4OWTB

Structural basis of soss1 complex assembly
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
105
structure length
72
Chain Sequence
TFVKDILIFIVLETGVRTCKVADKTGSINISVWDDVGNLIQPGDIIRLLTLYTDLQKIGEFCMVYSEVPNFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Integrator complex subunit 3
publication title Structural Basis of SOSS1 Complex Assembly and Recognition of ssDNA.
pubmed doi rcsb
source organism Homo sapiens
total genus 17
structure length 72
sequence length 105
ec nomenclature
pdb deposition date 2014-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01336 tRNA_anti-codon OB-fold nucleic acid binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4owtB00
4LF9Q 4DR4L 5LMNL 2V1CC 5GAGC 4JI0Q 3HOWG 4JV5L 5C4XG 4GNXA 5IY0A 2I5HA 3ULPA 4B3SQ 4LF4L 3STBD 2JA8G 1VQ9A 1LTLA 1N34Q 3FHWA 4DV2Q 4X6AH 5GADC 4A3KH 1XMOL 1HZAA 4AIMA 1E3PA 5ELOA 4DR1L 2JK8A 4MZ9A 2AWOA 3ULLA 2K14A 2C35B 2CCZA 3HOUH 2HHHL 1ASYA 3DLLA 3ICEA 2D62A 3NEMA 5IWAL 3PUWA 2RCNA 3JC66 3M4QA 3J7ZC 4A3MG 2R6GA 2N3SA 5IYBG 4DR5Q 2OWOA 2BH8A 2R92G 1EIYB 2RHQB 4GN4B 1SE8A 5GQOA 3OTOL 3I55A 3GTPH 1VS0A 1YNXA 1SLJA 3CCVA 1WOCA 4L5SA 3KF8B 1TWGH 4OO1I 3F1ZA 1VQNA 1KAWA 4C3IH 2VQEQ 1GO3E 4NXMQ 4NPSA 1PH2A 1AE3A 1PH8A 1S40A 1RIPA 2K75A 4YHHL 2OTLA 1J5EL 2Q2IA 3PO2H 5M3MH 1EQRA 4DR7L 2KHJA 1JT8A 2ATWA 3CC7A 2PNHA 3RZDH 3F8TA 3W1BA 4HJ7A 4K0KL 5IP7G 1IBKQ 2F4VL 3GTMH 4A3FH 4B3RQ 4OO1G 4DV4L 1HNXL 4NXNL 5IYDH 5IT9c 4GKJQ 4HJ5A 5LMNW 1JJCB 4IPHA 1G291 4DR3Q 4DV3L 3UDGA 4A3CH 4LFAQ 2NN6G 1X3GA 2JEBI 4A75A 1K3RA 1N36Q 1CSQA 2EXDA 3CAMA 4DUZQ 5C3EG 2WFWA 2Q2UA 3OYYA 1TXYA 4IJLA 4QL5A 1GKHA 4QJFA 1KIXA 3J81i 1NMGA 1OXUA 1SMXA 4PG3A 3PF5A 4BXXH 5HY6A 1OXXK 1R9TH 3HFZB 1WYDA 4HIDA 4PZ8A 1XNRQ 3CCLA 3GDEA 5IP9H 3M4PA 3T1HQ 4JI4L 3B6YA 2PMZE 4OX9L 3KDFB 2NZHA 3PIOA 1C9OA 1SFOH 2GN5A 1FJGQ 3S1QH 3K0XA 2ALYB 3U58A 2B63G 3M4OH 1E24A 2DGYA 5M5WH 1VQAA 4JI1Q 5FLMG 4BA1I 4BBSG 1VQIA 1VQPA 3I4MG 1YITA 2B3GA 2VL6A 2UUAL 1U5KA 4LFBL 4YWLA 4C3JH 4C3HH 3S1RH 3FKIH 1W3SA 3HOYG 5DLQE 2UUCL 1JE5A 1UWVA 2WAQG 4HJAA 1SN8A 1GVPA 4X65L 2IX0A 3S2HH 3CXCA 4BBRG 3GTJH 5IYCG 4JI2L 4LFCQ 4KLKA 4R4TA 2E8GA 1S72A 4GKKQ 1QZGA 3HOVG 3ZJYC 1VCIA 2CKZB 1X3FA 3K8AA 3RR5A 2AHOB 4JI7Q 3S14H 2UXCQ 2VNUD 4GNXC 2MO0A 3F2BA 4JYAQ 3BZCA 4YCWA 1J6QA 2IHEA 3KJPA 4DAYB 3CMEA 5BR8Q 2HIXA 3ER0A 4IOCA 1N8RC 4IPGA 3KDFA 3I2ZA 3CCUA 1YJ9A 4X66Q 1KRSA 3NBHB 2VQFQ 3K81C 4A3JG 4LF5L 1C0AA 1NMFA 4R1JA 4YWKA 4DNIA 4AQYL 3GTGH 2R7DA 4A3LG 1WFQA 3NELA 4H02A 4LF8L 1HNWQ 1K8AC 4O0AA 4LUOA 3GTLH 3A5UA 1NBWA 4A4IA 1PH9A 2Y0SG 3JAMi 2F52A 1VQOA 3JAMc 1Q12A 2QGQA 2I5LX 1YIJA 1YI2A 4XTCS 4A93G 2I0QA 3PUZA 4DV1L 3S15H 3S17H 3KFUA 2K52A 1IBML 4JI5L 3W5OA 3I4OA 1Y1WG 3PGZA 4UPAA 4X64Q 4A3IG 1KHIA 4IPCA 4HIMA 4DK3C 2A19A 1A63A 4BY1G 1U0LA 2K50A 2KBNA 1YEZA 4R4QA 3HOWH 5C4XH 4LF6L 2DUDA 4JI3Q 4ME3A 2JA8H 1H95A 4L5QA 1Q1BA 3I4NH 1KC8C 3AFPA 2A8VA 4KHPL 3CMAA 2OCEA 2XGTA 2L15A 2N78A 4P73A 1VQ7A 1L1OB 5C44G 4R4CA 3T1YQ 4QY7A 4DUYQ 5JJLA 1I3QH 1V43A 2HIVA 3GTKH 4A3MH 5AJ3Q 1YJNA 5IE8A 1Q86C 2JA5G 5IYBH 4JI6Q 4GN5A 4OWTB 2KHIA 3DM3A 2A1AA 3CC2A 3KF6B 3CC4A 1XNQL 1HZBA 2UXDQ 4POFA 1Y1VG 1HR0Q 5EAYA 2AWNA 2K5VA 3A5ZB 3H0GG 4AYBG 2PI2A 2D0OA 4GLXA 1VQ4A 1K8GA 2JA6G 3G48A 1UE7A 2ZJPA 3S24A 1OXSC 4WJ3M 3PO3G 1BKBA 3M85A 3U4ZA 1NJIC 2JEAI 2MQHA 3HKZE 2CFMA 1PH3A 2UXBQ 1G6PA 3F2CA 1YBYA 5JEAJ 1TWCH 1M90C 1N33Q 1HJPA 2KENA 1CKMA 1K83H 4DV5L 4GOPA 1PV4A 4A3KG 4DR2L 1D7QA 3J81j 4DR4Q 5LMNQ 1XMQL 1PH1A 4JV5Q 2R93H 4IOAA 1AE2A 4YCVA 3RLNA 1L1OA 3J80c 3TEHB 2KCMA 4LUZA 4LF4Q 2VUMG 2IT1A 3TQYA 2WB1G 1XMOQ 1JJGA 3KOJA 4J15A 4DR1Q 3H15A 2ZTEA 1Q1EA 2RHSB 3D0FA 1C7YA 3RN5A 2HHHQ 1MJCA 1EFWA 5IWAQ 3HOXG 3KF6A 5HGQA 1X55A 1K0RA 1PH7A 1LUZA 2ID0A 2JJQA 3OTOQ 4YY3L 4BY7G 3VDYA 2B63H 3PF4A 2XTIA 2JQOA 1EIFA 1JB7A 1P8LA 1QUQB 4DR6L 5FLMH 1I6HH 2IY5B 3U4VA 4BBSH 3PSIA 1N9WA 1HNZL 3PUVA 3E0EA 1YVCA 1L2FA 2RF4A 1FGUA 3BU2A 2KCTA 3K80C 4YHHQ 4DPGA 1J5EQ 2UUBL 3GO5A 4B3ML 5H1SE 3HOYH 3RZOH 4DR7Q 3K7UC 2I5MX 2GVAA 3CW2C 1M1KC 1SRUA 3UDXA 1PFSA 1D8LA 2YTYA 4P75A 5M3FG 5GROA 4K0KQ 2F4VQ 5IYCH 4P72A 4DV4Q 1HNXQ 4NXNQ 2Z6KC 2ZTDA 3H3VH 4R4OA 4UY8C 4GLAC 4DV3Q 2LXKA 4JBKA 4IJHA 4MNOA 4EX5A 1VQ6A 4PZ6A 1V9PA 5LMUL 2E2IH 2VS1A 5IP9G 5C4JH 2NVXH 1IBLL 1O7IA 3BJUA 3FP9A 4JC0A 4OXPA 2JE6I 1G51A 1Q7YC 4Y52H 4GLVB 4DV0L 1LM0A 3L2PA 4A3JH 1CKNB 3UE0A 3L0OA 4X62L 3HKSA 1A0IA 4RMFA 2UU9L 4B3TQ 4JI4Q 1QUQA 1QZHA 4OX9Q 4A3LH 2E5LL 3CF5A 4DV7L 3TREA 5JEAG 4A3DG 5FJ8G 5E7NA 3KLWA 1N32L 3EIVA 4DKAC 3GTOH 4DV6L 3PCOB 1SR3A 2FXQA 2MO1A 2BA0A 2HQLA 3M7NA 1A62A 1BVSA 1VQLA 2UUAQ 3HOZH 1VQJA 1BBUA 3J7A5 1HZ9A 4LFBQ 3GD7A 2YV5A 2B29A 3MEFA 2UUCQ 4P74A 1Q81C 2R7ZH 4A3BG 3M3YH 4GN3B 2QA4A 2PQAB 1FVIA 4X65Q 4ALPA 2ZM6L 2JA9A 4QGUA 4HIOA 1K73C 1I94L 1Y1WH 3KJOA 4JI2Q 1OTCA 4LF9L 4GOPC 4MTNA 3RLOA 4JI0L 2F3IA 1IXRA 4BY1H 1VQFA 4B3SL 1XPUA 3RNUA 1N34L 1WCMG 1YZ6A 1VQCA 4DV2L 2CQOA 1L1OC 2VW9A 4WJ4A 2CWPA 1DGSA 1MIUA 4L5TA 5C44H 5K36G 3CCMA 3W1GA 1CKNA 3S2DH 4B3TL 5C0XI 4DR5L 3S1NH 4JI8L 1I50H 2JA5H 1VQEA 3PV0A 1UE5A 1GM5A 3SGIA 1JJ2A 2OQKA 4YCUA 4LF5Q 1B8AA 1X54A 3PUYA 4AQYQ 3CCJA 1JMCA 1YHBA 2R92H 4LF8Q 2JA7G 3UE1A 2Q2HA 3CCRA 4A3GG 2VQEL 4NXML 4O2DA 1VQKA 5JJKA 4HIKA 1RL2A 1QVFA 3H0GH 4A3EG 3CQZH 3UDFA 2MFIA 3S1MH 3TS0A 3HKZG 2PQAA 1X9NA 2JA6H 1VQHA 1X3EA 1CKOA 3PO3H 3CD6A 3CCEA 5GAEC 4JCVE 4DV1Q 3CCSA 1EQQA 2LXJA 4JBWA 1IBKL 2NVTH 4B3RL 5ELNA 1IBMQ 3AQQA 5JJIA 4JI5Q 4GKJL 1Z47A 2R7FA 3RN2A 3I4NG 5FLXc 4JBMA 1GD7A 4DR3L 1IZ6A 1YJWA 2QEXA 4LFAL 1Y14B 2OQ0A 2YYZA 4JOIA 4QIWE 5IP7H 3G71A 1N36L 4LF6Q 3AEVA 1K9MC 2VUMH 1I5FA 1Q46A 1EYGA 4DUZL 4OWWB 4LW1A 3GTQH 4KI0A 1EWIA 3J80i 4JI8Q 4KHPQ 2D0PA 2K4KA 3HOUG 2YTXA 4DAMA 1B7YB 1S3OA 1PH4A 1YHAA 1UEBA 4FDBA 1XNRL 2YU9H 4LNQA 5C3EH 3T1HL 3HOXH 1HR0W 1NE3A 1B70B 3STBC 1FJGL 2ASBA 4Y7NH 3IRBA 1UE1A 3RLFA 2VZAA 2LSSA 2ZJQA 1QVGA 4BY7H 1IYJB 2ES2A 4HJ8A 1FL0A 2IHFA 1XNQQ 2NN6I 3TRZA 4JI1L 1EUJA 3E9IA 4AYBE 2GVBA 4HJ9A 1Q82C 1HZCA 1E7ZA 3I7FA 4POGA 3CP0A 1NTGA 4P71A 3E9HA 4AH6A 3F2DA 1E1OA 1YHQA 3PO2G 5M3MG 3CPWA 3WWVA 2H5XA 3I4MH 2N8NA 1L0WA 1EOVA 2N49A 1AH9A 4TVAB 2R93G 3BZKA 4A3FG 5IYDG 4LFCL 1X56A 2ZJRA 5M3FH 4JBJA 2OTJA 4IPDA 4UP8A 4DV5Q 3PIPA 2NVYH 1E22A 1XJVA 2BH2A 4OWXB 4GKKL 1TWAH 4DR2Q 4A3CG 4JI7L 4QQBX 2UXCL 1XMQQ 1LYLA 4BBRH 3I56A 1TWFH 1KD1C 1KL9A 1A8VA 1V1QA 4EQ5A 2WB1E 4JYAL 3J81c 4UP7A 4IFDJ 5C0XJ 3UDIA 4UP9A 4IO9A 1HH2P 5BR8L 1E1TA 1TWHH 3HOVH 4BXXG 3PUXA 2K5NA 4OONA 5GAHC 1PA6A 5M5XH 3AYHB 4X66L 2VQFL 4A76A 4JG2A 1WJJA 1PYSB 3CPFA 3CCQA 1PYBA 3H3VI 4YY3Q 1PHJA 1HNWL 4GS3A 1OXVA 1XPRA 4A3DH 3K7AH 5FJ8H 1SROA 2NVQH 4DR6Q 3TS2A 1PH5A 1HNZQ 3FKIG 1VQ8A 1KQSA 2EQSA 2UUBQ 2MNAA 1T9HA 2WP8J 4B3MQ 4DK6C 3A0JA 3A74A 4LWCA 4A3BH 4TQUS 2E2JH 2Z0SA 3EBEA 4XIGS 2IX1A 2WAQE 4X64L 3S16H 1CSPA 1Q8KA 2AMCB 1WI5A 1PH6A 3AFQA 4LUVA 2Q2TA 4A93H 3G6EA 3NENA 5J3BA 1CUKA 2YTVA 2VY3A 4JI3L 4JOIC 4A3IH 1OXTA 1WCMH 4LF7L 1KRTA 1VQMA 1VQDA 5LMUQ 4GNXB 4L5RC 1UE6A 1MKHA 1VQBA 1XPOA 3KYHC 3T1YL 1W2BA 4C2MH 4DUYL 1IBLQ 2CWAA 2BA1A 4R4IA 1Z9FA 5AJ3L 1X65A 1VQ5A 4JI6L 4DV0Q 4PMWA 3MXNB 4LF7Q 1QVCA 1X6OA 4X62Q 4IFDI 2UU9Q 1P16A 2UXDL 2E5LQ 3OW2A 3HOZG 4RG1A 4DV7Q 3EN2A 1XTDA 1IL2A 4APVA 1HR0L 2JA7H 4BA2I 4A3GH 4NB3A 1MJEA 2R7ZG 2NZOA 1N32Q 4DV6Q 2E2HH 1PVOA 4A3EH 4PZ7A 3D31A 2K5HA 2Y0SE 1Y1VH 2ZTCA 2Z6KA 2PI2E 3ERSX 4YWMA 3ULJA 4IFDG 2UXBL 5C0XG 3L7ZC 2HT1A 2AKWB 1BBWA 3U50C 5M5YH 1VQGA 4GOPB 1ASZA 3M9BA 1N33L 1KXLA 1NY4A 2ZM6Q 2EIFA 3Q8DA 4KHZA 1I94Q 3G4SA 3LGJA
chains in the Genus database with same CATH superfamily
4JI0Q 5C4XG 2K5QA 2JA8G 3P75A 4LF4L 1LTLA 3FHWA 4UAIA 3HOWB 4AIMA 1E3PA 2CCZA 2JK8A 1S5FD 4G7ZC 2HHHL 3ICEA 2D62A 4IUPA 3IKJA 5IWAL 3J7ZC 1RTOA 3JC66 4A3MG 3MA2B 3MXGA 2N3SA 4B3TQ 2QDLA 2AUKA 2RHQB 3GTKB 4ODGA 4DXFA 4N8X1 4CDFC 3E3XA 1VQNA 4NXMQ 1GO3E 1C4QA 2QDBA 2Q2IA 1EYAA 1FGBD 5ELBA 1H9RA 1JORA 1LACA 4A3FH 4DV4L 2ICEC 2K32A 4HJ5A 1TWCB 5EGTA 1BCPB 4DR3Q 2L5TA 2NN6G 4RCNA 2EYJA 1K3RA 1SNDA 2X6LA 3BVZA 1N36Q 5A2QE 1ML0D 1WTPA 2Q2UA 1SXTA 3OHXC 4QL5A 2SNMA 5G3LF 1NMGA 4PG3A 4QUCA 4HEDA 2YU9B 1FYCA 2I46A 1MHWC 3T1HQ 5IP9H 3M4PA 3B6YA 2ZT9C 2NZHA 4NW2A 2DJGC 1LTBD 1SSOA 4JI1Q 4BA1I 2B63B 1SNPA 1VQPA 3JAML 1U5KA 4YWLA 4C3JH 5DLQE 1RHPA 1UWVA 3V96A 1GVPA 3NTHA 3HOYB 3CXCA 3OW7A 3RZOB 2WAQB 1S4ZA 1MI2A 4R4TA 1MGSA 4EQPA 1SJED 1VCIA 2CKZB 4GNXC 3F2BA 3HOVB 4YCWA 4JK1C 5IOCA 3J7AF 1X3QA 5BR8Q 2HIXA 2R61A 2KQ3A 2WV6D 4IPGA 4KN4C 2Q8TA 1WTHA 4DNRB 3CCUA 1FR3A 4E6IA 4KHVA 4LF5L 4YWKA 2NBFA 4A3LG 3CKIB 2R7DA 3NELA 4A3JB 1DD2A 1NBWA 3JAMi 1U4PA 2KJXA 4KKUA 3JAMc 4F88A 4RKBA 4XXEA 4A93G 3MXPA 1S5CD 4DV1L 1SYFA 1WTVA 3S15H 1IBML 3S16B 4JI5L 3W5OA 3M3YB 3PGZA 1RTNA 5KGUA 4X64Q 4A3IG 4GZYC 1LTRD 4KD3A 5LHY1 1SE2A 4HAEA 1YEZA 2EJMA 5IT9L 5C4XH 5M9OA 3DWPA 4ME3A 2JA8H 2L11A 4BS9A 1Q1BA 2NZ1D 1R4QB 3MZ5A 4KHPL 3CMAA 2XGTA 2DNEA 4QY7A 2HDMA 2HIVA 1LT6D 1ENFA 4CDCC 5C44B 5IE8A 4A3MH 1YJNA 2JA5G 4JI6Q 4GN5A 1SEBD 2KHIA 1I50B 2RCFA 3A7AB 2PZTA 4AYBG 3H0GG 1STBA 1Y1VB 4ZAIA 1VQ4A 4FF1A 2ZJPA 4XYOA 2BDNA 1OXSC 3PO3G 3HRZC 1NJIC 4L6TB 2JEAI 1O7YA 1M90C 3EVQA 1TT2A 1KNEA 1HJPA 4DV5L 5FOBB 4A3KG 4DR2L 4DR4Q 5LMNQ 2E75C 4UDUC 4JV5Q 1TS4A 1GUWA 2NN6H 3D8GA 4X3UA 3RLNA 4WFN3 1D5ZC 2KCMA 1CTMA 5A35A 2WB1G 1JJGA 2AQ3B 5ELFA 1I4HA 3GTQB 3D0FA 1C7YA 2VB2X 2WINB 1MJCA 4ZQ3A 1D5XC 2D2CC 3KF6A 2A6HC 2JN4A 2JJQA 3OTOQ 3FRPB 5FO9B 1ENAA 4Y7NB 1C48A 1JB7A 3VR4A 1QUQB 2NTSA 2IX3A 1N9WA 1H9MA 1R4PB 3BU2A 3NBIA 2LFNA 3GO5A 1PZJD 5H1SE 3K7UC 2IJ0A 1SRUA 3UDXA 1BCPF 1SNOA 1D8LA 5M3FG 4IUNA 4K0KQ 1ESFA 4P72A 4NXNQ 5KNDA 4R4OA 4KN7C 3H3VC 1PFMA 4JBKA 1MD2D 2LXKA 4C56C 1QWYA 4EX5A 1VQ6A 3D4RA 1KNAA 4JPBW 5LMUL 2A6ED 3ZYYX 1IBLL 1D5MC 4OXPA 3VYTA 4ULLA 1G51A 4GLVB 5M5XB 3L2PA 4FXGC 4A3LH 3OWFA 2E5LL 4RHRA 4HR7B 4DV7L 3TREA 4C3HG 3KLWA 1A2UA 1CA6A 4DKAC 5D3IB 3PCOB 1SR3A 3OIPA 4L63B 1VQLA 2UUAQ 4LFBQ 2NVQB 3MEFA 4L8JA 5C6AA 2F3WA 1PRTD 3SR1A 2O5JC 2R7ZH 1A3UA 3C1EA 2KECA 3T51B 2ZM6L 4QGUA 4A3BB 4GOPC 3RLOA 2F0HA 1VQFA 4CDEC 3RNUA 4F87A 1M4VA 4ZUIA 1CM9A 4QUFA 5I4DA 1MIUA 4L5TA 3M4YA 3Q24A 2BOSA 2D9UA 4Q5VA 1A3VA 3S1NH 5I2XA 2B2UC 2JA5H 1VQEA 1GM5A 3SGIA 1JJ2A 2OQKA 4YCUA 5DAUA 2R92H 3L3OC 3UE1A 3CCRA 2MUYA 1HQMC 3OIQA 3H0GH 2JA7B 3TS0A 4N9TA 1X3EA 2MP1A 1B3AA 3PO3H 1K8MA 3CHBD 1PDQA 5ELNA 3AQQA 1BO0A 4QCLA 4BWGB 1GD7A 1S5BD 4DF7A 1S5ED 1Z7TA 1Y14B 2OQ0A 1QOHA 1VF5C 1K9MC 1EYGA 4DUZL 4KI0A 4FNFA 2EYHA 2K4KA 4FP5D 1PH4A 3HOUG 4DU9A 4K2LA 5C3EH 1VMPA 2E76C 1UE1A 3Q22A 2VZAA 2CH4W 1IYJB 1CHPD 3E9IA 1Q82C 2GVBA 1DM0B 1HZCA 4KY7A 1XYIA 2O2LD 1TWGB 3BDOA 1EFID 3KBXA 4C3IB 3E9HA 5CBEE 1YHQA 1TS2A 5M3MG 3QJYA 3I4MH 1SBBB 4FVMA 3PO2B 2F0WA 5IYDG 5M3FH 4KV6A 2NVYH 1XJVA 4GKKL 2BH2A 3FMCA 2UXCL 1XMQQ 4F7XA 1LYLA 4BBRH 2EYFA 3IFDA 3K5MA 1LTTD 2E74C 1V1QA 4EQ5A 4JYAL 3DXJC 3VR2A 1JC7A 1TWHH 4BXXG 3PUXA 1YNNC 3DEPA 2F0FA 2EYPA 1H9KA 3T16A 2VQFL 3C46A 1PYSB 5I2YA 1JWUD 3TBIB 1MSGA 4GS3A 3K7AH 5IGFA 4DR6Q 3TP8A 4PV1C 3WOFA 3FKIG 4V0BA 3SK8A 5BN4A 2UUBQ 4B3MQ 3NWTA 4DK6C 4LWCA 1H9SA 4DNTB 2BDOA 4XIGS 4XQQA 5DM63 2Q2TA 5EPKA 2SEBD 4RWSC 3VYUA 4UHVA 1EOTA 4JI3L 4JOIC 4LAAA 4OIJA 4L5RC 3S9WA 2EE1A 5T1GA 3A8KE 4C2MH 3FVQA 4WORA 1VQ5A 1NCVA 1GUNA 3W3AA 3MXNB 2UU9Q 1P16A 1UUPA 3GTGB 3EN2A 5CORA 4APVA 1HR0L 4NB3A 2H1EA 3SK5A 3D31A 2K5HA 2Y0SE 2R7ZB 4FXDA 1ZEQX 3U50C 5M5YH 1E2ZA 2B2TC 2EIFA 1I94Q 2OXPA 3LGJA 4LF9Q 5GAGC 4GNXA 3ULPA 2I5HA 4B3SQ 3STBD 1ZXTA 4DV2Q 5GADC 1HZAA 4DR1L 4ZUJA 2F3VA 3HOUH 3J81L 3S1NB 5D14A 3NEMA 3PUWA 2RCNA 3KLSA 3BVGA 2L1BA 1GHJA 2Z8LA 4GN4B 1SE8A 3NTIA 3GTPH 1K0SA 3SDZA 2R92B 1VS0A 1YNXA 1SLJA 4L5SA 3KF8B 3F1ZA 5C5LA 1KAWA 3R8BA 4MHEA 4NPSA 1PH2A 1PH8A 1RIPA 4P2CB 1J5EL 5M3MH 4DR7L 2ATWA 2TMPA 3RZDH 3F8TA 5EKKA 4RKLA 5IP7G 4ZLTF 1E0BA 1IBKQ 2F4VL 3VR3A 5IYDH 4X3SA 4GKJQ 4DGZA 1JJCB 2L4NA 1CHQD 3UDGA 1PTOB 3PMFA 2VXWA 3KBGA 3CAMA 5LL6S 3OYYA 4QJFA 3J81i 5I6WA 4BXXH 2KA7A 5C3EB 1R9TH 3NSWA 4PZ8A 5J22A 1XNRQ 1Y8OB 1F2MA 3VR5A 2E2DC 1GXDC 4ABNA 3A55A 4JI4L 2GN5A 2ALYB 1DZ1A 3HGBA 5M5WH 1I6VC 5C3WA 1X3PA 3FKIH 4BBSB 1H9JA 3I4MB 1JE5A 4HJAA 4OHJA 2F4IA 3VR6A 4X65L 1SYGA 3U9SA 4JVZA 3GTJH 4FF2A 1LV9A 4JI2L 2E8GA 3HEJA 1QZGA 4BBRB 3ZJYC 4JI7Q 3K8AA 1X3FA 3RR5A 3S14H 2VNUD 2MO0A 1TWHB 5ELEA 2A69D 3KJPA 3VA7A 1MSHA 1IHZA 4XQJA 2E2IB 5IGGA 2XRSD 2DJFC 3RMHA 5C4JB 1YJ9A 4X66Q 3NBHB 3K81C 3ITPA 3I90A 1C0AA 3TMEA 4R1JA 1G6ZA 1WFQA 3I3CA 3K7AB 1SMYC 4LF8L 1HNWQ 1WTRA 4WJWA 2Y0SG 3ONAB 1JWMD 2F52A 1Q12A 1CQVA 2I5LX 2KCNA 1RDPD 1YIJA 3PUZA 3DHQA 2K52A 1SE4A 3A8JE 1HRJA 4UPAA 4FXKC 4HIMA 3OPOA 4DK3C 2A19A 4BY1G 1U0LA 3SVMA 1Y1WB 2HDLA 3I72A 2DUDA 1A3TA 2RDFA 2ZXPA 4IURA 1GHKA 4CHTB 1KC8C 2N78A 1L1OB 2QKIC 4IQZA 5JJLA 1I3QH 1V43A 2KOLA 1LABA 3S2DB 3NUCA 5A2QL 1RODA 2AQ2B 3CC4A 3H94A 1XNQL 1HZBA 5JVG3 2A68C 1EIGA 2AWNA 3A5ZB 2PI2A 1WVLA 4N9PA 1LT4D 1UE7A 4HSPA 3SK6A 2F0DA 2JA6B 2MQHA 3HKZE 2UXBQ 1PH3A 1G6PA 2EY1A 3J80E 4GOPA 1CKMA 3DWAA 1PV4A 1PTOC 4CJ2C 1PH1A 3I4LA 2R93H 2PZWA 1GJXA 4YCVA 2VUMG 3J80c 4LF4Q 4LUZA 4RCOA 1B3QA 4PNYA 2Q8IB 2PO4A 3KOJA 5CBAE 5I9OA 3H15A 4HTHA 2HHHQ 3I8ZA 2B2UA 5IWAQ 3HOXG 3GTPB 1PH7A 1LUZA 5IIFA 3D3RA 2ID0A 2PMZB 2G9DA 1TQOA 3NHHA 1EY9A 1L0YB 1QNUA 3PF4A 3X3MA 2XTIA 2JQOA 1D1IA 5FO8B 4BY7B 2Z9HA 1YNJC 1HNZL 3MAQA 3PUVA 5M3MB 2F0PA 5IGDA 1L2FA 4XDXA 2KCTA 3BDCA 1JICA 3RZDB 3FEWX 2RVLA 1TIID 1PTOF 2DY7A 5EPLA 4DV4Q 4XT1B 2EYLA 1AP0A 2ZTDA 1ENCA 1BBXC 1T5XD 4IJHA 1AZQA 1V9PA 5KRUA 2VS1A 4M8AA 1T5EA 3NPPA 1CI3M 1LTGD 3G7LA 2A5HA 3NQIA 5CV4A 3BJUA 4K5VA 3U9OA 2JE6I 1Q7YC 4DV0L 3L0OA 5TSSA 1QUQA 1QZHA 3CF5A 4A3DG 3NP8A 3CRKC 3FDTA 2BCOA 4MIUA 2FFKB 3GTOH 1TY2A 1ZYRD 2FXQA 2MO1A 2HQLA 3X3NA 3O13A 1A62A 1IW7D 1BVSA 3M7NA 3HOZH 1HZ9A 4OGQC 2B29A 4P74A 3NXWA 3R2IA 1MBYA 1K73C 1OTCA 4MTNA 1PLFA 2F3IA 5IODA 1IXRA 4BY1H 2B2YC 2B8FA 5K5PA 2RQXA 1I4GA 1IL8A 1N34L 1WCMG 1CZWA 1YZ6A 2TSSA 1L1OC 3D6CA 1DGSA 5K36G 4C1NK 3F2UA 3QOJA 5KIXA 4DR5L 2M00A 4RH6A 2IW3A 5JAVA 4LF5Q 5CC4A 3CCJA 1B2TA 1YHBA 1ONLA 4V190 4A3GG 2VQEL 4O2DA 4HIKA 1QVFA 1U4MA 3CQZH 3UDFA 3S1MH 3HKZG 3CRLC 4K2KA 1NSNS 2E2HB 5FLXE 4A3EB 1CKOA 2B2VC 3CD6A 4DV1Q 2LXJA 2NVTH 4B3RL 1IBMQ 2N55A 4JI5Q 2VB3X 2R7FA 1PRTB 3I4NG 5FLXc 4JBMA 2EDGA 3GV6A 1YJWA 4LFAL 3G71A 4I7ZC 4JOIA 2A6HD 3AEVA 2VUMH 1Q46A 1BCPC 1I4RA 1EWIA 4KHPQ 3K5NA 1I3QB 1S3OA 4CDDC 1ICFB 1YHAA 1DXMA 4LNQA 3HOXH 3TZUA 3FPUB 1FJGL 1C8CA 3RLFA 2ES2A 3TRZA 4HJ8A 1FL0A 2IHFA 2NN6I 2HCIA 4KJOA 4FF3A 1NTGA 4J1MA 3C3LA 1SNQA 1EIHA 4CBVA 3WWVA 3T13A 2H5XA 5JPMC 2N8NA 1EOVA 2N49A 3EA6A 2B2TA 3BZKA 4KTAA 5JOBA 2ZJRA 4LFCL 1X56A 4JBJA 4IPDA 4DV5Q 3K6OA 1E22A 4OWXB 1CZGA 4A3FB 2R93B 1TWAH 2H4OA 2KEEA 4QB4A 2Q8RE 4DR2Q 4A3CG 2X69A 1TWFH 3QG1A 5DM73 1EY7A 1KL9A 1A8VA 2IPKD 4CKCA 2IWHA 5C0XJ 3UDIA 1HQRD 2BE5C 1SYBA 2K5NA 2F0UA 4EQOA 3GQBA 4JG2A 3CPFA 5F2DA 1DJRD 1PYBA 1LTAD 3LNNA 4A3DH 4IUUA 4LK1C 1JR0D 2K5WA 3K58A 3D4WA 5J1ZA 1CK1A 1Q8IA 3K5OA 1VQ8A 1KQSA 3C1FA 2EQSA 5C4HA 2WP8J 3MTSA 4C3JB 1CA5A 2EVBA 2E2JH 3A8IE 3M7GA 4CKEA 2WAQE 3T4AC 1Q8KA 2AMCB 1WI5A 4A93H 2EYMA 4OEMB 4CGYB 1CUKA 2YTVA 2VY3A 4FYDA 1B9NA 1D2BA 4A3IH 1WCMH 4MN3A 5ELDA 2SDFA 1VQDA 2L55A 5LMUQ 1UE6A 1VQBA 4J6HA 3KYHC 3T1YL 4DUYL 2B39A 2OF1A 2CWAA 1IBLQ 5K36H 2LY7A 5AJ3L 4I65A 2A6EC 4PMWA 4IFDI 1K28A 2D5DA 2UXDL 2E5LQ 4TSSA 4DV7Q 1B50A 1XTDA 3EJIA 4A3GH 3C2PA 4ILWA 1O80A 3HOZB 4CJ0B 1STEA 4R9WA 4PZ7A 1UNSA 2ZTCA 3A54A 2Z6KA 2PI2E 3ERSX 4G57A 5C0XG 3L7ZC 2AKWB 1N33L 1VQGA 3V2TA 3PIP3 1HHVA 1KXLA 2ZM6Q 3S15B 2GA4B 3K0YA 4XYQA 1AFPA 2I07B 3HOWG 1CQFA 5IY0A 4QIWB 1K3BC 1WTXA 2JXMB 2PQEA 5C4XB 4A3KH 1XMOL 5ELOA 2JA8B 1EY6A 3ULLA 4MZ9A 4NMZA 2K14A 2C35B 2G9HD 3A56A 3DLLA 1ASYA 3MXNA 3K57A 2XRQD 1K8OA 2R6GA 5IYBG 2BH8A 2MHVA 1BDOA 4A3MB 2PPBC 1WOCA 4G7HC 4OO1I 2A74C 1AE3A 2C5CA 1S40A 3VYRA 3LWUA 4YHHL 1IKLA 1DOMA 1PFBA 1JT8A 1PRTF 2KHJA 1LTID 2PNHA 3W1BA 4HJ7A 2XN9C 5CR3A 3GTMH 1JE4A 1HNXL 5ELCA 5LMNW 4DV3L 4A3CH 1X3GA 2JEBI 4A75A 4EVOA 4RA8A 2EXDA 4DUZQ 2WFWA 4H7BA 4IJLA 1SMXA 3PF5A 2RA4A 5EQ0A 1AN8A 2K6AA 1SDFA 1SYCA 4HIDA 3CCLA 4OX9L 3KF8A 1Y8NB 3KDFB 1SFOH 3S1QH 4J8QA 2B63G 3OMGA 1E24A 3M4OH 2LS01 1VQAA 5FLMG 3MEHA 2QF7A 1VQIA 1BQQT 2F0LA 2B3GA 4H0LC 4ME5A 2K04A 4C3HH 5DNFA 1W3SA 3HOYG 2UUCL 2WAQG 5KYIA 2F0VA 1ET6A 3S2HH 1WD1A 2PNRC 1HA6A 4WRDA 4KLKA 5IGCA 2J4XA 1S72A 4GKKQ 4RGTA 2HD3A 3HOVG 1HPCA 2UXCQ 2RSNA 2HUGA 2FHTA 1FD7D 4JYAQ 3BZCA 2IHEA 1EL0A 3H6MA 1B9MA 5E1FA 4DAYB 3CMEA 4O42A 4QMGA 4IOCA 3DEOA 2Z6BA 2VQFQ 4A3JG 2M2LA 1NMFA 4AQYL 4DNIA 1BUVT 3BVMA 1U9RA 2HCCA 1UEAB 1K8AC 4O0AA 3DWQA 3HS0C 1STAA 3A5UA 3GTLH 4RFBA 5E4XA 3HG9A 1PH9A 1VQOA 1KLUD 1ILPA 4NP5A 3K59A 4XTCS 4PMBA 2E2JB 2I0QA 3S17H 4OIKA 4RGOS 5C0XH 1KDBA 3P7JA 4A93B 5I6YA 3SE0A 2K50A 5DEHA 1NNXA 3HOWH 4A3IB 5E4WC 4LF6L 1EYCA 1H95A 4JI3Q 2F03A 3WOEA 4PQXA 2NTTA 2OCEA 2L15A 1EZ6A 1VQ7A 5C44G 3NBHA 4R4CA 3QB3A 3VA5A 1F9SA 3GTKH 1Q86C 4HMIA 1Z6HA 3PIO3 5IYBH 1W6JA 2F0JA 3BS1A 1KABA 4K5XA 4OWTB 3DM3A 5CMDA 3CC2A 2JA5B 1DCZA 1B53A 1BXTA 3I73A 5EKIA 1Y1VG 1HR0Q 5CYUA 2D0OA 3KLRA 1A6XA 4AYBB 3H0GB 3S24A 4WJ3M 1BKBA 2CFMA 3ND9A 3J7AV 3F2CA 1TWCH 5CV8A 3PO3B 4XQNA 2G5DA 2KENA 1B44D 2B2YA 3J81j 3TP6A 4CKBA 3PQIA 1X32A 4IOAA 3VYSA 1AE2A 1L1OA 4A3KB 3TEHB 4K8IA 1J8IA 1V1PB 1XTCD 4DA2A 2MPMA 4KMUC 4DR1Q 2ICIA 2ZTEA 1Q1EA 4LMQD 2ZXOA 3RN5A 2WB1B 1EFWA 1EU3A 3MWYW 2FMMA 1K0RA 2K33A 4DFAA 1SAPA 1ICWA 1B1ZA 2CH4A 2CW0C 3KUPA 4YY3L 2B63H 1EIFA 5FLMH 2IY5B 3U4VA 1JOOA 1O78A 3PSIA 3E0EA 1D6EC 3OWEB 1GUTA 3K80C 2B2VA 3QWNA 1J5EQ 3HOYH 3K5LA 3RZOH 4DR7Q 2C9OA 2GVAA 2N88A 3DM1A 4MTKA 2QILA 1M1KC 3RUZA 1A2TA 1PFSA 3AU7A 4P75A 2F4VQ 2Z6KC 3H3VH 5M3FB 4GLAC 2NVYB 3RD4A 3OMCA 4MNOA 4PZ6A 4IALA 5IP9G 4EGVA 4RHSA 1PXUA 2KUMA 3FP9A 4PMCA 5T1IA 2NWGA 1AEXA 4Y52H 1LM0A 1SFOB 4A3JH 1CKNB 4LF7L 4X62L 3HKSA 1A0IA 4RMFA 1D1KA 4JI4Q 3QO2A 5FJ8G 5E7NA 3LWEA 5COYA 3EIVA 1Q90A 4ZYSA 1N32L 4DV6L 4C3HB 2BA0A 3KLSX 3J7A5 1UAPA 2O5IC 1Q81C 3TP7A 2NB0A 4A3BG 3M3YH 3S2HB 1KDAA 2PQAB 1FVIA 3R3OA 4X65Q 4X3TA 1EEFD 2JA9A 1VMCA 2XSCA 5D65A 4X3KA 3KJOA 4JI2Q 3BYYB 1CFMA 1PZKD 3LX0A 4JI0L 2F0EA 1HTLD 1O7LA 3V05A 3EFXD 1JCKB 3P20A 1VQCA 2CQOA 3NTKA 2VW9A 4C1NI 4WJ4A 4HMJA 1KDCA 2CWPA 3J80L 2A68D 5G3LD 1JWSD 2WIIB 1FNVA 5C44H 4B3TL 2A69C 1I50H 4C2MB 3MHBA 3PV0A 1UE5A 2F0KA 3H09A 1RJTA 1X54A 3GTLB 1JMCA 1F2ZA 1HFNA 4LF8Q 2JA7G 2Q2HA 4NXML 4DK1A 2K1BA 1V8QA 5JJKA 1RL2A 3Q6SA 4YIJA 4RGMA 5KEEA 5C5MA 1XX8A 1VQHA 3T56B 1ILQA 4U68A 5C3XA 5GAEC 4JCVE 4X6AH 3CCSA 5IGEA 4JBWA 3TN2A 4FO2A 2CHBD 1AZPA 3CU7A 4K6DA 5M5YB 3MFYA 4DR3L 2QEXA 2YYZA 4K6LA 5IP7H 1W6KA 4K8JA 1N36L 3QIAA 4OWWB 3GTQH 4S3SA 2QW7A 1EQVA 1LTSD 1BR9A 3J80i 2D0PA 4DAMA 3SHLA 1UEBA 4FDBA 1WD0A 1YNJD 2FINB 2SOBA 3DMUA 3HOUB 1HR0W 3T1HL 1XWEA 5BN3A 1BNZA 1B70B 4Y7NH 3IRBA 4DK0A 2LSSA 1QVGA 1G91A 1XNQQ 3EQLC 4JI1L 4C3IG 4AYBE 4HJ9A 1E7ZA 3HZXA 3SEBA 4POGA 4IZ8A 3F2DA 4AH6A 1E1OA 3PO2G 4FF4A 3CPWA 2Z4HA 4RGNA 1U4LA 1AH9A 1IYVA 4TVAB 4K14A 1Y69U 2OTJA 4UP8A 1JOQA 3PIPA 2OEOA 2L12A 4B9WA 2RBMA 3I56A 2WB1E 4UP7A 4IFDJ 4IO9A 5BR8L 1E1TA 1HFGA 4OONA 1GUGA 5GAHC 1PA6A 5M5XH 4K5WA 1NR2A 1TY0A 4F8MA 2LKVA 2F0MA 1WJJA 1R9TB 5E3FA 1PHJA 1XPRA 1F9QA 5FJ8H 1PZID 3BDLA 2NVQH 1F9RA 1KLGD 5HGTA 3TS2A 3J7YW 5M5WB 1HNZQ 2F0IA 3W2DA 3UI2A 4G7OC 1HUMA 3QR8A 2MNAA 2RKSA 3FKIB 4ZK9B 4A3BH 3A74A 2EY5A 4H13C 2CQAA 2Z0SA 4X64L 2WKCA 3GTJB 3G6EA 3T53B 4Z9CB 5FLXL 2K5DA 1OXTA 3QOLA 1KRTA 3S14B 2V4DA 5C4ZA 1I4PA 4KY5A 4NKLA 2BA1A 4LJZC 1Z9FA 1X65A 3JAME 4JI6L 4DV0Q 2DN8A 1QVCA 1X6OA 5FKAC 3ERQA 2JP1A 3OW2A 4RG1A 2JA7H 4BA2I 2F0TA 1EU4A 1MJEA 2R7ZG 2NZOA 2B2WA 2EJFC 1WTQA 1QB5D 3NK9A 2F0SA 2K03A 1PVOA 1VF7A 3E5SA 1L0XB 1WTWA 1ZYRC 4YWMA 4ZCKA 1IW7C 4IFDG 1QJOA 1BCPD 2HT1A 5EKLA 4GOPB 1ASZA 5I9PA 1DOLA 3Q8DA 1EY8A 2WACA 1KAAA 4DR4L 5LMNL 2V1CC 4JV5L 1F2YA 1VQ9A 5KYLA 1N34Q 4B9XA 1JQYD 2XVSA 3TP5A 2AWOA 5HURA 3ND8A 1I4XA 3M4QA 2OWOA 2R92G 4DR5Q 4ZRZA 2J7ZA 1EIYB 3I55A 5GQOA 5CGKA 3OTOL 1TS5A 1SNCA 3CCVA 1TWGH 3BYTB 1F9PA 4C3IH 2VQEQ 2K75A 2OTLA 4DN4M 3PO2H 5IT9E 1EQRA 3CC7A 2WKDA 2L9HA 4K0KL 4OO1G 4B3RQ 1A15A 2BE5D 3OOCA 4NXNL 2K05A 5IT9c 4U673 4KKTA 4IPHA 1G291 1PYWD 4LFAQ 4DAVA 2K01A 1CSQA 3R93A 1ZKOA 3BZDB 5C3EG 1TXYA 1KIXA 4HSVA 1GKHA 1OXUA 5HY6A 1OXXK 3HFZB 1WYDA 1STGA 4M1UB 3GDEA 4O1NA 2PMZE 1FJGQ 1II3A 3PIOA 1C9OA 3K0XA 1EZ8A 3U58A 1F2LA 2P5ZX 1I4QA 2DGYA 4BBSG 3I4MG 1YITA 2VL6A 2UUAL 1QE6A 4LFBL 2KEDA 2F0GA 3S1RH 3N52A 3I70A 2EOTA 1SN8A 4OL7A 4HN7A 2IX0A 5IGBA 4BBRG 3AMUA 1DYQA 5IYCG 2L0CA 4LFCQ 3GP7A 1JOKA 5EJWA 5D3DA 2AHOB 2EZVA 3Q0AA 2EY2A 2FJ2A 1NUCA 3SK4A 2X6GA 2EXZA 4XT3B 1J6QA 3ER0A 1N8RC 1VDZA 3KDFA 3I2ZA 1ESRA 1KRSA 1SYEA 4Q0FA 3GTGH 4H02A 4LUOA 2MGSA 4A4IA 2A73B 5L37A 4IUVA 1EY0A 4ID6A 1SYDA 3GTOB 1U4RA 2QGQA 1XXGA 2Y0SB 4IUTA 4HCEA 1YI2A 4IFDH 3KFUA 3DUZA 3I4OA 1Y1WG 3A7LA 1KHIA 4IPCA 2KBNA 1E2WA 4R4QA 1PRTC 4DAYA 3KK7A 4L5QA 4KD4A 4BY1B 5CV6A 3I4NH 1G2SA 3AFPA 2A8VA 2EYOA 3MFGA 4P73A 4B08A 5EBDA 3L9AX 1GOZA 2ENBA 3T1YQ 4DUYQ 2XWJB 2B8GA 5AJ3Q 2F0NA 2A1AA 4I7AA 3KF6B 1TS3A 2UXDQ 4POFA 5EAYA 1KTKA 2K5VA 2EY6A 4GLXA 1K8GA 4IUQA 2JA6G 3G48A 3CQZB 3S1MB 3M85A 3U4ZA 1IYUA 1YBYA 5JEAJ 1EYDA 1N33Q 4OO1H 1K83H 1PTOH 3H91A 3R2TA 2NVTB 1GUOA 5AFWA 1D7QA 1XMQL 5JVH3 3AB9A 1YNND 5ISRA 2IT1A 3TQYA 1O7ZA 1XMOQ 2XIWA 2VUMB 4J15A 2RHSB 3IL8A 2NYZD 2DY8A 2KCCA 5HGQA 1ET9A 1X55A 1G8ZD 4R8NA 1Y8PB 4N8FA 1PFNA 1QNKA 2O4XA 3HOXB 4BY7G 3VDYA 1RCVD 4KJNA 1QILA 3P1HA 5CV7A 1P8LA 4DR6L 1I6HH 5BN5A 4BBSH 2EJGC 2PW5A 3TSSA 1YVCA 1DOKA 1RKNA 1Q3LA 1FGUA 2RF4A 4YHHQ 2UUBL 4DPGA 4B3ML 2I5MX 3CW2C 2B2WC 2YTYA 1SNMA 2JYOA 1E2VA 2PZUA 1B4OA 5GROA 2QCPX 5IYCH 1HNXQ 1G2TA 2F0QA 1V1PA 2KVMA 4UY8C 4DV3Q 1TWAB 4HCSA 1TU2B 2E2IH 4RAUC 1TWFB 5C4JH 2NVXH 2MJ8A 1M8AA 1O7IA 4JC0A 3IAYA 4DXGA 3OSOA 1HXYD 3UE0A 4OX9Q 5EPJA 2UU9L 1RF2D 5JEAG 4TKOB 1S5DD 2Z1CA 1HUNA 3D6WA 3G6JB 4KY6A 4A3DB 3S1RB 1BOSA 1QCBD 1VQJA 1BBUA 4R8IA 3GD7A 1LT3D 2YV5A 3I91A 2UUCQ 4GN3B 2QA4A 1WTOA 4ALPA 4HIOA 2XNAC 1I94L 1OO9B 1Y1WH 1BF4A 4LF9L 2K7VA 4B3SL 1XPUA 2SNSA 2XWBB 4DV2L 2LMCB 2NUCA 4ZKBB 2DNCA 4DAPA 1WCMB 4QF4A 3CCMA 3W1GA 1CKNA 2KHSA 3S2DH 5C0XI 4JI8L 2ZXRA 4KKSA 2JSOA 1AW7A 1B8AA 3PUYA 4AQYQ 1STYA 1HCZA 3MXUA 2PYKA 1SJHD 1EQTA 1EY5A 5KNBA 3Q23A 1VQKA 1RD9D 5CV5A 1FNWA 2RDGA 3IFTA 4A3EG 4H44C 4A3GB 2MFIA 2JA6H 2PQAA 1X9NA 1TR5A 1TKWB 3WDNA 3CCEA 2RSOA 3HKZB 1EQQA 1A63A 1IBKL 4EQNA 5JJIA 4GKJL 1Z47A 3RN2A 3GV3A 2HQEA 1IZ6A 2QEJC 4NDXA 4QIWE 3I4NB 3NQTA 4CJ1B 2AQ1B 4LF6Q 1I5FA 3E0JA 1DONA 2CW0D 4LW1A 5JPNC 3SXHA 3NE5B 4OELB 4JI8Q 2YTXA 1B7YB 1JB3A 2R3ZA 1XNRL 1PMRA 2YU9H 1NE3A 3STBC 2ASBA 1F77A 2AUJD 2F0OA 2ZJQA 1FNUA 1EY4A 3MC0B 4BY7H 5LL6X 1CT1D 1EUJA 2PW7A 3I7FA 5CV9A 3CP0A 5NUCA 4P71A 1TVXA 1LO5D 1HTPA 1EWCA 1L0WA 1STNA 1K83B 4A3FG 5FK9C 1HA5A 2R93G 1H9SB 3J81E 3GTMB 2RDHA 4JI7L 4QQBX 1NR4A 3EROA 1V1OA 3URYA 1KD1C 5JJZA 3J81c 2FMCA 3N6RA 4UP9A 1HH2P 2PCFB 3HOVH 1STHA 3FPPA 3AYHB 3NWSA 4X66L 2OT2A 4A76A 1SMYD 1IKMA 3CCQA 3H3VI 1HNWL 4YY3Q 1OXVA 5JEAH 1I6HB 3S1QB 5FO7B 1SROA 5EBCA 3M4OB 1PH5A 4TRDA 4KK7A 4C3JG 4G4KA 1T9HA 5J39A 3A0JA 4TQUS 2M9VA 2IL8A 3EBEA 2IX1A 3S16H 1CSPA 4IN3A 1LT5D 3D4DA 1PH6A 3AFQA 4LUVA 1SE3A 3NENA 5J3BA 3BG3A 2Z4IA 1VQMA 4GNXB 2NVXB 1MKHA 1NAPA 1XPOA 2CVRA 1W2BA 3HP3A 4R4IA 2J0TD 3TZDA 2F1MA 5KNCA 2K28A 1QG7A 4LF7Q 4X62Q 2EPBA 1J9OA 1LLRD 3HOZG 1IL2A 1EEID 1N32Q 4JW0A 4DV6Q 3MVVA 2E2HH 4A3EH 1EWHA 1GUSA 4ZKCB 1Y1VH 3ULJA 2UXBL 3TDQA 1PTOD 1BBWA 3M9BA 3S17B 1NY4A 3E6ZX 4KHZA 3G4SA
chains in the Genus database with same CATH topology
4LF9Q 4DR4L 5LMNL 2V1CC 5GAGC 4JI0Q 3HOWG 4JV5L 5C4XG 4GNXA 5IY0A 2I5HA 3ULPA 4B3SQ 4LF4L 3STBD 2JA8G 1VQ9A 1LTLA 1N34Q 3FHWA 4DV2Q 4X6AH 5GADC 4A3KH 1XMOL 1HZAA 4AIMA 1E3PA 5ELOA 4DR1L 2JK8A 4MZ9A 2AWOA 3ULLA 2K14A 2C35B 2CCZA 3HOUH 2HHHL 1ASYA 3DLLA 3ICEA 2D62A 3NEMA 5IWAL 3PUWA 2RCNA 3JC66 3M4QA 3J7ZC 4A3MG 2R6GA 2N3SA 5IYBG 4DR5Q 2OWOA 2BH8A 2R92G 1EIYB 2RHQB 4GN4B 1SE8A 5GQOA 3OTOL 3I55A 3GTPH 1VS0A 1YNXA 1SLJA 3CCVA 1WOCA 4L5SA 3KF8B 1TWGH 4OO1I 3F1ZA 1VQNA 1KAWA 4C3IH 2VQEQ 1GO3E 4NXMQ 4NPSA 1PH2A 1AE3A 1PH8A 1S40A 1RIPA 2K75A 4YHHL 2OTLA 1J5EL 2Q2IA 3PO2H 5M3MH 1EQRA 4DR7L 2KHJA 1JT8A 2ATWA 3CC7A 2PNHA 3RZDH 3F8TA 3W1BA 4HJ7A 4K0KL 5IP7G 1IBKQ 2F4VL 3GTMH 4A3FH 4B3RQ 4OO1G 4DV4L 1HNXL 4NXNL 5IYDH 5IT9c 4GKJQ 4HJ5A 5LMNW 1JJCB 4IPHA 1G291 4DR3Q 4DV3L 3UDGA 4A3CH 4LFAQ 2NN6G 1X3GA 2JEBI 4A75A 1K3RA 1N36Q 1CSQA 2EXDA 3CAMA 4DUZQ 5C3EG 2WFWA 2Q2UA 3OYYA 1TXYA 4IJLA 4QL5A 1GKHA 4QJFA 1KIXA 3J81i 1NMGA 1OXUA 1SMXA 4PG3A 3PF5A 4BXXH 5HY6A 1OXXK 1R9TH 3HFZB 1WYDA 4HIDA 4PZ8A 1XNRQ 3CCLA 3GDEA 5IP9H 3M4PA 3T1HQ 4JI4L 3B6YA 2PMZE 4OX9L 3KDFB 2NZHA 3PIOA 1C9OA 1SFOH 2GN5A 1FJGQ 3S1QH 3K0XA 2ALYB 3U58A 2B63G 3M4OH 1E24A 2DGYA 5M5WH 1VQAA 4JI1Q 5FLMG 4BA1I 4BBSG 1VQIA 1VQPA 3I4MG 1YITA 2B3GA 2VL6A 2UUAL 1U5KA 4LFBL 4YWLA 4C3JH 4C3HH 3S1RH 3FKIH 1W3SA 3HOYG 5DLQE 2UUCL 1JE5A 1UWVA 2WAQG 4HJAA 1SN8A 1GVPA 4X65L 2IX0A 3S2HH 3CXCA 4BBRG 3GTJH 5IYCG 4JI2L 4LFCQ 4KLKA 4R4TA 2E8GA 1S72A 4GKKQ 1QZGA 3HOVG 3ZJYC 1VCIA 2CKZB 1X3FA 3K8AA 3RR5A 2AHOB 4JI7Q 3S14H 2UXCQ 2VNUD 4GNXC 2MO0A 3F2BA 4JYAQ 3BZCA 4YCWA 1J6QA 2IHEA 3KJPA 4DAYB 3CMEA 5BR8Q 2HIXA 3ER0A 4IOCA 1N8RC 4IPGA 3KDFA 3I2ZA 3CCUA 1YJ9A 4X66Q 1KRSA 3NBHB 2VQFQ 3K81C 4A3JG 4LF5L 1C0AA 1NMFA 4R1JA 4YWKA 4DNIA 4AQYL 3GTGH 2R7DA 4A3LG 1WFQA 3NELA 4H02A 4LF8L 1HNWQ 1K8AC 4O0AA 4LUOA 3GTLH 3A5UA 1NBWA 4A4IA 1PH9A 2Y0SG 3JAMi 2F52A 1VQOA 3JAMc 1Q12A 2QGQA 2I5LX 1YIJA 1YI2A 4XTCS 4A93G 2I0QA 3PUZA 4DV1L 3S15H 3S17H 3KFUA 2K52A 1IBML 4JI5L 3W5OA 3I4OA 1Y1WG 3PGZA 4UPAA 4X64Q 4A3IG 1KHIA 4IPCA 4HIMA 4DK3C 2A19A 1A63A 4BY1G 1U0LA 2K50A 2KBNA 1YEZA 4R4QA 3HOWH 5C4XH 4LF6L 2DUDA 4JI3Q 4ME3A 2JA8H 1H95A 4L5QA 1Q1BA 3I4NH 1KC8C 3AFPA 2A8VA 4KHPL 3CMAA 2OCEA 2XGTA 2L15A 2N78A 4P73A 1VQ7A 1L1OB 5C44G 4R4CA 3T1YQ 4QY7A 4DUYQ 5JJLA 1I3QH 1V43A 2HIVA 3GTKH 4A3MH 5AJ3Q 1YJNA 5IE8A 1Q86C 2JA5G 5IYBH 4JI6Q 4GN5A 4OWTB 2KHIA 3DM3A 2A1AA 3CC2A 3KF6B 3CC4A 1XNQL 1HZBA 2UXDQ 4POFA 1Y1VG 1HR0Q 5EAYA 2AWNA 2K5VA 3A5ZB 3H0GG 4AYBG 2PI2A 2D0OA 4GLXA 1VQ4A 1K8GA 2JA6G 3G48A 1UE7A 2ZJPA 3S24A 1OXSC 4WJ3M 3PO3G 1BKBA 3M85A 3U4ZA 1NJIC 2JEAI 2MQHA 3HKZE 2CFMA 1PH3A 2UXBQ 1G6PA 3F2CA 1YBYA 5JEAJ 1TWCH 1M90C 1N33Q 1HJPA 2KENA 1CKMA 1K83H 4DV5L 4GOPA 1PV4A 4A3KG 4DR2L 1D7QA 3J81j 4DR4Q 5LMNQ 1XMQL 1PH1A 4JV5Q 2R93H 4IOAA 1AE2A 4YCVA 3RLNA 1L1OA 3J80c 3TEHB 2KCMA 4LUZA 4LF4Q 2VUMG 2IT1A 3TQYA 2WB1G 1XMOQ 1JJGA 3KOJA 4J15A 4DR1Q 3H15A 2ZTEA 1Q1EA 2RHSB 3D0FA 1C7YA 3RN5A 2HHHQ 1MJCA 1EFWA 5IWAQ 3HOXG 3KF6A 5HGQA 1X55A 1K0RA 1PH7A 1LUZA 2ID0A 2JJQA 3OTOQ 4YY3L 4BY7G 3VDYA 2B63H 3PF4A 2XTIA 2JQOA 1EIFA 1JB7A 1P8LA 1QUQB 4DR6L 5FLMH 1I6HH 2IY5B 3U4VA 4BBSH 3PSIA 1N9WA 1HNZL 3PUVA 3E0EA 1YVCA 1L2FA 2RF4A 1FGUA 3BU2A 2KCTA 3K80C 4YHHQ 4DPGA 1J5EQ 2UUBL 3GO5A 4B3ML 5H1SE 3HOYH 3RZOH 4DR7Q 3K7UC 2I5MX 2GVAA 3CW2C 1M1KC 1SRUA 3UDXA 1PFSA 1D8LA 2YTYA 4P75A 5M3FG 5GROA 4K0KQ 2F4VQ 5IYCH 4P72A 4DV4Q 1HNXQ 4NXNQ 2Z6KC 2ZTDA 3H3VH 4R4OA 4UY8C 4GLAC 4DV3Q 2LXKA 4JBKA 4IJHA 4MNOA 4EX5A 1VQ6A 4PZ6A 1V9PA 5LMUL 2E2IH 2VS1A 5IP9G 5C4JH 2NVXH 1IBLL 1O7IA 3BJUA 3FP9A 4JC0A 4OXPA 2JE6I 1G51A 1Q7YC 4Y52H 4GLVB 4DV0L 1LM0A 3L2PA 4A3JH 1CKNB 3UE0A 3L0OA 4X62L 3HKSA 1A0IA 4RMFA 2UU9L 4B3TQ 4JI4Q 1QUQA 1QZHA 4OX9Q 4A3LH 2E5LL 3CF5A 4DV7L 3TREA 5JEAG 4A3DG 5FJ8G 5E7NA 3KLWA 1N32L 3EIVA 4DKAC 3GTOH 4DV6L 3PCOB 1SR3A 2FXQA 2MO1A 2BA0A 2HQLA 3M7NA 1A62A 1BVSA 1VQLA 2UUAQ 3HOZH 1VQJA 1BBUA 3J7A5 1HZ9A 4LFBQ 3GD7A 2YV5A 2B29A 3MEFA 2UUCQ 4P74A 1Q81C 2R7ZH 4A3BG 3M3YH 4GN3B 2QA4A 2PQAB 1FVIA 4X65Q 4ALPA 2ZM6L 2JA9A 4QGUA 4HIOA 1K73C 1I94L 1Y1WH 3KJOA 4JI2Q 1OTCA 4LF9L 4GOPC 4MTNA 3RLOA 4JI0L 2F3IA 1IXRA 4BY1H 1VQFA 4B3SL 1XPUA 3RNUA 1N34L 1WCMG 1YZ6A 1VQCA 4DV2L 2CQOA 1L1OC 2VW9A 4WJ4A 2CWPA 1DGSA 1MIUA 4L5TA 5C44H 5K36G 3CCMA 3W1GA 1CKNA 3S2DH 4B3TL 5C0XI 4DR5L 3S1NH 4JI8L 1I50H 2JA5H 1VQEA 3PV0A 1UE5A 1GM5A 3SGIA 1JJ2A 2OQKA 4YCUA 4LF5Q 1B8AA 1X54A 3PUYA 4AQYQ 3CCJA 1JMCA 1YHBA 2R92H 4LF8Q 2JA7G 3UE1A 2Q2HA 3CCRA 4A3GG 2VQEL 4NXML 4O2DA 1VQKA 5JJKA 4HIKA 1RL2A 1QVFA 3H0GH 4A3EG 3CQZH 3UDFA 2MFIA 3S1MH 3TS0A 3HKZG 2PQAA 1X9NA 2JA6H 1VQHA 1X3EA 1CKOA 3PO3H 3CD6A 3CCEA 5GAEC 4JCVE 4DV1Q 3CCSA 1EQQA 2LXJA 4JBWA 1IBKL 2NVTH 4B3RL 5ELNA 1IBMQ 3AQQA 5JJIA 4JI5Q 4GKJL 1Z47A 2R7FA 3RN2A 3I4NG 5FLXc 4JBMA 1GD7A 4DR3L 1IZ6A 1YJWA 2QEXA 4LFAL 1Y14B 2OQ0A 2YYZA 4JOIA 4QIWE 5IP7H 3G71A 1N36L 4LF6Q 3AEVA 1K9MC 2VUMH 1I5FA 1Q46A 1EYGA 4DUZL 4OWWB 4LW1A 3GTQH 4KI0A 1EWIA 3J80i 4JI8Q 4KHPQ 2D0PA 2K4KA 3HOUG 2YTXA 4DAMA 1B7YB 1S3OA 1PH4A 1YHAA 1UEBA 4FDBA 1XNRL 2YU9H 4LNQA 5C3EH 3T1HL 3HOXH 1HR0W 1NE3A 1B70B 3STBC 1FJGL 2ASBA 4Y7NH 3IRBA 1UE1A 3RLFA 2VZAA 2LSSA 2ZJQA 1QVGA 4BY7H 1IYJB 2ES2A 4HJ8A 1FL0A 2IHFA 1XNQQ 2NN6I 3TRZA 4JI1L 1EUJA 3E9IA 4AYBE 2GVBA 4HJ9A 1Q82C 1HZCA 1E7ZA 3I7FA 4POGA 3CP0A 1NTGA 4P71A 3E9HA 4AH6A 3F2DA 1E1OA 1YHQA 3PO2G 5M3MG 3CPWA 3WWVA 2H5XA 3I4MH 2N8NA 1L0WA 1EOVA 2N49A 1AH9A 4TVAB 2R93G 3BZKA 4A3FG 5IYDG 4LFCL 1X56A 2ZJRA 5M3FH 4JBJA 2OTJA 4IPDA 4UP8A 4DV5Q 3PIPA 2NVYH 1E22A 1XJVA 2BH2A 4OWXB 4GKKL 1TWAH 4DR2Q 4A3CG 4JI7L 4QQBX 2UXCL 1XMQQ 1LYLA 4BBRH 3I56A 1TWFH 1KD1C 1KL9A 1A8VA 1V1QA 4EQ5A 2WB1E 4JYAL 3J81c 4UP7A 4IFDJ 5C0XJ 3UDIA 4UP9A 4IO9A 1HH2P 5BR8L 1E1TA 1TWHH 3HOVH 4BXXG 3PUXA 2K5NA 4OONA 5GAHC 1PA6A 5M5XH 3AYHB 4X66L 2VQFL 4A76A 4JG2A 1WJJA 1PYSB 3CPFA 3CCQA 1PYBA 3H3VI 4YY3Q 1PHJA 1HNWL 4GS3A 1OXVA 1XPRA 4A3DH 3K7AH 5FJ8H 1SROA 2NVQH 4DR6Q 3TS2A 1PH5A 1HNZQ 3FKIG 1VQ8A 1KQSA 2EQSA 2UUBQ 2MNAA 1T9HA 2WP8J 4B3MQ 4DK6C 3A0JA 3A74A 4LWCA 4A3BH 4TQUS 2E2JH 2Z0SA 3EBEA 4XIGS 2IX1A 2WAQE 4X64L 3S16H 1CSPA 1Q8KA 2AMCB 1WI5A 1PH6A 3AFQA 4LUVA 2Q2TA 4A93H 3G6EA 3NENA 5J3BA 1CUKA 2YTVA 2VY3A 4JI3L 4JOIC 4A3IH 1OXTA 1WCMH 4LF7L 1KRTA 1VQMA 1VQDA 5LMUQ 4GNXB 4L5RC 1UE6A 1MKHA 1VQBA 1XPOA 3KYHC 3T1YL 1W2BA 4C2MH 4DUYL 1IBLQ 2CWAA 2BA1A 4R4IA 1Z9FA 5AJ3L 1X65A 1VQ5A 4JI6L 4DV0Q 4PMWA 3MXNB 4LF7Q 1QVCA 1X6OA 4X62Q 4IFDI 2UU9Q 1P16A 2UXDL 2E5LQ 3OW2A 3HOZG 4RG1A 4DV7Q 3EN2A 1XTDA 1IL2A 4APVA 1HR0L 2JA7H 4BA2I 4A3GH 4NB3A 1MJEA 2R7ZG 2NZOA 1N32Q 4DV6Q 2E2HH 1PVOA 4A3EH 4PZ7A 3D31A 2K5HA 2Y0SE 1Y1VH 2ZTCA 2Z6KA 2PI2E 3ERSX 4YWMA 3ULJA 4IFDG 2UXBL 5C0XG 3L7ZC 2HT1A 2AKWB 1BBWA 3U50C 5M5YH 1VQGA 4GOPB 1ASZA 3M9BA 1N33L 1KXLA 1NY4A 2ZM6Q 2EIFA 3Q8DA 4KHZA 1I94Q 3G4SA 3LGJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF9 Q;  4DR4 L;  5LMN L;  2V1C C;  5GAG C;  4JI0 Q;  3HOW G;  4JV5 L;  5C4X G;  4GNX A;  5IY0 A;  2I5H A;  3ULP A;  4B3S Q;  4LF4 L;  3STB D;  2JA8 G;  1VQ9 A;  1LTL A;  1N34 Q;  3FHW A;  4DV2 Q;  4X6A H;  5GAD C;  4A3K H;  1XMO L;  1HZA A;  4AIM A;  1E3P A;  5ELO A;  4DR1 L;  2JK8 A;  4MZ9 A;  2AWO A;  3ULL A;  2K14 A;  2C35 B;  2CCZ A;  3HOU H;  2HHH L;  1ASY A;  3DLL A;  3ICE A;  2D62 A;  3NEM A;  5IWA L;  3PUW A;  2RCN A;  3JC6 6;  3M4Q A;  3J7Z C;  4A3M G;  2R6G A;  2N3S A;  5IYB G;  4DR5 Q;  2OWO A;  2BH8 A;  2R92 G;  1EIY B;  2RHQ B;  4GN4 B;  1SE8 A;  5GQO A;  3OTO L;  3I55 A;  3GTP H;  1VS0 A;  1YNX A;  1SLJ A;  3CCV A;  1WOC A;  4L5S A;  3KF8 B;  1TWG H;  4OO1 I;  3F1Z A;  1VQN A;  1KAW A;  4C3I H;  2VQE Q;  1GO3 E;  4NXM Q;  4NPS A;  1PH2 A;  1AE3 A;  1PH8 A;  1S40 A;  1RIP A;  2K75 A;  4YHH L;  2OTL A;  1J5E L;  2Q2I A;  3PO2 H;  5M3M H;  1EQR A;  4DR7 L;  2KHJ A;  1JT8 A;  2ATW A;  3CC7 A;  2PNH A;  3RZD H;  3F8T A;  3W1B A;  4HJ7 A;  4K0K L;  5IP7 G;  1IBK Q;  2F4V L;  3GTM H;  4A3F H;  4B3R Q;  4OO1 G;  4DV4 L;  1HNX L;  4NXN L;  5IYD H;  5IT9 c;  4GKJ Q;  4HJ5 A;  5LMN W;  1JJC B;  4IPH A;  1G29 1;  4DR3 Q;  4DV3 L;  3UDG A;  4A3C H;  4LFA Q;  2NN6 G;  1X3G A;  2JEB I;  4A75 A;  1K3R A;  1N36 Q;  1CSQ A;  2EXD A;  3CAM A;  4DUZ Q;  5C3E G;  2WFW A;  2Q2U A;  3OYY A;  1TXY A;  4IJL A;  4QL5 A;  1GKH A;  4QJF A;  1KIX A;  3J81 i;  1NMG A;  1OXU A;  1SMX A;  4PG3 A;  3PF5 A;  4BXX H;  5HY6 A;  1OXX K;  1R9T H;  3HFZ B;  1WYD A;  4HID A;  4PZ8 A;  1XNR Q;  3CCL A;  3GDE A;  5IP9 H;  3M4P A;  3T1H Q;  4JI4 L;  3B6Y A;  2PMZ E;  4OX9 L;  3KDF B;  2NZH A;  3PIO A;  1C9O A;  1SFO H;  2GN5 A;  1FJG Q;  3S1Q H;  3K0X A;  2ALY B;  3U58 A;  2B63 G;  3M4O H;  1E24 A;  2DGY A;  5M5W H;  1VQA A;  4JI1 Q;  5FLM G;  4BA1 I;  4BBS G;  1VQI A;  1VQP A;  3I4M G;  1YIT A;  2B3G A;  2VL6 A;  2UUA L;  1U5K A;  4LFB L;  4YWL A;  4C3J H;  4C3H H;  3S1R H;  3FKI H;  1W3S A;  3HOY G;  5DLQ E;  2UUC L;  1JE5 A;  1UWV A;  2WAQ G;  4HJA A;  1SN8 A;  1GVP A;  4X65 L;  2IX0 A;  3S2H H;  3CXC A;  4BBR G;  3GTJ H;  5IYC G;  4JI2 L;  4LFC Q;  4KLK A;  4R4T A;  2E8G A;  1S72 A;  4GKK Q;  1QZG A;  3HOV G;  3ZJY C;  1VCI A;  2CKZ B;  1X3F A;  3K8A A;  3RR5 A;  2AHO B;  4JI7 Q;  3S14 H;  2UXC Q;  2VNU D;  4GNX C;  2MO0 A;  3F2B A;  4JYA Q;  3BZC A;  4YCW A;  1J6Q A;  2IHE A;  3KJP A;  4DAY B;  3CME A;  5BR8 Q;  2HIX A;  3ER0 A;  4IOC A;  1N8R C;  4IPG A;  3KDF A;  3I2Z A;  3CCU A;  1YJ9 A;  4X66 Q;  1KRS A;  3NBH B;  2VQF Q;  3K81 C;  4A3J G;  4LF5 L;  1C0A A;  1NMF A;  4R1J A;  4YWK A;  4DNI A;  4AQY L;  3GTG H;  2R7D A;  4A3L G;  1WFQ A;  3NEL A;  4H02 A;  4LF8 L;  1HNW Q;  1K8A C;  4O0A A;  4LUO A;  3GTL H;  3A5U A;  1NBW A;  4A4I A;  1PH9 A;  2Y0S G;  3JAM i;  2F52 A;  1VQO A;  3JAM c;  1Q12 A;  2QGQ A;  2I5L X;  1YIJ A;  1YI2 A;  4XTC S;  4A93 G;  2I0Q A;  3PUZ A;  4DV1 L;  3S15 H;  3S17 H;  3KFU A;  2K52 A;  1IBM L;  4JI5 L;  3W5O A;  3I4O A;  1Y1W G;  3PGZ A;  4UPA A;  4X64 Q;  4A3I G;  1KHI A;  4IPC A;  4HIM A;  4DK3 C;  2A19 A;  1A63 A;  4BY1 G;  1U0L A;  2K50 A;  2KBN A;  1YEZ A;  4R4Q A;  3HOW H;  5C4X H;  4LF6 L;  2DUD A;  4JI3 Q;  4ME3 A;  2JA8 H;  1H95 A;  4L5Q A;  1Q1B A;  3I4N H;  1KC8 C;  3AFP A;  2A8V A;  4KHP L;  3CMA A;  2OCE A;  2XGT A;  2L15 A;  2N78 A;  4P73 A;  1VQ7 A;  1L1O B;  5C44 G;  4R4C A;  3T1Y Q;  4QY7 A;  4DUY Q;  5JJL A;  1I3Q H;  1V43 A;  2HIV A;  3GTK H;  4A3M H;  5AJ3 Q;  1YJN A;  5IE8 A;  1Q86 C;  2JA5 G;  5IYB H;  4JI6 Q;  4GN5 A;  4OWT B;  2KHI A;  3DM3 A;  2A1A A;  3CC2 A;  3KF6 B;  3CC4 A;  1XNQ L;  1HZB A;  2UXD Q;  4POF A;  1Y1V G;  1HR0 Q;  5EAY A;  2AWN A;  2K5V A;  3A5Z B;  3H0G G;  4AYB G;  2PI2 A;  2D0O A;  4GLX A;  1VQ4 A;  1K8G A;  2JA6 G;  3G48 A;  1UE7 A;  2ZJP A;  3S24 A;  1OXS C;  4WJ3 M;  3PO3 G;  1BKB A;  3M85 A;  3U4Z A;  1NJI C;  2JEA I;  2MQH A;  3HKZ E;  2CFM A;  1PH3 A;  2UXB Q;  1G6P A;  3F2C A;  1YBY A;  5JEA J;  1TWC H;  1M90 C;  1N33 Q;  1HJP A;  2KEN A;  1CKM A;  1K83 H;  4DV5 L;  4GOP A;  1PV4 A;  4A3K G;  4DR2 L;  1D7Q A;  3J81 j;  4DR4 Q;  5LMN Q;  1XMQ L;  1PH1 A;  4JV5 Q;  2R93 H;  4IOA A;  1AE2 A;  4YCV A;  3RLN A;  1L1O A;  3J80 c;  3TEH B;  2KCM A;  4LUZ A;  4LF4 Q;  2VUM G;  2IT1 A;  3TQY A;  2WB1 G;  1XMO Q;  1JJG A;  3KOJ A;  4J15 A;  4DR1 Q;  3H15 A;  2ZTE A;  1Q1E A;  2RHS B;  3D0F A;  1C7Y A;  3RN5 A;  2HHH Q;  1MJC A;  1EFW A;  5IWA Q;  3HOX G;  3KF6 A;  5HGQ A;  1X55 A;  1K0R A;  1PH7 A;  1LUZ A;  2ID0 A;  2JJQ A;  3OTO Q;  4YY3 L;  4BY7 G;  3VDY A;  2B63 H;  3PF4 A;  2XTI A;  2JQO A;  1EIF A;  1JB7 A;  1P8L A;  1QUQ B;  4DR6 L;  5FLM H;  1I6H H;  2IY5 B;  3U4V A;  4BBS H;  3PSI A;  1N9W A;  1HNZ L;  3PUV A;  3E0E A;  1YVC A;  1L2F A;  2RF4 A;  1FGU A;  3BU2 A;  2KCT A;  3K80 C;  4YHH Q;  4DPG A;  1J5E Q;  2UUB L;  3GO5 A;  4B3M L;  5H1S E;  3HOY H;  3RZO H;  4DR7 Q;  3K7U C;  2I5M X;  2GVA A;  3CW2 C;  1M1K C;  1SRU A;  3UDX A;  1PFS A;  1D8L A;  2YTY A;  4P75 A;  5M3F G;  5GRO A;  4K0K Q;  2F4V Q;  5IYC H;  4P72 A;  4DV4 Q;  1HNX Q;  4NXN Q;  2Z6K C;  2ZTD A;  3H3V H;  4R4O A;  4UY8 C;  4GLA C;  4DV3 Q;  2LXK A;  4JBK A;  4IJH A;  4MNO A;  4EX5 A;  1VQ6 A;  4PZ6 A;  1V9P A;  5LMU L;  2E2I H;  2VS1 A;  5IP9 G;  5C4J H;  2NVX H;  1IBL L;  1O7I A;  3BJU A;  3FP9 A;  4JC0 A;  4OXP A;  2JE6 I;  1G51 A;  1Q7Y C;  4Y52 H;  4GLV B;  4DV0 L;  1LM0 A;  3L2P A;  4A3J H;  1CKN B;  3UE0 A;  3L0O A;  4X62 L;  3HKS A;  1A0I A;  4RMF A;  2UU9 L;  4B3T Q;  4JI4 Q;  1QUQ A;  1QZH A;  4OX9 Q;  4A3L H;  2E5L L;  3CF5 A;  4DV7 L;  3TRE A;  5JEA G;  4A3D G;  5FJ8 G;  5E7N A;  3KLW A;  1N32 L;  3EIV A;  4DKA C;  3GTO H;  4DV6 L;  3PCO B;  1SR3 A;  2FXQ A;  2MO1 A;  2BA0 A;  2HQL A;  3M7N A;  1A62 A;  1BVS A;  1VQL A;  2UUA Q;  3HOZ H;  1VQJ A;  1BBU A;  3J7A 5;  1HZ9 A;  4LFB Q;  3GD7 A;  2YV5 A;  2B29 A;  3MEF A;  2UUC Q;  4P74 A;  1Q81 C;  2R7Z H;  4A3B G;  3M3Y H;  4GN3 B;  2QA4 A;  2PQA B;  1FVI A;  4X65 Q;  4ALP A;  2ZM6 L;  2JA9 A;  4QGU A;  4HIO A;  1K73 C;  1I94 L;  1Y1W H;  3KJO A;  4JI2 Q;  1OTC A;  4LF9 L;  4GOP C;  4MTN A;  3RLO A;  4JI0 L;  2F3I A;  1IXR A;  4BY1 H;  1VQF A;  4B3S L;  1XPU A;  3RNU A;  1N34 L;  1WCM G;  1YZ6 A;  1VQC A;  4DV2 L;  2CQO A;  1L1O C;  2VW9 A;  4WJ4 A;  2CWP A;  1DGS A;  1MIU A;  4L5T A;  5C44 H;  5K36 G;  3CCM A;  3W1G A;  1CKN A;  3S2D H;  4B3T L;  5C0X I;  4DR5 L;  3S1N H;  4JI8 L;  1I50 H;  2JA5 H;  1VQE A;  3PV0 A;  1UE5 A;  1GM5 A;  3SGI A;  1JJ2 A;  2OQK A;  4YCU A;  4LF5 Q;  1B8A A;  1X54 A;  3PUY A;  4AQY Q;  3CCJ A;  1JMC A;  1YHB A;  2R92 H;  4LF8 Q;  2JA7 G;  3UE1 A;  2Q2H A;  3CCR A;  4A3G G;  2VQE L;  4NXM L;  4O2D A;  1VQK A;  5JJK A;  4HIK A;  1RL2 A;  1QVF A;  3H0G H;  4A3E G;  3CQZ H;  3UDF A;  2MFI A;  3S1M H;  3TS0 A;  3HKZ G;  2PQA A;  1X9N A;  2JA6 H;  1VQH A;  1X3E A;  1CKO A;  3PO3 H;  3CD6 A;  3CCE A;  5GAE C;  4JCV E;  4DV1 Q;  3CCS A;  1EQQ A;  2LXJ A;  4JBW A;  1IBK L;  2NVT H;  4B3R L;  5ELN A;  1IBM Q;  3AQQ A;  5JJI A;  4JI5 Q;  4GKJ L;  1Z47 A;  2R7F A;  3RN2 A;  3I4N G;  5FLX c;  4JBM A;  1GD7 A;  4DR3 L;  1IZ6 A;  1YJW A;  2QEX A;  4LFA L;  1Y14 B;  2OQ0 A;  2YYZ A;  4JOI A;  4QIW E;  5IP7 H;  3G71 A;  1N36 L;  4LF6 Q;  3AEV A;  1K9M C;  2VUM H;  1I5F A;  1Q46 A;  1EYG A;  4DUZ L;  4OWW B;  4LW1 A;  3GTQ H;  4KI0 A;  1EWI A;  3J80 i;  4JI8 Q;  4KHP Q;  2D0P A;  2K4K A;  3HOU G;  2YTX A;  4DAM A;  1B7Y B;  1S3O A;  1PH4 A;  1YHA A;  1UEB A;  4FDB A;  1XNR L;  2YU9 H;  4LNQ A;  5C3E H;  3T1H L;  3HOX H;  1HR0 W;  1NE3 A;  1B70 B;  3STB C;  1FJG L;  2ASB A;  4Y7N H;  3IRB A;  1UE1 A;  3RLF A;  2VZA A;  2LSS A;  2ZJQ A;  1QVG A;  4BY7 H;  1IYJ B;  2ES2 A;  4HJ8 A;  1FL0 A;  2IHF A;  1XNQ Q;  2NN6 I;  3TRZ A;  4JI1 L;  1EUJ A;  3E9I A;  4AYB E;  2GVB A;  4HJ9 A;  1Q82 C;  1HZC A;  1E7Z A;  3I7F A;  4POG A;  3CP0 A;  1NTG A;  4P71 A;  3E9H A;  4AH6 A;  3F2D A;  1E1O A;  1YHQ A;  3PO2 G;  5M3M G;  3CPW A;  3WWV A;  2H5X A;  3I4M H;  2N8N A;  1L0W A;  1EOV A;  2N49 A;  1AH9 A;  4TVA B;  2R93 G;  3BZK A;  4A3F G;  5IYD G;  4LFC L;  1X56 A;  2ZJR A;  5M3F H;  4JBJ A;  2OTJ A;  4IPD A;  4UP8 A;  4DV5 Q;  3PIP A;  2NVY H;  1E22 A;  1XJV A;  2BH2 A;  4OWX B;  4GKK L;  1TWA H;  4DR2 Q;  4A3C G;  4JI7 L;  4QQB X;  2UXC L;  1XMQ Q;  1LYL A;  4BBR H;  3I56 A;  1TWF H;  1KD1 C;  1KL9 A;  1A8V A;  1V1Q A;  4EQ5 A;  2WB1 E;  4JYA L;  3J81 c;  4UP7 A;  4IFD J;  5C0X J;  3UDI A;  4UP9 A;  4IO9 A;  1HH2 P;  5BR8 L;  1E1T A;  1TWH H;  3HOV H;  4BXX G;  3PUX A;  2K5N A;  4OON A;  5GAH C;  1PA6 A;  5M5X H;  3AYH B;  4X66 L;  2VQF L;  4A76 A;  4JG2 A;  1WJJ A;  1PYS B;  3CPF A;  3CCQ A;  1PYB A;  3H3V I;  4YY3 Q;  1PHJ A;  1HNW L;  4GS3 A;  1OXV A;  1XPR A;  4A3D H;  3K7A H;  5FJ8 H;  1SRO A;  2NVQ H;  4DR6 Q;  3TS2 A;  1PH5 A;  1HNZ Q;  3FKI G;  1VQ8 A;  1KQS A;  2EQS A;  2UUB Q;  2MNA A;  1T9H A;  2WP8 J;  4B3M Q;  4DK6 C;  3A0J A;  3A74 A;  4LWC A;  4A3B H;  4TQU S;  2E2J H;  2Z0S A;  3EBE A;  4XIG S;  2IX1 A;  2WAQ E;  4X64 L;  3S16 H;  1CSP A;  1Q8K A;  2AMC B;  1WI5 A;  1PH6 A;  3AFQ A;  4LUV A;  2Q2T A;  4A93 H;  3G6E A;  3NEN A;  5J3B A;  1CUK A;  2YTV A;  2VY3 A;  4JI3 L;  4JOI C;  4A3I H;  1OXT A;  1WCM H;  4LF7 L;  1KRT A;  1VQM A;  1VQD A;  5LMU Q;  4GNX B;  4L5R C;  1UE6 A;  1MKH A;  1VQB A;  1XPO A;  3KYH C;  3T1Y L;  1W2B A;  4C2M H;  4DUY L;  1IBL Q;  2CWA A;  2BA1 A;  4R4I A;  1Z9F A;  5AJ3 L;  1X65 A;  1VQ5 A;  4JI6 L;  4DV0 Q;  4PMW A;  3MXN B;  4LF7 Q;  1QVC A;  1X6O A;  4X62 Q;  4IFD I;  2UU9 Q;  1P16 A;  2UXD L;  2E5L Q;  3OW2 A;  3HOZ G;  4RG1 A;  4DV7 Q;  3EN2 A;  1XTD A;  1IL2 A;  4APV A;  1HR0 L;  2JA7 H;  4BA2 I;  4A3G H;  4NB3 A;  1MJE A;  2R7Z G;  2NZO A;  1N32 Q;  4DV6 Q;  2E2H H;  1PVO A;  4A3E H;  4PZ7 A;  3D31 A;  2K5H A;  2Y0S E;  1Y1V H;  2ZTC A;  2Z6K A;  2PI2 E;  3ERS X;  4YWM A;  3ULJ A;  4IFD G;  2UXB L;  5C0X G;  3L7Z C;  2HT1 A;  2AKW B;  1BBW A;  3U50 C;  5M5Y H;  1VQG A;  4GOP B;  1ASZ A;  3M9B A;  1N33 L;  1KXL A;  1NY4 A;  2ZM6 Q;  2EIF A;  3Q8D A;  4KHZ A;  1I94 Q;  3G4S A;  3LGJ A; 
#chains in the Genus database with same CATH topology
 4JI0 Q;  5C4X G;  2K5Q A;  2JA8 G;  3P75 A;  4LF4 L;  1LTL A;  3FHW A;  4UAI A;  3HOW B;  4AIM A;  1E3P A;  2CCZ A;  2JK8 A;  1S5F D;  4G7Z C;  2HHH L;  3ICE A;  2D62 A;  4IUP A;  3IKJ A;  5IWA L;  3J7Z C;  1RTO A;  3JC6 6;  4A3M G;  3MA2 B;  3MXG A;  2N3S A;  4B3T Q;  2QDL A;  2AUK A;  2RHQ B;  3GTK B;  4ODG A;  4DXF A;  4N8X 1;  4CDF C;  3E3X A;  1VQN A;  4NXM Q;  1GO3 E;  1C4Q A;  2QDB A;  2Q2I A;  1EYA A;  1FGB D;  5ELB A;  1H9R A;  1JOR A;  1LAC A;  4A3F H;  4DV4 L;  2ICE C;  2K32 A;  4HJ5 A;  1TWC B;  5EGT A;  1BCP B;  4DR3 Q;  2L5T A;  2NN6 G;  4RCN A;  2EYJ A;  1K3R A;  1SND A;  2X6L A;  3BVZ A;  1N36 Q;  5A2Q E;  1ML0 D;  1WTP A;  2Q2U A;  1SXT A;  3OHX C;  4QL5 A;  2SNM A;  5G3L F;  1NMG A;  4PG3 A;  4QUC A;  4HED A;  2YU9 B;  1FYC A;  2I46 A;  1MHW C;  3T1H Q;  5IP9 H;  3M4P A;  3B6Y A;  2ZT9 C;  2NZH A;  4NW2 A;  2DJG C;  1LTB D;  1SSO A;  4JI1 Q;  4BA1 I;  2B63 B;  1SNP A;  1VQP A;  3JAM L;  1U5K A;  4YWL A;  4C3J H;  5DLQ E;  1RHP A;  1UWV A;  3V96 A;  1GVP A;  3NTH A;  3HOY B;  3CXC A;  3OW7 A;  3RZO B;  2WAQ B;  1S4Z A;  1MI2 A;  4R4T A;  1MGS A;  4EQP A;  1SJE D;  1VCI A;  2CKZ B;  4GNX C;  3F2B A;  3HOV B;  4YCW A;  4JK1 C;  5IOC A;  3J7A F;  1X3Q A;  5BR8 Q;  2HIX A;  2R61 A;  2KQ3 A;  2WV6 D;  4IPG A;  4KN4 C;  2Q8T A;  1WTH A;  4DNR B;  3CCU A;  1FR3 A;  4E6I A;  4KHV A;  4LF5 L;  4YWK A;  2NBF A;  4A3L G;  3CKI B;  2R7D A;  3NEL A;  4A3J B;  1DD2 A;  1NBW A;  3JAM i;  1U4P A;  2KJX A;  4KKU A;  3JAM c;  4F88 A;  4RKB A;  4XXE A;  4A93 G;  3MXP A;  1S5C D;  4DV1 L;  1SYF A;  1WTV A;  3S15 H;  1IBM L;  3S16 B;  4JI5 L;  3W5O A;  3M3Y B;  3PGZ A;  1RTN A;  5KGU A;  4X64 Q;  4A3I G;  4GZY C;  1LTR D;  4KD3 A;  5LHY 1;  1SE2 A;  4HAE A;  1YEZ A;  2EJM A;  5IT9 L;  5C4X H;  5M9O A;  3DWP A;  4ME3 A;  2JA8 H;  2L11 A;  4BS9 A;  1Q1B A;  2NZ1 D;  1R4Q B;  3MZ5 A;  4KHP L;  3CMA A;  2XGT A;  2DNE A;  4QY7 A;  2HDM A;  2HIV A;  1LT6 D;  1ENF A;  4CDC C;  5C44 B;  5IE8 A;  4A3M H;  1YJN A;  2JA5 G;  4JI6 Q;  4GN5 A;  1SEB D;  2KHI A;  1I50 B;  2RCF A;  3A7A B;  2PZT A;  4AYB G;  3H0G G;  1STB A;  1Y1V B;  4ZAI A;  1VQ4 A;  4FF1 A;  2ZJP A;  4XYO A;  2BDN A;  1OXS C;  3PO3 G;  3HRZ C;  1NJI C;  4L6T B;  2JEA I;  1O7Y A;  1M90 C;  3EVQ A;  1TT2 A;  1KNE A;  1HJP A;  4DV5 L;  5FOB B;  4A3K G;  4DR2 L;  4DR4 Q;  5LMN Q;  2E75 C;  4UDU C;  4JV5 Q;  1TS4 A;  1GUW A;  2NN6 H;  3D8G A;  4X3U A;  3RLN A;  4WFN 3;  1D5Z C;  2KCM A;  1CTM A;  5A35 A;  2WB1 G;  1JJG A;  2AQ3 B;  5ELF A;  1I4H A;  3GTQ B;  3D0F A;  1C7Y A;  2VB2 X;  2WIN B;  1MJC A;  4ZQ3 A;  1D5X C;  2D2C C;  3KF6 A;  2A6H C;  2JN4 A;  2JJQ A;  3OTO Q;  3FRP B;  5FO9 B;  1ENA A;  4Y7N B;  1C48 A;  1JB7 A;  3VR4 A;  1QUQ B;  2NTS A;  2IX3 A;  1N9W A;  1H9M A;  1R4P B;  3BU2 A;  3NBI A;  2LFN A;  3GO5 A;  1PZJ D;  5H1S E;  3K7U C;  2IJ0 A;  1SRU A;  3UDX A;  1BCP F;  1SNO A;  1D8L A;  5M3F G;  4IUN A;  4K0K Q;  1ESF A;  4P72 A;  4NXN Q;  5KND A;  4R4O A;  4KN7 C;  3H3V C;  1PFM A;  4JBK A;  1MD2 D;  2LXK A;  4C56 C;  1QWY A;  4EX5 A;  1VQ6 A;  3D4R A;  1KNA A;  4JPB W;  5LMU L;  2A6E D;  3ZYY X;  1IBL L;  1D5M C;  4OXP A;  3VYT A;  4ULL A;  1G51 A;  4GLV B;  5M5X B;  3L2P A;  4FXG C;  4A3L H;  3OWF A;  2E5L L;  4RHR A;  4HR7 B;  4DV7 L;  3TRE A;  4C3H G;  3KLW A;  1A2U A;  1CA6 A;  4DKA C;  5D3I B;  3PCO B;  1SR3 A;  3OIP A;  4L63 B;  1VQL A;  2UUA Q;  4LFB Q;  2NVQ B;  3MEF A;  4L8J A;  5C6A A;  2F3W A;  1PRT D;  3SR1 A;  2O5J C;  2R7Z H;  1A3U A;  3C1E A;  2KEC A;  3T51 B;  2ZM6 L;  4QGU A;  4A3B B;  4GOP C;  3RLO A;  2F0H A;  1VQF A;  4CDE C;  3RNU A;  4F87 A;  1M4V A;  4ZUI A;  1CM9 A;  4QUF A;  5I4D A;  1MIU A;  4L5T A;  3M4Y A;  3Q24 A;  2BOS A;  2D9U A;  4Q5V A;  1A3V A;  3S1N H;  5I2X A;  2B2U C;  2JA5 H;  1VQE A;  1GM5 A;  3SGI A;  1JJ2 A;  2OQK A;  4YCU A;  5DAU A;  2R92 H;  3L3O C;  3UE1 A;  3CCR A;  2MUY A;  1HQM C;  3OIQ A;  3H0G H;  2JA7 B;  3TS0 A;  4N9T A;  1X3E A;  2MP1 A;  1B3A A;  3PO3 H;  1K8M A;  3CHB D;  1PDQ A;  5ELN A;  3AQQ A;  1BO0 A;  4QCL A;  4BWG B;  1GD7 A;  1S5B D;  4DF7 A;  1S5E D;  1Z7T A;  1Y14 B;  2OQ0 A;  1QOH A;  1VF5 C;  1K9M C;  1EYG A;  4DUZ L;  4KI0 A;  4FNF A;  2EYH A;  2K4K A;  4FP5 D;  1PH4 A;  3HOU G;  4DU9 A;  4K2L A;  5C3E H;  1VMP A;  2E76 C;  1UE1 A;  3Q22 A;  2VZA A;  2CH4 W;  1IYJ B;  1CHP D;  3E9I A;  1Q82 C;  2GVB A;  1DM0 B;  1HZC A;  4KY7 A;  1XYI A;  2O2L D;  1TWG B;  3BDO A;  1EFI D;  3KBX A;  4C3I B;  3E9H A;  5CBE E;  1YHQ A;  1TS2 A;  5M3M G;  3QJY A;  3I4M H;  1SBB B;  4FVM A;  3PO2 B;  2F0W A;  5IYD G;  5M3F H;  4KV6 A;  2NVY H;  1XJV A;  4GKK L;  2BH2 A;  3FMC A;  2UXC L;  1XMQ Q;  4F7X A;  1LYL A;  4BBR H;  2EYF A;  3IFD A;  3K5M A;  1LTT D;  2E74 C;  1V1Q A;  4EQ5 A;  4JYA L;  3DXJ C;  3VR2 A;  1JC7 A;  1TWH H;  4BXX G;  3PUX A;  1YNN C;  3DEP A;  2F0F A;  2EYP A;  1H9K A;  3T16 A;  2VQF L;  3C46 A;  1PYS B;  5I2Y A;  1JWU D;  3TBI B;  1MSG A;  4GS3 A;  3K7A H;  5IGF A;  4DR6 Q;  3TP8 A;  4PV1 C;  3WOF A;  3FKI G;  4V0B A;  3SK8 A;  5BN4 A;  2UUB Q;  4B3M Q;  3NWT A;  4DK6 C;  4LWC A;  1H9S A;  4DNT B;  2BDO A;  4XIG S;  4XQQ A;  5DM6 3;  2Q2T A;  5EPK A;  2SEB D;  4RWS C;  3VYU A;  4UHV A;  1EOT A;  4JI3 L;  4JOI C;  4LAA A;  4OIJ A;  4L5R C;  3S9W A;  2EE1 A;  5T1G A;  3A8K E;  4C2M H;  3FVQ A;  4WOR A;  1VQ5 A;  1NCV A;  1GUN A;  3W3A A;  3MXN B;  2UU9 Q;  1P16 A;  1UUP A;  3GTG B;  3EN2 A;  5COR A;  4APV A;  1HR0 L;  4NB3 A;  2H1E A;  3SK5 A;  3D31 A;  2K5H A;  2Y0S E;  2R7Z B;  4FXD A;  1ZEQ X;  3U50 C;  5M5Y H;  1E2Z A;  2B2T C;  2EIF A;  1I94 Q;  2OXP A;  3LGJ A;  4LF9 Q;  5GAG C;  4GNX A;  3ULP A;  2I5H A;  4B3S Q;  3STB D;  1ZXT A;  4DV2 Q;  5GAD C;  1HZA A;  4DR1 L;  4ZUJ A;  2F3V A;  3HOU H;  3J81 L;  3S1N B;  5D14 A;  3NEM A;  3PUW A;  2RCN A;  3KLS A;  3BVG A;  2L1B A;  1GHJ A;  2Z8L A;  4GN4 B;  1SE8 A;  3NTI A;  3GTP H;  1K0S A;  3SDZ A;  2R92 B;  1VS0 A;  1YNX A;  1SLJ A;  4L5S A;  3KF8 B;  3F1Z A;  5C5L A;  1KAW A;  3R8B A;  4MHE A;  4NPS A;  1PH2 A;  1PH8 A;  1RIP A;  4P2C B;  1J5E L;  5M3M H;  4DR7 L;  2ATW A;  2TMP A;  3RZD H;  3F8T A;  5EKK A;  4RKL A;  5IP7 G;  4ZLT F;  1E0B A;  1IBK Q;  2F4V L;  3VR3 A;  5IYD H;  4X3S A;  4GKJ Q;  4DGZ A;  1JJC B;  2L4N A;  1CHQ D;  3UDG A;  1PTO B;  3PMF A;  2VXW A;  3KBG A;  3CAM A;  5LL6 S;  3OYY A;  4QJF A;  3J81 i;  5I6W A;  4BXX H;  2KA7 A;  5C3E B;  1R9T H;  3NSW A;  4PZ8 A;  5J22 A;  1XNR Q;  1Y8O B;  1F2M A;  3VR5 A;  2E2D C;  1GXD C;  4ABN A;  3A55 A;  4JI4 L;  2GN5 A;  2ALY B;  1DZ1 A;  3HGB A;  5M5W H;  1I6V C;  5C3W A;  1X3P A;  3FKI H;  4BBS B;  1H9J A;  3I4M B;  1JE5 A;  4HJA A;  4OHJ A;  2F4I A;  3VR6 A;  4X65 L;  1SYG A;  3U9S A;  4JVZ A;  3GTJ H;  4FF2 A;  1LV9 A;  4JI2 L;  2E8G A;  3HEJ A;  1QZG A;  4BBR B;  3ZJY C;  4JI7 Q;  3K8A A;  1X3F A;  3RR5 A;  3S14 H;  2VNU D;  2MO0 A;  1TWH B;  5ELE A;  2A69 D;  3KJP A;  3VA7 A;  1MSH A;  1IHZ A;  4XQJ A;  2E2I B;  5IGG A;  2XRS D;  2DJF C;  3RMH A;  5C4J B;  1YJ9 A;  4X66 Q;  3NBH B;  3K81 C;  3ITP A;  3I90 A;  1C0A A;  3TME A;  4R1J A;  1G6Z A;  1WFQ A;  3I3C A;  3K7A B;  1SMY C;  4LF8 L;  1HNW Q;  1WTR A;  4WJW A;  2Y0S G;  3ONA B;  1JWM D;  2F52 A;  1Q12 A;  1CQV A;  2I5L X;  2KCN A;  1RDP D;  1YIJ A;  3PUZ A;  3DHQ A;  2K52 A;  1SE4 A;  3A8J E;  1HRJ A;  4UPA A;  4FXK C;  4HIM A;  3OPO A;  4DK3 C;  2A19 A;  4BY1 G;  1U0L A;  3SVM A;  1Y1W B;  2HDL A;  3I72 A;  2DUD A;  1A3T A;  2RDF A;  2ZXP A;  4IUR A;  1GHK A;  4CHT B;  1KC8 C;  2N78 A;  1L1O B;  2QKI C;  4IQZ A;  5JJL A;  1I3Q H;  1V43 A;  2KOL A;  1LAB A;  3S2D B;  3NUC A;  5A2Q L;  1ROD A;  2AQ2 B;  3CC4 A;  3H94 A;  1XNQ L;  1HZB A;  5JVG 3;  2A68 C;  1EIG A;  2AWN A;  3A5Z B;  2PI2 A;  1WVL A;  4N9P A;  1LT4 D;  1UE7 A;  4HSP A;  3SK6 A;  2F0D A;  2JA6 B;  2MQH A;  3HKZ E;  2UXB Q;  1PH3 A;  1G6P A;  2EY1 A;  3J80 E;  4GOP A;  1CKM A;  3DWA A;  1PV4 A;  1PTO C;  4CJ2 C;  1PH1 A;  3I4L A;  2R93 H;  2PZW A;  1GJX A;  4YCV A;  2VUM G;  3J80 c;  4LF4 Q;  4LUZ A;  4RCO A;  1B3Q A;  4PNY A;  2Q8I B;  2PO4 A;  3KOJ A;  5CBA E;  5I9O A;  3H15 A;  4HTH A;  2HHH Q;  3I8Z A;  2B2U A;  5IWA Q;  3HOX G;  3GTP B;  1PH7 A;  1LUZ A;  5IIF A;  3D3R A;  2ID0 A;  2PMZ B;  2G9D A;  1TQO A;  3NHH A;  1EY9 A;  1L0Y B;  1QNU A;  3PF4 A;  3X3M A;  2XTI A;  2JQO A;  1D1I A;  5FO8 B;  4BY7 B;  2Z9H A;  1YNJ C;  1HNZ L;  3MAQ A;  3PUV A;  5M3M B;  2F0P A;  5IGD A;  1L2F A;  4XDX A;  2KCT A;  3BDC A;  1JIC A;  3RZD B;  3FEW X;  2RVL A;  1TII D;  1PTO F;  2DY7 A;  5EPL A;  4DV4 Q;  4XT1 B;  2EYL A;  1AP0 A;  2ZTD A;  1ENC A;  1BBX C;  1T5X D;  4IJH A;  1AZQ A;  1V9P A;  5KRU A;  2VS1 A;  4M8A A;  1T5E A;  3NPP A;  1CI3 M;  1LTG D;  3G7L A;  2A5H A;  3NQI A;  5CV4 A;  3BJU A;  4K5V A;  3U9O A;  2JE6 I;  1Q7Y C;  4DV0 L;  3L0O A;  5TSS A;  1QUQ A;  1QZH A;  3CF5 A;  4A3D G;  3NP8 A;  3CRK C;  3FDT A;  2BCO A;  4MIU A;  2FFK B;  3GTO H;  1TY2 A;  1ZYR D;  2FXQ A;  2MO1 A;  2HQL A;  3X3N A;  3O13 A;  1A62 A;  1IW7 D;  1BVS A;  3M7N A;  3HOZ H;  1HZ9 A;  4OGQ C;  2B29 A;  4P74 A;  3NXW A;  3R2I A;  1MBY A;  1K73 C;  1OTC A;  4MTN A;  1PLF A;  2F3I A;  5IOD A;  1IXR A;  4BY1 H;  2B2Y C;  2B8F A;  5K5P A;  2RQX A;  1I4G A;  1IL8 A;  1N34 L;  1WCM G;  1CZW A;  1YZ6 A;  2TSS A;  1L1O C;  3D6C A;  1DGS A;  5K36 G;  4C1N K;  3F2U A;  3QOJ A;  5KIX A;  4DR5 L;  2M00 A;  4RH6 A;  2IW3 A;  5JAV A;  4LF5 Q;  5CC4 A;  3CCJ A;  1B2T A;  1YHB A;  1ONL A;  4V19 0;  4A3G G;  2VQE L;  4O2D A;  4HIK A;  1QVF A;  1U4M A;  3CQZ H;  3UDF A;  3S1M H;  3HKZ G;  3CRL C;  4K2K A;  1NSN S;  2E2H B;  5FLX E;  4A3E B;  1CKO A;  2B2V C;  3CD6 A;  4DV1 Q;  2LXJ A;  2NVT H;  4B3R L;  1IBM Q;  2N55 A;  4JI5 Q;  2VB3 X;  2R7F A;  1PRT B;  3I4N G;  5FLX c;  4JBM A;  2EDG A;  3GV6 A;  1YJW A;  4LFA L;  3G71 A;  4I7Z C;  4JOI A;  2A6H D;  3AEV A;  2VUM H;  1Q46 A;  1BCP C;  1I4R A;  1EWI A;  4KHP Q;  3K5N A;  1I3Q B;  1S3O A;  4CDD C;  1ICF B;  1YHA A;  1DXM A;  4LNQ A;  3HOX H;  3TZU A;  3FPU B;  1FJG L;  1C8C A;  3RLF A;  2ES2 A;  3TRZ A;  4HJ8 A;  1FL0 A;  2IHF A;  2NN6 I;  2HCI A;  4KJO A;  4FF3 A;  1NTG A;  4J1M A;  3C3L A;  1SNQ A;  1EIH A;  4CBV A;  3WWV A;  3T13 A;  2H5X A;  5JPM C;  2N8N A;  1EOV A;  2N49 A;  3EA6 A;  2B2T A;  3BZK A;  4KTA A;  5JOB A;  2ZJR A;  4LFC L;  1X56 A;  4JBJ A;  4IPD A;  4DV5 Q;  3K6O A;  1E22 A;  4OWX B;  1CZG A;  4A3F B;  2R93 B;  1TWA H;  2H4O A;  2KEE A;  4QB4 A;  2Q8R E;  4DR2 Q;  4A3C G;  2X69 A;  1TWF H;  3QG1 A;  5DM7 3;  1EY7 A;  1KL9 A;  1A8V A;  2IPK D;  4CKC A;  2IWH A;  5C0X J;  3UDI A;  1HQR D;  2BE5 C;  1SYB A;  2K5N A;  2F0U A;  4EQO A;  3GQB A;  4JG2 A;  3CPF A;  5F2D A;  1DJR D;  1PYB A;  1LTA D;  3LNN A;  4A3D H;  4IUU A;  4LK1 C;  1JR0 D;  2K5W A;  3K58 A;  3D4W A;  5J1Z A;  1CK1 A;  1Q8I A;  3K5O A;  1VQ8 A;  1KQS A;  3C1F A;  2EQS A;  5C4H A;  2WP8 J;  3MTS A;  4C3J B;  1CA5 A;  2EVB A;  2E2J H;  3A8I E;  3M7G A;  4CKE A;  2WAQ E;  3T4A C;  1Q8K A;  2AMC B;  1WI5 A;  4A93 H;  2EYM A;  4OEM B;  4CGY B;  1CUK A;  2YTV A;  2VY3 A;  4FYD A;  1B9N A;  1D2B A;  4A3I H;  1WCM H;  4MN3 A;  5ELD A;  2SDF A;  1VQD A;  2L55 A;  5LMU Q;  1UE6 A;  1VQB A;  4J6H A;  3KYH C;  3T1Y L;  4DUY L;  2B39 A;  2OF1 A;  2CWA A;  1IBL Q;  5K36 H;  2LY7 A;  5AJ3 L;  4I65 A;  2A6E C;  4PMW A;  4IFD I;  1K28 A;  2D5D A;  2UXD L;  2E5L Q;  4TSS A;  4DV7 Q;  1B50 A;  1XTD A;  3EJI A;  4A3G H;  3C2P A;  4ILW A;  1O80 A;  3HOZ B;  4CJ0 B;  1STE A;  4R9W A;  4PZ7 A;  1UNS A;  2ZTC A;  3A54 A;  2Z6K A;  2PI2 E;  3ERS X;  4G57 A;  5C0X G;  3L7Z C;  2AKW B;  1N33 L;  1VQG A;  3V2T A;  3PIP 3;  1HHV A;  1KXL A;  2ZM6 Q;  3S15 B;  2GA4 B;  3K0Y A;  4XYQ A;  1AFP A;  2I07 B;  3HOW G;  1CQF A;  5IY0 A;  4QIW B;  1K3B C;  1WTX A;  2JXM B;  2PQE A;  5C4X B;  4A3K H;  1XMO L;  5ELO A;  2JA8 B;  1EY6 A;  3ULL A;  4MZ9 A;  4NMZ A;  2K14 A;  2C35 B;  2G9H D;  3A56 A;  3DLL A;  1ASY A;  3MXN A;  3K57 A;  2XRQ D;  1K8O A;  2R6G A;  5IYB G;  2BH8 A;  2MHV A;  1BDO A;  4A3M B;  2PPB C;  1WOC A;  4G7H C;  4OO1 I;  2A74 C;  1AE3 A;  2C5C A;  1S40 A;  3VYR A;  3LWU A;  4YHH L;  1IKL A;  1DOM A;  1PFB A;  1JT8 A;  1PRT F;  2KHJ A;  1LTI D;  2PNH A;  3W1B A;  4HJ7 A;  2XN9 C;  5CR3 A;  3GTM H;  1JE4 A;  1HNX L;  5ELC A;  5LMN W;  4DV3 L;  4A3C H;  1X3G A;  2JEB I;  4A75 A;  4EVO A;  4RA8 A;  2EXD A;  4DUZ Q;  2WFW A;  4H7B A;  4IJL A;  1SMX A;  3PF5 A;  2RA4 A;  5EQ0 A;  1AN8 A;  2K6A A;  1SDF A;  1SYC A;  4HID A;  3CCL A;  4OX9 L;  3KF8 A;  1Y8N B;  3KDF B;  1SFO H;  3S1Q H;  4J8Q A;  2B63 G;  3OMG A;  1E24 A;  3M4O H;  2LS0 1;  1VQA A;  5FLM G;  3MEH A;  2QF7 A;  1VQI A;  1BQQ T;  2F0L A;  2B3G A;  4H0L C;  4ME5 A;  2K04 A;  4C3H H;  5DNF A;  1W3S A;  3HOY G;  2UUC L;  2WAQ G;  5KYI A;  2F0V A;  1ET6 A;  3S2H H;  1WD1 A;  2PNR C;  1HA6 A;  4WRD A;  4KLK A;  5IGC A;  2J4X A;  1S72 A;  4GKK Q;  4RGT A;  2HD3 A;  3HOV G;  1HPC A;  2UXC Q;  2RSN A;  2HUG A;  2FHT A;  1FD7 D;  4JYA Q;  3BZC A;  2IHE A;  1EL0 A;  3H6M A;  1B9M A;  5E1F A;  4DAY B;  3CME A;  4O42 A;  4QMG A;  4IOC A;  3DEO A;  2Z6B A;  2VQF Q;  4A3J G;  2M2L A;  1NMF A;  4AQY L;  4DNI A;  1BUV T;  3BVM A;  1U9R A;  2HCC A;  1UEA B;  1K8A C;  4O0A A;  3DWQ A;  3HS0 C;  1STA A;  3A5U A;  3GTL H;  4RFB A;  5E4X A;  3HG9 A;  1PH9 A;  1VQO A;  1KLU D;  1ILP A;  4NP5 A;  3K59 A;  4XTC S;  4PMB A;  2E2J B;  2I0Q A;  3S17 H;  4OIK A;  4RGO S;  5C0X H;  1KDB A;  3P7J A;  4A93 B;  5I6Y A;  3SE0 A;  2K50 A;  5DEH A;  1NNX A;  3HOW H;  4A3I B;  5E4W C;  4LF6 L;  1EYC A;  1H95 A;  4JI3 Q;  2F03 A;  3WOE A;  4PQX A;  2NTT A;  2OCE A;  2L15 A;  1EZ6 A;  1VQ7 A;  5C44 G;  3NBH A;  4R4C A;  3QB3 A;  3VA5 A;  1F9S A;  3GTK H;  1Q86 C;  4HMI A;  1Z6H A;  3PIO 3;  5IYB H;  1W6J A;  2F0J A;  3BS1 A;  1KAB A;  4K5X A;  4OWT B;  3DM3 A;  5CMD A;  3CC2 A;  2JA5 B;  1DCZ A;  1B53 A;  1BXT A;  3I73 A;  5EKI A;  1Y1V G;  1HR0 Q;  5CYU A;  2D0O A;  3KLR A;  1A6X A;  4AYB B;  3H0G B;  3S24 A;  4WJ3 M;  1BKB A;  2CFM A;  3ND9 A;  3J7A V;  3F2C A;  1TWC H;  5CV8 A;  3PO3 B;  4XQN A;  2G5D A;  2KEN A;  1B44 D;  2B2Y A;  3J81 j;  3TP6 A;  4CKB A;  3PQI A;  1X32 A;  4IOA A;  3VYS A;  1AE2 A;  1L1O A;  4A3K B;  3TEH B;  4K8I A;  1J8I A;  1V1P B;  1XTC D;  4DA2 A;  2MPM A;  4KMU C;  4DR1 Q;  2ICI A;  2ZTE A;  1Q1E A;  4LMQ D;  2ZXO A;  3RN5 A;  2WB1 B;  1EFW A;  1EU3 A;  3MWY W;  2FMM A;  1K0R A;  2K33 A;  4DFA A;  1SAP A;  1ICW A;  1B1Z A;  2CH4 A;  2CW0 C;  3KUP A;  4YY3 L;  2B63 H;  1EIF A;  5FLM H;  2IY5 B;  3U4V A;  1JOO A;  1O78 A;  3PSI A;  3E0E A;  1D6E C;  3OWE B;  1GUT A;  3K80 C;  2B2V A;  3QWN A;  1J5E Q;  3HOY H;  3K5L A;  3RZO H;  4DR7 Q;  2C9O A;  2GVA A;  2N88 A;  3DM1 A;  4MTK A;  2QIL A;  1M1K C;  3RUZ A;  1A2T A;  1PFS A;  3AU7 A;  4P75 A;  2F4V Q;  2Z6K C;  3H3V H;  5M3F B;  4GLA C;  2NVY B;  3RD4 A;  3OMC A;  4MNO A;  4PZ6 A;  4IAL A;  5IP9 G;  4EGV A;  4RHS A;  1PXU A;  2KUM A;  3FP9 A;  4PMC A;  5T1I A;  2NWG A;  1AEX A;  4Y52 H;  1LM0 A;  1SFO B;  4A3J H;  1CKN B;  4LF7 L;  4X62 L;  3HKS A;  1A0I A;  4RMF A;  1D1K A;  4JI4 Q;  3QO2 A;  5FJ8 G;  5E7N A;  3LWE A;  5COY A;  3EIV A;  1Q90 A;  4ZYS A;  1N32 L;  4DV6 L;  4C3H B;  2BA0 A;  3KLS X;  3J7A 5;  1UAP A;  2O5I C;  1Q81 C;  3TP7 A;  2NB0 A;  4A3B G;  3M3Y H;  3S2H B;  1KDA A;  2PQA B;  1FVI A;  3R3O A;  4X65 Q;  4X3T A;  1EEF D;  2JA9 A;  1VMC A;  2XSC A;  5D65 A;  4X3K A;  3KJO A;  4JI2 Q;  3BYY B;  1CFM A;  1PZK D;  3LX0 A;  4JI0 L;  2F0E A;  1HTL D;  1O7L A;  3V05 A;  3EFX D;  1JCK B;  3P20 A;  1VQC A;  2CQO A;  3NTK A;  2VW9 A;  4C1N I;  4WJ4 A;  4HMJ A;  1KDC A;  2CWP A;  3J80 L;  2A68 D;  5G3L D;  1JWS D;  2WII B;  1FNV A;  5C44 H;  4B3T L;  2A69 C;  1I50 H;  4C2M B;  3MHB A;  3PV0 A;  1UE5 A;  2F0K A;  3H09 A;  1RJT A;  1X54 A;  3GTL B;  1JMC A;  1F2Z A;  1HFN A;  4LF8 Q;  2JA7 G;  2Q2H A;  4NXM L;  4DK1 A;  2K1B A;  1V8Q A;  5JJK A;  1RL2 A;  3Q6S A;  4YIJ A;  4RGM A;  5KEE A;  5C5M A;  1XX8 A;  1VQH A;  3T56 B;  1ILQ A;  4U68 A;  5C3X A;  5GAE C;  4JCV E;  4X6A H;  3CCS A;  5IGE A;  4JBW A;  3TN2 A;  4FO2 A;  2CHB D;  1AZP A;  3CU7 A;  4K6D A;  5M5Y B;  3MFY A;  4DR3 L;  2QEX A;  2YYZ A;  4K6L A;  5IP7 H;  1W6K A;  4K8J A;  1N36 L;  3QIA A;  4OWW B;  3GTQ H;  4S3S A;  2QW7 A;  1EQV A;  1LTS D;  1BR9 A;  3J80 i;  2D0P A;  4DAM A;  3SHL A;  1UEB A;  4FDB A;  1WD0 A;  1YNJ D;  2FIN B;  2SOB A;  3DMU A;  3HOU B;  1HR0 W;  3T1H L;  1XWE A;  5BN3 A;  1BNZ A;  1B70 B;  4Y7N H;  3IRB A;  4DK0 A;  2LSS A;  1QVG A;  1G91 A;  1XNQ Q;  3EQL C;  4JI1 L;  4C3I G;  4AYB E;  4HJ9 A;  1E7Z A;  3HZX A;  3SEB A;  4POG A;  4IZ8 A;  3F2D A;  4AH6 A;  1E1O A;  3PO2 G;  4FF4 A;  3CPW A;  2Z4H A;  4RGN A;  1U4L A;  1AH9 A;  1IYV A;  4TVA B;  4K14 A;  1Y69 U;  2OTJ A;  4UP8 A;  1JOQ A;  3PIP A;  2OEO A;  2L12 A;  4B9W A;  2RBM A;  3I56 A;  2WB1 E;  4UP7 A;  4IFD J;  4IO9 A;  5BR8 L;  1E1T A;  1HFG A;  4OON A;  1GUG A;  5GAH C;  1PA6 A;  5M5X H;  4K5W A;  1NR2 A;  1TY0 A;  4F8M A;  2LKV A;  2F0M A;  1WJJ A;  1R9T B;  5E3F A;  1PHJ A;  1XPR A;  1F9Q A;  5FJ8 H;  1PZI D;  3BDL A;  2NVQ H;  1F9R A;  1KLG D;  5HGT A;  3TS2 A;  3J7Y W;  5M5W B;  1HNZ Q;  2F0I A;  3W2D A;  3UI2 A;  4G7O C;  1HUM A;  3QR8 A;  2MNA A;  2RKS A;  3FKI B;  4ZK9 B;  4A3B H;  3A74 A;  2EY5 A;  4H13 C;  2CQA A;  2Z0S A;  4X64 L;  2WKC A;  3GTJ B;  3G6E A;  3T53 B;  4Z9C B;  5FLX L;  2K5D A;  1OXT A;  3QOL A;  1KRT A;  3S14 B;  2V4D A;  5C4Z A;  1I4P A;  4KY5 A;  4NKL A;  2BA1 A;  4LJZ C;  1Z9F A;  1X65 A;  3JAM E;  4JI6 L;  4DV0 Q;  2DN8 A;  1QVC A;  1X6O A;  5FKA C;  3ERQ A;  2JP1 A;  3OW2 A;  4RG1 A;  2JA7 H;  4BA2 I;  2F0T A;  1EU4 A;  1MJE A;  2R7Z G;  2NZO A;  2B2W A;  2EJF C;  1WTQ A;  1QB5 D;  3NK9 A;  2F0S A;  2K03 A;  1PVO A;  1VF7 A;  3E5S A;  1L0X B;  1WTW A;  1ZYR C;  4YWM A;  4ZCK A;  1IW7 C;  4IFD G;  1QJO A;  1BCP D;  2HT1 A;  5EKL A;  4GOP B;  1ASZ A;  5I9P A;  1DOL A;  3Q8D A;  1EY8 A;  2WAC A;  1KAA A;  4DR4 L;  5LMN L;  2V1C C;  4JV5 L;  1F2Y A;  1VQ9 A;  5KYL A;  1N34 Q;  4B9X A;  1JQY D;  2XVS A;  3TP5 A;  2AWO A;  5HUR A;  3ND8 A;  1I4X A;  3M4Q A;  2OWO A;  2R92 G;  4DR5 Q;  4ZRZ A;  2J7Z A;  1EIY B;  3I55 A;  5GQO A;  5CGK A;  3OTO L;  1TS5 A;  1SNC A;  3CCV A;  1TWG H;  3BYT B;  1F9P A;  4C3I H;  2VQE Q;  2K75 A;  2OTL A;  4DN4 M;  3PO2 H;  5IT9 E;  1EQR A;  3CC7 A;  2WKD A;  2L9H A;  4K0K L;  4OO1 G;  4B3R Q;  1A15 A;  2BE5 D;  3OOC A;  4NXN L;  2K05 A;  5IT9 c;  4U67 3;  4KKT A;  4IPH A;  1G29 1;  1PYW D;  4LFA Q;  4DAV A;  2K01 A;  1CSQ A;  3R93 A;  1ZKO A;  3BZD B;  5C3E G;  1TXY A;  1KIX A;  4HSV A;  1GKH A;  1OXU A;  5HY6 A;  1OXX K;  3HFZ B;  1WYD A;  1STG A;  4M1U B;  3GDE A;  4O1N A;  2PMZ E;  1FJG Q;  1II3 A;  3PIO A;  1C9O A;  3K0X A;  1EZ8 A;  3U58 A;  1F2L A;  2P5Z X;  1I4Q A;  2DGY A;  4BBS G;  3I4M G;  1YIT A;  2VL6 A;  2UUA L;  1QE6 A;  4LFB L;  2KED A;  2F0G A;  3S1R H;  3N52 A;  3I70 A;  2EOT A;  1SN8 A;  4OL7 A;  4HN7 A;  2IX0 A;  5IGB A;  4BBR G;  3AMU A;  1DYQ A;  5IYC G;  2L0C A;  4LFC Q;  3GP7 A;  1JOK A;  5EJW A;  5D3D A;  2AHO B;  2EZV A;  3Q0A A;  2EY2 A;  2FJ2 A;  1NUC A;  3SK4 A;  2X6G A;  2EXZ A;  4XT3 B;  1J6Q A;  3ER0 A;  1N8R C;  1VDZ A;  3KDF A;  3I2Z A;  1ESR A;  1KRS A;  1SYE A;  4Q0F A;  3GTG H;  4H02 A;  4LUO A;  2MGS A;  4A4I A;  2A73 B;  5L37 A;  4IUV A;  1EY0 A;  4ID6 A;  1SYD A;  3GTO B;  1U4R A;  2QGQ A;  1XXG A;  2Y0S B;  4IUT A;  4HCE A;  1YI2 A;  4IFD H;  3KFU A;  3DUZ A;  3I4O A;  1Y1W G;  3A7L A;  1KHI A;  4IPC A;  2KBN A;  1E2W A;  4R4Q A;  1PRT C;  4DAY A;  3KK7 A;  4L5Q A;  4KD4 A;  4BY1 B;  5CV6 A;  3I4N H;  1G2S A;  3AFP A;  2A8V A;  2EYO A;  3MFG A;  4P73 A;  4B08 A;  5EBD A;  3L9A X;  1GOZ A;  2ENB A;  3T1Y Q;  4DUY Q;  2XWJ B;  2B8G A;  5AJ3 Q;  2F0N A;  2A1A A;  4I7A A;  3KF6 B;  1TS3 A;  2UXD Q;  4POF A;  5EAY A;  1KTK A;  2K5V A;  2EY6 A;  4GLX A;  1K8G A;  4IUQ A;  2JA6 G;  3G48 A;  3CQZ B;  3S1M B;  3M85 A;  3U4Z A;  1IYU A;  1YBY A;  5JEA J;  1EYD A;  1N33 Q;  4OO1 H;  1K83 H;  1PTO H;  3H91 A;  3R2T A;  2NVT B;  1GUO A;  5AFW A;  1D7Q A;  1XMQ L;  5JVH 3;  3AB9 A;  1YNN D;  5ISR A;  2IT1 A;  3TQY A;  1O7Z A;  1XMO Q;  2XIW A;  2VUM B;  4J15 A;  2RHS B;  3IL8 A;  2NYZ D;  2DY8 A;  2KCC A;  5HGQ A;  1ET9 A;  1X55 A;  1G8Z D;  4R8N A;  1Y8P B;  4N8F A;  1PFN A;  1QNK A;  2O4X A;  3HOX B;  4BY7 G;  3VDY A;  1RCV D;  4KJN A;  1QIL A;  3P1H A;  5CV7 A;  1P8L A;  4DR6 L;  1I6H H;  5BN5 A;  4BBS H;  2EJG C;  2PW5 A;  3TSS A;  1YVC A;  1DOK A;  1RKN A;  1Q3L A;  1FGU A;  2RF4 A;  4YHH Q;  2UUB L;  4DPG A;  4B3M L;  2I5M X;  3CW2 C;  2B2W C;  2YTY A;  1SNM A;  2JYO A;  1E2V A;  2PZU A;  1B4O A;  5GRO A;  2QCP X;  5IYC H;  1HNX Q;  1G2T A;  2F0Q A;  1V1P A;  2KVM A;  4UY8 C;  4DV3 Q;  1TWA B;  4HCS A;  1TU2 B;  2E2I H;  4RAU C;  1TWF B;  5C4J H;  2NVX H;  2MJ8 A;  1M8A A;  1O7I A;  4JC0 A;  3IAY A;  4DXG A;  3OSO A;  1HXY D;  3UE0 A;  4OX9 Q;  5EPJ A;  2UU9 L;  1RF2 D;  5JEA G;  4TKO B;  1S5D D;  2Z1C A;  1HUN A;  3D6W A;  3G6J B;  4KY6 A;  4A3D B;  3S1R B;  1BOS A;  1QCB D;  1VQJ A;  1BBU A;  4R8I A;  3GD7 A;  1LT3 D;  2YV5 A;  3I91 A;  2UUC Q;  4GN3 B;  2QA4 A;  1WTO A;  4ALP A;  4HIO A;  2XNA C;  1I94 L;  1OO9 B;  1Y1W H;  1BF4 A;  4LF9 L;  2K7V A;  4B3S L;  1XPU A;  2SNS A;  2XWB B;  4DV2 L;  2LMC B;  2NUC A;  4ZKB B;  2DNC A;  4DAP A;  1WCM B;  4QF4 A;  3CCM A;  3W1G A;  1CKN A;  2KHS A;  3S2D H;  5C0X I;  4JI8 L;  2ZXR A;  4KKS A;  2JSO A;  1AW7 A;  1B8A A;  3PUY A;  4AQY Q;  1STY A;  1HCZ A;  3MXU A;  2PYK A;  1SJH D;  1EQT A;  1EY5 A;  5KNB A;  3Q23 A;  1VQK A;  1RD9 D;  5CV5 A;  1FNW A;  2RDG A;  3IFT A;  4A3E G;  4H44 C;  4A3G B;  2MFI A;  2JA6 H;  2PQA A;  1X9N A;  1TR5 A;  1TKW B;  3WDN A;  3CCE A;  2RSO A;  3HKZ B;  1EQQ A;  1A63 A;  1IBK L;  4EQN A;  5JJI A;  4GKJ L;  1Z47 A;  3RN2 A;  3GV3 A;  2HQE A;  1IZ6 A;  2QEJ C;  4NDX A;  4QIW E;  3I4N B;  3NQT A;  4CJ1 B;  2AQ1 B;  4LF6 Q;  1I5F A;  3E0J A;  1DON A;  2CW0 D;  4LW1 A;  5JPN C;  3SXH A;  3NE5 B;  4OEL B;  4JI8 Q;  2YTX A;  1B7Y B;  1JB3 A;  2R3Z A;  1XNR L;  1PMR A;  2YU9 H;  1NE3 A;  3STB C;  2ASB A;  1F77 A;  2AUJ D;  2F0O A;  2ZJQ A;  1FNU A;  1EY4 A;  3MC0 B;  4BY7 H;  5LL6 X;  1CT1 D;  1EUJ A;  2PW7 A;  3I7F A;  5CV9 A;  3CP0 A;  5NUC A;  4P71 A;  1TVX A;  1LO5 D;  1HTP A;  1EWC A;  1L0W A;  1STN A;  1K83 B;  4A3F G;  5FK9 C;  1HA5 A;  2R93 G;  1H9S B;  3J81 E;  3GTM B;  2RDH A;  4JI7 L;  4QQB X;  1NR4 A;  3ERO A;  1V1O A;  3URY A;  1KD1 C;  5JJZ A;  3J81 c;  2FMC A;  3N6R A;  4UP9 A;  1HH2 P;  2PCF B;  3HOV H;  1STH A;  3FPP A;  3AYH B;  3NWS A;  4X66 L;  2OT2 A;  4A76 A;  1SMY D;  1IKM A;  3CCQ A;  3H3V I;  1HNW L;  4YY3 Q;  1OXV A;  5JEA H;  1I6H B;  3S1Q B;  5FO7 B;  1SRO A;  5EBC A;  3M4O B;  1PH5 A;  4TRD A;  4KK7 A;  4C3J G;  4G4K A;  1T9H A;  5J39 A;  3A0J A;  4TQU S;  2M9V A;  2IL8 A;  3EBE A;  2IX1 A;  3S16 H;  1CSP A;  4IN3 A;  1LT5 D;  3D4D A;  1PH6 A;  3AFQ A;  4LUV A;  1SE3 A;  3NEN A;  5J3B A;  3BG3 A;  2Z4I A;  1VQM A;  4GNX B;  2NVX B;  1MKH A;  1NAP A;  1XPO A;  2CVR A;  1W2B A;  3HP3 A;  4R4I A;  2J0T D;  3TZD A;  2F1M A;  5KNC A;  2K28 A;  1QG7 A;  4LF7 Q;  4X62 Q;  2EPB A;  1J9O A;  1LLR D;  3HOZ G;  1IL2 A;  1EEI D;  1N32 Q;  4JW0 A;  4DV6 Q;  3MVV A;  2E2H H;  4A3E H;  1EWH A;  1GUS A;  4ZKC B;  1Y1V H;  3ULJ A;  2UXB L;  3TDQ A;  1PTO D;  1BBW A;  3M9B A;  3S17 B;  1NY4 A;  3E6Z X;  4KHZ A;  3G4S A; 
#chains in the Genus database with same CATH homology
 4LF9 Q;  4DR4 L;  5LMN L;  2V1C C;  5GAG C;  4JI0 Q;  3HOW G;  4JV5 L;  5C4X G;  4GNX A;  5IY0 A;  2I5H A;  3ULP A;  4B3S Q;  4LF4 L;  3STB D;  2JA8 G;  1VQ9 A;  1LTL A;  1N34 Q;  3FHW A;  4DV2 Q;  4X6A H;  5GAD C;  4A3K H;  1XMO L;  1HZA A;  4AIM A;  1E3P A;  5ELO A;  4DR1 L;  2JK8 A;  4MZ9 A;  2AWO A;  3ULL A;  2K14 A;  2C35 B;  2CCZ A;  3HOU H;  2HHH L;  1ASY A;  3DLL A;  3ICE A;  2D62 A;  3NEM A;  5IWA L;  3PUW A;  2RCN A;  3JC6 6;  3M4Q A;  3J7Z C;  4A3M G;  2R6G A;  2N3S A;  5IYB G;  4DR5 Q;  2OWO A;  2BH8 A;  2R92 G;  1EIY B;  2RHQ B;  4GN4 B;  1SE8 A;  5GQO A;  3OTO L;  3I55 A;  3GTP H;  1VS0 A;  1YNX A;  1SLJ A;  3CCV A;  1WOC A;  4L5S A;  3KF8 B;  1TWG H;  4OO1 I;  3F1Z A;  1VQN A;  1KAW A;  4C3I H;  2VQE Q;  1GO3 E;  4NXM Q;  4NPS A;  1PH2 A;  1AE3 A;  1PH8 A;  1S40 A;  1RIP A;  2K75 A;  4YHH L;  2OTL A;  1J5E L;  2Q2I A;  3PO2 H;  5M3M H;  1EQR A;  4DR7 L;  2KHJ A;  1JT8 A;  2ATW A;  3CC7 A;  2PNH A;  3RZD H;  3F8T A;  3W1B A;  4HJ7 A;  4K0K L;  5IP7 G;  1IBK Q;  2F4V L;  3GTM H;  4A3F H;  4B3R Q;  4OO1 G;  4DV4 L;  1HNX L;  4NXN L;  5IYD H;  5IT9 c;  4GKJ Q;  4HJ5 A;  5LMN W;  1JJC B;  4IPH A;  1G29 1;  4DR3 Q;  4DV3 L;  3UDG A;  4A3C H;  4LFA Q;  2NN6 G;  1X3G A;  2JEB I;  4A75 A;  1K3R A;  1N36 Q;  1CSQ A;  2EXD A;  3CAM A;  4DUZ Q;  5C3E G;  2WFW A;  2Q2U A;  3OYY A;  1TXY A;  4IJL A;  4QL5 A;  1GKH A;  4QJF A;  1KIX A;  3J81 i;  1NMG A;  1OXU A;  1SMX A;  4PG3 A;  3PF5 A;  4BXX H;  5HY6 A;  1OXX K;  1R9T H;  3HFZ B;  1WYD A;  4HID A;  4PZ8 A;  1XNR Q;  3CCL A;  3GDE A;  5IP9 H;  3M4P A;  3T1H Q;  4JI4 L;  3B6Y A;  2PMZ E;  4OX9 L;  3KDF B;  2NZH A;  3PIO A;  1C9O A;  1SFO H;  2GN5 A;  1FJG Q;  3S1Q H;  3K0X A;  2ALY B;  3U58 A;  2B63 G;  3M4O H;  1E24 A;  2DGY A;  5M5W H;  1VQA A;  4JI1 Q;  5FLM G;  4BA1 I;  4BBS G;  1VQI A;  1VQP A;  3I4M G;  1YIT A;  2B3G A;  2VL6 A;  2UUA L;  1U5K A;  4LFB L;  4YWL A;  4C3J H;  4C3H H;  3S1R H;  3FKI H;  1W3S A;  3HOY G;  5DLQ E;  2UUC L;  1JE5 A;  1UWV A;  2WAQ G;  4HJA A;  1SN8 A;  1GVP A;  4X65 L;  2IX0 A;  3S2H H;  3CXC A;  4BBR G;  3GTJ H;  5IYC G;  4JI2 L;  4LFC Q;  4KLK A;  4R4T A;  2E8G A;  1S72 A;  4GKK Q;  1QZG A;  3HOV G;  3ZJY C;  1VCI A;  2CKZ B;  1X3F A;  3K8A A;  3RR5 A;  2AHO B;  4JI7 Q;  3S14 H;  2UXC Q;  2VNU D;  4GNX C;  2MO0 A;  3F2B A;  4JYA Q;  3BZC A;  4YCW A;  1J6Q A;  2IHE A;  3KJP A;  4DAY B;  3CME A;  5BR8 Q;  2HIX A;  3ER0 A;  4IOC A;  1N8R C;  4IPG A;  3KDF A;  3I2Z A;  3CCU A;  1YJ9 A;  4X66 Q;  1KRS A;  3NBH B;  2VQF Q;  3K81 C;  4A3J G;  4LF5 L;  1C0A A;  1NMF A;  4R1J A;  4YWK A;  4DNI A;  4AQY L;  3GTG H;  2R7D A;  4A3L G;  1WFQ A;  3NEL A;  4H02 A;  4LF8 L;  1HNW Q;  1K8A C;  4O0A A;  4LUO A;  3GTL H;  3A5U A;  1NBW A;  4A4I A;  1PH9 A;  2Y0S G;  3JAM i;  2F52 A;  1VQO A;  3JAM c;  1Q12 A;  2QGQ A;  2I5L X;  1YIJ A;  1YI2 A;  4XTC S;  4A93 G;  2I0Q A;  3PUZ A;  4DV1 L;  3S15 H;  3S17 H;  3KFU A;  2K52 A;  1IBM L;  4JI5 L;  3W5O A;  3I4O A;  1Y1W G;  3PGZ A;  4UPA A;  4X64 Q;  4A3I G;  1KHI A;  4IPC A;  4HIM A;  4DK3 C;  2A19 A;  1A63 A;  4BY1 G;  1U0L A;  2K50 A;  2KBN A;  1YEZ A;  4R4Q A;  3HOW H;  5C4X H;  4LF6 L;  2DUD A;  4JI3 Q;  4ME3 A;  2JA8 H;  1H95 A;  4L5Q A;  1Q1B A;  3I4N H;  1KC8 C;  3AFP A;  2A8V A;  4KHP L;  3CMA A;  2OCE A;  2XGT A;  2L15 A;  2N78 A;  4P73 A;  1VQ7 A;  1L1O B;  5C44 G;  4R4C A;  3T1Y Q;  4QY7 A;  4DUY Q;  5JJL A;  1I3Q H;  1V43 A;  2HIV A;  3GTK H;  4A3M H;  5AJ3 Q;  1YJN A;  5IE8 A;  1Q86 C;  2JA5 G;  5IYB H;  4JI6 Q;  4GN5 A;  4OWT B;  2KHI A;  3DM3 A;  2A1A A;  3CC2 A;  3KF6 B;  3CC4 A;  1XNQ L;  1HZB A;  2UXD Q;  4POF A;  1Y1V G;  1HR0 Q;  5EAY A;  2AWN A;  2K5V A;  3A5Z B;  3H0G G;  4AYB G;  2PI2 A;  2D0O A;  4GLX A;  1VQ4 A;  1K8G A;  2JA6 G;  3G48 A;  1UE7 A;  2ZJP A;  3S24 A;  1OXS C;  4WJ3 M;  3PO3 G;  1BKB A;  3M85 A;  3U4Z A;  1NJI C;  2JEA I;  2MQH A;  3HKZ E;  2CFM A;  1PH3 A;  2UXB Q;  1G6P A;  3F2C A;  1YBY A;  5JEA J;  1TWC H;  1M90 C;  1N33 Q;  1HJP A;  2KEN A;  1CKM A;  1K83 H;  4DV5 L;  4GOP A;  1PV4 A;  4A3K G;  4DR2 L;  1D7Q A;  3J81 j;  4DR4 Q;  5LMN Q;  1XMQ L;  1PH1 A;  4JV5 Q;  2R93 H;  4IOA A;  1AE2 A;  4YCV A;  3RLN A;  1L1O A;  3J80 c;  3TEH B;  2KCM A;  4LUZ A;  4LF4 Q;  2VUM G;  2IT1 A;  3TQY A;  2WB1 G;  1XMO Q;  1JJG A;  3KOJ A;  4J15 A;  4DR1 Q;  3H15 A;  2ZTE A;  1Q1E A;  2RHS B;  3D0F A;  1C7Y A;  3RN5 A;  2HHH Q;  1MJC A;  1EFW A;  5IWA Q;  3HOX G;  3KF6 A;  5HGQ A;  1X55 A;  1K0R A;  1PH7 A;  1LUZ A;  2ID0 A;  2JJQ A;  3OTO Q;  4YY3 L;  4BY7 G;  3VDY A;  2B63 H;  3PF4 A;  2XTI A;  2JQO A;  1EIF A;  1JB7 A;  1P8L A;  1QUQ B;  4DR6 L;  5FLM H;  1I6H H;  2IY5 B;  3U4V A;  4BBS H;  3PSI A;  1N9W A;  1HNZ L;  3PUV A;  3E0E A;  1YVC A;  1L2F A;  2RF4 A;  1FGU A;  3BU2 A;  2KCT A;  3K80 C;  4YHH Q;  4DPG A;  1J5E Q;  2UUB L;  3GO5 A;  4B3M L;  5H1S E;  3HOY H;  3RZO H;  4DR7 Q;  3K7U C;  2I5M X;  2GVA A;  3CW2 C;  1M1K C;  1SRU A;  3UDX A;  1PFS A;  1D8L A;  2YTY A;  4P75 A;  5M3F G;  5GRO A;  4K0K Q;  2F4V Q;  5IYC H;  4P72 A;  4DV4 Q;  1HNX Q;  4NXN Q;  2Z6K C;  2ZTD A;  3H3V H;  4R4O A;  4UY8 C;  4GLA C;  4DV3 Q;  2LXK A;  4JBK A;  4IJH A;  4MNO A;  4EX5 A;  1VQ6 A;  4PZ6 A;  1V9P A;  5LMU L;  2E2I H;  2VS1 A;  5IP9 G;  5C4J H;  2NVX H;  1IBL L;  1O7I A;  3BJU A;  3FP9 A;  4JC0 A;  4OXP A;  2JE6 I;  1G51 A;  1Q7Y C;  4Y52 H;  4GLV B;  4DV0 L;  1LM0 A;  3L2P A;  4A3J H;  1CKN B;  3UE0 A;  3L0O A;  4X62 L;  3HKS A;  1A0I A;  4RMF A;  2UU9 L;  4B3T Q;  4JI4 Q;  1QUQ A;  1QZH A;  4OX9 Q;  4A3L H;  2E5L L;  3CF5 A;  4DV7 L;  3TRE A;  5JEA G;  4A3D G;  5FJ8 G;  5E7N A;  3KLW A;  1N32 L;  3EIV A;  4DKA C;  3GTO H;  4DV6 L;  3PCO B;  1SR3 A;  2FXQ A;  2MO1 A;  2BA0 A;  2HQL A;  3M7N A;  1A62 A;  1BVS A;  1VQL A;  2UUA Q;  3HOZ H;  1VQJ A;  1BBU A;  3J7A 5;  1HZ9 A;  4LFB Q;  3GD7 A;  2YV5 A;  2B29 A;  3MEF A;  2UUC Q;  4P74 A;  1Q81 C;  2R7Z H;  4A3B G;  3M3Y H;  4GN3 B;  2QA4 A;  2PQA B;  1FVI A;  4X65 Q;  4ALP A;  2ZM6 L;  2JA9 A;  4QGU A;  4HIO A;  1K73 C;  1I94 L;  1Y1W H;  3KJO A;  4JI2 Q;  1OTC A;  4LF9 L;  4GOP C;  4MTN A;  3RLO A;  4JI0 L;  2F3I A;  1IXR A;  4BY1 H;  1VQF A;  4B3S L;  1XPU A;  3RNU A;  1N34 L;  1WCM G;  1YZ6 A;  1VQC A;  4DV2 L;  2CQO A;  1L1O C;  2VW9 A;  4WJ4 A;  2CWP A;  1DGS A;  1MIU A;  4L5T A;  5C44 H;  5K36 G;  3CCM A;  3W1G A;  1CKN A;  3S2D H;  4B3T L;  5C0X I;  4DR5 L;  3S1N H;  4JI8 L;  1I50 H;  2JA5 H;  1VQE A;  3PV0 A;  1UE5 A;  1GM5 A;  3SGI A;  1JJ2 A;  2OQK A;  4YCU A;  4LF5 Q;  1B8A A;  1X54 A;  3PUY A;  4AQY Q;  3CCJ A;  1JMC A;  1YHB A;  2R92 H;  4LF8 Q;  2JA7 G;  3UE1 A;  2Q2H A;  3CCR A;  4A3G G;  2VQE L;  4NXM L;  4O2D A;  1VQK A;  5JJK A;  4HIK A;  1RL2 A;  1QVF A;  3H0G H;  4A3E G;  3CQZ H;  3UDF A;  2MFI A;  3S1M H;  3TS0 A;  3HKZ G;  2PQA A;  1X9N A;  2JA6 H;  1VQH A;  1X3E A;  1CKO A;  3PO3 H;  3CD6 A;  3CCE A;  5GAE C;  4JCV E;  4DV1 Q;  3CCS A;  1EQQ A;  2LXJ A;  4JBW A;  1IBK L;  2NVT H;  4B3R L;  5ELN A;  1IBM Q;  3AQQ A;  5JJI A;  4JI5 Q;  4GKJ L;  1Z47 A;  2R7F A;  3RN2 A;  3I4N G;  5FLX c;  4JBM A;  1GD7 A;  4DR3 L;  1IZ6 A;  1YJW A;  2QEX A;  4LFA L;  1Y14 B;  2OQ0 A;  2YYZ A;  4JOI A;  4QIW E;  5IP7 H;  3G71 A;  1N36 L;  4LF6 Q;  3AEV A;  1K9M C;  2VUM H;  1I5F A;  1Q46 A;  1EYG A;  4DUZ L;  4OWW B;  4LW1 A;  3GTQ H;  4KI0 A;  1EWI A;  3J80 i;  4JI8 Q;  4KHP Q;  2D0P A;  2K4K A;  3HOU G;  2YTX A;  4DAM A;  1B7Y B;  1S3O A;  1PH4 A;  1YHA A;  1UEB A;  4FDB A;  1XNR L;  2YU9 H;  4LNQ A;  5C3E H;  3T1H L;  3HOX H;  1HR0 W;  1NE3 A;  1B70 B;  3STB C;  1FJG L;  2ASB A;  4Y7N H;  3IRB A;  1UE1 A;  3RLF A;  2VZA A;  2LSS A;  2ZJQ A;  1QVG A;  4BY7 H;  1IYJ B;  2ES2 A;  4HJ8 A;  1FL0 A;  2IHF A;  1XNQ Q;  2NN6 I;  3TRZ A;  4JI1 L;  1EUJ A;  3E9I A;  4AYB E;  2GVB A;  4HJ9 A;  1Q82 C;  1HZC A;  1E7Z A;  3I7F A;  4POG A;  3CP0 A;  1NTG A;  4P71 A;  3E9H A;  4AH6 A;  3F2D A;  1E1O A;  1YHQ A;  3PO2 G;  5M3M G;  3CPW A;  3WWV A;  2H5X A;  3I4M H;  2N8N A;  1L0W A;  1EOV A;  2N49 A;  1AH9 A;  4TVA B;  2R93 G;  3BZK A;  4A3F G;  5IYD G;  4LFC L;  1X56 A;  2ZJR A;  5M3F H;  4JBJ A;  2OTJ A;  4IPD A;  4UP8 A;  4DV5 Q;  3PIP A;  2NVY H;  1E22 A;  1XJV A;  2BH2 A;  4OWX B;  4GKK L;  1TWA H;  4DR2 Q;  4A3C G;  4JI7 L;  4QQB X;  2UXC L;  1XMQ Q;  1LYL A;  4BBR H;  3I56 A;  1TWF H;  1KD1 C;  1KL9 A;  1A8V A;  1V1Q A;  4EQ5 A;  2WB1 E;  4JYA L;  3J81 c;  4UP7 A;  4IFD J;  5C0X J;  3UDI A;  4UP9 A;  4IO9 A;  1HH2 P;  5BR8 L;  1E1T A;  1TWH H;  3HOV H;  4BXX G;  3PUX A;  2K5N A;  4OON A;  5GAH C;  1PA6 A;  5M5X H;  3AYH B;  4X66 L;  2VQF L;  4A76 A;  4JG2 A;  1WJJ A;  1PYS B;  3CPF A;  3CCQ A;  1PYB A;  3H3V I;  4YY3 Q;  1PHJ A;  1HNW L;  4GS3 A;  1OXV A;  1XPR A;  4A3D H;  3K7A H;  5FJ8 H;  1SRO A;  2NVQ H;  4DR6 Q;  3TS2 A;  1PH5 A;  1HNZ Q;  3FKI G;  1VQ8 A;  1KQS A;  2EQS A;  2UUB Q;  2MNA A;  1T9H A;  2WP8 J;  4B3M Q;  4DK6 C;  3A0J A;  3A74 A;  4LWC A;  4A3B H;  4TQU S;  2E2J H;  2Z0S A;  3EBE A;  4XIG S;  2IX1 A;  2WAQ E;  4X64 L;  3S16 H;  1CSP A;  1Q8K A;  2AMC B;  1WI5 A;  1PH6 A;  3AFQ A;  4LUV A;  2Q2T A;  4A93 H;  3G6E A;  3NEN A;  5J3B A;  1CUK A;  2YTV A;  2VY3 A;  4JI3 L;  4JOI C;  4A3I H;  1OXT A;  1WCM H;  4LF7 L;  1KRT A;  1VQM A;  1VQD A;  5LMU Q;  4GNX B;  4L5R C;  1UE6 A;  1MKH A;  1VQB A;  1XPO A;  3KYH C;  3T1Y L;  1W2B A;  4C2M H;  4DUY L;  1IBL Q;  2CWA A;  2BA1 A;  4R4I A;  1Z9F A;  5AJ3 L;  1X65 A;  1VQ5 A;  4JI6 L;  4DV0 Q;  4PMW A;  3MXN B;  4LF7 Q;  1QVC A;  1X6O A;  4X62 Q;  4IFD I;  2UU9 Q;  1P16 A;  2UXD L;  2E5L Q;  3OW2 A;  3HOZ G;  4RG1 A;  4DV7 Q;  3EN2 A;  1XTD A;  1IL2 A;  4APV A;  1HR0 L;  2JA7 H;  4BA2 I;  4A3G H;  4NB3 A;  1MJE A;  2R7Z G;  2NZO A;  1N32 Q;  4DV6 Q;  2E2H H;  1PVO A;  4A3E H;  4PZ7 A;  3D31 A;  2K5H A;  2Y0S E;  1Y1V H;  2ZTC A;  2Z6K A;  2PI2 E;  3ERS X;  4YWM A;  3ULJ A;  4IFD G;  2UXB L;  5C0X G;  3L7Z C;  2HT1 A;  2AKW B;  1BBW A;  3U50 C;  5M5Y H;  1VQG A;  4GOP B;  1ASZ A;  3M9B A;  1N33 L;  1KXL A;  1NY4 A;  2ZM6 Q;  2EIF A;  3Q8D A;  4KHZ A;  1I94 Q;  3G4S A;  3LGJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...