1ZA 5C3WA 1AEXA 1TWAB 3D6CA 3D4DA 5D3DA 5E4WC 5FO9B 3VYTA 5DNFA 1LTRD 2IJ0A 3OOCA 1A3UA 4C1NK 4QUFA 3SXHA 3MFYA 4BA2I 5CV8A 3NWSA 3SK4A 5EKLA 4IURA 3VR3A 1I4GA 3DWQA 1HQMC 4P2CB 1CZWA 3MXUA 1YNND 2KOLA 3J7AF 3ND8A 3H6MA 5FOBB 5C6AA 2O4XA 5FO8B 2NUCA 2NTTA 2KA7A 3R3OA 3X3MA 4XDXA 2BA0A 5IGBA 1LTAD 3BZDB 1QE6A 1BBXC 5K5PA 4FYDA 3CRKC 4ILWA 4KK7A 2C9OA 2SNMA 2R61A 1TWCB 5KNBA 3FEWX 1NSNS 2QF7A 4K5VA 5T1GA 3BVGA 3X3NA 1BOSA 2EXZA 3A55A 3D3RA 4F7XA 3QOLA 3WDNA 5C4JB 4DA2A 2M2LA 3Q24A 2J7ZA 1DYQA 1GOZA 2NBFA 1EY7A 1DOMA 2K04A 2MJ8A 1KLUD 2OT2A 4F88A 2EZVA 1EWHA 2NVTB 1EY8A 5JEAH 3S14B 4IZ8A 4V0BA 5DAUA 3F2UA 1JC7A 4PMWA 3OWEB 3PUVA 1HCZA 3L7ZC 2B2WA 4X3SA 3S1MB 1XTCD 5IGFA 1CT1D 1LT6D 3IFDA 1MSGA 2EJFC 3JAME 1I6VC 4ZUJA 5IGGA 1STHA 1B53A 1TQOA 3NTKA 3VR5A 2MHVA 4KY5A 1FNUA 2WIIB 3R93A 3LX0A 1T5XD 4IQZA 1SAPA 1D5MC 4H0LC 4OGQC 3A8IE 2Q8IB 3NPPA 2HCCA 1DZ1A 1EY9A 1TS4A 3HOUB 4FP5D 2PMZB 2PZUA 3EROA 4H7BA 2IPKD 1K83B 1LTGD 3VA5A 5LHY1 5D14A 3LWEA 1SYDA 2E76C 1HXYD 5C0XH 3EQLC 5CMDA 1HUNA 3ITPA 4RHSA 2PO4A 1PTOH 1V1OA 4A3GB 1PFBA 3SHLA 4IUQA 3NK9A 5T1IA 3NQTA 1NUCA 3VYSA 3PO3B 2XSCA 3D31A 3K57A 1C8CA 3W3AA 4JK1C 2A6HC 2D9UA 1HQRD 2ICEC 2JEAI 4X3UA 2RA4A 2K5QA 2BCOA 2KVMA 5EPKA 2MUYA 4IFDJ 4A3EB 1BCPC 1D2BA 2AWNA 3ND9A 3A7AB 1NR4A 1F9PA 4GZYC 1HPCA 2NZ1D 4QIWB 2EDGA 2QDBA 1HTLD 4I65A 2OEOA 4ME5A 4FXDA 4RKLA 4DFAA 3C1EA 1OO9B 1QB5D 3FRPB 4OIJA 4ODGA 3HEJA 4HSVA 4ZYSA 2XRQD 1I4HA 1B4OA 1PFNA 2N88A 2JA7B 2B2YC 1RF2D 3NTHA 3DEPA 4A3MB 2K28A 2EYMA 1H9RA 2R6GA 3T53B 1BR9A 3K5MA 2PW5A 3U9SA 1Z47A 2Q8RE 2HDMA 3WOFA 5JPMC 2E75C 1PZID 5KNCA 5M5XB 2SNSA 3M4OB 2EYFA 1V8QA 1PLFA 2RDGA 2F0WA 2E2JB 3RLFA 5ISRA 3TP7A 3S2HB 1H9KA 3GTMB 3NQIA 2JE6I 2E74C 5BN4A 4G4KA 5E1FA 4FF2A 4KHVA 4H44C 1KAAA 3KUPA 1R4PB 2KECA 2L12A 3PUWA 4U68A 4S3SA 4PV1C 1CHPD 1F2MA 2BE5D 1Q12A 2MPMA 1O78A 1SNOA 4RAUC 3GD7A 3IKJA 1FD7D 5EPLA 3C1FA 3E5SA 3I8ZA 3K7AB 3URYA 2DNCA 1ESRA 5NUCA 2OF1A 2H4OA 5CV4A 4B9WA 2DY8A 2SOBA 4F8MA 3BS1A 1Y1WB 4X3KA 1SJED 1SYGA 4CJ2C 3HS0C 1C4QA 1PYWD 1F9SA 3NWTA 4C3JG 4C3IB 1U4MA 1JOOA 4UAIA 3S1NB 3A56A 1CQFA 5FK9C 1K8OA 2Z8LA 3H94A 4HMIA 1YNNC 4G7ZC 3J81L 1EYDA 2QILA 3C3LA 4TRDA 1TKWB 5A2QL 2IX3A 1SE3A 2LS01 1O7LA 3BYYB 4FXGC 4ZKBB 3DM1A 1J9OA 1SDFA 3EFXD 1I50B 3K5OA 1WTWA 2B2TA 2A68D 4CBVA 2N55A 1ET9A 3Q23A 4NKLA 2A6HD 1BF4A 1B3AA 3IFTA 2K33A 3VYUA 2NWGA 4DNRB 5CR3A 3J80L 2EYPA 4IUVA 3D4RA 1BDOA 3ZYYX 3G6JB 2C5CA 4G7HC 2B2UA 4ULLA 3T13A 1F77A 3I3CA 1F2ZA 3CU7A 1V43A 3Q6SA 3TZUA 1JORA 1DOLA 5I2YA 2NB0A 1EL0A 1M8AA 3D6WA 2F0QA 1SNDA 4DXFA 2K01A 2F3VA 2FJ2A 3HP3A 1M4VA 1DD2A 1SSOA 3MFGA 5JJZA 4K2KA 3NP8A 3I91A 1O80A 5EKKA 2Z4HA 1SE2A 1ZYRD 1TU2B 3DHQA 4EGVA 4V190 4ZUIA 2A69D 3E6ZX 5K36G 3TSSA 4K5XA 1CA5A 2PZTA 1JWSD 5A35A 3NUCA 2NN6G 2EE1A 3K0YA 4ZAIA 2F0LA 5AFWA 3HRZC 3M7NA 1Y69U 4XQNA 3S1RB 2FMCA 4IUUA 1G291 3SR1A 5FO7B 1EIHA 3LNNA 1A3TA 1MI2A 3MEHA 2PW7A 2O5IC 3NHHA 3M85A 2WAQB 4B08A 1EIGA 2X69A 4R9WA 1QCBD 3CHBD 5JAVA 4A3IB 1SJHD 1MD2D 3QOJA 4RA8A 1KDCA 3DEOA 3BG3A 1LACA 5DM63 3GO5A 1EZ6A 4CHTB 2F0FA 5I4DA 1LV9A 1U4PA 3OIPA 3GTJB 4R8IA 2D5DA 2F0EA 1RTNA 5G3LF 1TS2A 4C3JB 3P20A 5C4XB 1S5CD 5CYUA 1EFID 2A6ED 4IUPA 4KTAA 1G91A 4RFBA 3K59A 1YNJC 1MSHA 5G3LD 1ZEQX 4ZKCB 5CV7A 5FKAC 2F0VA 4Y7NB 2F0GA 1EY0A 2RSNA 5C4ZA 1IHZA 3R8BA 2F0IA 3PV0A 5C0XI 1RJTA 3V96A 4XYOA 2F0OA 4XXEA 2VUMB 4U673 4YIJA 5EBDA 3RD4A 4X3TA 5KYIA 4IFDG 2X6GA 1A6XA 2JSOA 3TBIB 3TZDA 2WV6D 1E2ZA 1ENFA 1AP0A 1EYAA 1SNMA 1XX8A 1RHPA 2ZXPA 3GQBA 1IYUA 1WTXA 1ILPA 4XT1B 1LO5D 4HEDA 1OXSC 4KN4C 4K8JA 4C2MB 5HGTA 4QCLA 4LAAA 2BE5C 3MVVA 1W6KA 1JQYD 4PNYA 3V2TA 3OPOA 3VR6A 4OL7A 5CGKA 4C56C 3MC0B 4NDXA 3OMCA 1GUOA 3NXWA 2K03A 1EQTA 4QUCA 3CQZB 1J8IA 2CW0D 4CKEA 1X3PA 3NBHA 2TSSA 2JA6B 1EZ8A 1G2TA 2RVLA 3NBIA 2F0MA 2EY2A 1H9JA 2NTSA 1NAPA 1WTRA 3MZ5A 1EU4A 3I4NB 3I90A 3KK7A 4K5WA 3L9AX 1JCKB 4L8JA 4C3IG 3DUZA 1ENCA 3GTKB 3A54A 3PUYA 2D62A 4OO1G 1DXMA 1JICA 1RODA 2HDLA 3OW7A 2BDNA 1MGSA 3J7YW 5ELFA 1XWEA 3I4MB 3PO2B 3V05A 4MIUA 5C4HA 4RGNA 2NN6I 5ELCA 2A68C 4HCEA 4KMUC 2R93B 1TWGB 3SK6A 1B9NA 3I73A 5D3IB 1IYVA 3HOZB 1LTSD 3SDZA 5DM73 3PIO3 2IX0A 3QJYA 3S16B 2OXPA 2Z1CA 1JR0D 5JOBA 1O7ZA 5M5YB 4G57A 5EGTA 1NCVA 2EY6A 5J22A 4EQPA 4CGYB 4KY6A 1TY0A 2KEEA 2JA5B 4XYQA 4JBWA 3NE5B 4A3FB 3QIAA 2B39A 4EQNA 1V1PB 3U9OA 1DJRD 2LY7A 2CHBD 5EPJA 2VB2X 3RZOB 1S5DD 4XQJA 3KLSA 4RHRA 4NMZA 3BYTB 1YNJD 3NSWA 1LTBD 3M3YB 5ELEA 1TWFB 3S2DB 2XWBB 4DNTB 1SNCA 1ZYRC 1HUMA 1S5BD 3R2IA 2CQAA 1STYA 3T51B 1PDQA 2O2LD 1VMPA 3C2PA 2FINB 3TN2A 3BDLA 5KYLA 2A69C 1IKMA 2E2IB 5C5MA 2M00A 4TQUS 4AYBB 1IKLA 2ZXOA 1Q1EA 2LFNA 5C5LA 2QKIC 1D1KA 2EJMA 1E2WA 4L6TB 2NVYB 1LABA 1F9QA 1A3VA 2LKVA 5BN3A 4HMJA 4IALA 2B8FA 2AWOA 2KUMA 1SE4A 5M3FB 3GTQB 3I70A 4A3JB 2XNAC 5I6WA 2H1EA 4Z9CB 2F0SA 2NN6H 2G9DA 1TR5A 1PRTB 4EVOA 4FVMA 4DK0A 2B2YA 3CRLC 3TMEA 3BDOA 2RBMA 2WKCA 2WACA 1CTMA 4N9PA 2A73B 1DOKA 3KF8A 4K6LA 2JP1A 2DN8A 4TSSA 4C1NI 3LWUA 1H9SB 2KQ3A 2NYZD 1FR3A 3DXJC 3RZDB 1BXTA 1OXVA 2A6EC 1Y8OB 1QILA 4NW2A 3KBGA 2L5TA 2D2CC 1HRJA 3FVQA 3FDTA 5F2DA 1ENAA 5EQ0A 4BA1I 2I07B 4MN3A 4BWGB 1Q90A 1SEBD 3FPUB 1SNPA 2K1BA 5ELBA 1WVLA 1JWUD 1GHKA 3P75A 3R2TA 3OWFA 3ERQA 4RKBA 1EEFD 3QO2A 3QG1A 1I4RA 1FNVA 3J81E 3MXGA 1EY4A 5IT9L 3GTOB 3RMHA 4WFN3 1RTOA 5IT9E 1BO0A 2QEJC 2RDHA 5A2QE 2YYZA 1R9TB 1VF7A 2HUGA 5I6YA 4IN3A 2WINB 1PRTF 4M8AA 3UI2A 2FFKB 4K6DA 1QG7A 3TP8A 4L63B 4O1NA 2VXWA 2NVQB 5KIXA 1I4XA 1JWMD 2KJXA 4QF4A 3SE0A 1W6JA 3KBXA 4OIKA 4IFDH 5CV9A 1S5FD 3L3OC 1PRTD 3ONAB 1KTKA 1PXUA 3J80E 2FHTA 2SEBD 3A7LA 1EQVA 5BN5A 2B2VC 2EVBA 3H09A 1Q3LA 4J6HA 2F0NA 2F03A 2F0UA 1SYBA 4ZRZA 3S9WA 1CHQD 1Z6HA 3K58A 2DY7A 5E3FA 2VNUD 2IWHA 3MA2B 2CW0C 2EYHA 3EA6A 2TMPA 3EJIA 4KY7A 2AUKA 2F0KA 2VB3X 3T4AC 1LT4D 5JEAJ 1KABA 3AB9A 1SXTA 3TDQA 4KJNA 1U4LA 3BVZA 3VYRA 2K05A 1PTOC 1PZJD 1UNSA 1VF5C 2SDFA 1TWHB 4HCSA 3W2DA 4J1MA 2XWJB 3AU7A 3GP7A 2K5DA 1FYCA 1II3A 1ET6A 2X6LA 1HHVA 2JYOA 1CQVA 2JEBI 3RUZA 4J8QA 1U9RA 1WTPA 1S5ED 2JA8B 4OO1H 4QMGA 2J4XA 2YU9B 3P7JA 1SMYD 2K7VA 1F9RA 4LK1C 4Q5VA 5C0XJ 4DK1A 4A3KB 5LL6S 1F2LA 3HGBA 2PZWA 5IGEA 4HAEA 4RH6A 1SYEA 1TY2A 1ICWA 4B9XA 2L0CA 5KRUA 1O7YA 4DN4M 2IW3A 3HOVB 1QOHA 3BDCA 3KLSX 5C3XA 3HOYB 2PCFB 5I9PA 2O5JC 2K5WA 5LL6X 5HURA 2F3WA 4CJ1B 4ID6A 1SYCA 4LJZC 1B44D 3H0GB 1AZQA 2XRSD 4KV6A 3KLRA 5DEHA 1PTOB 1RCVD 2KCNA 2F0JA 3QWNA 3I72A 2ZXRA 1X32A 5D65A 1WCMB 1ILQA 2WP8J 4WORA 1IL8A 1B50A 4K2LA 4NP5A 3FMCA 2PNRC 3T56B 1AN8A 4BBRB 3HG9A 4WJWA 2BA1A 4KKUA 1PMRA 2L4NA 2QCPX 1ESFA 4UDUC 1LT3D 4HTHA 3MWYW 1CA6A 1MBYA 4DAPA 1I4QA 2AUJD 4C3HB 2B2WC 1GUTA 2F1MA 3MXPA 4RCNA 1GHJA 4EQOA 4DGZA 2PPBC 1Y8PB 2V4DA 1T5EA 3MHBA 4KJOA 4IUTA 1GUGA 2B63B 3M4YA 1VDZA 5CBAE 1WD0A 1G2SA 1EY6A 5KGUA 3FPPA 4DU9A 1OXTA 2J0TD 3K5LA 4FF1A 2R7ZB 3G7LA 2I46A 5M9OA 3PMFA 2NVXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OWF A;  3TP7 A;  4KJN A;  2F0L A;  3ERQ A;  4RKB A;  1EY7 A;  5KYI A;  2RDF A;  2RKS A;  4KV6 A;  2EY1 A;  5E1F A;  5C5L A;  5DEH A;  4PMB A;  4KHV A;  4NKL A;  1KAA A;  2PQE A;  1EY4 A;  3P1H A;  3SR1 A;  1EYA A;  2HQE A;  3TP6 A;  4S3S A;  1A3T A;  2EYJ A;  1SNM A;  4MIU A;  1JOQ A;  1KDA A;  1EY8 A;  1A3V A;  2PW7 A;  3MEH A;  4J1M A;  4K14 A;  3SK8 A;  1F2M A;  5C4H A;  2F0J A;  5I9O A;  1EY5 A;  5IOC A;  3OSO A;  3NHH A;  2LKV A;  1SNO A;  5CR3 A;  4IZ8 A;  5J22 A;  2EYP A;  3DMU A;  5DAU A;  4HMJ A;  5CV6 A;  4IAL A;  4K8I A;  1II3 A;  5I6Y A;  5J1Z A;  4WOR A;  3SK6 A;  4K2L A;  3QB3 A;  5C3W A;  5JAV A;  1A2U A;  1AEX A;  3T16 A;  4NP5 A;  4K8J A;  3RUZ A;  3QOJ A;  3C1F A;  3D6C A;  5IGF A;  3E5S A;  3D4D A;  4K6D A;  5CV5 A;  3T13 A;  1U9R A;  5I6W A;  3TP8 A;  1KDC A;  5HGT A;  1F2Z A;  3HZX A;  4LAA A;  2F0S A;  5KIX A;  3MVV A;  4N9T A;  4QF4 A;  2OXP A;  1TR5 A;  2OF1 A;  5NUC A;  4EVO A;  1EZ6 A;  5CV4 A;  1JOR A;  3EVQ A;  4B9W A;  2F0F A;  4QMG A;  5JOB A;  2SOB A;  4PNY A;  3V2T A;  1A3U A;  2F0D A;  2QDB A;  4F8M A;  5IOD A;  1STG A;  4ZUJ A;  4I65 A;  5IGG A;  4G57 A;  5IGD A;  1KDB A;  5EGT A;  3SXH A;  1STH A;  2F0P A;  4OL7 A;  2OEO A;  4QB4 A;  4KD3 A;  2EY6 A;  4ME5 A;  1TQO A;  5CV9 A;  5CV8 A;  3TME A;  2RBM A;  4EQP A;  5CGK A;  4KY5 A;  4RKL A;  1SYG A;  2EYL A;  4KY6 A;  4NDX A;  2F0Q A;  1SND A;  4HTH A;  4DFA A;  2WAC A;  2F0E A;  4PMC A;  5EKL A;  3SK4 A;  4N9P A;  2F3V A;  5CC4 A;  3OMC A;  3C1E A;  3SK5 A;  3LX0 A;  3MXP A;  4ODG A;  3NXW A;  1A2T A;  5J39 A;  3HEJ A;  5IGC A;  4R8N A;  2PZW A;  4KTA A;  1EQV A;  4E6I A;  4EQO A;  5IGE A;  4DGZ A;  3H6M A;  5C6A A;  2O4X A;  3D4W A;  4EQN A;  2NUC A;  1EY9 A;  1SYE A;  1STB A;  1JOO A;  4K2K A;  3NP8 A;  4KD4 A;  3TP5 A;  4J6H A;  2F0N A;  5ISR A;  3R3O A;  5EKK A;  2F0U A;  3U9O A;  4B9X A;  5KRU A;  1SYB A;  2KQ3 A;  2PZU A;  3ERO A;  3S9W A;  4H7B A;  4HMI A;  5CV7 A;  3VA5 A;  2F0V A;  3DHQ A;  2EYM A;  3MHB A;  5IGB A;  1SYD A;  1EZ8 A;  1EYC A;  5E3F A;  2ENB A;  1EY0 A;  2F0G A;  2EY5 A;  3BDC A;  2F0M A;  4KJO A;  5IIF A;  2EY2 A;  4ZQ3 A;  5C3X A;  1EYD A;  5C4Z A;  5K5P A;  2EYO A;  4NMZ A;  1IHZ A;  4ZUI A;  5KEE A;  2PW5 A;  2SNM A;  2F0I A;  2F0H A;  3ITP A;  5F2D A;  2EYH A;  1ENA A;  1EY6 A;  4TRD A;  5KGU A;  3D8G A;  3EJI A;  3MZ5 A;  5I9P A;  4K5V A;  1NSN S;  1SNC A;  4DU9 A;  1F2Y A;  1TT2 A;  4K5X A;  4KY7 A;  4DF7 A;  4IUN A;  2F0T A;  1SYF A;  1STN A;  1STA A;  3SHL A;  4K5W A;  1STY A;  2F0K A;  2PZT A;  4WRD A;  1SNP A;  2F0O A;  2SNS A;  1SNQ A;  3NK9 A;  2EYF A;  2EXZ A;  3NQT A;  1NUC A;  3NUC A;  3QOL A;  4F7X A;  2PYK A;  5HUR A;  3BDL A;  2F3W A;  1ENC A;  3P75 A;  5KYL A;  1RKN A;  2F0W A;  3PMF A;  1KAB A;  3OMG A;  1JOK A;  4ID6 A;  2KHS A;  4YIJ A;  5M9O A;  5C5M A;  2M00 A;  1SYC A; 
#chains in the Genus database with same CATH topology
 1W3S A;  1NBW A;  4FNF A;  4CDC C;  1PTO F;  4YHH L;  1T9H A;  2EY1 A;  2ZTC A;  4M1U B;  1AZP A;  3JAM L;  2PQE A;  5E4X A;  3LGJ A;  1DGS A;  4GN4 B;  1LTI D;  5DLQ E;  2CVR A;  3UDI A;  1KDA A;  2AQ2 B;  2ICI A;  3SK8 A;  5IOC A;  4BY1 B;  3GTJ H;  3GTL B;  2Y0S B;  1FVI A;  4XTC S;  1PTO D;  1C7Y A;  4ABN A;  2IL8 A;  3HOY H;  4DXG A;  4MHE A;  3QB3 A;  4C3J H;  3BZC A;  5C4X H;  5C44 B;  5AJ3 L;  1ZXT A;  1Q1B A;  1TS3 A;  2CH4 A;  1P8L A;  3HZX A;  4GLX A;  4DV1 L;  3GV6 A;  1LTT D;  3ERS X;  3EVQ A;  3HKZ B;  1B9M A;  1V1P A;  3C46 A;  1XXG A;  5GAH C;  4QY7 A;  1IW7 D;  1STG A;  1VQH A;  4XQQ A;  4I7Z C;  4Y7N H;  4KD3 A;  4GKJ L;  1NR2 A;  5JJI A;  1DCZ A;  3TQY A;  2EJG C;  3RLN A;  2BOS A;  1YIT A;  3T1H Q;  4H13 C;  5J39 A;  4KN7 C;  2JJQ A;  3SVM A;  2C35 B;  4JI2 Q;  4LF5 L;  3CKI B;  1PRT C;  3VR2 A;  5LMN Q;  1STB A;  2K6A A;  3TP5 A;  2LMC B;  1D1I A;  1CZG A;  3A8K E;  4XT3 B;  1HR0 Q;  1GUW A;  5FLX L;  1PZK D;  4FXK C;  4CKB A;  2ENB A;  5C3E B;  2ATW A;  4ZQ3 A;  1VMC A;  5FLX E;  3MTS A;  1KNA A;  4DAV A;  3JAM c;  1JE4 A;  3N6R A;  3D8G A;  1G8Z D;  1GUN A;  1Y14 B;  5JPN C;  1F2Y A;  1RD9 D;  4RCO A;  4IUN A;  2Q8T A;  1FJG L;  1STN A;  4UP7 A;  5M3M B;  3EIV A;  1KNE A;  3S1Q B;  4A93 B;  1CM9 A;  3IL8 A;  1MKH A;  4DV1 Q;  1VQ8 A;  2BDO A;  4YWM A;  4DR3 Q;  2ZT9 C;  3CD6 A;  5IP7 G;  5JJK A;  4C2M H;  1M1K C;  2GVB A;  3WOE A;  1HNZ L;  3KDF A;  1YJW A;  4GKJ Q;  1D6E C;  3E0J A;  1HFN A;  1X3F A;  2L11 A;  1L0X B;  4FO2 A;  1Y8N B;  3CMA A;  4BY7 B;  1QNK A;  4K14 A;  1I3Q B;  2L1B A;  3OSO A;  4Q0F A;  2MGS A;  4EX5 A;  1EOT A;  2I5L X;  3U4Z A;  4LF5 Q;  3TRZ A;  1GJX A;  4JPB W;  3T16 A;  2D0O A;  4A3B B;  3K5N A;  1TVX A;  1YNX A;  3BZK A;  3E0E A;  3KF6 A;  3MAQ A;  1I6H B;  1STE A;  5CV5 A;  3CQZ H;  1VCI A;  5M5W B;  2JK8 A;  1UE7 A;  1DM0 B;  2R3Z A;  1UEB A;  1AFP A;  4JI1 L;  1EEI D;  1KLG D;  2AQ3 B;  2B8G A;  2JA6 H;  1YBY A;  1H9S A;  1SFO B;  1KDB A;  3VR4 A;  3CC2 A;  1HA5 A;  4QB4 A;  4OHJ A;  5JVG 3;  5FLX c;  1EIY B;  5K36 H;  1OXX K;  3VA7 A;  1GUS A;  4IFD I;  1VQL A;  1H95 A;  4FF3 A;  4ZCK A;  4LMQ D;  3H91 A;  3I4N H;  2DNE A;  1SMY C;  3D4W A;  2A1A A;  1GXD C;  1K8M A;  5EBC A;  3J7A 5;  4A4I A;  3OYY A;  4KD4 A;  3N52 A;  3M7G A;  4JW0 A;  1Q7Y C;  2JA8 G;  3AMU A;  3GTK H;  5IP9 G;  4OX9 Q;  3GV3 A;  3PUZ A;  1EQR A;  5IIF A;  2WKD A;  4O42 A;  5JEA G;  1UUP A;  5JVH 3;  4TKO B;  2FMM A;  3I4M H;  3PO2 H;  2A74 C;  1WTO A;  4OEM B;  1L1O B;  3Q0A A;  4A3K G;  1QUQ A;  4B3T L;  1TII D;  1WD1 A;  4G7O C;  5HGQ A;  4RGO S;  4RGM A;  2K5V A;  2R93 H;  1AW7 A;  1E7Z A;  1TWG H;  4CJ0 B;  2FXQ A;  2F4I A;  1I4P A;  1JOK A;  3OMG A;  2KHS A;  4ZLT F;  2K32 A;  4K0K Q;  1BCP B;  2H5X A;  3HOZ H;  1PYB A;  4DR2 Q;  4BBS B;  2L55 A;  2RDF A;  1VQ5 A;  1FL0 A;  2JXM B;  2UXD L;  5COY A;  1SLJ A;  2XIW A;  1CK1 A;  3HOV G;  2AHO B;  4LF6 L;  3S16 H;  2WB1 B;  4IJL A;  1JJG A;  3MXN A;  4KI0 A;  2HQE A;  2I5H A;  5M5Y H;  2KCC A;  1WTQ A;  5I9O A;  3KJP A;  5KND A;  1XMQ L;  5EKI A;  2JA5 H;  1HZ9 A;  3OHX C;  1A2U A;  3FKI B;  1DON A;  4YWL A;  3NTI A;  2B2T C;  4GKK Q;  2L9H A;  4DKA C;  4A3F H;  1PH8 A;  1JE5 A;  2RQX A;  3H0G G;  1E2V A;  5C0X G;  1H9M A;  2VW9 A;  1G6Z A;  1P16 A;  2F0D A;  4DV5 Q;  1J6Q A;  5IOD A;  5IGD A;  1C48 A;  3PF5 A;  2IT1 A;  3RZO H;  2F0P A;  4OO1 I;  2DGY A;  2A5H A;  4DV6 L;  1Z7T A;  2R92 B;  3UDX A;  1L2F A;  3M3Y H;  2XVS A;  1QWY A;  1TWF H;  3S2D H;  1WCM G;  2B2U C;  3I4L A;  3SK5 A;  1HA6 A;  5EJW A;  4DR6 Q;  2E2H B;  1RDP D;  1XYI A;  1OXU A;  4B3M Q;  2GA4 B;  1LLR D;  1JB3 A;  4BBR G;  2XN9 C;  1B2T A;  5TSS A;  2E2I H;  4PQX A;  4ZK9 B;  5IWA L;  2HCI A;  1SBB B;  1EYC A;  4A3D B;  2EY5 A;  3IAY A;  4R1J A;  1X55 A;  5COR A;  1HFG A;  4MZ9 A;  5GAE C;  3S15 B;  1EWC A;  3OIQ A;  1SMX A;  2CFM A;  2F0H A;  3SEB A;  3PIP 3;  2NVY H;  4HJ5 A;  1ZKO A;  4KKT A;  4C3H G;  4A75 A;  1TT2 A;  1S4Z A;  2F0T A;  1SYF A;  3PCO B;  4QJF A;  4WRD A;  1BCP F;  3CCU A;  1HNW Q;  1SNQ A;  4FF4 A;  1YHQ A;  1RKN A;  2M9V A;  3AFQ A;  5M3F H;  3GTQ H;  4CKC A;  3J7A V;  4RGT A;  4A3J H;  1N34 Q;  2RSO A;  4DAY A;  4UHV A;  1FNW A;  1U4R A;  3S17 B;  1BCP D;  5GAD C;  3P1H A;  4DV6 Q;  2B63 G;  1EU3 A;  1X3Q A;  3TP6 A;  2IHF A;  1R4Q B;  1JOQ A;  5CBE E;  3HOW B;  1FGB D;  1A15 A;  1ONL A;  5L37 A;  3BVM A;  3A8J E;  5CV6 A;  4IPC A;  3ULJ A;  3O13 A;  1JMC A;  1VQA A;  4F87 A;  1Y1V B;  3PUX A;  4KKS A;  1X6O A;  3H15 A;  1L0Y B;  4HN7 A;  4N9T A;  4BS9 A;  2ZM6 L;  2E2D C;  2B2V A;  2UUA L;  1J5E L;  2XGT A;  1MHW C;  2IX1 A;  1QJO A;  3DWA A;  1Q8I A;  3RZD H;  1AE3 A;  4KLK A;  4LF9 L;  2DJG C;  2EYL A;  3UE1 A;  5I2X A;  4BY1 G;  4PMC A;  5ELD A;  1ML0 D;  2Y0S G;  3DWP A;  5CC4 A;  3HOX B;  2G9H D;  1A2T A;  5IGC A;  2Z4I A;  4R8N A;  2Q2T A;  1IW7 C;  4E6I A;  5C44 G;  1E0B A;  4HSP A;  3JC6 6;  1U0L A;  3M4P A;  3HKZ G;  1WTV A;  1MJC A;  3H3V C;  1BNZ A;  1HTP A;  1BKB A;  4JI4 L;  1D5Z C;  1UE6 A;  2EYO A;  1PYS B;  1UAP A;  5KEE A;  3HKS A;  4KHZ A;  2EPB A;  3GTO H;  1UEA B;  1BUV T;  5LMU Q;  3Q22 A;  1X54 A;  4PZ8 A;  4DF7 A;  4LWC A;  2Y0S E;  1STA A;  4L5Q A;  1QNU A;  3GTP B;  1R9T H;  1K3R A;  4A3G G;  1JJ2 A;  2PYK A;  1N36 L;  4XIG S;  1NTG A;  3CF5 A;  4HIO A;  1UE5 A;  1GVP A;  1N32 L;  2UUA Q;  2EOT A;  1YJ9 A;  1J5E Q;  3J80 i;  1SN8 A;  1I94 L;  1BQQ T;  2RKS A;  1LT5 D;  2MP1 A;  4N8X 1;  2UUB Q;  2NVQ H;  1CI3 M;  4PMB A;  1HNX L;  3CAM A;  3HKZ E;  2QDL A;  5C3E G;  2AQ1 B;  1WOC A;  2ID0 A;  4X64 Q;  2AKW B;  2QEX A;  4LFC L;  4HR7 B;  3K6O A;  2EYJ A;  1PFM A;  1SR3 A;  1TS5 A;  4UP9 A;  4HIM A;  1D5X C;  1EY5 A;  5IYB G;  2KED A;  3DMU A;  2EQS A;  4RWS C;  4GNX C;  4K8I A;  4DV3 L;  5M3M G;  3GTG B;  5J1Z A;  2VQE L;  1QZG A;  1CFM A;  4A93 G;  1B1Z A;  1SRU A;  5C3W A;  1AEX A;  1TWA B;  4OEL B;  3I2Z A;  4B3R Q;  3D6C A;  3D4D A;  4A76 A;  5D3D A;  5E4W C;  2KCM A;  5FO9 B;  4YY3 L;  3ULP A;  3VYT A;  2HHH Q;  3L0O A;  1PH4 A;  2K5N A;  5DNF A;  2Z6K C;  1LTR D;  4DK3 C;  2IJ0 A;  3OOC A;  1A3U A;  4C1N K;  5IP7 H;  4QUF A;  3SXH A;  3MFY A;  2CQO A;  4BA2 I;  5CV8 A;  1HZC A;  3OTO Q;  1YJN A;  3NWS A;  1VQ4 A;  2RHS B;  1CSP A;  5GRO A;  5EKL A;  3SK4 A;  4IUR A;  3VR3 A;  4GN3 B;  1I4G A;  3DWQ A;  3S17 H;  2YTV A;  1HQM C;  4P2C B;  1CZW A;  3MXU A;  1YNN D;  2KOL A;  4DV7 Q;  1B7Y B;  3J7A F;  1N32 Q;  3ND8 A;  4A3B G;  3BU2 A;  3H6M A;  5FOB B;  5C6A A;  2O4X A;  5FO8 B;  1XMO L;  2NUC A;  1Q82 C;  2NTT A;  4I7A A;  1YIJ A;  2KA7 A;  3R3O A;  3X3M A;  1EFW A;  4HJ7 A;  4XDX A;  2BA0 A;  1LYL A;  5IGB A;  1LTA D;  3BZD B;  1QE6 A;  1BBX C;  5K5P A;  4FYD A;  3CRK C;  4ILW A;  4FDB A;  1A8V A;  4KK7 A;  4GOP C;  2JA9 A;  2C9O A;  2SNM A;  2R61 A;  1WTH A;  1TWC B;  4DV3 Q;  5KNB A;  3FEW X;  1NSN S;  2QF7 A;  4K5V A;  2VQE Q;  1TWH H;  2YTY A;  1V1Q A;  5T1G A;  3I55 A;  3BVG A;  3X3N A;  1JT8 A;  4A3L G;  1BOS A;  4DR1 L;  2EXZ A;  3A55 A;  3D3R A;  4F7X A;  3QOL A;  3WDN A;  5C4J B;  4DA2 A;  1PV4 A;  4QL5 A;  2M2L A;  3Q24 A;  2J7Z A;  1DYQ A;  1GOZ A;  2NBF A;  3U4V A;  1EY7 A;  1X56 A;  4YCV A;  1DOM A;  2JA8 H;  3DM3 A;  2K04 A;  2MJ8 A;  1KLU D;  2OT2 A;  3I56 A;  5IP9 H;  4F88 A;  2EZV A;  1EWH A;  1HJP A;  2NVT B;  2YU9 H;  3ZJY C;  2OTL A;  1EY8 A;  1A62 A;  4IO9 A;  5JEA H;  4EQ5 A;  3S14 B;  1S40 A;  2ZTD A;  3AEV A;  4IZ8 A;  4V0B A;  5DAU A;  3F2U A;  4GNX B;  3F8T A;  1JC7 A;  4PMW A;  3OWE B;  4YCU A;  4LF7 Q;  3PUV A;  1XMO Q;  1HCZ A;  3L7Z C;  4KHP Q;  2B2W A;  4X3S A;  4A3K H;  1VQ6 A;  3S1M B;  1XTC D;  1IBK L;  5IGF A;  1CT1 D;  1LT6 D;  3KFU A;  4DR7 L;  4BBS G;  3IFD A;  4LFB Q;  2CWA A;  1MSG A;  2EJF C;  3JAM E;  1I6V C;  2WB1 G;  4ZUJ A;  5IGG A;  1STH A;  1B53 A;  3HOV H;  1TQO A;  3NTK A;  3VR5 A;  3EN2 A;  2MHV A;  4KY5 A;  1FNU A;  2WII B;  4TVA B;  1KHI A;  1QZH A;  4DR1 Q;  3R93 A;  1WJJ A;  3LX0 A;  4JYA L;  1T5X D;  4IQZ A;  1SAP A;  1D5M C;  4H0L C;  4OGQ C;  3A8I E;  4X6A H;  1HZB A;  3FKI G;  1KXL A;  2Q8I B;  3NPP A;  2HCC A;  1DZ1 A;  4AQY L;  1EY9 A;  2DUD A;  1TS4 A;  3HOU B;  4FP5 D;  1K3B C;  2PMZ B;  4JBM A;  2PZU A;  3ERO A;  4H7B A;  2IPK D;  1K83 B;  1LTG D;  3VA5 A;  5LHY 1;  5D14 A;  3LWE A;  1SYD A;  2E76 C;  3H0G H;  1HXY D;  3FHW A;  3F2C A;  5C0X H;  4DV4 L;  1PA6 A;  3EQL C;  4GOP B;  5CMD A;  3M9B A;  1HUN A;  2F4V Q;  2WB1 E;  1VQI A;  3ITP A;  4RHS A;  2R92 G;  2PO4 A;  1PTO H;  1V1O A;  4A3G B;  5H1S E;  1PFB A;  3SHL A;  4IUQ A;  4QGU A;  3NK9 A;  4YHH Q;  5T1I A;  3NQT A;  1NUC A;  1WCM H;  3VYS A;  3PO3 B;  4DR7 Q;  1MIU A;  2XSC A;  3D31 A;  2HQL A;  3K57 A;  3NBH B;  2PNH A;  1C8C A;  3W3A A;  4JK1 C;  1EQQ A;  2A6H C;  4DUZ L;  2D9U A;  5GAG C;  1HQR D;  2ICE C;  4WJ4 A;  5FJ8 G;  2JEA I;  4BBR H;  4A3D G;  1XNQ L;  2D0P A;  3W1B A;  4X3U A;  2RA4 A;  4X62 L;  1L1O C;  2K5Q A;  3D0F A;  4POG A;  2BCO A;  1HH2 P;  1YZ6 A;  2KVM A;  5EPK A;  5AJ3 Q;  2L15 A;  4NB3 A;  5BR8 L;  1AE2 A;  2MUY A;  4IFD J;  4A3E B;  3T1Y L;  1IBM L;  3J81 j;  4C3H H;  1BCP C;  1QVF A;  1VQK A;  1X3G A;  1D2B A;  2KCT A;  2UXC L;  2AWN A;  3ND9 A;  3A7A B;  1NR4 A;  1F9P A;  1VQE A;  4GZY C;  1HPC A;  2NZ1 D;  3BJU A;  4QIW B;  2EDG A;  2QDB A;  1HTL D;  4DUY L;  4I65 A;  2OEO A;  4ME5 A;  3TRE A;  4FXD A;  4RKL A;  4DFA A;  3HOW G;  2B63 H;  3C1E A;  1OO9 B;  1QB5 D;  3FRP B;  4NPS A;  3PSI A;  4OIJ A;  4ODG A;  3HEJ A;  4HSV A;  4CDF C;  4ZYS A;  1L1O A;  4YWK A;  1MJE A;  2XRQ D;  1I4H A;  1YVC A;  3JAM i;  4DUZ Q;  1B4O A;  1PFN A;  5ELO A;  1Y1V G;  2N88 A;  4DR5 L;  2JA7 B;  2R7Z H;  2B2Y C;  1RF2 D;  3NTH A;  2NVX H;  2HIV A;  4JOI C;  2HD3 A;  1XNQ Q;  3A0J A;  1E22 A;  3DEP A;  4A3M B;  2K28 A;  5ELN A;  2EYM A;  4X62 Q;  1K73 C;  1H9R A;  2R6G A;  3J7Z C;  1FJG Q;  3T53 B;  1BR9 A;  3K5M A;  2PW5 A;  1K0S A;  3U9S A;  1Z47 A;  1IYJ B;  2MO0 A;  4O0A A;  2Q8R E;  1SE8 A;  2HDM A;  3WOF A;  3HOX G;  3PIP A;  3T1Y Q;  1UE1 A;  5JPM C;  1CKN B;  2E75 C;  4BY1 H;  1PZI D;  5KNC A;  3GTL H;  5M5X B;  2SNS A;  3M4O B;  2EYF A;  1V8Q A;  1PLF A;  2RDG A;  4R4O A;  1HNZ Q;  3G4S A;  2F0W A;  5FLM G;  2E2J B;  3RLF A;  5ISR A;  3TP7 A;  3S2H B;  1H9K A;  5C44 H;  3GTM B;  3NQI A;  2JE6 I;  2E74 C;  5BN4 A;  4G4K A;  5E1F A;  4FF2 A;  4KHV A;  3CCJ A;  4H44 C;  1KRT A;  1KAA A;  2Q2H A;  4UP8 A;  3KUP A;  1LTL A;  1R4P B;  2KEC A;  2L12 A;  3PUW A;  4U68 A;  4S3S A;  4PV1 C;  1CHP D;  1F2M A;  5GQO A;  2BE5 D;  1Q12 A;  2MPM A;  1O78 A;  1SNO A;  4RAU C;  2MNA A;  3GD7 A;  3IKJ A;  4B3S L;  4IOA A;  2Z9H A;  1FD7 D;  1O7I A;  5EPL A;  4JI1 Q;  5HY6 A;  2WAQ G;  3C1F A;  3E5S A;  5IY0 A;  4A3G H;  3I8Z A;  3K7A B;  3URY A;  2DNC A;  1ESR A;  5NUC A;  2OF1 A;  2H4O A;  5CV4 A;  2EXD A;  4B9W A;  2DY8 A;  2SOB A;  1QVG A;  4F8M A;  3BS1 A;  2F52 A;  1Y1W B;  1D8L A;  4X3K A;  3CCS A;  1SJE D;  1KRS A;  1SYG A;  5C3E H;  4HIK A;  3UE0 A;  3QR8 A;  4CJ2 C;  2B3G A;  3HS0 C;  3CXC A;  1C4Q A;  4R4Q A;  1A0I A;  1PYW D;  2PI2 E;  4R4T A;  4NXM L;  1XPO A;  5IYB H;  2QW7 A;  2Q2I A;  1F9S A;  3NWT A;  2GN5 A;  4C3J G;  3NEN A;  4C3I B;  1EOV A;  5M3M H;  3S1Q H;  4A93 H;  1U4M A;  1JOO A;  4UAI A;  3S1N B;  2WAQ E;  2P5Z X;  3A56 A;  2E5L L;  1CQF A;  5FK9 C;  1BBU A;  4POF A;  1K8O A;  2Z8L A;  3H94 A;  4HMI A;  2UUC L;  1YNN C;  4G7Z C;  4X66 L;  3J81 L;  5EAY A;  1L0W A;  1EYD A;  1WFQ A;  4B3T Q;  2QIL A;  3C3L A;  4TRD A;  2K14 A;  2ZJQ A;  3KF8 B;  1TKW B;  5A2Q L;  4BY7 H;  2IX3 A;  1SE3 A;  2VZA A;  3RLO A;  1I3Q H;  1V9P A;  2LS0 1;  4DPG A;  1O7L A;  2UXD Q;  3BYY B;  4FXG C;  5E7N A;  5IYC H;  4ZKB B;  3ULL A;  3DM1 A;  4LF6 Q;  1J9O A;  1SDF A;  4A3B H;  3EFX D;  1I50 B;  3K5O A;  1WTW A;  1I6H H;  2B2T A;  2VUM G;  2A68 D;  4CBV A;  2N55 A;  1XMQ Q;  4DAM A;  5M5W H;  1ET9 A;  1JJC B;  3Q23 A;  4NKL A;  4JBK A;  2A6H D;  1BF4 A;  1B3A A;  4JI3 L;  3IFT A;  2K33 A;  1SFO H;  3VYU A;  3OW2 A;  2NWG A;  1EUJ A;  4DNR B;  5CR3 A;  3K0X A;  3J80 L;  1G51 A;  2EYP A;  4IUV A;  4PZ6 A;  1PH3 A;  3D4R A;  2VQF L;  1BDO A;  3ZYY X;  3G6J B;  2C5C A;  4G7H C;  2B2U A;  4R4C A;  4A3L H;  4ULL A;  1N33 L;  3T13 A;  1F77 A;  1K28 A;  3I3C A;  1F2Z A;  3CU7 A;  2V1C C;  1PFS A;  4X66 Q;  1V43 A;  3UDG A;  2BH8 A;  3Q6S A;  3TZU A;  1OTC A;  1JOR A;  3KLW A;  1DOL A;  5I2Y A;  2NB0 A;  2KEN A;  1KC8 C;  1EL0 A;  1LUZ A;  1M8A A;  3D6W A;  2I0Q A;  2F0Q A;  1SND A;  4DXF A;  1CKM A;  4OON A;  3J81 c;  2K01 A;  2F3V A;  3RR5 A;  2E8G A;  2FJ2 A;  3HP3 A;  1M4V A;  1DD2 A;  5IWA Q;  3NEM A;  1SSO A;  3S24 A;  3MFG A;  5JJZ A;  1QVC A;  4K2K A;  3NP8 A;  3I91 A;  2N8N A;  1O80 A;  4JBJ A;  5EKK A;  2Z4H A;  1SE2 A;  1A63 A;  1ZYR D;  1TU2 B;  3DHQ A;  4BBS H;  1KL9 A;  4JI3 Q;  4EGV A;  4V19 0;  4GS3 A;  4ZUI A;  2A69 D;  3E6Z X;  5K36 G;  2VS1 A;  4OXP A;  2VQF Q;  3TSS A;  3G71 A;  4K5X A;  4JVZ A;  1CA5 A;  2PZT A;  1JWS D;  3F1Z A;  1N33 Q;  5A35 A;  3NUC A;  4WJ3 M;  3I4N G;  2NN6 G;  2EE1 A;  1NJI C;  3K0Y A;  4ZAI A;  3FKI H;  1K8G A;  2F0L A;  5AFW A;  3HRZ C;  3HOU G;  3UDF A;  4DAY B;  3M7N A;  1Y69 U;  4XQN A;  3S1R B;  4RG1 A;  3STB D;  2FMC A;  4IUU A;  2KHI A;  1G29 1;  3SR1 A;  5FO7 B;  2A8V A;  1EIH A;  3LNN A;  1A3T A;  1MI2 A;  3MEH A;  2PW7 A;  1CKO A;  1XPR A;  2O5I C;  1LM0 A;  3I4M G;  3NHH A;  2ES2 A;  3M85 A;  2R92 H;  2WAQ B;  4B08 A;  4PG3 A;  2ZM6 Q;  3CCQ A;  1EIG A;  2X69 A;  4R9W A;  2RCN A;  3PO3 G;  1QCB D;  3CHB D;  5JAV A;  4A3I B;  1SJH D;  1MD2 D;  1YHB A;  2R93 G;  3QOJ A;  2E2H H;  2JN4 A;  4RA8 A;  1KDC A;  3DEO A;  4LF9 Q;  3BG3 A;  1LAC A;  5DM6 3;  3GO5 A;  1EZ6 A;  4CHT B;  2F0F A;  1Q86 C;  2PMZ E;  5I4D A;  4P71 A;  1LV9 A;  1U4P A;  1W2B A;  3OIP A;  3GTJ B;  4R8I A;  1JB7 A;  2D5D A;  4A3D H;  3S15 H;  2F0E A;  1NMG A;  1RTN A;  1PH6 A;  5G3L F;  3CP0 A;  1TS2 A;  2LXK A;  4C3J B;  1M90 C;  1IBL L;  3P20 A;  4A3E G;  5C4X B;  1S5C D;  2OQK A;  1EFI D;  5CYU A;  2A6E D;  4IUP A;  4KTA A;  1G91 A;  4RFB A;  4JI4 Q;  4P75 A;  4A3F G;  3K59 A;  4MTN A;  1UWV A;  3CW2 C;  1YNJ C;  1MSH A;  5G3L D;  3HFZ B;  1ZEQ X;  4ZKC B;  5CV7 A;  5FKA C;  5LMN W;  2F0V A;  3CCM A;  4Y7N B;  2CKZ B;  2F0G A;  1EY0 A;  4PZ7 A;  4JV5 L;  2RSN A;  1RL2 A;  5JJL A;  5C4Z A;  2YTX A;  4L5T A;  1IHZ A;  1PHJ A;  2Q2U A;  2A19 A;  1HR0 W;  3R8B A;  2F0I A;  3PV0 A;  1N36 Q;  5C0X I;  1RJT A;  3V96 A;  4XYO A;  3HOW H;  1GM5 A;  2Z0S A;  4GLA C;  1I94 Q;  1EWI A;  2F0O A;  2MFI A;  1FGU A;  4XXE A;  4GNX A;  2VUM B;  1HNX Q;  4U67 3;  4YIJ A;  5EBD A;  2JA7 G;  3RD4 A;  4X3T A;  4LFC Q;  5KYI A;  1Y1V H;  2DJF C;  3IRB A;  4LW1 A;  4L5R C;  4A3M G;  4IFD G;  2X6G A;  1A6X A;  2JSO A;  3CCV A;  3TBI B;  3TZD A;  1KQS A;  2WV6 D;  4QIW E;  1B70 B;  1RIP A;  1E2Z A;  1ENF A;  2Z6K A;  1AP0 A;  1CUK A;  1EYA A;  1VQD A;  1XTD A;  1SNM A;  2RHQ B;  1XX8 A;  4JG2 A;  1RHP A;  4BXX G;  1IBL Q;  1PH2 A;  2ZXP A;  3GQB A;  1IYU A;  1WTX A;  1ILP A;  4IPG A;  4YY3 Q;  4XT1 B;  1LO5 D;  3HOX H;  4ALP A;  2B29 A;  4GN5 A;  4HED A;  1OXS C;  4KN4 C;  3H3V I;  4K8J A;  1B3Q A;  2ZJR A;  4C2M B;  1YEZ A;  3MEF A;  5HGT A;  4QCL A;  4LAA A;  3PQI A;  3SGI A;  1S3O A;  2BE5 C;  3MVV A;  4A3J G;  1W6K A;  1JQY D;  4PNY A;  2K4K A;  3OPO A;  3V2T A;  3K7U C;  2ALY B;  4YCW A;  3VR6 A;  4OL7 A;  3EBE A;  5CGK A;  4C56 C;  3MC0 B;  4NDX A;  4GOP A;  3OMC A;  1GUO A;  1Q81 C;  1EIF A;  3NXW A;  2HT1 A;  1BVS A;  2K03 A;  1EQT A;  4QUC A;  3CQZ B;  1J8I A;  3GTP H;  1K0R A;  2VL6 A;  2CW0 D;  4CKE A;  3T1H L;  1U5K A;  1X3P A;  2KBN A;  2TSS A;  3NBH A;  2JA6 B;  4JI2 L;  1EZ8 A;  1G2T A;  2RVL A;  1C9O A;  3NBI A;  2F0M A;  5LMN L;  2EY2 A;  4L5S A;  1H9J A;  1Y1W G;  2NTS A;  4CDD C;  1S72 A;  1NAP A;  2WFW A;  1XJV A;  1WTR A;  5IYD G;  1HR0 L;  1VQF A;  3MZ5 A;  1D7Q A;  1Z9F A;  1EU4 A;  3I4N B;  3I90 A;  3KK7 A;  4K5W A;  3L9A X;  1JCK B;  4L8J A;  4C3I G;  3DUZ A;  2ASB A;  2BH2 A;  1ENC A;  3GTG H;  3GTK B;  3A54 A;  3PUY A;  2D62 A;  4OO1 G;  1DXM A;  1TWA H;  1JIC A;  1ROD A;  4IPD A;  2R7F A;  2HDL A;  3OW7 A;  3B6Y A;  1PH7 A;  3CCE A;  2BDN A;  1MGS A;  3J7Y W;  5ELF A;  1XWE A;  1AH9 A;  3I4M B;  4LF4 L;  3PO2 B;  2PQA B;  4DR3 L;  1Q8K A;  3V05 A;  4MIU A;  5C4H A;  4RGN A;  4LFA L;  1IBK Q;  2NN6 I;  2OTJ A;  4JI7 L;  5ELC A;  2A68 C;  4HCE A;  3A5Z B;  1VQ7 A;  2AMC B;  4KMU C;  2R93 B;  1TWG B;  3SK6 A;  1B9N A;  3I73 A;  5D3I B;  1IYV A;  3HOZ B;  3KYH C;  1LTS D;  3SDZ A;  5DM7 3;  3PIO 3;  2IX0 A;  3QJY A;  3S16 B;  2OXP A;  2Z1C A;  4OWW B;  1JR0 D;  3ER0 A;  5JOB A;  2VUM H;  1O7Z A;  5J3B A;  5M5Y B;  4JYA Q;  4G57 A;  5EGT A;  1NCV A;  3H3V H;  2EY6 A;  5J22 A;  4EQP A;  4CGY B;  4KY6 A;  1TY0 A;  2KEE A;  2JA5 B;  4AQY Q;  4XYQ A;  3CC7 A;  4JBW A;  1TWC H;  4RMF A;  3KJO A;  3NE5 B;  4A3F B;  1KD1 C;  3QIA A;  1CKN A;  2B39 A;  4DV4 Q;  4EQN A;  1V1P B;  5C4J H;  3AYH B;  1KAW A;  1DJR D;  2LY7 A;  2CHB D;  5EPJ A;  3U9O A;  2VB2 X;  4LF4 Q;  4UY8 C;  1S5D D;  3RZO B;  4X65 L;  4XQJ A;  3I7F A;  3KLS A;  4RHR A;  3KOJ A;  4LFA Q;  4NMZ A;  3BYT B;  1YNJ D;  3NSW A;  4JI7 Q;  1LTB D;  3M3Y B;  5ELE A;  1TWF B;  3S2D B;  2OWO A;  2XWB B;  4DNT B;  4OX9 L;  2NVT H;  1SNC A;  2IHE A;  4LF8 L;  1ZYR C;  1HUM A;  1S5B D;  3R2I A;  2CQA A;  1E1O A;  1STY A;  3T51 B;  3S14 H;  1PDQ A;  2O2L D;  1VMP A;  3C2P A;  2FIN B;  3TN2 A;  3BDL A;  1ASZ A;  5KYL A;  2A69 C;  1IKM A;  2E2I B;  5C5M A;  2M00 A;  4TQU S;  3S1M H;  2I5M X;  4AYB B;  1IKL A;  2ZXO A;  1Q1E A;  2LFN A;  5C5L A;  2ZTE A;  2QKI C;  5BR8 Q;  1D1K A;  2EJM A;  1E2W A;  4K0K L;  4L6T B;  1IBM Q;  2NVY B;  1LAB A;  4DR2 L;  4LUV A;  4DK6 C;  1F9Q A;  1A3V A;  2UXC Q;  2LKV A;  5BN3 A;  3L2P A;  4HMJ A;  4IAL A;  2B8F A;  3STB C;  2AWO A;  1GKH A;  1VQJ A;  2KUM A;  3GDE A;  2GVA A;  4A3C G;  1SE4 A;  5M3F B;  3GTQ B;  3I70 A;  4A3J B;  1VQ9 A;  2XNA C;  4DUY Q;  1ASY A;  2N3S A;  5I6W A;  3KDF B;  2H1E A;  4Z9C B;  2F0S A;  2NN6 H;  2G9D A;  1TR5 A;  1PRT B;  4EVO A;  4X65 Q;  4FVM A;  4DK0 A;  1E24 A;  2B2Y A;  1NY4 A;  3HOU H;  2UXB L;  3VDY A;  4GKK L;  3CRL C;  4JOI A;  1K83 H;  3TME A;  2LXJ A;  3BDO A;  2RBM A;  4LF8 Q;  2OCE A;  2WKC A;  2WAC A;  1CTM A;  4N9P A;  4DR5 Q;  4DR4 L;  1VQO A;  2A73 B;  4DV5 L;  1DOK A;  3KF6 B;  3KF8 A;  4A3I G;  4K6L A;  2K52 A;  2JP1 A;  2DN8 A;  4TSS A;  3FP9 A;  4UPA A;  4C1N I;  3PO3 H;  3LWU A;  2KHJ A;  1PVO A;  1H9S B;  2KQ3 A;  4DR6 L;  2NYZ D;  1FR3 A;  4B3M L;  3DXJ C;  3RZD B;  1BXT A;  1OXV A;  2A6E C;  1Y8O B;  1QIL A;  4NW2 A;  1IL2 A;  3KBG A;  2L5T A;  2D2C C;  1HRJ A;  3FVQ A;  3FDT A;  5F2D A;  1ENA A;  5EQ0 A;  3HOY G;  4BA1 I;  4MNO A;  2I07 B;  4MN3 A;  4BWG B;  4HJ8 A;  1Q90 A;  1SEB D;  3CPF A;  5C4X G;  3FPU B;  1SNP A;  2K1B A;  5ELB A;  4DV0 L;  1XPU A;  1VQM A;  1WVL A;  2K75 A;  1JWU D;  1GHK A;  3P75 A;  4A3E H;  3R2T A;  1WYD A;  3OWF A;  3ERQ A;  4RKB A;  1IXR A;  1EEF D;  2UXB Q;  1HNW L;  3QO2 A;  3QG1 A;  1I4R A;  1FNV A;  3J81 E;  3MXG A;  1EY4 A;  5IT9 L;  4B3S Q;  1E1T A;  3GTO B;  2HIX A;  3RMH A;  4WFN 3;  1RTO A;  4DR4 Q;  1N34 L;  5IT9 E;  1BO0 A;  1QUQ B;  2QEJ C;  4R4I A;  2RDH A;  5A2Q E;  2YYZ A;  3K81 C;  1B8A A;  1R9T B;  1VF7 A;  3A5U A;  2UU9 L;  2HUG A;  5I6Y A;  3TS2 A;  4IN3 A;  2WIN B;  1PRT F;  4M8A A;  3UI2 A;  2FFK B;  4K6D A;  1QG7 A;  3TP8 A;  4L63 B;  4O1N A;  2VXW A;  2NVQ B;  5KIX A;  1I4X A;  1JWM D;  2KJX A;  4QF4 A;  3SE0 A;  2JA7 H;  3MXN B;  4LUZ A;  1W6J A;  1EYG A;  3KBX A;  1YHA A;  4OIK A;  4IFD H;  4A3M H;  4NXM Q;  5CV9 A;  1S5F D;  3E3X A;  3L3O C;  1PH9 A;  1PRT D;  3ONA B;  1KTK A;  1PXU A;  3J80 E;  4DV0 Q;  3TS0 A;  2QGQ A;  2FHT A;  2E5L Q;  2SEB D;  3A7L A;  4BXX H;  2RF4 A;  2UUC Q;  1EQV A;  5BN5 A;  5M5X H;  2F3I A;  3M4O H;  2B2V C;  2EVB A;  3H09 A;  1Q3L A;  3TEH B;  4J6H A;  2F0N A;  4DNI A;  2F03 A;  4HID A;  2F0U A;  2E2J H;  1X9N A;  4N8F A;  1SYB A;  4ZRZ A;  3S9W A;  1CHQ D;  1GO3 E;  3S2H H;  3GTM H;  1Z6H A;  3K58 A;  2DY7 A;  5E3F A;  3WWV A;  3CC4 A;  2VNU D;  2IWH A;  1G6P A;  1NNX A;  3MA2 B;  1VQN A;  2CW0 C;  2UU9 Q;  4IOC A;  2EYH A;  3NEL A;  3EA6 A;  2TMP A;  5IT9 c;  3EJI A;  2PI2 A;  1HZA A;  4KY7 A;  4JC0 A;  2AUK A;  2F0K A;  4JI5 L;  2VB3 X;  3T4A C;  3RNU A;  4HJA A;  1LT4 D;  5LMU L;  5JEA J;  1KAB A;  3AB9 A;  4LNQ A;  1SXT A;  3TDQ A;  1N9W A;  2R7Z G;  4KJN A;  1PH1 A;  2JA6 G;  2MO1 A;  1U4L A;  4AH6 A;  3K7A H;  3BVZ A;  3VYR A;  4IPH A;  1N8R C;  3CCR A;  2K05 A;  1WI5 A;  1ICF B;  3U50 C;  1PTO C;  1PZJ D;  1UNS A;  1VF5 C;  2SDF A;  1CSQ A;  1TWH B;  4HCS A;  3W2D A;  4J1M A;  2XWJ B;  3CPW A;  1Y1W H;  2UUB L;  3AU7 A;  3U58 A;  1X65 A;  3GP7 A;  2CH4 W;  2K5D A;  1FYC A;  3J80 c;  4JI6 L;  5IYD H;  1II3 A;  4X64 L;  1ET6 A;  2X6L A;  1HHV A;  2JYO A;  1CQV A;  2JEB I;  3RUZ A;  3AQQ A;  4IJH A;  3J81 i;  2YV5 A;  4J8Q A;  1U9R A;  4C3I H;  1WTP A;  1E3P A;  1S5E D;  2JA8 B;  2JQO A;  3E9I A;  3S1N H;  4OO1 H;  1SRO A;  4QMG A;  2CWP A;  2J4X A;  4HJ9 A;  2YU9 B;  4LUO A;  4B3R L;  3P7J A;  1SMY D;  3PO2 G;  4NXN L;  2K7V A;  1IZ6 A;  4OWX B;  5IE8 A;  2HHH L;  1F9R A;  2G5D A;  4LK1 C;  2VY3 A;  3PGZ A;  4Q5V A;  4JI5 Q;  5C0X J;  4DK1 A;  4A3K B;  5LL6 S;  4JCV E;  1F2L A;  3HGB A;  2PZW A;  3OTO L;  3CME A;  5IGE A;  4HAE A;  3HOZ G;  4RH6 A;  1BBW A;  1SYE A;  1TY2 A;  3CCL A;  4AIM A;  2K50 A;  1ICW A;  1K8A C;  4B9X A;  2L0C A;  5KRU A;  1O7Y A;  4DV7 L;  2LSS A;  4DN4 M;  1I50 H;  2IW3 A;  3I4O A;  5FJ8 H;  1X3E A;  3HOV B;  1QOH A;  3BDC A;  1TXY A;  3KLS X;  5C3X A;  4Y52 H;  1VQC A;  3HOY B;  2PCF B;  3M4Q A;  4JI8 L;  2EIF A;  2R7D A;  4JI6 Q;  4J15 A;  2JA5 G;  5I9P A;  2O5J C;  2RCF A;  3F2D A;  2K5W A;  5LL6 X;  3K8A A;  1VS0 A;  4O2D A;  2N49 A;  4JI0 L;  3G6E A;  5HUR A;  2F3W A;  4CJ1 B;  4ID6 A;  3AFP A;  1SYC A;  4LJZ C;  1B44 D;  3H0G B;  1AZQ A;  2XRS D;  4KV6 A;  1PH5 A;  3KLR A;  4NXN Q;  5DEH A;  2NZH A;  3E9H A;  1PTO B;  1XNR L;  1RCV D;  2KCN A;  2Z6B A;  1NMF A;  2F0J A;  3QWN A;  3I72 A;  2ZXR A;  1X32 A;  4CDE C;  4BY7 G;  5D65 A;  1WCM B;  1ILQ A;  2WP8 J;  4WOR A;  1IL8 A;  4DV2 L;  1B50 A;  4K2L A;  3W5O A;  4NP5 A;  4OWT B;  3FMC A;  5IYC G;  1VQG A;  3W1G A;  2PNR C;  2K5H A;  4AYB G;  3T56 B;  1AN8 A;  4BBR B;  4LF7 L;  3PIO A;  3HG9 A;  4WJW A;  2BA1 A;  2MQH A;  3A74 A;  4KHP L;  4KKU A;  1KIX A;  1PMR A;  3PF4 A;  2L4N A;  2QCP X;  4APV A;  1ESF A;  4JI8 Q;  4UDU C;  4GLV B;  2NZO A;  2CCZ A;  4LFB L;  1LT3 D;  4HTH A;  3MWY W;  1CA6 A;  2N78 A;  1MBY A;  4DAP A;  1I4Q A;  2AUJ D;  4C3H B;  3ICE A;  2B2W C;  1GUT A;  4JI0 Q;  2F1M A;  3MXP A;  3DLL A;  1Q46 A;  4MTK A;  4RCN A;  2IY5 B;  1VQB A;  1GHJ A;  5M3F G;  4EQO A;  4DGZ A;  2PPB C;  3F2B A;  3Q8D A;  5FLM H;  2XTI A;  4JV5 Q;  1Y8P B;  4A3C H;  2V4D A;  4P74 A;  2OQ0 A;  4QQB X;  4AYB E;  1VQP A;  4ME3 A;  1T5E A;  3K80 C;  1K9M C;  3MHB A;  4P72 A;  1XNR Q;  4KJO A;  4IUT A;  3S1R H;  1GUG A;  4H02 A;  2B63 B;  1C0A A;  3M4Y A;  1VDZ A;  5CBA E;  1WD0 A;  1I5F A;  1G2S A;  3RN2 A;  1EY6 A;  5KGU A;  2QA4 A;  1YI2 A;  3FPP A;  4DU9 A;  1OXT A;  2PQA A;  4DV2 Q;  2J0T D;  3K5L A;  4FF1 A;  3G48 A;  3RN5 A;  2ZJP A;  2F4V L;  2R7Z B;  4P73 A;  3G7L A;  1NE3 A;  2I46 A;  5M9O A;  3PMF A;  2NVX B;  1GD7 A;  4A3I H; 
#chains in the Genus database with same CATH homology
 4FNF A;  1PTO F;  2EY1 A;  4M1U B;  1AZP A;  3JAM L;  2PQE A;  5E4X A;  1LTI D;  2CVR A;  1KDA A;  2AQ2 B;  2ICI A;  3SK8 A;  5IOC A;  4BY1 B;  3GTL B;  2Y0S B;  4XTC S;  1PTO D;  4ABN A;  2IL8 A;  4DXG A;  4MHE A;  3QB3 A;  5C44 B;  1ZXT A;  1Q1B A;  1TS3 A;  3HZX A;  3GV6 A;  1LTT D;  3HKZ B;  3EVQ A;  1B9M A;  1V1P A;  3C46 A;  1XXG A;  1IW7 D;  1STG A;  4XQQ A;  4I7Z C;  4KD3 A;  1NR2 A;  1DCZ A;  2EJG C;  2BOS A;  4H13 C;  5J39 A;  4KN7 C;  3SVM A;  3CKI B;  1PRT C;  3VR2 A;  1STB A;  2K6A A;  3TP5 A;  2LMC B;  1D1I A;  1CZG A;  3A8K E;  4XT3 B;  1GUW A;  5FLX L;  1PZK D;  4FXK C;  4CKB A;  2ENB A;  5C3E B;  4ZQ3 A;  1VMC A;  5FLX E;  3MTS A;  1KNA A;  4DAV A;  1JE4 A;  3N6R A;  3D8G A;  1G8Z D;  5JPN C;  1GUN A;  1F2Y A;  1RD9 D;  4RCO A;  4IUN A;  2Q8T A;  1STN A;  5M3M B;  1KNE A;  3S1Q B;  4A93 B;  1CM9 A;  3IL8 A;  2BDO A;  2ZT9 C;  3WOE A;  1D6E C;  3E0J A;  1HFN A;  2L11 A;  1L0X B;  4FO2 A;  1Y8N B;  4BY7 B;  1QNK A;  4K14 A;  1I3Q B;  2L1B A;  3OSO A;  4Q0F A;  2MGS A;  1EOT A;  1GJX A;  3T16 A;  4A3B B;  3K5N A;  1TVX A;  1I6H B;  3MAQ A;  1STE A;  5CV5 A;  1VCI A;  5M5W B;  1DM0 B;  2R3Z A;  1AFP A;  1EEI D;  1KLG D;  2AQ3 B;  2B8G A;  1H9S A;  1SFO B;  1KDB A;  3VR4 A;  4QB4 A;  1HA5 A;  4OHJ A;  5JVG 3;  5K36 H;  1OXX K;  3VA7 A;  1GUS A;  4IFD I;  4FF3 A;  4LMQ D;  3H91 A;  2DNE A;  1SMY C;  3D4W A;  1GXD C;  1K8M A;  5EBC A;  4KD4 A;  3N52 A;  3M7G A;  3AMU A;  3GV3 A;  3PUZ A;  5IIF A;  2WKD A;  4O42 A;  5JEA G;  1UUP A;  5JVH 3;  4TKO B;  2FMM A;  2A74 C;  1WTO A;  3Q0A A;  1TII D;  1WD1 A;  4G7O C;  4RGO S;  4RGM A;  1AW7 A;  4CJ0 B;  2F4I A;  4ZLT F;  1I4P A;  1JOK A;  2KHS A;  3OMG A;  2K32 A;  1BCP B;  4BBS B;  2L55 A;  2RDF A;  2JXM B;  5COY A;  2XIW A;  1CK1 A;  2WB1 B;  3MXN A;  4KI0 A;  2HQE A;  2KCC A;  1WTQ A;  5I9O A;  5KND A;  5EKI A;  3OHX C;  1A2U A;  3FKI B;  1DON A;  3NTI A;  2B2T C;  2L9H A;  2RQX A;  1E2V A;  5C0X G;  1H9M A;  1G6Z A;  2F0D A;  5IOD A;  5IGD A;  1C48 A;  2IT1 A;  2F0P A;  4OO1 I;  2A5H A;  1Z7T A;  2R92 B;  2XVS A;  1QWY A;  3I4L A;  2B2U C;  3SK5 A;  1HA6 A;  5EJW A;  2E2H B;  1RDP D;  1XYI A;  1OXU A;  2GA4 B;  1LLR D;  1JB3 A;  2XN9 C;  1B2T A;  5TSS A;  4PQX A;  4ZK9 B;  2HCI A;  1SBB B;  1EYC A;  4A3D B;  2EY5 A;  3IAY A;  5COR A;  1HFG A;  3S15 B;  1EWC A;  3OIQ A;  2F0H A;  3SEB A;  3PIP 3;  1ZKO A;  4KKT A;  4C3H G;  1TT2 A;  1S4Z A;  2F0T A;  1SYF A;  4WRD A;  1BCP F;  1SNQ A;  4FF4 A;  1RKN A;  2M9V A;  4CKC A;  3J7A V;  4RGT A;  2RSO A;  4DAY A;  1FNW A;  1U4R A;  3S17 B;  1BCP D;  3P1H A;  1EU3 A;  1X3Q A;  3TP6 A;  1R4Q B;  1JOQ A;  5CBE E;  3HOW B;  1FGB D;  1A15 A;  1ONL A;  3BVM A;  3A8J E;  5CV6 A;  3O13 A;  4F87 A;  1Y1V B;  3PUX A;  4KKS A;  1L0Y B;  4HN7 A;  4N9T A;  4BS9 A;  2E2D C;  2B2V A;  2IX1 A;  1QJO A;  3DWA A;  1Q8I A;  2EYL A;  5I2X A;  4PMC A;  5ELD A;  1ML0 D;  3DWP A;  5CC4 A;  3HOX B;  2G9H D;  1A2T A;  5IGC A;  2Z4I A;  4R8N A;  1IW7 C;  4E6I A;  1E0B A;  4HSP A;  1WTV A;  3H3V C;  1BNZ A;  1HTP A;  1D5Z C;  2EYO A;  5KEE A;  1UAP A;  4KHZ A;  2EPB A;  1UEA B;  1BUV T;  3Q22 A;  4DF7 A;  1STA A;  1QNU A;  3GTP B;  2PYK A;  4XIG S;  2EOT A;  1BQQ T;  2RKS A;  1LT5 D;  2MP1 A;  1CI3 M;  4PMB A;  2AQ1 B;  2ID0 A;  4HR7 B;  3K6O A;  2EYJ A;  1PFM A;  1TS5 A;  1D5X C;  1EY5 A;  2KED A;  3DMU A;  4RWS C;  4K8I A;  3GTG B;  5J1Z A;  1CFM A;  1B1Z A;  5C3W A;  1AEX A;  1TWA B;  3D6C A;  3D4D A;  5D3D A;  5E4W C;  5FO9 B;  3VYT A;  5DNF A;  1LTR D;  2IJ0 A;  3OOC A;  1A3U A;  4C1N K;  4QUF A;  3SXH A;  3MFY A;  4BA2 I;  5CV8 A;  3NWS A;  3SK4 A;  5EKL A;  4IUR A;  3VR3 A;  1I4G A;  3DWQ A;  1HQM C;  4P2C B;  1CZW A;  3MXU A;  1YNN D;  2KOL A;  3J7A F;  3ND8 A;  3H6M A;  5FOB B;  5C6A A;  2O4X A;  5FO8 B;  2NUC A;  2NTT A;  2KA7 A;  3R3O A;  3X3M A;  4XDX A;  2BA0 A;  5IGB A;  1LTA D;  3BZD B;  1QE6 A;  1BBX C;  5K5P A;  4FYD A;  3CRK C;  4ILW A;  4KK7 A;  2C9O A;  2SNM A;  2R61 A;  1TWC B;  5KNB A;  3FEW X;  1NSN S;  2QF7 A;  4K5V A;  5T1G A;  3BVG A;  3X3N A;  1BOS A;  2EXZ A;  3A55 A;  3D3R A;  4F7X A;  3QOL A;  3WDN A;  5C4J B;  4DA2 A;  2M2L A;  3Q24 A;  2J7Z A;  1DYQ A;  1GOZ A;  2NBF A;  1EY7 A;  1DOM A;  2K04 A;  2MJ8 A;  1KLU D;  2OT2 A;  4F88 A;  2EZV A;  1EWH A;  2NVT B;  1EY8 A;  5JEA H;  3S14 B;  4IZ8 A;  4V0B A;  5DAU A;  3F2U A;  1JC7 A;  4PMW A;  3OWE B;  3PUV A;  1HCZ A;  3L7Z C;  2B2W A;  4X3S A;  3S1M B;  1XTC D;  5IGF A;  1CT1 D;  1LT6 D;  3IFD A;  1MSG A;  2EJF C;  3JAM E;  1I6V C;  4ZUJ A;  5IGG A;  1STH A;  1B53 A;  1TQO A;  3NTK A;  3VR5 A;  2MHV A;  4KY5 A;  1FNU A;  2WII B;  3R93 A;  3LX0 A;  1T5X D;  4IQZ A;  1SAP A;  1D5M C;  4H0L C;  4OGQ C;  3A8I E;  2Q8I B;  3NPP A;  2HCC A;  1DZ1 A;  1EY9 A;  1TS4 A;  3HOU B;  4FP5 D;  2PMZ B;  2PZU A;  3ERO A;  4H7B A;  2IPK D;  1K83 B;  1LTG D;  3VA5 A;  5LHY 1;  5D14 A;  3LWE A;  1SYD A;  2E76 C;  1HXY D;  5C0X H;  3EQL C;  5CMD A;  1HUN A;  3ITP A;  4RHS A;  2PO4 A;  1PTO H;  1V1O A;  4A3G B;  1PFB A;  3SHL A;  4IUQ A;  3NK9 A;  5T1I A;  3NQT A;  1NUC A;  3VYS A;  3PO3 B;  2XSC A;  3D31 A;  3K57 A;  1C8C A;  3W3A A;  4JK1 C;  2A6H C;  2D9U A;  1HQR D;  2ICE C;  2JEA I;  4X3U A;  2RA4 A;  2K5Q A;  2BCO A;  2KVM A;  5EPK A;  2MUY A;  4IFD J;  4A3E B;  1BCP C;  1D2B A;  2AWN A;  3ND9 A;  3A7A B;  1NR4 A;  1F9P A;  4GZY C;  1HPC A;  2NZ1 D;  4QIW B;  2EDG A;  2QDB A;  1HTL D;  4I65 A;  2OEO A;  4ME5 A;  4FXD A;  4RKL A;  4DFA A;  3C1E A;  1OO9 B;  1QB5 D;  3FRP B;  4OIJ A;  4ODG A;  3HEJ A;  4HSV A;  4ZYS A;  2XRQ D;  1I4H A;  1B4O A;  1PFN A;  2N88 A;  2JA7 B;  2B2Y C;  1RF2 D;  3NTH A;  3DEP A;  4A3M B;  2K28 A;  2EYM A;  1H9R A;  2R6G A;  3T53 B;  1BR9 A;  3K5M A;  2PW5 A;  3U9S A;  1Z47 A;  2Q8R E;  2HDM A;  3WOF A;  5JPM C;  2E75 C;  1PZI D;  5KNC A;  5M5X B;  2SNS A;  3M4O B;  2EYF A;  1V8Q A;  1PLF A;  2RDG A;  2F0W A;  2E2J B;  3RLF A;  5ISR A;  3TP7 A;  3S2H B;  1H9K A;  3GTM B;  3NQI A;  2JE6 I;  2E74 C;  5BN4 A;  4G4K A;  5E1F A;  4FF2 A;  4KHV A;  4H44 C;  1KAA A;  3KUP A;  1R4P B;  2KEC A;  2L12 A;  3PUW A;  4U68 A;  4S3S A;  4PV1 C;  1CHP D;  1F2M A;  2BE5 D;  1Q12 A;  2MPM A;  1O78 A;  1SNO A;  4RAU C;  3GD7 A;  3IKJ A;  1FD7 D;  5EPL A;  3C1F A;  3E5S A;  3I8Z A;  3K7A B;  3URY A;  2DNC A;  1ESR A;  5NUC A;  2OF1 A;  2H4O A;  5CV4 A;  4B9W A;  2DY8 A;  2SOB A;  4F8M A;  3BS1 A;  1Y1W B;  4X3K A;  1SJE D;  1SYG A;  4CJ2 C;  3HS0 C;  1C4Q A;  1PYW D;  1F9S A;  3NWT A;  4C3J G;  4C3I B;  1U4M A;  1JOO A;  4UAI A;  3S1N B;  3A56 A;  1CQF A;  5FK9 C;  1K8O A;  2Z8L A;  3H94 A;  4HMI A;  1YNN C;  4G7Z C;  3J81 L;  1EYD A;  2QIL A;  3C3L A;  4TRD A;  1TKW B;  5A2Q L;  2IX3 A;  1SE3 A;  2LS0 1;  1O7L A;  3BYY B;  4FXG C;  4ZKB B;  3DM1 A;  1J9O A;  1SDF A;  3EFX D;  1I50 B;  3K5O A;  1WTW A;  2B2T A;  2A68 D;  4CBV A;  2N55 A;  1ET9 A;  3Q23 A;  4NKL A;  2A6H D;  1BF4 A;  1B3A A;  3IFT A;  2K33 A;  3VYU A;  2NWG A;  4DNR B;  5CR3 A;  3J80 L;  2EYP A;  4IUV A;  3D4R A;  1BDO A;  3ZYY X;  3G6J B;  2C5C A;  4G7H C;  2B2U A;  4ULL A;  3T13 A;  1F77 A;  3I3C A;  1F2Z A;  3CU7 A;  1V43 A;  3Q6S A;  3TZU A;  1JOR A;  1DOL A;  5I2Y A;  2NB0 A;  1EL0 A;  1M8A A;  3D6W A;  2F0Q A;  1SND A;  4DXF A;  2K01 A;  2F3V A;  2FJ2 A;  3HP3 A;  1M4V A;  1DD2 A;  1SSO A;  3MFG A;  5JJZ A;  4K2K A;  3NP8 A;  3I91 A;  1O80 A;  5EKK A;  2Z4H A;  1SE2 A;  1ZYR D;  1TU2 B;  3DHQ A;  4EGV A;  4V19 0;  4ZUI A;  2A69 D;  3E6Z X;  5K36 G;  3TSS A;  4K5X A;  1CA5 A;  2PZT A;  1JWS D;  5A35 A;  3NUC A;  2NN6 G;  2EE1 A;  3K0Y A;  4ZAI A;  2F0L A;  5AFW A;  3HRZ C;  3M7N A;  1Y69 U;  4XQN A;  3S1R B;  2FMC A;  4IUU A;  1G29 1;  3SR1 A;  5FO7 B;  1EIH A;  3LNN A;  1A3T A;  1MI2 A;  3MEH A;  2PW7 A;  2O5I C;  3NHH A;  3M85 A;  2WAQ B;  4B08 A;  1EIG A;  2X69 A;  4R9W A;  1QCB D;  3CHB D;  5JAV A;  4A3I B;  1SJH D;  1MD2 D;  3QOJ A;  4RA8 A;  1KDC A;  3DEO A;  3BG3 A;  1LAC A;  5DM6 3;  3GO5 A;  1EZ6 A;  4CHT B;  2F0F A;  5I4D A;  1LV9 A;  1U4P A;  3OIP A;  3GTJ B;  4R8I A;  2D5D A;  2F0E A;  1RTN A;  5G3L F;  1TS2 A;  4C3J B;  3P20 A;  5C4X B;  1S5C D;  5CYU A;  1EFI D;  2A6E D;  4IUP A;  4KTA A;  1G91 A;  4RFB A;  3K59 A;  1YNJ C;  1MSH A;  5G3L D;  1ZEQ X;  4ZKC B;  5CV7 A;  5FKA C;  2F0V A;  4Y7N B;  2F0G A;  1EY0 A;  2RSN A;  5C4Z A;  1IHZ A;  3R8B A;  2F0I A;  3PV0 A;  5C0X I;  1RJT A;  3V96 A;  4XYO A;  2F0O A;  4XXE A;  2VUM B;  4U67 3;  4YIJ A;  5EBD A;  3RD4 A;  4X3T A;  5KYI A;  4IFD G;  2X6G A;  1A6X A;  2JSO A;  3TBI B;  3TZD A;  2WV6 D;  1E2Z A;  1ENF A;  1AP0 A;  1EYA A;  1SNM A;  1XX8 A;  1RHP A;  2ZXP A;  3GQB A;  1IYU A;  1WTX A;  1ILP A;  4XT1 B;  1LO5 D;  4HED A;  1OXS C;  4KN4 C;  4K8J A;  4C2M B;  5HGT A;  4QCL A;  4LAA A;  2BE5 C;  3MVV A;  1W6K A;  1JQY D;  4PNY A;  3V2T A;  3OPO A;  3VR6 A;  4OL7 A;  5CGK A;  4C56 C;  3MC0 B;  4NDX A;  3OMC A;  1GUO A;  3NXW A;  2K03 A;  1EQT A;  4QUC A;  3CQZ B;  1J8I A;  2CW0 D;  4CKE A;  1X3P A;  3NBH A;  2TSS A;  2JA6 B;  1EZ8 A;  1G2T A;  2RVL A;  3NBI A;  2F0M A;  2EY2 A;  1H9J A;  2NTS A;  1NAP A;  1WTR A;  3MZ5 A;  1EU4 A;  3I4N B;  3I90 A;  3KK7 A;  4K5W A;  3L9A X;  1JCK B;  4L8J A;  4C3I G;  3DUZ A;  1ENC A;  3GTK B;  3A54 A;  3PUY A;  2D62 A;  4OO1 G;  1DXM A;  1JIC A;  1ROD A;  2HDL A;  3OW7 A;  2BDN A;  1MGS A;  3J7Y W;  5ELF A;  1XWE A;  3I4M B;  3PO2 B;  3V05 A;  4MIU A;  5C4H A;  4RGN A;  2NN6 I;  5ELC A;  2A68 C;  4HCE A;  4KMU C;  2R93 B;  1TWG B;  3SK6 A;  1B9N A;  3I73 A;  5D3I B;  1IYV A;  3HOZ B;  1LTS D;  3SDZ A;  5DM7 3;  3PIO 3;  2IX0 A;  3QJY A;  3S16 B;  2OXP A;  2Z1C A;  1JR0 D;  5JOB A;  1O7Z A;  5M5Y B;  4G57 A;  5EGT A;  1NCV A;  2EY6 A;  5J22 A;  4EQP A;  4CGY B;  4KY6 A;  1TY0 A;  2KEE A;  2JA5 B;  4XYQ A;  4JBW A;  3NE5 B;  4A3F B;  3QIA A;  2B39 A;  4EQN A;  1V1P B;  3U9O A;  1DJR D;  2LY7 A;  2CHB D;  5EPJ A;  2VB2 X;  3RZO B;  1S5D D;  4XQJ A;  3KLS A;  4RHR A;  4NMZ A;  3BYT B;  1YNJ D;  3NSW A;  1LTB D;  3M3Y B;  5ELE A;  1TWF B;  3S2D B;  2XWB B;  4DNT B;  1SNC A;  1ZYR C;  1HUM A;  1S5B D;  3R2I A;  2CQA A;  1STY A;  3T51 B;  1PDQ A;  2O2L D;  1VMP A;  3C2P A;  2FIN B;  3TN2 A;  3BDL A;  5KYL A;  2A69 C;  1IKM A;  2E2I B;  5C5M A;  2M00 A;  4TQU S;  4AYB B;  1IKL A;  2ZXO A;  1Q1E A;  2LFN A;  5C5L A;  2QKI C;  1D1K A;  2EJM A;  1E2W A;  4L6T B;  2NVY B;  1LAB A;  1F9Q A;  1A3V A;  2LKV A;  5BN3 A;  4HMJ A;  4IAL A;  2B8F A;  2AWO A;  2KUM A;  1SE4 A;  5M3F B;  3GTQ B;  3I70 A;  4A3J B;  2XNA C;  5I6W A;  2H1E A;  4Z9C B;  2F0S A;  2NN6 H;  2G9D A;  1TR5 A;  1PRT B;  4EVO A;  4FVM A;  4DK0 A;  2B2Y A;  3CRL C;  3TME A;  3BDO A;  2RBM A;  2WKC A;  2WAC A;  1CTM A;  4N9P A;  2A73 B;  1DOK A;  3KF8 A;  4K6L A;  2JP1 A;  2DN8 A;  4TSS A;  4C1N I;  3LWU A;  1H9S B;  2KQ3 A;  2NYZ D;  1FR3 A;  3DXJ C;  3RZD B;  1BXT A;  1OXV A;  2A6E C;  1Y8O B;  1QIL A;  4NW2 A;  3KBG A;  2L5T A;  2D2C C;  1HRJ A;  3FVQ A;  3FDT A;  5F2D A;  1ENA A;  5EQ0 A;  4BA1 I;  2I07 B;  4MN3 A;  4BWG B;  1Q90 A;  1SEB D;  3FPU B;  1SNP A;  2K1B A;  5ELB A;  1WVL A;  1JWU D;  1GHK A;  3P75 A;  3R2T A;  3OWF A;  3ERQ A;  4RKB A;  1EEF D;  3QO2 A;  3QG1 A;  1I4R A;  1FNV A;  3J81 E;  3MXG A;  1EY4 A;  5IT9 L;  3GTO B;  3RMH A;  4WFN 3;  1RTO A;  5IT9 E;  1BO0 A;  2QEJ C;  2RDH A;  5A2Q E;  2YYZ A;  1R9T B;  1VF7 A;  2HUG A;  5I6Y A;  4IN3 A;  2WIN B;  1PRT F;  4M8A A;  3UI2 A;  2FFK B;  4K6D A;  1QG7 A;  3TP8 A;  4L63 B;  4O1N A;  2VXW A;  2NVQ B;  5KIX A;  1I4X A;  1JWM D;  2KJX A;  4QF4 A;  3SE0 A;  1W6J A;  3KBX A;  4OIK A;  4IFD H;  5CV9 A;  1S5F D;  3L3O C;  1PRT D;  3ONA B;  1KTK A;  1PXU A;  3J80 E;  2FHT A;  2SEB D;  3A7L A;  1EQV A;  5BN5 A;  2B2V C;  2EVB A;  3H09 A;  1Q3L A;  4J6H A;  2F0N A;  2F03 A;  2F0U A;  1SYB A;  4ZRZ A;  3S9W A;  1CHQ D;  1Z6H A;  3K58 A;  2DY7 A;  5E3F A;  2VNU D;  2IWH A;  3MA2 B;  2CW0 C;  2EYH A;  3EA6 A;  2TMP A;  3EJI A;  4KY7 A;  2AUK A;  2F0K A;  2VB3 X;  3T4A C;  1LT4 D;  5JEA J;  1KAB A;  3AB9 A;  1SXT A;  3TDQ A;  4KJN A;  1U4L A;  3BVZ A;  3VYR A;  2K05 A;  1PTO C;  1PZJ D;  1UNS A;  1VF5 C;  2SDF A;  1TWH B;  4HCS A;  3W2D A;  4J1M A;  2XWJ B;  3AU7 A;  3GP7 A;  2K5D A;  1FYC A;  1II3 A;  1ET6 A;  2X6L A;  1HHV A;  2JYO A;  1CQV A;  2JEB I;  3RUZ A;  4J8Q A;  1U9R A;  1WTP A;  1S5E D;  2JA8 B;  4OO1 H;  4QMG A;  2J4X A;  2YU9 B;  3P7J A;  1SMY D;  2K7V A;  1F9R A;  4LK1 C;  4Q5V A;  5C0X J;  4DK1 A;  4A3K B;  5LL6 S;  1F2L A;  3HGB A;  2PZW A;  5IGE A;  4HAE A;  4RH6 A;  1SYE A;  1TY2 A;  1ICW A;  4B9X A;  2L0C A;  5KRU A;  1O7Y A;  4DN4 M;  2IW3 A;  3HOV B;  1QOH A;  3BDC A;  3KLS X;  5C3X A;  3HOY B;  2PCF B;  5I9P A;  2O5J C;  2K5W A;  5LL6 X;  5HUR A;  2F3W A;  4CJ1 B;  4ID6 A;  1SYC A;  4LJZ C;  1B44 D;  3H0G B;  1AZQ A;  2XRS D;  4KV6 A;  3KLR A;  5DEH A;  1PTO B;  1RCV D;  2KCN A;  2F0J A;  3QWN A;  3I72 A;  2ZXR A;  1X32 A;  5D65 A;  1WCM B;  1ILQ A;  2WP8 J;  4WOR A;  1IL8 A;  1B50 A;  4K2L A;  4NP5 A;  3FMC A;  2PNR C;  3T56 B;  1AN8 A;  4BBR B;  3HG9 A;  4WJW A;  2BA1 A;  4KKU A;  1PMR A;  2L4N A;  2QCP X;  1ESF A;  4UDU C;  1LT3 D;  4HTH A;  3MWY W;  1CA6 A;  1MBY A;  4DAP A;  1I4Q A;  2AUJ D;  4C3H B;  2B2W C;  1GUT A;  2F1M A;  3MXP A;  4RCN A;  1GHJ A;  4EQO A;  4DGZ A;  2PPB C;  1Y8P B;  2V4D A;  1T5E A;  3MHB A;  4KJO A;  4IUT A;  1GUG A;  2B63 B;  3M4Y A;  1VDZ A;  5CBA E;  1WD0 A;  1G2S A;  1EY6 A;  5KGU A;  3FPP A;  4DU9 A;  1OXT A;  2J0T D;  3K5L A;  4FF1 A;  2R7Z B;  3G7L A;  2I46 A;  5M9O A;  3PMF A;  2NVX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...