5J1ZA

Crystal structure of staphylococcal nuclease variant delta+phs a90d at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLDYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS A90D at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5j1zA00
3TMEA 5C3WA 4MIUA 4KD4A 4K8JA 1SYEA 3EVQA 4DGZA 5M9OA 1EY0A 5J22A 2KQ3A 3SHLA 2F0UA 3H6MA 2EYLA 2F0QA 3EROA 1SNOA 4PMCA 1STBA 3C1FA 3PMFA 4ME5A 4NKLA 5J39A 3HZXA 2PZUA 5CV5A 3DHQA 1STGA 2EYOA 4G57A 5IGFA 1A2UA 3V2TA 5KGUA 2F0VA 2M00A 1SNPA 3OMGA 4HMIA 3SXHA 1SYBA 2RBMA 1JOOA 3P1HA 1STNA 2EXZA 4DU9A 4I65A 4K2LA 3D4DA 4B9WA 3SK6A 1EY5A 1II3A 4R8NA 2RDFA 1KDCA 3QB3A 4EQPA 4HMJA 1JOQA 4OL7A 4QF4A 5DEHA 5IGEA 5IODA 5EKLA 2F0MA 1EQVA 5CV4A 1EY4A 2O4XA 2EYJA 3T13A 1EYAA 4E6IA 5EKKA 4KD3A 4F7XA 4NDXA 5KYLA 2F0PA 5CR3A 4K8IA 4PMBA 4ZUJA 4KJOA 2EY5A 4KTAA 5EGTA 4IUNA 1F2YA 2SNMA 4EVOA 5HURA 3OWFA 5CV7A 5E1FA 2OXPA 3SK4A 4DFAA 3P75A 3NUCA 3SK8A 4ID6A 2F0TA 2PW7A 2PZWA 3TP7A 5KEEA 1ENCA 2NUCA 1U9RA 1NUCA 2F0GA 2EY1A 4K5WA 3T16A 4LAAA 3EJIA 3OSOA 5IGDA 1A3TA 2PW5A 4KY6A 1KDAA 5I6YA 1SYFA 2F0KA 4N9TA 3OMCA 2F0SA 1TR5A 1SYGA 1EYDA 2EYHA 4K14A 4NP5A 3VA5A 4KJNA 1JOKA 3NP8A 3NXWA 4B9XA 5DAUA 3TP8A 5IGCA 1A3VA 2OEOA 3TP5A 5KRUA 5IGGA 3HEJA 5J1ZA 3SK5A 4DF7A 5ISRA 2EYFA 4F8MA 5JAVA 4KV6A 2QDBA 5CV6A 3TP6A 2EYMA 3R3OA 4EQOA 1F2MA 1EY6A 1TT2A 2EY2A 1RKNA 4N9PA 5C6AA 1IHZA 1A2TA 3D6CA 3QOLA 2F0DA 1SNQA 4K5XA 4ZQ3A 4RKBA 4ODGA 2HQEA 3MXPA 5C5LA 2EY6A 4QB4A 1EYCA 5CC4A 5CV8A 3DMUA 1ENAA 1AEXA 3NQTA 2ENBA 4QMGA 3RUZA 3C1EA 4IALA 5CGKA 5F2DA 1A3UA 1TQOA 4J6HA 5I9PA 2PZTA 3MEHA 5CV9A 4K5VA 2F3VA 2SNSA 1F2ZA 2F0OA 2OF1A 5JOBA 2F0NA 1SYDA 1EZ6A 5KYIA 5IIFA 1SNCA 5E3FA 5NUCA 3U9OA 4HTHA 4WRDA 3E5SA 4YIJA 4K6DA 2EYPA 4S3SA 1STYA 1EY7A 2F0FA 3BDCA 4KHVA 1KDBA 2F3WA 5I9OA 1EY9A 1EY8A 1SYCA 5KIXA 3LX0A 3NHHA 2F0WA 5C3XA 4NMZA 1STHA 4KY7A 3MZ5A 2F0EA 5C5MA 5IOCA 1SNMA 5K5PA 1JORA 4ZUIA 4KY5A 5IGBA 2SOBA 2WACA 3NK9A 5C4ZA 1KAAA 2PQEA 3D4WA 5I6WA 1SNDA 2F0HA 2F0LA 3MHBA 4IZ8A 3D8GA 3MVVA 4RKLA 3BDLA 5HGTA 2PYKA 1EZ8A 1KABA 3QOJA 3ITPA 4TRDA 2F0JA 2LKVA 4H7BA 4WORA 4J1MA 4PNYA 5C4HA 3S9WA 3ERQA 4K2KA 2F0IA 2RKSA 1STAA 3SR1A 4EQNA 1NSNS 2KHSA
chains in the Genus database with same CATH superfamily
1EU3A 3TMEA 1QWYA 5G3LF 4JI7L 4DV7Q 1IKMA 4GLVB 2WINB 1IBLQ 4BBRB 3J7AV 5FOBB 1CK1A 4I7AA 1ICFB 5FJ8G 2VUMH 1U5KA 2I0QA 2B63H 4HIKA 3RLFA 1PYSB 4PZ6A 2HDLA 3CU7A 4K2LA 1EY5A 2K7VA 3MTSA 4X6AH 2LMCB 1XPOA 5M3MH 2UUAQ 1TKWB 1SR3A 4O2DA 2RSNA 3AFPA 2D5DA 1VQ6A 5BN4A 3CPFA 2R7ZB 4EGVA 2AQ2B 3A7AB 2R61A 2V1CC 4OEMB 4BY1B 1OXVA 1VQDA 5CV7A 1JMCA 1BNZA 3TRZA 2PZWA 1ENCA 4X62L 1Y1VH 2K5NA 1SE4A 1GUTA 4R4QA 3DWQA 3TS0A 1KNEA 2PI2E 4R4CA 2K5DA 3EIVA 3M3YB 3RZOB 1GJXA 5LMNQ 4A3KH 3S15H 3TDQA 4C3HG 1LYLA 5ISRA 4LF5L 5CYUA 4FVMA 4PG3A 4IUTA 4R9WA 3TP6A 4CKCA 3J7A5 3TN2A 4XT1B 2SDFA 1Q12A 1S4ZA 3D0FA 1Q82C 4C3JH 3S16B 5T1GA 1V1PA 3G48A 2X69A 1V1OA 1YNXA 2MPMA 4L63B 1ML0D 4RHSA 5I4DA 5CV9A 3K5LA 4LF4L 1BCPD 2VNUD 1CT1D 3HOXB 1SNCA 2R3ZA 2IJ0A 4MHEA 1JCKB 3S1RB 1S5ED 4APVA 2MP1A 5KIXA 3NELA 2K50A 5ELCA 2E2JB 1SROA 3U9SA 5C44B 2HT1A 1QG7A 2DNEA 2IHFA 1A62A 3J81c 3CCLA 1XMOL 4OO1H 1SNDA 4DR1L 2NBFA 2B2TA 2L5TA 1PYBA 2OCEA 5BN5A 1PA6A 3PO2G 1HNZQ 1X3QA 1J6QA 5GQOA 3ER0A 4DGZA 1CKNB 4IPCA 4RMFA 1I3QB 1E2ZA 3GTLB 1STGA 1OXTA 4FXGC 4UPAA 1HCZA 4DV0L 1PH4A 2A73B 1AN8A 4DUZQ 3NQIA 3CCQA 2JEBI 4A3MB 4L8JA 2KEEA 3RD4A 3JAMc 5M3FH 4YWKA 4HSVA 5EKLA 5IYCH 2A6EC 5I2XA 1WTQA 4MN3A 2R7DA 3BS1A 3KBGA 3H0GG 2UXDL 1I4HA 1BR9A 3HOZG 4XXEA 2JA8H 4EQ5A 3AEVA 4DFAA 3E0JA 2EJGC 2I5MX 4DR6Q 1KL9A 2EY1A 5IWAQ 1X65A 4A3DG 3OIQA 4MTKA 1PYWD 1LABA 4ALPA 1IZ6A 1TWFB 1R9TB 4K14A 2XNAC 2N78A 1U0LA 3WWVA 3Q24A 1XNRQ 3HOUH 4ZKBB 1JC7A 5IGGA 3HEJA 4QGUA 4DF7A 3NWTA 1WYDA 2EYMA 1GHKA 1F2MA 4NW2A 1L1OA 1BF4A 1VQIA 2Y0SE 3ZJYC 1OTCA 4FF1A 4JG2A 3NBHA 4DR2Q 1N36Q 1EWHA 4LFAQ 1LTBD 1LM0A 2E5LL 1HNXL 4JI5Q 2PZTA 4OWTB 4KMUC 3GTGB 1X3GA 1PTOC 2A68C 4YWMA 1A63A 5IE8A 1M4VA 3J7YW 5C4JB 3FP9A 3CD6A 2CH4W 1NTGA 4JYAQ 3T1HL 2AQ3B 3OPOA 5EKIA 4RAUC 5EPJA 2I5LX 3CC2A 5KNDA 4YWLA 4JK1C 2LXKA 3DXJC 3LNNA 1Z9FA 2OTJA 4BY7G 5IYDG 1I5FA 2NWGA 1MKHA 1XXGA 3R93A 5C3WA 1B3QA 3BZKA 1Y8NB 3SHLA 2F0UA 3H6MA 4JC0A 1L2FA 4ZAIA 3D6WA 2Q8RE 4DV5Q 3CMEA 3IFDA 4OX9Q 1PXUA 1CFMA 2H5XA 2QKIC 4HAEA 4C3HH 1CHPD 2FMCA 2P5ZX 2G5DA 4A93B 2D0PA 4KHZA 4DU9A 1HZ9A 1WD0A 1CM9A 4C56C 1HFNA 3RMHA 1HR0Q 2VL6A 1JOQA 4ZLTF 1MJCA 4WJWA 5IGEA 1EY4A 1I6HH 1Y8PB 3BZDB 1M1KC 1AZQA 4B3SL 2Z9HA 4KKUA 1YBYA 3S2DH 1K28A 1EIYB 4IPDA 3J80i 5DNFA 4C3IH 1N33L 4AYBB 3NUCA 2VW9A 2F52A 5E7NA 2N55A 4HJ9A 1GXDC 4Y52H 4YHHL 3L9AX 2VQEL 4GN3B 2VZAA 3S1NB 2WB1G 5GAHC 4U68A 1M90C 2K52A 1WTWA 1AZPA 4DV1L 1X54A 1K8OA 2VY3A 5HGQA 5FKAC 2AWNA 2CKZB 3HOWG 1CTMA 1FNUA 1HJPA 3GTQB 4POGA 2E2DC 2K75A 2QEJC 3OW2A 2JA5B 3K5OA 2HQEA 2PMZE 5C5LA 5GROA 1I94Q 3NTIA 1K8MA 1VQBA 3ZYYX 4P71A 4CDCC 4FYDA 3O13A 3PUXA 1HPCA 4PZ8A 1Z47A 4U673 1K8GA 1PDQA 2IHEA 1KIXA 4HTHA 4L5QA 2F0FA 4ZRZA 1AP0A 5EBCA 4AQYL 2A5HA 3GTOH 2JA6G 2F0EA 4UP7A 2NB0A 4X66Q 4A3IG 1NE3A 2WACA 1UNSA 3K0XA 3PIO3 2B2UC 1NMGA 1RD9D 4DAVA 4L5SA 2R6GA 4ABNA 1YEZA 3GTKB 2D9UA 1IBMQ 2KHSA 4A3DH 1FJGQ 1KLUD 4DR3L 1KTKA 2QW7A 1B9NA 2Z1CA 4MTNA 4ZYSA 4EX5A 4O1NA 2PZUA 2K32A 2F4VQ 1GUSA 2UU9L 3V2TA 4BA1I 2M00A 1ZXTA 3CAMA 2I5HA 4XTCS 1STNA 3DEPA 1E7ZA 4LF8L 4EQPA 2RF4A 4C2MH 4OWWB 2M9VA 2Z6KA 3CPWA 2EZVA 2BOSA 3K6OA 3KLRA 1NCVA 1TWAH 4A3BH 1ICWA 4F7XA 3P7JA 2N3SA 4DNTB 3FMCA 2ZM6L 3PO3G 3M4OB 2UXCL 5CMDA 1EQQA 3K58A 3PO2B 3OWFA 1SSOA 2XVSA 1N32Q 3X3MA 1LTRD 2N8NA 1N8RC 3BG3A 5C0XH 3RR5A 4HR7B 1RJTA 2EYHA 2DY7A 3AYHB 4BBSG 5DLQE 3H3VC 1HRJA 3CKIB 1BVSA 3BU2A 1EEFD 3TEHB 2QDBA 3MXUA 3I4OA 2B2WC 3D6CA 2WIIB 4YY3Q 4GNXC 1R4PB 1Z7TA 2K28A 1RTOA 2K6AA 2IW3A 3IFTA 5LL6X 4IUQA 1JE5A 3VYRA 4UY8C 2VUMG 3KJOA 2B63G 1ENFA 4JI8L 1W2BA 5C0XJ 2JXMB 3QR8A 3OHXC 2CW0D 4IPGA 4HIOA 3HOYB 3M4YA 2A6HC 1PZID 4ILWA 1X3FA 4NMZA 5IOCA 1CKNA 2OT2A 2YU9H 1VQ8A 4YCUA 5IGBA 3H09A 2DN8A 5C4ZA 3L7ZC 2F0LA 2BDNA 4L5TA 5J3BA 5HGTA 4GS3A 1KABA 2K5HA 1JJGA 1QE6A 4DR7Q 1PRTD 1Q1EA 1BBUA 4RGTA 3DWAA 1SYEA 4B3ML 1MSGA 4DXFA 1NY4A 3H94A 4CBVA 1G2TA 1D1IA 1Y1VG 1EL0A 4PV1C 3G7LA 1LT4D 4DV4L 5KGUA 2QILA 1WCMG 2E2IB 3CCVA 1TWHH 1TS3A 1A8VA 2DJGC 5HY6A 1QZGA 3S14B 1LV9A 1HZAA 3BYTB 3PIOA 4GKKQ 1XMQQ 3STBD 2EY5A 4KTAA 5ELDA 5HURA 4FF2A 4BY7B 3EA6A 4B3TQ 3K0YA 4O0AA 1XX8A 1HHVA 3QIAA 4TVAB 1PH9A 4JI1Q 1DJRD 4OGQC 1TR5A 2KBNA 2RVLA 5C3EH 1PH5A 3URYA 3A55A 4HIMA 3GP7A 3Q6SA 4B9XA 4A3IH 2R93B 2N49A 2RHQB 1H9SB 4RWSC 3H91A 2RSOA 4OO1G 2WAQE 4EQOA 1QVCA 1T9HA 5FLXE 3LWUA 1TS2A 4LFBL 4LF6L 4ZQ3A 1SNQA 1FGBD 4A3FH 4V190 1VQKA 3MXPA 3W3AA 1K0SA 5M5WH 1F77A 3C1EA 2NVYB 5BR8Q 2B29A 4TSSA 3MFYA 1IW7D 2NTTA 3Q23A 2DNCA 4HJ7A 1U4PA 5M5XH 1VQOA 4QQBX 1E0BA 2VB2X 1TU2B 2KHIA 4R4IA 2J7ZA 3CQZB 1LTAD 2GVBA 1HQMC 2BA1A 3VA7A 5M3FG 1PHJA 1N34Q 5IYCG 3PO3H 3NK9A 2LY7A 3HKZG 5C0XI 2Z8LA 3ITPA 3MEFA 1P16A 4HJ8A 3D3RA 4EQNA 1STAA 4V0BA 3T1YQ 1QILA 4KD4A 3J80E 3VR3A 3G6EA 2OWOA 3N52A 3K7UC 4JBMA 3PMFA 5M5YH 4WJ4A 5IGFA 4UP8A 1BCPF 1SNPA 3U58A 5GAGC 3M7GA 2PQAB 3GV3A 2EE1A 1ONLA 2RDFA 3I90A 1TS4A 2JA6B 2IT1A 1PFNA 4DV7L 1KLGD 1HFGA 1CA5A 4P74A 3E9IA 3Q0AA 1ILQA 5KYLA 1IBLL 4X3UA 4K8IA 1ZYRD 1H9KA 1VCIA 2Q2IA 3KJPA 3AMUA 1O78A 4RGOS 3FRPB 1T5EA 1DXMA 2SNMA 3OOCA 3IKJA 2VXWA 4N8FA 1TWCH 1V1QA 4GKJQ 4HCSA 4A3CH 1EWCA 3GTPB 4MZ9A 3GTMH 1VQAA 2G9HD 3J7ZC 1I50B 3SVMA 2UUAL 1S5FD 4XT3B 1Q81C 4N9TA 3BYYB 1IL2A 1Y8OB 4DUYQ 2CQOA 1BKBA 4JV5Q 2QF7A 1HA5A 1G91A 1EY6A 2EY2A 1SFOH 1CKMA 2MO1A 4IOCA 1HQRD 1K8AC 1MJEA 1P8LA 4GN4B 4IFDI 3D31A 3S17H 2D62A 4X3KA 1A6XA 5LMNL 2E75C 4JI6Q 1JB3A 3MEHA 3HOVH 2JA7B 2F0OA 1YNND 4P2CB 1WCMH 3KF6B 3G4SA 2B8GA 1B4OA 1Q46A 4K6DA 3UDIA 3NENA 4BBSB 4LF9Q 5I9OA 1B44D 3Q22A 2KEDA 3PF4A 3T51B 1VDZA 1RL2A 1ASYA 1LUZA 2RCFA 3SDZA 3JC66 3VDYA 2SOBA 2UUCQ 1KAAA 2B2YA 1QNKA 4HSPA 2OQKA 1E1OA 2MJ8A 3E9HA 4C3IG 3J81i 4JI4L 5JPNC 2HHHQ 4JW0A 2VS1A 1D8LA 4DAMA 4PMCA 4LF5Q 3C1FA 2QCPX 2VUMB 3TSSA 1V8QA 4DK3C 1J5EQ 1AE3A 4FF4A 3VYSA 1UWVA 2IX1A 4I65A 1F9QA 1D2BA 3K7AH 5M3MB 1KNAA 2JQOA 5JJKA 2Z4HA 4H13C 1A0IA 3VR2A 3MXNB 1EUJA 1JWUD 3NSWA 4DAPA 1RIPA 1O7LA 5CR3A 5EQ0A 1NR4A 3JAMi 1VQ9A 4KJOA 2Q2HA 1ZEQX 3K80C 2ES2A 1OXSC 5FLXL 3SK4A 4QIWE 1C9OA 4XYQA 3CCRA 4ID6A 1VQNA 1NUCA 4X3TA 2K33A 1XNQQ 3S2HH 1Y1VB 1T5XD 2N88A 4JBJA 4KY6A 5FK9C 5I6YA 1GOZA 1VQFA 4HJ5A 2CHBD 3OMCA 2F0SA 1VQEA 3R2TA 4OIJA 4K6LA 4DR1Q 1I4GA 4A3KB 3S15B 3A8KE 3NP8A 4PZ7A 1MD2D 4R1JA 3KDFB 3M4QA 2L12A 1DCZA 5A35A 4CJ2C 4DR5Q 4A3GG 1BBXC 5IWAL 4FDBA 1O80A 4C3JB 2EY6A 1EYCA 1XYIA 2TMPA 1PV4A 1Q1BA 2KUMA 3J7AF 4A3LH 2HCCA 4KLKA 3UDGA 2HUGA 4A3EH 1XPUA 3UI2A 2IX0A 2OF1A 2JJQA 1QUQB 1EZ6A 4RGNA 3I4NH 3U9OA 3PUVA 2X6LA 4KKSA 2Z4IA 3J80L 2UXBQ 4XQJA 4HEDA 1KDBA 4JI0Q 4DR2L 1X56A 1N36L 1U4LA 4LMQD 4HCEA 3UDXA 2A1AA 2F3IA 2YV5A 1JR0D 3NTHA 4JI5L 1SLJA 2EJFC 3KOJA 4A3BG 1ET9A 1O7YA 2ZTCA 3D8GA 4A75A 4RKLA 3S1MH 2PYKA 3QOJA 3E6ZX 4WORA 2NVXH 1IW7C 2LKVA 3FEWX 4QMGA 3HKSA 4J15A 1KXLA 3CCJA 4DV2Q 4JYAL 3EVQA 3GQBA 1MBYA 3PQIA 1PH7A 5C0XG 2UUBQ 1D7QA 3ND9A 4ME5A 1Q8IA 1E24A 1Y1WG 1WTPA 2B2WA 3VR4A 1KAWA 3RZDH 1BBWA 5FO9B 1FNWA 3GTJH 1X3PA 1W3SA 3QB3A 2RA4A 3X3NA 3I4MH 4IUVA 3SGIA 4LUZA 4QF4A 4HJAA 1SDFA 1VMPA 3M4PA 1EQVA 1WI5A 1BUVT 2NN6H 3HFZB 5K36G 4BS9A 3Q8DA 4NDXA 2KA7A 1DOKA 4EVOA 3FKIG 4IUNA 4OX9L 2JA8B 3PIP3 3PUYA 1YJNA 3IAYA 1CQVA 2JA5H 4DK0A 1H9SA 3SEBA 2Q2TA 4R4TA 4LF7Q 1HR0L 1SRUA 2EDGA 2ZTDA 1KDAA 1QVGA 1WTOA 4DAYB 1SYGA 1EYDA 3NEMA 2FFKB 4KHPQ 4IJLA 3HOUB 3P20A 4ZKCB 2ZJQA 4DR4L 4RA8A 3KYHC 3SK5A 5FLXc 4F8MA 5JAVA 1ZYRC 4X64L 2V4DA 5T1IA 1B70B 1MSHA 2Y0SG 4TKOB 5CC4A 3TQYA 3AFQA 2HIXA 3NQTA 1GKHA 2R92G 1Q3LA 4CJ0B 1D5ZC 4OIKA 4FXKC 4R8IA 4HIDA 1PTOB 3WOEA 1W6KA 1UE1A 2AWOA 4IFDG 3UE0A 3F2DA 4DXGA 1YNJD 2B39A 2IL8A 4BXXG 2GN5A 4H44C 1PMRA 1SMXA 1EY9A 1TVXA 2KOLA 1I94L 5JJLA 4NXNQ 3MZ5A 1HUMA 4OWXB 1EIGA 1E2VA 2JE6I 3D4WA 3K8AA 3NE5B 3V96A 1EU4A 5DAUA 2I46A 2VQEQ 1Z6HA 2PQAA 3J80c 3U4ZA 4O42A 4A3JH 3V05A 1IBKL 2A8VA 2HQLA 1LTGD 4Y7NH 1CUKA 2E2HH 2NZHA 4DNRB 3L0OA 3UE1A 1G8ZD 5D3IB 5CV5A 3DHQA 4X66L 3OTOL 1AFPA 4C3HB 1I4RA 2O5IC 5C3EG 2F03A 2NVQH 5DM73 2B2TC 3CF5A 4A3GH 4B3RQ 1Q8KA 1RHPA 1QCBD 1S5CD 1IBML 1VMCA 1FJGL 1AE2A 1HZBA 1KC8C 1W6JA 4OL7A 1Y69U 2F0MA 1I6HB 1BCPC 2KVMA 2EYJA 1KD1C 3I70A 1S3OA 4A3FG 4KD3A 4C3IB 2CH4A 5EGTA 3RLNA 2C9OA 4NXMQ 4NPSA 1PRTF 2F0GA 4GLAC 3RNUA 2EJMA 1VQMA 1EIFA 1K0RA 1SMYD 1JJ2A 1LO5D 1ZKOA 1E3PA 2PCFB 1VQ5A 2KJXA 3T4AC 2BE5D 4BBRG 2ZTEA 5LL6S 2EOTA 3CHBD 3TP5A 5BN3A 4DR3Q 2GVAA 4H02A 2TSSA 2ZT9C 3KF6A 1JJCB 2CVRA 1WTXA 4CDFC 1IHZA 1A2TA 3QOLA 4A4IA 3F1ZA 1O7ZA 2WFWA 2JP1A 3QWNA 2MHVA 4JOIA 3W1BA 1K3BC 2D2CC 3PIPA 1A3UA 2QGQA 4J6HA 3J81E 2FHTA 1Y1WH 1S5BD 3KLWA 2F0NA 1SYDA 2XRQD 4G7OC 4JI2Q 4XQQA 2DJFC 1L1OC 3K59A 1UE5A 2NN6I 1D5XC 4YY3L 5AJ3L 4J8QA 2EVBA 3GTOB 2F0WA 1UAPA 5K36H 2PNHA 3H0GB 3UDFA 1MHWC 4ZUIA 3HOZB 3FKIH 1S5DD 3K5MA 2J0TD 1CA6A 4OELB 3MVVA 4BWGB 2YYZA 4L5RC 1NJIC 4OONA 2O2LD 4J1MA 3KUPA 2HIVA 4K2KA 4A3DB 1QNUA 1IL8A 5IODA 1EEID 2K03A 4A3CG 3JAME 1D1KA 1K83B 5ELEA 4K0KQ 1GUNA 1GM5A 3MXNA 5EJWA 4G57A 2NVTH 2YTVA 2F0VA 4CGYB 2ZJPA 4PQXA 3K5NA 4JBKA 4KKTA 3AB9A 2Z0SA 2K14A 2XRSD 3SK6A 4C2MB 4R8NA 2F4IA 2B8FA 1G6PA 2IPKD 4LWCA 1TWAB 4A3BB 3C2PA 4ZK9B 2R92H 1YJ9A 4P73A 4DN4M 2AUJD 4PMBA 3PUWA 3KDFA 5E1FA 4KI0A 2OXPA 2BDOA 3RN2A 1E2WA 3HOVG 4IFDH 3PSIA 2NUCA 4LJZC 2IY5B 2L15A 1XJVA 4BXXH 2Q8TA 4GOPC 4WFN3 2JEAI 2DY8A 2ID0A 1C48A 3DM1A 5D3DA 1VQHA 4GKKL 1WTRA 5C4XH 1XMQL 4JI3Q 4DNIA 1F9SA 2VQFQ 4DK1A 1HUNA 1FGUA 3I7FA 4B3TL 1QUQA 3R3OA 4B3MQ 4GZYC 1PH6A 2C35B 4GNXB 1QOHA 4A3MG 3CQZH 4R4OA 2MUYA 1Q86C 5FO7B 2Q8IB 3ONAB 4JI1L 3DMUA 1YITA 2ENBA 2NYZD 1NNXA 2F3VA 4LNQA 2A6ED 4DA2A 4IFDJ 1F9PA 4S3SA 2DGYA 3CCSA 3AQQA 4KHVA 1GVPA 2F3WA 1O7IA 1HTLD 4A76A 2JN4A 2K5VA 3EN2A 1PH1A 2EXDA 2YU9B 1JORA 4XDXA 2RHSB 3A7LA 5BR8L 1MGSA 3AU7A 1EOTA 1C0AA 2PQEA 3CC7A 4IZ8A 4X65L 4DV6Q 5IY0A 3F2CA 1TWGH 3BDLA 1EZ8A 5C4HA 3S9WA 4AYBE 3K57A 2RKSA 5GADC 4K8JA 1SE2A 5M9OA 1TS5A 1EY0A 1UE7A 2KQ3A 2WB1B 2X6GA 2K4KA 4BBRH 1N34L 1B1ZA 3M85A 1SYBA 4QUCA 4DV3Q 3HOWB 1TWHB 1BO0A 3FPUB 1B9MA 4GOPB 1XTCD 3FHWA 3D4DA 3OW7A 1LTID 3C3LA 4HMJA 1VQPA 3T1YL 1X9NA 1PTOD 4IURA 1SXTA 2A68D 2FJ2A 1RDPD 1PH8A 4DAYA 3QJYA 3CCUA 2R7ZH 1F2YA 1SJED 3EQLC 3A54A 1ILPA 3PUZA 4BY1H 4A3LG 2DUDA 5A2QE 4A3EG 4LFCL 1VQGA 1U9RA 3T16A 2WKCA 1GHJA 3I4NG 2HD3A 1SYFA 1VQJA 5C3EB 1C4QA 3J81L 1ET6A 1HNWQ 1EFWA 4A3IB 1L0WA 1ASZA 1QB5D 3M3YH 2L11A 3RZOH 4QCLA 1IKLA 3M7NA 4F87A 1LACA 1WVLA 2XN9C 2IWHA 4GKJL 4A93G 2H1EA 1L0XB 3HP3A 2WP8J 1MIUA 1RKNA 1EQRA 3MC0B 3S24A 2WAQG 4A3FB 2Z6BA 5LMUQ 1U4MA 2BH2A 1X32A 4QB4A 2L9HA 2KHJA 3S16H 1K3RA 1WJJA 4UAIA 1X55A 5I9PA 2LS01 3OWEB 3F2UA 2SNSA 4XIGS 2CWPA 4JV5L 5M5XB 2JSOA 5D14A 3HOXH 1JE4A 2EIFA 3B6YA 3JAML 1FR3A 5JVH3 4OXPA 1FNVA 1QVFA 3S1RH 4RGMA 2YTXA 3F8TA 3TZDA 5IP9H 4JI7Q 1YHAA 1PFMA 3LX0A 3KFUA 4FP5D 3U4VA 5FO8B 3S1QB 2R7FA 3I4MG 2E2JH 1SNMA 3PO3B 5C44H 2NN6G 3FPPA 4JI6L 1SEBD 1LLRD 3LGJA 3A74A 3MHBA 1HTPA 3TBIB 4BA2I 1DOLA 3WOFA 2XWBB 4IN3A 3GV6A 2PMZB 1B8AA 2JA5G 1GUGA 4LF9L 2PNRC 3BVZA 1R4QB 5IYBH 1WFQA 1NMFA 5IT9E 5M5YB 2AMCB 1STBA 1LT3D 3HRZC 1J8IA 1I3QH 3L3OC 3GTLH 2UUCL 4JCVE 3OMGA 5EAYA 3SXHA 3CRKC 2RBMA 4B08A 4UP9A 3TREA 3P1HA 3W2DA 2EXZA 3I4LA 2OTLA 4G4KA 4X62Q 3R8BA 1H95A 4A3MH 1K73C 2HHHL 4JVZA 4DPGA 5EKKA 1H9JA 1X6OA 5JJIA 1J5EL 4AH6A 1TWCB 3KK7A 3G6JB 1LTSD 2MGSA 2CW0C 5KEEA 5CBAE 3GTMB 5ELOA 2B63B 4CJ1B 3NPPA 5CBEE 3OSOA 1F9RA 3W1GA 1SAPA 4UDUC 1TWFH 1B50A 1HNZL 3VA5A 1R9TH 3EBEA 1PVOA 1JOKA 1LT5D 4CDDC 3W5OA 2K5QA 1PRTC 1I4QA 4LF4Q 2K1BA 4JI4Q 2PPBC 1JICA 1SFOB 1TT2A 1H9MA 1XNQL 2ZXPA 1YZ6A 3DWPA 2OQ0A 4DUZL 2ICEC 4CHTB 5ELNA 5G3LD 2PI2A 3S17B 1AEXA 1XPRA 4A3JG 2G9DA 4IALA 2AKWB 2J4XA 2WV6D 3QO2A 3HOVB 1OXUA 1XMOQ 1CHQD 1WCMB 2KCTA 2KCCA 2B2UA 1K9MC 3KF8B 5FLMG 3GTGH 1VQ7A 5NUCA 4DR5L 3DUZA 2EYPA 4CKEA 3A5UA 1STYA 1SE3A 1EY7A 5C4JH 3M9BA 3KLSA 3STBC 4I7ZC 4YCVA 4DR6L 3NHHA 1DZ1A 1L0YB 2A69D 5K5PA 2B2VC 1PH2A 5L37A 3OIPA 2K04A 4DV0Q 1EIHA 2KCMA 1BDOA 1PFSA 1V43A 4IJHA 4PNYA 3OYYA 4POFA 1XNRL 2UXBL 3D4RA 2KENA 1B53A 4JI0L 3A56A 1BOSA 1TY0A 1UUPA 2UXDQ 2LXJA 5E4WC 1A2UA 5A2QL 4LFAL 5JEAG 5DM63 2NZ1D 4A93H 3A8IE 3K7AB 1II3A 3T53B 2LSSA 4N8X1 3ULJA 1Q7YC 1B3AA 2ALYB 1VQCA 1PRTB 4AIMA 2VB3X 4DV2L 5DEHA 2O4XA 3HOYG 2UUBL 4ZCKA 3MFGA 1DGSA 4ZUJA 4LW1A 4X3SA 2K01A 2RDHA 1S72A 5KNCA 2A6HD 4Q5VA 4YCWA 3P75A 1SN8A 2RCNA 1YIJA 2HDMA 3S2HB 4GNXA 1A3TA 4UHVA 1LTLA 2WB1E 3T56B 3PF5A 4DK6C 4IPHA 1KHIA 5FJ8H 4NP5A 3S1NH 2CWAA 4KJNA 2E5LQ 1PTOH 1HNXQ 5M3FB 4OHJA 3CC4A 4JBWA 1QJOA 1QZHA 5KRUA 3HKZB 3J81j 3N6RA 1GO3E 2EYFA 3CRLC 1UEBA 5CV6A 4DV5L 4Q0FA 4N9PA 3GTQH 4LF7L 4K5XA 4RKBA 2EQSA 3T1HQ 1V9PA 2A74C 4M1UB 4RHRA 5EPLA 1CQFA 1I6VC 1ENAA 1FVIA 2GA4B 2F1MA 2L1BA 3RUZA 3DM3A 4KHPL 1UEAB 1CKOA 4A3EB 1MI2A 3BZCA 4K5VA 4QUFA 2SEBD 3I4NB 3GDEA 3GD7A 4WRDA 2ATWA 1J9OA 1KQSA 5IT9L 2AUKA 1SYCA 1A15A 2YTYA 2E76C 4IUPA 3ND8A 4KY5A 2R93G 3PCOB 2WAQB 3S1MB 3PV0A 2NVXB 1DD2A 1LT6D 4GOPA 3NBIA 1PH3A 3GTKH 1NSNS 2BCOA 2E74C 4DR4Q 4B3SQ 1H9RA 1VS0A 2EYLA 4NXNL 2CQAA 5GAEC 4NKLA 5J39A 4X64Q 2MFIA 4HN7A 1VF7A 3RZDB 4HMIA 2B2YC 1N33Q 1B7YB 1G2SA 3KBXA 1NBWA 5LHY1 3GTJB 5C4XG 2XIWA 3E3XA 3I4MB 4OO1I 3HS0C 2JA9A 4YHHQ 1G291 2PO4A 1YNNC 1EYAA 3VYUA 4IO9A 1ESFA 3CMAA 2ZJRA 4DV1Q 2K05A 3M4OH 3GO5A 3PO2H 4IOAA 1G51A 4M8AA 5FLMH 1PLFA 3A0JA 4B3RL 4LAAA 4FXDA 3EJIA 2ICIA 3I8ZA 4GN5A 5I2YA 4H0LC 1PZJD 2XWJB 2WKDA 3BDOA 1VQ4A 1EQTA 1OO9B 5JVG3 3TP8A 5IGCA 1A3VA 3TZUA 1WTVA 3A5ZB 3S2DB 1DONA 1M8AA 3VYTA 4NXML 1IBKQ 1SBBB 2F4VL 4C1NI 1FYCA 4QY7A 2MQHA 4ODGA 2ASBA 3VR6A 3BVGA 3H0GH 5COYA 3OTOQ 1D5MC 4AQYQ 1AH9A 3HOZH 4LK1C 3I55A 2NTSA 3KLSX 5JEAH 1NAPA 4FO2A 5KYIA 5IIFA 3HGBA 3E5SA 1K83H 3SE0A 4KK7A 4JPBW 1YHQA 1N32L 3EFXD 1V1PB 1EY8A 1JWMD 3HOYH 3BVMA 3NWSA 2NZOA 2UU9Q 3I3CA 5LMNW 4QL5A 1D6EC 2R7ZG 3LWEA 2F0JA 2MNAA 4LF8Q 4BY1G 4JI2L 4A3JB 3MAQA 2ZXRA 5IT9c 3H15A 4MIUA 4Y7NB 3RLOA 2E2HB 5H1SE 4WJ3M 4P72A 1TIID 3EROA 2ZM6Q 2UXCQ 2EYOA 2A69C 2NVQB 2JA7G 5TSSA 1JOOA 2K5WA 5JEAJ 2E2IH 4ULLA 4PMWA 1DOMA 3A8JE 4A3GB 4B9WA 1E1TA 1EYGA 1KDCA 1YHBA 5IP7G 3H3VH 1BCPB 1IYUA 4RCNA 3S14H 4G7HC 5CV4A 4K0KL 2JYOA 3T13A 3CCMA 1C7YA 2CFMA 2LFNA 3K81C 4XQNA 4FF3A 1LTTD 4BY7H 5IYDH 1BQQT 2PW7A 3TP7A 5AJ3Q 1SE8A 3CXCA 4K5WA 5IGDA 5E4XA 3HOXG 3CP0A 2F0KA 4P75A 3F2BA 4DR7L 2L0CA 5IP9G 1UE6A 2H4OA 5EPKA 2A19A 3IL8A 1U4RA 2OEOA 2R93H 5J1ZA 1VF5C 4KV6A 5C44G 3KF8A 1Q90A 4CDEC 3ULPA 1BXTA 1VQLA 5C6AA 1DYQA 1ESRA 5AFWA 5M3MG 4JI8Q 1PTOF 1EWIA 3I91A 3ULLA 5IYBG 1TQOA 2NVYH 1XTDA 4QIWB 1Y1WB 4JI3L 1JWSD 1F2ZA 1Y14B 2EPBA 2VQFL 5JOBA 4KN7C 1PFBA 5E3FA 3C46A 1L1OB 4CKBA 1PZKD 2JK8A 3I72A 3NBHB 3BDCA 1JB7A 2AQ1B 2CCZA 1E22A 4ME3A 3ICEA 2XSCA 1HH2P 3DEOA 1RF2D 5C3XA 4KY7A 4L6TB 5C5MA 4DV4Q 4A3KG 3HOWH 2M2LA 3HKZE 1X3EA 3FKIB 1CZGA 4DKAC 4NB3A 2F0HA 5JJZA 5D65A 1G6ZA 1EFID 1N9WA 2AHOB 2F0IA 4TRDA 3R2IA 4C3JG 1TY2A 2XGTA 3MA2B 3U50C 5J22A 1CSPA 2F0QA 1SNOA 3HG9A 4RFBA 3HZXA 2NVTB 3VR5A 4G7ZC 4FNFA 1NR2A 5ELFA 3I2ZA 4QJFA 4DV6L 3FDTA 1F2LA 1B2TA 3MXGA 1XWEA 2RQXA 1GUOA 2Y0SB 2JA6H 2Q2UA 1WOCA 2E8GA 2R92B 1DM0B 1RTNA 1IXRA 2F0PA 2QA4A 1YNJC 2FXQA 1IYJB 4IUUA 5EBDA 4DV3L 3SK8A 2F0TA 4KN4C 3GTPH 3TS2A 3I56A 4LFBQ 1TXYA 4IQZA 4LF6Q 1RCVD 4XYOA 2ZXOA 2PW5A 1I50H 2B2VA 1WTHA 4MNOA 1HZCA 2KECA 4TQUS 4X65Q 1GD7A 3I73A 1C8CA 2HCIA 4Z9CB 1JT8A 3G71A 5C4XB 3FVQA 1CSQA 3NXWA 4LUOA 3CCEA 4GLXA 2I07B 1KRSA 2XTIA 1JQYD 5JPMC 3BJUA 1KRTA 1CI3M 3QG1A 1OXXK 3NTKA 1YI2A 1HA6A 4RCOA 5ELBA 1CZWA 2F0DA 3S1QH 1AW7A 1HR0W 1GUWA 2KCNA 5CORA 2QDLA 4LUVA 2QEXA 5CV8A 3ERSX 2C5CA 2Z6KC 1HNWL 3IRBA 4C1NK 1YVCA 5CGKA 1YJWA 5F2DA 3CW2C 4F88A 5KNBA 2JA8G 1SJHD 2JA7H 2FMMA 1IYVA 1S40A 3H3VI 3MWYW 2IX3A 2BA0A 4RH6A 3WDNA 4YIJA 1HXYD 2RDGA 2FINB 5LMUL 5IP7H 4BBSH 3RN5A 3E0EA 4RG1A 2D0OA 4JOIC 2B3GA 2MO0A 1FL0A 1STHA 5M5WB 2O5JC 1EOVA 3HOUG 4LFCQ 1I4PA 1WD1A 3PGZA 2BH8A 5I6WA 2L55A 2L4NA 1SMYC 1TWGB 1STEA 1FD7D 3DLLA 1I4XA 4E6IA 1RODA 4H7BA 4DUYL 3L2PA 3ERQA 3SR1A 2BE5C 4AYBG
chains in the Genus database with same CATH topology
1EU3A 3TMEA 1QWYA 5G3LF 1IKMA 2WINB 3J7AV 4BBRB 5FOBB 1CK1A 3RLFA 2HDLA 3CU7A 4K2LA 1EY5A 2K7VA 3MTSA 2LMCB 1TKWB 2RSNA 2D5DA 5BN4A 2R7ZB 4EGVA 2AQ2B 3A7AB 2R61A 4BY1B 1OXVA 5CV7A 1BNZA 2PZWA 1ENCA 1SE4A 1GUTA 3DWQA 1KNEA 2K5DA 3M3YB 3RZOB 1GJXA 3TDQA 4C3HG 5ISRA 5CYUA 4FVMA 4IUTA 4R9WA 3TP6A 4CKCA 3TN2A 4XT1B 2SDFA 1Q12A 1S4ZA 3S16B 5T1GA 1V1PA 2X69A 1V1OA 2MPMA 4L63B 1ML0D 4RHSA 5I4DA 5CV9A 3K5LA 1BCPD 2VNUD 1CT1D 3HOXB 1SNCA 2R3ZA 2IJ0A 4MHEA 1JCKB 3S1RB 1S5ED 2MP1A 5KIXA 5ELCA 2E2JB 3U9SA 5C44B 1QG7A 2DNEA 4OO1H 1SNDA 2NBFA 2B2TA 2L5TA 5BN5A 1X3QA 4DGZA 1I3QB 1E2ZA 3GTLB 1STGA 1OXTA 4FXGC 1HCZA 2A73B 1AN8A 3NQIA 2JEBI 4A3MB 4L8JA 2KEEA 3RD4A 4HSVA 5EKLA 2A6EC 5I2XA 1WTQA 4MN3A 3BS1A 3KBGA 1I4HA 1BR9A 4XXEA 4DFAA 3E0JA 2EJGC 2EY1A 3OIQA 1PYWD 1LABA 1TWFB 1R9TB 4K14A 2XNAC 3Q24A 4ZKBB 1JC7A 5IGGA 3HEJA 4DF7A 3NWTA 2EYMA 1GHKA 1F2MA 4NW2A 1BF4A 4FF1A 3NBHA 1EWHA 1LTBD 2PZTA 4KMUC 3GTGB 1PTOC 2A68C 1M4VA 3J7YW 5C4JB 2AQ3B 3OPOA 5EKIA 4RAUC 5EPJA 5KNDA 4JK1C 3DXJC 3LNNA 2NWGA 1XXGA 3R93A 5C3WA 1Y8NB 3SHLA 2F0UA 3H6MA 4ZAIA 3D6WA 2Q8RE 3IFDA 1PXUA 1CFMA 2QKIC 4HAEA 1CHPD 2FMCA 4A93B 4KHZA 4DU9A 1WD0A 1CM9A 4C56C 1HFNA 3RMHA 1JOQA 4ZLTF 4WJWA 5IGEA 1EY4A 1Y8PB 3BZDB 1AZQA 4KKUA 5DNFA 4AYBB 3NUCA 2N55A 1GXDC 3L9AX 3S1NB 4U68A 1WTWA 1AZPA 1K8OA 5FKAC 2AWNA 1CTMA 1FNUA 3GTQB 2E2DC 2QEJC 2JA5B 3K5OA 2HQEA 5C5LA 3NTIA 1K8MA 3ZYYX 4FYDA 3O13A 3PUXA 1HPCA 1Z47A 4U673 1PDQA 4HTHA 2F0FA 4ZRZA 1AP0A 5EBCA 2A5HA 2F0EA 2NB0A 2WACA 1UNSA 3PIO3 2B2UC 1RD9D 4DAVA 2R6GA 4ABNA 3GTKB 2D9UA 2KHSA 1KLUD 1KTKA 1B9NA 2Z1CA 4ZYSA 4O1NA 2PZUA 2K32A 1GUSA 3V2TA 4BA1I 2M00A 1ZXTA 4XTCS 1STNA 3DEPA 4EQPA 2M9VA 2EZVA 2BOSA 3K6OA 3KLRA 1NCVA 1ICWA 4F7XA 3P7JA 4DNTB 3FMCA 3M4OB 5CMDA 3K58A 3PO2B 3OWFA 1SSOA 2XVSA 3X3MA 1LTRD 3BG3A 5C0XH 4HR7B 1RJTA 2EYHA 2DY7A 3H3VC 1HRJA 3CKIB 1EEFD 2QDBA 3MXUA 2B2WC 3D6CA 2WIIB 1R4PB 1Z7TA 2K28A 1RTOA 2K6AA 2IW3A 3IFTA 5LL6X 4IUQA 3VYRA 1ENFA 5C0XJ 2JXMB 3OHXC 2CW0D 3HOYB 3M4YA 2A6HC 1PZID 4ILWA 4NMZA 5IOCA 2OT2A 5IGBA 3H09A 2DN8A 5C4ZA 3L7ZC 2F0LA 2BDNA 5HGTA 1KABA 1QE6A 1PRTD 1Q1EA 4RGTA 3DWAA 1SYEA 1MSGA 4DXFA 3H94A 4CBVA 1G2TA 1D1IA 1EL0A 4PV1C 3G7LA 1LT4D 5KGUA 2QILA 2E2IB 1TS3A 3S14B 1LV9A 3BYTB 2EY5A 4KTAA 5ELDA 5HURA 4FF2A 4BY7B 3EA6A 3K0YA 1XX8A 1HHVA 3QIAA 1DJRD 4OGQC 1TR5A 2RVLA 3URYA 3A55A 3GP7A 3Q6SA 4B9XA 2R93B 1H9SB 4RWSC 3H91A 2RSOA 4OO1G 4EQOA 5FLXE 3LWUA 1TS2A 4ZQ3A 1SNQA 1FGBD 4V190 3MXPA 3W3AA 1F77A 3C1EA 2NVYB 4TSSA 3MFYA 1IW7D 2NTTA 3Q23A 2DNCA 1U4PA 1E0BA 2VB2X 1TU2B 2J7ZA 3CQZB 1LTAD 1HQMC 2BA1A 3VA7A 3NK9A 2LY7A 5C0XI 2Z8LA 3ITPA 3D3RA 4EQNA 1STAA 4V0BA 1QILA 4KD4A 3J80E 3VR3A 3N52A 3PMFA 5IGFA 1BCPF 1SNPA 3M7GA 3GV3A 2EE1A 1ONLA 2RDFA 3I90A 1TS4A 2JA6B 2IT1A 1PFNA 1KLGD 1HFGA 1CA5A 3Q0AA 1ILQA 5KYLA 4X3UA 4K8IA 1ZYRD 1H9KA 1VCIA 3AMUA 1O78A 4RGOS 3FRPB 1T5EA 1DXMA 2SNMA 3OOCA 3IKJA 2VXWA 4HCSA 1EWCA 3GTPB 2G9HD 1I50B 3SVMA 1S5FD 4XT3B 4N9TA 3BYYB 1Y8OB 2QF7A 1HA5A 1G91A 1EY6A 2EY2A 1HQRD 4IFDI 3D31A 2D62A 4X3KA 1A6XA 2E75C 1JB3A 3MEHA 2JA7B 2F0OA 1YNND 4P2CB 2B8GA 1B4OA 4K6DA 4BBSB 5I9OA 1B44D 3Q22A 2KEDA 3T51B 1VDZA 3SDZA 2SOBA 1KAAA 2B2YA 1QNKA 4HSPA 2MJ8A 4C3IG 5JPNC 4PMCA 3C1FA 2QCPX 2VUMB 3TSSA 1V8QA 4FF4A 3VYSA 2IX1A 4I65A 1F9QA 1D2BA 5M3MB 1KNAA 2Z4HA 4H13C 3VR2A 1JWUD 3NSWA 4DAPA 5CR3A 1O7LA 5EQ0A 1NR4A 4KJOA 1ZEQX 1OXSC 5FLXL 3SK4A 4XYQA 4ID6A 1NUCA 4X3TA 2K33A 1Y1VB 1T5XD 2N88A 4KY6A 5FK9C 5I6YA 1GOZA 2CHBD 3OMCA 2F0SA 3R2TA 4OIJA 4K6LA 1I4GA 4A3KB 3S15B 3A8KE 3NP8A 1MD2D 2L12A 1DCZA 5A35A 4CJ2C 1BBXC 1O80A 4C3JB 2EY6A 1EYCA 1XYIA 2TMPA 1Q1BA 2KUMA 3J7AF 2HCCA 2HUGA 3UI2A 2IX0A 2OF1A 1EZ6A 4RGNA 3U9OA 3PUVA 2X6LA 4KKSA 2Z4IA 3J80L 4XQJA 4HEDA 1KDBA 1U4LA 4LMQD 4HCEA 1JR0D 3NTHA 2EJFC 1ET9A 1O7YA 3D8GA 4RKLA 2PYKA 3QOJA 3E6ZX 4WORA 1IW7C 2LKVA 3FEWX 4QMGA 3EVQA 3GQBA 1MBYA 5C0XG 3ND9A 4ME5A 1Q8IA 1WTPA 2B2WA 3VR4A 5FO9B 1FNWA 1X3PA 3QB3A 2RA4A 3X3NA 4IUVA 4QF4A 1SDFA 1VMPA 1EQVA 1BUVT 2NN6H 5K36G 4BS9A 4NDXA 2KA7A 1DOKA 4EVOA 4IUNA 2JA8B 3PIP3 3PUYA 3IAYA 1CQVA 4DK0A 1H9SA 3SEBA 2EDGA 1KDAA 1WTOA 1SYGA 1EYDA 2FFKB 3HOUB 3P20A 4ZKCB 4RA8A 3SK5A 4F8MA 5JAVA 1ZYRC 2V4DA 5T1IA 1MSHA 4TKOB 5CC4A 3NQTA 1Q3LA 4CJ0B 1D5ZC 4OIKA 4FXKC 4R8IA 1PTOB 3WOEA 1W6KA 2AWOA 4IFDG 4DXGA 1YNJD 2B39A 2IL8A 4H44C 1PMRA 1EY9A 1TVXA 2KOLA 3MZ5A 1HUMA 1EIGA 1E2VA 2JE6I 3D4WA 3NE5B 3V96A 1EU4A 5DAUA 2I46A 1Z6HA 4O42A 3V05A 1LTGD 4DNRB 1G8ZD 5D3IB 5CV5A 3DHQA 1AFPA 4C3HB 1I4RA 2O5IC 2F03A 5DM73 2B2TC 1RHPA 1QCBD 1S5CD 1VMCA 1W6JA 4OL7A 1Y69U 2F0MA 1I6HB 1BCPC 2KVMA 2EYJA 3I70A 4KD3A 4C3IB 5EGTA 2C9OA 1PRTF 2F0GA 2EJMA 1SMYD 1LO5D 1ZKOA 2PCFB 2KJXA 3T4AC 2BE5D 5LL6S 2EOTA 3CHBD 3TP5A 5BN3A 2TSSA 2ZT9C 2CVRA 1WTXA 1IHZA 1A2TA 3QOLA 1O7ZA 2JP1A 3QWNA 2MHVA 2D2CC 1A3UA 3J81E 4J6HA 2FHTA 1S5BD 2F0NA 1SYDA 2XRQD 4G7OC 4XQQA 3K59A 2NN6I 1D5XC 4J8QA 2EVBA 3GTOB 2F0WA 1UAPA 5K36H 3H0GB 4ZUIA 3HOZB 1S5DD 3K5MA 2J0TD 1CA6A 3MVVA 4BWGB 2YYZA 2O2LD 4J1MA 3KUPA 4K2KA 4A3DB 1QNUA 1IL8A 5IODA 1EEID 2K03A 3JAME 1D1KA 1K83B 5ELEA 1GUNA 3MXNA 5EJWA 4G57A 2F0VA 4CGYB 4PQXA 3K5NA 4KKTA 3AB9A 2XRSD 3SK6A 4C2MB 4R8NA 2F4IA 2B8FA 2IPKD 1TWAB 4A3BB 3C2PA 4ZK9B 4DN4M 2AUJD 4PMBA 3PUWA 5E1FA 4KI0A 2OXPA 2BDOA 1E2WA 4IFDH 2NUCA 4LJZC 2Q8TA 4WFN3 2JEAI 2DY8A 2ID0A 1C48A 3DM1A 5D3DA 1WTRA 1F9SA 4DK1A 1HUNA 3R3OA 4GZYC 1QOHA 2MUYA 5FO7B 2Q8IB 3ONAB 3DMUA 2ENBA 2NYZD 2F3VA 2A6ED 4DA2A 4IFDJ 1F9PA 4S3SA 4KHVA 2F3WA 1HTLD 2YU9B 1JORA 4XDXA 3A7LA 1MGSA 3AU7A 1EOTA 2PQEA 4IZ8A 3BDLA 1EZ8A 5C4HA 3S9WA 3K57A 2RKSA 4K8JA 1SE2A 5M9OA 1TS5A 1EY0A 2WB1B 2KQ3A 2X6GA 1B1ZA 3M85A 1SYBA 4QUCA 3HOWB 1TWHB 1BO0A 3FPUB 1B9MA 1XTCD 3OW7A 3D4DA 1LTID 3C3LA 4HMJA 1PTOD 4IURA 1SXTA 2A68D 2FJ2A 1RDPD 4DAYA 3QJYA 1F2YA 1SJED 3EQLC 3A54A 1ILPA 3PUZA 5A2QE 1U9RA 3T16A 2WKCA 1GHJA 1SYFA 5C3EB 1C4QA 3J81L 1ET6A 4A3IB 1QB5D 4QCLA 2L11A 1IKLA 3M7NA 4F87A 1LACA 1WVLA 2XN9C 2IWHA 2H1EA 1L0XB 3HP3A 2WP8J 1RKNA 3MC0B 4A3FB 1U4MA 1X32A 4QB4A 2L9HA 4UAIA 5I9PA 2LS01 3OWEB 3F2UA 2SNSA 4XIGS 5M5XB 2JSOA 5D14A 1JE4A 3JAML 5JVH3 1FR3A 1FNVA 4RGMA 3TZDA 1PFMA 3LX0A 4FP5D 3S1QB 5FO8B 1SNMA 3PO3B 2NN6G 3FPPA 1SEBD 1LLRD 3MHBA 1HTPA 3TBIB 4BA2I 1DOLA 3WOFA 2XWBB 4IN3A 3GV6A 2PMZB 1GUGA 2PNRC 3BVZA 1R4QB 5IT9E 5M5YB 1STBA 1LT3D 3HRZC 1J8IA 3L3OC 3OMGA 3SXHA 3CRKC 2RBMA 4B08A 3W2DA 3P1HA 2EXZA 3I4LA 4G4KA 3R8BA 5EKKA 1H9JA 1TWCB 3KK7A 3G6JB 1LTSD 2MGSA 2CW0C 5KEEA 5CBAE 3GTMB 2B63B 4CJ1B 3NPPA 5CBEE 3OSOA 1F9RA 1SAPA 4UDUC 1B50A 3VA5A 1JOKA 1LT5D 2K5QA 1PRTC 1I4QA 2K1BA 2PPBC 1JICA 1SFOB 1TT2A 1H9MA 2ZXPA 3DWPA 2ICEC 4CHTB 5G3LD 3S17B 1AEXA 2G9DA 4IALA 2J4XA 2WV6D 3QO2A 3HOVB 1OXUA 1CHQD 1WCMB 2KCCA 2B2UA 5NUCA 3DUZA 4CKEA 2EYPA 1STYA 1SE3A 1EY7A 3KLSA 4I7ZC 3NHHA 1DZ1A 1L0YB 2A69D 5K5PA 2B2VC 3OIPA 2K04A 1EIHA 1BDOA 1V43A 4PNYA 3D4RA 1B53A 3A56A 1BOSA 1TY0A 1UUPA 5E4WC 1A2UA 5A2QL 5JEAG 5DM63 2NZ1D 3A8IE 3K7AB 1II3A 3T53B 1B3AA 1PRTB 2VB3X 5DEHA 2O4XA 3MFGA 4ZUJA 4X3SA 2K01A 2RDHA 5KNCA 2A6HD 4Q5VA 3P75A 2HDMA 3S2HB 1A3TA 3T56B 4NP5A 4KJNA 1PTOH 5M3FB 4OHJA 4JBWA 1QJOA 5KRUA 3HKZB 3N6RA 2EYFA 3CRLC 5CV6A 4Q0FA 4N9PA 4K5XA 4RKBA 2A74C 4M1UB 4RHRA 5EPLA 1CQFA 1I6VC 1ENAA 2GA4B 2F1MA 2L1BA 3RUZA 1UEAB 4A3EB 1MI2A 4K5VA 4QUFA 2SEBD 3I4NB 3GD7A 4WRDA 1J9OA 5IT9L 2AUKA 1SYCA 1A15A 2E76C 4IUPA 3ND8A 4KY5A 2WAQB 3S1MB 3PV0A 2NVXB 1DD2A 1LT6D 3NBIA 1NSNS 2BCOA 2E74C 1H9RA 2EYLA 2CQAA 4NKLA 5J39A 4HN7A 1VF7A 3RZDB 4HMIA 2B2YC 1G2SA 3KBXA 5LHY1 3GTJB 2XIWA 3I4MB 4OO1I 3HS0C 1G291 2PO4A 1YNNC 1EYAA 3VYUA 1ESFA 2K05A 3GO5A 4M8AA 1PLFA 4LAAA 4FXDA 3EJIA 2ICIA 3I8ZA 5I2YA 4H0LC 1PZJD 2XWJB 2WKDA 3BDOA 1EQTA 1OO9B 5JVG3 3TP8A 5IGCA 1A3VA 3TZUA 1WTVA 3S2DB 1DONA 1M8AA 3VYTA 1SBBB 4C1NI 1FYCA 4ODGA 3VR6A 3BVGA 5COYA 1D5MC 4LK1C 2NTSA 3KLSX 5JEAH 1NAPA 4FO2A 5KYIA 5IIFA 3HGBA 3E5SA 3SE0A 4KK7A 3EFXD 1V1PB 1EY8A 1JWMD 3BVMA 3NWSA 3I3CA 1D6EC 3LWEA 2F0JA 4A3JB 3MAQA 2ZXRA 4MIUA 4Y7NB 2E2HB 1TIID 3EROA 2EYOA 2A69C 2NVQB 5TSSA 1JOOA 2K5WA 5JEAJ 4A3GB 4ULLA 4PMWA 1DOMA 3A8JE 4B9WA 1KDCA 1BCPB 1IYUA 4RCNA 4G7HC 5CV4A 2JYOA 3T13A 2LFNA 4XQNA 4FF3A 1LTTD 1BQQT 2PW7A 3TP7A 4K5WA 5IGDA 5E4XA 2F0KA 2L0CA 2H4OA 5EPKA 3IL8A 1U4RA 2OEOA 5J1ZA 1VF5C 4KV6A 3KF8A 1Q90A 1BXTA 5C6AA 1DYQA 1ESRA 5AFWA 1PTOF 3I91A 1TQOA 4QIWB 1Y1WB 1JWSD 1F2ZA 2EPBA 5JOBA 4KN7C 1PFBA 5E3FA 3C46A 4CKBA 1PZKD 3I72A 3BDCA 2AQ1B 2XSCA 3DEOA 1RF2D 5C3XA 4KY7A 4L6TB 5C5MA 2M2LA 3FKIB 1CZGA 2F0HA 5JJZA 5D65A 1G6ZA 1EFID 2F0IA 4TRDA 3R2IA 4C3JG 1TY2A 3MA2B 5J22A 2F0QA 1SNOA 3HG9A 4RFBA 3HZXA 2NVTB 3VR5A 4G7ZC 4FNFA 1NR2A 5ELFA 3FDTA 1F2LA 1B2TA 3MXGA 1XWEA 2RQXA 1GUOA 2Y0SB 2R92B 1DM0B 1RTNA 2F0PA 1YNJC 4IUUA 5EBDA 3SK8A 2F0TA 4KN4C 4IQZA 1RCVD 4XYOA 2ZXOA 2PW5A 2B2VA 2KECA 4TQUS 3I73A 1C8CA 2HCIA 4Z9CB 5C4XB 3FVQA 3NXWA 2I07B 1JQYD 5JPMC 1CI3M 3QG1A 1OXXK 3NTKA 1HA6A 4RCOA 5ELBA 1CZWA 2F0DA 1AW7A 1GUWA 2KCNA 5CORA 5CV8A 2C5CA 4C1NK 5CGKA 5F2DA 4F88A 5KNBA 1SJHD 2FMMA 1IYVA 3MWYW 2IX3A 2BA0A 4RH6A 3WDNA 4YIJA 1HXYD 2RDGA 2FINB 1STHA 5M5WB 2O5JC 1I4PA 1WD1A 5I6WA 2L55A 2L4NA 1SMYC 1TWGB 1STEA 1FD7D 1I4XA 4E6IA 1RODA 4H7BA 3ERQA 3SR1A 2BE5C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TME A;  5C3W A;  4MIU A;  4KD4 A;  4K8J A;  1SYE A;  3EVQ A;  4DGZ A;  5M9O A;  1EY0 A;  5J22 A;  2KQ3 A;  3SHL A;  2F0U A;  3H6M A;  2EYL A;  2F0Q A;  3ERO A;  1SNO A;  4PMC A;  1STB A;  3C1F A;  3PMF A;  4ME5 A;  4NKL A;  5J39 A;  3HZX A;  2PZU A;  5CV5 A;  3DHQ A;  1STG A;  2EYO A;  4G57 A;  5IGF A;  1A2U A;  3V2T A;  5KGU A;  2F0V A;  2M00 A;  1SNP A;  3OMG A;  4HMI A;  3SXH A;  1SYB A;  2RBM A;  1JOO A;  3P1H A;  1STN A;  2EXZ A;  4DU9 A;  4I65 A;  4K2L A;  3D4D A;  4B9W A;  3SK6 A;  1EY5 A;  1II3 A;  4R8N A;  2RDF A;  1KDC A;  3QB3 A;  4EQP A;  4HMJ A;  1JOQ A;  4OL7 A;  4QF4 A;  5DEH A;  5IGE A;  5IOD A;  5EKL A;  2F0M A;  1EQV A;  5CV4 A;  1EY4 A;  2O4X A;  2EYJ A;  3T13 A;  1EYA A;  4E6I A;  5EKK A;  4KD3 A;  4F7X A;  4NDX A;  5KYL A;  2F0P A;  5CR3 A;  4K8I A;  4PMB A;  4ZUJ A;  4KJO A;  2EY5 A;  4KTA A;  5EGT A;  4IUN A;  1F2Y A;  2SNM A;  4EVO A;  5HUR A;  3OWF A;  5CV7 A;  5E1F A;  2OXP A;  3SK4 A;  4DFA A;  3P75 A;  3NUC A;  3SK8 A;  4ID6 A;  2F0T A;  2PW7 A;  2PZW A;  3TP7 A;  5KEE A;  1ENC A;  2NUC A;  1U9R A;  1NUC A;  2F0G A;  2EY1 A;  4K5W A;  3T16 A;  4LAA A;  3EJI A;  3OSO A;  5IGD A;  1A3T A;  2PW5 A;  4KY6 A;  1KDA A;  5I6Y A;  1SYF A;  2F0K A;  4N9T A;  3OMC A;  2F0S A;  1TR5 A;  1SYG A;  1EYD A;  2EYH A;  4K14 A;  4NP5 A;  3VA5 A;  4KJN A;  1JOK A;  3NP8 A;  3NXW A;  4B9X A;  5DAU A;  3TP8 A;  5IGC A;  1A3V A;  2OEO A;  3TP5 A;  5KRU A;  5IGG A;  3HEJ A;  5J1Z A;  3SK5 A;  4DF7 A;  5ISR A;  2EYF A;  4F8M A;  5JAV A;  4KV6 A;  2QDB A;  5CV6 A;  3TP6 A;  2EYM A;  3R3O A;  4EQO A;  1F2M A;  1EY6 A;  1TT2 A;  2EY2 A;  1RKN A;  4N9P A;  5C6A A;  1IHZ A;  1A2T A;  3D6C A;  3QOL A;  2F0D A;  1SNQ A;  4K5X A;  4ZQ3 A;  4RKB A;  4ODG A;  2HQE A;  3MXP A;  5C5L A;  2EY6 A;  4QB4 A;  1EYC A;  5CC4 A;  5CV8 A;  3DMU A;  1ENA A;  1AEX A;  3NQT A;  2ENB A;  4QMG A;  3RUZ A;  3C1E A;  4IAL A;  5CGK A;  5F2D A;  1A3U A;  1TQO A;  4J6H A;  5I9P A;  2PZT A;  3MEH A;  5CV9 A;  4K5V A;  2F3V A;  2SNS A;  1F2Z A;  2F0O A;  2OF1 A;  5JOB A;  2F0N A;  1SYD A;  1EZ6 A;  5KYI A;  5IIF A;  1SNC A;  5E3F A;  5NUC A;  3U9O A;  4HTH A;  4WRD A;  3E5S A;  4YIJ A;  4K6D A;  2EYP A;  4S3S A;  1STY A;  1EY7 A;  2F0F A;  3BDC A;  4KHV A;  1KDB A;  2F3W A;  5I9O A;  1EY9 A;  1EY8 A;  1SYC A;  5KIX A;  3LX0 A;  3NHH A;  2F0W A;  5C3X A;  4NMZ A;  1STH A;  4KY7 A;  3MZ5 A;  2F0E A;  5C5M A;  5IOC A;  1SNM A;  5K5P A;  1JOR A;  4ZUI A;  4KY5 A;  5IGB A;  2SOB A;  2WAC A;  3NK9 A;  5C4Z A;  1KAA A;  2PQE A;  3D4W A;  5I6W A;  1SND A;  2F0H A;  2F0L A;  3MHB A;  4IZ8 A;  3D8G A;  3MVV A;  4RKL A;  3BDL A;  5HGT A;  2PYK A;  1EZ8 A;  1KAB A;  3QOJ A;  3ITP A;  4TRD A;  2F0J A;  2LKV A;  4H7B A;  4WOR A;  4J1M A;  4PNY A;  5C4H A;  3S9W A;  3ERQ A;  4K2K A;  2F0I A;  2RKS A;  1STA A;  3SR1 A;  4EQN A;  1NSN S;  2KHS A; 
#chains in the Genus database with same CATH topology
 1EU3 A;  3TME A;  1QWY A;  5G3L F;  4JI7 L;  4DV7 Q;  1IKM A;  4GLV B;  2WIN B;  1IBL Q;  4BBR B;  3J7A V;  5FOB B;  1CK1 A;  4I7A A;  1ICF B;  5FJ8 G;  2VUM H;  1U5K A;  2I0Q A;  2B63 H;  4HIK A;  3RLF A;  1PYS B;  4PZ6 A;  2HDL A;  3CU7 A;  4K2L A;  1EY5 A;  2K7V A;  3MTS A;  4X6A H;  2LMC B;  1XPO A;  5M3M H;  2UUA Q;  1TKW B;  1SR3 A;  4O2D A;  2RSN A;  3AFP A;  2D5D A;  1VQ6 A;  5BN4 A;  3CPF A;  2R7Z B;  4EGV A;  2AQ2 B;  3A7A B;  2R61 A;  2V1C C;  4OEM B;  4BY1 B;  1OXV A;  1VQD A;  5CV7 A;  1JMC A;  1BNZ A;  3TRZ A;  2PZW A;  1ENC A;  4X62 L;  1Y1V H;  2K5N A;  1SE4 A;  1GUT A;  4R4Q A;  3DWQ A;  3TS0 A;  1KNE A;  2PI2 E;  4R4C A;  2K5D A;  3EIV A;  3M3Y B;  3RZO B;  1GJX A;  5LMN Q;  4A3K H;  3S15 H;  3TDQ A;  4C3H G;  1LYL A;  5ISR A;  4LF5 L;  5CYU A;  4FVM A;  4PG3 A;  4IUT A;  4R9W A;  3TP6 A;  4CKC A;  3J7A 5;  3TN2 A;  4XT1 B;  2SDF A;  1Q12 A;  1S4Z A;  3D0F A;  1Q82 C;  4C3J H;  3S16 B;  5T1G A;  1V1P A;  3G48 A;  2X69 A;  1V1O A;  1YNX A;  2MPM A;  4L63 B;  1ML0 D;  4RHS A;  5I4D A;  5CV9 A;  3K5L A;  4LF4 L;  1BCP D;  2VNU D;  1CT1 D;  3HOX B;  1SNC A;  2R3Z A;  2IJ0 A;  4MHE A;  1JCK B;  3S1R B;  1S5E D;  4APV A;  2MP1 A;  5KIX A;  3NEL A;  2K50 A;  5ELC A;  2E2J B;  1SRO A;  3U9S A;  5C44 B;  2HT1 A;  1QG7 A;  2DNE A;  2IHF A;  1A62 A;  3J81 c;  3CCL A;  1XMO L;  4OO1 H;  1SND A;  4DR1 L;  2NBF A;  2B2T A;  2L5T A;  1PYB A;  2OCE A;  5BN5 A;  1PA6 A;  3PO2 G;  1HNZ Q;  1X3Q A;  1J6Q A;  5GQO A;  3ER0 A;  4DGZ A;  1CKN B;  4IPC A;  4RMF A;  1I3Q B;  1E2Z A;  3GTL B;  1STG A;  1OXT A;  4FXG C;  4UPA A;  1HCZ A;  4DV0 L;  1PH4 A;  2A73 B;  1AN8 A;  4DUZ Q;  3NQI A;  3CCQ A;  2JEB I;  4A3M B;  4L8J A;  2KEE A;  3RD4 A;  3JAM c;  5M3F H;  4YWK A;  4HSV A;  5EKL A;  5IYC H;  2A6E C;  5I2X A;  1WTQ A;  4MN3 A;  2R7D A;  3BS1 A;  3KBG A;  3H0G G;  2UXD L;  1I4H A;  1BR9 A;  3HOZ G;  4XXE A;  2JA8 H;  4EQ5 A;  3AEV A;  4DFA A;  3E0J A;  2EJG C;  2I5M X;  4DR6 Q;  1KL9 A;  2EY1 A;  5IWA Q;  1X65 A;  4A3D G;  3OIQ A;  4MTK A;  1PYW D;  1LAB A;  4ALP A;  1IZ6 A;  1TWF B;  1R9T B;  4K14 A;  2XNA C;  2N78 A;  1U0L A;  3WWV A;  3Q24 A;  1XNR Q;  3HOU H;  4ZKB B;  1JC7 A;  5IGG A;  3HEJ A;  4QGU A;  4DF7 A;  3NWT A;  1WYD A;  2EYM A;  1GHK A;  1F2M A;  4NW2 A;  1L1O A;  1BF4 A;  1VQI A;  2Y0S E;  3ZJY C;  1OTC A;  4FF1 A;  4JG2 A;  3NBH A;  4DR2 Q;  1N36 Q;  1EWH A;  4LFA Q;  1LTB D;  1LM0 A;  2E5L L;  1HNX L;  4JI5 Q;  2PZT A;  4OWT B;  4KMU C;  3GTG B;  1X3G A;  1PTO C;  2A68 C;  4YWM A;  1A63 A;  5IE8 A;  1M4V A;  3J7Y W;  5C4J B;  3FP9 A;  3CD6 A;  2CH4 W;  1NTG A;  4JYA Q;  3T1H L;  2AQ3 B;  3OPO A;  5EKI A;  4RAU C;  5EPJ A;  2I5L X;  3CC2 A;  5KND A;  4YWL A;  4JK1 C;  2LXK A;  3DXJ C;  3LNN A;  1Z9F A;  2OTJ A;  4BY7 G;  5IYD G;  1I5F A;  2NWG A;  1MKH A;  1XXG A;  3R93 A;  5C3W A;  1B3Q A;  3BZK A;  1Y8N B;  3SHL A;  2F0U A;  3H6M A;  4JC0 A;  1L2F A;  4ZAI A;  3D6W A;  2Q8R E;  4DV5 Q;  3CME A;  3IFD A;  4OX9 Q;  1PXU A;  1CFM A;  2H5X A;  2QKI C;  4HAE A;  4C3H H;  1CHP D;  2FMC A;  2P5Z X;  2G5D A;  4A93 B;  2D0P A;  4KHZ A;  4DU9 A;  1HZ9 A;  1WD0 A;  1CM9 A;  4C56 C;  1HFN A;  3RMH A;  1HR0 Q;  2VL6 A;  1JOQ A;  4ZLT F;  1MJC A;  4WJW A;  5IGE A;  1EY4 A;  1I6H H;  1Y8P B;  3BZD B;  1M1K C;  1AZQ A;  4B3S L;  2Z9H A;  4KKU A;  1YBY A;  3S2D H;  1K28 A;  1EIY B;  4IPD A;  3J80 i;  5DNF A;  4C3I H;  1N33 L;  4AYB B;  3NUC A;  2VW9 A;  2F52 A;  5E7N A;  2N55 A;  4HJ9 A;  1GXD C;  4Y52 H;  4YHH L;  3L9A X;  2VQE L;  4GN3 B;  2VZA A;  3S1N B;  2WB1 G;  5GAH C;  4U68 A;  1M90 C;  2K52 A;  1WTW A;  1AZP A;  4DV1 L;  1X54 A;  1K8O A;  2VY3 A;  5HGQ A;  5FKA C;  2AWN A;  2CKZ B;  3HOW G;  1CTM A;  1FNU A;  1HJP A;  3GTQ B;  4POG A;  2E2D C;  2K75 A;  2QEJ C;  3OW2 A;  2JA5 B;  3K5O A;  2HQE A;  2PMZ E;  5C5L A;  5GRO A;  1I94 Q;  3NTI A;  1K8M A;  1VQB A;  3ZYY X;  4P71 A;  4CDC C;  4FYD A;  3O13 A;  3PUX A;  1HPC A;  4PZ8 A;  1Z47 A;  4U67 3;  1K8G A;  1PDQ A;  2IHE A;  1KIX A;  4HTH A;  4L5Q A;  2F0F A;  4ZRZ A;  1AP0 A;  5EBC A;  4AQY L;  2A5H A;  3GTO H;  2JA6 G;  2F0E A;  4UP7 A;  2NB0 A;  4X66 Q;  4A3I G;  1NE3 A;  2WAC A;  1UNS A;  3K0X A;  3PIO 3;  2B2U C;  1NMG A;  1RD9 D;  4DAV A;  4L5S A;  2R6G A;  4ABN A;  1YEZ A;  3GTK B;  2D9U A;  1IBM Q;  2KHS A;  4A3D H;  1FJG Q;  1KLU D;  4DR3 L;  1KTK A;  2QW7 A;  1B9N A;  2Z1C A;  4MTN A;  4ZYS A;  4EX5 A;  4O1N A;  2PZU A;  2K32 A;  2F4V Q;  1GUS A;  2UU9 L;  3V2T A;  4BA1 I;  2M00 A;  1ZXT A;  3CAM A;  2I5H A;  4XTC S;  1STN A;  3DEP A;  1E7Z A;  4LF8 L;  4EQP A;  2RF4 A;  4C2M H;  4OWW B;  2M9V A;  2Z6K A;  3CPW A;  2EZV A;  2BOS A;  3K6O A;  3KLR A;  1NCV A;  1TWA H;  4A3B H;  1ICW A;  4F7X A;  3P7J A;  2N3S A;  4DNT B;  3FMC A;  2ZM6 L;  3PO3 G;  3M4O B;  2UXC L;  5CMD A;  1EQQ A;  3K58 A;  3PO2 B;  3OWF A;  1SSO A;  2XVS A;  1N32 Q;  3X3M A;  1LTR D;  2N8N A;  1N8R C;  3BG3 A;  5C0X H;  3RR5 A;  4HR7 B;  1RJT A;  2EYH A;  2DY7 A;  3AYH B;  4BBS G;  5DLQ E;  3H3V C;  1HRJ A;  3CKI B;  1BVS A;  3BU2 A;  1EEF D;  3TEH B;  2QDB A;  3MXU A;  3I4O A;  2B2W C;  3D6C A;  2WII B;  4YY3 Q;  4GNX C;  1R4P B;  1Z7T A;  2K28 A;  1RTO A;  2K6A A;  2IW3 A;  3IFT A;  5LL6 X;  4IUQ A;  1JE5 A;  3VYR A;  4UY8 C;  2VUM G;  3KJO A;  2B63 G;  1ENF A;  4JI8 L;  1W2B A;  5C0X J;  2JXM B;  3QR8 A;  3OHX C;  2CW0 D;  4IPG A;  4HIO A;  3HOY B;  3M4Y A;  2A6H C;  1PZI D;  4ILW A;  1X3F A;  4NMZ A;  5IOC A;  1CKN A;  2OT2 A;  2YU9 H;  1VQ8 A;  4YCU A;  5IGB A;  3H09 A;  2DN8 A;  5C4Z A;  3L7Z C;  2F0L A;  2BDN A;  4L5T A;  5J3B A;  5HGT A;  4GS3 A;  1KAB A;  2K5H A;  1JJG A;  1QE6 A;  4DR7 Q;  1PRT D;  1Q1E A;  1BBU A;  4RGT A;  3DWA A;  1SYE A;  4B3M L;  1MSG A;  4DXF A;  1NY4 A;  3H94 A;  4CBV A;  1G2T A;  1D1I A;  1Y1V G;  1EL0 A;  4PV1 C;  3G7L A;  1LT4 D;  4DV4 L;  5KGU A;  2QIL A;  1WCM G;  2E2I B;  3CCV A;  1TWH H;  1TS3 A;  1A8V A;  2DJG C;  5HY6 A;  1QZG A;  3S14 B;  1LV9 A;  1HZA A;  3BYT B;  3PIO A;  4GKK Q;  1XMQ Q;  3STB D;  2EY5 A;  4KTA A;  5ELD A;  5HUR A;  4FF2 A;  4BY7 B;  3EA6 A;  4B3T Q;  3K0Y A;  4O0A A;  1XX8 A;  1HHV A;  3QIA A;  4TVA B;  1PH9 A;  4JI1 Q;  1DJR D;  4OGQ C;  1TR5 A;  2KBN A;  2RVL A;  5C3E H;  1PH5 A;  3URY A;  3A55 A;  4HIM A;  3GP7 A;  3Q6S A;  4B9X A;  4A3I H;  2R93 B;  2N49 A;  2RHQ B;  1H9S B;  4RWS C;  3H91 A;  2RSO A;  4OO1 G;  2WAQ E;  4EQO A;  1QVC A;  1T9H A;  5FLX E;  3LWU A;  1TS2 A;  4LFB L;  4LF6 L;  4ZQ3 A;  1SNQ A;  1FGB D;  4A3F H;  4V19 0;  1VQK A;  3MXP A;  3W3A A;  1K0S A;  5M5W H;  1F77 A;  3C1E A;  2NVY B;  5BR8 Q;  2B29 A;  4TSS A;  3MFY A;  1IW7 D;  2NTT A;  3Q23 A;  2DNC A;  4HJ7 A;  1U4P A;  5M5X H;  1VQO A;  4QQB X;  1E0B A;  2VB2 X;  1TU2 B;  2KHI A;  4R4I A;  2J7Z A;  3CQZ B;  1LTA D;  2GVB A;  1HQM C;  2BA1 A;  3VA7 A;  5M3F G;  1PHJ A;  1N34 Q;  5IYC G;  3PO3 H;  3NK9 A;  2LY7 A;  3HKZ G;  5C0X I;  2Z8L A;  3ITP A;  3MEF A;  1P16 A;  4HJ8 A;  3D3R A;  4EQN A;  1STA A;  4V0B A;  3T1Y Q;  1QIL A;  4KD4 A;  3J80 E;  3VR3 A;  3G6E A;  2OWO A;  3N52 A;  3K7U C;  4JBM A;  3PMF A;  5M5Y H;  4WJ4 A;  5IGF A;  4UP8 A;  1BCP F;  1SNP A;  3U58 A;  5GAG C;  3M7G A;  2PQA B;  3GV3 A;  2EE1 A;  1ONL A;  2RDF A;  3I90 A;  1TS4 A;  2JA6 B;  2IT1 A;  1PFN A;  4DV7 L;  1KLG D;  1HFG A;  1CA5 A;  4P74 A;  3E9I A;  3Q0A A;  1ILQ A;  5KYL A;  1IBL L;  4X3U A;  4K8I A;  1ZYR D;  1H9K A;  1VCI A;  2Q2I A;  3KJP A;  3AMU A;  1O78 A;  4RGO S;  3FRP B;  1T5E A;  1DXM A;  2SNM A;  3OOC A;  3IKJ A;  2VXW A;  4N8F A;  1TWC H;  1V1Q A;  4GKJ Q;  4HCS A;  4A3C H;  1EWC A;  3GTP B;  4MZ9 A;  3GTM H;  1VQA A;  2G9H D;  3J7Z C;  1I50 B;  3SVM A;  2UUA L;  1S5F D;  4XT3 B;  1Q81 C;  4N9T A;  3BYY B;  1IL2 A;  1Y8O B;  4DUY Q;  2CQO A;  1BKB A;  4JV5 Q;  2QF7 A;  1HA5 A;  1G91 A;  1EY6 A;  2EY2 A;  1SFO H;  1CKM A;  2MO1 A;  4IOC A;  1HQR D;  1K8A C;  1MJE A;  1P8L A;  4GN4 B;  4IFD I;  3D31 A;  3S17 H;  2D62 A;  4X3K A;  1A6X A;  5LMN L;  2E75 C;  4JI6 Q;  1JB3 A;  3MEH A;  3HOV H;  2JA7 B;  2F0O A;  1YNN D;  4P2C B;  1WCM H;  3KF6 B;  3G4S A;  2B8G A;  1B4O A;  1Q46 A;  4K6D A;  3UDI A;  3NEN A;  4BBS B;  4LF9 Q;  5I9O A;  1B44 D;  3Q22 A;  2KED A;  3PF4 A;  3T51 B;  1VDZ A;  1RL2 A;  1ASY A;  1LUZ A;  2RCF A;  3SDZ A;  3JC6 6;  3VDY A;  2SOB A;  2UUC Q;  1KAA A;  2B2Y A;  1QNK A;  4HSP A;  2OQK A;  1E1O A;  2MJ8 A;  3E9H A;  4C3I G;  3J81 i;  4JI4 L;  5JPN C;  2HHH Q;  4JW0 A;  2VS1 A;  1D8L A;  4DAM A;  4PMC A;  4LF5 Q;  3C1F A;  2QCP X;  2VUM B;  3TSS A;  1V8Q A;  4DK3 C;  1J5E Q;  1AE3 A;  4FF4 A;  3VYS A;  1UWV A;  2IX1 A;  4I65 A;  1F9Q A;  1D2B A;  3K7A H;  5M3M B;  1KNA A;  2JQO A;  5JJK A;  2Z4H A;  4H13 C;  1A0I A;  3VR2 A;  3MXN B;  1EUJ A;  1JWU D;  3NSW A;  4DAP A;  1RIP A;  1O7L A;  5CR3 A;  5EQ0 A;  1NR4 A;  3JAM i;  1VQ9 A;  4KJO A;  2Q2H A;  1ZEQ X;  3K80 C;  2ES2 A;  1OXS C;  5FLX L;  3SK4 A;  4QIW E;  1C9O A;  4XYQ A;  3CCR A;  4ID6 A;  1VQN A;  1NUC A;  4X3T A;  2K33 A;  1XNQ Q;  3S2H H;  1Y1V B;  1T5X D;  2N88 A;  4JBJ A;  4KY6 A;  5FK9 C;  5I6Y A;  1GOZ A;  1VQF A;  4HJ5 A;  2CHB D;  3OMC A;  2F0S A;  1VQE A;  3R2T A;  4OIJ A;  4K6L A;  4DR1 Q;  1I4G A;  4A3K B;  3S15 B;  3A8K E;  3NP8 A;  4PZ7 A;  1MD2 D;  4R1J A;  3KDF B;  3M4Q A;  2L12 A;  1DCZ A;  5A35 A;  4CJ2 C;  4DR5 Q;  4A3G G;  1BBX C;  5IWA L;  4FDB A;  1O80 A;  4C3J B;  2EY6 A;  1EYC A;  1XYI A;  2TMP A;  1PV4 A;  1Q1B A;  2KUM A;  3J7A F;  4A3L H;  2HCC A;  4KLK A;  3UDG A;  2HUG A;  4A3E H;  1XPU A;  3UI2 A;  2IX0 A;  2OF1 A;  2JJQ A;  1QUQ B;  1EZ6 A;  4RGN A;  3I4N H;  3U9O A;  3PUV A;  2X6L A;  4KKS A;  2Z4I A;  3J80 L;  2UXB Q;  4XQJ A;  4HED A;  1KDB A;  4JI0 Q;  4DR2 L;  1X56 A;  1N36 L;  1U4L A;  4LMQ D;  4HCE A;  3UDX A;  2A1A A;  2F3I A;  2YV5 A;  1JR0 D;  3NTH A;  4JI5 L;  1SLJ A;  2EJF C;  3KOJ A;  4A3B G;  1ET9 A;  1O7Y A;  2ZTC A;  3D8G A;  4A75 A;  4RKL A;  3S1M H;  2PYK A;  3QOJ A;  3E6Z X;  4WOR A;  2NVX H;  1IW7 C;  2LKV A;  3FEW X;  4QMG A;  3HKS A;  4J15 A;  1KXL A;  3CCJ A;  4DV2 Q;  4JYA L;  3EVQ A;  3GQB A;  1MBY A;  3PQI A;  1PH7 A;  5C0X G;  2UUB Q;  1D7Q A;  3ND9 A;  4ME5 A;  1Q8I A;  1E24 A;  1Y1W G;  1WTP A;  2B2W A;  3VR4 A;  1KAW A;  3RZD H;  1BBW A;  5FO9 B;  1FNW A;  3GTJ H;  1X3P A;  1W3S A;  3QB3 A;  2RA4 A;  3X3N A;  3I4M H;  4IUV A;  3SGI A;  4LUZ A;  4QF4 A;  4HJA A;  1SDF A;  1VMP A;  3M4P A;  1EQV A;  1WI5 A;  1BUV T;  2NN6 H;  3HFZ B;  5K36 G;  4BS9 A;  3Q8D A;  4NDX A;  2KA7 A;  1DOK A;  4EVO A;  3FKI G;  4IUN A;  4OX9 L;  2JA8 B;  3PIP 3;  3PUY A;  1YJN A;  3IAY A;  1CQV A;  2JA5 H;  4DK0 A;  1H9S A;  3SEB A;  2Q2T A;  4R4T A;  4LF7 Q;  1HR0 L;  1SRU A;  2EDG A;  2ZTD A;  1KDA A;  1QVG A;  1WTO A;  4DAY B;  1SYG A;  1EYD A;  3NEM A;  2FFK B;  4KHP Q;  4IJL A;  3HOU B;  3P20 A;  4ZKC B;  2ZJQ A;  4DR4 L;  4RA8 A;  3KYH C;  3SK5 A;  5FLX c;  4F8M A;  5JAV A;  1ZYR C;  4X64 L;  2V4D A;  5T1I A;  1B70 B;  1MSH A;  2Y0S G;  4TKO B;  5CC4 A;  3TQY A;  3AFQ A;  2HIX A;  3NQT A;  1GKH A;  2R92 G;  1Q3L A;  4CJ0 B;  1D5Z C;  4OIK A;  4FXK C;  4R8I A;  4HID A;  1PTO B;  3WOE A;  1W6K A;  1UE1 A;  2AWO A;  4IFD G;  3UE0 A;  3F2D A;  4DXG A;  1YNJ D;  2B39 A;  2IL8 A;  4BXX G;  2GN5 A;  4H44 C;  1PMR A;  1SMX A;  1EY9 A;  1TVX A;  2KOL A;  1I94 L;  5JJL A;  4NXN Q;  3MZ5 A;  1HUM A;  4OWX B;  1EIG A;  1E2V A;  2JE6 I;  3D4W A;  3K8A A;  3NE5 B;  3V96 A;  1EU4 A;  5DAU A;  2I46 A;  2VQE Q;  1Z6H A;  2PQA A;  3J80 c;  3U4Z A;  4O42 A;  4A3J H;  3V05 A;  1IBK L;  2A8V A;  2HQL A;  1LTG D;  4Y7N H;  1CUK A;  2E2H H;  2NZH A;  4DNR B;  3L0O A;  3UE1 A;  1G8Z D;  5D3I B;  5CV5 A;  3DHQ A;  4X66 L;  3OTO L;  1AFP A;  4C3H B;  1I4R A;  2O5I C;  5C3E G;  2F03 A;  2NVQ H;  5DM7 3;  2B2T C;  3CF5 A;  4A3G H;  4B3R Q;  1Q8K A;  1RHP A;  1QCB D;  1S5C D;  1IBM L;  1VMC A;  1FJG L;  1AE2 A;  1HZB A;  1KC8 C;  1W6J A;  4OL7 A;  1Y69 U;  2F0M A;  1I6H B;  1BCP C;  2KVM A;  2EYJ A;  1KD1 C;  3I70 A;  1S3O A;  4A3F G;  4KD3 A;  4C3I B;  2CH4 A;  5EGT A;  3RLN A;  2C9O A;  4NXM Q;  4NPS A;  1PRT F;  2F0G A;  4GLA C;  3RNU A;  2EJM A;  1VQM A;  1EIF A;  1K0R A;  1SMY D;  1JJ2 A;  1LO5 D;  1ZKO A;  1E3P A;  2PCF B;  1VQ5 A;  2KJX A;  3T4A C;  2BE5 D;  4BBR G;  2ZTE A;  5LL6 S;  2EOT A;  3CHB D;  3TP5 A;  5BN3 A;  4DR3 Q;  2GVA A;  4H02 A;  2TSS A;  2ZT9 C;  3KF6 A;  1JJC B;  2CVR A;  1WTX A;  4CDF C;  1IHZ A;  1A2T A;  3QOL A;  4A4I A;  3F1Z A;  1O7Z A;  2WFW A;  2JP1 A;  3QWN A;  2MHV A;  4JOI A;  3W1B A;  1K3B C;  2D2C C;  3PIP A;  1A3U A;  2QGQ A;  4J6H A;  3J81 E;  2FHT A;  1Y1W H;  1S5B D;  3KLW A;  2F0N A;  1SYD A;  2XRQ D;  4G7O C;  4JI2 Q;  4XQQ A;  2DJF C;  1L1O C;  3K59 A;  1UE5 A;  2NN6 I;  1D5X C;  4YY3 L;  5AJ3 L;  4J8Q A;  2EVB A;  3GTO B;  2F0W A;  1UAP A;  5K36 H;  2PNH A;  3H0G B;  3UDF A;  1MHW C;  4ZUI A;  3HOZ B;  3FKI H;  1S5D D;  3K5M A;  2J0T D;  1CA6 A;  4OEL B;  3MVV A;  4BWG B;  2YYZ A;  4L5R C;  1NJI C;  4OON A;  2O2L D;  4J1M A;  3KUP A;  2HIV A;  4K2K A;  4A3D B;  1QNU A;  1IL8 A;  5IOD A;  1EEI D;  2K03 A;  4A3C G;  3JAM E;  1D1K A;  1K83 B;  5ELE A;  4K0K Q;  1GUN A;  1GM5 A;  3MXN A;  5EJW A;  4G57 A;  2NVT H;  2YTV A;  2F0V A;  4CGY B;  2ZJP A;  4PQX A;  3K5N A;  4JBK A;  4KKT A;  3AB9 A;  2Z0S A;  2K14 A;  2XRS D;  3SK6 A;  4C2M B;  4R8N A;  2F4I A;  2B8F A;  1G6P A;  2IPK D;  4LWC A;  1TWA B;  4A3B B;  3C2P A;  4ZK9 B;  2R92 H;  1YJ9 A;  4P73 A;  4DN4 M;  2AUJ D;  4PMB A;  3PUW A;  3KDF A;  5E1F A;  4KI0 A;  2OXP A;  2BDO A;  3RN2 A;  1E2W A;  3HOV G;  4IFD H;  3PSI A;  2NUC A;  4LJZ C;  2IY5 B;  2L15 A;  1XJV A;  4BXX H;  2Q8T A;  4GOP C;  4WFN 3;  2JEA I;  2DY8 A;  2ID0 A;  1C48 A;  3DM1 A;  5D3D A;  1VQH A;  4GKK L;  1WTR A;  5C4X H;  1XMQ L;  4JI3 Q;  4DNI A;  1F9S A;  2VQF Q;  4DK1 A;  1HUN A;  1FGU A;  3I7F A;  4B3T L;  1QUQ A;  3R3O A;  4B3M Q;  4GZY C;  1PH6 A;  2C35 B;  4GNX B;  1QOH A;  4A3M G;  3CQZ H;  4R4O A;  2MUY A;  1Q86 C;  5FO7 B;  2Q8I B;  3ONA B;  4JI1 L;  3DMU A;  1YIT A;  2ENB A;  2NYZ D;  1NNX A;  2F3V A;  4LNQ A;  2A6E D;  4DA2 A;  4IFD J;  1F9P A;  4S3S A;  2DGY A;  3CCS A;  3AQQ A;  4KHV A;  1GVP A;  2F3W A;  1O7I A;  1HTL D;  4A76 A;  2JN4 A;  2K5V A;  3EN2 A;  1PH1 A;  2EXD A;  2YU9 B;  1JOR A;  4XDX A;  2RHS B;  3A7L A;  5BR8 L;  1MGS A;  3AU7 A;  1EOT A;  1C0A A;  2PQE A;  3CC7 A;  4IZ8 A;  4X65 L;  4DV6 Q;  5IY0 A;  3F2C A;  1TWG H;  3BDL A;  1EZ8 A;  5C4H A;  3S9W A;  4AYB E;  3K57 A;  2RKS A;  5GAD C;  4K8J A;  1SE2 A;  5M9O A;  1TS5 A;  1EY0 A;  1UE7 A;  2KQ3 A;  2WB1 B;  2X6G A;  2K4K A;  4BBR H;  1N34 L;  1B1Z A;  3M85 A;  1SYB A;  4QUC A;  4DV3 Q;  3HOW B;  1TWH B;  1BO0 A;  3FPU B;  1B9M A;  4GOP B;  1XTC D;  3FHW A;  3D4D A;  3OW7 A;  1LTI D;  3C3L A;  4HMJ A;  1VQP A;  3T1Y L;  1X9N A;  1PTO D;  4IUR A;  1SXT A;  2A68 D;  2FJ2 A;  1RDP D;  1PH8 A;  4DAY A;  3QJY A;  3CCU A;  2R7Z H;  1F2Y A;  1SJE D;  3EQL C;  3A54 A;  1ILP A;  3PUZ A;  4BY1 H;  4A3L G;  2DUD A;  5A2Q E;  4A3E G;  4LFC L;  1VQG A;  1U9R A;  3T16 A;  2WKC A;  1GHJ A;  3I4N G;  2HD3 A;  1SYF A;  1VQJ A;  5C3E B;  1C4Q A;  3J81 L;  1ET6 A;  1HNW Q;  1EFW A;  4A3I B;  1L0W A;  1ASZ A;  1QB5 D;  3M3Y H;  2L11 A;  3RZO H;  4QCL A;  1IKL A;  3M7N A;  4F87 A;  1LAC A;  1WVL A;  2XN9 C;  2IWH A;  4GKJ L;  4A93 G;  2H1E A;  1L0X B;  3HP3 A;  2WP8 J;  1MIU A;  1RKN A;  1EQR A;  3MC0 B;  3S24 A;  2WAQ G;  4A3F B;  2Z6B A;  5LMU Q;  1U4M A;  2BH2 A;  1X32 A;  4QB4 A;  2L9H A;  2KHJ A;  3S16 H;  1K3R A;  1WJJ A;  4UAI A;  1X55 A;  5I9P A;  2LS0 1;  3OWE B;  3F2U A;  2SNS A;  4XIG S;  2CWP A;  4JV5 L;  5M5X B;  2JSO A;  5D14 A;  3HOX H;  1JE4 A;  2EIF A;  3B6Y A;  3JAM L;  1FR3 A;  5JVH 3;  4OXP A;  1FNV A;  1QVF A;  3S1R H;  4RGM A;  2YTX A;  3F8T A;  3TZD A;  5IP9 H;  4JI7 Q;  1YHA A;  1PFM A;  3LX0 A;  3KFU A;  4FP5 D;  3U4V A;  5FO8 B;  3S1Q B;  2R7F A;  3I4M G;  2E2J H;  1SNM A;  3PO3 B;  5C44 H;  2NN6 G;  3FPP A;  4JI6 L;  1SEB D;  1LLR D;  3LGJ A;  3A74 A;  3MHB A;  1HTP A;  3TBI B;  4BA2 I;  1DOL A;  3WOF A;  2XWB B;  4IN3 A;  3GV6 A;  2PMZ B;  1B8A A;  2JA5 G;  1GUG A;  4LF9 L;  2PNR C;  3BVZ A;  1R4Q B;  5IYB H;  1WFQ A;  1NMF A;  5IT9 E;  5M5Y B;  2AMC B;  1STB A;  1LT3 D;  3HRZ C;  1J8I A;  1I3Q H;  3L3O C;  3GTL H;  2UUC L;  4JCV E;  3OMG A;  5EAY A;  3SXH A;  3CRK C;  2RBM A;  4B08 A;  4UP9 A;  3TRE A;  3P1H A;  3W2D A;  2EXZ A;  3I4L A;  2OTL A;  4G4K A;  4X62 Q;  3R8B A;  1H95 A;  4A3M H;  1K73 C;  2HHH L;  4JVZ A;  4DPG A;  5EKK A;  1H9J A;  1X6O A;  5JJI A;  1J5E L;  4AH6 A;  1TWC B;  3KK7 A;  3G6J B;  1LTS D;  2MGS A;  2CW0 C;  5KEE A;  5CBA E;  3GTM B;  5ELO A;  2B63 B;  4CJ1 B;  3NPP A;  5CBE E;  3OSO A;  1F9R A;  3W1G A;  1SAP A;  4UDU C;  1TWF H;  1B50 A;  1HNZ L;  3VA5 A;  1R9T H;  3EBE A;  1PVO A;  1JOK A;  1LT5 D;  4CDD C;  3W5O A;  2K5Q A;  1PRT C;  1I4Q A;  4LF4 Q;  2K1B A;  4JI4 Q;  2PPB C;  1JIC A;  1SFO B;  1TT2 A;  1H9M A;  1XNQ L;  2ZXP A;  1YZ6 A;  3DWP A;  2OQ0 A;  4DUZ L;  2ICE C;  4CHT B;  5ELN A;  5G3L D;  2PI2 A;  3S17 B;  1AEX A;  1XPR A;  4A3J G;  2G9D A;  4IAL A;  2AKW B;  2J4X A;  2WV6 D;  3QO2 A;  3HOV B;  1OXU A;  1XMO Q;  1CHQ D;  1WCM B;  2KCT A;  2KCC A;  2B2U A;  1K9M C;  3KF8 B;  5FLM G;  3GTG H;  1VQ7 A;  5NUC A;  4DR5 L;  3DUZ A;  2EYP A;  4CKE A;  3A5U A;  1STY A;  1SE3 A;  1EY7 A;  5C4J H;  3M9B A;  3KLS A;  3STB C;  4I7Z C;  4YCV A;  4DR6 L;  3NHH A;  1DZ1 A;  1L0Y B;  2A69 D;  5K5P A;  2B2V C;  1PH2 A;  5L37 A;  3OIP A;  2K04 A;  4DV0 Q;  1EIH A;  2KCM A;  1BDO A;  1PFS A;  1V43 A;  4IJH A;  4PNY A;  3OYY A;  4POF A;  1XNR L;  2UXB L;  3D4R A;  2KEN A;  1B53 A;  4JI0 L;  3A56 A;  1BOS A;  1TY0 A;  1UUP A;  2UXD Q;  2LXJ A;  5E4W C;  1A2U A;  5A2Q L;  4LFA L;  5JEA G;  5DM6 3;  2NZ1 D;  4A93 H;  3A8I E;  3K7A B;  1II3 A;  3T53 B;  2LSS A;  4N8X 1;  3ULJ A;  1Q7Y C;  1B3A A;  2ALY B;  1VQC A;  1PRT B;  4AIM A;  2VB3 X;  4DV2 L;  5DEH A;  2O4X A;  3HOY G;  2UUB L;  4ZCK A;  3MFG A;  1DGS A;  4ZUJ A;  4LW1 A;  4X3S A;  2K01 A;  2RDH A;  1S72 A;  5KNC A;  2A6H D;  4Q5V A;  4YCW A;  3P75 A;  1SN8 A;  2RCN A;  1YIJ A;  2HDM A;  3S2H B;  4GNX A;  1A3T A;  4UHV A;  1LTL A;  2WB1 E;  3T56 B;  3PF5 A;  4DK6 C;  4IPH A;  1KHI A;  5FJ8 H;  4NP5 A;  3S1N H;  2CWA A;  4KJN A;  2E5L Q;  1PTO H;  1HNX Q;  5M3F B;  4OHJ A;  3CC4 A;  4JBW A;  1QJO A;  1QZH A;  5KRU A;  3HKZ B;  3J81 j;  3N6R A;  1GO3 E;  2EYF A;  3CRL C;  1UEB A;  5CV6 A;  4DV5 L;  4Q0F A;  4N9P A;  3GTQ H;  4LF7 L;  4K5X A;  4RKB A;  2EQS A;  3T1H Q;  1V9P A;  2A74 C;  4M1U B;  4RHR A;  5EPL A;  1CQF A;  1I6V C;  1ENA A;  1FVI A;  2GA4 B;  2F1M A;  2L1B A;  3RUZ A;  3DM3 A;  4KHP L;  1UEA B;  1CKO A;  4A3E B;  1MI2 A;  3BZC A;  4K5V A;  4QUF A;  2SEB D;  3I4N B;  3GDE A;  3GD7 A;  4WRD A;  2ATW A;  1J9O A;  1KQS A;  5IT9 L;  2AUK A;  1SYC A;  1A15 A;  2YTY A;  2E76 C;  4IUP A;  3ND8 A;  4KY5 A;  2R93 G;  3PCO B;  2WAQ B;  3S1M B;  3PV0 A;  2NVX B;  1DD2 A;  1LT6 D;  4GOP A;  3NBI A;  1PH3 A;  3GTK H;  1NSN S;  2BCO A;  2E74 C;  4DR4 Q;  4B3S Q;  1H9R A;  1VS0 A;  2EYL A;  4NXN L;  2CQA A;  5GAE C;  4NKL A;  5J39 A;  4X64 Q;  2MFI A;  4HN7 A;  1VF7 A;  3RZD B;  4HMI A;  2B2Y C;  1N33 Q;  1B7Y B;  1G2S A;  3KBX A;  1NBW A;  5LHY 1;  3GTJ B;  5C4X G;  2XIW A;  3E3X A;  3I4M B;  4OO1 I;  3HS0 C;  2JA9 A;  4YHH Q;  1G29 1;  2PO4 A;  1YNN C;  1EYA A;  3VYU A;  4IO9 A;  1ESF A;  3CMA A;  2ZJR A;  4DV1 Q;  2K05 A;  3M4O H;  3GO5 A;  3PO2 H;  4IOA A;  1G51 A;  4M8A A;  5FLM H;  1PLF A;  3A0J A;  4B3R L;  4LAA A;  4FXD A;  3EJI A;  2ICI A;  3I8Z A;  4GN5 A;  5I2Y A;  4H0L C;  1PZJ D;  2XWJ B;  2WKD A;  3BDO A;  1VQ4 A;  1EQT A;  1OO9 B;  5JVG 3;  3TP8 A;  5IGC A;  1A3V A;  3TZU A;  1WTV A;  3A5Z B;  3S2D B;  1DON A;  1M8A A;  3VYT A;  4NXM L;  1IBK Q;  1SBB B;  2F4V L;  4C1N I;  1FYC A;  4QY7 A;  2MQH A;  4ODG A;  2ASB A;  3VR6 A;  3BVG A;  3H0G H;  5COY A;  3OTO Q;  1D5M C;  4AQY Q;  1AH9 A;  3HOZ H;  4LK1 C;  3I55 A;  2NTS A;  3KLS X;  5JEA H;  1NAP A;  4FO2 A;  5KYI A;  5IIF A;  3HGB A;  3E5S A;  1K83 H;  3SE0 A;  4KK7 A;  4JPB W;  1YHQ A;  1N32 L;  3EFX D;  1V1P B;  1EY8 A;  1JWM D;  3HOY H;  3BVM A;  3NWS A;  2NZO A;  2UU9 Q;  3I3C A;  5LMN W;  4QL5 A;  1D6E C;  2R7Z G;  3LWE A;  2F0J A;  2MNA A;  4LF8 Q;  4BY1 G;  4JI2 L;  4A3J B;  3MAQ A;  2ZXR A;  5IT9 c;  3H15 A;  4MIU A;  4Y7N B;  3RLO A;  2E2H B;  5H1S E;  4WJ3 M;  4P72 A;  1TII D;  3ERO A;  2ZM6 Q;  2UXC Q;  2EYO A;  2A69 C;  2NVQ B;  2JA7 G;  5TSS A;  1JOO A;  2K5W A;  5JEA J;  2E2I H;  4ULL A;  4PMW A;  1DOM A;  3A8J E;  4A3G B;  4B9W A;  1E1T A;  1EYG A;  1KDC A;  1YHB A;  5IP7 G;  3H3V H;  1BCP B;  1IYU A;  4RCN A;  3S14 H;  4G7H C;  5CV4 A;  4K0K L;  2JYO A;  3T13 A;  3CCM A;  1C7Y A;  2CFM A;  2LFN A;  3K81 C;  4XQN A;  4FF3 A;  1LTT D;  4BY7 H;  5IYD H;  1BQQ T;  2PW7 A;  3TP7 A;  5AJ3 Q;  1SE8 A;  3CXC A;  4K5W A;  5IGD A;  5E4X A;  3HOX G;  3CP0 A;  2F0K A;  4P75 A;  3F2B A;  4DR7 L;  2L0C A;  5IP9 G;  1UE6 A;  2H4O A;  5EPK A;  2A19 A;  3IL8 A;  1U4R A;  2OEO A;  2R93 H;  5J1Z A;  1VF5 C;  4KV6 A;  5C44 G;  3KF8 A;  1Q90 A;  4CDE C;  3ULP A;  1BXT A;  1VQL A;  5C6A A;  1DYQ A;  1ESR A;  5AFW A;  5M3M G;  4JI8 Q;  1PTO F;  1EWI A;  3I91 A;  3ULL A;  5IYB G;  1TQO A;  2NVY H;  1XTD A;  4QIW B;  1Y1W B;  4JI3 L;  1JWS D;  1F2Z A;  1Y14 B;  2EPB A;  2VQF L;  5JOB A;  4KN7 C;  1PFB A;  5E3F A;  3C46 A;  1L1O B;  4CKB A;  1PZK D;  2JK8 A;  3I72 A;  3NBH B;  3BDC A;  1JB7 A;  2AQ1 B;  2CCZ A;  1E22 A;  4ME3 A;  3ICE A;  2XSC A;  1HH2 P;  3DEO A;  1RF2 D;  5C3X A;  4KY7 A;  4L6T B;  5C5M A;  4DV4 Q;  4A3K G;  3HOW H;  2M2L A;  3HKZ E;  1X3E A;  3FKI B;  1CZG A;  4DKA C;  4NB3 A;  2F0H A;  5JJZ A;  5D65 A;  1G6Z A;  1EFI D;  1N9W A;  2AHO B;  2F0I A;  4TRD A;  3R2I A;  4C3J G;  1TY2 A;  2XGT A;  3MA2 B;  3U50 C;  5J22 A;  1CSP A;  2F0Q A;  1SNO A;  3HG9 A;  4RFB A;  3HZX A;  2NVT B;  3VR5 A;  4G7Z C;  4FNF A;  1NR2 A;  5ELF A;  3I2Z A;  4QJF A;  4DV6 L;  3FDT A;  1F2L A;  1B2T A;  3MXG A;  1XWE A;  2RQX A;  1GUO A;  2Y0S B;  2JA6 H;  2Q2U A;  1WOC A;  2E8G A;  2R92 B;  1DM0 B;  1RTN A;  1IXR A;  2F0P A;  2QA4 A;  1YNJ C;  2FXQ A;  1IYJ B;  4IUU A;  5EBD A;  4DV3 L;  3SK8 A;  2F0T A;  4KN4 C;  3GTP H;  3TS2 A;  3I56 A;  4LFB Q;  1TXY A;  4IQZ A;  4LF6 Q;  1RCV D;  4XYO A;  2ZXO A;  2PW5 A;  1I50 H;  2B2V A;  1WTH A;  4MNO A;  1HZC A;  2KEC A;  4TQU S;  4X65 Q;  1GD7 A;  3I73 A;  1C8C A;  2HCI A;  4Z9C B;  1JT8 A;  3G71 A;  5C4X B;  3FVQ A;  1CSQ A;  3NXW A;  4LUO A;  3CCE A;  4GLX A;  2I07 B;  1KRS A;  2XTI A;  1JQY D;  5JPM C;  3BJU A;  1KRT A;  1CI3 M;  3QG1 A;  1OXX K;  3NTK A;  1YI2 A;  1HA6 A;  4RCO A;  5ELB A;  1CZW A;  2F0D A;  3S1Q H;  1AW7 A;  1HR0 W;  1GUW A;  2KCN A;  5COR A;  2QDL A;  4LUV A;  2QEX A;  5CV8 A;  3ERS X;  2C5C A;  2Z6K C;  1HNW L;  3IRB A;  4C1N K;  1YVC A;  5CGK A;  1YJW A;  5F2D A;  3CW2 C;  4F88 A;  5KNB A;  2JA8 G;  1SJH D;  2JA7 H;  2FMM A;  1IYV A;  1S40 A;  3H3V I;  3MWY W;  2IX3 A;  2BA0 A;  4RH6 A;  3WDN A;  4YIJ A;  1HXY D;  2RDG A;  2FIN B;  5LMU L;  5IP7 H;  4BBS H;  3RN5 A;  3E0E A;  4RG1 A;  2D0O A;  4JOI C;  2B3G A;  2MO0 A;  1FL0 A;  1STH A;  5M5W B;  2O5J C;  1EOV A;  3HOU G;  4LFC Q;  1I4P A;  1WD1 A;  3PGZ A;  2BH8 A;  5I6W A;  2L55 A;  2L4N A;  1SMY C;  1TWG B;  1STE A;  1FD7 D;  3DLL A;  1I4X A;  4E6I A;  1ROD A;  4H7B A;  4DUY L;  3L2P A;  3ERQ A;  3SR1 A;  2BE5 C;  4AYB G; 
#chains in the Genus database with same CATH homology
 1EU3 A;  3TME A;  1QWY A;  5G3L F;  1IKM A;  2WIN B;  3J7A V;  4BBR B;  5FOB B;  1CK1 A;  3RLF A;  2HDL A;  3CU7 A;  4K2L A;  1EY5 A;  2K7V A;  3MTS A;  2LMC B;  1TKW B;  2RSN A;  2D5D A;  5BN4 A;  2R7Z B;  4EGV A;  2AQ2 B;  3A7A B;  2R61 A;  4BY1 B;  1OXV A;  5CV7 A;  1BNZ A;  2PZW A;  1ENC A;  1SE4 A;  1GUT A;  3DWQ A;  1KNE A;  2K5D A;  3M3Y B;  3RZO B;  1GJX A;  3TDQ A;  4C3H G;  5ISR A;  5CYU A;  4FVM A;  4IUT A;  4R9W A;  3TP6 A;  4CKC A;  3TN2 A;  4XT1 B;  2SDF A;  1Q12 A;  1S4Z A;  3S16 B;  5T1G A;  1V1P A;  2X69 A;  1V1O A;  2MPM A;  4L63 B;  1ML0 D;  4RHS A;  5I4D A;  5CV9 A;  3K5L A;  1BCP D;  2VNU D;  1CT1 D;  3HOX B;  1SNC A;  2R3Z A;  2IJ0 A;  4MHE A;  1JCK B;  3S1R B;  1S5E D;  2MP1 A;  5KIX A;  5ELC A;  2E2J B;  3U9S A;  5C44 B;  1QG7 A;  2DNE A;  4OO1 H;  1SND A;  2NBF A;  2B2T A;  2L5T A;  5BN5 A;  1X3Q A;  4DGZ A;  1I3Q B;  1E2Z A;  3GTL B;  1STG A;  1OXT A;  4FXG C;  1HCZ A;  2A73 B;  1AN8 A;  3NQI A;  2JEB I;  4A3M B;  4L8J A;  2KEE A;  3RD4 A;  4HSV A;  5EKL A;  2A6E C;  5I2X A;  1WTQ A;  4MN3 A;  3BS1 A;  3KBG A;  1I4H A;  1BR9 A;  4XXE A;  4DFA A;  3E0J A;  2EJG C;  2EY1 A;  3OIQ A;  1PYW D;  1LAB A;  1TWF B;  1R9T B;  4K14 A;  2XNA C;  3Q24 A;  4ZKB B;  1JC7 A;  5IGG A;  3HEJ A;  4DF7 A;  3NWT A;  2EYM A;  1GHK A;  1F2M A;  4NW2 A;  1BF4 A;  4FF1 A;  3NBH A;  1EWH A;  1LTB D;  2PZT A;  4KMU C;  3GTG B;  1PTO C;  2A68 C;  1M4V A;  3J7Y W;  5C4J B;  2AQ3 B;  3OPO A;  5EKI A;  4RAU C;  5EPJ A;  5KND A;  4JK1 C;  3DXJ C;  3LNN A;  2NWG A;  1XXG A;  3R93 A;  5C3W A;  1Y8N B;  3SHL A;  2F0U A;  3H6M A;  4ZAI A;  3D6W A;  2Q8R E;  3IFD A;  1PXU A;  1CFM A;  2QKI C;  4HAE A;  1CHP D;  2FMC A;  4A93 B;  4KHZ A;  4DU9 A;  1WD0 A;  1CM9 A;  4C56 C;  1HFN A;  3RMH A;  1JOQ A;  4ZLT F;  4WJW A;  5IGE A;  1EY4 A;  1Y8P B;  3BZD B;  1AZQ A;  4KKU A;  5DNF A;  4AYB B;  3NUC A;  2N55 A;  1GXD C;  3L9A X;  3S1N B;  4U68 A;  1WTW A;  1AZP A;  1K8O A;  5FKA C;  2AWN A;  1CTM A;  1FNU A;  3GTQ B;  2E2D C;  2QEJ C;  2JA5 B;  3K5O A;  2HQE A;  5C5L A;  3NTI A;  1K8M A;  3ZYY X;  4FYD A;  3O13 A;  3PUX A;  1HPC A;  1Z47 A;  4U67 3;  1PDQ A;  4HTH A;  2F0F A;  4ZRZ A;  1AP0 A;  5EBC A;  2A5H A;  2F0E A;  2NB0 A;  2WAC A;  1UNS A;  3PIO 3;  2B2U C;  1RD9 D;  4DAV A;  2R6G A;  4ABN A;  3GTK B;  2D9U A;  2KHS A;  1KLU D;  1KTK A;  1B9N A;  2Z1C A;  4ZYS A;  4O1N A;  2PZU A;  2K32 A;  1GUS A;  3V2T A;  4BA1 I;  2M00 A;  1ZXT A;  4XTC S;  1STN A;  3DEP A;  4EQP A;  2M9V A;  2EZV A;  2BOS A;  3K6O A;  3KLR A;  1NCV A;  1ICW A;  4F7X A;  3P7J A;  4DNT B;  3FMC A;  3M4O B;  5CMD A;  3K58 A;  3PO2 B;  3OWF A;  1SSO A;  2XVS A;  3X3M A;  1LTR D;  3BG3 A;  5C0X H;  4HR7 B;  1RJT A;  2EYH A;  2DY7 A;  3H3V C;  1HRJ A;  3CKI B;  1EEF D;  2QDB A;  3MXU A;  2B2W C;  3D6C A;  2WII B;  1R4P B;  1Z7T A;  2K28 A;  1RTO A;  2K6A A;  2IW3 A;  3IFT A;  5LL6 X;  4IUQ A;  3VYR A;  1ENF A;  5C0X J;  2JXM B;  3OHX C;  2CW0 D;  3HOY B;  3M4Y A;  2A6H C;  1PZI D;  4ILW A;  4NMZ A;  5IOC A;  2OT2 A;  5IGB A;  3H09 A;  2DN8 A;  5C4Z A;  3L7Z C;  2F0L A;  2BDN A;  5HGT A;  1KAB A;  1QE6 A;  1PRT D;  1Q1E A;  4RGT A;  3DWA A;  1SYE A;  1MSG A;  4DXF A;  3H94 A;  4CBV A;  1G2T A;  1D1I A;  1EL0 A;  4PV1 C;  3G7L A;  1LT4 D;  5KGU A;  2QIL A;  2E2I B;  1TS3 A;  3S14 B;  1LV9 A;  3BYT B;  2EY5 A;  4KTA A;  5ELD A;  5HUR A;  4FF2 A;  4BY7 B;  3EA6 A;  3K0Y A;  1XX8 A;  1HHV A;  3QIA A;  1DJR D;  4OGQ C;  1TR5 A;  2RVL A;  3URY A;  3A55 A;  3GP7 A;  3Q6S A;  4B9X A;  2R93 B;  1H9S B;  4RWS C;  3H91 A;  2RSO A;  4OO1 G;  4EQO A;  5FLX E;  3LWU A;  1TS2 A;  4ZQ3 A;  1SNQ A;  1FGB D;  4V19 0;  3MXP A;  3W3A A;  1F77 A;  3C1E A;  2NVY B;  4TSS A;  3MFY A;  1IW7 D;  2NTT A;  3Q23 A;  2DNC A;  1U4P A;  1E0B A;  2VB2 X;  1TU2 B;  2J7Z A;  3CQZ B;  1LTA D;  1HQM C;  2BA1 A;  3VA7 A;  3NK9 A;  2LY7 A;  5C0X I;  2Z8L A;  3ITP A;  3D3R A;  4EQN A;  1STA A;  4V0B A;  1QIL A;  4KD4 A;  3J80 E;  3VR3 A;  3N52 A;  3PMF A;  5IGF A;  1BCP F;  1SNP A;  3M7G A;  3GV3 A;  2EE1 A;  1ONL A;  2RDF A;  3I90 A;  1TS4 A;  2JA6 B;  2IT1 A;  1PFN A;  1KLG D;  1HFG A;  1CA5 A;  3Q0A A;  1ILQ A;  5KYL A;  4X3U A;  4K8I A;  1ZYR D;  1H9K A;  1VCI A;  3AMU A;  1O78 A;  4RGO S;  3FRP B;  1T5E A;  1DXM A;  2SNM A;  3OOC A;  3IKJ A;  2VXW A;  4HCS A;  1EWC A;  3GTP B;  2G9H D;  1I50 B;  3SVM A;  1S5F D;  4XT3 B;  4N9T A;  3BYY B;  1Y8O B;  2QF7 A;  1HA5 A;  1G91 A;  1EY6 A;  2EY2 A;  1HQR D;  4IFD I;  3D31 A;  2D62 A;  4X3K A;  1A6X A;  2E75 C;  1JB3 A;  3MEH A;  2JA7 B;  2F0O A;  1YNN D;  4P2C B;  2B8G A;  1B4O A;  4K6D A;  4BBS B;  5I9O A;  1B44 D;  3Q22 A;  2KED A;  3T51 B;  1VDZ A;  3SDZ A;  2SOB A;  1KAA A;  2B2Y A;  1QNK A;  4HSP A;  2MJ8 A;  4C3I G;  5JPN C;  4PMC A;  3C1F A;  2QCP X;  2VUM B;  3TSS A;  1V8Q A;  4FF4 A;  3VYS A;  2IX1 A;  4I65 A;  1F9Q A;  1D2B A;  5M3M B;  1KNA A;  2Z4H A;  4H13 C;  3VR2 A;  1JWU D;  3NSW A;  4DAP A;  5CR3 A;  1O7L A;  5EQ0 A;  1NR4 A;  4KJO A;  1ZEQ X;  1OXS C;  5FLX L;  3SK4 A;  4XYQ A;  4ID6 A;  1NUC A;  4X3T A;  2K33 A;  1Y1V B;  1T5X D;  2N88 A;  4KY6 A;  5FK9 C;  5I6Y A;  1GOZ A;  2CHB D;  3OMC A;  2F0S A;  3R2T A;  4OIJ A;  4K6L A;  1I4G A;  4A3K B;  3S15 B;  3A8K E;  3NP8 A;  1MD2 D;  2L12 A;  1DCZ A;  5A35 A;  4CJ2 C;  1BBX C;  1O80 A;  4C3J B;  2EY6 A;  1EYC A;  1XYI A;  2TMP A;  1Q1B A;  2KUM A;  3J7A F;  2HCC A;  2HUG A;  3UI2 A;  2IX0 A;  2OF1 A;  1EZ6 A;  4RGN A;  3U9O A;  3PUV A;  2X6L A;  4KKS A;  2Z4I A;  3J80 L;  4XQJ A;  4HED A;  1KDB A;  1U4L A;  4LMQ D;  4HCE A;  1JR0 D;  3NTH A;  2EJF C;  1ET9 A;  1O7Y A;  3D8G A;  4RKL A;  2PYK A;  3QOJ A;  3E6Z X;  4WOR A;  1IW7 C;  2LKV A;  3FEW X;  4QMG A;  3EVQ A;  3GQB A;  1MBY A;  5C0X G;  3ND9 A;  4ME5 A;  1Q8I A;  1WTP A;  2B2W A;  3VR4 A;  5FO9 B;  1FNW A;  1X3P A;  3QB3 A;  2RA4 A;  3X3N A;  4IUV A;  4QF4 A;  1SDF A;  1VMP A;  1EQV A;  1BUV T;  2NN6 H;  5K36 G;  4BS9 A;  4NDX A;  2KA7 A;  1DOK A;  4EVO A;  4IUN A;  2JA8 B;  3PIP 3;  3PUY A;  3IAY A;  1CQV A;  4DK0 A;  1H9S A;  3SEB A;  2EDG A;  1KDA A;  1WTO A;  1SYG A;  1EYD A;  2FFK B;  3HOU B;  3P20 A;  4ZKC B;  4RA8 A;  3SK5 A;  4F8M A;  5JAV A;  1ZYR C;  2V4D A;  5T1I A;  1MSH A;  4TKO B;  5CC4 A;  3NQT A;  1Q3L A;  4CJ0 B;  1D5Z C;  4OIK A;  4FXK C;  4R8I A;  1PTO B;  3WOE A;  1W6K A;  2AWO A;  4IFD G;  4DXG A;  1YNJ D;  2B39 A;  2IL8 A;  4H44 C;  1PMR A;  1EY9 A;  1TVX A;  2KOL A;  3MZ5 A;  1HUM A;  1EIG A;  1E2V A;  2JE6 I;  3D4W A;  3NE5 B;  3V96 A;  1EU4 A;  5DAU A;  2I46 A;  1Z6H A;  4O42 A;  3V05 A;  1LTG D;  4DNR B;  1G8Z D;  5D3I B;  5CV5 A;  3DHQ A;  1AFP A;  4C3H B;  1I4R A;  2O5I C;  2F03 A;  5DM7 3;  2B2T C;  1RHP A;  1QCB D;  1S5C D;  1VMC A;  1W6J A;  4OL7 A;  1Y69 U;  2F0M A;  1I6H B;  1BCP C;  2KVM A;  2EYJ A;  3I70 A;  4KD3 A;  4C3I B;  5EGT A;  2C9O A;  1PRT F;  2F0G A;  2EJM A;  1SMY D;  1LO5 D;  1ZKO A;  2PCF B;  2KJX A;  3T4A C;  2BE5 D;  5LL6 S;  2EOT A;  3CHB D;  3TP5 A;  5BN3 A;  2TSS A;  2ZT9 C;  2CVR A;  1WTX A;  1IHZ A;  1A2T A;  3QOL A;  1O7Z A;  2JP1 A;  3QWN A;  2MHV A;  2D2C C;  1A3U A;  3J81 E;  4J6H A;  2FHT A;  1S5B D;  2F0N A;  1SYD A;  2XRQ D;  4G7O C;  4XQQ A;  3K59 A;  2NN6 I;  1D5X C;  4J8Q A;  2EVB A;  3GTO B;  2F0W A;  1UAP A;  5K36 H;  3H0G B;  4ZUI A;  3HOZ B;  1S5D D;  3K5M A;  2J0T D;  1CA6 A;  3MVV A;  4BWG B;  2YYZ A;  2O2L D;  4J1M A;  3KUP A;  4K2K A;  4A3D B;  1QNU A;  1IL8 A;  5IOD A;  1EEI D;  2K03 A;  3JAM E;  1D1K A;  1K83 B;  5ELE A;  1GUN A;  3MXN A;  5EJW A;  4G57 A;  2F0V A;  4CGY B;  4PQX A;  3K5N A;  4KKT A;  3AB9 A;  2XRS D;  3SK6 A;  4C2M B;  4R8N A;  2F4I A;  2B8F A;  2IPK D;  1TWA B;  4A3B B;  3C2P A;  4ZK9 B;  4DN4 M;  2AUJ D;  4PMB A;  3PUW A;  5E1F A;  4KI0 A;  2OXP A;  2BDO A;  1E2W A;  4IFD H;  2NUC A;  4LJZ C;  2Q8T A;  4WFN 3;  2JEA I;  2DY8 A;  2ID0 A;  1C48 A;  3DM1 A;  5D3D A;  1WTR A;  1F9S A;  4DK1 A;  1HUN A;  3R3O A;  4GZY C;  1QOH A;  2MUY A;  5FO7 B;  2Q8I B;  3ONA B;  3DMU A;  2ENB A;  2NYZ D;  2F3V A;  2A6E D;  4DA2 A;  4IFD J;  1F9P A;  4S3S A;  4KHV A;  2F3W A;  1HTL D;  2YU9 B;  1JOR A;  4XDX A;  3A7L A;  1MGS A;  3AU7 A;  1EOT A;  2PQE A;  4IZ8 A;  3BDL A;  1EZ8 A;  5C4H A;  3S9W A;  3K57 A;  2RKS A;  4K8J A;  1SE2 A;  5M9O A;  1TS5 A;  1EY0 A;  2WB1 B;  2KQ3 A;  2X6G A;  1B1Z A;  3M85 A;  1SYB A;  4QUC A;  3HOW B;  1TWH B;  1BO0 A;  3FPU B;  1B9M A;  1XTC D;  3OW7 A;  3D4D A;  1LTI D;  3C3L A;  4HMJ A;  1PTO D;  4IUR A;  1SXT A;  2A68 D;  2FJ2 A;  1RDP D;  4DAY A;  3QJY A;  1F2Y A;  1SJE D;  3EQL C;  3A54 A;  1ILP A;  3PUZ A;  5A2Q E;  1U9R A;  3T16 A;  2WKC A;  1GHJ A;  1SYF A;  5C3E B;  1C4Q A;  3J81 L;  1ET6 A;  4A3I B;  1QB5 D;  4QCL A;  2L11 A;  1IKL A;  3M7N A;  4F87 A;  1LAC A;  1WVL A;  2XN9 C;  2IWH A;  2H1E A;  1L0X B;  3HP3 A;  2WP8 J;  1RKN A;  3MC0 B;  4A3F B;  1U4M A;  1X32 A;  4QB4 A;  2L9H A;  4UAI A;  5I9P A;  2LS0 1;  3OWE B;  3F2U A;  2SNS A;  4XIG S;  5M5X B;  2JSO A;  5D14 A;  1JE4 A;  3JAM L;  5JVH 3;  1FR3 A;  1FNV A;  4RGM A;  3TZD A;  1PFM A;  3LX0 A;  4FP5 D;  3S1Q B;  5FO8 B;  1SNM A;  3PO3 B;  2NN6 G;  3FPP A;  1SEB D;  1LLR D;  3MHB A;  1HTP A;  3TBI B;  4BA2 I;  1DOL A;  3WOF A;  2XWB B;  4IN3 A;  3GV6 A;  2PMZ B;  1GUG A;  2PNR C;  3BVZ A;  1R4Q B;  5IT9 E;  5M5Y B;  1STB A;  1LT3 D;  3HRZ C;  1J8I A;  3L3O C;  3OMG A;  3SXH A;  3CRK C;  2RBM A;  4B08 A;  3W2D A;  3P1H A;  2EXZ A;  3I4L A;  4G4K A;  3R8B A;  5EKK A;  1H9J A;  1TWC B;  3KK7 A;  3G6J B;  1LTS D;  2MGS A;  2CW0 C;  5KEE A;  5CBA E;  3GTM B;  2B63 B;  4CJ1 B;  3NPP A;  5CBE E;  3OSO A;  1F9R A;  1SAP A;  4UDU C;  1B50 A;  3VA5 A;  1JOK A;  1LT5 D;  2K5Q A;  1PRT C;  1I4Q A;  2K1B A;  2PPB C;  1JIC A;  1SFO B;  1TT2 A;  1H9M A;  2ZXP A;  3DWP A;  2ICE C;  4CHT B;  5G3L D;  3S17 B;  1AEX A;  2G9D A;  4IAL A;  2J4X A;  2WV6 D;  3QO2 A;  3HOV B;  1OXU A;  1CHQ D;  1WCM B;  2KCC A;  2B2U A;  5NUC A;  3DUZ A;  4CKE A;  2EYP A;  1STY A;  1SE3 A;  1EY7 A;  3KLS A;  4I7Z C;  3NHH A;  1DZ1 A;  1L0Y B;  2A69 D;  5K5P A;  2B2V C;  3OIP A;  2K04 A;  1EIH A;  1BDO A;  1V43 A;  4PNY A;  3D4R A;  1B53 A;  3A56 A;  1BOS A;  1TY0 A;  1UUP A;  5E4W C;  1A2U A;  5A2Q L;  5JEA G;  5DM6 3;  2NZ1 D;  3A8I E;  3K7A B;  1II3 A;  3T53 B;  1B3A A;  1PRT B;  2VB3 X;  5DEH A;  2O4X A;  3MFG A;  4ZUJ A;  4X3S A;  2K01 A;  2RDH A;  5KNC A;  2A6H D;  4Q5V A;  3P75 A;  2HDM A;  3S2H B;  1A3T A;  3T56 B;  4NP5 A;  4KJN A;  1PTO H;  5M3F B;  4OHJ A;  4JBW A;  1QJO A;  5KRU A;  3HKZ B;  3N6R A;  2EYF A;  3CRL C;  5CV6 A;  4Q0F A;  4N9P A;  4K5X A;  4RKB A;  2A74 C;  4M1U B;  4RHR A;  5EPL A;  1CQF A;  1I6V C;  1ENA A;  2GA4 B;  2F1M A;  2L1B A;  3RUZ A;  1UEA B;  4A3E B;  1MI2 A;  4K5V A;  4QUF A;  2SEB D;  3I4N B;  3GD7 A;  4WRD A;  1J9O A;  5IT9 L;  2AUK A;  1SYC A;  1A15 A;  2E76 C;  4IUP A;  3ND8 A;  4KY5 A;  2WAQ B;  3S1M B;  3PV0 A;  2NVX B;  1DD2 A;  1LT6 D;  3NBI A;  1NSN S;  2BCO A;  2E74 C;  1H9R A;  2EYL A;  2CQA A;  4NKL A;  5J39 A;  4HN7 A;  1VF7 A;  3RZD B;  4HMI A;  2B2Y C;  1G2S A;  3KBX A;  5LHY 1;  3GTJ B;  2XIW A;  3I4M B;  4OO1 I;  3HS0 C;  1G29 1;  2PO4 A;  1YNN C;  1EYA A;  3VYU A;  1ESF A;  2K05 A;  3GO5 A;  4M8A A;  1PLF A;  4LAA A;  4FXD A;  3EJI A;  2ICI A;  3I8Z A;  5I2Y A;  4H0L C;  1PZJ D;  2XWJ B;  2WKD A;  3BDO A;  1EQT A;  1OO9 B;  5JVG 3;  3TP8 A;  5IGC A;  1A3V A;  3TZU A;  1WTV A;  3S2D B;  1DON A;  1M8A A;  3VYT A;  1SBB B;  4C1N I;  1FYC A;  4ODG A;  3VR6 A;  3BVG A;  5COY A;  1D5M C;  4LK1 C;  2NTS A;  3KLS X;  5JEA H;  1NAP A;  4FO2 A;  5KYI A;  5IIF A;  3HGB A;  3E5S A;  3SE0 A;  4KK7 A;  3EFX D;  1V1P B;  1EY8 A;  1JWM D;  3BVM A;  3NWS A;  3I3C A;  1D6E C;  3LWE A;  2F0J A;  4A3J B;  3MAQ A;  2ZXR A;  4MIU A;  4Y7N B;  2E2H B;  1TII D;  3ERO A;  2EYO A;  2A69 C;  2NVQ B;  5TSS A;  1JOO A;  2K5W A;  5JEA J;  4A3G B;  4ULL A;  4PMW A;  1DOM A;  3A8J E;  4B9W A;  1KDC A;  1BCP B;  1IYU A;  4RCN A;  4G7H C;  5CV4 A;  2JYO A;  3T13 A;  2LFN A;  4XQN A;  4FF3 A;  1LTT D;  1BQQ T;  2PW7 A;  3TP7 A;  4K5W A;  5IGD A;  5E4X A;  2F0K A;  2L0C A;  2H4O A;  5EPK A;  3IL8 A;  1U4R A;  2OEO A;  5J1Z A;  1VF5 C;  4KV6 A;  3KF8 A;  1Q90 A;  1BXT A;  5C6A A;  1DYQ A;  1ESR A;  5AFW A;  1PTO F;  3I91 A;  1TQO A;  4QIW B;  1Y1W B;  1JWS D;  1F2Z A;  2EPB A;  5JOB A;  4KN7 C;  1PFB A;  5E3F A;  3C46 A;  4CKB A;  1PZK D;  3I72 A;  3BDC A;  2AQ1 B;  2XSC A;  3DEO A;  1RF2 D;  5C3X A;  4KY7 A;  4L6T B;  5C5M A;  2M2L A;  3FKI B;  1CZG A;  2F0H A;  5JJZ A;  5D65 A;  1G6Z A;  1EFI D;  2F0I A;  4TRD A;  3R2I A;  4C3J G;  1TY2 A;  3MA2 B;  5J22 A;  2F0Q A;  1SNO A;  3HG9 A;  4RFB A;  3HZX A;  2NVT B;  3VR5 A;  4G7Z C;  4FNF A;  1NR2 A;  5ELF A;  3FDT A;  1F2L A;  1B2T A;  3MXG A;  1XWE A;  2RQX A;  1GUO A;  2Y0S B;  2R92 B;  1DM0 B;  1RTN A;  2F0P A;  1YNJ C;  4IUU A;  5EBD A;  3SK8 A;  2F0T A;  4KN4 C;  4IQZ A;  1RCV D;  4XYO A;  2ZXO A;  2PW5 A;  2B2V A;  2KEC A;  4TQU S;  3I73 A;  1C8C A;  2HCI A;  4Z9C B;  5C4X B;  3FVQ A;  3NXW A;  2I07 B;  1JQY D;  5JPM C;  1CI3 M;  3QG1 A;  1OXX K;  3NTK A;  1HA6 A;  4RCO A;  5ELB A;  1CZW A;  2F0D A;  1AW7 A;  1GUW A;  2KCN A;  5COR A;  5CV8 A;  2C5C A;  4C1N K;  5CGK A;  5F2D A;  4F88 A;  5KNB A;  1SJH D;  2FMM A;  1IYV A;  3MWY W;  2IX3 A;  2BA0 A;  4RH6 A;  3WDN A;  4YIJ A;  1HXY D;  2RDG A;  2FIN B;  1STH A;  5M5W B;  2O5J C;  1I4P A;  1WD1 A;  5I6W A;  2L55 A;  2L4N A;  1SMY C;  1TWG B;  1STE A;  1FD7 D;  1I4X A;  4E6I A;  1ROD A;  4H7B A;  3ERQ A;  3SR1 A;  2BE5 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...