1OXUA

Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
353
structure length
353
Chain Sequence
MVRIIVKNVSKVFKKGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDDRLVASNGKLIVPPEDRKIGMVFQTWALYPNLTAFENIAFPLTNMKMSKEEIRKRVEEVAKILDIHHVLNHFPRELSGGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARALVKEVQSRLGVTLLVVSHDPADIFAIADRVGVLVKGKLVQVGKPEDLYDNPVSIQVASLIGEINELEGKVTNEGVVIGSLRFPVSVSSDRAIIGIRPEDVKLSKDVIKDDSWILVGKGKVKVIGYQGGLFRITITPLDSEEEIFTYSDHPIHSGEEVLVYVRKDKIKVFEKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ABC transporter, ATP binding protein
publication title Crystal structures of the ATPase subunit of the glucose ABC transporter from Sulfolobus solfataricus: nucleotide-free and nucleotide-bound conformations
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transport protein
total genus 103
structure length 353
sequence length 353
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2003-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17847 GlcV_C_terminal Glucose ABC transporter C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1oxuA03
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1oxuA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1oxuA01
1XXHE 3B60A 5FH9A 5AWFC 1L1OC 4JI1L 4LF6Q 1OIVA 4JL6A 1NMGA 4A0HA 4BFXA 1MJCA 2KCCA 4YY3L 1TWHH 5BQ5A 4B3XA 4A3CG 3RAPR 1UKZA 1Q7YC 4C3ZA 2OQ0A 1NKTA 4QC2A 2R7FA 1PH5A 3HOUH 3K09C 2FJUA 2R6AA 3IO3A 4ESVA 1VQDA 3KTAB 2ODNA 4K8OA 4TT3D 3JVUA 1F5NA 2ZR7A 1W4CA 1KI7A 2K75A 3WP1B 4BASA 2BKUA 2WB1E 3T1YL 2FEMA 3HDTA 3OIVA 3EZ7A 1OB2A 4B6EA 5C3EH 1Y69U 1N6HA 4LRWA 4YXWD 4D4LA 2QA5A 4DUZQ 4GZMA 2O5IC 1GAJA 2DHRA 4ALPA 2HXYA 2A1AA 4O2RA 4FCVA 5E7NA 5B57C 1ZM3A 4O0AA 5M5YH 3GEEA 4L8GA 3ZH9B 1V9PA 3OOCA 4DT1B 1W36D 4BBRG 3MSXA 1KAWA 2PCJA 4IXMA 5EZ5A 5CM9C 2IYRA 2K5VA 1GO3E 5HGQA 3WYFA 1XMOQ 1EFWA 1P4SA 2ZI9A 2ZRHA 1L7VC 4IDQA 4V0OA 4B2IA 3BZKA 4JT2A 1RJ9A 3KTAA 4NL4H 2VHTA 2WJJA 3B6YA 1XCPA 1E3PA 5EUMA 521PA 4MRNA 1TX4B 4DV2Q 3K9NA 2WVJA 5IP9H 4A3KH 2XTNA 5J4KA 1PYSB 3ZD6A 3X1DA 3FGNA 2YWHA 3ZQJA 2AN9A 2OUKA 3C16C 1O87A 3MWLA 2VNUD 1JEEA 3LXXA 1HV8A 3T5GA 4DT1A 1SROA 2AKWB 1V1QA 2C2HA 4URYR 1KI4A 3LXRA 2IYXA 1X1SA 3DL0A 1V43A 1G3IA 4NCKA 1AZTA 4Q7KA 5BR8Q 4AYTA 2LKDA 2ASEA 4DB4A 1GD7A 1E32A 4TWZA 3I62A 2K32A 3S2DH 3NXSA 1RYHA 3CB4A 3TUZC 2E87A 2HLDA 2BH2A 1VCNA 1XD2B 1XP8A 4TLAA 5TY0A 4B35A 1UE1A 5CYOA 4GL2A 1JR6A 2ZQ5A 2OG2A 4CIDA 2OEPA 5K8TA 2I1QA 1N33L 1UEJA 1TAGA 1U5KA 5JWRA 2QGQA 2CWAA 3BB1A 3LLUA 1ZNWA 2HDNB 2Q21A 4LFBQ 1N6NA 4DDTA 2ZJ5A 1VQOA 4CEJB 4UKDA 5IP7G 2NTYC 1MO4A 4R1JA 1Z28A 2IYQA 3BK7A 3DZ8A 5JSZA 1XFAA 1Q44A 4LPSA 4Q4LA 2C9OA 2FA9A 2NN6I 2QY9A 5JEAJ 4RZ3A 1NG9A 4G3XA 1QZHA 4BUJA 4NYJR 4ZIRA 3UG6A 2E5LL 1XD2A 3A0JA 5DI9A 5IK2D 1PH2A 4DZZA 5EE9A 4DDUA 4JJKA 4R71A 4N3NA 1IXSB 4A1FA 2H18A 1T5LA 4PAOA 1I4LD 3CCJA 3NE5B 2Q2HA 4DBLC 2OCAA 2JJ2D 1UEBA 1PA6A 1R5NA 2LKCA 2ZRFA 5DISB 2WWYA 4CEJA 4HB4A 1T5EA 5AJVB 3CX6A 1X65A 1P7CA 1XRJA 3VKHA 2JA5H 1GJXA 3SHFA 1VIAA 2A5FA 2QTFA 2X77A 3MRSA 4KVGA 2ZXUA 2KBNA 2AXNA 2FPLA 4P0TA 2CMKA 1I4DD 3M4QA 4LJ5A 1DAHA 3OTOL 3CRKC 2MO0A 1CI3M 2EFCB 2KSQA 3HU3A 1I2MA 4AY2A 3W6OA 1N2CE 4LBWA 3S17H 4A92A 5AUOB 4B3MQ 4L15A 1Q46A 1CSQA 2HIVA 4Q4AB 4X65Q 5JMTA 2CCZA 3J80c 1DS6A 4JI8Q 4NXML 1G8YA 4TMXA 4G5GA 3SHWA 3ZVRA 4QNRA 4URXR 2ZJAA 4IDPA 4K0KQ 3F2DA 3UDFA 2A5GA 4AWXA 1N5JA 3VR4A 3CC2A 1COWA 2EQBA 1VQNA 3QY0A 2Z5FA 4FMCF 2F55A 1XTRA 1RC8A 3CCRA 1BO6A 1XD9A 3NC0C 4PO9A 4TMVA 4BEJA 1XDBA 3PO2G 1SXJE 3BB4A 4NE2A 2NZHA 1U90A 1KSHA 1XU4A 3D0FA 1FL0A 1JAIA 4OQNA 1B23P 1W4AA 1E6CA 3CNNA 2IX0A 4LF8L 5HKKD 4Q4AA 4R4TA 1T5IA 5DN6A 3A4LA 2QM7A 5H1SE 2DY1A 3RVBA 2Q3HA 1VQKA 3I32A 4JIMA 4GP7A 3KFUA 2ALYB 3BE4A 1CTMA 3CF5A 2GTPA 4IOCA 2BMEA 3DMDA 3CLVA 3GLIA 2GXSA 4WXPA 3K9HA 4R9UC 2PBRA 1Z22A 1E69A 3N5CA 3EZ2A 3NENA 1SVKA 3IPXA 2HHHQ 3UATA 4JI7Q 1Q57A 1NIPA 2IY5B 2ZETA 4L5QA 1E1RA 4JBWA 3MG9A 4WJ4A 3MCAA 4UPAA 3DLLA 1YI2A 4IVRA 4JL5A 4MUAA 3K70C 1OJLA 1G17A 1IAQA 4QBGB 3Q85A 4UXHA 5JCZA 4PO8A 2IYTA 3N2IA 4PZ6A 2JJ1D 2IYWA 2O0HA 1D5CA 2VP5A 3CWQA 2BDOA 4Q02A 5LB2A 1EXMA 2WSSD 3NKVA 3VQTA 2W00A 3PGZA 3A1WA 1VQ6A 2EWVA 4KO8A 3TJZA 3U7EB 2QE7D 2EFHB 4TVAB 4UJ5A 3RR5A 1OIWA 1S3GA 4DR5L 2ZVQX 2XZLA 2NZJA 4UQOA 1E2EA 1CKNA 1FMJA 4JT4A 5C18A 1R4AA 2VQEQ 3GJ3A 3A5UA 3F3YA 4J15A 2NPFA 4A36A 3LNNA 1KQSA 4E5UA 2CL7X 2FOLA 1E9CA 1P72A 4ASUA 3VR3A 3LWUA 4A3EG 2OZEA 1YKSA 3L0SA 3WRYC 1LM0A 3PO3G 3IO5A 3K1JA 2EDGA 2SHKA 3QVVA 2CE7A 3K7UC 3PUYA 1N34Q 3W5OA 1TU4A 4K46A 3V4FA 4PZYA 4LV6A 1R5BA 2ZJOA 2GZHA 3GJ7A 5J4HA 5FLMG 4H9GA 4AKGA 2VSXA 2N49A 4U5XA 5FOVA 3JZMA 4EX5A 4YMVA 4AI6A 2D0OA 5AJWA 2XTIA 1Y3AA 4B3BA 2ZEJA 4LJYA 2B8GA 1NY6A 3BDOA 4BZPA 1YU9A 3U4QB 1NMFA 4GBMA 4HAYA 3BIFA 1E0AA 1NN1A 3CP0A 3STBC 2HF8A 4LPKA 5FOUA 3GCGA 2ZITA 3ZS8A 2LXKA 2OTLA 1VQ4A 4A3JG 1Q90A 4DR6L 2R6CA 4KBGA 4AD8A 4A3CH 2MMGA 2IS2A 2A68D 3FKSA 4UP9A 2QM8A 4DLXA 1CRPA 1FOEB 1E2VA 4GMXA 2F6RA 1E79A 1Q3TA 2NO6A 3ICEA 2PT5A 2ZSAA 2Z6KC 3AVQA 1S3SA 2BBWA 3B82A 4RCNA 1P61B 5SZIA 4D82A 1M7HA 1ZVQA 4DV0Q 3THWB 1OKKA 1W2HA 3TW4A 4DV5L 3PF5A 2VUMG 1ZNXA 3BD9A 4PHHA 5CLQA 2MFIA 1YHBA 3GQBA 4D0LB 3U7HB 4N0DA 4BLTA 1AIPA 3FKQA 5CM8B 5K8UA 4TMWA 2GZDA 1UKVY 3EPKA 2NVXH 2Q0HA 2GDJA 3TQYA 5SZJA 3AM1A 4YLGA 3L82B 1R0XA 2CCGA 4HATA 4C0JA 1C7YA 4WZBE 2JLUA 1HNWL 1B70B 2BMJA 4TMTA 3VR1A 4HAWA 1D9ZA 3T15A 1OB5A 2XX3A 5F3WB 3WBKA 1R2QA 1S1CA 2VQFQ 1OIXA 4L16A 2F9LA 5HZHA 2H17A 2OWOA 1EFHA 2KB0A 2UXCL 3THWA 5EP1A 2Q9CA 2A3RA 2C8VA 5L3RA 1DCZA 4LWCA 2G1JA 4JV5L 2QAGB 3OHMA 2GEUA 2G1KA 4BFUA 3WNBA 3VHLB 3AKCA 1VCMA 5GVRA 2FZ4A 2B8FA 2MSEB 4B3RL 2QZ4A 4HAUA 1B8AA 1JJGA 3L0OA 5JEAG 3J81j 1J8YF 1VHTA 2GKSA 1VQPA 2NO0A 1YZ6A 5BN3A 1H9SB 2ZSDA 1OHHD 1KNQA 4MNOA 3WMFA 4EPXA 2VHUA 3SFVA 3AVTA 1D2EA 4JLDA 5IT9c 4ARZB 4LV8B 1LY1A 3A5ZB 5C0XJ 1W1WA 1W4BA 2ZSEA 2ZJ8A 2I3BA 3CW2A 4DR7L 4NPHA 4Q7LA 5EP4A 3THOA 3U4ZA 2HLDD 5M5XH 4JOIC 1S72A 1PLJA 2QAGA 2B8TA 4JKIA 4QNMA 4X8LA 1Z2CA 4KCGA 1R7RA 3LWNA 2ZE7A 4KFSA 4Q1CA 3TIFA 1U99A 4PC6A 2A5YB 3AVOA 4OWXB 5J4LA 4HLUC 5AJ3L 4NKRA 2I5LX 1Q1BA 1E1OA 2WP8J 5IP7H 2LCFA 2AL7A 4H44C 1KC8C 4HUQA 4P75A 4EKDA 1O3YA 1H9SA 1ODFA 3EC2A 1ZD8A 1TUIA 3EIEA 4Q1FA 1J6QA 4IPGA 3VDYA 1FQKA 4LV5B 1I4TD 4M2LA 3QSYA 3VX4A 5AK0A 1EWQA 2TMKA 1I5FA 1D7QA 1Y63A 1C1YA 1K5DA 1T6NA 3MJRA 1AKYA 2GAAA 3AF4A 4OQFA 3PVSA 1IZ6A 3U60B 2G3YA 3CNLA 4DV7Q 4MKHA 2GAOA 4RZUA 4QBIA 2K52A 3KXLA 1Z6HA 1VS0A 4L5TA 1Y8NB 4PSKA 1X86B 5B2ZA 5TVKA 3SFZA 3WNDA 1G4AE 1X56A 1NVVQ 1E99A 5LMNQ 4GZLA 2J0VA 1US8B 1EFRA 3GJ0A 5LMNW 3HOVG 1TWCH 4G5SA 2CHVA 4EUNA 4PPNA 4Q66C 2LWIA 4KLNA 4WZAE 3SYLA 1T0HB 3IBGA 1G8PA 2QMHA 2BE5D 3FHCB 1AZSC 4LHVA 1U9IA 1OE0A 4GKKQ 1QRAA 1XEFA 421PA 5BYJA 2ZM5A 2OBNA 5IDVA 4WAUA 4LZZA 2ZE6A 4Z1MA 4A4DA 4DWJA 3N2EA 1TQ6A 3U44B 4DV1L 3RS5A 5G53C 1E24A 2JXMB 3B1WA 4GZYC 4HZUB 1SMXA 4LJ9A 1N6LA 2V6JA 1RPZA 4HJ8A 2RGNA 4TN1A 1US8A 5JRZA 1W2GA 1YJ5A 2JDIA 3GFPA 5LB4A 4KI0A 2ZRNA 5LMUL 3B85A 3OPOA 1HZBA 4URZR 1JEDA 5J3BA 3M4YA 3HOYG 2WKRA 2ZROA 4RD3A 4M1KA 4OKSA 1DO2A 4DV6L 4WXRA 3Q3JB 4LUVA 2Y0SE 1WDTA 1PYBA 3GJ5A 3Q5EA 3PO2H 4LC1A 2BM1A 4G5QA 1E9FA 4ZCIA 2KBFA 3R9XA 3CR8A 1Y1VG 3RWMB 3QBTA 1CJMA 2OV2A 5FR1A 5HE8A 1WYDA 2VL6A 3RWOA 3T1HL 1GKIA 1BKDR 3SU8A 4PV1C 4PZLA 5KDOA 3U44A 5FTMA 3L0IB 1WFQA 3TW8B 4JYAL 5DN6D 4HZUA 3RHFA 2O8EB 1ETUA 3FYHA 1J5EQ 4CRWB 1CXZA 4JLMA 2EQSA 4G5OA 4E09A 5D3QA 4IEIA 2P6NA 3AKEA 1N36Q 3EWSA 3VU9B 1FJGQ 4XJXA 1B0UA 3J80i 4LC0A 4EJSC 2AD5A 4WIAA 4AG5A 1AQUA 2PJRA 3H2YA 4PANA 3LVQE 3ICQB 3CAMA 1BH2A 3IRBA 4GLAC 4IKEA 1VG9B 2WICA 1P16A 1PHJA 3M3YH 4GNXB 2GN5A 3UDIA 3RN5A 2NVYH 4OX9L 1KY2A 1W49A 2GJKA 4M9XA 4CT5A 3CNOA 3CX7A 4WJ3M 4LCBA 4HIOA 4YXWA 3KQUA 1JPNA 4EPYA 5CDFE 1BDOA 2AUJD 1KMQA 1TU3A 2J7PA 3LW8A 5JECA 3FFBA 2ZRPA 1K8OA 3F2CA 1K73C 2BJWA 4KKTA 1GRRA 3KJHA 3QG5A 4IJMA 4DC9A 2FDCA 2MNAA 3KJGA 2V1XA 2ZPTX 3VU9A 2ZYUX 4QY7A 4P4SB 2YWFA 3BAFA 3U6KA 3Q5DA 1P3JA 1JI0A 3X1WA 1JBKA 4I4LA 1IBKL 1GUAA 4C3HH 1TQ2A 2W58A 4Q5IA 1MJEA 4YC7A 2D7CA 2VL7A 1NBME 2VTKA 1Z6YA 3AYHB 3FDIA 3CMAA 1GRNA 1MH1A 4GNXA 2Q3FA 3NBZC 4MKGA 4MYUA 3TBKA 3U2QA 3CCSA 2GRJA 1N6PA 3QJYA 3VKWA 1OH6A 3MEFA 4A3EH 4PHFA 1HZAA 4ASUD 3TKLA 3PO3H 3LQQA 3UIEA 3VHXA 4QQBX 2Z4SA 1R8SA 2O5VA 1N0VC 2HJGA 4TLEA 2XOKD 1GUNA 5H8WA 2JK8A 3JC66 2CQOA 1BS1A 1ZBDA 4P4SA 4BFZA 4NCNA 4OWTB 3G0HA 4OBEA 1LF0A 3R9IA 1ZNYA 1IN8A 5TXGA 4D80A 1MV5A 5B64A 4GN5A 4WOPA 1VQGA 3EZ9A 1NJGA 1UBFA 4KMUC 1A0IA 1FTNA 1G6HA 1JQLB 1UJ2A 2C78A 3ZDQA 1EGAA 4BQSA 2YOFA 3S16H 1IQPA 1LNZA 4A3JH 1YVDA 4PZ8A 1ZD9A 3ECCA 1DE0A 3IUYA 4B33A 1ZCBA 4DLWA 3HOZG 1OPXA 3K0EA 4DEYA 3R8CA 3BORA 121PA 1T91A 3FKSD 2CCKA 2VRWA 2FN4A 3U3KA 1YR6A 2IHBA 1K6MA 3HR8A 4MKIA 4JI2L 1FFHA 2DWOA 3SS8A 5HCIA 2VP9A 5JHGB 1HPCA 1LS1A 3W6NA 5E95A 5JS8A 2VUMH 4DRZA 1VF7A 1CJVC 2G83A 5GQOA 2XZPA 4DUYQ 4ABYA 4M8NE 1W4RA 3H0GG 4GSYA 1XNRQ 2IC5A 3RZOH 4BRWA 1SFOH 4NYIQ 1VQEA 3CRRA 1V8QA 3BZCA 3I4OA 1DGSA 2IYLD 1JPJA 4S35A 4H1UA 1M90C 1L8QA 2JJ2A 3S14H 2FSFA 1KDTA 2AFIE 4DAMA 4QXAA 3RN2A 3EQLC 1P6XA 1II8B 2GZAA 2ZRBA 1KTVA 2YZ2A 3CPJB 3TMKA 4M1TA 3NWJA 4CEIA 1XZPA 2RHQB 4XSHA 3NH9A 1AK2A 3PFIA 1M1YE 4LW1A 2DNEA 1AS0A 2ZU0C 2FNAA 4KLZA 1P2TA 1DADA 1G4UR 2QF7A 1KIMA 1QF9A 2OLJA 2BMFA 3NEYA 3BJUA 1L2TA 5CYPA 3GTQH 2GILA 4OHZA 621PA 1L0WA 2JLSA 4PPQA 3CWZA 2Q6TA 5JEAH 4IPHA 1R8QA 4ZKDA 3C5HA 1VQMA 4NCIA 3LLMA 3L8ZA 1YJNA 4RFVA 1C9OA 4S2EA 1II8A 4OK6A 3E2IA 1Z6TA 3NDPA 1T8TA 1PFSA 2OBMA 3AKDA 4AYBE 2YTVA 1ZU5A 2P2LA 5IWAL 3O47A 4RSGA 1OW3B 4P4TA 1VQAA 1QVGA 1L4YA 2JAQA 3LRPA 4KFUA 4RZ2A 1D8TA 4QJ4A 1YNXA 1MIUA 2JEBI 1BYIA 4M1WA 5ELOA 2WJGA 4G01B 3THXB 3KOJA 4GOPC 1ZNZA 4JI6L 1E98A 2CLDX 3B9QA 2E76C 1G3QA 1SVWA 4A76A 5FOWA 2NO7A 3AP1A 4MDFA 3LBIA 2PCFB 5HKKA 1J90A 4ARZA 1GL9B 5AJYA 1WQ1R 3PIRA 2GCOB 1XNQL 2D74A 3VX3A 3K0CA 3U6BA 2WOOA 1EFUA 3GLGE 1IBLQ 3F0TA 4A6XA 3OFND 1TEXA 2YYZA 2WKQA 2GVDC 2J41A 2VW9A 1KY3A 2QMEA 4D2IA 4NYMQ 4URUR 5A0FA 4DK6C 2BEJA 1E2ZA 2KBEA 4C0QC 2VF7A 3THXA 3QF4B 1R5OA 1SVIA 2VPPA 4MYTA 5FPHA 4A3BG 3FMIA 4N1AA 3PEWA 1X3EA 4OWWB 3T1YQ 2R93G 3DVLA 1YR8A 2YTXA 3E70C 3M4OH 1J2JA 3PR1A 5FPYA 4ZCLA 2N3SA 4P71A 4IXNA 2PX3A 2JJ1A 3M0EA 2PLFA 1II0A 1U8AA 2GCOA 4HLDA 1XEWX 1QVRA 4DEXA 4Q9KA 1VPLA 3HOVH 4JI5L 1AGRA 3NIBA 4B2PA 4F93B 1E94E 1G51A 3ADBA 1A2BA 1TNDA 3BGWA 1GVPA 1EFRD 3BH6A 5CJ2A 1JMCA 1I94Q 4AQYQ 3F2BA 4TQAA 5KDDA 3M9BA 2YKGA 1MABA 5D3MA 3QE0A 1SULA 1W44A 1XB2A 1VQ7A 4A3DG 3AGQA 4HDOB 4WW0A 3DHWC 3QF4A 1S3OA 2ZUCA 1FPMA 1ZMXA 4XD7A 3ADKA 2QQEA 3OIYA 3Q72A 4LJ8A 4NDZA 4OJKA 4P73A 4Z1MD 3U3MA 4QHSA 5SZHB 1CKOA 4AIMA 3TREA 2OAP1 1N6OA 1HNXL 1L1OB 1AA9A 1AM4D 1HYQA 4FN5A 4LNQA 2WJYA 2L15A 4MYCA 3BB3A 1YJ9A 1W47A 1XCGB 5JWHA 4EDHA 2DFTA 2D62A 3W3AA 2PJZA 2V7QA 4M21A 2HYIC 3L7ZC 1Z0FA 4GOKA 3HOYH 5IE8A 1GWNA 4TQ9A 4Q1EA 4FCTA 1E96A 2IWRA 4OI2A 1T9HA 3C5CA 3HR7A 4M1MA 2VS1A 221PA 1Y1VH 5KSYA 4A6PA 3KXKA 4QM6A 5FPKA 2HIXA 4IFDG 2ATWA 3RANA 3B9PA 2QRZA 4JI3L 4A75A 3OZXA 3B6EA 1JR3E 1P75A 3RSLA 1IW7C 1QJOA 1N33Q 1IJFA 2MO1A 4KN4C 2XTMA 4DSNA 4DSTA 1RRGA 3SQXA 4RD2A 2JIZA 4P32A 2HCBA 4JK1C 3A8TA 2OCEA 1UE5A 1RKBA 3IGFA 2P5TB 2CNWD 2X2EA 4HI0E 4V0MA 2WWIA 3T5DA 3LY5A 1IN5A 3GJXC 1T4GA 2IWHA 3CO5A 1QG4A 2DNCA 3L2OB 3LFUA 4ZO4A 3ADCA 2WAQE 2D0PA 2BKEA 4RZXA 4HAXA 1U0HC 2A69D 2E5LQ 1OF1A 4QG7A 1VIYA 1NE3A 1PV4A 2RKOA 4MRVA 4C7OA 1ELOA 4A15A 2CDNA 2JLWA 2F52A 3SQWA 5EZ6B 2CL0X 2OTJA 2J7PD 4DK0A 2K5UA 4PC2A 2GK7A 2NQ2C 3K0FB 5J5CA 2IBMA 2J9RA 1OTCA 2F4VQ 2QTVB 4X6AH 3KF6B 4DLUA 5EXXA 3A58B 3TVTA 2A30A 5FBVB 3ZS9A 3MWYW 2WJHA 3T06B 3IQXA 2PI2E 4BE7B 1P9WA 3GD7A 1IBRA 3K8YA 3QKTA 4XVUA 5DI3B 3AV0B 3ZD7A 1H8ED 1G7CA 4UP8A 4PR0A 1GM5A 5LBIA 4XIGS 1TQDA 1PH6A 3SI7A 3TR0A 3OTOQ 1HCZA 4JI4L 1F60A 4QOSA 4GS3A 1EIYB 4BFWA 1E22A 1JJVA 3W34A 4OK5A 2R6GA 3EBEA 4AKHA 5FI1B 3SBEA 4KBFA 3PG5A 1R6BX 5FTJA 4HZIA 1G8HA 3K0FA 1GZSA 1NMXA 3BFKA 1HE1C 1MOZA 4L4UA 4B3TL 3AB9A 3KF6A 4NXMQ 3K53A 5KSOA 1ZM4A 3AH8A 1DARA 2O8EA 4JG2A 1LF5A 3I73A 4D4JA 2RMKA 1TPZA 4B73A 5ELXA 1OHHA 1E2QA 5DI3A 4V0NA 1YNNC 1QBKC 3NG1A 2JQOA 4LUCA 1F3OA 4LYFA 5EP2A 1ANKA 1E2MA 4OHXA 2OHFA 2AWNA 4JSYA 3NBFA 4B3GA 1YZUA 4Q7JB 4UXIA 4YONB 1E4VA 3HOZH 1E4YA 4C0HA 4DCNA 5FR2A 4DDWA 4LF8Q 5DHFA 5F98A 5KUTA 5L3QB 1ZYUA 1K0RA 2J87A 1M1KC 3Q8XB 2ZT9C 6Q21A 3ZJYA 2ZAOA 3MJHA 4HIKA 4PXAA 1DEKA 4RJLA 3T1VA 1E2JA 4IOMA 2XAUA 2KHIA 1IY2A 1LTLA 4LF7L 1N3BA 2V55B 2JASA 3LO5A 4FINA 4PAQA 4W5WA 4DHEA 1XTDA 3NHBA 4HAVA 3TLXA 1Q82C 1IY1A 1BYUA 4WA7A 4A2PA 3MMPA 4NH0A 2C03A 2I1VB 2MSCB 3H0GH 3O8BA 5BXQC 1S9HA 1WBBA 1X8KA 1NN3A 5FLXc 2ORIA 4W9MC 1E0JA 1EWRA 1VQHA 1EK0A 4LF5Q 3B1ZA 1QZGA 2RGDA 4C0SA 4IFDI 3UMSA 2ODWA 2BMDA 4HUTA 1X6OA 1Q8KA 1KRTA 1UDWA 3NH6A 1NVVR 4Q4JB 5K8LA 4HJ9A 2ZRCA 4O2LA 4D0NA 2JLXA 3LA6A 1VQIA 5M04A 1G9XA 2YOGA 4W5HA 3CPWA 1LW7A 5HPYB 3N70A 1H9MA 3GDEA 4V03A 4DR5Q 3KF8B 3OEEA 1Z0AA 1K9MC 5EE1A 5FBWB 1N6IA 1SVSA 4IOKA 2LXJA 2IXEA 4BY7G 2J5XA 2PCLA 3MWKA 4M9ZA 2GCPA 2HT6A 3EPJA 4C0BA 1K8GA 4TYNA 1XNJA 1X6VA 2ZJBA 3ZLJA 4UP7A 2JA7G 1VG8A 2B92A 3FFAA 2E1RA 3U50C 4GMDA 2RF4A 3QXXA 1JAHA 4Q4JA 3E1SA 3TSOA 5F9FA 3HKZE 1IJEA 2JA8G 5CJPA 3GO5A 3KUCA 4BFYA 5EUQB 4Z51A 5B30A 2G0NA 1XMOL 2QENA 2R7ZG 1YZTA 4YQFA 1MO5A 3VR2A 2ECKA 4D6PA 1GUOA 1G16A 1J8MF 2BE5C 3I55A 2O0KA 2OSBA 4TLBA 2UUBQ 1CR4A 3K70B 4HIMA 5KNCA 3FMOB 3WDNA 4JJZA 2A6ED 1AS3A 5E7MA 3SC3A 1Z2AA 3AQQA 4YCVA 1DVRA 5FUYA 1VQBA 1KI1A 4R2IA 3NC1C 1OYYA 2OO7A 3KQHA 1E9AA 4X8MA 1GG2A 2PH1A 4IPDA 2XEXA 2UXDQ 4B44A 1TF7A 1KYIA 4LJAA 4L5SA 4KYUA 4C3IH 4DPGA 5JWOA 2DGYA 2KJQA 2YOHA 3ZIAA 3LD9A 1VQLA 3WP0A 1E3MA 4LFCQ 4AC9A 4JLVA 3HPQA 2YJTD 2C99A 1TF5A 4DR1Q 2UXBQ 4A3BH 1P62B 1VYVA 2Z6VA 4NP6A 1VHLA 3L8YA 2R93H 4YMTA 3PEYA 2XJ9A 4DV5Q 1JJ7A 2EVWX 3WMGA 2WPDA 3GTLH 3VFDA 1I2DA 1WE2A 3CCEA 4ZCMA 3I5XA 1UPTA 1HH4A 1SXJD 3MUFA 4R2HA 5JEDA 1XMJA 1X3FA 1E1QD 2N1BA 2ZTEA 1FQJA 1Q0UA 2NIPA 3S15H 2CWPA 3GEIA 2J0UB 3PITA 2P6RA 2ODBA 1SHZA 1G41A 1E9RA 1A4RA 4KKSA 1TWGH 4QHTA 1XTQA 3TVDA 4A3DH 2PEYA 1SRUA 5J4YA 3AB3A 5AUPB 1NVWQ 5GAGC 4JBJA 2ZE8A 2YC2C 3LVRE 2BBTA 3RNUA 3GJ4A 2O0JA 1E1TA 2UXCQ 4UNQA 1JJ2A 1CULC 5JLJA 2BHRA 3NHAA 4XD7D 4IJHA 3TQCA 1WP9A 4WVFA 4IOAA 4A3MG 5KHOC 3UE0A 4JV5Q 3I8XA 4YHHQ 3QEOA 3CRQA 1A62A 2VO1A 4YMWA 1HNZL 3RSOA 3K0AB 4Q48A 4M9QA 1KK0A 3IIKA 4HSEA 1Q1QA 4ESHA 3PEUA 3I4NG 4B3RQ 1HR0Q 2J0UA 2V7QD 2XOKA 2VP4A 1LB1B 2OESA 3EAQA 4IFEA 4QM7A 2JJQA 1HR0W 5CIQA 3D7MA 1CJTC 2UU9Q 1R9TH 4OI1A 4GNKA 2ZR0A 3S2HH 3K81C 4DVGA 3CIOA 1Q81C 1NTGA 1K8AC 4IFDH 2C5LA 1P2UA 4BBSH 1NMZA 4IQZA 4HJ5A 3CRMA 4D25A 3C14C 3EW9A 1W46A 4MGKR 1GNRA 3FMFA 4US0R 1NBMA 1GDDA 2EJMA 4B3ML 3RABA 4QGUA 2RGCA 5C4XG 4DR2L 3K0AA 1AKEA 1HQCA 1E2WA 3PV0A 1SZPA 2WBLC 4LY6A 3GTOH 2QAJA 2BBSA 1E2FA 2VH5R 3QPWA 2ZS9A 4FW9A 5AJ3Q 4LJ7A 4PSVA 4A8JB 1Z63A 5GROA 2NMVA 1ZJ6A 1W0JD 1OV4A 3ULJA 2JIZD 4YMSA 5FBQB 4D4KA 4DCUA 5A4JA 1OH8A 2O8BB 4OQXA 4K0KL 5LD2C 2WJIA 3N6RA 2XB4A 2E75C 4Y0AA 4A2QA 1W0KD 2K50A 4TLCA 3VTKA 4US2R 1SLJA 1IOZA 4RCYA 5FL3A 2Y0SG 3TK1A 3CRVA 1KKLA 4EFMA 1TKWB 5HE9A 4KN7C 1I3QH 1ESMA 3U4QA 2K5HA 1CU1A 2MQHA 5CK5A 2REBA 3KKMA 3MAAC 5G40A 3L43A 4PG3A 2ZJ2A 1G21E 1N5LA 2H5EA 5EAYA 3KQLA 2ZI7A 1VYTA 4A8JA 1SVOA 3ADDA 3T53B 1KHIA 1S0UA 3CCMA 4PHGA 4F91B 4JCVE 2VIIA 2B29A 4NB3A 1PLKA 3ZVLA 2OFXA 2HJVA 1UBCA 4M1OA 4XWKA 2ZRIA 2PEZA 1HURA 4DB2A 2HHHL 3RNLA 4AKEA 5A35A 1IHUA 1DAFA 3B1YA 3HP1A 1X54A 1I50H 4U7DA 3B78A 1SVLA 4V02A 5IYBG 3E9IA 4WBSA 1SE8A 1ZM9A 3U7GA 4QKQA 1HT2E 1Z6XA 1SGWA 1T0JB 2C95A 2JLRA 4DV1Q 4POFA 1YITA 1XJQA 2DBYA 3EIHA 4X64Q 1TMKA 2OILA 3ZYCA 3O8CA 3QBVA 4TSFA 4NXNL 3D4RA 1G3MA 5JS7A 2HUPA 3R8FA 3CR7A 2GJ8A 4DNTB 2CXXA 3GEHA 1P9NA 4NHOA 3KKPA 2A78A 4G7OC 3HYTA 4DV6Q 4XWOA 1NBWA 1VQCA 4KHPQ 3J7ZC 3G71A 2BC9A 3FMPB 4PZZA 4F4CA 2B63G 2Q2TA 4MRPA 1HY3A 3H3VH 2PX0A 4EQ6B 2ANBA 3AF0A 4POAA 4JOIA 4LJZC 4RKEA 5KPJA 4DV3L 4GKJL 1XWIA 4JBXA 3T1HQ 5A5GA 2ZTCA 2OFOA 1KIXA 3NBYC 2FSGA 5HR5A 1KMHB 2IS4A 2BCGY 2OM2A 4JYAQ 3IHWA 2WHXA 4HLUA 5DYIA 3A36A 3A74A 3TGPA 1W5TA 5DYGA 4QL5A 1MT0A 1S2MA 3AVPA 2K4KA 1MO3A 3S1AB 1DAEA 4I81A 3OFNA 1GKHA 1LACA 2KE5A 3GTJH 1HJPA 3PUWA 4I1SA 5IYDG 3CF6R 3GLGB 1G5RA 1YR9A 4B75A 2XNDD 4LF9Q 1JALA 4Q9HA 1LUZA 2IL1A 3LDAA 3TZUA 2XTZA 2WAYA 4EQ6A 3SGIA 4OO1G 3CW2C 4OX9Q 1QVFA 5G41A 3IQWA 1L4UA 1TADA 1KNXA 2VF8A 3K0SA 2QAGC 3DOEA 1WI5A 5BN5A 4DR4L 1DTSA 1KMHA 2HV8A 4OXPA 1QHHB 2PMKA 2ZREA 4Q1AA 3S24A 3QQ5A 1R10A 2C96A 1ZUIA 4OONA 5FTLA 1SN8A 4CGZA 2KA7A 1T3HA 3A7LA 2WOJA 3QF7A 3WY9A 3S1AA 1OLOA 1HH2P 1QG2A 5TB5A 4QJFA 1YHQA 1SKYE 1OXXK 1OT3A 4QGGA 2EJFC 3FKIG 1IBKQ 4HDCA 4DNRB 3GLGA 3OEED 3OW2A 3U58A 2XITA 1KI9A 3NBXX 3NDBB 1NP6A 4BY7H 4NYJQ 2O8CB 1FNMA 3EPHA 2QI9C 2X1VA 3V9PA 4ZDIA 4G0NA 1MRSA 5CB6A 1LYLA 1XTIA 5IRCD 3FOZA 3PIPA 2JA7H 2ORVA 2V6IA 3TRZA 4FXPA 3QENA 1W2BA 2QGZA 3IIMA 2A7QA 5DHAA 4TLDA 2CVHA 4BWYA 1QHHA 2F1HA 4JLKA 1XF9A 3TS2A 2J45A 3H15A 2WM9B 1QUQB 4Q47A 1B9MA 1JNYA 2ONJA 4KLKA 2JA9A 2JA8H 3GTKH 1RRCA 3L2PA 2ORWA 2GF0A 2XJ4A 2JLQA 4ZKEA 2ZYVX 4P72A 1I6HH 3WYAA 1GL6A 3S1QH 3FPPA 3A1SA 5JCPA 2R7ZH 3GLFE 4EJSB 4KITB 4FDBA 2N42A 5CIWA 2RGEA 4QHYA 2FFQA 4II7A 2R6DA 4A3LG 3FHTA 2O8CA 4MGYR 1N32L 2BOVA 3RS7A 4DCVA 4X8OA 1BBUA 1UE7A 3M85A 1XMQQ 1UE6A 1U9IC 2AX4A 2YHSA 3BC1A 3Q7PA 5GJBA 1P2VA 4EFNA 2A5JA 1BMFA 1YRAA 3EARA 3IEUA 2UZ3A 4PO1A 4OK3A 2PQAB 4NU0A 2N78A 3GLIE 1QUQA 4KVAA 4IO9A 2GVBA 3DEFA 1N0UA 4LSGA 1XXHB 1DXMA 1PH7A 2CNWA 3ZIAD 4URVR 1NLZA 4EJSA 4F92B 4IPCA 4JI2Q 4A3IG 1G1MA 2IW3A 3SYNA 1TL7C 4QBHA 5L8VA 5IF9A 2ATXA 5KSZA 2QMUA 4HYYA 1G18A 3AP2A 2JEOA 3DMNA 3U3RA 1O7IA 2A6HC 3K70D 2BA1A 4DCTA 4M1SA 2XGTA 1LFDB 1U8YA 3G82C 1OH5A 3UKDA 2GNOA 1IN4A 3CF0A 2WPDD 3Q7QA 2PPBC 2PQAA 4Q00A 4C30A 4FMDF 2QN6A 3KKNA 2LMCB 4M1YA 5FOXA 1E2PA 1FP7A 5AJZA 2IXFA 2QEQA 3QXJA 4DR3Q 1H9JA 1XXHA 2ZRKA 4JZKA 5FTNA 4B3FX 2K7VA 1A63A 4F38A 1RFLA 3P20A 1CBUA 1Y8OB 3QKSB 5FTKA 3VNUA 1AE3A 3GTGH 1CP2A 2KCTA 3CCQA 4P31A 2D2FA 4LHWA 4JBMA 4Z8XA 2OCPA 3V00A 1H8EA 4CDGA 3QKUA 5UKDA 3BWDD 3D6TB 4XSGA 4V0KA 3X1ZA 5C1BA 3RLOA 4A3MH 5FBRB 1JXMA 2ZI5A 1XD8A 4L9SA 4DV7L 1Z6GA 5EE5B 4EIWA 4OHYA 4APVA 3J81c 4H0LC 4I1UA 3PUVA 5F9HA 1SVMA 2D3WA 3WBJA 1CSPA 5ELNA 3I4NH 2I0QA 1OFIA 4LWZA 3FPAA 2JEAI 2Y8EA 5M5WH 5KYKA 2IYVA 2EXDA 1ZUHA 2IHYA 4GN4B 1W36C 2OAQ1 2OLKA 5HTKA 1LTQA 1X8JA 1A5TA 3NELA 1HEIA 1QHNA 3UDXA 4TMKA 5C44G 1UF9A 2KWIA 4DV4Q 1XJCA 3IHLA 3SDZA 2PI2A 4RD0A 2EYQA 1PH4A 3CPFA 2PZEA 3KDSE 4CF7A 1EQQA 4AG6A 4GNXC 4AYXA 2N8NA 5C4XH 3STBD 1YZQA 4JL8A 1NBMD 4BECA 3TS0A 1IBMQ 2QG6A 1B7YB 5M3MG 2VQSA 2WWFA 1KSGA 1AS2A 4CYMA 4OJQA 3AFQA 4Q4HB 2W2VA 3BRWD 4DKAC 2VEDA 3K80C 2IUUA 1W5SA 3T12A 2ZJQA 1Z0IA 1EIFA 2QL6A 3EIQA 2RGAA 3T1QA 4KJZA 1FW6A 2IA5A 4NTZA 4A4IA 4Q1DA 2AK3A 1Z7TA 2D2CC 2BIFA 2R8RA 2W0SA 1KK1A 1Z06A 1BKBA 3GLHE 1CLUA 4G7HC 2EW1A 4X62L 4JYBA 1D2NA 2VLIA 4JSTA 2UUCQ 2GBLA 1N5KA 4Q18A 1KDOA 1EESA 1DAGA 2VP2A 3DXJC 2VSOA 4XOIA 1NSFA 1ZM7A 2GJSA 4Q4HA 1GP2A 1J5EL 2PMDA 3K9LA 3QXHA 2D4HA 3U3OA 4JI5Q 5FUXA 1IXRA 3EA0A 2OQKA 4QGAA 3W5JA 3W90A 4FWIB 1FJGL 1WCMG 5C0XG 1G5PA 4LYJA 2ZRMA 4MGZR 3BXZA 4IOJA 2Q8IB 4LFAQ 3ERSX 4JVSB 3T1OA 4IDOA 3THYB 3SEAA 1G291 3KXIA 1OXUA 5IYBH 2BBOA 2WSMA 5EQTA 1H9RA 1KI6B 2DWPA 3PENA 4LGMA 4PQRA 2WB1G 1KAGA 3DZDA 4MRRA 3IEVA 2QSYA 2QRNA 4GLXA 3ASYA 3CX8A 3O8DA 2F1IA 3IILA 3OEHA 1U0LA 1ESNA 3RS0A 2R44A 4CT4B 4TSFD 1Z83A 5E3HA 4O3MA 2G6BA 1EWHA 1CJUC 1Q21A 3CPEA 3H0KA 4B3SL 2ZJYA 1E2IA 1PMRA 1KJYA 4B74A 2F7SA 3MWJA 2B63H 1G5TA 5GJWC 4DK1A 2X8AA 3I92A 2CE2X 3UE1A 2B3GA 4ON9A 4PAMA 3THYA 2HXSA 2CK3A 2IHFA 1N6KA 4JLBA 1KI6A 3IDQA 4P4UA 4JI0L 3B7GA 2Q9BA 3AGPA 4B2LA 1NL3A 1K83H 3LW7A 1G6OA 1KJZA 3AF2A 2RB4A 4BFVA 5JEEA 1KK2A 1NJFA 4JI1Q 1SXJB 2AR7A 2ODEA 4J0QA 4NCJA 1TWAH 1E2DA 1M7GA 1NVUQ 2REXB 4EFLA 1KK3A 3VAAA 2IUTA 2Z0SA 2QEXA 2HYDA 4YY3Q 2IHEA 1RIFA 2ZR9A 3DPUA 5IYDH 4N0EA 3TH5A 2X2FA 2REOA 2EJGC 2JA6G 1D9XA 5B58C 1M8PA 2QPOA 4BRUA 4ZV4A 1FGUA 2Z4RA 5C2JB 1IYUA 1VG0B 2IYSA 4OO1H 2GXUA 5FI0B 4AK9A 1UKEA 2UKDA 1TTTA 2PZGA 4H02A 1N0WA 1N9WA 2DFNA 2ERXA 1XEWY 1Q12A 1RL2A 1XTJA 1ZAKA 3UMFA 2WWHA 3RS2A 1CF4A 4PC1A 1ASZA 5JJIA 2FEOA 4CW7A 1O7LA 4W7SA 1SXJA 2UZIR 2D5DA 2CKZB 3K8AA 2ZANA 3GFOA 2GXAA 1GRQA 1E1QA 3GMTA 3K0CC 1GILA 3UWKA 1SR3A 5JZVA 3C15C 4GDFA 4BA1I 2NZOA 4YDHB 3FKIH 3K0XA 2GWHA 3W1GA 3EZFA 1S1MA 2ZRAA 4POGA 1UKYA 721PA 2V1CC 1VCOA 1KSFX 1A8VA 5P21A 3A7AB 1PH3A 1Z9FA 3EA5A 1Z07A 1P60A 4A0FA 3EPLA 3OW7A 4YWKA 2IT1A 1NLYA 4P33A 2ZTDA 4IDNA 3T34A 1W48A 4QRHA 4JI4Q 3CM0A 1HQMC 4PZ7A 1G20E 1TU2B 2CFMA 1NY4A 3BU2A 1E9SA 4M0LA 4W5JA 2GA8A 1Z0DA 4LUOA 1D8LA 3HWSA 3I4MG 3HU2A 3X1XA 2FZLA 3I3SR 3Q9LA 2IX1A 2DWQA 5IHPA 5CLLA 1UM8A 2QORA 3WXMA 1IM2A 4Q9LA 2FGKA 2XZOA 3B1VA 3QPUA 1N8RC 4DXAA 3NVAA 4B3CA 4A3LH 1PUJA 3H84A 3S1NH 2ZM6L 4MZ9A 1FZQA 3D3QA 5C0XI 2GEVA 4OI0A 2V54A 1GHKA 2WFWA 2G88A 3I8SA 2WTUA 4WZ6A 1IN7A 3CH5A 1EQRA 2ES2A 4KXFB 4TKOB 4DLYA 1OFTA 3M4PA 1Z0JA 1BMFD 4BBSG 3ZZ0A 4GI7A 4DIDA 1L1OA 4A93H 1P2SA 1U0JA 2C04A 1OYWA 3KKQA 3ETLA 4QGHA 3RS4A 1VCIA 4DJTA 2BVNA 4DSUA 3H1TA 1FP6A 5K36G 3GJ6A 2VY3A 3LQRA 4DK3C 2Q2UA 1W0JA 1XJ0A 2QU8A 2FU5C 2C9YA 4NCHA 4A3IH 2FMXA 3HKZG 2WWWA 4Q9IA 3DM5A 4MRSA 2NN6G 1H8HD 2V8OA 4PPGA 1W0KA 3K09A 4DKXA 1J70A 1F6BA 4RMFA 2F3RA 3G48A 4TTQA 2YINC 5JI2E 4X66L 3GFTA 4LK1C 4F4JA 2Z0MA 2ASBA 2ZJZA 4L9WA 5K8IA 3ASZA 1MO6A 3P32A 1YBYA 4X8HA 1W7AA 3SNHA 2YNMA 4BXXG 2PMZE 5LPNA 2EVBA 2F3IA 5KTYA 2RHSB 1ONLA 1XJVA 2D2EA 3P1JA 2HT1A 2XNSA 4PTLA 4XTCS 2K33A 2F1RA 3W8NA 2VP6A 3K7AH 4RY2A 1IBLL 1QHSA 1JR3D 3WNCA 2A68C 1GKYA 1RYFA 3ZQ6A 4B48A 1EWIA 2KENA 2J3EA 2AUKA 4A0GA 2NOAA 1HE8B 4LF4L 3CQZH 1NRJB 1MKHA 3W5IA 5FL7D 1ZIPA 1N25A 3UDGA 4QBFA 4CZ2A 4TYYA 1RJ9B 1X3GA 4BLPA 4GPTA 3RLNA 3H94A 2QPTA 4DCSA 1JQJC 3KDFB 3TAUA 2NO9A 2Q2IA 4JS0A 1Z0KA 4BFSA 1EOVA 4PC7A 3AVVA 4HAZA 1AE2A 1O78A 4ZI2A 1Y14B 2XSZA 4HB3A 1OFUX 2V1UA 4MUBA 1Q1EA 3RLFA 2JCSA 2IUSA 4OHWA 1KL9A 3B1XA 4C7OB 1C0AA 1LS6A 2P6UA 1F2UB 3CPHA 1C4OA 1I94L 3IKJA 4AQYL 1EFTA 2AFHE 3BH0A 3MD0A 3DDCA 3AVUA 5KPDA 1KDPA 5C44H 5GADC 3QI2A 2XB2A 1MR3F 3HOWG 4Y52H 2OT3B 2FSIA 2AKYA 1MRNA 4BY1G 2AD1A 3KDFA 3FB4A 5M3MH 3HFZB 1RRFA 2QP3A 5DNYB 3F1ZA 1CS4C 4EQ5A 3WMEA 1Z8FA 5F2EA 3BG3A 2GF9A 3CH4B 4ITRC 1D6JA 2QT0A 2RHDA 2ZYTX 3EASA 1VG1A 2UUAL 1JB1A 1AH9A 1XTSA 1YE8A 5IYCG 3J81i 1E9BA 2EFDB 1F2UA 3ER0A 3MXUA 2VSFA 3NBHB 3C7KA 2EYUA 3OE7D 4I99A 4XVQA 3TQFA 3T1TA 5EJEA 2GVZC 3CRLC 4NONA 4OL0A 2QBYB 1HTWA 1R0WA 5DIFA 3TAHA 5JSZB 2CVFA 4GOXA 4D81A 2XNDA 2AWOA 2ERYA 2KCMA 3WWVA 1GKUB 2QT1A 4ILEA 3IPYA 4ZIRB 5IT5A 1XMIA 1JB7A 4JBYA 1PLLA 4FD2A 3CKLA 4UNNA 2G77B 4RD6A 3HGBA 1B9NA 3QG1A 2A8VA 1FNNA 1LV7A 2CCJA 2FWRA 2V4DA 2P5SA 4LYHA 3R7WB 3TNFA 5L3QA 4DNIA 3H4MA 4LF6L 5JJLA 1XBTA 3ZJYC 3C8UA 1WCMH 5C0XH 1XPOA 4NPSA 2QQ0A 1M74A 3SYKA 1G7TA 4Q7MB 3U5ZB 2QBYA 5KU1A 3I61A 4C2MH 2JLYA 1G7RA 2YTYA 3LNCA 3BOSA 3WYGA 4TYPA 1Y8PB 3D31A 2DYKA 2NO1A 2ZAMA 2ZRJA 3HOXG 3QEJA 1SKYB 3SJBA 1G8FA 4C9BA 4KSCA 1ZW6A 2JJ8A 2C77A 3S1MH 1JXOA 3QXSA 3ONWA 2PT7A 3R7WA 1HNZQ 4DUZL 1U2RA 3P4XA 2BJVA 3OEHD 1ZC3A 1QHIA 2F4VL 4BLSA 5HZKA 1GVNB 2R2AA 5JI3E 1NI3A 3MGCA 2NG1A 4H13C 2FPMA 1GL7A 2QGNA 2E9SA 3UXMA 1OXTA 1WXQA 3BJIC 3VR6A 3GLFB 3QIAA 1E0SA 5GAEC 2R6FA 4A3GG 4ZDWA 1ZUNB 1IL2A 2CK3D 3B8HA 4PQFA 1WCV1 1H9KA 5DH9A 1GNPA 4DV2L 1K8RA 2ZI6A 2DCUA 3RC3A 1OXSC 3A8JE 3OYYA 1YZGA 2CW0C 2WIBA 4ZPXA 3HJNA 2OBLA 5H68A 2ATVA 2GCNA 4MYHA 5GADl 1JT8A 2IS6A 1PVOA 4DR2Q 1P9RA 1QHGA 4QFMA 4EPVA 4LK2A 5DLQC 1FMLA 1IONA 4DR6Q 3SOPA 1PH8A 4PPFA 2OCBA 2O8DB 4AH6A 2JA6H 3CXCA 1M34E 3EZ6A 2CHGA 4JVLA 4BEBA 3GLIB 2IYZA 2AMCB 2W2XA 1Z6AA 4PFSA 4B6FA 3L0PA 2G9NA 1KD1C 2J0QA 3KJIA 4M4SA 4L8JA 5BR8L 2I5MX 1C9KA 1KO8A 4HDQB 4RD1A 4E07A 3GLFA 1N5IA 2FH5B 4GT1A 4AKIA 2ZJPA 3UMRA 1V5WA 3W9YA 1CEEA 2W6JD 3AP3A 2BH8A 4HEJA 3ULLA 2CEAA 1KZGB 5EE3A 2VA8A 3H3VI 4US1R 2GESA 2P0EA 5GJVC 2WWXA 3NEMA 5H1YA 5H70A 2HQLA 2EU8A 3X2SA 4B43A 2K14A 1ZM2A 2O8DA 2ONKA 2H16A 1HNWQ 2FGJA 5HCNA 4LFBL 4RVCA 3SZRA 1KXLA 3AUXA 2A19A 1FUUA 2EIFA 1PH9A 1KO5A 3CC4A 1CKEA 3I7FA 5EXTA 4JLJA 1K8MA 1DAKA 3CD6A 2GVAA 1CKNB 1DAIA 2FFBA 3VMFA 1DAMA 3GP8A 4LF5L 3RRZA 3I4MH 1DO0A 3FTQA 2QA4A 3A8IE 2FV8A 5EXPA 2PL3A 2IF0A 2DN8A 5FJ8G 1X8LA 2XGJA 1VKJA 2G0TA 5KSPA 5C4MA 4UY8C 2UVQA 5TDHA 3SBDA 2W6IA 4NXNQ 2VZAA 1VDZA 2GJ9A 3VKGA 3EG5A 1IYJB 1LABA 2J7KA 5CDFA 5LD2B 2A2ZA 2FFHA 3U3JA 3MXNB 2ZRGA 1I6VC 4IHQA 3U4VA 4OQLA 1PZNA 4L5BA 2ZS8A 1CKMA 3KFVA 2ZTSA 1BIFA 5IY0A 4EPTA 3VNVA 1WF3A 1S96A 3OESA 1A7JA 2DPXA 1IYVA 3OAAA 4Q21A 4TMZA 4DR7Q 2E2IH 3FMCA 1E0KA 2YWGA 4DV3Q 4JYCA 1ZKOA 3A8KE 4GKJQ 5FOTA 2ZE5A 2C35B 3CZQA 3GJ8A 1IW7D 2K5NA 5GAHC 1EG7A 1GIAA 4RKFA 4V0ME 3PUXA 5K36H 1UEIA 2GHIA 4C0AC 4TYWA 4X65L 1OFHA 5TMPA 4JI8L 1SMYC 4IW3B 4IJLA 4YCWA 3REFA 1Q22A 2R62A 2NN6H 2AKAB 3A1VA 4PSAA 1II9A 1PUIA 1WOCA 2OE2A 2FXQA 1PJRA 2Z6KA 2E2JH 3E5HA 2XXAB 5BYKA 3MFYA 3W6PA 2JATA 1A2KC 1AGPA 3CONA 1KO4A 2DFLA 2H57A 2UUBL 8OHMA 3HYRA 3ND8A 2I5HA 4TL7A 1X55A 3QOFA 5DE3A 4BXXH 1XMVA 3WRXC 4B76A 3GLHB 1HUQA 4DR4Q 1BVSA 4NYIR 3FWYA 3ZVMA 2R92G 1DG3A 1GUGA 1YJWA 3OIWA 2UXDL 4BGDA 4KYIB 1CTQA 4QL3A 3QVUA 5FUWA 1E9DA 2O8BA 1NMYA 4B32A 4DLTA 1Q86C 1ZRHA 2RCNA 3I2ZA 4LFCL 1EX6A 1ONBA 3C41J 4JLPA 4JMPA 2XXAA 4IFBA 1F48A 4JI7L 2JGNA 3ZVNA 4DR1L 2UXBL 1EFCA 1NG1A 4A3FG 1F2TB 2WJVA 3KZ1E 2FSHA 2NGRA 3REGA 3CF2A 3ND9A 5HY6A 4XVRA 1XCMA 2WIAA 4PX9A 2VBCA 4B47A 4ZDJA 3R9WA 2QP9X 1E9EA 5JJKA 2JLZA 3GLHA 1AN0A 2XSZD 3J7A5 4KSBA 4C0KA 3PIOA 5AJXA 3FE2A 3PSIA 1S4QA 2E8GA 1R0ZA 1G8GA 3P27A 4D26A 4FWTA 4I1VA 2GEDA 2MSDB 3QNUA 4A8JC 4F7WA 4I7ZC 2J0SA 4BBRH 2JLVA 4TYQA 3SJCA 3DOFA 5CK4A 3HOWH 5LMUQ 3QXCA 1NN0A 4LX0A 3W1BA 3HKSA 4BY1H 3JAMc 3JVVA 1MKYA 1F2TA 3I5YA 4YMUA 3RC8A 1N32Q 4QGFA 2VYFA 1BOFA 4LI0A 2VQEL 1S8FA 1S9DA 1VQ8A 2A5DA 3EIVA 1W3SA 4YHHL 1G3UA 3KLRA 2O5JC 4C3JH 4AIIA 1JE5A 1AJEA 1XZQA 4U00A 5IYCH 1Y1WG 1Q20A 4JKYA 4UNPA 5E4FA 3DO6A 3LX5A 2NVQH 4YWLA 2H1LA 4NMMA 4FMCB 1HR0L 5E7JA 3I4LA 3W8RA 3EN2A 1N34L 1G19A 3F8TA 1KHTA 4HUQB 4KODA 3I56A 1YHNA 4ACAA 2ZS7A 4PMWA 4K81B 4JVMA 1EYGA 4OHVA 2JE6I 2UU9L 4D0GA 5J47A 1DBSA 1OH7A 3KYHC 4P3YA 4C0LA 1SHKA 4DSOA 2RAPA 4NYMR 1VF5C 3CCUA 1YRBA 3K9GA 2ZIAA 4LJ6A 1UBEA 4MKFA 2F1JA 4BZXA 1YEZA 4TTRA 1KO1A 2L5TA 2ZUDA 4DLVA 1E2LA 2GJAA 1U8ZA 3NEJA 3TSZA 3KKOA 1CUKA 2ZUBA 2D7DA 5KOYA 3KL4A 2QPAA 2CL6X 1P5ZB 2RH5A 1Z47A 4BLRA 3J81k 2ZI3A 1FX0B 4URWR 5AR1A 3H86A 3OIUA 3LH5A 4MH0R 3ZGXA 4R4IA 2B7BA 1VQJA 4UNRA 5KNBA 4Z8YA 3HOXH 3UWOA 2ZRLA 1TXYA 3A6PC 2IF2A 4C2TA 2L0XA 4TZ0A 4DV0L 4GOJA 3V4RA 1G3RA 2Z83A 3C4JA 5DLQE 3E9HA 1TQ4A 4A9AA 4BLOA 4CVNA 4FI3C 3TR5A 1NNEA 3RRMA 3KB1A 821PA 1DG1G 2HEIA 3TUJC 3LBHA 2W83A 3RYTC 4LUZA 1K5GA 4YCUA 4IOLA 4KFRA 2YU9H 4O2DA 2W2TA 4CEHB 1FX0A 1RIPA 3ZZTA 3CBQA 1GTVA 4R4CA 5FBLB 4E22A 3LBNA 4ERNA 2MMCA 1UDXA 3LGJA 3BBPA 1T3SA 2VQFL 1WA5A 2QP4A 4LBVA 4DUGA 4KKUA 4A3GH 1TF2A 1OSNA 3MLEA 2N46A 1WJJA 1KSJA 1VYUA 1U94A 1UBGA 2FPKA 2QNRA 2BCJQ 5J40A 1GHJA 4GN3B 1J99A 2CHQA 2W0MA 5FOSA 4HLCA 3WHLA 2AHOB 3I1FA 2IXGA 1M7BA 2H7VA 5FPTA 1FL9A 1Q3HA 1UFQA 2P3SA 2YC4C 3EX7C 4X64L 3CCVA 5KO2A 1DPFA 1QHXA 2PNHA 4A93G 4CEHA 2EFEB 4L5RC 3AVWA 2PNRC 1VMAA 2RGNC 3U9SA 3UPUA 2DFKB 4HJ7A 1QVAA 5GJCA 4HIDA 2LSSA 1H8HA 1QZXA 1COWD 1Q1ZA 4BZQA 3T35A 4AYBG 4B34A 4KHPL 1KI3A 1XX6A 3CCLA 4MQBA 2CBZA 4A0RA 5M3FG 1P73A 3CMEA 2BEKA 4LBYA 4X62Q 2QMOA 4TL6A 4C2UA 4YWMA 2VHCA 4Q19A 4AYWA 2AHOA 1WMSA 5ANRB 4O25A 2ZU6A 4GRAA 1RRPA 4QIWE 2ZJRA 3AVXA 3I72A 4OGQC 4R4OA 3BS4A 4GP6A 5L3VA 5CB8A 1U98A 2R7DA 1JR3A 3D8BA 1TUEA 2QUZA 4A82A 3RZDH 1YNJC 1W36B 1JECA 1NF3A 4R7ZA 2YVUA 1WRBA 5AUQA 3PCOB 4Y0VA 3BFVA 5EE0A 4LF9L 1ZCAA 5FL7A 4IVQA 3ULPA 4IVPA 4LHZA 3PQCA 1NN5A 3SE0A 3HOUG 1E1RD 3QKRB 4TT3A 1XPRA 5TV2A 1NVXQ 2A69C 1NLFA 1QDEA 5FJ8H 4OO1I 2IEZA 5KDLA 1NIJA 2EFGA 3G4SA 1KRSA 1E2HA 5C3EG 1KDRA 1Z3IX 2ZSFA 3A1TA 4GLVB 4ME3A 2Q9AA 3T51B 4IFDJ 5LMNL 3B13B 1Z29A 2Q3MA 1HTPA 2W6ID 3A37A 4FIDA 1XEXB 1KAOA 1NY5A 1YZLA 3AEVA 4OQMA 4B3SQ 3RRNA 3KQNA 3CZPA 3AFPA 3QKSA 5DGXA 1YIJA 1ZD1A 4BFTA 2RGBA 4D4MA 4G1UC 5IWAQ 2GXQA 4UJ3A 2VHQA 3UG7A 3DKVA 3KUDA 4Y7NH 3QKRA 5JFGA 1E2NA 3NTUA 2V4ZA 1YQTA 5G3ZA 4EPRA 1TEVA 1GUSA 3OAAD 1XPUA 4GKKL 4FCWA 3PUZA 4JI6Q 4PHTA 2IYYA 3P26A 4LHYA 1UWVA 2ANCA 4P74A 4JI0Q 1VQFA 4JLNA 3JZAA 4Q03A 1GUTA 1G64A 1IY0A 2QSZA 4KU4A 4DLRA 5JBQA 4IDHA 2F1MA 4BA2I 2IYUA 5IP9G 4A3KG 1XNQQ 4HLQB 3RDPA 3TRFA 1XEXA 1U81A 3M1IA 5AUNB 1E2GA 3OE7A 3TUIC 1D2MA 4HJAA 1RW4A 5FFMA 4Z54A 5FLMH 2NZ8A 3LX8A 1UAAA 2WKPA 5GVSA 4MGIR 2J46A 3CRW1 4RD4A 3T56B 2WWGA 2R9VA 4HB0A 1DOAA 2PLRA 2V9PA 4NBSA 3AF1A 4GFDA 1X3SA 4Q01A 3X1YA 4B3DA 3O8RA 1XMQL 3SN6A 1ZP6A 1WB9A 3FHOA 3VA7A 4B71A 4F4IA 4Q1BA 2FE4A 3A4NA 5J4VA 2R92H 4BLQA 2O8FA 1M2OB 1VECA 2F9MA 1GFIA 1KKMA 4JLOA 3A1UA 1ASYA 2ID0A 3B2EA 5LDDC 3AEZA 1AQYA 3PCRB 4H1VA 4M53A 2IEYA 1HZ9A 3KFXA 4MDEA 1LVGA 1FYCA 3CUEF 2NPIA 1N36L 4LDJA 1ZU4A 4IEEA 4XH9B 2KHJA 4DLZA 1E79D 3DKPA 1YVCA 4PQYA 4A3FH 3TEHB 2RGXA 1JJCB 1VQ9A 2KI5A 1T8UA 4CEIB 1HT1E 4LHXA 3IBYA 2B8WA 4GOPB 2H5XA 1ZYRC 2YWEA 5CITA 5JRJA 1OKKD 5BW8A 4RG1A 2F43B 3AQ4A 2WAQG 4AURA 3ZZUA 3P4YA 5IK2A 4HB2A 3G5UA 5DO9A 5EXSA 1J7KA 2FF7A 3GTMH 2GBLC 2E74C 2OCYC 1ZIOA 1GSIA 2R65A 2DB3A 2B7CA 3T61A 1HNXQ 1WBDA 4O0MA 3QUSA 3KJOA 2PZFA 2ZVPX 4R4QA 3DM9B 4DR3L 1KOFA 2B21A 2D06A 2FFAA 1H95A 1IXRC 1FTSA 2ZYWX 3BFXA 4ACBA 1X1RA 2WMOB 3EXAA 3KX2A 3KQKA 1H65A 3CC7A 2ZM6Q 1CJKC 1S40A 1YR7A 4TL9A 4C4PA 1G6PA 4OYHA 3WHKA 3SJZA 4GOPA 1K3RA 3KB2A 2JA5G 3GPLA 1QVCA 2GK6A 2NVTH 2F43A 3U61B 1P8LA 3AUYA 4LJ4A 1A6XA 3IFTA 2DUDA 2C9CA 2CJWB 3PF4A 2IK8A 3S1RH 2J1LA 5C4JH 3Q8DA 4JBKA 2FG5A 3AF3A 1Y1WH 4JI3Q 1KZ7B 4RFSB 4XTRA 1RZ3A 1ZINA 2J59A 2JA1A 4UNSA 1VQ5A 1RE0A 1KO7A 2HCJB 2ZI4A 2H8KA 1OXVA 3LAWA 4M22A 4LYAA 1CIPA 3IIJA 3B5JA 5G3YA 3UK6A 2OFWA 1NKSA 3BH7A 4QJ5A 1KI2A 3R20A 3EWAA 3VR5A 2O8FB 4DDVA 4ZI3A 1UADA 4JC0A 1E2KA 2BM0A 2P65A 4X66Q 4G7ZC 3FHWA 1Z5ZA 4DV4L 4XWAA 2ZRDA 2OXCA 3KJEA 2V3CC 4TZ6A 2A9KA 1IXZA 1BBWA 4JLAA 1E7ZA 1EUJA 1XMSA 2CJWA 2I4IA 4DLSA 2W6JA 3PJRA 3JAMi 2WAXA 4E03A 5KNDA 3SR0A 2A6EC 1L2FA 2WV9A 1IBML 4R98A 4RFSA 3TE6A 2BV3A 3A4MA 1GITA 1R0YA 3EC1A 3AVYA 1DD2A 2RHMA 1X9NA 4M9SA 5FUVA 3SJAA 2RGGA 1EX7A 2VP0A 2C98A 2AK2A 3BERA 4MITA 1YZNA 4I1OA 1QHYA 5C46F 2OXRA 2P67A 1N6RA 1CR1A 1KJWA 2BWJA 5TARA 4LF4Q 4TTPA 1TWFH 1MABB 3KJPA 4OI4A 4Q9JA 2AXPA 5D3MB 3U7FB 4PC3A 2GETA 2EWWA 3PXGA 4FMDB 4DUYL 2H92A 1GOTA 1XNRL 4HR7B 2UUCL 4YDSA 5EP3A 2FX3A 4KV9A 5C4GB 1SQ5A 4EAQA 5JHHB 5L3SB 3OF5A 3KLWA 1T3LA 2WSSA 4TL8A 3RRYA 1SXJC 4KFTA 3FP9A 5E7IA 1Z08A 4B3TQ 5SZKB 1DELA 2E2HH 2QE7A 4RCZA 3DM3A 3AKYA 4UXJA 4TQUS 2F3TA 4DAYB 2CLCX 5DSZA 3W3ZB 3FVQA 3LV8A 1G7SA 4LFAL 4BPBA 1PH1A 4KHZA 2Z43A 4MA4A 1CFMA 1A82A 3RS3A 4DUGD 5BWMA 1CRQA 2BDTA 1HZCA 1HA3A 3GTPH 3M6AA 1YHAA 3G6EA 2HF9A 1FVIA 1CR0A 4QJ3A 1NJIC 3PEVA 4A2WA 2YV5A 4KAXA 3HPRA 2WMNB 4G5RA 5L3SA 2X19A 4LBZA 1M6NA 3TSWA 5BN4A 4JVNA 4LOAA 1IN6A 2UUAQ 1ZC4A 1FUKA 2QTHA 4EPWA 1FR3A 3M7NA 2B6HA 3F5FA 4U02A 2JDID 5FPSA 2O52A 3HU1A 1GNQA 4LF7Q 1RVDA 1XTKA 4V0LA 4DIEA 2IX3A 1CR2A 2WZQA 2CLSA 1NSTA 2IS1A 3E0EA 4FMBB 5M3FH 1VTKA 4ZDKA 1HQYE 2VHJA 2A6HD 4NZYA 3UANA 4MTNA 2ZSBA 2BA0A 2DR3A 1KGDA 1A1VA 1KI8A 2QROA 3QPVA 4IRUB 1YZKA 1SKQA
chains in the Genus database with same CATH superfamily
2KMLA 3Q22A 1L1OC 2WIJA 1SG6A 2Y1XA 3OJCA 2WNHA 2CMHA 1UKZA 2OCKA 1PH5A 3M6LA 3QFFA 2FJUA 1ZCFA 4KPYA 1KI7A 2GN2A 3H42B 4BEWA 3SLGA 1A9QA 2QSUA 4GZMA 2O5IC 2EKZA 2CSUA 3GEEA 4Z0TA 3K5OA 3OOCA 1V5FA 3NQTA 2XZLA 2K5VA 4Z53A 4B2IA 1P4SA 4MUXA 2L2QA 4C7XA 4OELB 1U7PA 2XTNA 2YUIA 4D3XA 4PYJA 4YCLA 4NBRA 3MWLA 3WIOA 1YVEI 3LUGA 2QYHA 1ZBQA 3WLMA 2VZEA 2A92A 2HA3A 1ZUWA 4KPGA 2HLDA 1Q19A 1P8AA 3EEOA 2OG2A 3M3HA 2I1QA 2Q1UA 5KINB 5AVKA 5E4WC 3UOWA 4C6SA 3R0ZA 1E6KA 4DF7A 1MO4A 1Z28A 3DZ8A 1EYAA 4C1NK 4OGFA 1ZRNA 1EE2A 4YRAA 1NYQA 1QFJA 4V0SA 1WULS 1R5NA 4RTLA 4KQEA 5AH0A 1IB6A 1F4PA 4BOYA 4E7OA 3FZEA 2F64A 3VVLA 1WDKA 2WIGA 3S17H 3MTJA 3M81A 1VMCA 2IUEA 4QSHA 3K30A 4KREA 1KNAA 1U0NA 1NV8A 5I48A 4IDPA 4N03A 1PNQA 1FXSA 2G7ZA 2GPJA 2QUBA 4TMVA 2HW8A 1XDBA 4NE2A 2L1BA 1XU4A 3A27A 2VNJA 3M6MD 2IX0A 1XZ8A 3W5CA 3ZGZA 3QPDA 1QH0A 2Z2IA 5HMMA 3SR4A 3EZ2A 3S28A 3H6KA 2V0CA 1YI2A 4UXHA 3UAVA 1R0BA 2RHWA 5A05A 2SDFA 1SBTA 2W00A 3QE3A 3A7DA 3U4GA 3NWSA 3RR5A 2ZVQX 2NZJA 3PNVA 1XQ1A 3ER8A 1CKNA 1FMJA 5C18A 5F5XA 2NPFA 1BRTA 1G2PA 1I13A 5J1ZA 1GTSA 3L0SA 2XWQA 5C31A 4QU0A 5HIAA 3VZBA 4ESEA 4F4UA 4PZUA 3U4QB 4KW7A 1R18A 2Y4OA 4PGGA 4R1SA 4A3JG 4LDNA 3FNFA 3T7JA 3DVQX 1T10A 1IEQA 1QV6A 1DYQA 1P5HA 5SZIA 4K2KA 3A3OA 2E2HB 1XL1A 5H02A 1NRWA 1ZNXA 4X60A 1FNDA 3TQYA 1TJ3A 5A9SB 1TZJA 4YP7A 1B70B 4E5NA 2YQ5A 4QASA 1W76A 3ZLVA 4IWXA 4RPHA 2F9LA 1WF6A 1NBWB 2VTEA 5THKA 2DG2A 4O8ZA 1F0PA 3FFWA 4LWCA 7MDHA 3C3YA 4G25A 1QJCA 3DFIA 1VQPA 4W5TA 4QDTA 1YZ6A 5BN3A 5EMJA 2GI4A 4OXNA 3CW2A 1K3BC 3E5RA 3RT1A 1FSZA 1B26A 5LM3A 5GIPE 1IWOA 1L4GA 1O03A 4CL8A 1KC8C 4XM2A 3EIEA 3P1HA 1I4TD 3I1YA 4DPMA 4QQ8A 3MJRA 1CETA 4CM8B 2GAOA 3SFZA 3FPLA 1EBFA 5HILA 1YQUA 5FEMA 2BE5D 1X1CA 4PLGA 1Z13A 4DV6B 2R66A 1H5QA 4J0IA 4RPJA 4RDCA 3C1TA 5K2MA 4HJ8A 1KABA 4PBSA 3O95A 3WK8A 1MN6A 3Q3JB 1U8EA 3D6MA 2BM1A 3R9XA 5KNCD 3QBTA 5FR1A 3RWOA 4ALMA 4WUVA 2Z1NA 3W9BA 4WBNA 2NNLD 4CRWB 1JEAA 5D3QA 1A76A 3E7XA 4PZEA 1NP3A 5TVGA 4RHFA 2BE9A 1JQEA 3ODPA 1VG9B 2WICA 4D9JA 4GNXB 3Q8WA 4WJ3M 4FFDA 2WG1A 3R75A 1PW7A 1GRRA 1CV2A 1PAUA 5GM2A 1LBQA 1LZLA 1EDZA 1SCDA 3R6GA 2X5KO 1M72A 1NBHA 3S2SA 4Z9BA 1WS6A 2Q3FA 5GZ3A 2VJPA 3SEBA 5C8YB 4ASUD 3LQQA 3KTOA 4QQBX 4O1NA 1GUNA 5H8WA 1VMIA 3DE7X 4GWLA 5KNCH 3G0HA 4ZQFA 4EW2A 3NGLA 3G2HA 3EZ9A 2YMQA 1KVQA 1CUWA 5CFPA 1UJ2A 2ET6A 5AW1A 1V1JA 2HMWA 4DLWA 3HOZG 3WTBA 4GXNA 2LS01 3L1HA 5DM63 3R0IA 4MKIA 4U2DA 1TS4A 1DOHA 3UM9A 1WETA 4LJRA 3FZNA 1R88A 4D8VA 3S14H 1C3XA 2WU0A 1Y42X 1F6WA 2PBZA 3ZW9A 2VSQA 3RD5A 1T9ZA 4FXOA 4XSHA 1ZH2A 3N6XA 2VJKA 3GFVA 5DWVA 1MCZA 2CVOA 4D02A 1ORHA 1PFSA 5FLXL 4KFUA 3QA9A 4GOPC 3GEPA 2PDAA 3KBGA 1SVWA 3NHMA 4HTFB 4KN6A 4FR5A 1WQ1R 1YMQA 3PPXA 3K0CA 3TDNA 3OZUA 1YS6A 2YYZA 2QEJC 2NXNA 1MVOA 4DK6C 1TKCA 4J76A 4MYTA 5FPHA 4OWWB 3PEEA 5FPYA 1Q95A 4YMLA 3J80L 2JJ1A 3W2GA 3RQSA 1XEWX 1X7YB 5MDHA 2ATCA 1TNDA 3O6VA 1SUFA 5AI0A 2VJBA 1W44A 4B85A 2GS9A 5IAAA 1EH5A 4FN5A 5CNJA 1A50B 5DHQA 4YUZA 3GDFA 2VKTA 1W88B 2JHAA 5KX5F 2D0PB 3O8QB 4XXHA 3M3PA 2MO1A 2VDNB 5EJ5A 1CD5A 3G6WA 2HCBA 2HSDA 4I2NA 3DC7A 2WWIA 1SOMA 4PAGA 2IRWA 4CLXA 5KTTA 3TL3A 3WJ2A 1C8VB 4QPDA 3FYUB 2OHOA 2F4VQ 5P8WA 2HDOA 1NDQA 3BREA 1A2QA 4KMOA 1WKVA 3DYVA 2F0UA 3H04A 1Z0ZA 3PNKA 1TS5A 5JCOC 5JH7F 1GYRA 3RFXA 2JFUA 4H7IA 4MQUA 4LUCA 2IY9A 2Y1OA 2WE8A 3FZGA 1K9VF 2JSOA 1H69A 2REQB 3QTBA 4OHUA 1ILEA 4AJLA 4N5IX 2RG1A 5DXAA 2P3OA 4CE6A 4F84A 5LYJF 5ALIA 4DA0A 4TWAA 4B7ZA 1D8AA 4Q4JB 3NPPA 1G9XA 3GDEA 1G63A 2CVRA 3LDHA 3MWKA 1JHUA 4XZ3A 1X6VA 2B92A 5KYUB 4KWEA 4QUBA 4I46A 1K6EA 1RKNA 2JAUA 3QEAZ 2UUBQ 3K70B 1Z2AA 1DVRA 5DB4A 3UFXB 1L8XA 3O1HB 2Z9DA 4X8MA 3NBQA 4G4SO 3DXFA 1T1GA 2FR8C 5IU6A 1PS8A 2AE1A 2X4GA 4YJ2B 4B9WA 4FFPA 1ZJWA 2ZJ6A 4QPJC 3D6HA 3UCFA 1DEHA 1XZDA 3L8GA 3LVRE 3CLTC 4XD7D 4KNVA 4IOAA 1M8KA 4BX8A 1SC6A 3K0AB 3IIKA 4HSEA 2PUFA 1RTNA 1T9AA 4JI8B 5I4DA 4UTZA 2UU9Q 1KFEB 2QG4A 5FLYA 5AOCA 1GNRA 4ND5A 3HCNA 1Z63A 4PSVA 4ZJZA 1QP4A 2Y66A 4JDUA 4L57A 5LP6F 3UGTA 4J1TA 4KN7C 4G0WA 2Q2QA 2REBA 1QVVA 1M2KA 1JLSA 2F3SA 3TRKA 2ZJ2A 5FOQA 4DMRA 5TGDA 3L4BC 2IOYA 3CTPA 3GDOA 3M83A 2OV3A 2R6HA 1QVWA 1UBCA 2ZRIA 2YY5A 4CODB 1PGOA 5K3CA 5IYBG 4KWTA 1ZM9A 4RQBA 5KYXB 4DV3B 3DW3X 4K86A 1T8YA 3O8CA 4KPUA 2CXXA 2J30A 4TV8B 4XWOA 3J7ZC 1V35A 2Q0SA 1RNLA 1TZBA 1ZRMA 1JDJA 4L07A 5HR5A 2MUYA 7REQB 1XQ9A 1DIHA 3FLBA 3OZCA 1R0SA 1STYA 2X8JA 4RDIA 5B2EA 4KQIA 4Q1AA 4HJXA 1NI4A 5K1ZA 2PUAA 4HDCA 1C14A 2XITA 3TF5A 3NBXX 3I58A 1ENZA 4EHDA 3WGIA 1CUSA 5DT2A 3PIPA 1J2UA 3HA2A 5EIAA 1QUQB 3VI4B 2AEMA 3A1SA 3PZBA 5CIWA 4GPIB 3KO8A 3RWBA 4C4TA 4KO2S 2BOVA 5ARCA 3G1WA 1QANA 1E3JA 4O5AA 1PDQA 3U9TA 3OM1A 2GVBA 2NV2B 3IS3A 1UZNA 1SCBA 1ENFA 3O8OB 3NB0A 3U3RA 5JSUA 1ICIA 2NSDA 4L08A 3QVGA 5DYWA 1H9JA 2ZRKA 4CKWB 4CMIB 2UDPA 3FLMA 1F8FA 3D3EA 1KR5A 1QYWA 4V0KA 5ITZB 2YJ3A 4WERA 4DV7L 3HB0A 2I0QA 1DKRA 4BWVA 1UBLS 2Y8EA 3MJEA 2OLKA 1A5TA 3NELA 1GTG1 3S9WA 3LRTA 4JUAA 4TMKA 2JA6B 5C44G 1V71A 3IHLA 1ZOSA 3DWPA 4CF7A 1UT8A 3STBD 1HQKA 2VQSA 1YR2A 4O4LA 4CKBB 4Q4HB 1Q3LA 5AVWA 3C87A 3T12A 1EIFA 3NBIA 5BW4A 5I3ZA 2D2CC 4N6OA 1WDLA 1IZZA 2EW1A 4RPIA 1TWGB 1J5XA 1N5KA 4MCJA 3DNPA 2RHBA 2VSOA 3K6SB 3FPKA 3QXHA 3CZCA 1FVHA 4ENSA 1TJPB 3RGWS 2Q8IB 4KN5A 4MAMA 1G291 5TQ2A 3MXGA 2HNBA 1QOQB 9LDTA 1TT5B 4IJUA 3JZFA 3OT5A 1JT2A 5FJIA 3WQQA 3OZWA 5E0OA 4DK1A 2QMQA 1FXUA 4FGUA 1ZOPA 2E2JB 2G17A 3G7SA 2AMLA 3DPUA 2ZR9A 2X2FA 3DWQA 1OOEA 4MB0A 4QZVA 2HRZA 1S8NA 4JUDX 1UKEA 4FS3A 1ZAKA 2ISQA 4O42A 1LDBA 1GNTA 2QRQA 1L5SA 4YASA 4W7SA 5DTIA 1SXJA 5D3KA 2ZANA 3DAFA 5EN4A 3IP6A 3OX4A 4ZODA 3IB3A 4ENPA 3R0QA 2V1CC 4ZLTF 1A8VA 2HSJA 1LTRD 5EXDA 4CIAA 4P33A 1YXMA 1YQEA 3T38A 1NY4A 4ND8B 4O0LA 1U31A 3X1XA 3KLOA 2AMJA 1WXDA 5IHPA 3FUTA 3QLEA 2V54A 3E7DA 1V6AA 4BNJA 3NOXA 2ES2A 1DRWA 4J0JA 1BMFD 5EL0A 1MEJA 1PJTA 4ECEA 2C04A 3E7FA 2MDTA 5CH8A 4OCZA 2WFAA 1PEAA 2R97A 3O38A 4TTQA 5A03A 3E5MA 1MGPA 3HQ4O 1ZHFA 1QHSA 3AUKA 4R0MA 1RAIA 3JQDA 1MKHA 1W1IA 4ENVA 3QVSA 1N1MA 1HL7A 1V4NA 3BMCB 4MLCA 1K7CA 4LJKA 4Q6BA 1YWGO 3NM6B 4MV7A 2GPWA 4EUHA 1U8XX 3OY7A 3PJFA 2RHDA 1U2TA 2UUAL 3F6EX 3GT0A 2EFDB 1F2UA 3T1TA 3F2UA 2I33A 5DX1A 1Y1PA 2QT1A 4V0QA 1EE1A 2NQTA 1LQUA 1LV7A 3TNFA 5FNZA 1LWNA 4WNIA 3CN9A 2J4FA 4GEKA 1TD1A 1MSGA 3G8YA 1SC1A 1GVNB 3VHQA 1PTOF 4ZTBA 1CZGA 1Q77A 3V05A 4NNPA 3C6YA 3B8HA 3ID6C 1ES9A 1YZGA 2A1TR 2GCNA 1XDWA 1U2DC 3DDSA 4YDRA 3INNA 1Z68A 5K3FA 4AJNA 4ME5A 4UAVA 5DM2A 3GLIB 5AP9A 2WAOA 1V5WA 2RK4A 2IH2A 1RYBA 2VA8A 2WWXA 1UBNA 3G6KA 1M6VA 1LX6A 1PKEA 2GVAA 5NULA 5CH3A 2B63B 3DEKA 2QA4A 1UFRA 4BNVA 4I4TB 2XGJA 3G5TA 2EKPA 3SBDA 1A0OA 1VJCA 2PYDA 1URPA 1XRQA 3NTRA 1XLVA 5BUCA 3TDMA 3AERB 1V4VA 4Q5VA 1E0KA 4GKJQ 2ZE5A 1IW7D 5H3CA 1UC8A 4G0OA 4GG1A 3Q2KA 4K1XA 4PE5B 3AEKB 4R8MA 2FF5A 2Z6KA 1A2KC 4I4NA 2PKXA 2VH2A 4UEKA 1HUQA 2AJLI 4L2IB 3C1FA 1RVV1 1RCFA 1D04A 2F59A 4WLUA 2UVDA 2E48A 3ZVNA 4NCAA 1KAMA 1F2TB 4F6RB 2FSHA 1HDXA 3TNDA 3I9JA 3FE2A 1S4QA 3WMRA 2ICAA 4TYQA 4O4LF 2WDPA 1NN0A 4TWBA 1HFGA 3MWDA 1NDUA 4WKCA 4BKPA 2DLNA 4OH1A 4QAQA 4UUQA 2XUFA 2QXYA 3G0BA 4ZJYA 4F85A 1PEKE 1HR0L 4BJ6A 4EEXA 4QG3A 3WFIA 3N87A 5DT9A 4NCBA 4RETA 1KYWA 3SSMA 2FB9A 1Q3KA 4QU9A 2D7DA 5IT9E 4YYEA 3FTCA 2PSEA 3ZXIA 5AR1A 4CIVA 5TLSA 4TRRA 3ZCQA 3BTVA 3TDQA 3K1ZA 5J1SB 1DOZA 4GOJA 1M1ZA 2QDXA 1K3TA 2Z83A 4TN5A 1U0RA 1BHSA 3ESYA 4NF2A 3AZPA 4CG2A 3C45A 4ERNA 3PX2A 1I7SB 1W85A 1U94A 3C39A 2BCJQ 3VV2A 4D9NA 3IPCA 3KR9A 2WILA 5CW2A 1FL9A 1DPFA 5EC8A 1VMAA 1RP7A 4OH7A 1G0NA 4ENTA 1ZA1A 1WM1A 5I7EA 3AHEA 1RWWA 1RRPA 1VJ0A 4MP3A 3O3MB 2AJTA 5E6RA 4HDKB 2X0RA 3BGOS 1XPRA 5AW2A 4JJAA 4IHKA 1NIJA 4BVBA 1NVMB 3B13B 1IQRA 4J94A 3DHVA 3MT0A 1YZLA 3KQNA 2Y0CA 2BGLA 3SKXA 4GX0A 1WCIA 4JI6Q 1FY2A 4QRIA 2XCOA 3SMVA 4DLRA 4U63A 3GV0A 4PLPA 2QPLA 4BA2I 4NJEA 1LJUA 2WFMA 3P52A 3GNSA 4LYGA 2EFJA 2KLHA 4WY2A 1BDMA 3CRW1 3BJRA 1YB1A 1M76A 3HVUA 4O4JB 1JTEA 1XMQL 4XX1A 1B1ZA 1HZ9A 4HQKA 2KHJA 1N3IA 5ETJA 1JJCB 1O94A 1Y6RA 4P7KA 4BB5A 2P9HA 5JRJA 1VZ2A 3ZZUA 1J7KA 2CXPA 2R65A 3E22A 1ZW1A 2B7CA 3T61A 5FWYB 3NP7A 2D06A 2FUG6 2ZYWX 2WJ3A 5GPBA 1S40A 2JA5G 2CJWB 1KZ7B 5IIFA 3FF1A 4MWDA 3T4EA 3G8AA 4JFAA 2ZUWA 3W2IA 4CG1A 3CKKA 5JD3A 3OIPA 4EKGA 4RFSA 5EPJA 2ATIA 1JOQA 3CY6A 4DN4M 3TXXA 1YK0A 2ZUTA 1TWFH 2JFHA 4TM7A 4R6WA 2Q4OA 3QIVA 1WUHS 4CQJA 2QLJA 2X69A 3RE1A 1Z62A 2V5AA 3RRYA 2YZMA 4B3TQ 3LGAA 4UXJA 1U3VA 1GGMA 1G7SA 1CRQA 3G2PA 1IJKA 1YHAA 4HYTA 1GQFA 1FVIA 3HNOA 3VYSA 5L3SA 5BNIA 4YY3B 2IPOA 2HI0A 2VQ6A 2O5CA 4Q4DA 1EEID 4KDEA 1XTTA 3BILA 3B3FA 4LF6Q 1OIVA 1NUPA 4AO6A 1QSGA 2W48A 1F5NA 1HF3A 3T1YL 3EZ7A 3MMZA 3WVNA 4OHJA 2J9GA 2VWGA 2QZ9A 4ALPA 2H4OA 4CV1A 1SNMA 5B57C 5JQWA 3MSXA 4BLTA 5HGQA 3E82A 4RIHA 2VHTA 3K9NA 4CQMA 1LT6D 3H2SA 4QWWA 3T5GA 2BP7B 2AKWB 4EFDA 5BMOA 1AZTA 3AESA 3I62A 5F1PA 2YIVX 3M6VA 4U7WA 3V2IA 3WOVA 4CIDA 2HMYB 3F7MA 4TS4A 1UEJA 3O4RA 4HCJA 1KH3A 1KVSA 1FFWA 1N6NA 4DDTA 1OU4A 1EJBA 1FLVA 3G89A 1NG9A 4EG3A 1G8JA 4FFMA 4NDNE 1KNEA 3EMDA 3OLWA 3OEWA 1VPEA 4MSUA 4IV8A 1RPAA 2NXJA 2GFQA 5FLXE 3OMGA 1BCSB 3A2KA 3NTXA 4FOPA 5D5QA 3MRSA 1C7EA 4FILA 2FY8A 3NV7A 3W6OA 3KD2A 1P29A 2LFNA 4DAVA 1SNYA 4CQLB 4JP3A 4BV9A 2QZPA 1PFMA 2CCZA 4LDAA 1OC2A 2YXNA 3SBOA 4UFPA 4FFRA 4U9UA 1VQNA 1ML4A 4D9IA 3T16A 3ED5A 4R3UC 3DFUA 1GLNA 1Y1RA 4HVTA 4OQNA 3PRKE 1HGXA 4M7WA 4IOCA 3K2EA 4UZSA 2UYYA 4JLWA 2E2DC 5AI8A 4JBWA 3MVEA 1G17A 2OOKA 4PZ6A 2KHSA 1D5CA 1HNZB 3PGZA 2XSCA 3UZUA 2O3SA 2JD1A 3HP7A 1VGVA 1AHHA 2M32A 4HD8A 5IX8A 2ZUVA 3EZYA 5FLMG 4AKGA 4KQHA 1A8HA 4HAYA 4Q93A 2R79A 5K0CA 5ELEA 1VQ4A 3ESDA 4KBGA 4P84A 2IS2A 2XHZA 1CRPA 2Q2WA 4KE6A 4HDNA 3UT0A 1M7HA 3TW4A 1YR1A 1UKVY 5IGDA 3N59A 2CNLA 4YLGA 1NZFA 4C0JA 4WZBE 1M5UA 2F62A 3HDJA 3WLHA 2R1TB 2VTDA 5HZHA 2MP1A 1Z15A 4HVCA 1B4DA 5DEIA 3QPCA 5L3RA 2G1KA 2IL8A 3C7TA 4TRMA 1WD5A 2B8FA 4OM7A 2PA3A 2GKSA 3E53A 3DZFA 3A5ZB 5DOVA 1OI2A 4BRZA 3L6UA 4QNMA 5GGYA 4QDKA 3DYBA 3AVOA 4XGQA 3LOUA 1ODFA 1PI3A 5AIBA 2A1UA 2QW8A 2YN0A 4CFYA 3OLCX 3NETA 1HDYA 2L42A 4RS4A 2GAAA 4DBZA 3PK0A 1I1QB 4H59A 4ZI7A 3GUHA 4M9RA 4EM6A 4GE0A 4LZJA 4UDOA