4U673

Crystal structure of the large ribosomal subunit (50s) of deinococcus radiodurans containing a three residue insertion in l22
Total Genus 0
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
0
sequence length
59
structure length
59
Chain Sequence
THKMAKRRIKITGTGKVMAFKSGKRHQNTGKSGDEIRGKGKGFVLAKAEWARMKLMLPR

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Ribosomal Protein uL22 Modulates the Shape of the Protein Exit Tunnel.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2014-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF01632 Ribosomal_L35p Ribosomal protein L35
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.530 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4u67300
3PIO3 4U673 3PIP3 4WFN3 5DM73 5DM63 5JVH3 5JVG3
chains in the Genus database with same CATH superfamily
3RLNA 3J81i 5AJ3Q 1LUZA 4PZ8A 3TZUA 3ULJA 1JB3A 3PF4A 3T4AC 4KY6A 4JBWA 3K57A 4JI5Q 1VCIA 4RFBA 4ME5A 5IGFA 2LSSA 1KABA 1JB7A 2K52A 2IW3A 5JOBA 2XVSA 5C3EH 1N9WA 4IJLA 4UY8C 1LTRD 3NWTA 4TRDA 1SDFA 1JJCB 1I4PA 4TKOB 4OWTB 4IUVA 2KEDA 4X3UA 1X56A 4HN7A 2MO0A 5M3FB 5C4JH 1YVCA 1L0WA 1WD0A 5A2QL 1M90C 4BY7B 1EWHA 4HIMA 3D3RA 5DEHA 2I5HA 1BNZA 4K8IA 3TMEA 2NVTB 2HHHL 4UP7A 1JT8A 3S17H 2QEXA 1QE6A 1Y8NB 2HDMA 4A3GH 1AN8A 2K01A 4CDCC 4YHHQ 1B9MA 2B2YA 2V1CC 1GUNA 1Y1WG 4FP5D 1DOMA 1T5EA 1HFGA 2DY8A 5LL6S 2B29A 1JICA 4A3CH 2ASBA 3KFUA 2RHQB 1RL2A 3QJYA 3CAMA 1D6EC 4IQZA 4TVAB 4H7BA 2UU9Q 1PH5A 4J8QA 3MWYW 3BDLA 2KEEA 3Q23A 4DR5L 2N49A 1JOKA 2DJFC 1EZ8A 2KVMA 4B3RQ 1STGA 1PH9A 4JBJA 1Q12A 4OO1I 1DYQA 1F2LA 1TU2B 2SEBD 4G7OC 2EXDA 1QJOA 3W2DA 3CPFA 3U9OA 1EY6A 1MHWC 4JI5L 3FHWA 2MP1A 4YIJA 1PTOD 3M9BA 1ENCA 5D3DA 1GJXA 1S5CD 2GA4B 1VQOA 2ZXPA 3S1RB 3PV0A 3VYRA 3NWSA 2F0NA 1SNDA 1PTOB 4IUNA 3BDCA 2WB1E 5C0XJ 1Q1BA 3K5MA 1A0IA 1O7LA 3X3NA 4LF4L 3GTKB 3MTSA 1DOKA 2XNAC 1E2VA 4X66Q 4L5QA 2K5VA 5ISRA 2R7DA 5K36G 1EQQA 2RDGA 4JOIC 2WAQE 2K1BA 1D5ZC 4P73A 1WI5A 3J81E 2VUMH 5I2XA 1IW7D 2EY6A 3SDZA 1EOTA 5BN3A 1RTNA 4AIMA 4RGTA 1PTOC 2K05A 3EROA 3URYA 5I4DA 3VYUA 1T5XD 3K7AB 4DNTB 4GLXA 1K8GA 1HNWQ 2LXJA 2N8NA 5HGQA 4DR6L 1S5FD 1WFQA 1E2WA 2EIFA 4KHPQ 1VQHA 5IT9E 1TS5A 4R4OA 4MHEA 3TS2A 5KNBA 2VZAA 5E7NA 4CJ1B 1DZ1A 4YY3L 5CBEE 4BY7G 2F0PA 3T1HL 3I91A 2CW0C 3D0FA 5IGDA 1TY2A 4XT3B 4DV3Q 2Y0SG 4M1UB 5J22A 1XPRA 3EBEA 1OTCA 5IIFA 4OGQC 1PRTF 1Q1EA 1RCVD 3HOYH 1U5KA 1N34L 3D6CA 1IBMQ 4BBSH 3T53B 3PUXA 4AYBB 4GLAC 3E3XA 3K80C 4A3DG 4HMIA 5EJWA 5M5YH 1RDPD 4ZRZA 5KEEA 5I2YA 3EN2A 2JEAI 1OXXK 3M4OH 4YWMA 5M3MH 2JJQA 3VR4A 2IHFA 2EXZA 2ICIA 1P16A 4RGOS 4EQOA 2E2HB 1BVSA 4F87A 1EWIA 4JBMA 4DV1L 2UUBQ 2XGTA 4C3HB 4IFDG 3D4DA 2NTSA 3DWPA 2RSNA 3TQYA 1B8AA 5M3FG 2CQAA 1ASYA 5KNDA 1B70B 3E0EA 1PZJD 1A6XA 2KOLA 4NXNL 2B63B 3I4NH 4ZYSA 3IRBA 2EYPA 3HOZB 4JI6Q 1TWCH 3EVQA 1LT6D 1STAA 3M3YH 5FKAC 3K58A 2L55A 1LTLA 1GUOA 1B44D 1JWSD 1QCBD 3Q24A 4XTCS 2XRQD 3F2UA 4MNOA 2HD3A 4LF7Q 1QVFA 1RIPA 1I6HH 3HOVB 1VQ8A 5JJZA 3L9AX 4BWGB 1SYGA 5GAHC 5IYDH 4RGNA 5KYLA 2I5MX 1CKNB 3H15A 3GTOB 3HOWH 4J6HA 5IGBA 3MA2B 1DCZA 1V1OA 3TP7A 1A2UA 4P72A 1BCPF 2A68C 1XPUA 2A73B 4LUOA 1SNMA 1BOSA 5ELBA 2EZVA 4K5VA 1YHBA 3A5ZB 1E2ZA 4J15A 2R93B 4HIDA 3U58A 4L5TA 4A3EB 2L1BA 4A3KG 1Q8KA 1GUWA 4RCNA 3R93A 2QCPX 3NPPA 4DU9A 2QEJC 1CHPD 2Q2HA 5AJ3L 4H13C 3CCEA 4BY1H 1HPCA 2NYZD 2ZJRA 4RHRA 1VQBA 1Q81C 1ILQA 3AFQA 3S1NH 3MZ5A 2OCEA 3I4MG 2NZHA 5HY6A 2F0UA 2DY7A 3KBXA 1AP0A 4LWCA 1X32A 2Q2UA 5ELFA 2J0TD 1XNQQ 3OMCA 4B3TL 3CC4A 5IGGA 3CHBD 1AE3A 5ELOA 3QIAA 4KKSA 2K32A 1ONLA 4B3RL 1VQCA 1ICFB 4DK1A 1SE4A 2Q2IA 2VQEQ 4X64Q 3GTPH 3HOXH 3TDQA 1PRTC 4PV1C 1K83B 1BUVT 3TEHB 2N88A 1PYBA 2JA9A 1I4XA 1Y8PB 5FK9C 2R92H 1YEZA 4OHJA 1Y1VH 2B2UC 4O2DA 1UAPA 3T51B 2QA4A 2NB0A 2ES2A 3G6EA 1YITA 4YWKA 4KJOA 2HDLA 4PZ7A 1SMXA 2RKSA 3NE5B 1FL0A 3MEFA 4RG1A 3QG1A 4N8FA 4LJZC 3TP6A 4ID6A 3CCJA 4HSVA 1AE2A 1CA6A 4C56C 4IOCA 4MIUA 2X69A 3OOCA 4IFDH 4ME3A 2FJ2A 1DONA 3TZDA 1BBUA 1ET6A 1STNA 2BCOA 4M8AA 3CCUA 3ULPA 1EOVA 3VA7A 2XN9C 3GTKH 1I4QA 1H9MA 2E2DC 1ZYRC 1JWUD 2YV5A 4KHVA 4DV2Q 3SK8A 5D65A 2TSSA 4YWLA 2L5TA 1X3QA 1JE5A 2FMCA 2NBFA 2A69D 2NVQH 3HOVG 2XTIA 4A3DB 1CA5A 1S5DD 2B2VA 1XPOA 1NJIC 5JJLA 3FRPB 4OO1H 3N52A 4JI1L 2JYOA 1TY0A 1WTPA 1X6OA 5KRUA 3SHLA 3CMEA 2AWOA 2GVAA 1QUQB 4DAYA 3K0XA 4B3SQ 3RZDH 1NNXA 2R6GA 4H44C 2M00A 2K6AA 4DR4L 3LGJA 5IP9H 2NVTH 1V8QA 4LFAL 1KNEA 5CGKA 1JORA 1SXTA 3ZJYC 2CH4W 3K5NA 2IX0A 2AUJD 5CC4A 2JA8B 4DV5L 2O2LD 4EX5A 4A3FG 3T1HQ 2PMZB 4JI3Q 4DV6L 2JA5H 3NTKA 5FLMG 2XWBB 5CV7A 1LLRD 1WOCA 4DXGA 1SE2A 2K14A 2PW5A 3DEPA 4LNQA 2UXDL 3G7LA 1PMRA 1VQMA 4IPCA 3U9SA 1HZCA 4NKLA 4LFCL 2F0KA 1N36Q 4YCWA 3I4MB 3CP0A 2RF4A 2EYMA 4K5XA 2DNCA 3M4PA 1CKNA 5CYUA 1GXDC 1JJ2A 4FF4A 2MJ8A 4WJ3M 4MN3A 3CCRA 2EYHA 1C4QA 3MEHA 2ZTCA 4IUUA 2Z0SA 4V0BA 4BBRG 2AUKA 5J3BA 1LTSD 1MBYA 1MSGA 3FP9A 4DR3Q 4LF8Q 4KD4A 4PMWA 1WTHA 3A7AB 1ESRA 5IWAQ 2WB1B 2K5HA 1GM5A 1HTLD 3PIO3 3KJPA 3U4ZA 4X65Q 1HJPA 1F77A 5M5XH 4DV3L 1E22A 2WKCA 3AYHB 2PQAA 3A7LA 5H1SE 1W2BA 3I55A 3A55A 2GN5A 3NSWA 1S5BD 4K2LA 3IAYA 2B2TA 4R4CA 1XMOQ 1XX8A 4DF7A 1FGBD 4ZCKA 3CCQA 1HFNA 2JA6B 1SNQA 4B3SL 3KF8B 1A3TA 1I94L 4R9WA 5C5MA 3QR8A 1QB5D 5M3MG 4DR4Q 2OQ0A 2CVRA 4A76A 4X3KA 3J81L 2KHIA 3KBGA 2R92G 1EQVA 2EDGA 3VR2A 3BDOA 3VR5A 3T1YQ 3T56B 5IE8A 1G51A 1XXGA 4DV0Q 5CV9A 1SROA 4UP8A 3HEJA 2D0OA 1AEXA 1WCMB 1Z47A 3OMGA 2L12A 2EYOA 3F2DA 2UXDQ 2A6ED 1WTWA 1N8RC 3H6MA 1VS0A 3CPWA 4NXNQ 2AHOB 1P8LA 1EY4A 3K8AA 2KCTA 4WJWA 2R61A 2QF7A 3OIQA 1K0RA 4JI7Q 5CORA 4QJFA 4R4QA 4K14A 5FLXL 1EIYB 4DV7L 1BKBA 5C4XB 1I4RA 1ENAA 2QILA 1F9RA 4IOAA 4F88A 2F0TA 1HR0Q 2E2IB 3U50C 4GN3B 4X65L 3PGZA 1G6PA 1J5EL 3MC0B 2QW7A 4JI0Q 3DUZA 4IPHA 2B2TC 2MO1A 2R7ZH 2E76C 4KY5A 4PZ6A 2MPMA 1JE4A 3MFGA 4DK6C 1Q86C 4L6TB 5JEAG 4C2MH 3LNNA 4NMZA 3BYYB 3CF5A 3K5OA 4JPBW 3CD6A 3BZCA 4AH6A 2I46A 1I94Q 1XNQL 3PIOA 5HURA 1W6KA 5T1GA 3R2TA 3CC7A 3QOLA 1EEFD 1QG7A 1KTKA 4HJ8A 1VQAA 3NUCA 4IUPA 4CHTB 2F3WA 3ICEA 1Z6HA 1C7YA 2ZT9C 2CWAA 1I50H 2F4VL 5BN5A 1GUTA 1EYCA 3F8TA 1AZQA 4NXMQ 2RDFA 1KIXA 1SE3A 2ALYB 5JPNC 3CXCA 1SYCA 1VQLA 2IX1A 3MHBA 4DFAA 5L37A 3C2PA 3V96A 2C35B 2Z8LA 5IP7H 2EYJA 1QNUA 1IW7C 1K8AC 3I3CA 3I4NB 1EL0A 2AKWB 1KAWA 4K6DA 1STHA 3R3OA 1R9TH 1CHQD 3M3YB 5T1IA 1SFOB 2IL8A 5CR3A 3GTJB 2MQHA 5E1FA 3V2TA 1CSQA 5GROA 1XMQL 2JA7B 1EY0A 1K0SA 3ONAB 1S4ZA 5GQOA 4HR7B 4R4TA 3HOWB 4JC0A 1Z7TA 5IYDG 1BR9A 4Q0FA 2NVXH 1QVGA 2DNEA 3OSOA 2UUAL 5EPLA 2MUYA 2AQ2B 4A3KB 1O78A 1C8CA 3AU7A 1GHJA 4O42A 5KIXA 3A74A 1I4HA 4A3GG 1I3QB 2B63G 3A54A 4L5SA 3PQIA 2ATWA 1XYIA 4Z9CB 1Y1WH 1HUMA 1FR3A 4K5WA 4QGUA 1V1PB 1I4GA 1FNVA 2TMPA 1PH1A 3BJUA 1LTBD 1VMPA 2VB2X 3M7GA 4B3ML 5C3EG 1UE6A 3KF6A 1TWHB 1M8AA 1Q90A 2F0MA 3HOZH 2YU9H 4NP5A 4GKKQ 1CZGA 1KQSA 2EPBA 3UDGA 2K75A 3W5OA 4B08A 5LL6X 4YHHL 2VW9A 3QWNA 5DM63 4XDXA 5IY0A 1VMCA 1HNZQ 2F4IA 3T16A 3HKZE 3WOFA 2OEOA 2K04A 3BZDB 4UPAA 2WIIB 2Q8RE 3STBC 1GOZA 1QNKA 3D8GA 4KI0A 1KRSA 2BE5D 5C5LA 4A3EG 3LWEA 1PLFA 1SNOA 1YNND 4FXGC 5FJ8G 2CCZA 4JCVE 4Y7NB 2RDHA 1D1KA 1X55A 3EQLC 1LABA 3AQQA 1C0AA 1K28A 5ELCA 4DNRB 4OWXB 3Q22A 4RH6A 1PFSA 4HCSA 4JW0A 1R9TB 3G71A 4X66L 4A3EH 4FF3A 1QILA 2JA7H 4FXKC 1PH3A 1IBLL 3R8BA 5C4HA 1FD7D 4C3IH 3CRKC 2B39A 1R4QB 4QIWE 1UEAB 3NXWA 4BY1B 2UXBQ 3F2CA 3S1NB 2NVXB 3P20A 3FPPA 2A69C 3BVGA 4L63B 1SMYC 3SR1A 1D1IA 2VQFQ 4BA1I 2K50A 3UE0A 4C3HG 4A3JH 2BH8A 1LYLA 2BDNA 3A8JE 1HHVA 4XYOA 3H0GG 2YYZA 3P7JA 3HKZB 2OXPA 4XQNA 2LKVA 4OX9Q 4DR3L 4LF8L 3ZYYX 2E74C 4PMBA 1DJRD 4KN7C 3STBD 3DWAA 1B4OA 3K0YA 4GOPC 2A74C 1LTTD 5C3WA 3NENA 3J80i 1STBA 4RMFA 3C1FA 2PW7A 1PH4A 2HIXA 1B7YB 2YU9B 2RCFA 3HOWG 3MXUA 2RA4A 5FLXc 4KTAA 3JAME 2PCFB 1TWCB 2QDBA 4KMUC 1IYUA 2IJ0A 4LF5L 4LF9L 3RZDB 4O1NA 1L1OB 3HOYB 2VXWA 1PDQA 4I7AA 3G6JB 1HUNA 3H3VC 1IL2A 3FMCA 1JJGA 1XNRL 2H4OA 4R1JA 1NE3A 1FJGL 1HNWL 2K33A 3CU7A 2JA6G 1EY5A 2XIWA 5EBDA 4FXDA 1HR0L 2HCCA 1YIJA 2A5HA 3S1RH 1YHQA 2MFIA 4POFA 3GP7A 4DAPA 1TR5A 3NK9A 3NBHB 2NWGA 3IKJA 1EIGA 5DM73 1JOQA 3H3VH 1N34Q 1IBML 1GO3E 2N3SA 1AFPA 2KJXA 3I4LA 1CKMA 2HUGA 4DGZA 3TP8A 3TS0A 4OL7A 3NQIA 3PUZA 4DK3C 1G6ZA 2VQFL 4BXXG 2LS01 3K81C 1PZID 3S16H 4U68A 3SK5A 3VYTA 4DR7L 3S2HB 1FVIA 3BVZA 3P1HA 4BBRH 3HKZG 3OPOA 4IUTA 1YI2A 4GOPA 3H91A 2L9HA 3KOJA 2FHTA 4C1NI 2K5DA 3GTQB 5E3FA 1EEID 2PMZE 5IP7G 4R8NA 1VQGA 5LMNW 4JG2A 4JK1C 1F2MA 3VR3A 1HZBA 4ABNA 1G291 1J5EQ 4K6LA 4V190 4LAAA 2UXCL 4E6IA 3HOVH 2UUBL 3SEBA 4OELB 1HQRD 4DV4Q 5JEAH 5FJ8H 2UUCL 3ERSX 4EQ5A 1NMGA 2HT1A 2F3IA 4CJ2C 2JA6H 4NDXA 3Q6SA 1B53A 3AMUA 2B2UA 4HAEA 3U4VA 1AW7A 4JYAQ 2A6EC 3E0JA 4OEMB 1PFBA 2CWPA 1I6VC 2KA7A 4YCVA 3UDFA 3SK6A 1JMCA 3OW2A 4QUCA 4X62Q 1A3UA 1X54A 3SXHA 4A3CG 3PO2H 4LFBL 1K73C 4KKUA 3TN2A 1N33L 3PUVA 2X6LA 2KHJA 3GTGB 2JA8G 1SEBD 3J7AV 3A0JA 1STEA 2EYFA 1F2YA 3J7YW 1X3GA 3AEVA 3F1ZA 3JAMi 4RKLA 3H0GH 5ELEA 1D7QA 1YNXA 2ZJQA 2ZM6L 3KYHC 3NTIA 5M3MB 4DR7Q 1SN8A 2B2VC 2WP8J 3R2IA 2RCNA 1M1KC 4QY7A 4HTHA 2EJGC 1U4PA 2A1AA 3S17B 1UE7A 3B6YA 5LHY1 3VA5A 1SJHD 1ICWA 5D3IB 3EFXD 3GTLB 4GKKL 1N32Q 3A5UA 1HQMC 3PO3H 5JAVA 1QZGA 2E5LQ 1QWYA 1BBXC 2EY1A 4MTKA 4FO2A 3RR5A 4GKJQ 2KECA 4YCUA 1MIUA 2UXCQ 5IYCH 2EY5A 1EFWA 2VS1A 3OIPA 1K83H 4IJHA 4XIGS 1DGSA 2L4NA 1IZ6A 2F1MA 2B63H 4C2MB 5C4ZA 3HOUB 1TS3A 2K5QA 3GDEA 1KNAA 4IURA 1LT5D 1RTOA 3KK7A 4GNXB 1PVOA 2LFNA 3PO2G 2SNMA 1RKNA 3RLFA 3MXGA 4B3TQ 1J8IA 4A3GB 4CJ0B 1VQ6A 2QDLA 4ZLTF 1SMYD 2FFKB 5G3LD 1SNPA 1EYGA 2Y0SE 2JA8H 4EVOA 1BF4A 3I7FA 2JE6I 1VQJA 3HOUG 2VQEL 3S14B 1YHAA 1T9HA 4QB4A 4BS9A 5TSSA 1N33Q 2NN6H 4RA8A 1MI2A 4HIOA 3H3VI 4GOPB 1VQ7A 1JCKB 3PIP3 1SYFA 5IYBG 2WV6D 5C4XH 1BCPD 1B9NA 1TWAB 4BY1G 3D31A 3J81c 1VQ5A 1SJED 2IX3A 3OTOL 2AWNA 1SFOH 3M85A 1WCMG 2ZTEA 2NVQB 4NPSA 1WTXA 3NEMA 4C3IB 2OWOA 1IHZA 1BCPB 3FVQA 4FNFA 1OXSC 2F0SA 4EGVA 4RCOA 5JJIA 5IYCG 5JVH3 4PMCA 1HNXQ 1ENFA 4A3IH 2VNUD 2FMMA 3QOJA 1WVLA 4IALA 1IKLA 3C46A 3HRZC 1EY8A 4F7XA 1PTOH 1SAPA 3SGIA 5M5XB 2D62A 3CKIB 2ZTDA 4H02A 3EIVA 4XQJA 5LMUL 1VQFA 3DM3A 3WDNA 4ILWA 4G7HC 4OIJA 4WRDA 5J39A 2KCCA 4POGA 1EU3A 2JXMB 3GQBA 3MFYA 3OWFA 1G8ZD 1H9RA 4P74A 2L0CA 1SR3A 2EY2A 3RNUA 4F8MA 3O13A 1BCPC 2VUMB 3OYYA 1N36L 1F9QA 5D14A 3UI2A 5IGEA 3GO5A 4LW1A 4OX9L 3Q0AA 4OONA 4TSSA 4DXFA 2IT1A 3GTJH 3ITPA 3KDFB 5E4WC 5GAEC 1YJNA 4LFAQ 4IFDJ 1FJGQ 4DV6Q 1EWCA 1X9NA 1CKOA 2F0GA 3FDTA 5C0XI 1I5FA 1Q8IA 3BZKA 2O4XA 2PQAB 2Z6KA 1MGSA 3MVVA 5KNCA 3K6OA 4ULLA 4I65A 3BG3A 1NAPA 3RN2A 1A2TA 4UP9A 4HMJA 4DR2L 4DNIA 1HZ9A 1X3FA 2Q8IB 3KJOA 4LF9Q 1Z9FA 2YTYA 4S3SA 1L1OC 3IFDA 4A75A 2I0QA 4A93B 2B8FA 2HCIA 1E7ZA 1HNXL 4DN4M 3PIPA 1SYDA 1KLGD 3KLRA 2CHBD 4K0KQ 4IUQA 2E2IH 1LTID 4KKTA 4BBSB 4OIKA 4C3JG 2Y0SB 3J80L 4AQYQ 5NUCA 1PRTD 5LMUQ 3S2HH 1KRTA 2IHEA 5FO9B 4APVA 4KV6A 2K5NA 2WB1G 2UUCQ 2YTVA 2JN4A 4JVZA 3IFTA 3GV3A 3Q8DA 5K5PA 3D4WA 2JSOA 3AFPA 3C1EA 4H0LC 4L5RC 5COYA 1V1PA 5J1ZA 3TSSA 2WFWA 2MGSA 3S1QB 2CQOA 4C3HH 4JV5Q 1U4LA 4HCEA 1ML0D 4G7ZC 4ZUIA 1IBKL 1K8MA 3RD4A 5BR8L 1QUQA 4JI7L 3NBHA 3PMFA 3ULLA 4HJ5A 3VYSA 1S5ED 1W3SA 5DAUA 4GNXA 5G3LF 3S15B 1B3QA 1L0XB 5KYIA 1E1OA 1UWVA 2WAQB 4X62L 4YY3Q 1K3RA 1IYJB 3W1BA 2M9VA 2BDOA 2NZOA 4XYQA 3FEWX 3L0OA 2WINB 4DV0L 4R4IA 2GVBA 4ZKCB 1PYWD 1NR2A 3QB3A 3DMUA 4ZKBB 5CMDA 1PTOF 4WJ4A 2CKZB 4A3MH 4HSPA 2A68D 4A93G 2KUMA 2XSCA 4KD3A 4XT1B 5M5WH 3TBIB 1CQVA 4ZK9B 3UDIA 1PZKD 1VF7A 3WWVA 5A2QE 4K0KL 1G2SA 3PSIA 3D4RA 2K28A 1WTQA 3FPUB 2N55A 4AQYL 3LWUA 4A93H 3J81j 4WORA 4DV7Q 3FKIB 4ZQ3A 2HHHQ 1VQDA 3HZXA 4R8IA 2Q2TA 5C4XG 2NVYB 3ERQA 3I8ZA 4XQQA 1I3QH 2NZ1D 1B2TA 3GTLH 2G9DA 4DV2L 4DPGA 2N78A 2R93G 1NSNS 1NR4A 3ND9A 1IL8A 3CRLC 1MJEA 4IFDI 1SSOA 1YZ6A 2RQXA 3W3AA 4FDBA 1SNCA 4I7ZC 3GTPB 3HOUH 3I72A 1RHPA 4JI6L 2WACA 1S72A 2B2YC 4GNXC 1UE5A 4LK1C 1ILPA 1EYDA 5E4XA 1ET9A 3PO3G 4MTNA 1Q7YC 4AYBG 1HXYD 3OWEB 1JWMD 5C44B 1QVCA 1GHKA 2KENA 2RHSB 3DHQA 3JC66 1TQOA 3K7AH 1K3BC 4FVMA 5KGUA 2Z4HA 4BA2I 3HGBA 2AQ1B 4GN5A 4B9XA 4EQPA 3AB9A 4JI3L 2KBNA 1YJWA 1HR0W 2BH2A 4RGMA 1MSHA 4CDEC 1KAAA 3RZOH 1ZXTA 4JI2L 1GD7A 5A35A 2FXQA 3S9WA 2M2LA 1V9PA 2WKDA 2V4DA 4ALPA 3S2DH 1K8OA 1HCZA 1CM9A 1QOHA 5C3XA 4A3JG 4C1NK 5C0XH 4FF2A 1FGUA 3A8IE 2F0OA 3E9IA 3LX0A 3S16B 2D0PA 2VL6A 1BDOA 1WTRA 1A15A 3BVMA 1TS4A 4OWWB 4G4KA 1A62A 1L1OA 1OXTA 2ENBA 1VQEA 1NY4A 5C4JB 3HP3A 1LT3D 3NQTA 3MXPA 3KF6B 4DUYL 2DN8A 2PO4A 2ZXRA 2UUAQ 3I70A 2D5DA 5EKKA 1IKMA 1D5MC 4RKBA 2OTLA 4N9PA 4C3JB 2F0HA 5FO7B 1KLUD 2HQLA 2JQOA 3DEOA 5BN4A 2DUDA 4RWSC 4Y52H 4A3FH 1PHJA 4DR6Q 3BYTB 2E2JH 3J7ZC 1NUCA 5IODA 4KHPL 1NMFA 5CV8A 1JR0D 2EQSA 2VB3X 3PCOB 1KD1C 2BE5C 4IO9A 4UAIA 2Z9HA 2F0VA 2F0DA 5EGTA 1NTGA 2BOSA 4CKCA 3J80E 5IOCA 1CT1D 3E5SA 3K5LA 1J9OA 1VQIA 1E24A 4Q5VA 3L7ZC 3HOZG 2NN6I 2IWHA 2Z6KC 3RLOA 1I6HB 5GADC 1G91A 3GTMB 4PQXA 2DGYA 2SNSA 2NUCA 1Y8OB 4PG3A 4JI8Q 1GKHA 1H9JA 4QIWB 1F2ZA 3VDYA 4BXXH 2JA5B 1WJJA 4XXEA 5JEAJ 2F03A 1LTGD 3UDXA 1U9RA 3K59A 1DXMA 4CKEA 5LMNQ 4JBKA 2R93H 4B9WA 1U0LA 2PZUA 3L3OC 5EPKA 1E1TA 3I4MH 3E9HA 1X65A 4RAUC 3SK4A 1YJ9A 1AH9A 5IYBH 1EUJA 1IBLQ 1EZ6A 1CFMA 1TS2A 5JPMC 1LT4D 1KHIA 2PZTA 3MXNA 1TWFH 2KCMA 4ZAIA 2ZJPA 1RF2D 2F0FA 1DM0B 1U4RA 1MKHA 3CQZB 4IN3A 4N9TA 2UXBL 4J1MA 1ASZA 1II3A 2EVBA 2MHVA 4LF6L 3H09A 1X3EA 2F52A 2YTXA 2PPBC 3C3LA 1SYBA 2SOBA 1VQPA 2H1EA 3TRZA 4A3BB 5IT9L 1H95A 1VQ4A 1MD2D 5FO8B 1UNSA 2HIVA 1OO9B 4X3TA 3S1QH 4P2CB 3BU2A 4JI4Q 2WAQG 4DR1Q 1CSPA 2F0LA 1BXTA 3MXNB 3CMAA 4A3FB 1PH8A 1BBWA 3NHHA 2ICEC 1S3OA 1PFMA 1YNJD 3S14H 2EJFC 2E75C 2EE1A 4Y7NH 1TKWB 4C3IG 4A3BG 1ESFA 1UEBA 3I4NG 2OTJA 2OQKA 3MAQA 1TWAH 2QGQA 4DKAC 2F0EA 2F0QA 2SDFA 1XNRQ 1Y1VB 2Z1CA 4KHZA 1HH2P 2KQ3A 5IGCA 3M4YA 4LUZA 4QUFA 5BR8Q 1EIHA 2JP1A 1DD2A 2Z4IA 2K03A 3OW7A 1SYEA 4A3MB 3HS0C 4DUZQ 3FKIG 5JVG3 2K7VA 1PV4A 5IT9c 2RSOA 4A3IB 1HA6A 5AFWA 4HIKA 5EKLA 5M5YB 2HQEA 1XWEA 4BY7H 1KDBA 5ELNA 1UE1A 3H0GB 3M4OB 4KN4C 5I9OA 4HJAA 1H9SB 2K4KA 1HRJA 3FKIH 2E2HH 2B2WC 4A3JB 1F9PA 1XMOL 4DAMA 1EFID 3NTHA 4A4IA 1L2FA 4BBSG 2L15A 3W1GA 1Y14B 3NP8A 4QF4A 2A8VA 2FINB 2R7ZB 4JYAL 1TXYA 3M7NA 1PH6A 2A6HC 4B3MQ 4X64L 5CV5A 1BQQT 1D8LA 1FNWA 1WTOA 1EU4A 4LFBQ 1E0BA 2X6GA 3ND8A 2EJMA 1CZWA 3TREA 2PI2E 4U673 5JJKA 1CI3M 1S40A 1PXUA 3K7UC 2PI2A 1VQ9A 1EQRA 3GTGH 3VR6A 5FOBB 1G2TA 2JK8A 4QMGA 3CC2A 3HKSA 2K5WA 4X6AH 1NBWA 4HJ7A 4IZ8A 2ZM6Q 1V1QA 2G5DA 4KY7A 1LM0A 2F0JA 1OXVA 2MNAA 4O0AA 1PFNA 3DLLA 1X3PA 5M9OA 2C5CA 1HA5A 3H94A 2DJGC 3P75A 4A3LG 4ODGA 5HGTA 2F0WA 1STYA 4JI0L 3A8KE 3A56A 1Y1WB 1SBBB 4RHSA 4KK7A 2CH4A 3NBIA 3J7A5 3CW2C 3I2ZA 4TQUS 1CK1A 2C9OA 3D6WA 4GS3A 2PNRC 4JI2Q 1ZYRD 5M3FH 1TWHH 2RVLA 3M4QA 1V43A 3DM1A 2Q8TA 4K2KA 4CKBA 1VQNA 4IPDA 2A6HD 2PQEA 4GLVB 4GZYC 3SVMA 1OXUA 1TIID 4IPGA 3PUWA 4JI1Q 4A3KH 2H5XA 2J4XA 3J80c 1ZKOA 1VDZA 3SE0A 3V05A 4QL5A 3I56A 4C3JH 4K8JA 5FLMH 4GKJL 2NVYH 3RN5A 3GV6A 5EPJA 2VY3A 2F0IA 1TWGB 2E5LL 3L2PA 2BA1A 3S24A 4DUYQ 5EBCA 1XTDA 1YBYA 3HOXB 3EJIA 2IY5B 3CCSA 1H9KA 4DAVA 3OHXC 1E3PA 5GAGC 1Q46A 5C6AA 1Q82C 2R92B 1B1ZA 1YNNC 4OXPA 5CV4A 1U4MA 4LF5Q 1WCMH 1F9SA 3GD7A 3GTMH 2RBMA 4DA2A 2PYKA 2G9HD 5IP9G 2JA7G 4DK0A 3NELA 5LMNL 1A63A 3HOXG 3JAMc 2R7ZG 3RMHA 1A3VA 3KLSA 3GTOH 2CW0D 1PYSB 5CV6A 4DV5Q 3DXJC 1XTCD 1EIFA 1EY9A 4QQBX 1Y1VG 4MZ9A 3X3MA 5I9PA 3OTOQ 5EKIA 1R4PB 1LACA 5EQ0A 2Z6BA 1KDAA 3I90A 4JOIA 3J7AF 1O7YA 1D2BA 1XJVA 2R3ZA 2VUMG 4JI8L 2QKIC 3PUYA 4UHVA 4A3MG 4LFCQ 4LUVA 1RD9D 2AMCB 2KCNA 1TWFB 3S1MB 3PO3B 1TT2A 1O7ZA 2AQ3B 5C0XG 4KJNA 3CQZH 1SRUA 2J7ZA 1WD1A 5C44G 4CDFC 2F3VA 4L8JA 4ZUJA 1KC8C 2B3GA 2BA0A 3KLWA 3TP5A 4CGYB 4DAYB 5DLQE 4LF4Q 4CDDC 2ZXOA 1CTMA 5ELDA 2LXKA 3WOEA 4DR1L 1EYAA 3N6RA 1LO5D 5IWAL 1EY7A 1Y69U 4A3BH 4LMQD 4X3SA 5C44H 3G48A 3E6ZX 4P71A 3EA6A 2JEBI 4PNYA 2PNHA 1HZAA 1HNZL 3DWQA 3QO2A 5I6YA 1I50B 1PH2A 4HJ9A 3RUZA 3JAML 4DV4L 2P5ZX 5K36H 2KHSA 3HFZB 3IL8A 1Q3LA 1TWGH 4LF6Q 1FYCA 4DR2Q 1KXLA 2EYLA 1C48A 3BS1A 3RZOB 1C9OA 1K9MC 1JC7A 4A3LH 3KLSX 1LV9A 1KDCA 2I07B 2XWJB 1D5XC 3S2DB 3PF5A 4QCLA 4JI4L 1ZEQX 3G4SA 4CBVA 1KL9A 4A3IG 1VQKA 2XRSD 2EOTA 1GUSA 4HEDA 2O5JC 1WTVA 3T1YL 5C3EB 4FYDA 2A19A 1A8VA 4P75A 2OF1A 2JA5G 2LMCB 4NB3A 3KF8A 5EAYA 1W6JA 4NW2A 3I4OA 1LTAD 1AZPA 4AYBE 1H9SA 1O7IA 4BBRB 3F2BA 2NN6G 3CCLA 3KDFA 1B50A 2LY7A 1QZHA 5DNFA 1M4VA 1NCVA 3T13A 3GTQH 4OO1G 2D9UA 5F2DA 2B8GA 2OT2A 1BO0A 3KUPA 4WFN3 1WYDA 4JV5L 2ID0A 1PA6A 5I6WA 3UE1A 4EQNA 1IYVA 2IPKD 1IBKQ 1TVXA 2CFMA 1JQYD 4DUZL 4FF1A 1PRTB 1IXRA 2F4VQ 1B3AA 3S1MH 4GN4B 1N32L 4NXML 1VF5C 4LF7L 1RJTA 1DOLA 1UUPA 1MJCA 2E2JB 2B2WA 4A3DH 2NTTA 3S15H 3ER0A 2L11A 1YNJC 4DV1Q 1GUGA 1FNUA 4N8X1 3I73A 1JOOA 1SLJA 2R7FA 3CCVA 3CCMA 1RODA 4KLKA 2E8GA 3PO2B 3HG9A 2D2CC 4G57A 2O5IC 3HOYG 1J6QA 5FLXE 2I5LX 1PH7A 2UU9L 5CBAE 1O80A 1CUKA 2PZWA 1EQTA 4UDUC 4DR5Q 5M5WB 1L0YB 1CQFA 1XMQQ 1SE8A 1GVPA 1HTPA
chains in the Genus database with same CATH topology
3TZUA 1JB3A 3T4AC 4KY6A 4JBWA 3K57A 1VCIA 4RFBA 4ME5A 5IGFA 1KABA 2IW3A 5JOBA 2XVSA 1LTRD 3NWTA 4TRDA 1SDFA 1I4PA 4TKOB 4IUVA 2KEDA 4X3UA 4HN7A 5M3FB 1WD0A 5A2QL 4BY7B 1EWHA 3D3RA 5DEHA 1BNZA 4K8IA 3TMEA 2NVTB 1QE6A 1Y8NB 2HDMA 1AN8A 2K01A 1B9MA 2B2YA 1GUNA 4FP5D 1DOMA 1T5EA 1HFGA 2DY8A 5LL6S 1JICA 3QJYA 1D6EC 4IQZA 4H7BA 4J8QA 3MWYW 3BDLA 2KEEA 3Q23A 1JOKA 2KVMA 1EZ8A 1STGA 1Q12A 4OO1I 1DYQA 1F2LA 1TU2B 2SEBD 4G7OC 1QJOA 3W2DA 3U9OA 1EY6A 2MP1A 4YIJA 1PTOD 1ENCA 5D3DA 1GJXA 1S5CD 2GA4B 2ZXPA 3S1RB 3PV0A 3VYRA 3NWSA 2F0NA 1SNDA 1PTOB 4IUNA 3BDCA 5C0XJ 1Q1BA 3K5MA 1O7LA 3X3NA 3GTKB 3MTSA 1DOKA 2XNAC 1E2VA 5ISRA 5K36G 2RDGA 2K1BA 1D5ZC 3J81E 5I2XA 1IW7D 2EY6A 3SDZA 1EOTA 5BN3A 1RTNA 4RGTA 1PTOC 2K05A 3EROA 3URYA 5I4DA 3VYUA 1T5XD 3K7AB 4DNTB 1S5FD 1E2WA 5IT9E 1TS5A 4MHEA 5KNBA 4CJ1B 1DZ1A 5CBEE 2F0PA 3I91A 2CW0C 5IGDA 1TY2A 4XT3B 5J22A 4M1UB 5IIFA 4OGQC 1PRTF 1Q1EA 1RCVD 3D6CA 3T53B 3PUXA 4AYBB 4HMIA 5EJWA 1RDPD 4ZRZA 5KEEA 5I2YA 2JEAI 1OXXK 3VR4A 2EXZA 2ICIA 4RGOS 4EQOA 2E2HB 4F87A 4C3HB 4IFDG 3D4DA 2NTSA 3DWPA 2RSNA 2CQAA 5KNDA 1PZJD 1A6XA 2KOLA 2B63B 4ZYSA 2EYPA 3HOZB 3EVQA 1LT6D 1STAA 5FKAC 3K58A 2L55A 1GUOA 1B44D 1JWSD 1QCBD 3Q24A 4XTCS 2XRQD 3F2UA 3HOVB 5JJZA 3L9AX 4BWGB 1SYGA 4RGNA 5KYLA 3GTOB 4J6HA 5IGBA 3MA2B 1DCZA 1V1OA 3TP7A 1A2UA 1BCPF 2A68C 2A73B 1SNMA 1BOSA 5ELBA 2EZVA 4K5VA 1E2ZA 2R93B 4A3EB 2L1BA 1GUWA 4RCNA 3R93A 2QCPX 3NPPA 4DU9A 2QEJC 1CHPD 4H13C 1HPCA 2NYZD 4RHRA 1ILQA 3MZ5A 2F0UA 2DY7A 3KBXA 1AP0A 1X32A 5ELFA 2J0TD 3OMCA 5IGGA 3CHBD 3QIAA 4KKSA 2K32A 1ONLA 4DK1A 1SE4A 3TDQA 1PRTC 4PV1C 1K83B 1BUVT 2N88A 1I4XA 1Y8PB 5FK9C 4OHJA 2B2UC 1UAPA 3T51B 2NB0A 4KJOA 2HDLA 2RKSA 3NE5B 3QG1A 4LJZC 3TP6A 4ID6A 4HSVA 1CA6A 4C56C 4MIUA 2X69A 3OOCA 4IFDH 2FJ2A 1DONA 3TZDA 1ET6A 1STNA 2BCOA 4M8AA 3VA7A 2XN9C 1I4QA 1H9MA 2E2DC 1ZYRC 1JWUD 4KHVA 3SK8A 5D65A 2TSSA 2L5TA 1X3QA 2FMCA 2NBFA 2A69D 4A3DB 1CA5A 1S5DD 2B2VA 3FRPB 4OO1H 3N52A 2JYOA 1TY0A 1WTPA 5KRUA 3SHLA 2AWOA 4DAYA 2R6GA 4H44C 2M00A 2K6AA 1V8QA 1JORA 1KNEA 5CGKA 1SXTA 3K5NA 2IX0A 2JA8B 2AUJD 5CC4A 2O2LD 2PMZB 3NTKA 2XWBB 5CV7A 1LLRD 4DXGA 1SE2A 2PW5A 3DEPA 3G7LA 1PMRA 3U9SA 4NKLA 2F0KA 3I4MB 2EYMA 4K5XA 2DNCA 5CYUA 1GXDC 4FF4A 2MJ8A 4MN3A 2EYHA 1C4QA 3MEHA 4IUUA 4V0BA 2AUKA 1LTSD 1MBYA 1MSGA 4KD4A 4PMWA 3A7AB 1ESRA 2WB1B 1HTLD 3PIO3 1F77A 2WKCA 3A7LA 3A55A 3NSWA 1S5BD 4K2LA 3IAYA 2B2TA 1XX8A 4DF7A 1FGBD 1HFNA 2JA6B 1SNQA 1A3TA 4R9WA 5C5MA 1QB5D 2CVRA 4X3KA 3J81L 3KBGA 1EQVA 2EDGA 3VR2A 3BDOA 3VR5A 3T56B 1XXGA 5CV9A 3HEJA 1AEXA 1WCMB 1Z47A 2L12A 3OMGA 2EYOA 2A6ED 1WTWA 3H6MA 1EY4A 4WJWA 2R61A 2QF7A 3OIQA 5CORA 4K14A 5FLXL 5C4XB 1I4RA 1ENAA 2QILA 1F9RA 4F88A 2F0TA 2E2IB 3MC0B 3DUZA 2B2TC 2E76C 4KY5A 2MPMA 1JE4A 3MFGA 4L6TB 5JEAG 3LNNA 4NMZA 3BYYB 3K5OA 2I46A 5HURA 1W6KA 5T1GA 3R2TA 3QOLA 1EEFD 1QG7A 1KTKA 3NUCA 4IUPA 4CHTB 2F3WA 1Z6HA 2ZT9C 5BN5A 1GUTA 1EYCA 1AZQA 2RDFA 1SE3A 5JPNC 1SYCA 2IX1A 3MHBA 4DFAA 3C2PA 3V96A 2Z8LA 2EYJA 1QNUA 1IW7C 3I3CA 3I4NB 1EL0A 4K6DA 1STHA 3R3OA 1CHQD 3M3YB 5T1IA 1SFOB 2IL8A 5CR3A 3GTJB 3V2TA 5E1FA 2JA7B 1EY0A 3ONAB 1S4ZA 4HR7B 3HOWB 1Z7TA 1BR9A 4Q0FA 2DNEA 3OSOA 5EPLA 2MUYA 2AQ2B 4A3KB 1O78A 1C8CA 3AU7A 1GHJA 4O42A 5KIXA 1I4HA 1I3QB 3A54A 1XYIA 4Z9CB 1HUMA 1FR3A 4K5WA 1V1PB 1I4GA 1FNVA 2TMPA 1LTBD 1VMPA 2VB2X 3M7GA 1TWHB 1M8AA 1Q90A 2F0MA 4NP5A 1CZGA 2EPBA 4B08A 5LL6X 3QWNA 5DM63 4XDXA 1VMCA 2F4IA 3T16A 3WOFA 2OEOA 2K04A 3BZDB 2WIIB 2Q8RE 1GOZA 1QNKA 3D8GA 4KI0A 2BE5D 5C5LA 3LWEA 1PLFA 1SNOA 1YNND 4FXGC 4Y7NB 2RDHA 1D1KA 3EQLC 1LABA 5ELCA 4DNRB 3Q22A 4RH6A 4HCSA 1R9TB 4FF3A 1QILA 4FXKC 3R8BA 5C4HA 1FD7D 3CRKC 2B39A 1R4QB 1UEAB 3NXWA 4BY1B 3S1NB 2NVXB 3P20A 3FPPA 2A69C 3BVGA 4L63B 1SMYC 3SR1A 1D1IA 4BA1I 4C3HG 2BDNA 3A8JE 1HHVA 4XYOA 2YYZA 3HKZB 3P7JA 2OXPA 4XQNA 2LKVA 3ZYYX 2E74C 4PMBA 1DJRD 4KN7C 3DWAA 1B4OA 3K0YA 2A74C 1LTTD 5C3WA 1STBA 3C1FA 2PW7A 2YU9B 3MXUA 2RA4A 4KTAA 3JAME 2PCFB 1TWCB 2QDBA 4KMUC 1IYUA 2IJ0A 3RZDB 4O1NA 3HOYB 2VXWA 1PDQA 3G6JB 1HUNA 3H3VC 3FMCA 2H4OA 2K33A 3CU7A 1EY5A 2XIWA 5EBDA 4FXDA 2HCCA 2A5HA 3GP7A 4DAPA 1TR5A 3NK9A 2NWGA 3IKJA 1EIGA 5DM73 1JOQA 1AFPA 2KJXA 3I4LA 2HUGA 4DGZA 3TP8A 4OL7A 3NQIA 3PUZA 1G6ZA 2LS01 1PZID 4U68A 3SK5A 3VYTA 3S2HB 3BVZA 3P1HA 3OPOA 4IUTA 3H91A 2L9HA 2FHTA 4C1NI 2K5DA 3GTQB 5E3FA 1EEID 4R8NA 4JK1C 1F2MA 3VR3A 4ABNA 1G291 4K6LA 4V190 4LAAA 4E6IA 3SEBA 1HQRD 5JEAH 4CJ2C 4NDXA 3Q6SA 1B53A 3AMUA 2B2UA 4HAEA 1AW7A 2A6EC 3E0JA 1PFBA 1I6VC 2KA7A 3SK6A 4QUCA 1A3UA 3SXHA 4KKUA 3TN2A 3PUVA 2X6LA 3GTGB 1SEBD 3J7AV 1STEA 2EYFA 1F2YA 3J7YW 4RKLA 5ELEA 3NTIA 5M3MB 2B2VC 2WP8J 3R2IA 4HTHA 2EJGC 1U4PA 3S17B 5LHY1 3VA5A 1SJHD 1ICWA 5D3IB 3EFXD 3GTLB 1HQMC 5JAVA 1QWYA 1BBXC 2EY1A 4FO2A 2KECA 2EY5A 3OIPA 4XIGS 2L4NA 2F1MA 4C2MB 5C4ZA 3HOUB 1TS3A 2K5QA 1KNAA 4IURA 1LT5D 1RTOA 3KK7A 2LFNA 2SNMA 1RKNA 3RLFA 3MXGA 1J8IA 4A3GB 4CJ0B 4ZLTF 1SMYD 2FFKB 5G3LD 1SNPA 4EVOA 1BF4A 2JE6I 3S14B 4QB4A 4BS9A 5TSSA 2NN6H 4RA8A 1MI2A 1JCKB 3PIP3 1SYFA 2WV6D 1BCPD 1B9NA 1TWAB 3D31A 1SJED 2IX3A 2AWNA 3M85A 2NVQB 1WTXA 4C3IB 1IHZA 1BCPB 3FVQA 4FNFA 1OXSC 2F0SA 4EGVA 4RCOA 5JVH3 4PMCA 1ENFA 2VNUD 2FMMA 3QOJA 1WVLA 4IALA 1IKLA 3C46A 3HRZC 1EY8A 4F7XA 1PTOH 1SAPA 5M5XB 2D62A 3CKIB 4XQJA 4G7HC 3WDNA 4ILWA 4OIJA 4WRDA 5J39A 2KCCA 1EU3A 2JXMB 3GQBA 3MFYA 3OWFA 1G8ZD 1H9RA 2L0CA 2EY2A 4F8MA 3O13A 1BCPC 2VUMB 1F9QA 5D14A 3UI2A 5IGEA 3GO5A 3Q0AA 4TSSA 4DXFA 2IT1A 3ITPA 5E4WC 4IFDJ 1EWCA 2F0GA 3FDTA 5C0XI 1Q8IA 2O4XA 3MVVA 1MGSA 5KNCA 3K6OA 4ULLA 4I65A 3BG3A 1NAPA 1A2TA 4HMJA 2Q8IB 4S3SA 3IFDA 4A93B 2B8FA 2HCIA 4DN4M 1SYDA 1KLGD 3KLRA 2CHBD 4IUQA 1LTID 4KKTA 4BBSB 4OIKA 4C3JG 2Y0SB 3J80L 5NUCA 1PRTD 5FO9B 4KV6A 3IFTA 3GV3A 5K5PA 3D4WA 2JSOA 3C1EA 4H0LC 5COYA 1V1PA 5J1ZA 3TSSA 2MGSA 3S1QB 1U4LA 4HCEA 1ML0D 4G7ZC 4ZUIA 1K8MA 3RD4A 3NBHA 3PMFA 3VYSA 1S5ED 5DAUA 5G3LF 3S15B 1L0XB 5KYIA 2WAQB 2M9VA 2BDOA 4XYQA 3FEWX 2WINB 4ZKCB 1PYWD 1NR2A 3QB3A 3DMUA 4ZKBB 5CMDA 1PTOF 4HSPA 2A68D 2KUMA 2XSCA 4KD3A 4XT1B 3TBIB 1CQVA 4ZK9B 1PZKD 1VF7A 5A2QE 1G2SA 3D4RA 2K28A 1WTQA 3FPUB 2N55A 3LWUA 4WORA 3FKIB 4ZQ3A 3HZXA 4R8IA 2NVYB 3ERQA 3I8ZA 4XQQA 1B2TA 2NZ1D 2G9DA 1NSNS 1NR4A 3ND9A 1IL8A 3CRLC 4IFDI 1SSOA 2RQXA 3W3AA 1SNCA 4I7ZC 3GTPB 3I72A 1RHPA 2WACA 2B2YC 4LK1C 1ILPA 1EYDA 5E4XA 1ET9A 1HXYD 3OWEB 1JWMD 5C44B 1GHKA 3DHQA 1TQOA 4FVMA 5KGUA 2Z4HA 4BA2I 3HGBA 2AQ1B 4B9XA 4EQPA 3AB9A 4RGMA 1MSHA 1KAAA 1ZXTA 5A35A 3S9WA 2M2LA 2WKDA 2V4DA 1K8OA 1HCZA 1CM9A 1QOHA 5C3XA 4FF2A 4C1NK 5C0XH 3A8IE 2F0OA 3LX0A 3S16B 1WTRA 1BDOA 1A15A 3BVMA 1TS4A 4G4KA 1OXTA 2ENBA 5C4JB 3HP3A 1LT3D 3NQTA 3MXPA 2DN8A 2PO4A 2ZXRA 3I70A 2D5DA 5EKKA 1IKMA 1D5MC 4RKBA 4N9PA 4C3JB 2F0HA 5FO7B 1KLUD 3DEOA 5BN4A 4RWSC 3BYTB 1NUCA 5IODA 5CV8A 1JR0D 2VB3X 2BE5C 4UAIA 2F0VA 2F0DA 5EGTA 2BOSA 4CKCA 3J80E 5IOCA 1CT1D 3E5SA 3K5LA 1J9OA 4Q5VA 3L7ZC 2NN6I 2IWHA 1I6HB 1G91A 3GTMB 4PQXA 2SNSA 2NUCA 1Y8OB 1H9JA 4QIWB 1F2ZA 2JA5B 4XXEA 5JEAJ 2F03A 1LTGD 1U9RA 3K59A 1DXMA 4CKEA 4B9WA 2PZUA 3L3OC 5EPKA 4RAUC 3SK4A 1EZ6A 1CFMA 1TS2A 5JPMC 1LT4D 2PZTA 3MXNA 4ZAIA 1RF2D 2F0FA 1DM0B 1U4RA 3CQZB 4IN3A 4N9TA 4J1MA 1II3A 2EVBA 2MHVA 3H09A 2PPBC 3C3LA 1SYBA 2SOBA 2H1EA 4A3BB 5IT9L 1MD2D 5FO8B 1UNSA 1OO9B 4X3TA 4P2CB 2F0LA 1BXTA 4A3FB 3NHHA 2ICEC 1PFMA 1YNJD 2EJFC 2E75C 2EE1A 1TKWB 4C3IG 1ESFA 3MAQA 2F0EA 2F0QA 2SDFA 1Y1VB 2Z1CA 4KHZA 2KQ3A 5IGCA 3M4YA 4QUFA 1EIHA 2JP1A 1DD2A 2Z4IA 2K03A 3OW7A 1SYEA 4A3MB 3HS0C 5JVG3 2K7VA 2RSOA 4A3IB 1HA6A 5AFWA 5EKLA 5M5YB 2HQEA 1XWEA 1KDBA 3H0GB 3M4OB 4KN4C 5I9OA 1H9SB 1HRJA 2B2WC 4A3JB 1F9PA 1EFID 3NTHA 3NP8A 4QF4A 2FINB 2R7ZB 3M7NA 2A6HC 5CV5A 1BQQT 1FNWA 1WTOA 1EU4A 1E0BA 2X6GA 3ND8A 2EJMA 1CZWA 4U673 1CI3M 1PXUA 3VR6A 5FOBB 1G2TA 4QMGA 2K5WA 4IZ8A 4KY7A 2F0JA 1OXVA 1PFNA 1X3PA 5M9OA 2C5CA 1HA5A 3H94A 3P75A 4ODGA 5HGTA 2F0WA 1STYA 3A8KE 3A56A 1Y1WB 1SBBB 4RHSA 4KK7A 3NBIA 4TQUS 1CK1A 2C9OA 3D6WA 2PNRC 1ZYRD 2RVLA 1V43A 3DM1A 2Q8TA 4K2KA 4CKBA 2A6HD 2PQEA 4GZYC 3SVMA 1OXUA 1TIID 3PUWA 2J4XA 1ZKOA 1VDZA 3SE0A 3V05A 4K8JA 3GV6A 5EPJA 2F0IA 1TWGB 2BA1A 5EBCA 3HOXB 3EJIA 1H9KA 4DAVA 3OHXC 5C6AA 2R92B 1B1ZA 1YNNC 5CV4A 1U4MA 1F9SA 3GD7A 2RBMA 4DA2A 2PYKA 2G9HD 4DK0A 3RMHA 1A3VA 3KLSA 2CW0D 5CV6A 3DXJC 1XTCD 1EY9A 3X3MA 5I9PA 5EKIA 1R4PB 1LACA 5EQ0A 1KDAA 3I90A 3J7AF 1O7YA 1D2BA 2R3ZA 2QKIC 3PUYA 1RD9D 2KCNA 1TWFB 3S1MB 3PO3B 1TT2A 1O7ZA 2AQ3B 5C0XG 4KJNA 1WD1A 2J7ZA 2F3VA 4L8JA 4ZUJA 2BA0A 3TP5A 4CGYB 2ZXOA 1CTMA 5ELDA 3WOEA 1EYAA 3N6RA 1LO5D 1Y69U 1EY7A 4LMQD 4X3SA 3E6ZX 3EA6A 2JEBI 4PNYA 5I6YA 3DWQA 3QO2A 1I50B 3RUZA 3JAML 5K36H 2KHSA 3IL8A 1Q3LA 1FYCA 2EYLA 1C48A 3BS1A 3RZOB 1JC7A 3KLSX 1LV9A 1KDCA 2I07B 2XWJB 1D5XC 3S2DB 4QCLA 1ZEQX 4CBVA 2XRSD 2EOTA 1GUSA 4HEDA 2O5JC 1WTVA 5C3EB 4FYDA 2OF1A 2LMCB 3KF8A 1W6JA 4NW2A 1LTAD 1AZPA 1H9SA 4BBRB 2NN6G 1B50A 2LY7A 5DNFA 1M4VA 1NCVA 3T13A 4OO1G 2D9UA 5F2DA 2B8GA 2OT2A 4WFN3 1BO0A 3KUPA 2ID0A 5I6WA 4EQNA 1IYVA 2IPKD 1TVXA 1JQYD 4FF1A 1PRTB 1B3AA 1VF5C 1RJTA 1DOLA 1UUPA 2E2JB 2B2WA 2NTTA 2L11A 1YNJC 1GUGA 1FNUA 3I73A 1JOOA 1RODA 3PO2B 3HG9A 2D2CC 4G57A 2O5IC 5FLXE 5CBAE 1O80A 2PZWA 1EQTA 4UDUC 5M5WB 1L0YB 1CQFA 1HTPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PIO 3;  4U67 3;  3PIP 3;  4WFN 3;  5DM7 3;  5DM6 3;  5JVH 3;  5JVG 3; 
#chains in the Genus database with same CATH topology
 3RLN A;  3J81 i;  5AJ3 Q;  1LUZ A;  4PZ8 A;  3TZU A;  3ULJ A;  1JB3 A;  3PF4 A;  3T4A C;  4KY6 A;  4JBW A;  3K57 A;  4JI5 Q;  1VCI A;  4RFB A;  4ME5 A;  5IGF A;  2LSS A;  1KAB A;  1JB7 A;  2K52 A;  2IW3 A;  5JOB A;  2XVS A;  5C3E H;  1N9W A;  4IJL A;  4UY8 C;  1LTR D;  3NWT A;  4TRD A;  1SDF A;  1JJC B;  1I4P A;  4TKO B;  4OWT B;  4IUV A;  2KED A;  4X3U A;  1X56 A;  4HN7 A;  2MO0 A;  5M3F B;  5C4J H;  1YVC A;  1L0W A;  1WD0 A;  5A2Q L;  1M90 C;  4BY7 B;  1EWH A;  4HIM A;  3D3R A;  5DEH A;  2I5H A;  1BNZ A;  4K8I A;  3TME A;  2NVT B;  2HHH L;  4UP7 A;  1JT8 A;  3S17 H;  2QEX A;  1QE6 A;  1Y8N B;  2HDM A;  4A3G H;  1AN8 A;  2K01 A;  4CDC C;  4YHH Q;  1B9M A;  2B2Y A;  2V1C C;  1GUN A;  1Y1W G;  4FP5 D;  1DOM A;  1T5E A;  1HFG A;  2DY8 A;  5LL6 S;  2B29 A;  1JIC A;  4A3C H;  2ASB A;  3KFU A;  2RHQ B;  1RL2 A;  3QJY A;  3CAM A;  1D6E C;  4IQZ A;  4TVA B;  4H7B A;  2UU9 Q;  1PH5 A;  4J8Q A;  3MWY W;  3BDL A;  2KEE A;  3Q23 A;  4DR5 L;  2N49 A;  1JOK A;  2DJF C;  1EZ8 A;  2KVM A;  4B3R Q;  1STG A;  1PH9 A;  4JBJ A;  1Q12 A;  4OO1 I;  1DYQ A;  1F2L A;  1TU2 B;  2SEB D;  4G7O C;  2EXD A;  1QJO A;  3W2D A;  3CPF A;  3U9O A;  1EY6 A;  1MHW C;  4JI5 L;  3FHW A;  2MP1 A;  4YIJ A;  1PTO D;  3M9B A;  1ENC A;  5D3D A;  1GJX A;  1S5C D;  2GA4 B;  1VQO A;  2ZXP A;  3S1R B;  3PV0 A;  3VYR A;  3NWS A;  2F0N A;  1SND A;  1PTO B;  4IUN A;  3BDC A;  2WB1 E;  5C0X J;  1Q1B A;  3K5M A;  1A0I A;  1O7L A;  3X3N A;  4LF4 L;  3GTK B;  3MTS A;  1DOK A;  2XNA C;  1E2V A;  4X66 Q;  4L5Q A;  2K5V A;  5ISR A;  2R7D A;  5K36 G;  1EQQ A;  2RDG A;  4JOI C;  2WAQ E;  2K1B A;  1D5Z C;  4P73 A;  1WI5 A;  3J81 E;  2VUM H;  5I2X A;  1IW7 D;  2EY6 A;  3SDZ A;  1EOT A;  5BN3 A;  1RTN A;  4AIM A;  4RGT A;  1PTO C;  2K05 A;  3ERO A;  3URY A;  5I4D A;  3VYU A;  1T5X D;  3K7A B;  4DNT B;  4GLX A;  1K8G A;  1HNW Q;  2LXJ A;  2N8N A;  5HGQ A;  4DR6 L;  1S5F D;  1WFQ A;  1E2W A;  2EIF A;  4KHP Q;  1VQH A;  5IT9 E;  1TS5 A;  4R4O A;  4MHE A;  3TS2 A;  5KNB A;  2VZA A;  5E7N A;  4CJ1 B;  1DZ1 A;  4YY3 L;  5CBE E;  4BY7 G;  2F0P A;  3T1H L;  3I91 A;  2CW0 C;  3D0F A;  5IGD A;  1TY2 A;  4XT3 B;  4DV3 Q;  2Y0S G;  4M1U B;  5J22 A;  1XPR A;  3EBE A;  1OTC A;  5IIF A;  4OGQ C;  1PRT F;  1Q1E A;  1RCV D;  3HOY H;  1U5K A;  1N34 L;  3D6C A;  1IBM Q;  4BBS H;  3T53 B;  3PUX A;  4AYB B;  4GLA C;  3E3X A;  3K80 C;  4A3D G;  4HMI A;  5EJW A;  5M5Y H;  1RDP D;  4ZRZ A;  5KEE A;  5I2Y A;  3EN2 A;  2JEA I;  1OXX K;  3M4O H;  4YWM A;  5M3M H;  2JJQ A;  3VR4 A;  2IHF A;  2EXZ A;  2ICI A;  1P16 A;  4RGO S;  4EQO A;  2E2H B;  1BVS A;  4F87 A;  1EWI A;  4JBM A;  4DV1 L;  2UUB Q;  2XGT A;  4C3H B;  4IFD G;  3D4D A;  2NTS A;  3DWP A;  2RSN A;  3TQY A;  1B8A A;  5M3F G;  2CQA A;  1ASY A;  5KND A;  1B70 B;  3E0E A;  1PZJ D;  1A6X A;  2KOL A;  4NXN L;  2B63 B;  3I4N H;  4ZYS A;  3IRB A;  2EYP A;  3HOZ B;  4JI6 Q;  1TWC H;  3EVQ A;  1LT6 D;  1STA A;  3M3Y H;  5FKA C;  3K58 A;  2L55 A;  1LTL A;  1GUO A;  1B44 D;  1JWS D;  1QCB D;  3Q24 A;  4XTC S;  2XRQ D;  3F2U A;  4MNO A;  2HD3 A;  4LF7 Q;  1QVF A;  1RIP A;  1I6H H;  3HOV B;  1VQ8 A;  5JJZ A;  3L9A X;  4BWG B;  1SYG A;  5GAH C;  5IYD H;  4RGN A;  5KYL A;  2I5M X;  1CKN B;  3H15 A;  3GTO B;  3HOW H;  4J6H A;  5IGB A;  3MA2 B;  1DCZ A;  1V1O A;  3TP7 A;  1A2U A;  4P72 A;  1BCP F;  2A68 C;  1XPU A;  2A73 B;  4LUO A;  1SNM A;  1BOS A;  5ELB A;  2EZV A;  4K5V A;  1YHB A;  3A5Z B;  1E2Z A;  4J15 A;  2R93 B;  4HID A;  3U58 A;  4L5T A;  4A3E B;  2L1B A;  4A3K G;  1Q8K A;  1GUW A;  4RCN A;  3R93 A;  2QCP X;  3NPP A;  4DU9 A;  2QEJ C;  1CHP D;  2Q2H A;  5AJ3 L;  4H13 C;  3CCE A;  4BY1 H;  1HPC A;  2NYZ D;  2ZJR A;  4RHR A;  1VQB A;  1Q81 C;  1ILQ A;  3AFQ A;  3S1N H;  3MZ5 A;  2OCE A;  3I4M G;  2NZH A;  5HY6 A;  2F0U A;  2DY7 A;  3KBX A;  1AP0 A;  4LWC A;  1X32 A;  2Q2U A;  5ELF A;  2J0T D;  1XNQ Q;  3OMC A;  4B3T L;  3CC4 A;  5IGG A;  3CHB D;  1AE3 A;  5ELO A;  3QIA A;  4KKS A;  2K32 A;  1ONL A;  4B3R L;  1VQC A;  1ICF B;  4DK1 A;  1SE4 A;  2Q2I A;  2VQE Q;  4X64 Q;  3GTP H;  3HOX H;  3TDQ A;  1PRT C;  4PV1 C;  1K83 B;  1BUV T;  3TEH B;  2N88 A;  1PYB A;  2JA9 A;  1I4X A;  1Y8P B;  5FK9 C;  2R92 H;  1YEZ A;  4OHJ A;  1Y1V H;  2B2U C;  4O2D A;  1UAP A;  3T51 B;  2QA4 A;  2NB0 A;  2ES2 A;  3G6E A;  1YIT A;  4YWK A;  4KJO A;  2HDL A;  4PZ7 A;  1SMX A;  2RKS A;  3NE5 B;  1FL0 A;  3MEF A;  4RG1 A;  3QG1 A;  4N8F A;  4LJZ C;  3TP6 A;  4ID6 A;  3CCJ A;  4HSV A;  1AE2 A;  1CA6 A;  4C56 C;  4IOC A;  4MIU A;  2X69 A;  3OOC A;  4IFD H;  4ME3 A;  2FJ2 A;  1DON A;  3TZD A;  1BBU A;  1ET6 A;  1STN A;  2BCO A;  4M8A A;  3CCU A;  3ULP A;  1EOV A;  3VA7 A;  2XN9 C;  3GTK H;  1I4Q A;  1H9M A;  2E2D C;  1ZYR C;  1JWU D;  2YV5 A;  4KHV A;  4DV2 Q;  3SK8 A;  5D65 A;  2TSS A;  4YWL A;  2L5T A;  1X3Q A;  1JE5 A;  2FMC A;  2NBF A;  2A69 D;  2NVQ H;  3HOV G;  2XTI A;  4A3D B;  1CA5 A;  1S5D D;  2B2V A;  1XPO A;  1NJI C;  5JJL A;  3FRP B;  4OO1 H;  3N52 A;  4JI1 L;  2JYO A;  1TY0 A;  1WTP A;  1X6O A;  5KRU A;  3SHL A;  3CME A;  2AWO A;  2GVA A;  1QUQ B;  4DAY A;  3K0X A;  4B3S Q;  3RZD H;  1NNX A;  2R6G A;  4H44 C;  2M00 A;  2K6A A;  4DR4 L;  3LGJ A;  5IP9 H;  2NVT H;  1V8Q A;  4LFA L;  1KNE A;  5CGK A;  1JOR A;  1SXT A;  3ZJY C;  2CH4 W;  3K5N A;  2IX0 A;  2AUJ D;  5CC4 A;  2JA8 B;  4DV5 L;  2O2L D;  4EX5 A;  4A3F G;  3T1H Q;  2PMZ B;  4JI3 Q;  4DV6 L;  2JA5 H;  3NTK A;  5FLM G;  2XWB B;  5CV7 A;  1LLR D;  1WOC A;  4DXG A;  1SE2 A;  2K14 A;  2PW5 A;  3DEP A;  4LNQ A;  2UXD L;  3G7L A;  1PMR A;  1VQM A;  4IPC A;  3U9S A;  1HZC A;  4NKL A;  4LFC L;  2F0K A;  1N36 Q;  4YCW A;  3I4M B;  3CP0 A;  2RF4 A;  2EYM A;  4K5X A;  2DNC A;  3M4P A;  1CKN A;  5CYU A;  1GXD C;  1JJ2 A;  4FF4 A;  2MJ8 A;  4WJ3 M;  4MN3 A;  3CCR A;  2EYH A;  1C4Q A;  3MEH A;  2ZTC A;  4IUU A;  2Z0S A;  4V0B A;  4BBR G;  2AUK A;  5J3B A;  1LTS D;  1MBY A;  1MSG A;  3FP9 A;  4DR3 Q;  4LF8 Q;  4KD4 A;  4PMW A;  1WTH A;  3A7A B;  1ESR A;  5IWA Q;  2WB1 B;  2K5H A;  1GM5 A;  1HTL D;  3PIO 3;  3KJP A;  3U4Z A;  4X65 Q;  1HJP A;  1F77 A;  5M5X H;  4DV3 L;  1E22 A;  2WKC A;  3AYH B;  2PQA A;  3A7L A;  5H1S E;  1W2B A;  3I55 A;  3A55 A;  2GN5 A;  3NSW A;  1S5B D;  4K2L A;  3IAY A;  2B2T A;  4R4C A;  1XMO Q;  1XX8 A;  4DF7 A;  1FGB D;  4ZCK A;  3CCQ A;  1HFN A;  2JA6 B;  1SNQ A;  4B3S L;  3KF8 B;  1A3T A;  1I94 L;  4R9W A;  5C5M A;  3QR8 A;  1QB5 D;  5M3M G;  4DR4 Q;  2OQ0 A;  2CVR A;  4A76 A;  4X3K A;  3J81 L;  2KHI A;  3KBG A;  2R92 G;  1EQV A;  2EDG A;  3VR2 A;  3BDO A;  3VR5 A;  3T1Y Q;  3T56 B;  5IE8 A;  1G51 A;  1XXG A;  4DV0 Q;  5CV9 A;  1SRO A;  4UP8 A;  3HEJ A;  2D0O A;  1AEX A;  1WCM B;  1Z47 A;  3OMG A;  2L12 A;  2EYO A;  3F2D A;  2UXD Q;  2A6E D;  1WTW A;  1N8R C;  3H6M A;  1VS0 A;  3CPW A;  4NXN Q;  2AHO B;  1P8L A;  1EY4 A;  3K8A A;  2KCT A;  4WJW A;  2R61 A;  2QF7 A;  3OIQ A;  1K0R A;  4JI7 Q;  5COR A;  4QJF A;  4R4Q A;  4K14 A;  5FLX L;  1EIY B;  4DV7 L;  1BKB A;  5C4X B;  1I4R A;  1ENA A;  2QIL A;  1F9R A;  4IOA A;  4F88 A;  2F0T A;  1HR0 Q;  2E2I B;  3U50 C;  4GN3 B;  4X65 L;  3PGZ A;  1G6P A;  1J5E L;  3MC0 B;  2QW7 A;  4JI0 Q;  3DUZ A;  4IPH A;  2B2T C;  2MO1 A;  2R7Z H;  2E76 C;  4KY5 A;  4PZ6 A;  2MPM A;  1JE4 A;  3MFG A;  4DK6 C;  1Q86 C;  4L6T B;  5JEA G;  4C2M H;  3LNN A;  4NMZ A;  3BYY B;  3CF5 A;  3K5O A;  4JPB W;  3CD6 A;  3BZC A;  4AH6 A;  2I46 A;  1I94 Q;  1XNQ L;  3PIO A;  5HUR A;  1W6K A;  5T1G A;  3R2T A;  3CC7 A;  3QOL A;  1EEF D;  1QG7 A;  1KTK A;  4HJ8 A;  1VQA A;  3NUC A;  4IUP A;  4CHT B;  2F3W A;  3ICE A;  1Z6H A;  1C7Y A;  2ZT9 C;  2CWA A;  1I50 H;  2F4V L;  5BN5 A;  1GUT A;  1EYC A;  3F8T A;  1AZQ A;  4NXM Q;  2RDF A;  1KIX A;  1SE3 A;  2ALY B;  5JPN C;  3CXC A;  1SYC A;  1VQL A;  2IX1 A;  3MHB A;  4DFA A;  5L37 A;  3C2P A;  3V96 A;  2C35 B;  2Z8L A;  5IP7 H;  2EYJ A;  1QNU A;  1IW7 C;  1K8A C;  3I3C A;  3I4N B;  1EL0 A;  2AKW B;  1KAW A;  4K6D A;  1STH A;  3R3O A;  1R9T H;  1CHQ D;  3M3Y B;  5T1I A;  1SFO B;  2IL8 A;  5CR3 A;  3GTJ B;  2MQH A;  5E1F A;  3V2T A;  1CSQ A;  5GRO A;  1XMQ L;  2JA7 B;  1EY0 A;  1K0S A;  3ONA B;  1S4Z A;  5GQO A;  4HR7 B;  4R4T A;  3HOW B;  4JC0 A;  1Z7T A;  5IYD G;  1BR9 A;  4Q0F A;  2NVX H;  1QVG A;  2DNE A;  3OSO A;  2UUA L;  5EPL A;  2MUY A;  2AQ2 B;  4A3K B;  1O78 A;  1C8C A;  3AU7 A;  1GHJ A;  4O42 A;  5KIX A;  3A74 A;  1I4H A;  4A3G G;  1I3Q B;  2B63 G;  3A54 A;  4L5S A;  3PQI A;  2ATW A;  1XYI A;  4Z9C B;  1Y1W H;  1HUM A;  1FR3 A;  4K5W A;  4QGU A;  1V1P B;  1I4G A;  1FNV A;  2TMP A;  1PH1 A;  3BJU A;  1LTB D;  1VMP A;  2VB2 X;  3M7G A;  4B3M L;  5C3E G;  1UE6 A;  3KF6 A;  1TWH B;  1M8A A;  1Q90 A;  2F0M A;  3HOZ H;  2YU9 H;  4NP5 A;  4GKK Q;  1CZG A;  1KQS A;  2EPB A;  3UDG A;  2K75 A;  3W5O A;  4B08 A;  5LL6 X;  4YHH L;  2VW9 A;  3QWN A;  5DM6 3;  4XDX A;  5IY0 A;  1VMC A;  1HNZ Q;  2F4I A;  3T16 A;  3HKZ E;  3WOF A;  2OEO A;  2K04 A;  3BZD B;  4UPA A;  2WII B;  2Q8R E;  3STB C;  1GOZ A;  1QNK A;  3D8G A;  4KI0 A;  1KRS A;  2BE5 D;  5C5L A;  4A3E G;  3LWE A;  1PLF A;  1SNO A;  1YNN D;  4FXG C;  5FJ8 G;  2CCZ A;  4JCV E;  4Y7N B;  2RDH A;  1D1K A;  1X55 A;  3EQL C;  1LAB A;  3AQQ A;  1C0A A;  1K28 A;  5ELC A;  4DNR B;  4OWX B;  3Q22 A;  4RH6 A;  1PFS A;  4HCS A;  4JW0 A;  1R9T B;  3G71 A;  4X66 L;  4A3E H;  4FF3 A;  1QIL A;  2JA7 H;  4FXK C;  1PH3 A;  1IBL L;  3R8B A;  5C4H A;  1FD7 D;  4C3I H;  3CRK C;  2B39 A;  1R4Q B;  4QIW E;  1UEA B;  3NXW A;  4BY1 B;  2UXB Q;  3F2C A;  3S1N B;  2NVX B;  3P20 A;  3FPP A;  2A69 C;  3BVG A;  4L63 B;  1SMY C;  3SR1 A;  1D1I A;  2VQF Q;  4BA1 I;  2K50 A;  3UE0 A;  4C3H G;  4A3J H;  2BH8 A;  1LYL A;  2BDN A;  3A8J E;  1HHV A;  4XYO A;  3H0G G;  2YYZ A;  3P7J A;  3HKZ B;  2OXP A;  4XQN A;  2LKV A;  4OX9 Q;  4DR3 L;  4LF8 L;  3ZYY X;  2E74 C;  4PMB A;  1DJR D;  4KN7 C;  3STB D;  3DWA A;  1B4O A;  3K0Y A;  4GOP C;  2A74 C;  1LTT D;  5C3W A;  3NEN A;  3J80 i;  1STB A;  4RMF A;  3C1F A;  2PW7 A;  1PH4 A;  2HIX A;  1B7Y B;  2YU9 B;  2RCF A;  3HOW G;  3MXU A;  2RA4 A;  5FLX c;  4KTA A;  3JAM E;  2PCF B;  1TWC B;  2QDB A;  4KMU C;  1IYU A;  2IJ0 A;  4LF5 L;  4LF9 L;  3RZD B;  4O1N A;  1L1O B;  3HOY B;  2VXW A;  1PDQ A;  4I7A A;  3G6J B;  1HUN A;  3H3V C;  1IL2 A;  3FMC A;  1JJG A;  1XNR L;  2H4O A;  4R1J A;  1NE3 A;  1FJG L;  1HNW L;  2K33 A;  3CU7 A;  2JA6 G;  1EY5 A;  2XIW A;  5EBD A;  4FXD A;  1HR0 L;  2HCC A;  1YIJ A;  2A5H A;  3S1R H;  1YHQ A;  2MFI A;  4POF A;  3GP7 A;  4DAP A;  1TR5 A;  3NK9 A;  3NBH B;  2NWG A;  3IKJ A;  1EIG A;  5DM7 3;  1JOQ A;  3H3V H;  1N34 Q;  1IBM L;  1GO3 E;  2N3S A;  1AFP A;  2KJX A;  3I4L A;  1CKM A;  2HUG A;  4DGZ A;  3TP8 A;  3TS0 A;  4OL7 A;  3NQI A;  3PUZ A;  4DK3 C;  1G6Z A;  2VQF L;  4BXX G;  2LS0 1;  3K81 C;  1PZI D;  3S16 H;  4U68 A;  3SK5 A;  3VYT A;  4DR7 L;  3S2H B;  1FVI A;  3BVZ A;  3P1H A;  4BBR H;  3HKZ G;  3OPO A;  4IUT A;  1YI2 A;  4GOP A;  3H91 A;  2L9H A;  3KOJ A;  2FHT A;  4C1N I;  2K5D A;  3GTQ B;  5E3F A;  1EEI D;  2PMZ E;  5IP7 G;  4R8N A;  1VQG A;  5LMN W;  4JG2 A;  4JK1 C;  1F2M A;  3VR3 A;  1HZB A;  4ABN A;  1G29 1;  1J5E Q;  4K6L A;  4V19 0;  4LAA A;  2UXC L;  4E6I A;  3HOV H;  2UUB L;  3SEB A;  4OEL B;  1HQR D;  4DV4 Q;  5JEA H;  5FJ8 H;  2UUC L;  3ERS X;  4EQ5 A;  1NMG A;  2HT1 A;  2F3I A;  4CJ2 C;  2JA6 H;  4NDX A;  3Q6S A;  1B53 A;  3AMU A;  2B2U A;  4HAE A;  3U4V A;  1AW7 A;  4JYA Q;  2A6E C;  3E0J A;  4OEM B;  1PFB A;  2CWP A;  1I6V C;  2KA7 A;  4YCV A;  3UDF A;  3SK6 A;  1JMC A;  3OW2 A;  4QUC A;  4X62 Q;  1A3U A;  1X54 A;  3SXH A;  4A3C G;  3PO2 H;  4LFB L;  1K73 C;  4KKU A;  3TN2 A;  1N33 L;  3PUV A;  2X6L A;  2KHJ A;  3GTG B;  2JA8 G;  1SEB D;  3J7A V;  3A0J A;  1STE A;  2EYF A;  1F2Y A;  3J7Y W;  1X3G A;  3AEV A;  3F1Z A;  3JAM i;  4RKL A;  3H0G H;  5ELE A;  1D7Q A;  1YNX A;  2ZJQ A;  2ZM6 L;  3KYH C;  3NTI A;  5M3M B;  4DR7 Q;  1SN8 A;  2B2V C;  2WP8 J;  3R2I A;  2RCN A;  1M1K C;  4QY7 A;  4HTH A;  2EJG C;  1U4P A;  2A1A A;  3S17 B;  1UE7 A;  3B6Y A;  5LHY 1;  3VA5 A;  1SJH D;  1ICW A;  5D3I B;  3EFX D;  3GTL B;  4GKK L;  1N32 Q;  3A5U A;  1HQM C;  3PO3 H;  5JAV A;  1QZG A;  2E5L Q;  1QWY A;  1BBX C;  2EY1 A;  4MTK A;  4FO2 A;  3RR5 A;  4GKJ Q;  2KEC A;  4YCU A;  1MIU A;  2UXC Q;  5IYC H;  2EY5 A;  1EFW A;  2VS1 A;  3OIP A;  1K83 H;  4IJH A;  4XIG S;  1DGS A;  2L4N A;  1IZ6 A;  2F1M A;  2B63 H;  4C2M B;  5C4Z A;  3HOU B;  1TS3 A;  2K5Q A;  3GDE A;  1KNA A;  4IUR A;  1LT5 D;  1RTO A;  3KK7 A;  4GNX B;  1PVO A;  2LFN A;  3PO2 G;  2SNM A;  1RKN A;  3RLF A;  3MXG A;  4B3T Q;  1J8I A;  4A3G B;  4CJ0 B;  1VQ6 A;  2QDL A;  4ZLT F;  1SMY D;  2FFK B;  5G3L D;  1SNP A;  1EYG A;  2Y0S E;  2JA8 H;  4EVO A;  1BF4 A;  3I7F A;  2JE6 I;  1VQJ A;  3HOU G;  2VQE L;  3S14 B;  1YHA A;  1T9H A;  4QB4 A;  4BS9 A;  5TSS A;  1N33 Q;  2NN6 H;  4RA8 A;  1MI2 A;  4HIO A;  3H3V I;  4GOP B;  1VQ7 A;  1JCK B;  3PIP 3;  1SYF A;  5IYB G;  2WV6 D;  5C4X H;  1BCP D;  1B9N A;  1TWA B;  4BY1 G;  3D31 A;  3J81 c;  1VQ5 A;  1SJE D;  2IX3 A;  3OTO L;  2AWN A;  1SFO H;  3M85 A;  1WCM G;  2ZTE A;  2NVQ B;  4NPS A;  1WTX A;  3NEM A;  4C3I B;  2OWO A;  1IHZ A;  1BCP B;  3FVQ A;  4FNF A;  1OXS C;  2F0S A;  4EGV A;  4RCO A;  5JJI A;  5IYC G;  5JVH 3;  4PMC A;  1HNX Q;  1ENF A;  4A3I H;  2VNU D;  2FMM A;  3QOJ A;  1WVL A;  4IAL A;  1IKL A;  3C46 A;  3HRZ C;  1EY8 A;  4F7X A;  1PTO H;  1SAP A;  3SGI A;  5M5X B;  2D62 A;  3CKI B;  2ZTD A;  4H02 A;  3EIV A;  4XQJ A;  5LMU L;  1VQF A;  3DM3 A;  3WDN A;  4ILW A;  4G7H C;  4OIJ A;  4WRD A;  5J39 A;  2KCC A;  4POG A;  1EU3 A;  2JXM B;  3GQB A;  3MFY A;  3OWF A;  1G8Z D;  1H9R A;  4P74 A;  2L0C A;  1SR3 A;  2EY2 A;  3RNU A;  4F8M A;  3O13 A;  1BCP C;  2VUM B;  3OYY A;  1N36 L;  1F9Q A;  5D14 A;  3UI2 A;  5IGE A;  3GO5 A;  4LW1 A;  4OX9 L;  3Q0A A;  4OON A;  4TSS A;  4DXF A;  2IT1 A;  3GTJ H;  3ITP A;  3KDF B;  5E4W C;  5GAE C;  1YJN A;  4LFA Q;  4IFD J;  1FJG Q;  4DV6 Q;  1EWC A;  1X9N A;  1CKO A;  2F0G A;  3FDT A;  5C0X I;  1I5F A;  1Q8I A;  3BZK A;  2O4X A;  2PQA B;  2Z6K A;  1MGS A;  3MVV A;  5KNC A;  3K6O A;  4ULL A;  4I65 A;  3BG3 A;  1NAP A;  3RN2 A;  1A2T A;  4UP9 A;  4HMJ A;  4DR2 L;  4DNI A;  1HZ9 A;  1X3F A;  2Q8I B;  3KJO A;  4LF9 Q;  1Z9F A;  2YTY A;  4S3S A;  1L1O C;  3IFD A;  4A75 A;  2I0Q A;  4A93 B;  2B8F A;  2HCI A;  1E7Z A;  1HNX L;  4DN4 M;  3PIP A;  1SYD A;  1KLG D;  3KLR A;  2CHB D;  4K0K Q;  4IUQ A;  2E2I H;  1LTI D;  4KKT A;  4BBS B;  4OIK A;  4C3J G;  2Y0S B;  3J80 L;  4AQY Q;  5NUC A;  1PRT D;  5LMU Q;  3S2H H;  1KRT A;  2IHE A;  5FO9 B;  4APV A;  4KV6 A;  2K5N A;  2WB1 G;  2UUC Q;  2YTV A;  2JN4 A;  4JVZ A;  3IFT A;  3GV3 A;  3Q8D A;  5K5P A;  3D4W A;  2JSO A;  3AFP A;  3C1E A;  4H0L C;  4L5R C;  5COY A;  1V1P A;  5J1Z A;  3TSS A;  2WFW A;  2MGS A;  3S1Q B;  2CQO A;  4C3H H;  4JV5 Q;  1U4L A;  4HCE A;  1ML0 D;  4G7Z C;  4ZUI A;  1IBK L;  1K8M A;  3RD4 A;  5BR8 L;  1QUQ A;  4JI7 L;  3NBH A;  3PMF A;  3ULL A;  4HJ5 A;  3VYS A;  1S5E D;  1W3S A;  5DAU A;  4GNX A;  5G3L F;  3S15 B;  1B3Q A;  1L0X B;  5KYI A;  1E1O A;  1UWV A;  2WAQ B;  4X62 L;  4YY3 Q;  1K3R A;  1IYJ B;  3W1B A;  2M9V A;  2BDO A;  2NZO A;  4XYQ A;  3FEW X;  3L0O A;  2WIN B;  4DV0 L;  4R4I A;  2GVB A;  4ZKC B;  1PYW D;  1NR2 A;  3QB3 A;  3DMU A;  4ZKB B;  5CMD A;  1PTO F;  4WJ4 A;  2CKZ B;  4A3M H;  4HSP A;  2A68 D;  4A93 G;  2KUM A;  2XSC A;  4KD3 A;  4XT1 B;  5M5W H;  3TBI B;  1CQV A;  4ZK9 B;  3UDI A;  1PZK D;  1VF7 A;  3WWV A;  5A2Q E;  4K0K L;  1G2S A;  3PSI A;  3D4R A;  2K28 A;  1WTQ A;  3FPU B;  2N55 A;  4AQY L;  3LWU A;  4A93 H;  3J81 j;  4WOR A;  4DV7 Q;  3FKI B;  4ZQ3 A;  2HHH Q;  1VQD A;  3HZX A;  4R8I A;  2Q2T A;  5C4X G;  2NVY B;  3ERQ A;  3I8Z A;  4XQQ A;  1I3Q H;  2NZ1 D;  1B2T A;  3GTL H;  2G9D A;  4DV2 L;  4DPG A;  2N78 A;  2R93 G;  1NSN S;  1NR4 A;  3ND9 A;  1IL8 A;  3CRL C;  1MJE A;  4IFD I;  1SSO A;  1YZ6 A;  2RQX A;  3W3A A;  4FDB A;  1SNC A;  4I7Z C;  3GTP B;  3HOU H;  3I72 A;  1RHP A;  4JI6 L;  2WAC A;  1S72 A;  2B2Y C;  4GNX C;  1UE5 A;  4LK1 C;  1ILP A;  1EYD A;  5E4X A;  1ET9 A;  3PO3 G;  4MTN A;  1Q7Y C;  4AYB G;  1HXY D;  3OWE B;  1JWM D;  5C44 B;  1QVC A;  1GHK A;  2KEN A;  2RHS B;  3DHQ A;  3JC6 6;  1TQO A;  3K7A H;  1K3B C;  4FVM A;  5KGU A;  2Z4H A;  4BA2 I;  3HGB A;  2AQ1 B;  4GN5 A;  4B9X A;  4EQP A;  3AB9 A;  4JI3 L;  2KBN A;  1YJW A;  1HR0 W;  2BH2 A;  4RGM A;  1MSH A;  4CDE C;  1KAA A;  3RZO H;  1ZXT A;  4JI2 L;  1GD7 A;  5A35 A;  2FXQ A;  3S9W A;  2M2L A;  1V9P A;  2WKD A;  2V4D A;  4ALP A;  3S2D H;  1K8O A;  1HCZ A;  1CM9 A;  1QOH A;  5C3X A;  4A3J G;  4C1N K;  5C0X H;  4FF2 A;  1FGU A;  3A8I E;  2F0O A;  3E9I A;  3LX0 A;  3S16 B;  2D0P A;  2VL6 A;  1BDO A;  1WTR A;  1A15 A;  3BVM A;  1TS4 A;  4OWW B;  4G4K A;  1A62 A;  1L1O A;  1OXT A;  2ENB A;  1VQE A;  1NY4 A;  5C4J B;  3HP3 A;  1LT3 D;  3NQT A;  3MXP A;  3KF6 B;  4DUY L;  2DN8 A;  2PO4 A;  2ZXR A;  2UUA Q;  3I70 A;  2D5D A;  5EKK A;  1IKM A;  1D5M C;  4RKB A;  2OTL A;  4N9P A;  4C3J B;  2F0H A;  5FO7 B;  1KLU D;  2HQL A;  2JQO A;  3DEO A;  5BN4 A;  2DUD A;  4RWS C;  4Y52 H;  4A3F H;  1PHJ A;  4DR6 Q;  3BYT B;  2E2J H;  3J7Z C;  1NUC A;  5IOD A;  4KHP L;  1NMF A;  5CV8 A;  1JR0 D;  2EQS A;  2VB3 X;  3PCO B;  1KD1 C;  2BE5 C;  4IO9 A;  4UAI A;  2Z9H A;  2F0V A;  2F0D A;  5EGT A;  1NTG A;  2BOS A;  4CKC A;  3J80 E;  5IOC A;  1CT1 D;  3E5S A;  3K5L A;  1J9O A;  1VQI A;  1E24 A;  4Q5V A;  3L7Z C;  3HOZ G;  2NN6 I;  2IWH A;  2Z6K C;  3RLO A;  1I6H B;  5GAD C;  1G91 A;  3GTM B;  4PQX A;  2DGY A;  2SNS A;  2NUC A;  1Y8O B;  4PG3 A;  4JI8 Q;  1GKH A;  1H9J A;  4QIW B;  1F2Z A;  3VDY A;  4BXX H;  2JA5 B;  1WJJ A;  4XXE A;  5JEA J;  2F03 A;  1LTG D;  3UDX A;  1U9R A;  3K59 A;  1DXM A;  4CKE A;  5LMN Q;  4JBK A;  2R93 H;  4B9W A;  1U0L A;  2PZU A;  3L3O C;  5EPK A;  1E1T A;  3I4M H;  3E9H A;  1X65 A;  4RAU C;  3SK4 A;  1YJ9 A;  1AH9 A;  5IYB H;  1EUJ A;  1IBL Q;  1EZ6 A;  1CFM A;  1TS2 A;  5JPM C;  1LT4 D;  1KHI A;  2PZT A;  3MXN A;  1TWF H;  2KCM A;  4ZAI A;  2ZJP A;  1RF2 D;  2F0F A;  1DM0 B;  1U4R A;  1MKH A;  3CQZ B;  4IN3 A;  4N9T A;  2UXB L;  4J1M A;  1ASZ A;  1II3 A;  2EVB A;  2MHV A;  4LF6 L;  3H09 A;  1X3E A;  2F52 A;  2YTX A;  2PPB C;  3C3L A;  1SYB A;  2SOB A;  1VQP A;  2H1E A;  3TRZ A;  4A3B B;  5IT9 L;  1H95 A;  1VQ4 A;  1MD2 D;  5FO8 B;  1UNS A;  2HIV A;  1OO9 B;  4X3T A;  3S1Q H;  4P2C B;  3BU2 A;  4JI4 Q;  2WAQ G;  4DR1 Q;  1CSP A;  2F0L A;  1BXT A;  3MXN B;  3CMA A;  4A3F B;  1PH8 A;  1BBW A;  3NHH A;  2ICE C;  1S3O A;  1PFM A;  1YNJ D;  3S14 H;  2EJF C;  2E75 C;  2EE1 A;  4Y7N H;  1TKW B;  4C3I G;  4A3B G;  1ESF A;  1UEB A;  3I4N G;  2OTJ A;  2OQK A;  3MAQ A;  1TWA H;  2QGQ A;  4DKA C;  2F0E A;  2F0Q A;  2SDF A;  1XNR Q;  1Y1V B;  2Z1C A;  4KHZ A;  1HH2 P;  2KQ3 A;  5IGC A;  3M4Y A;  4LUZ A;  4QUF A;  5BR8 Q;  1EIH A;  2JP1 A;  1DD2 A;  2Z4I A;  2K03 A;  3OW7 A;  1SYE A;  4A3M B;  3HS0 C;  4DUZ Q;  3FKI G;  5JVG 3;  2K7V A;  1PV4 A;  5IT9 c;  2RSO A;  4A3I B;  1HA6 A;  5AFW A;  4HIK A;  5EKL A;  5M5Y B;  2HQE A;  1XWE A;  4BY7 H;  1KDB A;  5ELN A;  1UE1 A;  3H0G B;  3M4O B;  4KN4 C;  5I9O A;  4HJA A;  1H9S B;  2K4K A;  1HRJ A;  3FKI H;  2E2H H;  2B2W C;  4A3J B;  1F9P A;  1XMO L;  4DAM A;  1EFI D;  3NTH A;  4A4I A;  1L2F A;  4BBS G;  2L15 A;  3W1G A;  1Y14 B;  3NP8 A;  4QF4 A;  2A8V A;  2FIN B;  2R7Z B;  4JYA L;  1TXY A;  3M7N A;  1PH6 A;  2A6H C;  4B3M Q;  4X64 L;  5CV5 A;  1BQQ T;  1D8L A;  1FNW A;  1WTO A;  1EU4 A;  4LFB Q;  1E0B A;  2X6G A;  3ND8 A;  2EJM A;  1CZW A;  3TRE A;  2PI2 E;  4U67 3;  5JJK A;  1CI3 M;  1S40 A;  1PXU A;  3K7U C;  2PI2 A;  1VQ9 A;  1EQR A;  3GTG H;  3VR6 A;  5FOB B;  1G2T A;  2JK8 A;  4QMG A;  3CC2 A;  3HKS A;  2K5W A;  4X6A H;  1NBW A;  4HJ7 A;  4IZ8 A;  2ZM6 Q;  1V1Q A;  2G5D A;  4KY7 A;  1LM0 A;  2F0J A;  1OXV A;  2MNA A;  4O0A A;  1PFN A;  3DLL A;  1X3P A;  5M9O A;  2C5C A;  1HA5 A;  3H94 A;  2DJG C;  3P75 A;  4A3L G;  4ODG A;  5HGT A;  2F0W A;  1STY A;  4JI0 L;  3A8K E;  3A56 A;  1Y1W B;  1SBB B;  4RHS A;  4KK7 A;  2CH4 A;  3NBI A;  3J7A 5;  3CW2 C;  3I2Z A;  4TQU S;  1CK1 A;  2C9O A;  3D6W A;  4GS3 A;  2PNR C;  4JI2 Q;  1ZYR D;  5M3F H;  1TWH H;  2RVL A;  3M4Q A;  1V43 A;  3DM1 A;  2Q8T A;  4K2K A;  4CKB A;  1VQN A;  4IPD A;  2A6H D;  2PQE A;  4GLV B;  4GZY C;  3SVM A;  1OXU A;  1TII D;  4IPG A;  3PUW A;  4JI1 Q;  4A3K H;  2H5X A;  2J4X A;  3J80 c;  1ZKO A;  1VDZ A;  3SE0 A;  3V05 A;  4QL5 A;  3I56 A;  4C3J H;  4K8J A;  5FLM H;  4GKJ L;  2NVY H;  3RN5 A;  3GV6 A;  5EPJ A;  2VY3 A;  2F0I A;  1TWG B;  2E5L L;  3L2P A;  2BA1 A;  3S24 A;  4DUY Q;  5EBC A;  1XTD A;  1YBY A;  3HOX B;  3EJI A;  2IY5 B;  3CCS A;  1H9K A;  4DAV A;  3OHX C;  1E3P A;  5GAG C;  1Q46 A;  5C6A A;  1Q82 C;  2R92 B;  1B1Z A;  1YNN C;  4OXP A;  5CV4 A;  1U4M A;  4LF5 Q;  1WCM H;  1F9S A;  3GD7 A;  3GTM H;  2RBM A;  4DA2 A;  2PYK A;  2G9H D;  5IP9 G;  2JA7 G;  4DK0 A;  3NEL A;  5LMN L;  1A63 A;  3HOX G;  3JAM c;  2R7Z G;  3RMH A;  1A3V A;  3KLS A;  3GTO H;  2CW0 D;  1PYS B;  5CV6 A;  4DV5 Q;  3DXJ C;  1XTC D;  1EIF A;  1EY9 A;  4QQB X;  1Y1V G;  4MZ9 A;  3X3M A;  5I9P A;  3OTO Q;  5EKI A;  1R4P B;  1LAC A;  5EQ0 A;  2Z6B A;  1KDA A;  3I90 A;  4JOI A;  3J7A F;  1O7Y A;  1D2B A;  1XJV A;  2R3Z A;  2VUM G;  4JI8 L;  2QKI C;  3PUY A;  4UHV A;  4A3M G;  4LFC Q;  4LUV A;  1RD9 D;  2AMC B;  2KCN A;  1TWF B;  3S1M B;  3PO3 B;  1TT2 A;  1O7Z A;  2AQ3 B;  5C0X G;  4KJN A;  3CQZ H;  1SRU A;  2J7Z A;  1WD1 A;  5C44 G;  4CDF C;  2F3V A;  4L8J A;  4ZUJ A;  1KC8 C;  2B3G A;  2BA0 A;  3KLW A;  3TP5 A;  4CGY B;  4DAY B;  5DLQ E;  4LF4 Q;  4CDD C;  2ZXO A;  1CTM A;  5ELD A;  2LXK A;  3WOE A;  4DR1 L;  1EYA A;  3N6R A;  1LO5 D;  5IWA L;  1EY7 A;  1Y69 U;  4A3B H;  4LMQ D;  4X3S A;  5C44 H;  3G48 A;  3E6Z X;  4P71 A;  3EA6 A;  2JEB I;  4PNY A;  2PNH A;  1HZA A;  1HNZ L;  3DWQ A;  3QO2 A;  5I6Y A;  1I50 B;  1PH2 A;  4HJ9 A;  3RUZ A;  3JAM L;  4DV4 L;  2P5Z X;  5K36 H;  2KHS A;  3HFZ B;  3IL8 A;  1Q3L A;  1TWG H;  4LF6 Q;  1FYC A;  4DR2 Q;  1KXL A;  2EYL A;  1C48 A;  3BS1 A;  3RZO B;  1C9O A;  1K9M C;  1JC7 A;  4A3L H;  3KLS X;  1LV9 A;  1KDC A;  2I07 B;  2XWJ B;  1D5X C;  3S2D B;  3PF5 A;  4QCL A;  4JI4 L;  1ZEQ X;  3G4S A;  4CBV A;  1KL9 A;  4A3I G;  1VQK A;  2XRS D;  2EOT A;  1GUS A;  4HED A;  2O5J C;  1WTV A;  3T1Y L;  5C3E B;  4FYD A;  2A19 A;  1A8V A;  4P75 A;  2OF1 A;  2JA5 G;  2LMC B;  4NB3 A;  3KF8 A;  5EAY A;  1W6J A;  4NW2 A;  3I4O A;  1LTA D;  1AZP A;  4AYB E;  1H9S A;  1O7I A;  4BBR B;  3F2B A;  2NN6 G;  3CCL A;  3KDF A;  1B50 A;  2LY7 A;  1QZH A;  5DNF A;  1M4V A;  1NCV A;  3T13 A;  3GTQ H;  4OO1 G;  2D9U A;  5F2D A;  2B8G A;  2OT2 A;  1BO0 A;  3KUP A;  4WFN 3;  1WYD A;  4JV5 L;  2ID0 A;  1PA6 A;  5I6W A;  3UE1 A;  4EQN A;  1IYV A;  2IPK D;  1IBK Q;  1TVX A;  2CFM A;  1JQY D;  4DUZ L;  4FF1 A;  1PRT B;  1IXR A;  2F4V Q;  1B3A A;  3S1M H;  4GN4 B;  1N32 L;  4NXM L;  1VF5 C;  4LF7 L;  1RJT A;  1DOL A;  1UUP A;  1MJC A;  2E2J B;  2B2W A;  4A3D H;  2NTT A;  3S15 H;  3ER0 A;  2L11 A;  1YNJ C;  4DV1 Q;  1GUG A;  1FNU A;  4N8X 1;  3I73 A;  1JOO A;  1SLJ A;  2R7F A;  3CCV A;  3CCM A;  1ROD A;  4KLK A;  2E8G A;  3PO2 B;  3HG9 A;  2D2C C;  4G57 A;  2O5I C;  3HOY G;  1J6Q A;  5FLX E;  2I5L X;  1PH7 A;  2UU9 L;  5CBA E;  1O80 A;  1CUK A;  2PZW A;  1EQT A;  4UDU C;  4DR5 Q;  5M5W B;  1L0Y B;  1CQF A;  1XMQ Q;  1SE8 A;  1GVP A;  1HTP A; 
#chains in the Genus database with same CATH homology
 3TZU A;  1JB3 A;  3T4A C;  4KY6 A;  4JBW A;  3K57 A;  1VCI A;  4RFB A;  4ME5 A;  5IGF A;  1KAB A;  2IW3 A;  5JOB A;  2XVS A;  1LTR D;  3NWT A;  4TRD A;  1SDF A;  1I4P A;  4TKO B;  4IUV A;  2KED A;  4X3U A;  4HN7 A;  5M3F B;  1WD0 A;  5A2Q L;  4BY7 B;  1EWH A;  3D3R A;  5DEH A;  1BNZ A;  4K8I A;  3TME A;  2NVT B;  1QE6 A;  1Y8N B;  2HDM A;  1AN8 A;  2K01 A;  1B9M A;  2B2Y A;  1GUN A;  4FP5 D;  1DOM A;  1T5E A;  1HFG A;  2DY8 A;  5LL6 S;  1JIC A;  3QJY A;  1D6E C;  4IQZ A;  4H7B A;  4J8Q A;  3MWY W;  3BDL A;  2KEE A;  3Q23 A;  1JOK A;  2KVM A;  1EZ8 A;  1STG A;  1Q12 A;  4OO1 I;  1DYQ A;  1F2L A;  1TU2 B;  2SEB D;  4G7O C;  1QJO A;  3W2D A;  3U9O A;  1EY6 A;  2MP1 A;  4YIJ A;  1PTO D;  1ENC A;  5D3D A;  1GJX A;  1S5C D;  2GA4 B;  2ZXP A;  3S1R B;  3PV0 A;  3VYR A;  3NWS A;  2F0N A;  1SND A;  1PTO B;  4IUN A;  3BDC A;  5C0X J;  1Q1B A;  3K5M A;  1O7L A;  3X3N A;  3GTK B;  3MTS A;  1DOK A;  2XNA C;  1E2V A;  5ISR A;  5K36 G;  2RDG A;  2K1B A;  1D5Z C;  3J81 E;  5I2X A;  1IW7 D;  2EY6 A;  3SDZ A;  1EOT A;  5BN3 A;  1RTN A;  4RGT A;  1PTO C;  2K05 A;  3ERO A;  3URY A;  5I4D A;  3VYU A;  1T5X D;  3K7A B;  4DNT B;  1S5F D;  1E2W A;  5IT9 E;  1TS5 A;  4MHE A;  5KNB A;  4CJ1 B;  1DZ1 A;  5CBE E;  2F0P A;  3I91 A;  2CW0 C;  5IGD A;  1TY2 A;  4XT3 B;  5J22 A;  4M1U B;  5IIF A;  4OGQ C;  1PRT F;  1Q1E A;  1RCV D;  3D6C A;  3T53 B;  3PUX A;  4AYB B;  4HMI A;  5EJW A;  1RDP D;  4ZRZ A;  5KEE A;  5I2Y A;  2JEA I;  1OXX K;  3VR4 A;  2EXZ A;  2ICI A;  4RGO S;  4EQO A;  2E2H B;  4F87 A;  4C3H B;  4IFD G;  3D4D A;  2NTS A;  3DWP A;  2RSN A;  2CQA A;  5KND A;  1PZJ D;  1A6X A;  2KOL A;  2B63 B;  4ZYS A;  2EYP A;  3HOZ B;  3EVQ A;  1LT6 D;  1STA A;  5FKA C;  3K58 A;  2L55 A;  1GUO A;  1B44 D;  1JWS D;  1QCB D;  3Q24 A;  4XTC S;  2XRQ D;  3F2U A;  3HOV B;  5JJZ A;  3L9A X;  4BWG B;  1SYG A;  4RGN A;  5KYL A;  3GTO B;  4J6H A;  5IGB A;  3MA2 B;  1DCZ A;  1V1O A;  3TP7 A;  1A2U A;  1BCP F;  2A68 C;  2A73 B;  1SNM A;  1BOS A;  5ELB A;  2EZV A;  4K5V A;  1E2Z A;  2R93 B;  4A3E B;  2L1B A;  1GUW A;  4RCN A;  3R93 A;  2QCP X;  3NPP A;  4DU9 A;  2QEJ C;  1CHP D;  4H13 C;  1HPC A;  2NYZ D;  4RHR A;  1ILQ A;  3MZ5 A;  2F0U A;  2DY7 A;  3KBX A;  1AP0 A;  1X32 A;  5ELF A;  2J0T D;  3OMC A;  5IGG A;  3CHB D;  3QIA A;  4KKS A;  2K32 A;  1ONL A;  4DK1 A;  1SE4 A;  3TDQ A;  1PRT C;  4PV1 C;  1K83 B;  1BUV T;  2N88 A;  1I4X A;  1Y8P B;  5FK9 C;  4OHJ A;  2B2U C;  1UAP A;  3T51 B;  2NB0 A;  4KJO A;  2HDL A;  2RKS A;  3NE5 B;  3QG1 A;  4LJZ C;  3TP6 A;  4ID6 A;  4HSV A;  1CA6 A;  4C56 C;  4MIU A;  2X69 A;  3OOC A;  4IFD H;  2FJ2 A;  1DON A;  3TZD A;  1ET6 A;  1STN A;  2BCO A;  4M8A A;  3VA7 A;  2XN9 C;  1I4Q A;  1H9M A;  2E2D C;  1ZYR C;  1JWU D;  4KHV A;  3SK8 A;  5D65 A;  2TSS A;  2L5T A;  1X3Q A;  2FMC A;  2NBF A;  2A69 D;  4A3D B;  1CA5 A;  1S5D D;  2B2V A;  3FRP B;  4OO1 H;  3N52 A;  2JYO A;  1TY0 A;  1WTP A;  5KRU A;  3SHL A;  2AWO A;  4DAY A;  2R6G A;  4H44 C;  2M00 A;  2K6A A;  1V8Q A;  1JOR A;  1KNE A;  5CGK A;  1SXT A;  3K5N A;  2IX0 A;  2JA8 B;  2AUJ D;  5CC4 A;  2O2L D;  2PMZ B;  3NTK A;  2XWB B;  5CV7 A;  1LLR D;  4DXG A;  1SE2 A;  2PW5 A;  3DEP A;  3G7L A;  1PMR A;  3U9S A;  4NKL A;  2F0K A;  3I4M B;  2EYM A;  4K5X A;  2DNC A;  5CYU A;  1GXD C;  4FF4 A;  2MJ8 A;  4MN3 A;  2EYH A;  1C4Q A;  3MEH A;  4IUU A;  4V0B A;  2AUK A;  1LTS D;  1MBY A;  1MSG A;  4KD4 A;  4PMW A;  3A7A B;  1ESR A;  2WB1 B;  1HTL D;  3PIO 3;  1F77 A;  2WKC A;  3A7L A;  3A55 A;  3NSW A;  1S5B D;  4K2L A;  3IAY A;  2B2T A;  1XX8 A;  4DF7 A;  1FGB D;  1HFN A;  2JA6 B;  1SNQ A;  1A3T A;  4R9W A;  5C5M A;  1QB5 D;  2CVR A;  4X3K A;  3J81 L;  3KBG A;  1EQV A;  2EDG A;  3VR2 A;  3BDO A;  3VR5 A;  3T56 B;  1XXG A;  5CV9 A;  3HEJ A;  1AEX A;  1WCM B;  1Z47 A;  2L12 A;  3OMG A;  2EYO A;  2A6E D;  1WTW A;  3H6M A;  1EY4 A;  4WJW A;  2R61 A;  2QF7 A;  3OIQ A;  5COR A;  4K14 A;  5FLX L;  5C4X B;  1I4R A;  1ENA A;  2QIL A;  1F9R A;  4F88 A;  2F0T A;  2E2I B;  3MC0 B;  3DUZ A;  2B2T C;  2E76 C;  4KY5 A;  2MPM A;  1JE4 A;  3MFG A;  4L6T B;  5JEA G;  3LNN A;  4NMZ A;  3BYY B;  3K5O A;  2I46 A;  5HUR A;  1W6K A;  5T1G A;  3R2T A;  3QOL A;  1EEF D;  1QG7 A;  1KTK A;  3NUC A;  4IUP A;  4CHT B;  2F3W A;  1Z6H A;  2ZT9 C;  5BN5 A;  1GUT A;  1EYC A;  1AZQ A;  2RDF A;  1SE3 A;  5JPN C;  1SYC A;  2IX1 A;  3MHB A;  4DFA A;  3C2P A;  3V96 A;  2Z8L A;  2EYJ A;  1QNU A;  1IW7 C;  3I3C A;  3I4N B;  1EL0 A;  4K6D A;  1STH A;  3R3O A;  1CHQ D;  3M3Y B;  5T1I A;  1SFO B;  2IL8 A;  5CR3 A;  3GTJ B;  3V2T A;  5E1F A;  2JA7 B;  1EY0 A;  3ONA B;  1S4Z A;  4HR7 B;  3HOW B;  1Z7T A;  1BR9 A;  4Q0F A;  2DNE A;  3OSO A;  5EPL A;  2MUY A;  2AQ2 B;  4A3K B;  1O78 A;  1C8C A;  3AU7 A;  1GHJ A;  4O42 A;  5KIX A;  1I4H A;  1I3Q B;  3A54 A;  1XYI A;  4Z9C B;  1HUM A;  1FR3 A;  4K5W A;  1V1P B;  1I4G A;  1FNV A;  2TMP A;  1LTB D;  1VMP A;  2VB2 X;  3M7G A;  1TWH B;  1M8A A;  1Q90 A;  2F0M A;  4NP5 A;  1CZG A;  2EPB A;  4B08 A;  5LL6 X;  3QWN A;  5DM6 3;  4XDX A;  1VMC A;  2F4I A;  3T16 A;  3WOF A;  2OEO A;  2K04 A;  3BZD B;  2WII B;  2Q8R E;  1GOZ A;  1QNK A;  3D8G A;  4KI0 A;  2BE5 D;  5C5L A;  3LWE A;  1PLF A;  1SNO A;  1YNN D;  4FXG C;  4Y7N B;  2RDH A;  1D1K A;  3EQL C;  1LAB A;  5ELC A;  4DNR B;  3Q22 A;  4RH6 A;  4HCS A;  1R9T B;  4FF3 A;  1QIL A;  4FXK C;  3R8B A;  5C4H A;  1FD7 D;  3CRK C;  2B39 A;  1R4Q B;  1UEA B;  3NXW A;  4BY1 B;  3S1N B;  2NVX B;  3P20 A;  3FPP A;  2A69 C;  3BVG A;  4L63 B;  1SMY C;  3SR1 A;  1D1I A;  4BA1 I;  4C3H G;  2BDN A;  3A8J E;  1HHV A;  4XYO A;  2YYZ A;  3HKZ B;  3P7J A;  2OXP A;  4XQN A;  2LKV A;  3ZYY X;  2E74 C;  4PMB A;  1DJR D;  4KN7 C;  3DWA A;  1B4O A;  3K0Y A;  2A74 C;  1LTT D;  5C3W A;  1STB A;  3C1F A;  2PW7 A;  2YU9 B;  3MXU A;  2RA4 A;  4KTA A;  3JAM E;  2PCF B;  1TWC B;  2QDB A;  4KMU C;  1IYU A;  2IJ0 A;  3RZD B;  4O1N A;  3HOY B;  2VXW A;  1PDQ A;  3G6J B;  1HUN A;  3H3V C;  3FMC A;  2H4O A;  2K33 A;  3CU7 A;  1EY5 A;  2XIW A;  5EBD A;  4FXD A;  2HCC A;  2A5H A;  3GP7 A;  4DAP A;  1TR5 A;  3NK9 A;  2NWG A;  3IKJ A;  1EIG A;  5DM7 3;  1JOQ A;  1AFP A;  2KJX A;  3I4L A;  2HUG A;  4DGZ A;  3TP8 A;  4OL7 A;  3NQI A;  3PUZ A;  1G6Z A;  2LS0 1;  1PZI D;  4U68 A;  3SK5 A;  3VYT A;  3S2H B;  3BVZ A;  3P1H A;  3OPO A;  4IUT A;  3H91 A;  2L9H A;  2FHT A;  4C1N I;  2K5D A;  3GTQ B;  5E3F A;  1EEI D;  4R8N A;  4JK1 C;  1F2M A;  3VR3 A;  4ABN A;  1G29 1;  4K6L A;  4V19 0;  4LAA A;  4E6I A;  3SEB A;  1HQR D;  5JEA H;  4CJ2 C;  4NDX A;  3Q6S A;  1B53 A;  3AMU A;  2B2U A;  4HAE A;  1AW7 A;  2A6E C;  3E0J A;  1PFB A;  1I6V C;  2KA7 A;  3SK6 A;  4QUC A;  1A3U A;  3SXH A;  4KKU A;  3TN2 A;  3PUV A;  2X6L A;  3GTG B;  1SEB D;  3J7A V;  1STE A;  2EYF A;  1F2Y A;  3J7Y W;  4RKL A;  5ELE A;  3NTI A;  5M3M B;  2B2V C;  2WP8 J;  3R2I A;  4HTH A;  2EJG C;  1U4P A;  3S17 B;  5LHY 1;  3VA5 A;  1SJH D;  1ICW A;  5D3I B;  3EFX D;  3GTL B;  1HQM C;  5JAV A;  1QWY A;  1BBX C;  2EY1 A;  4FO2 A;  2KEC A;  2EY5 A;  3OIP A;  4XIG S;  2L4N A;  2F1M A;  4C2M B;  5C4Z A;  3HOU B;  1TS3 A;  2K5Q A;  1KNA A;  4IUR A;  1LT5 D;  1RTO A;  3KK7 A;  2LFN A;  2SNM A;  1RKN A;  3RLF A;  3MXG A;  1J8I A;  4A3G B;  4CJ0 B;  4ZLT F;  1SMY D;  2FFK B;  5G3L D;  1SNP A;  4EVO A;  1BF4 A;  2JE6 I;  3S14 B;  4QB4 A;  4BS9 A;  5TSS A;  2NN6 H;  4RA8 A;  1MI2 A;  1JCK B;  3PIP 3;  1SYF A;  2WV6 D;  1BCP D;  1B9N A;  1TWA B;  3D31 A;  1SJE D;  2IX3 A;  2AWN A;  3M85 A;  2NVQ B;  1WTX A;  4C3I B;  1IHZ A;  1BCP B;  3FVQ A;  4FNF A;  1OXS C;  2F0S A;  4EGV A;  4RCO A;  5JVH 3;  4PMC A;  1ENF A;  2VNU D;  2FMM A;  3QOJ A;  1WVL A;  4IAL A;  1IKL A;  3C46 A;  3HRZ C;  1EY8 A;  4F7X A;  1PTO H;  1SAP A;  5M5X B;  2D62 A;  3CKI B;  4XQJ A;  4G7H C;  3WDN A;  4ILW A;  4OIJ A;  4WRD A;  5J39 A;  2KCC A;  1EU3 A;  2JXM B;  3GQB A;  3MFY A;  3OWF A;  1G8Z D;  1H9R A;  2L0C A;  2EY2 A;  4F8M A;  3O13 A;  1BCP C;  2VUM B;  1F9Q A;  5D14 A;  3UI2 A;  5IGE A;  3GO5 A;  3Q0A A;  4TSS A;  4DXF A;  2IT1 A;  3ITP A;  5E4W C;  4IFD J;  1EWC A;  2F0G A;  3FDT A;  5C0X I;  1Q8I A;  2O4X A;  3MVV A;  1MGS A;  5KNC A;  3K6O A;  4ULL A;  4I65 A;  3BG3 A;  1NAP A;  1A2T A;  4HMJ A;  2Q8I B;  4S3S A;  3IFD A;  4A93 B;  2B8F A;  2HCI A;  4DN4 M;  1SYD A;  1KLG D;  3KLR A;  2CHB D;  4IUQ A;  1LTI D;  4KKT A;  4BBS B;  4OIK A;  4C3J G;  2Y0S B;  3J80 L;  5NUC A;  1PRT D;  5FO9 B;  4KV6 A;  3IFT A;  3GV3 A;  5K5P A;  3D4W A;  2JSO A;  3C1E A;  4H0L C;  5COY A;  1V1P A;  5J1Z A;  3TSS A;  2MGS A;  3S1Q B;  1U4L A;  4HCE A;  1ML0 D;  4G7Z C;  4ZUI A;  1K8M A;  3RD4 A;  3NBH A;  3PMF A;  3VYS A;  1S5E D;  5DAU A;  5G3L F;  3S15 B;  1L0X B;  5KYI A;  2WAQ B;  2M9V A;  2BDO A;  4XYQ A;  3FEW X;  2WIN B;  4ZKC B;  1PYW D;  1NR2 A;  3QB3 A;  3DMU A;  4ZKB B;  5CMD A;  1PTO F;  4HSP A;  2A68 D;  2KUM A;  2XSC A;  4KD3 A;  4XT1 B;  3TBI B;  1CQV A;  4ZK9 B;  1PZK D;  1VF7 A;  5A2Q E;  1G2S A;  3D4R A;  2K28 A;  1WTQ A;  3FPU B;  2N55 A;  3LWU A;  4WOR A;  3FKI B;  4ZQ3 A;  3HZX A;  4R8I A;  2NVY B;  3ERQ A;  3I8Z A;  4XQQ A;  1B2T A;  2NZ1 D;  2G9D A;  1NSN S;  1NR4 A;  3ND9 A;  1IL8 A;  3CRL C;  4IFD I;  1SSO A;  2RQX A;  3W3A A;  1SNC A;  4I7Z C;  3GTP B;  3I72 A;  1RHP A;  2WAC A;  2B2Y C;  4LK1 C;  1ILP A;  1EYD A;  5E4X A;  1ET9 A;  1HXY D;  3OWE B;  1JWM D;  5C44 B;  1GHK A;  3DHQ A;  1TQO A;  4FVM A;  5KGU A;  2Z4H A;  4BA2 I;  3HGB A;  2AQ1 B;  4B9X A;  4EQP A;  3AB9 A;  4RGM A;  1MSH A;  1KAA A;  1ZXT A;  5A35 A;  3S9W A;  2M2L A;  2WKD A;  2V4D A;  1K8O A;  1HCZ A;  1CM9 A;  1QOH A;  5C3X A;  4FF2 A;  4C1N K;  5C0X H;  3A8I E;  2F0O A;  3LX0 A;  3S16 B;  1WTR A;  1BDO A;  1A15 A;  3BVM A;  1TS4 A;  4G4K A;  1OXT A;  2ENB A;  5C4J B;  3HP3 A;  1LT3 D;  3NQT A;  3MXP A;  2DN8 A;  2PO4 A;  2ZXR A;  3I70 A;  2D5D A;  5EKK A;  1IKM A;  1D5M C;  4RKB A;  4N9P A;  4C3J B;  2F0H A;  5FO7 B;  1KLU D;  3DEO A;  5BN4 A;  4RWS C;  3BYT B;  1NUC A;  5IOD A;  5CV8 A;  1JR0 D;  2VB3 X;  2BE5 C;  4UAI A;  2F0V A;  2F0D A;  5EGT A;  2BOS A;  4CKC A;  3J80 E;  5IOC A;  1CT1 D;  3E5S A;  3K5L A;  1J9O A;  4Q5V A;  3L7Z C;  2NN6 I;  2IWH A;  1I6H B;  1G91 A;  3GTM B;  4PQX A;  2SNS A;  2NUC A;  1Y8O B;  1H9J A;  4QIW B;  1F2Z A;  2JA5 B;  4XXE A;  5JEA J;  2F03 A;  1LTG D;  1U9R A;  3K59 A;  1DXM A;  4CKE A;  4B9W A;  2PZU A;  3L3O C;  5EPK A;  4RAU C;  3SK4 A;  1EZ6 A;  1CFM A;  1TS2 A;  5JPM C;  1LT4 D;  2PZT A;  3MXN A;  4ZAI A;  1RF2 D;  2F0F A;  1DM0 B;  1U4R A;  3CQZ B;  4IN3 A;  4N9T A;  4J1M A;  1II3 A;  2EVB A;  2MHV A;  3H09 A;  2PPB C;  3C3L A;  1SYB A;  2SOB A;  2H1E A;  4A3B B;  5IT9 L;  1MD2 D;  5FO8 B;  1UNS A;  1OO9 B;  4X3T A;  4P2C B;  2F0L A;  1BXT A;  4A3F B;  3NHH A;  2ICE C;  1PFM A;  1YNJ D;  2EJF C;  2E75 C;  2EE1 A;  1TKW B;  4C3I G;  1ESF A;  3MAQ A;  2F0E A;  2F0Q A;  2SDF A;  1Y1V B;  2Z1C A;  4KHZ A;  2KQ3 A;  5IGC A;  3M4Y A;  4QUF A;  1EIH A;  2JP1 A;  1DD2 A;  2Z4I A;  2K03 A;  3OW7 A;  1SYE A;  4A3M B;  3HS0 C;  5JVG 3;  2K7V A;  2RSO A;  4A3I B;  1HA6 A;  5AFW A;  5EKL A;  5M5Y B;  2HQE A;  1XWE A;  1KDB A;  3H0G B;  3M4O B;  4KN4 C;  5I9O A;  1H9S B;  1HRJ A;  2B2W C;  4A3J B;  1F9P A;  1EFI D;  3NTH A;  3NP8 A;  4QF4 A;  2FIN B;  2R7Z B;  3M7N A;  2A6H C;  5CV5 A;  1BQQ T;  1FNW A;  1WTO A;  1EU4 A;  1E0B A;  2X6G A;  3ND8 A;  2EJM A;  1CZW A;  4U67 3;  1CI3 M;  1PXU A;  3VR6 A;  5FOB B;  1G2T A;  4QMG A;  2K5W A;  4IZ8 A;  4KY7 A;  2F0J A;  1OXV A;  1PFN A;  1X3P A;  5M9O A;  2C5C A;  1HA5 A;  3H94 A;  3P75 A;  4ODG A;  5HGT A;  2F0W A;  1STY A;  3A8K E;  3A56 A;  1Y1W B;  1SBB B;  4RHS A;  4KK7 A;  3NBI A;  4TQU S;  1CK1 A;  2C9O A;  3D6W A;  2PNR C;  1ZYR D;  2RVL A;  1V43 A;  3DM1 A;  2Q8T A;  4K2K A;  4CKB A;  2A6H D;  2PQE A;  4GZY C;  3SVM A;  1OXU A;  1TII D;  3PUW A;  2J4X A;  1ZKO A;  1VDZ A;  3SE0 A;  3V05 A;  4K8J A;  3GV6 A;  5EPJ A;  2F0I A;  1TWG B;  2BA1 A;  5EBC A;  3HOX B;  3EJI A;  1H9K A;  4DAV A;  3OHX C;  5C6A A;  2R92 B;  1B1Z A;  1YNN C;  5CV4 A;  1U4M A;  1F9S A;  3GD7 A;  2RBM A;  4DA2 A;  2PYK A;  2G9H D;  4DK0 A;  3RMH A;  1A3V A;  3KLS A;  2CW0 D;  5CV6 A;  3DXJ C;  1XTC D;  1EY9 A;  3X3M A;  5I9P A;  5EKI A;  1R4P B;  1LAC A;  5EQ0 A;  1KDA A;  3I90 A;  3J7A F;  1O7Y A;  1D2B A;  2R3Z A;  2QKI C;  3PUY A;  1RD9 D;  2KCN A;  1TWF B;  3S1M B;  3PO3 B;  1TT2 A;  1O7Z A;  2AQ3 B;  5C0X G;  4KJN A;  1WD1 A;  2J7Z A;  2F3V A;  4L8J A;  4ZUJ A;  2BA0 A;  3TP5 A;  4CGY B;  2ZXO A;  1CTM A;  5ELD A;  3WOE A;  1EYA A;  3N6R A;  1LO5 D;  1Y69 U;  1EY7 A;  4LMQ D;  4X3S A;  3E6Z X;  3EA6 A;  2JEB I;  4PNY A;  5I6Y A;  3DWQ A;  3QO2 A;  1I50 B;  3RUZ A;  3JAM L;  5K36 H;  2KHS A;  3IL8 A;  1Q3L A;  1FYC A;  2EYL A;  1C48 A;  3BS1 A;  3RZO B;  1JC7 A;  3KLS X;  1LV9 A;  1KDC A;  2I07 B;  2XWJ B;  1D5X C;  3S2D B;  4QCL A;  1ZEQ X;  4CBV A;  2XRS D;  2EOT A;  1GUS A;  4HED A;  2O5J C;  1WTV A;  5C3E B;  4FYD A;  2OF1 A;  2LMC B;  3KF8 A;  1W6J A;  4NW2 A;  1LTA D;  1AZP A;  1H9S A;  4BBR B;  2NN6 G;  1B50 A;  2LY7 A;  5DNF A;  1M4V A;  1NCV A;  3T13 A;  4OO1 G;  2D9U A;  5F2D A;  2B8G A;  2OT2 A;  4WFN 3;  1BO0 A;  3KUP A;  2ID0 A;  5I6W A;  4EQN A;  1IYV A;  2IPK D;  1TVX A;  1JQY D;  4FF1 A;  1PRT B;  1B3A A;  1VF5 C;  1RJT A;  1DOL A;  1UUP A;  2E2J B;  2B2W A;  2NTT A;  2L11 A;  1YNJ C;  1GUG A;  1FNU A;  3I73 A;  1JOO A;  1ROD A;  3PO2 B;  3HG9 A;  2D2C C;  4G57 A;  2O5I C;  5FLX E;  5CBA E;  1O80 A;  2PZW A;  1EQT A;  4UDU C;  5M5W B;  1L0Y B;  1CQF A;  1HTP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...