1OXUA

Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
353
structure length
353
Chain Sequence
MVRIIVKNVSKVFKKGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDDRLVASNGKLIVPPEDRKIGMVFQTWALYPNLTAFENIAFPLTNMKMSKEEIRKRVEEVAKILDIHHVLNHFPRELSGGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARALVKEVQSRLGVTLLVVSHDPADIFAIADRVGVLVKGKLVQVGKPEDLYDNPVSIQVASLIGEINELEGKVTNEGVVIGSLRFPVSVSSDRAIIGIRPEDVKLSKDVIKDDSWILVGKGKVKVIGYQGGLFRITITPLDSEEEIFTYSDHPIHSGEEVLVYVRKDKIKVFEKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the ATPase subunit of the glucose ABC transporter from Sulfolobus solfataricus: nucleotide-free and nucleotide-bound conformations
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transport protein
molecule keywords ABC transporter, ATP binding protein
total genus 103
structure length 353
sequence length 353
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2003-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17847 GlcV_C_terminal Glucose ABC transporter C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1oxuA03
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1oxuA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1oxuA01
4DR1Q 4HZUA 2JA7G 1LVGA 1P72A 4UXIA 2CHQA 3U58A 1OHHA 4HZUB 2JA1A 2ZR7A 2AXPA 2J9RA 4IJLA 3QKRB 1J6QA 1FL9A 3KFXA 2ZJZA 2QI9C 1TWHH 5EE5B 1I2MA 3IGFA 3WP1B 1LV7A 4UJ3A 1ZIOA 1GKUB 1SKQA 1D2MA 1O3YA 1WP9A 1DAKA 1O7IA 1TAGA 1Z3IX 4JC0A 221PA 2GXSA 3KJGA 4J0QA 3ZQ6A 3ZLJA 3VR2A 3M4PA 5EQTA 1G4AE 1WDTA 4LF5Q 3K1JA 1GITA 2VP9A 4P75A 4C3JH 1KO1A 1DPFA 1G5RA 1GKIA 2R6DA 3T35A 2EJMA 2ZXUA 1SZPA 3UG7A 3K7AH 1QHHA 2GCPA 1Q20A 2HJGA 2YINC 3B1XA 4HAZA 1EFCA 1YJ9A 1HZ9A 1QHHB 3PEVA 4IO9A 4TTPA 4L8JA 1AE2A 2JIZA 2RF4A 2MMGA 2HHHQ 2D2CC 2WSMA 2ZTEA 1PH4A 2QMHA 1ESNA 1FPMA 2R2AA 4OHVA 1XCGB 1Z06A 2QQEA 1W4BA 4Q9HA 3WYGA 3QKTA 4ASUA 2EW1A 4F7WA 1VHTA 1W36B 4GNKA 4P0TA 1WFQA 1DTSA 4HIMA 2ZS7A 1FQKA 3DVLA 3CP0A 4LJ9A 2B7BA 4QGAA 5M5WH 1JT8A 1QVAA 2JLSA 3UMSA 4TZ0A 1MO3A 2JA5G 4PPGA 3EXAA 4QOSA 2ZIAA 2B29A 3SOPA 3ECCA 4B3GA 1X55A 2QE7D 3MSXA 1C9OA 2PNHA 1NJIC 3S2DH 1DAGA 1VQLA 2R8RA 4DV5Q 3UDFA 2ZRHA 4LPKA 4PC2A 4LSGA 5IT9c 3RLFA 3UKDA 4M1OA 1Q1BA 4DNTB 1Z6XA 3M9BA 3L0PA 3TE6A 1B8AA 1CR0A 2JDIA 1YHAA 2XJ9A 4LF8L 4LFCL 2LKCA 1NI3A 2QPAA 4PO1A 2OO7A 2B8WA 3O8DA 4R9UC 4C0BA 2EQBA 3RLNA 5EZ6B 4CIDA 1PH1A 4KKUA 2H57A 2PL3A 3F3YA 2ID0A 1YZGA 2MO1A 1OYWA 2F43A 3LGJA 1PMRA 4KHPL 4Q19A 5GAEC 3HOZG 4LJ5A 1R9TH 3VHLB 1XJ0A 2C95A 2DFNA 3L8ZA 721PA 3ZD6A 1Y8PB 1E2GA 1KK3A 1DAMA 3OESA 3NBFA 4IDQA 4TKOB 4DAMA 1CRPA 2D3WA 1KAOA 1M1KC 1BMFD 2PT7A 3K0FA 1J5EQ 3OHMA 3OEED 4WBSA 3W6NA 2B8FA 1KAGA 2A6HD 1RRGA 2QMEA 2X8AA 1XRJA 1RVDA 3S1MH 1ZM7A 3VFDA 4EFMA 5KOYA 2IS1A 1YI2A 3HOVH 1X86B 5IWAL 2NO9A 1G3IA 4RZ2A 3E2IA 5M3MG 4QQBX 1BIFA 2BH8A 2OQ0A 1Z2AA 3GJ5A 4MGZR 4CEJB 1IJFA 1Z6AA 3CF0A 4B43A 1IN8A 2R65A 2W6JA 2RHDA 3GLHE 4L8GA 3OAAA 1SXJA 3I8XA 4B76A 4DEYA 5F9FA 2E74C 5A35A 3A37A 1J7KA 1EFHA 5JRZA 1CEEA 3WMGA 5FPSA 4Q7MB 2ZM6L 3PITA 4B3SL 2ZRAA 4NONA 1EUJA 1KI7A 3GJXC 1TWCH 3RYTC 1H9MA 3UANA 4APVA 3W8NA 3K70D 2FSHA 4V03A 3BGWA 1YZKA 5LD2B 4GNXC 4D2IA 4A9AA 5TB5A 1VQAA 1TPZA 2PJZA 3L2PA 2QP9X 1VG9B 2UUAQ 5FLXc 3HOXH 3IUYA 3LLMA 4DV3L 4V0MA 1E22A 1E0KA 4LV8B 2VP6A 4MTNA 2J0VA 4ACAA 3REFA 4V0ME 1W46A 1MRNA 1ZIPA 4TL9A 2A19A 3HR7A 3OEHD 2KA7A 1E9FA 2IF0A 4GT1A 3K0SA 3SJCA 2KCTA 3FWYA 3KJPA 2UXCQ 3R8CA 2QTFA 1XMOL 3CH4B 3F5FA 5GADl 1R0YA 4LWCA 1Y3AA 1UBFA 2PCFB 4X6AH 2PT5A 1H9RA 3SN6A 4Q1DA 3GLGE 3RS7A 2JA5H 2QM8A 1R5BA 4B71A 3BB3A 1IW7C 4OQMA 2CW0C 3P4XA 2KHIA 1I4TD 3OW7A 2UUCL 3U4ZA 4EPTA 4A3JH 3IIJA 4TMKA 4A3EH 1G5TA 4AWXA 2QSZA 4LHZA 5AJWA 2H1LA 2QAGC 1AZTA 1NL3A 3PG5A 4P4SB 2F1MA 2BEJA 1KL9A 3CZPA 1PVOA 2A68C 3DL0A 3ZS8A 2GF9A 2Z0MA 1E2IA 1G17A 2N78A 4TYPA 4LYJA 3U44A 2ZRIA 1NLFA 3ADKA 3OW2A 1M74A 3TK1A 1TWGH 1N33L 2FZ4A 2V4ZA 3PVSA 1VQCA 4DPGA 1AK2A 3TH5A 4Q1CA 2Y0SE 3CC4A 1FYCA 1KD1C 1DAFA 1P61B 2WAYA 3LXXA 3P32A 5IE8A 2VSXA 4RD1A 2IYRA 1U8ZA 1P5ZB 4UNSA 5M5YH 4BRUA 3DZ8A 4LV5B 4AG6A 2JLYA 2GJKA 5CB8A 1F48A 2Z0SA 3IILA 1Y1VH 1C0AA 2J46A 4OWTB 2AHOB 4NBSA 1F60A 2QPOA 1OFUX 4U02A 4II7A 3A74A 1BVSA 1QZHA 2QQ0A 3J81j 3VKWA 4MDEA 4KSBA 3ULJA 1W0JD 4DR5Q 2QAGA 3R9XA 1IOZA 3CCSA 3WMFA 4LX0A 1XF9A 4Q9LA 2NVXH 1CIPA 1CXZA 1R7RA 4BA1I 3GFTA 1CKOA 2CKZB 1YZNA 2WBLC 4TSFD 2KBNA 1XMOQ 3BRWD 3W6OA 1I4DD 2VF8A 4B32A 3PIOA 1YQTA 5A0FA 1YJ5A 2W2TA 4EPWA 2P6RA 2B21A 4DNRB 1OJLA 4C0KA 5L8VA 2UXDQ 2XXAB 1HT2E 4TMVA 1DD2A 4JYAL 5AUQA 3R9IA 2V54A 3TW4A 1UBGA 4HDQB 1VIYA 2B63G 1LTLA 1TU2B 4HLCA 3UG6A 4MA4A 4O3MA 2L15A 3U7EB 3VMFA 1S0UA 5CLLA 3T56B 2C04A 2FJUA 2J7PD 2QT1A 2JA6H 2VS1A 2VP2A 1G7TA 8OHMA 4JJKA 3BE4A 4GZLA 5HR5A 2RCNA 1QHGA 1SXJE 4JBMA 4G1UC 2W0SA 3DLLA 2WWWA 4TL8A 2VL7A 1EOVA 5BR8Q 4M9QA 1JJ2A 1UKVY 3NHBA 5L3RA 4QL5A 3PR1A 1YZ6A 4BY7H 3AH8A 4ZPXA 2Q2TA 1KDRA 2A6ED 2OBLA 4NU0A 3UDGA 2XJ4A 1W36D 1R8SA 5FUYA 4V0LA 3G82C 4UXHA 4ZI2A 1JJVA 2X2FA 4IJHA 4JI8L 3FDIA 1RW4A 2IYWA 5DI3B 4P74A 3TGPA 4LF6L 1N6IA 1Q86C 1TEXA 1HE8B 2Q2HA 5GQOA 4POFA 3HU2A 3AVQA 3CB4A 3LRPA 1K0RA 4PPNA 4M22A 1GNQA 1TX4B 2NZ8A 3QEJA 2H5EA 2UUAL 4NCIA 4A8JB 3BU2A 4G7HC 1S72A 2FN4A 4IHQA 2OSBA 5E7JA 5FTMA 4B3CA 4A3MG 1RZ3A 1U8YA 3WXMA 1VCNA 2A5DA 1Z7TA 4I1UA 3BERA 5AJ3L 1IW7D 1KSHA 2A3RA 1QZGA 4Q48A 3D3QA 4AYTA 2Q6TA 3AVTA 4LJ7A 1ZD9A 2FF7A 2BV3A 3OYYA 3P4YA 1UBCA 3SYNA 1W4CA 1K6MA 3W1BA 5IK2D 5FJ8H 2FGKA 1K8MA 2QBYA 1AGRA 2XTZA 4B33A 5K36G 4BFUA 2WWGA 4XTRA 2PMZE 1CKMA 1J2JA 4X65Q 2GKSA 3MRSA 4OL0A 5E7IA 5IRCD 2ZU0C 3V4FA 5KO2A 1I5FA 4D25A 3NC0C 1GUSA 2HHHL 4IW3B 1ZJ6A 1VQ6A 1NBMA 2BVNA 2DHRA 5DYIA 2N49A 4KU4A 3I92A 3KZ1E 1DS6A 4OGQC 3QJYA 4KHPQ 4JVMA 4JBYA 3CRQA 3CRVA 2YC2C 3I8SA 4OONA 4HAUA 2FFAA 2BDTA 4LF9Q 3I4LA 4AYBG 2EFDB 3B85A 3C41J 2DB3A 3BFKA 4JL5A 1VQDA 2ZTDA 2O5IC 1IN5A 2A8VA 1Z22A 3CO5A 2WJGA 3H4MA 5CYOA 4AURA 5J47A 5LBIA 3RZDH 3GFOA 3BDOA 2IUUA 4AQYQ 1Q46A 1AA9A 1JAIA 4CDGA 5GAHC 1AIPA 4MGIR 4A92A 5LMNL 4A3BG 1GRQA 4A6XA 4LJZC 2ZYTX 4EAQA 1NMGA 1NIJA 4DCTA 4AIIA 1I6VC 2ZREA 5JEAJ 2KBEA 2WKQA 1XU4A 1K9MC 3T61A 3FMIA 1ODFA 4HDOB 4UXJA 2E2JH 1A5TA 4NXNQ 3V9PA 2IWRA 1UE5A 1COWD 1HH4A 1SKYE 3QBVA 1HZBA 3RWOA 2G0TA 1Q7YC 4QJ5A 4PAQA 4UNQA 4C4PA 2JJ1D 2I1VB 1DAEA 2Q8IB 4M4SA 4OXPA 1P73A 2FWRA 2R92H 1GHKA 2VPPA 3U7HB 3CQZH 1SN8A 2FEMA 3GEHA 5JS8A 1Z2CA 4Q4HA 2ZRCA 3KQNA 4Q4JA 1IY2A 4JLNA 4DIEA 4A2WA 4QY7A 1NJFA 3CNNA 2OHFA 3DPUA 4LF5L 3PFIA 3CPWA 4JLOA 4DCUA 2REXB 1N5LA 4PHGA 2VSOA 1FUKA 2HYIC 4TWZA 4O2DA 4A4DA 3GJ6A 5KSOA 1TF5A 2DYKA 3JVUA 4OKSA 1SVMA 1YR6A 4B3SQ 2D7CA 2C35B 3NHAA 4JI4L 4XWOA 2NPFA 1GDDA 2BOVA 1ZM4A 4L15A 5ELOA 2B6HA 1S4QA 2BMDA 3PUZA 3SFVA 5KPDA 2QTHA 1IYVA 4HJ8A 3AVOA 3GJ7A 4LHXA 1Y63A 1P62B 5FPKA 4IPCA 1RRFA 4LF7Q 1OH5A 1DG3A 1EIYB 5KSZA 4NYIR 1U9IC 2REOA 2FA9A 3THXB 1Y8NB 4I7ZC 3EIHA 3C14C 3K09C 1EXMA 3RWMB 3GLGB 4HYYA 3H0GH 1SFOH 4IVQA 5K8UA 3N6RA 3OIVA 1S3GA 4WJ4A 3Q7PA 3G71A 1ZU5A 2VF7A 5JSZB 2WB1E 2GESA 3ERSX 3K7UC 5C2JB 4LFAQ 3RRMA 2OFXA 1PUIA 1TQ2A 1RJ9A 4BUJA 5FR2A 1VQ4A 2ZSBA 4A0RA 4BXXH 2ERYA 1TU3A 3LQQA 2G9NA 1L1OC 1Z0AA 3RS3A 1VDZA 3QVVA 2Z43A 5G53C 1XB2A 2FEOA 2CXXA 2O0JA 1XCPA 3OAAD 1HQCA 3F0TA 1MJCA 3LV8A 2VP5A 2XTIA 2ZUCA 3THYB 1HR0W 1ZUIA 2ZJ2A 2VZAA 2PEZA 4M1MA 4UP8A 1FX0A 2PEYA 1XTQA 4XTCS 1EIFA 3IQXA 4I99A 1KI4A 3QXHA 2FDCA 4BY1H 1Z6GA 2UXDL 5CIQA 1SVLA 1GUOA 2XNDD 3BOSA 4GKKL 4B6FA 1E1TA 2XTNA 2WHXA 3FMOB 1OTCA 3GTJH 3KDSE 4OJQA 2EU8A 3QKSB 4URWR 1KYIA 2BM1A 1OXXK 2J59A 1GHJA 4YDHB 1US8A 4CRWB 3EPLA 2VQSA 4ZKDA 2WWIA 2E8GA 1ZINA 4C2MH 4GOJA 4M1WA 4QGFA 4MDFA 4JI1L 3BS4A 3GCGA 1I3QH 5C3EG 4I1OA 5FOUA 4PHFA 3GPLA 2O8DA 4IFEA 1JNYA 4NZYA 3DM9B 3TLXA 3UMFA 1E1OA 3KF6A 3OOCA 2I5LX 2V6JA 1II9A 2Z4SA 2QEXA 3KKNA 1L2TA 4Q9JA 5EE9A 1HURA 4NDZA 4C0QC 2YWGA 5JJIA 3AQQA 4C9BA 3EPKA 2GAAA 4GOKA 1JAHA 1RKBA 3EW9A 2WJYA 4AYXA 1B9MA 3A4MA 3TBKA 1Q21A 4L5TA 1H8HA 3K81C 4AIMA 1BOFA 1ZC4A 4DK0A 2OBNA 2AFIE 2VO1A 4IVPA 4LPSA 1F2TA 1BO6A 4TLCA 2VY3A 3U2QA 3JC66 2FOLA 5DN6D 4YCVA 3FKIG 1I94Q 1TEVA 3BIFA 3NVAA 4BY7G 4M8NE 2ZJBA 1D2NA 2C9OA 4IJMA 1SXJB 4LOAA 3U61B 3BORA 1CUKA 4BLQA 2QBYB 4DR7Q 1NY6A 3FHWA 2JGNA 1P60A 4Q1BA 2IY5B 2R7ZG 4DLZA 3D7MA 1Q22A 4QHYA 2ZEJA 3O47A 3BK7A 4BRWA 5GVRA 4GL2A 3MUFA 2PI2E 2D4HA 3MXNB 2GCOA 4CEIB 4V0OA 2NIPA 3MLEA 2JEOA 2XOKD 2DWOA 3X1DA 1KMHB 3AP2A 1V8QA 4EFNA 2CNWD 2EVWX 1LS1A 1HTPA 1T0JB 4JVLA 3FTQA 2OG2A 2WZQA 2X1VA 1DOAA 4JLJA 4MUAA 1NN3A 2LKDA 4HI0E 3TMKA 1OH6A 2EFGA 3BZKA 1YJWA 4P31A 3CWZA 1MT0A 2QGQA 1HNZL 3AF2A 4LJ4A 3RNLA 4A2PA 3UE0A 3NKVA 3TQFA 4BFVA 4PZ7A 1IYJB 3CUEF 4V02A 1OH8A 2AHOA 2CLSA 1VQKA 2P5TB 2QZ4A 2IUTA 4JYAQ 4DR2Q 4KVAA 4NXMQ 1T9HA 3A0JA 1RYHA 2FH5B 2ZRMA 3W6PA 3GLIE 1JJ7A 3W5JA 5IP7H 2BJVA 2VQFQ 1F6BA 5EP2A 5JRJA 1OF1A 3UWOA 4JI0Q 3T5DA 5IHPA 5HCIA 2PJRA 1UJ2A 2DFTA 2FMXA 5J40A 4K81B 2J7KA 4DCNA 4G5GA 2MSEB 2EFHB 1YZUA 1HH2P 1KOFA 2EIFA 2OM2A 4LZZA 4MRSA 4B3MQ 1J99A 4AD8A 1SE8A 1CULC 1SXJC 3DZDA 1Z8FA 5G3ZA 5K8TA 1M1YE 4MRRA 3KQKA 4ARZB 3LBNA 4UQOA 3IO3A 3RABA 4DCVA 5L3QA 1TTTA 5IWAQ 5KNCA 3I5YA 4NTZA 5EP4A 4F92B 3JZAA 4GNXA 1EQQA 3RZOH 1QVRA 4TLDA 1XCMA 1KNXA 5C4JH 1UFQA 2A78A 5L3QB 4QBFA 2YOGA 1CR4A 1JR3A 3BC1A 2A69C 2HLDD 5HKKD 5CDFE 2ZJYA 5DYGA 4DKXA 5JHHB 3K0FB 5KNBA 4CT5A 4UP9A 4C0SA 4ZKEA 1E2PA 4KMUC 1QUQA 1XEXB 4JLDA 1N0WA 4L5QA 4RG1A 4OK6A 2J5XA 2WM9B 4RKEA 2BHRA 2PQAB 2C5LA 5GROA 1OHHD 2WOJA 3JZMA 2IXEA 3KDFA 3SR0A 4W5WA 4A3DG 4F93B 1N25A 4BLRA 4D0GA 1L0WA 3W3ZB 3PEUA 5KDOA 2BMFA 1PH9A 1KI9A 1CS4C 5FPTA 1E6CA 5KSPA 3BH0A 1YEZA 2PZFA 4KHZA 4A76A 2FZLA 2P2LA 2K5UA 3CWQA 5FLMG 1SVKA 2EWWA 4TQ9A 3TR0A 4ZDIA 4NXML 1P6XA 1IBKQ 1N0VC 4XSGA 5FOSA 3T1OA 3GLGA 3AGPA 4HB4A 4KLZA 1PYBA 1UADA 2GA8A 1NVXQ 4C3IH 4AH6A 3PXGA 3KKPA 4Y0AA 3E9HA 4WOPA 2JE6I 1D2EA 2IYUA 4LBVA 2O0KA 2UKDA 4ON9A 2UXCL 1QUQB 4XWAA 4EIWA 5JCPA 3HR8A 4R2HA 5KU1A 5BQ5A 1AQUA 1JMCA 3CPJB 1NMXA 1QHXA 5IY0A 1L1OB 4KBFA 4X66Q 2RMKA 1H95A 4FWIB 3R7WA 3TUIC 4FCWA 1FR3A 3EIVA 1QVCA 1HQMC 4IXMA 3LA6A 4GMDA 4YWLA 1WRBA 3EASA 4H1UA 4OI0A 1CR2A 3HOUG 3PO3H 4Z54A 3QG5A 1E32A 3E1SA 4KAXA 4RCZA 4TTQA 1VQ9A 4UNPA 5CDFA 4DXAA 5AUOB 1HCZA 1XWIA 4YONB 5FJ8G 1LB1B 4A3GG 1UWVA 1U0LA 1R5OA 2GBLA 2XSZA 4ARZA 4GP7A 4RFVA 5F98A 1I50H 2QMUA 1WYDA 1VYVA 2PI2A 1LUZA 3BZCA 1E9RA 2Q9BA 2W2VA 2ZUBA 4PZZA 5FOVA 3PEYA 2HT6A 2FSIA 3CF6R 3QF4B 3K9GA 2ZT9C 1SROA 1N5KA 2GZAA 2IT1A 1Z08A 5KDDA 2RGBA 4ME3A 2RGDA 1WXQA 5JEAG 5HZKA 3VU9A 2J0QA 2Y8EA 4OQFA 1V43A 1TQ4A 2NN6H 4Q4LA 4GRAA 3A8JE 2FX3A 4RZUA 1EWRA 3TQYA 4Q5IA 4JI7L 5KSYA 4MQBA 3HU1A 4BEBA 4EPXA 2ZI6A 4IFDJ 3SS8A 4FMCF 1GVNB 2IYQA 3L43A 3PO2H 3U3OA 1QHYA 3PEWA 1YHBA 2OLKA 4DR3Q 1YR7A 2QEQA 2WAQE 4LWZA 4BPBA 3IKJA 4QC2A 2YZ2A 3CKLA 4WA7A 4CW7A 1Q0UA 1NBME 2AWNA 1VQ7A 1Q1QA 3T1YL 1P9WA 4TQUS 1ONBA 1EX6A 4O2RA 4IFBA 3EIQA 3W34A 5M5XH 4G01B 4RD3A 3BH7A 4ESVA 3A58B 1NVVQ 5GJCA 4ZDJA 2DWPA 3D31A 1DEKA 1XTIA 4DLTA 1AN0A 4FW9A 3L7ZC 1E79D 2AR7A 1HQYE 3CRW1 1ZAKA 2WPDA 2GF0A 1XMIA 5B30A 4F4CA 5J5CA 4KN4C 3REGA 2ZI3A 2SHKA 2QNRA 2AUKA 2WFWA 1YNJC 2VTKA 1N36L 2EFCB 3VR1A 4DSTA 4DV0Q 3AB3A 1KO4A 2ZJAA 4G3XA 4G5RA 5D3MB 4EJSC 4IPDA 2IF2A 3THOA 1DARA 4LNQA 2E75C 4FN5A 1S1CA 3AKEA 2ZJ5A 4YY3Q 1W47A 3L0IB 3V00A 3M4YA 4DV1L 4A3IH 3MWLA 1TU4A 2D2EA 3FVQA 2IS4A 1EFRA 5GJBA 3LXRA 1Z07A 1GKYA 2K33A 4BZQA 4TL6A 2ZRGA 3LX8A 2N46A 3QXSA 1TADA 3TNFA 1IAQA 5AK0A 4TLEA 3ICEA 121PA 3CRLC 3R9WA 5IP9G 1R8QA 3LWNA 1E2EA 1W2HA 1FVIA 2Z5FA 3M85A 2RGNA 3UE1A 2QSYA 2ZVPX 1P4SA 2AD1A 4DV2L 2H18A 4KSCA 1CP2A 4JV5L 3OTOL 2DR3A 1SULA 3QF7A 4Q00A 2D7DA 2UU9L 2CFMA 4B2PA 1NSFA 3RHFA 1N32Q 1PH3A 4LF7L 1DO2A 1GSIA 1A4RA 2VUMH 1O87A 2ZJ8A 3LD9A 4A3IG 5EE3A 1COWA 1OW3B 1X8KA 2ZYVX 5JHGB 4C2TA 3W9YA 1RRPA 3H94A 4JK1C 3AFQA 4JI4Q 5CK4A 3VDYA 3N2EA 2W6ID 4V0NA 1Z63A 3LLUA 1KJYA 3QENA 5K8IA 2R62A 2VQEQ 3B5JA 3I4OA 2WAXA 5BYKA 1X9NA 1S9DA 4D6PA 4BZPA 2XNSA 2QROA 2IEZA 2Q9CA 2IYZA 4BFZA 4A8JC 2V1XA 1EFRD 3VQTA 3QXXA 2WV9A 1GUGA 4OWWB 1V1QA 1GILA 1E1QA 2JLVA 2WMNB 2VIIA 1PV4A 4HR7B 1KSGA 1M8PA 1G8HA 4X8HA 1ZD1A 2KSQA 2ZRJA 3CCRA 1RJ9B 1UF9A 4WZBE 1XTJA 4RMFA 1ONLA 1LF0A 2OBMA 3AVYA 3ND8A 2W00A 5H70A 3TSWA 2CVFA 4XVRA 5F9HA 2AWOA 1P2UA 5FBVB 3U3RA 1CI3M 3VAAA 4HIKA 2K50A 1W5TA 4NE2A 4R71A 4Z1MA 3B1YA 3SI7A 2ZJQA 1LF5A 4CF7A 3OZXA 3GLFA 3VNUA 4KFTA 1XNQL 4PZ6A 4WJ3M 4JV5Q 3TZUA 2WWXA 5BN5A 2D0PA 3CPFA 4MNOA 4DV2Q 4KKTA 3FHCB 1EX7A 4KCGA 4PANA 5BWMA 3I62A 2J87A 3BWDD 3ICQB 4A4IA 1TQ6A 1CJMA 4MUBA 2AKYA 2CLCX 3U5ZB 4B3BA 1HYQA 1Q82C 3GTGH 3HWSA 1E4YA 1JQJC 4LRWA 4I1SA 4HLUA 4TQAA 2IHBA 1YE8A 4Y7NH 1W49A 2XZPA 4DR4L 1X8JA 2VHTA 3THYA 1MV5A 3B1WA 4Z51A 3CONA 4Q4AA 2ZUDA 1UM8A 3CCJA 2JATA 2LSSA 5D3QA 5UKDA 3SU8A 4YCWA 2NTYC 2H7VA 4JCVE 1JJGA 2KCCA 2OXRA 2YC4C 3CW2C 2P6NA 1EESA 1VIAA 4EFLA 3J81k 1T3SA 2VP0A 3KJIA 3DOFA 4KI0A 3VTKA 3QXCA 5FTNA 5DISB 2LXJA 2GEDA 1N36Q 4NYMR 2RGEA 1ZU4A 1FMLA 1HA3A 2R7FA 1R0XA 1XMVA 5JFGA 1D9ZA 1KI6B 4P4SA 1A82A 1K8OA 5TXGA 2E2IH 1X1RA 3M1IA 3ULLA 3MWKA 3QQ5A 3LY5A 2NO7A 2XITA 2CL0X 5SZHB 3X1ZA 2JJ2A 2VSFA 3SYLA 1P8LA 1KK0A 1OE0A 3BFVA 3CPHA 3OEEA 3B9QA 3EZ2A 3PSIA 3K9HA 1U81A 3BBPA 4HB0A 2EYUA 1XMQL 4RKFA 4P3YA 1YR9A 4GKKQ 1IXRC 5H8WA 3C5HA 4M9XA 4HUTA 1W5SA 2OCPA 4PMWA 2B8TA 3FGNA 1H9KA 2AK3A 3EPHA 4IOKA 5LB4A 1G21E 2BH2A 1A63A 1XTRA 2P0EA 3QOFA 3T1VA 1L4UA 2JJQA 4D4KA 1BBUA 1PH7A 3AP3A 3TSOA 4HSEA 4XOIA 1P75A 4X64Q 2WB1G 4LFBL 1XZQA 1E1RA 4A93G 3RAPR 4JJZA 1IONA 3GTMH 2ZAMA 4YMVA 2QAGB 4UPAA 1VQIA 4CT4B 1AS0A 2W83A 2B92A 1BS1A 2RGCA 4D81A 5JWRA 3KKQA 1N6KA 1GZSA 2ZS8A 4I1VA 2PZGA 1XXHB 2QGNA 1E98A 2ZR0A 4EPYA 2JLZA 3EWSA 2BE5D 3VKHA 4GOPC 4QJFA 1E2ZA 4Q66C 1KDTA 4FD2A 1BDOA 2F9MA 1VS0A 4BZXA 4Z1MD 1AS3A 1Q1EA 2VBCA 3DM3A 3A7LA 1RIFA 1II0A 4FMCB 4B2IA 3B8HA 3IIMA 2I1QA 4UNRA 1YR8A 3CX8A 3B1ZA 1M2OB 4DIDA 3NBHB 4OK5A 1W2BA 2HEIA 1VQFA 2CL6X 3KTAA 4DLVA 5DHFA 2KCMA 4ZI3A 3CC2A 4HAXA 1NTGA 2W0MA 3Q8DA 3C16C 3NH6A 4Y0VA 2WIAA 2O8CB 5M3FH 2Z83A 1D8TA 3LVRE 5C0XG 3NEJA 4PPQA 1SHZA 2D2FA 2CCJA 1K8GA 1GKHA 3FKSD 1IBMQ 1ZD8A 4LJ8A 2CNWA 4HJ5A 1XEWY 3K0AA 5DN6A 2PX3A 5DO9A 2IWHA 4DUZL 3I4NH 1TL7C 2GZDA 1OB5A 1S3OA 4L9SA 2RB4A 4PPFA 3HOXG 4ZIRA 3UPUA 2GVDC 4I81A 1KQSA 4JOIC 4PTLA 4BFSA 4QJ3A 3LVQE 3CMAA 2GN5A 4B2LA 3NENA 1VQOA 1IYUA 3B13B 2I5HA 2JASA 1SR3A 4DK3C 1KIMA 1LS6A 2WJIA 4QRHA 4R2IA 4QM6A 1D9XA 2D5DA 1NMZA 5F2EA 4BBSG 3PGZA 3I56A 1QZXA 1T3LA 2YOHA 2F3RA 3IEVA 1SMXA 1I4LD 2ZRDA 3HU3A 3STBD 1N5IA 4JI5Q 4DT1B 1C7YA 1NJGA 4XD7D 5FUXA 2CHVA 3QUSA 5TY0A 3K0CC 1CRQA 3PCOB 2A5YB 2EWVA 3NDPA 4NCJA 4DR7L 2UUBQ 3SNHA 4EQ5A 2BEKA 4ESHA 1SGWA 5JS7A 1IXZA 4U5XA 1VQEA 4Q4HB 5GAGC 2K5VA 2IA5A 1OYYA 3EN2A 1MOZA 3NDBB 1Q90A 2YJTD 4LK2A 4MYHA 1E2MA 3TJZA 3A4NA 4DLRA 1AZSC 4L16A 3QPUA 1XD2B 3WWVA 2F1RA 3EAQA 3OTOQ 5JJLA 1ELOA 3I4MG 2G83A 5DLQC 4FINA 3NH9A 5BN3A 1B70B 1Z0FA 3LDAA 3CNOA 4LGMA 1QHIA 5LMNQ 2G6BA 3SE0A 1NG1A 1KKMA 2G1KA 2GNOA 3IBYA 4U00A 3ZIAA 4X62Q 1KMHA 2UZ3A 3H84A 2C8VA 3IEUA 3PUWA 3UATA 1WBBA 4HDCA 1IHUA 2O8EA 5C4MA 2BCJQ 3GJ4A 4TTRA 1NF3A 3LH5A 4TYWA 4NPHA 2GEVA 3LAWA 4IDHA 4C30A 4A3MH 3K9NA 4QGGA 2CJWA 4QG7A 3AKCA 4DK6C 4IQZA 1ZNXA 3DKVA 1E1QD 1SXJD 3SDZA 1Z83A 1GUTA 2B63H 2A2ZA 4JLMA 3WP0A 2IX3A 2WVJA 1E9SA 1BYIA 3B82A 2J41A 4JI1Q 1N6OA 3HP1A 3NEMA 1G8FA 3GTPH 2QP4A 1G6OA 3HJNA 1IXSB 3QNUA 1EK0A 1VTKA 4TL7A 4X65L 1ZW6A 4P4UA 3RANA 4NCKA 1G8PA 2W2XA 2MQHA 4YXWA 3VKGA 4NYJQ 3EARA 4Q21A 1KZGB 1T4GA 1N34L 3J81i 1L4YA 2FFBA 2R7DA 3IDQA 3Q7QA 3PIPA 4ERNA 1E2LA 1K8RA 5DI9A 2WOOA 2P65A 3Q72A 5BYJA 1R10A 2H8KA 4LK1C 1JECA 4JMPA 2QORA 5IDVA 4AC9A 2ZS9A 3SC3A 1XPUA 2DNEA 2K75A 2NN6I 5IYDG 4H02A 3VR5A 2OXCA 5H1SE 2GXQA 5CK5A 5G41A 1ZNWA 4WXPA 5KDLA 1Z5ZA 1E1RD 2V1CC 2E2HH 4A3JG 3T1YQ 1B0UA 2KB0A 3LNNA 3T06B 4OO1H 1EWQA 1GRNA 1AKYA 4QHTA 2K5HA 1E0JA 2FFQA 2Q21A 4P4TA 3KJHA 4OWXB 4TYYA 5C44G 1VQMA 3QPVA 4URUR 4BFTA 4TMTA 1PFSA 2DBYA 3LFUA 1CSPA 3QKSA 4KO8A 4NYIQ 2VL6A 5E3HA 1M34E 2HV8A 3DOEA 4DC9A 3CF5A 4JS0A 1J5EL 1UE1A 4R1JA 1G1MA 1DBSA 2W58A 5M04A 2CCGA 4GLVB 4C0HA 4E09A 2NN6G 2P3SA 3NE5B 1E9AA 3PQCA 4HLQB 4ASUD 2Z6KC 2WSSD 3TS2A 3X1WA 2F4VL 5JZVA 2XB2A 2J0UA 3ZVRA 4POAA 5EJEA 1N2CE 3KQLA 2OQKA 2E1RA 2CHGA 2ZROA 4GKJL 4OHZA 4LBZA 2IX0A 2A5FA 3UIEA 2O8BA 1KI8A 5CITA 3CAMA 3A8TA 3GEIA 1Z29A 4D4JA 1S96A 4TMWA 2N8NA 1XPOA 4B6EA 1W1WA 4EQ6A 2GWHA 4LI0A 4D4LA 2AX4A 4D82A 2J1LA 1Z28A 3TUZC 2D06A 1SRUA 3M7NA 5FPYA 4L5SA 1N6NA 2YYZA 2PLRA 4PQRA 4BLOA 2ZI5A 3CM0A 5C0XI 5M3MH 4L5RC 4X66L 2IS6A 4IRUB 1G7CA 2GBLC 1QVGA 4M9SA 4HJ7A 4PV1C 1LNZA 1RE0A 1ZBDA 1ZC3A 2NGRA 1M6NA 2GAOA 4B48A 2AMCB 1ZYRC 3P20A 3EWAA 1R0WA 4DB2A 4YY3L 1XJVA 5KNDA 3CX7A 4EJSB 4YXWD 1H8HD 3WHKA 2IK8A 4BBRG 2LXKA 1ZM3A 2AUJD 1AH9A 2UZIR 5J4YA 5FL7A 3I5XA 3LW7A 2NVQH 3EZFA 3AVPA 1KJWA 2FE4A 4US0R 1XPRA 3ULPA 3SZRA 1UEJA 3H0GG 1TUEA 1E99A 2ZQ5A 2Q3MA 4HEJA 3A8IE 4KODA 3MFYA 2PNRC 3RVBA 1E9EA 4A3KH 2I3BA 1U98A 1NBWA 4RD2A 2H16A 1XJQA 4LJAA 5EZ5A 3WYFA 4JI3L 1KK1A 2IYYA 4A75A 5EUQB 1U2RA 2ODEA 4BE7B 3HOVG 3D4RA 2WWYA 1VQNA 4XWKA 2GXAA 1X3EA 5EUMA 3K0XA 1TWFH 4R98A 5IYBH 1HPCA 3GTKH 2C03A 4CZ2A 3Q3JB 1I2DA 2HF8A 2V6IA 4DR6L 5GVSA 2ATVA 4JVNA 1S1MA 1TF7A 5IK2A 3TW8B 1N33Q 1KNQA 2LWIA 1UBEA 2GK7A 2OESA 2QMOA 2REBA 2GJAA 2TMKA 1X65A 2Z4RA 2ZRPA 5AJZA 4DRZA 3AKDA 1G6PA 1YZLA 5HY6A 2BM0A 2ZPTX 4S35A 1AE3A 1SVOA 1XTKA 2OFWA 2QA4A 4RJLA 4DSUA 3R7WB 4DV7Q 4C0LA 5GADC 3VHXA 3S2HH 1R4AA 3A1UA 2AKWB 3MCAA 3U44B 2R6FA 3HOUH 3PO3G 1G64A 1WCMH 2F3IA 3KKOA 2JLWA 2O8DB 5LDDC 3Q5DA 1Z9FA 1KY3A 1U90A 3AGQA 4B3TQ 2BBSA 5FBRB 1YRAA 1F3OA 3CR7A 4DWJA 4DNIA 5KPJA 1CJUC 1X54A 3P27A 3ZH9B 4QNRA 4KITB 3U7GA 1XXHE 3I3SR 2Q3FA 4WZAE 1IY0A 3OIUA 4B3ML 1VKJA 1KHIA 4W5JA 1KXLA 1NNEA 1E4VA 4C0AC 3W90A 3LWUA 2ZRBA 1JJCB 2ONJA 4AYBE 4LW1A 3J7A5 1KI1A 3TRZA 5TARA 3CCMA 1LTQA 5FBLB 4XVUA 2DN8A 4AYWA 4DUZQ 3P26A 3IHLA 2BA1A 2WP8J 3RS5A 3WRYC 1LACA 4WIAA 1FX0B 3WMEA 3CCVA 1IBML 4FIDA 2ZRNA 2CK3D 4H9GA 3NTUA 1N9WA 4URZR 1NE3A 3CMEA 4MYCA 1G18A 2CWAA 3WY9A 3CNLA 5CM9C 4QGHA 5E95A 4GSYA 5HE8A 3A1VA 1QDEA 1N8RC 1FJGL 4MGKR 3OIYA 2AXNA 1OXTA 3J81c 4NKRA 3NBZC 2Y0SG 3EPJA 2ZM6Q 1KO5A 4N1AA 3TR5A 1A2BA 2YV5A 1VCIA 2J7PA 4O2LA 1UE7A 3U9SA 1M7GA 1FTNA 2ECKA 3R20A 4OQXA 4Q7JB 5JI3E 3O8RA 5DSZA 1EFWA 3RS2A 3TKLA 1VCMA 2XNDA 2KHJA 2VHUA 4UNNA 1PUJA 4XVQA 3KYHC 2WWFA 1S2MA 2I5MX 2NZHA 1DAHA 2NMVA 2PMDA 5LPNA 2DNCA 3A4LA 4H1VA 2VW9A 2CMKA 5FTJA 3D6TB 1CTQA 1XNJA 3I73A 1FOEB 3EX7C 1NY5A 5H1YA 3UDIA 1QG4A 1YVDA 1XZPA 1CJTC 1T91A 1Z0JA 1OFHA 3I32A 4C7OB 4QFMA 1Q44A 1WF3A 2PZEA 1P2VA 1BBWA 1KO7A 5EAYA 4P73A 3B2EA 2R44A 4BGDA 3LX5A 3IPXA 1HUQA 5JEEA 3GP8A 1PH8A 2JA6G 1HY3A 2OFOA 4Q01A 4A0GA 5HGQA 1E0AA 1JR3E 4PO9A 4ZV4A 4QM7A 1AJEA 4LF9L 1PZNA 3PUVA 1H8ED 3H15A 4Q4AB 2A6HC 4I4LA 3C7KA 2RKOA 3O8BA 2G88A 3VR3A 1V5WA 1SVIA 4BEJA 1P16A 1NIPA 2QENA 2XOKA 1HNWL 4JLBA 3W5OA 1KZ7B 3BD9A 2YTXA 3MXUA 4A3BH 2AD5A 4Q1EA 3CC7A 1RFLA 4GLAC 3T1HL 3K70B 2C77A 2GEUA 3TS0A 1N6LA 3ZZ0A 4B3RL 4X8MA 1E0SA 3CH5A 1H9JA 5E7NA 4P32A 4IFDG 5J4LA 1MO5A 2OCAA 1E9DA 1G51A 4B74A 4LUOA 1GUAA 4IPGA 5DH9A 1JBKA 4LYAA 1GL7A 2XZLA 2PCJA 1W4AA 1UE6A 1FMJA 2WKPA 1NBMD 4FCVA 1JPJA 3S16H 1R6BX 4HAWA 4Q03A 2CE2X 2YWHA 4YWKA 3MJRA 2C2HA 4DV3Q 5A4JA 2ZSEA 4NHOA 2FSGA 4QBGB 4XJXA 1E3MA 1ETUA 3ASYA 4FMBB 2FFHA 4D0NA 3OPOA 2ERXA 421PA 1H65A 2ZANA 4D4MA 1II8A 1XD2A 2JA9A 1XMJA 1XTDA 2ZRFA 1PJRA 2KE5A 1N0UA 4JKIA 4IOAA 5AWFC 3CLVA 4QXAA 4URXR 3HDTA 3GO5A 1G6HA 4RZ3A 1Q57A 4MKHA 1XXHA 4YCUA 2QRNA 3RSOA 3QVUA 4CGZA 3BB4A 1E69A 3QY0A 1GP2A 4PHTA 2R7ZH 4B3TL 3S1QH 2PX0A 3B7GA 4GMXA 1GNPA 2WJJA 3THWA 1EQRA 5BR8L 5IYDH 2HUPA 1Y1VG 1BH2A 1IXRA 2HQLA 1JI0A 1CKEA 1CF4A 1KK2A 2HDNB 2WIBA 1E2WA 2D0OA 3P1JA 2H17A 4PX9A 5IYBG 2BDOA 4PC1A 4A0HA 4MKIA 4YWMA 4B3FX 4EUNA 4ZO4A 1YBYA 3B78A 4EJSA 4DB4A 2E9SA 4B75A 4OBEA 4HZIA 4OI4A 4TMXA 4B3XA 1QRAA 2MSCB 1VF7A 2AL7A 1AKEA 1XNRQ 4YC7A 3BJUA 5CYPA 5FBQB 5FFMA 4HAVA 2HCBA 1TWAH 4NP6A 4BFWA 4LUVA 1XMQQ 3RN2A 1PLJA 2C9CA 2NO1A 2XGTA 3KLRA 3ONWA 4KFUA 4DV4L 2A5JA 4DV5L 2J3EA 4F4JA 3AM1A 5C0XJ 4A3EG 5HPYB 2EVBA 1VG8A 2ANCA 4LBYA 3NBXX 4LHWA 1NVVR 3RN5A 4NB3A 3HYTA 3UMRA 5JJKA 1QHNA 1S9HA 5IYCH 4DR5L 3GJ0A 4CYMA 1U0HC 2VP4A 4M1KA 1G291 5LMNW 1GUNA 2JJ1A 2A68D 2QG6A 3NELA 4HB2A 4M1YA 2JLUA 4A3FH 1WMSA 1CKNA 1W48A 2VA8A 3SJZA 1OV4A 4KYUA 4WZ6A 3K9LA 4DAYB 4TN1A 5HTKA 2ORWA 3MG9A 4IDNA 3RLOA 3I7FA 3A1TA 3CIOA 3U4VA 4JSYA 4JIMA 4PZLA 5AJVB 3WBKA 1RC8A 4NXNL 1E3PA 3BG3A 2ES2A 1VG1A 4RVCA 3M3YH 4RZXA 4Z8YA 1TKWB 3HPRA 2C78A 2NPIA 5FPHA 2DCUA 5IYCG 1LABA 1II8B 3H2YA 1FW6A 1WCMG 4G7ZC 3CCLA 1RRCA 4DV1Q 4M1SA 1R0ZA 1W0KD 1A8VA 4UJ5A 5FH9A 3EBEA 3IRBA 1AS2A 4XIGS 4OI2A 5FOXA 3GLFB 2Q0HA 1TUIA 3RR5A 1GL9B 2BC9A 1YIJA 1HV8A 4XSHA 4RD6A 4LUCA 1P3JA 1RIPA 1SHKA 2BKEA 2KWIA 4C0JA 3FPPA 1FZQA 3C4JA 1HNXL 2O8EB 1UEBA 2UUCQ 3QI2A 5JEDA 2HLDA 5HKKA 3U3MA 1XP8A 3R8FA 3OIWA 1JPNA 1C1YA 2NVTH 1J8MF 4L4UA 4MKGA 2WICA 2VNUD 3E70C 1O78A 3E5HA 2CLDX 4PQYA 2MO0A 5IT5A 1YZTA 1CSQA 1H8EA 2W6IA 1A62A 4OX9Q 3LW8A 1PHJA 2OV2A 4JL6A 1XJCA 3NIBA 2NQ2C 2YWFA 3PV0A 2RHQB 1G20E 4DUGA 3IBGA 4JI5L 1RL2A 3RNUA 3T12A 2VHQA 4RFSB 4A6PA 4URVR 2JDID 1A1VA 1KC8C 2PCLA 3HOWH 2F55A 3ZVNA 2HJVA 4NPSA 2O52A 3S14H 4MKFA 1CKNB 1MKYA 4Q7KA 4GZYC 1ANKA 3TAHA 4BWYA 2PQAA 1YHNA 5GJWC 2A30A 3OEHA 2L0XA 1HZAA 4BBRH 3F2CA 4Q18A 4JI7Q 3HOZH 1T5LA 3PF4A 1ZP6A 4IVRA 2C9YA 1OB2A 3LO5A 4KLNA 2ASEA 4A36A 2QE7A 2PMKA 3GFPA 3LBIA 4KN7C 4LYFA 4YMSA 3MEFA 5AJ3Q 1OXVA 1GL6A 1YZQA 1YRBA 2CCZA 4YMWA 5EE1A 3KB1A 1WOCA 1VQHA 2N1BA 2BMEA 4Q1AA 4TVAB 1K5GA 1SVWA 4GDFA 4JVSB 1E2QA 2A7QA 3CW2A 3N2IA 4IKEA 4AKEA 4GOPB 4LDJA 2ZVQX 1Y1WH 2UU9Q 2IW3A 3KX2A 4OK3A 4U7DA 3ND9A 3CXCA 5H68A 1EFTA 1P2TA 4G5QA 4MYTA 3K0AB 2ONKA 2ZTSA 1ZRHA 2GZHA 3DEFA 4AY2A 1X8LA 1FP7A 2XSZD 2BJWA 2AK2A 1KO8A 2FNAA 4PSVA 2VRWA 3EC2A 5IP7G 3KTAB 4JYCA 2IHYA 2WPDD 4ABYA 4OHYA 1GO3E 1JXOA 3TREA 3KQHA 4QNMA 2YKGA 5EP3A 2JJ2D 2ZJPA 4DR6Q 2CCKA 3TSZA 1X3SA 3RRNA 1W7AA 3M4OH 4QJ4A 3CCUA 3ZIAD 4E03A 1KGDA 1OIXA 2QAJA 4JBJA 2DGYA 1U0JA 3BH6A 1ZUNB 4Q7LA 3PO2G 5M3FG 5AJYA 3U7FB 2J0SA 1KI2A 2WKRA 3Q9LA 3SHFA 2WJVA 4H0LC 5E4FA 2HIVA 1VQPA 3K09A 2IYXA 1IBKL 3QPWA 1FL0A 3U50C 1MJEA 2ANBA 2ZRLA 1G7RA 4KFSA 4O0MA 4P33A 5SZIA 2XX3A 2OCEA 3G6EA 1SKYB 2X77A 3ZGXA 1HT1E 5CB6A 2E5LL 2Z6KA 5SZKB 3LQRA 4M1TA 4AK9A 2ODWA 1G3QA 2F52A 3FMCA 2OTLA 2BCGY 3HFZB 2P67A 2KENA 1R5NA 1ZM2A 2KBFA 3GLIA 3T53B 2UUBL 1DCZA 4W5HA 3T1TA 1L1OA 3UWKA 2ZYWX 1IL2A 4DLWA 1E2HA 1MH1A 3S1AA 4YQFA 3AKYA 1DELA 2OEPA 4NYJR 4RCYA 4B3RQ 5FTLA 3CRRA 3MWJA 4B34A 1D8LA 3T1HQ 1XTSA 2OAP1 2GILA 2OE2A 3A1WA 3TVTA 1UDXA 3WNDA 3AVXA 1HNWQ 3QKRA 1Z6TA 4F38A 1A7JA 2EDGA 3SQXA 4Y52H 2K5NA 3NC1C 2I0QA 3A6PC 3AVUA 4X62L 1QVFA 2FPLA 1EYGA 4DV4Q 4DJTA 1V9PA 1X56A 2ZE5A 4C7OA 3QF4A 3G5UA 5J3BA 4PZ8A 4DK1A 1KTVA 1UPTA 1T5IA 3PENA 4HUQA 4DV6L 2CK3A 1TXYA 1HR0Q 2GJ9A 1IBLL 5BXQC 4QL3A 3ADDA 3G4SA 1FNNA 1G7SA 4BLSA 1CU1A 5D3MA 1BYUA 4GBMA 1E7ZA 3KUDA 4IFDH 4DLSA 5AUNB 4HB3A 2K4KA 4HJ9A 1DE0A 1ASZA 1JXMA 1DO0A 1OIVA 1D7QA 1NKTA 3PUXA 3B6EA 4BFXA 3M6AA 4GN4B 4BY1G 4G5SA 3RSLA 3KF6B 4AI6A 1MO4A 3NG1A 2RH5A 3GD7A 4DHEA 1XNQQ 3L0OA 3EQLC 2BMJA 2G3YA 3OFNA 2ORVA 5FL3A 3AB9A 5HE9A 1Y8OB 3F1ZA 1OPXA 1US8B 1OH7A 2IYSA 4ILEA 2N42A 1FUUA 2GETA 2IYLD 2XB4A 4D0LB 4IOLA 5FUWA 3WNBA 1XEWX 1EWHA 3TAUA 3GDEA 1KI6A 4R7ZA 4EPRA 5TMPA 3ZDQA 4O0AA 4JT2A 3G0HA 3NXSA 2OUKA 5ELXA 1CFMA 2AKAB 1FJGQ 4KJZA 1NN0A 3E9IA 3AEVA 1N6HA 3H86A 3HGBA 4JLPA 4ALPA 1IY1A 5AR1A 1M90C 2D62A 2WJHA 4GP6A 1G3MA 4A3CH 2I4IA 3KXIA 4K46A 1Q81C 2DPXA 4B35A 3THWB 5C4XH 4IDOA 4UP7A 2GJ8A 4PXAA 1E24A 4JI2Q 4QHSA 1JQLB 4WAUA 3JAMi 5C4GB 3WHLA 2WTUA 4D26A 3TQCA 3BFXA 4HIOA 2YOFA 3K8YA 2O5VA 4IOJA 3VA7A 3STBC 5HZHA 5K8LA 4A3FG 4M2LA 2EXDA 4QIWE 3QSYA 2QN6A 4JLVA 2GK6A 4LC0A 5AUPB 5FOTA 3KQUA 3N5CA 2BBTA 1YITA 4N0DA 1L7VC 4CEHB 4BBSH 3MGCA 5FI1B 5CIWA 1IQPA 3C15C 4ZIRB 2F3TA 5EXTA 1UKZA 2E76C 3FKSA 4A1FA 3W1GA 2BBOA 2JLQA 2LCFA 4MYUA 2RGGA 4DUGD 3S17H 1BKDR 1N6PA 2IHEA 4X64L 2JA8H 4LFBQ 4JLKA 1LYLA 4OQLA 2GCOB 2MFIA 3DMNA 5L3VA 4CEIA 3RC8A 1ZMXA 1ZNZA 2K52A 1UEIA 4M0LA 1QHSA 3SYKA 4LUZA 1DG1G 3AVVA 3J80c 5DI3A 3ADBA 4HLDA 3X1YA 1DAIA 1YHQA 4Z8XA 4LFCQ 1X6VA 4LF8Q 4EX5A 5LMUQ 1GAJA 2DFLA 3GJ8A 3L82B 2ZSAA 2OWOA 4EKDA 5B58C 1LY1A 4DT1A 4R4IA 2R9VA 4FI3C 2FGJA 4HAYA 4AG5A 1GG2A 3CBQA 1A0IA 3VX3A 3OFND 4XH9B 2J0UB 4NYMQ 1X1SA 1XEFA 2ZAOA 3NEYA 4DDWA 1N5JA 2V8OA 1S8FA 1K83H 3GLFE 4AKHA 2CL7X 2ZM5A 1HEIA 1XDBA 2ZJOA 3I72A 2V4DA 2ZI7A 1OFTA 4PAMA 2CE7A 1E79A 2X2EA 1JR6A 1IN7A 4G5OA 1ASYA 4WXRA 4L9WA 1G3UA 4FWTA 3F2BA 3EZ6A 2NO0A 4PAOA 4R4OA 2ASBA 1XFAA 3L0SA 3QEOA 1ZCAA 5TDHA 3W8RA 2JLXA 1VHLA 5TVKA 3CCQA 3WBJA 2PBRA 1Q3TA 1C9KA 3HOYH 2OTJA 4RY2A 1YJNA 3A7AB 2KI5A 4DDUA 1EFUA 4YLGA 4GLXA 3UXMA 1Q8KA 5FTKA 3WYAA 3L2OB 1Z47A 4EPVA 5FBWB 2FPMA 4UKDA 5C1BA 3ZVLA 2O5JC 1GOTA 2VUMG 4OYHA 2UXBL 3AF0A 2C96A 1K73C 1ZNYA 4RD4A 3Q8XB 2IXGA 4LFAL 1G16A 2QP3A 1X6OA 1E2KA 2A69D 4GNXB 3U3JA 1CR1A 3K53A 4Q9IA 5LD2C 1VCOA 3M4QA 1E2NA 4LHVA 4Q02A 1K8AC 4US1R 2B7CA 3CPEA 4DLYA 4TSFA 5DIFA 2Q2IA 2KJQA 4KVGA 5F3WB 1T8UA 1Q3HA 2OZEA 3CRMA 1VYTA 2ZSDA 3KXKA 4DCSA 3FHOA 2NZJA 4AKGA 1SLJA 4DR1L 4RD0A 1NLYA 4RFSA 2P5SA 2IXFA 4ACBA 2EYQA 4B44A 3O8CA 4Q47A 2CDNA 2XZOA 1AQYA 2AN9A 2VHCA 3KDFB 1LW7A 3KUCA 3FOZA 3AF1A 1MIUA 2IX1A 1E2VA 5IP9H 1T5EA 1G3RA 1K5DA 4US2R 3QE0A 1EWIA 1NY4A 3D0FA 1C4OA 1MRSA 1XMSA 4MGYR 5C0XH 4JI6L 1G4UR 4A82A 1W36C 4A3DH 3FE2A 4MZ9A 2GHIA 4IPHA 3SGIA 2V9PA 1UKEA 1KMQA 2QY9A 4IXNA 4OHWA 1W0JA 2BWJA 5TV2A 2VEDA 1R2QA 5L3SB 2JJ8A 1T3HA 3U6BA 1MABB 1N3BA 3FKQA 1VQBA 1NLZA 3U60B 1BKBA 4IFDI 1KHTA 3DHWC 4K8OA 5B2ZA 2ATWA 3THXA 3KL4A 3GJ3A 1IM2A 1S40A 4K0KL 3GQBA 1PYSB 4OHXA 5SZJA 1OKKD 3QG1A 3E0EA 4CEJA 1FFHA 1LFDB 3FP9A 1EG7A 1MABA 1JR3D 1XD9A 4JI3Q 3A5ZB 3DXJC 3FFAA 1F5NA 4KFRA 4BECA 2O8CA 1M7HA 1PH2A 4PO8A 1WCV1 4DV0L 4A3LH 2JEAI 1GFIA 3JVVA 3Q85A 2GRJA 3SQWA 1U8AA 3GLHA 1OLOA 3ZVMA 1LM0A 2E5LQ 3S1NH 1KDPA 2YWEA 2JA8G 1GIAA 4EQ6B 1VYUA 1N34Q 3MD0A 1WB9A 2F7SA 1IBRA 5G3YA 2O8BB 1Z6HA 2QRZA 3M0EA 3VNVA 1J90A 4XD7A 3HYRA 1KIXA 2BA0A 4B73A 4TMZA 3IHWA 2XGJA 1ESMA 2VH5R 3QIAA 3KOJA 4AQYL 3AV0B 2H5XA 2IYVA 3T34A 5LMUL 4UY8C 521PA 3H0KA 5JWHA 1AGPA 2JLRA 3IO5A 3GTQH 4NCNA 2YTYA 3J80i 4DR4Q 4EDHA 2QTVB 4JBKA 2R6AA 1O7LA 1X3FA 2QPTA 4PC3A 4J15A 2ZSFA 1K3RA 2YHSA 3TUJC 4TZ6A 4BASA 4R4QA 2MMCA 4DDVA 2WAQG 3FFBA 2OCBA 1B7YB 2WWHA 2IEYA 3FKIH 2CJWB 5P21A 3U6KA 3CF2A 1OKKA 4JI6Q 3KFVA 5FOWA 3G48A 2ODBA 2HIXA 1KRSA 1KAWA 3F2DA 2RGXA 2HF9A 4L5BA 4PR0A 5BW8A 4IEEA 2E87A 3PF5A 1GWNA 3TIFA 4DZZA 3H3VI 1OXSC 2V55B 1NKSA 2ZE6A 4PC6A 5FL7D 4GKJQ 2A9KA 3KKMA 2K14A 4C2UA 2O8FB 2GXUA 1VF5C 2VHJA 4A93H 1GNRA 2ATXA 2IBMA 4GZMA 2NZOA 1GTVA 3AEZA 2F4VQ 2A1AA 3DKPA 2QL6A 4M21A 3I61A 1VQ5A 2YU9H 4HATA 2NG1A 4M53A 1RPZA 2EJFC 2CEAA 3HKZG 1YNXA 1QJOA 3FPAA 4E22A 3S1RH 2WMOB 4A3KG 4JI2L 4LCBA 3TVDA 2JEBI 2GDJA 5DGXA 3NBYC 2MNAA 2EFEB 2ZETA 1Y69U 2VQFL 1W3SA 3B1VA 5KUTA 1H9SA 2RHMA 2RGNC 2ZI4A 1JEEA 1ZUHA 1OXUA 4DEXA 4FXPA 3RS0A 4RSGA 2UXBQ 2V7QD 1W4RA 3EIEA 2R93H 3CRKC 3I55A 3H1TA 4MH0R 4KV9A 2QU8A 2PPBC 1WI5A 2O8FA 3AQ4A 3RRZA 2XEXA 1W2GA 4OX9L 4JBWA 3I4NG 2C99A 2YNMA 2NO6A 1GM5A 1T0HB 4DBLC 1QF9A 3OE7D 1G5PA 3ER0A 3ETLA 4IOCA 2J45A 5EXXA 1KY2A 2DY1A 2CWPA 1KJZA 4KYIB 5FR1A 3T5GA 2OILA 1G8YA 4HJAA 1I6HH 3IPYA 2V7QA 2BE5C 3ZYCA 2W6JD 1HNXQ 2L5TA 5K36H 1TQDA 2IYTA 2JIZD 1TNDA 3SHWA 3X1XA 4A8JA 1RYFA 4PHHA 4JSTA 3CR8A 2FSFA 5FUVA 4ZCLA 1Q12A 2ALYB 1Z0IA 3U4QB 2LMCB 1JE5A 2RHSB 2UVQA 3DO6A 4YDSA 5DE3A 3OF5A 3IIKA 4D80A 4TLAA 3L8YA 1WBDA 2WSSA 1KDOA 5B64A 5CM8B 1VG0B 2V1UA 1B23P 2HYDA 3WNCA 1HR0L 1P2SA 1GD7A 2K32A 3MJHA 5DHAA 4DV6Q 1PH5A 4G0NA 4LBWA 3AF3A 1WE2A 4W9MC 1WQ1R 4Q9KA 6Q21A 2G1JA 1SMYC 3AF4A 1FP6A 1N6RA 2HCJB 3FYHA 4A3GH 5GJVC 3VU9B 3S24A 4BLPA 5DNYB 5KTYA 4MRVA 1T8TA 2F1IA 4H44C 5FI0B 5EXPA 4TT3D 4YHHL 1VQJA 1U9IA 2F6RA 4QKQA 5JMTA 1KKLA 2XAUA 4WW0A 4R4CA 1M7BA 1Q1ZA 2JA7H 4JLAA 1NMYA 1UDWA 5AJXA 4B3DA 5JEAH 2OCYC 4PQFA 5C18A 4A15A 4GN3B 3K70C 2QF7A 3B6YA 4JZKA 4ZCIA 3JAMc 5BN4A 3IQWA 5J4HA 4LF4Q 2D74A 2V3CC 2ZJRA 3EZ9A 4OI1A 1VQGA 1QBKC 2GVBA 2B3GA 1W44A 2YTVA 3HOYG 3AP1A 5DLQE 2C98A 4HLUC 1QG2A 2H92A 2IL1A 3KF8B 5HCNA 1G8GA 1GJXA 3DDCA 4MRPA 5KHOC 2QA5A 5L3SA 1OSNA 2A6EC 1IN4A 3S1AB 1E9BA 2PLFA 4LF4L 2R92G 4TYNA 1HJPA 1XNRL 2OLJA 2RAPA 4QBHA 1YKSA 1TMKA 4DR3L 3FB4A 1CTMA 4CVNA 1EGAA 2ORIA 3X2SA 3HKSA 1P9NA 2ZITA 1NVUQ 4FMDB 3RRYA 4LV6A 4GOXA 821PA 1E9CA 1YNNC 4KLKA 3HPQA 3QKUA 4ZDKA 4JYBA 1PLLA 4FCTA 4LJ6A 4Q4JB 3WDNA 1DGSA 2FU5C 2QM7A 4A3LG 2FXQA 3GEEA 1E2JA 3K80C 1SQ5A 2A5GA 3MMPA 4E07A 4DDTA 1KSFX 1UAAA 3T1QA 1KSJA 1PLKA 1VECA 3U3KA 4DUYL 2ZTCA 5FLMH 4DLUA 4JOIA 3EA0A 1JB7A 5B57C 5JLJA 2DUDA 3AUXA 1PH6A 1VQ8A 2AFHE 2R6GA 3EG5A 2JCSA 4JG2A 1KRTA 2ZI9A 3KXLA 3MWYW 5CLQA 3ZZUA 3FHTA 1HTWA 5JI2E 1S3SA 1CJVC 1CLUA 1U94A 3EZ7A 2GVZC 2XXAA 4LHYA 1ZKOA 3FMPB 2B8GA 4WVFA 3GLHB 2F1JA 1BMFA 3HOWG 3RS4A 4JI0L 3PJRA 3GMTA 5JSZA 1Y14B 4PG3A 2IUSA 2RGAA 4C3ZA 4ZCMA 1JB1A 3K0CA 1A2KC 4DSNA 5JCZA 1HE1C 3CD6A 1AM4D 1A6XA 1I94L 4DR2L 2G0NA 2Z6VA 1T6NA 2QT0A 4GI7A 4DUYQ 1E2FA 4ITRC 3ZJYA 621PA 1IBLQ 3GLIB 1Z0DA 1SVSA 2HT1A 1MKHA 1NN1A 4C3HH 4JKYA 3I2ZA 5CJ2A 1J8YF 4F4IA 4P71A 4GFDA 4B47A 4DKAC 4GOPA 3PIRA 4N3NA 4KXFB 4E5UA 2JAQA 3BB1A 1L8QA 1OT3A 1JEDA 5J4KA 4GPTA 4V0KA 5IF9A 3W3AA 3H3VH 4RCNA 2CVHA 1NP6A 3ADCA 4TLBA 2ODNA 5J4VA 2N3SA 2GJSA 2Q3HA 2F1HA 1Z6YA 3BXZA 3RDPA 3ASZA 4YMUA 2VQEL 1P7CA 4DV7L 2Q2UA 3DM5A 3T15A 3SJAA 2BIFA 2GTPA 2QUZA 2IS2A 3ZJYC 3AYHB 4X8OA 5KYKA 1XEXA 3J7ZC 1TF2A 2X19A 3I1FA 3PCRB 2HXSA 3F8TA 1IJEA 2ZRKA 4OJKA 3SJBA 5E7MA 3RC3A 1Y1WG 1ZM9A 3DMDA 4Q1FA 2NOAA 4A2QA 2VLIA 3WRXC 5C44H 4DLXA 4AKIA 1FNMA 4BXXG 3GTOH 2JK8A 3A36A 4KBGA 1YU9A 2G77B 4GN5A 1U5KA 3SFZA 4BFYA 1W0KA 2Q9AA 2R93G 3VR6A 2ZYUX 1NRJB 3S15H 4JL8A 4PC7A 1VPLA 5CJPA 2EQSA 1CJKC 4YHHQ 1XX6A 3LNCA 4JBXA 3MAAC 2CQOA 2BKUA 4HIDA 3UK6A 3AFPA 1GVPA 4CEHA 3KLWA 3KJOA 2ZE8A 5EXSA 1WJJA 4M9ZA 1NMFA 1DVRA 2CBZA 3EC1A 3ZS9A 4DSOA 1ZCBA 2HXYA 4NMMA 2K7VA 1PA6A 1XD8A 2PH1A 3NWJA 4O25A 1G9XA 1DADA 1ZYUA 2DWQA 3SBDA 4H13C 4R4TA 1OFIA 2YVUA 2QGZA 4ZDWA 4BA2I 1JALA 2NVYH 1VMAA 3C8UA 3K8AA 2VYFA 4N0EA 3QBTA 4GS3A 1HZCA 4MITA 3TRFA 5LB2A 2OT3B 2IC5A 2O0HA 4OO1G 1DXMA 4F91B 4OO1I 3HKZE 3D8BA 1F2UB 4LY6A 4PSAA 3A8KE 1FQJA 1ZVQA 3SBEA 3ZZTA 5EE0A 1F2TB 1H9SB 1L2FA 3A1SA 3IFTA 3W5IA 1XBTA 5ELNA 1CBUA 3LBHA 4IDPA 3PUYA 4IOMA 4TT3A 1FTSA 4URYR 1YVCA 1NG9A 4X8LA 4G7OC 4A0FA 1MO6A 1F2UA 2DFKB 3B60A 3A5UA 3KJEA 4TYQA 1D5CA 1UKYA 2BBWA 2FV8A 4FMDF 1MR3F 3KFUA 5ANRB 1IZ6A 1NVWQ 1WA5A 4LJYA 4OQNA 4QBIA 2ZE7A 4IEIA 2P6UA 2XTMA 4P72A 2GVAA 2R6CA 4NCHA 4PSKA 3SEAA 3VX4A 4DVGA 5A5GA 1X3GA 1NSTA 4S2EA 5EP1A 4POGA 1HNZQ 3ZQJA 3EA5A 1G19A 3KB2A 3OE7A 4K0KQ 4W7SA 1OIWA 2OAQ1 3I4MH 1P9RA 2JQOA 1E96A 3N70A 2EJGC 3U4QA 1IN6A 4NL4H 2JXMB 1D6JA 2ZR9A 1U99A 2F9LA 4LC1A 1G41A 2FPKA 3AVWA 3VR4A 2ZU6A 1E2DA 4PFSA 4NH0A 4JT4A 5JWOA 3CX6A 3B9PA 3TEHB 4LF6Q 2FG5A 3C5CA 3UDXA 3CCEA 1E94E 2F43B 4A3CG 4BLTA 1KI3A 3Q5EA 3CZQA 3T51B 4KKSA 5G40A 4JI8Q 3BJIC 3AUYA 3K0EA 1NN5A 3GTLH 3FMFA 1FGUA 5C4XG 4BQSA 1Z0KA 3QXJA 3V4RA 2MSDB 2GCNA 4YMTA 2IHFA 4PZYA 5C3EH 1J70A 5JECA 1B9NA 4HUQB 4QGUA 5JBQA 4FDBA 3ZD7A 4MRNA 4LYHA 5C46F 3BAFA 1GRRA 1N32L
chains in the Genus database with same CATH superfamily
5BUQA 3R8XA 2QB5A 1P72A 3L7MA 1W6RA 3T9DA 4PNHA 1GCIA 1U6KA 4KJXA 4IJLA 4J0FA 3IKMB 3N7TA 2ZIUB 3KFXA 2QI9C 5H5JA 3TTXA 5JAOA 3IGFA 1LV7A 1EAMA 1ISIA 5IBRA 1O3YA 1DAKA 1TAGA 4HQOA 3ZQ6A 2QN1A 2GXSA 3LKDA 3QVTA 2QLBA 3N8NA 4ETMA 1WDTA 3UXEA 1XNRB 1AUVA 3K1JA 3WDKA 3LYHA 1KO1A 1WB5A 3OQIB 5CCBA 1PJQA 3A26A 3VJRA 2I3AA 4TRDA 2EJMA 2WD7B 1JJFA 3I2HA 3UG7A 4E6EA 2O7RA 1ULHA 3B2NA 2YINC 3ND7A 3MTJA 3ME5A 4HAZA 5T3UA 1TY0A 2P2DA 1SNOA 1MJFA 2DWCA 4L57A 2VF5X 1NI4A 5HCUA 2NTSA 1XKXA 1AE2A 2JIZA 2RF4A 4FBLA 3IAUA 3TPZA 1PH4A 2XBUA 1ESNA 4YI5A 3G2LA 1W4BA 3ETNA 3WYGA 1LJLA 2AG1A 4ASUA 3ANLA 1XA4A 3LIIA 3URYA 1V1JA 5C7IO 3LWZA 4FGKA 2ZPAA 1N2OA 5E6SA 5EUCA 2XUGA 1FQKA 1UC9A 2QS9A 1LPOA 1MFZA 3UMSA 1JP7A 1JT8A 3R5SA 4IUDS 5A2QA 1O7ZA 1Y8QA 2JA5G 4QOSA 5TT0A 2ZIAA 3ZXXA 3DEHA 2B29A 1O2DA 5K0BA 3AY7A 3C8MA 1V4BA 2P5UA 3ECCA 3MSXA 3OT4A 3BXOA 1OQAA 1DAGA 2R8RA 3S2DH 3PNMA 1VQLA 1PZHA 4HNAB 3UDFA 1SXHA 4PC2A 5IT9c 3HOVB 1JZTA 1UBMS 3NASA 2CFSA 3DMFA 3S1MB 1KZ4A 2GLUA 3TBHA 1B8AA 3OIQA 1CR0A 1YHAA 2JDIA 1QO0D 4INOA 1RM3A 1FDOA 4ZO7A 1F8YA 4LFCL 2LKCA 2QPAA 4BEVA 5JY6A 1MQ9A 2XMCA 3K7EA 4R9UC 5FLYA 1DI0A 2H54A 3O8DA 5C80A 5CFLA 1E3WB 5ICCA 2J9ZB 1T9GR 2ID0A 3F3YA 1BDMA 1P6UA 2F43A 3GJZA 2IOFK 3KKZA 1PMRA 3NTRA 4YRIA 5GAEC 3MRTA 721PA 4JQOA 1HKUA 5BRJA 3IL2A 1Y8PB 1NP7A 3ZZMA 4BO8A 2DXIA 4XWWA 2FWPA 4P1ZA 4IIEA 4TWJA 4WBSA 3TX6A 1QXSA 1I7PA 1C30B 1UWLA 2A0UA 5D86A 1EK1A 2H4YA 3G7SA 5F64A 2IS1A 1O7YA 3S1MH 1OV6A 1ZM7A 2XADA 3HOVH 1H2FA 2FZGA 2NO9A 5F12A 2VWPA 4RZ2A 4EI8A 3U4IA 2BH8A 4FNFA 1Z2AA 3GJ5A 3H1FA 1GSHA 4GLLA 1Z6AA 2AFIA 5AI8A 3UCXA 1IN8A 2R65A 1IULA 1E2UA 2POCA 3DBOB 3GLHE 4H3VA 3WVNA 4BC1A 3A10A 5I47A 3LKZA 1J7KA 1EFHA 5JRZA 4A5OA 1IC6A 5FPSA 1YD7A 3T94A 1CEEA 2HU8A 3QLUA 4HDMA 2X6QA 3RYTC 4XARA 5A5FA 1T5XD 1RLUA 1QH1A 4APVA 1DEHA 2Q8TA 1GZ6A 1YZKA 2P6PA 5DTMA 1UPXA 5IWCA 2PJZA 1CEXA 1ENAA 3L2PA 4GKJB 2ISSD 2Q1YA 3V46A 3LLMA 3J7AF 4IJ6A 4AJHA 1A15A 4A3GB 1DZ1A 4DCCA 2R5FA 4LV8B 4F4UA 5JD6A 3T99A 2J0VA 4ACAA 1WBJB 1GXDC 1MRNA 2AJTA 5T1GA 4TL9A 1VBFA 2B0JA 1WVIA 5KWVA 3WSTA 2P8SA 3CPSA 1SD1A 3SJCA 1P1FA 2Z2IA 5EEHA 3KJPA 4IFIA 2QTFA 3CH4B 4TN5A 1RWNA 4BMOB 4NAUA 5A5EA 4LWCA 1RZVA 1Y3AA 3KSRA 4IX1A 4LQ4A 2ENUA 3LUGA 5I7HA 4R8VA 4B71A 1IW7C 4K8JA 4ZRDA 4KMSA 2WB4A 4H2DA 4XASA 3VUEA 3EEYA 3H05A 4MUKA 3P4XA 2IJ0A 2KHIA 4ZOLF 3KQMA 2ZBGA 3X1JA 4YR7A 3VC3A 1DBPA 2P2ZA 4LHZA 3UGTA 2O07A 3DVAB 3PG5A 2F1MA 3ZS8A 3CZPA 3RUHA 1CVRA 4I8XA 4CL2A 1NDUA 2BFAA 2OKCA 3ADKA 1F4PA 1K9VF 3HC7A 1N33L 3DWEX 2FRXA 2I1WA 3RIHA 1OGYA 1GARA 5I5GA 1T9ZA 2J33A 4Z0HO 1YJXA 5AJVB 1P61B 5IE8A 3AINA 2IYRA 1FFYA 1P5ZB 4NH4A 4JI3B 3TWOA 3G0GA 3F6PA 5DHTA 1EP2B 4BRUA 3NQTA 2WW8A 2JLYA 8ADHA 4DILA 3JD4A 1F48A 2XGGA 4QYXA 2NYAA 3B6IA 2JPDA 4OWTB 3M1LA 5AT1A 4C4ZA 5HJ5A 1BVSA 1E1NA 3OCVA 3J81j 4J90A 1YAHA 3D43A 3VKWA 2PV0A 1NJ2A 4KD3A 2FSVC 1VKZA 2W42A 1FIUA 3R9XA 1YBHA 4DE5A 2XSCA 1U5BA 1SIWA 5A1TA 3H75A 2CKZB 4K28A 5HUQA 1NRWA 4MP6A 3MINA 5JD5A 1WZNA 4YMHA 1ZK2A 3PICA 4H35A 1I4DD 4KKVA 2KLBA 4GVPA 4LF6B 3O4FA 3S70A 3ETHA 5E0OA 1E7MA 1YJ5A 2IQ5A 2W2TA 4R1MA 4L07A 2RI1A 3KHUA 1AUXA 4XRRA 5HNKA 4DNRB 3IURA 3ORHA 1OJLA 5L8VA 1KYVA 5A05A 2ZVDA 5LUBA 5JALA 4LF9B 2Q8RE 4JYAL 1JW9B 2GAJA 2V54A 3E3LA 2YJ6A 3EQZA 4BYMA 2RK4A 5HDBB 1E66A 1VIYA 4BJHB 1LTLA 1FLDA 2X5OA 3ZQUA 4O3MA 1Y7PA 3PIP3 3U7EB 3T56B 3IOEA 2QN8A 3AEKA 4NDNE 3DUZA 2VP2A 1PFBA 2ZBRA 3BE4A 3P9IA 4QQRA 3PX7A 1GEGA 1Z82A 3LUBA 5CNKA 1KNEA 2RCNA 5E4TA 3QA9A 4NF2A 2Y05A 1LBTA 1EOVA 1NXPA 2OWDA 3BYTB 2VL7A 3JASA 4FDLA 3TW0A 1E58A 5CMDA 3EIXA 2PX8A 3R0XA 1KDRA 2XQGA 4TZTA 4C7VA 1GPKA 2H4HA 2MTBA 4XFDA 3UT0A 2XJ4A 3CUSA 1R8SA 5FUYA 3V4OA 1UK9A 4ECAA 3C6YA 3S28A 4HNGA 1SE4A 4JI8L 3VYRA 2PBZA 2H3HA 2XWQA 3PPXA 4YRAA 4NWIA 4GUDA 5C9ZA 1QE6A 4DABA 4P74A 3KZVA 1JU4A 3W77A 3FI9A 4LF6L 1N6IA 1Y6JA 2NU9B 4LWQA 3TGPA 4MHEA 1WIWA 1TEXA 3W05A 3OD1A 3FLEA 3HCRA 1OLXB 1VL6A 3NZEA 3UQZA 4W8OA 4J2TA 5GQOA 3O4JA 2KS6A 1RI3A 4A8JB 3BU2A 1S72A 5KWEA 2O7VA 1KAAA 1MC8A 2VUIB 4A3MG 1BKYA 2MINA 2AJ8A 4DR7B 2A5DA 1FS4A 3QW2A 3JWGA 1DBVO 4I1UA 1KSHA 2WC1A 2PU5A 3O0TA 4JQCA 3GYBA 1PWZA 1ZN8A 3AU7A 2DTDA 2NXCA 3D3QA 2ZBQA 4HGQA 4COOA 1QP7A 4LJ7A 1SIOA 2VPTA 3F6EX 4GI1A 3WJ2A 5LQAA 2HDLA 4K2KA 3F90A 2YVKA 1O03A 3ISTA 4QSMA 3RG8A 5I7OA 2LY7A 1C3JA 1YB1A 3KUXA 2DQKA 4BL5A 5IK2D 3NFRA 2QL7A 3JQRA 2C8JA 2ZWVA 2HMSA 1N1GA 4HR7A 4G1BA 3V7YA 1K1EA 2C2WA 4B33A 4WXEA 2QL9A 2G9ZA 1PJTA 3ODPA 3M3DA 5IRCD 3G17A 4X65Q 1R6DA 2GKSA 1L3BA 5FHQA 3BJMA 3UWMA 3KWFA 3VH2A 1M0EA 1I5FA 5D5QA 1QC5B 5B6IA 1E4OA 5FI5A 3Q8LA 1NBMA 3GLUA 3CW9A 3I92A 4XAQA 3KZ1E 4OGQC 5LZ9A 4JBYA 3UV3A 4ATNA 3CRVA 1U7HA 1QFSA 4AG3A 1CFZA 3IVGA 4LF9Q 2NUTB 4D45A 2BM8A 2EFDB 2PWZA 3B85A 3G0IA 3RU7A 1PTOB 1VI2A 1VQDA 4MS1A 1Z22A 2D0PB 3ZGOA 3H4MA 3RVJA 1XG5A 1RP1A 2VB2X 2W22A 4AQYQ 1FTWA 2IUUA 2DOKA 5E8JA 4BFLA 2FHSA 2XCQA 3QITA 1GRQA 2OAEA 3O4IA 4F5EA 1SRQA 1UKBA 2ZYTX 3ZC3A 5JYCA 1NIJA 4B45A 1JG4A 1DAOA 2ZREA 4UM9D 1B74A 1K9MC 1OMOA 5K3CA 1BDJA 1FK8A 1QS0B 2FX2A 3FMIA 3IODA 4HDOB 3OZVA 2C5SA 4HK4A 2OPHA 3V1KA 1MCZA 3VNQA 1A5TA 4NXNQ 1ODLA 2AYYA 4J03A 4HMPA 4CL0A 2JI7A 1HH4A 3BMOB 3DLPX 3QWHA 1KRXA 2G0TA 4WOPA 2JFOA 4PAQA 1RF2D 3HWRA 4UE3S 4H08A 4N5IX 4H7EA 4H1WA 3WK6A 4II3A 2XWBB 2I6TA 3HSKA 1VKRA 3BQNB 3ESQA 2FWRA 3K9CA 1V47A 4M1ZA 2FEMA 5EL0A 5JS8A 1P4AA 3WZ2A 5KS2A 1F2VA 2Y0PA 3T7TA 5AHRA 2I2CA 1VJ5A 1YS9A 3NHWA 4QY7A 4FP9A 3DPUA 4A27A 5ALSA 4DCUA 3VNBA 1VJCA 2A59A 1FUKA 2VSOA 3W5CA 2BUAA 3GPBA 1JKXA 2M1XA 3M81A 3RJMA 3U26A 3HDHA 1TM3E 1EVEA 1H0RA 3A56A 3MOSA 5KSOA 2X86A 2H11A 2XXBA 2F8SA 2D7CA 3SVTA 4RAUC 2EBFX 3L8HA 4ZALA 1XMXA 5KYUA 1PFWA 2QNBA 2NPFA 3W5SA 1GDDA 1YTUA 2W2PA 2PL9A 2J07A 2CMFA 4MKXA 3ABZA 4AYTA 1M0SA 3JTMA 1EEXB 1YJ8A 3GJ7A 4BWGA 1OH5A 1U2TA 1PK7A 1RRFA 3UO8B 1NJSA 5DHRA 1URPA 2GEJA 3O3NB 4NYIR 1X87A 3MINB 1SUPA 3LCCA 3NQ41 3MJTA 3L7KA 4RWZA 1Q2XA 3MSCA 4X85A 4JASB 1P7VA 2IELA 1Y8NB 2BF7A 2Y4NA 2A33A 2EEZA 2OHHA 2Q5LA 2AC2A 3MQFA 4KLAA 4BBPA 2WHYA 4O33A 4B6OA 2C7QA 3OIVA 1S5BD 1S3GA 3Q7PA 1TLFA 1JKJA 3G71A 2FY8A 2G8NA 1ZU5A 2GFHA 3PKIA 3K7UC 4TSRA 3DFMA 2R3SA 2ZAYA 1AK9A 3LC1O 4NAHA 1XMPA 1PUIA 4IRMA 5IAGA 2AEMA 4WZAB 3ZHUA 4AAYA 5IX8A 5IWAB 2J4XA 4OL9A 1VE9A 1QNKA 4MSUA 4A0RA 4JP3A 2V7GA 4KQEA 1TU3A 4B80A 3OCWA 4DYDA 1ECJA 3FNRA 5AFSA 4Y9SA 2QVYX 5BMVA 3LUCA 3C8DA 4QXOA 4RGVA 3EN0A 2HHHB 1PSZA 1ESZA 2CXXA 3SF8B 2F0JA 3OAAD 4FHZA 3UCEA 5CLIA 5NULA 3THYB 2NAFA 1FP4B 1EINA 2PZBA 4I4TF 4RAQA 4X7PA 1XYIA 1J9GA 1ZUIA 2ZJ2A 2WSIA 3OZ7A 3UB2A 4RK0A 4XQCA 1FX0A 1WOMA 2VDKB 3I30X 3IQXA 3U7QB 3P2JA 5A2QE 4IY1A 3U4DA 3F6CA 3BXGA 3C6ZA 3TTWA 2FDCA 1XL1A 5EKUA 2XUZA 4MP3A 1Z6GA 3NETA 1B15A 3FPHA 5CIQA 1SVLA 5ER9A 5TPWB 1VMEA 4GPD1 4RY9A 2XNDD 1RTNA 1X77A 1REQB 2IQIA 1E1TA 4YBRA 8AT1A 1Q5PA 2WHXA 2H4JA 3ADPA 1F8UA 1PT9A 3EDYA 1DIBA 5AFWA 3FMOB 2EQAA 2EY1A 1XF1A 1ZK0A 3H9EO 2J59A 3IA2A 2ONCA 1WCYA 2NBFA 3IAXA 4I6GA 3KVOA 1ZOLA 2FFRA 4GOJA 1TUGA 2NSDA 4XEUA 1ISHA 3GCGA 1SBBB 5JFGA 2WU8A 2O8DA 5C5EA 2H2WA 3ZJVA 4FYHA 3G13A 1G38A 3OOCA 2V6JA 1II9A 1NHWA 4WLNA 2QEXA 1FSZA 3DB2A 5EE9A 4ID6A 2EJUA 5IFKA 1JFTA 3HKDB 4C9BA 2EKZA 4XDYA 2XCUA 2YX1A 4GOKA 3PK0A 2Q8PA 1BU8A 1JAHA 1H6DA 1RKBA 4O3FA 2NO4A 3TIVA 2GPAA 1SD5A 4OAOA 5DX8A 3A4MA 3SE7A 3AJ8A 1UXIA 1XYGA 4L5TA 3DZKA 4H0CA 1BOFA 4LPSA 3RT7A 1EWCA 2AFIE 3DXFA 3HCWA 4HYEA 4YB8A 1UOOA 4TLCA 4YVFA 2VY3A 4YUVA 2W37A 3JR7A 3OCUA 3U2QA 1VPDA 3H2IA 3UA4A 5DN6D 1T9DA 2WT4A 4KV6A 3KAKA 2YFKA 4G0ZA 2YZGA 3ICOA 4QO7A 2FPIA 1PEDA 5IGDA 2SNSA 1LW6E 1I4EB 2JHFA 2YJ3A 5PGMA 3VDRA 4MW1A 3WLPA 1FYXA 1MVLA 5CXXA 2R7ZG 2YJZA 4GYJA 4ZYVA 4P0QB 4PQGA 2BR5A 2E18A 2X6TA 3IV7A 3KZMA 1WCIB 3CRZA 4C0WA 2PI2E 2D4HA 1PYWD 1MB0A 2GCOA 2P2YA 4MQEB 2C7RA 3RPEA 4CEIB 1UJ6A 4EY4A 1NW7A 2GZMA 4WK4B 3IFSA 3X1DA 3PDIA 4DMUB 5DX0A 2XT9A 1Q91A 3DOHA 3OY7A 3IIEA 1IUOA 1LS1A 1T0JB 1QAOA 4OHVA 3E58A 1H2BA 1SA0B 2WZQA 4JLJA 4KXNA 1G5IA 1PVDA 1ZISA 2EFGA 2GUWA 1MT0A 2QGQA 1QPBA 5AW7A 4CLHA 3UE0A 4MW0A 2F0PA 3OLYA 3TZHA 4AP9A 4PZ7A 1IYJB 1RD4A 1CT1D 3C3PA 4FVMA 5BYBA 2Q29A 4WFN3 4YECA 1A72A 1OH8A 5LFAA 2PE5A 1JIIA 2P5TB 5TJHA 1Q3LA 1IY8A 4JYAQ 3PU6A 3PD7A 4ZEOA 2OO5C 4NXMQ 1RC0A 3A0JA 2ZRMA 1JZSA 3PUHA 3QU5A 3VZPA 2P75A 1AMUA 5IP7H 4CMAA 2VQFQ 3KR0A 3RK0A 1JYSA 4UDOA 5LYYA 5MDHA 5IHPA 3CJRA 1U7WA 4ZP1A 4JXKA 2V96A 1EFLA 5GZ3A 1JHZA 3DF7A 3OM8A 1AF4A 3PVCA 4N9TA 4KKXB 4BB0A 3OX4A 4A15A 3NGMA 2MSEB 3BK2A 2OM2A 1KOFA 4LZZA 3SX2A 2O4UX 4YQZA 3Q24A 4NBUA 1W19A 1SXJC 1LDEA 4IHJF 1P1RA 1G2PA 5ER6A 4ARZB 3LBNA 3HEBA 1Y1RA 4GM0A 3IERA 4DBLE 1WU7A 1YA8A 2R8EA 3FROA 1RYZA 1YL5A 2I65A 2ISQA 2UYOA 2AZDA 3IP6A 5ECWA 3LHFA 1LPSA 1YOVB 4GNXA 2WG0A 2RCFA 1OLSA 1RRMA 4R2LA 1EQQA 3RZOH 1W34A 4OQEA 3X3HA 2XWPA 4E2XA 1HNZB 2YXEA 2Q1UA 2YVAA 3HZZA 1CR4A 1JR3A 1V11B 5DT2A 4KQXA 2P9CA 2FDRA 1D0VA 1L5LA 4B5KA 5HWSA 1G8SA 3K0FB 1J09A 3QHPA 1EEID 3BGDA 4UTZA 4ZKEA 4ZZIA 2EP5A 1IVNA 2O48X 1JTVA 2FJ2A 1XEXB 4CMIA 1N0WA 4F3KA 4L5QA 1HRDA 2X4DA 4PX2A 3DNMA 5HQTA 1GXSB 1DIHA 2ODAA 4RKEA 5DLEA 2F0VA 5HZMA 5LLDA 4KQKA 4GOLD 2X8JA 2YY6A 5SY9A 4LZOA 5GROA 3WDMA 1NSNS 1P2DA 2OA0A 3KDFA 2I22A 3DMTA 3FPUB 4HEQA 4D4KA 3A54A 3EXHC 5E1BA 4X92A 4NR0A 4F1JA 4D0GA 4FHGA 3W3ZB 3UMYA 1CS4C 5FPTA 4DJ5X 1U0TA 3KSUA 5HF6A 2NVOA 2VAXA 3M9WA 4KHZA 3R0ZA 4L8VA 4MQLA 4BUZA 1VIDA 1PU2A 4L63B 2EWWA 1N8SA 4NXML 2ZJ6A 1N0VC 2EJVA 4HX9A 4FLEA 4XDZA 4XSGA 4HB4A 4UD2A 1PYBA 2CVPA 3KBGA 1ESEA 2GA8A 3DBHA 4AH6A 3QEBZ 4Y0AA 1J00A 4MQ4A 2JE6I 4LBVA 4ON9A 3ZE6A 4EIWA 5JCPA 3Q2OA 4XWAA 1YUMA 4Q9DA 3HR8A 5B7NA 5C1DA 3ZJTA 4IFTA 4LJRA 1VI5A 2ZZMA 2XYVA 4FFBB 1AQUA 1F9QA 4YHHB 1E5QA 1V8FA 1NE7A 1JMCA 2EQ5A 3RF6A 1RRKA 1P17A 1G20A 2ACVA 4J0JA 4PVDA 1L1OB 2GN8A 2VCYA 2CH4W 5K0EA 4DXHA 4RTRA 4X66Q 2RMKA 4FLFA 3DXXA 4MUEA 2XF2A 1N1DA 2EL7A 4YAIA 2Q28A 4FZ5A 2QIOA 3RS9A 4KIFA 3K9WA 4IXMA 4O4HF 3D5TA 4QPPA 4QU5A 3EASA 5EPJA 4H1UA 1MJHA 4L76A 4Z7OB 2F0KA 1MLDA 4YQEA 3PJFA 5K2MA 4CV0A 1E32A 1SBZA 3E1SA 3OLZA 4KAXA 4QLAA 3ENWA 3IEKA 4TTQA 1IZ0A 9GPBA 5CXSA 4U7JA 4YONB 1LB1B <