5HGTA

Crystal structure of staphylococcal nuclease variant delta+phs l25k/i92t at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKKMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYTYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS L25K/I92T at cryogenic temperature
rcsb
source organism Staphylococcus aureus
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5hgtA00
4PMBA 4S3SA 3C1FA 2F0LA 4IUNA 5E3FA 3TP7A 4NKLA 4DF7A 2OEOA 5CV9A 2NUCA 3SXHA 2RBMA 5F2DA 3BDCA 5KYLA 1NUCA 2PYKA 4TRDA 2EYMA 3EJIA 1STAA 2EYPA 1SNDA 1JOOA 1A3TA 3NK9A 4KD3A 4KY6A 3HEJA 5DEHA 1F2YA 1U9RA 5CV6A 4B9WA 5JAVA 4HTHA 5C4ZA 3TP6A 4ID6A 2PZUA 1EY7A 1F2ZA 3MVVA 5CR3A 5CV4A 1TR5A 1TQOA 4K6DA 1AEXA 1A2TA 3ERQA 3PMFA 4B9XA 4J6HA 4DU9A 4R8NA 1KABA 2EYOA 3MEHA 4QF4A 3SK5A 4F8MA 5C4HA 2LKVA 4QMGA 2F0EA 2F3VA 4IALA 1KDAA 3LX0A 5E1FA 4KJNA 3TP5A 5J1ZA 2WACA 3QOLA 4KY7A 5IGEA 1EZ6A 2EY6A 1SNCA 1A3VA 2F0KA 3EROA 1SNMA 1KDCA 3D4WA 3NXWA 4K2LA 1STHA 5HGTA 3NP8A 4EQOA 5I6WA 4EVOA 2F0WA 2QDBA 5IGCA 2PZWA 2F0IA 3P1HA 1EY0A 4K2KA 4PNYA 1EY6A 1A3UA 1SYFA 4OL7A 4ZUIA 2F0DA 1SYDA 1SYGA 2M00A 2F0PA 1EQVA 5C5MA 5C3WA 4ZQ3A 3NHHA 5CV8A 5IGGA 2F0GA 5CV5A 4KY5A 1IHZA 3E5SA 3HZXA 2F0SA 4HMIA 1JORA 4K5WA 4DFAA 4EQNA 3TP8A 5I9PA 1JOQA 1SYEA 2F0NA 5EGTA 3V2TA 2OXPA 2F0HA 2F0JA 3MHBA 2PW7A 1A2UA 5JOBA 2KHSA 4K8JA 4K5VA 3R3OA 4KTAA 5HURA 3SK6A 5I9OA 3SK4A 2ENBA 4KHVA 5DAUA 3SR1A 5M9OA 3QOJA 3NQTA 1STYA 1EYDA 1TT2A 2F0FA 1NSNS 3NUCA 3TMEA 2EYFA 5C3XA 5KYIA 5IOCA 4K5XA 2OF1A 5C6AA 1KDBA 2RKSA 4NMZA 4WRDA 1SYBA 3MXPA 4IZ8A 2PZTA 3DHQA 4K8IA 4F7XA 2SNSA 5J39A 1EY4A 1EYCA 3D6CA 5KIXA 5KGUA 1ENCA 4EQPA 1SNQA 2RDFA 3S9WA 5IIFA 1STNA 4DGZA 5IODA 4RKLA 4KJOA 2F3WA 5EKLA 5NUCA 1F2MA 3T16A 4KV6A 4J1MA 2EYHA 4PMCA 2SNMA 1KAAA 1EY8A 3H6MA 2F0VA 1SNPA 4G57A 1JOKA 1SYCA 2KQ3A 1RKNA 4I65A 4ODGA 4QB4A 5C5LA 1EYAA 2EYLA 3P75A 1EY5A 4N9PA 3RUZA 4MIUA 4WORA 5K5PA 4ZUJA 5KRUA 4LAAA 4E6IA 3C1EA 5EKKA 5CGKA 3OMCA 1EZ8A 3OSOA 5ISRA 4K14A 2HQEA 3EVQA 3U9OA 3MZ5A 5CV7A 3SHLA 1EY9A 3D4DA 1II3A 5IGFA 4ME5A 3BDLA 2F0MA 4HMJA 2SOBA 2EY2A 3OMGA 5KEEA 3VA5A 2EY1A 2F0UA 5CC4A 3T13A 1STGA 3ITPA 4N9TA 4H7BA 1STBA 2O4XA 4NDXA 4NP5A 2F0OA 1ENAA 2EXZA 4YIJA 2F0TA 4RKBA 3SK8A 5I6YA 5IGDA 2EYJA 5IGBA 2PQEA 2EY5A 3D8GA 3OWFA 2PW5A 4KD4A 3DMUA 3QB3A 5J22A 1SNOA 2F0QA
chains in the Genus database with same CATH superfamily
2Q2UA 3S1NH 4IUNA 5GAEC 4R4OA 3GTJH 1SEBD 3SXHA 1CHQD 3I70A 4CDCC 2DUDA 4DAVA 2K52A 1JT8A 4DUZQ 1F2YA 5M3FB 2LMCB 5JAVA 3CPWA 1YVCA 3TP6A 1JJGA 1PH6A 3NTKA 2Z1CA 2QGQA 1A2TA 1Q3LA 3PMFA 1PVOA 2A73B 1EIHA 3SK5A 5C4HA 1QVGA 4OIJA 4QQBX 1HZAA 1B9MA 5E1FA 3LWEA 2Q2TA 4KY7A 3G4SA 4GNXB 2UXDL 4DUYL 2NWGA 4FF4A 1VQIA 3I4OA 2OQKA 3NP8A 1PFNA 1PH5A 1KTKA 3PV0A 4IURA 2K4KA 4DV7Q 2F0PA 4GOPC 5JJLA 5JPNC 1FVIA 1YEZA 2KEEA 4JC0A 1IHZA 1BQQT 2WB1G 2WP8J 1BNZA 2HHHL 1KL9A 1R4PB 1SJHD 1JQYD 2E2DC 3A7LA 3X3MA 4BY7G 3G71A 2X6LA 3ERSX 3Q6SA 5DAUA 2B63G 4FXDA 3PO2B 1EYDA 5M3FH 5C3XA 2QKIC 1X3GA 1WTOA 1X3PA 4K5XA 3GD7A 3I2ZA 2C5CA 3MAQA 2L12A 2N88A 2A68C 5KGUA 4P75A 1LTLA 1ESRA 2E76C 3T1YL 4LF4Q 5IODA 1Q8IA 3CF5A 1AH9A 4A3MG 2WV6D 3BYTB 3TSSA 1I4PA 4O0AA 4X66Q 4LFCL 1V8QA 4DUYQ 2E2HB 4K14A 1L0XB 2C9OA 1XMQL 1PDQA 2UUCQ 1HCZA 4JI6L 4BBSB 1TU2B 1PH4A 4IFDI 2L55A 2VW9A 3K81C 3J81E 1KNEA 4N9TA 2O5JC 2B2TA 2M2LA 4A3IG 3STBC 2E2JB 3IFTA 3PO2H 1NAPA 2HIVA 1NE3A 5ELCA 2ZM6Q 1HZ9A 1E3PA 2B2VA 1K73C 1YNNC 2ZT9C 2FXQA 2F0LA 4EGVA 1LTTD 4JI8L 4X62Q 5LL6X 4ZRZA 3PUWA 1DGSA 4HCEA 5EGTA 1JOOA 1BF4A 2H1EA 3TS0A 4GNXC 2JA8B 5C4ZA 2L5TA 4F88A 1F2ZA 5K36G 2AMCB 4B9XA 2JA5B 5C3EG 2RSNA 1L1OC 1WTPA 1B2TA 1K0SA 5C4XB 3T1YQ 1QOHA 1KDAA 2PQAA 3AB9A 2E2HH 5D65A 4TVAB 3BJUA 4A3KB 2CW0C 1I4QA 3KBGA 2FINB 4BBSH 2Z4IA 1VQMA 1S5CD 4KN4C 5IGCA 3D3RA 1ONLA 4ZKCB 1QILA 4M1UB 4DR2Q 3QIAA 2E2JH 1VQ9A 4G7ZC 4JI1L 1NJIC 2OWOA 4LFBL 1CT1D 4N8X1 2LSSA 3E5SA 3HZXA 3FMCA 4DFAA 1K8AC 1SYEA 3V2TA 2PW7A 4JI0L 1JMCA 3H09A 2Z0SA 3NQTA 1GOZA 1NSNS 4YY3L 5KYIA 2JA8H 1LYLA 1OTCA 4BBRG 3ONAB 2G9HD 1U4PA 2CQAA 2JA5H 1SYBA 4K0KQ 1HPCA 2NB0A 4JOIA 1PZID 3HOZG 3G7LA 3FPPA 5G3LF 4UP7A 2EIFA 3GQBA 3JAME 2NZHA 3VR5A 3TS2A 1CSQA 1YNXA 1XWEA 1SE4A 2IT1A 1YJ9A 2FMCA 1LTRD 3RD4A 3W2DA 1B53A 4HJ5A 1HA5A 3OMCA 4A93B 2K75A 2ZTDA 1WTRA 4KKSA 3FPUB 3KK7A 2I46A 1D1KA 3EFXD 3S16B 3DLLA 4G4KA 4JI1Q 4LFBQ 1KRTA 4BXXG 2WFWA 4C1NI 3TBIB 1Q1BA 4OHJA 3PIOA 4HR7B 3GV3A 3C1FA 3I56A 4HEDA 4NKLA 4PZ8A 1SDFA 3NSWA 2K5VA 1U5KA 4K6LA 4YY3Q 2Y0SG 1D6EC 1ZKOA 2R92G 2YV5A 3D31A 4MZ9A 3CAMA 2F52A 1YIJA 1VDZA 4K6DA 2JEBI 1E0BA 5E7NA 3J7AV 1K0RA 4DV1L 4OELB 5GAGC 4GKJL 1AP0A 1CZGA 4A93H 2WACA 4A3BB 3TDQA 3D0FA 1T5EA 1HTPA 3E9IA 2PI2E 3PIO3 1W3SA 3J7A5 3V05A 5D3DA 3EN2A 1QNKA 1UE5A 1EQVA 1M8AA 3DWQA 1XJVA 3AYHB 3J80E 4Y52H 2F0SA 4R4IA 3HG9A 3VR6A 2UU9L 4LK1C 1VF5C 2K05A 2D5DA 4OWXB 4HIMA 3SEBA 5IYBG 3IKJA 1STYA 1X56A 3VYTA 3HOYB 4A76A 3NTIA 5L37A 1SXTA 3GTQB 3AQQA 1PRTD 5IOCA 2PPBC 2H4OA 1Q90A 4NMZA 1XYIA 4DK6C 4CKEA 4DV4L 2O5IC 2NN6G 2RDFA 5I4DA 4A3BH 1YHAA 2MJ8A 1EQTA 4DV1Q 1BDOA 3H3VH 4P72A 3TREA 2QF7A 3G6JB 1Z7TA 1TWHB 2XN9C 2NVTB 3K80C 1SMYD 1PZKD 1UE6A 4FNFA 1JE5A 3LNNA 3Q23A 1MJCA 4O2DA 1PZJD 5BN4A 3BS1A 3HOWH 3HOXH 1STBA 2MO1A 4NP5A 1C7YA 4DXFA 3DXJC 1HNXL 4X64L 2KA7A 3L0OA 3OWFA 3J81c 1IL8A 3HOYH 4KD4A 4LFAL 3K7AB 2IL8A 4QIWE 1SN8A 3NENA 3TP7A 4HIOA 2EJGC 2SEBD 3HKSA 4A4IA 3H91A 2LFNA 4DF7A 1S5ED 3K57A 3PUZA 3IRBA 1VQNA 5IT9L 4DAYB 1I3QB 1SMXA 2L9HA 2EVBA 2JK8A 1P16A 1S5BD 1TWHH 2JEAI 2NVTH 1A3VA 2JSOA 1KDCA 2HDLA 3TN2A 2R7DA 4R4QA 4NXNQ 1IYUA 4PQXA 3S17B 5IWAL 2F0IA 1SBBB 1EIYB 3FRPB 2NVYB 2BDNA 2NBFA 4C2MB 5E4XA 4GLXA 3T1HL 1Q82C 2J7ZA 2JJQA 4GN4B 4JI5L 1HR0Q 1K8MA 5KNBA 5CV8A 5M3FG 2QEJC 1BCPD 4HMIA 3K7AH 4ZAIA 5FJ8G 4JI4Q 2Q2HA 4X64Q 1B3QA 1TWCB 2ZXRA 3NEMA 4XYOA 3BZCA 4MNOA 3BG3A 3UE1A 2MUYA 3NBHB 1S5FD 2LS01 1TT2A 3NUCA 2B29A 4B08A 3M85A 1WCMB 2OF1A 2DJFC 4IUQA 2IX3A 3ZYYX 4A3GB 1I3QH 3JC66 1VQ5A 4R4CA 1NMFA 1RL2A 4OO1I 3KLSA 1PYSB 1EYCA 4JYAQ 1BVSA 4HIKA 1W2BA 3S9WA 4L5RC 2ZJRA 2NN6I 2ICIA 1F2MA 3T16A 4PMCA 3CMAA 1QE6A 3CCUA 5CMDA 4NXMQ 3S17H 1OO9B 1SE8A 2NVYH 3S1QB 1A62A 5JEAH 1MSGA 4Y7NB 1B70B 1AN8A 4C2MH 3I4NB 3PO2G 3ULLA 1EUJA 4U68A 3HS0C 3T4AC 1Q46A 5KNCA 2IW3A 3PGZA 2BE5D 4LF6L 2G9DA 2PCFB 4FVMA 1TWCH 4C3IB 1EL0A 3BVMA 1PMRA 1U4MA 2SDFA 1HFGA 4BA2I 1D5ZC 3I3CA 2NVXH 1MJEA 4S3SA 4A3JB 3A5UA 1WCMH 2Q8TA 4A3GH 3K6OA 1FJGL 1OXTA 3EJIA 3N52A 4DV6L 2A69D 3NK9A 3KJOA 1WOCA 3EA6A 3CCEA 3H94A 2RVLA 4IQZA 4BBSG 4DR3L 4L5SA 3I90A 5FLXc 4PV1C 1LLRD 2ASBA 2YYZA 2BH2A 4GOPA 3KDFB 1RD9D 3S1QH 1WTHA 4Y7NH 1BKBA 1O7YA 1RIPA 3Q22A 3I4NH 3I4MB 1Y14B 1BBUA 3T56B 2YU9B 1RODA 4KKUA 2GN5A 4K2LA 2QDBA 3PF4A 5EPJA 2I5LX 3BYYB 1SYFA 4BWGB 4C3IH 5C5MA 4JCVE 1GHKA 4LF6Q 1HQMC 2JA8G 1JJ2A 1IBLL 1TVXA 1DYQA 1CQFA 2ALYB 4A3JH 2F4VQ 1M90C 2JA5G 5JOBA 4DNTB 1A2UA 2K03A 2KHSA 5C4XG 4PZ6A 4TKOB 1PYWD 2UUBL 2MO0A 4A3KG 1GVPA 3VR4A 1G291 4OXPA 3GTGB 2L11A 1FJGQ 2CQOA 3S2HH 4DV6Q 2E5LQ 2R7ZB 1CM9A 3U4ZA 1EY4A 3CCVA 4DR3Q 2K6AA 3I4MH 1C8CA 3A7AB 2VNUD 3NBIA 1CTMA 3T51B 3S14B 1W6KA 1KAWA 4Z9CB 2YU9H 1T5XD 4B3RQ 3A56A 5T1GA 1SE3A 4C3HH 3FVQA 3WWVA 1O7IA 2OCEA 4GOPB 4LAAA 1V1OA 3H0GB 4ZCKA 1Q12A 5C0XI 4G7HC 1S5DD 3J81j 2EY2A 1VMCA 3GV6A 1U4RA 3W3AA 4IO9A 2PNHA 4GNXA 5IGDA 1IBLQ 2EYJA 1WVLA 1LT5D 2XWJB 2HDMA 2JQOA 2RCNA 1L1OA 4DV2Q 3H15A 1CKNB 1VQDA 4HIDA 2DGYA 1LT4D 3GTGH 2OEOA 1SFOB 1NUCA 1GHJA 2QA4A 1TS5A 1QVFA 1D7QA 2G5DA 4A93G 2IX0A 1UEBA 1I5FA 1PRTC 4DV7L 1UAPA 2CWPA 3K0XA 4FF1A 4RHRA 1MGSA 1NCVA 3S14H 1L0WA 3D4RA 2EYOA 3HRZC 1B1ZA 4ZYSA 2LKVA 1BUVT 3LX0A 4X65Q 4A3CH 3H0GH 5A35A 1MHWC 3CP0A 2WB1E 1EFWA 1C48A 1SNMA 3E6ZX 1UE7A 4DR5Q 2N78A 3U4VA 1Z47A 1N33L 4ZUIA 3CXCA 1SMYC 4NB3A 4GKKQ 1XNQQ 5CV5A 4LF4L 2E8GA 1KLGD 4O1NA 3E9HA 4LW1A 4EQNA 3KJPA 1PH9A 2A5HA 3MHBA 2XTIA 1I4HA 1SFOH 4X66L 1Y8NB 1RCVD 3DM1A 3TRZA 4A3BG 2UUCL 3FHWA 1U0LA 2EOTA 1XNRL 1TWAH 1PH7A 1L1OB 2K50A 4RG1A 2JN4A 1KDBA 1WI5A 2N49A 1CI3M 2KENA 2QEXA 2F3WA 4DXGA 1VQBA 4YWMA 2ZM6L 2K04A 3VYRA 1EEID 1UEAB 3X3NA 4XYQA 1EQQA 3J80L 4JV5L 5KRUA 4X62L 3GTMB 2BDOA 1JWSD 4P73A 3OYYA 3OSOA 2R7FA 1P8LA 5M5WB 1BOSA 1CKMA 4ABNA 2KBNA 3HOYG 5IP7H 4KKTA 3D4DA 2GA4B 4YCWA 1N33Q 2XNAC 2A1AA 2RF4A 4U673 1GUGA 4RKBA 1RTOA 2PQEA 3D8GA 3Q0AA 1EIFA 1O7ZA 2K1BA 1NR2A 3AFQA 4ZKBB 2JE6I 2F1MA 2R3ZA 1VQJA 4UP9A 3E0JA 1CZWA 4C3JB 4ZK9B 1F9QA 2HD3A 4KY6A 1XX8A 4DR2L 1G6ZA 2DY8A 2MNAA 1XNRQ 4DR6Q 3KLWA 4JBKA 3PSIA 1HQRD 1Q8KA 5IYCH 1LT3D 1V43A 2RDHA 3A8IE 3MEFA 4CDFC 1A6XA 2F0EA 3SVMA 2X6GA 3GTMH 2JA6B 5CBEE 5M5WH 1I50H 3EIVA 2AKWB 3EROA 3D4WA 4JV5Q 4EQOA 1PH8A 3CCQA 2I07B 5IE8A 4PNYA 2N55A 3A0JA 2XWBB 1WTWA 4K0KL 1PFMA 2B2WC 1ZXTA 2BE5C 5IGGA 2F0GA 2VL6A 4LF5L 5IP9G 4A3LH 1VMPA 5BN5A 1MSHA 1C9OA 1NMGA 5I9PA 1JOQA 4APVA 4GN3B 3OTOL 4C3JH 3R3OA 3HFZB 3QR8A 1C0AA 2AHOB 2KECA 1FL0A 1EU3A 4IOAA 2B2YC 1IXRA 2X69A 4H0LC 4JG2A 4Q5VA 1IKMA 1Y1VB 2A69C 2O2LD 2Z6BA 4DPGA 5JEAG 3T53B 3H3VI 2JA6H 1ENCA 3MWYW 1GD7A 2FHTA 3OHXC 3NWTA 3CW2C 4I7ZC 4JW0A 1KLUD 1YHBA 5C5LA 2VQEQ 1VQ7A 2RHQB 4IJHA 3J7AF 2BCOA 1GJXA 5CGKA 2R93B 4I7AA 1PH1A 1D2BA 1HUNA 2JP1A 2DY7A 1N32Q 1DZ1A 1ZEQX 1JWUD 1WCMG 1F77A 1G51A 4KI0A 3WDNA 3JAMi 4A3GG 2R6GA 3BDOA 2ZXOA 3U9SA 2O4XA 2QCPX 2Y0SE 4YIJA 4LF5Q 4LUOA 4AH6A 1YI2A 1X3QA 3F2UA 3UDIA 2B3GA 2PW5A 4HSPA 4R4TA 3DMUA 1D5XC 3OTOQ 4TSSA 2NUCA 1Y1VH 3KLSX 4LUVA 3KFUA 2EPBA 2PYKA 1LTAD 2TSSA 1A3TA 3I4NG 2J0TD 1H9MA 2PO4A 5C44B 1TS2A 1SE2A 2PZUA 5FLMH 1AEXA 3W1GA 1AFPA 3CU7A 4R8NA 3FDTA 1YJWA 3MTSA 3GTOB 4RGNA 3KF6B 1FGUA 1I4XA 3DEOA 1YJNA 4C3IG 5HGQA 5C0XJ 4OX9Q 2R93H 1EZ6A 1NR4A 4AQYL 1X32A 2GVBA 3WOFA 4H02A 5DLQE 4A3JG 1STHA 5I6WA 3P1HA 4LF7L 1EY0A 4K2KA 4LNQA 1Q86C 4FF2A 4LF9Q 1DOKA 2AQ3B 1PTOD 2K01A 5FLXE 3MXNA 5FOBB 4X3SA 1E24A 4IUUA 2A6HD 1XTDA 1PFBA 5EBDA 4KY5A 3I8ZA 1STEA 4DR1Q 5LHY1 1V1QA 1K83B 2C35B 4FP5D 4KMUC 4KTAA 1WFQA 1X6OA 3I4MG 3F2CA 5C44H 1GUWA 1OXXK 2WINB 3J80i 2K5WA 3KUPA 4IPHA 4WRDA 4R8IA 1FNUA 2PMZE 1EFID 2B2UC 3GTOH 2SNSA 4DNIA 1S3OA 4B3TQ 2K33A 1HXYD 5FO9B 3CC7A 3DUZA 2VS1A 2WKDA 1IL2A 5E4WC 4J1MA 2ID0A 1KAAA 3H6MA 5GADC 2BOSA 1WD1A 3HOWB 1JOKA 3HOXB 4QB4A 4L8JA 4IOCA 2E75C 4AQYQ 3L7ZC 2YTXA 2VUMB 1XPOA 4P71A 1IBKL 2Z9HA 4DAYA 1HNZL 4LF7Q 2R61A 4HMJA 2SOBA 5KEEA 3PUVA 4NW2A 1STGA 1K83H 3HOVB 2R7ZG 1N34Q 5I2YA 4L63B 3MXNB 4A3DB 2EY5A 4L5TA 1VQFA 3CMEA 1QZHA 4NXNL 5LL6S 4KN7C 3BDCA 1L2FA 3MXUA 5KYLA 3G48A 2YTYA 3RLFA 4XT3B 1CA5A 4JI2L 4A3CG 3H0GG 3QO2A 1CA6A 1LO5D 4OEMB 5CV6A 1HR0L 3ERQA 1TWGB 5M5XB 4JI4L 1GUTA 3NBHA 5EAYA 1F9SA 4KJNA 3M4YA 2VUMH 2EY6A 2AUKA 4WJ3M 3GTPB 5C4JB 3A8KE 5JPMC 2ZTCA 2KVMA 2EQSA 3HOVH 1IBKQ 3CCJA 4BY7H 2NZ1D 1HUMA 5AJ3Q 4JYAL 1HNZQ 2B63H 3RZDH 4A3DH 4YCVA 2K5QA 3W5OA 4KHZA 2AWOA 4UHVA 1PYBA 2CWAA 1H9KA 4P74A 4NXML 4IFDJ 3S15B 1CUKA 4HAEA 2F4IA 4HN7A 1LTBD 4LJZC 3CCRA 3CRLC 1C4QA 4CBVA 1TWGH 5M5XH 5J3BA 4JI2Q 2L0CA 3CRKC 4F7XA 4GN5A 1EWIA 1GXDC 2CKZB 1R9TB 1K28A 1PFSA 3L9AX 1VQCA 4CGYB 4KV6A 3RN2A 3GTPH 5C4JH 4CKCA 1LM0A 1GO3E 1LABA 2K32A 1EZ8A 2MPMA 4RCNA 4C1NK 2HQEA 2AQ1B 2NVXB 1LTGD 3ND8A 1XMOQ 2N8NA 1VQHA 1AW7A 3KDFA 4BA1I 1RJTA 2E74C 3TQYA 1VF7A 1N9WA 3S15H 3ND9A 2J4XA 2LXKA 4DN4M 1BBWA 3KOJA 5EKIA 5E3FA 2L4NA 5IYCG 1N8RC 5F2DA 4WFN3 3N6RA 4TRDA 2NYZD 1WYDA 4KD3A 1R9TH 2K5DA 4AYBB 1YNJD 1HHVA 1TKWB 5CR3A 5CV4A 2K7VA 1S4ZA 2I5HA 3DEPA 2F4VL 2HCIA 4QF4A 3GP7A 4IN3A 1OXUA 2XRQD 4OONA 5J1ZA 4HJAA 3CD6A 2BH8A 4A3LG 4YWLA 1Q81C 2VXWA 3CCMA 3C3LA 2PZWA 4FXKC 1VQPA 1JB3A 4C3JG 3PIP3 2E5LL 3K0YA 1SYDA 1A0IA 1VS0A 1VQGA 1FR3A 1AZPA 1B7YB 2D62A 1PRTF 2JA7B 2VB2X 4OWTB 4KK7A 3S2HB 3MA2B 4L6TB 1PTOH 2ZTEA 4B3RL 3QWNA 4K8JA 2BA1A 1Y69U 2WKCA 2L1BA 1A63A 1PRTB 3J81L 2ENBA 2JA6G 4BY1B 4DV5L 2F0FA 1ICFB 3A74A 2GVAA 4RCOA 1HR0W 2Z6KC 3URYA 4UP8A 1B4OA 3C46A 1RF2D 4C3HB 2K5HA 1QNUA 1TY2A 3I4LA 5C6AA 4R9WA 4A3EB 1VQAA 2PZTA 1GUOA 5JJKA 2K5NA 1A8VA 1F9RA 2DJGC 2MP1A 1G91A 3C2PA 1CKNA 2JA9A 4RKLA 3M4QA 3M7GA 3VR2A 4DV2L 4HJ8A 1S40A 1RKNA 3RUZA 2EYLA 3P75A 4WORA 1VQ4A 5ISRA 3U9OA 4CHTB 1GKHA 1J6QA 1E7ZA 5IGFA 1T9HA 2JA7H 4BXXH 4UDUC 1DD2A 5ELDA 1EYGA 1PTOC 3K5NA 4POFA 1Y1VG 2IY5B 1QG7A 1X3FA 2A6HC 2B8FA 2F0OA 4B3SL 2WIIB 1UE1A 4KLKA 4BY1H 4X65L 3PO3B 4F87A 5FLMG 4PMBA 4XXEA 5GROA 4FYDA 2RHSB 2AUJD 4DR5L 3E0EA 4A3EH 2QDLA 4QJFA 1QCBD 1HA6A 3M9BA 4DV5Q 1MIUA 2R93G 5DEHA 3GDEA 1EEFD 3M3YB 3UE0A 4GKKL 4R1JA 3HKZB 2NZOA 4ID6A 1XNQL 1PA6A 1H95A 2ES2A 1KABA 1H9JA 1VQKA 2B2WA 3O13A 4IALA 5KNDA 2IHFA 1SNCA 1BCPF 3VA7A 4Q0FA 3NWSA 4QGUA 4DK0A 3NPPA 3JAML 3UI2A 1Y1WB 3F1ZA 1BCPB 1EOTA 1KQSA 2B2YA 4OWWB 1DONA 1TWAB 3NHHA 1EQRA 4CDEC 5C44G 3PO3H 2KCTA 1EU4A 4UY8C 4K5WA 1OXVA 4YCUA 4B3SQ 4OO1H 3MXGA 3NE5B 4RGMA 2WAQB 3SK4A 1QUQB 4GZYC 3SR1A 3M3YH 4XQNA 4IJLA 5IT9E 2YTVA 4IPCA 3FKIB 2QW7A 4DV3Q 2EE1A 1E1OA 1IBMQ 4FO2A 1KD1C 3GO5A 3GTLB 1NTGA 5J39A 1V1PB 1KXLA 2DNEA 2XSCA 3S1MB 4RGOS 4EQPA 5GAHC 1STNA 1K9MC 5FLXL 2B39A 4HSVA 3RN5A 2EYHA 4G57A 3RZOB 3ULJA 2RCFA 1Y1WH 1SR3A 4E6IA 2TMPA 1WTVA 3EVQA 3I91A 1HZBA 4DR6L 5G3LD 3G6EA 3CHBD 4ME5A 3RNUA 4QIWB 4RA8A 1B3AA 1V9PA 2MQHA 3QJYA 2OT2A 3I72A 5CC4A 4RFBA 3I7FA 1Y8PB 3VYUA 1IYJB 1MBYA 1UUPA 2CH4W 1X9NA 2OTLA 1ZYRD 2BA0A 1IW7D 4V0BA 1ILQA 1X55A 1UWVA 2PNRC 3CC2A 3FKIH 3HOUB 1O78A 2N3SA 1KNAA 2KCCA 5IYDH 3HOWG 3HOXG 2RBMA 1K8GA 3GTLH 1HFNA 3OWEB 5ELOA 2HT1A 3S1MH 2KEDA 1I50B 1CK1A 3HEJA 2VUMG 2CVRA 4B9WA 4JK1C 1WTQA 4B3ML 4QUFA 4POGA 1B50A 5DM63 4F8MA 3RZOH 1FD7D 1Y8OB 2Q2IA 4QMGA 3I55A 3HOVG 2EJFC 1BCPC 1E22A 3FP9A 5IGEA 4A3DG 4EQ5A 2KCMA 1AE2A 1JR0D 2F0KA 3NELA 2D0OA 3OIPA 5FJ8H 4DAMA 3J81i 1A3UA 2UXCL 4OL7A 1SAPA 4QUCA 2M00A 4RHSA 2D0PA 3ER0A 4ZQ3A 2VQFL 5ELFA 5EBCA 3AEVA 1M1KC 3NTHA 3HOUH 2Q8RE 1PH3A 2B2UA 5D3IB 3L3OC 1QB5D 2VQEL 3S2DB 4K5VA 3CQZB 2MHVA 3OW2A 2UXDQ 2EDGA 4ME3A 2EYFA 1SJED 4JI3L 1N32L 3GTKB 4IZ8A 1E1TA 2FMMA 1YNJC 2A6ED 4B3MQ 3LGJA 2XGTA 5C0XH 5EKLA 3IL8A 2HHHQ 3PQIA 1JCKB 3P7JA 1XTCD 2F0VA 2KQ3A 1SYCA 2VY3A 1QWYA 4DK3C 1R4QB 2KHJA 1F9PA 1TXYA 1I6VC 4HJ9A 1E2ZA 5H1SE 1I94L 1RDPD 3NQIA 1EY9A 1XXGA 1K8OA 3S1RB 2HCCA 2XVSA 5CYUA 2UXCQ 2EY1A 3KF6A 4XIGS 3A55A 3T13A 4DA2A 4AIMA 4IUPA 2A8VA 1HZCA 1ET6A 3S2DH 4LUZA 3CQZH 1TY0A 2VQFQ 3SK8A 4OX9L 2P5ZX 4MTKA 4DKAC 3QG1A 4AYBE 3AMUA 2F0QA 1FGBD 4XQQA 1PH2A 1B8AA 4LFCQ 3GTKH 1G6PA 1DJRD 4LF9L 1XMQQ 1G8ZD 3D6WA 1RHPA 4JI3Q 1JICA 4JI6Q 1ENFA 1E2VA 1LT6D 4QY7A 1VQEA 4X3TA 5IY0A 3KYHC 1TQOA 5COYA 4DR1L 2D9UA 5JJIA 4DR7L 1LTSD 4OGQC 3R93A 3TP5A 2VB3X 1X3EA 1JE4A 3RLNA 3F8TA 2L15A 4CDDC 2K28A 1BR9A 4RMFA 4KHPL 3S1RH 1B9NA 3BZDB 4LF8L 4JI8Q 1DOLA 5FKAC 2EZVA 3KLRA 1VQ6A 3OIQA 5C4XH 1I94Q 1I6HB 1BBXC 4B3TL 3HP3A 1KC8C 2KUMA 1YBYA 1MKHA 4AYBG 4J8QA 4A3KH 1D5MC 3BZKA 1JC7A 5M3MB 4C56C 2OXPA 3KBXA 4A3FB 1S72A 4L5QA 2KCNA 1WJJA 4XDXA 3L2PA 1ASYA 2MFIA 5M9OA 4XT1B 1Q1EA 2ZJQA 3W1BA 4O42A 3CKIB 2PQAB 5A2QE 3TZUA 2DN8A 2KOLA 3MC0B 1DXMA 1FNVA 3RLOA 3TEHB 5ELEA 5IT9c 2IPKD 5M5YB 5KIXA 1ASZA 3Q8DA 1N34L 3VDYA 1SNQA 3K5MA 2EJMA 1W6JA 4X6AH 1MI2A 2H5XA 4KJOA 5NUCA 2QILA 3BVGA 2JA7G 2SNMA 4I65A 4ODGA 4JI0Q 4DR7Q 2EXDA 3C1EA 2HIXA 1I6HH 2UXBL 1D1IA 4BY1G 1FYCA 4KHPQ 4LF8Q 3CPFA 1NNXA 3BDLA 4C3HG 1EWHA 4N8FA 4IPGA 2F0UA 1Z6HA 5M3MH 4A3EG 4A3FH 1D8LA 3M4OB 2A74C 3DWPA 2XRSD 4IFDH 1LTID 5JVH3 5J22A 3HKZE 1PHJA 2V4DA 3HGBA 3A54A 5M5YH 2EYMA 2B2TC 3KF8A 4CJ2C 3S16H 5AJ3L 4TQUS 4CKBA 2I0QA 3K59A 3MVVA 2LY7A 2WB1B 1BO0A 3R2IA 5LMNL 2HUGA 2B2VC 3BVZA 4BY7B 4GLAC 2F3VA 5ELNA 4MHEA 2B63B 3RZDB 5T1IA 2AQ2B 1YITA 3E3XA 2JXMB 1CKOA 1KRSA 1VQOA 3PO3G 3VR3A 3ICEA 1G2TA 3AU7A 3NXWA 1I4RA 2F0WA 1MD2D 4OO1G 4A75A 2UXBQ 3RMHA 3R2TA 2CCZA 2WAQE 4PZ7A 3M4OH 2Z6KA 1ESFA 3DM3A 2Z4HA 3HKZG 2CH4A 1WTXA 4EX5A 4A3MB 4WJ4A 2V1CC 1ZYRC 1O80A 4JPBW 5HURA 4GKJQ 1IW7C 1H9SA 2CHBD 2VZAA 4QL5A 4YHHL 1TS3A 3F2BA 3TMEA 4P2CB 5EPLA 1XMOL 2FJ2A 1F2LA 5FO8B 2RKSA 3MXPA 4PMWA 3DHQA 1Y1WG 4A3IB 1O7LA 1ET9A 3PUXA 3MFGA 3KF8B 4WJWA 2KJXA 5LMNQ 1IZ6A 1NY4A 5JJZA 2UU9Q 3GTQH 1OXSC 2RDGA 1G2SA 4MIUA 5K5PA 2WAQG 4ZUJA 3EBEA 5EKKA 1YZ6A 4GS3A 1ML0D 4JOIC 4DK1A 2RQXA 3FEWX 4LMQD 3SHLA 1AZQA 1II3A 3FKIG 2MGSA 3A8JE 4UPAA 4BS9A 1I4GA 5C3EB 3K58A 3VA5A 2K14A 5IYDG 4A3MH 4DV4Q 1IYVA 3H3VC 1ENAA 1FNWA 5IGBA 2F0TA 1VQ8A 5I6YA 1CFMA 3SE0A 3K5LA 1X65A 3PF5A 5IP7G 3CCSA 3M4PA 4G7OC 1JWMD 5CV9A 1L0YB 5AFWA 5HY6A 3TZDA 4YHHQ 1H9SB 4A3IH 1Q7YC 2D2CC 1STAA 1SNDA 3SGIA 1J8IA 2ICEC 2A68D 3CCLA 2NTTA 1EY7A 1DCZA 4IPDA 4YWKA 2A6EC 4RH6A 1PTOF 4DR4L 1HNXQ 1TS4A 4GLVB 3PCOB 5DM73 2JYOA 3QOLA 1BXTA 4LFAQ 1TWFB 3ULPA 4ULLA 4BBRB 3DWAA 3PIPA 1PTOB 4M8AA 5K36H 3HOUG 5IP9H 1UNSA 5HGTA 3J7YW 5C3EH 5CORA 4EVOA 1WD0A 4FF3A 4MN3A 3WOEA 1JJCB 3J7ZC 4ZLTF 1ILPA 2F0DA 4ILWA 3HOZB 1LUZA 3P20A 1CHPD 5BR8L 1EOVA 3STBD 1IKLA 1DM0B 1JORA 3ZJYC 3K5OA 1PLFA 4HJ7A 2F0NA 1YNND 2F0JA 1PV4A 5I9OA 3SK6A 4X3UA 1CQVA 2HQLA 3JAMc 5C0XG 1KIXA 4FXGC 2F03A 3Q24A 5IWAQ 1XPUA 1RTNA 5LMNW 4IUTA 5BN3A 3T1HQ 4JI5Q 4RWSC 3RR5A 5LMUL 1H9RA 3U58A 1JB7A 1CSPA 1EWCA 1LACA 4DGZA 3R8BA 1TWFH 2IHEA 4BBRH 3M7NA 4DR4Q 2CW0D 1EY8A 4FDBA 1SNPA 1A15A 1EYAA 4N9PA 4OIKA 2Q8IB 2F3IA 2Y0SB 4JBJA 4HCSA 3HOZH 2R92B 1N36L 3AFPA 3EQLC 3MZ5A 5CV7A 3A5ZB 2KHIA 2PI2A 2F0MA 4JI7L 1YHQA 2UUAL 5EJWA 4H7BA 5CBAE 4NDXA 1QZGA 5BR8Q 2EXZA 1U4LA 3BU2A 3LWUA 4XTCS 4QCLA 1VCIA 2ATWA 3QB3A 2NVQB 1SNOA 1J5EL 4XQJA 1AE3A 5FK9C 1M4VA 4DNRB 2IJ0A 1QJOA 5DNFA 1E2WA 5GQOA 2EYPA 1U9RA 4HTHA 4X3KA 1K3BC 3UDXA 1TR5A 4H13C 4PG3A 4JBMA 4J6HA 4DU9A 2E2IB 1XPRA 3MEHA 5LMUQ 1QUQA 1KHIA 3VYSA 2I5MX 3S24A 1DOMA 3J80c 1GM5A 1GUNA 1HTLD 3K8AA 2XIWA 2RA4A 1B44D 2R92H 3SDZA 2FFKB 2ZXPA 1Z9FA 3IFDA 4JVZA 1TIID 4V190 4DAPA 1SRUA 5EQ0A 2B8GA 4DV3L 1V1PA 5JEAJ 4UAIA 1EY6A 1IBML 3UDFA 1N36Q 3MFYA 3V96A 1J9OA 1SYGA 1HNWL 3B6YA 3F2DA 5C3WA 4JI7Q 4JBWA 2UUAQ 4LWCA 4DV0L 2NVQH 1K3RA 2DNCA 4NPSA 1GUSA 3TP8A 5D14A 2F0HA 2PMZB 4IUVA 5TSSA 2ZJPA 2M9VA 4KHVA 5FO7B 1ICWA 1NBWA 3QOJA 4J15A 4RGTA 2IWHA 1J5EQ 2AWNA 2IX1A 3UDGA 3OOCA 3I73A 4DUZL 3S1NB 2NTSA 4CJ1B 3GTJB 4MTNA 2E2IH 3OW7A 4K8IA 3D6CA 1SROA 1SLJA 5IYBH 4CJ0B 1HRJA 3PUYA 2LXJA 1PXUA 5IIFA 4ALPA 2CFMA 2RSOA 5M3MG 1EY5A 1HJPA 3OPOA 4A3FG 5ELBA 2UUBQ 2NN6H 2R7ZH 4RAUC 1EIGA 2OQ0A 3U50C 5EPKA 1VQLA 3IAYA 4IFDG 4H44C 5I2XA 3OMGA 1SSOA 3K7UC 5A2QL 2OTJA 3ITPA 1HNWQ 1LV9A 1X54A 5JVG3 4DV0Q 3CC4A 1HH2P 1QVCA 2Z8LA 2A19A
chains in the Genus database with same CATH topology
4IUNA 1SEBD 3SXHA 1CHQD 3I70A 4DAVA 1F2YA 5M3FB 2LMCB 5JAVA 3TP6A 3NTKA 2Z1CA 1A2TA 1Q3LA 3PMFA 2A73B 1EIHA 3SK5A 5C4HA 4OIJA 1B9MA 5E1FA 3LWEA 4KY7A 2NWGA 4FF4A 3NP8A 1PFNA 1KTKA 3PV0A 4IURA 2F0PA 5JPNC 2KEEA 1IHZA 1BQQT 2WP8J 1BNZA 1R4PB 1SJHD 1JQYD 2E2DC 3A7LA 3X3MA 2X6LA 3Q6SA 5DAUA 4FXDA 3PO2B 1EYDA 5C3XA 2QKIC 1WTOA 1X3PA 4K5XA 3GD7A 3MAQA 2C5CA 2L12A 2N88A 2A68C 5KGUA 2E76C 1ESRA 5IODA 1Q8IA 2WV6D 3BYTB 3TSSA 1I4PA 1V8QA 2E2HB 4K14A 1L0XB 2C9OA 1PDQA 1HCZA 4BBSB 1TU2B 4IFDI 2L55A 3J81E 1KNEA 4N9TA 2O5JC 2B2TA 2M2LA 2E2JB 3IFTA 1NAPA 5ELCA 2B2VA 1YNNC 2ZT9C 2F0LA 4EGVA 1LTTD 5LL6X 4ZRZA 3PUWA 5EGTA 4HCEA 1BF4A 1JOOA 2H1EA 2JA8B 5C4ZA 2L5TA 4F88A 1F2ZA 5K36G 4B9XA 2JA5B 2RSNA 1WTPA 1B2TA 5C4XB 1QOHA 1KDAA 3AB9A 5D65A 4A3KB 2CW0C 1I4QA 3KBGA 2FINB 2Z4IA 1S5CD 4KN4C 5IGCA 3D3RA 1ONLA 4ZKCB 1QILA 4M1UB 3QIAA 4G7ZC 1CT1D 3E5SA 3HZXA 3FMCA 4DFAA 1SYEA 3V2TA 2PW7A 3H09A 3NQTA 1GOZA 1NSNS 5KYIA 3ONAB 2G9HD 1U4PA 2CQAA 1SYBA 1HPCA 2NB0A 1PZID 3G7LA 3FPPA 5G3LF 3GQBA 3JAME 3VR5A 1XWEA 1SE4A 2IT1A 2FMCA 1LTRD 3RD4A 3W2DA 1B53A 1HA5A 3OMCA 4A93B 1WTRA 4KKSA 3FPUB 3KK7A 2I46A 1D1KA 3EFXD 3S16B 4G4KA 4C1NI 3TBIB 1Q1BA 4OHJA 4HR7B 3GV3A 3C1FA 4HEDA 4NKLA 1SDFA 3NSWA 4K6LA 1D6EC 1ZKOA 3D31A 1VDZA 4K6DA 2JEBI 1E0BA 3J7AV 1AP0A 1CZGA 2WACA 4A3BB 3TDQA 1T5EA 1HTPA 3PIO3 3V05A 5D3DA 1QNKA 1EQVA 1M8AA 3DWQA 3J80E 2F0SA 3VR6A 3HG9A 4LK1C 1VF5C 2K05A 2D5DA 3SEBA 3IKJA 1STYA 3VYTA 3HOYB 3NTIA 3GTQB 1SXTA 1PRTD 5IOCA 2PPBC 2H4OA 1Q90A 4NMZA 1XYIA 4CKEA 2O5IC 2NN6G 2RDFA 5I4DA 2MJ8A 1EQTA 1BDOA 2QF7A 3G6JB 1Z7TA 1TWHB 2XN9C 2NVTB 1SMYD 1PZKD 4FNFA 3LNNA 3Q23A 5BN4A 1PZJD 3BS1A 1STBA 4NP5A 4DXFA 3DXJC 2KA7A 3OWFA 1IL8A 4KD4A 3K7AB 2IL8A 3TP7A 2EJGC 2SEBD 3H91A 2LFNA 4DF7A 1S5ED 3K57A 3PUZA 5IT9L 1I3QB 2L9HA 2EVBA 1S5BD 2JEAI 1A3VA 2JSOA 1KDCA 2HDLA 3TN2A 1IYUA 4PQXA 3S17B 2F0IA 1SBBB 3FRPB 2NVYB 2BDNA 4C2MB 2NBFA 5E4XA 2J7ZA 1K8MA 5KNBA 5CV8A 2QEJC 1BCPD 4HMIA 4ZAIA 1TWCB 2ZXRA 4XYOA 3BG3A 2MUYA 1S5FD 2LS01 1TT2A 3NUCA 4B08A 3M85A 1WCMB 2OF1A 4IUQA 2IX3A 3ZYYX 4A3GB 4OO1I 3KLSA 1EYCA 3S9WA 2NN6I 2ICIA 1F2MA 3T16A 4PMCA 1QE6A 5CMDA 1OO9B 3S1QB 5JEAH 4Y7NB 1MSGA 1AN8A 3I4NB 4U68A 3HS0C 3T4AC 5KNCA 2IW3A 2BE5D 2G9DA 2PCFB 4FVMA 4C3IB 1EL0A 3BVMA 1PMRA 1U4MA 2SDFA 1HFGA 4BA2I 1D5ZC 3I3CA 4S3SA 4A3JB 2Q8TA 3K6OA 1OXTA 3EJIA 3N52A 2A69D 3NK9A 3EA6A 3H94A 2RVLA 4IQZA 3I90A 4PV1C 1LLRD 2YYZA 1RD9D 1O7YA 3I4MB 3Q22A 3T56B 2YU9B 1RODA 4KKUA 4K2LA 2QDBA 5EPJA 3BYYB 1SYFA 4BWGB 5C5MA 1GHKA 1HQMC 1TVXA 1DYQA 1CQFA 5JOBA 4DNTB 1A2UA 2K03A 2KHSA 4TKOB 1PYWD 3VR4A 1G291 3GTGB 2L11A 2R7ZB 1CM9A 1EY4A 2K6AA 1C8CA 3A7AB 2VNUD 3NBIA 1CTMA 3T51B 3S14B 1W6KA 4Z9CB 1T5XD 3A56A 5T1GA 1SE3A 3FVQA 4LAAA 1V1OA 3H0GB 1Q12A 5C0XI 4G7HC 1S5DD 2EY2A 1VMCA 3GV6A 1U4RA 3W3AA 5IGDA 2EYJA 1WVLA 1LT5D 2XWJB 2HDMA 1LT4D 2OEOA 1SFOB 1NUCA 1GHJA 1TS5A 2IX0A 1PRTC 1UAPA 4FF1A 4RHRA 1MGSA 1NCVA 3D4RA 2EYOA 3HRZC 1B1ZA 4ZYSA 2LKVA 1BUVT 3LX0A 5A35A 1C48A 1SNMA 3E6ZX 1Z47A 4ZUIA 1SMYC 5CV5A 1KLGD 4O1NA 4EQNA 2A5HA 3MHBA 1I4HA 1Y8NB 1RCVD 3DM1A 2EOTA 1KDBA 1CI3M 2F3WA 4DXGA 2K04A 3VYRA 1EEID 1UEAB 3X3NA 4XYQA 3J80L 5KRUA 3GTMB 2BDOA 1JWSD 3OSOA 5M5WB 1BOSA 4ABNA 4KKTA 3D4DA 2GA4B 2XNAC 4U673 1GUGA 4RKBA 1RTOA 2PQEA 3D8GA 3Q0AA 2K1BA 1O7ZA 1NR2A 4ZKBB 2JE6I 2F1MA 2R3ZA 3E0JA 1CZWA 4C3JB 4ZK9B 1F9QA 4KY6A 1XX8A 1G6ZA 2DY8A 1HQRD 1LT3D 1V43A 2RDHA 3A8IE 1A6XA 2F0EA 3SVMA 2X6GA 2JA6B 5CBEE 3EROA 3D4WA 4EQOA 2I07B 4PNYA 2N55A 2XWBB 1WTWA 1PFMA 2B2WC 1ZXTA 2BE5C 5IGGA 2F0GA 1VMPA 5BN5A 1MSHA 5I9PA 1JOQA 3R3OA 2KECA 1EU3A 2B2YC 2X69A 4H0LC 4Q5VA 1IKMA 1Y1VB 2A69C 2O2LD 5JEAG 3T53B 1ENCA 3MWYW 2FHTA 3OHXC 3NWTA 4I7ZC 1KLUD 5C5LA 3J7AF 1GJXA 2BCOA 5CGKA 2R93B 1D2BA 1HUNA 2JP1A 2DY7A 1DZ1A 1ZEQX 1JWUD 1F77A 4KI0A 3WDNA 2R6GA 3BDOA 2ZXOA 3U9SA 2O4XA 2QCPX 4YIJA 1X3QA 3F2UA 2PW5A 4HSPA 3DMUA 1D5XC 4TSSA 2NUCA 3KLSX 2EPBA 2PYKA 1LTAD 2TSSA 1A3TA 2J0TD 1H9MA 2PO4A 5C44B 1TS2A 1SE2A 2PZUA 1AEXA 1AFPA 3CU7A 4R8NA 3FDTA 3MTSA 3GTOB 4RGNA 1I4XA 3DEOA 4C3IG 5C0XJ 1EZ6A 1NR4A 1X32A 3WOFA 1STHA 5I6WA 3P1HA 1EY0A 4K2KA 4FF2A 1DOKA 2AQ3B 1PTOD 2K01A 5FLXE 3MXNA 5FOBB 4X3SA 4IUUA 2A6HD 1PFBA 5EBDA 4KY5A 3I8ZA 1STEA 5LHY1 1K83B 4FP5D 4KMUC 4KTAA 1GUWA 1OXXK 2WINB 2K5WA 3KUPA 4WRDA 4R8IA 1FNUA 1EFID 2B2UC 2SNSA 2K33A 1HXYD 5FO9B 3DUZA 2WKDA 5E4WC 4J1MA 2ID0A 1KAAA 3H6MA 1WD1A 2BOSA 3HOWB 1JOKA 3HOXB 4QB4A 4L8JA 2E75C 3L7ZC 2VUMB 4DAYA 2R61A 4HMJA 2SOBA 5KEEA 3PUVA 4NW2A 1STGA 3HOVB 5I2YA 4L63B 4A3DB 2EY5A 5LL6S 4KN7C 3BDCA 5KYLA 3MXUA 3RLFA 1CA5A 4XT3B 3QO2A 1CA6A 1LO5D 5CV6A 3ERQA 1TWGB 5M5XB 1GUTA 3NBHA 1F9SA 4KJNA 3M4YA 2EY6A 2AUKA 3GTPB 5C4JB 3A8KE 5JPMC 2KVMA 2NZ1D 1HUMA 2K5QA 4KHZA 2AWOA 1H9KA 4IFDJ 3S15B 4HAEA 2F4IA 4HN7A 1LTBD 4LJZC 3CRLC 1C4QA 4CBVA 2L0CA 3CRKC 4F7XA 1GXDC 1R9TB 3L9AX 4CGYB 4KV6A 4CKCA 1LABA 2K32A 1EZ8A 2MPMA 4RCNA 4C1NK 2HQEA 2AQ1B 2NVXB 1LTGD 3ND8A 1AW7A 4BA1I 1RJTA 2E74C 1VF7A 3ND9A 2J4XA 4DN4M 5EKIA 5E3FA 2L4NA 5F2DA 4WFN3 3N6RA 4TRDA 2NYZD 4KD3A 2K5DA 4AYBB 1YNJD 1HHVA 1TKWB 5CR3A 5CV4A 2K7VA 1S4ZA 3DEPA 2HCIA 4QF4A 3GP7A 4IN3A 1OXUA 2XRQD 5J1ZA 2VXWA 3C3LA 2PZWA 4FXKC 1JB3A 4C3JG 3PIP3 3K0YA 1SYDA 1FR3A 1AZPA 2D62A 1PRTF 2JA7B 2VB2X 4KK7A 3S2HB 3MA2B 4L6TB 1PTOH 3QWNA 4K8JA 2BA1A 1Y69U 2WKCA 2L1BA 1PRTB 3J81L 2ENBA 4BY1B 2F0FA 4RCOA 3URYA 1B4OA 3C46A 1RF2D 4C3HB 1QNUA 1TY2A 3I4LA 5C6AA 4R9WA 4A3EB 2PZTA 1GUOA 1F9RA 2MP1A 1G91A 3C2PA 4RKLA 3M7GA 3VR2A 1RKNA 3RUZA 2EYLA 3P75A 4WORA 5ISRA 3U9OA 4CHTB 1DD2A 5IGFA 4UDUC 5ELDA 1PTOC 3K5NA 1QG7A 2A6HC 2B8FA 2F0OA 2WIIB 3PO3B 4F87A 4PMBA 4XXEA 4FYDA 2AUJD 1QCBD 1HA6A 5DEHA 3M3YB 1EEFD 3HKZB 4ID6A 1KABA 1H9JA 2B2WA 3O13A 4IALA 5KNDA 1SNCA 1BCPF 3VA7A 4Q0FA 3NWSA 4DK0A 3NPPA 3JAML 3UI2A 1Y1WB 1BCPB 1EOTA 2B2YA 1DONA 1TWAB 3NHHA 1EU4A 4K5WA 1OXVA 4OO1H 3MXGA 3NE5B 4RGMA 2WAQB 3SK4A 4GZYC 3SR1A 4XQNA 5IT9E 3FKIB 2EE1A 4FO2A 3GO5A 3GTLB 5J39A 1V1PB 2DNEA 2XSCA 3S1MB 4RGOS 4EQPA 1STNA 5FLXL 2B39A 4HSVA 2EYHA 4G57A 3RZOB 4E6IA 2TMPA 1WTVA 3EVQA 3I91A 5G3LD 3CHBD 4ME5A 4QIWB 4RA8A 1B3AA 3QJYA 2OT2A 3I72A 5CC4A 4RFBA 1Y8PB 3VYUA 1MBYA 1UUPA 1ZYRD 2BA0A 1IW7D 4V0BA 1ILQA 2PNRC 3HOUB 1O78A 1KNAA 2KCCA 2RBMA 1HFNA 3OWEB 2KEDA 1I50B 1CK1A 3HEJA 2CVRA 4B9WA 4JK1C 1WTQA 4QUFA 1B50A 5DM63 4F8MA 1FD7D 1Y8OB 4QMGA 2EJFC 1BCPC 5IGEA 1JR0D 2F0KA 3OIPA 1A3UA 4OL7A 1SAPA 4QUCA 2M00A 4RHSA 4ZQ3A 5ELFA 5EBCA 3NTHA 2Q8RE 2B2UA 5D3IB 3L3OC 1QB5D 3S2DB 4K5VA 3CQZB 2MHVA 2EDGA 2EYFA 1SJED 3GTKB 4IZ8A 2FMMA 1YNJC 2A6ED 5C0XH 5EKLA 3IL8A 1JCKB 3P7JA 1XTCD 2F0VA 2KQ3A 1SYCA 1QWYA 1R4QB 1F9PA 1I6VC 1E2ZA 1RDPD 3NQIA 1EY9A 1XXGA 1K8OA 3S1RB 2HCCA 2XVSA 5CYUA 2EY1A 4XIGS 3A55A 3T13A 4DA2A 4IUPA 1ET6A 1TY0A 3SK8A 3QG1A 3AMUA 2F0QA 1FGBD 4XQQA 1DJRD 1G8ZD 3D6WA 1RHPA 1JICA 1ENFA 1E2VA 1LT6D 4X3TA 1TQOA 5COYA 2D9UA 1LTSD 4OGQC 3R93A 3TP5A 2VB3X 1JE4A 2K28A 1BR9A 1B9NA 3BZDB 1DOLA 5FKAC 2EZVA 3KLRA 3OIQA 1I6HB 1BBXC 3HP3A 2KUMA 4J8QA 1D5MC 1JC7A 5M3MB 4C56C 2OXPA 3KBXA 4A3FB 2KCNA 4XDXA 5M9OA 4XT1B 1Q1EA 4O42A 3CKIB 5A2QE 3TZUA 2DN8A 2KOLA 3MC0B 1DXMA 1FNVA 5ELEA 2IPKD 5M5YB 5KIXA 1SNQA 3K5MA 2EJMA 1W6JA 1MI2A 4KJOA 5NUCA 2QILA 3BVGA 2SNMA 4I65A 4ODGA 3C1EA 1D1IA 1FYCA 3BDLA 4C3HG 1EWHA 2F0UA 1Z6HA 3M4OB 2A74C 3DWPA 2XRSD 4IFDH 1LTID 5JVH3 5J22A 2V4DA 3HGBA 3A54A 2EYMA 2B2TC 3KF8A 4CJ2C 4TQUS 4CKBA 3K59A 3MVVA 2LY7A 2WB1B 1BO0A 3R2IA 2HUGA 2B2VC 3BVZA 4BY7B 2F3VA 4MHEA 2B63B 3RZDB 5T1IA 2AQ2B 2JXMB 3VR3A 1G2TA 3AU7A 3NXWA 1I4RA 2F0WA 1MD2D 4OO1G 3RMHA 3R2TA 1ESFA 2Z4HA 1WTXA 4A3MB 1ZYRC 1O80A 5HURA 1IW7C 1H9SA 2CHBD 1TS3A 3TMEA 4P2CB 5EPLA 2FJ2A 1F2LA 5FO8B 2RKSA 3MXPA 4PMWA 3DHQA 4A3IB 1O7LA 1ET9A 3PUXA 3MFGA 4WJWA 2KJXA 5JJZA 1OXSC 2RDGA 1G2SA 4MIUA 5K5PA 4ZUJA 5EKKA 1ML0D 4DK1A 2RQXA 3FEWX 4LMQD 3SHLA 1AZQA 1II3A 2MGSA 3A8JE 4BS9A 1I4GA 5C3EB 3K58A 3VA5A 1IYVA 3H3VC 1ENAA 1FNWA 5IGBA 2F0TA 5I6YA 1CFMA 3SE0A 3K5LA 4G7OC 1JWMD 5CV9A 1L0YB 5AFWA 3TZDA 1H9SB 2D2CC 1STAA 1SNDA 1J8IA 2ICEC 2A68D 2NTTA 1EY7A 1DCZA 2A6EC 4RH6A 1PTOF 1TS4A 5DM73 2JYOA 3QOLA 1BXTA 1TWFB 4ULLA 4BBRB 3DWAA 1PTOB 4M8AA 5K36H 1UNSA 5HGTA 3J7YW 5CORA 4EVOA 1WD0A 4FF3A 4MN3A 3WOEA 4ZLTF 1ILPA 2F0DA 4ILWA 3HOZB 3P20A 1CHPD 1IKLA 1DM0B 1JORA 3K5OA 1PLFA 2F0NA 1YNND 2F0JA 5I9OA 3SK6A 4X3UA 1CQVA 5C0XG 4FXGC 2F03A 3Q24A 1RTNA 4IUTA 5BN3A 4RWSC 1H9RA 1EWCA 1LACA 4DGZA 3R8BA 3M7NA 2CW0D 1EY8A 1SNPA 1A15A 1EYAA 4N9PA 4OIKA 2Q8IB 2Y0SB 4HCSA 2R92B 3EQLC 3MZ5A 5CV7A 2F0MA 5EJWA 4H7BA 5CBAE 4NDXA 2EXZA 1U4LA 3LWUA 4XTCS 4QCLA 1VCIA 3QB3A 2NVQB 1SNOA 4XQJA 5FK9C 1M4VA 4DNRB 2IJ0A 5DNFA 1QJOA 1E2WA 2EYPA 1U9RA 4HTHA 4X3KA 1TR5A 4H13C 4J6HA 4DU9A 2E2IB 3MEHA 3VYSA 1DOMA 1GUNA 1HTLD 2XIWA 2RA4A 1B44D 3SDZA 2FFKB 2ZXPA 3IFDA 1TIID 4V190 4DAPA 5EQ0A 2B8GA 1V1PA 5JEAJ 4UAIA 1EY6A 3MFYA 3V96A 1J9OA 1SYGA 5C3WA 4JBWA 2DNCA 1GUSA 3TP8A 5D14A 2F0HA 2PMZB 4IUVA 5TSSA 2M9VA 4KHVA 5FO7B 1ICWA 2IWHA 3QOJA 4RGTA 2AWNA 2IX1A 3OOCA 3I73A 3S1NB 2NTSA 4CJ1B 3GTJB 3OW7A 4K8IA 3D6CA 4CJ0B 1HRJA 3PUYA 1PXUA 5IIFA 2RSOA 1EY5A 3OPOA 5ELBA 2NN6H 4RAUC 1EIGA 5EPKA 3IAYA 4IFDG 4H44C 5I2XA 3OMGA 1SSOA 5A2QL 3ITPA 1LV9A 5JVG3 2Z8LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PMB A;  4S3S A;  3C1F A;  2F0L A;  4IUN A;  5E3F A;  3TP7 A;  4NKL A;  4DF7 A;  2OEO A;  5CV9 A;  2NUC A;  3SXH A;  2RBM A;  5F2D A;  3BDC A;  5KYL A;  1NUC A;  2PYK A;  4TRD A;  2EYM A;  3EJI A;  1STA A;  2EYP A;  1SND A;  1JOO A;  1A3T A;  3NK9 A;  4KD3 A;  4KY6 A;  3HEJ A;  5DEH A;  1F2Y A;  1U9R A;  5CV6 A;  4B9W A;  5JAV A;  4HTH A;  5C4Z A;  3TP6 A;  4ID6 A;  2PZU A;  1EY7 A;  1F2Z A;  3MVV A;  5CR3 A;  5CV4 A;  1TR5 A;  1TQO A;  4K6D A;  1AEX A;  1A2T A;  3ERQ A;  3PMF A;  4B9X A;  4J6H A;  4DU9 A;  4R8N A;  1KAB A;  2EYO A;  3MEH A;  4QF4 A;  3SK5 A;  4F8M A;  5C4H A;  2LKV A;  4QMG A;  2F0E A;  2F3V A;  4IAL A;  1KDA A;  3LX0 A;  5E1F A;  4KJN A;  3TP5 A;  5J1Z A;  2WAC A;  3QOL A;  4KY7 A;  5IGE A;  1EZ6 A;  2EY6 A;  1SNC A;  1A3V A;  2F0K A;  3ERO A;  1SNM A;  1KDC A;  3D4W A;  3NXW A;  4K2L A;  1STH A;  5HGT A;  3NP8 A;  4EQO A;  5I6W A;  4EVO A;  2F0W A;  2QDB A;  5IGC A;  2PZW A;  2F0I A;  3P1H A;  1EY0 A;  4K2K A;  4PNY A;  1EY6 A;  1A3U A;  1SYF A;  4OL7 A;  4ZUI A;  2F0D A;  1SYD A;  1SYG A;  2M00 A;  2F0P A;  1EQV A;  5C5M A;  5C3W A;  4ZQ3 A;  3NHH A;  5CV8 A;  5IGG A;  2F0G A;  5CV5 A;  4KY5 A;  1IHZ A;  3E5S A;  3HZX A;  2F0S A;  4HMI A;  1JOR A;  4K5W A;  4DFA A;  4EQN A;  3TP8 A;  5I9P A;  1JOQ A;  1SYE A;  2F0N A;  5EGT A;  3V2T A;  2OXP A;  2F0H A;  2F0J A;  3MHB A;  2PW7 A;  1A2U A;  5JOB A;  2KHS A;  4K8J A;  4K5V A;  3R3O A;  4KTA A;  5HUR A;  3SK6 A;  5I9O A;  3SK4 A;  2ENB A;  4KHV A;  5DAU A;  3SR1 A;  5M9O A;  3QOJ A;  3NQT A;  1STY A;  1EYD A;  1TT2 A;  2F0F A;  1NSN S;  3NUC A;  3TME A;  2EYF A;  5C3X A;  5KYI A;  5IOC A;  4K5X A;  2OF1 A;  5C6A A;  1KDB A;  2RKS A;  4NMZ A;  4WRD A;  1SYB A;  3MXP A;  4IZ8 A;  2PZT A;  3DHQ A;  4K8I A;  4F7X A;  2SNS A;  5J39 A;  1EY4 A;  1EYC A;  3D6C A;  5KIX A;  5KGU A;  1ENC A;  4EQP A;  1SNQ A;  2RDF A;  3S9W A;  5IIF A;  1STN A;  4DGZ A;  5IOD A;  4RKL A;  4KJO A;  2F3W A;  5EKL A;  5NUC A;  1F2M A;  3T16 A;  4KV6 A;  4J1M A;  2EYH A;  4PMC A;  2SNM A;  1KAA A;  1EY8 A;  3H6M A;  2F0V A;  1SNP A;  4G57 A;  1JOK A;  1SYC A;  2KQ3 A;  1RKN A;  4I65 A;  4ODG A;  4QB4 A;  5C5L A;  1EYA A;  2EYL A;  3P75 A;  1EY5 A;  4N9P A;  3RUZ A;  4MIU A;  4WOR A;  5K5P A;  4ZUJ A;  5KRU A;  4LAA A;  4E6I A;  3C1E A;  5EKK A;  5CGK A;  3OMC A;  1EZ8 A;  3OSO A;  5ISR A;  4K14 A;  2HQE A;  3EVQ A;  3U9O A;  3MZ5 A;  5CV7 A;  3SHL A;  1EY9 A;  3D4D A;  1II3 A;  5IGF A;  4ME5 A;  3BDL A;  2F0M A;  4HMJ A;  2SOB A;  2EY2 A;  3OMG A;  5KEE A;  3VA5 A;  2EY1 A;  2F0U A;  5CC4 A;  3T13 A;  1STG A;  3ITP A;  4N9T A;  4H7B A;  1STB A;  2O4X A;  4NDX A;  4NP5 A;  2F0O A;  1ENA A;  2EXZ A;  4YIJ A;  2F0T A;  4RKB A;  3SK8 A;  5I6Y A;  5IGD A;  2EYJ A;  5IGB A;  2PQE A;  2EY5 A;  3D8G A;  3OWF A;  2PW5 A;  4KD4 A;  3DMU A;  3QB3 A;  5J22 A;  1SNO A;  2F0Q A; 
#chains in the Genus database with same CATH topology
 2Q2U A;  3S1N H;  4IUN A;  5GAE C;  4R4O A;  3GTJ H;  1SEB D;  3SXH A;  1CHQ D;  3I70 A;  4CDC C;  2DUD A;  4DAV A;  2K52 A;  1JT8 A;  4DUZ Q;  1F2Y A;  5M3F B;  2LMC B;  5JAV A;  3CPW A;  1YVC A;  3TP6 A;  1JJG A;  1PH6 A;  3NTK A;  2Z1C A;  2QGQ A;  1A2T A;  1Q3L A;  3PMF A;  1PVO A;  2A73 B;  1EIH A;  3SK5 A;  5C4H A;  1QVG A;  4OIJ A;  4QQB X;  1HZA A;  1B9M A;  5E1F A;  3LWE A;  2Q2T A;  4KY7 A;  3G4S A;  4GNX B;  2UXD L;  4DUY L;  2NWG A;  4FF4 A;  1VQI A;  3I4O A;  2OQK A;  3NP8 A;  1PFN A;  1PH5 A;  1KTK A;  3PV0 A;  4IUR A;  2K4K A;  4DV7 Q;  2F0P A;  4GOP C;  5JJL A;  5JPN C;  1FVI A;  1YEZ A;  2KEE A;  4JC0 A;  1IHZ A;  1BQQ T;  2WB1 G;  2WP8 J;  1BNZ A;  2HHH L;  1KL9 A;  1R4P B;  1SJH D;  1JQY D;  2E2D C;  3A7L A;  3X3M A;  4BY7 G;  3G71 A;  2X6L A;  3ERS X;  3Q6S A;  5DAU A;  2B63 G;  4FXD A;  3PO2 B;  1EYD A;  5M3F H;  5C3X A;  2QKI C;  1X3G A;  1WTO A;  1X3P A;  4K5X A;  3GD7 A;  3I2Z A;  2C5C A;  3MAQ A;  2L12 A;  2N88 A;  2A68 C;  5KGU A;  4P75 A;  1LTL A;  1ESR A;  2E76 C;  3T1Y L;  4LF4 Q;  5IOD A;  1Q8I A;  3CF5 A;  1AH9 A;  4A3M G;  2WV6 D;  3BYT B;  3TSS A;  1I4P A;  4O0A A;  4X66 Q;  4LFC L;  1V8Q A;  4DUY Q;  2E2H B;  4K14 A;  1L0X B;  2C9O A;  1XMQ L;  1PDQ A;  2UUC Q;  1HCZ A;  4JI6 L;  4BBS B;  1TU2 B;  1PH4 A;  4IFD I;  2L55 A;  2VW9 A;  3K81 C;  3J81 E;  1KNE A;  4N9T A;  2O5J C;  2B2T A;  2M2L A;  4A3I G;  3STB C;  2E2J B;  3IFT A;  3PO2 H;  1NAP A;  2HIV A;  1NE3 A;  5ELC A;  2ZM6 Q;  1HZ9 A;  1E3P A;  2B2V A;  1K73 C;  1YNN C;  2ZT9 C;  2FXQ A;  2F0L A;  4EGV A;  1LTT D;  4JI8 L;  4X62 Q;  5LL6 X;  4ZRZ A;  3PUW A;  1DGS A;  4HCE A;  5EGT A;  1JOO A;  1BF4 A;  2H1E A;  3TS0 A;  4GNX C;  2JA8 B;  5C4Z A;  2L5T A;  4F88 A;  1F2Z A;  5K36 G;  2AMC B;  4B9X A;  2JA5 B;  5C3E G;  2RSN A;  1L1O C;  1WTP A;  1B2T A;  1K0S A;  5C4X B;  3T1Y Q;  1QOH A;  1KDA A;  2PQA A;  3AB9 A;  2E2H H;  5D65 A;  4TVA B;  3BJU A;  4A3K B;  2CW0 C;  1I4Q A;  3KBG A;  2FIN B;  4BBS H;  2Z4I A;  1VQM A;  1S5C D;  4KN4 C;  5IGC A;  3D3R A;  1ONL A;  4ZKC B;  1QIL A;  4M1U B;  4DR2 Q;  3QIA A;  2E2J H;  1VQ9 A;  4G7Z C;  4JI1 L;  1NJI C;  2OWO A;  4LFB L;  1CT1 D;  4N8X 1;  2LSS A;  3E5S A;  3HZX A;  3FMC A;  4DFA A;  1K8A C;  1SYE A;  3V2T A;  2PW7 A;  4JI0 L;  1JMC A;  3H09 A;  2Z0S A;  3NQT A;  1GOZ A;  1NSN S;  4YY3 L;  5KYI A;  2JA8 H;  1LYL A;  1OTC A;  4BBR G;  3ONA B;  2G9H D;  1U4P A;  2CQA A;  2JA5 H;  1SYB A;  4K0K Q;  1HPC A;  2NB0 A;  4JOI A;  1PZI D;  3HOZ G;  3G7L A;  3FPP A;  5G3L F;  4UP7 A;  2EIF A;  3GQB A;  3JAM E;  2NZH A;  3VR5 A;  3TS2 A;  1CSQ A;  1YNX A;  1XWE A;  1SE4 A;  2IT1 A;  1YJ9 A;  2FMC A;  1LTR D;  3RD4 A;  3W2D A;  1B53 A;  4HJ5 A;  1HA5 A;  3OMC A;  4A93 B;  2K75 A;  2ZTD A;  1WTR A;  4KKS A;  3FPU B;  3KK7 A;  2I46 A;  1D1K A;  3EFX D;  3S16 B;  3DLL A;  4G4K A;  4JI1 Q;  4LFB Q;  1KRT A;  4BXX G;  2WFW A;  4C1N I;  3TBI B;  1Q1B A;  4OHJ A;  3PIO A;  4HR7 B;  3GV3 A;  3C1F A;  3I56 A;  4HED A;  4NKL A;  4PZ8 A;  1SDF A;  3NSW A;  2K5V A;  1U5K A;  4K6L A;  4YY3 Q;  2Y0S G;  1D6E C;  1ZKO A;  2R92 G;  2YV5 A;  3D31 A;  4MZ9 A;  3CAM A;  2F52 A;  1YIJ A;  1VDZ A;  4K6D A;  2JEB I;  1E0B A;  5E7N A;  3J7A V;  1K0R A;  4DV1 L;  4OEL B;  5GAG C;  4GKJ L;  1AP0 A;  1CZG A;  4A93 H;  2WAC A;  4A3B B;  3TDQ A;  3D0F A;  1T5E A;  1HTP A;  3E9I A;  2PI2 E;  3PIO 3;  1W3S A;  3J7A 5;  3V05 A;  5D3D A;  3EN2 A;  1QNK A;  1UE5 A;  1EQV A;  1M8A A;  3DWQ A;  1XJV A;  3AYH B;  3J80 E;  4Y52 H;  2F0S A;  4R4I A;  3HG9 A;  3VR6 A;  2UU9 L;  4LK1 C;  1VF5 C;  2K05 A;  2D5D A;  4OWX B;  4HIM A;  3SEB A;  5IYB G;  3IKJ A;  1STY A;  1X56 A;  3VYT A;  3HOY B;  4A76 A;  3NTI A;  5L37 A;  1SXT A;  3GTQ B;  3AQQ A;  1PRT D;  5IOC A;  2PPB C;  2H4O A;  1Q90 A;  4NMZ A;  1XYI A;  4DK6 C;  4CKE A;  4DV4 L;  2O5I C;  2NN6 G;  2RDF A;  5I4D A;  4A3B H;  1YHA A;  2MJ8 A;  1EQT A;  4DV1 Q;  1BDO A;  3H3V H;  4P72 A;  3TRE A;  2QF7 A;  3G6J B;  1Z7T A;  1TWH B;  2XN9 C;  2NVT B;  3K80 C;  1SMY D;  1PZK D;  1UE6 A;  4FNF A;  1JE5 A;  3LNN A;  3Q23 A;  1MJC A;  4O2D A;  1PZJ D;  5BN4 A;  3BS1 A;  3HOW H;  3HOX H;  1STB A;  2MO1 A;  4NP5 A;  1C7Y A;  4DXF A;  3DXJ C;  1HNX L;  4X64 L;  2KA7 A;  3L0O A;  3OWF A;  3J81 c;  1IL8 A;  3HOY H;  4KD4 A;  4LFA L;  3K7A B;  2IL8 A;  4QIW E;  1SN8 A;  3NEN A;  3TP7 A;  4HIO A;  2EJG C;  2SEB D;  3HKS A;  4A4I A;  3H91 A;  2LFN A;  4DF7 A;  1S5E D;  3K57 A;  3PUZ A;  3IRB A;  1VQN A;  5IT9 L;  4DAY B;  1I3Q B;  1SMX A;  2L9H A;  2EVB A;  2JK8 A;  1P16 A;  1S5B D;  1TWH H;  2JEA I;  2NVT H;  1A3V A;  2JSO A;  1KDC A;  2HDL A;  3TN2 A;  2R7D A;  4R4Q A;  4NXN Q;  1IYU A;  4PQX A;  3S17 B;  5IWA L;  2F0I A;  1SBB B;  1EIY B;  3FRP B;  2NVY B;  2BDN A;  2NBF A;  4C2M B;  5E4X A;  4GLX A;  3T1H L;  1Q82 C;  2J7Z A;  2JJQ A;  4GN4 B;  4JI5 L;  1HR0 Q;  1K8M A;  5KNB A;  5CV8 A;  5M3F G;  2QEJ C;  1BCP D;  4HMI A;  3K7A H;  4ZAI A;  5FJ8 G;  4JI4 Q;  2Q2H A;  4X64 Q;  1B3Q A;  1TWC B;  2ZXR A;  3NEM A;  4XYO A;  3BZC A;  4MNO A;  3BG3 A;  3UE1 A;  2MUY A;  3NBH B;  1S5F D;  2LS0 1;  1TT2 A;  3NUC A;  2B29 A;  4B08 A;  3M85 A;  1WCM B;  2OF1 A;  2DJF C;  4IUQ A;  2IX3 A;  3ZYY X;  4A3G B;  1I3Q H;  3JC6 6;  1VQ5 A;  4R4C A;  1NMF A;  1RL2 A;  4OO1 I;  3KLS A;  1PYS B;  1EYC A;  4JYA Q;  1BVS A;  4HIK A;  1W2B A;  3S9W A;  4L5R C;  2ZJR A;  2NN6 I;  2ICI A;  1F2M A;  3T16 A;  4PMC A;  3CMA A;  1QE6 A;  3CCU A;  5CMD A;  4NXM Q;  3S17 H;  1OO9 B;  1SE8 A;  2NVY H;  3S1Q B;  1A62 A;  5JEA H;  1MSG A;  4Y7N B;  1B70 B;  1AN8 A;  4C2M H;  3I4N B;  3PO2 G;  3ULL A;  1EUJ A;  4U68 A;  3HS0 C;  3T4A C;  1Q46 A;  5KNC A;  2IW3 A;  3PGZ A;  2BE5 D;  4LF6 L;  2G9D A;  2PCF B;  4FVM A;  1TWC H;  4C3I B;  1EL0 A;  3BVM A;  1PMR A;  1U4M A;  2SDF A;  1HFG A;  4BA2 I;  1D5Z C;  3I3C A;  2NVX H;  1MJE A;  4S3S A;  4A3J B;  3A5U A;  1WCM H;  2Q8T A;  4A3G H;  3K6O A;  1FJG L;  1OXT A;  3EJI A;  3N52 A;  4DV6 L;  2A69 D;  3NK9 A;  3KJO A;  1WOC A;  3EA6 A;  3CCE A;  3H94 A;  2RVL A;  4IQZ A;  4BBS G;  4DR3 L;  4L5S A;  3I90 A;  5FLX c;  4PV1 C;  1LLR D;  2ASB A;  2YYZ A;  2BH2 A;  4GOP A;  3KDF B;  1RD9 D;  3S1Q H;  1WTH A;  4Y7N H;  1BKB A;  1O7Y A;  1RIP A;  3Q22 A;  3I4N H;  3I4M B;  1Y14 B;  1BBU A;  3T56 B;  2YU9 B;  1ROD A;  4KKU A;  2GN5 A;  4K2L A;  2QDB A;  3PF4 A;  5EPJ A;  2I5L X;  3BYY B;  1SYF A;  4BWG B;  4C3I H;  5C5M A;  4JCV E;  1GHK A;  4LF6 Q;  1HQM C;  2JA8 G;  1JJ2 A;  1IBL L;  1TVX A;  1DYQ A;  1CQF A;  2ALY B;  4A3J H;  2F4V Q;  1M90 C;  2JA5 G;  5JOB A;  4DNT B;  1A2U A;  2K03 A;  2KHS A;  5C4X G;  4PZ6 A;  4TKO B;  1PYW D;  2UUB L;  2MO0 A;  4A3K G;  1GVP A;  3VR4 A;  1G29 1;  4OXP A;  3GTG B;  2L11 A;  1FJG Q;  2CQO A;  3S2H H;  4DV6 Q;  2E5L Q;  2R7Z B;  1CM9 A;  3U4Z A;  1EY4 A;  3CCV A;  4DR3 Q;  2K6A A;  3I4M H;  1C8C A;  3A7A B;  2VNU D;  3NBI A;  1CTM A;  3T51 B;  3S14 B;  1W6K A;  1KAW A;  4Z9C B;  2YU9 H;  1T5X D;  4B3R Q;  3A56 A;  5T1G A;  1SE3 A;  4C3H H;  3FVQ A;  3WWV A;  1O7I A;  2OCE A;  4GOP B;  4LAA A;  1V1O A;  3H0G B;  4ZCK A;  1Q12 A;  5C0X I;  4G7H C;  1S5D D;  3J81 j;  2EY2 A;  1VMC A;  3GV6 A;  1U4R A;  3W3A A;  4IO9 A;  2PNH A;  4GNX A;  5IGD A;  1IBL Q;  2EYJ A;  1WVL A;  1LT5 D;  2XWJ B;  2HDM A;  2JQO A;  2RCN A;  1L1O A;  4DV2 Q;  3H15 A;  1CKN B;  1VQD A;  4HID A;  2DGY A;  1LT4 D;  3GTG H;  2OEO A;  1SFO B;  1NUC A;  1GHJ A;  2QA4 A;  1TS5 A;  1QVF A;  1D7Q A;  2G5D A;  4A93 G;  2IX0 A;  1UEB A;  1I5F A;  1PRT C;  4DV7 L;  1UAP A;  2CWP A;  3K0X A;  4FF1 A;  4RHR A;  1MGS A;  1NCV A;  3S14 H;  1L0W A;  3D4R A;  2EYO A;  3HRZ C;  1B1Z A;  4ZYS A;  2LKV A;  1BUV T;  3LX0 A;  4X65 Q;  4A3C H;  3H0G H;  5A35 A;  1MHW C;  3CP0 A;  2WB1 E;  1EFW A;  1C48 A;  1SNM A;  3E6Z X;  1UE7 A;  4DR5 Q;  2N78 A;  3U4V A;  1Z47 A;  1N33 L;  4ZUI A;  3CXC A;  1SMY C;  4NB3 A;  4GKK Q;  1XNQ Q;  5CV5 A;  4LF4 L;  2E8G A;  1KLG D;  4O1N A;  3E9H A;  4LW1 A;  4EQN A;  3KJP A;  1PH9 A;  2A5H A;  3MHB A;  2XTI A;  1I4H A;  1SFO H;  4X66 L;  1Y8N B;  1RCV D;  3DM1 A;  3TRZ A;  4A3B G;  2UUC L;  3FHW A;  1U0L A;  2EOT A;  1XNR L;  1TWA H;  1PH7 A;  1L1O B;  2K50 A;  4RG1 A;  2JN4 A;  1KDB A;  1WI5 A;  2N49 A;  1CI3 M;  2KEN A;  2QEX A;  2F3W A;  4DXG A;  1VQB A;  4YWM A;  2ZM6 L;  2K04 A;  3VYR A;  1EEI D;  1UEA B;  3X3N A;  4XYQ A;  1EQQ A;  3J80 L;  4JV5 L;  5KRU A;  4X62 L;  3GTM B;  2BDO A;  1JWS D;  4P73 A;  3OYY A;  3OSO A;  2R7F A;  1P8L A;  5M5W B;  1BOS A;  1CKM A;  4ABN A;  2KBN A;  3HOY G;  5IP7 H;  4KKT A;  3D4D A;  2GA4 B;  4YCW A;  1N33 Q;  2XNA C;  2A1A A;  2RF4 A;  4U67 3;  1GUG A;  4RKB A;  1RTO A;  2PQE A;  3D8G A;  3Q0A A;  1EIF A;  1O7Z A;  2K1B A;  1NR2 A;  3AFQ A;  4ZKB B;  2JE6 I;  2F1M A;  2R3Z A;  1VQJ A;  4UP9 A;  3E0J A;  1CZW A;  4C3J B;  4ZK9 B;  1F9Q A;  2HD3 A;  4KY6 A;  1XX8 A;  4DR2 L;  1G6Z A;  2DY8 A;  2MNA A;  1XNR Q;  4DR6 Q;  3KLW A;  4JBK A;  3PSI A;  1HQR D;  1Q8K A;  5IYC H;  1LT3 D;  1V43 A;  2RDH A;  3A8I E;  3MEF A;  4CDF C;  1A6X A;  2F0E A;  3SVM A;  2X6G A;  3GTM H;  2JA6 B;  5CBE E;  5M5W H;  1I50 H;  3EIV A;  2AKW B;  3ERO A;  3D4W A;  4JV5 Q;  4EQO A;  1PH8 A;  3CCQ A;  2I07 B;  5IE8 A;  4PNY A;  2N55 A;  3A0J A;  2XWB B;  1WTW A;  4K0K L;  1PFM A;  2B2W C;  1ZXT A;  2BE5 C;  5IGG A;  2F0G A;  2VL6 A;  4LF5 L;  5IP9 G;  4A3L H;  1VMP A;  5BN5 A;  1MSH A;  1C9O A;  1NMG A;  5I9P A;  1JOQ A;  4APV A;  4GN3 B;  3OTO L;  4C3J H;  3R3O A;  3HFZ B;  3QR8 A;  1C0A A;  2AHO B;  2KEC A;  1FL0 A;  1EU3 A;  4IOA A;  2B2Y C;  1IXR A;  2X69 A;  4H0L C;  4JG2 A;  4Q5V A;  1IKM A;  1Y1V B;  2A69 C;  2O2L D;  2Z6B A;  4DPG A;  5JEA G;  3T53 B;  3H3V I;  2JA6 H;  1ENC A;  3MWY W;  1GD7 A;  2FHT A;  3OHX C;  3NWT A;  3CW2 C;  4I7Z C;  4JW0 A;  1KLU D;  1YHB A;  5C5L A;  2VQE Q;  1VQ7 A;  2RHQ B;  4IJH A;  3J7A F;  2BCO A;  1GJX A;  5CGK A;  2R93 B;  4I7A A;  1PH1 A;  1D2B A;  1HUN A;  2JP1 A;  2DY7 A;  1N32 Q;  1DZ1 A;  1ZEQ X;  1JWU D;  1WCM G;  1F77 A;  1G51 A;  4KI0 A;  3WDN A;  3JAM i;  4A3G G;  2R6G A;  3BDO A;  2ZXO A;  3U9S A;  2O4X A;  2QCP X;  2Y0S E;  4YIJ A;  4LF5 Q;  4LUO A;  4AH6 A;  1YI2 A;  1X3Q A;  3F2U A;  3UDI A;  2B3G A;  2PW5 A;  4HSP A;  4R4T A;  3DMU A;  1D5X C;  3OTO Q;  4TSS A;  2NUC A;  1Y1V H;  3KLS X;  4LUV A;  3KFU A;  2EPB A;  2PYK A;  1LTA D;  2TSS A;  1A3T A;  3I4N G;  2J0T D;  1H9M A;  2PO4 A;  5C44 B;  1TS2 A;  1SE2 A;  2PZU A;  5FLM H;  1AEX A;  3W1G A;  1AFP A;  3CU7 A;  4R8N A;  3FDT A;  1YJW A;  3MTS A;  3GTO B;  4RGN A;  3KF6 B;  1FGU A;  1I4X A;  3DEO A;  1YJN A;  4C3I G;  5HGQ A;  5C0X J;  4OX9 Q;  2R93 H;  1EZ6 A;  1NR4 A;  4AQY L;  1X32 A;  2GVB A;  3WOF A;  4H02 A;  5DLQ E;  4A3J G;  1STH A;  5I6W A;  3P1H A;  4LF7 L;  1EY0 A;  4K2K A;  4LNQ A;  1Q86 C;  4FF2 A;  4LF9 Q;  1DOK A;  2AQ3 B;  1PTO D;  2K01 A;  5FLX E;  3MXN A;  5FOB B;  4X3S A;  1E24 A;  4IUU A;  2A6H D;  1XTD A;  1PFB A;  5EBD A;  4KY5 A;  3I8Z A;  1STE A;  4DR1 Q;  5LHY 1;  1V1Q A;  1K83 B;  2C35 B;  4FP5 D;  4KMU C;  4KTA A;  1WFQ A;  1X6O A;  3I4M G;  3F2C A;  5C44 H;  1GUW A;  1OXX K;  2WIN B;  3J80 i;  2K5W A;  3KUP A;  4IPH A;  4WRD A;  4R8I A;  1FNU A;  2PMZ E;  1EFI D;  2B2U C;  3GTO H;  2SNS A;  4DNI A;  1S3O A;  4B3T Q;  2K33 A;  1HXY D;  5FO9 B;  3CC7 A;  3DUZ A;  2VS1 A;  2WKD A;  1IL2 A;  5E4W C;  4J1M A;  2ID0 A;  1KAA A;  3H6M A;  5GAD C;  2BOS A;  1WD1 A;  3HOW B;  1JOK A;  3HOX B;  4QB4 A;  4L8J A;  4IOC A;  2E75 C;  4AQY Q;  3L7Z C;  2YTX A;  2VUM B;  1XPO A;  4P71 A;  1IBK L;  2Z9H A;  4DAY A;  1HNZ L;  4LF7 Q;  2R61 A;  4HMJ A;  2SOB A;  5KEE A;  3PUV A;  4NW2 A;  1STG A;  1K83 H;  3HOV B;  2R7Z G;  1N34 Q;  5I2Y A;  4L63 B;  3MXN B;  4A3D B;  2EY5 A;  4L5T A;  1VQF A;  3CME A;  1QZH A;  4NXN L;  5LL6 S;  4KN7 C;  3BDC A;  1L2F A;  3MXU A;  5KYL A;  3G48 A;  2YTY A;  3RLF A;  4XT3 B;  1CA5 A;  4JI2 L;  4A3C G;  3H0G G;  3QO2 A;  1CA6 A;  1LO5 D;  4OEM B;  5CV6 A;  1HR0 L;  3ERQ A;  1TWG B;  5M5X B;  4JI4 L;  1GUT A;  3NBH A;  5EAY A;  1F9S A;  4KJN A;  3M4Y A;  2VUM H;  2EY6 A;  2AUK A;  4WJ3 M;  3GTP B;  5C4J B;  3A8K E;  5JPM C;  2ZTC A;  2KVM A;  2EQS A;  3HOV H;  1IBK Q;  3CCJ A;  4BY7 H;  2NZ1 D;  1HUM A;  5AJ3 Q;  4JYA L;  1HNZ Q;  2B63 H;  3RZD H;  4A3D H;  4YCV A;  2K5Q A;  3W5O A;  4KHZ A;  2AWO A;  4UHV A;  1PYB A;  2CWA A;  1H9K A;  4P74 A;  4NXM L;  4IFD J;  3S15 B;  1CUK A;  4HAE A;  2F4I A;  4HN7 A;  1LTB D;  4LJZ C;  3CCR A;  3CRL C;  1C4Q A;  4CBV A;  1TWG H;  5M5X H;  5J3B A;  4JI2 Q;  2L0C A;  3CRK C;  4F7X A;  4GN5 A;  1EWI A;  1GXD C;  2CKZ B;  1R9T B;  1K28 A;  1PFS A;  3L9A X;  1VQC A;  4CGY B;  4KV6 A;  3RN2 A;  3GTP H;  5C4J H;  4CKC A;  1LM0 A;  1GO3 E;  1LAB A;  2K32 A;  1EZ8 A;  2MPM A;  4RCN A;  4C1N K;  2HQE A;  2AQ1 B;  2NVX B;  1LTG D;  3ND8 A;  1XMO Q;  2N8N A;  1VQH A;  1AW7 A;  3KDF A;  4BA1 I;  1RJT A;  2E74 C;  3TQY A;  1VF7 A;  1N9W A;  3S15 H;  3ND9 A;  2J4X A;  2LXK A;  4DN4 M;  1BBW A;  3KOJ A;  5EKI A;  5E3F A;  2L4N A;  5IYC G;  1N8R C;  5F2D A;  4WFN 3;  3N6R A;  4TRD A;  2NYZ D;  1WYD A;  4KD3 A;  1R9T H;  2K5D A;  4AYB B;  1YNJ D;  1HHV A;  1TKW B;  5CR3 A;  5CV4 A;  2K7V A;  1S4Z A;  2I5H A;  3DEP A;  2F4V L;  2HCI A;  4QF4 A;  3GP7 A;  4IN3 A;  1OXU A;  2XRQ D;  4OON A;  5J1Z A;  4HJA A;  3CD6 A;  2BH8 A;  4A3L G;  4YWL A;  1Q81 C;  2VXW A;  3CCM A;  3C3L A;  2PZW A;  4FXK C;  1VQP A;  1JB3 A;  4C3J G;  3PIP 3;  2E5L L;  3K0Y A;  1SYD A;  1A0I A;  1VS0 A;  1VQG A;  1FR3 A;  1AZP A;  1B7Y B;  2D62 A;  1PRT F;  2JA7 B;  2VB2 X;  4OWT B;  4KK7 A;  3S2H B;  3MA2 B;  4L6T B;  1PTO H;  2ZTE A;  4B3R L;  3QWN A;  4K8J A;  2BA1 A;  1Y69 U;  2WKC A;  2L1B A;  1A63 A;  1PRT B;  3J81 L;  2ENB A;  2JA6 G;  4BY1 B;  4DV5 L;  2F0F A;  1ICF B;  3A74 A;  2GVA A;  4RCO A;  1HR0 W;  2Z6K C;  3URY A;  4UP8 A;  1B4O A;  3C46 A;  1RF2 D;  4C3H B;  2K5H A;  1QNU A;  1TY2 A;  3I4L A;  5C6A A;  4R9W A;  4A3E B;  1VQA A;  2PZT A;  1GUO A;  5JJK A;  2K5N A;  1A8V A;  1F9R A;  2DJG C;  2MP1 A;  1G91 A;  3C2P A;  1CKN A;  2JA9 A;  4RKL A;  3M4Q A;  3M7G A;  3VR2 A;  4DV2 L;  4HJ8 A;  1S40 A;  1RKN A;  3RUZ A;  2EYL A;  3P75 A;  4WOR A;  1VQ4 A;  5ISR A;  3U9O A;  4CHT B;  1GKH A;  1J6Q A;  1E7Z A;  5IGF A;  1T9H A;  2JA7 H;  4BXX H;  4UDU C;  1DD2 A;  5ELD A;  1EYG A;  1PTO C;  3K5N A;  4POF A;  1Y1V G;  2IY5 B;  1QG7 A;  1X3F A;  2A6H C;  2B8F A;  2F0O A;  4B3S L;  2WII B;  1UE1 A;  4KLK A;  4BY1 H;  4X65 L;  3PO3 B;  4F87 A;  5FLM G;  4PMB A;  4XXE A;  5GRO A;  4FYD A;  2RHS B;  2AUJ D;  4DR5 L;  3E0E A;  4A3E H;  2QDL A;  4QJF A;  1QCB D;  1HA6 A;  3M9B A;  4DV5 Q;  1MIU A;  2R93 G;  5DEH A;  3GDE A;  1EEF D;  3M3Y B;  3UE0 A;  4GKK L;  4R1J A;  3HKZ B;  2NZO A;  4ID6 A;  1XNQ L;  1PA6 A;  1H95 A;  2ES2 A;  1KAB A;  1H9J A;  1VQK A;  2B2W A;  3O13 A;  4IAL A;  5KND A;  2IHF A;  1SNC A;  1BCP F;  3VA7 A;  4Q0F A;  3NWS A;  4QGU A;  4DK0 A;  3NPP A;  3JAM L;  3UI2 A;  1Y1W B;  3F1Z A;  1BCP B;  1EOT A;  1KQS A;  2B2Y A;  4OWW B;  1DON A;  1TWA B;  3NHH A;  1EQR A;  4CDE C;  5C44 G;  3PO3 H;  2KCT A;  1EU4 A;  4UY8 C;  4K5W A;  1OXV A;  4YCU A;  4B3S Q;  4OO1 H;  3MXG A;  3NE5 B;  4RGM A;  2WAQ B;  3SK4 A;  1QUQ B;  4GZY C;  3SR1 A;  3M3Y H;  4XQN A;  4IJL A;  5IT9 E;  2YTV A;  4IPC A;  3FKI B;  2QW7 A;  4DV3 Q;  2EE1 A;  1E1O A;  1IBM Q;  4FO2 A;  1KD1 C;  3GO5 A;  3GTL B;  1NTG A;  5J39 A;  1V1P B;  1KXL A;  2DNE A;  2XSC A;  3S1M B;  4RGO S;  4EQP A;  5GAH C;  1STN A;  1K9M C;  5FLX L;  2B39 A;  4HSV A;  3RN5 A;  2EYH A;  4G57 A;  3RZO B;  3ULJ A;  2RCF A;  1Y1W H;  1SR3 A;  4E6I A;  2TMP A;  1WTV A;  3EVQ A;  3I91 A;  1HZB A;  4DR6 L;  5G3L D;  3G6E A;  3CHB D;  4ME5 A;  3RNU A;  4QIW B;  4RA8 A;  1B3A A;  1V9P A;  2MQH A;  3QJY A;  2OT2 A;  3I72 A;  5CC4 A;  4RFB A;  3I7F A;  1Y8P B;  3VYU A;  1IYJ B;  1MBY A;  1UUP A;  2CH4 W;  1X9N A;  2OTL A;  1ZYR D;  2BA0 A;  1IW7 D;  4V0B A;  1ILQ A;  1X55 A;  1UWV A;  2PNR C;  3CC2 A;  3FKI H;  3HOU B;  1O78 A;  2N3S A;  1KNA A;  2KCC A;  5IYD H;  3HOW G;  3HOX G;  2RBM A;  1K8G A;  3GTL H;  1HFN A;  3OWE B;  5ELO A;  2HT1 A;  3S1M H;  2KED A;  1I50 B;  1CK1 A;  3HEJ A;  2VUM G;  2CVR A;  4B9W A;  4JK1 C;  1WTQ A;  4B3M L;  4QUF A;  4POG A;  1B50 A;  5DM6 3;  4F8M A;  3RZO H;  1FD7 D;  1Y8O B;  2Q2I A;  4QMG A;  3I55 A;  3HOV G;  2EJF C;  1BCP C;  1E22 A;  3FP9 A;  5IGE A;  4A3D G;  4EQ5 A;  2KCM A;  1AE2 A;  1JR0 D;  2F0K A;  3NEL A;  2D0O A;  3OIP A;  5FJ8 H;  4DAM A;  3J81 i;  1A3U A;  2UXC L;  4OL7 A;  1SAP A;  4QUC A;  2M00 A;  4RHS A;  2D0P A;  3ER0 A;  4ZQ3 A;  2VQF L;  5ELF A;  5EBC A;  3AEV A;  1M1K C;  3NTH A;  3HOU H;  2Q8R E;  1PH3 A;  2B2U A;  5D3I B;  3L3O C;  1QB5 D;  2VQE L;  3S2D B;  4K5V A;  3CQZ B;  2MHV A;  3OW2 A;  2UXD Q;  2EDG A;  4ME3 A;  2EYF A;  1SJE D;  4JI3 L;  1N32 L;  3GTK B;  4IZ8 A;  1E1T A;  2FMM A;  1YNJ C;  2A6E D;  4B3M Q;  3LGJ A;  2XGT A;  5C0X H;  5EKL A;  3IL8 A;  2HHH Q;  3PQI A;  1JCK B;  3P7J A;  1XTC D;  2F0V A;  2KQ3 A;  1SYC A;  2VY3 A;  1QWY A;  4DK3 C;  1R4Q B;  2KHJ A;  1F9P A;  1TXY A;  1I6V C;  4HJ9 A;  1E2Z A;  5H1S E;  1I94 L;  1RDP D;  3NQI A;  1EY9 A;  1XXG A;  1K8O A;  3S1R B;  2HCC A;  2XVS A;  5CYU A;  2UXC Q;  2EY1 A;  3KF6 A;  4XIG S;  3A55 A;  3T13 A;  4DA2 A;  4AIM A;  4IUP A;  2A8V A;  1HZC A;  1ET6 A;  3S2D H;  4LUZ A;  3CQZ H;  1TY0 A;  2VQF Q;  3SK8 A;  4OX9 L;  2P5Z X;  4MTK A;  4DKA C;  3QG1 A;  4AYB E;  3AMU A;  2F0Q A;  1FGB D;  4XQQ A;  1PH2 A;  1B8A A;  4LFC Q;  3GTK H;  1G6P A;  1DJR D;  4LF9 L;  1XMQ Q;  1G8Z D;  3D6W A;  1RHP A;  4JI3 Q;  1JIC A;  4JI6 Q;  1ENF A;  1E2V A;  1LT6 D;  4QY7 A;  1VQE A;  4X3T A;  5IY0 A;  3KYH C;  1TQO A;  5COY A;  4DR1 L;  2D9U A;  5JJI A;  4DR7 L;  1LTS D;  4OGQ C;  3R93 A;  3TP5 A;  2VB3 X;  1X3E A;  1JE4 A;  3RLN A;  3F8T A;  2L15 A;  4CDD C;  2K28 A;  1BR9 A;  4RMF A;  4KHP L;  3S1R H;  1B9N A;  3BZD B;  4LF8 L;  4JI8 Q;  1DOL A;  5FKA C;  2EZV A;  3KLR A;  1VQ6 A;  3OIQ A;  5C4X H;  1I94 Q;  1I6H B;  1BBX C;  4B3T L;  3HP3 A;  1KC8 C;  2KUM A;  1YBY A;  1MKH A;  4AYB G;  4J8Q A;  4A3K H;  1D5M C;  3BZK A;  1JC7 A;  5M3M B;  4C56 C;  2OXP A;  3KBX A;  4A3F B;  1S72 A;  4L5Q A;  2KCN A;  1WJJ A;  4XDX A;  3L2P A;  1ASY A;  2MFI A;  5M9O A;  4XT1 B;  1Q1E A;  2ZJQ A;  3W1B A;  4O42 A;  3CKI B;  2PQA B;  5A2Q E;  3TZU A;  2DN8 A;  2KOL A;  3MC0 B;  1DXM A;  1FNV A;  3RLO A;  3TEH B;  5ELE A;  5IT9 c;  2IPK D;  5M5Y B;  5KIX A;  1ASZ A;  3Q8D A;  1N34 L;  3VDY A;  1SNQ A;  3K5M A;  2EJM A;  1W6J A;  4X6A H;  1MI2 A;  2H5X A;  4KJO A;  5NUC A;  2QIL A;  3BVG A;  2JA7 G;  2SNM A;  4I65 A;  4ODG A;  4JI0 Q;  4DR7 Q;  2EXD A;  3C1E A;  2HIX A;  1I6H H;  2UXB L;  1D1I A;  4BY1 G;  1FYC A;  4KHP Q;  4LF8 Q;  3CPF A;  1NNX A;  3BDL A;  4C3H G;  1EWH A;  4N8F A;  4IPG A;  2F0U A;  1Z6H A;  5M3M H;  4A3E G;  4A3F H;  1D8L A;  3M4O B;  2A74 C;  3DWP A;  2XRS D;  4IFD H;  1LTI D;  5JVH 3;  5J22 A;  3HKZ E;  1PHJ A;  2V4D A;  3HGB A;  3A54 A;  5M5Y H;  2EYM A;  2B2T C;  3KF8 A;  4CJ2 C;  3S16 H;  5AJ3 L;  4TQU S;  4CKB A;  2I0Q A;  3K59 A;  3MVV A;  2LY7 A;  2WB1 B;  1BO0 A;  3R2I A;  5LMN L;  2HUG A;  2B2V C;  3BVZ A;  4BY7 B;  4GLA C;  2F3V A;  5ELN A;  4MHE A;  2B63 B;  3RZD B;  5T1I A;  2AQ2 B;  1YIT A;  3E3X A;  2JXM B;  1CKO A;  1KRS A;  1VQO A;  3PO3 G;  3VR3 A;  3ICE A;  1G2T A;  3AU7 A;  3NXW A;  1I4R A;  2F0W A;  1MD2 D;  4OO1 G;  4A75 A;  2UXB Q;  3RMH A;  3R2T A;  2CCZ A;  2WAQ E;  4PZ7 A;  3M4O H;  2Z6K A;  1ESF A;  3DM3 A;  2Z4H A;  3HKZ G;  2CH4 A;  1WTX A;  4EX5 A;  4A3M B;  4WJ4 A;  2V1C C;  1ZYR C;  1O80 A;  4JPB W;  5HUR A;  4GKJ Q;  1IW7 C;  1H9S A;  2CHB D;  2VZA A;  4QL5 A;  4YHH L;  1TS3 A;  3F2B A;  3TME A;  4P2C B;  5EPL A;  1XMO L;  2FJ2 A;  1F2L A;  5FO8 B;  2RKS A;  3MXP A;  4PMW A;  3DHQ A;  1Y1W G;  4A3I B;  1O7L A;  1ET9 A;  3PUX A;  3MFG A;  3KF8 B;  4WJW A;  2KJX A;  5LMN Q;  1IZ6 A;  1NY4 A;  5JJZ A;  2UU9 Q;  3GTQ H;  1OXS C;  2RDG A;  1G2S A;  4MIU A;  5K5P A;  2WAQ G;  4ZUJ A;  3EBE A;  5EKK A;  1YZ6 A;  4GS3 A;  1ML0 D;  4JOI C;  4DK1 A;  2RQX A;  3FEW X;  4LMQ D;  3SHL A;  1AZQ A;  1II3 A;  3FKI G;  2MGS A;  3A8J E;  4UPA A;  4BS9 A;  1I4G A;  5C3E B;  3K58 A;  3VA5 A;  2K14 A;  5IYD G;  4A3M H;  4DV4 Q;  1IYV A;  3H3V C;  1ENA A;  1FNW A;  5IGB A;  2F0T A;  1VQ8 A;  5I6Y A;  1CFM A;  3SE0 A;  3K5L A;  1X65 A;  3PF5 A;  5IP7 G;  3CCS A;  3M4P A;  4G7O C;  1JWM D;  5CV9 A;  1L0Y B;  5AFW A;  5HY6 A;  3TZD A;  4YHH Q;  1H9S B;  4A3I H;  1Q7Y C;  2D2C C;  1STA A;  1SND A;  3SGI A;  1J8I A;  2ICE C;  2A68 D;  3CCL A;  2NTT A;  1EY7 A;  1DCZ A;  4IPD A;  4YWK A;  2A6E C;  4RH6 A;  1PTO F;  4DR4 L;  1HNX Q;  1TS4 A;  4GLV B;  3PCO B;  5DM7 3;  2JYO A;  3QOL A;  1BXT A;  4LFA Q;  1TWF B;  3ULP A;  4ULL A;  4BBR B;  3DWA A;  3PIP A;  1PTO B;  4M8A A;  5K36 H;  3HOU G;  5IP9 H;  1UNS A;  5HGT A;  3J7Y W;  5C3E H;  5COR A;  4EVO A;  1WD0 A;  4FF3 A;  4MN3 A;  3WOE A;  1JJC B;  3J7Z C;  4ZLT F;  1ILP A;  2F0D A;  4ILW A;  3HOZ B;  1LUZ A;  3P20 A;  1CHP D;  5BR8 L;  1EOV A;  3STB D;  1IKL A;  1DM0 B;  1JOR A;  3ZJY C;  3K5O A;  1PLF A;  4HJ7 A;  2F0N A;  1YNN D;  2F0J A;  1PV4 A;  5I9O A;  3SK6 A;  4X3U A;  1CQV A;  2HQL A;  3JAM c;  5C0X G;  1KIX A;  4FXG C;  2F03 A;  3Q24 A;  5IWA Q;  1XPU A;  1RTN A;  5LMN W;  4IUT A;  5BN3 A;  3T1H Q;  4JI5 Q;  4RWS C;  3RR5 A;  5LMU L;  1H9R A;  3U58 A;  1JB7 A;  1CSP A;  1EWC A;  1LAC A;  4DGZ A;  3R8B A;  1TWF H;  2IHE A;  4BBR H;  3M7N A;  4DR4 Q;  2CW0 D;  1EY8 A;  4FDB A;  1SNP A;  1A15 A;  1EYA A;  4N9P A;  4OIK A;  2Q8I B;  2F3I A;  2Y0S B;  4JBJ A;  4HCS A;  3HOZ H;  2R92 B;  1N36 L;  3AFP A;  3EQL C;  3MZ5 A;  5CV7 A;  3A5Z B;  2KHI A;  2PI2 A;  2F0M A;  4JI7 L;  1YHQ A;  2UUA L;  5EJW A;  4H7B A;  5CBA E;  4NDX A;  1QZG A;  5BR8 Q;  2EXZ A;  1U4L A;  3BU2 A;  3LWU A;  4XTC S;  4QCL A;  1VCI A;  2ATW A;  3QB3 A;  2NVQ B;  1SNO A;  1J5E L;  4XQJ A;  1AE3 A;  5FK9 C;  1M4V A;  4DNR B;  2IJ0 A;  1QJO A;  5DNF A;  1E2W A;  5GQO A;  2EYP A;  1U9R A;  4HTH A;  4X3K A;  1K3B C;  3UDX A;  1TR5 A;  4H13 C;  4PG3 A;  4JBM A;  4J6H A;  4DU9 A;  2E2I B;  1XPR A;  3MEH A;  5LMU Q;  1QUQ A;  1KHI A;  3VYS A;  2I5M X;  3S24 A;  1DOM A;  3J80 c;  1GM5 A;  1GUN A;  1HTL D;  3K8A A;  2XIW A;  2RA4 A;  1B44 D;  2R92 H;  3SDZ A;  2FFK B;  2ZXP A;  1Z9F A;  3IFD A;  4JVZ A;  1TII D;  4V19 0;  4DAP A;  1SRU A;  5EQ0 A;  2B8G A;  4DV3 L;  1V1P A;  5JEA J;  4UAI A;  1EY6 A;  1IBM L;  3UDF A;  1N36 Q;  3MFY A;  3V96 A;  1J9O A;  1SYG A;  1HNW L;  3B6Y A;  3F2D A;  5C3W A;  4JI7 Q;  4JBW A;  2UUA Q;  4LWC A;  4DV0 L;  2NVQ H;  1K3R A;  2DNC A;  4NPS A;  1GUS A;  3TP8 A;  5D14 A;  2F0H A;  2PMZ B;  4IUV A;  5TSS A;  2ZJP A;  2M9V A;  4KHV A;  5FO7 B;  1ICW A;  1NBW A;  3QOJ A;  4J15 A;  4RGT A;  2IWH A;  1J5E Q;  2AWN A;  2IX1 A;  3UDG A;  3OOC A;  3I73 A;  4DUZ L;  3S1N B;  2NTS A;  4CJ1 B;  3GTJ B;  4MTN A;  2E2I H;  3OW7 A;  4K8I A;  3D6C A;  1SRO A;  1SLJ A;  5IYB H;  4CJ0 B;  1HRJ A;  3PUY A;  2LXJ A;  1PXU A;  5IIF A;  4ALP A;  2CFM A;  2RSO A;  5M3M G;  1EY5 A;  1HJP A;  3OPO A;  4A3F G;  5ELB A;  2UUB Q;  2NN6 H;  2R7Z H;  4RAU C;  1EIG A;  2OQ0 A;  3U50 C;  5EPK A;  1VQL A;  3IAY A;  4IFD G;  4H44 C;  5I2X A;  3OMG A;  1SSO A;  3K7U C;  5A2Q L;  2OTJ A;  3ITP A;  1HNW Q;  1LV9 A;  1X54 A;  5JVG 3;  4DV0 Q;  3CC4 A;  1HH2 P;  1QVC A;  2Z8L A;  2A19 A; 
#chains in the Genus database with same CATH homology
 4IUN A;  1SEB D;  3SXH A;  1CHQ D;  3I70 A;  4DAV A;  1F2Y A;  5M3F B;  2LMC B;  5JAV A;  3TP6 A;  3NTK A;  2Z1C A;  1A2T A;  1Q3L A;  3PMF A;  2A73 B;  1EIH A;  3SK5 A;  5C4H A;  4OIJ A;  1B9M A;  5E1F A;  3LWE A;  4KY7 A;  2NWG A;  4FF4 A;  3NP8 A;  1PFN A;  1KTK A;  3PV0 A;  4IUR A;  2F0P A;  5JPN C;  2KEE A;  1IHZ A;  1BQQ T;  2WP8 J;  1BNZ A;  1R4P B;  1SJH D;  1JQY D;  2E2D C;  3A7L A;  3X3M A;  2X6L A;  3Q6S A;  5DAU A;  4FXD A;  3PO2 B;  1EYD A;  5C3X A;  2QKI C;  1WTO A;  1X3P A;  4K5X A;  3GD7 A;  3MAQ A;  2C5C A;  2L12 A;  2N88 A;  2A68 C;  5KGU A;  2E76 C;  1ESR A;  5IOD A;  1Q8I A;  2WV6 D;  3BYT B;  3TSS A;  1I4P A;  1V8Q A;  2E2H B;  4K14 A;  1L0X B;  2C9O A;  1PDQ A;  1HCZ A;  4BBS B;  1TU2 B;  4IFD I;  2L55 A;  3J81 E;  1KNE A;  4N9T A;  2O5J C;  2B2T A;  2M2L A;  2E2J B;  3IFT A;  1NAP A;  5ELC A;  2B2V A;  1YNN C;  2ZT9 C;  2F0L A;  4EGV A;  1LTT D;  5LL6 X;  4ZRZ A;  3PUW A;  5EGT A;  4HCE A;  1BF4 A;  1JOO A;  2H1E A;  2JA8 B;  5C4Z A;  2L5T A;  4F88 A;  1F2Z A;  5K36 G;  4B9X A;  2JA5 B;  2RSN A;  1WTP A;  1B2T A;  5C4X B;  1QOH A;  1KDA A;  3AB9 A;  5D65 A;  4A3K B;  2CW0 C;  1I4Q A;  3KBG A;  2FIN B;  2Z4I A;  1S5C D;  4KN4 C;  5IGC A;  3D3R A;  1ONL A;  4ZKC B;  1QIL A;  4M1U B;  3QIA A;  4G7Z C;  1CT1 D;  3E5S A;  3HZX A;  3FMC A;  4DFA A;  1SYE A;  3V2T A;  2PW7 A;  3H09 A;  3NQT A;  1GOZ A;  1NSN S;  5KYI A;  3ONA B;  2G9H D;  1U4P A;  2CQA A;  1SYB A;  1HPC A;  2NB0 A;  1PZI D;  3G7L A;  3FPP A;  5G3L F;  3GQB A;  3JAM E;  3VR5 A;  1XWE A;  1SE4 A;  2IT1 A;  2FMC A;  1LTR D;  3RD4 A;  3W2D A;  1B53 A;  1HA5 A;  3OMC A;  4A93 B;  1WTR A;  4KKS A;  3FPU B;  3KK7 A;  2I46 A;  1D1K A;  3EFX D;  3S16 B;  4G4K A;  4C1N I;  3TBI B;  1Q1B A;  4OHJ A;  4HR7 B;  3GV3 A;  3C1F A;  4HED A;  4NKL A;  1SDF A;  3NSW A;  4K6L A;  1D6E C;  1ZKO A;  3D31 A;  1VDZ A;  4K6D A;  2JEB I;  1E0B A;  3J7A V;  1AP0 A;  1CZG A;  2WAC A;  4A3B B;  3TDQ A;  1T5E A;  1HTP A;  3PIO 3;  3V05 A;  5D3D A;  1QNK A;  1EQV A;  1M8A A;  3DWQ A;  3J80 E;  2F0S A;  3VR6 A;  3HG9 A;  4LK1 C;  1VF5 C;  2K05 A;  2D5D A;  3SEB A;  3IKJ A;  1STY A;  3VYT A;  3HOY B;  3NTI A;  3GTQ B;  1SXT A;  1PRT D;  5IOC A;  2PPB C;  2H4O A;  1Q90 A;  4NMZ A;  1XYI A;  4CKE A;  2O5I C;  2NN6 G;  2RDF A;  5I4D A;  2MJ8 A;  1EQT A;  1BDO A;  2QF7 A;  3G6J B;  1Z7T A;  1TWH B;  2XN9 C;  2NVT B;  1SMY D;  1PZK D;  4FNF A;  3LNN A;  3Q23 A;  5BN4 A;  1PZJ D;  3BS1 A;  1STB A;  4NP5 A;  4DXF A;  3DXJ C;  2KA7 A;  3OWF A;  1IL8 A;  4KD4 A;  3K7A B;  2IL8 A;  3TP7 A;  2EJG C;  2SEB D;  3H91 A;  2LFN A;  4DF7 A;  1S5E D;  3K57 A;  3PUZ A;  5IT9 L;  1I3Q B;  2L9H A;  2EVB A;  1S5B D;  2JEA I;  1A3V A;  2JSO A;  1KDC A;  2HDL A;  3TN2 A;  1IYU A;  4PQX A;  3S17 B;  2F0I A;  1SBB B;  3FRP B;  2NVY B;  2BDN A;  4C2M B;  2NBF A;  5E4X A;  2J7Z A;  1K8M A;  5KNB A;  5CV8 A;  2QEJ C;  1BCP D;  4HMI A;  4ZAI A;  1TWC B;  2ZXR A;  4XYO A;  3BG3 A;  2MUY A;  1S5F D;  2LS0 1;  1TT2 A;  3NUC A;  4B08 A;  3M85 A;  1WCM B;  2OF1 A;  4IUQ A;  2IX3 A;  3ZYY X;  4A3G B;  4OO1 I;  3KLS A;  1EYC A;  3S9W A;  2NN6 I;  2ICI A;  1F2M A;  3T16 A;  4PMC A;  1QE6 A;  5CMD A;  1OO9 B;  3S1Q B;  5JEA H;  4Y7N B;  1MSG A;  1AN8 A;  3I4N B;  4U68 A;  3HS0 C;  3T4A C;  5KNC A;  2IW3 A;  2BE5 D;  2G9D A;  2PCF B;  4FVM A;  4C3I B;  1EL0 A;  3BVM A;  1PMR A;  1U4M A;  2SDF A;  1HFG A;  4BA2 I;  1D5Z C;  3I3C A;  4S3S A;  4A3J B;  2Q8T A;  3K6O A;  1OXT A;  3EJI A;  3N52 A;  2A69 D;  3NK9 A;  3EA6 A;  3H94 A;  2RVL A;  4IQZ A;  3I90 A;  4PV1 C;  1LLR D;  2YYZ A;  1RD9 D;  1O7Y A;  3I4M B;  3Q22 A;  3T56 B;  2YU9 B;  1ROD A;  4KKU A;  4K2L A;  2QDB A;  5EPJ A;  3BYY B;  1SYF A;  4BWG B;  5C5M A;  1GHK A;  1HQM C;  1TVX A;  1DYQ A;  1CQF A;  5JOB A;  4DNT B;  1A2U A;  2K03 A;  2KHS A;  4TKO B;  1PYW D;  3VR4 A;  1G29 1;  3GTG B;  2L11 A;  2R7Z B;  1CM9 A;  1EY4 A;  2K6A A;  1C8C A;  3A7A B;  2VNU D;  3NBI A;  1CTM A;  3T51 B;  3S14 B;  1W6K A;  4Z9C B;  1T5X D;  3A56 A;  5T1G A;  1SE3 A;  3FVQ A;  4LAA A;  1V1O A;  3H0G B;  1Q12 A;  5C0X I;  4G7H C;  1S5D D;  2EY2 A;  1VMC A;  3GV6 A;  1U4R A;  3W3A A;  5IGD A;  2EYJ A;  1WVL A;  1LT5 D;  2XWJ B;  2HDM A;  1LT4 D;  2OEO A;  1SFO B;  1NUC A;  1GHJ A;  1TS5 A;  2IX0 A;  1PRT C;  1UAP A;  4FF1 A;  4RHR A;  1MGS A;  1NCV A;  3D4R A;  2EYO A;  3HRZ C;  1B1Z A;  4ZYS A;  2LKV A;  1BUV T;  3LX0 A;  5A35 A;  1C48 A;  1SNM A;  3E6Z X;  1Z47 A;  4ZUI A;  1SMY C;  5CV5 A;  1KLG D;  4O1N A;  4EQN A;  2A5H A;  3MHB A;  1I4H A;  1Y8N B;  1RCV D;  3DM1 A;  2EOT A;  1KDB A;  1CI3 M;  2F3W A;  4DXG A;  2K04 A;  3VYR A;  1EEI D;  1UEA B;  3X3N A;  4XYQ A;  3J80 L;  5KRU A;  3GTM B;  2BDO A;  1JWS D;  3OSO A;  5M5W B;  1BOS A;  4ABN A;  4KKT A;  3D4D A;  2GA4 B;  2XNA C;  4U67 3;  1GUG A;  4RKB A;  1RTO A;  2PQE A;  3D8G A;  3Q0A A;  2K1B A;  1O7Z A;  1NR2 A;  4ZKB B;  2JE6 I;  2F1M A;  2R3Z A;  3E0J A;  1CZW A;  4C3J B;  4ZK9 B;  1F9Q A;  4KY6 A;  1XX8 A;  1G6Z A;  2DY8 A;  1HQR D;  1LT3 D;  1V43 A;  2RDH A;  3A8I E;  1A6X A;  2F0E A;  3SVM A;  2X6G A;  2JA6 B;  5CBE E;  3ERO A;  3D4W A;  4EQO A;  2I07 B;  4PNY A;  2N55 A;  2XWB B;  1WTW A;  1PFM A;  2B2W C;  1ZXT A;  2BE5 C;  5IGG A;  2F0G A;  1VMP A;  5BN5 A;  1MSH A;  5I9P A;  1JOQ A;  3R3O A;  2KEC A;  1EU3 A;  2B2Y C;  2X69 A;  4H0L C;  4Q5V A;  1IKM A;  1Y1V B;  2A69 C;  2O2L D;  5JEA G;  3T53 B;  1ENC A;  3MWY W;  2FHT A;  3OHX C;  3NWT A;  4I7Z C;  1KLU D;  5C5L A;  3J7A F;  1GJX A;  2BCO A;  5CGK A;  2R93 B;  1D2B A;  1HUN A;  2JP1 A;  2DY7 A;  1DZ1 A;  1ZEQ X;  1JWU D;  1F77 A;  4KI0 A;  3WDN A;  2R6G A;  3BDO A;  2ZXO A;  3U9S A;  2O4X A;  2QCP X;  4YIJ A;  1X3Q A;  3F2U A;  2PW5 A;  4HSP A;  3DMU A;  1D5X C;  4TSS A;  2NUC A;  3KLS X;  2EPB A;  2PYK A;  1LTA D;  2TSS A;  1A3T A;  2J0T D;  1H9M A;  2PO4 A;  5C44 B;  1TS2 A;  1SE2 A;  2PZU A;  1AEX A;  1AFP A;  3CU7 A;  4R8N A;  3FDT A;  3MTS A;  3GTO B;  4RGN A;  1I4X A;  3DEO A;  4C3I G;  5C0X J;  1EZ6 A;  1NR4 A;  1X32 A;  3WOF A;  1STH A;  5I6W A;  3P1H A;  1EY0 A;  4K2K A;  4FF2 A;  1DOK A;  2AQ3 B;  1PTO D;  2K01 A;  5FLX E;  3MXN A;  5FOB B;  4X3S A;  4IUU A;  2A6H D;  1PFB A;  5EBD A;  4KY5 A;  3I8Z A;  1STE A;  5LHY 1;  1K83 B;  4FP5 D;  4KMU C;  4KTA A;  1GUW A;  1OXX K;  2WIN B;  2K5W A;  3KUP A;  4WRD A;  4R8I A;  1FNU A;  1EFI D;  2B2U C;  2SNS A;  2K33 A;  1HXY D;  5FO9 B;  3DUZ A;  2WKD A;  5E4W C;  4J1M A;  2ID0 A;  1KAA A;  3H6M A;  1WD1 A;  2BOS A;  3HOW B;  1JOK A;  3HOX B;  4QB4 A;  4L8J A;  2E75 C;  3L7Z C;  2VUM B;  4DAY A;  2R61 A;  4HMJ A;  2SOB A;  5KEE A;  3PUV A;  4NW2 A;  1STG A;  3HOV B;  5I2Y A;  4L63 B;  4A3D B;  2EY5 A;  5LL6 S;  4KN7 C;  3BDC A;  5KYL A;  3MXU A;  3RLF A;  1CA5 A;  4XT3 B;  3QO2 A;  1CA6 A;  1LO5 D;  5CV6 A;  3ERQ A;  1TWG B;  5M5X B;  1GUT A;  3NBH A;  1F9S A;  4KJN A;  3M4Y A;  2EY6 A;  2AUK A;  3GTP B;  5C4J B;  3A8K E;  5JPM C;  2KVM A;  2NZ1 D;  1HUM A;  2K5Q A;  4KHZ A;  2AWO A;  1H9K A;  4IFD J;  3S15 B;  4HAE A;  2F4I A;  4HN7 A;  1LTB D;  4LJZ C;  3CRL C;  1C4Q A;  4CBV A;  2L0C A;  3CRK C;  4F7X A;  1GXD C;  1R9T B;  3L9A X;  4CGY B;  4KV6 A;  4CKC A;  1LAB A;  2K32 A;  1EZ8 A;  2MPM A;  4RCN A;  4C1N K;  2HQE A;  2AQ1 B;  2NVX B;  1LTG D;  3ND8 A;  1AW7 A;  4BA1 I;  1RJT A;  2E74 C;  1VF7 A;  3ND9 A;  2J4X A;  4DN4 M;  5EKI A;  5E3F A;  2L4N A;  5F2D A;  4WFN 3;  3N6R A;  4TRD A;  2NYZ D;  4KD3 A;  2K5D A;  4AYB B;  1YNJ D;  1HHV A;  1TKW B;  5CR3 A;  5CV4 A;  2K7V A;  1S4Z A;  3DEP A;  2HCI A;  4QF4 A;  3GP7 A;  4IN3 A;  1OXU A;  2XRQ D;  5J1Z A;  2VXW A;  3C3L A;  2PZW A;  4FXK C;  1JB3 A;  4C3J G;  3PIP 3;  3K0Y A;  1SYD A;  1FR3 A;  1AZP A;  2D62 A;  1PRT F;  2JA7 B;  2VB2 X;  4KK7 A;  3S2H B;  3MA2 B;  4L6T B;  1PTO H;  3QWN A;  4K8J A;  2BA1 A;  1Y69 U;  2WKC A;  2L1B A;  1PRT B;  3J81 L;  2ENB A;  4BY1 B;  2F0F A;  4RCO A;  3URY A;  1B4O A;  3C46 A;  1RF2 D;  4C3H B;  1QNU A;  1TY2 A;  3I4L A;  5C6A A;  4R9W A;  4A3E B;  2PZT A;  1GUO A;  1F9R A;  2MP1 A;  1G91 A;  3C2P A;  4RKL A;  3M7G A;  3VR2 A;  1RKN A;  3RUZ A;  2EYL A;  3P75 A;  4WOR A;  5ISR A;  3U9O A;  4CHT B;  1DD2 A;  5IGF A;  4UDU C;  5ELD A;  1PTO C;  3K5N A;  1QG7 A;  2A6H C;  2B8F A;  2F0O A;  2WII B;  3PO3 B;  4F87 A;  4PMB A;  4XXE A;  4FYD A;  2AUJ D;  1QCB D;  1HA6 A;  5DEH A;  3M3Y B;  1EEF D;  3HKZ B;  4ID6 A;  1KAB A;  1H9J A;  2B2W A;  3O13 A;  4IAL A;  5KND A;  1SNC A;  1BCP F;  3VA7 A;  4Q0F A;  3NWS A;  4DK0 A;  3NPP A;  3JAM L;  3UI2 A;  1Y1W B;  1BCP B;  1EOT A;  2B2Y A;  1DON A;  1TWA B;  3NHH A;  1EU4 A;  4K5W A;  1OXV A;  4OO1 H;  3MXG A;  3NE5 B;  4RGM A;  2WAQ B;  3SK4 A;  4GZY C;  3SR1 A;  4XQN A;  5IT9 E;  3FKI B;  2EE1 A;  4FO2 A;  3GO5 A;  3GTL B;  5J39 A;  1V1P B;  2DNE A;  2XSC A;  3S1M B;  4RGO S;  4EQP A;  1STN A;  5FLX L;  2B39 A;  4HSV A;  2EYH A;  4G57 A;  3RZO B;  4E6I A;  2TMP A;  1WTV A;  3EVQ A;  3I91 A;  5G3L D;  3CHB D;  4ME5 A;  4QIW B;  4RA8 A;  1B3A A;  3QJY A;  2OT2 A;  3I72 A;  5CC4 A;  4RFB A;  1Y8P B;  3VYU A;  1MBY A;  1UUP A;  1ZYR D;  2BA0 A;  1IW7 D;  4V0B A;  1ILQ A;  2PNR C;  3HOU B;  1O78 A;  1KNA A;  2KCC A;  2RBM A;  1HFN A;  3OWE B;  2KED A;  1I50 B;  1CK1 A;  3HEJ A;  2CVR A;  4B9W A;  4JK1 C;  1WTQ A;  4QUF A;  1B50 A;  5DM6 3;  4F8M A;  1FD7 D;  1Y8O B;  4QMG A;  2EJF C;  1BCP C;  5IGE A;  1JR0 D;  2F0K A;  3OIP A;  1A3U A;  4OL7 A;  1SAP A;  4QUC A;  2M00 A;  4RHS A;  4ZQ3 A;  5ELF A;  5EBC A;  3NTH A;  2Q8R E;  2B2U A;  5D3I B;  3L3O C;  1QB5 D;  3S2D B;  4K5V A;  3CQZ B;  2MHV A;  2EDG A;  2EYF A;  1SJE D;  3GTK B;  4IZ8 A;  2FMM A;  1YNJ C;  2A6E D;  5C0X H;  5EKL A;  3IL8 A;  1JCK B;  3P7J A;  1XTC D;  2F0V A;  2KQ3 A;  1SYC A;  1QWY A;  1R4Q B;  1F9P A;  1I6V C;  1E2Z A;  1RDP D;  3NQI A;  1EY9 A;  1XXG A;  1K8O A;  3S1R B;  2HCC A;  2XVS A;  5CYU A;  2EY1 A;  4XIG S;  3A55 A;  3T13 A;  4DA2 A;  4IUP A;  1ET6 A;  1TY0 A;  3SK8 A;  3QG1 A;  3AMU A;  2F0Q A;  1FGB D;  4XQQ A;  1DJR D;  1G8Z D;  3D6W A;  1RHP A;  1JIC A;  1ENF A;  1E2V A;  1LT6 D;  4X3T A;  1TQO A;  5COY A;  2D9U A;  1LTS D;  4OGQ C;  3R93 A;  3TP5 A;  2VB3 X;  1JE4 A;  2K28 A;  1BR9 A;  1B9N A;  3BZD B;  1DOL A;  5FKA C;  2EZV A;  3KLR A;  3OIQ A;  1I6H B;  1BBX C;  3HP3 A;  2KUM A;  4J8Q A;  1D5M C;  1JC7 A;  5M3M B;  4C56 C;  2OXP A;  3KBX A;  4A3F B;  2KCN A;  4XDX A;  5M9O A;  4XT1 B;  1Q1E A;  4O42 A;  3CKI B;  5A2Q E;  3TZU A;  2DN8 A;  2KOL A;  3MC0 B;  1DXM A;  1FNV A;  5ELE A;  2IPK D;  5M5Y B;  5KIX A;  1SNQ A;  3K5M A;  2EJM A;  1W6J A;  1MI2 A;  4KJO A;  5NUC A;  2QIL A;  3BVG A;  2SNM A;  4I65 A;  4ODG A;  3C1E A;  1D1I A;  1FYC A;  3BDL A;  4C3H G;  1EWH A;  2F0U A;  1Z6H A;  3M4O B;  2A74 C;  3DWP A;  2XRS D;  4IFD H;  1LTI D;  5JVH 3;  5J22 A;  2V4D A;  3HGB A;  3A54 A;  2EYM A;  2B2T C;  3KF8 A;  4CJ2 C;  4TQU S;  4CKB A;  3K59 A;  3MVV A;  2LY7 A;  2WB1 B;  1BO0 A;  3R2I A;  2HUG A;  2B2V C;  3BVZ A;  4BY7 B;  2F3V A;  4MHE A;  2B63 B;  3RZD B;  5T1I A;  2AQ2 B;  2JXM B;  3VR3 A;  1G2T A;  3AU7 A;  3NXW A;  1I4R A;  2F0W A;  1MD2 D;  4OO1 G;  3RMH A;  3R2T A;  1ESF A;  2Z4H A;  1WTX A;  4A3M B;  1ZYR C;  1O80 A;  5HUR A;  1IW7 C;  1H9S A;  2CHB D;  1TS3 A;  3TME A;  4P2C B;  5EPL A;  2FJ2 A;  1F2L A;  5FO8 B;  2RKS A;  3MXP A;  4PMW A;  3DHQ A;  4A3I B;  1O7L A;  1ET9 A;  3PUX A;  3MFG A;  4WJW A;  2KJX A;  5JJZ A;  1OXS C;  2RDG A;  1G2S A;  4MIU A;  5K5P A;  4ZUJ A;  5EKK A;  1ML0 D;  4DK1 A;  2RQX A;  3FEW X;  4LMQ D;  3SHL A;  1AZQ A;  1II3 A;  2MGS A;  3A8J E;  4BS9 A;  1I4G A;  5C3E B;  3K58 A;  3VA5 A;  1IYV A;  3H3V C;  1ENA A;  1FNW A;  5IGB A;  2F0T A;  5I6Y A;  1CFM A;  3SE0 A;  3K5L A;  4G7O C;  1JWM D;  5CV9 A;  1L0Y B;  5AFW A;  3TZD A;  1H9S B;  2D2C C;  1STA A;  1SND A;  1J8I A;  2ICE C;  2A68 D;  2NTT A;  1EY7 A;  1DCZ A;  2A6E C;  4RH6 A;  1PTO F;  1TS4 A;  5DM7 3;  2JYO A;  3QOL A;  1BXT A;  1TWF B;  4ULL A;  4BBR B;  3DWA A;  1PTO B;  4M8A A;  5K36 H;  1UNS A;  5HGT A;  3J7Y W;  5COR A;  4EVO A;  1WD0 A;  4FF3 A;  4MN3 A;  3WOE A;  4ZLT F;  1ILP A;  2F0D A;  4ILW A;  3HOZ B;  3P20 A;  1CHP D;  1IKL A;  1DM0 B;  1JOR A;  3K5O A;  1PLF A;  2F0N A;  1YNN D;  2F0J A;  5I9O A;  3SK6 A;  4X3U A;  1CQV A;  5C0X G;  4FXG C;  2F03 A;  3Q24 A;  1RTN A;  4IUT A;  5BN3 A;  4RWS C;  1H9R A;  1EWC A;  1LAC A;  4DGZ A;  3R8B A;  3M7N A;  2CW0 D;  1EY8 A;  1SNP A;  1A15 A;  1EYA A;  4N9P A;  4OIK A;  2Q8I B;  2Y0S B;  4HCS A;  2R92 B;  3EQL C;  3MZ5 A;  5CV7 A;  2F0M A;  5EJW A;  4H7B A;  5CBA E;  4NDX A;  2EXZ A;  1U4L A;  3LWU A;  4XTC S;  4QCL A;  1VCI A;  3QB3 A;  2NVQ B;  1SNO A;  4XQJ A;  5FK9 C;  1M4V A;  4DNR B;  2IJ0 A;  5DNF A;  1QJO A;  1E2W A;  2EYP A;  1U9R A;  4HTH A;  4X3K A;  1TR5 A;  4H13 C;  4J6H A;  4DU9 A;  2E2I B;  3MEH A;  3VYS A;  1DOM A;  1GUN A;  1HTL D;  2XIW A;  2RA4 A;  1B44 D;  3SDZ A;  2FFK B;  2ZXP A;  3IFD A;  1TII D;  4V19 0;  4DAP A;  5EQ0 A;  2B8G A;  1V1P A;  5JEA J;  4UAI A;  1EY6 A;  3MFY A;  3V96 A;  1J9O A;  1SYG A;  5C3W A;  4JBW A;  2DNC A;  1GUS A;  3TP8 A;  5D14 A;  2F0H A;  2PMZ B;  4IUV A;  5TSS A;  2M9V A;  4KHV A;  5FO7 B;  1ICW A;  2IWH A;  3QOJ A;  4RGT A;  2AWN A;  2IX1 A;  3OOC A;  3I73 A;  3S1N B;  2NTS A;  4CJ1 B;  3GTJ B;  3OW7 A;  4K8I A;  3D6C A;  4CJ0 B;  1HRJ A;  3PUY A;  1PXU A;  5IIF A;  2RSO A;  1EY5 A;  3OPO A;  5ELB A;  2NN6 H;  4RAU C;  1EIG A;  5EPK A;  3IAY A;  4IFD G;  4H44 C;  5I2X A;  3OMG A;  1SSO A;  5A2Q L;  3ITP A;  1LV9 A;  5JVG 3;  2Z8L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...