1OXUA

Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
353
structure length
353
Chain Sequence
MVRIIVKNVSKVFKKGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDDRLVASNGKLIVPPEDRKIGMVFQTWALYPNLTAFENIAFPLTNMKMSKEEIRKRVEEVAKILDIHHVLNHFPRELSGGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARALVKEVQSRLGVTLLVVSHDPADIFAIADRVGVLVKGKLVQVGKPEDLYDNPVSIQVASLIGEINELEGKVTNEGVVIGSLRFPVSVSSDRAIIGIRPEDVKLSKDVIKDDSWILVGKGKVKVIGYQGGLFRITITPLDSEEEIFTYSDHPIHSGEEVLVYVRKDKIKVFEKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the ATPase subunit of the glucose ABC transporter from Sulfolobus solfataricus: nucleotide-free and nucleotide-bound conformations
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transport protein
molecule keywords ABC transporter, ATP binding protein
total genus 103
structure length 353
sequence length 353
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2003-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17847 GlcV_C_terminal Glucose ABC transporter C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1oxuA03
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1oxuA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1oxuA01
2HHHL 3HOXG 4URWR 4PO1A 1N8RC 1NKTA 4OBEA 1UJ2A 2DY1A 2Q3MA 1KSJA 4JBYA 4JI8Q 4OO1G 3GLFB 4IFDH 1CLUA 1UWVA 3A4MA 1Z0KA 3MG9A 3BFVA 5F3WB 4KV9A 4H02A 4EPYA 1KRSA 3G6EA 4PAOA 4MYHA 5LB4A 3T12A 3UANA 4A9AA 3KXIA 3L82B 4H1VA 3RHFA 2IYUA 2OV2A 2K7VA 2IS2A 4BY7G 3FHWA 4X65Q 1H8ED 3TGPA 3A5UA 4TZ0A 3MWYW 4OI1A 5IK2D 2ZJZA 3AGPA 5TY0A 1ZKOA 3SHWA 2IUUA 4YWKA 2GCOB 2K5HA 4NXNQ 1U8YA 4B3SL 1OT3A 4MRPA 1XD2B 1RYHA 3VU9B 3WBKA 1XXHB 1PUJA 2GJ8A 4NXNL 1LTQA 2XNDD 1WA5A 5UKDA 4L8JA 4DLWA 3U4QB 2R44A 1D2NA 5DE3A 2VUMH 4MA4A 4LF6L 1L0WA 1JBKA 4BZPA 4RSGA 3PO3G 2BMDA 4HIMA 3RS4A 3ADCA 3BK7A 3PEWA 2ZPTX 1H8HA 1N3BA 1L2FA 1TQ2A 2ZE7A 5J40A 3QKSB 4XD7A 1FTNA 3G48A 5LBIA 2DFNA 3H2YA 3QPWA 1GUGA 4CEJA 521PA 3SHFA 4C0HA 2I5LX 2YOFA 4N3NA 1PH3A 1QRAA 1I5FA 1E0JA 5F9HA 1R8QA 3K09A 4L5BA 2HHHQ 1M74A 4CT4B 2X77A 3W3AA 1E24A 4IPDA 4L8GA 4QGUA 5KUTA 5HR5A 2FPLA 5G53C 4UP8A 1CTQA 1L1OC 1XMQQ 3BWDD 5A4JA 2J0QA 1DAFA 2VS1A 1EFTA 1ZW6A 4RD0A 4EQ6A 2C77A 4GI7A 5J4HA 1HZBA 3GJ3A 1H9SA 1VCIA 2GCNA 3FP9A 1ZUHA 1SR3A 3B2EA 2JA6G 3OIUA 1LB1B 1FX0B 2OFXA 3AVTA 2FNAA 3UDGA 3QSYA 5DNYB 1W36C 1SVSA 2O8CA 1EYGA 1ESNA 1Z08A 4LFBL 1NL3A 3RNUA 2WBLC 4CEIA 2RGGA 1VQBA 3EASA 3KJOA 2JA8H 1UFQA 2EYQA 3K0CC 2QGNA 4DKAC 4IOKA 4NCJA 2B8WA 2GAAA 3BIFA 2GJAA 4QGHA 4GBMA 2KCCA 1B7YB 1FL0A 3H84A 3EPLA 2GEDA 4D81A 4PANA 4WJ4A 4MRVA 3OAAA 1KO4A 3PFIA 4UP9A 5HZKA 2V1CC 1SVLA 1G3MA 2VQFL 4YDSA 4X66Q 4UJ3A 4C2MH 4JI2Q 3EBEA 2ZI9A 4ZO4A 2XTMA 4XTRA 1EG7A 1GILA 1XWIA 2CL0X 1K6MA 3LXRA 4QRHA 2GJ9A 3NBZC 5IE8A 3ICEA 4IJLA 1Q3HA 2HCBA 4HAXA 3V4FA 3F2CA 3BH6A 3K9LA 2A2ZA 3ZD6A 1K5DA 2VRWA 1E32A 3QF4A 5JWRA 2QTVB 2K50A 2MMGA 5BN3A 1GKYA 1N5LA 2ZRDA 4LF6Q 3VR1A 4OONA 3RAPR 3BFKA 4IVQA 2CJWB 1TL7C 1FX0A 4BECA 3T1OA 3WNCA 4GOJA 1G7SA 4LBWA 2A69D 4Y0VA 2UUBQ 4RZXA 1XTSA 1KNQA 2YHSA 4BEJA 5CIQA 4G7ZC 2GCOA 1YHAA 2ZI3A 3F8TA 4IPCA 1EFRD 1Q1QA 1O78A 2OSBA 3IILA 1NMXA 1T6NA 3RS0A 2FJUA 4E09A 1L8QA 3FMIA 1VQIA 3Q8DA 4OL0A 4I1VA 2FEMA 1SKYE 1N34L 3P20A 1M90C 1D9ZA 4LGMA 2K32A 2JE6I 2KCTA 2VW9A 2IXEA 5BW8A 2VHJA 1E98A 1KAGA 1N2CE 3ND9A 2ZRNA 1IJEA 1X9NA 4LBVA 3GJ0A 4WXRA 3UMRA 4EFMA 1JT8A 4MUAA 4A3FH 3U3RA 1HT1E 3S16H 3PUVA 5P21A 2J46A 2QQ0A 2RGAA 3F1ZA 3DLLA 4BUJA 4CRWB 4AIMA 2AXNA 4X62Q 3OPOA 2FG5A 3HOVG 1E1QD 4A3KH 4TMWA 3ZS9A 1KSGA 1U9IC 4KU4A 1DEKA 2PNHA 5HKKA 4D4LA 4BLPA 2A7QA 4A3IH 3AGQA 2H17A 4KHPQ 4NH0A 1FR3A 1QUQA 2GF9A 1KAWA 2NIPA 1FZQA 4DK6C 1IN7A 2YYZA 1G5PA 2P3SA 3H86A 4DV7Q 1BOFA 3NKVA 5EP4A 3CIOA 2HF8A 2VP0A 1TUIA 5FUXA 5JS8A 1HR0W 1XNRL 2GEVA 3AKYA 4PC3A 4DR7Q 5FTJA 5L3QA 2HJGA 4DR3Q 1CULC 2XTIA 1YR9A 2FMXA 5FUVA 5DN6D 1Q90A 1T4GA 4I81A 3TE6A 2NPIA 3K9GA 2NQ2C 2J59A 3H0GG 4B3XA 4Q1BA 3TW4A 2E76C 1B9MA 1G6HA 2CMKA 2ZUBA 3VMFA 3K70D 1IBRA 4F7WA 4A15A 5JCZA 3A8IE 1PLJA 1L1OA 3A5ZB 2QPAA 4DV7L 2V8OA 3HU3A 2BMJA 1W4AA 3ZZUA 2A8VA 4GKJQ 3RABA 2J0SA 4PZZA 1NN3A 4OI4A 4DV6Q 1COWD 3BE4A 3M1IA 2PNRC 3U7FB 4PPFA 1WBBA 3TIFA 1F5NA 4JLVA 1N5JA 1X8LA 3R7WA 5BYKA 1B23P 2EJGC 4Q1CA 2BH8A 4URZR 5FBQB 1TWFH 4DR1Q 1EESA 1Z2CA 2GA8A 3AFPA 1PLLA 5JS7A 1FL9A 3KUCA 3RZOH 3A4NA 4DUGD 1G3UA 4JI3Q 4TLAA 1UBCA 3N6RA 1G41A 1NLZA 2ZYTX 3AB9A 2VP9A 4Q9HA 1PA6A 1US8B 3EIQA 4X8OA 4D25A 1IBLQ 2IYWA 3BORA 5FLXc 4GNKA 1X86B 1HZAA 4G7OC 4BBRG 4TZ6A 1VQ4A 3OF5A 4B6EA 1NLYA 1XD9A 4JI4Q 1YZTA 3G5UA 2FEOA 2REOA 3ECCA 3QG5A 4OKSA 5FPYA 3RSLA 2ZSDA 4KITB 1FJGL 1DOAA 2FWRA 2XOKA 3VR3A 4OX9L 3HKZE 4EUNA 2ODEA 3TEHB 3A8TA 1SKYB 4NE2A 4OYHA 4JI7L 1EFCA 1YITA 4QC2A 2CFMA 1S72A 4PAMA 1J6QA 4JKYA 4Q1DA 4ME3A 1KI4A 1DAEA 1JAHA 5KPDA 4Z54A 5FH9A 3ZH9B 2L15A 2YV5A 2PCLA 5HE8A 1ZNZA 1HPCA 3D4RA 2CBZA 4NMMA 2QMEA 3K7AH 2EFEB 2R93H 1Z2AA 2DWPA 4NCIA 3A74A 4U7DA 2JA6H 1XMOL 5KNBA 1DD2A 4MDEA 2ZRLA 2J41A 4YONB 3HOZH 4PHHA 1HNXL 1CI3M 3EPKA 4JI1L 3IPXA 4RD1A 3LX5A 4YC7A 5TDHA 3WNBA 3OHMA 1TEXA 2VQSA 1N33L 2XZLA 3PIPA 1S3OA 4UNRA 4NU0A 3I55A 1G6OA 4H0LC 1XEXB 4A2WA 4LF9L 4TL8A 4NYIQ 2J0VA 4F4IA 2BBOA 1EFUA 2ZU6A 4Q9IA 3AP3A 4JI2L 5HTKA 3K0SA 3PJRA 2XGJA 2R93G 1ONBA 2DCUA 4A8JB 5C0XG 1TNDA 1JE5A 4GN4B 4LK2A 2GJKA 2W83A 4NBSA 4XOIA 2JCSA 5B64A 1P62B 2HIXA 1QBKC 3A1VA 3BB3A 2F6RA 2Z4SA 2FZLA 2JIZD 1E1OA 4TT3D 1GL7A 1NI3A 4DUYL 1X1RA 1BH2A 5C44H 4KJZA 4BLOA 2HYDA 3DDCA 1UEBA 1I3QH 5AJZA 5DH9A 4IDOA 1O3YA 2QPOA 3M4OH 4A82A 2B8GA 3LQRA 4HB2A 2AK2A 2V4ZA 4IDNA 3K9HA 3A1SA 1U9IA 4DVGA 3H0KA 2O0JA 1EX7A 5M5YH 1BKBA 2KHIA 1RRGA 3DM5A 3NH6A 1RL2A 4B3GA 2EFCB 5C0XJ 3LX8A 2NOAA 4JLOA 4C2TA 3RS2A 3U4VA 1YVCA 1PH2A 2JIZA 4DJTA 4XH9B 2J87A 2OQ0A 1U98A 3P26A 3P4YA 1NN5A 1DXMA 2QNRA 2R7FA 1GUTA 3FKIG 4Q7LA 1WJJA 4IPHA 5FOWA 5CITA 1DAMA 4P0TA 1ZD8A 5JFGA 3NBXX 3KKMA 3M6AA 1O87A 2NVYH 5C4GB 1G64A 4PO9A 1IY1A 2D0PA 2K75A 1SLJA 3T1HL 5K36H 2ATWA 4FXPA 4TN1A 4NTZA 2PX3A 2CVHA 4CZ2A 1T3HA 1TQ4A 3L2OB 1Q57A 5E7JA 4MTNA 1WFQA 4IXNA 4B3DA 4PG3A 4LDJA 2VNUD 4A6XA 2WWYA 5IYBG 5GVSA 2WFWA 1B0UA 2QMHA 3C4JA 1Q22A 4FMBB 5KNCA 5KSOA 5TV2A 2CL6X 1D6JA 4M1TA 1A5TA 1HR0Q 4M4SA 4MH0R 2GAOA 3DPUA 4KODA 4ABYA 2YU9H 4NONA 1XZPA 4BFTA 1XMVA 4BWYA 4B71A 4HAZA 3ZD7A 4O3MA 2WKRA 3ICQB 1QZGA 3KLRA 4Q02A 4HUQA 3L0SA 3CO5A 5HE9A 3PENA 1XX6A 1LS6A 4D0NA 4LJ5A 2JA7H 2PZEA 4OK3A 3J81i 1I4DD 4JOIA 4AURA 4HR7B 1GVNB 3U3OA 3CC4A 3OOCA 2V7QA 3CX6A 4AYXA 4DEXA 1GITA 1VQJA 1ZD9A 3KJPA 1MO4A 4LY6A 4NP6A 4A3MG 1OFUX 2NO6A 3SJAA 1K0RA 3ADDA 2ES2A 3B82A 1P7CA 1QZXA 2GTPA 1G51A 1WB9A 1FOEB 3N2IA 4DB4A 4KVGA 1GL9B 1AGRA 4YCWA 3J81k 3GLGE 1COWA 4LYHA 4LC1A 1E9SA 3E2IA 3ZQJA 1GD7A 2XGTA 4LJ6A 5E95A 3W34A 1H9MA 1JNYA 2ERXA 4Q7JB 2QGQA 1DG1G 4NL4H 1G4UR 4GN3B 1KDRA 1XMJA 4M21A 2FF7A 3B9QA 4HB4A 1QHHB 2NO1A 2ZRGA 3GTGH 1GNQA 3AF1A 3QXSA 4ILEA 4PQYA 5JSZB 2FGJA 1YZNA 3EIEA 2C78A 1A0IA 5L3RA 3S17H 2Q9AA 5KDDA 1P16A 4ASUA 2JEAI 2W2VA 1NY4A 1TTTA 4LJZC 2VBCA 4A3GG 1ZCBA 4BFXA 3OIWA 3CP0A 3FKIH 3S24A 2EFGA 4N0DA 3VHXA 2R7ZH 2OEPA 1W47A 1F60A 1N6RA 5K36G 3RRNA 4G5OA 3G0HA 2Z0SA 3BG3A 2NO0A 2ZRBA 4PHTA 4BRUA 1Z0JA 1PLKA 4BLRA 2ZJ8A 2D7CA 1Y1VH 4XVRA 2ZITA 1SMXA 2BHRA 1Y3AA 2FV8A 1GUOA 3NDPA 5A5GA 5C18A 1GZSA 3EAQA 4YHHQ 1OYWA 1V43A 1MJEA 3W90A 1GO3E 2P6UA 4EJSC 3VKWA 4GRAA 2OZEA 2R65A 3T1VA 4Q7MB 2C04A 4JC0A 2G1JA 1KO8A 3DKVA 4V03A 3U44B 4PPNA 3ASYA 2B3GA 2LXKA 1KDPA 2NN6H 2AD5A 3B1YA 4DLYA 1NG9A 3FE2A 4LC0A 2D62A 2QM7A 5FLMH 4ZKDA 4DPGA 3DOFA 2NVTH 5B58C 2CLDX 3RLNA 4PC7A 4A3EH 2KHJA 3B6YA 3CH5A 4KN7C 2CE7A 4TYYA 3SOPA 1T5EA 3I62A 3CLVA 1QG4A 1SROA 2JA5G 2CHQA 2QP9X 5TVKA 1CJUC 2IX3A 4HLQB 1WF3A 3EZ6A 2EQBA 3Q7QA 4C0SA 1KO7A 3NBFA 3PO2H 2IXGA 1L2TA 1RRFA 4Q9LA 4DXAA 1E2JA 1W0KA 1WMSA 4GT1A 4IKEA 1OIVA 3R8CA 4A0RA 5IHPA 3FMCA 5DSZA 1VG0B 4LJ8A 4F91B 4B48A 4HIDA 1X3SA 2JLYA 4L9WA 1T8TA 4DUZQ 2WAYA 4B3SQ 4FIDA 2YWGA 5M3MG 5C0XI 4XWOA 4WA7A 2MMCA 1OXVA 1SMYC 3HFZB 2YKGA 3S1NH 4Q00A 5CLQA 4C30A 3UWOA 3HOYH 3P27A 3K0FA 2HYIC 4DAMA 5GJWC 4CEJB 1JEEA 4JLKA 2NZHA 4MKHA 1YR8A 3QKSA 1PYBA 2H5XA 2V4DA 2RHSB 2E1RA 1BO6A 2R6FA 4HSEA 4I1SA 3ZYCA 3CNOA 2PI2E 2DYKA 3GEHA 4M1KA 2CCJA 4NPHA 4F4CA 2K33A 3KQHA 3TR0A 3MLEA 3S2HH 4YMWA 2ZM5A 3TAHA 2ZSAA 1N6PA 5CDFE 2O8BB 1E99A 1KJWA 3UE1A 2O5JC 3FPPA 2GN5A 1Z6XA 1I6HH 2QZ4A 3NHBA 4EKDA 3V00A 1D8TA 2ASBA 2ASEA 1KI6B 4Q4HA 1IOZA 4WXPA 1EOVA 2PQAA 4JI0Q 2WHXA 2HJVA 4M9SA 4JOIC 1VQMA 4APVA 2BA1A 4F93B 2DWQA 3QOFA 1N32Q 1AH9A 4ZV4A 5DI9A 3ZJYA 1GG2A 1C7YA 2WAQE 1U8ZA 4PHFA 4FWIB 1FUKA 4JSYA 3A58B 5JLJA 5GADC 1KC8C 4BRWA 3S15H 4Y52H 2ZQ5A 5CK4A 3T1YQ 1NIJA 2R62A 2WWIA 2NZ8A 4DBLC 4GS3A 4DC9A 2EFHB 2WJJA 3S1AA 1UKZA 1LUZA 1JPJA 3K8YA 2QAGC 4EPRA 2UXDQ 3I61A 2EVBA 4KFTA 1PH4A 4D26A 1Z63A 2VL7A 3RLFA 1N0UA 4Q7KA 3LBHA 3ZGXA 4B35A 1V1QA 2E9SA 5JI2E 3GLIE 4PSAA 1H9SB 1G19A 3C5CA 1E2EA 4V0KA 2D7DA 1CR4A 1VKJA 4HAWA 2F52A 2QU8A 1MKHA 4ESVA 4B3TL 4NYIR 1TU3A 2IWHA 1OB5A 3IFTA 4DDTA 1R6BX 4URUR 1OFTA 1M1KC 4DV6L 2GVAA 1MRNA 4BE7B 1UEJA 5B57C 4DCUA 4DCNA 2WPDA 4F38A 5DLQE 2ZM6Q 2OCAA 4HLUA 3UE0A 2JLRA 3AKDA 2ODWA 2RGNA 1F6BA 1L7VC 4IHQA 1CSQA 4AQYQ 2LSSA 4EJSB 1E69A 1G8FA 3ZVNA 1BS1A 2BOVA 3CRQA 4PC2A 4Q1AA 4GOXA 3T1HQ 4GSYA 3KXLA 1XCMA 1G21E 2ZRFA 1VMAA 3TRZA 3QJYA 1JAIA 3UPUA 4B47A 1EFRA 3VTKA 4FMCF 1XTJA 5BN4A 1NSTA 3NE5B 4M9QA 3SDZA 3GEIA 2H92A 1UM8A 2EVWX 4D0GA 4EFNA 3OEEA 3E5HA 3BBPA 1E2QA 1P9NA 2CCKA 1ESMA 1KOFA 3KL4A 2I1VB 4LF8Q 4BXXG 4HDOB 3K1JA 3G71A 5CB8A 2AHOB 1VYUA 5IK2A 4DV5Q 3ERSX 2AD1A 2Q8IB 4A3BG 4PR0A 1CR1A 2N3SA 1GM5A 2J1LA 4OHVA 4JLDA 3BDOA 5M04A 1MO3A 2VPPA 2K5NA 1FQJA 3L0IB 2YNMA 4NXML 4GNXA 4RD6A 5ANRB 3H3VH 2V6IA 5JSZA 1MR3F 2CKZB 3KOJA 3MXNB 1YU9A 5TMPA 4EQ6B 1VQHA 4QJ5A 3LD9A 3A8JE 4G5RA 1R0WA 3QKRA 4OQNA 1KO1A 2GESA 2C03A 2PQAB 1FMJA 2P5SA 1E9CA 3IBYA 5G3ZA 5IWAQ 1UE5A 2DPXA 4DCSA 3CB4A 4DR2L 1LF5A 1XD2A 2VH5R 4ZDJA 1E79A 4NXMQ 4IQZA 1NIPA 1N0WA 1NJGA 1TQDA 2GEUA 1QVFA 1CIPA 3RSOA 1ZNWA 4C2UA 1ZM3A 4R4IA 1KK1A 2VYFA 2JA1A 2WWHA 4IDQA 1H65A 2FH5B 1BBUA 2D06A 2VHQA 1GHJA 3VAAA 2NO9A 1H9JA 3CBQA 5HKKD 3GTOH 1H8HD 1CBUA 5M3FG 1ZP6A 4R7ZA 1EIFA 1AN0A 1KZGB 2WJGA 2WMNB 3KQNA 1SXJE 4HJ8A 4V0OA 1GWNA 2K5UA 3U44A 4HZIA 2I3BA 4TMZA 5FJ8G 3CC2A 5F9FA 2A68C 1J8YF 1I94Q 1IBKQ 1P4SA 2OUKA 1G3QA 4BLQA 3KF8B 3SFVA 4LYJA 3DM3A 2J7PA 2E87A 3IO5A 3R8FA 5JEDA 4DDWA 1YRBA 1PMRA 3MWLA 3W1BA 2JJ8A 3QKUA 4LHYA 4JIMA 5C0XH 3CF5A 1XJVA 1CJMA 3AVPA 2DFKB 4QXAA 2GJSA 4QL5A 3QKRB 3UATA 1OYYA 4YHHL 2MFIA 3B60A 3O8DA 4LRWA 3VR2A 2WWFA 2DWOA 4K46A 4X8LA 5FUYA 1VQ8A 4BASA 4DZZA 4DV2Q 2PEYA 2IHEA 4GOPA 4X66L 4KN4C 1TQ6A 3K0AB 3IEVA 2BCJQ 4HAVA 2UZ3A 4P4TA 2YJTD 3EN2A 2OCYC 2WPDD 1E2KA 4MRSA 5GJVC 1TX4B 4JLPA 5KNDA 3MUFA 1W1WA 2GXAA 3WDNA 4YY3L 1N6HA 1S4QA 2ORWA 2QY9A 3B1WA 4A1FA 4BEBA 2AUJD 3QG1A 3HKSA 3PO2G 4UXIA 1I6VC 3T15A 5JRJA 1TWHH 1VYVA 2KENA 3AP2A 1RPZA 1T9HA 2D2FA 2XAUA 1SULA 5TARA 2QAJA 1DAGA 4XD7D 2MO1A 2MNAA 4Z51A 4C0LA 1WCMH 2FSIA 3DXJC 4DR4Q 1TU4A 2GBLC 1NN0A 2ZRMA 3IQWA 4HLUC 3UMFA 2F3TA 3EG5A 3A4LA 1N5KA 4Q19A 3UMSA 3GLIA 4JYAL 1VDZA 1IN8A 3FKSD 4U00A 4Q66C 5FOXA 3D6TB 5GJCA 4TWZA 1IBKL 1JR6A 4BZQA 4OI0A 1Q21A 2XNSA 4OXPA 1QHNA 4JYAQ 4NCHA 3THXB 4RMFA 2CVFA 2ZRCA 2ZS7A 1CRQA 3PGZA 5M5WH 2FZ4A 2H7VA 5K8LA 1IXRA 5JEAG 4G0NA 4B44A 4ZI3A 2IUSA 1Y8NB 1TF5A 3TUJC 4XJXA 3REGA 5AUNB 3RNLA 4JZKA 2ZETA 1EWHA 2Q6TA 2QSYA 4A36A 4C9BA 2A1AA 2O8EB 1UBGA 4DV2L 2IK8A 2EQSA 5GAGC 3LQQA 1G16A 1OXSC 2EFDB 2RB4A 3LLUA 5CM9C 3PUWA 5IP7H 1NN1A 1VCOA 1U90A 3FMOB 3W8RA 4CT5A 3Q5DA 2UXBQ 1XEFA 1DAIA 1S1MA 2GZDA 2W6ID 3DVLA 4URXR 1IXZA 4A3GH 3WYFA 3AVUA 1A7JA 2XOKD 4X62L 2J7KA 2AUKA 3BH0A 2DFTA 1W46A 3FPAA 4S2EA 3TS2A 6Q21A 5HY6A 1S3GA 1XTKA 1E2HA 3GTPH 4A8JC 2PI2A 1G18A 4DV1Q 2A78A 3GEEA 2AK3A 2ZI5A 2FXQA 3UDIA 1DELA 1G9XA 2ZUDA 4DV4L 1SXJB 2VP4A 4PZ8A 1GFIA 4KI0A 1XB2A 2Z43A 3KJIA 1XNRQ 2WIAA 5JHHB 1JPNA 1DTSA 2D2CC 1KSFX 2HUPA 3BAFA 4ZCIA 1W7AA 2ODBA 2ONKA 4POAA 4A4IA 3GPLA 3CCLA 3KF6A 5LMUL 1Q7YC 3HYTA 4JLJA 5DN6A 2PMZE 4KMUC 2B29A 1KKLA 4IW3B 1X6OA 2Z6VA 3T35A 4ZIRA 1HTPA 1NMZA 4D4KA 4C4PA 1US8A 2Q3FA 4O25A 5JHGB 2ZRPA 3VA7A 4A3IG 4NB3A 4LYFA 4DSTA 1O7LA 3ND8A 3NDBB 3F3YA 5FBLB 2B92A 2ODNA 4YMUA 4DR6L 3SYNA 2W2XA 3K0AA 4DWJA 2C9CA 2WWXA 4CGZA 4HIOA 1KKMA 4FD2A 1JJVA 1GDDA 3CD6A 2PT5A 4ZDKA 3CZPA 3EWSA 1P3JA 3I73A 4HI0E 1AJEA 1KD1C 2JK8A 2ZTSA 2BE5C 3TS0A 3AF4A 5IT5A 1N36L 1K9MC 1YIJA 4LX0A 1FNMA 1LM0A 4AD8A 1T8UA 1TAGA 1FVIA 1Z29A 1EUJA 2V1XA 3OFND 4BLSA 2A5FA 4LUVA 1E79D 4FINA 2PZGA 5LMNQ 3KJHA 4IOAA 2FSGA 4LYAA 3GLGA 3QNUA 1DVRA 1M34E 1YVDA 4TSFA 2JJ1D 2WB1E 5D3MA 4Q4JA 1PYSB 2WOOA 4CYMA 4GOPC 2BBWA 2QE7D 3VX3A 3NWJA 4B6FA 3QF4B 4PC6A 4CF7A 2OFWA 3CMAA 5SZJA 3K8AA 1A6XA 3FB4A 5GQOA 3BXZA 4AYTA 1KTVA 5ELXA 5GJBA 5EUMA 1ZM7A 3GO5A 3LFUA 4NKRA 2SHKA 3VNUA 4RZ2A 1AGPA 4YCVA 1LV7A 2BMEA 4LK1C 3BU2A 3H1TA 3SS8A 3GJXC 4GLVB 4JV5Q 1NSFA 4UY8C 1ASZA 2J3EA 4R4QA 2QMOA 3IUYA 3GCGA 3QXXA 1LTLA 4A3BH 3SR0A 2XZPA 4MDFA 3AF0A 1QVAA 1OV4A 1KK3A 2WSSA 4K8OA 3SEAA 1SVWA 3N2EA 1DBSA 2P5TB 3AYHB 3LH5A 2IYLD 2UXDL 4W5JA 1PH8A 1N36Q 2ZJRA 4L15A 5JI3E 2B63H 1AIPA 1D5CA 5G41A 1Q12A 4DIDA 1MO6A 1ZNXA 4G7HC 1C9KA 3RWMB 4A6PA 2A6HD 3BJUA 5E7MA 1ZAKA 1Y8OB 1N5IA 3GTMH 4ASUD 4BZXA 2NMVA 4ZPXA 1DO2A 2GVZC 2KBFA 3OFNA 4KSCA 1BKDR 3SI7A 1AZSC 2AN9A 4LJYA 4JBWA 3CNLA 3CC7A 3BD9A 5AUQA 1Y14B 5AJWA 1KI3A 3EZ2A 3FKSA 4DV0L 4B3RL 4FWTA 2F9LA 2QUZA 4DUYQ 4IOLA 2ZAOA 2O8BA 4AIIA 3WWVA 1E2FA 3T1TA 3SQWA 1G3IA 2GETA 4PHGA 4FN5A 1E9RA 4CW7A 3B1VA 4G3XA 5FOTA 4ZIRB 5EE5B 2XEXA 3VR5A 3KDFA 3CCJA 1OHHA 2AKAB 4H44C 1CJTC 4M2LA 1AM4D 2IYXA 1UADA 2LKDA 4GP7A 2JLVA 3PUZA 1Q8KA 4X6AH 2G0NA 4NYMQ 5AJXA 1YZKA 4OGQC 5DHAA 4OJKA 4WVFA 3TVDA 3NC1C 3U2QA 4A8JA 1I94L 3CRLC 3NTUA 4P73A 2OXCA 5FBRB 1OB2A 2UUAQ 4M53A 5E4FA 2UXCL 1KI2A 4MYUA 3OW7A 1P2SA 1Z06A 5AUOB 2EWWA 1EX6A 3MD0A 4OQMA 4EPXA 4JI1Q 1YZQA 3RLOA 5IY0A 2AR7A 2UKDA 1KYIA 3KZ1E 4LHZA 3KKNA 2C2HA 5CJPA 3R9IA 4LV5B 3HOUG 5IYDH 3PSIA 5DGXA 2JASA 3HPRA 2X8AA 3M4PA 1VIAA 4IDHA 3O47A 1I2MA 1XMIA 1YEZA 3M4QA 4KKTA 2G3YA 2GKSA 4QHTA 3I5YA 1XNQQ 5E7NA 4PZ6A 2JLQA 2PT7A 3I7FA 3EA0A 1NRJB 1N6IA 3F0TA 5G40A 3PR1A 3U7HB 2QBYB 2VUMG 2CNWA 5BWMA 3QI2A 2G1KA 4TQUS 1P72A 2ZAMA 1KY2A 3GLGB 1I50H 2IF0A 2GWHA 4RKEA 5FBVB 2ZRAA 3U50C 4L5TA 5IP9G 4M9ZA 2IS4A 3EW9A 1TADA 2Q21A 2ONJA 2IBMA 1PUIA 1DGSA 3QXJA 1W36D 3QENA 1S9DA 2QORA 1CP2A 1ONLA 2KBEA 4B75A 4YMTA 3PVSA 2ZS8A 3CPJB 1HTWA 1UBFA 4LOAA 3OEED 1W3SA 1WCV1 5CYOA 2C9OA 2GZHA 2AKYA 4KO8A 5FOUA 1ZUNB 3NELA 1S9HA 2WMOB 4XTCS 5JJKA 1X65A 2UXCQ 4PZYA 1JI0A 4HDQB 4LPSA 4FW9A 4LUZA 2ZIAA 721PA 3OEHA 1PV4A 4B3BA 5L3QB 1VHLA 4Q4HB 1Z0FA 1MRSA 3SFZA 3L0OA 2RGXA 5KTYA 1LYLA 1AE3A 1E2VA 1HUQA 1Q44A 4HJ9A 1R5BA 1WQ1R 2XJ9A 4QOSA 2OBLA 2QROA 4C7OB 1H95A 1ZMXA 3JVUA 1P2TA 2DNCA 3RS7A 1IJFA 3M4YA 2RHMA 4HUQB 1L1OB 2NZOA 5CIWA 4Q03A 1R7RA 2WV9A 4R2IA 4A3MH 3C8UA 1CR2A 3PG5A 3T61A 4P72A 4GDFA 4JT2A 3M7NA 3L0PA 4WW0A 2FA9A 1G3RA 5KHOC 3A0JA 3K0EA 5E3HA 3E1SA 5CB6A 5C46F 2R9VA 3K70B 3B7GA 3GD7A 1Y8PB 2QA4A 3MAAC 4M1MA 3CONA 1E9FA 3VR4A 3RC8A 1Z0DA 2DHRA 4JI3L 2BEJA 4X64L 1BYUA 1JXMA 2QRZA 3EARA 3FVQA 1PH5A 3Q3JB 3WNDA 2VP2A 3IQXA 4II7A 5JCPA 3U60B 3I4NG 1E1RA 1Z83A 4TSFD 4LSGA 4YXWA 2ZVQX 1XNJA 4LJ9A 4A75A 3KYHC 2A5GA 2IY5B 4P75A 4S35A 1V8QA 1Z0AA 2VP5A 3S2DH 3A1UA 2FPMA 1GKUB 3CCVA 1OIXA 4IXMA 3WBJA 4JI4L 1KY3A 1E3PA 1D2MA 3CR7A 3T56B 1Z47A 1PH1A 3SZRA 2A6EC 2P0EA 1QHIA 2PLFA 3HKZG 3KB2A 4DIEA 4DLVA 1W4BA 2WJHA 3HU1A 2JLWA 4JVNA 3HGBA 1FP7A 4DLZA 3CAMA 4JJZA 4C3HH 2G77B 1J5EQ 2CDNA 3CRW1 4P4UA 2YZ2A 3PF5A 1CXZA 3AKEA 1XPUA 5IRCD 1RJ9A 1YKSA 2Z5FA 4QL3A 4DUGA 2W0MA 1G1MA 2VQEL 5M5XH 3E9IA 1W0JD 2CHVA 2CK3D 2WSSD 3EA5A 3Q7PA 4WAUA 1MT0A 3T53B 4MKIA 1BYIA 2Y8EA 4AH6A 1AE2A 4IPGA 1YRAA 2CLCX 2O0KA 2ID0A 1E22A 1Z5ZA 2TMKA 1OIWA 5EXSA 1VQDA 2JGNA 5AJYA 1U81A 2BDTA 5FFMA 3M9BA 3STBD 3WY9A 4DSUA 3AVYA 4YMSA 1N32L 5K8UA 4HUTA 2RGEA 5CLLA 5IYCH 1MOZA 4O2RA 4R9UC 1KDOA 4HJ7A 3CUEF 1S3SA 2PCJA 4GOKA 4BXXH 5C3EH 3AFQA 2JEOA 4PQRA 4A93H 5FI1B 4TL6A 4FI3C 4NYJR 1ZBDA 5H1YA 4JBMA 3QE0A 1K83H 4DKXA 4A3JG 4QBHA 3RZDH 3KTAA 3TZUA 1P60A 2JAQA 1DPFA 2EDGA 4LBZA 1HZCA 2OLKA 2RF4A 1LABA 3ZVMA 4LW1A 2LXJA 2ANCA 4YY3Q 3EXAA 4DSOA 2JQOA 3A1TA 1KI7A 1TKWB 4V0ME 4C0KA 2VEDA 3CX7A 1VG1A 4F92B 2G83A 2LMCB 5SZKB 2QT0A 5JZVA 2HV8A 3THWA 4RG1A 1XU4A 2HXYA 4GMXA 2YOHA 2BIFA 3C16C 4GPTA 4LHXA 5JECA 4TLEA 4QBIA 3N70A 3GLIB 1PFSA 3EZFA 3DZ8A 2G88A 121PA 4B34A 1HQYE 1PHJA 1VQLA 2AWNA 1RVDA 1UBEA 2HXSA 4V0MA 2VY3A 2R92H 2YC2C 3REFA 3UG6A 2I0QA 2OO7A 1WRBA 1CKNA 1NVXQ 1C0AA 1IBMQ 5ELOA 1F2UB 1YNXA 2FFAA 4AKGA 2IHBA 5EE9A 3RN5A 3K0FB 5IYBH 1XNQL 3DEFA 3FYHA 3VX4A 3AVOA 1CF4A 2A6ED 3I4MH 2ORIA 4HJ5A 2QPTA 4FMDF 3LRPA 1JJ7A 1K8RA 2VSOA 2UU9Q 3H94A 3MJHA 4GZYC 4N1AA 2GNOA 2H8KA 4IVPA 3A37A 4B33A 1ETUA 3LV8A 3T5GA 1ZC4A 3TKLA 3U3MA 3L2PA 4XIGS 2DBYA 3PO3H 3AVQA 4A3CH 2ZJBA 4AKEA 4OO1I 3ZVRA 5LMNW 5HZHA 4M0LA 2H5EA 4HZUB 3K7UC 2B8FA 3TNFA 3ZQ6A 5IP9H 4B3CA 4B3FX 1JXOA 5J4VA 1P5ZB 1DARA 1LFDB 3D3QA 3UDXA 1FP6A 3B1ZA 2VSFA 5J5CA 3U6BA 1J8MF 3K80C 1VQPA 4A3CG 1G6PA 5K8TA 4W5HA 1P9WA 2PL3A 3G4SA 2REBA 2A5YB 2KJQA 3BB1A 5J3BA 3TBKA 4M1SA 2ZR0A 1S96A 4P31A 3UKDA 2IYSA 1KI9A 2A3RA 2QTFA 4BA1I 1Q46A 2VZAA 1Q86C 1W2HA 2CLSA 1TF2A 3M85A 3U9SA 1FJGQ 4I99A 4PTLA 4WIAA 5EQTA 1SHKA 3HP1A 5BXQC 5HGQA 2ZSBA 1GL6A 1VCMA 3EIHA 4JVMA 3OTOQ 4BPBA 4M1OA 1SXJD 5KSPA 2F4VQ 4YXWD 1RIPA 3J81c 1TMKA 4IVRA 2CXXA 2XITA 3T1QA 1II0A 3P32A 4D0LB 2O8FA 3HOYG 2IUTA 2QQEA 3AF2A 5EXXA 5C2JB 1DADA 5KOYA 2E2IH 1HEIA 4JI7Q 2YTVA 1QVCA 5DI3B 1A1VA 1X8JA 3QPVA 2WSMA 4IJMA 2HF9A 1JJCB 2WKPA 3BGWA 2ZRKA 1HNXQ 4H13C 3LO5A 5EZ5A 3GLFA 5FL3A 1P6XA 4EJSA 2B8TA 2BVNA 5EAYA 1N9WA 2C5LA 2H57A 3B1XA 5JRZA 1KIXA 1YJNA 1DAKA 1E2PA 4JVSB 4MGYR 4US0R 4RCZA 1R0ZA 1JB1A 2ZJ5A 3DMNA 4A3LH 3FTQA 4WBSA 2OFOA 4JV5L 3O8BA 4G1UC 4B43A 4JBKA 4OWTB 3CPFA 2B63G 3HOVH 3PEUA 5H8WA 4ZCMA 4YDHB 4OK6A 1FQKA 4GKKQ 1OW3B 4DV3Q 1YHNA 2EJFC 3C14C 1JR3D 3A7AB 2HCJB 3OESA 5J4YA 1E2ZA 4JI6Q 3TMKA 1HCZA 5M3FH 4Q48A 4MITA 2RGBA 1IW7C 1GIAA 2ZE6A 4RCYA 2ZTCA 4CVNA 1VQKA 4RD3A 4ZKEA 1HZ9A 1XZQA 1AQYA 3JVVA 1F2TB 5KSYA 2FU5C 4GLXA 3KXKA 4TTPA 1IBLL 1YI2A 1V5WA 5IF9A 4U02A 2RGDA 2ZJ2A 2IT1A 2QRNA 4DLUA 1E0AA 3IEUA 4F4JA 1VQFA 1R9TH 1NF3A 1VPLA 2AX4A 2DFLA 4KBGA 4L9SA 3U58A 4UPAA 421PA 3KF6B 3L7ZC 3LA6A 5IYCG 1LNZA 2J5XA 2AFHE 1NTGA 3RN2A 2QMUA 4DNRB 2WAQG 1SVMA 3DZDA 3OEHD 4PO8A 3VKGA 4TYPA 4X65L 3TUIC 1RZ3A 4EPWA 1G8YA 4O0MA 2YWHA 4C3IH 3KDFB 5JEAJ 3C15C 4DRZA 2VA8A 1XEWY 3FMFA 3C5HA 2NPFA 4XVUA 1OFIA 1JR3A 1DAHA 1KHTA 1AA9A 3I8XA 4GKKL 1VTKA 4TKOB 2QI9C 1R8SA 1TWCH 1KHIA 2BWJA 2XXAA 5KDLA 2JLZA 4IEEA 1S1CA 1OFHA 2N78A 1NP6A 5LB2A 4KLNA 2P6RA 3GJ5A 4QM6A 2IS6A 1HH4A 1C9OA 4B3ML 1IL2A 2EXDA 2W6JA 2PX0A 3ULLA 3ZZ0A 1Z6HA 1Y1WH 2PBRA 2JJ2D 1LS1A 2X1VA 4DLRA 3J7A5 3CW2A 4NCNA 4EPTA 1X8KA 2CL7X 2UUBL 3AUXA 4X8HA 4GOPB 1OKKD 2GZAA 2WIBA 2XTZA 1CJKC 1YQTA 1NVVQ 2YWFA 2ERYA 1M6NA 1ZUIA 3UIEA 4IOMA 4L5QA 4RD2A 3THXA 1EQRA 2JA8G 1U0HC 3FKQA 3ASZA 4UNSA 1HR0L 3FGNA 4QHSA 4Z1MA 3GJ8A 1FUUA 1YZUA 4NYMR 4US2R 3WP1B 1K5GA 3THYB 1TUEA 3H4MA 1R0XA 2C9YA 2IF2A 2D4HA 4Q01A 3QXCA 1OH7A 4GL2A 1VS0A 1B9NA 1GRNA 4B2IA 4O0AA 1RYFA 3LW7A 1ZVQA 3L8YA 3CXCA 1HNWL 4L5SA 3I92A 5GAHC 2JLSA 3B85A 4YWMA 3SJCA 4JL8A 5FPKA 1EIYB 3GLHA 3W5IA 2OXRA 2F1HA 2QENA 2C95A 2AMCB 1QHYA 5AUPB 1A2KC 3PUYA 3AVXA 5JJLA 3MFYA 2Q3HA 2X2FA 2BC9A 2ZRHA 4TMVA 4PSKA 4RY2A 4OHZA 3TSZA 4AG5A 4C0JA 1YBYA 4JBJA 2VHTA 1YZ6A 4XVQA 3TQCA 4AY2A 1Z9FA 2J9RA 4G5SA 2QF7A 4DB2A 2ZVPX 2CWPA 5CM8B 1WP9A 1KDTA 2H1LA 3GFPA 3CRVA 3KJEA 4HLDA 4MRNA 2VQFQ 1D7QA 821PA 2P65A 2L0XA 2A68D 5HCNA 4C0QC 1IY2A 1J70A 1II9A 2FSFA 3FDIA 1XD8A 1CRPA 1DO0A 1R4AA 1T3LA 1XTIA 4WOPA 1UDXA 2QP3A 2RGNC 4LUCA 1NBMD 1OPXA 3SN6A 1VQ5A 3CH4B 5FBWB 2A6HC 2ZJQA 2OWOA 1KMHA 2C98A 2KWIA 2RKOA 4G5QA 4JMPA 3KDSE 4WZBE 3THYA 2NVQH 4LF5Q 3CWQA 4U5XA 4I7ZC 5A0FA 2FN4A 3F5FA 4UXJA 2BDOA 1QZHA 2WAXA 2CE2X 3RS5A 1E9AA 1CFMA 1NNEA 2XB2A 3I8SA 2EWVA 2V1UA 2QP4A 3CPHA 4Q4JB 4AWXA 5F98A 4GP6A 3PEYA 2CJWA 2X19A 3CCSA 1U94A 4R98A 5IWAL 2OESA 1SGWA 2OBNA 4LHVA 1H8EA 2BJVA 1Q20A 2F1JA 2IXFA 2BEKA 2PPBC 2CWAA 4DUZL 3I4MG 4KBFA 4LJ7A 3I5XA 5A35A 4OO1H 1GJXA 3J81j 1K8GA 4G5GA 3SQXA 5G3YA 4Q1EA 1UE1A 4ACBA 2V6JA 2ZSEA 2WP8J 2XNDA 3AKCA 221PA 1DE0A 1ZINA 2J0UA 4NHOA 4DR5L 1VF7A 3TSWA 4GN5A 1KXLA 2LWIA 2RHDA 1G7TA 1G8HA 1Y63A 1IW7D 2QEXA 4UNQA 2K5VA 3CMEA 3S1QH 1CS4C 1G4AE 2R92G 4LF8L 1KNXA 1YJWA 4KFUA 3GTQH 3I4OA 1P73A 4QFMA 4G01B 3R9WA 2P2LA 3Q9LA 3X1XA 4C0AC 1JQLB 2OAP1 4MGIR 1EK0A 1ZJ6A 3UG7A 4GNXB 5L3VA 3T51B 4XWKA 3ADBA 4LJAA 4KHPL 2DB3A 1GAJA 2C35B 1G20E 5F2EA 4C3JH 4JT4A 3TQFA 4DR5Q 4M9XA 4DNIA 2JDIA 3V9PA 4JI5Q 4LWCA 1KRTA 5EE0A 1QVGA 1FNNA 1CTMA 4PQFA 1KO5A 3B9PA 4IFBA 3WHLA 3GTLH 2Q9CA 2QAGB 2F43A 2XSZD 1H9KA 3I1FA 3VU9A 4EIWA 2QBYA 1Y1WG 2V3CC 1NY6A 3A6PC 2ZRJA 1VCNA 5FR1A 4TVAB 4LV6A 1NG1A 1YR6A 3RVBA 4TYNA 4OHWA 2JLXA 3CW2C 4R4CA 1Q1ZA 1E2WA 3AB3A 1R10A 1GNRA 4KXFB 2XJ4A 2IEYA 3FHTA 4OWWB 3J80i 2J0UB 2F1RA 2KBNA 1P2UA 4BBRH 4ALPA 2IX1A 3LY5A 4HLCA 4JLNA 3WRYC 5C4XG 2VL6A 3VDYA 4QBFA 4DCVA 3WYAA 3KQUA 4QGFA 2JDID 2AL7A 3SYLA 2O8EA 1E2MA 1MV5A 1AK2A 4OI2A 1IQPA 1W48A 1MABA 4D4JA 3NBYC 2PLRA 1OH8A 3UDFA 1GNPA 3QEOA 5FPHA 1OKKA 5EZ6B 1N6NA 4B2LA 2ZS9A 2ZUCA 1JB7A 3DMDA 5CYPA 4C0BA 4OQLA 2ZU0C 1W49A 3CCUA 2W6JD 2JLUA 1G8PA 4A2PA 4BY7H 1EWQA 3K53A 4FCTA 4MRRA 1BMFD 5B2ZA 3DHWC 4PV1C 2CHGA 1OSNA 3GQBA 3EWAA 4A2QA 2NVXH 1VHTA 3KFXA 2AFIE 3HOWH 4XSGA 4ON9A 5FPSA 1Z7TA 3AUYA 4IOJA 1J90A 3I56A 1MO5A 2MSEB 1B8AA 1QUQB 2BKUA 2ZYVX 5FTKA 5H1SE 3IKJA 4Q9KA 1H9RA 1Z6YA 3HOXH 1LY1A 3TK1A 5TB5A 4OX9Q 2N42A 1VQ6A 3QY0A 5DYGA 2BA0A 2P6NA 3SC3A 3JZMA 1Z0IA 3B6EA 2E74C 2GBLA 8OHMA 3NENA 4QGGA 1V9PA 3OIVA 3I4NH 2RCNA 1M7GA 1X1SA 2QM8A 4ACAA 3Q72A 3LVQE 4ERNA 4POFA 1OHHD 3KLWA 2FE4A 4UJ5A 4BFZA 4ITRC 1XEWX 1RIFA 1ASYA 1GUAA 1SVIA 3TQYA 2PH1A 3MJRA 2GXQA 2PEZA 1VQEA 2IW3A 3NG1A 5FPTA 4WJ3M 4A0HA 2Q2UA 1IXRC 1XCPA 2I1QA 2RHQB 4KKUA 5JMTA 4RD4A 5DI3A 1P2VA 2GK7A 3EC1A 3DOEA 1NE3A 1JJ2A 4O2DA 2VF7A 1N33Q 3GJ4A 1XJ0A 3PEVA 1T0JB 3W1GA 1NJFA 3V4RA 3VNVA 1ZRHA 3S1MH 1W44A 3TAUA 1IYUA 5IT9c 2UUCL 1J2JA 1YE8A 4TTQA 5GADl 3D31A 4US1R 1G291 5CK5A 4B74A 1JEDA 5C4MA 4JLAA 2WTUA 3E70C 2I5HA 1W2BA 4A3FG 4GMDA 2F55A 5C4JH 1LVGA 1L4YA 2NGRA 1NVVR 3J7ZC 5GAEC 3J80c 3UWKA 2Q9BA 2WM9B 2W2TA 3E0EA 1P75A 1Q1BA 2ATVA 3A1WA 4RFSA 2FPKA 1E96A 1OXUA 2IC5A 2FX3A 3MXUA 4ESHA 3VKHA 3QVUA 1YZLA 3D0FA 1VQOA 1RC8A 1SXJA 5CJ2A 1W5TA 1CUKA 1TU2B 2A30A 4ZI2A 2O8CB 4ARZA 1E0SA 3OE7A 1GKIA 3JC66 1R5NA 3VHLB 1A63A 2HEIA 1RRCA 3EIVA 5J4LA 2JEBI 1X3FA 3RRMA 3VR6A 1JR3E 3IDQA 1RRPA 4AC9A 2WB1G 4A0GA 1QJOA 1LF0A 2W0SA 1IM2A 3P4XA 1XRJA 1I4TD 2O5VA 4NCKA 3IPYA 2VSXA 3CF2A 2FGKA 4MYTA 3LWUA 1I2DA 1M2OB 4E07A 1ZIPA 2OILA 2G6BA 4BY1G 2JATA 2ZJAA 3DM9B 1ZIOA 3B8HA 2OCBA 4TLBA 5JJIA 1MH1A 3GP8A 2D74A 4Y0AA 2G9NA 1E3MA 4H1UA 4YLGA 3SGIA 5JEAH 2VTKA 2Q0HA 3TSOA 3WXMA 4PX9A 3G82C 4D6PA 4AKHA 5C44G 1A82A 2VHUA 5FOVA 5H70A 3RWOA 2A19A 3WMFA 1F2UA 2F9MA 2H16A 3M0EA 3AVWA 3A36A 3HJNA 2IHFA 2ZROA 4KKSA 1K8MA 1NMFA 3X1WA 4TTRA 1IXSB 2XXAB 4P33A 4JL5A 2OHFA 1HE1C 4J15A 4JG2A 4P4SB 5EXTA 4D82A 1Z28A 4DLXA 2VIIA 4JJKA 3NEMA 5JBQA 4JBXA 3KKQA 4JSTA 3BZCA 1U5KA 3D7MA 4KAXA 3NIBA 2QA5A 1IN4A 4A3DG 1TWAH 1UE6A 1PZNA 4J0QA 1BDOA 2N8NA 4MKFA 3EX7C 3WP0A 2N46A 4BFUA 5KDOA 2QT1A 3PCRB 1QHSA 1T3SA 4P32A 1R2QA 2QTHA 1YHQA 3AEZA 2VF8A 3W8NA 4PFSA 2E2HH 1IZ6A 2BJWA 2GCPA 4JLMA 4Q4LA 1MIUA 2EYUA 3JAMc 2WICA 1WBDA 3EPHA 2K4KA 3CPWA 3U61B 3A8KE 1Q81C 1WE2A 2JA5H 4CEIB 2R6GA 1NBWA 2MQHA 1E2IA 3QVVA 5EXPA 4ZDIA 1OF1A 2Y0SG 1ZM9A 1E6CA 2GF0A 3GJ6A 3NXSA 5FI0B 2AKWB 1G17A 2F7SA 3OTOL 1ZM4A 4BFWA 4CEHA 1J5EL 2F1IA 3AQ4A 4MQBA 1KAOA 5C3EG 1X6VA 3CWZA 3HPQA 4DR4L 3HU2A 2CQOA 1U0LA 1AQUA 4IEIA 3WMGA 3ZIAD 1SFOH 3C7KA 4YCUA 1KK0A 4DAYB 1UKEA 1OLOA 1TWGH 1AS0A 1A62A 3LNNA 1JQJC 4I4LA 4MYCA 2O8FB 4LFBQ 4X8MA 5ELNA 1UEIA 3BERA 4P3YA 3R9XA 1VQNA 2GXUA 1J7KA 2HQLA 1AKYA 3SU8A 2GRJA 4RVCA 4TMKA 3CRKC 2LKCA 4M1WA 3EC2A 2FDCA 2V54A 2O8DB 4TQAA 5FTNA 3LAWA 2R7ZG 4UXHA 1YJ5A 4AG6A 3HR8A 3OIYA 1D8LA 3L43A 4B3MQ 1SRUA 4UNNA 2ZI4A 5KO2A 2PJRA 1EWRA 1RJ9B 1YJ9A 2EU8A 3GTKH 2FOLA 3PV0A 3FOZA 1XJQA 3X1ZA 4XSHA 5FUWA 4DDVA 4HEJA 1JALA 1XFAA 2OE2A 1UAAA 1HY3A 2BH2A 2ZREA 2WOJA 4JS0A 4NPSA 4E22A 3GJ7A 3JZAA 2EIFA 2ZSFA 1Y69U 2O52A 4HB3A 4KLZA 1M7HA 4H9GA 3W6OA 1J99A 4CIDA 4V02A 4IFDI 2A69C 3AF3A 1SXJC 5J4KA 3SE0A 3LVRE 4CEHB 2BCGY 1XTDA 4KYUA 2YTYA 3E9HA 2NG1A 1GKHA 2V55B 4Q1FA 3FHCB 1IYJB 5LMNL 3PCOB 1W36B 1G7CA 2VO1A 1L4UA 1F3OA 1Q3TA 5C4XH 3TW8B 1HNWQ 1XPOA 3CCQA 2G0TA 2ORVA 4NZYA 4DR7L 1HV8A 3EPJA 5LD2B 3TH5A 4E5UA 1QHHA 4Q47A 4M22A 1VYTA 2QEQA 5BR8L 1DG3A 4KSBA 3VFDA 3RR5A 4EX5A 3KX2A 4IDPA 4TL7A 2YWEA 3KKOA 4A3KG 5SZHB 4LF7Q 3AVVA 2OLJA 1HYQA 1SHZA 2DNEA 1A8VA 2A9KA 2ZI6A 2QN6A 3IHWA 3TREA 1Z22A 2HT6A 5EUQB 4AYBE 4C7OA 2AWOA 5C1BA 4A4DA 2QL6A 4RFVA 5BN5A 5EE3A 4O2LA 4AK9A 5AWFC 3JAMi 3PXGA 1NY5A 2ZJPA 4DNTB 3NC0C 2HIVA 3GFTA 1X55A 4A3LG 1KIMA 1N6LA 3O8RA 3FFAA 2ATXA 1HA3A 2WKQA 2ANBA 5KSZA 3CKLA 2E8GA 4HJAA 2ZANA 4Y7NH 1CKNB 3I4LA 1E1QA 2R6AA 1JJGA 2BV3A 2ZE5A 4P71A 4AKIA 1XMSA 5DHFA 4WZ6A 4OQFA 4JI5L 1MABB 2ZJYA 5CDFA 1N6KA 2OM2A 3MCAA 1S2MA 3HR7A 4C3ZA 4RFSB 4BGDA 4K0KL 1XF9A 3B78A 4LV8B 2ZTDA 1W4CA 2CEAA 1KJYA 2GK6A 2OTLA 2UZIR 3NEJA 1KI8A 1Z6GA 621PA 4JI6L 3AV0B 2MSDB 4URYR 4R71A 3ZLJA 1GTVA 3CCMA 3QQ5A 1U8AA 2IL1A 3AP1A 4EQ5A 3S1RH 3K81C 1FW6A 1Z6TA 1OJLA 1XPRA 1SQ5A 3ADKA 3Q85A 4JLBA 3WRXC 2YC4C 2B7BA 5IP7G 2P67A 1NVUQ 1VQ9A 4OHXA 2D5DA 2Q2TA 2IA5A 4D2IA 4LFCQ 4AQYL 1RE0A 4A76A 3CZQA 1II8B 5GROA 2XB4A 3CRMA 2F3IA 4R4OA 2V9PA 3RC3A 2D2EA 4IJHA 4HDCA 4P74A 2XZOA 3QBVA 1KSHA 1P61B 1N6OA 4LHWA 1GUSA 4M8NE 5IYDG 4DV4Q 3HOUH 2ZTEA 4IO9A 3T1YL 4BBSG 1XTQA 2JJ2A 3CM0A 3D8BA 4OHYA 1PJRA 1QDEA 4DV0Q 3GMTA 2R6DA 5AK0A 3CPEA 1VF5C 3TR5A 3VQTA 1AKEA 4R4TA 4IFEA 1IHUA 3MWKA 1VQAA 1VQCA 3MSXA 3TLXA 4I1OA 4QNMA 2GDJA 4V0LA 5AR1A 1KI6A 3T06B 4PC1A 1S40A 2Q2IA 3BFXA 1X3GA 2NZJA 4X64Q 4EPVA 1Q0UA 1E9EA 4DK0A 1ZD1A 3STBC 2OT3B 3I32A 3LWNA 3ZDQA 5LD2C 4MKGA 1AS3A 4R1JA 3MGCA 2J7PD 1NKSA 4XWAA 4DLSA 2OQKA 1A4RA 4IFDJ 1A2BA 3KKPA 4LF5L 2B6HA 2ZEJA 4KVAA 4DHEA 4GLAC 3RS3A 1RFLA 2IYYA 2XTNA 3OZXA 2FFBA 3MRSA 1GHKA 3KB1A 1FGUA 1TPZA 2C96A 4AI6A 5M3MH 4AYWA 1AS2A 4QJ3A 2QGZA 4WZAE 2D3WA 1JMCA 3ZIAA 3ZS8A 2IS1A 1SZPA 4KCGA 2Y0SE 1MJCA 5FTMA 3IBGA 3HOZG 4JI0L 1LW7A 1NBME 1E9BA 1PH7A 4UP7A 2YINC 5D3QA 1PVOA 2OTJA 1RW4A 1CEEA 3SYKA 2F4VL 2BE5D 2BBTA 4PPGA 1W0KD 1T5LA 3W6NA 1SKQA 1P9RA 1XXHA 1IN6A 3LXXA 4RZ3A 1DS6A 4TMTA 3X2SA 4DLTA 2RMKA 2BM1A 1EXMA 4GKJL 2JXMB 1R0YA 4JKIA 2YVUA 4IOCA 4A3EG 4CDGA 4LNQA 1KJZA 1XTRA 1ZCAA 5B30A 2VHCA 5JEEA 5FLMG 1O7IA 5EP3A 4A93G 3TJZA 3NVAA 2N49A 2KSQA 1U99A 2IHYA 2Z83A 4KYIB 4TLDA 4DV5L 1FMLA 3W3ZB 4Q9JA 5EP1A 1T0HB 4A3JH 4OWXB 1YZGA 2YTXA 3BZKA 4BBSH 2PMDA 3CX8A 1EFHA 3B5JA 1X54A 4RZUA 4TYQA 3IIMA 3Q8XB 2D0OA 1W4RA 2W6IA 5D3MB 3IRBA 2IYTA 1UE7A 1Y1VG 2NO7A 1D2EA 3CF0A 3QEJA 4PPQA 5DISB 2EJMA 2O8DA 2DUDA 4Z1MD 3B13B 1XMQL 5JWOA 3HOWG 3HYRA 1JECA 2IYQA 1GOTA 3N5CA 3TUZC 1WOCA 2J45A 2KB0A 2QE7A 4PXAA 2O0HA 3L8ZA 5J47A 3KQLA 1TF7A 1VG8A 1CKOA 3ER0A 5DYIA 4R2HA 2Z6KC 1Q82C 1T91A 2GXSA 3FMPB 3LLMA 4PAQA 3RRZA 2DN8A 1QG2A 4OJQA 1TXYA 3CCEA 1XEXA 4D80A 3U5ZB 5L3SB 2BM0A 4QBGB 4BFVA 1E2NA 2W58A 2B7CA 1WYDA 1KQSA 3THWB 2UUAL 4DR3L 3C41J 4IRUB 5DO9A 1K3RA 4TL9A 5K8IA 1GRRA 5IDVA 4YMVA 5BR8Q 3R7WB 4TT3A 1AZTA 4B2PA 3H3VI 2AXPA 4QM7A 3LBNA 4GZMA 4UNPA 1WDTA 1ANKA 2A5DA 3U3JA 3KUDA 3H0GH 4PMWA 2C99A 1ZYRC 3FWYA 2YOGA 1E0KA 1NMYA 3O8CA 5EE1A 1XDBA 1N34Q 2F43B 3KQKA 1E7ZA 2BKEA 1E9DA 4FMDB 1PH9A 4DR2Q 2BBSA 2ZYWX 4HAYA 3PITA 2UXBL 1NVWQ 4AYBG 4MNOA 4QY7A 1QHGA 1B70B 3M3YH 1U2RA 2RAPA 3ZVLA 2E75C 2ZXUA 2F3RA 3ONWA 5FOSA 2C8VA 3QIAA 1VQ7A 3CQZH 1SN8A 3LW8A 2V7QD 3ZJYC 4L5RC 3KJGA 5E7IA 4MGKR 2PCFB 2X2EA 1ZU4A 3BOSA 4RJLA 3ULPA 1G5RA 4Z8XA 4DCTA 4E03A 5HPYB 2ZRIA 5LPNA 2ZYUX 1HNZQ 3EZ9A 4NYJQ 3GLHE 1OXTA 3THOA 3X1YA 5DIFA 5L3SA 2RH5A 4B3TQ 4KHZA 2HDNB 1IY0A 3BC1A 2QAGA 4KLKA 1W2GA 4B73A 3IIKA 3A7LA 3PIRA 4DT1B 3W5OA 2IEZA 3U6KA 1YNJC 2F1MA 4MZ9A 4A3DH 2WJVA 1SE8A 2L5TA 3QXHA 2ALYB 4Q5IA 2HT1A 3KFUA 4B32A 2ZM6L 1EFWA 2UVQA 1FTSA 3IO3A 1G8GA 4DDUA 1OH6A 4QG7A 3AH8A 4EFLA 1HH2P 2QSZA 2WWGA 2WVJA 2DGYA 3I2ZA 1E4VA 2OAQ1 2PMKA 4K81B 2K52A 1TEVA 4RCNA 1E2GA 1VECA 2R7DA 2VQEQ 1LACA 2JA9A 4LF4Q 1C1YA 2CW0C 1NBMA 1OE0A 3RYTC 1HE8B 4QGAA 2WWWA 3SNHA 4QKQA 1E94E 5KYKA 1ZU5A 1BIFA 2GVBA 3NHAA 1KMHB 2ZI7A 2ZE8A 4POGA 4Z8YA 3QKTA 3NBHB 3OW2A 1DCZA 5BQ5A 4FDBA 3S1AB 1C4OA 4QJ4A 2O5IC 4L16A 4W5WA 5LDDC 4LFAQ 3OAAD 4LUOA 1RKBA 2QG6A 2FFQA 3CRRA 3FFBA 4JCVE 4KFSA 4W9MC 1U0JA 4BA2I 3MMPA 1EWIA 3LNCA 4QQBX 1CU1A 1EQQA 3WMEA 3PIOA 1T5IA 2HLDA 3W5JA 5KPJA 4LF9Q 2PZFA 1WCMG 5HCIA 5JWHA 5BYJA 2IYZA 2OCPA 2EW1A 2XX3A 1NMGA 3S14H 4BLTA 2DR3A 4DT1A 2REXB 5FTLA 2A5JA 4LJ4A 3GFOA 3DKPA 2FFHA 3U4QA 1KL9A 4M1YA 2GHIA 2E5LQ 1QVRA 2K14A 5AJ3Q 2ZR9A 1OXXK 2IYVA 3BRWD 3QF7A 3UK6A 1NJIC 1IBML 4HYYA 4I1UA 3NH9A 1Z3IX 1GVPA 4HZUA 4KFRA 4LFCL 5H68A 3W9YA 3F2DA 2E5LL 4YWLA 1CKEA 4GNXC 5AJ3L 2N1BA 3FHOA 2PJZA 3QPUA 4MGZR 4FMCB 2ECKA 3SJBA 3H15A 5LMUQ 3ULJA 4QJFA 1YHBA 3EQLC 3T34A 1Z6AA 2BMFA 3LBIA 2WZQA 3U3KA 1K73C 2Z6KA 3EZ7A 4EAQA 2ZJOA 2ZR7A 2UU9L 4TYWA 3QUSA 1KI1A 3GTJH 4JL6A 4LZZA 3UXMA 3OYYA 1XBTA 3CCRA 1ZNYA 4RKFA 1IYVA 2MSCB 3CR8A 4QHYA 3SBEA 1E2DA 4B76A 5KU1A 4FCVA 1FPMA 1XCGB 1WXQA 5FJ8H 3QBTA 4LFAL 3Q5EA 5AJVB 1ELOA 4PZLA 1KK2A 1N25A 3X1DA 1M7BA 3I3SR 4OQXA 2CCGA 5SZIA 3WHKA 1OH5A 3GLHB 1YR7A 2NN6I 1XP8A 2AHOA 4ZDWA 1Q1EA 2GILA 1E4YA 1GP2A 4Q4AA 4DEYA 4GFDA 1HT2E 3P1JA 2HLDD 4UKDA 3BS4A 1NLFA 3AEVA 4MUBA 4OK5A 1CR0A 3SBDA 4HB0A 4DSNA 2NN6G 3K0XA 2CNWD 2WJYA 5EP2A 4EDHA 1M1YE 1E2LA 4LF4L 1UDWA 4TMXA 1VG9B 1GRQA 4FCWA 3GLFE 4TQ9A 4DR1L 1BVSA 4Q18A 1GUNA 1EGAA 1KMQA 2JJQA 1ZM2A 3CNNA 2IWRA 2WJIA 3K09C 1YNNC 2CK3A 4V0NA 2CCZA 3DL0A 5FL7A 1UF9A 3WYGA 4DK3C 4BY1H 4P4SA 4JVLA 3ZZTA 3U7EB 3RANA 4DK1A 3PUXA 1SVKA 2IX0A 2W00A 1GSIA 4JI8L 1XMOQ 1R5OA 3GDEA 1ZYUA 1MKYA 2JJ1A 4JK1C 4Q21A 4B3RQ 1F48A 2I5MX 4GZLA 3LDAA 5FR2A 3ETLA 3BB4A 1IAQA 1KGDA 1BMFA 1UKVY 4LI0A 3RRYA 3U4ZA 2KE5A 2OG2A 1II8A 1Z07A 4BQSA 1VIYA 5EJEA 1D9XA 1XJCA 1WI5A 2I4IA 2R8RA 2MO0A 1E1TA 2KCMA 2Q2HA 1IN5A 1SVOA 1XXHE 2FSHA 3IGFA 1PH6A 4LCBA 4IFDG 1BBWA 1S8FA 1G5TA 1F2TA 3IHLA 3I72A 5DLQC 2VP6A 2E2JH 1W0JA 4L4UA 4Q4AB 1HJPA 3K0CA 3KFVA 4HIKA 3T5DA 2Z0MA 4K0KQ 4BFSA 4DV1L 1CKMA 3PQCA 1CSPA 2KA7A 2OBMA 1X3EA 4ARZB 1IONA 2NTYC 2OCEA 4NDZA 3LGJA 4N0EA 4LF7L 2R2AA 2Z4RA 2ZT9C 1FFHA 3OE7D 1Z8FA 1QHXA 4LPKA 3KTAB 4UQOA 3F2BA 2KI5A 4A0FA 2UUCQ 1K8AC 5FL7D 3NEYA 3TRFA 1FYCA 3BH7A 2GVDC 3TVTA 1HNZL 1M8PA 1UKYA 1QF9A 3MWJA 2VLIA 4QNRA 4YQFA 3AM1A 1OTCA 4PSVA 4JYCA 4D4MA 3SJZA 3CF6R 2XSZA 4ZCLA 2H18A 3BJIC 5TXGA 1G7RA 3IIJA 5GVRA 3R20A 4HAUA 2RGCA 2R6CA 3RDPA 3K70C 4QIWE 1P8LA 4W7SA 1KZ7B 1ZC3A 3HWSA 4JYBA 3MEFA 4DR6Q 1HQCA 2JA7G 2IYRA 4BFYA 1ODFA 1VQGA 1N0VC 3PF4A 3U7GA 1HQMC 4DV3L 4A92A 1W5SA 1I4LD 1X56A 3W6PA 4PZ7A 1CJVC 3HDTA 1UPTA 4TLCA 5L8VA 3AQQA 2LCFA 1S0UA 3K9NA 1K8OA 1E1RD 4LWZA 4HATA 4LBYA 3DO6A 4URVR 1HURA 2B21A
chains in the Genus database with same CATH superfamily
5T1IA 5EUCA 4GOMD 1BWSA 2NUAB 2ZAGA 1EZ1A 1PTOD 2HHHL 3GT7A 2RI0A 2NU8A 1OLXB 2CL5A 2DY1A 3LY8A 1F2DA 3N0XA 4OO1G 1RYZA 1CLUA 2PJUA 4R83A 3F3KA 3TDQA 3NOOA 4MQ6A 4C6HA 3AFNA 3D7LA 4FZ5A 4ETIA 4ZICA 1NWCA 3G6EA 5IC6A 3WGVA 5KTOA 5TEVA 4A9AA 4DYHA 2XN9C 2ILVA 3KXIA 5DK6A 1H2XA 5TQ0B 3RHFA 3FB1A 4BNXA 4D8TA 5BUCA 3F1LA 3MQ2A 4D7AA 5PNTA 4HWKA 4JJFA 5FBHA 2WF9A 5IK2D 2E4VA 1TVKB 3U56A 4NXNQ 1JIQA 2BELA 3IE0A 4B3SL 1ODKA 1OT3A 2ONZA 1XD2B 3GU3A 5AM2A 3B6JA 3VU9B 1XXHB 2FFRA 1PUJA 3BYTB 4NXNL 1EE1A 1X2BA 4G0QA 4RTSA 4GMHA 5DE3A 2VUMH 1KVRA 1TZCA 2X13A 1U4RA 4M86A 2K5DA 3FIJA 2VATA 4YROA 4BO1A 3ADCA 1L5WA 4KTVE 1GADO 2ZPTX 4GPAA 2B5WA 3FZEA 2ZE7A 3L9WA 4MGHA 3COWA 3QKSB 5J40A 1PQUA 1C7RA 1AKMA 1FTNA 3R7BA 4X63A 3QPWA 2Z6QA 2MSNA 1A2TA 1F2VA 4G0UA 5JVG3 2P6OA 4BXOA 2I5LX 1PBNA 3DZGA 1E0JA 2D7JA 3HVIA 1R8QA 1WEHA 1VL0A 1WUJS 3I5MA 4AJ2A 1AW7A 1QV9A 2AEJA 3T1HB 3PWZA 1H0KA 3RBZA 4DG5A 4PLWA 4LOKA 1L1OC 4CMCA 3BWDD 3CTMA 5DBIA 3OMWA 1TS4A 1ZW6A 4C7VA 5KSOA 4RD0A 4K2AA 1MX3A 1VM6A 2J3LA 2XQKA 5DDIP 1GQFA 5EJ5A 4QUCA 1EY0A 4Z3OA 2FSVA 4FXKC 4NK4A 4ZT3A 5K8VA 1VCIA 3R6DA 2Z98A 2CHFA 1ZUHA 3GIDA 5JYBA 1N2ZA 2FUG6 3V6MA 2JA6G 1NQTA 2VHWA 1SAYA 3QMMA 4FDUA 2GERA 1FX0B 3Q3HA 4CQMD 2X0JA 4EB0A 5E4WC 2AQ3B 2O8CA 1EYGA 1ESNA 1Z08A 1TC2A 2A7XA 3QE2A 4FEYA 4FYYA 5JYEA 3Q7SA 3RNUA 1KH3A 5KTRA 1VQBA 5ADVA 2QGNA 3HADA 1SD2A 1VRVA 1X92A 2G1UA 2IZOA 3JWIA 5BUQA 3V1TC 1FTGA 3RI3A 3GG2A 1QCBD 1DPGA 4GIBA 1FL0A 1UBKS 4PANA 3WLHA 5BW5A 1K7SN 5C32A 3D3KA 4UP9A 3MIIA 4F12A 3HZOA 3IQDB 1KLGD 1SVLA 3AMVA 3UJDA 3QFRA 4YDSA 4X66Q 1K7XB 4C2MH 1PAUA 1XPJA 3DBVO 1HEYA 5HYVA 2XTMA 4JOSA 5HGXA 4H7IA 4Z4QA 1EG7A 1GILA 2Z8XA 4KE7A 1E5DA 5AOVA 1TT2A 3NBQA 4KXUA 5AVVA 3N0WA 5IE8A 3IR7A 1Q3HA 3IH5A 5MGNA 3MWDB 3K9LA 2A2ZA 4ZPJA 4OL9A 1CRWG 1KVTA 1PL7A 4MUJA 3QF4A 1DUVG 1PDOA 3L1JA 5JQGA 1NX6A 4RYLA 1QIGA 1HEUA 2B94A 2ZRDA 3RAPR 4DILA 3K6OA 3BFKA 3HJFA 3SC2A 4BNJA 4WCDA 3WNCA 5EOVA 1ZOPA 4O4IA 2Q2QA 5HNKA 2Q5HA 5T6BA 1XTSA 2J3QA 1KNQA 2YHSA 5EJFA 5HF9A 1G5QA 3W8EA 2HWXA 1R6DA 1J5XA 3F8TA 3D43A 4CG0A 4K03A 3CVJA 2OSBA 1O78A 1WXFA 3IILA 3RS0A 2FJUA 4UCWA 3FMIA 3OWXA 2XDQA 1AKTA 4MPTA 1PP4A 4YAOA 3ZWYA 1N34L 2NU7A 5T41A 3DEYX 3CUSA 4BQRA 2JE6I 1RMTA 5HWSA 2VW9A 2B1RA 1PCXA 4HEHA 3S1MB 4IIFA 4UVGA 2ZUFA 5CAEB 3FTNA 1IJEA 4BU1A 4LBVA 1SXTA 2KUMA 4FZRA 1FTQA 1KZ9A 1H4TA 2BAGA 3BJMA 2OP0A 3N8NA 3S16H 3DKRA 4PCUA 3U1VA 3ZCXA 1FJ2A 4EG6A 1A9PA 4G0YA 4EG8A 4K0KB 3UWPA 3Q5GA 3CMCO 5C3EB 3GGSA 4L5JA 5C37A 4DYDA 3EXEA 2D0DA 4AIMA 2D9UA 1REQB 3OPOA 1H2FA 2FG5A 2V5AA 3V4LA 2ZT6A 3DOCA 4LZPA 5EHGA 4B5KA 5CDYA 3HXPA 1QGOA 1ML4A 1GKKA 1C4WA 1ZI9A 3LYLA 5AMXA 3M4JA 2NVUB 4BLPA 5F3DA 4A3IH 3AGQA 3PX3A 3PQ6A 5BN5B 1LH0A 1SCBA 1SIWA 2HMYB 3LT2A 1QUQA 5DX1A 2GF9A 2P3SA 2GI4A 1FZQA 3DAYA 1IN7A 2YYZA 3NKVA 3FFWA 1BOFA 4K3UA 3LOQA 3NWOA 4Q9AA 1WTVA 2HF8A 3IMFA 5FUXA 1PR0A 4TWAA 4AWBA 1Q7TA 3LX4A 1U2GC 4ZU6X 1A8UA 5L3QA 1CULC 1J9EA 5CYFA 2DULA 2XTIA 5AKKA 1YR9A 3RQIA 5DN6D 4MTKA 2V65A 1DUSA 5AKIA 1T4GA 1MORA 3LBYA 4F9TA 1KVSA 2Z04A 3IUPA 2NQ2C 2B2YA 4X97A 3J7YW 3ZBTA 5IGGA 3I76A 5KKNB 4Q1BA 2HF7A 2NBFA 3UXHA 4ETMA 2CMKA 2O23A 3VMFA 4UEWA 4H7HA 3JWHA 5JCZA 5KYYB 1UP7A 2ZYHA 4HRVA 3A5ZB 4KN6A 3OIDA 3KLPX 3QWBA 5CMDA 2B2CA 1W4AA 3ZZUA 5I4CA 4CMHA 1PZFA 2ABWA 4MB0A 1N5OX 2L82A 1V6SA 1Y7LA 1V5EA 2IUFA 3FUXA 4M9UA 5K0BA 1CUBA 1LTKA 4D43A 1F5NA 1EUQA 5BYKA 1GQ2A 4MHTA 4Q1CA 1O6CA 3V1UA 2H7XA 5FBQB 4I36A 5H83A 5EIEA 1TYZA 4QEZA 1EESA 3MPOA 2PV0A 1F38A 5JS7A 1EUZA 3A4NA 3DNPA 5K0FA 2ZFUA 3EBLA 1R16A 3DVRX 4G26A 1NLZA 3W9BA 4FJ0A 3NDIA 1U5BA 3ZKWB 1V1PB 3N6VA 2NWGA 3VA5A 3EIQA 3SIWA 1BFUA 3JWEA 3TRKA 4ZVLA 1IBLQ 4DQLA 1R0KA 2IYWA 3H8SA 5FLXc 4PPYA 2DTDA 3SSAA 1U2TA 4BBRG 3L0BA 1ZUNA 4TZ6A 4LRSB 1NLYA 1JFFA 2FDXA 1KMNA 2HSEA 5M3BA 4A10A 4UPDA 5CG2A 1RQ2A 2EDAA 3MJVA 4KITB 1IRXA 2ZSDA 1GV0A 3BRQA 2HDWA 4X90A 5BOSB 3KTFA 2CNLA 1YVRA 4FYIA 2ODEA 2HRBA 3TEHB 1Q11A 2C2YA 2FPSA 3ETJA 2R66A 3GUUA 4HGNA 5E1MA 1YITA 1XJ5A 2CFMA 1S72A 2I4NA 3MTEA 4PAMA 4L0DA 3SR3A 1J6QA 4JKYA 4Q1DA 1SCUB 5G0VA 4J4TA 4ME3A 4PLZA 3UAOA 1M34A 1QPBA 4MWTA 5ALZA 3ZCRA 5FH9A 1WTQA 2H08A 2L15A 2YV5A 1SU6A 4G4SP 1QQ5A 4POAA 2F62A 4IUDS 3HK2A 2R93H 1Z2AA 3B3AA 4TSRA 1RBYA 2DWPA 2YS7A 3AXTA 3ESBA 3NONA 2AI3A 3W9UA 3GXOA 4X6YA 5GIPE 2NVQB 3M34A 5KNBA 2RJOA 1ODTC 3HOZH 3O90A 4CHGA 3PUKA 1JIIA 4RPGA 3SF8A 2ZIUB 3AR4A 1N7HA 3FSGD 3EIFA 1TEXA 2VQSA 1CIVA 3DFZA 4RF4A 4BMSA 3SHVA 4DJEC 1IPFA 5JC1A 2R97A 4OHRA 4UNRA 1G6OA 1V5IA 4WLEA 2RDGA 3L1HA 2GARA 2F0UA 4LF9L 1L5OA 5DX0A 4WKPA 2B20A 2ZU6A 3DKIA 2XNCA 1UFOA 3G8BA 4JI2L 4GKAA 2I33A 4UM8B 3SEQA 2J0TD 2R93G 2WJWA 2DCUA 1TNDA 4XOIA 4GN4B 2FW6A 4JPBW 1Y3DE 4CQLB 5B64A 3KJXA 1PK9A 3M33A 1P62B 4EQOA 2DE0X 3MJFA 5BOSA 3ZDBA 2XADA 3BB3A 4OMUA 1FDRA 3HB1A 3A9VA 1E1OA 2DAPA 3FAKA 4TT3D 4EYSA 1NI3A 2MR6A 4IJUA 5CV5A 1BH2A 1SCNE 4KJZA 5JVDA 2VT2A 4DCPA 5KHLB 4IX1A 2FMIA 4RPIA 5CLJA 2JAUA 3DDCA 4U8HA 4B7UA 5JDIC 4HHEA 1K98A 4IDOA 4ZT4A 2JZNA 2QPOA 1QK3A 3M4OH 1K9SA 2ZIZA 1MFPA 4M55A 4A82A 1BFDA 2NVOA 4HB2A 1OZ0A 3UQZA 2AK2A 5LOVF 2V4ZA 3K9HA 4CLRA 1IEXA 4MV1A 4DVGA 1PD1A 4L5CA 2QJOA 4Q4JB 4GF5A 4IAOA 2H52A 2J9FA 2EYPA 3GTLB 3Q88A 5EQ0A 2JGMA 2Q46A 3L46A 4ZAXA 3B3JA 3LX8A 1ONNA 5EWJA 3TX6A 3IAXA 2BE9A 4E5MA 2MUYA 4MUMA 3H9QA 1YVCA 1ONOA 1RQGA 1U98A 1WV0A 3P26A 4AQDA 1DXMA 3URYA 5CHYA 1O7YA 4ZUJA 2Q5IA 2QNRA 3B12A 4FFBA 5CITA 4IPHA 3BHMA 5FOWA 3STUA 2F0WA 5IFLA 1O03A 1DIRA 4H4DA 5C4GB 3FLEA 1G64A 2ZTLA 4KW7A 2WAAA 1G8ZD 3WFZA 4A2CA 3ZCQA 1SLJA 2ATWA 2RKSA 4DCMA 1A2QA 4NTZA 4D9JA 4CM7A 4CIAA 2CVHA 3LU1A 1T3HA 2LCIA 3L2OB 4P5DA 4RGBA 5AM0A 5E7JA 4MTNA 4IXNA 3D8RA 4N0PA 4UUQA 4TN5A 2WWYA 1SN7A 2CFTA 1QIHA 3KVRA 1IBMB 4KR6A 4LX8A 4GRDA 1B0UA 1OBOA 4RMJA 5H7XA 1Q22A 3UICA 2C84A 2RHLA 5KNCA 3K31A 4FMBB 3ZDYB 2GN9A 1BS9A 3AHFA 3LKZA 1D1KA 1U4SA 3KZOA 2ECFA 4FP5D 1HR0Q 1XEAA 2F0PA 4M4SA 4RH1A 1DJRD 1F4LA 2RHOA 4KODA 3NATA 2YU9H 4WCFA 1XZPA 2QL5A 1KR2A 1UC8A 4BFTA 3I30X 4BWYA 1JP7A 2WKRA 3HHEA 4H7BA 3FTCA 1QBGA 2YVAA 1MPTA 3GUYA 3OBBA 3BM5A 3O2SB 4TMYA 4RK4A 2OQVA 2XCRB 2PKWA 4CF3A 3WGJA 2CVOA 3E9NA 3IKVA 4F7XA 5K6AC 4JOIA 4DNOA 1KQPA 4HR7B 3EGDA 1UBLS 4OB6A 3CC4A 4OXKA 4OB7A 3OOCA 1OLUB 4K5WA 4ZO9A 4R1NA 4HFMA 2C92A 2X23A 1GITA 3ZHCA 1G2PA 3PQIA 1C7FA 3KYCB 5CP8A 2ES2A 5C3MA 4P08A 1DKRA 2ENBA 1P7CA 4KO1S 4LTNA 4AO8A 3PNOA 1FOEB 3N2IA 1CY1A 3FTPA 4DMFA 4YCWA 5J5AA 5AXCA 4MJLA 2FMTA 1N3LA 3PKJA 2E3JA 3ZQJA 3GNSA 2B2UC 1UBUS 4PX2A 3OURA 4ZV7A 1FSZA 1JNYA 1YRYE 2CHBD 2ERXA 1KABA 1ZMOA 5TMEA 5FLXA 1PVVA 1ILWA 1GNTA 1KDRA 1QHHB 3AF1A 1RIIA 5LJIA 1YZNA 4Z9AA 3EIEA 2XI4A 2C78A 1R0RE 3M81A 1R4NA 2NT4A 1H69A 3E3AA 3SLGA 3IALA 2Q9AA 2DR2A 1P16A 4ASUA 1X2EA 2W2VA 4ENRA 2V3WA 5J39A 1ISHA 1ZCBA 2XWJI 5ES3A 4Y9DA 4BFXA 1P39A 3FKIH 3O4HA 1SNDA 3A4IA 3H1BA 4TLLB 4N0DA 2EAUA 3L8FA 1AHIA 4GXTA 4HN2A 3HDYA 1J97A 5KJ6A 3L18A 1F60A 4IMIB 4XQ9A 1ZONA 1QGED 3C45A 3QBDA 3ILYA 1XIVA 2KYRA 3OQJA 4BLRA 3DOJA 1U2DA 1MCZA 1M72A 1R00A 4K6DA 2D7CA 2DQYA 2FTKE 2WV7A 2ZITA 3G5LA 3R24A 4I9NA 4MB6A 4R6XA 1BDMA 5A4IS 2SKDA 4TRMA 2W2KA 1DQRA 4KXYA 4YUZA 3W90A 1GO3E 3TCKA 4NMWA 2X0DA 2YMMA 4H3VA 4DN6A 5ILOA 1EY9A 4OU5A 5LP1A 3VZSA 3U44B 3AIKA 4QFBA 2PGOA 1IZZA 3WB2A 2EFJA 2B3GA 1KDPA 1HXHA 2AD5A 3AF5A 3ASYA 3B1YA 4L27A 3S0JA 4N3GA 1VJGA 4YCDA 4AJIA 1A8HA 2WLSA 4DPGA 4ZO6A 5K3AA 1NW7A 2CLDX 4PC7A 3FYUB 3IA2A 4A3EH 3IEXA 3IXLA 5DWQA 3WL4A 3ZCSA 4KN7C 2CE7A 2M32A 3SOPA 2DKFA 4NAHA 4TUYB 1BXTA 3D0OA 1T8PA 1FGBD 1FJHA 3G2QA 2IX3A 3LP6A 1HYHA 2FKAA 3Q7QA 2JJMA 2XWSA 3NBFA 3DV2A 4WKCA 3PO2H 1BX1A 3QOXA 1W0KA 1WMSA 2J48A 3GROA 3P97A 4IKEA 3FH0A 4G97A 1JQAA 3R8CA 1IZ0A 4LAFA 3FMCA 5KNLA 1JAYA 5A6SA 4ZC1A 2WU4A 4FTWA 3ROKA 4DMKA 2JLYA 5SV2A 3F6BX 1EP1B 3Q3VA 2B7LA 3ZY5A 3ZBPA 4E2FA 4DHWA 1QE5A 1M0SA 4G07A 4X3OA 3Q22A 4WA7A 4YA6A 2YKGA 1KAQA 5KNCH 3KQOA 3MYYA 4ZEXA 1JSRA 5EHIA 4E5YA 1ARZA 4G37A 1B2LA 1DDIA 3EEQA 3IJPA 3RUAA 5BV8A 1DEAA 4HH3C 4LZJA 2F0FA 2I2DA 1OX4B 2HYIC 4MIEA 3FTEA 1V16A 2HJRA 4EBBA 3QKSA 2RHSB 1Z8DA 1PJBA 2E1RA 2R6FA 3MLAA 2JD1A 2DYKA 3VTFA 1CEYA 2QRMA 2PNFA 2K33A 3KQHA 3ACDA 4ODIA 1U7HA 1N6PA 2IOQA 2NNLD 3EODA 2DH6A 2FX5A 3VKUA 1KJWA 1IE3A 3PJGA 4LNAA 3NEPX 3FPPA 1M1NB 2HPAA 2NVWA 3LHKA 5FO1A 4EKDA 1VSUA 4OLJA 3ZVKA 1ORWA 2ASBA 4IIYA 2J4XA 4QDTA 5LP6A 3I09A 4Z4HA 4DXGA 4NJMB 4M9SA 4JOIC 2BM9A 2I7XA 5A2QL 1WM1A 4QIWB 2XRFA 2P9QA 3RRJA 4IF4A 4F93B 1V5FA 2GPJA 1WHSB 1SUCA 4V1CB 5JD5A 3R0QA 2I2CA 2P8JA 3HYCA 4EYQA 4CNQA 1X1BA 4IV5A 2I4OA 4IDGA 4FWIB 4JSYA 1CRLA 4ER3A 4PYNA 1KC8C 4G41A 5JCOA 4Y52H 2OBYA 2ZQ5A 3H0CA 1RAFA 2RGWA 1XK7A 2R62A 1BVHA 4GPZA 4GS3A 3OX1A 3C1TA 3KQNA 1WKVA 3DM1A 2OZLA 4M8KA 1UKZA 2C9DA 3AB8A 3B6KA 1JPJA 3EOBI 1A2UA 4B6OA 1LBHA 3RLFA 4Q7KA 3GLIE 1QRSA 5D51S 1V1QA 2F0SA 1ZGAA 4B35A 3D6HA 4XYBA 3RUIA 2BFBB 3EWNA 3IRVA 4S1PA 4R7GA 2NYVA 2BHLA 3TB4A 1I9CA 4I9FA 4YJKA 4DKJA 2IWHA 1X74A 1DBIA 1FXUA 3CLRD 3JY6A 3C5VA 3ICOA 1CY2A 3PHBE 3QW2A 4DV6L 3R5HA 1K92A 4URUR 1MRNA 1UQRA 5IC5A 4EW6A 3FRIA 1JHUA 4TVSA 2QX4A 2B25A 1A27A 1M0WA 1R3DA 4I50A 1K1EA 1O57A 2AFRA 3L0CA 3T3EA 4F5WA 5IWCA 3HCRA 2OCAA 4DOMA 3IT3A 3K20A 1L7RA 1RI1A 2XGOA 2HBQA 1Z17A 2PH3A 2XLBA 4R8IA 1S8OA 1YNND 1I50B 1L7VC 2RGNA 3AIMA 3EFXD 4FFNA 4F3CA 1C1XB 4E4YA 5HILA 1C7QA 4MW6A 1X87A 3H6HA 3VGPA 1T8SA 3N58A 2JG3A 3DVAB 1V4BA 1OC2A 3IVRA 4EAAA 4Z1OA 1MAVA 2VDUE 3ELBA 3I2YX 3KXLA 1YS1X 1JAIA 3QJYA 4LG1A 1RWKA 4IIUA 1EFRA 2GBFA 2VDQB 3VTKA 1NSTA 4MI6A 3NE5B 2OHOA 2Z1CA 3RZOB 3Q12A 1UM8A 1Q3KA 2ZIVB 1P31A 3EVCA 4Y8VA 2K6AA 1ADFA 2BDNA 2P3QA 2F0MA 3D64A 1E3QA 3SHFA 3AKZA 2VJAA 1KOFA 4B5LA 4DAPA 3IT1A 3V5NA 5CB8A 4J9VA 2AR9A 2OHIA 3PLRA 5DM0A 4ZRMA 1VLMA 3W2IA 5LJLA 3KTOA 3CKIB 1LU9A 2AD1A 4A3BG 1TZMA 1HLPA 3T5CA 1J22A 1MN6A 1XFDA 4ZVUA 4JLDA 1CETA 1O58A 2ERCA 2YNMA 4NXML 4GNXA 5ANRB 2IZ7A 2Q0QA 2EJTA 4KSYA 1RWXA 3H3VH 1XLWA 4TSKA 4ZU1X 3TI7A 5JSZA 2CKZB 3KOJA 4YT5A 5TMPA 4BMOB 2QR3A 2IH5A 7REQB 3LD9A 4BTEA 3A8JE 3TNJA 5E4TA 2BN4A 2HA5A 2GESA 5FHRA 2VQEB 3PIP3 3P9IA 1I33A 2M2IA 1QGUB 2YXEA 3FOBA <