1XYIA

Hyperthermophile chromosomal protein sac7d double mutant val26ala/met29ala in complex with dna gcgatcgc
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
66
structure length
66
Chain Sequence
MVKVKFKYKGEEKEVDTSKIKKVWRAGKAVSFTYDDNGKTGRGAVSEKDAPKELLDMLARAEREKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords 5'-D(*GP*CP*GP*AP*TP*CP*GP*C)-3'
publication title Probing the DNA kink structure induced by the hyperthermophilic chromosomal protein Sac7d
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
total genus 12
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2004-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02294 7kD_DNA_binding 7kD DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1xyiA00
4ZKBB 1WTWA 1AP0A 3P7JA 1WTQA 1MSHA 2B2TC 3IL8A 5CORA 1RTOA 4IUTA 1PFMA 4RA8A 1O80A 4IUQA 1WTOA 1O7YA 1JE4A 1F9SA 1WD0A 1X3PA 3F2UA 3DEPA 3FDTA 4X3TA 1RODA 2B2YC 2L1BA 2L12A 2N55A 2KOLA 3DM1A 1JICA 4QUCA 4DN4M 1U4LA 5AFWA 2X69A 4ZKCB 1BBXC 1BO0A 5E4WC 4HAEA 1GUWA 1X32A 1DOKA 4UAIA 1CA6A 3DEOA 5D14A 1G2SA 3TN2A 4XT1B 4X3SA 3TZDA 1NAPA 1B2TA 4HSVA 1QNKA 4XDXA 1MI2A 1DONA 1KNEA 2FHTA 1U4MA 1PDQA 1HFGA 2L9HA 1XYIA 1HRJA 1WTXA 1CA5A 4RWSC 1ML0D 1EQTA 5EKIA 4QUFA 1U4PA 1X3QA 4O42A 5COYA 3I8ZA 4ZAIA 1BF4A 2N88A 1DZ1A 1LV9A 1G91A 3KUPA 2NZ1D 2XIWA 4IUUA 1ZXTA 1B3AA 2NWGA 1E0BA 1VMCA 4OIKA 2K01A 5CBAE 3KBXA 1EL0A 1U4RA 1HFNA 1QE6A 2FJ2A 2HUGA 2FINB 3QO2A 1WVLA 1ICWA 2B2WA 2J7ZA 1SAPA 2MP1A 1WTVA 1AZQA 4CJ2C 2M2LA 5DNFA 2FMMA 1NR2A 1HA6A 2KUMA 2X6LA 2HCCA 2L11A 1ESRA 1SSOA 2MJ8A 1C8CA 2B2WC 2RA4A 1WTPA 2RSNA 3N52A 1RHPA 4OIJA 5D65A 1EIHA 5T1IA 1F9QA 2DY7A 3I91A 5EQ0A 1DOLA 4CJ1B 2K05A 4IUPA 1HUNA 1J9OA 4CJ0B 2EOTA 2D9UA 4R8IA 2HDMA 2CVRA 2KECA 5E4XA 1B4OA 1F2LA 3HP3A 3FPUB 2B2VA 1EOTA 2Q8RE 2VXWA 3MWYW 4IURA 5EPLA 1G2TA 3H91A 5CBEE 5EPJA 1O7ZA 3G7LA 1RTNA 5EPKA 4NW2A 1G6ZA 4XT3B 1B53A 2NYZD 5EJWA 4ZK9B 4X3KA 4MN3A 2IL8A 1PFBA 4MHEA 5T1GA 3UI2A 2FFKB 1ILQA 2KEDA 4HCSA 2B2VC 2JP1A 2K03A 4X3UA 1F9RA 2X6GA 1TVXA 3I90A 4LMQD 1SDFA 2BDNA 1PFNA 2B2UA 2RSOA 1MGSA 1IL8A 2H1EA 1AZPA 1XX8A 1IKLA 3Q6SA 1M8AA 1A15A 2RVLA 4RAUC 2Q8TA 2L4NA 1EIGA 2KEEA 2HCIA 1BNZA 1S4ZA 2KVMA 3ONAB 1CM9A 2MPMA 2K1BA 2DY8A 2K28A 1HHVA 1ILPA 1PLFA 1MSGA 4U68A 1DOMA 2B2UC 3GV6A 4IUVA 3I3CA 1HUMA 3D6WA 4ZLTF 1QG7A 5JJZA 2R3ZA 5CMDA 2SDFA 2EE1A 3SVMA 3R93A 1NR4A 1IKMA 2B2TA 1KNAA 2K04A 3GV3A 2MGSA 3IFDA 2HDLA 3LWEA 1Q3LA 1NCVA 4R9WA 3MTSA 1WTRA 2JYOA 1WD1A 4HEDA 1F9PA 1J8IA 1VMPA 1RJTA 1B50A 2B2YA 2EPBA
chains in the Genus database with same CATH superfamily
1BOSA 3C2PA 2BDOA 1SYGA 2ZXOA 4IJLA 3J7YW 1JC7A 1N34L 2JA5B 3PCOB 1JE4A 1HHVA 4KHPL 1LLRD 4DV6L 4WORA 1VQJA 4POGA 3GTPH 2CWAA 1ESFA 4XQQA 4IFDJ 1DOKA 1H9MA 2G9HD 3Q0AA 5D14A 2F0FA 3HS0C 4BY1H 2K75A 3PSIA 4J1MA 3K6OA 4XDXA 2NTTA 2VQFL 4PMBA 4KK7A 1E1TA 5CV9A 3HFZB 5G3LF 2PPBC 4NPSA 4QQBX 4JG2A 1CKNB 3K7UC 1ML0D 1EY9A 3JC66 5L37A 3TEHB 3UDIA 4YY3L 5COYA 3I8ZA 1HZ9A 1AH9A 3I4LA 1YIJA 1B3AA 3UE1A 2V1CC 3G4SA 3FKIH 2BCOA 3G48A 2FJ2A 3QO2A 4OWWB 1SAPA 4DR3Q 1B3QA 2K5VA 3OW7A 4FNFA 1FNWA 1VQ9A 1S5ED 1W6JA 2DNEA 2EYFA 4ILWA 4F88A 4KKUA 1EWHA 1C8CA 3D6CA 3CMEA 3T1YL 3F2BA 4A3KG 3OMGA 1Y1VG 2DY7A 2VQEQ 1XPUA 1Q12A 1SE2A 2ZJQA 1SNPA 1T5EA 2I46A 4XYOA 4LF9L 1EYCA 5EPLA 1R4PB 1ENFA 2YTXA 4JI4L 4A3MB 1G6ZA 4X66Q 3WWVA 1J6QA 1CHPD 4ZK9B 1SYFA 1O78A 3CCSA 1LYLA 3I90A 3KF8B 4GKJL 3CCLA 1QJOA 1S40A 3T51B 1M8AA 1EIGA 1NBWA 1UE5A 3MC0B 3Q24A 5JEAH 3PMFA 3UDGA 2LSSA 4Z9CB 3A7AB 3J7AF 5CR3A 5IP7H 5J39A 1JB7A 1EY8A 1UE6A 3GV3A 2HDLA 3DHQA 5LL6S 4HJ7A 1NCVA 2SNSA 4TQUS 1B50A 1UEBA 4IPCA 3NK9A 4ME3A 4KHPQ 4UP8A 4DV6Q 4FXKC 4RA8A 3TZUA 2C5CA 1CSQA 4C3IH 2BA1A 3LGJA 1SNDA 2D2CC 3A7LA 1RODA 3DM1A 4P72A 2JA6B 4BA1I 2VQFQ 1DCZA 4UAIA 5C44G 3KLRA 2CH4A 5JEAJ 1OTCA 2EJMA 4YY3Q 3ERQA 5K5PA 3J7AV 3PIO3 2NN6I 3GTGH 1FNVA 2EXZA 2RCFA 3I7FA 4K5XA 3K5OA 4O42A 1OXTA 3PF5A 5KIXA 1RKNA 2XIWA 2PMZB 1VMCA 3BJUA 2JXMB 1TIID 2HUGA 1K0SA 1VQIA 2GA4B 2OQ0A 2Z4HA 3NENA 3T1YQ 1N32L 1GJXA 3I56A 4R4OA 3MEHA 1CK1A 1WCMB 2K5HA 1XWEA 3N52A 5IYDG 4B08A 2I07B 4LF9Q 4A3FH 1L1OC 1DOLA 4JI7L 4X65Q 4JI4Q 2Z6KC 3MZ5A 2EOTA 1R9TB 4A3MG 3HZXA 3NE5B 2BE5C 2EYHA 1F2LA 1MBYA 3NELA 5CBEE 2NZHA 1SYCA 1GUNA 3H15A 5K36H 1VQKA 1B53A 2UUCL 1KDCA 4N9TA 1YJNA 4N8FA 4GKJQ 1TWHB 1X9NA 1JE5A 4L8JA 4DR5L 3BU2A 2F4VL 5JJKA 1TWFB 1KRTA 3GO5A 2VNUD 3G6EA 1AE3A 1AZPA 4IPGA 3S1RH 2PMZE 1PHJA 4QGUA 1N8RC 3DWPA 2A6HD 1YHQA 3AFQA 4WJWA 1B9MA 1KNAA 3GTPB 2PYKA 2F1MA 2KBNA 5BN5A 5GAEC 3WOFA 2LFNA 4BY1B 2JA6G 1KLGD 1O80A 3X3MA 2JA9A 1ASYA 2CQAA 3FDTA 2B2YC 2KHSA 1Z9FA 4GN3B 5DM63 1GKHA 3GTJH 3DEOA 3E3XA 1T9HA 3DM3A 3FKIB 3DLLA 4P2CB 2FXQA 1SLJA 1E24A 2F3IA 2EY6A 5ELFA 2XRQD 5IT9E 2A73B 5CV4A 1PFSA 1IL2A 2IX3A 2QW7A 2AWNA 2IT1A 3J81j 2K5DA 2AQ2B 4GKKQ 1N32Q 1BUVT 1Y1WH 1GUTA 4JI6L 1QUQB 2H5XA 4GN5A 1JJCB 3KF6A 1PH8A 2F3VA 1HZCA 3SK8A 4L5QA 4TSSA 1VQ5A 1TR5A 2MO1A 1L1OA 1D2BA 1Z7TA 1GXDC 1Y8PB 2Z6KA 3J81E 4KMUC 4RG1A 4JI7Q 3CPWA 1RHPA 3CW2C 4IFDG 1JOKA 2UXCQ 4CJ1B 4YWMA 5M3FG 4PMCA 5GAHC 2R7ZH 2UUCQ 2MO0A 3BG3A 1I3QH 1D1KA 1ICFB 4IURA 2YU9H 1STBA 1MIUA 4DR5Q 3BYYB 2F4VQ 2QILA 1CI3M 3JAMi 1LM0A 5IGGA 4X3UA 5FLXE 1I4RA 4OXPA 1H95A 1PFNA 2E75C 2QF7A 1GUGA 4DV5L 2HHHL 3BYTB 2ZJPA 4K6LA 1BNZA 4HMJA 1GOZA 1TWAH 4LFBL 1Q7YC 1ILPA 4HIOA 3GV6A 3NQIA 2F0MA 4C3IB 4HIKA 2XRSD 5JAVA 3CCRA 3H3VI 1EUJA 3TP6A 4JPBW 4BY1G 2F03A 3M4OH 1BCPC 1Q82C 1F77A 1SNMA 2F0OA 2B2YA 3PF4A 5F2DA 1NJIC 2D0OA 2VUMH 3HOWG 5I6WA 4IUTA 3C1FA 1VCIA 3S14B 1EEID 1RF2D 1PRTF 3E0JA 1JWMD 3GTGB 1Q1BA 1BBXC 1I4HA 2B63H 4A3BH 3I70A 4DNRB 2ZTEA 3FMCA 2AHOB 3A0JA 1DONA 3RLOA 5E3FA 3FHWA 4OWTB 4P71A 4RWSC 4BXXH 4DNIA 1EQTA 1LTID 1VQNA 1BF4A 4RGOS 4JI6Q 4KJOA 1STNA 1YHBA 2NZ1D 2UUBL 4RFBA 3S15H 2K01A 1U4RA 4FF1A 4YIJA 2NVTB 3S9WA 1E2VA 4OL7A 4BS9A 3NSWA 3HOYH 4V0BA 5ELOA 2VS1A 4R4QA 1EU3A 1ESRA 2B2WC 2NB0A 1QZHA 4Q0FA 1O7LA 2CKZB 3H94A 1HUNA 5ELNA 1IYUA 4KJNA 5JEAG 5LL6X 3CCUA 2HDMA 2WB1B 3BVZA 2WKCA 5JJLA 3GTQH 1NY4A 3OYYA 2EDGA 4FF3A 5H1SE 5J1ZA 4MN3A 2IL8A 4DV5Q 2HHHQ 1G291 1IXRA 2KEDA 3Q23A 2JEBI 5DM73 4LFCL 4LFBQ 2RSOA 2F4IA 3WOEA 5KNBA 2VY3A 3Q6SA 2NUCA 2KEEA 4C3IG 2UU9L 3D4RA 4ZQ3A 1K8MA 3HOXH 4KD3A 4DK6C 1HJPA 1EQRA 1JOQA 1PMRA 2N3SA 4TRDA 1OXSC 1M4VA 3FRPB 4CDCC 4JBKA 3U4ZA 4MNOA 1ZKOA 3GTJB 3M9BA 3ND8A 3I72A 3J81c 3KYHC 5KYLA 3GTLH 3NTKA 4HIMA 1EY4A 1QVCA 1WD0A 4A93H 3GTOH 3T4AC 2EYPA 2WB1E 4JBJA 1L2FA 3W1BA 5FO7B 4ME5A 3U58A 1G2SA 4XT1B 3TZDA 3J80c 3PO2H 2UXBQ 1Y1WB 4QB4A 1GD7A 5M3MG 4OEMB 4C2MH 2UUBQ 3EBEA 1X3QA 3QJYA 3D0FA 4A3EH 4R4TA 5BR8L 4A3FG 1KD1C 2A1AA 1G91A 2E5LL 2EJFC 1B7YB 4UHVA 4F8MA 4AQYL 2B2WA 1WTVA 3S1NH 5K36G 4RKLA 3MFGA 4DAYB 2MQHA 1I3QB 2YV5A 2KUMA 1A8VA 4A76A 2YU9B 3M4QA 2UUAL 5IYBH 4FF4A 4DV3L 5C4ZA 2EYLA 2VL6A 3W1GA 3AU7A 1F9QA 4DR1L 4AYBB 1P8LA 4PQXA 5M5YB 4CJ0B 2V4DA 3EQLC 1WJJA 5HGQA 2KECA 4PMWA 3MVVA 5GAGC 1TWAB 1E7ZA 1VQGA 1SNOA 3T16A 4LFCQ 5EKKA 3VR5A 4IJHA 4QJFA 2XWBB 2JP1A 3F8TA 1F9RA 3QIAA 2UU9Q 4CDFC 3H3VC 2ZTDA 2BDNA 3DUZA 1JCKB 3M4OB 5IP9H 3ULJA 1YBYA 5EKLA 3JAME 2EYJA 1X6OA 3J80L 5ISRA 3STBC 1NMGA 3CCVA 2B8GA 5M5WH 2R7FA 5EBCA 1YNJC 2AQ3B 2K6AA 1WI5A 3QG1A 1KRSA 1WD1A 4A3BB 1BR9A 1ZEQX 2J4XA 5J22A 5C4XH 5C0XH 4OWXB 1TXYA 3P7JA 1WTQA 3E6ZX 4N9PA 1EYAA 4DR2L 2RBMA 2WFWA 4AYBE 3H09A 1TS5A 5T1IA 5CV5A 1FD7D 3U50C 1U4LA 2A6EC 4A4IA 4RCNA 3RNUA 1Y1WG 1TWHH 1QNUA 1EIYB 1I6VC 1TWGB 2A5HA 2KCMA 4UP9A 3M85A 3S15B 1D8LA 2IY5B 1SYEA 2EXDA 3MXNB 3M4PA 4DV0L 1KNEA 5BR8Q 5JVH3 3HOYB 4A3LH 4CKBA 3F1ZA 4TVAB 2E5LQ 1WFQA 3KDFA 4NDXA 4AQYQ 4OX9L 2ALYB 4P75A 4R4CA 1STAA 3S2HH 4H7BA 2R7ZG 5IOCA 3A8IE 1RD9D 1NUCA 1VQCA 4KV6A 3NBIA 2O5JC 2UUAQ 2EY5A 5IGDA 4DV3Q 1SNQA 1K8AC 3IAYA 3A55A 2A8VA 4A3IB 2P5ZX 1I4GA 3GTQB 1KXLA 4DAPA 4DR1Q 3W3AA 1BQQT 4OO1H 4L6TB 4C3HB 1H9JA 2R93G 1PYSB 5IYCH 1J9OA 2I5MX 2R92G 2C9OA 1C9OA 3AEVA 3TRZA 1B4OA 1K3BC 2IW3A 4CBVA 4RKBA 5FO8B 5I2YA 5BN4A 1KAAA 3HOXB 4YCVA 1PFBA 2OEOA 3CQZH 3FEWX 1BCPD 4O1NA 2L0CA 1SDFA 3I4MG 2NVYH 4B9WA 2K4KA 2VUMG 1Q81C 1S5DD 3VR6A 5CYUA 5I6YA 4DR4L 2HCIA 2NN6H 4YCWA 2F0NA 1PRTD 4ULLA 1IYJB 3PO3G 2F0PA 3MXUA 4LAAA 1QVFA 3GTLB 5HURA 4IUVA 1GO3E 2B63G 1MJCA 3ER0A 4A3BG 4A93B 3W2DA 4EQNA 3GTOB 5FOBB 1EFID 4IFDI 1K8GA 2JYOA 2RF4A 4H0LC 4DR2Q 1LT3D 1MD2D 2R7DA 5CORA 3PO2B 4IUQA 3S1QH 3SE0A 1PTOC 3EFXD 4MTKA 4BBRB 5FLMH 4ZYSA 4ALPA 1PH7A 4C2MB 1JICA 4JI5L 4BBSH 2X69A 4OGQC 2HIXA 4A3EB 2DJFC 2KCNA 4DV0Q 4DV7L 3TN2A 4IN3A 4X3SA 4CDDC 4HMIA 4LWCA 1MI2A 2DGYA 3NHHA 4OX9Q 2JA5G 5LMNL 1N34Q 3S1NB 2QGQA 1PZID 3KLSA 3A5ZB 4XQNA 4EQPA 4GLAC 3TS2A 1B44D 1TWCH 4GOPC 1ZYRC 3KUPA 4BY7H 4KHZA 3KFUA 2NWGA 1XNRL 4OIKA 1MHWC 4RCOA 1QB5D 2LMCB 3KLWA 1DYQA 1CQVA 1EYGA 2PW7A 4A3DH 1D5MC 2RHSB 3C1EA 3K8AA 5I9PA 2JJQA 3N6RA 2CCZA 3S14H 4LF6L 3V05A 1IW7D 2R6GA 3R3OA 2K05A 3MXPA 3K0YA 1XXGA 1CFMA 1LABA 3ULPA 3HOXG 3EROA 1EOTA 4WRDA 5ELDA 1WYDA 3G7LA 1RTNA 2PZTA 4AIMA 2JA8H 5IWAL 2JEAI 1I6HH 3SGIA 5A35A 5M5WB 2PQAA 4QIWB 5A2QE 2X6GA 1YHAA 3R8BA 2WP8J 3VR4A 1IL8A 1CUKA 2RVLA 3MA2B 2HQLA 3HEJA 2IX1A 2NVTH 2NZOA 4A93G 4RGNA 5C4XB 2ZXPA 3ZJYC 4L5RC 2E2DC 1LTGD 1YITA 2B39A 4Q5VA 3MHBA 1WTHA 1H9SB 2QKIC 2OCEA 1P16A 1HA5A 3DMUA 3NTHA 4HEDA 1V43A 4GZYC 3GTKH 1PZJD 4G7OC 4JI5Q 3G71A 1JB3A 4WJ4A 4A3EG 3F2UA 4JK1C 2PI2A 1F2YA 4DV7Q 2I5HA 4DR7L 3J7ZC 3F2DA 1SRUA 3HKZB 3FP9A 1G8ZD 3S2HB 5LMNQ 4DNTB 1NAPA 2Q2TA 1SBBB 4GOPA 2Q2HA 4QIWE 4J6HA 5IYBG 1XNRQ 3PUWA 5EKIA 1AFPA 4RGTA 1HQRD 1DJRD 4A3CH 2K5WA 1Q46A 1HR0L 1M90C 2XSCA 1CKNA 3KBXA 2L15A 4PV1C 3M4YA 3W5OA 1PZKD 2SNMA 1CKOA 1Q86C 1NSNS 4NXML 3AQQA 4IQZA 1HNWL 3VYRA 1BCPB 3SK6A 2F0KA 4QF4A 1K73C 2XNAC 3CQZB 1Q8KA 3A54A 5IP9G 2QEXA 3TMEA 5EQ0A 3U9OA 2GVBA 1YNNC 3K5LA 3I55A 2NVYB 3OW2A 2ID0A 3K80C 4QY7A 1PRTB 5IWAQ 1LTRD 4HTHA 3FPUB 3HKZE 2VXWA 3SR1A 3NBHB 3FVQA 1WCMG 3SDZA 4F7XA 4JBMA 2F0JA 3K81C 1SYDA 3M3YH 4Y52H 4GNXB 1Z47A 3BVMA 1C0AA 2I0QA 5C4XG 4B3SL 4B9XA 4FF2A 1NMFA 2AUKA 2KVMA 4UP7A 1SN8A 1MSGA 3KF8A 2M9VA 2Q8IB 5CV6A 1C7YA 2A6ED 3S1QB 2XVSA 3D8GA 3RZDH 5JJIA 3M7NA 3VA7A 3BDCA 3QOLA 5I4DA 1Y8NB 4BBSB 3IFDA 5LMNW 1V1QA 2EPBA 4ZKBB 3S1MH 4A3LG 2H4OA 5D3DA 5M5YH 3IL8A 4HCEA 4DR7Q 1WTOA 1VQBA 1A3UA 1O7YA 3S24A 1X3PA 4K2LA 4JBWA 1FVIA 3CXCA 2QA4A 3TP7A 4NMZA 1K9MC 1A2TA 4KY6A 5FKAC 5E4WC 1TWCB 4X6AH 1LACA 4YCUA 3CPFA 2PO4A 1LT5D 4BY7B 2KJXA 3HGBA 1VQ6A 2NVQH 2F0IA 3OPOA 4DR6L 1BCPF 1U4MA 1PDQA 1IBML 4A3DB 3NTIA 3T53B 4F87A 1WTXA 5EAYA 1HZBA 3L9AX 4K8IA 5KRUA 1U0LA 1PA6A 4L5SA 2B29A 3NQTA 1EEFD 5IYCG 4X62L 1ZXTA 4JI1L 1E0BA 1SEBD 1L0WA 1HQMC 3FKIG 1WVLA 1W2BA 2G5DA 1Q1EA 4NXMQ 1MKHA 1HNWQ 4R1JA 4RHRA 1VQ7A 1XJVA 4G7HC 4MIUA 1UE7A 1HA6A 2Y0SB 2MJ8A 3F2CA 4ZRZA 2RA4A 1PH9A 5ELBA 2JA8B 1LTLA 1Y1VH 1SYBA 2E2HH 3T1HL 1I6HB 2OWOA 2RHQB 1TWGH 1V1PB 3A8KE 5GADC 2F0SA 4JI8L 2D9UA 5KGUA 3I4NB 2OXPA 1VQFA 2KHJA 2ASBA 3RD4A 4IOAA 1EU4A 4YWLA 4DF7A 5IIFA 1QWYA 1M1KC 4B3SQ 1TY2A 1BKBA 3S16H 1K0RA 1STYA 1VDZA 3VYSA 3K0XA 1H9KA 1LT4D 3I4OA 3BDLA 1MGSA 2WKDA 3RMHA 4LF5L 1SE3A 1FL0A 1D6EC 1LTSD 2EY1A 3GTKB 5FLMG 1F2ZA 2RCNA 4UDUC 3S2DH 5HY6A 2BH2A 1MJEA 4BBSG 3PIPA 5JJZA 1CZGA 3D6WA 4A3IH 4LK1C 4WFN3 5IP7G 1NR4A 4HSPA 1KABA 1Q3LA 1YEZA 4C3HH 2I5LX 3D4WA 2Y0SE 3GDEA 3VA5A 2DNCA 2YTVA 3QWNA 4G4KA 1HH2P 4KHVA 5KNCA 2RKSA 4DUYL 1CHQD 2Z6BA 1HR0W 4ODGA 1F9SA 2RDGA 5IT9c 1EY6A 1LTBD 2ENBA 4HJ9A 4ZKCB 3GP7A 5C44H 4DKAC 1GUWA 4DR6Q 2OT2A 1HTLD 1IBMQ 4A3DG 4JYAL 1S5BD 1SMYC 5IGEA 2B3GA 1B2TA 4HSVA 3HOVB 1LUZA 1EYDA 1QZGA 1STEA 1UNSA 3RR5A 1HFGA 3OWFA 4JC0A 2L9HA 3CCMA 4GLXA 1BVSA 1GHJA 4X62Q 2KCTA 4JI1Q 1VQHA 4UPAA 4I65A 5GQOA 3LWUA 2JA7B 2WACA 2E76C 4TKOB 3L7ZC 3HOZB 1QE6A 2Y0SG 2VW9A 4G7ZC 1JORA 2PCFB 2FMCA 3O13A 4O2DA 1KC8C 2JA8G 4K14A 1NR2A 1Q90A 3T1HQ 1Y69U 1QUQA 1CQFA 1AE2A 3HRZC 4Y7NH 3A8JE 5TSSA 4BBRH 3M3YB 1I94L 4JI8Q 5M5XH 1AEXA 3KJPA 5FLXc 4IUNA 1KDBA 2F0VA 2HQEA 1S5FD 2CVRA 4M1UB 1I50H 4N8X1 2EYMA 5E4XA 2BE5D 1G2TA 2D62A 4H13C 3PGZA 4X3KA 3GQBA 3UI2A 5IT9L 4B3ML 4LF5Q 4FXDA 1VS0A 4JV5L 3RZDB 4H02A 5I9OA 1BDOA 1DD2A 4B3TL 1XX8A 1IKLA 1UEAB 2WB1G 3RZOH 4BA2I 1EQQA 3ICEA 3CD6A 3KK7A 3ONAB 3S1MB 2A6HC 2DY8A 1X3FA 3Q22A 1ASZA 2HT1A 1W6KA 2CFMA 3EVQA 1CSPA 2ZT9C 1PH4A 1GVPA 4KY7A 3R2IA 4HJAA 3ULLA 3SVMA 3J81L 5C4JH 1KIXA 1XMQL 4R9WA 1WTRA 3PUXA 1J8IA 4OHJA 3L3OC 4DUYQ 3HG9A 1E2ZA 4LNQA 1MSHA 2NVQB 4DK3C 1KAWA 1SE4A 1II3A 1UE1A 3P20A 1E3PA 1W3SA 4A3CG 2N55A 2ZXRA 2L5TA 1HNXL 4LFAL 5AFWA 4JYAQ 3KLSX 2JN4A 3VR2A 4RGMA 1JT8A 1X32A 3X3NA 4C3JH 5FLXL 1X55A 2LS01 2F0WA 3MFYA 3WDNA 4YHHL 4C1NK 1N36L 4JI2L 1RCVD 3NPPA 4QUFA 1YZ6A 1DZ1A 4K5WA 4ZAIA 2N88A 4K8JA 4O0AA 4A3JH 4A3KB 4EQ5A 1Y1VB 2OF1A 2BOSA 2E2HB 2VQEL 2AKWB 1AW7A 2WINB 2E2JH 1Q8IA 3IFTA 1EY0A 1EY5A 1WOCA 4CJ2C 2Q2UA 2NBFA 1I94Q 1SFOH 3CC2A 1HCZA 3AB9A 1PYBA 3G6JB 1XTCD 1WTPA 2RSNA 3PIOA 1XTDA 1EIHA 4IO9A 3S16B 2K33A 3Q8DA 3NP8A 3CCEA 4ZUIA 4ABNA 3OWEB 5IY0A 4DXGA 3HP3A 4PZ6A 4JV5Q 4B3MQ 5C0XJ 2IPKD 4U673 1ONLA 3S2DB 5KYIA 3URYA 2KENA 5I2XA 1I5FA 2VZAA 4B3TQ 3J7A5 4HCSA 1UUPA 4DAVA 1TVXA 4CHTB 4AYBG 2NVXB 1SMXA 1X3GA 3BS1A 2F0TA 1C4QA 3CMAA 1TS4A 4LJZC 3CF5A 1G51A 3AMUA 1IYVA 1OXUA 2E2IH 1PLFA 4GOPB 2MUYA 1A2UA 4A3GH 2RDFA 1XMQQ 2R3ZA 3OHXC 2EE1A 2KQ3A 3NWSA 5IGBA 2WV6D 3LWEA 3A74A 3HKSA 3EA6A 3MTSA 1NNXA 5C44B 1F9PA 3CC7A 4DV2L 2KHIA 1XPRA 3HOWH 1B8AA 3UE0A 5ELCA 2B2TC 3K59A 4LFAQ 1HNXQ 3H0GH 4PG3A 3BDOA 4DUZL 1G6PA 2EVBA 4RHSA 2EY2A 2LXKA 3J81i 2QDBA 1YVCA 4HJ5A 4HAEA 2F52A 4YHHQ 5HGTA 5C5MA 1N36Q 1J5EL 4MTNA 4JI2Q 3OIPA 4HIDA 5C0XI 3NEMA 2PI2E 4KLKA 4JCVE 1X54A 3TREA 4EVOA 1CA5A 1B70B 3J80i 4KN7C 4BXXG 1XMOL 1KHIA 4Y7NB 3KF6B 1IZ6A 1PTOF 3ERSX 1STGA 5KNDA 5M5XB 1GHKA 1L1OB 4X65L 1HXYD 3AYHB 4KTAA 1PH6A 1FR3A 2ZM6L 5C5LA 1NTGA 3RN5A 4LF7L 4ZUJA 1QILA 3HOYG 4OONA 2MNAA 1I50B 1DXMA 3I2ZA 3BZKA 4MZ9A 2HCCA 4IPHA 1SNCA 1O7IA 2G9DA 2MHVA 3A5UA 1Y14B 4DAYA 3OOCA 4XTCS 1QCBD 3TP5A 2F0GA 3CC4A 2UXDL 1TS2A 4J8QA 4YWKA 4DV1L 4R8IA 4FDBA 3JAMc 2XGTA 4QL5A 2N49A 4EGVA 3MWYW 3RZOB 4A3IG 1RL2A 1FGUA 2JK8A 3V2TA 4NW2A 3BZDB 3CCQA 4V190 3RLNA 1GUSA 1KLUD 2PZWA 3DWAA 4C3HG 4OO1I 3D3RA 3D4DA 4JI3L 4PNYA 1KTKA 2J0TD 3TBIB 2QCPX 5C4JB 3K7AH 5JPMC 4RAUC 2Z1CA 3PUZA 1S4ZA 1YNXA 2K28A 2VB2X 2K50A 2B2UC 3S17B 4JW0A 4DV2Q 3IKJA 2B2TA 3NUCA 2RDHA 5CV7A 2K04A 1VQEA 4H44C 2B8FA 1EFWA 3GTMH 1D5XC 1SMYD 4APVA 3PUYA 1H9RA 4NB3A 4DUZQ 4DR4Q 3EJIA 2L55A 3LNNA 4J15A 5AJ3L 4C3JB 5JOBA 1WTWA 4LF8L 2XWJB 3B6YA 3K5MA 2EQSA 1AP0A 3VYUA 1RTOA 2Z8LA 5EGTA 4FVMA 1JJGA 3TDQA 3I4NH 5FJ8H 2L12A 2OQKA 1B9NA 3P1HA 1J5EQ 1LO5D 1K83H 4HN7A 3DXJC 4A3JB 4GKKL 1N9WA 4L63B 2XTIA 2F0QA 3D31A 1X65A 2DJGC 3PO2G 2M00A 2E2JB 2A68C 1XMOQ 5M3MH 3JAML 1V1OA 4BBRG 4LUOA 4DXFA 2EZVA 3MXNA 1VQ4A 1SFOB 3OIQA 1F2MA 4X64L 2ZM6Q 1SJED 1LTAD 4LF7Q 2UXCL 1ET9A 2RQXA 2LKVA 5DAUA 5M3FB 3SHLA 2Z9HA 1GM5A 1AN8A 1N33L 1I4QA 1TT2A 5E7NA 5J3BA 2N78A 1VF7A 2HIVA 2BH8A 1DGSA 1PXUA 1JMCA 1SJHD 2K5NA 5FO9B 1V8QA 1TQOA 2UXDQ 4IZ8A 4DV1Q 1VQDA 4L5TA 4KKTA 1L0YB 2IHFA 1QOHA 2DUDA 3VYTA 4LW1A 2A69C 1JWUD 2VB3X 1EY7A 3V96A 2D0PA 2PQEA 3HOVH 1KL9A 2HD3A 3H91A 2K5QA 4ID6A 5EPJA 4JI3Q 2ATWA 3E9HA 2E2IB 2K32A 3MXGA 4DU9A 4LUZA 1K3RA 5CGKA 4LF6Q 4MHEA 5T1GA 4LF4L 4A3GB 2PW5A 3OSOA 3UDXA 3H3VH 3RLFA 2K03A 2EIFA 5IGCA 2O4XA 1YJWA 1YJ9A 2JA7H 2B2UA 5DEHA 3ZYYX 4CKCA 3DWQA 2Q8TA 2L4NA 3RUZA 3HOZH 4C56C 2KA7A 2MPMA 3HOWB 4U68A 3E0EA 3I3CA 1HUMA 3H0GB 3STBD 1HTPA 4K5VA 4ZLTF 2YYZA 5BN3A 4M8AA 5AJ3Q 4C3JG 4EX5A 2WIIB 4FO2A 1YNJD 4S3SA 4LF8Q 1VF5C 5C3XA 4IALA 4DK0A 1PV4A 4CGYB 1RIPA 2ICEC 5C0XG 5C3EH 1VQMA 4GLVB 4CKEA 2ICIA 2K52A 2IHEA 1IBKL 2IWHA 2O2LD 4A3JG 1PH3A 3HOUH 4DN4M 4FYDA 1T5XD 4R4IA 4RMFA 1CA6A 2QEJC 2IJ0A 2CW0C 3I73A 4K0KL 1JQYD 2ZJRA 3T56B 4I7AA 1VQOA 4GN4B 1UAPA 1XPOA 1R4QB 4X64Q 1XYIA 1HRJA 5DLQE 3L0OA 1U4PA 1OXVA 3QR8A 3HKZG 1CTMA 1PYWD 3SK4A 1N33Q 1E2WA 3CP0A 5CBAE 1HFNA 3AFPA 2FINB 3TP8A 3J80E 2AWOA 4A75A 3U9SA 4GS3A 4JI0L 3E9IA 1GUOA 4P74A 5LMUL 2FMMA 2BA0A 2X6LA 2L11A 2E8GA 4I7ZC 4XQJA 4B3RL 2F0DA 5D65A 2R93H 2K14A 1HR0Q 5LHY1 4OO1G 2QDLA 2JQOA 2R92H 3KJOA 1RDPD 3K58A 2A19A 3EIVA 3EN2A 3K7AB 1EZ6A 4JOIC 4A3GG 4QMGA 1S5CD 4LF4Q 2WAQB 2Q2IA 4HJ8A 1OO9B 4C1NI 1D1IA 2NYZD 3A56A 5EJWA 3CRLC 2FFKB 4AH6A 3GD7A 4NXNL 3I4MH 5G3LD 4A3KH 1EQVA 4HR7B 3GTMB 3SXHA 1CZWA 3P75A 4DV4L 1E22A 1PRTC 3H0GG 4DPGA 3PO3H 1TY0A 2K1BA 2NN6G 4DFAA 1DOMA 2E74C 3CHBD 5FK9C 4XXEA 2D5DA 2LXJA 5CMDA 1FGBD 4GNXC 1SE8A 4IPDA 4KY5A 3QOJA 3LX0A 3ITPA 1K28A 1K83B 1HPCA 2F0LA 1Z6HA 1JOOA 1Y8OB 1RJTA 1BBWA 1H9SA 1IBKQ 3CCJA 1JWSD 2UXBL 1V9PA 3ND9A 5GROA 4BWGB 1PFMA 1PTOH 2F3WA 5M3MB 2MFIA 2Z4IA 4X3TA 1VQPA 4EQOA 1S3OA 3H6MA 1A0IA 2KOLA 2N8NA 4KKSA 4LUVA 1PTOD 4QUCA 1X56A 4KD4A 4R8NA 5E1FA 1FYCA 1TU2B 3VDYA 4K0KQ 4A3FB 1A6XA 2GVAA 4XIGS 2WAQE 5CV8A 1D5ZC 4XYQA 5A2QL 2K7VA 1QVGA 2GN5A 2NVXH 1JR0D 3KDFB 4KI0A 1QNKA 4POFA 2JA5H 2SEBD 3M7GA 1D7QA 4RH6A 1JJ2A 5EBDA 4IOCA 3SEBA 3MAQA 1ENCA 4NP5A 1LV9A 2O5IC 1A63A 1L0XB 1STHA 4JI0Q 4ZCKA 4BY7G 1BXTA 1ZYRD 1EZ8A 3T13A 5LMUQ 1SR3A 1ICWA 3S1RB 2J7ZA 2MP1A 1HNZL 4B3RQ 2OTJA 2M2LA 2PNRC 4K6DA 3NWTA 1A3VA 2CH4W 4PZ7A 1IW7C 1S72A 4OIJA 4JOIA 3TSSA 3I91A 1VQ8A 2WAQG 4IUPA 1UWVA 2JSOA 3C3LA 2AMCB 1B1ZA 2EYOA 1O7ZA 5EPKA 2F0UA 4NXNQ 3NXWA 1FJGL 3QB3A 2XN9C 1ILQA 5C3WA 4DV4Q 2B2VC 2F0EA 3NBHA 4FXGC 2YTYA 4LMQD 3R2TA 5IYDH 1ET6A 1A15A 1IHZA 4GNXA 3TS0A 1CT1D 5IODA 4PZ8A 3UDFA 3I4NG 1CM9A 1LT6D 5FJ8G 4A3MH 5C3EB 2JE6I 4CDEC 2PNHA 4DA2A 1QG7A 3CU7A 4UY8C 1A62A 3HOUB 3PQIA 3R93A 1E1OA 2TSSA 1IKMA 5JPNC 3PV0A 4WJ3M 1PH5A 4DGZA 3OTOL 1IBLL 3PUVA 1VMPA 2R61A 2CWPA 5DNFA 2A68D 4K2KA 3KOJA 1XNQL 1K8OA 4JVZA 1VQLA 3U4VA 1A3TA 1TKWB 3DEPA 2L1BA 1X3EA 3CKIB 1C48A 3BVGA 1BO0A 1PH1A 3SK5A 1PH2A 1YI2A 2R7ZB 1TS3A 2TMPA 1ENAA 2CQOA 2PZUA 4DAMA 3KBGA 2FHTA 1I4PA 3TQYA 5CC4A 1PVOA 2JA6H 3IRBA 1U9RA 1FNUA 3S17H 3K57A 4IUUA 2R93B 1HNZQ 1EL0A 2A69D 2R92B 1EWIA 3HOVG 3VR3A 1AZQA 2CHBD 1EWCA 3E5SA 2IX0A 3OMCA 5C6AA 1I4XA 3CRKC 1KDAA 1SSOA 4DR3L 3C46A 3RN2A 1VQAA 1SXTA 2JA7G 3FPPA 1CKMA 1SROA 5D3IB 3BZCA 4DK1A 3HOZG 3I4MB 3MEFA 2NTSA 2VUMB 1DM0B 2ZTCA 2DN8A 2ES2A 1YNND 1FJGQ 2C35B 1WCMH 2B2VA 2Q8RE 3PIP3 2PQAB 3K5NA 2OTLA 2KCCA 3PO3B 4P73A 4E6IA 1V1PA 4XT3B 4NKLA 2AQ1B 2B63B 5ELEA 1OXXK 4OELB 4G57A 5JVG3 2AUJD 4X66L 1R9TH 4IFDH 2H1EA 3CAMA 5C3EG 4QCLA 1LTTD 2Z0SA 5M9OA 2EJGC 5IE8A 3L2PA 5M3FH 1EOVA 5NUCA 2SOBA 2LY7A 3HOUG 1NE3A 1KQSA 5C4HA 5KEEA 1PTOB 1HZAA 2SDFA 3OTOQ 1IBLQ 5IGFA 1U5KA 4KN4C 4FP5D 1TWFH 2MGSA 2A74C 2CW0D 1BBUA 1XNQQ 1EIFA 2F0HA
chains in the Genus database with same CATH topology
1BOSA 3C2PA 2BDOA 1SYGA 2ZXOA 3J7YW 1JC7A 2JA5B 1JE4A 1HHVA 1LLRD 4WORA 1ESFA 4XQQA 4IFDJ 1DOKA 1H9MA 2G9HD 3Q0AA 5D14A 2F0FA 3HS0C 4J1MA 3K6OA 4XDXA 2NTTA 4PMBA 4KK7A 5CV9A 5G3LF 2PPBC 1ML0D 1EY9A 5COYA 3I8ZA 3I4LA 1B3AA 2BCOA 2FJ2A 3QO2A 1SAPA 3OW7A 4FNFA 1FNWA 1S5ED 1W6JA 2DNEA 2EYFA 4ILWA 4F88A 4KKUA 1EWHA 1C8CA 3D6CA 3OMGA 2DY7A 1Q12A 1SE2A 1SNPA 1T5EA 2I46A 4XYOA 1EYCA 5EPLA 1R4PB 1ENFA 4A3MB 1G6ZA 1CHPD 4ZK9B 1SYFA 1O78A 3I90A 1QJOA 3T51B 1M8AA 1EIGA 3MC0B 3Q24A 5JEAH 3PMFA 4Z9CB 3A7AB 3J7AF 5CR3A 5J39A 1EY8A 3GV3A 2HDLA 3DHQA 5LL6S 1NCVA 2SNSA 4TQUS 1B50A 3NK9A 4FXKC 4RA8A 3TZUA 2C5CA 2BA1A 1SNDA 2D2CC 3A7LA 1RODA 3DM1A 2JA6B 4BA1I 1DCZA 4UAIA 3KLRA 5JEAJ 2EJMA 3ERQA 5K5PA 3J7AV 3PIO3 2NN6I 1FNVA 2EXZA 4K5XA 3K5OA 4O42A 1OXTA 5KIXA 1RKNA 2XIWA 2PMZB 1VMCA 2JXMB 1TIID 2HUGA 2GA4B 2Z4HA 1GJXA 3MEHA 1CK1A 1WCMB 1XWEA 3N52A 4B08A 2I07B 1DOLA 3MZ5A 2EOTA 1R9TB 3HZXA 3NE5B 2BE5C 2EYHA 1F2LA 1MBYA 5CBEE 1SYCA 1GUNA 5K36H 1B53A 1KDCA 4N9TA 1TWHB 4L8JA 1TWFB 3GO5A 2VNUD 1AZPA 3DWPA 2A6HD 4WJWA 1B9MA 1KNAA 3GTPB 2PYKA 2F1MA 5BN5A 3WOFA 2LFNA 4BY1B 1KLGD 1O80A 3X3MA 2CQAA 3FDTA 2B2YC 2KHSA 5DM63 3DEOA 3FKIB 4P2CB 2EY6A 5ELFA 2XRQD 5IT9E 2A73B 5CV4A 2IX3A 2AWNA 2IT1A 2K5DA 2AQ2B 1BUVT 1GUTA 2F3VA 3SK8A 4TSSA 1TR5A 1D2BA 1Z7TA 1GXDC 1Y8PB 3J81E 4KMUC 1RHPA 4IFDG 1JOKA 4CJ1B 4PMCA 3BG3A 1D1KA 4IURA 1STBA 3BYYB 2QILA 1CI3M 5IGGA 4X3UA 5FLXE 1I4RA 1PFNA 2E75C 2QF7A 1GUGA 3BYTB 4K6LA 1BNZA 4HMJA 1GOZA 1ILPA 3GV6A 3NQIA 2F0MA 4C3IB 2XRSD 5JAVA 3TP6A 2F03A 1BCPC 1F77A 1SNMA 2F0OA 2B2YA 5F2DA 5I6WA 4IUTA 3C1FA 1VCIA 3S14B 1EEID 1RF2D 1PRTF 3E0JA 1JWMD 3GTGB 1Q1BA 1BBXC 1I4HA 3I70A 4DNRB 3FMCA 1DONA 5E3FA 4RWSC 1EQTA 1LTID 1BF4A 4RGOS 4KJOA 1STNA 2NZ1D 4RFBA 2K01A 1U4RA 4FF1A 4YIJA 2NVTB 3S9WA 1E2VA 4OL7A 4BS9A 3NSWA 4V0BA 1EU3A 1ESRA 2B2WC 2NB0A 4Q0FA 1O7LA 3H94A 1HUNA 1IYUA 4KJNA 5JEAG 5LL6X 2HDMA 2WB1B 3BVZA 2WKCA 2EDGA 4FF3A 5J1ZA 4MN3A 2IL8A 1G291 2KEDA 3Q23A 2JEBI 5DM73 2RSOA 2F4IA 3WOEA 5KNBA 3Q6SA 2NUCA 2KEEA 4C3IG 3D4RA 4ZQ3A 1K8MA 4KD3A 1JOQA 1PMRA 4TRDA 1OXSC 1M4VA 3FRPB 1ZKOA 3GTJB 3ND8A 3I72A 5KYLA 3NTKA 1EY4A 1WD0A 3T4AC 2EYPA 5FO7B 4ME5A 1G2SA 4XT1B 3TZDA 1Y1WB 4QB4A 1X3QA 3QJYA 1G91A 2EJFC 4F8MA 2B2WA 1WTVA 5K36G 4RKLA 3MFGA 1I3QB 2KUMA 2YU9B 4FF4A 5C4ZA 2EYLA 3AU7A 1F9QA 4AYBB 4PQXA 5M5YB 4CJ0B 2V4DA 3EQLC 2KECA 4PMWA 3MVVA 1TWAB 1SNOA 3T16A 5EKKA 3VR5A 2XWBB 2JP1A 3QIAA 1F9RA 3H3VC 2BDNA 3DUZA 1JCKB 3M4OB 5EKLA 3JAME 2EYJA 3J80L 5ISRA 2B8GA 5EBCA 1YNJC 2AQ3B 2K6AA 3QG1A 1WD1A 4A3BB 1BR9A 1ZEQX 2J4XA 5J22A 5C0XH 3P7JA 1WTQA 3E6ZX 4N9PA 1EYAA 2RBMA 3H09A 1TS5A 5T1IA 5CV5A 1FD7D 1U4LA 2A6EC 4RCNA 1QNUA 1I6VC 1TWGB 2A5HA 3M85A 3S15B 1SYEA 1KNEA 5JVH3 3HOYB 4CKBA 4NDXA 1STAA 4H7BA 5IOCA 3A8IE 1RD9D 1NUCA 4KV6A 3NBIA 2O5JC 2EY5A 5IGDA 1SNQA 3IAYA 3A55A 4A3IB 1I4GA 3GTQB 4DAPA 3W3AA 1BQQT 4OO1H 4L6TB 4C3HB 1H9JA 1J9OA 2C9OA 1B4OA 2IW3A 4CBVA 4RKBA 5FO8B 5I2YA 5BN4A 1KAAA 3HOXB 1PFBA 2OEOA 3FEWX 1BCPD 4O1NA 2L0CA 1SDFA 4B9WA 1S5DD 3VR6A 5CYUA 5I6YA 2HCIA 2NN6H 2F0NA 1PRTD 4ULLA 2F0PA 3MXUA 4LAAA 3GTLB 5HURA 4IUVA 4A93B 3W2DA 4EQNA 3GTOB 5FOBB 1EFID 4IFDI 2JYOA 4H0LC 1LT3D 1MD2D 5CORA 3PO2B 4IUQA 3SE0A 1PTOC 3EFXD 4BBRB 4ZYSA 4C2MB 1JICA 2X69A 4OGQC 4A3EB 2KCNA 3TN2A 4IN3A 4X3SA 4HMIA 1MI2A 3NHHA 3S1NB 1PZID 3KLSA 4XQNA 4EQPA 1B44D 1ZYRC 3KUPA 4KHZA 2NWGA 4OIKA 4RCOA 1QB5D 2LMCB 1DYQA 1CQVA 2PW7A 1D5MC 3C1EA 5I9PA 3N6RA 3V05A 1IW7D 2R6GA 3R3OA 2K05A 3MXPA 3K0YA 1XXGA 1CFMA 1LABA 3EROA 1EOTA 4WRDA 5ELDA 3G7LA 1RTNA 2PZTA 2JEAI 5A35A 5M5WB 4QIWB 5A2QE 2X6GA 3R8BA 2WP8J 3VR4A 1IL8A 2RVLA 3MA2B 3HEJA 2IX1A 5C4XB 4RGNA 2ZXPA 2E2DC 1LTGD 2B39A 4Q5VA 3MHBA 1H9SB 2QKIC 1HA5A 3DMUA 3NTHA 4HEDA 1V43A 4GZYC 1PZJD 4G7OC 1JB3A 3F2UA 4JK1C 1F2YA 3HKZB 1G8ZD 3S2HB 4DNTB 1NAPA 1SBBB 4J6HA 3PUWA 5EKIA 1AFPA 4RGTA 1HQRD 1DJRD 2K5WA 2XSCA 3KBXA 4PV1C 3M4YA 1PZKD 2SNMA 1NSNS 4IQZA 3VYRA 1BCPB 3SK6A 2F0KA 4QF4A 2XNAC 3CQZB 3A54A 3TMEA 5EQ0A 3U9OA 1YNNC 3K5LA 2NVYB 2ID0A 1PRTB 1LTRD 4HTHA 3FPUB 3SR1A 2VXWA 3FVQA 3SDZA 4F7XA 2F0JA 1SYDA 1Z47A 3BVMA 4B9XA 4FF2A 2AUKA 2KVMA 1MSGA 3KF8A 2M9VA 2Q8IB 5CV6A 3S1QB 2A6ED 2XVSA 3D8GA 3M7NA 3VA7A 5I4DA 3BDCA 3QOLA 1Y8NB 4BBSB 3IFDA 2EPBA 4ZKBB 2H4OA 5D3DA 3IL8A 4HCEA 1WTOA 1A3UA 1O7YA 1X3PA 4K2LA 4JBWA 3TP7A 4NMZA 1A2TA 4KY6A 5FKAC 5E4WC 1TWCB 1LACA 2PO4A 1LT5D 4BY7B 2KJXA 3HGBA 2F0IA 3OPOA 1BCPF 1U4MA 1PDQA 4A3DB 3NTIA 3T53B 4F87A 1WTXA 3L9AX 4K8IA 5KRUA 3NQTA 1EEFD 1ZXTA 1E0BA 1SEBD 1HQMC 1WVLA 1Q1EA 4RHRA 4G7HC 4MIUA 1HA6A 2Y0SB 2MJ8A 4ZRZA 2RA4A 5ELBA 2JA8B 1SYBA 1I6HB 1V1PB 3A8KE 2F0SA 2D9UA 5KGUA 3I4NB 2OXPA 3RD4A 1EU4A 4DF7A 5IIFA 1QWYA 1TY2A 1STYA 1VDZA 3VYSA 1H9KA 1LT4D 3BDLA 1MGSA 2WKDA 3RMHA 1SE3A 1D6EC 1LTSD 2EY1A 3GTKB 1F2ZA 4UDUC 5JJZA 1CZGA 3D6WA 4LK1C 4WFN3 1NR4A 4HSPA 1KABA 1Q3LA 3D4WA 3VA5A 2DNCA 3QWNA 4G4KA 4KHVA 5KNCA 2RKSA 1CHQD 4ODGA 1F9SA 2RDGA 1EY6A 1LTBD 2ENBA 4ZKCB 3GP7A 1GUWA 2OT2A 1HTLD 1S5BD 1SMYC 5IGEA 1B2TA 4HSVA 3HOVB 1EYDA 1STEA 1UNSA 1HFGA 3OWFA 2L9HA 1GHJA 4I65A 3LWUA 2JA7B 2WACA 2E76C 4TKOB 3L7ZC 3HOZB 1QE6A 4G7ZC 1JORA 2PCFB 2FMCA 3O13A 4K14A 1NR2A 1Q90A 1Y69U 1CQFA 3HRZC 3A8JE 5TSSA 3M3YB 1AEXA 4IUNA 1KDBA 2F0VA 2HQEA 1S5FD 2CVRA 4M1UB 2EYMA 5E4XA 2BE5D 1G2TA 2D62A 4H13C 4X3KA 3GQBA 3UI2A 5IT9L 4FXDA 3RZDB 5I9OA 1BDOA 1DD2A 1XX8A 1IKLA 1UEAB 4BA2I 3KK7A 3ONAB 3S1MB 2A6HC 2DY8A 3Q22A 1W6KA 3EVQA 2ZT9C 4KY7A 3R2IA 3SVMA 3J81L 4R9WA 1WTRA 3PUXA 1J8IA 4OHJA 3L3OC 3HG9A 1E2ZA 1MSHA 2NVQB 1SE4A 1II3A 3P20A 2N55A 2ZXRA 2L5TA 5AFWA 3KLSX 3VR2A 4RGMA 1X32A 3X3NA 5FLXL 2LS01 2F0WA 3MFYA 3WDNA 4C1NK 1RCVD 3NPPA 4QUFA 1DZ1A 4K5WA 4ZAIA 2N88A 4K8JA 4A3KB 1Y1VB 2OF1A 2BOSA 2E2HB 1AW7A 2WINB 1Q8IA 3IFTA 1EY0A 1EY5A 4CJ2C 2NBFA 1HCZA 3AB9A 3G6JB 1XTCD 1WTPA 2RSNA 1EIHA 3S16B 2K33A 3NP8A 4ZUIA 4ABNA 3OWEB 4DXGA 3HP3A 5C0XJ 2IPKD 4U673 1ONLA 3S2DB 5KYIA 3URYA 5I2XA 4HCSA 1UUPA 4DAVA 1TVXA 4CHTB 2NVXB 3BS1A 2F0TA 1C4QA 1TS4A 4LJZC 3AMUA 1IYVA 1OXUA 1PLFA 2MUYA 1A2UA 2RDFA 2R3ZA 3OHXC 2EE1A 2KQ3A 3NWSA 5IGBA 2WV6D 3LWEA 3EA6A 3MTSA 5C44B 1F9PA 5ELCA 2B2TC 3K59A 3BDOA 2EVBA 4RHSA 2EY2A 2QDBA 4HAEA 5HGTA 5C5MA 3OIPA 5C0XI 1CA5A 4EVOA 4KN7C 4Y7NB 1PTOF 1STGA 5KNDA 5M5XB 1GHKA 1HXYD 4KTAA 1FR3A 5C5LA 4ZUJA 1QILA 1I50B 1DXMA 2HCCA 1SNCA 2G9DA 2MHVA 4DAYA 3OOCA 4XTCS 1QCBD 3TP5A 2F0GA 1TS2A 4J8QA 4R8IA 4EGVA 3MWYW 3RZOB 3V2TA 4NW2A 3BZDB 4V190 1GUSA 1KLUD 2PZWA 3DWAA 4C3HG 4OO1I 3D3RA 3D4DA 4PNYA 1KTKA 2J0TD 3TBIB 2QCPX 5C4JB 5JPMC 4RAUC 2Z1CA 3PUZA 1S4ZA 2K28A 2VB2X 2B2UC 3S17B 3IKJA 2B2TA 3NUCA 2RDHA 5CV7A 2K04A 4H44C 2B8FA 1D5XC 1SMYD 3PUYA 1H9RA 3EJIA 2L55A 3LNNA 4C3JB 5JOBA 1WTWA 2XWJB 3K5MA 1AP0A 3VYUA 1RTOA 2Z8LA 5EGTA 4FVMA 3TDQA 2L12A 1B9NA 3P1HA 1LO5D 4HN7A 3DXJC 4A3JB 4L63B 2F0QA 3D31A 2M00A 2E2JB 2A68C 3JAML 1V1OA 4DXFA 2EZVA 3MXNA 1SFOB 3OIQA 1F2MA 1SJED 1LTAD 1ET9A 2RQXA 2LKVA 5DAUA 5M3FB 3SHLA 1AN8A 1I4QA 1TT2A 1VF7A 1PXUA 1SJHD 5FO9B 1V8QA 1TQOA 4IZ8A 4KKTA 1L0YB 1QOHA 3VYTA 2A69C 1JWUD 2VB3X 1EY7A 3V96A 2PQEA 3H91A 2K5QA 4ID6A 5EPJA 2E2IB 2K32A 3MXGA 4DU9A 5CGKA 4MHEA 5T1GA 4A3GB 2PW5A 3OSOA 3RLFA 2K03A 5IGCA 2O4XA 2B2UA 5DEHA 3ZYYX 4CKCA 3DWQA 2Q8TA 2L4NA 3RUZA 4C56C 2KA7A 2MPMA 3HOWB 4U68A 3I3CA 1HUMA 3H0GB 4ZLTF 1HTPA 4K5VA 2YYZA 5BN3A 4M8AA 4C3JG 2WIIB 4FO2A 1YNJD 4S3SA 1VF5C 5C3XA 4IALA 4DK0A 4CGYB 2ICEC 5C0XG 4CKEA 2ICIA 2IWHA 2O2LD 4DN4M 4FYDA 1T5XD 1CA6A 2QEJC 2IJ0A 2CW0C 3I73A 1JQYD 3T56B 1UAPA 1R4QB 1XYIA 1HRJA 1U4PA 1OXVA 1CTMA 1PYWD 3SK4A 1E2WA 5CBAE 1HFNA 2FINB 3TP8A 3J80E 2AWOA 3U9SA 1GUOA 2FMMA 2BA0A 2X6LA 2L11A 4I7ZC 4XQJA 2F0DA 5D65A 5LHY1 4OO1G 1RDPD 3K58A 3K7AB 1EZ6A 4QMGA 1S5CD 2WAQB 1OO9B 4C1NI 1D1IA 2NYZD 3A56A 5EJWA 3CRLC 2FFKB 3GD7A 5G3LD 1EQVA 4HR7B 3GTMB 3SXHA 1CZWA 3P75A 1PRTC 1TY0A 2K1BA 2NN6G 4DFAA 1DOMA 2E74C 3CHBD 5FK9C 4XXEA 2D5DA 5CMDA 1FGBD 4KY5A 3QOJA 3LX0A 3ITPA 1K83B 1HPCA 2F0LA 1Z6HA 1JOOA 1Y8OB 1RJTA 1H9SA 1JWSD 3ND9A 4BWGB 1PFMA 1PTOH 2F3WA 5M3MB 2Z4IA 4X3TA 4EQOA 3H6MA 2KOLA 4QUCA 4KKSA 1PTOD 4R8NA 5E1FA 4KD4A 1FYCA 1TU2B 1A6XA 4A3FB 4XIGS 5CV8A 1D5ZC 4XYQA 5A2QL 2K7VA 1JR0D 4KI0A 1QNKA 2SEBD 3M7GA 4RH6A 5EBDA 3SEBA 3MAQA 1ENCA 4NP5A 1LV9A 2O5IC 1L0XB 1STHA 1BXTA 1ZYRD 1EZ8A 3T13A 1ICWA 3S1RB 2J7ZA 2MP1A 2M2LA 2PNRC 4K6DA 3NWTA 1A3VA 1IW7C 4OIJA 3TSSA 3I91A 4IUPA 2JSOA 3C3LA 1B1ZA 2EYOA 1O7ZA 5EPKA 2F0UA 3NXWA 3QB3A 2XN9C 1ILQA 5C3WA 2B2VC 2F0EA 3NBHA 4FXGC 4LMQD 3R2TA 1ET6A 1A15A 1IHZA 1CT1D 5IODA 1CM9A 1LT6D 5C3EB 2JE6I 4DA2A 1QG7A 3CU7A 3HOUB 3R93A 2TSSA 1IKMA 5JPNC 3PV0A 4DGZA 3PUVA 1VMPA 2R61A 5DNFA 2A68D 4K2KA 1K8OA 1A3TA 1TKWB 3DEPA 2L1BA 3CKIB 1C48A 3BVGA 1BO0A 3SK5A 2R7ZB 1TS3A 2TMPA 1ENAA 2PZUA 3KBGA 2FHTA 1I4PA 5CC4A 1U9RA 1FNUA 3K57A 4IUUA 2R93B 1EL0A 2A69D 2R92B 3VR3A 1AZQA 2CHBD 1EWCA 3E5SA 2IX0A 3OMCA 5C6AA 1I4XA 3CRKC 1KDAA 1SSOA 3C46A 1SXTA 3FPPA 5D3IB 4DK1A 3I4MB 2NTSA 2VUMB 1DM0B 2DN8A 1YNND 3PIP3 2B2VA 2Q8RE 3K5NA 2KCCA 3PO3B 4E6IA 1V1PA 4XT3B 4NKLA 2AQ1B 2B63B 5ELEA 1OXXK 4G57A 5JVG3 2AUJD 4IFDH 2H1EA 4QCLA 1LTTD 5M9OA 2EJGC 5NUCA 2SOBA 2LY7A 5C4HA 5KEEA 1PTOB 2SDFA 5IGFA 4KN4C 4FP5D 2MGSA 2A74C 2CW0D 2F0HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZKB B;  1WTW A;  1AP0 A;  3P7J A;  1WTQ A;  1MSH A;  2B2T C;  3IL8 A;  5COR A;  1RTO A;  4IUT A;  1PFM A;  4RA8 A;  1O80 A;  4IUQ A;  1WTO A;  1O7Y A;  1JE4 A;  1F9S A;  1WD0 A;  1X3P A;  3F2U A;  3DEP A;  3FDT A;  4X3T A;  1ROD A;  2B2Y C;  2L1B A;  2L12 A;  2N55 A;  2KOL A;  3DM1 A;  1JIC A;  4QUC A;  4DN4 M;  1U4L A;  5AFW A;  2X69 A;  4ZKC B;  1BBX C;  1BO0 A;  5E4W C;  4HAE A;  1GUW A;  1X32 A;  1DOK A;  4UAI A;  1CA6 A;  3DEO A;  5D14 A;  1G2S A;  3TN2 A;  4XT1 B;  4X3S A;  3TZD A;  1NAP A;  1B2T A;  4HSV A;  1QNK A;  4XDX A;  1MI2 A;  1DON A;  1KNE A;  2FHT A;  1U4M A;  1PDQ A;  1HFG A;  2L9H A;  1XYI A;  1HRJ A;  1WTX A;  1CA5 A;  4RWS C;  1ML0 D;  1EQT A;  5EKI A;  4QUF A;  1U4P A;  1X3Q A;  4O42 A;  5COY A;  3I8Z A;  4ZAI A;  1BF4 A;  2N88 A;  1DZ1 A;  1LV9 A;  1G91 A;  3KUP A;  2NZ1 D;  2XIW A;  4IUU A;  1ZXT A;  1B3A A;  2NWG A;  1E0B A;  1VMC A;  4OIK A;  2K01 A;  5CBA E;  3KBX A;  1EL0 A;  1U4R A;  1HFN A;  1QE6 A;  2FJ2 A;  2HUG A;  2FIN B;  3QO2 A;  1WVL A;  1ICW A;  2B2W A;  2J7Z A;  1SAP A;  2MP1 A;  1WTV A;  1AZQ A;  4CJ2 C;  2M2L A;  5DNF A;  2FMM A;  1NR2 A;  1HA6 A;  2KUM A;  2X6L A;  2HCC A;  2L11 A;  1ESR A;  1SSO A;  2MJ8 A;  1C8C A;  2B2W C;  2RA4 A;  1WTP A;  2RSN A;  3N52 A;  1RHP A;  4OIJ A;  5D65 A;  1EIH A;  5T1I A;  1F9Q A;  2DY7 A;  3I91 A;  5EQ0 A;  1DOL A;  4CJ1 B;  2K05 A;  4IUP A;  1HUN A;  1J9O A;  4CJ0 B;  2EOT A;  2D9U A;  4R8I A;  2HDM A;  2CVR A;  2KEC A;  5E4X A;  1B4O A;  1F2L A;  3HP3 A;  3FPU B;  2B2V A;  1EOT A;  2Q8R E;  2VXW A;  3MWY W;  4IUR A;  5EPL A;  1G2T A;  3H91 A;  5CBE E;  5EPJ A;  1O7Z A;  3G7L A;  1RTN A;  5EPK A;  4NW2 A;  1G6Z A;  4XT3 B;  1B53 A;  2NYZ D;  5EJW A;  4ZK9 B;  4X3K A;  4MN3 A;  2IL8 A;  1PFB A;  4MHE A;  5T1G A;  3UI2 A;  2FFK B;  1ILQ A;  2KED A;  4HCS A;  2B2V C;  2JP1 A;  2K03 A;  4X3U A;  1F9R A;  2X6G A;  1TVX A;  3I90 A;  4LMQ D;  1SDF A;  2BDN A;  1PFN A;  2B2U A;  2RSO A;  1MGS A;  1IL8 A;  2H1E A;  1AZP A;  1XX8 A;  1IKL A;  3Q6S A;  1M8A A;  1A15 A;  2RVL A;  4RAU C;  2Q8T A;  2L4N A;  1EIG A;  2KEE A;  2HCI A;  1BNZ A;  1S4Z A;  2KVM A;  3ONA B;  1CM9 A;  2MPM A;  2K1B A;  2DY8 A;  2K28 A;  1HHV A;  1ILP A;  1PLF A;  1MSG A;  4U68 A;  1DOM A;  2B2U C;  3GV6 A;  4IUV A;  3I3C A;  1HUM A;  3D6W A;  4ZLT F;  1QG7 A;  5JJZ A;  2R3Z A;  5CMD A;  2SDF A;  2EE1 A;  3SVM A;  3R93 A;  1NR4 A;  1IKM A;  2B2T A;  1KNA A;  2K04 A;  3GV3 A;  2MGS A;  3IFD A;  2HDL A;  3LWE A;  1Q3L A;  1NCV A;  4R9W A;  3MTS A;  1WTR A;  2JYO A;  1WD1 A;  4HED A;  1F9P A;  1J8I A;  1VMP A;  1RJT A;  1B50 A;  2B2Y A;  2EPB A; 
#chains in the Genus database with same CATH topology
 1BOS A;  3C2P A;  2BDO A;  1SYG A;  2ZXO A;  4IJL A;  3J7Y W;  1JC7 A;  1N34 L;  2JA5 B;  3PCO B;  1JE4 A;  1HHV A;  4KHP L;  1LLR D;  4DV6 L;  4WOR A;  1VQJ A;  4POG A;  3GTP H;  2CWA A;  1ESF A;  4XQQ A;  4IFD J;  1DOK A;  1H9M A;  2G9H D;  3Q0A A;  5D14 A;  2F0F A;  3HS0 C;  4BY1 H;  2K75 A;  3PSI A;  4J1M A;  3K6O A;  4XDX A;  2NTT A;  2VQF L;  4PMB A;  4KK7 A;  1E1T A;  5CV9 A;  3HFZ B;  5G3L F;  2PPB C;  4NPS A;  4QQB X;  4JG2 A;  1CKN B;  3K7U C;  1ML0 D;  1EY9 A;  3JC6 6;  5L37 A;  3TEH B;  3UDI A;  4YY3 L;  5COY A;  3I8Z A;  1HZ9 A;  1AH9 A;  3I4L A;  1YIJ A;  1B3A A;  3UE1 A;  2V1C C;  3G4S A;  3FKI H;  2BCO A;  3G48 A;  2FJ2 A;  3QO2 A;  4OWW B;  1SAP A;  4DR3 Q;  1B3Q A;  2K5V A;  3OW7 A;  4FNF A;  1FNW A;  1VQ9 A;  1S5E D;  1W6J A;  2DNE A;  2EYF A;  4ILW A;  4F88 A;  4KKU A;  1EWH A;  1C8C A;  3D6C A;  3CME A;  3T1Y L;  3F2B A;  4A3K G;  3OMG A;  1Y1V G;  2DY7 A;  2VQE Q;  1XPU A;  1Q12 A;  1SE2 A;  2ZJQ A;  1SNP A;  1T5E A;  2I46 A;  4XYO A;  4LF9 L;  1EYC A;  5EPL A;  1R4P B;  1ENF A;  2YTX A;  4JI4 L;  4A3M B;  1G6Z A;  4X66 Q;  3WWV A;  1J6Q A;  1CHP D;  4ZK9 B;  1SYF A;  1O78 A;  3CCS A;  1LYL A;  3I90 A;  3KF8 B;  4GKJ L;  3CCL A;  1QJO A;  1S40 A;  3T51 B;  1M8A A;  1EIG A;  1NBW A;  1UE5 A;  3MC0 B;  3Q24 A;  5JEA H;  3PMF A;  3UDG A;  2LSS A;  4Z9C B;  3A7A B;  3J7A F;  5CR3 A;  5IP7 H;  5J39 A;  1JB7 A;  1EY8 A;  1UE6 A;  3GV3 A;  2HDL A;  3DHQ A;  5LL6 S;  4HJ7 A;  1NCV A;  2SNS A;  4TQU S;  1B50 A;  1UEB A;  4IPC A;  3NK9 A;  4ME3 A;  4KHP Q;  4UP8 A;  4DV6 Q;  4FXK C;  4RA8 A;  3TZU A;  2C5C A;  1CSQ A;  4C3I H;  2BA1 A;  3LGJ A;  1SND A;  2D2C C;  3A7L A;  1ROD A;  3DM1 A;  4P72 A;  2JA6 B;  4BA1 I;  2VQF Q;  1DCZ A;  4UAI A;  5C44 G;  3KLR A;  2CH4 A;  5JEA J;  1OTC A;  2EJM A;  4YY3 Q;  3ERQ A;  5K5P A;  3J7A V;  3PIO 3;  2NN6 I;  3GTG H;  1FNV A;  2EXZ A;  2RCF A;  3I7F A;  4K5X A;  3K5O A;  4O42 A;  1OXT A;  3PF5 A;  5KIX A;  1RKN A;  2XIW A;  2PMZ B;  1VMC A;  3BJU A;  2JXM B;  1TII D;  2HUG A;  1K0S A;  1VQI A;  2GA4 B;  2OQ0 A;  2Z4H A;  3NEN A;  3T1Y Q;  1N32 L;  1GJX A;  3I56 A;  4R4O A;  3MEH A;  1CK1 A;  1WCM B;  2K5H A;  1XWE A;  3N52 A;  5IYD G;  4B08 A;  2I07 B;  4LF9 Q;  4A3F H;  1L1O C;  1DOL A;  4JI7 L;  4X65 Q;  4JI4 Q;  2Z6K C;  3MZ5 A;  2EOT A;  1R9T B;  4A3M G;  3HZX A;  3NE5 B;  2BE5 C;  2EYH A;  1F2L A;  1MBY A;  3NEL A;  5CBE E;  2NZH A;  1SYC A;  1GUN A;  3H15 A;  5K36 H;  1VQK A;  1B53 A;  2UUC L;  1KDC A;  4N9T A;  1YJN A;  4N8F A;  4GKJ Q;  1TWH B;  1X9N A;  1JE5 A;  4L8J A;  4DR5 L;  3BU2 A;  2F4V L;  5JJK A;  1TWF B;  1KRT A;  3GO5 A;  2VNU D;  3G6E A;  1AE3 A;  1AZP A;  4IPG A;  3S1R H;  2PMZ E;  1PHJ A;  4QGU A;  1N8R C;  3DWP A;  2A6H D;  1YHQ A;  3AFQ A;  4WJW A;  1B9M A;  1KNA A;  3GTP B;  2PYK A;  2F1M A;  2KBN A;  5BN5 A;  5GAE C;  3WOF A;  2LFN A;  4BY1 B;  2JA6 G;  1KLG D;  1O80 A;  3X3M A;  2JA9 A;  1ASY A;  2CQA A;  3FDT A;  2B2Y C;  2KHS A;  1Z9F A;  4GN3 B;  5DM6 3;  1GKH A;  3GTJ H;  3DEO A;  3E3X A;  1T9H A;  3DM3 A;  3FKI B;  3DLL A;  4P2C B;  2FXQ A;  1SLJ A;  1E24 A;  2F3I A;  2EY6 A;  5ELF A;  2XRQ D;  5IT9 E;  2A73 B;  5CV4 A;  1PFS A;  1IL2 A;  2IX3 A;  2QW7 A;  2AWN A;  2IT1 A;  3J81 j;  2K5D A;  2AQ2 B;  4GKK Q;  1N32 Q;  1BUV T;  1Y1W H;  1GUT A;  4JI6 L;  1QUQ B;  2H5X A;  4GN5 A;  1JJC B;  3KF6 A;  1PH8 A;  2F3V A;  1HZC A;  3SK8 A;  4L5Q A;  4TSS A;  1VQ5 A;  1TR5 A;  2MO1 A;  1L1O A;  1D2B A;  1Z7T A;  1GXD C;  1Y8P B;  2Z6K A;  3J81 E;  4KMU C;  4RG1 A;  4JI7 Q;  3CPW A;  1RHP A;  3CW2 C;  4IFD G;  1JOK A;  2UXC Q;  4CJ1 B;  4YWM A;  5M3F G;  4PMC A;  5GAH C;  2R7Z H;  2UUC Q;  2MO0 A;  3BG3 A;  1I3Q H;  1D1K A;  1ICF B;  4IUR A;  2YU9 H;  1STB A;  1MIU A;  4DR5 Q;  3BYY B;  2F4V Q;  2QIL A;  1CI3 M;  3JAM i;  1LM0 A;  5IGG A;  4X3U A;  5FLX E;  1I4R A;  4OXP A;  1H95 A;  1PFN A;  2E75 C;  2QF7 A;  1GUG A;  4DV5 L;  2HHH L;  3BYT B;  2ZJP A;  4K6L A;  1BNZ A;  4HMJ A;  1GOZ A;  1TWA H;  4LFB L;  1Q7Y C;  1ILP A;  4HIO A;  3GV6 A;  3NQI A;  2F0M A;  4C3I B;  4HIK A;  2XRS D;  5JAV A;  3CCR A;  3H3V I;  1EUJ A;  3TP6 A;  4JPB W;  4BY1 G;  2F03 A;  3M4O H;  1BCP C;  1Q82 C;  1F77 A;  1SNM A;  2F0O A;  2B2Y A;  3PF4 A;  5F2D A;  1NJI C;  2D0O A;  2VUM H;  3HOW G;  5I6W A;  4IUT A;  3C1F A;  1VCI A;  3S14 B;  1EEI D;  1RF2 D;  1PRT F;  3E0J A;  1JWM D;  3GTG B;  1Q1B A;  1BBX C;  1I4H A;  2B63 H;  4A3B H;  3I70 A;  4DNR B;  2ZTE A;  3FMC A;  2AHO B;  3A0J A;  1DON A;  3RLO A;  5E3F A;  3FHW A;  4OWT B;  4P71 A;  4RWS C;  4BXX H;  4DNI A;  1EQT A;  1LTI D;  1VQN A;  1BF4 A;  4RGO S;  4JI6 Q;  4KJO A;  1STN A;  1YHB A;  2NZ1 D;  2UUB L;  4RFB A;  3S15 H;  2K01 A;  1U4R A;  4FF1 A;  4YIJ A;  2NVT B;  3S9W A;  1E2V A;  4OL7 A;  4BS9 A;  3NSW A;  3HOY H;  4V0B A;  5ELO A;  2VS1 A;  4R4Q A;  1EU3 A;  1ESR A;  2B2W C;  2NB0 A;  1QZH A;  4Q0F A;  1O7L A;  2CKZ B;  3H94 A;  1HUN A;  5ELN A;  1IYU A;  4KJN A;  5JEA G;  5LL6 X;  3CCU A;  2HDM A;  2WB1 B;  3BVZ A;  2WKC A;  5JJL A;  3GTQ H;  1NY4 A;  3OYY A;  2EDG A;  4FF3 A;  5H1S E;  5J1Z A;  4MN3 A;  2IL8 A;  4DV5 Q;  2HHH Q;  1G29 1;  1IXR A;  2KED A;  3Q23 A;  2JEB I;  5DM7 3;  4LFC L;  4LFB Q;  2RSO A;  2F4I A;  3WOE A;  5KNB A;  2VY3 A;  3Q6S A;  2NUC A;  2KEE A;  4C3I G;  2UU9 L;  3D4R A;  4ZQ3 A;  1K8M A;  3HOX H;  4KD3 A;  4DK6 C;  1HJP A;  1EQR A;  1JOQ A;  1PMR A;  2N3S A;  4TRD A;  1OXS C;  1M4V A;  3FRP B;  4CDC C;  4JBK A;  3U4Z A;  4MNO A;  1ZKO A;  3GTJ B;  3M9B A;  3ND8 A;  3I72 A;  3J81 c;  3KYH C;  5KYL A;  3GTL H;  3NTK A;  4HIM A;  1EY4 A;  1QVC A;  1WD0 A;  4A93 H;  3GTO H;  3T4A C;  2EYP A;  2WB1 E;  4JBJ A;  1L2F A;  3W1B A;  5FO7 B;  4ME5 A;  3U58 A;  1G2S A;  4XT1 B;  3TZD A;  3J80 c;  3PO2 H;  2UXB Q;  1Y1W B;  4QB4 A;  1GD7 A;  5M3M G;  4OEM B;  4C2M H;  2UUB Q;  3EBE A;  1X3Q A;  3QJY A;  3D0F A;  4A3E H;  4R4T A;  5BR8 L;  4A3F G;  1KD1 C;  2A1A A;  1G91 A;  2E5L L;  2EJF C;  1B7Y B;  4UHV A;  4F8M A;  4AQY L;  2B2W A;  1WTV A;  3S1N H;  5K36 G;  4RKL A;  3MFG A;  4DAY B;  2MQH A;  1I3Q B;  2YV5 A;  2KUM A;  1A8V A;  4A76 A;  2YU9 B;  3M4Q A;  2UUA L;  5IYB H;  4FF4 A;  4DV3 L;  5C4Z A;  2EYL A;  2VL6 A;  3W1G A;  3AU7 A;  1F9Q A;  4DR1 L;  4AYB B;  1P8L A;  4PQX A;  5M5Y B;  4CJ0 B;  2V4D A;  3EQL C;  1WJJ A;  5HGQ A;  2KEC A;  4PMW A;  3MVV A;  5GAG C;  1TWA B;  1E7Z A;  1VQG A;  1SNO A;  3T16 A;  4LFC Q;  5EKK A;  3VR5 A;  4IJH A;  4QJF A;  2XWB B;  2JP1 A;  3F8T A;  1F9R A;  3QIA A;  2UU9 Q;  4CDF C;  3H3V C;  2ZTD A;  2BDN A;  3DUZ A;  1JCK B;  3M4O B;  5IP9 H;  3ULJ A;  1YBY A;  5EKL A;  3JAM E;  2EYJ A;  1X6O A;  3J80 L;  5ISR A;  3STB C;  1NMG A;  3CCV A;  2B8G A;  5M5W H;  2R7F A;  5EBC A;  1YNJ C;  2AQ3 B;  2K6A A;  1WI5 A;  3QG1 A;  1KRS A;  1WD1 A;  4A3B B;  1BR9 A;  1ZEQ X;  2J4X A;  5J22 A;  5C4X H;  5C0X H;  4OWX B;  1TXY A;  3P7J A;  1WTQ A;  3E6Z X;  4N9P A;  1EYA A;  4DR2 L;  2RBM A;  2WFW A;  4AYB E;  3H09 A;  1TS5 A;  5T1I A;  5CV5 A;  1FD7 D;  3U50 C;  1U4L A;  2A6E C;  4A4I A;  4RCN A;  3RNU A;  1Y1W G;  1TWH H;  1QNU A;  1EIY B;  1I6V C;  1TWG B;  2A5H A;  2KCM A;  4UP9 A;  3M85 A;  3S15 B;  1D8L A;  2IY5 B;  1SYE A;  2EXD A;  3MXN B;  3M4P A;  4DV0 L;  1KNE A;  5BR8 Q;  5JVH 3;  3HOY B;  4A3L H;  4CKB A;  3F1Z A;  4TVA B;  2E5L Q;  1WFQ A;  3KDF A;  4NDX A;  4AQY Q;  4OX9 L;  2ALY B;  4P75 A;  4R4C A;  1STA A;  3S2H H;  4H7B A;  2R7Z G;  5IOC A;  3A8I E;  1RD9 D;  1NUC A;  1VQC A;  4KV6 A;  3NBI A;  2O5J C;  2UUA Q;  2EY5 A;  5IGD A;  4DV3 Q;  1SNQ A;  1K8A C;  3IAY A;  3A55 A;  2A8V A;  4A3I B;  2P5Z X;  1I4G A;  3GTQ B;  1KXL A;  4DAP A;  4DR1 Q;  3W3A A;  1BQQ T;  4OO1 H;  4L6T B;  4C3H B;  1H9J A;  2R93 G;  1PYS B;  5IYC H;  1J9O A;  2I5M X;  2R92 G;  2C9O A;  1C9O A;  3AEV A;  3TRZ A;  1B4O A;  1K3B C;  2IW3 A;  4CBV A;  4RKB A;  5FO8 B;  5I2Y A;  5BN4 A;  1KAA A;  3HOX B;  4YCV A;  1PFB A;  2OEO A;  3CQZ H;  3FEW X;  1BCP D;  4O1N A;  2L0C A;  1SDF A;  3I4M G;  2NVY H;  4B9W A;  2K4K A;  2VUM G;  1Q81 C;  1S5D D;  3VR6 A;  5CYU A;  5I6Y A;  4DR4 L;  2HCI A;  2NN6 H;  4YCW A;  2F0N A;  1PRT D;  4ULL A;  1IYJ B;  3PO3 G;  2F0P A;  3MXU A;  4LAA A;  1QVF A;  3GTL B;  5HUR A;  4IUV A;  1GO3 E;  2B63 G;  1MJC A;  3ER0 A;  4A3B G;  4A93 B;  3W2D A;  4EQN A;  3GTO B;  5FOB B;  1EFI D;  4IFD I;  1K8G A;  2JYO A;  2RF4 A;  4H0L C;  4DR2 Q;  1LT3 D;  1MD2 D;  2R7D A;  5COR A;  3PO2 B;  4IUQ A;  3S1Q H;  3SE0 A;  1PTO C;  3EFX D;  4MTK A;  4BBR B;  5FLM H;  4ZYS A;  4ALP A;  1PH7 A;  4C2M B;  1JIC A;  4JI5 L;  4BBS H;  2X69 A;  4OGQ C;  2HIX A;  4A3E B;  2DJF C;  2KCN A;  4DV0 Q;  4DV7 L;  3TN2 A;  4IN3 A;  4X3S A;  4CDD C;  4HMI A;  4LWC A;  1MI2 A;  2DGY A;  3NHH A;  4OX9 Q;  2JA5 G;  5LMN L;  1N34 Q;  3S1N B;  2QGQ A;  1PZI D;  3KLS A;  3A5Z B;  4XQN A;  4EQP A;  4GLA C;  3TS2 A;  1B44 D;  1TWC H;  4GOP C;  1ZYR C;  3KUP A;  4BY7 H;  4KHZ A;  3KFU A;  2NWG A;  1XNR L;  4OIK A;  1MHW C;  4RCO A;  1QB5 D;  2LMC B;  3KLW A;  1DYQ A;  1CQV A;  1EYG A;  2PW7 A;  4A3D H;  1D5M C;  2RHS B;  3C1E A;  3K8A A;  5I9P A;  2JJQ A;  3N6R A;  2CCZ A;  3S14 H;  4LF6 L;  3V05 A;  1IW7 D;  2R6G A;  3R3O A;  2K05 A;  3MXP A;  3K0Y A;  1XXG A;  1CFM A;  1LAB A;  3ULP A;  3HOX G;  3ERO A;  1EOT A;  4WRD A;  5ELD A;  1WYD A;  3G7L A;  1RTN A;  2PZT A;  4AIM A;  2JA8 H;  5IWA L;  2JEA I;  1I6H H;  3SGI A;  5A35 A;  5M5W B;  2PQA A;  4QIW B;  5A2Q E;  2X6G A;  1YHA A;  3R8B A;  2WP8 J;  3VR4 A;  1IL8 A;  1CUK A;  2RVL A;  3MA2 B;  2HQL A;  3HEJ A;  2IX1 A;  2NVT H;  2NZO A;  4A93 G;  4RGN A;  5C4X B;  2ZXP A;  3ZJY C;  4L5R C;  2E2D C;  1LTG D;  1YIT A;  2B39 A;  4Q5V A;  3MHB A;  1WTH A;  1H9S B;  2QKI C;  2OCE A;  1P16 A;  1HA5 A;  3DMU A;  3NTH A;  4HED A;  1V43 A;  4GZY C;  3GTK H;  1PZJ D;  4G7O C;  4JI5 Q;  3G71 A;  1JB3 A;  4WJ4 A;  4A3E G;  3F2U A;  4JK1 C;  2PI2 A;  1F2Y A;  4DV7 Q;  2I5H A;  4DR7 L;  3J7Z C;  3F2D A;  1SRU A;  3HKZ B;  3FP9 A;  1G8Z D;  3S2H B;  5LMN Q;  4DNT B;  1NAP A;  2Q2T A;  1SBB B;  4GOP A;  2Q2H A;  4QIW E;  4J6H A;  5IYB G;  1XNR Q;  3PUW A;  5EKI A;  1AFP A;  4RGT A;  1HQR D;  1DJR D;  4A3C H;  2K5W A;  1Q46 A;  1HR0 L;  1M90 C;  2XSC A;  1CKN A;  3KBX A;  2L15 A;  4PV1 C;  3M4Y A;  3W5O A;  1PZK D;  2SNM A;  1CKO A;  1Q86 C;  1NSN S;  4NXM L;  3AQQ A;  4IQZ A;  1HNW L;  3VYR A;  1BCP B;  3SK6 A;  2F0K A;  4QF4 A;  1K73 C;  2XNA C;  3CQZ B;  1Q8K A;  3A54 A;  5IP9 G;  2QEX A;  3TME A;  5EQ0 A;  3U9O A;  2GVB A;  1YNN C;  3K5L A;  3I55 A;  2NVY B;  3OW2 A;  2ID0 A;  3K80 C;  4QY7 A;  1PRT B;  5IWA Q;  1LTR D;  4HTH A;  3FPU B;  3HKZ E;  2VXW A;  3SR1 A;  3NBH B;  3FVQ A;  1WCM G;  3SDZ A;  4F7X A;  4JBM A;  2F0J A;  3K81 C;  1SYD A;  3M3Y H;  4Y52 H;  4GNX B;  1Z47 A;  3BVM A;  1C0A A;  2I0Q A;  5C4X G;  4B3S L;  4B9X A;  4FF2 A;  1NMF A;  2AUK A;  2KVM A;  4UP7 A;  1SN8 A;  1MSG A;  3KF8 A;  2M9V A;  2Q8I B;  5CV6 A;  1C7Y A;  2A6E D;  3S1Q B;  2XVS A;  3D8G A;  3RZD H;  5JJI A;  3M7N A;  3VA7 A;  3BDC A;  3QOL A;  5I4D A;  1Y8N B;  4BBS B;  3IFD A;  5LMN W;  1V1Q A;  2EPB A;  4ZKB B;  3S1M H;  4A3L G;  2H4O A;  5D3D A;  5M5Y H;  3IL8 A;  4HCE A;  4DR7 Q;  1WTO A;  1VQB A;  1A3U A;  1O7Y A;  3S24 A;  1X3P A;  4K2L A;  4JBW A;  1FVI A;  3CXC A;  2QA4 A;  3TP7 A;  4NMZ A;  1K9M C;  1A2T A;  4KY6 A;  5FKA C;  5E4W C;  1TWC B;  4X6A H;  1LAC A;  4YCU A;  3CPF A;  2PO4 A;  1LT5 D;  4BY7 B;  2KJX A;  3HGB A;  1VQ6 A;  2NVQ H;  2F0I A;  3OPO A;  4DR6 L;  1BCP F;  1U4M A;  1PDQ A;  1IBM L;  4A3D B;  3NTI A;  3T53 B;  4F87 A;  1WTX A;  5EAY A;  1HZB A;  3L9A X;  4K8I A;  5KRU A;  1U0L A;  1PA6 A;  4L5S A;  2B29 A;  3NQT A;  1EEF D;  5IYC G;  4X62 L;  1ZXT A;  4JI1 L;  1E0B A;  1SEB D;  1L0W A;  1HQM C;  3FKI G;  1WVL A;  1W2B A;  2G5D A;  1Q1E A;  4NXM Q;  1MKH A;  1HNW Q;  4R1J A;  4RHR A;  1VQ7 A;  1XJV A;  4G7H C;  4MIU A;  1UE7 A;  1HA6 A;  2Y0S B;  2MJ8 A;  3F2C A;  4ZRZ A;  2RA4 A;  1PH9 A;  5ELB A;  2JA8 B;  1LTL A;  1Y1V H;  1SYB A;  2E2H H;  3T1H L;  1I6H B;  2OWO A;  2RHQ B;  1TWG H;  1V1P B;  3A8K E;  5GAD C;  2F0S A;  4JI8 L;  2D9U A;  5KGU A;  3I4N B;  2OXP A;  1VQF A;  2KHJ A;  2ASB A;  3RD4 A;  4IOA A;  1EU4 A;  4YWL A;  4DF7 A;  5IIF A;  1QWY A;  1M1K C;  4B3S Q;  1TY2 A;  1BKB A;  3S16 H;  1K0R A;  1STY A;  1VDZ A;  3VYS A;  3K0X A;  1H9K A;  1LT4 D;  3I4O A;  3BDL A;  1MGS A;  2WKD A;  3RMH A;  4LF5 L;  1SE3 A;  1FL0 A;  1D6E C;  1LTS D;  2EY1 A;  3GTK B;  5FLM G;  1F2Z A;  2RCN A;  4UDU C;  3S2D H;  5HY6 A;  2BH2 A;  1MJE A;  4BBS G;  3PIP A;  5JJZ A;  1CZG A;  3D6W A;  4A3I H;  4LK1 C;  4WFN 3;  5IP7 G;  1NR4 A;  4HSP A;  1KAB A;  1Q3L A;  1YEZ A;  4C3H H;  2I5L X;  3D4W A;  2Y0S E;  3GDE A;  3VA5 A;  2DNC A;  2YTV A;  3QWN A;  4G4K A;  1HH2 P;  4KHV A;  5KNC A;  2RKS A;  4DUY L;  1CHQ D;  2Z6B A;  1HR0 W;  4ODG A;  1F9S A;  2RDG A;  5IT9 c;  1EY6 A;  1LTB D;  2ENB A;  4HJ9 A;  4ZKC B;  3GP7 A;  5C44 H;  4DKA C;  1GUW A;  4DR6 Q;  2OT2 A;  1HTL D;  1IBM Q;  4A3D G;  4JYA L;  1S5B D;  1SMY C;  5IGE A;  2B3G A;  1B2T A;  4HSV A;  3HOV B;  1LUZ A;  1EYD A;  1QZG A;  1STE A;  1UNS A;  3RR5 A;  1HFG A;  3OWF A;  4JC0 A;  2L9H A;  3CCM A;  4GLX A;  1BVS A;  1GHJ A;  4X62 Q;  2KCT A;  4JI1 Q;  1VQH A;  4UPA A;  4I65 A;  5GQO A;  3LWU A;  2JA7 B;  2WAC A;  2E76 C;  4TKO B;  3L7Z C;  3HOZ B;  1QE6 A;  2Y0S G;  2VW9 A;  4G7Z C;  1JOR A;  2PCF B;  2FMC A;  3O13 A;  4O2D A;  1KC8 C;  2JA8 G;  4K14 A;  1NR2 A;  1Q90 A;  3T1H Q;  1Y69 U;  1QUQ A;  1CQF A;  1AE2 A;  3HRZ C;  4Y7N H;  3A8J E;  5TSS A;  4BBR H;  3M3Y B;  1I94 L;  4JI8 Q;  5M5X H;  1AEX A;  3KJP A;  5FLX c;  4IUN A;  1KDB A;  2F0V A;  2HQE A;  1S5F D;  2CVR A;  4M1U B;  1I50 H;  4N8X 1;  2EYM A;  5E4X A;  2BE5 D;  1G2T A;  2D62 A;  4H13 C;  3PGZ A;  4X3K A;  3GQB A;  3UI2 A;  5IT9 L;  4B3M L;  4LF5 Q;  4FXD A;  1VS0 A;  4JV5 L;  3RZD B;  4H02 A;  5I9O A;  1BDO A;  1DD2 A;  4B3T L;  1XX8 A;  1IKL A;  1UEA B;  2WB1 G;  3RZO H;  4BA2 I;  1EQQ A;  3ICE A;  3CD6 A;  3KK7 A;  3ONA B;  3S1M B;  2A6H C;  2DY8 A;  1X3F A;  3Q22 A;  1ASZ A;  2HT1 A;  1W6K A;  2CFM A;  3EVQ A;  1CSP A;  2ZT9 C;  1PH4 A;  1GVP A;  4KY7 A;  3R2I A;  4HJA A;  3ULL A;  3SVM A;  3J81 L;  5C4J H;  1KIX A;  1XMQ L;  4R9W A;  1WTR A;  3PUX A;  1J8I A;  4OHJ A;  3L3O C;  4DUY Q;  3HG9 A;  1E2Z A;  4LNQ A;  1MSH A;  2NVQ B;  4DK3 C;  1KAW A;  1SE4 A;  1II3 A;  1UE1 A;  3P20 A;  1E3P A;  1W3S A;  4A3C G;  2N55 A;  2ZXR A;  2L5T A;  1HNX L;  4LFA L;  5AFW A;  4JYA Q;  3KLS X;  2JN4 A;  3VR2 A;  4RGM A;  1JT8 A;  1X32 A;  3X3N A;  4C3J H;  5FLX L;  1X55 A;  2LS0 1;  2F0W A;  3MFY A;  3WDN A;  4YHH L;  4C1N K;  1N36 L;  4JI2 L;  1RCV D;  3NPP A;  4QUF A;  1YZ6 A;  1DZ1 A;  4K5W A;  4ZAI A;  2N88 A;  4K8J A;  4O0A A;  4A3J H;  4A3K B;  4EQ5 A;  1Y1V B;  2OF1 A;  2BOS A;  2E2H B;  2VQE L;  2AKW B;  1AW7 A;  2WIN B;  2E2J H;  1Q8I A;  3IFT A;  1EY0 A;  1EY5 A;  1WOC A;  4CJ2 C;  2Q2U A;  2NBF A;  1I94 Q;  1SFO H;  3CC2 A;  1HCZ A;  3AB9 A;  1PYB A;  3G6J B;  1XTC D;  1WTP A;  2RSN A;  3PIO A;  1XTD A;  1EIH A;  4IO9 A;  3S16 B;  2K33 A;  3Q8D A;  3NP8 A;  3CCE A;  4ZUI A;  4ABN A;  3OWE B;  5IY0 A;  4DXG A;  3HP3 A;  4PZ6 A;  4JV5 Q;  4B3M Q;  5C0X J;  2IPK D;  4U67 3;  1ONL A;  3S2D B;  5KYI A;  3URY A;  2KEN A;  5I2X A;  1I5F A;  2VZA A;  4B3T Q;  3J7A 5;  4HCS A;  1UUP A;  4DAV A;  1TVX A;  4CHT B;  4AYB G;  2NVX B;  1SMX A;  1X3G A;  3BS1 A;  2F0T A;  1C4Q A;  3CMA A;  1TS4 A;  4LJZ C;  3CF5 A;  1G51 A;  3AMU A;  1IYV A;  1OXU A;  2E2I H;  1PLF A;  4GOP B;  2MUY A;  1A2U A;  4A3G H;  2RDF A;  1XMQ Q;  2R3Z A;  3OHX C;  2EE1 A;  2KQ3 A;  3NWS A;  5IGB A;  2WV6 D;  3LWE A;  3A74 A;  3HKS A;  3EA6 A;  3MTS A;  1NNX A;  5C44 B;  1F9P A;  3CC7 A;  4DV2 L;  2KHI A;  1XPR A;  3HOW H;  1B8A A;  3UE0 A;  5ELC A;  2B2T C;  3K59 A;  4LFA Q;  1HNX Q;  3H0G H;  4PG3 A;  3BDO A;  4DUZ L;  1G6P A;  2EVB A;  4RHS A;  2EY2 A;  2LXK A;  3J81 i;  2QDB A;  1YVC A;  4HJ5 A;  4HAE A;  2F52 A;  4YHH Q;  5HGT A;  5C5M A;  1N36 Q;  1J5E L;  4MTN A;  4JI2 Q;  3OIP A;  4HID A;  5C0X I;  3NEM A;  2PI2 E;  4KLK A;  4JCV E;  1X54 A;  3TRE A;  4EVO A;  1CA5 A;  1B70 B;  3J80 i;  4KN7 C;  4BXX G;  1XMO L;  1KHI A;  4Y7N B;  3KF6 B;  1IZ6 A;  1PTO F;  3ERS X;  1STG A;  5KND A;  5M5X B;  1GHK A;  1L1O B;  4X65 L;  1HXY D;  3AYH B;  4KTA A;  1PH6 A;  1FR3 A;  2ZM6 L;  5C5L A;  1NTG A;  3RN5 A;  4LF7 L;  4ZUJ A;  1QIL A;  3HOY G;  4OON A;  2MNA A;  1I50 B;  1DXM A;  3I2Z A;  3BZK A;  4MZ9 A;  2HCC A;  4IPH A;  1SNC A;  1O7I A;  2G9D A;  2MHV A;  3A5U A;  1Y14 B;  4DAY A;  3OOC A;  4XTC S;  1QCB D;  3TP5 A;  2F0G A;  3CC4 A;  2UXD L;  1TS2 A;  4J8Q A;  4YWK A;  4DV1 L;  4R8I A;  4FDB A;  3JAM c;  2XGT A;  4QL5 A;  2N49 A;  4EGV A;  3MWY W;  3RZO B;  4A3I G;  1RL2 A;  1FGU A;  2JK8 A;  3V2T A;  4NW2 A;  3BZD B;  3CCQ A;  4V19 0;  3RLN A;  1GUS A;  1KLU D;  2PZW A;  3DWA A;  4C3H G;  4OO1 I;  3D3R A;  3D4D A;  4JI3 L;  4PNY A;  1KTK A;  2J0T D;  3TBI B;  2QCP X;  5C4J B;  3K7A H;  5JPM C;  4RAU C;  2Z1C A;  3PUZ A;  1S4Z A;  1YNX A;  2K28 A;  2VB2 X;  2K50 A;  2B2U C;  3S17 B;  4JW0 A;  4DV2 Q;  3IKJ A;  2B2T A;  3NUC A;  2RDH A;  5CV7 A;  2K04 A;  1VQE A;  4H44 C;  2B8F A;  1EFW A;  3GTM H;  1D5X C;  1SMY D;  4APV A;  3PUY A;  1H9R A;  4NB3 A;  4DUZ Q;  4DR4 Q;  3EJI A;  2L55 A;  3LNN A;  4J15 A;  5AJ3 L;  4C3J B;  5JOB A;  1WTW A;  4LF8 L;  2XWJ B;  3B6Y A;  3K5M A;  2EQS A;  1AP0 A;  3VYU A;  1RTO A;  2Z8L A;  5EGT A;  4FVM A;  1JJG A;  3TDQ A;  3I4N H;  5FJ8 H;  2L12 A;  2OQK A;  1B9N A;  3P1H A;  1J5E Q;  1LO5 D;  1K83 H;  4HN7 A;  3DXJ C;  4A3J B;  4GKK L;  1N9W A;  4L63 B;  2XTI A;  2F0Q A;  3D31 A;  1X65 A;  2DJG C;  3PO2 G;  2M00 A;  2E2J B;  2A68 C;  1XMO Q;  5M3M H;  3JAM L;  1V1O A;  4BBR G;  4LUO A;  4DXF A;  2EZV A;  3MXN A;  1VQ4 A;  1SFO B;  3OIQ A;  1F2M A;  4X64 L;  2ZM6 Q;  1SJE D;  1LTA D;  4LF7 Q;  2UXC L;  1ET9 A;  2RQX A;  2LKV A;  5DAU A;  5M3F B;  3SHL A;  2Z9H A;  1GM5 A;  1AN8 A;  1N33 L;  1I4Q A;  1TT2 A;  5E7N A;  5J3B A;  2N78 A;  1VF7 A;  2HIV A;  2BH8 A;  1DGS A;  1PXU A;  1JMC A;  1SJH D;  2K5N A;  5FO9 B;  1V8Q A;  1TQO A;  2UXD Q;  4IZ8 A;  4DV1 Q;  1VQD A;  4L5T A;  4KKT A;  1L0Y B;  2IHF A;  1QOH A;  2DUD A;  3VYT A;  4LW1 A;  2A69 C;  1JWU D;  2VB3 X;  1EY7 A;  3V96 A;  2D0P A;  2PQE A;  3HOV H;  1KL9 A;  2HD3 A;  3H91 A;  2K5Q A;  4ID6 A;  5EPJ A;  4JI3 Q;  2ATW A;  3E9H A;  2E2I B;  2K32 A;  3MXG A;  4DU9 A;  4LUZ A;  1K3R A;  5CGK A;  4LF6 Q;  4MHE A;  5T1G A;  4LF4 L;  4A3G B;  2PW5 A;  3OSO A;  3UDX A;  3H3V H;  3RLF A;  2K03 A;  2EIF A;  5IGC A;  2O4X A;  1YJW A;  1YJ9 A;  2JA7 H;  2B2U A;  5DEH A;  3ZYY X;  4CKC A;  3DWQ A;  2Q8T A;  2L4N A;  3RUZ A;  3HOZ H;  4C56 C;  2KA7 A;  2MPM A;  3HOW B;  4U68 A;  3E0E A;  3I3C A;  1HUM A;  3H0G B;  3STB D;  1HTP A;  4K5V A;  4ZLT F;  2YYZ A;  5BN3 A;  4M8A A;  5AJ3 Q;  4C3J G;  4EX5 A;  2WII B;  4FO2 A;  1YNJ D;  4S3S A;  4LF8 Q;  1VF5 C;  5C3X A;  4IAL A;  4DK0 A;  1PV4 A;  4CGY B;  1RIP A;  2ICE C;  5C0X G;  5C3E H;  1VQM A;  4GLV B;  4CKE A;  2ICI A;  2K52 A;  2IHE A;  1IBK L;  2IWH A;  2O2L D;  4A3J G;  1PH3 A;  3HOU H;  4DN4 M;  4FYD A;  1T5X D;  4R4I A;  4RMF A;  1CA6 A;  2QEJ C;  2IJ0 A;  2CW0 C;  3I73 A;  4K0K L;  1JQY D;  2ZJR A;  3T56 B;  4I7A A;  1VQO A;  4GN4 B;  1UAP A;  1XPO A;  1R4Q B;  4X64 Q;  1XYI A;  1HRJ A;  5DLQ E;  3L0O A;  1U4P A;  1OXV A;  3QR8 A;  3HKZ G;  1CTM A;  1PYW D;  3SK4 A;  1N33 Q;  1E2W A;  3CP0 A;  5CBA E;  1HFN A;  3AFP A;  2FIN B;  3TP8 A;  3J80 E;  2AWO A;  4A75 A;  3U9S A;  4GS3 A;  4JI0 L;  3E9I A;  1GUO A;  4P74 A;  5LMU L;  2FMM A;  2BA0 A;  2X6L A;  2L11 A;  2E8G A;  4I7Z C;  4XQJ A;  4B3R L;  2F0D A;  5D65 A;  2R93 H;  2K14 A;  1HR0 Q;  5LHY 1;  4OO1 G;  2QDL A;  2JQO A;  2R92 H;  3KJO A;  1RDP D;  3K58 A;  2A19 A;  3EIV A;  3EN2 A;  3K7A B;  1EZ6 A;  4JOI C;  4A3G G;  4QMG A;  1S5C D;  4LF4 Q;  2WAQ B;  2Q2I A;  4HJ8 A;  1OO9 B;  4C1N I;  1D1I A;  2NYZ D;  3A56 A;  5EJW A;  3CRL C;  2FFK B;  4AH6 A;  3GD7 A;  4NXN L;  3I4M H;  5G3L D;  4A3K H;  1EQV A;  4HR7 B;  3GTM B;  3SXH A;  1CZW A;  3P75 A;  4DV4 L;  1E22 A;  1PRT C;  3H0G G;  4DPG A;  3PO3 H;  1TY0 A;  2K1B A;  2NN6 G;  4DFA A;  1DOM A;  2E74 C;  3CHB D;  5FK9 C;  4XXE A;  2D5D A;  2LXJ A;  5CMD A;  1FGB D;  4GNX C;  1SE8 A;  4IPD A;  4KY5 A;  3QOJ A;  3LX0 A;  3ITP A;  1K28 A;  1K83 B;  1HPC A;  2F0L A;  1Z6H A;  1JOO A;  1Y8O B;  1RJT A;  1BBW A;  1H9S A;  1IBK Q;  3CCJ A;  1JWS D;  2UXB L;  1V9P A;  3ND9 A;  5GRO A;  4BWG B;  1PFM A;  1PTO H;  2F3W A;  5M3M B;  2MFI A;  2Z4I A;  4X3T A;  1VQP A;  4EQO A;  1S3O A;  3H6M A;  1A0I A;  2KOL A;  2N8N A;  4KKS A;  4LUV A;  1PTO D;  4QUC A;  1X56 A;  4KD4 A;  4R8N A;  5E1F A;  1FYC A;  1TU2 B;  3VDY A;  4K0K Q;  4A3F B;  1A6X A;  2GVA A;  4XIG S;  2WAQ E;  5CV8 A;  1D5Z C;  4XYQ A;  5A2Q L;  2K7V A;  1QVG A;  2GN5 A;  2NVX H;  1JR0 D;  3KDF B;  4KI0 A;  1QNK A;  4POF A;  2JA5 H;  2SEB D;  3M7G A;  1D7Q A;  4RH6 A;  1JJ2 A;  5EBD A;  4IOC A;  3SEB A;  3MAQ A;  1ENC A;  4NP5 A;  1LV9 A;  2O5I C;  1A63 A;  1L0X B;  1STH A;  4JI0 Q;  4ZCK A;  4BY7 G;  1BXT A;  1ZYR D;  1EZ8 A;  3T13 A;  5LMU Q;  1SR3 A;  1ICW A;  3S1R B;  2J7Z A;  2MP1 A;  1HNZ L;  4B3R Q;  2OTJ A;  2M2L A;  2PNR C;  4K6D A;  3NWT A;  1A3V A;  2CH4 W;  4PZ7 A;  1IW7 C;  1S72 A;  4OIJ A;  4JOI A;  3TSS A;  3I91 A;  1VQ8 A;  2WAQ G;  4IUP A;  1UWV A;  2JSO A;  3C3L A;  2AMC B;  1B1Z A;  2EYO A;  1O7Z A;  5EPK A;  2F0U A;  4NXN Q;  3NXW A;  1FJG L;  3QB3 A;  2XN9 C;  1ILQ A;  5C3W A;  4DV4 Q;  2B2V C;  2F0E A;  3NBH A;  4FXG C;  2YTY A;  4LMQ D;  3R2T A;  5IYD H;  1ET6 A;  1A15 A;  1IHZ A;  4GNX A;  3TS0 A;  1CT1 D;  5IOD A;  4PZ8 A;  3UDF A;  3I4N G;  1CM9 A;  1LT6 D;  5FJ8 G;  4A3M H;  5C3E B;  2JE6 I;  4CDE C;  2PNH A;  4DA2 A;  1QG7 A;  3CU7 A;  4UY8 C;  1A62 A;  3HOU B;  3PQI A;  3R93 A;  1E1O A;  2TSS A;  1IKM A;  5JPN C;  3PV0 A;  4WJ3 M;  1PH5 A;  4DGZ A;  3OTO L;  1IBL L;  3PUV A;  1VMP A;  2R61 A;  2CWP A;  5DNF A;  2A68 D;  4K2K A;  3KOJ A;  1XNQ L;  1K8O A;  4JVZ A;  1VQL A;  3U4V A;  1A3T A;  1TKW B;  3DEP A;  2L1B A;  1X3E A;  3CKI B;  1C48 A;  3BVG A;  1BO0 A;  1PH1 A;  3SK5 A;  1PH2 A;  1YI2 A;  2R7Z B;  1TS3 A;  2TMP A;  1ENA A;  2CQO A;  2PZU A;  4DAM A;  3KBG A;  2FHT A;  1I4P A;  3TQY A;  5CC4 A;  1PVO A;  2JA6 H;  3IRB A;  1U9R A;  1FNU A;  3S17 H;  3K57 A;  4IUU A;  2R93 B;  1HNZ Q;  1EL0 A;  2A69 D;  2R92 B;  1EWI A;  3HOV G;  3VR3 A;  1AZQ A;  2CHB D;  1EWC A;  3E5S A;  2IX0 A;  3OMC A;  5C6A A;  1I4X A;  3CRK C;  1KDA A;  1SSO A;  4DR3 L;  3C46 A;  3RN2 A;  1VQA A;  1SXT A;  2JA7 G;  3FPP A;  1CKM A;  1SRO A;  5D3I B;  3BZC A;  4DK1 A;  3HOZ G;  3I4M B;  3MEF A;  2NTS A;  2VUM B;  1DM0 B;  2ZTC A;  2DN8 A;  2ES2 A;  1YNN D;  1FJG Q;  2C35 B;  1WCM H;  2B2V A;  2Q8R E;  3PIP 3;  2PQA B;  3K5N A;  2OTL A;  2KCC A;  3PO3 B;  4P73 A;  4E6I A;  1V1P A;  4XT3 B;  4NKL A;  2AQ1 B;  2B63 B;  5ELE A;  1OXX K;  4OEL B;  4G57 A;  5JVG 3;  2AUJ D;  4X66 L;  1R9T H;  4IFD H;  2H1E A;  3CAM A;  5C3E G;  4QCL A;  1LTT D;  2Z0S A;  5M9O A;  2EJG C;  5IE8 A;  3L2P A;  5M3F H;  1EOV A;  5NUC A;  2SOB A;  2LY7 A;  3HOU G;  1NE3 A;  1KQS A;  5C4H A;  5KEE A;  1PTO B;  1HZA A;  2SDF A;  3OTO Q;  1IBL Q;  5IGF A;  1U5K A;  4KN4 C;  4FP5 D;  1TWF H;  2MGS A;  2A74 C;  2CW0 D;  1BBU A;  1XNQ Q;  1EIF A;  2F0H A; 
#chains in the Genus database with same CATH homology
 1BOS A;  3C2P A;  2BDO A;  1SYG A;  2ZXO A;  3J7Y W;  1JC7 A;  2JA5 B;  1JE4 A;  1HHV A;  1LLR D;  4WOR A;  1ESF A;  4XQQ A;  4IFD J;  1DOK A;  1H9M A;  2G9H D;  3Q0A A;  5D14 A;  2F0F A;  3HS0 C;  4J1M A;  3K6O A;  4XDX A;  2NTT A;  4PMB A;  4KK7 A;  5CV9 A;  5G3L F;  2PPB C;  1ML0 D;  1EY9 A;  5COY A;  3I8Z A;  3I4L A;  1B3A A;  2BCO A;  2FJ2 A;  3QO2 A;  1SAP A;  3OW7 A;  4FNF A;  1FNW A;  1S5E D;  1W6J A;  2DNE A;  2EYF A;  4ILW A;  4F88 A;  4KKU A;  1EWH A;  1C8C A;  3D6C A;  3OMG A;  2DY7 A;  1Q12 A;  1SE2 A;  1SNP A;  1T5E A;  2I46 A;  4XYO A;  1EYC A;  5EPL A;  1R4P B;  1ENF A;  4A3M B;  1G6Z A;  1CHP D;  4ZK9 B;  1SYF A;  1O78 A;  3I90 A;  1QJO A;  3T51 B;  1M8A A;  1EIG A;  3MC0 B;  3Q24 A;  5JEA H;  3PMF A;  4Z9C B;  3A7A B;  3J7A F;  5CR3 A;  5J39 A;  1EY8 A;  3GV3 A;  2HDL A;  3DHQ A;  5LL6 S;  1NCV A;  2SNS A;  4TQU S;  1B50 A;  3NK9 A;  4FXK C;  4RA8 A;  3TZU A;  2C5C A;  2BA1 A;  1SND A;  2D2C C;  3A7L A;  1ROD A;  3DM1 A;  2JA6 B;  4BA1 I;  1DCZ A;  4UAI A;  3KLR A;  5JEA J;  2EJM A;  3ERQ A;  5K5P A;  3J7A V;  3PIO 3;  2NN6 I;  1FNV A;  2EXZ A;  4K5X A;  3K5O A;  4O42 A;  1OXT A;  5KIX A;  1RKN A;  2XIW A;  2PMZ B;  1VMC A;  2JXM B;  1TII D;  2HUG A;  2GA4 B;  2Z4H A;  1GJX A;  3MEH A;  1CK1 A;  1WCM B;  1XWE A;  3N52 A;  4B08 A;  2I07 B;  1DOL A;  3MZ5 A;  2EOT A;  1R9T B;  3HZX A;  3NE5 B;  2BE5 C;  2EYH A;  1F2L A;  1MBY A;  5CBE E;  1SYC A;  1GUN A;  5K36 H;  1B53 A;  1KDC A;  4N9T A;  1TWH B;  4L8J A;  1TWF B;  3GO5 A;  2VNU D;  1AZP A;  3DWP A;  2A6H D;  4WJW A;  1B9M A;  1KNA A;  3GTP B;  2PYK A;  2F1M A;  5BN5 A;  3WOF A;  2LFN A;  4BY1 B;  1KLG D;  1O80 A;  3X3M A;  2CQA A;  3FDT A;  2B2Y C;  2KHS A;  5DM6 3;  3DEO A;  3FKI B;  4P2C B;  2EY6 A;  5ELF A;  2XRQ D;  5IT9 E;  2A73 B;  5CV4 A;  2IX3 A;  2AWN A;  2IT1 A;  2K5D A;  2AQ2 B;  1BUV T;  1GUT A;  2F3V A;  3SK8 A;  4TSS A;  1TR5 A;  1D2B A;  1Z7T A;  1GXD C;  1Y8P B;  3J81 E;  4KMU C;  1RHP A;  4IFD G;  1JOK A;  4CJ1 B;  4PMC A;  3BG3 A;  1D1K A;  4IUR A;  1STB A;  3BYY B;  2QIL A;  1CI3 M;  5IGG A;  4X3U A;  5FLX E;  1I4R A;  1PFN A;  2E75 C;  2QF7 A;  1GUG A;  3BYT B;  4K6L A;  1BNZ A;  4HMJ A;  1GOZ A;  1ILP A;  3GV6 A;  3NQI A;  2F0M A;  4C3I B;  2XRS D;  5JAV A;  3TP6 A;  2F03 A;  1BCP C;  1F77 A;  1SNM A;  2F0O A;  2B2Y A;  5F2D A;  5I6W A;  4IUT A;  3C1F A;  1VCI A;  3S14 B;  1EEI D;  1RF2 D;  1PRT F;  3E0J A;  1JWM D;  3GTG B;  1Q1B A;  1BBX C;  1I4H A;  3I70 A;  4DNR B;  3FMC A;  1DON A;  5E3F A;  4RWS C;  1EQT A;  1LTI D;  1BF4 A;  4RGO S;  4KJO A;  1STN A;  2NZ1 D;  4RFB A;  2K01 A;  1U4R A;  4FF1 A;  4YIJ A;  2NVT B;  3S9W A;  1E2V A;  4OL7 A;  4BS9 A;  3NSW A;  4V0B A;  1EU3 A;  1ESR A;  2B2W C;  2NB0 A;  4Q0F A;  1O7L A;  3H94 A;  1HUN A;  1IYU A;  4KJN A;  5JEA G;  5LL6 X;  2HDM A;  2WB1 B;  3BVZ A;  2WKC A;  2EDG A;  4FF3 A;  5J1Z A;  4MN3 A;  2IL8 A;  1G29 1;  2KED A;  3Q23 A;  2JEB I;  5DM7 3;  2RSO A;  2F4I A;  3WOE A;  5KNB A;  3Q6S A;  2NUC A;  2KEE A;  4C3I G;  3D4R A;  4ZQ3 A;  1K8M A;  4KD3 A;  1JOQ A;  1PMR A;  4TRD A;  1OXS C;  1M4V A;  3FRP B;  1ZKO A;  3GTJ B;  3ND8 A;  3I72 A;  5KYL A;  3NTK A;  1EY4 A;  1WD0 A;  3T4A C;  2EYP A;  5FO7 B;  4ME5 A;  1G2S A;  4XT1 B;  3TZD A;  1Y1W B;  4QB4 A;  1X3Q A;  3QJY A;  1G91 A;  2EJF C;  4F8M A;  2B2W A;  1WTV A;  5K36 G;  4RKL A;  3MFG A;  1I3Q B;  2KUM A;  2YU9 B;  4FF4 A;  5C4Z A;  2EYL A;  3AU7 A;  1F9Q A;  4AYB B;  4PQX A;  5M5Y B;  4CJ0 B;  2V4D A;  3EQL C;  2KEC A;  4PMW A;  3MVV A;  1TWA B;  1SNO A;  3T16 A;  5EKK A;  3VR5 A;  2XWB B;  2JP1 A;  3QIA A;  1F9R A;  3H3V C;  2BDN A;  3DUZ A;  1JCK B;  3M4O B;  5EKL A;  3JAM E;  2EYJ A;  3J80 L;  5ISR A;  2B8G A;  5EBC A;  1YNJ C;  2AQ3 B;  2K6A A;  3QG1 A;  1WD1 A;  4A3B B;  1BR9 A;  1ZEQ X;  2J4X A;  5J22 A;  5C0X H;  3P7J A;  1WTQ A;  3E6Z X;  4N9P A;  1EYA A;  2RBM A;  3H09 A;  1TS5 A;  5T1I A;  5CV5 A;  1FD7 D;  1U4L A;  2A6E C;  4RCN A;  1QNU A;  1I6V C;  1TWG B;  2A5H A;  3M85 A;  3S15 B;  1SYE A;  1KNE A;  5JVH 3;  3HOY B;  4CKB A;  4NDX A;  1STA A;  4H7B A;  5IOC A;  3A8I E;  1RD9 D;  1NUC A;  4KV6 A;  3NBI A;  2O5J C;  2EY5 A;  5IGD A;  1SNQ A;  3IAY A;  3A55 A;  4A3I B;  1I4G A;  3GTQ B;  4DAP A;  3W3A A;  1BQQ T;  4OO1 H;  4L6T B;  4C3H B;  1H9J A;  1J9O A;  2C9O A;  1B4O A;  2IW3 A;  4CBV A;  4RKB A;  5FO8 B;  5I2Y A;  5BN4 A;  1KAA A;  3HOX B;  1PFB A;  2OEO A;  3FEW X;  1BCP D;  4O1N A;  2L0C A;  1SDF A;  4B9W A;  1S5D D;  3VR6 A;  5CYU A;  5I6Y A;  2HCI A;  2NN6 H;  2F0N A;  1PRT D;  4ULL A;  2F0P A;  3MXU A;  4LAA A;  3GTL B;  5HUR A;  4IUV A;  4A93 B;  3W2D A;  4EQN A;  3GTO B;  5FOB B;  1EFI D;  4IFD I;  2JYO A;  4H0L C;  1LT3 D;  1MD2 D;  5COR A;  3PO2 B;  4IUQ A;  3SE0 A;  1PTO C;  3EFX D;  4BBR B;  4ZYS A;  4C2M B;  1JIC A;  2X69 A;  4OGQ C;  4A3E B;  2KCN A;  3TN2 A;  4IN3 A;  4X3S A;  4HMI A;  1MI2 A;  3NHH A;  3S1N B;  1PZI D;  3KLS A;  4XQN A;  4EQP A;  1B44 D;  1ZYR C;  3KUP A;  4KHZ A;  2NWG A;  4OIK A;  4RCO A;  1QB5 D;  2LMC B;  1DYQ A;  1CQV A;  2PW7 A;  1D5M C;  3C1E A;  5I9P A;  3N6R A;  3V05 A;  1IW7 D;  2R6G A;  3R3O A;  2K05 A;  3MXP A;  3K0Y A;  1XXG A;  1CFM A;  1LAB A;  3ERO A;  1EOT A;  4WRD A;  5ELD A;  3G7L A;  1RTN A;  2PZT A;  2JEA I;  5A35 A;  5M5W B;  4QIW B;  5A2Q E;  2X6G A;  3R8B A;  2WP8 J;  3VR4 A;  1IL8 A;  2RVL A;  3MA2 B;  3HEJ A;  2IX1 A;  5C4X B;  4RGN A;  2ZXP A;  2E2D C;  1LTG D;  2B39 A;  4Q5V A;  3MHB A;  1H9S B;  2QKI C;  1HA5 A;  3DMU A;  3NTH A;  4HED A;  1V43 A;  4GZY C;  1PZJ D;  4G7O C;  1JB3 A;  3F2U A;  4JK1 C;  1F2Y A;  3HKZ B;  1G8Z D;  3S2H B;  4DNT B;  1NAP A;  1SBB B;  4J6H A;  3PUW A;  5EKI A;  1AFP A;  4RGT A;  1HQR D;  1DJR D;  2K5W A;  2XSC A;  3KBX A;  4PV1 C;  3M4Y A;  1PZK D;  2SNM A;  1NSN S;  4IQZ A;  3VYR A;  1BCP B;  3SK6 A;  2F0K A;  4QF4 A;  2XNA C;  3CQZ B;  3A54 A;  3TME A;  5EQ0 A;  3U9O A;  1YNN C;  3K5L A;  2NVY B;  2ID0 A;  1PRT B;  1LTR D;  4HTH A;  3FPU B;  3SR1 A;  2VXW A;  3FVQ A;  3SDZ A;  4F7X A;  2F0J A;  1SYD A;  1Z47 A;  3BVM A;  4B9X A;  4FF2 A;  2AUK A;  2KVM A;  1MSG A;  3KF8 A;  2M9V A;  2Q8I B;  5CV6 A;  3S1Q B;  2A6E D;  2XVS A;  3D8G A;  3M7N A;  3VA7 A;  5I4D A;  3BDC A;  3QOL A;  1Y8N B;  4BBS B;  3IFD A;  2EPB A;  4ZKB B;  2H4O A;  5D3D A;  3IL8 A;  4HCE A;  1WTO A;  1A3U A;  1O7Y A;  1X3P A;  4K2L A;  4JBW A;  3TP7 A;  4NMZ A;  1A2T A;  4KY6 A;  5FKA C;  5E4W C;  1TWC B;  1LAC A;  2PO4 A;  1LT5 D;  4BY7 B;  2KJX A;  3HGB A;  2F0I A;  3OPO A;  1BCP F;  1U4M A;  1PDQ A;  4A3D B;  3NTI A;  3T53 B;  4F87 A;  1WTX A;  3L9A X;  4K8I A;  5KRU A;  3NQT A;  1EEF D;  1ZXT A;  1E0B A;  1SEB D;  1HQM C;  1WVL A;  1Q1E A;  4RHR A;  4G7H C;  4MIU A;  1HA6 A;  2Y0S B;  2MJ8 A;  4ZRZ A;  2RA4 A;  5ELB A;  2JA8 B;  1SYB A;  1I6H B;  1V1P B;  3A8K E;  2F0S A;  2D9U A;  5KGU A;  3I4N B;  2OXP A;  3RD4 A;  1EU4 A;  4DF7 A;  5IIF A;  1QWY A;  1TY2 A;  1STY A;  1VDZ A;  3VYS A;  1H9K A;  1LT4 D;  3BDL A;  1MGS A;  2WKD A;  3RMH A;  1SE3 A;  1D6E C;  1LTS D;  2EY1 A;  3GTK B;  1F2Z A;  4UDU C;  5JJZ A;  1CZG A;  3D6W A;  4LK1 C;  4WFN 3;  1NR4 A;  4HSP A;  1KAB A;  1Q3L A;  3D4W A;  3VA5 A;  2DNC A;  3QWN A;  4G4K A;  4KHV A;  5KNC A;  2RKS A;  1CHQ D;  4ODG A;  1F9S A;  2RDG A;  1EY6 A;  1LTB D;  2ENB A;  4ZKC B;  3GP7 A;  1GUW A;  2OT2 A;  1HTL D;  1S5B D;  1SMY C;  5IGE A;  1B2T A;  4HSV A;  3HOV B;  1EYD A;  1STE A;  1UNS A;  1HFG A;  3OWF A;  2L9H A;  1GHJ A;  4I65 A;  3LWU A;  2JA7 B;  2WAC A;  2E76 C;  4TKO B;  3L7Z C;  3HOZ B;  1QE6 A;  4G7Z C;  1JOR A;  2PCF B;  2FMC A;  3O13 A;  4K14 A;  1NR2 A;  1Q90 A;  1Y69 U;  1CQF A;  3HRZ C;  3A8J E;  5TSS A;  3M3Y B;  1AEX A;  4IUN A;  1KDB A;  2F0V A;  2HQE A;  1S5F D;  2CVR A;  4M1U B;  2EYM A;  5E4X A;  2BE5 D;  1G2T A;  2D62 A;  4H13 C;  4X3K A;  3GQB A;  3UI2 A;  5IT9 L;  4FXD A;  3RZD B;  5I9O A;  1BDO A;  1DD2 A;  1XX8 A;  1IKL A;  1UEA B;  4BA2 I;  3KK7 A;  3ONA B;  3S1M B;  2A6H C;  2DY8 A;  3Q22 A;  1W6K A;  3EVQ A;  2ZT9 C;  4KY7 A;  3R2I A;  3SVM A;  3J81 L;  4R9W A;  1WTR A;  3PUX A;  1J8I A;  4OHJ A;  3L3O C;  3HG9 A;  1E2Z A;  1MSH A;  2NVQ B;  1SE4 A;  1II3 A;  3P20 A;  2N55 A;  2ZXR A;  2L5T A;  5AFW A;  3KLS X;  3VR2 A;  4RGM A;  1X32 A;  3X3N A;  5FLX L;  2LS0 1;  2F0W A;  3MFY A;  3WDN A;  4C1N K;  1RCV D;  3NPP A;  4QUF A;  1DZ1 A;  4K5W A;  4ZAI A;  2N88 A;  4K8J A;  4A3K B;  1Y1V B;  2OF1 A;  2BOS A;  2E2H B;  1AW7 A;  2WIN B;  1Q8I A;  3IFT A;  1EY0 A;  1EY5 A;  4CJ2 C;  2NBF A;  1HCZ A;  3AB9 A;  3G6J B;  1XTC D;  1WTP A;  2RSN A;  1EIH A;  3S16 B;  2K33 A;  3NP8 A;  4ZUI A;  4ABN A;  3OWE B;  4DXG A;  3HP3 A;  5C0X J;  2IPK D;  4U67 3;  1ONL A;  3S2D B;  5KYI A;  3URY A;  5I2X A;  4HCS A;  1UUP A;  4DAV A;  1TVX A;  4CHT B;  2NVX B;  3BS1 A;  2F0T A;  1C4Q A;  1TS4 A;  4LJZ C;  3AMU A;  1IYV A;  1OXU A;  1PLF A;  2MUY A;  1A2U A;  2RDF A;  2R3Z A;  3OHX C;  2EE1 A;  2KQ3 A;  3NWS A;  5IGB A;  2WV6 D;  3LWE A;  3EA6 A;  3MTS A;  5C44 B;  1F9P A;  5ELC A;  2B2T C;  3K59 A;  3BDO A;  2EVB A;  4RHS A;  2EY2 A;  2QDB A;  4HAE A;  5HGT A;  5C5M A;  3OIP A;  5C0X I;  1CA5 A;  4EVO A;  4KN7 C;  4Y7N B;  1PTO F;  1STG A;  5KND A;  5M5X B;  1GHK A;  1HXY D;  4KTA A;  1FR3 A;  5C5L A;  4ZUJ A;  1QIL A;  1I50 B;  1DXM A;  2HCC A;  1SNC A;  2G9D A;  2MHV A;  4DAY A;  3OOC A;  4XTC S;  1QCB D;  3TP5 A;  2F0G A;  1TS2 A;  4J8Q A;  4R8I A;  4EGV A;  3MWY W;  3RZO B;  3V2T A;  4NW2 A;  3BZD B;  4V19 0;  1GUS A;  1KLU D;  2PZW A;  3DWA A;  4C3H G;  4OO1 I;  3D3R A;  3D4D A;  4PNY A;  1KTK A;  2J0T D;  3TBI B;  2QCP X;  5C4J B;  5JPM C;  4RAU C;  2Z1C A;  3PUZ A;  1S4Z A;  2K28 A;  2VB2 X;  2B2U C;  3S17 B;  3IKJ A;  2B2T A;  3NUC A;  2RDH A;  5CV7 A;  2K04 A;  4H44 C;  2B8F A;  1D5X C;  1SMY D;  3PUY A;  1H9R A;  3EJI A;  2L55 A;  3LNN A;  4C3J B;  5JOB A;  1WTW A;  2XWJ B;  3K5M A;  1AP0 A;  3VYU A;  1RTO A;  2Z8L A;  5EGT A;  4FVM A;  3TDQ A;  2L12 A;  1B9N A;  3P1H A;  1LO5 D;  4HN7 A;  3DXJ C;  4A3J B;  4L63 B;  2F0Q A;  3D31 A;  2M00 A;  2E2J B;  2A68 C;  3JAM L;  1V1O A;  4DXF A;  2EZV A;  3MXN A;  1SFO B;  3OIQ A;  1F2M A;  1SJE D;  1LTA D;  1ET9 A;  2RQX A;  2LKV A;  5DAU A;  5M3F B;  3SHL A;  1AN8 A;  1I4Q A;  1TT2 A;  1VF7 A;  1PXU A;  1SJH D;  5FO9 B;  1V8Q A;  1TQO A;  4IZ8 A;  4KKT A;  1L0Y B;  1QOH A;  3VYT A;  2A69 C;  1JWU D;  2VB3 X;  1EY7 A;  3V96 A;  2PQE A;  3H91 A;  2K5Q A;  4ID6 A;  5EPJ A;  2E2I B;  2K32 A;  3MXG A;  4DU9 A;  5CGK A;  4MHE A;  5T1G A;  4A3G B;  2PW5 A;  3OSO A;  3RLF A;  2K03 A;  5IGC A;  2O4X A;  2B2U A;  5DEH A;  3ZYY X;  4CKC A;  3DWQ A;  2Q8T A;  2L4N A;  3RUZ A;  4C56 C;  2KA7 A;  2MPM A;  3HOW B;  4U68 A;  3I3C A;  1HUM A;  3H0G B;  4ZLT F;  1HTP A;  4K5V A;  2YYZ A;  5BN3 A;  4M8A A;  4C3J G;  2WII B;  4FO2 A;  1YNJ D;  4S3S A;  1VF5 C;  5C3X A;  4IAL A;  4DK0 A;  4CGY B;  2ICE C;  5C0X G;  4CKE A;  2ICI A;  2IWH A;  2O2L D;  4DN4 M;  4FYD A;  1T5X D;  1CA6 A;  2QEJ C;  2IJ0 A;  2CW0 C;  3I73 A;  1JQY D;  3T56 B;  1UAP A;  1R4Q B;  1XYI A;  1HRJ A;  1U4P A;  1OXV A;  1CTM A;  1PYW D;  3SK4 A;  1E2W A;  5CBA E;  1HFN A;  2FIN B;  3TP8 A;  3J80 E;  2AWO A;  3U9S A;  1GUO A;  2FMM A;  2BA0 A;  2X6L A;  2L11 A;  4I7Z C;  4XQJ A;  2F0D A;  5D65 A;  5LHY 1;  4OO1 G;  1RDP D;  3K58 A;  3K7A B;  1EZ6 A;  4QMG A;  1S5C D;  2WAQ B;  1OO9 B;  4C1N I;  1D1I A;  2NYZ D;  3A56 A;  5EJW A;  3CRL C;  2FFK B;  3GD7 A;  5G3L D;  1EQV A;  4HR7 B;  3GTM B;  3SXH A;  1CZW A;  3P75 A;  1PRT C;  1TY0 A;  2K1B A;  2NN6 G;  4DFA A;  1DOM A;  2E74 C;  3CHB D;  5FK9 C;  4XXE A;  2D5D A;  5CMD A;  1FGB D;  4KY5 A;  3QOJ A;  3LX0 A;  3ITP A;  1K83 B;  1HPC A;  2F0L A;  1Z6H A;  1JOO A;  1Y8O B;  1RJT A;  1H9S A;  1JWS D;  3ND9 A;  4BWG B;  1PFM A;  1PTO H;  2F3W A;  5M3M B;  2Z4I A;  4X3T A;  4EQO A;  3H6M A;  2KOL A;  4QUC A;  4KKS A;  1PTO D;  4R8N A;  5E1F A;  4KD4 A;  1FYC A;  1TU2 B;  1A6X A;  4A3F B;  4XIG S;  5CV8 A;  1D5Z C;  4XYQ A;  5A2Q L;  2K7V A;  1JR0 D;  4KI0 A;  1QNK A;  2SEB D;  3M7G A;  4RH6 A;  5EBD A;  3SEB A;  3MAQ A;  1ENC A;  4NP5 A;  1LV9 A;  2O5I C;  1L0X B;  1STH A;  1BXT A;  1ZYR D;  1EZ8 A;  3T13 A;  1ICW A;  3S1R B;  2J7Z A;  2MP1 A;  2M2L A;  2PNR C;  4K6D A;  3NWT A;  1A3V A;  1IW7 C;  4OIJ A;  3TSS A;  3I91 A;  4IUP A;  2JSO A;  3C3L A;  1B1Z A;  2EYO A;  1O7Z A;  5EPK A;  2F0U A;  3NXW A;  3QB3 A;  2XN9 C;  1ILQ A;  5C3W A;  2B2V C;  2F0E A;  3NBH A;  4FXG C;  4LMQ D;  3R2T A;  1ET6 A;  1A15 A;  1IHZ A;  1CT1 D;  5IOD A;  1CM9 A;  1LT6 D;  5C3E B;  2JE6 I;  4DA2 A;  1QG7 A;  3CU7 A;  3HOU B;  3R93 A;  2TSS A;  1IKM A;  5JPN C;  3PV0 A;  4DGZ A;  3PUV A;  1VMP A;  2R61 A;  5DNF A;  2A68 D;  4K2K A;  1K8O A;  1A3T A;  1TKW B;  3DEP A;  2L1B A;  3CKI B;  1C48 A;  3BVG A;  1BO0 A;  3SK5 A;  2R7Z B;  1TS3 A;  2TMP A;  1ENA A;  2PZU A;  3KBG A;  2FHT A;  1I4P A;  5CC4 A;  1U9R A;  1FNU A;  3K57 A;  4IUU A;  2R93 B;  1EL0 A;  2A69 D;  2R92 B;  3VR3 A;  1AZQ A;  2CHB D;  1EWC A;  3E5S A;  2IX0 A;  3OMC A;  5C6A A;  1I4X A;  3CRK C;  1KDA A;  1SSO A;  3C46 A;  1SXT A;  3FPP A;  5D3I B;  4DK1 A;  3I4M B;  2NTS A;  2VUM B;  1DM0 B;  2DN8 A;  1YNN D;  3PIP 3;  2B2V A;  2Q8R E;  3K5N A;  2KCC A;  3PO3 B;  4E6I A;  1V1P A;  4XT3 B;  4NKL A;  2AQ1 B;  2B63 B;  5ELE A;  1OXX K;  4G57 A;  5JVG 3;  2AUJ D;  4IFD H;  2H1E A;  4QCL A;  1LTT D;  5M9O A;  2EJG C;  5NUC A;  2SOB A;  2LY7 A;  5C4H A;  5KEE A;  1PTO B;  2SDF A;  5IGF A;  4KN4 C;  4FP5 D;  2MGS A;  2A74 C;  2CW0 D;  2F0H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...