1OXUA

Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
353
structure length
353
Chain Sequence
MVRIIVKNVSKVFKKGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDDRLVASNGKLIVPPEDRKIGMVFQTWALYPNLTAFENIAFPLTNMKMSKEEIRKRVEEVAKILDIHHVLNHFPRELSGGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARALVKEVQSRLGVTLLVVSHDPADIFAIADRVGVLVKGKLVQVGKPEDLYDNPVSIQVASLIGEINELEGKVTNEGVVIGSLRFPVSVSSDRAIIGIRPEDVKLSKDVIKDDSWILVGKGKVKVIGYQGGLFRITITPLDSEEEIFTYSDHPIHSGEEVLVYVRKDKIKVFEKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords ABC transporter, ATP binding protein
publication title Crystal structures of the ATPase subunit of the glucose ABC transporter from Sulfolobus solfataricus: nucleotide-free and nucleotide-bound conformations
pubmed doi rcsb
source organism Sulfolobus solfataricus
total genus 103
structure length 353
sequence length 353
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2003-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17847 GlcV_C_terminal Glucose ABC transporter C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1oxuA03
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1oxuA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1oxuA01
2UZ3A 4PC1A 1P72A 3BG3A 4JI4L 1RRPA 3A5ZB 4D82A 1OIWA 2VHUA 4HLUC 1TU4A 4ASUD 3S17H 4C0BA 4PZ8A 5IY0A 4LF7Q 1KY2A 1XMIA 1M7HA 4L8GA 1YZTA 1VQEA 1XNJA 2XX3A 2MSEB 5SZKB 4DSNA 4MGYR 4Q7JB 1HH2P 2IHEA 1KI2A 1OFHA 2QTHA 4PHFA 1E94E 4PPQA 1HTPA 4JLVA 1YZQA 3TUZC 1Z6GA 3VR6A 1HZAA 5EUQB 3RNLA 3L8ZA 2REXB 2QRZA 2J46A 4A2QA 2ZSBA 4GKKQ 4O25A 3U2QA 1N6OA 3CNNA 3U3RA 2FNAA 2VYFA 5ANRB 1JALA 3ND9A 4M1OA 5FI1B 5DN6A 4X8OA 2H57A 1NRJB 1IL2A 1TX4B 2QQ0A 4TMWA 4HDOB 4X65Q 4QKQA 3CB4A 2FSFA 4YWMA 1MIUA 1OYYA 1JE5A 1X1RA 4V0ME 1N6KA 3SHWA 4CRWB 1HNZQ 5E7NA 4DLZA 1XEXA 4H02A 4UP9A 1F2UB 2F9LA 3BFKA 5FL3A 5L3VA 2Z0SA 3SJZA 2V54A 2LKDA 4EFLA 4TZ0A 4G5QA 3PEWA 2CE2X 2WJHA 1P2UA 4QOSA 1L0WA 4HIDA 3A0JA 1NJIC 4GOPB 2PLRA 3G82C 3K1JA 2BVNA 3OAAD 5FBWB 2FXQA 2L5TA 4LSGA 3QBVA 1Z0DA 4RZXA 2PQAA 1VQNA 1G8GA 1PH7A 3K70C 4EPWA 1WFQA 3LGJA 3DHWC 5AR1A 1N36L 4HJAA 4C2MH 2ZRLA 2WWFA 4QHSA 4EDHA 2VHTA 4PX9A 1PV4A 1TXYA 2JIZA 1YNNC 5FR1A 3FMCA 5F9FA 4KLNA 2GNOA 1F3OA 4B3BA 2PJZA 1NP6A 1OFUX 2O8FB 2XTIA 4JI0L 2OCYC 1T8UA 1LS1A 3U44A 3L0OA 3GTMH 4B34A 1TL7C 4APVA 1KZGB 3GJ7A 2BM1A 5EXXA 2HDNB 3R9WA 4ESVA 3S1RH 4D81A 8OHMA 4MITA 3G48A 3SJAA 4HIKA 2OLJA 4HUQA 1SLJA 4OGQC 1XD9A 1N34Q 4IO9A 2R93G 1K8OA 1XTIA 4LUCA 4BXXH 1IBRA 3AGQA 3B78A 4OHVA 1E2EA 4L5RC 2ZYTX 3RZDH 2K5VA 3WYFA 1TWAH 4A3LH 1KJYA 3X1DA 4NCJA 2UXBL 3J81c 3Q7QA 2XJ4A 2GBLC 1R2QA 1GSIA 4M1YA 4KODA 3WYGA 5JEDA 1QJOA 4LF9Q 3FKIG 1J99A 3VKHA 4Q9JA 2EFEB 2A5FA 3EIEA 3NKVA 1U0JA 4DR4L 3OIUA 4U5XA 2MQHA 3WP0A 4BLSA 4EPYA 4G1UC 1HA3A 4JBXA 3QG1A 1SVWA 3QF4A 1T6NA 1Q20A 4UXIA 3PF5A 3FHTA 2X1VA 4HB4A 4BY7H 2BIFA 1E96A 4B47A 1CLUA 3AVOA 3AQ4A 4TWZA 1BVSA 2I1VB 2XOKA 1F5NA 3FGNA 3I4OA 3TUJC 1W36C 1YE8A 3GLFB 4TYYA 1EIFA 4DDWA 4DR2Q 1S96A 3AH8A 3STBC 4PSKA 4W9MC 4MRRA 1KNXA 1XPRA 3AF4A 1SVLA 1KAGA 1U0HC 3VHXA 2IEZA 1G1MA 1OH5A 3WMGA 5C4GB 2YYZA 3M4OH 2OFWA 2QA5A 4HB3A 4JBJA 1BH2A 2ZJ5A 1DEKA 2VL6A 4HDCA 4OQXA 1QVFA 2N49A 5DNYB 4UJ5A 5G53C 3AVTA 1VQFA 1EFUA 2BCGY 3IO5A 4PAMA 3ZVLA 4LJ5A 5TY0A 3EPLA 1UEJA 4ERNA 3QOFA 4ZIRB 1F60A 2CJWB 5GROA 3Q8XB 1E1QD 3WBJA 4B2IA 4QHTA 1WDTA 4E09A 4EPVA 5C0XG 2X19A 4G01B 2H5EA 2GJ8A 1Z6YA 4PV1C 2DFKB 2IW3A 4I1VA 3W8RA 1S9DA 2IYLD 2YWGA 4CF7A 3K9LA 4LPKA 4US2R 4GKJQ 1E3PA 1KAOA 4V0OA 2PNRC 2GKSA 1WMSA 4ZI2A 4TYNA 2FFQA 2ZRDA 3E2IA 2JDIA 1X8KA 4XIGS 2OZEA 4JI6L 1JEEA 2GVZC 2ZJAA 3L2OB 2O8CB 2P65A 2VSOA 4IFDJ 4A2WA 3G4SA 4DDVA 5HGQA 1QHSA 2C03A 1SVOA 2REOA 3HP1A 4DLWA 1EWQA 3CUEF 1G291 4AKGA 1GUSA 3AGPA 4DV6Q 2EXDA 4DR3Q 1XTRA 4JVMA 3C14C 5IP7G 2XNDD 4QL5A 5EQTA 3VFDA 1NNEA 1TTTA 4KV9A 2JE6I 4OHWA 3ZIAD 5JJLA 1KY3A 4IFDH 2YTXA 1VQ8A 1Q1QA 3J80c 2DYKA 4NYMQ 1OSNA 1RRFA 1XEWY 3AFQA 2I3BA 5B57C 5DIFA 4C2UA 3CRLC 2NZJA 5JEAG 2BH8A 3CNLA 4MH0R 1QBKC 2GF9A 1A0IA 3AV0B 1XD2B 3QVVA 1XNQL 2GDJA 5CM8B 3CH5A 4DSOA 2GWHA 1IBLQ 4WZBE 2REBA 4O0MA 3HFZB 4UJ3A 3NBZC 5M5YH 3T5DA 1FQJA 2KJQA 3NBYC 2CNWD 4NU0A 4X62L 1OF1A 1US8B 1KZ7B 1E0KA 5AJ3Q 1UM8A 2OM2A 2YJTD 4AIMA 4GN5A 4A4IA 4JI7L 2CK3A 1AZSC 2IK8A 3BFVA 4PO8A 2GVAA 3PXGA 3KQHA 4CEIB 3KDFA 1F2UA 5IT9c 2W58A 3RDPA 1A6XA 1FPMA 4PSAA 2YOFA 3BC1A 3L43A 4TQAA 2F4VL 1ESNA 3QXXA 2ODWA 2R44A 4AYTA 1TWFH 1XJVA 1IJFA 3B5JA 3DXJC 2PLFA 3B9PA 3HJNA 4F91B 2HT6A 2VTKA 3AF0A 4L8JA 2UXDL 4B48A 2YNMA 4X8LA 2G77B 4DCUA 4UKDA 2ERYA 3RC3A 5KSYA 4RJLA 4DV1Q 1QHYA 3ADKA 3LXRA 1UDWA 5HCNA 1L4UA 2XSZD 1G6OA 1VCOA 3K7UC 3VTKA 1YVCA 1H9JA 1GRNA 1KHTA 2IYRA 3B9QA 5FPSA 3W3ZB 3GLGB 3W5IA 3LNCA 4Z8YA 4P32A 3HR8A 3H94A 1G6HA 1R0ZA 2PEZA 5FTMA 1LACA 2VZAA 4XVQA 1E2ZA 1TU3A 3RABA 3OOCA 3ZJYC 2VQFQ 1YR8A 2EJFC 1IBKL 721PA 2K7VA 2QE7A 2XAUA 3FVQA 4LUVA 1E1RA 2PL3A 4PZYA 4BE7B 4F4CA 4JL6A 3DPUA 3A8IE 4OXPA 1ZM7A 3TQFA 3V4RA 2ZITA 2ZRCA 3MGCA 5KO2A 4LGMA 4QM7A 1BYIA 1G51A 2VL7A 2GK7A 2FFBA 1Y69U 3NH9A 4FD2A 4HZIA 4I1SA 1VQ4A 1WJJA 2W6JD 1S0UA 1K9MC 4WOPA 3A8KE 2ZI7A 2ORWA 2QAGB 5K8LA 2Q8IB 1UE7A 2KB0A 2ZE8A 1XZQA 4D26A 2O8BB 3CCEA 2WTUA 4Q1DA 1KL9A 1KDPA 1E2VA 2J3EA 2ZANA 1KK0A 1M8PA 4ON9A 221PA 4GKKL 1J2JA 1GFIA 2G0NA 2ZUBA 4TMXA 3QKSA 4TTPA 1E9FA 3C8UA 3F0TA 4PHGA 3NDBB 5AK0A 1PLKA 4D4MA 3AKCA 3U7EB 3CRRA 3OE7D 4E07A 2GEUA 4X65L 4HAZA 4JLKA 4BWYA 2ZRMA 2OCAA 2VP2A 1NLFA 1U8YA 3KLRA 1W7AA 3WNDA 3AVWA 4Z54A 4G3XA 1GWNA 2ERXA 1YVDA 4IFDG 2EYUA 2IX1A 3QEJA 4IXMA 3SYLA 1VHTA 1E9CA 2AK3A 5EJEA 2IYYA 1VCNA 3RRNA 2NO9A 4YQFA 3PSIA 2MO1A 1Z06A 4TMVA 4XTRA 1JXOA 1PFSA 3HPQA 3SZRA 4OHXA 1G7SA 3UIEA 4BASA 2PI2A 4PPFA 3W6OA 1U94A 3Q8DA 4V0NA 1X1SA 1QDEA 1E0SA 2Z5FA 4RD2A 3X2SA 3LNNA 4CGZA 3M4YA 2KA7A 1AKYA 1CSPA 3DDCA 3KXIA 3CCQA 2AKYA 2NG1A 2OBNA 2W2XA 3FMIA 2FH5B 1OXTA 4URVR 4D25A 4IOAA 3GJ6A 2B6HA 3WDNA 2K50A 5TB5A 4BRUA 1SXJA 1VG1A 1XTKA 1SVSA 4IJMA 4M1WA 3PG5A 4MGZR 1TUIA 4Q02A 3AVVA 4KU4A 4BPBA 1VIAA 5LB2A 1RJ9A 3QUSA 4XVRA 1GZSA 1LYLA 4XH9B 4OI1A 1L8QA 3W1BA 3CCSA 1TNDA 5F9HA 2J7PD 1DAEA 3OFND 1AN0A 3CF0A 2HYDA 3FMFA 4R7ZA 1HNWL 1N34L 2XITA 5C3EG 1YR7A 5FLXc 2IHBA 3OHMA 4TQUS 3CC7A 4O3MA 3ER0A 1VYVA 2HV8A 1EXMA 2C9OA 2WBLC 2DB3A 5SZIA 3P1JA 1VQKA 3M1IA 5HE8A 3NE5B 5DLQE 6Q21A 4LV6A 4GOKA 3G0HA 1TKWB 5FBLB 4DLRA 4FCWA 2IYZA 4KVGA 3PEVA 5HZHA 1YRBA 4G0NA 4LNQA 1XD2A 1XMQQ 2IYXA 1NL3A 4B73A 4GNXA 1NVUQ 1VQMA 2OBMA 5GADl 2VP4A 2A5DA 4M9ZA 4BQSA 2ID0A 5KPJA 2GEDA 4N1AA 3I7FA 4IPDA 1N5JA 3WRXC 4A82A 2WAQE 4OHZA 3CPWA 3FKSA 2Z83A 1GVPA 1Y1WH 1L1OB 4DR2L 2Q6TA 1T4GA 4DRZA 1NF3A 1JAIA 3PIRA 4HYYA 2ZJZA 3IGFA 4B3TL 2HHHQ 2CCGA 1ZD8A 5DSZA 2PI2E 4GN3B 3U3JA 3VR3A 3IRBA 3KJPA 3K70D 2PH1A 4Q4JB 3B6YA 4JBWA 2EJMA 4DV4Q 3GTOH 3D6TB 4K81B 4W7SA 821PA 4BBRH 5JECA 1B7YB 5KNBA 1EGAA 5FUWA 2DFLA 4BECA 1TAGA 2IXGA 1JR3A 3VKWA 4A8JC 2PZEA 2O52A 5CITA 2I0QA 1BKDR 4LJ9A 3H3VH 4DT1A 1KDRA 4P75A 3AYHB 4A9AA 3K0CC 2Q3FA 4OBEA 2B8FA 3U4ZA 2A8VA 4BLRA 1SGWA 1Z0IA 2PPBC 4NL4H 5GVRA 2J0UA 1E79A 1YBYA 1EX6A 1SXJE 2ORVA 1IXSB 3X1WA 1UBEA 4V02A 2FN4A 3OPOA 1T91A 3QIAA 1GNPA 1FJGQ 2OTLA 4KO8A 1NJGA 3WBKA 4B75A 2R7DA 3THXA 1GHJA 3RR5A 1ZJ6A 1G3UA 1XCPA 1XJCA 4U02A 5LMNW 5FBRB 4GOXA 2Q2HA 3RSOA 4GLXA 2YINC 2ZI6A 3O8CA 4OI4A 2NN6H 4C3IH 3RS3A 1TF2A 3PQCA 1E7ZA 3UDFA 1PH6A 4QL3A 4DV6L 4JI2Q 1OPXA 3CLVA 4LBZA 4DR3L 3KFUA 2RGAA 4JYBA 4DEXA 2B8TA 1DGSA 2AK2A 3SFVA 3C5HA 5DISB 5IRCD 5GJVC 2B21A 4JOIA 1D7QA 1W2GA 1G16A 3MXUA 4DSTA 5AUPB 4DLUA 5AJXA 5KSOA 5KUTA 4JLJA 4X8HA 5KSZA 1E9RA 2GXAA 2WV9A 4B3DA 3T5GA 1Q81C 5JJKA 4IRUB 2KI5A 4QBGB 2H18A 1W48A 3HDTA 1W36D 4OI0A 3GTPH 4XD7A 3TZUA 4Y0VA 3I1FA 3STBD 2R92H 4IQZA 3DEFA 5CYOA 2A30A 2GA8A 1AGPA 4Q4HA 4Z8XA 5HR5A 1IN7A 3IIMA 5FL7A 3M4PA 5AJ3L 5BR8L 3KXLA 5JCZA 2ZI5A 4YMSA 1XCMA 4A36A 4YCUA 4X64Q 1TMKA 2FX3A 4GP7A 4LHZA 5CK4A 5EZ5A 3TSWA 3ZZ0A 1H8HA 3K81C 1NBMD 1WBBA 1P6XA 4LV5B 5DHAA 4OX9L 4JI8Q 4HLCA 1GIAA 4KFRA 2PT5A 2KWIA 2ZRFA 2ZI4A 2RF4A 1QUQB 1ZIOA 3EARA 4H1UA 1II8B 1SZPA 5IK2D 3GJ0A 1C9OA 1Z0AA 1EFHA 1W4AA 4BEJA 2GEVA 3LY5A 1BOFA 1NVVQ 1YZKA 2V9PA 1CUKA 4LF8Q 3CPJB 1AS2A 1N0UA 2AWOA 4A75A 4II7A 3BGWA 1JQJC 5DI9A 1WI5A 2UXCQ 1C4OA 2IYVA 4RKEA 4DLYA 1JNYA 3HKSA 1E9DA 1Y1WG 4BBSH 5A5GA 2A5YB 4XSGA 4NPHA 2QM7A 3NEJA 4TT3D 3KTAB 3UE1A 4Q4AA 3IEUA 2ODEA 4IDPA 4B35A 4EFNA 1XMJA 1CR1A 2R7ZG 2R65A 4MRPA 5CIWA 3CM0A 1DG3A 1W0KD 1Z2AA 2VQFL 5FOXA 3MRSA 5LMNL 3BD9A 3LWNA 2KHIA 3OEHD 1FMLA 4M1MA 2RH5A 4EJSC 1ZINA 3RWOA 1CJKC 1MABA 2QMEA 3DM9B 1HE8B 2CDNA 4PO1A 4ACBA 4MTNA 4KFUA 5EP2A 4UY8C 4CDGA 3ND8A 2W83A 3IPYA 3MMPA 5L8VA 1YKSA 2IX3A 4CZ2A 2JLSA 2WMNB 1AA9A 1LV7A 2FJUA 2XTNA 1T3HA 3QY0A 2K32A 3TUIC 3TRFA 4QY7A 4NE2A 4AD8A 2OESA 5FH9A 3B13B 1CRPA 2AD1A 1TQDA 4LC0A 4C30A 3HYRA 4TMTA 1FUUA 1GUAA 5B64A 3IQWA 2C99A 1I50H 1X55A 3LRPA 2FPKA 4EQ6A 2WOOA 3HU2A 4R4IA 2QBYB 3ZVNA 3RLOA 3U3KA 4MKHA 2XGJA 1PLLA 2WB1E 2FE4A 2H92A 2Q9CA 1RYHA 3LV8A 4KXFB 5JHHB 2OBLA 2ZE7A 5D3MB 2ZU0C 4Q1FA 4DCNA 2HT1A 4TSFD 1B9NA 1GILA 1KSJA 4HLQB 5C2JB 1L1OA 2QF7A 2H8KA 4M2LA 2O5VA 3FDIA 4DV7Q 2F1JA 2G1JA 4Q66C 3TK1A 1XMSA 3ADBA 2PX0A 1Q1BA 3C15C 1J70A 2O8DB 4H0LC 2QEXA 2QGNA 2WOJA 4DZZA 4ZDIA 4H44C 3B8HA 2VUMH 2ATWA 4LRWA 4Q4JA 4C2TA 5D3MA 2DHRA 4KBGA 4NCKA 1EFRA 4RCZA 4IDNA 4BFWA 1S72A 1XNRQ 3M6AA 2ONJA 1TU2B 1YZNA 1M90C 4Q21A 4BGDA 1Q46A 2R92G 2AMCB 4F38A 3TIFA 4ASUA 1D8LA 2WKPA 3QENA 4DCSA 1E9BA 2G88A 1RKBA 2IBMA 4POAA 4QM6A 2C77A 3T51B 3LW8A 4D80A 4GDFA 2NVXH 1RL2A 4Q7KA 1P60A 2ZS8A 1RIPA 4PG3A 1XEXB 3LVQE 5TARA 1DADA 4KMUC 4DIDA 4P4SB 4Q7LA 1CI3M 1F2TB 5TV2A 2AWNA 3K9NA 3NHAA 5BWMA 2JLZA 3KJHA 4C0AC 4LF4Q 2GJAA 2UUBQ 4AH6A 1MKHA 3IDQA 3A5UA 2AUJD 1PH1A 5JHGB 2ZJ8A 2JLQA 2JEOA 2ZAOA 4A92A 5FJ8H 3F2BA 3PO2G 4YLGA 4JI5L 4M0LA 1J6QA 2C95A 4A15A 2P6RA 4A0GA 1NMZA 4MYTA 2IS6A 1SVMA 4QBHA 1H9SA 1QVGA 1EWHA 1ZYRC 3AKYA 2ZSDA 2H1LA 1OHHD 1Z6XA 3TH5A 4QIWE 3VAAA 1CFMA 4JL5A 4GZYC 5C44H 3PR1A 3U44B 4K0KQ 2WWWA 1XMQL 2DWQA 2NVYH 5E3HA 1XEWX 4M9QA 3PV0A 4B3XA 1ONLA 3VMFA 4GP6A 3IEVA 1GDDA 3L82B 5EXSA 1Z47A 4JSYA 5JI3E 1W1WA 2E1RA 2WJVA 2RGEA 2BBWA 1TEXA 4PC3A 3PFIA 4MGIR 3ZS9A 4OI2A 1M6NA 1Z22A 1AQUA 2DWPA 2LXKA 5FPYA 3UG7A 4DB2A 3EZ7A 5TVKA 3LLUA 4LPSA 4RCNA 4LZZA 3CIOA 5BW8A 1WCV1 2HHHL 1QUQA 4I7ZC 2CMKA 3FB4A 3QE0A 2G1KA 4MYHA 5FTJA 4TLCA 4BLQA 5JBQA 3K0SA 4DV4L 4FW9A 2NN6I 2C78A 4CVNA 1KOFA 1NLYA 4DBLC 4FCVA 2A1AA 2RGNA 4FINA 1IOZA 3QF4B 4KFSA 3SC3A 3SQWA 5DH9A 3LAWA 4M21A 4AKHA 2WM9B 2D2EA 1XB2A 2A6HC 3CKLA 5LMUQ 3ZH9B 3I5XA 4A3DH 4LUZA 3LBIA 4IOKA 3NBXX 4XWOA 4KITB 1AM4D 2GF0A 3I2ZA 1V43A 4ESHA 2IUUA 1KYIA 2I5LX 1KJWA 1U8AA 3ECCA 1L2FA 2GJKA 1AS0A 5HZKA 1O3YA 4MUBA 1U0LA 4KLKA 4DK6C 1XEFA 4JT4A 1KGDA 1I6VC 1T5EA 2ZRGA 1RZ3A 3KKQA 4JSTA 2AFHE 3SGIA 3M85A 1MH1A 3DVLA 2YZ2A 1YJ9A 1Z5ZA 1NKSA 2B7CA 4Q1AA 2OCBA 1P4SA 1XJ0A 2ASEA 3ZDQA 5CB8A 4IVPA 2R93H 1IXRA 4J0QA 4LOAA 2XXAA 4OJQA 2UUCQ 1GNRA 1TUEA 5M3FG 4MRNA 4KBFA 4B3MQ 2RGXA 4GN4B 2E2JH 1VCMA 1CKOA 1VQHA 3FKIH 4XTCS 1GAJA 2QP9X 1KK2A 1M1YE 5BN5A 2D4HA 3IIKA 4NMMA 4A6XA 1O7LA 1VYTA 2JATA 4PFSA 3BIFA 5HKKA 1K5DA 2Q3MA 1E1QA 4US1R 3WXMA 1X9NA 4F4IA 5FJ8G 5JZVA 5K8TA 4YDHB 2EQSA 2AKWB 3A1VA 3GEEA 2E8GA 1H9KA 4X64L 2ZYUX 3PIOA 5G3ZA 2V3CC 1GUNA 2Q9BA 3FP9A 1JJ2A 1E2GA 2EJGC 1SKQA 4MRVA 4OO1I 3L0PA 2DNEA 1EK0A 4QGAA 4DAYB 2W0SA 4QRHA 1I3QH 4C9BA 5C1BA 1U98A 4MA4A 5C0XJ 5C44G 1A63A 2EFDB 3U4QA 1YHAA 4QJFA 4OL0A 4GLVB 3RLNA 1VYUA 2OFXA 3RYTC 4LJ8A 3TKLA 3E70C 4Q9HA 2HJGA 3MWJA 4O2LA 1K83H 5CLQA 1VQDA 2EFHB 2VIIA 3BE4A 4A93H 1P75A 5KDDA 4OWWB 3G5UA 1V9PA 2XNDA 1YITA 4EQ5A 2XTZA 5KU1A 2UXCL 5C0XH 4UP8A 1K5GA 1G7TA 4DSUA 2R6GA 4R4QA 4PZLA 1KO7A 2V4ZA 5IWAQ 3B1XA 3WMFA 4PC7A 4DV0Q 2AFIE 2RGCA 4LYHA 4TLAA 4URXR 3T35A 1ZYUA 1ZU5A 5IYBG 3KDFB 4B3RL 4KCGA 2KBEA 4P4SA 3KZ1E 3T1TA 1M74A 1F2TA 2F7SA 2K52A 1H65A 1LS6A 1R6BX 2ZEJA 3B1ZA 3KFXA 4L4UA 4PPNA 4WW0A 4K8OA 3REGA 1I2MA 1ZW6A 3LBNA 4DNRB 1E2QA 2CNWA 1X6OA 1VECA 4DAMA 2C9YA 2FEMA 1K3RA 2QG6A 4MUAA 5JS8A 4MYUA 2J5XA 2WIAA 1KI8A 2F9MA 2JA7H 1UKVY 5JEAJ 4W5WA 1E2DA 2VRWA 1E2NA 1DELA 4AG5A 5IP7H 4NDZA 4A3DG 4KAXA 2OUKA 1E2MA 1PHJA 3F2DA 2MSCB 1E2JA 4GOPC 1G6PA 3K70B 4D4LA 1MO6A 4JBYA 1OH7A 4GZLA 4Q18A 4DUGD 5H8WA 4IPCA 2DUDA 2R7FA 3JAMi 2CVFA 3SS8A 5JEAH 3BK7A 1VHLA 3THOA 3K09C 5HKKD 2WKQA 3NENA 4B2PA 2IF2A 4RFVA 2ZSFA 2OHFA 5FFMA 1QVCA 2E75C 3HU1A 3EA5A 1UBCA 4LFBL 2J0VA 2CQOA 3CP0A 2OTJA 2BOVA 2XSZA 4PZZA 4DLVA 4B3FX 2A6EC 4BA2I 1YR9A 3D4RA 4KI0A 1E2IA 4JVSB 4TYPA 1YZUA 3R8FA 1UDXA 3CF6R 1Z63A 3BJIC 2O5JC 4PPGA 1WXQA 1O7IA 1E9EA 1PUIA 1S2MA 4Q00A 1R8QA 1UKEA 2C35B 1NIJA 4BUJA 1OFIA 2DFNA 4RKFA 2JLVA 2CL0X 2P0EA 3EIHA 3KLWA 1P61B 2BM0A 2GXUA 3QXSA 1FYCA 1IN4A 3A1TA 1MO5A 2RHQB 4MQBA 1KK3A 1XP8A 2IEYA 1E1TA 4URZR 4Q9KA 1JJ7A 3QKSB 4HIMA 3ULPA 5JWHA 5EE9A 2BHRA 2ZTEA 4TKOB 4NYMR 3CW2C 3B7GA 4L5QA 1PUJA 2YOGA 1XCGB 2W6JA 4KYUA 3DMNA 3A4LA 4B3SL 2AR7A 2R6FA 3I55A 5DLQC 1W5SA 1CTQA 1ZP6A 4POGA 3GJXC 2HYIC 1Y1VG 3EBEA 3S15H 1OKKD 1QZHA 2NPIA 1Z2CA 1N33Q 2HXSA 4PC2A 4A3JG 3HYTA 1G5PA 3U6KA 2O0KA 5IE8A 4HJ5A 1JEDA 2N8NA 4LF4L 2UUBL 4DK0A 4GPTA 4CT5A 3OE7A 2RCNA 4WZAE 1WOCA 1G8FA 5CLLA 4A93G 3H0KA 3QPUA 3D3QA 3KF6B 1NG9A 1UJ2A 3HOYH 1YZLA 3KOJA 1ZBDA 2AXPA 1PH3A 3QJYA 3QKRA 4LBVA 1XD8A 3ZD6A 3BH6A 1HZCA 3PO3H 4DK3C 2R6DA 4NYJQ 3FOZA 3C41J 4FWTA 1XJQA 1FGUA 2D2CC 2V7QA 1GKHA 2AHOA 3ZD7A 4YC7A 1J8YF 2QMUA 1SXJB 2ASBA 4HDQB 2QI9C 3GJ3A 2PBRA 3OYYA 2A19A 4M1SA 1RJ9B 3KJEA 2GVBA 1KI3A 5CJ2A 4DC9A 2AN9A 2QEQA 4A3KG 2Y0SE 5E4FA 2JA7G 4JI3Q 2XZLA 2A5GA 2IHFA 1HEIA 4B6EA 4A1FA 1HR0Q 1ZVQA 4HUTA 3W6PA 4DPGA 1V1QA 3GEHA 4RFSA 1COWD 3FPPA 2KCTA 2J41A 4NTZA 4QNRA 1DD2A 4HLUA 3A8JE 3DMDA 3SN6A 3SYNA 4G5GA 3MJHA 4L5TA 1JMCA 1GL9B 2ANBA 1T5IA 2A2ZA 2GAOA 3NHBA 4Q47A 3WNCA 4R71A 1CTMA 1Z08A 2J7PA 3OFNA 4Q9IA 5FTNA 2XB2A 4GL2A 2QM8A 4LDJA 4A0RA 2HIVA 4GNXB 4KFTA 5FPKA 3SOPA 3IBGA 2JLYA 1YQTA 4OK6A 1T9HA 4R2HA 4U00A 5LMUL 1CR0A 1MO3A 4OQNA 3GLHB 1HT2E 3LD9A 2WAQG 1R8SA 4Y7NH 2F1HA 4IOLA 2BBSA 2D7CA 3GP8A 3C16C 4A0FA 5IP9G 2ZRHA 4NCHA 4MNOA 3KJOA 1M7BA 1II9A 4OQFA 2BEKA 4Q19A 2VY3A 3Q5DA 4JCVE 2RB4A 4JVNA 3IILA 1H9MA 4DUYQ 2VH5R 1D9ZA 1KMHB 2G9NA 3TJZA 2ZQ5A 1E22A 3I56A 3TGPA 4N3NA 5GQOA 3T1HQ 2ZJQA 1S1MA 1P2VA 1R5OA 2B8WA 4BFTA 4QGUA 3CONA 4JBKA 2PCFB 3TQYA 4DT1B 2YTYA 3F2CA 5C3EH 3DZDA 2HCBA 3KKMA 3GQBA 2UUCL 2DPXA 3OF5A 3AF2A 1YJNA 2J0UB 1EX7A 1T0JB 3KF8B 1WRBA 1AGRA 2KBNA 3B6EA 4RD6A 4BFZA 4BY1H 2N1BA 3CWZA 5L3SA 1XTSA 1K6MA 2GILA 4MDFA 4RCYA 3PCRB 4PO9A 1GHKA 1CKNB 3TREA 4WZ6A 4YXWD 2ZYVX 3THXB 4BLPA 1CKMA 3K0XA 3EC1A 3N5CA 4LWZA 2FOLA 2XJ9A 4D0GA 2A3RA 1CF4A 1IQPA 5ELOA 1KDTA 4IW3B 2F1RA 1AKEA 3RS2A 5FPTA 4CEHB 1IN5A 2JLRA 3TW8B 1OTCA 3HOYG 4OK5A 4M9SA 4P0TA 2XGTA 4LYAA 1E1OA 1Y8NB 1GOTA 2QTVB 2ZT9C 1C0AA 2FG5A 3PO3G 2XNSA 4LF7L 3CMEA 3W5OA 3E9IA 4P72A 3CO5A 5CJPA 1Q0UA 1P2SA 1OB5A 1CIPA 2VNUD 1FL0A 1VQLA 4AKIA 2KHJA 3S1NH 2D0PA 2NO7A 3UG6A 2A6HD 1FNMA 2EFGA 5CDFA 2BMFA 2JA5H 2VLIA 1GL6A 1VG8A 3IHWA 3J7ZC 4O2RA 1JJGA 2BKUA 3GTGH 3T15A 1JJCB 3E5HA 2GBLA 3W5JA 2P67A 4GRAA 3WMEA 3RRYA 3WRYC 2QAGC 2JA6G 1WA5A 4DDUA 4R2IA 2LMCB 4Q4HB 2D2FA 5F2EA 3N2IA 3VX4A 3LQQA 5SZHB 3X1YA 4LUOA 1QHHA 1QHNA 3P32A 1BDOA 4B2LA 2O8EA 4H1VA 1WCMG 4DV0L 1HNZL 3D7MA 3OEED 3VR2A 4A3BG 4WJ4A 2XOKD 4JKIA 3SNHA 1E99A 3T53B 1XWIA 2DR3A 1KQSA 4DCVA 3AVQA 1EIYB 1DARA 1P9RA 3KYHC 1QG2A 3N6RA 1IBMQ 1KO8A 3F3YA 3RS4A 2JJ1A 3BERA 1S3SA 1SKYB 2ZR9A 2MMGA 1CR2A 1PYSB 4DR1Q 1GTVA 2AXNA 2JLUA 1FZQA 1PVOA 2QROA 3KF6A 4M4SA 5EAYA 2DNCA 4LJYA 3GTKH 2B29A 1DAGA 2BV3A 2QT1A 4MZ9A 4C3HH 1E9SA 1IYJB 1NIPA 2A7QA 2IYSA 3LXXA 2HXYA 3QBTA 1NBMA 3QNUA 1P16A 1FVIA 3P27A 3WHLA 3JZMA 1V5WA 3WYAA 3EW9A 4EKDA 3MSXA 4C0SA 4Q4AB 1TADA 2ZJBA 3KQLA 4J15A 2C8VA 1FL9A 2WWYA 3TBKA 4LCBA 1X65A 3T06B 2BE5D 4AG6A 3K9GA 3KQKA 3U9SA 4CW7A 2F1IA 1Z6TA 2ORIA 1MABB 2WAXA 5B30A 2KCCA 2JK8A 2L15A 4Q01A 2MFIA 1IN6A 4JS0A 3H0GH 3H15A 1HR0W 2ALYB 1W3SA 2Q3HA 3D0FA 4A3GH 4Z51A 3UK6A 4BY1G 1HV8A 2W6IA 2ZRBA 4WBSA 121PA 1W0KA 5CDFE 3U7HB 3TVDA 2UUAQ 4IFEA 3ETLA 3REFA 1GM5A 4LF9L 1CU1A 4DEYA 5C18A 3OEHA 1G20E 2OO7A 3S14H 2ZRJA 3NWJA 2IA5A 2YOHA 4LK2A 4DV2Q 4EQ6B 1PH9A 1Z6HA 3CRW1 1FP7A 4ZI3A 5E7JA 1O78A 2A9KA 1G18A 5JI2E 3IHLA 2OILA 2VSFA 3T34A 5BYKA 4TYWA 4JLMA 3LWUA 1LFDB 5GAEC 3GLHA 2Q0HA 5FOVA 1XF9A 3UATA 2WB1G 1J90A 2K4KA 3O8DA 1IZ6A 3R20A 4JJZA 2QPOA 3A74A 1HJPA 1FTNA 3S16H 2CK3D 2OEPA 2ZR7A 1K8GA 1HYQA 3HOVH 3RS5A 2ZJYA 3KB2A 4D0NA 1HNXQ 4OQLA 3HOWH 4AURA 2ODNA 1N33L 3VHLB 2R7ZH 5D3QA 3TVTA 5P21A 1X6VA 3CRMA 4HLDA 3EX7C 3MXNB 4YWLA 5KNDA 1G3RA 1KMHA 2JA5G 2R62A 3DKPA 2GZAA 4PZ7A 1WQ1R 4NBSA 4UXJA 3VKGA 1YRAA 1YU9A 1L1OC 1GKIA 1N5IA 3A1SA 1TWHH 1AQYA 2J87A 3MWYW 2WJJA 3P4YA 4LI0A 1S3GA 1MJCA 1NBME 1SVKA 4QC2A 1EFCA 1KNQA 4TSFA 3RHFA 3WNBA 1DPFA 2CL7X 4IFDI 1H8ED 3E9HA 2JJ2A 1XMOQ 5IYDH 5J40A 1KHIA 2IL1A 4PXAA 4GKJL 2EW1A 3ZQ6A 3I5YA 4YCVA 1LY1A 1MRSA 1NVVR 2JA8G 3CX7A 2OWOA 4A6PA 3I4MH 3GCGA 1CKNA 2ZUCA 4IDHA 2QAJA 1TQ2A 1VQ6A 3GDEA 3ULJA 1HZ9A 4QJ5A 2A6ED 2OAP1 3AF1A 3QVUA 2EFCB 4JJKA 2WJYA 4Q03A 4DUZQ 2A68C 1AE3A 1JI0A 2C9CA 1RC8A 4QQBX 4CEHA 4R9UC 1Q1ZA 1E1RD 3AVPA 1A62A 1NLZA 5GJWC 4UPAA 1VDZA 2QY9A 4DHEA 2DY1A 4JI3L 3PUZA 3ZJYA 2HCJB 4M9XA 2DN8A 3PUYA 5EP1A 3CPFA 1HR0L 1U99A 2WP8J 3SFZA 4A3CH 1H9SB 1XRJA 3KX2A 3CX8A 4X66Q 3MUFA 5H70A 5TMPA 2VPPA 1U81A 2ZIAA 3TNFA 3HOUG 4NH0A 4KKTA 4C7OA 1X86B 3HWSA 5DO9A 5G41A 2Q2UA 2SHKA 1KSGA 4BEBA 3QPVA 1EWIA 4JV5Q 2I5MX 1DO2A 2D74A 3M9BA 1IBLL 2C5LA 4DNTB 2CCJA 3Q3JB 3GO5A 4TTQA 2UKDA 2G6BA 1VQ7A 4GS3A 3PUVA 2ZYWX 3GLHE 1HCZA 4RVCA 4ZKEA 5AJWA 1GUGA 4IOCA 2P6NA 1X54A 2QPTA 1GVNB 2OT3B 3H0GG 3ICEA 2PJRA 1BBWA 2QP4A 4WIAA 3I4LA 1OHHA 1ONBA 1GRRA 1X3SA 3RRMA 3QQ5A 4I1UA 1Q3HA 1KRSA 2D7DA 4LJZC 3OW7A 4BA1I 2K5HA 4A3GG 3CCRA 1AS3A 1R7RA 2VHQA 4RD0A 2NTYC 2F3IA 2Z6KA 5DGXA 5J4HA 4DR5Q 4QGHA 2F43B 4TL6A 1VMAA 4B71A 3S1QH 1JR3E 3W6NA 3OTOQ 1GP2A 1G5TA 4A3EG 2GN5A 1C1YA 3I72A 5FOWA 2VHJA 1NE3A 4I81A 2C98A 1ZUNB 1FFHA 2IYQA 3VX3A 3PO2H 4JMPA 3EPKA 4HR7B 4DV1L 4AQYQ 3MFYA 1N6LA 3GFPA 2BC9A 1RIFA 1IAQA 4RMFA 1W2BA 2JJ8A 3L2PA 2CHQA 4AKEA 3HOVG 3HOZG 3HOWG 1CR4A 2NQ2C 3OW2A 3DKVA 1Q7YC 3SR0A 3TAUA 1R9TH 1KAWA 3KKPA 1XDBA 2YWHA 3BJUA 3NEMA 2OQKA 2V1UA 1Z6AA 1OIXA 1FTSA 4H13C 5A35A 1N2CE 2YHSA 4JLBA 3NDPA 4P3YA 3TLXA 2ZAMA 4BLOA 3B85A 3AP2A 3CRQA 4LY6A 2RMKA 2NZHA 5IDVA 2XXAB 4NB3A 4RD1A 2JA9A 4RG1A 1MT0A 1R0YA 2WWHA 3CRVA 5IYDG 1Q90A 2IY5B 5KYKA 2WJGA 1UEBA 1OH6A 2ZETA 1GJXA 3AB9A 1D8TA 1ODFA 4RY2A 3I4MG 1CKEA 2W2VA 3CF5A 2W2TA 3CMAA 2OCPA 2OE2A 1G7CA 3FHCB 1ESMA 3I3SR 4LWCA 4B43A 1Q8KA 1IXRC 1I4DD 2N42A 1R0XA 3LDAA 2F3TA 4JVLA 3NTUA 4KLZA 3MEFA 3BS4A 4DCTA 1G5RA 1W49A 2ZS7A 4Q1CA 3ONWA 2PMDA 2VO1A 3IUYA 4AK9A 1I4TD 1N36Q 1OT3A 1N6IA 1YZ6A 2HEIA 1Z0KA 5HE9A 1GUOA 3PEUA 1X8JA 1XPUA 4A3CG 4WXRA 3SE0A 3JZAA 1UE5A 2ANCA 1P73A 3TEHB 3CC2A 5GVSA 2ZJ2A 1SKYE 1IBML 2R8RA 3GMTA 1JQLB 4IXNA 3U4QB 1AJEA 3CZQA 5H1SE 4DB4A 4AYBE 2GTPA 3TR5A 4YONB 2IYWA 3B2EA 4PR0A 4DR1L 2V8OA 5EXPA 1N5KA 1PH2A 2B7BA 1QHIA 1G19A 3J7A5 3FTQA 3A37A 4A76A 1KC8C 3CC4A 5L3RA 1K0RA 3I4NG 2JAQA 4A8JA 1FQKA 1GG2A 3CWQA 2X2EA 3B1VA 4MKIA 2JEBI 1L2TA 5M3FH 2UXBQ 3U5ZB 1Z07A 3J81i 1E79D 3K0CA 1GNQA 1JPNA 1JBKA 4OONA 3ZZUA 3P4XA 4JBMA 4EPXA 1E9AA 1HY3A 3AUXA 1XU4A 5LB4A 2LCFA 1M7GA 4P71A 1Q3TA 2RHDA 4KVAA 3F8TA 3HKZE 4BFUA 3R8CA 2EWVA 2QZ4A 3K0FA 4E5UA 1NG1A 3CH4B 1JT8A 1K8AC 1CP2A 3NH6A 1GKYA 4JLNA 1S40A 1N5LA 2GRJA 2QL6A 4ITRC 2GCOB 4LHXA 1YHBA 4JLPA 1KO1A 1KIMA 4C4PA 4YCWA 1Z9FA 1QHGA 1VG9B 3CPHA 5IF9A 3CCJA 3A4MA 4MKFA 1ZMXA 2UU9Q 1AIPA 5J4KA 4B32A 3EASA 2UUAL 4ZDKA 2B92A 4FMDB 4LV8B 3Q9LA 3LW7A 2ZRPA 3OAAA 5GADC 2QN6A 2L0XA 3K0EA 1AE2A 4US0R 5F3WB 2IX0A 3H3VI 5FLMH 4DV2L 4V0KA 2BWJA 2C2HA 1VKJA 3VR1A 2MMCA 1YI2A 1PA6A 3ASYA 4XD7D 2EDGA 3S1MH 1FNNA 5FR2A 4C3JH 5M3MG 1N6HA 1BKBA 4Q5IA 2EVBA 5BN4A 1IW7C 1JXMA 2IYTA 1LM0A 1XXHA 2QNRA 4OK3A 2AX4A 1D9XA 1VS0A 2ZM6Q 3QG5A 1NKTA 1U9IA 1RRCA 1X3FA 2EIFA 5IYBH 3PCOB 2BEJA 1SVIA 3ULLA 4IHQA 1I4LD 2W0MA 5CYPA 1HNXL 2GXQA 3IKJA 4AC9A 3BAFA 2F43A 3QKUA 1MOZA 1KXLA 3CPEA 4TLBA 2CWPA 3U6BA 4JI6Q 1ZNZA 2YV5A 3EZ2A 2PT7A 2WPDD 1FOEB 1W4BA 3F1ZA 1Q21A 2FGKA 3K0AB 4UNRA 3U7FB 1UFQA 3OESA 3UWKA 1D6JA 4W5HA 2RHMA 1AK2A 2QENA 5CM9C 3FYHA 5E7IA 1A82A 1LF5A 2WWXA 1V8QA 1XMOL 1T5LA 1H95A 1M2OB 4CEJA 4P74A 4OHYA 4OYHA 1E2WA 2B63H 1PYBA 4UNPA 3A1WA 1FJGL 4R4CA 3SU8A 3J80i 3LFUA 2ZJOA 4DUGA 2FFAA 1N25A 4PC6A 2ATXA 4LBWA 4CYMA 3Q7PA 3WP1B 1TWGH 2CBZA 5DHFA 2CE7A 4HJ7A 3NBFA 1IY2A 1CS4C 4DUZL 2IYUA 1YHQA 2FPLA 2YVUA 4Q9LA 1N0VC 1CJVC 1SULA 2Q9AA 4JI2L 1ZKOA 1VQCA 3L0SA 4M53A 1RPZA 3QKRB 4DVGA 4EJSA 1Z83A 3NXSA 4JZKA 1K8MA 1LABA 1FMJA 1OKKA 3KJGA 3LLMA 1CXZA 2ZJRA 4YMUA 2AHOB 2CLSA 5JSZB 1LUZA 1BO6A 2OXRA 2X2FA 3EIQA 1UWVA 1G9XA 2ODBA 5J4LA 4EUNA 5EP3A 1UADA 3TAHA 3W1GA 2KBFA 4PAQA 4JV5L 1UEIA 3FE2A 4Y0AA 3B82A 5LD2B 2PMZE 4BFYA 1ELOA 1RFLA 1X8LA 2KCMA 2HQLA 1KI7A 2Y8EA 1XXHE 1C9KA 1RYFA 3RWMB 3IBYA 2WAYA 4FCTA 4F4JA 3K7AH 5IT5A 1Z0FA 4IDQA 2NO1A 2VS1A 4JT2A 3ZVRA 5K8IA 3K53A 2BE5C 2D5DA 2Y0SG 1G17A 3DM3A 1DO0A 4RFSB 2QGZA 4QBFA 4JI8L 1CJMA 3BWDD 1Y1VH 2WMOB 2ZTDA 2K5NA 4DR5L 2WIBA 3FKQA 3MCAA 4A3JH 1Q1EA 1Y14B 4M1KA 4RZ2A 4C0QC 2V4DA 3OTOL 2JCSA 1WF3A 3A58B 2WSSD 1IBKQ 3JVUA 4LC1A 4KN7C 4AIIA 2CKZB 5FLMG 3ZYCA 5JRZA 3QKTA 4ZCIA 2JJQA 4KKSA 3W3AA 3ZZTA 1OIVA 4LF8L 1HE1C 2P3SA 3KUDA 3DZ8A 4GBMA 1GRQA 4NCIA 4AQYL 1ZIPA 2I5HA 3UWOA 3ZLJA 2YU9H 2Z4SA 1JAHA 1ZNWA 3ZIAA 3PF4A 1COWA 3VDYA 4CIDA 1B0UA 1ETUA 1P8LA 4JLOA 2A68D 4ACAA 2N3SA 4G7HC 2DFTA 1PH5A 1XBTA 3NVAA 4FWIB 5KPDA 1P9NA 4PQYA 1G64A 4DLSA 2ZTSA 4WAUA 3PENA 1AZTA 1LTLA 3V9PA 3I61A 4MDEA 3UMFA 5JS7A 1ZRHA 1OXSC 4C0LA 3Q85A 1NVXQ 1VQGA 1KMQA 3T1YQ 1RW4A 2WWGA 3DL0A 3QF7A 4A3KH 1FX0B 2R6CA 3FWYA 4MGKR 5FOUA 4URUR 4Q1EA 4D4JA 4MRSA 2GCOA 1E6CA 4JYCA 2D3WA 3TMKA 4A3IH 3UDXA 3QXHA 3TS0A 5BQ5A 5IYCH 2IS1A 5EE3A 2FA9A 4ARZA 1NVWQ 3GTJH 421PA 4LX0A 4ZV4A 3S2DH 4KHPQ 1G3QA 1Q12A 1EFTA 2B63G 1OE0A 5L3SB 1NN1A 5GJCA 2A69C 4G5SA 3EZ6A 2G83A 2PEYA 4TL9A 4ALPA 1R10A 2EVWX 3G6EA 2O8DA 3BU2A 4JYAQ 1ANKA 4R4OA 2HLDD 3GJ8A 4NYJR 4TLDA 4W5JA 521PA 1A5TA 4FDBA 1U5KA 1LTQA 4A2PA 3LA6A 2BBOA 1HQMC 4DNIA 1LVGA 2FEOA 1W44A 3L7ZC 3AEZA 3FFBA 3SBEA 4HAXA 5HCIA 2ZXUA 4JG2A 4DV7L 1VIYA 1MO4A 4NONA 3C5CA 4A3FG 5EP4A 3S1AA 5B58C 5CB6A 1TPZA 2GXSA 4P4UA 3LQRA 5IP9H 1CRQA 3HGBA 4YXWA 2IT1A 3SDZA 2YKGA 2V55B 4X6AH 1W47A 2YTVA 4JC0A 4NXNQ 3ZQJA 1VQJA 2DCUA 4D6PA 3PVSA 2P6UA 2NVQH 1XNRL 3EXAA 1MKYA 3K0AA 1MV5A 2Z6VA 4L5SA 3GJ4A 3FMOB 1JPJA 5AUOB 1ASZA 1OYWA 4LJ4A 2OV2A 1KKLA 3J81k 4XWKA 4OWXB 2E9SA 1HNWQ 1N6NA 4UP7A 2ZSAA 1IXZA 1QHHB 2O8EB 3K80C 1M34E 4KSBA 5TXGA 2J1LA 4GLAC 1P9WA 2RGGA 1HZBA 2BMEA 4M1TA 1WYDA 1N6RA 4R1JA 1NSTA 3RANA 4KN4C 3GTLH 3HU3A 4POFA 5JLJA 2NVTH 1AH9A 4LJAA 1BMFD 2FZLA 1OV4A 2GK6A 4JI1Q 1PMRA 3NELA 1DOAA 3O8BA 1W36B 1XZPA 2GAAA 4C3ZA 1A2KC 1ZCBA 2GCNA 1W0JD 1E2HA 1HQCA 2F55A 4QG7A 1FUKA 4NHOA 1D2MA 2K14A 1G3MA 1CEEA 2BDTA 1S1CA 1T8TA 4DWJA 1QF9A 1P62B 3OEEA 3SJCA 5JRJA 1E4VA 4LFAQ 5L3QA 2FFHA 1NJFA 4AI6A 4IVQA 3RLFA 2H7VA 2RHSB 1Y63A 2UU9L 1L7VC 4BLTA 1E32A 4ZCMA 2E5LQ 2OAQ1 1CJUC 5J4VA 5JSZA 4RD3A 3MAAC 2VP6A 4B3TQ 1ZAKA 3H86A 2WSMA 2PMKA 3C4JA 3I32A 3K9HA 4S2EA 5AUQA 4E03A 4Z1MD 4K0KL 3A6PC 1YNJC 3MWLA 4LBYA 4UXHA 1ZM4A 2GZHA 2DBYA 2Q21A 3T56B 4F92B 1R4AA 3THYB 4TQ9A 3U58A 1NMGA 2CXXA 2XTMA 1A1VA 2QGQA 2HUPA 2ZRAA 1OXXK 2BA1A 2JA6H 3KUCA 1R5BA 1YZGA 4IJLA 5C4XH 5JJIA 1SXJC 3DO6A 4A3IG 1WCMH 3CAMA 1YJWA 5IYCG 2ZM6L 1DTSA 4A3BH 3O8RA 1S8FA 3AVUA 3AVXA 3UDGA 3B60A 3CBQA 3AP1A 2IXFA 4B76A 3A36A 3U61B 1OB2A 4DV3Q 2FMXA 1KO4A 1KK1A 4HEJA 3J81j 1N32Q 2FWRA 4TN1A 4ZKDA 1KI9A 3NEYA 5AWFC 1XTQA 1KJZA 5JWRA 3QPWA 4PZ6A 4R98A 4HSEA 3AUYA 3T1VA 4GI7A 1T3LA 2WKRA 2ZE5A 4HAWA 1OJLA 2VW9A 2VQEQ 1ZCAA 2VQSA 4WJ3M 2KSQA 1WE2A 4GSYA 4HAYA 2GJSA 2QU8A 5SZJA 1DAKA 2MSDB 2VEDA 3AEVA 1QZGA 4G7ZC 3W34A 1VQ9A 1IONA 4IOJA 1FR3A 3U50C 5DN6D 2CCKA 1L4YA 5GAGC 5AUNB 2EWWA 4DKAC 1K8RA 1QVAA 2NPFA 4TVAB 3ICQB 3DM5A 4GNXC 1CJTC 4ZCLA 5C4MA 2A5JA 3FPAA 3PUWA 1G3IA 1QRAA 3ZS8A 1UE6A 2LXJA 3T12A 4U7DA 1D2NA 1U90A 1Z7TA 3CXCA 1DE0A 1PJRA 4QGFA 2JXMB 1VG0B 4HB2A 5EE1A 4X8MA 1KSHA 1Q82C 1NY5A 2DWOA 2OXCA 1FX0A 1BIFA 2PX3A 2K75A 3EWSA 1ZUHA 2GJ9A 5DYGA 5BR8Q 3E0EA 5FOSA 2IS2A 4JK1C 4BXXG 3UXMA 3RC8A 1EOVA 2V6IA 2JASA 3VA7A 1A8VA 3KJIA 3PITA 3R9XA 1E24A 4A3LG 2FGJA 2OSBA 621PA 1MRNA 3HPRA 1EUJA 4PHHA 4UNSA 4B3ML 2JIZD 3CCMA 4OX9Q 4TL8A 1ZD9A 2FF7A 4IOMA 4PSVA 3SYKA 2FPMA 1NN5A 2RGBA 4DDTA 4I4LA 1XTJA 1IW7D 5G40A 2PCLA 1XTDA 2KENA 4GOPA 4KKUA 2V6JA 2D0OA 2CW0C 1SR3A 5JFGA 4ZO4A 4TYQA 4PQRA 4GOJA 3B1YA 5C0XI 1GD7A 2ZTCA 1H8EA 4BY7G 3FHWA 2QSZA 3K09A 3AQQA 5EZ6B 4RZUA 3V4FA 3QXCA 4C0JA 3FFAA 3WHKA 2ZPTX 1LF0A 2BJVA 1OFTA 2RGDA 1E2KA 5EUMA 5BXQC 2JLXA 1IY0A 2NGRA 2PNHA 4I99A 3QSYA 4JLAA 3AF3A 5FPHA 2O8FA 2ATVA 5AJVB 2WFWA 1HTWA 3PGZA 2QMOA 3RRZA 1MR3F 4GMDA 4BZXA 4F93B 3RNUA 2QQEA 1BS1A 4Q7MB 5M04A 1JB7A 3KQNA 4C7OB 2I4IA 1LNZA 1ZD1A 5LMNQ 3U7GA 3AVYA 1QVRA 4IPGA 4HAVA 4NP6A 3EQLC 4C0KA 4JOIC 1CBUA 4R4TA 2P5SA 1DAFA 3HOXH 1KTVA 1G21E 2R6AA 1B9MA 2ZSEA 3H4MA 5C4XG 1SFOH 1J5EQ 3A8TA 4P4TA 1SMXA 3CF2A 4D2IA 5IWAL 1CULC 2K33A 3GD7A 1D5CA 1HT1E 4H9GA 1N9WA 4XWAA 4BZPA 3UE0A 3VQTA 1PZNA 1A7JA 5HPYB 5F98A 3GEIA 5A0FA 2VA8A 3CW2A 2Q2TA 2IUSA 1MJEA 3TE6A 2JA8H 1DG1G 4B33A 1UBFA 3GLIB 1EWRA 4DXAA 4KHZA 4C0HA 3IO3A 4Q1BA 5KSPA 4FMCF 4XVUA 1U8ZA 2ZROA 4YHHQ 1II0A 4QHYA 3H2YA 3T1YL 5KTYA 4BFXA 3WWVA 4GT1A 4V03A 4DK1A 4LW1A 2E87A 1M1KC 4OKSA 3TSOA 4JL8A 5LBIA 2Z6KC 4PAOA 2R9VA 3GLFA 1LB1B 5CK5A 2PCJA 1BBUA 5GJBA 4KHPL 4LFCQ 5FBQB 5JCPA 5IK2A 1SN8A 1KI1A 2UZIR 4O2DA 3HOUH 5BN3A 3JAMc 1HQYE 2V7QD 3DOEA 3EC2A 3MWKA 4IFBA 3H1TA 3VU9B 4P73A 2BJWA 5M5WH 1W5TA 3UKDA 2GZDA 2O0HA 3THYA 4JYAL 2JDID 4I1OA 4PQFA 3U60B 1I94Q 3EG5A 4IEEA 1UF9A 4ZIRA 2CJWA 3F5FA 3R9IA 5KOYA 4UQOA 5LDDC 1Z8FA 3T1OA 4Y52H 1OW3B 1R0WA 4LJ7A 4FMDF 1TF7A 4TT3A 1NN3A 1KD1C 2IWHA 4ZPXA 2AUKA 1NMYA 1CSQA 4FMBB 3M0EA 3ADCA 4MYCA 1OLOA 4YDSA 4URWR 1UAAA 2V1CC 4ZDWA 4P33A 2YC4C 3KXKA 1B8AA 3BRWD 4NXNL 1HPCA 2FU5C 3W8NA 3GJ5A 1P5ZB 5KDLA 2O8CA 4IEIA 4A3EH 2X77A 5E7MA 3RZOH 4LF5Q 1W46A 1KDOA 4HI0E 1EYGA 1UE1A 2LSSA 1XMVA 1HH4A 4QBIA 4LYFA 4JI5Q 2UVQA 4EAQA 4DR6Q 1KI6B 4JLDA 1T3SA 4KJZA 1X3GA 3R7WB 1QZXA 3CCUA 1TQ6A 4YMWA 5BYJA 1Q57A 3HOZH 1YJ5A 2GCPA 4LF6Q 2FSIA 4RD4A 2W00A 4DLXA 4JI1L 2E74C 1NTGA 1IHUA 3THWB 4YMTA 2D62A 1NN0A 1N0WA 2ZS9A 1IYVA 1E3MA 2B3GA 1Y8PB 2JQOA 3EZFA 2HJVA 1SRUA 4B3CA 4E22A 3I8SA 4EPRA 3LVRE 2QMHA 1EQRA 1KO5A 4LHWA 2ZRNA 4CT4B 4GFDA 3GLFE 4AYBG 1US8A 5HTKA 4F7WA 5EXTA 2A69D 3HOXG 2J9RA 4G5OA 3BZCA 4LFAL 1IY1A 4ZDJA 1SROA 1G8YA 2ZVQX 2NZOA 4FN5A 4CEIA 4A8JB 3PEYA 3BH0A 2P5TB 2E5LL 4RSGA 5ELXA 4B3GA 4L16A 1VQPA 3NC0C 4NXMQ 4HZUB 1IJEA 2AKAB 3I62A 1T0HB 4NKRA 3KQUA 1PLJA 3RN5A 1C7YA 3K8AA 2KE5A 5FBVB 3TR0A 1RRGA 3K0FB 4YY3Q 3BB3A 2QE7D 1DXMA 2ZREA 1QG4A 3X1XA 3UPUA 2PZGA 3HKZG 2VP0A 1OXUA 5K36H 2N78A 1E4YA 2Z43A 3KB1A 4OJKA 4B6FA 3GLGA 4LK1C 2CFMA 2QA4A 1P3JA 1TQ4A 2BMDA 2F3RA 2GETA 3A1UA 4QXAA 4G5RA 3ADDA 1JR6A 1LW7A 4DV3L 4IVRA 1DCZA 1N32L 4L9SA 5FUYA 2FZ4A 4OQMA 4AYWA 4B74A 3DLLA 3BDOA 2QORA 4UNQA 3UANA 2ZM5A 4IPHA 1NMXA 3N2EA 2OFOA 3SBDA 2VQEL 2D06A 2J0SA 2VSXA 3SHFA 3CR8A 5DI3B 1B70B 1YNXA 1ZC3A 1YR6A 3PJRA 4A4DA 1E0JA 4DV5Q 1TEVA 3AKEA 4DJTA 1Y8OB 3I4NH 1XXHB 3S2HH 1ZUIA 2XZPA 3CX6A 4LHVA 1E69A 2QAGA 4QFMA 2O8BA 2Q2IA 1UPTA 2H5XA 4PMWA 3GLIA 3BFXA 2CEAA 2EYQA 4GMXA 3D31A 4DR7Q 4AY2A 4DUYL 2C96A 2VF7A 1J8MF 1S4QA 1UBGA 2ZRIA 4Q4LA 2JJ1D 3T1HL 1DBSA 5A4JA 2VP9A 2ONKA 3FHOA 5FUVA 1S3OA 1U9IC 2WZQA 3VNUA 3RS7A 2JLWA 1N8RC 4UNNA 3LO5A 4JI4Q 1JB1A 1A4RA 3W90A 4AYXA 1WBDA 1NY4A 1FP6A 3ZGXA 2E2IH 4S35A 3LBHA 4URYR 2XEXA 4HB0A 2BKEA 4EX5A 4WA7A 4IJHA 3QXJA 4HJ8A 2I1QA 1A2BA 1W4RA 2NOAA 2YWFA 4DLTA 4CEJB 5FOTA 2BMJA 2YWEA 5KDOA 3EPHA 3BH7A 3VU9A 5M5XH 2RGNC 1SQ5A 3V00A 4GNKA 3UMSA 2E76C 1EQQA 2WPDA 3U3OA 1G41A 1E2PA 1SXJD 5J47A 1VF5C 2QTFA 4B44A 3BOSA 1XPOA 1RVDA 1ZM2A 3EN2A 2F1MA 3U3MA 1H9RA 2CL6X 2F6RA 2RAPA 5B2ZA 3RAPR 3GLGE 5M3MH 5C4JH 1EFWA 1DAHA 2WJIA 2A78A 2G0TA 4PTLA 1TWCH 3MJRA 5DYIA 4EJSB 4NYIQ 4EFMA 2QT0A 1GO3E 1KSFX 3CCVA 2CVHA 3NG1A 1YHNA 4XJXA 4DKXA 4B3RQ 2P2LA 3RN2A 1VF7A 2CHGA 3CR7A 3EIVA 4OO1H 1I5FA 3JVVA 5UKDA 3OIWA 5JMTA 2W6ID 1JJVA 5G3YA 3BZKA 3KL4A 2GESA 2ZU6A 3O47A 2HF9A 4BBRG 2GHIA 1GKUB 4WXPA 4BFVA 2QUZA 2ZVPX 5J4YA 2ZJPA 2IC5A 2BDOA 4RZ3A 2JEAI 4ILEA 3LX5A 2PZFA 5E95A 4TMKA 4FXPA 2QP3A 3P20A 1KI6A 5K36G 1J5EL 1VPLA 2H17A 1OH8A 2JA1A 4NCNA 1SHZA 1VTKA 1Z3IX 2Z0MA 2C04A 4D0LB 5KHOC 3R7WA 1ZC4A 1XX6A 3EWAA 3GLIE 3FKSD 4LHYA 3VR4A 3BB4A 3QI2A 4EPTA 2MO0A 2VHCA 2CHVA 4JI0Q 1ZM3A 4EIWA 3THWA 2IWRA 3ASZA 4V0LA 5AJYA 2O5IC 4TL7A 3GFTA 4YHHL 2LWIA 2EQBA 1RE0A 2XB4A 3GTQH 2BBTA 4GZMA 4JIMA 3I8XA 4A3MH 3EA0A 2NN6G 4LFBQ 2N46A 3TW4A 3PIPA 3M4QA 2CCZA 1JR3D 2BCJQ 3L8YA 3MG9A 4XSHA 4FMCB 4TZ6A 1I6HH 2WVJA 3MLEA 1Z28A 4DIEA 4LFCL 1EG7A 3WY9A 1N3BA 2JJ2D 1VCIA 3SQXA 2QRNA 5EE5B 1Q44A 2R2AA 5J3BA 4A0HA 1QHXA 2OG2A 3VNVA 4HZUA 2WSSA 5FUXA 3CQZH 2ZE6A 3RSLA 3RVBA 3IIJA 3PUXA 1N6PA 4DR4Q 2IXEA 1PH4A 2ZRKA 1YIJA 4JKYA 3AM1A 2FV8A 1I94L 1ASYA 1F48A 2CWAA 3KKNA 2HIXA 1VQ5A 4G7OC 2HF8A 4IDOA 4P31A 2MNAA 1Z0JA 4FIDA 4BRWA 1UKYA 3C7KA 3SI7A 4FI3C 3NBHB 4D4KA 4ME3A 4B3SQ 3X1ZA 1I2DA 2VP5A 2E2HH 2ZUDA 4ARZB 3E1SA 2JGNA 3Q5EA 3AKDA 2J45A 1YEZA 1NMFA 1KRTA 2IUTA 4QJ3A 1J7KA 4QNMA 3NIBA 5EE0A 3GPLA 3UMRA 4LYJA 3EAQA 1BYUA 4L9WA 4ABYA 1F6BA 3IPXA 2QSYA 5FTLA 2OQ0A 5JEEA 2GVDC 4IKEA 3LH5A 2FSHA 4QGGA 4LF5L 5DI3A 3LX8A 2H16A 3KDSE 3EPJA 5ELNA 1P7CA 1GITA 1R5NA 2PQAB 2NIPA 4NZYA 1NI3A 1KIXA 2ZI9A 2ZR0A 4DR6L 3AFPA 2IHYA 4N0DA 4TLEA 5LPNA 4HJ9A 2G3YA 1E2LA 5FL7D 1WP9A 3M3YH 2AD5A 4BBSG 2EU8A 4NPSA 4PANA 1FW6A 4M8NE 1Q86C 4TMZA 3S1AB 2FDCA 3UDIA 3K8YA 4LF6L 1H8HD 1HURA 2CLDX 4NYIR 3JC66 3CZPA 3D8BA 2WHXA 4BZQA 1SE8A 4OO1G 3BB1A 3TRZA 3HR7A 3OZXA 4PHTA 2HLDA 5TDHA 2XZOA 1X3EA 2ECKA 4K46A 4BFSA 1KKMA 1D2EA 4OWTB 1VQOA 3I73A 3BORA 3BXZA 2V1XA 3MD0A 2F52A 3CD6A 2X8AA 2J0QA 2IS4A 3ERSX 1UKZA 3FMPB 3M7NA 3TQCA 1DS6A 4YWKA 2J7KA 1Z29A 2O0JA 3OIVA 4HUQB 4L15A 3QEOA 1OXVA 2VBCA 2NMVA 2LKCA 3VR5A 1GL7A 2K5UA 1G4UR 2WICA 4HIOA 1VQIA 1PH8A 1E2FA 3Q72A 1ZNXA 1DAIA 1NY6A 1X56A 2OCEA 3G71A 1NBWA 1HUQA 2DGYA 4NXML 1SHKA 3RS0A 1II8A 3TSZA 3ZVMA 1TF5A 4L5BA 5H68A 1XNQQ 5GAHC 4YMVA 1E98A 2ES2A 4YY3L 3NC1C 1EESA 3BBPA 4A3MG 1ZU4A 1B23P 3IFTA 2NO0A 4X62Q 3AB3A 1O87A 3N70A 1VQBA 3CCLA 1SMYC 3CNOA 4XOIA 3W9YA 1ZNYA 1GUTA 2VF8A 4Q48A 4AWXA 4JI7Q 5IHPA 1XFAA 2NO6A 2NZ8A 5L3QB 4O0AA 2AL7A 3GFOA 4A3FH 1BMFA 4X66L 3KTAA 2TMKA 2RKOA 3TS2A 4V0MA 1IYUA 1P2TA 5KNCA 1G8PA 3CRKC 1W0JA 3DOFA 2VUMG 2F4VQ 4WVFA 5C46F 4QJ4A 2BH2A 2FSGA 2B8GA 3A7AB 5HY6A 1G8HA 1KI4A 1NSFA 1G7RA 2CLCX 2Z4RA 1DVRA 3KFVA 4KSCA 2ZI3A 4HAUA 3B1WA 3L0IB 4M22A 2UXDQ 1IM2A 5J5CA 2YC2C 1IN8A 2J59A 3SEAA 4N0EA 1DAMA 1W4CA 3EZ9A 5DE3A 3SJBA 2IF0A 3T61A 5AJZA 4DV5L 5K8UA 1S9HA 5JWOA 1ZM9A 1E0AA 2BA0A 4HATA 3A7LA 1VQAA 3S24A 3T1QA 4Z1MA 5LD2C 3I92A 1W2HA 1Q22A 2QPAA 3U4VA 1K73C 3A4NA 2OLKA 4KYIB 5FI0B 4DR7L 3AP3A 1JECA 3OIYA 5CIQA 5FTKA 3IQXA 1WB9A 4TTRA 3H84A 1Y3AA 2WWIA 1G4AE 4MKGA 1EFRD 3KKOA 3P26A 4LJ6A 5H1YA 2QBYA 1U2RA
chains in the Genus database with same CATH superfamily
2RI0A 3MCTA 3S17H 4AFNA 4Z2YA 1G0OA 2MSEB 4F5YA 1NUCA 3R3UA 1HZAA 5WRFA 1IJKA 3MS7A 5EMNA 3ND9A 4M1OA 5IUNC 2EG9A 2FSFA 2AJBA 1X2BA 4CRWB 4EJ6A 3ZY4A 4XFJA 4P81A 4DE5A 2UV8A 4KR0A 3QBVA 1Z0DA 4RZXA 4R01A 4YT5A 2QCPX 3NX4A 4RIIA 4PX9A 4LE0A 5FR1A 2OC9A 3QOXA 3SPXA 1UQTA 3ED5A 2GS9A 4JI0L 3U44A 5HIKA 1KZGB 2W6CX 1Y6JA 2CMFA 2JD2A 1IOLA 3DXZA 4HUQA 1AB6A 1XD9A 1IBRA 1EFDN 4DG9A 1KJYA 4NCJA 3NFYA 2PUEA 1GSIA 2OT2A 5BWNA 1JFRA 3EISA 3I9MA 2YV3A 4KY7A 1SVWA 3PF5A 2BIFA 4B47A 1XKXA 4HY3A 4RTPA 1XPRA 3AF4A 1SVLA 3O2SB 3QFTA 1B0PA 1BH2A 5B4UA 1QVFA 1FUEA 3P97A 1FVFA 3U80A 2C9BA 3OM9A 4HX5A 1YQUA 3VI3B 4RQTA 2H5EA 3D3WB 2W22A 2FFQA 1AXEA 4PX5A 3HP1A 5H16A 4Y2VA 1JZQA 3FUCA 1A3UA 4YN3A 4ZWNA 2PQ2A 3BRWA 4RWEA 3CUWA 4BNZA 1YCHA 2GWHA 4S1WA 3NBZC 2YHIB 3LKDA 3I0MA 5H9VA 4AIMA 2W2MA 3QVKA 2KEEA 3TLKA 4L2IA 3W6UA 1N92A 1SKAA 3RVSA 4F6LA 1LVUA 2UXDL 1G8MA 3HEBA 1D6EC 3GAFA 1G6OA 3W3ZB 2XTJA 2Z8YM 3F98A 3DH0A 5I9LA 1AUXA 3WQSB 2TSSA 3QIVA 4MPJA 4NHEA 4W82A 4TS1A 4BE7B 1WKBA 4HXYA 3P9RA 4P4LA 4XVQA 4WOPA 4GL4A 1FNVA 2ZE8A 1E66A 3VC2A 3HUDA 4IIXA 4EECA 4WK6A 2H0QA 1QG0A 3NYRA 1PLKA 3SHVA 3TBHA 2VP2A 1G8ZD 1UBJS 2O3UA 4WCFC 3MIZA 2IX1A 4CLDA 4GZ3A 3PSIA 3S1NB 3UIEA 4LY9A 4V0NA 3GTGB 1GDHA 3HACA 2AKYA 2W2XA 3ROMA 1VG1A 4M1WA 3GDGA 4Q02A 3PHGA 2E1PA 1IBSA 1L8QA 2QD5A 3LX0A 3FCUB 4TQUS 1IUNA 5KVSA 4RGMA 3VH4A 1EAMA 3WX0A 2YHIA 4E2XA 2ID0A 1KDCA 2CKDA 4FT4A 4OA8A 1DC4A 4JHLA 4NOKA 2V59A 1JAIA 4QGBA 1TZBA 2CCGA 4GN3B 3LT1A 4PVDA 1FU4A 5JECA 4FP5D 2O52A 1P8AA 4MARA 3FOFC 3KAKA 5LP6F 4CM3A 2ZJ1A 2RVLA 2NNLD 1L7QA 2ORVA 4B5LA 4NS1A 3OPOA 3HOVB 2R7DA 4I3FA 4FYIA 5LMNW 1TWHB 1PJBA 3RS3A 4JI2Q 4LBZA 4ENTA 3EX7C 1K28A 1AV7A 4YP9A 1W2GA 4DSTA 1G9SA 4CDDC 2HV9A 1N8SA 1Q81C 4QBGB 1BDMA 2H18A 3FYCA 4JKOA 4OI0A 3GTPH 5FULA 2R92H 1DGQA 5ED0A 1IN7A 4BNXA 2FZEA 3WIDA 1E7SA 2OYCA 4C78A 1MX5A 2HRBA 3L7YA 1S8NA 1MAWA 4XCVA 5ESDA 3R3JA 3CPJB 4E5DA 2VP3A 1JQJC 1KFBB 2Z8XA 5CYUA 1DWQA 2N9UA 1PHPA 5HOQA 1RYMA 5CIWA 2WHEA 3D8SA 3V05A 1MN6A 1ZINA 1MVNA 5E3IA 2HMYB 3PA6A 4UY8C 4BC0A 2CD9A 3ILYA 1PZKD 4PYMA 2JLSA 4EZIA 5FH9A 3NTLA 4J2TA 1ORDA 5B64A 1B15A 5BN5B 4MKHA 4E2YA 2XGJA 5E6SB 2ZU0C 3ZV3A 1U3WA 2NO5A 2QGNA 2CLEB 1ITZA 4EENA 1PFKA 3TIFA 3KQWA 2MHCA 4D80A 1TZJA 3LW8A 1XEXB 3VYVA 3E9CA 4P4SB 2QE6A 5BWMA 3LTEA 4OJMX 2DVMA 5TJ9A 1JFSA 1MKHA 1N2HA 1TVXA 3VSAA 3O74A 3PRJA 5TMBA 5H3HA 2ZCVA 3RAEC 4M9QA 2X0RA 1AUOA 2WJVA 4MGIR 1OQAA 4BVAA 3L7JA 3RJ9A 5BW8A 3D59A 5LC1A 2H2HA 1FC0A 5DTRA 2P77A 3S1MB 4HR7A 2A6HC 1PDVA 1H2YA 5DNAA 3W2EA 2ID7A 1OI3A 1H1TA 2HA3A 2RK4A 3DMTA 1MXFA 1RZ3A 4U9HS 1L8AA 3HP3A 1M0WA 2HDMA 1YJ9A 4Q1AA 4YUVA 1IUPA 2FHTA 3S81A 5CA0B 3SK0A 5BN5A 4OKNA 2Q3MA 4QA9A 4XGIA 5A04A 3LM8A 4FYWA 4F4DA 4KDRA 4K8JA 1I3QH 3RSQA 4IG9A 4DJJA 2CVPA 1A63A 2ISCA 1C7RA 1WB6A 1L4MA 2G9UA 4BNHA 4CMHA 5DLEA 5J23A 2CL5A 5IX8A 1W2WB 4MP6A 4KCGA 4P4SA 3CV3A 1H65A 5DWVA 1R6BX 4EGFA 4A3JB 2B2XA 1GKKA 2WEKA 3LBNA 4DAMA 3HMKA 2JA7H 4O2AB 5JEAJ 2C7GA 1Q7EA 4C1NA 2R3SA 5JEAH 3TCXB 2IRWA 1LZLA 4E21A 1RHUA 2XSZA 4PZZA 1YZUA 3CGWA 1O7IA 1JG3A 2C35B 2BFOA 2DFNA 2JFOA 3LYAA 3QVWA 3P9NA 2RHQB 1KK3A 3QKSB 2F03A 2H7CA 4G8DA 1CD5A 1M2OA 1EUYA 1EWTA 4L3VA 3DTTA 1Z2CA 1IPFA 1JEDA 5FUMA 2LW7A 4O4JA 3V9AA 1UJ2A 1YZLA 2O2XA 3ETJA 4JU8A 4S12A 5K3AA 4Y2PA 2E5FA 4DV6B 4HUTA 2BCEA 3STTA 3G2JA 5JROA 2HIVA 3G7SA 4B4VA 4ZCQA 4FBGA 4AF6A 1C3VA 4A3BB 1U0EA 2P3OA 4B6JA 3GLSA 3ZU5A 3OLVA 2I80A 2B39A 4EHDA 4QXOA 5JXJA 1A9QA 2KW5A 3C6QA 4U2DA 2NXWA 4FNMA 3UK7A 5L3SA 5JC1A 4JXXA 2PRIA 4CL8A 3CMEA 1KBZA 4AW9A 1FL0A 2R8XA 3KDAA 2KHJA 4XXHA 2NO7A 3ASVA 2EFGA 4O2RA 5B1YA 1O95A 1PYOA 2XUOA 5F2EA 2O8EA 1WVIA 4P9NA 3Q88A 3WLIA 3PKIA 3HXTA 1XTUA 3OQMA 4NY1A 5F78A 4E31A 1E9SA 4IXWA 2A1IA 4MSUA 3EGXB 2V6FA 1U7TA 1HT3A 3BZBA 5EYPA 3KQKA 4M55A 3RK1A 2MR6A 5T7BA 2IW1A 2LE0A 1NVGA 1HV8A 2W6IA 1EQAA 3LDUA 2H9AA 3S14H 2OO7A 1TB4A 4TYWA 3PDHA 3FPSA 1WX1A 5IG2A 2R11A 2CK3D 1VJ1A 1I32A 2ZJYA 3QPCA 4B6SA 7MDHA 1U2PA 4DV4B 3VUEA 5A0VA 1T25A 2RGUA 1ZOPA 1SVKA 4V24A 3WNBA 1T8WA 2CL7X 1W94A 2IL1A 3WIUA 3CHYA 3GCZA 2L12A 3RHZA 3AJAA 3ULJA 1OUMA 3OJLA 3COVA 1BVYF 3HDQA 2XNKA 3UJ3X 4P8RA 5CR3A 2VPPA 4DZRA 2G6TA 3V8PA 1CUEA 3REQB 2R61A 3CNBA 2YQZA 1JTEA 3BWVA 5CHYA 4H16A 2DETA 3MS4A 1O0BA 3IR5A 1MC1A 1ORTA 1C1YA 1RWQA 4V2IA 1H3EA 1ZUNB 2GBCA 1O0CA 1N2GA 1E3TA 2B4AA 1IAQA 1XK7A 1LSOA 3HOWG 1CR4A 2NQ2C 3WK6A 4B3RB 3SR0A 3EGXA 2HF7A 4B08A 2V1UA 1JHRA 4MKXA 1MT0A 4HX2A 4A8HA 4A5SA 2OFPA 3Q22A 4YCCA 3I3SR 1QO9A 4GPD1 1L1EA 4GQAA 2BONA 2FEAA 2VO1A 1BMDA 1N36Q 2AXEA 3EEBA 2E82A 1Z0KA 3PEUA 4I8XA 1KC3A 3VBEA 4FKZA 5FFFA 4JAVC 1HUMA 3O26A 5B55A 1NZFA 1RABA 3FLMA 1YZVA 2DY7A 3AZQA 3A37A 3EODA 4WUTA 4Q9NA 3B1VA 1GNQA 3ZZUA 1JBKA 1C8CA 3KQOA 3GZNA 3JD0A 2WJWA 3F8TA 1ZX1A 4JB0A 2QZ4A 3ADOA 3U40A 4CKEA 1NW4A 4RS4A 3NH6A 1E7WA 4RF3A 4JLPA 1MQ9A 1AIPA 3FDXA 1SVUA 3EASA 2WVHA 1YONA 1ZGAA 1H2RS 1ZISA 1VKJA 1BKBA 4O5OA 5EFOA 5KYGA 3IULA 2YS7A 4JXZA 4C03A 1XVLA 4DUGA 3BAFA 2FK7A 4U2FA 1X3LA 2F48A 4UAUA 1ZUNA 1YBMA 2IEGA 5CM9C 1A82A 2D2IA 5JMWA 1YDHA 1F8XA 1T5LA 2H1OA 4X1YA 4PC6A 4K86A 5DHFA 2ERCA 1N0VC 1YZ3A 3F2IA 3NT4A 3A3NA 1CZOA 4UTRA 1CUJA 5K4HA 3O1JC 3I5UA 5JSZB 3IODA 3QPBA 3LQ2A 4UFPA 1UEIA 2QSUA 3RTEA 3LWDA 2DHEA 2FPWA 2Y8EA 3DHNA 3LG2A 5EJ9A 4I5GA 3GH1A 1EWCA 1RBMA 1EEXB 4R2JA 1Y1VH 4C0QC 3DOUA 1K8YB 4KQMA 2XGGA 4PLPA 3PL5A 2WIFA 3L4KA 1WQ3A 2ZB4A 2YU9H 4Z9AA 3G9QA 5ALQA 1P8LA 5IWAB 3T3IA 4DV0B 1ZJJA 2EYJA 3V7YA 2V97A 2Q45A 1VQGA 3D81A 2YJ5A 3TMKA 3DHYA 2C5BA 5ERXA 4RAQA 5LCXA 1EFTA 5I47A 2X22A 1GCIA 1TYAE 4ZQ3A 4J7UA 1R10A 4IXDA 1EE9A 1TC2A 4AUNA 1AHPA 2FEOA 1W44A 3H5RA 5CB6A 3C5CA 3SM9A 2V55B 1KKUA 3AC0A 4UM5A 4C7VA 1F1BA 3BAZA 1IXZA 5CFPA 3FVVA 4XWWA 1NSTA 2JFGA 1KOGA 1N33B 4C3ZA 1A2KC 2V6GA 4JCOA 1DDOA 3NWBA 3U16A 2FWBA 1HLGA 2FFHA 4JVZA 5JSZA 2VUTA 2POQX 3C3PA 5I9NA 3ZWVA 2H52A 3A6PC 3CEAA 3ZV4A 1ZM4A 3TQTA 1VBNA 1ADJA 2O1SA 4BY7B 4OYLA 1I1NA 4E33A 3A36A 2R87A 2ZYDA 2FMXA 1XRMA 1KK1A 5GONA 3W8DA 4GI7A 1OJLA 1QZUA 3IR7A 2QKYA 1BFDA 2WTEA 2WAMA 3PFCA 4WLVA 3RVOA 5JVG3 1GTL1 4ZCLA 5C4MA 1NLUA 1THMA 2IU0A 3PNVA 4M87A 1PJRA 2I1LA 2PX3A 1L4BA 2X5OA 1QO7A 1NNLA 4JBNA 4HGOA 3JALA 1ULAA 2FGJA 1RQ7A 1ZD9A 1Q0HA 3DEKA 4FJ1A 1XTJA 2GEJA 2DY8A 1JFFB 5G40A 3OTQA 3B1YA 2Z5GA 1GD7A 1H8EA 3AQQA 3A6HA 4RVHA 5CDYA 4LGYA 2Z58A 2ZIGA 2ZPTX 2P6OA 1TGVA 1U1CA 1T5BA 3QSYA 2WFWA 4DG8A 1MR3F 5LU9A 5DM2A 3CHBD 3JRNA 4L3OA 1KL7A 3AV3A 4R4TA 3A0UA 4OB7A 4U8HA 5C4XG 4REOA 4RL4A 1JZTA 4WGFA 2ZDQA 3OPMA 1SJ9A 4WKNA 1DZ1A 2BM9A 1X0VA 4HBZA 1KEUA 1K7EB 5ARDA 3WWVA 4OKSA 3KM0A 1DQNA 4B87A 2Z8YA 3JATB 4F86A 1W5TA 3EXG1 3HCBA 3AFGA 3KLSA 4XIJA 4MB0A 4KUGA 4YAGA 1EL0A 3DT8A 3K4HA 3FD8A 4YYZA 1UE1A 3KAPA 4EAQA 3E7WA 4GOMD 1PVDA 2VNIA 4S3MA 3HJCA 4UFNA 3W5VA 2BSQA 4RVGA 3GV0A 4DJ5X 3HKBA 3PEYA 4WUVA 4YBRA 1G8AA 4RSGA 1ECJA 1ILEA 1CUUA 3I3CA 4F21A 6YASA 4KR2A 3TQQA 2KPOA 1PL6A 4BO1A 3E3OA 3C1FA 1IEQA 3UANA 2OFOA 2J0SA 2VSXA 4JV5B 4DXDA 3HKCA 4CUZA 3CX6A 3K58A 3WRYA 3RTCA 3BRSA 2H00A 1C3XA 3KBXA 1I13A 1FSGA 1PJ2A 3NDJA 1YRWA 2VP9A 2G9ZA 5K8JB 1A4RA 1RHPA 2R4UA 1TXGA 4YRZA 3EBOA 4BPRA 1MGPA 2LD4A 5M5XH 4CG0A 2I67A 3NOQA 2A78A 3Q87B 2IPLA 2AOXA 3IFSA 2CXHA 1JJVA 2OWEA 4P0PB 2FRVA 3S2YA 3EXHA 1KPIA 2B5VA 4REMA 3GMDA 4LHYA 3PDCA 4DMUB 3T7TA 5E6UB 3TW0A 2P5UA 1RE0A 4XIYA 2N46A 5DBOA 1JA0A 3WLJA 4C5AA 5F7XA 3WY9A 2QEJC 3C5WP 3RVBA 1YIJA 2VF5X 3KKNA 2IDKA 1EP9A 3EFXD 3OQPA 3OWHA 4MQ4A 4EZEA 4NK4A 1A7KA 3WDKA 5K0SA 2J45A 3DBIA 5C8XA 3ELYA 3KSDO 5FTLA 5JEEA 2O8DB 4QGGA 1L8LA 2BLLA 1OZHA 1LTBD 3KQPA 2PQAB 4KLRA 4DJAA 4LG1A 3UAOA 2R85A 1PDOA 1Q86C 1Q50A 1SMKA 1GCUA 3OZXA 5CW2A 3DONA 4BNDB 1J0BA 3NP7A 4YRDA 1NJ5A 3OKFA 2HHLA 4M1ZA 1KJ9A 2PH7A 3PXXA 4RK5A 3M7NA 4FXGC 3ISJA 3DGEC 3WDMA 5FI5A 2O2DA 4IKOA 3KLSX 2WICA 1GN9A 5BWBA 2OCEA 3WOEA 1HUQA 1Q17A 1V26A 2HLPA 4O2BF 1NHGA 3V5NA 5B3JC 5TGTA 3NOVA 3BBPA 5L3QB 3X2FA 3W5DA 1LI5A 3PIDA 2B8GA 4OGGA 1ZUD1 1KU0A 4KSCA 3W8FA 3DEHA 2JBAB 3C6XA 2HBZA 4A3DB 2QTLA 4L6AA 3BIJA 3KHUA 4M38A 4NFSA 1K73C 1XHFA 1JECA 2DMRA 1Y3AA 4L1KA 2Z4TA 3G0GA 3UMYA 4L57A 4H18A 4YAKA 3ZUGA 1XNJA 1TKCA 2YXDA 1FLNA 4PPQA 3IHKA 4FR0A 4JLVA 3U39A 5ER6A 2EEPA 1E1CA 1R8JA 1IL2A 2X4LA 3CB4A 1U4PA 3TFOA 1KGSA 2F9LA 2VT3A 4CL0A 4TV9B 1L0WA 4HIDA 1ZJYA 4GOPB 2N75A 1BW9B 2C9MA 2PQAA 4N7BA 3MHBA 3Q2IA 3LGJA 4FF2A 1GLGA 3ZYYX 3R5FA 2F8TA 1Z9BA 3DC2A 2B9EA 3U4CA 2OCYC 4BNDA 4XCQA 4EB8A 2FZ5A 3DAPA 4RU1A 3DVQX 1UZLA 5KKNB 1NVDA 2ZYTX 1H2BA 1OY1A 4LY0A 2XJ4A 5FUBA 1GTMA 1J99A 2EFEB 1L3IA 1PYDA 4U5XA 3A6LA 4LIPD 2ZWOA 4EGVA 4UTOA 2I1VB 3FGNA 3EFEA 3B1JA 5JSQA 2PLWA 3DFIA 3ZDZB 5KWVA 2D2XA 3AR4A 3MZ5A 1DEKA 1RKVA 3I4CA 3V33A 4ERNA 1QLWA 4ZIRB 1F60A 5HKKD 5BV8A 4B2IA 3MCWA 2JBAA 1DKQA 3L7MA 3UT5B 3IC5A 2OR3A 1Q92A 2JCVA 3RG2A 1SZCA 1KPHA 3ZKAA 3DP9A 5EG5A 4TUYB 1SPXA 2PFGA 1Z39A 2XAAA 5D3IB 3OMGA 4DV6Q 1GPAA 5JJLA 4YP6A 5KVQA 4V0BA 4OXRA 2BH8A 1A0IA 3W2IA 3CH5A 2HQ1A 4NCXA 1DEOA 1GRCA 4NU0A 1Q91A 1VLLA 4MCIA 2IU6A 3KOOA 4Y2UA 3FCCA 1GG5A 3JQ8A 2R44A 4CV3A 3HJNA 1FU8A 1H0SA 4QGSA 3E81A 2ERYA 2CNBA 3F49S 4JQOA 4PPYA 3LXRA 2F0TA 4M7PA 4OXYA 1VCOA 3CCBA 1KHTA 2F0MA 4BMVA 3BE6A 5J2TA 3R0XA 2IHNA 1E0DA 3D4NA 4HO1X 5CLHA 3OLYA 3VYSB 3THSA 4QM7A 2W6OA 1J5EB 4HZIA 3WKDA 2VRBA 3RCBA 3AM3A 3ZY6A 2Q8IB 2KB0A 2WTUA 4JJIA 3TZCA 5TR9A 221PA 3VPXA 3NDBB 5ALVA 3T0IA 3OE7D 1X39A 1A9RA 2JGMA 1TCVA 4G3XA 3PGMA 3H3FA 3TJMA 3ZNNA 2PX5A 5JW6A 3LT0A 2CC2A 3HPQA 1NYLA 3I3OA 3RF6A 5B2EA 3DZHA 2OBNA 1UM9B 3Q2KA 1YBHA 1X9GA 3OHPA 2IU4A 3NM4A 1ZVKA 4TKLA 3CCSA 2C58A 3G85A 1XA3A 1NSNS 4F8MA 2Q1TA 1Y81A 1QMPA 4RK7A 2XIQA 5CNMA 1FSPA 6Q21A 2QTBA 1W6JA 2OQVA 1EVKA 4R05A 4BNNA 2Z6AA 3SR3A 2K1BA 1SE2A 3KB8A 3CPWA 3BWXA 1PXUA 1NF3A 2B3TA 4QDJA 2X7XA 4DV4Q 4P75A 5LZ8A 1BE6A 2NZXA 1BDIA 4EKIA 1YBYA 2Q4EA 1GNPA 4CG3A 3OZEA 5A5VA 1POWA 2A4KA 1DJRD 3ND5A 1CUVA 1Y5MA 4ED9A 1K68A 3UGTA 1E7ZA 3UDFA 2YDYA 4DV6L 1QV6A 2PVSA 3DCIA 4PG8A 2Y9MB 2PPLA 4HC4A 1OGJA 3I4MB 4AWAA 3RUHA 5BORA 1ZY2A 2DWUA 1AJEA 4DB4A 4RVNA 3ACCA 1W5AA 4YCUA 1TMKA 3V2GA 3U9LA 2FR0A 2H31