1OXUA

Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
353
structure length
353
Chain Sequence
MVRIIVKNVSKVFKKGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDDRLVASNGKLIVPPEDRKIGMVFQTWALYPNLTAFENIAFPLTNMKMSKEEIRKRVEEVAKILDIHHVLNHFPRELSGGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARALVKEVQSRLGVTLLVVSHDPADIFAIADRVGVLVKGKLVQVGKPEDLYDNPVSIQVASLIGEINELEGKVTNEGVVIGSLRFPVSVSSDRAIIGIRPEDVKLSKDVIKDDSWILVGKGKVKVIGYQGGLFRITITPLDSEEEIFTYSDHPIHSGEEVLVYVRKDKIKVFEKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the ATPase subunit of the glucose ABC transporter from Sulfolobus solfataricus: nucleotide-free and nucleotide-bound conformations
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transport protein
molecule keywords ABC transporter, ATP binding protein
total genus 103
structure length 353
sequence length 353
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2003-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17847 GlcV_C_terminal Glucose ABC transporter C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1oxuA03
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1oxuA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1oxuA01
1B8AA 4UNSA 3BRWD 4DNTB 4K0KL 1YJNA 1KJZA 4BLRA 4DV1L 2QP3A 4HZIA 4R2IA 3TREA 1OFUX 1XZPA 2F9LA 3WYAA 2W2VA 4ZI2A 2XEXA 1J7KA 1NE3A 2CEAA 3S1RH 1OFIA 2YC4C 3IEVA 2JDID 1TL7C 1UJ2A 2JEBI 1XBTA 2PCJA 3QNUA 3ZDQA 5AJXA 1PFSA 1FYCA 4EX5A 5FPKA 4AQYL 5AUOB 4A3GH 1ZNZA 1E9AA 4DV6L 3OESA 2OEPA 3O8DA 4QNMA 1E1RD 3BB1A 5HCIA 2F1JA 1TU4A 3RWOA 2N1BA 4PQFA 1W36C 1Z6TA 4EQ6A 5JECA 3K7AH 5HY6A 3AFQA 3LAWA 1YZTA 5FLMH 2FE4A 1OTCA 2OXRA 3LXXA 4BY1H 2IYXA 4JI6Q 3IBGA 2DNEA 4Q4JA 1PH3A 3SGIA 2KB0A 4KHPQ 2F55A 2K5HA 2QGNA 4U7DA 4EFMA 5GADC 4DT1B 4Q9IA 1G8HA 3FE2A 121PA 1IM2A 3NHAA 2JLYA 2UUBQ 4JLNA 2R2AA 2KCCA 1R10A 1J6QA 1X3SA 3J80c 2H17A 4PO1A 5EP2A 1CFMA 4KVGA 5FBRB 4EQ6B 4BGDA 4TZ0A 2CCGA 3CW2C 2VQSA 2ZETA 3SR0A 2QEQA 1RJ9B 3B1ZA 1EXMA 4R4CA 1KMHA 4IVRA 1P2TA 4PHGA 5M5WH 4JI0L 4LF4Q 1N6KA 4MYCA 4ZCIA 3IKJA 3U3RA 4BWYA 1FFHA 2YWGA 1DS6A 1G41A 4GKKQ 1GUSA 3I92A 4EUNA 1P4SA 4IVPA 1NL3A 3OE7A 2Q21A 2D74A 2IF2A 4KU4A 1CJKC 4F7WA 1XX6A 2Q3MA 1XNRQ 5A0FA 3TUZC 3ICEA 3B9PA 1TPZA 1Q90A 2ZUBA 2UXDQ 4H13C 3LQQA 2IBMA 3B1YA 2F1HA 3S17H 2O8DA 2WOOA 5IWAL 3EAQA 3WNDA 5DHFA 4TLAA 3FFAA 4DDVA 1PZNA 4QM7A 2HXYA 2Q2UA 1QF9A 4FWTA 1P2VA 3SFZA 4LGMA 1YNXA 2E2IH 4ARZA 1RC8A 3F2DA 3AB3A 2JJ8A 3ONWA 1JNYA 3LD9A 1YJ9A 1IN8A 1YJ5A 3STBC 5EUMA 2JASA 1WE2A 2OQKA 2HUPA 1I50H 2ZRGA 4EJSC 5JBQA 3K09C 3U3OA 2F3TA 2E2JH 4F4CA 3LV8A 4I7ZC 1IBLL 2LCFA 3PVSA 3TUIC 2ZM6L 1SVKA 1Y8OB 1HPCA 1ASYA 3I4NH 3A58B 2IHEA 3QENA 2J5XA 1L0WA 1G7RA 1T6NA 2CCKA 2C35B 3MWYW 4BEBA 1VQGA 2GF9A 1OH5A 3ERSX 2IX3A 1I4DD 2B8TA 3Q7PA 3DO6A 3M7NA 1LY1A 3WYFA 2IHBA 1VHTA 1XMVA 5FUWA 2OCPA 4P31A 1X6VA 4PAOA 1MH1A 2CNWA 1Y14B 4H1VA 3PJRA 4QC2A 2WSSD 3DM3A 1JAIA 1RZ3A 2GBLA 4XD7D 4P3YA 4V03A 1GRNA 1T9HA 1VYTA 1GL9B 2XSZA 4CT5A 1E2WA 2A68D 1KI7A 2OFXA 4KYUA 3VX3A 4ESVA 1P62B 3MXUA 3DHWC 4PZ6A 2ZPTX 5AUNB 4MUAA 4ZCLA 2ZE8A 2A9KA 4P4UA 2ANBA 1MRNA 1XD8A 1N5JA 2QG6A 2VTKA 4S35A 5F9HA 5KSZA 2CHGA 2NGRA 4DR6L 1NTGA 1G8PA 3THWB 1ZM7A 3W6NA 1T3HA 4F93B 1KL9A 4PAMA 2DB3A 1ZYRC 2ZROA 3R7WB 1FNMA 5HPYB 3IO3A 2D7DA 2FSGA 3W8NA 4Q4AB 4KFTA 4MDFA 3EX7C 4BECA 3T06B 3BJUA 1S8FA 4J15A 1LB1B 4CEIA 1KZ7B 1BDOA 3BDOA 1IY1A 3OW2A 4FIDA 3IIMA 3IRBA 1YRBA 4A0HA 4KSCA 1S1MA 4NONA 3CCLA 3ZD6A 4DUGA 3ASZA 1D9XA 2J0VA 4ON9A 4WOPA 3CB4A 1GD7A 2D2FA 4F4IA 1NY6A 4YXWD 2W6JD 4LYAA 3U7EB 1IYJB 3ZVNA 1LABA 2JK8A 2ZS9A 1KO4A 5JWHA 2FEMA 2Z83A 2C8VA 3CUEF 4M1KA 1N34Q 3AF4A 4NZYA 5JJKA 5C3EH 3AVXA 3VFDA 3ZZUA 3AV0B 1XPRA 2ZSFA 4NU0A 4X62L 3U4VA 1UF9A 4L9WA 1HT1E 4OO1G 1SVSA 1PUJA 2N3SA 2W2TA 2XZPA 2CLDX 1OXVA 3PEYA 2QE7D 1A82A 1VQIA 1HR0W 1M34E 4RY2A 4LC0A 3TQCA 4AY2A 2Z6KA 1GJXA 4H02A 3EG5A 3E70C 4DIDA 1JEEA 1NN0A 1Q1QA 1RYFA 2GAOA 2YZ2A 3CH5A 3MRSA 5FBQB 4A2QA 4EFNA 4ZO4A 1YBYA 4JVLA 1AE3A 2G6BA 1N2CE 2RAPA 2REBA 4L8JA 2EQBA 2ZRDA 4MRRA 3UWOA 2Z6VA 3B9QA 1X6OA 4TLCA 4G3XA 2YJTD 3ZIAD 5BYJA 1KRSA 5HGQA 1TX4B 2OAP1 3DKPA 3LBHA 1K5GA 2IYZA 3ADKA 3FVQA 1PJRA 1VMAA 4A93G 1Z6AA 2BE5D 4HLQB 4L15A 2PNRC 4JI5Q 1K8MA 1XEFA 1H9MA 1W4CA 1W4BA 3V00A 1GRRA 1G8FA 2P67A 4AKGA 5C4JH 1E2PA 4YLGA 1KI8A 4LI0A 2FSHA 4C3HH 2W0SA 4A3KH 3SJAA 2F1IA 4DDTA 4Q9LA 2JLVA 2MO0A 1NBME 1P73A 1FTSA 5D3MA 1Q1EA 2ZXUA 4Q00A 2QMHA 1LYLA 2F43A 1KO5A 1US8B 2IYVA 4PX9A 4C3ZA 1ZNXA 2BH8A 5C4XH 4A76A 1VDZA 5FTKA 3KJPA 4NCIA 1KC8C 5DSZA 4D82A 2UXDL 3OEED 4YDHB 4X64Q 4US2R 4LWZA 4PHFA 4LY6A 4OI0A 3QBTA 2H8KA 2IUSA 2A6HD 3X1YA 2WWWA 4R4TA 1HNWL 1VQ5A 1HE1C 1Z0JA 1II0A 4AYBE 1FW6A 3QI2A 2FZ4A 4A3DH 5EXXA 4LUOA 4X8LA 4AURA 1EGAA 4OQLA 4HDQB 4JVNA 4B76A 4LDJA 2AXNA 3S24A 3KZ1E 4KI0A 3LQRA 1Q12A 5IT9c 1BOFA 2PI2E 4PZ7A 1E2MA 4JI1Q 3G4SA 1KI6B 2QAGC 1G16A 4HLUA 1NVVQ 2XTZA 1W2GA 2PJRA 1PVOA 5CLLA 1Z0DA 4R2HA 4QHSA 2OAQ1 4Q4HA 1E98A 4HZUB 4P4TA 3CRKC 2UZIR 1E2VA 4NTZA 1O78A 2G88A 3GJ4A 3TGPA 5EE3A 1N0UA 2F3IA 2A6EC 3SYNA 1ZAKA 1VF5C 5JEAH 2IWHA 3RSLA 2IYYA 3HYTA 4DNIA 2WKRA 1YR9A 3W5OA 2UU9L 1C1YA 4P33A 2FDCA 3CNNA 1MOZA 4KAXA 4EPTA 1E9EA 2B7CA 3EASA 2WSSA 4PHHA 4XD7A 4RKFA 3LDAA 4ZDWA 4NCKA 2JLWA 2O52A 2K5VA 3G0HA 1B9NA 1AGRA 5LMUQ 2PT5A 3EPJA 4IJHA 3UXMA 1PHJA 1XU4A 1XNQQ 5BN5A 4YONB 1UAAA 1SROA 3HPRA 3VAAA 2OBMA 1EOVA 5FI1B 1E9SA 1P9NA 4Y0AA 2I0QA 2ORIA 1GL7A 2Q0HA 2CL6X 2FGJA 2C77A 5EP3A 1CKEA 1NSTA 4B48A 3ICQB 1FQJA 4GZLA 5KPDA 2CK3D 2XGTA 4B3RL 4OK5A 3SYKA 4DR3L 4BFZA 1IBRA 1GL6A 3VMFA 4BBSG 2WIBA 4LPSA 1RPZA 4PC3A 4GOKA 2HXSA 5K8TA 4D26A 4PPGA 4DLUA 2EDGA 1IQPA 2PJZA 4CEHA 4MRPA 1FJGL 2N46A 3RRNA 4A4DA 3EQLC 3PCOB 2JA6H 1W5SA 1G6HA 3KJIA 1Q0UA 4MKHA 5J4YA 2F1RA 2ZR7A 4W5JA 2C9OA 3T5DA 2CW0C 1F2UA 2IYQA 4K46A 4UXJA 2ASBA 3K8YA 1NY4A 4DV2Q 5DI3B 2YNMA 3VU9A 3VDYA 4GKJQ 2Q3HA 1W7AA 4CT4B 1KI1A 4B3ML 4LFCQ 4ZDKA 2AL7A 1IW7D 2D7CA 1K6MA 3L82B 8OHMA 1WMSA 3S15H 3NDBB 3QPVA 4ZV4A 4G7HC 1H9JA 2OBNA 2A5YB 3CPJB 1T3LA 4UNQA 2IYRA 4YMWA 4ZKDA 2RHMA 1IAQA 3EA0A 3E0EA 3DOFA 5FTJA 1I4LD 3JZMA 2VH5R 4DLXA 1K8AC 3HOWH 4G7ZC 1GKHA 1UEIA 1XF9A 3KFUA 1P60A 4JVMA 5EXPA 1GNPA 3IILA 3Q5DA 4A3LG 2J41A 1KO8A 3A36A 2C78A 3DZ8A 4AIMA 3H0GH 3B85A 5EZ6B 3NC0C 1YVCA 3CRW1 1E2DA 4A82A 3NBZC 4HEJA 4EPVA 2UUCQ 1GNRA 1MV5A 1KY3A 1OLOA 4LF9Q 1G4AE 3KJGA 4JL5A 3X1DA 4TYWA 4GT1A 3RSOA 1LVGA 1H8ED 5H1SE 1E94E 4JLMA 2GXSA 4IDQA 3U3JA 1HURA 5GVSA 4Q48A 3FMFA 2ODWA 2BM0A 3H4MA 3L0SA 5GJVC 4ESHA 1WBBA 5IYBG 4A3IG 4C2TA 2LKCA 2OXCA 1N6OA 1QHSA 3VQTA 4DV7Q 4DR5L 3GFOA 4R9UC 1OH7A 4LUCA 2K33A 3DMNA 4NL4H 4Q1FA 4OWXB 2GZHA 4EPYA 4XSGA 4L5SA 1JALA 1PMRA 1PH9A 1RYHA 3DMDA 1X3EA 1RIFA 3FB4A 3KXIA 3L2OB 2ORWA 3K0CC 2OILA 3ZH9B 1L1OA 3QG5A 4I81A 3QXXA 2BJWA 4M1YA 4QOSA 2JA5H 1LACA 4TL9A 4E07A 3K1JA 4Q1CA 5M3FH 621PA 1E7ZA 1FL9A 4GOPA 2J0UB 2WKPA 5KO2A 2WP8J 3BWDD 4LFAL 1M6NA 3IDQA 4LSGA 4BA2I 3LWUA 3B1WA 2PPBC 3J7ZC 1VQHA 1OW3B 3KB2A 1KSGA 4PZLA 3TSWA 1OF1A 2QT0A 1KDTA 4OHYA 4AQYQ 3B7GA 5KSYA 2JEOA 5C2JB 4DCTA 3GLHB 4M9SA 1E1TA 3RRYA 2K50A 4DCUA 3HKZE 1XEXB 1DPFA 3M1IA 3VHXA 2E74C 1YHBA 3K8AA 4LF7L 1XZQA 3M6AA 4DLTA 3NVAA 2REXB 4LV8B 1NIPA 2VP4A 4EDHA 2OBLA 1CKOA 1H95A 1QVFA 1JJ7A 4WZBE 5DE3A 3RNLA 4E5UA 1R6BX 3GP8A 5EAYA 4PG3A 4LV5B 4OYHA 3WBJA 3X1WA 3CCEA 5H68A 5LB4A 4DR6Q 2H57A 2NTYC 3UDXA 4JZKA 4BBSH 2BA1A 1JMCA 2AHOB 1MIUA 2LXKA 3PIPA 4HDOB 4A3LH 3CXCA 5KSPA 2CQOA 4BXXH 5J3BA 1YNNC 4OQNA 3V4RA 3GTMH 1IXRA 2P65A 1LF5A 1ZBDA 2Q6TA 1OJLA 1P16A 3TRFA 3T1TA 3E2IA 4HJ5A 2ZYWX 1UKVY 3FYHA 5B2ZA 2NMVA 2YTXA 4DVGA 2GXAA 3HPQA 1IN7A 4W9MC 5FLXc 5B30A 4KFUA 1JR3D 2QEXA 1E2LA 1HH4A 4E22A 1QHHA 4V0MA 4ZCMA 2DY1A 4IPCA 3GLGB 4GN3B 4X66Q 1ZM2A 1JXOA 3I73A 1SE8A 1DELA 2DFTA 5KDOA 1VF7A 1HE8B 4XIGS 2PQAA 1NBMD 2FG5A 2ZRKA 3REFA 2ZM5A 2QBYB 3AVUA 4XSHA 2R7ZG 5JEAG 1R4AA 4KSBA 4BLOA 1B23P 1XCMA 2VLIA 3A6PC 1UKZA 2JATA 4POGA 4B3SL 5CK5A 1KHIA 2EVWX 4PSKA 3HGBA 1CBUA 1L4YA 4G5GA 4B32A 5L3QA 1KK1A 5E3HA 3U5ZB 1ZD8A 4JBWA 5SZKB 1YITA 1CTQA 1JXMA 2EW1A 1KYIA 3BZCA 1IYVA 4O3MA 2VQFL 3GDEA 3RLFA 4BFTA 2PQAB 2DWOA 4HB3A 5JCZA 2BBSA 2C96A 2QRZA 4UJ5A 3LNNA 1N5LA 1CKMA 2OO7A 2JA8G 1OFHA 6Q21A 3ZVMA 4JYBA 4UP8A 3T61A 4BPBA 2EJMA 2J7PD 4OGQC 1HNWQ 1AA9A 5JSZA 3KTAA 1K8RA 1DOAA 4Q19A 1W47A 3LLMA 1OB2A 1JJCB 1ZW6A 2CWPA 1XTRA 3FKSD 5IYDH 1AM4D 1E99A 2R9VA 2WPDD 1KSHA 1YQTA 1Z8FA 3CONA 2W6ID 3LBNA 1OHHA 4P4SA 1KI3A 2ZSAA 2E5LL 1Z6XA 5TXGA 1Z22A 2EFEB 3CH4B 1MO4A 1S4QA 3IPXA 3OAAA 3Q72A 2PCLA 2QROA 1D7QA 3PV0A 1G64A 3CO5A 4M4SA 4KMUC 1SN8A 3CCQA 2KBNA 4G5OA 1CU1A 1ZIOA 4GMXA 2GTPA 2IYUA 1W5TA 3UDFA 3DPUA 5AJYA 2CJWA 5C1BA 5A5GA 2JLUA 4P74A 1Y8PB 4KHZA 1KKLA 3MAAC 4NXNL 2GILA 4LYJA 4Q7MB 1ZMXA 5G41A 3WMGA 3Q7QA 1KSJA 1SKQA 2QORA 3AKYA 4DR3Q 4A3KG 1R8SA 3KOJA 4Q1EA 5HE8A 1JQJC 3LLUA 3O8RA 2UU9Q 3B60A 5JS7A 4B6EA 4H0LC 1M8PA 2RB4A 4G0NA 4R7ZA 1R0WA 5GAHC 2RGCA 1FUKA 1P2SA 3BK7A 4FCTA 5FPSA 1DAHA 3C16C 1GFIA 1FJGQ 3UPUA 1HZCA 3R9WA 1XEWY 4PXAA 1KZGB 3CCJA 1VG1A 2CNWD 1UBFA 2V54A 3K9LA 2FSIA 2ZI4A 4Q18A 5C4MA 2FJUA 3VR6A 2I4IA 4DR2Q 1V43A 2UXBL 3THXB 1UKYA 1VG8A 1IXRC 1YR8A 1O3YA 3GJ0A 4A4IA 3OEHA 1H9KA 4Q66C 3T53B 4RZXA 5SZJA 3G5UA 2DN8A 3T15A 3HOXG 3ADDA 2GVBA 1HNXL 5BN3A 2PMDA 1QHGA 3TZUA 1I6VC 4IFDH 1MABA 1XD2B 3J7A5 5AJ3L 3CRMA 3AVWA 2AN9A 2XNDA 3WNBA 2BBTA 1DAEA 1X8JA 2GF0A 1ONLA 1TXYA 2LWIA 2RGAA 3KYHC 1VQ9A 2ZRIA 2B29A 3C15C 1EFUA 3SOPA 1KK3A 1VQEA 1X54A 2ZYUX 4JL6A 2MMCA 4QGHA 2QL6A 1E22A 2MNAA 3F5FA 3QY0A 4TMWA 3SZRA 3I61A 1X8LA 2RGEA 2MSDB 3QF7A 2F43B 4DDUA 3TAHA 1VECA 2WJGA 3T5GA 4DLVA 2ZE6A 3S16H 1UEBA 4GNXB 2ZAOA 2ZSDA 4IOMA 4UJ3A 1N36L 2XGJA 3I62A 3A8JE 2VP0A 3TSOA 1J2JA 4A93H 1R8QA 5CJ2A 3TH5A 4N1AA 3FMPB 3VHLB 4OK6A 1XMOQ 1Y1WG 4LBYA 3I4MG 3S1NH 3CF5A 1CXZA 1D9ZA 3F2CA 4P71A 3PF5A 1P7CA 2IYWA 2OHFA 1Q8KA 4JG2A 2RGDA 2WWXA 3K0AA 3QIAA 3OFND 3CP0A 1ZU4A 4OHVA 1U8ZA 3NDPA 5HCNA 5LMNL 3IBYA 5EQTA 4GLVB 4KYIB 4OBEA 2EYUA 2IXGA 1WP9A 4DSTA 3SU8A 1OH6A 3QPUA 1CI3M 3PQCA 4QHYA 3U60B 2V7QD 5HZKA 1HTWA 1N6HA 1R0XA 3AP1A 1PUIA 3TJZA 4A6XA 5CDFE 1NY5A 4PQYA 2Z0MA 3CR7A 4HI0E 2RF4A 2XTIA 4GOXA 3T1VA 5M3MG 4DV0Q 1VQOA 1A7JA 4PHTA 4HLDA 3OZXA 5TDHA 3GEEA 4MGKR 3I2ZA 3P26A 1EWIA 2OCEA 1N6IA 1T5IA 2C5LA 2CXXA 4LYHA 4MA4A 3H3VI 4PC7A 4QGFA 3THXA 3UDGA 1EFTA 1KNQA 3DM9B 4UKDA 2B8FA 2CCZA 2OLKA 5DYIA 1QHYA 1VCMA 4DUGD 1E3PA 3R8CA 3ADBA 4JBMA 1IJEA 2OCYC 2ZJ8A 3K9HA 4Z8YA 2EVBA 2ZJ2A 3BD9A 5JHGB 4A9AA 1NG9A 1EQRA 3ZJYC 3CCRA 3M4OH 3EA5A 2FPLA 1LW7A 1VQPA 1PLKA 4DV1Q 3L0OA 4IJMA 4QIWE 1DEKA 4OI4A 1EFWA 5FFMA 1W0KA 3M4QA 4A3MH 2HHHQ 1XDBA 2GJ8A 5C0XH 3EC1A 3MSXA 4QFMA 2C9CA 1GM5A 1XMSA 1ZJ6A 4O2LA 5E4FA 5C46F 4UNPA 4UP9A 1XEWX 2XXAA 5M5YH 1CRPA 3F2BA 1G3IA 3MWJA 4FI3C 4F91B 2ZYVX 1W36B 2PX0A 2A7QA 4URWR 1CRQA 3TAUA 3DL0A 3TMKA 2H7VA 3C8UA 1XMQQ 3FMOB 4QKQA 3TW8B 3I56A 4M1MA 1KY2A 2EJGC 1NIJA 4DLZA 3QXSA 3H15A 3RN2A 2P2LA 4DLSA 3S2DH 1JE5A 2F9MA 3M0EA 4EFLA 5EP1A 5CIQA 4F38A 2HV8A 4LF9L 5FL7A 2P6NA 3EPKA 4RKEA 3PSIA 2UUAL 3WP0A 4TL7A 3I4MH 4A1FA 1TTTA 1ZC3A 3D7MA 4LJ4A 4BQSA 4JJZA 5DIFA 4LNQA 1TEVA 4DK3C 2I5LX 2OFOA 3LW8A 4DCVA 1G5PA 2CFMA 3RS3A 1I4TD 2H18A 3MG9A 4LJ8A 2CLSA 4IDOA 3FDIA 4KV9A 4AYXA 1UFQA 5DH9A 1XJ0A 4JYCA 5J4HA 4HJAA 1JAHA 4LF7Q 2WV9A 1CEEA 1EWHA 5JCPA 1GRQA 1VIYA 2R92H 2PMZE 5DLQC 4UQOA 2ZRAA 2KBFA 2I1QA 2WAYA 3N2EA 4NP6A 1NJIC 4MKFA 2E76C 1XPUA 4KKTA 1BO6A 1F60A 1W49A 1K3RA 4KBFA 5CIWA 4OHZA 4DV5L 3R8FA 1AS0A 4GOJA 4A15A 5FBVB 1XNRL 2ODBA 3P4YA 4QHTA 4CDGA 1Q86C 1Q46A 1GIAA 1G19A 1N6PA 2BMEA 3AKEA 5FPTA 1AQUA 2A5FA 1EIFA 1P61B 1LNZA 4RJLA 1RJ9A 3QJYA 1TAGA 2ZI5A 2J7PA 2GCOA 3NBYC 4JV5L 2IT1A 3TQYA 4DKAC 1Z0KA 2O8BB 3FMCA 3BE4A 3VTKA 5H8WA 1J70A 4AYBG 3GEIA 3DOEA 1E2EA 1YZNA 2C99A 2QSYA 2QUZA 3S1MH 5KU1A 4RFVA 3PEWA 2QPOA 4X8OA 2ONJA 4M53A 1ZYUA 2E1RA 2EXDA 2L5TA 4Z1MA 4Q47A 3GJ3A 2XITA 3AM1A 1XXHA 2ZRHA 2KSQA 3LRPA 2X1VA 4IFDI 3BFVA 4NXMQ 3HOYG 3W3AA 1XXHE 2A6HC 1DAMA 4MRSA 2LMCB 2QAGA 3CCUA 4V0NA 4A8JA 4DJTA 1SVWA 2IUTA 1G9XA 3RN5A 3P1JA 4UNNA 5G3ZA 3HWSA 5TY0A 4DUZQ 2AXPA 1MJEA 1Z29A 5IDVA 1SVOA 2JIZD 1U9IC 4JL8A 5SZHB 4L16A 2VL6A 1S3SA 2MSCB 1HCZA 2K32A 2A78A 1U99A 2O0KA 4FCVA 1ZM4A 3BOSA 3SJBA 2O8FA 2ID0A 2EYQA 1IHUA 3CF6R 3O47A 2F52A 4ME3A 2OTLA 1DO0A 1TU2B 2Q2TA 1T5LA 2VZAA 3ZJYA 4BZQA 4TT3A 2FN4A 5HR5A 3OOCA 3EZFA 2Y0SE 4GDFA 2JA7G 1K0RA 3M9BA 1GVNB 4EKDA 3AGPA 5M04A 4NYIR 1AH9A 1FVIA 3NH9A 2X19A 3A7LA 2KCMA 1UE6A 1AZSC 1U0LA 5L3SA 1GG2A 3PF4A 4Q02A 1GP2A 3HFZB 1KD1C 3UATA 1W0JD 4V0ME 3TLXA 1YZKA 2R62A 4P4SB 3H94A 4F4JA 4JBJA 4TMTA 1C9OA 2WICA 1FOEB 4PFSA 2NVYH 2BE5C 3GQBA 4HJ8A 4K0KQ 1UM8A 3BH7A 5EE5B 5EE9A 4DSUA 5JZVA 1TQ4A 2QSZA 1KDOA 2RKOA 5C0XI 3AQ4A 4GZMA 2J9RA 3ETLA 5IYCH 3T35A 4B3GA 3GLFB 1YJWA 5LMNQ 2JLZA 2R93G 2EWVA 4DDWA 2ZVQX 2X77A 2R6CA 1WA5A 1TKWB 4QGUA 3G6EA 3TR0A 5J40A 4HAVA 1SQ5A 2MQHA 4JYAL 2VHCA 2QE7A 2NZJA 2R92G 2D0PA 3GCGA 4G5QA 4HIDA 4P73A 1UEJA 2ZTEA 3SQWA 3UK6A 5IHPA 3MXNB 4NXNQ 1EFRD 2D5DA 4RFSB 3JC66 4HZUA 4I1VA 3A7AB 3P20A 1GKIA 3EZ2A 1FR3A 1S0UA 3R20A 2KHIA 2CLCX 4ITRC 4A0GA 2NO1A 5K8IA 2Q3FA 1BVSA 4RD4A 4BFVA 2BKEA 5DNYB 3VNUA 2WHXA 4TMVA 2W83A 2FSFA 4IFEA 4B2LA 1PH1A 1FX0B 5JS8A 4WAUA 1HA3A 1SMYC 1CS4C 2BDOA 1G6OA 4YHHL 4F92B 3U6BA 1NNEA 3ZS9A 2QF7A 3M85A 4YY3L 3ND8A 2YC2C 1OYYA 3H84A 1TWAH 1SR3A 1IBML 2VP9A 2W58A 2YINC 4A3JH 4MKGA 1KOFA 3OIVA 5DI9A 3CQZH 1CR0A 1JJ2A 1Q3HA 2HLDD 4M8NE 2B6HA 2FOLA 2G1JA 4YDSA 1VQAA 1TF7A 5HKKD 2QI9C 2YTYA 2C03A 2ZEJA 1CF4A 3AVPA 1K8GA 2WWFA 2V8OA 3CR8A 5C0XG 4IOCA 4A3EG 1S96A 2FXQA 2ZT9C 1V8QA 4R4OA 4OX9L 2CL0X 2RMKA 1W2HA 2OCBA 1E0AA 5H70A 4DHEA 4DR7L 1CR4A 5JI2E 3CCVA 1VQ6A 1C7YA 2ORVA 3IGFA 4LK2A 1KAWA 5GROA 4X8HA 2A1AA 1DO2A 2D06A 4LJAA 4PSAA 4AC9A 4EPWA 3I5XA 1Y69U 1EX6A 1XD2A 4LHWA 1AK2A 3UKDA 4DKXA 1VQ4A 1QBKC 3AF0A 3QKUA 4BBRH 4TTRA 4RD0A 4OWWB 2PL3A 1T4GA 3RNUA 3KX2A 3QKSB 1P8LA 1TU3A 3CZPA 2WJVA 3SYLA 3LY5A 4R1JA 3KFVA 3KTAB 1B9MA 1SXJE 2A68C 1E1QD 4X66L 2J0QA 1HNXQ 2VF8A 4DUZL 5GAGC 3U7FB 1KQSA 4OL0A 3UWKA 3J81j 4C0LA 4LHXA 3VX4A 3VR4A 4XJXA 4Y7NH 1ZD9A 2OE2A 1OYWA 1AKEA 1CSPA 1EFCA 4RZUA 1GUTA 1G17A 3C14C 4LBVA 1ESNA 4D81A 4QGGA 3PENA 1NKSA 1R5NA 2CK3A 2GRJA 4LK1C 1LFDB 1SHKA 4URVR 2DUDA 1HZAA 3ULLA 1J90A 1OHHD 1GSIA 1ZUHA 2O0HA 3S2HH 1HZ9A 4JLAA 4IQZA 1W4RA 3L7ZC 1OXUA 4XWAA 3THYA 1VIAA 3N5CA 4Q03A 2R7FA 3HOZH 1X55A 1ZU5A 3MJRA 4MRNA 1A63A 4HLUC 4POAA 3B6YA 2DYKA 2RH5A 4OXPA 2QBYA 4U00A 1HEIA 4IRUB 1JR3E 1YVDA 3NBFA 4RCNA 4O2DA 3PITA 3ZS8A 4B75A 3H0KA 2BCJQ 3BH0A 1YRAA 2A8VA 1E9RA 4B3BA 4C4PA 3PR1A 4GSYA 4JI5L 4FMCB 1RRPA 4TYNA 4D25A 4Z1MD 1VG9B 4DUYQ 2BEKA 4Q01A 1GO3E 1NN3A 5LB2A 2YTVA 3V9PA 1E79D 1J8MF 1T3SA 1BIFA 1Y1VH 1GDDA 5J5CA 3THYB 3QUSA 4MDEA 1DXMA 2XXAB 1LS1A 2E5LQ 3H1TA 5BQ5A 3B6EA 5LPNA 3J81k 1NI3A 4BA1I 1KK0A 1H65A 1WB9A 2GAAA 1Q1BA 5FOSA 2QPAA 1QHNA 2HHHL 2CHVA 3HOWG 1L7VC 2JIZA 3PO2G 2G0TA 3OF5A 4M1TA 2NN6G 1T8TA 5K36G 2OUKA 2ZRMA 3U7HB 1T5EA 3TIFA 1G18A 3HOXH 4YMSA 4B74A 3GJ5A 4GN4B 4MYUA 3U58A 3CRQA 4AK9A 3U50C 3P27A 1NN1A 2FEOA 1CP2A 4JI4Q 1QZGA 3CPWA 3RS4A 4BFXA 5E7NA 1GUGA 2HT1A 2BCGY 2J3EA 4UP7A 3Q9LA 1TUIA 2QZ4A 5IP9H 3JVUA 4M9QA 5G3YA 2JLXA 2OTJA 1IYUA 1IBMQ 4DRZA 1OIXA 4TMXA 3H2YA 2F7SA 1Z6GA 4OI1A 3KJOA 4CF7A 1F6BA 3KQHA 4CEHB 2K52A 4P75A 4HAUA 2ZTCA 4C7OB 4CGZA 3W1GA 2D62A 4M9ZA 4LW1A 3AGQA 1M7HA 1KO7A 4QY7A 3OHMA 4NBSA 2YKGA 1U5KA 1VTKA 3GJ6A 1A1VA 1GHJA 4WZ6A 2FFBA 2VL7A 3KXKA 2VYFA 2BWJA 4X6AH 1I2DA 2VEDA 5CB8A 2ZJYA 4IVQA 4MGIR 1PLJA 5KSOA 2ZSEA 4DT1A 5K8UA 5EE0A 2GCPA 1IY2A 1G8GA 3TE6A 2IS1A 4YCVA 5AJ3Q 5GJCA 4QGAA 4DV4Q 2F1MA 4DR4L 1UBGA 3ADCA 1HQYE 4TZ6A 4QL3A 4HAYA 2ERXA 2V6JA 3L8YA 4JMPA 3X2SA 1NMFA 3IEUA 4PTLA 1KI9A 2XJ4A 3U7GA 2XTMA 1H8EA 2GJKA 4YHHQ 2NQ2C 2Q2IA 3EN2A 4RZ2A 2J1LA 3A37A 1SLJA 4QJ3A 1H9RA 2FX3A 3VKWA 3BZKA 3P32A 2JA8H 2W00A 4Q9HA 4PZYA 1ZRHA 4N0EA 4AYWA 4OQFA 2ZU6A 4A75A 2AKWB 2EIFA 1F2UB 1V5WA 1JR6A 2NZHA 4MTNA 4PO8A 1HY3A 1XD9A 1CJMA 1ZD1A 2BBWA 5L3QB 4IEIA 1E96A 1KJWA 2BVNA 2R44A 3D8BA 1FNNA 2XNDD 3CF0A 1DARA 4Q21A 2N49A 2J46A 2IX0A 5F98A 4JYAQ 3S1QH 1TF5A 2PX3A 4XH9B 5CYPA 1OIWA 3GLIB 4PZ8A 1PH8A 1ZNYA 2GA8A 4JKYA 5FOXA 1US8A 2A5DA 1VQMA 2WVJA 2UVQA 1P3JA 5JWOA 4M21A 1U2RA 2AD1A 4LHZA 1EQQA 4KLKA 2CHQA 2ANCA 2FA9A 5JMTA 4A3DG 4R98A 2J87A 5KTYA 4KO8A 5FOVA 1KI6A 3QBVA 1BYUA 2O5JC 1VQ7A 2JLSA 3UIEA 2BMJA 1R9TH 2E87A 3AEVA 3LA6A 1T0HB 3K0AB 4LRWA 4D2IA 5BW8A 3GLIA 4LJYA 1IONA 2IWRA 1XMIA 2ASEA 2ZRPA 4IFBA 2R8RA 4IOLA 3MMPA 4PR0A 5EXTA 1SXJC 5FBLB 4DXAA 3AB9A 1N0WA 1YR7A 3QVUA 1WFQA 3RABA 1Z7TA 1F48A 2WOJA 3PIRA 1VQCA 2VP2A 4FN5A 4LHVA 2O8EB 4AI6A 2GBLC 4HUQA 5JWRA 5FL7D 2QA4A 1TADA 3VA7A 3CNOA 5CITA 1Y1VG 3GTOH 1BBWA 3F3YA 3WYGA 1WJJA 5H1YA 2HJVA 1LUZA 4FMCF 1ESMA 5AWFC 3G82C 5TV2A 2KBEA 1OXXK 2OZEA 1OFTA 2N42A 2PBRA 1GILA 4CW7A 1QVGA 5IF9A 2FWRA 4ZKEA 5C4GB 1JPJA 2UZ3A 3GLFA 1HZBA 1EG7A 1G7SA 3E9IA 1M1KC 1EYGA 2CDNA 4C7OA 4QM6A 4O0AA 3WHKA 3T1HL 2CE2X 2KHJA 5FTNA 3MEFA 5B58C 3VR5A 5J4LA 1JB1A 4KBGA 2R65A 5G53C 2KA7A 1KXLA 4DV2L 3GLHE 2W6IA 4B47A 5GADl 4UXHA 4OJKA 4DV7L 3J80i 4DR5Q 2ZJQA 2DWPA 4B3FX 1TWHH 5BN4A 5M3FG 1HNZQ 1H8HA 1QUQB 2AK2A 5JEEA 2OFWA 1XTJA 2G77B 5BYKA 5EP4A 2L15A 3I4OA 2OWOA 3F1ZA 1P75A 4CRWB 1KIXA 4XVUA 2XZOA 3UDIA 2DPXA 4OX9Q 1S9HA 4CYMA 4JC0A 2ZJRA 1SFOH 2BC9A 2QTHA 4MUBA 3TQFA 4B43A 1TMKA 2VPPA 1ZNWA 1YHQA 1JT8A 3E5HA 2JQOA 4JI7Q 1D5CA 2MMGA 4QBGB 4ACAA 1RE0A 3REGA 3I72A 3Q5EA 3EPLA 3KQNA 2GK6A 4QJ5A 2CCJA 3GLHA 4KODA 2O8CA 4PSVA 1RRCA 1HQMC 4HJ9A 1UE7A 4Y52H 1F2TA 4FINA 1M7GA 4RSGA 3UMFA 4APVA 2BV3A 2J59A 3RDPA 2NVXH 1KTVA 1R0YA 2BJVA 3ZLJA 4GFDA 4JV5Q 2WPDA 5GJWC 3BORA 1N5KA 2WWYA 5FJ8H 3RR5A 1PYSB 1KMHB 1RW4A 5BWMA 2HIXA 2DR3A 3SQXA 1CJTC 1ZINA 2BEJA 4H1UA 2CMKA 4II7A 1VS0A 4JLJA 4JSTA 2YU9H 1I2MA 1XNQL 1AZTA 1JJVA 2AHOA 4DNRB 1W3SA 2Q2HA 1E6CA 2NG1A 4GKJL 4HAWA 1IN4A 5DN6A 4DC9A 2O8CB 2Q8IB 3W8RA 1JR3A 1QZXA 2K5NA 2VSXA 4EAQA 3BFXA 4Q9JA 3BG3A 4AD8A 3AP3A 1Q20A 3RWMB 1SKYE 3HP1A 4NXML 4GPTA 3ZQJA 2D0OA 4BFYA 3MCAA 3A5UA 1IOZA 1XTKA 2WMOB 4G5RA 3VR3A 2R6DA 4BLSA 4W5WA 1VQBA 4UNRA 4C3JH 4YMTA 1ETUA 2CJWB 2QAJA 3CPHA 4Z8XA 2VO1A 2WJHA 2Z0SA 1RFLA 4OHXA 2AMCB 5E7MA 1I94L 4JI2L 2XOKA 3RYTC 3PUYA 3OAAD 2GNOA 4K8OA 4LWCA 5JEAJ 3K0CA 5DN6D 3VR2A 4ALPA 4C2MH 4IOAA 3QOFA 2XB2A 3CNLA 3NG1A 4P32A 1FMJA 2G9NA 4DR1Q 5GQOA 4BBRG 4L5RC 1UKEA 2RGNC 4JS0A 2VW9A 4LJ6A 3LNCA 1OIVA 4JJKA 4PO9A 2KJQA 3THWA 3DXJC 3A1WA 3GTGH 5IT5A 1DAKA 3IHLA 5FI0B 5FTMA 2G1KA 2AUJD 2YOGA 5JJIA 1NMYA 3OPOA 4GZYC 2WAQG 3FKQA 3T56B 3D0FA 2AFHE 1SXJA 2I1VB 3B5JA 1K5DA 2JJ1A 1GNQA 2VBCA 2XOKD 4M1WA 4QJ4A 5TVKA 1B0UA 4KFSA 3GTPH 2RCNA 3OTOL 1G21E 1R5OA 2OV2A 2B8GA 3HOUG 3FGNA 2YOHA 3FTQA 3EIVA 1VKJA 3PUXA 3I4NG 3HYRA 4LFBQ 2R93H 3I8SA 2DFKB 2Z6KC 4HAZA 1M7BA 1WCV1 1XEXA 4DAYB 1NVUQ 1GHKA 1RKBA 1T0JB 3RVBA 1E2KA 2IYSA 5KNDA 3AF2A 3TK1A 2QM7A 5AUPB 1E24A 1EFHA 3RHFA 1WYDA 2QN6A 4O0MA 821PA 2GJSA 1E2IA 1FX0A 1AN0A 4LF8Q 1R7RA 2AKYA 1YEZA 2RHQB 1D8LA 4LUZA 3UE1A 4N0DA 5CM8B 4JCVE 1CTMA 2ZUDA 4DK0A 1EWRA 5GVRA 4WJ4A 1H9SA 2GJAA 3NEYA 3NXSA 4BY7G 3SNHA 1NF3A 5IK2D 1X1SA 3EZ7A 4PMWA 4PANA 5JSZB 1G291 2ZTSA 4LF6Q 4D6PA 1OV4A 1M90C 4Q1DA 2UUBL 3A4LA 3C41J 1Q82C 4G5SA 2PNHA 4J0QA 1RL2A 4A92A 3RC8A 4AIIA 4URYR 4B34A 3H86A 4FMDB 4TVAB 3KLRA 2WBLC 2CWAA 2YHSA 4HJ7A 4M1SA 1UDXA 3RS0A 4D0NA 4BLTA 3FHCB 4DSNA 1ASZA 1WF3A 2HIVA 4DSOA 2GVDC 4NYJQ 4DWJA 1XMJA 4I99A 4Y0VA 3TNFA 1QRAA 2IK8A 3TBKA 3X1ZA 2VS1A 1UADA 2YWEA 3NENA 2G83A 3I3SR 4POFA 3K53A 4QG7A 4XTCS 2H5XA 1Z2AA 1XTSA 4TLDA 2CBZA 3U6KA 3ULJA 5IYCG 3GJXC 1P9WA 2Q9AA 4C0JA 3CCMA 3A1SA 2I5MX 2K75A 2D3WA 4OI2A 2AWOA 4A6PA 5AJVB 2WZQA 1FMLA 2UUCL 2ZS7A 3KF6A 3T1HQ 1IW7C 2ZJPA 2IF0A 1E2NA 5BXQC 2IYTA 2JE6I 1N6NA 1G3QA 2D2CC 1PLLA 1XJVA 4D4KA 1VQJA 3BXZA 3SHWA 2ZJOA 2JJ2D 3TRZA 2PEZA 4KFRA 4LX0A 4URZR 1S3GA 2FMXA 4GNXA 5KDLA 3U61B 4WBSA 1N5IA 4LPKA 4TSFA 4BZXA 3KKOA 2DNCA 721PA 4DB4A 3GTKH 5FR1A 1BS1A 3BB4A 3NH6A 1Z83A 3B13B 4A8JC 4L5QA 1NMZA 1ZP6A 1LS6A 2NN6I 4A3GG 1KDRA 2QAGB 3D31A 1Q22A 5AJWA 4IDPA 3CX6A 3ZGXA 5JHHB 4TYQA 1NP6A 2GETA 2GZDA 4FXPA 1EWQA 1HQCA 4W7SA 4IJLA 2HEIA 3SE0A 4BRWA 4LF4L 1NBMA 1WCMG 1G20E 1EX7A 3WWVA 1JB7A 4PPQA 3EIHA 3A0JA 1F3OA 1GWNA 2BMDA 2R6FA 2ZI6A 4A2PA 1KSFX 2WAQE 2ODNA 1YZLA 2NPIA 5LD2C 1EK0A 2AUKA 4BY7H 3Q8XB 5FOTA 1HR0Q 3ECCA 5F9FA 2I5HA 4C3IH 2QTFA 4CZ2A 4DEXA 3SN6A 5C0XJ 3MWKA 1SULA 2EWWA 2GEVA 1OSNA 2QTVB 3BS4A 5L3VA 3GJ8A 2TMKA 3IPYA 4TTQA 3PGZA 2BOVA 3I55A 3GD7A 3T51B 4JI8L 3I5YA 1I3QH 2E9SA 2NO7A 4NCHA 3ULPA 1G4UR 3AF3A 4KKSA 3HDTA 2UXBQ 4DAMA 1GUNA 3EBEA 1E32A 1ZUNB 3RZDH 4TKOB 4KHPL 1WDTA 2UXCL 1X86B 2K4KA 3PO3G 2IXFA 4I4LA 4Z51A 2JEAI 3HR8A 4UY8C 4DBLC 3WMEA 2A6ED 4TLEA 1N33L 4IDNA 3HOUH 3FPPA 2FGKA 3N70A 3H3VH 4DLWA 2HQLA 2VUMG 4Q7LA 4OO1H 1OXSC 3PIOA 1FTNA 1HYQA 2IUUA 3AFPA 2QMOA 2YV5A 5DGXA 4LZZA 1JJGA 1K8OA 1SMXA 1YKSA 1BYIA 3RLOA 5C3EG 5C44H 1U8YA 2V9PA 2HCJB 2DFLA 3LVQE 4JI0Q 2B63G 3QEJA 4GI7A 4AWXA 3CC4A 1LF0A 1UBEA 2Q9CA 5SZIA 1ODFA 5FPYA 1FGUA 1N32L 4B3TL 1MABB 2P5TB 2PT7A 5J4VA 2ZI7A 3ZD7A 2KI5A 5FUXA 1YZ6A 4MYHA 1IXSB 2FFHA 2YYZA 3CWQA 1W0JA 4OWTB 3LVRE 1GZSA 1E2QA 1AJEA 3FKIH 5M3MH 4HR7B 4OQMA 5IWAQ 5F3WB 1RRFA 5IP7H 2UKDA 3IFTA 3NC1C 3QF4A 3AKDA 3HR7A 1NBWA 3CW2A 4DR2L 3CD6A 3OE7D 2XX3A 2ZR9A 1BMFA 1LTQA 3A8TA 4RVCA 4CEJA 1OPXA 2ZR0A 4TYPA 2ZJBA 1Q21A 2P5SA 2ZITA 3SI7A 4D4JA 4IW3B 4NPHA 4ZIRB 4AG5A 5D3QA 4N3NA 1XJCA 4B35A 1A0IA 2WIAA 2E2HH 3AUXA 2NOAA 1V1QA 3UANA 4YMVA 1EESA 1L1OC 2VY3A 2XB4A 1L8QA 2JLRA 1PH4A 3KF6B 4US0R 5FJ8G 1XNJA 4QBIA 2QPTA 4LF8L 3SJCA 4X65Q 1QVAA 2R6AA 2O5VA 5EUQB 5TB5A 1NG1A 4KXFB 1AGPA 2PMKA 2B8WA 2MFIA 2V1CC 2VIIA 2IS6A 5FH9A 4YCUA 4O25A 1XRJA 2GCOB 1A4RA 2XSZD 3PUZA 1YI2A 1XCGB 4Q7JB 3FOZA 3RANA 2QM8A 4GN5A 5JLJA 2QGQA 2XZLA 4IEEA 1IY0A 2MSEB 5TARA 1UWVA 4DCNA 2AK3A 3DVLA 1PA6A 4JBXA 4GL2A 3SC3A 3QKTA 2WB1G 2XAUA 2H16A 1FZQA 4JBYA 2ZSBA 4IFDG 4A3CH 2ZM6Q 1R0ZA 2EFHB 2HCBA 4MNOA 3M4PA 2O8DB 4G7OC 1ZVQA 3TVTA 4KJZA 2LKDA 4ILEA 2BDTA 5GAEC 3GPLA 3U2QA 3R9IA 1NVXQ 1DAIA 4BLQA 2ZI9A 2O8FB 3IIKA 1QZHA 2GXQA 4DCSA 3RLNA 3KJEA 1B7YB 1MRSA 2PZEA 2REOA 2UUAQ 3ER0A 1EIYB 2BKUA 2FZLA 3OIWA 2GHIA 3ZIAA 3CBQA 2RGGA 3L0PA 4W5HA 1ONBA 4A8JB 1GKUB 1MO6A 1FQKA 1G3UA 2HF9A 2ZRJA 5E95A 1E1QA 1FP7A 3WP1B 1Z3IX 1N6RA 1DVRA 2AX4A 4B3CA 3A1VA 3KB1A 4MGYR 4Q1AA 2ATXA 1OKKA 3CCSA 2VP5A 1E1RA 3RS7A 2GK7A 5J4KA 3NEMA 2AKAB 2B7BA 3IO5A 4FWIB 2OLJA 2EFCB 221PA 1GAJA 3PEUA 2BH2A 1QHXA 3QXCA 2ZTDA 4B73A 2JAQA 3KXLA 3LO5A 2HDNB 2PCFB 4P0TA 4DV0L 4KN4C 4DLYA 5JRJA 2W6JA 1Z5ZA 4B3TQ 4A3CG 1TWCH 3CC2A 1DG1G 1S1CA 4PPNA 4Q1BA 3T1OA 5FUVA 4NYMQ 3KKMA 2FFQA 1F5NA 4L5BA 5CYOA 4EIWA 2RGBA 1OE0A 2ZUCA 4LV6A 4PPFA 3EIQA 1DTSA 2RHSB 1A8VA 5FLMG 1QDEA 2ZS8A 3QQ5A 5ELXA 1Q3TA 3OEEA 4Q4JB 3WRXC 4U02A 3O8BA 1TEXA 2B3GA 4DIEA 1NN5A 1FL0A 1N34L 2JDIA 3NTUA 1ZUIA 3HKZG 4FMBB 5DHAA 2OM2A 3R7WA 3UG7A 1BBUA 1IL2A 3BIFA 1XCPA 2HYDA 2RGXA 5JEDA 1ANKA 4D4LA 3AF1A 3W6PA 1HT2E 3DEFA 4KCGA 3U44A 5ELNA 1BKDR 2V1UA 2AR7A 4PAQA 3A4NA 2VSFA 4L8GA 3CRVA 3OW7A 2C2HA 4PC1A 1H9SB 5A35A 1K73C 2V7QA 4RFSA 3SBEA 4MH0R 1KMQA 5JI3E 3T1YQ 4JLPA 3L43A 1SHZA 2F6RA 5FOUA 4DZZA 3K9GA 1T8UA 1IBKL 4LC1A 2ZJZA 4KKUA 5LD2B 2IS4A 4C0QC 2ZE7A 3CPFA 3STBD 1YHNA 2HLDA 4QL5A 1N32Q 2V55B 3HU3A 3NBXX 2DBYA 5IYDG 3QXJA 5HE9A 1CJUC 2CVFA 3KF8B 3BFKA 1HR0L 5IP7G 4DB2A 2IY5B 1E2HA 2OT3B 3FKIG 2WMNB 2VQEQ 4HATA 4YY3Q 1TQ6A 4IFDJ 2X2EA 4JI3Q 2PZFA 3DM5A 2H92A 1E9CA 3G48A 4WVFA 4BE7B 1GUOA 2JA9A 1ZKOA 3K0SA 3QKSA 2CL7X 1XP8A 1U81A 3EZ9A 2B63H 3TUJC 3OTOQ 3C4JA 4BASA 1AQYA 3EPHA 2G3YA 2ZANA 4DV5Q 4RG1A 4URUR 1VCIA 1QG4A 1NMXA 2VUMH 4X65L 1Y8NB 4S2EA 2R7ZH 1ZCAA 1HUQA 2PZGA 2IHYA 3PCRB 2V3CC 4LYFA 4TMZA 4DEYA 1A5TA 1NKTA 1G1MA 5CK4A 3PO3H 3GFPA 5CB6A 5IP9G 2ODEA 2O5IC 2WM9B 3R9XA 3TS0A 4A0RA 3AEZA 4AKEA 2XTNA 2FNAA 4D80A 3Q8DA 4A3JG 1NVWQ 2VP6A 2YOFA 5D3MB 3TEHB 4TL8A 2K5UA 2BA0A 2GEDA 4FD2A 4X64L 4JLVA 1QVCA 3SBDA 1DD2A 2D4HA 1O7LA 3FHTA 3TW4A 5CDFA 3OIUA 3ZVRA 2GJ9A 2QT1A 1J5EL 1JI0A 3QPWA 3N2IA 4XVRA 1G3MA 3X1XA 4E03A 3L0IB 1W36D 3PXGA 4BXXG 3W34A 3M4YA 5EE1A 2GWHA 4A0FA 3A5ZB 2GCNA 4R4IA 2Q9BA 3AYHB 3BB3A 1KGDA 4ZDJA 1CUKA 1WCMH 1YU9A 1T91A 4D4MA 1L4UA 2JJQA 4YMUA 1JQLB 4B3RQ 4HB2A 1KJYA 1SRUA 2A19A 2ECKA 4G1UC 4DLRA 4YCWA 3OEHD 1KI2A 4Q5IA 3K7UC 3DLLA 4M0LA 3C7KA 4V0LA 4CIDA 2AWNA 2L0XA 1XMQL 1SZPA 2NZ8A 4A2WA 4ZDIA 4WIAA 2HYIC 2JGNA 3B2EA 5KOYA 4HIOA 5DLQE 5LDDC 4GP7A 4B71A 2P3SA 5LBIA 1QHIA 2XNSA 1E69A 1CLUA 3D3QA 3K0FA 4MRVA 1TWGH 2QY9A 2DHRA 3H0GG 2DCUA 4JSYA 4DK6C 3MFYA 1Z2CA 3CMAA 1N0VC 1NRJB 1WRBA 1YZGA 2ZRBA 3DKVA 3FPAA 1U90A 2I3BA 2F4VL 1AS3A 4KLNA 2DFNA 4KVAA 3PUWA 5FBWB 5FOWA 5UKDA 3GLFE 4KN7C 2A5GA 2EU8A 4JI1L 3I4LA 2OG2A 3BBPA 4ZIRA 4Q7KA 1LM0A 4C0BA 1YZUA 1IBKQ 3U9SA 2P6RA 3WXMA 4GMDA 2JA1A 2ZRCA 4YXWA 4NE2A 1NSFA 1VYVA 4PC6A 4AKIA 3V4FA 4LFAQ 4K81B 3WY9A 4IPGA 4RMFA 3LWNA 1A2KC 3VR1A 3MJHA 4A3IH 5IYBH 1IJFA 4EPXA 3W3ZB 4A3FH 3U44B 4JK1C 4JT4A 2ZVPX 4JI3L 2BHRA 4H44C 4AYTA 1G5RA 3LX8A 5L8VA 1E2ZA 4IPHA 1S9DA 4PV1C 2WJYA 4Q9KA 1G7CA 4MZ9A 2ONKA 4LUVA 2V4DA 2O8BA 1U9IA 3KKQA 3BH6A 4WJ3M 4TTPA 1SVMA 2FH5B 2A69D 2IA5A 4JLOA 3CLVA 4HYYA 2VHUA 3QVVA 3I7FA 1OH8A 3KKPA 5G40A 2QRNA 3S1AA 3ASYA 2YVUA 2NO0A 1X3GA 1ELOA 1N33Q 3W90A 1KAOA 2WJIA 2IEZA 4QJFA 5KUTA 2FV8A 3KDFA 4TQUS 5BR8Q 3I1FA 4B44A 1VCNA 4C0HA 3QKRB 4KLZA 5HZHA 1G51A 2QENA 4BEJA 2IEYA 3F8TA 3PEVA 3A1UA 3D4RA 2WSMA 1OT3A 4TSFD 2CKZB 1CKNA 1FP6A 4WXRA 1YZQA 3CZQA 2GESA 4JT2A 3KKNA 3WHLA 1Y3AA 2EFGA 1VG0B 2GVZC 4JI4L 4HB4A 2FU5C 4QXAA 3WNCA 4Q4LA 5KPJA 2J0SA 3S1AB 3GTJH 1U98A 1VQFA 1Q1ZA 1JBKA 1CSQA 5CM9C 2QGZA 3G71A 1WOCA 1E2JA 5IK2A 3T12A 5B64A 3AQQA 1JPNA 2QNRA 3ZYCA 2NO6A 2V6IA 3EW9A 4H9GA 1IZ6A 3F0TA 1QJOA 2Y0SG 4HAXA 3IHWA 3K9NA 4LFCL 2IHFA 4B3MQ 1DBSA 1SXJB 2X8AA 3AVOA 3BAFA 1WBDA 5JRZA 2NVTH 1L2TA 1E3MA 1H8HD 4X8MA 4BFWA 2PH1A 4YWMA 4GLAC 4AH6A 4LF5L 1NVVR 3CM0A 4E09A 4EJSA 3B8HA 3K0XA 1XPOA 2HT6A 5F2EA 1E0KA 1N3BA 2A2ZA 3BU2A 1PH7A 5M5XH 3MUFA 5ELOA 4HB0A 2DWQA 3GMTA 3PUVA 2E75C 1S72A 3T1YL 3EZ6A 4L5TA 1ZM3A 4GBMA 2H5EA 2QMEA 1N25A 3QXHA 4MGZR 1E4VA 1JEDA 4JBKA 1E79A 1Q81C 1P5ZB 2GEUA 3GTQH 4RD2A 4RCZA 1Z47A 3S14H 4TLBA 5K8LA 1Y63A 3L8ZA 1Z07A 1G8YA 1D8TA 1IXZA 4LOAA 1WXQA 2P0EA 2FFAA 1P72A 1Z6YA 2Z4SA 2JA7H 3GLGE 1MO3A 4B2PA 4BLPA 2ZE5A 2JXMB 2VQEL 5C4XG 1F2TB 1MR3F 2EFDB 1E0JA 1HH2P 3J81i 2FF7A 4CEJB 3B1XA 4YC7A 3U4QB 2O8EA 4RD3A 1E4YA 3B1VA 1KDPA 4R71A 4KITB 1ZM9A 2PLRA 4LJ5A 4V02A 5KNCA 3CF2A 1U0HC 5CLQA 3L2PA 4BRUA 2JJ1D 3LXRA 1IN6A 5EJEA 4TQ9A 3UMRA 4FDBA 1C0AA 1XFAA 1AS2A 5FPHA 1ZC4A 1I6HH 1KO1A 1YIJA 1OB5A 4JI7L 1II9A 4IOKA 4B3SQ 1CR2A 4MYTA 3TKLA 3HOYH 4DK1A 4DR4Q 4BZPA 1XB2A 2FPMA 5KDDA 1P9RA 3A74A 4EPRA 4JOIA 3M3YH 4NYMR 2ZRFA 4FCWA 3LW7A 4BFUA 3U4QA 1GTVA 4LJZC 4LBWA 1N9WA 1M1YE 3CX7A 3HOVG 3Q85A 3T34A 4IDHA 4NHOA 3O8CA 3CAMA 3QSYA 1N36Q 2C95A 3C5CA 1W2BA 2ZQ5A 1UPTA 4DR7Q 1Q44A 3EC2A 4HLCA 1Z63A 4QNRA 1SVIA 1TQDA 4LHYA 2WWIA 1X1RA 2HJGA 3EWAA 4QRHA 3BGWA 1KNXA 4WW0A 3FP9A 1W48A 3AH8A 3RC3A 1QUQA 1TNDA 5DISB 1Y1WH 3U3KA 5E7IA 1DGSA 1Z0IA 4GP6A 5FL3A 5IE8A 1HNZL 4B3XA 3FWYA 2CE7A 3EARA 3KDFB 1XJQA 5JFGA 1M74A 4WA7A 4NCNA 4IOJA 4UPAA 2VHJA 3DZDA 3W9YA 5P21A 3CRLC 3ND9A 3DDCA 2VQFQ 1YHAA 1C9KA 2KCTA 4JVSB 3LX5A 3AVYA 4GNXC 3EIEA 1GVPA 3RRMA 1TF2A 2WAXA 421PA 1KK2A 1B70B 4JLBA 3I32A 4NDZA 3A8IE 3D6TB 3NWJA 4TMKA 5HTKA 4DR1L 4QBFA 4RD6A 3SS8A 5J47A 2ZJ5A 4LJ7A 5IY0A 2QU8A 4C2UA 2JLQA 2IL1A 2W2XA 1NLYA 2J7KA 2J0UA 2VA8A 1DADA 5TMPA 2EJFC 1E9FA 4US1R 1G6PA 4M2LA 1NLZA 1X3FA 2BIFA 4L9SA 2GN5A 1SVLA 1PH2A 4XTRA 4D0LB 1J5EQ 4YWKA 3KJHA 4HUTA 1X8KA 4I1OA 3HOVH 1XTQA 4DPGA 3QEOA 1DCZA 1QG2A 2K14A 2MO1A 1VYUA 3K0EA 4ASUD 3U4ZA 3EWSA 3K70B 4IKEA 1NMGA 1A62A 4HSEA 1COWD 1GOTA 1DE0A 1M2OB 3LH5A 5FTLA 4DUYL 1RIPA 4TYYA 3FMIA 4A3MG 4NH0A 2ZI3A 4HIMA 3ZZTA 3IQWA 2KWIA 3GLIE 1CR1A 1MT0A 1II8A 3JAMc 4RZ3A 3THOA 1GKYA 2ZJAA 2ALYB 3BC1A 4C0KA 4IXNA 1P2UA 3JZAA 2NPFA 3KUCA 4DV4L 4ZI3A 2ZIAA 4Z54A 4FW9A 4I1UA 1R5BA 5AK0A 2VRWA 2ZU0C 1COWA 3ZVLA 2PI2A 4DV3L 1XWIA 2QQ0A 3MWLA 2O0JA 3LBIA 4NCJA 5HKKA 1D6JA 1AKYA 2OSBA 4GOPC 2OESA 2WKQA 3CPEA 3Q3JB 2ZRNA 2WWGA 5EXSA 4OKSA 2ES2A 2F4VQ 1II8B 3RRZA 2QA5A 4HIKA 1P6XA 3AP2A 2WTUA 1EFRA 3TVDA 1VPLA 1A6XA 3KL4A 3SEAA 3KLWA 4IO9A 2N8NA 4JI6L 2D2EA 4B33A 4RD1A 1VHLA 4OJQA 3AVTA 2JCSA 1A2BA 1Z0AA 2YWHA 3A4MA 4G01B 3KDSE 1UE5A 1HTPA 3AUYA 3GJ7A 1X9NA 2LXJA 1ZIPA 2QMUA 2Z43A 1G3RA 1U8AA 1S2MA 4CVNA 3RS2A 3SDZA 2Z4RA 3AVVA 3VKGA 1PH5A 3E1SA 4TQAA 4M9XA 4OK3A 2NZOA 2RGNA 2IYLD 2ATVA 3B82A 2FPKA 5KHOC 4GLXA 4TWZA 2ZREA 3JAMi 3TS2A 3CWZA 1O87A 3GO5A 3W5JA 2X2FA 3HKSA 2G0NA 2RHDA 4GKKL 5IRCD 1XMOL 2V4ZA 1W44A 2ERYA 1QVRA 3NHBA 4LF6L 2QP4A 3VU9B 2QP9X 1BKBA 1R2QA 3SHFA 2NVQH 3UMSA 5ANRB 1AE2A 3K09A 4ACBA 4B2IA 5AJZA 1BH2A 2R7DA 2GZAA 4UXIA 1MO5A 2NIPA 4JIMA 4V0KA 1E2FA 1O7IA 3GEHA 1W0KD 2GXUA 1Q57A 3UG6A 1PH6A 1OXTA 3NELA 2IC5A 2DGYA 1CJVC 3K81C 1BMFD 4ARZB 1S40A 4C30A 2B92A 2BM1A 3E9HA 3NE5B 1KI4A 4URXR 3TSZA 5K36H 3QKRA 5KYKA 1WQ1R 2NN6H 4GS3A 1D2EA 4NKRA 2W0MA 4PQRA 3SFVA 3FKSA 1KKMA 1SGWA 1Z6HA 3IUYA 4OO1I 4JLDA 5L3SB 1MJCA 4XOIA 2R6GA 4C0AC 4BY1G 2P6UA 3IIJA 3KQLA 1HV8A 4NYJR 2QQEA 5JJLA 1IBLQ 2VNUD 3T1QA 1W4AA 3FFBA 4DV6Q 3CMEA 4EQ5A 2GVAA 4Q4HB 2N78A 1S3OA 1KAGA 2C04A 1CIPA 1W1WA 1Z08A 2EQSA 3GFTA 1X56A 1JECA 1VQLA 2WJJA 3RS5A 4R4QA 4JOIC 4A3FG 4O2RA 4Q4AA 4LF5Q 2SHKA 4OHWA 3HU1A 4GRAA 1YE8A 1NJGA 3NEJA 4CEIB 1GUAA 1PV4A 4LBZA 2PEYA 3SJZA 4PC2A 4AG6A 1UDWA 2HF8A 1VQDA 2C98A 2WFWA 4NB3A 4JKIA 3W5IA 1V9PA 4U5XA 2F3RA 2J45A 2YWFA 3MLEA 4X62Q 4L4UA 1PYBA 5BR8L 4BUJA 1SKYB 4TL6A 1E9DA 4B6FA 1L1OB 1TWFH 3KUDA 3J81c 1UE1A 5LMNW 2Z5FA 4OQXA 4HUQB 4RCYA 2PLFA 3I8XA 1DAGA 2JA5G 4C0SA 4ERNA 1G7TA 1N6LA 1Z28A 3PO2H 4JI2Q 4DV3Q 1I94Q 1YR6A 3P4XA 4GOPB 1I5FA 2OQ0A 3WRYC 1RRGA 1AIPA 2BBOA 2A30A 2ATWA 1RVDA 2V1XA 3K0FB 4JLKA 4B3DA 3MD0A 1G5TA 1NJFA 2WWHA 3VNVA 4MITA 2NO9A 4YQFA 4IHQA 4AKHA 1VQ8A 3TR5A 5GJBA 3AVQA 1K83H 1KRTA 5DYGA 3OIYA 4NYIQ 1DAFA 3B78A 2K7VA 3K80C 4A36A 2AD5A 5AUQA 1VCOA 5E7JA 3NBHB 3VKHA 2C9YA 3WMFA 2ZAMA 2LSSA 1HJPA 4YWLA 5B57C 5DO9A 3RZOH 4WZAE 1GITA 4A3BG 2E8GA 3HJNA 5CJPA 5A4JA 3KQKA 3EXAA 1N8RC 3GTLH 2VHTA 3WBKA 1J99A 1OKKD 4FMDF 4V0OA 4OONA 3NIBA 3IQXA 3HOZG 4LFBL 1CULC 3K70C 3JVVA 2KENA 1L2FA 1WI5A 1NLFA 2ZYTX 2VHQA 3KFXA 4LJ9A 4MQBA 3LFUA 3QG1A 3UE0A 3KQUA 2GDJA 4XVQA 4BFSA 1DG3A 3C5HA 3CIOA 4M22A 1XTDA 4PZZA 2H1LA 5AR1A 1ZCBA 4M1OA 2GKSA 4ZPXA 2A5JA 2AFIE 2CVHA 4P72A 3RAPR 1CKNB 2A69C 1IN5A 1Q7YC 1KHTA 1QHHB 3QF4B 5EZ5A 3W6OA 3GLGA 1FPMA 3A1TA 3K70D 3A8KE 2B21A 3AKCA 1VQNA 2Y8EA 3BJIC 5LMUL 1VQKA 1SXJD 4NPSA 3CC7A 1XXHB 1EUJA 4IXMA 4TT3D 1U0JA 2VF7A 3HU2A 3W1BA 4QQBX 5DI3A 1E1OA 3WDNA 2JA6G 4I1SA 3OYYA 3MGCA 1LV7A 3N6RA 2OCAA 1X65A 5KNBA 1UBCA 3PG5A 3CKLA 5C44G 1C4OA 1E0SA 1K9MC 2IX1A 5C18A 1FUUA 2XJ9A 4QBHA 4WXPA 4A3BH 2JJ2A 1D2NA 1Z0FA 4A3EH 1YNJC 3LGJA 1MKYA 3BERA 1Z06A 4XWKA 3OFNA 2KE5A 2BMFA 4HDCA 1J8YF 1KIMA 2ZRLA 3ZZ0A 4IPDA 2A3RA 4NMMA 4ASUA 1TUEA 2WB1E 1MKHA 3FHWA 521PA 4TN1A 3PFIA 4LCBA 4ABYA 1XTIA 1W46A 4JI8Q 5FR2A 5L3RA 3CRRA 2IW3A 1E9BA 1TQ2A 4MKIA 1E2GA 5FUYA 3U3MA 1U94A 3FHOA 3ZQ6A 1Z9FA 4D0GA 2IXEA 2VSOA 4GNKA 4EJSB 2UXCQ 4C9BA 1LTLA 4XWOA 3CX8A 3QE0A 1D2MA 2IS2A 3NKVA
chains in the Genus database with same CATH superfamily
1ECGA 2XWSA 5C35A 5CUQA 1KNAA 1J6UA 2FEXA 5KQRA 3UKJA 5JU6A 4DNTB 2HA2A 1B6TA 3P2KA 4I7AA 3F5MA 3H6MA 2QP3A 4N5MA 1UBMS 2CT8A 3TREA 1OFUX 4HWPA 4QO8A 4YLYA 5I7EA 2X0DA 2C7RA 3S15B 1J7KA 2CEAA 2DU8A 4LYEA 1XBTA 4AMYA 5CDHA 2CLIB 4EX5A 1SHJA 2FW7A 3OLQA 1Z7BA 4AQYL 3WGJA 1FEZA 4EMBA 3R3YA 5EKXA 5EQDA 1ZNZA 2LD4A 3R4VA 1TUBA 3TZ6A 3UICA 2AGVA 2PZBA 4MUYA 1ODCA 1JHXA 1I13A 1Z4LA 1B73A 3LI2A 4K6HA 5DIZA 2GCEA 1W36C 1O6ZA 1F17A 4MO9A 4EQ6A 5BNIA 5JECA 3RQSA 4YP9A 5ALYA 1PEKE 3NALA 1LSJA 2FE4A 1AD2A 2ZIEA 5C3XA 4X24A 2IYXA 1CZWA 4AL4A 2PX8A 4RC9A 1G2SA 1VSTA 3T3HA 5IYZA 4WN9B 2KB0A 1WETA 2K5HA 1E77A 1O7ZA 3AUSA 3QVGB 2W8BA 1A5AB 3NB0A 2JFZA 3PBKA 4FBGA 4K28A 1LQUA 3MVEA 4X71A 3LCVB 1FU7A 3KZNA 1A7AA 4KAJA 3J80c 3U7IA 3D8RA 1CFMA 5FBRB 3VBEA 3CW2C 1YE5A 5G1PA 4Q16A 3R40A 3IIIA 4WRRA 1KMHA 3OQNA 4R8SA 4PHGA 3AI2A 3BHMA 4MYCA 1RLJA 1GTMA 3IKJA 1ZIXA 4X7MA 4L95C 3I92A 2XMPA 3VUFA 1P4SA 1GO2A 1QILA 1T9AA 3AETB 3L79A 4PCLA 1JJIA 1CJKC 4GR4A 1XHEA 1ZD4A 2H4YA 4L5IA 3ICEA 3OKFA 3B9PA 3O8OA 5A0FA 1EK5A 3R2IA 4C4ZA 2CFRA 5CXQA 1ZXBA 3NI2A 3L8DA 1GAXA 1VLZA 2OCDA 3I6IA 5DKFA 2FUKA 3ZJ5A 2CN1A 1YJXA 4P92A 2H2GA 1UL1X 5KYYA 1N3IA 3E22A 1AMUA 4QM7A 3T95A 3A1CA 1JQ5A 4POOA 4UUMA 2Q2UA 1R9JA 5DVZA 1O5TA 2J4CA 3AEKB 3BTSA 3SFZA 5HQ3A 1JZSA 5JDIA 1RC8A 1G55A 2JJ8A 2WR8A 4G9EA 4DA0A 1YXMA 3Q8WA 3WB9A 1YJ5A 2E1PA 1FNDA 3GN2A 3HDYA 5CTAA 3JALA 1WE2A 2OQKA 1I50H 4WLFA 1HQDA 3K09C 3U3OA 4OJTA 1VMEA 2BDEA 4TKVA 4I7ZC 3MS2A 4H1WA 1IBLL 4DA4A 4GVXA 2KOLA 1PFUA 3M9WA 2Q0XA 1HPCA 1VE9A 4IMRA 1U3DA 3L04A 2CCKA 2C35B 2C9DA 2VJPA 5DNAA 4B3HA 3K0YA 4OB6A 1BC5A 2B8TA 2R85A 4MCHA 2XQFA 4BATA 3WMWA 4ZVPA 4RV5A 1GL3A 1VI6A 1Q5PA 2OCPA 3OTOB 4A3FB 4PAOA 2X9QA 1QOPB 2YWBA 3QLUC 1MH1A 4RK4A 1Y14B 3SZUA 5CDTA 1EQAA 1D6MA 2FETA 4PYQA 1DC7A 2RI1A 3RRBA 1GRNA 5LXTB 4CT5A 1VYTA 1E2WA 2ZBEA 1KI7A 4KYUA 3RZOB 2OFXA 2WLSA 2Y1CA 3B7PA 3C3WA 2YFYA 1P7YA 2H29A 1Z7EA 3F7NA 3GWGA 3ILYA 1YNSA 5AUNB 1YBMA 1P4HA 3H17A 1G9TA 1CR6A 3PC7A 4F3CA 1CJSA 4CF6A 1XD8A 5F9HA 2VTKA 3DAFA 4MDHA 4P7FA 3TW6A 5GWXA 4IHAA 3QTBA 1G8PA 2CVPA 3L0BA 3H1PA 2AR0A 3D4LA 5CJJA 4OJYA 2DB3A 3GBVA 1ZYRC 3R7WB 1FNMA 4JOCA 1V1PB 3EIWA 4Q4AB 6ADHA 1YD7A 2F3SA 3BD7A 3MYYA 4HDNB 5AVQA 3EX7C 4MQLA 3F73A 3WRXA 4KHVA 2I6GA 4LF6B 2RARA 5I9BA 4AY3A 3O21A 4XEHA 3BDOA 1SCBA 5L4SA 5E1FA 4Z2YA 1M1XB 1MHWC 5DHUA 1RXWA 1DWOA 3H3VC 3A6HA 1P0QA 2GB4A 2AN5A 5HZGA 2BDNA 2C29D 4NMWA 4FFLA 2FF5A 4YRJA 2PR7A 3E61A 1GD7A 2ASVA 2YNMD 3I4FA 3LVBA 3TCNA 3H8JA 4NBLA 4YXWD 4LYAA 2VCEA 3Q2OA 4M0CA 1SIWA 4AZSA 4CE6A 4UVEA 2X6LA 4HMOA 4P54A 5FPQA 2ALJA 3ZVNA 4RVUA 3AVXA 5JJKA 3JYPA 2WD8A 4LRYA 4FS3A 1PJ3A 4Y1EA 3AV0B 4I5EA 4GOND 2XDWA 4UTOA 2V4MA 4NU0A 4X62L 3U4VA 4X60A 3V8PA 1HT1E 4C4TA 3O3OB 4CDRA 5JBIA 4PVCA 2N3SA 2W2TA 5AXDA 4BQIA 1OXVA 3NPPA 3GHHA 2XI4A 3H6GA 2NAPA 2XDYA 1Y3BE 3BHNA 4FFVA 3KTDA 4CCYA 4WCFC 4CMEA 1P2DA 4LC0A 1ISFA 1ULSA 1YRYE 1GJXA 2VJMA 3EG5A 3E70C 3KZVA 4IJKA 5I7HA 1T5OA 3P2JA 4QYWA 1DT5A 3CH5A 2FP4A 2EYPA 3L4KA 3RUAA 4ZO4A 3L4JA 4KDCA 4LKOA 3VSBA 1N2CE 2RAPA 3IQZA 1S8NA 3TCXB 3DBLB 4L07A 1T6XA 3VNQA 1WLSA 1NJ2A 5GV7A 2Z6VA 1X6OA 5CV4A 4KQHA 4G3XA 3DSRA 3AIMA 2BFBB 3ZIAD 5HGQA 3DVRX 2ZWMA 3ID6C 3DKPA 4YS6A 1JLMA 3U49A 1SE4A 3FVQA 1XDSA 2A9PA 2CGEA 5H3LA 4DRYA 5I8ZA 2OCLA 3VH3A 3SS9X 1RWXA 1RXCA 4WNIA 1XEFA 1KPHA 3GBPA 1W4CA 3P8ZA 4RVCA 3G59A 5EIOA 4JEUA 3V00A 1SFOB 3WA6A 3ICWA 4AKGA 2EKBA 2Q7XA 4JN6B 1NHWA 3CX3A 3EPPA 5KJCA 3VPXA 3GRUA 2PLNA 2NVBA 2W0SA 2J31A 3I23A 3SJAA 4DDTA 4CM4A 2MO0A 1P73A 2LTAA 5D3MA 5EKSA 4C06A 1PK9A 1WDLA 3L77A 3PGKA 3WE7A 1LYLA 2F43A 1KO5A 3EQ2A 2IYVA 2NQTA 3JX9A 2X0NA 4PX9A 5AO9A 2O7QA 4IF6A 1ZNXA 3HVHA 2DTEA 2XUQA 3RREA 2BH8A 5C4XH 1I2BA 2IYEA 2H1IA 3BGSA 3T7AA 1TLLA 2P77A 3PL1A 1QIGA 3CG0A 3OTWA 4JYAB 4JUCA 3LUGA 5IC4A 4EVRA 1YACA 3ANXA 3LCJA 4WGGA 2ZM6B 4RK0A 1D2RA 4LWZA 5DNDA 4M0KA 1EBFA 1FRQA 3EXEA 5BV7A 2QNIA 3QE3A 4R4TA 1HNWL 2TMDA 2WC1A 3F2UA 5TMDA 4FYWA 1U0OC 1DTEA 3MZ0A 4JLSA 4I6JA 3MT8A 4QSHA 5CLHA 4EABA 3MBKA 5JSFA 1KIAA 3OZSA 1GTG1 3EH2A 4FFPA 1GTJ1 2EZ8A 1SBCA 4IL5A 2O8CB 1EGAA 4L3WA 4OQLA 4JVNA 3MNFA 5ALTA 2AXNA 2OKGA 3STWA 2OQ2A 4CBVA 4PZ7A 2ZXRA 4JI1Q 5EQ0A 1UXIA 1BXRB 1QKJA 2A1IA 5DM4A 3V7NA 4UVGA 3FZQA 4BMDA 2QD4A 3LQKA 4DXGA 1EY5A 1BX0A 1W2GA 2HSGA 4G1MB 4GLLA 4WUVA 3K58A 4JELA 3CTPA 4LGVA 1LT6D 4MK4A 4O2AA 4QVIA 5CLLA 1AXGA 1WCXA 2OAQ1 5MGBA 2XYRA 4LTNA 4I4TF 5JJBA 3K9FC 2UZIR 1E2VA 4R9NA 1O78A 2G88A 1IEXA 4WORA 3PZBA 5EE3A 2CHUA 1N2SA 1KU6A 3PGVA 4ZYZA 3RSLA 3AWDA 5JEAH 5CYUA 1IG0A 1QVWA 4O5AA 4CF4A 2OQVA 3HYTA 1DTWB 3D7SA 1SUPA 2UU9L 3K15A 5KI6A 5B12A 1LDBA 1SD1A 3P2MA 2R6R1 2JRLA 1H93A 4GVPA 2WSSA 3QEMA 4PHHA 4XD7A 3UAGA 3HOWB 4C87A 1ISRA 1RM5A 3IB3A 4NCKA 2P90A 2PKEA 2K5VA 2WPNA 5EMJA 5KMGA 3G0HA 1A3TA 3M6IA 2B4YA 3V42A 5K0NA 4JU9A 5ADWA 2XGSA 3NMUF 2HIHA 1M1UA 1ET6A 5BN5A 1UAAA 3LK7A 3P9YA 1TYDE 1EOVA 4Z3KA 4Y0AA 3PX7A 4G67A 2H4XA 4ID6A 5B7NA 3OQ1A 3D8SA 1LVUA 5T41A 3WNVA 1HDIA 2GBCA 1NVDA 3IEKA 4X44A 5GINE 4DR3L 4BFZA 1GPLA 1BVYF 3AOGA 3DB1A 3HJAA 2IU6A 3VMFA 2BHSA 4WADA 4Q6BA 4LPSA 1XRRA 2P4SA 5D01A 5HP4A 3HHEA 4GM0A 1RPZA 2IH4A 4UE6A 3TLGB 1WW2A 4AJJA 5K8TA 4I9FA 4O1MA 1U28A 1XRQA 4ICIA 1B8NA 1IQPA 4DLUA 3H6HA 2GHTA 4YQZA 1XTPA 2PVCA 4CEHA 4A4DA 3SBXA 4F72A 2AJ8A 4RQBA 2GOYA 3QE2A 1C8CA 3T5DA 2CW0C 1F2UA 2IYQA 5I7FA 4ZPJA 1RACA 3VR3D 3BXXA 3OZ7A 3PF9A 4YT4A 1HOXA 2A6PA 4EF5A 5CDUA 2NVWA 4K0RA 2I03A 4FBLA 2Q3HA 2X4GA 1R16A 3NAGA 4KQMA 3SYTA 4BQQA 4B3ML 4ZDKA 1IBMB 4RYLA 2UYCA 4XYEA 1K6MA 1GPBA 3ZHQA 1QB8A 3NDBB 3FXAA 3WTCA 1HRJA 4RLQA 3VR2D 2OC4A 4BTEA 2Q6LA 3U13A 4E3WA 5COAA 1XALA 1T3LA 2WNSA 2YMPA 2YQZA 3P19A 1N5MA 2H1WA 2VWGA 3EA0A 4WGFA 3R2JA 1L5KA 2GA9A 4YX9A 1E3WA 2B61A 3RYHA 2CLKB 5JNLA 2IU3A 4IMJB 3JV7A 1GKHA 2MJLA 1P60A 4OQDA 3AM3A 3JYQA 4UBIA 4V1CI 3T3PB 3IILA 3ILVA 4W82A 4IFIA 1QP8A 2H4WA 4A2WA 4H7IA 5L4NA 1AKMA 2HU8A 5IANA 1D0IA 5DEIA 1XGKA 3CRW1 1JC7A 2ZBDA 4UATA 2UUCQ 1MV5A 4FYIA 1TQHA 2DJIA 3QOXA 1J23A 5IGEA 1OLOA 2AB0A 3R6WA 4JL5A 4CL0A 3AZQA 1CPYA 5BUSA 4HWGA 1H8ED 5H1SE 3AFNA 4X61A 3EIFA 4Y9SA 4ALKA 5HNKA 1HURA 3M81A 1KYYA 1EEID 4DKXA 5ER6A 2X5NA 3EGXA 3H4MA 3LPLA 3OE4A 1PRTF 3PHLA 4G4SP 5DHQA 2LKCA 4CNQA 5J2UA 3FYTA 2GPNA 1JQYD 1DRUA 4PTYA 4JXJA 4R9UC 1XZHA 3T52A 3AFMA 4L0MA 4MV0A 3RIHA 1Z2NX 1PEYA 1UBTS 1Q1NA 2P5YA 2GT1A 2ECOA 4OO3A 4L5SA 1EKXA 4UU0A 1PMRA 4EI9A 3NYQA 5IKMA 1PH9A 1PJCA 5CAEA 1VSBA 1Q50A 2OILA 3QG5A 4JQZA 4TL9A 2H6EA 3WIDA 2JBAB 1LACA 2DY0A 1POXA 1MI2A 3LDGA 5E9JA 4ONEA 3UJCA 1IPEA 4MO2A 5BR8B 5IN5A 4LFAL 1M6NA 3IDQA 1F9PA 4UMEA 4BA2I 3TLMA 3DKRA 2PPBC 1OW3B 1VQHA 3BILA 4FGSA 4GH5A 1X32A 5LLDA 1OWMA 2V6MA 3G9UA 1EFAA 1QQ6A 4I4TB 3KVNA 4FHCA 3KK7A 3QGMA 3LC7O 2FG6C 4OL7A 4FFSA 1XEXB 1DPFA 1JFFB 3M1IA 4IZIA 4UM7A 3WYNA 3IAS6 3U3XA 4C4YA 5IYZB 5CCXA 3VYVA 4EDHA 7REQA 3JCZA 3CVYA 1CKOA 2GN0A 1QVFA 1L7DA 3RSZA 3GN1A 2DECA 1R6BX 1NVMB 2X7HA 3CCEA 4M1EA 4OXQA 1GUFA 4AJHA 1TVMA 4G0MA 4F1JA 1XNQB 2H57A 2F8LA 3UDXA 2TMGA 1EFVB 4JZKA 3ZY2A 1A7KA 1OD6A 2ENUA 2AHOB 2NUTB 1PHRA 1MIUA 4Y6LA 2QTGA 1LC3A 3BQMB 5KSPA 1W36D 5IZCA 4E15A 1YNNC 1Y8AA 2Q6TA 2WQZA 1ZBDA 2YTZA 4M55A 3S2HB 1FS5A 1OJLA 3TLZA 3TRFA 3T1TA 2FZGA 1ADGA 3ETJA 4HJ5A 1UKVY 2DHEA 1V2HE 1W2WB 3AL2A 4FEYA 1GZ4A 4JCOA 5ALXA 5B2ZA 1DRKA 1I3CA 3N53A 1EY4A 4GNRA 5FLXc 5B30A 8ATCA 5DW0A 3TOSA 3RYFB 5DWQA 4ZCMA 3KSMA 4V0MA 3H19A 4IPCA 4C6TA 5E0OA 2GRAA 3GLGB 3VM6A 4X66Q 2VHXA 5KSWB 2WTBA 5A7HA 3I73A 4IGEA 1WOYA 1EUYA 4KR3A 4OYYA 5AW5A 1EUDB 3REFA 3FJ1A 3NNDA 3QFTA 5H0IA 2Z6UA 1SU8A 2FMKA 2R7ZG 1PKEA 1O9HA 1R4AA 4Q37A 2L17A 3ZU3A 2VLIA 1CUXA 2HLHA 3L6UA 2QV7A 3D3WA 3DMYA 5BNZA 5LBUA 4KPEC 4B32A 3DWIA 2EVWX 2VOJA 3HGBA 1CBUA 2GCIA 4OUDA 4RSMA 4BNDA 5ITVA 5JXGA 3U5ZB 2C83A 1IH8A 1ZD8A 4FR5A 3W2HA 4UZEA 1A9PA 4DABA 1I01A 1CTQA 2ADFA 2I6UA 3USES 1IYVA 3WSVA 4M8AA 3RLFA 3N8NA 4BFTA 1JI3A 2WIGA 3H6KA 2BBSA 2QRZA 4NNOA 3OIPA 1N5LA 3LU1A 2OO7A 3MGBA 3RKRA 4EJ2A 3ZVMA 4FLFA 1XSEA 3T61A 4OHCA 2EJWA 2R7MA 4D99A 1ONNA 2H07A 1HNWQ 4ZRMA 5IMBA 3C8MA 3NTVA 3AU8A 1Z4IA 4QYSA 3SYRA 1U2GC 3ZD8A 5L51A 3KTAA 4Q19A 5IJWA 2BUBA 1C30B 1EI9A 2IDKA 2XW6A 3H2BA 3HMQA 3M33A 2H0AA 2CWPA 1XTRA 2WD7B 3FKSD 4QXRA 4M21A 4YYZA 5JIBA 1GPJA 2G8NA 4M8SA 4OLAA 1IFXA 2C2XA 3O6VA 4QJIA 4R2LA 4BYMA 3L9XA 4O2BB 4YRAA 1P1KA 2F0KA 3L41A 1Z22A 3LQFA 3PHBE 3CH4B 1MO4A 1S4QA 3UPDA 3KUUA 3Q72A 4AZWA 1JLSA 1D7QA 4J16A 3ANLA 3FOAA 3PE3A 3R0IA 2W6CX 4M4SA 5LFAA 1FLAA 4DMMA 1FUIA 1W5TA 3UDFA 1MIOB 5C1BA 4IZ6A 2WINI 4P74A 2Y9MB 1SOAA 4NXNL 4Q7MB 1SBYA 4LYJA 3EVFA 4A3SA 4HT3B 3A70A 4JASB 3O38A 1KSJA 3WMGA 1B43A 2JCVA 2QORA 4C3JB 3H5OA 3KG2A 3KOJA 1UBRS 3HVKA 1YNND 4RGNA 5CV5A 4E33A 2UU9Q 3O8RA 1QCYA 1OT5A 2OCXA 3K73O 4G0NA 3SX0A 3LT0A 1RHUA 1R0WA 4QDXA 5GAHC 4FHDA 2RGCA 3FTNA 3G2OA 3BK7A 3JYHA 4CJXA 2F8SA 1GFIA 1HG0A 3WDMA 3UPUA 1HZCA 3NUCA 4Q3DA 4AF8A 1XEWY 1DQPA 9MHTA 3HUFA 2CNWD 2QZJA 2WYVA 3K9LA 1FFSA 4Q18A 1MC1A 5HIAA 4QECA 3DW1X 5JV5A 1WMDA 1RAEA 4NV1A 2FSUA 1VG8A 1YR8A 3EBPA 5M3MB 5ECDA 4KPYA 4A4IA 1H9KA 4RLSA 1U02A 1PK7A 5KREA 3K5NA 3FPFA 3F3SA 3T3EA 5T4BA 4IFDH 3AVWA 4B09A 4QQ8A 5TF4A 1R18A 3NHKA 2BBTA 3UZUA 1DAEA 1PT8A 2ZRIA 2DF8A 2FDCA 1XLWA 2B29A 4WUTA 1EFUA 1KK3A 2OCKA 1VQEA 1X54A 1T8YA 2PGLA 3O8LA 3R6DA 4QGHA 4Z9XA 3L7LA 3VGPA 5JPDA 2BF4A 4B3TB 1QCBD 4JYMA 4NKLA 4F71A 1X8LA 5JDCC 3ZLBA 1I4EB 4GOLD 4ZXPA 2HSZA 2VYQA 1UIMA 4EY6A 1HYGA 2DAPA 2WJGA 2QM0A 3AF6A 4DLVA 1ECJA 3RVMA 4GNXB 1BCPB 2BZ1A 4MXDA 5D00A 1Y3IA 2CXSA 4B85A 5HSGA 4X65B 2XGJA 2AFIB 3A8JE 1OWOA 1WVGA 1YZ3A 2EHJA 1J2JA 2VP0A 3I05A 4R2KA 1KZ4A 3WQRA 3OKPA 4PWYA 4N1AA 1E6WA 3FMPB 4KR2A 1XMOQ 1CXZA 2CMDA 4R6WA 3PF5A 1DIBA 3L3BA 5IT9E 2KLHA 4JG2A 2P4QA 3PEYA 2I2AA 4IZHA 3CP0A 1ZU4A 2ZSHA 4J6EA 1EIHA 1KZ1A 1A8SA 3ZG6A 5HCNA 4RAQA 2OLEA 3OJWA 3LHDA 5EQTA 1A0OA 1SCUA 4EHIA 4OBEA 1MRZA 1J33A 4GYWA 1D2AA 1YL6A 3Q5GA 1WP9A 3QBDA 4L28A 4DSTA 1X1QA 5JJCA 1CI3M 3PQCA 4QEKA 3U60B 2V7QD 1IN1A 4FBMA 1NBEA 1R0XA 1WD5A 3HLTA 3BZDB 3IJRA 3AR6A 4HGNA 1NY5A 4LZOA 2Z0MA 3CR7A 3NTQA 5PNTA 3GPDG 1UK8A <