1XYIA

Hyperthermophile chromosomal protein sac7d double mutant val26ala/met29ala in complex with dna gcgatcgc
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
66
structure length
66
Chain Sequence
MVKVKFKYKGEEKEVDTSKIKKVWRAGKAVSFTYDDNGKTGRGAVSEKDAPKELLDMLARAEREKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*GP*CP*GP*AP*TP*CP*GP*C)-3'
publication title Probing the DNA kink structure induced by the hyperthermophilic chromosomal protein Sac7d
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
molecule tags Structural protein/dna
total genus 12
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2004-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02294 7kD_DNA_binding 7kD DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1xyiA00
1B3AA 2FMMA 2L1BA 2RVLA 1EQTA 2B2VA 1Q3LA 2X6GA 4XT1B 1J9OA 1BNZA 2HCCA 4U68A 5JJZA 1HFGA 4X3SA 1WTRA 1BO0A 2B2TA 1X3QA 5EPLA 2X6LA 3FDTA 4CJ0B 1WTVA 1AZPA 1CA5A 1LV9A 1ILQA 1DZ1A 1SAPA 2KEEA 4OIJA 1WTPA 2KVMA 1DOKA 2D9UA 3IL8A 5D65A 2MPMA 4DN4M 3MTSA 3DM1A 1WTQA 1XYIA 4QUFA 3I3CA 4IUQA 5D14A 2Q8RE 1G2SA 3GV3A 2H1EA 3I8ZA 4CJ1B 1MI2A 1NR4A 1HUNA 1QE6A 2KECA 4X3KA 4HAEA 2J7ZA 1AP0A 1AZQA 2RSNA 1PDQA 1U4MA 1SDFA 3FPUB 2HUGA 2N88A 4MHEA 4RWSC 1C8CA 4ZAIA 1B50A 1VMPA 2NWGA 3MWYW 1HHVA 2HDLA 1XX8A 2KUMA 3UI2A 2DY7A 4O42A 5CORA 1BBXC 1HA6A 1O7ZA 1WVLA 1JICA 1MSHA 1RTNA 1PFNA 1RODA 1VMCA 1DONA 1GUWA 4R9WA 4ZK9B 1ZXTA 2M2LA 2HDMA 3I90A 2L12A 5CBAE 1F9PA 1O7YA 5EPJA 2L11A 5E4XA 2B2YC 1G2TA 1KNAA 1IL8A 1B53A 3GV6A 4IURA 1DOMA 1ICWA 4IUVA 5EQ0A 3TN2A 4UAIA 1X32A 1PFMA 4NW2A 2FJ2A 1MSGA 5CBEE 1A15A 2B2YA 1B2TA 1EOTA 3Q6SA 1QG7A 3P7JA 1MGSA 4IUPA 1U4RA 4XT3B 3SVMA 2Q8TA 4ZKBB 1ML0D 1ESRA 3H91A 5E4WC 5COYA 1IKLA 1M8AA 2FINB 1HUMA 2EOTA 2K05A 4HEDA 3F2UA 1DOLA 2B2UC 2NYZD 2K1BA 1U4PA 2L9HA 3KUPA 1KNEA 1CA6A 2MJ8A 4IUTA 4RAUC 3TZDA 3I91A 5EKIA 2K01A 2VXWA 2K28A 4R8IA 2B2WC 2JP1A 4MN3A 1WTOA 2B2UA 2MGSA 1EIHA 2MP1A 3N52A 5EPKA 4ZLTF 2FFKB 2FHTA 3R93A 4X3UA 2B2WA 1NAPA 2RSOA 1F9RA 2X69A 3IFDA 5T1GA 5DNFA 4HCSA 4XDXA 1B4OA 1E0BA 2KEDA 2B2TC 2XIWA 3HP3A 5T1IA 1ILPA 1G6ZA 1NCVA 2RA4A 4OIKA 2CVRA 1O80A 1S4ZA 2JYOA 1F2LA 1RTOA 3QO2A 2EPBA 3G7LA 5AFWA 5EJWA 5CMDA 1SSOA 1G91A 3D6WA 1WTWA 2SDFA 4ZKCB 1EL0A 2IL8A 2K04A 4CJ2C 2L4NA 2EE1A 2HCIA 1EIGA 1RHPA 3ONAB 2DY8A 1IKMA 1BF4A 4QUCA 3KBXA 1TVXA 4RA8A 1CM9A 1F9SA 4LMQD 2NZ1D 3LWEA 3DEPA 1HFNA 4IUUA 1HRJA 1J8IA 1WTXA 2N55A 4HSVA 2K03A 4X3TA 1PFBA 1X3PA 1NR2A 2KOLA 1WD1A 2R3ZA 1F9QA 3DEOA 1WD0A 1PLFA 1U4LA 2B2VC 2BDNA 1RJTA 1JE4A 1QNKA
chains in the Genus database with same CATH superfamily
4LUVA 2RVLA 1I5FA 3HG9A 1EQTA 4JOIA 1AH9A 1BO0A 1PH5A 2EYFA 1AZPA 1SYEA 2ZTEA 1YJWA 3PUYA 1DXMA 2MPMA 3BZCA 3DM1A 2R93G 1WTQA 4GN5A 2PO4A 4AQYL 5JAVA 2VS1A 3I8ZA 4P72A 1EY8A 1MI2A 5BN5A 4A3GG 4GS3A 4DV5L 1YJ9A 1EYDA 1XPUA 5FOBB 4A93G 3MXGA 1I50H 1GO3E 3J7YW 1VQ6A 1RODA 1GUWA 3KDFA 1ZXTA 5C4ZA 4BA1I 2RHQB 2JN4A 2Z6KC 4Q5VA 2DJFC 4UY8C 3I4OA 3GV6A 2HHHQ 2Z1CA 5C3EB 1MJEA 3H6MA 4A3CG 4Y7NB 1GKHA 3G48A 1XNQQ 2YU9B 1PZJD 4LF9L 4GN3B 4JI5L 1PTOC 3K6OA 4GLAC 3CMEA 1KNEA 4JI2L 4EQPA 3M9BA 2UUAQ 4TQUS 1T5EA 2JP1A 3PO3B 3S17B 4HIMA 3N52A 1TS4A 3MEHA 5HGTA 5KRUA 3PIP3 4CDCC 3R3OA 1LTAD 2B2WA 3RZDB 3TS2A 2I07B 3JAME 1I94Q 4DK3C 3AEVA 2CW0D 1PH8A 4HCSA 3HP3A 3F2BA 2GA4B 2JQOA 4IOAA 3T1HQ 3FRPB 5DM63 1VQOA 5JPNC 3G7LA 1TS3A 3K58A 2R7ZG 3G6JB 1Q8KA 3OMCA 4P74A 2F4IA 2PI2E 3CRLC 3HOUG 2LKVA 4N8FA 5AJ3Q 2KOLA 2K52A 2K7VA 1MD2D 4JI8Q 3X3NA 2VUMG 2BDNA 4J6HA 1I4PA 2FMMA 1SNOA 4IFDI 1HFGA 3U9SA 2VB3X 1N36Q 1X65A 1CA5A 3PUZA 2XTIA 2QA4A 2BE5C 2K50A 2XVSA 4C3JB 4DN4M 3RNUA 1TS2A 1O7LA 2LXJA 4B3ML 1CI3M 5M9OA 2PMZB 5C0XJ 1NNXA 5M5YH 4ZCKA 1HNXQ 4JK1C 2NWGA 5DLQE 3JAML 3H0GG 2JJQA 2PW7A 3HOWG 1HZCA 1SROA 3SK4A 4XYOA 1VQGA 2B39A 2ZM6L 1KAWA 3BVGA 2E2HB 1CSPA 3J81E 1K83B 1E1TA 4DU9A 1XTDA 3CU7A 4GLXA 1X32A 4NW2A 1A15A 1IBMQ 4XXEA 4JBKA 1QZGA 3P7JA 5COYA 2AQ3B 2MUYA 2WAQB 5GQOA 3EVQA 1OXUA 3CC7A 1EY9A 4YIJA 2NN6H 2AQ1B 4RAUC 1FD7D 1XMQL 3NELA 2B8GA 2KCMA 3CQZH 2PW5A 4WJWA 2A69C 4EVOA 1JOOA 3I4NH 5ELOA 2BH8A 1UNSA 3S16H 4BY7B 1IBLQ 4LF6Q 1II3A 1VCIA 1STBA 3VR5A 2CHBD 3PQIA 2EPBA 3GTLB 4APVA 4DR3Q 3PV0A 4ZKCB 1WCMB 1LTTD 4CJ2C 4WRDA 3MXPA 1KDCA 4ZYSA 1E2ZA 4X66Q 1U9RA 2G5DA 5CGKA 3EFXD 4BY1H 1Y1VB 1V1PB 2HHHL 1DD2A 2V1CC 3GTKB 2CWPA 3NQTA 1T9HA 1F9QA 3J81L 1PLFA 2B2VC 1XNQL 5C4XB 1OXSC 4ID6A 4DA2A 1Y1WG 4P75A 4C3HG 5JPMC 5ELEA 1K3BC 3Q23A 3RMHA 3TEHB 2CH4A 4DNIA 2I0QA 3UDGA 1BCPB 2UUAL 1IHZA 2X6LA 1WTVA 1SRUA 2Z0SA 2Y0SB 4L63B 2JA7B 1KL9A 2PNHA 4IZ8A 2A19A 2VQFQ 2D9UA 2V4DA 1CTMA 1FNWA 4I7AA 2UU9L 3T1HL 2R7DA 2MHVA 3IAYA 4B3RQ 1R4PB 2OF1A 1VMPA 1HQRD 2XRSD 3R2TA 4KHZA 3Q0AA 4NPSA 1D8LA 4IN3A 3CPFA 3SXHA 3U58A 3CW2C 4NMZA 4O1NA 1O7YA 3C46A 1HNWQ 1Q1EA 3RN5A 1F77A 5AJ3L 1IL8A 4KI0A 3HOYH 3BDCA 3CC4A 1CZGA 2F3IA 5KEEA 4GOPC 5ELCA 2A74C 2RCNA 1LTRD 5CV6A 1SFOB 4DKAC 1TIID 2ZXPA 4OGQC 1N36L 3D31A 1Q8IA 1PMRA 4U673 4A3EG 3KUPA 4ODGA 1SYDA 1TKWB 3KK7A 3J7AF 1NTGA 4K6LA 3R93A 4PZ6A 4JV5Q 1HNXL 1EWIA 2MO1A 4KY6A 4OEMB 4HJ9A 1F2YA 3VDYA 4A3MG 5I9PA 4YCUA 4QB4A 4RMFA 2Q2TA 1UEAB 5AFWA 2VQEQ 1NBWA 3U4ZA 3HRZC 1B1ZA 3HOXG 3HGBA 4K5XA 2F0VA 4LF4Q 2WV6D 4M8AA 5C44H 2A6EC 3D4WA 4FNFA 3TMEA 4OWXB 1FVIA 2EXZA 1HFNA 1MKHA 5FK9C 2R7FA 1WTXA 4HSVA 3MC0B 1L0YB 2NVTB 2NN6I 1CKNA 3DEOA 4A3DG 2F0EA 1ASZA 2F1MA 5JEAG 1HR0L 1ET9A 2PNRC 3DMUA 3K7AB 4R8IA 1SE2A 3UDXA 4A3JB 1HR0W 2IHEA 1PRTD 4B3SQ 5C6AA 3JC66 1Y8PB 3WOEA 1JOQA 1LT3D 1DZ1A 1ILQA 5JJIA 2F4VQ 4O0AA 3PSIA 4JI3Q 4UHVA 3T1YQ 2ASBA 4IO9A 1KDAA 3E0EA 3TP5A 3GV3A 2SOBA 1IBLL 4JBWA 3MVVA 1TS5A 2KECA 4JI1L 5KNCA 1LT6D 4C3IH 3PIOA 3K5LA 3OIPA 4JI4Q 4YHHQ 4DR3L 2IW3A 4JYAQ 5C4HA 3WDNA 5L37A 5CV7A 5M3MH 1GM5A 3A5UA 4X66L 3BDLA 1IBKQ 3CCEA 2RDGA 1W6JA 2PPBC 1STAA 2F0NA 5IYBG 4DV7Q 1G2TA 4BBSB 1B8AA 3DHQA 1NUCA 2F0TA 1XXGA 4IURA 2EZVA 1K9MC 1QOHA 3PO2H 1IZ6A 5M3FB 4A75A 3KF6A 3VYUA 4BBRB 2YTYA 1X54A 3PMFA 4ZKBB 1ML0D 3HKZB 3D3RA 3QOJA 4JI6Q 3BYTB 4N9TA 3S1RB 1SNCA 1JWMD 5LMNQ 1ZEQX 4DR4L 3BZKA 4OX9L 3BU2A 1L0XB 5KGUA 1Y14B 2O5JC 3K81C 4JC0A 1EQVA 3HOVB 4LJZC 3I70A 1VQMA 1NAPA 4A3BH 4DK1A 2LY7A 4GKJQ 3M4PA 3A55A 2K5DA 3GTPH 4YWLA 4ALPA 3NK9A 4K6DA 4ZUIA 1KDBA 3PF5A 5IP9G 3K7UC 1HNWL 4KD3A 3KBXA 2IHFA 3G71A 1WYDA 4DAMA 4F8MA 5C3EG 1GUNA 5IP7H 2B3GA 2K03A 3GTQH 2ZT9C 3F1ZA 4A3LH 1E7ZA 2A73B 4KKTA 3S2DH 1I6VC 1AN8A 3NTHA 4YWMA 1ET6A 1J9OA 3PUWA 4DXGA 5JJZA 1QVGA 1RKNA 4BS9A 1WTRA 1K0SA 3PO3G 1YZ6A 1LV9A 2EVBA 1XJVA 4J15A 2EXDA 1WTPA 5FJ8H 5IYDG 3NBHB 3J7A5 4JV5L 2QEXA 2LS01 1IL2A 2OCEA 1FGBD 3CRKC 5ELBA 2K32A 1QE6A 1N9WA 3SK6A 1PH6A 4RFBA 1P8LA 4K2KA 2VQEL 4FP5D 1C8CA 4MHEA 3DM3A 1SNDA 2QKIC 1KXLA 4IUNA 4A3IH 3EROA 2BE5D 4C2MB 3KFUA 3S1MB 1O7ZA 2SNMA 1R9TH 4JI2Q 3DWQA 1ZYRC 3I4MH 1TWHB 1A2UA 1EOVA 1MIUA 5DEHA 2NBFA 5LL6X 3AFPA 4HN7A 3DWPA 4N8X1 1FGUA 5FLXE 5E4WC 1N34Q 1IKLA 4B3SL 4P73A 1HUMA 4R4QA 5IODA 4KKUA 4DNTB 3WWVA 2F4VL 1U4PA 4JI3L 1CHPD 1KABA 4C3JG 4N9PA 3T1YL 2YTXA 1I6HB 3KDFB 3S24A 2D0PA 1KQSA 2M00A 3HOXB 1H9SB 2FFKB 2AQ2B 1JB3A 3U4VA 2KA7A 2EY1A 2JA8G 1OXTA 3C3LA 1RIPA 1GVPA 4R4TA 4A3KB 4A3FB 1IBKL 3CMAA 4PMCA 4YY3L 4K8IA 2EE1A 2ALYB 3ONAB 4JI0Q 4JPBW 2LMCB 4DV7L 1ENAA 2F0WA 4JW0A 3I7FA 2B63H 1EUJA 1IKMA 4RGMA 3CXCA 1F9SA 1YNJC 1TWGB 2L0CA 4K14A 1PFBA 4RG1A 1UE7A 1JJ2A 1HTPA 2R3ZA 3NE5B 4JI6L 4JOIC 2WAQG 1YHBA 1D6EC 4FXDA 3DWAA 2OXPA 4L6TB 1BBWA 3RLOA 2JSOA 3ERSX 5I2XA 1ENFA 1S72A 1Q3LA 3M3YH 5LMNL 1LT5D 4QIWE 2A6HC 1Q81C 1GHKA 2RQXA 1E2WA 5FLXL 5JEAJ 5C0XH 2A68C 3TSSA 3FP9A 1EZ8A 1N32L 3NEMA 3T4AC 3HS0C 4OIJA 5LMNW 2JA6B 4S3SA 3IL8A 3TQYA 1HNZQ 1HZ9A 1NSNS 1GUGA 1NJIC 4GKJL 4BY7G 4DGZA 2AMCB 2PMZE 2JA5H 2NTSA 1SBBB 2J7ZA 2IPKD 1EY0A 1M90C 4L5QA 3A5ZB 1KD1C 1WCMG 4FDBA 1XX8A 3CKIB 1RDPD 4EX5A 4IJHA 4XTCS 4LAAA 1WVLA 5FO9B 2PZWA 1Y1VG 1A2TA 3U50C 1Y8NB 5CBAE 1L2FA 5IGGA 2R92B 1Q1BA 4NP5A 3J80c 5J22A 1XMQQ 3HOZH 1SE4A 5C4XG 1BR9A 1ICWA 2FJ2A 1MSGA 3VA5A 2B2YA 4NXMQ 1JR0D 3ERQA 4XT3B 4DV1Q 1TWCB 1LO5D 2FINB 2WAQE 2EOTA 2EYLA 5KYLA 1EQQA 1G8ZD 1G291 2Y0SG 2JA7G 2H4OA 4QL5A 2ZJPA 3L3OC 2ID0A 2B2WC 2PQAA 4MN3A 2MGSA 1H9SA 1TT2A 2FHTA 4IJLA 2CH4W 1V8QA 4X3UA 2UUBL 4RHSA 2X69A 3OHXC 1VQ9A 2B2TC 3BZDB 3GTMH 3ER0A 2F0HA 4DAPA 3ITPA 1GJXA 3K5OA 1PH4A 3CCVA 1YBYA 3W3AA 1R4QB 1STYA 1V1OA 3FKIB 3MXUA 2NVQH 1LTID 4IQZA 3KF8B 3S1QH 1UE1A 1NR2A 1F2ZA 1QB5D 3RZOB 4EQNA 1N34L 1X55A 2NVYB 3Q22A 2UU9Q 2A6ED 2Q2IA 4I65A 3HZXA 2TSSA 4JG2A 3GTJB 5I6YA 2F03A 3OSOA 2B2TA 5EPLA 3OTOQ 1VQHA 5IYCG 2Y0SE 3SE0A 3A54A 1DOKA 4KJOA 2R93H 1MHWC 2N78A 3I3CA 4RCOA 1UEBA 3J80i 5KNDA 1TWAB 4LF7Q 4A3GH 1I3QB 1L0WA 1MBYA 3VR2A 1AZQA 3VYTA 1PV4A 1AE2A 3TREA 3CAMA 1IXRA 2DUDA 3MAQA 4DXFA 4A93H 2KUMA 4Q0FA 4JI0L 4IALA 3VA7A 4QIWB 4IPHA 3AU7A 3VR6A 2Q2UA 4LNQA 2M2LA 3NUCA 4DK6C 2L11A 1STHA 2UXCQ 3PIPA 3UE1A 3RR5A 1JC7A 2MO0A 2PZTA 4QMGA 3F2DA 1EYAA 4CKEA 4KY7A 5CBEE 5C0XI 4A3CH 3LX0A 4POFA 1EOTA 1C4QA 2UXDQ 1U4RA 4A3JG 4HJAA 4JBMA 5KIXA 2XN9C 2JA8B 1CKMA 4OO1G 2KHSA 1Z47A 2NYZD 2IX3A 4NKLA 4IUTA 1FJGL 3I91A 1HXYD 1HNZL 4DV6L 4RCNA 2E2IH 2RHSB 2EIFA 2K5HA 2B2UA 4HR7B 5IT9E 4DV3Q 4DR1Q 1E22A 4KY5A 1EEFD 5IOCA 2EY2A 2HQLA 4OIKA 3GTGH 1O80A 5C5LA 4A76A 1HR0Q 1SJED 3S2HH 2CCZA 2R7ZH 2K04A 2J0TD 5EBDA 2PYKA 1I50B 5DAUA 4E6IA 4BBSG 3W2DA 1CM9A 2R61A 4EQOA 2NZ1D 3CPWA 3HOUH 3M7NA 2AWNA 2E75C 5M3FG 4DFAA 3CCRA 3KF8A 4NXML 4BBRG 2IY5B 3URYA 3F2CA 3HKZG 3NHHA 4DV1L 3SEBA 2VUMH 4AH6A 1PH7A 3H3VC 5GAEC 4JI1Q 3HKSA 1B3AA 3GP7A 1A3TA 1EWCA 2HCCA 5FLMG 1OTCA 3E5SA 1VQ5A 1S40A 1IW7C 3HOVG 3Q24A 1Q90A 1QZHA 3SDZA 3V2TA 1PHJA 1BUVT 1Q7YC 3L2PA 5J3BA 2ZTCA 1D5MC 1CKNB 5IT9L 4X3KA 3ULPA 2E2JH 1GUSA 3ICEA 3MWYW 1XMOL 2D5DA 3H0GH 3HOWH 4KV6A 1W6KA 1B9NA 4OXPA 3AYHB 4KJNA 5E7NA 2K5QA 5C3WA 3AQQA 1H95A 4DR4Q 4OX9Q 2LSSA 1CHQD 4XIGS 1D2BA 1PFMA 4QCLA 1QG7A 5LL6S 2QILA 3J7AV 1OXXK 1AEXA 3ND8A 3HKZE 1J5EL 3STBC 2EYHA 3OTOL 3T51B 3S15H 1DOLA 1ZYRD 4F7XA 2MJ8A 3P1HA 4DR5L 3QOLA 4PZ7A 2VY3A 3H15A 1QILA 3CD6A 5BN4A 2BCOA 4LF7L 1C0AA 3K8AA 3P20A 1L1OA 1X3GA 1B4OA 2JEBI 1GUOA 2XIWA 3KF6B 2H5XA 1S5CD 1NCVA 5M5YB 1A62A 4ZRZA 2F0FA 2ZTDA 5C4JH 4QGUA 3TBIB 1VQLA 1QUQA 5J39A 3RLFA 1VQCA 1VQ8A 2UXCL 4KHPL 4JBJA 1BF4A 2N8NA 4LMQD 2L5TA 3E9IA 3T13A 4X3TA 2K33A 3GO5A 3PCOB 4FYDA 4L5RC 2UXDL 2I5LX 1Y1WH 3S14H 4C3HH 1BCPC 4BXXG 3K80C 1JE4A 3IRBA 2X6GA 2OTJA 2KCCA 4J1MA 4NDXA 4GKKL 1X3QA 5CV9A 3FDTA 1D1KA 4DV3L 1SMYC 2EY6A 4DR1L 2BH2A 1K28A 3IFTA 4TRDA 3CQZB 4Z9CB 1E3PA 2F0PA 5FO7B 2A6HD 4GLVB 3VR3A 4A3KG 1YNND 4A3FG 1U4MA 3ND9A 4K2LA 3I4NB 2A68D 3S16B 4GNXA 3NWTA 1BBXC 4LFBQ 5ELFA 1QVCA 4KHVA 2LFNA 5I6WA 3GTOH 1HPCA 2RDFA 1D7QA 1F9PA 3Q8DA 4XQQA 4FF3A 2WP8J 1QVFA 3K59A 4BY1B 1ZKOA 3U9OA 4L8JA 3S1NH 2NB0A 2ENBA 3BVZA 3S1MH 1SNPA 4IPGA 1ESRA 5K36G 3EIVA 2K05A 4DR7Q 2BDOA 4A3EH 2JA6G 2LXKA 4XQJA 2Z4HA 5ISRA 1RD9D 1HCZA 4YY3Q 3NWSA 1EIHA 4OHJA 2KHJA 5EPKA 4ZLTF 4DPGA 4G57A 2F3VA 4B9XA 5M5WH 2YV5A 4A3MH 1C48A 5JVG3 4FF2A 2UXBL 2K4KA 4OONA 1XPOA 2NVXH 1EIFA 2BA0A 1S4ZA 3NTKA 5BR8L 4F87A 2F0QA 1XTCD 4M1UB 2R92G 2L4NA 1SEBD 1EIGA 2ICIA 3M4OH 4QUCA 4ME3A 2FXQA 2RKSA 2CFMA 1VQBA 1N32Q 2GVAA 2O2LD 2WACA 2PQEA 1X3PA 1B70B 1KC8C 3HOYB 4LF5L 5DM73 4A3DH 4HIOA 3FHWA 5M5XH 2DN8A 5JEAH 1PTOD 2HT1A 5KYIA 1UE6A 5CC4A 3MFGA 1TWFH 4K5VA 4XT1B 5KNBA 3QJYA 2F0SA 4B3TQ 3C1FA 4HMIA 4X3SA 4DUYL 2F0DA 3KLWA 5GADC 3RN2A 1NMGA 3K0YA 3AFQA 1LTBD 3B6YA 4RH6A 2CWAA 2Q8RE 4CDEC 5F2DA 4HAEA 5HY6A 1AP0A 2O5IC 4MIUA 1VQ4A 2E2DC 4OELB 4A4IA 4JCVE 4HSPA 2HDLA 5D3IB 1RF2D 5CORA 1YHAA 2MQHA 1PZID 1SXTA 1X3FA 2JK8A 1PTOH 1I4HA 1LTGD 1VMCA 2EYOA 3FKIG 4CGYB 4AYBB 1VQFA 4DAVA 1U5KA 5IYBH 2VZAA 1NMFA 5C44B 1B53A 3V96A 2RBMA 1JJGA 2XWJB 2UUBQ 1ASYA 3E9HA 1STNA 2FMCA 1EU3A 2PCFB 5TSSA 2HIVA 4ZQ3A 3OPOA 5K5PA 3M7GA 2VW9A 4DAYB 1CA6A 1B3QA 3TP8A 1VDZA 1SE8A 1HTLD 4IFDG 3CCSA 4WORA 3E3XA 3KLSA 1DGSA 4CHTB 2NZOA 3H09A 4DV0Q 2DNCA 4LFBL 1RCVD 4C3IB 4DUZQ 4GN4B 1STEA 5JVH3 1G91A 3D6WA 1NE3A 1LT4D 4KN7C 5IP9H 3R8BA 2HCIA 5M3MB 1WI5A 4IPCA 2PQAB 1KHIA 1PH2A 3LWEA 1YITA 5C3EH 4Y7NH 2EYMA 1LABA 1AFPA 1PRTF 1PRTB 5LHY1 3PO2B 2YU9H 1ONLA 3OMGA 1EZ6A 2A1AA 2JXMB 1M1KC 4DR7L 3J81c 1LTSD 4LUZA 3D4RA 1WFQA 5IWAQ 1N33Q 1V1QA 1SE3A 3PO3H 3S17H 4CJ0B 3C2PA 2GVBA 1PVOA 1GHJA 1STGA 2A69D 5IYDH 3RZDH 1PYSB 3JAMi 3OWEB 4K0KQ 3QIAA 1EY7A 1VQPA 4QUFA 4DF7A 5D14A 1K8AC 1H9JA 4OL7A 4R4CA 1HUNA 3FVQA 3M85A 2QDLA 3VYRA 4A3BB 3K5MA 1OXVA 3KJOA 2BA1A 1UAPA 2HUGA 2N88A 2NZHA 5IGCA 4V0BA 3O13A 3ZYYX 1CUKA 5NUCA 2DY7A 1JJCB 3GTPB 1QJOA 1YHQA 1MSHA 1RTNA 2KENA 2ICEC 4EGVA 2HD3A 4R9WA 2QEJC 4PG3A 3SGIA 1EY4A 4YCWA 1B7YB 2B2YC 1FJGQ 3CHBD 4DV6Q 4G7HC 5EQ0A 3TN2A 1XNRQ 1TQOA 4RGOS 3SVMA 3GTQB 2Q8TA 3EJIA 3H91A 2E8GA 4B3TL 2K75A 2NTTA 2I5HA 3H3VH 1PZKD 1M4VA 3S2DB 2M9VA 3CCLA 1CKOA 1JCKB 1VQIA 2K1BA 2L9HA 2F0IA 1Z6HA 4C3JH 4DAYA 5EKIA 1PTOF 1NY4A 2K01A 3QR8A 3EN2A 3KLSX 3L0OA 2VL6A 1PH3A 4DV4Q 2MP1A 1WJJA 1Z7TA 1SNQA 2E74C 3FEWX 4HMJA 3NENA 3T53B 4KN4C 4HJ7A 1FR3A 1SNMA 1U0LA 2UUCL 4TVAB 4BWGB 3CCUA 4EQ5A 1ILPA 2JA8H 1G51A 1G6ZA 2CVRA 2E5LQ 3A8IE 2E2HH 1EQRA 1EL0A 3NPPA 4A3IB 3DUZA 4FO2A 3J81i 1N8RC 1K83H 3A8JE 4RA8A 5A35A 2O4XA 4ILWA 2F52A 4R4OA 2KHIA 5EAYA 1R9TB 1WD1A 1WD0A 2TMPA 3LWUA 3I4MB 4RKLA 1SMXA 4X65Q 1RJTA 2HIXA 2XNAC 3E6ZX 3QG1A 1A3VA 4JI7Q 1KTKA 1BNZA 1SYCA 4DR6L 2K5WA 4U68A 1XMOQ 3NSWA 5CYUA 5ELNA 1PFSA 4RGTA 3BYYB 4LFAQ 1BCPD 3NQIA 4BY7H 4DR2L 4CJ1B 1IYVA 4DV0L 3BS1A 5G3LD 4DUZL 3GTLH 2OT2A 1SDFA 3HEJA 5I4DA 1Y69U 1SMYD 1WCMH 1HHVA 2C35B 2XSCA 2IWHA 3UI2A 1SYGA 2F0KA 1IYUA 1J5EQ 1Y1VH 3S9WA 3FMCA 3GTKH 2ZXRA 5EBCA 1EWHA 1JORA 4DR5Q 1HQMC 2D62A 2B63B 2WFWA 3P75A 1P16A 1AE3A 2RDHA 3GD7A 5C4XH 1DOMA 4IUVA 1ICFB 2WKCA 2Z6KA 2RCFA 1KIXA 2NUCA 2WB1B 4POGA 5IWAL 2N49A 2QW7A 3VYSA 1N33L 3A74A 3BVMA 4HEDA 3F2UA 2B2UC 5CV4A 4O2DA 1VQAA 4UP8A 2JA7H 2YYZA 4OWWB 3M3YB 1DJRD 4B9WA 2NN6G 2K28A 3X3MA 2OWOA 4K0KL 1BOSA 2OTLA 3GDEA 5JJLA 4KHPQ 1YEZA 2XRQD 1PH1A 3D0FA 1YJNA 2I46A 2WINB 4DV2L 3TP6A 4X64Q 1GD7A 2OEOA 3I4NG 5DNFA 3T16A 1E0BA 4X62L 3MHBA 1TXYA 2JA5B 5JJKA 4LK1C 4C1NK 1GXDC 2ZJQA 2I5MX 2MNAA 3QO2A 2C5CA 1A6XA 4IFDJ 2SDFA 3A8KE 1V9PA 1RHPA 4JVZA 1H9RA 3DXJC 2DY8A 2D0OA 1TVXA 4GKKQ 4BY1G 2QF7A 3H3VI 2L55A 1HA5A 3DEPA 1CT1D 3CC2A 4IUUA 4UDUC 1XNRL 1A0IA 1SFOH 3KJPA 3HOZB 1K8OA 1L1OB 3I56A 5CV5A 4R8NA 3HFZB 1VQJA 1QNKA 5JOBA 3EA6A 1SYBA 1PYBA 4XYQA 1QUQB 1WOCA 1HZBA 5J1ZA 3RUZA 2KJXA 2K5VA 4DV4L 5IYCH 2KEEA 3CF5A 1O7IA 1Y8OB 2G9HD 5D65A 5A2QE 3A0JA 4IUQA 1PYWD 2AWOA 1EEID 3BJUA 3K57A 1D1IA 1VF7A 1NR4A 4PNYA 5FO8B 2E5LL 1FYCA 3AB9A 3UE0A 2D2CC 2IT1A 1E24A 2DNEA 1Q46A 1VQEA 1CSQA 4YWKA 3GTMB 1KLGD 4I7ZC 5C3XA 1TY0A 4F88A 3I90A 5E4XA 2AUKA 2E76C 2NVTH 2F0LA 3HOYG 4DK0A 4HIKA 4UAIA 2Q2HA 2NVQB 4X65L 2AHOB 3MA2B 3S1QB 3K7AH 3Q6SA 4MZ9A 2A5HA 4DNRB 1YIJA 4IUPA 4A3JH 4JI7L 1CQFA 3D8GA 4GOPB 1W3SA 2UXBQ 3H94A 4ULLA 2B8FA 3SR1A 4CBVA 4GNXB 2ES2A 1T5XD 1JWSD 4OO1H 3CCJA 1JB7A 1EU4A 3SK5A 4HTHA 4FF1A 5BR8Q 2VXWA 1A3UA 4LFAL 3QB3A 5GAGC 2F0MA 3I55A 1K73C 3R2IA 4IPDA 1BQQT 1L1OC 3N6RA 3I72A 4PV1C 2YTVA 5CR3A 4BA2I 1I4RA 2R93B 4UPAA 1QCBD 4CKCA 4XDXA 2HQEA 5IE8A 3D6CA 3I4LA 3WOFA 5A2QL 1DYQA 1K3RA 2JA9A 3J80E 1B9MA 4A3GB 4LF5Q 1RTOA 3C1EA 1BCPF 1SSOA 4LF8Q 5HGQA 1MJCA 1SLJA 4PMBA 4TSSA 4AYBG 4A93B 1A8VA 5IGEA 1QNUA 4MTNA 5C44G 1LUZA 5G3LF 4BBSH 4AIMA 1H9MA 4DUYQ 4UP9A 1Q82C 5BN3A 1I94L 5M3FH 4BBRH 2F0OA 1CK1A 1RL2A 1K8MA 5HURA 2IX0A 1VQDA 4G7ZC 4KK7A 5IGBA 1FNVA 1SN8A 2KCTA 1D5XC 1EFID 3S1RH 2B2VA 5FLMH 1EYCA 1LYLA 5ELDA 3W1GA 4KTAA 3A56A 1YVCA 3CP0A 3HOVH 4QQBX 2IJ0A 2KVMA 5FLXc 5LMUQ 1EYGA 2E2IB 3NTIA 4X64L 2GN5A 4JI8L 2WKDA 1FNUA 1G2SA 2H1EA 3CCMA 2QCPX 1BXTA 2VB2X 4H44C 4NB3A 4GNXC 4C3IG 4B08A 4TKOB 2G9DA 1PDQA 1I4GA 1KAAA 1F2MA 2K5NA 4RWSC 1PH9A 1B50A 2EY5A 4X6AH 2CQAA 1C9OA 2AUJD 4KMUC 4O42A 3ZJYC 1HH2P 1UWVA 5M3MG 1HA6A 3GTGB 2OQKA 1YNJD 3J80L 4C56C 2F3WA 4NXNQ 3S2HB 4QJFA 1KRTA 1DONA 4ZK9B 2R7ZB 4AYBE 1S5DD 2HDMA 2KBNA 2L12A 5IGDA 3MXNB 1KNAA 1C7YA 2QDBA 4FVMA 4CDFC 3PO2G 3HOUB 3FPPA 1JMCA 1V43A 2ZJRA 2DJGC 4YCVA 3PIO3 4CDDC 1H9KA 4LW1A 3J7ZC 2EYJA 1M8AA 4GOPA 2VUMB 2JE6I 2AKWB 2CW0C 4FXKC 1LTLA 2EQSA 3V05A 4R1JA 4LFCQ 1Q12A 3A7AB 3DLLA 4XQNA 3J81j 1V1PA 2F0JA 3A7LA 1HZAA 1IBML 1BVSA 5I2YA 3MZ5A 5IGFA 1DCZA 1X3EA 4A3BG 2OQ0A 3IFDA 1J6QA 5T1GA 3TZUA 2KEDA 3PUXA 5T1IA 2EJFC 3G6EA 3ULJA 3TP7A 4C2MH 1JOKA 4PQXA 5IIFA 2E2JB 2C9OA 2QGQA 1XPRA 2J4XA 4FXGC 2IL8A 2A8VA 3H0GB 1S5ED 1EY5A 3HOWB 1OO9B 1UUPA 1TWHH 5C5MA 2PI2A 4OO1I 3NXWA 1HRJA 5EKLA 1J8IA 1I4QA 5IP7G 1K8GA 4LF6L 2KCNA 1U4LA 4R4IA 4A3LG 2CQOA 3EQLC 4BXXH 1JWUD 2Z6BA 3KOJA 3L7ZC 3I73A 1S5BD 1I6HH 4QF4A 2CKZB 3UDFA 2Q8IB 3SHLA 2SEBD 3ULLA 3HOXH 1AW7A 2K6AA 3S15B 2ATWA 1FL0A 5FJ8G 1LM0A 2K14A 3MTSA 1XYIA 4L5TA 4C1NI 1BDOA 3M4QA 4A3KH 1JE5A 2RSNA 4A3FH 2JEAI 3FPUB 1TU2B 4LF8L 4ZAIA 1UE5A 4A3IG 1SJHD 3L9AX 1JICA 2R6GA 1DM0B 1EIYB 5C4JB 1PFNA 2VQFL 4CKBA 2EDGA 1TWGH 2L15A 4PMWA 2XGTA 3SK8A 5EPJA 4ABNA 3MXNA 4MNOA 3KBGA 1VF5C 4RGNA 3G4SA 3I4MG 3TDQA 4B3RL 1X6OA 3OW2A 4Y52H 2UUCQ 5I9OA 3UDIA 4P71A 1LACA 3BG3A 3LNNA 1Y1WB 3S14B 4IOCA 4GZYC 5K36H 4C3HB 3K0XA 3OIQA 4QY7A 3NBIA 4PZ8A 2JA6H 1A63A 2RF4A 3QWNA 3TZDA 3JAMc 5LMUL 2Z9HA 1G6PA 1E2VA 4HJ5A 1LLRD 1F9RA 1S5FD 4AQYQ 2MFIA 5EKKA 1EY6A 1WTHA 2RA4A 5EGTA 3OWFA 2KQ3A 1K0RA 4DV5Q 3VR4A 3W1BA 4NXNL 1VQNA 1WTWA 2DGYA 2R92H 3K5NA 4KD4A 3OW7A 2Z4IA 4DR6Q 2B63G 3RD4A 3GTOB 1X56A 4L5SA 3W5OA 1KLUD 3TS0A 2SNSA 4HJ8A 3PGZA 2WB1G 1TWCH 2EJGC 4DR2Q 1PA6A 1SYFA 1EFWA 1XWEA 3S1NB 5IY0A 1TY2A 2L1BA 4LF4L 4LFCL 5GROA 2P5ZX 4H0LC 4JI5Q 4LF9Q 5C0XG 3KYHC 1SAPA 2Z8LA 4RKBA 4A3EB 1CFMA 1B44D 3OYYA 3F8TA 2EJMA 4H02A 1ENCA 5GAHC 2N3SA 4K5WA 3T56B 2JA5G 1ESFA 1TR5A 4WJ3M 1HJPA 5M5WB 1CQVA 1YNXA 4RHRA 4A3MB 3CCQA 5IT9c 4HCEA 1SR3A 2NVXB 5FKAC 4MTKA 4WFN3 3FKIH 3BDOA 1BBUA 1IYJB 1YI2A 1BKBA 3M4OB 2XWBB 1Z9FA 3M4YA 1VS0A 1JQYD 2EYPA 3HOZG 3RZOH 4LWCA 1S3OA 5CV8A 1B2TA 2NVYH 1W2BA 4JI4L 2ZXOA 4KKSA 4YHHL 4JYAL 3GQBA 5D3DA 4DV2Q 1E1OA 1MGSA 2WB1E 3I2ZA 4J8QA 3GTJH 4FF4A 4A3DB 4K8JA 5M5XB 2WIIB 3D4DA 4X62Q 3MEFA 1IW7D 1TWFB 2BOSA 2B29A 4WJ4A 4G4KA 2IX1A 4H7BA 1WTOA 1X9NA 5H1SE 2PZUA 4OWTB 4P2CB 1TWAH 1QWYA 1I3QH 4ME5A 3OOCA 4IFDH 5E3FA 2RSOA 4G7OC 1D5ZC 4UP7A 4B3MQ 3TRZA 2VNUD 3IKJA 4LUOA 1I4XA 4KLKA 3PUVA 1JT8A 2JYOA 5EJWA 1F2LA 1KRSA 5CMDA 1VQKA 1Q86C 4V190 1O78A 1YNNC 3KLRA 1VQ7A 1GOZA 4H13C 4ZUJA 2F0GA 3AMUA 3EBEA 4HIDA 3PF4A 2ZM6Q 1PTOB 5E1FA 3NBHA 2F0UA 1PRTC 3NP8A 3MFYA 2N55A 1CZWA 3STBD 3RLNA 1GUTA 3LGJA 3E0JA 1PXUA
chains in the Genus database with same CATH topology
2RVLA 3HG9A 1EQTA 1BO0A 2EYFA 1AZPA 1SYEA 3PUYA 1DXMA 2MPMA 3DM1A 1WTQA 2PO4A 5JAVA 3I8ZA 1EY8A 1MI2A 5BN5A 1EYDA 5FOBB 3MXGA 3J7YW 1RODA 1GUWA 1ZXTA 5C4ZA 4BA1I 4Q5VA 3GV6A 2Z1CA 5C3EB 3H6MA 4Y7NB 2YU9B 1PZJD 1PTOC 3K6OA 1KNEA 4EQPA 4TQUS 1T5EA 2JP1A 3PO3B 3S17B 3N52A 1TS4A 3MEHA 5HGTA 5KRUA 3PIP3 3R3OA 1LTAD 2B2WA 3RZDB 2I07B 3JAME 2CW0D 4HCSA 3HP3A 2GA4B 3FRPB 5DM63 5JPNC 3G7LA 1TS3A 3K58A 3G6JB 3OMCA 2F4IA 3CRLC 2LKVA 2KOLA 2K7VA 1MD2D 3X3NA 2BDNA 4J6HA 1I4PA 2FMMA 1SNOA 4IFDI 1HFGA 3U9SA 2VB3X 1CA5A 3PUZA 2BE5C 2XVSA 4C3JB 4DN4M 1TS2A 1O7LA 1CI3M 5M9OA 2PMZB 5C0XJ 4JK1C 2NWGA 3JAML 2PW7A 3SK4A 4XYOA 2B39A 3BVGA 2E2HB 3J81E 1K83B 4DU9A 3CU7A 1X32A 4NW2A 1A15A 4XXEA 3P7JA 5COYA 2AQ3B 2MUYA 2WAQB 3EVQA 1OXUA 1EY9A 4YIJA 2NN6H 2AQ1B 4RAUC 1FD7D 2B8GA 2PW5A 4WJWA 2A69C 4EVOA 1JOOA 1UNSA 4BY7B 1II3A 1VCIA 1STBA 3VR5A 2CHBD 2EPBA 3GTLB 3PV0A 4ZKCB 1WCMB 1LTTD 4CJ2C 4WRDA 3MXPA 1KDCA 4ZYSA 1E2ZA 1U9RA 5CGKA 3EFXD 1Y1VB 1V1PB 1DD2A 3GTKB 3NQTA 1F9QA 3J81L 1PLFA 2B2VC 5C4XB 1OXSC 4ID6A 4DA2A 4C3HG 5JPMC 5ELEA 3Q23A 3RMHA 1BCPB 1IHZA 2X6LA 1WTVA 2Y0SB 4L63B 2JA7B 4IZ8A 2D9UA 2V4DA 1CTMA 1FNWA 2MHVA 3IAYA 1R4PB 2OF1A 1VMPA 1HQRD 2XRSD 3R2TA 4KHZA 3Q0AA 4IN3A 3SXHA 4NMZA 4O1NA 1O7YA 3C46A 1Q1EA 1F77A 1IL8A 4KI0A 3BDCA 1CZGA 5KEEA 5ELCA 2A74C 1LTRD 5CV6A 1SFOB 1TIID 2ZXPA 4OGQC 3D31A 1Q8IA 1PMRA 4U673 3KUPA 4ODGA 1SYDA 1TKWB 3KK7A 3J7AF 4K6LA 3R93A 4KY6A 1F2YA 5I9PA 4QB4A 1UEAB 5AFWA 3HRZC 1B1ZA 3HGBA 4K5XA 2F0VA 2WV6D 4M8AA 2A6EC 3D4WA 4FNFA 3TMEA 2EXZA 1HFNA 5FK9C 1WTXA 4HSVA 3MC0B 1L0YB 2NVTB 2NN6I 3DEOA 2F0EA 2F1MA 5JEAG 1ET9A 2PNRC 3DMUA 3K7AB 4R8IA 1SE2A 4A3JB 1PRTD 5C6AA 1Y8PB 3WOEA 1JOQA 1LT3D 1DZ1A 1ILQA 1KDAA 3TP5A 3GV3A 2SOBA 4JBWA 3MVVA 1TS5A 2KECA 5KNCA 3K5LA 1LT6D 3OIPA 2IW3A 5C4HA 3WDNA 5CV7A 3BDLA 2RDGA 1W6JA 2PPBC 1STAA 2F0NA 1G2TA 4BBSB 1NUCA 3DHQA 2F0TA 1XXGA 4IURA 2EZVA 1QOHA 5M3FB 3VYUA 4BBRB 3PMFA 4ZKBB 1ML0D 3HKZB 3D3RA 3QOJA 3BYTB 4N9TA 3S1RB 1SNCA 1JWMD 1ZEQX 1L0XB 5KGUA 2O5JC 1EQVA 3HOVB 4LJZC 3I70A 1NAPA 4DK1A 2LY7A 3A55A 2K5DA 3NK9A 4K6DA 4ZUIA 1KDBA 4KD3A 3KBXA 4F8MA 1GUNA 2K03A 2ZT9C 2A73B 4KKTA 1I6VC 1AN8A 3NTHA 1ET6A 1J9OA 3PUWA 4DXGA 5JJZA 1RKNA 4BS9A 1WTRA 1LV9A 2EVBA 1WTPA 2LS01 1FGBD 3CRKC 5ELBA 2K32A 1QE6A 3SK6A 4RFBA 4K2KA 4FP5D 1C8CA 4MHEA 1SNDA 2QKIC 4IUNA 3EROA 2BE5D 4C2MB 3S1MB 1O7ZA 2SNMA 3DWQA 1ZYRC 1TWHB 1A2UA 5DEHA 2NBFA 5LL6X 4HN7A 3DWPA 5FLXE 5E4WC 1IKLA 5IODA 1HUMA 4KKUA 4DNTB 1U4PA 1CHPD 1KABA 4C3JG 4N9PA 1I6HB 2M00A 3HOXB 1H9SB 2FFKB 2AQ2B 1JB3A 2KA7A 2EY1A 1OXTA 3C3LA 4A3KB 4A3FB 4PMCA 4K8IA 2EE1A 3ONAB 2LMCB 1ENAA 2F0WA 1IKMA 4RGMA 1F9SA 1YNJC 1TWGB 2L0CA 4K14A 1PFBA 1HTPA 2R3ZA 3NE5B 1D6EC 4FXDA 3DWAA 2OXPA 4L6TB 2JSOA 5I2XA 1ENFA 1Q3LA 1LT5D 2A6HC 1GHKA 2RQXA 1E2WA 5FLXL 5JEAJ 5C0XH 2A68C 3TSSA 1EZ8A 3T4AC 3HS0C 4OIJA 2JA6B 4S3SA 3IL8A 1NSNS 1GUGA 4DGZA 2NTSA 1SBBB 2J7ZA 2IPKD 1EY0A 1XX8A 3CKIB 1RDPD 4XTCS 4LAAA 1WVLA 5FO9B 2PZWA 1A2TA 1Y8NB 5CBAE 5IGGA 2R92B 1Q1BA 4NP5A 5J22A 1SE4A 1BR9A 1ICWA 2FJ2A 1MSGA 3VA5A 2B2YA 1JR0D 3ERQA 4XT3B 1TWCB 1LO5D 2FINB 2EOTA 2EYLA 5KYLA 1G8ZD 1G291 2H4OA 3L3OC 2ID0A 2B2WC 4MN3A 2MGSA 1H9SA 1TT2A 2FHTA 1V8QA 4X3UA 4RHSA 2X69A 3OHXC 2B2TC 3BZDB 4DAPA 2F0HA 3ITPA 1GJXA 3K5OA 3W3AA 1R4QB 1STYA 1V1OA 3FKIB 3MXUA 1LTID 4IQZA 1NR2A 1F2ZA 1QB5D 3RZOB 4EQNA 2NVYB 3Q22A 2A6ED 4I65A 3HZXA 2TSSA 3GTJB 5I6YA 2F03A 3OSOA 2B2TA 5EPLA 3SE0A 3A54A 1DOKA 4KJOA 3I3CA 4RCOA 5KNDA 1TWAB 1I3QB 1MBYA 3VR2A 1AZQA 3VYTA 3MAQA 4DXFA 2KUMA 4Q0FA 4IALA 3VA7A 4QIWB 3AU7A 3VR6A 2M2LA 3NUCA 2L11A 1STHA 1JC7A 2PZTA 4QMGA 1EYAA 4CKEA 4KY7A 5CBEE 5C0XI 3LX0A 1EOTA 1C4QA 1U4RA 5KIXA 2XN9C 2JA8B 4OO1G 2KHSA 1Z47A 2NYZD 2IX3A 4NKLA 4IUTA 3I91A 1HXYD 4RCNA 2B2UA 4HR7B 5IT9E 4KY5A 1EEFD 5IOCA 2EY2A 4OIKA 1O80A 5C5LA 1SJED 2K04A 2J0TD 5EBDA 2PYKA 1I50B 5DAUA 4E6IA 3W2DA 1CM9A 2R61A 4EQOA 2NZ1D 3M7NA 2AWNA 2E75C 4DFAA 3KF8A 3URYA 3NHHA 3SEBA 3H3VC 1B3AA 3GP7A 1A3TA 1EWCA 2HCCA 3E5SA 1IW7C 3Q24A 1Q90A 3SDZA 3V2TA 1BUVT 1D5MC 5IT9L 4X3KA 1GUSA 3MWYW 2D5DA 4KV6A 1W6KA 1B9NA 4KJNA 2K5QA 5C3WA 1CHQD 4XIGS 1D2BA 1PFMA 4QCLA 1QG7A 5LL6S 2QILA 3J7AV 1OXXK 1AEXA 3ND8A 2EYHA 3T51B 1DOLA 1ZYRD 4F7XA 2MJ8A 3P1HA 3QOLA 1QILA 5BN4A 2BCOA 3P20A 1B4OA 2JEBI 1GUOA 2XIWA 1S5CD 1NCVA 5M5YB 4ZRZA 2F0FA 3TBIB 5J39A 3RLFA 1BF4A 4LMQD 2L5TA 3T13A 4X3TA 2K33A 3GO5A 4FYDA 1BCPC 1JE4A 2X6GA 2KCCA 4J1MA 4NDXA 1X3QA 5CV9A 3FDTA 1D1KA 1SMYC 2EY6A 3IFTA 4TRDA 3CQZB 4Z9CB 2F0PA 5FO7B 2A6HD 3VR3A 1YNND 3I4NB 1U4MA 3ND9A 4K2LA 2A68D 3S16B 3NWTA 1BBXC 5ELFA 4KHVA 2LFNA 5I6WA 1HPCA 2RDFA 1F9PA 4XQQA 4FF3A 2WP8J 3K59A 4BY1B 1ZKOA 3U9OA 4L8JA 2NB0A 2ENBA 3BVZA 1SNPA 1ESRA 5K36G 2K05A 2BDOA 4XQJA 2Z4HA 5ISRA 1RD9D 1HCZA 3NWSA 1EIHA 4OHJA 5EPKA 4ZLTF 4G57A 2F3VA 4B9XA 4FF2A 1C48A 5JVG3 2BA0A 1S4ZA 3NTKA 4F87A 2F0QA 1XTCD 4M1UB 2L4NA 1SEBD 1EIGA 2ICIA 4QUCA 2RKSA 2O2LD 2WACA 2PQEA 1X3PA 3HOYB 5DM73 2DN8A 5JEAH 1PTOD 5KYIA 5CC4A 3MFGA 4K5VA 4XT1B 5KNBA 3QJYA 2F0SA 3C1FA 4HMIA 4X3SA 2F0DA 3K0YA 1LTBD 4RH6A 2Q8RE 5F2DA 4HAEA 1AP0A 2O5IC 4MIUA 2E2DC 4HSPA 2HDLA 5D3IB 1RF2D 5CORA 1PZID 1SXTA 1PTOH 1I4HA 1LTGD 1VMCA 2EYOA 4CGYB 4AYBB 4DAVA 5C44B 1B53A 3V96A 2RBMA 2XWJB 1STNA 2FMCA 1EU3A 2PCFB 5TSSA 4ZQ3A 3OPOA 5K5PA 3M7GA 1CA6A 3TP8A 1VDZA 1HTLD 4IFDG 4WORA 3KLSA 4CHTB 3H09A 2DNCA 1RCVD 4C3IB 1STEA 5JVH3 1G91A 3D6WA 1LT4D 4KN7C 3R8BA 2HCIA 5M3MB 3LWEA 2EYMA 1LABA 1AFPA 1PRTF 1PRTB 5LHY1 3PO2B 1ONLA 3OMGA 2JXMB 1LTSD 3D4RA 1SE3A 4CJ0B 3C2PA 1GHJA 1STGA 2A69D 3OWEB 3QIAA 1EY7A 4QUFA 4DF7A 5D14A 1H9JA 4OL7A 1HUNA 3FVQA 3M85A 3VYRA 4A3BB 3K5MA 1OXVA 2BA1A 1UAPA 2HUGA 2N88A 5IGCA 4V0BA 3O13A 3ZYYX 5NUCA 2DY7A 3GTPB 1QJOA 1MSHA 1RTNA 2ICEC 4EGVA 4R9WA 2QEJC 1EY4A 2B2YC 3CHBD 4G7HC 5EQ0A 3TN2A 1TQOA 4RGOS 3SVMA 3GTQB 2Q8TA 3EJIA 3H91A 2NTTA 1PZKD 1M4VA 3S2DB 2M9VA 1JCKB 2K1BA 2L9HA 2F0IA 1Z6HA 4DAYA 5EKIA 1PTOF 2K01A 3KLSX 2MP1A 1Z7TA 2E74C 1SNQA 3FEWX 4HMJA 3T53B 4KN4C 1FR3A 1SNMA 4BWGB 1ILPA 1G6ZA 2CVRA 3A8IE 1EL0A 3NPPA 4A3IB 3DUZA 4FO2A 3A8JE 4RA8A 5A35A 2O4XA 4ILWA 1R9TB 1WD1A 1WD0A 2TMPA 3LWUA 3I4MB 4RKLA 1RJTA 2XNAC 3E6ZX 3QG1A 1A3VA 1KTKA 1BNZA 1SYCA 2K5WA 4U68A 3NSWA 5CYUA 4RGTA 3BYYB 1BCPD 3NQIA 4CJ1B 1IYVA 3BS1A 5G3LD 2OT2A 1SDFA 3HEJA 5I4DA 1Y69U 1SMYD 1HHVA 2XSCA 2IWHA 3UI2A 1SYGA 2F0KA 1IYUA 3S9WA 3FMCA 2ZXRA 5EBCA 1EWHA 1JORA 1HQMC 2D62A 2B63B 3P75A 2RDHA 3GD7A 1DOMA 4IUVA 2WKCA 2NUCA 2WB1B 3VYSA 3BVMA 4HEDA 3F2UA 2B2UC 5CV4A 2YYZA 3M3YB 1DJRD 4B9WA 2NN6G 2K28A 3X3MA 1BOSA 2XRQD 2I46A 2WINB 3TP6A 2OEOA 5DNFA 3T16A 1E0BA 3MHBA 2JA5B 4LK1C 4C1NK 1GXDC 3QO2A 2C5CA 1A6XA 4IFDJ 2SDFA 3A8KE 1RHPA 1H9RA 3DXJC 2DY8A 1TVXA 2QF7A 2L55A 1HA5A 3DEPA 1CT1D 4IUUA 4UDUC 3HOZB 1K8OA 5CV5A 4R8NA 5JOBA 1QNKA 3EA6A 1SYBA 4XYQA 5J1ZA 3RUZA 2KJXA 2KEEA 1Y8OB 2G9HD 5D65A 5A2QE 4IUQA 1PYWD 2AWOA 1EEID 3K57A 1D1IA 1VF7A 1NR4A 4PNYA 5FO8B 1FYCA 3AB9A 2D2CC 2IT1A 2DNEA 3GTMB 1KLGD 4I7ZC 5C3XA 1TY0A 4F88A 3I90A 5E4XA 2AUKA 2E76C 2F0LA 4DK0A 4UAIA 2NVQB 3MA2B 3S1QB 3Q6SA 2A5HA 4DNRB 4IUPA 1PXUA 1CQFA 3D8GA 3H94A 4CBVA 2B8FA 4ULLA 3SR1A 4OO1H 1T5XD 1JWSD 1EU4A 3SK5A 4HTHA 4FF1A 2VXWA 1A3UA 3QB3A 2F0MA 3R2IA 1BQQT 3N6RA 3I72A 4PV1C 5CR3A 4BA2I 1I4RA 2R93B 1QCBD 4CKCA 4XDXA 2HQEA 3D6CA 3I4LA 3WOFA 5A2QL 1DYQA 3J80E 4A3GB 1B9MA 1RTOA 3C1EA 1BCPF 1SSOA 4PMBA 4TSSA 4A93B 5IGEA 1QNUA 5G3LF 1H9MA 5BN3A 2F0OA 1CK1A 1K8MA 5HURA 2IX0A 4G7ZC 4KK7A 5IGBA 1FNVA 1D5XC 1EFID 2B2VA 1EYCA 5ELDA 4KTAA 3A56A 2IJ0A 2KVMA 2E2IB 3NTIA 2WKDA 1FNUA 1G2SA 2H1EA 2QCPX 1BXTA 2VB2X 4H44C 4C3IG 4B08A 4TKOB 2G9DA 1PDQA 1I4GA 1KAAA 1F2MA 4RWSC 1B50A 2EY5A 2CQAA 2AUJD 4KMUC 4O42A 1HA6A 3GTGB 1YNJD 3J80L 4C56C 2F3WA 3S2HB 1DONA 4ZK9B 2R7ZB 1S5DD 2HDMA 2L12A 5IGDA 1KNAA 2QDBA 4FVMA 3HOUB 3FPPA 1V43A 3PIO3 1H9KA 2EYJA 1M8AA 2VUMB 2JE6I 2CW0C 4FXKC 3V05A 1Q12A 3A7AB 4XQNA 1V1PA 2F0JA 3A7LA 5I2YA 3MZ5A 5IGFA 1DCZA 3IFDA 5T1GA 3TZUA 2KEDA 3PUXA 5T1IA 2EJFC 3TP7A 1JOKA 4PQXA 5IIFA 2E2JB 2C9OA 2J4XA 4FXGC 2IL8A 3H0GB 1S5ED 1EY5A 3HOWB 1OO9B 1UUPA 5C5MA 4OO1I 3NXWA 1HRJA 5EKLA 1J8IA 1I4QA 2KCNA 1U4LA 3EQLC 1JWUD 3L7ZC 3I73A 1S5BD 4QF4A 2Q8IB 3SHLA 2SEBD 1AW7A 2K6AA 3S15B 3MTSA 1XYIA 4C1NI 1BDOA 2RSNA 2JEAI 3FPUB 1TU2B 4ZAIA 1SJHD 3L9AX 1JICA 2R6GA 1DM0B 5C4JB 1PFNA 4CKBA 2EDGA 4ABNA 4PMWA 3SK8A 5EPJA 3MXNA 3KBGA 1VF5C 4RGNA 3TDQA 5I9OA 1LACA 3BG3A 3LNNA 1Y1WB 3S14B 4GZYC 5K36H 4C3HB 3OIQA 3NBIA 3QWNA 3TZDA 1E2VA 1LLRD 1F9RA 1S5FD 5EKKA 1EY6A 2RA4A 5EGTA 3OWFA 2KQ3A 3VR4A 1WTWA 3K5NA 4KD4A 3OW7A 2Z4IA 3RD4A 3GTOB 1KLUD 2SNSA 2EJGC 1SYFA 1XWEA 3S1NB 1TY2A 2L1BA 4H0LC 5C0XG 1SAPA 2Z8LA 4RKBA 4A3EB 1CFMA 1B44D 2EJMA 1ENCA 4K5WA 3T56B 1ESFA 1TR5A 5M5WB 1CQVA 4RHRA 4A3MB 4HCEA 2NVXB 5FKAC 4WFN3 3BDOA 3M4OB 2XWBB 3M4YA 1JQYD 2EYPA 5CV8A 1B2TA 2ZXOA 4KKSA 3GQBA 5D3DA 1MGSA 4FF4A 4A3DB 4J8QA 4K8JA 5M5XB 2WIIB 3D4DA 1IW7D 1TWFB 2BOSA 4G4KA 2IX1A 4H7BA 1WTOA 2PZUA 4P2CB 1QWYA 4ME5A 3OOCA 4IFDH 5E3FA 2RSOA 4G7OC 1D5ZC 2VNUD 3IKJA 1I4XA 3PUVA 2JYOA 5EJWA 1F2LA 5CMDA 4V190 1O78A 1YNNC 3KLRA 1GOZA 4H13C 4ZUJA 2F0GA 3AMUA 1PTOB 5E1FA 3NBHA 2F0UA 1PRTC 3NP8A 3MFYA 2N55A 1CZWA 1GUTA 3E0JA 1EZ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B3A A;  2FMM A;  2L1B A;  2RVL A;  1EQT A;  2B2V A;  1Q3L A;  2X6G A;  4XT1 B;  1J9O A;  1BNZ A;  2HCC A;  4U68 A;  5JJZ A;  1HFG A;  4X3S A;  1WTR A;  1BO0 A;  2B2T A;  1X3Q A;  5EPL A;  2X6L A;  3FDT A;  4CJ0 B;  1WTV A;  1AZP A;  1CA5 A;  1LV9 A;  1ILQ A;  1DZ1 A;  1SAP A;  2KEE A;  4OIJ A;  1WTP A;  2KVM A;  1DOK A;  2D9U A;  3IL8 A;  5D65 A;  2MPM A;  4DN4 M;  3MTS A;  3DM1 A;  1WTQ A;  1XYI A;  4QUF A;  3I3C A;  4IUQ A;  5D14 A;  2Q8R E;  1G2S A;  3GV3 A;  2H1E A;  3I8Z A;  4CJ1 B;  1MI2 A;  1NR4 A;  1HUN A;  1QE6 A;  2KEC A;  4X3K A;  4HAE A;  2J7Z A;  1AP0 A;  1AZQ A;  2RSN A;  1PDQ A;  1U4M A;  1SDF A;  3FPU B;  2HUG A;  2N88 A;  4MHE A;  4RWS C;  1C8C A;  4ZAI A;  1B50 A;  1VMP A;  2NWG A;  3MWY W;  1HHV A;  2HDL A;  1XX8 A;  2KUM A;  3UI2 A;  2DY7 A;  4O42 A;  5COR A;  1BBX C;  1HA6 A;  1O7Z A;  1WVL A;  1JIC A;  1MSH A;  1RTN A;  1PFN A;  1ROD A;  1VMC A;  1DON A;  1GUW A;  4R9W A;  4ZK9 B;  1ZXT A;  2M2L A;  2HDM A;  3I90 A;  2L12 A;  5CBA E;  1F9P A;  1O7Y A;  5EPJ A;  2L11 A;  5E4X A;  2B2Y C;  1G2T A;  1KNA A;  1IL8 A;  1B53 A;  3GV6 A;  4IUR A;  1DOM A;  1ICW A;  4IUV A;  5EQ0 A;  3TN2 A;  4UAI A;  1X32 A;  1PFM A;  4NW2 A;  2FJ2 A;  1MSG A;  5CBE E;  1A15 A;  2B2Y A;  1B2T A;  1EOT A;  3Q6S A;  1QG7 A;  3P7J A;  1MGS A;  4IUP A;  1U4R A;  4XT3 B;  3SVM A;  2Q8T A;  4ZKB B;  1ML0 D;  1ESR A;  3H91 A;  5E4W C;  5COY A;  1IKL A;  1M8A A;  2FIN B;  1HUM A;  2EOT A;  2K05 A;  4HED A;  3F2U A;  1DOL A;  2B2U C;  2NYZ D;  2K1B A;  1U4P A;  2L9H A;  3KUP A;  1KNE A;  1CA6 A;  2MJ8 A;  4IUT A;  4RAU C;  3TZD A;  3I91 A;  5EKI A;  2K01 A;  2VXW A;  2K28 A;  4R8I A;  2B2W C;  2JP1 A;  4MN3 A;  1WTO A;  2B2U A;  2MGS A;  1EIH A;  2MP1 A;  3N52 A;  5EPK A;  4ZLT F;  2FFK B;  2FHT A;  3R93 A;  4X3U A;  2B2W A;  1NAP A;  2RSO A;  1F9R A;  2X69 A;  3IFD A;  5T1G A;  5DNF A;  4HCS A;  4XDX A;  1B4O A;  1E0B A;  2KED A;  2B2T C;  2XIW A;  3HP3 A;  5T1I A;  1ILP A;  1G6Z A;  1NCV A;  2RA4 A;  4OIK A;  2CVR A;  1O80 A;  1S4Z A;  2JYO A;  1F2L A;  1RTO A;  3QO2 A;  2EPB A;  3G7L A;  5AFW A;  5EJW A;  5CMD A;  1SSO A;  1G91 A;  3D6W A;  1WTW A;  2SDF A;  4ZKC B;  1EL0 A;  2IL8 A;  2K04 A;  4CJ2 C;  2L4N A;  2EE1 A;  2HCI A;  1EIG A;  1RHP A;  3ONA B;  2DY8 A;  1IKM A;  1BF4 A;  4QUC A;  3KBX A;  1TVX A;  4RA8 A;  1CM9 A;  1F9S A;  4LMQ D;  2NZ1 D;  3LWE A;  3DEP A;  1HFN A;  4IUU A;  1HRJ A;  1J8I A;  1WTX A;  2N55 A;  4HSV A;  2K03 A;  4X3T A;  1PFB A;  1X3P A;  1NR2 A;  2KOL A;  1WD1 A;  2R3Z A;  1F9Q A;  3DEO A;  1WD0 A;  1PLF A;  1U4L A;  2B2V C;  2BDN A;  1RJT A;  1JE4 A;  1QNK A; 
#chains in the Genus database with same CATH topology
 4LUV A;  2RVL A;  1I5F A;  3HG9 A;  1EQT A;  4JOI A;  1AH9 A;  1BO0 A;  1PH5 A;  2EYF A;  1AZP A;  1SYE A;  2ZTE A;  1YJW A;  3PUY A;  1DXM A;  2MPM A;  3BZC A;  3DM1 A;  2R93 G;  1WTQ A;  4GN5 A;  2PO4 A;  4AQY L;  5JAV A;  2VS1 A;  3I8Z A;  4P72 A;  1EY8 A;  1MI2 A;  5BN5 A;  4A3G G;  4GS3 A;  4DV5 L;  1YJ9 A;  1EYD A;  1XPU A;  5FOB B;  4A93 G;  3MXG A;  1I50 H;  1GO3 E;  3J7Y W;  1VQ6 A;  1ROD A;  1GUW A;  3KDF A;  1ZXT A;  5C4Z A;  4BA1 I;  2RHQ B;  2JN4 A;  2Z6K C;  4Q5V A;  2DJF C;  4UY8 C;  3I4O A;  3GV6 A;  2HHH Q;  2Z1C A;  5C3E B;  1MJE A;  3H6M A;  4A3C G;  4Y7N B;  1GKH A;  3G48 A;  1XNQ Q;  2YU9 B;  1PZJ D;  4LF9 L;  4GN3 B;  4JI5 L;  1PTO C;  3K6O A;  4GLA C;  3CME A;  1KNE A;  4JI2 L;  4EQP A;  3M9B A;  2UUA Q;  4TQU S;  1T5E A;  2JP1 A;  3PO3 B;  3S17 B;  4HIM A;  3N52 A;  1TS4 A;  3MEH A;  5HGT A;  5KRU A;  3PIP 3;  4CDC C;  3R3O A;  1LTA D;  2B2W A;  3RZD B;  3TS2 A;  2I07 B;  3JAM E;  1I94 Q;  4DK3 C;  3AEV A;  2CW0 D;  1PH8 A;  4HCS A;  3HP3 A;  3F2B A;  2GA4 B;  2JQO A;  4IOA A;  3T1H Q;  3FRP B;  5DM6 3;  1VQO A;  5JPN C;  3G7L A;  1TS3 A;  3K58 A;  2R7Z G;  3G6J B;  1Q8K A;  3OMC A;  4P74 A;  2F4I A;  2PI2 E;  3CRL C;  3HOU G;  2LKV A;  4N8F A;  5AJ3 Q;  2KOL A;  2K52 A;  2K7V A;  1MD2 D;  4JI8 Q;  3X3N A;  2VUM G;  2BDN A;  4J6H A;  1I4P A;  2FMM A;  1SNO A;  4IFD I;  1HFG A;  3U9S A;  2VB3 X;  1N36 Q;  1X65 A;  1CA5 A;  3PUZ A;  2XTI A;  2QA4 A;  2BE5 C;  2K50 A;  2XVS A;  4C3J B;  4DN4 M;  3RNU A;  1TS2 A;  1O7L A;  2LXJ A;  4B3M L;  1CI3 M;  5M9O A;  2PMZ B;  5C0X J;  1NNX A;  5M5Y H;  4ZCK A;  1HNX Q;  4JK1 C;  2NWG A;  5DLQ E;  3JAM L;  3H0G G;  2JJQ A;  2PW7 A;  3HOW G;  1HZC A;  1SRO A;  3SK4 A;  4XYO A;  1VQG A;  2B39 A;  2ZM6 L;  1KAW A;  3BVG A;  2E2H B;  1CSP A;  3J81 E;  1K83 B;  1E1T A;  4DU9 A;  1XTD A;  3CU7 A;  4GLX A;  1X32 A;  4NW2 A;  1A15 A;  1IBM Q;  4XXE A;  4JBK A;  1QZG A;  3P7J A;  5COY A;  2AQ3 B;  2MUY A;  2WAQ B;  5GQO A;  3EVQ A;  1OXU A;  3CC7 A;  1EY9 A;  4YIJ A;  2NN6 H;  2AQ1 B;  4RAU C;  1FD7 D;  1XMQ L;  3NEL A;  2B8G A;  2KCM A;  3CQZ H;  2PW5 A;  4WJW A;  2A69 C;  4EVO A;  1JOO A;  3I4N H;  5ELO A;  2BH8 A;  1UNS A;  3S16 H;  4BY7 B;  1IBL Q;  4LF6 Q;  1II3 A;  1VCI A;  1STB A;  3VR5 A;  2CHB D;  3PQI A;  2EPB A;  3GTL B;  4APV A;  4DR3 Q;  3PV0 A;  4ZKC B;  1WCM B;  1LTT D;  4CJ2 C;  4WRD A;  3MXP A;  1KDC A;  4ZYS A;  1E2Z A;  4X66 Q;  1U9R A;  2G5D A;  5CGK A;  3EFX D;  4BY1 H;  1Y1V B;  1V1P B;  2HHH L;  1DD2 A;  2V1C C;  3GTK B;  2CWP A;  3NQT A;  1T9H A;  1F9Q A;  3J81 L;  1PLF A;  2B2V C;  1XNQ L;  5C4X B;  1OXS C;  4ID6 A;  4DA2 A;  1Y1W G;  4P75 A;  4C3H G;  5JPM C;  5ELE A;  1K3B C;  3Q23 A;  3RMH A;  3TEH B;  2CH4 A;  4DNI A;  2I0Q A;  3UDG A;  1BCP B;  2UUA L;  1IHZ A;  2X6L A;  1WTV A;  1SRU A;  2Z0S A;  2Y0S B;  4L63 B;  2JA7 B;  1KL9 A;  2PNH A;  4IZ8 A;  2A19 A;  2VQF Q;  2D9U A;  2V4D A;  1CTM A;  1FNW A;  4I7A A;  2UU9 L;  3T1H L;  2R7D A;  2MHV A;  3IAY A;  4B3R Q;  1R4P B;  2OF1 A;  1VMP A;  1HQR D;  2XRS D;  3R2T A;  4KHZ A;  3Q0A A;  4NPS A;  1D8L A;  4IN3 A;  3CPF A;  3SXH A;  3U58 A;  3CW2 C;  4NMZ A;  4O1N A;  1O7Y A;  3C46 A;  1HNW Q;  1Q1E A;  3RN5 A;  1F77 A;  5AJ3 L;  1IL8 A;  4KI0 A;  3HOY H;  3BDC A;  3CC4 A;  1CZG A;  2F3I A;  5KEE A;  4GOP C;  5ELC A;  2A74 C;  2RCN A;  1LTR D;  5CV6 A;  1SFO B;  4DKA C;  1TII D;  2ZXP A;  4OGQ C;  1N36 L;  3D31 A;  1Q8I A;  1PMR A;  4U67 3;  4A3E G;  3KUP A;  4ODG A;  1SYD A;  1TKW B;  3KK7 A;  3J7A F;  1NTG A;  4K6L A;  3R93 A;  4PZ6 A;  4JV5 Q;  1HNX L;  1EWI A;  2MO1 A;  4KY6 A;  4OEM B;  4HJ9 A;  1F2Y A;  3VDY A;  4A3M G;  5I9P A;  4YCU A;  4QB4 A;  4RMF A;  2Q2T A;  1UEA B;  5AFW A;  2VQE Q;  1NBW A;  3U4Z A;  3HRZ C;  1B1Z A;  3HOX G;  3HGB A;  4K5X A;  2F0V A;  4LF4 Q;  2WV6 D;  4M8A A;  5C44 H;  2A6E C;  3D4W A;  4FNF A;  3TME A;  4OWX B;  1FVI A;  2EXZ A;  1HFN A;  1MKH A;  5FK9 C;  2R7F A;  1WTX A;  4HSV A;  3MC0 B;  1L0Y B;  2NVT B;  2NN6 I;  1CKN A;  3DEO A;  4A3D G;  2F0E A;  1ASZ A;  2F1M A;  5JEA G;  1HR0 L;  1ET9 A;  2PNR C;  3DMU A;  3K7A B;  4R8I A;  1SE2 A;  3UDX A;  4A3J B;  1HR0 W;  2IHE A;  1PRT D;  4B3S Q;  5C6A A;  3JC6 6;  1Y8P B;  3WOE A;  1JOQ A;  1LT3 D;  1DZ1 A;  1ILQ A;  5JJI A;  2F4V Q;  4O0A A;  3PSI A;  4JI3 Q;  4UHV A;  3T1Y Q;  2ASB A;  4IO9 A;  1KDA A;  3E0E A;  3TP5 A;  3GV3 A;  2SOB A;  1IBL L;  4JBW A;  3MVV A;  1TS5 A;  2KEC A;  4JI1 L;  5KNC A;  1LT6 D;  4C3I H;  3PIO A;  3K5L A;  3OIP A;  4JI4 Q;  4YHH Q;  4DR3 L;  2IW3 A;  4JYA Q;  5C4H A;  3WDN A;  5L37 A;  5CV7 A;  5M3M H;  1GM5 A;  3A5U A;  4X66 L;  3BDL A;  1IBK Q;  3CCE A;  2RDG A;  1W6J A;  2PPB C;  1STA A;  2F0N A;  5IYB G;  4DV7 Q;  1G2T A;  4BBS B;  1B8A A;  3DHQ A;  1NUC A;  2F0T A;  1XXG A;  4IUR A;  2EZV A;  1K9M C;  1QOH A;  3PO2 H;  1IZ6 A;  5M3F B;  4A75 A;  3KF6 A;  3VYU A;  4BBR B;  2YTY A;  1X54 A;  3PMF A;  4ZKB B;  1ML0 D;  3HKZ B;  3D3R A;  3QOJ A;  4JI6 Q;  3BYT B;  4N9T A;  3S1R B;  1SNC A;  1JWM D;  5LMN Q;  1ZEQ X;  4DR4 L;  3BZK A;  4OX9 L;  3BU2 A;  1L0X B;  5KGU A;  1Y14 B;  2O5J C;  3K81 C;  4JC0 A;  1EQV A;  3HOV B;  4LJZ C;  3I70 A;  1VQM A;  1NAP A;  4A3B H;  4DK1 A;  2LY7 A;  4GKJ Q;  3M4P A;  3A55 A;  2K5D A;  3GTP H;  4YWL A;  4ALP A;  3NK9 A;  4K6D A;  4ZUI A;  1KDB A;  3PF5 A;  5IP9 G;  3K7U C;  1HNW L;  4KD3 A;  3KBX A;  2IHF A;  3G71 A;  1WYD A;  4DAM A;  4F8M A;  5C3E G;  1GUN A;  5IP7 H;  2B3G A;  2K03 A;  3GTQ H;  2ZT9 C;  3F1Z A;  4A3L H;  1E7Z A;  2A73 B;  4KKT A;  3S2D H;  1I6V C;  1AN8 A;  3NTH A;  4YWM A;  1ET6 A;  1J9O A;  3PUW A;  4DXG A;  5JJZ A;  1QVG A;  1RKN A;  4BS9 A;  1WTR A;  1K0S A;  3PO3 G;  1YZ6 A;  1LV9 A;  2EVB A;  1XJV A;  4J15 A;  2EXD A;  1WTP A;  5FJ8 H;  5IYD G;  3NBH B;  3J7A 5;  4JV5 L;  2QEX A;  2LS0 1;  1IL2 A;  2OCE A;  1FGB D;  3CRK C;  5ELB A;  2K32 A;  1QE6 A;  1N9W A;  3SK6 A;  1PH6 A;  4RFB A;  1P8L A;  4K2K A;  2VQE L;  4FP5 D;  1C8C A;  4MHE A;  3DM3 A;  1SND A;  2QKI C;  1KXL A;  4IUN A;  4A3I H;  3ERO A;  2BE5 D;  4C2M B;  3KFU A;  3S1M B;  1O7Z A;  2SNM A;  1R9T H;  4JI2 Q;  3DWQ A;  1ZYR C;  3I4M H;  1TWH B;  1A2U A;  1EOV A;  1MIU A;  5DEH A;  2NBF A;  5LL6 X;  3AFP A;  4HN7 A;  3DWP A;  4N8X 1;  1FGU A;  5FLX E;  5E4W C;  1N34 Q;  1IKL A;  4B3S L;  4P73 A;  1HUM A;  4R4Q A;  5IOD A;  4KKU A;  4DNT B;  3WWV A;  2F4V L;  1U4P A;  4JI3 L;  1CHP D;  1KAB A;  4C3J G;  4N9P A;  3T1Y L;  2YTX A;  1I6H B;  3KDF B;  3S24 A;  2D0P A;  1KQS A;  2M00 A;  3HOX B;  1H9S B;  2FFK B;  2AQ2 B;  1JB3 A;  3U4V A;  2KA7 A;  2EY1 A;  2JA8 G;  1OXT A;  3C3L A;  1RIP A;  1GVP A;  4R4T A;  4A3K B;  4A3F B;  1IBK L;  3CMA A;  4PMC A;  4YY3 L;  4K8I A;  2EE1 A;  2ALY B;  3ONA B;  4JI0 Q;  4JPB W;  2LMC B;  4DV7 L;  1ENA A;  2F0W A;  4JW0 A;  3I7F A;  2B63 H;  1EUJ A;  1IKM A;  4RGM A;  3CXC A;  1F9S A;  1YNJ C;  1TWG B;  2L0C A;  4K14 A;  1PFB A;  4RG1 A;  1UE7 A;  1JJ2 A;  1HTP A;  2R3Z A;  3NE5 B;  4JI6 L;  4JOI C;  2WAQ G;  1YHB A;  1D6E C;  4FXD A;  3DWA A;  2OXP A;  4L6T B;  1BBW A;  3RLO A;  2JSO A;  3ERS X;  5I2X A;  1ENF A;  1S72 A;  1Q3L A;  3M3Y H;  5LMN L;  1LT5 D;  4QIW E;  2A6H C;  1Q81 C;  1GHK A;  2RQX A;  1E2W A;  5FLX L;  5JEA J;  5C0X H;  2A68 C;  3TSS A;  3FP9 A;  1EZ8 A;  1N32 L;  3NEM A;  3T4A C;  3HS0 C;  4OIJ A;  5LMN W;  2JA6 B;  4S3S A;  3IL8 A;  3TQY A;  1HNZ Q;  1HZ9 A;  1NSN S;  1GUG A;  1NJI C;  4GKJ L;  4BY7 G;  4DGZ A;  2AMC B;  2PMZ E;  2JA5 H;  2NTS A;  1SBB B;  2J7Z A;  2IPK D;  1EY0 A;  1M90 C;  4L5Q A;  3A5Z B;  1KD1 C;  1WCM G;  4FDB A;  1XX8 A;  3CKI B;  1RDP D;  4EX5 A;  4IJH A;  4XTC S;  4LAA A;  1WVL A;  5FO9 B;  2PZW A;  1Y1V G;  1A2T A;  3U50 C;  1Y8N B;  5CBA E;  1L2F A;  5IGG A;  2R92 B;  1Q1B A;  4NP5 A;  3J80 c;  5J22 A;  1XMQ Q;  3HOZ H;  1SE4 A;  5C4X G;  1BR9 A;  1ICW A;  2FJ2 A;  1MSG A;  3VA5 A;  2B2Y A;  4NXM Q;  1JR0 D;  3ERQ A;  4XT3 B;  4DV1 Q;  1TWC B;  1LO5 D;  2FIN B;  2WAQ E;  2EOT A;  2EYL A;  5KYL A;  1EQQ A;  1G8Z D;  1G29 1;  2Y0S G;  2JA7 G;  2H4O A;  4QL5 A;  2ZJP A;  3L3O C;  2ID0 A;  2B2W C;  2PQA A;  4MN3 A;  2MGS A;  1H9S A;  1TT2 A;  2FHT A;  4IJL A;  2CH4 W;  1V8Q A;  4X3U A;  2UUB L;  4RHS A;  2X69 A;  3OHX C;  1VQ9 A;  2B2T C;  3BZD B;  3GTM H;  3ER0 A;  2F0H A;  4DAP A;  3ITP A;  1GJX A;  3K5O A;  1PH4 A;  3CCV A;  1YBY A;  3W3A A;  1R4Q B;  1STY A;  1V1O A;  3FKI B;  3MXU A;  2NVQ H;  1LTI D;  4IQZ A;  3KF8 B;  3S1Q H;  1UE1 A;  1NR2 A;  1F2Z A;  1QB5 D;  3RZO B;  4EQN A;  1N34 L;  1X55 A;  2NVY B;  3Q22 A;  2UU9 Q;  2A6E D;  2Q2I A;  4I65 A;  3HZX A;  2TSS A;  4JG2 A;  3GTJ B;  5I6Y A;  2F03 A;  3OSO A;  2B2T A;  5EPL A;  3OTO Q;  1VQH A;  5IYC G;  2Y0S E;  3SE0 A;  3A54 A;  1DOK A;  4KJO A;  2R93 H;  1MHW C;  2N78 A;  3I3C A;  4RCO A;  1UEB A;  3J80 i;  5KND A;  1TWA B;  4LF7 Q;  4A3G H;  1I3Q B;  1L0W A;  1MBY A;  3VR2 A;  1AZQ A;  3VYT A;  1PV4 A;  1AE2 A;  3TRE A;  3CAM A;  1IXR A;  2DUD A;  3MAQ A;  4DXF A;  4A93 H;  2KUM A;  4Q0F A;  4JI0 L;  4IAL A;  3VA7 A;  4QIW B;  4IPH A;  3AU7 A;  3VR6 A;  2Q2U A;  4LNQ A;  2M2L A;  3NUC A;  4DK6 C;  2L11 A;  1STH A;  2UXC Q;  3PIP A;  3UE1 A;  3RR5 A;  1JC7 A;  2MO0 A;  2PZT A;  4QMG A;  3F2D A;  1EYA A;  4CKE A;  4KY7 A;  5CBE E;  5C0X I;  4A3C H;  3LX0 A;  4POF A;  1EOT A;  1C4Q A;  2UXD Q;  1U4R A;  4A3J G;  4HJA A;  4JBM A;  5KIX A;  2XN9 C;  2JA8 B;  1CKM A;  4OO1 G;  2KHS A;  1Z47 A;  2NYZ D;  2IX3 A;  4NKL A;  4IUT A;  1FJG L;  3I91 A;  1HXY D;  1HNZ L;  4DV6 L;  4RCN A;  2E2I H;  2RHS B;  2EIF A;  2K5H A;  2B2U A;  4HR7 B;  5IT9 E;  4DV3 Q;  4DR1 Q;  1E22 A;  4KY5 A;  1EEF D;  5IOC A;  2EY2 A;  2HQL A;  4OIK A;  3GTG H;  1O80 A;  5C5L A;  4A76 A;  1HR0 Q;  1SJE D;  3S2H H;  2CCZ A;  2R7Z H;  2K04 A;  2J0T D;  5EBD A;  2PYK A;  1I50 B;  5DAU A;  4E6I A;  4BBS G;  3W2D A;  1CM9 A;  2R61 A;  4EQO A;  2NZ1 D;  3CPW A;  3HOU H;  3M7N A;  2AWN A;  2E75 C;  5M3F G;  4DFA A;  3CCR A;  3KF8 A;  4NXM L;  4BBR G;  2IY5 B;  3URY A;  3F2C A;  3HKZ G;  3NHH A;  4DV1 L;  3SEB A;  2VUM H;  4AH6 A;  1PH7 A;  3H3V C;  5GAE C;  4JI1 Q;  3HKS A;  1B3A A;  3GP7 A;  1A3T A;  1EWC A;  2HCC A;  5FLM G;  1OTC A;  3E5S A;  1VQ5 A;  1S40 A;  1IW7 C;  3HOV G;  3Q24 A;  1Q90 A;  1QZH A;  3SDZ A;  3V2T A;  1PHJ A;  1BUV T;  1Q7Y C;  3L2P A;  5J3B A;  2ZTC A;  1D5M C;  1CKN B;  5IT9 L;  4X3K A;  3ULP A;  2E2J H;  1GUS A;  3ICE A;  3MWY W;  1XMO L;  2D5D A;  3H0G H;  3HOW H;  4KV6 A;  1W6K A;  1B9N A;  4OXP A;  3AYH B;  4KJN A;  5E7N A;  2K5Q A;  5C3W A;  3AQQ A;  1H95 A;  4DR4 Q;  4OX9 Q;  2LSS A;  1CHQ D;  4XIG S;  1D2B A;  1PFM A;  4QCL A;  1QG7 A;  5LL6 S;  2QIL A;  3J7A V;  1OXX K;  1AEX A;  3ND8 A;  3HKZ E;  1J5E L;  3STB C;  2EYH A;  3OTO L;  3T51 B;  3S15 H;  1DOL A;  1ZYR D;  4F7X A;  2MJ8 A;  3P1H A;  4DR5 L;  3QOL A;  4PZ7 A;  2VY3 A;  3H15 A;  1QIL A;  3CD6 A;  5BN4 A;  2BCO A;  4LF7 L;  1C0A A;  3K8A A;  3P20 A;  1L1O A;  1X3G A;  1B4O A;  2JEB I;  1GUO A;  2XIW A;  3KF6 B;  2H5X A;  1S5C D;  1NCV A;  5M5Y B;  1A62 A;  4ZRZ A;  2F0F A;  2ZTD A;  5C4J H;  4QGU A;  3TBI B;  1VQL A;  1QUQ A;  5J39 A;  3RLF A;  1VQC A;  1VQ8 A;  2UXC L;  4KHP L;  4JBJ A;  1BF4 A;  2N8N A;  4LMQ D;  2L5T A;  3E9I A;  3T13 A;  4X3T A;  2K33 A;  3GO5 A;  3PCO B;  4FYD A;  4L5R C;  2UXD L;  2I5L X;  1Y1W H;  3S14 H;  4C3H H;  1BCP C;  4BXX G;  3K80 C;  1JE4 A;  3IRB A;  2X6G A;  2OTJ A;  2KCC A;  4J1M A;  4NDX A;  4GKK L;  1X3Q A;  5CV9 A;  3FDT A;  1D1K A;  4DV3 L;  1SMY C;  2EY6 A;  4DR1 L;  2BH2 A;  1K28 A;  3IFT A;  4TRD A;  3CQZ B;  4Z9C B;  1E3P A;  2F0P A;  5FO7 B;  2A6H D;  4GLV B;  3VR3 A;  4A3K G;  1YNN D;  4A3F G;  1U4M A;  3ND9 A;  4K2L A;  3I4N B;  2A68 D;  3S16 B;  4GNX A;  3NWT A;  1BBX C;  4LFB Q;  5ELF A;  1QVC A;  4KHV A;  2LFN A;  5I6W A;  3GTO H;  1HPC A;  2RDF A;  1D7Q A;  1F9P A;  3Q8D A;  4XQQ A;  4FF3 A;  2WP8 J;  1QVF A;  3K59 A;  4BY1 B;  1ZKO A;  3U9O A;  4L8J A;  3S1N H;  2NB0 A;  2ENB A;  3BVZ A;  3S1M H;  1SNP A;  4IPG A;  1ESR A;  5K36 G;  3EIV A;  2K05 A;  4DR7 Q;  2BDO A;  4A3E H;  2JA6 G;  2LXK A;  4XQJ A;  2Z4H A;  5ISR A;  1RD9 D;  1HCZ A;  4YY3 Q;  3NWS A;  1EIH A;  4OHJ A;  2KHJ A;  5EPK A;  4ZLT F;  4DPG A;  4G57 A;  2F3V A;  4B9X A;  5M5W H;  2YV5 A;  4A3M H;  1C48 A;  5JVG 3;  4FF2 A;  2UXB L;  2K4K A;  4OON A;  1XPO A;  2NVX H;  1EIF A;  2BA0 A;  1S4Z A;  3NTK A;  5BR8 L;  4F87 A;  2F0Q A;  1XTC D;  4M1U B;  2R92 G;  2L4N A;  1SEB D;  1EIG A;  2ICI A;  3M4O H;  4QUC A;  4ME3 A;  2FXQ A;  2RKS A;  2CFM A;  1VQB A;  1N32 Q;  2GVA A;  2O2L D;  2WAC A;  2PQE A;  1X3P A;  1B70 B;  1KC8 C;  3HOY B;  4LF5 L;  5DM7 3;  4A3D H;  4HIO A;  3FHW A;  5M5X H;  2DN8 A;  5JEA H;  1PTO D;  2HT1 A;  5KYI A;  1UE6 A;  5CC4 A;  3MFG A;  1TWF H;  4K5V A;  4XT1 B;  5KNB A;  3QJY A;  2F0S A;  4B3T Q;  3C1F A;  4HMI A;  4X3S A;  4DUY L;  2F0D A;  3KLW A;  5GAD C;  3RN2 A;  1NMG A;  3K0Y A;  3AFQ A;  1LTB D;  3B6Y A;  4RH6 A;  2CWA A;  2Q8R E;  4CDE C;  5F2D A;  4HAE A;  5HY6 A;  1AP0 A;  2O5I C;  4MIU A;  1VQ4 A;  2E2D C;  4OEL B;  4A4I A;  4JCV E;  4HSP A;  2HDL A;  5D3I B;  1RF2 D;  5COR A;  1YHA A;  2MQH A;  1PZI D;  1SXT A;  1X3F A;  2JK8 A;  1PTO H;  1I4H A;  1LTG D;  1VMC A;  2EYO A;  3FKI G;  4CGY B;  4AYB B;  1VQF A;  4DAV A;  1U5K A;  5IYB H;  2VZA A;  1NMF A;  5C44 B;  1B53 A;  3V96 A;  2RBM A;  1JJG A;  2XWJ B;  2UUB Q;  1ASY A;  3E9H A;  1STN A;  2FMC A;  1EU3 A;  2PCF B;  5TSS A;  2HIV A;  4ZQ3 A;  3OPO A;  5K5P A;  3M7G A;  2VW9 A;  4DAY B;  1CA6 A;  1B3Q A;  3TP8 A;  1VDZ A;  1SE8 A;  1HTL D;  4IFD G;  3CCS A;  4WOR A;  3E3X A;  3KLS A;  1DGS A;  4CHT B;  2NZO A;  3H09 A;  4DV0 Q;  2DNC A;  4LFB L;  1RCV D;  4C3I B;  4DUZ Q;  4GN4 B;  1STE A;  5JVH 3;  1G91 A;  3D6W A;  1NE3 A;  1LT4 D;  4KN7 C;  5IP9 H;  3R8B A;  2HCI A;  5M3M B;  1WI5 A;  4IPC A;  2PQA B;  1KHI A;  1PH2 A;  3LWE A;  1YIT A;  5C3E H;  4Y7N H;  2EYM A;  1LAB A;  1AFP A;  1PRT F;  1PRT B;  5LHY 1;  3PO2 B;  2YU9 H;  1ONL A;  3OMG A;  1EZ6 A;  2A1A A;  2JXM B;  1M1K C;  4DR7 L;  3J81 c;  1LTS D;  4LUZ A;  3D4R A;  1WFQ A;  5IWA Q;  1N33 Q;  1V1Q A;  1SE3 A;  3PO3 H;  3S17 H;  4CJ0 B;  3C2P A;  2GVB A;  1PVO A;  1GHJ A;  1STG A;  2A69 D;  5IYD H;  3RZD H;  1PYS B;  3JAM i;  3OWE B;  4K0K Q;  3QIA A;  1EY7 A;  1VQP A;  4QUF A;  4DF7 A;  5D14 A;  1K8A C;  1H9J A;  4OL7 A;  4R4C A;  1HUN A;  3FVQ A;  3M85 A;  2QDL A;  3VYR A;  4A3B B;  3K5M A;  1OXV A;  3KJO A;  2BA1 A;  1UAP A;  2HUG A;  2N88 A;  2NZH A;  5IGC A;  4V0B A;  3O13 A;  3ZYY X;  1CUK A;  5NUC A;  2DY7 A;  1JJC B;  3GTP B;  1QJO A;  1YHQ A;  1MSH A;  1RTN A;  2KEN A;  2ICE C;  4EGV A;  2HD3 A;  4R9W A;  2QEJ C;  4PG3 A;  3SGI A;  1EY4 A;  4YCW A;  1B7Y B;  2B2Y C;  1FJG Q;  3CHB D;  4DV6 Q;  4G7H C;  5EQ0 A;  3TN2 A;  1XNR Q;  1TQO A;  4RGO S;  3SVM A;  3GTQ B;  2Q8T A;  3EJI A;  3H91 A;  2E8G A;  4B3T L;  2K75 A;  2NTT A;  2I5H A;  3H3V H;  1PZK D;  1M4V A;  3S2D B;  2M9V A;  3CCL A;  1CKO A;  1JCK B;  1VQI A;  2K1B A;  2L9H A;  2F0I A;  1Z6H A;  4C3J H;  4DAY A;  5EKI A;  1PTO F;  1NY4 A;  2K01 A;  3QR8 A;  3EN2 A;  3KLS X;  3L0O A;  2VL6 A;  1PH3 A;  4DV4 Q;  2MP1 A;  1WJJ A;  1Z7T A;  1SNQ A;  2E74 C;  3FEW X;  4HMJ A;  3NEN A;  3T53 B;  4KN4 C;  4HJ7 A;  1FR3 A;  1SNM A;  1U0L A;  2UUC L;  4TVA B;  4BWG B;  3CCU A;  4EQ5 A;  1ILP A;  2JA8 H;  1G51 A;  1G6Z A;  2CVR A;  2E5L Q;  3A8I E;  2E2H H;  1EQR A;  1EL0 A;  3NPP A;  4A3I B;  3DUZ A;  4FO2 A;  3J81 i;  1N8R C;  1K83 H;  3A8J E;  4RA8 A;  5A35 A;  2O4X A;  4ILW A;  2F52 A;  4R4O A;  2KHI A;  5EAY A;  1R9T B;  1WD1 A;  1WD0 A;  2TMP A;  3LWU A;  3I4M B;  4RKL A;  1SMX A;  4X65 Q;  1RJT A;  2HIX A;  2XNA C;  3E6Z X;  3QG1 A;  1A3V A;  4JI7 Q;  1KTK A;  1BNZ A;  1SYC A;  4DR6 L;  2K5W A;  4U68 A;  1XMO Q;  3NSW A;  5CYU A;  5ELN A;  1PFS A;  4RGT A;  3BYY B;  4LFA Q;  1BCP D;  3NQI A;  4BY7 H;  4DR2 L;  4CJ1 B;  1IYV A;  4DV0 L;  3BS1 A;  5G3L D;  4DUZ L;  3GTL H;  2OT2 A;  1SDF A;  3HEJ A;  5I4D A;  1Y69 U;  1SMY D;  1WCM H;  1HHV A;  2C35 B;  2XSC A;  2IWH A;  3UI2 A;  1SYG A;  2F0K A;  1IYU A;  1J5E Q;  1Y1V H;  3S9W A;  3FMC A;  3GTK H;  2ZXR A;  5EBC A;  1EWH A;  1JOR A;  4DR5 Q;  1HQM C;  2D62 A;  2B63 B;  2WFW A;  3P75 A;  1P16 A;  1AE3 A;  2RDH A;  3GD7 A;  5C4X H;  1DOM A;  4IUV A;  1ICF B;  2WKC A;  2Z6K A;  2RCF A;  1KIX A;  2NUC A;  2WB1 B;  4POG A;  5IWA L;  2N49 A;  2QW7 A;  3VYS A;  1N33 L;  3A74 A;  3BVM A;  4HED A;  3F2U A;  2B2U C;  5CV4 A;  4O2D A;  1VQA A;  4UP8 A;  2JA7 H;  2YYZ A;  4OWW B;  3M3Y B;  1DJR D;  4B9W A;  2NN6 G;  2K28 A;  3X3M A;  2OWO A;  4K0K L;  1BOS A;  2OTL A;  3GDE A;  5JJL A;  4KHP Q;  1YEZ A;  2XRQ D;  1PH1 A;  3D0F A;  1YJN A;  2I46 A;  2WIN B;  4DV2 L;  3TP6 A;  4X64 Q;  1GD7 A;  2OEO A;  3I4N G;  5DNF A;  3T16 A;  1E0B A;  4X62 L;  3MHB A;  1TXY A;  2JA5 B;  5JJK A;  4LK1 C;  4C1N K;  1GXD C;  2ZJQ A;  2I5M X;  2MNA A;  3QO2 A;  2C5C A;  1A6X A;  4IFD J;  2SDF A;  3A8K E;  1V9P A;  1RHP A;  4JVZ A;  1H9R A;  3DXJ C;  2DY8 A;  2D0O A;  1TVX A;  4GKK Q;  4BY1 G;  2QF7 A;  3H3V I;  2L55 A;  1HA5 A;  3DEP A;  1CT1 D;  3CC2 A;  4IUU A;  4UDU C;  1XNR L;  1A0I A;  1SFO H;  3KJP A;  3HOZ B;  1K8O A;  1L1O B;  3I56 A;  5CV5 A;  4R8N A;  3HFZ B;  1VQJ A;  1QNK A;  5JOB A;  3EA6 A;  1SYB A;  1PYB A;  4XYQ A;  1QUQ B;  1WOC A;  1HZB A;  5J1Z A;  3RUZ A;  2KJX A;  2K5V A;  4DV4 L;  5IYC H;  2KEE A;  3CF5 A;  1O7I A;  1Y8O B;  2G9H D;  5D65 A;  5A2Q E;  3A0J A;  4IUQ A;  1PYW D;  2AWO A;  1EEI D;  3BJU A;  3K57 A;  1D1I A;  1VF7 A;  1NR4 A;  4PNY A;  5FO8 B;  2E5L L;  1FYC A;  3AB9 A;  3UE0 A;  2D2C C;  2IT1 A;  1E24 A;  2DNE A;  1Q46 A;  1VQE A;  1CSQ A;  4YWK A;  3GTM B;  1KLG D;  4I7Z C;  5C3X A;  1TY0 A;  4F88 A;  3I90 A;  5E4X A;  2AUK A;  2E76 C;  2NVT H;  2F0L A;  3HOY G;  4DK0 A;  4HIK A;  4UAI A;  2Q2H A;  2NVQ B;  4X65 L;  2AHO B;  3MA2 B;  3S1Q B;  3K7A H;  3Q6S A;  4MZ9 A;  2A5H A;  4DNR B;  1YIJ A;  4IUP A;  4A3J H;  4JI7 L;  1CQF A;  3D8G A;  4GOP B;  1W3S A;  2UXB Q;  3H94 A;  4ULL A;  2B8F A;  3SR1 A;  4CBV A;  4GNX B;  2ES2 A;  1T5X D;  1JWS D;  4OO1 H;  3CCJ A;  1JB7 A;  1EU4 A;  3SK5 A;  4HTH A;  4FF1 A;  5BR8 Q;  2VXW A;  1A3U A;  4LFA L;  3QB3 A;  5GAG C;  2F0M A;  3I55 A;  1K73 C;  3R2I A;  4IPD A;  1BQQ T;  1L1O C;  3N6R A;  3I72 A;  4PV1 C;  2YTV A;  5CR3 A;  4BA2 I;  1I4R A;  2R93 B;  4UPA A;  1QCB D;  4CKC A;  4XDX A;  2HQE A;  5IE8 A;  3D6C A;  3I4L A;  3WOF A;  5A2Q L;  1DYQ A;  1K3R A;  2JA9 A;  3J80 E;  1B9M A;  4A3G B;  4LF5 Q;  1RTO A;  3C1E A;  1BCP F;  1SSO A;  4LF8 Q;  5HGQ A;  1MJC A;  1SLJ A;  4PMB A;  4TSS A;  4AYB G;  4A93 B;  1A8V A;  5IGE A;  1QNU A;  4MTN A;  5C44 G;  1LUZ A;  5G3L F;  4BBS H;  4AIM A;  1H9M A;  4DUY Q;  4UP9 A;  1Q82 C;  5BN3 A;  1I94 L;  5M3F H;  4BBR H;  2F0O A;  1CK1 A;  1RL2 A;  1K8M A;  5HUR A;  2IX0 A;  1VQD A;  4G7Z C;  4KK7 A;  5IGB A;  1FNV A;  1SN8 A;  2KCT A;  1D5X C;  1EFI D;  3S1R H;  2B2V A;  5FLM H;  1EYC A;  1LYL A;  5ELD A;  3W1G A;  4KTA A;  3A56 A;  1YVC A;  3CP0 A;  3HOV H;  4QQB X;  2IJ0 A;  2KVM A;  5FLX c;  5LMU Q;  1EYG A;  2E2I B;  3NTI A;  4X64 L;  2GN5 A;  4JI8 L;  2WKD A;  1FNU A;  1G2S A;  2H1E A;  3CCM A;  2QCP X;  1BXT A;  2VB2 X;  4H44 C;  4NB3 A;  4GNX C;  4C3I G;  4B08 A;  4TKO B;  2G9D A;  1PDQ A;  1I4G A;  1KAA A;  1F2M A;  2K5N A;  4RWS C;  1PH9 A;  1B50 A;  2EY5 A;  4X6A H;  2CQA A;  1C9O A;  2AUJ D;  4KMU C;  4O42 A;  3ZJY C;  1HH2 P;  1UWV A;  5M3M G;  1HA6 A;  3GTG B;  2OQK A;  1YNJ D;  3J80 L;  4C56 C;  2F3W A;  4NXN Q;  3S2H B;  4QJF A;  1KRT A;  1DON A;  4ZK9 B;  2R7Z B;  4AYB E;  1S5D D;  2HDM A;  2KBN A;  2L12 A;  5IGD A;  3MXN B;  1KNA A;  1C7Y A;  2QDB A;  4FVM A;  4CDF C;  3PO2 G;  3HOU B;  3FPP A;  1JMC A;  1V43 A;  2ZJR A;  2DJG C;  4YCV A;  3PIO 3;  4CDD C;  1H9K A;  4LW1 A;  3J7Z C;  2EYJ A;  1M8A A;  4GOP A;  2VUM B;  2JE6 I;  2AKW B;  2CW0 C;  4FXK C;  1LTL A;  2EQS A;  3V05 A;  4R1J A;  4LFC Q;  1Q12 A;  3A7A B;  3DLL A;  4XQN A;  3J81 j;  1V1P A;  2F0J A;  3A7L A;  1HZA A;  1IBM L;  1BVS A;  5I2Y A;  3MZ5 A;  5IGF A;  1DCZ A;  1X3E A;  4A3B G;  2OQ0 A;  3IFD A;  1J6Q A;  5T1G A;  3TZU A;  2KED A;  3PUX A;  5T1I A;  2EJF C;  3G6E A;  3ULJ A;  3TP7 A;  4C2M H;  1JOK A;  4PQX A;  5IIF A;  2E2J B;  2C9O A;  2QGQ A;  1XPR A;  2J4X A;  4FXG C;  2IL8 A;  2A8V A;  3H0G B;  1S5E D;  1EY5 A;  3HOW B;  1OO9 B;  1UUP A;  1TWH H;  5C5M A;  2PI2 A;  4OO1 I;  3NXW A;  1HRJ A;  5EKL A;  1J8I A;  1I4Q A;  5IP7 G;  1K8G A;  4LF6 L;  2KCN A;  1U4L A;  4R4I A;  4A3L G;  2CQO A;  3EQL C;  4BXX H;  1JWU D;  2Z6B A;  3KOJ A;  3L7Z C;  3I73 A;  1S5B D;  1I6H H;  4QF4 A;  2CKZ B;  3UDF A;  2Q8I B;  3SHL A;  2SEB D;  3ULL A;  3HOX H;  1AW7 A;  2K6A A;  3S15 B;  2ATW A;  1FL0 A;  5FJ8 G;  1LM0 A;  2K14 A;  3MTS A;  1XYI A;  4L5T A;  4C1N I;  1BDO A;  3M4Q A;  4A3K H;  1JE5 A;  2RSN A;  4A3F H;  2JEA I;  3FPU B;  1TU2 B;  4LF8 L;  4ZAI A;  1UE5 A;  4A3I G;  1SJH D;  3L9A X;  1JIC A;  2R6G A;  1DM0 B;  1EIY B;  5C4J B;  1PFN A;  2VQF L;  4CKB A;  2EDG A;  1TWG H;  2L15 A;  4PMW A;  2XGT A;  3SK8 A;  5EPJ A;  4ABN A;  3MXN A;  4MNO A;  3KBG A;  1VF5 C;  4RGN A;  3G4S A;  3I4M G;  3TDQ A;  4B3R L;  1X6O A;  3OW2 A;  4Y52 H;  2UUC Q;  5I9O A;  3UDI A;  4P71 A;  1LAC A;  3BG3 A;  3LNN A;  1Y1W B;  3S14 B;  4IOC A;  4GZY C;  5K36 H;  4C3H B;  3K0X A;  3OIQ A;  4QY7 A;  3NBI A;  4PZ8 A;  2JA6 H;  1A63 A;  2RF4 A;  3QWN A;  3TZD A;  3JAM c;  5LMU L;  2Z9H A;  1G6P A;  1E2V A;  4HJ5 A;  1LLR D;  1F9R A;  1S5F D;  4AQY Q;  2MFI A;  5EKK A;  1EY6 A;  1WTH A;  2RA4 A;  5EGT A;  3OWF A;  2KQ3 A;  1K0R A;  4DV5 Q;  3VR4 A;  3W1B A;  4NXN L;  1VQN A;  1WTW A;  2DGY A;  2R92 H;  3K5N A;  4KD4 A;  3OW7 A;  2Z4I A;  4DR6 Q;  2B63 G;  3RD4 A;  3GTO B;  1X56 A;  4L5S A;  3W5O A;  1KLU D;  3TS0 A;  2SNS A;  4HJ8 A;  3PGZ A;  2WB1 G;  1TWC H;  2EJG C;  4DR2 Q;  1PA6 A;  1SYF A;  1EFW A;  1XWE A;  3S1N B;  5IY0 A;  1TY2 A;  2L1B A;  4LF4 L;  4LFC L;  5GRO A;  2P5Z X;  4H0L C;  4JI5 Q;  4LF9 Q;  5C0X G;  3KYH C;  1SAP A;  2Z8L A;  4RKB A;  4A3E B;  1CFM A;  1B44 D;  3OYY A;  3F8T A;  2EJM A;  4H02 A;  1ENC A;  5GAH C;  2N3S A;  4K5W A;  3T56 B;  2JA5 G;  1ESF A;  1TR5 A;  4WJ3 M;  1HJP A;  5M5W B;  1CQV A;  1YNX A;  4RHR A;  4A3M B;  3CCQ A;  5IT9 c;  4HCE A;  1SR3 A;  2NVX B;  5FKA C;  4MTK A;  4WFN 3;  3FKI H;  3BDO A;  1BBU A;  1IYJ B;  1YI2 A;  1BKB A;  3M4O B;  2XWB B;  1Z9F A;  3M4Y A;  1VS0 A;  1JQY D;  2EYP A;  3HOZ G;  3RZO H;  4LWC A;  1S3O A;  5CV8 A;  1B2T A;  2NVY H;  1W2B A;  4JI4 L;  2ZXO A;  4KKS A;  4YHH L;  4JYA L;  3GQB A;  5D3D A;  4DV2 Q;  1E1O A;  1MGS A;  2WB1 E;  3I2Z A;  4J8Q A;  3GTJ H;  4FF4 A;  4A3D B;  4K8J A;  5M5X B;  2WII B;  3D4D A;  4X62 Q;  3MEF A;  1IW7 D;  1TWF B;  2BOS A;  2B29 A;  4WJ4 A;  4G4K A;  2IX1 A;  4H7B A;  1WTO A;  1X9N A;  5H1S E;  2PZU A;  4OWT B;  4P2C B;  1TWA H;  1QWY A;  1I3Q H;  4ME5 A;  3OOC A;  4IFD H;  5E3F A;  2RSO A;  4G7O C;  1D5Z C;  4UP7 A;  4B3M Q;  3TRZ A;  2VNU D;  3IKJ A;  4LUO A;  1I4X A;  4KLK A;  3PUV A;  1JT8 A;  2JYO A;  5EJW A;  1F2L A;  1KRS A;  5CMD A;  1VQK A;  1Q86 C;  4V19 0;  1O78 A;  1YNN C;  3KLR A;  1VQ7 A;  1GOZ A;  4H13 C;  4ZUJ A;  2F0G A;  3AMU A;  3EBE A;  4HID A;  3PF4 A;  2ZM6 Q;  1PTO B;  5E1F A;  3NBH A;  2F0U A;  1PRT C;  3NP8 A;  3MFY A;  2N55 A;  1CZW A;  3STB D;  3RLN A;  1GUT A;  3LGJ A;  3E0J A;  1PXU A; 
#chains in the Genus database with same CATH homology
 2RVL A;  3HG9 A;  1EQT A;  1BO0 A;  2EYF A;  1AZP A;  1SYE A;  3PUY A;  1DXM A;  2MPM A;  3DM1 A;  1WTQ A;  2PO4 A;  5JAV A;  3I8Z A;  1EY8 A;  1MI2 A;  5BN5 A;  1EYD A;  5FOB B;  3MXG A;  3J7Y W;  1ROD A;  1GUW A;  1ZXT A;  5C4Z A;  4BA1 I;  4Q5V A;  3GV6 A;  2Z1C A;  5C3E B;  3H6M A;  4Y7N B;  2YU9 B;  1PZJ D;  1PTO C;  3K6O A;  1KNE A;  4EQP A;  4TQU S;  1T5E A;  2JP1 A;  3PO3 B;  3S17 B;  3N52 A;  1TS4 A;  3MEH A;  5HGT A;  5KRU A;  3PIP 3;  3R3O A;  1LTA D;  2B2W A;  3RZD B;  2I07 B;  3JAM E;  2CW0 D;  4HCS A;  3HP3 A;  2GA4 B;  3FRP B;  5DM6 3;  5JPN C;  3G7L A;  1TS3 A;  3K58 A;  3G6J B;  3OMC A;  2F4I A;  3CRL C;  2LKV A;  2KOL A;  2K7V A;  1MD2 D;  3X3N A;  2BDN A;  4J6H A;  1I4P A;  2FMM A;  1SNO A;  4IFD I;  1HFG A;  3U9S A;  2VB3 X;  1CA5 A;  3PUZ A;  2BE5 C;  2XVS A;  4C3J B;  4DN4 M;  1TS2 A;  1O7L A;  1CI3 M;  5M9O A;  2PMZ B;  5C0X J;  4JK1 C;  2NWG A;  3JAM L;  2PW7 A;  3SK4 A;  4XYO A;  2B39 A;  3BVG A;  2E2H B;  3J81 E;  1K83 B;  4DU9 A;  3CU7 A;  1X32 A;  4NW2 A;  1A15 A;  4XXE A;  3P7J A;  5COY A;  2AQ3 B;  2MUY A;  2WAQ B;  3EVQ A;  1OXU A;  1EY9 A;  4YIJ A;  2NN6 H;  2AQ1 B;  4RAU C;  1FD7 D;  2B8G A;  2PW5 A;  4WJW A;  2A69 C;  4EVO A;  1JOO A;  1UNS A;  4BY7 B;  1II3 A;  1VCI A;  1STB A;  3VR5 A;  2CHB D;  2EPB A;  3GTL B;  3PV0 A;  4ZKC B;  1WCM B;  1LTT D;  4CJ2 C;  4WRD A;  3MXP A;  1KDC A;  4ZYS A;  1E2Z A;  1U9R A;  5CGK A;  3EFX D;  1Y1V B;  1V1P B;  1DD2 A;  3GTK B;  3NQT A;  1F9Q A;  3J81 L;  1PLF A;  2B2V C;  5C4X B;  1OXS C;  4ID6 A;  4DA2 A;  4C3H G;  5JPM C;  5ELE A;  3Q23 A;  3RMH A;  1BCP B;  1IHZ A;  2X6L A;  1WTV A;  2Y0S B;  4L63 B;  2JA7 B;  4IZ8 A;  2D9U A;  2V4D A;  1CTM A;  1FNW A;  2MHV A;  3IAY A;  1R4P B;  2OF1 A;  1VMP A;  1HQR D;  2XRS D;  3R2T A;  4KHZ A;  3Q0A A;  4IN3 A;  3SXH A;  4NMZ A;  4O1N A;  1O7Y A;  3C46 A;  1Q1E A;  1F77 A;  1IL8 A;  4KI0 A;  3BDC A;  1CZG A;  5KEE A;  5ELC A;  2A74 C;  1LTR D;  5CV6 A;  1SFO B;  1TII D;  2ZXP A;  4OGQ C;  3D31 A;  1Q8I A;  1PMR A;  4U67 3;  3KUP A;  4ODG A;  1SYD A;  1TKW B;  3KK7 A;  3J7A F;  4K6L A;  3R93 A;  4KY6 A;  1F2Y A;  5I9P A;  4QB4 A;  1UEA B;  5AFW A;  3HRZ C;  1B1Z A;  3HGB A;  4K5X A;  2F0V A;  2WV6 D;  4M8A A;  2A6E C;  3D4W A;  4FNF A;  3TME A;  2EXZ A;  1HFN A;  5FK9 C;  1WTX A;  4HSV A;  3MC0 B;  1L0Y B;  2NVT B;  2NN6 I;  3DEO A;  2F0E A;  2F1M A;  5JEA G;  1ET9 A;  2PNR C;  3DMU A;  3K7A B;  4R8I A;  1SE2 A;  4A3J B;  1PRT D;  5C6A A;  1Y8P B;  3WOE A;  1JOQ A;  1LT3 D;  1DZ1 A;  1ILQ A;  1KDA A;  3TP5 A;  3GV3 A;  2SOB A;  4JBW A;  3MVV A;  1TS5 A;  2KEC A;  5KNC A;  3K5L A;  1LT6 D;  3OIP A;  2IW3 A;  5C4H A;  3WDN A;  5CV7 A;  3BDL A;  2RDG A;  1W6J A;  2PPB C;  1STA A;  2F0N A;  1G2T A;  4BBS B;  1NUC A;  3DHQ A;  2F0T A;  1XXG A;  4IUR A;  2EZV A;  1QOH A;  5M3F B;  3VYU A;  4BBR B;  3PMF A;  4ZKB B;  1ML0 D;  3HKZ B;  3D3R A;  3QOJ A;  3BYT B;  4N9T A;  3S1R B;  1SNC A;  1JWM D;  1ZEQ X;  1L0X B;  5KGU A;  2O5J C;  1EQV A;  3HOV B;  4LJZ C;  3I70 A;  1NAP A;  4DK1 A;  2LY7 A;  3A55 A;  2K5D A;  3NK9 A;  4K6D A;  4ZUI A;  1KDB A;  4KD3 A;  3KBX A;  4F8M A;  1GUN A;  2K03 A;  2ZT9 C;  2A73 B;  4KKT A;  1I6V C;  1AN8 A;  3NTH A;  1ET6 A;  1J9O A;  3PUW A;  4DXG A;  5JJZ A;  1RKN A;  4BS9 A;  1WTR A;  1LV9 A;  2EVB A;  1WTP A;  2LS0 1;  1FGB D;  3CRK C;  5ELB A;  2K32 A;  1QE6 A;  3SK6 A;  4RFB A;  4K2K A;  4FP5 D;  1C8C A;  4MHE A;  1SND A;  2QKI C;  4IUN A;  3ERO A;  2BE5 D;  4C2M B;  3S1M B;  1O7Z A;  2SNM A;  3DWQ A;  1ZYR C;  1TWH B;  1A2U A;  5DEH A;  2NBF A;  5LL6 X;  4HN7 A;  3DWP A;  5FLX E;  5E4W C;  1IKL A;  5IOD A;  1HUM A;  4KKU A;  4DNT B;  1U4P A;  1CHP D;  1KAB A;  4C3J G;  4N9P A;  1I6H B;  2M00 A;  3HOX B;  1H9S B;  2FFK B;  2AQ2 B;  1JB3 A;  2KA7 A;  2EY1 A;  1OXT A;  3C3L A;  4A3K B;  4A3F B;  4PMC A;  4K8I A;  2EE1 A;  3ONA B;  2LMC B;  1ENA A;  2F0W A;  1IKM A;  4RGM A;  1F9S A;  1YNJ C;  1TWG B;  2L0C A;  4K14 A;  1PFB A;  1HTP A;  2R3Z A;  3NE5 B;  1D6E C;  4FXD A;  3DWA A;  2OXP A;  4L6T B;  2JSO A;  5I2X A;  1ENF A;  1Q3L A;  1LT5 D;  2A6H C;  1GHK A;  2RQX A;  1E2W A;  5FLX L;  5JEA J;  5C0X H;  2A68 C;  3TSS A;  1EZ8 A;  3T4A C;  3HS0 C;  4OIJ A;  2JA6 B;  4S3S A;  3IL8 A;  1NSN S;  1GUG A;  4DGZ A;  2NTS A;  1SBB B;  2J7Z A;  2IPK D;  1EY0 A;  1XX8 A;  3CKI B;  1RDP D;  4XTC S;  4LAA A;  1WVL A;  5FO9 B;  2PZW A;  1A2T A;  1Y8N B;  5CBA E;  5IGG A;  2R92 B;  1Q1B A;  4NP5 A;  5J22 A;  1SE4 A;  1BR9 A;  1ICW A;  2FJ2 A;  1MSG A;  3VA5 A;  2B2Y A;  1JR0 D;  3ERQ A;  4XT3 B;  1TWC B;  1LO5 D;  2FIN B;  2EOT A;  2EYL A;  5KYL A;  1G8Z D;  1G29 1;  2H4O A;  3L3O C;  2ID0 A;  2B2W C;  4MN3 A;  2MGS A;  1H9S A;  1TT2 A;  2FHT A;  1V8Q A;  4X3U A;  4RHS A;  2X69 A;  3OHX C;  2B2T C;  3BZD B;  4DAP A;  2F0H A;  3ITP A;  1GJX A;  3K5O A;  3W3A A;  1R4Q B;  1STY A;  1V1O A;  3FKI B;  3MXU A;  1LTI D;  4IQZ A;  1NR2 A;  1F2Z A;  1QB5 D;  3RZO B;  4EQN A;  2NVY B;  3Q22 A;  2A6E D;  4I65 A;  3HZX A;  2TSS A;  3GTJ B;  5I6Y A;  2F03 A;  3OSO A;  2B2T A;  5EPL A;  3SE0 A;  3A54 A;  1DOK A;  4KJO A;  3I3C A;  4RCO A;  5KND A;  1TWA B;  1I3Q B;  1MBY A;  3VR2 A;  1AZQ A;  3VYT A;  3MAQ A;  4DXF A;  2KUM A;  4Q0F A;  4IAL A;  3VA7 A;  4QIW B;  3AU7 A;  3VR6 A;  2M2L A;  3NUC A;  2L11 A;  1STH A;  1JC7 A;  2PZT A;  4QMG A;  1EYA A;  4CKE A;  4KY7 A;  5CBE E;  5C0X I;  3LX0 A;  1EOT A;  1C4Q A;  1U4R A;  5KIX A;  2XN9 C;  2JA8 B;  4OO1 G;  2KHS A;  1Z47 A;  2NYZ D;  2IX3 A;  4NKL A;  4IUT A;  3I91 A;  1HXY D;  4RCN A;  2B2U A;  4HR7 B;  5IT9 E;  4KY5 A;  1EEF D;  5IOC A;  2EY2 A;  4OIK A;  1O80 A;  5C5L A;  1SJE D;  2K04 A;  2J0T D;  5EBD A;  2PYK A;  1I50 B;  5DAU A;  4E6I A;  3W2D A;  1CM9 A;  2R61 A;  4EQO A;  2NZ1 D;  3M7N A;  2AWN A;  2E75 C;  4DFA A;  3KF8 A;  3URY A;  3NHH A;  3SEB A;  3H3V C;  1B3A A;  3GP7 A;  1A3T A;  1EWC A;  2HCC A;  3E5S A;  1IW7 C;  3Q24 A;  1Q90 A;  3SDZ A;  3V2T A;  1BUV T;  1D5M C;  5IT9 L;  4X3K A;  1GUS A;  3MWY W;  2D5D A;  4KV6 A;  1W6K A;  1B9N A;  4KJN A;  2K5Q A;  5C3W A;  1CHQ D;  4XIG S;  1D2B A;  1PFM A;  4QCL A;  1QG7 A;  5LL6 S;  2QIL A;  3J7A V;  1OXX K;  1AEX A;  3ND8 A;  2EYH A;  3T51 B;  1DOL A;  1ZYR D;  4F7X A;  2MJ8 A;  3P1H A;  3QOL A;  1QIL A;  5BN4 A;  2BCO A;  3P20 A;  1B4O A;  2JEB I;  1GUO A;  2XIW A;  1S5C D;  1NCV A;  5M5Y B;  4ZRZ A;  2F0F A;  3TBI B;  5J39 A;  3RLF A;  1BF4 A;  4LMQ D;  2L5T A;  3T13 A;  4X3T A;  2K33 A;  3GO5 A;  4FYD A;  1BCP C;  1JE4 A;  2X6G A;  2KCC A;  4J1M A;  4NDX A;  1X3Q A;  5CV9 A;  3FDT A;  1D1K A;  1SMY C;  2EY6 A;  3IFT A;  4TRD A;  3CQZ B;  4Z9C B;  2F0P A;  5FO7 B;  2A6H D;  3VR3 A;  1YNN D;  3I4N B;  1U4M A;  3ND9 A;  4K2L A;  2A68 D;  3S16 B;  3NWT A;  1BBX C;  5ELF A;  4KHV A;  2LFN A;  5I6W A;  1HPC A;  2RDF A;  1F9P A;  4XQQ A;  4FF3 A;  2WP8 J;  3K59 A;  4BY1 B;  1ZKO A;  3U9O A;  4L8J A;  2NB0 A;  2ENB A;  3BVZ A;  1SNP A;  1ESR A;  5K36 G;  2K05 A;  2BDO A;  4XQJ A;  2Z4H A;  5ISR A;  1RD9 D;  1HCZ A;  3NWS A;  1EIH A;  4OHJ A;  5EPK A;  4ZLT F;  4G57 A;  2F3V A;  4B9X A;  4FF2 A;  1C48 A;  5JVG 3;  2BA0 A;  1S4Z A;  3NTK A;  4F87 A;  2F0Q A;  1XTC D;  4M1U B;  2L4N A;  1SEB D;  1EIG A;  2ICI A;  4QUC A;  2RKS A;  2O2L D;  2WAC A;  2PQE A;  1X3P A;  3HOY B;  5DM7 3;  2DN8 A;  5JEA H;  1PTO D;  5KYI A;  5CC4 A;  3MFG A;  4K5V A;  4XT1 B;  5KNB A;  3QJY A;  2F0S A;  3C1F A;  4HMI A;  4X3S A;  2F0D A;  3K0Y A;  1LTB D;  4RH6 A;  2Q8R E;  5F2D A;  4HAE A;  1AP0 A;  2O5I C;  4MIU A;  2E2D C;  4HSP A;  2HDL A;  5D3I B;  1RF2 D;  5COR A;  1PZI D;  1SXT A;  1PTO H;  1I4H A;  1LTG D;  1VMC A;  2EYO A;  4CGY B;  4AYB B;  4DAV A;  5C44 B;  1B53 A;  3V96 A;  2RBM A;  2XWJ B;  1STN A;  2FMC A;  1EU3 A;  2PCF B;  5TSS A;  4ZQ3 A;  3OPO A;  5K5P A;  3M7G A;  1CA6 A;  3TP8 A;  1VDZ A;  1HTL D;  4IFD G;  4WOR A;  3KLS A;  4CHT B;  3H09 A;  2DNC A;  1RCV D;  4C3I B;  1STE A;  5JVH 3;  1G91 A;  3D6W A;  1LT4 D;  4KN7 C;  3R8B A;  2HCI A;  5M3M B;  3LWE A;  2EYM A;  1LAB A;  1AFP A;  1PRT F;  1PRT B;  5LHY 1;  3PO2 B;  1ONL A;  3OMG A;  2JXM B;  1LTS D;  3D4R A;  1SE3 A;  4CJ0 B;  3C2P A;  1GHJ A;  1STG A;  2A69 D;  3OWE B;  3QIA A;  1EY7 A;  4QUF A;  4DF7 A;  5D14 A;  1H9J A;  4OL7 A;  1HUN A;  3FVQ A;  3M85 A;  3VYR A;  4A3B B;  3K5M A;  1OXV A;  2BA1 A;  1UAP A;  2HUG A;  2N88 A;  5IGC A;  4V0B A;  3O13 A;  3ZYY X;  5NUC A;  2DY7 A;  3GTP B;  1QJO A;  1MSH A;  1RTN A;  2ICE C;  4EGV A;  4R9W A;  2QEJ C;  1EY4 A;  2B2Y C;  3CHB D;  4G7H C;  5EQ0 A;  3TN2 A;  1TQO A;  4RGO S;  3SVM A;  3GTQ B;  2Q8T A;  3EJI A;  3H91 A;  2NTT A;  1PZK D;  1M4V A;  3S2D B;  2M9V A;  1JCK B;  2K1B A;  2L9H A;  2F0I A;  1Z6H A;  4DAY A;  5EKI A;  1PTO F;  2K01 A;  3KLS X;  2MP1 A;  1Z7T A;  2E74 C;  1SNQ A;  3FEW X;  4HMJ A;  3T53 B;  4KN4 C;  1FR3 A;  1SNM A;  4BWG B;  1ILP A;  1G6Z A;  2CVR A;  3A8I E;  1EL0 A;  3NPP A;  4A3I B;  3DUZ A;  4FO2 A;  3A8J E;  4RA8 A;  5A35 A;  2O4X A;  4ILW A;  1R9T B;  1WD1 A;  1WD0 A;  2TMP A;  3LWU A;  3I4M B;  4RKL A;  1RJT A;  2XNA C;  3E6Z X;  3QG1 A;  1A3V A;  1KTK A;  1BNZ A;  1SYC A;  2K5W A;  4U68 A;  3NSW A;  5CYU A;  4RGT A;  3BYY B;  1BCP D;  3NQI A;  4CJ1 B;  1IYV A;  3BS1 A;  5G3L D;  2OT2 A;  1SDF A;  3HEJ A;  5I4D A;  1Y69 U;  1SMY D;  1HHV A;  2XSC A;  2IWH A;  3UI2 A;  1SYG A;  2F0K A;  1IYU A;  3S9W A;  3FMC A;  2ZXR A;  5EBC A;  1EWH A;  1JOR A;  1HQM C;  2D62 A;  2B63 B;  3P75 A;  2RDH A;  3GD7 A;  1DOM A;  4IUV A;  2WKC A;  2NUC A;  2WB1 B;  3VYS A;  3BVM A;  4HED A;  3F2U A;  2B2U C;  5CV4 A;  2YYZ A;  3M3Y B;  1DJR D;  4B9W A;  2NN6 G;  2K28 A;  3X3M A;  1BOS A;  2XRQ D;  2I46 A;  2WIN B;  3TP6 A;  2OEO A;  5DNF A;  3T16 A;  1E0B A;  3MHB A;  2JA5 B;  4LK1 C;  4C1N K;  1GXD C;  3QO2 A;  2C5C A;  1A6X A;  4IFD J;  2SDF A;  3A8K E;  1RHP A;  1H9R A;  3DXJ C;  2DY8 A;  1TVX A;  2QF7 A;  2L55 A;  1HA5 A;  3DEP A;  1CT1 D;  4IUU A;  4UDU C;  3HOZ B;  1K8O A;  5CV5 A;  4R8N A;  5JOB A;  1QNK A;  3EA6 A;  1SYB A;  4XYQ A;  5J1Z A;  3RUZ A;  2KJX A;  2KEE A;  1Y8O B;  2G9H D;  5D65 A;  5A2Q E;  4IUQ A;  1PYW D;  2AWO A;  1EEI D;  3K57 A;  1D1I A;  1VF7 A;  1NR4 A;  4PNY A;  5FO8 B;  1FYC A;  3AB9 A;  2D2C C;  2IT1 A;  2DNE A;  3GTM B;  1KLG D;  4I7Z C;  5C3X A;  1TY0 A;  4F88 A;  3I90 A;  5E4X A;  2AUK A;  2E76 C;  2F0L A;  4DK0 A;  4UAI A;  2NVQ B;  3MA2 B;  3S1Q B;  3Q6S A;  2A5H A;  4DNR B;  4IUP A;  1PXU A;  1CQF A;  3D8G A;  3H94 A;  4CBV A;  2B8F A;  4ULL A;  3SR1 A;  4OO1 H;  1T5X D;  1JWS D;  1EU4 A;  3SK5 A;  4HTH A;  4FF1 A;  2VXW A;  1A3U A;  3QB3 A;  2F0M A;  3R2I A;  1BQQ T;  3N6R A;  3I72 A;  4PV1 C;  5CR3 A;  4BA2 I;  1I4R A;  2R93 B;  1QCB D;  4CKC A;  4XDX A;  2HQE A;  3D6C A;  3I4L A;  3WOF A;  5A2Q L;  1DYQ A;  3J80 E;  4A3G B;  1B9M A;  1RTO A;  3C1E A;  1BCP F;  1SSO A;  4PMB A;  4TSS A;  4A93 B;  5IGE A;  1QNU A;  5G3L F;  1H9M A;  5BN3 A;  2F0O A;  1CK1 A;  1K8M A;  5HUR A;  2IX0 A;  4G7Z C;  4KK7 A;  5IGB A;  1FNV A;  1D5X C;  1EFI D;  2B2V A;  1EYC A;  5ELD A;  4KTA A;  3A56 A;  2IJ0 A;  2KVM A;  2E2I B;  3NTI A;  2WKD A;  1FNU A;  1G2S A;  2H1E A;  2QCP X;  1BXT A;  2VB2 X;  4H44 C;  4C3I G;  4B08 A;  4TKO B;  2G9D A;  1PDQ A;  1I4G A;  1KAA A;  1F2M A;  4RWS C;  1B50 A;  2EY5 A;  2CQA A;  2AUJ D;  4KMU C;  4O42 A;  1HA6 A;  3GTG B;  1YNJ D;  3J80 L;  4C56 C;  2F3W A;  3S2H B;  1DON A;  4ZK9 B;  2R7Z B;  1S5D D;  2HDM A;  2L12 A;  5IGD A;  1KNA A;  2QDB A;  4FVM A;  3HOU B;  3FPP A;  1V43 A;  3PIO 3;  1H9K A;  2EYJ A;  1M8A A;  2VUM B;  2JE6 I;  2CW0 C;  4FXK C;  3V05 A;  1Q12 A;  3A7A B;  4XQN A;  1V1P A;  2F0J A;  3A7L A;  5I2Y A;  3MZ5 A;  5IGF A;  1DCZ A;  3IFD A;  5T1G A;  3TZU A;  2KED A;  3PUX A;  5T1I A;  2EJF C;  3TP7 A;  1JOK A;  4PQX A;  5IIF A;  2E2J B;  2C9O A;  2J4X A;  4FXG C;  2IL8 A;  3H0G B;  1S5E D;  1EY5 A;  3HOW B;  1OO9 B;  1UUP A;  5C5M A;  4OO1 I;  3NXW A;  1HRJ A;  5EKL A;  1J8I A;  1I4Q A;  2KCN A;  1U4L A;  3EQL C;  1JWU D;  3L7Z C;  3I73 A;  1S5B D;  4QF4 A;  2Q8I B;  3SHL A;  2SEB D;  1AW7 A;  2K6A A;  3S15 B;  3MTS A;  1XYI A;  4C1N I;  1BDO A;  2RSN A;  2JEA I;  3FPU B;  1TU2 B;  4ZAI A;  1SJH D;  3L9A X;  1JIC A;  2R6G A;  1DM0 B;  5C4J B;  1PFN A;  4CKB A;  2EDG A;  4ABN A;  4PMW A;  3SK8 A;  5EPJ A;  3MXN A;  3KBG A;  1VF5 C;  4RGN A;  3TDQ A;  5I9O A;  1LAC A;  3BG3 A;  3LNN A;  1Y1W B;  3S14 B;  4GZY C;  5K36 H;  4C3H B;  3OIQ A;  3NBI A;  3QWN A;  3TZD A;  1E2V A;  1LLR D;  1F9R A;  1S5F D;  5EKK A;  1EY6 A;  2RA4 A;  5EGT A;  3OWF A;  2KQ3 A;  3VR4 A;  1WTW A;  3K5N A;  4KD4 A;  3OW7 A;  2Z4I A;  3RD4 A;  3GTO B;  1KLU D;  2SNS A;  2EJG C;  1SYF A;  1XWE A;  3S1N B;  1TY2 A;  2L1B A;  4H0L C;  5C0X G;  1SAP A;  2Z8L A;  4RKB A;  4A3E B;  1CFM A;  1B44 D;  2EJM A;  1ENC A;  4K5W A;  3T56 B;  1ESF A;  1TR5 A;  5M5W B;  1CQV A;  4RHR A;  4A3M B;  4HCE A;  2NVX B;  5FKA C;  4WFN 3;  3BDO A;  3M4O B;  2XWB B;  3M4Y A;  1JQY D;  2EYP A;  5CV8 A;  1B2T A;  2ZXO A;  4KKS A;  3GQB A;  5D3D A;  1MGS A;  4FF4 A;  4A3D B;  4J8Q A;  4K8J A;  5M5X B;  2WII B;  3D4D A;  1IW7 D;  1TWF B;  2BOS A;  4G4K A;  2IX1 A;  4H7B A;  1WTO A;  2PZU A;  4P2C B;  1QWY A;  4ME5 A;  3OOC A;  4IFD H;  5E3F A;  2RSO A;  4G7O C;  1D5Z C;  2VNU D;  3IKJ A;  1I4X A;  3PUV A;  2JYO A;  5EJW A;  1F2L A;  5CMD A;  4V19 0;  1O78 A;  1YNN C;  3KLR A;  1GOZ A;  4H13 C;  4ZUJ A;  2F0G A;  3AMU A;  1PTO B;  5E1F A;  3NBH A;  2F0U A;  1PRT C;  3NP8 A;  3MFY A;  2N55 A;  1CZW A;  1GUT A;  3E0J A;  1EZ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...