4OWTB

Structural basis of soss1 complex assembly
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
105
structure length
72
Chain Sequence
b'TFVKDILIFIVLETGVRTCKVADKTGSINISVWDDVGNLIQPGDIIRLLTLYTDLQKIGEFCMVYSEVPNFS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrator complex subunit 3
publication title Structural Basis of SOSS1 Complex Assembly and Recognition of ssDNA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 17
structure length 72
sequence length 105
ec nomenclature
pdb deposition date 2014-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01336 tRNA_anti-codon OB-fold nucleic acid binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4owtB00
4BXXH 4JYAQ 5M5YH 2RF4A 3I4NG 2NZOA 3A0JA 4KHPL 4MTNA 3F8TA 1SFOH 4A4IA 2JE6I 2K50A 5LMUL 4LFAQ 1BVSA 4O0AA 4POFA 1R9TH 1E1OA 4DAMA 2MO1A 4NB3A 2AWNA 4B3SL 4NXNL 5LMNW 2UUBQ 1UWVA 4FDBA 3HKZE 3TS2A 1M90C 4A3MH 1XMQL 3S1NH 2ID0A 1VQ5A 4WJ3M 4JI1L 4GLVB 2H5XA 1SMXA 4LF9Q 5GQOA 1VS0A 3KF6A 3FKIH 4KLKA 2E2JH 1OXVA 3ULJA 3J81c 1C7YA 4DK3C 2QGQA 3DLLA 1DGSA 1ASZA 5JJKA 4EQ5A 2F4VQ 1EIFA 1A8VA 1OXSC 4A3IG 3TEHB 1KQSA 3TS0A 3CCMA 1K3RA 4BY7H 3CCVA 1MKHA 4JV5Q 4GLXA 1XJVA 4DR3L 1VQOA 4AH6A 1PYSB 2VY3A 3M4PA 1YITA 1JB7A 4IJHA 3GTMH 1EUJA 2D62A 2WB1E 1N36Q 4YY3Q 3KJPA 4JI5Q 4JBJA 5FLMG 5EAYA 4LF9L 3M9BA 4RMFA 2LSSA 3U4VA 3RN5A 4A3GG 1Q86C 1TWGH 3KYHC 2MNAA 2PQAB 2QA4A 1B70B 2HQLA 3K7UC 1GD7A 1YJWA 4P73A 2A8VA 4WJ4A 1G291 4LF7Q 2FXQA 5ELNA 1PH5A 1VQGA 2KHIA 2B29A 3GDEA 1QVCA 3IRBA 4BY1G 4C3HH 4GOPC 1GM5A 4LF5Q 3GTQH 4B3MQ 3G4SA 3VDYA 1B7YB 4YWMA 4DR4Q 2D0OA 4JV5L 1UE5A 2NN6I 1D8LA 4L5SA 2N78A 3S1MH 3MXNB 3RLNA 4IPHA 4UY8C 2PMZE 3F2CA 1N36L 4GNXA 2YTYA 3I56A 5IYBG 1J6QA 1B8AA 1FL0A 4DV1Q 1KD1C 1BKBA 1AH9A 4NXML 2JK8A 4GN5A 4JOIC 3HOWG 4JBKA 1VQJA 2ZJQA 1E3PA 4LF7L 2RHSB 1KRTA 3PIOA 3HOXG 3CCUA 4A3KG 4UP7A 4Y52H 2ZM6Q 5HGQA 2JJQA 4B3ML 1Y1WG 4DR4L 1ASYA 5IYDG 2VL6A 1YJNA 1V9PA 2N8NA 5ELOA 5M5WH 5IP9G 2JA5G 1C9OA 1SE8A 4DV7Q 2OCEA 3RLFA 3U58A 2YU9H 4GKKQ 5C4XG 4AQYQ 1H95A 2OQ0A 1IL2A 2Q2HA 4QJFA 4DAYB 4DV3Q 1PFSA 1VQDA 1VQPA 1HJPA 2Q2TA 2I0QA 1HNZL 5FJ8G 3GTOH 2NVTH 2OTJA 3HOYG 3HOVG 1NY4A 1I3QH 2R92G 5IWAL 2ZM6L 4X64Q 1PH1A 1KHIA 2Z6KC 1KRSA 4H02A 3J81i 3NEMA 3KFUA 1WI5A 3AFQA 4A3FG 2E8GA 2AWOA 2VW9A 5C0XJ 4DV7L 3S17H 3S16H 3DM3A 1KAWA 4AQYL 1NE3A 3I4MG 4GKKL 4DV3L 1QZGA 1SLJA 4OWXB 3ZJYC 5AJ3L 3PF4A 4GNXB 3ER0A 1MJEA 3EIVA 3CPFA 2Y0SE 2ZJRA 4A3IH 4LFBQ 5JEAJ 4LUOA 4O2DA 1EYGA 4GOPB 5C3EG 4HIDA 4TQUS 2ZJPA 1YI2A 5IE8A 4HIOA 1EQRA 4HIMA 3CCLA 1SN8A 3AFPA 4DUYQ 2ATWA 5M5XH 4DUZQ 1UE6A 4JI6Q 3GTPH 4A3LG 4LW1A 4LF4Q 5C0XG 4KHZA 1WCMG 4YHHQ 5FLMH 4JI7Q 4POGA 2IX1A 2GVBA 3PO3G 4NPSA 2F3IA 3A74A 1PH2A 2HIVA 4PZ8A 4OWTB 1IBKL 1G6PA 4P71A 3S2HH 1LM0A 2WP8J 3CC2A 4JI0Q 1KXLA 4A3CH 4X65Q 4YCVA 4MZ9A 2OTLA 2KENA 4A3BH 4LFBL 2PQAA 2WAQE 3OTOQ 1X65A 4DV4Q 1XPUA 1TWAH 1P16A 4YCUA 1O7IA 4DUYL 1V1QA 4A93G 1IZ6A 4IPDA 4L5TA 4DUZL 1K8AC 2Z0SA 1Q1EA 1S72A 1AE3A 1LYLA 2CWPA 2LXKA 4DK6C 4YHHL 5JJLA 3K8AA 1PVOA 2I5MX 1HZCA 2JQOA 2Q2IA 4DNIA 4J15A 2UUAQ 4GN4B 2K5NA 3HOWH 1N34Q 4IFDJ 4JI0L 2N49A 3H0GG 3CCJA 4X65L 5IP7G 2A1AA 3T1HQ 1FJGQ 3HOXH 2B63G 3PUXA 3OTOL 1HR0L 1OXTA 4DV4L 3CW2C 1Q12A 3PV0A 1VQ9A 5IYDH 2F4VL 3M4OH 3BU2A 3CMAA 4JYAL 3K80C 1X3FA 1UE7A 1L1OC 1RL2A 2JA5H 1CKNB 3PCOB 3D0FA 4OWWB 4LFAL 2R7ZG 3PO2G 1XPOA 4DR6Q 2UUAL 4RG1A 3J80c 5FJ8H 1XTDA 4A3JH 1N34L 1U0LA 1XNQQ 2UUBL 1N33Q 3HOYH 4IFDG 2E5LQ 4B3TQ 3HOVH 2YYZA 3W1GA 3SGIA 5GADC 1FJGL 1VQNA 4C3IH 2R92H 1I6HH 4PZ6A 1LUZA 5JJIA 2CQOA 4DV2Q 4UP8A 1HR0W 1VQ7A 3CC7A 4JCVE 3W1BA 3S24A 5M3MG 3HKZG 1N8RC 4JI2Q 2NN6G 2EIFA 3PSIA 1FGUA 1Z47A 4A3FH 1LTLA 1WFQA 1X56A 2EXDA 3PUVA 4DKAC 2KHJA 5C44G 2JA7G 1NMFA 2R93G 4GN3B 4DR6L 1NTGA 1Q8KA 1PH7A 2GVAA 3B6YA 4OXPA 3CCRA 4LF8Q 1SRUA 2UUCQ 1XNQL 1I94Q 2E5LL 2N3SA 4L5QA 4OONA 4XTCS 4OX9Q 3JAMc 4YY3L 4DV2L 4JI5L 5C3EH 3M3YH 1UE1A 1HH2P 1HNXQ 4JI2L 1X3GA 1PYBA 2V1CC 2WB1G 2JA8G 4LFCQ 1CUKA 1Z9FA 4GOPA 4DV6Q 1OTCA 3E9HA 2I5HA 4A3LH 1VCIA 4APVA 3L2PA 3K7AH 2BA1A 1WCMH 4LF5L 3UE1A 2OWOA 2VS1A 3PO3H 3F2BA 2AHOB 1IBMQ 4LUZA 4R4CA 1QUQB 2JEAI 1IYJB 2K5VA 4IO9A 3L7ZC 2UUCL 1I94L 1PH8A 3TRZA 2YV5A 2UU9Q 1MIUA 4R1JA 2MO0A 3CPWA 4OX9L 1YJ9A 4QQBX 4JOIA 1G51A 4DV1L 1WOCA 1HNXL 1EOVA 3TQYA 4LF6Q 3FP9A 3HFZB 4JI3Q 3EBEA 2ASBA 1U5KA 5H1SE 3CCQA 4DV6L 1YEZA 1W3SA 3FHWA 1L1OB 3PUZA 3PF5A 4ALPA 3L0OA 4PG3A 2NZHA 2ZTDA 4BA1I 1N9WA 3M7NA 2UXBQ 2UXDQ 1UEBA 3A5UA 1IBML 1JJCB 2IT1A 3AYHB 3HOZG 4Y7NH 4GLAC 4BBSG 2UU9L 2IX0A 5IP7H 1PH4A 2VQFQ 2IHEA 2B63H 1OXXK 1L2FA 1J5EQ 1PA6A 1K83H 1NMGA 2F52A 3J80i 1WYDA 4XIGS 4JI3L 2K52A 2Z6KA 3CAMA 1SR3A 2UXBL 1I50H 2CWAA 4X64L 2R7ZH 1CKNA 1CKOA 2I5LX 4HJ8A 2D0PA 3LGJA 2VNUD 1S40A 1CKMA 2HIXA 3BZKA 3RR5A 4K0KQ 2K5HA 3J81j 1K73C 1HZBA 2VQFL 3M85A 4PZ7A 4LNQA 2Q2UA 1J5EL 2XGTA 5M3MH 2CCZA 4IPCA 1VQBA 4A3GH 1Y14B 3RZDH 1VQKA 1X54A 3CXCA 1Q7YC 1P8LA 1YHQA 5LMNQ 5C44H 3JAMi 1JE5A 3CCSA 1Q82C 4P75A 1PH9A 2JA7H 4BY1H 2R93H 1VQFA 4X66Q 2VQEQ 2C35B 1X9NA 1TXYA 4A3DG 2L15A 1N32Q 4OO1I 5M3FG 1HZ9A 2MQHA 4EX5A 1KL9A 3S15H 4AYBG 1BBUA 1VQHA 1A0IA 4JI6L 2PNHA 4IPGA 3U50C 3F2DA 4LF4L 4KHPQ 4JI7L 2CFMA 5IYBH 2IHFA 1PH3A 5LMUQ 5K36G 1VQIA 4TVAB 2KCTA 5GROA 3KJOA 3CC4A 5GAHC 4L5RC 1VQMA 5BR8Q 2JA8H 2CKZB 3MEFA 3K81C 2AMCB 3CP0A 5J3BA 4A75A 1BBWA 1KC8C 4DR5Q 4B3SQ 4HJAA 2MFIA 4HJ7A 3UDGA 4A3KH 1HZAA 3D31A 4AIMA 3TREA 1WJJA 1Y1WH 1XMQQ 3RN2A 1Q81C 5C0XI 1A62A 4DV0Q 1Y1VG 3AQQA 4R4OA 1VQLA 1GVPA 1XMOQ 2WAQG 1PV4A 1X6OA 5IP9H 4GS3A 3HKSA 1TWHH 1QUQA 3I7FA 5C4XH 2ES2A 3HOUG 4IOAA 1IBLQ 2WFWA 1C0AA 2PI2E 3G6EA 5C4JH 3I4NH 4ME3A 5BR8L 3STBD 1XPRA 3U4ZA 4DR5L 1X3EA 3T1HL 4DR3Q 1XNRQ 2LXJA 4YCWA 3BJUA 5IYCG 1VQ8A 4BA2I 5GAEC 1L1OA 2AKWB 5HY6A 4DV0L 1KIXA 4YWLA 3GTLH 3HOZH 4BBSH 1XMOL 3GTGH 4A93H 4X62Q 3I55A 4R4QA 5E7NA 1V43A 3PGZA 3PUYA 1VQ6A 3GO5A 2ZTCA 3I4MH 1IBLL 1RIPA 4A3EG 3AEVA 2HHHQ 2R7FA 4QL5A 1GKHA 1YVCA 3S1RH 1L0WA 1TWFH 2EQSA 1MJCA 5GAGC 1K8GA 3G48A 1N33L 1YHBA 3KDFA 3RNUA 1QVFA 4B3TL 2JA6G 2RHQB 1XNRL 2VUMG 1JJGA 1VQ4A 3I2ZA 3PUWA 2ZTEA 3H3VH 4MNOA 4GKJQ 4DR1Q 3GD7A 3ICEA 1TWCH 4X62L 4HJ9A 3JC66 4NXMQ 2UXCQ 1M1KC 4QIWE 4GNXC 3RLOA 2YTVA 3KOJA 1W2BA 4A3CG 4IFDI 4A3BG 2E2HH 3WWVA 4BBRG 1K0RA 1VQAA 2HHHL 4DV5Q 3NELA 4PMWA 2JEBI 3S2DH 2IY5B 4LF8L 3PIPA 4DR7Q 2XTIA 1EQQA 1GO3E 4JI8Q 3T1YQ 1OXUA 4BXXG 4R4TA 1CSPA 1YNXA 1D7QA 2BA0A 4GKJL 3W5OA 4A3DH 3UE0A 4JC0A 4DR1L 3G71A 5M3FH 1PHJA 1AE2A 1JJ2A 3CD6A 1EIYB 3J7A5 2UXCL 1S3OA 4LFCL 1CSQA 3F1ZA 1HNZQ 1YBYA 4HIKA 1A63A 3UDFA 2NVQH 2DGYA 1I5FA 3KF8B 4UP9A 4QY7A 4JG2A 3GTKH 3EN2A 3KF6B 3Q8DA 4DPGA 1IXRA 3E9IA 2GN5A 5IT9c 5IWAQ 4DV5L 3CCEA 4A3MG 1NJIC 2E2IH 2K4KA 2A19A 4DR7L 1VQCA 3H0GH 3FKIG 4LUVA 4JI8L 3T1YL 2DUDA 5IY0A 3ULPA 4KI0A 2K75A 3S1QH 1E24A 2VZAA 3E0EA 5DLQE 4R4IA 3KDFB 1Y1VH 3NBHB 3STBC 4JI4Q 2HT1A 4LF6L 1E1TA 3OW2A 4BY7G 3OYYA 4A3JG 5AJ3Q 3HOUH 2UXDL 1YZ6A 1JT8A 3PO2H 1T9HA 3UDIA 2RCNA 2R7DA 4P72A 3CMEA 4DR2Q 2PI2A 4JBWA 1FVIA 3K0XA 3ERSX 2KBNA 4B3RQ 4X6AH 4C3JH 2BH8A 1NBWA 1PH6A 5IYCH 1YIJA 1HNWQ 3NENA 4OO1G 4JI4L 1E7ZA 2KCMA 2ALYB 4YWKA 2R6GA 1X55A 2B3GA 1IBKQ 3KLWA 3UDXA 3M4QA 1Q1BA 2NVYH 4A3EH 1QZHA 2JA9A 4LWCA 4C2MH 4QGUA 1EFWA 3RZOH 2YTXA 4AYBE 4DR2L 2Y0SG 4A76A 2QEXA 4HJ5A 1JMCA 1QVGA 4K0KL 2JA6H 5FLXc 2VUMH 4B3RL 3ULLA 1EWIA 4JBMA 3S14H 1Q46A 1HNWL 4IOCA 2BH2A 3I4OA 3A5ZB 3H3VI 4UPAA 3CQZH 4IJLA 3CF5A 5LMNL 3BZCA 4NXNQ 1SROA 4P74A 2K14A 4X66L 2VQEL 4BBRH 2OQKA 1N32L 1K9MC 1HR0Q 4JI1Q 2NVXH 1YHAA 5JEAG 3H15A 1E22A 3GTJH 1VQEA 3J7ZC
chains in the Genus database with same CATH superfamily
5M5YH 4KHPL 1DONA 3F8TA 1BBXC 3TP7A 1U4MA 1STHA 1CZGA 4O0AA 2AWNA 5LMNW 4O1NA 1UWVA 2F0MA 4O42A 3S1NH 2ID0A 4JI1L 1SMXA 4H0LC 4LF9Q 2NVYB 4A3EB 1PTOB 3ULJA 3J81c 3DLLA 2LFNA 4EQ5A 2EYHA 5D3DA 1A8VA 3TEHB 1KQSA 1JWUD 1RCVD 3S14B 3CCVA 3D4WA 4H7BA 1TKWB 1CT1D 3NBHA 4GLXA 4DAYA 1XJVA 1S5ED 2L1BA 5IOCA 4N9TA 2EYMA 2WB1E 5FOBB 4JI5Q 5EAYA 4RMFA 3SEBA 3U4VA 1Q86C 4BBRB 2EYOA 2MNAA 3VYTA 1G291 2FXQA 4ME5A 2NTTA 3K0YA 4GOPC 1GM5A 3A8IE 1HHVA 3A7AB 1EY5A 1SFOB 2NN6I 3P75A 2PMZE 3F2CA 1BCPF 2YTYA 1GUGA 3BYTB 3KK7A 4DV1Q 1KD1C 4NXML 2B2YC 2I46A 1HTPA 2HD3A 3GTLB 5C3XA 1QOHA 3HRZC 2RHSB 4LF7L 3FKIB 3CCUA 5HGQA 4DR4L 3QWNA 5KGUA 5IP9G 4XXEA 4BY7B 3MA2B 5C4XG 5I4DA 4AQYQ 2OQ0A 1BCPC 3KBXA 4QJFA 4DV3Q 3EVQA 1UNSA 1HJPA 4F7XA 3TZDA 2A69C 4X3TA 2NUCA 3IFTA 4K5WA 3GTOH 2NVTH 5JVH3 1BUVT 5IWAL 5FK9C 2ZM6L 4H02A 2PQEA 2K5WA 3S2DB 3NQIA 2AWOA 4DV7L 1EY7A 1BNZA 3S16H 3I4MG 4HCEA 4G7HC 4RHRA 4JVZA 5KNDA 3N52A 3PF4A 2A6HD 4FP5D 1LTBD 3ER0A 1MJEA 1NR2A 3EIVA 4A3IH 4LFBQ 4DF7A 1NNXA 2CQAA 4X3SA 4TQUS 1YI2A 4B9XA 3WDNA 2OT2A 3CCLA 5JPNC 4WFN3 5M5XH 1XWEA 3J80E 3AMUA 5C0XG 4POGA 4JI7Q 5FLMH 1CHQD 5F2DA 4LK1C 1PH2A 4N9PA 3TSSA 4P71A 1KXLA 1LM0A 1W6KA 2KECA 4A3CH 1ZEQX 4MZ9A 2XRQD 2OTLA 3X3NA 2WAQE 1I3QB 4DUYL 3DWAA 2Z0SA 3I4LA 1S72A 3TZUA 4YHHL 1QJOA 2I5MX 2JQOA 2Q2IA 1ZXTA 4J15A 4DNIA 1PFMA 2UUAQ 4RWSC 3S17B 2K5NA 3HOWH 4IUQA 5DAUA 2A1AA 1B4OA 3HOXH 1VDZA 3OTOL 2A6ED 3CW2C 1VQ9A 2RA4A 2F4VL 3M4OH 1X3FA 1O7LA 1F9PA 1L1OC 3NWSA 3D0FA 4OWWB 2QKIC 4LFAL 3PO2G 3GTPB 2AQ3B 2UUBL 4IFDG 2E5LQ 3HOVH 1I6HH 3SGIA 2XSCA 2DY8A 4C3IH 4DV2Q 1HR0W 3N6RA 5M9OA 4JCVE 3W1BA 4JI2Q 2KCNA 2F0HA 3PSIA 4C1NK 1Z47A 1LTAD 1X56A 1ENCA 2PW7A 2F3VA 2WINB 4DKAC 5BN3A 1SNPA 2R93G 1NTGA 1DOMA 4OXPA 5ELCA 1SRUA 1KTKA 2LKVA 1I94Q 2XWBB 2N3SA 4L5QA 4YY3L 2RVLA 1GUWA 1BOSA 1GOZA 1X3GA 1PYBA 2V1CC 2WB1G 2JA8G 1CUKA 5CV6A 2F0GA 1OTCA 4A3LH 4XQQA 3NE5B 5EJWA 2OWOA 1DXMA 2JEAI 2K5VA 1SNDA 1H9RA 4RGTA 1PH8A 4CBVA 1QCBD 4MTKA 4OX9L 4RA8A 4FF4A 2C9OA 1WOCA 4I65A 3MVVA 1IKMA 3I4NH 1F9QA 1JC7A 1U5KA 4DV6L 4CDDC 3FHWA 1HTLD 3LWEA 1CHPD 5E4XA 4ALPA 2F03A 2UXBQ 2ZTDA 2UXDQ 1N9WA 3A5UA 1IBML 2B8GA 2IT1A 4X3KA 5TSSA 2VQFQ 3C3LA 1L2FA 3A55A 4RGOS 1LTGD 3U9SA 4JI3L 3LNNA 2K52A 3M3YB 4LAAA 1SR3A 2JYOA 5IT9L 1MHWC 1EQVA 5EKLA 5IODA 4X64L 1CKOA 2D0PA 3K7AB 3LGJA 1QB5D 2VNUD 3J81j 4IUNA 3DWQA 4PZ7A 2EY1A 1EZ6A 4M8AA 2XGTA 4A3GH 1VQKA 3SR1A 3CXCA 1Q7YC 1P8LA 1YHQA 1JE5A 2KJXA 2JA7H 3K57A 2L15A 4OO1I 1HZ9A 2MQHA 4XT3B 5EPLA 1HFNA 3A54A 3TMEA 4AYBG 2R3ZA 4JI6L 1BQQT 4Y7NB 4LF4L 1D5XC 2CFMA 2MPMA 1H9SA 2C5CA 2QEJC 2KCTA 5GROA 3O13A 2H4OA 4EQPA 3CP0A 5J3BA 4DR5Q 4HJAA 1D5MC 1GXDC 3T53B 3UDGA 4A3KH 3TREA 1Y8OB 1Y1WH 1XMQQ 2FJ2A 3RN2A 1A62A 4DV0Q 1Y1VG 4R4OA 1VQLA 2WAQG 4TKOB 1X6OA 4XYQA 2DJFC 2AUKA 2A68D 3HOUG 4HEDA 5KRUA 3C1FA 5BR8L 1BDOA 3ZYYX 3U4ZA 4RKLA 3FMCA 5IYCG 4BA2I 4KD3A 2L55A 1KIXA 3GTLH 5NUCA 3GTGH 4XT1B 2IJ0A 5E7NA 4OIKA 1VQ6A 4DXGA 3FVQA 2K04A 1IBLL 1RF2D 3GV3A 3GP7A 3TP5A 5GAGC 1N33L 4RCNA 3DM1A 4B3TL 2JA6G 2WACA 2JA8B 1AEXA 2KHSA 1K8MA 3SK8A 2F0JA 2PW5A 1TWCH 2NTSA 4X62L 4HJ9A 2UXCQ 2AUJD 3SHLA 3RLOA 1ZKOA 4S3SA 4A3CG 2HCCA 4CKEA 3HZXA 2JA5B 4DV5Q 3S2DH 2IY5B 3NHHA 4LF8L 1KNAA 1SBBB 1K0SA 4HTHA 3OOCA 4BXXG 3NWTA 1OXUA 2F4IA 1CSPA 3SK5A 5C4JB 4A3DH 1PMRA 2RKSA 4MIUA 4C56C 4HIKA 1LTTD 3UDFA 1KDCA 2XWJB 1STEA 3OIPA 1HQRD 2GN5A 5IIFA 5IGBA 2E2IH 4LUVA 2A73B 2DUDA 2Z8LA 1VF7A 4LF6L 1E1TA 3OW2A 4HCSA 4ZAIA 1F2MA 1A3VA 1YZ6A 1IL8A 1T9HA 3UDIA 4K8IA 4XQNA 2R7DA 2Q8IB 3CMEA 3BS1A 1FVIA 4M1UB 1EZ8A 3NENA 1E7ZA 4C3HG 1X55A 1G2SA 1TR5A 2B3GA 3BZDB 1IBKQ 4H44C 4AYBB 2F0SA 2JA9A 4LWCA 3L9AX 4DR2L 2Y0SG 4IQZA 3BVMA 1JMCA 5D65A 4K0KL 1D1IA 2VUMH 3ULLA 2EYPA 4JBMA 1Q46A 1Y8NB 3H0GB 4G7ZC 2BH2A 3VR3A 3H3VI 3CQZH 3VR4A 5LMNL 1K83B 1Y1VB 4NXNQ 5LL6S 1YNJD 2K14A 4X66L 2VQEL 1N32L 1K9MC 3HOUB 5CBEE 1JB3A 5JVG3 2NVXH 3H15A 1HUMA 3I4NG 2NZOA 4RH6A 1AW7A 2K01A 2K50A 1I4QA 4POFA 1BCPD 1E1OA 4NB3A 2OF1A 1SJHD 1SYDA 3VA5A 2A69D 4ZUIA 4EQNA 5AFWA 2K05A 4XYOA 3HKZE 4A3MH 5EPKA 1VQ5A 3VYUA 4GLVB 2E2JH 3KF6A 1OXVA 4WORA 5JJKA 2JA6B 1WTQA 3CCMA 3W2DA 1K3RA 5CV5A 4ZK9B 4JV5Q 3EJIA 1VQOA 2VY3A 3GTMH 3DMUA 4IJHA 2PZWA 1N36Q 3KJPA 4CHTB 1WTRA 4RFBA 4LF9L 2LSSA 4A3GG 3RN5A 5G3LF 1TWGH 2PQAB 3K58A 1J9OA 2WV6D 4P73A 2A8VA 3FPPA 1PH5A 1UEAB 3IRBA 4LF5Q 3X3MA 1B7YB 4YWMA 3URYA 1UE5A 1BR9A 1D8LA 4GZYC 4L5SA 2N78A 3S1MH 2EJFC 1R9TB 3MXNB 4IPHA 4UY8C 3BVZA 3HG9A 3I56A 1FL0A 1CQFA 2CHBD 1BKBA 1DOKA 2SOBA 2LMCB 1SNOA 4JBKA 2ZJQA 1E3PA 4FF1A 4A3KG 4Y52H 4UP7A 2JJQA 1Y1WG 3J7YW 2DN8A 2JSOA 2P5ZX 2VL6A 5IYDG 1YJNA 2A68C 5ELOA 5M5WH 1LO5D 2MUYA 3BVGA 1IHZA 2Z4HA 2YU9H 2OCEA 3RLFA 4GKKQ 2Q2HA 2VB3X 1VQPA 3T4AC 3HOYG 2H1EA 2LS01 2R92G 2K5QA 1S5FD 1KHIA 2JXMB 1KRSA 1B1ZA 2L0CA 3J81i 1WTHA 1JWSD 4MN3A 3GTQB 3A56A 4C3HB 1B53A 4IURA 3AFQA 3Q0AA 3CRKC 1PRTF 5C0XJ 4QB4A 3DM3A 2K03A 4AQYL 4DV3L 3J7AF 1QZGA 1SLJA 3ZJYC 4C1NI 5KNCA 2Y0SB 2N55A 4JW0A 3OHXC 5JEAJ 4LUOA 1EYGA 4GOPB 4FNFA 5JOBA 4HIDA 2ZJPA 2G5DA 3IKJA 3AFPA 1G8ZD 1Q3LA 4LW1A 1JICA 1V1OA 2ENBA 2IX1A 1WCMG 3BDOA 2GVBA 3PO3G 4NPSA 3A74A 3DHQA 1AP0A 4NP5A 3S2HH 2WP8J 4JI0Q 4TRDA 3HGBA 4X65Q 4LFBL 2IL8A 3NTKA 4DV4Q 3DEPA 1SE2A 2Q8RE 2E74C 1IZ6A 4L5TA 1LYLA 2F0KA 4DK6C 3ND9A 1KLGD 3QOJA 5HGTA 2E75C 1MD2D 4IFDJ 3CCJA 4CJ2C 3T1HQ 1WTXA 2B63G 3FDTA 1HR0L 1HFGA 4G57A 2B39A 1CQVA 4PV1C 3BU2A 4JYAL 4FYDA 2JA5H 1CKNB 3PCOB 2MHVA 3UI2A 3M4YA 1XTCD 2UUAL 4RG1A 5FJ8H 1IKLA 2K33A 1VQNA 4CDCC 3G6JB 1LUZA 2CQOA 1B9MA 1I4RA 3CC7A 1JORA 5M3MG 3HKZG 4A3BB 2EIFA 4K14A 4KKTA 4A3FH 2EXDA 2J0TD 3CKIB 1NMFA 5EKKA 1EWHA 1PH7A 2GVAA 3B6YA 5HURA 2E5LL 4XTCS 3JAMc 4DV2L 5C3EH 1ILQA 4JI2L 1B44D 3J81L 1KLUD 4LFCQ 3OWFA 1Z9FA 2ZXRA 4CKBA 1YNJC 2I5HA 2BA1A 3UE1A 3EFXD 5CORA 1TS5A 3NP8A 4LUZA 1QUQB 1I94L 2YV5A 2MO0A 1YJ9A 4A3JB 4JOIA 1G51A 1EQTA 1EY0A 1NAPA 1I4PA 3HOYB 1F2LA 1GUSA 1PFNA 3TQYA 3FP9A 3HFZB 2G9HD 4ZRZA 3RD4A 3PF5A 4A93H 1YEZA 1L1OB 2PCFB 3PUZA 2XN9C 4BA1I 3M7NA 1ICFB 1UEBA 1JJCB 4F8MA 1PTOF 3AYHB 4QMGA 2KEEA 5IP7H 2PZUA 2R61A 1OXXK 1J5EQ 4FF2A 1K83H 2F52A 1JWMD 5ISRA 3EROA 3MWYW 2Z6KA 2LY7A 2UXBL 3OW7A 2R7ZH 1STBA 1GUTA 5E3FA 4IALA 2I5LX 1WCMB 1S40A 5KEEA 3BZKA 3PO3B 4RAUC 3NTIA 2VQFL 1Q8IA 4LNQA 2Q2UA 2CCZA 2NN6H 1Y14B 4ZKBB 4ZCKA 1SMYC 3RZDH 1GJXA 4IUVA 2EOTA 3A7LA 5C44H 4BY1H 1LABA 3K6OA 1X9NA 1S4ZA 3ITPA 2KVMA 4EX5A 1KL9A 3S15H 1BBUA 5D14A 4RKBA 4ZKCB 5IGDA 3F2DA 4KHPQ 4PQXA 3FEWX 5IGEA 4K5XA 5K36G 1VQIA 1H9MA 3KJOA 4L5RC 5GAHC 3P20A 2MFIA 4HSVA 5I2YA 1HZAA 3D31A 1WJJA 1IW7C 3AQQA 3QOLA 1CA5A 1I50B 1V1PB 1PV4A 3RMHA 4GS3A 3HKSA 1RD9D 4KN7C 2BDOA 3NK9A 4DK1A 4IN3A 5E1FA 4DR5L 1X3EA 5M3MB 1XNRQ 4C3JG 5GAEC 1SAPA 5HY6A 4DV0L 3HOZH 4BBSH 1PZJD 1D5ZC 1JQYD 1I4XA 1ZYRC 4R4QA 1TWAB 3T56B 4QUFA 3I70A 1RIPA 4FF3A 2NZ1D 2HHHQ 4Q0FA 4QL5A 1GKHA 1L0WA 1KDAA 2EQSA 1SEBD 3OIQA 3RNUA 1MI2A 3Q6SA 2Z4IA 5LHY1 2PZTA 1JJGA 4GKJQ 4MNOA 3R2IA 4DR1Q 3GD7A 4QIWB 3ICEA 4I7ZC 5C6AA 4NXMQ 1M1KC 1B2TA 2E2HH 3WWVA 1VQAA 1TWHB 5C4XB 3F2UA 2F0PA 3CHBD 3T1YQ 3NSWA 4R4TA 1EYAA 1YNXA 2B2TC 4JC0A 1PHJA 5M3FH 4L6TB 3J7A5 2UXCL 1S3OA 3F1ZA 1YBYA 1DJRD 3M7GA 1JOKA 2NVQH 2DGYA 1CM9A 4UP9A 3GTKH 1SNQA 2O5IC 3Q8DA 2QF7A 1S5DD 5FLXE 5IT9c 1D1KA 3E9IA 5IWAQ 4DV5L 2O5JC 3I4MB 3MXPA 2EZVA 1HQMC 3S1RB 2VZAA 3V96A 4R8IA 3NBHB 4U673 2EVBA 5ELDA 5EKIA 5COYA 5BN4A 5DEHA 4HN7A 2IX3A 3K0XA 3I8ZA 1PZID 2FMMA 1NBWA 4NW2A 1PH6A 1WTPA 1HNWQ 4BWGB 2KCMA 2ALYB 3E0JA 1BO0A 3M4QA 2NVYH 4A3EH 1QZHA 1PTOH 4QGUA 3J81E 1EFWA 2B2WA 2YTXA 4A76A 2QEXA 5BN5A 2XVSA 3S14H 3BYYB 4ID6A 3S1QB 2QDBA 4RHSA 3K5LA 5G3LD 2KQ3A 4BBRH 2OQKA 3AU7A 1YHAA 2HQEA 4NKLA 1VQEA 3PO2B 3U58A 2F4VQ 3I90A 2RF4A 3A0JA 1JOQA 4MTNA 1SFOH 4A4IA 4IUTA 5LMUL 4LFAQ 4C3JB 1BVSA 1HCZA 4DAMA 2MO1A 4B3SL 4NXNL 2UUBQ 4FDBA 3K5MA 4KMUC 1M90C 4WJ3M 3KF8A 1FGBD 3E5SA 3KBGA 3NQTA 5GQOA 2R93B 1VS0A 3FKIH 4C2MB 3E3XA 4KKSA 1C7YA 2L12A 1EIFA 1EOTA 1L0XB 4A3IG 2IWHA 1TQOA 3TS0A 1STGA 5IGGA 3K59A 4BY7H 1MKHA 2X6GA 1LT6D 5CV9A 4DR3L 4BS9A 1PYSB 2WB1B 4DGZA 2SEBD 1SYFA 1FNUA 4YY3Q 5FLMG 3I73A 2K7VA 4NMZA 1EU3A 2HQLA 2RBMA 3GTJB 1DZ1A 2EY2A 5ELNA 1VQGA 2KHIA 2B29A 3GDEA 1QVCA 1PRTD 4BY1G 5M5YB 2K6AA 4B3MQ 3D6CA 1T5EA 4JV5L 1XX8A 2F0IA 2NYZD 2CW0C 2PMZB 1H9KA 1N36L 1J6QA 1AH9A 2X69A 2JK8A 4GN5A 4JOIC 3S1NB 3A8KE 3AB9A 3HOWG 4K8JA 1SNMA 2F0VA 4OEMB 1U4LA 3BG3A 3PIOA 3HOXG 4V0BA 3OPOA 3ND8A 4G4KA 1ASYA 1FNWA 1GUNA 4MHEA 1V9PA 2N8NA 3BDCA 1NR4A 2EY6A 3CU7A 1SE8A 3KLSA 2FHTA 4KJNA 2A74C 1IL2A 1B3AA 2Q2TA 2BE5D 5C4ZA 5CV4A 1HNZL 2VXWA 4KKUA 1TVXA 3HOVG 1I3QH 1I4GA 4C3IG 1CZWA 4X64Q 1PH1A 2Z6KC 1WI5A 2M00A 4E6IA 2E8GA 2KEDA 5JJZA 3S17H 2IW3A 4GKKL 1VMPA 4OWXB 2BOSA 5AJ3L 2QW7A 1SNCA 4HMJA 4GNXB 1KNEA 2SNMA 2ZJRA 4HSPA 1LTID 3TP8A 3MC0B 3D8GA 4HIMA 2WIIB 5DM63 2M2LA 4DUZQ 4JI6Q 3GTPH 1O7ZA 3H6MA 4A3LG 4OGQC 1LTRD 4DXFA 3D6WA 1FYCA 4LF4Q 1PYWD 4UDUC 1BXTA 4PMBA 4OWTB 1G6PA 3CC2A 2ICIA 5I9PA 2WAQB 3WOEA 1OO9B 2F0WA 5E4WC 3GTOB 1X65A 3R3OA 1SE3A 2NVTB 1TWAH 1DD2A 2O2LD 4YCUA 2RDGA 5C4HA 4Z9CB 2X6LA 1T5XD 1A3TA 1AE3A 3RUZA 5JJLA 3K8AA 1HZCA 4RGNA 2HCIA 3S16B 1STAA 3PMFA 1N34Q 4JI0L 4TSSA 4X65L 1QNKA 1FJGQ 1HRJA 4DV4L 4QUCA 1Q12A 1SYBA 4A3IB 3RZOB 4JPBW 4R8NA 3K80C 3CRLC 1RL2A 2RCFA 3SE0A 5J1ZA 4ULLA 2DNCA 3QIAA 1EU4A 3R93A 5M5XB 1XPOA 3EQLC 4DR6Q 2Z9HA 3J80c 1DYQA 1XNQQ 1CK1A 1TY0A 1N33Q 1YNNC 4B3TQ 2YYZA 5EBCA 1NCVA 2D9UA 4PZ6A 4X3UA 4UP8A 3VR5A 3S24A 1MBYA 4R9WA 1PTOD 1LTLA 1WFQA 3PUVA 2PNRC 2KHJA 2JA7G 4YIJA 4GN3B 2QILA 2D5DA 3CCRA 4LF8Q 2UUCQ 1SMYD 1RDPD 2FINB 5K5PA 3HOWB 4JI5L 4Q5VA 3M3YH 1E2WA 4OELB 1HNXQ 2B2VA 3HOXB 2L4NA 4B9WA 3QG1A 1RKNA 3E9HA 1VCIA 2V4DA 3M4OB 3K7AH 5C0XH 2F0QA 5EPJA 1SJED 2ZXOA 5FO7B 4K6DA 2VS1A 3F2BA 2AHOB 4IUPA 3K5NA 2B2TA 3R8BA 1HXYD 2UU9Q 1W6JA 1MIUA 2TMPA 5JEAH 1ENAA 4DV1L 1CTMA 3H94A 1TS4A 4F87A 1SYGA 1FNVA 4LF6Q 1IW7D 2ASBA 3EBEA 5H1SE 1EFID 3CCQA 1W3SA 1Y8PB 3L0OA 4PG3A 4FXDA 1AZPA 2F0OA 3P7JA 2XNAC 1RTNA 2F0LA 1NSNS 4Y7NH 4GLAC 4DAPA 2IX0A 1JE4A 1VMCA 3IFDA 1LACA 1PA6A 1NMGA 4DNRB 3WOFA 3C46A 4XIGS 3T51B 5J39A 1X32A 1AFPA 2JN4A 3QJYA 4DAVA 5KYIA 2HDLA 1ZYRD 1Y69U 1CKMA 2HIXA 4K0KQ 2B2WC 4IFDH 1K73C 1F2ZA 1PRTC 2D2CC 1J5EL 1C4QA 5CV7A 5FO8B 1LT5D 3MFYA 4CDEC 1AN8A 1VQBA 4B08A 1K28A 1X54A 5ELFA 4EQOA 5LMNQ 3CCSA 3JAMi 1Q82C 1PH9A 4ILWA 4P75A 2R93H 4X66Q 2VQEQ 3I4NB 5C5MA 4A3DG 1TXYA 2KA7A 3V2TA 2K32A 1N32Q 3TN2A 1EIGA 4NDXA 2DNEA 3U50C 4JI7L 5IYBH 2IHFA 5IGCA 1BCPB 2PYKA 1VQMA 2JA8H 3MEFA 1UAPA 4A75A 1BBWA 1F9RA 1WTVA 2PPBC 4AIMA 2BE5C 3FRPB 1AZQA 1HPCA 5FLXL 1MGSA 1XMOQ 1MSGA 1WTOA 2ES2A 2HDMA 4IOAA 1X3QA 3H09A 3G6EA 1DCZA 5C4JH 1XPRA 4A3GB 5LL6X 2KCCA 2LXJA 2AKWB 2NWGA 4YWLA 2JA7B 4RCOA 3D3RA 1V43A 3PUYA 3GO5A 4FVMA 5CBAE 1B3QA 5ELBA 3AEVA 3DXJC 1QNUA 1YVCA 1D2BA 3LX0A 1MJCA 3G48A 2VUMG 4U68A 2L11A 1XNRL 1VQ4A 3I2ZA 1STNA 1EEID 4A3KB 4CKCA 1Y1WB 2YTVA 1LT4D 4G7OC 1RHPA 2AQ2B 2HHHL 1K0RA 1RTOA 1EY4A 1A2UA 2JEBI 3NELA 4PMWA 4DNTB 5JAVA 3PIPA 4DR7Q 2XTIA 1EQQA 1DOLA 1LLRD 1GO3E 4JI8Q 2MP1A 1D7QA 4WRDA 4HMIA 4GKJL 5CMDA 3W5OA 1S5CD 4DR1L 3G71A 3CD6A 1AE2A 2R92B 1EYCA 1A63A 3MAQA 3GTGB 3KF6B 1SDFA 4DPGA 1IXRA 4A3MG 5EBDA 1CI3M 3CCEA 1NJIC 1TU2B 3H0GH 3T1YL 1K3BC 4KY6A 5IY0A 3JAML 2K75A 3ULPA 1G6ZA 1U9RA 3KDFB 1Y1VH 3STBC 3IAYA 4JI4Q 2JP1A 4KN4C 3OYYA 3HOUH 2M9VA 4KY7A 1TWCB 3PQIA 2UXDL 5JPMC 2EJMA 3L3OC 2SNSA 1PTOC 3GQBA 4B3RQ 2BH8A 5IYCH 1WD1A 1PLFA 1YIJA 3D4DA 2EXZA 2MGSA 3NTHA 4H13C 4YWKA 4A3DB 3MHBA 1RODA 4HR7B 3UDXA 4J1MA 1Q1BA 2B2UA 3RZOH 2FFKB 4AYBE 5KYLA 4QCLA 4HJ5A 1TT2A 2K28A 2JA6H 2E2IB 1EWIA 2CW0D 1HNWL 2B63B 3QB3A 3Q23A 1STYA 3CF5A 3BZCA 4ABNA 1SROA 4P74A 1JCKB 4OIJA 4WJWA 1HR0Q 4JI1Q 1B50A 5JEAG 1FD7D 4BXXH 4JYAQ 2TSSA 5A2QE 1EY6A 2JE6I 4LJZC 1R9TH 1QILA 3NXWA 1V8QA 3HKZB 3MXGA 1XXGA 2BCOA 3TS2A 3KLRA 1XMQL 3KLSX 4F88A 2H5XA 1JR0D 1DM0B 3QR8A 4KLKA 2EY5A 3PIO3 4DK3C 2QGQA 1DGSA 1ASZA 1GHKA 1O7YA 1OXSC 2VUMB 1HA5A 4AH6A 2Q8TA 3CQZB 3M4PA 3LWUA 1YITA 1JB7A 1EIHA 1EUJA 2D62A 1D6EC 5ELEA 4JBJA 5A35A 1EY8A 3M9BA 1RJTA 1R4QB 3KYHC 2QA4A 1L0YB 1B70B 3K7UC 4ZUJA 4XDXA 4ZYSA 1GD7A 1YJWA 2NVXB 2B2VC 1SYEA 4WJ4A 4LF7Q 2EYLA 3GTQH 4C3HH 2E76C 2AQ1B 3G4SA 3VDYA 4DR4Q 2D0OA 1ESFA 1EL0A 3RLNA 1E2ZA 5CYUA 2XRSD 4GNXA 5IYBG 1B8AA 3SXHA 1X3PA 2NBFA 5CR3A 4A3MB 1EEFD 2L5TA 4DU9A 5CV8A 1VQJA 5T1GA 2E2JB 1KRTA 2ZM6Q 4B3ML 2EPBA 4DFAA 3HS0C 2F0DA 1G2TA 2JA5G 1C9OA 1TWFB 4DV7Q 1LV9A 3I72A 3T13A 3MTSA 3W3AA 1H95A 3E6ZX 4DAYB 1G91A 1PFSA 5KIXA 1VQDA 3GTMB 2I0QA 5FJ8G 1A6XA 2OTJA 1A3UA 1U4PA 1NY4A 3I91A 1TWGB 3S9WA 2EYFA 1E0BA 1EY9A 4FO2A 1Z6HA 1A2TA 3NEMA 1R4PB 3KFUA 3A8JE 4ZQ3A 4A3FG 2VW9A 2RSOA 1YNND 1QG7A 1KAWA 2EYJA 1NE3A 3S1MB 3V05A 1HA6A 2Z6BA 2NB0A 3HP3A 4KD4A 2ICEC 3CPFA 2Y0SE 3SVMA 3H91A 1LTSD 1B9NA 2CH4W 4O2DA 5C3EG 5I2XA 1ESRA 5IE8A 4HIOA 1EQRA 1SN8A 4DUYQ 2ATWA 1CA6A 1UE6A 4DA2A 4QF4A 4KHZA 4YHHQ 5M5WB 5EQ0A 1SSOA 2F3IA 5C5LA 3OMGA 2HIVA 4EGVA 3BDLA 4PZ8A 2YU9B 1IBKL 1ENFA 2K5DA 4CGYB 4KY5A 1PXUA 4YCVA 4HAEA 5C3WA 4ZLTF 2EDGA 2KENA 4FXGC 4A3BH 2PQAA 3OTOQ 1WTWA 1XPUA 1P16A 1O7IA 1V1QA 4A93G 4DUZL 4IPDA 1K8AC 1Q1EA 2CWPA 2MJ8A 2LXKA 4OL7A 1PVOA 3MXNA 4UAIA 5I9OA 5DM73 2KOLA 3ERQA 4KV6A 3JAME 4GN4B 2N49A 3H0GG 5IP7G 1O78A 4CJ1B 2K1BA 4DK0A 3PUXA 3QO2A 1OXTA 3VYRA 3PV0A 5IYDH 4DN4M 3CMAA 2BDNA 1UE7A 2F0FA 2WKCA 3OMCA 4EVOA 1J8IA 2R7ZG 1S5BD 2WKDA 3VYSA 3C1EA 2EJGC 1XTDA 4A3JH 1N34L 1U0LA 1IYUA 3HOYH 5J22A 3W1GA 5GADC 1FJGL 2R92H 5JJIA 2RDHA 1VQ7A 3S2HB 2L9HA 1N8RC 1ICWA 3H3VC 2A6HC 1PFBA 2NN6G 2ZT9C 3R2TA 1FGUA 1WD0A 2E2DC 5C44G 4OO1H 1O80A 4K5VA 4DR6L 1Q8KA 5EGTA 3VR6A 1XNQL 4OONA 4OX9Q 5IGFA 1KABA 5FKAC 1UE1A 1HH2P 1SYCA 4GOPA 2HUGA 4L8JA 4DV6Q 3I3CA 3NPPA 4APVA 3L2PA 4LF5L 1WCMH 3K5OA 3PO3H 1IYVA 1IBMQ 3NUCA 4IZ8A 4R4CA 3VR2A 1IYJB 4IO9A 2I07B 3L7ZC 2UUCL 1M8AA 3TRZA 4R1JA 3CPWA 4QQBX 3T16A 2B2YA 1MSHA 2EE1A 2SDFA 4IUUA 1HNXL 1CFMA 1EOVA 1M4VA 4JI3Q 2F0TA 3IL8A 3MEHA 2A6EC 2NZHA 1F77A 5D3IB 4A3FB 3FPUB 3J7AV 1TS2A 3HOZG 3P1HA 4BBSG 4KJOA 1SXTA 4LMQD 1BF4A 4I7AA 2UU9L 2VB2X 1PH4A 1TIID 2IHEA 2B63H 5I6YA 1H9JA 3J80i 1WYDA 1C48A 5C3EB 1QE6A 3CAMA 1ET6A 2CH4A 1I50H 2CWAA 1CKNA 4HJ8A 1FR3A 2B2UC 3RR5A 1HUNA 2K5HA 4OHJA 1HZBA 3M85A 4CDFC 4KK7A 1EYDA 5M3MH 4IPCA 1Q90A 1PDQA 2GA4B 2F0UA 3VA7A 1A15A 4J6HA 3EA6A 1VQFA 4A93B 2C35B 2DJGC 1TS3A 5M3FG 4KTAA 1E2VA 1VQHA 1A0IA 2PNHA 4IPGA 1I6VC 3TDQA 1EWCA 4FXKC 1KDBA 4XQJA 1I4HA 4P2CB 1PH3A 5LMUQ 4TVAB 3CC4A 5DNFA 3NBIA 5BR8Q 2CKZB 2IPKD 3K81C 2AMCB 1KC8C 2Z1CA 4PMCA 4B3SQ 2J7ZA 4HJ7A 2N88A 2J4XA 3D4RA 2F1MA 1GUOA 1Q81C 5C0XI 1GVPA 2R7ZB 5IP9H 2QDLA 1ILPA 1TWHH 1QUQA 3I7FA 3C2PA 5C4XH 2RDFA 3SDZA 4UHVA 4ODGA 2RQXA 3PIP3 1IBLQ 2WFWA 3U9OA 1C0AA 2O4XA 2PI2E 4ME3A 3DWPA 3STBD 2F3WA 1VF5C 3T1HL 4DR3Q 2OEOA 3RZDB 3DUZA 4YCWA 2KUMA 3BJUA 1VQ8A 1L1OA 5C44B 5I6WA 1XMOL 4BY1B 4X62Q 1U4RA 4K2KA 3I55A 5IT9E 3PGZA 3S15B 1PRTB 2ZTCA 3I4MH 4A3EG 4V190 2R7FA 4N8X1 3S1RH 2CVRA 1TWFH 5T1IA 3TP6A 1K8GA 3G7LA 1YHBA 3KDFA 1QVFA 2RHQB 1H9SB 1Z7TA 3DEOA 3PUWA 4L63B 2ZTEA 4JK1C 3H3VH 3Q22A 2QCPX 3JC66 4QIWE 2XIWA 4GNXC 3OWEB 3KOJA 1W2BA 4IFDI 4A3BG 3MXUA 4BBRG 3J80L 5FO9B 1F2YA 3MFGA 2DY7A 1II3A 3GV6A 2BA0A 3UE0A 3HOVB 1I6HB 1JJ2A 1WVLA 1EIYB 4C3IB 4LFCL 1CSQA 1HNZQ 3OSOA 2RSNA 1F9SA 3HOZB 1I5FA 3KF8B 4BBSB 4QY7A 4JG2A 5A2QL 3EN2A 5K36H 2K4KA 2A19A 4DR7L 1VQCA 3FKIG 4JI8L 1K8OA 3Q24A 4KI0A 3S1QH 2B8FA 5L37A 1E24A 3E0EA 5DLQE 4R4IA 5CC4A 2HT1A 3HEJA 4BY7G 1XYIA 2OXPA 4A3JG 4J8QA 5AJ3Q 3SK6A 1V1PA 1JT8A 4KHVA 3PO2H 2PO4A 1QWYA 2RCNA 3KUPA 4P72A 4DR2Q 1ML0D 2PI2A 4JBWA 1ET9A 1LT3D 2E2HB 3ERSX 2A5HA 2KBNA 4X6AH 4C3JH 4K6LA 4K2LA 4OO1G 1TY2A 4JI4L 4RGMA 1C8CA 2R6GA 3KLWA 5M3FB 1SE4A 3TBIB 4C2MH 2FMCA 2NVQB 1KAAA 3GTKB 1QVGA 1NUCA 4PNYA 5FLXc 4B3RL 3ONAB 3MZ5A 5KNBA 2F0EA 4IOCA 5CGKA 1ONLA 4CJ0B 3I4OA 3A5ZB 4UPAA 4IJLA 4N8FA 1JOOA 1UUPA 2ZXPA 2F0NA 1GHJA 2G9DA 1PZKD 1E22A 3SK4A 3GTJH 3J7ZC
chains in the Genus database with same CATH topology
4BXXH 4JYAQ 5M5YH 2RF4A 3I4NG 2NZOA 3A0JA 4KHPL 4MTNA 3F8TA 1SFOH 4A4IA 2JE6I 2K50A 5LMUL 4LFAQ 1BVSA 4O0AA 4POFA 1R9TH 1E1OA 4DAMA 2MO1A 4NB3A 2AWNA 4B3SL 4NXNL 5LMNW 2UUBQ 1UWVA 4FDBA 3HKZE 3TS2A 1M90C 4A3MH 1XMQL 3S1NH 2ID0A 1VQ5A 4WJ3M 4JI1L 4GLVB 2H5XA 1SMXA 4LF9Q 5GQOA 1VS0A 3KF6A 3FKIH 4KLKA 2E2JH 1OXVA 3ULJA 3J81c 1C7YA 4DK3C 2QGQA 3DLLA 1DGSA 1ASZA 5JJKA 4EQ5A 2F4VQ 1EIFA 1A8VA 1OXSC 4A3IG 3TEHB 1KQSA 3TS0A 3CCMA 1K3RA 4BY7H 3CCVA 1MKHA 4JV5Q 4GLXA 1XJVA 4DR3L 1VQOA 4AH6A 1PYSB 2VY3A 3M4PA 1YITA 1JB7A 4IJHA 3GTMH 1EUJA 2D62A 2WB1E 1N36Q 4YY3Q 3KJPA 4JI5Q 4JBJA 5FLMG 5EAYA 4LF9L 3M9BA 4RMFA 2LSSA 3U4VA 3RN5A 4A3GG 1Q86C 1TWGH 3KYHC 2MNAA 2PQAB 2QA4A 1B70B 2HQLA 3K7UC 1GD7A 1YJWA 4P73A 2A8VA 4WJ4A 1G291 4LF7Q 2FXQA 5ELNA 1PH5A 1VQGA 2KHIA 2B29A 3GDEA 1QVCA 3IRBA 4BY1G 4C3HH 4GOPC 1GM5A 4LF5Q 3GTQH 4B3MQ 3G4SA 3VDYA 1B7YB 4YWMA 4DR4Q 2D0OA 4JV5L 1UE5A 2NN6I 1D8LA 4L5SA 2N78A 3S1MH 3MXNB 3RLNA 4IPHA 4UY8C 2PMZE 3F2CA 1N36L 4GNXA 2YTYA 3I56A 5IYBG 1J6QA 1B8AA 1FL0A 4DV1Q 1KD1C 1BKBA 1AH9A 4NXML 2JK8A 4GN5A 4JOIC 3HOWG 4JBKA 1VQJA 2ZJQA 1E3PA 4LF7L 2RHSB 1KRTA 3PIOA 3HOXG 3CCUA 4A3KG 4UP7A 4Y52H 2ZM6Q 5HGQA 2JJQA 4B3ML 1Y1WG 4DR4L 1ASYA 5IYDG 2VL6A 1YJNA 1V9PA 2N8NA 5ELOA 5M5WH 5IP9G 2JA5G 1C9OA 1SE8A 4DV7Q 2OCEA 3RLFA 3U58A 2YU9H 4GKKQ 5C4XG 4AQYQ 1H95A 2OQ0A 1IL2A 2Q2HA 4QJFA 4DAYB 4DV3Q 1PFSA 1VQDA 1VQPA 1HJPA 2Q2TA 2I0QA 1HNZL 5FJ8G 3GTOH 2NVTH 2OTJA 3HOYG 3HOVG 1NY4A 1I3QH 2R92G 5IWAL 2ZM6L 4X64Q 1PH1A 1KHIA 2Z6KC 1KRSA 4H02A 3J81i 3NEMA 3KFUA 1WI5A 3AFQA 4A3FG 2E8GA 2AWOA 2VW9A 5C0XJ 4DV7L 3S17H 3S16H 3DM3A 1KAWA 4AQYL 1NE3A 3I4MG 4GKKL 4DV3L 1QZGA 1SLJA 4OWXB 3ZJYC 5AJ3L 3PF4A 4GNXB 3ER0A 1MJEA 3EIVA 3CPFA 2Y0SE 2ZJRA 4A3IH 4LFBQ 5JEAJ 4LUOA 4O2DA 1EYGA 4GOPB 5C3EG 4HIDA 4TQUS 2ZJPA 1YI2A 5IE8A 4HIOA 1EQRA 4HIMA 3CCLA 1SN8A 3AFPA 4DUYQ 2ATWA 5M5XH 4DUZQ 1UE6A 4JI6Q 3GTPH 4A3LG 4LW1A 4LF4Q 5C0XG 4KHZA 1WCMG 4YHHQ 5FLMH 4JI7Q 4POGA 2IX1A 2GVBA 3PO3G 4NPSA 2F3IA 3A74A 1PH2A 2HIVA 4PZ8A 4OWTB 1IBKL 1G6PA 4P71A 3S2HH 1LM0A 2WP8J 3CC2A 4JI0Q 1KXLA 4A3CH 4X65Q 4YCVA 4MZ9A 2OTLA 2KENA 4A3BH 4LFBL 2PQAA 2WAQE 3OTOQ 1X65A 4DV4Q 1XPUA 1TWAH 1P16A 4YCUA 1O7IA 4DUYL 1V1QA 4A93G 1IZ6A 4IPDA 4L5TA 4DUZL 1K8AC 2Z0SA 1Q1EA 1S72A 1AE3A 1LYLA 2CWPA 2LXKA 4DK6C 4YHHL 5JJLA 3K8AA 1PVOA 2I5MX 1HZCA 2JQOA 2Q2IA 4DNIA 4J15A 2UUAQ 4GN4B 2K5NA 3HOWH 1N34Q 4IFDJ 4JI0L 2N49A 3H0GG 3CCJA 4X65L 5IP7G 2A1AA 3T1HQ 1FJGQ 3HOXH 2B63G 3PUXA 3OTOL 1HR0L 1OXTA 4DV4L 3CW2C 1Q12A 3PV0A 1VQ9A 5IYDH 2F4VL 3M4OH 3BU2A 3CMAA 4JYAL 3K80C 1X3FA 1UE7A 1L1OC 1RL2A 2JA5H 1CKNB 3PCOB 3D0FA 4OWWB 4LFAL 2R7ZG 3PO2G 1XPOA 4DR6Q 2UUAL 4RG1A 3J80c 5FJ8H 1XTDA 4A3JH 1N34L 1U0LA 1XNQQ 2UUBL 1N33Q 3HOYH 4IFDG 2E5LQ 4B3TQ 3HOVH 2YYZA 3W1GA 3SGIA 5GADC 1FJGL 1VQNA 4C3IH 2R92H 1I6HH 4PZ6A 1LUZA 5JJIA 2CQOA 4DV2Q 4UP8A 1HR0W 1VQ7A 3CC7A 4JCVE 3W1BA 3S24A 5M3MG 3HKZG 1N8RC 4JI2Q 2NN6G 2EIFA 3PSIA 1FGUA 1Z47A 4A3FH 1LTLA 1WFQA 1X56A 2EXDA 3PUVA 4DKAC 2KHJA 5C44G 2JA7G 1NMFA 2R93G 4GN3B 4DR6L 1NTGA 1Q8KA 1PH7A 2GVAA 3B6YA 4OXPA 3CCRA 4LF8Q 1SRUA 2UUCQ 1XNQL 1I94Q 2E5LL 2N3SA 4L5QA 4OONA 4XTCS 4OX9Q 3JAMc 4YY3L 4DV2L 4JI5L 5C3EH 3M3YH 1UE1A 1HH2P 1HNXQ 4JI2L 1X3GA 1PYBA 2V1CC 2WB1G 2JA8G 4LFCQ 1CUKA 1Z9FA 4GOPA 4DV6Q 1OTCA 3E9HA 2I5HA 4A3LH 1VCIA 4APVA 3L2PA 3K7AH 2BA1A 1WCMH 4LF5L 3UE1A 2OWOA 2VS1A 3PO3H 3F2BA 2AHOB 1IBMQ 4LUZA 4R4CA 1QUQB 2JEAI 1IYJB 2K5VA 4IO9A 3L7ZC 2UUCL 1I94L 1PH8A 3TRZA 2YV5A 2UU9Q 1MIUA 4R1JA 2MO0A 3CPWA 4OX9L 1YJ9A 4QQBX 4JOIA 1G51A 4DV1L 1WOCA 1HNXL 1EOVA 3TQYA 4LF6Q 3FP9A 3HFZB 4JI3Q 3EBEA 2ASBA 1U5KA 5H1SE 3CCQA 4DV6L 1YEZA 1W3SA 3FHWA 1L1OB 3PUZA 3PF5A 4ALPA 3L0OA 4PG3A 2NZHA 2ZTDA 4BA1I 1N9WA 3M7NA 2UXBQ 2UXDQ 1UEBA 3A5UA 1IBML 1JJCB 2IT1A 3AYHB 3HOZG 4Y7NH 4GLAC 4BBSG 2UU9L 2IX0A 5IP7H 1PH4A 2VQFQ 2IHEA 2B63H 1OXXK 1L2FA 1J5EQ 1PA6A 1K83H 1NMGA 2F52A 3J80i 1WYDA 4XIGS 4JI3L 2K52A 2Z6KA 3CAMA 1SR3A 2UXBL 1I50H 2CWAA 4X64L 2R7ZH 1CKNA 1CKOA 2I5LX 4HJ8A 2D0PA 3LGJA 2VNUD 1S40A 1CKMA 2HIXA 3BZKA 3RR5A 4K0KQ 2K5HA 3J81j 1K73C 1HZBA 2VQFL 3M85A 4PZ7A 4LNQA 2Q2UA 1J5EL 2XGTA 5M3MH 2CCZA 4IPCA 1VQBA 4A3GH 1Y14B 3RZDH 1VQKA 1X54A 3CXCA 1Q7YC 1P8LA 1YHQA 5LMNQ 5C44H 3JAMi 1JE5A 3CCSA 1Q82C 4P75A 1PH9A 2JA7H 4BY1H 2R93H 1VQFA 4X66Q 2VQEQ 2C35B 1X9NA 1TXYA 4A3DG 2L15A 1N32Q 4OO1I 5M3FG 1HZ9A 2MQHA 4EX5A 1KL9A 3S15H 4AYBG 1BBUA 1VQHA 1A0IA 4JI6L 2PNHA 4IPGA 3U50C 3F2DA 4LF4L 4KHPQ 4JI7L 2CFMA 5IYBH 2IHFA 1PH3A 5LMUQ 5K36G 1VQIA 4TVAB 2KCTA 5GROA 3KJOA 3CC4A 5GAHC 4L5RC 1VQMA 5BR8Q 2JA8H 2CKZB 3MEFA 3K81C 2AMCB 3CP0A 5J3BA 4A75A 1BBWA 1KC8C 4DR5Q 4B3SQ 4HJAA 2MFIA 4HJ7A 3UDGA 4A3KH 1HZAA 3D31A 4AIMA 3TREA 1WJJA 1Y1WH 1XMQQ 3RN2A 1Q81C 5C0XI 1A62A 4DV0Q 1Y1VG 3AQQA 4R4OA 1VQLA 1GVPA 1XMOQ 2WAQG 1PV4A 1X6OA 5IP9H 4GS3A 3HKSA 1TWHH 1QUQA 3I7FA 5C4XH 2ES2A 3HOUG 4IOAA 1IBLQ 2WFWA 1C0AA 2PI2E 3G6EA 5C4JH 3I4NH 4ME3A 5BR8L 3STBD 1XPRA 3U4ZA 4DR5L 1X3EA 3T1HL 4DR3Q 1XNRQ 2LXJA 4YCWA 3BJUA 5IYCG 1VQ8A 4BA2I 5GAEC 1L1OA 2AKWB 5HY6A 4DV0L 1KIXA 4YWLA 3GTLH 3HOZH 4BBSH 1XMOL 3GTGH 4A93H 4X62Q 3I55A 4R4QA 5E7NA 1V43A 3PGZA 3PUYA 1VQ6A 3GO5A 2ZTCA 3I4MH 1IBLL 1RIPA 4A3EG 3AEVA 2HHHQ 2R7FA 4QL5A 1GKHA 1YVCA 3S1RH 1L0WA 1TWFH 2EQSA 1MJCA 5GAGC 1K8GA 3G48A 1N33L 1YHBA 3KDFA 3RNUA 1QVFA 4B3TL 2JA6G 2RHQB 1XNRL 2VUMG 1JJGA 1VQ4A 3I2ZA 3PUWA 2ZTEA 3H3VH 4MNOA 4GKJQ 4DR1Q 3GD7A 3ICEA 1TWCH 4X62L 4HJ9A 3JC66 4NXMQ 2UXCQ 1M1KC 4QIWE 4GNXC 3RLOA 2YTVA 3KOJA 1W2BA 4A3CG 4IFDI 4A3BG 2E2HH 3WWVA 4BBRG 1K0RA 1VQAA 2HHHL 4DV5Q 3NELA 4PMWA 2JEBI 3S2DH 2IY5B 4LF8L 3PIPA 4DR7Q 2XTIA 1EQQA 1GO3E 4JI8Q 3T1YQ 1OXUA 4BXXG 4R4TA 1CSPA 1YNXA 1D7QA 2BA0A 4GKJL 3W5OA 4A3DH 3UE0A 4JC0A 4DR1L 3G71A 5M3FH 1PHJA 1AE2A 1JJ2A 3CD6A 1EIYB 3J7A5 2UXCL 1S3OA 4LFCL 1CSQA 3F1ZA 1HNZQ 1YBYA 4HIKA 1A63A 3UDFA 2NVQH 2DGYA 1I5FA 3KF8B 4UP9A 4QY7A 4JG2A 3GTKH 3EN2A 3KF6B 3Q8DA 4DPGA 1IXRA 3E9IA 2GN5A 5IT9c 5IWAQ 4DV5L 3CCEA 4A3MG 1NJIC 2E2IH 2K4KA 2A19A 4DR7L 1VQCA 3H0GH 3FKIG 4LUVA 4JI8L 3T1YL 2DUDA 5IY0A 3ULPA 4KI0A 2K75A 3S1QH 1E24A 2VZAA 3E0EA 5DLQE 4R4IA 3KDFB 1Y1VH 3NBHB 3STBC 4JI4Q 2HT1A 4LF6L 1E1TA 3OW2A 4BY7G 3OYYA 4A3JG 5AJ3Q 3HOUH 2UXDL 1YZ6A 1JT8A 3PO2H 1T9HA 3UDIA 2RCNA 2R7DA 4P72A 3CMEA 4DR2Q 2PI2A 4JBWA 1FVIA 3K0XA 3ERSX 2KBNA 4B3RQ 4X6AH 4C3JH 2BH8A 1NBWA 1PH6A 5IYCH 1YIJA 1HNWQ 3NENA 4OO1G 4JI4L 1E7ZA 2KCMA 2ALYB 4YWKA 2R6GA 1X55A 2B3GA 1IBKQ 3KLWA 3UDXA 3M4QA 1Q1BA 2NVYH 4A3EH 1QZHA 2JA9A 4LWCA 4C2MH 4QGUA 1EFWA 3RZOH 2YTXA 4AYBE 4DR2L 2Y0SG 4A76A 2QEXA 4HJ5A 1JMCA 1QVGA 4K0KL 2JA6H 5FLXc 2VUMH 4B3RL 3ULLA 1EWIA 4JBMA 3S14H 1Q46A 1HNWL 4IOCA 2BH2A 3I4OA 3A5ZB 3H3VI 4UPAA 3CQZH 4IJLA 3CF5A 5LMNL 3BZCA 4NXNQ 1SROA 4P74A 2K14A 4X66L 2VQEL 4BBRH 2OQKA 1N32L 1K9MC 1HR0Q 4JI1Q 2NVXH 1YHAA 5JEAG 3H15A 1E22A 3GTJH 1VQEA 3J7ZC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BXX H;  4JYA Q;  5M5Y H;  2RF4 A;  3I4N G;  2NZO A;  3A0J A;  4KHP L;  4MTN A;  3F8T A;  1SFO H;  4A4I A;  2JE6 I;  2K50 A;  5LMU L;  4LFA Q;  1BVS A;  4O0A A;  4POF A;  1R9T H;  1E1O A;  4DAM A;  2MO1 A;  4NB3 A;  2AWN A;  4B3S L;  4NXN L;  5LMN W;  2UUB Q;  1UWV A;  4FDB A;  3HKZ E;  3TS2 A;  1M90 C;  4A3M H;  1XMQ L;  3S1N H;  2ID0 A;  1VQ5 A;  4WJ3 M;  4JI1 L;  4GLV B;  2H5X A;  1SMX A;  4LF9 Q;  5GQO A;  1VS0 A;  3KF6 A;  3FKI H;  4KLK A;  2E2J H;  1OXV A;  3ULJ A;  3J81 c;  1C7Y A;  4DK3 C;  2QGQ A;  3DLL A;  1DGS A;  1ASZ A;  5JJK A;  4EQ5 A;  2F4V Q;  1EIF A;  1A8V A;  1OXS C;  4A3I G;  3TEH B;  1KQS A;  3TS0 A;  3CCM A;  1K3R A;  4BY7 H;  3CCV A;  1MKH A;  4JV5 Q;  4GLX A;  1XJV A;  4DR3 L;  1VQO A;  4AH6 A;  1PYS B;  2VY3 A;  3M4P A;  1YIT A;  1JB7 A;  4IJH A;  3GTM H;  1EUJ A;  2D62 A;  2WB1 E;  1N36 Q;  4YY3 Q;  3KJP A;  4JI5 Q;  4JBJ A;  5FLM G;  5EAY A;  4LF9 L;  3M9B A;  4RMF A;  2LSS A;  3U4V A;  3RN5 A;  4A3G G;  1Q86 C;  1TWG H;  3KYH C;  2MNA A;  2PQA B;  2QA4 A;  1B70 B;  2HQL A;  3K7U C;  1GD7 A;  1YJW A;  4P73 A;  2A8V A;  4WJ4 A;  1G29 1;  4LF7 Q;  2FXQ A;  5ELN A;  1PH5 A;  1VQG A;  2KHI A;  2B29 A;  3GDE A;  1QVC A;  3IRB A;  4BY1 G;  4C3H H;  4GOP C;  1GM5 A;  4LF5 Q;  3GTQ H;  4B3M Q;  3G4S A;  3VDY A;  1B7Y B;  4YWM A;  4DR4 Q;  2D0O A;  4JV5 L;  1UE5 A;  2NN6 I;  1D8L A;  4L5S A;  2N78 A;  3S1M H;  3MXN B;  3RLN A;  4IPH A;  4UY8 C;  2PMZ E;  3F2C A;  1N36 L;  4GNX A;  2YTY A;  3I56 A;  5IYB G;  1J6Q A;  1B8A A;  1FL0 A;  4DV1 Q;  1KD1 C;  1BKB A;  1AH9 A;  4NXM L;  2JK8 A;  4GN5 A;  4JOI C;  3HOW G;  4JBK A;  1VQJ A;  2ZJQ A;  1E3P A;  4LF7 L;  2RHS B;  1KRT A;  3PIO A;  3HOX G;  3CCU A;  4A3K G;  4UP7 A;  4Y52 H;  2ZM6 Q;  5HGQ A;  2JJQ A;  4B3M L;  1Y1W G;  4DR4 L;  1ASY A;  5IYD G;  2VL6 A;  1YJN A;  1V9P A;  2N8N A;  5ELO A;  5M5W H;  5IP9 G;  2JA5 G;  1C9O A;  1SE8 A;  4DV7 Q;  2OCE A;  3RLF A;  3U58 A;  2YU9 H;  4GKK Q;  5C4X G;  4AQY Q;  1H95 A;  2OQ0 A;  1IL2 A;  2Q2H A;  4QJF A;  4DAY B;  4DV3 Q;  1PFS A;  1VQD A;  1VQP A;  1HJP A;  2Q2T A;  2I0Q A;  1HNZ L;  5FJ8 G;  3GTO H;  2NVT H;  2OTJ A;  3HOY G;  3HOV G;  1NY4 A;  1I3Q H;  2R92 G;  5IWA L;  2ZM6 L;  4X64 Q;  1PH1 A;  1KHI A;  2Z6K C;  1KRS A;  4H02 A;  3J81 i;  3NEM A;  3KFU A;  1WI5 A;  3AFQ A;  4A3F G;  2E8G A;  2AWO A;  2VW9 A;  5C0X J;  4DV7 L;  3S17 H;  3S16 H;  3DM3 A;  1KAW A;  4AQY L;  1NE3 A;  3I4M G;  4GKK L;  4DV3 L;  1QZG A;  1SLJ A;  4OWX B;  3ZJY C;  5AJ3 L;  3PF4 A;  4GNX B;  3ER0 A;  1MJE A;  3EIV A;  3CPF A;  2Y0S E;  2ZJR A;  4A3I H;  4LFB Q;  5JEA J;  4LUO A;  4O2D A;  1EYG A;  4GOP B;  5C3E G;  4HID A;  4TQU S;  2ZJP A;  1YI2 A;  5IE8 A;  4HIO A;  1EQR A;  4HIM A;  3CCL A;  1SN8 A;  3AFP A;  4DUY Q;  2ATW A;  5M5X H;  4DUZ Q;  1UE6 A;  4JI6 Q;  3GTP H;  4A3L G;  4LW1 A;  4LF4 Q;  5C0X G;  4KHZ A;  1WCM G;  4YHH Q;  5FLM H;  4JI7 Q;  4POG A;  2IX1 A;  2GVB A;  3PO3 G;  4NPS A;  2F3I A;  3A74 A;  1PH2 A;  2HIV A;  4PZ8 A;  4OWT B;  1IBK L;  1G6P A;  4P71 A;  3S2H H;  1LM0 A;  2WP8 J;  3CC2 A;  4JI0 Q;  1KXL A;  4A3C H;  4X65 Q;  4YCV A;  4MZ9 A;  2OTL A;  2KEN A;  4A3B H;  4LFB L;  2PQA A;  2WAQ E;  3OTO Q;  1X65 A;  4DV4 Q;  1XPU A;  1TWA H;  1P16 A;  4YCU A;  1O7I A;  4DUY L;  1V1Q A;  4A93 G;  1IZ6 A;  4IPD A;  4L5T A;  4DUZ L;  1K8A C;  2Z0S A;  1Q1E A;  1S72 A;  1AE3 A;  1LYL A;  2CWP A;  2LXK A;  4DK6 C;  4YHH L;  5JJL A;  3K8A A;  1PVO A;  2I5M X;  1HZC A;  2JQO A;  2Q2I A;  4DNI A;  4J15 A;  2UUA Q;  4GN4 B;  2K5N A;  3HOW H;  1N34 Q;  4IFD J;  4JI0 L;  2N49 A;  3H0G G;  3CCJ A;  4X65 L;  5IP7 G;  2A1A A;  3T1H Q;  1FJG Q;  3HOX H;  2B63 G;  3PUX A;  3OTO L;  1HR0 L;  1OXT A;  4DV4 L;  3CW2 C;  1Q12 A;  3PV0 A;  1VQ9 A;  5IYD H;  2F4V L;  3M4O H;  3BU2 A;  3CMA A;  4JYA L;  3K80 C;  1X3F A;  1UE7 A;  1L1O C;  1RL2 A;  2JA5 H;  1CKN B;  3PCO B;  3D0F A;  4OWW B;  4LFA L;  2R7Z G;  3PO2 G;  1XPO A;  4DR6 Q;  2UUA L;  4RG1 A;  3J80 c;  5FJ8 H;  1XTD A;  4A3J H;  1N34 L;  1U0L A;  1XNQ Q;  2UUB L;  1N33 Q;  3HOY H;  4IFD G;  2E5L Q;  4B3T Q;  3HOV H;  2YYZ A;  3W1G A;  3SGI A;  5GAD C;  1FJG L;  1VQN A;  4C3I H;  2R92 H;  1I6H H;  4PZ6 A;  1LUZ A;  5JJI A;  2CQO A;  4DV2 Q;  4UP8 A;  1HR0 W;  1VQ7 A;  3CC7 A;  4JCV E;  3W1B A;  3S24 A;  5M3M G;  3HKZ G;  1N8R C;  4JI2 Q;  2NN6 G;  2EIF A;  3PSI A;  1FGU A;  1Z47 A;  4A3F H;  1LTL A;  1WFQ A;  1X56 A;  2EXD A;  3PUV A;  4DKA C;  2KHJ A;  5C44 G;  2JA7 G;  1NMF A;  2R93 G;  4GN3 B;  4DR6 L;  1NTG A;  1Q8K A;  1PH7 A;  2GVA A;  3B6Y A;  4OXP A;  3CCR A;  4LF8 Q;  1SRU A;  2UUC Q;  1XNQ L;  1I94 Q;  2E5L L;  2N3S A;  4L5Q A;  4OON A;  4XTC S;  4OX9 Q;  3JAM c;  4YY3 L;  4DV2 L;  4JI5 L;  5C3E H;  3M3Y H;  1UE1 A;  1HH2 P;  1HNX Q;  4JI2 L;  1X3G A;  1PYB A;  2V1C C;  2WB1 G;  2JA8 G;  4LFC Q;  1CUK A;  1Z9F A;  4GOP A;  4DV6 Q;  1OTC A;  3E9H A;  2I5H A;  4A3L H;  1VCI A;  4APV A;  3L2P A;  3K7A H;  2BA1 A;  1WCM H;  4LF5 L;  3UE1 A;  2OWO A;  2VS1 A;  3PO3 H;  3F2B A;  2AHO B;  1IBM Q;  4LUZ A;  4R4C A;  1QUQ B;  2JEA I;  1IYJ B;  2K5V A;  4IO9 A;  3L7Z C;  2UUC L;  1I94 L;  1PH8 A;  3TRZ A;  2YV5 A;  2UU9 Q;  1MIU A;  4R1J A;  2MO0 A;  3CPW A;  4OX9 L;  1YJ9 A;  4QQB X;  4JOI A;  1G51 A;  4DV1 L;  1WOC A;  1HNX L;  1EOV A;  3TQY A;  4LF6 Q;  3FP9 A;  3HFZ B;  4JI3 Q;  3EBE A;  2ASB A;  1U5K A;  5H1S E;  3CCQ A;  4DV6 L;  1YEZ A;  1W3S A;  3FHW A;  1L1O B;  3PUZ A;  3PF5 A;  4ALP A;  3L0O A;  4PG3 A;  2NZH A;  2ZTD A;  4BA1 I;  1N9W A;  3M7N A;  2UXB Q;  2UXD Q;  1UEB A;  3A5U A;  1IBM L;  1JJC B;  2IT1 A;  3AYH B;  3HOZ G;  4Y7N H;  4GLA C;  4BBS G;  2UU9 L;  2IX0 A;  5IP7 H;  1PH4 A;  2VQF Q;  2IHE A;  2B63 H;  1OXX K;  1L2F A;  1J5E Q;  1PA6 A;  1K83 H;  1NMG A;  2F52 A;  3J80 i;  1WYD A;  4XIG S;  4JI3 L;  2K52 A;  2Z6K A;  3CAM A;  1SR3 A;  2UXB L;  1I50 H;  2CWA A;  4X64 L;  2R7Z H;  1CKN A;  1CKO A;  2I5L X;  4HJ8 A;  2D0P A;  3LGJ A;  2VNU D;  1S40 A;  1CKM A;  2HIX A;  3BZK A;  3RR5 A;  4K0K Q;  2K5H A;  3J81 j;  1K73 C;  1HZB A;  2VQF L;  3M85 A;  4PZ7 A;  4LNQ A;  2Q2U A;  1J5E L;  2XGT A;  5M3M H;  2CCZ A;  4IPC A;  1VQB A;  4A3G H;  1Y14 B;  3RZD H;  1VQK A;  1X54 A;  3CXC A;  1Q7Y C;  1P8L A;  1YHQ A;  5LMN Q;  5C44 H;  3JAM i;  1JE5 A;  3CCS A;  1Q82 C;  4P75 A;  1PH9 A;  2JA7 H;  4BY1 H;  2R93 H;  1VQF A;  4X66 Q;  2VQE Q;  2C35 B;  1X9N A;  1TXY A;  4A3D G;  2L15 A;  1N32 Q;  4OO1 I;  5M3F G;  1HZ9 A;  2MQH A;  4EX5 A;  1KL9 A;  3S15 H;  4AYB G;  1BBU A;  1VQH A;  1A0I A;  4JI6 L;  2PNH A;  4IPG A;  3U50 C;  3F2D A;  4LF4 L;  4KHP Q;  4JI7 L;  2CFM A;  5IYB H;  2IHF A;  1PH3 A;  5LMU Q;  5K36 G;  1VQI A;  4TVA B;  2KCT A;  5GRO A;  3KJO A;  3CC4 A;  5GAH C;  4L5R C;  1VQM A;  5BR8 Q;  2JA8 H;  2CKZ B;  3MEF A;  3K81 C;  2AMC B;  3CP0 A;  5J3B A;  4A75 A;  1BBW A;  1KC8 C;  4DR5 Q;  4B3S Q;  4HJA A;  2MFI A;  4HJ7 A;  3UDG A;  4A3K H;  1HZA A;  3D31 A;  4AIM A;  3TRE A;  1WJJ A;  1Y1W H;  1XMQ Q;  3RN2 A;  1Q81 C;  5C0X I;  1A62 A;  4DV0 Q;  1Y1V G;  3AQQ A;  4R4O A;  1VQL A;  1GVP A;  1XMO Q;  2WAQ G;  1PV4 A;  1X6O A;  5IP9 H;  4GS3 A;  3HKS A;  1TWH H;  1QUQ A;  3I7F A;  5C4X H;  2ES2 A;  3HOU G;  4IOA A;  1IBL Q;  2WFW A;  1C0A A;  2PI2 E;  3G6E A;  5C4J H;  3I4N H;  4ME3 A;  5BR8 L;  3STB D;  1XPR A;  3U4Z A;  4DR5 L;  1X3E A;  3T1H L;  4DR3 Q;  1XNR Q;  2LXJ A;  4YCW A;  3BJU A;  5IYC G;  1VQ8 A;  4BA2 I;  5GAE C;  1L1O A;  2AKW B;  5HY6 A;  4DV0 L;  1KIX A;  4YWL A;  3GTL H;  3HOZ H;  4BBS H;  1XMO L;  3GTG H;  4A93 H;  4X62 Q;  3I55 A;  4R4Q A;  5E7N A;  1V43 A;  3PGZ A;  3PUY A;  1VQ6 A;  3GO5 A;  2ZTC A;  3I4M H;  1IBL L;  1RIP A;  4A3E G;  3AEV A;  2HHH Q;  2R7F A;  4QL5 A;  1GKH A;  1YVC A;  3S1R H;  1L0W A;  1TWF H;  2EQS A;  1MJC A;  5GAG C;  1K8G A;  3G48 A;  1N33 L;  1YHB A;  3KDF A;  3RNU A;  1QVF A;  4B3T L;  2JA6 G;  2RHQ B;  1XNR L;  2VUM G;  1JJG A;  1VQ4 A;  3I2Z A;  3PUW A;  2ZTE A;  3H3V H;  4MNO A;  4GKJ Q;  4DR1 Q;  3GD7 A;  3ICE A;  1TWC H;  4X62 L;  4HJ9 A;  3JC6 6;  4NXM Q;  2UXC Q;  1M1K C;  4QIW E;  4GNX C;  3RLO A;  2YTV A;  3KOJ A;  1W2B A;  4A3C G;  4IFD I;  4A3B G;  2E2H H;  3WWV A;  4BBR G;  1K0R A;  1VQA A;  2HHH L;  4DV5 Q;  3NEL A;  4PMW A;  2JEB I;  3S2D H;  2IY5 B;  4LF8 L;  3PIP A;  4DR7 Q;  2XTI A;  1EQQ A;  1GO3 E;  4JI8 Q;  3T1Y Q;  1OXU A;  4BXX G;  4R4T A;  1CSP A;  1YNX A;  1D7Q A;  2BA0 A;  4GKJ L;  3W5O A;  4A3D H;  3UE0 A;  4JC0 A;  4DR1 L;  3G71 A;  5M3F H;  1PHJ A;  1AE2 A;  1JJ2 A;  3CD6 A;  1EIY B;  3J7A 5;  2UXC L;  1S3O A;  4LFC L;  1CSQ A;  3F1Z A;  1HNZ Q;  1YBY A;  4HIK A;  1A63 A;  3UDF A;  2NVQ H;  2DGY A;  1I5F A;  3KF8 B;  4UP9 A;  4QY7 A;  4JG2 A;  3GTK H;  3EN2 A;  3KF6 B;  3Q8D A;  4DPG A;  1IXR A;  3E9I A;  2GN5 A;  5IT9 c;  5IWA Q;  4DV5 L;  3CCE A;  4A3M G;  1NJI C;  2E2I H;  2K4K A;  2A19 A;  4DR7 L;  1VQC A;  3H0G H;  3FKI G;  4LUV A;  4JI8 L;  3T1Y L;  2DUD A;  5IY0 A;  3ULP A;  4KI0 A;  2K75 A;  3S1Q H;  1E24 A;  2VZA A;  3E0E A;  5DLQ E;  4R4I A;  3KDF B;  1Y1V H;  3NBH B;  3STB C;  4JI4 Q;  2HT1 A;  4LF6 L;  1E1T A;  3OW2 A;  4BY7 G;  3OYY A;  4A3J G;  5AJ3 Q;  3HOU H;  2UXD L;  1YZ6 A;  1JT8 A;  3PO2 H;  1T9H A;  3UDI A;  2RCN A;  2R7D A;  4P72 A;  3CME A;  4DR2 Q;  2PI2 A;  4JBW A;  1FVI A;  3K0X A;  3ERS X;  2KBN A;  4B3R Q;  4X6A H;  4C3J H;  2BH8 A;  1NBW A;  1PH6 A;  5IYC H;  1YIJ A;  1HNW Q;  3NEN A;  4OO1 G;  4JI4 L;  1E7Z A;  2KCM A;  2ALY B;  4YWK A;  2R6G A;  1X55 A;  2B3G A;  1IBK Q;  3KLW A;  3UDX A;  3M4Q A;  1Q1B A;  2NVY H;  4A3E H;  1QZH A;  2JA9 A;  4LWC A;  4C2M H;  4QGU A;  1EFW A;  3RZO H;  2YTX A;  4AYB E;  4DR2 L;  2Y0S G;  4A76 A;  2QEX A;  4HJ5 A;  1JMC A;  1QVG A;  4K0K L;  2JA6 H;  5FLX c;  2VUM H;  4B3R L;  3ULL A;  1EWI A;  4JBM A;  3S14 H;  1Q46 A;  1HNW L;  4IOC A;  2BH2 A;  3I4O A;  3A5Z B;  3H3V I;  4UPA A;  3CQZ H;  4IJL A;  3CF5 A;  5LMN L;  3BZC A;  4NXN Q;  1SRO A;  4P74 A;  2K14 A;  4X66 L;  2VQE L;  4BBR H;  2OQK A;  1N32 L;  1K9M C;  1HR0 Q;  4JI1 Q;  2NVX H;  1YHA A;  5JEA G;  3H15 A;  1E22 A;  3GTJ H;  1VQE A;  3J7Z C; 
#chains in the Genus database with same CATH topology
 5M5Y H;  4KHP L;  1DON A;  3F8T A;  1BBX C;  3TP7 A;  1U4M A;  1STH A;  1CZG A;  4O0A A;  2AWN A;  5LMN W;  4O1N A;  1UWV A;  2F0M A;  4O42 A;  3S1N H;  2ID0 A;  4JI1 L;  1SMX A;  4H0L C;  4LF9 Q;  2NVY B;  4A3E B;  1PTO B;  3ULJ A;  3J81 c;  3DLL A;  2LFN A;  4EQ5 A;  2EYH A;  5D3D A;  1A8V A;  3TEH B;  1KQS A;  1JWU D;  1RCV D;  3S14 B;  3CCV A;  3D4W A;  4H7B A;  1TKW B;  1CT1 D;  3NBH A;  4GLX A;  4DAY A;  1XJV A;  1S5E D;  2L1B A;  5IOC A;  4N9T A;  2EYM A;  2WB1 E;  5FOB B;  4JI5 Q;  5EAY A;  4RMF A;  3SEB A;  3U4V A;  1Q86 C;  4BBR B;  2EYO A;  2MNA A;  3VYT A;  1G29 1;  2FXQ A;  4ME5 A;  2NTT A;  3K0Y A;  4GOP C;  1GM5 A;  3A8I E;  1HHV A;  3A7A B;  1EY5 A;  1SFO B;  2NN6 I;  3P75 A;  2PMZ E;  3F2C A;  1BCP F;  2YTY A;  1GUG A;  3BYT B;  3KK7 A;  4DV1 Q;  1KD1 C;  4NXM L;  2B2Y C;  2I46 A;  1HTP A;  2HD3 A;  3GTL B;  5C3X A;  1QOH A;  3HRZ C;  2RHS B;  4LF7 L;  3FKI B;  3CCU A;  5HGQ A;  4DR4 L;  3QWN A;  5KGU A;  5IP9 G;  4XXE A;  4BY7 B;  3MA2 B;  5C4X G;  5I4D A;  4AQY Q;  2OQ0 A;  1BCP C;  3KBX A;  4QJF A;  4DV3 Q;  3EVQ A;  1UNS A;  1HJP A;  4F7X A;  3TZD A;  2A69 C;  4X3T A;  2NUC A;  3IFT A;  4K5W A;  3GTO H;  2NVT H;  5JVH 3;  1BUV T;  5IWA L;  5FK9 C;  2ZM6 L;  4H02 A;  2PQE A;  2K5W A;  3S2D B;  3NQI A;  2AWO A;  4DV7 L;  1EY7 A;  1BNZ A;  3S16 H;  3I4M G;  4HCE A;  4G7H C;  4RHR A;  4JVZ A;  5KND A;  3N52 A;  3PF4 A;  2A6H D;  4FP5 D;  1LTB D;  3ER0 A;  1MJE A;  1NR2 A;  3EIV A;  4A3I H;  4LFB Q;  4DF7 A;  1NNX A;  2CQA A;  4X3S A;  4TQU S;  1YI2 A;  4B9X A;  3WDN A;  2OT2 A;  3CCL A;  5JPN C;  4WFN 3;  5M5X H;  1XWE A;  3J80 E;  3AMU A;  5C0X G;  4POG A;  4JI7 Q;  5FLM H;  1CHQ D;  5F2D A;  4LK1 C;  1PH2 A;  4N9P A;  3TSS A;  4P71 A;  1KXL A;  1LM0 A;  1W6K A;  2KEC A;  4A3C H;  1ZEQ X;  4MZ9 A;  2XRQ D;  2OTL A;  3X3N A;  2WAQ E;  1I3Q B;  4DUY L;  3DWA A;  2Z0S A;  3I4L A;  1S72 A;  3TZU A;  4YHH L;  1QJO A;  2I5M X;  2JQO A;  2Q2I A;  1ZXT A;  4J15 A;  4DNI A;  1PFM A;  2UUA Q;  4RWS C;  3S17 B;  2K5N A;  3HOW H;  4IUQ A;  5DAU A;  2A1A A;  1B4O A;  3HOX H;  1VDZ A;  3OTO L;  2A6E D;  3CW2 C;  1VQ9 A;  2RA4 A;  2F4V L;  3M4O H;  1X3F A;  1O7L A;  1F9P A;  1L1O C;  3NWS A;  3D0F A;  4OWW B;  2QKI C;  4LFA L;  3PO2 G;  3GTP B;  2AQ3 B;  2UUB L;  4IFD G;  2E5L Q;  3HOV H;  1I6H H;  3SGI A;  2XSC A;  2DY8 A;  4C3I H;  4DV2 Q;  1HR0 W;  3N6R A;  5M9O A;  4JCV E;  3W1B A;  4JI2 Q;  2KCN A;  2F0H A;  3PSI A;  4C1N K;  1Z47 A;  1LTA D;  1X56 A;  1ENC A;  2PW7 A;  2F3V A;  2WIN B;  4DKA C;  5BN3 A;  1SNP A;  2R93 G;  1NTG A;  1DOM A;  4OXP A;  5ELC A;  1SRU A;  1KTK A;  2LKV A;  1I94 Q;  2XWB B;  2N3S A;  4L5Q A;  4YY3 L;  2RVL A;  1GUW A;  1BOS A;  1GOZ A;  1X3G A;  1PYB A;  2V1C C;  2WB1 G;  2JA8 G;  1CUK A;  5CV6 A;  2F0G A;  1OTC A;  4A3L H;  4XQQ A;  3NE5 B;  5EJW A;  2OWO A;  1DXM A;  2JEA I;  2K5V A;  1SND A;  1H9R A;  4RGT A;  1PH8 A;  4CBV A;  1QCB D;  4MTK A;  4OX9 L;  4RA8 A;  4FF4 A;  2C9O A;  1WOC A;  4I65 A;  3MVV A;  1IKM A;  3I4N H;  1F9Q A;  1JC7 A;  1U5K A;  4DV6 L;  4CDD C;  3FHW A;  1HTL D;  3LWE A;  1CHP D;  5E4X A;  4ALP A;  2F03 A;  2UXB Q;  2ZTD A;  2UXD Q;  1N9W A;  3A5U A;  1IBM L;  2B8G A;  2IT1 A;  4X3K A;  5TSS A;  2VQF Q;  3C3L A;  1L2F A;  3A55 A;  4RGO S;  1LTG D;  3U9S A;  4JI3 L;  3LNN A;  2K52 A;  3M3Y B;  4LAA A;  1SR3 A;  2JYO A;  5IT9 L;  1MHW C;  1EQV A;  5EKL A;  5IOD A;  4X64 L;  1CKO A;  2D0P A;  3K7A B;  3LGJ A;  1QB5 D;  2VNU D;  3J81 j;  4IUN A;  3DWQ A;  4PZ7 A;  2EY1 A;  1EZ6 A;  4M8A A;  2XGT A;  4A3G H;  1VQK A;  3SR1 A;  3CXC A;  1Q7Y C;  1P8L A;  1YHQ A;  1JE5 A;  2KJX A;  2JA7 H;  3K57 A;  2L15 A;  4OO1 I;  1HZ9 A;  2MQH A;  4XT3 B;  5EPL A;  1HFN A;  3A54 A;  3TME A;  4AYB G;  2R3Z A;  4JI6 L;  1BQQ T;  4Y7N B;  4LF4 L;  1D5X C;  2CFM A;  2MPM A;  1H9S A;  2C5C A;  2QEJ C;  2KCT A;  5GRO A;  3O13 A;  2H4O A;  4EQP A;  3CP0 A;  5J3B A;  4DR5 Q;  4HJA A;  1D5M C;  1GXD C;  3T53 B;  3UDG A;  4A3K H;  3TRE A;  1Y8O B;  1Y1W H;  1XMQ Q;  2FJ2 A;  3RN2 A;  1A62 A;  4DV0 Q;  1Y1V G;  4R4O A;  1VQL A;  2WAQ G;  4TKO B;  1X6O A;  4XYQ A;  2DJF C;  2AUK A;  2A68 D;  3HOU G;  4HED A;  5KRU A;  3C1F A;  5BR8 L;  1BDO A;  3ZYY X;  3U4Z A;  4RKL A;  3FMC A;  5IYC G;  4BA2 I;  4KD3 A;  2L55 A;  1KIX A;  3GTL H;  5NUC A;  3GTG H;  4XT1 B;  2IJ0 A;  5E7N A;  4OIK A;  1VQ6 A;  4DXG A;  3FVQ A;  2K04 A;  1IBL L;  1RF2 D;  3GV3 A;  3GP7 A;  3TP5 A;  5GAG C;  1N33 L;  4RCN A;  3DM1 A;  4B3T L;  2JA6 G;  2WAC A;  2JA8 B;  1AEX A;  2KHS A;  1K8M A;  3SK8 A;  2F0J A;  2PW5 A;  1TWC H;  2NTS A;  4X62 L;  4HJ9 A;  2UXC Q;  2AUJ D;  3SHL A;  3RLO A;  1ZKO A;  4S3S A;  4A3C G;  2HCC A;  4CKE A;  3HZX A;  2JA5 B;  4DV5 Q;  3S2D H;  2IY5 B;  3NHH A;  4LF8 L;  1KNA A;  1SBB B;  1K0S A;  4HTH A;  3OOC A;  4BXX G;  3NWT A;  1OXU A;  2F4I A;  1CSP A;  3SK5 A;  5C4J B;  4A3D H;  1PMR A;  2RKS A;  4MIU A;  4C56 C;  4HIK A;  1LTT D;  3UDF A;  1KDC A;  2XWJ B;  1STE A;  3OIP A;  1HQR D;  2GN5 A;  5IIF A;  5IGB A;  2E2I H;  4LUV A;  2A73 B;  2DUD A;  2Z8L A;  1VF7 A;  4LF6 L;  1E1T A;  3OW2 A;  4HCS A;  4ZAI A;  1F2M A;  1A3V A;  1YZ6 A;  1IL8 A;  1T9H A;  3UDI A;  4K8I A;  4XQN A;  2R7D A;  2Q8I B;  3CME A;  3BS1 A;  1FVI A;  4M1U B;  1EZ8 A;  3NEN A;  1E7Z A;  4C3H G;  1X55 A;  1G2S A;  1TR5 A;  2B3G A;  3BZD B;  1IBK Q;  4H44 C;  4AYB B;  2F0S A;  2JA9 A;  4LWC A;  3L9A X;  4DR2 L;  2Y0S G;  4IQZ A;  3BVM A;  1JMC A;  5D65 A;  4K0K L;  1D1I A;  2VUM H;  3ULL A;  2EYP A;  4JBM A;  1Q46 A;  1Y8N B;  3H0G B;  4G7Z C;  2BH2 A;  3VR3 A;  3H3V I;  3CQZ H;  3VR4 A;  5LMN L;  1K83 B;  1Y1V B;  4NXN Q;  5LL6 S;  1YNJ D;  2K14 A;  4X66 L;  2VQE L;  1N32 L;  1K9M C;  3HOU B;  5CBE E;  1JB3 A;  5JVG 3;  2NVX H;  3H15 A;  1HUM A;  3I4N G;  2NZO A;  4RH6 A;  1AW7 A;  2K01 A;  2K50 A;  1I4Q A;  4POF A;  1BCP D;  1E1O A;  4NB3 A;  2OF1 A;  1SJH D;  1SYD A;  3VA5 A;  2A69 D;  4ZUI A;  4EQN A;  5AFW A;  2K05 A;  4XYO A;  3HKZ E;  4A3M H;  5EPK A;  1VQ5 A;  3VYU A;  4GLV B;  2E2J H;  3KF6 A;  1OXV A;  4WOR A;  5JJK A;  2JA6 B;  1WTQ A;  3CCM A;  3W2D A;  1K3R A;  5CV5 A;  4ZK9 B;  4JV5 Q;  3EJI A;  1VQO A;  2VY3 A;  3GTM H;  3DMU A;  4IJH A;  2PZW A;  1N36 Q;  3KJP A;  4CHT B;  1WTR A;  4RFB A;  4LF9 L;  2LSS A;  4A3G G;  3RN5 A;  5G3L F;  1TWG H;  2PQA B;  3K58 A;  1J9O A;  2WV6 D;  4P73 A;  2A8V A;  3FPP A;  1PH5 A;  1UEA B;  3IRB A;  4LF5 Q;  3X3M A;  1B7Y B;  4YWM A;  3URY A;  1UE5 A;  1BR9 A;  1D8L A;  4GZY C;  4L5S A;  2N78 A;  3S1M H;  2EJF C;  1R9T B;  3MXN B;  4IPH A;  4UY8 C;  3BVZ A;  3HG9 A;  3I56 A;  1FL0 A;  1CQF A;  2CHB D;  1BKB A;  1DOK A;  2SOB A;  2LMC B;  1SNO A;  4JBK A;  2ZJQ A;  1E3P A;  4FF1 A;  4A3K G;  4Y52 H;  4UP7 A;  2JJQ A;  1Y1W G;  3J7Y W;  2DN8 A;  2JSO A;  2P5Z X;  2VL6 A;  5IYD G;  1YJN A;  2A68 C;  5ELO A;  5M5W H;  1LO5 D;  2MUY A;  3BVG A;  1IHZ A;  2Z4H A;  2YU9 H;  2OCE A;  3RLF A;  4GKK Q;  2Q2H A;  2VB3 X;  1VQP A;  3T4A C;  3HOY G;  2H1E A;  2LS0 1;  2R92 G;  2K5Q A;  1S5F D;  1KHI A;  2JXM B;  1KRS A;  1B1Z A;  2L0C A;  3J81 i;  1WTH A;  1JWS D;  4MN3 A;  3GTQ B;  3A56 A;  4C3H B;  1B53 A;  4IUR A;  3AFQ A;  3Q0A A;  3CRK C;  1PRT F;  5C0X J;  4QB4 A;  3DM3 A;  2K03 A;  4AQY L;  4DV3 L;  3J7A F;  1QZG A;  1SLJ A;  3ZJY C;  4C1N I;  5KNC A;  2Y0S B;  2N55 A;  4JW0 A;  3OHX C;  5JEA J;  4LUO A;  1EYG A;  4GOP B;  4FNF A;  5JOB A;  4HID A;  2ZJP A;  2G5D A;  3IKJ A;  3AFP A;  1G8Z D;  1Q3L A;  4LW1 A;  1JIC A;  1V1O A;  2ENB A;  2IX1 A;  1WCM G;  3BDO A;  2GVB A;  3PO3 G;  4NPS A;  3A74 A;  3DHQ A;  1AP0 A;  4NP5 A;  3S2H H;  2WP8 J;  4JI0 Q;  4TRD A;  3HGB A;  4X65 Q;  4LFB L;  2IL8 A;  3NTK A;  4DV4 Q;  3DEP A;  1SE2 A;  2Q8R E;  2E74 C;  1IZ6 A;  4L5T A;  1LYL A;  2F0K A;  4DK6 C;  3ND9 A;  1KLG D;  3QOJ A;  5HGT A;  2E75 C;  1MD2 D;  4IFD J;  3CCJ A;  4CJ2 C;  3T1H Q;  1WTX A;  2B63 G;  3FDT A;  1HR0 L;  1HFG A;  4G57 A;  2B39 A;  1CQV A;  4PV1 C;  3BU2 A;  4JYA L;  4FYD A;  2JA5 H;  1CKN B;  3PCO B;  2MHV A;  3UI2 A;  3M4Y A;  1XTC D;  2UUA L;  4RG1 A;  5FJ8 H;  1IKL A;  2K33 A;  1VQN A;  4CDC C;  3G6J B;  1LUZ A;  2CQO A;  1B9M A;  1I4R A;  3CC7 A;  1JOR A;  5M3M G;  3HKZ G;  4A3B B;  2EIF A;  4K14 A;  4KKT A;  4A3F H;  2EXD A;  2J0T D;  3CKI B;  1NMF A;  5EKK A;  1EWH A;  1PH7 A;  2GVA A;  3B6Y A;  5HUR A;  2E5L L;  4XTC S;  3JAM c;  4DV2 L;  5C3E H;  1ILQ A;  4JI2 L;  1B44 D;  3J81 L;  1KLU D;  4LFC Q;  3OWF A;  1Z9F A;  2ZXR A;  4CKB A;  1YNJ C;  2I5H A;  2BA1 A;  3UE1 A;  3EFX D;  5COR A;  1TS5 A;  3NP8 A;  4LUZ A;  1QUQ B;  1I94 L;  2YV5 A;  2MO0 A;  1YJ9 A;  4A3J B;  4JOI A;  1G51 A;  1EQT A;  1EY0 A;  1NAP A;  1I4P A;  3HOY B;  1F2L A;  1GUS A;  1PFN A;  3TQY A;  3FP9 A;  3HFZ B;  2G9H D;  4ZRZ A;  3RD4 A;  3PF5 A;  4A93 H;  1YEZ A;  1L1O B;  2PCF B;  3PUZ A;  2XN9 C;  4BA1 I;  3M7N A;  1ICF B;  1UEB A;  1JJC B;  4F8M A;  1PTO F;  3AYH B;  4QMG A;  2KEE A;  5IP7 H;  2PZU A;  2R61 A;  1OXX K;  1J5E Q;  4FF2 A;  1K83 H;  2F52 A;  1JWM D;  5ISR A;  3ERO A;  3MWY W;  2Z6K A;  2LY7 A;  2UXB L;  3OW7 A;  2R7Z H;  1STB A;  1GUT A;  5E3F A;  4IAL A;  2I5L X;  1WCM B;  1S40 A;  5KEE A;  3BZK A;  3PO3 B;  4RAU C;  3NTI A;  2VQF L;  1Q8I A;  4LNQ A;  2Q2U A;  2CCZ A;  2NN6 H;  1Y14 B;  4ZKB B;  4ZCK A;  1SMY C;  3RZD H;  1GJX A;  4IUV A;  2EOT A;  3A7L A;  5C44 H;  4BY1 H;  1LAB A;  3K6O A;  1X9N A;  1S4Z A;  3ITP A;  2KVM A;  4EX5 A;  1KL9 A;  3S15 H;  1BBU A;  5D14 A;  4RKB A;  4ZKC B;  5IGD A;  3F2D A;  4KHP Q;  4PQX A;  3FEW X;  5IGE A;  4K5X A;  5K36 G;  1VQI A;  1H9M A;  3KJO A;  4L5R C;  5GAH C;  3P20 A;  2MFI A;  4HSV A;  5I2Y A;  1HZA A;  3D31 A;  1WJJ A;  1IW7 C;  3AQQ A;  3QOL A;  1CA5 A;  1I50 B;  1V1P B;  1PV4 A;  3RMH A;  4GS3 A;  3HKS A;  1RD9 D;  4KN7 C;  2BDO A;  3NK9 A;  4DK1 A;  4IN3 A;  5E1F A;  4DR5 L;  1X3E A;  5M3M B;  1XNR Q;  4C3J G;  5GAE C;  1SAP A;  5HY6 A;  4DV0 L;  3HOZ H;  4BBS H;  1PZJ D;  1D5Z C;  1JQY D;  1I4X A;  1ZYR C;  4R4Q A;  1TWA B;  3T56 B;  4QUF A;  3I70 A;  1RIP A;  4FF3 A;  2NZ1 D;  2HHH Q;  4Q0F A;  4QL5 A;  1GKH A;  1L0W A;  1KDA A;  2EQS A;  1SEB D;  3OIQ A;  3RNU A;  1MI2 A;  3Q6S A;  2Z4I A;  5LHY 1;  2PZT A;  1JJG A;  4GKJ Q;  4MNO A;  3R2I A;  4DR1 Q;  3GD7 A;  4QIW B;  3ICE A;  4I7Z C;  5C6A A;  4NXM Q;  1M1K C;  1B2T A;  2E2H H;  3WWV A;  1VQA A;  1TWH B;  5C4X B;  3F2U A;  2F0P A;  3CHB D;  3T1Y Q;  3NSW A;  4R4T A;  1EYA A;  1YNX A;  2B2T C;  4JC0 A;  1PHJ A;  5M3F H;  4L6T B;  3J7A 5;  2UXC L;  1S3O A;  3F1Z A;  1YBY A;  1DJR D;  3M7G A;  1JOK A;  2NVQ H;  2DGY A;  1CM9 A;  4UP9 A;  3GTK H;  1SNQ A;  2O5I C;  3Q8D A;  2QF7 A;  1S5D D;  5FLX E;  5IT9 c;  1D1K A;  3E9I A;  5IWA Q;  4DV5 L;  2O5J C;  3I4M B;  3MXP A;  2EZV A;  1HQM C;  3S1R B;  2VZA A;  3V96 A;  4R8I A;  3NBH B;  4U67 3;  2EVB A;  5ELD A;  5EKI A;  5COY A;  5BN4 A;  5DEH A;  4HN7 A;  2IX3 A;  3K0X A;  3I8Z A;  1PZI D;  2FMM A;  1NBW A;  4NW2 A;  1PH6 A;  1WTP A;  1HNW Q;  4BWG B;  2KCM A;  2ALY B;  3E0J A;  1BO0 A;  3M4Q A;  2NVY H;  4A3E H;  1QZH A;  1PTO H;  4QGU A;  3J81 E;  1EFW A;  2B2W A;  2YTX A;  4A76 A;  2QEX A;  5BN5 A;  2XVS A;  3S14 H;  3BYY B;  4ID6 A;  3S1Q B;  2QDB A;  4RHS A;  3K5L A;  5G3L D;  2KQ3 A;  4BBR H;  2OQK A;  3AU7 A;  1YHA A;  2HQE A;  4NKL A;  1VQE A;  3PO2 B;  3U58 A;  2F4V Q;  3I90 A;  2RF4 A;  3A0J A;  1JOQ A;  4MTN A;  1SFO H;  4A4I A;  4IUT A;  5LMU L;  4LFA Q;  4C3J B;  1BVS A;  1HCZ A;  4DAM A;  2MO1 A;  4B3S L;  4NXN L;  2UUB Q;  4FDB A;  3K5M A;  4KMU C;  1M90 C;  4WJ3 M;  3KF8 A;  1FGB D;  3E5S A;  3KBG A;  3NQT A;  5GQO A;  2R93 B;  1VS0 A;  3FKI H;  4C2M B;  3E3X A;  4KKS A;  1C7Y A;  2L12 A;  1EIF A;  1EOT A;  1L0X B;  4A3I G;  2IWH A;  1TQO A;  3TS0 A;  1STG A;  5IGG A;  3K59 A;  4BY7 H;  1MKH A;  2X6G A;  1LT6 D;  5CV9 A;  4DR3 L;  4BS9 A;  1PYS B;  2WB1 B;  4DGZ A;  2SEB D;  1SYF A;  1FNU A;  4YY3 Q;  5FLM G;  3I73 A;  2K7V A;  4NMZ A;  1EU3 A;  2HQL A;  2RBM A;  3GTJ B;  1DZ1 A;  2EY2 A;  5ELN A;  1VQG A;  2KHI A;  2B29 A;  3GDE A;  1QVC A;  1PRT D;  4BY1 G;  5M5Y B;  2K6A A;  4B3M Q;  3D6C A;  1T5E A;  4JV5 L;  1XX8 A;  2F0I A;  2NYZ D;  2CW0 C;  2PMZ B;  1H9K A;  1N36 L;  1J6Q A;  1AH9 A;  2X69 A;  2JK8 A;  4GN5 A;  4JOI C;  3S1N B;  3A8K E;  3AB9 A;  3HOW G;  4K8J A;  1SNM A;  2F0V A;  4OEM B;  1U4L A;  3BG3 A;  3PIO A;  3HOX G;  4V0B A;  3OPO A;  3ND8 A;  4G4K A;  1ASY A;  1FNW A;  1GUN A;  4MHE A;  1V9P A;  2N8N A;  3BDC A;  1NR4 A;  2EY6 A;  3CU7 A;  1SE8 A;  3KLS A;  2FHT A;  4KJN A;  2A74 C;  1IL2 A;  1B3A A;  2Q2T A;  2BE5 D;  5C4Z A;  5CV4 A;  1HNZ L;  2VXW A;  4KKU A;  1TVX A;  3HOV G;  1I3Q H;  1I4G A;  4C3I G;  1CZW A;  4X64 Q;  1PH1 A;  2Z6K C;  1WI5 A;  2M00 A;  4E6I A;  2E8G A;  2KED A;  5JJZ A;  3S17 H;  2IW3 A;  4GKK L;  1VMP A;  4OWX B;  2BOS A;  5AJ3 L;  2QW7 A;  1SNC A;  4HMJ A;  4GNX B;  1KNE A;  2SNM A;  2ZJR A;  4HSP A;  1LTI D;  3TP8 A;  3MC0 B;  3D8G A;  4HIM A;  2WII B;  5DM6 3;  2M2L A;  4DUZ Q;  4JI6 Q;  3GTP H;  1O7Z A;  3H6M A;  4A3L G;  4OGQ C;  1LTR D;  4DXF A;  3D6W A;  1FYC A;  4LF4 Q;  1PYW D;  4UDU C;  1BXT A;  4PMB A;  4OWT B;  1G6P A;  3CC2 A;  2ICI A;  5I9P A;  2WAQ B;  3WOE A;  1OO9 B;  2F0W A;  5E4W C;  3GTO B;  1X65 A;  3R3O A;  1SE3 A;  2NVT B;  1TWA H;  1DD2 A;  2O2L D;  4YCU A;  2RDG A;  5C4H A;  4Z9C B;  2X6L A;  1T5X D;  1A3T A;  1AE3 A;  3RUZ A;  5JJL A;  3K8A A;  1HZC A;  4RGN A;  2HCI A;  3S16 B;  1STA A;  3PMF A;  1N34 Q;  4JI0 L;  4TSS A;  4X65 L;  1QNK A;  1FJG Q;  1HRJ A;  4DV4 L;  4QUC A;  1Q12 A;  1SYB A;  4A3I B;  3RZO B;  4JPB W;  4R8N A;  3K80 C;  3CRL C;  1RL2 A;  2RCF A;  3SE0 A;  5J1Z A;  4ULL A;  2DNC A;  3QIA A;  1EU4 A;  3R93 A;  5M5X B;  1XPO A;  3EQL C;  4DR6 Q;  2Z9H A;  3J80 c;  1DYQ A;  1XNQ Q;  1CK1 A;  1TY0 A;  1N33 Q;  1YNN C;  4B3T Q;  2YYZ A;  5EBC A;  1NCV A;  2D9U A;  4PZ6 A;  4X3U A;  4UP8 A;  3VR5 A;  3S24 A;  1MBY A;  4R9W A;  1PTO D;  1LTL A;  1WFQ A;  3PUV A;  2PNR C;  2KHJ A;  2JA7 G;  4YIJ A;  4GN3 B;  2QIL A;  2D5D A;  3CCR A;  4LF8 Q;  2UUC Q;  1SMY D;  1RDP D;  2FIN B;  5K5P A;  3HOW B;  4JI5 L;  4Q5V A;  3M3Y H;  1E2W A;  4OEL B;  1HNX Q;  2B2V A;  3HOX B;  2L4N A;  4B9W A;  3QG1 A;  1RKN A;  3E9H A;  1VCI A;  2V4D A;  3M4O B;  3K7A H;  5C0X H;  2F0Q A;  5EPJ A;  1SJE D;  2ZXO A;  5FO7 B;  4K6D A;  2VS1 A;  3F2B A;  2AHO B;  4IUP A;  3K5N A;  2B2T A;  3R8B A;  1HXY D;  2UU9 Q;  1W6J A;  1MIU A;  2TMP A;  5JEA H;  1ENA A;  4DV1 L;  1CTM A;  3H94 A;  1TS4 A;  4F87 A;  1SYG A;  1FNV A;  4LF6 Q;  1IW7 D;  2ASB A;  3EBE A;  5H1S E;  1EFI D;  3CCQ A;  1W3S A;  1Y8P B;  3L0O A;  4PG3 A;  4FXD A;  1AZP A;  2F0O A;  3P7J A;  2XNA C;  1RTN A;  2F0L A;  1NSN S;  4Y7N H;  4GLA C;  4DAP A;  2IX0 A;  1JE4 A;  1VMC A;  3IFD A;  1LAC A;  1PA6 A;  1NMG A;  4DNR B;  3WOF A;  3C46 A;  4XIG S;  3T51 B;  5J39 A;  1X32 A;  1AFP A;  2JN4 A;  3QJY A;  4DAV A;  5KYI A;  2HDL A;  1ZYR D;  1Y69 U;  1CKM A;  2HIX A;  4K0K Q;  2B2W C;  4IFD H;  1K73 C;  1F2Z A;  1PRT C;  2D2C C;  1J5E L;  1C4Q A;  5CV7 A;  5FO8 B;  1LT5 D;  3MFY A;  4CDE C;  1AN8 A;  1VQB A;  4B08 A;  1K28 A;  1X54 A;  5ELF A;  4EQO A;  5LMN Q;  3CCS A;  3JAM i;  1Q82 C;  1PH9 A;  4ILW A;  4P75 A;  2R93 H;  4X66 Q;  2VQE Q;  3I4N B;  5C5M A;  4A3D G;  1TXY A;  2KA7 A;  3V2T A;  2K32 A;  1N32 Q;  3TN2 A;  1EIG A;  4NDX A;  2DNE A;  3U50 C;  4JI7 L;  5IYB H;  2IHF A;  5IGC A;  1BCP B;  2PYK A;  1VQM A;  2JA8 H;  3MEF A;  1UAP A;  4A75 A;  1BBW A;  1F9R A;  1WTV A;  2PPB C;  4AIM A;  2BE5 C;  3FRP B;  1AZQ A;  1HPC A;  5FLX L;  1MGS A;  1XMO Q;  1MSG A;  1WTO A;  2ES2 A;  2HDM A;  4IOA A;  1X3Q A;  3H09 A;  3G6E A;  1DCZ A;  5C4J H;  1XPR A;  4A3G B;  5LL6 X;  2KCC A;  2LXJ A;  2AKW B;  2NWG A;  4YWL A;  2JA7 B;  4RCO A;  3D3R A;  1V43 A;  3PUY A;  3GO5 A;  4FVM A;  5CBA E;  1B3Q A;  5ELB A;  3AEV A;  3DXJ C;  1QNU A;  1YVC A;  1D2B A;  3LX0 A;  1MJC A;  3G48 A;  2VUM G;  4U68 A;  2L11 A;  1XNR L;  1VQ4 A;  3I2Z A;  1STN A;  1EEI D;  4A3K B;  4CKC A;  1Y1W B;  2YTV A;  1LT4 D;  4G7O C;  1RHP A;  2AQ2 B;  2HHH L;  1K0R A;  1RTO A;  1EY4 A;  1A2U A;  2JEB I;  3NEL A;  4PMW A;  4DNT B;  5JAV A;  3PIP A;  4DR7 Q;  2XTI A;  1EQQ A;  1DOL A;  1LLR D;  1GO3 E;  4JI8 Q;  2MP1 A;  1D7Q A;  4WRD A;  4HMI A;  4GKJ L;  5CMD A;  3W5O A;  1S5C D;  4DR1 L;  3G71 A;  3CD6 A;  1AE2 A;  2R92 B;  1EYC A;  1A63 A;  3MAQ A;  3GTG B;  3KF6 B;  1SDF A;  4DPG A;  1IXR A;  4A3M G;  5EBD A;  1CI3 M;  3CCE A;  1NJI C;  1TU2 B;  3H0G H;  3T1Y L;  1K3B C;  4KY6 A;  5IY0 A;  3JAM L;  2K75 A;  3ULP A;  1G6Z A;  1U9R A;  3KDF B;  1Y1V H;  3STB C;  3IAY A;  4JI4 Q;  2JP1 A;  4KN4 C;  3OYY A;  3HOU H;  2M9V A;  4KY7 A;  1TWC B;  3PQI A;  2UXD L;  5JPM C;  2EJM A;  3L3O C;  2SNS A;  1PTO C;  3GQB A;  4B3R Q;  2BH8 A;  5IYC H;  1WD1 A;  1PLF A;  1YIJ A;  3D4D A;  2EXZ A;  2MGS A;  3NTH A;  4H13 C;  4YWK A;  4A3D B;  3MHB A;  1ROD A;  4HR7 B;  3UDX A;  4J1M A;  1Q1B A;  2B2U A;  3RZO H;  2FFK B;  4AYB E;  5KYL A;  4QCL A;  4HJ5 A;  1TT2 A;  2K28 A;  2JA6 H;  2E2I B;  1EWI A;  2CW0 D;  1HNW L;  2B63 B;  3QB3 A;  3Q23 A;  1STY A;  3CF5 A;  3BZC A;  4ABN A;  1SRO A;  4P74 A;  1JCK B;  4OIJ A;  4WJW A;  1HR0 Q;  4JI1 Q;  1B50 A;  5JEA G;  1FD7 D;  4BXX H;  4JYA Q;  2TSS A;  5A2Q E;  1EY6 A;  2JE6 I;  4LJZ C;  1R9T H;  1QIL A;  3NXW A;  1V8Q A;  3HKZ B;  3MXG A;  1XXG A;  2BCO A;  3TS2 A;  3KLR A;  1XMQ L;  3KLS X;  4F88 A;  2H5X A;  1JR0 D;  1DM0 B;  3QR8 A;  4KLK A;  2EY5 A;  3PIO 3;  4DK3 C;  2QGQ A;  1DGS A;  1ASZ A;  1GHK A;  1O7Y A;  1OXS C;  2VUM B;  1HA5 A;  4AH6 A;  2Q8T A;  3CQZ B;  3M4P A;  3LWU A;  1YIT A;  1JB7 A;  1EIH A;  1EUJ A;  2D62 A;  1D6E C;  5ELE A;  4JBJ A;  5A35 A;  1EY8 A;  3M9B A;  1RJT A;  1R4Q B;  3KYH C;  2QA4 A;  1L0Y B;  1B70 B;  3K7U C;  4ZUJ A;  4XDX A;  4ZYS A;  1GD7 A;  1YJW A;  2NVX B;  2B2V C;  1SYE A;  4WJ4 A;  4LF7 Q;  2EYL A;  3GTQ H;  4C3H H;  2E76 C;  2AQ1 B;  3G4S A;  3VDY A;  4DR4 Q;  2D0O A;  1ESF A;  1EL0 A;  3RLN A;  1E2Z A;  5CYU A;  2XRS D;  4GNX A;  5IYB G;  1B8A A;  3SXH A;  1X3P A;  2NBF A;  5CR3 A;  4A3M B;  1EEF D;  2L5T A;  4DU9 A;  5CV8 A;  1VQJ A;  5T1G A;  2E2J B;  1KRT A;  2ZM6 Q;  4B3M L;  2EPB A;  4DFA A;  3HS0 C;  2F0D A;  1G2T A;  2JA5 G;  1C9O A;  1TWF B;  4DV7 Q;  1LV9 A;  3I72 A;  3T13 A;  3MTS A;  3W3A A;  1H95 A;  3E6Z X;  4DAY B;  1G91 A;  1PFS A;  5KIX A;  1VQD A;  3GTM B;  2I0Q A;  5FJ8 G;  1A6X A;  2OTJ A;  1A3U A;  1U4P A;  1NY4 A;  3I91 A;  1TWG B;  3S9W A;  2EYF A;  1E0B A;  1EY9 A;  4FO2 A;  1Z6H A;  1A2T A;  3NEM A;  1R4P B;  3KFU A;  3A8J E;  4ZQ3 A;  4A3F G;  2VW9 A;  2RSO A;  1YNN D;  1QG7 A;  1KAW A;  2EYJ A;  1NE3 A;  3S1M B;  3V05 A;  1HA6 A;  2Z6B A;  2NB0 A;  3HP3 A;  4KD4 A;  2ICE C;  3CPF A;  2Y0S E;  3SVM A;  3H91 A;  1LTS D;  1B9N A;  2CH4 W;  4O2D A;  5C3E G;  5I2X A;  1ESR A;  5IE8 A;  4HIO A;  1EQR A;  1SN8 A;  4DUY Q;  2ATW A;  1CA6 A;  1UE6 A;  4DA2 A;  4QF4 A;  4KHZ A;  4YHH Q;  5M5W B;  5EQ0 A;  1SSO A;  2F3I A;  5C5L A;  3OMG A;  2HIV A;  4EGV A;  3BDL A;  4PZ8 A;  2YU9 B;  1IBK L;  1ENF A;  2K5D A;  4CGY B;  4KY5 A;  1PXU A;  4YCV A;  4HAE A;  5C3W A;  4ZLT F;  2EDG A;  2KEN A;  4FXG C;  4A3B H;  2PQA A;  3OTO Q;  1WTW A;  1XPU A;  1P16 A;  1O7I A;  1V1Q A;  4A93 G;  4DUZ L;  4IPD A;  1K8A C;  1Q1E A;  2CWP A;  2MJ8 A;  2LXK A;  4OL7 A;  1PVO A;  3MXN A;  4UAI A;  5I9O A;  5DM7 3;  2KOL A;  3ERQ A;  4KV6 A;  3JAM E;  4GN4 B;  2N49 A;  3H0G G;  5IP7 G;  1O78 A;  4CJ1 B;  2K1B A;  4DK0 A;  3PUX A;  3QO2 A;  1OXT A;  3VYR A;  3PV0 A;  5IYD H;  4DN4 M;  3CMA A;  2BDN A;  1UE7 A;  2F0F A;  2WKC A;  3OMC A;  4EVO A;  1J8I A;  2R7Z G;  1S5B D;  2WKD A;  3VYS A;  3C1E A;  2EJG C;  1XTD A;  4A3J H;  1N34 L;  1U0L A;  1IYU A;  3HOY H;  5J22 A;  3W1G A;  5GAD C;  1FJG L;  2R92 H;  5JJI A;  2RDH A;  1VQ7 A;  3S2H B;  2L9H A;  1N8R C;  1ICW A;  3H3V C;  2A6H C;  1PFB A;  2NN6 G;  2ZT9 C;  3R2T A;  1FGU A;  1WD0 A;  2E2D C;  5C44 G;  4OO1 H;  1O80 A;  4K5V A;  4DR6 L;  1Q8K A;  5EGT A;  3VR6 A;  1XNQ L;  4OON A;  4OX9 Q;  5IGF A;  1KAB A;  5FKA C;  1UE1 A;  1HH2 P;  1SYC A;  4GOP A;  2HUG A;  4L8J A;  4DV6 Q;  3I3C A;  3NPP A;  4APV A;  3L2P A;  4LF5 L;  1WCM H;  3K5O A;  3PO3 H;  1IYV A;  1IBM Q;  3NUC A;  4IZ8 A;  4R4C A;  3VR2 A;  1IYJ B;  4IO9 A;  2I07 B;  3L7Z C;  2UUC L;  1M8A A;  3TRZ A;  4R1J A;  3CPW A;  4QQB X;  3T16 A;  2B2Y A;  1MSH A;  2EE1 A;  2SDF A;  4IUU A;  1HNX L;  1CFM A;  1EOV A;  1M4V A;  4JI3 Q;  2F0T A;  3IL8 A;  3MEH A;  2A6E C;  2NZH A;  1F77 A;  5D3I B;  4A3F B;  3FPU B;  3J7A V;  1TS2 A;  3HOZ G;  3P1H A;  4BBS G;  4KJO A;  1SXT A;  4LMQ D;  1BF4 A;  4I7A A;  2UU9 L;  2VB2 X;  1PH4 A;  1TII D;  2IHE A;  2B63 H;  5I6Y A;  1H9J A;  3J80 i;  1WYD A;  1C48 A;  5C3E B;  1QE6 A;  3CAM A;  1ET6 A;  2CH4 A;  1I50 H;  2CWA A;  1CKN A;  4HJ8 A;  1FR3 A;  2B2U C;  3RR5 A;  1HUN A;  2K5H A;  4OHJ A;  1HZB A;  3M85 A;  4CDF C;  4KK7 A;  1EYD A;  5M3M H;  4IPC A;  1Q90 A;  1PDQ A;  2GA4 B;  2F0U A;  3VA7 A;  1A15 A;  4J6H A;  3EA6 A;  1VQF A;  4A93 B;  2C35 B;  2DJG C;  1TS3 A;  5M3F G;  4KTA A;  1E2V A;  1VQH A;  1A0I A;  2PNH A;  4IPG A;  1I6V C;  3TDQ A;  1EWC A;  4FXK C;  1KDB A;  4XQJ A;  1I4H A;  4P2C B;  1PH3 A;  5LMU Q;  4TVA B;  3CC4 A;  5DNF A;  3NBI A;  5BR8 Q;  2CKZ B;  2IPK D;  3K81 C;  2AMC B;  1KC8 C;  2Z1C A;  4PMC A;  4B3S Q;  2J7Z A;  4HJ7 A;  2N88 A;  2J4X A;  3D4R A;  2F1M A;  1GUO A;  1Q81 C;  5C0X I;  1GVP A;  2R7Z B;  5IP9 H;  2QDL A;  1ILP A;  1TWH H;  1QUQ A;  3I7F A;  3C2P A;  5C4X H;  2RDF A;  3SDZ A;  4UHV A;  4ODG A;  2RQX A;  3PIP 3;  1IBL Q;  2WFW A;  3U9O A;  1C0A A;  2O4X A;  2PI2 E;  4ME3 A;  3DWP A;  3STB D;  2F3W A;  1VF5 C;  3T1H L;  4DR3 Q;  2OEO A;  3RZD B;  3DUZ A;  4YCW A;  2KUM A;  3BJU A;  1VQ8 A;  1L1O A;  5C44 B;  5I6W A;  1XMO L;  4BY1 B;  4X62 Q;  1U4R A;  4K2K A;  3I55 A;  5IT9 E;  3PGZ A;  3S15 B;  1PRT B;  2ZTC A;  3I4M H;  4A3E G;  4V19 0;  2R7F A;  4N8X 1;  3S1R H;  2CVR A;  1TWF H;  5T1I A;  3TP6 A;  1K8G A;  3G7L A;  1YHB A;  3KDF A;  1QVF A;  2RHQ B;  1H9S B;  1Z7T A;  3DEO A;  3PUW A;  4L63 B;  2ZTE A;  4JK1 C;  3H3V H;  3Q22 A;  2QCP X;  3JC6 6;  4QIW E;  2XIW A;  4GNX C;  3OWE B;  3KOJ A;  1W2B A;  4IFD I;  4A3B G;  3MXU A;  4BBR G;  3J80 L;  5FO9 B;  1F2Y A;  3MFG A;  2DY7 A;  1II3 A;  3GV6 A;  2BA0 A;  3UE0 A;  3HOV B;  1I6H B;  1JJ2 A;  1WVL A;  1EIY B;  4C3I B;  4LFC L;  1CSQ A;  1HNZ Q;  3OSO A;  2RSN A;  1F9S A;  3HOZ B;  1I5F A;  3KF8 B;  4BBS B;  4QY7 A;  4JG2 A;  5A2Q L;  3EN2 A;  5K36 H;  2K4K A;  2A19 A;  4DR7 L;  1VQC A;  3FKI G;  4JI8 L;  1K8O A;  3Q24 A;  4KI0 A;  3S1Q H;  2B8F A;  5L37 A;  1E24 A;  3E0E A;  5DLQ E;  4R4I A;  5CC4 A;  2HT1 A;  3HEJ A;  4BY7 G;  1XYI A;  2OXP A;  4A3J G;  4J8Q A;  5AJ3 Q;  3SK6 A;  1V1P A;  1JT8 A;  4KHV A;  3PO2 H;  2PO4 A;  1QWY A;  2RCN A;  3KUP A;  4P72 A;  4DR2 Q;  1ML0 D;  2PI2 A;  4JBW A;  1ET9 A;  1LT3 D;  2E2H B;  3ERS X;  2A5H A;  2KBN A;  4X6A H;  4C3J H;  4K6L A;  4K2L A;  4OO1 G;  1TY2 A;  4JI4 L;  4RGM A;  1C8C A;  2R6G A;  3KLW A;  5M3F B;  1SE4 A;  3TBI B;  4C2M H;  2FMC A;  2NVQ B;  1KAA A;  3GTK B;  1QVG A;  1NUC A;  4PNY A;  5FLX c;  4B3R L;  3ONA B;  3MZ5 A;  5KNB A;  2F0E A;  4IOC A;  5CGK A;  1ONL A;  4CJ0 B;  3I4O A;  3A5Z B;  4UPA A;  4IJL A;  4N8F A;  1JOO A;  1UUP A;  2ZXP A;  2F0N A;  1GHJ A;  2G9D A;  1PZK D;  1E22 A;  3SK4 A;  3GTJ H;  3J7Z C; 
#chains in the Genus database with same CATH homology
 4BXX H;  4JYA Q;  5M5Y H;  2RF4 A;  3I4N G;  2NZO A;  3A0J A;  4KHP L;  4MTN A;  3F8T A;  1SFO H;  4A4I A;  2JE6 I;  2K50 A;  5LMU L;  4LFA Q;  1BVS A;  4O0A A;  4POF A;  1R9T H;  1E1O A;  4DAM A;  2MO1 A;  4NB3 A;  2AWN A;  4B3S L;  4NXN L;  5LMN W;  2UUB Q;  1UWV A;  4FDB A;  3HKZ E;  3TS2 A;  1M90 C;  4A3M H;  1XMQ L;  3S1N H;  2ID0 A;  1VQ5 A;  4WJ3 M;  4JI1 L;  4GLV B;  2H5X A;  1SMX A;  4LF9 Q;  5GQO A;  1VS0 A;  3KF6 A;  3FKI H;  4KLK A;  2E2J H;  1OXV A;  3ULJ A;  3J81 c;  1C7Y A;  4DK3 C;  2QGQ A;  3DLL A;  1DGS A;  1ASZ A;  5JJK A;  4EQ5 A;  2F4V Q;  1EIF A;  1A8V A;  1OXS C;  4A3I G;  3TEH B;  1KQS A;  3TS0 A;  3CCM A;  1K3R A;  4BY7 H;  3CCV A;  1MKH A;  4JV5 Q;  4GLX A;  1XJV A;  4DR3 L;  1VQO A;  4AH6 A;  1PYS B;  2VY3 A;  3M4P A;  1YIT A;  1JB7 A;  4IJH A;  3GTM H;  1EUJ A;  2D62 A;  2WB1 E;  1N36 Q;  4YY3 Q;  3KJP A;  4JI5 Q;  4JBJ A;  5FLM G;  5EAY A;  4LF9 L;  3M9B A;  4RMF A;  2LSS A;  3U4V A;  3RN5 A;  4A3G G;  1Q86 C;  1TWG H;  3KYH C;  2MNA A;  2PQA B;  2QA4 A;  1B70 B;  2HQL A;  3K7U C;  1GD7 A;  1YJW A;  4P73 A;  2A8V A;  4WJ4 A;  1G29 1;  4LF7 Q;  2FXQ A;  5ELN A;  1PH5 A;  1VQG A;  2KHI A;  2B29 A;  3GDE A;  1QVC A;  3IRB A;  4BY1 G;  4C3H H;  4GOP C;  1GM5 A;  4LF5 Q;  3GTQ H;  4B3M Q;  3G4S A;  3VDY A;  1B7Y B;  4YWM A;  4DR4 Q;  2D0O A;  4JV5 L;  1UE5 A;  2NN6 I;  1D8L A;  4L5S A;  2N78 A;  3S1M H;  3MXN B;  3RLN A;  4IPH A;  4UY8 C;  2PMZ E;  3F2C A;  1N36 L;  4GNX A;  2YTY A;  3I56 A;  5IYB G;  1J6Q A;  1B8A A;  1FL0 A;  4DV1 Q;  1KD1 C;  1BKB A;  1AH9 A;  4NXM L;  2JK8 A;  4GN5 A;  4JOI C;  3HOW G;  4JBK A;  1VQJ A;  2ZJQ A;  1E3P A;  4LF7 L;  2RHS B;  1KRT A;  3PIO A;  3HOX G;  3CCU A;  4A3K G;  4UP7 A;  4Y52 H;  2ZM6 Q;  5HGQ A;  2JJQ A;  4B3M L;  1Y1W G;  4DR4 L;  1ASY A;  5IYD G;  2VL6 A;  1YJN A;  1V9P A;  2N8N A;  5ELO A;  5M5W H;  5IP9 G;  2JA5 G;  1C9O A;  1SE8 A;  4DV7 Q;  2OCE A;  3RLF A;  3U58 A;  2YU9 H;  4GKK Q;  5C4X G;  4AQY Q;  1H95 A;  2OQ0 A;  1IL2 A;  2Q2H A;  4QJF A;  4DAY B;  4DV3 Q;  1PFS A;  1VQD A;  1VQP A;  1HJP A;  2Q2T A;  2I0Q A;  1HNZ L;  5FJ8 G;  3GTO H;  2NVT H;  2OTJ A;  3HOY G;  3HOV G;  1NY4 A;  1I3Q H;  2R92 G;  5IWA L;  2ZM6 L;  4X64 Q;  1PH1 A;  1KHI A;  2Z6K C;  1KRS A;  4H02 A;  3J81 i;  3NEM A;  3KFU A;  1WI5 A;  3AFQ A;  4A3F G;  2E8G A;  2AWO A;  2VW9 A;  5C0X J;  4DV7 L;  3S17 H;  3S16 H;  3DM3 A;  1KAW A;  4AQY L;  1NE3 A;  3I4M G;  4GKK L;  4DV3 L;  1QZG A;  1SLJ A;  4OWX B;  3ZJY C;  5AJ3 L;  3PF4 A;  4GNX B;  3ER0 A;  1MJE A;  3EIV A;  3CPF A;  2Y0S E;  2ZJR A;  4A3I H;  4LFB Q;  5JEA J;  4LUO A;  4O2D A;  1EYG A;  4GOP B;  5C3E G;  4HID A;  4TQU S;  2ZJP A;  1YI2 A;  5IE8 A;  4HIO A;  1EQR A;  4HIM A;  3CCL A;  1SN8 A;  3AFP A;  4DUY Q;  2ATW A;  5M5X H;  4DUZ Q;  1UE6 A;  4JI6 Q;  3GTP H;  4A3L G;  4LW1 A;  4LF4 Q;  5C0X G;  4KHZ A;  1WCM G;  4YHH Q;  5FLM H;  4JI7 Q;  4POG A;  2IX1 A;  2GVB A;  3PO3 G;  4NPS A;  2F3I A;  3A74 A;  1PH2 A;  2HIV A;  4PZ8 A;  4OWT B;  1IBK L;  1G6P A;  4P71 A;  3S2H H;  1LM0 A;  2WP8 J;  3CC2 A;  4JI0 Q;  1KXL A;  4A3C H;  4X65 Q;  4YCV A;  4MZ9 A;  2OTL A;  2KEN A;  4A3B H;  4LFB L;  2PQA A;  2WAQ E;  3OTO Q;  1X65 A;  4DV4 Q;  1XPU A;  1TWA H;  1P16 A;  4YCU A;  1O7I A;  4DUY L;  1V1Q A;  4A93 G;  1IZ6 A;  4IPD A;  4L5T A;  4DUZ L;  1K8A C;  2Z0S A;  1Q1E A;  1S72 A;  1AE3 A;  1LYL A;  2CWP A;  2LXK A;  4DK6 C;  4YHH L;  5JJL A;  3K8A A;  1PVO A;  2I5M X;  1HZC A;  2JQO A;  2Q2I A;  4DNI A;  4J15 A;  2UUA Q;  4GN4 B;  2K5N A;  3HOW H;  1N34 Q;  4IFD J;  4JI0 L;  2N49 A;  3H0G G;  3CCJ A;  4X65 L;  5IP7 G;  2A1A A;  3T1H Q;  1FJG Q;  3HOX H;  2B63 G;  3PUX A;  3OTO L;  1HR0 L;  1OXT A;  4DV4 L;  3CW2 C;  1Q12 A;  3PV0 A;  1VQ9 A;  5IYD H;  2F4V L;  3M4O H;  3BU2 A;  3CMA A;  4JYA L;  3K80 C;  1X3F A;  1UE7 A;  1L1O C;  1RL2 A;  2JA5 H;  1CKN B;  3PCO B;  3D0F A;  4OWW B;  4LFA L;  2R7Z G;  3PO2 G;  1XPO A;  4DR6 Q;  2UUA L;  4RG1 A;  3J80 c;  5FJ8 H;  1XTD A;  4A3J H;  1N34 L;  1U0L A;  1XNQ Q;  2UUB L;  1N33 Q;  3HOY H;  4IFD G;  2E5L Q;  4B3T Q;  3HOV H;  2YYZ A;  3W1G A;  3SGI A;  5GAD C;  1FJG L;  1VQN A;  4C3I H;  2R92 H;  1I6H H;  4PZ6 A;  1LUZ A;  5JJI A;  2CQO A;  4DV2 Q;  4UP8 A;  1HR0 W;  1VQ7 A;  3CC7 A;  4JCV E;  3W1B A;  3S24 A;  5M3M G;  3HKZ G;  1N8R C;  4JI2 Q;  2NN6 G;  2EIF A;  3PSI A;  1FGU A;  1Z47 A;  4A3F H;  1LTL A;  1WFQ A;  1X56 A;  2EXD A;  3PUV A;  4DKA C;  2KHJ A;  5C44 G;  2JA7 G;  1NMF A;  2R93 G;  4GN3 B;  4DR6 L;  1NTG A;  1Q8K A;  1PH7 A;  2GVA A;  3B6Y A;  4OXP A;  3CCR A;  4LF8 Q;  1SRU A;  2UUC Q;  1XNQ L;  1I94 Q;  2E5L L;  2N3S A;  4L5Q A;  4OON A;  4XTC S;  4OX9 Q;  3JAM c;  4YY3 L;  4DV2 L;  4JI5 L;  5C3E H;  3M3Y H;  1UE1 A;  1HH2 P;  1HNX Q;  4JI2 L;  1X3G A;  1PYB A;  2V1C C;  2WB1 G;  2JA8 G;  4LFC Q;  1CUK A;  1Z9F A;  4GOP A;  4DV6 Q;  1OTC A;  3E9H A;  2I5H A;  4A3L H;  1VCI A;  4APV A;  3L2P A;  3K7A H;  2BA1 A;  1WCM H;  4LF5 L;  3UE1 A;  2OWO A;  2VS1 A;  3PO3 H;  3F2B A;  2AHO B;  1IBM Q;  4LUZ A;  4R4C A;  1QUQ B;  2JEA I;  1IYJ B;  2K5V A;  4IO9 A;  3L7Z C;  2UUC L;  1I94 L;  1PH8 A;  3TRZ A;  2YV5 A;  2UU9 Q;  1MIU A;  4R1J A;  2MO0 A;  3CPW A;  4OX9 L;  1YJ9 A;  4QQB X;  4JOI A;  1G51 A;  4DV1 L;  1WOC A;  1HNX L;  1EOV A;  3TQY A;  4LF6 Q;  3FP9 A;  3HFZ B;  4JI3 Q;  3EBE A;  2ASB A;  1U5K A;  5H1S E;  3CCQ A;  4DV6 L;  1YEZ A;  1W3S A;  3FHW A;  1L1O B;  3PUZ A;  3PF5 A;  4ALP A;  3L0O A;  4PG3 A;  2NZH A;  2ZTD A;  4BA1 I;  1N9W A;  3M7N A;  2UXB Q;  2UXD Q;  1UEB A;  3A5U A;  1IBM L;  1JJC B;  2IT1 A;  3AYH B;  3HOZ G;  4Y7N H;  4GLA C;  4BBS G;  2UU9 L;  2IX0 A;  5IP7 H;  1PH4 A;  2VQF Q;  2IHE A;  2B63 H;  1OXX K;  1L2F A;  1J5E Q;  1PA6 A;  1K83 H;  1NMG A;  2F52 A;  3J80 i;  1WYD A;  4XIG S;  4JI3 L;  2K52 A;  2Z6K A;  3CAM A;  1SR3 A;  2UXB L;  1I50 H;  2CWA A;  4X64 L;  2R7Z H;  1CKN A;  1CKO A;  2I5L X;  4HJ8 A;  2D0P A;  3LGJ A;  2VNU D;  1S40 A;  1CKM A;  2HIX A;  3BZK A;  3RR5 A;  4K0K Q;  2K5H A;  3J81 j;  1K73 C;  1HZB A;  2VQF L;  3M85 A;  4PZ7 A;  4LNQ A;  2Q2U A;  1J5E L;  2XGT A;  5M3M H;  2CCZ A;  4IPC A;  1VQB A;  4A3G H;  1Y14 B;  3RZD H;  1VQK A;  1X54 A;  3CXC A;  1Q7Y C;  1P8L A;  1YHQ A;  5LMN Q;  5C44 H;  3JAM i;  1JE5 A;  3CCS A;  1Q82 C;  4P75 A;  1PH9 A;  2JA7 H;  4BY1 H;  2R93 H;  1VQF A;  4X66 Q;  2VQE Q;  2C35 B;  1X9N A;  1TXY A;  4A3D G;  2L15 A;  1N32 Q;  4OO1 I;  5M3F G;  1HZ9 A;  2MQH A;  4EX5 A;  1KL9 A;  3S15 H;  4AYB G;  1BBU A;  1VQH A;  1A0I A;  4JI6 L;  2PNH A;  4IPG A;  3U50 C;  3F2D A;  4LF4 L;  4KHP Q;  4JI7 L;  2CFM A;  5IYB H;  2IHF A;  1PH3 A;  5LMU Q;  5K36 G;  1VQI A;  4TVA B;  2KCT A;  5GRO A;  3KJO A;  3CC4 A;  5GAH C;  4L5R C;  1VQM A;  5BR8 Q;  2JA8 H;  2CKZ B;  3MEF A;  3K81 C;  2AMC B;  3CP0 A;  5J3B A;  4A75 A;  1BBW A;  1KC8 C;  4DR5 Q;  4B3S Q;  4HJA A;  2MFI A;  4HJ7 A;  3UDG A;  4A3K H;  1HZA A;  3D31 A;  4AIM A;  3TRE A;  1WJJ A;  1Y1W H;  1XMQ Q;  3RN2 A;  1Q81 C;  5C0X I;  1A62 A;  4DV0 Q;  1Y1V G;  3AQQ A;  4R4O A;  1VQL A;  1GVP A;  1XMO Q;  2WAQ G;  1PV4 A;  1X6O A;  5IP9 H;  4GS3 A;  3HKS A;  1TWH H;  1QUQ A;  3I7F A;  5C4X H;  2ES2 A;  3HOU G;  4IOA A;  1IBL Q;  2WFW A;  1C0A A;  2PI2 E;  3G6E A;  5C4J H;  3I4N H;  4ME3 A;  5BR8 L;  3STB D;  1XPR A;  3U4Z A;  4DR5 L;  1X3E A;  3T1H L;  4DR3 Q;  1XNR Q;  2LXJ A;  4YCW A;  3BJU A;  5IYC G;  1VQ8 A;  4BA2 I;  5GAE C;  1L1O A;  2AKW B;  5HY6 A;  4DV0 L;  1KIX A;  4YWL A;  3GTL H;  3HOZ H;  4BBS H;  1XMO L;  3GTG H;  4A93 H;  4X62 Q;  3I55 A;  4R4Q A;  5E7N A;  1V43 A;  3PGZ A;  3PUY A;  1VQ6 A;  3GO5 A;  2ZTC A;  3I4M H;  1IBL L;  1RIP A;  4A3E G;  3AEV A;  2HHH Q;  2R7F A;  4QL5 A;  1GKH A;  1YVC A;  3S1R H;  1L0W A;  1TWF H;  2EQS A;  1MJC A;  5GAG C;  1K8G A;  3G48 A;  1N33 L;  1YHB A;  3KDF A;  3RNU A;  1QVF A;  4B3T L;  2JA6 G;  2RHQ B;  1XNR L;  2VUM G;  1JJG A;  1VQ4 A;  3I2Z A;  3PUW A;  2ZTE A;  3H3V H;  4MNO A;  4GKJ Q;  4DR1 Q;  3GD7 A;  3ICE A;  1TWC H;  4X62 L;  4HJ9 A;  3JC6 6;  4NXM Q;  2UXC Q;  1M1K C;  4QIW E;  4GNX C;  3RLO A;  2YTV A;  3KOJ A;  1W2B A;  4A3C G;  4IFD I;  4A3B G;  2E2H H;  3WWV A;  4BBR G;  1K0R A;  1VQA A;  2HHH L;  4DV5 Q;  3NEL A;  4PMW A;  2JEB I;  3S2D H;  2IY5 B;  4LF8 L;  3PIP A;  4DR7 Q;  2XTI A;  1EQQ A;  1GO3 E;  4JI8 Q;  3T1Y Q;  1OXU A;  4BXX G;  4R4T A;  1CSP A;  1YNX A;  1D7Q A;  2BA0 A;  4GKJ L;  3W5O A;  4A3D H;  3UE0 A;  4JC0 A;  4DR1 L;  3G71 A;  5M3F H;  1PHJ A;  1AE2 A;  1JJ2 A;  3CD6 A;  1EIY B;  3J7A 5;  2UXC L;  1S3O A;  4LFC L;  1CSQ A;  3F1Z A;  1HNZ Q;  1YBY A;  4HIK A;  1A63 A;  3UDF A;  2NVQ H;  2DGY A;  1I5F A;  3KF8 B;  4UP9 A;  4QY7 A;  4JG2 A;  3GTK H;  3EN2 A;  3KF6 B;  3Q8D A;  4DPG A;  1IXR A;  3E9I A;  2GN5 A;  5IT9 c;  5IWA Q;  4DV5 L;  3CCE A;  4A3M G;  1NJI C;  2E2I H;  2K4K A;  2A19 A;  4DR7 L;  1VQC A;  3H0G H;  3FKI G;  4LUV A;  4JI8 L;  3T1Y L;  2DUD A;  5IY0 A;  3ULP A;  4KI0 A;  2K75 A;  3S1Q H;  1E24 A;  2VZA A;  3E0E A;  5DLQ E;  4R4I A;  3KDF B;  1Y1V H;  3NBH B;  3STB C;  4JI4 Q;  2HT1 A;  4LF6 L;  1E1T A;  3OW2 A;  4BY7 G;  3OYY A;  4A3J G;  5AJ3 Q;  3HOU H;  2UXD L;  1YZ6 A;  1JT8 A;  3PO2 H;  1T9H A;  3UDI A;  2RCN A;  2R7D A;  4P72 A;  3CME A;  4DR2 Q;  2PI2 A;  4JBW A;  1FVI A;  3K0X A;  3ERS X;  2KBN A;  4B3R Q;  4X6A H;  4C3J H;  2BH8 A;  1NBW A;  1PH6 A;  5IYC H;  1YIJ A;  1HNW Q;  3NEN A;  4OO1 G;  4JI4 L;  1E7Z A;  2KCM A;  2ALY B;  4YWK A;  2R6G A;  1X55 A;  2B3G A;  1IBK Q;  3KLW A;  3UDX A;  3M4Q A;  1Q1B A;  2NVY H;  4A3E H;  1QZH A;  2JA9 A;  4LWC A;  4C2M H;  4QGU A;  1EFW A;  3RZO H;  2YTX A;  4AYB E;  4DR2 L;  2Y0S G;  4A76 A;  2QEX A;  4HJ5 A;  1JMC A;  1QVG A;  4K0K L;  2JA6 H;  5FLX c;  2VUM H;  4B3R L;  3ULL A;  1EWI A;  4JBM A;  3S14 H;  1Q46 A;  1HNW L;  4IOC A;  2BH2 A;  3I4O A;  3A5Z B;  3H3V I;  4UPA A;  3CQZ H;  4IJL A;  3CF5 A;  5LMN L;  3BZC A;  4NXN Q;  1SRO A;  4P74 A;  2K14 A;  4X66 L;  2VQE L;  4BBR H;  2OQK A;  1N32 L;  1K9M C;  1HR0 Q;  4JI1 Q;  2NVX H;  1YHA A;  5JEA G;  3H15 A;  1E22 A;  3GTJ H;  1VQE A;  3J7Z C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...