5J1ZA

Crystal structure of staphylococcal nuclease variant delta+phs a90d at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLDYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS A90D at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5j1zA00
5CR3A 4B9XA 2F0IA 4WORA 2F0WA 2EYLA 2OXPA 1STAA 4HMJA 1EYCA 4EQNA 3P1HA 1STHA 4J6HA 2M00A 3C1FA 4TRDA 1F2ZA 5KYLA 1SYGA 3D4WA 4K5VA 5IGEA 1STNA 2KHSA 4OL7A 3SK4A 1EYDA 3D6CA 3NHHA 4K5XA 5CV8A 5IGGA 1RKNA 2SNMA 2KQ3A 5IOCA 3V2TA 2F0NA 1SYEA 5KGUA 2F0QA 5ISRA 3H6MA 2PZWA 4KHVA 2EY5A 5KYIA 2ENBA 4ZUJA 1KDAA 4H7BA 3T13A 1ENAA 3MZ5A 3NQTA 4I65A 3VA5A 1EY6A 3P75A 5E1FA 5EKLA 1A3TA 5HGTA 3E5SA 2O4XA 4HMIA 1IHZA 1EYAA 2F3VA 4ME5A 4DF7A 1KABA 3PMFA 1SNDA 3MXPA 4NP5A 5C5LA 1EQVA 2F0EA 3T16A 2OF1A 4DU9A 1A2TA 5M9OA 1SYCA 1A2UA 3D8GA 3ERQA 4ID6A 3SK6A 1SNOA 4K6DA 3TP8A 5CC4A 2EXZA 3OSOA 5I9OA 1SNPA 2PW7A 4E6IA 5E3FA 5C4HA 4PMCA 4RKBA 4NDXA 5K5PA 5J39A 5HURA 5IGDA 4F8MA 1SYDA 4K14A 2F0HA 4KD3A 2EYPA 5JAVA 2F0DA 4KY5A 4HTHA 1EY9A 1SYBA 2F0UA 3DMUA 3R3OA 3MEHA 4R8NA 1TT2A 4J1MA 3HEJA 4F7XA 3S9WA 4KY6A 4PMBA 4EQPA 3OMCA 1F2MA 4K2KA 4QF4A 1EZ6A 4ZUIA 4LAAA 4WRDA 5J1ZA 4B9WA 5C3XA 5CV9A 2F0VA 2F3WA 3QOJA 4S3SA 3SR1A 2PYKA 1SNCA 4KD4A 5KIXA 4G57A 5C5MA 2PZUA 4IUNA 3TP5A 2RBMA 2F0TA 2OEOA 4IZ8A 1KAAA 2EYOA 2EYJA 2F0FA 3NXWA 3ITPA 5I9PA 4EVOA 2F0LA 3D4DA 4QB4A 5NUCA 3C1EA 4K8JA 2F0JA 2PQEA 5JOBA 3U9OA 5EGTA 5C4ZA 2RDFA 4RKLA 1SNQA 5I6YA 2EYHA 3QOLA 3SK5A 1KDCA 1STBA 5EKKA 5CV6A 1EY4A 2QDBA 2F0GA 2F0SA 2EY1A 4KJNA 3MHBA 4MIUA 2F0KA 3SXHA 1JOQA 3TMEA 4DFAA 4KTAA 2F0MA 4K2LA 4NKLA 5CV5A 4ZQ3A 4ODGA 5IGFA 5IIFA 1SYFA 1U9RA 3EROA 4K8IA 4NMZA 2HQEA 4QMGA 1EY5A 3EJIA 2NUCA 5CV7A 5DEHA 5DAUA 4YIJA 5KEEA 2LKVA 2SOBA 1SNMA 1ENCA 5C3WA 4PNYA 1KDBA 2EY6A 2SNSA 3OWFA 1EY7A 1JORA 5C6AA 3NP8A 3NUCA 3BDLA 3RUZA 1JOKA 5CGKA 4K5WA 5IGBA 5J22A 1NUCA 3EVQA 3SK8A 1STGA 1F2YA 1JOOA 2F0OA 1EY0A 1EZ8A 1TR5A 1TQOA 2WACA 1A3UA 2EYFA 3NK9A 3HZXA 5IODA 4KV6A 5F2DA 2F0PA 4N9TA 1NSNS 5KRUA 3SHLA 5I6WA 1STYA 2PW5A 1A3VA 4EQOA 1EY8A 2RKSA 3BDCA 4N9PA 4KY7A 4DGZA 5IGCA 3DHQA 3TP7A 3OMGA 2EY2A 4KJOA 1II3A 3QB3A 3MVVA 2PZTA 5CV4A 3TP6A 4IALA 3LX0A 1AEXA 2EYMA
chains in the Genus database with same CATH superfamily
2F0WA 4DV7L 1BCPC 1YI2A 2IX3A 1F2ZA 2ICIA 3DM3A 4Y7NB 4DV0L 2LFNA 1N36Q 5I2XA 1STNA 3TZDA 1LT3D 3K6OA 3I3CA 3M4PA 1XNQQ 1IZ6A 1JWSD 3WOEA 4PG3A 1VQBA 5HY6A 1CFMA 1YJNA 2JJQA 2VB2X 4JVZA 1VMCA 4A3GH 1AE3A 5HGQA 1HPCA 4YWKA 3L2PA 3HOVG 1KABA 2DJGC 1EQVA 1YNXA 3ZJYC 1Y8NB 1BDOA 1MGSA 2DY7A 1B8AA 1HNZQ 1Q90A 4X64L 3F2BA 1NE3A 4GOPC 1EEID 3PUXA 4V0BA 3UI2A 1I4GA 3ICEA 1NAPA 1BQQT 3CMEA 1TWGB 1B3QA 4RFBA 2JA6B 4BBRH 2DJFC 1VQGA 5FLXc 2HD3A 4HJAA 2UUCL 4K2KA 1H9RA 2XRQD 5JJZA 1Q81C 1CTMA 3DEPA 1NNXA 2ZXRA 2PO4A 2G5DA 4KMUC 3TRZA 1H9SB 3K0YA 1R4QB 3BZDB 4RGOS 4A3GG 4C1NK 4LNQA 2E2HH 4QB4A 1YITA 1G91A 2KCCA 3MXGA 4HIOA 1SRUA 4FXGC 1VQOA 4C2MH 2E75C 5D65A 2EY1A 5C4XG 1LT4D 1LTID 4H44C 3T53B 3L0OA 1D1KA 1SN8A 3ERSX 4IPGA 4K8IA 2DUDA 2NUCA 4LFBQ 1SFOB 4ZKBB 4MN3A 1FNWA 4UPAA 4LUVA 1Q7YC 4YY3L 2B2UC 4A3KG 2R92G 3URYA 4IFDH 2XGTA 1BCPB 5DNFA 1HNXQ 1EZ8A 4A3BH 1SXTA 3CW2C 5F2DA 2YTXA 3W2DA 2N78A 1K3RA 3I4MH 3RLOA 2K28A 5KNBA 4WFN3 2VY3A 5L37A 5COYA 3BDCA 3GV3A 2X6GA 4P72A 4NB3A 1I4PA 1FJGL 1VF7A 2HIVA 2A73B 5CR3A 1OXXK 2AWNA 2NVQH 1B9NA 1STAA 1X56A 4KHZA 5C44H 2K5HA 2N3SA 4UAIA 4DR7Q 3WOFA 2K5DA 1CQFA 5BN4A 2B63B 5M3MB 1WCMG 3S2HB 1Y1WG 1RJTA 2B2VA 1G51A 4PZ8A 3VR5A 1K8GA 5C5LA 3HOYH 2OF1A 3UDIA 1K3BC 2BDNA 3QG1A 3ERQA 1VQPA 2WIIB 4HSPA 2XRSD 3IKJA 2HHHQ 2EXZA 4L5SA 4XXEA 3TREA 4JG2A 5EQ0A 3CPWA 1W2BA 4RKBA 5K5PA 4F8MA 1EFWA 1CKMA 5C3EB 4BBSH 3S1NH 2G9HD 1LT5D 1L0YB 1V1QA 2K6AA 4XT1B 2LS01 3KBXA 2D9UA 4KHPL 5IT9E 3QOJA 5AJ3Q 5IT9L 1Y1WH 1TIID 4JI3L 1KAAA 2IW3A 2NZ1D 1TXYA 4K8JA 4I7AA 3GTLH 4UP7A 5BR8Q 4RKLA 2DNCA 5KNDA 3VR4A 3S16B 3BYTB 2EJMA 1ZKOA 1C7YA 1EIHA 1DYQA 1IYJB 3RZOH 2AMCB 2A6HC 3MHBA 4LWCA 3V96A 3TMEA 4FF4A 1EWIA 2K14A 2WB1G 4PV1C 3UDFA 1PTOB 1V43A 4HIMA 3OPOA 1MJEA 4JBMA 2N8NA 1IL2A 2EY6A 3PF5A 1WTQA 1W6KA 4HCSA 2JN4A 2WAQB 5ELNA 4HR7B 3EVQA 2QW7A 3SK8A 5C0XJ 4IFDI 1TR5A 5LL6X 4CDEC 1XPOA 2F0PA 4LF6L 1NCVA 3TBIB 1H9KA 2B2TA 4MNOA 2K5QA 1EU3A 4GKKL 2ZXPA 1ZEQX 1G2TA 1VQHA 5BR8L 4HMJA 2ALYB 2R7ZG 1RHPA 1HZCA 1LV9A 3MAQA 1M1KC 2CQOA 2BE5D 4DAYA 1C9OA 1E22A 2IX0A 2MO0A 3D4WA 5IGEA 5I2YA 1GVPA 1H9JA 5CV8A 1VQ8A 1JB7A 2K4KA 2NN6G 1CHQD 4UY8C 3H6MA 2PZWA 4KHVA 2KBNA 4EQPA 3MZ5A 5C4XB 1I50B 1A3TA 1EWCA 3I56A 1A2TA 3EIVA 4LFCL 2Z9HA 1I4RA 4A93H 4C3IH 3HOVB 1F77A 4GOPB 1CUKA 3HRZC 2VS1A 2Z6KC 3CAMA 4DV4L 1SYDA 3GD7A 4K14A 4A3JG 4B3TL 3GTKH 2DGYA 2KCMA 1CKNA 1C4QA 2FMMA 2XWJB 1QNUA 2HCIA 3M4OB 3HOZB 3PIO3 2B8FA 1YVCA 4JI3Q 5M3FG 1LTRD 2A74C 3B6YA 1KAWA 2ES2A 4LF7L 4G57A 3CCSA 1XTCD 5M3FB 2PQAB 4B3SL 1Y1VH 1EUJA 1IBML 1ASYA 3HOXB 4PMWA 2Q8IB 5A2QE 4CGYB 4DK0A 4LF7Q 3RN2A 3H0GB 1CA6A 3CC2A 3SEBA 1UE6A 5FK9C 1Q86C 3S2HH 1BUVT 2YU9H 1VQAA 1I94Q 3H0GH 3NEMA 5JJKA 2RSNA 1D8LA 2IWHA 2YYZA 4OX9L 5EJWA 1LTTD 4POFA 1JORA 3QO2A 3NENA 4DV2Q 4M1UB 2EXDA 4OIJA 4GN4B 4QIWE 4A3LH 1KLUD 4C1NI 1YNJD 5JEAG 2CQAA 2X69A 3M4OH 1HR0L 1S72A 3SHLA 2Y0SG 1B7YB 3BYYB 2K05A 4GNXB 1PRTB 1DM0B 3PO2G 1PRTD 1RTNA 3H0GG 4IN3A 2L55A 4NXML 1R9TB 3HOUG 3E9IA 2CW0C 3R93A 2RDGA 1Q3LA 5FO8B 2SNMA 1NR2A 4O1NA 5ISRA 4BA1I 1JMCA 2ENBA 5IY0A 2B2YC 3PO3H 2R93G 1VQFA 1LT6D 3OHXC 4ME5A 1HZBA 4AH6A 1N9WA 4DV6Q 4XQNA 1LTGD 2DY8A 4A4IA 1K28A 5CC4A 4XDXA 2NN6H 5C4HA 1IL8A 4BS9A 2XWBB 3K7UC 2K52A 1WTPA 1XMOL 3HG9A 1TT2A 4GNXC 2VXWA 1WTRA 4B3RL 3AFQA 3OMCA 3VYSA 4WRDA 2IHEA 2BA1A 4GLVB 1H9SA 3BZCA 4AQYQ 1NY4A 1PRTF 5A2QL 5M5XH 3S1MB 1V1OA 1GJXA 3S1QB 3CCUA 2L1BA 5H1SE 5C0XH 2E8GA 5JOBA 3PIOA 2KA7A 1ICWA 1Z47A 1QZGA 2Y0SB 4GN5A 5FKAC 4JI5L 1JB3A 2R7ZH 1Q8IA 2QDBA 5TSSA 3JAME 1WTHA 3F2DA 5IP7H 1K83H 1X54A 4RCOA 2IJ0A 4NMZA 3I55A 4GKJL 5M5YB 1K9MC 5CV7A 5DEHA 5EBDA 2TSSA 4R4TA 1F9SA 4KI0A 1N32L 2ZJPA 2YV5A 2O5IC 1BCPF 4LF9L 4A3MH 3BDLA 2LXKA 1DGSA 3NK9A 3CP0A 4IOAA 3LGJA 2SDFA 3FP9A 1MIUA 5GADC 4A3FB 2AHOB 5KRUA 2CVRA 2J4XA 3PO2H 2F52A 2H4OA 2PW5A 1CK1A 3S15B 2VQEQ 1KLGD 4OEMB 1GUNA 4KJOA 2IY5B 3A54A 4IPCA 3LX0A 4NW2A 2NWGA 4B9XA 1GOZA 4FYDA 3SVMA 3NE5B 2F4VQ 2JA5B 2JP1A 1XJVA 4C3JB 3HOYB 3HKSA 1SYGA 4A3EG 3U9SA 3VR2A 5IGGA 5KNCA 4QUFA 2KQ3A 2OT2A 3E6ZX 4ZLTF 1K83B 4DV7Q 5D3DA 1BBXC 2NZOA 3G4SA 2KENA 1IBKL 1IHZA 3CCRA 2DN8A 1QILA 2K5NA 2F0EA 3N52A 3H15A 3TS0A 5IT9c 4UP9A 4IURA 5GROA 1Q82C 3TP8A 5EBCA 3TEHB 4RG1A 2PW7A 1S5BD 1HUMA 4X3TA 2Z4HA 1PFMA 2B2YA 5HURA 1IKMA 3PUZA 1TWHB 1Q8KA 1HA6A 1VQNA 2JA5H 4XT3B 3DMUA 3PF4A 4JI1L 1E3PA 1QB5D 3D31A 4LAAA 1Q1BA 1X65A 1C48A 4ZAIA 4CKEA 5JJLA 1PYWD 4A3KB 3I4NH 2XN9C 3TP5A 1DOLA 4P73A 4A3DH 1S4ZA 4O0AA 4L63B 3GTJB 5DM73 3FMCA 1C8CA 1HNXL 2A1AA 1A62A 2EVBA 3HKZB 1V1PB 4JW0A 4JV5Q 5EKKA 1WJJA 3SE0A 1LUZA 4OGQC 4A3MB 1YHBA 1RDPD 4IJLA 1CT1D 3TN2A 3A8KE 1PV4A 4IPDA 2UUCQ 1DOMA 1JOQA 1VQJA 4ODGA 1MI2A 3I2ZA 5FLXE 3J80L 5JEAJ 3T51B 2JA9A 2I5LX 1MBYA 5KEEA 4QJFA 1SNMA 1SBBB 4JI6Q 1KDBA 3KF6A 1EY7A 4JBJA 2A5HA 5M5WB 5IP7G 1NUCA 2NVTB 4IPHA 2QF7A 4A3KH 5ELBA 2AQ1B 3PUYA 2OQKA 4K0KQ 1XMOQ 1FD7D 4L8JA 2PMZB 3MFGA 4KY7A 3EQLC 3W1GA 1BR9A 1VQDA 4EQOA 4F87A 4DR3L 1II3A 2XVSA 5CV4A 4GLXA 3S15H 2CWAA 4MTKA 1VQEA 3KLSA 3JAMi 4LJZC 3HKZG 5E4WC 1OTCA 3BG3A 4JOIA 1S3OA 5KYLA 4OONA 1XPUA 2ICEC 1UAPA 3GTKB 2NVXH 1G2SA 4K5XA 3FHWA 3CD6A 1GO3E 1Y14B 3M85A 3GTMB 2GVBA 3E9HA 4PZ6A 2E2IB 4UDUC 1QUQA 1EY6A 1SLJA 3VYRA 1MHWC 5FJ8G 3E5SA 2R7FA 1U4MA 5C3WA 3VA7A 1TS4A 3PO3B 4J8QA 5EPLA 3AB9A 4ID6A 5CYUA 3JC66 5I9OA 3S14H 4AYBE 4ULLA 2RHQB 1HQRD 3BVGA 3Q0AA 4BBSG 2D2CC 1ESFA 1JJGA 2KVMA 4JI1Q 4J15A 2PI2A 5IYCH 3KLRA 4A3JB 4A3FH 3PO2B 5CORA 1PFSA 3I4NG 1IBLL 3A7AB 3BZKA 3P20A 3OTOQ 3SR1A 1N34Q 1ONLA 2N88A 2CKZB 2F0FA 4R4QA 3CQZH 2UXBL 2H5XA 2RA4A 4CDFC 3R2TA 4IO9A 4ABNA 4N8FA 3I4OA 4IUTA 1JICA 3AEVA 1I50H 5E4XA 3W1BA 1EY4A 1AN8A 3U4VA 4ZCKA 1IBMQ 3MC0B 3IRBA 1X55A 3GDEA 1E2VA 2K5WA 3BU2A 1EYGA 3ZYYX 4LF8Q 1SYFA 4FP5D 5JVG3 2N49A 5DAUA 1QJOA 1V8QA 1XNRQ 1AFPA 4B3ML 2E5LL 3C3LA 1JE4A 2MPMA 1HJPA 1TWAH 1A63A 2A6EC 3F2CA 1SEBD 1CI3M 1AZQA 2F0OA 1F2LA 1TS3A 1AZPA 1A15A 1XMQQ 3CQZB 1B4OA 1QVCA 1YZ6A 1TVXA 1PVOA 2I07B 4JC0A 3DEOA 4ZRZA 1STEA 1UUPA 4H13C 5I4DA 1VF5C 1U5KA 5G3LF 2GA4B 2EYLA 2OXPA 1STHA 4A3BG 4QQBX 4X65L 4TRDA 4R8IA 3PIP3 4IFDG 3I72A 4OIKA 2B2UA 3J80i 4JV5L 2Q8TA 2M2LA 3G7LA 2QA4A 3D3RA 3M4YA 2LXJA 3S14B 3CRKC 1K73C 3FDTA 4C3HG 4B3MQ 2K7VA 3OW2A 3CRLC 2MJ8A 3T16A 2CH4A 1DZ1A 1R9TH 5EKIA 2YU9B 2ID0A 1HCZA 1HFGA 3PV0A 3CCQA 4JI2Q 4X6AH 2ZTDA 3MXNB 4HJ7A 1EOTA 1FYCA 4L6TB 1IYUA 2B2VC 1VDZA 4IJHA 5IGDA 2IX1A 2QDLA 4P75A 3VR3A 2WB1B 3UE1A 1PH8A 2EYPA 3PGZA 3AQQA 4DUYL 5M3FH 2FJ2A 4OX9Q 5CV9A 2PYKA 2LSSA 3CU7A 4CJ0B 1KXLA 4X65Q 1SE4A 5AJ3L 2KJXA 3LWUA 2F0TA 5I9PA 4C3HH 4LW1A 4DV6L 4FXDA 5NUCA 1BBWA 1ET6A 1DONA 1ESRA 4FF1A 2MHVA 3W5OA 1EOVA 3QOLA 5BN3A 4O42A 2HDMA 1Z6HA 4Q0FA 3K5MA 4FDBA 2F0SA 4DKAC 3Q24A 1SE2A 1W3SA 2F4IA 4DFAA 2NN6I 2GVAA 4DNTB 3VDYA 1WTOA 1LLRD 4YIJA 1VQ9A 2SOBA 3FKIG 3FRPB 3HOWB 1EWHA 3RLNA 3LNNA 4JBWA 5IODA 4KV6A 3S2DB 1DD2A 3PUVA 4LF9Q 3NSWA 4R9WA 4RWSC 4DAPA 4DR1L 1UE7A 4QL5A 4QCLA 2EY2A 1FVIA 3H3VH 2L0CA 4DAYB 3MWYW 4DR3Q 2F0IA 2X6LA 2KEEA 3G71A 4A93B 3UDXA 1FR3A 3S2DH 4DK6C 4BY1H 2BE5C 1LO5D 4JI0L 1SFOH 1TWHH 3TZUA 1IW7C 4GN3B 2KHSA 3TDQA 3OTOL 4DUZQ 3H3VC 5LMUQ 2RSOA 2PCFB 1FGBD 5ELDA 1EQTA 2WFWA 2Z1CA 4GS3A 3VA5A 4H7BA 3QIAA 4GZYC 1GUSA 1X3FA 1S5DD 3NQTA 4AQYL 1WD1A 3J80E 2CH4W 3AYHB 3P75A 1XMQL 2V1CC 4NP5A 2B63G 1S5FD 3SK6A 1T5XD 4HIKA 5FLMH 2BDOA 2XNAC 2VW9A 3WWVA 1N33L 3H3VI 2OTLA 4KD3A 1EFID 2EDGA 4KY5A 4R4CA 2OTJA 2NVQB 5J1ZA 1ICFB 3CKIB 3QR8A 5E7NA 1YEZA 4S3SA 1YBYA 2QCPX 4YCUA 2RBMA 4LF4L 2IHFA 2EYOA 3ITPA 2EE1A 4A3JH 1F9PA 3SK5A 2HIXA 1H9MA 3CHBD 4U68A 4JYAQ 2B29A 2VQEL 2ZJRA 1ET9A 2F0KA 4NKLA 2F0MA 5IGFA 1SJED 2EIFA 1I5FA 5LMNW 3FKIH 4C56C 2L4NA 1F9RA 3HOWG 2CFMA 3L3OC 4DV1L 1V9PA 1CSQA 3MA2B 3CF5A 2I5HA 3NTHA 1WI5A 5C6AA 3GTMH 1D6EC 2RF4A 1O7LA 1I4HA 4BA2I 2OQ0A 2NVXB 3GTPB 4DV1Q 1UNSA 2WACA 4P71A 1GHJA 2EJFC 2KECA 2UXDL 5FO9B 4DN4M 1S40A 4BBSB 3K0XA 4A3DG 3KYHC 1X3EA 1IBLQ 1PRTC 1L1OC 1VS0A 1JR0D 3IFTA 4LFCQ 4BBRB 1YNNC 3RLFA 5ELOA 4DR5L 1VMPA 4K5VA 1PFNA 4OL7A 2UU9L 3GQBA 5IOCA 1RKNA 5M5WH 1MSHA 1U4PA 3FPPA 3TQYA 4JBKA 3CCJA 2B63H 4GKJQ 3J7AV 3I73A 1G8ZD 1EQRA 2O2LD 1SROA 3E0EA 3NTIA 2BH8A 2NBFA 4TVAB 4C2MB 4A3IG 4DR7L 1FNVA 2JA5G 5M5YH 1PZJD 1EIGA 3PSIA 3E0JA 1CQVA 2F0DA 2A6ED 2VZAA 2A69C 2RHSB 2ZT9C 4FO2A 3J81c 3GTJH 1ILQA 1EZ6A 4A3DB 1CM9A 5JPNC 4BY7G 3J81L 2JEAI 3BS1A 3VYUA 4Y52H 4JCVE 1I4QA 4JI8L 4XTCS 1QCBD 3J80c 2QGQA 2WKCA 3A74A 4DK1A 4EVOA 1BKBA 2HT1A 4HJ9A 3GTOB 1D1IA 4K0KL 2C35B 3NBHB 2PQAA 3Q6SA 1TWGH 5GAEC 3UDGA 4BY1G 2UXCL 2HCCA 3CXCA 2R3ZA 2D0OA 5LL6S 1X9NA 1TY2A 5EAYA 4MIUA 4XIGS 1GD7A 1LTLA 2QEJC 3F1ZA 1QZHA 3EROA 3CCVA 4MHEA 4QIWB 2LY7A 1SMYD 2DNEA 1NBWA 2E2IH 2ZM6Q 3OWFA 5IGBA 1U4LA 5D3IB 1N32Q 1UE5A 5IYDG 2R7ZB 5J22A 4JOIC 1B9MA 3M9BA 3PQIA 1L1OB 1D5MC 2SEBD 5IYBG 3RN5A 3G6JB 5K36H 1PH7A 4HCEA 3A0JA 4NXMQ 3AFPA 3S1MH 5I6WA 2JA7G 2Z4IA 1I6VC 4YWLA 2XTIA 3A56A 4N9PA 1U0LA 2Z0SA 3ER0A 2PZTA 1X3GA 4LF8L 5C4JH 4BY1B 4JI6L 3PUWA 1MJCA 4TKOB 3G48A 2M00A 1JJCB 1D2BA 1YNND 2PI2E 1PH4A 1Q12A 1BCPD 2PNRC 1IKLA 4A3GB 4WJWA 4JI0Q 5GQOA 4OXPA 3A7LA 4LF6Q 1T5EA 2B3GA 4JI7L 1N34L 5HGTA 2NB0A 1L2FA 2WP8J 1NTGA 2MO1A 2AQ3B 3OIQA 4C3JG 1Y8PB 4RHSA 4DU9A 5C4XH 1HRJA 4OWXB 3M7GA 1I6HB 3KF8A 3J7A5 1NMFA 3M3YB 1LACA 1SNOA 5IP9H 2Q2HA 2ZTCA 2CHBD 4DR5Q 4ZK9B 1MD2D 1EEFD 3E3XA 2B2TC 4DV0Q 1OXTA 1H95A 2F0UA 3KOJA 4PMBA 4G7HC 1F2MA 3MXUA 1KRTA 3KDFA 4LUOA 5FJ8H 1JJ2A 1KIXA 1FNUA 3T1YL 5GAGC 2OWOA 2EYJA 4CHTB 4YY3Q 1I4XA 2QILA 4DUYQ 3MTSA 4R1JA 2KCNA 4LF4Q 3U9OA 1HFNA 1VQCA 2XSCA 2HQLA 2JA7B 1HTPA 4RGMA 2UUBL 3T1HL 3S24A 1SR3A 3R8BA 5JJIA 2MFIA 3GP7A 3K5NA 3H91A 4F88A 2ASBA 1VQ5A 4LFAL 5LHY1 1V1PA 2CCZA 2UUAQ 4DUZL 2L15A 1XX8A 5M3MG 1SE8A 1PTOD 4A75A 1B2TA 4QUCA 4DV5Q 4B3SQ 4JK1C 1PH5A 4JI8Q 4LF5L 1JCKB 1PYSB 3J81i 2ZXOA 4DV3Q 2QKIC 2K50A 2EYFA 1J8IA 5EPKA 1BVSA 2ZM6L 4QY7A 1Y1VG 1SMXA 3DHQA 3TP7A 3FPUB 4KLKA 1FGUA 3QB3A 3TP6A 4DNRB 1Z9FA 4BY7H 4B08A 3S1QH 4HEDA 4DR2L 4DR6L 3C2PA 3P1HA 4HSVA 3M7NA 3STBC 3ONAB 4DXFA 1X32A 3HKZE 3M4QA 2B2WC 1JE5A 2HUGA 3SK4A 4ILWA 3NHHA 2LMCB 3HP3A 3I70A 2RCFA 3RNUA 4DPGA 1LABA 3DUZA 1HR0Q 2EY5A 3STBD 1PYBA 2H1EA 3C46A 1ENAA 5ELEA 4DV5L 5E1FA 1XPRA 4HMIA 3EA6A 1RL2A 3PMFA 5ELCA 1ZXTA 5G3LD 1SYCA 5D14A 1K8AC 3HGBA 1VQKA 4K6DA 2CWPA 1DJRD 5IYCG 3A5ZB 3G6EA 1SAPA 1GHKA 2YTVA 3A5UA 2NTTA 2VQFL 1I94L 2AKWB 3MEHA 4GOPA 4X3UA 4A3IH 2IPKD 5C0XI 4R4OA 1N33Q 1HTLD 3S16H 1M8AA 2BH2A 1SNCA 1PTOC 3GTLB 3IL8A 2Q8RE 2OEOA 4JI2L 3I4MB 5CBEE 4DR4L 2WV6D 1Q46A 3K8AA 1SE3A 1XNQL 1J9OA 5EGTA 1TWFB 1SNQA 4A93G 4I7ZC 1I3QH 4YHHL 2OCEA 3DWPA 1PH3A 2Q2TA 2R92H 3RD4A 3J7ZC 2FHTA 4DR4Q 3H94A 4KJNA 3SGIA 4IQZA 4L5RC 1JT8A 1U9RA 5T1IA 3JAMc 2JA8G 3OWEB 3HOXG 1OO9B 2PNHA 3HOWH 3BVZA 4P74A 3RZOB 2UXDQ 1XNRL 1UEBA 5JVH3 1A6XA 5ELFA 3L7ZC 1HZAA 1F2YA 4FVMA 3KJPA 4EX5A 4DR1Q 1BNZA 1HHVA 3AU7A 1HUNA 5FOBB 1DXMA 1EY8A 2RKSA 1L0XB 2K01A 1LTAD 1ILPA 4LK1C 3JAML 3DM1A 3MEFA 1RD9D 4BWGB 3OOCA 1WFQA 1VCIA 2MUYA 3C1FA 1B1ZA 3KF8B 5C3EH 3KF6B 1GKHA 2E74C 2MP1A 4B3TQ 1EYDA 1B53A 2KHIA 1L0WA 3OYYA 3CMAA 3RZDH 1A0IA 1SYEA 2F0QA 4DR2Q 4AIMA 4ZUJA 1KDAA 2JSOA 3KLWA 1YJWA 1LM0A 2K04A 3Q8DA 1IYVA 4X66Q 3HOVH 1GM5A 3GTQH 2UXBQ 2L11A 4WJ3M 1AE2A 4E6IA 1G6PA 3K80C 1CKOA 1YNJC 2Z6KA 2R93B 4HAEA 1CHPD 1BF4A 5A35A 2M9VA 4KY6A 2PMZE 4KN4C 4XQJA 4B9WA 3CCLA 2F0VA 1PHJA 2EQSA 4XYQA 4WJ4A 2PZUA 2RVLA 3NBIA 2VUMB 3QWNA 4KN7C 3HS0C 4ZKCB 2F0JA 3I4NB 3TS2A 4A3BB 3LWEA 4CBVA 5JPMC 2WINB 2XIWA 2QEXA 1N8RC 4CJ2C 3EN2A 1K0RA 1OXUA 5CV6A 3I8ZA 5FLMG 4C3IB 3H09A 4IUUA 2E5LQ 2KOLA 3BDOA 3NPPA 4N8X1 2NTSA 2A68C 5EPJA 3U58A 1UWVA 2AUJD 4X3SA 1SJHD 3K57A 1HNWL 4IUVA 2J7ZA 3EJIA 3P7JA 2JA7H 2UUAL 1D7QA 3OIPA 2I46A 1TS2A 5JEAH 4XYOA 4PNYA 4DK3C 2SNSA 3K5OA 3HOUB 1QOHA 2WAQG 3RUZA 1EIYB 2V4DA 4K5WA 4P2CB 2JA8B 1L1OA 2Q2UA 4RA8A 2WKDA 1STGA 5C44G 1PH6A 1DCZA 3HZXA 4O2DA 2D0PA 1WVLA 1XTDA 1A8VA 4OO1I 5C0XG 2VL6A 3J7AF 4FF3A 3T4AC 3OMGA 1QE6A 4TSSA 3GTPH 3I4MG 1AEXA 1KNAA 2JA8H 3VYTA 3IFDA 1WYDA 3ULJA 4FF2A 4EQNA 1AH9A 4J6HA 3NELA 4IUQA 2FFKB 3HOZG 3Q23A 1D5XC 5FLXL 4BXXH 1B3AA 1D5ZC 1BOSA 5KGUA 5DM63 3K58A 4CKCA 1K0SA 5J3BA 3Q22A 3GTQB 3S1NB 4I65A 3D4RA 3GV6A 3I90A 4HJ5A 2F3VA 3CC4A 2ATWA 2I5MX 4MTNA 2WB1E 4RH6A 3DLLA 1CZGA 4CDDC 1SMYC 3D8GA 3O13A 4OO1H 2D62A 3AMUA 3PCOB 2WAQE 4BBRG 4UP8A 5IP9G 2E2JH 1IXRA 1PMRA 4HTHA 1EY9A 2NVYB 4A3CH 3A8IE 1HR0W 4QF4A 2P5ZX 3ND8A 4KKSA 2F03A 2ZJQA 4LFBL 2R93H 4KD4A 1FJGQ 5C5MA 5LMNQ 1T9HA 2B8GA 4CDCC 1Q1EA 1C0AA 5AFWA 5M5XB 2F0LA 3GTGH 2PQEA 2E2JB 2UXCQ 5K36G 4X62Q 1KL9A 5I6YA 1TU2B 1STBA 4DAMA 3X3MA 4OO1G 2F0GA 1E24A 3HOUH 1LYLA 4KTAA 5IWAQ 4TQUS 5JAVA 2N55A 1WD0A 3BVMA 2MGSA 1KD1C 2LKVA 1ENCA 1S5CD 1ASZA 2R92B 2JQOA 5CGKA 3SDZA 1E2WA 1EU4A 1KQSA 5IYDH 1EY0A 2C9OA 2JEBI 1TQOA 4RAUC 2FINB 4A3EB 2VUMH 1Y8OB 4K6LA 2JYOA 1EL0A 1RIPA 1XYIA 1QVGA 2A8VA 2K33A 4EGVA 3A55A 4WORA 4POGA 4H0LC 1B70B 1WOCA 3S1RB 4A3FG 1ZYRD 1PZID 2A69D 4U673 3ND9A 2FXQA 4MZ9A 1TWCB 4EQ5A 1QG7A 3MFYA 3D6CA 2K5VA 1B44D 1PZKD 3KLSX 3TSSA 3V2TA 5T1GA 4X64Q 2JA6H 4JYAL 3T1YQ 5EKLA 2NYZD 1E1TA 3HOYG 1TWFH 1SNDA 4DA2A 3NTKA 2Z8LA 3CCEA 1AW7A 4AYBG 1HA5A 1O80A 2IT1A 3RZDB 1DOKA 1VQ4A 3OSOA 4JI4L 1SNPA 3NWTA 5E3FA 4NDXA 1GXDC 1HXYD 4C3IG 2K03A 3BJUA 3EFXD 2B39A 3GTGB 1HNWQ 3PIPA 2YTYA 2G9DA 1JQYD 3KUPA 4J1MA 2E2DC 4F7XA 3ULLA 1J6QA 1NMGA 4ZUIA 5C3XA 2A68D 2R7DA 3D0FA 3F2UA 1E2ZA 4Y7NH 4Q5VA 1CKNB 4C3JH 4JPBW 1Y69U 2JE6I 2NVYH 3NXWA 3IAYA 2KUMA 1RTOA 3C1EA 1NJIC 2RDFA 3U4ZA 2EYHA 3L9AX 4FNFA 3FKIB 3HOZH 4DXGA 1HQMC 4ZQ3A 4QMGA 1HH2P 2HQEA 4OHJA 2Y0SE 1CSPA 1P16A 3FEWX 1VQMA 4LF5Q 4DNIA 1GUWA 1HZ9A 2JXMB 1GUOA 1BBUA 1JOOA 3OW7A 4ZYSA 4CJ1B 2BOSA 4JI5Q 2R6GA 4IFDJ 1JWMD 1PDQA 2Q2IA 5DLQE 1WTWA 1KHIA 4YHHQ 3S17H 1CZWA 2J0TD 1PTOF 2BA0A 2KEDA 5CMDA 2JK8A 3KDFB 5IYBH 1Z7TA 1X3QA 4L5QA 4GNXA 2CW0D 3KBGA 4RCNA 1JC7A 2EJGC 4A76A 4KHPQ 2O5JC 3D6WA 2F0NA 4CKBA 4DR6Q 3UE0A 5KYIA 1PA6A 3T13A 1FL0A 1K8MA 5LMNL 4APVA 1BO0A 2MQHA 1O7YA 2O4XA 3QJYA 4DF7A 2F1MA 2K1BA 5M9OA 1F9QA 1P8LA 2L5TA 1X3PA 2ZTEA 2NZHA 1VQLA 1QUQB 2UUBQ 3CC7A 3N6RA 1PTOH 1PLFA 4PMCA 3U50C 1QVFA 1WCMH 2L9HA 2TMPA 1RCVD 3VR6A 1IW7D 2R61A 3MXNA 5IWAL 3K59A 3S1RH 1M90C 2K75A 5C3EG 4G7ZC 3HEJA 4YCWA 2EZVA 2F3WA 4YCVA 1PFBA 2JA6G 1OXVA 1KRSA 2L12A 1M4VA 4YWMA 4NXNQ 1BXTA 4IUNA 1CA5A 4A3IB 4X66L 3X3NA 3D4DA 4A3EH 2D5DA 2E76C 2RDHA 1Y1WB 1GUTA 1VQ6A 1N36L 1SDFA 1KDCA 2K32A 1WCMB 4JI4Q 4IOCA 4PQXA 4RGTA 1G6ZA 5LMUL 3A8JE 4L5TA 1OXSC 1LTBD 3I91A 2IL8A 1O7ZA 3T1HQ 1W6JA 5CV5A 4GKKQ 3KFUA 1I3QB 5IIFA 1KNEA 2AWOA 3CCMA 2A6HD 4RHRA 4H02A 1U4RA 1YHAA 1HNZL 4GLAC 3K7AH 4C3HB 4Z9CB 4AYBB 3T56B 4HIDA 2KHJA 5C4JB 5CBAE 4FXKC 4RGNA 4R4IA 3I7FA 2VB3X 4XQQA 3K81C 1YHQA 2C5CA 1A3UA 1PH9A 1EQQA 3WDNA 1JWUD 3DWAA 4M8AA 3NBHA 4N9TA 1NSNS 4OELB 1PXUA 1STYA 5M3MH 4G4KA 2I0QA 4DGZA 3MVVA 3R2IA 1MSGA 3HOXH 2NVTH 5C44B 2VUMG 1O78A 5IE8A 1Y1VB 1EYCA 1UEAB 1UE1A 5BN5A 3J7YW 2VQFQ 1QNKA 1J5EQ 4A3MG 3DWQA 3K7AB 1K8OA 1ZYRC 4G7OC 4LUZA 1WTXA 4X3KA 3J81j 3RMHA 1J5EL 2RQXA 1EYAA 1O7IA 3MXPA 4OWWB 2AUKA 3GTOH 1LTSD 2KCTA 3I4LA 1A2UA 4B3RQ 4DAVA 1SSOA 4BY7B 1X6OA 3CPFA 1KC8C 5J39A 1XWEA 3NWSA 2VNUD 3HFZB 1QWYA 4LMQD 2F0HA 3V05A 4ME3A 1PH1A 1SYBA 3R3OA 4KK7A 1G291 2F3IA 4HN7A 4R8NA 3S9WA 3DXJC 1KTKA 1MKHA 2AQ2B 4DV4Q 2Z6BA 1E0BA 5KIXA 4A3CG 1TWAB 4RMFA 2E2HB 4IZ8A 4IUPA 4LFAQ 3NQIA 2F4VL 4V190 1PH2A 3KK7A 3F8TA 2EPBA 4KKUA 5C4ZA 1E1OA 1EIFA 4UHVA 4DV3L 3S17B 3K5LA 3KJOA 1XXGA 2RCNA 3M3YH 2MNAA 3SXHA 1TY0A 1I6HH 4K2LA 2GN5A 1TKWB 4X62L 1VQ7A 1IBKQ 1EY5A 3RR5A 3PO3G 2A19A 2EOTA 2FMCA 1WTVA 1RF2D 3FVQA 4HJ8A 3ULPA 1ML0D 1YIJA 5FO7B 5GAHC 3NUCA 3NP8A 2HHHL 2UU9Q 1JOKA 1E7ZA 1TS5A 3W3AA 4A3LG 4BXXG 4NXNL 1GUGA 3J81E 1TWCH 2PPBC 4OWTB 2BCOA 4JI7Q 4DV2L 4QGUA 4KKTA 1VQIA 1S5ED 1B50A 1A3VA 3EBEA 5IGCA 1NR4A 1RODA 1AP0A 2HDLA 3GO5A 1YJ9A 4PZ7A 1ENFA 4IALA 1R4PB 4NPSA 4ALPA 2B2WA 2EYMA
chains in the Genus database with same CATH topology
2F0WA 1BCPC 2IX3A 1F2ZA 2ICIA 4Y7NB 2LFNA 5I2XA 1STNA 3TZDA 1LT3D 3K6OA 3I3CA 1JWSD 3WOEA 1CFMA 2VB2X 1VMCA 1HPCA 1KABA 1EQVA 1Y8NB 1BDOA 1MGSA 2DY7A 1Q90A 1EEID 3PUXA 4V0BA 3UI2A 1I4GA 1NAPA 1BQQT 1TWGB 4RFBA 2JA6B 4K2KA 1H9RA 2XRQD 5JJZA 1CTMA 3DEPA 2ZXRA 2PO4A 4KMUC 1H9SB 3K0YA 1R4QB 3BZDB 4RGOS 4C1NK 4QB4A 1G91A 2KCCA 3MXGA 4FXGC 2E75C 5D65A 2EY1A 1LT4D 1LTID 4H44C 3T53B 1D1KA 4K8IA 2NUCA 1SFOB 4ZKBB 4MN3A 1FNWA 2B2UC 3URYA 4IFDH 1BCPB 5DNFA 1EZ8A 1SXTA 5F2DA 3W2DA 2K28A 5KNBA 4WFN3 5COYA 3BDCA 3GV3A 2X6GA 1I4PA 1VF7A 2A73B 5CR3A 1OXXK 2AWNA 1B9NA 1STAA 4KHZA 4UAIA 3WOFA 2K5DA 1CQFA 5BN4A 2B63B 5M3MB 3S2HB 1RJTA 2B2VA 3VR5A 5C5LA 2OF1A 2BDNA 3QG1A 3ERQA 2WIIB 4HSPA 2XRSD 3IKJA 2EXZA 4XXEA 5EQ0A 4RKBA 5K5PA 4F8MA 5C3EB 2G9HD 1LT5D 1L0YB 2K6AA 4XT1B 2LS01 3KBXA 2D9UA 5IT9E 3QOJA 5IT9L 1TIID 1KAAA 2IW3A 2NZ1D 4K8JA 4RKLA 2DNCA 5KNDA 3VR4A 3S16B 3BYTB 2EJMA 1ZKOA 1EIHA 1DYQA 2A6HC 3MHBA 3V96A 3TMEA 4FF4A 4PV1C 1PTOB 1V43A 3OPOA 2EY6A 1WTQA 1W6KA 4HCSA 2WAQB 4HR7B 3EVQA 3SK8A 5C0XJ 4IFDI 1TR5A 5LL6X 2F0PA 1NCVA 3TBIB 1H9KA 2B2TA 2K5QA 1EU3A 2ZXPA 1ZEQX 1G2TA 4HMJA 1RHPA 1LV9A 3MAQA 2BE5D 4DAYA 2IX0A 3D4WA 5IGEA 5I2YA 5CV8A 1H9JA 2NN6G 1CHQD 3H6MA 2PZWA 4KHVA 4EQPA 3MZ5A 5C4XB 1I50B 1A3TA 1EWCA 1A2TA 1I4RA 3HOVB 1F77A 3HRZC 1SYDA 3GD7A 4K14A 1C4QA 2FMMA 2XWJB 1QNUA 2HCIA 3M4OB 3HOZB 3PIO3 2B8FA 1LTRD 2A74C 4G57A 1XTCD 5M3FB 3HOXB 4PMWA 2Q8IB 5A2QE 4CGYB 4DK0A 3H0GB 1CA6A 3SEBA 5FK9C 1BUVT 2RSNA 2IWHA 2YYZA 5EJWA 1LTTD 1JORA 3QO2A 4M1UB 4OIJA 1KLUD 4C1NI 1YNJD 5JEAG 2CQAA 2X69A 3SHLA 3BYYB 2K05A 1PRTB 1DM0B 1PRTD 1RTNA 4IN3A 2L55A 1R9TB 2CW0C 3R93A 2RDGA 1Q3LA 5FO8B 2SNMA 1NR2A 4O1NA 5ISRA 4BA1I 2ENBA 2B2YC 1LT6D 3OHXC 4ME5A 4XQNA 1LTGD 2DY8A 5CC4A 4XDXA 2NN6H 5C4HA 1IL8A 4BS9A 2XWBB 1WTPA 3HG9A 1TT2A 1WTRA 2VXWA 3OMCA 3VYSA 4WRDA 2BA1A 1H9SA 1PRTF 5A2QL 3S1MB 1V1OA 1GJXA 3S1QB 2L1BA 5C0XH 5JOBA 2KA7A 1ICWA 1Z47A 2Y0SB 5FKAC 1JB3A 1Q8IA 2QDBA 5TSSA 3JAME 4RCOA 2IJ0A 4NMZA 5M5YB 5CV7A 5DEHA 5EBDA 2TSSA 1F9SA 4KI0A 2O5IC 1BCPF 3BDLA 3NK9A 2SDFA 4A3FB 5KRUA 2CVRA 2J4XA 2H4OA 2PW5A 3S15B 1CK1A 1KLGD 1GUNA 4KJOA 3A54A 3LX0A 4NW2A 2NWGA 4B9XA 1GOZA 4FYDA 3SVMA 3NE5B 2JA5B 2JP1A 4C3JB 3HOYB 1SYGA 3U9SA 3VR2A 5IGGA 5KNCA 4QUFA 2KQ3A 2OT2A 3E6ZX 4ZLTF 1K83B 5D3DA 1BBXC 1IHZA 2DN8A 1QILA 2F0EA 3N52A 4IURA 3TP8A 5EBCA 2PW7A 1S5BD 1HUMA 4X3TA 2Z4HA 1PFMA 2B2YA 5HURA 1IKMA 3PUZA 1TWHB 1HA6A 4XT3B 3DMUA 1QB5D 3D31A 4LAAA 1Q1BA 1C48A 4ZAIA 4CKEA 1PYWD 4A3KB 2XN9C 3TP5A 1DOLA 1S4ZA 4L63B 3GTJB 5DM73 3FMCA 1C8CA 3HKZB 2EVBA 1V1PB 5EKKA 3SE0A 4OGQC 4A3MB 1RDPD 1CT1D 3TN2A 3A8KE 1JOQA 1DOMA 4ODGA 1MI2A 3J80L 5FLXE 5JEAJ 3T51B 1MBYA 5KEEA 1SNMA 1SBBB 1KDBA 1EY7A 2A5HA 5M5WB 1NUCA 2NVTB 2QF7A 5ELBA 2AQ1B 3PUYA 1FD7D 4L8JA 2PMZB 3MFGA 4KY7A 3EQLC 4F87A 1BR9A 4EQOA 1II3A 2XVSA 5CV4A 3KLSA 4LJZC 5E4WC 3BG3A 5KYLA 2ICEC 1UAPA 3GTKB 1G2SA 4K5XA 3GTMB 3M85A 2E2IB 4UDUC 1EY6A 3VYRA 3E5SA 1U4MA 5C3WA 3VA7A 1TS4A 3PO3B 4J8QA 5EPLA 3AB9A 4ID6A 5CYUA 5I9OA 4ULLA 1HQRD 3BVGA 3Q0AA 2D2CC 1ESFA 2KVMA 3KLRA 4A3JB 3PO2B 5CORA 3A7AB 3P20A 3SR1A 1ONLA 2N88A 2F0FA 2RA4A 3R2TA 4ABNA 4IUTA 1JICA 5E4XA 1EY4A 1AN8A 3MC0B 1E2VA 2K5WA 3ZYYX 1SYFA 4FP5D 5JVG3 5DAUA 1QJOA 1V8QA 1AFPA 3C3LA 1JE4A 2MPMA 2A6EC 1SEBD 1CI3M 1AZQA 2F0OA 1F2LA 1TS3A 1AZPA 1A15A 3CQZB 1B4OA 1TVXA 2I07B 3DEOA 4ZRZA 1STEA 1UUPA 4H13C 5I4DA 1VF5C 5G3LF 2GA4B 2EYLA 2OXPA 1STHA 4TRDA 3PIP3 4R8IA 4IFDG 3I72A 4OIKA 2B2UA 2Q8TA 2M2LA 3G7LA 3D3RA 3M4YA 3S14B 3CRKC 3FDTA 4C3HG 2K7VA 3CRLC 2MJ8A 3T16A 1DZ1A 5EKIA 2YU9B 2ID0A 1HCZA 1HFGA 3PV0A 1EOTA 1FYCA 4L6TB 1IYUA 2B2VC 1VDZA 5IGDA 2IX1A 3VR3A 2WB1B 2EYPA 2FJ2A 5CV9A 2PYKA 3CU7A 4CJ0B 1SE4A 2KJXA 3LWUA 2F0TA 5I9PA 4FXDA 5NUCA 1ET6A 1DONA 1ESRA 4FF1A 2MHVA 3QOLA 5BN3A 4O42A 2HDMA 1Z6HA 4Q0FA 3K5MA 2F0SA 3Q24A 1SE2A 2F4IA 4DFAA 2NN6I 4DNTB 1WTOA 1LLRD 4YIJA 2SOBA 3FRPB 3HOWB 1EWHA 3LNNA 4JBWA 5IODA 4KV6A 3S2DB 1DD2A 3PUVA 3NSWA 4R9WA 4RWSC 4DAPA 4QCLA 2EY2A 2L0CA 3MWYW 2F0IA 2X6LA 2KEEA 4A93B 1FR3A 2BE5C 1LO5D 3TZUA 1IW7C 2KHSA 3TDQA 3H3VC 2RSOA 2PCFB 1FGBD 5ELDA 1EQTA 2Z1CA 3VA5A 4H7BA 3QIAA 4GZYC 1GUSA 1S5DD 3NQTA 1WD1A 3J80E 3P75A 4NP5A 1S5FD 3SK6A 1T5XD 2BDOA 2XNAC 4KD3A 1EFID 2EDGA 4KY5A 2NVQB 5J1ZA 3CKIB 4S3SA 2QCPX 2RBMA 2EYOA 3ITPA 2EE1A 1F9PA 3SK5A 1H9MA 3CHBD 4U68A 1ET9A 2F0KA 4NKLA 2F0MA 5IGFA 1SJED 4C56C 2L4NA 1F9RA 3L3OC 3MA2B 3NTHA 5C6AA 1D6EC 1O7LA 1I4HA 4BA2I 2NVXB 3GTPB 1UNSA 2WACA 1GHJA 2EJFC 2KECA 5FO9B 4DN4M 4BBSB 1PRTC 3IFTA 1JR0D 4BBRB 1YNNC 3RLFA 1VMPA 4K5VA 1PFNA 4OL7A 3GQBA 5IOCA 1RKNA 1MSHA 1U4PA 3FPPA 3J7AV 3I73A 1G8ZD 2O2LD 3NTIA 2NBFA 4C2MB 1FNVA 1PZJD 1EIGA 3E0JA 1CQVA 2F0DA 2A6ED 2A69C 2ZT9C 4FO2A 1ILQA 1EZ6A 4A3DB 1CM9A 5JPNC 3J81L 2JEAI 3BS1A 3VYUA 1I4QA 4XTCS 1QCBD 2WKCA 4DK1A 4EVOA 3GTOB 1D1IA 3Q6SA 2HCCA 2R3ZA 5LL6S 1TY2A 4MIUA 4XIGS 2QEJC 3EROA 4MHEA 4QIWB 2LY7A 1SMYD 2DNEA 3OWFA 5IGBA 1U4LA 5D3IB 2R7ZB 5J22A 1B9MA 1D5MC 2SEBD 3G6JB 5K36H 4HCEA 5I6WA 2Z4IA 1I6VC 3A56A 4N9PA 2PZTA 4BY1B 3PUWA 4TKOB 2M00A 1D2BA 1YNND 1Q12A 1BCPD 2PNRC 1IKLA 4A3GB 4WJWA 3A7LA 1T5EA 5HGTA 2NB0A 2WP8J 2AQ3B 3OIQA 4C3JG 1Y8PB 4RHSA 4DU9A 1HRJA 3M7GA 1I6HB 3KF8A 3M3YB 1LACA 1SNOA 2CHBD 4ZK9B 1MD2D 1EEFD 2B2TC 1OXTA 2F0UA 4PMBA 4G7HC 1F2MA 3MXUA 1FNUA 2EYJA 4CHTB 1I4XA 2QILA 3MTSA 2KCNA 3U9OA 1HFNA 2XSCA 2JA7B 1HTPA 4RGMA 3R8BA 3GP7A 3K5NA 3H91A 4F88A 5LHY1 1V1PA 1XX8A 1PTOD 1B2TA 4QUCA 4JK1C 1JCKB 2ZXOA 2QKIC 2EYFA 1J8IA 5EPKA 3DHQA 3TP7A 3FPUB 3QB3A 3TP6A 4DNRB 4B08A 4HEDA 3C2PA 3P1HA 4HSVA 3M7NA 3ONAB 4DXFA 1X32A 2B2WC 2HUGA 3SK4A 4ILWA 2LMCB 3NHHA 3HP3A 3I70A 1LABA 3DUZA 2EY5A 3C46A 2H1EA 1ENAA 5ELEA 5E1FA 4HMIA 3EA6A 3PMFA 5ELCA 1ZXTA 5G3LD 1SYCA 5D14A 3HGBA 4K6DA 1DJRD 1SAPA 1GHKA 2NTTA 3MEHA 4X3UA 2IPKD 5C0XI 1HTLD 1M8AA 1SNCA 1PTOC 3GTLB 3IL8A 2Q8RE 2OEOA 3I4MB 5CBEE 2WV6D 1SE3A 1J9OA 5EGTA 1TWFB 1SNQA 4I7ZC 3DWPA 3RD4A 2FHTA 3H94A 4KJNA 4IQZA 1U9RA 5T1IA 3OWEB 1OO9B 3BVZA 3RZOB 5JVH3 1A6XA 5ELFA 3L7ZC 1F2YA 4FVMA 1BNZA 1HHVA 3AU7A 1HUNA 5FOBB 1DXMA 1EY8A 2RKSA 1L0XB 2K01A 1LTAD 1ILPA 4LK1C 3JAML 3DM1A 4BWGB 1RD9D 3OOCA 1VCIA 2MUYA 3C1FA 1B1ZA 2E74C 2MP1A 1EYDA 1B53A 1SYEA 2F0QA 4ZUJA 1KDAA 2JSOA 2K04A 1IYVA 2L11A 4E6IA 1YNJC 2R93B 4HAEA 1CHPD 1BF4A 5A35A 2M9VA 4KY6A 4KN4C 4XQJA 4B9WA 2F0VA 4XYQA 2PZUA 2RVLA 3NBIA 2VUMB 3QWNA 4KN7C 3HS0C 4ZKCB 2F0JA 3I4NB 4A3BB 3LWEA 4CBVA 5JPMC 2WINB 2XIWA 4CJ2C 1OXUA 5CV6A 3I8ZA 4C3IB 3H09A 4IUUA 2KOLA 3BDOA 3NPPA 2NTSA 2A68C 5EPJA 2AUJD 4X3SA 3K57A 1SJHD 4IUVA 2J7ZA 3EJIA 3P7JA 3OIPA 2I46A 1TS2A 5JEAH 4XYOA 4PNYA 2SNSA 3HOUB 3K5OA 1QOHA 3RUZA 2V4DA 4K5WA 4P2CB 2JA8B 4RA8A 2WKDA 1STGA 1DCZA 3HZXA 1WVLA 4OO1I 5C0XG 3J7AF 4FF3A 3T4AC 3OMGA 1QE6A 4TSSA 1AEXA 1KNAA 3VYTA 3IFDA 4FF2A 4EQNA 4J6HA 4IUQA 2FFKB 3Q23A 1D5XC 5FLXL 1B3AA 1D5ZC 1BOSA 5KGUA 5DM63 3K58A 4CKCA 3Q22A 3GTQB 3S1NB 4I65A 3D4RA 3GV6A 3I90A 2F3VA 4RH6A 1CZGA 1SMYC 3D8GA 3O13A 4OO1H 2D62A 3AMUA 1PMRA 4HTHA 1EY9A 2NVYB 3A8IE 4QF4A 3ND8A 4KKSA 2F03A 4KD4A 5C5MA 2B8GA 1Q1EA 5AFWA 5M5XB 2F0LA 2PQEA 2E2JB 5K36G 5I6YA 1TU2B 1STBA 3X3MA 4OO1G 2F0GA 4KTAA 4TQUS 5JAVA 2N55A 1WD0A 3BVMA 2MGSA 2LKVA 1ENCA 1S5CD 2R92B 5CGKA 3SDZA 1E2WA 1EU4A 1EY0A 2C9OA 2JEBI 1TQOA 4RAUC 2FINB 4A3EB 1Y8OB 4K6LA 2JYOA 1EL0A 1XYIA 2K33A 4EGVA 3A55A 4WORA 4H0LC 3S1RB 1ZYRD 1PZID 2A69D 4U673 3ND9A 1TWCB 1QG7A 3MFYA 3D6CA 1B44D 1PZKD 3KLSX 3TSSA 3V2TA 5T1GA 5EKLA 2NYZD 1SNDA 4DA2A 3NTKA 2Z8LA 1AW7A 1HA5A 1O80A 2IT1A 3RZDB 1DOKA 3OSOA 1SNPA 3NWTA 5E3FA 4NDXA 1GXDC 1HXYD 4C3IG 2K03A 3EFXD 2B39A 3GTGB 2G9DA 1JQYD 3KUPA 4J1MA 2E2DC 4F7XA 4ZUIA 5C3XA 2A68D 3F2UA 1E2ZA 4Q5VA 1Y69U 2JE6I 3NXWA 3IAYA 2KUMA 1RTOA 3C1EA 2RDFA 2EYHA 3L9AX 4FNFA 3FKIB 4DXGA 1HQMC 4ZQ3A 4QMGA 2HQEA 4OHJA 3FEWX 1GUWA 2JXMB 1GUOA 1JOOA 3OW7A 4ZYSA 4CJ1B 2BOSA 2R6GA 4IFDJ 1JWMD 1PDQA 1WTWA 1CZWA 2J0TD 1PTOF 2BA0A 2KEDA 5CMDA 1Z7TA 1X3QA 2CW0D 3KBGA 4RCNA 1JC7A 2EJGC 2O5JC 3D6WA 2F0NA 4CKBA 5KYIA 3T13A 1K8MA 1BO0A 2O4XA 1O7YA 3QJYA 4DF7A 2F1MA 2K1BA 5M9OA 1F9QA 2L5TA 1X3PA 3N6RA 1PTOH 1PLFA 4PMCA 2L9HA 2TMPA 1RCVD 3VR6A 1IW7D 2R61A 3MXNA 3K59A 4G7ZC 3HEJA 2EZVA 2F3WA 1PFBA 1OXVA 2L12A 1M4VA 1BXTA 4IUNA 1CA5A 4A3IB 3X3NA 3D4DA 2D5DA 2E76C 2RDHA 1Y1WB 1GUTA 1SDFA 1KDCA 2K32A 1WCMB 4PQXA 4RGTA 1G6ZA 3A8JE 1OXSC 1LTBD 3I91A 2IL8A 1O7ZA 1W6JA 5CV5A 1I3QB 5IIFA 1KNEA 2AWOA 2A6HD 4RHRA 1U4RA 4C3HB 4Z9CB 4AYBB 3T56B 5C4JB 5CBAE 4FXKC 4RGNA 2VB3X 4XQQA 2C5CA 1A3UA 3WDNA 1JWUD 3DWAA 4M8AA 3NBHA 4N9TA 1NSNS 1PXUA 1STYA 4G4KA 4DGZA 3MVVA 3R2IA 1MSGA 5C44B 1O78A 1Y1VB 1EYCA 1UEAB 5BN5A 3J7YW 1QNKA 3DWQA 3K7AB 1K8OA 1ZYRC 4G7OC 1WTXA 4X3KA 3RMHA 2RQXA 1EYAA 3MXPA 2AUKA 1LTSD 3I4LA 1A2UA 4DAVA 1SSOA 4BY7B 5J39A 1XWEA 3NWSA 2VNUD 1QWYA 4LMQD 2F0HA 3V05A 1SYBA 3R3OA 4KK7A 1G291 4HN7A 4R8NA 3S9WA 3DXJC 1KTKA 2AQ2B 1E0BA 5KIXA 1TWAB 2E2HB 4IZ8A 4IUPA 3NQIA 4V190 3KK7A 2EPBA 4KKUA 5C4ZA 3S17B 3K5LA 1XXGA 3SXHA 1TY0A 4K2LA 1TKWB 1EY5A 2EOTA 2FMCA 1WTVA 1RF2D 3FVQA 1ML0D 5FO7B 3NP8A 3NUCA 1JOKA 1TS5A 3W3AA 1GUGA 3J81E 2PPBC 2BCOA 4KKTA 1S5ED 1B50A 1A3VA 5IGCA 1NR4A 1RODA 1AP0A 2HDLA 3GO5A 1ENFA 4IALA 1R4PB 2B2WA 2EYMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CR3 A;  4B9X A;  2F0I A;  4WOR A;  2F0W A;  2EYL A;  2OXP A;  1STA A;  4HMJ A;  1EYC A;  4EQN A;  3P1H A;  1STH A;  4J6H A;  2M00 A;  3C1F A;  4TRD A;  1F2Z A;  5KYL A;  1SYG A;  3D4W A;  4K5V A;  5IGE A;  1STN A;  2KHS A;  4OL7 A;  3SK4 A;  1EYD A;  3D6C A;  3NHH A;  4K5X A;  5CV8 A;  5IGG A;  1RKN A;  2SNM A;  2KQ3 A;  5IOC A;  3V2T A;  2F0N A;  1SYE A;  5KGU A;  2F0Q A;  5ISR A;  3H6M A;  2PZW A;  4KHV A;  2EY5 A;  5KYI A;  2ENB A;  4ZUJ A;  1KDA A;  4H7B A;  3T13 A;  1ENA A;  3MZ5 A;  3NQT A;  4I65 A;  3VA5 A;  1EY6 A;  3P75 A;  5E1F A;  5EKL A;  1A3T A;  5HGT A;  3E5S A;  2O4X A;  4HMI A;  1IHZ A;  1EYA A;  2F3V A;  4ME5 A;  4DF7 A;  1KAB A;  3PMF A;  1SND A;  3MXP A;  4NP5 A;  5C5L A;  1EQV A;  2F0E A;  3T16 A;  2OF1 A;  4DU9 A;  1A2T A;  5M9O A;  1SYC A;  1A2U A;  3D8G A;  3ERQ A;  4ID6 A;  3SK6 A;  1SNO A;  4K6D A;  3TP8 A;  5CC4 A;  2EXZ A;  3OSO A;  5I9O A;  1SNP A;  2PW7 A;  4E6I A;  5E3F A;  5C4H A;  4PMC A;  4RKB A;  4NDX A;  5K5P A;  5J39 A;  5HUR A;  5IGD A;  4F8M A;  1SYD A;  4K14 A;  2F0H A;  4KD3 A;  2EYP A;  5JAV A;  2F0D A;  4KY5 A;  4HTH A;  1EY9 A;  1SYB A;  2F0U A;  3DMU A;  3R3O A;  3MEH A;  4R8N A;  1TT2 A;  4J1M A;  3HEJ A;  4F7X A;  3S9W A;  4KY6 A;  4PMB A;  4EQP A;  3OMC A;  1F2M A;  4K2K A;  4QF4 A;  1EZ6 A;  4ZUI A;  4LAA A;  4WRD A;  5J1Z A;  4B9W A;  5C3X A;  5CV9 A;  2F0V A;  2F3W A;  3QOJ A;  4S3S A;  3SR1 A;  2PYK A;  1SNC A;  4KD4 A;  5KIX A;  4G57 A;  5C5M A;  2PZU A;  4IUN A;  3TP5 A;  2RBM A;  2F0T A;  2OEO A;  4IZ8 A;  1KAA A;  2EYO A;  2EYJ A;  2F0F A;  3NXW A;  3ITP A;  5I9P A;  4EVO A;  2F0L A;  3D4D A;  4QB4 A;  5NUC A;  3C1E A;  4K8J A;  2F0J A;  2PQE A;  5JOB A;  3U9O A;  5EGT A;  5C4Z A;  2RDF A;  4RKL A;  1SNQ A;  5I6Y A;  2EYH A;  3QOL A;  3SK5 A;  1KDC A;  1STB A;  5EKK A;  5CV6 A;  1EY4 A;  2QDB A;  2F0G A;  2F0S A;  2EY1 A;  4KJN A;  3MHB A;  4MIU A;  2F0K A;  3SXH A;  1JOQ A;  3TME A;  4DFA A;  4KTA A;  2F0M A;  4K2L A;  4NKL A;  5CV5 A;  4ZQ3 A;  4ODG A;  5IGF A;  5IIF A;  1SYF A;  1U9R A;  3ERO A;  4K8I A;  4NMZ A;  2HQE A;  4QMG A;  1EY5 A;  3EJI A;  2NUC A;  5CV7 A;  5DEH A;  5DAU A;  4YIJ A;  5KEE A;  2LKV A;  2SOB A;  1SNM A;  1ENC A;  5C3W A;  4PNY A;  1KDB A;  2EY6 A;  2SNS A;  3OWF A;  1EY7 A;  1JOR A;  5C6A A;  3NP8 A;  3NUC A;  3BDL A;  3RUZ A;  1JOK A;  5CGK A;  4K5W A;  5IGB A;  5J22 A;  1NUC A;  3EVQ A;  3SK8 A;  1STG A;  1F2Y A;  1JOO A;  2F0O A;  1EY0 A;  1EZ8 A;  1TR5 A;  1TQO A;  2WAC A;  1A3U A;  2EYF A;  3NK9 A;  3HZX A;  5IOD A;  4KV6 A;  5F2D A;  2F0P A;  4N9T A;  1NSN S;  5KRU A;  3SHL A;  5I6W A;  1STY A;  2PW5 A;  1A3V A;  4EQO A;  1EY8 A;  2RKS A;  3BDC A;  4N9P A;  4KY7 A;  4DGZ A;  5IGC A;  3DHQ A;  3TP7 A;  3OMG A;  2EY2 A;  4KJO A;  1II3 A;  3QB3 A;  3MVV A;  2PZT A;  5CV4 A;  3TP6 A;  4IAL A;  3LX0 A;  1AEX A;  2EYM A; 
#chains in the Genus database with same CATH topology
 2F0W A;  4DV7 L;  1BCP C;  1YI2 A;  2IX3 A;  1F2Z A;  2ICI A;  3DM3 A;  4Y7N B;  4DV0 L;  2LFN A;  1N36 Q;  5I2X A;  1STN A;  3TZD A;  1LT3 D;  3K6O A;  3I3C A;  3M4P A;  1XNQ Q;  1IZ6 A;  1JWS D;  3WOE A;  4PG3 A;  1VQB A;  5HY6 A;  1CFM A;  1YJN A;  2JJQ A;  2VB2 X;  4JVZ A;  1VMC A;  4A3G H;  1AE3 A;  5HGQ A;  1HPC A;  4YWK A;  3L2P A;  3HOV G;  1KAB A;  2DJG C;  1EQV A;  1YNX A;  3ZJY C;  1Y8N B;  1BDO A;  1MGS A;  2DY7 A;  1B8A A;  1HNZ Q;  1Q90 A;  4X64 L;  3F2B A;  1NE3 A;  4GOP C;  1EEI D;  3PUX A;  4V0B A;  3UI2 A;  1I4G A;  3ICE A;  1NAP A;  1BQQ T;  3CME A;  1TWG B;  1B3Q A;  4RFB A;  2JA6 B;  4BBR H;  2DJF C;  1VQG A;  5FLX c;  2HD3 A;  4HJA A;  2UUC L;  4K2K A;  1H9R A;  2XRQ D;  5JJZ A;  1Q81 C;  1CTM A;  3DEP A;  1NNX A;  2ZXR A;  2PO4 A;  2G5D A;  4KMU C;  3TRZ A;  1H9S B;  3K0Y A;  1R4Q B;  3BZD B;  4RGO S;  4A3G G;  4C1N K;  4LNQ A;  2E2H H;  4QB4 A;  1YIT A;  1G91 A;  2KCC A;  3MXG A;  4HIO A;  1SRU A;  4FXG C;  1VQO A;  4C2M H;  2E75 C;  5D65 A;  2EY1 A;  5C4X G;  1LT4 D;  1LTI D;  4H44 C;  3T53 B;  3L0O A;  1D1K A;  1SN8 A;  3ERS X;  4IPG A;  4K8I A;  2DUD A;  2NUC A;  4LFB Q;  1SFO B;  4ZKB B;  4MN3 A;  1FNW A;  4UPA A;  4LUV A;  1Q7Y C;  4YY3 L;  2B2U C;  4A3K G;  2R92 G;  3URY A;  4IFD H;  2XGT A;  1BCP B;  5DNF A;  1HNX Q;  1EZ8 A;  4A3B H;  1SXT A;  3CW2 C;  5F2D A;  2YTX A;  3W2D A;  2N78 A;  1K3R A;  3I4M H;  3RLO A;  2K28 A;  5KNB A;  4WFN 3;  2VY3 A;  5L37 A;  5COY A;  3BDC A;  3GV3 A;  2X6G A;  4P72 A;  4NB3 A;  1I4P A;  1FJG L;  1VF7 A;  2HIV A;  2A73 B;  5CR3 A;  1OXX K;  2AWN A;  2NVQ H;  1B9N A;  1STA A;  1X56 A;  4KHZ A;  5C44 H;  2K5H A;  2N3S A;  4UAI A;  4DR7 Q;  3WOF A;  2K5D A;  1CQF A;  5BN4 A;  2B63 B;  5M3M B;  1WCM G;  3S2H B;  1Y1W G;  1RJT A;  2B2V A;  1G51 A;  4PZ8 A;  3VR5 A;  1K8G A;  5C5L A;  3HOY H;  2OF1 A;  3UDI A;  1K3B C;  2BDN A;  3QG1 A;  3ERQ A;  1VQP A;  2WII B;  4HSP A;  2XRS D;  3IKJ A;  2HHH Q;  2EXZ A;  4L5S A;  4XXE A;  3TRE A;  4JG2 A;  5EQ0 A;  3CPW A;  1W2B A;  4RKB A;  5K5P A;  4F8M A;  1EFW A;  1CKM A;  5C3E B;  4BBS H;  3S1N H;  2G9H D;  1LT5 D;  1L0Y B;  1V1Q A;  2K6A A;  4XT1 B;  2LS0 1;  3KBX A;  2D9U A;  4KHP L;  5IT9 E;  3QOJ A;  5AJ3 Q;  5IT9 L;  1Y1W H;  1TII D;  4JI3 L;  1KAA A;  2IW3 A;  2NZ1 D;  1TXY A;  4K8J A;  4I7A A;  3GTL H;  4UP7 A;  5BR8 Q;  4RKL A;  2DNC A;  5KND A;  3VR4 A;  3S16 B;  3BYT B;  2EJM A;  1ZKO A;  1C7Y A;  1EIH A;  1DYQ A;  1IYJ B;  3RZO H;  2AMC B;  2A6H C;  3MHB A;  4LWC A;  3V96 A;  3TME A;  4FF4 A;  1EWI A;  2K14 A;  2WB1 G;  4PV1 C;  3UDF A;  1PTO B;  1V43 A;  4HIM A;  3OPO A;  1MJE A;  4JBM A;  2N8N A;  1IL2 A;  2EY6 A;  3PF5 A;  1WTQ A;  1W6K A;  4HCS A;  2JN4 A;  2WAQ B;  5ELN A;  4HR7 B;  3EVQ A;  2QW7 A;  3SK8 A;  5C0X J;  4IFD I;  1TR5 A;  5LL6 X;  4CDE C;  1XPO A;  2F0P A;  4LF6 L;  1NCV A;  3TBI B;  1H9K A;  2B2T A;  4MNO A;  2K5Q A;  1EU3 A;  4GKK L;  2ZXP A;  1ZEQ X;  1G2T A;  1VQH A;  5BR8 L;  4HMJ A;  2ALY B;  2R7Z G;  1RHP A;  1HZC A;  1LV9 A;  3MAQ A;  1M1K C;  2CQO A;  2BE5 D;  4DAY A;  1C9O A;  1E22 A;  2IX0 A;  2MO0 A;  3D4W A;  5IGE A;  5I2Y A;  1GVP A;  1H9J A;  5CV8 A;  1VQ8 A;  1JB7 A;  2K4K A;  2NN6 G;  1CHQ D;  4UY8 C;  3H6M A;  2PZW A;  4KHV A;  2KBN A;  4EQP A;  3MZ5 A;  5C4X B;  1I50 B;  1A3T A;  1EWC A;  3I56 A;  1A2T A;  3EIV A;  4LFC L;  2Z9H A;  1I4R A;  4A93 H;  4C3I H;  3HOV B;  1F77 A;  4GOP B;  1CUK A;  3HRZ C;  2VS1 A;  2Z6K C;  3CAM A;  4DV4 L;  1SYD A;  3GD7 A;  4K14 A;  4A3J G;  4B3T L;  3GTK H;  2DGY A;  2KCM A;  1CKN A;  1C4Q A;  2FMM A;  2XWJ B;  1QNU A;  2HCI A;  3M4O B;  3HOZ B;  3PIO 3;  2B8F A;  1YVC A;  4JI3 Q;  5M3F G;  1LTR D;  2A74 C;  3B6Y A;  1KAW A;  2ES2 A;  4LF7 L;  4G57 A;  3CCS A;  1XTC D;  5M3F B;  2PQA B;  4B3S L;  1Y1V H;  1EUJ A;  1IBM L;  1ASY A;  3HOX B;  4PMW A;  2Q8I B;  5A2Q E;  4CGY B;  4DK0 A;  4LF7 Q;  3RN2 A;  3H0G B;  1CA6 A;  3CC2 A;  3SEB A;  1UE6 A;  5FK9 C;  1Q86 C;  3S2H H;  1BUV T;  2YU9 H;  1VQA A;  1I94 Q;  3H0G H;  3NEM A;  5JJK A;  2RSN A;  1D8L A;  2IWH A;  2YYZ A;  4OX9 L;  5EJW A;  1LTT D;  4POF A;  1JOR A;  3QO2 A;  3NEN A;  4DV2 Q;  4M1U B;  2EXD A;  4OIJ A;  4GN4 B;  4QIW E;  4A3L H;  1KLU D;  4C1N I;  1YNJ D;  5JEA G;  2CQA A;  2X69 A;  3M4O H;  1HR0 L;  1S72 A;  3SHL A;  2Y0S G;  1B7Y B;  3BYY B;  2K05 A;  4GNX B;  1PRT B;  1DM0 B;  3PO2 G;  1PRT D;  1RTN A;  3H0G G;  4IN3 A;  2L55 A;  4NXM L;  1R9T B;  3HOU G;  3E9I A;  2CW0 C;  3R93 A;  2RDG A;  1Q3L A;  5FO8 B;  2SNM A;  1NR2 A;  4O1N A;  5ISR A;  4BA1 I;  1JMC A;  2ENB A;  5IY0 A;  2B2Y C;  3PO3 H;  2R93 G;  1VQF A;  1LT6 D;  3OHX C;  4ME5 A;  1HZB A;  4AH6 A;  1N9W A;  4DV6 Q;  4XQN A;  1LTG D;  2DY8 A;  4A4I A;  1K28 A;  5CC4 A;  4XDX A;  2NN6 H;  5C4H A;  1IL8 A;  4BS9 A;  2XWB B;  3K7U C;  2K52 A;  1WTP A;  1XMO L;  3HG9 A;  1TT2 A;  4GNX C;  2VXW A;  1WTR A;  4B3R L;  3AFQ A;  3OMC A;  3VYS A;  4WRD A;  2IHE A;  2BA1 A;  4GLV B;  1H9S A;  3BZC A;  4AQY Q;  1NY4 A;  1PRT F;  5A2Q L;  5M5X H;  3S1M B;  1V1O A;  1GJX A;  3S1Q B;  3CCU A;  2L1B A;  5H1S E;  5C0X H;  2E8G A;  5JOB A;  3PIO A;  2KA7 A;  1ICW A;  1Z47 A;  1QZG A;  2Y0S B;  4GN5 A;  5FKA C;  4JI5 L;  1JB3 A;  2R7Z H;  1Q8I A;  2QDB A;  5TSS A;  3JAM E;  1WTH A;  3F2D A;  5IP7 H;  1K83 H;  1X54 A;  4RCO A;  2IJ0 A;  4NMZ A;  3I55 A;  4GKJ L;  5M5Y B;  1K9M C;  5CV7 A;  5DEH A;  5EBD A;  2TSS A;  4R4T A;  1F9S A;  4KI0 A;  1N32 L;  2ZJP A;  2YV5 A;  2O5I C;  1BCP F;  4LF9 L;  4A3M H;  3BDL A;  2LXK A;  1DGS A;  3NK9 A;  3CP0 A;  4IOA A;  3LGJ A;  2SDF A;  3FP9 A;  1MIU A;  5GAD C;  4A3F B;  2AHO B;  5KRU A;  2CVR A;  2J4X A;  3PO2 H;  2F52 A;  2H4O A;  2PW5 A;  1CK1 A;  3S15 B;  2VQE Q;  1KLG D;  4OEM B;  1GUN A;  4KJO A;  2IY5 B;  3A54 A;  4IPC A;  3LX0 A;  4NW2 A;  2NWG A;  4B9X A;  1GOZ A;  4FYD A;  3SVM A;  3NE5 B;  2F4V Q;  2JA5 B;  2JP1 A;  1XJV A;  4C3J B;  3HOY B;  3HKS A;  1SYG A;  4A3E G;  3U9S A;  3VR2 A;  5IGG A;  5KNC A;  4QUF A;  2KQ3 A;  2OT2 A;  3E6Z X;  4ZLT F;  1K83 B;  4DV7 Q;  5D3D A;  1BBX C;  2NZO A;  3G4S A;  2KEN A;  1IBK L;  1IHZ A;  3CCR A;  2DN8 A;  1QIL A;  2K5N A;  2F0E A;  3N52 A;  3H15 A;  3TS0 A;  5IT9 c;  4UP9 A;  4IUR A;  5GRO A;  1Q82 C;  3TP8 A;  5EBC A;  3TEH B;  4RG1 A;  2PW7 A;  1S5B D;  1HUM A;  4X3T A;  2Z4H A;  1PFM A;  2B2Y A;  5HUR A;  1IKM A;  3PUZ A;  1TWH B;  1Q8K A;  1HA6 A;  1VQN A;  2JA5 H;  4XT3 B;  3DMU A;  3PF4 A;  4JI1 L;  1E3P A;  1QB5 D;  3D31 A;  4LAA A;  1Q1B A;  1X65 A;  1C48 A;  4ZAI A;  4CKE A;  5JJL A;  1PYW D;  4A3K B;  3I4N H;  2XN9 C;  3TP5 A;  1DOL A;  4P73 A;  4A3D H;  1S4Z A;  4O0A A;  4L63 B;  3GTJ B;  5DM7 3;  3FMC A;  1C8C A;  1HNX L;  2A1A A;  1A62 A;  2EVB A;  3HKZ B;  1V1P B;  4JW0 A;  4JV5 Q;  5EKK A;  1WJJ A;  3SE0 A;  1LUZ A;  4OGQ C;  4A3M B;  1YHB A;  1RDP D;  4IJL A;  1CT1 D;  3TN2 A;  3A8K E;  1PV4 A;  4IPD A;  2UUC Q;  1DOM A;  1JOQ A;  1VQJ A;  4ODG A;  1MI2 A;  3I2Z A;  5FLX E;  3J80 L;  5JEA J;  3T51 B;  2JA9 A;  2I5L X;  1MBY A;  5KEE A;  4QJF A;  1SNM A;  1SBB B;  4JI6 Q;  1KDB A;  3KF6 A;  1EY7 A;  4JBJ A;  2A5H A;  5M5W B;  5IP7 G;  1NUC A;  2NVT B;  4IPH A;  2QF7 A;  4A3K H;  5ELB A;  2AQ1 B;  3PUY A;  2OQK A;  4K0K Q;  1XMO Q;  1FD7 D;  4L8J A;  2PMZ B;  3MFG A;  4KY7 A;  3EQL C;  3W1G A;  1BR9 A;  1VQD A;  4EQO A;  4F87 A;  4DR3 L;  1II3 A;  2XVS A;  5CV4 A;  4GLX A;  3S15 H;  2CWA A;  4MTK A;  1VQE A;  3KLS A;  3JAM i;  4LJZ C;  3HKZ G;  5E4W C;  1OTC A;  3BG3 A;  4JOI A;  1S3O A;  5KYL A;  4OON A;  1XPU A;  2ICE C;  1UAP A;  3GTK B;  2NVX H;  1G2S A;  4K5X A;  3FHW A;  3CD6 A;  1GO3 E;  1Y14 B;  3M85 A;  3GTM B;  2GVB A;  3E9H A;  4PZ6 A;  2E2I B;  4UDU C;  1QUQ A;  1EY6 A;  1SLJ A;  3VYR A;  1MHW C;  5FJ8 G;  3E5S A;  2R7F A;  1U4M A;  5C3W A;  3VA7 A;  1TS4 A;  3PO3 B;  4J8Q A;  5EPL A;  3AB9 A;  4ID6 A;  5CYU A;  3JC6 6;  5I9O A;  3S14 H;  4AYB E;  4ULL A;  2RHQ B;  1HQR D;  3BVG A;  3Q0A A;  4BBS G;  2D2C C;  1ESF A;  1JJG A;  2KVM A;  4JI1 Q;  4J15 A;  2PI2 A;  5IYC H;  3KLR A;  4A3J B;  4A3F H;  3PO2 B;  5COR A;  1PFS A;  3I4N G;  1IBL L;  3A7A B;  3BZK A;  3P20 A;  3OTO Q;  3SR1 A;  1N34 Q;  1ONL A;  2N88 A;  2CKZ B;  2F0F A;  4R4Q A;  3CQZ H;  2UXB L;  2H5X A;  2RA4 A;  4CDF C;  3R2T A;  4IO9 A;  4ABN A;  4N8F A;  3I4O A;  4IUT A;  1JIC A;  3AEV A;  1I50 H;  5E4X A;  3W1B A;  1EY4 A;  1AN8 A;  3U4V A;  4ZCK A;  1IBM Q;  3MC0 B;  3IRB A;  1X55 A;  3GDE A;  1E2V A;  2K5W A;  3BU2 A;  1EYG A;  3ZYY X;  4LF8 Q;  1SYF A;  4FP5 D;  5JVG 3;  2N49 A;  5DAU A;  1QJO A;  1V8Q A;  1XNR Q;  1AFP A;  4B3M L;  2E5L L;  3C3L A;  1JE4 A;  2MPM A;  1HJP A;  1TWA H;  1A63 A;  2A6E C;  3F2C A;  1SEB D;  1CI3 M;  1AZQ A;  2F0O A;  1F2L A;  1TS3 A;  1AZP A;  1A15 A;  1XMQ Q;  3CQZ B;  1B4O A;  1QVC A;  1YZ6 A;  1TVX A;  1PVO A;  2I07 B;  4JC0 A;  3DEO A;  4ZRZ A;  1STE A;  1UUP A;  4H13 C;  5I4D A;  1VF5 C;  1U5K A;  5G3L F;  2GA4 B;  2EYL A;  2OXP A;  1STH A;  4A3B G;  4QQB X;  4X65 L;  4TRD A;  4R8I A;  3PIP 3;  4IFD G;  3I72 A;  4OIK A;  2B2U A;  3J80 i;  4JV5 L;  2Q8T A;  2M2L A;  3G7L A;  2QA4 A;  3D3R A;  3M4Y A;  2LXJ A;  3S14 B;  3CRK C;  1K73 C;  3FDT A;  4C3H G;  4B3M Q;  2K7V A;  3OW2 A;  3CRL C;  2MJ8 A;  3T16 A;  2CH4 A;  1DZ1 A;  1R9T H;  5EKI A;  2YU9 B;  2ID0 A;  1HCZ A;  1HFG A;  3PV0 A;  3CCQ A;  4JI2 Q;  4X6A H;  2ZTD A;  3MXN B;  4HJ7 A;  1EOT A;  1FYC A;  4L6T B;  1IYU A;  2B2V C;  1VDZ A;  4IJH A;  5IGD A;  2IX1 A;  2QDL A;  4P75 A;  3VR3 A;  2WB1 B;  3UE1 A;  1PH8 A;  2EYP A;  3PGZ A;  3AQQ A;  4DUY L;  5M3F H;  2FJ2 A;  4OX9 Q;  5CV9 A;  2PYK A;  2LSS A;  3CU7 A;  4CJ0 B;  1KXL A;  4X65 Q;  1SE4 A;  5AJ3 L;  2KJX A;  3LWU A;  2F0T A;  5I9P A;  4C3H H;  4LW1 A;  4DV6 L;  4FXD A;  5NUC A;  1BBW A;  1ET6 A;  1DON A;  1ESR A;  4FF1 A;  2MHV A;  3W5O A;  1EOV A;  3QOL A;  5BN3 A;  4O42 A;  2HDM A;  1Z6H A;  4Q0F A;  3K5M A;  4FDB A;  2F0S A;  4DKA C;  3Q24 A;  1SE2 A;  1W3S A;  2F4I A;  4DFA A;  2NN6 I;  2GVA A;  4DNT B;  3VDY A;  1WTO A;  1LLR D;  4YIJ A;  1VQ9 A;  2SOB A;  3FKI G;  3FRP B;  3HOW B;  1EWH A;  3RLN A;  3LNN A;  4JBW A;  5IOD A;  4KV6 A;  3S2D B;  1DD2 A;  3PUV A;  4LF9 Q;  3NSW A;  4R9W A;  4RWS C;  4DAP A;  4DR1 L;  1UE7 A;  4QL5 A;  4QCL A;  2EY2 A;  1FVI A;  3H3V H;  2L0C A;  4DAY B;  3MWY W;  4DR3 Q;  2F0I A;  2X6L A;  2KEE A;  3G71 A;  4A93 B;  3UDX A;  1FR3 A;  3S2D H;  4DK6 C;  4BY1 H;  2BE5 C;  1LO5 D;  4JI0 L;  1SFO H;  1TWH H;  3TZU A;  1IW7 C;  4GN3 B;  2KHS A;  3TDQ A;  3OTO L;  4DUZ Q;  3H3V C;  5LMU Q;  2RSO A;  2PCF B;  1FGB D;  5ELD A;  1EQT A;  2WFW A;  2Z1C A;  4GS3 A;  3VA5 A;  4H7B A;  3QIA A;  4GZY C;  1GUS A;  1X3F A;  1S5D D;  3NQT A;  4AQY L;  1WD1 A;  3J80 E;  2CH4 W;  3AYH B;  3P75 A;  1XMQ L;  2V1C C;  4NP5 A;  2B63 G;  1S5F D;  3SK6 A;  1T5X D;  4HIK A;  5FLM H;  2BDO A;  2XNA C;  2VW9 A;  3WWV A;  1N33 L;  3H3V I;  2OTL A;  4KD3 A;  1EFI D;  2EDG A;  4KY5 A;  4R4C A;  2OTJ A;  2NVQ B;  5J1Z A;  1ICF B;  3CKI B;  3QR8 A;  5E7N A;  1YEZ A;  4S3S A;  1YBY A;  2QCP X;  4YCU A;  2RBM A;  4LF4 L;  2IHF A;  2EYO A;  3ITP A;  2EE1 A;  4A3J H;  1F9P A;  3SK5 A;  2HIX A;  1H9M A;  3CHB D;  4U68 A;  4JYA Q;  2B29 A;  2VQE L;  2ZJR A;  1ET9 A;  2F0K A;  4NKL A;  2F0M A;  5IGF A;  1SJE D;  2EIF A;  1I5F A;  5LMN W;  3FKI H;  4C56 C;  2L4N A;  1F9R A;  3HOW G;  2CFM A;  3L3O C;  4DV1 L;  1V9P A;  1CSQ A;  3MA2 B;  3CF5 A;  2I5H A;  3NTH A;  1WI5 A;  5C6A A;  3GTM H;  1D6E C;  2RF4 A;  1O7L A;  1I4H A;  4BA2 I;  2OQ0 A;  2NVX B;  3GTP B;  4DV1 Q;  1UNS A;  2WAC A;  4P71 A;  1GHJ A;  2EJF C;  2KEC A;  2UXD L;  5FO9 B;  4DN4 M;  1S40 A;  4BBS B;  3K0X A;  4A3D G;  3KYH C;  1X3E A;  1IBL Q;  1PRT C;  1L1O C;  1VS0 A;  1JR0 D;  3IFT A;  4LFC Q;  4BBR B;  1YNN C;  3RLF A;  5ELO A;  4DR5 L;  1VMP A;  4K5V A;  1PFN A;  4OL7 A;  2UU9 L;  3GQB A;  5IOC A;  1RKN A;  5M5W H;  1MSH A;  1U4P A;  3FPP A;  3TQY A;  4JBK A;  3CCJ A;  2B63 H;  4GKJ Q;  3J7A V;  3I73 A;  1G8Z D;  1EQR A;  2O2L D;  1SRO A;  3E0E A;  3NTI A;  2BH8 A;  2NBF A;  4TVA B;  4C2M B;  4A3I G;  4DR7 L;  1FNV A;  2JA5 G;  5M5Y H;  1PZJ D;  1EIG A;  3PSI A;  3E0J A;  1CQV A;  2F0D A;  2A6E D;  2VZA A;  2A69 C;  2RHS B;  2ZT9 C;  4FO2 A;  3J81 c;  3GTJ H;  1ILQ A;  1EZ6 A;  4A3D B;  1CM9 A;  5JPN C;  4BY7 G;  3J81 L;  2JEA I;  3BS1 A;  3VYU A;  4Y52 H;  4JCV E;  1I4Q A;  4JI8 L;  4XTC S;  1QCB D;  3J80 c;  2QGQ A;  2WKC A;  3A74 A;  4DK1 A;  4EVO A;  1BKB A;  2HT1 A;  4HJ9 A;  3GTO B;  1D1I A;  4K0K L;  2C35 B;  3NBH B;  2PQA A;  3Q6S A;  1TWG H;  5GAE C;  3UDG A;  4BY1 G;  2UXC L;  2HCC A;  3CXC A;  2R3Z A;  2D0O A;  5LL6 S;  1X9N A;  1TY2 A;  5EAY A;  4MIU A;  4XIG S;  1GD7 A;  1LTL A;  2QEJ C;  3F1Z A;  1QZH A;  3ERO A;  3CCV A;  4MHE A;  4QIW B;  2LY7 A;  1SMY D;  2DNE A;  1NBW A;  2E2I H;  2ZM6 Q;  3OWF A;  5IGB A;  1U4L A;  5D3I B;  1N32 Q;  1UE5 A;  5IYD G;  2R7Z B;  5J22 A;  4JOI C;  1B9M A;  3M9B A;  3PQI A;  1L1O B;  1D5M C;  2SEB D;  5IYB G;  3RN5 A;  3G6J B;  5K36 H;  1PH7 A;  4HCE A;  3A0J A;  4NXM Q;  3AFP A;  3S1M H;  5I6W A;  2JA7 G;  2Z4I A;  1I6V C;  4YWL A;  2XTI A;  3A56 A;  4N9P A;  1U0L A;  2Z0S A;  3ER0 A;  2PZT A;  1X3G A;  4LF8 L;  5C4J H;  4BY1 B;  4JI6 L;  3PUW A;  1MJC A;  4TKO B;  3G48 A;  2M00 A;  1JJC B;  1D2B A;  1YNN D;  2PI2 E;  1PH4 A;  1Q12 A;  1BCP D;  2PNR C;  1IKL A;  4A3G B;  4WJW A;  4JI0 Q;  5GQO A;  4OXP A;  3A7L A;  4LF6 Q;  1T5E A;  2B3G A;  4JI7 L;  1N34 L;  5HGT A;  2NB0 A;  1L2F A;  2WP8 J;  1NTG A;  2MO1 A;  2AQ3 B;  3OIQ A;  4C3J G;  1Y8P B;  4RHS A;  4DU9 A;  5C4X H;  1HRJ A;  4OWX B;  3M7G A;  1I6H B;  3KF8 A;  3J7A 5;  1NMF A;  3M3Y B;  1LAC A;  1SNO A;  5IP9 H;  2Q2H A;  2ZTC A;  2CHB D;  4DR5 Q;  4ZK9 B;  1MD2 D;  1EEF D;  3E3X A;  2B2T C;  4DV0 Q;  1OXT A;  1H95 A;  2F0U A;  3KOJ A;  4PMB A;  4G7H C;  1F2M A;  3MXU A;  1KRT A;  3KDF A;  4LUO A;  5FJ8 H;  1JJ2 A;  1KIX A;  1FNU A;  3T1Y L;  5GAG C;  2OWO A;  2EYJ A;  4CHT B;  4YY3 Q;  1I4X A;  2QIL A;  4DUY Q;  3MTS A;  4R1J A;  2KCN A;  4LF4 Q;  3U9O A;  1HFN A;  1VQC A;  2XSC A;  2HQL A;  2JA7 B;  1HTP A;  4RGM A;  2UUB L;  3T1H L;  3S24 A;  1SR3 A;  3R8B A;  5JJI A;  2MFI A;  3GP7 A;  3K5N A;  3H91 A;  4F88 A;  2ASB A;  1VQ5 A;  4LFA L;  5LHY 1;  1V1P A;  2CCZ A;  2UUA Q;  4DUZ L;  2L15 A;  1XX8 A;  5M3M G;  1SE8 A;  1PTO D;  4A75 A;  1B2T A;  4QUC A;  4DV5 Q;  4B3S Q;  4JK1 C;  1PH5 A;  4JI8 Q;  4LF5 L;  1JCK B;  1PYS B;  3J81 i;  2ZXO A;  4DV3 Q;  2QKI C;  2K50 A;  2EYF A;  1J8I A;  5EPK A;  1BVS A;  2ZM6 L;  4QY7 A;  1Y1V G;  1SMX A;  3DHQ A;  3TP7 A;  3FPU B;  4KLK A;  1FGU A;  3QB3 A;  3TP6 A;  4DNR B;  1Z9F A;  4BY7 H;  4B08 A;  3S1Q H;  4HED A;  4DR2 L;  4DR6 L;  3C2P A;  3P1H A;  4HSV A;  3M7N A;  3STB C;  3ONA B;  4DXF A;  1X32 A;  3HKZ E;  3M4Q A;  2B2W C;  1JE5 A;  2HUG A;  3SK4 A;  4ILW A;  3NHH A;  2LMC B;  3HP3 A;  3I70 A;  2RCF A;  3RNU A;  4DPG A;  1LAB A;  3DUZ A;  1HR0 Q;  2EY5 A;  3STB D;  1PYB A;  2H1E A;  3C46 A;  1ENA A;  5ELE A;  4DV5 L;  5E1F A;  1XPR A;  4HMI A;  3EA6 A;  1RL2 A;  3PMF A;  5ELC A;  1ZXT A;  5G3L D;  1SYC A;  5D14 A;  1K8A C;  3HGB A;  1VQK A;  4K6D A;  2CWP A;  1DJR D;  5IYC G;  3A5Z B;  3G6E A;  1SAP A;  1GHK A;  2YTV A;  3A5U A;  2NTT A;  2VQF L;  1I94 L;  2AKW B;  3MEH A;  4GOP A;  4X3U A;  4A3I H;  2IPK D;  5C0X I;  4R4O A;  1N33 Q;  1HTL D;  3S16 H;  1M8A A;  2BH2 A;  1SNC A;  1PTO C;  3GTL B;  3IL8 A;  2Q8R E;  2OEO A;  4JI2 L;  3I4M B;  5CBE E;  4DR4 L;  2WV6 D;  1Q46 A;  3K8A A;  1SE3 A;  1XNQ L;  1J9O A;  5EGT A;  1TWF B;  1SNQ A;  4A93 G;  4I7Z C;  1I3Q H;  4YHH L;  2OCE A;  3DWP A;  1PH3 A;  2Q2T A;  2R92 H;  3RD4 A;  3J7Z C;  2FHT A;  4DR4 Q;  3H94 A;  4KJN A;  3SGI A;  4IQZ A;  4L5R C;  1JT8 A;  1U9R A;  5T1I A;  3JAM c;  2JA8 G;  3OWE B;  3HOX G;  1OO9 B;  2PNH A;  3HOW H;  3BVZ A;  4P74 A;  3RZO B;  2UXD Q;  1XNR L;  1UEB A;  5JVH 3;  1A6X A;  5ELF A;  3L7Z C;  1HZA A;  1F2Y A;  4FVM A;  3KJP A;  4EX5 A;  4DR1 Q;  1BNZ A;  1HHV A;  3AU7 A;  1HUN A;  5FOB B;  1DXM A;  1EY8 A;  2RKS A;  1L0X B;  2K01 A;  1LTA D;  1ILP A;  4LK1 C;  3JAM L;  3DM1 A;  3MEF A;  1RD9 D;  4BWG B;  3OOC A;  1WFQ A;  1VCI A;  2MUY A;  3C1F A;  1B1Z A;  3KF8 B;  5C3E H;  3KF6 B;  1GKH A;  2E74 C;  2MP1 A;  4B3T Q;  1EYD A;  1B53 A;  2KHI A;  1L0W A;  3OYY A;  3CMA A;  3RZD H;  1A0I A;  1SYE A;  2F0Q A;  4DR2 Q;  4AIM A;  4ZUJ A;  1KDA A;  2JSO A;  3KLW A;  1YJW A;  1LM0 A;  2K04 A;  3Q8D A;  1IYV A;  4X66 Q;  3HOV H;  1GM5 A;  3GTQ H;  2UXB Q;  2L11 A;  4WJ3 M;  1AE2 A;  4E6I A;  1G6P A;  3K80 C;  1CKO A;  1YNJ C;  2Z6K A;  2R93 B;  4HAE A;  1CHP D;  1BF4 A;  5A35 A;  2M9V A;  4KY6 A;  2PMZ E;  4KN4 C;  4XQJ A;  4B9W A;  3CCL A;  2F0V A;  1PHJ A;  2EQS A;  4XYQ A;  4WJ4 A;  2PZU A;  2RVL A;  3NBI A;  2VUM B;  3QWN A;  4KN7 C;  3HS0 C;  4ZKC B;  2F0J A;  3I4N B;  3TS2 A;  4A3B B;  3LWE A;  4CBV A;  5JPM C;  2WIN B;  2XIW A;  2QEX A;  1N8R C;  4CJ2 C;  3EN2 A;  1K0R A;  1OXU A;  5CV6 A;  3I8Z A;  5FLM G;  4C3I B;  3H09 A;  4IUU A;  2E5L Q;  2KOL A;  3BDO A;  3NPP A;  4N8X 1;  2NTS A;  2A68 C;  5EPJ A;  3U58 A;  1UWV A;  2AUJ D;  4X3S A;  1SJH D;  3K57 A;  1HNW L;  4IUV A;  2J7Z A;  3EJI A;  3P7J A;  2JA7 H;  2UUA L;  1D7Q A;  3OIP A;  2I46 A;  1TS2 A;  5JEA H;  4XYO A;  4PNY A;  4DK3 C;  2SNS A;  3K5O A;  3HOU B;  1QOH A;  2WAQ G;  3RUZ A;  1EIY B;  2V4D A;  4K5W A;  4P2C B;  2JA8 B;  1L1O A;  2Q2U A;  4RA8 A;  2WKD A;  1STG A;  5C44 G;  1PH6 A;  1DCZ A;  3HZX A;  4O2D A;  2D0P A;  1WVL A;  1XTD A;  1A8V A;  4OO1 I;  5C0X G;  2VL6 A;  3J7A F;  4FF3 A;  3T4A C;  3OMG A;  1QE6 A;  4TSS A;  3GTP H;  3I4M G;  1AEX A;  1KNA A;  2JA8 H;  3VYT A;  3IFD A;  1WYD A;  3ULJ A;  4FF2 A;  4EQN A;  1AH9 A;  4J6H A;  3NEL A;  4IUQ A;  2FFK B;  3HOZ G;  3Q23 A;  1D5X C;  5FLX L;  4BXX H;  1B3A A;  1D5Z C;  1BOS A;  5KGU A;  5DM6 3;  3K58 A;  4CKC A;  1K0S A;  5J3B A;  3Q22 A;  3GTQ B;  3S1N B;  4I65 A;  3D4R A;  3GV6 A;  3I90 A;  4HJ5 A;  2F3V A;  3CC4 A;  2ATW A;  2I5M X;  4MTN A;  2WB1 E;  4RH6 A;  3DLL A;  1CZG A;  4CDD C;  1SMY C;  3D8G A;  3O13 A;  4OO1 H;  2D62 A;  3AMU A;  3PCO B;  2WAQ E;  4BBR G;  4UP8 A;  5IP9 G;  2E2J H;  1IXR A;  1PMR A;  4HTH A;  1EY9 A;  2NVY B;  4A3C H;  3A8I E;  1HR0 W;  4QF4 A;  2P5Z X;  3ND8 A;  4KKS A;  2F03 A;  2ZJQ A;  4LFB L;  2R93 H;  4KD4 A;  1FJG Q;  5C5M A;  5LMN Q;  1T9H A;  2B8G A;  4CDC C;  1Q1E A;  1C0A A;  5AFW A;  5M5X B;  2F0L A;  3GTG H;  2PQE A;  2E2J B;  2UXC Q;  5K36 G;  4X62 Q;  1KL9 A;  5I6Y A;  1TU2 B;  1STB A;  4DAM A;  3X3M A;  4OO1 G;  2F0G A;  1E24 A;  3HOU H;  1LYL A;  4KTA A;  5IWA Q;  4TQU S;  5JAV A;  2N55 A;  1WD0 A;  3BVM A;  2MGS A;  1KD1 C;  2LKV A;  1ENC A;  1S5C D;  1ASZ A;  2R92 B;  2JQO A;  5CGK A;  3SDZ A;  1E2W A;  1EU4 A;  1KQS A;  5IYD H;  1EY0 A;  2C9O A;  2JEB I;  1TQO A;  4RAU C;  2FIN B;  4A3E B;  2VUM H;  1Y8O B;  4K6L A;  2JYO A;  1EL0 A;  1RIP A;  1XYI A;  1QVG A;  2A8V A;  2K33 A;  4EGV A;  3A55 A;  4WOR A;  4POG A;  4H0L C;  1B70 B;  1WOC A;  3S1R B;  4A3F G;  1ZYR D;  1PZI D;  2A69 D;  4U67 3;  3ND9 A;  2FXQ A;  4MZ9 A;  1TWC B;  4EQ5 A;  1QG7 A;  3MFY A;  3D6C A;  2K5V A;  1B44 D;  1PZK D;  3KLS X;  3TSS A;  3V2T A;  5T1G A;  4X64 Q;  2JA6 H;  4JYA L;  3T1Y Q;  5EKL A;  2NYZ D;  1E1T A;  3HOY G;  1TWF H;  1SND A;  4DA2 A;  3NTK A;  2Z8L A;  3CCE A;  1AW7 A;  4AYB G;  1HA5 A;  1O80 A;  2IT1 A;  3RZD B;  1DOK A;  1VQ4 A;  3OSO A;  4JI4 L;  1SNP A;  3NWT A;  5E3F A;  4NDX A;  1GXD C;  1HXY D;  4C3I G;  2K03 A;  3BJU A;  3EFX D;  2B39 A;  3GTG B;  1HNW Q;  3PIP A;  2YTY A;  2G9D A;  1JQY D;  3KUP A;  4J1M A;  2E2D C;  4F7X A;  3ULL A;  1J6Q A;  1NMG A;  4ZUI A;  5C3X A;  2A68 D;  2R7D A;  3D0F A;  3F2U A;  1E2Z A;  4Y7N H;  4Q5V A;  1CKN B;  4C3J H;  4JPB W;  1Y69 U;  2JE6 I;  2NVY H;  3NXW A;  3IAY A;  2KUM A;  1RTO A;  3C1E A;  1NJI C;  2RDF A;  3U4Z A;  2EYH A;  3L9A X;  4FNF A;  3FKI B;  3HOZ H;  4DXG A;  1HQM C;  4ZQ3 A;  4QMG A;  1HH2 P;  2HQE A;  4OHJ A;  2Y0S E;  1CSP A;  1P16 A;  3FEW X;  1VQM A;  4LF5 Q;  4DNI A;  1GUW A;  1HZ9 A;  2JXM B;  1GUO A;  1BBU A;  1JOO A;  3OW7 A;  4ZYS A;  4CJ1 B;  2BOS A;  4JI5 Q;  2R6G A;  4IFD J;  1JWM D;  1PDQ A;  2Q2I A;  5DLQ E;  1WTW A;  1KHI A;  4YHH Q;  3S17 H;  1CZW A;  2J0T D;  1PTO F;  2BA0 A;  2KED A;  5CMD A;  2JK8 A;  3KDF B;  5IYB H;  1Z7T A;  1X3Q A;  4L5Q A;  4GNX A;  2CW0 D;  3KBG A;  4RCN A;  1JC7 A;  2EJG C;  4A76 A;  4KHP Q;  2O5J C;  3D6W A;  2F0N A;  4CKB A;  4DR6 Q;  3UE0 A;  5KYI A;  1PA6 A;  3T13 A;  1FL0 A;  1K8M A;  5LMN L;  4APV A;  1BO0 A;  2MQH A;  1O7Y A;  2O4X A;  3QJY A;  4DF7 A;  2F1M A;  2K1B A;  5M9O A;  1F9Q A;  1P8L A;  2L5T A;  1X3P A;  2ZTE A;  2NZH A;  1VQL A;  1QUQ B;  2UUB Q;  3CC7 A;  3N6R A;  1PTO H;  1PLF A;  4PMC A;  3U50 C;  1QVF A;  1WCM H;  2L9H A;  2TMP A;  1RCV D;  3VR6 A;  1IW7 D;  2R61 A;  3MXN A;  5IWA L;  3K59 A;  3S1R H;  1M90 C;  2K75 A;  5C3E G;  4G7Z C;  3HEJ A;  4YCW A;  2EZV A;  2F3W A;  4YCV A;  1PFB A;  2JA6 G;  1OXV A;  1KRS A;  2L12 A;  1M4V A;  4YWM A;  4NXN Q;  1BXT A;  4IUN A;  1CA5 A;  4A3I B;  4X66 L;  3X3N A;  3D4D A;  4A3E H;  2D5D A;  2E76 C;  2RDH A;  1Y1W B;  1GUT A;  1VQ6 A;  1N36 L;  1SDF A;  1KDC A;  2K32 A;  1WCM B;  4JI4 Q;  4IOC A;  4PQX A;  4RGT A;  1G6Z A;  5LMU L;  3A8J E;  4L5T A;  1OXS C;  1LTB D;  3I91 A;  2IL8 A;  1O7Z A;  3T1H Q;  1W6J A;  5CV5 A;  4GKK Q;  3KFU A;  1I3Q B;  5IIF A;  1KNE A;  2AWO A;  3CCM A;  2A6H D;  4RHR A;  4H02 A;  1U4R A;  1YHA A;  1HNZ L;  4GLA C;  3K7A H;  4C3H B;  4Z9C B;  4AYB B;  3T56 B;  4HID A;  2KHJ A;  5C4J B;  5CBA E;  4FXK C;  4RGN A;  4R4I A;  3I7F A;  2VB3 X;  4XQQ A;  3K81 C;  1YHQ A;  2C5C A;  1A3U A;  1PH9 A;  1EQQ A;  3WDN A;  1JWU D;  3DWA A;  4M8A A;  3NBH A;  4N9T A;  1NSN S;  4OEL B;  1PXU A;  1STY A;  5M3M H;  4G4K A;  2I0Q A;  4DGZ A;  3MVV A;  3R2I A;  1MSG A;  3HOX H;  2NVT H;  5C44 B;  2VUM G;  1O78 A;  5IE8 A;  1Y1V B;  1EYC A;  1UEA B;  1UE1 A;  5BN5 A;  3J7Y W;  2VQF Q;  1QNK A;  1J5E Q;  4A3M G;  3DWQ A;  3K7A B;  1K8O A;  1ZYR C;  4G7O C;  4LUZ A;  1WTX A;  4X3K A;  3J81 j;  3RMH A;  1J5E L;  2RQX A;  1EYA A;  1O7I A;  3MXP A;  4OWW B;  2AUK A;  3GTO H;  1LTS D;  2KCT A;  3I4L A;  1A2U A;  4B3R Q;  4DAV A;  1SSO A;  4BY7 B;  1X6O A;  3CPF A;  1KC8 C;  5J39 A;  1XWE A;  3NWS A;  2VNU D;  3HFZ B;  1QWY A;  4LMQ D;  2F0H A;  3V05 A;  4ME3 A;  1PH1 A;  1SYB A;  3R3O A;  4KK7 A;  1G29 1;  2F3I A;  4HN7 A;  4R8N A;  3S9W A;  3DXJ C;  1KTK A;  1MKH A;  2AQ2 B;  4DV4 Q;  2Z6B A;  1E0B A;  5KIX A;  4A3C G;  1TWA B;  4RMF A;  2E2H B;  4IZ8 A;  4IUP A;  4LFA Q;  3NQI A;  2F4V L;  4V19 0;  1PH2 A;  3KK7 A;  3F8T A;  2EPB A;  4KKU A;  5C4Z A;  1E1O A;  1EIF A;  4UHV A;  4DV3 L;  3S17 B;  3K5L A;  3KJO A;  1XXG A;  2RCN A;  3M3Y H;  2MNA A;  3SXH A;  1TY0 A;  1I6H H;  4K2L A;  2GN5 A;  1TKW B;  4X62 L;  1VQ7 A;  1IBK Q;  1EY5 A;  3RR5 A;  3PO3 G;  2A19 A;  2EOT A;  2FMC A;  1WTV A;  1RF2 D;  3FVQ A;  4HJ8 A;  3ULP A;  1ML0 D;  1YIJ A;  5FO7 B;  5GAH C;  3NUC A;  3NP8 A;  2HHH L;  2UU9 Q;  1JOK A;  1E7Z A;  1TS5 A;  3W3A A;  4A3L G;  4BXX G;  4NXN L;  1GUG A;  3J81 E;  1TWC H;  2PPB C;  4OWT B;  2BCO A;  4JI7 Q;  4DV2 L;  4QGU A;  4KKT A;  1VQI A;  1S5E D;  1B50 A;  1A3V A;  3EBE A;  5IGC A;  1NR4 A;  1ROD A;  1AP0 A;  2HDL A;  3GO5 A;  1YJ9 A;  4PZ7 A;  1ENF A;  4IAL A;  1R4P B;  4NPS A;  4ALP A;  2B2W A;  2EYM A; 
#chains in the Genus database with same CATH homology
 2F0W A;  1BCP C;  2IX3 A;  1F2Z A;  2ICI A;  4Y7N B;  2LFN A;  5I2X A;  1STN A;  3TZD A;  1LT3 D;  3K6O A;  3I3C A;  1JWS D;  3WOE A;  1CFM A;  2VB2 X;  1VMC A;  1HPC A;  1KAB A;  1EQV A;  1Y8N B;  1BDO A;  1MGS A;  2DY7 A;  1Q90 A;  1EEI D;  3PUX A;  4V0B A;  3UI2 A;  1I4G A;  1NAP A;  1BQQ T;  1TWG B;  4RFB A;  2JA6 B;  4K2K A;  1H9R A;  2XRQ D;  5JJZ A;  1CTM A;  3DEP A;  2ZXR A;  2PO4 A;  4KMU C;  1H9S B;  3K0Y A;  1R4Q B;  3BZD B;  4RGO S;  4C1N K;  4QB4 A;  1G91 A;  2KCC A;  3MXG A;  4FXG C;  2E75 C;  5D65 A;  2EY1 A;  1LT4 D;  1LTI D;  4H44 C;  3T53 B;  1D1K A;  4K8I A;  2NUC A;  1SFO B;  4ZKB B;  4MN3 A;  1FNW A;  2B2U C;  3URY A;  4IFD H;  1BCP B;  5DNF A;  1EZ8 A;  1SXT A;  5F2D A;  3W2D A;  2K28 A;  5KNB A;  4WFN 3;  5COY A;  3BDC A;  3GV3 A;  2X6G A;  1I4P A;  1VF7 A;  2A73 B;  5CR3 A;  1OXX K;  2AWN A;  1B9N A;  1STA A;  4KHZ A;  4UAI A;  3WOF A;  2K5D A;  1CQF A;  5BN4 A;  2B63 B;  5M3M B;  3S2H B;  1RJT A;  2B2V A;  3VR5 A;  5C5L A;  2OF1 A;  2BDN A;  3QG1 A;  3ERQ A;  2WII B;  4HSP A;  2XRS D;  3IKJ A;  2EXZ A;  4XXE A;  5EQ0 A;  4RKB A;  5K5P A;  4F8M A;  5C3E B;  2G9H D;  1LT5 D;  1L0Y B;  2K6A A;  4XT1 B;  2LS0 1;  3KBX A;  2D9U A;  5IT9 E;  3QOJ A;  5IT9 L;  1TII D;  1KAA A;  2IW3 A;  2NZ1 D;  4K8J A;  4RKL A;  2DNC A;  5KND A;  3VR4 A;  3S16 B;  3BYT B;  2EJM A;  1ZKO A;  1EIH A;  1DYQ A;  2A6H C;  3MHB A;  3V96 A;  3TME A;  4FF4 A;  4PV1 C;  1PTO B;  1V43 A;  3OPO A;  2EY6 A;  1WTQ A;  1W6K A;  4HCS A;  2WAQ B;  4HR7 B;  3EVQ A;  3SK8 A;  5C0X J;  4IFD I;  1TR5 A;  5LL6 X;  2F0P A;  1NCV A;  3TBI B;  1H9K A;  2B2T A;  2K5Q A;  1EU3 A;  2ZXP A;  1ZEQ X;  1G2T A;  4HMJ A;  1RHP A;  1LV9 A;  3MAQ A;  2BE5 D;  4DAY A;  2IX0 A;  3D4W A;  5IGE A;  5I2Y A;  5CV8 A;  1H9J A;  2NN6 G;  1CHQ D;  3H6M A;  2PZW A;  4KHV A;  4EQP A;  3MZ5 A;  5C4X B;  1I50 B;  1A3T A;  1EWC A;  1A2T A;  1I4R A;  3HOV B;  1F77 A;  3HRZ C;  1SYD A;  3GD7 A;  4K14 A;  1C4Q A;  2FMM A;  2XWJ B;  1QNU A;  2HCI A;  3M4O B;  3HOZ B;  3PIO 3;  2B8F A;  1LTR D;  2A74 C;  4G57 A;  1XTC D;  5M3F B;  3HOX B;  4PMW A;  2Q8I B;  5A2Q E;  4CGY B;  4DK0 A;  3H0G B;  1CA6 A;  3SEB A;  5FK9 C;  1BUV T;  2RSN A;  2IWH A;  2YYZ A;  5EJW A;  1LTT D;  1JOR A;  3QO2 A;  4M1U B;  4OIJ A;  1KLU D;  4C1N I;  1YNJ D;  5JEA G;  2CQA A;  2X69 A;  3SHL A;  3BYY B;  2K05 A;  1PRT B;  1DM0 B;  1PRT D;  1RTN A;  4IN3 A;  2L55 A;  1R9T B;  2CW0 C;  3R93 A;  2RDG A;  1Q3L A;  5FO8 B;  2SNM A;  1NR2 A;  4O1N A;  5ISR A;  4BA1 I;  2ENB A;  2B2Y C;  1LT6 D;  3OHX C;  4ME5 A;  4XQN A;  1LTG D;  2DY8 A;  5CC4 A;  4XDX A;  2NN6 H;  5C4H A;  1IL8 A;  4BS9 A;  2XWB B;  1WTP A;  3HG9 A;  1TT2 A;  1WTR A;  2VXW A;  3OMC A;  3VYS A;  4WRD A;  2BA1 A;  1H9S A;  1PRT F;  5A2Q L;  3S1M B;  1V1O A;  1GJX A;  3S1Q B;  2L1B A;  5C0X H;  5JOB A;  2KA7 A;  1ICW A;  1Z47 A;  2Y0S B;  5FKA C;  1JB3 A;  1Q8I A;  2QDB A;  5TSS A;  3JAM E;  4RCO A;  2IJ0 A;  4NMZ A;  5M5Y B;  5CV7 A;  5DEH A;  5EBD A;  2TSS A;  1F9S A;  4KI0 A;  2O5I C;  1BCP F;  3BDL A;  3NK9 A;  2SDF A;  4A3F B;  5KRU A;  2CVR A;  2J4X A;  2H4O A;  2PW5 A;  3S15 B;  1CK1 A;  1KLG D;  1GUN A;  4KJO A;  3A54 A;  3LX0 A;  4NW2 A;  2NWG A;  4B9X A;  1GOZ A;  4FYD A;  3SVM A;  3NE5 B;  2JA5 B;  2JP1 A;  4C3J B;  3HOY B;  1SYG A;  3U9S A;  3VR2 A;  5IGG A;  5KNC A;  4QUF A;  2KQ3 A;  2OT2 A;  3E6Z X;  4ZLT F;  1K83 B;  5D3D A;  1BBX C;  1IHZ A;  2DN8 A;  1QIL A;  2F0E A;  3N52 A;  4IUR A;  3TP8 A;  5EBC A;  2PW7 A;  1S5B D;  1HUM A;  4X3T A;  2Z4H A;  1PFM A;  2B2Y A;  5HUR A;  1IKM A;  3PUZ A;  1TWH B;  1HA6 A;  4XT3 B;  3DMU A;  1QB5 D;  3D31 A;  4LAA A;  1Q1B A;  1C48 A;  4ZAI A;  4CKE A;  1PYW D;  4A3K B;  2XN9 C;  3TP5 A;  1DOL A;  1S4Z A;  4L63 B;  3GTJ B;  5DM7 3;  3FMC A;  1C8C A;  3HKZ B;  2EVB A;  1V1P B;  5EKK A;  3SE0 A;  4OGQ C;  4A3M B;  1RDP D;  1CT1 D;  3TN2 A;  3A8K E;  1JOQ A;  1DOM A;  4ODG A;  1MI2 A;  3J80 L;  5FLX E;  5JEA J;  3T51 B;  1MBY A;  5KEE A;  1SNM A;  1SBB B;  1KDB A;  1EY7 A;  2A5H A;  5M5W B;  1NUC A;  2NVT B;  2QF7 A;  5ELB A;  2AQ1 B;  3PUY A;  1FD7 D;  4L8J A;  2PMZ B;  3MFG A;  4KY7 A;  3EQL C;  4F87 A;  1BR9 A;  4EQO A;  1II3 A;  2XVS A;  5CV4 A;  3KLS A;  4LJZ C;  5E4W C;  3BG3 A;  5KYL A;  2ICE C;  1UAP A;  3GTK B;  1G2S A;  4K5X A;  3GTM B;  3M85 A;  2E2I B;  4UDU C;  1EY6 A;  3VYR A;  3E5S A;  1U4M A;  5C3W A;  3VA7 A;  1TS4 A;  3PO3 B;  4J8Q A;  5EPL A;  3AB9 A;  4ID6 A;  5CYU A;  5I9O A;  4ULL A;  1HQR D;  3BVG A;  3Q0A A;  2D2C C;  1ESF A;  2KVM A;  3KLR A;  4A3J B;  3PO2 B;  5COR A;  3A7A B;  3P20 A;  3SR1 A;  1ONL A;  2N88 A;  2F0F A;  2RA4 A;  3R2T A;  4ABN A;  4IUT A;  1JIC A;  5E4X A;  1EY4 A;  1AN8 A;  3MC0 B;  1E2V A;  2K5W A;  3ZYY X;  1SYF A;  4FP5 D;  5JVG 3;  5DAU A;  1QJO A;  1V8Q A;  1AFP A;  3C3L A;  1JE4 A;  2MPM A;  2A6E C;  1SEB D;  1CI3 M;  1AZQ A;  2F0O A;  1F2L A;  1TS3 A;  1AZP A;  1A15 A;  3CQZ B;  1B4O A;  1TVX A;  2I07 B;  3DEO A;  4ZRZ A;  1STE A;  1UUP A;  4H13 C;  5I4D A;  1VF5 C;  5G3L F;  2GA4 B;  2EYL A;  2OXP A;  1STH A;  4TRD A;  3PIP 3;  4R8I A;  4IFD G;  3I72 A;  4OIK A;  2B2U A;  2Q8T A;  2M2L A;  3G7L A;  3D3R A;  3M4Y A;  3S14 B;  3CRK C;  3FDT A;  4C3H G;  2K7V A;  3CRL C;  2MJ8 A;  3T16 A;  1DZ1 A;  5EKI A;  2YU9 B;  2ID0 A;  1HCZ A;  1HFG A;  3PV0 A;  1EOT A;  1FYC A;  4L6T B;  1IYU A;  2B2V C;  1VDZ A;  5IGD A;  2IX1 A;  3VR3 A;  2WB1 B;  2EYP A;  2FJ2 A;  5CV9 A;  2PYK A;  3CU7 A;  4CJ0 B;  1SE4 A;  2KJX A;  3LWU A;  2F0T A;  5I9P A;  4FXD A;  5NUC A;  1ET6 A;  1DON A;  1ESR A;  4FF1 A;  2MHV A;  3QOL A;  5BN3 A;  4O42 A;  2HDM A;  1Z6H A;  4Q0F A;  3K5M A;  2F0S A;  3Q24 A;  1SE2 A;  2F4I A;  4DFA A;  2NN6 I;  4DNT B;  1WTO A;  1LLR D;  4YIJ A;  2SOB A;  3FRP B;  3HOW B;  1EWH A;  3LNN A;  4JBW A;  5IOD A;  4KV6 A;  3S2D B;  1DD2 A;  3PUV A;  3NSW A;  4R9W A;  4RWS C;  4DAP A;  4QCL A;  2EY2 A;  2L0C A;  3MWY W;  2F0I A;  2X6L A;  2KEE A;  4A93 B;  1FR3 A;  2BE5 C;  1LO5 D;  3TZU A;  1IW7 C;  2KHS A;  3TDQ A;  3H3V C;  2RSO A;  2PCF B;  1FGB D;  5ELD A;  1EQT A;  2Z1C A;  3VA5 A;  4H7B A;  3QIA A;  4GZY C;  1GUS A;  1S5D D;  3NQT A;  1WD1 A;  3J80 E;  3P75 A;  4NP5 A;  1S5F D;  3SK6 A;  1T5X D;  2BDO A;  2XNA C;  4KD3 A;  1EFI D;  2EDG A;  4KY5 A;  2NVQ B;  5J1Z A;  3CKI B;  4S3S A;  2QCP X;  2RBM A;  2EYO A;  3ITP A;  2EE1 A;  1F9P A;  3SK5 A;  1H9M A;  3CHB D;  4U68 A;  1ET9 A;  2F0K A;  4NKL A;  2F0M A;  5IGF A;  1SJE D;  4C56 C;  2L4N A;  1F9R A;  3L3O C;  3MA2 B;  3NTH A;  5C6A A;  1D6E C;  1O7L A;  1I4H A;  4BA2 I;  2NVX B;  3GTP B;  1UNS A;  2WAC A;  1GHJ A;  2EJF C;  2KEC A;  5FO9 B;  4DN4 M;  4BBS B;  1PRT C;  3IFT A;  1JR0 D;  4BBR B;  1YNN C;  3RLF A;  1VMP A;  4K5V A;  1PFN A;  4OL7 A;  3GQB A;  5IOC A;  1RKN A;  1MSH A;  1U4P A;  3FPP A;  3J7A V;  3I73 A;  1G8Z D;  2O2L D;  3NTI A;  2NBF A;  4C2M B;  1FNV A;  1PZJ D;  1EIG A;  3E0J A;  1CQV A;  2F0D A;  2A6E D;  2A69 C;  2ZT9 C;  4FO2 A;  1ILQ A;  1EZ6 A;  4A3D B;  1CM9 A;  5JPN C;  3J81 L;  2JEA I;  3BS1 A;  3VYU A;  1I4Q A;  4XTC S;  1QCB D;  2WKC A;  4DK1 A;  4EVO A;  3GTO B;  1D1I A;  3Q6S A;  2HCC A;  2R3Z A;  5LL6 S;  1TY2 A;  4MIU A;  4XIG S;  2QEJ C;  3ERO A;  4MHE A;  4QIW B;  2LY7 A;  1SMY D;  2DNE A;  3OWF A;  5IGB A;  1U4L A;  5D3I B;  2R7Z B;  5J22 A;  1B9M A;  1D5M C;  2SEB D;  3G6J B;  5K36 H;  4HCE A;  5I6W A;  2Z4I A;  1I6V C;  3A56 A;  4N9P A;  2PZT A;  4BY1 B;  3PUW A;  4TKO B;  2M00 A;  1D2B A;  1YNN D;  1Q12 A;  1BCP D;  2PNR C;  1IKL A;  4A3G B;  4WJW A;  3A7L A;  1T5E A;  5HGT A;  2NB0 A;  2WP8 J;  2AQ3 B;  3OIQ A;  4C3J G;  1Y8P B;  4RHS A;  4DU9 A;  1HRJ A;  3M7G A;  1I6H B;  3KF8 A;  3M3Y B;  1LAC A;  1SNO A;  2CHB D;  4ZK9 B;  1MD2 D;  1EEF D;  2B2T C;  1OXT A;  2F0U A;  4PMB A;  4G7H C;  1F2M A;  3MXU A;  1FNU A;  2EYJ A;  4CHT B;  1I4X A;  2QIL A;  3MTS A;  2KCN A;  3U9O A;  1HFN A;  2XSC A;  2JA7 B;  1HTP A;  4RGM A;  3R8B A;  3GP7 A;  3K5N A;  3H91 A;  4F88 A;  5LHY 1;  1V1P A;  1XX8 A;  1PTO D;  1B2T A;  4QUC A;  4JK1 C;  1JCK B;  2ZXO A;  2QKI C;  2EYF A;  1J8I A;  5EPK A;  3DHQ A;  3TP7 A;  3FPU B;  3QB3 A;  3TP6 A;  4DNR B;  4B08 A;  4HED A;  3C2P A;  3P1H A;  4HSV A;  3M7N A;  3ONA B;  4DXF A;  1X32 A;  2B2W C;  2HUG A;  3SK4 A;  4ILW A;  2LMC B;  3NHH A;  3HP3 A;  3I70 A;  1LAB A;  3DUZ A;  2EY5 A;  3C46 A;  2H1E A;  1ENA A;  5ELE A;  5E1F A;  4HMI A;  3EA6 A;  3PMF A;  5ELC A;  1ZXT A;  5G3L D;  1SYC A;  5D14 A;  3HGB A;  4K6D A;  1DJR D;  1SAP A;  1GHK A;  2NTT A;  3MEH A;  4X3U A;  2IPK D;  5C0X I;  1HTL D;  1M8A A;  1SNC A;  1PTO C;  3GTL B;  3IL8 A;  2Q8R E;  2OEO A;  3I4M B;  5CBE E;  2WV6 D;  1SE3 A;  1J9O A;  5EGT A;  1TWF B;  1SNQ A;  4I7Z C;  3DWP A;  3RD4 A;  2FHT A;  3H94 A;  4KJN A;  4IQZ A;  1U9R A;  5T1I A;  3OWE B;  1OO9 B;  3BVZ A;  3RZO B;  5JVH 3;  1A6X A;  5ELF A;  3L7Z C;  1F2Y A;  4FVM A;  1BNZ A;  1HHV A;  3AU7 A;  1HUN A;  5FOB B;  1DXM A;  1EY8 A;  2RKS A;  1L0X B;  2K01 A;  1LTA D;  1ILP A;  4LK1 C;  3JAM L;  3DM1 A;  4BWG B;  1RD9 D;  3OOC A;  1VCI A;  2MUY A;  3C1F A;  1B1Z A;  2E74 C;  2MP1 A;  1EYD A;  1B53 A;  1SYE A;  2F0Q A;  4ZUJ A;  1KDA A;  2JSO A;  2K04 A;  1IYV A;  2L11 A;  4E6I A;  1YNJ C;  2R93 B;  4HAE A;  1CHP D;  1BF4 A;  5A35 A;  2M9V A;  4KY6 A;  4KN4 C;  4XQJ A;  4B9W A;  2F0V A;  4XYQ A;  2PZU A;  2RVL A;  3NBI A;  2VUM B;  3QWN A;  4KN7 C;  3HS0 C;  4ZKC B;  2F0J A;  3I4N B;  4A3B B;  3LWE A;  4CBV A;  5JPM C;  2WIN B;  2XIW A;  4CJ2 C;  1OXU A;  5CV6 A;  3I8Z A;  4C3I B;  3H09 A;  4IUU A;  2KOL A;  3BDO A;  3NPP A;  2NTS A;  2A68 C;  5EPJ A;  2AUJ D;  4X3S A;  3K57 A;  1SJH D;  4IUV A;  2J7Z A;  3EJI A;  3P7J A;  3OIP A;  2I46 A;  1TS2 A;  5JEA H;  4XYO A;  4PNY A;  2SNS A;  3HOU B;  3K5O A;  1QOH A;  3RUZ A;  2V4D A;  4K5W A;  4P2C B;  2JA8 B;  4RA8 A;  2WKD A;  1STG A;  1DCZ A;  3HZX A;  1WVL A;  4OO1 I;  5C0X G;  3J7A F;  4FF3 A;  3T4A C;  3OMG A;  1QE6 A;  4TSS A;  1AEX A;  1KNA A;  3VYT A;  3IFD A;  4FF2 A;  4EQN A;  4J6H A;  4IUQ A;  2FFK B;  3Q23 A;  1D5X C;  5FLX L;  1B3A A;  1D5Z C;  1BOS A;  5KGU A;  5DM6 3;  3K58 A;  4CKC A;  3Q22 A;  3GTQ B;  3S1N B;  4I65 A;  3D4R A;  3GV6 A;  3I90 A;  2F3V A;  4RH6 A;  1CZG A;  1SMY C;  3D8G A;  3O13 A;  4OO1 H;  2D62 A;  3AMU A;  1PMR A;  4HTH A;  1EY9 A;  2NVY B;  3A8I E;  4QF4 A;  3ND8 A;  4KKS A;  2F03 A;  4KD4 A;  5C5M A;  2B8G A;  1Q1E A;  5AFW A;  5M5X B;  2F0L A;  2PQE A;  2E2J B;  5K36 G;  5I6Y A;  1TU2 B;  1STB A;  3X3M A;  4OO1 G;  2F0G A;  4KTA A;  4TQU S;  5JAV A;  2N55 A;  1WD0 A;  3BVM A;  2MGS A;  2LKV A;  1ENC A;  1S5C D;  2R92 B;  5CGK A;  3SDZ A;  1E2W A;  1EU4 A;  1EY0 A;  2C9O A;  2JEB I;  1TQO A;  4RAU C;  2FIN B;  4A3E B;  1Y8O B;  4K6L A;  2JYO A;  1EL0 A;  1XYI A;  2K33 A;  4EGV A;  3A55 A;  4WOR A;  4H0L C;  3S1R B;  1ZYR D;  1PZI D;  2A69 D;  4U67 3;  3ND9 A;  1TWC B;  1QG7 A;  3MFY A;  3D6C A;  1B44 D;  1PZK D;  3KLS X;  3TSS A;  3V2T A;  5T1G A;  5EKL A;  2NYZ D;  1SND A;  4DA2 A;  3NTK A;  2Z8L A;  1AW7 A;  1HA5 A;  1O80 A;  2IT1 A;  3RZD B;  1DOK A;  3OSO A;  1SNP A;  3NWT A;  5E3F A;  4NDX A;  1GXD C;  1HXY D;  4C3I G;  2K03 A;  3EFX D;  2B39 A;  3GTG B;  2G9D A;  1JQY D;  3KUP A;  4J1M A;  2E2D C;  4F7X A;  4ZUI A;  5C3X A;  2A68 D;  3F2U A;  1E2Z A;  4Q5V A;  1Y69 U;  2JE6 I;  3NXW A;  3IAY A;  2KUM A;  1RTO A;  3C1E A;  2RDF A;  2EYH A;  3L9A X;  4FNF A;  3FKI B;  4DXG A;  1HQM C;  4ZQ3 A;  4QMG A;  2HQE A;  4OHJ A;  3FEW X;  1GUW A;  2JXM B;  1GUO A;  1JOO A;  3OW7 A;  4ZYS A;  4CJ1 B;  2BOS A;  2R6G A;  4IFD J;  1JWM D;  1PDQ A;  1WTW A;  1CZW A;  2J0T D;  1PTO F;  2BA0 A;  2KED A;  5CMD A;  1Z7T A;  1X3Q A;  2CW0 D;  3KBG A;  4RCN A;  1JC7 A;  2EJG C;  2O5J C;  3D6W A;  2F0N A;  4CKB A;  5KYI A;  3T13 A;  1K8M A;  1BO0 A;  2O4X A;  1O7Y A;  3QJY A;  4DF7 A;  2F1M A;  2K1B A;  5M9O A;  1F9Q A;  2L5T A;  1X3P A;  3N6R A;  1PTO H;  1PLF A;  4PMC A;  2L9H A;  2TMP A;  1RCV D;  3VR6 A;  1IW7 D;  2R61 A;  3MXN A;  3K59 A;  4G7Z C;  3HEJ A;  2EZV A;  2F3W A;  1PFB A;  1OXV A;  2L12 A;  1M4V A;  1BXT A;  4IUN A;  1CA5 A;  4A3I B;  3X3N A;  3D4D A;  2D5D A;  2E76 C;  2RDH A;  1Y1W B;  1GUT A;  1SDF A;  1KDC A;  2K32 A;  1WCM B;  4PQX A;  4RGT A;  1G6Z A;  3A8J E;  1OXS C;  1LTB D;  3I91 A;  2IL8 A;  1O7Z A;  1W6J A;  5CV5 A;  1I3Q B;  5IIF A;  1KNE A;  2AWO A;  2A6H D;  4RHR A;  1U4R A;  4C3H B;  4Z9C B;  4AYB B;  3T56 B;  5C4J B;  5CBA E;  4FXK C;  4RGN A;  2VB3 X;  4XQQ A;  2C5C A;  1A3U A;  3WDN A;  1JWU D;  3DWA A;  4M8A A;  3NBH A;  4N9T A;  1NSN S;  1PXU A;  1STY A;  4G4K A;  4DGZ A;  3MVV A;  3R2I A;  1MSG A;  5C44 B;  1O78 A;  1Y1V B;  1EYC A;  1UEA B;  5BN5 A;  3J7Y W;  1QNK A;  3DWQ A;  3K7A B;  1K8O A;  1ZYR C;  4G7O C;  1WTX A;  4X3K A;  3RMH A;  2RQX A;  1EYA A;  3MXP A;  2AUK A;  1LTS D;  3I4L A;  1A2U A;  4DAV A;  1SSO A;  4BY7 B;  5J39 A;  1XWE A;  3NWS A;  2VNU D;  1QWY A;  4LMQ D;  2F0H A;  3V05 A;  1SYB A;  3R3O A;  4KK7 A;  1G29 1;  4HN7 A;  4R8N A;  3S9W A;  3DXJ C;  1KTK A;  2AQ2 B;  1E0B A;  5KIX A;  1TWA B;  2E2H B;  4IZ8 A;  4IUP A;  3NQI A;  4V19 0;  3KK7 A;  2EPB A;  4KKU A;  5C4Z A;  3S17 B;  3K5L A;  1XXG A;  3SXH A;  1TY0 A;  4K2L A;  1TKW B;  1EY5 A;  2EOT A;  2FMC A;  1WTV A;  1RF2 D;  3FVQ A;  1ML0 D;  5FO7 B;  3NP8 A;  3NUC A;  1JOK A;  1TS5 A;  3W3A A;  1GUG A;  3J81 E;  2PPB C;  2BCO A;  4KKT A;  1S5E D;  1B50 A;  1A3V A;  5IGC A;  1NR4 A;  1ROD A;  1AP0 A;  2HDL A;  3GO5 A;  1ENF A;  4IAL A;  1R4P B;  2B2W A;  2EYM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...