2EYHA

Crystal structure of staphylococcal nuclease mutant t62s
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
135
structure length
135
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFSKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Threonine mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Staphylococcal nuclease
total genus 38
structure length 135
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2005-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2eyhA00
5C5LA 1KDBA 2SNMA 2F0PA 4KJOA 2F0OA 3TP5A 4F7XA 5IODA 5KGUA 4NP5A 1EQVA 4PMBA 4E6IA 1EYDA 5J22A 2OEOA 1STGA 3VA5A 4K5VA 2EYLA 5IGGA 1SYEA 2F0KA 1F2MA 2PZTA 4NDXA 5EGTA 4QB4A 3SK5A 5C6AA 4KTAA 2EYOA 3RUZA 1JORA 2F0EA 4N9TA 3SXHA 4KY6A 5C3XA 3HEJA 1JOOA 5DAUA 3EJIA 5CR3A 4EQOA 4QF4A 1KDCA 3DHQA 4DFAA 1TT2A 2EY6A 5KRUA 4N9PA 3NK9A 3MZ5A 4K2LA 4DGZA 2F0WA 2F0FA 4LAAA 1TR5A 2F0UA 2PW5A 2KQ3A 2F0JA 4KD4A 3QB3A 4PMCA 4HMIA 4MIUA 3S9WA 3NUCA 4IALA 5CV4A 3U9OA 2RDFA 5IGCA 1EY9A 2KHSA 5IGBA 3T13A 1EY4A 2EY5A 3ITPA 1KABA 4G57A 1EYAA 4ZQ3A 1F2YA 4KD3A 1AEXA 3D8GA 4HMJA 1A2TA 1A3VA 4ZUJA 2F3VA 5ISRA 3EVQA 3SK8A 1EYCA 5C3WA 5CV7A 1SYBA 5IOCA 4K14A 5I9OA 1A3UA 2OXPA 2PZUA 5EKLA 4KV6A 3ERQA 5CGKA 1U9RA 3BDCA 5I9PA 1ENCA 2EYFA 2M00A 1JOQA 3V2TA 5CV5A 5M9OA 4IUNA 2RBMA 5IGDA 4B9XA 2EYPA 3TP8A 2WACA 3BDLA 5KYLA 5CV6A 1EY8A 3NQTA 4I65A 3NP8A 4B9WA 1ENAA 4EQPA 3D6CA 2F0IA 3TMEA 2EYJA 2F0DA 4RKBA 3SK4A 1STYA 5IIFA 4HTHA 1EY7A 1KAAA 1KDAA 3NHHA 4DF7A 5KIXA 4KHVA 1SNQA 3D4DA 2QDBA 4IZ8A 5CV8A 2EXZA 3QOLA 4K2KA 4J1MA 3MEHA 4KY5A 1SNMA 1SNCA 5DEHA 5IGEA 5JAVA 5C4HA 1NUCA 5I6YA 5I6WA 1A2UA 1TQOA 2EYHA 2RKSA 4F8MA 1SNDA 3HZXA 4TRDA 3OMGA 2F0GA 2EYMA 1IHZA 3PMFA 2F3WA 3SR1A 1EZ8A 3MVVA 4ODGA 5EKKA 2PQEA 1RKNA 2SOBA 5NUCA 5KYIA 4ME5A 3SK6A 5HURA 1SYCA 5JOBA 3TP7A 4EVOA 5E3FA 4WRDA 3P75A 2HQEA 3P1HA 4K8JA 1A3TA 4H7BA 4K5XA 3C1FA 4QMGA 4RKLA 2F0LA 1JOKA 1EY6A 1EZ6A 2EY2A 1SYGA 5E1FA 2LKVA 4EQNA 2OF1A 4KJNA 2F0SA 3QOJA 5F2DA 3SHLA 2F0HA 3DMUA 5IGFA 4DU9A 5K5PA 2NUCA 2F0NA 4NMZA 4K6DA 4ZUIA 3T16A 1EY5A 4J6HA 5CC4A 2F0VA 1II3A 1SYDA 2PYKA 3H6MA 1SNOA 4WORA 5C5MA 1SNPA 5C4ZA 4K5WA 2EY1A 2PZWA 3MHBA 3MXPA 4YIJA 3LX0A 2F0MA 3NXWA 3EROA 3OSOA 5J39A 4KY7A 3C1EA 2PW7A 1NSNS 3OWFA 2ENBA 4K8IA 4ID6A 4NKLA 1EY0A 2O4XA 2SNSA 3D4WA 5CV9A 3TP6A 1SYFA 5J1ZA 3E5SA 1STHA 1STAA 4S3SA 1F2ZA 2F0QA 1STNA 5KEEA 2F0TA 1STBA 5HGTA 3OMCA 4R8NA 4PNYA 3R3OA 4OL7A
chains in the Genus database with same CATH superfamily
4OX9L 3HOUG 4IPHA 3RZOH 2WINB 4LFBL 2CWAA 2JA8B 2YV5A 1OXVA 3DM3A 1A63A 4CKCA 1F2MA 4OWWB 4DV0L 1WFQA 1Q7YC 4HR7B 3ICEA 4JK1C 5C6AA 1P8LA 2A6ED 2K5WA 5IYBH 1WI5A 3DHQA 1XNRQ 1ML0D 1GUTA 4DK3C 2K52A 2F0WA 3H09A 4BXXH 4A3KH 4CGYB 1LTBD 1XNQQ 1EY9A 1U4MA 1SR3A 3ITPA 2CW0D 1KABA 2FHTA 1TVXA 1PXUA 2VUMG 2R3ZA 1E22A 5ELFA 4F88A 3IAYA 4CJ0B 1FD7D 4RH6A 2JXMB 3GTQH 4IUUA 2F4IA 3CF5A 4QL5A 1YI2A 5I9PA 1CTMA 1FR3A 3GTPB 2VQFQ 4EGVA 1Y1VG 1FYCA 2EYPA 3TP8A 1U4RA 3M4OB 1HR0Q 3UDXA 2PNHA 1EWHA 1QG7A 2NN6I 2RSOA 2OTLA 4JI6L 2B2VC 1AH9A 1HCZA 5JVG3 4OWXB 3BZKA 2EYHA 1TQOA 2E74C 4ME3A 1VQPA 1XPRA 2BDNA 2BCOA 4GNXA 1BNZA 1BR9A 1C48A 1CM9A 3BS1A 1V1PB 3ZJYC 4X65Q 4ZCKA 2JN4A 1TWGB 4C3HB 5J3BA 1ESFA 4OX9Q 3T4AC 4XTCS 4CKBA 1IW7D 2WFWA 3UE1A 2F0NA 3CMEA 4K6DA 3I4NG 1VQEA 2K32A 4YHHL 1SYDA 3NENA 2GVAA 4FDBA 1CK1A 4MTNA 5COYA 1S5DD 1HNWL 1PH5A 3U9SA 1VQCA 1O7YA 1N36Q 4A3BH 4K8IA 1FVIA 1F2ZA 5D65A 2I07B 1STBA 2A1AA 4X3KA 3HOVB 3QR8A 4KJOA 4DR6L 4F87A 4FO2A 3NELA 1LT3D 3J81c 1TWFB 4IJLA 4R4TA 2PQAA 5ELDA 4AQYL 1V1PA 2WKCA 4Z9CB 2PZTA 4NDXA 1BKBA 1KQSA 3RUZA 1TS2A 4A3FB 4H13C 3EJIA 5JJKA 3N52A 1HNWQ 1U5KA 2N8NA 2G9DA 1VQ4A 3Q8DA 4R4QA 3OPOA 1SJED 4XQNA 4PZ6A 1VQ9A 5C4XB 3U9OA 3BVGA 4LF6Q 2RDHA 1NJIC 2JEBI 2K6AA 3A7LA 4A4IA 1D2BA 4JI3L 3S15H 3K5OA 1FL0A 2JQOA 2ZTEA 3TS0A 5IOCA 1IYJB 5A35A 4XQJA 3GTPH 4MZ9A 2K5HA 2EYFA 2L5TA 1PYWD 2Z4HA 1SMXA 4OEMB 4GLAC 3HOZB 3OW7A 1OXTA 1BF4A 1EOTA 1H9SA 1XNQL 4A3GH 4IFDH 1RJTA 3K6OA 4RKBA 1PH8A 3P7JA 2EPBA 1B4OA 3VYSA 2XTIA 5DEHA 1JICA 4A3JB 1LABA 3M4QA 5C4HA 1NUCA 3PSIA 2I0QA 2ZT9C 1A2UA 1MGSA 1EEID 3OMGA 3SE0A 4UHVA 3K57A 1H9JA 4IOCA 5EKKA 5EKIA 4FVMA 2SOBA 2KEEA 2XNAC 4C3HH 3TP7A 1F2LA 2WB1E 4RHRA 4FF3A 3I70A 1A3TA 3C1FA 3NTKA 4LF6L 1Q1BA 1EY6A 4BY7G 3G48A 5IT9E 4EQNA 1EWIA 1HPCA 3PO3G 2Z8LA 2F0VA 1VMPA 3NSWA 3FMCA 1VQMA 1FGBD 1ZXTA 1K0SA 3DWAA 2PI2A 3CC2A 1O7LA 1PTOD 4A93B 2RA4A 4KY7A 2R92G 1YZ6A 2KECA 2O4XA 1EUJA 1Y1WH 1S5CD 2DY8A 1H9MA 4FF1A 5KNCA 5IODA 4LFBQ 4EQ5A 1ZEQX 2HQLA 2OEOA 2BH2A 1U4LA 3S14H 2UXCQ 1QILA 3K80C 5FJ8H 2ASBA 1OXXK 1PZKD 4BXXG 1XNRL 4K0KL 1BCPD 1KIXA 3OWEB 2R92H 1FGUA 4QF4A 1SAPA 4FXGC 3CU7A 3NWSA 4O2DA 3S9WA 2F0JA 1V8QA 4R9WA 4HMIA 4MIUA 3T56B 3UI2A 2Z1CA 2E2IH 2R7ZH 1GD7A 1AP0A 3GTKB 3A54A 3T1YQ 4QIWB 5LMUQ 4HEDA 4B3RL 1IXRA 4DV6L 3VYUA 5FJ8G 4GKJL 3A8IE 1N36L 2OTJA 3QIAA 2GN5A 4R4IA 1HUMA 4RGOS 5KYLA 4HSPA 2L11A 5C44H 5EAYA 4LF7Q 4DNRB 2E76C 4TSSA 4M8AA 3TMEA 1ET9A 2A68D 1CA6A 2V1CC 4P71A 1RTOA 2EXZA 5FO7B 4J8QA 3LGJA 1HH2P 1A0IA 1YBYA 1W6JA 2DNEA 2PQEA 4OIJA 3SK6A 1X3PA 5E7NA 4Y7NB 1WD0A 3JAMi 2JA8G 4K5XA 2ES2A 2F0LA 3CCEA 2QCPX 3QOJA 4L5RC 3OTOQ 3HOYH 2K04A 1EY5A 2L0CA 3UE0A 1GM5A 1IBKL 4K5WA 5I2XA 1CHQD 1LTGD 2YTXA 3MXPA 2NVXH 2FMCA 3E3XA 1EOVA 2YU9H 1NTGA 5CV9A 4BBSG 1VCIA 2J7ZA 3KJPA 1UE1A 3E0EA 3CXCA 1K8AC 3CC4A 5IYDH 4JV5Q 4F7XA 1AZPA 1SEBD 3UDFA 4GKKQ 3GTMH 2ZJRA 4BY1H 4DR7L 4XT1B 4YY3Q 3TDQA 1QCBD 3OIQA 1HNZQ 1PFMA 3D4RA 1TY2A 1UE7A 4TQUS 2KCTA 2F0EA 2IX0A 1BCPF 2MP1A 3OHXC 1J9OA 1QUQA 1NR4A 2E2JH 5FK9C 2KA7A 3KDFB 4BBSH 5IWAL 4FYDA 1E24A 1LM0A 1VQBA 3QWNA 2XIWA 1HJPA 2UU9L 5IGCA 2Y0SG 2JA6G 4IUQA 1EIHA 4HCSA 3VYTA 4B08A 1E2WA 5GQOA 3K59A 3AEVA 2RVLA 3PO2H 4C3IG 1PZJD 3H3VI 5I9OA 3D0FA 1VQLA 1PTOF 3OOCA 1PV4A 4C3HG 4JBMA 4IUNA 2RBMA 1I4PA 4DUZL 5M5WB 4NB3A 1XMOL 1BQQT 2WACA 2F03A 1EQRA 1KTKA 4B9WA 1I4HA 3VYRA 2WB1B 1E2VA 1HZAA 2Z9HA 5GADC 3HKZB 1HNZL 2XWJB 1CHPD 2X6GA 4A76A 1C7YA 2NB0A 2R6GA 1SN8A 1S72A 4F8MA 3GTJB 2KCCA 4A3LG 1H9SB 4JBJA 3S1NB 1SE2A 4ZYSA 4DR1L 3TN2A 1HRJA 1N33Q 2DJFC 2IX1A 3HOWB 3I4MB 2HIVA 3PF5A 2B2YA 2I5LX 5NUCA 1KNAA 2MNAA 3PV0A 4FP5D 5E3FA 4WRDA 2HQEA 2PO4A 3M3YB 4PZ7A 2EZVA 2OF1A 2Y0SE 4XIGS 3KJOA 1NR2A 4L6TB 2ZJQA 2NVQB 2ZTDA 3BJUA 4N8X1 2K50A 2PCFB 3R2TA 1CT1D 2JA5H 4DR4L 5LMNQ 1NAPA 1HNXQ 2AQ1B 3OSOA 1VQ5A 1BBWA 2MQHA 4JI4Q 1FNUA 3H0GG 5M3MH 2F0QA 4CJ2C 1N8RC 1VMCA 1CKOA 3HFZB 1KDBA 3GTMB 4I7ZC 1Y14B 3H91A 4DV5Q 2UUBL 3J80c 3K7AB 4HJ9A 4JCVE 2ID0A 1BOSA 2NWGA 2RF4A 4H02A 4QB4A 2L12A 3F2DA 4LF4L 1W2BA 2EYOA 4JG2A 5FLXc 1YEZA 4N9TA 1I94L 1QWYA 1HTLD 1KDCA 1TT2A 2EY6A 2G9HD 5KRUA 3SEBA 1AZQA 3W2DA 1HA6A 3J81E 2KQ3A 4R1JA 3IKJA 3MC0B 1B8AA 5FO9B 1PLFA 2RCNA 1LTSD 5A2QL 4LF8L 3NTIA 4A3JG 2NTSA 4HIOA 4A3MB 2K1BA 4B3RQ 1WTVA 3TRZA 3ERSX 1TY0A 1TU2B 5C3WA 1SYBA 3GQBA 1WTRA 2OXPA 4LF4Q 2YTVA 1WCMH 2K75A 1QB5D 2L9HA 4P75A 4NXML 1IKMA 4CHTB 1TWFH 4OONA 4BY7B 1JMCA 3KF8A 1UEAB 1HUNA 3BYTB 3A7AB 1EY8A 3J80i 2VL6A 2A74C 5JEAH 5IYBG 3K0YA 1ENAA 3E6ZX 4DV7Q 3EN2A 2BDOA 2DNCA 1GUWA 2BE5C 1SNQA 1QZHA 1O80A 2ICIA 1SNMA 2OQ0A 2IL8A 4MN3A 4JI5L 1HNXL 5IP9H 1PRTB 1CI3M 3SR1A 4C3JH 1VQNA 1EU4A 1LT4D 2B2YC 2IJ0A 3D31A 4LF5L 3GTOH 2EIFA 4ME5A 2VB2X 5IYCG 3PIO3 4RHSA 3P75A 4ULLA 2F1MA 2NVQH 1Y69U 3LWUA 2ATWA 1Z47A 4OXPA 4L63B 1J5EQ 3MA2B 1A62A 5C4ZA 4OIKA 3IFTA 2MPMA 5FOBB 5JEAJ 2LXKA 2EY1A 2N88A 3HOZH 3LX0A 4OHJA 5IP9G 1B7YB 2OCEA 3BG3A 1STHA 5KEEA 3D3RA 1I4RA 5KNDA 1GHJA 1KC8C 1EQVA 4QIWE 1WVLA 4DN4M 3BZDB 3VA5A 3CKIB 4GS3A 1B2TA 4R4CA 1VQFA 3BVZA 2MGSA 2AKWB 3K5LA 3SK5A 3NPPA 1YNXA 1SDFA 1ILPA 4RWSC 1U0LA 1CQFA 2EJMA 1JJCB 2JP1A 4XT3B 3FEWX 2N3SA 4ZLTF 5AJ3Q 3NQIA 3CCMA 1CSQA 1CA5A 1QVFA 1MBYA 4LUVA 3I8ZA 4JI2Q 4IO9A 4JI7Q 3J80E 2CQAA 3A8JE 4ZRZA 3HOUH 2ZXOA 4LFAQ 1STEA 4ZQ3A 3RD4A 1LTID 3D8GA 3H94A 2XWBB 3WDNA 2E5LQ 1VF5C 4QY7A 2HUGA 4RCOA 2K28A 1IYVA 2H1EA 5C0XI 1SSOA 2DN8A 1ENCA 5CV5A 3F1ZA 5IGDA 2A8VA 2QILA 3DXJC 1PYSB 2B2UA 2WAQE 3IFDA 2CHBD 3G6JB 3VR3A 4A3BB 1N9WA 1PH6A 3L2PA 1S5ED 5GROA 3NHHA 3N6RA 3CPFA 5M5XH 3MEHA 3Q22A 4JI1L 4WFN3 2H4OA 2UUBQ 1N32Q 3G6EA 5C0XH 4DUYL 1E1OA 5IT9L 1IHZA 3K81C 4NPSA 1ZYRD 4OO1I 2QF7A 1YJNA 2E2IB 5D3IB 3T1HQ 3ND9A 1RKNA 5HURA 2E2DC 4N8FA 3MXNA 1T5EA 1SXTA 2BH8A 2SDFA 1JR0D 1PH4A 3S1RH 3E9IA 3PQIA 5K5PA 4TVAB 4GOPB 2K7VA 1LACA 3TSSA 1PVOA 1G8ZD 4HJ7A 3PCOB 5GAEC 3FKIH 4OO1H 3DM1A 3W5OA 3KLSX 1E2ZA 4DV3Q 4RG1A 1SE4A 1PH7A 4B3ML 3M7GA 3P20A 1K73C 2V4DA 4JPBW 1UE6A 2K01A 1O7ZA 1TWAB 1KLGD 5J22A 5ELCA 3JC66 2CH4A 1WCMG 3MXNB 1HZCA 2EYLA 2LMCB 2N49A 4A3GB 3F2UA 3SDZA 3FKIG 1SLJA 2K05A 4Y7NH 5M3FB 1TKWB 2VY3A 1LV9A 5ELOA 1K8OA 1RCVD 4A3JH 2NVYB 4UY8C 1VQAA 3E9HA 1O78A 2MO1A 4BBRG 4DGZA 1XMOQ 1MKHA 1XPOA 4B3MQ 2F0FA 1TR5A 1I3QH 1WTPA 1L0XB 3QB3A 3HKZG 5GAHC 2RDFA 1BUVT 2VS1A 1IBLQ 1I4QA 4IURA 1VQOA 4DR3L 4OWTB 4GZYC 4HJ5A 2BOSA 3KF6A 3MXGA 2A6EC 5FLMG 3I4MG 3GDEA 4PQXA 2WIIB 3J81j 2B63H 1EYCA 4YWLA 5JPNC 4JOIA 2PMZB 4ZKBB 3DWPA 4XYOA 5CYUA 3U58A 4KHPL 2B2TA 4BY1B 2ZXRA 2XVSA 3S1MH 5T1IA 3J7A5 1BBXC 4A75A 3GP7A 4JBWA 4J15A 4XDXA 1TWHH 1Y1WB 4MNOA 4GN4B 4IUTA 4KHVA 4M1UB 4JI0Q 1B3QA 1LTLA 4IZ8A 4LMQD 1EIYB 3QOLA 4JI0L 4K2KA 3S16H 3X3NA 5IE8A 4O42A 2JEAI 3HKSA 4K6LA 2B8FA 1SNDA 1S5BD 4G7ZC 2EJGC 3KK7A 1S5FD 3S14B 3BU2A 4V0BA 4PV1C 5LL6S 1X3GA 5DM63 2K4KA 3HS0C 1K83B 4FF2A 4HSVA 1IBMQ 5C3EG 2A5HA 2B29A 1QVGA 1F77A 4XQQA 2R93B 5G3LF 3DMUA 4DPGA 4IN3A 1UAPA 3KDFA 3W1BA 3FDTA 5D3DA 4DV0Q 5M5WH 4V190 2WAQG 1JQYD 2A19A 1QOHA 3GTKH 3CRKC 1EU3A 5EBCA 3KLSA 1B3AA 2ENBA 2A69D 3CQZB 4KI0A 2SNSA 2Z6BA 3PUZA 5J1ZA 1AFPA 4H0LC 4DAYA 1B1ZA 1STNA 4JI2L 4X66L 1DCZA 1L1OA 3R3OA 1UNSA 3EIVA 3C2PA 1K3BC 3GTJH 1FNVA 2Z0SA 1EQTA 1JE4A 2KUMA 2ZM6L 2C35B 4X62L 4HJ8A 5C4JB 1UE5A 5C44B 1SYEA 1B9MA 1X9NA 2NN6G 5EGTA 5M3FH 3KLWA 3HOXG 4CDCC 4KK7A 1XWEA 3OW2A 1CKNA 1XPUA 2JA6H 3T53B 1I3QB 1Q46A 4PMCA 2DY7A 2P5ZX 3AMUA 1YIJA 4L5QA 1X55A 5CBEE 2L1BA 1KNEA 2WV6D 4DXFA 4A3KB 1PA6A 4RGTA 4GNXB 2RCFA 2B63B 1VDZA 2J4XA 3C3LA 2LY7A 3W1GA 1QNKA 1MSGA 1RF2D 3EBEA 1KL9A 2SEBD 2L55A 1X54A 4A3DH 1JWMD 1JOQA 1DM0B 1KRSA 3OIPA 2C5CA 2UXDL 2NVXB 4HIKA 1D8LA 1IBLL 2DJGC 1V1OA 4DR6Q 3AU7A 1L0YB 1EWCA 1SFOB 2RQXA 1Q1EA 1V9PA 1Y8OB 4KY5A 4X3SA 1SROA 1MD2D 4OGQC 3Q23A 4WJ4A 1PYBA 4PMWA 1XJVA 3G4SA 3M4YA 4KHPQ 4ODGA 1BBUA 5EBDA 5JVH3 2IT1A 1F9RA 1LO5D 3K5NA 1Y1VB 1TS4A 1TWGH 5F2DA 5IGFA 5FLXL 1PFNA 4UP8A 1CZGA 1GXDC 4J6HA 5LMNL 5AFWA 2D9UA 3F8TA 2BE5D 1VS0A 3CQZH 3CW2C 4XYQA 2F3IA 3PUYA 2QGQA 1D5XC 4ABNA 3PO2B 2JA5G 2A69C 1IBML 5C0XJ 2MUYA 1JB3A 1ICFB 4DA2A 4YCUA 1D7QA 3TP5A 4RA8A 5KGUA 3CCLA 5IT9c 2PI2E 3NEMA 4MHEA 4GN3B 4LFCQ 4P72A 5CMDA 1AW7A 3CCJA 2CKZB 4ALPA 1DGSA 1LTTD 2Z4IA 4CJ1B 5L37A 2FINB 3ULJA 4JVZA 4DUZQ 3HOWH 2Q8RE 1XXGA 1OXUA 1JT8A 3J7AF 2ZM6Q 5DM73 4BA1I 4R8IA 1VQ6A 1JWSD 1LT6D 1H9RA 1F2YA 4KD3A 4DAVA 4O0AA 3Q0AA 3S15B 4O1NA 4P74A 2PNRC 2HT1A 4IPCA 2PZUA 1PMRA 4DV1L 4U68A 5IY0A 1K9MC 1KXLA 2M00A 5I4DA 1PH2A 4NW2A 1HZBA 3GD7A 1X65A 2K14A 4KN4C 5BN5A 4IPGA 1JC7A 2VW9A 1SE8A 5M3MB 1KAAA 1G51A 2O5IC 1YHAA 2K03A 5C4XG 2QDBA 1MSHA 4ILWA 2JA7H 2CW0C 3FVQA 2HDMA 3T1YL 5I6WA 3NTHA 1GJXA 1T9HA 3S2HB 2AWNA 3K7AH 2VXWA 1X32A 2ICEC 2E8GA 1PRTD 3HOUB 4EVOA 4K8JA 3FP9A 1G6PA 1SRUA 1SYGA 1X3FA 4KKTA 4X62Q 2F0HA 3JAMc 4ZUIA 5IP7H 2KOLA 2QW7A 3HKZE 3U4VA 2BA0A 5BR8L 1R9TH 4A3MH 3BDOA 2PW7A 4IFDJ 2CVRA 2K33A 4QCLA 4A93H 5JJLA 3J7ZC 1K0RA 1STAA 3HRZC 2CCZA 1SE3A 2F0TA 1G2TA 2NN6H 1GVPA 2FMMA 3J81L 2Q2IA 1DONA 2F0PA 4UPAA 4E6IA 4DAYB 2VUMH 4AH6A 4JI6Q 3I2ZA 4DR7Q 4DR5Q 1XX8A 3PO3B 3I73A 2M2LA 3F2BA 4KTAA 2CQOA 1DOLA 4QQBX 2UXBL 3BVMA 2HCCA 5BR8Q 4BY1G 1WTQA 3PGZA 1V43A 4UP9A 5H1SE 2R92B 4G4KA 2F0UA 2YTYA 4JYAQ 3S24A 1HQMC 3A8KE 3KOJA 4QJFA 3GTOB 3TZDA 4G57A 3S17B 1EEFD 4X3TA 4U673 1CKNB 1Q3LA 1M90C 1F9QA 5FKAC 1A8VA 1HFGA 2F3VA 3GTQB 2K5NA 1PFSA 3I90A 4DV4L 3BDCA 5C3EB 5FLXE 1G291 2JSOA 3GTLH 3CCVA 3RMHA 3PUVA 3NQTA 1GO3E 3I4NB 4RFBA 5G3LD 5IIFA 1B44D 1EY7A 1IYUA 5ELEA 4B3SQ 2L4NA 5KYIA 4J1MA 1JE5A 3ER0A 3CCQA 1B53A 2OT2A 5I6YA 4DV1Q 2B3GA 2EYMA 3H3VH 1G91A 2XRSD 3HOVG 4HIMA 2PMZE 3V2TA 1AN8A 2MJ8A 2LKVA 4A3CH 4KJNA 4A3IG 5EPKA 4CKEA 1II3A 3H6MA 3V05A 4FF4A 4DV6Q 3L0OA 2EOTA 4LNQA 4DXGA 1NSNS 1X3QA 3KF6B 1C9OA 3E5SA 4S3SA 3HOVH 5C0XG 1XTCD 4LJZC 3H3VC 4LF9L 1PRTC 1PZID 3LWEA 5C5LA 3WOEA 1D5ZC 2RSNA 4DR2L 4LF7L 2B63G 4PMBA 4B3SL 5E4WC 2IHFA 3NWTA 4BBRH 4A3FH 5TSSA 3J81i 3S1QH 4AYBE 1LTRD 1V1QA 4KY6A 2UUAQ 3A5UA 5DAUA 5M5XB 1OTCA 4DFAA 3UDGA 5DLQE 5GAGC 3NK9A 4K2LA 4OO1G 5C4XH 1HZ9A 2Q2TA 4X65L 4Q5VA 3X3MA 3M85A 4BBSB 1DYQA 4IALA 5CV4A 3S17H 2GVBA 3STBC 3L7ZC 4DR2Q 1FJGL 2JYOA 4DR3Q 4HIDA 3OTOL 1AEXA 2KVMA 3I56A 2Q2UA 4YY3L 4ZUJA 1KRTA 4DV5L 2KBNA 2XGTA 1CQVA 1N34L 3L9AX 2KEDA 1N34Q 3MFYA 5C3EH 5K36G 2IX3A 4LK1C 3E0JA 3VR5A 3TQYA 1XMQL 3GTLB 2JE6I 1PH3A 3KUPA 3O13A 2O2LD 2WKDA 3RR5A 5IP7G 3RNUA 2AWOA 2FXQA 3AFQA 5AJ3L 2AQ2B 1WTOA 1EFID 4IJHA 3HP3A 1XYIA 3TZUA 1IBKQ 3K5MA 4LFCL 1TWAH 1SNCA 4JI8Q 1L1OB 2JA6B 4LUOA 3AYHB 5EQ0A 1SMYC 4APVA 1MJEA 1NBWA 3L3OC 2AQ3B 4QUCA 5IYDG 3AFPA 3I7FA 3M4PA 5T1GA 2Q8TA 2NVYH 1SJHD 2XN9C 2UU9Q 5JPMC 5LMUL 1RODA 3ZYYX 1VQKA 2WB1G 3STBD 4PG3A 4WORA 5JEAG 2F4VL 1A15A 4RAUC 2EQSA 2PZWA 1EFWA 3J80L 3NXWA 5J39A 5M5YH 2E2HH 1I94Q 2A73B 5CBAE 4C3JG 1YHBA 2ZJPA 1EIFA 4KMUC 3D4WA 5ELBA 4EQPA 1BXTA 4GOPA 1I6HB 4POGA 3HOWG 3MWYW 2IHEA 4YCWA 4IPDA 5HGQA 5DNFA 4X64L 4I7AA 1VQ8A 2AMCB 2KCMA 3S1QB 5IGGA 3S2DH 1RL2A 2QEXA 3FPUB 2VB3X 3NE5B 1I4GA 4FXDA 1X6OA 3I4LA 1QZGA 1JORA 3A0JA 1T5XD 1ET6A 3MZ5A 1YVCA 5EPJA 3WWVA 1ESRA 3MEFA 1DXMA 1F9SA 1RDPD 2R7ZB 2UUCL 2NYZD 4UDUC 1ASYA 1YHQA 2D62A 3A5ZB 3G71A 2Q2HA 4X64Q 1EYGA 4LFAL 4DV7L 2JA9A 2UXCL 3A74A 1IW7C 1A3VA 1E1TA 5ISRA 2R93H 2UUAL 1L2FA 3EVQA 3SK8A 2IPKD 4RGNA 3VA7A 2E5LL 4KV6A 5CGKA 1BO0A 1ENFA 1U9RA 3KYHC 1Q8IA 4A3EH 2L15A 5M9OA 2NZHA 3QO2A 2N78A 4LF5Q 2TSSA 3J7AV 4BY7H 4I65A 1JWUD 3PIPA 1M1KC 3D6CA 3GV3A 4A3IH 3HOYG 2EYJA 2IWHA 3SK4A 5BN3A 4ZKCB 4DF7A 5KIXA 5CV8A 4BA2I 1ONLA 4Y52H 5D14A 3TEHB 4A3MG 4POFA 2UXBQ 5LMNW 4CDEC 2RKSA 3RLOA 3VR2A 4GNXC 1Z9FA 4HAEA 1ASZA 1NNXA 5BN4A 3Q6SA 3T51B 2YYZA 3M9BA 4CDDC 1OO9B 1PHJA 2O5JC 3PUXA 1EZ6A 3CHBD 1WTXA 3SGIA 4P2CB 4A3DG 2FJ2A 4DU9A 1GUOA 4JI3Q 4NMZA 2NVTB 1K28A 2K5VA 4DR4Q 1MJCA 2HCIA 2LXJA 1NY4A 2E2HB 4IUVA 4FXKC 1GHKA 2F0MA 2PQAB 3EROA 2PPBC 5EJWA 1LLRD 3C1EA 2EE1A 4C56C 1YNJC 2TMPA 1I6HH 1XMQQ 3PUWA 1BCPB 2IY5B 4P73A 3K58A 1G2SA 4DNTB 2Y0SB 3JAME 4JYAL 4R8NA 2WP8J 2JA7B 1VQ7A 4OELB 2X6LA 1HFNA 1FJGQ 2IW3A 4HN7A 2J0TD 4C1NI 3UDIA 4DKAC 4C3IB 1W3SA 5KNBA 1UWVA 2F0KA 1R4PB 3GO5A 2F4VQ 2R7DA 3K0XA 1S3OA 3SXHA 4IUPA 1JOOA 4EQOA 4G7HC 4G7OC 2FFKB 3LNNA 4RMFA 1PTOB 2PW5A 1I5FA 1QUQB 2H5XA 1QE6A 5IGBA 3SVMA 4GKKL 3EFXD 1F9PA 1LUZA 2HD3A 4DAMA 1E0BA 3KBGA 1Y1VH 1HHVA 4ZAIA 2K5DA 4A3EB 2I5MX 3V96A 2ZXPA 4L5SA 3ERQA 3BYYB 3I55A 2EVBA 4XXEA 4B9XA 4WJ3M 3BDLA 1OXSC 4A3IB 4KKSA 5E4XA 3DUZA 4ZK9B 5JJZA 3PO3H 5LHY1 1IZ6A 2F0DA 1EQQA 3BZCA 1KDAA 4FNFA 1S40A 3VDYA 3D4DA 2A6HC 3B6YA 3FPPA 3S1NH 2AUKA 1CKMA 3I4MH 2JA8H 1B70B 2F0GA 4HCEA 1PDQA 3H0GB 3PMFA 3VR4A 1DD2A 5JOBA 5FLMH 4NXMQ 1Q8KA 1BVSA 3P1HA 4KN7C 4QMGA 3U50C 1JOKA 3DEPA 3AQQA 2I46A 2R61A 4LF8Q 2HDLA 2LFNA 2NUCA 4A3BG 2Q8IB 4AYBB 3I3CA 2RDGA 2VQEL 4B3TL 3MHBA 3NBHA 1K8MA 2AUJD 4JC0A 4YIJA 4K0KQ 2HIXA 1WTWA 2Z6KA 3OWFA 1J8IA 5IWAQ 1JJGA 4L8JA 1EY0A 3TP6A 2AHOB 3WOFA 1B9NA 1WTHA 2UUCQ 2CFMA 1J6QA 2QKIC 5ELNA 1VF7A 1Y8PB 4LUZA 2F0OA 1LT5D 4C3IH 2RHQB 4NP5A 3G7LA 1M8AA 3KLRA 1QVCA 4K5VA 4AQYQ 1Z6HA 1JCKB 1C0AA 2QEJC 2DGYA 4JI4L 3EA6A 1LTAD 1CUKA 3HEJA 4DV3L 3GV6A 5CR3A 4C1NK 1B50A 4N9PA 1QJOA 2D0PA 2MHVA 3S2HH 4LW1A 3R93A 5FO8B 3NUCA 3KFUA 2KENA 1Q12A 1D5MC 2A68C 1UUPA 3DEOA 2EDGA 1WCMB 5CV7A 4HJAA 3HG9A 3TBIB 4A3GG 1A3UA 4JI5Q 4IFDG 5EKLA 3CCUA 3CCSA 1Y8NB 1KHIA 4JOIC 1C8CA 4DNIA 4WJWA 1SMYD 5M3FG 2VNUD 1D6EC 4CDFC 2B2TC 3MTSA 3W3AA 1R9TB 1WD1A 1MHWC 1CZWA 4NXNL 4BBRB 4UAIA 3S1MB 4BWGB 2QDLA 3ONAB 2ZTCA 4DK0A 2B39A 4YHHQ 3PIP3 3H0GH 3S16B 1SBBB 4C3JB 3CAMA 4TRDA 2VUMB 3A55A 3HGBA 3T1HL 3MVVA 4H44C 4JW0A 5A2QE 3D6WA 3R8BA 1KLUD 1JB7A 1K8GA 4JV5L 3CD6A 1K83H 2EY2A 2EJFC 3RZDH 4X66Q 3SHLA 4BS9A 1GUSA 1IL8A 1PTOC 5CC4A 2PYKA 1YJWA 2QA4A 1SNOA 4GLVB 2NTTA 1Y1WG 2F52A 3I4OA 4A3CG 1Q90A 1XTDA 4QUFA 4YCVA 2NZ1D 4NKLA 1SYFA 3F2CA 2R7ZG 1YITA 3MFGA 1I50H 5HGTA 1DZ1A 1WYDA 2VQFL 4PNYA 1L1OC 3QJYA 4OL7A 1P16A 1FNWA 2LSSA 1K3RA 1EYDA 4JBKA 1R4QB 1H95A 4TKOB 4QGUA 1IL2A 1BCPC 1KD1C 3I4NH 3OYYA 4RGMA 5C4JH 3TS2A 3URYA 3DLLA 1GUGA 2XRQD 1GKHA 2WAQB 4RCNA 4X6AH 2I5HA 4PZ8A 1VQJA 3HOYB 1BDOA 4NXNQ 3DWQA 5CORA 2R7FA 1HXYD 4C2MH 3H15A 1IKLA 2KHIA 1ICWA 2KHSA 3T13A 2EY5A 1W6KA 1EYAA 1DOMA 1M4VA 3J7YW 2YU9B 4HMJA 2HHHQ 1G6ZA 4JI1Q 1N32L 5IYCH 3JAML 1Q81C 3ULPA 3AB9A 5C44G 1PFBA 5EPLA 2EXDA 3R2IA 2BA1A 2DUDA 4A3FG 1VQHA 3GTGB 1EIGA 4A3DB 2B2UC 1TWCH 3IL8A 5CV6A 1L0WA 2C9OA 3S2DB 3NP8A 2B2WC 1RIPA 1LYLA 5JJIA 1J5EL 2KJXA 3TREA 1HR0L 2F0IA 1STYA 4HTHA 1TS3A 4R4OA 1RTNA 1SFOH 2KCNA 4IOAA 5JAVA 5IGEA 4Q0FA 1Q82C 3FRPB 2RHSB 1CFMA 1O7IA 3EQLC 4JI8L 2G5DA 2GA4B 1Z7TA 3FHWA 1HTPA 2LS01 2JA7G 1SYCA 3NBHB 3RZDB 2K5QA 4RKLA 3S1RB 4H7BA 1HR0W 5E1FA 3HOZG 2F0SA 4IQZA 1TIID 1HQRD 3FKIB 5C5MA 5LL6X 4GLXA 4IFDI 1UEBA 4KHZA 3HOXH 2XSCA 1QNUA 2OWOA 2ALYB 1NMGA 2CWPA 4ID6A 1I50B 3U4ZA 1DOKA 1RD9D 3VR6A 2N55A 4JI7L 1VQIA 3OMCA 1VQDA 1ILQA 2SNMA 4AIMA 1ZKOA 1EL0A 2OQKA 1STGA 4DAPA 3PF4A 3RZOB 1HA5A 2JK8A 2HHHL 2VZAA 4A3EG 3KBXA 3CP0A 4EX5A 1A6XA 2D2CC 2A6HD 4DR5L 4DUYQ 5C3XA 1NCVA 3M3YH 2KHJA 1Q86C 4A93G 3IRBA 3QG1A 4C2MB 4DV2Q 1H9KA 4DV2L 4LAAA 2NVTH 3CRLC 4KD4A 1PRTF 5I2YA 4LF9Q 1U4PA 3PO2G 3RLFA 2JA5B 1KAWA 2NZOA 4X3UA 1JJ2A 1MI2A 1EY4A 2CH4W 2MFIA 1C4QA 5HY6A 4UP7A 2VQEQ 4B3TQ 3KF8B 3NBIA 3MXUA 2B8GA 3I91A 1RHPA 1A2TA 4YWMA 1X3EA 2JJQA 4CBVA 4YWKA 4K14A 1YNNC 3ULLA 1D1KA 1NE3A 2MO0A 3GTGH 4DV4Q 1VQGA 3RN5A 1TWCB 1GUNA 1MIUA 1ZYRC 1AE3A 2R93G 5M5YB 4DK6C 1D1IA 2E75C 2B2WA 1YJ9A 1TXYA 1TWHB 4AYBG 3M4OH 3RLNA 1GOZA 1S4ZA 2D5DA 3CC7A 1E3PA 2B2VA 3MAQA 3RN2A 3PIOA 4KLKA 1PTOH 3HZXA 4DK1A 2X69A 3C46A 2F3WA 4GKJQ 1EZ8A 1CSPA 2NBFA 5K36H 1NMFA 1WJJA 4DR1Q 1N33L 2D0OA 3ND8A 1YNND 1AE2A 3I72A 3K7UC 2UXDQ 2E2JB 4GN5A 1PH1A 1DJRD 3T16A 3HOXB 1I6VC 1SNPA 4MTKA 5M3MG 4L5TA 1X56A 4LWCA 1PH9A 3K8AA 3A56A 2Z6KC 3CCRA 2M9VA 3Q24A 4GOPC 3CPWA 1I4XA 3CMAA 1TS5A 4A3LH 1E7ZA 4KKUA 4A3KG 3M7NA 1YNJD 1WOCA
chains in the Genus database with same CATH topology
2WINB 2JA8B 1OXVA 4CKCA 1F2MA 4HR7B 4JK1C 5C6AA 2A6ED 2K5WA 3DHQA 1ML0D 1GUTA 2F0WA 3H09A 4CGYB 1LTBD 1EY9A 1U4MA 3ITPA 2CW0D 1KABA 2FHTA 1TVXA 1PXUA 2R3ZA 3IAYA 5ELFA 4F88A 4CJ0B 1FD7D 4RH6A 2JXMB 4IUUA 2F4IA 5I9PA 1CTMA 1FR3A 3GTPB 4EGVA 1FYCA 2EYPA 3TP8A 1U4RA 3M4OB 1EWHA 1QG7A 2NN6I 2RSOA 2B2VC 1HCZA 5JVG3 2EYHA 1TQOA 2E74C 2BDNA 2BCOA 1BNZA 1BR9A 1C48A 1CM9A 3BS1A 1V1PB 1TWGB 4C3HB 1ESFA 3T4AC 4XTCS 4CKBA 1IW7D 2F0NA 4K6DA 2K32A 1SYDA 1CK1A 5COYA 1S5DD 3U9SA 1O7YA 4K8IA 1F2ZA 5D65A 2I07B 1STBA 4X3KA 3HOVB 4KJOA 4F87A 4FO2A 1LT3D 1TWFB 5ELDA 1V1PA 2WKCA 4Z9CB 2PZTA 4NDXA 3RUZA 1TS2A 4A3FB 4H13C 3EJIA 3N52A 2G9DA 3OPOA 1SJED 4XQNA 5C4XB 3U9OA 3BVGA 2RDHA 2JEBI 2K6AA 3A7LA 1D2BA 3K5OA 5IOCA 5A35A 4XQJA 2EYFA 2L5TA 1PYWD 2Z4HA 3HOZB 1BF4A 3OW7A 1OXTA 1EOTA 1H9SA 4IFDH 1RJTA 3K6OA 4RKBA 3P7JA 2EPBA 1B4OA 3VYSA 5DEHA 1JICA 4A3JB 1LABA 5C4HA 1NUCA 2ZT9C 1A2UA 1MGSA 1EEID 3OMGA 3SE0A 3K57A 1H9JA 5EKKA 5EKIA 4FVMA 2SOBA 2KEEA 2XNAC 3TP7A 1F2LA 4RHRA 4FF3A 3I70A 1A3TA 3C1FA 3NTKA 1Q1BA 1EY6A 5IT9E 4EQNA 1HPCA 2Z8LA 2F0VA 1VMPA 3NSWA 3FMCA 1FGBD 1ZXTA 3DWAA 1O7LA 1PTOD 4A93B 2RA4A 4KY7A 2KECA 2O4XA 1S5CD 2DY8A 1H9MA 4FF1A 5KNCA 5IODA 1ZEQX 2OEOA 1U4LA 1QILA 1OXXK 1PZKD 1BCPD 3OWEB 4QF4A 1SAPA 4FXGC 3CU7A 3NWSA 3S9WA 2F0JA 1V8QA 4R9WA 3UI2A 4HMIA 4MIUA 3T56B 2Z1CA 1AP0A 3GTKB 3A54A 4QIWB 4HEDA 3VYUA 3A8IE 3QIAA 1HUMA 4RGOS 5KYLA 4HSPA 2L11A 4DNRB 2E76C 4TSSA 4M8AA 3TMEA 1ET9A 2A68D 1CA6A 1RTOA 2EXZA 5FO7B 4J8QA 1W6JA 2DNEA 2PQEA 4OIJA 3SK6A 1X3PA 4Y7NB 1WD0A 4K5XA 2F0LA 2QCPX 3QOJA 2K04A 1EY5A 2L0CA 4K5WA 5I2XA 1CHQD 1LTGD 3MXPA 2FMCA 5CV9A 1VCIA 2J7ZA 4F7XA 1AZPA 1SEBD 4XT1B 3TDQA 1QCBD 3OIQA 1PFMA 3D4RA 1TY2A 4TQUS 2F0EA 2IX0A 1BCPF 2MP1A 3OHXC 1J9OA 1NR4A 5FK9C 2KA7A 4FYDA 3QWNA 2XIWA 5IGCA 4IUQA 1EIHA 4HCSA 3VYTA 4B08A 1E2WA 3K59A 2RVLA 4C3IG 1PZJD 5I9OA 1PTOF 3OOCA 4C3HG 4IUNA 2RBMA 1I4PA 5M5WB 1BQQT 2WACA 2F03A 1KTKA 4B9WA 1I4HA 3VYRA 2WB1B 1E2VA 3HKZB 2XWJB 1CHPD 2X6GA 2NB0A 2R6GA 4F8MA 3GTJB 2KCCA 1H9SB 3S1NB 1SE2A 4ZYSA 3TN2A 1HRJA 2IX1A 3HOWB 3I4MB 2B2YA 5NUCA 1KNAA 3PV0A 4FP5D 5E3FA 4WRDA 2HQEA 2PO4A 3M3YB 2EZVA 2OF1A 4XIGS 1NR2A 4L6TB 2NVQB 2PCFB 3R2TA 1CT1D 1NAPA 2AQ1B 3OSOA 1FNUA 2F0QA 4CJ2C 1VMCA 1KDBA 3GTMB 4I7ZC 3H91A 3K7AB 2ID0A 1BOSA 2NWGA 4QB4A 2L12A 2EYOA 4N9TA 1QWYA 1HTLD 1KDCA 1TT2A 2EY6A 2G9HD 5KRUA 3SEBA 1AZQA 3W2DA 1HA6A 3J81E 2KQ3A 3IKJA 3MC0B 5FO9B 1PLFA 5A2QL 1LTSD 3NTIA 2NTSA 4A3MB 2K1BA 1WTVA 1TY0A 1TU2B 5C3WA 1SYBA 3GQBA 1WTRA 2OXPA 1QB5D 2L9HA 1IKMA 4CHTB 4BY7B 3KF8A 1UEAB 1HUNA 3BYTB 3A7AB 1EY8A 2A74C 5JEAH 3K0YA 1ENAA 3E6ZX 2BDOA 2DNCA 1GUWA 2BE5C 1SNQA 1O80A 2ICIA 1SNMA 2IL8A 4MN3A 1PRTB 1CI3M 3SR1A 1EU4A 1LT4D 2B2YC 2IJ0A 3D31A 4ME5A 2VB2X 3PIO3 4RHSA 3P75A 4ULLA 2F1MA 1Y69U 3LWUA 1Z47A 4L63B 3MA2B 5C4ZA 4OIKA 3IFTA 2MPMA 5FOBB 5JEAJ 2EY1A 2N88A 3LX0A 4OHJA 3BG3A 1STHA 5KEEA 3D3RA 1I4RA 5KNDA 1GHJA 1EQVA 1WVLA 4DN4M 3BZDB 3VA5A 3CKIB 1B2TA 3BVZA 2MGSA 3K5LA 3SK5A 3NPPA 1ILPA 1SDFA 4RWSC 1CQFA 2EJMA 2JP1A 4XT3B 3FEWX 4ZLTF 3NQIA 1CA5A 1MBYA 3I8ZA 3J80E 2CQAA 3A8JE 4ZRZA 2ZXOA 1STEA 4ZQ3A 3RD4A 1LTID 3D8GA 3H94A 2XWBB 3WDNA 1VF5C 2HUGA 4RCOA 2K28A 1IYVA 2H1EA 5C0XI 1SSOA 2DN8A 1ENCA 5CV5A 5IGDA 2QILA 3DXJC 2B2UA 3IFDA 2CHBD 3G6JB 3VR3A 4A3BB 1S5ED 3NHHA 3N6RA 3MEHA 3Q22A 4WFN3 2H4OA 5C0XH 5IT9L 1IHZA 1ZYRD 4OO1I 2QF7A 2E2IB 5D3IB 3ND9A 1RKNA 5HURA 2E2DC 3MXNA 1T5EA 1SXTA 2SDFA 1JR0D 5K5PA 2K7VA 1LACA 3TSSA 1G8ZD 4OO1H 3DM1A 3KLSX 1E2ZA 1SE4A 3M7GA 3P20A 2V4DA 2K01A 1TWAB 1O7ZA 1KLGD 5J22A 5ELCA 2EYLA 2LMCB 4A3GB 3F2UA 3SDZA 2K05A 5M3FB 1TKWB 1LV9A 1K8OA 1RCVD 2NVYB 1O78A 4DGZA 2F0FA 1TR5A 1WTPA 1L0XB 3QB3A 2RDFA 1BUVT 1I4QA 4IURA 4GZYC 2BOSA 3MXGA 2A6EC 4PQXA 2WIIB 1EYCA 5JPNC 2PMZB 4ZKBB 3DWPA 4XYOA 5CYUA 2B2TA 4BY1B 2ZXRA 2XVSA 5T1IA 1BBXC 3GP7A 4JBWA 4XDXA 1Y1WB 4IUTA 4KHVA 4M1UB 4IZ8A 4LMQD 3QOLA 4K2KA 3X3NA 4O42A 2JEAI 4K6LA 2B8FA 1SNDA 1S5BD 4G7ZC 2EJGC 3KK7A 1S5FD 3S14B 4V0BA 4PV1C 5LL6S 5DM63 3HS0C 1K83B 4FF2A 4HSVA 2A5HA 1F77A 4XQQA 2R93B 5G3LF 3DMUA 4IN3A 1UAPA 3FDTA 5D3DA 4V190 1JQYD 1QOHA 3CRKC 1EU3A 5EBCA 3KLSA 1B3AA 2ENBA 2A69D 3CQZB 4KI0A 2SNSA 3PUZA 5J1ZA 1AFPA 4H0LC 4DAYA 1B1ZA 1STNA 1DCZA 3R3OA 1UNSA 3C2PA 1FNVA 1EQTA 1JE4A 2KUMA 5C4JB 5C44B 1SYEA 1B9MA 2NN6G 5EGTA 4KK7A 1XWEA 3T53B 1I3QB 4PMCA 2DY7A 3AMUA 5CBEE 2L1BA 1KNEA 2WV6D 4DXFA 4A3KB 4RGTA 2B63B 1VDZA 2J4XA 3C3LA 2LY7A 1QNKA 1MSGA 1RF2D 2SEBD 2L55A 1JWMD 1JOQA 1DM0B 3OIPA 2C5CA 2NVXB 1V1OA 3AU7A 1L0YB 1EWCA 1SFOB 2RQXA 1Q1EA 1Y8OB 4KY5A 4X3SA 1MD2D 4OGQC 3Q23A 4PMWA 3M4YA 4ODGA 5EBDA 5JVH3 2IT1A 1F9RA 1LO5D 3K5NA 1Y1VB 1TS4A 5F2DA 5IGFA 5FLXL 1PFNA 1CZGA 1GXDC 4J6HA 5AFWA 2D9UA 2BE5D 4XYQA 3PUYA 1D5XC 4ABNA 3PO2B 2A69C 5C0XJ 2MUYA 1JB3A 4DA2A 3TP5A 4RA8A 5KGUA 4MHEA 5CMDA 1AW7A 1LTTD 2Z4IA 4CJ1B 2FINB 2Q8RE 1XXGA 1OXUA 3J7AF 5DM73 4BA1I 4R8IA 1JWSD 1LT6D 1H9RA 1F2YA 4KD3A 4DAVA 3Q0AA 3S15B 4O1NA 2PNRC 2PZUA 1PMRA 4U68A 2M00A 5I4DA 4NW2A 3GD7A 4KN4C 5BN5A 1JC7A 5M3MB 1KAAA 2O5IC 2K03A 2QDBA 1MSHA 4ILWA 2CW0C 3FVQA 2HDMA 5I6WA 3NTHA 1GJXA 3S2HB 2AWNA 2VXWA 1X32A 2ICEC 1PRTD 3HOUB 4EVOA 4K8JA 1SYGA 4KKTA 2F0HA 4ZUIA 2KOLA 2BA0A 3BDOA 2PW7A 4IFDJ 2CVRA 2K33A 4QCLA 1STAA 3HRZC 1SE3A 2F0TA 1G2TA 2NN6H 2FMMA 3J81L 1DONA 2F0PA 4E6IA 1XX8A 3PO3B 3I73A 2M2LA 4KTAA 1DOLA 3BVMA 2HCCA 1WTQA 1V43A 2R92B 4G4KA 2F0UA 1HQMC 3A8KE 3GTOB 3TZDA 4G57A 3S17B 1EEFD 4X3TA 4U673 1Q3LA 1F9QA 5FKAC 1HFGA 2F3VA 3GTQB 3I90A 3BDCA 5C3EB 5FLXE 1G291 2JSOA 3RMHA 3PUVA 3NQTA 3I4NB 4RFBA 5G3LD 5IIFA 1B44D 1EY7A 1IYUA 5ELEA 2L4NA 5KYIA 4J1MA 1B53A 2OT2A 5I6YA 2EYMA 1G91A 2XRSD 3V2TA 1AN8A 2MJ8A 2LKVA 4KJNA 5EPKA 4CKEA 1II3A 3H6MA 3V05A 4FF4A 2EOTA 4DXGA 1NSNS 1X3QA 3E5SA 4S3SA 5C0XG 1XTCD 4LJZC 3H3VC 1PRTC 1PZID 3LWEA 5C5LA 3WOEA 1D5ZC 2RSNA 4PMBA 5E4WC 3NWTA 5TSSA 1LTRD 4KY6A 5DAUA 5M5XB 4DFAA 3NK9A 4K2LA 4OO1G 4Q5VA 3M85A 3X3MA 4BBSB 1DYQA 4IALA 5CV4A 3L7ZC 2JYOA 1AEXA 2KVMA 4ZUJA 1CQVA 3L9AX 2KEDA 3MFYA 5K36G 2IX3A 4LK1C 3E0JA 3VR5A 3GTLB 2JE6I 3KUPA 3O13A 2O2LD 2WKDA 2AWOA 2AQ2B 1WTOA 1EFID 3HP3A 1XYIA 3TZUA 3K5MA 1SNCA 2JA6B 5EQ0A 1SMYC 3L3OC 2AQ3B 4QUCA 5T1GA 2Q8TA 1SJHD 2XN9C 5JPMC 1RODA 3ZYYX 4WORA 5JEAG 1A15A 4RAUC 2PZWA 3J80L 3NXWA 5J39A 2A73B 5CBAE 4C3JG 4EQPA 4KMUC 3D4WA 5ELBA 1BXTA 1I6HB 3MWYW 5DNFA 3S1QB 5IGGA 3FPUB 2VB3X 3NE5B 1I4GA 4FXDA 3I4LA 1JORA 1T5XD 1ET6A 3MZ5A 5EPJA 1ESRA 1DXMA 1F9SA 1RDPD 2R7ZB 2NYZD 4UDUC 2D62A 1IW7C 1A3VA 5ISRA 3EVQA 3SK8A 2IPKD 4RGNA 3VA7A 4KV6A 5CGKA 1BO0A 1ENFA 1U9RA 1Q8IA 5M9OA 3QO2A 2TSSA 3J7AV 4I65A 1JWUD 3D6CA 3GV3A 2EYJA 2IWHA 3SK4A 5BN3A 4ZKCB 4DF7A 5KIXA 5CV8A 4BA2I 1ONLA 5D14A 2RKSA 3VR2A 4HAEA 5BN4A 3Q6SA 3T51B 2YYZA 1OO9B 2O5JC 3PUXA 1EZ6A 3CHBD 1WTXA 4P2CB 2FJ2A 4DU9A 1GUOA 4NMZA 2NVTB 2HCIA 2E2HB 4IUVA 4FXKC 1GHKA 2F0MA 2PPBC 3EROA 5EJWA 1LLRD 3C1EA 2EE1A 4C56C 1YNJC 2TMPA 3PUWA 1BCPB 3K58A 1G2SA 4DNTB 2Y0SB 3JAME 4R8NA 2WP8J 2JA7B 2X6LA 1HFNA 2IW3A 4HN7A 2J0TD 4C1NI 4C3IB 5KNBA 2F0KA 1R4PB 3GO5A 3SXHA 4IUPA 1JOOA 4EQOA 4G7HC 4G7OC 2FFKB 3LNNA 1PTOB 2PW5A 1QE6A 5IGBA 3SVMA 3EFXD 1F9PA 1E0BA 3KBGA 1HHVA 4ZAIA 2K5DA 4A3EB 3V96A 2ZXPA 3ERQA 3BYYB 2EVBA 4XXEA 4B9XA 3BDLA 1OXSC 4A3IB 4KKSA 5E4XA 3DUZA 4ZK9B 5JJZA 5LHY1 2F0DA 1KDAA 4FNFA 3D4DA 2A6HC 3FPPA 2AUKA 2F0GA 4HCEA 1PDQA 3H0GB 3PMFA 3VR4A 1DD2A 5JOBA 3P1HA 4KN7C 4QMGA 1JOKA 3DEPA 2I46A 2R61A 2HDLA 2LFNA 2NUCA 2Q8IB 4AYBB 3I3CA 2RDGA 3MHBA 3NBHA 1K8MA 2AUJD 4YIJA 1WTWA 3OWFA 1J8IA 4L8JA 1EY0A 3TP6A 3WOFA 1B9NA 2QKIC 1VF7A 1Y8PB 2F0OA 1LT5D 4NP5A 3G7LA 1M8AA 3KLRA 4K5VA 1Z6HA 1JCKB 2QEJC 3EA6A 1LTAD 3HEJA 3GV6A 5CR3A 4C1NK 1B50A 4N9PA 1QJOA 2MHVA 3R93A 5FO8B 3NUCA 1Q12A 1D5MC 2A68C 1UUPA 3DEOA 2EDGA 1WCMB 5CV7A 3HG9A 3TBIB 4IFDG 1A3UA 5EKLA 1Y8NB 1C8CA 4WJWA 1SMYD 2VNUD 1D6EC 1R9TB 2B2TC 3MTSA 3W3AA 1WD1A 1CZWA 4BBRB 4UAIA 3S1MB 4BWGB 3ONAB 4DK0A 2B39A 3PIP3 3S16B 1SBBB 4C3JB 4TRDA 2VUMB 3A55A 3HGBA 3MVVA 4H44C 5A2QE 3D6WA 3R8BA 1KLUD 2EY2A 2EJFC 3SHLA 4BS9A 1GUSA 1IL8A 1PTOC 5CC4A 2PYKA 1SNOA 2NTTA 1Q90A 4QUFA 2NZ1D 4NKLA 1SYFA 3MFGA 5HGTA 1DZ1A 4PNYA 3QJYA 4OL7A 1FNWA 1EYDA 1R4QB 4TKOB 1BCPC 4RGMA 3URYA 1GUGA 2XRQD 2WAQB 4RCNA 3HOYB 1BDOA 3DWQA 5CORA 1HXYD 1IKLA 1ICWA 2KHSA 3T13A 2EY5A 1W6KA 1EYAA 1DOMA 1M4VA 3J7YW 2YU9B 4HMJA 1G6ZA 3JAML 3AB9A 1PFBA 5EPLA 3R2IA 2BA1A 3GTGB 1EIGA 4A3DB 2B2UC 3IL8A 5CV6A 3S2DB 2C9OA 3NP8A 2B2WC 2KJXA 2F0IA 1STYA 4HTHA 1TS3A 1RTNA 2KCNA 5JAVA 5IGEA 4Q0FA 3FRPB 1CFMA 3EQLC 2GA4B 1Z7TA 1HTPA 2LS01 1SYCA 3RZDB 2K5QA 4RKLA 3S1RB 4H7BA 5E1FA 2F0SA 4IQZA 1TIID 1HQRD 3FKIB 5C5MA 5LL6X 4IFDI 4KHZA 2XSCA 1QNUA 4ID6A 1I50B 1DOKA 1RD9D 3VR6A 2N55A 3OMCA 1ILQA 2SNMA 1ZKOA 1EL0A 1STGA 4DAPA 3RZOB 1HA5A 3KBXA 1A6XA 2D2CC 2A6HD 5C3XA 1NCVA 3QG1A 4C2MB 1H9KA 4LAAA 3CRLC 4KD4A 1PRTF 5I2YA 1U4PA 3RLFA 2JA5B 4X3UA 1MI2A 1EY4A 1C4QA 3NBIA 3MXUA 2B8GA 3I91A 1RHPA 1A2TA 4CBVA 4K14A 1YNNC 1D1KA 1TWCB 1GUNA 1ZYRC 5M5YB 1D1IA 2E75C 2B2WA 1TWHB 1GOZA 1S4ZA 2D5DA 2B2VA 3MAQA 1PTOH 3HZXA 4DK1A 2X69A 3C46A 2F3WA 1EZ8A 2NBFA 5K36H 3ND8A 1YNND 3I72A 2E2JB 1DJRD 3T16A 3HOXB 1I6VC 1SNPA 3A56A 2M9VA 3Q24A 1I4XA 1TS5A 4KKUA 3M7NA 1YNJD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C5L A;  1KDB A;  2SNM A;  2F0P A;  4KJO A;  2F0O A;  3TP5 A;  4F7X A;  5IOD A;  5KGU A;  4NP5 A;  1EQV A;  4PMB A;  4E6I A;  1EYD A;  5J22 A;  2OEO A;  1STG A;  3VA5 A;  4K5V A;  2EYL A;  5IGG A;  1SYE A;  2F0K A;  1F2M A;  2PZT A;  4NDX A;  5EGT A;  4QB4 A;  3SK5 A;  5C6A A;  4KTA A;  2EYO A;  3RUZ A;  1JOR A;  2F0E A;  4N9T A;  3SXH A;  4KY6 A;  5C3X A;  3HEJ A;  1JOO A;  5DAU A;  3EJI A;  5CR3 A;  4EQO A;  4QF4 A;  1KDC A;  3DHQ A;  4DFA A;  1TT2 A;  2EY6 A;  5KRU A;  4N9P A;  3NK9 A;  3MZ5 A;  4K2L A;  4DGZ A;  2F0W A;  2F0F A;  4LAA A;  1TR5 A;  2F0U A;  2PW5 A;  2KQ3 A;  2F0J A;  4KD4 A;  3QB3 A;  4PMC A;  4HMI A;  4MIU A;  3S9W A;  3NUC A;  4IAL A;  5CV4 A;  3U9O A;  2RDF A;  5IGC A;  1EY9 A;  2KHS A;  5IGB A;  3T13 A;  1EY4 A;  2EY5 A;  3ITP A;  1KAB A;  4G57 A;  1EYA A;  4ZQ3 A;  1F2Y A;  4KD3 A;  1AEX A;  3D8G A;  4HMJ A;  1A2T A;  1A3V A;  4ZUJ A;  2F3V A;  5ISR A;  3EVQ A;  3SK8 A;  1EYC A;  5C3W A;  5CV7 A;  1SYB A;  5IOC A;  4K14 A;  5I9O A;  1A3U A;  2OXP A;  2PZU A;  5EKL A;  4KV6 A;  3ERQ A;  5CGK A;  1U9R A;  3BDC A;  5I9P A;  1ENC A;  2EYF A;  2M00 A;  1JOQ A;  3V2T A;  5CV5 A;  5M9O A;  4IUN A;  2RBM A;  5IGD A;  4B9X A;  2EYP A;  3TP8 A;  2WAC A;  3BDL A;  5KYL A;  5CV6 A;  1EY8 A;  3NQT A;  4I65 A;  3NP8 A;  4B9W A;  1ENA A;  4EQP A;  3D6C A;  2F0I A;  3TME A;  2EYJ A;  2F0D A;  4RKB A;  3SK4 A;  1STY A;  5IIF A;  4HTH A;  1EY7 A;  1KAA A;  1KDA A;  3NHH A;  4DF7 A;  5KIX A;  4KHV A;  1SNQ A;  3D4D A;  2QDB A;  4IZ8 A;  5CV8 A;  2EXZ A;  3QOL A;  4K2K A;  4J1M A;  3MEH A;  4KY5 A;  1SNM A;  1SNC A;  5DEH A;  5IGE A;  5JAV A;  5C4H A;  1NUC A;  5I6Y A;  5I6W A;  1A2U A;  1TQO A;  2EYH A;  2RKS A;  4F8M A;  1SND A;  3HZX A;  4TRD A;  3OMG A;  2F0G A;  2EYM A;  1IHZ A;  3PMF A;  2F3W A;  3SR1 A;  1EZ8 A;  3MVV A;  4ODG A;  5EKK A;  2PQE A;  1RKN A;  2SOB A;  5NUC A;  5KYI A;  4ME5 A;  3SK6 A;  5HUR A;  1SYC A;  5JOB A;  3TP7 A;  4EVO A;  5E3F A;  4WRD A;  3P75 A;  2HQE A;  3P1H A;  4K8J A;  1A3T A;  4H7B A;  4K5X A;  3C1F A;  4QMG A;  4RKL A;  2F0L A;  1JOK A;  1EY6 A;  1EZ6 A;  2EY2 A;  1SYG A;  5E1F A;  2LKV A;  4EQN A;  2OF1 A;  4KJN A;  2F0S A;  3QOJ A;  5F2D A;  3SHL A;  2F0H A;  3DMU A;  5IGF A;  4DU9 A;  5K5P A;  2NUC A;  2F0N A;  4NMZ A;  4K6D A;  4ZUI A;  3T16 A;  1EY5 A;  4J6H A;  5CC4 A;  2F0V A;  1II3 A;  1SYD A;  2PYK A;  3H6M A;  1SNO A;  4WOR A;  5C5M A;  1SNP A;  5C4Z A;  4K5W A;  2EY1 A;  2PZW A;  3MHB A;  3MXP A;  4YIJ A;  3LX0 A;  2F0M A;  3NXW A;  3ERO A;  3OSO A;  5J39 A;  4KY7 A;  3C1E A;  2PW7 A;  1NSN S;  3OWF A;  2ENB A;  4K8I A;  4ID6 A;  4NKL A;  1EY0 A;  2O4X A;  2SNS A;  3D4W A;  5CV9 A;  3TP6 A;  1SYF A;  5J1Z A;  3E5S A;  1STH A;  1STA A;  4S3S A;  1F2Z A;  2F0Q A;  1STN A;  5KEE A;  2F0T A;  1STB A;  5HGT A;  3OMC A;  4R8N A;  4PNY A;  3R3O A;  4OL7 A; 
#chains in the Genus database with same CATH topology
 4OX9 L;  3HOU G;  4IPH A;  3RZO H;  2WIN B;  4LFB L;  2CWA A;  2JA8 B;  2YV5 A;  1OXV A;  3DM3 A;  1A63 A;  4CKC A;  1F2M A;  4OWW B;  4DV0 L;  1WFQ A;  1Q7Y C;  4HR7 B;  3ICE A;  4JK1 C;  5C6A A;  1P8L A;  2A6E D;  2K5W A;  5IYB H;  1WI5 A;  3DHQ A;  1XNR Q;  1ML0 D;  1GUT A;  4DK3 C;  2K52 A;  2F0W A;  3H09 A;  4BXX H;  4A3K H;  4CGY B;  1LTB D;  1XNQ Q;  1EY9 A;  1U4M A;  1SR3 A;  3ITP A;  2CW0 D;  1KAB A;  2FHT A;  1TVX A;  1PXU A;  2VUM G;  2R3Z A;  1E22 A;  5ELF A;  4F88 A;  3IAY A;  4CJ0 B;  1FD7 D;  4RH6 A;  2JXM B;  3GTQ H;  4IUU A;  2F4I A;  3CF5 A;  4QL5 A;  1YI2 A;  5I9P A;  1CTM A;  1FR3 A;  3GTP B;  2VQF Q;  4EGV A;  1Y1V G;  1FYC A;  2EYP A;  3TP8 A;  1U4R A;  3M4O B;  1HR0 Q;  3UDX A;  2PNH A;  1EWH A;  1QG7 A;  2NN6 I;  2RSO A;  2OTL A;  4JI6 L;  2B2V C;  1AH9 A;  1HCZ A;  5JVG 3;  4OWX B;  3BZK A;  2EYH A;  1TQO A;  2E74 C;  4ME3 A;  1VQP A;  1XPR A;  2BDN A;  2BCO A;  4GNX A;  1BNZ A;  1BR9 A;  1C48 A;  1CM9 A;  3BS1 A;  1V1P B;  3ZJY C;  4X65 Q;  4ZCK A;  2JN4 A;  1TWG B;  4C3H B;  5J3B A;  1ESF A;  4OX9 Q;  3T4A C;  4XTC S;  4CKB A;  1IW7 D;  2WFW A;  3UE1 A;  2F0N A;  3CME A;  4K6D A;  3I4N G;  1VQE A;  2K32 A;  4YHH L;  1SYD A;  3NEN A;  2GVA A;  4FDB A;  1CK1 A;  4MTN A;  5COY A;  1S5D D;  1HNW L;  1PH5 A;  3U9S A;  1VQC A;  1O7Y A;  1N36 Q;  4A3B H;  4K8I A;  1FVI A;  1F2Z A;  5D65 A;  2I07 B;  1STB A;  2A1A A;  4X3K A;  3HOV B;  3QR8 A;  4KJO A;  4DR6 L;  4F87 A;  4FO2 A;  3NEL A;  1LT3 D;  3J81 c;  1TWF B;  4IJL A;  4R4T A;  2PQA A;  5ELD A;  4AQY L;  1V1P A;  2WKC A;  4Z9C B;  2PZT A;  4NDX A;  1BKB A;  1KQS A;  3RUZ A;  1TS2 A;  4A3F B;  4H13 C;  3EJI A;  5JJK A;  3N52 A;  1HNW Q;  1U5K A;  2N8N A;  2G9D A;  1VQ4 A;  3Q8D A;  4R4Q A;  3OPO A;  1SJE D;  4XQN A;  4PZ6 A;  1VQ9 A;  5C4X B;  3U9O A;  3BVG A;  4LF6 Q;  2RDH A;  1NJI C;  2JEB I;  2K6A A;  3A7L A;  4A4I A;  1D2B A;  4JI3 L;  3S15 H;  3K5O A;  1FL0 A;  2JQO A;  2ZTE A;  3TS0 A;  5IOC A;  1IYJ B;  5A35 A;  4XQJ A;  3GTP H;  4MZ9 A;  2K5H A;  2EYF A;  2L5T A;  1PYW D;  2Z4H A;  1SMX A;  4OEM B;  4GLA C;  3HOZ B;  3OW7 A;  1OXT A;  1BF4 A;  1EOT A;  1H9S A;  1XNQ L;  4A3G H;  4IFD H;  1RJT A;  3K6O A;  4RKB A;  1PH8 A;  3P7J A;  2EPB A;  1B4O A;  3VYS A;  2XTI A;  5DEH A;  1JIC A;  4A3J B;  1LAB A;  3M4Q A;  5C4H A;  1NUC A;  3PSI A;  2I0Q A;  2ZT9 C;  1A2U A;  1MGS A;  1EEI D;  3OMG A;  3SE0 A;  4UHV A;  3K57 A;  1H9J A;  4IOC A;  5EKK A;  5EKI A;  4FVM A;  2SOB A;  2KEE A;  2XNA C;  4C3H H;  3TP7 A;  1F2L A;  2WB1 E;  4RHR A;  4FF3 A;  3I70 A;  1A3T A;  3C1F A;  3NTK A;  4LF6 L;  1Q1B A;  1EY6 A;  4BY7 G;  3G48 A;  5IT9 E;  4EQN A;  1EWI A;  1HPC A;  3PO3 G;  2Z8L A;  2F0V A;  1VMP A;  3NSW A;  3FMC A;  1VQM A;  1FGB D;  1ZXT A;  1K0S A;  3DWA A;  2PI2 A;  3CC2 A;  1O7L A;  1PTO D;  4A93 B;  2RA4 A;  4KY7 A;  2R92 G;  1YZ6 A;  2KEC A;  2O4X A;  1EUJ A;  1Y1W H;  1S5C D;  2DY8 A;  1H9M A;  4FF1 A;  5KNC A;  5IOD A;  4LFB Q;  4EQ5 A;  1ZEQ X;  2HQL A;  2OEO A;  2BH2 A;  1U4L A;  3S14 H;  2UXC Q;  1QIL A;  3K80 C;  5FJ8 H;  2ASB A;  1OXX K;  1PZK D;  4BXX G;  1XNR L;  4K0K L;  1BCP D;  1KIX A;  3OWE B;  2R92 H;  1FGU A;  4QF4 A;  1SAP A;  4FXG C;  3CU7 A;  3NWS A;  4O2D A;  3S9W A;  2F0J A;  1V8Q A;  4R9W A;  4HMI A;  4MIU A;  3T56 B;  3UI2 A;  2Z1C A;  2E2I H;  2R7Z H;  1GD7 A;  1AP0 A;  3GTK B;  3A54 A;  3T1Y Q;  4QIW B;  5LMU Q;  4HED A;  4B3R L;  1IXR A;  4DV6 L;  3VYU A;  5FJ8 G;  4GKJ L;  3A8I E;  1N36 L;  2OTJ A;  3QIA A;  2GN5 A;  4R4I A;  1HUM A;  4RGO S;  5KYL A;  4HSP A;  2L11 A;  5C44 H;  5EAY A;  4LF7 Q;  4DNR B;  2E76 C;  4TSS A;  4M8A A;  3TME A;  1ET9 A;  2A68 D;  1CA6 A;  2V1C C;  4P71 A;  1RTO A;  2EXZ A;  5FO7 B;  4J8Q A;  3LGJ A;  1HH2 P;  1A0I A;  1YBY A;  1W6J A;  2DNE A;  2PQE A;  4OIJ A;  3SK6 A;  1X3P A;  5E7N A;  4Y7N B;  1WD0 A;  3JAM i;  2JA8 G;  4K5X A;  2ES2 A;  2F0L A;  3CCE A;  2QCP X;  3QOJ A;  4L5R C;  3OTO Q;  3HOY H;  2K04 A;  1EY5 A;  2L0C A;  3UE0 A;  1GM5 A;  1IBK L;  4K5W A;  5I2X A;  1CHQ D;  1LTG D;  2YTX A;  3MXP A;  2NVX H;  2FMC A;  3E3X A;  1EOV A;  2YU9 H;  1NTG A;  5CV9 A;  4BBS G;  1VCI A;  2J7Z A;  3KJP A;  1UE1 A;  3E0E A;  3CXC A;  1K8A C;  3CC4 A;  5IYD H;  4JV5 Q;  4F7X A;  1AZP A;  1SEB D;  3UDF A;  4GKK Q;  3GTM H;  2ZJR A;  4BY1 H;  4DR7 L;  4XT1 B;  4YY3 Q;  3TDQ A;  1QCB D;  3OIQ A;  1HNZ Q;  1PFM A;  3D4R A;  1TY2 A;  1UE7 A;  4TQU S;  2KCT A;  2F0E A;  2IX0 A;  1BCP F;  2MP1 A;  3OHX C;  1J9O A;  1QUQ A;  1NR4 A;  2E2J H;  5FK9 C;  2KA7 A;  3KDF B;  4BBS H;  5IWA L;  4FYD A;  1E24 A;  1LM0 A;  1VQB A;  3QWN A;  2XIW A;  1HJP A;  2UU9 L;  5IGC A;  2Y0S G;  2JA6 G;  4IUQ A;  1EIH A;  4HCS A;  3VYT A;  4B08 A;  1E2W A;  5GQO A;  3K59 A;  3AEV A;  2RVL A;  3PO2 H;  4C3I G;  1PZJ D;  3H3V I;  5I9O A;  3D0F A;  1VQL A;  1PTO F;  3OOC A;  1PV4 A;  4C3H G;  4JBM A;  4IUN A;  2RBM A;  1I4P A;  4DUZ L;  5M5W B;  4NB3 A;  1XMO L;  1BQQ T;  2WAC A;  2F03 A;  1EQR A;  1KTK A;  4B9W A;  1I4H A;  3VYR A;  2WB1 B;  1E2V A;  1HZA A;  2Z9H A;  5GAD C;  3HKZ B;  1HNZ L;  2XWJ B;  1CHP D;  2X6G A;  4A76 A;  1C7Y A;  2NB0 A;  2R6G A;  1SN8 A;  1S72 A;  4F8M A;  3GTJ B;  2KCC A;  4A3L G;  1H9S B;  4JBJ A;  3S1N B;  1SE2 A;  4ZYS A;  4DR1 L;  3TN2 A;  1HRJ A;  1N33 Q;  2DJF C;  2IX1 A;  3HOW B;  3I4M B;  2HIV A;  3PF5 A;  2B2Y A;  2I5L X;  5NUC A;  1KNA A;  2MNA A;  3PV0 A;  4FP5 D;  5E3F A;  4WRD A;  2HQE A;  2PO4 A;  3M3Y B;  4PZ7 A;  2EZV A;  2OF1 A;  2Y0S E;  4XIG S;  3KJO A;  1NR2 A;  4L6T B;  2ZJQ A;  2NVQ B;  2ZTD A;  3BJU A;  4N8X 1;  2K50 A;  2PCF B;  3R2T A;  1CT1 D;  2JA5 H;  4DR4 L;  5LMN Q;  1NAP A;  1HNX Q;  2AQ1 B;  3OSO A;  1VQ5 A;  1BBW A;  2MQH A;  4JI4 Q;  1FNU A;  3H0G G;  5M3M H;  2F0Q A;  4CJ2 C;  1N8R C;  1VMC A;  1CKO A;  3HFZ B;  1KDB A;  3GTM B;  4I7Z C;  1Y14 B;  3H91 A;  4DV5 Q;  2UUB L;  3J80 c;  3K7A B;  4HJ9 A;  4JCV E;  2ID0 A;  1BOS A;  2NWG A;  2RF4 A;  4H02 A;  4QB4 A;  2L12 A;  3F2D A;  4LF4 L;  1W2B A;  2EYO A;  4JG2 A;  5FLX c;  1YEZ A;  4N9T A;  1I94 L;  1QWY A;  1HTL D;  1KDC A;  1TT2 A;  2EY6 A;  2G9H D;  5KRU A;  3SEB A;  1AZQ A;  3W2D A;  1HA6 A;  3J81 E;  2KQ3 A;  4R1J A;  3IKJ A;  3MC0 B;  1B8A A;  5FO9 B;  1PLF A;  2RCN A;  1LTS D;  5A2Q L;  4LF8 L;  3NTI A;  4A3J G;  2NTS A;  4HIO A;  4A3M B;  2K1B A;  4B3R Q;  1WTV A;  3TRZ A;  3ERS X;  1TY0 A;  1TU2 B;  5C3W A;  1SYB A;  3GQB A;  1WTR A;  2OXP A;  4LF4 Q;  2YTV A;  1WCM H;  2K75 A;  1QB5 D;  2L9H A;  4P75 A;  4NXM L;  1IKM A;  4CHT B;  1TWF H;  4OON A;  4BY7 B;  1JMC A;  3KF8 A;  1UEA B;  1HUN A;  3BYT B;  3A7A B;  1EY8 A;  3J80 i;  2VL6 A;  2A74 C;  5JEA H;  5IYB G;  3K0Y A;  1ENA A;  3E6Z X;  4DV7 Q;  3EN2 A;  2BDO A;  2DNC A;  1GUW A;  2BE5 C;  1SNQ A;  1QZH A;  1O80 A;  2ICI A;  1SNM A;  2OQ0 A;  2IL8 A;  4MN3 A;  4JI5 L;  1HNX L;  5IP9 H;  1PRT B;  1CI3 M;  3SR1 A;  4C3J H;  1VQN A;  1EU4 A;  1LT4 D;  2B2Y C;  2IJ0 A;  3D31 A;  4LF5 L;  3GTO H;  2EIF A;  4ME5 A;  2VB2 X;  5IYC G;  3PIO 3;  4RHS A;  3P75 A;  4ULL A;  2F1M A;  2NVQ H;  1Y69 U;  3LWU A;  2ATW A;  1Z47 A;  4OXP A;  4L63 B;  1J5E Q;  3MA2 B;  1A62 A;  5C4Z A;  4OIK A;  3IFT A;  2MPM A;  5FOB B;  5JEA J;  2LXK A;  2EY1 A;  2N88 A;  3HOZ H;  3LX0 A;  4OHJ A;  5IP9 G;  1B7Y B;  2OCE A;  3BG3 A;  1STH A;  5KEE A;  3D3R A;  1I4R A;  5KND A;  1GHJ A;  1KC8 C;  1EQV A;  4QIW E;  1WVL A;  4DN4 M;  3BZD B;  3VA5 A;  3CKI B;  4GS3 A;  1B2T A;  4R4C A;  1VQF A;  3BVZ A;  2MGS A;  2AKW B;  3K5L A;  3SK5 A;  3NPP A;  1YNX A;  1SDF A;  1ILP A;  4RWS C;  1U0L A;  1CQF A;  2EJM A;  1JJC B;  2JP1 A;  4XT3 B;  3FEW X;  2N3S A;  4ZLT F;  5AJ3 Q;  3NQI A;  3CCM A;  1CSQ A;  1CA5 A;  1QVF A;  1MBY A;  4LUV A;  3I8Z A;  4JI2 Q;  4IO9 A;  4JI7 Q;  3J80 E;  2CQA A;  3A8J E;  4ZRZ A;  3HOU H;  2ZXO A;  4LFA Q;  1STE A;  4ZQ3 A;  3RD4 A;  1LTI D;  3D8G A;  3H94 A;  2XWB B;  3WDN A;  2E5L Q;  1VF5 C;  4QY7 A;  2HUG A;  4RCO A;  2K28 A;  1IYV A;  2H1E A;  5C0X I;  1SSO A;  2DN8 A;  1ENC A;  5CV5 A;  3F1Z A;  5IGD A;  2A8V A;  2QIL A;  3DXJ C;  1PYS B;  2B2U A;  2WAQ E;  3IFD A;  2CHB D;  3G6J B;  3VR3 A;  4A3B B;  1N9W A;  1PH6 A;  3L2P A;  1S5E D;  5GRO A;  3NHH A;  3N6R A;  3CPF A;  5M5X H;  3MEH A;  3Q22 A;  4JI1 L;  4WFN 3;  2H4O A;  2UUB Q;  1N32 Q;  3G6E A;  5C0X H;  4DUY L;  1E1O A;  5IT9 L;  1IHZ A;  3K81 C;  4NPS A;  1ZYR D;  4OO1 I;  2QF7 A;  1YJN A;  2E2I B;  5D3I B;  3T1H Q;  3ND9 A;  1RKN A;  5HUR A;  2E2D C;  4N8F A;  3MXN A;  1T5E A;  1SXT A;  2BH8 A;  2SDF A;  1JR0 D;  1PH4 A;  3S1R H;  3E9I A;  3PQI A;  5K5P A;  4TVA B;  4GOP B;  2K7V A;  1LAC A;  3TSS A;  1PVO A;  1G8Z D;  4HJ7 A;  3PCO B;  5GAE C;  3FKI H;  4OO1 H;  3DM1 A;  3W5O A;  3KLS X;  1E2Z A;  4DV3 Q;  4RG1 A;  1SE4 A;  1PH7 A;  4B3M L;  3M7G A;  3P20 A;  1K73 C;  2V4D A;  4JPB W;  1UE6 A;  2K01 A;  1O7Z A;  1TWA B;  1KLG D;  5J22 A;  5ELC A;  3JC6 6;  2CH4 A;  1WCM G;  3MXN B;  1HZC A;  2EYL A;  2LMC B;  2N49 A;  4A3G B;  3F2U A;  3SDZ A;  3FKI G;  1SLJ A;  2K05 A;  4Y7N H;  5M3F B;  1TKW B;  2VY3 A;  1LV9 A;  5ELO A;  1K8O A;  1RCV D;  4A3J H;  2NVY B;  4UY8 C;  1VQA A;  3E9H A;  1O78 A;  2MO1 A;  4BBR G;  4DGZ A;  1XMO Q;  1MKH A;  1XPO A;  4B3M Q;  2F0F A;  1TR5 A;  1I3Q H;  1WTP A;  1L0X B;  3QB3 A;  3HKZ G;  5GAH C;  2RDF A;  1BUV T;  2VS1 A;  1IBL Q;  1I4Q A;  4IUR A;  1VQO A;  4DR3 L;  4OWT B;  4GZY C;  4HJ5 A;  2BOS A;  3KF6 A;  3MXG A;  2A6E C;  5FLM G;  3I4M G;  3GDE A;  4PQX A;  2WII B;  3J81 j;  2B63 H;  1EYC A;  4YWL A;  5JPN C;  4JOI A;  2PMZ B;  4ZKB B;  3DWP A;  4XYO A;  5CYU A;  3U58 A;  4KHP L;  2B2T A;  4BY1 B;  2ZXR A;  2XVS A;  3S1M H;  5T1I A;  3J7A 5;  1BBX C;  4A75 A;  3GP7 A;  4JBW A;  4J15 A;  4XDX A;  1TWH H;  1Y1W B;  4MNO A;  4GN4 B;  4IUT A;  4KHV A;  4M1U B;  4JI0 Q;  1B3Q A;  1LTL A;  4IZ8 A;  4LMQ D;  1EIY B;  3QOL A;  4JI0 L;  4K2K A;  3S16 H;  3X3N A;  5IE8 A;  4O42 A;  2JEA I;  3HKS A;  4K6L A;  2B8F A;  1SND A;  1S5B D;  4G7Z C;  2EJG C;  3KK7 A;  1S5F D;  3S14 B;  3BU2 A;  4V0B A;  4PV1 C;  5LL6 S;  1X3G A;  5DM6 3;  2K4K A;  3HS0 C;  1K83 B;  4FF2 A;  4HSV A;  1IBM Q;  5C3E G;  2A5H A;  2B29 A;  1QVG A;  1F77 A;  4XQQ A;  2R93 B;  5G3L F;  3DMU A;  4DPG A;  4IN3 A;  1UAP A;  3KDF A;  3W1B A;  3FDT A;  5D3D A;  4DV0 Q;  5M5W H;  4V19 0;  2WAQ G;  1JQY D;  2A19 A;  1QOH A;  3GTK H;  3CRK C;  1EU3 A;  5EBC A;  3KLS A;  1B3A A;  2ENB A;  2A69 D;  3CQZ B;  4KI0 A;  2SNS A;  2Z6B A;  3PUZ A;  5J1Z A;  1AFP A;  4H0L C;  4DAY A;  1B1Z A;  1STN A;  4JI2 L;  4X66 L;  1DCZ A;  1L1O A;  3R3O A;  1UNS A;  3EIV A;  3C2P A;  1K3B C;  3GTJ H;  1FNV A;  2Z0S A;  1EQT A;  1JE4 A;  2KUM A;  2ZM6 L;  2C35 B;  4X62 L;  4HJ8 A;  5C4J B;  1UE5 A;  5C44 B;  1SYE A;  1B9M A;  1X9N A;  2NN6 G;  5EGT A;  5M3F H;  3KLW A;  3HOX G;  4CDC C;  4KK7 A;  1XWE A;  3OW2 A;  1CKN A;  1XPU A;  2JA6 H;  3T53 B;  1I3Q B;  1Q46 A;  4PMC A;  2DY7 A;  2P5Z X;  3AMU A;  1YIJ A;  4L5Q A;  1X55 A;  5CBE E;  2L1B A;  1KNE A;  2WV6 D;  4DXF A;  4A3K B;  1PA6 A;  4RGT A;  4GNX B;  2RCF A;  2B63 B;  1VDZ A;  2J4X A;  3C3L A;  2LY7 A;  3W1G A;  1QNK A;  1MSG A;  1RF2 D;  3EBE A;  1KL9 A;  2SEB D;  2L55 A;  1X54 A;  4A3D H;  1JWM D;  1JOQ A;  1DM0 B;  1KRS A;  3OIP A;  2C5C A;  2UXD L;  2NVX B;  4HIK A;  1D8L A;  1IBL L;  2DJG C;  1V1O A;  4DR6 Q;  3AU7 A;  1L0Y B;  1EWC A;  1SFO B;  2RQX A;  1Q1E A;  1V9P A;  1Y8O B;  4KY5 A;  4X3S A;  1SRO A;  1MD2 D;  4OGQ C;  3Q23 A;  4WJ4 A;  1PYB A;  4PMW A;  1XJV A;  3G4S A;  3M4Y A;  4KHP Q;  4ODG A;  1BBU A;  5EBD A;  5JVH 3;  2IT1 A;  1F9R A;  1LO5 D;  3K5N A;  1Y1V B;  1TS4 A;  1TWG H;  5F2D A;  5IGF A;  5FLX L;  1PFN A;  4UP8 A;  1CZG A;  1GXD C;  4J6H A;  5LMN L;  5AFW A;  2D9U A;  3F8T A;  2BE5 D;  1VS0 A;  3CQZ H;  3CW2 C;  4XYQ A;  2F3I A;  3PUY A;  2QGQ A;  1D5X C;  4ABN A;  3PO2 B;  2JA5 G;  2A69 C;  1IBM L;  5C0X J;  2MUY A;  1JB3 A;  1ICF B;  4DA2 A;  4YCU A;  1D7Q A;  3TP5 A;  4RA8 A;  5KGU A;  3CCL A;  5IT9 c;  2PI2 E;  3NEM A;  4MHE A;  4GN3 B;  4LFC Q;  4P72 A;  5CMD A;  1AW7 A;  3CCJ A;  2CKZ B;  4ALP A;  1DGS A;  1LTT D;  2Z4I A;  4CJ1 B;  5L37 A;  2FIN B;  3ULJ A;  4JVZ A;  4DUZ Q;  3HOW H;  2Q8R E;  1XXG A;  1OXU A;  1JT8 A;  3J7A F;  2ZM6 Q;  5DM7 3;  4BA1 I;  4R8I A;  1VQ6 A;  1JWS D;  1LT6 D;  1H9R A;  1F2Y A;  4KD3 A;  4DAV A;  4O0A A;  3Q0A A;  3S15 B;  4O1N A;  4P74 A;  2PNR C;  2HT1 A;  4IPC A;  2PZU A;  1PMR A;  4DV1 L;  4U68 A;  5IY0 A;  1K9M C;  1KXL A;  2M00 A;  5I4D A;  1PH2 A;  4NW2 A;  1HZB A;  3GD7 A;  1X65 A;  2K14 A;  4KN4 C;  5BN5 A;  4IPG A;  1JC7 A;  2VW9 A;  1SE8 A;  5M3M B;  1KAA A;  1G51 A;  2O5I C;  1YHA A;  2K03 A;  5C4X G;  2QDB A;  1MSH A;  4ILW A;  2JA7 H;  2CW0 C;  3FVQ A;  2HDM A;  3T1Y L;  5I6W A;  3NTH A;  1GJX A;  1T9H A;  3S2H B;  2AWN A;  3K7A H;  2VXW A;  1X32 A;  2ICE C;  2E8G A;  1PRT D;  3HOU B;  4EVO A;  4K8J A;  3FP9 A;  1G6P A;  1SRU A;  1SYG A;  1X3F A;  4KKT A;  4X62 Q;  2F0H A;  3JAM c;  4ZUI A;  5IP7 H;  2KOL A;  2QW7 A;  3HKZ E;  3U4V A;  2BA0 A;  5BR8 L;  1R9T H;  4A3M H;  3BDO A;  2PW7 A;  4IFD J;  2CVR A;  2K33 A;  4QCL A;  4A93 H;  5JJL A;  3J7Z C;  1K0R A;  1STA A;  3HRZ C;  2CCZ A;  1SE3 A;  2F0T A;  1G2T A;  2NN6 H;  1GVP A;  2FMM A;  3J81 L;  2Q2I A;  1DON A;  2F0P A;  4UPA A;  4E6I A;  4DAY B;  2VUM H;  4AH6 A;  4JI6 Q;  3I2Z A;  4DR7 Q;  4DR5 Q;  1XX8 A;  3PO3 B;  3I73 A;  2M2L A;  3F2B A;  4KTA A;  2CQO A;  1DOL A;  4QQB X;  2UXB L;  3BVM A;  2HCC A;  5BR8 Q;  4BY1 G;  1WTQ A;  3PGZ A;  1V43 A;  4UP9 A;  5H1S E;  2R92 B;  4G4K A;  2F0U A;  2YTY A;  4JYA Q;  3S24 A;  1HQM C;  3A8K E;  3KOJ A;  4QJF A;  3GTO B;  3TZD A;  4G57 A;  3S17 B;  1EEF D;  4X3T A;  4U67 3;  1CKN B;  1Q3L A;  1M90 C;  1F9Q A;  5FKA C;  1A8V A;  1HFG A;  2F3V A;  3GTQ B;  2K5N A;  1PFS A;  3I90 A;  4DV4 L;  3BDC A;  5C3E B;  5FLX E;  1G29 1;  2JSO A;  3GTL H;  3CCV A;  3RMH A;  3PUV A;  3NQT A;  1GO3 E;  3I4N B;  4RFB A;  5G3L D;  5IIF A;  1B44 D;  1EY7 A;  1IYU A;  5ELE A;  4B3S Q;  2L4N A;  5KYI A;  4J1M A;  1JE5 A;  3ER0 A;  3CCQ A;  1B53 A;  2OT2 A;  5I6Y A;  4DV1 Q;  2B3G A;  2EYM A;  3H3V H;  1G91 A;  2XRS D;  3HOV G;  4HIM A;  2PMZ E;  3V2T A;  1AN8 A;  2MJ8 A;  2LKV A;  4A3C H;  4KJN A;  4A3I G;  5EPK A;  4CKE A;  1II3 A;  3H6M A;  3V05 A;  4FF4 A;  4DV6 Q;  3L0O A;  2EOT A;  4LNQ A;  4DXG A;  1NSN S;  1X3Q A;  3KF6 B;  1C9O A;  3E5S A;  4S3S A;  3HOV H;  5C0X G;  1XTC D;  4LJZ C;  3H3V C;  4LF9 L;  1PRT C;  1PZI D;  3LWE A;  5C5L A;  3WOE A;  1D5Z C;  2RSN A;  4DR2 L;  4LF7 L;  2B63 G;  4PMB A;  4B3S L;  5E4W C;  2IHF A;  3NWT A;  4BBR H;  4A3F H;  5TSS A;  3J81 i;  3S1Q H;  4AYB E;  1LTR D;  1V1Q A;  4KY6 A;  2UUA Q;  3A5U A;  5DAU A;  5M5X B;  1OTC A;  4DFA A;  3UDG A;  5DLQ E;  5GAG C;  3NK9 A;  4K2L A;  4OO1 G;  5C4X H;  1HZ9 A;  2Q2T A;  4X65 L;  4Q5V A;  3X3M A;  3M85 A;  4BBS B;  1DYQ A;  4IAL A;  5CV4 A;  3S17 H;  2GVB A;  3STB C;  3L7Z C;  4DR2 Q;  1FJG L;  2JYO A;  4DR3 Q;  4HID A;  3OTO L;  1AEX A;  2KVM A;  3I56 A;  2Q2U A;  4YY3 L;  4ZUJ A;  1KRT A;  4DV5 L;  2KBN A;  2XGT A;  1CQV A;  1N34 L;  3L9A X;  2KED A;  1N34 Q;  3MFY A;  5C3E H;  5K36 G;  2IX3 A;  4LK1 C;  3E0J A;  3VR5 A;  3TQY A;  1XMQ L;  3GTL B;  2JE6 I;  1PH3 A;  3KUP A;  3O13 A;  2O2L D;  2WKD A;  3RR5 A;  5IP7 G;  3RNU A;  2AWO A;  2FXQ A;  3AFQ A;  5AJ3 L;  2AQ2 B;  1WTO A;  1EFI D;  4IJH A;  3HP3 A;  1XYI A;  3TZU A;  1IBK Q;  3K5M A;  4LFC L;  1TWA H;  1SNC A;  4JI8 Q;  1L1O B;  2JA6 B;  4LUO A;  3AYH B;  5EQ0 A;  1SMY C;  4APV A;  1MJE A;  1NBW A;  3L3O C;  2AQ3 B;  4QUC A;  5IYD G;  3AFP A;  3I7F A;  3M4P A;  5T1G A;  2Q8T A;  2NVY H;  1SJH D;  2XN9 C;  2UU9 Q;  5JPM C;  5LMU L;  1ROD A;  3ZYY X;  1VQK A;  2WB1 G;  3STB D;  4PG3 A;  4WOR A;  5JEA G;  2F4V L;  1A15 A;  4RAU C;  2EQS A;  2PZW A;  1EFW A;  3J80 L;  3NXW A;  5J39 A;  5M5Y H;  2E2H H;  1I94 Q;  2A73 B;  5CBA E;  4C3J G;  1YHB A;  2ZJP A;  1EIF A;  4KMU C;  3D4W A;  5ELB A;  4EQP A;  1BXT A;  4GOP A;  1I6H B;  4POG A;  3HOW G;  3MWY W;  2IHE A;  4YCW A;  4IPD A;  5HGQ A;  5DNF A;  4X64 L;  4I7A A;  1VQ8 A;  2AMC B;  2KCM A;  3S1Q B;  5IGG A;  3S2D H;  1RL2 A;  2QEX A;  3FPU B;  2VB3 X;  3NE5 B;  1I4G A;  4FXD A;  1X6O A;  3I4L A;  1QZG A;  1JOR A;  3A0J A;  1T5X D;  1ET6 A;  3MZ5 A;  1YVC A;  5EPJ A;  3WWV A;  1ESR A;  3MEF A;  1DXM A;  1F9S A;  1RDP D;  2R7Z B;  2UUC L;  2NYZ D;  4UDU C;  1ASY A;  1YHQ A;  2D62 A;  3A5Z B;  3G71 A;  2Q2H A;  4X64 Q;  1EYG A;  4LFA L;  4DV7 L;  2JA9 A;  2UXC L;  3A74 A;  1IW7 C;  1A3V A;  1E1T A;  5ISR A;  2R93 H;  2UUA L;  1L2F A;  3EVQ A;  3SK8 A;  2IPK D;  4RGN A;  3VA7 A;  2E5L L;  4KV6 A;  5CGK A;  1BO0 A;  1ENF A;  1U9R A;  3KYH C;  1Q8I A;  4A3E H;  2L15 A;  5M9O A;  2NZH A;  3QO2 A;  2N78 A;  4LF5 Q;  2TSS A;  3J7A V;  4BY7 H;  4I65 A;  1JWU D;  3PIP A;  1M1K C;  3D6C A;  3GV3 A;  4A3I H;  3HOY G;  2EYJ A;  2IWH A;  3SK4 A;  5BN3 A;  4ZKC B;  4DF7 A;  5KIX A;  5CV8 A;  4BA2 I;  1ONL A;  4Y52 H;  5D14 A;  3TEH B;  4A3M G;  4POF A;  2UXB Q;  5LMN W;  4CDE C;  2RKS A;  3RLO A;  3VR2 A;  4GNX C;  1Z9F A;  4HAE A;  1ASZ A;  1NNX A;  5BN4 A;  3Q6S A;  3T51 B;  2YYZ A;  3M9B A;  4CDD C;  1OO9 B;  1PHJ A;  2O5J C;  3PUX A;  1EZ6 A;  3CHB D;  1WTX A;  3SGI A;  4P2C B;  4A3D G;  2FJ2 A;  4DU9 A;  1GUO A;  4JI3 Q;  4NMZ A;  2NVT B;  1K28 A;  2K5V A;  4DR4 Q;  1MJC A;  2HCI A;  2LXJ A;  1NY4 A;  2E2H B;  4IUV A;  4FXK C;  1GHK A;  2F0M A;  2PQA B;  3ERO A;  2PPB C;  5EJW A;  1LLR D;  3C1E A;  2EE1 A;  4C56 C;  1YNJ C;  2TMP A;  1I6H H;  1XMQ Q;  3PUW A;  1BCP B;  2IY5 B;  4P73 A;  3K58 A;  1G2S A;  4DNT B;  2Y0S B;  3JAM E;  4JYA L;  4R8N A;  2WP8 J;  2JA7 B;  1VQ7 A;  4OEL B;  2X6L A;  1HFN A;  1FJG Q;  2IW3 A;  4HN7 A;  2J0T D;  4C1N I;  3UDI A;  4DKA C;  4C3I B;  1W3S A;  5KNB A;  1UWV A;  2F0K A;  1R4P B;  3GO5 A;  2F4V Q;  2R7D A;  3K0X A;  1S3O A;  3SXH A;  4IUP A;  1JOO A;  4EQO A;  4G7H C;  4G7O C;  2FFK B;  3LNN A;  4RMF A;  1PTO B;  2PW5 A;  1I5F A;  1QUQ B;  2H5X A;  1QE6 A;  5IGB A;  3SVM A;  4GKK L;  3EFX D;  1F9P A;  1LUZ A;  2HD3 A;  4DAM A;  1E0B A;  3KBG A;  1Y1V H;  1HHV A;  4ZAI A;  2K5D A;  4A3E B;  2I5M X;  3V96 A;  2ZXP A;  4L5S A;  3ERQ A;  3BYY B;  3I55 A;  2EVB A;  4XXE A;  4B9X A;  4WJ3 M;  3BDL A;  1OXS C;  4A3I B;  4KKS A;  5E4X A;  3DUZ A;  4ZK9 B;  5JJZ A;  3PO3 H;  5LHY 1;  1IZ6 A;  2F0D A;  1EQQ A;  3BZC A;  1KDA A;  4FNF A;  1S40 A;  3VDY A;  3D4D A;  2A6H C;  3B6Y A;  3FPP A;  3S1N H;  2AUK A;  1CKM A;  3I4M H;  2JA8 H;  1B70 B;  2F0G A;  4HCE A;  1PDQ A;  3H0G B;  3PMF A;  3VR4 A;  1DD2 A;  5JOB A;  5FLM H;  4NXM Q;  1Q8K A;  1BVS A;  3P1H A;  4KN7 C;  4QMG A;  3U50 C;  1JOK A;  3DEP A;  3AQQ A;  2I46 A;  2R61 A;  4LF8 Q;  2HDL A;  2LFN A;  2NUC A;  4A3B G;  2Q8I B;  4AYB B;  3I3C A;  2RDG A;  2VQE L;  4B3T L;  3MHB A;  3NBH A;  1K8M A;  2AUJ D;  4JC0 A;  4YIJ A;  4K0K Q;  2HIX A;  1WTW A;  2Z6K A;  3OWF A;  1J8I A;  5IWA Q;  1JJG A;  4L8J A;  1EY0 A;  3TP6 A;  2AHO B;  3WOF A;  1B9N A;  1WTH A;  2UUC Q;  2CFM A;  1J6Q A;  2QKI C;  5ELN A;  1VF7 A;  1Y8P B;  4LUZ A;  2F0O A;  1LT5 D;  4C3I H;  2RHQ B;  4NP5 A;  3G7L A;  1M8A A;  3KLR A;  1QVC A;  4K5V A;  4AQY Q;  1Z6H A;  1JCK B;  1C0A A;  2QEJ C;  2DGY A;  4JI4 L;  3EA6 A;  1LTA D;  1CUK A;  3HEJ A;  4DV3 L;  3GV6 A;  5CR3 A;  4C1N K;  1B50 A;  4N9P A;  1QJO A;  2D0P A;  2MHV A;  3S2H H;  4LW1 A;  3R93 A;  5FO8 B;  3NUC A;  3KFU A;  2KEN A;  1Q12 A;  1D5M C;  2A68 C;  1UUP A;  3DEO A;  2EDG A;  1WCM B;  5CV7 A;  4HJA A;  3HG9 A;  3TBI B;  4A3G G;  1A3U A;  4JI5 Q;  4IFD G;  5EKL A;  3CCU A;  3CCS A;  1Y8N B;  1KHI A;  4JOI C;  1C8C A;  4DNI A;  4WJW A;  1SMY D;  5M3F G;  2VNU D;  1D6E C;  4CDF C;  2B2T C;  3MTS A;  3W3A A;  1R9T B;  1WD1 A;  1MHW C;  1CZW A;  4NXN L;  4BBR B;  4UAI A;  3S1M B;  4BWG B;  2QDL A;  3ONA B;  2ZTC A;  4DK0 A;  2B39 A;  4YHH Q;  3PIP 3;  3H0G H;  3S16 B;  1SBB B;  4C3J B;  3CAM A;  4TRD A;  2VUM B;  3A55 A;  3HGB A;  3T1H L;  3MVV A;  4H44 C;  4JW0 A;  5A2Q E;  3D6W A;  3R8B A;  1KLU D;  1JB7 A;  1K8G A;  4JV5 L;  3CD6 A;  1K83 H;  2EY2 A;  2EJF C;  3RZD H;  4X66 Q;  3SHL A;  4BS9 A;  1GUS A;  1IL8 A;  1PTO C;  5CC4 A;  2PYK A;  1YJW A;  2QA4 A;  1SNO A;  4GLV B;  2NTT A;  1Y1W G;  2F52 A;  3I4O A;  4A3C G;  1Q90 A;  1XTD A;  4QUF A;  4YCV A;  2NZ1 D;  4NKL A;  1SYF A;  3F2C A;  2R7Z G;  1YIT A;  3MFG A;  1I50 H;  5HGT A;  1DZ1 A;  1WYD A;  2VQF L;  4PNY A;  1L1O C;  3QJY A;  4OL7 A;  1P16 A;  1FNW A;  2LSS A;  1K3R A;  1EYD A;  4JBK A;  1R4Q B;  1H95 A;  4TKO B;  4QGU A;  1IL2 A;  1BCP C;  1KD1 C;  3I4N H;  3OYY A;  4RGM A;  5C4J H;  3TS2 A;  3URY A;  3DLL A;  1GUG A;  2XRQ D;  1GKH A;  2WAQ B;  4RCN A;  4X6A H;  2I5H A;  4PZ8 A;  1VQJ A;  3HOY B;  1BDO A;  4NXN Q;  3DWQ A;  5COR A;  2R7F A;  1HXY D;  4C2M H;  3H15 A;  1IKL A;  2KHI A;  1ICW A;  2KHS A;  3T13 A;  2EY5 A;  1W6K A;  1EYA A;  1DOM A;  1M4V A;  3J7Y W;  2YU9 B;  4HMJ A;  2HHH Q;  1G6Z A;  4JI1 Q;  1N32 L;  5IYC H;  3JAM L;  1Q81 C;  3ULP A;  3AB9 A;  5C44 G;  1PFB A;  5EPL A;  2EXD A;  3R2I A;  2BA1 A;  2DUD A;  4A3F G;  1VQH A;  3GTG B;  1EIG A;  4A3D B;  2B2U C;  1TWC H;  3IL8 A;  5CV6 A;  1L0W A;  2C9O A;  3S2D B;  3NP8 A;  2B2W C;  1RIP A;  1LYL A;  5JJI A;  1J5E L;  2KJX A;  3TRE A;  1HR0 L;  2F0I A;  1STY A;  4HTH A;  1TS3 A;  4R4O A;  1RTN A;  1SFO H;  2KCN A;  4IOA A;  5JAV A;  5IGE A;  4Q0F A;  1Q82 C;  3FRP B;  2RHS B;  1CFM A;  1O7I A;  3EQL C;  4JI8 L;  2G5D A;  2GA4 B;  1Z7T A;  3FHW A;  1HTP A;  2LS0 1;  2JA7 G;  1SYC A;  3NBH B;  3RZD B;  2K5Q A;  4RKL A;  3S1R B;  4H7B A;  1HR0 W;  5E1F A;  3HOZ G;  2F0S A;  4IQZ A;  1TII D;  1HQR D;  3FKI B;  5C5M A;  5LL6 X;  4GLX A;  4IFD I;  1UEB A;  4KHZ A;  3HOX H;  2XSC A;  1QNU A;  2OWO A;  2ALY B;  1NMG A;  2CWP A;  4ID6 A;  1I50 B;  3U4Z A;  1DOK A;  1RD9 D;  3VR6 A;  2N55 A;  4JI7 L;  1VQI A;  3OMC A;  1VQD A;  1ILQ A;  2SNM A;  4AIM A;  1ZKO A;  1EL0 A;  2OQK A;  1STG A;  4DAP A;  3PF4 A;  3RZO B;  1HA5 A;  2JK8 A;  2HHH L;  2VZA A;  4A3E G;  3KBX A;  3CP0 A;  4EX5 A;  1A6X A;  2D2C C;  2A6H D;  4DR5 L;  4DUY Q;  5C3X A;  1NCV A;  3M3Y H;  2KHJ A;  1Q86 C;  4A93 G;  3IRB A;  3QG1 A;  4C2M B;  4DV2 Q;  1H9K A;  4DV2 L;  4LAA A;  2NVT H;  3CRL C;  4KD4 A;  1PRT F;  5I2Y A;  4LF9 Q;  1U4P A;  3PO2 G;  3RLF A;  2JA5 B;  1KAW A;  2NZO A;  4X3U A;  1JJ2 A;  1MI2 A;  1EY4 A;  2CH4 W;  2MFI A;  1C4Q A;  5HY6 A;  4UP7 A;  2VQE Q;  4B3T Q;  3KF8 B;  3NBI A;  3MXU A;  2B8G A;  3I91 A;  1RHP A;  1A2T A;  4YWM A;  1X3E A;  2JJQ A;  4CBV A;  4YWK A;  4K14 A;  1YNN C;  3ULL A;  1D1K A;  1NE3 A;  2MO0 A;  3GTG H;  4DV4 Q;  1VQG A;  3RN5 A;  1TWC B;  1GUN A;  1MIU A;  1ZYR C;  1AE3 A;  2R93 G;  5M5Y B;  4DK6 C;  1D1I A;  2E75 C;  2B2W A;  1YJ9 A;  1TXY A;  1TWH B;  4AYB G;  3M4O H;  3RLN A;  1GOZ A;  1S4Z A;  2D5D A;  3CC7 A;  1E3P A;  2B2V A;  3MAQ A;  3RN2 A;  3PIO A;  4KLK A;  1PTO H;  3HZX A;  4DK1 A;  2X69 A;  3C46 A;  2F3W A;  4GKJ Q;  1EZ8 A;  1CSP A;  2NBF A;  5K36 H;  1NMF A;  1WJJ A;  4DR1 Q;  1N33 L;  2D0O A;  3ND8 A;  1YNN D;  1AE2 A;  3I72 A;  3K7U C;  2UXD Q;  2E2J B;  4GN5 A;  1PH1 A;  1DJR D;  3T16 A;  3HOX B;  1I6V C;  1SNP A;  4MTK A;  5M3M G;  4L5T A;  1X56 A;  4LWC A;  1PH9 A;  3K8A A;  3A56 A;  2Z6K C;  3CCR A;  2M9V A;  3Q24 A;  4GOP C;  3CPW A;  1I4X A;  3CMA A;  1TS5 A;  4A3L H;  1E7Z A;  4KKU A;  4A3K G;  3M7N A;  1YNJ D;  1WOC A; 
#chains in the Genus database with same CATH homology
 2WIN B;  2JA8 B;  1OXV A;  4CKC A;  1F2M A;  4HR7 B;  4JK1 C;  5C6A A;  2A6E D;  2K5W A;  3DHQ A;  1ML0 D;  1GUT A;  2F0W A;  3H09 A;  4CGY B;  1LTB D;  1EY9 A;  1U4M A;  3ITP A;  2CW0 D;  1KAB A;  2FHT A;  1TVX A;  1PXU A;  2R3Z A;  3IAY A;  5ELF A;  4F88 A;  4CJ0 B;  1FD7 D;  4RH6 A;  2JXM B;  4IUU A;  2F4I A;  5I9P A;  1CTM A;  1FR3 A;  3GTP B;  4EGV A;  1FYC A;  2EYP A;  3TP8 A;  1U4R A;  3M4O B;  1EWH A;  1QG7 A;  2NN6 I;  2RSO A;  2B2V C;  1HCZ A;  5JVG 3;  2EYH A;  1TQO A;  2E74 C;  2BDN A;  2BCO A;  1BNZ A;  1BR9 A;  1C48 A;  1CM9 A;  3BS1 A;  1V1P B;  1TWG B;  4C3H B;  1ESF A;  3T4A C;  4XTC S;  4CKB A;  1IW7 D;  2F0N A;  4K6D A;  2K32 A;  1SYD A;  1CK1 A;  5COY A;  1S5D D;  3U9S A;  1O7Y A;  4K8I A;  1F2Z A;  5D65 A;  2I07 B;  1STB A;  4X3K A;  3HOV B;  4KJO A;  4F87 A;  4FO2 A;  1LT3 D;  1TWF B;  5ELD A;  1V1P A;  2WKC A;  4Z9C B;  2PZT A;  4NDX A;  3RUZ A;  1TS2 A;  4A3F B;  4H13 C;  3EJI A;  3N52 A;  2G9D A;  3OPO A;  1SJE D;  4XQN A;  5C4X B;  3U9O A;  3BVG A;  2RDH A;  2JEB I;  2K6A A;  3A7L A;  1D2B A;  3K5O A;  5IOC A;  5A35 A;  4XQJ A;  2EYF A;  2L5T A;  1PYW D;  2Z4H A;  3HOZ B;  1BF4 A;  3OW7 A;  1OXT A;  1EOT A;  1H9S A;  4IFD H;  1RJT A;  3K6O A;  4RKB A;  3P7J A;  2EPB A;  1B4O A;  3VYS A;  5DEH A;  1JIC A;  4A3J B;  1LAB A;  5C4H A;  1NUC A;  2ZT9 C;  1A2U A;  1MGS A;  1EEI D;  3OMG A;  3SE0 A;  3K57 A;  1H9J A;  5EKK A;  5EKI A;  4FVM A;  2SOB A;  2KEE A;  2XNA C;  3TP7 A;  1F2L A;  4RHR A;  4FF3 A;  3I70 A;  1A3T A;  3C1F A;  3NTK A;  1Q1B A;  1EY6 A;  5IT9 E;  4EQN A;  1HPC A;  2Z8L A;  2F0V A;  1VMP A;  3NSW A;  3FMC A;  1FGB D;  1ZXT A;  3DWA A;  1O7L A;  1PTO D;  4A93 B;  2RA4 A;  4KY7 A;  2KEC A;  2O4X A;  1S5C D;  2DY8 A;  1H9M A;  4FF1 A;  5KNC A;  5IOD A;  1ZEQ X;  2OEO A;  1U4L A;  1QIL A;  1OXX K;  1PZK D;  1BCP D;  3OWE B;  4QF4 A;  1SAP A;  4FXG C;  3CU7 A;  3NWS A;  3S9W A;  2F0J A;  1V8Q A;  4R9W A;  3UI2 A;  4HMI A;  4MIU A;  3T56 B;  2Z1C A;  1AP0 A;  3GTK B;  3A54 A;  4QIW B;  4HED A;  3VYU A;  3A8I E;  3QIA A;  1HUM A;  4RGO S;  5KYL A;  4HSP A;  2L11 A;  4DNR B;  2E76 C;  4TSS A;  4M8A A;  3TME A;  1ET9 A;  2A68 D;  1CA6 A;  1RTO A;  2EXZ A;  5FO7 B;  4J8Q A;  1W6J A;  2DNE A;  2PQE A;  4OIJ A;  3SK6 A;  1X3P A;  4Y7N B;  1WD0 A;  4K5X A;  2F0L A;  2QCP X;  3QOJ A;  2K04 A;  1EY5 A;  2L0C A;  4K5W A;  5I2X A;  1CHQ D;  1LTG D;  3MXP A;  2FMC A;  5CV9 A;  1VCI A;  2J7Z A;  4F7X A;  1AZP A;  1SEB D;  4XT1 B;  3TDQ A;  1QCB D;  3OIQ A;  1PFM A;  3D4R A;  1TY2 A;  4TQU S;  2F0E A;  2IX0 A;  1BCP F;  2MP1 A;  3OHX C;  1J9O A;  1NR4 A;  5FK9 C;  2KA7 A;  4FYD A;  3QWN A;  2XIW A;  5IGC A;  4IUQ A;  1EIH A;  4HCS A;  3VYT A;  4B08 A;  1E2W A;  3K59 A;  2RVL A;  4C3I G;  1PZJ D;  5I9O A;  1PTO F;  3OOC A;  4C3H G;  4IUN A;  2RBM A;  1I4P A;  5M5W B;  1BQQ T;  2WAC A;  2F03 A;  1KTK A;  4B9W A;  1I4H A;  3VYR A;  2WB1 B;  1E2V A;  3HKZ B;  2XWJ B;  1CHP D;  2X6G A;  2NB0 A;  2R6G A;  4F8M A;  3GTJ B;  2KCC A;  1H9S B;  3S1N B;  1SE2 A;  4ZYS A;  3TN2 A;  1HRJ A;  2IX1 A;  3HOW B;  3I4M B;  2B2Y A;  5NUC A;  1KNA A;  3PV0 A;  4FP5 D;  5E3F A;  4WRD A;  2HQE A;  2PO4 A;  3M3Y B;  2EZV A;  2OF1 A;  4XIG S;  1NR2 A;  4L6T B;  2NVQ B;  2PCF B;  3R2T A;  1CT1 D;  1NAP A;  2AQ1 B;  3OSO A;  1FNU A;  2F0Q A;  4CJ2 C;  1VMC A;  1KDB A;  3GTM B;  4I7Z C;  3H91 A;  3K7A B;  2ID0 A;  1BOS A;  2NWG A;  4QB4 A;  2L12 A;  2EYO A;  4N9T A;  1QWY A;  1HTL D;  1KDC A;  1TT2 A;  2EY6 A;  2G9H D;  5KRU A;  3SEB A;  1AZQ A;  3W2D A;  1HA6 A;  3J81 E;  2KQ3 A;  3IKJ A;  3MC0 B;  5FO9 B;  1PLF A;  5A2Q L;  1LTS D;  3NTI A;  2NTS A;  4A3M B;  2K1B A;  1WTV A;  1TY0 A;  1TU2 B;  5C3W A;  1SYB A;  3GQB A;  1WTR A;  2OXP A;  1QB5 D;  2L9H A;  1IKM A;  4CHT B;  4BY7 B;  3KF8 A;  1UEA B;  1HUN A;  3BYT B;  3A7A B;  1EY8 A;  2A74 C;  5JEA H;  3K0Y A;  1ENA A;  3E6Z X;  2BDO A;  2DNC A;  1GUW A;  2BE5 C;  1SNQ A;  1O80 A;  2ICI A;  1SNM A;  2IL8 A;  4MN3 A;  1PRT B;  1CI3 M;  3SR1 A;  1EU4 A;  1LT4 D;  2B2Y C;  2IJ0 A;  3D31 A;  4ME5 A;  2VB2 X;  3PIO 3;  4RHS A;  3P75 A;  4ULL A;  2F1M A;  1Y69 U;  3LWU A;  1Z47 A;  4L63 B;  3MA2 B;  5C4Z A;  4OIK A;  3IFT A;  2MPM A;  5FOB B;  5JEA J;  2EY1 A;  2N88 A;  3LX0 A;  4OHJ A;  3BG3 A;  1STH A;  5KEE A;  3D3R A;  1I4R A;  5KND A;  1GHJ A;  1EQV A;  1WVL A;  4DN4 M;  3BZD B;  3VA5 A;  3CKI B;  1B2T A;  3BVZ A;  2MGS A;  3K5L A;  3SK5 A;  3NPP A;  1ILP A;  1SDF A;  4RWS C;  1CQF A;  2EJM A;  2JP1 A;  4XT3 B;  3FEW X;  4ZLT F;  3NQI A;  1CA5 A;  1MBY A;  3I8Z A;  3J80 E;  2CQA A;  3A8J E;  4ZRZ A;  2ZXO A;  1STE A;  4ZQ3 A;  3RD4 A;  1LTI D;  3D8G A;  3H94 A;  2XWB B;  3WDN A;  1VF5 C;  2HUG A;  4RCO A;  2K28 A;  1IYV A;  2H1E A;  5C0X I;  1SSO A;  2DN8 A;  1ENC A;  5CV5 A;  5IGD A;  2QIL A;  3DXJ C;  2B2U A;  3IFD A;  2CHB D;  3G6J B;  3VR3 A;  4A3B B;  1S5E D;  3NHH A;  3N6R A;  3MEH A;  3Q22 A;  4WFN 3;  2H4O A;  5C0X H;  5IT9 L;  1IHZ A;  1ZYR D;  4OO1 I;  2QF7 A;  2E2I B;  5D3I B;  3ND9 A;  1RKN A;  5HUR A;  2E2D C;  3MXN A;  1T5E A;  1SXT A;  2SDF A;  1JR0 D;  5K5P A;  2K7V A;  1LAC A;  3TSS A;  1G8Z D;  4OO1 H;  3DM1 A;  3KLS X;  1E2Z A;  1SE4 A;  3M7G A;  3P20 A;  2V4D A;  2K01 A;  1TWA B;  1O7Z A;  1KLG D;  5J22 A;  5ELC A;  2EYL A;  2LMC B;  4A3G B;  3F2U A;  3SDZ A;  2K05 A;  5M3F B;  1TKW B;  1LV9 A;  1K8O A;  1RCV D;  2NVY B;  1O78 A;  4DGZ A;  2F0F A;  1TR5 A;  1WTP A;  1L0X B;  3QB3 A;  2RDF A;  1BUV T;  1I4Q A;  4IUR A;  4GZY C;  2BOS A;  3MXG A;  2A6E C;  4PQX A;  2WII B;  1EYC A;  5JPN C;  2PMZ B;  4ZKB B;  3DWP A;  4XYO A;  5CYU A;  2B2T A;  4BY1 B;  2ZXR A;  2XVS A;  5T1I A;  1BBX C;  3GP7 A;  4JBW A;  4XDX A;  1Y1W B;  4IUT A;  4KHV A;  4M1U B;  4IZ8 A;  4LMQ D;  3QOL A;  4K2K A;  3X3N A;  4O42 A;  2JEA I;  4K6L A;  2B8F A;  1SND A;  1S5B D;  4G7Z C;  2EJG C;  3KK7 A;  1S5F D;  3S14 B;  4V0B A;  4PV1 C;  5LL6 S;  5DM6 3;  3HS0 C;  1K83 B;  4FF2 A;  4HSV A;  2A5H A;  1F77 A;  4XQQ A;  2R93 B;  5G3L F;  3DMU A;  4IN3 A;  1UAP A;  3FDT A;  5D3D A;  4V19 0;  1JQY D;  1QOH A;  3CRK C;  1EU3 A;  5EBC A;  3KLS A;  1B3A A;  2ENB A;  2A69 D;  3CQZ B;  4KI0 A;  2SNS A;  3PUZ A;  5J1Z A;  1AFP A;  4H0L C;  4DAY A;  1B1Z A;  1STN A;  1DCZ A;  3R3O A;  1UNS A;  3C2P A;  1FNV A;  1EQT A;  1JE4 A;  2KUM A;  5C4J B;  5C44 B;  1SYE A;  1B9M A;  2NN6 G;  5EGT A;  4KK7 A;  1XWE A;  3T53 B;  1I3Q B;  4PMC A;  2DY7 A;  3AMU A;  5CBE E;  2L1B A;  1KNE A;  2WV6 D;  4DXF A;  4A3K B;  4RGT A;  2B63 B;  1VDZ A;  2J4X A;  3C3L A;  2LY7 A;  1QNK A;  1MSG A;  1RF2 D;  2SEB D;  2L55 A;  1JWM D;  1JOQ A;  1DM0 B;  3OIP A;  2C5C A;  2NVX B;  1V1O A;  3AU7 A;  1L0Y B;  1EWC A;  1SFO B;  2RQX A;  1Q1E A;  1Y8O B;  4KY5 A;  4X3S A;  1MD2 D;  4OGQ C;  3Q23 A;  4PMW A;  3M4Y A;  4ODG A;  5EBD A;  5JVH 3;  2IT1 A;  1F9R A;  1LO5 D;  3K5N A;  1Y1V B;  1TS4 A;  5F2D A;  5IGF A;  5FLX L;  1PFN A;  1CZG A;  1GXD C;  4J6H A;  5AFW A;  2D9U A;  2BE5 D;  4XYQ A;  3PUY A;  1D5X C;  4ABN A;  3PO2 B;  2A69 C;  5C0X J;  2MUY A;  1JB3 A;  4DA2 A;  3TP5 A;  4RA8 A;  5KGU A;  4MHE A;  5CMD A;  1AW7 A;  1LTT D;  2Z4I A;  4CJ1 B;  2FIN B;  2Q8R E;  1XXG A;  1OXU A;  3J7A F;  5DM7 3;  4BA1 I;  4R8I A;  1JWS D;  1LT6 D;  1H9R A;  1F2Y A;  4KD3 A;  4DAV A;  3Q0A A;  3S15 B;  4O1N A;  2PNR C;  2PZU A;  1PMR A;  4U68 A;  2M00 A;  5I4D A;  4NW2 A;  3GD7 A;  4KN4 C;  5BN5 A;  1JC7 A;  5M3M B;  1KAA A;  2O5I C;  2K03 A;  2QDB A;  1MSH A;  4ILW A;  2CW0 C;  3FVQ A;  2HDM A;  5I6W A;  3NTH A;  1GJX A;  3S2H B;  2AWN A;  2VXW A;  1X32 A;  2ICE C;  1PRT D;  3HOU B;  4EVO A;  4K8J A;  1SYG A;  4KKT A;  2F0H A;  4ZUI A;  2KOL A;  2BA0 A;  3BDO A;  2PW7 A;  4IFD J;  2CVR A;  2K33 A;  4QCL A;  1STA A;  3HRZ C;  1SE3 A;  2F0T A;  1G2T A;  2NN6 H;  2FMM A;  3J81 L;  1DON A;  2F0P A;  4E6I A;  1XX8 A;  3PO3 B;  3I73 A;  2M2L A;  4KTA A;  1DOL A;  3BVM A;  2HCC A;  1WTQ A;  1V43 A;  2R92 B;  4G4K A;  2F0U A;  1HQM C;  3A8K E;  3GTO B;  3TZD A;  4G57 A;  3S17 B;  1EEF D;  4X3T A;  4U67 3;  1Q3L A;  1F9Q A;  5FKA C;  1HFG A;  2F3V A;  3GTQ B;  3I90 A;  3BDC A;  5C3E B;  5FLX E;  1G29 1;  2JSO A;  3RMH A;  3PUV A;  3NQT A;  3I4N B;  4RFB A;  5G3L D;  5IIF A;  1B44 D;  1EY7 A;  1IYU A;  5ELE A;  2L4N A;  5KYI A;  4J1M A;  1B53 A;  2OT2 A;  5I6Y A;  2EYM A;  1G91 A;  2XRS D;  3V2T A;  1AN8 A;  2MJ8 A;  2LKV A;  4KJN A;  5EPK A;  4CKE A;  1II3 A;  3H6M A;  3V05 A;  4FF4 A;  2EOT A;  4DXG A;  1NSN S;  1X3Q A;  3E5S A;  4S3S A;  5C0X G;  1XTC D;  4LJZ C;  3H3V C;  1PRT C;  1PZI D;  3LWE A;  5C5L A;  3WOE A;  1D5Z C;  2RSN A;  4PMB A;  5E4W C;  3NWT A;  5TSS A;  1LTR D;  4KY6 A;  5DAU A;  5M5X B;  4DFA A;  3NK9 A;  4K2L A;  4OO1 G;  4Q5V A;  3M85 A;  3X3M A;  4BBS B;  1DYQ A;  4IAL A;  5CV4 A;  3L7Z C;  2JYO A;  1AEX A;  2KVM A;  4ZUJ A;  1CQV A;  3L9A X;  2KED A;  3MFY A;  5K36 G;  2IX3 A;  4LK1 C;  3E0J A;  3VR5 A;  3GTL B;  2JE6 I;  3KUP A;  3O13 A;  2O2L D;  2WKD A;  2AWO A;  2AQ2 B;  1WTO A;  1EFI D;  3HP3 A;  1XYI A;  3TZU A;  3K5M A;  1SNC A;  2JA6 B;  5EQ0 A;  1SMY C;  3L3O C;  2AQ3 B;  4QUC A;  5T1G A;  2Q8T A;  1SJH D;  2XN9 C;  5JPM C;  1ROD A;  3ZYY X;  4WOR A;  5JEA G;  1A15 A;  4RAU C;  2PZW A;  3J80 L;  3NXW A;  5J39 A;  2A73 B;  5CBA E;  4C3J G;  4EQP A;  4KMU C;  3D4W A;  5ELB A;  1BXT A;  1I6H B;  3MWY W;  5DNF A;  3S1Q B;  5IGG A;  3FPU B;  2VB3 X;  3NE5 B;  1I4G A;  4FXD A;  3I4L A;  1JOR A;  1T5X D;  1ET6 A;  3MZ5 A;  5EPJ A;  1ESR A;  1DXM A;  1F9S A;  1RDP D;  2R7Z B;  2NYZ D;  4UDU C;  2D62 A;  1IW7 C;  1A3V A;  5ISR A;  3EVQ A;  3SK8 A;  2IPK D;  4RGN A;  3VA7 A;  4KV6 A;  5CGK A;  1BO0 A;  1ENF A;  1U9R A;  1Q8I A;  5M9O A;  3QO2 A;  2TSS A;  3J7A V;  4I65 A;  1JWU D;  3D6C A;  3GV3 A;  2EYJ A;  2IWH A;  3SK4 A;  5BN3 A;  4ZKC B;  4DF7 A;  5KIX A;  5CV8 A;  4BA2 I;  1ONL A;  5D14 A;  2RKS A;  3VR2 A;  4HAE A;  5BN4 A;  3Q6S A;  3T51 B;  2YYZ A;  1OO9 B;  2O5J C;  3PUX A;  1EZ6 A;  3CHB D;  1WTX A;  4P2C B;  2FJ2 A;  4DU9 A;  1GUO A;  4NMZ A;  2NVT B;  2HCI A;  2E2H B;  4IUV A;  4FXK C;  1GHK A;  2F0M A;  2PPB C;  3ERO A;  5EJW A;  1LLR D;  3C1E A;  2EE1 A;  4C56 C;  1YNJ C;  2TMP A;  3PUW A;  1BCP B;  3K58 A;  1G2S A;  4DNT B;  2Y0S B;  3JAM E;  4R8N A;  2WP8 J;  2JA7 B;  2X6L A;  1HFN A;  2IW3 A;  4HN7 A;  2J0T D;  4C1N I;  4C3I B;  5KNB A;  2F0K A;  1R4P B;  3GO5 A;  3SXH A;  4IUP A;  1JOO A;  4EQO A;  4G7H C;  4G7O C;  2FFK B;  3LNN A;  1PTO B;  2PW5 A;  1QE6 A;  5IGB A;  3SVM A;  3EFX D;  1F9P A;  1E0B A;  3KBG A;  1HHV A;  4ZAI A;  2K5D A;  4A3E B;  3V96 A;  2ZXP A;  3ERQ A;  3BYY B;  2EVB A;  4XXE A;  4B9X A;  3BDL A;  1OXS C;  4A3I B;  4KKS A;  5E4X A;  3DUZ A;  4ZK9 B;  5JJZ A;  5LHY 1;  2F0D A;  1KDA A;  4FNF A;  3D4D A;  2A6H C;  3FPP A;  2AUK A;  2F0G A;  4HCE A;  1PDQ A;  3H0G B;  3PMF A;  3VR4 A;  1DD2 A;  5JOB A;  3P1H A;  4KN7 C;  4QMG A;  1JOK A;  3DEP A;  2I46 A;  2R61 A;  2HDL A;  2LFN A;  2NUC A;  2Q8I B;  4AYB B;  3I3C A;  2RDG A;  3MHB A;  3NBH A;  1K8M A;  2AUJ D;  4YIJ A;  1WTW A;  3OWF A;  1J8I A;  4L8J A;  1EY0 A;  3TP6 A;  3WOF A;  1B9N A;  2QKI C;  1VF7 A;  1Y8P B;  2F0O A;  1LT5 D;  4NP5 A;  3G7L A;  1M8A A;  3KLR A;  4K5V A;  1Z6H A;  1JCK B;  2QEJ C;  3EA6 A;  1LTA D;  3HEJ A;  3GV6 A;  5CR3 A;  4C1N K;  1B50 A;  4N9P A;  1QJO A;  2MHV A;  3R93 A;  5FO8 B;  3NUC A;  1Q12 A;  1D5M C;  2A68 C;  1UUP A;  3DEO A;  2EDG A;  1WCM B;  5CV7 A;  3HG9 A;  3TBI B;  4IFD G;  1A3U A;  5EKL A;  1Y8N B;  1C8C A;  4WJW A;  1SMY D;  2VNU D;  1D6E C;  1R9T B;  2B2T C;  3MTS A;  3W3A A;  1WD1 A;  1CZW A;  4BBR B;  4UAI A;  3S1M B;  4BWG B;  3ONA B;  4DK0 A;  2B39 A;  3PIP 3;  3S16 B;  1SBB B;  4C3J B;  4TRD A;  2VUM B;  3A55 A;  3HGB A;  3MVV A;  4H44 C;  5A2Q E;  3D6W A;  3R8B A;  1KLU D;  2EY2 A;  2EJF C;  3SHL A;  4BS9 A;  1GUS A;  1IL8 A;  1PTO C;  5CC4 A;  2PYK A;  1SNO A;  2NTT A;  1Q90 A;  4QUF A;  2NZ1 D;  4NKL A;  1SYF A;  3MFG A;  5HGT A;  1DZ1 A;  4PNY A;  3QJY A;  4OL7 A;  1FNW A;  1EYD A;  1R4Q B;  4TKO B;  1BCP C;  4RGM A;  3URY A;  1GUG A;  2XRQ D;  2WAQ B;  4RCN A;  3HOY B;  1BDO A;  3DWQ A;  5COR A;  1HXY D;  1IKL A;  1ICW A;  2KHS A;  3T13 A;  2EY5 A;  1W6K A;  1EYA A;  1DOM A;  1M4V A;  3J7Y W;  2YU9 B;  4HMJ A;  1G6Z A;  3JAM L;  3AB9 A;  1PFB A;  5EPL A;  3R2I A;  2BA1 A;  3GTG B;  1EIG A;  4A3D B;  2B2U C;  3IL8 A;  5CV6 A;  3S2D B;  2C9O A;  3NP8 A;  2B2W C;  2KJX A;  2F0I A;  1STY A;  4HTH A;  1TS3 A;  1RTN A;  2KCN A;  5JAV A;  5IGE A;  4Q0F A;  3FRP B;  1CFM A;  3EQL C;  2GA4 B;  1Z7T A;  1HTP A;  2LS0 1;  1SYC A;  3RZD B;  2K5Q A;  4RKL A;  3S1R B;  4H7B A;  5E1F A;  2F0S A;  4IQZ A;  1TII D;  1HQR D;  3FKI B;  5C5M A;  5LL6 X;  4IFD I;  4KHZ A;  2XSC A;  1QNU A;  4ID6 A;  1I50 B;  1DOK A;  1RD9 D;  3VR6 A;  2N55 A;  3OMC A;  1ILQ A;  2SNM A;  1ZKO A;  1EL0 A;  1STG A;  4DAP A;  3RZO B;  1HA5 A;  3KBX A;  1A6X A;  2D2C C;  2A6H D;  5C3X A;  1NCV A;  3QG1 A;  4C2M B;  1H9K A;  4LAA A;  3CRL C;  4KD4 A;  1PRT F;  5I2Y A;  1U4P A;  3RLF A;  2JA5 B;  4X3U A;  1MI2 A;  1EY4 A;  1C4Q A;  3NBI A;  3MXU A;  2B8G A;  3I91 A;  1RHP A;  1A2T A;  4CBV A;  4K14 A;  1YNN C;  1D1K A;  1TWC B;  1GUN A;  1ZYR C;  5M5Y B;  1D1I A;  2E75 C;  2B2W A;  1TWH B;  1GOZ A;  1S4Z A;  2D5D A;  2B2V A;  3MAQ A;  1PTO H;  3HZX A;  4DK1 A;  2X69 A;  3C46 A;  2F3W A;  1EZ8 A;  2NBF A;  5K36 H;  3ND8 A;  1YNN D;  3I72 A;  2E2J B;  1DJR D;  3T16 A;  3HOX B;  1I6V C;  1SNP A;  3A56 A;  2M9V A;  3Q24 A;  1I4X A;  1TS5 A;  4KKU A;  3M7N A;  1YNJ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...