5J1ZA

Crystal structure of staphylococcal nuclease variant delta+phs a90d at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLDYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS A90D at cryogenic temperature
rcsb
source organism Staphylococcus aureus
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5j1zA00
1A3TA 3BDLA 1KDBA 1SYBA 3SK4A 4KY6A 5IGFA 1TT2A 3LX0A 5IGCA 1JORA 4K14A 2F0FA 1NUCA 2WACA 5C5MA 2LKVA 5CV7A 3T13A 5C4HA 2F0VA 5C6AA 4K2LA 5EGTA 5IIFA 1EYCA 2EY1A 4B9XA 2OEOA 2PZTA 3BDCA 3U9OA 3OSOA 3QOJA 4KY5A 1SNOA 3ITPA 2RBMA 4WORA 1EY7A 3MHBA 2RDFA 4K5WA 4DFAA 1SNCA 3SHLA 5CR3A 1JOKA 2QDBA 1EZ6A 5IOCA 2F0UA 1STNA 4ODGA 1EYDA 2F0JA 3NUCA 4RKBA 3TP5A 5ISRA 4NDXA 1EY4A 2PZWA 5CV5A 5CV6A 5JOBA 2HQEA 1SNQA 5J39A 4KY7A 5JAVA 4TRDA 3D4WA 5EKKA 2EY6A 5I6WA 3ERQA 3SK8A 3NXWA 2M00A 1EZ8A 2F0SA 4ZUJA 3R3OA 1STYA 2F0DA 1A2UA 2EYOA 2EYFA 3NK9A 4KJOA 3SXHA 4B9WA 2NUCA 1A3VA 4N9TA 5CGKA 5KEEA 2PQEA 5E3FA 4F8MA 3MXPA 4G57A 3HEJA 4HMIA 5KYLA 3OMCA 5CC4A 5M9OA 2F0PA 1SNPA 2F0OA 4ZUIA 4K5VA 4K8IA 2KQ3A 4KV6A 1STGA 5HURA 5IGBA 2ENBA 4KTAA 1SNMA 5C3XA 4H7BA 4ID6A 1F2MA 4NP5A 3T16A 5KGUA 3EVQA 1ENAA 2KHSA 1EY0A 1IHZA 4R8NA 4RKLA 4KJNA 1STAA 1II3A 1SYGA 5KYIA 1JOQA 1EY6A 1KDCA 2F0QA 4J1MA 4IALA 5C3WA 2F0GA 5IGDA 3QOLA 5I9OA 2EXZA 5KIXA 2F3VA 5DAUA 3HZXA 5E1FA 3TP7A 1KABA 3MEHA 4WRDA 1STHA 4HMJA 4K6DA 4PNYA 4KHVA 1SNDA 3OWFA 2PZUA 2EYHA 2F0WA 4J6HA 3PMFA 3TP6A 1SYFA 3SK6A 3VA5A 3TP8A 1SYEA 4PMCA 3C1FA 2O4XA 4EQNA 5IGGA 1EYAA 2PW5A 2F0MA 2F0EA 2SOBA 3EROA 3NHHA 3P75A 3V2TA 4HTHA 1STBA 2OXPA 1U9RA 2SNMA 1A3UA 4KD3A 5EKLA 1ENCA 5F2DA 4ZQ3A 3S9WA 3H6MA 3MZ5A 2PW7A 4YIJA 5J22A 2F0HA 1KDAA 3D8GA 5K5PA 2SNSA 5CV4A 1RKNA 4EQOA 3DHQA 2EYMA 3D4DA 5CV8A 4DF7A 1EY8A 1KAAA 2EYPA 4NKLA 4N9PA 2F0LA 5J1ZA 3QB3A 3C1EA 5NUCA 4F7XA 4PMBA 4IUNA 5I9PA 4EVOA 4S3SA 5IGEA 3SR1A 2EY2A 2F0KA 1SYDA 2PYKA 1EQVA 3MVVA 5KRUA 4QB4A 3EJIA 2F0NA 3SK5A 3P1HA 3OMGA 4I65A 5C5LA 3DMUA 2EY5A 2EYLA 3D6CA 5HGTA 4KD4A 4K5XA 5CV9A 5I6YA 2F3WA 1EY9A 1A2TA 3RUZA 2EYJA 2OF1A 2F0TA 3NQTA 2RKSA 4EQPA 1SYCA 3NP8A 5IODA 4DGZA 3E5SA 4ME5A 1EY5A 2F0IA 1NSNS 4IZ8A 4QF4A 1F2YA 1JOOA 1TR5A 4NMZA 4K2KA 1AEXA 5DEHA 1F2ZA 4OL7A 3TMEA 4LAAA 1TQOA 4K8JA 4DU9A 5C4ZA 4QMGA 4MIUA 4E6IA
chains in the Genus database with same CATH superfamily
1TWHB 5M5WH 1SYBA 2I46A 2UXDQ 4PZ7A 2F0FA 4C3IG 5C4JB 1GM5A 5CV7A 5C4HA 2D9UA 4C3HG 5EGTA 1EYCA 1SR3A 1D2BA 1KD1C 1CFMA 1H9SA 3QOJA 4FXKC 2K33A 3SHLA 2I5MX 4DR2Q 2LFNA 2DUDA 3L9AX 3MC0B 3U50C 2KBNA 4KI0A 4DNRB 1PH2A 4A3LG 3NUCA 4UP7A 1K3BC 1AZQA 2H4OA 3JAML 4HCSA 3RZDB 2H1EA 2D5DA 4X65Q 2Q2IA 3GTJH 2OTJA 1CUKA 1TS5A 2F0SA 3R3OA 1KXLA 1AN8A 1U4MA 5CGKA 4JBKA 1A3VA 5KEEA 2EE1A 5D3DA 1KC8C 4UP8A 2HIXA 2Z4HA 5LHY1 4NB3A 4JI3Q 2MP1A 2R93H 2CVRA 1SE8A 3E3XA 4H7BA 4GOPC 3OTOQ 3PO2B 1DOKA 1X32A 3MWYW 4FVMA 5TSSA 1E1TA 4A3EH 2LXJA 1KTKA 4BS9A 1W6JA 3QR8A 1F77A 1KABA 4HIDA 1AE3A 2CH4W 3KF8A 3TP6A 3RN5A 3TP8A 3GTMB 5AJ3Q 3EROA 5C3EH 2JE6I 2X69A 3ZJYC 3S1NB 4XXEA 3A56A 3E0EA 1Z7TA 2A73B 3J7YW 3Q24A 2K14A 1I50H 4A3DB 1F9QA 1F9PA 2M9VA 3KDFA 4JI6Q 5G3LF 1VQJA 2F0HA 1LO5D 2NZOA 2JN4A 3S14B 1IBKL 1AZPA 1VQAA 4IN3A 4NKLA 3IFTA 5GAEC 1YNJC 3OW2A 2F0LA 1X3QA 2YTVA 3CCVA 1PH4A 1HR0W 2DNCA 4C56C 2E2JB 2D62A 1TWGB 5DLQE 2PYKA 3JC66 2JA6B 4RGNA 3CU7A 4QB4A 3CCUA 1MGSA 4DV1L 1N33L 1WCMG 4XQJA 4K5XA 1FL0A 2UXBL 4PZ6A 1I94L 3FPPA 4K0KQ 5IODA 3KOJA 4DK1A 2PNHA 5JEAG 1GUTA 1NSNS 5IWAQ 1SE2A 1JOOA 4NMZA 2KVMA 1O80A 1HZ9A 5C44B 5K36H 1ET9A 2B2YC 3K5LA 3RN2A 1UE7A 4E6IA 3A7AB 3R2TA 4RGTA 4A3KB 2A6HD 4K14A 1LT3D 3T13A 3MAQA 4H02A 2HDLA 4C3JH 3H09A 3K0XA 2RBMA 4DAYB 3BS1A 3EQLC 1KQSA 2HCCA 1EZ6A 3F2DA 1XTDA 3K5OA 1EQQA 2QCPX 3KBGA 1VQ8A 2K6AA 2YYZA 2NTTA 2X6GA 3I70A 1PLFA 3A54A 3J81j 1VQDA 2D0PA 2O5JC 4MTNA 4F88A 2NZHA 4KN4C 4JPBW 4B9WA 1CSQA 2B39A 1ZYRC 4OO1H 2B2WC 1YNXA 1MHWC 4CBVA 3MXNA 1CHQD 4DUZQ 4J8QA 1SYGA 3S1QB 3FPUB 2I0QA 1O7LA 4IUTA 3VYRA 1TWHH 3DM1A 1XNQL 2R93G 3CF5A 4A3GB 4LUZA 2BDOA 1A62A 3STBC 5C4JH 4A3FB 4CDEC 3VA5A 1B4OA 1YITA 4JI0L 3NBHA 5IT9c 1VS0A 1OTCA 4CKCA 2IX0A 4DK0A 5IP9G 3GTGB 1H9KA 4AYBG 4A3EG 4DR6L 2M2LA 3E0JA 1D5MC 4LFBL 2ZTCA 3S24A 1E2ZA 3RZDH 2L1BA 3HOVB 2WKCA 3BVZA 3H91A 3C1EA 3BVMA 4EVOA 2EY2A 1EQVA 4P2CB 2F0NA 1O7YA 3OMGA 2RQXA 2MFIA 2R61A 4QIWE 1U5KA 2VUMB 1G2TA 2UUBQ 1PXUA 3F2UA 5E7NA 2N88A 1VQ6A 3PO2H 1VQPA 1EFID 4NXML 4X64Q 5C0XJ 2ZTEA 2Z1CA 1Q8IA 1PRTC 3PSIA 5LMNQ 4KHPQ 4Y52H 1G91A 4QMGA 3A55A 4KY6A 4HCEA 1TT2A 4DK6C 3GTMH 2PMZE 4GLAC 5CBAE 5IIFA 4K2LA 3M7NA 3S1NH 4YHHQ 1ML0D 2OCEA 2JA9A 3GD7A 5K36G 5JJIA 4A3DH 1SNCA 3D31A 4DAMA 3S14H 1Q8KA 4CHTB 1B2TA 5ELEA 4JI4Q 4O2DA 2NVXB 2HQEA 4A3JB 2EXDA 2K28A 3ER0A 1Q86C 5FLXE 2E2JH 2K5HA 1LTID 3I55A 1V1QA 1JJCB 4C3JG 4CDFC 2O2LD 2JA6H 3J81c 3MXGA 3PF5A 1NR2A 2Q2TA 1C8CA 5G3LD 1IKMA 2FFKB 4KLKA 4LF9Q 3EFXD 1ENAA 1IXRA 4QL5A 1JB7A 1BKBA 5C44H 4IALA 5BN5A 2RHSB 3J80i 1V43A 1HQRD 4OO1G 5FLXL 1QILA 3J80E 4LF4L 1I6VC 1CQFA 1BOSA 5KIXA 5IYCH 4OELB 2NN6I 4A3KH 3KJPA 1QUQB 4YWMA 4ALPA 2K01A 3OWFA 2ES2A 1DZ1A 1K8GA 1SLJA 3EBEA 2R7ZG 2EIFA 2TMPA 1SXTA 2EQSA 1A3UA 4LF7L 1ENFA 2VQEQ 1FGBD 1TWFB 4GN4B 2AWNA 3PIOA 1CKNB 1X6OA 3A74A 3D8GA 2Q8TA 4C3IB 3CCSA 3D4DA 4DF7A 5EQ0A 4C3HB 2EYPA 2UU9Q 3J80L 4QUCA 4HJ5A 3NWSA 1NMFA 3W3AA 1E22A 3GV3A 1FGUA 3K81C 2Y0SE 3ZYYX 3P1HA 4JBJA 2JEBI 2QKIC 1HCZA 4JV5L 2EYLA 2LSSA 3LNNA 5HGTA 4LNQA 2IHEA 2N8NA 3PUZA 2OF1A 2F0TA 4DR1Q 2RKSA 4APVA 1OXUA 4WJWA 3STBD 1LYLA 4DGZA 3S1QH 3EIVA 1EY5A 4DAYA 4DR7L 1CTMA 2Z6KC 1F2ZA 2B2VC 1V8QA 1G2SA 2B29A 4FYDA 1PA6A 1B53A 1EQTA 3OYYA 4A3GH 4MIUA 2DY7A 4A3FH 4LUVA 1CM9A 3PO2G 3X3MA 4DUYQ 3RZOH 2VB2X 3A5UA 3GTGH 4WORA 1EY7A 5FO8B 4FXDA 3TDQA 3PIO3 1Y8NB 3CW2C 3FDTA 4MNOA 3HOVH 2Q8IB 1HNWQ 4X62Q 4LFCL 3QG1A 1L1OC 4JBMA 1FJGQ 1WJJA 2CWAA 3SXHA 4G57A 2VUMH 3PUXA 3PQIA 4KMUC 2F52A 2GVBA 3T53B 1VQFA 1EEFD 1S5BD 4Q5VA 1A15A 3OIPA 2JA6G 1KDCA 1TY0A 2NB0A 1PHJA 5IGDA 3CD6A 4B3TL 3HG9A 3OW7A 4FP5D 2X6LA 1QVFA 2A19A 1BVSA 1C48A 2BCOA 3Q8DA 1HH2P 3NHHA 4HTHA 2OXPA 3G7LA 1I3QB 4C2MB 4JW0A 5IYCG 1CSPA 4DV6L 4A3KG 2NVXH 2BOSA 4EQOA 5CV8A 4A3JH 1PH7A 2CFMA 1R4PB 1MJEA 2WB1G 1BCPB 2ZXPA 4OX9L 4QIWB 1DOMA 4C1NK 1PYWD 4B3SQ 2J7ZA 4HIOA 1GUSA 1STEA 4OWTB 5M5WB 1LACA 5C5LA 3DMUA 1BXTA 2H5XA 1N34Q 1T5XD 1Y1VG 2A6EC 2JYOA 1Y69U 4YWLA 3A8KE 3FKIB 3BZKA 4CJ0B 1D5XC 2PMZB 1QWYA 3TMEA 4K8JA 5FJ8G 1YJWA 2F1MA 2BH8A 1VQGA 2UUCL 4YCUA 4GNXA 5FOBB 3ULLA 3M4OB 1EEID 4K5WA 1HZBA 1EIYB 5JPMC 2R7FA 1LUZA 2VQFQ 5BN4A 4A3FG 4C3HH 5ISRA 3T1YQ 2RSNA 4NPSA 1U4RA 3CRLC 1PH6A 5JPNC 1C0AA 3TREA 3MFYA 3AEVA 3BVGA 4POFA 4A3LH 1A2UA 1MJCA 2EYOA 1WTQA 4DR2L 2YU9H 3I4MB 2NUCA 4N9TA 1QUQA 1BUVT 2JXMB 2VW9A 5LL6S 4K5VA 1QZGA 3HOVG 3CCQA 2AUJD 3NTIA 5AFWA 4BBSB 1U4PA 3DWAA 3S2HB 4X65L 5GROA 1CQVA 4UY8C 2B2TC 5CORA 3NQIA 2WB1E 1JWMD 4DR5Q 2BA1A 2VUMG 3HZXA 5E1FA 4JI3L 3MEHA 1IYJB 3I56A 4YY3Q 2JA7G 5ELFA 3OTOL 2KHJA 2NN6H 1VQCA 2RDGA 4R4TA 4JYAQ 1E1OA 4OWWB 3ONAB 3OIQA 1BCPF 1FR3A 4YIJA 4X66Q 2Y0SB 2N78A 1CI3M 1HZCA 4P75A 1PH9A 5AJ3L 4H0LC 2A68C 1HNXQ 4ABNA 1XMOQ 3DM3A 1CHPD 4JI6L 4YWKA 2NZ1D 4B3MQ 3UDXA 2Z4IA 1WTOA 3BJUA 5EPLA 4Q0FA 4GLXA 4DR4L 1XMQQ 3I90A 4MZ9A 2ATWA 1N36Q 1B50A 1B70B 1YJ9A 3GTKB 5DEHA 1PFSA 1S72A 4JK1C 1O7IA 3S1MH 3GO5A 1UWVA 2FJ2A 4A3MG 1EIFA 2PO4A 3G71A 4U68A 3WWVA 1WTPA 5JEAH 2D2CC 3C46A 1EYGA 1Y1WG 4K0KL 5IP7H 2WACA 2IWHA 2EY1A 5IWAL 1I3QH 2PZTA 4L63B 3U9OA 2DY8A 5EPJA 3U4ZA 4C2MH 3IL8A 4RCNA 3VYUA 2VS1A 2DN8A 3CAMA 2IT1A 4RKBA 1TY2A 3I2ZA 4JI8Q 1EY4A 1UE6A 5CV6A 2ICEC 4X6AH 2KOLA 2R7ZB 1G51A 5M5XB 3AFQA 1R4QB 4L5SA 1Z9FA 3PUVA 1CT1D 4KJOA 4EQ5A 2F4VQ 2VB3X 3FKIH 5C3XA 4A3IG 2UUAQ 4V190 1TS2A 4R8NA 1L0WA 3T4AC 1NMGA 2N55A 3TQYA 1SMYD 2BE5D 5DAUA 2A69D 3HRZC 2K1BA 3TP7A 3UDGA 2HT1A 4K6DA 1S5DD 1KL9A 4DUZL 5JJZA 4JI7L 3M4OH 1SYEA 4NXNQ 3K0YA 2O4XA 2HHHQ 1EYAA 1SN8A 3MFGA 2SOBA 4GLVB 2KUMA 1GVPA 3M7GA 3N52A 4LWCA 4L5QA 1ZKOA 1K73C 1PZJD 4N9PA 5IP9H 2ID0A 5DM63 2NN6G 4X3SA 2SDFA 3W2DA 1NY4A 3CC4A 3I4MH 4LF5Q 4BA2I 3KF6B 2F0KA 1PYSB 1WYDA 3K58A 4I65A 4JCVE 3D6CA 3HOYB 4HR7B 5LMUQ 1W3SA 2F3WA 3I72A 4OWXB 4BBSH 2A5HA 3S2HH 4GS3A 1HFNA 1SYCA 2K5QA 5IYDH 3SGIA 4A93G 4A76A 4ME5A 2NBFA 1JJ2A 1TR5A 1AEXA 4AIMA 1SFOB 2NVYB 1LTGD 1I4QA 1VMPA 1JE4A 1VQ4A 2UUBL 2A1AA 1PRTB 2ZM6Q 2GN5A 3NE5B 3E9IA 4X64L 1ET6A 3AMUA 3KFUA 4HJAA 4OGQC 4CJ1B 3KLWA 1NE3A 1RODA 3GV6A 2F0JA 3TP5A 2JA8G 4IJLA 3QIAA 2MQHA 5CV5A 5IP7G 1DYQA 2K5VA 4GOPA 3MA2B 4YHHL 1LABA 3NXWA 1D1IA 3PIPA 1HTPA 1BCPD 1JE5A 1PH5A 4HMIA 2WB1B 1O78A 4M8AA 4JI4L 4K8IA 4IPDA 5HGQA 1TVXA 1GD7A 1YNNC 1SE4A 5BR8Q 1JJGA 3U58A 4LUOA 3CP0A 1UNSA 1QJOA 4R1JA 3GTKH 2E8GA 1A63A 2QEJC 1CA5A 1XYIA 1Y1VB 4JBWA 3UDFA 1NBWA 3FKIG 5A2QE 1Q7YC 2JSOA 3R8BA 2F0WA 1LTLA 1F9RA 2WAQE 4X3UA 5FO9B 4ZAIA 2WP8J 3TBIB 2IX3A 4IFDJ 4KN7C 4O1NA 2QEXA 1VMCA 1XX8A 3RNUA 4L5RC 3AU7A 2RHQB 3A8JE 1LTAD 1V1PB 4DAPA 4AQYQ 2RF4A 4JC0A 2R7ZH 2K32A 5M5XH 1BO0A 3AFPA 3I3CA 5A2QL 4FF3A 2QW7A 3PIP3 1KNAA 2VQEL 4RHRA 3DEPA 2B2YA 4DV4L 2YV5A 3RZOB 2B2UC 2UU9L 3J7AV 1X3GA 4P72A 1WD1A 4HSPA 3I4MG 2F0IA 3K7UC 3W1BA 1TIID 4LAAA 2WFWA 4HIMA 1YHBA 1QVGA 1PFMA 1BBWA 1HPCA 5A35A 2MUYA 2ICIA 4BBSG 5IGFA 1GUOA 3NSWA 5IYDG 5C6AA 2AQ1B 3IFDA 5T1GA 2A8VA 2O5IC 3I4OA 4TSSA 1CZWA 1SNOA 3ITPA 1IL2A 2RDFA 1PH1A 4L5TA 4BXXG 1E3PA 5LL6X 2XWBB 1K83B 5IOCA 2GA4B 2B2WA 1AW7A 2JA7B 5JJLA 4FF1A 3E9HA 3LWUA 4HJ8A 1SRUA 1FYCA 3D6WA 3A0JA 1Q1EA 1SNQA 2ZXRA 1KHIA 4KY7A 1PTOB 3ERQA 3TN2A 3SK8A 3UDIA 3SEBA 2ZJQA 1L1OB 1WTWA 2CHBD 4XTCS 3HOYH 3MXPA 2Y0SG 2DGYA 1YNJD 2FMMA 4JI1L 2KEEA 1HNWL 1I5FA 2BH2A 2K5NA 2BDNA 3T16A 4IOCA 1M1KC 3OHXC 4ZLTF 4OXPA 5BN3A 3U4VA 1FJGL 3CMAA 1SFOH 2NVYH 1QZHA 5I4DA 2PI2A 4LF8Q 2OQKA 1OXTA 1FNUA 4PNYA 3RR5A 2CH4A 4PZ8A 4J6HA 1PFNA 1SYFA 3KF6A 2RVLA 3M85A 2YTYA 1OO9B 2XRQD 3VR6A 1BDOA 4A3MB 3VYTA 3MZ5A 2ZJRA 1Y1WB 5K5PA 1TKWB 2CQOA 3DHQA 1B1ZA 4TVAB 2NVTB 2QA4A 4CDCC 1NCVA 5LMNW 1HA5A 3M3YB 4DV5Q 1FNVA 2IJ0A 1RDPD 3BG3A 1PFBA 2WKDA 2MNAA 3RLFA 3HOXG 2FMCA 2TSSA 1WTHA 4TKOB 2P5ZX 4A4IA 3K5NA 1NR4A 3CCEA 1WTXA 4B3SL 3QWNA 3K7AB 4JI5Q 3L2PA 1ZYRD 1S4ZA 1Y1VH 1ILPA 3FRPB 1ZEQX 1IYVA 3GP7A 5J39A 4A3IB 1N34L 3BDLA 3G6JB 1KDBA 3RMHA 1QB5D 2G9HD 2HD3A 1K8OA 1NTGA 2XRSD 2YU9B 4KKTA 1YHAA 3HOWB 3BDCA 1UAPA 5FJ8H 3OSOA 1IL8A 4I7AA 4PG3A 2MO1A 1STNA 4ODGA 4XDXA 1EYDA 2L12A 5ELNA 2J0TD 4DKAC 3PUYA 5JAVA 2PNRC 5IT9E 2FHTA 1JWSD 4IOAA 2HQLA 2FINB 3NK9A 3VR2A 2VQFL 4OHJA 2IY5B 2ZTDA 1Q12A 3P7JA 1PV4A 1P8LA 3T1YL 3G48A 4POGA 1BBUA 5HURA 5IGBA 2ENBA 4ID6A 1EY0A 4ZKCB 1EWHA 4KJNA 1II3A 5HY6A 1PTOC 1QOHA 2WAQB 5C3WA 4WFN3 1DGSA 1MI2A 2WV6D 1RTOA 5M3MG 3HOYG 3J7AF 5IT9L 1Z6HA 1D6EC 2LY7A 1PMRA 1MKHA 4DV7Q 4A93B 3I7FA 4N8FA 2EYHA 3SVMA 1BR9A 5IYBG 3C1FA 4CJ2C 3NWTA 1KRTA 3KK7A 2F0EA 5JEAJ 2OT2A 2QGQA 1IBLQ 1PRTD 5EKLA 1CA6A 1YI2A 1K83H 1KNEA 2JA7H 5CV4A 1P16A 4GN5A 4YY3L 2AKWB 4Z9CB 1PTOH 1Y8OB 2GVAA 4R9WA 4JYAL 5COYA 5I9PA 3S1MB 4S3SA 3R93A 3VYSA 2Z9HA 1XPOA 3ULPA 1S3OA 2B2VA 4ME3A 2JA8B 4X66L 2R92G 1EIHA 3CMEA 1EL0A 3NQTA 4EQPA 3J81i 3UI2A 1ILQA 1HNXL 4LW1A 1XMOL 1X56A 1XXGA 1IW7C 1EUJA 4MHEA 1J5EQ 3VDYA 4B3ML 4HEDA 2C5CA 2ASBA 1N32Q 4IUPA 1Q81C 1T5EA 3HOUG 1G8ZD 4FDBA 1XMQL 1EU3A 1H9SB 1NUCA 5C5MA 3M4QA 1L1OA 4RGMA 4ZYSA 3H94A 4L6TB 4A3MH 2VL6A 1H9JA 4KY5A 1BQQT 3HKZG 2JK8A 3WOFA 1Y1WH 1YJNA 4G7ZC 4NDXA 2NVTH 2XNAC 3KLSA 3U9SA 1VQIA 1VQEA 4G7HC 3OPOA 3T56B 4DR3Q 1GUNA 4QGUA 3HKSA 3M3YH 3JAMc 2PQEA 2EJGC 3OMCA 1V1OA 2JQOA 4JI8L 2KQ3A 1STGA 1DONA 2WINB 1SNMA 3KYHC 1DCZA 5KGUA 4V0BA 1IHZA 1H9MA 3VR5A 3K7AH 1SMXA 2E2DC 1I4RA 1PZKD 2B3GA 4I7ZC 2UXDL 4A3IH 3QOLA 3FEWX 2F4VL 1W6KA 2F4IA 1JC7A 1B8AA 2I5LX 3KJOA 4DAVA 1VQ9A 1LTTD 4CKEA 2K7VA 5D14A 3VR4A 2UUAL 3TRZA 4PMCA 3HOWH 3I4NG 1MSHA 3P75A 3V2TA 4EX5A 1GOZA 4Y7NB 4ZQ3A 1UUPA 2L11A 4RA8A 3P20A 1GJXA 1EY8A 1CKNA 1H9RA 3R2IA 1ZXTA 2C9OA 2HHHL 1LTBD 2KCMA 3TZDA 3QJYA 4F7XA 1HA6A 3NELA 1TS3A 3S1RB 1PTOD 3EA6A 1KRSA 1LTRD 4IPGA 3CPWA 4UP9A 1K8AC 2HDMA 1VF7A 2N3SA 3HKZE 1B3QA 3DXJC 3E5SA 5JVH3 3V05A 3UE1A 4LF5L 2VY3A 4K2KA 4OL7A 1V9PA 1TQOA 2K03A 4DU9A 4K6LA 4QUFA 5LMUL 1A3TA 4A93H 1B3AA 3VA7A 1NAPA 2IW3A 4KK7A 4JI2Q 1EOTA 4BY7G 1G6ZA 2ZJPA 3C2PA 1Y14B 4JG2A 2L5TA 1SJHD 4DV3Q 3PF4A 2F0VA 2R3ZA 4XT1B 1UEBA 4CDDC 3T1HQ 3MHBA 3NENA 4J15A 1B7YB 2CW0C 3K57A 1EQRA 2F0UA 3FHWA 4DPGA 2UXCQ 1LT6D 5CMDA 1U0LA 3S2DB 2ZM6L 4ZKBB 5GAGC 1XTCD 4A3BG 2XN9C 2YTXA 1SDFA 3RD4A 2PQAB 2M00A 2B2TA 4ZUJA 5C0XG 1LM0A 4OX9Q 2K5WA 2JA8H 3KUPA 1GKHA 1SJED 3FP9A 3MXNB 4B08A 1IW7D 2F0PA 1BBXC 3ICEA 3WOEA 1MSGA 1B9MA 1F2MA 4NP5A 4FNFA 5DNFA 4LF6Q 1XPUA 3BU2A 5KYIA 1EY6A 4B3RQ 1XWEA 1GO3E 5L37A 1E0BA 4ILWA 2ALYB 2A6ED 5I9OA 4JOIA 5ELOA 2A74C 2K4KA 4GKKQ 3HOXB 4KHVA 1SNDA 5BR8L 2PZUA 4IURA 3SK6A 3M9BA 3TZUA 2N49A 1R9TB 3BYTB 1SBBB 2PW5A 2F0MA 5I2YA 2B63G 3F2CA 1HFGA 1BF4A 1EU4A 3S9WA 4UAIA 1M4VA 1XNRQ 1D1KA 5FK9C 1VQKA 1KDAA 2EZVA 4LFAQ 3M4YA 1RIPA 2XVSA 3HOWG 5C4XG 2R7DA 3KLSX 1SEBD 2IPKD 5IGEA 5JVG3 3MVVA 1WTVA 4BBRB 4ZK9B 1RL2A 1SE3A 3AQQA 3F8TA 3I8ZA 2E5LQ 4AQYL 5CV9A 4IUQA 4AH6A 5I6YA 1EY9A 2PCFB 1GHKA 1DD2A 1GHJA 4CGYB 4LMQD 1X65A 1HR0Q 3I91A 1ESFA 2MHVA 1S5FD 4IZ8A 1K8MA 1J8IA 3CXCA 1KLUD 4IJHA 2Z6BA 1ONLA 4OONA 4P74A 5C4ZA 4RH6A 2V1CC 1QG7A 1RJTA 1AE2A 1JORA 3CCLA 2WAQG 5M3MB 4Y7NH 1IBMQ 1O7ZA 1CKMA 2XTIA 4KHZA 2JA5B 4DV2Q 4H44C 2AWOA 3FMCA 5FKAC 1IYUA 3UE0A 2HCIA 5IE8A 1HUNA 3H3VI 1DM0B 2Z0SA 2XSCA 4XQQA 5JOBA 1M90C 2NVQB 4BXXH 2EY6A 2L0CA 2CCZA 4FF4A 1I6HB 2EPBA 2EVBA 3Q22A 3N6RA 1LT4D 3S1RH 2EYFA 1VQ5A 4GKJQ 5GQOA 1K9MC 4ZRZA 2SEBD 4KTAA 2EJMA 2A68D 4UPAA 3HOZB 5LMNL 4KHPL 5EBCA 2R92B 2JJQA 1C7YA 1PYBA 3HP3A 2CW0D 3K8AA 5H1SE 4RWSC 4BY1G 3TS2A 3MEFA 4B9XA 3PMFA 4FXGC 3GTOH 5FLXc 2XWJB 1TXYA 3CCRA 5M5YB 3BYYB 1QE6A 4LJZC 2E76C 5FO7B 3AB9A 4H13C 2CKZB 3TS0A 4LF8L 3HOUB 1K3RA 1VQLA 5J22A 3S2DH 3CKIB 1RKNA 4XQNA 4A3CG 1X3EA 2QF7A 4HN7A 1ICWA 4RGOS 1SROA 2VNUD 4DV0Q 4IFDI 4KKSA 2ZXOA 1YHQA 1YIJA 3HKZB 3SR1A 4G7OC 1E2WA 1K28A 1NNXA 4LF9L 1FNWA 3LWEA 1HNZQ 2RCNA 4IQZA 3J80c 3GQBA 5E4WC 2KCCA 2NWGA 1GUGA 2RSOA 4U673 2NTSA 4NW2A 1W2BA 2E2IB 2XIWA 2RCFA 5I2XA 4DN4M 1S5CD 2AUKA 3FVQA 5E4XA 4IUVA 3KLRA 5GADC 3G6EA 1KAWA 3CRKC 4R4OA 1N8RC 2Q2HA 4DV5L 3VR3A 2OWOA 1CK1A 3HOXH 4RG1A 1PH8A 4IPHA 3SK4A 1VQBA 3A8IE 4UDUC 2PQAA 5IGCA 3IAYA 2G9DA 1R9TH 3W1GA 2OTLA 1WOCA 1AFPA 4JI5L 2OEOA 1L2FA 3BZCA 1CZGA 4DFAA 1AH9A 4JI7Q 5IY0A 3GTLB 4WJ4A 1KIXA 3GTQB 3I4NB 1PRTF 1JWUD 2IHFA 1Q82C 1AP0A 4N8X1 5I6WA 1EFWA 1A6XA 4BBRH 5EJWA 4RFBA 4HIKA 4DR1L 5C0XI 5KYLA 2L9HA 5M9OA 1LTSD 2F0OA 2B8GA 4KV6A 4L8JA 2LMCB 2E2HB 1QVCA 1B9NA 4HJ7A 2F0GA 4DUYL 3M4PA 3T51B 2JP1A 5C3EG 2EXZA 2F3VA 4XYOA 4R4IA 3H0GB 4WJ3M 1IBKQ 2RDHA 4O0AA 1YBYA 1LLRD 3AYHB 3DUZA 5IGGA 3CPFA 4QJFA 5M3MH 2JA5H 2KECA 4YCWA 4DV1Q 4X62L 2KEDA 3NEMA 1N33Q 4BY7B 3I4LA 5IYBH 1SSOA 4DV7L 2K04A 1TWCB 2UXBQ 2NVQH 1I94Q 2B2UA 4X3TA 5D65A 1WVLA 5J1ZA 1XPRA 3QB3A 5NUCA 1ASYA 1I6HH 1VQHA 4QY7A 1IBLL 4HJ9A 1SYDA 4RMFA 4ULLA 4M1UB 4RCOA 1C4QA 1X55A 1S40A 1WFQA 1JCKB 2KCTA 1X3FA 1EWIA 2KCNA 5EBDA 3J7A5 2MJ8A 4A3BB 1SAPA 1EOVA 1A2TA 1TU2B 3HOZH 4XYQA 2VZAA 3D0FA 3NP8A 1PH3A 4OIKA 4HSVA 2BA0A 3RLNA 2R92H 4QF4A 1B44D 4HAEA 2IL8A 5JJKA 3H3VC 3KBXA 1MBYA 1TWGH 2V4DA 2ZT9C 3L7ZC 4GNXB 1YZ6A 1YNND 4RHSA 4BA1I 1K0SA 3LX0A 5M5YH 3PO3B 4JVZA 3S16B 1EIGA 2E75C 3DLLA 4AYBE 3HOUH 1HXYD 1J5EL 1JOKA 1VQMA 3GTPB 2KJXA 3K5MA 1N32L 1QNUA 5M3FB 3S15B 3TSSA 3E6ZX 1F2LA 3A7LA 3H3VH 2B63B 3QO2A 1UE1A 4DNTB 4G4KA 1I4GA 1A8VA 1VQ7A 1STYA 1YVCA 1M8AA 1FD7D 3W5OA 1DXMA 1Q90A 2R6GA 3PV0A 1IZ6A 4DXFA 2RA4A 1XNQQ 3F1ZA 4ZUIA 3NTKA 2CQAA 3ULJA 5C4XB 4PV1C 2G5DA 2E2IH 4PMWA 5DM73 4DV4Q 1PTOF 4JI0Q 4BBRG 4J1MA 4DR3L 1RHPA 3MTSA 1JICA 2HIVA 1RTNA 1Q1BA 1ASZA 5ELBA 3HFZB 4DR6Q 4LFBQ 1STHA 3H15A 4DR4Q 5ELDA 4DXGA 3OOCA 3S17B 3K6OA 1ENCA 4KKUA 3H6MA 3GTLH 1ICFB 2SNSA 3GTQH 3I4NH 1D8LA 2D0OA 2PPBC 1L0YB 1E24A 1KAAA 3J7ZC 1V1PA 1UEAB 3D4RA 2I07B 4OEMB 4GZYC 3BZDB 4PMBA 4IUNA 2JA5G 4NXMQ 3CQZB 3OWEB 4IFDH 3EJIA 3CHBD 1RF2D 4XIGS 4DK3C 1LT5D 2HUGA 2K5DA 2EY5A 2Z8LA 4KD4A 3WDNA 1QCBD 1LV9A 5FLMH 4DR5L 2E2HH 2L55A 2QILA 2F03A 4JI1Q 3LGJA 2IX1A 1S5ED 1YEZA 2B8FA 4CKBA 3ND9A 1PDQA 1J9OA 2Q2UA 4QCLA 3H0GH 3IKJA 4A3DG 4LK1C 2EJFC 3HOZG 5CBEE 1E7ZA 1JQYD 2KA7A 4R8IA 2Z6KA 1F9SA 2CWPA 1HUMA 3CCJA 1GUWA 4PQXA 1TWAB 5CR3A 1GXDC 2QDLA 4BY7H 4BY1B 1TWCH 4O42A 4GN3B 3J81E 4JI2L 1WCMB 2PZWA 4GNXC 4DV3L 3NBIA 3D4WA 2MGSA 1L0XB 1CKOA 3T1HL 1EWCA 2F0DA 5CC4A 3EN2A 1T9HA 5E3FA 4LF4Q 3HEJA 5C44G 4A3BH 4MTKA 2UXCL 2L4NA 1SNPA 1N36L 3SE0A 2K05A 2F3IA 5C0XH 1A0IA 3EVQA 3D3RA 2KHSA 1VDZA 2J4XA 2KHIA 1U4LA 1JOQA 3J81L 3ERSX 1IKLA 4BWGB 3DWPA 4LF7Q 2EDGA 4P71A 1Q46A 4WRDA 3A5ZB 1OXVA 5J3BA 2PI2E 3PO3H 4LF6L 3S16H 4EQNA 1X54A 1HTLD 1MD2D 3IRBA 4B3RL 5T1IA 2AQ3B 2SNMA 1U9RA 3GTPH 5F2DA 1PZID 5M3FH 3K80C 3S15H 3L3OC 4UHVA 4JV5Q 1Y8PB 4GKKL 3G4SA 2EYMA 3CC7A 3PUWA 2B63H 3KF8B 2MO0A 1NJIC 4DR7Q 2NYZD 1PVOA 3GTJB 5KRUA 3PGZA 3X3NA 2DNEA 3SK5A 1KLGD 2LS01 1QNKA 5ELCA 1XNRL 5C4XH 1I4HA 1MIUA 1HQMC 1TWFH 4P73A 1SMYC 5EPKA 4LFAL 2BE5C 2JEAI 3KDFB 2R93B 1JB3A 2A69C 1HRJA 1Q3LA 3F2BA 4A3GG 4OIJA 4C3IH 4RAUC 3MXUA 2OQ0A 2FXQA 1F2YA 4ZCKA 4IFDG 2AMCB 5KNDA 4YCVA 2L15A 3Q0AA 1VCIA 3I73A 1C9OA 3Q6SA 4NXNL 2E5LL 1JT8A 4AYBB 4A3EB 2K75A 1G291 3V96A 5FLMG 2LKVA 1HR0L 4QQBX 4EGVA 3Q23A 2XGTA 1D7QA 3SDZA 4LFCQ 3S17H 5KNBA 1UE5A 1WTRA 5C3EB 2Q8RE 1X3PA 3B6YA 4FF2A 2QDBA 4IO9A 3H0GG 1X9NA 1I50B 4IUUA 4GOPB 3URYA 3L0OA 1N9WA 1HJPA 4F87A 4TRDA 2KENA 5EAYA 5EKKA 3CQZH 2E74C 4OO1I 1IBML 3HS0C 1XJVA 1ESRA 1EZ8A 3CC2A 4DV2L 2AQ2B 2MPMA 4F8MA 1HZAA 1RCVD 1BNZA 1G6PA 4B3TQ 3GTOB 3NTHA 1FVIA 1VQNA 1H95A 5GAHC 3CCMA 4JOIC 2C35B 4RKLA 1STAA 3HGBA 1VF5C 2F0QA 3BDOA 1I4XA 2VXWA 4GKJL 2I5HA 1JMCA 4DA2A 3TEHB 4DV6Q 5KNCA 4C1NI 4MN3A 4HMJA 3DEOA 3ND8A 1Z47A 3NPPA 4DNIA 4A3JG 4A75A 2LXKA 3C3LA 2AHOB 3O13A 2K52A 1TWAH 1STBA 4KD3A 4C3JB 1E2VA 4BY1H 4X3KA 2K50A 2PW7A 2DJFC 1J6QA 1BCPC 1WD0A 1WCMH 2A6HC 3K59A 1K0RA 3PO3G 1OXSC 1TS4A 4XT3B 1JR0D 4IPCA 1D5ZC 4A3CH 3NBHB 5M3FG 4FO2A 5D3IB 1DOLA 3DWQA 5EKIA 2EOTA 1OXXK 4R4CA 3RUZA 3GDEA 2DJGC 2EYJA 4DV0L 1HHVA 2UUCQ 1RD9D 4R4QA 3JAMi 2WIIB 3JAME 4TQUS 1HNZL 3RLOA 1I4PA 5CYUA 3PCOB 1WI5A 1DJRD 1VQOA
chains in the Genus database with same CATH topology
1TWHB 1SYBA 2I46A 2F0FA 4C3IG 5C4JB 5CV7A 5C4HA 2D9UA 4C3HG 5EGTA 1EYCA 1D2BA 1CFMA 1H9SA 3QOJA 4FXKC 2K33A 3SHLA 2LFNA 3L9AX 3MC0B 4KI0A 4DNRB 3NUCA 1AZQA 2H4OA 3JAML 4HCSA 3RZDB 2H1EA 2D5DA 2F0SA 1TS5A 3R3OA 1AN8A 1U4MA 5CGKA 1A3VA 5KEEA 2EE1A 5D3DA 2Z4HA 5LHY1 2MP1A 2CVRA 4H7BA 3PO2B 1DOKA 1X32A 3MWYW 4FVMA 5TSSA 1KTKA 4BS9A 1W6JA 1F77A 1KABA 3KF8A 3TP6A 3TP8A 3GTMB 3EROA 2JE6I 2X69A 3S1NB 4XXEA 3A56A 1Z7TA 2A73B 3J7YW 3Q24A 4A3DB 1F9QA 1F9PA 2M9VA 5G3LF 2F0HA 1LO5D 3S14B 1AZPA 4IN3A 4NKLA 3IFTA 1YNJC 2F0LA 1X3QA 2DNCA 4C56C 2E2JB 2D62A 1TWGB 2PYKA 2JA6B 4RGNA 3CU7A 4QB4A 1MGSA 4XQJA 4K5XA 3FPPA 5IODA 4DK1A 5JEAG 1GUTA 1NSNS 1SE2A 1JOOA 4NMZA 2KVMA 1O80A 5C44B 5K36H 1ET9A 2B2YC 3K5LA 4E6IA 3A7AB 3R2TA 4RGTA 4A3KB 2A6HD 4K14A 1LT3D 3T13A 3MAQA 2HDLA 3H09A 2RBMA 3BS1A 3EQLC 2HCCA 1EZ6A 3K5OA 2QCPX 3KBGA 2K6AA 2YYZA 2NTTA 2X6GA 3I70A 1PLFA 3A54A 2O5JC 4F88A 4KN4C 4B9WA 2B39A 1ZYRC 4OO1H 2B2WC 4CBVA 3MXNA 1CHQD 4J8QA 1SYGA 3S1QB 3FPUB 1O7LA 4IUTA 3VYRA 3DM1A 4A3GB 2BDOA 4A3FB 3VA5A 1B4OA 3NBHA 4CKCA 2IX0A 4DK0A 3GTGB 1H9KA 2M2LA 3E0JA 1D5MC 1E2ZA 2L1BA 3HOVB 2WKCA 3BVZA 3H91A 3C1EA 3BVMA 4EVOA 2EY2A 1EQVA 4P2CB 2F0NA 1O7YA 3OMGA 2RQXA 2R61A 2VUMB 1G2TA 1PXUA 3F2UA 2N88A 1EFID 5C0XJ 2Z1CA 1Q8IA 1PRTC 1G91A 4QMGA 3A55A 4KY6A 4HCEA 1TT2A 5CBAE 5IIFA 4K2LA 3M7NA 1ML0D 3GD7A 5K36G 1SNCA 3D31A 4CHTB 1B2TA 5ELEA 2NVXB 2HQEA 4A3JB 2K28A 5FLXE 1LTID 4C3JG 2O2LD 3MXGA 1NR2A 1C8CA 5G3LD 1IKMA 2FFKB 3EFXD 1ENAA 4IALA 5BN5A 1V43A 1HQRD 4OO1G 5FLXL 1QILA 3J80E 1I6VC 1CQFA 1BOSA 5KIXA 2NN6I 2K01A 3OWFA 1DZ1A 2TMPA 1SXTA 1A3UA 1ENFA 1FGBD 1TWFB 2AWNA 3D8GA 2Q8TA 4C3IB 3D4DA 4DF7A 5EQ0A 4C3HB 2EYPA 3J80L 4QUCA 3NWSA 3W3AA 3GV3A 3ZYYX 3P1HA 2JEBI 2QKIC 1HCZA 2EYLA 3LNNA 5HGTA 3PUZA 2OF1A 2F0TA 2RKSA 1OXUA 4WJWA 4DGZA 1EY5A 4DAYA 1CTMA 1F2ZA 2B2VC 1V8QA 1G2SA 4FYDA 1B53A 1EQTA 4MIUA 2DY7A 1CM9A 3X3MA 2VB2X 4WORA 1EY7A 5FO8B 4FXDA 3TDQA 3PIO3 1Y8NB 3FDTA 2Q8IB 3QG1A 3SXHA 4G57A 3PUXA 4KMUC 3T53B 1EEFD 1S5BD 4Q5VA 1A15A 3OIPA 1KDCA 1TY0A 2NB0A 5IGDA 3HG9A 3OW7A 4FP5D 2X6LA 1C48A 2BCOA 3NHHA 4HTHA 2OXPA 3G7LA 1I3QB 4C2MB 4EQOA 2BOSA 5CV8A 1R4PB 2ZXPA 1BCPB 4QIWB 1DOMA 4C1NK 1PYWD 2J7ZA 1GUSA 1STEA 5M5WB 1LACA 5C5LA 3DMUA 1BXTA 1T5XD 2A6EC 2JYOA 1Y69U 3A8KE 3FKIB 4CJ0B 1D5XC 2PMZB 1QWYA 3TMEA 4K8JA 2F1MA 5FOBB 3M4OB 1EEID 4K5WA 5JPMC 5BN4A 5ISRA 2RSNA 1U4RA 3CRLC 5JPNC 3MFYA 3BVGA 1A2UA 2EYOA 1WTQA 3I4MB 2NUCA 4N9TA 1BUVT 2JXMB 5LL6S 4K5VA 2AUJD 3NTIA 5AFWA 4BBSB 1U4PA 3DWAA 3S2HB 1CQVA 2B2TC 5CORA 3NQIA 1JWMD 2BA1A 3HZXA 5E1FA 3MEHA 5ELFA 2NN6H 2RDGA 3ONAB 3OIQA 1BCPF 1FR3A 4YIJA 2Y0SB 1CI3M 4H0LC 2A68C 4ABNA 1CHPD 2NZ1D 2Z4IA 1WTOA 5EPLA 4Q0FA 3I90A 1B50A 3GTKB 5DEHA 4JK1C 3GO5A 2FJ2A 2PO4A 4U68A 1WTPA 5JEAH 2D2CC 3C46A 2WACA 2IWHA 2EY1A 2PZTA 4L63B 3U9OA 2DY8A 5EPJA 3IL8A 4RCNA 3VYUA 2DN8A 2IT1A 4RKBA 1TY2A 1EY4A 5CV6A 2ICEC 2KOLA 2R7ZB 5M5XB 1R4QB 3PUVA 1CT1D 4KJOA 2VB3X 5C3XA 4V190 1TS2A 4R8NA 3T4AC 2N55A 1SMYD 2BE5D 5DAUA 2A69D 3HRZC 2K1BA 3TP7A 4K6DA 1S5DD 5JJZA 1SYEA 3K0YA 2O4XA 1EYAA 3MFGA 2SOBA 2KUMA 3M7GA 3N52A 1ZKOA 1PZJD 4N9PA 2ID0A 5DM63 2NN6G 4X3SA 2SDFA 3W2DA 4BA2I 2F0KA 3K58A 4I65A 3HOYB 3D6CA 4HR7B 3I72A 2F3WA 2A5HA 1HFNA 1SYCA 2K5QA 4ME5A 2NBFA 1TR5A 1AEXA 1SFOB 2NVYB 1LTGD 1I4QA 1VMPA 1JE4A 1PRTB 3NE5B 1ET6A 3AMUA 4OGQC 4CJ1B 1RODA 3GV6A 2F0JA 3TP5A 3QIAA 5CV5A 1DYQA 3MA2B 1LABA 3NXWA 1D1IA 1HTPA 1BCPD 4HMIA 2WB1B 1O78A 4M8AA 4K8IA 1TVXA 1YNNC 1SE4A 1UNSA 1QJOA 2QEJC 1CA5A 1XYIA 1Y1VB 4JBWA 5A2QE 2JSOA 3R8BA 2F0WA 1F9RA 4X3UA 5FO9B 4ZAIA 2WP8J 3TBIB 2IX3A 4IFDJ 4KN7C 4O1NA 1VMCA 1XX8A 3AU7A 3A8JE 1LTAD 1V1PB 4DAPA 2K32A 1BO0A 3I3CA 5A2QL 4FF3A 3PIP3 1KNAA 4RHRA 3DEPA 2B2YA 3RZOB 2B2UC 3J7AV 1WD1A 4HSPA 2F0IA 1TIID 4LAAA 1PFMA 1HPCA 5A35A 2MUYA 2ICIA 5IGFA 1GUOA 3NSWA 5C6AA 2AQ1B 3IFDA 5T1GA 2O5IC 4TSSA 1CZWA 1SNOA 3ITPA 2RDFA 5LL6X 2XWBB 1K83B 5IOCA 2GA4B 2B2WA 1AW7A 2JA7B 4FF1A 3LWUA 1FYCA 3D6WA 1Q1EA 1SNQA 2ZXRA 4KY7A 1PTOB 3ERQA 3TN2A 3SK8A 3SEBA 1WTWA 2CHBD 4XTCS 3MXPA 1YNJD 2FMMA 2KEEA 3T16A 2BDNA 3OHXC 4ZLTF 5BN3A 5I4DA 1OXTA 1FNUA 4PNYA 4J6HA 1PFNA 1SYFA 3M85A 2RVLA 1OO9B 2XRQD 3VR6A 1BDOA 4A3MB 3VYTA 3MZ5A 1Y1WB 5K5PA 1TKWB 3DHQA 1B1ZA 2NVTB 1NCVA 1HA5A 3M3YB 1FNVA 2IJ0A 1RDPD 3BG3A 1PFBA 2WKDA 3RLFA 2FMCA 2TSSA 1WTXA 4TKOB 3K5NA 1NR4A 3QWNA 3K7AB 1ZYRD 1S4ZA 1ILPA 3FRPB 1ZEQX 1IYVA 3GP7A 5J39A 4A3IB 3BDLA 3G6JB 1KDBA 3RMHA 1QB5D 2G9HD 1K8OA 2XRSD 2YU9B 4KKTA 3HOWB 3BDCA 1UAPA 3OSOA 1IL8A 4ODGA 1STNA 4XDXA 1EYDA 2L12A 2J0TD 3PUYA 5JAVA 2PNRC 5IT9E 2FHTA 1JWSD 2FINB 3NK9A 3VR2A 4OHJA 1Q12A 3P7JA 5HURA 5IGBA 2ENBA 4ID6A 1EY0A 4ZKCB 1EWHA 4KJNA 1II3A 1PTOC 1QOHA 2WAQB 5C3WA 4WFN3 1MI2A 2WV6D 1RTOA 3J7AF 5IT9L 1Z6HA 1D6EC 2LY7A 1PMRA 4A93B 2EYHA 3SVMA 1BR9A 3C1FA 4CJ2C 3NWTA 5JEAJ 3KK7A 2F0EA 2OT2A 1PRTD 5EKLA 1CA6A 1KNEA 5CV4A 4Z9CB 1PTOH 1Y8OB 4R9WA 5COYA 5I9PA 3S1MB 4S3SA 3R93A 3VYSA 2B2VA 2JA8B 1EIHA 1EL0A 3NQTA 4EQPA 3UI2A 1ILQA 1XXGA 1IW7C 4MHEA 4HEDA 2C5CA 4IUPA 1T5EA 1G8ZD 1EU3A 1H9SB 1NUCA 5C5MA 4ZYSA 4RGMA 3H94A 4L6TB 1H9JA 4KY5A 1BQQT 3WOFA 4G7ZC 4NDXA 2XNAC 3KLSA 3U9SA 4G7HC 3OPOA 3T56B 1GUNA 2PQEA 2EJGC 3OMCA 1V1OA 2KQ3A 1STGA 1DONA 2WINB 1SNMA 1DCZA 5KGUA 4V0BA 1IHZA 1H9MA 3VR5A 2E2DC 1I4RA 1PZKD 4I7ZC 3QOLA 3FEWX 1W6KA 2F4IA 1JC7A 4DAVA 1LTTD 4CKEA 2K7VA 5D14A 3VR4A 4PMCA 1MSHA 3P75A 3V2TA 1GOZA 4Y7NB 4ZQ3A 1UUPA 2L11A 4RA8A 3P20A 1GJXA 1EY8A 1H9RA 3R2IA 1ZXTA 2C9OA 1LTBD 3TZDA 3QJYA 4F7XA 1HA6A 1TS3A 3S1RB 1PTOD 3EA6A 1LTRD 2HDMA 1VF7A 3DXJC 3E5SA 5JVH3 3V05A 4K2KA 4OL7A 1TQOA 2K03A 4DU9A 4K6LA 4QUFA 1A3TA 1B3AA 3VA7A 1NAPA 2IW3A 4KK7A 1EOTA 1G6ZA 3C2PA 2L5TA 1SJHD 2F0VA 2R3ZA 4XT1B 3MHBA 2CW0C 3K57A 2F0UA 1LT6D 5CMDA 3S2DB 4ZKBB 1XTCD 2XN9C 1SDFA 3RD4A 2M00A 2B2TA 4ZUJA 5C0XG 2K5WA 3KUPA 1SJED 4B08A 1IW7D 2F0PA 1BBXC 3WOEA 1MSGA 1B9MA 1F2MA 4NP5A 4FNFA 5DNFA 5KYIA 1EY6A 1XWEA 1E0BA 4ILWA 2A6ED 5I9OA 2A74C 3HOXB 4KHVA 1SNDA 2PZUA 4IURA 3SK6A 3TZUA 1R9TB 3BYTB 1SBBB 2PW5A 2F0MA 5I2YA 1HFGA 1BF4A 1EU4A 3S9WA 4UAIA 1M4VA 1D1KA 5FK9C 1KDAA 2EZVA 3M4YA 2XVSA 3KLSX 1SEBD 2IPKD 5IGEA 5JVG3 3MVVA 1WTVA 4BBRB 4ZK9B 1SE3A 3I8ZA 5CV9A 4IUQA 5I6YA 1EY9A 2PCFB 1GHKA 1DD2A 1GHJA 4CGYB 4LMQD 3I91A 1ESFA 2MHVA 1S5FD 4IZ8A 1K8MA 1J8IA 1KLUD 1ONLA 5C4ZA 4RH6A 1QG7A 1RJTA 1JORA 5M3MB 1O7ZA 4KHZA 2JA5B 4H44C 2AWOA 3FMCA 5FKAC 1IYUA 2HCIA 1HUNA 1DM0B 2XSCA 4XQQA 5JOBA 2NVQB 2EY6A 2L0CA 4FF4A 1I6HB 2EPBA 2EVBA 3Q22A 3N6RA 1LT4D 2EYFA 4ZRZA 2SEBD 4KTAA 2EJMA 2A68D 3HOZB 5EBCA 2R92B 3HP3A 2CW0D 4RWSC 4B9XA 3PMFA 4FXGC 2XWJB 5M5YB 3BYYB 1QE6A 4LJZC 2E76C 5FO7B 3AB9A 4H13C 3HOUB 5J22A 3CKIB 1RKNA 4XQNA 2QF7A 4HN7A 1ICWA 4RGOS 2VNUD 4IFDI 4KKSA 2ZXOA 3HKZB 3SR1A 4G7OC 1E2WA 1FNWA 3LWEA 4IQZA 3GQBA 5E4WC 2KCCA 2NWGA 1GUGA 2RSOA 4U673 2NTSA 4NW2A 2E2IB 2XIWA 5I2XA 4DN4M 1S5CD 2AUKA 3FVQA 5E4XA 4IUVA 3KLRA 3CRKC 3VR3A 1CK1A 3SK4A 3A8IE 4UDUC 5IGCA 3IAYA 2G9DA 1AFPA 2OEOA 1CZGA 4DFAA 3GTLB 3GTQB 3I4NB 1PRTF 1JWUD 1AP0A 5I6WA 1A6XA 5EJWA 4RFBA 5C0XI 5KYLA 2L9HA 5M9OA 1LTSD 2F0OA 2B8GA 4KV6A 4L8JA 2LMCB 2E2HB 1B9NA 2F0GA 3T51B 2JP1A 2EXZA 2F3VA 4XYOA 3H0GB 2RDHA 1LLRD 3DUZA 5IGGA 2KECA 2KEDA 4BY7B 3I4LA 1SSOA 2K04A 1TWCB 2B2UA 4X3TA 5D65A 1WVLA 5J1ZA 3QB3A 5NUCA 1SYDA 4ULLA 4M1UB 4RCOA 1C4QA 1JCKB 2KCNA 5EBDA 2MJ8A 4A3BB 1SAPA 1A2TA 1TU2B 4XYQA 3NP8A 4OIKA 4HSVA 2BA0A 4QF4A 1B44D 4HAEA 2IL8A 3H3VC 1MBYA 2V4DA 2ZT9C 3KBXA 3L7ZC 1YNND 4RHSA 4BA1I 3LX0A 3PO3B 3S16B 1EIGA 2E75C 1HXYD 1JOKA 3GTPB 2KJXA 3K5MA 1QNUA 5M3FB 3S15B 3TSSA 3E6ZX 1F2LA 3A7LA 2B63B 3QO2A 4DNTB 4G4KA 1I4GA 1STYA 1M8AA 1FD7D 1DXMA 1Q90A 2R6GA 3PV0A 4DXFA 2RA4A 4ZUIA 3NTKA 2CQAA 5C4XB 4PV1C 4PMWA 5DM73 1PTOF 4J1MA 1RHPA 3MTSA 1JICA 1RTNA 1Q1BA 5ELBA 1STHA 5ELDA 4DXGA 3OOCA 3S17B 3K6OA 1ENCA 4KKUA 3H6MA 2SNSA 2PPBC 1L0YB 1KAAA 1V1PA 1UEAB 3D4RA 2I07B 4GZYC 3BZDB 4PMBA 4IUNA 3CQZB 3OWEB 4IFDH 3EJIA 3CHBD 1RF2D 4XIGS 1LT5D 2HUGA 2K5DA 2EY5A 2Z8LA 4KD4A 3WDNA 1QCBD 1LV9A 2L55A 2QILA 2F03A 2IX1A 1S5ED 2B8FA 4CKBA 3ND9A 1PDQA 1J9OA 4QCLA 3IKJA 4LK1C 2EJFC 5CBEE 2KA7A 1JQYD 4R8IA 1F9SA 1HUMA 1GUWA 4PQXA 1TWAB 5CR3A 1GXDC 4BY1B 4O42A 3J81E 1WCMB 2PZWA 3NBIA 3D4WA 2MGSA 1L0XB 1EWCA 2F0DA 5CC4A 5E3FA 3HEJA 2L4NA 1SNPA 3SE0A 2K05A 5C0XH 3EVQA 3D3RA 2KHSA 1VDZA 2J4XA 1U4LA 1JOQA 3J81L 1IKLA 4BWGB 3DWPA 2EDGA 4WRDA 1OXVA 4EQNA 1HTLD 1MD2D 5T1IA 2AQ3B 2SNMA 1U9RA 5F2DA 1PZID 3L3OC 1Y8PB 2EYMA 3PUWA 2NYZD 3GTJB 5KRUA 3X3NA 2DNEA 3SK5A 1KLGD 2LS01 1QNKA 5ELCA 1I4HA 1HQMC 1SMYC 5EPKA 2R93B 2BE5C 2JEAI 1JB3A 2A69C 1HRJA 1Q3LA 4OIJA 4RAUC 3MXUA 1F2YA 4IFDG 5KNDA 3Q0AA 1VCIA 3I73A 3Q6SA 4AYBB 4A3EB 1G291 3V96A 2LKVA 4EGVA 3Q23A 3SDZA 5KNBA 1WTRA 5C3EB 2Q8RE 1X3PA 4FF2A 2QDBA 1I50B 4IUUA 3URYA 4F87A 4TRDA 5EKKA 2E74C 4OO1I 3HS0C 1ESRA 1EZ8A 2AQ2B 2MPMA 4F8MA 1RCVD 1BNZA 3GTOB 3NTHA 4RKLA 1STAA 3HGBA 1VF5C 2F0QA 3BDOA 1I4XA 2VXWA 4DA2A 5KNCA 4C1NI 4MN3A 4HMJA 3DEOA 3ND8A 1Z47A 3NPPA 3C3LA 3O13A 1STBA 4KD3A 4C3JB 1E2VA 4X3KA 2PW7A 1BCPC 1WD0A 2A6HC 3K59A 1OXSC 1TS4A 4XT3B 1JR0D 1D5ZC 4FO2A 5D3IB 1DOLA 3DWQA 5EKIA 2EOTA 1OXXK 3RUZA 2EYJA 1HHVA 1RD9D 2WIIB 3JAME 4TQUS 1I4PA 5CYUA 1DJRD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A3T A;  3BDL A;  1KDB A;  1SYB A;  3SK4 A;  4KY6 A;  5IGF A;  1TT2 A;  3LX0 A;  5IGC A;  1JOR A;  4K14 A;  2F0F A;  1NUC A;  2WAC A;  5C5M A;  2LKV A;  5CV7 A;  3T13 A;  5C4H A;  2F0V A;  5C6A A;  4K2L A;  5EGT A;  5IIF A;  1EYC A;  2EY1 A;  4B9X A;  2OEO A;  2PZT A;  3BDC A;  3U9O A;  3OSO A;  3QOJ A;  4KY5 A;  1SNO A;  3ITP A;  2RBM A;  4WOR A;  1EY7 A;  3MHB A;  2RDF A;  4K5W A;  4DFA A;  1SNC A;  3SHL A;  5CR3 A;  1JOK A;  2QDB A;  1EZ6 A;  5IOC A;  2F0U A;  1STN A;  4ODG A;  1EYD A;  2F0J A;  3NUC A;  4RKB A;  3TP5 A;  5ISR A;  4NDX A;  1EY4 A;  2PZW A;  5CV5 A;  5CV6 A;  5JOB A;  2HQE A;  1SNQ A;  5J39 A;  4KY7 A;  5JAV A;  4TRD A;  3D4W A;  5EKK A;  2EY6 A;  5I6W A;  3ERQ A;  3SK8 A;  3NXW A;  2M00 A;  1EZ8 A;  2F0S A;  4ZUJ A;  3R3O A;  1STY A;  2F0D A;  1A2U A;  2EYO A;  2EYF A;  3NK9 A;  4KJO A;  3SXH A;  4B9W A;  2NUC A;  1A3V A;  4N9T A;  5CGK A;  5KEE A;  2PQE A;  5E3F A;  4F8M A;  3MXP A;  4G57 A;  3HEJ A;  4HMI A;  5KYL A;  3OMC A;  5CC4 A;  5M9O A;  2F0P A;  1SNP A;  2F0O A;  4ZUI A;  4K5V A;  4K8I A;  2KQ3 A;  4KV6 A;  1STG A;  5HUR A;  5IGB A;  2ENB A;  4KTA A;  1SNM A;  5C3X A;  4H7B A;  4ID6 A;  1F2M A;  4NP5 A;  3T16 A;  5KGU A;  3EVQ A;  1ENA A;  2KHS A;  1EY0 A;  1IHZ A;  4R8N A;  4RKL A;  4KJN A;  1STA A;  1II3 A;  1SYG A;  5KYI A;  1JOQ A;  1EY6 A;  1KDC A;  2F0Q A;  4J1M A;  4IAL A;  5C3W A;  2F0G A;  5IGD A;  3QOL A;  5I9O A;  2EXZ A;  5KIX A;  2F3V A;  5DAU A;  3HZX A;  5E1F A;  3TP7 A;  1KAB A;  3MEH A;  4WRD A;  1STH A;  4HMJ A;  4K6D A;  4PNY A;  4KHV A;  1SND A;  3OWF A;  2PZU A;  2EYH A;  2F0W A;  4J6H A;  3PMF A;  3TP6 A;  1SYF A;  3SK6 A;  3VA5 A;  3TP8 A;  1SYE A;  4PMC A;  3C1F A;  2O4X A;  4EQN A;  5IGG A;  1EYA A;  2PW5 A;  2F0M A;  2F0E A;  2SOB A;  3ERO A;  3NHH A;  3P75 A;  3V2T A;  4HTH A;  1STB A;  2OXP A;  1U9R A;  2SNM A;  1A3U A;  4KD3 A;  5EKL A;  1ENC A;  5F2D A;  4ZQ3 A;  3S9W A;  3H6M A;  3MZ5 A;  2PW7 A;  4YIJ A;  5J22 A;  2F0H A;  1KDA A;  3D8G A;  5K5P A;  2SNS A;  5CV4 A;  1RKN A;  4EQO A;  3DHQ A;  2EYM A;  3D4D A;  5CV8 A;  4DF7 A;  1EY8 A;  1KAA A;  2EYP A;  4NKL A;  4N9P A;  2F0L A;  5J1Z A;  3QB3 A;  3C1E A;  5NUC A;  4F7X A;  4PMB A;  4IUN A;  5I9P A;  4EVO A;  4S3S A;  5IGE A;  3SR1 A;  2EY2 A;  2F0K A;  1SYD A;  2PYK A;  1EQV A;  3MVV A;  5KRU A;  4QB4 A;  3EJI A;  2F0N A;  3SK5 A;  3P1H A;  3OMG A;  4I65 A;  5C5L A;  3DMU A;  2EY5 A;  2EYL A;  3D6C A;  5HGT A;  4KD4 A;  4K5X A;  5CV9 A;  5I6Y A;  2F3W A;  1EY9 A;  1A2T A;  3RUZ A;  2EYJ A;  2OF1 A;  2F0T A;  3NQT A;  2RKS A;  4EQP A;  1SYC A;  3NP8 A;  5IOD A;  4DGZ A;  3E5S A;  4ME5 A;  1EY5 A;  2F0I A;  1NSN S;  4IZ8 A;  4QF4 A;  1F2Y A;  1JOO A;  1TR5 A;  4NMZ A;  4K2K A;  1AEX A;  5DEH A;  1F2Z A;  4OL7 A;  3TME A;  4LAA A;  1TQO A;  4K8J A;  4DU9 A;  5C4Z A;  4QMG A;  4MIU A;  4E6I A; 
#chains in the Genus database with same CATH topology
 1TWH B;  5M5W H;  1SYB A;  2I46 A;  2UXD Q;  4PZ7 A;  2F0F A;  4C3I G;  5C4J B;  1GM5 A;  5CV7 A;  5C4H A;  2D9U A;  4C3H G;  5EGT A;  1EYC A;  1SR3 A;  1D2B A;  1KD1 C;  1CFM A;  1H9S A;  3QOJ A;  4FXK C;  2K33 A;  3SHL A;  2I5M X;  4DR2 Q;  2LFN A;  2DUD A;  3L9A X;  3MC0 B;  3U50 C;  2KBN A;  4KI0 A;  4DNR B;  1PH2 A;  4A3L G;  3NUC A;  4UP7 A;  1K3B C;  1AZQ A;  2H4O A;  3JAM L;  4HCS A;  3RZD B;  2H1E A;  2D5D A;  4X65 Q;  2Q2I A;  3GTJ H;  2OTJ A;  1CUK A;  1TS5 A;  2F0S A;  3R3O A;  1KXL A;  1AN8 A;  1U4M A;  5CGK A;  4JBK A;  1A3V A;  5KEE A;  2EE1 A;  5D3D A;  1KC8 C;  4UP8 A;  2HIX A;  2Z4H A;  5LHY 1;  4NB3 A;  4JI3 Q;  2MP1 A;  2R93 H;  2CVR A;  1SE8 A;  3E3X A;  4H7B A;  4GOP C;  3OTO Q;  3PO2 B;  1DOK A;  1X32 A;  3MWY W;  4FVM A;  5TSS A;  1E1T A;  4A3E H;  2LXJ A;  1KTK A;  4BS9 A;  1W6J A;  3QR8 A;  1F77 A;  1KAB A;  4HID A;  1AE3 A;  2CH4 W;  3KF8 A;  3TP6 A;  3RN5 A;  3TP8 A;  3GTM B;  5AJ3 Q;  3ERO A;  5C3E H;  2JE6 I;  2X69 A;  3ZJY C;  3S1N B;  4XXE A;  3A56 A;  3E0E A;  1Z7T A;  2A73 B;  3J7Y W;  3Q24 A;  2K14 A;  1I50 H;  4A3D B;  1F9Q A;  1F9P A;  2M9V A;  3KDF A;  4JI6 Q;  5G3L F;  1VQJ A;  2F0H A;  1LO5 D;  2NZO A;  2JN4 A;  3S14 B;  1IBK L;  1AZP A;  1VQA A;  4IN3 A;  4NKL A;  3IFT A;  5GAE C;  1YNJ C;  3OW2 A;  2F0L A;  1X3Q A;  2YTV A;  3CCV A;  1PH4 A;  1HR0 W;  2DNC A;  4C56 C;  2E2J B;  2D62 A;  1TWG B;  5DLQ E;  2PYK A;  3JC6 6;  2JA6 B;  4RGN A;  3CU7 A;  4QB4 A;  3CCU A;  1MGS A;  4DV1 L;  1N33 L;  1WCM G;  4XQJ A;  4K5X A;  1FL0 A;  2UXB L;  4PZ6 A;  1I94 L;  3FPP A;  4K0K Q;  5IOD A;  3KOJ A;  4DK1 A;  2PNH A;  5JEA G;  1GUT A;  1NSN S;  5IWA Q;  1SE2 A;  1JOO A;  4NMZ A;  2KVM A;  1O80 A;  1HZ9 A;  5C44 B;  5K36 H;  1ET9 A;  2B2Y C;  3K5L A;  3RN2 A;  1UE7 A;  4E6I A;  3A7A B;  3R2T A;  4RGT A;  4A3K B;  2A6H D;  4K14 A;  1LT3 D;  3T13 A;  3MAQ A;  4H02 A;  2HDL A;  4C3J H;  3H09 A;  3K0X A;  2RBM A;  4DAY B;  3BS1 A;  3EQL C;  1KQS A;  2HCC A;  1EZ6 A;  3F2D A;  1XTD A;  3K5O A;  1EQQ A;  2QCP X;  3KBG A;  1VQ8 A;  2K6A A;  2YYZ A;  2NTT A;  2X6G A;  3I70 A;  1PLF A;  3A54 A;  3J81 j;  1VQD A;  2D0P A;  2O5J C;  4MTN A;  4F88 A;  2NZH A;  4KN4 C;  4JPB W;  4B9W A;  1CSQ A;  2B39 A;  1ZYR C;  4OO1 H;  2B2W C;  1YNX A;  1MHW C;  4CBV A;  3MXN A;  1CHQ D;  4DUZ Q;  4J8Q A;  1SYG A;  3S1Q B;  3FPU B;  2I0Q A;  1O7L A;  4IUT A;  3VYR A;  1TWH H;  3DM1 A;  1XNQ L;  2R93 G;  3CF5 A;  4A3G B;  4LUZ A;  2BDO A;  1A62 A;  3STB C;  5C4J H;  4A3F B;  4CDE C;  3VA5 A;  1B4O A;  1YIT A;  4JI0 L;  3NBH A;  5IT9 c;  1VS0 A;  1OTC A;  4CKC A;  2IX0 A;  4DK0 A;  5IP9 G;  3GTG B;  1H9K A;  4AYB G;  4A3E G;  4DR6 L;  2M2L A;  3E0J A;  1D5M C;  4LFB L;  2ZTC A;  3S24 A;  1E2Z A;  3RZD H;  2L1B A;  3HOV B;  2WKC A;  3BVZ A;  3H91 A;  3C1E A;  3BVM A;  4EVO A;  2EY2 A;  1EQV A;  4P2C B;  2F0N A;  1O7Y A;  3OMG A;  2RQX A;  2MFI A;  2R61 A;  4QIW E;  1U5K A;  2VUM B;  1G2T A;  2UUB Q;  1PXU A;  3F2U A;  5E7N A;  2N88 A;  1VQ6 A;  3PO2 H;  1VQP A;  1EFI D;  4NXM L;  4X64 Q;  5C0X J;  2ZTE A;  2Z1C A;  1Q8I A;  1PRT C;  3PSI A;  5LMN Q;  4KHP Q;  4Y52 H;  1G91 A;  4QMG A;  3A55 A;  4KY6 A;  4HCE A;  1TT2 A;  4DK6 C;  3GTM H;  2PMZ E;  4GLA C;  5CBA E;  5IIF A;  4K2L A;  3M7N A;  3S1N H;  4YHH Q;  1ML0 D;  2OCE A;  2JA9 A;  3GD7 A;  5K36 G;  5JJI A;  4A3D H;  1SNC A;  3D31 A;  4DAM A;  3S14 H;  1Q8K A;  4CHT B;  1B2T A;  5ELE A;  4JI4 Q;  4O2D A;  2NVX B;  2HQE A;  4A3J B;  2EXD A;  2K28 A;  3ER0 A;  1Q86 C;  5FLX E;  2E2J H;  2K5H A;  1LTI D;  3I55 A;  1V1Q A;  1JJC B;  4C3J G;  4CDF C;  2O2L D;  2JA6 H;  3J81 c;  3MXG A;  3PF5 A;  1NR2 A;  2Q2T A;  1C8C A;  5G3L D;  1IKM A;  2FFK B;  4KLK A;  4LF9 Q;  3EFX D;  1ENA A;  1IXR A;  4QL5 A;  1JB7 A;  1BKB A;  5C44 H;  4IAL A;  5BN5 A;  2RHS B;  3J80 i;  1V43 A;  1HQR D;  4OO1 G;  5FLX L;  1QIL A;  3J80 E;  4LF4 L;  1I6V C;  1CQF A;  1BOS A;  5KIX A;  5IYC H;  4OEL B;  2NN6 I;  4A3K H;  3KJP A;  1QUQ B;  4YWM A;  4ALP A;  2K01 A;  3OWF A;  2ES2 A;  1DZ1 A;  1K8G A;  1SLJ A;  3EBE A;  2R7Z G;  2EIF A;  2TMP A;  1SXT A;  2EQS A;  1A3U A;  4LF7 L;  1ENF A;  2VQE Q;  1FGB D;  1TWF B;  4GN4 B;  2AWN A;  3PIO A;  1CKN B;  1X6O A;  3A74 A;  3D8G A;  2Q8T A;  4C3I B;  3CCS A;  3D4D A;  4DF7 A;  5EQ0 A;  4C3H B;  2EYP A;  2UU9 Q;  3J80 L;  4QUC A;  4HJ5 A;  3NWS A;  1NMF A;  3W3A A;  1E22 A;  3GV3 A;  1FGU A;  3K81 C;  2Y0S E;  3ZYY X;  3P1H A;  4JBJ A;  2JEB I;  2QKI C;  1HCZ A;  4JV5 L;  2EYL A;  2LSS A;  3LNN A;  5HGT A;  4LNQ A;  2IHE A;  2N8N A;  3PUZ A;  2OF1 A;  2F0T A;  4DR1 Q;  2RKS A;  4APV A;  1OXU A;  4WJW A;  3STB D;  1LYL A;  4DGZ A;  3S1Q H;  3EIV A;  1EY5 A;  4DAY A;  4DR7 L;  1CTM A;  2Z6K C;  1F2Z A;  2B2V C;  1V8Q A;  1G2S A;  2B29 A;  4FYD A;  1PA6 A;  1B53 A;  1EQT A;  3OYY A;  4A3G H;  4MIU A;  2DY7 A;  4A3F H;  4LUV A;  1CM9 A;  3PO2 G;  3X3M A;  4DUY Q;  3RZO H;  2VB2 X;  3A5U A;  3GTG H;  4WOR A;  1EY7 A;  5FO8 B;  4FXD A;  3TDQ A;  3PIO 3;  1Y8N B;  3CW2 C;  3FDT A;  4MNO A;  3HOV H;  2Q8I B;  1HNW Q;  4X62 Q;  4LFC L;  3QG1 A;  1L1O C;  4JBM A;  1FJG Q;  1WJJ A;  2CWA A;  3SXH A;  4G57 A;  2VUM H;  3PUX A;  3PQI A;  4KMU C;  2F52 A;  2GVB A;  3T53 B;  1VQF A;  1EEF D;  1S5B D;  4Q5V A;  1A15 A;  3OIP A;  2JA6 G;  1KDC A;  1TY0 A;  2NB0 A;  1PHJ A;  5IGD A;  3CD6 A;  4B3T L;  3HG9 A;  3OW7 A;  4FP5 D;  2X6L A;  1QVF A;  2A19 A;  1BVS A;  1C48 A;  2BCO A;  3Q8D A;  1HH2 P;  3NHH A;  4HTH A;  2OXP A;  3G7L A;  1I3Q B;  4C2M B;  4JW0 A;  5IYC G;  1CSP A;  4DV6 L;  4A3K G;  2NVX H;  2BOS A;  4EQO A;  5CV8 A;  4A3J H;  1PH7 A;  2CFM A;  1R4P B;  1MJE A;  2WB1 G;  1BCP B;  2ZXP A;  4OX9 L;  4QIW B;  1DOM A;  4C1N K;  1PYW D;  4B3S Q;  2J7Z A;  4HIO A;  1GUS A;  1STE A;  4OWT B;  5M5W B;  1LAC A;  5C5L A;  3DMU A;  1BXT A;  2H5X A;  1N34 Q;  1T5X D;  1Y1V G;  2A6E C;  2JYO A;  1Y69 U;  4YWL A;  3A8K E;  3FKI B;  3BZK A;  4CJ0 B;  1D5X C;  2PMZ B;  1QWY A;  3TME A;  4K8J A;  5FJ8 G;  1YJW A;  2F1M A;  2BH8 A;  1VQG A;  2UUC L;  4YCU A;  4GNX A;  5FOB B;  3ULL A;  3M4O B;  1EEI D;  4K5W A;  1HZB A;  1EIY B;  5JPM C;  2R7F A;  1LUZ A;  2VQF Q;  5BN4 A;  4A3F G;  4C3H H;  5ISR A;  3T1Y Q;  2RSN A;  4NPS A;  1U4R A;  3CRL C;  1PH6 A;  5JPN C;  1C0A A;  3TRE A;  3MFY A;  3AEV A;  3BVG A;  4POF A;  4A3L H;  1A2U A;  1MJC A;  2EYO A;  1WTQ A;  4DR2 L;  2YU9 H;  3I4M B;  2NUC A;  4N9T A;  1QUQ A;  1BUV T;  2JXM B;  2VW9 A;  5LL6 S;  4K5V A;  1QZG A;  3HOV G;  3CCQ A;  2AUJ D;  3NTI A;  5AFW A;  4BBS B;  1U4P A;  3DWA A;  3S2H B;  4X65 L;  5GRO A;  1CQV A;  4UY8 C;  2B2T C;  5COR A;  3NQI A;  2WB1 E;  1JWM D;  4DR5 Q;  2BA1 A;  2VUM G;  3HZX A;  5E1F A;  4JI3 L;  3MEH A;  1IYJ B;  3I56 A;  4YY3 Q;  2JA7 G;  5ELF A;  3OTO L;  2KHJ A;  2NN6 H;  1VQC A;  2RDG A;  4R4T A;  4JYA Q;  1E1O A;  4OWW B;  3ONA B;  3OIQ A;  1BCP F;  1FR3 A;  4YIJ A;  4X66 Q;  2Y0S B;  2N78 A;  1CI3 M;  1HZC A;  4P75 A;  1PH9 A;  5AJ3 L;  4H0L C;  2A68 C;  1HNX Q;  4ABN A;  1XMO Q;  3DM3 A;  1CHP D;  4JI6 L;  4YWK A;  2NZ1 D;  4B3M Q;  3UDX A;  2Z4I A;  1WTO A;  3BJU A;  5EPL A;  4Q0F A;  4GLX A;  4DR4 L;  1XMQ Q;  3I90 A;  4MZ9 A;  2ATW A;  1N36 Q;  1B50 A;  1B70 B;  1YJ9 A;  3GTK B;  5DEH A;  1PFS A;  1S72 A;  4JK1 C;  1O7I A;  3S1M H;  3GO5 A;  1UWV A;  2FJ2 A;  4A3M G;  1EIF A;  2PO4 A;  3G71 A;  4U68 A;  3WWV A;  1WTP A;  5JEA H;  2D2C C;  3C46 A;  1EYG A;  1Y1W G;  4K0K L;  5IP7 H;  2WAC A;  2IWH A;  2EY1 A;  5IWA L;  1I3Q H;  2PZT A;  4L63 B;  3U9O A;  2DY8 A;  5EPJ A;  3U4Z A;  4C2M H;  3IL8 A;  4RCN A;  3VYU A;  2VS1 A;  2DN8 A;  3CAM A;  2IT1 A;  4RKB A;  1TY2 A;  3I2Z A;  4JI8 Q;  1EY4 A;  1UE6 A;  5CV6 A;  2ICE C;  4X6A H;  2KOL A;  2R7Z B;  1G51 A;  5M5X B;  3AFQ A;  1R4Q B;  4L5S A;  1Z9F A;  3PUV A;  1CT1 D;  4KJO A;  4EQ5 A;  2F4V Q;  2VB3 X;  3FKI H;  5C3X A;  4A3I G;  2UUA Q;  4V19 0;  1TS2 A;  4R8N A;  1L0W A;  3T4A C;  1NMG A;  2N55 A;  3TQY A;  1SMY D;  2BE5 D;  5DAU A;  2A69 D;  3HRZ C;  2K1B A;  3TP7 A;  3UDG A;  2HT1 A;  4K6D A;  1S5D D;  1KL9 A;  4DUZ L;  5JJZ A;  4JI7 L;  3M4O H;  1SYE A;  4NXN Q;  3K0Y A;  2O4X A;  2HHH Q;  1EYA A;  1SN8 A;  3MFG A;  2SOB A;  4GLV B;  2KUM A;  1GVP A;  3M7G A;  3N52 A;  4LWC A;  4L5Q A;  1ZKO A;  1K73 C;  1PZJ D;  4N9P A;  5IP9 H;  2ID0 A;  5DM6 3;  2NN6 G;  4X3S A;  2SDF A;  3W2D A;  1NY4 A;  3CC4 A;  3I4M H;  4LF5 Q;  4BA2 I;  3KF6 B;  2F0K A;  1PYS B;  1WYD A;  3K58 A;  4I65 A;  4JCV E;  3D6C A;  3HOY B;  4HR7 B;  5LMU Q;  1W3S A;  2F3W A;  3I72 A;  4OWX B;  4BBS H;  2A5H A;  3S2H H;  4GS3 A;  1HFN A;  1SYC A;  2K5Q A;  5IYD H;  3SGI A;  4A93 G;  4A76 A;  4ME5 A;  2NBF A;  1JJ2 A;  1TR5 A;  1AEX A;  4AIM A;  1SFO B;  2NVY B;  1LTG D;  1I4Q A;  1VMP A;  1JE4 A;  1VQ4 A;  2UUB L;  2A1A A;  1PRT B;  2ZM6 Q;  2GN5 A;  3NE5 B;  3E9I A;  4X64 L;  1ET6 A;  3AMU A;  3KFU A;  4HJA A;  4OGQ C;  4CJ1 B;  3KLW A;  1NE3 A;  1ROD A;  3GV6 A;  2F0J A;  3TP5 A;  2JA8 G;  4IJL A;  3QIA A;  2MQH A;  5CV5 A;  5IP7 G;  1DYQ A;  2K5V A;  4GOP A;  3MA2 B;  4YHH L;  1LAB A;  3NXW A;  1D1I A;  3PIP A;  1HTP A;  1BCP D;  1JE5 A;  1PH5 A;  4HMI A;  2WB1 B;  1O78 A;  4M8A A;  4JI4 L;  4K8I A;  4IPD A;  5HGQ A;  1TVX A;  1GD7 A;  1YNN C;  1SE4 A;  5BR8 Q;  1JJG A;  3U58 A;  4LUO A;  3CP0 A;  1UNS A;  1QJO A;  4R1J A;  3GTK H;  2E8G A;  1A63 A;  2QEJ C;  1CA5 A;  1XYI A;  1Y1V B;  4JBW A;  3UDF A;  1NBW A;  3FKI G;  5A2Q E;  1Q7Y C;  2JSO A;  3R8B A;  2F0W A;  1LTL A;  1F9R A;  2WAQ E;  4X3U A;  5FO9 B;  4ZAI A;  2WP8 J;  3TBI B;  2IX3 A;  4IFD J;  4KN7 C;  4O1N A;  2QEX A;  1VMC A;  1XX8 A;  3RNU A;  4L5R C;  3AU7 A;  2RHQ B;  3A8J E;  1LTA D;  1V1P B;  4DAP A;  4AQY Q;  2RF4 A;  4JC0 A;  2R7Z H;  2K32 A;  5M5X H;  1BO0 A;  3AFP A;  3I3C A;  5A2Q L;  4FF3 A;  2QW7 A;  3PIP 3;  1KNA A;  2VQE L;  4RHR A;  3DEP A;  2B2Y A;  4DV4 L;  2YV5 A;  3RZO B;  2B2U C;  2UU9 L;  3J7A V;  1X3G A;  4P72 A;  1WD1 A;  4HSP A;  3I4M G;  2F0I A;  3K7U C;  3W1B A;  1TII D;  4LAA A;  2WFW A;  4HIM A;  1YHB A;  1QVG A;  1PFM A;  1BBW A;  1HPC A;  5A35 A;  2MUY A;  2ICI A;  4BBS G;  5IGF A;  1GUO A;  3NSW A;  5IYD G;  5C6A A;  2AQ1 B;  3IFD A;  5T1G A;  2A8V A;  2O5I C;  3I4O A;  4TSS A;  1CZW A;  1SNO A;  3ITP A;  1IL2 A;  2RDF A;  1PH1 A;  4L5T A;  4BXX G;  1E3P A;  5LL6 X;  2XWB B;  1K83 B;  5IOC A;  2GA4 B;  2B2W A;  1AW7 A;  2JA7 B;  5JJL A;  4FF1 A;  3E9H A;  3LWU A;  4HJ8 A;  1SRU A;  1FYC A;  3D6W A;  3A0J A;  1Q1E A;  1SNQ A;  2ZXR A;  1KHI A;  4KY7 A;  1PTO B;  3ERQ A;  3TN2 A;  3SK8 A;  3UDI A;  3SEB A;  2ZJQ A;  1L1O B;  1WTW A;  2CHB D;  4XTC S;  3HOY H;  3MXP A;  2Y0S G;  2DGY A;  1YNJ D;  2FMM A;  4JI1 L;  2KEE A;  1HNW L;  1I5F A;  2BH2 A;  2K5N A;  2BDN A;  3T16 A;  4IOC A;  1M1K C;  3OHX C;  4ZLT F;  4OXP A;  5BN3 A;  3U4V A;  1FJG L;  3CMA A;  1SFO H;  2NVY H;  1QZH A;  5I4D A;  2PI2 A;  4LF8 Q;  2OQK A;  1OXT A;  1FNU A;  4PNY A;  3RR5 A;  2CH4 A;  4PZ8 A;  4J6H A;  1PFN A;  1SYF A;  3KF6 A;  2RVL A;  3M85 A;  2YTY A;  1OO9 B;  2XRQ D;  3VR6 A;  1BDO A;  4A3M B;  3VYT A;  3MZ5 A;  2ZJR A;  1Y1W B;  5K5P A;  1TKW B;  2CQO A;  3DHQ A;  1B1Z A;  4TVA B;  2NVT B;  2QA4 A;  4CDC C;  1NCV A;  5LMN W;  1HA5 A;  3M3Y B;  4DV5 Q;  1FNV A;  2IJ0 A;  1RDP D;  3BG3 A;  1PFB A;  2WKD A;  2MNA A;  3RLF A;  3HOX G;  2FMC A;  2TSS A;  1WTH A;  4TKO B;  2P5Z X;  4A4I A;  3K5N A;  1NR4 A;  3CCE A;  1WTX A;  4B3S L;  3QWN A;  3K7A B;  4JI5 Q;  3L2P A;  1ZYR D;  1S4Z A;  1Y1V H;  1ILP A;  3FRP B;  1ZEQ X;  1IYV A;  3GP7 A;  5J39 A;  4A3I B;  1N34 L;  3BDL A;  3G6J B;  1KDB A;  3RMH A;  1QB5 D;  2G9H D;  2HD3 A;  1K8O A;  1NTG A;  2XRS D;  2YU9 B;  4KKT A;  1YHA A;  3HOW B;  3BDC A;  1UAP A;  5FJ8 H;  3OSO A;  1IL8 A;  4I7A A;  4PG3 A;  2MO1 A;  1STN A;  4ODG A;  4XDX A;  1EYD A;  2L12 A;  5ELN A;  2J0T D;  4DKA C;  3PUY A;  5JAV A;  2PNR C;  5IT9 E;  2FHT A;  1JWS D;  4IOA A;  2HQL A;  2FIN B;  3NK9 A;  3VR2 A;  2VQF L;  4OHJ A;  2IY5 B;  2ZTD A;  1Q12 A;  3P7J A;  1PV4 A;  1P8L A;  3T1Y L;  3G48 A;  4POG A;  1BBU A;  5HUR A;  5IGB A;  2ENB A;  4ID6 A;  1EY0 A;  4ZKC B;  1EWH A;  4KJN A;  1II3 A;  5HY6 A;  1PTO C;  1QOH A;  2WAQ B;  5C3W A;  4WFN 3;  1DGS A;  1MI2 A;  2WV6 D;  1RTO A;  5M3M G;  3HOY G;  3J7A F;  5IT9 L;  1Z6H A;  1D6E C;  2LY7 A;  1PMR A;  1MKH A;  4DV7 Q;  4A93 B;  3I7F A;  4N8F A;  2EYH A;  3SVM A;  1BR9 A;  5IYB G;  3C1F A;  4CJ2 C;  3NWT A;  1KRT A;  3KK7 A;  2F0E A;  5JEA J;  2OT2 A;  2QGQ A;  1IBL Q;  1PRT D;  5EKL A;  1CA6 A;  1YI2 A;  1K83 H;  1KNE A;  2JA7 H;  5CV4 A;  1P16 A;  4GN5 A;  4YY3 L;  2AKW B;  4Z9C B;  1PTO H;  1Y8O B;  2GVA A;  4R9W A;  4JYA L;  5COY A;  5I9P A;  3S1M B;  4S3S A;  3R93 A;  3VYS A;  2Z9H A;  1XPO A;  3ULP A;  1S3O A;  2B2V A;  4ME3 A;  2JA8 B;  4X66 L;  2R92 G;  1EIH A;  3CME A;  1EL0 A;  3NQT A;  4EQP A;  3J81 i;  3UI2 A;  1ILQ A;  1HNX L;  4LW1 A;  1XMO L;  1X56 A;  1XXG A;  1IW7 C;  1EUJ A;  4MHE A;  1J5E Q;  3VDY A;  4B3M L;  4HED A;  2C5C A;  2ASB A;  1N32 Q;  4IUP A;  1Q81 C;  1T5E A;  3HOU G;  1G8Z D;  4FDB A;  1XMQ L;  1EU3 A;  1H9S B;  1NUC A;  5C5M A;  3M4Q A;  1L1O A;  4RGM A;  4ZYS A;  3H94 A;  4L6T B;  4A3M H;  2VL6 A;  1H9J A;  4KY5 A;  1BQQ T;  3HKZ G;  2JK8 A;  3WOF A;  1Y1W H;  1YJN A;  4G7Z C;  4NDX A;  2NVT H;  2XNA C;  3KLS A;  3U9S A;  1VQI A;  1VQE A;  4G7H C;  3OPO A;  3T56 B;  4DR3 Q;  1GUN A;  4QGU A;  3HKS A;  3M3Y H;  3JAM c;  2PQE A;  2EJG C;  3OMC A;  1V1O A;  2JQO A;  4JI8 L;  2KQ3 A;  1STG A;  1DON A;  2WIN B;  1SNM A;  3KYH C;  1DCZ A;  5KGU A;  4V0B A;  1IHZ A;  1H9M A;  3VR5 A;  3K7A H;  1SMX A;  2E2D C;  1I4R A;  1PZK D;  2B3G A;  4I7Z C;  2UXD L;  4A3I H;  3QOL A;  3FEW X;  2F4V L;  1W6K A;  2F4I A;  1JC7 A;  1B8A A;  2I5L X;  3KJO A;  4DAV A;  1VQ9 A;  1LTT D;  4CKE A;  2K7V A;  5D14 A;  3VR4 A;  2UUA L;  3TRZ A;  4PMC A;  3HOW H;  3I4N G;  1MSH A;  3P75 A;  3V2T A;  4EX5 A;  1GOZ A;  4Y7N B;  4ZQ3 A;  1UUP A;  2L11 A;  4RA8 A;  3P20 A;  1GJX A;  1EY8 A;  1CKN A;  1H9R A;  3R2I A;  1ZXT A;  2C9O A;  2HHH L;  1LTB D;  2KCM A;  3TZD A;  3QJY A;  4F7X A;  1HA6 A;  3NEL A;  1TS3 A;  3S1R B;  1PTO D;  3EA6 A;  1KRS A;  1LTR D;  4IPG A;  3CPW A;  4UP9 A;  1K8A C;  2HDM A;  1VF7 A;  2N3S A;  3HKZ E;  1B3Q A;  3DXJ C;  3E5S A;  5JVH 3;  3V05 A;  3UE1 A;  4LF5 L;  2VY3 A;  4K2K A;  4OL7 A;  1V9P A;  1TQO A;  2K03 A;  4DU9 A;  4K6L A;  4QUF A;  5LMU L;  1A3T A;  4A93 H;  1B3A A;  3VA7 A;  1NAP A;  2IW3 A;  4KK7 A;  4JI2 Q;  1EOT A;  4BY7 G;  1G6Z A;  2ZJP A;  3C2P A;  1Y14 B;  4JG2 A;  2L5T A;  1SJH D;  4DV3 Q;  3PF4 A;  2F0V A;  2R3Z A;  4XT1 B;  1UEB A;  4CDD C;  3T1H Q;  3MHB A;  3NEN A;  4J15 A;  1B7Y B;  2CW0 C;  3K57 A;  1EQR A;  2F0U A;  3FHW A;  4DPG A;  2UXC Q;  1LT6 D;  5CMD A;  1U0L A;  3S2D B;  2ZM6 L;  4ZKB B;  5GAG C;  1XTC D;  4A3B G;  2XN9 C;  2YTX A;  1SDF A;  3RD4 A;  2PQA B;  2M00 A;  2B2T A;  4ZUJ A;  5C0X G;  1LM0 A;  4OX9 Q;  2K5W A;  2JA8 H;  3KUP A;  1GKH A;  1SJE D;  3FP9 A;  3MXN B;  4B08 A;  1IW7 D;  2F0P A;  1BBX C;  3ICE A;  3WOE A;  1MSG A;  1B9M A;  1F2M A;  4NP5 A;  4FNF A;  5DNF A;  4LF6 Q;  1XPU A;  3BU2 A;  5KYI A;  1EY6 A;  4B3R Q;  1XWE A;  1GO3 E;  5L37 A;  1E0B A;  4ILW A;  2ALY B;  2A6E D;  5I9O A;  4JOI A;  5ELO A;  2A74 C;  2K4K A;  4GKK Q;  3HOX B;  4KHV A;  1SND A;  5BR8 L;  2PZU A;  4IUR A;  3SK6 A;  3M9B A;  3TZU A;  2N49 A;  1R9T B;  3BYT B;  1SBB B;  2PW5 A;  2F0M A;  5I2Y A;  2B63 G;  3F2C A;  1HFG A;  1BF4 A;  1EU4 A;  3S9W A;  4UAI A;  1M4V A;  1XNR Q;  1D1K A;  5FK9 C;  1VQK A;  1KDA A;  2EZV A;  4LFA Q;  3M4Y A;  1RIP A;  2XVS A;  3HOW G;  5C4X G;  2R7D A;  3KLS X;  1SEB D;  2IPK D;  5IGE A;  5JVG 3;  3MVV A;  1WTV A;  4BBR B;  4ZK9 B;  1RL2 A;  1SE3 A;  3AQQ A;  3F8T A;  3I8Z A;  2E5L Q;  4AQY L;  5CV9 A;  4IUQ A;  4AH6 A;  5I6Y A;  1EY9 A;  2PCF B;  1GHK A;  1DD2 A;  1GHJ A;  4CGY B;  4LMQ D;  1X65 A;  1HR0 Q;  3I91 A;  1ESF A;  2MHV A;  1S5F D;  4IZ8 A;  1K8M A;  1J8I A;  3CXC A;  1KLU D;  4IJH A;  2Z6B A;  1ONL A;  4OON A;  4P74 A;  5C4Z A;  4RH6 A;  2V1C C;  1QG7 A;  1RJT A;  1AE2 A;  1JOR A;  3CCL A;  2WAQ G;  5M3M B;  4Y7N H;  1IBM Q;  1O7Z A;  1CKM A;  2XTI A;  4KHZ A;  2JA5 B;  4DV2 Q;  4H44 C;  2AWO A;  3FMC A;  5FKA C;  1IYU A;  3UE0 A;  2HCI A;  5IE8 A;  1HUN A;  3H3V I;  1DM0 B;  2Z0S A;  2XSC A;  4XQQ A;  5JOB A;  1M90 C;  2NVQ B;  4BXX H;  2EY6 A;  2L0C A;  2CCZ A;  4FF4 A;  1I6H B;  2EPB A;  2EVB A;  3Q22 A;  3N6R A;  1LT4 D;  3S1R H;  2EYF A;  1VQ5 A;  4GKJ Q;  5GQO A;  1K9M C;  4ZRZ A;  2SEB D;  4KTA A;  2EJM A;  2A68 D;  4UPA A;  3HOZ B;  5LMN L;  4KHP L;  5EBC A;  2R92 B;  2JJQ A;  1C7Y A;  1PYB A;  3HP3 A;  2CW0 D;  3K8A A;  5H1S E;  4RWS C;  4BY1 G;  3TS2 A;  3MEF A;  4B9X A;  3PMF A;  4FXG C;  3GTO H;  5FLX c;  2XWJ B;  1TXY A;  3CCR A;  5M5Y B;  3BYY B;  1QE6 A;  4LJZ C;  2E76 C;  5FO7 B;  3AB9 A;  4H13 C;  2CKZ B;  3TS0 A;  4LF8 L;  3HOU B;  1K3R A;  1VQL A;  5J22 A;  3S2D H;  3CKI B;  1RKN A;  4XQN A;  4A3C G;  1X3E A;  2QF7 A;  4HN7 A;  1ICW A;  4RGO S;  1SRO A;  2VNU D;  4DV0 Q;  4IFD I;  4KKS A;  2ZXO A;  1YHQ A;  1YIJ A;  3HKZ B;  3SR1 A;  4G7O C;  1E2W A;  1K28 A;  1NNX A;  4LF9 L;  1FNW A;  3LWE A;  1HNZ Q;  2RCN A;  4IQZ A;  3J80 c;  3GQB A;  5E4W C;  2KCC A;  2NWG A;  1GUG A;  2RSO A;  4U67 3;  2NTS A;  4NW2 A;  1W2B A;  2E2I B;  2XIW A;  2RCF A;  5I2X A;  4DN4 M;  1S5C D;  2AUK A;  3FVQ A;  5E4X A;  4IUV A;  3KLR A;  5GAD C;  3G6E A;  1KAW A;  3CRK C;  4R4O A;  1N8R C;  2Q2H A;  4DV5 L;  3VR3 A;  2OWO A;  1CK1 A;  3HOX H;  4RG1 A;  1PH8 A;  4IPH A;  3SK4 A;  1VQB A;  3A8I E;  4UDU C;  2PQA A;  5IGC A;  3IAY A;  2G9D A;  1R9T H;  3W1G A;  2OTL A;  1WOC A;  1AFP A;  4JI5 L;  2OEO A;  1L2F A;  3BZC A;  1CZG A;  4DFA A;  1AH9 A;  4JI7 Q;  5IY0 A;  3GTL B;  4WJ4 A;  1KIX A;  3GTQ B;  3I4N B;  1PRT F;  1JWU D;  2IHF A;  1Q82 C;  1AP0 A;  4N8X 1;  5I6W A;  1EFW A;  1A6X A;  4BBR H;  5EJW A;  4RFB A;  4HIK A;  4DR1 L;  5C0X I;  5KYL A;  2L9H A;  5M9O A;  1LTS D;  2F0O A;  2B8G A;  4KV6 A;  4L8J A;  2LMC B;  2E2H B;  1QVC A;  1B9N A;  4HJ7 A;  2F0G A;  4DUY L;  3M4P A;  3T51 B;  2JP1 A;  5C3E G;  2EXZ A;  2F3V A;  4XYO A;  4R4I A;  3H0G B;  4WJ3 M;  1IBK Q;  2RDH A;  4O0A A;  1YBY A;  1LLR D;  3AYH B;  3DUZ A;  5IGG A;  3CPF A;  4QJF A;  5M3M H;  2JA5 H;  2KEC A;  4YCW A;  4DV1 Q;  4X62 L;  2KED A;  3NEM A;  1N33 Q;  4BY7 B;  3I4L A;  5IYB H;  1SSO A;  4DV7 L;  2K04 A;  1TWC B;  2UXB Q;  2NVQ H;  1I94 Q;  2B2U A;  4X3T A;  5D65 A;  1WVL A;  5J1Z A;  1XPR A;  3QB3 A;  5NUC A;  1ASY A;  1I6H H;  1VQH A;  4QY7 A;  1IBL L;  4HJ9 A;  1SYD A;  4RMF A;  4ULL A;  4M1U B;  4RCO A;  1C4Q A;  1X55 A;  1S40 A;  1WFQ A;  1JCK B;  2KCT A;  1X3F A;  1EWI A;  2KCN A;  5EBD A;  3J7A 5;  2MJ8 A;  4A3B B;  1SAP A;  1EOV A;  1A2T A;  1TU2 B;  3HOZ H;  4XYQ A;  2VZA A;  3D0F A;  3NP8 A;  1PH3 A;  4OIK A;  4HSV A;  2BA0 A;  3RLN A;  2R92 H;  4QF4 A;  1B44 D;  4HAE A;  2IL8 A;  5JJK A;  3H3V C;  3KBX A;  1MBY A;  1TWG H;  2V4D A;  2ZT9 C;  3L7Z C;  4GNX B;  1YZ6 A;  1YNN D;  4RHS A;  4BA1 I;  1K0S A;  3LX0 A;  5M5Y H;  3PO3 B;  4JVZ A;  3S16 B;  1EIG A;  2E75 C;  3DLL A;  4AYB E;  3HOU H;  1HXY D;  1J5E L;  1JOK A;  1VQM A;  3GTP B;  2KJX A;  3K5M A;  1N32 L;  1QNU A;  5M3F B;  3S15 B;  3TSS A;  3E6Z X;  1F2L A;  3A7L A;  3H3V H;  2B63 B;  3QO2 A;  1UE1 A;  4DNT B;  4G4K A;  1I4G A;  1A8V A;  1VQ7 A;  1STY A;  1YVC A;  1M8A A;  1FD7 D;  3W5O A;  1DXM A;  1Q90 A;  2R6G A;  3PV0 A;  1IZ6 A;  4DXF A;  2RA4 A;  1XNQ Q;  3F1Z A;  4ZUI A;  3NTK A;  2CQA A;  3ULJ A;  5C4X B;  4PV1 C;  2G5D A;  2E2I H;  4PMW A;  5DM7 3;  4DV4 Q;  1PTO F;  4JI0 Q;  4BBR G;  4J1M A;  4DR3 L;  1RHP A;  3MTS A;  1JIC A;  2HIV A;  1RTN A;  1Q1B A;  1ASZ A;  5ELB A;  3HFZ B;  4DR6 Q;  4LFB Q;  1STH A;  3H15 A;  4DR4 Q;  5ELD A;  4DXG A;  3OOC A;  3S17 B;  3K6O A;  1ENC A;  4KKU A;  3H6M A;  3GTL H;  1ICF B;  2SNS A;  3GTQ H;  3I4N H;  1D8L A;  2D0O A;  2PPB C;  1L0Y B;  1E24 A;  1KAA A;  3J7Z C;  1V1P A;  1UEA B;  3D4R A;  2I07 B;  4OEM B;  4GZY C;  3BZD B;  4PMB A;  4IUN A;  2JA5 G;  4NXM Q;  3CQZ B;  3OWE B;  4IFD H;  3EJI A;  3CHB D;  1RF2 D;  4XIG S;  4DK3 C;  1LT5 D;  2HUG A;  2K5D A;  2EY5 A;  2Z8L A;  4KD4 A;  3WDN A;  1QCB D;  1LV9 A;  5FLM H;  4DR5 L;  2E2H H;  2L55 A;  2QIL A;  2F03 A;  4JI1 Q;  3LGJ A;  2IX1 A;  1S5E D;  1YEZ A;  2B8F A;  4CKB A;  3ND9 A;  1PDQ A;  1J9O A;  2Q2U A;  4QCL A;  3H0G H;  3IKJ A;  4A3D G;  4LK1 C;  2EJF C;  3HOZ G;  5CBE E;  1E7Z A;  1JQY D;  2KA7 A;  4R8I A;  2Z6K A;  1F9S A;  2CWP A;  1HUM A;  3CCJ A;  1GUW A;  4PQX A;  1TWA B;  5CR3 A;  1GXD C;  2QDL A;  4BY7 H;  4BY1 B;  1TWC H;  4O42 A;  4GN3 B;  3J81 E;  4JI2 L;  1WCM B;  2PZW A;  4GNX C;  4DV3 L;  3NBI A;  3D4W A;  2MGS A;  1L0X B;  1CKO A;  3T1H L;  1EWC A;  2F0D A;  5CC4 A;  3EN2 A;  1T9H A;  5E3F A;  4LF4 Q;  3HEJ A;  5C44 G;  4A3B H;  4MTK A;  2UXC L;  2L4N A;  1SNP A;  1N36 L;  3SE0 A;  2K05 A;  2F3I A;  5C0X H;  1A0I A;  3EVQ A;  3D3R A;  2KHS A;  1VDZ A;  2J4X A;  2KHI A;  1U4L A;  1JOQ A;  3J81 L;  3ERS X;  1IKL A;  4BWG B;  3DWP A;  4LF7 Q;  2EDG A;  4P71 A;  1Q46 A;  4WRD A;  3A5Z B;  1OXV A;  5J3B A;  2PI2 E;  3PO3 H;  4LF6 L;  3S16 H;  4EQN A;  1X54 A;  1HTL D;  1MD2 D;  3IRB A;  4B3R L;  5T1I A;  2AQ3 B;  2SNM A;  1U9R A;  3GTP H;  5F2D A;  1PZI D;  5M3F H;  3K80 C;  3S15 H;  3L3O C;  4UHV A;  4JV5 Q;  1Y8P B;  4GKK L;  3G4S A;  2EYM A;  3CC7 A;  3PUW A;  2B63 H;  3KF8 B;  2MO0 A;  1NJI C;  4DR7 Q;  2NYZ D;  1PVO A;  3GTJ B;  5KRU A;  3PGZ A;  3X3N A;  2DNE A;  3SK5 A;  1KLG D;  2LS0 1;  1QNK A;  5ELC A;  1XNR L;  5C4X H;  1I4H A;  1MIU A;  1HQM C;  1TWF H;  4P73 A;  1SMY C;  5EPK A;  4LFA L;  2BE5 C;  2JEA I;  3KDF B;  2R93 B;  1JB3 A;  2A69 C;  1HRJ A;  1Q3L A;  3F2B A;  4A3G G;  4OIJ A;  4C3I H;  4RAU C;  3MXU A;  2OQ0 A;  2FXQ A;  1F2Y A;  4ZCK A;  4IFD G;  2AMC B;  5KND A;  4YCV A;  2L15 A;  3Q0A A;  1VCI A;  3I73 A;  1C9O A;  3Q6S A;  4NXN L;  2E5L L;  1JT8 A;  4AYB B;  4A3E B;  2K75 A;  1G29 1;  3V96 A;  5FLM G;  2LKV A;  1HR0 L;  4QQB X;  4EGV A;  3Q23 A;  2XGT A;  1D7Q A;  3SDZ A;  4LFC Q;  3S17 H;  5KNB A;  1UE5 A;  1WTR A;  5C3E B;  2Q8R E;  1X3P A;  3B6Y A;  4FF2 A;  2QDB A;  4IO9 A;  3H0G G;  1X9N A;  1I50 B;  4IUU A;  4GOP B;  3URY A;  3L0O A;  1N9W A;  1HJP A;  4F87 A;  4TRD A;  2KEN A;  5EAY A;  5EKK A;  3CQZ H;  2E74 C;  4OO1 I;  1IBM L;  3HS0 C;  1XJV A;  1ESR A;  1EZ8 A;  3CC2 A;  4DV2 L;  2AQ2 B;  2MPM A;  4F8M A;  1HZA A;  1RCV D;  1BNZ A;  1G6P A;  4B3T Q;  3GTO B;  3NTH A;  1FVI A;  1VQN A;  1H95 A;  5GAH C;  3CCM A;  4JOI C;  2C35 B;  4RKL A;  1STA A;  3HGB A;  1VF5 C;  2F0Q A;  3BDO A;  1I4X A;  2VXW A;  4GKJ L;  2I5H A;  1JMC A;  4DA2 A;  3TEH B;  4DV6 Q;  5KNC A;  4C1N I;  4MN3 A;  4HMJ A;  3DEO A;  3ND8 A;  1Z47 A;  3NPP A;  4DNI A;  4A3J G;  4A75 A;  2LXK A;  3C3L A;  2AHO B;  3O13 A;  2K52 A;  1TWA H;  1STB A;  4KD3 A;  4C3J B;  1E2V A;  4BY1 H;  4X3K A;  2K50 A;  2PW7 A;  2DJF C;  1J6Q A;  1BCP C;  1WD0 A;  1WCM H;  2A6H C;  3K59 A;  1K0R A;  3PO3 G;  1OXS C;  1TS4 A;  4XT3 B;  1JR0 D;  4IPC A;  1D5Z C;  4A3C H;  3NBH B;  5M3F G;  4FO2 A;  5D3I B;  1DOL A;  3DWQ A;  5EKI A;  2EOT A;  1OXX K;  4R4C A;  3RUZ A;  3GDE A;  2DJG C;  2EYJ A;  4DV0 L;  1HHV A;  2UUC Q;  1RD9 D;  4R4Q A;  3JAM i;  2WII B;  3JAM E;  4TQU S;  1HNZ L;  3RLO A;  1I4P A;  5CYU A;  3PCO B;  1WI5 A;  1DJR D;  1VQO A; 
#chains in the Genus database with same CATH homology
 1TWH B;  1SYB A;  2I46 A;  2F0F A;  4C3I G;  5C4J B;  5CV7 A;  5C4H A;  2D9U A;  4C3H G;  5EGT A;  1EYC A;  1D2B A;  1CFM A;  1H9S A;  3QOJ A;  4FXK C;  2K33 A;  3SHL A;  2LFN A;  3L9A X;  3MC0 B;  4KI0 A;  4DNR B;  3NUC A;  1AZQ A;  2H4O A;  3JAM L;  4HCS A;  3RZD B;  2H1E A;  2D5D A;  2F0S A;  1TS5 A;  3R3O A;  1AN8 A;  1U4M A;  5CGK A;  1A3V A;  5KEE A;  2EE1 A;  5D3D A;  2Z4H A;  5LHY 1;  2MP1 A;  2CVR A;  4H7B A;  3PO2 B;  1DOK A;  1X32 A;  3MWY W;  4FVM A;  5TSS A;  1KTK A;  4BS9 A;  1W6J A;  1F77 A;  1KAB A;  3KF8 A;  3TP6 A;  3TP8 A;  3GTM B;  3ERO A;  2JE6 I;  2X69 A;  3S1N B;  4XXE A;  3A56 A;  1Z7T A;  2A73 B;  3J7Y W;  3Q24 A;  4A3D B;  1F9Q A;  1F9P A;  2M9V A;  5G3L F;  2F0H A;  1LO5 D;  3S14 B;  1AZP A;  4IN3 A;  4NKL A;  3IFT A;  1YNJ C;  2F0L A;  1X3Q A;  2DNC A;  4C56 C;  2E2J B;  2D62 A;  1TWG B;  2PYK A;  2JA6 B;  4RGN A;  3CU7 A;  4QB4 A;  1MGS A;  4XQJ A;  4K5X A;  3FPP A;  5IOD A;  4DK1 A;  5JEA G;  1GUT A;  1NSN S;  1SE2 A;  1JOO A;  4NMZ A;  2KVM A;  1O80 A;  5C44 B;  5K36 H;  1ET9 A;  2B2Y C;  3K5L A;  4E6I A;  3A7A B;  3R2T A;  4RGT A;  4A3K B;  2A6H D;  4K14 A;  1LT3 D;  3T13 A;  3MAQ A;  2HDL A;  3H09 A;  2RBM A;  3BS1 A;  3EQL C;  2HCC A;  1EZ6 A;  3K5O A;  2QCP X;  3KBG A;  2K6A A;  2YYZ A;  2NTT A;  2X6G A;  3I70 A;  1PLF A;  3A54 A;  2O5J C;  4F88 A;  4KN4 C;  4B9W A;  2B39 A;  1ZYR C;  4OO1 H;  2B2W C;  4CBV A;  3MXN A;  1CHQ D;  4J8Q A;  1SYG A;  3S1Q B;  3FPU B;  1O7L A;  4IUT A;  3VYR A;  3DM1 A;  4A3G B;  2BDO A;  4A3F B;  3VA5 A;  1B4O A;  3NBH A;  4CKC A;  2IX0 A;  4DK0 A;  3GTG B;  1H9K A;  2M2L A;  3E0J A;  1D5M C;  1E2Z A;  2L1B A;  3HOV B;  2WKC A;  3BVZ A;  3H91 A;  3C1E A;  3BVM A;  4EVO A;  2EY2 A;  1EQV A;  4P2C B;  2F0N A;  1O7Y A;  3OMG A;  2RQX A;  2R61 A;  2VUM B;  1G2T A;  1PXU A;  3F2U A;  2N88 A;  1EFI D;  5C0X J;  2Z1C A;  1Q8I A;  1PRT C;  1G91 A;  4QMG A;  3A55 A;  4KY6 A;  4HCE A;  1TT2 A;  5CBA E;  5IIF A;  4K2L A;  3M7N A;  1ML0 D;  3GD7 A;  5K36 G;  1SNC A;  3D31 A;  4CHT B;  1B2T A;  5ELE A;  2NVX B;  2HQE A;  4A3J B;  2K28 A;  5FLX E;  1LTI D;  4C3J G;  2O2L D;  3MXG A;  1NR2 A;  1C8C A;  5G3L D;  1IKM A;  2FFK B;  3EFX D;  1ENA A;  4IAL A;  5BN5 A;  1V43 A;  1HQR D;  4OO1 G;  5FLX L;  1QIL A;  3J80 E;  1I6V C;  1CQF A;  1BOS A;  5KIX A;  2NN6 I;  2K01 A;  3OWF A;  1DZ1 A;  2TMP A;  1SXT A;  1A3U A;  1ENF A;  1FGB D;  1TWF B;  2AWN A;  3D8G A;  2Q8T A;  4C3I B;  3D4D A;  4DF7 A;  5EQ0 A;  4C3H B;  2EYP A;  3J80 L;  4QUC A;  3NWS A;  3W3A A;  3GV3 A;  3ZYY X;  3P1H A;  2JEB I;  2QKI C;  1HCZ A;  2EYL A;  3LNN A;  5HGT A;  3PUZ A;  2OF1 A;  2F0T A;  2RKS A;  1OXU A;  4WJW A;  4DGZ A;  1EY5 A;  4DAY A;  1CTM A;  1F2Z A;  2B2V C;  1V8Q A;  1G2S A;  4FYD A;  1B53 A;  1EQT A;  4MIU A;  2DY7 A;  1CM9 A;  3X3M A;  2VB2 X;  4WOR A;  1EY7 A;  5FO8 B;  4FXD A;  3TDQ A;  3PIO 3;  1Y8N B;  3FDT A;  2Q8I B;  3QG1 A;  3SXH A;  4G57 A;  3PUX A;  4KMU C;  3T53 B;  1EEF D;  1S5B D;  4Q5V A;  1A15 A;  3OIP A;  1KDC A;  1TY0 A;  2NB0 A;  5IGD A;  3HG9 A;  3OW7 A;  4FP5 D;  2X6L A;  1C48 A;  2BCO A;  3NHH A;  4HTH A;  2OXP A;  3G7L A;  1I3Q B;  4C2M B;  4EQO A;  2BOS A;  5CV8 A;  1R4P B;  2ZXP A;  1BCP B;  4QIW B;  1DOM A;  4C1N K;  1PYW D;  2J7Z A;  1GUS A;  1STE A;  5M5W B;  1LAC A;  5C5L A;  3DMU A;  1BXT A;  1T5X D;  2A6E C;  2JYO A;  1Y69 U;  3A8K E;  3FKI B;  4CJ0 B;  1D5X C;  2PMZ B;  1QWY A;  3TME A;  4K8J A;  2F1M A;  5FOB B;  3M4O B;  1EEI D;  4K5W A;  5JPM C;  5BN4 A;  5ISR A;  2RSN A;  1U4R A;  3CRL C;  5JPN C;  3MFY A;  3BVG A;  1A2U A;  2EYO A;  1WTQ A;  3I4M B;  2NUC A;  4N9T A;  1BUV T;  2JXM B;  5LL6 S;  4K5V A;  2AUJ D;  3NTI A;  5AFW A;  4BBS B;  1U4P A;  3DWA A;  3S2H B;  1CQV A;  2B2T C;  5COR A;  3NQI A;  1JWM D;  2BA1 A;  3HZX A;  5E1F A;  3MEH A;  5ELF A;  2NN6 H;  2RDG A;  3ONA B;  3OIQ A;  1BCP F;  1FR3 A;  4YIJ A;  2Y0S B;  1CI3 M;  4H0L C;  2A68 C;  4ABN A;  1CHP D;  2NZ1 D;  2Z4I A;  1WTO A;  5EPL A;  4Q0F A;  3I90 A;  1B50 A;  3GTK B;  5DEH A;  4JK1 C;  3GO5 A;  2FJ2 A;  2PO4 A;  4U68 A;  1WTP A;  5JEA H;  2D2C C;  3C46 A;  2WAC A;  2IWH A;  2EY1 A;  2PZT A;  4L63 B;  3U9O A;  2DY8 A;  5EPJ A;  3IL8 A;  4RCN A;  3VYU A;  2DN8 A;  2IT1 A;  4RKB A;  1TY2 A;  1EY4 A;  5CV6 A;  2ICE C;  2KOL A;  2R7Z B;  5M5X B;  1R4Q B;  3PUV A;  1CT1 D;  4KJO A;  2VB3 X;  5C3X A;  4V19 0;  1TS2 A;  4R8N A;  3T4A C;  2N55 A;  1SMY D;  2BE5 D;  5DAU A;  2A69 D;  3HRZ C;  2K1B A;  3TP7 A;  4K6D A;  1S5D D;  5JJZ A;  1SYE A;  3K0Y A;  2O4X A;  1EYA A;  3MFG A;  2SOB A;  2KUM A;  3M7G A;  3N52 A;  1ZKO A;  1PZJ D;  4N9P A;  2ID0 A;  5DM6 3;  2NN6 G;  4X3S A;  2SDF A;  3W2D A;  4BA2 I;  2F0K A;  3K58 A;  4I65 A;  3HOY B;  3D6C A;  4HR7 B;  3I72 A;  2F3W A;  2A5H A;  1HFN A;  1SYC A;  2K5Q A;  4ME5 A;  2NBF A;  1TR5 A;  1AEX A;  1SFO B;  2NVY B;  1LTG D;  1I4Q A;  1VMP A;  1JE4 A;  1PRT B;  3NE5 B;  1ET6 A;  3AMU A;  4OGQ C;  4CJ1 B;  1ROD A;  3GV6 A;  2F0J A;  3TP5 A;  3QIA A;  5CV5 A;  1DYQ A;  3MA2 B;  1LAB A;  3NXW A;  1D1I A;  1HTP A;  1BCP D;  4HMI A;  2WB1 B;  1O78 A;  4M8A A;  4K8I A;  1TVX A;  1YNN C;  1SE4 A;  1UNS A;  1QJO A;  2QEJ C;  1CA5 A;  1XYI A;  1Y1V B;  4JBW A;  5A2Q E;  2JSO A;  3R8B A;  2F0W A;  1F9R A;  4X3U A;  5FO9 B;  4ZAI A;  2WP8 J;  3TBI B;  2IX3 A;  4IFD J;  4KN7 C;  4O1N A;  1VMC A;  1XX8 A;  3AU7 A;  3A8J E;  1LTA D;  1V1P B;  4DAP A;  2K32 A;  1BO0 A;  3I3C A;  5A2Q L;  4FF3 A;  3PIP 3;  1KNA A;  4RHR A;  3DEP A;  2B2Y A;  3RZO B;  2B2U C;  3J7A V;  1WD1 A;  4HSP A;  2F0I A;  1TII D;  4LAA A;  1PFM A;  1HPC A;  5A35 A;  2MUY A;  2ICI A;  5IGF A;  1GUO A;  3NSW A;  5C6A A;  2AQ1 B;  3IFD A;  5T1G A;  2O5I C;  4TSS A;  1CZW A;  1SNO A;  3ITP A;  2RDF A;  5LL6 X;  2XWB B;  1K83 B;  5IOC A;  2GA4 B;  2B2W A;  1AW7 A;  2JA7 B;  4FF1 A;  3LWU A;  1FYC A;  3D6W A;  1Q1E A;  1SNQ A;  2ZXR A;  4KY7 A;  1PTO B;  3ERQ A;  3TN2 A;  3SK8 A;  3SEB A;  1WTW A;  2CHB D;  4XTC S;  3MXP A;  1YNJ D;  2FMM A;  2KEE A;  3T16 A;  2BDN A;  3OHX C;  4ZLT F;  5BN3 A;  5I4D A;  1OXT A;  1FNU A;  4PNY A;  4J6H A;  1PFN A;  1SYF A;  3M85 A;  2RVL A;  1OO9 B;  2XRQ D;  3VR6 A;  1BDO A;  4A3M B;  3VYT A;  3MZ5 A;  1Y1W B;  5K5P A;  1TKW B;  3DHQ A;  1B1Z A;  2NVT B;  1NCV A;  1HA5 A;  3M3Y B;  1FNV A;  2IJ0 A;  1RDP D;  3BG3 A;  1PFB A;  2WKD A;  3RLF A;  2FMC A;  2TSS A;  1WTX A;  4TKO B;  3K5N A;  1NR4 A;  3QWN A;  3K7A B;  1ZYR D;  1S4Z A;  1ILP A;  3FRP B;  1ZEQ X;  1IYV A;  3GP7 A;  5J39 A;  4A3I B;  3BDL A;  3G6J B;  1KDB A;  3RMH A;  1QB5 D;  2G9H D;  1K8O A;  2XRS D;  2YU9 B;  4KKT A;  3HOW B;  3BDC A;  1UAP A;  3OSO A;  1IL8 A;  4ODG A;  1STN A;  4XDX A;  1EYD A;  2L12 A;  2J0T D;  3PUY A;  5JAV A;  2PNR C;  5IT9 E;  2FHT A;  1JWS D;  2FIN B;  3NK9 A;  3VR2 A;  4OHJ A;  1Q12 A;  3P7J A;  5HUR A;  5IGB A;  2ENB A;  4ID6 A;  1EY0 A;  4ZKC B;  1EWH A;  4KJN A;  1II3 A;  1PTO C;  1QOH A;  2WAQ B;  5C3W A;  4WFN 3;  1MI2 A;  2WV6 D;  1RTO A;  3J7A F;  5IT9 L;  1Z6H A;  1D6E C;  2LY7 A;  1PMR A;  4A93 B;  2EYH A;  3SVM A;  1BR9 A;  3C1F A;  4CJ2 C;  3NWT A;  5JEA J;  3KK7 A;  2F0E A;  2OT2 A;  1PRT D;  5EKL A;  1CA6 A;  1KNE A;  5CV4 A;  4Z9C B;  1PTO H;  1Y8O B;  4R9W A;  5COY A;  5I9P A;  3S1M B;  4S3S A;  3R93 A;  3VYS A;  2B2V A;  2JA8 B;  1EIH A;  1EL0 A;  3NQT A;  4EQP A;  3UI2 A;  1ILQ A;  1XXG A;  1IW7 C;  4MHE A;  4HED A;  2C5C A;  4IUP A;  1T5E A;  1G8Z D;  1EU3 A;  1H9S B;  1NUC A;  5C5M A;  4ZYS A;  4RGM A;  3H94 A;  4L6T B;  1H9J A;  4KY5 A;  1BQQ T;  3WOF A;  4G7Z C;  4NDX A;  2XNA C;  3KLS A;  3U9S A;  4G7H C;  3OPO A;  3T56 B;  1GUN A;  2PQE A;  2EJG C;  3OMC A;  1V1O A;  2KQ3 A;  1STG A;  1DON A;  2WIN B;  1SNM A;  1DCZ A;  5KGU A;  4V0B A;  1IHZ A;  1H9M A;  3VR5 A;  2E2D C;  1I4R A;  1PZK D;  4I7Z C;  3QOL A;  3FEW X;  1W6K A;  2F4I A;  1JC7 A;  4DAV A;  1LTT D;  4CKE A;  2K7V A;  5D14 A;  3VR4 A;  4PMC A;  1MSH A;  3P75 A;  3V2T A;  1GOZ A;  4Y7N B;  4ZQ3 A;  1UUP A;  2L11 A;  4RA8 A;  3P20 A;  1GJX A;  1EY8 A;  1H9R A;  3R2I A;  1ZXT A;  2C9O A;  1LTB D;  3TZD A;  3QJY A;  4F7X A;  1HA6 A;  1TS3 A;  3S1R B;  1PTO D;  3EA6 A;  1LTR D;  2HDM A;  1VF7 A;  3DXJ C;  3E5S A;  5JVH 3;  3V05 A;  4K2K A;  4OL7 A;  1TQO A;  2K03 A;  4DU9 A;  4K6L A;  4QUF A;  1A3T A;  1B3A A;  3VA7 A;  1NAP A;  2IW3 A;  4KK7 A;  1EOT A;  1G6Z A;  3C2P A;  2L5T A;  1SJH D;  2F0V A;  2R3Z A;  4XT1 B;  3MHB A;  2CW0 C;  3K57 A;  2F0U A;  1LT6 D;  5CMD A;  3S2D B;  4ZKB B;  1XTC D;  2XN9 C;  1SDF A;  3RD4 A;  2M00 A;  2B2T A;  4ZUJ A;  5C0X G;  2K5W A;  3KUP A;  1SJE D;  4B08 A;  1IW7 D;  2F0P A;  1BBX C;  3WOE A;  1MSG A;  1B9M A;  1F2M A;  4NP5 A;  4FNF A;  5DNF A;  5KYI A;  1EY6 A;  1XWE A;  1E0B A;  4ILW A;  2A6E D;  5I9O A;  2A74 C;  3HOX B;  4KHV A;  1SND A;  2PZU A;  4IUR A;  3SK6 A;  3TZU A;  1R9T B;  3BYT B;  1SBB B;  2PW5 A;  2F0M A;  5I2Y A;  1HFG A;  1BF4 A;  1EU4 A;  3S9W A;  4UAI A;  1M4V A;  1D1K A;  5FK9 C;  1KDA A;  2EZV A;  3M4Y A;  2XVS A;  3KLS X;  1SEB D;  2IPK D;  5IGE A;  5JVG 3;  3MVV A;  1WTV A;  4BBR B;  4ZK9 B;  1SE3 A;  3I8Z A;  5CV9 A;  4IUQ A;  5I6Y A;  1EY9 A;  2PCF B;  1GHK A;  1DD2 A;  1GHJ A;  4CGY B;  4LMQ D;  3I91 A;  1ESF A;  2MHV A;  1S5F D;  4IZ8 A;  1K8M A;  1J8I A;  1KLU D;  1ONL A;  5C4Z A;  4RH6 A;  1QG7 A;  1RJT A;  1JOR A;  5M3M B;  1O7Z A;  4KHZ A;  2JA5 B;  4H44 C;  2AWO A;  3FMC A;  5FKA C;  1IYU A;  2HCI A;  1HUN A;  1DM0 B;  2XSC A;  4XQQ A;  5JOB A;  2NVQ B;  2EY6 A;  2L0C A;  4FF4 A;  1I6H B;  2EPB A;  2EVB A;  3Q22 A;  3N6R A;  1LT4 D;  2EYF A;  4ZRZ A;  2SEB D;  4KTA A;  2EJM A;  2A68 D;  3HOZ B;  5EBC A;  2R92 B;  3HP3 A;  2CW0 D;  4RWS C;  4B9X A;  3PMF A;  4FXG C;  2XWJ B;  5M5Y B;  3BYY B;  1QE6 A;  4LJZ C;  2E76 C;  5FO7 B;  3AB9 A;  4H13 C;  3HOU B;  5J22 A;  3CKI B;  1RKN A;  4XQN A;  2QF7 A;  4HN7 A;  1ICW A;  4RGO S;  2VNU D;  4IFD I;  4KKS A;  2ZXO A;  3HKZ B;  3SR1 A;  4G7O C;  1E2W A;  1FNW A;  3LWE A;  4IQZ A;  3GQB A;  5E4W C;  2KCC A;  2NWG A;  1GUG A;  2RSO A;  4U67 3;  2NTS A;  4NW2 A;  2E2I B;  2XIW A;  5I2X A;  4DN4 M;  1S5C D;  2AUK A;  3FVQ A;  5E4X A;  4IUV A;  3KLR A;  3CRK C;  3VR3 A;  1CK1 A;  3SK4 A;  3A8I E;  4UDU C;  5IGC A;  3IAY A;  2G9D A;  1AFP A;  2OEO A;  1CZG A;  4DFA A;  3GTL B;  3GTQ B;  3I4N B;  1PRT F;  1JWU D;  1AP0 A;  5I6W A;  1A6X A;  5EJW A;  4RFB A;  5C0X I;  5KYL A;  2L9H A;  5M9O A;  1LTS D;  2F0O A;  2B8G A;  4KV6 A;  4L8J A;  2LMC B;  2E2H B;  1B9N A;  2F0G A;  3T51 B;  2JP1 A;  2EXZ A;  2F3V A;  4XYO A;  3H0G B;  2RDH A;  1LLR D;  3DUZ A;  5IGG A;  2KEC A;  2KED A;  4BY7 B;  3I4L A;  1SSO A;  2K04 A;  1TWC B;  2B2U A;  4X3T A;  5D65 A;  1WVL A;  5J1Z A;  3QB3 A;  5NUC A;  1SYD A;  4ULL A;  4M1U B;  4RCO A;  1C4Q A;  1JCK B;  2KCN A;  5EBD A;  2MJ8 A;  4A3B B;  1SAP A;  1A2T A;  1TU2 B;  4XYQ A;  3NP8 A;  4OIK A;  4HSV A;  2BA0 A;  4QF4 A;  1B44 D;  4HAE A;  2IL8 A;  3H3V C;  1MBY A;  2V4D A;  2ZT9 C;  3KBX A;  3L7Z C;  1YNN D;  4RHS A;  4BA1 I;  3LX0 A;  3PO3 B;  3S16 B;  1EIG A;  2E75 C;  1HXY D;  1JOK A;  3GTP B;  2KJX A;  3K5M A;  1QNU A;  5M3F B;  3S15 B;  3TSS A;  3E6Z X;  1F2L A;  3A7L A;  2B63 B;  3QO2 A;  4DNT B;  4G4K A;  1I4G A;  1STY A;  1M8A A;  1FD7 D;  1DXM A;  1Q90 A;  2R6G A;  3PV0 A;  4DXF A;  2RA4 A;  4ZUI A;  3NTK A;  2CQA A;  5C4X B;  4PV1 C;  4PMW A;  5DM7 3;  1PTO F;  4J1M A;  1RHP A;  3MTS A;  1JIC A;  1RTN A;  1Q1B A;  5ELB A;  1STH A;  5ELD A;  4DXG A;  3OOC A;  3S17 B;  3K6O A;  1ENC A;  4KKU A;  3H6M A;  2SNS A;  2PPB C;  1L0Y B;  1KAA A;  1V1P A;  1UEA B;  3D4R A;  2I07 B;  4GZY C;  3BZD B;  4PMB A;  4IUN A;  3CQZ B;  3OWE B;  4IFD H;  3EJI A;  3CHB D;  1RF2 D;  4XIG S;  1LT5 D;  2HUG A;  2K5D A;  2EY5 A;  2Z8L A;  4KD4 A;  3WDN A;  1QCB D;  1LV9 A;  2L55 A;  2QIL A;  2F03 A;  2IX1 A;  1S5E D;  2B8F A;  4CKB A;  3ND9 A;  1PDQ A;  1J9O A;  4QCL A;  3IKJ A;  4LK1 C;  2EJF C;  5CBE E;  2KA7 A;  1JQY D;  4R8I A;  1F9S A;  1HUM A;  1GUW A;  4PQX A;  1TWA B;  5CR3 A;  1GXD C;  4BY1 B;  4O42 A;  3J81 E;  1WCM B;  2PZW A;  3NBI A;  3D4W A;  2MGS A;  1L0X B;  1EWC A;  2F0D A;  5CC4 A;  5E3F A;  3HEJ A;  2L4N A;  1SNP A;  3SE0 A;  2K05 A;  5C0X H;  3EVQ A;  3D3R A;  2KHS A;  1VDZ A;  2J4X A;  1U4L A;  1JOQ A;  3J81 L;  1IKL A;  4BWG B;  3DWP A;  2EDG A;  4WRD A;  1OXV A;  4EQN A;  1HTL D;  1MD2 D;  5T1I A;  2AQ3 B;  2SNM A;  1U9R A;  5F2D A;  1PZI D;  3L3O C;  1Y8P B;  2EYM A;  3PUW A;  2NYZ D;  3GTJ B;  5KRU A;  3X3N A;  2DNE A;  3SK5 A;  1KLG D;  2LS0 1;  1QNK A;  5ELC A;  1I4H A;  1HQM C;  1SMY C;  5EPK A;  2R93 B;  2BE5 C;  2JEA I;  1JB3 A;  2A69 C;  1HRJ A;  1Q3L A;  4OIJ A;  4RAU C;  3MXU A;  1F2Y A;  4IFD G;  5KND A;  3Q0A A;  1VCI A;  3I73 A;  3Q6S A;  4AYB B;  4A3E B;  1G29 1;  3V96 A;  2LKV A;  4EGV A;  3Q23 A;  3SDZ A;  5KNB A;  1WTR A;  5C3E B;  2Q8R E;  1X3P A;  4FF2 A;  2QDB A;  1I50 B;  4IUU A;  3URY A;  4F87 A;  4TRD A;  5EKK A;  2E74 C;  4OO1 I;  3HS0 C;  1ESR A;  1EZ8 A;  2AQ2 B;  2MPM A;  4F8M A;  1RCV D;  1BNZ A;  3GTO B;  3NTH A;  4RKL A;  1STA A;  3HGB A;  1VF5 C;  2F0Q A;  3BDO A;  1I4X A;  2VXW A;  4DA2 A;  5KNC A;  4C1N I;  4MN3 A;  4HMJ A;  3DEO A;  3ND8 A;  1Z47 A;  3NPP A;  3C3L A;  3O13 A;  1STB A;  4KD3 A;  4C3J B;  1E2V A;  4X3K A;  2PW7 A;  1BCP C;  1WD0 A;  2A6H C;  3K59 A;  1OXS C;  1TS4 A;  4XT3 B;  1JR0 D;  1D5Z C;  4FO2 A;  5D3I B;  1DOL A;  3DWQ A;  5EKI A;  2EOT A;  1OXX K;  3RUZ A;  2EYJ A;  1HHV A;  1RD9 D;  2WII B;  3JAM E;  4TQU S;  1I4P A;  5CYU A;  1DJR D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...