1OXUA

Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
353
structure length
353
Chain Sequence
MVRIIVKNVSKVFKKGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDDRLVASNGKLIVPPEDRKIGMVFQTWALYPNLTAFENIAFPLTNMKMSKEEIRKRVEEVAKILDIHHVLNHFPRELSGGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARALVKEVQSRLGVTLLVVSHDPADIFAIADRVGVLVKGKLVQVGKPEDLYDNPVSIQVASLIGEINELEGKVTNEGVVIGSLRFPVSVSSDRAIIGIRPEDVKLSKDVIKDDSWILVGKGKVKVIGYQGGLFRITITPLDSEEEIFTYSDHPIHSGEEVLVYVRKDKIKVFEKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ABC transporter, ATP binding protein
publication title Crystal structures of the ATPase subunit of the glucose ABC transporter from Sulfolobus solfataricus: nucleotide-free and nucleotide-bound conformations
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transport protein
total genus 103
structure length 353
sequence length 353
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2003-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17847 GlcV_C_terminal Glucose ABC transporter C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1oxuA03
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1oxuA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1oxuA01
4P33A 4DR6L 4M2LA 4D80A 3SEAA 4URXR 4JYAL 4RFSB 5CLLA 1TF7A 3AF3A 3RS4A 3T1QA 4JL8A 2JLUA 1SVKA 2CLDX 3R8FA 3W6PA 1VQFA 2NZ8A 1JEDA 1OH6A 1SHZA 5EXXA 1XMOL 1N36Q 3SZRA 4LFAQ 2MMGA 3MJHA 3CZPA 3WYGA 1YNJC 4IJMA 4X66L 4IFDI 1CKNB 4OWTB 3MWYW 3RC8A 2AHOA 5FPTA 2XB2A 1N25A 1Z0JA 2OXCA 1V9PA 1E2FA 4GKKQ 3N5CA 1ZCBA 4HEJA 3MWKA 1DAHA 1GKIA 3REGA 4B2PA 2ZSAA 1E0JA 1SMYC 4LYJA 1HTPA 3I4NG 2ZI9A 1VQ4A 4HJ9A 3UG6A 1MO4A 3HYTA 1G7RA 3R7WA 1L1OB 1D2EA 1RKBA 1U2RA 2BKEA 3B5JA 2IWHA 1UE5A 3SC3A 1N36L 1G8FA 1UBFA 3EW9A 3VX3A 1L2FA 4Q4HB 2E76C 1JNYA 3E1SA 1N5IA 1PLKA 1AQYA 3HR8A 2E9SA 4WXRA 4ACAA 4RD6A 4RJLA 4DLWA 4L9WA 3NENA 1N33L 3RRZA 1Y8PB 3UG7A 3KJIA 4PAMA 1OH5A 4NCIA 2YNMA 4PPNA 4BZXA 5TARA 2A6HD 2BHRA 1GNRA 3W5IA 1PH8A 3C4JA 4B32A 1G6OA 1KAOA 2WP8J 1JECA 4Q9KA 4BUJA 5KDOA 1X9NA 1IN8A 2WBLC 3SOPA 4DUGA 1U8YA 4BEJA 4IFEA 2CWAA 2OWOA 3CNOA 2OFOA 1QBKC 3CNNA 4HSEA 4LDJA 2IUUA 1HYQA 1C9KA 3AVXA 3CH5A 3EZ6A 1KO7A 1Q1EA 3GFOA 4NXNQ 1PH6A 1AH9A 1HQYE 4GZLA 4I1VA 4M9XA 4D82A 1GRRA 4GMDA 1UEJA 3T34A 4Z51A 1E2ZA 4C0SA 3J81c 1K73C 4LF7Q 1SVWA 2PQAA 5BR8Q 2E75C 1VG1A 1UKEA 2W6JA 3FMFA 4TT3D 2CWPA 5LMNL 1NBMD 4B3SQ 3I92A 2CL6X 1J6QA 2QL6A 4B43A 1E96A 3RRMA 2V6JA 5FI0B 1OKKD 2BVNA 2PT7A 3OIVA 4QJ3A 4B33A 3SFZA 1G7CA 4X8OA 5FBWB 1XTQA 3S1NH 1KJWA 1NMYA 1XZPA 4OYHA 3SN6A 3B6EA 5J4HA 1ZC3A 3SBDA 2BCGY 4BA1I 2H18A 2KI5A 1ZW6A 4YQFA 4KBGA 2L15A 3P26A 721PA 4MYTA 3U44A 1VQNA 3QOFA 3GTMH 2BC9A 4O3MA 4DNIA 1J5EQ 2IYYA 2ZRKA 5DIFA 1IBML 2ODEA 4DLYA 5IF9A 1JI0A 3L0IB 2A69C 1GZSA 2R7FA 1A8VA 3AP3A 1KKMA 1MT0A 2HT1A 4W5WA 1P9RA 4V03A 3B78A 3L0OA 3KDFB 4QL3A 3SE0A 2E8GA 3DOEA 3OFNA 5J40A 3EPLA 1OT3A 2BBSA 4QNMA 2EFGA 5DISB 3HU1A 1W4BA 1XTDA 1Z8FA 5DLQC 4B74A 2H1LA 2IUTA 1UKZA 3T12A 1X54A 3G48A 1ZM7A 3CRKC 4YLGA 2AX4A 4UY8C 2DWQA 2Q21A 1V43A 2JA7G 3JZMA 3PITA 3SJBA 5JWRA 3SGIA 4BFUA 4G7HC 4EJSB 3PENA 2R6DA 5EUQB 3E0EA 1SMXA 1MH1A 3CUEF 3AF0A 1E69A 1W5SA 4DR7Q 2CE2X 4MRVA 1E4VA 1KJZA 3SJCA 4IJHA 1ZIOA 4A6XA 4I1OA 3KJOA 4BY7G 1YZTA 1ZCAA 3LBNA 3CD6A 2NVQH 4JLNA 1SFOH 1KSGA 2QBYB 2GBLA 3LWUA 4IPCA 1BYIA 4JS0A 1BMFD 4RKEA 1DAGA 4R4TA 2CK3D 3GJ3A 3KDSE 4WVFA 4HB4A 4ZV4A 4P73A 2ZTSA 4PZ8A 4HJ7A 2IYSA 2PH1A 1HY3A 3KLWA 3CONA 3GJ0A 1DELA 2OBMA 3RS0A 2WOOA 2A6HC 1E9CA 1IBRA 3X1YA 1JAIA 3LBIA 1E2LA 2RMKA 2WPDD 3KKNA 2QZ4A 4LK1C 2J5XA 1DAMA 5SZHB 1A2BA 2PNHA 1KI9A 4NYIQ 4TTPA 2C35B 3RNLA 1TPZA 4BFYA 2D7CA 4EIWA 4JI5Q 2Q3MA 3GTQH 2BA0A 1C4OA 4ZPXA 1S8FA 2Z4RA 3WMFA 3EQLC 3MCAA 3PXGA 3CPEA 3GLHE 2OM2A 2GDJA 3GTJH 4P4SB 3U7EB 2I3BA 1WF3A 4DV0Q 2PT5A 3H0GG 3K70D 1VQLA 4EPWA 2JQOA 4DEXA 4IXMA 5AJ3Q 3KKPA 4S35A 2XGJA 1BIFA 2W2TA 1TAGA 2R6CA 1EX7A 2ZI6A 3QENA 4A3KG 5KSOA 3NG1A 2D0OA 4DV3Q 4H9GA 2D5DA 3EPKA 2ZE6A 5H68A 4EQ6A 1ZM9A 1J8YF 1SXJA 3FPPA 3AH8A 3RS7A 1LUZA 3L8YA 3RLFA 3QF4A 2LXJA 3W1GA 2D74A 4BECA 3KJEA 2QA4A 2P5TB 3L2OB 3LY5A 4JYBA 4IVQA 1EYGA 1SE8A 2IUSA 2W0MA 3VAAA 4D0GA 2QU8A 2Z6VA 5ELXA 4M1MA 1ZP6A 1RL2A 3OOCA 2HCJB 1EFRA 3LQRA 5C0XH 2H7VA 3DXJC 4M9QA 1XX6A 4DR1L 4UNNA 4DSOA 1WP9A 5KTYA 4LK2A 3KJPA 1XCMA 3B9QA 4QKQA 1IQPA 1E2HA 5TB5A 1CR0A 1VQAA 1E9DA 5DI9A 5CB8A 1KQSA 1S96A 1UBGA 1X8LA 1OTCA 2IT1A 4EPYA 3QIAA 3GLIA 1COWD 1ZJ6A 1KI1A 2GEVA 3MWLA 4FWTA 3TVTA 1EGAA 1G5TA 3BGWA 1KMHB 4MH0R 4QG7A 1E4YA 1N6OA 1ZUHA 1RYFA 1G291 2GXQA 3G5UA 1NG1A 1G3IA 2E87A 3SS8A 3K80C 4PSVA 2FSHA 4WZ6A 1YZKA 3QXCA 2ZITA 3PEUA 2YTVA 1G3UA 2R2AA 3V00A 1J90A 2QMEA 1CS4C 1DG3A 1T8UA 3D4RA 3WP0A 3S2HH 4BLQA 5HZKA 1Q7YC 3K7UC 3A5ZB 4JBMA 2CQOA 2FSIA 3HU3A 4GKJL 2OFXA 3J80i 4MA4A 4UJ3A 3LRPA 3IBGA 4AY2A 4YONB 4TMKA 1HT1E 1UDXA 2BBTA 4I1UA 1F2UB 3DM9B 1XMSA 2C99A 2X19A 2FF7A 3ECCA 3FVQA 2PZGA 2J0SA 4LBWA 1CUKA 3I32A 4PMWA 3RLNA 1CU1A 1XBTA 4BLRA 3S24A 3ZH9B 1YHAA 1HNZQ 5BW8A 5DHFA 3UKDA 4C7OA 5EJEA 1YU9A 4HJAA 3B2EA 2ZEJA 4TLAA 1UAAA 3AP1A 2V4ZA 4A3DH 4L15A 4XWKA 5C4XH 2A5DA 2OHFA 4JBYA 4M1OA 3IKJA 4TYNA 2IA5A 4C0BA 1SKYB 1WI5A 4JCVE 3CCMA 4RSGA 4D26A 5J5CA 1SR3A 1AK2A 5KPJA 4XSHA 1Q44A 4V0OA 3L0SA 1F60A 3CW2A 4CZ2A 4AKHA 2D7DA 221PA 1M90C 5JJLA 1GKHA 1TQ6A 2ZROA 5AUQA 5FPSA 5IHPA 5LDDC 5KPDA 1ESNA 1R0YA 2ZRPA 3SNHA 1XJQA 4K46A 3EX7C 3K70C 2I4IA 2R6AA 5FBVB 5JJKA 3NC1C 1HT2E 4A0FA 4MDEA 2GCOB 1KJYA 5D3MA 2MMCA 2G0TA 3K0FA 4ZIRB 1GUGA 2VLIA 4B3XA 2QAGC 3VKHA 3MFYA 4NYMR 2ES2A 4JI3Q 1JJCB 3GLFE 1PLJA 4FCWA 4G1UC 2VPPA 2OZEA 3TQFA 5TV2A 3X1DA 3SBEA 2WAQG 2ZU6A 5JECA 2J9RA 4ZCIA 1NLFA 4YMSA 1FJGQ 1NN1A 3RYTC 5GQOA 4PZLA 4B76A 3KQKA 2UXDQ 1XD2A 2NN6I 4AKEA 4E03A 1QDEA 2JA8H 1R8SA 3QKRB 4V0KA 1MJCA 1TU4A 1KSJA 1X56A 4DR4L 1SHKA 2QT0A 3C7KA 3GPLA 1OH8A 3MEFA 1CJMA 3ZQ6A 1X6VA 3LW8A 2B21A 3EN2A 1XNJA 2FPMA 1GIAA 3T35A 2D2EA 1XNQL 3QJYA 4NKRA 4NMMA 4EPTA 1WJJA 2IYLD 3A5UA 4DDVA 3K0CA 5AJVB 4BA2I 4QFMA 1FJGL 2C03A 5LMUQ 1NKTA 1F5NA 5M5XH 3CNLA 5IE8A 2ZRFA 1OXSC 5JLJA 3AF4A 1Z2CA 3VR1A 1T91A 2GAOA 3UANA 2I1QA 4LC1A 3AVTA 4DUYQ 3K9GA 3OFND 4HDCA 5L3QB 3RS2A 4B73A 3M0EA 3EWSA 4HYYA 2ZYWX 1IN7A 1F3OA 3VX4A 4JI6L 2ZJRA 2DN8A 4FN5A 1LABA 4R4OA 4WOPA 4LBVA 4Q1DA 3L7ZC 2OCPA 2GEDA 1RIPA 2NIPA 5BXQC 1VQGA 3HKZG 5LMUL 5ELNA 2IX1A 3MD0A 3GO5A 4L4UA 5JSZB 1YNNC 3ONWA 4JJKA 3NIBA 5BQ5A 2OUKA 4EPVA 1ANKA 3FHCB 3C16C 3BRWD 5C18A 3PG5A 4R4IA 5KSPA 4A93H 1H8HD 1IJEA 1KGDA 2ERYA 1RJ9B 4LJ7A 3B85A 4OWWB 1HZ9A 3GLGE 4CEIB 2ZI5A 3GFPA 2IF2A 4IDQA 1XDBA 2QT1A 4N0EA 4B6FA 4DDTA 5DYIA 1HNXQ 2IXFA 3AYHB 1CR1A 5EZ5A 1HPCA 1JR3E 5CITA 3TR5A 4B34A 1FNNA 1O7LA 3BFXA 4NU0A 1T3SA 2OT3B 4XIGS 1R6BX 3ZVNA 3A8IE 1UBEA 4LX0A 4KLNA 2IXEA 1Q1ZA 2KBFA 4TZ0A 1RE0A 2C98A 4L5QA 3T56B 4HUQB 3NELA 1VCOA 2GCPA 4J0QA 4NCHA 3UMFA 1FMJA 4RZ3A 2HQLA 1DO0A 2MSCB 3CM0A 2GJ9A 3LA6A 3UXMA 4ABYA 1KC8C 4U7DA 3ADDA 2YWEA 3HP1A 1DOAA 1NVVQ 4JLJA 2EFDB 1YI2A 3W5JA 1A7JA 4LJ5A 3BH7A 1YHNA 4PHGA 5CDFE 1AJEA 5DN6A 3FGNA 1GVPA 4YWLA 3PEVA 1V1QA 5FOVA 5FFMA 1XNRQ 5C0XG 3AFQA 1E2DA 3CBQA 3RC3A 2WAQE 4QQBX 3B1VA 3CF6R 2PL3A 3VMFA 4ARZB 1NL3A 2RGXA 2R62A 1JMCA 3NDBB 2FPLA 3DZ8A 1GHJA 1T5LA 2B8TA 4R4CA 2NQ2C 2YJTD 4YDHB 5JHGB 2DFKB 1VPLA 3R20A 2UUAL 4OBEA 4DBLC 5E7JA 1OXXK 2ONJA 1LM0A 3K0SA 1W4CA 4DCVA 1XNRL 5DLQE 1S72A 4HDOB 2H16A 4KVGA 2VHCA 2KE5A 3J81i 1EFRD 3U3KA 3U3OA 4BFTA 3OEHA 4OQXA 1BDOA 2Q3FA 5A5GA 1Z6TA 1YR9A 2OE2A 2V7QD 4L9SA 1VQ7A 2F1MA 1GVNB 1U5KA 1MRNA 4M1TA 5DNYB 1KTVA 4EX5A 1P16A 1XPOA 1G6HA 2YOFA 1GP2A 2VS1A 2PJRA 1PMRA 4C2TA 3JC66 4Q7MB 1ZYUA 4Q66C 3NE5B 1II9A 4V0MA 3LO5A 1GTVA 1OYWA 5CB6A 4GN3B 4C3IH 3S1AA 4KYUA 2VA8A 1M8PA 4DHEA 3BZKA 4GS3A 1D8TA 1VHLA 4LJ4A 1MABB 1Y1WH 1Z83A 3HKZE 4GSYA 5FUVA 5E3HA 2IBMA 3TRFA 1TWFH 1W4AA 1W36B 5IYDH 4AQYQ 2DFNA 2IYRA 4D4LA 3PJRA 1Y1VH 1A5TA 1DBSA 2JASA 5FUWA 2QI9C 1PH9A 3TBKA 3ER0A 4P71A 1XTSA 1N34Q 4ZCMA 2IHFA 4PHFA 5C4XG 1YJNA 2R93H 2WJVA 3NH9A 4DAMA 5IWAL 5FLMG 4A76A 3AKCA 3A8KE 3KKOA 5LBIA 3ZDQA 4DCUA 1TWAH 1G6PA 1TUEA 4KN7C 2QGQA 1VF5C 1IN4A 4P31A 2ZRMA 2PLRA 5CM8B 3K8YA 5E4FA 2E2HH 1AIPA 4KITB 1AZTA 2UKDA 2REXB 1NMXA 5C2JB 3Q5DA 4UXIA 2GBLC 4Z1MA 3I5XA 2QUZA 1HZCA 1TQ4A 3OIYA 4L5BA 2IEZA 1X8KA 1N34L 1OXVA 4MKGA 4DC9A 1NBME 3F1ZA 4DR3L 1Q46A 3SQWA 1KIXA 1G20E 3UMSA 1JJVA 4CEJB 3CCEA 1XTJA 3K53A 1T9HA 3U4VA 4LF8Q 1H8EA 1VCNA 2QG6A 3FMPB 1ZM4A 1B23P 2R92H 3DMNA 3O8RA 1QHNA 1J2JA 2LKDA 3TGPA 2ZTCA 1T0JB 3PO2H 3M4YA 4MZ9A 4LF9Q 1S3SA 3AEZA 3B1YA 4QBHA 3GEHA 2MQHA 4IFDJ 3TSZA 1KO8A 2A1AA 2GZHA 4D25A 2ZRLA 4B35A 1TMKA 5K36H 2ZUCA 4OXPA 4BLOA 2GK7A 3DHWC 3BB1A 5IK2D 4PR0A 1A0IA 1KD1C 3VR5A 4FMBB 4QGAA 2OCEA 3RRNA 2CNWA 1RYHA 4R7ZA 2AWNA 1SXJC 5DHAA 1PH1A 4AK9A 4QL5A 4DV7L 1CJTC 1IYUA 3FTQA 4IDPA 5A0FA 1K9MC 4EFLA 1XEWX 4UJ5A 2GJKA 3H94A 2EWWA 1IHUA 1XXHE 1E9RA 3TW8B 3KX2A 3LD9A 4JI0Q 3Q7QA 3IFTA 2CCGA 1JPNA 4TMWA 3CMEA 4IOKA 2YWHA 2B8GA 1AE2A 3L2PA 2BMFA 2Y8EA 1K6MA 2LSSA 1HURA 4GOKA 4DXAA 5J4VA 2VQEQ 5J4LA 2DHRA 1EFHA 3BG3A 1LV7A 1VYVA 3SJAA 2YOGA 1N6PA 4FD2A 2JLWA 2ZRGA 1P2TA 1LVGA 2JLRA 1D2NA 2YZ2A 4UNQA 1E9EA 5TVKA 1P72A 4BPBA 4QGGA 1IONA 3K09A 5J47A 4B3GA 4DSNA 4TMXA 3RANA 3I7FA 2C9YA 3T51B 1N32L 3W6OA 4A6PA 2EJFC 1H9SA 5EZ6B 1FQJA 1KK1A 1E1TA 1KMQA 4Q7LA 1DS6A 3CR7A 1VYUA 4LBYA 5FL3A 4BEBA 3J7ZC 2KHJA 2O8EB 3O47A 1L4YA 4DV4L 4FWIB 1Z22A 1PJRA 3BE4A 3PVSA 1FQKA 4H1UA 4D6PA 2GJAA 4LHVA 4IEIA 2MSEB 2GESA 4G5OA 2IHBA 4Q19A 3AF2A 1GWNA 2CE7A 3GJ7A 1XJVA 3LLMA 1E2KA 3JAMc 1KZGB 3FHOA 2EVWX 5FTNA 3NEYA 2FDCA 5DI3A 3WP1B 1YZ6A 3I8XA 3VU9A 3OAAA 1D5CA 2IS6A 3HFZB 2CVFA 4TWZA 4A3LH 3BWDD 2EFHB 3IILA 5G53C 3TE6A 2A8VA 2X77A 2CHGA 1YZNA 2ZTDA 1E2IA 4P75A 1ZD1A 2Q9CA 2O0HA 3CZQA 1W44A 1WQ1R 3H2YA 1WBDA 2PEYA 2QP4A 3IRBA 2OV2A 4JVSB 1KSFX 4B3CA 1CKMA 3ND9A 4JBKA 3QKSB 3CW2C 3CCQA 2GF9A 1E6CA 3VQTA 2PI2A 5GJVC 3IIKA 1N0UA 4LCBA 3B6YA 1NI3A 4R9UC 4JMPA 3LNNA 4GOPB 3CPHA 3B8HA 4Q21A 4AKGA 3DO6A 3Q7PA 1NN5A 4LY6A 5JRZA 4YY3L 4DDUA 4IPDA 4DV2L 1OFHA 4TLEA 4OX9Q 1OHHA 3KTAB 3IEUA 1LF0A 2UUCQ 4AYBG 4I99A 1XEWY 2W83A 1LFDB 2GXSA 2WKPA 4IOJA 4XD7A 4LFBL 5DN6D 3U4ZA 1T8TA 1QVCA 4A2WA 2KA7A 1AQUA 1TF2A 4DR5Q 5CK5A 4PX9A 1WB9A 1AGPA 1KDPA 2P6UA 4DK1A 2SHKA 4II7A 5TXGA 1ZM3A 3RWMB 3FWYA 1A4RA 1Z0IA 1NN3A 3IIJA 4TL8A 5TDHA 5CIQA 5EQTA 2WICA 3U7GA 2ASBA 3OZXA 2AWOA 5H1YA 2VL6A 2CJWA 4DSUA 1KIMA 1B8AA 3GJXC 3W1BA 1ZYRC 1ZIPA 5F3WB 3VA7A 4PFSA 2JLQA 4LJ9A 3T1YQ 2QROA 1Y1WG 2GXUA 2XJ9A 4BGDA 1IN6A 4UPAA 2P2LA 2P3SA 2JCSA 2OTLA 2PLFA 3K0CC 5IYDG 2D0PA 3P20A 4RD1A 5D3QA 1MKYA 4A8JB 3AFPA 2O8CB 1Y1VG 2CMKA 2NN6H 1T3HA 2ZRHA 2WTUA 2O8BA 4Q4LA 1EFCA 2HLDD 2HEIA 2RF4A 2QN6A 2R93G 3Q5EA 3FHTA 1W46A 2VP5A 3EPHA 3F2DA 1YEZA 4X62Q 2VH5R 3RR5A 4WZAE 3CCVA 2PZEA 1N5KA 4RFSA 3M4OH 1VDZA 3ZIAA 5JS8A 1XWIA 4FCTA 3WNDA 2XSZA 3GJ5A 1N6HA 1ODFA 4LI0A 2N8NA 2DNEA 3VHLB 3T53B 2B7BA 3CRLC 3GTGH 1MJEA 2ZI3A 1QJOA 1Y3AA 4QHTA 4DR6Q 1CKNA 1JXOA 1Y14B 1XEXB 2DGYA 4FIDA 4MRNA 4JI7L 4XVQA 4A3MH 3FKSA 3T15A 4JYAQ 2GHIA 1T5IA 4BRWA 4MDFA 1S9HA 4HLUA 1XMOQ 4ON9A 2GRJA 4X62L 1NP6A 4DLRA 2K50A 1CTMA 2XNDA 4X66Q 3M9BA 2HDNB 1DAKA 3OEEA 2NMVA 4ASUD 1NLYA 4IW3B 4OI4A 1L1OA 1RFLA 2R92G 2QPTA 1XD9A 4MGZR 4L5SA 2QSYA 2JLSA 3B7GA 5GVRA 3WMEA 1NSTA 4Q4HA 3RVBA 3ZZUA 4JG2A 3PO2G 2AXPA 2QF7A 4KN4C 2JIZA 4ERNA 3K70B 5F9FA 1P9NA 1W4RA 5KU1A 2XXAB 1XJCA 1XMIA 2OEPA 4DCTA 3CX6A 1N6NA 2AD1A 1I50H 3KB2A 5K36G 4YCWA 4JLAA 4BLTA 1Q1QA 4JVLA 1O87A 3CRMA 4N1AA 4LUOA 2DB3A 2EWVA 3H3VI 4DLVA 1H8ED 1N33Q 4UQOA 4WJ4A 2OESA 1NMZA 3Q9LA 1NJIC 1Q90A 1FP6A 1X6OA 3WMGA 1DGSA 2A7QA 3AUYA 1R2QA 4W5HA 2Q2TA 1K5GA 2ZR0A 1VIAA 1UE6A 2WSMA 4GNKA 2VUMH 1IBKL 4NB3A 4AYBE 3F3YA 4KMUC 1GRQA 4JKIA 5FOWA 4C0KA 4JLVA 3RN5A 1HNWL 2ZRJA 3U6BA 3C14C 3TJZA 3ASYA 2JEAI 1NVWQ 4OHZA 4Z8XA 1L4UA 4OHWA 2RGEA 3OE7D 5G40A 4ZKDA 4DUZL 2WIBA 3CX8A 2BA1A 2OBNA 2W2XA 4X8LA 1YVCA 3IUYA 5M3MH 5P21A 4Y0VA 1QVAA 4JZKA 1EQRA 3TQYA 5LMNQ 3HPRA 1QZHA 2FSFA 3SQXA 3PUYA 3AVUA 3DOFA 1R5OA 4B2IA 1G4AE 3J81j 4OK5A 1BS1A 2IYXA 1BBUA 2R44A 3A1SA 5DGXA 2IS4A 3HOVH 1E0AA 4GMXA 4G5SA 4MUAA 1D8LA 4C3JH 1T0HB 4Q9JA 2BDTA 1KYIA 1OIVA 3JVUA 3SYNA 2GZAA 2KHIA 4DDWA 4QY7A 3MLEA 5FLXc 2DYKA 3W8NA 3KDFA 2WJYA 4OJQA 1EOVA 1IBMQ 2FN4A 2W00A 3T06B 5JHHB 2FX3A 2AFHE 1M7BA 1CLUA 2N1BA 2ORIA 3CC7A 1G19A 2QE7A 4JI2L 2QAJA 1GUSA 2R6FA 3P4YA 4HAXA 4KLKA 5KDLA 4Q7KA 4RMFA 1VQJA 3G71A 1ZC4A 3FE2A 4LPKA 3STBC 1J8MF 3VTKA 2IYVA 4LF4L 1N0WA 1N6RA 3AVQA 2V55B 4ZDJA 2ZRBA 1YZLA 2G1KA 3TAHA 4EJSA 4AH6A 1DADA 2FZ4A 4G7OC 3S1RH 2B8FA 4A3LG 5FL7D 4N3NA 3U2QA 4JLOA 1IXRA 3QE0A 1GOTA 4DNRB 1AKEA 4L5TA 4GN4B 4JOIA 2NO7A 3K1JA 1CJVC 4O0AA 3W5OA 2QNRA 3MSXA 4GT1A 4QHYA 2RHQB 4US0R 2NG1A 5B58C 2QBYA 2KBEA 1ONLA 3NXSA 4KO8A 4Q9LA 2IS1A 1W2GA 3W6NA 2DWOA 3GCGA 1QG4A 4P32A 3OAAD 2XAUA 4LC0A 1YR6A 3IO3A 3CCRA 2B92A 4QM6A 2CXXA 3MMPA 4FDBA 2HUPA 4XSGA 4BASA 4K0KL 1MRSA 1BBWA 2C04A 2ZPTX 5CYPA 4QBIA 4A2QA 1A62A 1EIYB 4C0HA 1N5LA 4OI2A 3RAPR 2RHDA 3CF2A 3KXLA 4B44A 2KWIA 1Q86C 3CXCA 2GWHA 2DWPA 2PCFB 4TTQA 1KI8A 1SXJE 5HZHA 4OHXA 3AB3A 2CHQA 5JRJA 3PQCA 2UXBL 3TK1A 3ULPA 4QIWE 1EQQA 3A8TA 3BH0A 1WFQA 4P4SA 4DLSA 4M9ZA 2YYZA 4OO1I 1QHHB 1ASZA 1E2NA 3UDFA 1OHHD 1AZSC 3SJZA 1YHBA 2GJSA 1DARA 2QQ0A 3CPWA 3K0EA 4GI7A 1H95A 4LPSA 5JWOA 3AVYA 1QHYA 5C3EH 5HGQA 1XCGB 4QGHA 2EQBA 3UATA 1JJGA 4O0MA 1KAGA 1OJLA 1KO4A 4URYR 2GVAA 4LUZA 5EP4A 1XTKA 3BXZA 3AM1A 1VQMA 2NN6G 2K14A 2P6RA 4OKSA 5EUMA 2BWJA 2ZANA 2FSGA 1MO6A 5ANRB 2JA5H 1DAFA 1H65A 1Z2AA 4Q01A 4R98A 4BFZA 2QMHA 3HDTA 3FPAA 4A36A 1GITA 2DFTA 3PCRB 5GAGC 4QJ5A 4QM7A 1CKEA 1XEFA 2BBWA 3TZUA 2NPIA 4G7ZC 2ZSBA 5FOSA 1VQHA 3EZ2A 5L3RA 1UDWA 4KFTA 1C0AA 4X65L 2BOVA 1QHXA 4EFMA 4HIDA 4A3MG 2F1IA 1G3QA 4DR1Q 1G8HA 2NO6A 4MNOA 1KMHA 2F3IA 1M34E 3K09C 1HUQA 4QRHA 1K0RA 5LD2B 3HKSA 3VHXA 5GADl 1DCZA 3T1HL 2G0NA 3M7NA 1HR0Q 2N78A 3KYHC 3S1MH 1FOEB 3EIEA 4DNTB 3U3RA 1E98A 2D62A 2EVBA 4DV1Q 1TQ2A 2EYQA 3PFIA 4FI3C 1B7YB 3EA5A 2RGAA 2DCUA 3ZIAD 4HATA 3WYAA 1E1OA 1H9KA 1LB1B 2WIAA 1H9RA 2XSZD 3DVLA 4YMTA 2CVHA 3THWA 2EFEB 3U7HB 1GUNA 1H9JA 4P74A 4A0GA 1G3RA 4X64L 2ZRIA 4RD4A 1E1RD 1F2UA 1TQDA 2IYQA 4UNRA 1Z6YA 3CCLA 2W58A 4ZDWA 3AB9A 1HR0L 4AG6A 1LS6A 4DV6L 2OCBA 3W34A 2PMKA 4GKJQ 1VQ6A 4DV1L 1KDTA 2XNDD 2GETA 4F91B 5HE8A 1KHIA 3OEED 2ZS7A 4TSFD 3KQHA 1D9XA 2NO0A 4AYXA 1NE3A 4A75A 1QVRA 3T1OA 1X55A 4G5QA 3K9HA 5LPNA 3TRZA 2YV5A 4JBWA 2YWGA 4S2EA 5M5WH 2VUMG 4JBJA 2Z0SA 2JIZD 1TWCH 4LJAA 1K8OA 4EDHA 1PH7A 2OFWA 2L5TA 3DKPA 3WY9A 3UE0A 4WAUA 2CBZA 4DV5Q 3WNBA 1WYDA 3OYYA 1TADA 2RGNA 1S3OA 1CKOA 1AS2A 3IBYA 5AR1A 3T5GA 4C3ZA 4E09A 4ESHA 5KHOC 1P2VA 2BE5C 5GVSA 1D6JA 1WRBA 5HCIA 2AK3A 5M3MG 2G83A 2BM0A 2HF8A 2BEJA 4PSKA 1JXMA 4QC2A 3JAMi 1PLLA 4YDSA 1BKBA 1VCMA 4ZI3A 2GCOA 4URVR 3K81C 2BM1A 4ZIRA 4NP6A 1Z47A 1MO5A 3FDIA 4ZO4A 4C30A 2J7PA 3M85A 4IJLA 3ZD7A 2CDNA 3QKUA 1CR2A 3HOVG 2H57A 4DV5L 5TMPA 3AQQA 2IS2A 1PHJA 3SFVA 3OPOA 1A2KC 5J3BA 4M9SA 4DEYA 1RC8A 3KF6B 1XMJA 5FLMH 2MFIA 1CI3M 2EIFA 2JA6H 3P32A 4PHHA 2ZAOA 3S17H 2Q6TA 5IRCD 3OESA 2WWYA 1HTWA 3QKRA 3WBJA 2X2FA 3WRYC 1E2QA 5B2ZA 1W3SA 2PCLA 4DUGD 3HWSA 2QY9A 3RLOA 4GNXB 2VP4A 3VDYA 3WRXC 3FMCA 2JATA 5FBQB 3ZD6A 1W2BA 3P4XA 5JI3E 2QQEA 4HLQB 5JWHA 4B2LA 2IXGA 3TUZC 4Q00A 3MXNB 2HF9A 3GLHB 4PANA 1GL7A 2F1JA 3SI7A 5KOYA 3CCUA 3NDPA 4DR4Q 1E9AA 1XMVA 3IQXA 2W6JD 1U0HC 3TSWA 4XH9B 4TMVA 3CF5A 1SVMA 1XNQQ 2ODNA 3AUXA 5IYCH 3AKDA 5AK0A 3CRVA 5L3QA 4PC6A 2ZSEA 3E5HA 4MRRA 1UWVA 1HQMC 1IN5A 2R7ZH 2RAPA 2RKOA 4GFDA 5SZKB 1H9MA 1W0JA 3I55A 4EPRA 3SU8A 4A92A 2OAQ1 4LYAA 2KENA 2WSSA 3A1WA 4HZUB 1FYCA 3CH4B 2GTPA 4N0DA 2F9MA 3AQ4A 4YHHL 3PUXA 5J4YA 1HH2P 4ZDIA 1K3RA 3A6PC 1PUIA 2DPXA 3CPJB 5JSZA 3WHKA 1FGUA 1F2TB 4TKOB 1D9ZA 2RHMA 3EIQA 2VY3A 4JI6Q 1YBYA 4BZPA 2YHSA 3EZ9A 2CFMA 2MO0A 5FJ8H 1G1MA 4HLUC 1NVXQ 1WCV1 4TMTA 1RJ9A 2ZJQA 4CEIA 1L1OC 1CF4A 1QHIA 1AGRA 2GEUA 2ZU0C 2HIXA 3NC0C 3QBVA 4E07A 2ODWA 5FBLB 3ZS8A 3U60B 1VQCA 3ICEA 4BLSA 1LW7A 5SZIA 2DBYA 2FFQA 1NKSA 2ZR7A 4DLUA 2UXCQ 4Z54A 2XGTA 1C7YA 3HU2A 5IYBH 4DK3C 1YR8A 3LXRA 4OK6A 4Q1BA 4DZZA 1E2JA 2QEQA 1R4AA 5EP3A 2KB0A 2KCCA 3OHMA 4RCNA 5DSZA 4LYHA 1VKJA 4HUQA 2FMXA 1G7TA 3AEVA 2VP9A 2ORVA 4Q1EA 1LY1A 5C3EG 1GRNA 2JEOA 4Y7NH 4EUNA 5L3SB 2QMOA 3FHWA 2ZJPA 4LSGA 3THYB 3M3YH 1OFIA 3Q3JB 3ZQJA 2ECKA 1K83H 1NVVR 4HAYA 4DK6C 4HZIA 4Q48A 5G41A 1T6NA 4DB4A 4EPXA 2UXCL 5EE1A 2J87A 1NY5A 5EE9A 3ERSX 3EARA 3D31A 1W49A 2A6EC 1Z0AA 4BLPA 1OW3B 1A6XA 4PV1C 2JA5G 4IFDH 1KY2A 5FUXA 2GF0A 2ZS8A 2LMCB 4UP8A 1PH3A 3I8SA 3I72A 4LYFA 3IDQA 1IY2A 4ARZA 2C78A 3EC2A 3S14H 1V5WA 5JEAJ 4C2UA 2RGCA 1L8QA 3KFVA 1PA6A 1E79A 3C5HA 4QBFA 4DPGA 1E0SA 3DEFA 1NMFA 4V0ME 2XITA 4TLCA 3A74A 1KXLA 2JK8A 1GL9B 1IAQA 3BZCA 1M1KC 2UUBL 2VL7A 4GZYC 5FUYA 2PJZA 3QPUA 4LHYA 3W3ZB 2K7VA 4GLXA 1E9FA 3Q85A 1JQJC 4A3CH 4FMDB 2UUAQ 1AA9A 1CJUC 5GJCA 2WOJA 4A9AA 2JAQA 2GAAA 2F3TA 5EXSA 3R9IA 4HJ8A 4GOJA 4RKFA 4RZ2A 1I4LD 5AUPB 4GLAC 2J46A 2ZJ5A 2XOKA 3BJUA 4IDOA 1XPUA 4PC2A 4XVUA 1E32A 3THXB 4C2MH 1OXUA 3LAWA 1SQ5A 3K0AB 4V02A 4YXWA 5CM9C 4GRAA 3GLFB 4M4SA 2WJIA 1SXJD 4QJFA 3CC2A 2ZUDA 2ZXUA 1RPZA 1SROA 1MABA 3NBHB 1W2HA 3I4LA 1KO1A 4LJYA 4JI4Q 4NE2A 3SYKA 2K5NA 1G4UR 3H15A 2J0QA 1X1RA 4MGKR 3U4QB 4EJSC 3I5YA 1Y63A 4PC3A 2QPOA 1WCMH 4H02A 3FP9A 3ZGXA 4R4QA 2RHSB 3NEMA 1SN8A 4A3FH 1IXRC 1Y8OB 4URWR 5EE0A 2R9VA 2CHVA 1KSHA 1ESMA 4IRUB 4B3BA 4A3JH 3OW2A 1KY3A 4JOIC 4BZQA 4KFSA 3TUIC 4LFCL 2ZE5A 4PQRA 4POAA 4JI4L 1G41A 1G9XA 5L8VA 5GROA 3ULLA 1GAJA 2GVZC 4GP6A 1G51A 4CYMA 5JEAG 3SYLA 4Q1CA 5IWAQ 4LWCA 2ZRAA 2ZVQX 4C0QC 1NY4A 1N6KA 4KFUA 3O8CA 2ORWA 3GTLH 1VQPA 3F5FA 1LTLA 2B29A 4O2DA 1K8GA 2EFCB 2QM8A 1I94L 4IDHA 4RCZA 4CEJA 1TL7C 1MIUA 3ULJA 1G3MA 1U94A 2B7CA 3DDCA 1I4DD 5BN5A 6Q21A 4A3EH 3ADKA 1DPFA 2H5EA 4M53A 4RFVA 1FL0A 2ZT9C 2Z43A 4DR3Q 3QUSA 4KAXA 4I7ZC 5EAYA 2E2IH 521PA 1KI7A 2B6HA 2JA6G 3D3QA 3LX8A 1Z0DA 4BRUA 2VW9A 2ZI7A 4FMCF 3AKEA 4TL6A 5EP2A 3KQUA 4M22A 2A9KA 1U81A 1E24A 4EQ5A 3L43A 3UIEA 4A2PA 4UXHA 2O8DB 4C4PA 4M1WA 1FTSA 3GLGB 1FX0B 2LXKA 4BWYA 3I4OA 2FV8A 1XFAA 5HPYB 2VF8A 2K33A 1W5TA 5F2EA 5IT9c 3F2BA 3RZDH 3T61A 4NDZA 4AG5A 1NF3A 2WWHA 1P2SA 3M4QA 3EC1A 4CVNA 3UWKA 3I56A 1L2TA 2A2ZA 1JB7A 3HJNA 3QEOA 3SHFA 2W0SA 4DT1B 1R0ZA 3PGZA 1KI6B 2EJGC 4OO1H 2C2HA 4HI0E 2AUJD 1KHTA 2XTNA 4U02A 5IYCG 1OYYA 4NYJR 2ERXA 5M3FH 1UKVY 2O5IC 1X3EA 4P3YA 1C9OA 4DV7Q 1YVDA 1E2GA 2R7ZG 1Z28A 3Q8XB 2ZVPX 1Z0FA 1GUTA 2ZSFA 4NPSA 1WE2A 2V6IA 1IM2A 1U0JA 4F7WA 2ALYB 5KSYA 1G5PA 3GP8A 1VG9B 2OG2A 2J0UB 3KLRA 2FEMA 1PVOA 4G0NA 4P4UA 1I6VC 4BFXA 1Q12A 1US8B 1Z6AA 4AKIA 4IXNA 5FJ8G 4B3RL 2ZRCA 2LWIA 1PH5A 3ZJYA 3AP2A 4CGZA 2O52A 1UE1A 1FNMA 2NVXH 1FZQA 1W0JD 4ME3A 4F38A 2O8EA 3AVOA 2VSFA 1E2VA 1N32Q 5JFGA 2WSSD 2ZJBA 1VECA 1U98A 5IP7G 2PNRC 4QNRA 1YITA 5K8UA 2WVJA 2ZETA 5GADC 1NSFA 2FG5A 2V1CC 1QF9A 5IYBG 2IYUA 4Q5IA 4RD2A 1K8MA 2PPBC 4DV4Q 3L0PA 1Q20A 4PG3A 2A19A 3I1FA 2B8WA 4IOMA 3S2DH 2PI2E 3E2IA 3MJRA 2K5HA 2J45A 3EASA 1DEKA 4KHPL 2XJ4A 3V9PA 5HE9A 3QVVA 2XEXA 2A30A 2J59A 1YZQA 3IHLA 1NY6A 4V0NA 1UFQA 2QA5A 2BMJA 5CLQA 1QUQB 2GVBA 4J15A 2QTVB 4DAYB 5SZJA 1OXTA 4ALPA 5FR1A 2K52A 2YTXA 4W7SA 4CEHB 4IFDG 1ZD8A 4V0LA 1ZUIA 1LYLA 3QKSA 4D0LB 2R7DA 2A68C 5H1SE 5C0XI 2RGNC 5JJIA 2K5VA 3BFVA 5FPHA 1NNEA 3DMDA 1VTKA 4GOPA 1BKDR 2WWXA 1P7CA 5A35A 2JA9A 2WZQA 3DKVA 2RH5A 3PF4A 1VHTA 5AJZA 2AXNA 3RRYA 1FVIA 1HCZA 4LV5B 3KTAA 3H0KA 1VQBA 1UF9A 4HR7B 4XJXA 3TIFA 3NBYC 1OF1A 1M7HA 2HJVA 1KL9A 1CP2A 2BEKA 3QG5A 4B3FX 1DAIA 4C0JA 4F92B 4JLBA 2IWRA 2ZYVX 1JJ7A 2Q0HA 1ZMXA 1NMGA 2Z5FA 3FFBA 3L8ZA 4YY3Q 4HDQB 4ILEA 4WBSA 4DV2Q 4JV5Q 4IPHA 4A3CG 3QKTA 4U00A 3QXXA 2ZR9A 1AE3A 1B70B 5KYKA 1Z7TA 2A5YB 1KK3A 1RW4A 2J0VA 4LFBQ 1OLOA 1ZRHA 2YC2C 2IY5B 1Q82C 1U0LA 4LF5L 1ELOA 121PA 1FTNA 2C96A 4JL5A 5IDVA 1P60A 1Q1BA 1W1WA 4NH0A 1SLJA 4KFRA 2XZPA 2Y0SG 2CCZA 1X65A 3A7AB 1O3YA 3U58A 4FMCB 1S0UA 3K9LA 4US2R 4BXXH 4JV5L 1JE5A 2F43B 3CWQA 3HOXH 2UU9L 3UMRA 5FTMA 1F6BA 4A8JA 2Q2HA 2BH2A 2FU5C 2O8CA 4HIKA 1WCMG 5H8WA 2F7SA 2J7KA 1CIPA 2VYFA 2ZUBA 3T1VA 2REOA 3X1XA 4Q02A 1E2MA 2H17A 2VSOA 4A3FG 3EA0A 4MKFA 4MITA 3BU2A 2OCYC 4A3JG 2X8AA 4BY1H 2ZJOA 1A1VA 4Q4AB 2HHHL 3LVRE 3NH6A 4OHVA 4YXWD 4PC7A 2JLZA 2V1UA 2G1JA 1TUIA 1YJ9A 5AJXA 1Z63A 3F8TA 4XVRA 4UKDA 4LUCA 3X2SA 3NTUA 1XEXA 1IW7C 2O5JC 1YE8A 1TX4B 1BMFA 3EIHA 1TWGH 1W36D 2CK3A 2GNOA 4UNPA 1KRTA 1XXHB 2Z0MA 1L0WA 4TYWA 1G21E 3RABA 4GOXA 3U50C 2W6IA 3UE1A 2E2JH 3OEHD 3BERA 3CB4A 2DNCA 4IVPA 3A0JA 3X1WA 1I6HH 2VHUA 2WPDA 4JI7Q 4DK0A 1HZBA 1P75A 1E94E 4A3EG 3OIWA 2G3YA 1FFHA 1II8B 3E70C 1ZNYA 2IF0A 2G88A 4MYHA 4DJTA 2NVTH 2ZJYA 3TREA 4IOLA 2OQKA 1OFUX 2XXAA 3HOUH 2I5MX 2MNAA 1I2DA 2XB4A 3ASZA 2X1VA 4PO8A 4R1JA 821PA 1IL2A 1UM8A 3STBD 4DSTA 5KUTA 3U7FB 2BCJQ 2E5LQ 1ZBDA 1N0VC 2AR7A 1G5RA 3BFKA 5JEEA 1OB2A 4A3GH 3KFXA 3HOWH 1KI3A 4OQNA 1I2MA 3ZVLA 2ATWA 1OFTA 3S1QH 4YC7A 4KI0A 1HE1C 2RGDA 4Q4JB 3EIVA 1YQTA 1M7GA 1QZGA 1ZD9A 3CRRA 5B64A 3H4MA 2HJGA 4JVMA 4RD0A 2X2EA 3WNCA 3TEHB 1AS0A 1UJ2A 3AGPA 3DM5A 2CL7X 5E7NA 4X6AH 3N6RA 1EFTA 1FP7A 1Z0KA 3NHBA 4OO1G 5EP1A 2E5LL 1E1QA 4TZ6A 3QPWA 5CYOA 3LX5A 5M3FG 3G4SA 2ODBA 2REBA 1UEIA 4DCSA 4C7OB 1M1YE 3P27A 4Z1MD 1IBKQ 4RZXA 3ZYCA 4YMWA 1Z07A 1HNWQ 3S16H 1MOZA 2FOLA 2D4HA 2GILA 1G18A 1SZPA 3A36A 3DPUA 3NBXX 4UNSA 2ZQ5A 2F4VL 4JI8L 3CX7A 1OB5A 1X3GA 4DUZQ 2Y0SE 2WJHA 2WWFA 2QAGB 4M1SA 4DKXA 4AIIA 4Q03A 4A3BH 1P9WA 2HCBA 3TNFA 4LBZA 2AN9A 2P5SA 4AD8A 4DLTA 4PZ6A 1X8JA 4DKAC 2QRNA 3GMTA 3CLVA 3QNUA 4PO1A 3BORA 1JEEA 2C9OA 2G9NA 3FKIG 4HAVA 3J7A5 2PX3A 4X8HA 1HA3A 2WAYA 4C0LA 3ICQB 3QBTA 1D7QA 2WJGA 4L5RC 2D2FA 5B30A 4DVGA 2RCNA 3VNUA 5E7MA 2P6NA 2CNWD 1P6XA 3A4LA 4D4JA 2UVQA 3HPQA 1EX6A 2V8OA 2V1XA 5ELOA 2IYZA 1VG8A 4KCGA 5KSZA 1OIXA 4BFSA 2E1RA 2O0KA 1J7KA 1K8RA 1XPRA 1W36C 4WW0A 4TYYA 4JI2Q 3IPXA 3QG1A 4HIOA 2CEAA 1JJ2A 4LFAL 3K0XA 1RIFA 1GNPA 1AKYA 2ZTEA 1ZVQA 2DY1A 2GVDC 2MO1A 3KXKA 4BFVA 2QM7A 4OI1A 3L82B 4LF4Q 4GKKL 2NZHA 5GJWC 621PA 3MUFA 3A1UA 1UADA 1KRSA 2IHEA 3PEWA 1HJPA 4YMVA 2F1RA 2ZJZA 4QGUA 1KO5A 2DUDA 1NIJA 2AHOB 1EFUA 2FGKA 4OJKA 4ZI2A 2WJJA 5FI1B 3EZ7A 3PCOB 2AKYA 1I4TD 3TUJC 2NZOA 2HXYA 3E9IA 4ZDKA 3I62A 3PF5A 1EXMA 2HYIC 2OLJA 2V54A 2WKRA 2B63H 1UEBA 4TVAB 1CR4A 4G5RA 1OH7A 1KDOA 3CC4A 2Q9AA 3EWAA 4NCNA 3R7WB 2IC5A 2BH8A 1B9MA 4DCNA 1NG9A 2QP3A 4L8GA 2ID0A 1VQ5A 4K0KQ 3IIMA 3GD7A 2JLYA 1NTGA 1AN0A 4HLDA 1UE7A 4Q1AA 1WA5A 3RN2A 2WMOB 5B57C 4B6EA 4H1VA 4LW1A 3BH6A 2XZLA 1Q81C 2BJWA 1VQIA 1WMSA 4HIMA 2HV8A 4NXNL 1QHHA 2NTYC 3NVAA 3ZVRA 2C5LA 3GJ8A 1KI4A 2UXBQ 2G6BA 2NO9A 4ACBA 1B0UA 1GSIA 2YVUA 4LF7L 4M8NE 5BR8L 3QI2A 1XCPA 4ZCLA 3QXJA 1R8QA 4OQLA 5JBQA 4BXXG 1ZU5A 3ADCA 2VHTA 5F9HA 4B3SL 3HOXG 2UZIR 2VTKA 4IKEA 2QTFA 1E3PA 3HOYH 3KFUA 2YC4C 2MSDB 3GJ6A 4NYIR 5KDDA 4QXAA 1Z08A 1IY1A 1M6NA 1OV4A 2PQAB 3W3AA 3NWJA 2WB1G 3GFTA 4PTLA 2NO1A 2PX0A 3HR7A 4IFBA 2JEBI 4URUR 3ZVMA 1NN0A 2BE5D 1G64A 3U3JA 1EUJA 4BY1G 2QPAA 1N6IA 2K32A 1VCIA 4YCUA 1PV4A 3A7LA 4OQMA 2VQSA 3BDOA 1VS0A 1J5EL 4IOAA 3KF8B 1X3SA 1X1SA 4HUTA 4GP7A 3PUVA 3BJIC 5IP9H 4XD7D 1AM4D 5FPKA 3U44B 3TQCA 5K8IA 4MRPA 1S2MA 5BN3A 1W0KA 2JA1A 3LQQA 2VP6A 3BAFA 4FINA 1KK0A 3GLIE 1VQ8A 4X65Q 5KNDA 1ZAKA 3KZ1E 4Q1FA 2ZE8A 3ZJYC 4WJ3M 1H8HA 4DRZA 2H5XA 1HEIA 2C77A 1FUKA 3U5ZB 2K5UA 1XMQQ 3TVDA 4KXFB 3A4NA 2N46A 4L8JA 3I73A 3T1HQ 3R8CA 1R0WA 2JJ1A 4CT4B 3HOUG 1RRGA 4OQFA 5AUNB 4CIDA 3K7AH 2ZM5A 1SKYE 4M21A 2RGBA 3NEJA 1U9IA 2WMNB 2W6ID 3ZS9A 4BQSA 1L7VC 1NVUQ 3MWJA 3E9HA 4DR7L 4C3HH 4A3GG 2I0QA 4X64Q 4LJ6A 3HOWG 1XMQL 3J81k 3W8RA 1VIYA 4AWXA 3CF0A 1R7RA 2BV3A 3KQNA 4OL0A 2VSXA 5UKDA 4F93B 1VYTA 1ZINA 4DV6Q 2ZYTX 3TR0A 1E9SA 3MXUA 4O2RA 2Z6KA 1CXZA 2ZJAA 3AVWA 1VF7A 4K8OA 1YZUA 3CP0A 4AURA 4LGMA 2AK2A 2O8FA 4ZKEA 4R71A 3BBPA 3GEIA 4LHZA 1P8LA 2AKAB 2CCJA 2I5LX 1C1YA 4IPGA 3FKSD 5L3VA 4EFNA 1I5FA 2DR3A 2IW3A 2VQFQ 4GOPC 3LLUA 3G0HA 4JI5L 2E74C 2OSBA 2LCFA 3HGBA 1NBWA 3AGQA 2NPFA 5K8LA 2WFWA 3UDGA 1OSNA 1U99A 4WA7A 4FCVA 3U9SA 2BJVA 2FGJA 4TMZA 5E7IA 2Q3HA 2PMZE 4KV9A 4A3BG 4IO9A 4YWMA 1ZKOA 4DV0L 1GG2A 3DL0A 4MGIR 4EKDA 3LW7A 2B3GA 4GZMA 1V8QA 2EDGA 3I2ZA 5AJ3L 1HV8A 1E1QD 2WWWA 4LOAA 4TTRA 1O7IA 5FR2A 1ZUNB 3IEVA 1SVOA 1E2WA 3UK6A 3KF6A 3I3SR 2V7QA 5JCPA 1GD7A 4DV3L 2GJ8A 1SRUA 4OONA 2VQFL 2A3RA 2VBCA 4MUBA 1G8GA 2K4KA 4HJ5A 3QXHA 3PEYA 2WB1E 4P72A 2FH5B 2ATVA 4LJZC 2I5HA 4BBRH 4XTRA 3RSOA 1PZNA 4LV8B 2CLSA 2ZAMA 1EWQA 5JEAH 1U90A 1IXZA 2WM9B 5CIWA 5DYGA 3OTOQ 1P61B 4GNXA 1CRQA 2Q8IB 4BBSH 1ZM2A 2BMEA 2LKCA 4EQ6B 3RZOH 1XD8A 1SXJB 4HB2A 3QEJA 4NPHA 3QF4B 1YJWA 2YOHA 2XZOA 1G7SA 4Q9IA 2F1HA 1DTSA 1YNXA 3GLHA 2CLCX 4RVCA 4FMDF 3LWNA 1PFSA 2A6ED 1Z3IX 4A8JC 4A1FA 1J70A 2NZJA 4RCYA 4RD3A 4W9MC 2O0JA 2JJ2A 3B82A 3OTOL 3QY0A 2ASEA 2F52A 4ITRC 3MG9A 2GN5A 3M4PA 2EU8A 4FW9A 4Y0AA 4F4IA 4UP7A 3KUCA 2R8RA 5BWMA 1E2EA 2H92A 5C4MA 1SVLA 4GBMA 4HZUA 1LACA 4OHYA 1SKQA 2XX3A 1EWRA 1P4SA 1A63A 4MKIA 3GLIB 2HIVA 2BBOA 2HXSA 3N70A 5DH9A 1F2TA 1GDDA 2OLKA 1N2CE 1YRBA 3B60A 3FFAA 4M1YA 4US1R 4QJ4A 1T4GA 2TMKA 2GZDA 3VR2A 1E9BA 1ETUA 2IYWA 4H44C 2B63G 1Z6HA 2IX0A 4YHHQ 3EPJA 4WZBE 3VNVA 2VNUD 4URZR 1XZQA 4OWXB 3I61A 4LRWA 2PZFA 3NKVA 4GL2A 4JC0A 4JSTA 2GXAA 2OQ0A 5JEDA 2JLVA 2ZM6Q 1K8AC 3QVUA 1EWIA 2NOAA 1VQDA 3DZDA 1NIPA 3PR1A 1HNZL 1N5JA 1PYBA 2OTJA 2QE7D 4P4TA 2OBLA 5LMNW 4MYUA 4EAQA 1Q8KA 1N8RC 3VFDA 3TKLA 8OHMA 1GNQA 3H84A 2ZREA 4A82A 3Q8DA 3CCSA 1SVIA 2R6GA 2NVYH 5IK2A 2ZIAA 4KODA 4GDFA 2VRWA 2I1VB 2QENA 4F4CA 3KOJA 4A3IH 3D0FA 2ZM6L 1JBKA 4KBFA 4D81A 1DG1G 5L3SA 2Z83A 1EG7A 2XTIA 3T5DA 3THYA 3R9XA 4JT4A 1TXYA 3HOYG 2V3CC 4D4MA 1JALA 1W7AA 4LZZA 5IT5A 1VQKA 1DE0A 1RZ3A 4APVA 1N9WA 3KL4A 2P0EA 3A58B 2FZLA 2ANCA 3AVPA 4HAUA 3TS0A 3SHWA 4LUVA 1YIJA 1II0A 3ZZTA 1QVFA 1LF5A 1I3QH 5IP7H 2VF7A 3B1WA 2K75A 2ZRNA 4JI3L 2D3WA 5FTJA 3BS4A 3VKWA 2FJUA 1M74A 3LV8A 1OE0A 4D2IA 2D06A 3CPFA 3A4MA 4JI1Q 5D3MB 3ZZ0A 3K0FB 5A4JA 2IL1A 5IP9G 1XU4A 2R65A 2JJ8A 4B47A 1CRPA 2HT6A 4JJZA 4PQYA 3V4FA 2UXDL 2XTMA 3B13B 1SULA 2JDIA 2OILA 4NYMQ 3VR6A 1KI2A 3BB4A 1IJFA 1HE8B 5TY0A 1WBBA 4JYCA 2PCJA 2VHQA 4POGA 3S15H 3K9NA 4JBXA 4KHZA 1VMAA 5C0XJ 4NBSA 4CF7A 4XWAA 5JZVA 2OO7A 2JJQA 1R5NA 1E7ZA 1XD2B 2UUBQ 4CT5A 3PUWA 4JI1L 1DO2A 4LHXA 2FFBA 5C46F 4B3TQ 3THXA 4JLMA 3H3VH 1E99A 1JPJA 3K0AA 4A0RA 1IZ6A 1YHQA 4YMUA 3G6EA 4GLVB 3GLFA 4HB3A 4TQ9A 1W0KD 1Z29A 3F0TA 3B1ZA 1Q21A 2AL7A 4O25A 4DUYL 5K8TA 3QXSA 3EG5A 4MGYR 4O2LA 1HQCA 1GJXA 3U4QA 3AF1A 2C9CA 1WXQA 4IHQA 1S4QA 1T3LA 2YTYA 1JB1A 3GDEA 4JLKA 4B3TL 1RRFA 1PUJA 4AIMA 2JJ1D 2WV9A 3HOZH 4JIMA 1P2UA 2YWFA 2ZRDA 4RY2A 4LV6A 3KB1A 3ND8A 2ZYUX 3FOZA 421PA 3I4MH 1KNXA 5EXTA 4IEEA 4Z8YA 5HR5A 1YJ5A 4LNQA 3PO3H 1VQEA 4G5GA 2KBNA 1CULC 3JZAA 4F4JA 4NHOA 5KO2A 4LF6Q 2IEYA 3CQZH 2CL0X 2ZJ2A 2PBRA 3C15C 3RS3A 4A15A 2YKGA 2F6RA 5FBRB 3TLXA 5AJWA 4H13C 3CMAA 2FWRA 4DR2Q 1Q57A 1BH2A 4LFCQ 2A5FA 2PEZA 3CIOA 5BYJA 5CK4A 4IOCA 3K8AA 1HNXL 3DM3A 3CRQA 3RWOA 4JLDA 4A0HA 2EJMA 3GTOH 3CO5A 1P62B 2ZSDA 4FXPA 3N2EA 3U6KA 4TQUS 1HH4A 2N42A 3W90A 4XWOA 1SVSA 5C44H 1IOZA 4M1KA 4LF6L 1KZ7B 5HTKA 1E3MA 3O8BA 1MR3F 1FMLA 3WBKA 4POFA 1F48A 1I94Q 1FUUA 4KJZA 1DXMA 2Q2UA 4DR2L 3TSOA 1FR3A 1GKYA 3KXIA 1GHKA 1E0KA 2OCAA 2QSZA 2H8KA 2ZI4A 4PHTA 4BBRG 1JQLB 2O8DA 1QRAA 4AI6A 1AS3A 3A8JE 2HYDA 4B75A 2IHYA 2OXRA 4PSAA 3A37A 1FX0A 4BBSG 2YINC 4B71A 4DIEA 3GLGA 4H0LC 3MRSA 1HR0W 1R0XA 3MAAC 2N3SA 1FPMA 5M04A 3FMOB 3G82C 5EE5B 4Q18A 3WDNA 4JKYA 4JLPA 2JGNA 1JR3A 1Z06A 4DT1A 3FMIA 2PMDA 4PO9A 1U8AA 2JE6I 4BFWA 4KKUA 1GUOA 1KI6A 3OW7A 3WXMA 2A68D 1CTQA 2FXQA 2D2CC 1BO6A 2HLDA 2W2VA 1RRPA 1S3GA 2C95A 3THOA 2XNSA 4B3DA 1ASYA 1NJGA 2A5JA 2P65A 4TL9A 1Y8NB 1JAHA 3C41J 1TEVA 5HKKA 3CWZA 4YCVA 4KKTA 2ZS9A 1TEXA 3VR4A 1TF5A 1N3BA 5HY6A 2VO1A 5DO9A 4A4DA 3Q72A 5FOUA 3CAMA 2VP0A 4K81B 2EW1A 2J0UA 2J7PD 3M1IA 4OGQC 1U8ZA 1UKYA 2IYTA 5CDFA 1QZXA 2JXMB 2ZE7A 5AWFC 3KKMA 1US8A 2A78A 3M6AA 1XJ0A 2FPKA 3V4RA 5LD2C 2QP9X 5BN4A 2UZ3A 1R10A 1GFIA 4A3DG 3RHFA 1XF9A 2JJ2D 3QQ5A 5GJBA 2ANBA 1CSQA 5IY0A 4ASUA 4DWJA 2WHXA 3VR3A 3AV0B 4HAWA 2C8VA 3CRW1 3D7MA 3EZFA 3NHAA 1TU3A 4B3RQ 3GQBA 2AUKA 2XTZA 1VG0B 4TYPA 4WIAA 4A4IA 4AQYL 4HAZA 3S1AB 4KSBA 3F2CA 1DAEA 4ESVA 2J1LA 4DLXA 3CCJA 1U9IC 1WOCA 4NXMQ 5JCZA 3T1TA 1R9TH 3KJGA 4HLCA 2VHJA 3IPYA 2BKUA 4A3IG 3TH5A 4BE7B 4LWZA 1D2MA 5F98A 4PAOA 1J99A 3U61B 2FFHA 4MYCA 5FH9A 2WWGA 4QOSA 4UXJA 2Z6KC 1QHGA 3OF5A 1QUQA 4E5UA 1TWHH 5FOTA 2KSQA 3IO5A 3FKIH 3PUZA 4NXML 2ONKA 4KHPQ 3LBHA 3QF7A 5GAEC 3PSIA 1KNQA 4JVNA 2JA8G 4QBGB 2F55A 1IW7D 1Y69U 1EIFA 3OE7A 1A82A 4R2HA 5BYKA 2IX3A 3N2IA 4LF8L 5C1BA 2J41A 3KUDA 3FYHA 4KLZA 1RRCA 1Q3TA 1TNDA 1K5DA 3ZLJA 3FKQA 4LF9L 3I4NH 3REFA 3OIUA 3P1JA 4AYTA 4JL6A 1XTIA 1P3JA 3PIPA 4Q7JB 5JS7A 3UPUA 2EYUA 3WHLA 2QEXA 1IBLQ 2EQSA 2P67A 4TQAA 3IHWA 2KCMA 5FOXA 1CEEA 1GL6A 5FTLA 3SDZA 3LDAA 2CCKA 4NYJQ 4PXAA 4LHWA 3AKYA 3VKGA 3RS5A 2BMDA 4CDGA 4PZ7A 4TLBA 4TT3A 1KK2A 1NBMA 2VZAA 4X8MA 4D0NA 5LB4A 3PIOA 4KVAA 3W9YA 3H86A 3LGJA 1X86B 1Q3HA 2WAXA 3LFUA 3O8DA 3PV0A 2AMCB 5FTKA 3THWB 4PPQA 1OKKA 2Q2IA 4L16A 4I4LA 1DVRA 4GNXC 2JDID 4NCJA 4OK3A 5KNBA 1IBLL 5G3YA 4JI0L 4LF5Q 1PH2A 2BIFA 1GILA 2F43A 4NTZA 4AYWA 2YU9H 4A93G 1M2OB 2VP2A 4WXPA 4KSCA 1E2PA 3NBFA 4LJ8A 5DE3A 5CJ2A 2FEOA 1IYVA 2VQEL 4Y52H 3ETLA 1E22A 1IY0A 1FL9A 1UPTA 4G01B 4I1SA 3ADBA 3D6TB 4QHSA 1YKSA 3H1TA 4W5JA 2OAP1 2AD5A 1EESA 5FL7A 2IK8A 4PQFA 3HOZG 2NGRA 4HB0A 4TL7A 1S1MA 2UU9Q 4AC9A 2F3RA 3I4MG 3LXXA 1G8PA 4TN1A 4Q4AA 3QSYA 3J80c 2AKWB 4JK1C 3IGFA 3PO3G 4PAQA 4D4KA 1E79D 1ZNXA 3JVVA 3RDPA 2F9LA 1Z6GA 3LVQE 2QRZA 4B48A 4PPFA 5M5YH 1QG2A 2QORA 5EXPA 1GKUB 2J3EA 3U3MA 3KQLA 1GUAA 1Q0UA 2HHHQ 1XXHA 1GO3E 1JR6A 3WWVA 1BVSA 1NLZA 1Z6XA 3NBZC 5C4JH 1ZNZA 4MKHA 2L0XA 3FB4A 4MQBA 4CW7A 1H9SB 1P5ZB 4XOIA 1S9DA 3TAUA 4CEHA 1G17A 1S1CA 5JI2E 1JT8A 3A1TA 4E22A 4PZYA 1II8A 4NL4H 5C44G 1VQOA 5GAHC 1KDRA 2QGNA 2XOKD 4IDNA 2CKZB 1X3FA 1EK0A 1R5BA 4C9BA 2FE4A 1XP8A 2WKQA 1T5EA 2VIIA 1MO3A 3MGCA 3GEEA 3EAQA 3HYRA 4KU4A 2RGGA 4U5XA 3RSLA 1Z5ZA 3C5CA 2BDOA 1HZAA 3X1ZA 4MRSA 2GKSA 5KNCA 1P73A 1WDTA 3BB3A 3TMKA 2JA7H 3BC1A 5DI3B 4DIDA 4R2IA 3VU9B 1LNZA 5G3ZA 4RG1A 1MV5A 1OPXA 2FFAA 1NJFA 3WYFA 1OIWA 1EFWA 1B9NA 1EWHA 1RVDA 2N49A 2CW0C 4Q4JA 3LNCA 4PC1A 1BOFA 2Z4SA 5FPYA 3GTKH 2O8FB 2QTHA 1LS1A 2FNAA 3B1XA 4PPGA 3B9PA 1PH4A 1PYSB 1NRJB 2QMUA 4BY7H 5JMTA 2DFLA 4G3XA 4GPTA 4OX9L 2GK6A 1VQ9A 2KCTA 3BD9A 1KOFA 3CR8A 4RZUA 2UUCL 1KKLA 3RNUA 1YR7A 2RB4A 3CKLA 4I81A 3KKQA 4YWKA 1TKWB 1XTRA 2AFIE 4M0LA 4UP9A 1G16A 1GM5A 5EE3A 3SR0A 3BOSA 4DR5L 2O5VA 1ONBA 3C8UA 3BK7A 4NZYA 4OI0A 4MTNA 2V9PA 4Q9HA 1IXSB 5CJPA 3UDIA 4NONA 2QAGA 1BYUA 1XRJA 2WWIA 2A5GA 1JR3D 4QGFA 4KYIB 1TTTA 1N6LA 1Q22A 1ZU4A 3EBEA 4C0AC 3A1VA 3D8BA 2F4VQ 4JI8Q 4B3MQ 4NCKA 5E95A 1QVGA 1G8YA 3EXAA 5HKKD 3TS2A 1TU2B 1FW6A 2FA9A 1O78A 5J4KA 3PIRA 1YZGA 3IQWA 5H70A 3AVVA 1SGWA 3H0GH 4P0TA 1KAWA 2G77B 3T1YL 5LB2A 2QGZA 4IVRA 1MKHA 5AUOB 2JLXA 4KKSA 4DB2A 2ATXA 2CJWB 1Z9FA 1CSPA 2GA8A 1XB2A 4TYQA 4TLDA 4A3KH 3GJ4A 3QPVA 1QHSA 1CFMA 1E1RA 1LTQA 1ZNWA 4JT2A 2V4DA 1S40A 2EXDA 3LH5A 3UWOA 3TW4A 3R9WA 4B3ML 3KJHA 4JSYA 1CBUA 2A69D 5HCNA 3GTPH 4IQZA 1UBCA 1COWA 1CJKC 1W47A 1YRAA 4PZZA 5C4GB 3DLLA 1W48A 4TSFA 1IYJB 4CRWB 4DLZA 4GN5A 2GCNA 2ZJ8A 4Q47A 2Q9BA 5AJYA 3BIFA 2O8BB 3UDXA 2VEDA 4XTCS 2KJQA 1DD2A
chains in the Genus database with same CATH superfamily
4I6GA 2CLDX 2VJOA 4FSDA 5EXXA 1P7ZA 2R87A 1Z5PA 1Z0JA 2XWJI 1YQEA 4R3NA 3SY8A 1YOVB 5LP1A 2UV8A 2PHZA 1RACA 2IWHA 3EW9A 2WB4A 3PFBA 1U7WA 4MPJA 4QT4A 2BHRA 1KAOA 4WESA 3TM5A 4MUJA 2CWAA 3W1EA 3VDMA 4LDJA 3WK4A 3WTCA 1EP1B 2C5GA 4BVLA 1BKSB 5U4QA 2ZVDA 1ABFA 2BKLA 4B3SQ 4MR8A 1E96A 3CLHA 2ZYHA 1KJWA 2Q8QA 2QDLA 2KI5A 2NTTA 5HILA 4K5WA 1AHPA 1EP3B 2Z8XA 3FVWA 5IF9A 1EU4A 3VU3A 3P9XA 4NJEA 4L1KA 5LQNA 2R7FA 1OQAA 4MYSA 2HT1A 4IQ4A 3FYTA 2QVZX 1C7IA 1VJCA 2XYHA 1ULHA 2IUTA 1ZM7A 2AE1A 2Q27A 1J5PA 1V43A 3SGIA 1QOZA 4UTOA 1SMXA 2Q07A 4UMFA 4A3JB 2NYZD 3FX2A 3GH3A 4Y2SA 3A6GA 2YVQA 1DAGA 4P73A 4ZRZA 1Y34E 5GAJA 3K96A 3LBIA 3MTEA 2C35B 3TTSA 3NCTA 3CPEA 1FQOA 2QX4A 3GLRA 4D79A 4DV0Q 1FTQA 4S1TA 5AJ3Q 4S35A 1PDOA 3ZBUA 2D0OA 1P2GA 1GFWA 3L8YA 2CXNA 3K16A 3PE3A 1NURA 1DBWA 2PKXA 1WD7A 4IIJF 3M6XA 3I2KA 4H7IA 4CGYB 1JR0D 5LZ5A 1CS0B 2QYSA 2P35A 3FTFA 5T1GA 4CQMA 3W8DA 2HSGA 2ZITA 5BV7A 3ND6A 5JXJA 4JBHA 3S2HH 3FPJA 3G7SA 2K01A 1A77A 5BWBA 2OHGA 4YONB 3UNXA 1XMSA 2FF7A 3T3OA 3UAYA 3QX8A 1KYXA 3M3PA 2MHCA 4L15A 3CEHA 1VOTA 5KPJA 2PG3A 3DM1A 2ZROA 4ND1A 3TLKA 4OUDB 2I4IA 4MDEA 3LUAA 1KJYA 5LYJB 4LXHA 2ZU6A 5IVDA 3Q0EA 4TYMA 3NP9A 1NLFA 4BLUA 4IIJA 3T9AA 1E3LA 2ZSJA 4YJ3A 1XTZA 2O19A 2RHRA 2QT0A 3MEFA 4GECA 4NMMA 4RGTA 2BDUA 1FJGL 1T1EA 2C1XA 4EBBA 4FF3A 3VR1A 4L85A 3IV9A 1NJ8A 1ZI6A 3IH5A 3DEHA 2ZXPA 3K9FC 1E7MA 2XRQD 5HM8A 5K45A 1RJEA 4KD4A 3DKRA 1NE7A 2E2JB 5T1IA 2A6PA 1I6HB 2KOLA 1H8HD 4YP6A 4UVHA 4OWWB 3GDOA 4QQRA 5EIEA 3VISA 3ZVNA 1MHWC 4GI2A 3KETA 3KUPA 2WRZA 4XUDA 4MR7B 2ZJ4A 3NTHA 3E0XA 2AZDA 3OKAA 3JQ8B 2KEDA 4LJ5A 5L40A 3GLSA 5FOVA 3DVAB 4PLWA 3PGJA 1HHVA 1GSHA 1NL3A 1EWCA 5JO9A 5DZSA 1VPLA 3B5EA 4H17A 3K0SA 2QNBA 5D86A 3J81i 2F0KA 4PLTA 4E70A 1TPYA 2IW1A 1GA1A 1EIZA 1WZIA 3E9MA 5CB6A 3S1AA 4C3IH 3PFNA 1C4XA 4XGIA 1L5GB 2KQUA 2X58A 2J6CA 3TRFA 5IYDH 1F7VA 3PJRA 1DBSA 2UUOA 3QE9Y 2OQ2A 4L4YA 1NFQA 4PHFA 5C4XG 2J85A 3LFTA 1NUUA 4U2KA 1VF5C 1M33A 4AMUA 4I3FA 5C2JB 5C52B 3AWIA 3NANA 2AOVA 1NVMB 3E3NA 4MKGA 3F1ZA 3EGWA 2GK4A 2EPBA 4CEJB 4O4HB 2VDJA 1J2JA 4TT8A 2LKDA 2ZTCA 2AEJA 1SNQA 4OTZA 3UJDA 3EVTA 4K6LA 2ZYAA 1JHPA 4N5HX 5HUQA 2SECE 4DCMA 2Q29A 2CBGA 3ZW8A 2RK3A 3OLWA 3IFTA 2B8GA 1JWUD 5DCUA 1DDOA 1SWVA 1V11B 1P2TA 1PRTC 4DSZA 5M5BA 2WHPA 4OMCA 4BJHB 3LNTA 1FQJA 4BVFA 2I4NA 2HNKA 4LHVA 3AY7A 2MSEB 1YDWA 4RWSC 4EEZA 5ALEA 2VZ9A 3JAMc 1IHDA 5ALXA 1EK6A 4DQUA 1WD1A 1I3MA 5DGDA 5F5XA 4DR3B 1ZD1A 1SY7A 1ONSA 4Y6LA 4Z4EA 2EWMA 5AVJA 3B3FA 1JLLB 3CPHA 3CRNA 5C7OO 3RVJA 4JGBA 5I9NA 1DJNA 5EGSA 3LGSA 1C4QA 1CDZA 4WVLA 2ASBA 1I51A 3N0TA 4YJDA 2XB9A 1ZIPA 5ABPA 5JAOA 2VT3A 1RWOA 3V6LA 1KR2A 1PZXA 1XWIA 3L84A 1ODFA 4TKZA 1Y3AA 5BQXA 3FKSA 4MICA 4BRWA 4U9HS 3EJIA 1NP6A 3TI7A 1UFRA 4NV1A 1BRTA 1FVXA 1DAKA 5CBPA 1I4PA 1F6DA 5HS4A 4E11A 3PO2G 2QF7A 5F9FA 1P9NA 1FS6A 3PI7A 5TQ2B 1F9EA 2AD1A 4BLTA 1O87A 2DB3A 1BQ3A 4G4JA 2FMIA 4JKIA 1CK4A 4OB7A 1F0KA 3WJ1A 3OE7D 4I46A 2R0QC 1YVCA 4IV0A 5DXFA 1USVA 1LDNA 1R0LA 2GZAA 4CF3A 1O97D 1ONPA 4DDWA 3TZCA 2ZB7A 2FX3A 1KEKA 4HAXA 4D74A 4RLHA 3ZWWA 4EJSA 5GZ3A 3GNQA 4P93A 3V1LA 3ULKA 4N3NA 3M5DA 2FP4A 3EQ2A 4L5TA 2ATIA 1CY8A 2DSTA 2INGX 2EGHA 3M6FA 4LJKA 2GPNA 2FETA 2PYZA 3ISJA 1QRSA 4QM6A 4H18A 2VYVD 1LLUA 3MMPA 4K0KL 3QMPA 4C7JA 4Y1EA 3I1YA 4ER3A 3NM6B 3ZWVA 4G1VA 5DB4A 3TK1A 3A8TA 4TTTS 3QX7A 2QTWB 1E2NA 4P0QB 2IHJA 3AEUA 4JCOA 1V6SA 1JJGA 3X0DA 1CETA 2DY8A 1XTKA 4U3JA 1OILA 3I12A 2X0IA 5ANRB 1Z2AA 2QMHA 3ZGLA 4KAFA 1PFBA 4KDEA 3IE2A 2PXXA 1K0FA 3GA0A 1KMHA 2J32A 2C4KA 3H75A 3HKSA 3HL4A 2W8BA 5C1DA 4LF4B 1Q7GA 2A92A 2G06A 3THWA 1QWYA 4YP1A 4XJSA 1A9XA 3ELDA 1UC5B 1LLCA 3ENQA 4ZP1A 4ZDWA 1BDIA 3AB9A 3UJ9A 1OVGA 3HQ4O 2OO5C 2JI8A 4JBWA 4QYMA 5M5WH 3ODGA 3ENNA 2ZJFA 3H1EA 4D4HA 4DV5Q 3K5PA 1CKOA 3MJ4A 4LVCA 1BKBA 3LY7A 4WNAA 5T57A 4UDYX 4IJLA 4RA9A 5I9MA 4C3JG 4HSGA 5CV7A 2BOSA 1CI3M 2ZAOA 4UPEA 5B2ZA 2VZ8A 3KQOA 2H7XA 2Q3BA 4HLQB 2IXGA 1LT5D 5EKIA 3NDPA 3VGJA 4XH9B 3E23A 3CF5A 4P98A 5K3DA 1NUSA 1E89A 1TJ3A 1D4ZA 3JTMA 4DAEA 3A6PC 2HADA 4H08A 5BOSB 4U2CA 5FJ8H 4BRSA 4D02A 4TMTA 1JWLA 1NFFA 3QWBA 3NTKA 4RIGA 3F67A 2Q4OA 3WFIA 3WG9A 1WDWB 4LSWA 4D45A 1MBZA 4PCVA 2FMXA 2VP9A 4Y7NH 2H1RA 3IP3A 2YL2A 2OC9A 5G41A 1POXA 1E6KA 3ERSX 2I34A 3ZXXA 2WTXA 2JA5G 2R3ZA 3S8YA 3EGIA 2WF6A 5JH7B 1E0SA 1XJWA 2PJZA 3FNGA 1YFKA 4TSKA 3H16A 1E32A 5HUJA 3GROA 4NE2A 4ZVRA 2A73B 1Y63A 1N78A 4H02A 3L9WA 1Y89A 1KSHA 1LLRD 2GDZA 1QG0A 1ORTA 3IBFA 3PKZA 2A74C 1QIJA 1C9DB 1WCXA 3ZTTA 2VXBA 5EVJA 3STVA 3IAM1 3URKA 5HWSA 521PA 1MBYA 4FMCF 4M22A 5K0SA 5A5FA 1NPTO 4EO7A 3TOCA 4W9NC 1SCJA 1FDIA 1GU7A 2ZWIA 1P2SA 1QDUA 4AY6A 1YMUA 3PU6A 1X3EA 3L41A 1XEAA 3SLKA 4NPSA 4KQ9A 5ILOA 2ALYB 2FMTA 4U2EA 1NATA 1US8B 1PE0A 3AP2A 4YYEA 2NVXH 2QRUA 5I6DA 2VSFA 3AEXA 1IBSA 2ZETA 1DOZA 3ZHXA 3I1FA 3OECA 4A91A 4YAUA 4IFTA 2PI2E 2C2WA 4MWTA 3IUBA 3G49A 2A0WA 2OMKA 1VLJA 4DAYB 5FR1A 1XUOA 2SICE 1Y8RA 3VRHA 1MAVA 1GPNA 1VTKA 5C3EB 1BKDR 5FWYB 4DN6A 1XRNA 4YY3Q 4X92A 4F46A 2FINB 5JOBA 1FNDA 1Q1BA 3ZCUA 4NOJA 5EZYB 2JN4A 1X65A 5A4DA 4TOIA 4E46A 4W82A 3WB0A 4Q02A 1XRRA 4B3RB 2OCYC 4QE3A 1WPRA 4RHYA 4IDAA 2UZ1A 4BTVA 2O5JC 4L76A 4TYWA 5GY7A 1AMOA 2P0YA 4J16C 3CB4A 1O4VA 2PGNA 3O7WA 2Q1XA 1SA0B 5YASA 1F77A 4MYHA 3MOSA 2ST1A 3A3YA 1OFUX 3CVYA 4CTOA 5F4ZA 4RMNA 2MSNA 1DKNA 1U11A 2IPAB 2EYMA 4ZCTA 4JH0A 1L5FA 4PCLA 5DLYA 1EFTA 1XXLA 2QB5A 2V98A 5F51A 3SQOA 4NECA 1UIMA 3K70B 3A36A 3DPUA 3K4QA 2JLAA 4K14A 3CX7A 1DFIA 4Q03A 4WRRA 3WLJA 2OV6A 2O14A 1J8VA 2F8TA 2EKDA 2AYXA 2GAJA 3AW9A 3MT7A 5H80A 5DT9A 3KSBC 1JHQA 4L5RC 1CY6A 1WLYA 2CDBA 1KF0A 4BVKA 2V8OA 3EFHA 3E35A 1J7KA 1SVUA 4EHAA 4JI2Q 1RIFA 2DQSA 3O75A 1CDDA 5CW1A 4R1OA 1W5BA 3ZV3A 2W43A 2F1RA 3K8OE 2WJJA 2JVJA 4BUZA 4EUFA 2AJCA 2YS6A 1MAAA 2IC5A 4BBZA 4UTZA 4EF6A 3EIOA 2X0KA 3HVHA 2GA9A 1GSIA 3HVIA 4MAMA 3OQOA 4BQNA 3R41A 1B73A 3T3MB 1XSEA 4JI8B 4K6KA 1ITZA 2R8PA 4ZO7A 3TZLA 3MJSA 1VBMA 3GF4A 2PFKA 1GGMA 4HNTA 1U65A 4RTNA 3FPUB 3HSKA 3MTGA 4FINA 5K0BA 5JD5A 4WJ3M 4DRZA 3EEYA 1FUKA 1I7LA 2H29A 4PX3A 4YV7A 1ZXBA 1JZTA 1RRGA 3C39A 3A4VA 3VZBA 3NEJA 1Y1WB 2FRVA 3MWJA 3W8RA 2JPDA 5DYWA 3FETA 1HZZC 2D5LA 2FG6C 3TR0A 3ETCA 5CFNA 5LBTA 3GEIA 1D2HA 4M36A 2BHTA 5DN9A 3IODA 1T43A 1QDLB 4RESA 3EZGA 3U9SA 2PMZE 1GG2A 4MGIR 1Z56C 3R0QA 1WIWA 4RK7A 3ZWNA 3I2ZA 2Y1KA 1FY2A 3L05A 2GJ8A 3CKYA 2VPWA 4NICA 4LJZC 2FN7A 3IOEA 3FXAA 2P9TA 1E9VA 2ZYSA 1PUXA 4QPPA 5JSUA 2W2KA 4A8JC 2XMZA 3HBJA 3TIXB 1BDJA 2A35A 2XBMA 2QHXA 4IEFB 2AW3A 3CLRD 1SPBS 5C4MA 2ICAA 1SVLA 4BJ6A 4MZXA 1A63A 4MKIA 2BBOA 4S0XA 3NUGA 1T5OA 5DH9A 1OU4A 3UH0A 3H9EO 4L0CA 2DUMA 3ZQKA 2JARA 2BFEB 4JUBA 2ZM6Q 2AA3A 1JDNA 4XGQA 4P4TA 3GFGA 1I3CA 1RPTA 2COUA 4UARA 2VRWA 1DC4A 3D0RA 4D81A 1GO2A 3W2TA 4L63B 1QP4A 4HJXA 4D1YA 1VJTA 4NBLA 3O95A 2Y2UA 3TS0A 3H7AA 1RI1A 4PQEA 1Q84A 4J1QA 4HEA6 5FTJA 3BS4A 2FJUA 3LV8A 1Z4LA 1OE0A 1Y6GA 1F1BA 4NK4A 4B47A 1S02A 4DJAA 2XTMA 1DBVO 2OILA 1J9OA 4IUQA 2X5XA 6AT1A 2P5YA 3PE6A 4NULA 2Z4IA 3AONB 4OLJA 3QXGA 4GLVB 3NQIA 5KKAA 1GZHB 3CNBA 1MTZA 4L95C 4K6FA 4RTQA 4F93B 4EP1A 5FA8A 1TAHA 3PD1A 1YJ5A 3N1UA 2F3PA 3RS3A 3TLXA 4PE5B 4ALNA 1FDTA 1DXOA 3CIOA 5CK4A 5EYPA 1LC0A 1W85A 3OFVA 2BF4A 1FXUA 1PQPA 2ZZKA 4DFAA 4KIFA 5EQ0A 1JKXA 2QDKA 3JWPA 2C1EA 1I2ZA 3R0VA 3HZHA 1JQLB 1KOGA 4O08A 2PLAA 1Q1NA 5JROA 3WGVA 2EW2A 3G82C 3A6FA 2I33A 1KI6A 3OW7A 4BFZA 2HLDA 1S3GA 1NJGA 4A6EA 1YNOA 3V5NA 3W05A 2Z1CA 1E3JA 5KQRA 2JXMB 2A78A 3UGJA 1KBOA 5AIAA 1M5TA 4H59A 3H5OA 3RPEA 1FSPA 3C8MA 2C8VA 1C7FA 4WFN3 4JT8A 4ZYUA 3F2CA 2Q4RA 4HX2A 1EWYA 2WUDA 3LC7O 4E4TA 3KD2A 2X8JB 3PXXA 3RIMA 3UQYS 4MVJF 2XDQB 3QVLA 4MLCA 4UM5A 1S3FA 5GAEC 2XECA 1Z8DA 4AJ9A 1PQ4A 3V2HA 4Q82A 1QTRA 1EY9A 2QJOA 3NUZA 3KE8A 1EK1A 3TPCA 3NKFA 1V3TA 5AI6A 4AJ2A 1Z6QA 1U8UA 3T4EA 4PXAA 3LY9A 1NSYA 4B3HA 1YHYA 4X3OA 1Q3HA 4XRGA 2MGSA 3KL2A 3NDJA 3DDOA 2Y0EA 2YU9H 4KSCA 1E2PA 4ZGBA 4Y52H 3ICCA 1UPTA 3COJA 1YKSA 2R6ZA 3PBKA 3W2EA 1LWOA 1NVTA 5MHTA 2PO7A 4ZT7A 4AUMA 3EFOB 1XXHA 5H3HA 2Z2XA 3GJQA 1SBNE 3NBZC 5HYVA 2CKZB 5E2IA 4MVJA 2G5CA 3O38A 1DMRA 2HWYA 4LF8B 1EFWA 4O33A 4M49A 4Q4JA 5TPWB 2QTHA 4PPGA 4BY7H 3PKJA 1V1RA 3V4RA 4OX9L 4RZUA 2A58A 1SYCA 1KKLA 3TLJA 4YWKA 1A76A 1ISHA 3RZOB 1G16A 4J75A 4DR5L 5C0OE 5CIYA 2VSNA 2AEEA 4INAA 4M7OA 1MD9A 2NV6A 2GPBA 3A9TA 1LDEA 4RQAA 1J8FA 1TU2B 2QLMA 4RPJA 3RRBA 2G77B 1OX4B 2CJWB 3IAAA 4TLDA 4BBJA 2FOXA 4EUKA 3CWCA 2A69D 5D1HA 4YMGA 2D0PB 1IYJB 2L55A 3LP8A 2F0PA 2OXIA 4DR6L 2KVMA 5C9ZA 4BE9A 3AF3A 3UXHA 3SZRA 4Z4HA 3KJZA 1HPLA 4LYJA 4WZAA 2XT0A 3DL2A 4U7TB 1X3LA 1NHGA 4DLWA 3DFMA 1MIHA 5C3MA 3JQAB 2A6HD 4BUJA 2WP8J 2R2GA 2YW2A 4YAFA 1IK4A 5CEEA 5L9AA 4HLNA 1JQYD 4CMAA 5ESDA 4R84A 4UFNA 2GERA 5LMNL 1A9ZA 3RRMA 3OIVA 4B33A 5D51S 5KNBD 4X8OA 2EEZA 2QD2A 3NORA 1E0DA 1JEOA 4ONEA 2JB9A 1B76A 1A8VA 2ZCVA 3DBRB 1Q50A 4C6RA 2B35A 4BP8A 2FZCA 1EA7A 4KLCA 4DLBA 2ZQZA 3PNMA 3T12A 3AFHA 3CRKC 2Y27A 3SJBA 2MTBA 4UCQA 4FKMA 5TMEA 3DEKA 1T8RA 3FNQA 3LRXA 3EDCA 3GV0A 4YJGA 4IJHA 4A6XA 3I9LA 1YZTA 4WXYB 2IEGA 2HU7A 2ZTSA 2IV2X 1DELA 1R0KA 5FAKA 1HM5A 1QCCA 3NASA 3ICPA 1DAMA 3E3LA 4PRYA 4JI5Q 2Q3MA 2YBEA 4ZPXA 3EQLC 1L5ZA 2GDJA 1D4AA 3AR2A 1YCHA 4J0FA 1VQLA 1L0BA 3QENA 3CZAA 1B4DA 3RH0A 4G8BA 3RS7A 3S2IA 2ZUSA 3W1GA 4G0VA 2VAWA 4X6XA 5BUSA 4IVQA 3RW9A 1SYFA 4DANA 2Z6VA 2Z98A 3OM9A 4RJJA 2EG5A 1RJWA 1NNI1 1O57A 1JFRA 4TWIA 3E9EA 4G41A 2FDXA 3B12A 5LP6F 3BGWA 4HNUA 1ZUHA 2GXQA 4Y3UA 1X94A 3QXCA 1I5OA 4DYDA 3FKIB 2PUHA 3VU1A 4GKJL 2BBTA 1F2UB 3C3YA 3DM9B 9MHTA 3N76A 3AINA 3BT7A 1CU1A 4MQ5A 2C94A 4HJAA 4HMQA 1VKZA 1QYXA 4FNGA 1WI5A 2ZIFA 2ZYGA 3SS7X 2J0TD 2DBZA 2RJOA 5F2NA 3MF4A 2IE0A 4LGCA 3DV9A 3DOUA 1F7UA 5IC5A 3SIWA 2FPUA 5TV2A 3SBEA 1QQ5A 5CTAA 5JECA 1OWPA 2O06A 2CKDA 1WVIA 3HCFA 1K6IA 4C7XA 2FCRA 2PMZB 2DAPA 3VYRB 1Y1QA 1OMOA 1KZ1A 5LP6A 4BA2I 1NKTA 5LL6P 4H7BA 5JLJA 4ARBA 3SE7A 3AHIA 1JG6A 2QR5A 4RM3A 3OFND 3LHIA 3OJEA 4R9VA 4Q1DA 1Y7IA 5CLGA 4N65A 1UDCA 2IZOA 3NVKI 1IZYA 3HBFA 1EFPA 2OAEA 4R4IA 5J22A 2B5WA 3ZBPA 2YHBA 4IDQA 3H2JA 3ZC3A 3D5TA 3WV4A 2ZBGA 2EQ5A 1JR3E 3TQSA 1FNNA 3N2GA 3BIWA