4U673

Crystal structure of the large ribosomal subunit (50s) of deinococcus radiodurans containing a three residue insertion in l22
Total Genus 0
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
0
sequence length
59
structure length
59
Chain Sequence
THKMAKRRIKITGTGKVMAFKSGKRHQNTGKSGDEIRGKGKGFVLAKAEWARMKLMLPR

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2
publication title The Ribosomal Protein uL22 Modulates the Shape of the Protein Exit Tunnel.
pubmed doi rcsb
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2014-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF01632 Ribosomal_L35p Ribosomal protein L35
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.530 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4u67300
3PIP3 5DM73 5DM63 4WFN3 5JVG3 5JVH3 4U673 3PIO3
chains in the Genus database with same CATH superfamily
5CC4A 4DAVA 4EQPA 3DHQA 2X6LA 1S4ZA 3S1RH 2A68D 1Q86C 2AKWB 1A2TA 3R93A 1EWHA 1QB5D 2QEJC 3GTLB 1JOKA 1VQEA 1SSOA 2A1AA 3RD4A 4DV7L 4XDXA 4PZ7A 3HKSA 1UE6A 1G51A 4DV5L 3ULPA 2J4XA 3M4OB 2F03A 1NMGA 3NBIA 3S16H 3KLRA 5IP7H 1HUMA 3QR8A 4QIWE 4BY7G 1WTXA 3E0JA 4C2MB 3PIO3 1EL0A 2F4IA 3GTQB 1EQRA 1PXUA 3LWUA 2RDGA 2Q2UA 4DV3Q 3HOWH 1EUJA 2AWNA 4B3RQ 3K81C 2B29A 1XMQQ 1X3FA 2JEBI 2XVSA 2KQ3A 3OHXC 4KHVA 3D4WA 5J22A 4OO1H 4N9TA 4FF1A 1LT5D 2QCPX 4X3UA 1PA6A 5DNFA 2UXCL 2EPBA 3U50C 2IX0A 1YHBA 2QDBA 2XRQD 2WKDA 1IBKL 1N34Q 2KCCA 1LT3D 2CH4W 1H9MA 3IAYA 2CCZA 2F0QA 2VQFL 3IRBA 4AQYQ 3ONAB 4IUVA 4JI6L 3GQBA 3VYSA 4BY7H 4A3BG 4GNXC 3J7A5 1VQAA 2L4NA 1Q81C 4FF2A 3AYHB 1PYSB 4DR7L 3S17H 2KECA 1Z6HA 3TZDA 1BOSA 2EYMA 4FP5D 3GTGB 2R6GA 4DNRB 2KCMA 3O13A 1HQRD 2LS01 3U58A 4OWWB 2AWOA 4XQJA 4IO9A 1E24A 3TP8A 1Y1VG 3HEJA 5FO9B 3I7FA 2V1CC 1P8LA 1P16A 4YWMA 4NPSA 1N36L 3PGZA 1JC7A 2WIIB 4XT1B 1WTHA 3M4YA 2IX3A 4LF6Q 3W2DA 2UUAL 2WACA 2SOBA 1VQDA 2JA6B 4XIGS 3I3CA 3OOCA 3DLLA 1E1TA 4OGQC 4A3BH 5EJWA 1PFBA 4YCUA 2IHFA 3RN5A 3CAMA 3BZCA 5M5YB 1WFQA 1F2LA 2Z6KC 1UE5A 5JVH3 3EBEA 2B2YC 1HRJA 1JT8A 3CW2C 3PO3B 4M1UB 1PTOB 4MTKA 4X62L 3F8TA 4YY3Q 4B3ML 1Y1VH 2RQXA 3UE0A 5JVG3 5M5XH 4G4KA 1YIJA 1XNRL 1WTRA 4ZUIA 1AP0A 3A7AB 3EIVA 4K0KL 4QUCA 3PIOA 1YNNC 2DNCA 2XGTA 4OXPA 1GHKA 2E2IH 1TWGH 4X66Q 1RDPD 1JB3A 2YV5A 1H9RA 5CV5A 1ZXTA 4C3IB 1EYCA 1TT2A 1D5XC 1EWIA 2GVBA 3H0GH 4B08A 4BBSB 1Q8KA 4K8JA 3GTLH 4XT3B 2LKVA 5HY6A 3HP3A 4L63B 3SGIA 4F88A 3J81i 3HOVB 1KC8C 1MGSA 3S9WA 3M4OH 1YNJC 4DR3Q 1LT6D 2F0PA 1TS3A 4DAMA 5LL6X 1LYLA 3E6ZX 4K2LA 3BZKA 3R2IA 4C2MH 3EVQA 1IW7C 4DK1A 4OX9L 4HEDA 1CI3M 4HTHA 2IWHA 4B9WA 2DGYA 1E3PA 1BCPD 1X65A 4XXEA 1BBUA 3DEPA 3TZUA 3EFXD 2DN8A 4NXNQ 2F0WA 4J6HA 1D7QA 1D6EC 3K7AH 4NMZA 1K8GA 2HD3A 2EJGC 3K5LA 2JJQA 5M3FB 1VQCA 2JA6G 2MPMA 4JI4L 2EYHA 4Z9CB 2IW3A 1DD2A 2R93B 3G4SA 3ZJYC 5I2XA 1VCIA 1HNZL 4AIMA 1R9TB 2BE5D 1I3QB 3R3OA 1QZHA 3G7LA 2Z6BA 5JEAG 5ELNA 2ATWA 4CJ1B 1BR9A 1EY7A 2KBNA 5M9OA 3T1HL 3MWYW 4JYAQ 5C4XB 3GTGH 2EXDA 2ZT9C 2VY3A 5LMUQ 3PV0A 3PO3G 1K0RA 1GM5A 3I4OA 4KJNA 3IFTA 3C1FA 5IWAQ 1CHPD 4JI0L 5EBDA 4GLVB 1N9WA 2K32A 2IX1A 3RUZA 2X69A 4K6DA 3PUXA 4B3TQ 2NVXH 3L2PA 1CKMA 4C3IG 2RHSB 4NDXA 1SNQA 4B3SQ 2JSOA 4A3FB 4BBSG 1IBLL 2JA6H 2KCNA 3GTKB 1STHA 1SROA 4X65L 5I4DA 1WTQA 1ENCA 3HOVG 2Q2HA 1STAA 1K73C 2IHEA 1WCMB 5M5YH 5JEAH 1PFMA 4DUYL 1EWCA 3U9SA 2I5HA 4DV6Q 1YJ9A 2ASBA 4LNQA 5FOBB 1PTOH 5A35A 1EY0A 3MFGA 3KF8B 3GV6A 2B2VC 5HURA 2MHVA 2C9OA 1I50B 2NZOA 1H95A 4UP9A 4CKBA 4DR5Q 4LF9Q 4QJFA 2A73B 4KN7C 4C3IH 2K5NA 4F87A 4A3MG 1O80A 2F4VQ 1HZ9A 2NN6I 1PRTF 1NR4A 1RD9D 2OTJA 1QILA 3H09A 4HIOA 3HOVH 2JN4A 2WB1B 1E2WA 3BJUA 1B9MA 3UDFA 5CYUA 2GVAA 1PH2A 4JBWA 1N33Q 3CPWA 1O7YA 1XTCD 2EE1A 4DV3L 1IL2A 1GKHA 3F2CA 2EY2A 4B3RL 2EJMA 1KNAA 3JAME 1XMQL 1G6PA 3A8IE 3BG3A 1DM0B 1LTLA 5KYLA 1PH8A 3MFYA 1DXMA 1YHAA 3AMUA 3VYRA 4MIUA 5C4XG 4JI8Q 4JI7Q 5IP9G 4FXGC 1KDAA 3FKIB 1GXDC 4KD4A 4LAAA 1CQFA 4DKAC 3A74A 2DNEA 4BXXG 1N34L 1DOMA 1LLRD 4RCOA 2UXDQ 5IOCA 4A3MH 4RKLA 4HIKA 5KGUA 4KMUC 1AEXA 1V1QA 3T56B 1VQJA 2WP8J 4AQYL 3C2PA 3CQZB 1UEBA 2N8NA 1EU3A 4C3HB 1NCVA 2N3SA 3NHHA 1RTOA 4TRDA 5C6AA 2F3WA 4A3FG 5CV7A 2PPBC 3K6OA 3CCMA 4R4QA 4DNIA 4L8JA 2EDGA 5E4XA 2ZTEA 2L12A 1I3QH 2D9UA 1MKHA 4UY8C 1TS4A 4HSPA 4FNFA 4PMBA 4IFDG 5C3EG 5C4XH 4Y52H 2B2WA 5IP9H 2OXPA 4LUOA 1HFNA 4KLKA 4BXXH 1U4MA 3CCEA 2Z8LA 1LTSD 2KEDA 4DGZA 4LF6L 2D0OA 3CHBD 1XYIA 4S3SA 2BOSA 1EIYB 2UU9Q 2M2LA 1K0SA 1G6ZA 2JK8A 4WRDA 3GTOH 2RKSA 3CPFA 5CBAE 1DCZA 1GJXA 1QVFA 4OL7A 2WAQE 1U0LA 3GTKH 4AH6A 1HUNA 3CCJA 2JYOA 2ZM6Q 1PLFA 1IYJB 2WB1G 3G6EA 4A4IA 4PV1C 3H15A 4YY3L 5IGBA 4WJWA 4IFDH 1IHZA 2XTIA 5C3EH 1LACA 4QY7A 3V05A 1TIID 2A5HA 3JC66 4RCNA 3UDIA 4NW2A 1QG7A 2H1EA 2HIVA 1BKBA 1EIGA 2BH2A 1PH5A 1X3PA 4N8FA 4X66L 1JOOA 4GN3B 1A62A 4LWCA 1I50H 1K83B 3FKIG 4IALA 2CQAA 4JI5Q 3ITPA 3CF5A 2R7FA 2PNRC 2EQSA 3VR6A 3MXPA 5KEEA 2RHQB 3I91A 3X3NA 2B8GA 1SYGA 1AZQA 4DR3L 1DOKA 2DJFC 4N9PA 1VQOA 1MJEA 4KKTA 4C3HG 1TR5A 1I6HH 5IIFA 4QB4A 4A3EB 4WJ3M 1K8OA 1L1OA 1JE4A 3S2HH 1X6OA 4A3DB 3TP7A 2E2HH 1A15A 1LTTD 1Z7TA 4HR7B 1HNWQ 3MC0B 2D5DA 1XX8A 3SEBA 2RCNA 4HIMA 1A3VA 4A3KB 4K2KA 2FMMA 2NTSA 1HHVA 3FKIH 5DAUA 4LFBQ 4NXNL 3GTPB 4DR2Q 3LWEA 3HOZB 4ME5A 4UDUC 4JI3Q 4JI2Q 3CQZH 2N88A 4C3HH 2F3VA 1SYEA 1A0IA 4EQNA 2XN9C 5IYBG 5EPKA 4EQ5A 1EY4A 1LUZA 3WOEA 4LK1C 4ALPA 3VDYA 2SNSA 1JMCA 1Y14B 4JYAL 2B3GA 1HXYD 2GA4B 5LMUL 1TY0A 5DM63 2RF4A 2EY5A 2F0TA 4GS3A 1UE1A 4QUFA 2HDLA 5IWAL 1YJWA 1Y69U 3T16A 2EOTA 4C1NI 4X64Q 3NUCA 3OMGA 1KD1C 4B3TL 3W1BA 5FLMG 1RL2A 1U9RA 2CW0D 4B3SL 3C46A 4UP8A 4O1NA 3PUZA 1Y8NB 4J15A 3TP6A 5IYBH 1K9MC 1B53A 1FNVA 3TS2A 1XNQQ 3F2BA 3AB9A 3OTOQ 5J3BA 2PW7A 3QWNA 2C35B 4XQNA 3NQTA 4DV6L 4RMFA 2ALYB 1VQFA 3U4ZA 4N8X1 1UWVA 1X32A 4AYBB 1E0BA 4RGMA 4A3DG 3K80C 1TWAB 1PRTB 1RJTA 2WFWA 4R8IA 3HKZE 1F9PA 4J8QA 2OQ0A 3K57A 1FYCA 4DR5L 2HT1A 4LUZA 3HG9A 1K3BC 4LF9L 1JWSD 3OMCA 1DGSA 5FLMH 4MN3A 1N8RC 1K83H 2F4VL 4BA1I 2B8FA 2L55A 3MZ5A 3SVMA 2QF7A 2CKZB 1GUTA 2PMZB 3E5SA 1KTKA 4JV5Q 2KHIA 2PYKA 5C0XI 3OYYA 3P7JA 3NPPA 1NBWA 3CCLA 1RTNA 3M4PA 1N33L 4ZRZA 2E2JB 5GAHC 1YEZA 2PI2E 1S40A 3T4AC 1C9OA 5E1FA 3I4MB 5C4JH 5BN3A 5IGFA 2ZJRA 1PH9A 4EX5A 3J80i 4LMQD 3NQIA 4A3DH 2K4KA 2ZXOA 1EFID 1PH3A 4A3GB 4JI8L 4JI7L 3RLFA 1QOHA 1LTBD 4OONA 4HMIA 1KL9A 3TEHB 2K1BA 1K8MA 2Q2TA 4TSSA 5G3LF 1Q82C 2O5IC 1X9NA 2UXDL 2B63B 2FINB 1VQ9A 1I4QA 4IUTA 4J1MA 2CWAA 1LM0A 3S1MB 2H5XA 2DY8A 1JB7A 4YHHQ 1KXLA 2B2VA 2BH8A 5IYCH 1T5XD 4XYOA 1EYDA 3QOLA 4KY6A 3FHWA 3G48A 3Q24A 2YTYA 4FXKC 1PDQA 4IFDJ 1XPOA 4QIWB 2F0GA 1U4LA 4ZUJA 2V4DA 3SK6A 2D2CC 5JPMC 4JOIA 2FMCA 1G291 5IGDA 2TMPA 4Q5VA 4AYBG 3ZYYX 4DN4M 2KVMA 1SYDA 4JBKA 1XTDA 3LNNA 1QNKA 1OXSC 3KK7A 4DU9A 5EPJA 4OO1I 3STBC 1WD0A 3HKZG 3S15B 4FYDA 1OXVA 2UU9L 1GUWA 3KLSX 1CSQA 1H9JA 4RGOS 1TWCH 3NTHA 3FMCA 5LMNQ 2D62A 2ZM6L 1SJHD 1TXYA 1I4HA 3RZOB 1SNMA 3F2UA 2F0IA 1SNOA 3D4RA 4BS9A 1JICA 2JA9A 1H9SA 5F2DA 1H9SB 1V9PA 2MGSA 2JEAI 1K3RA 4FO2A 3S1NB 5TSSA 1TWAH 1FL0A 5EGTA 5T1IA 5EBCA 3H6MA 4CBVA 3BVGA 1DJRD 1X55A 4JI5L 2CHBD 4FF3A 1ICWA 4FDBA 1G2TA 1JWMD 3JAMc 1VQ6A 2SNMA 4JCVE 2K50A 3ERQA 3J81E 4PQXA 1KQSA 2LXKA 5C5LA 5I6WA 2B63G 4KK7A 2F1MA 1X56A 2F0UA 3HS0C 3A56A 2EZVA 4K14A 5T1GA 1X3QA 3L9AX 1K8AC 1SXTA 3FDTA 1V43A 2ZXRA 4KTAA 2E2JH 1JOQA 1J9OA 3G6JB 1GHJA 1HNWL 2KENA 2RBMA 4R8NA 5CGKA 1X3EA 3KOJA 1WTPA 2K6AA 4CKCA 4RH6A 4K5WA 4LFBL 4DR2L 5C5MA 5KNDA 2DY7A 1D8LA 4APVA 1CFMA 4ZCKA 4JI3L 1IZ6A 3CD6A 4JI2L 4H44C 3TQYA 3PQIA 2B63H 4KHPQ 5D65A 3CMAA 3GTQH 3CC7A 2VNUD 4KN4C 1YNND 2FXQA 3S1MH 1Q8IA 1PMRA 1CKNA 1CHQD 3T1YQ 1AZPA 4HMJA 5I9OA 3CMEA 2UXBQ 3VA7A 1O7LA 4ABNA 4NB3A 4A3IB 2KA7A 1SE2A 1EQVA 4X3TA 4IJLA 2HCCA 1QUQA 1QUQB 1M4VA 3S24A 1E2ZA 2ICEC 2K33A 3MVVA 4X3SA 2B2TA 1YNJD 3SDZA 2M00A 1L0YB 2O5JC 1JE5A 3QIAA 2E74C 4X64L 2J7ZA 4IOAA 1I4RA 4OHJA 1IW7D 1EZ8A 2QW7A 2YYZA 4GKJQ 4U673 4G7ZC 1VQ4A 1I6VC 5CMDA 5ELBA 1YBYA 5JJZA 3RNUA 1XNQL 3DWAA 5IT9E 3OTOL 1H9KA 1F9RA 4JBMA 4Y7NB 2VL6A 3NELA 4QGUA 4GOPC 4BY1B 5KNBA 3K5OA 3K8AA 4MZ9A 2HUGA 2FFKB 1RCVD 3RZOH 1TY2A 3OIQA 3H3VH 4IQZA 1BCPF 4IZ8A 1RIPA 1E7ZA 2LSSA 4L5QA 4KI0A 2QILA 2ES2A 5CBEE 3F2DA 1JORA 1CZGA 2NWGA 4L5TA 5KIXA 4QF4A 4F8MA 4HJAA 1CZWA 3ULJA 2M9VA 1HPCA 1VQ7A 2MUYA 1C0AA 2RCFA 4ZKBB 4DAPA 4P75A 1EEID 2NYZD 1OXTA 2IPKD 1WYDA 4M8AA 5AJ3Q 3W1GA 4PG3A 2CVRA 3ND8A 3HRZC 1TWFB 2ENBA 4LFCQ 4JV5L 3RR5A 1PH1A 1ENAA 3D6WA 1L0WA 3PO3H 2SDFA 2OQKA 4KJOA 5FK9C 3I56A 5FLXc 1VMCA 3MAQA 1B3AA 1HFGA 3ER0A 3JAML 2F3IA 3N52A 3K58A 5K36G 3NK9A 1STYA 4DNTB 2BA0A 1KABA 5BN4A 4A3IG 4O2DA 4BBSH 2OEOA 2XNAC 1HR0Q 1YJNA 2JP1A 3I90A 1EFWA 3L0OA 3E3XA 3GTJB 3CU7A 2P5ZX 3H94A 5IY0A 1SYFA 2F0JA 2WB1E 1KIXA 4K5XA 3W5OA 5M3FG 1MJCA 2NVYB 1XMOQ 3MXGA 3TDQA 1QCBD 4R4IA 2R93G 4LFAQ 1GD7A 3NE5B 4TKOB 4HAEA 3TBIB 2HHHQ 3HOYB 3FPUB 2DUDA 4YHHL 4HIDA 5HGQA 3J81j 1TQOA 4K8IA 2LMCB 3A54A 2Y0SB 4I65A 2BCOA 4NXMQ 1UUPA 3HOUB 5BR8Q 2XSCA 5K36H 2B2UA 3BVZA 4CHTB 2A69C 5LL6S 1CSPA 4O0AA 1VQMA 3S14B 3P1HA 4KKSA 4QQBX 1ML0D 2NB0A 1EZ6A 5D3IB 2F52A 4DFAA 1FJGQ 5ELFA 5JJKA 3E9IA 1G8ZD 4YWLA 1PH6A 1OXXK 3LGJA 3Q22A 5M3FH 2PNHA 4HN7A 4R4OA 4LF4Q 2KHJA 3I8ZA 1NAPA 1S5ED 4PZ8A 2WV6D 2R93H 1SN8A 1WTVA 2A6HC 3CP0A 3H3VC 1MBYA 1R9TH 3KDFA 5CV6A 2PO4A 3KDFB 1WCMG 4HJ5A 3Q6SA 2F0FA 4IUNA 5LMNL 2FHTA 2EXZA 3QOJA 3WWVA 2EIFA 2IT1A 2NZ1D 4L5RC 1STNA 4Y7NH 3S1QB 1AE3A 2HCIA 4DV0Q 2RSOA 3WDNA 4ZLTF 2I0QA 2GN5A 5H1SE 4HJ9A 1GUSA 1BXTA 4CDCC 3PO2B 2EYLA 1PTOC 3TS0A 1W3SA 4A3FH 1KAWA 2VQFQ 2L15A 2ZTDA 1MIUA 1PZKD 4HCEA 3BDLA 3D8GA 5EPLA 1KAAA 1WCMH 1T9HA 1SAPA 3OPOA 2VZAA 4IJHA 1TWFH 1Y8OB 2KEEA 4XQQA 1JCKB 3HOYG 5ELOA 5C3XA 4GNXA 4H13C 4MNOA 1SYBA 2HQLA 3PMFA 2K05A 2Y0SG 5GQOA 1FD7D 2F0DA 4JK1C 3KLSA 1PTOD 4TVAB 4E6IA 1Z47A 5FLXL 1UNSA 4R1JA 4IFDI 1OO9B 3EA6A 1LT4D 3A0JA 4IUQA 2R7ZB 5EKIA 4R4CA 5I2YA 1Q1EA 3NWSA 4RHSA 3KYHC 4H0LC 4A3JB 2VB3X 1DOLA 2NVYH 1WTOA 1WOCA 1L1OB 1QVCA 4KHPL 3RMHA 3VA5A 2JQOA 1YI2A 1EY5A 1LTRD 3MEFA 3TREA 3PUYA 5GROA 3MXNA 3GP7A 3MXNB 3A8JE 2Z0SA 4TQUS 1KHIA 2LY7A 3NBHA 3T1YL 4DAYA 4IOCA 3AFPA 3DXJC 5DM73 2UXBL 2BDNA 1BUVT 1STGA 1VF5C 2MQHA 2Z6KA 1N32Q 3CCUA 4KY7A 4GKKQ 3BU2A 3OW7A 1BVSA 5L37A 1U4PA 2B2YA 1EYGA 1B7YB 5COYA 3CC4A 1BDOA 3KUPA 1ZYRC 5BN5A 1TWHB 1IKMA 2ZTCA 5ISRA 2NBFA 1O7IA 2PCFB 4QCLA 1MHWC 2KCTA 3FPPA 1EQQA 4RAUC 3S16B 4GKJL 5CORA 2A8VA 4DPGA 2O4XA 1PV4A 5EAYA 1D5MC 1VQHA 2TSSA 3T53B 5FO8B 2QGQA 4RGNA 1BCPB 2C5CA 1IBMQ 3RZDB 1ESFA 1NY4A 2CH4A 4PMWA 2L0CA 3PUWA 4ID6A 2E5LQ 2F0NA 1HZCA 3AU7A 1SE4A 1X3GA 2K5HA 3S1QH 4OWTB 1ZYRD 3IKJA 3SXHA 1B8AA 3P75A 5ELEA 1VQPA 2CWPA 3KBGA 2QKIC 3J81c 3D3RA 5EKKA 4G7OC 4RWSC 3VR5A 4DA2A 2NVTB 3L7ZC 2K28A 1HZAA 1TKWB 3M85A 5AJ3L 3VR2A 1MI2A 4BY7B 2NUCA 5CV8A 2R7ZG 1I94Q 4LJZC 1CQVA 4DV2Q 1RHPA 2I5MX 5HGTA 4B9XA 4DUZQ 4LFCL 4DV4Q 3M4QA 1MSGA 4CJ0B 4A3EG 2JA5B 4AYBE 4EVOA 1LABA 2JXMB 4DK6C 3A5UA 1R4QB 4K5VA 4ULLA 2EJFC 1BNZA 2EY6A 2HQEA 2JE6I 5A2QE 1HA6A 2RDFA 5DLQE 3J80E 5IE8A 4A3KG 2IL8A 2R7DA 1NTGA 1XJVA 1D1KA 4P72A 4POGA 1EOTA 1HR0L 1IL8A 1JR0D 2DJGC 3NEMA 3HOZG 3HGBA 4C3JB 3V2TA 3CC2A 5EKLA 2OTLA 2R7ZH 1AN8A 2AQ2B 1XMOL 2RSNA 1JJGA 2HDMA 2PZWA 5GADC 3I55A 2Z4HA 1VQLA 4LFAL 4BWGB 2HHHL 4A3EH 4P74A 2UUCQ 1QWYA 3ND9A 3PCOB 3H91A 2Z9HA 1Q90A 3AQQA 1EOVA 4PZ6A 1O78A 2K04A 1A8VA 1PFSA 1ZKOA 3Q0AA 1ESRA 4RFBA 2CFMA 4NXML 3QJYA 5BR8L 1A6XA 1TS2A 3E0EA 4IPDA 5IODA 1RF2D 4JVZA 3PF5A 4A3KH 1VQKA 1F77A 1WI5A 1SNPA 1Q46A 3A8KE 5DEHA 1PYWD 1PYBA 1SDFA 2PI2A 1V1OA 3J7ZC 3SK4A 3GTPH 1K28A 1FJGL 3H0GB 4MTNA 5AFWA 3HOZH 3TN2A 4Q0FA 3UDXA 4LF7Q 1TWHH 2JA7B 2R3ZA 5IT9c 1ENFA 2K14A 2K5VA 2Q8RE 1IKLA 1FGUA 2F0VA 4LF4L 1OXUA 2QA4A 1F9SA 2B2WC 4IPGA 2AUJD 2R92B 2AHOB 1EY6A 2EYPA 4IPHA 1W2BA 4OELB 1GO3E 3BDCA 3URYA 1Y1WB 3QG1A 4A93B 4A3CG 3FRPB 3RZDH 2JA5G 4LW1A 1AH9A 4DV0L 4P71A 2JA8B 4HJ8A 3RN2A 1L0XB 2LXJA 1B9NA 4ODGA 1Q12A 2PQAA 3AEVA 2PQAB 3J7AV 2VS1A 2B39A 3DM1A 1FGBD 3T51B 4OWXB 2EVBA 3KBXA 1EIHA 3K7AB 2K5WA 1J5EQ 4JG2A 4JI1Q 1CKOA 2E75C 2NVTH 3UE1A 3BVMA 1B44D 3KLWA 3KF6A 3D31A 3KF6B 4RKBA 2KJXA 4ZKCB 4C3JG 4L5SA 5IGEA 1PH7A 3J81L 2A6EC 2VUMB 3DM3A 2F0KA 4A3CH 3X3MA 3BYTB 1I5FA 5I6YA 2JA5H 1BQQT 1GUNA 3I4MG 4XTCS 1B1ZA 4DR6Q 2PZTA 3OW2A 1WTWA 3RLNA 4XYQA 3RLOA 1I4XA 3STBD 4LUVA 4A3GG 3G71A 1NR2A 4ME3A 2OWOA 4ZYSA 4K6LA 4ZAIA 3J7AF 2N55A 3A7LA 3CCSA 3NXWA 5M3MB 1YITA 1A63A 3NP8A 1YNXA 1B3QA 1SFOB 1FVIA 4CDEC 1L1OC 4YWKA 4G7HC 1OTCA 2ZJQA 2NVXB 1TU2B 3NSWA 1I4PA 1E1OA 3H0GG 4LF8Q 1QE6A 2A6ED 3CKIB 4JC0A 4QL5A 4C3JH 3BS1A 1NSNS 2JA7G 3L3OC 3PIP3 1ILQA 5NUCA 3DMUA 1NE3A 1SRUA 1SNCA 1F9QA 2R92G 3V96A 3N6RA 4PNYA 3M7GA 1YHQA 4DR1Q 3GDEA 4R4TA 3I4MH 2AQ1B 3PUVA 3TSSA 5GAEC 3HZXA 3GV3A 1B2TA 1Y1WG 1VQIA 1D2BA 1G2SA 4WFN3 4A3GH 4A93G 3VYUA 1N32L 3VR4A 1S5BD 1SE8A 4GKKL 4P2CB 2I07B 4H02A 2F0LA 2JA8G 1VMPA 1HQMC 1A2UA 2F0HA 3QB3A 1VQGA 1BCPC 1AW7A 5C44B 2E2DC 1Q3LA 3A5ZB 1SMYC 2JA7H 2PZUA 4DV1Q 2D0PA 1CKNB 4L6TB 2NVQB 1NUCA 2R92H 3I2ZA 1B50A 2BDOA 1IBML 3F1ZA 1KLUD 4DR4Q 5IT9L 4RA8A 2WKCA 3UDGA 4FXDA 1A3UA 2VUMG 2F0MA 1KNEA 1Y1WH 2E5LL 5CR3A 3I4NB 4A93H 1IXRA 4BBRB 5D3DA 2BE5C 2N78A 4IURA 1BBXC 3M9BA 2L1BA 1V8QA 1HR0W 1NNXA 1ET9A 1VQBA 2JA8H 1WJJA 1W6JA 1S5CD 3TP5A 1S72A 1LTID 1S3OA 1Y8PB 5C0XJ 3S15H 1SMYD 2PQEA 5M3MG 4A3MB 2X6GA 2OF1A 4LF5Q 2N49A 3ERSX 4YIJA 3NWTA 3UI2A 1J6QA 4OIJA 1I94L 1HJPA 3I72A 1PRTC 2MNAA 2NZHA 2I5LX 4DV2L 1BF4A 3S2DB 2KHSA 2QDLA 4DUZL 4DV4L 3MHBA 1NJIC 1MD2D 3W3AA 2G9HD 2VUMH 2VQEQ 1BBWA 1HTPA 1XPRA 4IUUA 1GUGA 2BA1A 1TVXA 4RGTA 3VR3A 1F2MA 1STEA 3WOFA 3PIPA 2NN6G 4JBJA 4IPCA 1KDCA 2EYJA 4CKEA 1BO0A 4POFA 2VXWA 3S1NH 1M90C 4GZYC 1WD1A 2Q8TA 3NTIA 2VB2X 3BYYB 4V0BA 4I7AA 2L9HA 4R9WA 5ELDA 5M3MH 3PSIA 2Z1CA 3I70A 3P20A 1SFOH 3H3VI 3K5MA 2OCEA 3CCQA 1Z9FA 2ZXPA 1AE2A 1PRTD 1ASYA 1SMXA 3GTOB 1ASZA 5GAGC 3BDOA 4UAIA 5C44G 2KOLA 1LO5D 1HCZA 2I46A 5J39A 1EQTA 2MFIA 4GN4B 4DXGA 3HFZB 3HOXB 1PFNA 2UUCL 3MA2B 3VYTA 3C3LA 3CCVA 4KY5A 1QVGA 3GO5A 1G91A 3D0FA 2Q2IA 1CTMA 1SBBB 5C3EB 2NN6H 5FO7B 1HZBA 2G9DA 4DF7A 1ET6A 4UP7A 5E3FA 3KF8A 3I4NG 4HCSA 4BBRG 1QJOA 1EEFD 2IJ0A 2G5DA 3QO2A 3TMEA 1SE3A 3OSOA 2MP1A 1C48A 3J7YW 2UUBQ 1M8AA 1HNXQ 1F2ZA 4LF7L 1C7YA 1JJ2A 4EGVA 1ZEQX 3GTMB 5C44H 3Q8DA 4JOIC 2AMCB 3KJPA 1CT1D 1GVPA 3CRLC 4QMGA 1VQNA 2Y0SE 3ICEA 4CJ2C 4ZK9B 4JW0A 1J8IA 4A75A 1DYQA 1I6HB 2NVQH 2LFNA 2MO1A 1CA5A 4BY1G 2ICIA 2F0OA 3S2HB 2IY5B 3SHLA 1U4RA 4A3IH 2E2HB 1NMFA 4KD3A 2ID0A 3OWEB 3I4NH 3MXUA 4BBRH 1ILPA 1VQ8A 4BA2I 4DV7Q 3R8BA 2XWJB 4DV5Q 3CXCA 1J5EL 3KJOA 5M5WB 3ULLA 4JI1L 1TS5A 4UHVA 5IGCA 1SLJA 2E8GA 1C8CA 3I73A 1KLGD 3FEWX 1M1KC 3DEOA 1QZGA 3JAMi 1W6KA 2A69D 5I9PA 4KKUA 1UE7A 3T13A 4BY1H 4RHRA 3J80c 4F7XA 3S2DH 4A3LG 2FJ2A 2HIXA 3HOXG 1DONA 4DR6L 2ZJPA 4MHEA 2UXCQ 2F0EA 2J0TD 3BZDB 3NENA 4PMCA 3IL8A 2XRSD 1IBKQ 4X6AH 4KHZA 3EROA 3TRZA 3U9OA 1FNWA 1CUKA 2A6HD 1X54A 1B4OA 3OIPA 2XWBB 3C1EA 4JI6Q 2K5DA 3M3YB 3CRKC 5IGGA 1PHJA 1HA5A 1F2YA 1YVCA 1WVLA 3K59A 4LF8L 1LTAD 4DR7Q 4YCWA 4I7ZC 4KV6A 1CK1A 2K52A 1KDBA 1DZ1A 2CQOA 4GNXB 1IYVA 2WAQB 1PVOA 4A3LH 4YCVA 3D4DA 5C4ZA 4DR1L 3HOXH 1LTGD 5C3WA 2PW5A 3HOUG 3LX0A 4WORA 1N36Q 2MO0A 3MTSA 5E7NA 2SEBD 3I4LA 3GD7A 1EIFA 1XWEA 3SE0A 2UUAQ 2NTTA 4C1NK 4UPAA 3GTJH 5EQ0A 3IFDA 2AUKA 1S5FD 3SR1A 1XPUA 3D6CA 3FVQA 4EQOA 3K7UC 4C56C 1S5DD 1ICFB 1R4PB 1PH4A 4GLXA 3HOYH 2A19A 4DV1L 1JWUD 1HTLD 2K7VA 1T5EA 3GTMH 3NBHB 3E9HA 3K0YA 1SYCA 4DAYB 1LV9A 4X62Q 2B2TC 3EJIA 4B3MQ 5CV4A 2YU9B 1SEBD 4WJ4A 1XNRQ 4U68A 1YZ6A 3DUZA 4DR4L 4K0KQ 2L5TA 3HOUH 2K03A 3S1RB 4HSVA 5C4JB 1D5ZC 2AQ3B 4FF4A 4HJ7A 1U5KA 4NP5A 3S14H 5KRUA 2O2LD 3B6YA 1PTOF 1D1IA 1EYAA 1C4QA 3M7NA 4GLAC 3SK5A 5CV9A 1PZID 4CDFC 4NKLA 5IYDG 4ILWA 5FLXE 1MSHA 1Q1BA 3PO2G 4GN5A 1KRTA 2A74C 5JPNC 2EYFA 1Q7YC 1QNUA 4LF5L 3DWPA 1SR3A 1VDZA 1RODA 3KFUA 5M5WH 5K5PA 3HOWB 3K0XA 1SNDA 2RA4A 1ONLA 2EYOA 2H4OA 4OEMB 1GUOA 1II3A 5JEAJ 1CA6A 2CW0C 1VQ5A 5JOBA 4OX9Q 3A55A 1SJED 1JJCB 1HH2P 1VF7A 2VQEL 2WAQG 4FVMA 4JPBW 2QEXA 1E2VA 2XIWA 1RKNA 1L2FA 2WINB 5A2QL 1PZJD 1V1PA 3EN2A 3NTKA 1V1PB 1E22A 2Q8IB 5KYIA 3Q23A 2F0SA 2YTXA 5IYDH 3J80L 1EY8A 5E4WC 3PO2H 2OT2A 2Z4IA 5C0XG 4RG1A 1UAPA 1VS0A 1AFPA 1KRSA 2R61A 2L11A 3FP9A 4JI4Q 3M3YH 4O42A 5C4HA 3S17B 5FKAC 2RVLA 4A3JG 1JQYD 2K5QA 4IN3A 1HNZQ 2RDHA 1TWCB 4DXFA 3PF4A 3SK8A 5ELCA 5J1ZA 1EU4A 1I4GA 4OIKA 4DK3C 3T1HQ 3R2TA 1GOZA 5JAVA 3K5NA 1EY9A 4V190 3OWFA 5FJ8G 4X3KA 3U4VA 5JJIA 3DWQA 4DK0A 4JI0Q 1B70B 4CDDC 1O7ZA 3AFQA 4P73A 4A76A 1CM9A 4CGYB 2PMZE 5C0XH 2A68C 2VW9A 5D14A 4GOPA 2KUMA 4GOPB 4A3BB 5G3LD 4G57A 5JJLA 2E76C 3HKZB 5LMNW 1IBLQ 2UUBL 1FR3A 4IUPA 1HNXL 4ZQ3A 2K01A 4A3JH 4X65Q 5IP7G 2B2UC 5KNCA 2MJ8A 3EQLC 3MEHA 1XXGA 1UEAB 4DUYQ 1IYUA 1Y1VB 2EY1A 5M5XB 1STBA 3CCRA 3HOWG 2K75A 5FJ8H 1FNUA 4H7BA 5IYCG 2YU9H 1A3TA 5LHY1 2YTVA 2E2IB 1TWGB 4OO1G
chains in the Genus database with same CATH topology
5CC4A 4DAVA 4EQPA 3DHQA 2X6LA 1S4ZA 2A68D 1A2TA 3R93A 1EWHA 1QB5D 2QEJC 3GTLB 1JOKA 1SSOA 3RD4A 4XDXA 2J4XA 3M4OB 2F03A 3NBIA 3KLRA 1HUMA 1WTXA 3E0JA 4C2MB 3PIO3 1EL0A 2F4IA 3GTQB 1PXUA 3LWUA 2RDGA 2AWNA 2JEBI 2XVSA 2KQ3A 3OHXC 4KHVA 3D4WA 5J22A 4OO1H 4N9TA 4FF1A 1LT5D 2QCPX 4X3UA 5DNFA 2EPBA 2IX0A 2QDBA 2XRQD 2WKDA 2KCCA 1LT3D 1H9MA 3IAYA 2F0QA 3ONAB 4IUVA 3GQBA 3VYSA 2L4NA 4FF2A 2KECA 1Z6HA 3TZDA 1BOSA 2EYMA 4FP5D 3GTGB 2R6GA 4DNRB 3O13A 1HQRD 2LS01 2AWOA 4XQJA 3TP8A 3HEJA 5FO9B 1JC7A 2WIIB 4XT1B 3M4YA 2IX3A 3W2DA 2WACA 2SOBA 2JA6B 4XIGS 3I3CA 3OOCA 4OGQC 5EJWA 1PFBA 5M5YB 1F2LA 5JVH3 2B2YC 1HRJA 3PO3B 4M1UB 1PTOB 2RQXA 5JVG3 4G4KA 1WTRA 4ZUIA 1AP0A 3A7AB 4QUCA 1YNNC 2DNCA 1GHKA 1RDPD 1JB3A 1H9RA 5CV5A 1ZXTA 4C3IB 1EYCA 1TT2A 1D5XC 4BBSB 4B08A 4K8JA 4XT3B 2LKVA 3HP3A 4L63B 4F88A 3HOVB 1MGSA 3S9WA 1YNJC 1LT6D 2F0PA 1TS3A 5LL6X 3E6ZX 4K2LA 3R2IA 3EVQA 1IW7C 4DK1A 4HEDA 1CI3M 4HTHA 2IWHA 4B9WA 1BCPD 4XXEA 3DEPA 3TZUA 3EFXD 2DN8A 2F0WA 4J6HA 1D6EC 4NMZA 3K5LA 2EJGC 5M3FB 2MPMA 2EYHA 4Z9CB 2IW3A 1DD2A 2R93B 5I2XA 1VCIA 1R9TB 2BE5D 1I3QB 3R3OA 3G7LA 5JEAG 4CJ1B 1BR9A 1EY7A 5M9OA 3MWYW 5C4XB 2ZT9C 3PV0A 4KJNA 3IFTA 3C1FA 1CHPD 5EBDA 2K32A 2IX1A 3RUZA 2X69A 4K6DA 3PUXA 4C3IG 4NDXA 1SNQA 2JSOA 4A3FB 2KCNA 3GTKB 1STHA 5I4DA 1WTQA 1ENCA 1STAA 1WCMB 5JEAH 1PFMA 1EWCA 3U9SA 5FOBB 1PTOH 5A35A 1EY0A 3MFGA 3GV6A 2B2VC 5HURA 2MHVA 2C9OA 1I50B 4CKBA 2A73B 4KN7C 4F87A 1O80A 2NN6I 1PRTF 1NR4A 1RD9D 1QILA 3H09A 2WB1B 1E2WA 1B9MA 5CYUA 4JBWA 1O7YA 1XTCD 2EE1A 2EY2A 2EJMA 1KNAA 3JAME 3A8IE 1DM0B 3BG3A 5KYLA 3MFYA 1DXMA 3AMUA 3VYRA 4MIUA 4FXGC 1KDAA 3FKIB 1GXDC 4KD4A 4LAAA 1CQFA 2DNEA 1DOMA 1LLRD 4RCOA 5IOCA 4RKLA 5KGUA 4KMUC 3T56B 1AEXA 3C2PA 2WP8J 3CQZB 1EU3A 4C3HB 1NCVA 3NHHA 1RTOA 4TRDA 5C6AA 2F3WA 5CV7A 2PPBC 3K6OA 4L8JA 2EDGA 5E4XA 2L12A 2D9UA 1TS4A 4HSPA 4FNFA 4PMBA 4IFDG 2B2WA 2OXPA 1HFNA 1U4MA 2Z8LA 1LTSD 2KEDA 4DGZA 3CHBD 1XYIA 4S3SA 2BOSA 2M2LA 1G6ZA 4WRDA 2RKSA 5CBAE 1DCZA 1GJXA 4OL7A 1HUNA 2JYOA 1PLFA 4PV1C 5IGBA 4WJWA 4IFDH 1IHZA 1LACA 3V05A 1TIID 2A5HA 4RCNA 4NW2A 1QG7A 2H1EA 1EIGA 1X3PA 1JOOA 1K83B 4IALA 2CQAA 3ITPA 2PNRC 3VR6A 3MXPA 5KEEA 3I91A 3X3NA 2B8GA 1SYGA 1AZQA 1DOKA 4N9PA 4KKTA 4C3HG 1TR5A 5IIFA 4QB4A 4A3EB 1K8OA 1JE4A 4A3DB 3TP7A 1A15A 1LTTD 1Z7TA 4HR7B 3MC0B 2D5DA 1XX8A 3SEBA 1A3VA 4A3KB 4K2KA 2FMMA 2NTSA 1HHVA 5DAUA 3GTPB 3LWEA 3HOZB 4ME5A 4UDUC 2N88A 2F3VA 1SYEA 4EQNA 2XN9C 5EPKA 1EY4A 3WOEA 4LK1C 2SNSA 1HXYD 2GA4B 1TY0A 5DM63 2EY5A 2F0TA 4QUFA 2HDLA 1Y69U 3T16A 2EOTA 4C1NI 3NUCA 3OMGA 1U9RA 2CW0D 3C46A 4O1NA 3PUZA 1Y8NB 3TP6A 1B53A 1FNVA 3AB9A 2PW7A 3QWNA 4XQNA 3NQTA 1X32A 4AYBB 1E0BA 4RGMA 1TWAB 1PRTB 1RJTA 4R8IA 1F9PA 4J8QA 3K57A 1FYCA 3HG9A 1JWSD 3OMCA 4MN3A 4BA1I 2B8FA 2L55A 3MZ5A 3SVMA 2QF7A 1GUTA 2PMZB 3E5SA 1KTKA 2PYKA 5C0XI 3P7JA 3NPPA 1RTNA 4ZRZA 2E2JB 3T4AC 5E1FA 3I4MB 5BN3A 5IGFA 4LMQD 3NQIA 2ZXOA 1EFID 4A3GB 3RLFA 1QOHA 1LTBD 4HMIA 2K1BA 1K8MA 4TSSA 5G3LF 2O5IC 2B63B 2FINB 1I4QA 4IUTA 4J1MA 3S1MB 2DY8A 2B2VA 1T5XD 4XYOA 1EYDA 3QOLA 4KY6A 3Q24A 4FXKC 1PDQA 4IFDJ 4QIWB 2F0GA 1U4LA 4ZUJA 2V4DA 3SK6A 2D2CC 5JPMC 2FMCA 1G291 5IGDA 2TMPA 4Q5VA 3ZYYX 4DN4M 2KVMA 1SYDA 3LNNA 1QNKA 1OXSC 3KK7A 4DU9A 5EPJA 4OO1I 1WD0A 3S15B 4FYDA 1OXVA 1GUWA 3KLSX 1H9JA 4RGOS 3NTHA 3FMCA 2D62A 1SJHD 1I4HA 3RZOB 1SNMA 3F2UA 2F0IA 1SNOA 3D4RA 4BS9A 1JICA 5F2DA 1H9SA 1H9SB 2MGSA 2JEAI 4FO2A 3S1NB 5TSSA 5EGTA 5T1IA 5EBCA 3H6MA 4CBVA 3BVGA 1DJRD 2CHBD 4FF3A 1ICWA 1G2TA 1JWMD 2SNMA 3ERQA 3J81E 4PQXA 5C5LA 5I6WA 4KK7A 2F1MA 2F0UA 3HS0C 3A56A 2EZVA 4K14A 5T1GA 1X3QA 3L9AX 1SXTA 3FDTA 1V43A 2ZXRA 4KTAA 1JOQA 1J9OA 3G6JB 1GHJA 2RBMA 4R8NA 5CGKA 1WTPA 2K6AA 4CKCA 4RH6A 4K5WA 5C5MA 5KNDA 2DY7A 1CFMA 4H44C 5D65A 2VNUD 4KN4C 1YNND 1Q8IA 1PMRA 1CHQD 1AZPA 4HMJA 5I9OA 3VA7A 1O7LA 4ABNA 4A3IB 2KA7A 1SE2A 1EQVA 4X3TA 2HCCA 1M4VA 1E2ZA 2ICEC 2K33A 3MVVA 4X3SA 2B2TA 1YNJD 3SDZA 2M00A 1L0YB 2O5JC 3QIAA 2E74C 2J7ZA 1I4RA 4OHJA 1IW7D 1EZ8A 2YYZA 4U673 4G7ZC 1I6VC 5CMDA 5ELBA 5JJZA 3DWAA 5IT9E 1H9KA 1F9RA 4Y7NB 4BY1B 5KNBA 3K5OA 2HUGA 2FFKB 1RCVD 1TY2A 3OIQA 4IQZA 1BCPF 4IZ8A 4KI0A 2QILA 5CBEE 1JORA 1CZGA 2NWGA 5KIXA 4QF4A 4F8MA 1CZWA 2M9VA 1HPCA 2MUYA 4ZKBB 4DAPA 1EEID 2NYZD 1OXTA 2IPKD 4M8AA 2CVRA 3ND8A 3HRZC 1TWFB 2ENBA 1ENAA 3D6WA 2SDFA 4KJOA 5FK9C 1VMCA 3MAQA 1B3AA 1HFGA 3JAML 3N52A 3K58A 5K36G 3NK9A 1STYA 4DNTB 2BA0A 1KABA 5BN4A 2OEOA 2XNAC 2JP1A 3I90A 3GTJB 3CU7A 3H94A 1SYFA 2F0JA 4K5XA 2NVYB 3MXGA 3TDQA 1QCBD 3NE5B 4TKOB 4HAEA 3TBIB 3HOYB 3FPUB 1TQOA 4K8IA 2LMCB 3A54A 2Y0SB 4I65A 2BCOA 1UUPA 3HOUB 5K36H 2XSCA 2B2UA 3BVZA 4CHTB 2A69C 5LL6S 3S14B 3P1HA 4KKSA 1ML0D 2NB0A 1EZ6A 5D3IB 4DFAA 5ELFA 1G8ZD 1OXXK 3Q22A 4HN7A 3I8ZA 1NAPA 1S5ED 2WV6D 1WTVA 2A6HC 3H3VC 1MBYA 5CV6A 2PO4A 3Q6SA 2F0FA 4IUNA 2FHTA 2EXZA 3QOJA 2IT1A 2NZ1D 1STNA 3S1QB 2HCIA 2RSOA 3WDNA 4ZLTF 1GUSA 1BXTA 3PO2B 2EYLA 1PTOC 1PZKD 4HCEA 3BDLA 3D8GA 5EPLA 1KAAA 1SAPA 3OPOA 2KEEA 1Y8OB 4XQQA 1JCKB 5C3XA 4H13C 1SYBA 3PMFA 2K05A 1FD7D 2F0DA 4JK1C 3KLSA 1PTOD 4E6IA 1Z47A 5FLXL 1UNSA 4IFDI 1OO9B 3EA6A 1LT4D 4IUQA 2R7ZB 5EKIA 5I2YA 1Q1EA 3NWSA 4RHSA 4H0LC 4A3JB 2VB3X 1DOLA 1WTOA 3RMHA 3VA5A 1EY5A 1LTRD 3PUYA 3MXNA 3GP7A 3A8JE 4TQUS 2LY7A 3NBHA 4DAYA 3DXJC 5DM73 2BDNA 1BUVT 1STGA 1VF5C 4KY7A 3OW7A 1U4PA 2B2YA 5COYA 1BDOA 3KUPA 1ZYRC 5BN5A 1TWHB 1IKMA 5ISRA 2NBFA 2PCFB 4QCLA 3FPPA 4RAUC 3S16B 5CORA 2O4XA 1D5MC 2TSSA 3T53B 5FO8B 4RGNA 1BCPB 2C5CA 3RZDB 1ESFA 4PMWA 2L0CA 3PUWA 4ID6A 2F0NA 3AU7A 1SE4A 1ZYRD 3IKJA 3SXHA 3P75A 5ELEA 3KBGA 2QKIC 3D3RA 5EKKA 4G7OC 4RWSC 3VR5A 4DA2A 2NVTB 3L7ZC 2K28A 1TKWB 3M85A 3VR2A 1MI2A 4BY7B 2NUCA 5CV8A 4LJZC 1CQVA 1RHPA 5HGTA 4B9XA 1MSGA 4CJ0B 2JA5B 4EVOA 1LABA 2JXMB 1R4QB 4K5VA 4ULLA 2EJFC 1BNZA 2EY6A 2HQEA 2JE6I 5A2QE 1HA6A 2RDFA 3J80E 2IL8A 1D1KA 1EOTA 1IL8A 1JR0D 3HGBA 4C3JB 3V2TA 5EKLA 1AN8A 2AQ2B 2RSNA 2HDMA 2PZWA 2Z4HA 4BWGB 1QWYA 3ND9A 3H91A 1Q90A 1O78A 2K04A 1ZKOA 3Q0AA 1ESRA 4RFBA 3QJYA 1A6XA 1TS2A 5IODA 1RF2D 1F77A 1SNPA 3A8KE 5DEHA 1PYWD 1SDFA 1V1OA 3SK4A 3H0GB 5AFWA 3TN2A 4Q0FA 2JA7B 2R3ZA 1ENFA 2Q8RE 1IKLA 2F0VA 1OXUA 1F9SA 2B2WC 2AUJD 2R92B 1EY6A 2EYPA 3BDCA 3URYA 1Y1WB 3QG1A 4A93B 3FRPB 2JA8B 1L0XB 4ODGA 1B9NA 1Q12A 3J7AV 2B39A 3DM1A 1FGBD 3T51B 2EVBA 3KBXA 1EIHA 3K7AB 2K5WA 2E75C 3BVMA 1B44D 3D31A 4RKBA 2KJXA 4ZKCB 4C3JG 5IGEA 3J81L 2A6EC 2VUMB 2F0KA 3X3MA 3BYTB 5I6YA 1BQQT 1GUNA 4XTCS 1B1ZA 2PZTA 1WTWA 4XYQA 1I4XA 1NR2A 4ZYSA 4K6LA 4ZAIA 3J7AF 2N55A 3A7LA 3NXWA 5M3MB 3NP8A 1SFOB 4G7HC 2NVXB 1TU2B 3NSWA 1I4PA 1QE6A 2A6ED 3CKIB 3BS1A 1NSNS 3L3OC 3PIP3 1ILQA 5NUCA 3DMUA 1SNCA 1F9QA 3V96A 3N6RA 4PNYA 3M7GA 2AQ1B 3PUVA 3TSSA 3HZXA 3GV3A 1B2TA 1D2BA 1G2SA 4WFN3 3VYUA 3VR4A 1S5BD 4P2CB 2I07B 2F0LA 1VMPA 1HQMC 1A2UA 2F0HA 3QB3A 1BCPC 1AW7A 5C44B 2E2DC 1Q3LA 1SMYC 2PZUA 4L6TB 2NVQB 1NUCA 1B50A 2BDOA 1KLUD 5IT9L 4RA8A 2WKCA 4FXDA 1A3UA 2F0MA 1KNEA 5CR3A 3I4NB 4BBRB 5D3DA 2BE5C 4IURA 1BBXC 2L1BA 1V8QA 1ET9A 1W6JA 1S5CD 3TP5A 1LTID 1Y8PB 5C0XJ 1SMYD 2PQEA 4A3MB 2X6GA 2OF1A 4YIJA 3NWTA 3UI2A 4OIJA 3I72A 1PRTC 1BF4A 3S2DB 2KHSA 3MHBA 1MD2D 3W3AA 2G9HD 1HTPA 4IUUA 1GUGA 2BA1A 1TVXA 4RGTA 3VR3A 1F2MA 1STEA 3WOFA 2NN6G 1KDCA 2EYJA 4CKEA 1BO0A 2VXWA 4GZYC 1WD1A 2Q8TA 3NTIA 2VB2X 3BYYB 4V0BA 2L9HA 4R9WA 5ELDA 2Z1CA 3I70A 3P20A 3K5MA 2ZXPA 1PRTD 3GTOB 3BDOA 4UAIA 2KOLA 1LO5D 1HCZA 2I46A 5J39A 1EQTA 4DXGA 3HOXB 1PFNA 3MA2B 3VYTA 3C3LA 4KY5A 3GO5A 1G91A 1CTMA 1SBBB 5C3EB 2NN6H 5FO7B 2G9DA 4DF7A 1ET6A 5E3FA 3KF8A 4HCSA 1QJOA 1EEFD 2IJ0A 3QO2A 3TMEA 1SE3A 3OSOA 2MP1A 1C48A 3J7YW 1M8AA 1F2ZA 4EGVA 1ZEQX 3GTMB 1CT1D 3CRLC 4QMGA 4CJ2C 4ZK9B 1J8IA 1DYQA 1I6HB 2LFNA 1CA5A 3S2HB 2ICIA 2F0OA 3SHLA 1U4RA 2E2HB 4KD3A 2ID0A 3OWEB 3MXUA 1ILPA 4BA2I 3R8BA 2XWJB 5M5WB 1TS5A 5IGCA 1C8CA 3I73A 1KLGD 3FEWX 3DEOA 1W6KA 2A69D 5I9PA 4KKUA 3T13A 4RHRA 4F7XA 2FJ2A 1DONA 4MHEA 2F0EA 2J0TD 3BZDB 4PMCA 3IL8A 2XRSD 4KHZA 3EROA 3U9OA 1FNWA 2A6HD 3OIPA 1B4OA 2XWBB 3C1EA 2K5DA 3M3YB 3CRKC 5IGGA 1HA5A 1F2YA 1WVLA 3K59A 1LTAD 4I7ZC 4KV6A 1CK1A 1KDBA 1DZ1A 1IYVA 2WAQB 3D4DA 5C4ZA 1LTGD 5C3WA 2PW5A 3LX0A 4WORA 3MTSA 2SEBD 3I4LA 3GD7A 1XWEA 3SE0A 2NTTA 4C1NK 5EQ0A 3IFDA 2AUKA 1S5FD 3SR1A 3D6CA 3FVQA 4EQOA 4C56C 1S5DD 1R4PB 1JWUD 1HTLD 2K7VA 1T5EA 3K0YA 1SYCA 1LV9A 2B2TC 3EJIA 2YU9B 5CV4A 1SEBD 4U68A 3DUZA 2L5TA 2K03A 3S1RB 4HSVA 5C4JB 1D5ZC 2AQ3B 4FF4A 4NP5A 5KRUA 2O2LD 1PTOF 1D1IA 1EYAA 1C4QA 3M7NA 3SK5A 5CV9A 1PZID 4NKLA 4ILWA 5FLXE 1MSHA 1Q1BA 5JPNC 2A74C 2EYFA 1QNUA 3DWPA 1VDZA 1RODA 5K5PA 3HOWB 1SNDA 2RA4A 1ONLA 2EYOA 2H4OA 1GUOA 1II3A 5JEAJ 1CA6A 2CW0C 5JOBA 3A55A 1SJED 1VF7A 4FVMA 1E2VA 2XIWA 1RKNA 2WINB 5A2QL 1PZJD 1V1PA 3NTKA 1V1PB 2Q8IB 5KYIA 3Q23A 2F0SA 3J80L 1EY8A 5E4WC 2OT2A 2Z4IA 5C0XG 1UAPA 1AFPA 2R61A 2L11A 4O42A 5C4HA 3S17B 5FKAC 2RVLA 1JQYD 2K5QA 4IN3A 2RDHA 1TWCB 4DXFA 3SK8A 5ELCA 5J1ZA 1EU4A 1I4GA 4OIKA 3R2TA 1GOZA 5JAVA 3K5NA 1EY9A 4V190 3OWFA 4X3KA 3DWQA 4DK0A 1O7ZA 1CM9A 4CGYB 5C0XH 2A68C 5D14A 2KUMA 4A3BB 5G3LD 4G57A 2E76C 3HKZB 1FR3A 4IUPA 4ZQ3A 2K01A 2B2UC 5KNCA 2MJ8A 3EQLC 3MEHA 1XXGA 1UEAB 1IYUA 1Y1VB 2EY1A 5M5XB 1STBA 1FNUA 4H7BA 1A3TA 5LHY1 2E2IB 1TWGB 4OO1G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PIP 3;  5DM7 3;  5DM6 3;  4WFN 3;  5JVG 3;  5JVH 3;  4U67 3;  3PIO 3; 
#chains in the Genus database with same CATH topology
 5CC4 A;  4DAV A;  4EQP A;  3DHQ A;  2X6L A;  1S4Z A;  3S1R H;  2A68 D;  1Q86 C;  2AKW B;  1A2T A;  3R93 A;  1EWH A;  1QB5 D;  2QEJ C;  3GTL B;  1JOK A;  1VQE A;  1SSO A;  2A1A A;  3RD4 A;  4DV7 L;  4XDX A;  4PZ7 A;  3HKS A;  1UE6 A;  1G51 A;  4DV5 L;  3ULP A;  2J4X A;  3M4O B;  2F03 A;  1NMG A;  3NBI A;  3S16 H;  3KLR A;  5IP7 H;  1HUM A;  3QR8 A;  4QIW E;  4BY7 G;  1WTX A;  3E0J A;  4C2M B;  3PIO 3;  1EL0 A;  2F4I A;  3GTQ B;  1EQR A;  1PXU A;  3LWU A;  2RDG A;  2Q2U A;  4DV3 Q;  3HOW H;  1EUJ A;  2AWN A;  4B3R Q;  3K81 C;  2B29 A;  1XMQ Q;  1X3F A;  2JEB I;  2XVS A;  2KQ3 A;  3OHX C;  4KHV A;  3D4W A;  5J22 A;  4OO1 H;  4N9T A;  4FF1 A;  1LT5 D;  2QCP X;  4X3U A;  1PA6 A;  5DNF A;  2UXC L;  2EPB A;  3U50 C;  2IX0 A;  1YHB A;  2QDB A;  2XRQ D;  2WKD A;  1IBK L;  1N34 Q;  2KCC A;  1LT3 D;  2CH4 W;  1H9M A;  3IAY A;  2CCZ A;  2F0Q A;  2VQF L;  3IRB A;  4AQY Q;  3ONA B;  4IUV A;  4JI6 L;  3GQB A;  3VYS A;  4BY7 H;  4A3B G;  4GNX C;  3J7A 5;  1VQA A;  2L4N A;  1Q81 C;  4FF2 A;  3AYH B;  1PYS B;  4DR7 L;  3S17 H;  2KEC A;  1Z6H A;  3TZD A;  1BOS A;  2EYM A;  4FP5 D;  3GTG B;  2R6G A;  4DNR B;  2KCM A;  3O13 A;  1HQR D;  2LS0 1;  3U58 A;  4OWW B;  2AWO A;  4XQJ A;  4IO9 A;  1E24 A;  3TP8 A;  1Y1V G;  3HEJ A;  5FO9 B;  3I7F A;  2V1C C;  1P8L A;  1P16 A;  4YWM A;  4NPS A;  1N36 L;  3PGZ A;  1JC7 A;  2WII B;  4XT1 B;  1WTH A;  3M4Y A;  2IX3 A;  4LF6 Q;  3W2D A;  2UUA L;  2WAC A;  2SOB A;  1VQD A;  2JA6 B;  4XIG S;  3I3C A;  3OOC A;  3DLL A;  1E1T A;  4OGQ C;  4A3B H;  5EJW A;  1PFB A;  4YCU A;  2IHF A;  3RN5 A;  3CAM A;  3BZC A;  5M5Y B;  1WFQ A;  1F2L A;  2Z6K C;  1UE5 A;  5JVH 3;  3EBE A;  2B2Y C;  1HRJ A;  1JT8 A;  3CW2 C;  3PO3 B;  4M1U B;  1PTO B;  4MTK A;  4X62 L;  3F8T A;  4YY3 Q;  4B3M L;  1Y1V H;  2RQX A;  3UE0 A;  5JVG 3;  5M5X H;  4G4K A;  1YIJ A;  1XNR L;  1WTR A;  4ZUI A;  1AP0 A;  3A7A B;  3EIV A;  4K0K L;  4QUC A;  3PIO A;  1YNN C;  2DNC A;  2XGT A;  4OXP A;  1GHK A;  2E2I H;  1TWG H;  4X66 Q;  1RDP D;  1JB3 A;  2YV5 A;  1H9R A;  5CV5 A;  1ZXT A;  4C3I B;  1EYC A;  1TT2 A;  1D5X C;  1EWI A;  2GVB A;  3H0G H;  4B08 A;  4BBS B;  1Q8K A;  4K8J A;  3GTL H;  4XT3 B;  2LKV A;  5HY6 A;  3HP3 A;  4L63 B;  3SGI A;  4F88 A;  3J81 i;  3HOV B;  1KC8 C;  1MGS A;  3S9W A;  3M4O H;  1YNJ C;  4DR3 Q;  1LT6 D;  2F0P A;  1TS3 A;  4DAM A;  5LL6 X;  1LYL A;  3E6Z X;  4K2L A;  3BZK A;  3R2I A;  4C2M H;  3EVQ A;  1IW7 C;  4DK1 A;  4OX9 L;  4HED A;  1CI3 M;  4HTH A;  2IWH A;  4B9W A;  2DGY A;  1E3P A;  1BCP D;  1X65 A;  4XXE A;  1BBU A;  3DEP A;  3TZU A;  3EFX D;  2DN8 A;  4NXN Q;  2F0W A;  4J6H A;  1D7Q A;  1D6E C;  3K7A H;  4NMZ A;  1K8G A;  2HD3 A;  2EJG C;  3K5L A;  2JJQ A;  5M3F B;  1VQC A;  2JA6 G;  2MPM A;  4JI4 L;  2EYH A;  4Z9C B;  2IW3 A;  1DD2 A;  2R93 B;  3G4S A;  3ZJY C;  5I2X A;  1VCI A;  1HNZ L;  4AIM A;  1R9T B;  2BE5 D;  1I3Q B;  3R3O A;  1QZH A;  3G7L A;  2Z6B A;  5JEA G;  5ELN A;  2ATW A;  4CJ1 B;  1BR9 A;  1EY7 A;  2KBN A;  5M9O A;  3T1H L;  3MWY W;  4JYA Q;  5C4X B;  3GTG H;  2EXD A;  2ZT9 C;  2VY3 A;  5LMU Q;  3PV0 A;  3PO3 G;  1K0R A;  1GM5 A;  3I4O A;  4KJN A;  3IFT A;  3C1F A;  5IWA Q;  1CHP D;  4JI0 L;  5EBD A;  4GLV B;  1N9W A;  2K32 A;  2IX1 A;  3RUZ A;  2X69 A;  4K6D A;  3PUX A;  4B3T Q;  2NVX H;  3L2P A;  1CKM A;  4C3I G;  2RHS B;  4NDX A;  1SNQ A;  4B3S Q;  2JSO A;  4A3F B;  4BBS G;  1IBL L;  2JA6 H;  2KCN A;  3GTK B;  1STH A;  1SRO A;  4X65 L;  5I4D A;  1WTQ A;  1ENC A;  3HOV G;  2Q2H A;  1STA A;  1K73 C;  2IHE A;  1WCM B;  5M5Y H;  5JEA H;  1PFM A;  4DUY L;  1EWC A;  3U9S A;  2I5H A;  4DV6 Q;  1YJ9 A;  2ASB A;  4LNQ A;  5FOB B;  1PTO H;  5A35 A;  1EY0 A;  3MFG A;  3KF8 B;  3GV6 A;  2B2V C;  5HUR A;  2MHV A;  2C9O A;  1I50 B;  2NZO A;  1H95 A;  4UP9 A;  4CKB A;  4DR5 Q;  4LF9 Q;  4QJF A;  2A73 B;  4KN7 C;  4C3I H;  2K5N A;  4F87 A;  4A3M G;  1O80 A;  2F4V Q;  1HZ9 A;  2NN6 I;  1PRT F;  1NR4 A;  1RD9 D;  2OTJ A;  1QIL A;  3H09 A;  4HIO A;  3HOV H;  2JN4 A;  2WB1 B;  1E2W A;  3BJU A;  1B9M A;  3UDF A;  5CYU A;  2GVA A;  1PH2 A;  4JBW A;  1N33 Q;  3CPW A;  1O7Y A;  1XTC D;  2EE1 A;  4DV3 L;  1IL2 A;  1GKH A;  3F2C A;  2EY2 A;  4B3R L;  2EJM A;  1KNA A;  3JAM E;  1XMQ L;  1G6P A;  3A8I E;  3BG3 A;  1DM0 B;  1LTL A;  5KYL A;  1PH8 A;  3MFY A;  1DXM A;  1YHA A;  3AMU A;  3VYR A;  4MIU A;  5C4X G;  4JI8 Q;  4JI7 Q;  5IP9 G;  4FXG C;  1KDA A;  3FKI B;  1GXD C;  4KD4 A;  4LAA A;  1CQF A;  4DKA C;  3A74 A;  2DNE A;  4BXX G;  1N34 L;  1DOM A;  1LLR D;  4RCO A;  2UXD Q;  5IOC A;  4A3M H;  4RKL A;  4HIK A;  5KGU A;  4KMU C;  1AEX A;  1V1Q A;  3T56 B;  1VQJ A;  2WP8 J;  4AQY L;  3C2P A;  3CQZ B;  1UEB A;  2N8N A;  1EU3 A;  4C3H B;  1NCV A;  2N3S A;  3NHH A;  1RTO A;  4TRD A;  5C6A A;  2F3W A;  4A3F G;  5CV7 A;  2PPB C;  3K6O A;  3CCM A;  4R4Q A;  4DNI A;  4L8J A;  2EDG A;  5E4X A;  2ZTE A;  2L12 A;  1I3Q H;  2D9U A;  1MKH A;  4UY8 C;  1TS4 A;  4HSP A;  4FNF A;  4PMB A;  4IFD G;  5C3E G;  5C4X H;  4Y52 H;  2B2W A;  5IP9 H;  2OXP A;  4LUO A;  1HFN A;  4KLK A;  4BXX H;  1U4M A;  3CCE A;  2Z8L A;  1LTS D;  2KED A;  4DGZ A;  4LF6 L;  2D0O A;  3CHB D;  1XYI A;  4S3S A;  2BOS A;  1EIY B;  2UU9 Q;  2M2L A;  1K0S A;  1G6Z A;  2JK8 A;  4WRD A;  3GTO H;  2RKS A;  3CPF A;  5CBA E;  1DCZ A;  1GJX A;  1QVF A;  4OL7 A;  2WAQ E;  1U0L A;  3GTK H;  4AH6 A;  1HUN A;  3CCJ A;  2JYO A;  2ZM6 Q;  1PLF A;  1IYJ B;  2WB1 G;  3G6E A;  4A4I A;  4PV1 C;  3H15 A;  4YY3 L;  5IGB A;  4WJW A;  4IFD H;  1IHZ A;  2XTI A;  5C3E H;  1LAC A;  4QY7 A;  3V05 A;  1TII D;  2A5H A;  3JC6 6;  4RCN A;  3UDI A;  4NW2 A;  1QG7 A;  2H1E A;  2HIV A;  1BKB A;  1EIG A;  2BH2 A;  1PH5 A;  1X3P A;  4N8F A;  4X66 L;  1JOO A;  4GN3 B;  1A62 A;  4LWC A;  1I50 H;  1K83 B;  3FKI G;  4IAL A;  2CQA A;  4JI5 Q;  3ITP A;  3CF5 A;  2R7F A;  2PNR C;  2EQS A;  3VR6 A;  3MXP A;  5KEE A;  2RHQ B;  3I91 A;  3X3N A;  2B8G A;  1SYG A;  1AZQ A;  4DR3 L;  1DOK A;  2DJF C;  4N9P A;  1VQO A;  1MJE A;  4KKT A;  4C3H G;  1TR5 A;  1I6H H;  5IIF A;  4QB4 A;  4A3E B;  4WJ3 M;  1K8O A;  1L1O A;  1JE4 A;  3S2H H;  1X6O A;  4A3D B;  3TP7 A;  2E2H H;  1A15 A;  1LTT D;  1Z7T A;  4HR7 B;  1HNW Q;  3MC0 B;  2D5D A;  1XX8 A;  3SEB A;  2RCN A;  4HIM A;  1A3V A;  4A3K B;  4K2K A;  2FMM A;  2NTS A;  1HHV A;  3FKI H;  5DAU A;  4LFB Q;  4NXN L;  3GTP B;  4DR2 Q;  3LWE A;  3HOZ B;  4ME5 A;  4UDU C;  4JI3 Q;  4JI2 Q;  3CQZ H;  2N88 A;  4C3H H;  2F3V A;  1SYE A;  1A0I A;  4EQN A;  2XN9 C;  5IYB G;  5EPK A;  4EQ5 A;  1EY4 A;  1LUZ A;  3WOE A;  4LK1 C;  4ALP A;  3VDY A;  2SNS A;  1JMC A;  1Y14 B;  4JYA L;  2B3G A;  1HXY D;  2GA4 B;  5LMU L;  1TY0 A;  5DM6 3;  2RF4 A;  2EY5 A;  2F0T A;  4GS3 A;  1UE1 A;  4QUF A;  2HDL A;  5IWA L;  1YJW A;  1Y69 U;  3T16 A;  2EOT A;  4C1N I;  4X64 Q;  3NUC A;  3OMG A;  1KD1 C;  4B3T L;  3W1B A;  5FLM G;  1RL2 A;  1U9R A;  2CW0 D;  4B3S L;  3C46 A;  4UP8 A;  4O1N A;  3PUZ A;  1Y8N B;  4J15 A;  3TP6 A;  5IYB H;  1K9M C;  1B53 A;  1FNV A;  3TS2 A;  1XNQ Q;  3F2B A;  3AB9 A;  3OTO Q;  5J3B A;  2PW7 A;  3QWN A;  2C35 B;  4XQN A;  3NQT A;  4DV6 L;  4RMF A;  2ALY B;  1VQF A;  3U4Z A;  4N8X 1;  1UWV A;  1X32 A;  4AYB B;  1E0B A;  4RGM A;  4A3D G;  3K80 C;  1TWA B;  1PRT B;  1RJT A;  2WFW A;  4R8I A;  3HKZ E;  1F9P A;  4J8Q A;  2OQ0 A;  3K57 A;  1FYC A;  4DR5 L;  2HT1 A;  4LUZ A;  3HG9 A;  1K3B C;  4LF9 L;  1JWS D;  3OMC A;  1DGS A;  5FLM H;  4MN3 A;  1N8R C;  1K83 H;  2F4V L;  4BA1 I;  2B8F A;  2L55 A;  3MZ5 A;  3SVM A;  2QF7 A;  2CKZ B;  1GUT A;  2PMZ B;  3E5S A;  1KTK A;  4JV5 Q;  2KHI A;  2PYK A;  5C0X I;  3OYY A;  3P7J A;  3NPP A;  1NBW A;  3CCL A;  1RTN A;  3M4P A;  1N33 L;  4ZRZ A;  2E2J B;  5GAH C;  1YEZ A;  2PI2 E;  1S40 A;  3T4A C;  1C9O A;  5E1F A;  3I4M B;  5C4J H;  5BN3 A;  5IGF A;  2ZJR A;  1PH9 A;  4EX5 A;  3J80 i;  4LMQ D;  3NQI A;  4A3D H;  2K4K A;  2ZXO A;  1EFI D;  1PH3 A;  4A3G B;  4JI8 L;  4JI7 L;  3RLF A;  1QOH A;  1LTB D;  4OON A;  4HMI A;  1KL9 A;  3TEH B;  2K1B A;  1K8M A;  2Q2T A;  4TSS A;  5G3L F;  1Q82 C;  2O5I C;  1X9N A;  2UXD L;  2B63 B;  2FIN B;  1VQ9 A;  1I4Q A;  4IUT A;  4J1M A;  2CWA A;  1LM0 A;  3S1M B;  2H5X A;  2DY8 A;  1JB7 A;  4YHH Q;  1KXL A;  2B2V A;  2BH8 A;  5IYC H;  1T5X D;  4XYO A;  1EYD A;  3QOL A;  4KY6 A;  3FHW A;  3G48 A;  3Q24 A;  2YTY A;  4FXK C;  1PDQ A;  4IFD J;  1XPO A;  4QIW B;  2F0G A;  1U4L A;  4ZUJ A;  2V4D A;  3SK6 A;  2D2C C;  5JPM C;  4JOI A;  2FMC A;  1G29 1;  5IGD A;  2TMP A;  4Q5V A;  4AYB G;  3ZYY X;  4DN4 M;  2KVM A;  1SYD A;  4JBK A;  1XTD A;  3LNN A;  1QNK A;  1OXS C;  3KK7 A;  4DU9 A;  5EPJ A;  4OO1 I;  3STB C;  1WD0 A;  3HKZ G;  3S15 B;  4FYD A;  1OXV A;  2UU9 L;  1GUW A;  3KLS X;  1CSQ A;  1H9J A;  4RGO S;  1TWC H;  3NTH A;  3FMC A;  5LMN Q;  2D62 A;  2ZM6 L;  1SJH D;  1TXY A;  1I4H A;  3RZO B;  1SNM A;  3F2U A;  2F0I A;  1SNO A;  3D4R A;  4BS9 A;  1JIC A;  2JA9 A;  1H9S A;  5F2D A;  1H9S B;  1V9P A;  2MGS A;  2JEA I;  1K3R A;  4FO2 A;  3S1N B;  5TSS A;  1TWA H;  1FL0 A;  5EGT A;  5T1I A;  5EBC A;  3H6M A;  4CBV A;  3BVG A;  1DJR D;  1X55 A;  4JI5 L;  2CHB D;  4FF3 A;  1ICW A;  4FDB A;  1G2T A;  1JWM D;  3JAM c;  1VQ6 A;  2SNM A;  4JCV E;  2K50 A;  3ERQ A;  3J81 E;  4PQX A;  1KQS A;  2LXK A;  5C5L A;  5I6W A;  2B63 G;  4KK7 A;  2F1M A;  1X56 A;  2F0U A;  3HS0 C;  3A56 A;  2EZV A;  4K14 A;  5T1G A;  1X3Q A;  3L9A X;  1K8A C;  1SXT A;  3FDT A;  1V43 A;  2ZXR A;  4KTA A;  2E2J H;  1JOQ A;  1J9O A;  3G6J B;  1GHJ A;  1HNW L;  2KEN A;  2RBM A;  4R8N A;  5CGK A;  1X3E A;  3KOJ A;  1WTP A;  2K6A A;  4CKC A;  4RH6 A;  4K5W A;  4LFB L;  4DR2 L;  5C5M A;  5KND A;  2DY7 A;  1D8L A;  4APV A;  1CFM A;  4ZCK A;  4JI3 L;  1IZ6 A;  3CD6 A;  4JI2 L;  4H44 C;  3TQY A;  3PQI A;  2B63 H;  4KHP Q;  5D65 A;  3CMA A;  3GTQ H;  3CC7 A;  2VNU D;  4KN4 C;  1YNN D;  2FXQ A;  3S1M H;  1Q8I A;  1PMR A;  1CKN A;  1CHQ D;  3T1Y Q;  1AZP A;  4HMJ A;  5I9O A;  3CME A;  2UXB Q;  3VA7 A;  1O7L A;  4ABN A;  4NB3 A;  4A3I B;  2KA7 A;  1SE2 A;  1EQV A;  4X3T A;  4IJL A;  2HCC A;  1QUQ A;  1QUQ B;  1M4V A;  3S24 A;  1E2Z A;  2ICE C;  2K33 A;  3MVV A;  4X3S A;  2B2T A;  1YNJ D;  3SDZ A;  2M00 A;  1L0Y B;  2O5J C;  1JE5 A;  3QIA A;  2E74 C;  4X64 L;  2J7Z A;  4IOA A;  1I4R A;  4OHJ A;  1IW7 D;  1EZ8 A;  2QW7 A;  2YYZ A;  4GKJ Q;  4U67 3;  4G7Z C;  1VQ4 A;  1I6V C;  5CMD A;  5ELB A;  1YBY A;  5JJZ A;  3RNU A;  1XNQ L;  3DWA A;  5IT9 E;  3OTO L;  1H9K A;  1F9R A;  4JBM A;  4Y7N B;  2VL6 A;  3NEL A;  4QGU A;  4GOP C;  4BY1 B;  5KNB A;  3K5O A;  3K8A A;  4MZ9 A;  2HUG A;  2FFK B;  1RCV D;  3RZO H;  1TY2 A;  3OIQ A;  3H3V H;  4IQZ A;  1BCP F;  4IZ8 A;  1RIP A;  1E7Z A;  2LSS A;  4L5Q A;  4KI0 A;  2QIL A;  2ES2 A;  5CBE E;  3F2D A;  1JOR A;  1CZG A;  2NWG A;  4L5T A;  5KIX A;  4QF4 A;  4F8M A;  4HJA A;  1CZW A;  3ULJ A;  2M9V A;  1HPC A;  1VQ7 A;  2MUY A;  1C0A A;  2RCF A;  4ZKB B;  4DAP A;  4P75 A;  1EEI D;  2NYZ D;  1OXT A;  2IPK D;  1WYD A;  4M8A A;  5AJ3 Q;  3W1G A;  4PG3 A;  2CVR A;  3ND8 A;  3HRZ C;  1TWF B;  2ENB A;  4LFC Q;  4JV5 L;  3RR5 A;  1PH1 A;  1ENA A;  3D6W A;  1L0W A;  3PO3 H;  2SDF A;  2OQK A;  4KJO A;  5FK9 C;  3I56 A;  5FLX c;  1VMC A;  3MAQ A;  1B3A A;  1HFG A;  3ER0 A;  3JAM L;  2F3I A;  3N52 A;  3K58 A;  5K36 G;  3NK9 A;  1STY A;  4DNT B;  2BA0 A;  1KAB A;  5BN4 A;  4A3I G;  4O2D A;  4BBS H;  2OEO A;  2XNA C;  1HR0 Q;  1YJN A;  2JP1 A;  3I90 A;  1EFW A;  3L0O A;  3E3X A;  3GTJ B;  3CU7 A;  2P5Z X;  3H94 A;  5IY0 A;  1SYF A;  2F0J A;  2WB1 E;  1KIX A;  4K5X A;  3W5O A;  5M3F G;  1MJC A;  2NVY B;  1XMO Q;  3MXG A;  3TDQ A;  1QCB D;  4R4I A;  2R93 G;  4LFA Q;  1GD7 A;  3NE5 B;  4TKO B;  4HAE A;  3TBI B;  2HHH Q;  3HOY B;  3FPU B;  2DUD A;  4YHH L;  4HID A;  5HGQ A;  3J81 j;  1TQO A;  4K8I A;  2LMC B;  3A54 A;  2Y0S B;  4I65 A;  2BCO A;  4NXM Q;  1UUP A;  3HOU B;  5BR8 Q;  2XSC A;  5K36 H;  2B2U A;  3BVZ A;  4CHT B;  2A69 C;  5LL6 S;  1CSP A;  4O0A A;  1VQM A;  3S14 B;  3P1H A;  4KKS A;  4QQB X;  1ML0 D;  2NB0 A;  1EZ6 A;  5D3I B;  2F52 A;  4DFA A;  1FJG Q;  5ELF A;  5JJK A;  3E9I A;  1G8Z D;  4YWL A;  1PH6 A;  1OXX K;  3LGJ A;  3Q22 A;  5M3F H;  2PNH A;  4HN7 A;  4R4O A;  4LF4 Q;  2KHJ A;  3I8Z A;  1NAP A;  1S5E D;  4PZ8 A;  2WV6 D;  2R93 H;  1SN8 A;  1WTV A;  2A6H C;  3CP0 A;  3H3V C;  1MBY A;  1R9T H;  3KDF A;  5CV6 A;  2PO4 A;  3KDF B;  1WCM G;  4HJ5 A;  3Q6S A;  2F0F A;  4IUN A;  5LMN L;  2FHT A;  2EXZ A;  3QOJ A;  3WWV A;  2EIF A;  2IT1 A;  2NZ1 D;  4L5R C;  1STN A;  4Y7N H;  3S1Q B;  1AE3 A;  2HCI A;  4DV0 Q;  2RSO A;  3WDN A;  4ZLT F;  2I0Q A;  2GN5 A;  5H1S E;  4HJ9 A;  1GUS A;  1BXT A;  4CDC C;  3PO2 B;  2EYL A;  1PTO C;  3TS0 A;  1W3S A;  4A3F H;  1KAW A;  2VQF Q;  2L15 A;  2ZTD A;  1MIU A;  1PZK D;  4HCE A;  3BDL A;  3D8G A;  5EPL A;  1KAA A;  1WCM H;  1T9H A;  1SAP A;  3OPO A;  2VZA A;  4IJH A;  1TWF H;  1Y8O B;  2KEE A;  4XQQ A;  1JCK B;  3HOY G;  5ELO A;  5C3X A;  4GNX A;  4H13 C;  4MNO A;  1SYB A;  2HQL A;  3PMF A;  2K05 A;  2Y0S G;  5GQO A;  1FD7 D;  2F0D A;  4JK1 C;  3KLS A;  1PTO D;  4TVA B;  4E6I A;  1Z47 A;  5FLX L;  1UNS A;  4R1J A;  4IFD I;  1OO9 B;  3EA6 A;  1LT4 D;  3A0J A;  4IUQ A;  2R7Z B;  5EKI A;  4R4C A;  5I2Y A;  1Q1E A;  3NWS A;  4RHS A;  3KYH C;  4H0L C;  4A3J B;  2VB3 X;  1DOL A;  2NVY H;  1WTO A;  1WOC A;  1L1O B;  1QVC A;  4KHP L;  3RMH A;  3VA5 A;  2JQO A;  1YI2 A;  1EY5 A;  1LTR D;  3MEF A;  3TRE A;  3PUY A;  5GRO A;  3MXN A;  3GP7 A;  3MXN B;  3A8J E;  2Z0S A;  4TQU S;  1KHI A;  2LY7 A;  3NBH A;  3T1Y L;  4DAY A;  4IOC A;  3AFP A;  3DXJ C;  5DM7 3;  2UXB L;  2BDN A;  1BUV T;  1STG A;  1VF5 C;  2MQH A;  2Z6K A;  1N32 Q;  3CCU A;  4KY7 A;  4GKK Q;  3BU2 A;  3OW7 A;  1BVS A;  5L37 A;  1U4P A;  2B2Y A;  1EYG A;  1B7Y B;  5COY A;  3CC4 A;  1BDO A;  3KUP A;  1ZYR C;  5BN5 A;  1TWH B;  1IKM A;  2ZTC A;  5ISR A;  2NBF A;  1O7I A;  2PCF B;  4QCL A;  1MHW C;  2KCT A;  3FPP A;  1EQQ A;  4RAU C;  3S16 B;  4GKJ L;  5COR A;  2A8V A;  4DPG A;  2O4X A;  1PV4 A;  5EAY A;  1D5M C;  1VQH A;  2TSS A;  3T53 B;  5FO8 B;  2QGQ A;  4RGN A;  1BCP B;  2C5C A;  1IBM Q;  3RZD B;  1ESF A;  1NY4 A;  2CH4 A;  4PMW A;  2L0C A;  3PUW A;  4ID6 A;  2E5L Q;  2F0N A;  1HZC A;  3AU7 A;  1SE4 A;  1X3G A;  2K5H A;  3S1Q H;  4OWT B;  1ZYR D;  3IKJ A;  3SXH A;  1B8A A;  3P75 A;  5ELE A;  1VQP A;  2CWP A;  3KBG A;  2QKI C;  3J81 c;  3D3R A;  5EKK A;  4G7O C;  4RWS C;  3VR5 A;  4DA2 A;  2NVT B;  3L7Z C;  2K28 A;  1HZA A;  1TKW B;  3M85 A;  5AJ3 L;  3VR2 A;  1MI2 A;  4BY7 B;  2NUC A;  5CV8 A;  2R7Z G;  1I94 Q;  4LJZ C;  1CQV A;  4DV2 Q;  1RHP A;  2I5M X;  5HGT A;  4B9X A;  4DUZ Q;  4LFC L;  4DV4 Q;  3M4Q A;  1MSG A;  4CJ0 B;  4A3E G;  2JA5 B;  4AYB E;  4EVO A;  1LAB A;  2JXM B;  4DK6 C;  3A5U A;  1R4Q B;  4K5V A;  4ULL A;  2EJF C;  1BNZ A;  2EY6 A;  2HQE A;  2JE6 I;  5A2Q E;  1HA6 A;  2RDF A;  5DLQ E;  3J80 E;  5IE8 A;  4A3K G;  2IL8 A;  2R7D A;  1NTG A;  1XJV A;  1D1K A;  4P72 A;  4POG A;  1EOT A;  1HR0 L;  1IL8 A;  1JR0 D;  2DJG C;  3NEM A;  3HOZ G;  3HGB A;  4C3J B;  3V2T A;  3CC2 A;  5EKL A;  2OTL A;  2R7Z H;  1AN8 A;  2AQ2 B;  1XMO L;  2RSN A;  1JJG A;  2HDM A;  2PZW A;  5GAD C;  3I55 A;  2Z4H A;  1VQL A;  4LFA L;  4BWG B;  2HHH L;  4A3E H;  4P74 A;  2UUC Q;  1QWY A;  3ND9 A;  3PCO B;  3H91 A;  2Z9H A;  1Q90 A;  3AQQ A;  1EOV A;  4PZ6 A;  1O78 A;  2K04 A;  1A8V A;  1PFS A;  1ZKO A;  3Q0A A;  1ESR A;  4RFB A;  2CFM A;  4NXM L;  3QJY A;  5BR8 L;  1A6X A;  1TS2 A;  3E0E A;  4IPD A;  5IOD A;  1RF2 D;  4JVZ A;  3PF5 A;  4A3K H;  1VQK A;  1F77 A;  1WI5 A;  1SNP A;  1Q46 A;  3A8K E;  5DEH A;  1PYW D;  1PYB A;  1SDF A;  2PI2 A;  1V1O A;  3J7Z C;  3SK4 A;  3GTP H;  1K28 A;  1FJG L;  3H0G B;  4MTN A;  5AFW A;  3HOZ H;  3TN2 A;  4Q0F A;  3UDX A;  4LF7 Q;  1TWH H;  2JA7 B;  2R3Z A;  5IT9 c;  1ENF A;  2K14 A;  2K5V A;  2Q8R E;  1IKL A;  1FGU A;  2F0V A;  4LF4 L;  1OXU A;  2QA4 A;  1F9S A;  2B2W C;  4IPG A;  2AUJ D;  2R92 B;  2AHO B;  1EY6 A;  2EYP A;  4IPH A;  1W2B A;  4OEL B;  1GO3 E;  3BDC A;  3URY A;  1Y1W B;  3QG1 A;  4A93 B;  4A3C G;  3FRP B;  3RZD H;  2JA5 G;  4LW1 A;  1AH9 A;  4DV0 L;  4P71 A;  2JA8 B;  4HJ8 A;  3RN2 A;  1L0X B;  2LXJ A;  1B9N A;  4ODG A;  1Q12 A;  2PQA A;  3AEV A;  2PQA B;  3J7A V;  2VS1 A;  2B39 A;  3DM1 A;  1FGB D;  3T51 B;  4OWX B;  2EVB A;  3KBX A;  1EIH A;  3K7A B;  2K5W A;  1J5E Q;  4JG2 A;  4JI1 Q;  1CKO A;  2E75 C;  2NVT H;  3UE1 A;  3BVM A;  1B44 D;  3KLW A;  3KF6 A;  3D31 A;  3KF6 B;  4RKB A;  2KJX A;  4ZKC B;  4C3J G;  4L5S A;  5IGE A;  1PH7 A;  3J81 L;  2A6E C;  2VUM B;  3DM3 A;  2F0K A;  4A3C H;  3X3M A;  3BYT B;  1I5F A;  5I6Y A;  2JA5 H;  1BQQ T;  1GUN A;  3I4M G;  4XTC S;  1B1Z A;  4DR6 Q;  2PZT A;  3OW2 A;  1WTW A;  3RLN A;  4XYQ A;  3RLO A;  1I4X A;  3STB D;  4LUV A;  4A3G G;  3G71 A;  1NR2 A;  4ME3 A;  2OWO A;  4ZYS A;  4K6L A;  4ZAI A;  3J7A F;  2N55 A;  3A7L A;  3CCS A;  3NXW A;  5M3M B;  1YIT A;  1A63 A;  3NP8 A;  1YNX A;  1B3Q A;  1SFO B;  1FVI A;  4CDE C;  1L1O C;  4YWK A;  4G7H C;  1OTC A;  2ZJQ A;  2NVX B;  1TU2 B;  3NSW A;  1I4P A;  1E1O A;  3H0G G;  4LF8 Q;  1QE6 A;  2A6E D;  3CKI B;  4JC0 A;  4QL5 A;  4C3J H;  3BS1 A;  1NSN S;  2JA7 G;  3L3O C;  3PIP 3;  1ILQ A;  5NUC A;  3DMU A;  1NE3 A;  1SRU A;  1SNC A;  1F9Q A;  2R92 G;  3V96 A;  3N6R A;  4PNY A;  3M7G A;  1YHQ A;  4DR1 Q;  3GDE A;  4R4T A;  3I4M H;  2AQ1 B;  3PUV A;  3TSS A;  5GAE C;  3HZX A;  3GV3 A;  1B2T A;  1Y1W G;  1VQI A;  1D2B A;  1G2S A;  4WFN 3;  4A3G H;  4A93 G;  3VYU A;  1N32 L;  3VR4 A;  1S5B D;  1SE8 A;  4GKK L;  4P2C B;  2I07 B;  4H02 A;  2F0L A;  2JA8 G;  1VMP A;  1HQM C;  1A2U A;  2F0H A;  3QB3 A;  1VQG A;  1BCP C;  1AW7 A;  5C44 B;  2E2D C;  1Q3L A;  3A5Z B;  1SMY C;  2JA7 H;  2PZU A;  4DV1 Q;  2D0P A;  1CKN B;  4L6T B;  2NVQ B;  1NUC A;  2R92 H;  3I2Z A;  1B50 A;  2BDO A;  1IBM L;  3F1Z A;  1KLU D;  4DR4 Q;  5IT9 L;  4RA8 A;  2WKC A;  3UDG A;  4FXD A;  1A3U A;  2VUM G;  2F0M A;  1KNE A;  1Y1W H;  2E5L L;  5CR3 A;  3I4N B;  4A93 H;  1IXR A;  4BBR B;  5D3D A;  2BE5 C;  2N78 A;  4IUR A;  1BBX C;  3M9B A;  2L1B A;  1V8Q A;  1HR0 W;  1NNX A;  1ET9 A;  1VQB A;  2JA8 H;  1WJJ A;  1W6J A;  1S5C D;  3TP5 A;  1S72 A;  1LTI D;  1S3O A;  1Y8P B;  5C0X J;  3S15 H;  1SMY D;  2PQE A;  5M3M G;  4A3M B;  2X6G A;  2OF1 A;  4LF5 Q;  2N49 A;  3ERS X;  4YIJ A;  3NWT A;  3UI2 A;  1J6Q A;  4OIJ A;  1I94 L;  1HJP A;  3I72 A;  1PRT C;  2MNA A;  2NZH A;  2I5L X;  4DV2 L;  1BF4 A;  3S2D B;  2KHS A;  2QDL A;  4DUZ L;  4DV4 L;  3MHB A;  1NJI C;  1MD2 D;  3W3A A;  2G9H D;  2VUM H;  2VQE Q;  1BBW A;  1HTP A;  1XPR A;  4IUU A;  1GUG A;  2BA1 A;  1TVX A;  4RGT A;  3VR3 A;  1F2M A;  1STE A;  3WOF A;  3PIP A;  2NN6 G;  4JBJ A;  4IPC A;  1KDC A;  2EYJ A;  4CKE A;  1BO0 A;  4POF A;  2VXW A;  3S1N H;  1M90 C;  4GZY C;  1WD1 A;  2Q8T A;  3NTI A;  2VB2 X;  3BYY B;  4V0B A;  4I7A A;  2L9H A;  4R9W A;  5ELD A;  5M3M H;  3PSI A;  2Z1C A;  3I70 A;  3P20 A;  1SFO H;  3H3V I;  3K5M A;  2OCE A;  3CCQ A;  1Z9F A;  2ZXP A;  1AE2 A;  1PRT D;  1ASY A;  1SMX A;  3GTO B;  1ASZ A;  5GAG C;  3BDO A;  4UAI A;  5C44 G;  2KOL A;  1LO5 D;  1HCZ A;  2I46 A;  5J39 A;  1EQT A;  2MFI A;  4GN4 B;  4DXG A;  3HFZ B;  3HOX B;  1PFN A;  2UUC L;  3MA2 B;  3VYT A;  3C3L A;  3CCV A;  4KY5 A;  1QVG A;  3GO5 A;  1G91 A;  3D0F A;  2Q2I A;  1CTM A;  1SBB B;  5C3E B;  2NN6 H;  5FO7 B;  1HZB A;  2G9D A;  4DF7 A;  1ET6 A;  4UP7 A;  5E3F A;  3KF8 A;  3I4N G;  4HCS A;  4BBR G;  1QJO A;  1EEF D;  2IJ0 A;  2G5D A;  3QO2 A;  3TME A;  1SE3 A;  3OSO A;  2MP1 A;  1C48 A;  3J7Y W;  2UUB Q;  1M8A A;  1HNX Q;  1F2Z A;  4LF7 L;  1C7Y A;  1JJ2 A;  4EGV A;  1ZEQ X;  3GTM B;  5C44 H;  3Q8D A;  4JOI C;  2AMC B;  3KJP A;  1CT1 D;  1GVP A;  3CRL C;  4QMG A;  1VQN A;  2Y0S E;  3ICE A;  4CJ2 C;  4ZK9 B;  4JW0 A;  1J8I A;  4A75 A;  1DYQ A;  1I6H B;  2NVQ H;  2LFN A;  2MO1 A;  1CA5 A;  4BY1 G;  2ICI A;  2F0O A;  3S2H B;  2IY5 B;  3SHL A;  1U4R A;  4A3I H;  2E2H B;  1NMF A;  4KD3 A;  2ID0 A;  3OWE B;  3I4N H;  3MXU A;  4BBR H;  1ILP A;  1VQ8 A;  4BA2 I;  4DV7 Q;  3R8B A;  2XWJ B;  4DV5 Q;  3CXC A;  1J5E L;  3KJO A;  5M5W B;  3ULL A;  4JI1 L;  1TS5 A;  4UHV A;  5IGC A;  1SLJ A;  2E8G A;  1C8C A;  3I73 A;  1KLG D;  3FEW X;  1M1K C;  3DEO A;  1QZG A;  3JAM i;  1W6K A;  2A69 D;  5I9P A;  4KKU A;  1UE7 A;  3T13 A;  4BY1 H;  4RHR A;  3J80 c;  4F7X A;  3S2D H;  4A3L G;  2FJ2 A;  2HIX A;  3HOX G;  1DON A;  4DR6 L;  2ZJP A;  4MHE A;  2UXC Q;  2F0E A;  2J0T D;  3BZD B;  3NEN A;  4PMC A;  3IL8 A;  2XRS D;  1IBK Q;  4X6A H;  4KHZ A;  3ERO A;  3TRZ A;  3U9O A;  1FNW A;  1CUK A;  2A6H D;  1X54 A;  1B4O A;  3OIP A;  2XWB B;  3C1E A;  4JI6 Q;  2K5D A;  3M3Y B;  3CRK C;  5IGG A;  1PHJ A;  1HA5 A;  1F2Y A;  1YVC A;  1WVL A;  3K59 A;  4LF8 L;  1LTA D;  4DR7 Q;  4YCW A;  4I7Z C;  4KV6 A;  1CK1 A;  2K52 A;  1KDB A;  1DZ1 A;  2CQO A;  4GNX B;  1IYV A;  2WAQ B;  1PVO A;  4A3L H;  4YCV A;  3D4D A;  5C4Z A;  4DR1 L;  3HOX H;  1LTG D;  5C3W A;  2PW5 A;  3HOU G;  3LX0 A;  4WOR A;  1N36 Q;  2MO0 A;  3MTS A;  5E7N A;  2SEB D;  3I4L A;  3GD7 A;  1EIF A;  1XWE A;  3SE0 A;  2UUA Q;  2NTT A;  4C1N K;  4UPA A;  3GTJ H;  5EQ0 A;  3IFD A;  2AUK A;  1S5F D;  3SR1 A;  1XPU A;  3D6C A;  3FVQ A;  4EQO A;  3K7U C;  4C56 C;  1S5D D;  1ICF B;  1R4P B;  1PH4 A;  4GLX A;  3HOY H;  2A19 A;  4DV1 L;  1JWU D;  1HTL D;  2K7V A;  1T5E A;  3GTM H;  3NBH B;  3E9H A;  3K0Y A;  1SYC A;  4DAY B;  1LV9 A;  4X62 Q;  2B2T C;  3EJI A;  4B3M Q;  5CV4 A;  2YU9 B;  1SEB D;  4WJ4 A;  1XNR Q;  4U68 A;  1YZ6 A;  3DUZ A;  4DR4 L;  4K0K Q;  2L5T A;  3HOU H;  2K03 A;  3S1R B;  4HSV A;  5C4J B;  1D5Z C;  2AQ3 B;  4FF4 A;  4HJ7 A;  1U5K A;  4NP5 A;  3S14 H;  5KRU A;  2O2L D;  3B6Y A;  1PTO F;  1D1I A;  1EYA A;  1C4Q A;  3M7N A;  4GLA C;  3SK5 A;  5CV9 A;  1PZI D;  4CDF C;  4NKL A;  5IYD G;  4ILW A;  5FLX E;  1MSH A;  1Q1B A;  3PO2 G;  4GN5 A;  1KRT A;  2A74 C;  5JPN C;  2EYF A;  1Q7Y C;  1QNU A;  4LF5 L;  3DWP A;  1SR3 A;  1VDZ A;  1ROD A;  3KFU A;  5M5W H;  5K5P A;  3HOW B;  3K0X A;  1SND A;  2RA4 A;  1ONL A;  2EYO A;  2H4O A;  4OEM B;  1GUO A;  1II3 A;  5JEA J;  1CA6 A;  2CW0 C;  1VQ5 A;  5JOB A;  4OX9 Q;  3A55 A;  1SJE D;  1JJC B;  1HH2 P;  1VF7 A;  2VQE L;  2WAQ G;  4FVM A;  4JPB W;  2QEX A;  1E2V A;  2XIW A;  1RKN A;  1L2F A;  2WIN B;  5A2Q L;  1PZJ D;  1V1P A;  3EN2 A;  3NTK A;  1V1P B;  1E22 A;  2Q8I B;  5KYI A;  3Q23 A;  2F0S A;  2YTX A;  5IYD H;  3J80 L;  1EY8 A;  5E4W C;  3PO2 H;  2OT2 A;  2Z4I A;  5C0X G;  4RG1 A;  1UAP A;  1VS0 A;  1AFP A;  1KRS A;  2R61 A;  2L11 A;  3FP9 A;  4JI4 Q;  3M3Y H;  4O42 A;  5C4H A;  3S17 B;  5FKA C;  2RVL A;  4A3J G;  1JQY D;  2K5Q A;  4IN3 A;  1HNZ Q;  2RDH A;  1TWC B;  4DXF A;  3PF4 A;  3SK8 A;  5ELC A;  5J1Z A;  1EU4 A;  1I4G A;  4OIK A;  4DK3 C;  3T1H Q;  3R2T A;  1GOZ A;  5JAV A;  3K5N A;  1EY9 A;  4V19 0;  3OWF A;  5FJ8 G;  4X3K A;  3U4V A;  5JJI A;  3DWQ A;  4DK0 A;  4JI0 Q;  1B70 B;  4CDD C;  1O7Z A;  3AFQ A;  4P73 A;  4A76 A;  1CM9 A;  4CGY B;  2PMZ E;  5C0X H;  2A68 C;  2VW9 A;  5D14 A;  4GOP A;  2KUM A;  4GOP B;  4A3B B;  5G3L D;  4G57 A;  5JJL A;  2E76 C;  3HKZ B;  5LMN W;  1IBL Q;  2UUB L;  1FR3 A;  4IUP A;  1HNX L;  4ZQ3 A;  2K01 A;  4A3J H;  4X65 Q;  5IP7 G;  2B2U C;  5KNC A;  2MJ8 A;  3EQL C;  3MEH A;  1XXG A;  1UEA B;  4DUY Q;  1IYU A;  1Y1V B;  2EY1 A;  5M5X B;  1STB A;  3CCR A;  3HOW G;  2K75 A;  5FJ8 H;  1FNU A;  4H7B A;  5IYC G;  2YU9 H;  1A3T A;  5LHY 1;  2YTV A;  2E2I B;  1TWG B;  4OO1 G; 
#chains in the Genus database with same CATH homology
 5CC4 A;  4DAV A;  4EQP A;  3DHQ A;  2X6L A;  1S4Z A;  2A68 D;  1A2T A;  3R93 A;  1EWH A;  1QB5 D;  2QEJ C;  3GTL B;  1JOK A;  1SSO A;  3RD4 A;  4XDX A;  2J4X A;  3M4O B;  2F03 A;  3NBI A;  3KLR A;  1HUM A;  1WTX A;  3E0J A;  4C2M B;  3PIO 3;  1EL0 A;  2F4I A;  3GTQ B;  1PXU A;  3LWU A;  2RDG A;  2AWN A;  2JEB I;  2XVS A;  2KQ3 A;  3OHX C;  4KHV A;  3D4W A;  5J22 A;  4OO1 H;  4N9T A;  4FF1 A;  1LT5 D;  2QCP X;  4X3U A;  5DNF A;  2EPB A;  2IX0 A;  2QDB A;  2XRQ D;  2WKD A;  2KCC A;  1LT3 D;  1H9M A;  3IAY A;  2F0Q A;  3ONA B;  4IUV A;  3GQB A;  3VYS A;  2L4N A;  4FF2 A;  2KEC A;  1Z6H A;  3TZD A;  1BOS A;  2EYM A;  4FP5 D;  3GTG B;  2R6G A;  4DNR B;  3O13 A;  1HQR D;  2LS0 1;  2AWO A;  4XQJ A;  3TP8 A;  3HEJ A;  5FO9 B;  1JC7 A;  2WII B;  4XT1 B;  3M4Y A;  2IX3 A;  3W2D A;  2WAC A;  2SOB A;  2JA6 B;  4XIG S;  3I3C A;  3OOC A;  4OGQ C;  5EJW A;  1PFB A;  5M5Y B;  1F2L A;  5JVH 3;  2B2Y C;  1HRJ A;  3PO3 B;  4M1U B;  1PTO B;  2RQX A;  5JVG 3;  4G4K A;  1WTR A;  4ZUI A;  1AP0 A;  3A7A B;  4QUC A;  1YNN C;  2DNC A;  1GHK A;  1RDP D;  1JB3 A;  1H9R A;  5CV5 A;  1ZXT A;  4C3I B;  1EYC A;  1TT2 A;  1D5X C;  4BBS B;  4B08 A;  4K8J A;  4XT3 B;  2LKV A;  3HP3 A;  4L63 B;  4F88 A;  3HOV B;  1MGS A;  3S9W A;  1YNJ C;  1LT6 D;  2F0P A;  1TS3 A;  5LL6 X;  3E6Z X;  4K2L A;  3R2I A;  3EVQ A;  1IW7 C;  4DK1 A;  4HED A;  1CI3 M;  4HTH A;  2IWH A;  4B9W A;  1BCP D;  4XXE A;  3DEP A;  3TZU A;  3EFX D;  2DN8 A;  2F0W A;  4J6H A;  1D6E C;  4NMZ A;  3K5L A;  2EJG C;  5M3F B;  2MPM A;  2EYH A;  4Z9C B;  2IW3 A;  1DD2 A;  2R93 B;  5I2X A;  1VCI A;  1R9T B;  2BE5 D;  1I3Q B;  3R3O A;  3G7L A;  5JEA G;  4CJ1 B;  1BR9 A;  1EY7 A;  5M9O A;  3MWY W;  5C4X B;  2ZT9 C;  3PV0 A;  4KJN A;  3IFT A;  3C1F A;  1CHP D;  5EBD A;  2K32 A;  2IX1 A;  3RUZ A;  2X69 A;  4K6D A;  3PUX A;  4C3I G;  4NDX A;  1SNQ A;  2JSO A;  4A3F B;  2KCN A;  3GTK B;  1STH A;  5I4D A;  1WTQ A;  1ENC A;  1STA A;  1WCM B;  5JEA H;  1PFM A;  1EWC A;  3U9S A;  5FOB B;  1PTO H;  5A35 A;  1EY0 A;  3MFG A;  3GV6 A;  2B2V C;  5HUR A;  2MHV A;  2C9O A;  1I50 B;  4CKB A;  2A73 B;  4KN7 C;  4F87 A;  1O80 A;  2NN6 I;  1PRT F;  1NR4 A;  1RD9 D;  1QIL A;  3H09 A;  2WB1 B;  1E2W A;  1B9M A;  5CYU A;  4JBW A;  1O7Y A;  1XTC D;  2EE1 A;  2EY2 A;  2EJM A;  1KNA A;  3JAM E;  3A8I E;  1DM0 B;  3BG3 A;  5KYL A;  3MFY A;  1DXM A;  3AMU A;  3VYR A;  4MIU A;  4FXG C;  1KDA A;  3FKI B;  1GXD C;  4KD4 A;  4LAA A;  1CQF A;  2DNE A;  1DOM A;  1LLR D;  4RCO A;  5IOC A;  4RKL A;  5KGU A;  4KMU C;  3T56 B;  1AEX A;  3C2P A;  2WP8 J;  3CQZ B;  1EU3 A;  4C3H B;  1NCV A;  3NHH A;  1RTO A;  4TRD A;  5C6A A;  2F3W A;  5CV7 A;  2PPB C;  3K6O A;  4L8J A;  2EDG A;  5E4X A;  2L12 A;  2D9U A;  1TS4 A;  4HSP A;  4FNF A;  4PMB A;  4IFD G;  2B2W A;  2OXP A;  1HFN A;  1U4M A;  2Z8L A;  1LTS D;  2KED A;  4DGZ A;  3CHB D;  1XYI A;  4S3S A;  2BOS A;  2M2L A;  1G6Z A;  4WRD A;  2RKS A;  5CBA E;  1DCZ A;  1GJX A;  4OL7 A;  1HUN A;  2JYO A;  1PLF A;  4PV1 C;  5IGB A;  4WJW A;  4IFD H;  1IHZ A;  1LAC A;  3V05 A;  1TII D;  2A5H A;  4RCN A;  4NW2 A;  1QG7 A;  2H1E A;  1EIG A;  1X3P A;  1JOO A;  1K83 B;  4IAL A;  2CQA A;  3ITP A;  2PNR C;  3VR6 A;  3MXP A;  5KEE A;  3I91 A;  3X3N A;  2B8G A;  1SYG A;  1AZQ A;  1DOK A;  4N9P A;  4KKT A;  4C3H G;  1TR5 A;  5IIF A;  4QB4 A;  4A3E B;  1K8O A;  1JE4 A;  4A3D B;  3TP7 A;  1A15 A;  1LTT D;  1Z7T A;  4HR7 B;  3MC0 B;  2D5D A;  1XX8 A;  3SEB A;  1A3V A;  4A3K B;  4K2K A;  2FMM A;  2NTS A;  1HHV A;  5DAU A;  3GTP B;  3LWE A;  3HOZ B;  4ME5 A;  4UDU C;  2N88 A;  2F3V A;  1SYE A;  4EQN A;  2XN9 C;  5EPK A;  1EY4 A;  3WOE A;  4LK1 C;  2SNS A;  1HXY D;  2GA4 B;  1TY0 A;  5DM6 3;  2EY5 A;  2F0T A;  4QUF A;  2HDL A;  1Y69 U;  3T16 A;  2EOT A;  4C1N I;  3NUC A;  3OMG A;  1U9R A;  2CW0 D;  3C46 A;  4O1N A;  3PUZ A;  1Y8N B;  3TP6 A;  1B53 A;  1FNV A;  3AB9 A;  2PW7 A;  3QWN A;  4XQN A;  3NQT A;  1X32 A;  4AYB B;  1E0B A;  4RGM A;  1TWA B;  1PRT B;  1RJT A;  4R8I A;  1F9P A;  4J8Q A;  3K57 A;  1FYC A;  3HG9 A;  1JWS D;  3OMC A;  4MN3 A;  4BA1 I;  2B8F A;  2L55 A;  3MZ5 A;  3SVM A;  2QF7 A;  1GUT A;  2PMZ B;  3E5S A;  1KTK A;  2PYK A;  5C0X I;  3P7J A;  3NPP A;  1RTN A;  4ZRZ A;  2E2J B;  3T4A C;  5E1F A;  3I4M B;  5BN3 A;  5IGF A;  4LMQ D;  3NQI A;  2ZXO A;  1EFI D;  4A3G B;  3RLF A;  1QOH A;  1LTB D;  4HMI A;  2K1B A;  1K8M A;  4TSS A;  5G3L F;  2O5I C;  2B63 B;  2FIN B;  1I4Q A;  4IUT A;  4J1M A;  3S1M B;  2DY8 A;  2B2V A;  1T5X D;  4XYO A;  1EYD A;  3QOL A;  4KY6 A;  3Q24 A;  4FXK C;  1PDQ A;  4IFD J;  4QIW B;  2F0G A;  1U4L A;  4ZUJ A;  2V4D A;  3SK6 A;  2D2C C;  5JPM C;  2FMC A;  1G29 1;  5IGD A;  2TMP A;  4Q5V A;  3ZYY X;  4DN4 M;  2KVM A;  1SYD A;  3LNN A;  1QNK A;  1OXS C;  3KK7 A;  4DU9 A;  5EPJ A;  4OO1 I;  1WD0 A;  3S15 B;  4FYD A;  1OXV A;  1GUW A;  3KLS X;  1H9J A;  4RGO S;  3NTH A;  3FMC A;  2D62 A;  1SJH D;  1I4H A;  3RZO B;  1SNM A;  3F2U A;  2F0I A;  1SNO A;  3D4R A;  4BS9 A;  1JIC A;  5F2D A;  1H9S A;  1H9S B;  2MGS A;  2JEA I;  4FO2 A;  3S1N B;  5TSS A;  5EGT A;  5T1I A;  5EBC A;  3H6M A;  4CBV A;  3BVG A;  1DJR D;  2CHB D;  4FF3 A;  1ICW A;  1G2T A;  1JWM D;  2SNM A;  3ERQ A;  3J81 E;  4PQX A;  5C5L A;  5I6W A;  4KK7 A;  2F1M A;  2F0U A;  3HS0 C;  3A56 A;  2EZV A;  4K14 A;  5T1G A;  1X3Q A;  3L9A X;  1SXT A;  3FDT A;  1V43 A;  2ZXR A;  4KTA A;  1JOQ A;  1J9O A;  3G6J B;  1GHJ A;  2RBM A;  4R8N A;  5CGK A;  1WTP A;  2K6A A;  4CKC A;  4RH6 A;  4K5W A;  5C5M A;  5KND A;  2DY7 A;  1CFM A;  4H44 C;  5D65 A;  2VNU D;  4KN4 C;  1YNN D;  1Q8I A;  1PMR A;  1CHQ D;  1AZP A;  4HMJ A;  5I9O A;  3VA7 A;  1O7L A;  4ABN A;  4A3I B;  2KA7 A;  1SE2 A;  1EQV A;  4X3T A;  2HCC A;  1M4V A;  1E2Z A;  2ICE C;  2K33 A;  3MVV A;  4X3S A;  2B2T A;  1YNJ D;  3SDZ A;  2M00 A;  1L0Y B;  2O5J C;  3QIA A;  2E74 C;  2J7Z A;  1I4R A;  4OHJ A;  1IW7 D;  1EZ8 A;  2YYZ A;  4U67 3;  4G7Z C;  1I6V C;  5CMD A;  5ELB A;  5JJZ A;  3DWA A;  5IT9 E;  1H9K A;  1F9R A;  4Y7N B;  4BY1 B;  5KNB A;  3K5O A;  2HUG A;  2FFK B;  1RCV D;  1TY2 A;  3OIQ A;  4IQZ A;  1BCP F;  4IZ8 A;  4KI0 A;  2QIL A;  5CBE E;  1JOR A;  1CZG A;  2NWG A;  5KIX A;  4QF4 A;  4F8M A;  1CZW A;  2M9V A;  1HPC A;  2MUY A;  4ZKB B;  4DAP A;  1EEI D;  2NYZ D;  1OXT A;  2IPK D;  4M8A A;  2CVR A;  3ND8 A;  3HRZ C;  1TWF B;  2ENB A;  1ENA A;  3D6W A;  2SDF A;  4KJO A;  5FK9 C;  1VMC A;  3MAQ A;  1B3A A;  1HFG A;  3JAM L;  3N52 A;  3K58 A;  5K36 G;  3NK9 A;  1STY A;  4DNT B;  2BA0 A;  1KAB A;  5BN4 A;  2OEO A;  2XNA C;  2JP1 A;  3I90 A;  3GTJ B;  3CU7 A;  3H94 A;  1SYF A;  2F0J A;  4K5X A;  2NVY B;  3MXG A;  3TDQ A;  1QCB D;  3NE5 B;  4TKO B;  4HAE A;  3TBI B;  3HOY B;  3FPU B;  1TQO A;  4K8I A;  2LMC B;  3A54 A;  2Y0S B;  4I65 A;  2BCO A;  1UUP A;  3HOU B;  5K36 H;  2XSC A;  2B2U A;  3BVZ A;  4CHT B;  2A69 C;  5LL6 S;  3S14 B;  3P1H A;  4KKS A;  1ML0 D;  2NB0 A;  1EZ6 A;  5D3I B;  4DFA A;  5ELF A;  1G8Z D;  1OXX K;  3Q22 A;  4HN7 A;  3I8Z A;  1NAP A;  1S5E D;  2WV6 D;  1WTV A;  2A6H C;  3H3V C;  1MBY A;  5CV6 A;  2PO4 A;  3Q6S A;  2F0F A;  4IUN A;  2FHT A;  2EXZ A;  3QOJ A;  2IT1 A;  2NZ1 D;  1STN A;  3S1Q B;  2HCI A;  2RSO A;  3WDN A;  4ZLT F;  1GUS A;  1BXT A;  3PO2 B;  2EYL A;  1PTO C;  1PZK D;  4HCE A;  3BDL A;  3D8G A;  5EPL A;  1KAA A;  1SAP A;  3OPO A;  2KEE A;  1Y8O B;  4XQQ A;  1JCK B;  5C3X A;  4H13 C;  1SYB A;  3PMF A;  2K05 A;  1FD7 D;  2F0D A;  4JK1 C;  3KLS A;  1PTO D;  4E6I A;  1Z47 A;  5FLX L;  1UNS A;  4IFD I;  1OO9 B;  3EA6 A;  1LT4 D;  4IUQ A;  2R7Z B;  5EKI A;  5I2Y A;  1Q1E A;  3NWS A;  4RHS A;  4H0L C;  4A3J B;  2VB3 X;  1DOL A;  1WTO A;  3RMH A;  3VA5 A;  1EY5 A;  1LTR D;  3PUY A;  3MXN A;  3GP7 A;  3A8J E;  4TQU S;  2LY7 A;  3NBH A;  4DAY A;  3DXJ C;  5DM7 3;  2BDN A;  1BUV T;  1STG A;  1VF5 C;  4KY7 A;  3OW7 A;  1U4P A;  2B2Y A;  5COY A;  1BDO A;  3KUP A;  1ZYR C;  5BN5 A;  1TWH B;  1IKM A;  5ISR A;  2NBF A;  2PCF B;  4QCL A;  3FPP A;  4RAU C;  3S16 B;  5COR A;  2O4X A;  1D5M C;  2TSS A;  3T53 B;  5FO8 B;  4RGN A;  1BCP B;  2C5C A;  3RZD B;  1ESF A;  4PMW A;  2L0C A;  3PUW A;  4ID6 A;  2F0N A;  3AU7 A;  1SE4 A;  1ZYR D;  3IKJ A;  3SXH A;  3P75 A;  5ELE A;  3KBG A;  2QKI C;  3D3R A;  5EKK A;  4G7O C;  4RWS C;  3VR5 A;  4DA2 A;  2NVT B;  3L7Z C;  2K28 A;  1TKW B;  3M85 A;  3VR2 A;  1MI2 A;  4BY7 B;  2NUC A;  5CV8 A;  4LJZ C;  1CQV A;  1RHP A;  5HGT A;  4B9X A;  1MSG A;  4CJ0 B;  2JA5 B;  4EVO A;  1LAB A;  2JXM B;  1R4Q B;  4K5V A;  4ULL A;  2EJF C;  1BNZ A;  2EY6 A;  2HQE A;  2JE6 I;  5A2Q E;  1HA6 A;  2RDF A;  3J80 E;  2IL8 A;  1D1K A;  1EOT A;  1IL8 A;  1JR0 D;  3HGB A;  4C3J B;  3V2T A;  5EKL A;  1AN8 A;  2AQ2 B;  2RSN A;  2HDM A;  2PZW A;  2Z4H A;  4BWG B;  1QWY A;  3ND9 A;  3H91 A;  1Q90 A;  1O78 A;  2K04 A;  1ZKO A;  3Q0A A;  1ESR A;  4RFB A;  3QJY A;  1A6X A;  1TS2 A;  5IOD A;  1RF2 D;  1F77 A;  1SNP A;  3A8K E;  5DEH A;  1PYW D;  1SDF A;  1V1O A;  3SK4 A;  3H0G B;  5AFW A;  3TN2 A;  4Q0F A;  2JA7 B;  2R3Z A;  1ENF A;  2Q8R E;  1IKL A;  2F0V A;  1OXU A;  1F9S A;  2B2W C;  2AUJ D;  2R92 B;  1EY6 A;  2EYP A;  3BDC A;  3URY A;  1Y1W B;  3QG1 A;  4A93 B;  3FRP B;  2JA8 B;  1L0X B;  4ODG A;  1B9N A;  1Q12 A;  3J7A V;  2B39 A;  3DM1 A;  1FGB D;  3T51 B;  2EVB A;  3KBX A;  1EIH A;  3K7A B;  2K5W A;  2E75 C;  3BVM A;  1B44 D;  3D31 A;  4RKB A;  2KJX A;  4ZKC B;  4C3J G;  5IGE A;  3J81 L;  2A6E C;  2VUM B;  2F0K A;  3X3M A;  3BYT B;  5I6Y A;  1BQQ T;  1GUN A;  4XTC S;  1B1Z A;  2PZT A;  1WTW A;  4XYQ A;  1I4X A;  1NR2 A;  4ZYS A;  4K6L A;  4ZAI A;  3J7A F;  2N55 A;  3A7L A;  3NXW A;  5M3M B;  3NP8 A;  1SFO B;  4G7H C;  2NVX B;  1TU2 B;  3NSW A;  1I4P A;  1QE6 A;  2A6E D;  3CKI B;  3BS1 A;  1NSN S;  3L3O C;  3PIP 3;  1ILQ A;  5NUC A;  3DMU A;  1SNC A;  1F9Q A;  3V96 A;  3N6R A;  4PNY A;  3M7G A;  2AQ1 B;  3PUV A;  3TSS A;  3HZX A;  3GV3 A;  1B2T A;  1D2B A;  1G2S A;  4WFN 3;  3VYU A;  3VR4 A;  1S5B D;  4P2C B;  2I07 B;  2F0L A;  1VMP A;  1HQM C;  1A2U A;  2F0H A;  3QB3 A;  1BCP C;  1AW7 A;  5C44 B;  2E2D C;  1Q3L A;  1SMY C;  2PZU A;  4L6T B;  2NVQ B;  1NUC A;  1B50 A;  2BDO A;  1KLU D;  5IT9 L;  4RA8 A;  2WKC A;  4FXD A;  1A3U A;  2F0M A;  1KNE A;  5CR3 A;  3I4N B;  4BBR B;  5D3D A;  2BE5 C;  4IUR A;  1BBX C;  2L1B A;  1V8Q A;  1ET9 A;  1W6J A;  1S5C D;  3TP5 A;  1LTI D;  1Y8P B;  5C0X J;  1SMY D;  2PQE A;  4A3M B;  2X6G A;  2OF1 A;  4YIJ A;  3NWT A;  3UI2 A;  4OIJ A;  3I72 A;  1PRT C;  1BF4 A;  3S2D B;  2KHS A;  3MHB A;  1MD2 D;  3W3A A;  2G9H D;  1HTP A;  4IUU A;  1GUG A;  2BA1 A;  1TVX A;  4RGT A;  3VR3 A;  1F2M A;  1STE A;  3WOF A;  2NN6 G;  1KDC A;  2EYJ A;  4CKE A;  1BO0 A;  2VXW A;  4GZY C;  1WD1 A;  2Q8T A;  3NTI A;  2VB2 X;  3BYY B;  4V0B A;  2L9H A;  4R9W A;  5ELD A;  2Z1C A;  3I70 A;  3P20 A;  3K5M A;  2ZXP A;  1PRT D;  3GTO B;  3BDO A;  4UAI A;  2KOL A;  1LO5 D;  1HCZ A;  2I46 A;  5J39 A;  1EQT A;  4DXG A;  3HOX B;  1PFN A;  3MA2 B;  3VYT A;  3C3L A;  4KY5 A;  3GO5 A;  1G91 A;  1CTM A;  1SBB B;  5C3E B;  2NN6 H;  5FO7 B;  2G9D A;  4DF7 A;  1ET6 A;  5E3F A;  3KF8 A;  4HCS A;  1QJO A;  1EEF D;  2IJ0 A;  3QO2 A;  3TME A;  1SE3 A;  3OSO A;  2MP1 A;  1C48 A;  3J7Y W;  1M8A A;  1F2Z A;  4EGV A;  1ZEQ X;  3GTM B;  1CT1 D;  3CRL C;  4QMG A;  4CJ2 C;  4ZK9 B;  1J8I A;  1DYQ A;  1I6H B;  2LFN A;  1CA5 A;  3S2H B;  2ICI A;  2F0O A;  3SHL A;  1U4R A;  2E2H B;  4KD3 A;  2ID0 A;  3OWE B;  3MXU A;  1ILP A;  4BA2 I;  3R8B A;  2XWJ B;  5M5W B;  1TS5 A;  5IGC A;  1C8C A;  3I73 A;  1KLG D;  3FEW X;  3DEO A;  1W6K A;  2A69 D;  5I9P A;  4KKU A;  3T13 A;  4RHR A;  4F7X A;  2FJ2 A;  1DON A;  4MHE A;  2F0E A;  2J0T D;  3BZD B;  4PMC A;  3IL8 A;  2XRS D;  4KHZ A;  3ERO A;  3U9O A;  1FNW A;  2A6H D;  3OIP A;  1B4O A;  2XWB B;  3C1E A;  2K5D A;  3M3Y B;  3CRK C;  5IGG A;  1HA5 A;  1F2Y A;  1WVL A;  3K59 A;  1LTA D;  4I7Z C;  4KV6 A;  1CK1 A;  1KDB A;  1DZ1 A;  1IYV A;  2WAQ B;  3D4D A;  5C4Z A;  1LTG D;  5C3W A;  2PW5 A;  3LX0 A;  4WOR A;  3MTS A;  2SEB D;  3I4L A;  3GD7 A;  1XWE A;  3SE0 A;  2NTT A;  4C1N K;  5EQ0 A;  3IFD A;  2AUK A;  1S5F D;  3SR1 A;  3D6C A;  3FVQ A;  4EQO A;  4C56 C;  1S5D D;  1R4P B;  1JWU D;  1HTL D;  2K7V A;  1T5E A;  3K0Y A;  1SYC A;  1LV9 A;  2B2T C;  3EJI A;  2YU9 B;  5CV4 A;  1SEB D;  4U68 A;  3DUZ A;  2L5T A;  2K03 A;  3S1R B;  4HSV A;  5C4J B;  1D5Z C;  2AQ3 B;  4FF4 A;  4NP5 A;  5KRU A;  2O2L D;  1PTO F;  1D1I A;  1EYA A;  1C4Q A;  3M7N A;  3SK5 A;  5CV9 A;  1PZI D;  4NKL A;  4ILW A;  5FLX E;  1MSH A;  1Q1B A;  5JPN C;  2A74 C;  2EYF A;  1QNU A;  3DWP A;  1VDZ A;  1ROD A;  5K5P A;  3HOW B;  1SND A;  2RA4 A;  1ONL A;  2EYO A;  2H4O A;  1GUO A;  1II3 A;  5JEA J;  1CA6 A;  2CW0 C;  5JOB A;  3A55 A;  1SJE D;  1VF7 A;  4FVM A;  1E2V A;  2XIW A;  1RKN A;  2WIN B;  5A2Q L;  1PZJ D;  1V1P A;  3NTK A;  1V1P B;  2Q8I B;  5KYI A;  3Q23 A;  2F0S A;  3J80 L;  1EY8 A;  5E4W C;  2OT2 A;  2Z4I A;  5C0X G;  1UAP A;  1AFP A;  2R61 A;  2L11 A;  4O42 A;  5C4H A;  3S17 B;  5FKA C;  2RVL A;  1JQY D;  2K5Q A;  4IN3 A;  2RDH A;  1TWC B;  4DXF A;  3SK8 A;  5ELC A;  5J1Z A;  1EU4 A;  1I4G A;  4OIK A;  3R2T A;  1GOZ A;  5JAV A;  3K5N A;  1EY9 A;  4V19 0;  3OWF A;  4X3K A;  3DWQ A;  4DK0 A;  1O7Z A;  1CM9 A;  4CGY B;  5C0X H;  2A68 C;  5D14 A;  2KUM A;  4A3B B;  5G3L D;  4G57 A;  2E76 C;  3HKZ B;  1FR3 A;  4IUP A;  4ZQ3 A;  2K01 A;  2B2U C;  5KNC A;  2MJ8 A;  3EQL C;  3MEH A;  1XXG A;  1UEA B;  1IYU A;  1Y1V B;  2EY1 A;  5M5X B;  1STB A;  1FNU A;  4H7B A;  1A3T A;  5LHY 1;  2E2I B;  1TWG B;  4OO1 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...