4U673

Crystal structure of the large ribosomal subunit (50s) of deinococcus radiodurans containing a three residue insertion in l22
Total Genus 0
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
0
sequence length
59
structure length
59
Chain Sequence
THKMAKRRIKITGTGKVMAFKSGKRHQNTGKSGDEIRGKGKGFVLAKAEWARMKLMLPR

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2
publication title The Ribosomal Protein uL22 Modulates the Shape of the Protein Exit Tunnel.
pubmed doi rcsb
molecule tags Ribosome
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2014-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF01632 Ribosomal_L35p Ribosomal protein L35
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.530 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4u67300
5JVH3 3PIP3 5DM63 5JVG3 4U673 4WFN3 3PIO3 5DM73
chains in the Genus database with same CATH superfamily
3LWUA 1E1TA 2R3ZA 5M5WB 5C3XA 3BG3A 5G3LF 1SNDA 5LMUQ 2UUBL 4O1NA 2ENBA 3M4OB 5KEEA 1QZHA 5NUCA 1D1KA 5ELBA 1LT5D 1ZXTA 3EFXD 4KJOA 1PZKD 1ZYRC 1GUWA 2Q8IB 1ENCA 2UXCQ 2PQEA 5COYA 3GTOH 1AP0A 1DOLA 5FLMH 4H0LC 5EKKA 3HOYB 3OIQA 3OYYA 1Q81C 4EQ5A 4UP9A 2V4DA 2JA8B 1KAWA 3OPOA 1EFWA 1QJOA 2OWOA 1I4HA 2MP1A 2B63H 1X56A 4X3UA 1PYBA 2B8FA 4IUVA 3SR1A 4FF2A 3HOVG 1RJTA 2PMZE 4OELB 2L0CA 1BKBA 4R4CA 5EGTA 4HSVA 1C7YA 3S9WA 4K8JA 4J6HA 5IGBA 1I3QH 2EYOA 5IT9L 4O42A 1Q86C 2ASBA 1AEXA 3K0YA 5FO7B 4HIKA 3HOXB 4ALPA 2MO1A 2ZTEA 1S72A 3K5OA 2JEAI 4B3MQ 2RF4A 1LTLA 3G48A 4BBRG 2F0FA 3KYHC 4ILWA 4A75A 1OO9B 2JSOA 3M4YA 1GM5A 1VF5C 3D3RA 4GN4B 1SE4A 4BY1H 3D6CA 1LTTD 4A3IH 2BDOA 1ZYRD 5IYDG 4A3LG 5IODA 3HKZE 2WFWA 4KK7A 2IL8A 2K5HA 4DXFA 3P20A 3BZCA 5AJ3L 3J81L 1PTOB 5BR8L 2FFKB 2R93B 1PZJD 4F87A 1EL0A 3ND8A 4N8X1 1VMCA 1PRTD 3H94A 1PV4A 3J81i 1EIHA 1O7ZA 1MBYA 4KKUA 1ESRA 1RKNA 2FHTA 2JA5G 3HOUB 4JG2A 1UUPA 4GKJL 1V8QA 2R7ZH 2HD3A 2TSSA 5C0XI 3D4DA 1Q8IA 5EPJA 4K2KA 4JI6Q 2O5JC 2CHBD 4DU9A 4YY3L 2BH8A 1X32A 5IIFA 1FNUA 2CW0D 2HDMA 3B6YA 2RCFA 1PH8A 3S17H 4A3GB 4IUPA 4C1NK 1JB7A 5IYBG 5H1SE 4KY6A 4CKBA 1PVOA 1GD7A 1DOKA 1I4RA 1SE3A 3DEPA 4J1MA 3E0JA 4DK1A 5IGDA 2IX0A 3I4MB 2IHFA 2H5XA 4M1UB 2UXCL 1Q46A 4KI0A 4A3BB 3P75A 1TS4A 1SN8A 4RAUC 5GAEC 3HOWG 3Q8DA 5K36G 4ABNA 5CYUA 1VQEA 1XMQL 1N36L 3KLWA 4XDXA 5HURA 1AN8A 4PMBA 1LACA 4PMWA 4YCWA 1RHPA 2NVYB 2OXPA 2NUCA 2WAQG 4C3JB 1PYSB 4BBSB 4AYBG 5E4WC 1SFOB 1FNWA 4KV6A 3S1NH 3S2DH 1ICWA 1V1QA 3S15B 4XYQA 3RUZA 3GD7A 2MQHA 5ELNA 4L5RC 4A93H 4N9PA 4B3ML 1SLJA 4CHTB 3C3LA 1PLFA 4ULLA 1KAAA 4EVOA 2F1MA 2VUMG 5JJLA 3IFDA 2SEBD 2K14A 3ICEA 2R92G 2HCIA 3NQIA 2HUGA 1QOHA 4F88A 5C3EG 1I4QA 2K03A 2IWHA 1XMOQ 1R4PB 4JBMA 1CM9A 2G5DA 2FMCA 3LWEA 4L5TA 5KYLA 2I46A 1DOMA 2O5IC 3FDTA 1X55A 1FJGQ 2JXMB 2F0HA 2B2UC 2E75C 1IBMQ 5CMDA 1QCBD 3JAME 1N32Q 3CKIB 1NBWA 1B70B 2MGSA 1Y1VH 3D4RA 1BNZA 3VDYA 1YHBA 2A68C 5CV5A 3PIOA 1WD0A 3H6MA 1GXDC 5EKIA 5KYIA 5C5MA 4DV2Q 2HCCA 1PH7A 2KJXA 2EYFA 5FJ8G 3QIAA 4A4IA 4JI6L 2QCPX 3QO2A 4NKLA 5FO8B 3RZOB 3D6WA 4DFAA 2PI2E 5C4XB 3AYHB 1UE5A 3K7AB 1N8RC 1TWHH 2JEBI 3O13A 1MJCA 4FF3A 4GKKQ 2EYLA 4P2CB 3R93A 2KHSA 2ALYB 1L2FA 3AU7A 3CW2C 4HJ5A 2ES2A 5EBDA 3V96A 1X3EA 5JVH3 4DV7Q 1GJXA 1SXTA 2MUYA 1D5XC 5M5XH 3HP3A 1ILQA 4JI4L 2WB1B 2Y0SB 1EYCA 1XXGA 3A55A 1BXTA 3CQZH 4OWWB 4A3KH 5CV9A 2VL6A 3TRZA 1ZKOA 5IGCA 3T1HQ 1EQQA 1KNEA 2EY6A 2RBMA 1NJIC 4A76A 4K5WA 3Q0AA 3UE1A 3IFTA 5FLXc 1Y8OB 4X3SA 1GHKA 3G6JB 2CQAA 4ZYSA 1LABA 1PRTF 2PO4A 2A68D 2CCZA 2L15A 1B44D 2B29A 3DWPA 5IGGA 3F8TA 5D14A 1L0WA 4JI1L 4RKBA 4WJWA 3R2IA 3AQQA 1F77A 3I55A 1NMFA 5I2YA 1PYWD 3MFGA 1FR3A 2K1BA 2B2UA 3TZDA 1U4MA 3OTOL 2ZJPA 4A3CH 2F0NA 2RVLA 5LMNQ 4G7OC 3DLLA 3J80c 2B63G 2E5LL 3K5LA 5M3MG 1KABA 2PMZB 4BY7H 1XMOL 1U4RA 3NUCA 4IUTA 2NN6H 4UP7A 4IOAA 2JA6G 1DJRD 2F0SA 1DGSA 3EQLC 4B3TQ 1STGA 4L5SA 3J7AF 1KHIA 4CDFC 3EVQA 3TP7A 1WTPA 3BZKA 1JOOA 4DPGA 2F0DA 2R7DA 1VQCA 2KECA 1PFSA 4HCSA 1W6JA 3T13A 1BDOA 1N32L 3H0GB 5ISRA 3MEFA 1SNPA 1VQLA 3CCVA 3U50C 3FRPB 3R2TA 2WACA 4DV2L 2MPMA 2VQFQ 3QJYA 1EFID 4BY1G 2RSNA 5FOBB 4GOPB 2KCNA 3L0OA 2D0OA 4JVZA 3TZUA 2ZTDA 1U0LA 4A3IB 1Y14B 1VQGA 2SOBA 4H7BA 2XN9C 1W6KA 4LNQA 2A69C 4CJ2C 1DYQA 2RA4A 5M3FG 3K5MA 1MJEA 4GKKL 2CH4A 1SR3A 4NW2A 1FNVA 1CZWA 2BA1A 2B2TC 3G4SA 1EYDA 3DUZA 1I6VC 4U68A 1VQFA 2YTVA 4ZK9B 4DV7L 3URYA 3STBC 2YU9H 2XRSD 1IW7C 2GVAA 1L0XB 5KRUA 2Q8RE 4DK0A 1IBKQ 2R7ZB 4RH6A 3S1QH 1YNND 4IFDI 5GROA 3L9AX 4WJ3M 1JOQA 1TWFB 1E2WA 2LKVA 2PW5A 2C5CA 3T1HL 1GUOA 2HIXA 1VS0A 3HRZC 1HRJA 4R4TA 3F1ZA 4JC0A 1X3FA 3CRKC 4MIUA 1TWGH 1AW7A 4X64Q 4DR4L 4R4IA 4JI0Q 2YTXA 2JP1A 3PGZA 1WCMB 1N9WA 1XTCD 4YWMA 1C48A 2NZOA 2JA5H 2XRQD 1VQJA 4KMUC 3M3YB 2JN4A 2BA0A 2FXQA 4POGA 4LF6Q 3KBXA 3PIP3 3I4NB 2GVBA 2NTTA 5DAUA 5CV4A 3GTGB 1X3QA 3ONAB 2AQ1B 3QOLA 2NVQH 1VQAA 3K58A 2F4IA 1CHQD 5LMNL 3RMHA 3V05A 3M7NA 1SNOA 2B2WC 3KDFA 2ICIA 3PQIA 3PUWA 2L11A 3MA2B 1A3UA 3SK8A 1Y1WB 2KHIA 4G7HC 2SNSA 1HUNA 4B3TL 1MD2D 2NYZD 2VNUD 4QMGA 2N3SA 4YCVA 3GTKH 2DN8A 5K36H 3S2DB 1TU2B 1ASZA 1E2ZA 1SYEA 4XXEA 3TSSA 4A93G 4KHVA 1WI5A 2E2IH 1PH3A 3U4ZA 1NE3A 4J15A 1CTMA 4F8MA 2B2TA 4RGTA 4DV0Q 2VQFL 3F2DA 3T51B 1F9RA 1F9SA 3QB3A 1DONA 4LF8L 4LFBQ 2RDFA 3PO3H 1D1IA 1MSGA 4OHJA 1EY6A 1IBLQ 1ML0D 3F2CA 2WAQE 3UDGA 4FXKC 1N34Q 3PO2H 1PFNA 4AYBE 1VDZA 4Q0FA 2FMMA 3MXGA 3S14H 2K01A 3PV0A 4KHZA 2BE5C 2CQOA 2KHJA 1M8AA 2UXBQ 4HJ7A 1G91A 3KK7A 5JPMC 1U9RA 1B7YB 1MHWC 1B3QA 4TSSA 4XYOA 3I4OA 2VUMH 1G2SA 4QL5A 1Y1VB 4LWCA 3OW7A 5LMNW 5HGQA 1CHPD 4GLAC 2R92H 4UPAA 5LL6X 1HNXQ 1I4PA 2PPBC 5C3EH 3U9SA 1CQFA 1EU3A 4QY7A 1SYBA 1H9MA 4YHHQ 1NAPA 3CCLA 4JYAQ 3IL8A 3Q22A 2JYOA 1VQMA 1U5KA 1SROA 1TWHB 4JI5Q 4DK6C 2K04A 2KA7A 1ET9A 4X64L 2F3VA 1A63A 3TS0A 2B2WA 2EXDA 5T1GA 3VR3A 3PMFA 4CDCC 1STHA 2HQEA 1LT6D 2ZM6L 1TS5A 2NVTH 3VA5A 4I7ZC 5IE8A 1A62A 3TMEA 4A3JH 4G7ZC 1P16A 5I9PA 1X54A 4LF6L 4FNFA 3X3NA 1P8LA 1LO5D 3A5ZB 4PQXA 1Y69U 4NXNQ 3U9OA 2PZWA 1ENAA 4A3KG 1DZ1A 2OQ0A 1V9PA 1SNCA 2KEEA 3CPWA 1PRTB 3L2PA 5EAYA 1PDQA 3S2HH 1O7LA 1WFQA 4DR7Q 4PG3A 2A6ED 4RCOA 5JJZA 1PH1A 4QB4A 4I65A 4DR5Q 1XYIA 1R4QB 1CZGA 3WDNA 1SE2A 5LHY1 1PH9A 3I2ZA 2MNAA 2QDLA 4KLKA 3S16H 3KF8B 4K6DA 2M9VA 4EGVA 4QF4A 3RLOA 4R8NA 4A3CG 1CI3M 4V0BA 2O2LD 1QVCA 1CSQA 3NK9A 4BY7G 4LFBL 2E8GA 2K32A 2NN6G 3LGJA 3LNNA 3UI2A 4C3IH 1IBLL 3UE0A 1KIXA 4OGQC 4HAEA 2LFNA 1N34L 2E2JB 2J4XA 2L55A 2UXBL 1B9NA 3M7GA 4Y7NH 1TS2A 4AH6A 1BBUA 2PZTA 5IOCA 3F2BA 4LUVA 3KLSA 2K5VA 2EYJA 4C1NI 1KNAA 3R3OA 1D5MC 1EOTA 3OOCA 5M3MH 3CF5A 1HNXL 1XNQQ 1II3A 1J8IA 2R61A 2DGYA 4CDEC 1H9SA 3HOVB 2JA6H 1IL2A 5CV7A 4YHHL 3D4WA 5JJKA 3TP5A 2EDGA 5T1IA 3C1FA 1NTGA 4DNTB 1SMYC 3SHLA 2A74C 1OTCA 4JBWA 1CA5A 3UDFA 2FINB 5JVG3 4OWXB 1STAA 3EA6A 4BBRB 5KNDA 3FVQA 2K50A 1VQPA 3PUVA 1HHVA 1BUVT 4L5QA 2YV5A 5D3IB 3M4PA 3PIO3 5KIXA 3SK5A 1TWCB 2PZUA 2OTJA 3S1QB 4NXNL 5JAVA 3E6ZX 2ZTCA 1NMGA 2PYKA 1YNJC 3PUXA 2HDLA 4FVMA 1K83B 2EE1A 2EY5A 2K5NA 3DEOA 1MSHA 5A2QE 5M3FH 3CXCA 1NUCA 1EUJA 1Q90A 5JEAH 1PH5A 4DR7L 4DV5L 1SEBD 1PFMA 1X3PA 1LTRD 4R4QA 1RL2A 3T1YQ 4DR5L 5ELFA 5FLXE 2ATWA 2K5WA 2Q2HA 4P75A 4XQJA 2KCMA 4TQUS 3BVZA 2JA5B 4JOIC 4JW0A 1BQQT 4PZ6A 3HKSA 3ERQA 1XNRQ 3LX0A 2WINB 1RD9D 5E4XA 4IPGA 4NB3A 1A0IA 4LAAA 1WD1A 5FK9C 3GTJB 3KBGA 3CC7A 4A3MG 4A3FG 1HPCA 1AZPA 2I5LX 4A3EH 2K28A 4IO9A 4UP8A 5LMUL 4LFCQ 1CKMA 4X62Q 1NR2A 3GTPH 1I50B 1BBWA 3J80E 3J7YW 1NR4A 3A56A 5C4JB 3HOZH 3RR5A 2E2HB 2WIIB 3KF6A 3ULJA 4X6AH 1KDAA 1EZ6A 2RSOA 1GHJA 5ELDA 3HOWB 2JQOA 2Z1CA 4ZCKA 2DJGC 4A3DH 1YNJD 3SGIA 4C2MB 3NE5B 4KY7A 5JEAJ 1I6HB 1HQMC 2QGQA 5DLQE 5KNCA 2NZ1D 2ZJQA 2XSCA 5A2QL 3DXJC 4BWGB 1QE6A 2JJQA 3H3VC 1GUNA 1CFMA 4K5XA 1CKNA 4JK1C 4CGYB 3PO3G 5CV6A 3RD4A 2WAQB 5DM73 5BN5A 1Q7YC 3OWEB 1JE4A 4AYBB 1JT8A 2F3IA 1H9KA 2JA7H 4OO1H 2AWNA 3HG9A 3PO2G 1W2BA 2NZHA 1HA6A 1PTOC 4QUCA 1XTDA 4LFAQ 1OXTA 4LF4Q 3BDCA 1KRTA 1Z7TA 4PZ8A 3AMUA 4IUUA 3K80C 5EJWA 1GKHA 4R9WA 2VUMB 4IZ8A 4UHVA 1K3RA 4DR6Q 2R92B 1RTOA 2ZJRA 2QILA 2OF1A 1XPOA 4JOIA 5C3EB 4HR7B 2DUDA 3BYYB 4ZUIA 3QWNA 4LMQD 1BR9A 1EYGA 4WJ4A 1HH2P 2B39A 4DAYA 3NQTA 5CV8A 2F0PA 2YYZA 2B2YC 1K8OA 2LXKA 2J7ZA 4DUYQ 3T1YL 5J22A 2DY7A 4A3JG 3J81c 1EOVA 4Y52H 1LLRD 1EY4A 1QG7A 1VQHA 4P71A 5C44G 3K57A 1XNRL 1VQBA 1TKWB 4RMFA 3OMCA 4IN3A 4XT3B 1HNWQ 4RCNA 5M9OA 1Q12A 2XGTA 3PF5A 1J6QA 4X62L 3MXPA 4IOCA 3RLNA 3E5SA 1K73C 3S1RH 2OQKA 5E1FA 2KUMA 3SXHA 3CCUA 1K0RA 1VF7A 2IX1A 2AUKA 3NBHB 2VS1A 1EU4A 3L3OC 2B3GA 2R7FA 4GNXC 1HJPA 4DA2A 3CAMA 3S16B 3NTIA 1VQ4A 4DXGA 4QQBX 2I0QA 1VQ8A 4U673 1E7ZA 4PMCA 1OXSC 5E3FA 1YJWA 2VZAA 4IPHA 1QVFA 4AQYQ 2V1CC 2AWOA 4FF1A 3JAML 3DM3A 1A6XA 5EBCA 5C5LA 3FEWX 3VR5A 4S3SA 2ZXOA 4C3IG 4TRDA 3MXNA 3I70A 4APVA 3A5UA 2Q2TA 1S5ED 3JAMi 3SDZA 4K2LA 1JCKB 3HFZB 3GTOB 4LFAL 4K14A 4LF4L 1QILA 3VYSA 1LYLA 1CKOA 1CT1D 2XTIA 1V1PB 1IZ6A 2RDGA 2F3WA 1L0YB 3ULPA 3NSWA 1O80A 2B2YA 3T53B 1O78A 4DR6L 1TVXA 1JE5A 2XVSA 2NTSA 2B63B 5M3MB 1JORA 1Q3LA 4UDUC 2RCNA 1G6ZA 1K8GA 3BVMA 2JA6B 2H1EA 1K9MC 1FJGL 1I3QB 3NP8A 5IGEA 1CQVA 1HZAA 3CP0A 5M5WH 4H44C 3J7AV 1IBML 1W3SA 3PCOB 1VQ9A 2DNCA 1E24A 1ASYA 3M4OH 1HUMA 5IWAQ 4DUYL 5EPLA 4NP5A 3N6RA 4DR1Q 4HJAA 3S1MH 2D2CC 4V190 3S24A 1E3PA 5KGUA 2PQAB 4BY1B 3HOYH 3CMEA 1BOSA 3BDLA 4GNXA 2VY3A 3VYTA 2F0TA 1HNWL 4I7AA 4NXMQ 3P7JA 1XX8A 4OONA 2G9HD 2JA8H 3GTQH 2EYMA 3ITPA 3W5OA 3G7LA 2Z6KC 4WFN3 5M3FB 1EWCA 1R9TH 2BDNA 5IGFA 2UUAQ 1DM0B 2F4VQ 1CA6A 2AHOB 2EQSA 5JEAG 1ET6A 1S5CD 5I9OA 2AUJD 3HKZG 1PA6A 4JPBW 2K5DA 1F2LA 2KENA 1K8MA 2RQXA 1EQTA 3HOXH 1STNA 2F52A 4DV1Q 5F2DA 3FHWA 1IXRA 5CBEE 4DV3Q 2EJMA 3CC2A 3EIVA 2K75A 1MGSA 3HZXA 4X66Q 1VCIA 4GN5A 4Q5VA 3NWSA 3KJPA 4QCLA 2F0KA 3S17B 4QGUA 4A3EG 4OEMB 3H3VH 3T4AC 4AQYL 4GZYC 1AZQA 2VXWA 4XT1B 1HQRD 3HOZG 2LXJA 3KLRA 4NDXA 1Q1BA 4GLVB 1I94Q 5C3WA 4B9WA 1D2BA 1UNSA 4CBVA 2QW7A 4CKCA 2WP8J 3E9IA 2XIWA 3MC0B 4DR3Q 1BO0A 3Q24A 1PTOH 5GADC 2K7VA 4MTKA 4YCUA 4LW1A 5G3LD 2R93H 3JC66 4KKTA 4A3DG 1DCZA 2A69D 1O7IA 4DV6Q 4OWTB 4A3MH 4N9TA 4A3FH 2X6LA 1A2UA 2NN6I 2K05A 4Z9CB 2NVXH 2F0WA 4HN7A 3J7ZC 3FKIG 4JI3Q 4KJNA 1SE8A 4PZ7A 3STBD 1PH4A 2JA7G 2C9OA 1IW7D 4OO1G 1F9QA 2VQEQ 1VQIA 3SK6A 3CCMA 1M4VA 1I4XA 4ZQ3A 4A3GH 1C4QA 3S1NB 4UY8C 4DGZA 1MI2A 1E0BA 3TP6A 2Z6KA 4A93B 3CC4A 4NMZA 3I4MH 2ID0A 3SK4A 2EVBA 4HTHA 5IWAL 2KEDA 1A2TA 4HJ8A 1TS3A 5E7NA 4DR1L 4L6TB 4LUOA 4N8FA 3TBIB 4GN3B 3A7AB 1KDBA 4DV4Q 1YI2A 1HXYD 1QUQA 4C56C 2QF7A 2J0TD 1C8CA 3F2UA 4NXML 3A8JE 4ZKCB 3OMGA 3FMCA 4OL7A 4JV5Q 2F0LA 3A74A 2UUCQ 2UUAL 2F4VL 1H9RA 2NVYH 3TEHB 4RGOS 1TY0A 2MO0A 4C3JH 2PNHA 1BCPC 3I72A 4B9XA 3ZYYX 1LTGD 5M5YH 1X9NA 3I3CA 1SFOH 2F0MA 1A8VA 3VR6A 1LUZA 1LM0A 2VB3X 4GLXA 2BCOA 1WTWA 1IBKL 3K59A 3CU7A 4IALA 3WWVA 2CWPA 4MHEA 5CC4A 4DV3L 1AE2A 5TSSA 4X66L 4DAPA 3TP8A 1GO3E 4JCVE 2DJFC 4JI0L 1JJGA 2EZVA 1L1OC 4YWKA 1HA5A 4KD3A 3BZDB 2KOLA 1EYAA 5BN3A 2Q2IA 4DR3L 1B2TA 5C44H 2OEOA 4YWLA 4BA2I 5M5XB 1N33Q 1K0SA 2WV6D 1S3OA 1HR0Q 4QIWE 4CKEA 1EEFD 2K4KA 4P72A 3CD6A 3CQZB 4A3KB 3VR2A 5FKAC 2BE5D 4EQOA 3E9HA 2A8VA 4ZUJA 3HGBA 1S5DD 2JA9A 1BCPD 2Z8LA 4RG1A 3RZOH 1OXXK 4JI3L 4DAVA 1STEA 2K6AA 4RGNA 5C4XH 3A8IE 3Q6SA 1A15A 3DHQA 3K7AH 4XIGS 2AQ3B 1SMXA 5AJ3Q 2TMPA 2X6GA 4JI8Q 3GTMH 4B3SQ 3L7ZC 3GP7A 5ELEA 4BXXH 2F0EA 1JWUD 1D8LA 4DUZQ 4DV0L 2MJ8A 4DV4L 2Q2UA 1SBBB 4GKJQ 1C9OA 4BY7B 4MN3A 4C3HG 2PNRC 3HEJA 4HSPA 5CGKA 5I6WA 5IP9G 1FGUA 2K33A 3K8AA 2HIVA 5J1ZA 2ICEC 3UDXA 2RDHA 2D9UA 1PMRA 4LF5Q 2D5DA 5C0XH 1NSNS 2UUCL 1G51A 1LTAD 3NELA 3D0FA 1IYVA 3ULLA 1VMPA 3CCSA 1X6OA 1AH9A 4L63B 3E0EA 3ZJYC 4G57A 2E76C 3A54A 1EIYB 4LK1C 1HZCA 1UE7A 1L1OA 3GV6A 1H9JA 2I07B 3S1MB 2HQLA 2N55A 2O4XA 2B8GA 2Q8TA 3KLSX 3SEBA 3J81E 3HOYG 1YHQA 4RKLA 5IP7H 4JI7Q 4FF4A 4JYAL 2LMCB 1XMQQ 3I4LA 4IPDA 2XNAC 3CMAA 1N36Q 3E3XA 1PRTC 1EY0A 2JA8G 4JI5L 2AMCB 3GTQB 2P5ZX 3CCEA 4DAYB 1TWAH 2HT1A 1SJED 1KLUD 3AB9A 1KQSA 1R9TB 2N8NA 3I90A 4IJHA 2NB0A 3BYTB 4KTAA 3BJUA 5ELCA 5HGTA 3BDOA 3NXWA 1WTQA 4MTNA 5GQOA 3G6EA 1A3VA 2YU9B 4GS3A 2CW0C 1SDFA 1N33L 3HOXG 2CH4W 5C0XJ 3H0GH 1E22A 1B3AA 1HR0L 3V2TA 2I5MX 3PUYA 2L9HA 1ILPA 3TS2A 2JE6I 2E2DC 1G8ZD 3PUZA 2IPKD 1HCZA 5D65A 1TWGB 5DNFA 4WRDA 1HZ9A 2KVMA 5JJIA 1OXUA 3K6OA 2PI2A 3QR8A 1OXVA 1JB3A 1YHAA 1D6EC 3Q23A 1XWEA 1B53A 2QDBA 1S40A 4R1JA 3MFYA 2A73B 3TQYA 4JI8L 2R93G 3NEMA 4B3SL 2MHVA 3CRLC 4PNYA 1SMYD 3J7A5 4X3KA 1HTLD 3KFUA 2NVQB 1G6PA 1JJCB 4A3FB 4A3MB 4DUZL 4TVAB 5CORA 4DF7A 3I8ZA 3HOUG 1H95A 2NVXB 3HS0C 1J9OA 1EQRA 1WOCA 2IW3A 4K8IA 1S4ZA 1TY2A 3MXNB 4ZLTF 2MFIA 1JMCA 1GVPA 1SYGA 1TWFH 1YJNA 4LF5L 2DY8A 1B1ZA 2D62A 3CHBD 3C1EA 3GTKB 2DNEA 3NTKA 3I91A 4A3GG 3OIPA 4EQNA 1JOKA 3RLFA 4ZRZA 4LUZA 2IJ0A 4X65Q 3I4MG 1HR0W 1PHJA 2GA4B 1WCMH 2E2IB 5HY6A 2UU9Q 1E1OA 4OX9Q 2CWAA 3M3YH 1QVGA 1XNQL 3MVVA 2Z9HA 1FGBD 3I7FA 1V1OA 2EYHA 1EQVA 4NPSA 4A3BG 1GUGA 3I4NH 1MKHA 1BCPF 1F2ZA 4JI4Q 3MEHA 3PO3B 3FKIH 1KDCA 5FLXL 4JI7L 3C46A 3GTGH 3KF8A 1UE6A 3TN2A 1TQOA 3PO2B 1M1KC 5GAGC 4M8AA 3FPUB 3S14B 4DN4M 1WTVA 1VQOA 1WTXA 3IRBA 5I6YA 4KHPQ 1Y1WH 4C3JG 2OCEA 4BBSG 4RFBA 2A6HC 4FO2A 5IT9c 4HIMA 1EY5A 2D0PA 2F0JA 3AEVA 5M5YB 1E2VA 4IQZA 1RODA 1SYFA 5C4ZA 1HTPA 1QNKA 4P73A 2EJGC 1Z9FA 3J80L 1JJ2A 3VR4A 4JI1Q 4GNXB 4CJ0B 1CSPA 5ELOA 1U4LA 3FP9A 2EY2A 3M4QA 3DMUA 3J80i 2Z6BA 3OTOQ 1JWSD 5A35A 3MHBA 1HFNA 2KQ3A 2OTLA 5JPNC 1A3TA 1WVLA 1S5FD 4B3RQ 2E5LQ 4ID6A 1GOZA 2QKIC 4CJ1B 2KBNA 4R4OA 3KJOA 1X65A 2NVTB 3M9BA 4A3JB 2F03A 1TT2A 3IKJA 4O0AA 5AFWA 3N52A 5C44B 1IYUA 4QIWB 3I73A 4XQNA 1YIJA 3D31A 3H15A 4IURA 3WOEA 3EBEA 3RZDH 3UDIA 1PTOD 3M85A 3AFPA 3S2HB 4LFCL 4HIDA 5CBAE 1KXLA 1CK1A 1JWMD 2LSSA 4B08A 3EROA 1EEID 4IPCA 3A7LA 3QOJA 4L8JA 5I2XA 2A6HD 2A19A 1KRSA 2XWBB 3OHXC 4FXGC 5C4XG 2H4OA 2F0OA 1FL0A 5IYCH 3OW2A 4OIJA 4UAIA 4P74A 2UXDQ 5LL6S 2SNMA 4X65L 1XPUA 3GTMB 2AQ2B 4BXXG 2UU9L 4OX9L 3W3AA 3K81C 3KDFB 2LY7A 3G71A 2WKDA 4PV1C 4DAMA 1RDPD 4OO1I 2NBFA 1TXYA 2F0GA 3KOJA 5EQ0A 2WB1G 3GTLH 2Y0SG 3KUPA 4C3IB 3RN5A 3RN2A 1NCVA 3BU2A 4K0KQ 4J8QA 5C0XG 3C2PA 3DM1A 1J5EQ 4IFDH 3WOFA 3TDQA 3EJIA 1QB5D 2EOTA 1TR5A 2L1BA 3SE0A 4Y7NB 1EY7A 3OWFA 5EKLA 4DR4Q 4KHPL 1UAPA 1QZGA 1K8AC 2KCTA 5DEHA 1TIID 2CFMA 1LT4D 1JICA 1EZ8A 2CVRA 2EYPA 2EY1A 5EPKA 5C6AA 1QUQB 2KCCA 1NY4A 4C3HH 4K6LA 5DM63 5FLMG 3T16A 5IP9H 3K5NA 4RHRA 1BF4A 1EWHA 3A8KE 2R6GA 4H13C 3MTSA 5IP7G 1Q1EA 4CDDC 1EIFA 4KN4C 1FVIA 3U58A 3NENA 1KTKA 4B3RL 5J39A 1TWAB 5CR3A 1EY9A 1VQ6A 1FD7D 3I56A 3A0JA 1YNXA 4FP5D 4RA8A 1B4OA 4BA1I 1D5ZC 1YNNC 1U4PA 3X3MA 1O7YA 2IT1A 2E2JH 3W2DA 1UWVA 3VYUA 1SYCA 4HCEA 4DNIA 2K52A 3AFQA 2F0VA 1HZBA 1LTID 4H02A 4HIOA 3NTHA 3CCRA 4LF9Q 3H0GG 4IFDJ 1T5XD 4ODGA 1YJ9A 3RNUA 1QWYA 1CUKA 4E6IA 1T9HA 2HHHQ 2E74C 3MXUA 1D7QA 1B9MA 1BBXC 5GAHC 1T5EA 4LF8Q 3HOVH 2L12A 4A3IG 3NBIA 2M2LA 3NHHA 3HKZB 3GQBA 3W1BA 2F0IA 4HEDA 4KN7C 3NPPA 2EXZA 4RWSC 1XPRA 1K28A 2EIFA 2UXDL 4IUNA 1Q8KA 4RGMA 1WJJA 4ME5A 5L37A 4JI2Q 4BBRH 3SVMA 2GN5A 1LV9A 4HMIA 2OT2A 1QNUA 4ZAIA 2FJ2A 4A3EB 3GTPB 1SJHD 2R7ZG 1SAPA 1UEAB 1TWCH 4FDBA 1KL9A 3HOZB 4HMJA 4YIJA 5K5PA 4XQQA 4FYDA 1EIGA 5IYDH 1WTOA 2VW9A 1K83H 4A3LH 1LTSD 4K0KL 3T56B 2PW7A 3DWAA 1J5EL 3IAYA 3JAMc 4IJLA 1F2YA 1GUSA 1UE1A 1RIPA 2L5TA 3K0XA 2RKSA 4A3DB 1PXUA 1WCMG 2N88A 1UEBA 1B8AA 1HNZQ 1V43A 1PTOF 1BCPB 1VQNA 4QUFA 2ZM6Q 3HOUH 4GOPC 1B50A 1PZID 3I4NG 4K5VA 3NBHA 3VA7A 4AIMA 1VQDA 4EX5A 3R8BA 1C0AA 3H09A 3FKIB 4EQPA 4IUQA 2JA7B 3GTJH 2N78A 2YTYA 4O2DA 4LF7Q 1I5FA 4MZ9A 4X3TA 2RHSB 3BS1A 1BVSA 1SRUA 5IYBH 5JOBA 1IKMA 1I50H 2N49A 1KC8C 4QJFA 4DR2Q 4KY5A 3EN2A 4POFA 5C4JH 1Y1WG 2E2HH 3P1HA 1G2TA 1L1OB 2BOSA 3CCQA 1WTHA 1YVCA 1RCVD 1G291 3GV3A 1ENFA 5FO9B 1WTRA 4A3BH 1YZ6A 1IYJB 2B2VC 1H9SB 2ZXPA 2Z4HA 4JBJA 3HOWH 3MAQA 4XTCS 3GO5A 2C35B 1PH2A 4LF9L 5KNBA 1JR0D 1KLGD 3ERSX 4C2MH 2NWGA 1STYA 3QG1A 1EWIA 3OSOA 2K5QA 1I6HH 1V1PA 2HHHL 3CCJA 2IY5B 1IKLA 3GDEA 1ZEQX 4WORA 1PH6A 4R8IA 2L4NA 1STBA 4LJZC 3NWTA 2QA4A 2UUBQ 1LT3D 2EPBA 4BBSH 2F0UA 4OIKA 3MZ5A 2QEJC 1SNMA 1PFBA 3MWYW 1RTNA 2Z4IA 1SNQA 1Z47A 3S15H 4BS9A 1DXMA 5IY0A 2ZXRA 4DV1L 3TREA 3H3VI 4JI2L 1JQYD 3RZDB 3K7UC 1AFPA 1Y1VG 2A6EC 4DNRB 1XJVA 4DK3C 2JK8A 1M90C 1ONLA 3S1RB 1Q82C 4ME3A 4GOPA 2PQAA 1DD2A 2WKCA 3J81j 1VQ5A 1I94L 2SDFA 1F2MA 3W1GA 1HFGA 5J3BA 1GUTA 2A1AA 4FXDA 2G9DA 2VB2X 4F7XA 3PF4A 1SYDA 1Y8NB 5IYCG 1VQ7A 4MNOA 2IHEA 3BVGA 2AKWB 3FPPA 4OXPA 4DV6L 5BN4A 3PSIA 1HNZL 2EJFC 5I4DA 2XWJB 2PCFB 4RHSA 3CPFA 1SSOA 2A5HA 2RHQB 1Y8PB 2IX3A 1KD1C 1VQKA 5FJ8H 1K3BC 1MIUA 2F0QA 4KKSA 2I5HA 2BH2A 2QEXA 1WYDA 3VYRA 1ICFB 2B2VA 3KF6B 4DKAC 3GTLB 1YBYA 2VQEL 4HJ9A 4LF7L 2LS01 4IFDG 5BR8Q 3ND9A 1LTBD 3D8GA 4DR2L 5D3DA 2Z0SA 4DV5Q 4KD4A 1RF2D 1EY8A 5C4HA 2X69A 3PIPA 1X3GA 1YEZA 4G4KA 1NNXA 2ZT9C 5IT9E 3ER0A 1CKNB 1I4GA 2CKZB 3U4VA 4C3HB 1FYCA 1IL8A 1ESFA 1JC7A 3DWQA 4ZKBB 4YY3Q 2M00A 2WB1E 4JBKA 1Z6HA 2Y0SE 1IHZA 1YITA 1S5BD 4JV5L 1F9PA 4TKOB 1AE3A 3H91A
chains in the Genus database with same CATH topology
3LWUA 2R3ZA 5M5WB 5C3XA 3BG3A 5G3LF 1SNDA 4O1NA 2ENBA 3M4OB 5KEEA 5NUCA 1D1KA 5ELBA 1LT5D 1ZXTA 3EFXD 4KJOA 1PZKD 1ZYRC 1GUWA 2Q8IB 1ENCA 2PQEA 5COYA 1AP0A 1DOLA 4H0LC 5EKKA 3HOYB 3OIQA 2V4DA 2JA8B 3OPOA 1QJOA 1I4HA 2MP1A 4X3UA 2B8FA 4IUVA 3SR1A 4FF2A 1RJTA 2L0CA 5EGTA 4HSVA 3S9WA 4K8JA 4J6HA 5IGBA 2EYOA 5IT9L 4O42A 1AEXA 3K0YA 5FO7B 3HOXB 3K5OA 2JEAI 2F0FA 4ILWA 1OO9B 2JSOA 3M4YA 1VF5C 3D3RA 1SE4A 3D6CA 1LTTD 2BDOA 1ZYRD 5IODA 4KK7A 2IL8A 4DXFA 3P20A 3J81L 1PTOB 2FFKB 2R93B 1PZJD 4F87A 1EL0A 3ND8A 1VMCA 1PRTD 3H94A 1EIHA 1O7ZA 1MBYA 4KKUA 1ESRA 1RKNA 2FHTA 3HOUB 1UUPA 1V8QA 2TSSA 5C0XI 3D4DA 1Q8IA 5EPJA 4K2KA 2O5JC 2CHBD 4DU9A 1X32A 5IIFA 1FNUA 2CW0D 2HDMA 4A3GB 4IUPA 4C1NK 4KY6A 4CKBA 1SE3A 1DOKA 1I4RA 3DEPA 4J1MA 4DK1A 3E0JA 5IGDA 3I4MB 2IX0A 4M1UB 4KI0A 4A3BB 3P75A 1TS4A 4RAUC 5K36G 4ABNA 5CYUA 4XDXA 5HURA 1AN8A 4PMBA 1LACA 4PMWA 1RHPA 2NVYB 2OXPA 2NUCA 4C3JB 4BBSB 5E4WC 1SFOB 1FNWA 4KV6A 1ICWA 3S15B 4XYQA 3RUZA 3GD7A 4N9PA 4CHTB 3C3LA 1PLFA 4ULLA 1KAAA 4EVOA 2F1MA 3IFDA 2SEBD 2HCIA 3NQIA 2HUGA 1QOHA 4F88A 1I4QA 2K03A 2IWHA 1R4PB 1CM9A 2FMCA 3LWEA 5KYLA 2I46A 1DOMA 2O5IC 3FDTA 2JXMB 2F0HA 2B2UC 2E75C 5CMDA 1QCBD 3JAME 3CKIB 2MGSA 3D4RA 1BNZA 2A68C 5CV5A 1WD0A 3H6MA 1GXDC 5EKIA 5KYIA 5C5MA 2HCCA 2KJXA 2EYFA 3QIAA 2QCPX 3QO2A 4NKLA 5FO8B 3RZOB 3D6WA 4DFAA 5C4XB 3K7AB 2JEBI 3O13A 4FF3A 2EYLA 4P2CB 3R93A 2KHSA 3AU7A 5EBDA 3V96A 5JVH3 1GJXA 1SXTA 2MUYA 1D5XC 3HP3A 1ILQA 2WB1B 2Y0SB 1EYCA 1XXGA 3A55A 1BXTA 5CV9A 1ZKOA 5IGCA 1KNEA 2EY6A 2RBMA 4K5WA 3Q0AA 3IFTA 1Y8OB 4X3SA 1GHKA 3G6JB 2CQAA 4ZYSA 1LABA 1PRTF 2PO4A 2A68D 1B44D 3DWPA 5IGGA 5D14A 4RKBA 4WJWA 3R2IA 1F77A 5I2YA 1PYWD 3MFGA 1FR3A 2K1BA 3TZDA 2B2UA 1U4MA 2F0NA 2RVLA 4G7OC 3K5LA 1KABA 2PMZB 1U4RA 3NUCA 4IUTA 2NN6H 1DJRD 2F0SA 3EQLC 1STGA 3J7AF 3EVQA 3TP7A 1WTPA 1JOOA 2F0DA 4HCSA 2KECA 1W6JA 3T13A 1BDOA 3H0GB 5ISRA 1SNPA 3FRPB 3R2TA 2WACA 2MPMA 3QJYA 1EFID 2RSNA 5FOBB 2KCNA 3TZUA 4A3IB 2SOBA 4H7BA 2XN9C 1W6KA 2A69C 4CJ2C 1DYQA 2RA4A 3K5MA 4NW2A 1FNVA 1CZWA 2BA1A 2B2TC 1EYDA 3DUZA 1I6VC 4U68A 4ZK9B 3URYA 2XRSD 1IW7C 1L0XB 5KRUA 2Q8RE 4DK0A 2R7ZB 4RH6A 1YNND 4IFDI 3L9AX 1JOQA 1TWFB 1E2WA 2LKVA 2PW5A 2C5CA 1GUOA 3HRZC 1HRJA 3CRKC 4MIUA 1AW7A 2JP1A 1WCMB 1XTCD 1C48A 3M3YB 2XRQD 4KMUC 2BA0A 3KBXA 3PIP3 3I4NB 2NTTA 5DAUA 5CV4A 3GTGB 1X3QA 3ONAB 2AQ1B 3QOLA 3K58A 2F4IA 1CHQD 3RMHA 3V05A 3M7NA 1SNOA 2B2WC 2ICIA 3PUWA 2L11A 3MA2B 1A3UA 3SK8A 1Y1WB 4G7HC 2SNSA 1HUNA 1MD2D 2NYZD 2VNUD 4QMGA 2DN8A 5K36H 3S2DB 1TU2B 1E2ZA 1SYEA 4XXEA 3TSSA 4KHVA 1CTMA 4F8MA 2B2TA 4RGTA 3T51B 1F9RA 1F9SA 3QB3A 1DONA 2RDFA 1D1IA 1MSGA 4OHJA 1EY6A 1ML0D 4FXKC 1PFNA 1VDZA 4Q0FA 2FMMA 3MXGA 2K01A 3PV0A 4KHZA 2BE5C 1M8AA 1G91A 3KK7A 5JPMC 1U9RA 4TSSA 4XYOA 1G2SA 1Y1VB 3OW7A 1CHPD 5LL6X 1I4PA 2PPBC 3U9SA 1CQFA 1EU3A 1SYBA 1H9MA 1NAPA 3IL8A 3Q22A 2JYOA 1TWHB 2K04A 2KA7A 1ET9A 2F3VA 2B2WA 5T1GA 3VR3A 3PMFA 1STHA 2HQEA 1LT6D 1TS5A 3VA5A 4I7ZC 3TMEA 4G7ZC 5I9PA 4FNFA 3X3NA 1LO5D 4PQXA 1Y69U 3U9OA 2PZWA 1ENAA 1DZ1A 1SNCA 2KEEA 1PRTB 1PDQA 1O7LA 2A6ED 4RCOA 5JJZA 4QB4A 4I65A 1XYIA 1R4QB 1CZGA 3WDNA 1SE2A 5LHY1 4K6DA 2M9VA 4EGVA 4QF4A 4R8NA 1CI3M 4V0BA 2O2LD 3NK9A 2K32A 2NN6G 3LNNA 3UI2A 4OGQC 4HAEA 2LFNA 2E2JB 2J4XA 2L55A 1B9NA 3M7GA 1TS2A 5IOCA 2PZTA 3KLSA 2EYJA 4C1NI 1KNAA 3R3OA 1D5MC 1EOTA 3OOCA 1II3A 1J8IA 2R61A 1H9SA 3HOVB 5CV7A 3D4WA 3TP5A 2EDGA 5T1IA 3C1FA 4DNTB 1SMYC 3SHLA 2A74C 4JBWA 1CA5A 2FINB 5JVG3 1STAA 3EA6A 4BBRB 5KNDA 3FVQA 1HHVA 3PUVA 1BUVT 5D3IB 3PIO3 5KIXA 3SK5A 1TWCB 2PZUA 3S1QB 5JAVA 3E6ZX 2PYKA 1YNJC 3PUXA 2HDLA 4FVMA 1K83B 2EE1A 2EY5A 3DEOA 1MSHA 5A2QE 1NUCA 1Q90A 5JEAH 1SEBD 1PFMA 1X3PA 1LTRD 5ELFA 5FLXE 2K5WA 4XQJA 4TQUS 3BVZA 2JA5B 1BQQT 3ERQA 3LX0A 2WINB 1RD9D 5E4XA 4LAAA 1WD1A 5FK9C 3GTJB 3KBGA 1HPCA 1AZPA 2K28A 1NR2A 1I50B 3J80E 3J7YW 1NR4A 3A56A 5C4JB 2E2HB 2WIIB 1KDAA 1EZ6A 2RSOA 1GHJA 5ELDA 3HOWB 2Z1CA 1YNJD 4C2MB 3NE5B 4KY7A 5JEAJ 1I6HB 1HQMC 5KNCA 2NZ1D 2XSCA 5A2QL 3DXJC 4BWGB 1QE6A 3H3VC 1GUNA 1CFMA 4K5XA 4CGYB 4JK1C 5CV6A 3RD4A 2WAQB 5DM73 5BN5A 3OWEB 1JE4A 4AYBB 1H9KA 4OO1H 2AWNA 3HG9A 1HA6A 1PTOC 4QUCA 1OXTA 3BDCA 1Z7TA 3AMUA 4IUUA 5EJWA 4R9WA 2VUMB 4IZ8A 2R92B 1RTOA 2QILA 2OF1A 5C3EB 4HR7B 3BYYB 4ZUIA 3QWNA 4LMQD 1BR9A 2B39A 4DAYA 3NQTA 5CV8A 2F0PA 2YYZA 2B2YC 1K8OA 2J7ZA 5J22A 2DY7A 1EY4A 1LLRD 1QG7A 3K57A 1TKWB 3OMCA 4IN3A 4XT3B 4RCNA 5M9OA 1Q12A 3MXPA 3E5SA 5E1FA 2KUMA 3SXHA 2IX1A 1VF7A 2AUKA 1EU4A 3L3OC 4DA2A 3S16B 3NTIA 4DXGA 4U673 4PMCA 1OXSC 5E3FA 2AWOA 4FF1A 3JAML 1A6XA 5EBCA 5C5LA 3FEWX 3VR5A 4S3SA 2ZXOA 4C3IG 4TRDA 3MXNA 3I70A 1S5ED 3SDZA 4K2LA 1JCKB 3GTOB 4K14A 1QILA 3VYSA 1CT1D 1V1PB 2RDGA 2F3WA 1L0YB 3NSWA 1O80A 2B2YA 3T53B 1O78A 1TVXA 2XVSA 2NTSA 2B63B 5M3MB 1JORA 1Q3LA 4UDUC 1G6ZA 3BVMA 2JA6B 2H1EA 1I3QB 3NP8A 5IGEA 1CQVA 4H44C 3J7AV 2DNCA 1HUMA 5EPLA 4NP5A 3N6RA 2D2CC 4V190 5KGUA 4BY1B 1BOSA 3BDLA 3VYTA 2F0TA 3P7JA 1XX8A 2G9HD 2EYMA 3ITPA 3G7LA 4WFN3 5M3FB 1EWCA 2BDNA 5IGFA 1DM0B 1CA6A 5JEAG 1ET6A 1S5CD 5I9OA 2AUJD 2K5DA 1F2LA 1K8MA 2RQXA 1EQTA 1STNA 5F2DA 5CBEE 2EJMA 1MGSA 3HZXA 1VCIA 4Q5VA 4QCLA 3NWSA 2F0KA 3S17B 3T4AC 4GZYC 1AZQA 2VXWA 4XT1B 1HQRD 3KLRA 4NDXA 1Q1BA 5C3WA 4B9WA 1D2BA 1UNSA 4CBVA 4CKCA 2WP8J 2XIWA 3MC0B 1BO0A 3Q24A 1PTOH 2K7VA 5G3LD 4KKTA 1DCZA 2A69D 4N9TA 2X6LA 1A2UA 2NN6I 2K05A 4Z9CB 2F0WA 4HN7A 4KJNA 2C9OA 1IW7D 4OO1G 1F9QA 3SK6A 1M4VA 1I4XA 4ZQ3A 1C4QA 3S1NB 4DGZA 1MI2A 1E0BA 3TP6A 4A93B 4NMZA 2ID0A 3SK4A 2EVBA 4HTHA 2KEDA 1A2TA 1TS3A 4L6TB 3TBIB 3A7AB 1KDBA 1HXYD 4C56C 2QF7A 2J0TD 1C8CA 3F2UA 3A8JE 4ZKCB 3OMGA 3FMCA 4OL7A 2F0LA 1H9RA 4RGOS 1TY0A 1BCPC 3I72A 4B9XA 3ZYYX 1LTGD 3I3CA 2F0MA 3VR6A 2VB3X 2BCOA 1WTWA 3K59A 3CU7A 4IALA 4MHEA 5CC4A 5TSSA 4DAPA 3TP8A 2EZVA 1HA5A 4KD3A 3BZDB 2KOLA 1EYAA 5BN3A 1B2TA 2OEOA 4BA2I 5M5XB 2WV6D 4CKEA 1EEFD 3CQZB 4A3KB 3VR2A 5FKAC 2BE5D 4EQOA 4ZUJA 3HGBA 1S5DD 1BCPD 2Z8LA 1OXXK 4DAVA 1STEA 2K6AA 4RGNA 3A8IE 3Q6SA 1A15A 3DHQA 4XIGS 2AQ3B 2TMPA 2X6GA 3L7ZC 3GP7A 5ELEA 2F0EA 1JWUD 2MJ8A 1SBBB 4BY7B 4MN3A 4C3HG 2PNRC 3HEJA 4HSPA 5CGKA 5I6WA 2K33A 5J1ZA 2ICEC 2RDHA 2D9UA 1PMRA 2D5DA 5C0XH 1NSNS 1LTAD 1IYVA 1VMPA 4L63B 4G57A 2E76C 3A54A 4LK1C 3GV6A 1H9JA 2I07B 3S1MB 2N55A 2O4XA 2B8GA 2Q8TA 3KLSX 3SEBA 3J81E 4RKLA 4FF4A 2LMCB 3I4LA 2XNAC 1PRTC 1EY0A 3GTQB 1SJED 1KLUD 3AB9A 1R9TB 3I90A 2NB0A 3BYTB 4KTAA 5ELCA 5HGTA 3BDOA 3NXWA 1WTQA 2YU9B 1A3VA 2CW0C 1SDFA 5C0XJ 1B3AA 3V2TA 3PUYA 2L9HA 1ILPA 2JE6I 2E2DC 1G8ZD 3PUZA 2IPKD 1HCZA 5D65A 1TWGB 5DNFA 4WRDA 2KVMA 1OXUA 3K6OA 1OXVA 1JB3A 1D6EC 3Q23A 1XWEA 1B53A 2QDBA 3MFYA 2A73B 2MHVA 3CRLC 4PNYA 1SMYD 4X3KA 1HTLD 2NVQB 4A3MB 4A3FB 5CORA 4DF7A 3I8ZA 2NVXB 3HS0C 1J9OA 2IW3A 4K8IA 1S4ZA 1TY2A 4ZLTF 1SYGA 2DY8A 1B1ZA 2D62A 3CHBD 3C1EA 3GTKB 2DNEA 3NTKA 3I91A 3OIPA 4EQNA 1JOKA 3RLFA 4ZRZA 2IJ0A 2GA4B 2E2IB 3MVVA 1FGBD 1V1OA 2EYHA 1EQVA 1GUGA 1BCPF 1F2ZA 3MEHA 3PO3B 1KDCA 5FLXL 3C46A 3KF8A 3TN2A 1TQOA 3PO2B 4M8AA 3FPUB 3S14B 4DN4M 1WTVA 1WTXA 5I6YA 4C3JG 4RFBA 2A6HC 4FO2A 1EY5A 2F0JA 5M5YB 1E2VA 4IQZA 1RODA 1SYFA 5C4ZA 1HTPA 1QNKA 2EJGC 3J80L 3VR4A 4CJ0B 1U4LA 2EY2A 3DMUA 1JWSD 5A35A 3MHBA 1HFNA 2KQ3A 5JPNC 1A3TA 1WVLA 1S5FD 4ID6A 1GOZA 2QKIC 4CJ1B 2NVTB 4A3JB 2F03A 1TT2A 3IKJA 5AFWA 3N52A 5C44B 1IYUA 4QIWB 3I73A 4XQNA 3D31A 4IURA 3WOEA 1PTOD 3M85A 3S2HB 5CBAE 1CK1A 1JWMD 4B08A 3EROA 1EEID 3A7LA 3QOJA 4L8JA 5I2XA 2A6HD 2XWBB 3OHXC 4FXGC 2H4OA 2F0OA 4OIJA 4UAIA 5LL6S 2SNMA 3GTMB 2AQ2B 3W3AA 2LY7A 2WKDA 4PV1C 1RDPD 4OO1I 2NBFA 2F0GA 5EQ0A 3KUPA 4C3IB 1NCVA 4J8QA 5C0XG 3C2PA 3DM1A 4IFDH 3WOFA 3TDQA 3EJIA 1QB5D 2EOTA 1TR5A 2L1BA 3SE0A 4Y7NB 1EY7A 3OWFA 5EKLA 1UAPA 5DEHA 1TIID 1LT4D 1JICA 1EZ8A 2CVRA 2EYPA 2EY1A 5EPKA 5C6AA 2KCCA 5DM63 4K6LA 3T16A 3K5NA 4RHRA 1BF4A 1EWHA 3A8KE 2R6GA 4H13C 3MTSA 1Q1EA 4KN4C 1KTKA 5J39A 1TWAB 5CR3A 1EY9A 1FD7D 4FP5D 4RA8A 4BA1I 1B4OA 1D5ZC 1YNNC 1U4PA 3X3MA 1O7YA 2IT1A 3W2DA 3VYUA 1SYCA 4HCEA 2F0VA 1LTID 3NTHA 4IFDJ 1T5XD 4ODGA 1QWYA 4E6IA 2E74C 3MXUA 1B9MA 1BBXC 1T5EA 2L12A 3NBIA 2M2LA 3NHHA 3HKZB 3GQBA 2F0IA 4HEDA 4KN7C 3NPPA 2EXZA 4RWSC 4IUNA 4RGMA 4ME5A 3SVMA 1LV9A 4HMIA 2OT2A 1QNUA 4ZAIA 2FJ2A 4A3EB 3GTPB 1SJHD 1SAPA 1UEAB 3HOZB 4HMJA 4YIJA 5K5PA 4XQQA 4FYDA 1EIGA 1WTOA 1LTSD 3T56B 2PW7A 3DWAA 3IAYA 1F2YA 1GUSA 2L5TA 2RKSA 4A3DB 1PXUA 2N88A 1V43A 1PTOF 1BCPB 4QUFA 1B50A 1PZID 4K5VA 3NBHA 3VA7A 3R8BA 3H09A 3FKIB 4EQPA 4IUQA 2JA7B 4X3TA 3BS1A 5JOBA 1IKMA 4KY5A 3P1HA 1G2TA 2BOSA 1RCVD 1G291 3GV3A 1ENFA 5FO9B 1WTRA 2B2VC 1H9SB 2ZXPA 2Z4HA 3MAQA 4XTCS 3GO5A 5KNBA 1JR0D 1KLGD 2NWGA 1STYA 3QG1A 3OSOA 2K5QA 1V1PA 1IKLA 1ZEQX 4WORA 4R8IA 2L4NA 1STBA 4LJZC 3NWTA 1LT3D 2EPBA 4OIKA 2F0UA 3MZ5A 2QEJC 1SNMA 1PFBA 3MWYW 1RTNA 2Z4IA 1SNQA 1Z47A 4BS9A 1DXMA 2ZXRA 1JQYD 3RZDB 1AFPA 2A6EC 4DNRB 1ONLA 3S1RB 1DD2A 2WKCA 2SDFA 1F2MA 1HFGA 1GUTA 4FXDA 2G9DA 2VB2X 4F7XA 1SYDA 1Y8NB 3BVGA 3FPPA 5BN4A 2EJFC 5I4DA 2XWJB 2PCFB 4RHSA 1SSOA 2A5HA 2IX3A 1Y8PB 2F0QA 4KKSA 3VYRA 2B2VA 3GTLB 2LS01 4IFDG 3ND9A 1LTBD 3D8GA 5D3DA 4KD4A 1RF2D 1EY8A 5C4HA 2X69A 4G4KA 2ZT9C 5IT9E 1I4GA 4C3HB 1FYCA 1IL8A 1ESFA 1JC7A 3DWQA 4ZKBB 2M00A 1Z6HA 1IHZA 1S5BD 1F9PA 4TKOB 3H91A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JVH 3;  3PIP 3;  5DM6 3;  5JVG 3;  4U67 3;  4WFN 3;  3PIO 3;  5DM7 3; 
#chains in the Genus database with same CATH topology
 3LWU A;  1E1T A;  2R3Z A;  5M5W B;  5C3X A;  3BG3 A;  5G3L F;  1SND A;  5LMU Q;  2UUB L;  4O1N A;  2ENB A;  3M4O B;  5KEE A;  1QZH A;  5NUC A;  1D1K A;  5ELB A;  1LT5 D;  1ZXT A;  3EFX D;  4KJO A;  1PZK D;  1ZYR C;  1GUW A;  2Q8I B;  1ENC A;  2UXC Q;  2PQE A;  5COY A;  3GTO H;  1AP0 A;  1DOL A;  5FLM H;  4H0L C;  5EKK A;  3HOY B;  3OIQ A;  3OYY A;  1Q81 C;  4EQ5 A;  4UP9 A;  2V4D A;  2JA8 B;  1KAW A;  3OPO A;  1EFW A;  1QJO A;  2OWO A;  1I4H A;  2MP1 A;  2B63 H;  1X56 A;  4X3U A;  1PYB A;  2B8F A;  4IUV A;  3SR1 A;  4FF2 A;  3HOV G;  1RJT A;  2PMZ E;  4OEL B;  2L0C A;  1BKB A;  4R4C A;  5EGT A;  4HSV A;  1C7Y A;  3S9W A;  4K8J A;  4J6H A;  5IGB A;  1I3Q H;  2EYO A;  5IT9 L;  4O42 A;  1Q86 C;  2ASB A;  1AEX A;  3K0Y A;  5FO7 B;  4HIK A;  3HOX B;  4ALP A;  2MO1 A;  2ZTE A;  1S72 A;  3K5O A;  2JEA I;  4B3M Q;  2RF4 A;  1LTL A;  3G48 A;  4BBR G;  2F0F A;  3KYH C;  4ILW A;  4A75 A;  1OO9 B;  2JSO A;  3M4Y A;  1GM5 A;  1VF5 C;  3D3R A;  4GN4 B;  1SE4 A;  4BY1 H;  3D6C A;  1LTT D;  4A3I H;  2BDO A;  1ZYR D;  5IYD G;  4A3L G;  5IOD A;  3HKZ E;  2WFW A;  4KK7 A;  2IL8 A;  2K5H A;  4DXF A;  3P20 A;  3BZC A;  5AJ3 L;  3J81 L;  1PTO B;  5BR8 L;  2FFK B;  2R93 B;  1PZJ D;  4F87 A;  1EL0 A;  3ND8 A;  4N8X 1;  1VMC A;  1PRT D;  3H94 A;  1PV4 A;  3J81 i;  1EIH A;  1O7Z A;  1MBY A;  4KKU A;  1ESR A;  1RKN A;  2FHT A;  2JA5 G;  3HOU B;  4JG2 A;  1UUP A;  4GKJ L;  1V8Q A;  2R7Z H;  2HD3 A;  2TSS A;  5C0X I;  3D4D A;  1Q8I A;  5EPJ A;  4K2K A;  4JI6 Q;  2O5J C;  2CHB D;  4DU9 A;  4YY3 L;  2BH8 A;  1X32 A;  5IIF A;  1FNU A;  2CW0 D;  2HDM A;  3B6Y A;  2RCF A;  1PH8 A;  3S17 H;  4A3G B;  4IUP A;  4C1N K;  1JB7 A;  5IYB G;  5H1S E;  4KY6 A;  4CKB A;  1PVO A;  1GD7 A;  1DOK A;  1I4R A;  1SE3 A;  3DEP A;  4J1M A;  3E0J A;  4DK1 A;  5IGD A;  2IX0 A;  3I4M B;  2IHF A;  2H5X A;  4M1U B;  2UXC L;  1Q46 A;  4KI0 A;  4A3B B;  3P75 A;  1TS4 A;  1SN8 A;  4RAU C;  5GAE C;  3HOW G;  3Q8D A;  5K36 G;  4ABN A;  5CYU A;  1VQE A;  1XMQ L;  1N36 L;  3KLW A;  4XDX A;  5HUR A;  1AN8 A;  4PMB A;  1LAC A;  4PMW A;  4YCW A;  1RHP A;  2NVY B;  2OXP A;  2NUC A;  2WAQ G;  4C3J B;  1PYS B;  4BBS B;  4AYB G;  5E4W C;  1SFO B;  1FNW A;  4KV6 A;  3S1N H;  3S2D H;  1ICW A;  1V1Q A;  3S15 B;  4XYQ A;  3RUZ A;  3GD7 A;  2MQH A;  5ELN A;  4L5R C;  4A93 H;  4N9P A;  4B3M L;  1SLJ A;  4CHT B;  3C3L A;  1PLF A;  4ULL A;  1KAA A;  4EVO A;  2F1M A;  2VUM G;  5JJL A;  3IFD A;  2SEB D;  2K14 A;  3ICE A;  2R92 G;  2HCI A;  3NQI A;  2HUG A;  1QOH A;  4F88 A;  5C3E G;  1I4Q A;  2K03 A;  2IWH A;  1XMO Q;  1R4P B;  4JBM A;  1CM9 A;  2G5D A;  2FMC A;  3LWE A;  4L5T A;  5KYL A;  2I46 A;  1DOM A;  2O5I C;  3FDT A;  1X55 A;  1FJG Q;  2JXM B;  2F0H A;  2B2U C;  2E75 C;  1IBM Q;  5CMD A;  1QCB D;  3JAM E;  1N32 Q;  3CKI B;  1NBW A;  1B70 B;  2MGS A;  1Y1V H;  3D4R A;  1BNZ A;  3VDY A;  1YHB A;  2A68 C;  5CV5 A;  3PIO A;  1WD0 A;  3H6M A;  1GXD C;  5EKI A;  5KYI A;  5C5M A;  4DV2 Q;  2HCC A;  1PH7 A;  2KJX A;  2EYF A;  5FJ8 G;  3QIA A;  4A4I A;  4JI6 L;  2QCP X;  3QO2 A;  4NKL A;  5FO8 B;  3RZO B;  3D6W A;  4DFA A;  2PI2 E;  5C4X B;  3AYH B;  1UE5 A;  3K7A B;  1N8R C;  1TWH H;  2JEB I;  3O13 A;  1MJC A;  4FF3 A;  4GKK Q;  2EYL A;  4P2C B;  3R93 A;  2KHS A;  2ALY B;  1L2F A;  3AU7 A;  3CW2 C;  4HJ5 A;  2ES2 A;  5EBD A;  3V96 A;  1X3E A;  5JVH 3;  4DV7 Q;  1GJX A;  1SXT A;  2MUY A;  1D5X C;  5M5X H;  3HP3 A;  1ILQ A;  4JI4 L;  2WB1 B;  2Y0S B;  1EYC A;  1XXG A;  3A55 A;  1BXT A;  3CQZ H;  4OWW B;  4A3K H;  5CV9 A;  2VL6 A;  3TRZ A;  1ZKO A;  5IGC A;  3T1H Q;  1EQQ A;  1KNE A;  2EY6 A;  2RBM A;  1NJI C;  4A76 A;  4K5W A;  3Q0A A;  3UE1 A;  3IFT A;  5FLX c;  1Y8O B;  4X3S A;  1GHK A;  3G6J B;  2CQA A;  4ZYS A;  1LAB A;  1PRT F;  2PO4 A;  2A68 D;  2CCZ A;  2L15 A;  1B44 D;  2B29 A;  3DWP A;  5IGG A;  3F8T A;  5D14 A;  1L0W A;  4JI1 L;  4RKB A;  4WJW A;  3R2I A;  3AQQ A;  1F77 A;  3I55 A;  1NMF A;  5I2Y A;  1PYW D;  3MFG A;  1FR3 A;  2K1B A;  2B2U A;  3TZD A;  1U4M A;  3OTO L;  2ZJP A;  4A3C H;  2F0N A;  2RVL A;  5LMN Q;  4G7O C;  3DLL A;  3J80 c;  2B63 G;  2E5L L;  3K5L A;  5M3M G;  1KAB A;  2PMZ B;  4BY7 H;  1XMO L;  1U4R A;  3NUC A;  4IUT A;  2NN6 H;  4UP7 A;  4IOA A;  2JA6 G;  1DJR D;  2F0S A;  1DGS A;  3EQL C;  4B3T Q;  1STG A;  4L5S A;  3J7A F;  1KHI A;  4CDF C;  3EVQ A;  3TP7 A;  1WTP A;  3BZK A;  1JOO A;  4DPG A;  2F0D A;  2R7D A;  1VQC A;  2KEC A;  1PFS A;  4HCS A;  1W6J A;  3T13 A;  1BDO A;  1N32 L;  3H0G B;  5ISR A;  3MEF A;  1SNP A;  1VQL A;  3CCV A;  3U50 C;  3FRP B;  3R2T A;  2WAC A;  4DV2 L;  2MPM A;  2VQF Q;  3QJY A;  1EFI D;  4BY1 G;  2RSN A;  5FOB B;  4GOP B;  2KCN A;  3L0O A;  2D0O A;  4JVZ A;  3TZU A;  2ZTD A;  1U0L A;  4A3I B;  1Y14 B;  1VQG A;  2SOB A;  4H7B A;  2XN9 C;  1W6K A;  4LNQ A;  2A69 C;  4CJ2 C;  1DYQ A;  2RA4 A;  5M3F G;  3K5M A;  1MJE A;  4GKK L;  2CH4 A;  1SR3 A;  4NW2 A;  1FNV A;  1CZW A;  2BA1 A;  2B2T C;  3G4S A;  1EYD A;  3DUZ A;  1I6V C;  4U68 A;  1VQF A;  2YTV A;  4ZK9 B;  4DV7 L;  3URY A;  3STB C;  2YU9 H;  2XRS D;  1IW7 C;  2GVA A;  1L0X B;  5KRU A;  2Q8R E;  4DK0 A;  1IBK Q;  2R7Z B;  4RH6 A;  3S1Q H;  1YNN D;  4IFD I;  5GRO A;  3L9A X;  4WJ3 M;  1JOQ A;  1TWF B;  1E2W A;  2LKV A;  2PW5 A;  2C5C A;  3T1H L;  1GUO A;  2HIX A;  1VS0 A;  3HRZ C;  1HRJ A;  4R4T A;  3F1Z A;  4JC0 A;  1X3F A;  3CRK C;  4MIU A;  1TWG H;  1AW7 A;  4X64 Q;  4DR4 L;  4R4I A;  4JI0 Q;  2YTX A;  2JP1 A;  3PGZ A;  1WCM B;  1N9W A;  1XTC D;  4YWM A;  1C48 A;  2NZO A;  2JA5 H;  2XRQ D;  1VQJ A;  4KMU C;  3M3Y B;  2JN4 A;  2BA0 A;  2FXQ A;  4POG A;  4LF6 Q;  3KBX A;  3PIP 3;  3I4N B;  2GVB A;  2NTT A;  5DAU A;  5CV4 A;  3GTG B;  1X3Q A;  3ONA B;  2AQ1 B;  3QOL A;  2NVQ H;  1VQA A;  3K58 A;  2F4I A;  1CHQ D;  5LMN L;  3RMH A;  3V05 A;  3M7N A;  1SNO A;  2B2W C;  3KDF A;  2ICI A;  3PQI A;  3PUW A;  2L11 A;  3MA2 B;  1A3U A;  3SK8 A;  1Y1W B;  2KHI A;  4G7H C;  2SNS A;  1HUN A;  4B3T L;  1MD2 D;  2NYZ D;  2VNU D;  4QMG A;  2N3S A;  4YCV A;  3GTK H;  2DN8 A;  5K36 H;  3S2D B;  1TU2 B;  1ASZ A;  1E2Z A;  1SYE A;  4XXE A;  3TSS A;  4A93 G;  4KHV A;  1WI5 A;  2E2I H;  1PH3 A;  3U4Z A;  1NE3 A;  4J15 A;  1CTM A;  4F8M A;  2B2T A;  4RGT A;  4DV0 Q;  2VQF L;  3F2D A;  3T51 B;  1F9R A;  1F9S A;  3QB3 A;  1DON A;  4LF8 L;  4LFB Q;  2RDF A;  3PO3 H;  1D1I A;  1MSG A;  4OHJ A;  1EY6 A;  1IBL Q;  1ML0 D;  3F2C A;  2WAQ E;  3UDG A;  4FXK C;  1N34 Q;  3PO2 H;  1PFN A;  4AYB E;  1VDZ A;  4Q0F A;  2FMM A;  3MXG A;  3S14 H;  2K01 A;  3PV0 A;  4KHZ A;  2BE5 C;  2CQO A;  2KHJ A;  1M8A A;  2UXB Q;  4HJ7 A;  1G91 A;  3KK7 A;  5JPM C;  1U9R A;  1B7Y B;  1MHW C;  1B3Q A;  4TSS A;  4XYO A;  3I4O A;  2VUM H;  1G2S A;  4QL5 A;  1Y1V B;  4LWC A;  3OW7 A;  5LMN W;  5HGQ A;  1CHP D;  4GLA C;  2R92 H;  4UPA A;  5LL6 X;  1HNX Q;  1I4P A;  2PPB C;  5C3E H;  3U9S A;  1CQF A;  1EU3 A;  4QY7 A;  1SYB A;  1H9M A;  4YHH Q;  1NAP A;  3CCL A;  4JYA Q;  3IL8 A;  3Q22 A;  2JYO A;  1VQM A;  1U5K A;  1SRO A;  1TWH B;  4JI5 Q;  4DK6 C;  2K04 A;  2KA7 A;  1ET9 A;  4X64 L;  2F3V A;  1A63 A;  3TS0 A;  2B2W A;  2EXD A;  5T1G A;  3VR3 A;  3PMF A;  4CDC C;  1STH A;  2HQE A;  1LT6 D;  2ZM6 L;  1TS5 A;  2NVT H;  3VA5 A;  4I7Z C;  5IE8 A;  1A62 A;  3TME A;  4A3J H;  4G7Z C;  1P16 A;  5I9P A;  1X54 A;  4LF6 L;  4FNF A;  3X3N A;  1P8L A;  1LO5 D;  3A5Z B;  4PQX A;  1Y69 U;  4NXN Q;  3U9O A;  2PZW A;  1ENA A;  4A3K G;  1DZ1 A;  2OQ0 A;  1V9P A;  1SNC A;  2KEE A;  3CPW A;  1PRT B;  3L2P A;  5EAY A;  1PDQ A;  3S2H H;  1O7L A;  1WFQ A;  4DR7 Q;  4PG3 A;  2A6E D;  4RCO A;  5JJZ A;  1PH1 A;  4QB4 A;  4I65 A;  4DR5 Q;  1XYI A;  1R4Q B;  1CZG A;  3WDN A;  1SE2 A;  5LHY 1;  1PH9 A;  3I2Z A;  2MNA A;  2QDL A;  4KLK A;  3S16 H;  3KF8 B;  4K6D A;  2M9V A;  4EGV A;  4QF4 A;  3RLO A;  4R8N A;  4A3C G;  1CI3 M;  4V0B A;  2O2L D;  1QVC A;  1CSQ A;  3NK9 A;  4BY7 G;  4LFB L;  2E8G A;  2K32 A;  2NN6 G;  3LGJ A;  3LNN A;  3UI2 A;  4C3I H;  1IBL L;  3UE0 A;  1KIX A;  4OGQ C;  4HAE A;  2LFN A;  1N34 L;  2E2J B;  2J4X A;  2L55 A;  2UXB L;  1B9N A;  3M7G A;  4Y7N H;  1TS2 A;  4AH6 A;  1BBU A;  2PZT A;  5IOC A;  3F2B A;  4LUV A;  3KLS A;  2K5V A;  2EYJ A;  4C1N I;  1KNA A;  3R3O A;  1D5M C;  1EOT A;  3OOC A;  5M3M H;  3CF5 A;  1HNX L;  1XNQ Q;  1II3 A;  1J8I A;  2R61 A;  2DGY A;  4CDE C;  1H9S A;  3HOV B;  2JA6 H;  1IL2 A;  5CV7 A;  4YHH L;  3D4W A;  5JJK A;  3TP5 A;  2EDG A;  5T1I A;  3C1F A;  1NTG A;  4DNT B;  1SMY C;  3SHL A;  2A74 C;  1OTC A;  4JBW A;  1CA5 A;  3UDF A;  2FIN B;  5JVG 3;  4OWX B;  1STA A;  3EA6 A;  4BBR B;  5KND A;  3FVQ A;  2K50 A;  1VQP A;  3PUV A;  1HHV A;  1BUV T;  4L5Q A;  2YV5 A;  5D3I B;  3M4P A;  3PIO 3;  5KIX A;  3SK5 A;  1TWC B;  2PZU A;  2OTJ A;  3S1Q B;  4NXN L;  5JAV A;  3E6Z X;  2ZTC A;  1NMG A;  2PYK A;  1YNJ C;  3PUX A;  2HDL A;  4FVM A;  1K83 B;  2EE1 A;  2EY5 A;  2K5N A;  3DEO A;  1MSH A;  5A2Q E;  5M3F H;  3CXC A;  1NUC A;  1EUJ A;  1Q90 A;  5JEA H;  1PH5 A;  4DR7 L;  4DV5 L;  1SEB D;  1PFM A;  1X3P A;  1LTR D;  4R4Q A;  1RL2 A;  3T1Y Q;  4DR5 L;  5ELF A;  5FLX E;  2ATW A;  2K5W A;  2Q2H A;  4P75 A;  4XQJ A;  2KCM A;  4TQU S;  3BVZ A;  2JA5 B;  4JOI C;  4JW0 A;  1BQQ T;  4PZ6 A;  3HKS A;  3ERQ A;  1XNR Q;  3LX0 A;  2WIN B;  1RD9 D;  5E4X A;  4IPG A;  4NB3 A;  1A0I A;  4LAA A;  1WD1 A;  5FK9 C;  3GTJ B;  3KBG A;  3CC7 A;  4A3M G;  4A3F G;  1HPC A;  1AZP A;  2I5L X;  4A3E H;  2K28 A;  4IO9 A;  4UP8 A;  5LMU L;  4LFC Q;  1CKM A;  4X62 Q;  1NR2 A;  3GTP H;  1I50 B;  1BBW A;  3J80 E;  3J7Y W;  1NR4 A;  3A56 A;  5C4J B;  3HOZ H;  3RR5 A;  2E2H B;  2WII B;  3KF6 A;  3ULJ A;  4X6A H;  1KDA A;  1EZ6 A;  2RSO A;  1GHJ A;  5ELD A;  3HOW B;  2JQO A;  2Z1C A;  4ZCK A;  2DJG C;  4A3D H;  1YNJ D;  3SGI A;  4C2M B;  3NE5 B;  4KY7 A;  5JEA J;  1I6H B;  1HQM C;  2QGQ A;  5DLQ E;  5KNC A;  2NZ1 D;  2ZJQ A;  2XSC A;  5A2Q L;  3DXJ C;  4BWG B;  1QE6 A;  2JJQ A;  3H3V C;  1GUN A;  1CFM A;  4K5X A;  1CKN A;  4JK1 C;  4CGY B;  3PO3 G;  5CV6 A;  3RD4 A;  2WAQ B;  5DM7 3;  5BN5 A;  1Q7Y C;  3OWE B;  1JE4 A;  4AYB B;  1JT8 A;  2F3I A;  1H9K A;  2JA7 H;  4OO1 H;  2AWN A;  3HG9 A;  3PO2 G;  1W2B A;  2NZH A;  1HA6 A;  1PTO C;  4QUC A;  1XTD A;  4LFA Q;  1OXT A;  4LF4 Q;  3BDC A;  1KRT A;  1Z7T A;  4PZ8 A;  3AMU A;  4IUU A;  3K80 C;  5EJW A;  1GKH A;  4R9W A;  2VUM B;  4IZ8 A;  4UHV A;  1K3R A;  4DR6 Q;  2R92 B;  1RTO A;  2ZJR A;  2QIL A;  2OF1 A;  1XPO A;  4JOI A;  5C3E B;  4HR7 B;  2DUD A;  3BYY B;  4ZUI A;  3QWN A;  4LMQ D;  1BR9 A;  1EYG A;  4WJ4 A;  1HH2 P;  2B39 A;  4DAY A;  3NQT A;  5CV8 A;  2F0P A;  2YYZ A;  2B2Y C;  1K8O A;  2LXK A;  2J7Z A;  4DUY Q;  3T1Y L;  5J22 A;  2DY7 A;  4A3J G;  3J81 c;  1EOV A;  4Y52 H;  1LLR D;  1EY4 A;  1QG7 A;  1VQH A;  4P71 A;  5C44 G;  3K57 A;  1XNR L;  1VQB A;  1TKW B;  4RMF A;  3OMC A;  4IN3 A;  4XT3 B;  1HNW Q;  4RCN A;  5M9O A;  1Q12 A;  2XGT A;  3PF5 A;  1J6Q A;  4X62 L;  3MXP A;  4IOC A;  3RLN A;  3E5S A;  1K73 C;  3S1R H;  2OQK A;  5E1F A;  2KUM A;  3SXH A;  3CCU A;  1K0R A;  1VF7 A;  2IX1 A;  2AUK A;  3NBH B;  2VS1 A;  1EU4 A;  3L3O C;  2B3G A;  2R7F A;  4GNX C;  1HJP A;  4DA2 A;  3CAM A;  3S16 B;  3NTI A;  1VQ4 A;  4DXG A;  4QQB X;  2I0Q A;  1VQ8 A;  4U67 3;  1E7Z A;  4PMC A;  1OXS C;  5E3F A;  1YJW A;  2VZA A;  4IPH A;  1QVF A;  4AQY Q;  2V1C C;  2AWO A;  4FF1 A;  3JAM L;  3DM3 A;  1A6X A;  5EBC A;  5C5L A;  3FEW X;  3VR5 A;  4S3S A;  2ZXO A;  4C3I G;  4TRD A;  3MXN A;  3I70 A;  4APV A;  3A5U A;  2Q2T A;  1S5E D;  3JAM i;  3SDZ A;  4K2L A;  1JCK B;  3HFZ B;  3GTO B;  4LFA L;  4K14 A;  4LF4 L;  1QIL A;  3VYS A;  1LYL A;  1CKO A;  1CT1 D;  2XTI A;  1V1P B;  1IZ6 A;  2RDG A;  2F3W A;  1L0Y B;  3ULP A;  3NSW A;  1O80 A;  2B2Y A;  3T53 B;  1O78 A;  4DR6 L;  1TVX A;  1JE5 A;  2XVS A;  2NTS A;  2B63 B;  5M3M B;  1JOR A;  1Q3L A;  4UDU C;  2RCN A;  1G6Z A;  1K8G A;  3BVM A;  2JA6 B;  2H1E A;  1K9M C;  1FJG L;  1I3Q B;  3NP8 A;  5IGE A;  1CQV A;  1HZA A;  3CP0 A;  5M5W H;  4H44 C;  3J7A V;  1IBM L;  1W3S A;  3PCO B;  1VQ9 A;  2DNC A;  1E24 A;  1ASY A;  3M4O H;  1HUM A;  5IWA Q;  4DUY L;  5EPL A;  4NP5 A;  3N6R A;  4DR1 Q;  4HJA A;  3S1M H;  2D2C C;  4V19 0;  3S24 A;  1E3P A;  5KGU A;  2PQA B;  4BY1 B;  3HOY H;  3CME A;  1BOS A;  3BDL A;  4GNX A;  2VY3 A;  3VYT A;  2F0T A;  1HNW L;  4I7A A;  4NXM Q;  3P7J A;  1XX8 A;  4OON A;  2G9H D;  2JA8 H;  3GTQ H;  2EYM A;  3ITP A;  3W5O A;  3G7L A;  2Z6K C;  4WFN 3;  5M3F B;  1EWC A;  1R9T H;  2BDN A;  5IGF A;  2UUA Q;  1DM0 B;  2F4V Q;  1CA6 A;  2AHO B;  2EQS A;  5JEA G;  1ET6 A;  1S5C D;  5I9O A;  2AUJ D;  3HKZ G;  1PA6 A;  4JPB W;  2K5D A;  1F2L A;  2KEN A;  1K8M A;  2RQX A;  1EQT A;  3HOX H;  1STN A;  2F52 A;  4DV1 Q;  5F2D A;  3FHW A;  1IXR A;  5CBE E;  4DV3 Q;  2EJM A;  3CC2 A;  3EIV A;  2K75 A;  1MGS A;  3HZX A;  4X66 Q;  1VCI A;  4GN5 A;  4Q5V A;  3NWS A;  3KJP A;  4QCL A;  2F0K A;  3S17 B;  4QGU A;  4A3E G;  4OEM B;  3H3V H;  3T4A C;  4AQY L;  4GZY C;  1AZQ A;  2VXW A;  4XT1 B;  1HQR D;  3HOZ G;  2LXJ A;  3KLR A;  4NDX A;  1Q1B A;  4GLV B;  1I94 Q;  5C3W A;  4B9W A;  1D2B A;  1UNS A;  4CBV A;  2QW7 A;  4CKC A;  2WP8 J;  3E9I A;  2XIW A;  3MC0 B;  4DR3 Q;  1BO0 A;  3Q24 A;  1PTO H;  5GAD C;  2K7V A;  4MTK A;  4YCU A;  4LW1 A;  5G3L D;  2R93 H;  3JC6 6;  4KKT A;  4A3D G;  1DCZ A;  2A69 D;  1O7I A;  4DV6 Q;  4OWT B;  4A3M H;  4N9T A;  4A3F H;  2X6L A;  1A2U A;  2NN6 I;  2K05 A;  4Z9C B;  2NVX H;  2F0W A;  4HN7 A;  3J7Z C;  3FKI G;  4JI3 Q;  4KJN A;  1SE8 A;  4PZ7 A;  3STB D;  1PH4 A;  2JA7 G;  2C9O A;  1IW7 D;  4OO1 G;  1F9Q A;  2VQE Q;  1VQI A;  3SK6 A;  3CCM A;  1M4V A;  1I4X A;  4ZQ3 A;  4A3G H;  1C4Q A;  3S1N B;  4UY8 C;  4DGZ A;  1MI2 A;  1E0B A;  3TP6 A;  2Z6K A;  4A93 B;  3CC4 A;  4NMZ A;  3I4M H;  2ID0 A;  3SK4 A;  2EVB A;  4HTH A;  5IWA L;  2KED A;  1A2T A;  4HJ8 A;  1TS3 A;  5E7N A;  4DR1 L;  4L6T B;  4LUO A;  4N8F A;  3TBI B;  4GN3 B;  3A7A B;  1KDB A;  4DV4 Q;  1YI2 A;  1HXY D;  1QUQ A;  4C56 C;  2QF7 A;  2J0T D;  1C8C A;  3F2U A;  4NXM L;  3A8J E;  4ZKC B;  3OMG A;  3FMC A;  4OL7 A;  4JV5 Q;  2F0L A;  3A74 A;  2UUC Q;  2UUA L;  2F4V L;  1H9R A;  2NVY H;  3TEH B;  4RGO S;  1TY0 A;  2MO0 A;  4C3J H;  2PNH A;  1BCP C;  3I72 A;  4B9X A;  3ZYY X;  1LTG D;  5M5Y H;  1X9N A;  3I3C A;  1SFO H;  2F0M A;  1A8V A;  3VR6 A;  1LUZ A;  1LM0 A;  2VB3 X;  4GLX A;  2BCO A;  1WTW A;  1IBK L;  3K59 A;  3CU7 A;  4IAL A;  3WWV A;  2CWP A;  4MHE A;  5CC4 A;  4DV3 L;  1AE2 A;  5TSS A;  4X66 L;  4DAP A;  3TP8 A;  1GO3 E;  4JCV E;  2DJF C;  4JI0 L;  1JJG A;  2EZV A;  1L1O C;  4YWK A;  1HA5 A;  4KD3 A;  3BZD B;  2KOL A;  1EYA A;  5BN3 A;  2Q2I A;  4DR3 L;  1B2T A;  5C44 H;  2OEO A;  4YWL A;  4BA2 I;  5M5X B;  1N33 Q;  1K0S A;  2WV6 D;  1S3O A;  1HR0 Q;  4QIW E;  4CKE A;  1EEF D;  2K4K A;  4P72 A;  3CD6 A;  3CQZ B;  4A3K B;  3VR2 A;  5FKA C;  2BE5 D;  4EQO A;  3E9H A;  2A8V A;  4ZUJ A;  3HGB A;  1S5D D;  2JA9 A;  1BCP D;  2Z8L A;  4RG1 A;  3RZO H;  1OXX K;  4JI3 L;  4DAV A;  1STE A;  2K6A A;  4RGN A;  5C4X H;  3A8I E;  3Q6S A;  1A15 A;  3DHQ A;  3K7A H;  4XIG S;  2AQ3 B;  1SMX A;  5AJ3 Q;  2TMP A;  2X6G A;  4JI8 Q;  3GTM H;  4B3S Q;  3L7Z C;  3GP7 A;  5ELE A;  4BXX H;  2F0E A;  1JWU D;  1D8L A;  4DUZ Q;  4DV0 L;  2MJ8 A;  4DV4 L;  2Q2U A;  1SBB B;  4GKJ Q;  1C9O A;  4BY7 B;  4MN3 A;  4C3H G;  2PNR C;  3HEJ A;  4HSP A;  5CGK A;  5I6W A;  5IP9 G;  1FGU A;  2K33 A;  3K8A A;  2HIV A;  5J1Z A;  2ICE C;  3UDX A;  2RDH A;  2D9U A;  1PMR A;  4LF5 Q;  2D5D A;  5C0X H;  1NSN S;  2UUC L;  1G51 A;  1LTA D;  3NEL A;  3D0F A;  1IYV A;  3ULL A;  1VMP A;  3CCS A;  1X6O A;  1AH9 A;  4L63 B;  3E0E A;  3ZJY C;  4G57 A;  2E76 C;  3A54 A;  1EIY B;  4LK1 C;  1HZC A;  1UE7 A;  1L1O A;  3GV6 A;  1H9J A;  2I07 B;  3S1M B;  2HQL A;  2N55 A;  2O4X A;  2B8G A;  2Q8T A;  3KLS X;  3SEB A;  3J81 E;  3HOY G;  1YHQ A;  4RKL A;  5IP7 H;  4JI7 Q;  4FF4 A;  4JYA L;  2LMC B;  1XMQ Q;  3I4L A;  4IPD A;  2XNA C;  3CMA A;  1N36 Q;  3E3X A;  1PRT C;  1EY0 A;  2JA8 G;  4JI5 L;  2AMC B;  3GTQ B;  2P5Z X;  3CCE A;  4DAY B;  1TWA H;  2HT1 A;  1SJE D;  1KLU D;  3AB9 A;  1KQS A;  1R9T B;  2N8N A;  3I90 A;  4IJH A;  2NB0 A;  3BYT B;  4KTA A;  3BJU A;  5ELC A;  5HGT A;  3BDO A;  3NXW A;  1WTQ A;  4MTN A;  5GQO A;  3G6E A;  1A3V A;  2YU9 B;  4GS3 A;  2CW0 C;  1SDF A;  1N33 L;  3HOX G;  2CH4 W;  5C0X J;  3H0G H;  1E22 A;  1B3A A;  1HR0 L;  3V2T A;  2I5M X;  3PUY A;  2L9H A;  1ILP A;  3TS2 A;  2JE6 I;  2E2D C;  1G8Z D;  3PUZ A;  2IPK D;  1HCZ A;  5D65 A;  1TWG B;  5DNF A;  4WRD A;  1HZ9 A;  2KVM A;  5JJI A;  1OXU A;  3K6O A;  2PI2 A;  3QR8 A;  1OXV A;  1JB3 A;  1YHA A;  1D6E C;  3Q23 A;  1XWE A;  1B53 A;  2QDB A;  1S40 A;  4R1J A;  3MFY A;  2A73 B;  3TQY A;  4JI8 L;  2R93 G;  3NEM A;  4B3S L;  2MHV A;  3CRL C;  4PNY A;  1SMY D;  3J7A 5;  4X3K A;  1HTL D;  3KFU A;  2NVQ B;  1G6P A;  1JJC B;  4A3F B;  4A3M B;  4DUZ L;  4TVA B;  5COR A;  4DF7 A;  3I8Z A;  3HOU G;  1H95 A;  2NVX B;  3HS0 C;  1J9O A;  1EQR A;  1WOC A;  2IW3 A;  4K8I A;  1S4Z A;  1TY2 A;  3MXN B;  4ZLT F;  2MFI A;  1JMC A;  1GVP A;  1SYG A;  1TWF H;  1YJN A;  4LF5 L;  2DY8 A;  1B1Z A;  2D62 A;  3CHB D;  3C1E A;  3GTK B;  2DNE A;  3NTK A;  3I91 A;  4A3G G;  3OIP A;  4EQN A;  1JOK A;  3RLF A;  4ZRZ A;  4LUZ A;  2IJ0 A;  4X65 Q;  3I4M G;  1HR0 W;  1PHJ A;  2GA4 B;  1WCM H;  2E2I B;  5HY6 A;  2UU9 Q;  1E1O A;  4OX9 Q;  2CWA A;  3M3Y H;  1QVG A;  1XNQ L;  3MVV A;  2Z9H A;  1FGB D;  3I7F A;  1V1O A;  2EYH A;  1EQV A;  4NPS A;  4A3B G;  1GUG A;  3I4N H;  1MKH A;  1BCP F;  1F2Z A;  4JI4 Q;  3MEH A;  3PO3 B;  3FKI H;  1KDC A;  5FLX L;  4JI7 L;  3C46 A;  3GTG H;  3KF8 A;  1UE6 A;  3TN2 A;  1TQO A;  3PO2 B;  1M1K C;  5GAG C;  4M8A A;  3FPU B;  3S14 B;  4DN4 M;  1WTV A;  1VQO A;  1WTX A;  3IRB A;  5I6Y A;  4KHP Q;  1Y1W H;  4C3J G;  2OCE A;  4BBS G;  4RFB A;  2A6H C;  4FO2 A;  5IT9 c;  4HIM A;  1EY5 A;  2D0P A;  2F0J A;  3AEV A;  5M5Y B;  1E2V A;  4IQZ A;  1ROD A;  1SYF A;  5C4Z A;  1HTP A;  1QNK A;  4P73 A;  2EJG C;  1Z9F A;  3J80 L;  1JJ2 A;  3VR4 A;  4JI1 Q;  4GNX B;  4CJ0 B;  1CSP A;  5ELO A;  1U4L A;  3FP9 A;  2EY2 A;  3M4Q A;  3DMU A;  3J80 i;  2Z6B A;  3OTO Q;  1JWS D;  5A35 A;  3MHB A;  1HFN A;  2KQ3 A;  2OTL A;  5JPN C;  1A3T A;  1WVL A;  1S5F D;  4B3R Q;  2E5L Q;  4ID6 A;  1GOZ A;  2QKI C;  4CJ1 B;  2KBN A;  4R4O A;  3KJO A;  1X65 A;  2NVT B;  3M9B A;  4A3J B;  2F03 A;  1TT2 A;  3IKJ A;  4O0A A;  5AFW A;  3N52 A;  5C44 B;  1IYU A;  4QIW B;  3I73 A;  4XQN A;  1YIJ A;  3D31 A;  3H15 A;  4IUR A;  3WOE A;  3EBE A;  3RZD H;  3UDI A;  1PTO D;  3M85 A;  3AFP A;  3S2H B;  4LFC L;  4HID A;  5CBA E;  1KXL A;  1CK1 A;  1JWM D;  2LSS A;  4B08 A;  3ERO A;  1EEI D;  4IPC A;  3A7L A;  3QOJ A;  4L8J A;  5I2X A;  2A6H D;  2A19 A;  1KRS A;  2XWB B;  3OHX C;  4FXG C;  5C4X G;  2H4O A;  2F0O A;  1FL0 A;  5IYC H;  3OW2 A;  4OIJ A;  4UAI A;  4P74 A;  2UXD Q;  5LL6 S;  2SNM A;  4X65 L;  1XPU A;  3GTM B;  2AQ2 B;  4BXX G;  2UU9 L;  4OX9 L;  3W3A A;  3K81 C;  3KDF B;  2LY7 A;  3G71 A;  2WKD A;  4PV1 C;  4DAM A;  1RDP D;  4OO1 I;  2NBF A;  1TXY A;  2F0G A;  3KOJ A;  5EQ0 A;  2WB1 G;  3GTL H;  2Y0S G;  3KUP A;  4C3I B;  3RN5 A;  3RN2 A;  1NCV A;  3BU2 A;  4K0K Q;  4J8Q A;  5C0X G;  3C2P A;  3DM1 A;  1J5E Q;  4IFD H;  3WOF A;  3TDQ A;  3EJI A;  1QB5 D;  2EOT A;  1TR5 A;  2L1B A;  3SE0 A;  4Y7N B;  1EY7 A;  3OWF A;  5EKL A;  4DR4 Q;  4KHP L;  1UAP A;  1QZG A;  1K8A C;  2KCT A;  5DEH A;  1TII D;  2CFM A;  1LT4 D;  1JIC A;  1EZ8 A;  2CVR A;  2EYP A;  2EY1 A;  5EPK A;  5C6A A;  1QUQ B;  2KCC A;  1NY4 A;  4C3H H;  4K6L A;  5DM6 3;  5FLM G;  3T16 A;  5IP9 H;  3K5N A;  4RHR A;  1BF4 A;  1EWH A;  3A8K E;  2R6G A;  4H13 C;  3MTS A;  5IP7 G;  1Q1E A;  4CDD C;  1EIF A;  4KN4 C;  1FVI A;  3U58 A;  3NEN A;  1KTK A;  4B3R L;  5J39 A;  1TWA B;  5CR3 A;  1EY9 A;  1VQ6 A;  1FD7 D;  3I56 A;  3A0J A;  1YNX A;  4FP5 D;  4RA8 A;  1B4O A;  4BA1 I;  1D5Z C;  1YNN C;  1U4P A;  3X3M A;  1O7Y A;  2IT1 A;  2E2J H;  3W2D A;  1UWV A;  3VYU A;  1SYC A;  4HCE A;  4DNI A;  2K52 A;  3AFQ A;  2F0V A;  1HZB A;  1LTI D;  4H02 A;  4HIO A;  3NTH A;  3CCR A;  4LF9 Q;  3H0G G;  4IFD J;  1T5X D;  4ODG A;  1YJ9 A;  3RNU A;  1QWY A;  1CUK A;  4E6I A;  1T9H A;  2HHH Q;  2E74 C;  3MXU A;  1D7Q A;  1B9M A;  1BBX C;  5GAH C;  1T5E A;  4LF8 Q;  3HOV H;  2L12 A;  4A3I G;  3NBI A;  2M2L A;  3NHH A;  3HKZ B;  3GQB A;  3W1B A;  2F0I A;  4HED A;  4KN7 C;  3NPP A;  2EXZ A;  4RWS C;  1XPR A;  1K28 A;  2EIF A;  2UXD L;  4IUN A;  1Q8K A;  4RGM A;  1WJJ A;  4ME5 A;  5L37 A;  4JI2 Q;  4BBR H;  3SVM A;  2GN5 A;  1LV9 A;  4HMI A;  2OT2 A;  1QNU A;  4ZAI A;  2FJ2 A;  4A3E B;  3GTP B;  1SJH D;  2R7Z G;  1SAP A;  1UEA B;  1TWC H;  4FDB A;  1KL9 A;  3HOZ B;  4HMJ A;  4YIJ A;  5K5P A;  4XQQ A;  4FYD A;  1EIG A;  5IYD H;  1WTO A;  2VW9 A;  1K83 H;  4A3L H;  1LTS D;  4K0K L;  3T56 B;  2PW7 A;  3DWA A;  1J5E L;  3IAY A;  3JAM c;  4IJL A;  1F2Y A;  1GUS A;  1UE1 A;  1RIP A;  2L5T A;  3K0X A;  2RKS A;  4A3D B;  1PXU A;  1WCM G;  2N88 A;  1UEB A;  1B8A A;  1HNZ Q;  1V43 A;  1PTO F;  1BCP B;  1VQN A;  4QUF A;  2ZM6 Q;  3HOU H;  4GOP C;  1B50 A;  1PZI D;  3I4N G;  4K5V A;  3NBH A;  3VA7 A;  4AIM A;  1VQD A;  4EX5 A;  3R8B A;  1C0A A;  3H09 A;  3FKI B;  4EQP A;  4IUQ A;  2JA7 B;  3GTJ H;  2N78 A;  2YTY A;  4O2D A;  4LF7 Q;  1I5F A;  4MZ9 A;  4X3T A;  2RHS B;  3BS1 A;  1BVS A;  1SRU A;  5IYB H;  5JOB A;  1IKM A;  1I50 H;  2N49 A;  1KC8 C;  4QJF A;  4DR2 Q;  4KY5 A;  3EN2 A;  4POF A;  5C4J H;  1Y1W G;  2E2H H;  3P1H A;  1G2T A;  1L1O B;  2BOS A;  3CCQ A;  1WTH A;  1YVC A;  1RCV D;  1G29 1;  3GV3 A;  1ENF A;  5FO9 B;  1WTR A;  4A3B H;  1YZ6 A;  1IYJ B;  2B2V C;  1H9S B;  2ZXP A;  2Z4H A;  4JBJ A;  3HOW H;  3MAQ A;  4XTC S;  3GO5 A;  2C35 B;  1PH2 A;  4LF9 L;  5KNB A;  1JR0 D;  1KLG D;  3ERS X;  4C2M H;  2NWG A;  1STY A;  3QG1 A;  1EWI A;  3OSO A;  2K5Q A;  1I6H H;  1V1P A;  2HHH L;  3CCJ A;  2IY5 B;  1IKL A;  3GDE A;  1ZEQ X;  4WOR A;  1PH6 A;  4R8I A;  2L4N A;  1STB A;  4LJZ C;  3NWT A;  2QA4 A;  2UUB Q;  1LT3 D;  2EPB A;  4BBS H;  2F0U A;  4OIK A;  3MZ5 A;  2QEJ C;  1SNM A;  1PFB A;  3MWY W;  1RTN A;  2Z4I A;  1SNQ A;  1Z47 A;  3S15 H;  4BS9 A;  1DXM A;  5IY0 A;  2ZXR A;  4DV1 L;  3TRE A;  3H3V I;  4JI2 L;  1JQY D;  3RZD B;  3K7U C;  1AFP A;  1Y1V G;  2A6E C;  4DNR B;  1XJV A;  4DK3 C;  2JK8 A;  1M90 C;  1ONL A;  3S1R B;  1Q82 C;  4ME3 A;  4GOP A;  2PQA A;  1DD2 A;  2WKC A;  3J81 j;  1VQ5 A;  1I94 L;  2SDF A;  1F2M A;  3W1G A;  1HFG A;  5J3B A;  1GUT A;  2A1A A;  4FXD A;  2G9D A;  2VB2 X;  4F7X A;  3PF4 A;  1SYD A;  1Y8N B;  5IYC G;  1VQ7 A;  4MNO A;  2IHE A;  3BVG A;  2AKW B;  3FPP A;  4OXP A;  4DV6 L;  5BN4 A;  3PSI A;  1HNZ L;  2EJF C;  5I4D A;  2XWJ B;  2PCF B;  4RHS A;  3CPF A;  1SSO A;  2A5H A;  2RHQ B;  1Y8P B;  2IX3 A;  1KD1 C;  1VQK A;  5FJ8 H;  1K3B C;  1MIU A;  2F0Q A;  4KKS A;  2I5H A;  2BH2 A;  2QEX A;  1WYD A;  3VYR A;  1ICF B;  2B2V A;  3KF6 B;  4DKA C;  3GTL B;  1YBY A;  2VQE L;  4HJ9 A;  4LF7 L;  2LS0 1;  4IFD G;  5BR8 Q;  3ND9 A;  1LTB D;  3D8G A;  4DR2 L;  5D3D A;  2Z0S A;  4DV5 Q;  4KD4 A;  1RF2 D;  1EY8 A;  5C4H A;  2X69 A;  3PIP A;  1X3G A;  1YEZ A;  4G4K A;  1NNX A;  2ZT9 C;  5IT9 E;  3ER0 A;  1CKN B;  1I4G A;  2CKZ B;  3U4V A;  4C3H B;  1FYC A;  1IL8 A;  1ESF A;  1JC7 A;  3DWQ A;  4ZKB B;  4YY3 Q;  2M00 A;  2WB1 E;  4JBK A;  1Z6H A;  2Y0S E;  1IHZ A;  1YIT A;  1S5B D;  4JV5 L;  1F9P A;  4TKO B;  1AE3 A;  3H91 A; 
#chains in the Genus database with same CATH homology
 3LWU A;  2R3Z A;  5M5W B;  5C3X A;  3BG3 A;  5G3L F;  1SND A;  4O1N A;  2ENB A;  3M4O B;  5KEE A;  5NUC A;  1D1K A;  5ELB A;  1LT5 D;  1ZXT A;  3EFX D;  4KJO A;  1PZK D;  1ZYR C;  1GUW A;  2Q8I B;  1ENC A;  2PQE A;  5COY A;  1AP0 A;  1DOL A;  4H0L C;  5EKK A;  3HOY B;  3OIQ A;  2V4D A;  2JA8 B;  3OPO A;  1QJO A;  1I4H A;  2MP1 A;  4X3U A;  2B8F A;  4IUV A;  3SR1 A;  4FF2 A;  1RJT A;  2L0C A;  5EGT A;  4HSV A;  3S9W A;  4K8J A;  4J6H A;  5IGB A;  2EYO A;  5IT9 L;  4O42 A;  1AEX A;  3K0Y A;  5FO7 B;  3HOX B;  3K5O A;  2JEA I;  2F0F A;  4ILW A;  1OO9 B;  2JSO A;  3M4Y A;  1VF5 C;  3D3R A;  1SE4 A;  3D6C A;  1LTT D;  2BDO A;  1ZYR D;  5IOD A;  4KK7 A;  2IL8 A;  4DXF A;  3P20 A;  3J81 L;  1PTO B;  2FFK B;  2R93 B;  1PZJ D;  4F87 A;  1EL0 A;  3ND8 A;  1VMC A;  1PRT D;  3H94 A;  1EIH A;  1O7Z A;  1MBY A;  4KKU A;  1ESR A;  1RKN A;  2FHT A;  3HOU B;  1UUP A;  1V8Q A;  2TSS A;  5C0X I;  3D4D A;  1Q8I A;  5EPJ A;  4K2K A;  2O5J C;  2CHB D;  4DU9 A;  1X32 A;  5IIF A;  1FNU A;  2CW0 D;  2HDM A;  4A3G B;  4IUP A;  4C1N K;  4KY6 A;  4CKB A;  1SE3 A;  1DOK A;  1I4R A;  3DEP A;  4J1M A;  4DK1 A;  3E0J A;  5IGD A;  3I4M B;  2IX0 A;  4M1U B;  4KI0 A;  4A3B B;  3P75 A;  1TS4 A;  4RAU C;  5K36 G;  4ABN A;  5CYU A;  4XDX A;  5HUR A;  1AN8 A;  4PMB A;  1LAC A;  4PMW A;  1RHP A;  2NVY B;  2OXP A;  2NUC A;  4C3J B;  4BBS B;  5E4W C;  1SFO B;  1FNW A;  4KV6 A;  1ICW A;  3S15 B;  4XYQ A;  3RUZ A;  3GD7 A;  4N9P A;  4CHT B;  3C3L A;  1PLF A;  4ULL A;  1KAA A;  4EVO A;  2F1M A;  3IFD A;  2SEB D;  2HCI A;  3NQI A;  2HUG A;  1QOH A;  4F88 A;  1I4Q A;  2K03 A;  2IWH A;  1R4P B;  1CM9 A;  2FMC A;  3LWE A;  5KYL A;  2I46 A;  1DOM A;  2O5I C;  3FDT A;  2JXM B;  2F0H A;  2B2U C;  2E75 C;  5CMD A;  1QCB D;  3JAM E;  3CKI B;  2MGS A;  3D4R A;  1BNZ A;  2A68 C;  5CV5 A;  1WD0 A;  3H6M A;  1GXD C;  5EKI A;  5KYI A;  5C5M A;  2HCC A;  2KJX A;  2EYF A;  3QIA A;  2QCP X;  3QO2 A;  4NKL A;  5FO8 B;  3RZO B;  3D6W A;  4DFA A;  5C4X B;  3K7A B;  2JEB I;  3O13 A;  4FF3 A;  2EYL A;  4P2C B;  3R93 A;  2KHS A;  3AU7 A;  5EBD A;  3V96 A;  5JVH 3;  1GJX A;  1SXT A;  2MUY A;  1D5X C;  3HP3 A;  1ILQ A;  2WB1 B;  2Y0S B;  1EYC A;  1XXG A;  3A55 A;  1BXT A;  5CV9 A;  1ZKO A;  5IGC A;  1KNE A;  2EY6 A;  2RBM A;  4K5W A;  3Q0A A;  3IFT A;  1Y8O B;  4X3S A;  1GHK A;  3G6J B;  2CQA A;  4ZYS A;  1LAB A;  1PRT F;  2PO4 A;  2A68 D;  1B44 D;  3DWP A;  5IGG A;  5D14 A;  4RKB A;  4WJW A;  3R2I A;  1F77 A;  5I2Y A;  1PYW D;  3MFG A;  1FR3 A;  2K1B A;  3TZD A;  2B2U A;  1U4M A;  2F0N A;  2RVL A;  4G7O C;  3K5L A;  1KAB A;  2PMZ B;  1U4R A;  3NUC A;  4IUT A;  2NN6 H;  1DJR D;  2F0S A;  3EQL C;  1STG A;  3J7A F;  3EVQ A;  3TP7 A;  1WTP A;  1JOO A;  2F0D A;  4HCS A;  2KEC A;  1W6J A;  3T13 A;  1BDO A;  3H0G B;  5ISR A;  1SNP A;  3FRP B;  3R2T A;  2WAC A;  2MPM A;  3QJY A;  1EFI D;  2RSN A;  5FOB B;  2KCN A;  3TZU A;  4A3I B;  2SOB A;  4H7B A;  2XN9 C;  1W6K A;  2A69 C;  4CJ2 C;  1DYQ A;  2RA4 A;  3K5M A;  4NW2 A;  1FNV A;  1CZW A;  2BA1 A;  2B2T C;  1EYD A;  3DUZ A;  1I6V C;  4U68 A;  4ZK9 B;  3URY A;  2XRS D;  1IW7 C;  1L0X B;  5KRU A;  2Q8R E;  4DK0 A;  2R7Z B;  4RH6 A;  1YNN D;  4IFD I;  3L9A X;  1JOQ A;  1TWF B;  1E2W A;  2LKV A;  2PW5 A;  2C5C A;  1GUO A;  3HRZ C;  1HRJ A;  3CRK C;  4MIU A;  1AW7 A;  2JP1 A;  1WCM B;  1XTC D;  1C48 A;  3M3Y B;  2XRQ D;  4KMU C;  2BA0 A;  3KBX A;  3PIP 3;  3I4N B;  2NTT A;  5DAU A;  5CV4 A;  3GTG B;  1X3Q A;  3ONA B;  2AQ1 B;  3QOL A;  3K58 A;  2F4I A;  1CHQ D;  3RMH A;  3V05 A;  3M7N A;  1SNO A;  2B2W C;  2ICI A;  3PUW A;  2L11 A;  3MA2 B;  1A3U A;  3SK8 A;  1Y1W B;  4G7H C;  2SNS A;  1HUN A;  1MD2 D;  2NYZ D;  2VNU D;  4QMG A;  2DN8 A;  5K36 H;  3S2D B;  1TU2 B;  1E2Z A;  1SYE A;  4XXE A;  3TSS A;  4KHV A;  1CTM A;  4F8M A;  2B2T A;  4RGT A;  3T51 B;  1F9R A;  1F9S A;  3QB3 A;  1DON A;  2RDF A;  1D1I A;  1MSG A;  4OHJ A;  1EY6 A;  1ML0 D;  4FXK C;  1PFN A;  1VDZ A;  4Q0F A;  2FMM A;  3MXG A;  2K01 A;  3PV0 A;  4KHZ A;  2BE5 C;  1M8A A;  1G91 A;  3KK7 A;  5JPM C;  1U9R A;  4TSS A;  4XYO A;  1G2S A;  1Y1V B;  3OW7 A;  1CHP D;  5LL6 X;  1I4P A;  2PPB C;  3U9S A;  1CQF A;  1EU3 A;  1SYB A;  1H9M A;  1NAP A;  3IL8 A;  3Q22 A;  2JYO A;  1TWH B;  2K04 A;  2KA7 A;  1ET9 A;  2F3V A;  2B2W A;  5T1G A;  3VR3 A;  3PMF A;  1STH A;  2HQE A;  1LT6 D;  1TS5 A;  3VA5 A;  4I7Z C;  3TME A;  4G7Z C;  5I9P A;  4FNF A;  3X3N A;  1LO5 D;  4PQX A;  1Y69 U;  3U9O A;  2PZW A;  1ENA A;  1DZ1 A;  1SNC A;  2KEE A;  1PRT B;  1PDQ A;  1O7L A;  2A6E D;  4RCO A;  5JJZ A;  4QB4 A;  4I65 A;  1XYI A;  1R4Q B;  1CZG A;  3WDN A;  1SE2 A;  5LHY 1;  4K6D A;  2M9V A;  4EGV A;  4QF4 A;  4R8N A;  1CI3 M;  4V0B A;  2O2L D;  3NK9 A;  2K32 A;  2NN6 G;  3LNN A;  3UI2 A;  4OGQ C;  4HAE A;  2LFN A;  2E2J B;  2J4X A;  2L55 A;  1B9N A;  3M7G A;  1TS2 A;  5IOC A;  2PZT A;  3KLS A;  2EYJ A;  4C1N I;  1KNA A;  3R3O A;  1D5M C;  1EOT A;  3OOC A;  1II3 A;  1J8I A;  2R61 A;  1H9S A;  3HOV B;  5CV7 A;  3D4W A;  3TP5 A;  2EDG A;  5T1I A;  3C1F A;  4DNT B;  1SMY C;  3SHL A;  2A74 C;  4JBW A;  1CA5 A;  2FIN B;  5JVG 3;  1STA A;  3EA6 A;  4BBR B;  5KND A;  3FVQ A;  1HHV A;  3PUV A;  1BUV T;  5D3I B;  3PIO 3;  5KIX A;  3SK5 A;  1TWC B;  2PZU A;  3S1Q B;  5JAV A;  3E6Z X;  2PYK A;  1YNJ C;  3PUX A;  2HDL A;  4FVM A;  1K83 B;  2EE1 A;  2EY5 A;  3DEO A;  1MSH A;  5A2Q E;  1NUC A;  1Q90 A;  5JEA H;  1SEB D;  1PFM A;  1X3P A;  1LTR D;  5ELF A;  5FLX E;  2K5W A;  4XQJ A;  4TQU S;  3BVZ A;  2JA5 B;  1BQQ T;  3ERQ A;  3LX0 A;  2WIN B;  1RD9 D;  5E4X A;  4LAA A;  1WD1 A;  5FK9 C;  3GTJ B;  3KBG A;  1HPC A;  1AZP A;  2K28 A;  1NR2 A;  1I50 B;  3J80 E;  3J7Y W;  1NR4 A;  3A56 A;  5C4J B;  2E2H B;  2WII B;  1KDA A;  1EZ6 A;  2RSO A;  1GHJ A;  5ELD A;  3HOW B;  2Z1C A;  1YNJ D;  4C2M B;  3NE5 B;  4KY7 A;  5JEA J;  1I6H B;  1HQM C;  5KNC A;  2NZ1 D;  2XSC A;  5A2Q L;  3DXJ C;  4BWG B;  1QE6 A;  3H3V C;  1GUN A;  1CFM A;  4K5X A;  4CGY B;  4JK1 C;  5CV6 A;  3RD4 A;  2WAQ B;  5DM7 3;  5BN5 A;  3OWE B;  1JE4 A;  4AYB B;  1H9K A;  4OO1 H;  2AWN A;  3HG9 A;  1HA6 A;  1PTO C;  4QUC A;  1OXT A;  3BDC A;  1Z7T A;  3AMU A;  4IUU A;  5EJW A;  4R9W A;  2VUM B;  4IZ8 A;  2R92 B;  1RTO A;  2QIL A;  2OF1 A;  5C3E B;  4HR7 B;  3BYY B;  4ZUI A;  3QWN A;  4LMQ D;  1BR9 A;  2B39 A;  4DAY A;  3NQT A;  5CV8 A;  2F0P A;  2YYZ A;  2B2Y C;  1K8O A;  2J7Z A;  5J22 A;  2DY7 A;  1EY4 A;  1LLR D;  1QG7 A;  3K57 A;  1TKW B;  3OMC A;  4IN3 A;  4XT3 B;  4RCN A;  5M9O A;  1Q12 A;  3MXP A;  3E5S A;  5E1F A;  2KUM A;  3SXH A;  2IX1 A;  1VF7 A;  2AUK A;  1EU4 A;  3L3O C;  4DA2 A;  3S16 B;  3NTI A;  4DXG A;  4U67 3;  4PMC A;  1OXS C;  5E3F A;  2AWO A;  4FF1 A;  3JAM L;  1A6X A;  5EBC A;  5C5L A;  3FEW X;  3VR5 A;  4S3S A;  2ZXO A;  4C3I G;  4TRD A;  3MXN A;  3I70 A;  1S5E D;  3SDZ A;  4K2L A;  1JCK B;  3GTO B;  4K14 A;  1QIL A;  3VYS A;  1CT1 D;  1V1P B;  2RDG A;  2F3W A;  1L0Y B;  3NSW A;  1O80 A;  2B2Y A;  3T53 B;  1O78 A;  1TVX A;  2XVS A;  2NTS A;  2B63 B;  5M3M B;  1JOR A;  1Q3L A;  4UDU C;  1G6Z A;  3BVM A;  2JA6 B;  2H1E A;  1I3Q B;  3NP8 A;  5IGE A;  1CQV A;  4H44 C;  3J7A V;  2DNC A;  1HUM A;  5EPL A;  4NP5 A;  3N6R A;  2D2C C;  4V19 0;  5KGU A;  4BY1 B;  1BOS A;  3BDL A;  3VYT A;  2F0T A;  3P7J A;  1XX8 A;  2G9H D;  2EYM A;  3ITP A;  3G7L A;  4WFN 3;  5M3F B;  1EWC A;  2BDN A;  5IGF A;  1DM0 B;  1CA6 A;  5JEA G;  1ET6 A;  1S5C D;  5I9O A;  2AUJ D;  2K5D A;  1F2L A;  1K8M A;  2RQX A;  1EQT A;  1STN A;  5F2D A;  5CBE E;  2EJM A;  1MGS A;  3HZX A;  1VCI A;  4Q5V A;  4QCL A;  3NWS A;  2F0K A;  3S17 B;  3T4A C;  4GZY C;  1AZQ A;  2VXW A;  4XT1 B;  1HQR D;  3KLR A;  4NDX A;  1Q1B A;  5C3W A;  4B9W A;  1D2B A;  1UNS A;  4CBV A;  4CKC A;  2WP8 J;  2XIW A;  3MC0 B;  1BO0 A;  3Q24 A;  1PTO H;  2K7V A;  5G3L D;  4KKT A;  1DCZ A;  2A69 D;  4N9T A;  2X6L A;  1A2U A;  2NN6 I;  2K05 A;  4Z9C B;  2F0W A;  4HN7 A;  4KJN A;  2C9O A;  1IW7 D;  4OO1 G;  1F9Q A;  3SK6 A;  1M4V A;  1I4X A;  4ZQ3 A;  1C4Q A;  3S1N B;  4DGZ A;  1MI2 A;  1E0B A;  3TP6 A;  4A93 B;  4NMZ A;  2ID0 A;  3SK4 A;  2EVB A;  4HTH A;  2KED A;  1A2T A;  1TS3 A;  4L6T B;  3TBI B;  3A7A B;  1KDB A;  1HXY D;  4C56 C;  2QF7 A;  2J0T D;  1C8C A;  3F2U A;  3A8J E;  4ZKC B;  3OMG A;  3FMC A;  4OL7 A;  2F0L A;  1H9R A;  4RGO S;  1TY0 A;  1BCP C;  3I72 A;  4B9X A;  3ZYY X;  1LTG D;  3I3C A;  2F0M A;  3VR6 A;  2VB3 X;  2BCO A;  1WTW A;  3K59 A;  3CU7 A;  4IAL A;  4MHE A;  5CC4 A;  5TSS A;  4DAP A;  3TP8 A;  2EZV A;  1HA5 A;  4KD3 A;  3BZD B;  2KOL A;  1EYA A;  5BN3 A;  1B2T A;  2OEO A;  4BA2 I;  5M5X B;  2WV6 D;  4CKE A;  1EEF D;  3CQZ B;  4A3K B;  3VR2 A;  5FKA C;  2BE5 D;  4EQO A;  4ZUJ A;  3HGB A;  1S5D D;  1BCP D;  2Z8L A;  1OXX K;  4DAV A;  1STE A;  2K6A A;  4RGN A;  3A8I E;  3Q6S A;  1A15 A;  3DHQ A;  4XIG S;  2AQ3 B;  2TMP A;  2X6G A;  3L7Z C;  3GP7 A;  5ELE A;  2F0E A;  1JWU D;  2MJ8 A;  1SBB B;  4BY7 B;  4MN3 A;  4C3H G;  2PNR C;  3HEJ A;  4HSP A;  5CGK A;  5I6W A;  2K33 A;  5J1Z A;  2ICE C;  2RDH A;  2D9U A;  1PMR A;  2D5D A;  5C0X H;  1NSN S;  1LTA D;  1IYV A;  1VMP A;  4L63 B;  4G57 A;  2E76 C;  3A54 A;  4LK1 C;  3GV6 A;  1H9J A;  2I07 B;  3S1M B;  2N55 A;  2O4X A;  2B8G A;  2Q8T A;  3KLS X;  3SEB A;  3J81 E;  4RKL A;  4FF4 A;  2LMC B;  3I4L A;  2XNA C;  1PRT C;  1EY0 A;  3GTQ B;  1SJE D;  1KLU D;  3AB9 A;  1R9T B;  3I90 A;  2NB0 A;  3BYT B;  4KTA A;  5ELC A;  5HGT A;  3BDO A;  3NXW A;  1WTQ A;  2YU9 B;  1A3V A;  2CW0 C;  1SDF A;  5C0X J;  1B3A A;  3V2T A;  3PUY A;  2L9H A;  1ILP A;  2JE6 I;  2E2D C;  1G8Z D;  3PUZ A;  2IPK D;  1HCZ A;  5D65 A;  1TWG B;  5DNF A;  4WRD A;  2KVM A;  1OXU A;  3K6O A;  1OXV A;  1JB3 A;  1D6E C;  3Q23 A;  1XWE A;  1B53 A;  2QDB A;  3MFY A;  2A73 B;  2MHV A;  3CRL C;  4PNY A;  1SMY D;  4X3K A;  1HTL D;  2NVQ B;  4A3M B;  4A3F B;  5COR A;  4DF7 A;  3I8Z A;  2NVX B;  3HS0 C;  1J9O A;  2IW3 A;  4K8I A;  1S4Z A;  1TY2 A;  4ZLT F;  1SYG A;  2DY8 A;  1B1Z A;  2D62 A;  3CHB D;  3C1E A;  3GTK B;  2DNE A;  3NTK A;  3I91 A;  3OIP A;  4EQN A;  1JOK A;  3RLF A;  4ZRZ A;  2IJ0 A;  2GA4 B;  2E2I B;  3MVV A;  1FGB D;  1V1O A;  2EYH A;  1EQV A;  1GUG A;  1BCP F;  1F2Z A;  3MEH A;  3PO3 B;  1KDC A;  5FLX L;  3C46 A;  3KF8 A;  3TN2 A;  1TQO A;  3PO2 B;  4M8A A;  3FPU B;  3S14 B;  4DN4 M;  1WTV A;  1WTX A;  5I6Y A;  4C3J G;  4RFB A;  2A6H C;  4FO2 A;  1EY5 A;  2F0J A;  5M5Y B;  1E2V A;  4IQZ A;  1ROD A;  1SYF A;  5C4Z A;  1HTP A;  1QNK A;  2EJG C;  3J80 L;  3VR4 A;  4CJ0 B;  1U4L A;  2EY2 A;  3DMU A;  1JWS D;  5A35 A;  3MHB A;  1HFN A;  2KQ3 A;  5JPN C;  1A3T A;  1WVL A;  1S5F D;  4ID6 A;  1GOZ A;  2QKI C;  4CJ1 B;  2NVT B;  4A3J B;  2F03 A;  1TT2 A;  3IKJ A;  5AFW A;  3N52 A;  5C44 B;  1IYU A;  4QIW B;  3I73 A;  4XQN A;  3D31 A;  4IUR A;  3WOE A;  1PTO D;  3M85 A;  3S2H B;  5CBA E;  1CK1 A;  1JWM D;  4B08 A;  3ERO A;  1EEI D;  3A7L A;  3QOJ A;  4L8J A;  5I2X A;  2A6H D;  2XWB B;  3OHX C;  4FXG C;  2H4O A;  2F0O A;  4OIJ A;  4UAI A;  5LL6 S;  2SNM A;  3GTM B;  2AQ2 B;  3W3A A;  2LY7 A;  2WKD A;  4PV1 C;  1RDP D;  4OO1 I;  2NBF A;  2F0G A;  5EQ0 A;  3KUP A;  4C3I B;  1NCV A;  4J8Q A;  5C0X G;  3C2P A;  3DM1 A;  4IFD H;  3WOF A;  3TDQ A;  3EJI A;  1QB5 D;  2EOT A;  1TR5 A;  2L1B A;  3SE0 A;  4Y7N B;  1EY7 A;  3OWF A;  5EKL A;  1UAP A;  5DEH A;  1TII D;  1LT4 D;  1JIC A;  1EZ8 A;  2CVR A;  2EYP A;  2EY1 A;  5EPK A;  5C6A A;  2KCC A;  5DM6 3;  4K6L A;  3T16 A;  3K5N A;  4RHR A;  1BF4 A;  1EWH A;  3A8K E;  2R6G A;  4H13 C;  3MTS A;  1Q1E A;  4KN4 C;  1KTK A;  5J39 A;  1TWA B;  5CR3 A;  1EY9 A;  1FD7 D;  4FP5 D;  4RA8 A;  4BA1 I;  1B4O A;  1D5Z C;  1YNN C;  1U4P A;  3X3M A;  1O7Y A;  2IT1 A;  3W2D A;  3VYU A;  1SYC A;  4HCE A;  2F0V A;  1LTI D;  3NTH A;  4IFD J;  1T5X D;  4ODG A;  1QWY A;  4E6I A;  2E74 C;  3MXU A;  1B9M A;  1BBX C;  1T5E A;  2L12 A;  3NBI A;  2M2L A;  3NHH A;  3HKZ B;  3GQB A;  2F0I A;  4HED A;  4KN7 C;  3NPP A;  2EXZ A;  4RWS C;  4IUN A;  4RGM A;  4ME5 A;  3SVM A;  1LV9 A;  4HMI A;  2OT2 A;  1QNU A;  4ZAI A;  2FJ2 A;  4A3E B;  3GTP B;  1SJH D;  1SAP A;  1UEA B;  3HOZ B;  4HMJ A;  4YIJ A;  5K5P A;  4XQQ A;  4FYD A;  1EIG A;  1WTO A;  1LTS D;  3T56 B;  2PW7 A;  3DWA A;  3IAY A;  1F2Y A;  1GUS A;  2L5T A;  2RKS A;  4A3D B;  1PXU A;  2N88 A;  1V43 A;  1PTO F;  1BCP B;  4QUF A;  1B50 A;  1PZI D;  4K5V A;  3NBH A;  3VA7 A;  3R8B A;  3H09 A;  3FKI B;  4EQP A;  4IUQ A;  2JA7 B;  4X3T A;  3BS1 A;  5JOB A;  1IKM A;  4KY5 A;  3P1H A;  1G2T A;  2BOS A;  1RCV D;  1G29 1;  3GV3 A;  1ENF A;  5FO9 B;  1WTR A;  2B2V C;  1H9S B;  2ZXP A;  2Z4H A;  3MAQ A;  4XTC S;  3GO5 A;  5KNB A;  1JR0 D;  1KLG D;  2NWG A;  1STY A;  3QG1 A;  3OSO A;  2K5Q A;  1V1P A;  1IKL A;  1ZEQ X;  4WOR A;  4R8I A;  2L4N A;  1STB A;  4LJZ C;  3NWT A;  1LT3 D;  2EPB A;  4OIK A;  2F0U A;  3MZ5 A;  2QEJ C;  1SNM A;  1PFB A;  3MWY W;  1RTN A;  2Z4I A;  1SNQ A;  1Z47 A;  4BS9 A;  1DXM A;  2ZXR A;  1JQY D;  3RZD B;  1AFP A;  2A6E C;  4DNR B;  1ONL A;  3S1R B;  1DD2 A;  2WKC A;  2SDF A;  1F2M A;  1HFG A;  1GUT A;  4FXD A;  2G9D A;  2VB2 X;  4F7X A;  1SYD A;  1Y8N B;  3BVG A;  3FPP A;  5BN4 A;  2EJF C;  5I4D A;  2XWJ B;  2PCF B;  4RHS A;  1SSO A;  2A5H A;  2IX3 A;  1Y8P B;  2F0Q A;  4KKS A;  3VYR A;  2B2V A;  3GTL B;  2LS0 1;  4IFD G;  3ND9 A;  1LTB D;  3D8G A;  5D3D A;  4KD4 A;  1RF2 D;  1EY8 A;  5C4H A;  2X69 A;  4G4K A;  2ZT9 C;  5IT9 E;  1I4G A;  4C3H B;  1FYC A;  1IL8 A;  1ESF A;  1JC7 A;  3DWQ A;  4ZKB B;  2M00 A;  1Z6H A;  1IHZ A;  1S5B D;  1F9P A;  4TKO B;  3H91 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...