4OWTB

Structural basis of soss1 complex assembly
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
105
structure length
72
Chain Sequence
TFVKDILIFIVLETGVRTCKVADKTGSINISVWDDVGNLIQPGDIIRLLTLYTDLQKIGEFCMVYSEVPNFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of SOSS1 Complex Assembly and Recognition of ssDNA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords Integrator complex subunit 3
total genus 17
structure length 72
sequence length 105
ec nomenclature
pdb deposition date 2014-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01336 tRNA_anti-codon OB-fold nucleic acid binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4owtB00
1KRTA 4HJ8A 3EIVA 1HNZQ 3I4MG 3SGIA 5FLXc 1HZBA 1HR0L 4DK6C 4A3CG 4OONA 3E9IA 4DR4Q 4B3MQ 2CCZA 5IP9H 3EBEA 3FHWA 4JI3L 2JQOA 1VQGA 4IJHA 4LF9L 2UXCQ 4YY3L 1X3EA 3FP9A 4YHHL 1N36Q 2JA8H 3I2ZA 1V9PA 4C2MH 1WCMH 1TWFH 2ZTEA 5C4JH 4UP9A 5GQOA 4IPGA 1EIYB 3K7AH 3JAMi 2PQAB 3NBHB 1OXVA 2B29A 4GN5A 4XIGS 1SE8A 4APVA 2BH2A 5JJIA 4DV4Q 4AYBE 2DGYA 1N34L 1TWGH 3L7ZC 5ELOA 1ASYA 2UU9L 4LFBL 4NXMQ 2I5LX 3MXNB 4JYAQ 2WP8J 4BA2I 2IHEA 1XMOQ 4LF6L 1CSPA 4BBRG 5IY0A 4DV7L 5IYBH 2KHJA 2K75A 5GAEC 2QEXA 1G6PA 1Y14B 4NXNQ 1YVCA 3HOWH 3STBD 2GVAA 3ERSX 3S15H 3HKZE 4IFDJ 1JT8A 3ULLA 1LYLA 5GROA 1HJPA 3HFZB 2EIFA 4JI5Q 4LF5L 4Y52H 4A3JG 1P16A 2YYZA 1EOVA 4LUVA 1YEZA 4A3GG 1PH7A 1YJNA 2R7ZH 1LM0A 4IO9A 4BBSH 4JI2Q 3CCUA 2E2JH 4EX5A 2KCMA 1MKHA 2A1AA 2N49A 3PSIA 5HGQA 5GADC 2JA7G 2UUBL 2ZTDA 3G71A 4PZ6A 4DR3L 4JV5Q 1VQ7A 4LFBQ 1PHJA 1VQEA 1X56A 2XTIA 2QGQA 3CCVA 4OO1I 4B3SL 1EWIA 2OCEA 1KL9A 3AYHB 4UPAA 3S1RH 1X55A 2Q2UA 5IYDH 5C0XG 2K4KA 4ALPA 4OWWB 3RZDH 2NZHA 3PO3H 1FJGQ 1OXUA 1TWHH 3KF6A 4A3GH 1K73C 4DKAC 1V1QA 5IWAQ 1E3PA 2H5XA 2JA5H 4A3BG 2VQEQ 4UY8C 3I4NG 2N78A 1EYGA 2VUMH 5IP7G 1SLJA 1SROA 3CMEA 3J81i 3I56A 5JEAJ 4DAMA 2JE6I 5FLMG 1EIFA 1NY4A 2AWOA 4JI3Q 1HZ9A 3JC66 2R7DA 1QVFA 2LXKA 4GN4B 4YCUA 2VY3A 2I5HA 4JI7Q 4AH6A 5C3EG 1WJJA 1KRSA 2F52A 2Y0SG 4LF4L 2OTJA 3CPFA 3F2DA 2VQFQ 3TREA 2GN5A 4B3SQ 2VS1A 2ZTCA 4JG2A 1XPRA 4QGUA 2R7FA 5GAHC 3S16H 3OW2A 4A75A 2UU9Q 3J81c 2JEAI 3FKIG 1YJ9A 4NXML 4X65Q 4BXXG 1VQ9A 1WCMG 1SN8A 4IJLA 1Z47A 3CCJA 5C44H 1N8RC 1EQRA 3NENA 4HIOA 4A3DG 5JJKA 1OXXK 3WWVA 1AH9A 3I4OA 4KI0A 4POGA 1SMXA 4DUYQ 3A5UA 4LNQA 3AFPA 1XNQQ 4A3LG 3J7A5 3KLWA 3PUYA 5EAYA 1L1OA 1Q46A 4DR5Q 1XTDA 4HIMA 1JB7A 4NB3A 2K14A 5IYBG 3HOXG 3M4OH 1XPOA 4TVAB 1HR0W 4DR2Q 3Q8DA 3CPWA 3KDFB 4JI2L 4JC0A 2ZJPA 4MZ9A 1LUZA 3DLLA 1VS0A 3RLFA 1HH2P 3J81j 2UUBQ 3K7UC 2WFWA 3CXCA 1JMCA 3T1HL 2WB1E 1GVPA 1QUQA 4AQYQ 1T9HA 3J80i 2BA1A 3D0FA 3GO5A 1K9MC 2JA9A 3ER0A 2CWPA 2NVTH 1EUJA 1YBYA 3DM3A 3G48A 4X66L 4A3EH 2RHSB 3A74A 4A3JH 1KD1C 1X3GA 1A8VA 1CUKA 3S2HH 2VW9A 2BA0A 2K5HA 4DUYL 1PH1A 3I4NH 1PH5A 3PF4A 4JBWA 1FJGL 3UDGA 4TQUS 4PZ7A 4Y7NH 5LMNQ 1JE5A 5IE8A 4DR5L 1SR3A 1Y1VH 4YCVA 1XNRQ 3T1YL 3OYYA 1N33Q 1EFWA 1QVCA 4A3FG 3KJOA 3CC4A 2MO1A 2R92H 3M9BA 1Q86C 1PH8A 1E1TA 1L0WA 1XMQL 3UE1A 1CKOA 3PUWA 3I55A 4GS3A 4DR1Q 1QZHA 1IBKQ 4BY1H 4JI6L 1WOCA 4A93G 1VQHA 4R4TA 5J3BA 1OTCA 1PVOA 3CC2A 2VQFL 4A3MH 2KCTA 3HOVH 2JA6H 4DV3L 1IBMQ 4BBRH 2JA8G 4X66Q 4L5TA 4R1JA 2A8VA 1C7YA 3RLOA 4GKKQ 2RCNA 4L5QA 4B3TQ 4LWCA 1KC8C 1ASZA 4X65L 3MEFA 5M3MH 5JEAG 4R4CA 3S1MH 2WAQE 3NEMA 1GKHA 3RZOH 1L2FA 4YCWA 4YWMA 4JBJA 1S40A 2Z6KA 2ZM6L 2D62A 2E2HH 4LFAL 2NN6I 1XNQL 3UDFA 1I94L 3TRZA 4BBSG 2K5NA 3K81C 3F2BA 1VQMA 3OTOQ 1SRUA 1X65A 1Q7YC 4DR6Q 5M5XH 2E5LQ 2AMCB 2JA6G 4P71A 1X54A 4A3MG 1MJCA 5IYDG 4RMFA 4DV6Q 3M3YH 2ATWA 2CQOA 4B3RL 2KHIA 2UXBQ 2YTVA 1RIPA 3AFQA 4YWKA 3UDXA 1O7IA 4DV3Q 1IBML 2PI2E 2PI2A 2EXDA 3A5ZB 2IX1A 2VNUD 5K36G 3GTMH 3L0OA 5M5YH 3BJUA 4C3JH 4OWXB 4JOIA 3NELA 4LFCL 5BR8L 2ZJRA 2VUMG 3PO3G 2YU9H 4DV0Q 4A3KH 3S14H 1B7YB 1VQBA 3F1ZA 2GVBA 4AIMA 1YZ6A 4LF9Q 2UXCL 2N3SA 3J80c 4A3IG 1CKNA 1VQDA 1VQPA 3CP0A 4DK3C 1VQKA 2Q2TA 3KJPA 4HJAA 2OTLA 3UDIA 3RN2A 4O2DA 4JBKA 3K0XA 5M3FH 4NPSA 1N36L 1DGSA 1K83H 5LMNL 1PA6A 1I6HH 4H02A 1U5KA 2UUCQ 2R93H 4DAYB 2B63H 1J6QA 3U58A 4JI1L 4DV4L 3S24A 3H3VH 1N33L 2RF4A 2QA4A 4KLKA 3U50C 4P73A 4DPGA 2F3IA 1HNWQ 1E7ZA 1UWVA 3CCQA 1N34Q 3GDEA 1XMOL 4LF6Q 2F4VL 2UXBL 5C4XG 2C35B 2L15A 4FDBA 1R9TH 3CCSA 1S72A 3KF8B 4DR1L 3W1GA 2KBNA 3KOJA 4DUZQ 4DV7Q 3FKIH 2ALYB 3CCRA 4LF8L 2JJQA 4BXXH 1K0RA 3PUVA 5BR8Q 4LFCQ 1N32Q 2JK8A 3RLNA 4DV0L 3CF5A 3W1BA 4GN3B 1AE2A 5C0XI 1VQ5A 1VCIA 4O0AA 3PUXA 4JI5L 3HOWG 1HNZL 2IT1A 3GTQH 4KHPL 3HKZG 1NTGA 3CW2C 4GNXA 4LF5Q 3CQZH 5M5WH 4A3LH 1GD7A 3PV0A 4A93H 1TWAH 1C0AA 3I4MH 3M4PA 4KHZA 3HOUG 1VQFA 3D31A 4DV5Q 3HOVG 4XTCS 3GTLH 4DR7L 4A3CH 4QIWE 1CSQA 4B3ML 4JI4Q 3IRBA 2ZM6Q 1BVSA 5HY6A 1D8LA 4YY3Q 4OXPA 1HNWL 1JJGA 3KF6B 1YIJA 4P74A 2NVYH 1QVGA 1VQCA 2ES2A 3RR5A 4WJ4A 1UE6A 2MNAA 1GO3E 4DR6L 1N9WA 4PMWA 3PF5A 1I5FA 1K3RA 1NJIC 5LMNW 3RNUA 1KIXA 1E1OA 1JJ2A 3K80C 2WB1G 2HQLA 2IY5B 3J7ZC 3HOYG 4OX9L 2I0QA 4JYAL 3GTOH 1NMFA 3CCEA 2KENA 4NXNL 3HOUH 1NE3A 1V43A 3K8AA 1Y1VG 4KHPQ 5FLMH 5JJLA 2VQEL 1YHQA 1VQ8A 1HNXL 1X3FA 3ZJYC 2LSSA 2R6GA 3GTPH 4LUOA 3RN5A 1MIUA 1VQ6A 3CCMA 4DV5L 4GOPB 4DR7Q 4JI4L 2Y0SE 1KAWA 3H0GG 3E0EA 1PH3A 4JBMA 4JI7L 3AQQA 4R4IA 2HT1A 4LF4Q 4WJ3M 2V1CC 1WFQA 1AE3A 4GNXC 3ULPA 2OQ0A 3A0JA 1EQQA 3STBC 4JOIC 3W5OA 2R7ZG 1IYJB 1OXSC 4EQ5A 5C4XH 3HOZG 4BY7H 4RG1A 3S17H 2AHOB 1TXYA 3GD7A 2B3GA 1LTLA 4PG3A 5GAGC 4YWLA 1L1OB 4DV1Q 2F4VQ 3S1NH 3TS2A 4OO1G 3KYHC 2YTYA 2CFMA 2PMZE 4QL5A 4UP7A 4DNIA 4A3FH 1PH2A 4A3DH 2UUAQ 1S3OA 3M85A 1HNXQ 4HJ9A 4GLAC 3M4QA 1WI5A 5IT9c 3BU2A 2OWOA 2I5MX 4GLXA 2RHQB 1YITA 2ZJQA 3G4SA 2E8GA 1K8AC 1YHBA 5IP7H 2Z0SA 1IBLL 4QQBX 4JI0Q 5IWAL 1OXTA 3TS0A 1IXRA 1KXLA 2Q2HA 1YI2A 2JA5G 1JJCB 4BY7G 3TQYA 1A63A 4GLVB 1VQ4A 2CWAA 1E24A 1NBWA 1PYBA 4DR2L 4DV2Q 4HIKA 2UXDL 4BA1I 1B70B 1IZ6A 5C3EH 3F2CA 1PYSB 2YV5A 3CMAA 2DUDA 5FJ8H 5LMUQ 1QZGA 1FVIA 3H15A 1E22A 5E7NA 4X62L 1PV4A 3E9HA 3BZCA 2NVXH 1VQOA 3T1HQ 4IPDA 1WYDA 4DV1L 4AQYL 2MO0A 2K50A 1PH9A 1KHIA 1Y1WG 4A3BH 3M7NA 1HZCA 3PO2G 5ELNA 1Q1EA 1M90C 4R4QA 1BBUA 4A3EG 2UUAL 4IFDI 4K0KQ 1Z9FA 2Q2IA 2PQAA 2HIXA 4J15A 5M3FG 1UE7A 4OX9Q 1Q82C 1XNRL 4IPHA 1U0LA 4A3IH 1FGUA 2K52A 1PH6A 4JI0L 3L2PA 3KFUA 4HIDA 3PUZA 2HHHL 3T1YQ 3VDYA 3G6EA 4L5RC 2HIVA 1XPUA 3TEHB 2Z6KC 2B63G 3PO2H 4JI8Q 3HOXH 2R92G 4C3IH 4JI6Q 4R4OA 2MQHA 5LMUL 2JEBI 1K8GA 1VQNA 1Q8KA 1YNXA 1IBKL 1RL2A 1M1KC 2AWNA 4A76A 3GTKH 3HKSA 4K0KL 4IOAA 3H0GH 1VQIA 2ID0A 3B6YA 4X64Q 1A62A 1HR0Q 4X6AH 5AJ3L 1PH4A 4QY7A 1X9NA 2XGTA 4PZ8A 3KDFA 3EN2A 1G51A 1PFSA 2D0OA 4MNOA 2NVQH 3I7FA 1HZAA 1I50H 1UE1A 2FXQA 1G291 4LFAQ 5H1SE 4JV5L 4IPCA 2K5VA 1L1OC 2WAQG 3GTJH 3CD6A 1X6OA 1UEBA 1C9OA 1P8LA 1NMGA 1QUQB 1VQAA 5IYCG 1SFOH 1I94Q 2ASBA 4UP8A 1IBLQ 2IX0A 1B8AA 3CAMA 1IL2A 5C44G 3F8TA 2VZAA 1H95A 2E5LL 2YTXA 2EQSA 1GM5A 1J5EL 4LUZA 4POFA 4IOCA 1D7QA 4LW1A 4DV6L 5DLQE 1BKBA 2MFIA 1XMQQ 2PNHA 3PGZA 4L5SA 4BY1G 1CKNB 2R93G 4HJ7A 4DV2L 2UXDQ 4LF7Q 1Q12A 4C3HH 3JAMc 3UE0A 4GKJQ 4JCVE 4GOPA 2JA7H 2D0PA 2LXJA 4MTNA 1FL0A 4X62Q 3LGJA 4X64L 4GOPC 1KQSA 1TWCH 1CKMA 5AJ3Q 5IP9G 5C0XJ 2N8NA 3GTGH 4GKKL 2E2IH 4A3KG 4B3TL 4P75A 3BZKA 5IYCH 3CC7A 1VQJA 2AKWB 4QJFA 4A4IA 1MJEA 3AEVA 2A19A 2UUCL 4DR4L 3PIPA 1YJWA 4JI1Q 5M3MG 1Q1BA 3ULJA 4OWTB 1Q81C 1I3QH 2NZOA 3HOZH 3CCLA 2VL6A 5FJ8G 1Y1WH 2BH8A 4YHHQ 3HOYH 3S1QH 2HHHQ 2OQKA 4DR3Q 1YHAA 2NN6G 1J5EQ 1BBWA 1VQLA 1A0IA 3U4ZA 4JI8L 4ME3A 4HJ5A 4LF7L 3OTOL 1W3SA 2IHFA 4GNXB 4LF8Q 4P72A 3PIOA 4GKJL 2CKZB 3ICEA 1W2BA 1N32L 4DUZL 1XJVA 3H3VI 4IFDG 4AYBG 1UE5A 4B3RQ 3PCOB 3S2DH 3U4VA
chains in the Genus database with same CATH superfamily
4RGTA 1LTRD 4HJ8A 3QOJA 5FKAC 3SGIA 4A3CG 4OONA 3A7LA 1TWAB 5IP9H 3VR6A 2UXCQ 4YY3L 2QDBA 1E0BA 1V9PA 4C2MH 5J22A 4UP9A 4FF4A 3I70A 4IPGA 3JAMi 5G3LD 4APVA 1B4OA 1PRTC 1Y8NB 2NB0A 3L7ZC 5ELOA 4NXMQ 3MXNB 4JYAQ 2B2YA 4A3KB 3S14B 2Y0SB 2IHEA 1XMOQ 4DV7L 2A74C 4CKCA 5HURA 4NXNQ 3S2DB 2GVAA 3ERSX 1NCVA 1JT8A 1I6HB 4JK1C 4X3TA 1HJPA 4LF5L 2EIFA 4JI5Q 4Y52H 2EDGA 1PRTD 3CKIB 1YJNA 2R7ZH 4IO9A 3CQZB 4BBSH 4IUNA 3CCUA 3R2IA 2Z9HA 4C3IG 4EX5A 1MKHA 2A1AA 5HGQA 5GADC 1JE4A 4X3SA 1Y1WB 2IL8A 2RBMA 3CCVA 1EWIA 1KL9A 4K5VA 1X55A 2L1BA 1TS4A 1HXYD 4ALPA 4OWWB 1PDQA 2KOLA 5KEEA 2NZHA 3RZDH 4DKAC 1E3PA 1JWUD 4FVMA 1H9KA 2CW0C 2PQEA 2N78A 4E6IA 1EYGA 3CMEA 5C4JB 2VUMH 2NVQB 1HRJA 3TN2A 4DAMA 4RCOA 1B1ZA 1EIFA 5FLMG 1NY4A 2AWOA 1HZ9A 4GN4B 2J7ZA 2ENBA 4AH6A 5C3EG 1KRSA 1HTLD 3F2DA 4ZUIA 4KV6A 2EJGC 4HMIA 3TREA 1LACA 4CHTB 4UAIA 2EJMA 3OW2A 1SYCA 3FKIG 4A3EB 4X65Q 4TRDA 4IJLA 2K04A 1B3QA 4UHVA 1OXXK 2CQAA 1PRTF 4LNQA 5CYUA 1IYVA 3J7A5 1VDZA 5EAYA 5NUCA 3DWPA 1JB7A 2CH4W 2K14A 3HOXG 4C56C 4LJZC 2K28A 4DR2Q 2MHVA 2ZJPA 5COYA 3K7UC 1JMCA 2F0VA 1RTOA 2BA1A 2CWPA 1O78A 2D2CC 3K6OA 3A74A 1A8VA 1CUKA 5KYLA 1ZYRC 2VW9A 2BA0A 2K5HA 3I4NH 3QO2A 4AYBB 1C48A 4PZ7A 1TWHB 5IE8A 2EYHA 1XNRQ 1CA6A 3OYYA 2EOTA 1N33Q 3I4MB 1B44D 1EQVA 2F3WA 4A3FG 3CC4A 2MO1A 2R92H 3OWEB 1ZXTA 1SFOB 3M9BA 4IZ8A 1PH8A 3P7JA 5K36H 3UE1A 3PUWA 1FYCA 1TR5A 4NMZA 4RKBA 1OTCA 4RA8A 4A3MH 1CQFA 3HOVH 1Q3LA 4BBRH 5ELEA 3GTGB 3RLOA 1TIID 4L5QA 4X65L 5I6WA 4R4CA 3D8GA 2WAQE 3J7YW 1JOOA 3RZOH 1SNCA 4YWMA 1LT6D 2ZM6L 4IUPA 2D62A 1DZ1A 1XNQL 3EROA 2F0LA 2XRSD 3UDFA 1Q7YC 4DR6Q 5M5XH 3X3MA 4P71A 1TS3A 4IUUA 2KHIA 4PV1C 1RIPA 3AFQA 4TKOB 2PI2E 3L0OA 1KLGD 3VYTA 4C3JH 4ZCKA 2WKDA 1PZJD 3NSWA 2F0FA 3RUZA 1B7YB 4AIMA 3WOFA 4A3DB 2UXCL 3IFDA 2N3SA 1VQPA 1D1KA 2EYJA 2JYOA 4HJAA 3RN2A 4JBKA 5M3FH 4NPSA 1K83H 1U5KA 1MD2D 2B63H 1J6QA 4JI1L 1BQQT 1VF5C 1N33L 2E76C 3Q22A 3U50C 4DPGA 3HKZB 3Q0AA 1E7ZA 3CCQA 1XMOL 5C4XG 1TWCB 1DOMA 2C35B 2L15A 3BVGA 1WTWA 1I4XA 3D6WA 3KF8B 5M9OA 1BDOA 1CTMA 1LT3D 3KOJA 4DUZQ 4BXXH 4F7XA 2ALYB 2JJQA 1K0RA 5BR8Q 5FLXE 4K8JA 3J81L 4IOAA 1AE2A 5C5MA 1VCIA 4JI5L 1WVLA 1A3VA 2F0KA 1PTOF 1STHA 2O4XA 4OGQC 5M5WH 3PV0A 3I4MH 3EQLC 1D5MC 3D31A 3FPPA 4DR7L 1KTKA 1CSQA 5IGBA 2ZM6Q 2K5QA 4KHVA 5HY6A 4OXPA 1X32A 1HNWL 1YIJA 2NVYH 1DOKA 1VQCA 2ES2A 4WJ4A 1N9WA 2G9HD 1QG7A 1PTOD 1PZKD 2RKSA 3PO3B 1JJ2A 1E1OA 2IY5B 3HOYG 2I0QA 4IQZA 1F9PA 4H13C 1PFBA 3CCEA 2B8FA 4NXNL 1V43A 3Q6SA 5JJLA 2VQEL 2R61A 3ZJYC 2LSSA 3RN5A 5M3FB 1VQ6A 4DR7Q 1MBYA 2Y0SE 1KAWA 1PH3A 2WACA 3AQQA 4IUTA 3GTLB 1J8IA 2XWBB 1S5FD 2SEBD 2OQ0A 3W5OA 5D14A 3FVQA 4BY7H 1ILQA 1ICFB 3EFXD 3GD7A 2B3GA 1L1OB 1PTOB 4LMQD 4DV1Q 4OO1G 1RCVD 5M3MB 3S1MB 4A3DH 3M85A 1TQOA 3M7GA 1WI5A 3BU2A 2I5MX 2RHQB 2NWGA 1IBLL 1ONLA 1K8AC 4QQBX 3TS0A 1KXLA 1YI2A 1EYDA 4GLVB 5C3XA 3KLSX 3TBIB 2CWAA 1NBWA 1PYWD 1SMYC 5JVG3 4DR2L 1B70B 1IZ6A 3CMAA 4K8IA 5FJ8H 1PV4A 3V05A 3E9HA 3BZCA 5CORA 3T1HQ 4KY5A 4RHSA 5EPLA 1HZCA 3PO2G 4EGVA 4IFDI 4K0KQ 1D6EC 2A6EC 1IYUA 4J15A 1UE7A 4HAEA 1Q82C 4IFDH 4IPHA 4DAPA 3L2PA 3OOCA 3PUZA 3R93A 3T1YQ 1BUVT 4L5RC 1B53A 1XPUA 3PO2H 3HOZB 3HOXH 2NVYB 3T51B 2E2HB 2F0WA 4K6LA 2MQHA 2JEBI 3J80L 3Q23A 1Q8KA 1YNXA 2E2JB 1UNSA 3SHLA 2I07B 1W6JA 5C3WA 4A76A 3HKSA 1VQIA 5CBEE 4X64Q 4NKLA 1A62A 2RCFA 3LNNA 1PH4A 1EZ6A 3GTJB 1CZGA 3KDFA 1PFSA 3S2HB 1ENCA 1SJHD 3GTJH 2EJFC 3LWUA 1LTSD 1UEBA 1P8LA 1LV9A 1QUQB 1SFOH 1BF4A 4BBSB 2KQ3A 4UP8A 4DNTB 1IBLQ 1B8AA 1GUSA 3F8TA 2E5LL 2YTXA 1IW7C 1GM5A 4LUZA 1VMCA 4IOCA 1FNUA 4DV6L 1BKBA 2MFIA 4XT3B 2JXMB 2PZUA 1GUWA 4JCVE 4R9WA 4X64L 2EZVA 2CHBD 1II3A 1SMYD 2HCCA 3P20A 3K5LA 4GKKL 3HOVB 2B2VA 3BZKA 4KKSA 2NTSA 4QJFA 1BCPF 2R93B 2N55A 2PCFB 2OXPA 3KF8A 2NZOA 3HOZH 5FJ8G 3HOYH 4XDXA 5IGDA 1BBWA 3IAYA 3OTOL 1W3SA 2IHFA 5CR3A 4LF8Q 4DFAA 5IGGA 4C3JB 4XQJA 2CKZB 2Q8TA 1N32L 1B50A 2MJ8A 3D6CA 3OIQA 1ET9A 4HTHA 1KNEA 4IFDG 4B3RQ 1DYQA 2KUMA 3MC0B 1JQYD 4WRDA 4ABNA 4EQNA 1KRTA 3SXHA 1SNQA 2AQ2B 4HSPA 1BNZA 2XN9C 1HZBA 3E9IA 1SNPA 4DR4Q 3D4DA 4A3IB 2TMPA 3FHWA 2JQOA 1VQGA 4IJHA 4U673 4LF9L 3KK7A 2P5ZX 3I2ZA 1TWFH 2L5TA 5GQOA 1EIYB 3IL8A 1OXVA 4GN5A 3T13A 1C8CA 1SE8A 2F0UA 2XIWA 2BH2A 5JJIA 4ULLA 4OIJA 3MTSA 4DV4Q 2DGYA 1TWGH 1ASYA 2UU9L 4LFBL 1RKNA 1SYBA 4BA2I 1CSPA 1TWGB 4DAYA 1K0SA 1Y14B 1YVCA 1EYCA 2IX3A 3K5NA 2RDGA 4K2KA 4IFDJ 3HKZE 4FNFA 1S5CD 3QJYA 1LYLA 5GROA 4A3JG 5DM63 1EOVA 5D3IB 1YEZA 4R8NA 1PH7A 1LM0A 4IURA 4BS9A 1AZPA 3PSIA 4KN4C 4LFBQ 1VQ7A 3C2PA 5CMDA 1VQEA 1X56A 2XTIA 3ND8A 1EIHA 2AUJD 2OCEA 1VMPA 4KJOA 2BE5C 1M4VA 4G7HC 5M5WB 3PO3H 2M00A 4TSSA 1K73C 1V1QA 2H5XA 2VQEQ 2R3ZA 4UY8C 3W2DA 5IP7G 1SLJA 3JAML 3I56A 1STNA 2O5IC 1PRTB 1A15A 2JE6I 4F87A 4Z9CB 4Q5VA 3JC66 2R7DA 4KK7A 4JI7Q 3NQIA 1EWCA 2Y0SG 4G7ZC 3DUZA 4LF4L 2GN5A 2ZTCA 1R4PB 2QILA 4QGUA 3S16H 3NUCA 5GAHC 2VXWA 4A75A 2UU9Q 4BXXG 1VQ9A 3CCJA 5C44H 2B2TC 3NENA 4MIUA 4HIOA 3WWVA 1EY4A 4KI0A 4POGA 4C3JG 4DUYQ 3I73A 1XNQQ 4A3LG 1SNDA 3KLWA 3PUYA 4CDDC 4QUFA 4DR5Q 1BO0A 1RODA 4HIMA 4NB3A 2FFKB 1F9QA 5IYBG 3TDQA 1UEAB 2HDLA 4TVAB 1HR0W 1AN8A 3Q8DA 2F03A 3KDFB 3OHXC 1H9MA 4ZUJA 1B2TA 3DLLA 2K5DA 3RLFA 1HH2P 5FO8B 2WFWA 4FF3A 3T1HL 2SOBA 1QUQA 2HCIA 1SNMA 3GO5A 3GTMB 5FOBB 1GUNA 3EVQA 2RHSB 4A3JH 1B9NA 1Q8IA 4G4KA 1QJOA 2DNCA 1T5EA 3FPUB 1FJGL 3UDGA 4Y7NH 2DJFC 3M4YA 1JE5A 3EJIA 1SR3A 1Y1VH 4YCVA 2EE1A 3T1YL 3FDTA 2C5CA 1NUCA 2A68D 5EPKA 3HOYB 2IJ0A 3J80E 2B39A 1L0WA 4N8FA 1QNUA 4FO2A 4BY1H 3I55A 1QZHA 4JI6L 3DWQA 1VQHA 1PFMA 5BN4A 4DV3L 4L5TA 1C7YA 4HCEA 4GKKQ 2HUGA 4WFN3 3MEFA 5JEAG 3BYTB 5AFWA 1I3QB 4RCNA 2BCOA 1I50B 1GKHA 4PMBA 1L2FA 3HOXB 2E2HH 2NN6I 3PQIA 5IOCA 4F88A 2K5NA 3C46A 3OTOQ 5LL6X 1X65A 1SAPA 2E5LQ 1I4GA 4FXGC 3S1QB 1X54A 4RMFA 1QOHA 4DV6Q 3M3YH 3DHQA 3A7AB 2CQOA 4B3RL 1O7IA 4DV3Q 2EXDA 3A5ZB 3M3YB 4QCLA 3GTMH 2EY5A 3NTIA 4LFCL 2VUMG 2ZJRA 3A8JE 2YU9H 2HQEA 4LF9Q 1RDPD 3VR4A 1SDFA 1EY6A 1CKNA 1VQDA 2Q2TA 4DK3C 2RA4A 2CH4A 4PNYA 3KJPA 3UDIA 4O2DA 1R4QB 3K0XA 2VB2X 1J9OA 1PA6A 3KBXA 2R93H 1EFID 3FMCA 3I72A 4DAYB 4KY7A 4MTKA 3H3VH 2RF4A 2QA4A 2F3IA 2DN8A 1UWVA 1U4PA 3NWTA 4RWSC 3CCSA 1G6ZA 2AQ3B 1S72A 2KBNA 3FKIH 3PUVA 2JK8A 1VQ5A 5C0XI 4GN3B 3HOWG 4O0AA 4HR7B 3E0JA 4MHEA 1GD7A 1I6VC 1GUOA 1ICWA 1TWAH 1C0AA 3HOUG 4DV5Q 3HOVG 1L0XB 4XTCS 4A3CH 4QIWE 4JI4Q 2MP1A 3IRBA 1BVSA 1DXMA 1D8LA 4L6TB 1IKLA 1QVGA 1UE6A 4M8AA 1LO5D 4PMWA 4DXFA 4V190 5LMNW 2F0NA 3RNUA 2K32A 4OX9L 2PZWA 1CHQD 3MXPA 2KENA 2B2UC 3HOUH 5C44B 3I4NB 1YHQA 1HNXL 5CC4A 3CCMA 4DV5L 4GOPB 5BN3A 4RH6A 4GNXC 1EQQA 2R7ZG 3STBC 4JOIC 1IYJB 2B63B 3C1FA 4EQ5A 1WD1A 4RG1A 3M4OB 2AHOB 1TXYA 3DWAA 4PG3A 2KCNA 4DXGA 4YWLA 5GAGC 2O5JC 4C1NK 1AFPA 2YTYA 1A3UA 2CFMA 4QL5A 2Z8LA 4UP7A 3J81E 2UUAQ 1LTTD 2EYOA 2BOSA 5ELDA 3K58A 2BDOA 3OWFA 3G4SA 4C3HG 4CJ1B 5IWAL 5CBAE 1IXRA 4HN7A 1PYBA 1F9SA 1NSNS 5C3EH 2WKCA 1E22A 5E7NA 4DV1L 3S1RB 5CV5A 1PH9A 2JA7B 4A3BH 3M7NA 3S1NB 4R4QA 2UUAL 4CKEA 4A3EG 1Z9FA 5CGKA 2PQAA 5EBDA 5M3FG 3ONAB 4NDXA 4OX9Q 4DK1A 2AQ1B 1XNRL 1SEBD 1LTAD 5CV8A 5IGCA 4A3IH 3TP6A 1DJRD 1X3PA 4RGNA 1H9SA 4NW2A 5I2YA 2ZXRA 4JI6Q 1A6XA 4QF4A 1E2ZA 3VYUA 5A2QE 4K0KL 3H0GH 1SSOA 2EPBA 3A8KE 1X9NA 3T53B 3EN2A 2NVQH 2FXQA 4O42A 1L1OC 1PTOC 2WAQG 2AUKA 3PMFA 3ZYYX 2F0SA 2ASBA 1VQAA 4B9XA 3CRLC 5C44G 4KD4A 1H95A 3OPOA 2EQSA 4I65A 5DLQE 1XMQQ 2R93G 3PGZA 2KEDA 1CKNB 4BY1G 3UE0A 4GKJQ 2JA7H 1JOKA 1SYFA 1KAAA 1KQSA 1CKMA 2FINB 5IP9G 3GTGH 2N8NA 2E2IH 4A3KG 5FK9C 4B3TL 2FMMA 3DEPA 5IYCH 1VQJA 1MJEA 2A19A 3R3OA 3R8BA 2XWJB 4JI1Q 1Q81C 1I3QH 4KKUA 2VL6A 4YHHQ 4V0BA 3S1QH 2HDMA 2XRQD 1YHAA 3VR5A 1VQLA 3T56B 2PW7A 3U4ZA 2C9OA 2M9VA 2NTTA 1WTOA 4FF2A 4RHRA 5K5PA 4GNXB 1KDAA 2EY2A 4P72A 2IWHA 1BCPB 1FR3A 5C4ZA 1W2BA 3HGBA 2LMCB 2IW3A 1UE5A 1ENAA 3S2DH 1EZ8A 3HS0C 1GOZA 5FLXc 1EQTA 1QWYA 2QDLA 1SBBB 1K28A 3NTKA 2YU9B 3EBEA 3FP9A 1N36Q 4H44C 1RTNA 3K7AH 2KHSA 4XIGS 1ENFA 3D4RA 3KUPA 4WORA 2F0HA 4HMJA 4AYBE 1HFGA 2I5LX 3U9OA 4B08A 2WP8J 1F2MA 4LF6L 4JVZA 5IY0A 1GHKA 2KHJA 2K75A 5F2DA 2QEXA 1G6PA 1ZEQX 3RZOB 3STBD 3FKIB 3R2TA 3K0YA 2RVLA 5I4DA 1XX8A 2YYZA 4L63B 3HRZC 1NR4A 2RDFA 1ESFA 1A2TA 2PMZB 1YNNC 1JC7A 3I91A 3NXWA 2JA7G 3G71A 3X3NA 5JPMC 4OO1H 3MFYA 2F4IA 2WAQB 3IKJA 4CDFC 4EQPA 2X6LA 1AZQA 2QGQA 4OO1I 1CT1D 3S1RH 2Q2UA 4A3GB 2GA4B 5IYDH 4QIWB 3CRKC 5IGEA 5C0XG 2K4KA 1G2TA 2EXZA 4CBVA 1FJGQ 3KF6A 4A3GH 4P2CB 3TSSA 3VA5A 5IWAQ 2JA5H 3QWNA 1AP0A 4KTAA 4K2LA 3V96A 4ME5A 1STBA 1TWFB 1SROA 3KLSA 3N6RA 1LABA 5E1FA 4C1NI 1AW7A 1S5BD 3MZ5A 5L37A 5DNFA 3G7LA 3NK9A 2VY3A 4YCUA 2I5HA 1I4RA 1WJJA 3A55A 2F52A 2OTJA 2KA7A 2VQFQ 2Z6BA 4ODGA 1XPRA 2ZXOA 2VB3X 2K6AA 3WDNA 5EQ0A 3J81c 1H9SB 1VF7A 1I4HA 1SN8A 1N8RC 2A69C 1EQRA 4PMCA 1M8AA 4A3DG 3VA7A 1AH9A 3GQBA 1SMXA 3HP3A 1EEFD 2J0TD 1X3QA 4S3SA 4Y7NB 3AMUA 1L1OA 1BCPC 1Q46A 5EGTA 2RDHA 1LTGD 3M4OH 5LHY1 4J1MA 2F1MA 4JI2L 2B2TA 5C4XB 3E3XA 4MZ9A 3A54A 3GTKB 1VS0A 5IGFA 3Q24A 3P1HA 3J81j 2UUBQ 1WTVA 2WB1E 2K01A 2DY8A 2X6GA 1GVPA 2OT2A 3D0FA 5C6AA 1HUMA 2JA9A 3ER0A 5KRUA 1EUJA 1YBYA 4X66L 3G48A 4A3EH 2B8GA 1EU4A 1X3GA 4DUYL 4DGZA 1PH1A 3PF4A 5T1IA 5LMNQ 2JSOA 1STEA 4XYOA 4DR5L 2EVBA 4UDUC 1B3AA 3SDZA 1EFWA 1QVCA 3BZDB 2E75C 4G57A 1Q86C 1E1TA 4C3HB 3H6MA 5CV7A 1XMQL 2XVSA 2O2LD 4CJ2C 3EA6A 5D3DA 4DR1Q 1WOCA 1HA5A 4A93G 3HZXA 2L4NA 4R4TA 4FP5D 5J3BA 1PVOA 3TP8A 2VQFL 2JA6H 1IBMQ 5TSSA 2RCNA 4A3FB 2F0JA 1A2UA 2JN4A 3QB3A 4LWCA 1KC8C 4B3TQ 2K7VA 5M3MH 3S1MH 5DAUA 3NEMA 3MAQA 2MPMA 3H91A 1Z6HA 2EY6A 1QE6A 1EOTA 1H9RA 4JBJA 1S40A 2Z6KA 4LFAL 2SNSA 3GV3A 1XTCD 3QOLA 3TRZA 4BBSG 2H4OA 3K81C 3F2BA 1VQMA 1CI3M 1SRUA 2R7ZB 5KNDA 4ZQ3A 2JA6G 4A3MG 1BBXC 1B9MA 2RSNA 2UXBQ 2B2VC 3A56A 2YTVA 1IBML 2IX1A 2VNUD 5K36G 2F0PA 1WD0A 5M5YH 2L11A 1K8MA 1D5ZC 4JOIA 4DF7A 4EQOA 1FD7D 1KDBA 2F0MA 3GTOB 4DV0Q 3MVVA 4ZK9B 1VQBA 3BDCA 1YZ6A 3J80c 5JJZA 1T5XD 5E4XA 2ICIA 2OTLA 1JORA 5A2QL 1N36L 5LMNL 3GTPB 2UUCQ 1LT4D 3TP7A 1G91A 4K6DA 2WIIB 2A6HC 4I7ZC 4DV4L 2PYKA 4YIJA 2B2UA 4P73A 4OL7A 3ND9A 1EY9A 4FF1A 3GDEA 2B2YC 4LF6Q 4FDBA 1WTHA 5KIXA 5C4HA 4IALA 4DA2A 4DR1L 3CCRA 3AU7A 4LFCQ 3DXJC 3RLNA 4DV0L 3MWYW 3W1BA 4H7BA 3PUXA 2K03A 4K5WA 4L8JA 1HNZL 2IT1A 4KHPL 3HKZG 2RSOA 3CW2C 2JA5B 2EYLA 4A93H 4KHZA 5FLXL 3GTLH 4B3ML 1HQMC 2OEOA 4YY3Q 3KF6B 5KYIA 1JWMD 1FGBD 3PF5A 1K3RA 1PXUA 4RFBA 3ERQA 1KIXA 3K80C 1HTPA 2WB1G 2HQLA 2NBFA 2SDFA 3J7ZC 3PIP3 1GUTA 4XQQA 3GTOH 4RAUC 3TZDA 3GTQB 1Y1VG 4KHPQ 5FLMH 5C5LA 3T16A 1XWEA 4XQNA 1NNXA 1YNND 2R6GA 2VUMB 4LUOA 4ZKCB 1MIUA 1Q90A 2R92B 1OO9B 2JA8B 4JI4L 4CDCC 4IN3A 4JBMA 3E0EA 4JI7L 5I9PA 2HT1A 4LF4Q 4WJ3M 3IFTA 1S4ZA 5CV6A 2QEJC 5A35A 3RD4A 5C4XH 1TT2A 5KGUA 4JW0A 1PLFA 2KEEA 2LS01 4KKTA 2FHTA 2I46A 5JEAH 2EYMA 3LX0A 3D3RA 3TS2A 2A6HD 5IT9L 4ZKBB 2E2IB 4DNIA 2PMZE 2QF7A 3K57A 1PH2A 4CGYB 1HNXQ 4HJ9A 4FXKC 3M4QA 5IT9c 2OWOA 1TVXA 1YITA 2ZJQA 1DM0B 2E8GA 1YHBA 5IP7H 5IT9E 4JI0Q 3T4AC 1JWSD 5JPNC 4BY7G 3W3AA 2A69D 1E24A 1HHVA 1S5DD 1RF2D 3F2CA 5LMUQ 2DUDA 1QZGA 2NVXH 1MI2A 4X62L 3DEOA 3GV6A 4IPDA 4AQYL 3I90A 4FXDA 1PTOH 1Q1EA 1BBUA 5J1ZA 1IKMA 2Q2IA 1ML0D 3TP5A 4CJ0B 1PH6A 4JI0L 4HIDA 1SE2A 1LLRD 1PZID 5FO7B 2NZ1D 3VDYA 2N88A 1G2SA 1WTXA 4DN4M 2Z6KC 1ET6A 2B63G 4JI8Q 3SEBA 3E6ZX 4C3IH 1DOLA 4R4OA 5LMUL 2Z4IA 1VQNA 3MXGA 1IBKL 1GJXA 1RL2A 1E2WA 4ZRZA 3SK4A 3U9SA 3GTKH 1FNVA 1EY7A 4X3UA 4X6AH 1HR0Q 3BVMA 3KLRA 3SK8A 2XGTA 4PZ8A 1G51A 3FEWX 3I7FA 1HZAA 4KY6A 4LFAQ 3BDLA 1G291 4N9TA 5H1SE 4JV5L 4C2MB 2WB1B 1X6OA 1C9OA 1NMGA 5IYCG 2IX0A 2L55A 1IL2A 1J5EL 3D4WA 4POFA 4LW1A 4ILWA 1SJED 2PNHA 4HJ7A 4A3BB 4DV2L 1I4QA 4LF7Q 2UXDQ 4QUCA 4RKLA 2K5WA 4C3HH 3JAMc 3S17B 3MXUA 4GOPA 3BDOA 2D0PA 2LXJA 4H0LC 1FL0A 4X62Q 3LGJA 1HA6A 4GOPC 2NN6H 1F2YA 4P75A 3OW7A 3V2TA 4A4IA 3AEVA 4I7AA 2WV6D 2PW5A 3PIPA 5EPJA 1K83B 2J4XA 3ULJA 1YNJD 1HCZA 1O80A 1Y1WH 3CCLA 2BH8A 2HHHQ 2OQKA 4DR3Q 1AEXA 2NN6G 1J5EQ 1A0IA 4JI8L 4ME3A 4HJ5A 1HPCA 2JA6B 4LF7L 3PIOA 4GKJL 3ICEA 1IHZA 1JOQA 1XJVA 4AYBG 3PCOB 4QB4A 5EKKA 3U4VA 4DAVA 4Q0FA 1QNKA 3EIVA 1HNZQ 3I4MG 2OF1A 3H0GB 3WOEA 1HR0L 2EYFA 4DK6C 1QILA 4N9PA 5EKIA 3RZDB 4B3MQ 2DY7A 2CCZA 4JI3L 1X3EA 4YHHL 2JA8H 3CHBD 4FYDA 1EIGA 1WCMH 2ZTEA 5C4JH 3NP8A 3J7AV 1U4MA 2PQAB 3NBHB 2B29A 1F9RA 1CK1A 1JICA 4ZYSA 4F8MA 1N34L 3NWSA 2K1BA 2DNEA 3SK5A 2V4DA 3K59A 4BBRG 1KNAA 4A3MB 5IYBH 5GAEC 4N8X1 3K5MA 3HOWH 1I4PA 2BDNA 3S15H 3SVMA 3DM1A 3ULLA 3QR8A 4RGMA 3FRPB 1SYEA 2LY7A 3HFZB 3PO2B 1P16A 4LUVA 4A3GG 3AB9A 1FNWA 3L3OC 4JI2Q 2PPBC 1TY2A 2E2JH 3N52A 1XXGA 2KCMA 3H94A 2N49A 2UUBL 1S5ED 2ZTDA 4PZ6A 5JOBA 4DR3L 1GUGA 1Y8OB 1PHJA 3S16B 1Z7TA 4B3SL 1RJTA 3AYHB 4UPAA 5CV4A 4BWGB 3DMUA 1QCBD 4DNRB 1OXUA 1TWHH 5HGTA 4A3BG 5EJWA 3I4NG 2B2WC 1SYGA 3J81i 1DCZA 5JEAJ 2F0GA 1LTBD 3A8IE 4K14A 1TY0A 5E3FA 4JI3Q 1HUNA 3NTHA 1QVFA 2LXKA 2CW0D 2XSCA 4XXEA 3CPFA 5FO9B 1EU3A 1V1PB 3UI2A 4K5XA 4B3SQ 1TKWB 2VS1A 3I8ZA 4JG2A 2R7FA 4HCSA 1DONA 5I9OA 2JEAI 1YJ9A 1K3BC 4NXML 1LTID 1WCMG 1Z47A 5JJKA 4BBRB 3I4OA 2A68C 3A5UA 3AFPA 1F2ZA 1QB5D 3NHHA 1JR0D 1SE4A 2RQXA 5I2XA 3BG3A 1XTDA 3S9WA 1WTRA 1O7YA 1XPOA 3CPWA 5T1GA 4JC0A 1LUZA 1PFNA 2F0IA 4U68A 1GXDC 4DU9A 3CXCA 5E4WC 1UAPA 2A5HA 5ELFA 4AQYQ 1T9HA 1BCPD 3J80i 2ZXPA 1K9MC 4JV5Q 2NVTH 3S15B 1MHWC 3DM3A 1KD1C 1RHPA 3S2HH 3I4LA 2QW7A 2NVTB 1PH5A 4JBWA 4TQUS 3HOUB 1STGA 3MXNA 3VR2A 3BS1A 1SE3A 2PZTA 2HD3A 1MSHA 1GHJA 3HEJA 3KJOA 3CU7A 1F77A 3QIAA 1CM9A 1BOSA 1CKOA 1Y69U 1WTQA 4GS3A 1IBKQ 4BY7B 2F0QA 4ZAIA 2NYZD 1R9TB 3CC2A 2KCTA 2JA8G 4X66Q 4R1JA 2A8VA 3K5OA 1CQVA 1ASZA 2H1EA 1F2LA 2EY1A 4YCWA 3KBGA 4OELB 1Y8PB 4M1UB 1I94L 2F0DA 4R8IA 3MEHA 1E2VA 2AMCB 3RMHA 1MJCA 5IYDG 2BE5D 1KDCA 2ATWA 1STAA 4O1NA 4BY1B 1CA5A 4YWKA 3UDXA 1CHPD 2KECA 2PI2A 3I3CA 1NR2A 3BJUA 1W6KA 4OWXB 4NP5A 3NELA 4KD3A 5BR8L 3PO3G 4A3KH 3NBHA 3S14H 3F1ZA 2GVBA 4A3IG 3CP0A 4HEDA 5JVH3 1VQKA 4PQXA 1HFNA 2K05A 1CFMA 1I6HH 1DGSA 2F3VA 5DM73 1EY5A 4H02A 5EBCA 2ICEC 1UUPA 4OHJA 3OMCA 3U58A 3NBIA 3S24A 4KLKA 1HNWQ 1NAPA 1LT5D 2NVXB 1N34Q 3L9AX 3TMEA 2UXBL 2DJGC 2F4VL 3VYRA 1R9TH 5ISRA 2F0OA 3BYYB 2SNMA 3W1GA 4DV7Q 4LF8L 2WINB 1U4RA 2FMCA 3LWEA 1N32Q 3CF5A 2L9HA 3ITPA 3GTQH 5C0XH 1NTGA 1G8ZD 4GNXA 4LF5Q 3CQZH 4A3LH 4QMGA 3M4PA 1VQFA 4J6HA 2ZT9C 1O7ZA 4JPBW 3E5SA 1EY0A 1V8QA 3H3VC 1JJGA 1CZWA 1MSGA 4P74A 3K7AB 1TS2A 2Z4HA 1O7LA 3RR5A 1WCMB 2B2WA 2D5DA 2MNAA 1GO3E 1XYIA 4DR6L 2KVMA 1I5FA 2A6ED 2E74C 1RD9D 1IL8A 2K33A 2KCCA 1NJIC 2IPKD 1STYA 1YNJC 3NQTA 4IUVA 1EYAA 4JYAL 1HQRD 1KLUD 3SE0A 1NMFA 1NE3A 3K8AA 1SYDA 2MUYA 4KMUC 3J7AF 5M5YB 1JB3A 1VQ8A 1SNOA 5J39A 1X3FA 2D9UA 1D2BA 1V1PA 3GTPH 2F0TA 1TS5A 1ILPA 2M2LA 2LKVA 3H0GG 4R4IA 2V1CC 5KNBA 2Q8IB 1WFQA 4CKBA 5C3EB 1AE3A 3ULPA 3A0JA 2JP1A 2PO4A 1OXSC 3HOZG 3S17H 4GZYC 3C3LA 1LTLA 4CDEC 3HOWB 4XYQA 2F4VQ 3S1NH 3KYHC 3P75A 1ZKOA 3PIO3 4A3FH 1S3OA 1L0YB 2FJ2A 1SXTA 3BVZA 5JAVA 4A93B 2F0EA 3OIPA 4GLAC 2KJXA 4XT1B 2NUCA 3TZUA 4GLXA 2G5DA 4ZLTF 3MFGA 5BN5A 2Z0SA 1PMRA 1JCKB 1OXTA 1EWHA 2QKIC 2Q2HA 2JA5G 1JJCB 3TQYA 1A63A 2MGSA 1VQ4A 4DV2Q 4HIKA 2UXDL 3QG1A 4BA1I 3OMGA 1PYSB 2YV5A 5IIFA 1FVIA 3H15A 2PNRC 1DD2A 1VQOA 4OEMB 1WYDA 4ID6A 2MO0A 2K50A 3C1EA 1KHIA 1Y1WG 1IW7D 4KJNA 1EEID 5ELNA 1M90C 4A3JB 4IUQA 3NPPA 2HIXA 1V1OA 1A3TA 5ELBA 1U0LA 1FGUA 2K52A 4KN7C 2L12A 3KFUA 1Y1VB 1EL0A 2HHHL 3H09A 3VYSA 3G6EA 2HIVA 3SR1A 3TEHB 2LFNA 2TSSA 3MHBA 3OSOA 2R92G 3G6JB 1BXTA 1K8GA 2G9DA 1D5XC 4WJWA 2L0CA 5M5XB 3JAME 1M1KC 2XNAC 2AWNA 1U9RA 1MGSA 5EKLA 2ID0A 3B6YA 4RGOS 2QCPX 5AJ3L 4QY7A 1KABA 2D0OA 4MNOA 1I50H 1UE1A 2EYPA 4X3KA 5D65A 4LAAA 4G7OC 4IPCA 2K5VA 2A73B 3CD6A 1ESRA 1TU2B 5LL6S 1I94Q 2E2DC 3CAMA 4B9WA 2VZAA 5I6YA 1D1IA 1H9JA 1D7QA 4L5SA 4EVOA 5G3LF 3MA2B 1U4LA 3F2UA 3GP7A 1Q12A 4MTNA 1EY8A 1TWCH 5AJ3Q 5C0XJ 4DK0A 2CVRA 4HSVA 3NE5B 4J8QA 3CC7A 2AKWB 3O13A 2UUCL 4DR4L 1YJWA 5M3MG 5DEHA 1C4QA 4C3IB 1Q1BA 5IODA 1BR9A 4OWTB 1WTPA 1K8OA 5CV9A 5KNCA 1ZYRD 2Q8RE 3SK6A 3VR3A 3URYA 2X69A 4OIKA 2Z1CA 4MN3A 4DUZL 3H3VI 4LK1C 3HG9A 5ELCA
chains in the Genus database with same CATH topology
1KRTA 4HJ8A 3EIVA 1HNZQ 3I4MG 3SGIA 5FLXc 1HZBA 1HR0L 4DK6C 4A3CG 4OONA 3E9IA 4DR4Q 4B3MQ 2CCZA 5IP9H 3EBEA 3FHWA 4JI3L 2JQOA 1VQGA 4IJHA 4LF9L 2UXCQ 4YY3L 1X3EA 3FP9A 4YHHL 1N36Q 2JA8H 3I2ZA 1V9PA 4C2MH 1WCMH 1TWFH 2ZTEA 5C4JH 4UP9A 5GQOA 4IPGA 1EIYB 3K7AH 3JAMi 2PQAB 3NBHB 1OXVA 2B29A 4GN5A 4XIGS 1SE8A 4APVA 2BH2A 5JJIA 4DV4Q 4AYBE 2DGYA 1N34L 1TWGH 3L7ZC 5ELOA 1ASYA 2UU9L 4LFBL 4NXMQ 2I5LX 3MXNB 4JYAQ 2WP8J 4BA2I 2IHEA 1XMOQ 4LF6L 1CSPA 4BBRG 5IY0A 4DV7L 5IYBH 2KHJA 2K75A 5GAEC 2QEXA 1G6PA 1Y14B 4NXNQ 1YVCA 3HOWH 3STBD 2GVAA 3ERSX 3S15H 3HKZE 4IFDJ 1JT8A 3ULLA 1LYLA 5GROA 1HJPA 3HFZB 2EIFA 4JI5Q 4LF5L 4Y52H 4A3JG 1P16A 2YYZA 1EOVA 4LUVA 1YEZA 4A3GG 1PH7A 1YJNA 2R7ZH 1LM0A 4IO9A 4BBSH 4JI2Q 3CCUA 2E2JH 4EX5A 2KCMA 1MKHA 2A1AA 2N49A 3PSIA 5HGQA 5GADC 2JA7G 2UUBL 2ZTDA 3G71A 4PZ6A 4DR3L 4JV5Q 1VQ7A 4LFBQ 1PHJA 1VQEA 1X56A 2XTIA 2QGQA 3CCVA 4OO1I 4B3SL 1EWIA 2OCEA 1KL9A 3AYHB 4UPAA 3S1RH 1X55A 2Q2UA 5IYDH 5C0XG 2K4KA 4ALPA 4OWWB 3RZDH 2NZHA 3PO3H 1FJGQ 1OXUA 1TWHH 3KF6A 4A3GH 1K73C 4DKAC 1V1QA 5IWAQ 1E3PA 2H5XA 2JA5H 4A3BG 2VQEQ 4UY8C 3I4NG 2N78A 1EYGA 2VUMH 5IP7G 1SLJA 1SROA 3CMEA 3J81i 3I56A 5JEAJ 4DAMA 2JE6I 5FLMG 1EIFA 1NY4A 2AWOA 4JI3Q 1HZ9A 3JC66 2R7DA 1QVFA 2LXKA 4GN4B 4YCUA 2VY3A 2I5HA 4JI7Q 4AH6A 5C3EG 1WJJA 1KRSA 2F52A 2Y0SG 4LF4L 2OTJA 3CPFA 3F2DA 2VQFQ 3TREA 2GN5A 4B3SQ 2VS1A 2ZTCA 4JG2A 1XPRA 4QGUA 2R7FA 5GAHC 3S16H 3OW2A 4A75A 2UU9Q 3J81c 2JEAI 3FKIG 1YJ9A 4NXML 4X65Q 4BXXG 1VQ9A 1WCMG 1SN8A 4IJLA 1Z47A 3CCJA 5C44H 1N8RC 1EQRA 3NENA 4HIOA 4A3DG 5JJKA 1OXXK 3WWVA 1AH9A 3I4OA 4KI0A 4POGA 1SMXA 4DUYQ 3A5UA 4LNQA 3AFPA 1XNQQ 4A3LG 3J7A5 3KLWA 3PUYA 5EAYA 1L1OA 1Q46A 4DR5Q 1XTDA 4HIMA 1JB7A 4NB3A 2K14A 5IYBG 3HOXG 3M4OH 1XPOA 4TVAB 1HR0W 4DR2Q 3Q8DA 3CPWA 3KDFB 4JI2L 4JC0A 2ZJPA 4MZ9A 1LUZA 3DLLA 1VS0A 3RLFA 1HH2P 3J81j 2UUBQ 3K7UC 2WFWA 3CXCA 1JMCA 3T1HL 2WB1E 1GVPA 1QUQA 4AQYQ 1T9HA 3J80i 2BA1A 3D0FA 3GO5A 1K9MC 2JA9A 3ER0A 2CWPA 2NVTH 1EUJA 1YBYA 3DM3A 3G48A 4X66L 4A3EH 2RHSB 3A74A 4A3JH 1KD1C 1X3GA 1A8VA 1CUKA 3S2HH 2VW9A 2BA0A 2K5HA 4DUYL 1PH1A 3I4NH 1PH5A 3PF4A 4JBWA 1FJGL 3UDGA 4TQUS 4PZ7A 4Y7NH 5LMNQ 1JE5A 5IE8A 4DR5L 1SR3A 1Y1VH 4YCVA 1XNRQ 3T1YL 3OYYA 1N33Q 1EFWA 1QVCA 4A3FG 3KJOA 3CC4A 2MO1A 2R92H 3M9BA 1Q86C 1PH8A 1E1TA 1L0WA 1XMQL 3UE1A 1CKOA 3PUWA 3I55A 4GS3A 4DR1Q 1QZHA 1IBKQ 4BY1H 4JI6L 1WOCA 4A93G 1VQHA 4R4TA 5J3BA 1OTCA 1PVOA 3CC2A 2VQFL 4A3MH 2KCTA 3HOVH 2JA6H 4DV3L 1IBMQ 4BBRH 2JA8G 4X66Q 4L5TA 4R1JA 2A8VA 1C7YA 3RLOA 4GKKQ 2RCNA 4L5QA 4B3TQ 4LWCA 1KC8C 1ASZA 4X65L 3MEFA 5M3MH 5JEAG 4R4CA 3S1MH 2WAQE 3NEMA 1GKHA 3RZOH 1L2FA 4YCWA 4YWMA 4JBJA 1S40A 2Z6KA 2ZM6L 2D62A 2E2HH 4LFAL 2NN6I 1XNQL 3UDFA 1I94L 3TRZA 4BBSG 2K5NA 3K81C 3F2BA 1VQMA 3OTOQ 1SRUA 1X65A 1Q7YC 4DR6Q 5M5XH 2E5LQ 2AMCB 2JA6G 4P71A 1X54A 4A3MG 1MJCA 5IYDG 4RMFA 4DV6Q 3M3YH 2ATWA 2CQOA 4B3RL 2KHIA 2UXBQ 2YTVA 1RIPA 3AFQA 4YWKA 3UDXA 1O7IA 4DV3Q 1IBML 2PI2E 2PI2A 2EXDA 3A5ZB 2IX1A 2VNUD 5K36G 3GTMH 3L0OA 5M5YH 3BJUA 4C3JH 4OWXB 4JOIA 3NELA 4LFCL 5BR8L 2ZJRA 2VUMG 3PO3G 2YU9H 4DV0Q 4A3KH 3S14H 1B7YB 1VQBA 3F1ZA 2GVBA 4AIMA 1YZ6A 4LF9Q 2UXCL 2N3SA 3J80c 4A3IG 1CKNA 1VQDA 1VQPA 3CP0A 4DK3C 1VQKA 2Q2TA 3KJPA 4HJAA 2OTLA 3UDIA 3RN2A 4O2DA 4JBKA 3K0XA 5M3FH 4NPSA 1N36L 1DGSA 1K83H 5LMNL 1PA6A 1I6HH 4H02A 1U5KA 2UUCQ 2R93H 4DAYB 2B63H 1J6QA 3U58A 4JI1L 4DV4L 3S24A 3H3VH 1N33L 2RF4A 2QA4A 4KLKA 3U50C 4P73A 4DPGA 2F3IA 1HNWQ 1E7ZA 1UWVA 3CCQA 1N34Q 3GDEA 1XMOL 4LF6Q 2F4VL 2UXBL 5C4XG 2C35B 2L15A 4FDBA 1R9TH 3CCSA 1S72A 3KF8B 4DR1L 3W1GA 2KBNA 3KOJA 4DUZQ 4DV7Q 3FKIH 2ALYB 3CCRA 4LF8L 2JJQA 4BXXH 1K0RA 3PUVA 5BR8Q 4LFCQ 1N32Q 2JK8A 3RLNA 4DV0L 3CF5A 3W1BA 4GN3B 1AE2A 5C0XI 1VQ5A 1VCIA 4O0AA 3PUXA 4JI5L 3HOWG 1HNZL 2IT1A 3GTQH 4KHPL 3HKZG 1NTGA 3CW2C 4GNXA 4LF5Q 3CQZH 5M5WH 4A3LH 1GD7A 3PV0A 4A93H 1TWAH 1C0AA 3I4MH 3M4PA 4KHZA 3HOUG 1VQFA 3D31A 4DV5Q 3HOVG 4XTCS 3GTLH 4DR7L 4A3CH 4QIWE 1CSQA 4B3ML 4JI4Q 3IRBA 2ZM6Q 1BVSA 5HY6A 1D8LA 4YY3Q 4OXPA 1HNWL 1JJGA 3KF6B 1YIJA 4P74A 2NVYH 1QVGA 1VQCA 2ES2A 3RR5A 4WJ4A 1UE6A 2MNAA 1GO3E 4DR6L 1N9WA 4PMWA 3PF5A 1I5FA 1K3RA 1NJIC 5LMNW 3RNUA 1KIXA 1E1OA 1JJ2A 3K80C 2WB1G 2HQLA 2IY5B 3J7ZC 3HOYG 4OX9L 2I0QA 4JYAL 3GTOH 1NMFA 3CCEA 2KENA 4NXNL 3HOUH 1NE3A 1V43A 3K8AA 1Y1VG 4KHPQ 5FLMH 5JJLA 2VQEL 1YHQA 1VQ8A 1HNXL 1X3FA 3ZJYC 2LSSA 2R6GA 3GTPH 4LUOA 3RN5A 1MIUA 1VQ6A 3CCMA 4DV5L 4GOPB 4DR7Q 4JI4L 2Y0SE 1KAWA 3H0GG 3E0EA 1PH3A 4JBMA 4JI7L 3AQQA 4R4IA 2HT1A 4LF4Q 4WJ3M 2V1CC 1WFQA 1AE3A 4GNXC 3ULPA 2OQ0A 3A0JA 1EQQA 3STBC 4JOIC 3W5OA 2R7ZG 1IYJB 1OXSC 4EQ5A 5C4XH 3HOZG 4BY7H 4RG1A 3S17H 2AHOB 1TXYA 3GD7A 2B3GA 1LTLA 4PG3A 5GAGC 4YWLA 1L1OB 4DV1Q 2F4VQ 3S1NH 3TS2A 4OO1G 3KYHC 2YTYA 2CFMA 2PMZE 4QL5A 4UP7A 4DNIA 4A3FH 1PH2A 4A3DH 2UUAQ 1S3OA 3M85A 1HNXQ 4HJ9A 4GLAC 3M4QA 1WI5A 5IT9c 3BU2A 2OWOA 2I5MX 4GLXA 2RHQB 1YITA 2ZJQA 3G4SA 2E8GA 1K8AC 1YHBA 5IP7H 2Z0SA 1IBLL 4QQBX 4JI0Q 5IWAL 1OXTA 3TS0A 1IXRA 1KXLA 2Q2HA 1YI2A 2JA5G 1JJCB 4BY7G 3TQYA 1A63A 4GLVB 1VQ4A 2CWAA 1E24A 1NBWA 1PYBA 4DR2L 4DV2Q 4HIKA 2UXDL 4BA1I 1B70B 1IZ6A 5C3EH 3F2CA 1PYSB 2YV5A 3CMAA 2DUDA 5FJ8H 5LMUQ 1QZGA 1FVIA 3H15A 1E22A 5E7NA 4X62L 1PV4A 3E9HA 3BZCA 2NVXH 1VQOA 3T1HQ 4IPDA 1WYDA 4DV1L 4AQYL 2MO0A 2K50A 1PH9A 1KHIA 1Y1WG 4A3BH 3M7NA 1HZCA 3PO2G 5ELNA 1Q1EA 1M90C 4R4QA 1BBUA 4A3EG 2UUAL 4IFDI 4K0KQ 1Z9FA 2Q2IA 2PQAA 2HIXA 4J15A 5M3FG 1UE7A 4OX9Q 1Q82C 1XNRL 4IPHA 1U0LA 4A3IH 1FGUA 2K52A 1PH6A 4JI0L 3L2PA 3KFUA 4HIDA 3PUZA 2HHHL 3T1YQ 3VDYA 3G6EA 4L5RC 2HIVA 1XPUA 3TEHB 2Z6KC 2B63G 3PO2H 4JI8Q 3HOXH 2R92G 4C3IH 4JI6Q 4R4OA 2MQHA 5LMUL 2JEBI 1K8GA 1VQNA 1Q8KA 1YNXA 1IBKL 1RL2A 1M1KC 2AWNA 4A76A 3GTKH 3HKSA 4K0KL 4IOAA 3H0GH 1VQIA 2ID0A 3B6YA 4X64Q 1A62A 1HR0Q 4X6AH 5AJ3L 1PH4A 4QY7A 1X9NA 2XGTA 4PZ8A 3KDFA 3EN2A 1G51A 1PFSA 2D0OA 4MNOA 2NVQH 3I7FA 1HZAA 1I50H 1UE1A 2FXQA 1G291 4LFAQ 5H1SE 4JV5L 4IPCA 2K5VA 1L1OC 2WAQG 3GTJH 3CD6A 1X6OA 1UEBA 1C9OA 1P8LA 1NMGA 1QUQB 1VQAA 5IYCG 1SFOH 1I94Q 2ASBA 4UP8A 1IBLQ 2IX0A 1B8AA 3CAMA 1IL2A 5C44G 3F8TA 2VZAA 1H95A 2E5LL 2YTXA 2EQSA 1GM5A 1J5EL 4LUZA 4POFA 4IOCA 1D7QA 4LW1A 4DV6L 5DLQE 1BKBA 2MFIA 1XMQQ 2PNHA 3PGZA 4L5SA 4BY1G 1CKNB 2R93G 4HJ7A 4DV2L 2UXDQ 4LF7Q 1Q12A 4C3HH 3JAMc 3UE0A 4GKJQ 4JCVE 4GOPA 2JA7H 2D0PA 2LXJA 4MTNA 1FL0A 4X62Q 3LGJA 4X64L 4GOPC 1KQSA 1TWCH 1CKMA 5AJ3Q 5IP9G 5C0XJ 2N8NA 3GTGH 4GKKL 2E2IH 4A3KG 4B3TL 4P75A 3BZKA 5IYCH 3CC7A 1VQJA 2AKWB 4QJFA 4A4IA 1MJEA 3AEVA 2A19A 2UUCL 4DR4L 3PIPA 1YJWA 4JI1Q 5M3MG 1Q1BA 3ULJA 4OWTB 1Q81C 1I3QH 2NZOA 3HOZH 3CCLA 2VL6A 5FJ8G 1Y1WH 2BH8A 4YHHQ 3HOYH 3S1QH 2HHHQ 2OQKA 4DR3Q 1YHAA 2NN6G 1J5EQ 1BBWA 1VQLA 1A0IA 3U4ZA 4JI8L 4ME3A 4HJ5A 4LF7L 3OTOL 1W3SA 2IHFA 4GNXB 4LF8Q 4P72A 3PIOA 4GKJL 2CKZB 3ICEA 1W2BA 1N32L 4DUZL 1XJVA 3H3VI 4IFDG 4AYBG 1UE5A 4B3RQ 3PCOB 3S2DH 3U4VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KRT A;  4HJ8 A;  3EIV A;  1HNZ Q;  3I4M G;  3SGI A;  5FLX c;  1HZB A;  1HR0 L;  4DK6 C;  4A3C G;  4OON A;  3E9I A;  4DR4 Q;  4B3M Q;  2CCZ A;  5IP9 H;  3EBE A;  3FHW A;  4JI3 L;  2JQO A;  1VQG A;  4IJH A;  4LF9 L;  2UXC Q;  4YY3 L;  1X3E A;  3FP9 A;  4YHH L;  1N36 Q;  2JA8 H;  3I2Z A;  1V9P A;  4C2M H;  1WCM H;  1TWF H;  2ZTE A;  5C4J H;  4UP9 A;  5GQO A;  4IPG A;  1EIY B;  3K7A H;  3JAM i;  2PQA B;  3NBH B;  1OXV A;  2B29 A;  4GN5 A;  4XIG S;  1SE8 A;  4APV A;  2BH2 A;  5JJI A;  4DV4 Q;  4AYB E;  2DGY A;  1N34 L;  1TWG H;  3L7Z C;  5ELO A;  1ASY A;  2UU9 L;  4LFB L;  4NXM Q;  2I5L X;  3MXN B;  4JYA Q;  2WP8 J;  4BA2 I;  2IHE A;  1XMO Q;  4LF6 L;  1CSP A;  4BBR G;  5IY0 A;  4DV7 L;  5IYB H;  2KHJ A;  2K75 A;  5GAE C;  2QEX A;  1G6P A;  1Y14 B;  4NXN Q;  1YVC A;  3HOW H;  3STB D;  2GVA A;  3ERS X;  3S15 H;  3HKZ E;  4IFD J;  1JT8 A;  3ULL A;  1LYL A;  5GRO A;  1HJP A;  3HFZ B;  2EIF A;  4JI5 Q;  4LF5 L;  4Y52 H;  4A3J G;  1P16 A;  2YYZ A;  1EOV A;  4LUV A;  1YEZ A;  4A3G G;  1PH7 A;  1YJN A;  2R7Z H;  1LM0 A;  4IO9 A;  4BBS H;  4JI2 Q;  3CCU A;  2E2J H;  4EX5 A;  2KCM A;  1MKH A;  2A1A A;  2N49 A;  3PSI A;  5HGQ A;  5GAD C;  2JA7 G;  2UUB L;  2ZTD A;  3G71 A;  4PZ6 A;  4DR3 L;  4JV5 Q;  1VQ7 A;  4LFB Q;  1PHJ A;  1VQE A;  1X56 A;  2XTI A;  2QGQ A;  3CCV A;  4OO1 I;  4B3S L;  1EWI A;  2OCE A;  1KL9 A;  3AYH B;  4UPA A;  3S1R H;  1X55 A;  2Q2U A;  5IYD H;  5C0X G;  2K4K A;  4ALP A;  4OWW B;  3RZD H;  2NZH A;  3PO3 H;  1FJG Q;  1OXU A;  1TWH H;  3KF6 A;  4A3G H;  1K73 C;  4DKA C;  1V1Q A;  5IWA Q;  1E3P A;  2H5X A;  2JA5 H;  4A3B G;  2VQE Q;  4UY8 C;  3I4N G;  2N78 A;  1EYG A;  2VUM H;  5IP7 G;  1SLJ A;  1SRO A;  3CME A;  3J81 i;  3I56 A;  5JEA J;  4DAM A;  2JE6 I;  5FLM G;  1EIF A;  1NY4 A;  2AWO A;  4JI3 Q;  1HZ9 A;  3JC6 6;  2R7D A;  1QVF A;  2LXK A;  4GN4 B;  4YCU A;  2VY3 A;  2I5H A;  4JI7 Q;  4AH6 A;  5C3E G;  1WJJ A;  1KRS A;  2F52 A;  2Y0S G;  4LF4 L;  2OTJ A;  3CPF A;  3F2D A;  2VQF Q;  3TRE A;  2GN5 A;  4B3S Q;  2VS1 A;  2ZTC A;  4JG2 A;  1XPR A;  4QGU A;  2R7F A;  5GAH C;  3S16 H;  3OW2 A;  4A75 A;  2UU9 Q;  3J81 c;  2JEA I;  3FKI G;  1YJ9 A;  4NXM L;  4X65 Q;  4BXX G;  1VQ9 A;  1WCM G;  1SN8 A;  4IJL A;  1Z47 A;  3CCJ A;  5C44 H;  1N8R C;  1EQR A;  3NEN A;  4HIO A;  4A3D G;  5JJK A;  1OXX K;  3WWV A;  1AH9 A;  3I4O A;  4KI0 A;  4POG A;  1SMX A;  4DUY Q;  3A5U A;  4LNQ A;  3AFP A;  1XNQ Q;  4A3L G;  3J7A 5;  3KLW A;  3PUY A;  5EAY A;  1L1O A;  1Q46 A;  4DR5 Q;  1XTD A;  4HIM A;  1JB7 A;  4NB3 A;  2K14 A;  5IYB G;  3HOX G;  3M4O H;  1XPO A;  4TVA B;  1HR0 W;  4DR2 Q;  3Q8D A;  3CPW A;  3KDF B;  4JI2 L;  4JC0 A;  2ZJP A;  4MZ9 A;  1LUZ A;  3DLL A;  1VS0 A;  3RLF A;  1HH2 P;  3J81 j;  2UUB Q;  3K7U C;  2WFW A;  3CXC A;  1JMC A;  3T1H L;  2WB1 E;  1GVP A;  1QUQ A;  4AQY Q;  1T9H A;  3J80 i;  2BA1 A;  3D0F A;  3GO5 A;  1K9M C;  2JA9 A;  3ER0 A;  2CWP A;  2NVT H;  1EUJ A;  1YBY A;  3DM3 A;  3G48 A;  4X66 L;  4A3E H;  2RHS B;  3A74 A;  4A3J H;  1KD1 C;  1X3G A;  1A8V A;  1CUK A;  3S2H H;  2VW9 A;  2BA0 A;  2K5H A;  4DUY L;  1PH1 A;  3I4N H;  1PH5 A;  3PF4 A;  4JBW A;  1FJG L;  3UDG A;  4TQU S;  4PZ7 A;  4Y7N H;  5LMN Q;  1JE5 A;  5IE8 A;  4DR5 L;  1SR3 A;  1Y1V H;  4YCV A;  1XNR Q;  3T1Y L;  3OYY A;  1N33 Q;  1EFW A;  1QVC A;  4A3F G;  3KJO A;  3CC4 A;  2MO1 A;  2R92 H;  3M9B A;  1Q86 C;  1PH8 A;  1E1T A;  1L0W A;  1XMQ L;  3UE1 A;  1CKO A;  3PUW A;  3I55 A;  4GS3 A;  4DR1 Q;  1QZH A;  1IBK Q;  4BY1 H;  4JI6 L;  1WOC A;  4A93 G;  1VQH A;  4R4T A;  5J3B A;  1OTC A;  1PVO A;  3CC2 A;  2VQF L;  4A3M H;  2KCT A;  3HOV H;  2JA6 H;  4DV3 L;  1IBM Q;  4BBR H;  2JA8 G;  4X66 Q;  4L5T A;  4R1J A;  2A8V A;  1C7Y A;  3RLO A;  4GKK Q;  2RCN A;  4L5Q A;  4B3T Q;  4LWC A;  1KC8 C;  1ASZ A;  4X65 L;  3MEF A;  5M3M H;  5JEA G;  4R4C A;  3S1M H;  2WAQ E;  3NEM A;  1GKH A;  3RZO H;  1L2F A;  4YCW A;  4YWM A;  4JBJ A;  1S40 A;  2Z6K A;  2ZM6 L;  2D62 A;  2E2H H;  4LFA L;  2NN6 I;  1XNQ L;  3UDF A;  1I94 L;  3TRZ A;  4BBS G;  2K5N A;  3K81 C;  3F2B A;  1VQM A;  3OTO Q;  1SRU A;  1X65 A;  1Q7Y C;  4DR6 Q;  5M5X H;  2E5L Q;  2AMC B;  2JA6 G;  4P71 A;  1X54 A;  4A3M G;  1MJC A;  5IYD G;  4RMF A;  4DV6 Q;  3M3Y H;  2ATW A;  2CQO A;  4B3R L;  2KHI A;  2UXB Q;  2YTV A;  1RIP A;  3AFQ A;  4YWK A;  3UDX A;  1O7I A;  4DV3 Q;  1IBM L;  2PI2 E;  2PI2 A;  2EXD A;  3A5Z B;  2IX1 A;  2VNU D;  5K36 G;  3GTM H;  3L0O A;  5M5Y H;  3BJU A;  4C3J H;  4OWX B;  4JOI A;  3NEL A;  4LFC L;  5BR8 L;  2ZJR A;  2VUM G;  3PO3 G;  2YU9 H;  4DV0 Q;  4A3K H;  3S14 H;  1B7Y B;  1VQB A;  3F1Z A;  2GVB A;  4AIM A;  1YZ6 A;  4LF9 Q;  2UXC L;  2N3S A;  3J80 c;  4A3I G;  1CKN A;  1VQD A;  1VQP A;  3CP0 A;  4DK3 C;  1VQK A;  2Q2T A;  3KJP A;  4HJA A;  2OTL A;  3UDI A;  3RN2 A;  4O2D A;  4JBK A;  3K0X A;  5M3F H;  4NPS A;  1N36 L;  1DGS A;  1K83 H;  5LMN L;  1PA6 A;  1I6H H;  4H02 A;  1U5K A;  2UUC Q;  2R93 H;  4DAY B;  2B63 H;  1J6Q A;  3U58 A;  4JI1 L;  4DV4 L;  3S24 A;  3H3V H;  1N33 L;  2RF4 A;  2QA4 A;  4KLK A;  3U50 C;  4P73 A;  4DPG A;  2F3I A;  1HNW Q;  1E7Z A;  1UWV A;  3CCQ A;  1N34 Q;  3GDE A;  1XMO L;  4LF6 Q;  2F4V L;  2UXB L;  5C4X G;  2C35 B;  2L15 A;  4FDB A;  1R9T H;  3CCS A;  1S72 A;  3KF8 B;  4DR1 L;  3W1G A;  2KBN A;  3KOJ A;  4DUZ Q;  4DV7 Q;  3FKI H;  2ALY B;  3CCR A;  4LF8 L;  2JJQ A;  4BXX H;  1K0R A;  3PUV A;  5BR8 Q;  4LFC Q;  1N32 Q;  2JK8 A;  3RLN A;  4DV0 L;  3CF5 A;  3W1B A;  4GN3 B;  1AE2 A;  5C0X I;  1VQ5 A;  1VCI A;  4O0A A;  3PUX A;  4JI5 L;  3HOW G;  1HNZ L;  2IT1 A;  3GTQ H;  4KHP L;  3HKZ G;  1NTG A;  3CW2 C;  4GNX A;  4LF5 Q;  3CQZ H;  5M5W H;  4A3L H;  1GD7 A;  3PV0 A;  4A93 H;  1TWA H;  1C0A A;  3I4M H;  3M4P A;  4KHZ A;  3HOU G;  1VQF A;  3D31 A;  4DV5 Q;  3HOV G;  4XTC S;  3GTL H;  4DR7 L;  4A3C H;  4QIW E;  1CSQ A;  4B3M L;  4JI4 Q;  3IRB A;  2ZM6 Q;  1BVS A;  5HY6 A;  1D8L A;  4YY3 Q;  4OXP A;  1HNW L;  1JJG A;  3KF6 B;  1YIJ A;  4P74 A;  2NVY H;  1QVG A;  1VQC A;  2ES2 A;  3RR5 A;  4WJ4 A;  1UE6 A;  2MNA A;  1GO3 E;  4DR6 L;  1N9W A;  4PMW A;  3PF5 A;  1I5F A;  1K3R A;  1NJI C;  5LMN W;  3RNU A;  1KIX A;  1E1O A;  1JJ2 A;  3K80 C;  2WB1 G;  2HQL A;  2IY5 B;  3J7Z C;  3HOY G;  4OX9 L;  2I0Q A;  4JYA L;  3GTO H;  1NMF A;  3CCE A;  2KEN A;  4NXN L;  3HOU H;  1NE3 A;  1V43 A;  3K8A A;  1Y1V G;  4KHP Q;  5FLM H;  5JJL A;  2VQE L;  1YHQ A;  1VQ8 A;  1HNX L;  1X3F A;  3ZJY C;  2LSS A;  2R6G A;  3GTP H;  4LUO A;  3RN5 A;  1MIU A;  1VQ6 A;  3CCM A;  4DV5 L;  4GOP B;  4DR7 Q;  4JI4 L;  2Y0S E;  1KAW A;  3H0G G;  3E0E A;  1PH3 A;  4JBM A;  4JI7 L;  3AQQ A;  4R4I A;  2HT1 A;  4LF4 Q;  4WJ3 M;  2V1C C;  1WFQ A;  1AE3 A;  4GNX C;  3ULP A;  2OQ0 A;  3A0J A;  1EQQ A;  3STB C;  4JOI C;  3W5O A;  2R7Z G;  1IYJ B;  1OXS C;  4EQ5 A;  5C4X H;  3HOZ G;  4BY7 H;  4RG1 A;  3S17 H;  2AHO B;  1TXY A;  3GD7 A;  2B3G A;  1LTL A;  4PG3 A;  5GAG C;  4YWL A;  1L1O B;  4DV1 Q;  2F4V Q;  3S1N H;  3TS2 A;  4OO1 G;  3KYH C;  2YTY A;  2CFM A;  2PMZ E;  4QL5 A;  4UP7 A;  4DNI A;  4A3F H;  1PH2 A;  4A3D H;  2UUA Q;  1S3O A;  3M85 A;  1HNX Q;  4HJ9 A;  4GLA C;  3M4Q A;  1WI5 A;  5IT9 c;  3BU2 A;  2OWO A;  2I5M X;  4GLX A;  2RHQ B;  1YIT A;  2ZJQ A;  3G4S A;  2E8G A;  1K8A C;  1YHB A;  5IP7 H;  2Z0S A;  1IBL L;  4QQB X;  4JI0 Q;  5IWA L;  1OXT A;  3TS0 A;  1IXR A;  1KXL A;  2Q2H A;  1YI2 A;  2JA5 G;  1JJC B;  4BY7 G;  3TQY A;  1A63 A;  4GLV B;  1VQ4 A;  2CWA A;  1E24 A;  1NBW A;  1PYB A;  4DR2 L;  4DV2 Q;  4HIK A;  2UXD L;  4BA1 I;  1B70 B;  1IZ6 A;  5C3E H;  3F2C A;  1PYS B;  2YV5 A;  3CMA A;  2DUD A;  5FJ8 H;  5LMU Q;  1QZG A;  1FVI A;  3H15 A;  1E22 A;  5E7N A;  4X62 L;  1PV4 A;  3E9H A;  3BZC A;  2NVX H;  1VQO A;  3T1H Q;  4IPD A;  1WYD A;  4DV1 L;  4AQY L;  2MO0 A;  2K50 A;  1PH9 A;  1KHI A;  1Y1W G;  4A3B H;  3M7N A;  1HZC A;  3PO2 G;  5ELN A;  1Q1E A;  1M90 C;  4R4Q A;  1BBU A;  4A3E G;  2UUA L;  4IFD I;  4K0K Q;  1Z9F A;  2Q2I A;  2PQA A;  2HIX A;  4J15 A;  5M3F G;  1UE7 A;  4OX9 Q;  1Q82 C;  1XNR L;  4IPH A;  1U0L A;  4A3I H;  1FGU A;  2K52 A;  1PH6 A;  4JI0 L;  3L2P A;  3KFU A;  4HID A;  3PUZ A;  2HHH L;  3T1Y Q;  3VDY A;  3G6E A;  4L5R C;  2HIV A;  1XPU A;  3TEH B;  2Z6K C;  2B63 G;  3PO2 H;  4JI8 Q;  3HOX H;  2R92 G;  4C3I H;  4JI6 Q;  4R4O A;  2MQH A;  5LMU L;  2JEB I;  1K8G A;  1VQN A;  1Q8K A;  1YNX A;  1IBK L;  1RL2 A;  1M1K C;  2AWN A;  4A76 A;  3GTK H;  3HKS A;  4K0K L;  4IOA A;  3H0G H;  1VQI A;  2ID0 A;  3B6Y A;  4X64 Q;  1A62 A;  1HR0 Q;  4X6A H;  5AJ3 L;  1PH4 A;  4QY7 A;  1X9N A;  2XGT A;  4PZ8 A;  3KDF A;  3EN2 A;  1G51 A;  1PFS A;  2D0O A;  4MNO A;  2NVQ H;  3I7F A;  1HZA A;  1I50 H;  1UE1 A;  2FXQ A;  1G29 1;  4LFA Q;  5H1S E;  4JV5 L;  4IPC A;  2K5V A;  1L1O C;  2WAQ G;  3GTJ H;  3CD6 A;  1X6O A;  1UEB A;  1C9O A;  1P8L A;  1NMG A;  1QUQ B;  1VQA A;  5IYC G;  1SFO H;  1I94 Q;  2ASB A;  4UP8 A;  1IBL Q;  2IX0 A;  1B8A A;  3CAM A;  1IL2 A;  5C44 G;  3F8T A;  2VZA A;  1H95 A;  2E5L L;  2YTX A;  2EQS A;  1GM5 A;  1J5E L;  4LUZ A;  4POF A;  4IOC A;  1D7Q A;  4LW1 A;  4DV6 L;  5DLQ E;  1BKB A;  2MFI A;  1XMQ Q;  2PNH A;  3PGZ A;  4L5S A;  4BY1 G;  1CKN B;  2R93 G;  4HJ7 A;  4DV2 L;  2UXD Q;  4LF7 Q;  1Q12 A;  4C3H H;  3JAM c;  3UE0 A;  4GKJ Q;  4JCV E;  4GOP A;  2JA7 H;  2D0P A;  2LXJ A;  4MTN A;  1FL0 A;  4X62 Q;  3LGJ A;  4X64 L;  4GOP C;  1KQS A;  1TWC H;  1CKM A;  5AJ3 Q;  5IP9 G;  5C0X J;  2N8N A;  3GTG H;  4GKK L;  2E2I H;  4A3K G;  4B3T L;  4P75 A;  3BZK A;  5IYC H;  3CC7 A;  1VQJ A;  2AKW B;  4QJF A;  4A4I A;  1MJE A;  3AEV A;  2A19 A;  2UUC L;  4DR4 L;  3PIP A;  1YJW A;  4JI1 Q;  5M3M G;  1Q1B A;  3ULJ A;  4OWT B;  1Q81 C;  1I3Q H;  2NZO A;  3HOZ H;  3CCL A;  2VL6 A;  5FJ8 G;  1Y1W H;  2BH8 A;  4YHH Q;  3HOY H;  3S1Q H;  2HHH Q;  2OQK A;  4DR3 Q;  1YHA A;  2NN6 G;  1J5E Q;  1BBW A;  1VQL A;  1A0I A;  3U4Z A;  4JI8 L;  4ME3 A;  4HJ5 A;  4LF7 L;  3OTO L;  1W3S A;  2IHF A;  4GNX B;  4LF8 Q;  4P72 A;  3PIO A;  4GKJ L;  2CKZ B;  3ICE A;  1W2B A;  1N32 L;  4DUZ L;  1XJV A;  3H3V I;  4IFD G;  4AYB G;  1UE5 A;  4B3R Q;  3PCO B;  3S2D H;  3U4V A; 
#chains in the Genus database with same CATH topology
 4RGT A;  1LTR D;  4HJ8 A;  3QOJ A;  5FKA C;  3SGI A;  4A3C G;  4OON A;  3A7L A;  1TWA B;  5IP9 H;  3VR6 A;  2UXC Q;  4YY3 L;  2QDB A;  1E0B A;  1V9P A;  4C2M H;  5J22 A;  4UP9 A;  4FF4 A;  3I70 A;  4IPG A;  3JAM i;  5G3L D;  4APV A;  1B4O A;  1PRT C;  1Y8N B;  2NB0 A;  3L7Z C;  5ELO A;  4NXM Q;  3MXN B;  4JYA Q;  2B2Y A;  4A3K B;  3S14 B;  2Y0S B;  2IHE A;  1XMO Q;  4DV7 L;  2A74 C;  4CKC A;  5HUR A;  4NXN Q;  3S2D B;  2GVA A;  3ERS X;  1NCV A;  1JT8 A;  1I6H B;  4JK1 C;  4X3T A;  1HJP A;  4LF5 L;  2EIF A;  4JI5 Q;  4Y52 H;  2EDG A;  1PRT D;  3CKI B;  1YJN A;  2R7Z H;  4IO9 A;  3CQZ B;  4BBS H;  4IUN A;  3CCU A;  3R2I A;  2Z9H A;  4C3I G;  4EX5 A;  1MKH A;  2A1A A;  5HGQ A;  5GAD C;  1JE4 A;  4X3S A;  1Y1W B;  2IL8 A;  2RBM A;  3CCV A;  1EWI A;  1KL9 A;  4K5V A;  1X55 A;  2L1B A;  1TS4 A;  1HXY D;  4ALP A;  4OWW B;  1PDQ A;  2KOL A;  5KEE A;  2NZH A;  3RZD H;  4DKA C;  1E3P A;  1JWU D;  4FVM A;  1H9K A;  2CW0 C;  2PQE A;  2N78 A;  4E6I A;  1EYG A;  3CME A;  5C4J B;  2VUM H;  2NVQ B;  1HRJ A;  3TN2 A;  4DAM A;  4RCO A;  1B1Z A;  1EIF A;  5FLM G;  1NY4 A;  2AWO A;  1HZ9 A;  4GN4 B;  2J7Z A;  2ENB A;  4AH6 A;  5C3E G;  1KRS A;  1HTL D;  3F2D A;  4ZUI A;  4KV6 A;  2EJG C;  4HMI A;  3TRE A;  1LAC A;  4CHT B;  4UAI A;  2EJM A;  3OW2 A;  1SYC A;  3FKI G;  4A3E B;  4X65 Q;  4TRD A;  4IJL A;  2K04 A;  1B3Q A;  4UHV A;  1OXX K;  2CQA A;  1PRT F;  4LNQ A;  5CYU A;  1IYV A;  3J7A 5;  1VDZ A;  5EAY A;  5NUC A;  3DWP A;  1JB7 A;  2CH4 W;  2K14 A;  3HOX G;  4C56 C;  4LJZ C;  2K28 A;  4DR2 Q;  2MHV A;  2ZJP A;  5COY A;  3K7U C;  1JMC A;  2F0V A;  1RTO A;  2BA1 A;  2CWP A;  1O78 A;  2D2C C;  3K6O A;  3A74 A;  1A8V A;  1CUK A;  5KYL A;  1ZYR C;  2VW9 A;  2BA0 A;  2K5H A;  3I4N H;  3QO2 A;  4AYB B;  1C48 A;  4PZ7 A;  1TWH B;  5IE8 A;  2EYH A;  1XNR Q;  1CA6 A;  3OYY A;  2EOT A;  1N33 Q;  3I4M B;  1B44 D;  1EQV A;  2F3W A;  4A3F G;  3CC4 A;  2MO1 A;  2R92 H;  3OWE B;  1ZXT A;  1SFO B;  3M9B A;  4IZ8 A;  1PH8 A;  3P7J A;  5K36 H;  3UE1 A;  3PUW A;  1FYC A;  1TR5 A;  4NMZ A;  4RKB A;  1OTC A;  4RA8 A;  4A3M H;  1CQF A;  3HOV H;  1Q3L A;  4BBR H;  5ELE A;  3GTG B;  3RLO A;  1TII D;  4L5Q A;  4X65 L;  5I6W A;  4R4C A;  3D8G A;  2WAQ E;  3J7Y W;  1JOO A;  3RZO H;  1SNC A;  4YWM A;  1LT6 D;  2ZM6 L;  4IUP A;  2D62 A;  1DZ1 A;  1XNQ L;  3ERO A;  2F0L A;  2XRS D;  3UDF A;  1Q7Y C;  4DR6 Q;  5M5X H;  3X3M A;  4P71 A;  1TS3 A;  4IUU A;  2KHI A;  4PV1 C;  1RIP A;  3AFQ A;  4TKO B;  2PI2 E;  3L0O A;  1KLG D;  3VYT A;  4C3J H;  4ZCK A;  2WKD A;  1PZJ D;  3NSW A;  2F0F A;  3RUZ A;  1B7Y B;  4AIM A;  3WOF A;  4A3D B;  2UXC L;  3IFD A;  2N3S A;  1VQP A;  1D1K A;  2EYJ A;  2JYO A;  4HJA A;  3RN2 A;  4JBK A;  5M3F H;  4NPS A;  1K83 H;  1U5K A;  1MD2 D;  2B63 H;  1J6Q A;  4JI1 L;  1BQQ T;  1VF5 C;  1N33 L;  2E76 C;  3Q22 A;  3U50 C;  4DPG A;  3HKZ B;  3Q0A A;  1E7Z A;  3CCQ A;  1XMO L;  5C4X G;  1TWC B;  1DOM A;  2C35 B;  2L15 A;  3BVG A;  1WTW A;  1I4X A;  3D6W A;  3KF8 B;  5M9O A;  1BDO A;  1CTM A;  1LT3 D;  3KOJ A;  4DUZ Q;  4BXX H;  4F7X A;  2ALY B;  2JJQ A;  1K0R A;  5BR8 Q;  5FLX E;  4K8J A;  3J81 L;  4IOA A;  1AE2 A;  5C5M A;  1VCI A;  4JI5 L;  1WVL A;  1A3V A;  2F0K A;  1PTO F;  1STH A;  2O4X A;  4OGQ C;  5M5W H;  3PV0 A;  3I4M H;  3EQL C;  1D5M C;  3D31 A;  3FPP A;  4DR7 L;  1KTK A;  1CSQ A;  5IGB A;  2ZM6 Q;  2K5Q A;  4KHV A;  5HY6 A;  4OXP A;  1X32 A;  1HNW L;  1YIJ A;  2NVY H;  1DOK A;  1VQC A;  2ES2 A;  4WJ4 A;  1N9W A;  2G9H D;  1QG7 A;  1PTO D;  1PZK D;  2RKS A;  3PO3 B;  1JJ2 A;  1E1O A;  2IY5 B;  3HOY G;  2I0Q A;  4IQZ A;  1F9P A;  4H13 C;  1PFB A;  3CCE A;  2B8F A;  4NXN L;  1V43 A;  3Q6S A;  5JJL A;  2VQE L;  2R61 A;  3ZJY C;  2LSS A;  3RN5 A;  5M3F B;  1VQ6 A;  4DR7 Q;  1MBY A;  2Y0S E;  1KAW A;  1PH3 A;  2WAC A;  3AQQ A;  4IUT A;  3GTL B;  1J8I A;  2XWB B;  1S5F D;  2SEB D;  2OQ0 A;  3W5O A;  5D14 A;  3FVQ A;  4BY7 H;  1ILQ A;  1ICF B;  3EFX D;  3GD7 A;  2B3G A;  1L1O B;  1PTO B;  4LMQ D;  4DV1 Q;  4OO1 G;  1RCV D;  5M3M B;  3S1M B;  4A3D H;  3M85 A;  1TQO A;  3M7G A;  1WI5 A;  3BU2 A;  2I5M X;  2RHQ B;  2NWG A;  1IBL L;  1ONL A;  1K8A C;  4QQB X;  3TS0 A;  1KXL A;  1YI2 A;  1EYD A;  4GLV B;  5C3X A;  3KLS X;  3TBI B;  2CWA A;  1NBW A;  1PYW D;  1SMY C;  5JVG 3;  4DR2 L;  1B70 B;  1IZ6 A;  3CMA A;  4K8I A;  5FJ8 H;  1PV4 A;  3V05 A;  3E9H A;  3BZC A;  5COR A;  3T1H Q;  4KY5 A;  4RHS A;  5EPL A;  1HZC A;  3PO2 G;  4EGV A;  4IFD I;  4K0K Q;  1D6E C;  2A6E C;  1IYU A;  4J15 A;  1UE7 A;  4HAE A;  1Q82 C;  4IFD H;  4IPH A;  4DAP A;  3L2P A;  3OOC A;  3PUZ A;  3R93 A;  3T1Y Q;  1BUV T;  4L5R C;  1B53 A;  1XPU A;  3PO2 H;  3HOZ B;  3HOX H;  2NVY B;  3T51 B;  2E2H B;  2F0W A;  4K6L A;  2MQH A;  2JEB I;  3J80 L;  3Q23 A;  1Q8K A;  1YNX A;  2E2J B;  1UNS A;  3SHL A;  2I07 B;  1W6J A;  5C3W A;  4A76 A;  3HKS A;  1VQI A;  5CBE E;  4X64 Q;  4NKL A;  1A62 A;  2RCF A;  3LNN A;  1PH4 A;  1EZ6 A;  3GTJ B;  1CZG A;  3KDF A;  1PFS A;  3S2H B;  1ENC A;  1SJH D;  3GTJ H;  2EJF C;  3LWU A;  1LTS D;  1UEB A;  1P8L A;  1LV9 A;  1QUQ B;  1SFO H;  1BF4 A;  4BBS B;  2KQ3 A;  4UP8 A;  4DNT B;  1IBL Q;  1B8A A;  1GUS A;  3F8T A;  2E5L L;  2YTX A;  1IW7 C;  1GM5 A;  4LUZ A;  1VMC A;  4IOC A;  1FNU A;  4DV6 L;  1BKB A;  2MFI A;  4XT3 B;  2JXM B;  2PZU A;  1GUW A;  4JCV E;  4R9W A;  4X64 L;  2EZV A;  2CHB D;  1II3 A;  1SMY D;  2HCC A;  3P20 A;  3K5L A;  4GKK L;  3HOV B;  2B2V A;  3BZK A;  4KKS A;  2NTS A;  4QJF A;  1BCP F;  2R93 B;  2N55 A;  2PCF B;  2OXP A;  3KF8 A;  2NZO A;  3HOZ H;  5FJ8 G;  3HOY H;  4XDX A;  5IGD A;  1BBW A;  3IAY A;  3OTO L;  1W3S A;  2IHF A;  5CR3 A;  4LF8 Q;  4DFA A;  5IGG A;  4C3J B;  4XQJ A;  2CKZ B;  2Q8T A;  1N32 L;  1B50 A;  2MJ8 A;  3D6C A;  3OIQ A;  1ET9 A;  4HTH A;  1KNE A;  4IFD G;  4B3R Q;  1DYQ A;  2KUM A;  3MC0 B;  1JQY D;  4WRD A;  4ABN A;  4EQN A;  1KRT A;  3SXH A;  1SNQ A;  2AQ2 B;  4HSP A;  1BNZ A;  2XN9 C;  1HZB A;  3E9I A;  1SNP A;  4DR4 Q;  3D4D A;  4A3I B;  2TMP A;  3FHW A;  2JQO A;  1VQG A;  4IJH A;  4U67 3;  4LF9 L;  3KK7 A;  2P5Z X;  3I2Z A;  1TWF H;  2L5T A;  5GQO A;  1EIY B;  3IL8 A;  1OXV A;  4GN5 A;  3T13 A;  1C8C A;  1SE8 A;  2F0U A;  2XIW A;  2BH2 A;  5JJI A;  4ULL A;  4OIJ A;  3MTS A;  4DV4 Q;  2DGY A;  1TWG H;  1ASY A;  2UU9 L;  4LFB L;  1RKN A;  1SYB A;  4BA2 I;  1CSP A;  1TWG B;  4DAY A;  1K0S A;  1Y14 B;  1YVC A;  1EYC A;  2IX3 A;  3K5N A;  2RDG A;  4K2K A;  4IFD J;  3HKZ E;  4FNF A;  1S5C D;  3QJY A;  1LYL A;  5GRO A;  4A3J G;  5DM6 3;  1EOV A;  5D3I B;  1YEZ A;  4R8N A;  1PH7 A;  1LM0 A;  4IUR A;  4BS9 A;  1AZP A;  3PSI A;  4KN4 C;  4LFB Q;  1VQ7 A;  3C2P A;  5CMD A;  1VQE A;  1X56 A;  2XTI A;  3ND8 A;  1EIH A;  2AUJ D;  2OCE A;  1VMP A;  4KJO A;  2BE5 C;  1M4V A;  4G7H C;  5M5W B;  3PO3 H;  2M00 A;  4TSS A;  1K73 C;  1V1Q A;  2H5X A;  2VQE Q;  2R3Z A;  4UY8 C;  3W2D A;  5IP7 G;  1SLJ A;  3JAM L;  3I56 A;  1STN A;  2O5I C;  1PRT B;  1A15 A;  2JE6 I;  4F87 A;  4Z9C B;  4Q5V A;  3JC6 6;  2R7D A;  4KK7 A;  4JI7 Q;  3NQI A;  1EWC A;  2Y0S G;  4G7Z C;  3DUZ A;  4LF4 L;  2GN5 A;  2ZTC A;  1R4P B;  2QIL A;  4QGU A;  3S16 H;  3NUC A;  5GAH C;  2VXW A;  4A75 A;  2UU9 Q;  4BXX G;  1VQ9 A;  3CCJ A;  5C44 H;  2B2T C;  3NEN A;  4MIU A;  4HIO A;  3WWV A;  1EY4 A;  4KI0 A;  4POG A;  4C3J G;  4DUY Q;  3I73 A;  1XNQ Q;  4A3L G;  1SND A;  3KLW A;  3PUY A;  4CDD C;  4QUF A;  4DR5 Q;  1BO0 A;  1ROD A;  4HIM A;  4NB3 A;  2FFK B;  1F9Q A;  5IYB G;  3TDQ A;  1UEA B;  2HDL A;  4TVA B;  1HR0 W;  1AN8 A;  3Q8D A;  2F03 A;  3KDF B;  3OHX C;  1H9M A;  4ZUJ A;  1B2T A;  3DLL A;  2K5D A;  3RLF A;  1HH2 P;  5FO8 B;  2WFW A;  4FF3 A;  3T1H L;  2SOB A;  1QUQ A;  2HCI A;  1SNM A;  3GO5 A;  3GTM B;  5FOB B;  1GUN A;  3EVQ A;  2RHS B;  4A3J H;  1B9N A;  1Q8I A;  4G4K A;  1QJO A;  2DNC A;  1T5E A;  3FPU B;  1FJG L;  3UDG A;  4Y7N H;  2DJF C;  3M4Y A;  1JE5 A;  3EJI A;  1SR3 A;  1Y1V H;  4YCV A;  2EE1 A;  3T1Y L;  3FDT A;  2C5C A;  1NUC A;  2A68 D;  5EPK A;  3HOY B;  2IJ0 A;  3J80 E;  2B39 A;  1L0W A;  4N8F A;  1QNU A;  4FO2 A;  4BY1 H;  3I55 A;  1QZH A;  4JI6 L;  3DWQ A;  1VQH A;  1PFM A;  5BN4 A;  4DV3 L;  4L5T A;  1C7Y A;  4HCE A;  4GKK Q;  2HUG A;  4WFN 3;  3MEF A;  5JEA G;  3BYT B;  5AFW A;  1I3Q B;  4RCN A;  2BCO A;  1I50 B;  1GKH A;  4PMB A;  1L2F A;  3HOX B;  2E2H H;  2NN6 I;  3PQI A;  5IOC A;  4F88 A;  2K5N A;  3C46 A;  3OTO Q;  5LL6 X;  1X65 A;  1SAP A;  2E5L Q;  1I4G A;  4FXG C;  3S1Q B;  1X54 A;  4RMF A;  1QOH A;  4DV6 Q;  3M3Y H;  3DHQ A;  3A7A B;  2CQO A;  4B3R L;  1O7I A;  4DV3 Q;  2EXD A;  3A5Z B;  3M3Y B;  4QCL A;  3GTM H;  2EY5 A;  3NTI A;  4LFC L;  2VUM G;  2ZJR A;  3A8J E;  2YU9 H;  2HQE A;  4LF9 Q;  1RDP D;  3VR4 A;  1SDF A;  1EY6 A;  1CKN A;  1VQD A;  2Q2T A;  4DK3 C;  2RA4 A;  2CH4 A;  4PNY A;  3KJP A;  3UDI A;  4O2D A;  1R4Q B;  3K0X A;  2VB2 X;  1J9O A;  1PA6 A;  3KBX A;  2R93 H;  1EFI D;  3FMC A;  3I72 A;  4DAY B;  4KY7 A;  4MTK A;  3H3V H;  2RF4 A;  2QA4 A;  2F3I A;  2DN8 A;  1UWV A;  1U4P A;  3NWT A;  4RWS C;  3CCS A;  1G6Z A;  2AQ3 B;  1S72 A;  2KBN A;  3FKI H;  3PUV A;  2JK8 A;  1VQ5 A;  5C0X I;  4GN3 B;  3HOW G;  4O0A A;  4HR7 B;  3E0J A;  4MHE A;  1GD7 A;  1I6V C;  1GUO A;  1ICW A;  1TWA H;  1C0A A;  3HOU G;  4DV5 Q;  3HOV G;  1L0X B;  4XTC S;  4A3C H;  4QIW E;  4JI4 Q;  2MP1 A;  3IRB A;  1BVS A;  1DXM A;  1D8L A;  4L6T B;  1IKL A;  1QVG A;  1UE6 A;  4M8A A;  1LO5 D;  4PMW A;  4DXF A;  4V19 0;  5LMN W;  2F0N A;  3RNU A;  2K32 A;  4OX9 L;  2PZW A;  1CHQ D;  3MXP A;  2KEN A;  2B2U C;  3HOU H;  5C44 B;  3I4N B;  1YHQ A;  1HNX L;  5CC4 A;  3CCM A;  4DV5 L;  4GOP B;  5BN3 A;  4RH6 A;  4GNX C;  1EQQ A;  2R7Z G;  3STB C;  4JOI C;  1IYJ B;  2B63 B;  3C1F A;  4EQ5 A;  1WD1 A;  4RG1 A;  3M4O B;  2AHO B;  1TXY A;  3DWA A;  4PG3 A;  2KCN A;  4DXG A;  4YWL A;  5GAG C;  2O5J C;  4C1N K;  1AFP A;  2YTY A;  1A3U A;  2CFM A;  4QL5 A;  2Z8L A;  4UP7 A;  3J81 E;  2UUA Q;  1LTT D;  2EYO A;  2BOS A;  5ELD A;  3K58 A;  2BDO A;  3OWF A;  3G4S A;  4C3H G;  4CJ1 B;  5IWA L;  5CBA E;  1IXR A;  4HN7 A;  1PYB A;  1F9S A;  1NSN S;  5C3E H;  2WKC A;  1E22 A;  5E7N A;  4DV1 L;  3S1R B;  5CV5 A;  1PH9 A;  2JA7 B;  4A3B H;  3M7N A;  3S1N B;  4R4Q A;  2UUA L;  4CKE A;  4A3E G;  1Z9F A;  5CGK A;  2PQA A;  5EBD A;  5M3F G;  3ONA B;  4NDX A;  4OX9 Q;  4DK1 A;  2AQ1 B;  1XNR L;  1SEB D;  1LTA D;  5CV8 A;  5IGC A;  4A3I H;  3TP6 A;  1DJR D;  1X3P A;  4RGN A;  1H9S A;  4NW2 A;  5I2Y A;  2ZXR A;  4JI6 Q;  1A6X A;  4QF4 A;  1E2Z A;  3VYU A;  5A2Q E;  4K0K L;  3H0G H;  1SSO A;  2EPB A;  3A8K E;  1X9N A;  3T53 B;  3EN2 A;  2NVQ H;  2FXQ A;  4O42 A;  1L1O C;  1PTO C;  2WAQ G;  2AUK A;  3PMF A;  3ZYY X;  2F0S A;  2ASB A;  1VQA A;  4B9X A;  3CRL C;  5C44 G;  4KD4 A;  1H95 A;  3OPO A;  2EQS A;  4I65 A;  5DLQ E;  1XMQ Q;  2R93 G;  3PGZ A;  2KED A;  1CKN B;  4BY1 G;  3UE0 A;  4GKJ Q;  2JA7 H;  1JOK A;  1SYF A;  1KAA A;  1KQS A;  1CKM A;  2FIN B;  5IP9 G;  3GTG H;  2N8N A;  2E2I H;  4A3K G;  5FK9 C;  4B3T L;  2FMM A;  3DEP A;  5IYC H;  1VQJ A;  1MJE A;  2A19 A;  3R3O A;  3R8B A;  2XWJ B;  4JI1 Q;  1Q81 C;  1I3Q H;  4KKU A;  2VL6 A;  4YHH Q;  4V0B A;  3S1Q H;  2HDM A;  2XRQ D;  1YHA A;  3VR5 A;  1VQL A;  3T56 B;  2PW7 A;  3U4Z A;  2C9O A;  2M9V A;  2NTT A;  1WTO A;  4FF2 A;  4RHR A;  5K5P A;  4GNX B;  1KDA A;  2EY2 A;  4P72 A;  2IWH A;  1BCP B;  1FR3 A;  5C4Z A;  1W2B A;  3HGB A;  2LMC B;  2IW3 A;  1UE5 A;  1ENA A;  3S2D H;  1EZ8 A;  3HS0 C;  1GOZ A;  5FLX c;  1EQT A;  1QWY A;  2QDL A;  1SBB B;  1K28 A;  3NTK A;  2YU9 B;  3EBE A;  3FP9 A;  1N36 Q;  4H44 C;  1RTN A;  3K7A H;  2KHS A;  4XIG S;  1ENF A;  3D4R A;  3KUP A;  4WOR A;  2F0H A;  4HMJ A;  4AYB E;  1HFG A;  2I5L X;  3U9O A;  4B08 A;  2WP8 J;  1F2M A;  4LF6 L;  4JVZ A;  5IY0 A;  1GHK A;  2KHJ A;  2K75 A;  5F2D A;  2QEX A;  1G6P A;  1ZEQ X;  3RZO B;  3STB D;  3FKI B;  3R2T A;  3K0Y A;  2RVL A;  5I4D A;  1XX8 A;  2YYZ A;  4L63 B;  3HRZ C;  1NR4 A;  2RDF A;  1ESF A;  1A2T A;  2PMZ B;  1YNN C;  1JC7 A;  3I91 A;  3NXW A;  2JA7 G;  3G71 A;  3X3N A;  5JPM C;  4OO1 H;  3MFY A;  2F4I A;  2WAQ B;  3IKJ A;  4CDF C;  4EQP A;  2X6L A;  1AZQ A;  2QGQ A;  4OO1 I;  1CT1 D;  3S1R H;  2Q2U A;  4A3G B;  2GA4 B;  5IYD H;  4QIW B;  3CRK C;  5IGE A;  5C0X G;  2K4K A;  1G2T A;  2EXZ A;  4CBV A;  1FJG Q;  3KF6 A;  4A3G H;  4P2C B;  3TSS A;  3VA5 A;  5IWA Q;  2JA5 H;  3QWN A;  1AP0 A;  4KTA A;  4K2L A;  3V96 A;  4ME5 A;  1STB A;  1TWF B;  1SRO A;  3KLS A;  3N6R A;  1LAB A;  5E1F A;  4C1N I;  1AW7 A;  1S5B D;  3MZ5 A;  5L37 A;  5DNF A;  3G7L A;  3NK9 A;  2VY3 A;  4YCU A;  2I5H A;  1I4R A;  1WJJ A;  3A55 A;  2F52 A;  2OTJ A;  2KA7 A;  2VQF Q;  2Z6B A;  4ODG A;  1XPR A;  2ZXO A;  2VB3 X;  2K6A A;  3WDN A;  5EQ0 A;  3J81 c;  1H9S B;  1VF7 A;  1I4H A;  1SN8 A;  1N8R C;  2A69 C;  1EQR A;  4PMC A;  1M8A A;  4A3D G;  3VA7 A;  1AH9 A;  3GQB A;  1SMX A;  3HP3 A;  1EEF D;  2J0T D;  1X3Q A;  4S3S A;  4Y7N B;  3AMU A;  1L1O A;  1BCP C;  1Q46 A;  5EGT A;  2RDH A;  1LTG D;  3M4O H;  5LHY 1;  4J1M A;  2F1M A;  4JI2 L;  2B2T A;  5C4X B;  3E3X A;  4MZ9 A;  3A54 A;  3GTK B;  1VS0 A;  5IGF A;  3Q24 A;  3P1H A;  3J81 j;  2UUB Q;  1WTV A;  2WB1 E;  2K01 A;  2DY8 A;  2X6G A;  1GVP A;  2OT2 A;  3D0F A;  5C6A A;  1HUM A;  2JA9 A;  3ER0 A;  5KRU A;  1EUJ A;  1YBY A;  4X66 L;  3G48 A;  4A3E H;  2B8G A;  1EU4 A;  1X3G A;  4DUY L;  4DGZ A;  1PH1 A;  3PF4 A;  5T1I A;  5LMN Q;  2JSO A;  1STE A;  4XYO A;  4DR5 L;  2EVB A;  4UDU C;  1B3A A;  3SDZ A;  1EFW A;  1QVC A;  3BZD B;  2E75 C;  4G57 A;  1Q86 C;  1E1T A;  4C3H B;  3H6M A;  5CV7 A;  1XMQ L;  2XVS A;  2O2L D;  4CJ2 C;  3EA6 A;  5D3D A;  4DR1 Q;  1WOC A;  1HA5 A;  4A93 G;  3HZX A;  2L4N A;  4R4T A;  4FP5 D;  5J3B A;  1PVO A;  3TP8 A;  2VQF L;  2JA6 H;  1IBM Q;  5TSS A;  2RCN A;  4A3F B;  2F0J A;  1A2U A;  2JN4 A;  3QB3 A;  4LWC A;  1KC8 C;  4B3T Q;  2K7V A;  5M3M H;  3S1M H;  5DAU A;  3NEM A;  3MAQ A;  2MPM A;  3H91 A;  1Z6H A;  2EY6 A;  1QE6 A;  1EOT A;  1H9R A;  4JBJ A;  1S40 A;  2Z6K A;  4LFA L;  2SNS A;  3GV3 A;  1XTC D;  3QOL A;  3TRZ A;  4BBS G;  2H4O A;  3K81 C;  3F2B A;  1VQM A;  1CI3 M;  1SRU A;  2R7Z B;  5KND A;  4ZQ3 A;  2JA6 G;  4A3M G;  1BBX C;  1B9M A;  2RSN A;  2UXB Q;  2B2V C;  3A56 A;  2YTV A;  1IBM L;  2IX1 A;  2VNU D;  5K36 G;  2F0P A;  1WD0 A;  5M5Y H;  2L11 A;  1K8M A;  1D5Z C;  4JOI A;  4DF7 A;  4EQO A;  1FD7 D;  1KDB A;  2F0M A;  3GTO B;  4DV0 Q;  3MVV A;  4ZK9 B;  1VQB A;  3BDC A;  1YZ6 A;  3J80 c;  5JJZ A;  1T5X D;  5E4X A;  2ICI A;  2OTL A;  1JOR A;  5A2Q L;  1N36 L;  5LMN L;  3GTP B;  2UUC Q;  1LT4 D;  3TP7 A;  1G91 A;  4K6D A;  2WII B;  2A6H C;  4I7Z C;  4DV4 L;  2PYK A;  4YIJ A;  2B2U A;  4P73 A;  4OL7 A;  3ND9 A;  1EY9 A;  4FF1 A;  3GDE A;  2B2Y C;  4LF6 Q;  4FDB A;  1WTH A;  5KIX A;  5C4H A;  4IAL A;  4DA2 A;  4DR1 L;  3CCR A;  3AU7 A;  4LFC Q;  3DXJ C;  3RLN A;  4DV0 L;  3MWY W;  3W1B A;  4H7B A;  3PUX A;  2K03 A;  4K5W A;  4L8J A;  1HNZ L;  2IT1 A;  4KHP L;  3HKZ G;  2RSO A;  3CW2 C;  2JA5 B;  2EYL A;  4A93 H;  4KHZ A;  5FLX L;  3GTL H;  4B3M L;  1HQM C;  2OEO A;  4YY3 Q;  3KF6 B;  5KYI A;  1JWM D;  1FGB D;  3PF5 A;  1K3R A;  1PXU A;  4RFB A;  3ERQ A;  1KIX A;  3K80 C;  1HTP A;  2WB1 G;  2HQL A;  2NBF A;  2SDF A;  3J7Z C;  3PIP 3;  1GUT A;  4XQQ A;  3GTO H;  4RAU C;  3TZD A;  3GTQ B;  1Y1V G;  4KHP Q;  5FLM H;  5C5L A;  3T16 A;  1XWE A;  4XQN A;  1NNX A;  1YNN D;  2R6G A;  2VUM B;  4LUO A;  4ZKC B;  1MIU A;  1Q90 A;  2R92 B;  1OO9 B;  2JA8 B;  4JI4 L;  4CDC C;  4IN3 A;  4JBM A;  3E0E A;  4JI7 L;  5I9P A;  2HT1 A;  4LF4 Q;  4WJ3 M;  3IFT A;  1S4Z A;  5CV6 A;  2QEJ C;  5A35 A;  3RD4 A;  5C4X H;  1TT2 A;  5KGU A;  4JW0 A;  1PLF A;  2KEE A;  2LS0 1;  4KKT A;  2FHT A;  2I46 A;  5JEA H;  2EYM A;  3LX0 A;  3D3R A;  3TS2 A;  2A6H D;  5IT9 L;  4ZKB B;  2E2I B;  4DNI A;  2PMZ E;  2QF7 A;  3K57 A;  1PH2 A;  4CGY B;  1HNX Q;  4HJ9 A;  4FXK C;  3M4Q A;  5IT9 c;  2OWO A;  1TVX A;  1YIT A;  2ZJQ A;  1DM0 B;  2E8G A;  1YHB A;  5IP7 H;  5IT9 E;  4JI0 Q;  3T4A C;  1JWS D;  5JPN C;  4BY7 G;  3W3A A;  2A69 D;  1E24 A;  1HHV A;  1S5D D;  1RF2 D;  3F2C A;  5LMU Q;  2DUD A;  1QZG A;  2NVX H;  1MI2 A;  4X62 L;  3DEO A;  3GV6 A;  4IPD A;  4AQY L;  3I90 A;  4FXD A;  1PTO H;  1Q1E A;  1BBU A;  5J1Z A;  1IKM A;  2Q2I A;  1ML0 D;  3TP5 A;  4CJ0 B;  1PH6 A;  4JI0 L;  4HID A;  1SE2 A;  1LLR D;  1PZI D;  5FO7 B;  2NZ1 D;  3VDY A;  2N88 A;  1G2S A;  1WTX A;  4DN4 M;  2Z6K C;  1ET6 A;  2B63 G;  4JI8 Q;  3SEB A;  3E6Z X;  4C3I H;  1DOL A;  4R4O A;  5LMU L;  2Z4I A;  1VQN A;  3MXG A;  1IBK L;  1GJX A;  1RL2 A;  1E2W A;  4ZRZ A;  3SK4 A;  3U9S A;  3GTK H;  1FNV A;  1EY7 A;  4X3U A;  4X6A H;  1HR0 Q;  3BVM A;  3KLR A;  3SK8 A;  2XGT A;  4PZ8 A;  1G51 A;  3FEW X;  3I7F A;  1HZA A;  4KY6 A;  4LFA Q;  3BDL A;  1G29 1;  4N9T A;  5H1S E;  4JV5 L;  4C2M B;  2WB1 B;  1X6O A;  1C9O A;  1NMG A;  5IYC G;  2IX0 A;  2L55 A;  1IL2 A;  1J5E L;  3D4W A;  4POF A;  4LW1 A;  4ILW A;  1SJE D;  2PNH A;  4HJ7 A;  4A3B B;  4DV2 L;  1I4Q A;  4LF7 Q;  2UXD Q;  4QUC A;  4RKL A;  2K5W A;  4C3H H;  3JAM c;  3S17 B;  3MXU A;  4GOP A;  3BDO A;  2D0P A;  2LXJ A;  4H0L C;  1FL0 A;  4X62 Q;  3LGJ A;  1HA6 A;  4GOP C;  2NN6 H;  1F2Y A;  4P75 A;  3OW7 A;  3V2T A;  4A4I A;  3AEV A;  4I7A A;  2WV6 D;  2PW5 A;  3PIP A;  5EPJ A;  1K83 B;  2J4X A;  3ULJ A;  1YNJ D;  1HCZ A;  1O80 A;  1Y1W H;  3CCL A;  2BH8 A;  2HHH Q;  2OQK A;  4DR3 Q;  1AEX A;  2NN6 G;  1J5E Q;  1A0I A;  4JI8 L;  4ME3 A;  4HJ5 A;  1HPC A;  2JA6 B;  4LF7 L;  3PIO A;  4GKJ L;  3ICE A;  1IHZ A;  1JOQ A;  1XJV A;  4AYB G;  3PCO B;  4QB4 A;  5EKK A;  3U4V A;  4DAV A;  4Q0F A;  1QNK A;  3EIV A;  1HNZ Q;  3I4M G;  2OF1 A;  3H0G B;  3WOE A;  1HR0 L;  2EYF A;  4DK6 C;  1QIL A;  4N9P A;  5EKI A;  3RZD B;  4B3M Q;  2DY7 A;  2CCZ A;  4JI3 L;  1X3E A;  4YHH L;  2JA8 H;  3CHB D;  4FYD A;  1EIG A;  1WCM H;  2ZTE A;  5C4J H;  3NP8 A;  3J7A V;  1U4M A;  2PQA B;  3NBH B;  2B29 A;  1F9R A;  1CK1 A;  1JIC A;  4ZYS A;  4F8M A;  1N34 L;  3NWS A;  2K1B A;  2DNE A;  3SK5 A;  2V4D A;  3K59 A;  4BBR G;  1KNA A;  4A3M B;  5IYB H;  5GAE C;  4N8X 1;  3K5M A;  3HOW H;  1I4P A;  2BDN A;  3S15 H;  3SVM A;  3DM1 A;  3ULL A;  3QR8 A;  4RGM A;  3FRP B;  1SYE A;  2LY7 A;  3HFZ B;  3PO2 B;  1P16 A;  4LUV A;  4A3G G;  3AB9 A;  1FNW A;  3L3O C;  4JI2 Q;  2PPB C;  1TY2 A;  2E2J H;  3N52 A;  1XXG A;  2KCM A;  3H94 A;  2N49 A;  2UUB L;  1S5E D;  2ZTD A;  4PZ6 A;  5JOB A;  4DR3 L;  1GUG A;  1Y8O B;  1PHJ A;  3S16 B;  1Z7T A;  4B3S L;  1RJT A;  3AYH B;  4UPA A;  5CV4 A;  4BWG B;  3DMU A;  1QCB D;  4DNR B;  1OXU A;  1TWH H;  5HGT A;  4A3B G;  5EJW A;  3I4N G;  2B2W C;  1SYG A;  3J81 i;  1DCZ A;  5JEA J;  2F0G A;  1LTB D;  3A8I E;  4K14 A;  1TY0 A;  5E3F A;  4JI3 Q;  1HUN A;  3NTH A;  1QVF A;  2LXK A;  2CW0 D;  2XSC A;  4XXE A;  3CPF A;  5FO9 B;  1EU3 A;  1V1P B;  3UI2 A;  4K5X A;  4B3S Q;  1TKW B;  2VS1 A;  3I8Z A;  4JG2 A;  2R7F A;  4HCS A;  1DON A;  5I9O A;  2JEA I;  1YJ9 A;  1K3B C;  4NXM L;  1LTI D;  1WCM G;  1Z47 A;  5JJK A;  4BBR B;  3I4O A;  2A68 C;  3A5U A;  3AFP A;  1F2Z A;  1QB5 D;  3NHH A;  1JR0 D;  1SE4 A;  2RQX A;  5I2X A;  3BG3 A;  1XTD A;  3S9W A;  1WTR A;  1O7Y A;  1XPO A;  3CPW A;  5T1G A;  4JC0 A;  1LUZ A;  1PFN A;  2F0I A;  4U68 A;  1GXD C;  4DU9 A;  3CXC A;  5E4W C;  1UAP A;  2A5H A;  5ELF A;  4AQY Q;  1T9H A;  1BCP D;  3J80 i;  2ZXP A;  1K9M C;  4JV5 Q;  2NVT H;  3S15 B;  1MHW C;  3DM3 A;  1KD1 C;  1RHP A;  3S2H H;  3I4L A;  2QW7 A;  2NVT B;  1PH5 A;  4JBW A;  4TQU S;  3HOU B;  1STG A;  3MXN A;  3VR2 A;  3BS1 A;  1SE3 A;  2PZT A;  2HD3 A;  1MSH A;  1GHJ A;  3HEJ A;  3KJO A;  3CU7 A;  1F77 A;  3QIA A;  1CM9 A;  1BOS A;  1CKO A;  1Y69 U;  1WTQ A;  4GS3 A;  1IBK Q;  4BY7 B;  2F0Q A;  4ZAI A;  2NYZ D;  1R9T B;  3CC2 A;  2KCT A;  2JA8 G;  4X66 Q;  4R1J A;  2A8V A;  3K5O A;  1CQV A;  1ASZ A;  2H1E A;  1F2L A;  2EY1 A;  4YCW A;  3KBG A;  4OEL B;  1Y8P B;  4M1U B;  1I94 L;  2F0D A;  4R8I A;  3MEH A;  1E2V A;  2AMC B;  3RMH A;  1MJC A;  5IYD G;  2BE5 D;  1KDC A;  2ATW A;  1STA A;  4O1N A;  4BY1 B;  1CA5 A;  4YWK A;  3UDX A;  1CHP D;  2KEC A;  2PI2 A;  3I3C A;  1NR2 A;  3BJU A;  1W6K A;  4OWX B;  4NP5 A;  3NEL A;  4KD3 A;  5BR8 L;  3PO3 G;  4A3K H;  3NBH A;  3S14 H;  3F1Z A;  2GVB A;  4A3I G;  3CP0 A;  4HED A;  5JVH 3;  1VQK A;  4PQX A;  1HFN A;  2K05 A;  1CFM A;  1I6H H;  1DGS A;  2F3V A;  5DM7 3;  1EY5 A;  4H02 A;  5EBC A;  2ICE C;  1UUP A;  4OHJ A;  3OMC A;  3U58 A;  3NBI A;  3S24 A;  4KLK A;  1HNW Q;  1NAP A;  1LT5 D;  2NVX B;  1N34 Q;  3L9A X;  3TME A;  2UXB L;  2DJG C;  2F4V L;  3VYR A;  1R9T H;  5ISR A;  2F0O A;  3BYY B;  2SNM A;  3W1G A;  4DV7 Q;  4LF8 L;  2WIN B;  1U4R A;  2FMC A;  3LWE A;  1N32 Q;  3CF5 A;  2L9H A;  3ITP A;  3GTQ H;  5C0X H;  1NTG A;  1G8Z D;  4GNX A;  4LF5 Q;  3CQZ H;  4A3L H;  4QMG A;  3M4P A;  1VQF A;  4J6H A;  2ZT9 C;  1O7Z A;  4JPB W;  3E5S A;  1EY0 A;  1V8Q A;  3H3V C;  1JJG A;  1CZW A;  1MSG A;  4P74 A;  3K7A B;  1TS2 A;  2Z4H A;  1O7L A;  3RR5 A;  1WCM B;  2B2W A;  2D5D A;  2MNA A;  1GO3 E;  1XYI A;  4DR6 L;  2KVM A;  1I5F A;  2A6E D;  2E74 C;  1RD9 D;  1IL8 A;  2K33 A;  2KCC A;  1NJI C;  2IPK D;  1STY A;  1YNJ C;  3NQT A;  4IUV A;  1EYA A;  4JYA L;  1HQR D;  1KLU D;  3SE0 A;  1NMF A;  1NE3 A;  3K8A A;  1SYD A;  2MUY A;  4KMU C;  3J7A F;  5M5Y B;  1JB3 A;  1VQ8 A;  1SNO A;  5J39 A;  1X3F A;  2D9U A;  1D2B A;  1V1P A;  3GTP H;  2F0T A;  1TS5 A;  1ILP A;  2M2L A;  2LKV A;  3H0G G;  4R4I A;  2V1C C;  5KNB A;  2Q8I B;  1WFQ A;  4CKB A;  5C3E B;  1AE3 A;  3ULP A;  3A0J A;  2JP1 A;  2PO4 A;  1OXS C;  3HOZ G;  3S17 H;  4GZY C;  3C3L A;  1LTL A;  4CDE C;  3HOW B;  4XYQ A;  2F4V Q;  3S1N H;  3KYH C;  3P75 A;  1ZKO A;  3PIO 3;  4A3F H;  1S3O A;  1L0Y B;  2FJ2 A;  1SXT A;  3BVZ A;  5JAV A;  4A93 B;  2F0E A;  3OIP A;  4GLA C;  2KJX A;  4XT1 B;  2NUC A;  3TZU A;  4GLX A;  2G5D A;  4ZLT F;  3MFG A;  5BN5 A;  2Z0S A;  1PMR A;  1JCK B;  1OXT A;  1EWH A;  2QKI C;  2Q2H A;  2JA5 G;  1JJC B;  3TQY A;  1A63 A;  2MGS A;  1VQ4 A;  4DV2 Q;  4HIK A;  2UXD L;  3QG1 A;  4BA1 I;  3OMG A;  1PYS B;  2YV5 A;  5IIF A;  1FVI A;  3H15 A;  2PNR C;  1DD2 A;  1VQO A;  4OEM B;  1WYD A;  4ID6 A;  2MO0 A;  2K50 A;  3C1E A;  1KHI A;  1Y1W G;  1IW7 D;  4KJN A;  1EEI D;  5ELN A;  1M90 C;  4A3J B;  4IUQ A;  3NPP A;  2HIX A;  1V1O A;  1A3T A;  5ELB A;  1U0L A;  1FGU A;  2K52 A;  4KN7 C;  2L12 A;  3KFU A;  1Y1V B;  1EL0 A;  2HHH L;  3H09 A;  3VYS A;  3G6E A;  2HIV A;  3SR1 A;  3TEH B;  2LFN A;  2TSS A;  3MHB A;  3OSO A;  2R92 G;  3G6J B;  1BXT A;  1K8G A;  2G9D A;  1D5X C;  4WJW A;  2L0C A;  5M5X B;  3JAM E;  1M1K C;  2XNA C;  2AWN A;  1U9R A;  1MGS A;  5EKL A;  2ID0 A;  3B6Y A;  4RGO S;  2QCP X;  5AJ3 L;  4QY7 A;  1KAB A;  2D0O A;  4MNO A;  1I50 H;  1UE1 A;  2EYP A;  4X3K A;  5D65 A;  4LAA A;  4G7O C;  4IPC A;  2K5V A;  2A73 B;  3CD6 A;  1ESR A;  1TU2 B;  5LL6 S;  1I94 Q;  2E2D C;  3CAM A;  4B9W A;  2VZA A;  5I6Y A;  1D1I A;  1H9J A;  1D7Q A;  4L5S A;  4EVO A;  5G3L F;  3MA2 B;  1U4L A;  3F2U A;  3GP7 A;  1Q12 A;  4MTN A;  1EY8 A;  1TWC H;  5AJ3 Q;  5C0X J;  4DK0 A;  2CVR A;  4HSV A;  3NE5 B;  4J8Q A;  3CC7 A;  2AKW B;  3O13 A;  2UUC L;  4DR4 L;  1YJW A;  5M3M G;  5DEH A;  1C4Q A;  4C3I B;  1Q1B A;  5IOD A;  1BR9 A;  4OWT B;  1WTP A;  1K8O A;  5CV9 A;  5KNC A;  1ZYR D;  2Q8R E;  3SK6 A;  3VR3 A;  3URY A;  2X69 A;  4OIK A;  2Z1C A;  4MN3 A;  4DUZ L;  3H3V I;  4LK1 C;  3HG9 A;  5ELC A; 
#chains in the Genus database with same CATH homology
 1KRT A;  4HJ8 A;  3EIV A;  1HNZ Q;  3I4M G;  3SGI A;  5FLX c;  1HZB A;  1HR0 L;  4DK6 C;  4A3C G;  4OON A;  3E9I A;  4DR4 Q;  4B3M Q;  2CCZ A;  5IP9 H;  3EBE A;  3FHW A;  4JI3 L;  2JQO A;  1VQG A;  4IJH A;  4LF9 L;  2UXC Q;  4YY3 L;  1X3E A;  3FP9 A;  4YHH L;  1N36 Q;  2JA8 H;  3I2Z A;  1V9P A;  4C2M H;  1WCM H;  1TWF H;  2ZTE A;  5C4J H;  4UP9 A;  5GQO A;  4IPG A;  1EIY B;  3K7A H;  3JAM i;  2PQA B;  3NBH B;  1OXV A;  2B29 A;  4GN5 A;  4XIG S;  1SE8 A;  4APV A;  2BH2 A;  5JJI A;  4DV4 Q;  4AYB E;  2DGY A;  1N34 L;  1TWG H;  3L7Z C;  5ELO A;  1ASY A;  2UU9 L;  4LFB L;  4NXM Q;  2I5L X;  3MXN B;  4JYA Q;  2WP8 J;  4BA2 I;  2IHE A;  1XMO Q;  4LF6 L;  1CSP A;  4BBR G;  5IY0 A;  4DV7 L;  5IYB H;  2KHJ A;  2K75 A;  5GAE C;  2QEX A;  1G6P A;  1Y14 B;  4NXN Q;  1YVC A;  3HOW H;  3STB D;  2GVA A;  3ERS X;  3S15 H;  3HKZ E;  4IFD J;  1JT8 A;  3ULL A;  1LYL A;  5GRO A;  1HJP A;  3HFZ B;  2EIF A;  4JI5 Q;  4LF5 L;  4Y52 H;  4A3J G;  1P16 A;  2YYZ A;  1EOV A;  4LUV A;  1YEZ A;  4A3G G;  1PH7 A;  1YJN A;  2R7Z H;  1LM0 A;  4IO9 A;  4BBS H;  4JI2 Q;  3CCU A;  2E2J H;  4EX5 A;  2KCM A;  1MKH A;  2A1A A;  2N49 A;  3PSI A;  5HGQ A;  5GAD C;  2JA7 G;  2UUB L;  2ZTD A;  3G71 A;  4PZ6 A;  4DR3 L;  4JV5 Q;  1VQ7 A;  4LFB Q;  1PHJ A;  1VQE A;  1X56 A;  2XTI A;  2QGQ A;  3CCV A;  4OO1 I;  4B3S L;  1EWI A;  2OCE A;  1KL9 A;  3AYH B;  4UPA A;  3S1R H;  1X55 A;  2Q2U A;  5IYD H;  5C0X G;  2K4K A;  4ALP A;  4OWW B;  3RZD H;  2NZH A;  3PO3 H;  1FJG Q;  1OXU A;  1TWH H;  3KF6 A;  4A3G H;  1K73 C;  4DKA C;  1V1Q A;  5IWA Q;  1E3P A;  2H5X A;  2JA5 H;  4A3B G;  2VQE Q;  4UY8 C;  3I4N G;  2N78 A;  1EYG A;  2VUM H;  5IP7 G;  1SLJ A;  1SRO A;  3CME A;  3J81 i;  3I56 A;  5JEA J;  4DAM A;  2JE6 I;  5FLM G;  1EIF A;  1NY4 A;  2AWO A;  4JI3 Q;  1HZ9 A;  3JC6 6;  2R7D A;  1QVF A;  2LXK A;  4GN4 B;  4YCU A;  2VY3 A;  2I5H A;  4JI7 Q;  4AH6 A;  5C3E G;  1WJJ A;  1KRS A;  2F52 A;  2Y0S G;  4LF4 L;  2OTJ A;  3CPF A;  3F2D A;  2VQF Q;  3TRE A;  2GN5 A;  4B3S Q;  2VS1 A;  2ZTC A;  4JG2 A;  1XPR A;  4QGU A;  2R7F A;  5GAH C;  3S16 H;  3OW2 A;  4A75 A;  2UU9 Q;  3J81 c;  2JEA I;  3FKI G;  1YJ9 A;  4NXM L;  4X65 Q;  4BXX G;  1VQ9 A;  1WCM G;  1SN8 A;  4IJL A;  1Z47 A;  3CCJ A;  5C44 H;  1N8R C;  1EQR A;  3NEN A;  4HIO A;  4A3D G;  5JJK A;  1OXX K;  3WWV A;  1AH9 A;  3I4O A;  4KI0 A;  4POG A;  1SMX A;  4DUY Q;  3A5U A;  4LNQ A;  3AFP A;  1XNQ Q;  4A3L G;  3J7A 5;  3KLW A;  3PUY A;  5EAY A;  1L1O A;  1Q46 A;  4DR5 Q;  1XTD A;  4HIM A;  1JB7 A;  4NB3 A;  2K14 A;  5IYB G;  3HOX G;  3M4O H;  1XPO A;  4TVA B;  1HR0 W;  4DR2 Q;  3Q8D A;  3CPW A;  3KDF B;  4JI2 L;  4JC0 A;  2ZJP A;  4MZ9 A;  1LUZ A;  3DLL A;  1VS0 A;  3RLF A;  1HH2 P;  3J81 j;  2UUB Q;  3K7U C;  2WFW A;  3CXC A;  1JMC A;  3T1H L;  2WB1 E;  1GVP A;  1QUQ A;  4AQY Q;  1T9H A;  3J80 i;  2BA1 A;  3D0F A;  3GO5 A;  1K9M C;  2JA9 A;  3ER0 A;  2CWP A;  2NVT H;  1EUJ A;  1YBY A;  3DM3 A;  3G48 A;  4X66 L;  4A3E H;  2RHS B;  3A74 A;  4A3J H;  1KD1 C;  1X3G A;  1A8V A;  1CUK A;  3S2H H;  2VW9 A;  2BA0 A;  2K5H A;  4DUY L;  1PH1 A;  3I4N H;  1PH5 A;  3PF4 A;  4JBW A;  1FJG L;  3UDG A;  4TQU S;  4PZ7 A;  4Y7N H;  5LMN Q;  1JE5 A;  5IE8 A;  4DR5 L;  1SR3 A;  1Y1V H;  4YCV A;  1XNR Q;  3T1Y L;  3OYY A;  1N33 Q;  1EFW A;  1QVC A;  4A3F G;  3KJO A;  3CC4 A;  2MO1 A;  2R92 H;  3M9B A;  1Q86 C;  1PH8 A;  1E1T A;  1L0W A;  1XMQ L;  3UE1 A;  1CKO A;  3PUW A;  3I55 A;  4GS3 A;  4DR1 Q;  1QZH A;  1IBK Q;  4BY1 H;  4JI6 L;  1WOC A;  4A93 G;  1VQH A;  4R4T A;  5J3B A;  1OTC A;  1PVO A;  3CC2 A;  2VQF L;  4A3M H;  2KCT A;  3HOV H;  2JA6 H;  4DV3 L;  1IBM Q;  4BBR H;  2JA8 G;  4X66 Q;  4L5T A;  4R1J A;  2A8V A;  1C7Y A;  3RLO A;  4GKK Q;  2RCN A;  4L5Q A;  4B3T Q;  4LWC A;  1KC8 C;  1ASZ A;  4X65 L;  3MEF A;  5M3M H;  5JEA G;  4R4C A;  3S1M H;  2WAQ E;  3NEM A;  1GKH A;  3RZO H;  1L2F A;  4YCW A;  4YWM A;  4JBJ A;  1S40 A;  2Z6K A;  2ZM6 L;  2D62 A;  2E2H H;  4LFA L;  2NN6 I;  1XNQ L;  3UDF A;  1I94 L;  3TRZ A;  4BBS G;  2K5N A;  3K81 C;  3F2B A;  1VQM A;  3OTO Q;  1SRU A;  1X65 A;  1Q7Y C;  4DR6 Q;  5M5X H;  2E5L Q;  2AMC B;  2JA6 G;  4P71 A;  1X54 A;  4A3M G;  1MJC A;  5IYD G;  4RMF A;  4DV6 Q;  3M3Y H;  2ATW A;  2CQO A;  4B3R L;  2KHI A;  2UXB Q;  2YTV A;  1RIP A;  3AFQ A;  4YWK A;  3UDX A;  1O7I A;  4DV3 Q;  1IBM L;  2PI2 E;  2PI2 A;  2EXD A;  3A5Z B;  2IX1 A;  2VNU D;  5K36 G;  3GTM H;  3L0O A;  5M5Y H;  3BJU A;  4C3J H;  4OWX B;  4JOI A;  3NEL A;  4LFC L;  5BR8 L;  2ZJR A;  2VUM G;  3PO3 G;  2YU9 H;  4DV0 Q;  4A3K H;  3S14 H;  1B7Y B;  1VQB A;  3F1Z A;  2GVB A;  4AIM A;  1YZ6 A;  4LF9 Q;  2UXC L;  2N3S A;  3J80 c;  4A3I G;  1CKN A;  1VQD A;  1VQP A;  3CP0 A;  4DK3 C;  1VQK A;  2Q2T A;  3KJP A;  4HJA A;  2OTL A;  3UDI A;  3RN2 A;  4O2D A;  4JBK A;  3K0X A;  5M3F H;  4NPS A;  1N36 L;  1DGS A;  1K83 H;  5LMN L;  1PA6 A;  1I6H H;  4H02 A;  1U5K A;  2UUC Q;  2R93 H;  4DAY B;  2B63 H;  1J6Q A;  3U58 A;  4JI1 L;  4DV4 L;  3S24 A;  3H3V H;  1N33 L;  2RF4 A;  2QA4 A;  4KLK A;  3U50 C;  4P73 A;  4DPG A;  2F3I A;  1HNW Q;  1E7Z A;  1UWV A;  3CCQ A;  1N34 Q;  3GDE A;  1XMO L;  4LF6 Q;  2F4V L;  2UXB L;  5C4X G;  2C35 B;  2L15 A;  4FDB A;  1R9T H;  3CCS A;  1S72 A;  3KF8 B;  4DR1 L;  3W1G A;  2KBN A;  3KOJ A;  4DUZ Q;  4DV7 Q;  3FKI H;  2ALY B;  3CCR A;  4LF8 L;  2JJQ A;  4BXX H;  1K0R A;  3PUV A;  5BR8 Q;  4LFC Q;  1N32 Q;  2JK8 A;  3RLN A;  4DV0 L;  3CF5 A;  3W1B A;  4GN3 B;  1AE2 A;  5C0X I;  1VQ5 A;  1VCI A;  4O0A A;  3PUX A;  4JI5 L;  3HOW G;  1HNZ L;  2IT1 A;  3GTQ H;  4KHP L;  3HKZ G;  1NTG A;  3CW2 C;  4GNX A;  4LF5 Q;  3CQZ H;  5M5W H;  4A3L H;  1GD7 A;  3PV0 A;  4A93 H;  1TWA H;  1C0A A;  3I4M H;  3M4P A;  4KHZ A;  3HOU G;  1VQF A;  3D31 A;  4DV5 Q;  3HOV G;  4XTC S;  3GTL H;  4DR7 L;  4A3C H;  4QIW E;  1CSQ A;  4B3M L;  4JI4 Q;  3IRB A;  2ZM6 Q;  1BVS A;  5HY6 A;  1D8L A;  4YY3 Q;  4OXP A;  1HNW L;  1JJG A;  3KF6 B;  1YIJ A;  4P74 A;  2NVY H;  1QVG A;  1VQC A;  2ES2 A;  3RR5 A;  4WJ4 A;  1UE6 A;  2MNA A;  1GO3 E;  4DR6 L;  1N9W A;  4PMW A;  3PF5 A;  1I5F A;  1K3R A;  1NJI C;  5LMN W;  3RNU A;  1KIX A;  1E1O A;  1JJ2 A;  3K80 C;  2WB1 G;  2HQL A;  2IY5 B;  3J7Z C;  3HOY G;  4OX9 L;  2I0Q A;  4JYA L;  3GTO H;  1NMF A;  3CCE A;  2KEN A;  4NXN L;  3HOU H;  1NE3 A;  1V43 A;  3K8A A;  1Y1V G;  4KHP Q;  5FLM H;  5JJL A;  2VQE L;  1YHQ A;  1VQ8 A;  1HNX L;  1X3F A;  3ZJY C;  2LSS A;  2R6G A;  3GTP H;  4LUO A;  3RN5 A;  1MIU A;  1VQ6 A;  3CCM A;  4DV5 L;  4GOP B;  4DR7 Q;  4JI4 L;  2Y0S E;  1KAW A;  3H0G G;  3E0E A;  1PH3 A;  4JBM A;  4JI7 L;  3AQQ A;  4R4I A;  2HT1 A;  4LF4 Q;  4WJ3 M;  2V1C C;  1WFQ A;  1AE3 A;  4GNX C;  3ULP A;  2OQ0 A;  3A0J A;  1EQQ A;  3STB C;  4JOI C;  3W5O A;  2R7Z G;  1IYJ B;  1OXS C;  4EQ5 A;  5C4X H;  3HOZ G;  4BY7 H;  4RG1 A;  3S17 H;  2AHO B;  1TXY A;  3GD7 A;  2B3G A;  1LTL A;  4PG3 A;  5GAG C;  4YWL A;  1L1O B;  4DV1 Q;  2F4V Q;  3S1N H;  3TS2 A;  4OO1 G;  3KYH C;  2YTY A;  2CFM A;  2PMZ E;  4QL5 A;  4UP7 A;  4DNI A;  4A3F H;  1PH2 A;  4A3D H;  2UUA Q;  1S3O A;  3M85 A;  1HNX Q;  4HJ9 A;  4GLA C;  3M4Q A;  1WI5 A;  5IT9 c;  3BU2 A;  2OWO A;  2I5M X;  4GLX A;  2RHQ B;  1YIT A;  2ZJQ A;  3G4S A;  2E8G A;  1K8A C;  1YHB A;  5IP7 H;  2Z0S A;  1IBL L;  4QQB X;  4JI0 Q;  5IWA L;  1OXT A;  3TS0 A;  1IXR A;  1KXL A;  2Q2H A;  1YI2 A;  2JA5 G;  1JJC B;  4BY7 G;  3TQY A;  1A63 A;  4GLV B;  1VQ4 A;  2CWA A;  1E24 A;  1NBW A;  1PYB A;  4DR2 L;  4DV2 Q;  4HIK A;  2UXD L;  4BA1 I;  1B70 B;  1IZ6 A;  5C3E H;  3F2C A;  1PYS B;  2YV5 A;  3CMA A;  2DUD A;  5FJ8 H;  5LMU Q;  1QZG A;  1FVI A;  3H15 A;  1E22 A;  5E7N A;  4X62 L;  1PV4 A;  3E9H A;  3BZC A;  2NVX H;  1VQO A;  3T1H Q;  4IPD A;  1WYD A;  4DV1 L;  4AQY L;  2MO0 A;  2K50 A;  1PH9 A;  1KHI A;  1Y1W G;  4A3B H;  3M7N A;  1HZC A;  3PO2 G;  5ELN A;  1Q1E A;  1M90 C;  4R4Q A;  1BBU A;  4A3E G;  2UUA L;  4IFD I;  4K0K Q;  1Z9F A;  2Q2I A;  2PQA A;  2HIX A;  4J15 A;  5M3F G;  1UE7 A;  4OX9 Q;  1Q82 C;  1XNR L;  4IPH A;  1U0L A;  4A3I H;  1FGU A;  2K52 A;  1PH6 A;  4JI0 L;  3L2P A;  3KFU A;  4HID A;  3PUZ A;  2HHH L;  3T1Y Q;  3VDY A;  3G6E A;  4L5R C;  2HIV A;  1XPU A;  3TEH B;  2Z6K C;  2B63 G;  3PO2 H;  4JI8 Q;  3HOX H;  2R92 G;  4C3I H;  4JI6 Q;  4R4O A;  2MQH A;  5LMU L;  2JEB I;  1K8G A;  1VQN A;  1Q8K A;  1YNX A;  1IBK L;  1RL2 A;  1M1K C;  2AWN A;  4A76 A;  3GTK H;  3HKS A;  4K0K L;  4IOA A;  3H0G H;  1VQI A;  2ID0 A;  3B6Y A;  4X64 Q;  1A62 A;  1HR0 Q;  4X6A H;  5AJ3 L;  1PH4 A;  4QY7 A;  1X9N A;  2XGT A;  4PZ8 A;  3KDF A;  3EN2 A;  1G51 A;  1PFS A;  2D0O A;  4MNO A;  2NVQ H;  3I7F A;  1HZA A;  1I50 H;  1UE1 A;  2FXQ A;  1G29 1;  4LFA Q;  5H1S E;  4JV5 L;  4IPC A;  2K5V A;  1L1O C;  2WAQ G;  3GTJ H;  3CD6 A;  1X6O A;  1UEB A;  1C9O A;  1P8L A;  1NMG A;  1QUQ B;  1VQA A;  5IYC G;  1SFO H;  1I94 Q;  2ASB A;  4UP8 A;  1IBL Q;  2IX0 A;  1B8A A;  3CAM A;  1IL2 A;  5C44 G;  3F8T A;  2VZA A;  1H95 A;  2E5L L;  2YTX A;  2EQS A;  1GM5 A;  1J5E L;  4LUZ A;  4POF A;  4IOC A;  1D7Q A;  4LW1 A;  4DV6 L;  5DLQ E;  1BKB A;  2MFI A;  1XMQ Q;  2PNH A;  3PGZ A;  4L5S A;  4BY1 G;  1CKN B;  2R93 G;  4HJ7 A;  4DV2 L;  2UXD Q;  4LF7 Q;  1Q12 A;  4C3H H;  3JAM c;  3UE0 A;  4GKJ Q;  4JCV E;  4GOP A;  2JA7 H;  2D0P A;  2LXJ A;  4MTN A;  1FL0 A;  4X62 Q;  3LGJ A;  4X64 L;  4GOP C;  1KQS A;  1TWC H;  1CKM A;  5AJ3 Q;  5IP9 G;  5C0X J;  2N8N A;  3GTG H;  4GKK L;  2E2I H;  4A3K G;  4B3T L;  4P75 A;  3BZK A;  5IYC H;  3CC7 A;  1VQJ A;  2AKW B;  4QJF A;  4A4I A;  1MJE A;  3AEV A;  2A19 A;  2UUC L;  4DR4 L;  3PIP A;  1YJW A;  4JI1 Q;  5M3M G;  1Q1B A;  3ULJ A;  4OWT B;  1Q81 C;  1I3Q H;  2NZO A;  3HOZ H;  3CCL A;  2VL6 A;  5FJ8 G;  1Y1W H;  2BH8 A;  4YHH Q;  3HOY H;  3S1Q H;  2HHH Q;  2OQK A;  4DR3 Q;  1YHA A;  2NN6 G;  1J5E Q;  1BBW A;  1VQL A;  1A0I A;  3U4Z A;  4JI8 L;  4ME3 A;  4HJ5 A;  4LF7 L;  3OTO L;  1W3S A;  2IHF A;  4GNX B;  4LF8 Q;  4P72 A;  3PIO A;  4GKJ L;  2CKZ B;  3ICE A;  1W2B A;  1N32 L;  4DUZ L;  1XJV A;  3H3V I;  4IFD G;  4AYB G;  1UE5 A;  4B3R Q;  3PCO B;  3S2D H;  3U4V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...