4U673

Crystal structure of the large ribosomal subunit (50s) of deinococcus radiodurans containing a three residue insertion in l22
Total Genus 0
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
0
sequence length
59
structure length
59
Chain Sequence
THKMAKRRIKITGTGKVMAFKSGKRHQNTGKSGDEIRGKGKGFVLAKAEWARMKLMLPR

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2
publication title The Ribosomal Protein uL22 Modulates the Shape of the Protein Exit Tunnel.
pubmed doi rcsb
molecule tags Ribosome
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2014-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF01632 Ribosomal_L35p Ribosomal protein L35
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.530 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4u67300
3PIP3 4WFN3 5JVG3 5JVH3 5DM63 3PIO3 4U673 5DM73
chains in the Genus database with same CATH superfamily
5ISRA 1KC8C 4QUCA 4LUOA 2OCEA 4LF9L 1A3VA 1I4RA 1V1PA 4GN4B 1TS2A 2Z9HA 1EYCA 1NNXA 2CW0D 4POGA 2R3ZA 5IP9G 1NJIC 3PGZA 2JE6I 1E3PA 4LWCA 4A3CG 3M85A 2EOTA 4LFBQ 3RD4A 2NVXH 2EIFA 3E3XA 4Q5VA 3R2IA 1BBXC 1EQTA 1HNXL 2KQ3A 1EQQA 3S1MB 1QWYA 2M2LA 4CKEA 1CTMA 1NSNS 2R7FA 3H94A 4DGZA 1S5DD 1X3EA 2JA9A 5C5MA 4KD4A 3AFQA 4WFN3 1C0AA 1WTPA 1GUNA 2K50A 2RCNA 1D1KA 1G6ZA 1QUQA 1ENFA 1Y1VH 2BDOA 1LACA 2ICEC 3NXWA 1UE5A 4NXNL 1RJTA 3A0JA 1EY9A 2C35B 2NVYB 4B3MQ 1DZ1A 4DNIA 4DR4Q 4UP9A 2UXDL 3UE1A 3STBC 1DGSA 4QUFA 5A2QL 2XTIA 1BVSA 5M9OA 4RGTA 5I2XA 1BXTA 2IJ0A 4O1NA 4XXEA 4HCSA 1TU2B 4JI4L 3L0OA 4APVA 3PF5A 5L37A 4H02A 1QZGA 3H3VH 2K75A 4N8FA 1PA6A 1EL0A 2TMPA 1W6JA 1L0WA 2XRSD 2HT1A 5DAUA 1E2ZA 5GQOA 4KMUC 4Y7NB 3I8ZA 4A3KB 2Q8TA 1BDOA 4PQXA 4CDEC 1MHWC 1WCMG 4MNOA 1EYDA 2Z1CA 3CD6A 1SSOA 2F0WA 4A3KG 4LFAL 4ZKCB 1TWFB 4A93G 2K7VA 4PG3A 2AHOB 1GOZA 4R4OA 3IKJA 2H5XA 3D31A 4YCWA 3UDXA 2K33A 4NW2A 1CM9A 2D0PA 1YITA 1O7IA 4JW0A 4Z9CB 5FLXL 3FRPB 4HIMA 2OEOA 2NN6G 3KLSX 4ME5A 2Q2UA 3GTPH 3CC2A 2VNUD 3NELA 1B44D 2JA8G 3MC0B 5IYCG 4L63B 2XWJB 3S14B 1SE3A 1M4VA 1QE6A 4KN4C 4LF6Q 4L8JA 1B9NA 1B3AA 4LFBL 3EIVA 2F0TA 4U673 1Y69U 1Q8KA 1T5EA 3K57A 3TS2A 2VUMB 3I4OA 4AYBG 4C3HB 2UUBL 4LFCQ 3FHWA 4X64Q 1TXYA 3M4PA 4C3HG 4DV4Q 2VW9A 1FR3A 3JAMi 4FNFA 1O80A 1IYUA 2E2JB 4QGUA 2BE5C 4DXFA 4WJWA 4P2CB 2O2LD 3TREA 1X3PA 1K8GA 1DYQA 2NWGA 2EPBA 2BE5D 4DV6Q 1FNUA 4B3ML 3HOXB 5ELEA 3UDFA 5KRUA 4DR4L 4MIUA 3PUWA 3PMFA 3ND8A 3TSSA 5FO9B 2F0PA 3HOXG 1F2ZA 4DAVA 4PZ8A 3AYHB 3Q8DA 5IP7G 5E4WC 4TSSA 4GNXB 4DAYB 1BBWA 1LLRD 1HFNA 1YBYA 4FXGC 3GTJB 1R4PB 1C48A 1AN8A 1OXVA 4N9PA 5CV7A 5K36G 1BQQT 2IHFA 1YNJC 1KAWA 3I4MB 1HQRD 3NWTA 3RZDB 1UEAB 2JP1A 3R2TA 1KRTA 4RGNA 2JYOA 1SFOB 4UP7A 1YNJD 3GTOB 3I4MG 2P5ZX 2SOBA 1X54A 4RWSC 5AJ3Q 4MHEA 1CA6A 3SK8A 1LTAD 4BY1H 4DR3Q 3NP8A 2RHSB 1FD7D 1A63A 1EY5A 4RCOA 4JPBW 2RQXA 1YZ6A 3NUCA 3A54A 1PTOC 3E0JA 1HZBA 2FXQA 4DV2Q 1CKNA 3U4ZA 3LNNA 1ONLA 2R61A 3NPPA 3K5MA 1M90C 2H1EA 1KXLA 3MXNB 2KJXA 1E7ZA 3A7LA 3H6MA 1RTOA 4CDCC 1PXUA 4JC0A 2NVQH 2ZXRA 4K8JA 4CJ2C 1ZKOA 2R7ZH 3MWYW 4A3DH 4K0KQ 4ZCKA 4OWWB 5JAVA 2PZTA 1S5FD 1FGBD 3I72A 1VQGA 3BG3A 3PIO3 1KHIA 1PH5A 2DJFC 3J7AV 3S1MH 2E5LQ 4OWXB 1N32Q 2GN5A 1B7YB 2CWPA 3SE0A 4C3IB 2GVAA 4A3BH 2Q2IA 3I3CA 2F3VA 1V8QA 4K5XA 3F2BA 4LF6L 1X3GA 4IZ8A 2A6HD 5T1GA 3KLWA 4DV5Q 4OXPA 3J7AF 1OXTA 2QA4A 4DK3C 1DM0B 1HRJA 2G9HD 2OQ0A 4LFCL 2A73B 1UAPA 2SNSA 4X64L 2RDFA 2XNAC 5I4DA 2J7ZA 4DV4L 2NBFA 4I7ZC 3D0FA 1VQDA 1KNEA 2VQFQ 1VQNA 3K5OA 2F0SA 1PDQA 2F52A 3Q0AA 1CK1A 3DEOA 2KENA 4R9WA 2UXCQ 2BA1A 1VQ4A 3HOZB 1GO3E 2EJFC 4DV6L 4MN3A 5KEEA 1H9SA 1LO5D 1DONA 1S72A 1GXDC 3I2ZA 3HOZG 2J4XA 1IKLA 1VF7A 2AQ3B 2DUDA 4JOIA 1KDBA 3FPPA 4IQZA 4H13C 3G71A 4OIKA 4IFDJ 1LUZA 2ASBA 4Y7NH 1I4GA 4QCLA 1VMCA 3S9WA 1K83H 4A3MG 5IGDA 3ONAB 4A3IB 3J7YW 1I3QH 3MEFA 1RF2D 3EBEA 2AMCB 4A3IG 3M9BA 3DWPA 4OEMB 4F88A 5IIFA 2K4KA 1B3QA 4GOPB 5GAHC 4A3LH 1AE2A 2K04A 5AJ3L 3W2DA 4IUNA 4F7XA 1S5CD 5HURA 4DR3L 4DR1Q 4L5TA 4DV7Q 4OWTB 5BN4A 1IXRA 1JOQA 5C4XB 1BUVT 3OMGA 5DM73 2OXPA 2JA7H 2B39A 4IPCA 2A68C 1S5ED 1JOKA 4DV2L 2MFIA 1A2TA 2K14A 2A68D 1QJOA 5G3LF 3A55A 3CCSA 1JOOA 2KUMA 3S14H 2EY5A 3DHQA 3OSOA 4DK1A 5C0XI 4RGOS 5CV4A 4G7HC 2Y0SE 2RF4A 1JE4A 1EIYB 4JI6Q 3AQQA 4H7BA 2JJQA 4K0KL 5KNBA 3GTGH 2Q2HA 2F0KA 3FEWX 1YJNA 1SMYC 3DUZA 4KKSA 2CFMA 2VUMH 3BZDB 1N32L 2E5LL 4NMZA 4XTCS 2F0NA 2R93H 1VQKA 3PIOA 2PQAB 5FKAC 1Y1VG 1Y1WH 3K7AB 3K6OA 1PH9A 2C5CA 2DNCA 1XPRA 4X62Q 1JJCB 4MTKA 2C9OA 3RLOA 5GAGC 5GADC 2EYFA 2PMZB 2N78A 2HQEA 5DLQE 1BNZA 3P7JA 5M3FH 4DV5L 2E74C 4R8IA 3PUYA 3GTMB 4N8X1 1BBUA 3NBIA 4AH6A 2ZJPA 2F0DA 3HZXA 1J9OA 1ENAA 3UDIA 4XQNA 5I6YA 2K5VA 3J81E 2VQFL 5EPJA 1L1OC 3CC7A 3CCEA 2UXCL 3G7LA 2OTLA 3QJYA 4DN4M 5K5PA 2E76C 2Z8LA 4DK6C 5DEHA 3MFGA 2RDGA 5M3MB 1U4MA 2PI2A 5IT9c 1ICFB 1Q3LA 5CGKA 2F0EA 3HKZG 1EQRA 1ILQA 1A3TA 2JSOA 3I55A 3SR1A 2K5HA 1SFOH 1DXMA 3GTOH 1A6XA 4OL7A 4BXXH 2I07B 2B63B 1HZ9A 3CHBD 1ASYA 2B2UC 4ILWA 4CJ1B 1WTWA 1MSHA 1N8RC 3DM1A 3IRBA 1JE5A 1ICWA 1EIFA 3D4RA 3HOYH 4OGQC 2HQLA 4DR1L 1MD2D 4DV7L 4HJ7A 4G7OC 3T13A 2JXMB 4ID6A 3U9OA 1SNPA 2JA6B 2PNHA 1STGA 1HTLD 2EVBA 3BZCA 5C3EH 1Y8NB 2NTSA 2Z6BA 5JJKA 2WIIB 5D3IB 4KKTA 4DA2A 1CUKA 1KAAA 1UE6A 4K5VA 4ME3A 5A2QE 4J15A 1EOTA 4C3IH 2MNAA 1KQSA 3NWSA 3TEHB 3ZYYX 2E2DC 3ULPA 4L5SA 1TR5A 1YJWA 5LL6X 2YTYA 1TIID 4JI6L 2B29A 4L5QA 1SYFA 2HDMA 1SYBA 4LF8Q 3JAML 3TS0A 3RZOH 1Z7TA 3RUZA 5IOCA 3CP0A 4A3GB 5HGQA 1XXGA 3I73A 4RG1A 2J0TD 5C0XH 4FF3A 3PO2H 2Q8IB 5ELFA 1HR0Q 3NE5B 4IO9A 3A8KE 1PMRA 1OXUA 4X62L 1FL0A 1IBKQ 2AUJD 5EKIA 1YHBA 1EWCA 1QG7A 4JV5Q 2K32A 3CCQA 3K5NA 1KNAA 3I70A 2KVMA 2G9DA 3NQTA 1IW7C 3V05A 1YHQA 1PH8A 3MAQA 2B2TC 1QNUA 2HHHQ 3GTQH 2XSCA 4JI2Q 4GLVB 3CCRA 4FYDA 4M1UB 1VQEA 3ER0A 3RN5A 4N9TA 4IN3A 3F2DA 5IWAQ 1O78A 4DPGA 2OTJA 1SBBB 3KF6A 1VQAA 1U4LA 3PUXA 2ZXPA 4BY1B 4C1NI 4B9WA 2L4NA 3CCMA 3R3OA 1FYCA 2GA4B 1Z47A 1VQHA 1V1PB 3NBHA 2EYOA 1EYAA 5GROA 5M5XB 1A62A 4BY1G 2VY3A 1BCPB 2A8VA 2EJGC 5EKLA 2KEDA 1VQPA 2YV5A 1IBLQ 4DXGA 2XIWA 2I46A 2CW0C 2K6AA 1IBMQ 1VS0A 3T51B 1VQOA 1HUNA 5IGFA 1CHPD 5C4JH 4J8QA 1JQYD 5C4XH 4JBKA 3MXPA 2NVQB 3GTKH 1JR0D 2R7ZB 2MHVA 4GS3A 4A3DB 3SK6A 4RMFA 1KDCA 1TT2A 1EY0A 3Q23A 4C3JH 2R7ZG 2NTTA 4A3DG 4V190 4AIMA 5BN3A 2UUBQ 2F03A 1E1TA 1EQVA 4OONA 1B1ZA 4A3BB 3IAYA 1X55A 2ZXOA 4FDBA 3MA2B 4GNXC 2UXBQ 1HCZA 4F87A 2L0CA 2R7DA 4RHRA 2R92H 3QR8A 4A3BG 4LJZC 1K28A 1EU4A 3K0YA 3KBGA 1L1OA 1SYEA 3SVMA 1C4QA 1U5KA 1N9WA 4TQUS 2BOSA 2YTVA 1Q8IA 1P16A 3K7AH 3WWVA 4NKLA 1I4PA 3LX0A 1QVGA 3QO2A 4L5RC 3SHLA 4WORA 1D5MC 3AU7A 1JICA 4K6LA 3W1GA 1D7QA 3A56A 1XYIA 1WJJA 1PFNA 2L9HA 4B08A 4LF8L 1G2SA 3GD7A 1PH4A 4ZUIA 2FFKB 3GTMH 2F4VQ 1IKMA 1SDFA 3UDGA 1SN8A 1ET9A 1GKHA 3EFXD 3TP6A 4K2KA 2PW7A 1HR0L 3PUZA 5E3FA 1T5XD 5F2DA 1DCZA 3PCOB 5KNCA 1IBKL 4TVAB 2B2UA 1WI5A 4EQOA 2EYLA 4CGYB 4DR5Q 4JV5L 3UI2A 4FXDA 3HS0C 1SYGA 2V1CC 1CQVA 2X6GA 3I7FA 3K81C 1E2WA 1GUTA 4JI3Q 3TDQA 2HHHL 4GZYC 3I91A 5M3MH 1I4HA 3KDFA 1K83B 1YI2A 4JI2L 5D65A 1S40A 1PFSA 3CAMA 2A69D 2IY5B 1I3QB 2EYJA 2BH8A 5J39A 1WVLA 2CH4W 2KCMA 5ELCA 5IWAL 4M8AA 1ENCA 4XDXA 4I7AA 4FF4A 1EY8A 1JWSD 2ZTCA 3VR5A 1PRTD 3NEMA 1KDAA 2B63H 4CHTB 1WTXA 1DOMA 1PYBA 3BU2A 4BY7B 1H9MA 5CBAE 4U68A 4A3LG 1TKWB 2F0FA 2JA7B 1FJGQ 5LMNW 1IBLL 4DUZQ 3P75A 1K8OA 1IBML 1NY4A 2JA7G 2KCCA 1O7ZA 5COYA 2VXWA 3RR5A 4KN7C 2PZUA 2N88A 1SNMA 5IYBH 2PYKA 1RCVD 1H95A 5ELNA 5FJ8H 2JA6H 4ZK9B 1CQFA 3GV3A 3MZ5A 1D5XC 2F0GA 3TP8A 2ATWA 1VQMA 3FP9A 3GTGB 2HIXA 5GAEC 3LWUA 2JA5B 1VF5C 3D3RA 4O2DA 3K80C 5CV8A 2B2TA 2D0OA 4NDXA 2RKSA 4OX9Q 2R93B 1B70B 1Y1WB 2VUMG 4XQJA 4NPSA 2ID0A 3HRZC 3T16A 2UXBL 1PFBA 2R93G 4JBWA 5KGUA 1Y1WG 1EY4A 2O5IC 3PF4A 3AFPA 1TS5A 3EQLC 5M3FB 1C8CA 1G8ZD 4GKJQ 2RBMA 3J7ZC 5I9OA 4A3GH 5M3FG 3I4NH 3CMAA 1VQ6A 2E2IB 1X3FA 3JC66 2L12A 1F2YA 2QGQA 4GOPC 5EBCA 3PIP3 1YHAA 1XPUA 3E0EA 4FO2A 1VQ8A 1WYDA 2EXZA 2ENBA 4HJAA 1PRTF 1VQFA 1MSGA 2FJ2A 5NUCA 3A7AB 1R9TB 2F4VL 4HJ5A 3J81j 3G6JB 2FMMA 2D2CC 4FF1A 1TWAH 1ZYRD 3S2HH 1SNOA 3J80i 3M3YH 3A5UA 1WD0A 3OIQA 1NAPA 4DR5L 2WINB 4IURA 4LMQD 2SDFA 1VQLA 1Q90A 1OO9B 1BKBA 4RKLA 4JI3L 1X56A 3GDEA 2B8GA 1YNXA 2XVSA 1J6QA 1OXXK 1J5EQ 3M4OH 2LXKA 2Z4HA 5JJLA 4CDFC 3CRKC 2ZM6Q 1CKNB 3E9HA 4XT1B 1QB5D 4RGMA 4BXXG 1F9QA 5M5XH 3C1FA 4JI5Q 1TWHB 3DEPA 1A2UA 4GNXA 3S16H 1MGSA 4PMBA 5JPNC 1RIPA 3WOFA 1PV4A 2CWAA 4B3SQ 3HOYB 1TY0A 1JJGA 2QEXA 4BA2I 5JOBA 3R93A 1HNWQ 1Y8PB 1W6KA 4KV6A 4IUPA 1SE8A 2HUGA 3VR3A 2D5DA 3HOYG 2Y0SB 1SRUA 2ZJRA 4ZRZA 1FJGL 5C3EB 3KLRA 1S5BD 3DXJC 4DUZL 5CR3A 2Y0SG 2ALYB 1AFPA 1H9JA 5C3EG 4DV3Q 2B2YC 1K0SA 3SGIA 3H3VC 1PRTB 1S4ZA 3NK9A 4DR2Q 1HPCA 1KLUD 1SLJA 4TKOB 2A6HC 5CC4A 1RL2A 4C3IG 1VQBA 2NZ1D 4JK1C 3KF8B 3SK5A 2SEBD 3J80c 4RCNA 2HCCA 1NMFA 4QF4A 1VQCA 2RVLA 3RZOB 4OX9L 1JCKB 4J6HA 5FO8B 5G3LD 4I65A 1SE2A 5LL6S 3PO2B 4RKBA 2NZHA 3K59A 2OF1A 1JORA 2QEJC 3VYUA 5C0XG 1PHJA 4ZUJA 3PO2G 4DAPA 2CKZB 3TBIB 2IX3A 4DR7Q 4GKJL 2QCPX 5HY6A 1Q1EA 2A6ED 1D1IA 4P75A 5TSSA 3GTQB 1XMQQ 1VQ9A 5M5WH 1E2VA 3GP7A 1B2TA 1B4OA 1TWCB 5J1ZA 3E5SA 4IFDI 2JEAI 3J81c 2F0IA 3ICEA 1VDZA 1KIXA 1M8AA 3Q6SA 3BVMA 3D4WA 3PIPA 2EXDA 1FNVA 4OO1I 1SYCA 2CVRA 5IGEA 1G2TA 3RLFA 4POFA 4B3RQ 2EY2A 2DY8A 4P71A 1XNRQ 3TMEA 4KHPQ 4PMCA 1QVCA 1BF4A 4EQ5A 3KOJA 5EQ0A 3BZKA 3RMHA 1SEBD 4KI0A 2MUYA 2CH4A 3UE0A 2KOLA 4RAUC 3K0XA 2DY7A 3FVQA 1ML0D 1LTSD 1J5EL 1WOCA 3G4SA 4A3FH 1I4XA 3CF5A 2K03A 4R4IA 2ZM6L 2F1MA 1VQ7A 4BY7H 1EOVA 4HTHA 5C4JB 4YHHQ 2F0VA 4JI5L 1WTQA 1Q7YC 1D6EC 1LABA 3GTKB 3KFUA 5JPMC 4B3TQ 1SYDA 3GO5A 1HUMA 5C44B 5C4XG 2I5LX 1Q82C 4A3EH 3T4AC 3CCLA 3M4QA 1PH7A 1U4PA 1PZID 4B3SL 4IOAA 1HA6A 4C3JB 2RA4A 1HNWL 1UNSA 4XYQA 2MO1A 2LY7A 5DM63 3HGBA 2KA7A 4C3JG 1X3QA 3JAME 4KTAA 2XGTA 4GOPA 1O7YA 2AQ2B 2R92B 4RHSA 1KLGD 5I9PA 3GTLB 1DD2A 2JA5H 2FMCA 3S15B 1D8LA 1STEA 4DV3L 2R92G 2K1BA 5EGTA 5BR8Q 1JMCA 4FVMA 3AMUA 5IE8A 4YCVA 2WAQE 3T56B 4DR2L 3ERQA 5IGGA 1K8AC 3BDLA 5LMUQ 2M00A 1VCIA 1H9RA 2NB0A 1LT6D 1LT4D 2XWBB 3C3LA 3ZJYC 1CZGA 2ZTDA 4G7ZC 1XNQQ 3CQZB 2QF7A 2AWOA 3H0GH 1PTOB 4ZQ3A 2E2IH 4BBRB 4ZKBB 3S24A 2I5MX 3OWFA 1BCPD 4IPHA 5E1FA 2L5TA 5KYIA 2KHSA 3BDCA 3CCJA 1CT1D 2WKDA 3I56A 4AQYQ 4DR7L 4A76A 1R9TH 1LM0A 1Q12A 1R4QB 3BDOA 4CJ0B 3KUPA 3DMUA 1RHPA 1XMQL 5EJWA 2NVTH 1TQOA 2YU9H 2NZOA 3OHXC 1I50H 3L2PA 1EZ6A 2E2HH 1XJVA 1SJHD 2HCIA 1JWMD 5M3MG 1HA5A 1SNDA 4C56C 2K5NA 1TVXA 5FLXc 4B3RL 1XNRL 3G48A 4R8NA 1WFQA 2MO0A 1S3OA 4DV1Q 4KD3A 4KHPL 1PYSB 1HTPA 4IFDH 4EVOA 2QDLA 3R8BA 2B63G 1TWHH 1ESFA 4KLKA 4OO1H 2DJGC 1A15A 1XTCD 3NHHA 4HR7B 2PQEA 4CKBA 1SNCA 1QNKA 1ET6A 4KY6A 3HEJA 1N36Q 1NE3A 1Q46A 1YIJA 3P1HA 1NR2A 1SJED 4YHHL 3TRZA 5FO7B 2YYZA 5LMNQ 2NYZD 4B3TL 5IYBG 5EPKA 3DLLA 1HZCA 5FJ8G 2JA6G 1GD7A 2F4IA 4ZLTF 1K9MC 3N6RA 1E1OA 4X3SA 5EPLA 4DNTB 3SEBA 1B50A 2MQHA 1G51A 3QIAA 1BCPF 1C7YA 2KECA 3QG1A 3DM3A 1AZQA 5JVG3 4IPDA 4IUVA 1ILPA 4YY3Q 4HJ8A 1HHVA 1EWHA 3X3MA 4BBSH 3X3NA 1UE1A 3D6CA 1FGUA 5BR8L 1IZ6A 2H4OA 3E6ZX 1KD1C 3S2DH 5DNFA 3H09A 4P73A 5FLMH 2VB2X 3MEHA 2N8NA 1WTVA 3I4NB 3PO3H 5LMUL 1X6OA 2MPMA 1HXYD 5LHY1 1RODA 4A75A 4A3GG 3I4NG 1X32A 2WFWA 2WP8J 2LFNA 2KHIA 4PV1C 3M4YA 2IPKD 1RKNA 1A0IA 1PVOA 1XNQL 1W3SA 1UWVA 1TWAB 1GUWA 1KL9A 3S2HB 3LWEA 4DKAC 1FNWA 3M3YB 1TWCH 4QQBX 2HD3A 3GV6A 4H0LC 3S1NH 1Q86C 3KF6B 4IJHA 4A3JH 1EY7A 2QDBA 4IJLA 3J80L 1YNND 2LXJA 4AQYL 5ELDA 5KNDA 1EIHA 3MXGA 3F1ZA 2UUAQ 2PI2E 1UE7A 4MZ9A 4KKUA 2IW3A 2EY1A 3M4OB 3PSIA 1AP0A 1YVCA 2B2VC 4NP5A 4OHJA 3EN2A 4ABNA 5JJIA 2UU9Q 3OPOA 3QWNA 4KY5A 5IT9E 1LT5D 4LUVA 3S16B 2B8FA 2RCFA 3VR6A 4X65Q 3ERSX 2QILA 3S17B 1EIGA 5C4HA 4KY7A 1C9OA 4DV1L 1DJRD 1GHJA 3PQIA 2TSSA 2RDHA 5CBEE 3D8GA 3P20A 4MTNA 4J1MA 3HOUH 3QB3A 4ZAIA 4CKCA 3K8AA 1A3UA 4EX5A 2FHTA 1QZHA 3F2CA 4JI7Q 3KLSA 4RA8A 2E8GA 1STBA 4YCUA 5C44H 4LF7Q 4CBVA 2AKWB 4L6TB 5EKKA 3RLNA 4CDDC 3HOVH 1N36L 4C1NK 4G4KA 4X66Q 4JCVE 1CSQA 3CW2C 3CKIB 1QUQB 2IX1A 1G291 1J8IA 1L1OB 3TP5A 2N55A 5LMNL 3L7ZC 4FXKC 4DUYQ 4PMWA 4JI1Q 3I90A 4FF2A 2JEBI 3GTLH 4JBJA 5KIXA 5IYDG 1X9NA 2WB1E 3S15H 1LTBD 3WDNA 1HNZQ 3L3OC 4HJ9A 1QCBD 2YTXA 1E22A 5ELOA 4QB4A 2LS01 1OTCA 4JVZA 4KK7A 4GLXA 3A8JE 2UUCQ 2PO4A 4KJOA 2RSNA 1EEFD 2DGYA 2BA0A 3CCUA 3U58A 1BO0A 3RN2A 3CU7A 1B8AA 1Z9FA 4YY3L 4LF4Q 1EFID 1NUCA 1QOHA 2VB3X 1AE3A 1EFWA 3BYTB 4K14A 4R1JA 5EBDA 4DU9A 1WD1A 3CQZH 4HAEA 1PTOH 3FPUB 4O0AA 4BBRH 1EY6A 5M5WB 4HSVA 1LTID 3MXUA 2L11A 3VA7A 1K3BC 5CYUA 3FDTA 1ASZA 3BYYB 2F0UA 2F0JA 4ULLA 4KHZA 5IGCA 3O13A 4YWLA 3KDFB 1G6PA 3ND9A 3EJIA 1F9RA 3STBD 3S1QB 3N52A 2Z6KC 4F8MA 2A69C 5M5YB 1I6HH 5JEAJ 1D2BA 4IUQA 1CKMA 2B2WC 2VQEQ 1D5ZC 4OELB 2CCZA 1SE4A 2WACA 4HSPA 5D14A 1PRTC 1TY2A 2UUAL 2N49A 2X6LA 5J3BA 2F0HA 1WCMB 1II3A 2CQAA 1PH3A 3OW2A 4A3FB 3E9IA 4DNRB 5EAYA 4A93B 2BH2A 1MBYA 2K28A 2OT2A 2UU9L 1CKOA 4A3FG 1W2BA 1LTTD 4KHVA 4BY7G 1JB7A 4KJNA 3OOCA 2BCOA 5CV6A 4X65L 1B53A 5CV9A 1L0XB 1F9PA 3FKIH 4A3EB 3NENA 2RSOA 5IT9L 3W3AA 1TS3A 4JG2A 4R4QA 4G57A 3HOWH 3NTKA 4A3EG 4EQNA 1KABA 4JI7L 2IWHA 4JOIC 4LF7L 2PCFB 4DR6Q 2JA8B 5A35A 3HKSA 2MJ8A 3A5ZB 1P8LA 2EJMA 1NTGA 4X66L 2K5WA 4LUZA 3C46A 2JA5G 3LGJA 3TZDA 1STAA 3S1RH 2OQKA 4PNYA 2K5DA 4QMGA 4DUYL 4JI1L 5JJZA 3V2TA 5JVH3 3IFTA 2A74C 4XIGS 3SXHA 4AYBB 1HNZL 3BVZA 1LT3D 3ULJA 4ALPA 3H0GB 5CMDA 1IYVA 1NBWA 2UUCL 2B2VA 3HG9A 3KYHC 1V9PA 3H0GG 1CFMA 1HR0W 4LF4L 2ICIA 3KBXA 3U4VA 2HDLA 1ZYRC 3SK4A 1LYLA 2EYMA 3VYTA 1VQ5A 3OTOQ 1JC7A 1F77A 1SNQA 4LK1C 3TZUA 2LKVA 2K52A 4HIOA 4C2MH 4YIJA 2NVTB 1A8VA 2DNEA 2V4DA 2YU9B 1I50B 2KCTA 2E2HB 1VQIA 2N3SA 4XQQA 1SR3A 1PH2A 2F0LA 2I5HA 2M9VA 3G6EA 2L1BA 2OWOA 4YWKA 2VZAA 2IL8A 1TWGH 4QIWB 4OIJA 3Q22A 1STNA 1L2FA 1MIUA 2VQEL 1HJPA 2L15A 3BJUA 5IGBA 2EY6A 1CA5A 2NN6I 4DFAA 4DV0Q 2LSSA 5JEAH 1BR9A 4K2LA 1XX8A 4DAMA 4DAYA 4IFDG 3J81i 4HMIA 2WV6D 3TN2A 3S17H 3B6YA 5E4XA 4WJ4A 5FOBB 4OO1G 4ZYSA 1ZEQX 2DN8A 5C5LA 3BVGA 1SAPA 1KTKA 2KEEA 3A8IE 2JK8A 1YJ9A 4HN7A 2LMCB 1CSPA 3H91A 3VDYA 1MJCA 3T53B 4GKKQ 1XPOA 4UY8C 4NB3A 1AEXA 1LTLA 1PTOD 5IP9H 3OYYA 1U0LA 2WAQB 4S3SA 4FP5D 3CPWA 3F8TA 4A3CH 2B3GA 3JAMc 1IYJB 4IOCA 5IYDH 2WAQG 1K8MA 1TS4A 1BOSA 1U9RA 1O7LA 4DK0A 3MXNA 4DR6L 4V0BA 4A4IA 1H9KA 4UHVA 4BBSB 3K58A 5ELBA 5H1SE 1V43A 3L9AX 4X3UA 3S2DB 4NXMQ 2Z6KA 4B9XA 1Q81C 3AB9A 4BBSG 3C1EA 2Q8RE 5BN5A 3PO3B 3KJOA 1DOLA 1VMPA 1HFGA 2B2WA 2R6GA 3DWAA 1L0YB 5CORA 5FLMG 1CHQD 1JB3A 4K5WA 3PO3G 2A6EC 2K5QA 2QW7A 1I94Q 1X65A 1NMGA 1H9SB 3PV0A 4P72A 4AYBE 1SMXA 4RFBA 4XYOA 3CCVA 2NVYH 3MFYA 5AFWA 2EQSA 3KF8A 1PYWD 3S1NB 4A3JB 4IALA 5I6WA 4YWMA 4QJFA 1EZ8A 2Z4IA 4UPAA 4A3JG 4PZ6A 3S1QH 3D6WA 3OTOL 3MTSA 3DWQA 5M5YH 3Q24A 1ZXTA 3NTIA 1N33Q 1Y8OB 2IT1A 3M7NA 1XWEA 1PTOF 1MI2A 1SXTA 1XMOQ 3CXCA 2AWNA 2IX0A 4A3MB 2F0OA 1WCMH 5I2YA 1AZPA 4RH6A 4A3KH 3T1HQ 4QIWE 4R4TA 4JYAQ 3TQYA 4A93H 2XRQD 3HOUB 1SROA 3CRLC 2ZJQA 4DV0L 3NQIA 1K0RA 1Y14B 1PFMA 1TWFH 5KYLA 2EZVA 4IUUA 3HOUG 2G5DA 4HMJA 1HQMC 1OXSC 5HGTA 1GUGA 4XT3B 4IUTA 1UEBA 1I4QA 2EYHA 4IPGA 3HOVB 5C44G 2D62A 2NN6H 4JI0Q 3HOVG 1DOKA 4WRDA 1PH1A 2FINB 1E0BA 2Z0SA 4Y52H 2K01A 4JI8Q 1MKHA 2JA8H 5CV5A 4GKKL 4X3KA 4BWGB 5IYCH 2NVXB 4BA1I 3GQBA 2F0QA 4O42A 4DF7A 2EYPA 4K6DA 3T1YQ 1KRSA 3W5OA 1QVFA 3WOEA 4LF5Q 5IY0A 2L55A 4QY7A 2I0QA 2KCNA 4GN5A 4UAIA 5C0XJ 3I4LA 5C3WA 1UUPA 1B9MA 1Y1VB 2MP1A 2RHQB 3J80E 4NXML 1BCPC 3U50C 3ULLA 4C3HH 3VR2A 2X69A 2ZT9C 3ITPA 5D3DA 1SMYD 1RDPD 2F3IA 3K7UC 1JJ2A 1K3RA 1PH6A 4TRDA 4BBRG 1LTGD 1I94L 4GN3B 4H44C 3IFDA 2E2JH 3PUVA 2PQAA 1Z6HA 4HEDA 2PPBC 2JN4A 2ES2A 1I6HB 3HOXH 1AW7A 2K05A 2KBNA 3C2PA 3EA6A 1STHA 2A5HA 5IP7H 2QKIC 3MHBA 4K8IA 1G91A 4BS9A 4HIKA 2AUKA 3NSWA 1EU3A 1FVIA 1MJEA 3FMCA 1I5FA 1U4RA 5C4ZA 3F2UA 1F2LA 1N34Q 5K36H 2B2YA 1V1QA 2D9UA 3HKZB 1N33L 3U9SA 2F3WA 3GTJH 4R4CA 3AEVA 2VS1A 2E75C 1STYA 4LNQA 3I4MH 3RZDH 1PZKD 2NUCA 2O4XA 4LW1A 1XMOL 1AH9A 2VL6A 1PLFA 1EWIA 3FKIB 2MGSA 4LF9Q 3KJPA 3T1HL 1RD9D 4WJ3M 4PZ7A 4Q0FA 4JYAL 3M7GA 3EVQA 3HOWB 3FKIG 2EDGA 3OIPA 2PNRC 5T1IA 3CPFA 2O5JC 5E7NA 3D4DA 4EGVA 1EEID 2ZTEA 2EE1A 1CZWA 4EQPA 3HOWG 1GVPA 2WB1B 1CI3M 3HFZB 2BDNA 1GUOA 2A19A 4QL5A 3GTPB 1VQJA 3CMEA 4ODGA 1IHZA 1HNXQ 2WB1G 1E24A 2HIVA 3CC4A 4JI0L 3S1RB 4JI8L 1V1OA 3QOJA 2XN9C 1NCVA 2GVBA 2PZWA 3KK7A 4JBMA 1QILA 4NXNQ 3T1YL 1JT8A 1EUJA 5J22A 4LF5L 1IL8A 5FK9C 2UXDQ 2A1AA 1WTRA 3OMCA 1PZJD 3A74A 1T9HA 3K5LA 2SNMA 3J7A5 3URYA 3H3VI 4P74A 2CQOA 1NR4A 3VYRA 1EYGA 1K73C 2KHJA 4E6IA 4JI4Q 2F0MA 1YNNC 4C2MB 3BS1A 3RNUA 1YEZA 3EROA 1XTDA 3NTHA 1M1KC 1GM5A 3MVVA 5IODA 3VA5A 3VYSA 4LAAA 1GHKA 2PMZE 2AQ1B 1Q1BA 4X6AH 3NBHB 1LV9A 3HOZH 2PW5A 1F2MA 1GUSA 1TWGB 4UP8A 3OWEB 1HH2P 1GJXA 1IW7D 4X3TA 3TP7A 3VR4A 4HCEA 2IHEA 3QOLA 4LFAQ 3V96A 1HZAA 1WTHA 1F9SA 5C3XA 1ESRA 1JWUD 2WKCA 4GLAC 4A3MH 3OW7A 3HP3A 2CHBD 3W1BA 1I6VC 5JEAG 5C6AA 3IL8A 4HIDA 1N34L 5FLXE 4UDUC 1RTNA 1WTOA 3J81L 1IL2A 3H15A 3SDZA 3HKZE 2Q2TA 2JQOA 4A3IH 1LTRD
chains in the Genus database with same CATH topology
5ISRA 4QUCA 1A3VA 1I4RA 1V1PA 1TS2A 1EYCA 2CW0D 2R3ZA 2JE6I 3M85A 2EOTA 3RD4A 4Q5VA 3R2IA 1BBXC 1EQTA 2KQ3A 3S1MB 1QWYA 2M2LA 4CKEA 1CTMA 1NSNS 3H94A 4DGZA 1S5DD 5C5MA 4KD4A 4WFN3 1WTPA 1GUNA 1G6ZA 1D1KA 1ENFA 2BDOA 1LACA 2ICEC 3NXWA 1RJTA 1EY9A 2NVYB 1DZ1A 4QUFA 5A2QL 5M9OA 4RGTA 5I2XA 1BXTA 2IJ0A 4O1NA 4XXEA 4HCSA 1TU2B 1EL0A 2TMPA 1W6JA 2XRSD 5DAUA 1E2ZA 4A3KB 4KMUC 4Y7NB 3I8ZA 2Q8TA 1BDOA 4PQXA 1EYDA 2Z1CA 1SSOA 2F0WA 4ZKCB 1TWFB 2K7VA 1GOZA 3IKJA 3D31A 2K33A 4NW2A 1CM9A 4Z9CB 5FLXL 3FRPB 2OEOA 2NN6G 3KLSX 4ME5A 2VNUD 1B44D 3MC0B 4L63B 2XWJB 3S14B 1SE3A 1M4VA 1QE6A 4KN4C 4L8JA 1B9NA 1B3AA 2F0TA 4U673 1Y69U 1T5EA 3K57A 2VUMB 4C3HB 4C3HG 1FR3A 4FNFA 1O80A 1IYUA 2E2JB 2BE5C 4DXFA 4WJWA 4P2CB 2O2LD 1X3PA 1DYQA 2NWGA 2EPBA 2BE5D 1FNUA 3HOXB 5ELEA 5KRUA 4MIUA 3PUWA 3PMFA 3ND8A 3TSSA 5FO9B 2F0PA 1F2ZA 4DAVA 5E4WC 4TSSA 1LLRD 1HFNA 4FXGC 3GTJB 1R4PB 1C48A 1AN8A 5CV7A 1OXVA 4N9PA 5K36G 1BQQT 1YNJC 3I4MB 1HQRD 3NWTA 3RZDB 1UEAB 2JP1A 3R2TA 4RGNA 2JYOA 1SFOB 1YNJD 3GTOB 2SOBA 4RWSC 4MHEA 1CA6A 3SK8A 1LTAD 3NP8A 1FD7D 1EY5A 4RCOA 2RQXA 3NUCA 3A54A 1PTOC 3E0JA 3LNNA 1ONLA 2R61A 3NPPA 3K5MA 2H1EA 2KJXA 3A7LA 3H6MA 1RTOA 1PXUA 2ZXRA 4K8JA 4CJ2C 1ZKOA 3MWYW 5JAVA 2PZTA 1S5FD 1FGBD 3I72A 3BG3A 3PIO3 3J7AV 3SE0A 4C3IB 3I3CA 2F3VA 1V8QA 4K5XA 4IZ8A 2A6HD 5T1GA 3J7AF 1OXTA 1DM0B 1HRJA 2G9HD 2A73B 1UAPA 2SNSA 2RDFA 2XNAC 5I4DA 2J7ZA 2NBFA 4I7ZC 1KNEA 3K5OA 2F0SA 1PDQA 3Q0AA 1CK1A 3DEOA 4R9WA 2BA1A 3HOZB 2EJFC 4MN3A 5KEEA 1H9SA 1LO5D 1DONA 1GXDC 2J4XA 1IKLA 1VF7A 2AQ3B 1KDBA 3FPPA 4IQZA 4H13C 4OIKA 4IFDJ 1I4GA 4QCLA 1VMCA 3S9WA 5IGDA 3ONAB 4A3IB 3J7YW 1RF2D 3DWPA 4F88A 5IIFA 2K04A 3W2DA 4IUNA 4F7XA 1S5CD 5HURA 5BN4A 1JOQA 5C4XB 1BUVT 3OMGA 5DM73 2OXPA 2B39A 2A68C 1S5ED 1JOKA 1A2TA 2A68D 1QJOA 5G3LF 3A55A 1JOOA 2KUMA 2EY5A 3DHQA 3OSOA 4DK1A 5C0XI 4RGOS 5CV4A 4G7HC 1JE4A 4H7BA 5KNBA 2F0KA 3FEWX 1SMYC 3DUZA 4KKSA 3BZDB 4NMZA 4XTCS 2F0NA 5FKAC 3K7AB 3K6OA 2C5CA 2DNCA 2C9OA 2EYFA 2PMZB 1BNZA 2HQEA 3P7JA 2E74C 4R8IA 3PUYA 3GTMB 3NBIA 2F0DA 3HZXA 1J9OA 1ENAA 4XQNA 5I6YA 3J81E 5EPJA 3G7LA 3QJYA 4DN4M 5K5PA 2E76C 2Z8LA 5DEHA 3MFGA 2RDGA 5M3MB 1U4MA 1Q3LA 5CGKA 2F0EA 1ILQA 1A3TA 2JSOA 3SR1A 1DXMA 1A6XA 4OL7A 2I07B 2B63B 3CHBD 2B2UC 4ILWA 4CJ1B 1WTWA 1MSHA 3DM1A 1ICWA 3D4RA 4OGQC 1MD2D 4G7OC 3T13A 2JXMB 4ID6A 3U9OA 1SNPA 2JA6B 1STGA 1HTLD 2EVBA 1Y8NB 2NTSA 2WIIB 5D3IB 4KKTA 4DA2A 1KAAA 4K5VA 5A2QE 1EOTA 3NWSA 3ZYYX 2E2DC 1TR5A 5LL6X 1TIID 1SYFA 2HDMA 1SYBA 3JAML 1Z7TA 3RUZA 5IOCA 4A3GB 4FF3A 1XXGA 3I73A 5C0XH 2J0TD 2Q8IB 5ELFA 3NE5B 3A8KE 1PMRA 1OXUA 2AUJD 5EKIA 1EWCA 1QG7A 2K32A 3K5NA 1KNAA 3I70A 2KVMA 2G9DA 3NQTA 1IW7C 3V05A 3MAQA 2B2TC 1QNUA 2XSCA 4FYDA 4M1UB 4N9TA 4IN3A 1O78A 1SBBB 3PUXA 1U4LA 2ZXPA 4BY1B 4C1NI 4B9WA 2L4NA 3R3OA 1FYCA 2GA4B 1Z47A 1V1PB 3NBHA 2EYOA 1EYAA 5M5XB 1BCPB 2EJGC 5EKLA 2KEDA 4DXGA 2XIWA 2I46A 2CW0C 2K6AA 3T51B 1HUNA 5IGFA 1CHPD 4J8QA 1JQYD 3MXPA 2NVQB 1JR0D 2R7ZB 2MHVA 4A3DB 3SK6A 1KDCA 1TT2A 1EY0A 3Q23A 2NTTA 4V190 5BN3A 2F03A 1EQVA 1B1ZA 4A3BB 3IAYA 2ZXOA 3MA2B 1HCZA 4F87A 2L0CA 4RHRA 4LJZC 1EU4A 3K0YA 3KBGA 1SYEA 3SVMA 1C4QA 4TQUS 2BOSA 1Q8IA 4NKLA 1I4PA 3LX0A 3QO2A 3SHLA 4WORA 1D5MC 3AU7A 1JICA 4K6LA 3A56A 1XYIA 1PFNA 2L9HA 4B08A 1G2SA 3GD7A 4ZUIA 2FFKB 1IKMA 1SDFA 1ET9A 3EFXD 3TP6A 4K2KA 2PW7A 3PUZA 5E3FA 1T5XD 5F2DA 1DCZA 5KNCA 2B2UA 4EQOA 2EYLA 4CGYB 3UI2A 4FXDA 3HS0C 1SYGA 1CQVA 2X6GA 1E2WA 1GUTA 3TDQA 4GZYC 3I91A 1I4HA 1K83B 5D65A 2A69D 1I3QB 2EYJA 5J39A 1WVLA 5ELCA 4M8AA 1ENCA 4XDXA 4FF4A 1EY8A 1JWSD 3VR5A 1PRTD 1KDAA 4CHTB 1WTXA 1DOMA 4BY7B 1H9MA 5CBAE 4U68A 1TKWB 2F0FA 2JA7B 3P75A 1K8OA 2KCCA 1O7ZA 5COYA 2VXWA 4KN7C 2PZUA 2N88A 1SNMA 2PYKA 1RCVD 4ZK9B 1CQFA 3GV3A 3MZ5A 1D5XC 2F0GA 3TP8A 3GTGB 3LWUA 2JA5B 1VF5C 3D3RA 5CV8A 2B2TA 4NDXA 2RKSA 2R93B 1Y1WB 4XQJA 2ID0A 3HRZC 3T16A 1PFBA 4JBWA 5KGUA 1EY4A 2O5IC 1TS5A 3EQLC 5M3FB 1C8CA 1G8ZD 2RBMA 5I9OA 2E2IB 2L12A 1F2YA 5EBCA 3PIP3 4FO2A 2EXZA 2ENBA 1PRTF 1MSGA 2FJ2A 5NUCA 3A7AB 1R9TB 3G6JB 2FMMA 2D2CC 4FF1A 1ZYRD 1SNOA 1WD0A 3OIQA 1NAPA 2WINB 4IURA 4LMQD 2SDFA 1Q90A 1OO9B 4RKLA 2B8GA 2XVSA 1OXXK 2Z4HA 3CRKC 4XT1B 1QB5D 4RGMA 1F9QA 3C1FA 1TWHB 3DEPA 1A2UA 1MGSA 4PMBA 5JPNC 3WOFA 3HOYB 1TY0A 4BA2I 5JOBA 3R93A 1Y8PB 1W6KA 4KV6A 4IUPA 2HUGA 3VR3A 2D5DA 2Y0SB 4ZRZA 5C3EB 3KLRA 1S5BD 3DXJC 5CR3A 1AFPA 1H9JA 2B2YC 3H3VC 1PRTB 1S4ZA 3NK9A 1HPCA 1KLUD 4TKOB 5CC4A 2A6HC 4C3IG 2NZ1D 4JK1C 3SK5A 2SEBD 4RCNA 2HCCA 4QF4A 2RVLA 3RZOB 4J6HA 5FO8B 1JCKB 5G3LD 4I65A 1SE2A 5LL6S 3PO2B 4RKBA 3K59A 2OF1A 1JORA 2QEJC 3VYUA 5C0XG 4ZUJA 4DAPA 3TBIB 2IX3A 2QCPX 1Q1EA 2A6ED 1D1IA 5TSSA 3GTQB 1E2VA 3GP7A 1B2TA 1B4OA 1TWCB 5J1ZA 3E5SA 4IFDI 2JEAI 2F0IA 1VDZA 1M8AA 3Q6SA 3BVMA 3D4WA 1FNVA 4OO1I 1SYCA 2CVRA 5IGEA 1G2TA 3RLFA 2EY2A 2DY8A 3TMEA 4PMCA 1BF4A 5EQ0A 3RMHA 1SEBD 4KI0A 2MUYA 2KOLA 4RAUC 2DY7A 3FVQA 1ML0D 1LTSD 1I4XA 2K03A 2F1MA 4HTHA 5C4JB 2F0VA 1WTQA 1D6EC 1LABA 3GTKB 5JPMC 1SYDA 3GO5A 1HUMA 5C44B 3T4AC 1U4PA 1PZID 1HA6A 4C3JB 2RA4A 1UNSA 4XYQA 2LY7A 5DM63 3HGBA 2KA7A 4C3JG 1X3QA 3JAME 4KTAA 1O7YA 2AQ2B 2R92B 4RHSA 1KLGD 5I9PA 3GTLB 1DD2A 2FMCA 3S15B 1STEA 2K1BA 5EGTA 4FVMA 3AMUA 3T56B 3ERQA 5IGGA 3BDLA 2M00A 1VCIA 1H9RA 2NB0A 1LT6D 1LT4D 2XWBB 3C3LA 1CZGA 4G7ZC 3CQZB 2QF7A 2AWOA 1PTOB 4ZQ3A 4BBRB 4ZKBB 3OWFA 1BCPD 5E1FA 2L5TA 5KYIA 2KHSA 3BDCA 1CT1D 2WKDA 1Q12A 3BDOA 1R4QB 4CJ0B 3KUPA 3DMUA 1RHPA 5EJWA 1TQOA 3OHXC 1EZ6A 1SJHD 2HCIA 1JWMD 1HA5A 1SNDA 4C56C 1TVXA 4R8NA 4KD3A 1HTPA 4IFDH 4EVOA 3R8BA 1ESFA 4OO1H 4HR7B 1A15A 1XTCD 3NHHA 2PQEA 4CKBA 1SNCA 1QNKA 1ET6A 4KY6A 3HEJA 3P1HA 1NR2A 1SJED 5FO7B 2YYZA 2NYZD 5EPKA 2F4IA 4ZLTF 3N6RA 4X3SA 5EPLA 4DNTB 3SEBA 1B50A 3QIAA 1BCPF 2KECA 3QG1A 1AZQA 5JVG3 4IUVA 1ILPA 1HHVA 1EWHA 3X3MA 3X3NA 3D6CA 2H4OA 3E6ZX 5DNFA 3H09A 2VB2X 3MEHA 1WTVA 3I4NB 2MPMA 1HXYD 5LHY1 1RODA 1X32A 2WP8J 2LFNA 4PV1C 3M4YA 2IPKD 1RKNA 1TWAB 1GUWA 3S2HB 3LWEA 1FNWA 3M3YB 3GV6A 4H0LC 1EY7A 2QDBA 3J80L 1YNND 5ELDA 5KNDA 1EIHA 3MXGA 4KKUA 2IW3A 2EY1A 3M4OB 1AP0A 2B2VC 4NP5A 4OHJA 4ABNA 3OPOA 3QWNA 4KY5A 5IT9E 1LT5D 3S16B 2B8FA 3VR6A 2QILA 3S17B 5C4HA 1EIGA 4KY7A 1DJRD 1GHJA 2TSSA 2RDHA 5CBEE 3D8GA 3P20A 4J1MA 3QB3A 4ZAIA 4CKCA 1A3UA 2FHTA 3KLSA 4RA8A 1STBA 4CBVA 4L6TB 5EKKA 4C1NK 4G4KA 3CKIB 2IX1A 1G291 1J8IA 3TP5A 2N55A 3L7ZC 4FXKC 4PMWA 3I90A 4FF2A 2JEBI 5KIXA 1LTBD 3WDNA 3L3OC 1QCBD 4QB4A 2LS01 4KK7A 3A8JE 2PO4A 4KJOA 2RSNA 1EEFD 2BA0A 1BO0A 3CU7A 1EFID 1NUCA 1QOHA 2VB3X 3BYTB 4K14A 5EBDA 4DU9A 1WD1A 4HAEA 1PTOH 3FPUB 1EY6A 5M5WB 4HSVA 1LTID 3MXUA 2L11A 3VA7A 5CYUA 3FDTA 3BYYB 2F0UA 2F0JA 4ULLA 4KHZA 5IGCA 3O13A 3ND9A 3EJIA 1F9RA 3S1QB 3N52A 4F8MA 2A69C 5M5YB 5JEAJ 1D2BA 4IUQA 2B2WC 1D5ZC 1SE4A 2WACA 4HSPA 5D14A 1PRTC 1TY2A 2X6LA 2F0HA 1WCMB 1II3A 2CQAA 4A3FB 4DNRB 4A93B 1MBYA 2K28A 2OT2A 1LTTD 4KHVA 4KJNA 3OOCA 2BCOA 5CV6A 1B53A 5CV9A 1L0XB 1F9PA 4A3EB 2RSOA 5IT9L 3W3AA 1TS3A 4G57A 3NTKA 4EQNA 1KABA 2IWHA 2PCFB 2JA8B 5A35A 2MJ8A 2EJMA 2K5WA 3C46A 3TZDA 1STAA 4PNYA 2K5DA 4QMGA 5JJZA 3V2TA 5JVH3 3IFTA 2A74C 4XIGS 3SXHA 4AYBB 3BVZA 1LT3D 3H0GB 5CMDA 1IYVA 2B2VA 3HG9A 1CFMA 2ICIA 3KBXA 2HDLA 1ZYRC 3SK4A 2EYMA 3VYTA 1JC7A 1F77A 1SNQA 4LK1C 3TZUA 2LKVA 4YIJA 2NVTB 2DNEA 2V4DA 2YU9B 1I50B 2E2HB 4XQQA 2F0LA 2M9VA 2L1BA 2IL8A 4QIWB 4OIJA 3Q22A 1STNA 5IGBA 2EY6A 1CA5A 2NN6I 4DFAA 5JEAH 1BR9A 4K2LA 1XX8A 4DAYA 4IFDG 4HMIA 2WV6D 3TN2A 5E4XA 5FOBB 4OO1G 4ZYSA 1ZEQX 2DN8A 5C5LA 3BVGA 1SAPA 1KTKA 2KEEA 3A8IE 4HN7A 2LMCB 3H91A 3T53B 1AEXA 1PTOD 2WAQB 4S3SA 4FP5D 1K8MA 1TS4A 1BOSA 1U9RA 1O7LA 4DK0A 3MXNA 4V0BA 1H9KA 4BBSB 3K58A 5ELBA 1V43A 3L9AX 4X3UA 3S2DB 4B9XA 3AB9A 3C1EA 2Q8RE 5BN5A 3PO3B 1DOLA 1VMPA 1HFGA 2B2WA 2R6GA 3DWAA 1L0YB 5CORA 1CHQD 1JB3A 4K5WA 2A6EC 2K5QA 1H9SB 3PV0A 4RFBA 4XYOA 3MFYA 5AFWA 3KF8A 1PYWD 3S1NB 4A3JB 4IALA 5I6WA 1EZ8A 2Z4IA 3D6WA 3MTSA 3DWQA 3Q24A 1ZXTA 3NTIA 1Y8OB 2IT1A 3M7NA 1XWEA 1PTOF 1MI2A 1SXTA 2AWNA 2IX0A 4A3MB 2F0OA 5I2YA 1AZPA 4RH6A 2XRQD 3HOUB 3CRLC 3NQIA 1PFMA 5KYLA 2EZVA 4IUUA 4HMJA 1HQMC 1OXSC 5HGTA 1GUGA 4XT3B 4IUTA 1I4QA 2EYHA 3HOVB 2D62A 2NN6H 1DOKA 4WRDA 2FINB 1E0BA 2K01A 5CV5A 4X3KA 4BWGB 2NVXB 4BA1I 3GQBA 2F0QA 4O42A 4DF7A 2EYPA 4K6DA 3WOEA 2L55A 2KCNA 4UAIA 5C0XJ 3I4LA 5C3WA 1UUPA 1B9MA 1Y1VB 2MP1A 3J80E 1BCPC 3VR2A 2X69A 2ZT9C 3ITPA 5D3DA 1SMYD 1RDPD 4TRDA 1LTGD 4H44C 3IFDA 3PUVA 1Z6HA 4HEDA 2PPBC 1I6HB 1AW7A 2K05A 3C2PA 3EA6A 1STHA 2A5HA 2QKIC 3MHBA 4K8IA 1G91A 4BS9A 2AUKA 3NSWA 1EU3A 3FMCA 1U4RA 5C4ZA 3F2UA 1F2LA 5K36H 2B2YA 3HKZB 2D9UA 3U9SA 2F3WA 2E75C 1STYA 1PZKD 2NUCA 2O4XA 1PLFA 3FKIB 2MGSA 1RD9D 4Q0FA 3M7GA 3EVQA 3HOWB 2EDGA 3OIPA 2PNRC 5T1IA 2O5JC 3D4DA 4EGVA 1EEID 2EE1A 1CZWA 4EQPA 2WB1B 1CI3M 2BDNA 1GUOA 3GTPB 4ODGA 1IHZA 3S1RB 1V1OA 3QOJA 2XN9C 1NCVA 2PZWA 3KK7A 1QILA 5J22A 1IL8A 5FK9C 1WTRA 3OMCA 1PZJD 3K5LA 2SNMA 3URYA 1NR4A 3VYRA 4E6IA 2F0MA 1YNNC 4C2MB 3BS1A 3EROA 3NTHA 3MVVA 5IODA 3VA5A 3VYSA 4LAAA 1GHKA 2AQ1B 1Q1BA 1LV9A 2PW5A 1F2MA 1GUSA 1TWGB 3OWEB 1GJXA 1IW7D 4X3TA 3TP7A 3VR4A 4HCEA 3QOLA 3V96A 1F9SA 5C3XA 1ESRA 1JWUD 2WKCA 3OW7A 3HP3A 2CHBD 1I6VC 5JEAG 5C6AA 3IL8A 5FLXE 4UDUC 1RTNA 1WTOA 3J81L 3SDZA 1LTRD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PIP 3;  4WFN 3;  5JVG 3;  5JVH 3;  5DM6 3;  3PIO 3;  4U67 3;  5DM7 3; 
#chains in the Genus database with same CATH topology
 5ISR A;  1KC8 C;  4QUC A;  4LUO A;  2OCE A;  4LF9 L;  1A3V A;  1I4R A;  1V1P A;  4GN4 B;  1TS2 A;  2Z9H A;  1EYC A;  1NNX A;  2CW0 D;  4POG A;  2R3Z A;  5IP9 G;  1NJI C;  3PGZ A;  2JE6 I;  1E3P A;  4LWC A;  4A3C G;  3M85 A;  2EOT A;  4LFB Q;  3RD4 A;  2NVX H;  2EIF A;  3E3X A;  4Q5V A;  3R2I A;  1BBX C;  1EQT A;  1HNX L;  2KQ3 A;  1EQQ A;  3S1M B;  1QWY A;  2M2L A;  4CKE A;  1CTM A;  1NSN S;  2R7F A;  3H94 A;  4DGZ A;  1S5D D;  1X3E A;  2JA9 A;  5C5M A;  4KD4 A;  3AFQ A;  4WFN 3;  1C0A A;  1WTP A;  1GUN A;  2K50 A;  2RCN A;  1D1K A;  1G6Z A;  1QUQ A;  1ENF A;  1Y1V H;  2BDO A;  1LAC A;  2ICE C;  3NXW A;  1UE5 A;  4NXN L;  1RJT A;  3A0J A;  1EY9 A;  2C35 B;  2NVY B;  4B3M Q;  1DZ1 A;  4DNI A;  4DR4 Q;  4UP9 A;  2UXD L;  3UE1 A;  3STB C;  1DGS A;  4QUF A;  5A2Q L;  2XTI A;  1BVS A;  5M9O A;  4RGT A;  5I2X A;  1BXT A;  2IJ0 A;  4O1N A;  4XXE A;  4HCS A;  1TU2 B;  4JI4 L;  3L0O A;  4APV A;  3PF5 A;  5L37 A;  4H02 A;  1QZG A;  3H3V H;  2K75 A;  4N8F A;  1PA6 A;  1EL0 A;  2TMP A;  1W6J A;  1L0W A;  2XRS D;  2HT1 A;  5DAU A;  1E2Z A;  5GQO A;  4KMU C;  4Y7N B;  3I8Z A;  4A3K B;  2Q8T A;  1BDO A;  4PQX A;  4CDE C;  1MHW C;  1WCM G;  4MNO A;  1EYD A;  2Z1C A;  3CD6 A;  1SSO A;  2F0W A;  4A3K G;  4LFA L;  4ZKC B;  1TWF B;  4A93 G;  2K7V A;  4PG3 A;  2AHO B;  1GOZ A;  4R4O A;  3IKJ A;  2H5X A;  3D31 A;  4YCW A;  3UDX A;  2K33 A;  4NW2 A;  1CM9 A;  2D0P A;  1YIT A;  1O7I A;  4JW0 A;  4Z9C B;  5FLX L;  3FRP B;  4HIM A;  2OEO A;  2NN6 G;  3KLS X;  4ME5 A;  2Q2U A;  3GTP H;  3CC2 A;  2VNU D;  3NEL A;  1B44 D;  2JA8 G;  3MC0 B;  5IYC G;  4L63 B;  2XWJ B;  3S14 B;  1SE3 A;  1M4V A;  1QE6 A;  4KN4 C;  4LF6 Q;  4L8J A;  1B9N A;  1B3A A;  4LFB L;  3EIV A;  2F0T A;  4U67 3;  1Y69 U;  1Q8K A;  1T5E A;  3K57 A;  3TS2 A;  2VUM B;  3I4O A;  4AYB G;  4C3H B;  2UUB L;  4LFC Q;  3FHW A;  4X64 Q;  1TXY A;  3M4P A;  4C3H G;  4DV4 Q;  2VW9 A;  1FR3 A;  3JAM i;  4FNF A;  1O80 A;  1IYU A;  2E2J B;  4QGU A;  2BE5 C;  4DXF A;  4WJW A;  4P2C B;  2O2L D;  3TRE A;  1X3P A;  1K8G A;  1DYQ A;  2NWG A;  2EPB A;  2BE5 D;  4DV6 Q;  1FNU A;  4B3M L;  3HOX B;  5ELE A;  3UDF A;  5KRU A;  4DR4 L;  4MIU A;  3PUW A;  3PMF A;  3ND8 A;  3TSS A;  5FO9 B;  2F0P A;  3HOX G;  1F2Z A;  4DAV A;  4PZ8 A;  3AYH B;  3Q8D A;  5IP7 G;  5E4W C;  4TSS A;  4GNX B;  4DAY B;  1BBW A;  1LLR D;  1HFN A;  1YBY A;  4FXG C;  3GTJ B;  1R4P B;  1C48 A;  1AN8 A;  1OXV A;  4N9P A;  5CV7 A;  5K36 G;  1BQQ T;  2IHF A;  1YNJ C;  1KAW A;  3I4M B;  1HQR D;  3NWT A;  3RZD B;  1UEA B;  2JP1 A;  3R2T A;  1KRT A;  4RGN A;  2JYO A;  1SFO B;  4UP7 A;  1YNJ D;  3GTO B;  3I4M G;  2P5Z X;  2SOB A;  1X54 A;  4RWS C;  5AJ3 Q;  4MHE A;  1CA6 A;  3SK8 A;  1LTA D;  4BY1 H;  4DR3 Q;  3NP8 A;  2RHS B;  1FD7 D;  1A63 A;  1EY5 A;  4RCO A;  4JPB W;  2RQX A;  1YZ6 A;  3NUC A;  3A54 A;  1PTO C;  3E0J A;  1HZB A;  2FXQ A;  4DV2 Q;  1CKN A;  3U4Z A;  3LNN A;  1ONL A;  2R61 A;  3NPP A;  3K5M A;  1M90 C;  2H1E A;  1KXL A;  3MXN B;  2KJX A;  1E7Z A;  3A7L A;  3H6M A;  1RTO A;  4CDC C;  1PXU A;  4JC0 A;  2NVQ H;  2ZXR A;  4K8J A;  4CJ2 C;  1ZKO A;  2R7Z H;  3MWY W;  4A3D H;  4K0K Q;  4ZCK A;  4OWW B;  5JAV A;  2PZT A;  1S5F D;  1FGB D;  3I72 A;  1VQG A;  3BG3 A;  3PIO 3;  1KHI A;  1PH5 A;  2DJF C;  3J7A V;  3S1M H;  2E5L Q;  4OWX B;  1N32 Q;  2GN5 A;  1B7Y B;  2CWP A;  3SE0 A;  4C3I B;  2GVA A;  4A3B H;  2Q2I A;  3I3C A;  2F3V A;  1V8Q A;  4K5X A;  3F2B A;  4LF6 L;  1X3G A;  4IZ8 A;  2A6H D;  5T1G A;  3KLW A;  4DV5 Q;  4OXP A;  3J7A F;  1OXT A;  2QA4 A;  4DK3 C;  1DM0 B;  1HRJ A;  2G9H D;  2OQ0 A;  4LFC L;  2A73 B;  1UAP A;  2SNS A;  4X64 L;  2RDF A;  2XNA C;  5I4D A;  2J7Z A;  4DV4 L;  2NBF A;  4I7Z C;  3D0F A;  1VQD A;  1KNE A;  2VQF Q;  1VQN A;  3K5O A;  2F0S A;  1PDQ A;  2F52 A;  3Q0A A;  1CK1 A;  3DEO A;  2KEN A;  4R9W A;  2UXC Q;  2BA1 A;  1VQ4 A;  3HOZ B;  1GO3 E;  2EJF C;  4DV6 L;  4MN3 A;  5KEE A;  1H9S A;  1LO5 D;  1DON A;  1S72 A;  1GXD C;  3I2Z A;  3HOZ G;  2J4X A;  1IKL A;  1VF7 A;  2AQ3 B;  2DUD A;  4JOI A;  1KDB A;  3FPP A;  4IQZ A;  4H13 C;  3G71 A;  4OIK A;  4IFD J;  1LUZ A;  2ASB A;  4Y7N H;  1I4G A;  4QCL A;  1VMC A;  3S9W A;  1K83 H;  4A3M G;  5IGD A;  3ONA B;  4A3I B;  3J7Y W;  1I3Q H;  3MEF A;  1RF2 D;  3EBE A;  2AMC B;  4A3I G;  3M9B A;  3DWP A;  4OEM B;  4F88 A;  5IIF A;  2K4K A;  1B3Q A;  4GOP B;  5GAH C;  4A3L H;  1AE2 A;  2K04 A;  5AJ3 L;  3W2D A;  4IUN A;  4F7X A;  1S5C D;  5HUR A;  4DR3 L;  4DR1 Q;  4L5T A;  4DV7 Q;  4OWT B;  5BN4 A;  1IXR A;  1JOQ A;  5C4X B;  1BUV T;  3OMG A;  5DM7 3;  2OXP A;  2JA7 H;  2B39 A;  4IPC A;  2A68 C;  1S5E D;  1JOK A;  4DV2 L;  2MFI A;  1A2T A;  2K14 A;  2A68 D;  1QJO A;  5G3L F;  3A55 A;  3CCS A;  1JOO A;  2KUM A;  3S14 H;  2EY5 A;  3DHQ A;  3OSO A;  4DK1 A;  5C0X I;  4RGO S;  5CV4 A;  4G7H C;  2Y0S E;  2RF4 A;  1JE4 A;  1EIY B;  4JI6 Q;  3AQQ A;  4H7B A;  2JJQ A;  4K0K L;  5KNB A;  3GTG H;  2Q2H A;  2F0K A;  3FEW X;  1YJN A;  1SMY C;  3DUZ A;  4KKS A;  2CFM A;  2VUM H;  3BZD B;  1N32 L;  2E5L L;  4NMZ A;  4XTC S;  2F0N A;  2R93 H;  1VQK A;  3PIO A;  2PQA B;  5FKA C;  1Y1V G;  1Y1W H;  3K7A B;  3K6O A;  1PH9 A;  2C5C A;  2DNC A;  1XPR A;  4X62 Q;  1JJC B;  4MTK A;  2C9O A;  3RLO A;  5GAG C;  5GAD C;  2EYF A;  2PMZ B;  2N78 A;  2HQE A;  5DLQ E;  1BNZ A;  3P7J A;  5M3F H;  4DV5 L;  2E74 C;  4R8I A;  3PUY A;  3GTM B;  4N8X 1;  1BBU A;  3NBI A;  4AH6 A;  2ZJP A;  2F0D A;  3HZX A;  1J9O A;  1ENA A;  3UDI A;  4XQN A;  5I6Y A;  2K5V A;  3J81 E;  2VQF L;  5EPJ A;  1L1O C;  3CC7 A;  3CCE A;  2UXC L;  3G7L A;  2OTL A;  3QJY A;  4DN4 M;  5K5P A;  2E76 C;  2Z8L A;  4DK6 C;  5DEH A;  3MFG A;  2RDG A;  5M3M B;  1U4M A;  2PI2 A;  5IT9 c;  1ICF B;  1Q3L A;  5CGK A;  2F0E A;  3HKZ G;  1EQR A;  1ILQ A;  1A3T A;  2JSO A;  3I55 A;  3SR1 A;  2K5H A;  1SFO H;  1DXM A;  3GTO H;  1A6X A;  4OL7 A;  4BXX H;  2I07 B;  2B63 B;  1HZ9 A;  3CHB D;  1ASY A;  2B2U C;  4ILW A;  4CJ1 B;  1WTW A;  1MSH A;  1N8R C;  3DM1 A;  3IRB A;  1JE5 A;  1ICW A;  1EIF A;  3D4R A;  3HOY H;  4OGQ C;  2HQL A;  4DR1 L;  1MD2 D;  4DV7 L;  4HJ7 A;  4G7O C;  3T13 A;  2JXM B;  4ID6 A;  3U9O A;  1SNP A;  2JA6 B;  2PNH A;  1STG A;  1HTL D;  2EVB A;  3BZC A;  5C3E H;  1Y8N B;  2NTS A;  2Z6B A;  5JJK A;  2WII B;  5D3I B;  4KKT A;  4DA2 A;  1CUK A;  1KAA A;  1UE6 A;  4K5V A;  4ME3 A;  5A2Q E;  4J15 A;  1EOT A;  4C3I H;  2MNA A;  1KQS A;  3NWS A;  3TEH B;  3ZYY X;  2E2D C;  3ULP A;  4L5S A;  1TR5 A;  1YJW A;  5LL6 X;  2YTY A;  1TII D;  4JI6 L;  2B29 A;  4L5Q A;  1SYF A;  2HDM A;  1SYB A;  4LF8 Q;  3JAM L;  3TS0 A;  3RZO H;  1Z7T A;  3RUZ A;  5IOC A;  3CP0 A;  4A3G B;  5HGQ A;  1XXG A;  3I73 A;  4RG1 A;  2J0T D;  5C0X H;  4FF3 A;  3PO2 H;  2Q8I B;  5ELF A;  1HR0 Q;  3NE5 B;  4IO9 A;  3A8K E;  1PMR A;  1OXU A;  4X62 L;  1FL0 A;  1IBK Q;  2AUJ D;  5EKI A;  1YHB A;  1EWC A;  1QG7 A;  4JV5 Q;  2K32 A;  3CCQ A;  3K5N A;  1KNA A;  3I70 A;  2KVM A;  2G9D A;  3NQT A;  1IW7 C;  3V05 A;  1YHQ A;  1PH8 A;  3MAQ A;  2B2T C;  1QNU A;  2HHH Q;  3GTQ H;  2XSC A;  4JI2 Q;  4GLV B;  3CCR A;  4FYD A;  4M1U B;  1VQE A;  3ER0 A;  3RN5 A;  4N9T A;  4IN3 A;  3F2D A;  5IWA Q;  1O78 A;  4DPG A;  2OTJ A;  1SBB B;  3KF6 A;  1VQA A;  1U4L A;  3PUX A;  2ZXP A;  4BY1 B;  4C1N I;  4B9W A;  2L4N A;  3CCM A;  3R3O A;  1FYC A;  2GA4 B;  1Z47 A;  1VQH A;  1V1P B;  3NBH A;  2EYO A;  1EYA A;  5GRO A;  5M5X B;  1A62 A;  4BY1 G;  2VY3 A;  1BCP B;  2A8V A;  2EJG C;  5EKL A;  2KED A;  1VQP A;  2YV5 A;  1IBL Q;  4DXG A;  2XIW A;  2I46 A;  2CW0 C;  2K6A A;  1IBM Q;  1VS0 A;  3T51 B;  1VQO A;  1HUN A;  5IGF A;  1CHP D;  5C4J H;  4J8Q A;  1JQY D;  5C4X H;  4JBK A;  3MXP A;  2NVQ B;  3GTK H;  1JR0 D;  2R7Z B;  2MHV A;  4GS3 A;  4A3D B;  3SK6 A;  4RMF A;  1KDC A;  1TT2 A;  1EY0 A;  3Q23 A;  4C3J H;  2R7Z G;  2NTT A;  4A3D G;  4V19 0;  4AIM A;  5BN3 A;  2UUB Q;  2F03 A;  1E1T A;  1EQV A;  4OON A;  1B1Z A;  4A3B B;  3IAY A;  1X55 A;  2ZXO A;  4FDB A;  3MA2 B;  4GNX C;  2UXB Q;  1HCZ A;  4F87 A;  2L0C A;  2R7D A;  4RHR A;  2R92 H;  3QR8 A;  4A3B G;  4LJZ C;  1K28 A;  1EU4 A;  3K0Y A;  3KBG A;  1L1O A;  1SYE A;  3SVM A;  1C4Q A;  1U5K A;  1N9W A;  4TQU S;  2BOS A;  2YTV A;  1Q8I A;  1P16 A;  3K7A H;  3WWV A;  4NKL A;  1I4P A;  3LX0 A;  1QVG A;  3QO2 A;  4L5R C;  3SHL A;  4WOR A;  1D5M C;  3AU7 A;  1JIC A;  4K6L A;  3W1G A;  1D7Q A;  3A56 A;  1XYI A;  1WJJ A;  1PFN A;  2L9H A;  4B08 A;  4LF8 L;  1G2S A;  3GD7 A;  1PH4 A;  4ZUI A;  2FFK B;  3GTM H;  2F4V Q;  1IKM A;  1SDF A;  3UDG A;  1SN8 A;  1ET9 A;  1GKH A;  3EFX D;  3TP6 A;  4K2K A;  2PW7 A;  1HR0 L;  3PUZ A;  5E3F A;  1T5X D;  5F2D A;  1DCZ A;  3PCO B;  5KNC A;  1IBK L;  4TVA B;  2B2U A;  1WI5 A;  4EQO A;  2EYL A;  4CGY B;  4DR5 Q;  4JV5 L;  3UI2 A;  4FXD A;  3HS0 C;  1SYG A;  2V1C C;  1CQV A;  2X6G A;  3I7F A;  3K81 C;  1E2W A;  1GUT A;  4JI3 Q;  3TDQ A;  2HHH L;  4GZY C;  3I91 A;  5M3M H;  1I4H A;  3KDF A;  1K83 B;  1YI2 A;  4JI2 L;  5D65 A;  1S40 A;  1PFS A;  3CAM A;  2A69 D;  2IY5 B;  1I3Q B;  2EYJ A;  2BH8 A;  5J39 A;  1WVL A;  2CH4 W;  2KCM A;  5ELC A;  5IWA L;  4M8A A;  1ENC A;  4XDX A;  4I7A A;  4FF4 A;  1EY8 A;  1JWS D;  2ZTC A;  3VR5 A;  1PRT D;  3NEM A;  1KDA A;  2B63 H;  4CHT B;  1WTX A;  1DOM A;  1PYB A;  3BU2 A;  4BY7 B;  1H9M A;  5CBA E;  4U68 A;  4A3L G;  1TKW B;  2F0F A;  2JA7 B;  1FJG Q;  5LMN W;  1IBL L;  4DUZ Q;  3P75 A;  1K8O A;  1IBM L;  1NY4 A;  2JA7 G;  2KCC A;  1O7Z A;  5COY A;  2VXW A;  3RR5 A;  4KN7 C;  2PZU A;  2N88 A;  1SNM A;  5IYB H;  2PYK A;  1RCV D;  1H95 A;  5ELN A;  5FJ8 H;  2JA6 H;  4ZK9 B;  1CQF A;  3GV3 A;  3MZ5 A;  1D5X C;  2F0G A;  3TP8 A;  2ATW A;  1VQM A;  3FP9 A;  3GTG B;  2HIX A;  5GAE C;  3LWU A;  2JA5 B;  1VF5 C;  3D3R A;  4O2D A;  3K80 C;  5CV8 A;  2B2T A;  2D0O A;  4NDX A;  2RKS A;  4OX9 Q;  2R93 B;  1B70 B;  1Y1W B;  2VUM G;  4XQJ A;  4NPS A;  2ID0 A;  3HRZ C;  3T16 A;  2UXB L;  1PFB A;  2R93 G;  4JBW A;  5KGU A;  1Y1W G;  1EY4 A;  2O5I C;  3PF4 A;  3AFP A;  1TS5 A;  3EQL C;  5M3F B;  1C8C A;  1G8Z D;  4GKJ Q;  2RBM A;  3J7Z C;  5I9O A;  4A3G H;  5M3F G;  3I4N H;  3CMA A;  1VQ6 A;  2E2I B;  1X3F A;  3JC6 6;  2L12 A;  1F2Y A;  2QGQ A;  4GOP C;  5EBC A;  3PIP 3;  1YHA A;  1XPU A;  3E0E A;  4FO2 A;  1VQ8 A;  1WYD A;  2EXZ A;  2ENB A;  4HJA A;  1PRT F;  1VQF A;  1MSG A;  2FJ2 A;  5NUC A;  3A7A B;  1R9T B;  2F4V L;  4HJ5 A;  3J81 j;  3G6J B;  2FMM A;  2D2C C;  4FF1 A;  1TWA H;  1ZYR D;  3S2H H;  1SNO A;  3J80 i;  3M3Y H;  3A5U A;  1WD0 A;  3OIQ A;  1NAP A;  4DR5 L;  2WIN B;  4IUR A;  4LMQ D;  2SDF A;  1VQL A;  1Q90 A;  1OO9 B;  1BKB A;  4RKL A;  4JI3 L;  1X56 A;  3GDE A;  2B8G A;  1YNX A;  2XVS A;  1J6Q A;  1OXX K;  1J5E Q;  3M4O H;  2LXK A;  2Z4H A;  5JJL A;  4CDF C;  3CRK C;  2ZM6 Q;  1CKN B;  3E9H A;  4XT1 B;  1QB5 D;  4RGM A;  4BXX G;  1F9Q A;  5M5X H;  3C1F A;  4JI5 Q;  1TWH B;  3DEP A;  1A2U A;  4GNX A;  3S16 H;  1MGS A;  4PMB A;  5JPN C;  1RIP A;  3WOF A;  1PV4 A;  2CWA A;  4B3S Q;  3HOY B;  1TY0 A;  1JJG A;  2QEX A;  4BA2 I;  5JOB A;  3R93 A;  1HNW Q;  1Y8P B;  1W6K A;  4KV6 A;  4IUP A;  1SE8 A;  2HUG A;  3VR3 A;  2D5D A;  3HOY G;  2Y0S B;  1SRU A;  2ZJR A;  4ZRZ A;  1FJG L;  5C3E B;  3KLR A;  1S5B D;  3DXJ C;  4DUZ L;  5CR3 A;  2Y0S G;  2ALY B;  1AFP A;  1H9J A;  5C3E G;  4DV3 Q;  2B2Y C;  1K0S A;  3SGI A;  3H3V C;  1PRT B;  1S4Z A;  3NK9 A;  4DR2 Q;  1HPC A;  1KLU D;  1SLJ A;  4TKO B;  2A6H C;  5CC4 A;  1RL2 A;  4C3I G;  1VQB A;  2NZ1 D;  4JK1 C;  3KF8 B;  3SK5 A;  2SEB D;  3J80 c;  4RCN A;  2HCC A;  1NMF A;  4QF4 A;  1VQC A;  2RVL A;  3RZO B;  4OX9 L;  1JCK B;  4J6H A;  5FO8 B;  5G3L D;  4I65 A;  1SE2 A;  5LL6 S;  3PO2 B;  4RKB A;  2NZH A;  3K59 A;  2OF1 A;  1JOR A;  2QEJ C;  3VYU A;  5C0X G;  1PHJ A;  4ZUJ A;  3PO2 G;  4DAP A;  2CKZ B;  3TBI B;  2IX3 A;  4DR7 Q;  4GKJ L;  2QCP X;  5HY6 A;  1Q1E A;  2A6E D;  1D1I A;  4P75 A;  5TSS A;  3GTQ B;  1XMQ Q;  1VQ9 A;  5M5W H;  1E2V A;  3GP7 A;  1B2T A;  1B4O A;  1TWC B;  5J1Z A;  3E5S A;  4IFD I;  2JEA I;  3J81 c;  2F0I A;  3ICE A;  1VDZ A;  1KIX A;  1M8A A;  3Q6S A;  3BVM A;  3D4W A;  3PIP A;  2EXD A;  1FNV A;  4OO1 I;  1SYC A;  2CVR A;  5IGE A;  1G2T A;  3RLF A;  4POF A;  4B3R Q;  2EY2 A;  2DY8 A;  4P71 A;  1XNR Q;  3TME A;  4KHP Q;  4PMC A;  1QVC A;  1BF4 A;  4EQ5 A;  3KOJ A;  5EQ0 A;  3BZK A;  3RMH A;  1SEB D;  4KI0 A;  2MUY A;  2CH4 A;  3UE0 A;  2KOL A;  4RAU C;  3K0X A;  2DY7 A;  3FVQ A;  1ML0 D;  1LTS D;  1J5E L;  1WOC A;  3G4S A;  4A3F H;  1I4X A;  3CF5 A;  2K03 A;  4R4I A;  2ZM6 L;  2F1M A;  1VQ7 A;  4BY7 H;  1EOV A;  4HTH A;  5C4J B;  4YHH Q;  2F0V A;  4JI5 L;  1WTQ A;  1Q7Y C;  1D6E C;  1LAB A;  3GTK B;  3KFU A;  5JPM C;  4B3T Q;  1SYD A;  3GO5 A;  1HUM A;  5C44 B;  5C4X G;  2I5L X;  1Q82 C;  4A3E H;  3T4A C;  3CCL A;  3M4Q A;  1PH7 A;  1U4P A;  1PZI D;  4B3S L;  4IOA A;  1HA6 A;  4C3J B;  2RA4 A;  1HNW L;  1UNS A;  4XYQ A;  2MO1 A;  2LY7 A;  5DM6 3;  3HGB A;  2KA7 A;  4C3J G;  1X3Q A;  3JAM E;  4KTA A;  2XGT A;  4GOP A;  1O7Y A;  2AQ2 B;  2R92 B;  4RHS A;  1KLG D;  5I9P A;  3GTL B;  1DD2 A;  2JA5 H;  2FMC A;  3S15 B;  1D8L A;  1STE A;  4DV3 L;  2R92 G;  2K1B A;  5EGT A;  5BR8 Q;  1JMC A;  4FVM A;  3AMU A;  5IE8 A;  4YCV A;  2WAQ E;  3T56 B;  4DR2 L;  3ERQ A;  5IGG A;  1K8A C;  3BDL A;  5LMU Q;  2M00 A;  1VCI A;  1H9R A;  2NB0 A;  1LT6 D;  1LT4 D;  2XWB B;  3C3L A;  3ZJY C;  1CZG A;  2ZTD A;  4G7Z C;  1XNQ Q;  3CQZ B;  2QF7 A;  2AWO A;  3H0G H;  1PTO B;  4ZQ3 A;  2E2I H;  4BBR B;  4ZKB B;  3S24 A;  2I5M X;  3OWF A;  1BCP D;  4IPH A;  5E1F A;  2L5T A;  5KYI A;  2KHS A;  3BDC A;  3CCJ A;  1CT1 D;  2WKD A;  3I56 A;  4AQY Q;  4DR7 L;  4A76 A;  1R9T H;  1LM0 A;  1Q12 A;  1R4Q B;  3BDO A;  4CJ0 B;  3KUP A;  3DMU A;  1RHP A;  1XMQ L;  5EJW A;  2NVT H;  1TQO A;  2YU9 H;  2NZO A;  3OHX C;  1I50 H;  3L2P A;  1EZ6 A;  2E2H H;  1XJV A;  1SJH D;  2HCI A;  1JWM D;  5M3M G;  1HA5 A;  1SND A;  4C56 C;  2K5N A;  1TVX A;  5FLX c;  4B3R L;  1XNR L;  3G48 A;  4R8N A;  1WFQ A;  2MO0 A;  1S3O A;  4DV1 Q;  4KD3 A;  4KHP L;  1PYS B;  1HTP A;  4IFD H;  4EVO A;  2QDL A;  3R8B A;  2B63 G;  1TWH H;  1ESF A;  4KLK A;  4OO1 H;  2DJG C;  1A15 A;  1XTC D;  3NHH A;  4HR7 B;  2PQE A;  4CKB A;  1SNC A;  1QNK A;  1ET6 A;  4KY6 A;  3HEJ A;  1N36 Q;  1NE3 A;  1Q46 A;  1YIJ A;  3P1H A;  1NR2 A;  1SJE D;  4YHH L;  3TRZ A;  5FO7 B;  2YYZ A;  5LMN Q;  2NYZ D;  4B3T L;  5IYB G;  5EPK A;  3DLL A;  1HZC A;  5FJ8 G;  2JA6 G;  1GD7 A;  2F4I A;  4ZLT F;  1K9M C;  3N6R A;  1E1O A;  4X3S A;  5EPL A;  4DNT B;  3SEB A;  1B50 A;  2MQH A;  1G51 A;  3QIA A;  1BCP F;  1C7Y A;  2KEC A;  3QG1 A;  3DM3 A;  1AZQ A;  5JVG 3;  4IPD A;  4IUV A;  1ILP A;  4YY3 Q;  4HJ8 A;  1HHV A;  1EWH A;  3X3M A;  4BBS H;  3X3N A;  1UE1 A;  3D6C A;  1FGU A;  5BR8 L;  1IZ6 A;  2H4O A;  3E6Z X;  1KD1 C;  3S2D H;  5DNF A;  3H09 A;  4P73 A;  5FLM H;  2VB2 X;  3MEH A;  2N8N A;  1WTV A;  3I4N B;  3PO3 H;  5LMU L;  1X6O A;  2MPM A;  1HXY D;  5LHY 1;  1ROD A;  4A75 A;  4A3G G;  3I4N G;  1X32 A;  2WFW A;  2WP8 J;  2LFN A;  2KHI A;  4PV1 C;  3M4Y A;  2IPK D;  1RKN A;  1A0I A;  1PVO A;  1XNQ L;  1W3S A;  1UWV A;  1TWA B;  1GUW A;  1KL9 A;  3S2H B;  3LWE A;  4DKA C;  1FNW A;  3M3Y B;  1TWC H;  4QQB X;  2HD3 A;  3GV6 A;  4H0L C;  3S1N H;  1Q86 C;  3KF6 B;  4IJH A;  4A3J H;  1EY7 A;  2QDB A;  4IJL A;  3J80 L;  1YNN D;  2LXJ A;  4AQY L;  5ELD A;  5KND A;  1EIH A;  3MXG A;  3F1Z A;  2UUA Q;  2PI2 E;  1UE7 A;  4MZ9 A;  4KKU A;  2IW3 A;  2EY1 A;  3M4O B;  3PSI A;  1AP0 A;  1YVC A;  2B2V C;  4NP5 A;  4OHJ A;  3EN2 A;  4ABN A;  5JJI A;  2UU9 Q;  3OPO A;  3QWN A;  4KY5 A;  5IT9 E;  1LT5 D;  4LUV A;  3S16 B;  2B8F A;  2RCF A;  3VR6 A;  4X65 Q;  3ERS X;  2QIL A;  3S17 B;  1EIG A;  5C4H A;  4KY7 A;  1C9O A;  4DV1 L;  1DJR D;  1GHJ A;  3PQI A;  2TSS A;  2RDH A;  5CBE E;  3D8G A;  3P20 A;  4MTN A;  4J1M A;  3HOU H;  3QB3 A;  4ZAI A;  4CKC A;  3K8A A;  1A3U A;  4EX5 A;  2FHT A;  1QZH A;  3F2C A;  4JI7 Q;  3KLS A;  4RA8 A;  2E8G A;  1STB A;  4YCU A;  5C44 H;  4LF7 Q;  4CBV A;  2AKW B;  4L6T B;  5EKK A;  3RLN A;  4CDD C;  3HOV H;  1N36 L;  4C1N K;  4G4K A;  4X66 Q;  4JCV E;  1CSQ A;  3CW2 C;  3CKI B;  1QUQ B;  2IX1 A;  1G29 1;  1J8I A;  1L1O B;  3TP5 A;  2N55 A;  5LMN L;  3L7Z C;  4FXK C;  4DUY Q;  4PMW A;  4JI1 Q;  3I90 A;  4FF2 A;  2JEB I;  3GTL H;  4JBJ A;  5KIX A;  5IYD G;  1X9N A;  2WB1 E;  3S15 H;  1LTB D;  3WDN A;  1HNZ Q;  3L3O C;  4HJ9 A;  1QCB D;  2YTX A;  1E22 A;  5ELO A;  4QB4 A;  2LS0 1;  1OTC A;  4JVZ A;  4KK7 A;  4GLX A;  3A8J E;  2UUC Q;  2PO4 A;  4KJO A;  2RSN A;  1EEF D;  2DGY A;  2BA0 A;  3CCU A;  3U58 A;  1BO0 A;  3RN2 A;  3CU7 A;  1B8A A;  1Z9F A;  4YY3 L;  4LF4 Q;  1EFI D;  1NUC A;  1QOH A;  2VB3 X;  1AE3 A;  1EFW A;  3BYT B;  4K14 A;  4R1J A;  5EBD A;  4DU9 A;  1WD1 A;  3CQZ H;  4HAE A;  1PTO H;  3FPU B;  4O0A A;  4BBR H;  1EY6 A;  5M5W B;  4HSV A;  1LTI D;  3MXU A;  2L11 A;  3VA7 A;  1K3B C;  5CYU A;  3FDT A;  1ASZ A;  3BYY B;  2F0U A;  2F0J A;  4ULL A;  4KHZ A;  5IGC A;  3O13 A;  4YWL A;  3KDF B;  1G6P A;  3ND9 A;  3EJI A;  1F9R A;  3STB D;  3S1Q B;  3N52 A;  2Z6K C;  4F8M A;  2A69 C;  5M5Y B;  1I6H H;  5JEA J;  1D2B A;  4IUQ A;  1CKM A;  2B2W C;  2VQE Q;  1D5Z C;  4OEL B;  2CCZ A;  1SE4 A;  2WAC A;  4HSP A;  5D14 A;  1PRT C;  1TY2 A;  2UUA L;  2N49 A;  2X6L A;  5J3B A;  2F0H A;  1WCM B;  1II3 A;  2CQA A;  1PH3 A;  3OW2 A;  4A3F B;  3E9I A;  4DNR B;  5EAY A;  4A93 B;  2BH2 A;  1MBY A;  2K28 A;  2OT2 A;  2UU9 L;  1CKO A;  4A3F G;  1W2B A;  1LTT D;  4KHV A;  4BY7 G;  1JB7 A;  4KJN A;  3OOC A;  2BCO A;  5CV6 A;  4X65 L;  1B53 A;  5CV9 A;  1L0X B;  1F9P A;  3FKI H;  4A3E B;  3NEN A;  2RSO A;  5IT9 L;  3W3A A;  1TS3 A;  4JG2 A;  4R4Q A;  4G57 A;  3HOW H;  3NTK A;  4A3E G;  4EQN A;  1KAB A;  4JI7 L;  2IWH A;  4JOI C;  4LF7 L;  2PCF B;  4DR6 Q;  2JA8 B;  5A35 A;  3HKS A;  2MJ8 A;  3A5Z B;  1P8L A;  2EJM A;  1NTG A;  4X66 L;  2K5W A;  4LUZ A;  3C46 A;  2JA5 G;  3LGJ A;  3TZD A;  1STA A;  3S1R H;  2OQK A;  4PNY A;  2K5D A;  4QMG A;  4DUY L;  4JI1 L;  5JJZ A;  3V2T A;  5JVH 3;  3IFT A;  2A74 C;  4XIG S;  3SXH A;  4AYB B;  1HNZ L;  3BVZ A;  1LT3 D;  3ULJ A;  4ALP A;  3H0G B;  5CMD A;  1IYV A;  1NBW A;  2UUC L;  2B2V A;  3HG9 A;  3KYH C;  1V9P A;  3H0G G;  1CFM A;  1HR0 W;  4LF4 L;  2ICI A;  3KBX A;  3U4V A;  2HDL A;  1ZYR C;  3SK4 A;  1LYL A;  2EYM A;  3VYT A;  1VQ5 A;  3OTO Q;  1JC7 A;  1F77 A;  1SNQ A;  4LK1 C;  3TZU A;  2LKV A;  2K52 A;  4HIO A;  4C2M H;  4YIJ A;  2NVT B;  1A8V A;  2DNE A;  2V4D A;  2YU9 B;  1I50 B;  2KCT A;  2E2H B;  1VQI A;  2N3S A;  4XQQ A;  1SR3 A;  1PH2 A;  2F0L A;  2I5H A;  2M9V A;  3G6E A;  2L1B A;  2OWO A;  4YWK A;  2VZA A;  2IL8 A;  1TWG H;  4QIW B;  4OIJ A;  3Q22 A;  1STN A;  1L2F A;  1MIU A;  2VQE L;  1HJP A;  2L15 A;  3BJU A;  5IGB A;  2EY6 A;  1CA5 A;  2NN6 I;  4DFA A;  4DV0 Q;  2LSS A;  5JEA H;  1BR9 A;  4K2L A;  1XX8 A;  4DAM A;  4DAY A;  4IFD G;  3J81 i;  4HMI A;  2WV6 D;  3TN2 A;  3S17 H;  3B6Y A;  5E4X A;  4WJ4 A;  5FOB B;  4OO1 G;  4ZYS A;  1ZEQ X;  2DN8 A;  5C5L A;  3BVG A;  1SAP A;  1KTK A;  2KEE A;  3A8I E;  2JK8 A;  1YJ9 A;  4HN7 A;  2LMC B;  1CSP A;  3H91 A;  3VDY A;  1MJC A;  3T53 B;  4GKK Q;  1XPO A;  4UY8 C;  4NB3 A;  1AEX A;  1LTL A;  1PTO D;  5IP9 H;  3OYY A;  1U0L A;  2WAQ B;  4S3S A;  4FP5 D;  3CPW A;  3F8T A;  4A3C H;  2B3G A;  3JAM c;  1IYJ B;  4IOC A;  5IYD H;  2WAQ G;  1K8M A;  1TS4 A;  1BOS A;  1U9R A;  1O7L A;  4DK0 A;  3MXN A;  4DR6 L;  4V0B A;  4A4I A;  1H9K A;  4UHV A;  4BBS B;  3K58 A;  5ELB A;  5H1S E;  1V43 A;  3L9A X;  4X3U A;  3S2D B;  4NXM Q;  2Z6K A;  4B9X A;  1Q81 C;  3AB9 A;  4BBS G;  3C1E A;  2Q8R E;  5BN5 A;  3PO3 B;  3KJO A;  1DOL A;  1VMP A;  1HFG A;  2B2W A;  2R6G A;  3DWA A;  1L0Y B;  5COR A;  5FLM G;  1CHQ D;  1JB3 A;  4K5W A;  3PO3 G;  2A6E C;  2K5Q A;  2QW7 A;  1I94 Q;  1X65 A;  1NMG A;  1H9S B;  3PV0 A;  4P72 A;  4AYB E;  1SMX A;  4RFB A;  4XYO A;  3CCV A;  2NVY H;  3MFY A;  5AFW A;  2EQS A;  3KF8 A;  1PYW D;  3S1N B;  4A3J B;  4IAL A;  5I6W A;  4YWM A;  4QJF A;  1EZ8 A;  2Z4I A;  4UPA A;  4A3J G;  4PZ6 A;  3S1Q H;  3D6W A;  3OTO L;  3MTS A;  3DWQ A;  5M5Y H;  3Q24 A;  1ZXT A;  3NTI A;  1N33 Q;  1Y8O B;  2IT1 A;  3M7N A;  1XWE A;  1PTO F;  1MI2 A;  1SXT A;  1XMO Q;  3CXC A;  2AWN A;  2IX0 A;  4A3M B;  2F0O A;  1WCM H;  5I2Y A;  1AZP A;  4RH6 A;  4A3K H;  3T1H Q;  4QIW E;  4R4T A;  4JYA Q;  3TQY A;  4A93 H;  2XRQ D;  3HOU B;  1SRO A;  3CRL C;  2ZJQ A;  4DV0 L;  3NQI A;  1K0R A;  1Y14 B;  1PFM A;  1TWF H;  5KYL A;  2EZV A;  4IUU A;  3HOU G;  2G5D A;  4HMJ A;  1HQM C;  1OXS C;  5HGT A;  1GUG A;  4XT3 B;  4IUT A;  1UEB A;  1I4Q A;  2EYH A;  4IPG A;  3HOV B;  5C44 G;  2D62 A;  2NN6 H;  4JI0 Q;  3HOV G;  1DOK A;  4WRD A;  1PH1 A;  2FIN B;  1E0B A;  2Z0S A;  4Y52 H;  2K01 A;  4JI8 Q;  1MKH A;  2JA8 H;  5CV5 A;  4GKK L;  4X3K A;  4BWG B;  5IYC H;  2NVX B;  4BA1 I;  3GQB A;  2F0Q A;  4O42 A;  4DF7 A;  2EYP A;  4K6D A;  3T1Y Q;  1KRS A;  3W5O A;  1QVF A;  3WOE A;  4LF5 Q;  5IY0 A;  2L55 A;  4QY7 A;  2I0Q A;  2KCN A;  4GN5 A;  4UAI A;  5C0X J;  3I4L A;  5C3W A;  1UUP A;  1B9M A;  1Y1V B;  2MP1 A;  2RHQ B;  3J80 E;  4NXM L;  1BCP C;  3U50 C;  3ULL A;  4C3H H;  3VR2 A;  2X69 A;  2ZT9 C;  3ITP A;  5D3D A;  1SMY D;  1RDP D;  2F3I A;  3K7U C;  1JJ2 A;  1K3R A;  1PH6 A;  4TRD A;  4BBR G;  1LTG D;  1I94 L;  4GN3 B;  4H44 C;  3IFD A;  2E2J H;  3PUV A;  2PQA A;  1Z6H A;  4HED A;  2PPB C;  2JN4 A;  2ES2 A;  1I6H B;  3HOX H;  1AW7 A;  2K05 A;  2KBN A;  3C2P A;  3EA6 A;  1STH A;  2A5H A;  5IP7 H;  2QKI C;  3MHB A;  4K8I A;  1G91 A;  4BS9 A;  4HIK A;  2AUK A;  3NSW A;  1EU3 A;  1FVI A;  1MJE A;  3FMC A;  1I5F A;  1U4R A;  5C4Z A;  3F2U A;  1F2L A;  1N34 Q;  5K36 H;  2B2Y A;  1V1Q A;  2D9U A;  3HKZ B;  1N33 L;  3U9S A;  2F3W A;  3GTJ H;  4R4C A;  3AEV A;  2VS1 A;  2E75 C;  1STY A;  4LNQ A;  3I4M H;  3RZD H;  1PZK D;  2NUC A;  2O4X A;  4LW1 A;  1XMO L;  1AH9 A;  2VL6 A;  1PLF A;  1EWI A;  3FKI B;  2MGS A;  4LF9 Q;  3KJP A;  3T1H L;  1RD9 D;  4WJ3 M;  4PZ7 A;  4Q0F A;  4JYA L;  3M7G A;  3EVQ A;  3HOW B;  3FKI G;  2EDG A;  3OIP A;  2PNR C;  5T1I A;  3CPF A;  2O5J C;  5E7N A;  3D4D A;  4EGV A;  1EEI D;  2ZTE A;  2EE1 A;  1CZW A;  4EQP A;  3HOW G;  1GVP A;  2WB1 B;  1CI3 M;  3HFZ B;  2BDN A;  1GUO A;  2A19 A;  4QL5 A;  3GTP B;  1VQJ A;  3CME A;  4ODG A;  1IHZ A;  1HNX Q;  2WB1 G;  1E24 A;  2HIV A;  3CC4 A;  4JI0 L;  3S1R B;  4JI8 L;  1V1O A;  3QOJ A;  2XN9 C;  1NCV A;  2GVB A;  2PZW A;  3KK7 A;  4JBM A;  1QIL A;  4NXN Q;  3T1Y L;  1JT8 A;  1EUJ A;  5J22 A;  4LF5 L;  1IL8 A;  5FK9 C;  2UXD Q;  2A1A A;  1WTR A;  3OMC A;  1PZJ D;  3A74 A;  1T9H A;  3K5L A;  2SNM A;  3J7A 5;  3URY A;  3H3V I;  4P74 A;  2CQO A;  1NR4 A;  3VYR A;  1EYG A;  1K73 C;  2KHJ A;  4E6I A;  4JI4 Q;  2F0M A;  1YNN C;  4C2M B;  3BS1 A;  3RNU A;  1YEZ A;  3ERO A;  1XTD A;  3NTH A;  1M1K C;  1GM5 A;  3MVV A;  5IOD A;  3VA5 A;  3VYS A;  4LAA A;  1GHK A;  2PMZ E;  2AQ1 B;  1Q1B A;  4X6A H;  3NBH B;  1LV9 A;  3HOZ H;  2PW5 A;  1F2M A;  1GUS A;  1TWG B;  4UP8 A;  3OWE B;  1HH2 P;  1GJX A;  1IW7 D;  4X3T A;  3TP7 A;  3VR4 A;  4HCE A;  2IHE A;  3QOL A;  4LFA Q;  3V96 A;  1HZA A;  1WTH A;  1F9S A;  5C3X A;  1ESR A;  1JWU D;  2WKC A;  4GLA C;  4A3M H;  3OW7 A;  3HP3 A;  2CHB D;  3W1B A;  1I6V C;  5JEA G;  5C6A A;  3IL8 A;  4HID A;  1N34 L;  5FLX E;  4UDU C;  1RTN A;  1WTO A;  3J81 L;  1IL2 A;  3H15 A;  3SDZ A;  3HKZ E;  2Q2T A;  2JQO A;  4A3I H;  1LTR D; 
#chains in the Genus database with same CATH homology
 5ISR A;  4QUC A;  1A3V A;  1I4R A;  1V1P A;  1TS2 A;  1EYC A;  2CW0 D;  2R3Z A;  2JE6 I;  3M85 A;  2EOT A;  3RD4 A;  4Q5V A;  3R2I A;  1BBX C;  1EQT A;  2KQ3 A;  3S1M B;  1QWY A;  2M2L A;  4CKE A;  1CTM A;  1NSN S;  3H94 A;  4DGZ A;  1S5D D;  5C5M A;  4KD4 A;  4WFN 3;  1WTP A;  1GUN A;  1G6Z A;  1D1K A;  1ENF A;  2BDO A;  1LAC A;  2ICE C;  3NXW A;  1RJT A;  1EY9 A;  2NVY B;  1DZ1 A;  4QUF A;  5A2Q L;  5M9O A;  4RGT A;  5I2X A;  1BXT A;  2IJ0 A;  4O1N A;  4XXE A;  4HCS A;  1TU2 B;  1EL0 A;  2TMP A;  1W6J A;  2XRS D;  5DAU A;  1E2Z A;  4A3K B;  4KMU C;  4Y7N B;  3I8Z A;  2Q8T A;  1BDO A;  4PQX A;  1EYD A;  2Z1C A;  1SSO A;  2F0W A;  4ZKC B;  1TWF B;  2K7V A;  1GOZ A;  3IKJ A;  3D31 A;  2K33 A;  4NW2 A;  1CM9 A;  4Z9C B;  5FLX L;  3FRP B;  2OEO A;  2NN6 G;  3KLS X;  4ME5 A;  2VNU D;  1B44 D;  3MC0 B;  4L63 B;  2XWJ B;  3S14 B;  1SE3 A;  1M4V A;  1QE6 A;  4KN4 C;  4L8J A;  1B9N A;  1B3A A;  2F0T A;  4U67 3;  1Y69 U;  1T5E A;  3K57 A;  2VUM B;  4C3H B;  4C3H G;  1FR3 A;  4FNF A;  1O80 A;  1IYU A;  2E2J B;  2BE5 C;  4DXF A;  4WJW A;  4P2C B;  2O2L D;  1X3P A;  1DYQ A;  2NWG A;  2EPB A;  2BE5 D;  1FNU A;  3HOX B;  5ELE A;  5KRU A;  4MIU A;  3PUW A;  3PMF A;  3ND8 A;  3TSS A;  5FO9 B;  2F0P A;  1F2Z A;  4DAV A;  5E4W C;  4TSS A;  1LLR D;  1HFN A;  4FXG C;  3GTJ B;  1R4P B;  1C48 A;  1AN8 A;  5CV7 A;  1OXV A;  4N9P A;  5K36 G;  1BQQ T;  1YNJ C;  3I4M B;  1HQR D;  3NWT A;  3RZD B;  1UEA B;  2JP1 A;  3R2T A;  4RGN A;  2JYO A;  1SFO B;  1YNJ D;  3GTO B;  2SOB A;  4RWS C;  4MHE A;  1CA6 A;  3SK8 A;  1LTA D;  3NP8 A;  1FD7 D;  1EY5 A;  4RCO A;  2RQX A;  3NUC A;  3A54 A;  1PTO C;  3E0J A;  3LNN A;  1ONL A;  2R61 A;  3NPP A;  3K5M A;  2H1E A;  2KJX A;  3A7L A;  3H6M A;  1RTO A;  1PXU A;  2ZXR A;  4K8J A;  4CJ2 C;  1ZKO A;  3MWY W;  5JAV A;  2PZT A;  1S5F D;  1FGB D;  3I72 A;  3BG3 A;  3PIO 3;  3J7A V;  3SE0 A;  4C3I B;  3I3C A;  2F3V A;  1V8Q A;  4K5X A;  4IZ8 A;  2A6H D;  5T1G A;  3J7A F;  1OXT A;  1DM0 B;  1HRJ A;  2G9H D;  2A73 B;  1UAP A;  2SNS A;  2RDF A;  2XNA C;  5I4D A;  2J7Z A;  2NBF A;  4I7Z C;  1KNE A;  3K5O A;  2F0S A;  1PDQ A;  3Q0A A;  1CK1 A;  3DEO A;  4R9W A;  2BA1 A;  3HOZ B;  2EJF C;  4MN3 A;  5KEE A;  1H9S A;  1LO5 D;  1DON A;  1GXD C;  2J4X A;  1IKL A;  1VF7 A;  2AQ3 B;  1KDB A;  3FPP A;  4IQZ A;  4H13 C;  4OIK A;  4IFD J;  1I4G A;  4QCL A;  1VMC A;  3S9W A;  5IGD A;  3ONA B;  4A3I B;  3J7Y W;  1RF2 D;  3DWP A;  4F88 A;  5IIF A;  2K04 A;  3W2D A;  4IUN A;  4F7X A;  1S5C D;  5HUR A;  5BN4 A;  1JOQ A;  5C4X B;  1BUV T;  3OMG A;  5DM7 3;  2OXP A;  2B39 A;  2A68 C;  1S5E D;  1JOK A;  1A2T A;  2A68 D;  1QJO A;  5G3L F;  3A55 A;  1JOO A;  2KUM A;  2EY5 A;  3DHQ A;  3OSO A;  4DK1 A;  5C0X I;  4RGO S;  5CV4 A;  4G7H C;  1JE4 A;  4H7B A;  5KNB A;  2F0K A;  3FEW X;  1SMY C;  3DUZ A;  4KKS A;  3BZD B;  4NMZ A;  4XTC S;  2F0N A;  5FKA C;  3K7A B;  3K6O A;  2C5C A;  2DNC A;  2C9O A;  2EYF A;  2PMZ B;  1BNZ A;  2HQE A;  3P7J A;  2E74 C;  4R8I A;  3PUY A;  3GTM B;  3NBI A;  2F0D A;  3HZX A;  1J9O A;  1ENA A;  4XQN A;  5I6Y A;  3J81 E;  5EPJ A;  3G7L A;  3QJY A;  4DN4 M;  5K5P A;  2E76 C;  2Z8L A;  5DEH A;  3MFG A;  2RDG A;  5M3M B;  1U4M A;  1Q3L A;  5CGK A;  2F0E A;  1ILQ A;  1A3T A;  2JSO A;  3SR1 A;  1DXM A;  1A6X A;  4OL7 A;  2I07 B;  2B63 B;  3CHB D;  2B2U C;  4ILW A;  4CJ1 B;  1WTW A;  1MSH A;  3DM1 A;  1ICW A;  3D4R A;  4OGQ C;  1MD2 D;  4G7O C;  3T13 A;  2JXM B;  4ID6 A;  3U9O A;  1SNP A;  2JA6 B;  1STG A;  1HTL D;  2EVB A;  1Y8N B;  2NTS A;  2WII B;  5D3I B;  4KKT A;  4DA2 A;  1KAA A;  4K5V A;  5A2Q E;  1EOT A;  3NWS A;  3ZYY X;  2E2D C;  1TR5 A;  5LL6 X;  1TII D;  1SYF A;  2HDM A;  1SYB A;  3JAM L;  1Z7T A;  3RUZ A;  5IOC A;  4A3G B;  4FF3 A;  1XXG A;  3I73 A;  5C0X H;  2J0T D;  2Q8I B;  5ELF A;  3NE5 B;  3A8K E;  1PMR A;  1OXU A;  2AUJ D;  5EKI A;  1EWC A;  1QG7 A;  2K32 A;  3K5N A;  1KNA A;  3I70 A;  2KVM A;  2G9D A;  3NQT A;  1IW7 C;  3V05 A;  3MAQ A;  2B2T C;  1QNU A;  2XSC A;  4FYD A;  4M1U B;  4N9T A;  4IN3 A;  1O78 A;  1SBB B;  3PUX A;  1U4L A;  2ZXP A;  4BY1 B;  4C1N I;  4B9W A;  2L4N A;  3R3O A;  1FYC A;  2GA4 B;  1Z47 A;  1V1P B;  3NBH A;  2EYO A;  1EYA A;  5M5X B;  1BCP B;  2EJG C;  5EKL A;  2KED A;  4DXG A;  2XIW A;  2I46 A;  2CW0 C;  2K6A A;  3T51 B;  1HUN A;  5IGF A;  1CHP D;  4J8Q A;  1JQY D;  3MXP A;  2NVQ B;  1JR0 D;  2R7Z B;  2MHV A;  4A3D B;  3SK6 A;  1KDC A;  1TT2 A;  1EY0 A;  3Q23 A;  2NTT A;  4V19 0;  5BN3 A;  2F03 A;  1EQV A;  1B1Z A;  4A3B B;  3IAY A;  2ZXO A;  3MA2 B;  1HCZ A;  4F87 A;  2L0C A;  4RHR A;  4LJZ C;  1EU4 A;  3K0Y A;  3KBG A;  1SYE A;  3SVM A;  1C4Q A;  4TQU S;  2BOS A;  1Q8I A;  4NKL A;  1I4P A;  3LX0 A;  3QO2 A;  3SHL A;  4WOR A;  1D5M C;  3AU7 A;  1JIC A;  4K6L A;  3A56 A;  1XYI A;  1PFN A;  2L9H A;  4B08 A;  1G2S A;  3GD7 A;  4ZUI A;  2FFK B;  1IKM A;  1SDF A;  1ET9 A;  3EFX D;  3TP6 A;  4K2K A;  2PW7 A;  3PUZ A;  5E3F A;  1T5X D;  5F2D A;  1DCZ A;  5KNC A;  2B2U A;  4EQO A;  2EYL A;  4CGY B;  3UI2 A;  4FXD A;  3HS0 C;  1SYG A;  1CQV A;  2X6G A;  1E2W A;  1GUT A;  3TDQ A;  4GZY C;  3I91 A;  1I4H A;  1K83 B;  5D65 A;  2A69 D;  1I3Q B;  2EYJ A;  5J39 A;  1WVL A;  5ELC A;  4M8A A;  1ENC A;  4XDX A;  4FF4 A;  1EY8 A;  1JWS D;  3VR5 A;  1PRT D;  1KDA A;  4CHT B;  1WTX A;  1DOM A;  4BY7 B;  1H9M A;  5CBA E;  4U68 A;  1TKW B;  2F0F A;  2JA7 B;  3P75 A;  1K8O A;  2KCC A;  1O7Z A;  5COY A;  2VXW A;  4KN7 C;  2PZU A;  2N88 A;  1SNM A;  2PYK A;  1RCV D;  4ZK9 B;  1CQF A;  3GV3 A;  3MZ5 A;  1D5X C;  2F0G A;  3TP8 A;  3GTG B;  3LWU A;  2JA5 B;  1VF5 C;  3D3R A;  5CV8 A;  2B2T A;  4NDX A;  2RKS A;  2R93 B;  1Y1W B;  4XQJ A;  2ID0 A;  3HRZ C;  3T16 A;  1PFB A;  4JBW A;  5KGU A;  1EY4 A;  2O5I C;  1TS5 A;  3EQL C;  5M3F B;  1C8C A;  1G8Z D;  2RBM A;  5I9O A;  2E2I B;  2L12 A;  1F2Y A;  5EBC A;  3PIP 3;  4FO2 A;  2EXZ A;  2ENB A;  1PRT F;  1MSG A;  2FJ2 A;  5NUC A;  3A7A B;  1R9T B;  3G6J B;  2FMM A;  2D2C C;  4FF1 A;  1ZYR D;  1SNO A;  1WD0 A;  3OIQ A;  1NAP A;  2WIN B;  4IUR A;  4LMQ D;  2SDF A;  1Q90 A;  1OO9 B;  4RKL A;  2B8G A;  2XVS A;  1OXX K;  2Z4H A;  3CRK C;  4XT1 B;  1QB5 D;  4RGM A;  1F9Q A;  3C1F A;  1TWH B;  3DEP A;  1A2U A;  1MGS A;  4PMB A;  5JPN C;  3WOF A;  3HOY B;  1TY0 A;  4BA2 I;  5JOB A;  3R93 A;  1Y8P B;  1W6K A;  4KV6 A;  4IUP A;  2HUG A;  3VR3 A;  2D5D A;  2Y0S B;  4ZRZ A;  5C3E B;  3KLR A;  1S5B D;  3DXJ C;  5CR3 A;  1AFP A;  1H9J A;  2B2Y C;  3H3V C;  1PRT B;  1S4Z A;  3NK9 A;  1HPC A;  1KLU D;  4TKO B;  5CC4 A;  2A6H C;  4C3I G;  2NZ1 D;  4JK1 C;  3SK5 A;  2SEB D;  4RCN A;  2HCC A;  4QF4 A;  2RVL A;  3RZO B;  4J6H A;  5FO8 B;  1JCK B;  5G3L D;  4I65 A;  1SE2 A;  5LL6 S;  3PO2 B;  4RKB A;  3K59 A;  2OF1 A;  1JOR A;  2QEJ C;  3VYU A;  5C0X G;  4ZUJ A;  4DAP A;  3TBI B;  2IX3 A;  2QCP X;  1Q1E A;  2A6E D;  1D1I A;  5TSS A;  3GTQ B;  1E2V A;  3GP7 A;  1B2T A;  1B4O A;  1TWC B;  5J1Z A;  3E5S A;  4IFD I;  2JEA I;  2F0I A;  1VDZ A;  1M8A A;  3Q6S A;  3BVM A;  3D4W A;  1FNV A;  4OO1 I;  1SYC A;  2CVR A;  5IGE A;  1G2T A;  3RLF A;  2EY2 A;  2DY8 A;  3TME A;  4PMC A;  1BF4 A;  5EQ0 A;  3RMH A;  1SEB D;  4KI0 A;  2MUY A;  2KOL A;  4RAU C;  2DY7 A;  3FVQ A;  1ML0 D;  1LTS D;  1I4X A;  2K03 A;  2F1M A;  4HTH A;  5C4J B;  2F0V A;  1WTQ A;  1D6E C;  1LAB A;  3GTK B;  5JPM C;  1SYD A;  3GO5 A;  1HUM A;  5C44 B;  3T4A C;  1U4P A;  1PZI D;  1HA6 A;  4C3J B;  2RA4 A;  1UNS A;  4XYQ A;  2LY7 A;  5DM6 3;  3HGB A;  2KA7 A;  4C3J G;  1X3Q A;  3JAM E;  4KTA A;  1O7Y A;  2AQ2 B;  2R92 B;  4RHS A;  1KLG D;  5I9P A;  3GTL B;  1DD2 A;  2FMC A;  3S15 B;  1STE A;  2K1B A;  5EGT A;  4FVM A;  3AMU A;  3T56 B;  3ERQ A;  5IGG A;  3BDL A;  2M00 A;  1VCI A;  1H9R A;  2NB0 A;  1LT6 D;  1LT4 D;  2XWB B;  3C3L A;  1CZG A;  4G7Z C;  3CQZ B;  2QF7 A;  2AWO A;  1PTO B;  4ZQ3 A;  4BBR B;  4ZKB B;  3OWF A;  1BCP D;  5E1F A;  2L5T A;  5KYI A;  2KHS A;  3BDC A;  1CT1 D;  2WKD A;  1Q12 A;  3BDO A;  1R4Q B;  4CJ0 B;  3KUP A;  3DMU A;  1RHP A;  5EJW A;  1TQO A;  3OHX C;  1EZ6 A;  1SJH D;  2HCI A;  1JWM D;  1HA5 A;  1SND A;  4C56 C;  1TVX A;  4R8N A;  4KD3 A;  1HTP A;  4IFD H;  4EVO A;  3R8B A;  1ESF A;  4OO1 H;  4HR7 B;  1A15 A;  1XTC D;  3NHH A;  2PQE A;  4CKB A;  1SNC A;  1QNK A;  1ET6 A;  4KY6 A;  3HEJ A;  3P1H A;  1NR2 A;  1SJE D;  5FO7 B;  2YYZ A;  2NYZ D;  5EPK A;  2F4I A;  4ZLT F;  3N6R A;  4X3S A;  5EPL A;  4DNT B;  3SEB A;  1B50 A;  3QIA A;  1BCP F;  2KEC A;  3QG1 A;  1AZQ A;  5JVG 3;  4IUV A;  1ILP A;  1HHV A;  1EWH A;  3X3M A;  3X3N A;  3D6C A;  2H4O A;  3E6Z X;  5DNF A;  3H09 A;  2VB2 X;  3MEH A;  1WTV A;  3I4N B;  2MPM A;  1HXY D;  5LHY 1;  1ROD A;  1X32 A;  2WP8 J;  2LFN A;  4PV1 C;  3M4Y A;  2IPK D;  1RKN A;  1TWA B;  1GUW A;  3S2H B;  3LWE A;  1FNW A;  3M3Y B;  3GV6 A;  4H0L C;  1EY7 A;  2QDB A;  3J80 L;  1YNN D;  5ELD A;  5KND A;  1EIH A;  3MXG A;  4KKU A;  2IW3 A;  2EY1 A;  3M4O B;  1AP0 A;  2B2V C;  4NP5 A;  4OHJ A;  4ABN A;  3OPO A;  3QWN A;  4KY5 A;  5IT9 E;  1LT5 D;  3S16 B;  2B8F A;  3VR6 A;  2QIL A;  3S17 B;  5C4H A;  1EIG A;  4KY7 A;  1DJR D;  1GHJ A;  2TSS A;  2RDH A;  5CBE E;  3D8G A;  3P20 A;  4J1M A;  3QB3 A;  4ZAI A;  4CKC A;  1A3U A;  2FHT A;  3KLS A;  4RA8 A;  1STB A;  4CBV A;  4L6T B;  5EKK A;  4C1N K;  4G4K A;  3CKI B;  2IX1 A;  1G29 1;  1J8I A;  3TP5 A;  2N55 A;  3L7Z C;  4FXK C;  4PMW A;  3I90 A;  4FF2 A;  2JEB I;  5KIX A;  1LTB D;  3WDN A;  3L3O C;  1QCB D;  4QB4 A;  2LS0 1;  4KK7 A;  3A8J E;  2PO4 A;  4KJO A;  2RSN A;  1EEF D;  2BA0 A;  1BO0 A;  3CU7 A;  1EFI D;  1NUC A;  1QOH A;  2VB3 X;  3BYT B;  4K14 A;  5EBD A;  4DU9 A;  1WD1 A;  4HAE A;  1PTO H;  3FPU B;  1EY6 A;  5M5W B;  4HSV A;  1LTI D;  3MXU A;  2L11 A;  3VA7 A;  5CYU A;  3FDT A;  3BYY B;  2F0U A;  2F0J A;  4ULL A;  4KHZ A;  5IGC A;  3O13 A;  3ND9 A;  3EJI A;  1F9R A;  3S1Q B;  3N52 A;  4F8M A;  2A69 C;  5M5Y B;  5JEA J;  1D2B A;  4IUQ A;  2B2W C;  1D5Z C;  1SE4 A;  2WAC A;  4HSP A;  5D14 A;  1PRT C;  1TY2 A;  2X6L A;  2F0H A;  1WCM B;  1II3 A;  2CQA A;  4A3F B;  4DNR B;  4A93 B;  1MBY A;  2K28 A;  2OT2 A;  1LTT D;  4KHV A;  4KJN A;  3OOC A;  2BCO A;  5CV6 A;  1B53 A;  5CV9 A;  1L0X B;  1F9P A;  4A3E B;  2RSO A;  5IT9 L;  3W3A A;  1TS3 A;  4G57 A;  3NTK A;  4EQN A;  1KAB A;  2IWH A;  2PCF B;  2JA8 B;  5A35 A;  2MJ8 A;  2EJM A;  2K5W A;  3C46 A;  3TZD A;  1STA A;  4PNY A;  2K5D A;  4QMG A;  5JJZ A;  3V2T A;  5JVH 3;  3IFT A;  2A74 C;  4XIG S;  3SXH A;  4AYB B;  3BVZ A;  1LT3 D;  3H0G B;  5CMD A;  1IYV A;  2B2V A;  3HG9 A;  1CFM A;  2ICI A;  3KBX A;  2HDL A;  1ZYR C;  3SK4 A;  2EYM A;  3VYT A;  1JC7 A;  1F77 A;  1SNQ A;  4LK1 C;  3TZU A;  2LKV A;  4YIJ A;  2NVT B;  2DNE A;  2V4D A;  2YU9 B;  1I50 B;  2E2H B;  4XQQ A;  2F0L A;  2M9V A;  2L1B A;  2IL8 A;  4QIW B;  4OIJ A;  3Q22 A;  1STN A;  5IGB A;  2EY6 A;  1CA5 A;  2NN6 I;  4DFA A;  5JEA H;  1BR9 A;  4K2L A;  1XX8 A;  4DAY A;  4IFD G;  4HMI A;  2WV6 D;  3TN2 A;  5E4X A;  5FOB B;  4OO1 G;  4ZYS A;  1ZEQ X;  2DN8 A;  5C5L A;  3BVG A;  1SAP A;  1KTK A;  2KEE A;  3A8I E;  4HN7 A;  2LMC B;  3H91 A;  3T53 B;  1AEX A;  1PTO D;  2WAQ B;  4S3S A;  4FP5 D;  1K8M A;  1TS4 A;  1BOS A;  1U9R A;  1O7L A;  4DK0 A;  3MXN A;  4V0B A;  1H9K A;  4BBS B;  3K58 A;  5ELB A;  1V43 A;  3L9A X;  4X3U A;  3S2D B;  4B9X A;  3AB9 A;  3C1E A;  2Q8R E;  5BN5 A;  3PO3 B;  1DOL A;  1VMP A;  1HFG A;  2B2W A;  2R6G A;  3DWA A;  1L0Y B;  5COR A;  1CHQ D;  1JB3 A;  4K5W A;  2A6E C;  2K5Q A;  1H9S B;  3PV0 A;  4RFB A;  4XYO A;  3MFY A;  5AFW A;  3KF8 A;  1PYW D;  3S1N B;  4A3J B;  4IAL A;  5I6W A;  1EZ8 A;  2Z4I A;  3D6W A;  3MTS A;  3DWQ A;  3Q24 A;  1ZXT A;  3NTI A;  1Y8O B;  2IT1 A;  3M7N A;  1XWE A;  1PTO F;  1MI2 A;  1SXT A;  2AWN A;  2IX0 A;  4A3M B;  2F0O A;  5I2Y A;  1AZP A;  4RH6 A;  2XRQ D;  3HOU B;  3CRL C;  3NQI A;  1PFM A;  5KYL A;  2EZV A;  4IUU A;  4HMJ A;  1HQM C;  1OXS C;  5HGT A;  1GUG A;  4XT3 B;  4IUT A;  1I4Q A;  2EYH A;  3HOV B;  2D62 A;  2NN6 H;  1DOK A;  4WRD A;  2FIN B;  1E0B A;  2K01 A;  5CV5 A;  4X3K A;  4BWG B;  2NVX B;  4BA1 I;  3GQB A;  2F0Q A;  4O42 A;  4DF7 A;  2EYP A;  4K6D A;  3WOE A;  2L55 A;  2KCN A;  4UAI A;  5C0X J;  3I4L A;  5C3W A;  1UUP A;  1B9M A;  1Y1V B;  2MP1 A;  3J80 E;  1BCP C;  3VR2 A;  2X69 A;  2ZT9 C;  3ITP A;  5D3D A;  1SMY D;  1RDP D;  4TRD A;  1LTG D;  4H44 C;  3IFD A;  3PUV A;  1Z6H A;  4HED A;  2PPB C;  1I6H B;  1AW7 A;  2K05 A;  3C2P A;  3EA6 A;  1STH A;  2A5H A;  2QKI C;  3MHB A;  4K8I A;  1G91 A;  4BS9 A;  2AUK A;  3NSW A;  1EU3 A;  3FMC A;  1U4R A;  5C4Z A;  3F2U A;  1F2L A;  5K36 H;  2B2Y A;  3HKZ B;  2D9U A;  3U9S A;  2F3W A;  2E75 C;  1STY A;  1PZK D;  2NUC A;  2O4X A;  1PLF A;  3FKI B;  2MGS A;  1RD9 D;  4Q0F A;  3M7G A;  3EVQ A;  3HOW B;  2EDG A;  3OIP A;  2PNR C;  5T1I A;  2O5J C;  3D4D A;  4EGV A;  1EEI D;  2EE1 A;  1CZW A;  4EQP A;  2WB1 B;  1CI3 M;  2BDN A;  1GUO A;  3GTP B;  4ODG A;  1IHZ A;  3S1R B;  1V1O A;  3QOJ A;  2XN9 C;  1NCV A;  2PZW A;  3KK7 A;  1QIL A;  5J22 A;  1IL8 A;  5FK9 C;  1WTR A;  3OMC A;  1PZJ D;  3K5L A;  2SNM A;  3URY A;  1NR4 A;  3VYR A;  4E6I A;  2F0M A;  1YNN C;  4C2M B;  3BS1 A;  3ERO A;  3NTH A;  3MVV A;  5IOD A;  3VA5 A;  3VYS A;  4LAA A;  1GHK A;  2AQ1 B;  1Q1B A;  1LV9 A;  2PW5 A;  1F2M A;  1GUS A;  1TWG B;  3OWE B;  1GJX A;  1IW7 D;  4X3T A;  3TP7 A;  3VR4 A;  4HCE A;  3QOL A;  3V96 A;  1F9S A;  5C3X A;  1ESR A;  1JWU D;  2WKC A;  3OW7 A;  3HP3 A;  2CHB D;  1I6V C;  5JEA G;  5C6A A;  3IL8 A;  5FLX E;  4UDU C;  1RTN A;  1WTO A;  3J81 L;  3SDZ A;  1LTR D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...