1XYIA

Hyperthermophile chromosomal protein sac7d double mutant val26ala/met29ala in complex with dna gcgatcgc
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
66
structure length
66
Chain Sequence
MVKVKFKYKGEEKEVDTSKIKKVWRAGKAVSFTYDDNGKTGRGAVSEKDAPKELLDMLARAEREKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Probing the DNA kink structure induced by the hyperthermophilic chromosomal protein Sac7d
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
molecule tags Structural protein/dna
molecule keywords 5'-D(*GP*CP*GP*AP*TP*CP*GP*C)-3'
total genus 12
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2004-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02294 7kD_DNA_binding 7kD DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1xyiA00
5CORA 1ILQA 1IL8A 1HFGA 5JJZA 5EQ0A 1U4MA 2K28A 4HAEA 1B53A 1ICWA 2VXWA 2B2TA 1QE6A 1XYIA 2JYOA 4ZKCB 2FHTA 2RVLA 1F9PA 1B4OA 2RSNA 3FPUB 4RA8A 5EJWA 2KEEA 1U4LA 1ZXTA 1G2SA 3I90A 3DM1A 1O7YA 2B2UC 1WTXA 3D6WA 4X3UA 4ZAIA 2L4NA 2KUMA 2L11A 5DNFA 2FINB 3HP3A 5CBEE 4IUVA 1EL0A 1PFNA 1GUWA 4IUUA 3H91A 2B2WA 5EKIA 1MSHA 3Q6SA 2HUGA 4O42A 2EPBA 3MTSA 4CJ0B 2L1BA 1KNEA 4LMQD 1NAPA 2X6GA 3G7LA 2J7ZA 1LV9A 3GV6A 3KBXA 4CJ1B 1C8CA 1SAPA 4IURA 1NR4A 2K01A 1SDFA 1WTRA 4QUCA 4U68A 1AZPA 2IL8A 3N52A 2MJ8A 3IL8A 1PDQA 2KVMA 5EPKA 1F9SA 1PFMA 4IUTA 4R9WA 4ZK9B 1AP0A 1ESRA 2KEDA 5CMDA 2XIWA 1BNZA 1O7ZA 3I3CA 1DZ1A 1DOLA 3LWEA 1TVXA 3QO2A 2BDNA 2HDMA 2K1BA 2M2LA 1E0BA 2EE1A 2K03A 1EIHA 4ZLTF 4IUQA 2JP1A 1BO0A 1QG7A 1HFNA 1G6ZA 1CM9A 1O80A 3I8ZA 1EOTA 1B2TA 4RAUC 2DY7A 4HEDA 2B2YC 1WD0A 1DOMA 1G2TA 1XX8A 5E4WC 1MSGA 4IUPA 2D9UA 2X6LA 3DEPA 3R93A 2Q8RE 4HSVA 4DN4M 2MPMA 1X3PA 2DY8A 3GV3A 3KUPA 5CBAE 1WTPA 4XT1B 2NWGA 2Q8TA 1U4PA 1Q3LA 1ML0D 4UAIA 2CVRA 1SSOA 4X3KA 5COYA 1NCVA 5D14A 4XDXA 2L9HA 1BF4A 1RTNA 1WTVA 1CA6A 1G91A 3P7JA 2B2WC 3MWYW 1ILPA 4MHEA 1WVLA 1VMCA 2FMMA 1PLFA 2R3ZA 1DOKA 2HDLA 2NZ1D 4HCSA 1EQTA 3FDTA 1IKMA 1HA6A 1VMPA 1S4ZA 2RSOA 4QUFA 5D65A 1U4RA 1KNAA 1NR2A 1JICA 1RODA 2N88A 5AFWA 1HRJA 1HHVA 2B2TC 4XT3B 1MGSA 2NYZD 4R8IA 2KECA 2HCIA 2MP1A 4RWSC 1RTOA 2EOTA 1F9RA 1X32A 2SDFA 1A15A 3SVMA 1WD1A 1M8AA 4NW2A 1B50A 1QNKA 3TZDA 5E4XA 5EPJA 4X3SA 1PFBA 2B2UA 2B2YA 2K05A 5T1GA 1AZQA 1BBXC 4X3TA 1J8IA 3F2UA 2FFKB 4ZKBB 1F9QA 1MI2A 1RHPA 2L12A 1EIGA 2RA4A 2X69A 2KOLA 2FJ2A 1B3AA 1J9OA 3DEOA 1WTWA 3ONAB 2HCCA 1HUNA 2N55A 4OIKA 4CJ2C 2H1EA 2K04A 2MGSA 3TN2A 1WTQA 3I91A 3UI2A 2B2VA 1WTOA 1JE4A 1F2LA 1X3QA 4MN3A 4OIJA 1IKLA 5EPLA 1HUMA 1RJTA 2B2VC 1CA5A 1DONA 5T1IA 3IFDA
chains in the Genus database with same CATH superfamily
1B1ZA 4X66Q 4HAEA 4EQOA 2XVSA 4N9TA 4A76A 4EGVA 4HIMA 4YWLA 1TWHB 5M3FB 3R3OA 1KLGD 2F0MA 1OXUA 1GUTA 4A3KG 4DAYA 1VS0A 2XSCA 1FL0A 1EEFD 2B2WA 4B3ML 3IFTA 1KNEA 1I3QB 3S1MH 1JE5A 1STGA 1D5ZC 3RN5A 4J15A 4BY1B 3J7ZC 3OYYA 4IO9A 1HZ9A 1PDQA 4R9WA 2EQSA 5LMNQ 3I4NB 4G4KA 2KEDA 5DEHA 2B63H 1FGBD 3CP0A 1QUQB 3HS0C 2M2LA 1B70B 4P71A 2K03A 2KHSA 1U9RA 3Q0AA 3SGIA 5LHY1 3A5UA 2AQ2B 2NB0A 3DWAA 1G6ZA 1CM9A 2Z4IA 1EOTA 2PI2E 1KTKA 3IRBA 1DOMA 3OWEB 5E4WC 1X54A 2NN6H 4K5XA 1VQGA 4MTNA 4QIWE 4JVZA 3ICEA 2DY8A 3S9WA 4C56C 3CF5A 1XMOL 3GTGH 2ZTCA 5EPJA 4BBSB 4JI1Q 1DYQA 3RZOB 3HOWH 1RTNA 1Y69U 1PZID 1CA6A 3D0FA 2B2WC 4CKEA 2G9HD 4MHEA 4C3IH 2R3ZA 5M3MG 2NZ1D 1PTOD 2PZTA 1QZHA 5C3EG 1NR2A 1HRJA 2RBMA 1HR0W 1IBLL 2CW0D 3HGBA 2ZXOA 4L5QA 4RWSC 4DV1L 4JI2L 2IWHA 1M8AA 1L0WA 4GNXA 2Z1CA 4QY7A 1AZQA 2K05A 3A56A 3D31A 5CV8A 4ZKBB 1PTOB 4P74A 1SYBA 1SNMA 4LF9Q 3S14H 4NXNL 2FJ2A 1J9OA 4QJFA 2HCCA 1LLRD 3U9OA 5KYLA 1BKBA 1K3BC 1MKHA 2VUMB 3PO3G 5FLXc 3QB3A 1QVGA 3VR6A 3E3XA 4POGA 4HSPA 3MXGA 1HUMA 1SEBD 1M1KC 4L5TA 5CC4A 2BA1A 3BDLA 1EQQA 2UU9Q 3JAML 2VXWA 3VA5A 4YHHQ 2MQHA 2ZJPA 4A3FB 1PH5A 1MHWC 2WKDA 2BH2A 4A3GH 3AQQA 4K2LA 5IGEA 2FINB 3BZDB 4IUVA 3HOXB 2WB1B 5D3DA 4DXFA 1PMRA 3HKZB 1N33Q 4FF1A 3GTMB 1JJCB 1V1QA 4JOIC 3M3YB 3GV6A 1SAPA 3S24A 4AYBG 4A3CG 4OO1I 1AEXA 5FO9B 1AP0A 2EYFA 2C35B 1BNZA 1N9WA 1W6JA 5FLMG 3FEWX 1XNQQ 5I6WA 4XYQA 1EIHA 1JOOA 4KHVA 1O80A 1HNXQ 1D1IA 5IE8A 4LAAA 2NZHA 4LF5L 1RL2A 3OIPA 3NBHA 3H0GG 4OX9Q 3DHQA 2IT1A 1D7QA 3TMEA 3P1HA 4CKCA 2Q8RE 3WWVA 3EQLC 4UAIA 2EYLA 3HFZB 1TS4A 3K0YA 3BVMA 2EZVA 4TKOB 2PMZE 1YNNC 1LTRD 3C2PA 4L8JA 1PLFA 4B9WA 4M8AA 3X3MA 3P20A 2CWPA 3KOJA 2ZXRA 1D5XC 2N88A 4HJ8A 4IJHA 2Q8IB 4OO1H 4DXGA 2E2HB 2PQEA 4IUNA 1AE3A 2TMPA 3OMCA 3D4RA 2B29A 1F9RA 1X32A 2SDFA 3KLSA 3M7GA 3SE0A 4B3TQ 2O5IC 4KTAA 5A35A 1G51A 3DLLA 3K0XA 1AFPA 1Y8PB 3M9BA 3J80L 2VQEL 3NBIA 2XRSD 3VA7A 5M5XB 4OHJA 5G3LF 1TWFH 2SNSA 4PG3A 5FJ8H 2QILA 2K6AA 1A3TA 4ZRZA 2UUAQ 1YJWA 1CKOA 1J5EL 2UU9L 2V1CC 1PH3A 4JYAL 4A3BH 4OIJA 2PCFB 1PRTD 1TS5A 2BOSA 3U50C 1CHQD 1NMFA 3SXHA 3MXNB 2CH4W 1IL8A 1YEZA 2WAQG 1VQ6A 1QUQA 2JYOA 2FHTA 3JAME 4QL5A 1H9RA 2WINB 5DNFA 4X64Q 4LF7Q 1YZ6A 4QIWB 1E22A 2QEJC 4HCEA 5HY6A 1XMQL 2K01A 2Q2TA 1SDFA 2IL8A 5C5LA 4EQ5A 3JAMi 2NVXH 2XIWA 2DNEA 1Z9FA 5LMUQ 1HJPA 2OTJA 1N34L 1YNXA 2PZUA 5FKAC 2RHSB 3BVGA 5IP7G 3S1NH 2ASBA 3UDIA 3T16A 1ONLA 3RNUA 2F0WA 2F0DA 4DNRB 5A2QL 3G48A 1TWCH 3HOVH 2D9UA 2KBNA 5L37A 3A8JE 1U5KA 1WTPA 3HOZB 1U4PA 4X3KA 3S2HH 1SNQA 4B08A 3VR3A 4JI3Q 1SRUA 4BBRB 3FDTA 4QGUA 3J7AF 1OXXK 1KNAA 3KF6B 2B8FA 3I55A 3L9AX 1QB5D 3H3VH 1YNJC 1VQLA 2QF7A 3PF4A 1A15A 2AHOB 2EY2A 1NMGA 4RCNA 2I5MX 5T1GA 4HMIA 3HKZG 3S17H 4CKBA 1FGUA 1TS3A 4PV1C 1Q8KA 4O0AA 4JI6L 2CQOA 1XWEA 4HJAA 4CDDC 1SE3A 3S15H 1BBUA 2D5DA 1SFOB 2Q2UA 1IXRA 3TP7A 1CQFA 3E9HA 1HNWQ 2JA6G 2BE5C 1SFOH 2K7VA 1HZAA 2B63G 2L0CA 2SNMA 5T1IA 2QDLA 4A4IA 3NELA 2I46A 2Y0SB 3H15A 4TRDA 3HG9A 2DJGC 2JA8H 3FP9A 4Y52H 2K33A 3A5ZB 1JC7A 4AQYQ 4PMBA 4JI2Q 5I4DA 2F0VA 1HR0L 1EY6A 3LNNA 2L4NA 3GTMH 2KUMA 3K7UC 1DGSA 3S16B 3T56B 3H91A 4GKKL 2HUGA 4O42A 1KAAA 3MTSA 4XQNA 2PPBC 2B39A 4JI0Q 1I5FA 4EX5A 2P5ZX 3NTIA 1HTLD 1AZPA 3N52A 2O5JC 2ZM6L 4HN7A 3URYA 4X64L 4LF7L 4RGMA 5ELCA 1E1OA 5IIFA 1EUJA 1I4QA 3QO2A 4DAPA 1GXDC 2Q2HA 3BS1A 4I7ZC 4DV4Q 1XTDA 2EVBA 2AUKA 3VYRA 4GN5A 1WCMG 1K28A 5EBDA 5M5XH 1HNWL 1B2TA 1I6HH 4DK1A 1EY4A 1KDCA 3I4LA 4BBSG 4GNXB 3W2DA 3K81C 1PZJD 1JCKB 3TRZA 1S5ED 1UE5A 1M4VA 5IGGA 1LTTD 1Q3LA 3AFQA 3H94A 1ZYRC 1C48A 2XRQD 4DR4L 1A2UA 3N6RA 4DV3Q 1HZCA 4KY5A 1VMPA 2RSOA 4DR2Q 1PTOC 2E2IH 3I4NG 3EFXD 3RN2A 2NYZD 4L63B 4DR1Q 1PH8A 1Q46A 3FKIB 2K5DA 2MP1A 4JG2A 1HTPA 4OWTB 4BY1G 1W3SA 1YBYA 3J80i 3K7AB 4C3JB 1GD7A 1B3QA 5CV7A 4CHTB 1GJXA 3AFPA 1UAPA 4WFN3 1EIFA 4LF6Q 4AIMA 4ME3A 1TY0A 1EIGA 2FXQA 4DV6L 4A3KB 3CAMA 4QB4A 2M00A 5FJ8G 2GVAA 1STEA 2F0GA 2WACA 1H9SA 1H9MA 4A3IG 1V43A 3TS2A 2EYMA 2F3VA 5GROA 3PO2G 3PV0A 1PRTC 1KAWA 1CA5A 4DAMA 2D2CC 3GTKB 4DA2A 5C4HA 4HTHA 3KF6A 5JPMC 1BR9A 2VB3X 1VQBA 4JC0A 1KABA 1MJCA 3MEFA 4KV6A 5BN4A 1O7IA 4K5VA 3CCEA 5KNCA 3ULJA 1VQKA 2E2JB 3CU7A 3FPUB 4ID6A 5IP7H 4YY3L 3QOLA 2UXDL 1U4LA 2CWAA 1XMQQ 1WTXA 5JPNC 1E2ZA 4KKUA 2D0OA 1GUWA 5JEAG 4GLVB 3BZCA 1KHIA 4JW0A 5BR8L 5M3MH 3A8IE 3CCQA 3PMFA 1MSHA 2EPBA 2EY5A 2C5CA 2AKWB 1OXTA 2JN4A 1EYAA 2F0SA 1TWAH 4A3CH 2NZOA 5EAYA 2AMCB 1EY0A 2YTVA 1TWAB 1WI5A 1GUSA 4KHZA 1Y1VG 2IPKD 3K5MA 3CCUA 1DZ1A 2HDMA 3ZYYX 5JJLA 3FVQA 1E1TA 1TXYA 3GTPH 5C5MA 4NDXA 2WAQB 4RAUC 4OGQC 4EQPA 4ZYSA 1LT5D 1PRTF 3MHBA 3PUZA 1K0RA 1SMYD 1X55A 2NVYH 5LMNW 4YCVA 5CV4A 1X3PA 1VQ8A 1Q82C 1LTID 1WTVA 2K5QA 2PI2A 5LMUL 4XXEA 1VMCA 1X56A 3GTQB 1I4XA 2F0QA 5D65A 4GZYC 4BBRH 2K5HA 2JA8G 5KNDA 2IX0A 1KDAA 4R4TA 2RQXA 3NWSA 1PH2A 2QKIC 1Y1WB 1PFBA 4X6AH 4Y7NB 1TS2A 4OWXB 1MI2A 3OSOA 2PNHA 2GN5A 4PQXA 5I9PA 3M4OB 1BCPD 1NBWA 1LACA 3S15B 1LABA 2KOLA 3S1NB 2UUBQ 4H7BA 4LW1A 1MD2D 2XWJB 4PZ8A 5GAGC 1S40A 4A3EH 4DV7Q 1B9NA 1I50B 1JJGA 4YIJA 2WIIB 4G7HC 2PQAA 2PW7A 2ZXPA 5COYA 4LFCL 1UE1A 2ZT9C 3RZOH 2GVBA 5I2YA 4JYAQ 1XYIA 1JOKA 3S1QH 3CHBD 4NPSA 3E0EA 3U4VA 1HQRD 3T4AC 2OXPA 5KRUA 1SNPA 4X3UA 3NBHB 1WFQA 1BQQT 4K2KA 4DR5L 4KHPL 4IUUA 5EGTA 5IYDG 2VS1A 3OHXC 3Q6SA 3MXNA 4P75A 3HOXH 3C3LA 2VW9A 3W1BA 4IFDH 4LFBL 4KJOA 2WB1G 1GHJA 4C3HB 5EPKA 3J81c 4I65A 4PNYA 2KENA 4C1NI 4CDFC 4A3EB 1EYGA 1Q7YC 4UP7A 1CUKA 4IALA 3T53B 1MBYA 5CV6A 4JV5L 1WYDA 4N9PA 5M5WB 2Z4HA 1PRTB 1SYFA 4X62L 5I6YA 3M85A 1IW7C 2KA7A 3G6JB 3OIQA 5M5WH 1F2MA 4DK6C 2YU9B 1XNRQ 3BYYB 4IOCA 3FMCA 1N34Q 4TSSA 2LXKA 4LK1C 2X6LA 3R93A 4IZ8A 4F88A 4NXNQ 2HIVA 3PO3B 5C0XH 3CCRA 2EYJA 4FVMA 1BF4A 4IN3A 3PO3H 5ELEA 1QOHA 4FYDA 1ENAA 1EQTA 1FNWA 1JB7A 4IPGA 4DK3C 4LFBQ 5FOBB 1RDPD 2HCIA 3F2BA 4NKLA 1MJEA 4DR6Q 1STBA 2EYHA 4DR1L 2SOBA 4R1JA 4R4QA 3O13A 2VQFQ 4DR5Q 3VDYA 5I2XA 1HPCA 4BA1I 4K14A 3CXCA 2ZTEA 2KHIA 3Q22A 1GUGA 2HD3A 3V2TA 5FLMH 2JA5B 2R7ZG 1JORA 3WDNA 1J5EQ 2Z6BA 2SEBD 2CHBD 1LYLA 1FNVA 5EPLA 2JA5H 2KQ3A 5HGQA 3D6CA 4KKTA 1PXUA 4J6HA 1S3OA 3TP5A 1L1OC 4B9XA 1UEAB 5IGCA 3FPPA 2N8NA 3EN2A 1FD7D 1O7YA 2E2HH 4C1NK 1JWSD 5IODA 1A2TA 1HXYD 2ZM6Q 3TBIB 4OXPA 1AH9A 5EKIA 1W2BA 1HCZA 4JI4L 1Y8NB 1GHKA 3GD7A 2M9VA 3CQZB 3RMHA 2F1MA 2EY6A 3S2DB 4L6TB 3CW2C 4ZK9B 5M3FG 1CZGA 5BN3A 3PIOA 3PUYA 5AJ3Q 1WCMH 1EU4A 3I3CA 3GQBA 1FJGL 1K8MA 2LFNA 2K1BA 2WV6D 4OO1G 1YJ9A 4JBKA 3BJUA 1JWUD 1XNRL 5FLXL 4POFA 2A8VA 4FDBA 1Y1WG 2K5VA 3J81E 4DAYB 3M7NA 1GM5A 1K3RA 1QVCA 4LF4L 2MPMA 1P16A 1NCVA 2OQKA 2K5WA 1I6VC 1MIUA 3P7JA 5CV9A 3TSSA 3F2CA 1ILPA 1PZKD 3B6YA 4OWWB 2FMMA 1ASZA 2WB1E 3X3NA 2KCCA 2C9OA 1S4ZA 2A69D 2EJGC 1IBML 3RD4A 3KDFB 1OO9B 2JA9A 2RF4A 4RKBA 2VUMG 1JB3A 3C1FA 4DV3L 3ZJYC 1B9MA 3KDFA 2NTSA 1D5MC 2G5DA 4DAVA 1Y1WH 4K0KQ 4IFDJ 2RA4A 2KCNA 1B3AA 1BUVT 1G8ZD 3U4ZA 3ONAB 5IYDH 1HUNA 2N49A 3S14B 2K04A 2A6HD 1STAA 1WTQA 4YWMA 3ERSX 1DCZA 2B2VA 1IW7D 2K32A 5C3EB 4LUZA 5D3IB 5JOBA 3K59A 4LUVA 1DONA 1DM0B 1L0YB 1SMYC 1EWHA 3SR1A 5JJZA 5EQ0A 2EYPA 2F0IA 2IW3A 1ICWA 5J3BA 2Y0SG 3D4DA 4DPGA 3BU2A 1BVSA 1O7LA 5JEAH 2RCFA 4RA8A 3PSIA 4FXKC 4J8QA 3CCMA 1T9HA 2B2UC 3NHHA 3D6WA 4JI5L 3Q23A 2L11A 1SYEA 2Z9HA 1PFNA 3A8KE 3G4SA 2Y0SE 4JI5Q 4LMQD 5KYIA 4QUCA 3A7LA 2LSSA 3K7AH 3SK4A 2CW0C 4N8FA 4C3JH 3TEHB 2A19A 4JCVE 4TVAB 1S5DD 2XN9C 1S72A 3LWEA 4DV5L 5KEEA 3STBD 4BS9A 4JBJA 3CMEA 4Z9CB 1I94L 5C3WA 4XQJA 1CK1A 2QW7A 3PIPA 3RLOA 3H3VC 1D8LA 3OW2A 2K4KA 1MSGA 4PMWA 4QMGA 4Q0FA 1I94Q 1WOCA 3PQIA 1WD0A 3HOZG 2VB2X 5D14A 3VYSA 3T1HQ 2A6HC 4GN3B 1ASYA 1G91A 1LTAD 4B3SL 3S16H 3E5SA 3E6ZX 3UE1A 3NUCA 4NXMQ 4HCSA 5K5PA 2OCEA 4RGNA 3HZXA 1VF7A 2B2TC 3NWTA 4DF7A 5E3FA 1JR0D 5IGDA 2K14A 1JWMD 2XGTA 1CI3M 2IX3A 1AN8A 2A68C 2R7ZB 2VY3A 2B2YA 4KLKA 3NP8A 4FNFA 4HMJA 5EKLA 1EY8A 3EVQA 3BDOA 3ERQA 4AH6A 2R7ZH 2F0FA 2PMZB 3F1ZA 1WTWA 4A3DG 4OEMB 2A6ED 1KDBA 1V9PA 4IOAA 2E5LL 4DNIA 1EIYB 3NQIA 2JEAI 3ND9A 1F2LA 1X3QA 3OTOL 4QQBX 1EY9A 4NMZA 5C44G 2NVTB 4DV6Q 1GKHA 3L2PA 1U4MA 4IQZA 1TWCB 3HOVB 1XNQL 1FR3A 1GO3E 1CKNA 1B4OA 5EJWA 4A3LG 1LM0A 1EFWA 4KY7A 2OTLA 5DM73 5ELFA 3UDFA 5CGKA 4K8JA 1BBWA 4K5WA 4MNOA 2A69C 2HHHL 4TQUS 1TQOA 2RKSA 2F0OA 3NEMA 3EROA 4BY7H 4K8IA 3ND8A 1NR4A 4WORA 3UE0A 5IP9G 3T1YL 1WTRA 4B3SQ 1BCPB 3L0OA 4P2CB 5GAEC 2B63B 3CPWA 3CCSA 1W6KA 4IUTA 3LX0A 4G7OC 3ER0A 3OPOA 5IWAL 1A62A 1EEID 5CYUA 4M1UB 3I4NH 4DV2L 2B8GA 2A74C 1HFNA 1KL9A 4H13C 1EYCA 1NY4A 1J6QA 4LFCQ 4IPHA 1SYDA 4GLXA 3K57A 3KBGA 4OONA 4R8NA 4A3MG 4ALPA 2VZAA 3DEPA 5C0XG 5C4ZA 5IY0A 4UY8C 4QCLA 3PUWA 3SK8A 4KY6A 5CBAE 1ML0D 2NVYB 2CVRA 4BA2I 4DGZA 1L0XB 3H0GB 3U58A 1FJGQ 3MAQA 3I70A 3TDQA 3QWNA 1EWCA 2EIFA 2IHEA 1U4RA 1JICA 2ATWA 4J1MA 1RF2D 1B8AA 1R4PB 2EYOA 2AUJD 2MUYA 4RHRA 4GOPC 1RTOA 4JI4Q 1NUCA 2Z6KA 5FK9C 1WD1A 2BA0A 3A0JA 1B50A 2JSOA 1IBLQ 3J80E 5E4XA 3M3YH 3AMUA 1C4QA 1PFSA 5BN5A 1Q81C 2KCTA 1V1OA 1BCPF 1I50H 5HGTA 2KCMA 4BXXG 1IZ6A 3CRKC 4LF5Q 2DNCA 1HNXL 2DUDA 1EU3A 4HJ7A 4KN7C 3D8GA 1H9SB 4DUYL 4L5SA 2QGQA 4A3FG 1JJ2A 2NTTA 2OWOA 4JV5Q 3S1QB 3Q8DA 4ME5A 3H0GH 3C1EA 2UUAL 4YCUA 4DV2Q 4P73A 1K83H 5IGBA 1BCPC 1EY5A 3R8BA 3KF8A 4JI7Q 3I7FA 1VQAA 3DM1A 4AYBE 2Z6KC 2UXBL 4KK7A 1KRSA 2EY1A 2L1BA 2L55A 1LTLA 3A74A 4C3HH 2J7ZA 4Y7NH 1YNND 3KBXA 3W3AA 1K73C 3NPPA 4JI3L 2FMCA 2L15A 2DJFC 2HHHQ 3KYHC 4UP9A 5C4XG 4YHHL 3GP7A 2NBFA 5C44B 1VQMA 3VYTA 2J0TD 5LL6X 4G57A 2VUMH 3ULPA 1Z7TA 3PGZA 4GOPB 1QZGA 2LXJA 1PV4A 5A2QE 4R4OA 1TWFB 1OXSC 3NSWA 4DV7L 4A3LH 1XXGA 4EVOA 1SYCA 1VQEA 3MVVA 2RDFA 4O1NA 3OTOQ 1R4QB 1Q86C 1CSPA 4DN4M 4KKSA 3DUZA 3D3RA 1SSOA 4A3MH 2F0EA 3QIAA 4JOIA 1U0LA 2E76C 4RCOA 1VQOA 4C3HG 5IT9E 1EFID 2HQEA 4O2DA 2H5XA 4HIDA 4XIGS 1V1PA 5G3LD 1OTCA 3MFYA 1I4GA 1BOSA 1IKMA 3U9SA 2JJQA 3JAMc 2R93G 4R8IA 5ELDA 3MC0B 3NK9A 1PH6A 1G291 3HRZC 2NVQH 1HZBA 4JBWA 1N33L 4KN4C 2G9DA 4A3IB 3UDXA 5IGFA 4DR2L 1R9TH 1VQ9A 1N32Q 1HQMC 1F9QA 5JJIA 3DWPA 2DN8A 2N55A 1K8AC 4FF2A 1Q1EA 2YU9H 4CJ2C 1F2YA 3FHWA 2UUCQ 5GQOA 3SK6A 4C3JG 2HT1A 2LKVA 1KRTA 4FXGC 2UXCQ 4AYBB 1CZWA 5KIXA 1KC8C 1I4RA 2K28A 1B53A 5LMNL 3JC66 5IYCG 1N32L 5C0XI 2QCPX 3HOXG 1F77A 3SEBA 4HJ5A 4A3BG 3DXJC 1Y8OB 2AQ3B 2WAQE 3I4MB 4Q5VA 1A3UA 1UWVA 3BZKA 3MXPA 1LT4D 3HEJA 1NE3A 3OWFA 2ID0A 4U68A 4IJLA 4ZQ3A 2R93B 1H95A 1SXTA 5KNBA 4BY1H 2BE5D 3DWQA 2ICIA 1TY2A 1RCVD 3M4QA 2HIXA 2J4XA 5HURA 3M4OH 4JI1L 2NVXB 1CT1D 3TZUA 1JT8A 5F2DA 1QWYA 2GA4B 3K80C 3HOZH 2N78A 1KIXA 3R2IA 1CKMA 1L1OA 4XDXA 2E8GA 4H0LC 3BDCA 3GTGB 2MNAA 1WVLA 5M3MB 1DOKA 1LUZA 5IT9L 2A73B 3GTLB 5AFWA 3F8TA 3IAYA 4XT3B 1YIJA 1YITA 4GKJQ 5C4XB 2B3GA 2PYKA 1UEBA 3S2DH 1ESFA 3DM3A 4NXML 4CDEC 1I4HA 3S1RH 2E2DC 4GKJL 4A75A 2VL6A 1QNKA 1LTSD 1TKWB 3TZDA 4X3SA 1J8IA 1C9OA 2I5HA 2JEBI 2A68D 3T1HL 3S1RB 3VYUA 2BH8A 1T5XD 3BG3A 3F2DA 4QF4A 2X69A 2UXDQ 1KD1C 1NSNS 1NTGA 4A3GG 2ES2A 2ENBA 1VDZA 1YHBA 2MGSA 3TN2A 3PO2B 5DLQE 1Q90A 3HKZE 4MN3A 1SJED 1TWGH 3CRLC 3J81j 2B2VC 1ZYRD 3BVZA 5KGUA 2UUBL 1A3VA 4DV5Q 2LMCB 4FF4A 2QDBA 3M4YA 2E5LQ 5H1SE 2JK8A 1F9PA 1P8LA 4BBRG 3W5OA 1DJRD 2HQLA 2KEEA 1ZXTA 3PUXA 3RLFA 2CKZB 4LF6L 1HNZL 1NJIC 2OF1A 4LFAQ 3EIVA 2XNAC 2EXDA 4DK0A 4A93H 4ILWA 4IURA 5FO7B 3H3VI 2OQ0A 1JMCA 3EBEA 2F0PA 2PZWA 4A93G 1I4PA 1NNXA 1LT6D 1TU2B 3WOFA 1I6HB 4A3JB 2IX1A 2F0UA 1D1KA 1VQHA 5JJKA 2EE1A 3VR2A 4IUQA 2JP1A 4KJNA 5ELBA 5FO8B 4K6DA 3TQYA 4ZCKA 3HOWG 3CD6A 3MA2B 4IFDI 4IPDA 4X65L 2UXCL 2BDOA 2RCNA 3J7AV 4K0KL 3GV3A 2NWGA 1IYJB 5GAHC 4LNQA 3I72A 4GN4B 2BCOA 2L9HA 4A3GB 1A0IA 1VQIA 4DR7Q 3HOUG 3ITPA 1E2VA 5JVH3 2VNUD 1EY7A 1XPOA 4B3RL 4WJ3M 1K8GA 4ODGA 1TR5A 3KJOA 4XYOA 2K75A 3FKIH 2F0HA 1X65A 1HHVA 1MGSA 5IYCH 1QJOA 4JI0L 4R4IA 5DM63 1Z6HA 1RD9D 5NUCA 4NW2A 2F0TA 4RGOS 4E6IA 3EJIA 4BY7G 3AU7A 3MZ5A 4GLAC 3SHLA 2E74C 3QOJA 3F2UA 5IP9H 3DMUA 2ZJRA 3I56A 1AW7A 3CQZH 1RHPA 4LF4Q 2EXZA 4RHSA 3I73A 5DAUA 5I9OA 4AQYL 3GO5A 3NE5B 3D4WA 1A6XA 4OIKA 1ZKOA 3K8AA 2F4VQ 1V8QA 1SR3A 4A3KH 1RIPA 2JA6B 3UI2A 2NVTH 4UP8A 2F4VL 1RJTA 4N8X1 5IT9c 4RFBA 1N8RC 5GADC 2PNRC 1YI2A 1TWHH 2XWBB 1GUOA 4UPAA 2R7DA 2E2IB 1L1OB 3G6EA 1L2FA 1BDOA 3E9IA 1IBKL 1CKNB 3A55A 3OOCA 1XTCD 3HP3A 4F7XA 2KHJA 2CFMA 3LWUA 2NVQB 1PH4A 3I2ZA 1GOZA 4CJ0B 2X6GA 1C8CA 1B44D 3PCOB 4A3JG 1LTBD 3I4MG 4KHPQ 2AWOA 1IYVA 2KVMA 2ICEC 2EJFC 3KF8B 2QA4A 1QCBD 1EYDA 4XTCS 1ESRA 1ENCA 3TP8A 5CMDA 4FXDA 3MXUA 1O7ZA 2JA6H 5FLXE 1TVXA 3S17B 1E0BA 3M4PA 1G6PA 4BXXH 2I0QA 5CV5A 4IPCA 4LF8Q 3KLWA 4DV0L 2DY7A 4HEDA 2UUCL 1Q8IA 1SROA 2XTIA 4MTKA 1SBBB 4DV4L 2JA7G 4DKAC 4DUYQ 1EQVA 1H9KA 1K9MC 1E3PA 1O78A 1IYUA 4PZ6A 3PUVA 4JK1C 4HSVA 2VQEQ 1C0AA 2F4IA 4C2MH 4XT1B 3IKJA 4C3IB 1X3EA 3CC7A 4H44C 3J7A5 1SE8A 4KD4A 3NENA 2ZTDA 2JA8B 5TSSA 4DR6L 3BYTB 4DR3Q 2EDGA 3QG1A 4QUFA 3PIP3 3S1MB 1PH1A 4MIUA 4WRDA 1SN8A 1H9JA 3C46A 1LTGD 4KMUC 3SVMA 3NTKA 3V96A 3KK7A 1PTOH 3K58A 3SDZA 1QVFA 1CFMA 2DGYA 2L5TA 4PZ7A 2WFWA 4FO2A 4X3TA 1OXVA 5IOCA 1VQ5A 4HIKA 2F0NA 3GTPB 1PTOF 4RKLA 1VQFA 1XMOQ 3TREA 1BXTA 4MZ9A 1IKLA 1YVCA 5CORA 1ILQA 5JEAJ 3GDEA 1YNJD 1V1PB 1FNUA 5J22A 3RZDB 4ZKCB 3GTLH 1CTMA 1JQYD 2RSNA 5CR3A 1VQNA 4R4CA 2F52A 3CMAA 3GTJH 2F3IA 2CCZA 5CBEE 5IYBG 2Z8LA 3H09A 1YJNA 4JI8L 1RKNA 3HOUH 3G7LA 4GOPA 4DFAA 2LY7A 3AB9A 1D6EC 4JI7L 3PF5A 4B3MQ 1KQSA 2MJ8A 1QILA 3IL8A 5BR8Q 1EOVA 1XPUA 3VR4A 4A3JH 1KLUD 1VQ4A 4FP5D 4RG1A 3G71A 1ENFA 3P75A 4CDCC 4YY3Q 4HIOA 3PO2H 2BDNA 3K5NA 5C4JB 1CSQA 1PH9A 5C3EH 4BWGB 2I5LX 3KLRA 3J81L 1E2WA 5JAVA 1PYWD 5J1ZA 5C4JH 3FRPB 1N36L 2A1AA 4ZUIA 1A63A 2AWNA 4KD3A 2IY5B 4IUPA 4A3BB 3RZDH 2TSSA 5AJ3L 3SK5A 4A3FH 2WKCA 4JPBW 3RUZA 3KUPA 4LJZC 4LF9L 2JA7H 3GTKH 4WJ4A 1VQPA 3L7ZC 1STHA 4RMFA 3MWYW 2JA7B 3FKIG 2OEOA 4DV1Q 3STBC 1PVOA 1DD2A 2F0KA 1RODA 4ZUJA 1EZ8A 1F2ZA 2I07B 4GS3A 2JXMB 4G7ZC 1Q1BA 1STYA 1TIID 4UHVA 3MFGA 1K8OA 2EOTA 1R9TB 4DNTB 4F87A 2JE6I 1X3FA 1LT3D 5K36H 2YTXA 2L12A 4S3SA 3CCVA 2ALYB 5EBCA 1PH7A 2N3SA 1UNSA 4DR7L 2A5HA 2OT2A 2H1EA 1WCMB 5ELOA 4KI0A 2R61A 4P72A 2PQAB 4LF8L 1PYBA 1SMXA 5LL6S 3CC2A 1PHJA 4X65Q 1IL2A 1E24A 5ISRA 4IFDG 2E2JH 4GNXC 2IJ0A 2B2TA 1UUPA 1QE6A 4YCWA 1SLJA 4JBMA 3A54A 4F8MA 2JA5G 2YV5A 4B3TL 1VCIA 3T1YQ 5EKKA 3I90A 2YYZA 5C3XA 1TT2A 2R92B 1ET6A 1EL0A 1SYGA 3V05A 5C6AA 3T51B 1IHZA 3RLNA 4CGYB 5M3FH 2F0JA 2QEXA 2R92H 1IBKQ 5JVG3 2D62A 1LV9A 1C7YA 5M5YB 3I4MH 1DXMA 3HOYB 3LGJA 4GKKQ 5C4XH 1STNA 1I3QH 4BY7B 1HH2P 1PFMA 1HNZQ 1A8VA 3J80c 4DR3L 3MEHA 2MHVA 4X66L 4HJ9A 2CQAA 3KJPA 2R93H 4OX9L 3NQTA 1N36Q 1BO0A 3KLSX 1QG7A 1S5BD 3I8ZA 4X62Q 3CCLA 1UE6A 2K52A 3CPFA 3NTHA 3CC4A 1G2TA 2RDGA 3S2HB 2CH4A 1Z47A 4DV0Q 1VF5C 4HR7B 1B7YB 2O4XA 1AE2A 1SE2A 3I4OA 4C2MB 4EQNA 1X9NA 1K0SA 4BBSH 1PA6A 4PMCA 2K5NA 3HOWB 1EQRA 4A3EG 3EA6A 1T5EA 4JI8Q 5C0XJ 1XPRA 4C3IG 2R6GA 1ET9A 2KECA 2UXBQ 1GVPA 1SNCA 1YHQA 4B3RQ 2V4DA 3WOEA 1JOQA 3VR5A 1S5CD 4A93B 1LO5D 2B2UA 4ABNA 1WTHA 1II3A 2NN6G 4DU9A 4NB3A 2KJXA 5ELNA 1VQ7A 5IYBH 2F3WA 4APVA 1VQJA 3W1GA 5J39A 4L5RC 1SNOA 4RGTA 1FVIA 1UE7A 4YWKA 3CKIB 2ZJQA 2E75C 1JE4A 3AYHB 2D0PA 2EJMA 3TS0A 3GTOH 4CBVA 1HFGA 1TWGB 2IHFA 3Q24A 1WJJA 3GTOB 1ICFB 3K5LA 3QR8A 3GTQH 4OL7A 3UDGA 2RVLA 4ULLA 4K6LA 1E7ZA 1EWIA 4A3MB 1M90C 1G2SA 1S5FD 4ZAIA 3RR5A 1KXLA 3HKSA 4NP5A 3GTJB 2PO4A 1Y1VH 4V0BA 4DUZL 1NAPA 4CJ1B 5C44H 1ZEQX 4UDUC 3PIO3 1SNDA 2F0LA 1EZ6A 1FYCA 1F9SA 2RDHA 2JQOA 1X3GA 2PW5A 1HA5A 3AEVA 2NN6I 4DR4Q 4A3IH 1DOLA 1X6OA 1CHPD 2YTYA 4ZLTF 4WJWA 4U673 5E1FA 2B2YC 2NUCA 2R7FA 3HOYG 3KFUA 5K36G 1SE4A 1XX8A 1VQDA 4LWCA 2Z0SA 3H6MA 2LS01 3NXWA 3R2TA 4JI6Q 2K50A 1PYSB 2A6EC 1Q12A 5IWAQ 1K83B 3CCJA 2Q2IA 2Q8TA 2R92G 3HOVG 1YHAA 2F03A 1Y14B 2HDLA 1HA6A 5E7NA 3K6OA 1Y1VB 4H02A 3HOUB 2AQ1B 2VQFL 3L3OC 1IBMQ 3OW7A 4A3DH 1GUNA 4RH6A 4DUZQ 2H4OA 4LFAL 5M9OA 1CQVA 4I7AA 4A3DB 3E0JA 4LUOA 1BBXC 5M5YH 2FFKB 3HOYH 1SJHD 2WP8J 1HR0Q 4FF3A 2MO1A 2O2LD 1VQCA 4V190 3DEOA 3OMGA 2MFIA 4XQQA 1QNUA 3ULLA 3J7YW 3QJYA 1XJVA 3K5OA 1D2BA 3A7AB 3TP6A 3I91A 3J81i 2RHQB 1WTOA 2MO0A 3T13A 4OELB 3IFDA
chains in the Genus database with same CATH topology
1B1ZA 4HAEA 4EQOA 2XVSA 4N9TA 4EGVA 1TWHB 5M3FB 3R3OA 1KLGD 2F0MA 1OXUA 1GUTA 4DAYA 2XSCA 1EEFD 2B2WA 3IFTA 1KNEA 1I3QB 1STGA 1D5ZC 4BY1B 1PDQA 4R9WA 3I4NB 4G4KA 2KEDA 5DEHA 1FGBD 3HS0C 2M2LA 2K03A 2KHSA 1U9RA 3Q0AA 5LHY1 2AQ2B 2NB0A 3DWAA 1G6ZA 1CM9A 2Z4IA 1EOTA 1KTKA 1DOMA 3OWEB 5E4WC 2NN6H 4K5XA 2DY8A 3S9WA 4C56C 5EPJA 4BBSB 1DYQA 3RZOB 1RTNA 1Y69U 1PZID 1CA6A 2B2WC 4CKEA 2G9HD 4MHEA 2R3ZA 2NZ1D 1PTOD 2PZTA 1NR2A 1HRJA 2RBMA 2CW0D 3HGBA 2ZXOA 4RWSC 2IWHA 1M8AA 2Z1CA 1AZQA 2K05A 3A56A 3D31A 5CV8A 4ZKBB 1PTOB 1SYBA 1SNMA 2FJ2A 1J9OA 2HCCA 1LLRD 3U9OA 5KYLA 2VUMB 3QB3A 3VR6A 4HSPA 3MXGA 1HUMA 1SEBD 5CC4A 2BA1A 3BDLA 3JAML 2VXWA 3VA5A 4A3FB 2WKDA 4K2LA 5IGEA 2FINB 3BZDB 4IUVA 3HOXB 2WB1B 5D3DA 4DXFA 1PMRA 3HKZB 4FF1A 3GTMB 3M3YB 3GV6A 1SAPA 4OO1I 1AEXA 5FO9B 1AP0A 2EYFA 1BNZA 1W6JA 3FEWX 5I6WA 4XYQA 1EIHA 1JOOA 4KHVA 1O80A 1D1IA 4LAAA 3OIPA 3NBHA 3DHQA 2IT1A 3TMEA 3P1HA 4CKCA 2Q8RE 3EQLC 4UAIA 2EYLA 1TS4A 3K0YA 3BVMA 2EZVA 4TKOB 1YNNC 1LTRD 3C2PA 4L8JA 1PLFA 4B9WA 4M8AA 3X3MA 3P20A 2ZXRA 1D5XC 2N88A 2Q8IB 4OO1H 4DXGA 2E2HB 2PQEA 4IUNA 2TMPA 3OMCA 3D4RA 3SE0A 1F9RA 1X32A 2SDFA 3M7GA 3KLSA 2O5IC 4KTAA 5A35A 1AFPA 1Y8PB 3J80L 3NBIA 2XRSD 3VA7A 5M5XB 4OHJA 5G3LF 2SNSA 2QILA 2K6AA 1A3TA 4ZRZA 4OIJA 2PCFB 1PRTD 1TS5A 2BOSA 1CHQD 3SXHA 1IL8A 2JYOA 2FHTA 3JAME 1H9RA 2WINB 5DNFA 4QIWB 2QEJC 4HCEA 2K01A 1SDFA 2IL8A 5C5LA 2XIWA 2DNEA 2PZUA 5FKAC 3BVGA 3T16A 1ONLA 4DNRB 2F0DA 2F0WA 5A2QL 2D9UA 3A8JE 1WTPA 3HOZB 1U4PA 4X3KA 1SNQA 4B08A 3VR3A 4BBRB 3FDTA 3J7AF 1OXXK 1KNAA 2B8FA 3L9AX 1QB5D 1YNJC 2QF7A 1A15A 2EY2A 4RCNA 5T1GA 4HMIA 4CKBA 1TS3A 4PV1C 1XWEA 1SE3A 1SFOB 2D5DA 3TP7A 1CQFA 2BE5C 2K7VA 2L0CA 2SNMA 5T1IA 2I46A 2Y0SB 4TRDA 3HG9A 2K33A 1JC7A 4PMBA 5I4DA 2F0VA 1EY6A 3LNNA 2L4NA 2KUMA 3S16B 3T56B 3H91A 2HUGA 4O42A 1KAAA 3MTSA 2PPBC 4XQNA 2B39A 3NTIA 1HTLD 1AZPA 3N52A 2O5JC 4HN7A 3URYA 4RGMA 5ELCA 5IIFA 1I4QA 3QO2A 4DAPA 1GXDC 3BS1A 4I7ZC 2EVBA 2AUKA 3VYRA 5EBDA 1B2TA 4DK1A 1EY4A 1KDCA 3I4LA 3W2DA 1PZJD 1JCKB 1S5ED 1M4VA 5IGGA 1LTTD 1Q3LA 3H94A 1ZYRC 1C48A 2XRQD 1A2UA 3N6RA 4KY5A 1VMPA 2RSOA 1PTOC 3EFXD 2NYZD 4L63B 3FKIB 2K5DA 2MP1A 1HTPA 3K7AB 4C3JB 5CV7A 4CHTB 1GJXA 1UAPA 4WFN3 1TY0A 1EIGA 4A3KB 4QB4A 2M00A 1STEA 2F0GA 2WACA 1H9SA 1H9MA 1V43A 2EYMA 2F3VA 3PV0A 1PRTC 1CA5A 2D2CC 3GTKB 4DA2A 5C4HA 4HTHA 5JPMC 1BR9A 2VB3X 1KABA 4KV6A 5BN4A 4K5VA 5KNCA 2E2JB 3CU7A 3FPUB 4ID6A 3QOLA 1U4LA 1WTXA 5JPNC 1E2ZA 4KKUA 1GUWA 5JEAG 3A8IE 3PMFA 1MSHA 2EPBA 2EY5A 2C5CA 1OXTA 1EYAA 2F0SA 1EY0A 1TWAB 1GUSA 4KHZA 3K5MA 2IPKD 1DZ1A 2HDMA 3ZYYX 3FVQA 5C5MA 4NDXA 2WAQB 4RAUC 4OGQC 4EQPA 4ZYSA 1LT5D 1PRTF 3MHBA 3PUZA 1SMYD 5CV4A 1X3PA 1LTID 1WTVA 2K5QA 4XXEA 1VMCA 3GTQB 1I4XA 2F0QA 5D65A 4GZYC 5KNDA 2IX0A 1KDAA 2RQXA 3NWSA 2QKIC 1Y1WB 1PFBA 4Y7NB 1TS2A 1MI2A 3OSOA 4PQXA 5I9PA 3M4OB 1BCPD 3S15B 1LACA 1LABA 2KOLA 3S1NB 4H7BA 1MD2D 2XWJB 1B9NA 1I50B 4YIJA 2WIIB 4G7HC 2PW7A 2ZXPA 5COYA 2ZT9C 5I2YA 1XYIA 1JOKA 3CHBD 1HQRD 3T4AC 2OXPA 5KRUA 1SNPA 4X3UA 4K2KA 1BQQT 4IUUA 5EGTA 3OHXC 3Q6SA 3MXNA 3C3LA 4IFDH 4KJOA 1GHJA 4C3HB 5EPKA 4I65A 4PNYA 4C1NI 4A3EB 4IALA 3T53B 1MBYA 5CV6A 4N9PA 5M5WB 2Z4HA 1PRTB 1SYFA 3M85A 5I6YA 1IW7C 2KA7A 3G6JB 3OIQA 1F2MA 2YU9B 3BYYB 3FMCA 4TSSA 4LK1C 2X6LA 3R93A 4IZ8A 4F88A 3PO3B 5C0XH 2EYJA 4FVMA 1BF4A 4IN3A 5ELEA 1QOHA 4FYDA 1ENAA 1EQTA 1FNWA 5FOBB 1RDPD 2HCIA 4NKLA 1STBA 2EYHA 2SOBA 3O13A 5I2XA 1HPCA 4BA1I 4K14A 3Q22A 1GUGA 3V2TA 2JA5B 1JORA 3WDNA 2SEBD 2CHBD 1FNVA 5EPLA 2KQ3A 3D6CA 4KKTA 1PXUA 4J6HA 3TP5A 4B9XA 1UEAB 5IGCA 3FPPA 1FD7D 1O7YA 4C1NK 1JWSD 5IODA 1A2TA 1HXYD 3TBIB 5EKIA 1HCZA 1Y8NB 1GHKA 3GD7A 2M9VA 3CQZB 3RMHA 2F1MA 2EY6A 3S2DB 4L6TB 4ZK9B 1CZGA 5BN3A 3PUYA 1EU4A 3I3CA 3GQBA 1K8MA 2LFNA 2K1BA 2WV6D 4OO1G 1JWUD 5FLXL 3J81E 3M7NA 2MPMA 1NCVA 2K5WA 1I6VC 3P7JA 5CV9A 3TSSA 1ILPA 1PZKD 2FMMA 3X3NA 2KCCA 2C9OA 1S4ZA 2A69D 2EJGC 3RD4A 1OO9B 4RKBA 1JB3A 3C1FA 1B9MA 2NTSA 1D5MC 4DAVA 4IFDJ 2RA4A 2KCNA 1B3AA 1BUVT 1G8ZD 3ONAB 1HUNA 3S14B 2K04A 2A6HD 1STAA 1WTQA 1DCZA 2B2VA 1IW7D 2K32A 5C3EB 5D3IB 5JOBA 3K59A 1DONA 1DM0B 1L0YB 1SMYC 1EWHA 3SR1A 5JJZA 5EQ0A 2EYPA 2F0IA 2IW3A 1ICWA 3D4DA 1O7LA 5JEAH 4RA8A 4FXKC 4J8QA 2B2UC 3NHHA 3D6WA 3Q23A 2L11A 1SYEA 1PFNA 3A8KE 4LMQD 5KYIA 4QUCA 3A7LA 3SK4A 2CW0C 1S5DD 2XN9C 3LWEA 5KEEA 4BS9A 4Z9CB 5C3WA 4XQJA 1CK1A 3H3VC 1MSGA 4PMWA 4QMGA 4Q0FA 1WD0A 2VB2X 5D14A 3VYSA 2A6HC 1G91A 1LTAD 3E5SA 3E6ZX 3NUCA 4HCSA 5K5PA 4RGNA 3HZXA 1VF7A 2B2TC 3NWTA 4DF7A 5E3FA 1JR0D 5IGDA 1JWMD 1CI3M 2IX3A 1AN8A 2A68C 2R7ZB 2B2YA 3NP8A 4FNFA 4HMJA 5EKLA 1EY8A 3BDOA 3EVQA 3ERQA 2F0FA 2PMZB 1WTWA 2A6ED 1KDBA 3NQIA 2JEAI 3ND9A 1F2LA 1X3QA 1EY9A 4NMZA 2NVTB 1U4MA 4IQZA 1TWCB 3HOVB 1FR3A 1B4OA 5EJWA 4KY7A 5DM73 5ELFA 5CGKA 4K8JA 4K5WA 2A69C 4TQUS 1TQOA 2RKSA 2F0OA 3EROA 4K8IA 3ND8A 1NR4A 4WORA 1WTRA 1BCPB 4P2CB 2B63B 1W6KA 4IUTA 3LX0A 4G7OC 3OPOA 1EEID 5CYUA 4M1UB 2B8GA 2A74C 1HFNA 4H13C 1EYCA 1SYDA 3K57A 3KBGA 4R8NA 3DEPA 5C0XG 5C4ZA 4QCLA 3PUWA 3SK8A 4KY6A 5CBAE 1ML0D 2NVYB 2CVRA 4BA2I 4DGZA 1L0XB 3H0GB 3MAQA 3I70A 3TDQA 3QWNA 1EWCA 1U4RA 1JICA 4J1MA 1RF2D 1R4PB 2EYOA 2AUJD 2MUYA 4RHRA 1RTOA 1NUCA 5FK9C 1WD1A 2BA0A 1B50A 2JSOA 3J80E 5E4XA 3AMUA 1C4QA 5BN5A 1V1OA 1BCPF 5HGTA 3CRKC 2DNCA 1EU3A 4KN7C 3D8GA 1H9SB 2NTTA 3S1QB 4ME5A 3C1EA 5IGBA 1BCPC 1EY5A 3R8BA 3KF8A 3DM1A 4KK7A 2EY1A 2L1BA 2L55A 2J7ZA 1YNND 3KBXA 3W3AA 3NPPA 2FMCA 3GP7A 2NBFA 5C44B 3VYTA 2J0TD 5LL6X 4G57A 1Z7TA 5A2QE 1TWFB 1OXSC 3NSWA 1XXGA 4EVOA 1SYCA 3MVVA 2RDFA 4O1NA 1R4QB 4DN4M 4KKSA 3DUZA 3D3RA 1SSOA 2F0EA 3QIAA 2E76C 4RCOA 4C3HG 5IT9E 1EFID 2HQEA 4XIGS 1V1PA 5G3LD 3MFYA 1I4GA 1BOSA 1IKMA 3U9SA 4R8IA 5ELDA 3MC0B 3NK9A 1G291 3HRZC 4JBWA 4KN4C 2G9DA 4A3IB 5IGFA 1HQMC 1F9QA 3DWPA 2DN8A 2N55A 4FF2A 1Q1EA 4CJ2C 1F2YA 3SK6A 4C3JG 2LKVA 4FXGC 4AYBB 1CZWA 5KIXA 1I4RA 2K28A 1B53A 5C0XI 2QCPX 1F77A 3SEBA 3DXJC 1Y8OB 2AQ3B 3I4MB 4Q5VA 1A3UA 3MXPA 1LT4D 3HEJA 3OWFA 4U68A 2ID0A 4ZQ3A 2R93B 1SXTA 5KNBA 2BE5D 3DWQA 2ICIA 1TY2A 1RCVD 2J4XA 5HURA 2NVXB 1CT1D 3TZUA 5F2DA 1QWYA 2GA4B 3R2IA 4XDXA 4H0LC 3BDCA 3GTGB 1WVLA 5M3MB 1DOKA 5IT9L 2A73B 3GTLB 5AFWA 3IAYA 4XT3B 5C4XB 2PYKA 1ESFA 1I4HA 2E2DC 1QNKA 1LTSD 1TKWB 3TZDA 4X3SA 1J8IA 2JEBI 2A68D 3S1RB 3VYUA 1T5XD 3BG3A 4QF4A 2X69A 1NSNS 2ENBA 1VDZA 2MGSA 3TN2A 3PO2B 1Q90A 4MN3A 1SJED 3CRLC 2B2VC 1ZYRD 3BVZA 5KGUA 1A3VA 2LMCB 4FF4A 2QDBA 3M4YA 1F9PA 1DJRD 2KEEA 1ZXTA 3PUXA 3RLFA 2OF1A 4DK0A 2XNAC 4ILWA 4IURA 5FO7B 2F0PA 2PZWA 1I4PA 1LT6D 1TU2B 3WOFA 1I6HB 4A3JB 2IX1A 2F0UA 1D1KA 2EE1A 3VR2A 4IUQA 2JP1A 4KJNA 5ELBA 5FO8B 4K6DA 4IFDI 3MA2B 2BDOA 3J7AV 3GV3A 2NWGA 3I72A 2BCOA 2L9HA 4A3GB 3ITPA 1E2VA 5JVH3 2VNUD 1EY7A 4ODGA 1TR5A 4XYOA 2F0HA 1HHVA 1MGSA 1QJOA 5DM63 1Z6HA 1RD9D 5NUCA 4NW2A 2F0TA 4RGOS 4E6IA 3EJIA 3AU7A 3MZ5A 3SHLA 2E74C 3QOJA 3F2UA 3DMUA 1AW7A 1RHPA 2EXZA 4RHSA 3I73A 5DAUA 5I9OA 3GO5A 3NE5B 3D4WA 1A6XA 4OIKA 1ZKOA 1V8QA 2JA6B 3UI2A 1RJTA 4RFBA 2PNRC 2XWBB 1GUOA 2E2IB 1BDOA 3A55A 3OOCA 1XTCD 3HP3A 4F7XA 3LWUA 2NVQB 1GOZA 4CJ0B 2X6GA 1C8CA 1B44D 1LTBD 2AWOA 1IYVA 2KVMA 2ICEC 2EJFC 1QCBD 1EYDA 4XTCS 1ESRA 1ENCA 3TP8A 5CMDA 4FXDA 3MXUA 1O7ZA 5FLXE 1TVXA 3S17B 1E0BA 5CV5A 2DY7A 4HEDA 1Q8IA 1SBBB 1EQVA 1H9KA 1O78A 1IYUA 3PUVA 4JK1C 4HSVA 2F4IA 4XT1B 3IKJA 4C3IB 4H44C 4KD4A 2JA8B 5TSSA 3BYTB 2EDGA 3QG1A 4QUFA 3PIP3 3S1MB 4MIUA 4WRDA 1H9JA 3C46A 1LTGD 4KMUC 3SVMA 3NTKA 3V96A 3KK7A 1PTOH 3K58A 3SDZA 1CFMA 2L5TA 4FO2A 4X3TA 1OXVA 5IOCA 2F0NA 3GTPB 1PTOF 4RKLA 1BXTA 1IKLA 5CORA 1ILQA 5JEAJ 1YNJD 1V1PB 1FNUA 5J22A 3RZDB 4ZKCB 1CTMA 1JQYD 2RSNA 5CR3A 5CBEE 2Z8LA 3H09A 1RKNA 3G7LA 4DFAA 2LY7A 3AB9A 1D6EC 2MJ8A 1QILA 3IL8A 3VR4A 1KLUD 4FP5D 1ENFA 3P75A 2BDNA 3K5NA 5C4JB 4BWGB 3KLRA 3J81L 1E2WA 5JAVA 1PYWD 5J1ZA 3FRPB 4ZUIA 2AWNA 4KD3A 4IUPA 4A3BB 2TSSA 3SK5A 2WKCA 3RUZA 3KUPA 4LJZC 3L7ZC 1STHA 3MWYW 2JA7B 2OEOA 1DD2A 2F0KA 1RODA 4ZUJA 1EZ8A 1F2ZA 2I07B 2JXMB 4G7ZC 1STYA 1TIID 1Q1BA 3MFGA 1K8OA 2EOTA 1R9TB 4DNTB 4F87A 2JE6I 1LT3D 5K36H 2L12A 4S3SA 5EBCA 1UNSA 2A5HA 2OT2A 2H1EA 1WCMB 4KI0A 2R61A 5LL6S 5ISRA 4IFDG 2IJ0A 2B2TA 1UUPA 1QE6A 3A54A 4F8MA 1VCIA 5EKKA 3I90A 2YYZA 5C3XA 1TT2A 2R92B 1ET6A 1EL0A 1SYGA 3V05A 5C6AA 3T51B 1IHZA 4CGYB 2F0JA 5JVG3 2D62A 1LV9A 5M5YB 1DXMA 3HOYB 1STNA 4BY7B 1PFMA 3MEHA 2MHVA 2CQAA 3NQTA 1BO0A 3KLSX 1QG7A 1S5BD 3I8ZA 3NTHA 1G2TA 2RDGA 3S2HB 1Z47A 1VF5C 4HR7B 2O4XA 1SE2A 4C2MB 4EQNA 4PMCA 3HOWB 3EA6A 1T5EA 5C0XJ 4C3IG 2R6GA 1ET9A 2KECA 1SNCA 2V4DA 3WOEA 1JOQA 3VR5A 1S5CD 4A93B 1LO5D 2B2UA 4ABNA 1II3A 2NN6G 4DU9A 2KJXA 2F3WA 5J39A 1SNOA 4RGTA 3CKIB 2E75C 1JE4A 2EJMA 4CBVA 1HFGA 1TWGB 3Q24A 3GTOB 3K5LA 4OL7A 2RVLA 4ULLA 4K6LA 4A3MB 1G2SA 1S5FD 4ZAIA 4NP5A 3GTJB 2PO4A 4V0BA 1NAPA 4CJ1B 1ZEQX 4UDUC 3PIO3 1SNDA 2F0LA 1EZ6A 1FYCA 1F9SA 2RDHA 2PW5A 1HA5A 2NN6I 1DOLA 1CHPD 4ZLTF 4WJWA 4U673 5E1FA 2B2YC 2NUCA 5K36G 1SE4A 1XX8A 3H6MA 3NXWA 2LS01 3R2TA 2A6EC 1Q12A 1K83B 2Q8TA 2F03A 2HDLA 1HA6A 3K6OA 1Y1VB 3HOUB 2AQ1B 3L3OC 3OW7A 1GUNA 4RH6A 2H4OA 5M9OA 1CQVA 4A3DB 3E0JA 1BBXC 2FFKB 1SJHD 2WP8J 4FF3A 2O2LD 4V190 3DEOA 3OMGA 4XQQA 1QNUA 3J7YW 3QJYA 3K5OA 1D2BA 3A7AB 3TP6A 3I91A 1WTOA 3T13A 3IFDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5COR A;  1ILQ A;  1IL8 A;  1HFG A;  5JJZ A;  5EQ0 A;  1U4M A;  2K28 A;  4HAE A;  1B53 A;  1ICW A;  2VXW A;  2B2T A;  1QE6 A;  1XYI A;  2JYO A;  4ZKC B;  2FHT A;  2RVL A;  1F9P A;  1B4O A;  2RSN A;  3FPU B;  4RA8 A;  5EJW A;  2KEE A;  1U4L A;  1ZXT A;  1G2S A;  3I90 A;  3DM1 A;  1O7Y A;  2B2U C;  1WTX A;  3D6W A;  4X3U A;  4ZAI A;  2L4N A;  2KUM A;  2L11 A;  5DNF A;  2FIN B;  3HP3 A;  5CBE E;  4IUV A;  1EL0 A;  1PFN A;  1GUW A;  4IUU A;  3H91 A;  2B2W A;  5EKI A;  1MSH A;  3Q6S A;  2HUG A;  4O42 A;  2EPB A;  3MTS A;  4CJ0 B;  2L1B A;  1KNE A;  4LMQ D;  1NAP A;  2X6G A;  3G7L A;  2J7Z A;  1LV9 A;  3GV6 A;  3KBX A;  4CJ1 B;  1C8C A;  1SAP A;  4IUR A;  1NR4 A;  2K01 A;  1SDF A;  1WTR A;  4QUC A;  4U68 A;  1AZP A;  2IL8 A;  3N52 A;  2MJ8 A;  3IL8 A;  1PDQ A;  2KVM A;  5EPK A;  1F9S A;  1PFM A;  4IUT A;  4R9W A;  4ZK9 B;  1AP0 A;  1ESR A;  2KED A;  5CMD A;  2XIW A;  1BNZ A;  1O7Z A;  3I3C A;  1DZ1 A;  1DOL A;  3LWE A;  1TVX A;  3QO2 A;  2BDN A;  2HDM A;  2K1B A;  2M2L A;  1E0B A;  2EE1 A;  2K03 A;  1EIH A;  4ZLT F;  4IUQ A;  2JP1 A;  1BO0 A;  1QG7 A;  1HFN A;  1G6Z A;  1CM9 A;  1O80 A;  3I8Z A;  1EOT A;  1B2T A;  4RAU C;  2DY7 A;  4HED A;  2B2Y C;  1WD0 A;  1DOM A;  1G2T A;  1XX8 A;  5E4W C;  1MSG A;  4IUP A;  2D9U A;  2X6L A;  3DEP A;  3R93 A;  2Q8R E;  4HSV A;  4DN4 M;  2MPM A;  1X3P A;  2DY8 A;  3GV3 A;  3KUP A;  5CBA E;  1WTP A;  4XT1 B;  2NWG A;  2Q8T A;  1U4P A;  1Q3L A;  1ML0 D;  4UAI A;  2CVR A;  1SSO A;  4X3K A;  5COY A;  1NCV A;  5D14 A;  4XDX A;  2L9H A;  1BF4 A;  1RTN A;  1WTV A;  1CA6 A;  1G91 A;  3P7J A;  2B2W C;  3MWY W;  1ILP A;  4MHE A;  1WVL A;  1VMC A;  2FMM A;  1PLF A;  2R3Z A;  1DOK A;  2HDL A;  2NZ1 D;  4HCS A;  1EQT A;  3FDT A;  1IKM A;  1HA6 A;  1VMP A;  1S4Z A;  2RSO A;  4QUF A;  5D65 A;  1U4R A;  1KNA A;  1NR2 A;  1JIC A;  1ROD A;  2N88 A;  5AFW A;  1HRJ A;  1HHV A;  2B2T C;  4XT3 B;  1MGS A;  2NYZ D;  4R8I A;  2KEC A;  2HCI A;  2MP1 A;  4RWS C;  1RTO A;  2EOT A;  1F9R A;  1X32 A;  2SDF A;  1A15 A;  3SVM A;  1WD1 A;  1M8A A;  4NW2 A;  1B50 A;  1QNK A;  3TZD A;  5E4X A;  5EPJ A;  4X3S A;  1PFB A;  2B2U A;  2B2Y A;  2K05 A;  5T1G A;  1AZQ A;  1BBX C;  4X3T A;  1J8I A;  3F2U A;  2FFK B;  4ZKB B;  1F9Q A;  1MI2 A;  1RHP A;  2L12 A;  1EIG A;  2RA4 A;  2X69 A;  2KOL A;  2FJ2 A;  1B3A A;  1J9O A;  3DEO A;  1WTW A;  3ONA B;  2HCC A;  1HUN A;  2N55 A;  4OIK A;  4CJ2 C;  2H1E A;  2K04 A;  2MGS A;  3TN2 A;  1WTQ A;  3I91 A;  3UI2 A;  2B2V A;  1WTO A;  1JE4 A;  1F2L A;  1X3Q A;  4MN3 A;  4OIJ A;  1IKL A;  5EPL A;  1HUM A;  1RJT A;  2B2V C;  1CA5 A;  1DON A;  5T1I A;  3IFD A; 
#chains in the Genus database with same CATH topology
 1B1Z A;  4X66 Q;  4HAE A;  4EQO A;  2XVS A;  4N9T A;  4A76 A;  4EGV A;  4HIM A;  4YWL A;  1TWH B;  5M3F B;  3R3O A;  1KLG D;  2F0M A;  1OXU A;  1GUT A;  4A3K G;  4DAY A;  1VS0 A;  2XSC A;  1FL0 A;  1EEF D;  2B2W A;  4B3M L;  3IFT A;  1KNE A;  1I3Q B;  3S1M H;  1JE5 A;  1STG A;  1D5Z C;  3RN5 A;  4J15 A;  4BY1 B;  3J7Z C;  3OYY A;  4IO9 A;  1HZ9 A;  1PDQ A;  4R9W A;  2EQS A;  5LMN Q;  3I4N B;  4G4K A;  2KED A;  5DEH A;  2B63 H;  1FGB D;  3CP0 A;  1QUQ B;  3HS0 C;  2M2L A;  1B70 B;  4P71 A;  2K03 A;  2KHS A;  1U9R A;  3Q0A A;  3SGI A;  5LHY 1;  3A5U A;  2AQ2 B;  2NB0 A;  3DWA A;  1G6Z A;  1CM9 A;  2Z4I A;  1EOT A;  2PI2 E;  1KTK A;  3IRB A;  1DOM A;  3OWE B;  5E4W C;  1X54 A;  2NN6 H;  4K5X A;  1VQG A;  4MTN A;  4QIW E;  4JVZ A;  3ICE A;  2DY8 A;  3S9W A;  4C56 C;  3CF5 A;  1XMO L;  3GTG H;  2ZTC A;  5EPJ A;  4BBS B;  4JI1 Q;  1DYQ A;  3RZO B;  3HOW H;  1RTN A;  1Y69 U;  1PZI D;  1CA6 A;  3D0F A;  2B2W C;  4CKE A;  2G9H D;  4MHE A;  4C3I H;  2R3Z A;  5M3M G;  2NZ1 D;  1PTO D;  2PZT A;  1QZH A;  5C3E G;  1NR2 A;  1HRJ A;  2RBM A;  1HR0 W;  1IBL L;  2CW0 D;  3HGB A;  2ZXO A;  4L5Q A;  4RWS C;  4DV1 L;  4JI2 L;  2IWH A;  1M8A A;  1L0W A;  4GNX A;  2Z1C A;  4QY7 A;  1AZQ A;  2K05 A;  3A56 A;  3D31 A;  5CV8 A;  4ZKB B;  1PTO B;  4P74 A;  1SYB A;  1SNM A;  4LF9 Q;  3S14 H;  4NXN L;  2FJ2 A;  1J9O A;  4QJF A;  2HCC A;  1LLR D;  3U9O A;  5KYL A;  1BKB A;  1K3B C;  1MKH A;  2VUM B;  3PO3 G;  5FLX c;  3QB3 A;  1QVG A;  3VR6 A;  3E3X A;  4POG A;  4HSP A;  3MXG A;  1HUM A;  1SEB D;  1M1K C;  4L5T A;  5CC4 A;  2BA1 A;  3BDL A;  1EQQ A;  2UU9 Q;  3JAM L;  2VXW A;  3VA5 A;  4YHH Q;  2MQH A;  2ZJP A;  4A3F B;  1PH5 A;  1MHW C;  2WKD A;  2BH2 A;  4A3G H;  3AQQ A;  4K2L A;  5IGE A;  2FIN B;  3BZD B;  4IUV A;  3HOX B;  2WB1 B;  5D3D A;  4DXF A;  1PMR A;  3HKZ B;  1N33 Q;  4FF1 A;  3GTM B;  1JJC B;  1V1Q A;  4JOI C;  3M3Y B;  3GV6 A;  1SAP A;  3S24 A;  4AYB G;  4A3C G;  4OO1 I;  1AEX A;  5FO9 B;  1AP0 A;  2EYF A;  2C35 B;  1BNZ A;  1N9W A;  1W6J A;  5FLM G;  3FEW X;  1XNQ Q;  5I6W A;  4XYQ A;  1EIH A;  1JOO A;  4KHV A;  1O80 A;  1HNX Q;  1D1I A;  5IE8 A;  4LAA A;  2NZH A;  4LF5 L;  1RL2 A;  3OIP A;  3NBH A;  3H0G G;  4OX9 Q;  3DHQ A;  2IT1 A;  1D7Q A;  3TME A;  3P1H A;  4CKC A;  2Q8R E;  3WWV A;  3EQL C;  4UAI A;  2EYL A;  3HFZ B;  1TS4 A;  3K0Y A;  3BVM A;  2EZV A;  4TKO B;  2PMZ E;  1YNN C;  1LTR D;  3C2P A;  4L8J A;  1PLF A;  4B9W A;  4M8A A;  3X3M A;  3P20 A;  2CWP A;  3KOJ A;  2ZXR A;  1D5X C;  2N88 A;  4HJ8 A;  4IJH A;  2Q8I B;  4OO1 H;  4DXG A;  2E2H B;  2PQE A;  4IUN A;  1AE3 A;  2TMP A;  3OMC A;  3D4R A;  2B29 A;  1F9R A;  1X32 A;  2SDF A;  3KLS A;  3M7G A;  3SE0 A;  4B3T Q;  2O5I C;  4KTA A;  5A35 A;  1G51 A;  3DLL A;  3K0X A;  1AFP A;  1Y8P B;  3M9B A;  3J80 L;  2VQE L;  3NBI A;  2XRS D;  3VA7 A;  5M5X B;  4OHJ A;  5G3L F;  1TWF H;  2SNS A;  4PG3 A;  5FJ8 H;  2QIL A;  2K6A A;  1A3T A;  4ZRZ A;  2UUA Q;  1YJW A;  1CKO A;  1J5E L;  2UU9 L;  2V1C C;  1PH3 A;  4JYA L;  4A3B H;  4OIJ A;  2PCF B;  1PRT D;  1TS5 A;  2BOS A;  3U50 C;  1CHQ D;  1NMF A;  3SXH A;  3MXN B;  2CH4 W;  1IL8 A;  1YEZ A;  2WAQ G;  1VQ6 A;  1QUQ A;  2JYO A;  2FHT A;  3JAM E;  4QL5 A;  1H9R A;  2WIN B;  5DNF A;  4X64 Q;  4LF7 Q;  1YZ6 A;  4QIW B;  1E22 A;  2QEJ C;  4HCE A;  5HY6 A;  1XMQ L;  2K01 A;  2Q2T A;  1SDF A;  2IL8 A;  5C5L A;  4EQ5 A;  3JAM i;  2NVX H;  2XIW A;  2DNE A;  1Z9F A;  5LMU Q;  1HJP A;  2OTJ A;  1N34 L;  1YNX A;  2PZU A;  5FKA C;  2RHS B;  3BVG A;  5IP7 G;  3S1N H;  2ASB A;  3UDI A;  3T16 A;  1ONL A;  3RNU A;  2F0W A;  2F0D A;  4DNR B;  5A2Q L;  3G48 A;  1TWC H;  3HOV H;  2D9U A;  2KBN A;  5L37 A;  3A8J E;  1U5K A;  1WTP A;  3HOZ B;  1U4P A;  4X3K A;  3S2H H;  1SNQ A;  4B08 A;  3VR3 A;  4JI3 Q;  1SRU A;  4BBR B;  3FDT A;  4QGU A;  3J7A F;  1OXX K;  1KNA A;  3KF6 B;  2B8F A;  3I55 A;  3L9A X;  1QB5 D;  3H3V H;  1YNJ C;  1VQL A;  2QF7 A;  3PF4 A;  1A15 A;  2AHO B;  2EY2 A;  1NMG A;  4RCN A;  2I5M X;  5T1G A;  4HMI A;  3HKZ G;  3S17 H;  4CKB A;  1FGU A;  1TS3 A;  4PV1 C;  1Q8K A;  4O0A A;  4JI6 L;  2CQO A;  1XWE A;  4HJA A;  4CDD C;  1SE3 A;  3S15 H;  1BBU A;  2D5D A;  1SFO B;  2Q2U A;  1IXR A;  3TP7 A;  1CQF A;  3E9H A;  1HNW Q;  2JA6 G;  2BE5 C;  1SFO H;  2K7V A;  1HZA A;  2B63 G;  2L0C A;  2SNM A;  5T1I A;  2QDL A;  4A4I A;  3NEL A;  2I46 A;  2Y0S B;  3H15 A;  4TRD A;  3HG9 A;  2DJG C;  2JA8 H;  3FP9 A;  4Y52 H;  2K33 A;  3A5Z B;  1JC7 A;  4AQY Q;  4PMB A;  4JI2 Q;  5I4D A;  2F0V A;  1HR0 L;  1EY6 A;  3LNN A;  2L4N A;  3GTM H;  2KUM A;  3K7U C;  1DGS A;  3S16 B;  3T56 B;  3H91 A;  4GKK L;  2HUG A;  4O42 A;  1KAA A;  3MTS A;  4XQN A;  2PPB C;  2B39 A;  4JI0 Q;  1I5F A;  4EX5 A;  2P5Z X;  3NTI A;  1HTL D;  1AZP A;  3N52 A;  2O5J C;  2ZM6 L;  4HN7 A;  3URY A;  4X64 L;  4LF7 L;  4RGM A;  5ELC A;  1E1O A;  5IIF A;  1EUJ A;  1I4Q A;  3QO2 A;  4DAP A;  1GXD C;  2Q2H A;  3BS1 A;  4I7Z C;  4DV4 Q;  1XTD A;  2EVB A;  2AUK A;  3VYR A;  4GN5 A;  1WCM G;  1K28 A;  5EBD A;  5M5X H;  1HNW L;  1B2T A;  1I6H H;  4DK1 A;  1EY4 A;  1KDC A;  3I4L A;  4BBS G;  4GNX B;  3W2D A;  3K81 C;  1PZJ D;  1JCK B;  3TRZ A;  1S5E D;  1UE5 A;  1M4V A;  5IGG A;  1LTT D;  1Q3L A;  3AFQ A;  3H94 A;  1ZYR C;  1C48 A;  2XRQ D;  4DR4 L;  1A2U A;  3N6R A;  4DV3 Q;  1HZC A;  4KY5 A;  1VMP A;  2RSO A;  4DR2 Q;  1PTO C;  2E2I H;  3I4N G;  3EFX D;  3RN2 A;  2NYZ D;  4L63 B;  4DR1 Q;  1PH8 A;  1Q46 A;  3FKI B;  2K5D A;  2MP1 A;  4JG2 A;  1HTP A;  4OWT B;  4BY1 G;  1W3S A;  1YBY A;  3J80 i;  3K7A B;  4C3J B;  1GD7 A;  1B3Q A;  5CV7 A;  4CHT B;  1GJX A;  3AFP A;  1UAP A;  4WFN 3;  1EIF A;  4LF6 Q;  4AIM A;  4ME3 A;  1TY0 A;  1EIG A;  2FXQ A;  4DV6 L;  4A3K B;  3CAM A;  4QB4 A;  2M00 A;  5FJ8 G;  2GVA A;  1STE A;  2F0G A;  2WAC A;  1H9S A;  1H9M A;  4A3I G;  1V43 A;  3TS2 A;  2EYM A;  2F3V A;  5GRO A;  3PO2 G;  3PV0 A;  1PRT C;  1KAW A;  1CA5 A;  4DAM A;  2D2C C;  3GTK B;  4DA2 A;  5C4H A;  4HTH A;  3KF6 A;  5JPM C;  1BR9 A;  2VB3 X;  1VQB A;  4JC0 A;  1KAB A;  1MJC A;  3MEF A;  4KV6 A;  5BN4 A;  1O7I A;  4K5V A;  3CCE A;  5KNC A;  3ULJ A;  1VQK A;  2E2J B;  3CU7 A;  3FPU B;  4ID6 A;  5IP7 H;  4YY3 L;  3QOL A;  2UXD L;  1U4L A;  2CWA A;  1XMQ Q;  1WTX A;  5JPN C;  1E2Z A;  4KKU A;  2D0O A;  1GUW A;  5JEA G;  4GLV B;  3BZC A;  1KHI A;  4JW0 A;  5BR8 L;  5M3M H;  3A8I E;  3CCQ A;  3PMF A;  1MSH A;  2EPB A;  2EY5 A;  2C5C A;  2AKW B;  1OXT A;  2JN4 A;  1EYA A;  2F0S A;  1TWA H;  4A3C H;  2NZO A;  5EAY A;  2AMC B;  1EY0 A;  2YTV A;  1TWA B;  1WI5 A;  1GUS A;  4KHZ A;  1Y1V G;  2IPK D;  3K5M A;  3CCU A;  1DZ1 A;  2HDM A;  3ZYY X;  5JJL A;  3FVQ A;  1E1T A;  1TXY A;  3GTP H;  5C5M A;  4NDX A;  2WAQ B;  4RAU C;  4OGQ C;  4EQP A;  4ZYS A;  1LT5 D;  1PRT F;  3MHB A;  3PUZ A;  1K0R A;  1SMY D;  1X55 A;  2NVY H;  5LMN W;  4YCV A;  5CV4 A;  1X3P A;  1VQ8 A;  1Q82 C;  1LTI D;  1WTV A;  2K5Q A;  2PI2 A;  5LMU L;  4XXE A;  1VMC A;  1X56 A;  3GTQ B;  1I4X A;  2F0Q A;  5D65 A;  4GZY C;  4BBR H;  2K5H A;  2JA8 G;  5KND A;  2IX0 A;  1KDA A;  4R4T A;  2RQX A;  3NWS A;  1PH2 A;  2QKI C;  1Y1W B;  1PFB A;  4X6A H;  4Y7N B;  1TS2 A;  4OWX B;  1MI2 A;  3OSO A;  2PNH A;  2GN5 A;  4PQX A;  5I9P A;  3M4O B;  1BCP D;  1NBW A;  1LAC A;  3S15 B;  1LAB A;  2KOL A;  3S1N B;  2UUB Q;  4H7B A;  4LW1 A;  1MD2 D;  2XWJ B;  4PZ8 A;  5GAG C;  1S40 A;  4A3E H;  4DV7 Q;  1B9N A;  1I50 B;  1JJG A;  4YIJ A;  2WII B;  4G7H C;  2PQA A;  2PW7 A;  2ZXP A;  5COY A;  4LFC L;  1UE1 A;  2ZT9 C;  3RZO H;  2GVB A;  5I2Y A;  4JYA Q;  1XYI A;  1JOK A;  3S1Q H;  3CHB D;  4NPS A;  3E0E A;  3U4V A;  1HQR D;  3T4A C;  2OXP A;  5KRU A;  1SNP A;  4X3U A;  3NBH B;  1WFQ A;  1BQQ T;  4K2K A;  4DR5 L;  4KHP L;  4IUU A;  5EGT A;  5IYD G;  2VS1 A;  3OHX C;  3Q6S A;  3MXN A;  4P75 A;  3HOX H;  3C3L A;  2VW9 A;  3W1B A;  4IFD H;  4LFB L;  4KJO A;  2WB1 G;  1GHJ A;  4C3H B;  5EPK A;  3J81 c;  4I65 A;  4PNY A;  2KEN A;  4C1N I;  4CDF C;  4A3E B;  1EYG A;  1Q7Y C;  4UP7 A;  1CUK A;  4IAL A;  3T53 B;  1MBY A;  5CV6 A;  4JV5 L;  1WYD A;  4N9P A;  5M5W B;  2Z4H A;  1PRT B;  1SYF A;  4X62 L;  5I6Y A;  3M85 A;  1IW7 C;  2KA7 A;  3G6J B;  3OIQ A;  5M5W H;  1F2M A;  4DK6 C;  2YU9 B;  1XNR Q;  3BYY B;  4IOC A;  3FMC A;  1N34 Q;  4TSS A;  2LXK A;  4LK1 C;  2X6L A;  3R93 A;  4IZ8 A;  4F88 A;  4NXN Q;  2HIV A;  3PO3 B;  5C0X H;  3CCR A;  2EYJ A;  4FVM A;  1BF4 A;  4IN3 A;  3PO3 H;  5ELE A;  1QOH A;  4FYD A;  1ENA A;  1EQT A;  1FNW A;  1JB7 A;  4IPG A;  4DK3 C;  4LFB Q;  5FOB B;  1RDP D;  2HCI A;  3F2B A;  4NKL A;  1MJE A;  4DR6 Q;  1STB A;  2EYH A;  4DR1 L;  2SOB A;  4R1J A;  4R4Q A;  3O13 A;  2VQF Q;  4DR5 Q;  3VDY A;  5I2X A;  1HPC A;  4BA1 I;  4K14 A;  3CXC A;  2ZTE A;  2KHI A;  3Q22 A;  1GUG A;  2HD3 A;  3V2T A;  5FLM H;  2JA5 B;  2R7Z G;  1JOR A;  3WDN A;  1J5E Q;  2Z6B A;  2SEB D;  2CHB D;  1LYL A;  1FNV A;  5EPL A;  2JA5 H;  2KQ3 A;  5HGQ A;  3D6C A;  4KKT A;  1PXU A;  4J6H A;  1S3O A;  3TP5 A;  1L1O C;  4B9X A;  1UEA B;  5IGC A;  3FPP A;  2N8N A;  3EN2 A;  1FD7 D;  1O7Y A;  2E2H H;  4C1N K;  1JWS D;  5IOD A;  1A2T A;  1HXY D;  2ZM6 Q;  3TBI B;  4OXP A;  1AH9 A;  5EKI A;  1W2B A;  1HCZ A;  4JI4 L;  1Y8N B;  1GHK A;  3GD7 A;  2M9V A;  3CQZ B;  3RMH A;  2F1M A;  2EY6 A;  3S2D B;  4L6T B;  3CW2 C;  4ZK9 B;  5M3F G;  1CZG A;  5BN3 A;  3PIO A;  3PUY A;  5AJ3 Q;  1WCM H;  1EU4 A;  3I3C A;  3GQB A;  1FJG L;  1K8M A;  2LFN A;  2K1B A;  2WV6 D;  4OO1 G;  1YJ9 A;  4JBK A;  3BJU A;  1JWU D;  1XNR L;  5FLX L;  4POF A;  2A8V A;  4FDB A;  1Y1W G;  2K5V A;  3J81 E;  4DAY B;  3M7N A;  1GM5 A;  1K3R A;  1QVC A;  4LF4 L;  2MPM A;  1P16 A;  1NCV A;  2OQK A;  2K5W A;  1I6V C;  1MIU A;  3P7J A;  5CV9 A;  3TSS A;  3F2C A;  1ILP A;  1PZK D;  3B6Y A;  4OWW B;  2FMM A;  1ASZ A;  2WB1 E;  3X3N A;  2KCC A;  2C9O A;  1S4Z A;  2A69 D;  2EJG C;  1IBM L;  3RD4 A;  3KDF B;  1OO9 B;  2JA9 A;  2RF4 A;  4RKB A;  2VUM G;  1JB3 A;  3C1F A;  4DV3 L;  3ZJY C;  1B9M A;  3KDF A;  2NTS A;  1D5M C;  2G5D A;  4DAV A;  1Y1W H;  4K0K Q;  4IFD J;  2RA4 A;  2KCN A;  1B3A A;  1BUV T;  1G8Z D;  3U4Z A;  3ONA B;  5IYD H;  1HUN A;  2N49 A;  3S14 B;  2K04 A;  2A6H D;  1STA A;  1WTQ A;  4YWM A;  3ERS X;  1DCZ A;  2B2V A;  1IW7 D;  2K32 A;  5C3E B;  4LUZ A;  5D3I B;  5JOB A;  3K59 A;  4LUV A;  1DON A;  1DM0 B;  1L0Y B;  1SMY C;  1EWH A;  3SR1 A;  5JJZ A;  5EQ0 A;  2EYP A;  2F0I A;  2IW3 A;  1ICW A;  5J3B A;  2Y0S G;  3D4D A;  4DPG A;  3BU2 A;  1BVS A;  1O7L A;  5JEA H;  2RCF A;  4RA8 A;  3PSI A;  4FXK C;  4J8Q A;  3CCM A;  1T9H A;  2B2U C;  3NHH A;  3D6W A;  4JI5 L;  3Q23 A;  2L11 A;  1SYE A;  2Z9H A;  1PFN A;  3A8K E;  3G4S A;  2Y0S E;  4JI5 Q;  4LMQ D;  5KYI A;  4QUC A;  3A7L A;  2LSS A;  3K7A H;  3SK4 A;  2CW0 C;  4N8F A;  4C3J H;  3TEH B;  2A19 A;  4JCV E;  4TVA B;  1S5D D;  2XN9 C;  1S72 A;  3LWE A;  4DV5 L;  5KEE A;  3STB D;  4BS9 A;  4JBJ A;  3CME A;  4Z9C B;  1I94 L;  5C3W A;  4XQJ A;  1CK1 A;  2QW7 A;  3PIP A;  3RLO A;  3H3V C;  1D8L A;  3OW2 A;  2K4K A;  1MSG A;  4PMW A;  4QMG A;  4Q0F A;  1I94 Q;  1WOC A;  3PQI A;  1WD0 A;  3HOZ G;  2VB2 X;  5D14 A;  3VYS A;  3T1H Q;  2A6H C;  4GN3 B;  1ASY A;  1G91 A;  1LTA D;  4B3S L;  3S16 H;  3E5S A;  3E6Z X;  3UE1 A;  3NUC A;  4NXM Q;  4HCS A;  5K5P A;  2OCE A;  4RGN A;  3HZX A;  1VF7 A;  2B2T C;  3NWT A;  4DF7 A;  5E3F A;  1JR0 D;  5IGD A;  2K14 A;  1JWM D;  2XGT A;  1CI3 M;  2IX3 A;  1AN8 A;  2A68 C;  2R7Z B;  2VY3 A;  2B2Y A;  4KLK A;  3NP8 A;  4FNF A;  4HMJ A;  5EKL A;  1EY8 A;  3EVQ A;  3BDO A;  3ERQ A;  4AH6 A;  2R7Z H;  2F0F A;  2PMZ B;  3F1Z A;  1WTW A;  4A3D G;  4OEM B;  2A6E D;  1KDB A;  1V9P A;  4IOA A;  2E5L L;  4DNI A;  1EIY B;  3NQI A;  2JEA I;  3ND9 A;  1F2L A;  1X3Q A;  3OTO L;  4QQB X;  1EY9 A;  4NMZ A;  5C44 G;  2NVT B;  4DV6 Q;  1GKH A;  3L2P A;  1U4M A;  4IQZ A;  1TWC B;  3HOV B;  1XNQ L;  1FR3 A;  1GO3 E;  1CKN A;  1B4O A;  5EJW A;  4A3L G;  1LM0 A;  1EFW A;  4KY7 A;  2OTL A;  5DM7 3;  5ELF A;  3UDF A;  5CGK A;  4K8J A;  1BBW A;  4K5W A;  4MNO A;  2A69 C;  2HHH L;  4TQU S;  1TQO A;  2RKS A;  2F0O A;  3NEM A;  3ERO A;  4BY7 H;  4K8I A;  3ND8 A;  1NR4 A;  4WOR A;  3UE0 A;  5IP9 G;  3T1Y L;  1WTR A;  4B3S Q;  1BCP B;  3L0O A;  4P2C B;  5GAE C;  2B63 B;  3CPW A;  3CCS A;  1W6K A;  4IUT A;  3LX0 A;  4G7O C;  3ER0 A;  3OPO A;  5IWA L;  1A62 A;  1EEI D;  5CYU A;  4M1U B;  3I4N H;  4DV2 L;  2B8G A;  2A74 C;  1HFN A;  1KL9 A;  4H13 C;  1EYC A;  1NY4 A;  1J6Q A;  4LFC Q;  4IPH A;  1SYD A;  4GLX A;  3K57 A;  3KBG A;  4OON A;  4R8N A;  4A3M G;  4ALP A;  2VZA A;  3DEP A;  5C0X G;  5C4Z A;  5IY0 A;  4UY8 C;  4QCL A;  3PUW A;  3SK8 A;  4KY6 A;  5CBA E;  1ML0 D;  2NVY B;  2CVR A;  4BA2 I;  4DGZ A;  1L0X B;  3H0G B;  3U58 A;  1FJG Q;  3MAQ A;  3I70 A;  3TDQ A;  3QWN A;  1EWC A;  2EIF A;  2IHE A;  1U4R A;  1JIC A;  2ATW A;  4J1M A;  1RF2 D;  1B8A A;  1R4P B;  2EYO A;  2AUJ D;  2MUY A;  4RHR A;  4GOP C;  1RTO A;  4JI4 Q;  1NUC A;  2Z6K A;  5FK9 C;  1WD1 A;  2BA0 A;  3A0J A;  1B50 A;  2JSO A;  1IBL Q;  3J80 E;  5E4X A;  3M3Y H;  3AMU A;  1C4Q A;  1PFS A;  5BN5 A;  1Q81 C;  2KCT A;  1V1O A;  1BCP F;  1I50 H;  5HGT A;  2KCM A;  4BXX G;  1IZ6 A;  3CRK C;  4LF5 Q;  2DNC A;  1HNX L;  2DUD A;  1EU3 A;  4HJ7 A;  4KN7 C;  3D8G A;  1H9S B;  4DUY L;  4L5S A;  2QGQ A;  4A3F G;  1JJ2 A;  2NTT A;  2OWO A;  4JV5 Q;  3S1Q B;  3Q8D A;  4ME5 A;  3H0G H;  3C1E A;  2UUA L;  4YCU A;  4DV2 Q;  4P73 A;  1K83 H;  5IGB A;  1BCP C;  1EY5 A;  3R8B A;  3KF8 A;  4JI7 Q;  3I7F A;  1VQA A;  3DM1 A;  4AYB E;  2Z6K C;  2UXB L;  4KK7 A;  1KRS A;  2EY1 A;  2L1B A;  2L55 A;  1LTL A;  3A74 A;  4C3H H;  2J7Z A;  4Y7N H;  1YNN D;  3KBX A;  3W3A A;  1K73 C;  3NPP A;  4JI3 L;  2FMC A;  2L15 A;  2DJF C;  2HHH Q;  3KYH C;  4UP9 A;  5C4X G;  4YHH L;  3GP7 A;  2NBF A;  5C44 B;  1VQM A;  3VYT A;  2J0T D;  5LL6 X;  4G57 A;  2VUM H;  3ULP A;  1Z7T A;  3PGZ A;  4GOP B;  1QZG A;  2LXJ A;  1PV4 A;  5A2Q E;  4R4O A;  1TWF B;  1OXS C;  3NSW A;  4DV7 L;  4A3L H;  1XXG A;  4EVO A;  1SYC A;  1VQE A;  3MVV A;  2RDF A;  4O1N A;  3OTO Q;  1R4Q B;  1Q86 C;  1CSP A;  4DN4 M;  4KKS A;  3DUZ A;  3D3R A;  1SSO A;  4A3M H;  2F0E A;  3QIA A;  4JOI A;  1U0L A;  2E76 C;  4RCO A;  1VQO A;  4C3H G;  5IT9 E;  1EFI D;  2HQE A;  4O2D A;  2H5X A;  4HID A;  4XIG S;  1V1P A;  5G3L D;  1OTC A;  3MFY A;  1I4G A;  1BOS A;  1IKM A;  3U9S A;  2JJQ A;  3JAM c;  2R93 G;  4R8I A;  5ELD A;  3MC0 B;  3NK9 A;  1PH6 A;  1G29 1;  3HRZ C;  2NVQ H;  1HZB A;  4JBW A;  1N33 L;  4KN4 C;  2G9D A;  4A3I B;  3UDX A;  5IGF A;  4DR2 L;  1R9T H;  1VQ9 A;  1N32 Q;  1HQM C;  1F9Q A;  5JJI A;  3DWP A;  2DN8 A;  2N55 A;  1K8A C;  4FF2 A;  1Q1E A;  2YU9 H;  4CJ2 C;  1F2Y A;  3FHW A;  2UUC Q;  5GQO A;  3SK6 A;  4C3J G;  2HT1 A;  2LKV A;  1KRT A;  4FXG C;  2UXC Q;  4AYB B;  1CZW A;  5KIX A;  1KC8 C;  1I4R A;  2K28 A;  1B53 A;  5LMN L;  3JC6 6;  5IYC G;  1N32 L;  5C0X I;  2QCP X;  3HOX G;  1F77 A;  3SEB A;  4HJ5 A;  4A3B G;  3DXJ C;  1Y8O B;  2AQ3 B;  2WAQ E;  3I4M B;  4Q5V A;  1A3U A;  1UWV A;  3BZK A;  3MXP A;  1LT4 D;  3HEJ A;  1NE3 A;  3OWF A;  2ID0 A;  4U68 A;  4IJL A;  4ZQ3 A;  2R93 B;  1H95 A;  1SXT A;  5KNB A;  4BY1 H;  2BE5 D;  3DWQ A;  2ICI A;  1TY2 A;  1RCV D;  3M4Q A;  2HIX A;  2J4X A;  5HUR A;  3M4O H;  4JI1 L;  2NVX B;  1CT1 D;  3TZU A;  1JT8 A;  5F2D A;  1QWY A;  2GA4 B;  3K80 C;  3HOZ H;  2N78 A;  1KIX A;  3R2I A;  1CKM A;  1L1O A;  4XDX A;  2E8G A;  4H0L C;  3BDC A;  3GTG B;  2MNA A;  1WVL A;  5M3M B;  1DOK A;  1LUZ A;  5IT9 L;  2A73 B;  3GTL B;  5AFW A;  3F8T A;  3IAY A;  4XT3 B;  1YIJ A;  1YIT A;  4GKJ Q;  5C4X B;  2B3G A;  2PYK A;  1UEB A;  3S2D H;  1ESF A;  3DM3 A;  4NXM L;  4CDE C;  1I4H A;  3S1R H;  2E2D C;  4GKJ L;  4A75 A;  2VL6 A;  1QNK A;  1LTS D;  1TKW B;  3TZD A;  4X3S A;  1J8I A;  1C9O A;  2I5H A;  2JEB I;  2A68 D;  3T1H L;  3S1R B;  3VYU A;  2BH8 A;  1T5X D;  3BG3 A;  3F2D A;  4QF4 A;  2X69 A;  2UXD Q;  1KD1 C;  1NSN S;  1NTG A;  4A3G G;  2ES2 A;  2ENB A;  1VDZ A;  1YHB A;  2MGS A;  3TN2 A;  3PO2 B;  5DLQ E;  1Q90 A;  3HKZ E;  4MN3 A;  1SJE D;  1TWG H;  3CRL C;  3J81 j;  2B2V C;  1ZYR D;  3BVZ A;  5KGU A;  2UUB L;  1A3V A;  4DV5 Q;  2LMC B;  4FF4 A;  2QDB A;  3M4Y A;  2E5L Q;  5H1S E;  2JK8 A;  1F9P A;  1P8L A;  4BBR G;  3W5O A;  1DJR D;  2HQL A;  2KEE A;  1ZXT A;  3PUX A;  3RLF A;  2CKZ B;  4LF6 L;  1HNZ L;  1NJI C;  2OF1 A;  4LFA Q;  3EIV A;  2XNA C;  2EXD A;  4DK0 A;  4A93 H;  4ILW A;  4IUR A;  5FO7 B;  3H3V I;  2OQ0 A;  1JMC A;  3EBE A;  2F0P A;  2PZW A;  4A93 G;  1I4P A;  1NNX A;  1LT6 D;  1TU2 B;  3WOF A;  1I6H B;  4A3J B;  2IX1 A;  2F0U A;  1D1K A;  1VQH A;  5JJK A;  2EE1 A;  3VR2 A;  4IUQ A;  2JP1 A;  4KJN A;  5ELB A;  5FO8 B;  4K6D A;  3TQY A;  4ZCK A;  3HOW G;  3CD6 A;  3MA2 B;  4IFD I;  4IPD A;  4X65 L;  2UXC L;  2BDO A;  2RCN A;  3J7A V;  4K0K L;  3GV3 A;  2NWG A;  1IYJ B;  5GAH C;  4LNQ A;  3I72 A;  4GN4 B;  2BCO A;  2L9H A;  4A3G B;  1A0I A;  1VQI A;  4DR7 Q;  3HOU G;  3ITP A;  1E2V A;  5JVH 3;  2VNU D;  1EY7 A;  1XPO A;  4B3R L;  4WJ3 M;  1K8G A;  4ODG A;  1TR5 A;  3KJO A;  4XYO A;  2K75 A;  3FKI H;  2F0H A;  1X65 A;  1HHV A;  1MGS A;  5IYC H;  1QJO A;  4JI0 L;  4R4I A;  5DM6 3;  1Z6H A;  1RD9 D;  5NUC A;  4NW2 A;  2F0T A;  4RGO S;  4E6I A;  3EJI A;  4BY7 G;  3AU7 A;  3MZ5 A;  4GLA C;  3SHL A;  2E74 C;  3QOJ A;  3F2U A;  5IP9 H;  3DMU A;  2ZJR A;  3I56 A;  1AW7 A;  3CQZ H;  1RHP A;  4LF4 Q;  2EXZ A;  4RHS A;  3I73 A;  5DAU A;  5I9O A;  4AQY L;  3GO5 A;  3NE5 B;  3D4W A;  1A6X A;  4OIK A;  1ZKO A;  3K8A A;  2F4V Q;  1V8Q A;  1SR3 A;  4A3K H;  1RIP A;  2JA6 B;  3UI2 A;  2NVT H;  4UP8 A;  2F4V L;  1RJT A;  4N8X 1;  5IT9 c;  4RFB A;  1N8R C;  5GAD C;  2PNR C;  1YI2 A;  1TWH H;  2XWB B;  1GUO A;  4UPA A;  2R7D A;  2E2I B;  1L1O B;  3G6E A;  1L2F A;  1BDO A;  3E9I A;  1IBK L;  1CKN B;  3A55 A;  3OOC A;  1XTC D;  3HP3 A;  4F7X A;  2KHJ A;  2CFM A;  3LWU A;  2NVQ B;  1PH4 A;  3I2Z A;  1GOZ A;  4CJ0 B;  2X6G A;  1C8C A;  1B44 D;  3PCO B;  4A3J G;  1LTB D;  3I4M G;  4KHP Q;  2AWO A;  1IYV A;  2KVM A;  2ICE C;  2EJF C;  3KF8 B;  2QA4 A;  1QCB D;  1EYD A;  4XTC S;  1ESR A;  1ENC A;  3TP8 A;  5CMD A;  4FXD A;  3MXU A;  1O7Z A;  2JA6 H;  5FLX E;  1TVX A;  3S17 B;  1E0B A;  3M4P A;  1G6P A;  4BXX H;  2I0Q A;  5CV5 A;  4IPC A;  4LF8 Q;  3KLW A;  4DV0 L;  2DY7 A;  4HED A;  2UUC L;  1Q8I A;  1SRO A;  2XTI A;  4MTK A;  1SBB B;  4DV4 L;  2JA7 G;  4DKA C;  4DUY Q;  1EQV A;  1H9K A;  1K9M C;  1E3P A;  1O78 A;  1IYU A;  4PZ6 A;  3PUV A;  4JK1 C;  4HSV A;  2VQE Q;  1C0A A;  2F4I A;  4C2M H;  4XT1 B;  3IKJ A;  4C3I B;  1X3E A;  3CC7 A;  4H44 C;  3J7A 5;  1SE8 A;  4KD4 A;  3NEN A;  2ZTD A;  2JA8 B;  5TSS A;  4DR6 L;  3BYT B;  4DR3 Q;  2EDG A;  3QG1 A;  4QUF A;  3PIP 3;  3S1M B;  1PH1 A;  4MIU A;  4WRD A;  1SN8 A;  1H9J A;  3C46 A;  1LTG D;  4KMU C;  3SVM A;  3NTK A;  3V96 A;  3KK7 A;  1PTO H;  3K58 A;  3SDZ A;  1QVF A;  1CFM A;  2DGY A;  2L5T A;  4PZ7 A;  2WFW A;  4FO2 A;  4X3T A;  1OXV A;  5IOC A;  1VQ5 A;  4HIK A;  2F0N A;  3GTP B;  1PTO F;  4RKL A;  1VQF A;  1XMO Q;  3TRE A;  1BXT A;  4MZ9 A;  1IKL A;  1YVC A;  5COR A;  1ILQ A;  5JEA J;  3GDE A;  1YNJ D;  1V1P B;  1FNU A;  5J22 A;  3RZD B;  4ZKC B;  3GTL H;  1CTM A;  1JQY D;  2RSN A;  5CR3 A;  1VQN A;  4R4C A;  2F52 A;  3CMA A;  3GTJ H;  2F3I A;  2CCZ A;  5CBE E;  5IYB G;  2Z8L A;  3H09 A;  1YJN A;  4JI8 L;  1RKN A;  3HOU H;  3G7L A;  4GOP A;  4DFA A;  2LY7 A;  3AB9 A;  1D6E C;  4JI7 L;  3PF5 A;  4B3M Q;  1KQS A;  2MJ8 A;  1QIL A;  3IL8 A;  5BR8 Q;  1EOV A;  1XPU A;  3VR4 A;  4A3J H;  1KLU D;  1VQ4 A;  4FP5 D;  4RG1 A;  3G71 A;  1ENF A;  3P75 A;  4CDC C;  4YY3 Q;  4HIO A;  3PO2 H;  2BDN A;  3K5N A;  5C4J B;  1CSQ A;  1PH9 A;  5C3E H;  4BWG B;  2I5L X;  3KLR A;  3J81 L;  1E2W A;  5JAV A;  1PYW D;  5J1Z A;  5C4J H;  3FRP B;  1N36 L;  2A1A A;  4ZUI A;  1A63 A;  2AWN A;  4KD3 A;  2IY5 B;  4IUP A;  4A3B B;  3RZD H;  2TSS A;  5AJ3 L;  3SK5 A;  4A3F H;  2WKC A;  4JPB W;  3RUZ A;  3KUP A;  4LJZ C;  4LF9 L;  2JA7 H;  3GTK H;  4WJ4 A;  1VQP A;  3L7Z C;  1STH A;  4RMF A;  3MWY W;  2JA7 B;  3FKI G;  2OEO A;  4DV1 Q;  3STB C;  1PVO A;  1DD2 A;  2F0K A;  1ROD A;  4ZUJ A;  1EZ8 A;  1F2Z A;  2I07 B;  4GS3 A;  2JXM B;  4G7Z C;  1Q1B A;  1STY A;  1TII D;  4UHV A;  3MFG A;  1K8O A;  2EOT A;  1R9T B;  4DNT B;  4F87 A;  2JE6 I;  1X3F A;  1LT3 D;  5K36 H;  2YTX A;  2L12 A;  4S3S A;  3CCV A;  2ALY B;  5EBC A;  1PH7 A;  2N3S A;  1UNS A;  4DR7 L;  2A5H A;  2OT2 A;  2H1E A;  1WCM B;  5ELO A;  4KI0 A;  2R61 A;  4P72 A;  2PQA B;  4LF8 L;  1PYB A;  1SMX A;  5LL6 S;  3CC2 A;  1PHJ A;  4X65 Q;  1IL2 A;  1E24 A;  5ISR A;  4IFD G;  2E2J H;  4GNX C;  2IJ0 A;  2B2T A;  1UUP A;  1QE6 A;  4YCW A;  1SLJ A;  4JBM A;  3A54 A;  4F8M A;  2JA5 G;  2YV5 A;  4B3T L;  1VCI A;  3T1Y Q;  5EKK A;  3I90 A;  2YYZ A;  5C3X A;  1TT2 A;  2R92 B;  1ET6 A;  1EL0 A;  1SYG A;  3V05 A;  5C6A A;  3T51 B;  1IHZ A;  3RLN A;  4CGY B;  5M3F H;  2F0J A;  2QEX A;  2R92 H;  1IBK Q;  5JVG 3;  2D62 A;  1LV9 A;  1C7Y A;  5M5Y B;  3I4M H;  1DXM A;  3HOY B;  3LGJ A;  4GKK Q;  5C4X H;  1STN A;  1I3Q H;  4BY7 B;  1HH2 P;  1PFM A;  1HNZ Q;  1A8V A;  3J80 c;  4DR3 L;  3MEH A;  2MHV A;  4X66 L;  4HJ9 A;  2CQA A;  3KJP A;  2R93 H;  4OX9 L;  3NQT A;  1N36 Q;  1BO0 A;  3KLS X;  1QG7 A;  1S5B D;  3I8Z A;  4X62 Q;  3CCL A;  1UE6 A;  2K52 A;  3CPF A;  3NTH A;  3CC4 A;  1G2T A;  2RDG A;  3S2H B;  2CH4 A;  1Z47 A;  4DV0 Q;  1VF5 C;  4HR7 B;  1B7Y B;  2O4X A;  1AE2 A;  1SE2 A;  3I4O A;  4C2M B;  4EQN A;  1X9N A;  1K0S A;  4BBS H;  1PA6 A;  4PMC A;  2K5N A;  3HOW B;  1EQR A;  4A3E G;  3EA6 A;  1T5E A;  4JI8 Q;  5C0X J;  1XPR A;  4C3I G;  2R6G A;  1ET9 A;  2KEC A;  2UXB Q;  1GVP A;  1SNC A;  1YHQ A;  4B3R Q;  2V4D A;  3WOE A;  1JOQ A;  3VR5 A;  1S5C D;  4A93 B;  1LO5 D;  2B2U A;  4ABN A;  1WTH A;  1II3 A;  2NN6 G;  4DU9 A;  4NB3 A;  2KJX A;  5ELN A;  1VQ7 A;  5IYB H;  2F3W A;  4APV A;  1VQJ A;  3W1G A;  5J39 A;  4L5R C;  1SNO A;  4RGT A;  1FVI A;  1UE7 A;  4YWK A;  3CKI B;  2ZJQ A;  2E75 C;  1JE4 A;  3AYH B;  2D0P A;  2EJM A;  3TS0 A;  3GTO H;  4CBV A;  1HFG A;  1TWG B;  2IHF A;  3Q24 A;  1WJJ A;  3GTO B;  1ICF B;  3K5L A;  3QR8 A;  3GTQ H;  4OL7 A;  3UDG A;  2RVL A;  4ULL A;  4K6L A;  1E7Z A;  1EWI A;  4A3M B;  1M90 C;  1G2S A;  1S5F D;  4ZAI A;  3RR5 A;  1KXL A;  3HKS A;  4NP5 A;  3GTJ B;  2PO4 A;  1Y1V H;  4V0B A;  4DUZ L;  1NAP A;  4CJ1 B;  5C44 H;  1ZEQ X;  4UDU C;  3PIO 3;  1SND A;  2F0L A;  1EZ6 A;  1FYC A;  1F9S A;  2RDH A;  2JQO A;  1X3G A;  2PW5 A;  1HA5 A;  3AEV A;  2NN6 I;  4DR4 Q;  4A3I H;  1DOL A;  1X6O A;  1CHP D;  2YTY A;  4ZLT F;  4WJW A;  4U67 3;  5E1F A;  2B2Y C;  2NUC A;  2R7F A;  3HOY G;  3KFU A;  5K36 G;  1SE4 A;  1XX8 A;  1VQD A;  4LWC A;  2Z0S A;  3H6M A;  2LS0 1;  3NXW A;  3R2T A;  4JI6 Q;  2K50 A;  1PYS B;  2A6E C;  1Q12 A;  5IWA Q;  1K83 B;  3CCJ A;  2Q2I A;  2Q8T A;  2R92 G;  3HOV G;  1YHA A;  2F03 A;  1Y14 B;  2HDL A;  1HA6 A;  5E7N A;  3K6O A;  1Y1V B;  4H02 A;  3HOU B;  2AQ1 B;  2VQF L;  3L3O C;  1IBM Q;  3OW7 A;  4A3D H;  1GUN A;  4RH6 A;  4DUZ Q;  2H4O A;  4LFA L;  5M9O A;  1CQV A;  4I7A A;  4A3D B;  3E0J A;  4LUO A;  1BBX C;  5M5Y H;  2FFK B;  3HOY H;  1SJH D;  2WP8 J;  1HR0 Q;  4FF3 A;  2MO1 A;  2O2L D;  1VQC A;  4V19 0;  3DEO A;  3OMG A;  2MFI A;  4XQQ A;  1QNU A;  3ULL A;  3J7Y W;  3QJY A;  1XJV A;  3K5O A;  1D2B A;  3A7A B;  3TP6 A;  3I91 A;  3J81 i;  2RHQ B;  1WTO A;  2MO0 A;  3T13 A;  4OEL B;  3IFD A; 
#chains in the Genus database with same CATH homology
 1B1Z A;  4HAE A;  4EQO A;  2XVS A;  4N9T A;  4EGV A;  1TWH B;  5M3F B;  3R3O A;  1KLG D;  2F0M A;  1OXU A;  1GUT A;  4DAY A;  2XSC A;  1EEF D;  2B2W A;  3IFT A;  1KNE A;  1I3Q B;  1STG A;  1D5Z C;  4BY1 B;  1PDQ A;  4R9W A;  3I4N B;  4G4K A;  2KED A;  5DEH A;  1FGB D;  3HS0 C;  2M2L A;  2K03 A;  2KHS A;  1U9R A;  3Q0A A;  5LHY 1;  2AQ2 B;  2NB0 A;  3DWA A;  1G6Z A;  1CM9 A;  2Z4I A;  1EOT A;  1KTK A;  1DOM A;  3OWE B;  5E4W C;  2NN6 H;  4K5X A;  2DY8 A;  3S9W A;  4C56 C;  5EPJ A;  4BBS B;  1DYQ A;  3RZO B;  1RTN A;  1Y69 U;  1PZI D;  1CA6 A;  2B2W C;  4CKE A;  2G9H D;  4MHE A;  2R3Z A;  2NZ1 D;  1PTO D;  2PZT A;  1NR2 A;  1HRJ A;  2RBM A;  2CW0 D;  3HGB A;  2ZXO A;  4RWS C;  2IWH A;  1M8A A;  2Z1C A;  1AZQ A;  2K05 A;  3A56 A;  3D31 A;  5CV8 A;  4ZKB B;  1PTO B;  1SYB A;  1SNM A;  2FJ2 A;  1J9O A;  2HCC A;  1LLR D;  3U9O A;  5KYL A;  2VUM B;  3QB3 A;  3VR6 A;  4HSP A;  3MXG A;  1HUM A;  1SEB D;  5CC4 A;  2BA1 A;  3BDL A;  3JAM L;  2VXW A;  3VA5 A;  4A3F B;  2WKD A;  4K2L A;  5IGE A;  2FIN B;  3BZD B;  4IUV A;  3HOX B;  2WB1 B;  5D3D A;  4DXF A;  1PMR A;  3HKZ B;  4FF1 A;  3GTM B;  3M3Y B;  3GV6 A;  1SAP A;  4OO1 I;  1AEX A;  5FO9 B;  1AP0 A;  2EYF A;  1BNZ A;  1W6J A;  3FEW X;  5I6W A;  4XYQ A;  1EIH A;  1JOO A;  4KHV A;  1O80 A;  1D1I A;  4LAA A;  3OIP A;  3NBH A;  3DHQ A;  2IT1 A;  3TME A;  3P1H A;  4CKC A;  2Q8R E;  3EQL C;  4UAI A;  2EYL A;  1TS4 A;  3K0Y A;  3BVM A;  2EZV A;  4TKO B;  1YNN C;  1LTR D;  3C2P A;  4L8J A;  1PLF A;  4B9W A;  4M8A A;  3X3M A;  3P20 A;  2ZXR A;  1D5X C;  2N88 A;  2Q8I B;  4OO1 H;  4DXG A;  2E2H B;  2PQE A;  4IUN A;  2TMP A;  3OMC A;  3D4R A;  3SE0 A;  1F9R A;  1X32 A;  2SDF A;  3M7G A;  3KLS A;  2O5I C;  4KTA A;  5A35 A;  1AFP A;  1Y8P B;  3J80 L;  3NBI A;  2XRS D;  3VA7 A;  5M5X B;  4OHJ A;  5G3L F;  2SNS A;  2QIL A;  2K6A A;  1A3T A;  4ZRZ A;  4OIJ A;  2PCF B;  1PRT D;  1TS5 A;  2BOS A;  1CHQ D;  3SXH A;  1IL8 A;  2JYO A;  2FHT A;  3JAM E;  1H9R A;  2WIN B;  5DNF A;  4QIW B;  2QEJ C;  4HCE A;  2K01 A;  1SDF A;  2IL8 A;  5C5L A;  2XIW A;  2DNE A;  2PZU A;  5FKA C;  3BVG A;  3T16 A;  1ONL A;  4DNR B;  2F0D A;  2F0W A;  5A2Q L;  2D9U A;  3A8J E;  1WTP A;  3HOZ B;  1U4P A;  4X3K A;  1SNQ A;  4B08 A;  3VR3 A;  4BBR B;  3FDT A;  3J7A F;  1OXX K;  1KNA A;  2B8F A;  3L9A X;  1QB5 D;  1YNJ C;  2QF7 A;  1A15 A;  2EY2 A;  4RCN A;  5T1G A;  4HMI A;  4CKB A;  1TS3 A;  4PV1 C;  1XWE A;  1SE3 A;  1SFO B;  2D5D A;  3TP7 A;  1CQF A;  2BE5 C;  2K7V A;  2L0C A;  2SNM A;  5T1I A;  2I46 A;  2Y0S B;  4TRD A;  3HG9 A;  2K33 A;  1JC7 A;  4PMB A;  5I4D A;  2F0V A;  1EY6 A;  3LNN A;  2L4N A;  2KUM A;  3S16 B;  3T56 B;  3H91 A;  2HUG A;  4O42 A;  1KAA A;  3MTS A;  2PPB C;  4XQN A;  2B39 A;  3NTI A;  1HTL D;  1AZP A;  3N52 A;  2O5J C;  4HN7 A;  3URY A;  4RGM A;  5ELC A;  5IIF A;  1I4Q A;  3QO2 A;  4DAP A;  1GXD C;  3BS1 A;  4I7Z C;  2EVB A;  2AUK A;  3VYR A;  5EBD A;  1B2T A;  4DK1 A;  1EY4 A;  1KDC A;  3I4L A;  3W2D A;  1PZJ D;  1JCK B;  1S5E D;  1M4V A;  5IGG A;  1LTT D;  1Q3L A;  3H94 A;  1ZYR C;  1C48 A;  2XRQ D;  1A2U A;  3N6R A;  4KY5 A;  1VMP A;  2RSO A;  1PTO C;  3EFX D;  2NYZ D;  4L63 B;  3FKI B;  2K5D A;  2MP1 A;  1HTP A;  3K7A B;  4C3J B;  5CV7 A;  4CHT B;  1GJX A;  1UAP A;  4WFN 3;  1TY0 A;  1EIG A;  4A3K B;  4QB4 A;  2M00 A;  1STE A;  2F0G A;  2WAC A;  1H9S A;  1H9M A;  1V43 A;  2EYM A;  2F3V A;  3PV0 A;  1PRT C;  1CA5 A;  2D2C C;  3GTK B;  4DA2 A;  5C4H A;  4HTH A;  5JPM C;  1BR9 A;  2VB3 X;  1KAB A;  4KV6 A;  5BN4 A;  4K5V A;  5KNC A;  2E2J B;  3CU7 A;  3FPU B;  4ID6 A;  3QOL A;  1U4L A;  1WTX A;  5JPN C;  1E2Z A;  4KKU A;  1GUW A;  5JEA G;  3A8I E;  3PMF A;  1MSH A;  2EPB A;  2EY5 A;  2C5C A;  1OXT A;  1EYA A;  2F0S A;  1EY0 A;  1TWA B;  1GUS A;  4KHZ A;  3K5M A;  2IPK D;  1DZ1 A;  2HDM A;  3ZYY X;  3FVQ A;  5C5M A;  4NDX A;  2WAQ B;  4RAU C;  4OGQ C;  4EQP A;  4ZYS A;  1LT5 D;  1PRT F;  3MHB A;  3PUZ A;  1SMY D;  5CV4 A;  1X3P A;  1LTI D;  1WTV A;  2K5Q A;  4XXE A;  1VMC A;  3GTQ B;  1I4X A;  2F0Q A;  5D65 A;  4GZY C;  5KND A;  2IX0 A;  1KDA A;  2RQX A;  3NWS A;  2QKI C;  1Y1W B;  1PFB A;  4Y7N B;  1TS2 A;  1MI2 A;  3OSO A;  4PQX A;  5I9P A;  3M4O B;  1BCP D;  3S15 B;  1LAC A;  1LAB A;  2KOL A;  3S1N B;  4H7B A;  1MD2 D;  2XWJ B;  1B9N A;  1I50 B;  4YIJ A;  2WII B;  4G7H C;  2PW7 A;  2ZXP A;  5COY A;  2ZT9 C;  5I2Y A;  1XYI A;  1JOK A;  3CHB D;  1HQR D;  3T4A C;  2OXP A;  5KRU A;  1SNP A;  4X3U A;  4K2K A;  1BQQ T;  4IUU A;  5EGT A;  3OHX C;  3Q6S A;  3MXN A;  3C3L A;  4IFD H;  4KJO A;  1GHJ A;  4C3H B;  5EPK A;  4I65 A;  4PNY A;  4C1N I;  4A3E B;  4IAL A;  3T53 B;  1MBY A;  5CV6 A;  4N9P A;  5M5W B;  2Z4H A;  1PRT B;  1SYF A;  3M85 A;  5I6Y A;  1IW7 C;  2KA7 A;  3G6J B;  3OIQ A;  1F2M A;  2YU9 B;  3BYY B;  3FMC A;  4TSS A;  4LK1 C;  2X6L A;  3R93 A;  4IZ8 A;  4F88 A;  3PO3 B;  5C0X H;  2EYJ A;  4FVM A;  1BF4 A;  4IN3 A;  5ELE A;  1QOH A;  4FYD A;  1ENA A;  1EQT A;  1FNW A;  5FOB B;  1RDP D;  2HCI A;  4NKL A;  1STB A;  2EYH A;  2SOB A;  3O13 A;  5I2X A;  1HPC A;  4BA1 I;  4K14 A;  3Q22 A;  1GUG A;  3V2T A;  2JA5 B;  1JOR A;  3WDN A;  2SEB D;  2CHB D;  1FNV A;  5EPL A;  2KQ3 A;  3D6C A;  4KKT A;  1PXU A;  4J6H A;  3TP5 A;  4B9X A;  1UEA B;  5IGC A;  3FPP A;  1FD7 D;  1O7Y A;  4C1N K;  1JWS D;  5IOD A;  1A2T A;  1HXY D;  3TBI B;  5EKI A;  1HCZ A;  1Y8N B;  1GHK A;  3GD7 A;  2M9V A;  3CQZ B;  3RMH A;  2F1M A;  2EY6 A;  3S2D B;  4L6T B;  4ZK9 B;  1CZG A;  5BN3 A;  3PUY A;  1EU4 A;  3I3C A;  3GQB A;  1K8M A;  2LFN A;  2K1B A;  2WV6 D;  4OO1 G;  1JWU D;  5FLX L;  3J81 E;  3M7N A;  2MPM A;  1NCV A;  2K5W A;  1I6V C;  3P7J A;  5CV9 A;  3TSS A;  1ILP A;  1PZK D;  2FMM A;  3X3N A;  2KCC A;  2C9O A;  1S4Z A;  2A69 D;  2EJG C;  3RD4 A;  1OO9 B;  4RKB A;  1JB3 A;  3C1F A;  1B9M A;  2NTS A;  1D5M C;  4DAV A;  4IFD J;  2RA4 A;  2KCN A;  1B3A A;  1BUV T;  1G8Z D;  3ONA B;  1HUN A;  3S14 B;  2K04 A;  2A6H D;  1STA A;  1WTQ A;  1DCZ A;  2B2V A;  1IW7 D;  2K32 A;  5C3E B;  5D3I B;  5JOB A;  3K59 A;  1DON A;  1DM0 B;  1L0Y B;  1SMY C;  1EWH A;  3SR1 A;  5JJZ A;  5EQ0 A;  2EYP A;  2F0I A;  2IW3 A;  1ICW A;  3D4D A;  1O7L A;  5JEA H;  4RA8 A;  4FXK C;  4J8Q A;  2B2U C;  3NHH A;  3D6W A;  3Q23 A;  2L11 A;  1SYE A;  1PFN A;  3A8K E;  4LMQ D;  5KYI A;  4QUC A;  3A7L A;  3SK4 A;  2CW0 C;  1S5D D;  2XN9 C;  3LWE A;  5KEE A;  4BS9 A;  4Z9C B;  5C3W A;  4XQJ A;  1CK1 A;  3H3V C;  1MSG A;  4PMW A;  4QMG A;  4Q0F A;  1WD0 A;  2VB2 X;  5D14 A;  3VYS A;  2A6H C;  1G91 A;  1LTA D;  3E5S A;  3E6Z X;  3NUC A;  4HCS A;  5K5P A;  4RGN A;  3HZX A;  1VF7 A;  2B2T C;  3NWT A;  4DF7 A;  5E3F A;  1JR0 D;  5IGD A;  1JWM D;  1CI3 M;  2IX3 A;  1AN8 A;  2A68 C;  2R7Z B;  2B2Y A;  3NP8 A;  4FNF A;  4HMJ A;  5EKL A;  1EY8 A;  3BDO A;  3EVQ A;  3ERQ A;  2F0F A;  2PMZ B;  1WTW A;  2A6E D;  1KDB A;  3NQI A;  2JEA I;  3ND9 A;  1F2L A;  1X3Q A;  1EY9 A;  4NMZ A;  2NVT B;  1U4M A;  4IQZ A;  1TWC B;  3HOV B;  1FR3 A;  1B4O A;  5EJW A;  4KY7 A;  5DM7 3;  5ELF A;  5CGK A;  4K8J A;  4K5W A;  2A69 C;  4TQU S;  1TQO A;  2RKS A;  2F0O A;  3ERO A;  4K8I A;  3ND8 A;  1NR4 A;  4WOR A;  1WTR A;  1BCP B;  4P2C B;  2B63 B;  1W6K A;  4IUT A;  3LX0 A;  4G7O C;  3OPO A;  1EEI D;  5CYU A;  4M1U B;  2B8G A;  2A74 C;  1HFN A;  4H13 C;  1EYC A;  1SYD A;  3K57 A;  3KBG A;  4R8N A;  3DEP A;  5C0X G;  5C4Z A;  4QCL A;  3PUW A;  3SK8 A;  4KY6 A;  5CBA E;  1ML0 D;  2NVY B;  2CVR A;  4BA2 I;  4DGZ A;  1L0X B;  3H0G B;  3MAQ A;  3I70 A;  3TDQ A;  3QWN A;  1EWC A;  1U4R A;  1JIC A;  4J1M A;  1RF2 D;  1R4P B;  2EYO A;  2AUJ D;  2MUY A;  4RHR A;  1RTO A;  1NUC A;  5FK9 C;  1WD1 A;  2BA0 A;  1B50 A;  2JSO A;  3J80 E;  5E4X A;  3AMU A;  1C4Q A;  5BN5 A;  1V1O A;  1BCP F;  5HGT A;  3CRK C;  2DNC A;  1EU3 A;  4KN7 C;  3D8G A;  1H9S B;  2NTT A;  3S1Q B;  4ME5 A;  3C1E A;  5IGB A;  1BCP C;  1EY5 A;  3R8B A;  3KF8 A;  3DM1 A;  4KK7 A;  2EY1 A;  2L1B A;  2L55 A;  2J7Z A;  1YNN D;  3KBX A;  3W3A A;  3NPP A;  2FMC A;  3GP7 A;  2NBF A;  5C44 B;  3VYT A;  2J0T D;  5LL6 X;  4G57 A;  1Z7T A;  5A2Q E;  1TWF B;  1OXS C;  3NSW A;  1XXG A;  4EVO A;  1SYC A;  3MVV A;  2RDF A;  4O1N A;  1R4Q B;  4DN4 M;  4KKS A;  3DUZ A;  3D3R A;  1SSO A;  2F0E A;  3QIA A;  2E76 C;  4RCO A;  4C3H G;  5IT9 E;  1EFI D;  2HQE A;  4XIG S;  1V1P A;  5G3L D;  3MFY A;  1I4G A;  1BOS A;  1IKM A;  3U9S A;  4R8I A;  5ELD A;  3MC0 B;  3NK9 A;  1G29 1;  3HRZ C;  4JBW A;  4KN4 C;  2G9D A;  4A3I B;  5IGF A;  1HQM C;  1F9Q A;  3DWP A;  2DN8 A;  2N55 A;  4FF2 A;  1Q1E A;  4CJ2 C;  1F2Y A;  3SK6 A;  4C3J G;  2LKV A;  4FXG C;  4AYB B;  1CZW A;  5KIX A;  1I4R A;  2K28 A;  1B53 A;  5C0X I;  2QCP X;  1F77 A;  3SEB A;  3DXJ C;  1Y8O B;  2AQ3 B;  3I4M B;  4Q5V A;  1A3U A;  3MXP A;  1LT4 D;  3HEJ A;  3OWF A;  4U68 A;  2ID0 A;  4ZQ3 A;  2R93 B;  1SXT A;  5KNB A;  2BE5 D;  3DWQ A;  2ICI A;  1TY2 A;  1RCV D;  2J4X A;  5HUR A;  2NVX B;  1CT1 D;  3TZU A;  5F2D A;  1QWY A;  2GA4 B;  3R2I A;  4XDX A;  4H0L C;  3BDC A;  3GTG B;  1WVL A;  5M3M B;  1DOK A;  5IT9 L;  2A73 B;  3GTL B;  5AFW A;  3IAY A;  4XT3 B;  5C4X B;  2PYK A;  1ESF A;  1I4H A;  2E2D C;  1QNK A;  1LTS D;  1TKW B;  3TZD A;  4X3S A;  1J8I A;  2JEB I;  2A68 D;  3S1R B;  3VYU A;  1T5X D;  3BG3 A;  4QF4 A;  2X69 A;  1NSN S;  2ENB A;  1VDZ A;  2MGS A;  3TN2 A;  3PO2 B;  1Q90 A;  4MN3 A;  1SJE D;  3CRL C;  2B2V C;  1ZYR D;  3BVZ A;  5KGU A;  1A3V A;  2LMC B;  4FF4 A;  2QDB A;  3M4Y A;  1F9P A;  1DJR D;  2KEE A;  1ZXT A;  3PUX A;  3RLF A;  2OF1 A;  4DK0 A;  2XNA C;  4ILW A;  4IUR A;  5FO7 B;  2F0P A;  2PZW A;  1I4P A;  1LT6 D;  1TU2 B;  3WOF A;  1I6H B;  4A3J B;  2IX1 A;  2F0U A;  1D1K A;  2EE1 A;  3VR2 A;  4IUQ A;  2JP1 A;  4KJN A;  5ELB A;  5FO8 B;  4K6D A;  4IFD I;  3MA2 B;  2BDO A;  3J7A V;  3GV3 A;  2NWG A;  3I72 A;  2BCO A;  2L9H A;  4A3G B;  3ITP A;  1E2V A;  5JVH 3;  2VNU D;  1EY7 A;  4ODG A;  1TR5 A;  4XYO A;  2F0H A;  1HHV A;  1MGS A;  1QJO A;  5DM6 3;  1Z6H A;  1RD9 D;  5NUC A;  4NW2 A;  2F0T A;  4RGO S;  4E6I A;  3EJI A;  3AU7 A;  3MZ5 A;  3SHL A;  2E74 C;  3QOJ A;  3F2U A;  3DMU A;  1AW7 A;  1RHP A;  2EXZ A;  4RHS A;  3I73 A;  5DAU A;  5I9O A;  3GO5 A;  3NE5 B;  3D4W A;  1A6X A;  4OIK A;  1ZKO A;  1V8Q A;  2JA6 B;  3UI2 A;  1RJT A;  4RFB A;  2PNR C;  2XWB B;  1GUO A;  2E2I B;  1BDO A;  3A55 A;  3OOC A;  1XTC D;  3HP3 A;  4F7X A;  3LWU A;  2NVQ B;  1GOZ A;  4CJ0 B;  2X6G A;  1C8C A;  1B44 D;  1LTB D;  2AWO A;  1IYV A;  2KVM A;  2ICE C;  2EJF C;  1QCB D;  1EYD A;  4XTC S;  1ESR A;  1ENC A;  3TP8 A;  5CMD A;  4FXD A;  3MXU A;  1O7Z A;  5FLX E;  1TVX A;  3S17 B;  1E0B A;  5CV5 A;  2DY7 A;  4HED A;  1Q8I A;  1SBB B;  1EQV A;  1H9K A;  1O78 A;  1IYU A;  3PUV A;  4JK1 C;  4HSV A;  2F4I A;  4XT1 B;  3IKJ A;  4C3I B;  4H44 C;  4KD4 A;  2JA8 B;  5TSS A;  3BYT B;  2EDG A;  3QG1 A;  4QUF A;  3PIP 3;  3S1M B;  4MIU A;  4WRD A;  1H9J A;  3C46 A;  1LTG D;  4KMU C;  3SVM A;  3NTK A;  3V96 A;  3KK7 A;  1PTO H;  3K58 A;  3SDZ A;  1CFM A;  2L5T A;  4FO2 A;  4X3T A;  1OXV A;  5IOC A;  2F0N A;  3GTP B;  1PTO F;  4RKL A;  1BXT A;  1IKL A;  5COR A;  1ILQ A;  5JEA J;  1YNJ D;  1V1P B;  1FNU A;  5J22 A;  3RZD B;  4ZKC B;  1CTM A;  1JQY D;  2RSN A;  5CR3 A;  5CBE E;  2Z8L A;  3H09 A;  1RKN A;  3G7L A;  4DFA A;  2LY7 A;  3AB9 A;  1D6E C;  2MJ8 A;  1QIL A;  3IL8 A;  3VR4 A;  1KLU D;  4FP5 D;  1ENF A;  3P75 A;  2BDN A;  3K5N A;  5C4J B;  4BWG B;  3KLR A;  3J81 L;  1E2W A;  5JAV A;  1PYW D;  5J1Z A;  3FRP B;  4ZUI A;  2AWN A;  4KD3 A;  4IUP A;  4A3B B;  2TSS A;  3SK5 A;  2WKC A;  3RUZ A;  3KUP A;  4LJZ C;  3L7Z C;  1STH A;  3MWY W;  2JA7 B;  2OEO A;  1DD2 A;  2F0K A;  1ROD A;  4ZUJ A;  1EZ8 A;  1F2Z A;  2I07 B;  2JXM B;  4G7Z C;  1STY A;  1TII D;  1Q1B A;  3MFG A;  1K8O A;  2EOT A;  1R9T B;  4DNT B;  4F87 A;  2JE6 I;  1LT3 D;  5K36 H;  2L12 A;  4S3S A;  5EBC A;  1UNS A;  2A5H A;  2OT2 A;  2H1E A;  1WCM B;  4KI0 A;  2R61 A;  5LL6 S;  5ISR A;  4IFD G;  2IJ0 A;  2B2T A;  1UUP A;  1QE6 A;  3A54 A;  4F8M A;  1VCI A;  5EKK A;  3I90 A;  2YYZ A;  5C3X A;  1TT2 A;  2R92 B;  1ET6 A;  1EL0 A;  1SYG A;  3V05 A;  5C6A A;  3T51 B;  1IHZ A;  4CGY B;  2F0J A;  5JVG 3;  2D62 A;  1LV9 A;  5M5Y B;  1DXM A;  3HOY B;  1STN A;  4BY7 B;  1PFM A;  3MEH A;  2MHV A;  2CQA A;  3NQT A;  1BO0 A;  3KLS X;  1QG7 A;  1S5B D;  3I8Z A;  3NTH A;  1G2T A;  2RDG A;  3S2H B;  1Z47 A;  1VF5 C;  4HR7 B;  2O4X A;  1SE2 A;  4C2M B;  4EQN A;  4PMC A;  3HOW B;  3EA6 A;  1T5E A;  5C0X J;  4C3I G;  2R6G A;  1ET9 A;  2KEC A;  1SNC A;  2V4D A;  3WOE A;  1JOQ A;  3VR5 A;  1S5C D;  4A93 B;  1LO5 D;  2B2U A;  4ABN A;  1II3 A;  2NN6 G;  4DU9 A;  2KJX A;  2F3W A;  5J39 A;  1SNO A;  4RGT A;  3CKI B;  2E75 C;  1JE4 A;  2EJM A;  4CBV A;  1HFG A;  1TWG B;  3Q24 A;  3GTO B;  3K5L A;  4OL7 A;  2RVL A;  4ULL A;  4K6L A;  4A3M B;  1G2S A;  1S5F D;  4ZAI A;  4NP5 A;  3GTJ B;  2PO4 A;  4V0B A;  1NAP A;  4CJ1 B;  1ZEQ X;  4UDU C;  3PIO 3;  1SND A;  2F0L A;  1EZ6 A;  1FYC A;  1F9S A;  2RDH A;  2PW5 A;  1HA5 A;  2NN6 I;  1DOL A;  1CHP D;  4ZLT F;  4WJW A;  4U67 3;  5E1F A;  2B2Y C;  2NUC A;  5K36 G;  1SE4 A;  1XX8 A;  3H6M A;  3NXW A;  2LS0 1;  3R2T A;  2A6E C;  1Q12 A;  1K83 B;  2Q8T A;  2F03 A;  2HDL A;  1HA6 A;  3K6O A;  1Y1V B;  3HOU B;  2AQ1 B;  3L3O C;  3OW7 A;  1GUN A;  4RH6 A;  2H4O A;  5M9O A;  1CQV A;  4A3D B;  3E0J A;  1BBX C;  2FFK B;  1SJH D;  2WP8 J;  4FF3 A;  2O2L D;  4V19 0;  3DEO A;  3OMG A;  4XQQ A;  1QNU A;  3J7Y W;  3QJY A;  3K5O A;  1D2B A;  3A7A B;  3TP6 A;  3I91 A;  1WTO A;  3T13 A;  3IFD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...