4OWTB

Structural basis of soss1 complex assembly
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
105
structure length
72
Chain Sequence
TFVKDILIFIVLETGVRTCKVADKTGSINISVWDDVGNLIQPGDIIRLLTLYTDLQKIGEFCMVYSEVPNFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrator complex subunit 3
publication title Structural Basis of SOSS1 Complex Assembly and Recognition of ssDNA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 17
structure length 72
sequence length 105
ec nomenclature
pdb deposition date 2014-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01336 tRNA_anti-codon OB-fold nucleic acid binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4owtB00
2QA4A 2LXKA 4DV4L 1AH9A 4TQUS 1I5FA 1X3GA 1S40A 1SMXA 3BZKA 2R7DA 5LMUQ 2EXDA 4IPDA 1KC8C 1NMFA 1OTCA 3J80c 2MNAA 3NENA 1EFWA 2UUCL 5IY0A 3H15A 3HKSA 1VQKA 3GTQH 4IOCA 1KXLA 5HGQA 2ID0A 3GO5A 1OXVA 3TS2A 1V43A 4BA2I 3CCRA 1XPRA 2VZAA 1X9NA 1FJGQ 4JI6Q 4DV6L 3JC66 5IP7G 1YNXA 3CC4A 1HZCA 4LF7L 1HR0L 5IP7H 4IJLA 3T1YQ 4PZ6A 2CCZA 1HNZQ 1QVFA 5E7NA 4A3MG 1IBLQ 2UU9Q 3UE0A 1Q82C 2Z6KC 5ELOA 3PIOA 1VQNA 4DK6C 1JT8A 4A3MH 2VQFL 4A4IA 5J3BA 3CCMA 1MJEA 2IX0A 4DK3C 3RZDH 4PZ7A 3J7ZC 1IBML 5GAGC 1X3FA 2HHHQ 2CFMA 2ES2A 3U4ZA 2F4VL 4X62Q 4OX9Q 4QQBX 1N34Q 1S3OA 1N32L 4GNXA 1HNXQ 4PMWA 3STBD 3RN5A 1Q12A 3ERSX 3PSIA 2DGYA 2AWOA 4GOPA 3M4OH 1YZ6A 4HJ8A 2NVXH 4C3IH 3UE1A 1HNWL 1BBWA 1TWCH 3MEFA 4Y52H 4ALPA 1EUJA 3KJPA 5EAYA 5M5WH 1K8GA 4GKKQ 3RLNA 3K7UC 3L2PA 1YJNA 2VQEL 3CCVA 2Y0SE 2A19A 1IBKL 2MQHA 4LF5Q 4DR1L 5C4XG 4NXML 4LF4L 4YWLA 4LFCQ 4KHPL 3J81c 3TRZA 2K14A 1K8AC 4YWKA 1W3SA 5C4XH 3CF5A 1UE7A 3KF6B 1C9OA 2YTVA 3T1HL 2WAQE 4DV7L 3VDYA 1TWAH 3NEMA 3GTJH 4AQYL 5GADC 2PMZE 4B3MQ 1U0LA 4X66L 3PO2G 1L1OA 2UXCL 4C3JH 1N36L 3S17H 3PO2H 1E24A 1RL2A 1WI5A 2YV5A 4JI8Q 1JB7A 4X65L 3DLLA 4JC0A 4R4QA 4DUZQ 4DV3L 3L0OA 2PI2A 3TS0A 3GTMH 5JJIA 4IPCA 1NE3A 5IYDG 3AEVA 3HOVG 4JCVE 2IHFA 2ZJRA 5IYCG 1VQJA 5IYDH 3F1ZA 2MO0A 4X64Q 1Y1WG 3HOVH 2YTXA 4R4OA 3PUXA 2PQAB 5IYCH 4LF8L 1E3PA 1JJGA 1Y1WH 1GKHA 2EQSA 3S14H 3UDGA 2JEBI 4LFAL 2HIVA 4DR6L 1UE6A 3KOJA 3CCQA 4DR2Q 2YU9H 5IWAL 3I2ZA 2KENA 4JI2Q 1EQRA 1UE5A 1QVGA 1J5EQ 5AJ3L 2E2IH 3CCEA 4DUYQ 1KL9A 5BR8Q 2UUAL 1PH1A 2I5MX 4B3SQ 4JOIC 4HJAA 4APVA 1KHIA 1E1OA 1XTDA 1VQ4A 3TEHB 3WWVA 1I94Q 3GTPH 3I4NG 2PI2E 3CC7A 3K7AH 1VQLA 3CD6A 2NVTH 4B3TQ 1FGUA 5C44G 1N33Q 2EIFA 4KI0A 3CXCA 3I4NH 4JI7Q 1PFSA 4LUOA 2CQOA 5C44H 4UP9A 1Z9FA 4DR7Q 3K0XA 4R4TA 2NVQH 1SFOH 1I6HH 1X3EA 4K0KQ 1YHQA 3KLWA 1JMCA 1FJGL 1IYJB 2R7FA 3GTGH 4DR5Q 3J81i 1YBYA 4XTCS 4NXNQ 1UWVA 3A5UA 2Y0SG 3T1YL 1KRTA 3GD7A 5GROA 2RHQB 1Q8KA 4DR3Q 1HNZL 2JE6I 1IBLL 3ULLA 4DAMA 4A3FG 1KD1C 1AE2A 1X65A 3HKZG 1OXTA 4ME3A 4A3FH 3K81C 3I7FA 4YY3Q 4DV1L 1WCMG 1L1OB 1SRUA 4YHHQ 3E9IA 5M3FG 4LF9Q 2WAQG 3K80C 1P8LA 4P72A 3KFUA 4DPGA 1WCMH 2HHHL 1NMGA 4X62L 1Q7YC 5M3FH 1N34L 2HQLA 4OX9L 1HNXL 1LTLA 1N8RC 1SROA 2IHEA 5HY6A 5H1SE 3S2DH 1VQIA 2IX1A 2BH8A 1HR0W 4KLKA 2R7ZG 1XMOQ 3NBHB 4L5QA 3I4OA 1CUKA 1E1TA 1WFQA 1KQSA 3GTOH 4QL5A 3PO3G 2UXDQ 2BA1A 2R7ZH 3RZOH 3PO3H 4A75A 5C4JH 3IRBA 1CKOA 1EIFA 3PUZA 4A3CG 2B29A 4LUZA 2UUBQ 4GKKL 2Q2HA 1XNRL 4A3CH 2DUDA 3CCSA 2JA5G 4JI3Q 3D0FA 4A3DG 2VNUD 1X55A 4H02A 2XTIA 4LF5L 2JA5H 4DV2Q 3S1RH 3SGIA 4A3DH 4QIWE 4LFCL 1IXRA 2RCNA 1MKHA 2D0OA 3PF4A 5LMNQ 1C0AA 3PV0A 4LWCA 1GO3E 2UUCQ 1Q1BA 2K75A 4MTNA 4RMFA 4DNIA 1YJ9A 1UE1A 4B3ML 3I4MG 3RR5A 4DR4Q 4LF6Q 2Q2IA 3HOZG 1XJVA 5FJ8G 1X54A 5M5XH 3I4MH 4O2DA 1VQEA 3GDEA 3HOZH 5FJ8H 4JI0Q 2Z6KA 2JQOA 4DUZL 3PF5A 4BY7G 1L1OC 4P74A 1GVPA 3HKZE 1PH2A 1CKNA 1VS0A 3M4PA 4BA1I 2ZTDA 2K5HA 4BY7H 2ZJQA 4GKJL 4A3GG 2Z0SA 1VQOA 4OWWB 1EOVA 5IT9c 3S15H 3S1MH 4KHZA 4X64L 2OCEA 4A3GH 2YTYA 4WJ4A 2GVBA 1KIXA 3JAMc 1CKMA 1V1QA 3EIVA 1XPOA 3CMEA 1XNQQ 5C0XJ 1NY4A 2MFIA 3J80i 5FLMG 3ULPA 2H5XA 1TWFH 1PH5A 2JK8A 2WP8J 2LXJA 2N3SA 1QUQA 1KAWA 4LUVA 5GQOA 3RLOA 5FLMH 1PA6A 2N49A 4JI2L 1PVOA 1A63A 1UEBA 1J5EL 1A8VA 3M85A 3BZCA 3LGJA 4DUYL 2ZM6Q 4IJHA 4A3EG 3CCLA 3HOYG 3CCJA 3PUYA 1J6QA 1IL2A 1VQ7A 1WJJA 1C7YA 4JG2A 2FXQA 4AYBE 5IP9G 3E9HA 4GLXA 3U58A 4A3EH 4B3SL 3HOYH 3CQZH 4NB3A 1VQAA 1VQBA 1EWIA 4DV0L 1M90C 5JJLA 5IP9H 2VY3A 1I94L 2CWAA 4AH6A 5K36G 1YEZA 4B3RQ 2R6GA 4B3TL 4UY8C 3G4SA 5M3MG 2VQEQ 1N33L 1CSPA 1VQGA 3KJOA 2Q2TA 1NJIC 2D62A 4UP7A 5JEAJ 4EX5A 5M3MH 4DR7L 3W1BA 2D0PA 1OXXK 2PNHA 4K0KL 1IZ6A 3J81j 2XGTA 3RNUA 2ASBA 2F4VQ 1PH4A 4RG1A 5C0XI 1XMQL 4GNXB 1VQPA 1EIYB 4DR5L 2JA7G 2F52A 3A0JA 4NXNL 3CC2A 2UXBQ 1HZAA 1VQHA 1PV4A 4JI4Q 1DGSA 4DV5Q 2JA7H 2UXDL 4GOPB 4X66Q 4DR3L 4IOAA 1B8AA 1SE8A 1GD7A 2WFWA 1Y14B 1YIJA 2E2JH 5LMUL 1VQCA 1Z47A 3L7ZC 3E0EA 2NZOA 4FDBA 4JI5Q 1ASZA 3D31A 4LF9L 3MXNB 1VQ5A 1VQ9A 1Q1EA 1CSQA 1LYLA 2JJQA 4C3HH 1E22A 2IY5B 4JI6L 1X6OA 4A3IG 2R93G 3G71A 4R1JA 3ULJA 2IT1A 4JI1Q 4A3IH 1I3QH 1HH2P 1SN8A 2R93H 1CKNB 4POFA 4GS3A 1K83H 3FP9A 1T9HA 3CCUA 1RIPA 1OXUA 2KCMA 2UU9L 3F2DA 4LFBQ 3A74A 2AKWB 3BJUA 3EN2A 3PIPA 4LW1A 4JYAQ 4L5RC 1YJWA 4JV5Q 2I5HA 2E8GA 2YYZA 3Q8DA 2JEAI 1VQMA 2VL6A 2N8NA 3I55A 2UUBL 3KDFA 4BBSG 3FHWA 3W5OA 5AJ3Q 1JJ2A 3EBEA 4JI3L 4BBSH 5GAHC 4JBKA 3KF8B 4XIGS 3TQYA 1QUQB 1GM5A 1W2BA 2UUAQ 3KF6A 4GN4B 3S1NH 1O7IA 4DV2L 4OO1G 2WB1G 3OTOQ 2N78A 1PH6A 2LSSA 2E5LQ 2MO1A 1M1KC 1JJCB 1D8LA 1TXYA 1QVCA 5LMNL 2K52A 3H3VI 5ELNA 3M4QA 3HOUG 1Q46A 4O0AA 2F3IA 5LMNW 2ZTEA 4GNXC 1I50H 4P71A 1PH3A 2V1CC 4DKAC 1YVCA 3PUVA 4OXPA 1EYGA 2KHJA 5DLQE 3AYHB 3A5ZB 4IPGA 3HOUH 4DR4L 4LF6L 4GOPC 3UDXA 4AYBG 2VS1A 3UDFA 4WJ3M 3CPWA 2RHSB 2KHIA 4HIDA 1B70B 3UDIA 4J15A 4A3BG 4JI0L 1V9PA 4X6AH 2HT1A 1WYDA 1G51A 4EQ5A 4A3BH 1K73C 3S16H 4P73A 4OWTB 4NPSA 3G6EA 2OWOA 4POGA 2PQAA 3J7A5 4IFDG 2OTLA 4DV4Q 2JA6G 3GTKH 1D7QA 4Y7NH 3CW2C 1LUZA 1VQFA 2JA6H 4BBRG 3HFZB 2BA0A 1PH9A 2B63G 1N9WA 1BVSA 4DV1Q 4A3JG 5C0XG 4TVAB 1EQQA 4BBRH 1Y1VG 1XNQL 2B63H 4R4CA 1U5KA 5M5YH 1YHBA 2CKZB 4A3JH 1Y1VH 2AHOB 3PCOB 4JI8L 4DV6Q 3GTLH 2NN6G 3F8TA 4A3LG 4UPAA 4L5SA 4QGUA 4HJ9A 4LF7Q 2KCTA 2K5NA 1MIUA 1XPUA 1K9MC 1HR0Q 3F2BA 2JA8G 1VQ6A 2ZM6L 1E7ZA 4P75A 1NTGA 4IFDJ 2R92G 3DM3A 1BKBA 1AE3A 2JA8H 3CMAA 1YI2A 3ER0A 3KYHC 3CPFA 3HOXG 4PZ8A 2R92H 1K0RA 3PUWA 3AQQA 4MNOA 2VQFQ 1S72A 4PG3A 4QJFA 2E2HH 4OO1I 3HOXH 1YHAA 1R9TH 3NELA 2C35B 1G291 2I0QA 2WB1E 4B3RL 1IBMQ 1XNRQ 4DR2L 1HJPA 4YCUA 1OXSC 2HIXA 1HZBA 1B7YB 5JEAG 2BH2A 1N32Q 2K4KA 4LNQA 1A62A 3KDFB 4GN5A 1FVIA 1P16A 3AFPA 4JBWA 4DAYB 4A76A 2QEXA 5BR8L 1HNWQ 3CP0A 1KRSA 4JI4L 4BXXG 2UXBL 2RF4A 4DV5L 5GAEC 1WOCA 1Q86C 1PHJA 4BY1G 2A8VA 4GN3B 3M3YH 4BXXH 1K3RA 2ALYB 2K5VA 4AIMA 2GVAA 4BY1H 1LM0A 4IFDI 1TWHH 2ZJPA 4IPHA 4JI7L 2L15A 1IBKQ 5JJKA 4YCWA 1SR3A 4JI5L 4JBJA 1VQDA 1ASYA 3M9BA 4YWMA 3CAMA 4DR1Q 4NXMQ 4UP8A 4LF4Q 2NVYH 3HOWG 4KHPQ 2CWPA 2OQKA 3HOWH 3H3VH 2ATWA 3AFQA 4GKJQ 2VUMG 3I56A 3W1GA 3H0GG 3PGZA 4JI1L 3T1HQ 4DV7Q 3K8AA 2VUMH 4AQYQ 3OYYA 2NN6I 5FLXc 3H0GH 4OWXB 2UXCQ 4YCVA 3RLFA 1SLJA 1N36Q 2NZHA 4JBMA 4LFBL 3ICEA 4JYAL 2AWNA 4JV5L 1BBUA 1X56A 4HJ7A 3B6YA 2Q2UA 4GLVB 4YY3L 4QY7A 4X65Q 2B3GA 1TWGH 2JA9A 4YHHL 2GN5A 3S1QH 3G48A 3FKIG 4L5TA 3ZJYC 5C3EG 4DV3Q 2OTJA 1H95A 5IYBG 3M7NA 4GLAC 2AMCB 1PH7A 3FKIH 5C3EH 1Q81C 3U4VA 5IYBH 4IO9A 2I5LX 1JE5A 3OTOL 2KBNA 1L0WA 2E5LL 2OQ0A 4HIMA 2VW9A 4MZ9A 2A1AA 4HJ5A 2ZTCA 1PYSB 1HZ9A 4DV0Q 1XMOL 1L2FA 4OONA 4LF8Q 1PYBA 3S2HH 4LFAQ 4DR6Q 3STBC 4A3LH 4A93G 2K50A 1G6PA 3JAMi 1MJCA 5IWAQ 1NBWA 4HIKA 3TREA 4A93H 1VCIA 1QZHA 4JOIA 4HIOA 3U50C 1YITA 4R4IA 1QZGA 3S24A 3OW2A 4A3KG 3RN2A 1A0IA 1XMQQ 2QGQA 1FL0A 1VQ8A 4A3KH 3F2CA 1PH8A 3BU2A 4C2MH 5IE8A
chains in the Genus database with same CATH superfamily
2BE5C 2LXKA 5FO9B 4DV4L 4TQUS 3BZKA 2R7DA 2UUCL 3HS0C 3HOXB 3H15A 1R9TB 4TKOB 5CV8A 1VQKA 1U4PA 1CI3M 1ZYRC 1PTOD 1XPRA 1X9NA 1EQTA 3JC66 5IP7G 1B44D 1YNXA 3CC4A 3MTSA 4B08A 1QE6A 3T1YQ 3SHLA 4PZ6A 1LT4D 4WFN3 1HNZQ 2LS01 4DAPA 1BDOA 2UU9Q 1CK1A 3UE0A 3PIOA 2XWJB 3CKIB 4A3MH 1EZ6A 1NAPA 1IBML 3PIP3 1E2VA 2ES2A 3U4ZA 3AB9A 1N34Q 1IKMA 2DJGC 3PQIA 2NVYB 5BN3A 2DGYA 2VXWA 3J80L 4HJ8A 3CRLC 2DNEA 1HNWL 2L11A 1SDFA 1LACA 1UNSA 4Y52H 1EUJA 5M5WH 2E75C 3KBXA 1E0BA 3C1EA 3MXNA 4HEDA 3L2PA 4QUFA 4HN7A 5I2XA 3CCVA 2RSOA 2I07B 1TWGB 3TMEA 2NB0A 4E6IA 2SOBA 4LF4L 4LFCQ 3VA5A 1K8AC 3I8ZA 1W3SA 4YWKA 5C4XH 3CF5A 4K2LA 3D8GA 2VB3X 2YTVA 4TRDA 3VDYA 1LT6D 3S2HB 2IJ0A 2G5DA 3PO2G 3GTPB 2MPMA 2UXCL 4C3JH 3S17H 1RL2A 1TU2B 2YV5A 1B50A 4BWGB 2IL8A 5D3IB 1A3UA 4KN4C 2IHFA 2CW0C 2O5IC 5IYDH 1WTPA 3F1ZA 2MO0A 2KECA 5IYCH 1E3PA 1Y1WH 1GKHA 2WACA 3S14H 5LL6X 4DR6L 3EVQA 4ABNA 3QWNA 2DY8A 3J7YW 4JI2Q 1NCVA 1UE5A 1YNJD 5AJ3L 3CCEA 5IT9L 2KQ3A 1E2WA 1PTOH 4DUYQ 1SBBB 1GUOA 2UUAL 1PZJD 1KABA 3NQIA 4ZKBB 4JOIC 3Q23A 2V4DA 1KHIA 1E1OA 1XTDA 3OOCA 3WWVA 3K58A 2IWHA 1YNND 5C5LA 3T51B 3GTPH 4G7OC 1VQLA 1N33Q 5C4JB 5I2YA 2KJXA 4DR7Q 2NVQH 3N52A 2K1BA 3EQLC 1YHQA 1G6ZA 4DR5Q 1G2SA 2NTSA 1EOTA 2Q8IB 1UWVA 3H91A 2LKVA 2Y0SG 4OIJA 3NUCA 1Q8KA 4DR3Q 3C46A 2JE6I 2QDBA 1IBLL 1F9SA 1TWCB 4P2CB 2O5JC 1S5CD 1AE2A 2HDLA 2VB2X 4DV1L 1WCMG 1OO9B 5M3FG 3NWTA 2HHHL 2A6HD 1Q7YC 1SMYD 4RKBA 4H7BA 1LTLA 1N8RC 5HY6A 1QWYA 1RODA 2R7ZG 1ENAA 1XMOQ 3NE5B 4O42A 2TSSA 4QL5A 3SK5A 3IRBA 4IUPA 4HCEA 5C4JH 1WTXA 4GKKL 1SYFA 5CMDA 2J4XA 2JA5G 4A3DG 2L9HA 4DXGA 4I65A 3L9AX 4DNTB 1DZ1A 3PF4A 2FMCA 5LMNQ 2PW5A 3OW7A 1HTLD 3HOVB 4K5VA 1Y8PB 1JWUD 2QKIC 2PNRC 1O78A 3I4MG 2EYOA 3H6MA 2Q2IA 3HOZG 5A2QE 1X54A 3GV3A 3DEPA 2EY5A 3K5MA 2XN9C 3V05A 4QCLA 2JQOA 1D5ZC 5HGTA 3HZXA 4P74A 1GVPA 3HKZE 2F0OA 2WKCA 4OWWB 1EOVA 1SSOA 4KHZA 4X64L 5CORA 2GVBA 1KIXA 3JAMc 3MAQA 3K7AB 1XNQQ 1B9NA 2NVTB 5C0XJ 3PIO3 2MP1A 4KTAA 3I4NB 1DXMA 4EVOA 1PH5A 2N3SA 3RLOA 3QR8A 1I6HB 1UEBA 1F2YA 2XRSD 4IJHA 3HOYG 3CCJA 2OF1A 1IL2A 4K6DA 1C7YA 1ZXTA 4A3EH 3AMUA 2B2UC 1FNVA 1XTCD 4DV0L 5JJLA 1I94L 1EYAA 5K36G 1KDAA 3E0JA 3G4SA 4A3FB 1CQFA 3RD4A 2Q2TA 3HKZB 1NJIC 1STAA 3N6RA 1GUGA 1XMQL 4GNXB 3S2DB 3A0JA 4NXNL 3CC2A 3W2DA 1HZAA 2FINB 1PV4A 1DGSA 3VR4A 2UXDL 1GD7A 1YIJA 3RZOB 3PO3B 1STHA 1PDQA 1Z47A 5ELDA 3E0EA 2NZOA 5CV4A 3J81E 2D9UA 2RCFA 4LF9L 3DWAA 3OMGA 1CSQA 2WIIB 3R2TA 1II3A 3BVMA 4R1JA 3ULJA 1MBYA 4A3IH 1SN8A 1CKNB 1UUPA 3FP9A 1BNZA 1HHVA 2UU9L 3BJUA 4JYAQ 4LW1A 1SNCA 4HAEA 1YJWA 4JV5Q 2E8GA 5M5XB 5KIXA 4ZLTF 1QILA 3EBEA 1Y8OB 1V1OA 5I6WA 3TQYA 2R3ZA 4GN4B 5FLXL 2WB1G 2N78A 1A3VA 2F0SA 4ZRZA 1CTMA 2E5LQ 4OO1H 4BY7B 2X6LA 1D8LA 2XIWA 1QVCA 1EY0A 2K52A 1RCVD 4RH6A 3S1MB 3U9SA 1Q46A 5LMNW 3NQTA 4GNXC 4A3GB 1PRTD 4P71A 2V1CC 4DKAC 1EYGA 3Q6SA 3A5ZB 4IPGA 4DGZA 4LF6L 1A2TA 1G2TA 2AUKA 2K5QA 3UDXA 3CPWA 2RHSB 1B70B 2A68D 4J15A 2F0HA 4QMGA 1G51A 4EQ5A 4A3BH 1K73C 2OEOA 2EJMA 1L0YB 2JYOA 3T16A 4OWTB 3T4AC 5C4HA 3G6EA 2OTLA 4DV4Q 3CW2C 4IFDH 1VQFA 2B39A 1EYCA 1N9WA 4A3JG 4TVAB 4CDEC 2CKZB 1Y1VH 1UAPA 3GTLH 3F8TA 1BCPB 4QGUA 4HJ9A 1T5XD 2LFNA 1K9MC 3TP6A 1E7ZA 1LTBD 4IFDJ 3DM3A 4NDXA 5I6YA 3CMAA 2CH4A 1BF4A 3J80E 2F0KA 4IUQA 2F0UA 5IGCA 3ER0A 3KYHC 3HOXG 4PZ8A 2R92H 3AQQA 4PG3A 2OT2A 2JXMB 3NELA 1TVXA 2K05A 2I0QA 5CBAE 1IBMQ 4CJ2C 4QIWB 1LTGD 1HZBA 1B7YB 1A62A 4C3HB 5JEAH 4R8IA 3BZDB 4GN5A 5IIFA 1RTOA 1LTTD 3F2UA 4XDXA 1HNWQ 2R93B 1EY8A 4KJNA 4JI4L 3RUZA 1DCZA 1RTNA 4BXXH 5EQ0A 4QF4A 4IUNA 3K0YA 1IHZA 1VQDA 1NNXA 4UP8A 1IYUA 4LF4Q 4BBSB 5LHY1 2G9HD 1CQVA 4RHSA 2CWPA 3FPPA 3H3VH 1ENFA 1K28A 4RFBA 4Q5VA 5FKAC 1BCPC 5CV5A 4JI1L 2Z6BA 4U673 3BG3A 2UXCQ 3RLFA 4JBMA 1F9RA 1SYDA 3ICEA 3HOUB 1IKLA 1Z6HA 2B2UA 1H95A 2OTJA 5IYBG 2B2TA 5IT9E 1W6JA 5C3EH 3BYTB 3QOLA 1L0WA 2OQ0A 1SNDA 2VW9A 1S5ED 4HR7B 4HJ5A 1PYSB 3U9OA 1TQOA 1XMOL 4A3LG 4OONA 1VMCA 4DR6Q 2JA6B 1G6PA 4HIKA 3EJIA 3TREA 2B63B 5M5YB 1I4XA 3OW2A 1ILPA 4IURA 1FL0A 3VYTA 1JOKA 1PH8A 2JA8B 2EY1A 4C3IB 1AH9A 2AQ3B 3M7GA 1I5FA 1X3GA 1Q3LA 3OPOA 1NMFA 3A7AB 1EFWA 4CHTB 3HKSA 5G3LD 4IOCA 1TS2A 2ID0A 4RCOA 1Q8IA 1F2LA 1PXUA 2VZAA 1D5MC 4DV6L 2F03A 1D5XC 4LF7L 2F0FA 4IJLA 1IBLQ 1Q82C 2Z6KC 1TWAB 1VQNA 4A4IA 4G7HC 2IX0A 4BY1B 4ZAIA 4DK3C 4PNYA 3J7ZC 2EOTA 2B2WC 5J22A 2HHHQ 1S3OA 4GNXA 4PMWA 2E74C 3IL8A 3HOWB 3M4OH 3QIAA 1KLUD 1B9MA 4C3IH 3UE1A 1BBWA 4DU9A 3LWUA 3H0GB 3KJPA 1CHPD 1SYCA 5DNFA 2QDLA 4GKKQ 1F77A 1YJNA 3J7AV 2FFKB 2BE5D 1IBKL 2KA7A 4IUVA 5A35A 3S1QB 3Q22A 5J1ZA 3C1FA 3TRZA 1H9SA 3FKIB 1XWEA 1GHJA 1UE7A 3SEBA 1C9OA 1ZYRD 2KEDA 1NR2A 2WAQE 1TWAH 3GTJH 5GADC 3DHQA 2BDOA 1L1OA 2K5WA 3Q0AA 2EYJA 2NZ1D 4JI8Q 3DLLA 4JC0A 2Q8TA 3WOEA 5KYLA 2PI2A 2K7VA 5C6AA 5G3LF 1C8CA 2Q8RE 3HOVG 4A3KB 2ZJRA 1VQJA 1TIID 4X64Q 1JJGA 4GZYC 2JEBI 4LFAL 3CCQA 1TS3A 3KOJA 1LV9A 2KUMA 5KEEA 2YU9H 4KY7A 5IWAL 3SE0A 5C4ZA 1QVGA 2HCCA 1L0XB 1KL9A 5ELCA 2I5MX 4RHRA 1SYGA 1TS5A 1F2MA 1Y8NB 2K33A 1VQ4A 1I94Q 5ELFA 3I4NG 3OIQA 3TZUA 3CD6A 4A3MB 5E4XA 2EIFA 4KI0A 4LAAA 4KD3A 3CXCA 3SK8A 1EQVA 2F3VA 5C44H 4UP9A 1Z9FA 2MGSA 3K0XA 5EKKA 1X3EA 4XQQA 2EY2A 3D4RA 4X3TA 3KLRA 3GTGH 3J81i 3ITPA 4ZUJA 4NXNQ 3A5UA 3SK4A 3GD7A 5GROA 2FJ2A 1JE4A 3W3AA 4M1UB 1RDPD 4DAMA 1GXDC 4A3FG 2RDGA 3HKZG 1R4PB 5M5WB 2RQXA 5JOBA 3K81C 1FNUA 3I7FA 4YY3Q 4I7ZC 5JVH3 2CW0D 1SRUA 2IPKD 2K28A 3E9IA 4YHHQ 4LF9Q 4P72A 3SVMA 1NMGA 4X62L 1UEAB 5H1SE 1SYEA 4L6TB 2JN4A 5FLXE 5C4XB 1VQIA 4HSPA 1HR0W 4KLKA 1Z7TA 3PO3G 1CUKA 1WFQA 3GTOH 1SNQA 3I4LA 2FMMA 4A75A 1NR4A 1E2ZA 5JAVA 1D1KA 4A3CG 3PUZA 4C3JB 2K01A 3S17B 2B29A 2DY7A 4XQNA 3D0FA 1V1PB 4H02A 2XTIA 4LF5L 3S1RH 1IL8A 1X3PA 4FVMA 1C0AA 3PV0A 1K8OA 1STYA 5EGTA 1AZQA 1Q1BA 1LO5D 4RMFA 1YJ9A 1Y1WB 1UE1A 2PW7A 5HURA 3ONAB 3S14B 4LF6Q 5FJ8G 2HDMA 2M2LA 2EVBA 4O2DA 2PZUA 4PMBA 2HD3A 2Z6KA 4DN4M 5E1FA 4K6LA 3PF5A 4NMZA 4BY7G 1PTOB 2B8FA 3M4PA 5T1GA 2K5HA 5IGFA 4A3GG 1VQOA 2B2WA 4K5WA 3S15H 2YTYA 2WINB 1V1QA 1XPOA 2MFIA 3J80i 5FLMG 2WP8J 2LXJA 3FRPB 1KAWA 1VDZA 4N9PA 1EY5A 2NVQB 4DNRB 1A8VA 3BZCA 4WORA 3CCLA 1J6QA 3MHBA 1I3QB 1VQ7A 4GLXA 4B3SL 4AYBE 3CQZH 4NB3A 2PZWA 5IP9H 2CWAA 4FXGC 2EYMA 2R6GA 1JOQA 4B3TL 4EQPA 2D62A 5M3MH 1CM9A 2D0PA 4K0KL 1IZ6A 2XGTA 1CHQD 3Q24A 1FNWA 1VQPA 1I4HA 2JSOA 1A3TA 2QF7A 4JI4Q 1PTOC 2JA7H 4GOPB 4X66Q 4X3UA 3I70A 1SE8A 1TY0A 1Y14B 2E2JH 2E2DC 1VQCA 2H1EA 3D4WA 4C3HG 5I9OA 2B2VC 5CYUA 1X6OA 2R93G 4JPBW 4JI1Q 1I3QH 1HH2P 3I91A 1IYVA 4GS3A 2NWGA 5CBEE 4XQJA 3OWFA 3NTKA 1MI2A 1SE2A 3MEHA 3P20A 4L5RC 2RVLA 3K5NA 3Q8DA 2JEAI 1PZKD 2VL6A 1VQMA 4BBSG 3KDFA 4V190 3FHWA 3G6JB 5FO7B 4DAYA 1HFGA 1SE3A 3KF8B 1QUQB 1GUNA 4DV2L 2MO1A 5K5PA 3NBIA 1M1KC 3MZ5A 1TXYA 5EKLA 3MFYA 2QILA 3H3VI 3M4QA 3HOUG 4O0AA 2F3IA 2ZTEA 3PUVA 4OXPA 2IX3A 3NPPA 4DR4L 4RGTA 2B2YC 4GOPC 2KVMA 4HIDA 4C1NK 1J8IA 4JI0L 1V9PA 4X6AH 1A6XA 3BYYB 1WYDA 1U4LA 1KAAA 2ENBA 4P73A 2OWOA 1D7QA 3GTKH 2JA6G 4CKEA 1ET9A 4A3EB 4Y7NH 3LWEA 1ET6A 1PH9A 2B63G 1ZEQX 1BVSA 1EIGA 3R8BA 4BBRH 1PMRA 4R4CA 3VR3A 2L5TA 3DXJC 5C0XH 3PCOB 4JI8L 4DV6Q 3H94A 4UPAA 4L5SA 2BDNA 4LF7Q 2K5NA 1EY9A 1XPUA 2NN6H 2RSNA 4Z9CB 3F2BA 2JA8G 4C3IG 2ZM6L 1NTGA 3C2PA 1BKBA 1XYIA 1YI2A 1JQYD 1STEA 5I4DA 4J6HA 4L8JA 4MNOA 3GP7A 1S72A 2IW3A 1YHAA 3SK6A 2C35B 1I4QA 4RGNA 5E4WC 2E76C 1XNRQ 1OXSC 2ZXPA 4PQXA 2K4KA 3SDZA 1YNNC 2HQEA 1WTOA 2QEXA 5IODA 4A3IB 3NSWA 1KRSA 4K8JA 4DV5L 1VF5C 2F0VA 3R2IA 1Q86C 4BY1G 3M3YH 5DAUA 1K3RA 2EDGA 2GVAA 4KJOA 1LM0A 1AZPA 1TWHH 2L15A 1IBKQ 4YCWA 1SR3A 4JI5L 2N88A 3HOWG 4M8AA 4IUTA 1B4OA 3P75A 4ZK9B 2A69C 3CU7A 2RDFA 4GKJQ 1B2TA 5EPKA 3I56A 3H0GG 2VUMH 3OYYA 2ZXRA 4RGMA 4DXFA 4YCVA 3ND8A 2NZHA 2AWNA 1BBUA 1V1PA 4YY3L 4MTKA 3OMCA 5EPLA 4YHHL 2GN5A 3G48A 3FKIG 1SNOA 3K5LA 2AMCB 3WDNA 1PH7A 4A3BB 4OL7A 2I5LX 5E3FA 2DNCA 2KHSA 4MZ9A 4HMJA 1L2FA 4CDFC 1PYBA 4LFAQ 3OWEB 3STBC 2K50A 2ZT9C 1WTWA 5IWAQ 1NBWA 4A93H 1QZHA 4JOIA 3U50C 3V96A 1Y1VB 4KY5A 1QZGA 3GTLB 1WD1A 4A3KG 3RN2A 1S5FD 1PYWD 3F2CA 1HQMC 1HUMA 4LJZC 4C2MH 1JB7A 5FK9C 2B2VA 3VR5A 2R92B 1S40A 1SMXA 1KC8C 4WJ4A 2F1MA 3FVQA 4IQZA 1OTCA 3KLSA 1GHKA 4QUCA 3J80c 3NENA 3PMFA 5IY0A 3GTQH 4WRDA 3UI2A 4EQNA 1BCPD 5HGQA 1PFNA 3CCRA 4UDUC 2SNMA 1JOOA 1HZCA 3G7LA 3NWSA 5IP7H 1KDCA 2NUCA 4CKBA 1QVFA 5E7NA 4A3MG 1SJHD 4HSVA 1WTRA 1JT8A 1O7ZA 4DK6C 1QB5D 1STNA 1MSGA 3BDLA 2ICEC 3RZDH 4PZ7A 5JJZA 1O7LA 4KN7C 1X3FA 2CFMA 4ZQ3A 5CGKA 4X62Q 2NTTA 1N32L 5CV6A 2AUJD 1BBXC 2AWOA 4GOPA 2NVXH 4ALPA 3L3OC 5EAYA 1KLGD 2LMCB 2JP1A 3RLNA 3R93A 1PRTB 1F9QA 2CVRA 3SXHA 2Y0SE 2O4XA 2H4OA 2MQHA 3GV6A 4LF5Q 4DR1L 1LTRD 5C4XG 1H9MA 2XVSA 1WTQA 4YWLA 4NXML 1PFBA 4KHPL 2XRQD 2K14A 3V2TA 5C3EB 1LLRD 5C3WA 1K3BC 4RGOS 4KY6A 2A6EC 3T1HL 4K14A 4DV7L 1D1IA 4C3JG 4AQYL 4J8QA 2PMZE 4C56C 1U0LA 4X66L 2EY6A 4FF3A 3PO2H 1E24A 1DOLA 1WI5A 4X65L 4R4QA 3MA2B 4DV3L 3BVGA 3GTMH 5JJIA 4IPCA 5IYDG 1BCPF 1AP0A 1HFNA 4JCVE 5IYCG 3O13A 1Y1WG 3BDCA 5EJWA 2CHBD 3H3VC 2PQAB 4LF8L 3MXGA 2HIVA 1UE6A 1V8QA 3I2ZA 2KENA 2MHVA 1EQRA 2E2IH 3K59A 4XXEA 4UHVA 1PRTC 1FYCA 5BR8Q 3D4DA 4X3KA 5EPJA 4B3SQ 1X3QA 2Z4IA 4ID6A 3CC7A 4B3TQ 1FGUA 2X6GA 2F0DA 1PFSA 4LUOA 1WTVA 4OHJA 2CQOA 1SEBD 4RCNA 3A54A 2HCIA 3HEJA 1SFOH 4K0KQ 3KLWA 1O80A 1JMCA 1FJGL 3WOFA 4KHVA 1YBYA 4FF1A 4XTCS 2EZVA 3M4OB 1KRTA 2RHQB 1QG7A 4KKTA 1FGBD 1QOHA 3ULLA 1QNUA 1BUVT 3E6ZX 2HUGA 1RHPA 3X3MA 2F0JA 3TP7A 3I4MB 3K80C 3KFUA 1WCMH 4OX9L 5M3FH 2HQLA 2PO4A 1HNXL 1SROA 5TSSA 3QJYA 3I4OA 1E1TA 2XSCA 4OEMB 3GTJB 2AQ1B 2BA1A 2R7ZH 4F8MA 1CKOA 1EIFA 1O7YA 5BN5A 2DJFC 1XNRL 2DUDA 5JVG3 1TKWB 4ODGA 5T1IA 1X55A 3NTHA 2JA5H 4DV2Q 4A3DH 1KTKA 3DEOA 2RCNA 1MKHA 2D0OA 2I46A 4WJWA 2QW7A 1GO3E 1AEXA 2K75A 5KNBA 4B3ML 4G4KA 4DR4Q 3RR5A 5M9OA 1ONLA 2KEEA 2YU9B 2EYFA 1VQEA 3I4MH 5IGDA 3HOZH 4JI0Q 1FD7D 4DUZL 3KLSX 1PH2A 3VR6A 1CKNA 1HXYD 1F9PA 4PMCA 2ZTDA 4GKJL 2J0TD 2Z0SA 4TSSA 4B9XA 2F0NA 3A8KE 3CMEA 2Z1CA 1RF2D 4DFAA 4NW2A 1TWFH 2F4VQ 1PA6A 5C44B 4LUVA 1PVOA 1J5EL 3M85A 1SNPA 2ZM6Q 2F0EA 1NSNS 5JPNC 4A3EG 3GTGB 3PUYA 4Q0FA 1HQRD 1WJJA 4JG2A 2FXQA 3U58A 1CA6A 3E9HA 3HOYH 1S4ZA 5EKIA 1EWIA 1WVLA 1M90C 3A55A 1DYQA 1DM0B 1U4RA 3CRKC 1YEZA 4CDCC 4UY8C 1TS4A 2VQEQ 3KJOA 5K36H 4C1NI 3HRZC 2K6AA 3URYA 1HUNA 1IW7C 2WAQB 3RNUA 2ASBA 4RG1A 2EYLA 3EROA 3TDQA 5C0XI 2F0PA 4RWSC 3JAML 2F52A 4DV5Q 2MJ8A 4IOAA 3GTOB 1B8AA 2SEBD 1I50B 2WV6D 1SJED 3L7ZC 4FDBA 3I73A 4JI5Q 1Y69U 1VQ5A 1VQ9A 1Q1EA 1LYLA 3I3CA 1E22A 5LL6S 4A3IG 3S1RB 3K5OA 2QCPX 3G71A 5ISRA 1K83H 3DWQA 1RIPA 1OXUA 2KCMA 3KUPA 1B3AA 2RDHA 2YYZA 3MFGA 4EQOA 3NTIA 2N8NA 2UUBL 1JJ2A 3D6WA 4JI3L 3BVZA 1ILQA 5GAHC 4JBKA 4XIGS 2J7ZA 1W2BA 4OO1G 3S1NH 1O7IA 4YIJA 4ZYSA 4F88A 1JJCB 1EWHA 3S15B 1I50H 1PH3A 2E2HB 2X69A 2G9DA 5DLQE 3AYHB 1EZ8A 2VS1A 4WJ3M 2KHIA 3UDIA 4A3BG 1DJRD 2F0GA 1SYBA 3TSSA 1HPCA 1H9KA 3RMHA 3S16H 1JWMD 2C9OA 4NPSA 1H9RA 4IFDG 2PQAA 1GOZA 2XWBB 1LUZA 3CQZB 4PV1C 2BA0A 1LABA 4FO2A 1EQQA 1Y1VG 4LMQD 1U5KA 1YHBA 4A3JH 3FPUB 5BN4A 5M3MB 3EA6A 3IFDA 3H09A 5C3XA 2KCTA 1MIUA 3EFXD 1VQ6A 4DK1A 4O1NA 1TR5A 2R92G 1HCZA 4NP5A 3TN2A 2NYZD 1B1ZA 1K0RA 2JA7B 4QJFA 2E2HH 4OO1I 3HOXH 2E2JB 1R9TH 1G291 3T13A 4B3RL 2PQEA 5KGUA 1HJPA 4YCUA 2HIXA 3BDOA 5JEAG 3TBIB 1N32Q 1MSHA 4XT3B 3IKJA 3MWYW 2AQ2B 1ESFA 1FVIA 1P16A 4A76A 5BR8L 2D2CC 1C4QA 3FDTA 3CP0A 4BXXG 2UXBL 2RF4A 3NXWA 5FOBB 4GN3B 5CR3A 1R4QB 2ALYB 2K5VA 4AIMA 2F3WA 4IFDI 2KCNA 4IPHA 1BQQT 3SR1A 1I4RA 1Q90A 5JJKA 3KBGA 4FP5D 4JK1C 4MHEA 1ASYA 4DR1Q 4NXMQ 2NVYH 3R3OA 4KHPQ 3TP5A 3NK9A 3S9WA 2OQKA 3AFQA 1LTAD 3W1GA 1PTOF 5CV7A 3T1HQ 4DV7Q 4AQYQ 1JCKB 4DA2A 3AU7A 3IFTA 4LFBL 4KKUA 1BOSA 1X56A 4DAVA 3B6YA 4QY7A 4X65Q 1TWGH 3P7JA 4L5TA 4DV3Q 5C3EG 1JB3A 4AYBB 2BCOA 4R8NA 1HA5A 1W6KA 1Q81C 5IYBH 4IO9A 3OTOL 1B53A 1XX8A 3OHXC 2A1AA 3GTKB 3S2HH 1HZ9A 1EY6A 1MD2D 1SAPA 4Y7NB 4LF8Q 5IGEA 4A3LH 1ICFB 1U4MA 1MJCA 1U9RA 4BBRB 2K5DA 3VR2A 2SNSA 1EFID 1ESRA 1YITA 1K8MA 4R4IA 2F4IA 4IUUA 3OSOA 3S24A 1A2UA 4N8FA 1AN8A 1LTSD 2F0WA 3BU2A 1STBA 3CHBD 1VMPA 3QOJA 5IE8A 2QA4A 4HMIA 4ZUIA 5EBDA 5LMUQ 2EXDA 4IPDA 2MNAA 1BR9A 2WKDA 4CDDC 2A69D 2F0TA 1KXLA 3GO5A 1OXVA 3TS2A 2Z4HA 1V43A 4BA2I 1MGSA 1FJGQ 4JI6Q 4H44C 1EIHA 1HR0L 2CCZA 1XXGA 4KV6A 3A8JE 5ELOA 4JVZA 2VQFL 3M3YB 1A15A 5J3BA 3CCMA 1DONA 1MJEA 4DK0A 4LK1C 1LT3D 1TWHB 2KCCA 2A5HA 2PYKA 4FXKC 5GAGC 1PZID 2F4VL 4OX9Q 4QQBX 5D3DA 1HNXQ 3STBD 3RN5A 1Q12A 1GUSA 3ERSX 3I90A 1EYDA 3PSIA 1M8AA 1YZ6A 4I7AA 5J39A 1YNJC 2VUMB 1TWCH 3MEFA 1SNMA 3FMCA 1K8GA 2OXPA 3K7UC 4KKSA 2VQEL 3K57A 2A19A 3ZYYX 1F2ZA 1QNKA 1CT1D 4FF4A 3J81c 4OELB 1FR3A 2K03A 2K04A 3KF6B 4U68A 1T5EA 4S3SA 4V0BA 1I4GA 1JC7A 3MXPA 3TZDA 3NEMA 3DMUA 4B3MQ 4K2KA 4K5XA 1N36L 4CGYB 1BXTA 4A93B 2CH4W 4DUZQ 4HCSA 5ELEA 3L0OA 3TS0A 2A73B 4G57A 3T56B 4IN3A 1NE3A 1TY2A 3AEVA 4JW0A 3HOVH 2A74C 3VYRA 4C2MB 3DWPA 2YTXA 1CA5A 2A6HC 4R4OA 3PUXA 1SMYC 2B2TC 2EQSA 3UDGA 5DM73 4DR2Q 3GTQB 2PPBC 3MXUA 3T53B 1EU3A 1J5EQ 2EYPA 3D3RA 1JORA 1AW7A 1PH1A 3JAME 3MVVA 4HJAA 4APVA 3TEHB 2PI2E 5L37A 3K7AH 2NVTH 5C44G 5I9PA 3I4NH 4JI7Q 3RZDB 4F7XA 2A6ED 2BOSA 4R4TA 1I6HH 5NUCA 1DD2A 1IYJB 2L12A 2R7FA 1H9SB 3K6OA 3T1YL 2NVXB 4F87A 1HNZL 4RAUC 3IAYA 1PFMA 1KD1C 1X65A 4CJ0B 4BS9A 1J9OA 1OXTA 4ME3A 4A3FH 1L1OB 2CQAA 3KK7A 2EJFC 5C5MA 2WAQG 1P8LA 4DPGA 3DUZA 2M00A 1N34L 2EE1A 4CJ1B 3QO2A 2IHEA 3S2DH 1X32A 2IX1A 2BH8A 4ILWA 1DOKA 3NBHB 4L5QA 2L0CA 2DN8A 1KQSA 2EYHA 3RZOH 3PO3H 4KMUC 4ZKCB 3VA7A 2UUBQ 4LUZA 3PO2B 2F0QA 2Q2HA 4A3CH 4HTHA 4ULLA 3CCSA 4KK7A 4JI3Q 2VNUD 1NUCA 5KNCA 3SGIA 3GTMB 2P5ZX 4QIWE 4LFCL 1IXRA 2B2YA 4FF2A 4LWCA 2UUCQ 2EXZA 4MTNA 4DNIA 1XJVA 2Z8LA 5M5XH 3GDEA 1ENCA 5FJ8H 2E2IB 1L1OC 1S5DD 2L4NA 1VS0A 4OIKA 4BA1I 5FO8B 4BY7H 2ZJQA 3QG1A 5IT9c 5KRUA 3S1MH 5AFWA 4KD4A 2OCEA 3A7LA 2QEJC 3J7AF 2F0MA 4DF7A 4A3GH 1CKMA 1VF7A 4RKLA 3EIVA 1HTPA 1NY4A 1BO0A 3ULPA 2H5XA 3P1HA 2JK8A 3KF8A 2HT1A 5GQOA 1QUQA 3M4YA 5FLMH 4JI2L 1A63A 2N49A 1SFOB 1RJTA 5IOCA 1GJXA 4H13C 3LGJA 4DUYL 4X3SA 1CZWA 2K32A 5IP9G 4RA8A 3VYUA 1D6EC 1JWSD 1VQAA 1VQBA 2Y0SB 3FEWX 2FHTA 2VY3A 3DM1A 4AH6A 4B3RQ 3NP8A 4XT1B 1HA6A 5M3MG 1QJOA 5D14A 1N33L 1CSPA 1VQGA 3MC0B 4UP7A 5JEAJ 1AFPA 4EX5A 1PRTF 3ND9A 3W1BA 4XYQA 4DR7L 1WCMB 1OXXK 2PNHA 3J81j 5M3FB 2MUYA 1PH4A 1I6VC 2PMZB 5DEHA 5KYIA 1EIYB 4DR5L 2JA7G 2C5CA 4N9TA 2UXBQ 1VQHA 2A68C 4DR3L 2WFWA 2R7ZB 3HP3A 5KNDA 1GUTA 5LMUL 1S5BD 2EPBA 5IGBA 1G91A 1KNAA 1ASZA 3D31A 3MXNB 2JJQA 3A56A 1JR0D 2RA4A 4C3HH 2IY5B 4JI6L 2JA5B 4FXDA 4A3DB 2IT1A 2GA4B 2R93H 4POFA 4MN3A 1T9HA 3CCUA 3F2DA 4LFBQ 4N8X1 3A74A 2AKWB 3EN2A 3PIPA 2I5HA 4IALA 4MIUA 3I55A 4XYOA 2RKSA 3W5OA 5AJ3Q 2XNAC 3HOZB 4EGVA 4BBSH 1GM5A 2UUAQ 1B3QA 3KF6A 1PH6A 3OTOQ 2LSSA 4CKCA 4H0LC 5LMNL 2F0IA 5ELNA 4UAIA 1IW7D 1YVCA 4G7ZC 2NBFA 2KHJA 3HOUH 2KOLA 1WD0A 1EU4A 1TWFB 4AYBG 4B9WA 1LTID 2RBMA 3UDFA 4J1MA 4OGQC 3NHHA 3D6CA 1LT5D 1EEFD 4IZ8A 4POGA 1H9JA 1I4PA 1RKNA 3J7A5 5DM63 2B8GA 2EJGC 3A8IE 3HOYB 1EY4A 2JA6H 4BBRG 3HFZB 5A2QL 4DV1Q 5C0XG 1TT2A 2M9VA 1XNQL 2B63H 1K0SA 1GUWA 1WTHA 5M5YH 3HG9A 2L55A 2AHOB 2NN6G 1STGA 1HR0Q 2ICIA 4P75A 1RD9D 1AE3A 2JA8H 3C3LA 2LY7A 3GQBA 3CPFA 3PUWA 2VQFQ 3LX0A 3ERQA 1ML0D 1SXTA 3E5SA 1KDBA 3E3XA 2WB1E 4QB4A 4DR2L 1ZKOA 1CZGA 2BH2A 4LNQA 3KDFB 4FYDA 1DOMA 3AFPA 4JBWA 4DAYB 2Z9HA 5ELBA 5IGGA 1KNEA 2L1BA 1K83B 1QCBD 3OIPA 5GAEC 1WOCA 1PHJA 2A8VA 3BS1A 4BY1H 1C48A 1EL0A 2ZJPA 3VYSA 3I72A 4JI7L 2ZXOA 4JBJA 3M9BA 4YWMA 3CAMA 3LNNA 4ME5A 4FNFA 5EBCA 1EEID 1EWCA 4K8IA 3HOWH 2ATWA 3S1NB 2N55A 3HGBA 3NBHA 2VUMG 2R61A 2PZTA 2TMPA 3PGZA 3K8AA 2WB1B 5COYA 2NN6I 2F0LA 5FLXc 1SE4A 3H0GH 1CFMA 1M4VA 4OWXB 1N36Q 1SLJA 2SDFA 4R9WA 4JYAL 4JV5L 3J81L 4HJ7A 2Q2UA 4GLVB 2PCFB 2B3GA 2JA9A 3S1QH 3ZJYC 5CV9A 1ICWA 3M7NA 4GLAC 5F2DA 1MHWC 2D5DA 3FKIH 3U4VA 3S16B 1JE5A 1HRJA 2KBNA 2E5LL 4HIMA 5D65A 2O2LD 2ZTCA 1JICA 4DV0Q 1PLFA 4A93G 3JAMi 1D2BA 4ZCKA 4L63B 3X3NA 4CBVA 1VCIA 4HIOA 4A3JB 5CC4A 1G8ZD 4NKLA 1EY7A 1A0IA 3QB3A 1XMQQ 2QGQA 3TP8A 1VQ8A 4A3KH 5JPMC 2UXDQ
chains in the Genus database with same CATH topology
2QA4A 2LXKA 4DV4L 1AH9A 4TQUS 1I5FA 1X3GA 1S40A 1SMXA 3BZKA 2R7DA 5LMUQ 2EXDA 4IPDA 1KC8C 1NMFA 1OTCA 3J80c 2MNAA 3NENA 1EFWA 2UUCL 5IY0A 3H15A 3HKSA 1VQKA 3GTQH 4IOCA 1KXLA 5HGQA 2ID0A 3GO5A 1OXVA 3TS2A 1V43A 4BA2I 3CCRA 1XPRA 2VZAA 1X9NA 1FJGQ 4JI6Q 4DV6L 3JC66 5IP7G 1YNXA 3CC4A 1HZCA 4LF7L 1HR0L 5IP7H 4IJLA 3T1YQ 4PZ6A 2CCZA 1HNZQ 1QVFA 5E7NA 4A3MG 1IBLQ 2UU9Q 3UE0A 1Q82C 2Z6KC 5ELOA 3PIOA 1VQNA 4DK6C 1JT8A 4A3MH 2VQFL 4A4IA 5J3BA 3CCMA 1MJEA 2IX0A 4DK3C 3RZDH 4PZ7A 3J7ZC 1IBML 5GAGC 1X3FA 2HHHQ 2CFMA 2ES2A 3U4ZA 2F4VL 4X62Q 4OX9Q 4QQBX 1N34Q 1S3OA 1N32L 4GNXA 1HNXQ 4PMWA 3STBD 3RN5A 1Q12A 3ERSX 3PSIA 2DGYA 2AWOA 4GOPA 3M4OH 1YZ6A 4HJ8A 2NVXH 4C3IH 3UE1A 1HNWL 1BBWA 1TWCH 3MEFA 4Y52H 4ALPA 1EUJA 3KJPA 5EAYA 5M5WH 1K8GA 4GKKQ 3RLNA 3K7UC 3L2PA 1YJNA 2VQEL 3CCVA 2Y0SE 2A19A 1IBKL 2MQHA 4LF5Q 4DR1L 5C4XG 4NXML 4LF4L 4YWLA 4LFCQ 4KHPL 3J81c 3TRZA 2K14A 1K8AC 4YWKA 1W3SA 5C4XH 3CF5A 1UE7A 3KF6B 1C9OA 2YTVA 3T1HL 2WAQE 4DV7L 3VDYA 1TWAH 3NEMA 3GTJH 4AQYL 5GADC 2PMZE 4B3MQ 1U0LA 4X66L 3PO2G 1L1OA 2UXCL 4C3JH 1N36L 3S17H 3PO2H 1E24A 1RL2A 1WI5A 2YV5A 4JI8Q 1JB7A 4X65L 3DLLA 4JC0A 4R4QA 4DUZQ 4DV3L 3L0OA 2PI2A 3TS0A 3GTMH 5JJIA 4IPCA 1NE3A 5IYDG 3AEVA 3HOVG 4JCVE 2IHFA 2ZJRA 5IYCG 1VQJA 5IYDH 3F1ZA 2MO0A 4X64Q 1Y1WG 3HOVH 2YTXA 4R4OA 3PUXA 2PQAB 5IYCH 4LF8L 1E3PA 1JJGA 1Y1WH 1GKHA 2EQSA 3S14H 3UDGA 2JEBI 4LFAL 2HIVA 4DR6L 1UE6A 3KOJA 3CCQA 4DR2Q 2YU9H 5IWAL 3I2ZA 2KENA 4JI2Q 1EQRA 1UE5A 1QVGA 1J5EQ 5AJ3L 2E2IH 3CCEA 4DUYQ 1KL9A 5BR8Q 2UUAL 1PH1A 2I5MX 4B3SQ 4JOIC 4HJAA 4APVA 1KHIA 1E1OA 1XTDA 1VQ4A 3TEHB 3WWVA 1I94Q 3GTPH 3I4NG 2PI2E 3CC7A 3K7AH 1VQLA 3CD6A 2NVTH 4B3TQ 1FGUA 5C44G 1N33Q 2EIFA 4KI0A 3CXCA 3I4NH 4JI7Q 1PFSA 4LUOA 2CQOA 5C44H 4UP9A 1Z9FA 4DR7Q 3K0XA 4R4TA 2NVQH 1SFOH 1I6HH 1X3EA 4K0KQ 1YHQA 3KLWA 1JMCA 1FJGL 1IYJB 2R7FA 3GTGH 4DR5Q 3J81i 1YBYA 4XTCS 4NXNQ 1UWVA 3A5UA 2Y0SG 3T1YL 1KRTA 3GD7A 5GROA 2RHQB 1Q8KA 4DR3Q 1HNZL 2JE6I 1IBLL 3ULLA 4DAMA 4A3FG 1KD1C 1AE2A 1X65A 3HKZG 1OXTA 4ME3A 4A3FH 3K81C 3I7FA 4YY3Q 4DV1L 1WCMG 1L1OB 1SRUA 4YHHQ 3E9IA 5M3FG 4LF9Q 2WAQG 3K80C 1P8LA 4P72A 3KFUA 4DPGA 1WCMH 2HHHL 1NMGA 4X62L 1Q7YC 5M3FH 1N34L 2HQLA 4OX9L 1HNXL 1LTLA 1N8RC 1SROA 2IHEA 5HY6A 5H1SE 3S2DH 1VQIA 2IX1A 2BH8A 1HR0W 4KLKA 2R7ZG 1XMOQ 3NBHB 4L5QA 3I4OA 1CUKA 1E1TA 1WFQA 1KQSA 3GTOH 4QL5A 3PO3G 2UXDQ 2BA1A 2R7ZH 3RZOH 3PO3H 4A75A 5C4JH 3IRBA 1CKOA 1EIFA 3PUZA 4A3CG 2B29A 4LUZA 2UUBQ 4GKKL 2Q2HA 1XNRL 4A3CH 2DUDA 3CCSA 2JA5G 4JI3Q 3D0FA 4A3DG 2VNUD 1X55A 4H02A 2XTIA 4LF5L 2JA5H 4DV2Q 3S1RH 3SGIA 4A3DH 4QIWE 4LFCL 1IXRA 2RCNA 1MKHA 2D0OA 3PF4A 5LMNQ 1C0AA 3PV0A 4LWCA 1GO3E 2UUCQ 1Q1BA 2K75A 4MTNA 4RMFA 4DNIA 1YJ9A 1UE1A 4B3ML 3I4MG 3RR5A 4DR4Q 4LF6Q 2Q2IA 3HOZG 1XJVA 5FJ8G 1X54A 5M5XH 3I4MH 4O2DA 1VQEA 3GDEA 3HOZH 5FJ8H 4JI0Q 2Z6KA 2JQOA 4DUZL 3PF5A 4BY7G 1L1OC 4P74A 1GVPA 3HKZE 1PH2A 1CKNA 1VS0A 3M4PA 4BA1I 2ZTDA 2K5HA 4BY7H 2ZJQA 4GKJL 4A3GG 2Z0SA 1VQOA 4OWWB 1EOVA 5IT9c 3S15H 3S1MH 4KHZA 4X64L 2OCEA 4A3GH 2YTYA 4WJ4A 2GVBA 1KIXA 3JAMc 1CKMA 1V1QA 3EIVA 1XPOA 3CMEA 1XNQQ 5C0XJ 1NY4A 2MFIA 3J80i 5FLMG 3ULPA 2H5XA 1TWFH 1PH5A 2JK8A 2WP8J 2LXJA 2N3SA 1QUQA 1KAWA 4LUVA 5GQOA 3RLOA 5FLMH 1PA6A 2N49A 4JI2L 1PVOA 1A63A 1UEBA 1J5EL 1A8VA 3M85A 3BZCA 3LGJA 4DUYL 2ZM6Q 4IJHA 4A3EG 3CCLA 3HOYG 3CCJA 3PUYA 1J6QA 1IL2A 1VQ7A 1WJJA 1C7YA 4JG2A 2FXQA 4AYBE 5IP9G 3E9HA 4GLXA 3U58A 4A3EH 4B3SL 3HOYH 3CQZH 4NB3A 1VQAA 1VQBA 1EWIA 4DV0L 1M90C 5JJLA 5IP9H 2VY3A 1I94L 2CWAA 4AH6A 5K36G 1YEZA 4B3RQ 2R6GA 4B3TL 4UY8C 3G4SA 5M3MG 2VQEQ 1N33L 1CSPA 1VQGA 3KJOA 2Q2TA 1NJIC 2D62A 4UP7A 5JEAJ 4EX5A 5M3MH 4DR7L 3W1BA 2D0PA 1OXXK 2PNHA 4K0KL 1IZ6A 3J81j 2XGTA 3RNUA 2ASBA 2F4VQ 1PH4A 4RG1A 5C0XI 1XMQL 4GNXB 1VQPA 1EIYB 4DR5L 2JA7G 2F52A 3A0JA 4NXNL 3CC2A 2UXBQ 1HZAA 1VQHA 1PV4A 4JI4Q 1DGSA 4DV5Q 2JA7H 2UXDL 4GOPB 4X66Q 4DR3L 4IOAA 1B8AA 1SE8A 1GD7A 2WFWA 1Y14B 1YIJA 2E2JH 5LMUL 1VQCA 1Z47A 3L7ZC 3E0EA 2NZOA 4FDBA 4JI5Q 1ASZA 3D31A 4LF9L 3MXNB 1VQ5A 1VQ9A 1Q1EA 1CSQA 1LYLA 2JJQA 4C3HH 1E22A 2IY5B 4JI6L 1X6OA 4A3IG 2R93G 3G71A 4R1JA 3ULJA 2IT1A 4JI1Q 4A3IH 1I3QH 1HH2P 1SN8A 2R93H 1CKNB 4POFA 4GS3A 1K83H 3FP9A 1T9HA 3CCUA 1RIPA 1OXUA 2KCMA 2UU9L 3F2DA 4LFBQ 3A74A 2AKWB 3BJUA 3EN2A 3PIPA 4LW1A 4JYAQ 4L5RC 1YJWA 4JV5Q 2I5HA 2E8GA 2YYZA 3Q8DA 2JEAI 1VQMA 2VL6A 2N8NA 3I55A 2UUBL 3KDFA 4BBSG 3FHWA 3W5OA 5AJ3Q 1JJ2A 3EBEA 4JI3L 4BBSH 5GAHC 4JBKA 3KF8B 4XIGS 3TQYA 1QUQB 1GM5A 1W2BA 2UUAQ 3KF6A 4GN4B 3S1NH 1O7IA 4DV2L 4OO1G 2WB1G 3OTOQ 2N78A 1PH6A 2LSSA 2E5LQ 2MO1A 1M1KC 1JJCB 1D8LA 1TXYA 1QVCA 5LMNL 2K52A 3H3VI 5ELNA 3M4QA 3HOUG 1Q46A 4O0AA 2F3IA 5LMNW 2ZTEA 4GNXC 1I50H 4P71A 1PH3A 2V1CC 4DKAC 1YVCA 3PUVA 4OXPA 1EYGA 2KHJA 5DLQE 3AYHB 3A5ZB 4IPGA 3HOUH 4DR4L 4LF6L 4GOPC 3UDXA 4AYBG 2VS1A 3UDFA 4WJ3M 3CPWA 2RHSB 2KHIA 4HIDA 1B70B 3UDIA 4J15A 4A3BG 4JI0L 1V9PA 4X6AH 2HT1A 1WYDA 1G51A 4EQ5A 4A3BH 1K73C 3S16H 4P73A 4OWTB 4NPSA 3G6EA 2OWOA 4POGA 2PQAA 3J7A5 4IFDG 2OTLA 4DV4Q 2JA6G 3GTKH 1D7QA 4Y7NH 3CW2C 1LUZA 1VQFA 2JA6H 4BBRG 3HFZB 2BA0A 1PH9A 2B63G 1N9WA 1BVSA 4DV1Q 4A3JG 5C0XG 4TVAB 1EQQA 4BBRH 1Y1VG 1XNQL 2B63H 4R4CA 1U5KA 5M5YH 1YHBA 2CKZB 4A3JH 1Y1VH 2AHOB 3PCOB 4JI8L 4DV6Q 3GTLH 2NN6G 3F8TA 4A3LG 4UPAA 4L5SA 4QGUA 4HJ9A 4LF7Q 2KCTA 2K5NA 1MIUA 1XPUA 1K9MC 1HR0Q 3F2BA 2JA8G 1VQ6A 2ZM6L 1E7ZA 4P75A 1NTGA 4IFDJ 2R92G 3DM3A 1BKBA 1AE3A 2JA8H 3CMAA 1YI2A 3ER0A 3KYHC 3CPFA 3HOXG 4PZ8A 2R92H 1K0RA 3PUWA 3AQQA 4MNOA 2VQFQ 1S72A 4PG3A 4QJFA 2E2HH 4OO1I 3HOXH 1YHAA 1R9TH 3NELA 2C35B 1G291 2I0QA 2WB1E 4B3RL 1IBMQ 1XNRQ 4DR2L 1HJPA 4YCUA 1OXSC 2HIXA 1HZBA 1B7YB 5JEAG 2BH2A 1N32Q 2K4KA 4LNQA 1A62A 3KDFB 4GN5A 1FVIA 1P16A 3AFPA 4JBWA 4DAYB 4A76A 2QEXA 5BR8L 1HNWQ 3CP0A 1KRSA 4JI4L 4BXXG 2UXBL 2RF4A 4DV5L 5GAEC 1WOCA 1Q86C 1PHJA 4BY1G 2A8VA 4GN3B 3M3YH 4BXXH 1K3RA 2ALYB 2K5VA 4AIMA 2GVAA 4BY1H 1LM0A 4IFDI 1TWHH 2ZJPA 4IPHA 4JI7L 2L15A 1IBKQ 5JJKA 4YCWA 1SR3A 4JI5L 4JBJA 1VQDA 1ASYA 3M9BA 4YWMA 3CAMA 4DR1Q 4NXMQ 4UP8A 4LF4Q 2NVYH 3HOWG 4KHPQ 2CWPA 2OQKA 3HOWH 3H3VH 2ATWA 3AFQA 4GKJQ 2VUMG 3I56A 3W1GA 3H0GG 3PGZA 4JI1L 3T1HQ 4DV7Q 3K8AA 2VUMH 4AQYQ 3OYYA 2NN6I 5FLXc 3H0GH 4OWXB 2UXCQ 4YCVA 3RLFA 1SLJA 1N36Q 2NZHA 4JBMA 4LFBL 3ICEA 4JYAL 2AWNA 4JV5L 1BBUA 1X56A 4HJ7A 3B6YA 2Q2UA 4GLVB 4YY3L 4QY7A 4X65Q 2B3GA 1TWGH 2JA9A 4YHHL 2GN5A 3S1QH 3G48A 3FKIG 4L5TA 3ZJYC 5C3EG 4DV3Q 2OTJA 1H95A 5IYBG 3M7NA 4GLAC 2AMCB 1PH7A 3FKIH 5C3EH 1Q81C 3U4VA 5IYBH 4IO9A 2I5LX 1JE5A 3OTOL 2KBNA 1L0WA 2E5LL 2OQ0A 4HIMA 2VW9A 4MZ9A 2A1AA 4HJ5A 2ZTCA 1PYSB 1HZ9A 4DV0Q 1XMOL 1L2FA 4OONA 4LF8Q 1PYBA 3S2HH 4LFAQ 4DR6Q 3STBC 4A3LH 4A93G 2K50A 1G6PA 3JAMi 1MJCA 5IWAQ 1NBWA 4HIKA 3TREA 4A93H 1VCIA 1QZHA 4JOIA 4HIOA 3U50C 1YITA 4R4IA 1QZGA 3S24A 3OW2A 4A3KG 3RN2A 1A0IA 1XMQQ 2QGQA 1FL0A 1VQ8A 4A3KH 3F2CA 1PH8A 3BU2A 4C2MH 5IE8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QA4 A;  2LXK A;  4DV4 L;  1AH9 A;  4TQU S;  1I5F A;  1X3G A;  1S40 A;  1SMX A;  3BZK A;  2R7D A;  5LMU Q;  2EXD A;  4IPD A;  1KC8 C;  1NMF A;  1OTC A;  3J80 c;  2MNA A;  3NEN A;  1EFW A;  2UUC L;  5IY0 A;  3H15 A;  3HKS A;  1VQK A;  3GTQ H;  4IOC A;  1KXL A;  5HGQ A;  2ID0 A;  3GO5 A;  1OXV A;  3TS2 A;  1V43 A;  4BA2 I;  3CCR A;  1XPR A;  2VZA A;  1X9N A;  1FJG Q;  4JI6 Q;  4DV6 L;  3JC6 6;  5IP7 G;  1YNX A;  3CC4 A;  1HZC A;  4LF7 L;  1HR0 L;  5IP7 H;  4IJL A;  3T1Y Q;  4PZ6 A;  2CCZ A;  1HNZ Q;  1QVF A;  5E7N A;  4A3M G;  1IBL Q;  2UU9 Q;  3UE0 A;  1Q82 C;  2Z6K C;  5ELO A;  3PIO A;  1VQN A;  4DK6 C;  1JT8 A;  4A3M H;  2VQF L;  4A4I A;  5J3B A;  3CCM A;  1MJE A;  2IX0 A;  4DK3 C;  3RZD H;  4PZ7 A;  3J7Z C;  1IBM L;  5GAG C;  1X3F A;  2HHH Q;  2CFM A;  2ES2 A;  3U4Z A;  2F4V L;  4X62 Q;  4OX9 Q;  4QQB X;  1N34 Q;  1S3O A;  1N32 L;  4GNX A;  1HNX Q;  4PMW A;  3STB D;  3RN5 A;  1Q12 A;  3ERS X;  3PSI A;  2DGY A;  2AWO A;  4GOP A;  3M4O H;  1YZ6 A;  4HJ8 A;  2NVX H;  4C3I H;  3UE1 A;  1HNW L;  1BBW A;  1TWC H;  3MEF A;  4Y52 H;  4ALP A;  1EUJ A;  3KJP A;  5EAY A;  5M5W H;  1K8G A;  4GKK Q;  3RLN A;  3K7U C;  3L2P A;  1YJN A;  2VQE L;  3CCV A;  2Y0S E;  2A19 A;  1IBK L;  2MQH A;  4LF5 Q;  4DR1 L;  5C4X G;  4NXM L;  4LF4 L;  4YWL A;  4LFC Q;  4KHP L;  3J81 c;  3TRZ A;  2K14 A;  1K8A C;  4YWK A;  1W3S A;  5C4X H;  3CF5 A;  1UE7 A;  3KF6 B;  1C9O A;  2YTV A;  3T1H L;  2WAQ E;  4DV7 L;  3VDY A;  1TWA H;  3NEM A;  3GTJ H;  4AQY L;  5GAD C;  2PMZ E;  4B3M Q;  1U0L A;  4X66 L;  3PO2 G;  1L1O A;  2UXC L;  4C3J H;  1N36 L;  3S17 H;  3PO2 H;  1E24 A;  1RL2 A;  1WI5 A;  2YV5 A;  4JI8 Q;  1JB7 A;  4X65 L;  3DLL A;  4JC0 A;  4R4Q A;  4DUZ Q;  4DV3 L;  3L0O A;  2PI2 A;  3TS0 A;  3GTM H;  5JJI A;  4IPC A;  1NE3 A;  5IYD G;  3AEV A;  3HOV G;  4JCV E;  2IHF A;  2ZJR A;  5IYC G;  1VQJ A;  5IYD H;  3F1Z A;  2MO0 A;  4X64 Q;  1Y1W G;  3HOV H;  2YTX A;  4R4O A;  3PUX A;  2PQA B;  5IYC H;  4LF8 L;  1E3P A;  1JJG A;  1Y1W H;  1GKH A;  2EQS A;  3S14 H;  3UDG A;  2JEB I;  4LFA L;  2HIV A;  4DR6 L;  1UE6 A;  3KOJ A;  3CCQ A;  4DR2 Q;  2YU9 H;  5IWA L;  3I2Z A;  2KEN A;  4JI2 Q;  1EQR A;  1UE5 A;  1QVG A;  1J5E Q;  5AJ3 L;  2E2I H;  3CCE A;  4DUY Q;  1KL9 A;  5BR8 Q;  2UUA L;  1PH1 A;  2I5M X;  4B3S Q;  4JOI C;  4HJA A;  4APV A;  1KHI A;  1E1O A;  1XTD A;  1VQ4 A;  3TEH B;  3WWV A;  1I94 Q;  3GTP H;  3I4N G;  2PI2 E;  3CC7 A;  3K7A H;  1VQL A;  3CD6 A;  2NVT H;  4B3T Q;  1FGU A;  5C44 G;  1N33 Q;  2EIF A;  4KI0 A;  3CXC A;  3I4N H;  4JI7 Q;  1PFS A;  4LUO A;  2CQO A;  5C44 H;  4UP9 A;  1Z9F A;  4DR7 Q;  3K0X A;  4R4T A;  2NVQ H;  1SFO H;  1I6H H;  1X3E A;  4K0K Q;  1YHQ A;  3KLW A;  1JMC A;  1FJG L;  1IYJ B;  2R7F A;  3GTG H;  4DR5 Q;  3J81 i;  1YBY A;  4XTC S;  4NXN Q;  1UWV A;  3A5U A;  2Y0S G;  3T1Y L;  1KRT A;  3GD7 A;  5GRO A;  2RHQ B;  1Q8K A;  4DR3 Q;  1HNZ L;  2JE6 I;  1IBL L;  3ULL A;  4DAM A;  4A3F G;  1KD1 C;  1AE2 A;  1X65 A;  3HKZ G;  1OXT A;  4ME3 A;  4A3F H;  3K81 C;  3I7F A;  4YY3 Q;  4DV1 L;  1WCM G;  1L1O B;  1SRU A;  4YHH Q;  3E9I A;  5M3F G;  4LF9 Q;  2WAQ G;  3K80 C;  1P8L A;  4P72 A;  3KFU A;  4DPG A;  1WCM H;  2HHH L;  1NMG A;  4X62 L;  1Q7Y C;  5M3F H;  1N34 L;  2HQL A;  4OX9 L;  1HNX L;  1LTL A;  1N8R C;  1SRO A;  2IHE A;  5HY6 A;  5H1S E;  3S2D H;  1VQI A;  2IX1 A;  2BH8 A;  1HR0 W;  4KLK A;  2R7Z G;  1XMO Q;  3NBH B;  4L5Q A;  3I4O A;  1CUK A;  1E1T A;  1WFQ A;  1KQS A;  3GTO H;  4QL5 A;  3PO3 G;  2UXD Q;  2BA1 A;  2R7Z H;  3RZO H;  3PO3 H;  4A75 A;  5C4J H;  3IRB A;  1CKO A;  1EIF A;  3PUZ A;  4A3C G;  2B29 A;  4LUZ A;  2UUB Q;  4GKK L;  2Q2H A;  1XNR L;  4A3C H;  2DUD A;  3CCS A;  2JA5 G;  4JI3 Q;  3D0F A;  4A3D G;  2VNU D;  1X55 A;  4H02 A;  2XTI A;  4LF5 L;  2JA5 H;  4DV2 Q;  3S1R H;  3SGI A;  4A3D H;  4QIW E;  4LFC L;  1IXR A;  2RCN A;  1MKH A;  2D0O A;  3PF4 A;  5LMN Q;  1C0A A;  3PV0 A;  4LWC A;  1GO3 E;  2UUC Q;  1Q1B A;  2K75 A;  4MTN A;  4RMF A;  4DNI A;  1YJ9 A;  1UE1 A;  4B3M L;  3I4M G;  3RR5 A;  4DR4 Q;  4LF6 Q;  2Q2I A;  3HOZ G;  1XJV A;  5FJ8 G;  1X54 A;  5M5X H;  3I4M H;  4O2D A;  1VQE A;  3GDE A;  3HOZ H;  5FJ8 H;  4JI0 Q;  2Z6K A;  2JQO A;  4DUZ L;  3PF5 A;  4BY7 G;  1L1O C;  4P74 A;  1GVP A;  3HKZ E;  1PH2 A;  1CKN A;  1VS0 A;  3M4P A;  4BA1 I;  2ZTD A;  2K5H A;  4BY7 H;  2ZJQ A;  4GKJ L;  4A3G G;  2Z0S A;  1VQO A;  4OWW B;  1EOV A;  5IT9 c;  3S15 H;  3S1M H;  4KHZ A;  4X64 L;  2OCE A;  4A3G H;  2YTY A;  4WJ4 A;  2GVB A;  1KIX A;  3JAM c;  1CKM A;  1V1Q A;  3EIV A;  1XPO A;  3CME A;  1XNQ Q;  5C0X J;  1NY4 A;  2MFI A;  3J80 i;  5FLM G;  3ULP A;  2H5X A;  1TWF H;  1PH5 A;  2JK8 A;  2WP8 J;  2LXJ A;  2N3S A;  1QUQ A;  1KAW A;  4LUV A;  5GQO A;  3RLO A;  5FLM H;  1PA6 A;  2N49 A;  4JI2 L;  1PVO A;  1A63 A;  1UEB A;  1J5E L;  1A8V A;  3M85 A;  3BZC A;  3LGJ A;  4DUY L;  2ZM6 Q;  4IJH A;  4A3E G;  3CCL A;  3HOY G;  3CCJ A;  3PUY A;  1J6Q A;  1IL2 A;  1VQ7 A;  1WJJ A;  1C7Y A;  4JG2 A;  2FXQ A;  4AYB E;  5IP9 G;  3E9H A;  4GLX A;  3U58 A;  4A3E H;  4B3S L;  3HOY H;  3CQZ H;  4NB3 A;  1VQA A;  1VQB A;  1EWI A;  4DV0 L;  1M90 C;  5JJL A;  5IP9 H;  2VY3 A;  1I94 L;  2CWA A;  4AH6 A;  5K36 G;  1YEZ A;  4B3R Q;  2R6G A;  4B3T L;  4UY8 C;  3G4S A;  5M3M G;  2VQE Q;  1N33 L;  1CSP A;  1VQG A;  3KJO A;  2Q2T A;  1NJI C;  2D62 A;  4UP7 A;  5JEA J;  4EX5 A;  5M3M H;  4DR7 L;  3W1B A;  2D0P A;  1OXX K;  2PNH A;  4K0K L;  1IZ6 A;  3J81 j;  2XGT A;  3RNU A;  2ASB A;  2F4V Q;  1PH4 A;  4RG1 A;  5C0X I;  1XMQ L;  4GNX B;  1VQP A;  1EIY B;  4DR5 L;  2JA7 G;  2F52 A;  3A0J A;  4NXN L;  3CC2 A;  2UXB Q;  1HZA A;  1VQH A;  1PV4 A;  4JI4 Q;  1DGS A;  4DV5 Q;  2JA7 H;  2UXD L;  4GOP B;  4X66 Q;  4DR3 L;  4IOA A;  1B8A A;  1SE8 A;  1GD7 A;  2WFW A;  1Y14 B;  1YIJ A;  2E2J H;  5LMU L;  1VQC A;  1Z47 A;  3L7Z C;  3E0E A;  2NZO A;  4FDB A;  4JI5 Q;  1ASZ A;  3D31 A;  4LF9 L;  3MXN B;  1VQ5 A;  1VQ9 A;  1Q1E A;  1CSQ A;  1LYL A;  2JJQ A;  4C3H H;  1E22 A;  2IY5 B;  4JI6 L;  1X6O A;  4A3I G;  2R93 G;  3G71 A;  4R1J A;  3ULJ A;  2IT1 A;  4JI1 Q;  4A3I H;  1I3Q H;  1HH2 P;  1SN8 A;  2R93 H;  1CKN B;  4POF A;  4GS3 A;  1K83 H;  3FP9 A;  1T9H A;  3CCU A;  1RIP A;  1OXU A;  2KCM A;  2UU9 L;  3F2D A;  4LFB Q;  3A74 A;  2AKW B;  3BJU A;  3EN2 A;  3PIP A;  4LW1 A;  4JYA Q;  4L5R C;  1YJW A;  4JV5 Q;  2I5H A;  2E8G A;  2YYZ A;  3Q8D A;  2JEA I;  1VQM A;  2VL6 A;  2N8N A;  3I55 A;  2UUB L;  3KDF A;  4BBS G;  3FHW A;  3W5O A;  5AJ3 Q;  1JJ2 A;  3EBE A;  4JI3 L;  4BBS H;  5GAH C;  4JBK A;  3KF8 B;  4XIG S;  3TQY A;  1QUQ B;  1GM5 A;  1W2B A;  2UUA Q;  3KF6 A;  4GN4 B;  3S1N H;  1O7I A;  4DV2 L;  4OO1 G;  2WB1 G;  3OTO Q;  2N78 A;  1PH6 A;  2LSS A;  2E5L Q;  2MO1 A;  1M1K C;  1JJC B;  1D8L A;  1TXY A;  1QVC A;  5LMN L;  2K52 A;  3H3V I;  5ELN A;  3M4Q A;  3HOU G;  1Q46 A;  4O0A A;  2F3I A;  5LMN W;  2ZTE A;  4GNX C;  1I50 H;  4P71 A;  1PH3 A;  2V1C C;  4DKA C;  1YVC A;  3PUV A;  4OXP A;  1EYG A;  2KHJ A;  5DLQ E;  3AYH B;  3A5Z B;  4IPG A;  3HOU H;  4DR4 L;  4LF6 L;  4GOP C;  3UDX A;  4AYB G;  2VS1 A;  3UDF A;  4WJ3 M;  3CPW A;  2RHS B;  2KHI A;  4HID A;  1B70 B;  3UDI A;  4J15 A;  4A3B G;  4JI0 L;  1V9P A;  4X6A H;  2HT1 A;  1WYD A;  1G51 A;  4EQ5 A;  4A3B H;  1K73 C;  3S16 H;  4P73 A;  4OWT B;  4NPS A;  3G6E A;  2OWO A;  4POG A;  2PQA A;  3J7A 5;  4IFD G;  2OTL A;  4DV4 Q;  2JA6 G;  3GTK H;  1D7Q A;  4Y7N H;  3CW2 C;  1LUZ A;  1VQF A;  2JA6 H;  4BBR G;  3HFZ B;  2BA0 A;  1PH9 A;  2B63 G;  1N9W A;  1BVS A;  4DV1 Q;  4A3J G;  5C0X G;  4TVA B;  1EQQ A;  4BBR H;  1Y1V G;  1XNQ L;  2B63 H;  4R4C A;  1U5K A;  5M5Y H;  1YHB A;  2CKZ B;  4A3J H;  1Y1V H;  2AHO B;  3PCO B;  4JI8 L;  4DV6 Q;  3GTL H;  2NN6 G;  3F8T A;  4A3L G;  4UPA A;  4L5S A;  4QGU A;  4HJ9 A;  4LF7 Q;  2KCT A;  2K5N A;  1MIU A;  1XPU A;  1K9M C;  1HR0 Q;  3F2B A;  2JA8 G;  1VQ6 A;  2ZM6 L;  1E7Z A;  4P75 A;  1NTG A;  4IFD J;  2R92 G;  3DM3 A;  1BKB A;  1AE3 A;  2JA8 H;  3CMA A;  1YI2 A;  3ER0 A;  3KYH C;  3CPF A;  3HOX G;  4PZ8 A;  2R92 H;  1K0R A;  3PUW A;  3AQQ A;  4MNO A;  2VQF Q;  1S72 A;  4PG3 A;  4QJF A;  2E2H H;  4OO1 I;  3HOX H;  1YHA A;  1R9T H;  3NEL A;  2C35 B;  1G29 1;  2I0Q A;  2WB1 E;  4B3R L;  1IBM Q;  1XNR Q;  4DR2 L;  1HJP A;  4YCU A;  1OXS C;  2HIX A;  1HZB A;  1B7Y B;  5JEA G;  2BH2 A;  1N32 Q;  2K4K A;  4LNQ A;  1A62 A;  3KDF B;  4GN5 A;  1FVI A;  1P16 A;  3AFP A;  4JBW A;  4DAY B;  4A76 A;  2QEX A;  5BR8 L;  1HNW Q;  3CP0 A;  1KRS A;  4JI4 L;  4BXX G;  2UXB L;  2RF4 A;  4DV5 L;  5GAE C;  1WOC A;  1Q86 C;  1PHJ A;  4BY1 G;  2A8V A;  4GN3 B;  3M3Y H;  4BXX H;  1K3R A;  2ALY B;  2K5V A;  4AIM A;  2GVA A;  4BY1 H;  1LM0 A;  4IFD I;  1TWH H;  2ZJP A;  4IPH A;  4JI7 L;  2L15 A;  1IBK Q;  5JJK A;  4YCW A;  1SR3 A;  4JI5 L;  4JBJ A;  1VQD A;  1ASY A;  3M9B A;  4YWM A;  3CAM A;  4DR1 Q;  4NXM Q;  4UP8 A;  4LF4 Q;  2NVY H;  3HOW G;  4KHP Q;  2CWP A;  2OQK A;  3HOW H;  3H3V H;  2ATW A;  3AFQ A;  4GKJ Q;  2VUM G;  3I56 A;  3W1G A;  3H0G G;  3PGZ A;  4JI1 L;  3T1H Q;  4DV7 Q;  3K8A A;  2VUM H;  4AQY Q;  3OYY A;  2NN6 I;  5FLX c;  3H0G H;  4OWX B;  2UXC Q;  4YCV A;  3RLF A;  1SLJ A;  1N36 Q;  2NZH A;  4JBM A;  4LFB L;  3ICE A;  4JYA L;  2AWN A;  4JV5 L;  1BBU A;  1X56 A;  4HJ7 A;  3B6Y A;  2Q2U A;  4GLV B;  4YY3 L;  4QY7 A;  4X65 Q;  2B3G A;  1TWG H;  2JA9 A;  4YHH L;  2GN5 A;  3S1Q H;  3G48 A;  3FKI G;  4L5T A;  3ZJY C;  5C3E G;  4DV3 Q;  2OTJ A;  1H95 A;  5IYB G;  3M7N A;  4GLA C;  2AMC B;  1PH7 A;  3FKI H;  5C3E H;  1Q81 C;  3U4V A;  5IYB H;  4IO9 A;  2I5L X;  1JE5 A;  3OTO L;  2KBN A;  1L0W A;  2E5L L;  2OQ0 A;  4HIM A;  2VW9 A;  4MZ9 A;  2A1A A;  4HJ5 A;  2ZTC A;  1PYS B;  1HZ9 A;  4DV0 Q;  1XMO L;  1L2F A;  4OON A;  4LF8 Q;  1PYB A;  3S2H H;  4LFA Q;  4DR6 Q;  3STB C;  4A3L H;  4A93 G;  2K50 A;  1G6P A;  3JAM i;  1MJC A;  5IWA Q;  1NBW A;  4HIK A;  3TRE A;  4A93 H;  1VCI A;  1QZH A;  4JOI A;  4HIO A;  3U50 C;  1YIT A;  4R4I A;  1QZG A;  3S24 A;  3OW2 A;  4A3K G;  3RN2 A;  1A0I A;  1XMQ Q;  2QGQ A;  1FL0 A;  1VQ8 A;  4A3K H;  3F2C A;  1PH8 A;  3BU2 A;  4C2M H;  5IE8 A; 
#chains in the Genus database with same CATH topology
 2BE5 C;  2LXK A;  5FO9 B;  4DV4 L;  4TQU S;  3BZK A;  2R7D A;  2UUC L;  3HS0 C;  3HOX B;  3H15 A;  1R9T B;  4TKO B;  5CV8 A;  1VQK A;  1U4P A;  1CI3 M;  1ZYR C;  1PTO D;  1XPR A;  1X9N A;  1EQT A;  3JC6 6;  5IP7 G;  1B44 D;  1YNX A;  3CC4 A;  3MTS A;  4B08 A;  1QE6 A;  3T1Y Q;  3SHL A;  4PZ6 A;  1LT4 D;  4WFN 3;  1HNZ Q;  2LS0 1;  4DAP A;  1BDO A;  2UU9 Q;  1CK1 A;  3UE0 A;  3PIO A;  2XWJ B;  3CKI B;  4A3M H;  1EZ6 A;  1NAP A;  1IBM L;  3PIP 3;  1E2V A;  2ES2 A;  3U4Z A;  3AB9 A;  1N34 Q;  1IKM A;  2DJG C;  3PQI A;  2NVY B;  5BN3 A;  2DGY A;  2VXW A;  3J80 L;  4HJ8 A;  3CRL C;  2DNE A;  1HNW L;  2L11 A;  1SDF A;  1LAC A;  1UNS A;  4Y52 H;  1EUJ A;  5M5W H;  2E75 C;  3KBX A;  1E0B A;  3C1E A;  3MXN A;  4HED A;  3L2P A;  4QUF A;  4HN7 A;  5I2X A;  3CCV A;  2RSO A;  2I07 B;  1TWG B;  3TME A;  2NB0 A;  4E6I A;  2SOB A;  4LF4 L;  4LFC Q;  3VA5 A;  1K8A C;  3I8Z A;  1W3S A;  4YWK A;  5C4X H;  3CF5 A;  4K2L A;  3D8G A;  2VB3 X;  2YTV A;  4TRD A;  3VDY A;  1LT6 D;  3S2H B;  2IJ0 A;  2G5D A;  3PO2 G;  3GTP B;  2MPM A;  2UXC L;  4C3J H;  3S17 H;  1RL2 A;  1TU2 B;  2YV5 A;  1B50 A;  4BWG B;  2IL8 A;  5D3I B;  1A3U A;  4KN4 C;  2IHF A;  2CW0 C;  2O5I C;  5IYD H;  1WTP A;  3F1Z A;  2MO0 A;  2KEC A;  5IYC H;  1E3P A;  1Y1W H;  1GKH A;  2WAC A;  3S14 H;  5LL6 X;  4DR6 L;  3EVQ A;  4ABN A;  3QWN A;  2DY8 A;  3J7Y W;  4JI2 Q;  1NCV A;  1UE5 A;  1YNJ D;  5AJ3 L;  3CCE A;  5IT9 L;  2KQ3 A;  1E2W A;  1PTO H;  4DUY Q;  1SBB B;  1GUO A;  2UUA L;  1PZJ D;  1KAB A;  3NQI A;  4ZKB B;  4JOI C;  3Q23 A;  2V4D A;  1KHI A;  1E1O A;  1XTD A;  3OOC A;  3WWV A;  3K58 A;  2IWH A;  1YNN D;  5C5L A;  3T51 B;  3GTP H;  4G7O C;  1VQL A;  1N33 Q;  5C4J B;  5I2Y A;  2KJX A;  4DR7 Q;  2NVQ H;  3N52 A;  2K1B A;  3EQL C;  1YHQ A;  1G6Z A;  4DR5 Q;  1G2S A;  2NTS A;  1EOT A;  2Q8I B;  1UWV A;  3H91 A;  2LKV A;  2Y0S G;  4OIJ A;  3NUC A;  1Q8K A;  4DR3 Q;  3C46 A;  2JE6 I;  2QDB A;  1IBL L;  1F9S A;  1TWC B;  4P2C B;  2O5J C;  1S5C D;  1AE2 A;  2HDL A;  2VB2 X;  4DV1 L;  1WCM G;  1OO9 B;  5M3F G;  3NWT A;  2HHH L;  2A6H D;  1Q7Y C;  1SMY D;  4RKB A;  4H7B A;  1LTL A;  1N8R C;  5HY6 A;  1QWY A;  1ROD A;  2R7Z G;  1ENA A;  1XMO Q;  3NE5 B;  4O42 A;  2TSS A;  4QL5 A;  3SK5 A;  3IRB A;  4IUP A;  4HCE A;  5C4J H;  1WTX A;  4GKK L;  1SYF A;  5CMD A;  2J4X A;  2JA5 G;  4A3D G;  2L9H A;  4DXG A;  4I65 A;  3L9A X;  4DNT B;  1DZ1 A;  3PF4 A;  2FMC A;  5LMN Q;  2PW5 A;  3OW7 A;  1HTL D;  3HOV B;  4K5V A;  1Y8P B;  1JWU D;  2QKI C;  2PNR C;  1O78 A;  3I4M G;  2EYO A;  3H6M A;  2Q2I A;  3HOZ G;  5A2Q E;  1X54 A;  3GV3 A;  3DEP A;  2EY5 A;  3K5M A;  2XN9 C;  3V05 A;  4QCL A;  2JQO A;  1D5Z C;  5HGT A;  3HZX A;  4P74 A;  1GVP A;  3HKZ E;  2F0O A;  2WKC A;  4OWW B;  1EOV A;  1SSO A;  4KHZ A;  4X64 L;  5COR A;  2GVB A;  1KIX A;  3JAM c;  3MAQ A;  3K7A B;  1XNQ Q;  1B9N A;  2NVT B;  5C0X J;  3PIO 3;  2MP1 A;  4KTA A;  3I4N B;  1DXM A;  4EVO A;  1PH5 A;  2N3S A;  3RLO A;  3QR8 A;  1I6H B;  1UEB A;  1F2Y A;  2XRS D;  4IJH A;  3HOY G;  3CCJ A;  2OF1 A;  1IL2 A;  4K6D A;  1C7Y A;  1ZXT A;  4A3E H;  3AMU A;  2B2U C;  1FNV A;  1XTC D;  4DV0 L;  5JJL A;  1I94 L;  1EYA A;  5K36 G;  1KDA A;  3E0J A;  3G4S A;  4A3F B;  1CQF A;  3RD4 A;  2Q2T A;  3HKZ B;  1NJI C;  1STA A;  3N6R A;  1GUG A;  1XMQ L;  4GNX B;  3S2D B;  3A0J A;  4NXN L;  3CC2 A;  3W2D A;  1HZA A;  2FIN B;  1PV4 A;  1DGS A;  3VR4 A;  2UXD L;  1GD7 A;  1YIJ A;  3RZO B;  3PO3 B;  1STH A;  1PDQ A;  1Z47 A;  5ELD A;  3E0E A;  2NZO A;  5CV4 A;  3J81 E;  2D9U A;  2RCF A;  4LF9 L;  3DWA A;  3OMG A;  1CSQ A;  2WII B;  3R2T A;  1II3 A;  3BVM A;  4R1J A;  3ULJ A;  1MBY A;  4A3I H;  1SN8 A;  1CKN B;  1UUP A;  3FP9 A;  1BNZ A;  1HHV A;  2UU9 L;  3BJU A;  4JYA Q;  4LW1 A;  1SNC A;  4HAE A;  1YJW A;  4JV5 Q;  2E8G A;  5M5X B;  5KIX A;  4ZLT F;  1QIL A;  3EBE A;  1Y8O B;  1V1O A;  5I6W A;  3TQY A;  2R3Z A;  4GN4 B;  5FLX L;  2WB1 G;  2N78 A;  1A3V A;  2F0S A;  4ZRZ A;  1CTM A;  2E5L Q;  4OO1 H;  4BY7 B;  2X6L A;  1D8L A;  2XIW A;  1QVC A;  1EY0 A;  2K52 A;  1RCV D;  4RH6 A;  3S1M B;  3U9S A;  1Q46 A;  5LMN W;  3NQT A;  4GNX C;  4A3G B;  1PRT D;  4P71 A;  2V1C C;  4DKA C;  1EYG A;  3Q6S A;  3A5Z B;  4IPG A;  4DGZ A;  4LF6 L;  1A2T A;  1G2T A;  2AUK A;  2K5Q A;  3UDX A;  3CPW A;  2RHS B;  1B70 B;  2A68 D;  4J15 A;  2F0H A;  4QMG A;  1G51 A;  4EQ5 A;  4A3B H;  1K73 C;  2OEO A;  2EJM A;  1L0Y B;  2JYO A;  3T16 A;  4OWT B;  3T4A C;  5C4H A;  3G6E A;  2OTL A;  4DV4 Q;  3CW2 C;  4IFD H;  1VQF A;  2B39 A;  1EYC A;  1N9W A;  4A3J G;  4TVA B;  4CDE C;  2CKZ B;  1Y1V H;  1UAP A;  3GTL H;  3F8T A;  1BCP B;  4QGU A;  4HJ9 A;  1T5X D;  2LFN A;  1K9M C;  3TP6 A;  1E7Z A;  1LTB D;  4IFD J;  3DM3 A;  4NDX A;  5I6Y A;  3CMA A;  2CH4 A;  1BF4 A;  3J80 E;  2F0K A;  4IUQ A;  2F0U A;  5IGC A;  3ER0 A;  3KYH C;  3HOX G;  4PZ8 A;  2R92 H;  3AQQ A;  4PG3 A;  2OT2 A;  2JXM B;  3NEL A;  1TVX A;  2K05 A;  2I0Q A;  5CBA E;  1IBM Q;  4CJ2 C;  4QIW B;  1LTG D;  1HZB A;  1B7Y B;  1A62 A;  4C3H B;  5JEA H;  4R8I A;  3BZD B;  4GN5 A;  5IIF A;  1RTO A;  1LTT D;  3F2U A;  4XDX A;  1HNW Q;  2R93 B;  1EY8 A;  4KJN A;  4JI4 L;  3RUZ A;  1DCZ A;  1RTN A;  4BXX H;  5EQ0 A;  4QF4 A;  4IUN A;  3K0Y A;  1IHZ A;  1VQD A;  1NNX A;  4UP8 A;  1IYU A;  4LF4 Q;  4BBS B;  5LHY 1;  2G9H D;  1CQV A;  4RHS A;  2CWP A;  3FPP A;  3H3V H;  1ENF A;  1K28 A;  4RFB A;  4Q5V A;  5FKA C;  1BCP C;  5CV5 A;  4JI1 L;  2Z6B A;  4U67 3;  3BG3 A;  2UXC Q;  3RLF A;  4JBM A;  1F9R A;  1SYD A;  3ICE A;  3HOU B;  1IKL A;  1Z6H A;  2B2U A;  1H95 A;  2OTJ A;  5IYB G;  2B2T A;  5IT9 E;  1W6J A;  5C3E H;  3BYT B;  3QOL A;  1L0W A;  2OQ0 A;  1SND A;  2VW9 A;  1S5E D;  4HR7 B;  4HJ5 A;  1PYS B;  3U9O A;  1TQO A;  1XMO L;  4A3L G;  4OON A;  1VMC A;  4DR6 Q;  2JA6 B;  1G6P A;  4HIK A;  3EJI A;  3TRE A;  2B63 B;  5M5Y B;  1I4X A;  3OW2 A;  1ILP A;  4IUR A;  1FL0 A;  3VYT A;  1JOK A;  1PH8 A;  2JA8 B;  2EY1 A;  4C3I B;  1AH9 A;  2AQ3 B;  3M7G A;  1I5F A;  1X3G A;  1Q3L A;  3OPO A;  1NMF A;  3A7A B;  1EFW A;  4CHT B;  3HKS A;  5G3L D;  4IOC A;  1TS2 A;  2ID0 A;  4RCO A;  1Q8I A;  1F2L A;  1PXU A;  2VZA A;  1D5M C;  4DV6 L;  2F03 A;  1D5X C;  4LF7 L;  2F0F A;  4IJL A;  1IBL Q;  1Q82 C;  2Z6K C;  1TWA B;  1VQN A;  4A4I A;  4G7H C;  2IX0 A;  4BY1 B;  4ZAI A;  4DK3 C;  4PNY A;  3J7Z C;  2EOT A;  2B2W C;  5J22 A;  2HHH Q;  1S3O A;  4GNX A;  4PMW A;  2E74 C;  3IL8 A;  3HOW B;  3M4O H;  3QIA A;  1KLU D;  1B9M A;  4C3I H;  3UE1 A;  1BBW A;  4DU9 A;  3LWU A;  3H0G B;  3KJP A;  1CHP D;  1SYC A;  5DNF A;  2QDL A;  4GKK Q;  1F77 A;  1YJN A;  3J7A V;  2FFK B;  2BE5 D;  1IBK L;  2KA7 A;  4IUV A;  5A35 A;  3S1Q B;  3Q22 A;  5J1Z A;  3C1F A;  3TRZ A;  1H9S A;  3FKI B;  1XWE A;  1GHJ A;  1UE7 A;  3SEB A;  1C9O A;  1ZYR D;  2KED A;  1NR2 A;  2WAQ E;  1TWA H;  3GTJ H;  5GAD C;  3DHQ A;  2BDO A;  1L1O A;  2K5W A;  3Q0A A;  2EYJ A;  2NZ1 D;  4JI8 Q;  3DLL A;  4JC0 A;  2Q8T A;  3WOE A;  5KYL A;  2PI2 A;  2K7V A;  5C6A A;  5G3L F;  1C8C A;  2Q8R E;  3HOV G;  4A3K B;  2ZJR A;  1VQJ A;  1TII D;  4X64 Q;  1JJG A;  4GZY C;  2JEB I;  4LFA L;  3CCQ A;  1TS3 A;  3KOJ A;  1LV9 A;  2KUM A;  5KEE A;  2YU9 H;  4KY7 A;  5IWA L;  3SE0 A;  5C4Z A;  1QVG A;  2HCC A;  1L0X B;  1KL9 A;  5ELC A;  2I5M X;  4RHR A;  1SYG A;  1TS5 A;  1F2M A;  1Y8N B;  2K33 A;  1VQ4 A;  1I94 Q;  5ELF A;  3I4N G;  3OIQ A;  3TZU A;  3CD6 A;  4A3M B;  5E4X A;  2EIF A;  4KI0 A;  4LAA A;  4KD3 A;  3CXC A;  3SK8 A;  1EQV A;  2F3V A;  5C44 H;  4UP9 A;  1Z9F A;  2MGS A;  3K0X A;  5EKK A;  1X3E A;  4XQQ A;  2EY2 A;  3D4R A;  4X3T A;  3KLR A;  3GTG H;  3J81 i;  3ITP A;  4ZUJ A;  4NXN Q;  3A5U A;  3SK4 A;  3GD7 A;  5GRO A;  2FJ2 A;  1JE4 A;  3W3A A;  4M1U B;  1RDP D;  4DAM A;  1GXD C;  4A3F G;  2RDG A;  3HKZ G;  1R4P B;  5M5W B;  2RQX A;  5JOB A;  3K81 C;  1FNU A;  3I7F A;  4YY3 Q;  4I7Z C;  5JVH 3;  2CW0 D;  1SRU A;  2IPK D;  2K28 A;  3E9I A;  4YHH Q;  4LF9 Q;  4P72 A;  3SVM A;  1NMG A;  4X62 L;  1UEA B;  5H1S E;  1SYE A;  4L6T B;  2JN4 A;  5FLX E;  5C4X B;  1VQI A;  4HSP A;  1HR0 W;  4KLK A;  1Z7T A;  3PO3 G;  1CUK A;  1WFQ A;  3GTO H;  1SNQ A;  3I4L A;  2FMM A;  4A75 A;  1NR4 A;  1E2Z A;  5JAV A;  1D1K A;  4A3C G;  3PUZ A;  4C3J B;  2K01 A;  3S17 B;  2B29 A;  2DY7 A;  4XQN A;  3D0F A;  1V1P B;  4H02 A;  2XTI A;  4LF5 L;  3S1R H;  1IL8 A;  1X3P A;  4FVM A;  1C0A A;  3PV0 A;  1K8O A;  1STY A;  5EGT A;  1AZQ A;  1Q1B A;  1LO5 D;  4RMF A;  1YJ9 A;  1Y1W B;  1UE1 A;  2PW7 A;  5HUR A;  3ONA B;  3S14 B;  4LF6 Q;  5FJ8 G;  2HDM A;  2M2L A;  2EVB A;  4O2D A;  2PZU A;  4PMB A;  2HD3 A;  2Z6K A;  4DN4 M;  5E1F A;  4K6L A;  3PF5 A;  4NMZ A;  4BY7 G;  1PTO B;  2B8F A;  3M4P A;  5T1G A;  2K5H A;  5IGF A;  4A3G G;  1VQO A;  2B2W A;  4K5W A;  3S15 H;  2YTY A;  2WIN B;  1V1Q A;  1XPO A;  2MFI A;  3J80 i;  5FLM G;  2WP8 J;  2LXJ A;  3FRP B;  1KAW A;  1VDZ A;  4N9P A;  1EY5 A;  2NVQ B;  4DNR B;  1A8V A;  3BZC A;  4WOR A;  3CCL A;  1J6Q A;  3MHB A;  1I3Q B;  1VQ7 A;  4GLX A;  4B3S L;  4AYB E;  3CQZ H;  4NB3 A;  2PZW A;  5IP9 H;  2CWA A;  4FXG C;  2EYM A;  2R6G A;  1JOQ A;  4B3T L;  4EQP A;  2D62 A;  5M3M H;  1CM9 A;  2D0P A;  4K0K L;  1IZ6 A;  2XGT A;  1CHQ D;  3Q24 A;  1FNW A;  1VQP A;  1I4H A;  2JSO A;  1A3T A;  2QF7 A;  4JI4 Q;  1PTO C;  2JA7 H;  4GOP B;  4X66 Q;  4X3U A;  3I70 A;  1SE8 A;  1TY0 A;  1Y14 B;  2E2J H;  2E2D C;  1VQC A;  2H1E A;  3D4W A;  4C3H G;  5I9O A;  2B2V C;  5CYU A;  1X6O A;  2R93 G;  4JPB W;  4JI1 Q;  1I3Q H;  1HH2 P;  3I91 A;  1IYV A;  4GS3 A;  2NWG A;  5CBE E;  4XQJ A;  3OWF A;  3NTK A;  1MI2 A;  1SE2 A;  3MEH A;  3P20 A;  4L5R C;  2RVL A;  3K5N A;  3Q8D A;  2JEA I;  1PZK D;  2VL6 A;  1VQM A;  4BBS G;  3KDF A;  4V19 0;  3FHW A;  3G6J B;  5FO7 B;  4DAY A;  1HFG A;  1SE3 A;  3KF8 B;  1QUQ B;  1GUN A;  4DV2 L;  2MO1 A;  5K5P A;  3NBI A;  1M1K C;  3MZ5 A;  1TXY A;  5EKL A;  3MFY A;  2QIL A;  3H3V I;  3M4Q A;  3HOU G;  4O0A A;  2F3I A;  2ZTE A;  3PUV A;  4OXP A;  2IX3 A;  3NPP A;  4DR4 L;  4RGT A;  2B2Y C;  4GOP C;  2KVM A;  4HID A;  4C1N K;  1J8I A;  4JI0 L;  1V9P A;  4X6A H;  1A6X A;  3BYY B;  1WYD A;  1U4L A;  1KAA A;  2ENB A;  4P73 A;  2OWO A;  1D7Q A;  3GTK H;  2JA6 G;  4CKE A;  1ET9 A;  4A3E B;  4Y7N H;  3LWE A;  1ET6 A;  1PH9 A;  2B63 G;  1ZEQ X;  1BVS A;  1EIG A;  3R8B A;  4BBR H;  1PMR A;  4R4C A;  3VR3 A;  2L5T A;  3DXJ C;  5C0X H;  3PCO B;  4JI8 L;  4DV6 Q;  3H94 A;  4UPA A;  4L5S A;  2BDN A;  4LF7 Q;  2K5N A;  1EY9 A;  1XPU A;  2NN6 H;  2RSN A;  4Z9C B;  3F2B A;  2JA8 G;  4C3I G;  2ZM6 L;  1NTG A;  3C2P A;  1BKB A;  1XYI A;  1YI2 A;  1JQY D;  1STE A;  5I4D A;  4J6H A;  4L8J A;  4MNO A;  3GP7 A;  1S72 A;  2IW3 A;  1YHA A;  3SK6 A;  2C35 B;  1I4Q A;  4RGN A;  5E4W C;  2E76 C;  1XNR Q;  1OXS C;  2ZXP A;  4PQX A;  2K4K A;  3SDZ A;  1YNN C;  2HQE A;  1WTO A;  2QEX A;  5IOD A;  4A3I B;  3NSW A;  1KRS A;  4K8J A;  4DV5 L;  1VF5 C;  2F0V A;  3R2I A;  1Q86 C;  4BY1 G;  3M3Y H;  5DAU A;  1K3R A;  2EDG A;  2GVA A;  4KJO A;  1LM0 A;  1AZP A;  1TWH H;  2L15 A;  1IBK Q;  4YCW A;  1SR3 A;  4JI5 L;  2N88 A;  3HOW G;  4M8A A;  4IUT A;  1B4O A;  3P75 A;  4ZK9 B;  2A69 C;  3CU7 A;  2RDF A;  4GKJ Q;  1B2T A;  5EPK A;  3I56 A;  3H0G G;  2VUM H;  3OYY A;  2ZXR A;  4RGM A;  4DXF A;  4YCV A;  3ND8 A;  2NZH A;  2AWN A;  1BBU A;  1V1P A;  4YY3 L;  4MTK A;  3OMC A;  5EPL A;  4YHH L;  2GN5 A;  3G48 A;  3FKI G;  1SNO A;  3K5L A;  2AMC B;  3WDN A;  1PH7 A;  4A3B B;  4OL7 A;  2I5L X;  5E3F A;  2DNC A;  2KHS A;  4MZ9 A;  4HMJ A;  1L2F A;  4CDF C;  1PYB A;  4LFA Q;  3OWE B;  3STB C;  2K50 A;  2ZT9 C;  1WTW A;  5IWA Q;  1NBW A;  4A93 H;  1QZH A;  4JOI A;  3U50 C;  3V96 A;  1Y1V B;  4KY5 A;  1QZG A;  3GTL B;  1WD1 A;  4A3K G;  3RN2 A;  1S5F D;  1PYW D;  3F2C A;  1HQM C;  1HUM A;  4LJZ C;  4C2M H;  1JB7 A;  5FK9 C;  2B2V A;  3VR5 A;  2R92 B;  1S40 A;  1SMX A;  1KC8 C;  4WJ4 A;  2F1M A;  3FVQ A;  4IQZ A;  1OTC A;  3KLS A;  1GHK A;  4QUC A;  3J80 c;  3NEN A;  3PMF A;  5IY0 A;  3GTQ H;  4WRD A;  3UI2 A;  4EQN A;  1BCP D;  5HGQ A;  1PFN A;  3CCR A;  4UDU C;  2SNM A;  1JOO A;  1HZC A;  3G7L A;  3NWS A;  5IP7 H;  1KDC A;  2NUC A;  4CKB A;  1QVF A;  5E7N A;  4A3M G;  1SJH D;  4HSV A;  1WTR A;  1JT8 A;  1O7Z A;  4DK6 C;  1QB5 D;  1STN A;  1MSG A;  3BDL A;  2ICE C;  3RZD H;  4PZ7 A;  5JJZ A;  1O7L A;  4KN7 C;  1X3F A;  2CFM A;  4ZQ3 A;  5CGK A;  4X62 Q;  2NTT A;  1N32 L;  5CV6 A;  2AUJ D;  1BBX C;  2AWO A;  4GOP A;  2NVX H;  4ALP A;  3L3O C;  5EAY A;  1KLG D;  2LMC B;  2JP1 A;  3RLN A;  3R93 A;  1PRT B;  1F9Q A;  2CVR A;  3SXH A;  2Y0S E;  2O4X A;  2H4O A;  2MQH A;  3GV6 A;  4LF5 Q;  4DR1 L;  1LTR D;  5C4X G;  1H9M A;  2XVS A;  1WTQ A;  4YWL A;  4NXM L;  1PFB A;  4KHP L;  2XRQ D;  2K14 A;  3V2T A;  5C3E B;  1LLR D;  5C3W A;  1K3B C;  4RGO S;  4KY6 A;  2A6E C;  3T1H L;  4K14 A;  4DV7 L;  1D1I A;  4C3J G;  4AQY L;  4J8Q A;  2PMZ E;  4C56 C;  1U0L A;  4X66 L;  2EY6 A;  4FF3 A;  3PO2 H;  1E24 A;  1DOL A;  1WI5 A;  4X65 L;  4R4Q A;  3MA2 B;  4DV3 L;  3BVG A;  3GTM H;  5JJI A;  4IPC A;  5IYD G;  1BCP F;  1AP0 A;  1HFN A;  4JCV E;  5IYC G;  3O13 A;  1Y1W G;  3BDC A;  5EJW A;  2CHB D;  3H3V C;  2PQA B;  4LF8 L;  3MXG A;  2HIV A;  1UE6 A;  1V8Q A;  3I2Z A;  2KEN A;  2MHV A;  1EQR A;  2E2I H;  3K59 A;  4XXE A;  4UHV A;  1PRT C;  1FYC A;  5BR8 Q;  3D4D A;  4X3K A;  5EPJ A;  4B3S Q;  1X3Q A;  2Z4I A;  4ID6 A;  3CC7 A;  4B3T Q;  1FGU A;  2X6G A;  2F0D A;  1PFS A;  4LUO A;  1WTV A;  4OHJ A;  2CQO A;  1SEB D;  4RCN A;  3A54 A;  2HCI A;  3HEJ A;  1SFO H;  4K0K Q;  3KLW A;  1O80 A;  1JMC A;  1FJG L;  3WOF A;  4KHV A;  1YBY A;  4FF1 A;  4XTC S;  2EZV A;  3M4O B;  1KRT A;  2RHQ B;  1QG7 A;  4KKT A;  1FGB D;  1QOH A;  3ULL A;  1QNU A;  1BUV T;  3E6Z X;  2HUG A;  1RHP A;  3X3M A;  2F0J A;  3TP7 A;  3I4M B;  3K80 C;  3KFU A;  1WCM H;  4OX9 L;  5M3F H;  2HQL A;  2PO4 A;  1HNX L;  1SRO A;  5TSS A;  3QJY A;  3I4O A;  1E1T A;  2XSC A;  4OEM B;  3GTJ B;  2AQ1 B;  2BA1 A;  2R7Z H;  4F8M A;  1CKO A;  1EIF A;  1O7Y A;  5BN5 A;  2DJF C;  1XNR L;  2DUD A;  5JVG 3;  1TKW B;  4ODG A;  5T1I A;  1X55 A;  3NTH A;  2JA5 H;  4DV2 Q;  4A3D H;  1KTK A;  3DEO A;  2RCN A;  1MKH A;  2D0O A;  2I46 A;  4WJW A;  2QW7 A;  1GO3 E;  1AEX A;  2K75 A;  5KNB A;  4B3M L;  4G4K A;  4DR4 Q;  3RR5 A;  5M9O A;  1ONL A;  2KEE A;  2YU9 B;  2EYF A;  1VQE A;  3I4M H;  5IGD A;  3HOZ H;  4JI0 Q;  1FD7 D;  4DUZ L;  3KLS X;  1PH2 A;  3VR6 A;  1CKN A;  1HXY D;  1F9P A;  4PMC A;  2ZTD A;  4GKJ L;  2J0T D;  2Z0S A;  4TSS A;  4B9X A;  2F0N A;  3A8K E;  3CME A;  2Z1C A;  1RF2 D;  4DFA A;  4NW2 A;  1TWF H;  2F4V Q;  1PA6 A;  5C44 B;  4LUV A;  1PVO A;  1J5E L;  3M85 A;  1SNP A;  2ZM6 Q;  2F0E A;  1NSN S;  5JPN C;  4A3E G;  3GTG B;  3PUY A;  4Q0F A;  1HQR D;  1WJJ A;  4JG2 A;  2FXQ A;  3U58 A;  1CA6 A;  3E9H A;  3HOY H;  1S4Z A;  5EKI A;  1EWI A;  1WVL A;  1M90 C;  3A55 A;  1DYQ A;  1DM0 B;  1U4R A;  3CRK C;  1YEZ A;  4CDC C;  4UY8 C;  1TS4 A;  2VQE Q;  3KJO A;  5K36 H;  4C1N I;  3HRZ C;  2K6A A;  3URY A;  1HUN A;  1IW7 C;  2WAQ B;  3RNU A;  2ASB A;  4RG1 A;  2EYL A;  3ERO A;  3TDQ A;  5C0X I;  2F0P A;  4RWS C;  3JAM L;  2F52 A;  4DV5 Q;  2MJ8 A;  4IOA A;  3GTO B;  1B8A A;  2SEB D;  1I50 B;  2WV6 D;  1SJE D;  3L7Z C;  4FDB A;  3I73 A;  4JI5 Q;  1Y69 U;  1VQ5 A;  1VQ9 A;  1Q1E A;  1LYL A;  3I3C A;  1E22 A;  5LL6 S;  4A3I G;  3S1R B;  3K5O A;  2QCP X;  3G71 A;  5ISR A;  1K83 H;  3DWQ A;  1RIP A;  1OXU A;  2KCM A;  3KUP A;  1B3A A;  2RDH A;  2YYZ A;  3MFG A;  4EQO A;  3NTI A;  2N8N A;  2UUB L;  1JJ2 A;  3D6W A;  4JI3 L;  3BVZ A;  1ILQ A;  5GAH C;  4JBK A;  4XIG S;  2J7Z A;  1W2B A;  4OO1 G;  3S1N H;  1O7I A;  4YIJ A;  4ZYS A;  4F88 A;  1JJC B;  1EWH A;  3S15 B;  1I50 H;  1PH3 A;  2E2H B;  2X69 A;  2G9D A;  5DLQ E;  3AYH B;  1EZ8 A;  2VS1 A;  4WJ3 M;  2KHI A;  3UDI A;  4A3B G;  1DJR D;  2F0G A;  1SYB A;  3TSS A;  1HPC A;  1H9K A;  3RMH A;  3S16 H;  1JWM D;  2C9O A;  4NPS A;  1H9R A;  4IFD G;  2PQA A;  1GOZ A;  2XWB B;  1LUZ A;  3CQZ B;  4PV1 C;  2BA0 A;  1LAB A;  4FO2 A;  1EQQ A;  1Y1V G;  4LMQ D;  1U5K A;  1YHB A;  4A3J H;  3FPU B;  5BN4 A;  5M3M B;  3EA6 A;  3IFD A;  3H09 A;  5C3X A;  2KCT A;  1MIU A;  3EFX D;  1VQ6 A;  4DK1 A;  4O1N A;  1TR5 A;  2R92 G;  1HCZ A;  4NP5 A;  3TN2 A;  2NYZ D;  1B1Z A;  1K0R A;  2JA7 B;  4QJF A;  2E2H H;  4OO1 I;  3HOX H;  2E2J B;  1R9T H;  1G29 1;  3T13 A;  4B3R L;  2PQE A;  5KGU A;  1HJP A;  4YCU A;  2HIX A;  3BDO A;  5JEA G;  3TBI B;  1N32 Q;  1MSH A;  4XT3 B;  3IKJ A;  3MWY W;  2AQ2 B;  1ESF A;  1FVI A;  1P16 A;  4A76 A;  5BR8 L;  2D2C C;  1C4Q A;  3FDT A;  3CP0 A;  4BXX G;  2UXB L;  2RF4 A;  3NXW A;  5FOB B;  4GN3 B;  5CR3 A;  1R4Q B;  2ALY B;  2K5V A;  4AIM A;  2F3W A;  4IFD I;  2KCN A;  4IPH A;  1BQQ T;  3SR1 A;  1I4R A;  1Q90 A;  5JJK A;  3KBG A;  4FP5 D;  4JK1 C;  4MHE A;  1ASY A;  4DR1 Q;  4NXM Q;  2NVY H;  3R3O A;  4KHP Q;  3TP5 A;  3NK9 A;  3S9W A;  2OQK A;  3AFQ A;  1LTA D;  3W1G A;  1PTO F;  5CV7 A;  3T1H Q;  4DV7 Q;  4AQY Q;  1JCK B;  4DA2 A;  3AU7 A;  3IFT A;  4LFB L;  4KKU A;  1BOS A;  1X56 A;  4DAV A;  3B6Y A;  4QY7 A;  4X65 Q;  1TWG H;  3P7J A;  4L5T A;  4DV3 Q;  5C3E G;  1JB3 A;  4AYB B;  2BCO A;  4R8N A;  1HA5 A;  1W6K A;  1Q81 C;  5IYB H;  4IO9 A;  3OTO L;  1B53 A;  1XX8 A;  3OHX C;  2A1A A;  3GTK B;  3S2H H;  1HZ9 A;  1EY6 A;  1MD2 D;  1SAP A;  4Y7N B;  4LF8 Q;  5IGE A;  4A3L H;  1ICF B;  1U4M A;  1MJC A;  1U9R A;  4BBR B;  2K5D A;  3VR2 A;  2SNS A;  1EFI D;  1ESR A;  1YIT A;  1K8M A;  4R4I A;  2F4I A;  4IUU A;  3OSO A;  3S24 A;  1A2U A;  4N8F A;  1AN8 A;  1LTS D;  2F0W A;  3BU2 A;  1STB A;  3CHB D;  1VMP A;  3QOJ A;  5IE8 A;  2QA4 A;  4HMI A;  4ZUI A;  5EBD A;  5LMU Q;  2EXD A;  4IPD A;  2MNA A;  1BR9 A;  2WKD A;  4CDD C;  2A69 D;  2F0T A;  1KXL A;  3GO5 A;  1OXV A;  3TS2 A;  2Z4H A;  1V43 A;  4BA2 I;  1MGS A;  1FJG Q;  4JI6 Q;  4H44 C;  1EIH A;  1HR0 L;  2CCZ A;  1XXG A;  4KV6 A;  3A8J E;  5ELO A;  4JVZ A;  2VQF L;  3M3Y B;  1A15 A;  5J3B A;  3CCM A;  1DON A;  1MJE A;  4DK0 A;  4LK1 C;  1LT3 D;  1TWH B;  2KCC A;  2A5H A;  2PYK A;  4FXK C;  5GAG C;  1PZI D;  2F4V L;  4OX9 Q;  4QQB X;  5D3D A;  1HNX Q;  3STB D;  3RN5 A;  1Q12 A;  1GUS A;  3ERS X;  3I90 A;  1EYD A;  3PSI A;  1M8A A;  1YZ6 A;  4I7A A;  5J39 A;  1YNJ C;  2VUM B;  1TWC H;  3MEF A;  1SNM A;  3FMC A;  1K8G A;  2OXP A;  3K7U C;  4KKS A;  2VQE L;  3K57 A;  2A19 A;  3ZYY X;  1F2Z A;  1QNK A;  1CT1 D;  4FF4 A;  3J81 c;  4OEL B;  1FR3 A;  2K03 A;  2K04 A;  3KF6 B;  4U68 A;  1T5E A;  4S3S A;  4V0B A;  1I4G A;  1JC7 A;  3MXP A;  3TZD A;  3NEM A;  3DMU A;  4B3M Q;  4K2K A;  4K5X A;  1N36 L;  4CGY B;  1BXT A;  4A93 B;  2CH4 W;  4DUZ Q;  4HCS A;  5ELE A;  3L0O A;  3TS0 A;  2A73 B;  4G57 A;  3T56 B;  4IN3 A;  1NE3 A;  1TY2 A;  3AEV A;  4JW0 A;  3HOV H;  2A74 C;  3VYR A;  4C2M B;  3DWP A;  2YTX A;  1CA5 A;  2A6H C;  4R4O A;  3PUX A;  1SMY C;  2B2T C;  2EQS A;  3UDG A;  5DM7 3;  4DR2 Q;  3GTQ B;  2PPB C;  3MXU A;  3T53 B;  1EU3 A;  1J5E Q;  2EYP A;  3D3R A;  1JOR A;  1AW7 A;  1PH1 A;  3JAM E;  3MVV A;  4HJA A;  4APV A;  3TEH B;  2PI2 E;  5L37 A;  3K7A H;  2NVT H;  5C44 G;  5I9P A;  3I4N H;  4JI7 Q;  3RZD B;  4F7X A;  2A6E D;  2BOS A;  4R4T A;  1I6H H;  5NUC A;  1DD2 A;  1IYJ B;  2L12 A;  2R7F A;  1H9S B;  3K6O A;  3T1Y L;  2NVX B;  4F87 A;  1HNZ L;  4RAU C;  3IAY A;  1PFM A;  1KD1 C;  1X65 A;  4CJ0 B;  4BS9 A;  1J9O A;  1OXT A;  4ME3 A;  4A3F H;  1L1O B;  2CQA A;  3KK7 A;  2EJF C;  5C5M A;  2WAQ G;  1P8L A;  4DPG A;  3DUZ A;  2M00 A;  1N34 L;  2EE1 A;  4CJ1 B;  3QO2 A;  2IHE A;  3S2D H;  1X32 A;  2IX1 A;  2BH8 A;  4ILW A;  1DOK A;  3NBH B;  4L5Q A;  2L0C A;  2DN8 A;  1KQS A;  2EYH A;  3RZO H;  3PO3 H;  4KMU C;  4ZKC B;  3VA7 A;  2UUB Q;  4LUZ A;  3PO2 B;  2F0Q A;  2Q2H A;  4A3C H;  4HTH A;  4ULL A;  3CCS A;  4KK7 A;  4JI3 Q;  2VNU D;  1NUC A;  5KNC A;  3SGI A;  3GTM B;  2P5Z X;  4QIW E;  4LFC L;  1IXR A;  2B2Y A;  4FF2 A;  4LWC A;  2UUC Q;  2EXZ A;  4MTN A;  4DNI A;  1XJV A;  2Z8L A;  5M5X H;  3GDE A;  1ENC A;  5FJ8 H;  2E2I B;  1L1O C;  1S5D D;  2L4N A;  1VS0 A;  4OIK A;  4BA1 I;  5FO8 B;  4BY7 H;  2ZJQ A;  3QG1 A;  5IT9 c;  5KRU A;  3S1M H;  5AFW A;  4KD4 A;  2OCE A;  3A7L A;  2QEJ C;  3J7A F;  2F0M A;  4DF7 A;  4A3G H;  1CKM A;  1VF7 A;  4RKL A;  3EIV A;  1HTP A;  1NY4 A;  1BO0 A;  3ULP A;  2H5X A;  3P1H A;  2JK8 A;  3KF8 A;  2HT1 A;  5GQO A;  1QUQ A;  3M4Y A;  5FLM H;  4JI2 L;  1A63 A;  2N49 A;  1SFO B;  1RJT A;  5IOC A;  1GJX A;  4H13 C;  3LGJ A;  4DUY L;  4X3S A;  1CZW A;  2K32 A;  5IP9 G;  4RA8 A;  3VYU A;  1D6E C;  1JWS D;  1VQA A;  1VQB A;  2Y0S B;  3FEW X;  2FHT A;  2VY3 A;  3DM1 A;  4AH6 A;  4B3R Q;  3NP8 A;  4XT1 B;  1HA6 A;  5M3M G;  1QJO A;  5D14 A;  1N33 L;  1CSP A;  1VQG A;  3MC0 B;  4UP7 A;  5JEA J;  1AFP A;  4EX5 A;  1PRT F;  3ND9 A;  3W1B A;  4XYQ A;  4DR7 L;  1WCM B;  1OXX K;  2PNH A;  3J81 j;  5M3F B;  2MUY A;  1PH4 A;  1I6V C;  2PMZ B;  5DEH A;  5KYI A;  1EIY B;  4DR5 L;  2JA7 G;  2C5C A;  4N9T A;  2UXB Q;  1VQH A;  2A68 C;  4DR3 L;  2WFW A;  2R7Z B;  3HP3 A;  5KND A;  1GUT A;  5LMU L;  1S5B D;  2EPB A;  5IGB A;  1G91 A;  1KNA A;  1ASZ A;  3D31 A;  3MXN B;  2JJQ A;  3A56 A;  1JR0 D;  2RA4 A;  4C3H H;  2IY5 B;  4JI6 L;  2JA5 B;  4FXD A;  4A3D B;  2IT1 A;  2GA4 B;  2R93 H;  4POF A;  4MN3 A;  1T9H A;  3CCU A;  3F2D A;  4LFB Q;  4N8X 1;  3A74 A;  2AKW B;  3EN2 A;  3PIP A;  2I5H A;  4IAL A;  4MIU A;  3I55 A;  4XYO A;  2RKS A;  3W5O A;  5AJ3 Q;  2XNA C;  3HOZ B;  4EGV A;  4BBS H;  1GM5 A;  2UUA Q;  1B3Q A;  3KF6 A;  1PH6 A;  3OTO Q;  2LSS A;  4CKC A;  4H0L C;  5LMN L;  2F0I A;  5ELN A;  4UAI A;  1IW7 D;  1YVC A;  4G7Z C;  2NBF A;  2KHJ A;  3HOU H;  2KOL A;  1WD0 A;  1EU4 A;  1TWF B;  4AYB G;  4B9W A;  1LTI D;  2RBM A;  3UDF A;  4J1M A;  4OGQ C;  3NHH A;  3D6C A;  1LT5 D;  1EEF D;  4IZ8 A;  4POG A;  1H9J A;  1I4P A;  1RKN A;  3J7A 5;  5DM6 3;  2B8G A;  2EJG C;  3A8I E;  3HOY B;  1EY4 A;  2JA6 H;  4BBR G;  3HFZ B;  5A2Q L;  4DV1 Q;  5C0X G;  1TT2 A;  2M9V A;  1XNQ L;  2B63 H;  1K0S A;  1GUW A;  1WTH A;  5M5Y H;  3HG9 A;  2L55 A;  2AHO B;  2NN6 G;  1STG A;  1HR0 Q;  2ICI A;  4P75 A;  1RD9 D;  1AE3 A;  2JA8 H;  3C3L A;  2LY7 A;  3GQB A;  3CPF A;  3PUW A;  2VQF Q;  3LX0 A;  3ERQ A;  1ML0 D;  1SXT A;  3E5S A;  1KDB A;  3E3X A;  2WB1 E;  4QB4 A;  4DR2 L;  1ZKO A;  1CZG A;  2BH2 A;  4LNQ A;  3KDF B;  4FYD A;  1DOM A;  3AFP A;  4JBW A;  4DAY B;  2Z9H A;  5ELB A;  5IGG A;  1KNE A;  2L1B A;  1K83 B;  1QCB D;  3OIP A;  5GAE C;  1WOC A;  1PHJ A;  2A8V A;  3BS1 A;  4BY1 H;  1C48 A;  1EL0 A;  2ZJP A;  3VYS A;  3I72 A;  4JI7 L;  2ZXO A;  4JBJ A;  3M9B A;  4YWM A;  3CAM A;  3LNN A;  4ME5 A;  4FNF A;  5EBC A;  1EEI D;  1EWC A;  4K8I A;  3HOW H;  2ATW A;  3S1N B;  2N55 A;  3HGB A;  3NBH A;  2VUM G;  2R61 A;  2PZT A;  2TMP A;  3PGZ A;  3K8A A;  2WB1 B;  5COY A;  2NN6 I;  2F0L A;  5FLX c;  1SE4 A;  3H0G H;  1CFM A;  1M4V A;  4OWX B;  1N36 Q;  1SLJ A;  2SDF A;  4R9W A;  4JYA L;  4JV5 L;  3J81 L;  4HJ7 A;  2Q2U A;  4GLV B;  2PCF B;  2B3G A;  2JA9 A;  3S1Q H;  3ZJY C;  5CV9 A;  1ICW A;  3M7N A;  4GLA C;  5F2D A;  1MHW C;  2D5D A;  3FKI H;  3U4V A;  3S16 B;  1JE5 A;  1HRJ A;  2KBN A;  2E5L L;  4HIM A;  5D65 A;  2O2L D;  2ZTC A;  1JIC A;  4DV0 Q;  1PLF A;  4A93 G;  3JAM i;  1D2B A;  4ZCK A;  4L63 B;  3X3N A;  4CBV A;  1VCI A;  4HIO A;  4A3J B;  5CC4 A;  1G8Z D;  4NKL A;  1EY7 A;  1A0I A;  3QB3 A;  1XMQ Q;  2QGQ A;  3TP8 A;  1VQ8 A;  4A3K H;  5JPM C;  2UXD Q; 
#chains in the Genus database with same CATH homology
 2QA4 A;  2LXK A;  4DV4 L;  1AH9 A;  4TQU S;  1I5F A;  1X3G A;  1S40 A;  1SMX A;  3BZK A;  2R7D A;  5LMU Q;  2EXD A;  4IPD A;  1KC8 C;  1NMF A;  1OTC A;  3J80 c;  2MNA A;  3NEN A;  1EFW A;  2UUC L;  5IY0 A;  3H15 A;  3HKS A;  1VQK A;  3GTQ H;  4IOC A;  1KXL A;  5HGQ A;  2ID0 A;  3GO5 A;  1OXV A;  3TS2 A;  1V43 A;  4BA2 I;  3CCR A;  1XPR A;  2VZA A;  1X9N A;  1FJG Q;  4JI6 Q;  4DV6 L;  3JC6 6;  5IP7 G;  1YNX A;  3CC4 A;  1HZC A;  4LF7 L;  1HR0 L;  5IP7 H;  4IJL A;  3T1Y Q;  4PZ6 A;  2CCZ A;  1HNZ Q;  1QVF A;  5E7N A;  4A3M G;  1IBL Q;  2UU9 Q;  3UE0 A;  1Q82 C;  2Z6K C;  5ELO A;  3PIO A;  1VQN A;  4DK6 C;  1JT8 A;  4A3M H;  2VQF L;  4A4I A;  5J3B A;  3CCM A;  1MJE A;  2IX0 A;  4DK3 C;  3RZD H;  4PZ7 A;  3J7Z C;  1IBM L;  5GAG C;  1X3F A;  2HHH Q;  2CFM A;  2ES2 A;  3U4Z A;  2F4V L;  4X62 Q;  4OX9 Q;  4QQB X;  1N34 Q;  1S3O A;  1N32 L;  4GNX A;  1HNX Q;  4PMW A;  3STB D;  3RN5 A;  1Q12 A;  3ERS X;  3PSI A;  2DGY A;  2AWO A;  4GOP A;  3M4O H;  1YZ6 A;  4HJ8 A;  2NVX H;  4C3I H;  3UE1 A;  1HNW L;  1BBW A;  1TWC H;  3MEF A;  4Y52 H;  4ALP A;  1EUJ A;  3KJP A;  5EAY A;  5M5W H;  1K8G A;  4GKK Q;  3RLN A;  3K7U C;  3L2P A;  1YJN A;  2VQE L;  3CCV A;  2Y0S E;  2A19 A;  1IBK L;  2MQH A;  4LF5 Q;  4DR1 L;  5C4X G;  4NXM L;  4LF4 L;  4YWL A;  4LFC Q;  4KHP L;  3J81 c;  3TRZ A;  2K14 A;  1K8A C;  4YWK A;  1W3S A;  5C4X H;  3CF5 A;  1UE7 A;  3KF6 B;  1C9O A;  2YTV A;  3T1H L;  2WAQ E;  4DV7 L;  3VDY A;  1TWA H;  3NEM A;  3GTJ H;  4AQY L;  5GAD C;  2PMZ E;  4B3M Q;  1U0L A;  4X66 L;  3PO2 G;  1L1O A;  2UXC L;  4C3J H;  1N36 L;  3S17 H;  3PO2 H;  1E24 A;  1RL2 A;  1WI5 A;  2YV5 A;  4JI8 Q;  1JB7 A;  4X65 L;  3DLL A;  4JC0 A;  4R4Q A;  4DUZ Q;  4DV3 L;  3L0O A;  2PI2 A;  3TS0 A;  3GTM H;  5JJI A;  4IPC A;  1NE3 A;  5IYD G;  3AEV A;  3HOV G;  4JCV E;  2IHF A;  2ZJR A;  5IYC G;  1VQJ A;  5IYD H;  3F1Z A;  2MO0 A;  4X64 Q;  1Y1W G;  3HOV H;  2YTX A;  4R4O A;  3PUX A;  2PQA B;  5IYC H;  4LF8 L;  1E3P A;  1JJG A;  1Y1W H;  1GKH A;  2EQS A;  3S14 H;  3UDG A;  2JEB I;  4LFA L;  2HIV A;  4DR6 L;  1UE6 A;  3KOJ A;  3CCQ A;  4DR2 Q;  2YU9 H;  5IWA L;  3I2Z A;  2KEN A;  4JI2 Q;  1EQR A;  1UE5 A;  1QVG A;  1J5E Q;  5AJ3 L;  2E2I H;  3CCE A;  4DUY Q;  1KL9 A;  5BR8 Q;  2UUA L;  1PH1 A;  2I5M X;  4B3S Q;  4JOI C;  4HJA A;  4APV A;  1KHI A;  1E1O A;  1XTD A;  1VQ4 A;  3TEH B;  3WWV A;  1I94 Q;  3GTP H;  3I4N G;  2PI2 E;  3CC7 A;  3K7A H;  1VQL A;  3CD6 A;  2NVT H;  4B3T Q;  1FGU A;  5C44 G;  1N33 Q;  2EIF A;  4KI0 A;  3CXC A;  3I4N H;  4JI7 Q;  1PFS A;  4LUO A;  2CQO A;  5C44 H;  4UP9 A;  1Z9F A;  4DR7 Q;  3K0X A;  4R4T A;  2NVQ H;  1SFO H;  1I6H H;  1X3E A;  4K0K Q;  1YHQ A;  3KLW A;  1JMC A;  1FJG L;  1IYJ B;  2R7F A;  3GTG H;  4DR5 Q;  3J81 i;  1YBY A;  4XTC S;  4NXN Q;  1UWV A;  3A5U A;  2Y0S G;  3T1Y L;  1KRT A;  3GD7 A;  5GRO A;  2RHQ B;  1Q8K A;  4DR3 Q;  1HNZ L;  2JE6 I;  1IBL L;  3ULL A;  4DAM A;  4A3F G;  1KD1 C;  1AE2 A;  1X65 A;  3HKZ G;  1OXT A;  4ME3 A;  4A3F H;  3K81 C;  3I7F A;  4YY3 Q;  4DV1 L;  1WCM G;  1L1O B;  1SRU A;  4YHH Q;  3E9I A;  5M3F G;  4LF9 Q;  2WAQ G;  3K80 C;  1P8L A;  4P72 A;  3KFU A;  4DPG A;  1WCM H;  2HHH L;  1NMG A;  4X62 L;  1Q7Y C;  5M3F H;  1N34 L;  2HQL A;  4OX9 L;  1HNX L;  1LTL A;  1N8R C;  1SRO A;  2IHE A;  5HY6 A;  5H1S E;  3S2D H;  1VQI A;  2IX1 A;  2BH8 A;  1HR0 W;  4KLK A;  2R7Z G;  1XMO Q;  3NBH B;  4L5Q A;  3I4O A;  1CUK A;  1E1T A;  1WFQ A;  1KQS A;  3GTO H;  4QL5 A;  3PO3 G;  2UXD Q;  2BA1 A;  2R7Z H;  3RZO H;  3PO3 H;  4A75 A;  5C4J H;  3IRB A;  1CKO A;  1EIF A;  3PUZ A;  4A3C G;  2B29 A;  4LUZ A;  2UUB Q;  4GKK L;  2Q2H A;  1XNR L;  4A3C H;  2DUD A;  3CCS A;  2JA5 G;  4JI3 Q;  3D0F A;  4A3D G;  2VNU D;  1X55 A;  4H02 A;  2XTI A;  4LF5 L;  2JA5 H;  4DV2 Q;  3S1R H;  3SGI A;  4A3D H;  4QIW E;  4LFC L;  1IXR A;  2RCN A;  1MKH A;  2D0O A;  3PF4 A;  5LMN Q;  1C0A A;  3PV0 A;  4LWC A;  1GO3 E;  2UUC Q;  1Q1B A;  2K75 A;  4MTN A;  4RMF A;  4DNI A;  1YJ9 A;  1UE1 A;  4B3M L;  3I4M G;  3RR5 A;  4DR4 Q;  4LF6 Q;  2Q2I A;  3HOZ G;  1XJV A;  5FJ8 G;  1X54 A;  5M5X H;  3I4M H;  4O2D A;  1VQE A;  3GDE A;  3HOZ H;  5FJ8 H;  4JI0 Q;  2Z6K A;  2JQO A;  4DUZ L;  3PF5 A;  4BY7 G;  1L1O C;  4P74 A;  1GVP A;  3HKZ E;  1PH2 A;  1CKN A;  1VS0 A;  3M4P A;  4BA1 I;  2ZTD A;  2K5H A;  4BY7 H;  2ZJQ A;  4GKJ L;  4A3G G;  2Z0S A;  1VQO A;  4OWW B;  1EOV A;  5IT9 c;  3S15 H;  3S1M H;  4KHZ A;  4X64 L;  2OCE A;  4A3G H;  2YTY A;  4WJ4 A;  2GVB A;  1KIX A;  3JAM c;  1CKM A;  1V1Q A;  3EIV A;  1XPO A;  3CME A;  1XNQ Q;  5C0X J;  1NY4 A;  2MFI A;  3J80 i;  5FLM G;  3ULP A;  2H5X A;  1TWF H;  1PH5 A;  2JK8 A;  2WP8 J;  2LXJ A;  2N3S A;  1QUQ A;  1KAW A;  4LUV A;  5GQO A;  3RLO A;  5FLM H;  1PA6 A;  2N49 A;  4JI2 L;  1PVO A;  1A63 A;  1UEB A;  1J5E L;  1A8V A;  3M85 A;  3BZC A;  3LGJ A;  4DUY L;  2ZM6 Q;  4IJH A;  4A3E G;  3CCL A;  3HOY G;  3CCJ A;  3PUY A;  1J6Q A;  1IL2 A;  1VQ7 A;  1WJJ A;  1C7Y A;  4JG2 A;  2FXQ A;  4AYB E;  5IP9 G;  3E9H A;  4GLX A;  3U58 A;  4A3E H;  4B3S L;  3HOY H;  3CQZ H;  4NB3 A;  1VQA A;  1VQB A;  1EWI A;  4DV0 L;  1M90 C;  5JJL A;  5IP9 H;  2VY3 A;  1I94 L;  2CWA A;  4AH6 A;  5K36 G;  1YEZ A;  4B3R Q;  2R6G A;  4B3T L;  4UY8 C;  3G4S A;  5M3M G;  2VQE Q;  1N33 L;  1CSP A;  1VQG A;  3KJO A;  2Q2T A;  1NJI C;  2D62 A;  4UP7 A;  5JEA J;  4EX5 A;  5M3M H;  4DR7 L;  3W1B A;  2D0P A;  1OXX K;  2PNH A;  4K0K L;  1IZ6 A;  3J81 j;  2XGT A;  3RNU A;  2ASB A;  2F4V Q;  1PH4 A;  4RG1 A;  5C0X I;  1XMQ L;  4GNX B;  1VQP A;  1EIY B;  4DR5 L;  2JA7 G;  2F52 A;  3A0J A;  4NXN L;  3CC2 A;  2UXB Q;  1HZA A;  1VQH A;  1PV4 A;  4JI4 Q;  1DGS A;  4DV5 Q;  2JA7 H;  2UXD L;  4GOP B;  4X66 Q;  4DR3 L;  4IOA A;  1B8A A;  1SE8 A;  1GD7 A;  2WFW A;  1Y14 B;  1YIJ A;  2E2J H;  5LMU L;  1VQC A;  1Z47 A;  3L7Z C;  3E0E A;  2NZO A;  4FDB A;  4JI5 Q;  1ASZ A;  3D31 A;  4LF9 L;  3MXN B;  1VQ5 A;  1VQ9 A;  1Q1E A;  1CSQ A;  1LYL A;  2JJQ A;  4C3H H;  1E22 A;  2IY5 B;  4JI6 L;  1X6O A;  4A3I G;  2R93 G;  3G71 A;  4R1J A;  3ULJ A;  2IT1 A;  4JI1 Q;  4A3I H;  1I3Q H;  1HH2 P;  1SN8 A;  2R93 H;  1CKN B;  4POF A;  4GS3 A;  1K83 H;  3FP9 A;  1T9H A;  3CCU A;  1RIP A;  1OXU A;  2KCM A;  2UU9 L;  3F2D A;  4LFB Q;  3A74 A;  2AKW B;  3BJU A;  3EN2 A;  3PIP A;  4LW1 A;  4JYA Q;  4L5R C;  1YJW A;  4JV5 Q;  2I5H A;  2E8G A;  2YYZ A;  3Q8D A;  2JEA I;  1VQM A;  2VL6 A;  2N8N A;  3I55 A;  2UUB L;  3KDF A;  4BBS G;  3FHW A;  3W5O A;  5AJ3 Q;  1JJ2 A;  3EBE A;  4JI3 L;  4BBS H;  5GAH C;  4JBK A;  3KF8 B;  4XIG S;  3TQY A;  1QUQ B;  1GM5 A;  1W2B A;  2UUA Q;  3KF6 A;  4GN4 B;  3S1N H;  1O7I A;  4DV2 L;  4OO1 G;  2WB1 G;  3OTO Q;  2N78 A;  1PH6 A;  2LSS A;  2E5L Q;  2MO1 A;  1M1K C;  1JJC B;  1D8L A;  1TXY A;  1QVC A;  5LMN L;  2K52 A;  3H3V I;  5ELN A;  3M4Q A;  3HOU G;  1Q46 A;  4O0A A;  2F3I A;  5LMN W;  2ZTE A;  4GNX C;  1I50 H;  4P71 A;  1PH3 A;  2V1C C;  4DKA C;  1YVC A;  3PUV A;  4OXP A;  1EYG A;  2KHJ A;  5DLQ E;  3AYH B;  3A5Z B;  4IPG A;  3HOU H;  4DR4 L;  4LF6 L;  4GOP C;  3UDX A;  4AYB G;  2VS1 A;  3UDF A;  4WJ3 M;  3CPW A;  2RHS B;  2KHI A;  4HID A;  1B70 B;  3UDI A;  4J15 A;  4A3B G;  4JI0 L;  1V9P A;  4X6A H;  2HT1 A;  1WYD A;  1G51 A;  4EQ5 A;  4A3B H;  1K73 C;  3S16 H;  4P73 A;  4OWT B;  4NPS A;  3G6E A;  2OWO A;  4POG A;  2PQA A;  3J7A 5;  4IFD G;  2OTL A;  4DV4 Q;  2JA6 G;  3GTK H;  1D7Q A;  4Y7N H;  3CW2 C;  1LUZ A;  1VQF A;  2JA6 H;  4BBR G;  3HFZ B;  2BA0 A;  1PH9 A;  2B63 G;  1N9W A;  1BVS A;  4DV1 Q;  4A3J G;  5C0X G;  4TVA B;  1EQQ A;  4BBR H;  1Y1V G;  1XNQ L;  2B63 H;  4R4C A;  1U5K A;  5M5Y H;  1YHB A;  2CKZ B;  4A3J H;  1Y1V H;  2AHO B;  3PCO B;  4JI8 L;  4DV6 Q;  3GTL H;  2NN6 G;  3F8T A;  4A3L G;  4UPA A;  4L5S A;  4QGU A;  4HJ9 A;  4LF7 Q;  2KCT A;  2K5N A;  1MIU A;  1XPU A;  1K9M C;  1HR0 Q;  3F2B A;  2JA8 G;  1VQ6 A;  2ZM6 L;  1E7Z A;  4P75 A;  1NTG A;  4IFD J;  2R92 G;  3DM3 A;  1BKB A;  1AE3 A;  2JA8 H;  3CMA A;  1YI2 A;  3ER0 A;  3KYH C;  3CPF A;  3HOX G;  4PZ8 A;  2R92 H;  1K0R A;  3PUW A;  3AQQ A;  4MNO A;  2VQF Q;  1S72 A;  4PG3 A;  4QJF A;  2E2H H;  4OO1 I;  3HOX H;  1YHA A;  1R9T H;  3NEL A;  2C35 B;  1G29 1;  2I0Q A;  2WB1 E;  4B3R L;  1IBM Q;  1XNR Q;  4DR2 L;  1HJP A;  4YCU A;  1OXS C;  2HIX A;  1HZB A;  1B7Y B;  5JEA G;  2BH2 A;  1N32 Q;  2K4K A;  4LNQ A;  1A62 A;  3KDF B;  4GN5 A;  1FVI A;  1P16 A;  3AFP A;  4JBW A;  4DAY B;  4A76 A;  2QEX A;  5BR8 L;  1HNW Q;  3CP0 A;  1KRS A;  4JI4 L;  4BXX G;  2UXB L;  2RF4 A;  4DV5 L;  5GAE C;  1WOC A;  1Q86 C;  1PHJ A;  4BY1 G;  2A8V A;  4GN3 B;  3M3Y H;  4BXX H;  1K3R A;  2ALY B;  2K5V A;  4AIM A;  2GVA A;  4BY1 H;  1LM0 A;  4IFD I;  1TWH H;  2ZJP A;  4IPH A;  4JI7 L;  2L15 A;  1IBK Q;  5JJK A;  4YCW A;  1SR3 A;  4JI5 L;  4JBJ A;  1VQD A;  1ASY A;  3M9B A;  4YWM A;  3CAM A;  4DR1 Q;  4NXM Q;  4UP8 A;  4LF4 Q;  2NVY H;  3HOW G;  4KHP Q;  2CWP A;  2OQK A;  3HOW H;  3H3V H;  2ATW A;  3AFQ A;  4GKJ Q;  2VUM G;  3I56 A;  3W1G A;  3H0G G;  3PGZ A;  4JI1 L;  3T1H Q;  4DV7 Q;  3K8A A;  2VUM H;  4AQY Q;  3OYY A;  2NN6 I;  5FLX c;  3H0G H;  4OWX B;  2UXC Q;  4YCV A;  3RLF A;  1SLJ A;  1N36 Q;  2NZH A;  4JBM A;  4LFB L;  3ICE A;  4JYA L;  2AWN A;  4JV5 L;  1BBU A;  1X56 A;  4HJ7 A;  3B6Y A;  2Q2U A;  4GLV B;  4YY3 L;  4QY7 A;  4X65 Q;  2B3G A;  1TWG H;  2JA9 A;  4YHH L;  2GN5 A;  3S1Q H;  3G48 A;  3FKI G;  4L5T A;  3ZJY C;  5C3E G;  4DV3 Q;  2OTJ A;  1H95 A;  5IYB G;  3M7N A;  4GLA C;  2AMC B;  1PH7 A;  3FKI H;  5C3E H;  1Q81 C;  3U4V A;  5IYB H;  4IO9 A;  2I5L X;  1JE5 A;  3OTO L;  2KBN A;  1L0W A;  2E5L L;  2OQ0 A;  4HIM A;  2VW9 A;  4MZ9 A;  2A1A A;  4HJ5 A;  2ZTC A;  1PYS B;  1HZ9 A;  4DV0 Q;  1XMO L;  1L2F A;  4OON A;  4LF8 Q;  1PYB A;  3S2H H;  4LFA Q;  4DR6 Q;  3STB C;  4A3L H;  4A93 G;  2K50 A;  1G6P A;  3JAM i;  1MJC A;  5IWA Q;  1NBW A;  4HIK A;  3TRE A;  4A93 H;  1VCI A;  1QZH A;  4JOI A;  4HIO A;  3U50 C;  1YIT A;  4R4I A;  1QZG A;  3S24 A;  3OW2 A;  4A3K G;  3RN2 A;  1A0I A;  1XMQ Q;  2QGQ A;  1FL0 A;  1VQ8 A;  4A3K H;  3F2C A;  1PH8 A;  3BU2 A;  4C2M H;  5IE8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...