5J1ZA

Crystal structure of staphylococcal nuclease variant delta+phs a90d at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLDYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS A90D at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5j1zA00
4WRDA 5EGTA 5E3FA 5IGCA 4B9WA 5CV6A 5C5LA 3NP8A 2F3VA 3DHQA 1II3A 3MHBA 5I9OA 3D4WA 4IALA 2F0UA 2WACA 4K5WA 5E1FA 3E5SA 3SXHA 2SOBA 5KEEA 1EY4A 4J1MA 1AEXA 1KABA 1SYGA 2PQEA 1TR5A 1EYAA 3TP6A 1U9RA 2SNMA 5C3XA 5ISRA 4KJOA 1TQOA 4K8IA 4NKLA 4QB4A 5CV4A 3TP8A 3NQTA 1STHA 2OF1A 2RKSA 3SK4A 1A3TA 3SHLA 3TP7A 2F0KA 3QB3A 1JOKA 2PZUA 4LAAA 3HZXA 1EYDA 5CR3A 4NDXA 5C6AA 5IGGA 2EYHA 2EY6A 2F0GA 2HQEA 2F0VA 3VA5A 1EZ8A 1JOQA 4E6IA 1EY8A 2EYJA 2EYFA 4KD3A 4ZUJA 2OEOA 4KY7A 4ID6A 2F0OA 2F0FA 1EZ6A 5KRUA 4MIUA 3SK8A 2PZWA 1ENAA 1F2YA 3MVVA 5IOCA 5HGTA 2PYKA 1STYA 3PMFA 4KY6A 3DMUA 3SK5A 3BDCA 4DF7A 2RBMA 1EYCA 1SYDA 1STAA 1STNA 3OSOA 4IUNA 2EYLA 3RUZA 3U9OA 1SNMA 4PMBA 2EYMA 4F8MA 4KV6A 4ZUIA 5IGDA 3C1EA 4B9XA 5J39A 4K6DA 4I65A 1IHZA 4KJNA 2F0EA 2LKVA 2KQ3A 1KDCA 3R3OA 4K5VA 4TRDA 4HTHA 5I6YA 3EROA 3ERQA 4KTAA 4PNYA 5CV5A 3SK6A 4HMJA 4ZQ3A 5IGEA 1NSNS 2EXZA 1EY0A 1EY7A 2F0SA 3NHHA 2F0MA 4H7BA 4PMCA 4EVOA 2EYPA 4OL7A 3T16A 5KGUA 3H6MA 3NUCA 2PW7A 4QF4A 5M9OA 2F0JA 3P75A 4K2LA 5KYIA 1STBA 5IIFA 4DU9A 4YIJA 3HEJA 1SYBA 3T13A 3P1HA 1F2MA 3V2TA 1EY5A 1EY9A 4J6HA 5EKKA 4N9TA 3S9WA 3TP5A 5C4ZA 5KIXA 1A3UA 1JOOA 4WORA 3SR1A 5CGKA 3MEHA 4KHVA 2F3WA 1SYFA 2F0IA 5DEHA 2F0TA 2F0QA 4EQOA 2O4XA 1SNDA 2M00A 3OMGA 2QDBA 2ENBA 5J22A 1A3VA 3LX0A 4DGZA 5JOBA 5CV9A 5CV7A 4DFAA 1EQVA 2F0NA 3BDLA 4K2KA 1SNQA 3MZ5A 5HURA 3NXWA 1JORA 4NP5A 4K14A 3NK9A 3MXPA 4EQNA 1SNOA 4N9PA 5C5MA 5DAUA 5IGBA 4NMZA 3OMCA 1F2ZA 1KDAA 4RKBA 1STGA 2KHSA 2SNSA 4IZ8A 2EY2A 3EJIA 1A2UA 5IGFA 5IODA 2F0HA 2F0LA 3ITPA 4KY5A 5F2DA 3TMEA 4F7XA 1A2TA 3C1FA 4EQPA 1EY6A 5JAVA 3D8GA 3D6CA 1ENCA 4KD4A 5EKLA 3QOLA 3QOJA 2EY5A 4HMIA 4R8NA 5KYLA 4RKLA 5I9PA 1RKNA 4ME5A 4K5XA 5C4HA 1KAAA 2EYOA 3EVQA 2EY1A 2F0DA 3OWFA 2PZTA 5K5PA 2NUCA 1SNPA 5J1ZA 1SNCA 1KDBA 2F0PA 2RDFA 4G57A 4ODGA 3D4DA 5I6WA 4QMGA 5CV8A 1TT2A 4K8JA 2OXPA 5CC4A 2F0WA 2PW5A 1NUCA 4S3SA 1SYCA 5C3WA 1SYEA 5NUCA
chains in the Genus database with same CATH superfamily
1TY2A 3VR6A 1GKHA 2CW0C 1CHQD 2F3VA 3CMAA 2AKWB 4A3KB 4FF1A 4IALA 1L1OA 5E7NA 2WAQG 1VQLA 4O0AA 4C3JB 4A3FB 4GOPA 3NBIA 2E2JH 4JYAL 2JYOA 1N32L 4O1NA 4HCEA 1QZHA 1HTLD 2XWBB 2MP1A 1EOVA 2RKSA 4DNIA 4RH6A 2JE6I 1VQHA 3UI2A 5IGGA 1RL2A 2EYJA 3A54A 3IFTA 4TSSA 4JI1L 5M3MH 4LF4Q 3EN2A 4OO1G 4DV3L 2UUAQ 1EZ6A 3J80c 4HIKA 3GV6A 3I4NG 3CCVA 4IPCA 3A56A 2XIWA 5HGTA 1W2BA 3ULPA 3HOVB 3Q22A 3S2HB 4DK1A 2R6GA 4IPDA 3HOWG 2YTVA 2ID0A 3C1EA 3A7LA 2GVBA 1RODA 3M4OB 1CZWA 3CQZB 4PZ6A 2LKVA 4IOCA 5LMUL 4UHVA 1PH3A 5BN3A 3RLOA 2CCZA 1T5XD 2A74C 1KD1C 1NSNS 4APVA 2Z6KC 2Z8LA 1SXTA 4GNXC 4HJAA 3HOYH 4XQNA 4JK1C 4C2MH 2B63H 3CAMA 2F0JA 4QQBX 3T56B 1WYDA 3CD6A 3HEJA 3TZDA 1DXMA 2Y0SB 1F2MA 1HUMA 2H4OA 3VA7A 4K0KQ 2SDFA 1KIXA 5A2QL 1Y14B 3DWAA 3PUZA 5CGKA 2NVQH 4FVMA 2B2VA 3K81C 3TEHB 2KENA 4UY8C 1YI2A 1SE8A 3K7UC 1NR4A 1EQVA 3BVZA 1HZBA 3HKSA 1Q46A 4K2KA 1EIHA 2YTXA 3TDQA 4JOIA 2VQFQ 1SEBD 1I50H 2QKIC 3A7AB 1CTMA 3HFZB 1S5ED 3TMEA 3SDZA 4OIJA 1XNQQ 5JAVA 1DCZA 5EKLA 4X62L 2JXMB 1YNNC 1V9PA 4A3MG 1XPRA 3N6RA 1LO5D 3E0JA 1V1OA 1E0BA 2IWHA 2WB1E 2NVYH 1KQSA 4CDEC 1YEZA 4BY1G 1EIFA 1QG7A 1UWVA 5JEAG 4A3FH 2NTTA 3H3VH 2A69D 5IYDH 4LW1A 1KLUD 3L0OA 4IUQA 2MNAA 5K36G 4OELB 1E22A 1BXTA 1JCKB 4B9WA 1HR0Q 5C5LA 5FO9B 5AJ3L 4UP8A 1OXVA 4R4OA 4DV7Q 1SYGA 5C3XA 2IHEA 5M5YB 3NEMA 4UDUC 1XMOL 4QB4A 3NELA 2D9UA 4LF8L 3NQTA 4FF4A 4DR6Q 5JJLA 1XWEA 4L8JA 4JPBW 5D14A 1A15A 1J9OA 2EYHA 1W3SA 2M2LA 1LTID 4X65L 2B2VC 2M9VA 1O7ZA 2BH2A 1YJ9A 4LUVA 1ESRA 3G4SA 5FK9C 3RLFA 1D1KA 2RQXA 3S1RB 4WJ3M 4YWLA 1STNA 1VQIA 2Q8TA 4RFBA 1I94Q 2XTIA 3F1ZA 1QZGA 1W6JA 4JYAQ 4HIOA 4K5VA 1KC8C 5I6YA 1IKLA 1HNWL 5IGEA 4H7BA 2E8GA 3K6OA 3S15H 2AQ1B 2IPKD 1VCIA 4DAYB 4R4TA 2EOTA 2J4XA 2K28A 1VQBA 3FPPA 3SEBA 5M9OA 1LTRD 2MUYA 4OO1H 1X56A 4NXNL 1C4QA 3J81j 2NVXB 5IP9G 2GA4B 4CGYB 3MEHA 4KHVA 1SYFA 2F0IA 5JEAJ 2NN6G 3K0XA 4B3TQ 4EQOA 1SNDA 3W2DA 1YJNA 1MHWC 2ENBA 1N33Q 1EEID 4I7AA 2VNUD 4GLXA 2TSSA 5M5XH 3DEPA 4A93B 2G9HD 4JI3L 2V1CC 2HUGA 1FNWA 3GP7A 4JV5Q 3HGBA 1MIUA 2Q8IB 1N36Q 5E4XA 2IHFA 4A3JH 2QA4A 3K58A 2XWJB 3I70A 1NTGA 4DR3L 4DR1Q 3VYRA 2E5LQ 2EYOA 1MI2A 4RGNA 4G7OC 2L12A 4OWTB 1SNCA 4LF8Q 4DR6L 5I6WA 1YHQA 1IXRA 1TT2A 1WOCA 2B2YA 1DZ1A 2BE5C 5C3WA 4DV7L 3PO3B 1PHJA 1SYEA 2XN9C 3P75A 2FXQA 1K3RA 3DXJC 2Q2TA 2AMCB 3DHQA 4LF4L 3D4WA 2WB1B 2X6LA 4KN4C 5IY0A 2CQAA 5COYA 1TR5A 2B2TC 1EYAA 2Y0SE 3GTMB 2K33A 2VXWA 5CV4A 3CCSA 1W6KA 4IPGA 3MAQA 1A3TA 1VS0A 1NY4A 1N32Q 4OEMB 4LAAA 1WD0A 4M8AA 2L5TA 3IL8A 4EX5A 3QWNA 4CDFC 4A3FG 1J8IA 4NXNQ 3K0YA 2ZJPA 4DV4Q 5K36H 4X66Q 5EBDA 4OWXB 2RBMA 3HRZC 1H9KA 3ER0A 3K5OA 2DJGC 4OXPA 4B9XA 1ET9A 3LNNA 2HIXA 3C3LA 4KJNA 3I90A 4KHZA 4B3MQ 3EROA 3SK6A 1I94L 4R9WA 4DR5Q 2B29A 5M5WH 2JA5H 3DM1A 2OCEA 1MSGA 2XGTA 4YCUA 1BNZA 4ZRZA 2ICIA 4YCVA 2D0PA 2KEDA 3HOYB 1LABA 3PIP3 2CH4A 2B39A 2DY8A 1HFGA 4BA1I 2QDBA 3GDEA 1PH8A 5E4WC 1ICWA 4JBKA 5FKAC 2Z4HA 4OX9L 3RNUA 2RF4A 3OYYA 4N9PA 2YV5A 5IGBA 4NMZA 4HEDA 5CYUA 3ITPA 4V0BA 1HR0L 1JICA 1HCZA 4DUZQ 1IW7C 3QOJA 1PZJD 1AFPA 3SE0A 5FO8B 3ZJYC 3T1HQ 3S17H 5IP9H 4LWCA 1M8AA 1XTDA 1PYSB 5IYBG 2L1BA 4LFCL 2F52A 4P2CB 3GTMH 3HOXH 1MGSA 3KBGA 2JA7G 4QF4A 5C3EH 2KUMA 1PRTD 3MXNB 3DWQA 2KCMA 2BDOA 1DOMA 4ZKCB 2R3ZA 1A8VA 1JJ2A 4LF9L 2PO4A 5HY6A 3S2DB 1L2FA 3TP6A 4PG3A 3J7ZC 1E24A 4JG2A 1TQOA 3M3YB 2F0KA 1HA5A 3B6YA 4NDXA 3M4OH 5C4XH 1N34Q 2MO1A 1R4QB 2YTYA 4J15A 5GQOA 5JPMC 4K0KL 1FGBD 4ILWA 5KRUA 2JN4A 1R9TH 2B8GA 4L5QA 5IYBH 1S5BD 3J7YW 4DAPA 3BDCA 4IUNA 5FJ8H 4R1JA 2NYZD 1Q7YC 1JE5A 3JC66 5IGDA 3UDGA 5IWAQ 1CA6A 4JI7Q 4Y7NB 1KDCA 1RDPD 1HNXL 2N88A 3AU7A 2WAQE 2C35B 4A3IG 2R93H 4DR7L 5LMNQ 3LGJA 4JI8L 3E0EA 3BVGA 1BQQT 3T13A 3U50C 5JJKA 1Q8KA 1HZAA 2I46A 4PMWA 4A3GH 1EIYB 3CQZH 4QUFA 2ZT9C 1H9RA 4JI2L 5IWAL 1LTGD 4HJ7A 2P5ZX 3PGZA 1C0AA 2F0NA 2NVXH 4X64Q 2CKZB 2X6GA 1TS4A 3MFYA 2MO0A 1YNJD 1F2ZA 4OIKA 1BO0A 4JI3Q 1J5EL 5F2DA 5BN4A 3G71A 1EWCA 1Q12A 2R93B 2KJXA 2F4VQ 2EY5A 1N33L 5ELOA 1E1TA 1D8LA 3H09A 1EWHA 4RHSA 4CKCA 3V96A 5T1IA 1JJCB 2F1MA 3PUVA 5C0XG 2PW5A 3GTOB 4LF9Q 5ELFA 4DV5L 4A4IA 3GTGB 1AP0A 1YHBA 4A3CG 1I4QA 1QUQB 1PRTF 1Y1WH 3I8ZA 1IL8A 1TY0A 2F0UA 4K5WA 4L5RC 3T4AC 1HNWQ 1I4PA 3FMCA 3J81i 1T9HA 4NKLA 1UE5A 4K8IA 3AMUA 1GHJA 4LUOA 2HQLA 3TP7A 1STEA 4P73A 3E3XA 4KK7A 5ELEA 4LF6Q 3CC2A 1D5MC 1CZGA 5JVG3 4GLAC 2R7ZG 2OWOA 4IQZA 3UDXA 2F0OA 1B3AA 1GHKA 4DV1Q 2WP8J 1GXDC 2CHBD 4ABNA 3D0FA 4JI8Q 1WTOA 2JJQA 1TWHH 1E7ZA 4DNRB 1XNRL 2Z1CA 2K5VA 4P74A 3UDFA 1OXXK 1VQ8A 3CCJA 5C44B 4L5SA 2K5WA 2WIIB 3M4PA 3H94A 1RTOA 3IFDA 3K8AA 4ZLTF 1BCPC 1VMPA 4DK6C 4ZYSA 1LYLA 1YVCA 3JAML 2Z9HA 2F0MA 4AH6A 5BR8Q 3K7AB 1CM9A 1QNUA 4G7HC 4LF5Q 3KF6A 2A68D 4IPHA 2D5DA 4WORA 1PV4A 1XTCD 2JEAI 2EZVA 2LXKA 5FJ8G 1VQFA 3MXGA 4V190 1D6EC 5CBEE 2CWAA 3F2BA 4IUVA 2K75A 5IYCG 1G2TA 3AQQA 5EPJA 5EQ0A 4RKBA 1XMQQ 1CKMA 1PXUA 2VL6A 2B63B 1NMFA 4JBJA 4R4CA 4CJ1B 5DM73 3GTQB 2EVBA 5L37A 3OTOL 4BBSH 2Z0SA 3S14H 1PTOD 3KLWA 1BBUA 2F0DA 3WWVA 3OWFA 3DEOA 4KHPL 5JJZA 5M3MG 2LY7A 1B7YB 5ELDA 4UP9A 1NUCA 2BOSA 3RLNA 2OTJA 3NBHB 4NB3A 4WRDA 3D31A 1Z47A 4A3JB 4DV6L 4OONA 3PUYA 3FRPB 5C4JH 5DLQE 4JVZA 4O42A 4X3TA 3VR3A 1SFOH 5KEEA 3CCQA 2PNHA 1HUNA 2SNMA 3FKIB 2C9OA 3U9SA 1U4LA 5EKIA 2XNAC 2NVQB 2O5IC 2ASBA 4DR1L 2J7ZA 2VQEL 1MJEA 2EY6A 2JK8A 3S2DH 3ONAB 5AJ3Q 2OEOA 4BBRH 3PO3H 1K0RA 3SK8A 4ZK9B 1PH2A 1PYWD 3HKZB 4H0LC 1JJGA 3MVVA 4LFBQ 5M3FG 4BY7G 3GO5A 4DF7A 3K7AH 3PUXA 3GTPH 3RUZA 2R92B 1SNMA 1Q81C 2EYMA 1Y1WG 4KV6A 2RCFA 1VQJA 4AYBB 1QOHA 3NE5B 4JBWA 1FVIA 2MHVA 1Q90A 4PNYA 1EFID 3UE1A 1EY0A 1TU2B 4RA8A 2WB1G 2E75C 3STBC 2EYPA 3H6MA 3I4LA 1X55A 4P75A 2BA0A 1GUGA 4JI6L 2BA1A 2Q2UA 1BUVT 2NZOA 1VF5C 2G9DA 3PIPA 5IYDG 1B53A 1F9RA 2KOLA 1AZQA 1SBBB 5J22A 2IL8A 1K8GA 1GOZA 3GTPB 1MJCA 3I91A 1GUTA 4A3GB 1LT3D 3UDIA 2QCPX 5DAUA 2NN6I 2VB3X 5TSSA 4PZ8A 4DN4M 1CQFA 5KNCA 3EJIA 4A3KH 1A63A 5M5WB 2JA5B 1DONA 1V43A 1G291 4LF7L 4B08A 2MQHA 4HMIA 5KYLA 2UXBQ 4A3LH 2WKCA 5I9PA 4ME5A 1K28A 5C44G 2VQEQ 2OQKA 2E76C 5J1ZA 2AHOB 4HR7B 4ODGA 4QMGA 3VR5A 2WAQB 2PQAA 4FNFA 5CC4A 2WV6D 4HSVA 4N8X1 2PCFB 3BZDB 3S2HH 1HFNA 3SVMA 1UAPA 2AWOA 3KK7A 2A6EC 3L9AX 1BOSA 5I9OA 4K6LA 5FLXc 1M1KC 1YITA 1R9TB 3CW2C 1WCMH 2QILA 1KABA 2HDLA 4Y52H 3NTIA 5ISRA 3MFGA 4AIMA 4WFN3 4ULLA 1K8AC 4KHPQ 2YU9B 4BBSG 3S17B 1JOKA 3HOVG 3P20A 2N8NA 2NTSA 4POGA 1IBMQ 3I56A 2L55A 2OTLA 1Z7TA 2LS01 5M3FB 2PZWA 1LT5D 1PRTB 1KHIA 4C1NI 4A93H 3SK5A 1LTLA 3CPFA 4HAEA 5EPLA 2Z6BA 2R7ZB 1CK1A 2ALYB 2L0CA 2MGSA 1SMXA 4IN3A 4XT1B 4YY3Q 3J80E 3G6JB 5A35A 4HMJA 3CCLA 4GNXB 1FJGQ 2EXZA 2ZXOA 4F87A 2LMCB 2KHJA 2HT1A 1F77A 1VF7A 1J5EQ 2PW7A 3RZDB 3GTKB 1RTNA 4DK3C 4A3JG 4LFBL 4IO9A 4K2LA 1Q8IA 1EU3A 3OWEB 1LV9A 4LF5L 2K5NA 3PO3G 3S9WA 5LMNW 2RHSB 3D4RA 4X65Q 4BY7H 4Y7NH 4XXEA 1PTOB 2RSNA 3P7JA 3OMGA 4RHRA 4RCOA 4FO2A 4HIMA 4KMUC 1DGSA 1HJPA 1Y8OB 3S14B 3MZ5A 5DNFA 3NQIA 4GNXA 3U4VA 1SNOA 3H3VI 5IP7H 1XNRQ 2V4DA 5GAGC 2KBNA 3PCOB 4IZ8A 4JI4L 4EQ5A 1SE4A 1YZ6A 2A6HC 2K6AA 1M4VA 4OX9Q 1E3PA 3C1FA 3QG1A 4NXMQ 1D7QA 1XXGA 1SN8A 2DJFC 4GKJL 2B2UC 3W1GA 3HOWB 4FYDA 3BYTB 1R4PB 1LLRD 3OIQA 1DJRD 5D65A 4GN4B 3BG3A 4DXGA 1TWCB 2JQOA 4KKUA 3HS0C 1TWAH 1IYVA 2F0WA 3A55A 1EOTA 3SGIA 1I3QH 1P8LA 4CJ2C 5KNDA 1WTVA 1EY4A 1CFMA 3W1BA 1H95A 5I2XA 4ZCKA 4DV0L 2EXDA 3V05A 1QB5D 1A62A 4CHTB 3BS1A 1XPOA 5C44H 3HOYG 2A19A 1X3QA 3EBEA 4NW2A 5C6AA 1JR0D 4E6IA 3KOJA 2IX0A 5FLMH 3PIO3 1WTXA 3PSIA 4M1UB 4LK1C 3I2ZA 2BH8A 2I07B 5IOCA 2VUMG 1JB7A 1STYA 1S72A 1S3OA 1NNXA 3NSWA 4A3MB 3Q8DA 1TWGB 4GOPC 1XYIA 4UAIA 3HKZG 3R3OA 3M3YH 1IBLL 1ICFB 5J3BA 3OIPA 1C7YA 1L1OC 1I6HH 3FDTA 4OL7A 3H0GB 1VQCA 1O7IA 2CQOA 1ZKOA 4MTKA 1VMCA 4AYBE 4DPGA 1NAPA 3J81E 1VQKA 5LMNL 1UE1A 3H3VC 2RDGA 2AQ3B 3UE0A 4XT3B 1HNXQ 4A93G 2HHHL 3CKIB 1PRTC 2F0TA 5FLXE 3HOXG 4BBSB 1JC7A 5GAEC 3DLLA 3DUZA 3PF5A 1SNQA 5EPKA 3FPUB 1TWGH 4C3IH 2QEXA 1TS3A 2HIVA 2KHSA 2SNSA 3R93A 2N3SA 4HN7A 1AE2A 1XJVA 1B3QA 3FVQA 2E2DC 3L7ZC 4RWSC 4NPSA 3PUWA 2K03A 1YNJC 1Y69U 3TZUA 1QJOA 1OO9B 1NCVA 3FP9A 3HOZH 1K8MA 1I5FA 1O80A 1EU4A 4DV0Q 1Z6HA 4CKBA 3S1MB 4X66L 5IE8A 5LL6S 3VA5A 3CC7A 4PV1C 3MWYW 2K5HA 3OW7A 4A3IB 2N78A 1I4HA 1AEXA 3VYTA 2PQEA 4X64L 3D6WA 1KRTA 1L0YB 3TP8A 1PTOF 1H9JA 1X3PA 2OF1A 3WDNA 1WCMB 3T1HL 1VQ9A 1WVLA 2HCCA 2HHHQ 2R7DA 4DUYL 1CUKA 2E2JB 4A76A 4DUZL 1NE3A 1OXUA 3FHWA 1H9SB 4ID6A 1V1QA 4KY7A 3VR4A 2JA6B 2VUMB 1FNVA 1YBYA 3MXUA 2MFIA 1SMYD 3S15B 4C2MB 1EYCA 2NN6H 3OSOA 5M3MB 1Q82C 3GTJB 1QVFA 5J39A 2E5LL 4K6DA 4Q5VA 4JI7L 5LL6X 1PDQA 4IOAA 4H44C 1JWMD 3NHHA 4GKKQ 5AFWA 2Q2IA 5KGUA 3A5UA 1HRJA 4JV5L 2PQAB 3E6ZX 2ZTDA 4BBRB 3Q24A 3NTHA 1L0XB 1ONLA 1STBA 2Z6KA 1E1OA 1EY9A 2K1BA 3Q0AA 1LACA 2L9HA 5EAYA 3TP5A 4HJ5A 4DXFA 4MZ9A 1N34L 4JI0Q 4QCLA 3HOXB 2K5QA 1DYQA 4LMQD 3QR8A 3M7GA 3TS0A 5CMDA 1H9SA 3PO2G 1K9MC 3W5OA 1PH7A 3OMCA 1XX8A 3I4OA 2AUJD 1A2TA 1BKBA 1VDZA 1UE7A 3I72A 1F9SA 1I3QB 4QGUA 2DGYA 1P16A 1G6ZA 2PMZB 4DR2Q 1KRSA 1RKNA 1I6VC 1VQMA 4TKOB 2EJFC 5EBCA 1IBKL 2JA8H 3O13A 1N8RC 1X32A 1DOKA 3EVQA 5FOBB 3Q23A 5C0XJ 2E2HH 4HJ9A 4J8QA 3BU2A 5CV8A 1U5KA 2BE5D 3H0GG 5DM63 3DWPA 5E3FA 2RDHA 4OGQC 3MHBA 2FMMA 1XPUA 4C3JG 1Y1VG 3AYHB 3U4ZA 2WACA 3J80L 4C3HB 2HCIA 2K32A 3T51B 1SR3A 2DUDA 1XMOQ 3J7A5 1X65A 1WD1A 2E2IH 1SE2A 4A3LG 3QB3A 5IT9c 2RA4A 1FL0A 2A68C 4QY7A 2JA5G 2PI2A 4JI5Q 3HOZG 2K52A 1S5CD 1JOQA 3ULJA 3HOUH 4ZUJA 4LNQA 4KI0A 3S16B 4DV6Q 3KDFB 4L5TA 4DV1L 4MIUA 4HJ8A 1ENAA 3AFPA 5FLXL 1PH5A 1ASYA 4MTNA 1GO3E 3DMUA 4KLKA 4XTCS 5ELCA 3L2PA 3KLRA 3WOFA 2VB2X 2O5JC 3A5ZB 4C56C 1S4ZA 5JVH3 2B2TA 1HQRD 3A74A 3CRLC 4UPAA 1EY7A 2ICEC 5FO7B 3Q6SA 1L1OB 1BCPB 4QIWE 3HOVH 2Y0SG 1GM5A 1PTOC 3M4QA 3J81c 2QDLA 3TN2A 4DV4L 3P1HA 4UP7A 1DD2A 5IT9E 3T1YQ 2WFWA 1K83B 1K8OA 2EDGA 1IBML 1JT8A 1PFBA 2UU9Q 1A0IA 1GUNA 1V1PA 3KF8A 4A3EB 3OPOA 3HOWH 3RN2A 5CV7A 1S5DD 1SJHD 3FKIG 2A1AA 2CWPA 2B3GA 2N55A 3MXPA 1EIGA 5C5MA 2Q2HA 2JA6G 1CA5A 2FMCA 3JAMc 5BR8L 3N52A 1U4PA 2R61A 4P72A 2F0LA 3AFQA 5G3LF 4F7XA 1IL2A 2ES2A 1EY6A 1CSPA 3G6EA 1DM0B 3PIOA 2IX1A 1YNND 1EQTA 2NWGA 1KAAA 1ZYRD 1ET6A 4FP5D 5K5PA 3R2TA 2R92G 1KDBA 4PQXA 1K83H 2UUBQ 3AEVA 2KCCA 1VQ7A 3PO2H 5EJWA 5IODA 4BS9A 1HNZL 3KDFA 3KJOA 2L4NA 1KNAA 3CC4A 5IGCA 1GUOA 3CP0A 4U68A 3I73A 4C3HG 2BCOA 5E1FA 3S16H 1SE3A 4KN7C 3IRBA 1UEBA 2ZJQA 2KCTA 1NBWA 2A6ED 3CF5A 1FGUA 2K7VA 4A3MH 3KJPA 3GTLH 2PZUA 3HG9A 4A3IH 1B50A 1AW7A 1S5FD 3AB9A 2I0QA 3CPWA 3K59A 4B3SL 2RSOA 3GTQH 1C9OA 4DV5Q 4A3GG 1F2YA 1PA6A 3H0GH 1CHPD 2UXCQ 4POFA 4XDXA 4CJ0B 1Y1VH 1F9QA 1NJIC 4I65A 3NTKA 4Q0FA 1B70B 2JP1A 4LFAQ 3S1NB 3RR5A 5C4JB 4KKTA 1IYUA 2K50A 4DR4L 1X3FA 1SAPA 5IIFA 2KEEA 4DU9A 3CU7A 4IFDJ 4N9TA 4DA2A 2I5HA 5C4ZA 4HCSA 3SR1A 4JI2Q 1GUWA 2UUCL 1WTHA 1FD7D 3OW2A 4YWMA 1UNSA 5C0XH 2IW3A 1LTAD 1PLFA 4GN3B 5HURA 1K73C 1JORA 1SSOA 3NXWA 3CCUA 1I4RA 4A3CH 3EFXD 2A5HA 1HZCA 4DKAC 4QL5A 2FJ2A 3I55A 1STGA 1HHVA 3RZDH 4MHEA 1A2UA 2E74C 1TXYA 2ZJRA 4DV3Q 2UUAL 1O7LA 4JI1Q 1GD7A 4DUYQ 2WKDA 4LUZA 3U58A 4BXXG 5C4HA 4LF6L 3KLSA 3EA6A 2R7ZH 4BWGB 1UUPA 3D4DA 3NWTA 2L11A 1VQ6A 3HP3A 4K8JA 3OTOQ 3VR2A 1PFSA 3L3OC 4IURA 1B1ZA 3A8JE 4RAUC 4IFDH 3CHBD 5LHY1 1ZEQX 4DV2L 3HOUB 2JA6H 3F8TA 1D1IA 3ZYYX 3SXHA 4JCVE 2I5MX 2VQFL 3E9IA 1WTWA 3RZOB 3EQLC 1PZKD 3GTJH 4BY7B 1D5ZC 5CR3A 3EIVA 1GJXA 4JI0L 1K0SA 1CI3M 4GZYC 2F4VL 2UXCL 2RHQB 1OXTA 3LWEA 2NBFA 1EQQA 2B2WC 1SDFA 1SRUA 1B44D 5C4XB 1VQDA 1VQNA 1HPCA 2XSCA 3U9OA 1C48A 1H9MA 4C1NK 2JEBI 2NB0A 4QUCA 1KTKA 1HR0W 3GD7A 1FYCA 2EQSA 2A6HD 1BCPD 2RVLA 1VQ4A 2NVYB 3MXNA 4KTAA 1M90C 1E2VA 4ZQ3A 3H91A 1VQEA 3I3CA 1LM0A 1RF2D 2K05A 1TWFB 1YHAA 3M85A 2K5DA 1GUSA 3BZCA 1F9PA 4GS3A 2EIFA 1VQPA 3GV3A 2F3IA 1I4GA 2F3WA 1OTCA 1IBLQ 1EWIA 1Q1BA 2UXBL 1MSHA 1I4XA 5M5YH 3MA2B 4LF7Q 2QEJC 3ULLA 2I5LX 3NK9A 2D2CC 1JMCA 1QCBD 4X6AH 4DR4Q 4HIDA 1HA6A 1JE4A 2DNEA 1O7YA 1DOLA 1QNKA 1T5EA 2A73B 5T1GA 1LT4D 1EL0A 2B63G 2RCNA 2NVTB 3NENA 5GAHC 2XRQD 1SLJA 1N9WA 3TBIB 1B2TA 5CBAE 5ELNA 2FHTA 1VQAA 4RGMA 1SNPA 1WFQA 1EFWA 3M9BA 4BBRG 4JBMA 2IJ0A 5FLMG 3BZKA 1U0LA 2OXPA 3F2UA 4A3BH 2PNRC 5M3FH 5EGTA 2QGQA 3BDOA 5M5XB 1VQOA 1AZPA 3TSSA 1II3A 4B3SQ 3E9HA 1V1PB 3KF8B 1J6QA 3GTOH 3MEFA 3I4MH 2TMPA 2L15A 2LXJA 2E2HB 4LFCQ 4A3DG 1PH6A 3SK4A 3KUPA 2F4IA 2HQEA 3M7NA 2Q8RE 2EYFA 4QJFA 4B3RL 3ICEA 3KF6B 2VW9A 2JA7H 1HNZQ 1QE6A 2AQ2B 3CCEA 1PVOA 4IFDG 4A3BB 1U4RA 3PMFA 5C0XI 1SYDA 2K14A 3PQIA 1MD2D 2EYLA 5I2YA 2SEBD 1PTOH 2QW7A 2XVSA 1SMYC 4DR3Q 2ZTCA 3KBXA 4C3IG 1EYGA 1BR9A 1LTTD 4RG1A 4GN5A 1IYJB 4EVOA 2YYZA 2B2YC 3K5MA 1N36L 3NUCA 4RGTA 4YHHL 1BDOA 1I50B 1E2WA 3HOUG 4FXDA 1SYBA 1WTPA 4DR5L 4EGVA 1ESFA 1JOOA 2DNCA 2ZM6L 2UXDL 1PZID 4CDDC 1TWAB 4XYOA 2AWNA 3HKZE 1TWCH 4YY3L 4LFAL 2O4XA 4DR2L 1KXLA 2CW0D 1QILA 3QO2A 2NVTH 4RMFA 3GQBA 4TVAB 4G7ZC 4CDCC 1XNQL 1HZ9A 2KA7A 4OWWB 1NMGA 1WCMG 2D62A 2EY2A 1TS5A 1TIID 4KY5A 2R93G 4IUPA 1LUZA 3TQYA 4IJLA 3D8GA 2EJMA 4IUTA 1CSQA 4X3SA 3A0JA 1QUQA 4K5XA 5BN5A 2EY1A 4YWKA 1PH9A 2PZTA 2EJGC 2NUCA 4A3EH 2F0PA 2QF7A 3BVMA 3NPPA 1QWYA 1KL9A 1MKHA 1SJED 4ZUIA 4JW0A 1QVGA 3MC0B 1YNXA 1GVPA 4JI4Q 4GKKL 2O2LD 4N8FA 1UE6A 2SOBA 1RHPA 4R8IA 1A6XA 5A2QE 4A3DB 1I6HB 4DK0A 1Q3LA 1PMRA 2KCNA 3K57A 1BBXC 2FFKB 1WI5A 3ERSX 2UUCQ 3KYHC 2F0VA 3MTSA 1EY8A 2R92H 3F2CA 2IY5B 2F0FA 1ZYRC 1SFOB 4B3RQ 4DNTB 4A3BG 3GTGH 4I7ZC 3X3NA 1G6PA 3GTKH 4XIGS 3R8BA 1RJTA 1FJGL 4F88A 4OHJA 3URYA 1EEFD 4RCNA 4HTHA 5IP7G 4HSPA 3OHXC 4ME3A 1BF4A 1U4MA 3ERQA 5CV5A 2JA8B 2PPBC 4A3DH 1G91A 2XRSD 4PMCA 3RD4A 1G2SA 1TS2A 1HH2P 2MJ8A 2VS1A 2F03A 1VQGA 4YIJA 5C3EB 4O2DA 1HXYD 3BYYB 3CRKC 3I7FA 1G51A 4BY1H 4WJWA 2VY3A 2EE1A 3J80i 3S1NH 5DEHA 1ILPA 1Y1VB 2KECA 2M00A 4AQYQ 4A75A 2UXDQ 5JOBA 1CKNB 2PI2E 1QVCA 1RD9D 4K14A 4EQNA 1RIPA 1VQ5A 2B2WA 1KDAA 1PH1A 2K04A 4IUUA 4EQPA 1ENCA 1JB3A 1PFNA 1Y8PB 3A8IE 3QOLA 1ASZA 4RKLA 2UUBL 3QJYA 2LFNA 1BBWA 3JAMi 3I4MB 2RDFA 1KAWA 1Q1EA 4IFDI 4FF2A 4KKSA 5JPNC 4S3SA 1ILQA 1SYCA 3T53B 2VUMH 1X6OA 3M4YA 3ND9A 1B8AA 3S1RH 5IYCH 2IT1A 1Y8NB 2PMZE 3G7LA 3KLSX 2GN5A 1OXSC 1KNEA 1LTSD 2KHIA 1PYBA 2GVAA 4J1MA 4ZKBB 2ATWA 1CKNA 2J0TD 4DAMA 1X9NA 1U9RA 1AH9A 4KJOA 1K3BC 3X3MA 3C46A 4L6TB 4DAYA 2B2UA 1EQRA 1AN8A 3S24A 3SHLA 4RGOS 3RMHA 1IBKQ 3HZXA 4BXXH 1EYDA 2JA9A 1IKMA 4ZAIA 3CXCA 1E2ZA 2F0GA 2UU9L 1EZ8A 4X62Q 2BDNA 4A3EG 1KLGD 3NBHA 3G48A 4R4QA 3VDYA 2H5XA 4JI6Q 1ML0D 4X3KA 5CORA 4KY6A 5KYIA 2B8FA 1X54A 4AYBG 1STAA 1WJJA 3IKJA 3BJUA 4PMBA 3RZOH 3VYSA 3DM3A 3WOEA 2KVMA 4TQUS 2LSSA 2D0OA 1IHZA 3FKIH 1TKWB 2N49A 4LJZC 4TRDA 4CBVA 1PH4A 1FR3A 5ELBA 4MNOA 2ZM6Q 3K80C 3R2IA 3T16A 2R7FA 3STBD 5GROA 1G8ZD 1C8CA 5G3LD 3K5NA 3PF4A 3PO2B 3RN5A 2OT2A 3V2TA 1EY5A 4YHHQ 4X3UA 5KIXA 4FXKC 2WINB 4JI5L 3TREA 4G4KA 3A8KE 1A3VA 1TWHB 2Z4IA 4DGZA 5CV9A 2ZTEA 3CCRA 3PV0A 3OOCA 2X69A 2NZ1D 2HD3A 4CKEA 2JSOA 3D3RA 2MPMA 4C3HH 3ND8A 5JJIA 4DR7Q 1EUJA 4JOIC 3S1MH 1JWUD 1ZXTA 2CFMA 1SROA 3D6CA 2CVRA 5KNBA 4KD4A 3J81L 4R8NA 2OQ0A 3KFUA 5H1SE 3J7AV 1BVSA 1ENFA 2E2IB 1WTQA 1F2LA 4G57A 4U673 3I4NH 1S40A 3S1QB 4PZ7A 3K5LA 2EPBA 5CV6A 1HQMC 3IAYA 3NP8A 4YCWA 4JC0A 3J7AF 1XMQL 2H1EA 3E5SA 5D3DA 4A3KG 1AE3A 4B3ML 3VYUA 2K4KA 1UEAB 1B4OA 3C2PA 4OO1I 1STHA 2AUKA 1PFMA 5I4DA 3TS2A 5IT9L 1FNUA 1X3EA 1RCVD 1JQYD 4IJHA 3LWUA 1BCPF 4DV2Q 4KD3A 2K01A 4GLVB 3I4NB 3S1QH 2PYKA 1B9NA 1B9MA 2IX3A 3FEWX 5HGQA 2YU9H 4FF3A 4F8MA 2A8VA 2ZXRA 5GADC 3JAME 1D2BA 1V8QA 5LMUQ 3I4MG 2KQ3A 4P71A 1WTRA 1Q86C 4BY1B 4GKJQ 4Z9CB 3CMEA 3H15A 2F0SA 4NXML 1MBYA 2C5CA 1IW7D 2FINB 1Y1WB 2DY7A 3QIAA 4WJ4A 2NZHA 4GOPB 1LT6D 1D5XC 2JA7B 2HDMA 4J6HA 5EKKA 2JA8G 4FDBA 3TRZA 1A3UA 1HTPA 1JWSD 3GTLB 5JEAH 1Z9FA 2F0QA 3F2DA 1CKOA 4QIWB 4R4IA 4L63B 3LX0A 5C3EG 4DFAA 4MN3A 2DN8A 3BDLA 1TVXA 4H13C 2VZAA 3HOZB 3CCMA 4NP5A 1NR2A 4DAVA 1YJWA 4ALPA 1IZ6A 4C3JH 4XYQA 5IGFA 2F0HA 1LTBD 1TWFH 1YIJA 2CH4W 1CT1D 4H02A 4C3IB 4FXGC 5D3IB 4AQYL 1CQVA 4B3TL 2G5DA 1L0WA 5C4XG 1X3GA 2A69C 4XQQA 4XQJA 3T1YL 3NWSA 2ZXPA 4BA2I 2F0EA 3W3AA 1O78A 5NUCA
chains in the Genus database with same CATH topology
1TY2A 3VR6A 2CW0C 1CHQD 2F3VA 4A3KB 4FF1A 4IALA 4C3JB 4A3FB 3NBIA 2JYOA 4O1NA 4HCEA 1HTLD 2XWBB 2MP1A 2RKSA 4RH6A 2JE6I 3UI2A 5IGGA 2EYJA 3A54A 3IFTA 4TSSA 4OO1G 1EZ6A 3GV6A 3A56A 2XIWA 5HGTA 3HOVB 3Q22A 3S2HB 4DK1A 2R6GA 2ID0A 3C1EA 3A7LA 1RODA 3M4OB 1CZWA 3CQZB 2LKVA 5BN3A 1T5XD 2A74C 1NSNS 2Z8LA 1SXTA 4XQNA 4JK1C 2F0JA 3T56B 3HEJA 3TZDA 1DXMA 2Y0SB 1F2MA 1HUMA 2H4OA 3VA7A 2SDFA 5A2QL 3DWAA 3PUZA 5CGKA 4FVMA 2B2VA 1NR4A 1EQVA 3BVZA 4K2KA 1EIHA 3TDQA 1SEBD 2QKIC 3A7AB 1CTMA 1S5ED 3TMEA 3SDZA 4OIJA 5JAVA 1DCZA 5EKLA 2JXMB 1YNNC 3N6RA 1LO5D 3E0JA 1V1OA 1E0BA 2IWHA 1QG7A 5JEAG 2NTTA 2A69D 1KLUD 4IUQA 5K36G 1BXTA 1JCKB 4B9WA 5C5LA 5FO9B 1OXVA 1SYGA 5C3XA 5M5YB 4UDUC 4QB4A 4FF4A 2D9UA 3NQTA 1XWEA 4L8JA 5D14A 1A15A 1J9OA 2EYHA 2M2LA 1LTID 2B2VC 2M9VA 1O7ZA 1ESRA 5FK9C 3RLFA 1D1KA 2RQXA 3S1RB 1STNA 2Q8TA 4RFBA 1W6JA 4K5VA 5I6YA 1IKLA 5IGEA 4H7BA 3K6OA 2AQ1B 2IPKD 1VCIA 2EOTA 2J4XA 2K28A 3FPPA 3SEBA 5M9OA 1LTRD 2MUYA 4OO1H 1C4QA 2NVXB 2GA4B 4CGYB 3MEHA 4KHVA 1SYFA 2F0IA 5JEAJ 2NN6G 4EQOA 1SNDA 3W2DA 2ENBA 1EEID 2VNUD 2TSSA 4A93B 3DEPA 2G9HD 2HUGA 1FNWA 3GP7A 3HGBA 2Q8IB 5E4XA 3K58A 2XWJB 3I70A 3VYRA 2EYOA 1MI2A 4RGNA 4G7OC 2L12A 1SNCA 5I6WA 1TT2A 2B2YA 1DZ1A 2BE5C 5C3WA 3PO3B 1SYEA 2XN9C 3P75A 3DXJC 3DHQA 2WB1B 2X6LA 3D4WA 4KN4C 2CQAA 5COYA 1TR5A 2B2TC 1EYAA 3GTMB 2K33A 2VXWA 5CV4A 1W6KA 3MAQA 1A3TA 4LAAA 1WD0A 4M8AA 2L5TA 3IL8A 3QWNA 1J8IA 3K0YA 5K36H 5EBDA 2RBMA 3HRZC 1H9KA 3K5OA 4B9XA 1ET9A 3LNNA 3C3LA 4KJNA 3I90A 4KHZA 3EROA 3SK6A 4R9WA 3DM1A 1MSGA 1BNZA 4ZRZA 2ICIA 2KEDA 3HOYB 1LABA 3PIP3 2B39A 2DY8A 1HFGA 4BA1I 2QDBA 5E4WC 1ICWA 5FKAC 2Z4HA 5IGBA 4N9PA 4NMZA 4HEDA 5CYUA 3ITPA 4V0BA 1JICA 1HCZA 1IW7C 3QOJA 1PZJD 1AFPA 3SE0A 5FO8B 1M8AA 2L1BA 4P2CB 1MGSA 3KBGA 4QF4A 2KUMA 1PRTD 3DWQA 2BDOA 1DOMA 4ZKCB 2R3ZA 2PO4A 3S2DB 3TP6A 1TQOA 3M3YB 2F0KA 1HA5A 4NDXA 1R4QB 5JPMC 1FGBD 4ILWA 5KRUA 2B8GA 1S5BD 3J7YW 4DAPA 3BDCA 4IUNA 2NYZD 5IGDA 1CA6A 4Y7NB 1KDCA 1RDPD 2N88A 3AU7A 3BVGA 1BQQT 3T13A 2I46A 4PMWA 4QUFA 2ZT9C 1H9RA 1LTGD 2F0NA 2X6GA 1TS4A 3MFYA 1YNJD 1F2ZA 4OIKA 1BO0A 5F2DA 5BN4A 1EWCA 1Q12A 2R93B 2KJXA 2EY5A 3H09A 1EWHA 4RHSA 4CKCA 3V96A 5T1IA 2F1MA 3PUVA 5C0XG 2PW5A 3GTOB 5ELFA 3GTGB 1AP0A 1I4QA 1PRTF 3I8ZA 1IL8A 1TY0A 2F0UA 4K5WA 3T4AC 1I4PA 3FMCA 4NKLA 4K8IA 3AMUA 1GHJA 3TP7A 1STEA 4KK7A 5ELEA 1D5MC 1CZGA 5JVG3 4IQZA 2F0OA 1B3AA 1GHKA 2WP8J 1GXDC 2CHBD 4ABNA 1WTOA 4DNRB 2Z1CA 1OXXK 5C44B 2K5WA 2WIIB 3H94A 1RTOA 3IFDA 4ZLTF 1BCPC 1VMPA 4ZYSA 3JAML 2F0MA 3K7AB 1CM9A 1QNUA 4G7HC 2A68D 2D5DA 4WORA 2JEAI 1XTCD 2EZVA 3MXGA 4V190 1D6EC 5CBEE 4IUVA 1G2TA 5EPJA 5EQ0A 4RKBA 1PXUA 2B63B 4CJ1B 5DM73 3GTQB 2EVBA 1PTOD 2F0DA 3OWFA 3DEOA 5JJZA 2LY7A 5ELDA 1NUCA 2BOSA 4WRDA 3D31A 1Z47A 4A3JB 3PUYA 3FRPB 4O42A 4X3TA 3VR3A 5KEEA 1HUNA 2SNMA 3FKIB 2C9OA 3U9SA 1U4LA 5EKIA 2XNAC 2NVQB 2O5IC 2J7ZA 2EY6A 3ONAB 2OEOA 3SK8A 4ZK9B 1PYWD 3HKZB 4H0LC 3MVVA 3GO5A 4DF7A 3PUXA 3RUZA 2R92B 1SNMA 2EYMA 4KV6A 4AYBB 1QOHA 3NE5B 4JBWA 2MHVA 1Q90A 4PNYA 1EFID 1EY0A 1TU2B 4RA8A 2E75C 2EYPA 3H6MA 3I4LA 2BA0A 1GUGA 2BA1A 1BUVT 1VF5C 2G9DA 1B53A 1F9RA 2KOLA 1AZQA 1SBBB 5J22A 2IL8A 1GOZA 3GTPB 3I91A 1GUTA 4A3GB 1LT3D 2QCPX 5DAUA 2NN6I 2VB3X 5TSSA 4DN4M 1CQFA 5KNCA 3EJIA 5M5WB 2JA5B 1DONA 1V43A 1G291 4B08A 4HMIA 5KYLA 2WKCA 5I9PA 4ME5A 2E76C 5J1ZA 4HR7B 4ODGA 4QMGA 3VR5A 2WAQB 4FNFA 5CC4A 2WV6D 4HSVA 2PCFB 3BZDB 1HFNA 3SVMA 1UAPA 2AWOA 3KK7A 2A6EC 3L9AX 1BOSA 5I9OA 4K6LA 1R9TB 2QILA 1KABA 2HDLA 3NTIA 5ISRA 3MFGA 4WFN3 4ULLA 2YU9B 3S17B 1JOKA 3P20A 2NTSA 2L55A 1Z7TA 2LS01 5M3FB 2PZWA 1LT5D 1PRTB 4C1NI 3SK5A 4HAEA 5EPLA 2R7ZB 1CK1A 2L0CA 2MGSA 4IN3A 4XT1B 3J80E 3G6JB 5A35A 4HMJA 2EXZA 2ZXOA 4F87A 2LMCB 1F77A 1VF7A 2PW7A 3RZDB 3GTKB 1RTNA 4K2LA 1Q8IA 1EU3A 3OWEB 1LV9A 3S9WA 3D4RA 4XXEA 1PTOB 2RSNA 3P7JA 3OMGA 4RHRA 4RCOA 4FO2A 1Y8OB 4KMUC 3S14B 3MZ5A 5DNFA 3NQIA 1SNOA 2V4DA 4IZ8A 1SE4A 2A6HC 2K6AA 1M4VA 3C1FA 3QG1A 1XXGA 2B2UC 3HOWB 4FYDA 3BYTB 1R4PB 1LLRD 3OIQA 1DJRD 5D65A 3BG3A 4DXGA 1TWCB 4KKUA 3HS0C 1IYVA 2F0WA 3A55A 1EOTA 4CJ2C 5KNDA 1WTVA 1EY4A 1CFMA 5I2XA 3V05A 1QB5D 3BS1A 4CHTB 1X3QA 4NW2A 5C6AA 1JR0D 4E6IA 2IX0A 3PIO3 1WTXA 4M1UB 4LK1C 2I07B 5IOCA 1STYA 3NSWA 4A3MB 1TWGB 1XYIA 4UAIA 3R3OA 3OIPA 3FDTA 4OL7A 3H0GB 1ZKOA 1VMCA 1NAPA 3J81E 3H3VC 2RDGA 2AQ3B 4XT3B 3CKIB 1PRTC 2F0TA 5FLXE 4BBSB 1JC7A 3DUZA 1SNQA 5EPKA 3FPUB 1TS3A 2KHSA 2SNSA 3R93A 4HN7A 3FVQA 2E2DC 3L7ZC 4RWSC 3PUWA 2K03A 1YNJC 1Y69U 3TZUA 1QJOA 1OO9B 1NCVA 1K8MA 1O80A 1EU4A 1Z6HA 4CKBA 3S1MB 3VA5A 5LL6S 4PV1C 3MWYW 3OW7A 4A3IB 1I4HA 1AEXA 3VYTA 2PQEA 3D6WA 1L0YB 3TP8A 1PTOF 1H9JA 1X3PA 2OF1A 3WDNA 1WCMB 1WVLA 2HCCA 2E2JB 1OXUA 1H9SB 4ID6A 4KY7A 3VR4A 2JA6B 2VUMB 1FNVA 3MXUA 1SMYD 3S15B 4C2MB 1EYCA 2NN6H 3OSOA 5M3MB 3GTJB 5J39A 4K6DA 4Q5VA 5LL6X 1PDQA 4H44C 1JWMD 3NHHA 5AFWA 5KGUA 1HRJA 3E6ZX 4BBRB 3Q24A 1STBA 1L0XB 1ONLA 3NTHA 1EY9A 2K1BA 3Q0AA 1LACA 2L9HA 3TP5A 4DXFA 4QCLA 3HOXB 2K5QA 1DYQA 4LMQD 3M7GA 5CMDA 1H9SA 3OMCA 1XX8A 2AUJD 1A2TA 1VDZA 3I72A 1F9SA 1I3QB 1G6ZA 2PMZB 1RKNA 1I6VC 4TKOB 2EJFC 5EBCA 3O13A 1X32A 1DOKA 3EVQA 5FOBB 3Q23A 5C0XJ 4J8QA 5CV8A 2BE5D 5DM63 3DWPA 5E3FA 2RDHA 4OGQC 3MHBA 2FMMA 4C3JG 2WACA 3J80L 4C3HB 2HCIA 2K32A 3T51B 1WD1A 1SE2A 3QB3A 2RA4A 2A68C 1S5CD 1JOQA 4ZUJA 4KI0A 3S16B 4MIUA 1ENAA 5FLXL 3DMUA 4XTCS 5ELCA 3KLRA 3WOFA 2VB2X 2O5JC 4C56C 1S4ZA 5JVH3 2B2TA 1HQRD 3CRLC 1EY7A 5FO7B 2ICEC 3Q6SA 1BCPB 1PTOC 3TN2A 3P1HA 1DD2A 5IT9E 1K83B 1K8OA 2EDGA 1PFBA 1GUNA 1V1PA 3KF8A 4A3EB 3OPOA 5CV7A 1S5DD 1SJHD 2N55A 3MXPA 1EIGA 5C5MA 1CA5A 2FMCA 3N52A 1U4PA 2R61A 5G3LF 2F0LA 4F7XA 1EY6A 1DM0B 2IX1A 1YNND 1EQTA 2NWGA 1KAAA 1ZYRD 1ET6A 4FP5D 5K5PA 3R2TA 1KDBA 4PQXA 2KCCA 5EJWA 5IODA 4BS9A 2L4NA 1KNAA 5IGCA 1GUOA 4U68A 3I73A 4C3HG 2BCOA 5E1FA 1SE3A 4KN7C 2A6ED 2K7VA 2PZUA 3HG9A 1B50A 1AW7A 1S5FD 3AB9A 3K59A 2RSOA 1F2YA 1CHPD 4XDXA 4CJ0B 1F9QA 4I65A 3NTKA 4Q0FA 2JP1A 3S1NB 5C4JB 4KKTA 1IYUA 1SAPA 5IIFA 2KEEA 4DU9A 3CU7A 4IFDJ 4N9TA 4DA2A 5C4ZA 4HCSA 3SR1A 1GUWA 1FD7D 1UNSA 5C0XH 2IW3A 1LTAD 1PLFA 5HURA 1JORA 1SSOA 3NXWA 1I4RA 3EFXD 2A5HA 2FJ2A 1STGA 1HHVA 4MHEA 1A2UA 2E74C 1O7LA 2WKDA 5C4HA 3KLSA 3EA6A 4BWGB 1UUPA 3D4DA 3NWTA 2L11A 3HP3A 4K8JA 3VR2A 3L3OC 4IURA 1B1ZA 3A8JE 4RAUC 4IFDH 3CHBD 5LHY1 1ZEQX 3HOUB 1D1IA 3ZYYX 3SXHA 1WTWA 3RZOB 3EQLC 1PZKD 4BY7B 1D5ZC 5CR3A 1GJXA 1CI3M 4GZYC 1OXTA 3LWEA 2NBFA 2B2WC 1SDFA 1B44D 5C4XB 1HPCA 2XSCA 3U9OA 1C48A 1H9MA 4C1NK 2JEBI 2NB0A 4QUCA 1KTKA 3GD7A 1FYCA 2A6HD 1BCPD 2RVLA 2NVYB 3MXNA 4KTAA 1E2VA 4ZQ3A 3H91A 3I3CA 1RF2D 2K05A 1TWFB 3M85A 2K5DA 1GUSA 1F9PA 3GV3A 1I4GA 2F3WA 1Q1BA 1MSHA 1I4XA 3MA2B 2QEJC 3NK9A 2D2CC 1QCBD 1HA6A 1JE4A 2DNEA 1O7YA 1DOLA 1QNKA 1T5EA 2A73B 5T1GA 1LT4D 1EL0A 2NVTB 2XRQD 3TBIB 1B2TA 5CBAE 2FHTA 4RGMA 1SNPA 2IJ0A 2OXPA 3F2UA 2PNRC 5EGTA 3BDOA 5M5XB 1AZPA 3TSSA 1II3A 1V1PB 2TMPA 2E2HB 3SK4A 3KUPA 2F4IA 2HQEA 3M7NA 2Q8RE 2EYFA 1QE6A 2AQ2B 4IFDG 4A3BB 1U4RA 3PMFA 5C0XI 1SYDA 1MD2D 2EYLA 5I2YA 2SEBD 1PTOH 2XVSA 1SMYC 3KBXA 4C3IG 1BR9A 1LTTD 4EVOA 2YYZA 2B2YC 3K5MA 3NUCA 4RGTA 1BDOA 1I50B 1E2WA 4FXDA 1SYBA 1WTPA 4EGVA 1ESFA 1JOOA 2DNCA 1PZID 1TWAB 4XYOA 2AWNA 2O4XA 2CW0D 1QILA 3QO2A 3GQBA 4G7ZC 2KA7A 2D62A 2EY2A 1TS5A 1TIID 4KY5A 4IUPA 3D8GA 2EJMA 4IUTA 4X3SA 4K5XA 5BN5A 2EY1A 2PZTA 2EJGC 2NUCA 2F0PA 2QF7A 3BVMA 3NPPA 1QWYA 1SJED 4ZUIA 3MC0B 2O2LD 2SOBA 1RHPA 4R8IA 1A6XA 5A2QE 4A3DB 1I6HB 4DK0A 1Q3LA 1PMRA 2KCNA 3K57A 1BBXC 2FFKB 2F0VA 3MTSA 1EY8A 2F0FA 1ZYRC 1SFOB 4DNTB 4I7ZC 3X3NA 4XIGS 3R8BA 1RJTA 4F88A 4OHJA 3URYA 1EEFD 4RCNA 4HTHA 4HSPA 3OHXC 1BF4A 1U4MA 3ERQA 5CV5A 2JA8B 2PPBC 1G91A 2XRSD 3RD4A 4PMCA 1G2SA 1TS2A 2MJ8A 2F03A 4YIJA 5C3EB 1HXYD 3BYYB 3CRKC 4WJWA 2EE1A 1ILPA 5DEHA 1Y1VB 2KECA 2M00A 5JOBA 1RD9D 4K14A 4EQNA 2B2WA 1KDAA 2K04A 4IUUA 4EQPA 1ENCA 1JB3A 1PFNA 1Y8PB 3A8IE 3QOLA 4RKLA 3QJYA 2LFNA 3I4MB 2RDFA 1Q1EA 4IFDI 4FF2A 4KKSA 5JPNC 4S3SA 1SYCA 1ILQA 3T53B 3M4YA 3ND9A 2IT1A 1Y8NB 3G7LA 3KLSX 1OXSC 1KNEA 1LTSD 4J1MA 4ZKBB 2J0TD 1U9RA 4KJOA 3X3MA 3C46A 4L6TB 4DAYA 2B2UA 1AN8A 3SHLA 4RGOS 3RMHA 3HZXA 1IKMA 1EYDA 4ZAIA 1E2ZA 2F0GA 1EZ8A 2BDNA 1KLGD 3NBHA 1ML0D 4X3KA 5CORA 4KY6A 5KYIA 2B8FA 1STAA 3IKJA 4PMBA 3VYSA 3WOEA 2KVMA 4TQUS 1IHZA 1TKWB 4LJZC 4TRDA 4CBVA 1FR3A 5ELBA 3R2IA 3T16A 1G8ZD 1C8CA 5G3LD 3K5NA 3PO2B 2OT2A 3V2TA 1EY5A 4X3UA 5KIXA 4FXKC 2WINB 4G4KA 3A8KE 1A3VA 1TWHB 2Z4IA 4DGZA 5CV9A 3PV0A 3OOCA 2X69A 2NZ1D 4CKEA 2JSOA 3D3RA 2MPMA 3ND8A 1JWUD 1ZXTA 3D6CA 2CVRA 5KNBA 4KD4A 3J81L 4R8NA 3J7AV 1ENFA 2E2IB 1WTQA 1F2LA 4G57A 4U673 3S1QB 3K5LA 2EPBA 5CV6A 1HQMC 3IAYA 3NP8A 3J7AF 2H1EA 3E5SA 5D3DA 3VYUA 1UEAB 1B4OA 3C2PA 4OO1I 1STHA 2AUKA 1PFMA 5I4DA 5IT9L 1FNUA 1RCVD 1JQYD 3LWUA 1BCPF 4KD3A 2K01A 3I4NB 2PYKA 1B9NA 1B9MA 2IX3A 3FEWX 4FF3A 4F8MA 2ZXRA 3JAME 1D2BA 1V8QA 2KQ3A 1WTRA 4BY1B 4Z9CB 2F0SA 1MBYA 2C5CA 1IW7D 2FINB 1Y1WB 2DY7A 3QIAA 1LT6D 1D5XC 2JA7B 2HDMA 4J6HA 5EKKA 1A3UA 1HTPA 1JWSD 3GTLB 5JEAH 2F0QA 4QIWB 4L63B 3LX0A 4DFAA 2DN8A 3BDLA 4H13C 1TVXA 4MN3A 3HOZB 4NP5A 1NR2A 4DAVA 4XYQA 5IGFA 2F0HA 1LTBD 1CT1D 4C3IB 4FXGC 5D3IB 1CQVA 2A69C 4XQQA 4XQJA 3NWSA 2ZXPA 4BA2I 2F0EA 3W3AA 1O78A 5NUCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WRD A;  5EGT A;  5E3F A;  5IGC A;  4B9W A;  5CV6 A;  5C5L A;  3NP8 A;  2F3V A;  3DHQ A;  1II3 A;  3MHB A;  5I9O A;  3D4W A;  4IAL A;  2F0U A;  2WAC A;  4K5W A;  5E1F A;  3E5S A;  3SXH A;  2SOB A;  5KEE A;  1EY4 A;  4J1M A;  1AEX A;  1KAB A;  1SYG A;  2PQE A;  1TR5 A;  1EYA A;  3TP6 A;  1U9R A;  2SNM A;  5C3X A;  5ISR A;  4KJO A;  1TQO A;  4K8I A;  4NKL A;  4QB4 A;  5CV4 A;  3TP8 A;  3NQT A;  1STH A;  2OF1 A;  2RKS A;  3SK4 A;  1A3T A;  3SHL A;  3TP7 A;  2F0K A;  3QB3 A;  1JOK A;  2PZU A;  4LAA A;  3HZX A;  1EYD A;  5CR3 A;  4NDX A;  5C6A A;  5IGG A;  2EYH A;  2EY6 A;  2F0G A;  2HQE A;  2F0V A;  3VA5 A;  1EZ8 A;  1JOQ A;  4E6I A;  1EY8 A;  2EYJ A;  2EYF A;  4KD3 A;  4ZUJ A;  2OEO A;  4KY7 A;  4ID6 A;  2F0O A;  2F0F A;  1EZ6 A;  5KRU A;  4MIU A;  3SK8 A;  2PZW A;  1ENA A;  1F2Y A;  3MVV A;  5IOC A;  5HGT A;  2PYK A;  1STY A;  3PMF A;  4KY6 A;  3DMU A;  3SK5 A;  3BDC A;  4DF7 A;  2RBM A;  1EYC A;  1SYD A;  1STA A;  1STN A;  3OSO A;  4IUN A;  2EYL A;  3RUZ A;  3U9O A;  1SNM A;  4PMB A;  2EYM A;  4F8M A;  4KV6 A;  4ZUI A;  5IGD A;  3C1E A;  4B9X A;  5J39 A;  4K6D A;  4I65 A;  1IHZ A;  4KJN A;  2F0E A;  2LKV A;  2KQ3 A;  1KDC A;  3R3O A;  4K5V A;  4TRD A;  4HTH A;  5I6Y A;  3ERO A;  3ERQ A;  4KTA A;  4PNY A;  5CV5 A;  3SK6 A;  4HMJ A;  4ZQ3 A;  5IGE A;  1NSN S;  2EXZ A;  1EY0 A;  1EY7 A;  2F0S A;  3NHH A;  2F0M A;  4H7B A;  4PMC A;  4EVO A;  2EYP A;  4OL7 A;  3T16 A;  5KGU A;  3H6M A;  3NUC A;  2PW7 A;  4QF4 A;  5M9O A;  2F0J A;  3P75 A;  4K2L A;  5KYI A;  1STB A;  5IIF A;  4DU9 A;  4YIJ A;  3HEJ A;  1SYB A;  3T13 A;  3P1H A;  1F2M A;  3V2T A;  1EY5 A;  1EY9 A;  4J6H A;  5EKK A;  4N9T A;  3S9W A;  3TP5 A;  5C4Z A;  5KIX A;  1A3U A;  1JOO A;  4WOR A;  3SR1 A;  5CGK A;  3MEH A;  4KHV A;  2F3W A;  1SYF A;  2F0I A;  5DEH A;  2F0T A;  2F0Q A;  4EQO A;  2O4X A;  1SND A;  2M00 A;  3OMG A;  2QDB A;  2ENB A;  5J22 A;  1A3V A;  3LX0 A;  4DGZ A;  5JOB A;  5CV9 A;  5CV7 A;  4DFA A;  1EQV A;  2F0N A;  3BDL A;  4K2K A;  1SNQ A;  3MZ5 A;  5HUR A;  3NXW A;  1JOR A;  4NP5 A;  4K14 A;  3NK9 A;  3MXP A;  4EQN A;  1SNO A;  4N9P A;  5C5M A;  5DAU A;  5IGB A;  4NMZ A;  3OMC A;  1F2Z A;  1KDA A;  4RKB A;  1STG A;  2KHS A;  2SNS A;  4IZ8 A;  2EY2 A;  3EJI A;  1A2U A;  5IGF A;  5IOD A;  2F0H A;  2F0L A;  3ITP A;  4KY5 A;  5F2D A;  3TME A;  4F7X A;  1A2T A;  3C1F A;  4EQP A;  1EY6 A;  5JAV A;  3D8G A;  3D6C A;  1ENC A;  4KD4 A;  5EKL A;  3QOL A;  3QOJ A;  2EY5 A;  4HMI A;  4R8N A;  5KYL A;  4RKL A;  5I9P A;  1RKN A;  4ME5 A;  4K5X A;  5C4H A;  1KAA A;  2EYO A;  3EVQ A;  2EY1 A;  2F0D A;  3OWF A;  2PZT A;  5K5P A;  2NUC A;  1SNP A;  5J1Z A;  1SNC A;  1KDB A;  2F0P A;  2RDF A;  4G57 A;  4ODG A;  3D4D A;  5I6W A;  4QMG A;  5CV8 A;  1TT2 A;  4K8J A;  2OXP A;  5CC4 A;  2F0W A;  2PW5 A;  1NUC A;  4S3S A;  1SYC A;  5C3W A;  1SYE A;  5NUC A; 
#chains in the Genus database with same CATH topology
 1TY2 A;  3VR6 A;  1GKH A;  2CW0 C;  1CHQ D;  2F3V A;  3CMA A;  2AKW B;  4A3K B;  4FF1 A;  4IAL A;  1L1O A;  5E7N A;  2WAQ G;  1VQL A;  4O0A A;  4C3J B;  4A3F B;  4GOP A;  3NBI A;  2E2J H;  4JYA L;  2JYO A;  1N32 L;  4O1N A;  4HCE A;  1QZH A;  1HTL D;  2XWB B;  2MP1 A;  1EOV A;  2RKS A;  4DNI A;  4RH6 A;  2JE6 I;  1VQH A;  3UI2 A;  5IGG A;  1RL2 A;  2EYJ A;  3A54 A;  3IFT A;  4TSS A;  4JI1 L;  5M3M H;  4LF4 Q;  3EN2 A;  4OO1 G;  4DV3 L;  2UUA Q;  1EZ6 A;  3J80 c;  4HIK A;  3GV6 A;  3I4N G;  3CCV A;  4IPC A;  3A56 A;  2XIW A;  5HGT A;  1W2B A;  3ULP A;  3HOV B;  3Q22 A;  3S2H B;  4DK1 A;  2R6G A;  4IPD A;  3HOW G;  2YTV A;  2ID0 A;  3C1E A;  3A7L A;  2GVB A;  1ROD A;  3M4O B;  1CZW A;  3CQZ B;  4PZ6 A;  2LKV A;  4IOC A;  5LMU L;  4UHV A;  1PH3 A;  5BN3 A;  3RLO A;  2CCZ A;  1T5X D;  2A74 C;  1KD1 C;  1NSN S;  4APV A;  2Z6K C;  2Z8L A;  1SXT A;  4GNX C;  4HJA A;  3HOY H;  4XQN A;  4JK1 C;  4C2M H;  2B63 H;  3CAM A;  2F0J A;  4QQB X;  3T56 B;  1WYD A;  3CD6 A;  3HEJ A;  3TZD A;  1DXM A;  2Y0S B;  1F2M A;  1HUM A;  2H4O A;  3VA7 A;  4K0K Q;  2SDF A;  1KIX A;  5A2Q L;  1Y14 B;  3DWA A;  3PUZ A;  5CGK A;  2NVQ H;  4FVM A;  2B2V A;  3K81 C;  3TEH B;  2KEN A;  4UY8 C;  1YI2 A;  1SE8 A;  3K7U C;  1NR4 A;  1EQV A;  3BVZ A;  1HZB A;  3HKS A;  1Q46 A;  4K2K A;  1EIH A;  2YTX A;  3TDQ A;  4JOI A;  2VQF Q;  1SEB D;  1I50 H;  2QKI C;  3A7A B;  1CTM A;  3HFZ B;  1S5E D;  3TME A;  3SDZ A;  4OIJ A;  1XNQ Q;  5JAV A;  1DCZ A;  5EKL A;  4X62 L;  2JXM B;  1YNN C;  1V9P A;  4A3M G;  1XPR A;  3N6R A;  1LO5 D;  3E0J A;  1V1O A;  1E0B A;  2IWH A;  2WB1 E;  2NVY H;  1KQS A;  4CDE C;  1YEZ A;  4BY1 G;  1EIF A;  1QG7 A;  1UWV A;  5JEA G;  4A3F H;  2NTT A;  3H3V H;  2A69 D;  5IYD H;  4LW1 A;  1KLU D;  3L0O A;  4IUQ A;  2MNA A;  5K36 G;  4OEL B;  1E22 A;  1BXT A;  1JCK B;  4B9W A;  1HR0 Q;  5C5L A;  5FO9 B;  5AJ3 L;  4UP8 A;  1OXV A;  4R4O A;  4DV7 Q;  1SYG A;  5C3X A;  2IHE A;  5M5Y B;  3NEM A;  4UDU C;  1XMO L;  4QB4 A;  3NEL A;  2D9U A;  4LF8 L;  3NQT A;  4FF4 A;  4DR6 Q;  5JJL A;  1XWE A;  4L8J A;  4JPB W;  5D14 A;  1A15 A;  1J9O A;  2EYH A;  1W3S A;  2M2L A;  1LTI D;  4X65 L;  2B2V C;  2M9V A;  1O7Z A;  2BH2 A;  1YJ9 A;  4LUV A;  1ESR A;  3G4S A;  5FK9 C;  3RLF A;  1D1K A;  2RQX A;  3S1R B;  4WJ3 M;  4YWL A;  1STN A;  1VQI A;  2Q8T A;  4RFB A;  1I94 Q;  2XTI A;  3F1Z A;  1QZG A;  1W6J A;  4JYA Q;  4HIO A;  4K5V A;  1KC8 C;  5I6Y A;  1IKL A;  1HNW L;  5IGE A;  4H7B A;  2E8G A;  3K6O A;  3S15 H;  2AQ1 B;  2IPK D;  1VCI A;  4DAY B;  4R4T A;  2EOT A;  2J4X A;  2K28 A;  1VQB A;  3FPP A;  3SEB A;  5M9O A;  1LTR D;  2MUY A;  4OO1 H;  1X56 A;  4NXN L;  1C4Q A;  3J81 j;  2NVX B;  5IP9 G;  2GA4 B;  4CGY B;  3MEH A;  4KHV A;  1SYF A;  2F0I A;  5JEA J;  2NN6 G;  3K0X A;  4B3T Q;  4EQO A;  1SND A;  3W2D A;  1YJN A;  1MHW C;  2ENB A;  1N33 Q;  1EEI D;  4I7A A;  2VNU D;  4GLX A;  2TSS A;  5M5X H;  3DEP A;  4A93 B;  2G9H D;  4JI3 L;  2V1C C;  2HUG A;  1FNW A;  3GP7 A;  4JV5 Q;  3HGB A;  1MIU A;  2Q8I B;  1N36 Q;  5E4X A;  2IHF A;  4A3J H;  2QA4 A;  3K58 A;  2XWJ B;  3I70 A;  1NTG A;  4DR3 L;  4DR1 Q;  3VYR A;  2E5L Q;  2EYO A;  1MI2 A;  4RGN A;  4G7O C;  2L12 A;  4OWT B;  1SNC A;  4LF8 Q;  4DR6 L;  5I6W A;  1YHQ A;  1IXR A;  1TT2 A;  1WOC A;  2B2Y A;  1DZ1 A;  2BE5 C;  5C3W A;  4DV7 L;  3PO3 B;  1PHJ A;  1SYE A;  2XN9 C;  3P75 A;  2FXQ A;  1K3R A;  3DXJ C;  2Q2T A;  2AMC B;  3DHQ A;  4LF4 L;  3D4W A;  2WB1 B;  2X6L A;  4KN4 C;  5IY0 A;  2CQA A;  5COY A;  1TR5 A;  2B2T C;  1EYA A;  2Y0S E;  3GTM B;  2K33 A;  2VXW A;  5CV4 A;  3CCS A;  1W6K A;  4IPG A;  3MAQ A;  1A3T A;  1VS0 A;  1NY4 A;  1N32 Q;  4OEM B;  4LAA A;  1WD0 A;  4M8A A;  2L5T A;  3IL8 A;  4EX5 A;  3QWN A;  4CDF C;  4A3F G;  1J8I A;  4NXN Q;  3K0Y A;  2ZJP A;  4DV4 Q;  5K36 H;  4X66 Q;  5EBD A;  4OWX B;  2RBM A;  3HRZ C;  1H9K A;  3ER0 A;  3K5O A;  2DJG C;  4OXP A;  4B9X A;  1ET9 A;  3LNN A;  2HIX A;  3C3L A;  4KJN A;  3I90 A;  4KHZ A;  4B3M Q;  3ERO A;  3SK6 A;  1I94 L;  4R9W A;  4DR5 Q;  2B29 A;  5M5W H;  2JA5 H;  3DM1 A;  2OCE A;  1MSG A;  2XGT A;  4YCU A;  1BNZ A;  4ZRZ A;  2ICI A;  4YCV A;  2D0P A;  2KED A;  3HOY B;  1LAB A;  3PIP 3;  2CH4 A;  2B39 A;  2DY8 A;  1HFG A;  4BA1 I;  2QDB A;  3GDE A;  1PH8 A;  5E4W C;  1ICW A;  4JBK A;  5FKA C;  2Z4H A;  4OX9 L;  3RNU A;  2RF4 A;  3OYY A;  4N9P A;  2YV5 A;  5IGB A;  4NMZ A;  4HED A;  5CYU A;  3ITP A;  4V0B A;  1HR0 L;  1JIC A;  1HCZ A;  4DUZ Q;  1IW7 C;  3QOJ A;  1PZJ D;  1AFP A;  3SE0 A;  5FO8 B;  3ZJY C;  3T1H Q;  3S17 H;  5IP9 H;  4LWC A;  1M8A A;  1XTD A;  1PYS B;  5IYB G;  2L1B A;  4LFC L;  2F52 A;  4P2C B;  3GTM H;  3HOX H;  1MGS A;  3KBG A;  2JA7 G;  4QF4 A;  5C3E H;  2KUM A;  1PRT D;  3MXN B;  3DWQ A;  2KCM A;  2BDO A;  1DOM A;  4ZKC B;  2R3Z A;  1A8V A;  1JJ2 A;  4LF9 L;  2PO4 A;  5HY6 A;  3S2D B;  1L2F A;  3TP6 A;  4PG3 A;  3J7Z C;  1E24 A;  4JG2 A;  1TQO A;  3M3Y B;  2F0K A;  1HA5 A;  3B6Y A;  4NDX A;  3M4O H;  5C4X H;  1N34 Q;  2MO1 A;  1R4Q B;  2YTY A;  4J15 A;  5GQO A;  5JPM C;  4K0K L;  1FGB D;  4ILW A;  5KRU A;  2JN4 A;  1R9T H;  2B8G A;  4L5Q A;  5IYB H;  1S5B D;  3J7Y W;  4DAP A;  3BDC A;  4IUN A;  5FJ8 H;  4R1J A;  2NYZ D;  1Q7Y C;  1JE5 A;  3JC6 6;  5IGD A;  3UDG A;  5IWA Q;  1CA6 A;  4JI7 Q;  4Y7N B;  1KDC A;  1RDP D;  1HNX L;  2N88 A;  3AU7 A;  2WAQ E;  2C35 B;  4A3I G;  2R93 H;  4DR7 L;  5LMN Q;  3LGJ A;  4JI8 L;  3E0E A;  3BVG A;  1BQQ T;  3T13 A;  3U50 C;  5JJK A;  1Q8K A;  1HZA A;  2I46 A;  4PMW A;  4A3G H;  1EIY B;  3CQZ H;  4QUF A;  2ZT9 C;  1H9R A;  4JI2 L;  5IWA L;  1LTG D;  4HJ7 A;  2P5Z X;  3PGZ A;  1C0A A;  2F0N A;  2NVX H;  4X64 Q;  2CKZ B;  2X6G A;  1TS4 A;  3MFY A;  2MO0 A;  1YNJ D;  1F2Z A;  4OIK A;  1BO0 A;  4JI3 Q;  1J5E L;  5F2D A;  5BN4 A;  3G71 A;  1EWC A;  1Q12 A;  2R93 B;  2KJX A;  2F4V Q;  2EY5 A;  1N33 L;  5ELO A;  1E1T A;  1D8L A;  3H09 A;  1EWH A;  4RHS A;  4CKC A;  3V96 A;  5T1I A;  1JJC B;  2F1M A;  3PUV A;  5C0X G;  2PW5 A;  3GTO B;  4LF9 Q;  5ELF A;  4DV5 L;  4A4I A;  3GTG B;  1AP0 A;  1YHB A;  4A3C G;  1I4Q A;  1QUQ B;  1PRT F;  1Y1W H;  3I8Z A;  1IL8 A;  1TY0 A;  2F0U A;  4K5W A;  4L5R C;  3T4A C;  1HNW Q;  1I4P A;  3FMC A;  3J81 i;  1T9H A;  4NKL A;  1UE5 A;  4K8I A;  3AMU A;  1GHJ A;  4LUO A;  2HQL A;  3TP7 A;  1STE A;  4P73 A;  3E3X A;  4KK7 A;  5ELE A;  4LF6 Q;  3CC2 A;  1D5M C;  1CZG A;  5JVG 3;  4GLA C;  2R7Z G;  2OWO A;  4IQZ A;  3UDX A;  2F0O A;  1B3A A;  1GHK A;  4DV1 Q;  2WP8 J;  1GXD C;  2CHB D;  4ABN A;  3D0F A;  4JI8 Q;  1WTO A;  2JJQ A;  1TWH H;  1E7Z A;  4DNR B;  1XNR L;  2Z1C A;  2K5V A;  4P74 A;  3UDF A;  1OXX K;  1VQ8 A;  3CCJ A;  5C44 B;  4L5S A;  2K5W A;  2WII B;  3M4P A;  3H94 A;  1RTO A;  3IFD A;  3K8A A;  4ZLT F;  1BCP C;  1VMP A;  4DK6 C;  4ZYS A;  1LYL A;  1YVC A;  3JAM L;  2Z9H A;  2F0M A;  4AH6 A;  5BR8 Q;  3K7A B;  1CM9 A;  1QNU A;  4G7H C;  4LF5 Q;  3KF6 A;  2A68 D;  4IPH A;  2D5D A;  4WOR A;  1PV4 A;  1XTC D;  2JEA I;  2EZV A;  2LXK A;  5FJ8 G;  1VQF A;  3MXG A;  4V19 0;  1D6E C;  5CBE E;  2CWA A;  3F2B A;  4IUV A;  2K75 A;  5IYC G;  1G2T A;  3AQQ A;  5EPJ A;  5EQ0 A;  4RKB A;  1XMQ Q;  1CKM A;  1PXU A;  2VL6 A;  2B63 B;  1NMF A;  4JBJ A;  4R4C A;  4CJ1 B;  5DM7 3;  3GTQ B;  2EVB A;  5L37 A;  3OTO L;  4BBS H;  2Z0S A;  3S14 H;  1PTO D;  3KLW A;  1BBU A;  2F0D A;  3WWV A;  3OWF A;  3DEO A;  4KHP L;  5JJZ A;  5M3M G;  2LY7 A;  1B7Y B;  5ELD A;  4UP9 A;  1NUC A;  2BOS A;  3RLN A;  2OTJ A;  3NBH B;  4NB3 A;  4WRD A;  3D31 A;  1Z47 A;  4A3J B;  4DV6 L;  4OON A;  3PUY A;  3FRP B;  5C4J H;  5DLQ E;  4JVZ A;  4O42 A;  4X3T A;  3VR3 A;  1SFO H;  5KEE A;  3CCQ A;  2PNH A;  1HUN A;  2SNM A;  3FKI B;  2C9O A;  3U9S A;  1U4L A;  5EKI A;  2XNA C;  2NVQ B;  2O5I C;  2ASB A;  4DR1 L;  2J7Z A;  2VQE L;  1MJE A;  2EY6 A;  2JK8 A;  3S2D H;  3ONA B;  5AJ3 Q;  2OEO A;  4BBR H;  3PO3 H;  1K0R A;  3SK8 A;  4ZK9 B;  1PH2 A;  1PYW D;  3HKZ B;  4H0L C;  1JJG A;  3MVV A;  4LFB Q;  5M3F G;  4BY7 G;  3GO5 A;  4DF7 A;  3K7A H;  3PUX A;  3GTP H;  3RUZ A;  2R92 B;  1SNM A;  1Q81 C;  2EYM A;  1Y1W G;  4KV6 A;  2RCF A;  1VQJ A;  4AYB B;  1QOH A;  3NE5 B;  4JBW A;  1FVI A;  2MHV A;  1Q90 A;  4PNY A;  1EFI D;  3UE1 A;  1EY0 A;  1TU2 B;  4RA8 A;  2WB1 G;  2E75 C;  3STB C;  2EYP A;  3H6M A;  3I4L A;  1X55 A;  4P75 A;  2BA0 A;  1GUG A;  4JI6 L;  2BA1 A;  2Q2U A;  1BUV T;  2NZO A;  1VF5 C;  2G9D A;  3PIP A;  5IYD G;  1B53 A;  1F9R A;  2KOL A;  1AZQ A;  1SBB B;  5J22 A;  2IL8 A;  1K8G A;  1GOZ A;  3GTP B;  1MJC A;  3I91 A;  1GUT A;  4A3G B;  1LT3 D;  3UDI A;  2QCP X;  5DAU A;  2NN6 I;  2VB3 X;  5TSS A;  4PZ8 A;  4DN4 M;  1CQF A;  5KNC A;  3EJI A;  4A3K H;  1A63 A;  5M5W B;  2JA5 B;  1DON A;  1V43 A;  1G29 1;  4LF7 L;  4B08 A;  2MQH A;  4HMI A;  5KYL A;  2UXB Q;  4A3L H;  2WKC A;  5I9P A;  4ME5 A;  1K28 A;  5C44 G;  2VQE Q;  2OQK A;  2E76 C;  5J1Z A;  2AHO B;  4HR7 B;  4ODG A;  4QMG A;  3VR5 A;  2WAQ B;  2PQA A;  4FNF A;  5CC4 A;  2WV6 D;  4HSV A;  4N8X 1;  2PCF B;  3BZD B;  3S2H H;  1HFN A;  3SVM A;  1UAP A;  2AWO A;  3KK7 A;  2A6E C;  3L9A X;  1BOS A;  5I9O A;  4K6L A;  5FLX c;  1M1K C;  1YIT A;  1R9T B;  3CW2 C;  1WCM H;  2QIL A;  1KAB A;  2HDL A;  4Y52 H;  3NTI A;  5ISR A;  3MFG A;  4AIM A;  4WFN 3;  4ULL A;  1K8A C;  4KHP Q;  2YU9 B;  4BBS G;  3S17 B;  1JOK A;  3HOV G;  3P20 A;  2N8N A;  2NTS A;  4POG A;  1IBM Q;  3I56 A;  2L55 A;  2OTL A;  1Z7T A;  2LS0 1;  5M3F B;  2PZW A;  1LT5 D;  1PRT B;  1KHI A;  4C1N I;  4A93 H;  3SK5 A;  1LTL A;  3CPF A;  4HAE A;  5EPL A;  2Z6B A;  2R7Z B;  1CK1 A;  2ALY B;  2L0C A;  2MGS A;  1SMX A;  4IN3 A;  4XT1 B;  4YY3 Q;  3J80 E;  3G6J B;  5A35 A;  4HMJ A;  3CCL A;  4GNX B;  1FJG Q;  2EXZ A;  2ZXO A;  4F87 A;  2LMC B;  2KHJ A;  2HT1 A;  1F77 A;  1VF7 A;  1J5E Q;  2PW7 A;  3RZD B;  3GTK B;  1RTN A;  4DK3 C;  4A3J G;  4LFB L;  4IO9 A;  4K2L A;  1Q8I A;  1EU3 A;  3OWE B;  1LV9 A;  4LF5 L;  2K5N A;  3PO3 G;  3S9W A;  5LMN W;  2RHS B;  3D4R A;  4X65 Q;  4BY7 H;  4Y7N H;  4XXE A;  1PTO B;  2RSN A;  3P7J A;  3OMG A;  4RHR A;  4RCO A;  4FO2 A;  4HIM A;  4KMU C;  1DGS A;  1HJP A;  1Y8O B;  3S14 B;  3MZ5 A;  5DNF A;  3NQI A;  4GNX A;  3U4V A;  1SNO A;  3H3V I;  5IP7 H;  1XNR Q;  2V4D A;  5GAG C;  2KBN A;  3PCO B;  4IZ8 A;  4JI4 L;  4EQ5 A;  1SE4 A;  1YZ6 A;  2A6H C;  2K6A A;  1M4V A;  4OX9 Q;  1E3P A;  3C1F A;  3QG1 A;  4NXM Q;  1D7Q A;  1XXG A;  1SN8 A;  2DJF C;  4GKJ L;  2B2U C;  3W1G A;  3HOW B;  4FYD A;  3BYT B;  1R4P B;  1LLR D;  3OIQ A;  1DJR D;  5D65 A;  4GN4 B;  3BG3 A;  4DXG A;  1TWC B;  2JQO A;  4KKU A;  3HS0 C;  1TWA H;  1IYV A;  2F0W A;  3A55 A;  1EOT A;  3SGI A;  1I3Q H;  1P8L A;  4CJ2 C;  5KND A;  1WTV A;  1EY4 A;  1CFM A;  3W1B A;  1H95 A;  5I2X A;  4ZCK A;  4DV0 L;  2EXD A;  3V05 A;  1QB5 D;  1A62 A;  4CHT B;  3BS1 A;  1XPO A;  5C44 H;  3HOY G;  2A19 A;  1X3Q A;  3EBE A;  4NW2 A;  5C6A A;  1JR0 D;  4E6I A;  3KOJ A;  2IX0 A;  5FLM H;  3PIO 3;  1WTX A;  3PSI A;  4M1U B;  4LK1 C;  3I2Z A;  2BH8 A;  2I07 B;  5IOC A;  2VUM G;  1JB7 A;  1STY A;  1S72 A;  1S3O A;  1NNX A;  3NSW A;  4A3M B;  3Q8D A;  1TWG B;  4GOP C;  1XYI A;  4UAI A;  3HKZ G;  3R3O A;  3M3Y H;  1IBL L;  1ICF B;  5J3B A;  3OIP A;  1C7Y A;  1L1O C;  1I6H H;  3FDT A;  4OL7 A;  3H0G B;  1VQC A;  1O7I A;  2CQO A;  1ZKO A;  4MTK A;  1VMC A;  4AYB E;  4DPG A;  1NAP A;  3J81 E;  1VQK A;  5LMN L;  1UE1 A;  3H3V C;  2RDG A;  2AQ3 B;  3UE0 A;  4XT3 B;  1HNX Q;  4A93 G;  2HHH L;  3CKI B;  1PRT C;  2F0T A;  5FLX E;  3HOX G;  4BBS B;  1JC7 A;  5GAE C;  3DLL A;  3DUZ A;  3PF5 A;  1SNQ A;  5EPK A;  3FPU B;  1TWG H;  4C3I H;  2QEX A;  1TS3 A;  2HIV A;  2KHS A;  2SNS A;  3R93 A;  2N3S A;  4HN7 A;  1AE2 A;  1XJV A;  1B3Q A;  3FVQ A;  2E2D C;  3L7Z C;  4RWS C;  4NPS A;  3PUW A;  2K03 A;  1YNJ C;  1Y69 U;  3TZU A;  1QJO A;  1OO9 B;  1NCV A;  3FP9 A;  3HOZ H;  1K8M A;  1I5F A;  1O80 A;  1EU4 A;  4DV0 Q;  1Z6H A;  4CKB A;  3S1M B;  4X66 L;  5IE8 A;  5LL6 S;  3VA5 A;  3CC7 A;  4PV1 C;  3MWY W;  2K5H A;  3OW7 A;  4A3I B;  2N78 A;  1I4H A;  1AEX A;  3VYT A;  2PQE A;  4X64 L;  3D6W A;  1KRT A;  1L0Y B;  3TP8 A;  1PTO F;  1H9J A;  1X3P A;  2OF1 A;  3WDN A;  1WCM B;  3T1H L;  1VQ9 A;  1WVL A;  2HCC A;  2HHH Q;  2R7D A;  4DUY L;  1CUK A;  2E2J B;  4A76 A;  4DUZ L;  1NE3 A;  1OXU A;  3FHW A;  1H9S B;  4ID6 A;  1V1Q A;  4KY7 A;  3VR4 A;  2JA6 B;  2VUM B;  1FNV A;  1YBY A;  3MXU A;  2MFI A;  1SMY D;  3S15 B;  4C2M B;  1EYC A;  2NN6 H;  3OSO A;  5M3M B;  1Q82 C;  3GTJ B;  1QVF A;  5J39 A;  2E5L L;  4K6D A;  4Q5V A;  4JI7 L;  5LL6 X;  1PDQ A;  4IOA A;  4H44 C;  1JWM D;  3NHH A;  4GKK Q;  5AFW A;  2Q2I A;  5KGU A;  3A5U A;  1HRJ A;  4JV5 L;  2PQA B;  3E6Z X;  2ZTD A;  4BBR B;  3Q24 A;  3NTH A;  1L0X B;  1ONL A;  1STB A;  2Z6K A;  1E1O A;  1EY9 A;  2K1B A;  3Q0A A;  1LAC A;  2L9H A;  5EAY A;  3TP5 A;  4HJ5 A;  4DXF A;  4MZ9 A;  1N34 L;  4JI0 Q;  4QCL A;  3HOX B;  2K5Q A;  1DYQ A;  4LMQ D;  3QR8 A;  3M7G A;  3TS0 A;  5CMD A;  1H9S A;  3PO2 G;  1K9M C;  3W5O A;  1PH7 A;  3OMC A;  1XX8 A;  3I4O A;  2AUJ D;  1A2T A;  1BKB A;  1VDZ A;  1UE7 A;  3I72 A;  1F9S A;  1I3Q B;  4QGU A;  2DGY A;  1P16 A;  1G6Z A;  2PMZ B;  4DR2 Q;  1KRS A;  1RKN A;  1I6V C;  1VQM A;  4TKO B;  2EJF C;  5EBC A;  1IBK L;  2JA8 H;  3O13 A;  1N8R C;  1X32 A;  1DOK A;  3EVQ A;  5FOB B;  3Q23 A;  5C0X J;  2E2H H;  4HJ9 A;  4J8Q A;  3BU2 A;  5CV8 A;  1U5K A;  2BE5 D;  3H0G G;  5DM6 3;  3DWP A;  5E3F A;  2RDH A;  4OGQ C;  3MHB A;  2FMM A;  1XPU A;  4C3J G;  1Y1V G;  3AYH B;  3U4Z A;  2WAC A;  3J80 L;  4C3H B;  2HCI A;  2K32 A;  3T51 B;  1SR3 A;  2DUD A;  1XMO Q;  3J7A 5;  1X65 A;  1WD1 A;  2E2I H;  1SE2 A;  4A3L G;  3QB3 A;  5IT9 c;  2RA4 A;  1FL0 A;  2A68 C;  4QY7 A;  2JA5 G;  2PI2 A;  4JI5 Q;  3HOZ G;  2K52 A;  1S5C D;  1JOQ A;  3ULJ A;  3HOU H;  4ZUJ A;  4LNQ A;  4KI0 A;  3S16 B;  4DV6 Q;  3KDF B;  4L5T A;  4DV1 L;  4MIU A;  4HJ8 A;  1ENA A;  3AFP A;  5FLX L;  1PH5 A;  1ASY A;  4MTN A;  1GO3 E;  3DMU A;  4KLK A;  4XTC S;  5ELC A;  3L2P A;  3KLR A;  3WOF A;  2VB2 X;  2O5J C;  3A5Z B;  4C56 C;  1S4Z A;  5JVH 3;  2B2T A;  1HQR D;  3A74 A;  3CRL C;  4UPA A;  1EY7 A;  2ICE C;  5FO7 B;  3Q6S A;  1L1O B;  1BCP B;  4QIW E;  3HOV H;  2Y0S G;  1GM5 A;  1PTO C;  3M4Q A;  3J81 c;  2QDL A;  3TN2 A;  4DV4 L;  3P1H A;  4UP7 A;  1DD2 A;  5IT9 E;  3T1Y Q;  2WFW A;  1K83 B;  1K8O A;  2EDG A;  1IBM L;  1JT8 A;  1PFB A;  2UU9 Q;  1A0I A;  1GUN A;  1V1P A;  3KF8 A;  4A3E B;  3OPO A;  3HOW H;  3RN2 A;  5CV7 A;  1S5D D;  1SJH D;  3FKI G;  2A1A A;  2CWP A;  2B3G A;  2N55 A;  3MXP A;  1EIG A;  5C5M A;  2Q2H A;  2JA6 G;  1CA5 A;  2FMC A;  3JAM c;  5BR8 L;  3N52 A;  1U4P A;  2R61 A;  4P72 A;  2F0L A;  3AFQ A;  5G3L F;  4F7X A;  1IL2 A;  2ES2 A;  1EY6 A;  1CSP A;  3G6E A;  1DM0 B;  3PIO A;  2IX1 A;  1YNN D;  1EQT A;  2NWG A;  1KAA A;  1ZYR D;  1ET6 A;  4FP5 D;  5K5P A;  3R2T A;  2R92 G;  1KDB A;  4PQX A;  1K83 H;  2UUB Q;  3AEV A;  2KCC A;  1VQ7 A;  3PO2 H;  5EJW A;  5IOD A;  4BS9 A;  1HNZ L;  3KDF A;  3KJO A;  2L4N A;  1KNA A;  3CC4 A;  5IGC A;  1GUO A;  3CP0 A;  4U68 A;  3I73 A;  4C3H G;  2BCO A;  5E1F A;  3S16 H;  1SE3 A;  4KN7 C;  3IRB A;  1UEB A;  2ZJQ A;  2KCT A;  1NBW A;  2A6E D;  3CF5 A;  1FGU A;  2K7V A;  4A3M H;  3KJP A;  3GTL H;  2PZU A;  3HG9 A;  4A3I H;  1B50 A;  1AW7 A;  1S5F D;  3AB9 A;  2I0Q A;  3CPW A;  3K59 A;  4B3S L;  2RSO A;  3GTQ H;  1C9O A;  4DV5 Q;  4A3G G;  1F2Y A;  1PA6 A;  3H0G H;  1CHP D;  2UXC Q;  4POF A;  4XDX A;  4CJ0 B;  1Y1V H;  1F9Q A;  1NJI C;  4I65 A;  3NTK A;  4Q0F A;  1B70 B;  2JP1 A;  4LFA Q;  3S1N B;  3RR5 A;  5C4J B;  4KKT A;  1IYU A;  2K50 A;  4DR4 L;  1X3F A;  1SAP A;  5IIF A;  2KEE A;  4DU9 A;  3CU7 A;  4IFD J;  4N9T A;  4DA2 A;  2I5H A;  5C4Z A;  4HCS A;  3SR1 A;  4JI2 Q;  1GUW A;  2UUC L;  1WTH A;  1FD7 D;  3OW2 A;  4YWM A;  1UNS A;  5C0X H;  2IW3 A;  1LTA D;  1PLF A;  4GN3 B;  5HUR A;  1K73 C;  1JOR A;  1SSO A;  3NXW A;  3CCU A;  1I4R A;  4A3C H;  3EFX D;  2A5H A;  1HZC A;  4DKA C;  4QL5 A;  2FJ2 A;  3I55 A;  1STG A;  1HHV A;  3RZD H;  4MHE A;  1A2U A;  2E74 C;  1TXY A;  2ZJR A;  4DV3 Q;  2UUA L;  1O7L A;  4JI1 Q;  1GD7 A;  4DUY Q;  2WKD A;  4LUZ A;  3U58 A;  4BXX G;  5C4H A;  4LF6 L;  3KLS A;  3EA6 A;  2R7Z H;  4BWG B;  1UUP A;  3D4D A;  3NWT A;  2L11 A;  1VQ6 A;  3HP3 A;  4K8J A;  3OTO Q;  3VR2 A;  1PFS A;  3L3O C;  4IUR A;  1B1Z A;  3A8J E;  4RAU C;  4IFD H;  3CHB D;  5LHY 1;  1ZEQ X;  4DV2 L;  3HOU B;  2JA6 H;  3F8T A;  1D1I A;  3ZYY X;  3SXH A;  4JCV E;  2I5M X;  2VQF L;  3E9I A;  1WTW A;  3RZO B;  3EQL C;  1PZK D;  3GTJ H;  4BY7 B;  1D5Z C;  5CR3 A;  3EIV A;  1GJX A;  4JI0 L;  1K0S A;  1CI3 M;  4GZY C;  2F4V L;  2UXC L;  2RHQ B;  1OXT A;  3LWE A;  2NBF A;  1EQQ A;  2B2W C;  1SDF A;  1SRU A;  1B44 D;  5C4X B;  1VQD A;  1VQN A;  1HPC A;  2XSC A;  3U9O A;  1C48 A;  1H9M A;  4C1N K;  2JEB I;  2NB0 A;  4QUC A;  1KTK A;  1HR0 W;  3GD7 A;  1FYC A;  2EQS A;  2A6H D;  1BCP D;  2RVL A;  1VQ4 A;  2NVY B;  3MXN A;  4KTA A;  1M90 C;  1E2V A;  4ZQ3 A;  3H91 A;  1VQE A;  3I3C A;  1LM0 A;  1RF2 D;  2K05 A;  1TWF B;  1YHA A;  3M85 A;  2K5D A;  1GUS A;  3BZC A;  1F9P A;  4GS3 A;  2EIF A;  1VQP A;  3GV3 A;  2F3I A;  1I4G A;  2F3W A;  1OTC A;  1IBL Q;  1EWI A;  1Q1B A;  2UXB L;  1MSH A;  1I4X A;  5M5Y H;  3MA2 B;  4LF7 Q;  2QEJ C;  3ULL A;  2I5L X;  3NK9 A;  2D2C C;  1JMC A;  1QCB D;  4X6A H;  4DR4 Q;  4HID A;  1HA6 A;  1JE4 A;  2DNE A;  1O7Y A;  1DOL A;  1QNK A;  1T5E A;  2A73 B;  5T1G A;  1LT4 D;  1EL0 A;  2B63 G;  2RCN A;  2NVT B;  3NEN A;  5GAH C;  2XRQ D;  1SLJ A;  1N9W A;  3TBI B;  1B2T A;  5CBA E;  5ELN A;  2FHT A;  1VQA A;  4RGM A;  1SNP A;  1WFQ A;  1EFW A;  3M9B A;  4BBR G;  4JBM A;  2IJ0 A;  5FLM G;  3BZK A;  1U0L A;  2OXP A;  3F2U A;  4A3B H;  2PNR C;  5M3F H;  5EGT A;  2QGQ A;  3BDO A;  5M5X B;  1VQO A;  1AZP A;  3TSS A;  1II3 A;  4B3S Q;  3E9H A;  1V1P B;  3KF8 B;  1J6Q A;  3GTO H;  3MEF A;  3I4M H;  2TMP A;  2L15 A;  2LXJ A;  2E2H B;  4LFC Q;  4A3D G;  1PH6 A;  3SK4 A;  3KUP A;  2F4I A;  2HQE A;  3M7N A;  2Q8R E;  2EYF A;  4QJF A;  4B3R L;  3ICE A;  3KF6 B;  2VW9 A;  2JA7 H;  1HNZ Q;  1QE6 A;  2AQ2 B;  3CCE A;  1PVO A;  4IFD G;  4A3B B;  1U4R A;  3PMF A;  5C0X I;  1SYD A;  2K14 A;  3PQI A;  1MD2 D;  2EYL A;  5I2Y A;  2SEB D;  1PTO H;  2QW7 A;  2XVS A;  1SMY C;  4DR3 Q;  2ZTC A;  3KBX A;  4C3I G;  1EYG A;  1BR9 A;  1LTT D;  4RG1 A;  4GN5 A;  1IYJ B;  4EVO A;  2YYZ A;  2B2Y C;  3K5M A;  1N36 L;  3NUC A;  4RGT A;  4YHH L;  1BDO A;  1I50 B;  1E2W A;  3HOU G;  4FXD A;  1SYB A;  1WTP A;  4DR5 L;  4EGV A;  1ESF A;  1JOO A;  2DNC A;  2ZM6 L;  2UXD L;  1PZI D;  4CDD C;  1TWA B;  4XYO A;  2AWN A;  3HKZ E;  1TWC H;  4YY3 L;  4LFA L;  2O4X A;  4DR2 L;  1KXL A;  2CW0 D;  1QIL A;  3QO2 A;  2NVT H;  4RMF A;  3GQB A;  4TVA B;  4G7Z C;  4CDC C;  1XNQ L;  1HZ9 A;  2KA7 A;  4OWW B;  1NMG A;  1WCM G;  2D62 A;  2EY2 A;  1TS5 A;  1TII D;  4KY5 A;  2R93 G;  4IUP A;  1LUZ A;  3TQY A;  4IJL A;  3D8G A;  2EJM A;  4IUT A;  1CSQ A;  4X3S A;  3A0J A;  1QUQ A;  4K5X A;  5BN5 A;  2EY1 A;  4YWK A;  1PH9 A;  2PZT A;  2EJG C;  2NUC A;  4A3E H;  2F0P A;  2QF7 A;  3BVM A;  3NPP A;  1QWY A;  1KL9 A;  1MKH A;  1SJE D;  4ZUI A;  4JW0 A;  1QVG A;  3MC0 B;  1YNX A;  1GVP A;  4JI4 Q;  4GKK L;  2O2L D;  4N8F A;  1UE6 A;  2SOB A;  1RHP A;  4R8I A;  1A6X A;  5A2Q E;  4A3D B;  1I6H B;  4DK0 A;  1Q3L A;  1PMR A;  2KCN A;  3K57 A;  1BBX C;  2FFK B;  1WI5 A;  3ERS X;  2UUC Q;  3KYH C;  2F0V A;  3MTS A;  1EY8 A;  2R92 H;  3F2C A;  2IY5 B;  2F0F A;  1ZYR C;  1SFO B;  4B3R Q;  4DNT B;  4A3B G;  3GTG H;  4I7Z C;  3X3N A;  1G6P A;  3GTK H;  4XIG S;  3R8B A;  1RJT A;  1FJG L;  4F88 A;  4OHJ A;  3URY A;  1EEF D;  4RCN A;  4HTH A;  5IP7 G;  4HSP A;  3OHX C;  4ME3 A;  1BF4 A;  1U4M A;  3ERQ A;  5CV5 A;  2JA8 B;  2PPB C;  4A3D H;  1G91 A;  2XRS D;  4PMC A;  3RD4 A;  1G2S A;  1TS2 A;  1HH2 P;  2MJ8 A;  2VS1 A;  2F03 A;  1VQG A;  4YIJ A;  5C3E B;  4O2D A;  1HXY D;  3BYY B;  3CRK C;  3I7F A;  1G51 A;  4BY1 H;  4WJW A;  2VY3 A;  2EE1 A;  3J80 i;  3S1N H;  5DEH A;  1ILP A;  1Y1V B;  2KEC A;  2M00 A;  4AQY Q;  4A75 A;  2UXD Q;  5JOB A;  1CKN B;  2PI2 E;  1QVC A;  1RD9 D;  4K14 A;  4EQN A;  1RIP A;  1VQ5 A;  2B2W A;  1KDA A;  1PH1 A;  2K04 A;  4IUU A;  4EQP A;  1ENC A;  1JB3 A;  1PFN A;  1Y8P B;  3A8I E;  3QOL A;  1ASZ A;  4RKL A;  2UUB L;  3QJY A;  2LFN A;  1BBW A;  3JAM i;  3I4M B;  2RDF A;  1KAW A;  1Q1E A;  4IFD I;  4FF2 A;  4KKS A;  5JPN C;  4S3S A;  1ILQ A;  1SYC A;  3T53 B;  2VUM H;  1X6O A;  3M4Y A;  3ND9 A;  1B8A A;  3S1R H;  5IYC H;  2IT1 A;  1Y8N B;  2PMZ E;  3G7L A;  3KLS X;  2GN5 A;  1OXS C;  1KNE A;  1LTS D;  2KHI A;  1PYB A;  2GVA A;  4J1M A;  4ZKB B;  2ATW A;  1CKN A;  2J0T D;  4DAM A;  1X9N A;  1U9R A;  1AH9 A;  4KJO A;  1K3B C;  3X3M A;  3C46 A;  4L6T B;  4DAY A;  2B2U A;  1EQR A;  1AN8 A;  3S24 A;  3SHL A;  4RGO S;  3RMH A;  1IBK Q;  3HZX A;  4BXX H;  1EYD A;  2JA9 A;  1IKM A;  4ZAI A;  3CXC A;  1E2Z A;  2F0G A;  2UU9 L;  1EZ8 A;  4X62 Q;  2BDN A;  4A3E G;  1KLG D;  3NBH A;  3G48 A;  4R4Q A;  3VDY A;  2H5X A;  4JI6 Q;  1ML0 D;  4X3K A;  5COR A;  4KY6 A;  5KYI A;  2B8F A;  1X54 A;  4AYB G;  1STA A;  1WJJ A;  3IKJ A;  3BJU A;  4PMB A;  3RZO H;  3VYS A;  3DM3 A;  3WOE A;  2KVM A;  4TQU S;  2LSS A;  2D0O A;  1IHZ A;  3FKI H;  1TKW B;  2N49 A;  4LJZ C;  4TRD A;  4CBV A;  1PH4 A;  1FR3 A;  5ELB A;  4MNO A;  2ZM6 Q;  3K80 C;  3R2I A;  3T16 A;  2R7F A;  3STB D;  5GRO A;  1G8Z D;  1C8C A;  5G3L D;  3K5N A;  3PF4 A;  3PO2 B;  3RN5 A;  2OT2 A;  3V2T A;  1EY5 A;  4YHH Q;  4X3U A;  5KIX A;  4FXK C;  2WIN B;  4JI5 L;  3TRE A;  4G4K A;  3A8K E;  1A3V A;  1TWH B;  2Z4I A;  4DGZ A;  5CV9 A;  2ZTE A;  3CCR A;  3PV0 A;  3OOC A;  2X69 A;  2NZ1 D;  2HD3 A;  4CKE A;  2JSO A;  3D3R A;  2MPM A;  4C3H H;  3ND8 A;  5JJI A;  4DR7 Q;  1EUJ A;  4JOI C;  3S1M H;  1JWU D;  1ZXT A;  2CFM A;  1SRO A;  3D6C A;  2CVR A;  5KNB A;  4KD4 A;  3J81 L;  4R8N A;  2OQ0 A;  3KFU A;  5H1S E;  3J7A V;  1BVS A;  1ENF A;  2E2I B;  1WTQ A;  1F2L A;  4G57 A;  4U67 3;  3I4N H;  1S40 A;  3S1Q B;  4PZ7 A;  3K5L A;  2EPB A;  5CV6 A;  1HQM C;  3IAY A;  3NP8 A;  4YCW A;  4JC0 A;  3J7A F;  1XMQ L;  2H1E A;  3E5S A;  5D3D A;  4A3K G;  1AE3 A;  4B3M L;  3VYU A;  2K4K A;  1UEA B;  1B4O A;  3C2P A;  4OO1 I;  1STH A;  2AUK A;  1PFM A;  5I4D A;  3TS2 A;  5IT9 L;  1FNU A;  1X3E A;  1RCV D;  1JQY D;  4IJH A;  3LWU A;  1BCP F;  4DV2 Q;  4KD3 A;  2K01 A;  4GLV B;  3I4N B;  3S1Q H;  2PYK A;  1B9N A;  1B9M A;  2IX3 A;  3FEW X;  5HGQ A;  2YU9 H;  4FF3 A;  4F8M A;  2A8V A;  2ZXR A;  5GAD C;  3JAM E;  1D2B A;  1V8Q A;  5LMU Q;  3I4M G;  2KQ3 A;  4P71 A;  1WTR A;  1Q86 C;  4BY1 B;  4GKJ Q;  4Z9C B;  3CME A;  3H15 A;  2F0S A;  4NXM L;  1MBY A;  2C5C A;  1IW7 D;  2FIN B;  1Y1W B;  2DY7 A;  3QIA A;  4WJ4 A;  2NZH A;  4GOP B;  1LT6 D;  1D5X C;  2JA7 B;  2HDM A;  4J6H A;  5EKK A;  2JA8 G;  4FDB A;  3TRZ A;  1A3U A;  1HTP A;  1JWS D;  3GTL B;  5JEA H;  1Z9F A;  2F0Q A;  3F2D A;  1CKO A;  4QIW B;  4R4I A;  4L63 B;  3LX0 A;  5C3E G;  4DFA A;  4MN3 A;  2DN8 A;  3BDL A;  1TVX A;  4H13 C;  2VZA A;  3HOZ B;  3CCM A;  4NP5 A;  1NR2 A;  4DAV A;  1YJW A;  4ALP A;  1IZ6 A;  4C3J H;  4XYQ A;  5IGF A;  2F0H A;  1LTB D;  1TWF H;  1YIJ A;  2CH4 W;  1CT1 D;  4H02 A;  4C3I B;  4FXG C;  5D3I B;  4AQY L;  1CQV A;  4B3T L;  2G5D A;  1L0W A;  5C4X G;  1X3G A;  2A69 C;  4XQQ A;  4XQJ A;  3T1Y L;  3NWS A;  2ZXP A;  4BA2 I;  2F0E A;  3W3A A;  1O78 A;  5NUC A; 
#chains in the Genus database with same CATH homology
 1TY2 A;  3VR6 A;  2CW0 C;  1CHQ D;  2F3V A;  4A3K B;  4FF1 A;  4IAL A;  4C3J B;  4A3F B;  3NBI A;  2JYO A;  4O1N A;  4HCE A;  1HTL D;  2XWB B;  2MP1 A;  2RKS A;  4RH6 A;  2JE6 I;  3UI2 A;  5IGG A;  2EYJ A;  3A54 A;  3IFT A;  4TSS A;  4OO1 G;  1EZ6 A;  3GV6 A;  3A56 A;  2XIW A;  5HGT A;  3HOV B;  3Q22 A;  3S2H B;  4DK1 A;  2R6G A;  2ID0 A;  3C1E A;  3A7L A;  1ROD A;  3M4O B;  1CZW A;  3CQZ B;  2LKV A;  5BN3 A;  1T5X D;  2A74 C;  1NSN S;  2Z8L A;  1SXT A;  4XQN A;  4JK1 C;  2F0J A;  3T56 B;  3HEJ A;  3TZD A;  1DXM A;  2Y0S B;  1F2M A;  1HUM A;  2H4O A;  3VA7 A;  2SDF A;  5A2Q L;  3DWA A;  3PUZ A;  5CGK A;  4FVM A;  2B2V A;  1NR4 A;  1EQV A;  3BVZ A;  4K2K A;  1EIH A;  3TDQ A;  1SEB D;  2QKI C;  3A7A B;  1CTM A;  1S5E D;  3TME A;  3SDZ A;  4OIJ A;  5JAV A;  1DCZ A;  5EKL A;  2JXM B;  1YNN C;  3N6R A;  1LO5 D;  3E0J A;  1V1O A;  1E0B A;  2IWH A;  1QG7 A;  5JEA G;  2NTT A;  2A69 D;  1KLU D;  4IUQ A;  5K36 G;  1BXT A;  1JCK B;  4B9W A;  5C5L A;  5FO9 B;  1OXV A;  1SYG A;  5C3X A;  5M5Y B;  4UDU C;  4QB4 A;  4FF4 A;  2D9U A;  3NQT A;  1XWE A;  4L8J A;  5D14 A;  1A15 A;  1J9O A;  2EYH A;  2M2L A;  1LTI D;  2B2V C;  2M9V A;  1O7Z A;  1ESR A;  5FK9 C;  3RLF A;  1D1K A;  2RQX A;  3S1R B;  1STN A;  2Q8T A;  4RFB A;  1W6J A;  4K5V A;  5I6Y A;  1IKL A;  5IGE A;  4H7B A;  3K6O A;  2AQ1 B;  2IPK D;  1VCI A;  2EOT A;  2J4X A;  2K28 A;  3FPP A;  3SEB A;  5M9O A;  1LTR D;  2MUY A;  4OO1 H;  1C4Q A;  2NVX B;  2GA4 B;  4CGY B;  3MEH A;  4KHV A;  1SYF A;  2F0I A;  5JEA J;  2NN6 G;  4EQO A;  1SND A;  3W2D A;  2ENB A;  1EEI D;  2VNU D;  2TSS A;  4A93 B;  3DEP A;  2G9H D;  2HUG A;  1FNW A;  3GP7 A;  3HGB A;  2Q8I B;  5E4X A;  3K58 A;  2XWJ B;  3I70 A;  3VYR A;  2EYO A;  1MI2 A;  4RGN A;  4G7O C;  2L12 A;  1SNC A;  5I6W A;  1TT2 A;  2B2Y A;  1DZ1 A;  2BE5 C;  5C3W A;  3PO3 B;  1SYE A;  2XN9 C;  3P75 A;  3DXJ C;  3DHQ A;  2WB1 B;  2X6L A;  3D4W A;  4KN4 C;  2CQA A;  5COY A;  1TR5 A;  2B2T C;  1EYA A;  3GTM B;  2K33 A;  2VXW A;  5CV4 A;  1W6K A;  3MAQ A;  1A3T A;  4LAA A;  1WD0 A;  4M8A A;  2L5T A;  3IL8 A;  3QWN A;  1J8I A;  3K0Y A;  5K36 H;  5EBD A;  2RBM A;  3HRZ C;  1H9K A;  3K5O A;  4B9X A;  1ET9 A;  3LNN A;  3C3L A;  4KJN A;  3I90 A;  4KHZ A;  3ERO A;  3SK6 A;  4R9W A;  3DM1 A;  1MSG A;  1BNZ A;  4ZRZ A;  2ICI A;  2KED A;  3HOY B;  1LAB A;  3PIP 3;  2B39 A;  2DY8 A;  1HFG A;  4BA1 I;  2QDB A;  5E4W C;  1ICW A;  5FKA C;  2Z4H A;  5IGB A;  4N9P A;  4NMZ A;  4HED A;  5CYU A;  3ITP A;  4V0B A;  1JIC A;  1HCZ A;  1IW7 C;  3QOJ A;  1PZJ D;  1AFP A;  3SE0 A;  5FO8 B;  1M8A A;  2L1B A;  4P2C B;  1MGS A;  3KBG A;  4QF4 A;  2KUM A;  1PRT D;  3DWQ A;  2BDO A;  1DOM A;  4ZKC B;  2R3Z A;  2PO4 A;  3S2D B;  3TP6 A;  1TQO A;  3M3Y B;  2F0K A;  1HA5 A;  4NDX A;  1R4Q B;  5JPM C;  1FGB D;  4ILW A;  5KRU A;  2B8G A;  1S5B D;  3J7Y W;  4DAP A;  3BDC A;  4IUN A;  2NYZ D;  5IGD A;  1CA6 A;  4Y7N B;  1KDC A;  1RDP D;  2N88 A;  3AU7 A;  3BVG A;  1BQQ T;  3T13 A;  2I46 A;  4PMW A;  4QUF A;  2ZT9 C;  1H9R A;  1LTG D;  2F0N A;  2X6G A;  1TS4 A;  3MFY A;  1YNJ D;  1F2Z A;  4OIK A;  1BO0 A;  5F2D A;  5BN4 A;  1EWC A;  1Q12 A;  2R93 B;  2KJX A;  2EY5 A;  3H09 A;  1EWH A;  4RHS A;  4CKC A;  3V96 A;  5T1I A;  2F1M A;  3PUV A;  5C0X G;  2PW5 A;  3GTO B;  5ELF A;  3GTG B;  1AP0 A;  1I4Q A;  1PRT F;  3I8Z A;  1IL8 A;  1TY0 A;  2F0U A;  4K5W A;  3T4A C;  1I4P A;  3FMC A;  4NKL A;  4K8I A;  3AMU A;  1GHJ A;  3TP7 A;  1STE A;  4KK7 A;  5ELE A;  1D5M C;  1CZG A;  5JVG 3;  4IQZ A;  2F0O A;  1B3A A;  1GHK A;  2WP8 J;  1GXD C;  2CHB D;  4ABN A;  1WTO A;  4DNR B;  2Z1C A;  1OXX K;  5C44 B;  2K5W A;  2WII B;  3H94 A;  1RTO A;  3IFD A;  4ZLT F;  1BCP C;  1VMP A;  4ZYS A;  3JAM L;  2F0M A;  3K7A B;  1CM9 A;  1QNU A;  4G7H C;  2A68 D;  2D5D A;  4WOR A;  2JEA I;  1XTC D;  2EZV A;  3MXG A;  4V19 0;  1D6E C;  5CBE E;  4IUV A;  1G2T A;  5EPJ A;  5EQ0 A;  4RKB A;  1PXU A;  2B63 B;  4CJ1 B;  5DM7 3;  3GTQ B;  2EVB A;  1PTO D;  2F0D A;  3OWF A;  3DEO A;  5JJZ A;  2LY7 A;  5ELD A;  1NUC A;  2BOS A;  4WRD A;  3D31 A;  1Z47 A;  4A3J B;  3PUY A;  3FRP B;  4O42 A;  4X3T A;  3VR3 A;  5KEE A;  1HUN A;  2SNM A;  3FKI B;  2C9O A;  3U9S A;  1U4L A;  5EKI A;  2XNA C;  2NVQ B;  2O5I C;  2J7Z A;  2EY6 A;  3ONA B;  2OEO A;  3SK8 A;  4ZK9 B;  1PYW D;  3HKZ B;  4H0L C;  3MVV A;  3GO5 A;  4DF7 A;  3PUX A;  3RUZ A;  2R92 B;  1SNM A;  2EYM A;  4KV6 A;  4AYB B;  1QOH A;  3NE5 B;  4JBW A;  2MHV A;  1Q90 A;  4PNY A;  1EFI D;  1EY0 A;  1TU2 B;  4RA8 A;  2E75 C;  2EYP A;  3H6M A;  3I4L A;  2BA0 A;  1GUG A;  2BA1 A;  1BUV T;  1VF5 C;  2G9D A;  1B53 A;  1F9R A;  2KOL A;  1AZQ A;  1SBB B;  5J22 A;  2IL8 A;  1GOZ A;  3GTP B;  3I91 A;  1GUT A;  4A3G B;  1LT3 D;  2QCP X;  5DAU A;  2NN6 I;  2VB3 X;  5TSS A;  4DN4 M;  1CQF A;  5KNC A;  3EJI A;  5M5W B;  2JA5 B;  1DON A;  1V43 A;  1G29 1;  4B08 A;  4HMI A;  5KYL A;  2WKC A;  5I9P A;  4ME5 A;  2E76 C;  5J1Z A;  4HR7 B;  4ODG A;  4QMG A;  3VR5 A;  2WAQ B;  4FNF A;  5CC4 A;  2WV6 D;  4HSV A;  2PCF B;  3BZD B;  1HFN A;  3SVM A;  1UAP A;  2AWO A;  3KK7 A;  2A6E C;  3L9A X;  1BOS A;  5I9O A;  4K6L A;  1R9T B;  2QIL A;  1KAB A;  2HDL A;  3NTI A;  5ISR A;  3MFG A;  4WFN 3;  4ULL A;  2YU9 B;  3S17 B;  1JOK A;  3P20 A;  2NTS A;  2L55 A;  1Z7T A;  2LS0 1;  5M3F B;  2PZW A;  1LT5 D;  1PRT B;  4C1N I;  3SK5 A;  4HAE A;  5EPL A;  2R7Z B;  1CK1 A;  2L0C A;  2MGS A;  4IN3 A;  4XT1 B;  3J80 E;  3G6J B;  5A35 A;  4HMJ A;  2EXZ A;  2ZXO A;  4F87 A;  2LMC B;  1F77 A;  1VF7 A;  2PW7 A;  3RZD B;  3GTK B;  1RTN A;  4K2L A;  1Q8I A;  1EU3 A;  3OWE B;  1LV9 A;  3S9W A;  3D4R A;  4XXE A;  1PTO B;  2RSN A;  3P7J A;  3OMG A;  4RHR A;  4RCO A;  4FO2 A;  1Y8O B;  4KMU C;  3S14 B;  3MZ5 A;  5DNF A;  3NQI A;  1SNO A;  2V4D A;  4IZ8 A;  1SE4 A;  2A6H C;  2K6A A;  1M4V A;  3C1F A;  3QG1 A;  1XXG A;  2B2U C;  3HOW B;  4FYD A;  3BYT B;  1R4P B;  1LLR D;  3OIQ A;  1DJR D;  5D65 A;  3BG3 A;  4DXG A;  1TWC B;  4KKU A;  3HS0 C;  1IYV A;  2F0W A;  3A55 A;  1EOT A;  4CJ2 C;  5KND A;  1WTV A;  1EY4 A;  1CFM A;  5I2X A;  3V05 A;  1QB5 D;  3BS1 A;  4CHT B;  1X3Q A;  4NW2 A;  5C6A A;  1JR0 D;  4E6I A;  2IX0 A;  3PIO 3;  1WTX A;  4M1U B;  4LK1 C;  2I07 B;  5IOC A;  1STY A;  3NSW A;  4A3M B;  1TWG B;  1XYI A;  4UAI A;  3R3O A;  3OIP A;  3FDT A;  4OL7 A;  3H0G B;  1ZKO A;  1VMC A;  1NAP A;  3J81 E;  3H3V C;  2RDG A;  2AQ3 B;  4XT3 B;  3CKI B;  1PRT C;  2F0T A;  5FLX E;  4BBS B;  1JC7 A;  3DUZ A;  1SNQ A;  5EPK A;  3FPU B;  1TS3 A;  2KHS A;  2SNS A;  3R93 A;  4HN7 A;  3FVQ A;  2E2D C;  3L7Z C;  4RWS C;  3PUW A;  2K03 A;  1YNJ C;  1Y69 U;  3TZU A;  1QJO A;  1OO9 B;  1NCV A;  1K8M A;  1O80 A;  1EU4 A;  1Z6H A;  4CKB A;  3S1M B;  3VA5 A;  5LL6 S;  4PV1 C;  3MWY W;  3OW7 A;  4A3I B;  1I4H A;  1AEX A;  3VYT A;  2PQE A;  3D6W A;  1L0Y B;  3TP8 A;  1PTO F;  1H9J A;  1X3P A;  2OF1 A;  3WDN A;  1WCM B;  1WVL A;  2HCC A;  2E2J B;  1OXU A;  1H9S B;  4ID6 A;  4KY7 A;  3VR4 A;  2JA6 B;  2VUM B;  1FNV A;  3MXU A;  1SMY D;  3S15 B;  4C2M B;  1EYC A;  2NN6 H;  3OSO A;  5M3M B;  3GTJ B;  5J39 A;  4K6D A;  4Q5V A;  5LL6 X;  1PDQ A;  4H44 C;  1JWM D;  3NHH A;  5AFW A;  5KGU A;  1HRJ A;  3E6Z X;  4BBR B;  3Q24 A;  1STB A;  1L0X B;  1ONL A;  3NTH A;  1EY9 A;  2K1B A;  3Q0A A;  1LAC A;  2L9H A;  3TP5 A;  4DXF A;  4QCL A;  3HOX B;  2K5Q A;  1DYQ A;  4LMQ D;  3M7G A;  5CMD A;  1H9S A;  3OMC A;  1XX8 A;  2AUJ D;  1A2T A;  1VDZ A;  3I72 A;  1F9S A;  1I3Q B;  1G6Z A;  2PMZ B;  1RKN A;  1I6V C;  4TKO B;  2EJF C;  5EBC A;  3O13 A;  1X32 A;  1DOK A;  3EVQ A;  5FOB B;  3Q23 A;  5C0X J;  4J8Q A;  5CV8 A;  2BE5 D;  5DM6 3;  3DWP A;  5E3F A;  2RDH A;  4OGQ C;  3MHB A;  2FMM A;  4C3J G;  2WAC A;  3J80 L;  4C3H B;  2HCI A;  2K32 A;  3T51 B;  1WD1 A;  1SE2 A;  3QB3 A;  2RA4 A;  2A68 C;  1S5C D;  1JOQ A;  4ZUJ A;  4KI0 A;  3S16 B;  4MIU A;  1ENA A;  5FLX L;  3DMU A;  4XTC S;  5ELC A;  3KLR A;  3WOF A;  2VB2 X;  2O5J C;  4C56 C;  1S4Z A;  5JVH 3;  2B2T A;  1HQR D;  3CRL C;  1EY7 A;  5FO7 B;  2ICE C;  3Q6S A;  1BCP B;  1PTO C;  3TN2 A;  3P1H A;  1DD2 A;  5IT9 E;  1K83 B;  1K8O A;  2EDG A;  1PFB A;  1GUN A;  1V1P A;  3KF8 A;  4A3E B;  3OPO A;  5CV7 A;  1S5D D;  1SJH D;  2N55 A;  3MXP A;  1EIG A;  5C5M A;  1CA5 A;  2FMC A;  3N52 A;  1U4P A;  2R61 A;  5G3L F;  2F0L A;  4F7X A;  1EY6 A;  1DM0 B;  2IX1 A;  1YNN D;  1EQT A;  2NWG A;  1KAA A;  1ZYR D;  1ET6 A;  4FP5 D;  5K5P A;  3R2T A;  1KDB A;  4PQX A;  2KCC A;  5EJW A;  5IOD A;  4BS9 A;  2L4N A;  1KNA A;  5IGC A;  1GUO A;  4U68 A;  3I73 A;  4C3H G;  2BCO A;  5E1F A;  1SE3 A;  4KN7 C;  2A6E D;  2K7V A;  2PZU A;  3HG9 A;  1B50 A;  1AW7 A;  1S5F D;  3AB9 A;  3K59 A;  2RSO A;  1F2Y A;  1CHP D;  4XDX A;  4CJ0 B;  1F9Q A;  4I65 A;  3NTK A;  4Q0F A;  2JP1 A;  3S1N B;  5C4J B;  4KKT A;  1IYU A;  1SAP A;  5IIF A;  2KEE A;  4DU9 A;  3CU7 A;  4IFD J;  4N9T A;  4DA2 A;  5C4Z A;  4HCS A;  3SR1 A;  1GUW A;  1FD7 D;  1UNS A;  5C0X H;  2IW3 A;  1LTA D;  1PLF A;  5HUR A;  1JOR A;  1SSO A;  3NXW A;  1I4R A;  3EFX D;  2A5H A;  2FJ2 A;  1STG A;  1HHV A;  4MHE A;  1A2U A;  2E74 C;  1O7L A;  2WKD A;  5C4H A;  3KLS A;  3EA6 A;  4BWG B;  1UUP A;  3D4D A;  3NWT A;  2L11 A;  3HP3 A;  4K8J A;  3VR2 A;  3L3O C;  4IUR A;  1B1Z A;  3A8J E;  4RAU C;  4IFD H;  3CHB D;  5LHY 1;  1ZEQ X;  3HOU B;  1D1I A;  3ZYY X;  3SXH A;  1WTW A;  3RZO B;  3EQL C;  1PZK D;  4BY7 B;  1D5Z C;  5CR3 A;  1GJX A;  1CI3 M;  4GZY C;  1OXT A;  3LWE A;  2NBF A;  2B2W C;  1SDF A;  1B44 D;  5C4X B;  1HPC A;  2XSC A;  3U9O A;  1C48 A;  1H9M A;  4C1N K;  2JEB I;  2NB0 A;  4QUC A;  1KTK A;  3GD7 A;  1FYC A;  2A6H D;  1BCP D;  2RVL A;  2NVY B;  3MXN A;  4KTA A;  1E2V A;  4ZQ3 A;  3H91 A;  3I3C A;  1RF2 D;  2K05 A;  1TWF B;  3M85 A;  2K5D A;  1GUS A;  1F9P A;  3GV3 A;  1I4G A;  2F3W A;  1Q1B A;  1MSH A;  1I4X A;  3MA2 B;  2QEJ C;  3NK9 A;  2D2C C;  1QCB D;  1HA6 A;  1JE4 A;  2DNE A;  1O7Y A;  1DOL A;  1QNK A;  1T5E A;  2A73 B;  5T1G A;  1LT4 D;  1EL0 A;  2NVT B;  2XRQ D;  3TBI B;  1B2T A;  5CBA E;  2FHT A;  4RGM A;  1SNP A;  2IJ0 A;  2OXP A;  3F2U A;  2PNR C;  5EGT A;  3BDO A;  5M5X B;  1AZP A;  3TSS A;  1II3 A;  1V1P B;  2TMP A;  2E2H B;  3SK4 A;  3KUP A;  2F4I A;  2HQE A;  3M7N A;  2Q8R E;  2EYF A;  1QE6 A;  2AQ2 B;  4IFD G;  4A3B B;  1U4R A;  3PMF A;  5C0X I;  1SYD A;  1MD2 D;  2EYL A;  5I2Y A;  2SEB D;  1PTO H;  2XVS A;  1SMY C;  3KBX A;  4C3I G;  1BR9 A;  1LTT D;  4EVO A;  2YYZ A;  2B2Y C;  3K5M A;  3NUC A;  4RGT A;  1BDO A;  1I50 B;  1E2W A;  4FXD A;  1SYB A;  1WTP A;  4EGV A;  1ESF A;  1JOO A;  2DNC A;  1PZI D;  1TWA B;  4XYO A;  2AWN A;  2O4X A;  2CW0 D;  1QIL A;  3QO2 A;  3GQB A;  4G7Z C;  2KA7 A;  2D62 A;  2EY2 A;  1TS5 A;  1TII D;  4KY5 A;  4IUP A;  3D8G A;  2EJM A;  4IUT A;  4X3S A;  4K5X A;  5BN5 A;  2EY1 A;  2PZT A;  2EJG C;  2NUC A;  2F0P A;  2QF7 A;  3BVM A;  3NPP A;  1QWY A;  1SJE D;  4ZUI A;  3MC0 B;  2O2L D;  2SOB A;  1RHP A;  4R8I A;  1A6X A;  5A2Q E;  4A3D B;  1I6H B;  4DK0 A;  1Q3L A;  1PMR A;  2KCN A;  3K57 A;  1BBX C;  2FFK B;  2F0V A;  3MTS A;  1EY8 A;  2F0F A;  1ZYR C;  1SFO B;  4DNT B;  4I7Z C;  3X3N A;  4XIG S;  3R8B A;  1RJT A;  4F88 A;  4OHJ A;  3URY A;  1EEF D;  4RCN A;  4HTH A;  4HSP A;  3OHX C;  1BF4 A;  1U4M A;  3ERQ A;  5CV5 A;  2JA8 B;  2PPB C;  1G91 A;  2XRS D;  3RD4 A;  4PMC A;  1G2S A;  1TS2 A;  2MJ8 A;  2F03 A;  4YIJ A;  5C3E B;  1HXY D;  3BYY B;  3CRK C;  4WJW A;  2EE1 A;  1ILP A;  5DEH A;  1Y1V B;  2KEC A;  2M00 A;  5JOB A;  1RD9 D;  4K14 A;  4EQN A;  2B2W A;  1KDA A;  2K04 A;  4IUU A;  4EQP A;  1ENC A;  1JB3 A;  1PFN A;  1Y8P B;  3A8I E;  3QOL A;  4RKL A;  3QJY A;  2LFN A;  3I4M B;  2RDF A;  1Q1E A;  4IFD I;  4FF2 A;  4KKS A;  5JPN C;  4S3S A;  1SYC A;  1ILQ A;  3T53 B;  3M4Y A;  3ND9 A;  2IT1 A;  1Y8N B;  3G7L A;  3KLS X;  1OXS C;  1KNE A;  1LTS D;  4J1M A;  4ZKB B;  2J0T D;  1U9R A;  4KJO A;  3X3M A;  3C46 A;  4L6T B;  4DAY A;  2B2U A;  1AN8 A;  3SHL A;  4RGO S;  3RMH A;  3HZX A;  1IKM A;  1EYD A;  4ZAI A;  1E2Z A;  2F0G A;  1EZ8 A;  2BDN A;  1KLG D;  3NBH A;  1ML0 D;  4X3K A;  5COR A;  4KY6 A;  5KYI A;  2B8F A;  1STA A;  3IKJ A;  4PMB A;  3VYS A;  3WOE A;  2KVM A;  4TQU S;  1IHZ A;  1TKW B;  4LJZ C;  4TRD A;  4CBV A;  1FR3 A;  5ELB A;  3R2I A;  3T16 A;  1G8Z D;  1C8C A;  5G3L D;  3K5N A;  3PO2 B;  2OT2 A;  3V2T A;  1EY5 A;  4X3U A;  5KIX A;  4FXK C;  2WIN B;  4G4K A;  3A8K E;  1A3V A;  1TWH B;  2Z4I A;  4DGZ A;  5CV9 A;  3PV0 A;  3OOC A;  2X69 A;  2NZ1 D;  4CKE A;  2JSO A;  3D3R A;  2MPM A;  3ND8 A;  1JWU D;  1ZXT A;  3D6C A;  2CVR A;  5KNB A;  4KD4 A;  3J81 L;  4R8N A;  3J7A V;  1ENF A;  2E2I B;  1WTQ A;  1F2L A;  4G57 A;  4U67 3;  3S1Q B;  3K5L A;  2EPB A;  5CV6 A;  1HQM C;  3IAY A;  3NP8 A;  3J7A F;  2H1E A;  3E5S A;  5D3D A;  3VYU A;  1UEA B;  1B4O A;  3C2P A;  4OO1 I;  1STH A;  2AUK A;  1PFM A;  5I4D A;  5IT9 L;  1FNU A;  1RCV D;  1JQY D;  3LWU A;  1BCP F;  4KD3 A;  2K01 A;  3I4N B;  2PYK A;  1B9N A;  1B9M A;  2IX3 A;  3FEW X;  4FF3 A;  4F8M A;  2ZXR A;  3JAM E;  1D2B A;  1V8Q A;  2KQ3 A;  1WTR A;  4BY1 B;  4Z9C B;  2F0S A;  1MBY A;  2C5C A;  1IW7 D;  2FIN B;  1Y1W B;  2DY7 A;  3QIA A;  1LT6 D;  1D5X C;  2JA7 B;  2HDM A;  4J6H A;  5EKK A;  1A3U A;  1HTP A;  1JWS D;  3GTL B;  5JEA H;  2F0Q A;  4QIW B;  4L63 B;  3LX0 A;  4DFA A;  2DN8 A;  3BDL A;  4H13 C;  1TVX A;  4MN3 A;  3HOZ B;  4NP5 A;  1NR2 A;  4DAV A;  4XYQ A;  5IGF A;  2F0H A;  1LTB D;  1CT1 D;  4C3I B;  4FXG C;  5D3I B;  1CQV A;  2A69 C;  4XQQ A;  4XQJ A;  3NWS A;  2ZXP A;  4BA2 I;  2F0E A;  3W3A A;  1O78 A;  5NUC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...