1OXUA

Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
353
structure length
353
Chain Sequence
b'MVRIIVKNVSKVFKKGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDDRLVASNGKLIVPPEDRKIGMVFQTWALYPNLTAFENIAFPLTNMKMSKEEIRKRVEEVAKILDIHHVLNHFPRELSGGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARALVKEVQSRLGVTLLVVSHDPADIFAIADRVGVLVKGKLVQVGKPEDLYDNPVSIQVASLIGEINELEGKVTNEGVVIGSLRFPVSVSSDRAIIGIRPEDVKLSKDVIKDDSWILVGKGKVKVIGYQGGLFRITITPLDSEEEIFTYSDHPIHSGEEVLVYVRKDKIKVFEKN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ABC transporter, ATP binding protein
publication title Crystal structures of the ATPase subunit of the glucose ABC transporter from Sulfolobus solfataricus: nucleotide-free and nucleotide-bound conformations
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transport protein
total genus 103
structure length 353
sequence length 353
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2003-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17847 GlcV_C_terminal Glucose ABC transporter C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1oxuA03
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1oxuA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1oxuA01
4JOIA 1UF9A 1BMFD 3RS5A 1YR7A 1E24A 2PZGA 3B7GA 1XMQL 3WHLA 3T1YL 3EIHA 1SKYB 2GETA 1XJCA 1HNWL 2OO7A 3GLHB 4YCWA 621PA 2YYZA 1E1QD 4V0OA 1ZYUA 3K53A 4OYHA 5L3SB 4PQYA 1KI7A 3DPUA 1S9DA 2WVJA 4JI1L 3HR8A 2WSMA 3HPRA 2P3SA 2G3YA 4YHHL 3CX6A 4EAQA 3UE1A 2Z5FA 4MKFA 3W6OA 4BUJA 2D7DA 2J9RA 3AB3A 3VHXA 3U60B 3CRLC 4J15A 4YWMA 3I8XA 1E4VA 3OOCA 1NMFA 2FSGA 2RGBA 3AF1A 4QOSA 5HZKA 3VNUA 4HLUA 2GN5A 1GUAA 3K81C 2BJVA 1NJGA 3L8ZA 4A3FG 3QKTA 3GJ8A 2RKOA 4A3DH 3K0FA 4ZCMA 1VQ6A 3HR7A 4C0HA 3GDEA 4XWAA 2NO1A 4ZIRB 5F9FA 2Q3MA 2ATVA 4DK6C 2GK7A 2PQAB 2CKZB 4DLZA 1S4QA 2LMCB 4IJHA 3PO2G 2OM2A 2ANBA 3FTQA 2MO0A 1N6OA 1E2FA 2FSIA 1FL0A 2H17A 4IXNA 4LCBA 5FBLB 3L0OA 4TLBA 1W0KD 2BOVA 3NE5B 1H9JA 5BN4A 1CS4C 1U8AA 1Q44A 2B7CA 2PT5A 1QZHA 2ZRPA 4MKHA 3UDGA 2WB1G 4UP8A 3L0SA 2PNRC 2GEVA 4B43A 5KPJA 721PA 2JLYA 4ACBA 5IK2A 4BFZA 2BA0A 2QM8A 2WWHA 3VR2A 5AUNB 4B2LA 3DDCA 4AYBG 4PPGA 2ZSDA 2J0VA 2QSZA 5LMNL 3EC1A 2QG6A 1G8YA 2A69D 2CBZA 3K70D 4C4PA 3GTLH 5AJ3Q 4JMPA 1NLYA 2FNAA 3BH6A 4GN5A 1PYSB 1PLKA 1JR3A 2YVUA 5JJKA 1CKNA 3BG3A 3LD9A 3LVQE 5C4XH 3U4QB 1TWCH 1XDBA 1XMVA 3PIPA 2HT6A 2GZAA 4ZV4A 2OCEA 3DL0A 1OKKD 3A5ZB 4II7A 2W6JD 3HOXH 1PZNA 2DY1A 1ZD9A 4XJXA 2FFAA 5IF9A 3TR5A 4BZQA 4GOJA 1IL2A 4IDQA 3T61A 4TMKA 2GJSA 3A36A 5LDDC 1YQTA 2Z0MA 3PCRB 1GHKA 4XTRA 1QG2A 1KK1A 2K52A 3KB1A 1ESMA 3TH5A 4ZKEA 3LXRA 4JLOA 3BU2A 5C4GB 3VHLB 2ZUDA 4KJZA 3U7GA 1G64A 5JMTA 2O8CA 1N6PA 1K73C 1Q12A 4LV5B 4TYPA 3DMDA 4PC3A 4B3SL 3A37A 2OFOA 4MQBA 1E2GA 3B8HA 3D8BA 1G291 4QL3A 4PSVA 1IBKL 1RJ9A 1EFHA 4TMVA 3TEHB 2E9SA 5J5CA 3F2CA 2YTXA 3I3SR 4JCVE 2BV3A 3LBHA 5J4HA 3PF4A 4JI3Q 4C7OB 3IEUA 3T5GA 4Q48A 5CB8A 3KKNA 2ZRDA 4LFBL 1KDTA 1U0JA 1Z0KA 1EFUA 1Z0DA 2R6GA 4DR2Q 1M6NA 1KIXA 1W0JA 2JCSA 2RGNC 4LC0A 4B34A 3SEAA 1Q46A 4BY1G 3ADCA 3A8JE 2MQHA 3GFPA 1JR6A 3ECCA 5K36H 1G5TA 4PPQA 4Y0VA 5JWHA 4B3MQ 5KDLA 1KK0A 2VQSA 2RAPA 4TLDA 3CMEA 4B3RL 4DDTA 3CNLA 5SZJA 5BYKA 3S17H 1CLUA 4WZAE 3THXA 4JVNA 4WJ3M 1ZU4A 4BLPA 2WWGA 2BEKA 5GAEC 2XB4A 3W5OA 3G0HA 2VZAA 3AH8A 4CEHB 3SYLA 3BJIC 4LV8B 3SHFA 1F48A 4PO1A 4BFWA 1W4CA 1KC8C 2JA9A 1P61B 5KO2A 4HR7B 2PBRA 1C0AA 1XJVA 3RLNA 2QAJA 1HZBA 4URUR 4OO1I 1CJVC 1NG9A 3IQWA 4Q1EA 2W58A 1PHJA 5HGQA 1HT1E 1XEWX 2GRJA 3DO6A 1XNQL 3GEEA 4LBYA 4ARZA 4NB3A 4OQFA 1QDEA 4A2QA 2WWIA 3K9GA 3KDSE 3AVPA 2UZ3A 3AGQA 4RCZA 4FCTA 2QRZA 2KCTA 3EPHA 2XGJA 1ZUIA 3AVUA 2H8KA 3OAAA 2HQLA 1K0RA 1J7KA 3SFVA 3N6RA 2FG5A 1MABB 4OX9Q 4OQXA 4WOPA 4Q03A 4M1SA 1V8QA 2OTJA 1QZXA 4M1YA 2QTFA 3CONA 1IYJB 3I4MG 3ZQ6A 1AGPA 4AK9A 1CEEA 5C0XJ 3GLIE 1G19A 1IYVA 3JC66 1KD1C 1GSIA 4LW1A 1RVDA 3SQXA 3QF7A 4MA4A 4DT1A 1U90A 3OESA 2BM0A 4PQFA 1AZTA 2ZI5A 2C04A 1UEJA 3CNNA 3R8FA 4DXAA 2F43A 3OHMA 2EQSA 4LDJA 3SYKA 3TIFA 3HKZE 4ERNA 5F98A 5FJ8G 4O2LA 2XEXA 3DZDA 4P4TA 1XTDA 3UDXA 1VECA 1KI6B 4RD0A 1DAKA 5EXTA 4YMUA 3U3OA 1VQPA 4P71A 1RYHA 2C9OA 2VL7A 3AF0A 4E03A 3T51B 1OT3A 1KHTA 1JI0A 2QTHA 4A3IG 1EFRD 1W46A 1PMRA 1EIFA 1FL9A 1FQJA 2V6IA 2XITA 4KBFA 5FPHA 5ANRB 2FPKA 1XXHA 4QBGB 3UDIA 5CM9C 2O5JC 4LYHA 2DHRA 4GNXB 3DM9B 1O78A 3U61B 3T1HQ 1BIFA 4POFA 3G71A 3K7UC 2GAOA 1M74A 3WHKA 2IYRA 1WOCA 1SLJA 4A3GG 2K7VA 2FOLA 4BWYA 1P2SA 1YZTA 2F52A 4JI2Q 3SC3A 2NO6A 5EE1A 2JQOA 1XTJA 3DOFA 1QHHA 4MUBA 4WJ4A 3ULPA 2IK8A 5JHHB 3UWOA 1V9PA 2QRNA 4FMBB 3UWKA 4GN4B 2QUZA 3EIQA 3VKWA 3DMNA 4DR5Q 4B35A 5JSZA 2ZRCA 3CZQA 1HNXL 2UXCL 1NP6A 1YE8A 4QC2A 3THWB 2OEPA 4JYCA 4MKIA 1NLFA 1N34Q 4Q4JB 4DV1Q 2VA8A 4NXNQ 1BO6A 3A1SA 3WMGA 1FJGL 2B7BA 1TXYA 4JZKA 1LUZA 4FCVA 1QG4A 1E2LA 3LQQA 1R5OA 2A6HD 3KYHC 4IJMA 1VQHA 4KHPQ 4JLAA 5IT5A 1VMAA 2I5LX 1FTSA 1A4RA 5ELOA 4DBLC 1ONLA 4BA2I 2A69C 4GBMA 4A3BG 4LI0A 3K70C 3G4SA 1AJEA 2MSCB 3OW2A 3W1GA 1YIJA 1KO1A 2R92H 1CRQA 1YVCA 2NVTH 1E9CA 2ATXA 2VP4A 3SNHA 1PH7A 1II8A 1JBKA 1KZGB 4IDNA 4KKUA 1CBUA 2UXBL 1E96A 1E98A 1TEVA 3UANA 1CKMA 2NPFA 1RIPA 3HP1A 2JLWA 3NIBA 1ELOA 2CLSA 4XSGA 1OHHA 3KFUA 3R7WB 3C14C 1E79A 4MNOA 2OAQ1 4GI7A 4PAQA 1SVKA 1LB1B 1CR0A 4JI5L 4TL6A 4GP6A 4I1VA 1FMJA 3ZZTA 1NKSA 2QM7A 2AKWB 1RRPA 4BFUA 4IOAA 1DAGA 1SVIA 2O5IC 3TW8B 2UXDQ 4KXFB 3QVVA 4ACAA 1ASZA 2CJWA 3ZLJA 2R9VA 3EA0A 3WP1B 5L3QA 3ZJYA 1A63A 1UKYA 4RD1A 1KK3A 1X3GA 1YHNA 2JGNA 4RCYA 5GJBA 1XP8A 4H0LC 1WYDA 2ZQ5A 5H68A 2WKQA 1G4AE 4L9SA 4DV6L 2IYWA 4MRVA 1TUIA 1TTTA 4I1SA 1P2TA 1Q1BA 1MJCA 4MGKR 4DV7L 2NQ2C 3S1MH 2VL6A 3H15A 2RGGA 4FIDA 4IPDA 2VHQA 4Q9KA 3FP9A 1KRTA 2EFHB 3A1VA 2WAQE 4D4LA 2PH1A 3IDQA 4EPXA 4A0RA 1UKVY 4HI0E 2EYUA 4BLQA 2L5TA 4QGAA 3CRW1 5LMUL 3KJPA 1MH1A 1Z29A 2KCMA 4AQYQ 5EZ5A 3PXGA 1F2TA 4CIDA 3GMTA 3P4XA 1QVGA 1EQQA 4OQLA 1R0ZA 4RD6A 3X1WA 1R5BA 1KMQA 1XMQQ 1O87A 1L7VC 2ZM6Q 2DN8A 1HNWQ 1AQYA 2WWWA 3B6YA 1ZIOA 3AM1A 2J0UB 1HURA 2CNWD 4GRAA 3AUYA 2I3BA 4IFDI 1Q57A 4EFLA 4BGDA 2Z6VA 3CCSA 4JI1Q 4M1OA 3BFVA 1VF7A 4RG1A 1N32Q 1U94A 1LF0A 3PEVA 1VPLA 3VU9A 3RWMB 3NH6A 2FMXA 2ZSEA 2MMCA 2HJGA 4KYUA 4TL9A 3U6BA 2W2TA 4UP7A 3RLOA 4QGUA 1G5PA 3M6AA 5FUYA 2OG2A 3K70B 3RC8A 2ZJQA 1NBME 3M0EA 2GZHA 3DM5A 2ZVQX 4ZDKA 2GCOA 2GA8A 3PUXA 3AVQA 1EWHA 1GD7A 3TAUA 3PF5A 4OJKA 1TAGA 4Q5IA 3I4OA 1L1OC 1ZD8A 1O3YA 1XD8A 5DN6A 2WKPA 1S96A 3TUJC 1VQIA 2H16A 1J6QA 1SKYE 3GLHE 4LOAA 2V1CC 5C3EH 3QKSB 4Q9LA 2IHEA 1E7ZA 1P62B 1VG9B 1R0XA 2IW3A 5D3MA 1P2UA 3ZS9A 1VQJA 2K33A 2J46A 3B1ZA 3CO5A 3HFZB 4QGFA 1I4TD 4EQ6B 1V43A 4Q7JB 2ZAOA 4KI0A 5HY6A 1FQKA 2N78A 2QMHA 2LCFA 2ZJ2A 1TWHH 2EU8A 3QNUA 3SR0A 4A3KH 2W6IA 4XIGS 1WRBA 3B82A 2HIXA 3G82C 4RVCA 2VEDA 2VSXA 5UKDA 821PA 2OILA 4R98A 3NG1A 4I7ZC 5FOSA 1BS1A 5FLXc 1NBMD 2WWYA 1Z83A 2J1LA 5IP9G 1BOFA 1E6CA 1G8FA 2ATWA 1U81A 2JLRA 2JEOA 2P5SA 2AL7A 5IYCG 3FKIG 2V1XA 4Q4HA 4LUCA 1WQ1R 3AGPA 4JLKA 4N0EA 3NXSA 3SHWA 4R9UC 4KN4C 5DISB 5K8UA 3BERA 1Y8OB 1IY1A 3OEHD 3K9HA 3NENA 2FSFA 1TQDA 1IHUA 4P33A 4TQ9A 5JJLA 1LABA 2Z43A 3BFKA 2GXAA 4URZR 4LHWA 3CMAA 1ZNZA 4HB0A 4JJZA 1Q3HA 2IYZA 4GLAC 4PSAA 4EPYA 1G4UR 3MXNB 1G1MA 3OF5A 1MO5A 1P75A 2EVWX 1VQ4A 1LVGA 4R4QA 2IYYA 2KI5A 5JWRA 4OI1A 1G8PA 2OWOA 5JEAG 2ZRJA 1PUIA 1YRBA 1GVPA 2CK3D 2PX3A 4JKYA 2XXAA 1N0WA 4NYIQ 4XD7D 2YKGA 3UK6A 5C46F 3LDAA 3U50C 4A3JH 1G7CA 4L5SA 5TARA 3CRRA 4K46A 3LNCA 1AS2A 1JJGA 2PT7A 3ZVLA 5CITA 1IBKQ 4GZYC 2EFCB 2C95A 4Q21A 4NONA 3LXXA 4M1KA 1Y8PB 2K4KA 2UU9L 3C41J 5HPYB 5J47A 3NBZC 4CEIA 1EK0A 3VKGA 2CW0C 4R4IA 1G6PA 1XMJA 3ASYA 3KX2A 1GJXA 3TQFA 4LFBQ 2JJ2D 4D4KA 4LJ8A 3KOJA 4C3JH 1KI1A 1EWRA 1L1OB 4KCGA 5GJCA 3RRZA 4IPCA 1XTRA 1A62A 1W2GA 3VX3A 4ASUA 1FFHA 3EN2A 2NVYH 3TREA 2V4ZA 3C7KA 2A6HC 4JKIA 5EQTA 2C9YA 4YDSA 2DYKA 5IHPA 4AY2A 5AJWA 4B3RQ 1DARA 5AUQA 3GJ7A 3CCRA 2O8BB 2K5UA 1TQ4A 5IYDG 2NG1A 1QHSA 2OCPA 4NCHA 3V00A 4BY7H 4BASA 4KO8A 1NTGA 5DYIA 2UZIR 4LBVA 1I94L 2ASBA 1S9HA 2QGNA 5FTNA 3VTKA 1Z63A 1KO7A 1YHBA 1VQ7A 1M1KC 1K8RA 1KMHA 1VIYA 1FUUA 3KJOA 3OEEA 4UXJA 4LHYA 1DAMA 1W36D 4JI3L 1NY6A 2ZT9C 3KF6B 1E2HA 2ZRGA 3AVTA 3AP2A 3TR0A 3P32A 2D2FA 4JI6Q 1PFSA 3KKQA 2D2EA 2J7PD 1QJOA 4X8OA 5KTYA 3GLIB 1NJFA 1XNQQ 2GXSA 5B58C 4V0LA 2WV9A 2IXEA 2FJUA 1EGAA 3J80c 2VYFA 4B3ML 3MWYW 1IZ6A 1Q1ZA 4IVQA 4Q7MB 3LVRE 4D6PA 3C5HA 5DSZA 3U3KA 4AI6A 4R4OA 3QKUA 1GNRA 3AKYA 5SZKB 4TT3A 2CCZA 3VAAA 1XMOL 2ZREA 5JCZA 4MGYR 3K8AA 1M2OB 1N6LA 1YJ5A 1MO4A 1XJ0A 2R6DA 2X2FA 4PQRA 5TY0A 3S1AB 4G0NA 2MSDB 4UXIA 4B3CA 2HLDD 3FPAA 4MZ9A 5BW8A 1Z6AA 4UXHA 2BWJA 1O7IA 1I2DA 4OKSA 1IAQA 4YXWD 2BE5D 2I1QA 1X8JA 5DO9A 5JZVA 4HATA 5M3MH 1NN1A 1OIXA 4C3IH 1P9WA 3EWSA 3UIEA 4DNTB 2O8DB 2VQFL 3NDBB 1HR0Q 4LUOA 2G77B 3F3YA 2BKEA 2IL1A 3W8NA 1ZRHA 2ZM5A 4CVNA 2YWHA 1CU1A 3FWYA 2NVXH 3DOEA 1U9IC 3A8IE 1NNEA 1XTIA 3AEVA 2BDTA 2PZFA 2ZETA 1EUJA 2FEMA 4OX9L 4RSGA 1D8LA 1YEZA 2QGQA 2ECKA 5JEDA 1L8QA 1PUJA 4LGMA 3J81k 2VY3A 1ZM9A 2QTVB 3QI2A 4BEJA 4A0FA 1GL6A 1Q22A 1ZKOA 4PZ7A 4EJSA 5KOYA 1BH2A 3HOYH 2I4IA 4QM7A 4JT2A 1NF3A 1YI2A 4NKRA 3KUDA 1SMXA 2GJ8A 3X2SA 4A3MG 1P6XA 3A74A 3T53B 1E1RA 2QGZA 5GADl 4DSNA 2V7QD 3KTAA 3OW7A 4IQZA 3K09C 1K3RA 3CWQA 1UE6A 4Q1AA 4ME3A 1MKYA 1N36L 2J7KA 3T1OA 3RWOA 2C78A 2XJ9A 2XOKA 5JLJA 2VP2A 1BMFA 2RGCA 3CF5A 1HR0W 4EUNA 2XZOA 1B0UA 4A8JC 1YZUA 4DV5L 3D4RA 1HNXQ 2GWHA 1MRSA 4TZ0A 4UPAA 2JA7H 1ZVQA 4DLYA 4HAWA 1OH8A 2OAP1 2RCNA 1B70B 4MITA 3W6PA 1G41A 1DAHA 2ZYTX 3OZXA 1W48A 3UATA 4DCSA 1E2ZA 1FJGQ 4RFSA 5FUVA 2IS2A 3WMEA 5JHGB 2NIPA 3MJHA 4NYMQ 1U0HC 3CF6R 5CLQA 2GJ9A 1ONBA 5FLMH 1EFCA 2XTMA 2IC5A 4IOJA 1QUQB 3P4YA 3SN6A 2MFIA 4NTZA 2PX0A 1ZCAA 1VQ5A 3A7AB 3HOZH 1KOFA 4LF8L 1YHQA 4G5GA 2D0OA 1JAHA 2F7SA 3SBDA 4ARZB 4V0ME 4G5SA 2JE6I 4DR5L 3CRMA 3EXAA 3FVQA 1NI3A 3HOWH 2DNEA 5E7NA 1XZPA 2Z6KA 1Z2AA 2A5JA 1XJQA 3KKMA 2E2IH 3N2IA 1KK2A 4YLGA 5C0XI 4AIIA 3VR4A 4URYR 4CT4B 4IDHA 1S3OA 5DI9A 3BGWA 1SQ5A 4Q1BA 4JVMA 3VQTA 1U0LA 1KRSA 4B3BA 2AFHE 4DLXA 1G17A 1SKQA 4HJ9A 4JI5Q 4G7HC 2BH2A 2YOFA 2ALYB 4URVR 1EYGA 2R93H 1FGUA 4ALPA 3EX7C 2XTIA 4KHPL 4R2IA 5GVSA 4TYQA 5JI2E 2XZPA 2H5XA 3IUYA 1NY4A 4DKAC 4RCNA 3L82B 5L8VA 1C9KA 1ZM4A 4D82A 2BMEA 2PMKA 3IPXA 1P9NA 1SVOA 3A5UA 1T5IA 1ETUA 5CYOA 4DV6Q 4DUGD 1I50H 3M4PA 3PO3G 4PZYA 4RKEA 5JBQA 3M7NA 3JVUA 2VP0A 2BCJQ 4PAMA 5EXXA 3K0AB 5GVRA 3U7HB 5KNCA 2EDGA 2Q9BA 4NDZA 1NBWA 4L15A 3W5JA 1VF5C 4FWTA 4GL2A 4GKJQ 3TSOA 1L4YA 2KWIA 2DR3A 1DPFA 2A2ZA 2REOA 1L2TA 3LY5A 4H13C 3Q5EA 5CIWA 1A1VA 4AKHA 5FPKA 4B74A 2B63G 1N33L 2HXYA 4NCKA 1VYUA 1I6VC 4UNRA 5LMUQ 5BN3A 1E94E 1ODFA 1H9MA 4E09A 2WSSD 1SVWA 2WMNB 3EZ2A 3K0CC 3UMSA 4AURA 2BM1A 4A8JB 1XXHB 2K14A 5CJPA 2OZEA 2G83A 5DLQE 1KAOA 2FPMA 3QXSA 4JLMA 1RPZA 1B7YB 2IX3A 1IXRC 2PEZA 2VHCA 4WA7A 2O8EA 1ZM3A 4K0KL 5EE5B 3T1QA 3K0EA 4NMMA 1AM4D 4LPKA 1WFQA 1N25A 3CPJB 2IYTA 1W36C 4C2TA 1IONA 4JYAL 1VQ9A 3CCLA 1OXSC 1UBEA 1X86B 3T56B 5C0XG 3R9XA 1RRFA 4FMCF 1K8MA 5AJXA 4ZI3A 2YV5A 4DUZL 1NMXA 2JXMB 1WJJA 3MLEA 4MYTA 2I0QA 3E5HA 4OWWB 2QNRA 1FX0B 3OIYA 1N6NA 1NN5A 1WCMH 4LHXA 1CR1A 3ADKA 3J81i 2GTPA 4B32A 3K80C 1AN0A 2AHOA 3OFND 2ZM6L 1SHKA 4HLQB 4PV1C 1GTVA 2NOAA 2GBLA 2FH5B 1D7QA 1N32L 3KJIA 1NMYA 4I4LA 3T5DA 2ZTDA 1ZINA 4RD4A 2ERXA 1KSGA 1Y3AA 3QENA 2A68D 4OHWA 4RZUA 1Z6XA 2A1AA 4D0NA 4LNQA 2GJKA 1K83H 1Y63A 1E2NA 1SVLA 3VR1A 1UAAA 4AIMA 5EP2A 3WRYC 2BE5C 2K5NA 1II8B 1QVAA 1SVSA 3BS4A 6Q21A 5AJZA 4DLUA 3QG5A 5FOTA 3QBVA 4EFNA 4BZPA 2JLSA 2W2VA 3PUWA 1VIAA 2VPPA 2BMFA 1B8AA 5F3WB 4X8MA 3NBFA 1CJTC 2GEUA 2R7ZG 4EPRA 2NN6H 1HZ9A 3J7ZC 4ZCLA 2WPDA 2EJGC 1HTPA 1LTLA 2QT0A 1Z6GA 2Z4SA 2XJ4A 1VQBA 4JLNA 1CKOA 5AWFC 2J0SA 2OSBA 1OFTA 1GFIA 1GVNB 4US0R 1O7LA 1ZUHA 3RRYA 4O0AA 4M1TA 2NVQH 5FL7D 1GUOA 1NKTA 2CJWB 5GROA 5IY0A 2XTZA 1Z2CA 4BBRH 3BB1A 4LJ9A 4X64L 3B85A 1GHJA 5M5YH 1XD2A 3LWUA 3AEZA 2JA6G 4JLVA 4LWCA 2KHIA 1OW3B 4UY8C 2XNSA 3A58B 4MH0R 4PC7A 2ERYA 1QHNA 4JI4L 1NRJB 3K8YA 3T12A 3SJZA 4AYWA 4D80A 1F2UB 4DUYQ 1FZQA 2NO9A 2OLJA 3ADBA 2A7QA 2UUBQ 4B3TQ 2I5MX 3UMFA 1R8QA 4S35A 1IY2A 2IS6A 4BLRA 2DNCA 2AR7A 4D25A 2ZI4A 4BPBA 1W36B 1HQYE 3GJ0A 2KBEA 3WNCA 3TVTA 3TE6A 5C44H 2J59A 3RAPR 3WNDA 3FKSA 2IWRA 3RRMA 5FBVB 2UU9Q 1GRQA 2NPIA 1D2NA 1RE0A 4PX9A 4RD3A 1FTNA 3K9NA 4JBYA 1Z3IX 4OO1H 1KI2A 2ONKA 3KQLA 3ZD6A 1EFRA 2R8RA 4Z1MA 1GM5A 1V1QA 4IDOA 4JBXA 2CL7X 3GLGB 3MRSA 2L0XA 4HZUA 3JAMc 2OXCA 3GD7A 2EFGA 3I56A 4Q9IA 1FNMA 1XNJA 1X56A 3LX8A 4P4SA 3GLFB 3I8SA 3VR5A 5TB5A 3VU9B 3HOVG 1CJKC 1C4OA 1ZM7A 1OFHA 2FGKA 5IP7H 3A1TA 4A0GA 5CDFE 5EP1A 3MWKA 3U7EB 4QJFA 2YWEA 2LKDA 3TK1A 4DV3Q 4A3EH 3CD6A 1I94Q 4OONA 4CT5A 1NSFA 4H1UA 3B9QA 3R20A 4GOKA 4JBJA 4BFXA 4N0DA 5HKKA 1XRJA 2IXGA 3H0GG 2Q2UA 2H57A 2HUPA 3RSLA 5KHOC 3I5YA 2AN9A 2QAGC 4HDOB 3QUSA 2ZTSA 4UP9A 4YWLA 4M9XA 1HA3A 2AKYA 5LBIA 3RYTC 4Y0AA 5CB6A 5J4YA 2CVFA 2HF9A 3K1JA 5JRJA 4A93G 1R10A 2ZRKA 3GJ4A 3R8CA 2MO1A 4E22A 4IEEA 2ZR9A 3L7ZC 1FP6A 1GUTA 1U5KA 4GNXC 1LNZA 4QBFA 3LNNA 4PR0A 2MNAA 4DLWA 1AE2A 2UUCL 2CLCX 3IBYA 4TLEA 2F1JA 4G1UC 3V4RA 4C0AC 4JBKA 3E1SA 2LWIA 1XMOQ 2OFWA 1Z7TA 3GTGH 3O8DA 1Q90A 3D31A 4FINA 4A4IA 3NHAA 3GJ3A 1I3QH 3TS2A 3U2QA 1CI3M 1XTKA 3BORA 4TTQA 1XF9A 3L43A 3LBIA 2JJ1A 4GT1A 1UDWA 4UNNA 2RMKA 1R0WA 3VKHA 2AUJD 1CSQA 1VQAA 1KJWA 3F0TA 3LW7A 2EJMA 4APVA 2Q2TA 3MCAA 4MYUA 4Z8XA 2IYXA 4NE2A 1ZP6A 4JI6L 2H92A 1UKEA 3G48A 4Q4HB 1UADA 3U5ZB 4IPGA 1SULA 1UKZA 3FB4A 5FUWA 2VQFQ 4M2LA 2QT1A 2IWHA 1Y8NB 3BDOA 3ER0A 4RMFA 1AZSC 2IUTA 2JK8A 1P7CA 3C8UA 4LHZA 2A3RA 1OH6A 2OFXA 4JBMA 3HYRA 2IA5A 1XEFA 3WBJA 4IFBA 1Q81C 2J0QA 3HU3A 4A3CH 4WIAA 4B6EA 1T8TA 4Q4AA 3CPEA 4IOLA 4JL8A 1CXZA 3ZVMA 1K9MC 1XNRL 4GP7A 1CKEA 4MUAA 3CW2C 1IBML 1DG3A 1TQ2A 1E9FA 4KFUA 4GZMA 1SXJB 2AXNA 2E8GA 1JR3E 2D62A 1RKBA 4EPTA 4TSFA 2REXB 3H3VI 2DFKB 2B8FA 1X65A 2XZLA 5JS7A 2WIAA 1U99A 1S0UA 3TQCA 2P67A 1Z0AA 1HR0L 1WA5A 3E9IA 4PC1A 4XOIA 2JA5H 5KU1A 3STBD 1XTSA 2F9MA 2WOOA 3TSZA 4CEIB 1E0JA 4A3DG 1H9SA 2ZUBA 3RS0A 1N36Q 4LF6Q 2IHYA 3CXCA 2FFQA 3FHTA 1RC8A 1COWA 2QAGB 1DBSA 2DUDA 2V54A 2ZPTX 421PA 4Y52H 2OXRA 1KTVA 2XNDA 5IK2D 4AKGA 4US2R 1HE8B 4PANA 4WW0A 1M7HA 1LM0A 4DV5Q 1DGSA 1PYBA 5DLQC 2GILA 3A4NA 3KUCA 2CNWA 2ZI3A 4DLSA 1HUQA 1TADA 2IHBA 1KO4A 1PH3A 4QKQA 4KLNA 2E5LL 4YCVA 1XX6A 4WAUA 1UE5A 2A68C 3L2OB 1W5SA 3TBKA 2QBYA 1JR3D 3IGFA 4YWKA 4PO8A 2V3CC 1KMHB 2EWVA 1T5EA 4HAZA 4BXXH 2VF8A 3B1XA 5JFGA 1SVMA 2A5YB 4YC7A 4DSUA 2ZYUX 3M9BA 2OV2A 5E7MA 3W9YA 1H65A 1YZKA 1E2DA 4GS3A 2VBCA 3NVAA 4LF8Q 5E4FA 5JEEA 3CRQA 1EOVA 1N6IA 4DR7L 5C4XG 3KFVA 1II0A 1YNNC 3QF4A 4OK6A 4L5BA 3TRFA 3P27A 3T34A 1RFLA 1E0SA 1S8FA 2ZYWX 4WZBE 2NO0A 3BH0A 5A5GA 4LFAQ 1OB2A 1AS3A 1OTCA 3L8YA 3I32A 4KLZA 5FBRB 3HOXG 1JXOA 1S3SA 1ZC3A 4C2MH 3FYHA 3W3ZB 3IHLA 3C5CA 2GKSA 2YINC 2KHJA 1TX4B 4OHVA 2KSQA 3QXXA 1U98A 2B8WA 1SROA 2ZJYA 5AJYA 5K8LA 5IWAL 4DIDA 1OXXK 1E32A 3QPWA 1CJUC 5DNYB 4OHXA 5B57C 3ICQB 1VS0A 2X1VA 4D0LB 1P8LA 5E95A 1Q86C 3KLRA 2RHQB 4O2DA 1C7YA 1GKIA 1XD9A 3WNBA 4B3FX 2ZEJA 1JE5A 4HIOA 1BKBA 4IFDH 3R9WA 3QKRA 1W0JD 2ZU6A 5DI3B 1YKSA 3L0IB 4GN3B 3QE0A 4A3LH 1Z6YA 1N5IA 1SZPA 1Y69U 2B6HA 3M1IA 2JLXA 4RFVA 2Q2IA 1QVCA 2QE7A 3OEHA 5IE8A 1HCZA 3RS3A 4FWIB 1HPCA 1GITA 4GOPC 3B1WA 2JDID 4J0QA 4YMWA 5L3SA 3I61A 1Z07A 4YDHB 2QMUA 4DLTA 1N33Q 4X8HA 2GVAA 1US8B 2K5VA 2ZI9A 4BBSH 4I1OA 5KYKA 3NEMA 3I4NH 4IHQA 4G01B 4F4IA 1H8EA 3QPUA 5K36G 2OE2A 2R7DA 3HGBA 3OYYA 1Z08A 1KJZA 2VO1A 1TEXA 3QQ5A 2ZRMA 4DV4L 1TF7A 2QMEA 1RYFA 5E7JA 2PI2E 4DAYB 1PH6A 1YR6A 2CK3A 4M8NE 2CE7A 2Y0SE 1T3SA 4JI7L 1YR9A 3Q7QA 4XD7A 2FDCA 2WWFA 3P1JA 3HOUH 2AKAB 2A5GA 2A5DA 4L8GA 3ZIAA 4BQSA 4K0KQ 2ZUCA 5JS8A 1CF4A 3FMPB 4NU0A 2ZVPX 4PPFA 1Z6HA 5FTMA 4ZIRA 4UNQA 2C9CA 3REFA 3W3AA 2H7VA 1H8HA 3EA5A 4GKJL 2IY5B 4DK1A 5IT9c 1NN0A 1YHAA 4JYAQ 2FN4A 2GCPA 2NMVA 3IQXA 4TN1A 4D4MA 2A6ED 2P6UA 3VMFA 5KPDA 4G3XA 4LJ7A 1OLOA 4QFMA 3BOSA 4DUZQ 3QPVA 2Q3HA 4GLXA 4QBIA 1GKUB 2AD5A 2B29A 1JB1A 4R7ZA 3SYNA 2Z0SA 3FFBA 3N2EA 1DD2A 1XXHE 1UE1A 3OIUA 4OI4A 2ES2A 1VKJA 2GDJA 4RD2A 1TU4A 4QJ4A 2RF4A 1BYIA 4IOMA 3UG6A 3KQUA 4TKOB 1IN8A 1KAGA 2R6CA 3H1TA 2JLVA 2WBLC 2LSSA 2QZ4A 3L0PA 3K0XA 2GXUA 4Q01A 1I4DD 4QHYA 4ZDWA 3SDZA 2XSZA 1I6HH 3FKQA 4JV5Q 4CZ2A 2CLDX 2O8FA 2L15A 4P72A 1PH5A 1JJVA 4LC1A 3U4QA 2V4DA 1BBWA 3FHWA 1IW7D 4KN7C 2KBNA 1VQKA 1WF3A 2UKDA 4E5UA 3AKDA 3M4OH 3RS4A 3WRXC 3CRKC 1HH4A 5EP4A 3AF2A 2NZJA 3W8RA 2J7PA 3RRNA 3KQNA 1UM8A 3BFXA 3WYAA 1M1YE 1JECA 4NCNA 3IHWA 2E87A 2PLFA 5FOUA 4YMTA 521PA 5BR8L 1Z22A 1XPOA 2CHGA 1TKWB 1Q8KA 2F1RA 2FGJA 3MMPA 4XSHA 5B2ZA 2FF7A 3ZZ0A 4Z1MD 4DK3C 1VCOA 2WJJA 5J4VA 5JI3E 4A15A 1E3PA 2GEDA 1K8OA 1X3FA 3KFXA 3A7LA 2G0NA 1PV4A 2ZJ8A 4GOPB 2JA8H 1LY1A 3LWNA 4Q7LA 1DCZA 2WB1E 2A9KA 3NTUA 4K81B 1GL7A 4TQAA 2G88A 3C15C 3F2DA 5AR1A 5LB4A 1ZYRC 3TS0A 2QP4A 3TRZA 2HLDA 4X64Q 1N5LA 3LW8A 2R7FA 2D2CC 4AYBE 5LPNA 2A19A 3QJYA 3E9HA 2ZJRA 1LFDB 1OYWA 2KE5A 1SFOH 4C7OA 4BFTA 4JI4Q 5M3FH 4AWXA 4C0BA 1X6OA 1AK2A 2CHVA 1CRPA 3CBQA 1X54A 3BB3A 3S2DH 2VTKA 3LLMA 4FMDF 4OK3A 1W4BA 3RSOA 1JEDA 3STBC 1DAIA 2O8CB 4NCJA 1FPMA 3UKDA 3LGJA 2QF7A 1X1RA 5CK4A 4DLVA 3PQCA 4L5RC 4HB3A 4TVAB 3VFDA 4A2WA 3KQHA 1OIWA 1D8TA 1GOTA 2JATA 2ZI7A 4PTLA 5FPTA 4LF5Q 1KJYA 5B64A 4R1JA 3SZRA 2P0EA 3CM0A 5ELXA 2O0HA 2R62A 3EZ9A 1E9EA 1VCIA 2Q8IB 2DWPA 1YR8A 4DDWA 1QHGA 5IYBH 4GMDA 3LLUA 1P72A 4KFSA 2GVBA 4M9QA 4XH9B 5DHFA 1NSTA 1VDZA 2XX3A 1CR4A 3MWJA 3NBHB 3FDIA 4JLPA 4Q19A 4MRSA 4RY2A 2ZRIA 1E0AA 4HIDA 1G7RA 1T4GA 4DUYL 4HJ7A 1PVOA 1ESNA 1L2FA 2OTLA 2FA9A 2FX3A 4JVLA 1D2MA 2XGTA 2UUBL 4B3TL 3LAWA 4HJAA 3CPWA 1OJLA 3NHBA 4DWJA 4D26A 1RRGA 1TF2A 1LYLA 3TQYA 2VHJA 2P6RA 4YONB 4P0TA 3SU8A 2NZ8A 1G3QA 2PJRA 3AVYA 3U3JA 2PMZE 1IN4A 2R92G 3TZUA 1OHHD 1S1MA 1Q1EA 1XEXB 4NYMR 4M53A 1E79D 4M1MA 3S1NH 3SOPA 3VX4A 2KB0A 3A8KE 3H94A 4KAXA 1MABA 3CC7A 1X3EA 2A30A 3GCGA 3AVOA 2GZDA 3LO5A 4ZI2A 3GLGE 2IT1A 1E2WA 4US1R 1WI5A 4JI0L 3B5JA 4DDVA 8OHMA 1MJEA 1WP9A 1I5FA 1Y14B 2ZR7A 3ND8A 3B78A 4KFTA 4A9AA 1A5TA 5EUMA 2CWAA 2QORA 4HUTA 5KDDA 3Q7PA 3GLFE 1U8ZA 2UUCQ 1AA9A 2ZRNA 4ABYA 3HYTA 2C5LA 1AKEA 4MGIR 3E70C 2OESA 2QN6A 3IKJA 4DV3L 121PA 1P60A 1ZD1A 3FMOB 3NELA 2ZXUA 2CDNA 3PUYA 1BBUA 4JT4A 1DADA 3S24A 3T15A 3K0FB 2ZTCA 3OE7A 1P4SA 1KI6A 3B1VA 1DEKA 1H95A 3U9SA 3G6EA 1DVRA 1E2KA 2BMDA 1GUSA 3EZ6A 4U5XA 1Q0UA 2ZIAA 1NMGA 4HAYA 4HLDA 2RGNA 4ZCIA 1SGWA 3LV8A 2C8VA 4FW9A 1PLLA 1T3HA 3RN5A 1YITA 3ERSX 1XTQA 5G41A 5BXQC 1Y1VH 4GNXA 4PHTA 2VP9A 5TDHA 3K0SA 3TJZA 3IO5A 1DO0A 1XD2B 2OBNA 2DWQA 4C30A 2VUMH 4URWR 3ICEA 3JZAA 4TMXA 3BIFA 5JRZA 4P73A 2ZSFA 1XNRQ 4NPHA 1IBMQ 3GTOH 4HUQA 4DUGA 4MYHA 1GRNA 1EG7A 1CKNB 2IYVA 4TYYA 5M5WH 1KY2A 2ZITA 4V0MA 3DVLA 2FFBA 5DE3A 1D9ZA 2A6EC 2ZJAA 4MRRA 2R6FA 3CF2A 2W0MA 4Q4JA 1T8UA 1Z6TA 4QNRA 2AWNA 5M04A 2F6RA 3AP1A 1OXTA 2QPOA 1JPJA 1EESA 2WSSA 1S2MA 1Z5ZA 2Z83A 3RLFA 2VS1A 3BD9A 3FMIA 1W44A 1GILA 1SMYC 1R0YA 2GVDC 2ZE6A 3FHOA 5C3EG 1HH2P 3QEJA 4P3YA 4KU4A 3KJEA 2W6ID 3AQQA 4X65L 4YMSA 1JQLB 4OXPA 1NE3A 5FOVA 2W0SA 3CW2A 1N9WA 2C2HA 1SXJE 2JJQA 1KSHA 2IS4A 2VH5R 2ODWA 2YNMA 2E5LQ 1AQUA 2VSOA 5HE8A 1Y1WH 4FDBA 1E2EA 1RJ9B 1W49A 1R9TH 3SJBA 3NEYA 4A3KG 1IW7C 4KMUC 5G3ZA 4ESVA 3ZYCA 4TTRA 1ZM2A 3A4MA 1N5KA 1OV4A 2WP8J 4FN5A 4LJ6A 2BEJA 3RC3A 1RRCA 3CWZA 4I81A 4MTNA 1XB2A 3R7WA 3HJNA 5FPYA 1NVVQ 1IJEA 1U8YA 2E74C 5H70A 1A0IA 1ZNYA 5TMPA 4LF6L 3EAQA 3I73A 4OI2A 4F7WA 4BLOA 5BN5A 3KDFA 5EP3A 2EIFA 4FMCB 3WDNA 4DR7Q 1QVRA 3PUZA 3MG9A 1T0HB 2Q21A 4PZLA 2QP3A 1T9HA 5EXPA 2AK2A 1WE2A 1CTMA 1E1QA 1PA6A 1QF9A 4UNSA 3S1RH 1VQDA 3BE4A 3SI7A 3RR5A 2R44A 1VCNA 3THXB 5GAHC 4GLVB 4A3FH 4HYYA 1SXJD 3WYGA 4MRPA 4B75A 1S72A 5GQOA 3NBXX 2MMGA 2QP9X 2ZAMA 1GKYA 1UDXA 2QROA 3FFAA 5IWAQ 4QL5A 4N3NA 1GUNA 1DG1G 2F55A 2OQ0A 3HKZG 1P3JA 1J5EL 2KENA 3PO2H 4G7OC 2CFMA 4LF7L 2Q9AA 4A3JG 5BYJA 2QU8A 3UMRA 3SE0A 3B6EA 4KBGA 2YJTD 5DIFA 4KLKA 4D2IA 4TLAA 4LFAL 2YWFA 3QY0A 4OJQA 3RDPA 4LYAA 5HR5A 5JWOA 1XCPA 2VSFA 5HZHA 1SN8A 1W0KA 4NCIA 1X55A 3T35A 2XB2A 2J0UA 2XAUA 1XFAA 2AXPA 4JJKA 4OI0A 2E2HH 4A2PA 4Z54A 1PH1A 4XVQA 1KO5A 1E9BA 4QQBX 1X8LA 1NVUQ 2AWOA 4I99A 3X1ZA 2BCGY 1CSPA 2ZE7A 4B76A 1OFIA 3J7A5 3CH5A 3QVUA 5L3RA 1KDPA 4DV2L 4DV4Q 1PLJA 2R2AA 2YZ2A 4DT1B 1MV5A 1IQPA 2RGEA 3EG5A 4IFDJ 4QRHA 4V02A 3FMCA 3TNFA 3U7FB 4JI7Q 4JLJA 4NZYA 4MKGA 4BY7G 1UBCA 4JVSB 5KNDA 1VQCA 3DZ8A 1VTKA 1W4AA 3SQWA 1FR3A 1A7JA 2F43B 2IX1A 1LW7A 2QEQA 4JLDA 1K5GA 4RZ3A 2N3SA 5TXGA 1OKKA 2YOHA 3KB2A 4DNRB 3WMFA 4DEYA 2W6JA 3RZDH 5DGXA 2JAQA 2KA7A 3DM3A 2G1KA 2HDNB 2IXFA 3E0EA 2QL6A 4DCVA 4QY7A 4ILEA 4TMTA 4U02A 4TT3D 3M4YA 2CQOA 3J81j 1MT0A 1M90C 3ZJYC 1WXQA 2EW1A 4M22A 4EFMA 2D74A 2Q0HA 4W9MC 1KKLA 3UE0A 4RZ2A 2AX4A 4NYJQ 5EZ6B 3M85A 1P5ZB 4D0GA 4EQ5A 2AUKA 3CCUA 2IF2A 2N46A 2J5XA 2FV8A 5E7IA 2RHMA 1TL7C 4PO9A 4Q1FA 1Z8FA 3TLXA 2ZSBA 3CR8A 1DE0A 2O52A 1E1OA 1VQFA 1HV8A 4DPGA 3C4JA 3EWAA 4P32A 4C2UA 2UUAQ 2A8VA 3MXUA 4JI8L 1EX7A 4GKKQ 5J40A 1W3SA 1HQCA 1C9OA 4PHGA 3I4LA 1ZMXA 2ZI6A 1DTSA 4GMXA 5HTKA 3CNOA 3IO3A 2K32A 2FZLA 1QHHB 4JYBA 4M9SA 1E0KA 5JECA 4DJTA 3TVDA 2PEYA 2NTYC 2F3RA 1HEIA 2DB3A 5M3MG 5CK5A 4TTPA 5JSZB 3KJGA 5J4LA 4V0NA 1K8GA 5EE9A 3K7AH 4IJLA 2N49A 4DCNA 3Q85A 4G5OA 3EPJA 3AV0B 3HU1A 5BR8Q 4JLBA 5SZIA 4LJZC 1HTWA 1OXVA 1G3UA 2NGRA 3THOA 3QG1A 1KY3A 4BLTA 5FPSA 2N42A 3BAFA 4GDFA 4DR6L 2J45A 1UE7A 1FMLA 1QRAA 3AF4A 1EWIA 1E1RD 3BWDD 4HDQB 4LJYA 4NL4H 4XVRA 2ZJBA 2UVQA 4JV5L 2PJZA 5CDFA 3RHFA 4KKSA 1N6RA 2WAQG 1XCGB 4JSYA 2QSYA 3PEUA 3QOFA 3HOYG 1VQGA 3ULLA 4L16A 2EFDB 2A78A 4C0JA 1QHXA 3MD0A 1VHTA 1Y1WG 2QA4A 5CM8B 3WBKA 1JEEA 4LF4L 2XOKD 1AS0A 5CIQA 4BECA 4TMZA 1LACA 3SFZA 4FCWA 1B9NA 1L1OA 2NO7A 1Z0FA 3I4MH 3MSXA 4DRZA 2WJYA 3UPUA 2GF9A 1E9SA 4P4UA 3W5IA 2CL6X 2OT3B 5LB2A 4CGZA 3IPYA 4LV6A 1XMIA 5G3YA 1OH7A 3NKVA 3CR7A 2O8BA 2Q2HA 4DV0L 3CH4B 1F60A 2JA7G 2JIZD 1ZC4A 1GG2A 4L9WA 5L3QB 5H1YA 4FI3C 4E07A 3THYB 2X8AA 4LBZA 3QBTA 4YY3Q 5M5XH 4LYJA 4TL8A 4NH0A 1NJIC 1ZIPA 1UEIA 4B44A 2D06A 4MGZR 1HNZL 4HAVA 4EX5A 5FJ8H 2ZANA 3IIMA 3KQKA 3KF6A 2BDOA 5CYPA 4KFRA 1A8VA 1P2VA 2VLIA 1D5CA 2YTYA 5FLMG 1F3OA 3GJ5A 3LH5A 3GLIA 2RGXA 2RH5A 2D7CA 1XU4A 1YVDA 2ZJZA 2QEXA 5IRCD 1NLZA 3HOZG 4A3IH 4Y7NH 1N6HA 4U7DA 4OHYA 1RZ3A 2BHRA 4PMWA 2ZRFA 5P21A 1YZGA 3RNLA 4LF5L 2VIIA 1U2RA 3ASZA 4R4CA 3B60A 3RNUA 1J8YF 3PV0A 1F2TB 2VQEL 4PZ6A 3HOWG 1IXSB 2ASEA 3P26A 4LPSA 4DZZA 1E2JA 4O0MA 3CKLA 5EXSA 1TPZA 4A3GH 1M8PA 3VR3A 1OIVA 4LRWA 3S1AA 5A4JA 2NZOA 2GNOA 2PCLA 4JI0Q 1DAFA 4DVGA 1G3MA 4BFSA 1SXJC 1Z47A 2E1RA 4TZ6A 1OPXA 2R93G 5C4JH 1J2JA 5B30A 2C77A 2O0KA 5IDVA 2O0JA 1PH8A 4X8LA 4Q02A 1I4LD 3ZGXA 2O8FB 2FEOA 2EYQA 3W90A 4CYMA 3I5XA 3VNVA 2ZR0A 2O8DA 3KKOA 1KSJA 4LX0A 2E75C 3L2PA 1G18A 2F4VL 2HYDA 3I7FA 2GCOB 2W00A 4LY6A 1R6BX 4TLCA 3TUIC 3ZDQA 4B3XA 1HY3A 3I62A 2BA1A 1E9RA 2WMOB 4DR4Q 5H8WA 1XWIA 4JK1C 2QENA 1SHZA 2LKCA 2WTUA 4NXMQ 1XPRA 3KXKA 4HDCA 3REGA 3H3VH 3EIVA 1IM2A 4BRUA 3H86A 4JSTA 4L5QA 3GO5A 3MGCA 1N3BA 2RB4A 4G5QA 2V55B 2I1VB 3S16H 4A3BH 1QVFA 4LK1C 1D6JA 2QPTA 4A76A 2B92A 5D3MB 5GJWC 1H9KA 3RS7A 3WY9A 2NN6I 3BH7A 4L4UA 4TQUS 3GEHA 3D3QA 1VQEA 1IBLQ 4DR3Q 4DR1L 4OBEA 4D4JA 2IS1A 2BH8A 1Q1QA 1RW4A 3T1VA 5TVKA 3UXMA 4F93B 4G7ZC 2ZE5A 2QQEA 4QGHA 2HCBA 1KI8A 1HQMC 2B3GA 1GKHA 5SZHB 4BE7B 3GTPH 4POAA 3F2BA 2VHUA 1ZUNB 3FMFA 3HWSA 3LA6A 4PC2A 5HCIA 1LS1A 1NN3A 4H02A 1P73A 2ONJA 1YZLA 5JCPA 1OXUA 5EAYA 1MRNA 1E69A 1UPTA 2J3EA 1YU9A 3EZFA 4MDFA 1GNPA 1VQMA 1EFTA 3H0KA 3J81c 2ODBA 3KXLA 2JDIA 4EIWA 4P74A 3S1QH 1MO6A 4IEIA 4C0LA 1GRRA 3U3RA 2GJAA 3VA7A 2CE2X 4LJAA 1WCMG 4PG3A 2IX0A 3D6TB 1HT2E 2JLUA 2PCFB 4R4TA 3KL4A 3B2EA 1DXMA 5AUOB 3M3YH 2QA5A 1YJNA 3OIVA 4LHVA 1QUQA 4X65Q 2OBLA 2IYQA 4QHSA 4BA1I 4A92A 2OCBA 1B23P 2XXAB 3PENA 4IVRA 4X62L 3T06B 1G8HA 3BZKA 1XBTA 3Q5DA 5C4MA 2D4HA 3EIEA 2ANCA 4CDGA 2EWWA 1CP2A 1R5NA 3CC2A 3CB4A 4OHZA 2ZYVX 1MOZA 4TYNA 4HIKA 2YC2C 4H9GA 4OWTB 3IEVA 1FOEB 4Q66C 2F9LA 2V8OA 3PJRA 2C99A 2WPDD 3Q8XB 3TAHA 4DKXA 3ULJA 1Q3TA 2R6AA 4LZZA 5EUQB 5ELNA 1Q21A 2WICA 3KLWA 2ORWA 1Q7YC 4IOKA 3PG5A 4AH6A 2NN6G 1U9IA 1W2HA 3PITA 3JVVA 1E99A 2V1UA 4EJSC 1GL9B 3DEFA 4B2IA 3HKSA 1Q82C 1OYYA 1XZQA 1MIUA 2BIFA 2WZQA 2K75A 2PI2A 3P20A 3A0JA 4C0QC 2ZJ5A 1P9RA 4RJLA 4KHZA 4BBRG 1E2PA 1EIYB 4JBWA 4Q9JA 1M34E 3K0AA 2W83A 4C9BA 3F8TA 1CR2A 2IEZA 4A36A 2ODEA 3S15H 3K09A 1JQJC 3NDPA 4QXAA 1TU3A 3GJXC 1J5EQ 4LJ5A 4EPVA 3FKSD 5FTJA 1KZ7B 2LXKA 3CQZH 4LF7Q 2GAAA 3AQ4A 2P5TB 3ZVNA 1N2CE 2WHXA 2F1HA 4O25A 5FTKA 4IRUB 4M21A 4HB4A 1K8AC 3H2YA 4UNPA 4A8JA 2BBWA 3HDTA 1Q20A 5C44G 3I72A 2K50A 4P31A 3KF8B 4ZO4A 1I2MA 3NBYC 2HCJB 2EXDA 3GTKH 1Z28A 3TKLA 4OO1G 3AYHB 1KHIA 2ZRBA 2GF0A 5KSZA 4DAMA 1W5TA 3U4VA 5IP9H 3U44A 2C96A 2FZ4A 5IYCH 3BRWD 3FKIH 4HUQB 3U6KA 3DHWC 2CCJA 3HU2A 2ZTEA 4ITRC 4M4SA 4CEJA 5J3BA 3CUEF 3CCEA 3GFTA 5HKKD 2KCCA 4DV2Q 3PSIA 2Q3FA 3A4LA 5IP7G 1NBMA 4O3MA 1JT8A 4LUVA 1KSFX 2WFWA 1D9XA 2QI9C 2Z6KC 1HYQA 1N0UA 4KSCA 4X66L 2ZRLA 3PFIA 4AKEA 1AKYA 1UBFA 4A3EG 1X1SA 1FX0A 1T6NA 3GEIA 4PHHA 4IOCA 4U00A 4QIWE 4O2RA 1W47A 2E76C 1NG1A 2ODNA 4OGQC 4NYIR 1KI9A 3W1BA 2W2XA 3GLHA 4FMDB 5LD2C 1UFQA 1XCMA 1AIPA 1JXMA 3AKEA 4PXAA 3R9IA 2RHSB 4QNMA 3CF0A 5JEAH 1KGDA 1GZSA 4GFDA 5EE3A 5KSYA 1KAWA 3FHCB 2DBYA 4C3ZA 4GPTA 3QEOA 1A6XA 1X8KA 3MWLA 2JLZA 4OWXB 1GUGA 1TMKA 1T0JB 1YZQA 2Q9CA 1E22A 2FU5C 2JJ1D 3N70A 4IVPA 4EJSB 4DLRA 5FI1B 3AP3A 2GESA 3AB9A 4HEJA 4PZ8A 3BXZA 1A82A 5FR2A 2VNUD 2SHKA 3WWVA 5DYGA 2IHFA 1ZNWA 2X2EA 4JI8Q 3KTAB 4JS0A 5G40A 1BVSA 1UWVA 1XEWY 4A0HA 4UQOA 1G51A 2VW9A 4XWOA 1JB7A 3NWJA 2PQAA 4KITB 3GQBA 3OPOA 4DB2A 5CLLA 3NEJA 3KDFB 5BWMA 1R4AA 4LBWA 3KXIA 4F92B 3AFQA 1NL3A 3OAAD 3HPQA 4M1WA 5HE9A 3BJUA 2JJ2A 4HB2A 1YBYA 2N8NA 3M4QA 3PIOA 5IYDH 2CMKA 2X77A 3AUXA 1JJCB 3ZH9B 2HJVA 2D0PA 3EPKA 3K0CA 5D3QA 3GTQH 1T91A 3SGIA 4DIEA 3I2ZA 2RHDA 3CIOA 1NY5A 1IBRA 4GOXA 1BDOA 2IEYA 4RFSB 4F4JA 1TF5A 3GPLA 1F5NA 4A3CG 3DKPA 2G9NA 1IXRA 1ZCBA 4TSFD 2R65A 1F2UA 2UUAL 1OSNA 4IW3B 4BZXA 4PSKA 1FP7A 2GCNA 4LF9Q 4DR6Q 4GKKL 3OTOL 1T3LA 1X3SA 3CRVA 2JEBI 1RL2A 4V03A 3RVBA 1KYIA 1B9MA 2LXJA 2HHHQ 1KKMA 1NVWQ 3CLVA 5C2JB 1CUKA 1EXMA 1WDTA 1AGRA 3B1YA 3O47A 4XWKA 2TMKA 4F38A 3SBEA 1RIFA 4CW7A 1ASYA 1LS6A 1II9A 2EVBA 3LBNA 2C35B 1MR3F 4JOIC 1G6HA 2OUKA 2X19A 3EC2A 4LF4Q 1COWD 1IXZA 4KV9A 1VG8A 1JJ7A 3GTJH 2XNDD 3J80i 3T1YQ 2JA5G 2G0TA 3W6NA 5FH9A 2YC4C 4ZDIA 1EQRA 2WM9B 4G5RA 1HZCA 1JAIA 3GLGA 2GBLC 3U3MA 1CFMA 1M7GA 2HEIA 2RGAA 3EZ7A 4AC9A 4AG5A 1MKHA 3RN2A 3ETLA 5F2EA 2IUSA 5LD2B 3ADDA 1E3MA 2GK6A 4NBSA 4DSOA 4YHHQ 1ZAKA 4Q18A 4XVUA 1VQOA 3GLFA 1FW6A 2Z4RA 2B21A 1TQ6A 3BC1A 2DFLA 1K5DA 2WAYA 3MJRA 4DV0Q 2CCGA 3F1ZA 4LFCL 1PH9A 2FFHA 3IIJA 4HLUC 5FBQB 2YOGA 1QZGA 5FTLA 1EWQA 4DSTA 1JJ2A 2I5HA 2NZHA 1IN7A 3BZCA 1LTQA 3RANA 1S40A 4B2PA 2BKUA 1LF5A 4B33A 2DFTA 4FXPA 1HNZQ 2ZE8A 3I1FA 4YXWA 1OFUX 5C1BA 4KVGA 2D5DA 4QM6A 3NC1C 4BXXG 2VRWA 3FE2A 5FOWA 4BFVA 4OK5A 4DHEA 2CWPA 1GO3E 3QXJA 3VDYA 4QJ3A 4POGA 1NIPA 4LUZA 2ZS8A 3PGZA 1TNDA 1Z0IA 2JJ8A 2ZRHA 4PHFA 3F5FA 4PFSA 2CVHA 4DDUA 3B9PA 3A6PC 1Z0JA 1FVIA 2B8GA 1A2BA 1NVVR 4D81A 1DO2A 2VQEQ 4A3MH 1CIPA 1JNYA 2V6JA 5G53C 3G5UA 2WJGA 1TWFH 2IF0A 4A4DA 4YY3L 4JG2A 2OCYC 1ANKA 1JALA 4FD2A 4ESHA 2OBMA 1K6MA 4KODA 4CEHA 2ZS7A 5LMNQ 2O8EB 2PMDA 5KUTA 1BYUA 1G3IA 5BQ5A 3GJ6A 3UG7A 4Q7KA 1DOAA 3NH9A 4HZIA 5FFMA 4L8JA 1NIJA 3DLLA 2V7QA 1W2BA 1M7BA 3E2IA 5KSPA 4KKTA 3WXMA 4DC9A 3MUFA 4B71A 3OIWA 2AFIE 5FI0B 2QE7D 3EW9A 2IYLD 2F4VQ 1ZW6A 3BBPA 4IFDG 1IJFA 2CXXA 4LWZA 4DB4A 1JPNA 1ZNXA 3CCMA 5GJVC 1G8GA 4ZKDA 4A3LG 4JL5A 2HXSA 2DWOA 3C16C 4RZXA 3RS2A 3TW4A 4NPSA 2AHOB 1H8ED 2PZEA 1VQLA 4YMVA 3CX8A 1YNJC 2PPBC 3DXJC 4QBHA 4QGGA 3UDFA 1VG0B 3W34A 3QKRB 5AJ3L 1P16A 2CHQA 2PLRA 1SXJA 5K8TA 3U58A 4B3SQ 4BBSG 2WJHA 3QXHA 3ZIAD 3I4NG 1UJ2A 1XPUA 1N8RC 2QPAA 3CPHA 3LRPA 1EX6A 4HAUA 4LJ4A 5AUPB 4KSBA 1R7RA 4DR1Q 3MEFA 1J90A 5LMNW 2AK3A 1H8HD 2WKRA 3IILA 1HJPA 5FL3A 4A1FA 4Q00A 1G20E 1GWNA 4GZLA 1KL9A 1L0WA 1Z06A 1X9NA 5DHAA 4MYCA 3HOUG 3TMKA 2EQBA 3EBEA 2WIBA 3QXCA 4DR4L 4BRWA 3BK7A 4DK0A 1TWGH 4X6AH 4YCUA 2Y8EA 2QAGA 4NXML 2JLQA 3EPLA 4AKIA 3SS8A 3X1DA 4N1AA 3FOZA 1C1YA 3CCJA 1KQSA 2FWRA 4S2EA 3Q9LA 3EQLC 2PNHA 4CRWB 5GAGC 2ORIA 3IFTA 2N1BA 4R71A 1VG1A 4Q9HA 4B6FA 2JEAI 4JC0A 1QHYA 1QBKC 2B8TA 2BC9A 2YHSA 3O8CA 3S14H 3WYFA 4URXR 4TYWA 1IBLL 4DR3L 3PO3H 3ZQJA 3TGPA 3X1XA 2XSZD 3Q3JB 3CCQA 2VF7A 2WJVA 3VR6A 4C3HH 5A35A 4PZZA 4AYXA 3RZOH 2CL0X 2GXQA 3A8TA 2P6NA 5K8IA 1EFWA 4NYJR 4Q1CA 4PPNA 4Q4LA 1WBDA 3U4ZA 4X62Q 1E4YA 4DR2L 4W5WA 2B63H 4AD8A 4EDHA 5KNBA 4MRNA 3ZZUA 4B3GA 1G16A 1L4UA 1G9XA 4RKFA 4BFYA 5DN6D 3T1TA 4Q47A 3THWA 2F1MA 2YWGA 3KZ1E 3V9PA 4LYFA 1R8SA 4Z51A 2EJFC 2DPXA 4IDPA 3MAAC 4I1UA 1LV7A 1G6OA 1GAJA 1CTQA 5TV2A 5L3VA 4M9ZA 2BBTA 2REBA 4UKDA 5AJVB 2F3IA 5KSOA 4HAXA 1E1TA 4W5HA 1KDRA 1CULC 5H1SE 1MO3A 4HZUB 1QHIA 2QQ0A 5FUXA 1UEBA 4NP6A 2P2LA 2F1IA 1FUKA 3PEYA 3FPPA 1YNXA 1KIMA 4P4SB 4V0KA 5C0XH 2JA8G 1KXLA 1OE0A 2G6BA 5E3HA 2OCAA 2ZS9A 2ORVA 2PCJA 1FNNA 3CC4A 4HSEA 1PJRA 2IBMA 4BEBA 2OLKA 5C18A 5DI3A 1NMZA 1W1WA 5M3FG 2GHIA 2WWXA 4Q1DA 2DCUA 3A1UA 1X6VA 2WJIA 1IOZA 1TUEA 1YZ6A 2C03A 1GP2A 5CJ2A 3IRBA 1E9AA 4QG7A 5AK0A 1TWAH 2OQKA 1J99A 4QJ5A 3CCVA 1DS6A 1US8A 1G5RA 4KYIB 1GIAA 1G21E 3OFNA 4WZ6A 1H9RA 4B3DA 3JZMA 4F91B 4ON9A 2MSEB 1OB5A 1SR3A 1PH2A 4KVAA 1CJMA 4TMWA 1G7TA 4AG6A 2AMCB 2C98A 1GNQA 2EFEB 4WBSA 4DNIA 4M0LA 2HV8A 2J41A 1KI4A 1DAEA 3PEWA 4UJ5A 5J4KA 4A6XA 5EJEA 5IYBG 1DELA 2D3WA 4IKEA 3KKPA 4WVFA 1JMCA 4MDEA 1BKDR 3X1YA 4BLSA 2R7ZH 4H1VA 4EKDA 4Z8YA 1IY0A 4EPWA 1W7AA 2HYIC 3D7MA 1SE8A 4CF7A 4LK2A 4TWZA 3ND9A 1VYVA 3KJHA 4A6PA 5GADC 4TL7A 1PH4A 5EE0A 2A5FA 1VHLA 2DFNA 4A82A 1IN6A 1VYTA 3I55A 2UXCQ 4X66Q 3TSWA 5KDOA 3QIAA 2DGYA 4LSGA 5FBWB 1YZNA 1IN5A 3I92A 2WOJA 4PC6A 3TUZC 2WAXA 4IFEA 4A75A 3ZS8A 2JA6H 3T1HL 4ASUD 4HLCA 3PCOB 2BJWA 1GDDA 2KBFA 3WP0A 3NC0C 5FL7A 4HJ8A 4W5JA 3PVSA 3IIKA 1G7SA 2JIZA 3ZVRA 1KDOA 4Q4AB 4WXPA 4AYTA 1S3GA 1E2QA 2RGDA 4JI2L 1E9DA 2G1JA 2PL3A 1N5JA 2V9PA 4QHTA 3GTMH 2ZROA 3EARA 1KI3A 3BB4A 3H84A 2H5EA 3FGNA 3OEED 1VCMA 1A2KC 3AKCA 3MFYA 2OHFA 4IO9A 1IYUA 1KNQA 1NVXQ 2JA1A 1ZJ6A 2BMJA 3CX7A 3OE7D 4K8OA 4B73A 2ZU0C 4IXMA 2P65A 4JIMA 2UXBQ 3AVWA 2IYUA 1N34L 2FPLA 2J87A 2K5HA 3D0FA 3EASA 4DV1L 2H1LA 5FR1A 3CAMA 3LQRA 5A0FA 4NXNL 1HZAA 1T5LA 4WXRA 5FOXA 1H9SB 1OF1A 2F3TA 4OQMA 5JEAJ 3SJCA 2BBSA 3QKSA 4GNKA 1R2QA 3Q8DA 3LFUA 4GOPA 2ZJOA 3HOVH 1SRUA 221PA 3ONWA 3CPFA 3JAMi 5JJIA 4GSYA 4DCUA 4EQ6A 2ZRAA 1FYCA 3AF3A 4W7SA 1Y1VG 1N6KA 3QSYA 1W4RA 4C0SA 3Q72A 2IUUA 1J70A 2QBYB 3H0GH 3CP0A 2FXQA 3S2HH 2VUMG 1YRAA 3AFPA 2VHTA 3O8RA 4DV7Q 3AVVA 3ZD7A 4H44C 3OTOQ 1AE3A 4L5TA 4R2HA 5F9HA 2E2JH 3LX5A 2QMOA 2YTVA 1ZBDA 2FE4A 2VP5A 1ZU5A 2CCKA 3DKVA 2YU9H 3IBGA 3PR1A 1WCV1 4BY1H 5HCNA 1AH9A 4XTCS 4A93H 2HIVA 3GFOA 3H4MA 4DEXA 2O5VA 3THYA 3AVXA 3CZPA 1Z9FA 2HF8A 3PIRA 4OQNA 2ZJPA 2UXDL 5DH9A 4HJ5A 1KO8A 1E2VA 4IPHA 3QF4B 3V4FA 1UBGA 3RABA 2FSHA 4P75A 2BVNA 1E2MA 3O8BA 4UJ3A 1OH5A 4HIMA 1HE1C 3PUVA 1D2EA 2ZSAA 4B48A 4C0KA 2VP6A 2Y0SG 1WMSA 1TU2B 1YJWA 1F6BA 2BBOA 2JASA 3B13B 4JL6A 4ZPXA 2GVZC 3U44B 1G3RA 4OL0A 2QY9A 4LF9L 2Q6TA 4DCTA 1VQ8A 4F4CA 1KNXA 4YQFA 2CEAA 1J8MF 3N5CA 1V5WA 2H18A 4CEJB 4LFCQ 2HHHL 4NHOA 2ID0A 3GP8A 2XTNA 1WB9A 2AD1A 4PAOA 4B47A 1WBBA 3SJAA 1N0VC 3K9LA 1YJ9A 3A1WA 1XEXA 4ZDJA 4AQYL 2IYSA 2HT1A 1XMSA 1S1CA 1VQNA 1E2IA 2KJQA
chains in the Genus database with same CATH superfamily
1TM4E 4AN4A 4E88A 2PZGA 1Z7EA 3B7GA 2JAHA 1E1QD 4V0OA 1ILEA 1E7RA 3OKPA 4YMHA 1RM4A 4YIJA 2YV3A 5I6YA 3AB3A 1QYWA 4AMGA 3KK7A 2R68A 3GJ8A 3QE3A 3JWEA 1NSYA 3CLTC 4XXEA 1HQRD 4ZVVA 2PT5A 5C5EA 5JNUA 2PNRC 1YS9A 3B5EA 4UU1A 5AUNB 3V2UA 1OX6A 2YXBA 5CHYA 4EITA 3GCDA 1A15A 4M6WA 3EE6A 1V8OA 2GJSA 3MFQA 1VHWA 5T4BA 4OHRA 2PJUA 4YBZA 5GGYA 5IMBA 3JQ9C 3C3MA 4R40A 3WWPA 4FIZA 1THGA 5M3BA 5IJ9B 1SIWA 3IUEA 4Q48A 5LXTF 4QEDA 3W05A 4YRKA 4TV9A 3TXXA 2XA1A 1YHZA 1P8AA 2WWGA 5D85A 2ZZMA 3BGDA 2IIBA 2B3TA 3F5DA 5CV6A 2F8TA 4CR8A 3RLNA 5B55A 2W58A 3GV0A 4YRGA 1YB5A 2H4HA 3V2HA 4YJHA 1ZH2A 3QE2A 2X14A 1VI2A 1JQKA 4QUCA 1V8QA 3WOEA 4WXYB 4K9OA 2QTGA 2EW2A 5BR7A 5LDGA 2Q5HA 1ILWA 5BMVB 2M6RA 4IV8A 4K5WA 1VZ3A 3NVKI 2HTEA 3RVSA 2ESRA 5FJ8G 3G59A 5BQPA 3MVEA 1KRXA 3IP3A 4P71A 4GHWA 3T51B 1OT3A 2QTHA 2QLLA 4Z1MD 1PMRA 5HKOA 4L07A 3U61B 5HKLA 2WHQA 3ROPA 2FOLA 1P2SA 4JI2Q 2GBGA 4NVRA 1XLWA 3UUGA 1JDBB 3ULPA 4WLFA 4MS4A 3ZE6A 3EIQA 4B35A 3BEOA 3SIRA 2EOTA 1NLFA 3ZDDA 2FJ0A 4H17A 1FJGL 1DQNA 1F6DA 1U2ZA 1O9HA 3K6RA 2PUTA 1E4OA 1ONLA 1KYVA 1CRQA 1DOMA 1ZVKA 1II8A 3UM9A 4P3KA 3S4YA 1TEVA 2HF7A 1THMA 2OAQ1 4MNOA 4ZMSA 4KXFB 5DOVA 1TZBA 1SUIA 2ZTMA 3UQYS 3WIOA 1CUYA 1Y5MA 5AVSA 2VHYA 3TDMA 4DPKA 2Y1KA 1BFDA 1R0ZA 2DN8A 3LT0A 4JT9A 2BEUB 4OIMA 1HURA 3L8GA 4TL9A 1PEDA 4KYUA 5ALQA 4ETWA 1AKVA 2OG2A 5G0WA 3VYUB 4NMWA 1TAGA 3I4OA 5L9AA 4B3MB 3BQ9A 2PGJA 3UQZA 1CUZA 4BDSA 4Q7JB 2FRDC 2LCFA 3SR0A 1XZLA 3VA5A 821PA 1V5FA 1KU6A 1Z83A 2QR3A 3P9KA 3AHJA 1EEXB 1FRZA 4DW8A 2PSDA 5ALEA 1JMYA 3JQQA 2Z43A 4GLAC 4PSAA 1EM8B 4LQ4A 2KI5A 4PRYA 4JKYA 2F59A 2D1QA 3SZ3A 4NBLA 4L5SA 3BCSA 3B1FA 1EY5A 3P9IA 2ZVDA 2QUJA 3OA2A 4R16A 1KEWA 3PXDA 1EK0A 1G6PA 4Q7QA 4C3JH 3F5QA 1EWRA 4IPCA 2DETA 3EN2A 4ZVOA 2W7TA 5AJWA 3ZZ1A 1IHOA 3S6JA 2CFCA 2WF9A 3ELUA 5DYIA 4EMBA 1D4OA 2HSWA 3K6SA 2XWBF 2AT1A 1XCOA 4PGHA 1IZ6A 4Q7MB 5C52B 3I6ZA 3S2DB 2O2YA 4FLEA 2X2FA 5TY0A 4J8QA 2DBVO 3BWYA 3PHJA 1T6XA 4FD3A 2NAFA 2A74C 5A6SA 3D4IA 2YWHA 3NVDA 1UEAB 1PWHA 1BXRB 3DVQX 4RSGA 1LWNA 1Q22A 5KYUA 2PO5A 4XKJA 4DSNA 3KTAA 1N36L 1X19A 1EVEA 2NX2A 4IH1A 4QQRA 4KAJA 4MITA 3H9JA 2AJTA 2ZYTX 4FYIA 1CY4A 1U0HC 4ZT5A 1IHDA 1ZCAA 3LY7A 4N65A 2YY6A 3UZUA 4DR5L 3HOWH 1Z2AA 1XJQA 5G1OA 1S3OA 3B3FA 3EVFA 4ZU6X 4B3BA 3GAZA 2GEKA 4YR9A 2BH2A 1FGUA 1MBZA 2XTIA 1B2LA 3OBBA 2XBLA 3O9MA 3OOJA 3Q11A 2ZB4A 3IQEA 4RKEA 4PLTA 2G06A 5GVRA 3QUTA 1VSVA 3OIPA 1J09A 1PI3A 2PUAA 1E3JA 2A2ZA 5FEMA 3U3DA 1N33L 1VYUA 1DBWA 4P5DA 3PQEA 3WL7A 5ISRA 4AP9A 1TT5A 2WF8A 4NMMA 1EDDA 1UZNA 1WFQA 1N25A 4JQOA 1JORA 3S1RB 3AWIA 2ZSHA 1GCIA 1XAGA 1O89A 5LXTB 2GM3A 4CCYA 3GLKA 2GBLA 3EQ7A 3PB3A 4MMZB 2GASA 1GLGA 5JVG3 2C3UA 1R6AA 2X0JA 4OY3A 3A6KA 4BZPA 1LVHA 4ZCLA 1CT1D 3UIEA 1RDPD 2YS7A 1PL7A 4DRXB 1UT8A 2Y1CA 1XIVA 1GUOA 5JIBA 3QOYA 1FNCA 2WE7A 1XD2A 3EC7A 3UT6A 3JVIA 3U39A 3EIOA 1MJGM 1F2UB 4QSMA 2NO9A 4B7ZA 1R8QA 4F2HA 4BLRA 4LW8A 1S5BD 4CQJA 3DDOA 1EH5A 1GADO 3TEJA 4PX9A 4LXGA 4TWBA 2HB6A 3IV9A 3OP1A 1LBSA 2JBAB 1QIFA 5TSSA 3GD7A 4DIKA 1X56A 1RRMA 1KDYA 3BVZA 3I8SA 3HOVG 3A1TA 3EVEA 4FJ0A 3DYBA 1A8PA 4QLAA 3B9QA 1KJIA 5K03A 4N0DA 3RSLA 3IMCA 1C81A 1CUJA 4HDOB 3E5SA 4JJ8A 3RVNA 4MS1A 1U1DA 3LHDA 3LNNA 1X2BA 5IWAB 2O57A 3IBYA 3F78A 5A3QA 2LWIA 2HKIA 5ITWA 3WGOA 1TYZA 3RRJA 5ES3A 3V1KA 4WRDA 3K5MA 1WUIS 2FUG1 1OH6A 3WBJA 3T0FA 3AL3A 4H3KB 3X3MA 1Q81C 2E5WA 1XN1A 3HU3A 1NASA 4CTMA 1DJNA 4KFUA 2E8GA 1MAAA 1DEAA 4K5VA 1QB7A 2SCUA 3E05A 1RXYA 1SUAA 5KWIA 5J1ZA 4EZBA 5KU1A 4FF3A 3BMQA 1H9SA 1DBSA 1KTVA 4HQLA 1B3AA 1LTSD 1EDZA 1UMCA 3IOCA 1JOQA 4Q05A 3OT4A 3ZDCA 4X3OA 1VJCA 5KYYB 3GNLA 3ZDEA 4C2AA 1T2AA 3NVAA 1E2DA 1RHJA 3BMNA 5EFOA 4L02A 3DWFA 1H1LB 4WZBE 1FMFA 3CN9A 4KLZA 4DANA 1S3SA 1GZDA 4MYRA 1J07A 3D8GA 1QRSA 3H6GA 4OHVA 5K8LA 3CCCA 3KETA 4OHXA 2CMDA 1Y3FE 4QT0A 4Z4GA 4WY2A 3S1QB 3LYAA 1W581 4M86A 2IIVA 4KR2A 4IFDH 1EP3B 3QKRA 3L0IB 2HJSA 2JLXA 3FA2A 3P9SA 3NBAA 2IOFK 4X8HA 2PLNA 4I1OA 3I4NH 5BOSB 3ELBA 3QQ5A 1XTUA 3DYVA 4DLAA 1HLDA 4B17A 4EMSA 2A5DA 2BW0A 2Q1SA 3UWDA 3PPYA 1GL3A 4IIFA 3IQXA 4G3XA 5HS6A 4DM7A 3QPVA 1G6KA 3S2SA 4UDOA 4CPDA 2JIMA 3KL2A 2GB4A 1OFVA 3W8FA 1SYDA 3R23A 5FWAA 4R9NA 5BRNA 1TUBB 2QSUA 4EY7A 3MS7A 1V9SA 5L40A 2ZWPA 1L5KA 4XRRA 4TSSA 3IEPA 2H7YA 5J2TA 2JA8H 4MAMA 2H31A 1NYLA 3P2YA 2FQ1A 1N0HA 2P5ZX 4UHEA 1CQIA 3LW8A 5JT1A 4AYBE 5CBEE 3G9XA 1A4IA 2BR4A 1Z0SA 3DBHB 3GFSA 5REQB 3OZ7A 2O8CB 3BRSA 2X7HA 4Z9CB 5I9OA 3GC6A 3FLEA 3CM0A 4D9BA 4X65B 3NJ8A 4WOCA 4RU1A 4Q19A 1G0OA 5JH7F 4ZCRA 4YQYA 2XLBA 1AN9A 1UMDA 4BECA 4JVLA 5EIWA 1HC7A 3LAWA 5EAIA 5ULLA 4UARA 1RRGA 1G3QA 4F3NA 2YQ4A 1EUCA 3TZUA 1OHHD 1XEXB 3S1NH 4LXIA 3IVCA 4GIBA 2JIRA 4WEOA 9MHTA 2C9BA 1SG0A 4ZI2A 4XGQA 1DXYA 2FX2A 3VHXB 1JDVA 4XFKA 1YDHA 1VIDA 3BD7A 4H7IA 3WLKX 1QH8B 1EE9A 3EZ6A 4ZI5A 4FEAA 2D2IA 4TTJA 4TLMB 2YJ5A 4PAWA 4O1NA 5E4YA 1UZAA 4CLRB 4DDHA 2EKLA 1EWCA 1JAYA 1X8XA 1SUCA 5BSEA 5CD1A 1YASA 3S2UA 1T9KA 4AO8A 1DV1A 1N8TA 3U5TA 1S2MA 4HGPA 4DADA 3FMIA 1U8UA 2ZE6A 2R60A 3WLFA 1ML3A 2IUFA 4FDBA 2HSJA 2KX7A 3L46A 3NT2A 2XIWA 4ZQCB 4U2FA 4M1QA 4ZALA 2D00A 2BFOA 4GUAA 3CF4A 4GKBA 3V4VB 2R44A 5FI5A 2G28A 5JYBA 1FMTA 4FE7A 4LF4B 3RMHA 3NAZA 1QFZA 4B4VA 2W2KA 1ZXXA 1RLTA 2OBBA 5JAHA 1ENZA 3R0VA 5CT5A 2E2HH 1KO5A 3AEKB 4BB9A 1BG6A 1CSPA 4PBSA 1KDPA 4YJGA 4QRHA 4Z7QB 1X7HA 4NKLA 1JB9A 5KTPA 2NU9A 4A5SA 4I4IA 4UTOA 5EJMA 2OL4A 1Y33E 1UIRA 4HH3C 2P9FA 4M22A 4W9MC 1YIOA 1KKLA 4NYJQ 3HP4A 2X5NA 2J7ZA 3P9YA 2WINI 2O8VA 4AX4A 1GG5A 2PFSA 1WZ2A 2F4VB 4G07A 2GBCA 1DTSA 4IFIA 3NTHA 1NTRA 3AY7A 1GV1A 2F3RA 1HEIA 4MUKA 4P3OA 4RK1A 5U4QA 3FJOA 4FR2A 5EE9A 1CYDA 3AV0B 1OTXA 3SZOA 3HXPA 3F7TA 1P1IA 4KPFC 3BWDD 3I6QA 2C83A 4S04A 2AI1A 3PCXA 1QHXA 2VZ8A 1X9IA 2QA4A 4W9NC 4ZHQF 1AQNA 1LNSA 1XKLA 4WI1A 3WA7A 4KIGA 2NO7A 2Z1DA 1ZN8A 2VPZA 5ES4B 4LV6A 3BWXA 4XW2A 5ARBA 1GG2A 1P5JA 3NETA 5EZQA 1YWGO 1UEIA 1QZ3A 2JK1A 1QMPA 3W7BA 3X2EA 5EKDA 4KFRA 4KN5A 3HA5A 5KQLA 5FQNA 3GLIA 2VC2B 1X7ZA 2IKSA 1ABEA 4UEQA 1DQSA 2EBFX 3ZTWA 5B7PA 2GEFA 3F6CA 3VR3A 4ZYYA 1QK4A 3S0JA 2QTMA 4YGYA 1R50A 2O0KA 3HKBB 1E18A 2O8DA 4HJRA 1I2CA 5CW2A 3HHPA 1L7AA 2BAGA 3MYRA 4NXMQ 1E77A 5IVPA 2I1VB 2CLFB 2D2VA 2VB3X 3CT4A 4G7ZC 1VHJA 2QN2A 2D2XA 3M5CA 5CEJA 1EVZA 3MXGA 3ZV4A 3VYTA 3IR6A 2WG2A 3EZFA 3T3PB 1D2HA 2JDIA 3KK0A 1O96A 1RXCA 5F9MA 1S02A 4MJ3A 5DLDA 4KD4A 4MP6A 1HDYA 3PWZA 1AXEA 5L53A 1JSRA 2YC2C 3IEVA 4UBNA 4JBLA 4KIUA 3UFXB 3V2GA 3PG5A 4GX2A 4MVYA 1H2XA 1GL9B 5T67A 3QEKA 3HOXB 2WZQA 3EBOA 2EKPA 2FPPA 4C0QC 2Z2JA 1HQDA 3BT7A 4P58A 2R5NA 1XDDA 2W8BA 2IXAA 4R3UC 4NSNA 4L6TB 4PQGA 1GNLA 5DM0A 5LU8A 1YNJD 4Q12A 3STVA 1J9GA 1RYDA 4JX9A 3BRWD 2AQIA 3U6KA 2ZUVA 2FPIB 4KXQA 5IP7G 4O3MA 1IH8A 1IU9A 1HYQA 2ZAIA 4AKEA 4A3EG 2FQYA 1FX0A 2QDXA 3G0DA 3BFJA 4MVJF 3NHSA 3FCSB 1WKBA 3R4VA 1JHQA 3LYHA 1S3FA 5KSYA 1BEEA 3ZR4B 2H0AA 1LDBA 3FGPA 2RSOA 1CV2A 5L6LB 5JH7B 3PUKA 1JLLB 2YASA 5EN4A 1NL3A 4AP6A 2N8NA 1FLNA 4DIEA 4F5DA 2VRCA 4S1PA 1OSNA 4CFYA 2GLUA 3B36A 4HQFA 4DR6Q 1JG2A 1J1IA 4XCQA 4PLYA 3C74A 3A0RB 4RENA 1AGRA 1PW7A 1CDZA 1G6HA 4BGDA 1NVBA 4IF6A 4D0SA 2IPKD 3OLQA 3J80i 5A03A 5FH9A 1AKWA 3DHEA 5EHIA 2X9QA 3GLFA 1VQOA 1TQ6A 2NSDA 4Z0PA 5BWLA 3OLZA 3W2FA 5GZ6A 4DSTA 3K0YA 1GUZA 3OLCX 3VDYA 4F2WA 1JKFA 4WCFB 4RGTA 2VQEQ 1CIPA 2WJGA 4A4DA 4MK4A 1R6UA 5ERGB 4CODB 3AINA 1CHNA 4PLZA 2V7QA 3MC0B 3DMUA 3E2IA 3TTUA 3MUFA 3OIWA 1VOTA 4DB4A 2H1OA 1Q1NA 4ZKDA 4QFDA 5G1PA 3DXJC 3DVAA 4MPRA 1ICWA 4Q39A 1U11A 1SXJA 2C2WA 4ARVA 1X7WA 4NBNA 1U3DA 3GRZA 1G59A 5DHAA 3KHTA 1QMGA 2ZAYA 3OFVA 5GAGC 2G8NA 4BO2A 1HGXA 2YFYA 4A16A 3GF4A 1OC2A 2V98A 1W8DA 1QHYA 2LPMA 1ADJA 1A5BB 3ZLVA 2G80A 4UHKA 1JFFB 4TYWA 3ZWWA 1N57A 4C3HH 5K8IA 2P6NA 3ZW7A 1GRCA 2R3SA 5CT6A 1E4YA 2R00A 4DR2L 3Q7RA 4MRNA 3IV7A 1G16A 1G9XA 1TY0A 3MAAC 5CLGA 1ZK3A 1JFTA 1KVSA 2F3IA 5B1IA 3A7DA 3RYIA 2VCHA 1ZS9A 2WR8A 1N2XA 4HSEA 2DZDA 2GZMA 4D97A 4O02B 2DUWA 2JAXA 3C1UA 1K2WA 3M3DA 5K3FB 1AW7A 3N2LA 2Z9HA 4LSZA 4JAVC 4RAOA 2C98A 2EFEB 5ICEA 4L9AA 1DAEA 4AQYB 3X1YA 3L8FA 1W7AA 2Q5EA 3D1JA 3BZDB 1GUFA 1VYVA 1VGVA 1STHA 1UJNA 4PC6A 3TUZC 1N2SA 2VUIB 1N9GB 5FL7A 3IIKA 3DMYA 2IV3A 3C1FA 1N5JA 3DLHA 4CHTA 3RRFA 1VCMA 2I2XB 3Q3CA 2BMJA 3OE7D 3RFCA 2J87A 2NUAA 3SJUA 2H1LA 1E4EB 3AX6A 4NXNL 3HJGA 4WXRA 3PGXA 3LK7A 4NCAA 1B43A 4GSYA 1TVMA 4EM6A 5T8KA 3X3NA 2NVXB 3OPYA 4GXQA 5AVJA 1J70A 3CP0A 4GX0A 3ABRB 5CYFA 5IP5A 4G65A 4XUEA 1WCIB 2CH4W 2VJYA 3OWFA 4HJ5A 4Z7JA 3ZXXA 3MW8A 4IMIB 1HE1C 5E6RB 1UAGA 1CUWA 3MXNA 2VP6A 3HXKA 4JL6A 2GVZC 1PD0A 1SYGA 5EWMA 5CV5A 1JGTA 4WBNB 1ZGAA 1WBBA 5TGZA 1FX1A 4PHCA 1BMFD 1SZJG 3RW9A 1IUPA 4B3RB 2QD5A 4EK9A 4EUEA 4CKZA 1M75A 4BUJA 1WUJS 3K81C 5GY7A 4IXWA 3L8ZA 1J0AA 4RA6B 3MTSA 1Q5PA 2Q0QA 1QIIA 2XQFA 4RF4A 4LCBA 2A9RA 1FY2A 2BA0A 1C7QA 2UZAA 4UDYX 4AYBG 1WQ3A 3NP8A 2R7AA 4RFBA 1RXSA 1TMYA 1ADBA 2XKAA 3DBIA 2FN3A 5HBRA 4CM5A 2OKCA 1F3LA 4R1PA 3MD9A 1OKKD 3PI6A 4ETIA 5AM2A 1DKMA 1SUSA 2QLNA 3NDJA 3AB7A 4ANFA 2DUNA 3KB1A 4AFNA 5MHTA 3OKAA 2JLAA 3A37A 4MQBA 5DHQA 4N5MA 1M6HA 1RJ9A 1QIMA 1QLHA 4JUAA 3R40A 3VVCA 1A8SA 1HNXB 3WMWA 3R7DA 5DNEA 3BD8A 3PC8A 1VL6A 2RAPA 1J2RA 3BMCB 4A10A 3CMEA 5SZJA 2AOUB 5EQFA 4X6UA 1R8YA 4YO7A 1YBFA 3CVUA 3UV7A 4DY6A 3UXEA 4DIBA 4Q1EA 4ZT7A 1X7YB 4B8YA 1OYOA 3K9GA 3HQ4O 3KDSE 3KOZA 4MPJA 2AJLI 5BV0A 3SFVA 2WQ6A 2QTFA 1IYJB 5B3AA 1DUSA 3FFWA 3V7YA 5C44B 1GSIA 4BYGA 2YNMC 5IS2A 3M33A 4FNGA 1W5AA 4DTIA 2AXQA 4PIPA 1SPBS 3SZUA 5AW7A 5C4ZA 1U3FA 1R9GA 4WKOA 4QBGB 5CM9C 1ZH8A 1O77A 4AZWA 1KRWA 4BVFA 1M74A 1O6GA 4A3GG 1YZTA 2PH3A 4Y7DA 3DOFA 2IK8A 2OWEA 2VYQA 1RMQA 3U1TA 4MKRA 1HQKA 1AU9A 2OEPA 4DV1Q 4QUKA 2VA8A 2EZ8A 3RSGA 2DPHA 3AB8A 3HTXA 3D59A 4FWBA 2HRQA 3ADOA 1PYDA 1L9XA 4QARA 2W2PA 2VAWA 3N3AC 4RAQA 5CFLA 3GIWA 2ATXA 1JBKA 1AF7A 1KQOA 3AM5A 4WKGA 3KFUA 1JZQA 1KU0A 2VDUE 3DDNA 3ZZTA 2XCSB 1RRPA 3E84A 3IRVA 5JY1A 1DAGA 2UXDQ 3ZLJA 2CYCA 2JA5B 4DCPA 1IC6A 4R05A 2WUWE 4DV7L 4IPDA 1HTLD 1YDFA 3NOXA 5L6MB 4RDHA 5T4HA 3BWBA 5E6UA 1MH1A 4IEFB 1F2TA 1PWXA 1QVGA 4P8RA 3X1WA 3ZDZB 1ZIOA 2CNWD 5JANA 1I94B 4JI1Q 4M1OA 1BU5A 3X1KA 4A0QA 2R61A 3AUFA