2EYHA

Crystal structure of staphylococcal nuclease mutant t62s
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
135
structure length
135
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFSKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Staphylococcal nuclease
publication title Threonine mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 38
structure length 135
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2005-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2eyhA00
1EY0A 3TP8A 2F0GA 5IGBA 5J1ZA 4J1MA 3S9WA 4HMJA 1JOKA 2PYKA 2QDBA 3NP8A 3EROA 2EYOA 4R8NA 4E6IA 5EKKA 5C6AA 5M9OA 4F7XA 3MEHA 1EY7A 1EY5A 4KTAA 5KEEA 3BDCA 4EQOA 1EY6A 4QF4A 2F0HA 1EYDA 2SNSA 1KDCA 3ERQA 3ITPA 2F0JA 2WACA 1NUCA 4NKLA 5CV8A 4K5VA 5EKLA 4YIJA 1KDAA 3MVVA 4DFAA 5DAUA 5F2DA 1STBA 2F0KA 2NUCA 4NP5A 5IGEA 4B9XA 3BDLA 3SK6A 3U9OA 2OF1A 1EZ6A 5KYLA 1EYCA 5I9PA 1EY4A 1A2UA 1EQVA 2F0VA 2EYPA 2OEOA 3HEJA 4KY5A 2HQEA 1TT2A 3R3OA 4IUNA 1JORA 1EY8A 4ZUJA 4TRDA 3SXHA 1SYDA 2EYJA 2PW7A 1SNMA 5JAVA 4K5WA 2PZTA 4I65A 1JOOA 3NHHA 5C5LA 4QMGA 5NUCA 3V2TA 4EQPA 5C3WA 2KQ3A 1SNPA 2F0LA 3T13A 3VA5A 1A3VA 1NSNS 5I6YA 3TP7A 1SNDA 2EY5A 3NQTA 3DHQA 3E5SA 3SR1A 2PW5A 2EYFA 5K5PA 4HMIA 4K14A 2EYLA 3C1FA 5KIXA 2SOBA 1SNOA 2EY1A 2RKSA 3C1EA 4DU9A 1EYAA 2F0EA 5KYIA 1F2ZA 5EGTA 4KV6A 3OMCA 1STGA 5HURA 1A3TA 2RBMA 1EY9A 4K8IA 4N9TA 3P1HA 5JOBA 3SK8A 3DMUA 3RUZA 4RKBA 2F0WA 2SNMA 2F0MA 4K8JA 4KY7A 4G57A 4DF7A 1KDBA 3SHLA 3D4WA 1STAA 4DGZA 1STNA 5I9OA 4J6HA 1STHA 4QB4A 2F0UA 5DEHA 4RKLA 4PNYA 4ZQ3A 4F8MA 5IGGA 1SNCA 4K6DA 2OXPA 2EYHA 3MHBA 1F2YA 3OWFA 5C5MA 1SNQA 5C4HA 4ZUIA 2F3WA 3HZXA 5CR3A 3PMFA 2PZUA 5CV9A 3D6CA 2EYMA 2M00A 3MZ5A 2EY2A 4K2LA 4EVOA 4IZ8A 2ENBA 5E3FA 5CV5A 3QOLA 2F0IA 1ENAA 3D8GA 1II3A 2F0TA 3EJIA 3NXWA 3T16A 4ID6A 5C3XA 3LX0A 4LAAA 4WORA 3TP6A 1F2MA 5E1FA 5J39A 2F0OA 4H7BA 1SYCA 3QOJA 5CV7A 4PMBA 1A3UA 4NMZA 1U9RA 3H6MA 2F0SA 1TQOA 2PZWA 2PQEA 3SK5A 5IODA 1SYBA 4KHVA 1TR5A 3QB3A 5CC4A 5CGKA 5J22A 1ENCA 2F0QA 4K5XA 4KJOA 4WRDA 1AEXA 3NUCA 1KAAA 3SK4A 3EVQA 2EY6A 3MXPA 2F0FA 3TMEA 4ODGA 2F0NA 1SYEA 1SYFA 3P75A 5CV6A 5IGDA 4NDXA 4PMCA 1EZ8A 3TP5A 1JOQA 2F0PA 2EXZA 4EQNA 5IGCA 4KD3A 5ISRA 1IHZA 5C4ZA 3OMGA 4KJNA 4N9PA 5CV4A 4KY6A 4K2KA 2O4XA 5IIFA 3OSOA 3D4DA 4KD4A 4HTHA 4ME5A 4B9WA 1A2TA 5KRUA 5HGTA 1STYA 5IGFA 1RKNA 2F3VA 4IALA 5KGUA 2RDFA 5IOCA 2LKVA 1SYGA 2F0DA 4MIUA 5I6WA 1KABA 4S3SA 2KHSA 3NK9A 4OL7A
chains in the Genus database with same CATH superfamily
3CQZH 1W2BA 2K04A 2E5LQ 1XNQQ 1CT1D 4R8NA 3S16B 2CQOA 1VF7A 2UUBQ 1NY4A 2Q2UA 3ERQA 3T56B 3DLLA 4NKLA 4K5VA 4KHPQ 1TWGH 4R4QA 3HOZG 3HKSA 3O13A 4P71A 2O5JC 2JE6I 5I9PA 3OHXC 5C4XH 4ZKCB 1B3AA 1KTKA 2B63G 1OXTA 5GAEC 2I5MX 2R7FA 1HZ9A 5IGCA 4QMGA 3DUZA 4DR2Q 4WFN3 1HTPA 1PTOF 1GUTA 4C3IB 3I4NG 2K03A 1TS5A 3A8IE 2JA7G 1HNZQ 1JT8A 2E76C 3RZOH 3I4MG 4DV6L 3CF5A 4C3HB 2HDLA 5BR8Q 2B2TA 2I07B 1NAPA 5FKAC 4BY1G 2H5XA 3RLNA 1BDOA 1EIGA 1IZ6A 2K5NA 1I94Q 2Z9HA 4GNXB 4YHHL 1BCPB 2F4VQ 5IGGA 1FR3A 3K0YA 4FP5D 2GA4B 4X65Q 5ELDA 2EYMA 1JJ2A 2EY2A 4C1NI 2IX1A 4IZ8A 1ENAA 1V9PA 3GTMB 5LL6X 3LX0A 3TP6A 3AQQA 1PFSA 1MHWC 4HJ8A 2ZJPA 4JBMA 4B3SL 1VMPA 4Y7NH 3CP0A 4DK6C 3HOXG 4IOAA 2NWGA 5FLMG 3EVQA 3I55A 1SYEA 3WWVA 5GAHC 2VNUD 3HOZB 4KD3A 5C4ZA 4UP9A 3HOYG 4A4IA 5IIFA 2R7DA 4TSSA 1QZGA 5M3FG 3D4DA 1SAPA 4GKKL 1RODA 3E0JA 2B63B 4JI7L 2F0DA 4MIUA 4DXGA 2B2UA 4BBSB 3PF5A 3LWEA 3MEHA 5C3EG 2Z0SA 2JA7B 2FFKB 2RDGA 2IHFA 4KHZA 1GUOA 3D6WA 1HR0Q 3CCQA 4V0BA 1NR4A 1XNQL 3L0OA 3J7ZC 1HH2P 4MTNA 3VYSA 2A6ED 1DXMA 4KHPL 4I7ZC 4OIKA 3IAYA 3OIPA 2EJGC 3M4OB 4ZAIA 1S3OA 4PZ6A 4IFDG 1HUNA 3IFDA 2K52A 1SLJA 1A3VA 2L12A 1SNDA 1CHPD 2JYOA 1VQKA 2PW5A 4NB3A 1RF2D 4H44C 4H13C 1G6ZA 2L4NA 1DZ1A 3CD6A 2Q8IB 5L37A 1VMCA 4A3JG 1BKBA 1ZEQX 4DAMA 5E4XA 5JPMC 3A74A 2RBMA 4PMWA 1EY9A 3PSIA 3J81L 3IKJA 3M7GA 4RKBA 3RN2A 4HIOA 3PQIA 1LABA 3H3VC 3SHLA 3HOXB 3G48A 4A75A 5IT9E 4XXEA 2BDNA 1E1OA 2EYHA 3K7AH 2XRQD 1Q12A 3FMCA 1MJCA 4A93H 3I2ZA 1S5BD 3C2PA 3AMUA 3HOYB 5JVG3 1H95A 4LUOA 4LNQA 5M3MH 4FF4A 3FEWX 1CKMA 3BZCA 1K8GA 1EWIA 1LUZA 2N78A 1E0BA 3CMAA 4DPGA 1CSPA 3UDGA 2E2JH 1SYCA 1PV4A 2O2LD 2HHHL 1YHQA 4NMZA 4YY3Q 5FLXc 4H02A 5DM73 1CQFA 2PZWA 2KCMA 1EEFD 1SMYC 4UDUC 2L9HA 2PQAA 4DR3L 1PHJA 3PGZA 5COYA 4OGQC 1I4XA 4A3GG 1Z47A 4PV1C 4GLVB 1KNAA 3ONAB 3KF8B 4A3KH 3NWSA 3MFYA 2VS1A 4OELB 5C44H 3NWTA 1BCPF 1O7ZA 3GTJB 2RDFA 2MO1A 1S5DD 4GS3A 2L55A 3HOVH 2QA4A 5IGBA 1XPOA 5J1ZA 4J1MA 4L8JA 5IP7G 5IP9G 2PYKA 3RNUA 1LT4D 1YEZA 1H9JA 2B2WA 1GM5A 1DYQA 4QF4A 4CDDC 2F0HA 1XNRL 1EYDA 4ZK9B 1TWFH 1CK1A 2WACA 1Y8PB 1STBA 4A3JB 1GUWA 1HHVA 5D3DA 4LF4Q 4DUYQ 1EIFA 1STEA 2F0VA 3ULJA 4KY5A 3HEJA 1VQCA 3QIAA 1K73C 2TSSA 2EYJA 2UUCQ 1BBUA 2UUAQ 1I5FA 4K5WA 3KF6A 5EPKA 1MBYA 1LTBD 2K5QA 4DUZQ 4DV3Q 1GUGA 4YWKA 3CKIB 1BXTA 1EYGA 2QW7A 4LF8Q 1TWHH 1EOVA 3PO2G 3CCLA 2SOBA 1U4RA 4EQ5A 5A2QE 1OO9B 3CCUA 5M5YB 2NB0A 4K6LA 5EGTA 3Q0AA 3F1ZA 2A1AA 4KKSA 1NBWA 2VQEQ 1GHJA 4ILWA 4DV5Q 2NVYH 3DXJC 3J80c 1KLGD 2EVBA 4K8JA 5IE8A 1KHIA 3EN2A 1ESRA 1HZAA 4F8MA 1I3QH 2XSCA 1U4MA 2EE1A 2VZAA 2DNEA 2VL6A 1RTOA 1Q81C 1TU2B 3D6CA 3S17H 3STBC 3RD4A 4EGVA 2F0IA 4U673 2ID0A 5LMNW 2ZXRA 5C0XH 1TKWB 5FOBB 3NPPA 2N55A 1HZCA 3PUWA 4OX9L 1QUQA 3OTOQ 4JCVE 4IFDJ 5EQ0A 1TQOA 1TS2A 1HCZA 1LYLA 3T1HQ 1H9MA 1E7ZA 4X3TA 1VQGA 1VQLA 3NTKA 3J7YW 4ODGA 4BXXG 1Y8OB 2CQAA 1DJRD 4JBKA 2K7VA 2F1MA 1GHKA 4LFAQ 4KN7C 1IBLQ 1V1PB 1NMGA 5IYCG 1YNJC 4XIGS 1RKNA 4LUVA 1PRTC 5KGUA 2CW0C 5I6WA 1ILQA 1KABA 1C9OA 2C9OA 2G5DA 1TWCH 2ZXPA 1MSGA 4OWWB 1RJTA 1LTRD 4LF7Q 1M90C 2NZ1D 1KDCA 4R4OA 2WIIB 1LLRD 1L1OC 1JR0D 3CCEA 2F4IA 2E2DC 1Q8KA 5BN3A 1EZ6A 3PO3G 1EYCA 1WTPA 1J8IA 2OEOA 2LS01 1GD7A 4C3JB 4KI0A 3NQIA 1L0XB 1SFOH 2E75C 4GKJL 2JA8B 2IY5B 5AJ3Q 4LF4L 4DUYL 2KQ3A 3TRZA 3MXNA 1W6KA 1A6XA 1UEBA 2UUCL 2DY7A 5JJLA 3NQTA 3E5SA 4DUZL 3K0XA 4DV3L 1Q3LA 4DU9A 3BS1A 4LF8L 4AYBG 1X56A 3GQBA 1T5EA 3BDOA 3QR8A 4P74A 3HOUH 2XIWA 3JAME 2Q2TA 3U58A 5ELEA 2F0WA 4DN4M 4A3EH 1E3PA 4NXMQ 4J6HA 4O42A 3T51B 1PH1A 4GOPB 3OWFA 4JI3Q 1UWVA 2DGYA 3GV3A 2WINB 4UP7A 4CDCC 1CHQD 1P8LA 3I91A 3PV0A 1BBWA 5C3XA 3K6OA 4RCNA 1N33Q 1B9NA 1X3QA 1H9RA 3KLWA 1U9RA 3S16H 2LXJA 1V1QA 5J22A 4B3RQ 3MAQA 1L0YB 3TMEA 3OTOL 1NR2A 4IUQA 1DOLA 2MHVA 5IT9L 2O5IC 1WTRA 3PO3B 1D5ZC 3S2DB 3CPFA 3K59A 4ME5A 3I90A 4B9WA 3TEHB 2JK8A 4JI2L 3CC2A 3OW7A 2ATWA 3OPOA 5IOCA 4LFAL 1A15A 4OO1H 3TP8A 3S9WA 4C3IH 2JA6G 1CA5A 2B3GA 4GLAC 5EKKA 4GNXC 5KEEA 1BCPC 5M5WB 1EWCA 4C1NK 1ICWA 4NPSA 1SJHD 1AN8A 3F2UA 4C3HH 4LF5L 4AYBB 4AIMA 3P20A 1JWMD 4ZKBB 1XPUA 5KYLA 1FJGQ 1TS4A 2L1BA 2EYPA 3A7LA 3SXHA 1SYDA 2PMZB 2HIVA 5HGQA 4JI4Q 1EQTA 4RMFA 3D0FA 1PA6A 2LSSA 3CMEA 2SEBD 1JQYD 4IPHA 3GTMH 1TY0A 1YIJA 1X3FA 2MQHA 3KDFB 3SVMA 2PMZE 4IPGA 3A7AB 1Z9FA 4UY8C 3DWAA 4B3ML 2PPBC 1ET9A 1CKOA 1VQ4A 3SK8A 2X69A 3D31A 1UEAB 4DF7A 1WTXA 3GTOB 4X6AH 3L3OC 1SNCA 2A6HC 4L5QA 4DAVA 4DV1L 2XVSA 5C4HA 2BA0A 3OOCA 3A55A 3HOZH 3NBIA 5E4WC 1JC7A 4NXML 3FDTA 1OTCA 4OXPA 2IWHA 1PDQA 2B63H 4JI3L 3CRLC 5ELBA 2VB3X 2OTLA 1JCKB 1PRTB 4CBVA 1FD7D 1WTHA 2BCOA 5FO9B 1I4QA 4BBSH 1PH5A 3S2HB 1FVIA 1PTOD 1A3UA 1WFQA 4KK7A 2Z1CA 1N33L 1TVXA 2PQEA 5JEAG 4KHVA 2JA7H 2DN8A 4XQNA 1T5XD 3X3MA 1Z7TA 2F0FA 1NE3A 3A0JA 1C7YA 4PMCA 2F0PA 1D5MC 2EXZA 5ISRA 4C56C 1IXRA 3VR3A 4B3RL 4L63B 3Q6SA 2K33A 1L1OA 2XN9C 1PYWD 3G4SA 1HFGA 4ZYSA 3STBD 3M4OH 4GLXA 1K3BC 5FO7B 2R7ZG 2BA1A 3NK9A 1PFMA 2CVRA 2MP1A 2ZTCA 1XMQQ 4LFCQ 4O1NA 1QILA 4JV5L 4DR4L 3ZYYX 4E6IA 4RCOA 1LTSD 4KTAA 4FXDA 1A63A 3BDCA 1VQNA 4HSVA 4J8QA 3R8BA 2A8VA 3T1YQ 1WTQA 3KFUA 2EOTA 2B39A 1PH6A 4DAYA 1EY8A 3HOXH 2YYZA 2B29A 5FLMH 1SNMA 2KJXA 4CJ1B 1N32L 2YTYA 4RGNA 3HGBA 4FF3A 2CW0D 2KHIA 3E9IA 4Q0FA 2DUDA 4AQYQ 3HOYH 3OWEB 5D14A 2EY5A 4X66Q 4OONA 4HMIA 2K1BA 3UE1A 2ZM6L 5FLXE 4DNTB 2NVTB 3OMCA 1A3TA 3BVZA 1FGUA 3RMHA 2VUMG 4L5TA 5DLQE 3P1HA 4QIWB 3NTHA 2DJGC 1MIUA 4N8FA 1TIID 5DEHA 4ME3A 1DONA 2RVLA 1SNQA 3AYHB 3D3RA 3GV6A 4ZUIA 2R93G 3OW2A 1F9RA 4QIWE 2VQFL 2JP1A 1DCZA 3T16A 3AFQA 4PZ7A 2H1EA 1RIPA 3N52A 1XMOL 2EDGA 3GTJH 1S72A 1Q46A 1MKHA 1G6PA 2F0OA 4IFDH 3DEPA 2A73B 4LF6Q 1CFMA 5H1SE 2JN4A 3S14B 1JJGA 4BA2I 2R3ZA 1DM0B 1HUMA 5IODA 2RHSB 3L7ZC 2QDLA 2AQ3B 1ENCA 1F9QA 2RCNA 3RLOA 4JPBW 4QQBX 4HR7B 2C35B 4GNXA 3J7A5 5T1IA 3H15A 1VQBA 3P75A 4NDXA 4LFBL 2K6AA 4A3JH 4RGMA 2KA7A 2MJ8A 4G7ZC 4UHVA 2WKDA 4PG3A 1SJED 5BN5A 4HTHA 3CPWA 1QVCA 2F3VA 2ICEC 1B44D 4DV2Q 1PH4A 3T53B 4A3BG 1EY0A 4FF2A 2MUYA 1Z6HA 2OQKA 4DV0L 2EYOA 1EY5A 2VW9A 1ZXTA 2F0JA 3BJUA 2A68C 3HG9A 4OWXB 3J80E 4A3LG 1PRTF 3RLFA 5M5YH 4QGUA 1Y69U 3TS2A 1HXYD 3U9OA 4CDEC 1P16A 1D7QA 4GN3B 1OXXK 2QF7A 3K5LA 5JEAJ 3T1YL 2PW7A 2CKZB 1WYDA 1Q1EA 4AH6A 4P73A 3W1BA 5KNBA 2K32A 3NENA 5C3WA 2QGQA 3TQYA 3I4NB 2B8FA 4DV4Q 4I7AA 3Q8DA 3VA5A 4H0LC 2CWPA 1YNXA 4RFBA 4ABNA 2ZTEA 3I4MB 1RD9D 4R9WA 2Q2HA 2E5LL 1YNNC 1BCPD 4AQYL 3GO5A 4BY1B 3KJOA 3W2DA 1W3SA 2UUBL 4YCUA 3QG1A 1Q8IA 1FNWA 4PZ8A 3NTIA 5IP7H 4MZ9A 1X32A 1ZYRC 1I6HB 1IKLA 4C2MB 4DK0A 2B8GA 3BG3A 4DGZA 4DR5Q 3ERSX 2F0UA 4PNYA 1LTAD 4JI0Q 2R92G 1O78A 3M3YB 1K8OA 3TZDA 2AQ2B 2F3WA 1PH7A 5FO8B 1IW7C 4JBJA 2HUGA 4DR2L 4YCVA 1KD1C 1HNWQ 3F2CA 2ZXOA 1G2TA 3F2BA 1H9SB 1FYCA 1F2MA 1CKNB 1LT6D 2BH2A 1QJOA 3FKIG 1VQPA 1HNZL 1S5CD 3QOJA 4A3BB 4PMBA 5TSSA 1JE4A 2J0TD 1EFWA 2CFMA 5BR8L 1AFPA 1SE8A 3BZDB 5GAGC 2KEDA 3UDFA 1IKMA 3CXCA 1K83B 4FXKC 1YJNA 2BE5C 1SYFA 1O7IA 1K8AC 1D1IA 1I94L 1Q7YC 1JOQA 2X6GA 1IHZA 1I50B 2NZHA 2F4VL 1NCVA 3VDYA 2RHQB 1V1OA 5CV4A 5M3FB 4IQZA 1QNUA 3K80C 4C3JH 1A2TA 5KRUA 4POGA 3H3VH 4X65L 2JA8H 5DM63 2NVXB 2KHSA 3C46A 1JOKA 1YBYA 2LY7A 5M9OA 3EROA 5C6AA 5C3EB 1X3PA 2KENA 3KK7A 4GOPC 4A3MG 2UXCQ 4POFA 4YIJA 4DFAA 2XWJB 2NTSA 3L9AX 3S24A 2F0KA 2NUCA 2K5VA 1TWGB 1WCMG 5K36H 2N49A 5T1GA 4JOIC 3KF8A 4JYAQ 1GJXA 2ZTDA 4A3DG 4DR6Q 1UNSA 3PUVA 1ENFA 3VA7A 5CBAE 5JAVA 4BXXH 2WV6D 2KCCA 3S15B 1UE1A 1A0IA 2R92B 2VY3A 3FPPA 5CORA 1IBKQ 1GUSA 3TP7A 4LF9Q 1QB5D 4DR1Q 5K5PA 4K14A 2EYLA 2FHTA 4F87A 4K0KQ 4Y52H 2WAQG 1I4GA 2BH8A 2HD3A 2AWNA 1E24A 1ASYA 1CZGA 2Z6BA 3F2DA 3FKIB 1OXVA 4GZYC 5HURA 1HR0L 5LL6S 3BZKA 1KDBA 2NVQB 4IUPA 1SR3A 2A5HA 3PIP3 4RG1A 3NSWA 1DGSA 4LJZC 4JK1C 1ICFB 3PO3H 2NZOA 3CCSA 3S2DH 1X65A 4JI0L 3GTLB 1II3A 2F0TA 5ELOA 3N6RA 3E0EA 1VQOA 1B3QA 5FLXL 2IW3A 1KRTA 3H6MA 1HNWL 4LK1C 3NBHB 5M5WH 4A3MB 4YWLA 3TN2A 4X3SA 4CKEA 1QCBD 1Y8NB 2N88A 4A3GB 3A8KE 3MA2B 1WCMB 2AQ1B 4A93G 5LHY1 4X3KA 5M3MG 4A3DB 3M4QA 4XTCS 2E74C 1WI5A 4HSPA 2XRSD 4HJ7A 5ELFA 4YY3L 2B2VC 3J7AF 3I56A 3S1QB 3S1MB 1AW7A 1NUCA 3U4ZA 1B1ZA 3RN5A 5DAUA 3HKZG 5IGEA 4WJWA 2A19A 4XT3B 5CBEE 2JEBI 3JAMi 1K28A 2IT1A 2HCIA 2K01A 1BOSA 2WFWA 4HCEA 2K5WA 1A62A 4IPDA 1AP0A 2Z8LA 3GTOH 1V1PA 4A3KG 3CCJA 5G3LF 2WB1G 2UXBQ 3M9BA 2G9DA 4FNFA 3KBGA 4JYAL 1U0LA 1NSNS 1C8CA 1GVPA 3WOFA 4M8AA 2NN6H 3K81C 3WDNA 3PO2B 2EYFA 4FDBA 3GTQB 4MN3A 4X62Q 3C1FA 1PVOA 1YJ9A 1XXGA 2AUJD 1N34Q 5JJZA 4LF9L 3AEVA 3S2HH 1UE7A 1CSQA 2A68D 3J80L 3WOEA 3DMUA 3MTSA 1HA6A 1MI2A 5IWAQ 1AZPA 3CU7A 2OXPA 3MEFA 1HA5A 4IJHA 3F8TA 5C5MA 4CKCA 2ZJQA 1B53A 5E7NA 5CR3A 5CV9A 4CHTB 4P2CB 1VQHA 2UUAL 1NNXA 2FMCA 5CV5A 2CH4A 2PI2E 2V1CC 4HJ5A 1S5ED 4ID6A 1PZJD 3ER0A 3OIQA 1JICA 1LO5D 2OT2A 2RDHA 3Q23A 4DKAC 1D6EC 4H7BA 4NXNQ 2GVBA 1CI3M 3I70A 2JQOA 4A3CH 3EBEA 5CGKA 1GO3E 2KEEA 3CHBD 2VQEL 1AEXA 2HCCA 3K7UC 2Z6KC 4DV5L 4FO2A 4KKTA 3LNNA 3HKZB 4GOPA 4OIJA 1SE4A 3CC4A 2O4XA 3I8ZA 1E1TA 1JWUD 1L0WA 4RGTA 2LKVA 4JOIA 2RSOA 5CV7A 1PZKD 1PYSB 2NBFA 2QDBA 4TQUS 4F7XA 2UU9Q 1L2FA 1WJJA 3BYYB 4FYDA 4HIKA 2OCEA 3ITPA 2D9UA 2E2HB 3G6EA 3T1HL 3S1NB 2NVTH 3URYA 1D8LA 3SK6A 1BBXC 2JA9A 2F03A 1EQVA 4XYOA 4IUTA 2KECA 4DAPA 5I2XA 4BWGB 4UAIA 1UAPA 1IBLL 2AWOA 3S1RB 2R6GA 1YVCA 4JI8Q 1EU4A 3ULPA 1SEBD 1SN8A 3NELA 4JI6Q 4JVZA 1PH2A 4Q5VA 1SMYD 1KLUD 2P5ZX 2RKSA 2D0PA 3Q22A 3HP3A 4A3FG 1J5EQ 4R8IA 4LF7L 4EX5A 1O80A 1BUVT 1IYJB 3U4VA 4X62L 3S14H 1EWHA 3B6YA 3PUXA 3RUZA 3C3LA 2VB2X 2NVYB 3GTKB 1N34L 4KY7A 2D62A 5IY0A 3GDEA 3HFZB 3AB9A 3I72A 2E2IB 4AYBE 3MHBA 1UE5A 1U4PA 2I5HA 2SDFA 4BY7G 3A54A 1SROA 4HEDA 1EFID 1PTOB 2M00A 3G7LA 5AJ3L 1QE6A 1Y1WG 1IL2A 3I4LA 1HR0W 2ENBA 3FP9A 5EJWA 1TXYA 3KDFA 4LAAA 4WORA 4NW2A 4A3IG 4BBRG 1WVLA 3BVMA 1PFNA 2F0SA 5LMUQ 3HOUG 2K5HA 3DWPA 3SK5A 1SYBA 1TR5A 1K3RA 3D4RA 4KJOA 4CDFC 4RWSC 4A3EG 1KAAA 3I7FA 1BO0A 3W1GA 3TS0A 3H0GG 1VQ5A 2B2VA 3OMGA 2FMMA 4KJNA 1SBBB 3PUYA 2MO0A 2B2YC 3HOWG 4DK1A 5IGFA 3K5MA 2R61A 5A2QL 1ASZA 4S3SA 2JA6B 3I4NH 2CCZA 3I73A 4DV6Q 4XYQA 4ZLTF 1EY7A 3PIO3 1DD2A 3VYTA 3I4MH 4EQOA 3DM3A 2SNSA 3CCRA 2JA5G 3W5OA 4BY1H 3PF4A 3ND8A 5LMNQ 3MVVA 4A3FB 3SE0A 3ND9A 4B9XA 2UU9L 4JW0A 1A2UA 1EY4A 3G71A 2EXDA 2Y0SG 3P7JA 1I6HH 4C2MH 3DM1A 5JPNC 1DOKA 1KRSA 4TRDA 1EEID 5IYDG 3KJPA 3M3YH 4I65A 4BY7B 4TKOB 3KOJA 4OO1G 2EJFC 2YV5A 4IN3A 1Y1WB 4P72A 4ZCKA 2OTJA 2ZT9C 4YWMA 2N3SA 1RL2A 4A3IB 4O0AA 4A3BH 4BBRB 4IUVA 4JI6L 1STGA 3PIPA 3VYRA 2IPKD 3K8AA 1EIHA 2F0MA 2YU9B 1IL8A 1YNJD 1STNA 1K83H 3L2PA 1J5EL 1QNKA 4A3EB 1FJGL 2J7ZA 1PRTD 3CW2C 4DNRB 2F52A 3H0GB 4FXGC 4GKKQ 2Z6KA 1I50H 3EA6A 1HPCA 4JI4L 1FNVA 3R2TA 1XYIA 1TY2A 1GUNA 4DA2A 5M3FH 1R9TB 4JI7Q 1KIXA 2AKWB 3HOWB 2ALYB 3EJIA 3IFTA 1YHBA 3EIVA 1E22A 3FHWA 2CWAA 1Y1VG 1IBMQ 5E1FA 2NVXH 5GROA 5D65A 1MSHA 4KLKA 1N9WA 4RHSA 2K28A 5C3EH 4WJ4A 1X55A 3VR6A 2JA5B 3J80i 1Q90A 3NEMA 5CV6A 5LMUL 2QEJC 2AHOB 5CYUA 3ULLA 2RF4A 1G51A 1CQVA 1T9HA 2Y0SB 4QJFA 2EJMA 2JXMB 1DOMA 1FL0A 1FGBD 4R4IA 4L5SA 2XTIA 1VF5C 2R7ZB 1VCIA 3S15H 1UE6A 3QJYA 1UUPA 4DXFA 2R92H 2WP8J 2DY8A 2F0GA 4BBSG 3JAML 2B2WC 2KVMA 3R93A 2Y0SE 1C4QA 3MWYW 1B50A 3TDQA 4LWCA 3CAMA 1VQ8A 3W3AA 3FKIH 3BU2A 1D1KA 2OWOA 3KUPA 3BYTB 2XGTA 3RR5A 1K0RA 4IUNA 5LMNL 4ZUJA 1AZQA 4APVA 2NVQH 2N8NA 5IYBG 2VXWA 5AFWA 1SDFA 5NUCA 5C5LA 2GVAA 3H09A 1BQQT 3QWNA 3KLRA 3M4PA 3UI2A 3J7AV 1K0SA 1CTMA 4YCWA 3GTLH 5FJ8G 1XMQL 4LFCL 1TS3A 1Q1BA 3K5OA 2HHHQ 3EQLC 3GTGB 1GOZA 1LTLA 3SDZA 1HQMC 1Y1VB 4CJ2C 3A56A 3J81j 2VUMB 2QEXA 4B3TQ 4JI1Q 2NYZD 2A69C 4DR3Q 4WJ3M 1LV9A 4OO1I 3J81c 4A3MH 2XNAC 4RKLA 5M5XB 2PCFB 2R93B 4A3GH 2F3IA 5I2YA 4HIDA 4RH6A 1VQIA 1WCMH 1I4HA 4V190 3GTPB 5JJKA 1VDZA 2OQ0A 1NMFA 2ICIA 4A3DH 2JEAI 4GN5A 4A76A 1O7YA 1TWAB 2B2YA 1JB3A 1EQRA 4X66L 3FRPB 5IP9H 2BOSA 1XNRQ 4DK3C 1OXSC 4BS9A 5C4XG 2FJ2A 1X9NA 1IBML 4K5XA 5C4JB 1J9OA 3S1QH 3S1MH 2EY6A 2DNCA 5EPLA 3TP5A 1A8VA 3E6ZX 1I4RA 1LM0A 1U5KA 3E3XA 2K14A 4QUCA 1D5XC 3KBXA 1PH8A 4K2KA 1WTOA 3RZDB 1XPRA 5EAYA 3UDIA 1KXLA 1MJEA 4DR7Q 4IALA 1HRJA 4L5RC 2PNHA 1XJVA 2C5CA 1H9SA 1FNUA 1CKNA 3AFPA 3SEBA 3LGJA 3PO2H 3H94A 3GTQH 4LF6L 2BDOA 3E9HA 1F9SA 1KDAA 5DNFA 2CHBD 2A6HD 5EKIA 1EQQA 2L15A 4NP5A 2FXQA 1HQRD 1ONLA 4XQJA 1KL9A 2HQEA 2L5TA 3CC7A 2UXDQ 3CCVA 5J3BA 1VQMA 1JOOA 2F0LA 3CQZB 3CRKC 4DV2L 3DWQA 1X54A 1F2LA 4OX9Q 1S4ZA 2L0CA 1CM9A 1LTTD 2K50A 1Q82C 5EBDA 1F2ZA 4KV6A 4MTKA 4DV7Q 5EBCA 5GADC 4N9TA 5C4XB 1YJWA 2PO4A 3R2IA 3VYUA 2PQAB 5JJIA 4G57A 2NTTA 3U50C 1EL0A 5I9OA 1GXDC 2RCFA 4B3TL 4JI1L 1BVSA 4RHRA 5A35A 3HZXA 1AH9A 1B9MA 2EPBA 3GD7A 3CCMA 5IYCH 1VQ9A 1ESFA 1M4VA 5E3FA 3A5UA 2EZVA 1VQFA 1N36Q 4DV4L 3RZOB 5G3LD 1V43A 1JWSD 4R1JA 3QO2A 2IX0A 1QWYA 3ZJYC 3NUCA 2MPMA 1MD2D 1LT3D 1PYBA 1W6JA 4OWTB 2E2HH 1SSOA 1B8AA 3S1NH 1B2TA 2WKCA 4DR5L 2IL8A 3G6JB 2D5DA 4GKJQ 3V05A 3VR4A 1LT5D 4N9PA 2D2CC 3FVQA 3OSOA 1RTNA 1E2WA 1G291 5HGTA 1KQSA 2I0QA 3OYYA 5JVH3 3PIOA 3KF6B 1VQ7A 1YZ6A 1SYGA 1M8AA 2RA4A 3S1RH 1C48A 2GN5A 3NP8A 4JI5Q 4DR7L 1B4OA 4IURA 4PQXA 4Y7NB 3NBHA 3X3NA 4N8X1 3K58A 2HQLA 3MFGA 5F2DA 1PTOC 1PH9A 1PH3A 3KLSA 2JSOA 4O2DA 4B08A 4ULLA 3GTKH 4IFDI 1TT2A 1N8RC 1VQDA 3IRBA 2CH4W 4C3JG 4FF1A 2E2IH 2JA8G 2D0OA 2J4XA 4IO9A 4EQPA 3TSSA 3T13A 2UXDL 1PTOH 5I6YA 3V96A 1E2VA 1JMCA 2WAQB 1SNOA 1JJCB 1EYAA 5KYIA 1QUQB 1LTGD 1VS0A 2PNRC 2UXCL 3KYHC 5K36G 2K5DA 1B70B 4HCSA 2WAQE 5BN4A 1EU3A 5C44G 4XQQA 4DV7L 1KAWA 3HOVG 2ZJRA 4JI2Q 4DR6L 3PMFA 3MZ5A 4EVOA 2M9VA 4IOCA 2KCTA 1IBKL 1LACA 1U4LA 4QY7A 4X64Q 2ASBA 1VQ6A 4DR1L 1AE3A 2JA6H 1WOCA 2MGSA 4K0KL 1N36L 4KN4C 1PLFA 2Q2IA 1K9MC 1R4PB 4CJ0B 5ELNA 2A69D 1WD0A 4LF5Q 2ES2A 2PI2A 2F0NA 5IGDA 4A3FH 3K7AB 2I46A 1X6OA 1EUJA 1EZ8A 4JC0A 5IT9c 3Q24A 4A93B 2V4DA 1CA6A 3TBIB 1SE3A 4KD4A 5M3MB 1STYA 2K4KA 1YNND 3IL8A 3M85A 1PMRA 1Y14B 4P75A 4ZRZA 2L11A 3MXNB 4KY6A 4ALPA 4BY7H 1VQAA 2E2JB 4HMJA 2KUMA 4LW1A 1Y1WH 1XX8A 2IJ0A 1YI2A 1SRUA 1ZYRD 1RCVD 1EY6A 2Q8RE 3PUZA 1HNXQ 4B3MQ 4GN4B 1KNEA 5EKLA 2I5LX 4JG2A 4A3IH 1GKHA 4JI5L 4BBRH 4CGYB 1JE5A 3BDLA 5GQOA 4J15A 3HS0C 3LWUA 3KLSX 2A74C 4DV1Q 2H4OA 2KBNA 3R3OA 4TVAB 4A3KB 2YU9H 1O7LA 1IW7D 2HT1A 5C0XG 2WB1B 2E8GA 5C44B 4QCLA 2G9HD 3HKZE 4R4CA 1EIYB 2PZTA 3H0GH 3HOVB 3JC66 1R9TH 1C0AA 2YTXA 1SMXA 2LXKA 3HOWH 3DHQA 1J6QA 4IJLA 3SR1A 1XTCD 1S40A 1EOTA 2WB1E 3TZUA 1WTVA 2EY1A 1TWFB 4G7HC 2F0EA 2BE5D 1X3GA 3H3VI 4HJ9A 4XT1B 2QCPX 5JEAH 2QKIC 4K8IA 1B7YB 2SNMA 2Z4HA 3D4WA 1STAA 4RAUC 3DEOA 1Q86C 4HN7A 2JA5H 1VQJA 1KC8C 1X3EA 1PXUA 4L6TB 1V8QA 3J81i 1MGSA 1RDPD 4K2LA 2UXBL 1WD1A 1NTGA 1QVFA 1TWHB 3NXWA 2B2TC 4BA1I 2NN6G 1PFBA 5IYDH 2EQSA 2LFNA 4G4KA 2EIFA 3TREA 2R7ZH 4DR4Q 1F9PA 1G8ZD 4JV5Q 1QG7A 2HDMA 2K05A 2DJFC 3A8JE 4X64L 4UPAA 5HY6A 1HFNA 4FVMA 3SK4A 1AE2A 3MXPA 3I4OA 1I3QB 1VQEA 3T4AC 2M2LA 1YITA 2A6EC 4EQNA 4UP8A 5IWAL 4R4TA 4XDXA 1HZBA 4OEMB 3S17B 3HRZC 1N32Q 2K75A 4M1UB 4QL5A 3UE0A 1I4PA 1D2BA 4RGOS 3UDXA 3NE5B 2LMCB 1PZID 4LMQD 5ELCA 2ZM6Q 1G2SA 1ILPA 4NXNL 4A3CG 2MFIA 5EPJA 5D3IB 1RHPA 1JB7A 1R4QB 3GTGH 5CV8A 1ZKOA 2KCNA 1Y1VH 3MXUA 1IYUA 4G7OC 3MXGA 1E2ZA 1BNZA 2VUMH 4IPCA 3K57A 1SXTA 3J81E 2OF1A 4X3UA 3U9SA 1HNXL 1JORA 1QZHA 5FK9C 4JBWA 2B2UC 1XWEA 1NJIC 1S5FD 4KMUC 1M1KC 5M5XH 2R93H 4HAEA 2VQFQ 2AUKA 3NHHA 3V2TA 1TWCB 1SNPA 2Q8TA 4MNOA 3FPUB 4U68A 1XMOQ 2KOLA 3VR2A 3AU7A 3SGIA 2QILA 3GTPH 1I6VC 3MC0B 1K8MA 5KIXA 1BF4A 1WTWA 4KKUA 1F77A 1TWAH 1XTDA 3C1EA 2RSNA 3GP7A 5C0XI 3BVGA 2IX3A 2RQXA 4YHHQ 3ICEA 1G91A 1CZWA 5JOBA 1SE2A 5KNCA 4OHJA 4MHEA 4LFBQ 5C4JH 4QUFA 1SFOB 5KNDA 2JJQA 1STHA 4QB4A 3M4YA 4ZQ3A 4K6DA 1ML0D 1F2YA 2XWBB 2YTVA 4C3IG 2PZUA 1L1OB 4LUZA 1BR9A 2HIXA 3RZDH 3PCOB 1QOHA 3QOLA 3D8GA 1HJPA 4B3SQ 4JI8L 3EFXD 4DV0Q 4C3HG 5IYBH 4DNIA 5C0XJ 2TMPA 1LTID 5J39A 1IYVA 3HOUB 4Z9CB 1QVGA 1H9KA 5CC4A 3QB3A 5FJ8H 5CMDA 4CKBA 2F0QA 3JAMc 4WRDA 1HTLD 2IHEA 1OXUA 2AMCB 4A3LH 1ET6A 3A5ZB 3I3CA 4IUUA 4HJAA 2NN6I 3H91A 4F88A 2X6LA 1CUKA 3M7NA 3VR5A 4DAYB 5I4DA 1YHAA 4HIMA 2KHJA 2Z4IA 2FINB 4RA8A 3K5NA 2MNAA 4OL7A
chains in the Genus database with same CATH topology
2K04A 1CT1D 4R8NA 3S16B 1VF7A 3ERQA 3T56B 4NKLA 4K5VA 3O13A 2O5JC 2JE6I 5I9PA 3OHXC 4ZKCB 1B3AA 1KTKA 1OXTA 5IGCA 4QMGA 3DUZA 4WFN3 1HTPA 1PTOF 1GUTA 4C3IB 2K03A 1TS5A 3A8IE 2E76C 4C3HB 2HDLA 2B2TA 2I07B 1NAPA 5FKAC 1BDOA 1EIGA 1BCPB 5IGGA 1FR3A 3K0YA 4FP5D 2GA4B 5ELDA 2EYMA 2EY2A 4C1NI 2IX1A 4IZ8A 1ENAA 3GTMB 5LL6X 3LX0A 3TP6A 1VMPA 2NWGA 3EVQA 1SYEA 2VNUD 3HOZB 4KD3A 5C4ZA 5IIFA 4TSSA 3D4DA 1SAPA 1RODA 3E0JA 2B63B 2F0DA 4MIUA 4DXGA 2B2UA 4BBSB 3LWEA 3MEHA 2JA7B 2FFKB 2RDGA 4KHZA 1GUOA 3D6WA 4V0BA 1NR4A 3VYSA 2A6ED 1DXMA 4I7ZC 4OIKA 3IAYA 3OIPA 2EJGC 3M4OB 4ZAIA 4IFDG 1HUNA 3IFDA 1A3VA 2L12A 1SNDA 1CHPD 2JYOA 2PW5A 1RF2D 4H44C 4H13C 1G6ZA 2L4NA 1DZ1A 2Q8IB 1VMCA 1ZEQX 5E4XA 5JPMC 2RBMA 4PMWA 1EY9A 3J81L 3IKJA 3M7GA 4RKBA 1LABA 3H3VC 3SHLA 3HOXB 5IT9E 4XXEA 2BDNA 2EYHA 2XRQD 1Q12A 3FMCA 3C2PA 1S5BD 3AMUA 3HOYB 5JVG3 4FF4A 3FEWX 1E0BA 1SYCA 2O2LD 4NMZA 5DM73 1CQFA 2PZWA 1EEFD 1SMYC 4UDUC 2L9HA 5COYA 4OGQC 1I4XA 1Z47A 4PV1C 1KNAA 3ONAB 3NWSA 3MFYA 3NWTA 1BCPF 1O7ZA 3GTJB 2RDFA 1S5DD 2L55A 5IGBA 5J1ZA 4J1MA 4L8JA 2PYKA 1LT4D 1H9JA 2B2WA 1DYQA 4QF4A 2F0HA 1EYDA 4ZK9B 1CK1A 2WACA 1Y8PB 1STBA 4A3JB 1GUWA 1HHVA 5D3DA 1STEA 2F0VA 4KY5A 3HEJA 3QIAA 2TSSA 2EYJA 4K5WA 5EPKA 1MBYA 1LTBD 2K5QA 1GUGA 3CKIB 1BXTA 2SOBA 1U4RA 5A2QE 1OO9B 5M5YB 2NB0A 4K6LA 5EGTA 3Q0AA 4KKSA 1GHJA 4ILWA 3DXJC 1KLGD 2EVBA 4K8JA 1ESRA 4F8MA 2XSCA 1U4MA 2EE1A 2DNEA 1RTOA 1TU2B 3D6CA 3RD4A 4EGVA 2F0IA 4U673 2ID0A 2ZXRA 5C0XH 1TKWB 5FOBB 2N55A 3NPPA 3PUWA 4IFDJ 5EQ0A 1TQOA 1TS2A 1HCZA 1H9MA 4X3TA 3NTKA 3J7YW 4ODGA 1Y8OB 2CQAA 1DJRD 2K7VA 2F1MA 1GHKA 4KN7C 1V1PB 1YNJC 4XIGS 1RKNA 1PRTC 5KGUA 2CW0C 5I6WA 1ILQA 1KABA 2C9OA 2ZXPA 1MSGA 1RJTA 1LTRD 2NZ1D 1KDCA 2WIIB 1LLRD 1JR0D 2F4IA 2E2DC 5BN3A 1EZ6A 1EYCA 1WTPA 1J8IA 2OEOA 2LS01 4C3JB 4KI0A 3NQIA 1L0XB 2E75C 2JA8B 2KQ3A 3MXNA 1W6KA 1A6XA 2DY7A 3NQTA 3E5SA 1Q3LA 4DU9A 3BS1A 3GQBA 1T5EA 3BDOA 2XIWA 3JAME 5ELEA 2F0WA 4DN4M 4J6HA 4O42A 3T51B 3OWFA 3GV3A 2WINB 1CHQD 3I91A 3PV0A 5C3XA 3K6OA 4RCNA 1B9NA 1X3QA 1H9RA 1U9RA 5J22A 3MAQA 1L0YB 3TMEA 1NR2A 4IUQA 1DOLA 2MHVA 5IT9L 2O5IC 1WTRA 3PO3B 1D5ZC 3S2DB 3K59A 4ME5A 3I90A 4B9WA 3OW7A 3OPOA 5IOCA 1A15A 4OO1H 3TP8A 3S9WA 1CA5A 5EKKA 5KEEA 1BCPC 5M5WB 1EWCA 4C1NK 1ICWA 1SJHD 1AN8A 3F2UA 4AYBB 3P20A 1JWMD 4ZKBB 5KYLA 1TS4A 2L1BA 2EYPA 3A7LA 3SXHA 1SYDA 2PMZB 1EQTA 2SEBD 1JQYD 1TY0A 3SVMA 3A7AB 3DWAA 2PPBC 1ET9A 3SK8A 2X69A 3D31A 1UEAB 4DF7A 1WTXA 3GTOB 3L3OC 1SNCA 2A6HC 4DAVA 2XVSA 5C4HA 2BA0A 3OOCA 3A55A 3NBIA 5E4WC 1JC7A 3FDTA 2IWHA 1PDQA 3CRLC 5ELBA 2VB3X 1JCKB 1PRTB 4CBVA 1FD7D 5FO9B 2BCOA 1I4QA 3S2HB 1PTOD 1A3UA 4KK7A 2Z1CA 1TVXA 2PQEA 5JEAG 4KHVA 2DN8A 4XQNA 1T5XD 3X3MA 1Z7TA 2F0FA 4PMCA 2F0PA 1D5MC 2EXZA 5ISRA 4C56C 3VR3A 4L63B 3Q6SA 2K33A 2XN9C 1PYWD 1HFGA 4ZYSA 5FO7B 2BA1A 3NK9A 1PFMA 2CVRA 2MP1A 4O1NA 1QILA 3ZYYX 4E6IA 4RCOA 1LTSD 4KTAA 4FXDA 3BDCA 4HSVA 4J8QA 3R8BA 1WTQA 2EOTA 2B39A 4DAYA 1EY8A 2YYZA 1SNMA 2KJXA 4CJ1B 4RGNA 3HGBA 4FF3A 2CW0D 4Q0FA 3OWEB 5D14A 2EY5A 4HMIA 2K1BA 5FLXE 4DNTB 2NVTB 3OMCA 1A3TA 3BVZA 3RMHA 3P1HA 4QIWB 3NTHA 1TIID 5DEHA 1DONA 2RVLA 1SNQA 3D3RA 3GV6A 4ZUIA 1F9RA 2JP1A 1DCZA 3T16A 2H1EA 3N52A 2EDGA 2F0OA 4IFDH 3DEPA 2A73B 1CFMA 3S14B 4BA2I 2R3ZA 1DM0B 1HUMA 5IODA 3L7ZC 2AQ3B 1ENCA 1F9QA 4HR7B 5T1IA 3P75A 4NDXA 2K6AA 4RGMA 2KA7A 2MJ8A 4G7ZC 2WKDA 1SJED 5BN5A 4HTHA 2F3VA 2ICEC 1B44D 3T53B 1EY0A 4FF2A 2MUYA 1Z6HA 2EYOA 1EY5A 1ZXTA 2F0JA 2A68C 3HG9A 3J80E 1PRTF 3RLFA 1Y69U 1HXYD 3U9OA 1OXXK 2QF7A 3K5LA 5JEAJ 2PW7A 1Q1EA 5KNBA 2K32A 5C3WA 3I4NB 2B8FA 3VA5A 4H0LC 4RFBA 4ABNA 3I4MB 1RD9D 4R9WA 1YNNC 1BCPD 3GO5A 4BY1B 3W2DA 3QG1A 1Q8IA 1FNWA 3NTIA 1X32A 1ZYRC 1I6HB 1IKLA 4C2MB 4DK0A 2B8GA 3BG3A 4DGZA 2F0UA 4PNYA 1LTAD 3M3YB 1O78A 1K8OA 3TZDA 2AQ2B 2F3WA 5FO8B 1IW7C 2HUGA 2ZXOA 1G2TA 1FYCA 1H9SB 1F2MA 1LT6D 1QJOA 1S5CD 3QOJA 4A3BB 4PMBA 5TSSA 1JE4A 2J0TD 1AFPA 3BZDB 2KEDA 1IKMA 1K83B 4FXKC 2BE5C 1SYFA 1D1IA 1JOQA 2X6GA 1IHZA 1I50B 1NCVA 5CV4A 1V1OA 5M3FB 4IQZA 1QNUA 1A2TA 5KRUA 5DM63 2NVXB 2KHSA 3C46A 1JOKA 2LY7A 5M9OA 3EROA 5C6AA 5C3EB 1X3PA 3KK7A 4DFAA 4YIJA 2XWJB 2NTSA 3L9AX 2F0KA 2NUCA 1TWGB 5K36H 5T1GA 3KF8A 1GJXA 1UNSA 3PUVA 1ENFA 3VA7A 5CBAE 5JAVA 2WV6D 2KCCA 3S15B 2R92B 3FPPA 5CORA 1GUSA 3TP7A 1QB5D 5K5PA 4K14A 2EYLA 2FHTA 4F87A 1I4GA 2AWNA 1CZGA 3FKIB 1OXVA 4GZYC 5HURA 5LL6S 1KDBA 2NVQB 4IUPA 2A5HA 3PIP3 3NSWA 4LJZC 4JK1C 3GTLB 1II3A 2F0TA 3N6RA 5FLXL 2IW3A 3H6MA 4LK1C 4A3MB 3TN2A 4X3SA 4CKEA 1QCBD 1Y8NB 2N88A 4A3GB 3A8KE 3MA2B 1WCMB 2AQ1B 5LHY1 4X3KA 4A3DB 4XTCS 2E74C 4HSPA 2XRSD 5ELFA 3J7AF 2B2VC 3S1QB 3S1MB 1AW7A 1NUCA 1B1ZA 5DAUA 5IGEA 4WJWA 4XT3B 5CBEE 2JEBI 2IT1A 2HCIA 2K01A 1BOSA 4HCEA 2K5WA 1AP0A 2Z8LA 1V1PA 5G3LF 2G9DA 4FNFA 3KBGA 1NSNS 1C8CA 3WOFA 4M8AA 2NN6H 3WDNA 3PO2B 2EYFA 3GTQB 4MN3A 3C1FA 1XXGA 2AUJD 5JJZA 3J80L 2A68D 3WOEA 3DMUA 3MTSA 1HA6A 1MI2A 1AZPA 3CU7A 2OXPA 1HA5A 5C5MA 4CKCA 1B53A 5CR3A 5CV9A 4CHTB 4P2CB 2FMCA 5CV5A 1S5ED 4ID6A 1PZJD 3OIQA 1JICA 1LO5D 2OT2A 2RDHA 3Q23A 1D6EC 4H7BA 1CI3M 3I70A 5CGKA 2KEEA 3CHBD 1AEXA 2HCCA 4FO2A 4KKTA 3LNNA 3HKZB 4OIJA 1SE4A 2O4XA 3I8ZA 1JWUD 4RGTA 2LKVA 2RSOA 5CV7A 1PZKD 2NBFA 2QDBA 4TQUS 4F7XA 3BYYB 4FYDA 3ITPA 2D9UA 2E2HB 3S1NB 3URYA 3SK6A 1BBXC 2F03A 1EQVA 4XYOA 4IUTA 2KECA 4DAPA 5I2XA 4BWGB 4UAIA 1UAPA 2AWOA 3S1RB 2R6GA 1EU4A 1SEBD 4Q5VA 1SMYD 1KLUD 2RKSA 3Q22A 3HP3A 4R8IA 1O80A 1BUVT 1EWHA 3PUXA 3RUZA 3C3LA 2VB2X 2NVYB 3GTKB 4KY7A 2D62A 3AB9A 3I72A 2E2IB 3MHBA 1U4PA 2SDFA 3A54A 4HEDA 1EFID 1PTOB 2M00A 3G7LA 1QE6A 3I4LA 2ENBA 5EJWA 4LAAA 4WORA 4NW2A 1WVLA 3BVMA 1PFNA 2F0SA 3DWPA 3SK5A 1SYBA 1TR5A 3D4RA 4KJOA 4RWSC 1KAAA 1BO0A 2B2VA 3OMGA 2FMMA 4KJNA 1SBBB 3PUYA 2B2YC 4DK1A 5IGFA 3K5MA 2R61A 5A2QL 4S3SA 2JA6B 3I73A 4XYQA 4ZLTF 1EY7A 3PIO3 1DD2A 3VYTA 4EQOA 2SNSA 3ND8A 3MVVA 4A3FB 3SE0A 3ND9A 4B9XA 1A2UA 1EY4A 3P7JA 3DM1A 5JPNC 1DOKA 4TRDA 1EEID 4I65A 4BY7B 4TKOB 4OO1G 2EJFC 4IN3A 1Y1WB 2ZT9C 4A3IB 4BBRB 4IUVA 1STGA 3VYRA 2IPKD 1EIHA 2F0MA 2YU9B 1IL8A 1YNJD 1STNA 1QNKA 4A3EB 2J7ZA 1PRTD 4DNRB 3H0GB 4FXGC 3EA6A 1HPCA 1FNVA 3R2TA 1XYIA 1TY2A 1GUNA 4DA2A 1R9TB 3HOWB 3EJIA 3IFTA 5E1FA 5D65A 1MSHA 4RHSA 2K28A 3VR6A 2JA5B 1Q90A 5CV6A 2QEJC 5CYUA 1CQVA 2Y0SB 2EJMA 2JXMB 1DOMA 1FGBD 1VF5C 2R7ZB 1VCIA 4DXFA 1UUPA 3QJYA 2WP8J 2DY8A 2F0GA 3JAML 2B2WC 2KVMA 3R93A 1C4QA 3MWYW 1B50A 3TDQA 3W3AA 1D1KA 3KUPA 3BYTB 4IUNA 4ZUJA 1AZQA 2VXWA 5AFWA 1SDFA 5NUCA 5C5LA 3H09A 1BQQT 3QWNA 3KLRA 3UI2A 3J7AV 1CTMA 1TS3A 1Q1BA 3K5OA 3EQLC 3GTGB 1GOZA 3SDZA 1HQMC 1Y1VB 4CJ2C 3A56A 2VUMB 2NYZD 2A69C 1LV9A 4OO1I 2XNAC 4RKLA 5M5XB 2PCFB 2R93B 5I2YA 4RH6A 1I4HA 4V190 3GTPB 1VDZA 2ICIA 2JEAI 1O7YA 1TWAB 2B2YA 1JB3A 3FRPB 2BOSA 1OXSC 4BS9A 2FJ2A 4K5XA 5C4JB 1J9OA 2EY6A 2DNCA 5EPLA 3TP5A 3E6ZX 1I4RA 4QUCA 1D5XC 3KBXA 4K2KA 1WTOA 3RZDB 1HRJA 4IALA 2C5CA 1H9SA 1FNUA 3SEBA 3H94A 2BDOA 1F9SA 1KDAA 5DNFA 2CHBD 2A6HD 5EKIA 4NP5A 1HQRD 1ONLA 4XQJA 2HQEA 2L5TA 1JOOA 2F0LA 3CQZB 3CRKC 3DWQA 1F2LA 1S4ZA 2L0CA 1CM9A 1LTTD 5EBDA 1F2ZA 4KV6A 5EBCA 4N9TA 5C4XB 2PO4A 3R2IA 3VYUA 4G57A 2NTTA 1EL0A 5I9OA 1GXDC 4RHRA 5A35A 3HZXA 1B9MA 2EPBA 3GD7A 1ESFA 1M4VA 5E3FA 2EZVA 3RZOB 5G3LD 1V43A 1JWSD 3QO2A 2IX0A 1QWYA 3NUCA 2MPMA 1MD2D 1LT3D 1W6JA 1SSOA 1B2TA 2WKCA 2IL8A 3G6JB 2D5DA 3V05A 3VR4A 1LT5D 4N9PA 2D2CC 3FVQA 3OSOA 1RTNA 1E2WA 1G291 5HGTA 5JVH3 1SYGA 1M8AA 2RA4A 1C48A 3NP8A 1B4OA 4IURA 4PQXA 4Y7NB 3NBHA 3X3NA 3K58A 3MFGA 5F2DA 1PTOC 3KLSA 2JSOA 4B08A 4ULLA 4IFDI 1TT2A 4C3JG 4FF1A 2J4XA 4EQPA 3TSSA 3T13A 1PTOH 5I6YA 3V96A 1E2VA 2WAQB 1SNOA 1EYAA 5KYIA 1LTGD 2PNRC 5K36G 2K5DA 4HCSA 5BN4A 1EU3A 4XQQA 3PMFA 3MZ5A 4EVOA 2M9VA 1LACA 1U4LA 2MGSA 4KN4C 1PLFA 1R4PB 4CJ0B 2A69D 1WD0A 2F0NA 5IGDA 3K7AB 2I46A 1EZ8A 3Q24A 4A93B 2V4DA 1CA6A 3TBIB 1SE3A 4KD4A 5M3MB 1STYA 1YNND 3IL8A 3M85A 1PMRA 4ZRZA 2L11A 4KY6A 2E2JB 4HMJA 2KUMA 1XX8A 2IJ0A 1ZYRD 1RCVD 1EY6A 2Q8RE 3PUZA 1KNEA 5EKLA 4CGYB 3BDLA 3HS0C 3LWUA 3KLSX 2A74C 2H4OA 4A3KB 3R3OA 1O7LA 1IW7D 5C0XG 2WB1B 5C44B 4QCLA 2G9HD 2PZTA 3HOVB 3DHQA 3SR1A 1XTCD 1EOTA 3TZUA 1WTVA 2EY1A 1TWFB 4G7HC 2F0EA 2BE5D 4XT1B 2QCPX 5JEAH 2QKIC 4K8IA 2SNMA 2Z4HA 3D4WA 1STAA 4RAUC 3DEOA 4HN7A 1PXUA 4L6TB 1V8QA 1MGSA 1RDPD 4K2LA 1WD1A 1TWHB 3NXWA 2B2TC 4BA1I 2NN6G 1PFBA 2LFNA 4G4KA 1F9PA 1G8ZD 1QG7A 2HDMA 2K05A 3A8JE 1HFNA 4FVMA 3SK4A 3MXPA 1I3QB 3T4AC 2M2LA 2A6EC 4EQNA 4XDXA 3S17B 3HRZC 4M1UB 1I4PA 1D2BA 4RGOS 3NE5B 2LMCB 1PZID 4LMQD 5ELCA 1G2SA 1ILPA 5EPJA 5D3IB 1RHPA 1R4QB 5CV8A 1ZKOA 2KCNA 3MXUA 1IYUA 4G7OC 3MXGA 1E2ZA 1BNZA 3K57A 1SXTA 3J81E 2OF1A 4X3UA 3U9SA 1JORA 5FK9C 4JBWA 2B2UC 1XWEA 1S5FD 4KMUC 4HAEA 2AUKA 3NHHA 3V2TA 1TWCB 1SNPA 2Q8TA 3FPUB 4U68A 2KOLA 3VR2A 3AU7A 2QILA 1I6VC 3MC0B 1K8MA 5KIXA 1BF4A 1WTWA 4KKUA 1F77A 3C1EA 2RSNA 3GP7A 5C0XI 3BVGA 2IX3A 2RQXA 1G91A 1CZWA 5JOBA 1SE2A 5KNCA 4OHJA 4MHEA 4QUFA 1SFOB 5KNDA 4QB4A 1STHA 3M4YA 4ZQ3A 4K6DA 1ML0D 1F2YA 2XWBB 4C3IG 2PZUA 1BR9A 1QOHA 3QOLA 3D8GA 3EFXD 4C3HG 5C0XJ 2TMPA 1LTID 5J39A 1IYVA 3HOUB 4Z9CB 1H9KA 5CC4A 3QB3A 5CMDA 4CKBA 2F0QA 4WRDA 1HTLD 1OXUA 1ET6A 3I3CA 4IUUA 4F88A 2NN6I 3H91A 2X6LA 3M7NA 3VR5A 5I4DA 2Z4IA 2FINB 4RA8A 3K5NA 4OL7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EY0 A;  3TP8 A;  2F0G A;  5IGB A;  5J1Z A;  4J1M A;  3S9W A;  4HMJ A;  1JOK A;  2PYK A;  2QDB A;  3NP8 A;  3ERO A;  2EYO A;  4R8N A;  4E6I A;  5EKK A;  5C6A A;  5M9O A;  4F7X A;  3MEH A;  1EY7 A;  1EY5 A;  4KTA A;  5KEE A;  3BDC A;  4EQO A;  1EY6 A;  4QF4 A;  2F0H A;  1EYD A;  2SNS A;  1KDC A;  3ERQ A;  3ITP A;  2F0J A;  2WAC A;  1NUC A;  4NKL A;  5CV8 A;  4K5V A;  5EKL A;  4YIJ A;  1KDA A;  3MVV A;  4DFA A;  5DAU A;  5F2D A;  1STB A;  2F0K A;  2NUC A;  4NP5 A;  5IGE A;  4B9X A;  3BDL A;  3SK6 A;  3U9O A;  2OF1 A;  1EZ6 A;  5KYL A;  1EYC A;  5I9P A;  1EY4 A;  1A2U A;  1EQV A;  2F0V A;  2EYP A;  2OEO A;  3HEJ A;  4KY5 A;  2HQE A;  1TT2 A;  3R3O A;  4IUN A;  1JOR A;  1EY8 A;  4ZUJ A;  4TRD A;  3SXH A;  1SYD A;  2EYJ A;  2PW7 A;  1SNM A;  5JAV A;  4K5W A;  2PZT A;  4I65 A;  1JOO A;  3NHH A;  5C5L A;  4QMG A;  5NUC A;  3V2T A;  4EQP A;  5C3W A;  2KQ3 A;  1SNP A;  2F0L A;  3T13 A;  3VA5 A;  1A3V A;  1NSN S;  5I6Y A;  3TP7 A;  1SND A;  2EY5 A;  3NQT A;  3DHQ A;  3E5S A;  3SR1 A;  2PW5 A;  2EYF A;  5K5P A;  4HMI A;  4K14 A;  2EYL A;  3C1F A;  5KIX A;  2SOB A;  1SNO A;  2EY1 A;  2RKS A;  3C1E A;  4DU9 A;  1EYA A;  2F0E A;  5KYI A;  1F2Z A;  5EGT A;  4KV6 A;  3OMC A;  1STG A;  5HUR A;  1A3T A;  2RBM A;  1EY9 A;  4K8I A;  4N9T A;  3P1H A;  5JOB A;  3SK8 A;  3DMU A;  3RUZ A;  4RKB A;  2F0W A;  2SNM A;  2F0M A;  4K8J A;  4KY7 A;  4G57 A;  4DF7 A;  1KDB A;  3SHL A;  3D4W A;  1STA A;  4DGZ A;  1STN A;  5I9O A;  4J6H A;  1STH A;  4QB4 A;  2F0U A;  5DEH A;  4RKL A;  4PNY A;  4ZQ3 A;  4F8M A;  5IGG A;  1SNC A;  4K6D A;  2OXP A;  2EYH A;  3MHB A;  1F2Y A;  3OWF A;  5C5M A;  1SNQ A;  5C4H A;  4ZUI A;  2F3W A;  3HZX A;  5CR3 A;  3PMF A;  2PZU A;  5CV9 A;  3D6C A;  2EYM A;  2M00 A;  3MZ5 A;  2EY2 A;  4K2L A;  4EVO A;  4IZ8 A;  2ENB A;  5E3F A;  5CV5 A;  3QOL A;  2F0I A;  1ENA A;  3D8G A;  1II3 A;  2F0T A;  3EJI A;  3NXW A;  3T16 A;  4ID6 A;  5C3X A;  3LX0 A;  4LAA A;  4WOR A;  3TP6 A;  1F2M A;  5E1F A;  5J39 A;  2F0O A;  4H7B A;  1SYC A;  3QOJ A;  5CV7 A;  4PMB A;  1A3U A;  4NMZ A;  1U9R A;  3H6M A;  2F0S A;  1TQO A;  2PZW A;  2PQE A;  3SK5 A;  5IOD A;  1SYB A;  4KHV A;  1TR5 A;  3QB3 A;  5CC4 A;  5CGK A;  5J22 A;  1ENC A;  2F0Q A;  4K5X A;  4KJO A;  4WRD A;  1AEX A;  3NUC A;  1KAA A;  3SK4 A;  3EVQ A;  2EY6 A;  3MXP A;  2F0F A;  3TME A;  4ODG A;  2F0N A;  1SYE A;  1SYF A;  3P75 A;  5CV6 A;  5IGD A;  4NDX A;  4PMC A;  1EZ8 A;  3TP5 A;  1JOQ A;  2F0P A;  2EXZ A;  4EQN A;  5IGC A;  4KD3 A;  5ISR A;  1IHZ A;  5C4Z A;  3OMG A;  4KJN A;  4N9P A;  5CV4 A;  4KY6 A;  4K2K A;  2O4X A;  5IIF A;  3OSO A;  3D4D A;  4KD4 A;  4HTH A;  4ME5 A;  4B9W A;  1A2T A;  5KRU A;  5HGT A;  1STY A;  5IGF A;  1RKN A;  2F3V A;  4IAL A;  5KGU A;  2RDF A;  5IOC A;  2LKV A;  1SYG A;  2F0D A;  4MIU A;  5I6W A;  1KAB A;  4S3S A;  2KHS A;  3NK9 A;  4OL7 A; 
#chains in the Genus database with same CATH topology
 3CQZ H;  1W2B A;  2K04 A;  2E5L Q;  1XNQ Q;  1CT1 D;  4R8N A;  3S16 B;  2CQO A;  1VF7 A;  2UUB Q;  1NY4 A;  2Q2U A;  3ERQ A;  3T56 B;  3DLL A;  4NKL A;  4K5V A;  4KHP Q;  1TWG H;  4R4Q A;  3HOZ G;  3HKS A;  3O13 A;  4P71 A;  2O5J C;  2JE6 I;  5I9P A;  3OHX C;  5C4X H;  4ZKC B;  1B3A A;  1KTK A;  2B63 G;  1OXT A;  5GAE C;  2I5M X;  2R7F A;  1HZ9 A;  5IGC A;  4QMG A;  3DUZ A;  4DR2 Q;  4WFN 3;  1HTP A;  1PTO F;  1GUT A;  4C3I B;  3I4N G;  2K03 A;  1TS5 A;  3A8I E;  2JA7 G;  1HNZ Q;  1JT8 A;  2E76 C;  3RZO H;  3I4M G;  4DV6 L;  3CF5 A;  4C3H B;  2HDL A;  5BR8 Q;  2B2T A;  2I07 B;  1NAP A;  5FKA C;  4BY1 G;  2H5X A;  3RLN A;  1BDO A;  1EIG A;  1IZ6 A;  2K5N A;  1I94 Q;  2Z9H A;  4GNX B;  4YHH L;  1BCP B;  2F4V Q;  5IGG A;  1FR3 A;  3K0Y A;  4FP5 D;  2GA4 B;  4X65 Q;  5ELD A;  2EYM A;  1JJ2 A;  2EY2 A;  4C1N I;  2IX1 A;  4IZ8 A;  1ENA A;  1V9P A;  3GTM B;  5LL6 X;  3LX0 A;  3TP6 A;  3AQQ A;  1PFS A;  1MHW C;  4HJ8 A;  2ZJP A;  4JBM A;  4B3S L;  1VMP A;  4Y7N H;  3CP0 A;  4DK6 C;  3HOX G;  4IOA A;  2NWG A;  5FLM G;  3EVQ A;  3I55 A;  1SYE A;  3WWV A;  5GAH C;  2VNU D;  3HOZ B;  4KD3 A;  5C4Z A;  4UP9 A;  3HOY G;  4A4I A;  5IIF A;  2R7D A;  4TSS A;  1QZG A;  5M3F G;  3D4D A;  1SAP A;  4GKK L;  1ROD A;  3E0J A;  2B63 B;  4JI7 L;  2F0D A;  4MIU A;  4DXG A;  2B2U A;  4BBS B;  3PF5 A;  3LWE A;  3MEH A;  5C3E G;  2Z0S A;  2JA7 B;  2FFK B;  2RDG A;  2IHF A;  4KHZ A;  1GUO A;  3D6W A;  1HR0 Q;  3CCQ A;  4V0B A;  1NR4 A;  1XNQ L;  3L0O A;  3J7Z C;  1HH2 P;  4MTN A;  3VYS A;  2A6E D;  1DXM A;  4KHP L;  4I7Z C;  4OIK A;  3IAY A;  3OIP A;  2EJG C;  3M4O B;  4ZAI A;  1S3O A;  4PZ6 A;  4IFD G;  1HUN A;  3IFD A;  2K52 A;  1SLJ A;  1A3V A;  2L12 A;  1SND A;  1CHP D;  2JYO A;  1VQK A;  2PW5 A;  4NB3 A;  1RF2 D;  4H44 C;  4H13 C;  1G6Z A;  2L4N A;  1DZ1 A;  3CD6 A;  2Q8I B;  5L37 A;  1VMC A;  4A3J G;  1BKB A;  1ZEQ X;  4DAM A;  5E4X A;  5JPM C;  3A74 A;  2RBM A;  4PMW A;  1EY9 A;  3PSI A;  3J81 L;  3IKJ A;  3M7G A;  4RKB A;  3RN2 A;  4HIO A;  3PQI A;  1LAB A;  3H3V C;  3SHL A;  3HOX B;  3G48 A;  4A75 A;  5IT9 E;  4XXE A;  2BDN A;  1E1O A;  2EYH A;  3K7A H;  2XRQ D;  1Q12 A;  3FMC A;  1MJC A;  4A93 H;  3I2Z A;  1S5B D;  3C2P A;  3AMU A;  3HOY B;  5JVG 3;  1H95 A;  4LUO A;  4LNQ A;  5M3M H;  4FF4 A;  3FEW X;  1CKM A;  3BZC A;  1K8G A;  1EWI A;  1LUZ A;  2N78 A;  1E0B A;  3CMA A;  4DPG A;  1CSP A;  3UDG A;  2E2J H;  1SYC A;  1PV4 A;  2O2L D;  2HHH L;  1YHQ A;  4NMZ A;  4YY3 Q;  5FLX c;  4H02 A;  5DM7 3;  1CQF A;  2PZW A;  2KCM A;  1EEF D;  1SMY C;  4UDU C;  2L9H A;  2PQA A;  4DR3 L;  1PHJ A;  3PGZ A;  5COY A;  4OGQ C;  1I4X A;  4A3G G;  1Z47 A;  4PV1 C;  4GLV B;  1KNA A;  3ONA B;  3KF8 B;  4A3K H;  3NWS A;  3MFY A;  2VS1 A;  4OEL B;  5C44 H;  3NWT A;  1BCP F;  1O7Z A;  3GTJ B;  2RDF A;  2MO1 A;  1S5D D;  4GS3 A;  2L55 A;  3HOV H;  2QA4 A;  5IGB A;  1XPO A;  5J1Z A;  4J1M A;  4L8J A;  5IP7 G;  5IP9 G;  2PYK A;  3RNU A;  1LT4 D;  1YEZ A;  1H9J A;  2B2W A;  1GM5 A;  1DYQ A;  4QF4 A;  4CDD C;  2F0H A;  1XNR L;  1EYD A;  4ZK9 B;  1TWF H;  1CK1 A;  2WAC A;  1Y8P B;  1STB A;  4A3J B;  1GUW A;  1HHV A;  5D3D A;  4LF4 Q;  4DUY Q;  1EIF A;  1STE A;  2F0V A;  3ULJ A;  4KY5 A;  3HEJ A;  1VQC A;  3QIA A;  1K73 C;  2TSS A;  2EYJ A;  2UUC Q;  1BBU A;  2UUA Q;  1I5F A;  4K5W A;  3KF6 A;  5EPK A;  1MBY A;  1LTB D;  2K5Q A;  4DUZ Q;  4DV3 Q;  1GUG A;  4YWK A;  3CKI B;  1BXT A;  1EYG A;  2QW7 A;  4LF8 Q;  1TWH H;  1EOV A;  3PO2 G;  3CCL A;  2SOB A;  1U4R A;  4EQ5 A;  5A2Q E;  1OO9 B;  3CCU A;  5M5Y B;  2NB0 A;  4K6L A;  5EGT A;  3Q0A A;  3F1Z A;  2A1A A;  4KKS A;  1NBW A;  2VQE Q;  1GHJ A;  4ILW A;  4DV5 Q;  2NVY H;  3DXJ C;  3J80 c;  1KLG D;  2EVB A;  4K8J A;  5IE8 A;  1KHI A;  3EN2 A;  1ESR A;  1HZA A;  4F8M A;  1I3Q H;  2XSC A;  1U4M A;  2EE1 A;  2VZA A;  2DNE A;  2VL6 A;  1RTO A;  1Q81 C;  1TU2 B;  3D6C A;  3S17 H;  3STB C;  3RD4 A;  4EGV A;  2F0I A;  4U67 3;  2ID0 A;  5LMN W;  2ZXR A;  5C0X H;  1TKW B;  5FOB B;  3NPP A;  2N55 A;  1HZC A;  3PUW A;  4OX9 L;  1QUQ A;  3OTO Q;  4JCV E;  4IFD J;  5EQ0 A;  1TQO A;  1TS2 A;  1HCZ A;  1LYL A;  3T1H Q;  1H9M A;  1E7Z A;  4X3T A;  1VQG A;  1VQL A;  3NTK A;  3J7Y W;  4ODG A;  4BXX G;  1Y8O B;  2CQA A;  1DJR D;  4JBK A;  2K7V A;  2F1M A;  1GHK A;  4LFA Q;  4KN7 C;  1IBL Q;  1V1P B;  1NMG A;  5IYC G;  1YNJ C;  4XIG S;  1RKN A;  4LUV A;  1PRT C;  5KGU A;  2CW0 C;  5I6W A;  1ILQ A;  1KAB A;  1C9O A;  2C9O A;  2G5D A;  1TWC H;  2ZXP A;  1MSG A;  4OWW B;  1RJT A;  1LTR D;  4LF7 Q;  1M90 C;  2NZ1 D;  1KDC A;  4R4O A;  2WII B;  1LLR D;  1L1O C;  1JR0 D;  3CCE A;  2F4I A;  2E2D C;  1Q8K A;  5BN3 A;  1EZ6 A;  3PO3 G;  1EYC A;  1WTP A;  1J8I A;  2OEO A;  2LS0 1;  1GD7 A;  4C3J B;  4KI0 A;  3NQI A;  1L0X B;  1SFO H;  2E75 C;  4GKJ L;  2JA8 B;  2IY5 B;  5AJ3 Q;  4LF4 L;  4DUY L;  2KQ3 A;  3TRZ A;  3MXN A;  1W6K A;  1A6X A;  1UEB A;  2UUC L;  2DY7 A;  5JJL A;  3NQT A;  3E5S A;  4DUZ L;  3K0X A;  4DV3 L;  1Q3L A;  4DU9 A;  3BS1 A;  4LF8 L;  4AYB G;  1X56 A;  3GQB A;  1T5E A;  3BDO A;  3QR8 A;  4P74 A;  3HOU H;  2XIW A;  3JAM E;  2Q2T A;  3U58 A;  5ELE A;  2F0W A;  4DN4 M;  4A3E H;  1E3P A;  4NXM Q;  4J6H A;  4O42 A;  3T51 B;  1PH1 A;  4GOP B;  3OWF A;  4JI3 Q;  1UWV A;  2DGY A;  3GV3 A;  2WIN B;  4UP7 A;  4CDC C;  1CHQ D;  1P8L A;  3I91 A;  3PV0 A;  1BBW A;  5C3X A;  3K6O A;  4RCN A;  1N33 Q;  1B9N A;  1X3Q A;  1H9R A;  3KLW A;  1U9R A;  3S16 H;  2LXJ A;  1V1Q A;  5J22 A;  4B3R Q;  3MAQ A;  1L0Y B;  3TME A;  3OTO L;  1NR2 A;  4IUQ A;  1DOL A;  2MHV A;  5IT9 L;  2O5I C;  1WTR A;  3PO3 B;  1D5Z C;  3S2D B;  3CPF A;  3K59 A;  4ME5 A;  3I90 A;  4B9W A;  3TEH B;  2JK8 A;  4JI2 L;  3CC2 A;  3OW7 A;  2ATW A;  3OPO A;  5IOC A;  4LFA L;  1A15 A;  4OO1 H;  3TP8 A;  3S9W A;  4C3I H;  2JA6 G;  1CA5 A;  2B3G A;  4GLA C;  5EKK A;  4GNX C;  5KEE A;  1BCP C;  5M5W B;  1EWC A;  4C1N K;  1ICW A;  4NPS A;  1SJH D;  1AN8 A;  3F2U A;  4C3H H;  4LF5 L;  4AYB B;  4AIM A;  3P20 A;  1JWM D;  4ZKB B;  1XPU A;  5KYL A;  1FJG Q;  1TS4 A;  2L1B A;  2EYP A;  3A7L A;  3SXH A;  1SYD A;  2PMZ B;  2HIV A;  5HGQ A;  4JI4 Q;  1EQT A;  4RMF A;  3D0F A;  1PA6 A;  2LSS A;  3CME A;  2SEB D;  1JQY D;  4IPH A;  3GTM H;  1TY0 A;  1YIJ A;  1X3F A;  2MQH A;  3KDF B;  3SVM A;  2PMZ E;  4IPG A;  3A7A B;  1Z9F A;  4UY8 C;  3DWA A;  4B3M L;  2PPB C;  1ET9 A;  1CKO A;  1VQ4 A;  3SK8 A;  2X69 A;  3D31 A;  1UEA B;  4DF7 A;  1WTX A;  3GTO B;  4X6A H;  3L3O C;  1SNC A;  2A6H C;  4L5Q A;  4DAV A;  4DV1 L;  2XVS A;  5C4H A;  2BA0 A;  3OOC A;  3A55 A;  3HOZ H;  3NBI A;  5E4W C;  1JC7 A;  4NXM L;  3FDT A;  1OTC A;  4OXP A;  2IWH A;  1PDQ A;  2B63 H;  4JI3 L;  3CRL C;  5ELB A;  2VB3 X;  2OTL A;  1JCK B;  1PRT B;  4CBV A;  1FD7 D;  1WTH A;  2BCO A;  5FO9 B;  1I4Q A;  4BBS H;  1PH5 A;  3S2H B;  1FVI A;  1PTO D;  1A3U A;  1WFQ A;  4KK7 A;  2Z1C A;  1N33 L;  1TVX A;  2PQE A;  5JEA G;  4KHV A;  2JA7 H;  2DN8 A;  4XQN A;  1T5X D;  3X3M A;  1Z7T A;  2F0F A;  1NE3 A;  3A0J A;  1C7Y A;  4PMC A;  2F0P A;  1D5M C;  2EXZ A;  5ISR A;  4C56 C;  1IXR A;  3VR3 A;  4B3R L;  4L63 B;  3Q6S A;  2K33 A;  1L1O A;  2XN9 C;  1PYW D;  3G4S A;  1HFG A;  4ZYS A;  3STB D;  3M4O H;  4GLX A;  1K3B C;  5FO7 B;  2R7Z G;  2BA1 A;  3NK9 A;  1PFM A;  2CVR A;  2MP1 A;  2ZTC A;  1XMQ Q;  4LFC Q;  4O1N A;  1QIL A;  4JV5 L;  4DR4 L;  3ZYY X;  4E6I A;  4RCO A;  1LTS D;  4KTA A;  4FXD A;  1A63 A;  3BDC A;  1VQN A;  4HSV A;  4J8Q A;  3R8B A;  2A8V A;  3T1Y Q;  1WTQ A;  3KFU A;  2EOT A;  2B39 A;  1PH6 A;  4DAY A;  1EY8 A;  3HOX H;  2YYZ A;  2B29 A;  5FLM H;  1SNM A;  2KJX A;  4CJ1 B;  1N32 L;  2YTY A;  4RGN A;  3HGB A;  4FF3 A;  2CW0 D;  2KHI A;  3E9I A;  4Q0F A;  2DUD A;  4AQY Q;  3HOY H;  3OWE B;  5D14 A;  2EY5 A;  4X66 Q;  4OON A;  4HMI A;  2K1B A;  3UE1 A;  2ZM6 L;  5FLX E;  4DNT B;  2NVT B;  3OMC A;  1A3T A;  3BVZ A;  1FGU A;  3RMH A;  2VUM G;  4L5T A;  5DLQ E;  3P1H A;  4QIW B;  3NTH A;  2DJG C;  1MIU A;  4N8F A;  1TII D;  5DEH A;  4ME3 A;  1DON A;  2RVL A;  1SNQ A;  3AYH B;  3D3R A;  3GV6 A;  4ZUI A;  2R93 G;  3OW2 A;  1F9R A;  4QIW E;  2VQF L;  2JP1 A;  1DCZ A;  3T16 A;  3AFQ A;  4PZ7 A;  2H1E A;  1RIP A;  3N52 A;  1XMO L;  2EDG A;  3GTJ H;  1S72 A;  1Q46 A;  1MKH A;  1G6P A;  2F0O A;  4IFD H;  3DEP A;  2A73 B;  4LF6 Q;  1CFM A;  5H1S E;  2JN4 A;  3S14 B;  1JJG A;  4BA2 I;  2R3Z A;  1DM0 B;  1HUM A;  5IOD A;  2RHS B;  3L7Z C;  2QDL A;  2AQ3 B;  1ENC A;  1F9Q A;  2RCN A;  3RLO A;  4JPB W;  4QQB X;  4HR7 B;  2C35 B;  4GNX A;  3J7A 5;  5T1I A;  3H15 A;  1VQB A;  3P75 A;  4NDX A;  4LFB L;  2K6A A;  4A3J H;  4RGM A;  2KA7 A;  2MJ8 A;  4G7Z C;  4UHV A;  2WKD A;  4PG3 A;  1SJE D;  5BN5 A;  4HTH A;  3CPW A;  1QVC A;  2F3V A;  2ICE C;  1B44 D;  4DV2 Q;  1PH4 A;  3T53 B;  4A3B G;  1EY0 A;  4FF2 A;  2MUY A;  1Z6H A;  2OQK A;  4DV0 L;  2EYO A;  1EY5 A;  2VW9 A;  1ZXT A;  2F0J A;  3BJU A;  2A68 C;  3HG9 A;  4OWX B;  3J80 E;  4A3L G;  1PRT F;  3RLF A;  5M5Y H;  4QGU A;  1Y69 U;  3TS2 A;  1HXY D;  3U9O A;  4CDE C;  1P16 A;  1D7Q A;  4GN3 B;  1OXX K;  2QF7 A;  3K5L A;  5JEA J;  3T1Y L;  2PW7 A;  2CKZ B;  1WYD A;  1Q1E A;  4AH6 A;  4P73 A;  3W1B A;  5KNB A;  2K32 A;  3NEN A;  5C3W A;  2QGQ A;  3TQY A;  3I4N B;  2B8F A;  4DV4 Q;  4I7A A;  3Q8D A;  3VA5 A;  4H0L C;  2CWP A;  1YNX A;  4RFB A;  4ABN A;  2ZTE A;  3I4M B;  1RD9 D;  4R9W A;  2Q2H A;  2E5L L;  1YNN C;  1BCP D;  4AQY L;  3GO5 A;  4BY1 B;  3KJO A;  3W2D A;  1W3S A;  2UUB L;  4YCU A;  3QG1 A;  1Q8I A;  1FNW A;  4PZ8 A;  3NTI A;  5IP7 H;  4MZ9 A;  1X32 A;  1ZYR C;  1I6H B;  1IKL A;  4C2M B;  4DK0 A;  2B8G A;  3BG3 A;  4DGZ A;  4DR5 Q;  3ERS X;  2F0U A;  4PNY A;  1LTA D;  4JI0 Q;  2R92 G;  1O78 A;  3M3Y B;  1K8O A;  3TZD A;  2AQ2 B;  2F3W A;  1PH7 A;  5FO8 B;  1IW7 C;  4JBJ A;  2HUG A;  4DR2 L;  4YCV A;  1KD1 C;  1HNW Q;  3F2C A;  2ZXO A;  1G2T A;  3F2B A;  1H9S B;  1FYC A;  1F2M A;  1CKN B;  1LT6 D;  2BH2 A;  1QJO A;  3FKI G;  1VQP A;  1HNZ L;  1S5C D;  3QOJ A;  4A3B B;  4PMB A;  5TSS A;  1JE4 A;  2J0T D;  1EFW A;  2CFM A;  5BR8 L;  1AFP A;  1SE8 A;  3BZD B;  5GAG C;  2KED A;  3UDF A;  1IKM A;  3CXC A;  1K83 B;  4FXK C;  1YJN A;  2BE5 C;  1SYF A;  1O7I A;  1K8A C;  1D1I A;  1I94 L;  1Q7Y C;  1JOQ A;  2X6G A;  1IHZ A;  1I50 B;  2NZH A;  2F4V L;  1NCV A;  3VDY A;  2RHQ B;  1V1O A;  5CV4 A;  5M3F B;  4IQZ A;  1QNU A;  3K80 C;  4C3J H;  1A2T A;  5KRU A;  4POG A;  3H3V H;  4X65 L;  2JA8 H;  5DM6 3;  2NVX B;  2KHS A;  3C46 A;  1JOK A;  1YBY A;  2LY7 A;  5M9O A;  3ERO A;  5C6A A;  5C3E B;  1X3P A;  2KEN A;  3KK7 A;  4GOP C;  4A3M G;  2UXC Q;  4POF A;  4YIJ A;  4DFA A;  2XWJ B;  2NTS A;  3L9A X;  3S24 A;  2F0K A;  2NUC A;  2K5V A;  1TWG B;  1WCM G;  5K36 H;  2N49 A;  5T1G A;  4JOI C;  3KF8 A;  4JYA Q;  1GJX A;  2ZTD A;  4A3D G;  4DR6 Q;  1UNS A;  3PUV A;  1ENF A;  3VA7 A;  5CBA E;  5JAV A;  4BXX H;  2WV6 D;  2KCC A;  3S15 B;  1UE1 A;  1A0I A;  2R92 B;  2VY3 A;  3FPP A;  5COR A;  1IBK Q;  1GUS A;  3TP7 A;  4LF9 Q;  1QB5 D;  4DR1 Q;  5K5P A;  4K14 A;  2EYL A;  2FHT A;  4F87 A;  4K0K Q;  4Y52 H;  2WAQ G;  1I4G A;  2BH8 A;  2HD3 A;  2AWN A;  1E24 A;  1ASY A;  1CZG A;  2Z6B A;  3F2D A;  3FKI B;  1OXV A;  4GZY C;  5HUR A;  1HR0 L;  5LL6 S;  3BZK A;  1KDB A;  2NVQ B;  4IUP A;  1SR3 A;  2A5H A;  3PIP 3;  4RG1 A;  3NSW A;  1DGS A;  4LJZ C;  4JK1 C;  1ICF B;  3PO3 H;  2NZO A;  3CCS A;  3S2D H;  1X65 A;  4JI0 L;  3GTL B;  1II3 A;  2F0T A;  5ELO A;  3N6R A;  3E0E A;  1VQO A;  1B3Q A;  5FLX L;  2IW3 A;  1KRT A;  3H6M A;  1HNW L;  4LK1 C;  3NBH B;  5M5W H;  4A3M B;  4YWL A;  3TN2 A;  4X3S A;  4CKE A;  1QCB D;  1Y8N B;  2N88 A;  4A3G B;  3A8K E;  3MA2 B;  1WCM B;  2AQ1 B;  4A93 G;  5LHY 1;  4X3K A;  5M3M G;  4A3D B;  3M4Q A;  4XTC S;  2E74 C;  1WI5 A;  4HSP A;  2XRS D;  4HJ7 A;  5ELF A;  4YY3 L;  2B2V C;  3J7A F;  3I56 A;  3S1Q B;  3S1M B;  1AW7 A;  1NUC A;  3U4Z A;  1B1Z A;  3RN5 A;  5DAU A;  3HKZ G;  5IGE A;  4WJW A;  2A19 A;  4XT3 B;  5CBE E;  2JEB I;  3JAM i;  1K28 A;  2IT1 A;  2HCI A;  2K01 A;  1BOS A;  2WFW A;  4HCE A;  2K5W A;  1A62 A;  4IPD A;  1AP0 A;  2Z8L A;  3GTO H;  1V1P A;  4A3K G;  3CCJ A;  5G3L F;  2WB1 G;  2UXB Q;  3M9B A;  2G9D A;  4FNF A;  3KBG A;  4JYA L;  1U0L A;  1NSN S;  1C8C A;  1GVP A;  3WOF A;  4M8A A;  2NN6 H;  3K81 C;  3WDN A;  3PO2 B;  2EYF A;  4FDB A;  3GTQ B;  4MN3 A;  4X62 Q;  3C1F A;  1PVO A;  1YJ9 A;  1XXG A;  2AUJ D;  1N34 Q;  5JJZ A;  4LF9 L;  3AEV A;  3S2H H;  1UE7 A;  1CSQ A;  2A68 D;  3J80 L;  3WOE A;  3DMU A;  3MTS A;  1HA6 A;  1MI2 A;  5IWA Q;  1AZP A;  3CU7 A;  2OXP A;  3MEF A;  1HA5 A;  4IJH A;  3F8T A;  5C5M A;  4CKC A;  2ZJQ A;  1B53 A;  5E7N A;  5CR3 A;  5CV9 A;  4CHT B;  4P2C B;  1VQH A;  2UUA L;  1NNX A;  2FMC A;  5CV5 A;  2CH4 A;  2PI2 E;  2V1C C;  4HJ5 A;  1S5E D;  4ID6 A;  1PZJ D;  3ER0 A;  3OIQ A;  1JIC A;  1LO5 D;  2OT2 A;  2RDH A;  3Q23 A;  4DKA C;  1D6E C;  4H7B A;  4NXN Q;  2GVB A;  1CI3 M;  3I70 A;  2JQO A;  4A3C H;  3EBE A;  5CGK A;  1GO3 E;  2KEE A;  3CHB D;  2VQE L;  1AEX A;  2HCC A;  3K7U C;  2Z6K C;  4DV5 L;  4FO2 A;  4KKT A;  3LNN A;  3HKZ B;  4GOP A;  4OIJ A;  1SE4 A;  3CC4 A;  2O4X A;  3I8Z A;  1E1T A;  1JWU D;  1L0W A;  4RGT A;  2LKV A;  4JOI A;  2RSO A;  5CV7 A;  1PZK D;  1PYS B;  2NBF A;  2QDB A;  4TQU S;  4F7X A;  2UU9 Q;  1L2F A;  1WJJ A;  3BYY B;  4FYD A;  4HIK A;  2OCE A;  3ITP A;  2D9U A;  2E2H B;  3G6E A;  3T1H L;  3S1N B;  2NVT H;  3URY A;  1D8L A;  3SK6 A;  1BBX C;  2JA9 A;  2F03 A;  1EQV A;  4XYO A;  4IUT A;  2KEC A;  4DAP A;  5I2X A;  4BWG B;  4UAI A;  1UAP A;  1IBL L;  2AWO A;  3S1R B;  2R6G A;  1YVC A;  4JI8 Q;  1EU4 A;  3ULP A;  1SEB D;  1SN8 A;  3NEL A;  4JI6 Q;  4JVZ A;  1PH2 A;  4Q5V A;  1SMY D;  1KLU D;  2P5Z X;  2RKS A;  2D0P A;  3Q22 A;  3HP3 A;  4A3F G;  1J5E Q;  4R8I A;  4LF7 L;  4EX5 A;  1O80 A;  1BUV T;  1IYJ B;  3U4V A;  4X62 L;  3S14 H;  1EWH A;  3B6Y A;  3PUX A;  3RUZ A;  3C3L A;  2VB2 X;  2NVY B;  3GTK B;  1N34 L;  4KY7 A;  2D62 A;  5IY0 A;  3GDE A;  3HFZ B;  3AB9 A;  3I72 A;  2E2I B;  4AYB E;  3MHB A;  1UE5 A;  1U4P A;  2I5H A;  2SDF A;  4BY7 G;  3A54 A;  1SRO A;  4HED A;  1EFI D;  1PTO B;  2M00 A;  3G7L A;  5AJ3 L;  1QE6 A;  1Y1W G;  1IL2 A;  3I4L A;  1HR0 W;  2ENB A;  3FP9 A;  5EJW A;  1TXY A;  3KDF A;  4LAA A;  4WOR A;  4NW2 A;  4A3I G;  4BBR G;  1WVL A;  3BVM A;  1PFN A;  2F0S A;  5LMU Q;  3HOU G;  2K5H A;  3DWP A;  3SK5 A;  1SYB A;  1TR5 A;  1K3R A;  3D4R A;  4KJO A;  4CDF C;  4RWS C;  4A3E G;  1KAA A;  3I7F A;  1BO0 A;  3W1G A;  3TS0 A;  3H0G G;  1VQ5 A;  2B2V A;  3OMG A;  2FMM A;  4KJN A;  1SBB B;  3PUY A;  2MO0 A;  2B2Y C;  3HOW G;  4DK1 A;  5IGF A;  3K5M A;  2R61 A;  5A2Q L;  1ASZ A;  4S3S A;  2JA6 B;  3I4N H;  2CCZ A;  3I73 A;  4DV6 Q;  4XYQ A;  4ZLT F;  1EY7 A;  3PIO 3;  1DD2 A;  3VYT A;  3I4M H;  4EQO A;  3DM3 A;  2SNS A;  3CCR A;  2JA5 G;  3W5O A;  4BY1 H;  3PF4 A;  3ND8 A;  5LMN Q;  3MVV A;  4A3F B;  3SE0 A;  3ND9 A;  4B9X A;  2UU9 L;  4JW0 A;  1A2U A;  1EY4 A;  3G71 A;  2EXD A;  2Y0S G;  3P7J A;  1I6H H;  4C2M H;  3DM1 A;  5JPN C;  1DOK A;  1KRS A;  4TRD A;  1EEI D;  5IYD G;  3KJP A;  3M3Y H;  4I65 A;  4BY7 B;  4TKO B;  3KOJ A;  4OO1 G;  2EJF C;  2YV5 A;  4IN3 A;  1Y1W B;  4P72 A;  4ZCK A;  2OTJ A;  2ZT9 C;  4YWM A;  2N3S A;  1RL2 A;  4A3I B;  4O0A A;  4A3B H;  4BBR B;  4IUV A;  4JI6 L;  1STG A;  3PIP A;  3VYR A;  2IPK D;  3K8A A;  1EIH A;  2F0M A;  2YU9 B;  1IL8 A;  1YNJ D;  1STN A;  1K83 H;  3L2P A;  1J5E L;  1QNK A;  4A3E B;  1FJG L;  2J7Z A;  1PRT D;  3CW2 C;  4DNR B;  2F52 A;  3H0G B;  4FXG C;  4GKK Q;  2Z6K A;  1I50 H;  3EA6 A;  1HPC A;  4JI4 L;  1FNV A;  3R2T A;  1XYI A;  1TY2 A;  1GUN A;  4DA2 A;  5M3F H;  1R9T B;  4JI7 Q;  1KIX A;  2AKW B;  3HOW B;  2ALY B;  3EJI A;  3IFT A;  1YHB A;  3EIV A;  1E22 A;  3FHW A;  2CWA A;  1Y1V G;  1IBM Q;  5E1F A;  2NVX H;  5GRO A;  5D65 A;  1MSH A;  4KLK A;  1N9W A;  4RHS A;  2K28 A;  5C3E H;  4WJ4 A;  1X55 A;  3VR6 A;  2JA5 B;  3J80 i;  1Q90 A;  3NEM A;  5CV6 A;  5LMU L;  2QEJ C;  2AHO B;  5CYU A;  3ULL A;  2RF4 A;  1G51 A;  1CQV A;  1T9H A;  2Y0S B;  4QJF A;  2EJM A;  2JXM B;  1DOM A;  1FL0 A;  1FGB D;  4R4I A;  4L5S A;  2XTI A;  1VF5 C;  2R7Z B;  1VCI A;  3S15 H;  1UE6 A;  3QJY A;  1UUP A;  4DXF A;  2R92 H;  2WP8 J;  2DY8 A;  2F0G A;  4BBS G;  3JAM L;  2B2W C;  2KVM A;  3R93 A;  2Y0S E;  1C4Q A;  3MWY W;  1B50 A;  3TDQ A;  4LWC A;  3CAM A;  1VQ8 A;  3W3A A;  3FKI H;  3BU2 A;  1D1K A;  2OWO A;  3KUP A;  3BYT B;  2XGT A;  3RR5 A;  1K0R A;  4IUN A;  5LMN L;  4ZUJ A;  1AZQ A;  4APV A;  2NVQ H;  2N8N A;  5IYB G;  2VXW A;  5AFW A;  1SDF A;  5NUC A;  5C5L A;  2GVA A;  3H09 A;  1BQQ T;  3QWN A;  3KLR A;  3M4P A;  3UI2 A;  3J7A V;  1K0S A;  1CTM A;  4YCW A;  3GTL H;  5FJ8 G;  1XMQ L;  4LFC L;  1TS3 A;  1Q1B A;  3K5O A;  2HHH Q;  3EQL C;  3GTG B;  1GOZ A;  1LTL A;  3SDZ A;  1HQM C;  1Y1V B;  4CJ2 C;  3A56 A;  3J81 j;  2VUM B;  2QEX A;  4B3T Q;  4JI1 Q;  2NYZ D;  2A69 C;  4DR3 Q;  4WJ3 M;  1LV9 A;  4OO1 I;  3J81 c;  4A3M H;  2XNA C;  4RKL A;  5M5X B;  2PCF B;  2R93 B;  4A3G H;  2F3I A;  5I2Y A;  4HID A;  4RH6 A;  1VQI A;  1WCM H;  1I4H A;  4V19 0;  3GTP B;  5JJK A;  1VDZ A;  2OQ0 A;  1NMF A;  2ICI A;  4A3D H;  2JEA I;  4GN5 A;  4A76 A;  1O7Y A;  1TWA B;  2B2Y A;  1JB3 A;  1EQR A;  4X66 L;  3FRP B;  5IP9 H;  2BOS A;  1XNR Q;  4DK3 C;  1OXS C;  4BS9 A;  5C4X G;  2FJ2 A;  1X9N A;  1IBM L;  4K5X A;  5C4J B;  1J9O A;  3S1Q H;  3S1M H;  2EY6 A;  2DNC A;  5EPL A;  3TP5 A;  1A8V A;  3E6Z X;  1I4R A;  1LM0 A;  1U5K A;  3E3X A;  2K14 A;  4QUC A;  1D5X C;  3KBX A;  1PH8 A;  4K2K A;  1WTO A;  3RZD B;  1XPR A;  5EAY A;  3UDI A;  1KXL A;  1MJE A;  4DR7 Q;  4IAL A;  1HRJ A;  4L5R C;  2PNH A;  1XJV A;  2C5C A;  1H9S A;  1FNU A;  1CKN A;  3AFP A;  3SEB A;  3LGJ A;  3PO2 H;  3H94 A;  3GTQ H;  4LF6 L;  2BDO A;  3E9H A;  1F9S A;  1KDA A;  5DNF A;  2CHB D;  2A6H D;  5EKI A;  1EQQ A;  2L15 A;  4NP5 A;  2FXQ A;  1HQR D;  1ONL A;  4XQJ A;  1KL9 A;  2HQE A;  2L5T A;  3CC7 A;  2UXD Q;  3CCV A;  5J3B A;  1VQM A;  1JOO A;  2F0L A;  3CQZ B;  3CRK C;  4DV2 L;  3DWQ A;  1X54 A;  1F2L A;  4OX9 Q;  1S4Z A;  2L0C A;  1CM9 A;  1LTT D;  2K50 A;  1Q82 C;  5EBD A;  1F2Z A;  4KV6 A;  4MTK A;  4DV7 Q;  5EBC A;  5GAD C;  4N9T A;  5C4X B;  1YJW A;  2PO4 A;  3R2I A;  3VYU A;  2PQA B;  5JJI A;  4G57 A;  2NTT A;  3U50 C;  1EL0 A;  5I9O A;  1GXD C;  2RCF A;  4B3T L;  4JI1 L;  1BVS A;  4RHR A;  5A35 A;  3HZX A;  1AH9 A;  1B9M A;  2EPB A;  3GD7 A;  3CCM A;  5IYC H;  1VQ9 A;  1ESF A;  1M4V A;  5E3F A;  3A5U A;  2EZV A;  1VQF A;  1N36 Q;  4DV4 L;  3RZO B;  5G3L D;  1V43 A;  1JWS D;  4R1J A;  3QO2 A;  2IX0 A;  1QWY A;  3ZJY C;  3NUC A;  2MPM A;  1MD2 D;  1LT3 D;  1PYB A;  1W6J A;  4OWT B;  2E2H H;  1SSO A;  1B8A A;  3S1N H;  1B2T A;  2WKC A;  4DR5 L;  2IL8 A;  3G6J B;  2D5D A;  4GKJ Q;  3V05 A;  3VR4 A;  1LT5 D;  4N9P A;  2D2C C;  3FVQ A;  3OSO A;  1RTN A;  1E2W A;  1G29 1;  5HGT A;  1KQS A;  2I0Q A;  3OYY A;  5JVH 3;  3PIO A;  3KF6 B;  1VQ7 A;  1YZ6 A;  1SYG A;  1M8A A;  2RA4 A;  3S1R H;  1C48 A;  2GN5 A;  3NP8 A;  4JI5 Q;  4DR7 L;  1B4O A;  4IUR A;  4PQX A;  4Y7N B;  3NBH A;  3X3N A;  4N8X 1;  3K58 A;  2HQL A;  3MFG A;  5F2D A;  1PTO C;  1PH9 A;  1PH3 A;  3KLS A;  2JSO A;  4O2D A;  4B08 A;  4ULL A;  3GTK H;  4IFD I;  1TT2 A;  1N8R C;  1VQD A;  3IRB A;  2CH4 W;  4C3J G;  4FF1 A;  2E2I H;  2JA8 G;  2D0O A;  2J4X A;  4IO9 A;  4EQP A;  3TSS A;  3T13 A;  2UXD L;  1PTO H;  5I6Y A;  3V96 A;  1E2V A;  1JMC A;  2WAQ B;  1SNO A;  1JJC B;  1EYA A;  5KYI A;  1QUQ B;  1LTG D;  1VS0 A;  2PNR C;  2UXC L;  3KYH C;  5K36 G;  2K5D A;  1B70 B;  4HCS A;  2WAQ E;  5BN4 A;  1EU3 A;  5C44 G;  4XQQ A;  4DV7 L;  1KAW A;  3HOV G;  2ZJR A;  4JI2 Q;  4DR6 L;  3PMF A;  3MZ5 A;  4EVO A;  2M9V A;  4IOC A;  2KCT A;  1IBK L;  1LAC A;  1U4L A;  4QY7 A;  4X64 Q;  2ASB A;  1VQ6 A;  4DR1 L;  1AE3 A;  2JA6 H;  1WOC A;  2MGS A;  4K0K L;  1N36 L;  4KN4 C;  1PLF A;  2Q2I A;  1K9M C;  1R4P B;  4CJ0 B;  5ELN A;  2A69 D;  1WD0 A;  4LF5 Q;  2ES2 A;  2PI2 A;  2F0N A;  5IGD A;  4A3F H;  3K7A B;  2I46 A;  1X6O A;  1EUJ A;  1EZ8 A;  4JC0 A;  5IT9 c;  3Q24 A;  4A93 B;  2V4D A;  1CA6 A;  3TBI B;  1SE3 A;  4KD4 A;  5M3M B;  1STY A;  2K4K A;  1YNN D;  3IL8 A;  3M85 A;  1PMR A;  1Y14 B;  4P75 A;  4ZRZ A;  2L11 A;  3MXN B;  4KY6 A;  4ALP A;  4BY7 H;  1VQA A;  2E2J B;  4HMJ A;  2KUM A;  4LW1 A;  1Y1W H;  1XX8 A;  2IJ0 A;  1YI2 A;  1SRU A;  1ZYR D;  1RCV D;  1EY6 A;  2Q8R E;  3PUZ A;  1HNX Q;  4B3M Q;  4GN4 B;  1KNE A;  5EKL A;  2I5L X;  4JG2 A;  4A3I H;  1GKH A;  4JI5 L;  4BBR H;  4CGY B;  1JE5 A;  3BDL A;  5GQO A;  4J15 A;  3HS0 C;  3LWU A;  3KLS X;  2A74 C;  4DV1 Q;  2H4O A;  2KBN A;  3R3O A;  4TVA B;  4A3K B;  2YU9 H;  1O7L A;  1IW7 D;  2HT1 A;  5C0X G;  2WB1 B;  2E8G A;  5C44 B;  4QCL A;  2G9H D;  3HKZ E;  4R4C A;  1EIY B;  2PZT A;  3H0G H;  3HOV B;  3JC6 6;  1R9T H;  1C0A A;  2YTX A;  1SMX A;  2LXK A;  3HOW H;  3DHQ A;  1J6Q A;  4IJL A;  3SR1 A;  1XTC D;  1S40 A;  1EOT A;  2WB1 E;  3TZU A;  1WTV A;  2EY1 A;  1TWF B;  4G7H C;  2F0E A;  2BE5 D;  1X3G A;  3H3V I;  4HJ9 A;  4XT1 B;  2QCP X;  5JEA H;  2QKI C;  4K8I A;  1B7Y B;  2SNM A;  2Z4H A;  3D4W A;  1STA A;  4RAU C;  3DEO A;  1Q86 C;  4HN7 A;  2JA5 H;  1VQJ A;  1KC8 C;  1X3E A;  1PXU A;  4L6T B;  1V8Q A;  3J81 i;  1MGS A;  1RDP D;  4K2L A;  2UXB L;  1WD1 A;  1NTG A;  1QVF A;  1TWH B;  3NXW A;  2B2T C;  4BA1 I;  2NN6 G;  1PFB A;  5IYD H;  2EQS A;  2LFN A;  4G4K A;  2EIF A;  3TRE A;  2R7Z H;  4DR4 Q;  1F9P A;  1G8Z D;  4JV5 Q;  1QG7 A;  2HDM A;  2K05 A;  2DJF C;  3A8J E;  4X64 L;  4UPA A;  5HY6 A;  1HFN A;  4FVM A;  3SK4 A;  1AE2 A;  3MXP A;  3I4O A;  1I3Q B;  1VQE A;  3T4A C;  2M2L A;  1YIT A;  2A6E C;  4EQN A;  4UP8 A;  5IWA L;  4R4T A;  4XDX A;  1HZB A;  4OEM B;  3S17 B;  3HRZ C;  1N32 Q;  2K75 A;  4M1U B;  4QL5 A;  3UE0 A;  1I4P A;  1D2B A;  4RGO S;  3UDX A;  3NE5 B;  2LMC B;  1PZI D;  4LMQ D;  5ELC A;  2ZM6 Q;  1G2S A;  1ILP A;  4NXN L;  4A3C G;  2MFI A;  5EPJ A;  5D3I B;  1RHP A;  1JB7 A;  1R4Q B;  3GTG H;  5CV8 A;  1ZKO A;  2KCN A;  1Y1V H;  3MXU A;  1IYU A;  4G7O C;  3MXG A;  1E2Z A;  1BNZ A;  2VUM H;  4IPC A;  3K57 A;  1SXT A;  3J81 E;  2OF1 A;  4X3U A;  3U9S A;  1HNX L;  1JOR A;  1QZH A;  5FK9 C;  4JBW A;  2B2U C;  1XWE A;  1NJI C;  1S5F D;  4KMU C;  1M1K C;  5M5X H;  2R93 H;  4HAE A;  2VQF Q;  2AUK A;  3NHH A;  3V2T A;  1TWC B;  1SNP A;  2Q8T A;  4MNO A;  3FPU B;  4U68 A;  1XMO Q;  2KOL A;  3VR2 A;  3AU7 A;  3SGI A;  2QIL A;  3GTP H;  1I6V C;  3MC0 B;  1K8M A;  5KIX A;  1BF4 A;  1WTW A;  4KKU A;  1F77 A;  1TWA H;  1XTD A;  3C1E A;  2RSN A;  3GP7 A;  5C0X I;  3BVG A;  2IX3 A;  2RQX A;  4YHH Q;  3ICE A;  1G91 A;  1CZW A;  5JOB A;  1SE2 A;  5KNC A;  4OHJ A;  4MHE A;  4LFB Q;  5C4J H;  4QUF A;  1SFO B;  5KND A;  2JJQ A;  1STH A;  4QB4 A;  3M4Y A;  4ZQ3 A;  4K6D A;  1ML0 D;  1F2Y A;  2XWB B;  2YTV A;  4C3I G;  2PZU A;  1L1O B;  4LUZ A;  1BR9 A;  2HIX A;  3RZD H;  3PCO B;  1QOH A;  3QOL A;  3D8G A;  1HJP A;  4B3S Q;  4JI8 L;  3EFX D;  4DV0 Q;  4C3H G;  5IYB H;  4DNI A;  5C0X J;  2TMP A;  1LTI D;  5J39 A;  1IYV A;  3HOU B;  4Z9C B;  1QVG A;  1H9K A;  5CC4 A;  3QB3 A;  5FJ8 H;  5CMD A;  4CKB A;  2F0Q A;  3JAM c;  4WRD A;  1HTL D;  2IHE A;  1OXU A;  2AMC B;  4A3L H;  1ET6 A;  3A5Z B;  3I3C A;  4IUU A;  4HJA A;  2NN6 I;  3H91 A;  4F88 A;  2X6L A;  1CUK A;  3M7N A;  3VR5 A;  4DAY B;  5I4D A;  1YHA A;  4HIM A;  2KHJ A;  2Z4I A;  2FIN B;  4RA8 A;  3K5N A;  2MNA A;  4OL7 A; 
#chains in the Genus database with same CATH homology
 2K04 A;  1CT1 D;  4R8N A;  3S16 B;  1VF7 A;  3ERQ A;  3T56 B;  4NKL A;  4K5V A;  3O13 A;  2O5J C;  2JE6 I;  5I9P A;  3OHX C;  4ZKC B;  1B3A A;  1KTK A;  1OXT A;  5IGC A;  4QMG A;  3DUZ A;  4WFN 3;  1HTP A;  1PTO F;  1GUT A;  4C3I B;  2K03 A;  1TS5 A;  3A8I E;  2E76 C;  4C3H B;  2HDL A;  2B2T A;  2I07 B;  1NAP A;  5FKA C;  1BDO A;  1EIG A;  1BCP B;  5IGG A;  1FR3 A;  3K0Y A;  4FP5 D;  2GA4 B;  5ELD A;  2EYM A;  2EY2 A;  4C1N I;  2IX1 A;  4IZ8 A;  1ENA A;  3GTM B;  5LL6 X;  3LX0 A;  3TP6 A;  1VMP A;  2NWG A;  3EVQ A;  1SYE A;  2VNU D;  3HOZ B;  4KD3 A;  5C4Z A;  5IIF A;  4TSS A;  3D4D A;  1SAP A;  1ROD A;  3E0J A;  2B63 B;  2F0D A;  4MIU A;  4DXG A;  2B2U A;  4BBS B;  3LWE A;  3MEH A;  2JA7 B;  2FFK B;  2RDG A;  4KHZ A;  1GUO A;  3D6W A;  4V0B A;  1NR4 A;  3VYS A;  2A6E D;  1DXM A;  4I7Z C;  4OIK A;  3IAY A;  3OIP A;  2EJG C;  3M4O B;  4ZAI A;  4IFD G;  1HUN A;  3IFD A;  1A3V A;  2L12 A;  1SND A;  1CHP D;  2JYO A;  2PW5 A;  1RF2 D;  4H44 C;  4H13 C;  1G6Z A;  2L4N A;  1DZ1 A;  2Q8I B;  1VMC A;  1ZEQ X;  5E4X A;  5JPM C;  2RBM A;  4PMW A;  1EY9 A;  3J81 L;  3IKJ A;  3M7G A;  4RKB A;  1LAB A;  3H3V C;  3SHL A;  3HOX B;  5IT9 E;  4XXE A;  2BDN A;  2EYH A;  2XRQ D;  1Q12 A;  3FMC A;  3C2P A;  1S5B D;  3AMU A;  3HOY B;  5JVG 3;  4FF4 A;  3FEW X;  1E0B A;  1SYC A;  2O2L D;  4NMZ A;  5DM7 3;  1CQF A;  2PZW A;  1EEF D;  1SMY C;  4UDU C;  2L9H A;  5COY A;  4OGQ C;  1I4X A;  1Z47 A;  4PV1 C;  1KNA A;  3ONA B;  3NWS A;  3MFY A;  3NWT A;  1BCP F;  1O7Z A;  3GTJ B;  2RDF A;  1S5D D;  2L55 A;  5IGB A;  5J1Z A;  4J1M A;  4L8J A;  2PYK A;  1LT4 D;  1H9J A;  2B2W A;  1DYQ A;  4QF4 A;  2F0H A;  1EYD A;  4ZK9 B;  1CK1 A;  2WAC A;  1Y8P B;  1STB A;  4A3J B;  1GUW A;  1HHV A;  5D3D A;  1STE A;  2F0V A;  4KY5 A;  3HEJ A;  3QIA A;  2TSS A;  2EYJ A;  4K5W A;  5EPK A;  1MBY A;  1LTB D;  2K5Q A;  1GUG A;  3CKI B;  1BXT A;  2SOB A;  1U4R A;  5A2Q E;  1OO9 B;  5M5Y B;  2NB0 A;  4K6L A;  5EGT A;  3Q0A A;  4KKS A;  1GHJ A;  4ILW A;  3DXJ C;  1KLG D;  2EVB A;  4K8J A;  1ESR A;  4F8M A;  2XSC A;  1U4M A;  2EE1 A;  2DNE A;  1RTO A;  1TU2 B;  3D6C A;  3RD4 A;  4EGV A;  2F0I A;  4U67 3;  2ID0 A;  2ZXR A;  5C0X H;  1TKW B;  5FOB B;  2N55 A;  3NPP A;  3PUW A;  4IFD J;  5EQ0 A;  1TQO A;  1TS2 A;  1HCZ A;  1H9M A;  4X3T A;  3NTK A;  3J7Y W;  4ODG A;  1Y8O B;  2CQA A;  1DJR D;  2K7V A;  2F1M A;  1GHK A;  4KN7 C;  1V1P B;  1YNJ C;  4XIG S;  1RKN A;  1PRT C;  5KGU A;  2CW0 C;  5I6W A;  1ILQ A;  1KAB A;  2C9O A;  2ZXP A;  1MSG A;  1RJT A;  1LTR D;  2NZ1 D;  1KDC A;  2WII B;  1LLR D;  1JR0 D;  2F4I A;  2E2D C;  5BN3 A;  1EZ6 A;  1EYC A;  1WTP A;  1J8I A;  2OEO A;  2LS0 1;  4C3J B;  4KI0 A;  3NQI A;  1L0X B;  2E75 C;  2JA8 B;  2KQ3 A;  3MXN A;  1W6K A;  1A6X A;  2DY7 A;  3NQT A;  3E5S A;  1Q3L A;  4DU9 A;  3BS1 A;  3GQB A;  1T5E A;  3BDO A;  2XIW A;  3JAM E;  5ELE A;  2F0W A;  4DN4 M;  4J6H A;  4O42 A;  3T51 B;  3OWF A;  3GV3 A;  2WIN B;  1CHQ D;  3I91 A;  3PV0 A;  5C3X A;  3K6O A;  4RCN A;  1B9N A;  1X3Q A;  1H9R A;  1U9R A;  5J22 A;  3MAQ A;  1L0Y B;  3TME A;  1NR2 A;  4IUQ A;  1DOL A;  2MHV A;  5IT9 L;  2O5I C;  1WTR A;  3PO3 B;  1D5Z C;  3S2D B;  3K59 A;  4ME5 A;  3I90 A;  4B9W A;  3OW7 A;  3OPO A;  5IOC A;  1A15 A;  4OO1 H;  3TP8 A;  3S9W A;  1CA5 A;  5EKK A;  5KEE A;  1BCP C;  5M5W B;  1EWC A;  4C1N K;  1ICW A;  1SJH D;  1AN8 A;  3F2U A;  4AYB B;  3P20 A;  1JWM D;  4ZKB B;  5KYL A;  1TS4 A;  2L1B A;  2EYP A;  3A7L A;  3SXH A;  1SYD A;  2PMZ B;  1EQT A;  2SEB D;  1JQY D;  1TY0 A;  3SVM A;  3A7A B;  3DWA A;  2PPB C;  1ET9 A;  3SK8 A;  2X69 A;  3D31 A;  1UEA B;  4DF7 A;  1WTX A;  3GTO B;  3L3O C;  1SNC A;  2A6H C;  4DAV A;  2XVS A;  5C4H A;  2BA0 A;  3OOC A;  3A55 A;  3NBI A;  5E4W C;  1JC7 A;  3FDT A;  2IWH A;  1PDQ A;  3CRL C;  5ELB A;  2VB3 X;  1JCK B;  1PRT B;  4CBV A;  1FD7 D;  5FO9 B;  2BCO A;  1I4Q A;  3S2H B;  1PTO D;  1A3U A;  4KK7 A;  2Z1C A;  1TVX A;  2PQE A;  5JEA G;  4KHV A;  2DN8 A;  4XQN A;  1T5X D;  3X3M A;  1Z7T A;  2F0F A;  4PMC A;  2F0P A;  1D5M C;  2EXZ A;  5ISR A;  4C56 C;  3VR3 A;  4L63 B;  3Q6S A;  2K33 A;  2XN9 C;  1PYW D;  1HFG A;  4ZYS A;  5FO7 B;  2BA1 A;  3NK9 A;  1PFM A;  2CVR A;  2MP1 A;  4O1N A;  1QIL A;  3ZYY X;  4E6I A;  4RCO A;  1LTS D;  4KTA A;  4FXD A;  3BDC A;  4HSV A;  4J8Q A;  3R8B A;  1WTQ A;  2EOT A;  2B39 A;  4DAY A;  1EY8 A;  2YYZ A;  1SNM A;  2KJX A;  4CJ1 B;  4RGN A;  3HGB A;  4FF3 A;  2CW0 D;  4Q0F A;  3OWE B;  5D14 A;  2EY5 A;  4HMI A;  2K1B A;  5FLX E;  4DNT B;  2NVT B;  3OMC A;  1A3T A;  3BVZ A;  3RMH A;  3P1H A;  4QIW B;  3NTH A;  1TII D;  5DEH A;  1DON A;  2RVL A;  1SNQ A;  3D3R A;  3GV6 A;  4ZUI A;  1F9R A;  2JP1 A;  1DCZ A;  3T16 A;  2H1E A;  3N52 A;  2EDG A;  2F0O A;  4IFD H;  3DEP A;  2A73 B;  1CFM A;  3S14 B;  4BA2 I;  2R3Z A;  1DM0 B;  1HUM A;  5IOD A;  3L7Z C;  2AQ3 B;  1ENC A;  1F9Q A;  4HR7 B;  5T1I A;  3P75 A;  4NDX A;  2K6A A;  4RGM A;  2KA7 A;  2MJ8 A;  4G7Z C;  2WKD A;  1SJE D;  5BN5 A;  4HTH A;  2F3V A;  2ICE C;  1B44 D;  3T53 B;  1EY0 A;  4FF2 A;  2MUY A;  1Z6H A;  2EYO A;  1EY5 A;  1ZXT A;  2F0J A;  2A68 C;  3HG9 A;  3J80 E;  1PRT F;  3RLF A;  1Y69 U;  1HXY D;  3U9O A;  1OXX K;  2QF7 A;  3K5L A;  5JEA J;  2PW7 A;  1Q1E A;  5KNB A;  2K32 A;  5C3W A;  3I4N B;  2B8F A;  3VA5 A;  4H0L C;  4RFB A;  4ABN A;  3I4M B;  1RD9 D;  4R9W A;  1YNN C;  1BCP D;  3GO5 A;  4BY1 B;  3W2D A;  3QG1 A;  1Q8I A;  1FNW A;  3NTI A;  1X32 A;  1ZYR C;  1I6H B;  1IKL A;  4C2M B;  4DK0 A;  2B8G A;  3BG3 A;  4DGZ A;  2F0U A;  4PNY A;  1LTA D;  3M3Y B;  1O78 A;  1K8O A;  3TZD A;  2AQ2 B;  2F3W A;  5FO8 B;  1IW7 C;  2HUG A;  2ZXO A;  1G2T A;  1FYC A;  1H9S B;  1F2M A;  1LT6 D;  1QJO A;  1S5C D;  3QOJ A;  4A3B B;  4PMB A;  5TSS A;  1JE4 A;  2J0T D;  1AFP A;  3BZD B;  2KED A;  1IKM A;  1K83 B;  4FXK C;  2BE5 C;  1SYF A;  1D1I A;  1JOQ A;  2X6G A;  1IHZ A;  1I50 B;  1NCV A;  5CV4 A;  1V1O A;  5M3F B;  4IQZ A;  1QNU A;  1A2T A;  5KRU A;  5DM6 3;  2NVX B;  2KHS A;  3C46 A;  1JOK A;  2LY7 A;  5M9O A;  3ERO A;  5C6A A;  5C3E B;  1X3P A;  3KK7 A;  4DFA A;  4YIJ A;  2XWJ B;  2NTS A;  3L9A X;  2F0K A;  2NUC A;  1TWG B;  5K36 H;  5T1G A;  3KF8 A;  1GJX A;  1UNS A;  3PUV A;  1ENF A;  3VA7 A;  5CBA E;  5JAV A;  2WV6 D;  2KCC A;  3S15 B;  2R92 B;  3FPP A;  5COR A;  1GUS A;  3TP7 A;  1QB5 D;  5K5P A;  4K14 A;  2EYL A;  2FHT A;  4F87 A;  1I4G A;  2AWN A;  1CZG A;  3FKI B;  1OXV A;  4GZY C;  5HUR A;  5LL6 S;  1KDB A;  2NVQ B;  4IUP A;  2A5H A;  3PIP 3;  3NSW A;  4LJZ C;  4JK1 C;  3GTL B;  1II3 A;  2F0T A;  3N6R A;  5FLX L;  2IW3 A;  3H6M A;  4LK1 C;  4A3M B;  3TN2 A;  4X3S A;  4CKE A;  1QCB D;  1Y8N B;  2N88 A;  4A3G B;  3A8K E;  3MA2 B;  1WCM B;  2AQ1 B;  5LHY 1;  4X3K A;  4A3D B;  4XTC S;  2E74 C;  4HSP A;  2XRS D;  5ELF A;  3J7A F;  2B2V C;  3S1Q B;  3S1M B;  1AW7 A;  1NUC A;  1B1Z A;  5DAU A;  5IGE A;  4WJW A;  4XT3 B;  5CBE E;  2JEB I;  2IT1 A;  2HCI A;  2K01 A;  1BOS A;  4HCE A;  2K5W A;  1AP0 A;  2Z8L A;  1V1P A;  5G3L F;  2G9D A;  4FNF A;  3KBG A;  1NSN S;  1C8C A;  3WOF A;  4M8A A;  2NN6 H;  3WDN A;  3PO2 B;  2EYF A;  3GTQ B;  4MN3 A;  3C1F A;  1XXG A;  2AUJ D;  5JJZ A;  3J80 L;  2A68 D;  3WOE A;  3DMU A;  3MTS A;  1HA6 A;  1MI2 A;  1AZP A;  3CU7 A;  2OXP A;  1HA5 A;  5C5M A;  4CKC A;  1B53 A;  5CR3 A;  5CV9 A;  4CHT B;  4P2C B;  2FMC A;  5CV5 A;  1S5E D;  4ID6 A;  1PZJ D;  3OIQ A;  1JIC A;  1LO5 D;  2OT2 A;  2RDH A;  3Q23 A;  1D6E C;  4H7B A;  1CI3 M;  3I70 A;  5CGK A;  2KEE A;  3CHB D;  1AEX A;  2HCC A;  4FO2 A;  4KKT A;  3LNN A;  3HKZ B;  4OIJ A;  1SE4 A;  2O4X A;  3I8Z A;  1JWU D;  4RGT A;  2LKV A;  2RSO A;  5CV7 A;  1PZK D;  2NBF A;  2QDB A;  4TQU S;  4F7X A;  3BYY B;  4FYD A;  3ITP A;  2D9U A;  2E2H B;  3S1N B;  3URY A;  3SK6 A;  1BBX C;  2F03 A;  1EQV A;  4XYO A;  4IUT A;  2KEC A;  4DAP A;  5I2X A;  4BWG B;  4UAI A;  1UAP A;  2AWO A;  3S1R B;  2R6G A;  1EU4 A;  1SEB D;  4Q5V A;  1SMY D;  1KLU D;  2RKS A;  3Q22 A;  3HP3 A;  4R8I A;  1O80 A;  1BUV T;  1EWH A;  3PUX A;  3RUZ A;  3C3L A;  2VB2 X;  2NVY B;  3GTK B;  4KY7 A;  2D62 A;  3AB9 A;  3I72 A;  2E2I B;  3MHB A;  1U4P A;  2SDF A;  3A54 A;  4HED A;  1EFI D;  1PTO B;  2M00 A;  3G7L A;  1QE6 A;  3I4L A;  2ENB A;  5EJW A;  4LAA A;  4WOR A;  4NW2 A;  1WVL A;  3BVM A;  1PFN A;  2F0S A;  3DWP A;  3SK5 A;  1SYB A;  1TR5 A;  3D4R A;  4KJO A;  4RWS C;  1KAA A;  1BO0 A;  2B2V A;  3OMG A;  2FMM A;  4KJN A;  1SBB B;  3PUY A;  2B2Y C;  4DK1 A;  5IGF A;  3K5M A;  2R61 A;  5A2Q L;  4S3S A;  2JA6 B;  3I73 A;  4XYQ A;  4ZLT F;  1EY7 A;  3PIO 3;  1DD2 A;  3VYT A;  4EQO A;  2SNS A;  3ND8 A;  3MVV A;  4A3F B;  3SE0 A;  3ND9 A;  4B9X A;  1A2U A;  1EY4 A;  3P7J A;  3DM1 A;  5JPN C;  1DOK A;  4TRD A;  1EEI D;  4I65 A;  4BY7 B;  4TKO B;  4OO1 G;  2EJF C;  4IN3 A;  1Y1W B;  2ZT9 C;  4A3I B;  4BBR B;  4IUV A;  1STG A;  3VYR A;  2IPK D;  1EIH A;  2F0M A;  2YU9 B;  1IL8 A;  1YNJ D;  1STN A;  1QNK A;  4A3E B;  2J7Z A;  1PRT D;  4DNR B;  3H0G B;  4FXG C;  3EA6 A;  1HPC A;  1FNV A;  3R2T A;  1XYI A;  1TY2 A;  1GUN A;  4DA2 A;  1R9T B;  3HOW B;  3EJI A;  3IFT A;  5E1F A;  5D65 A;  1MSH A;  4RHS A;  2K28 A;  3VR6 A;  2JA5 B;  1Q90 A;  5CV6 A;  2QEJ C;  5CYU A;  1CQV A;  2Y0S B;  2EJM A;  2JXM B;  1DOM A;  1FGB D;  1VF5 C;  2R7Z B;  1VCI A;  4DXF A;  1UUP A;  3QJY A;  2WP8 J;  2DY8 A;  2F0G A;  3JAM L;  2B2W C;  2KVM A;  3R93 A;  1C4Q A;  3MWY W;  1B50 A;  3TDQ A;  3W3A A;  1D1K A;  3KUP A;  3BYT B;  4IUN A;  4ZUJ A;  1AZQ A;  2VXW A;  5AFW A;  1SDF A;  5NUC A;  5C5L A;  3H09 A;  1BQQ T;  3QWN A;  3KLR A;  3UI2 A;  3J7A V;  1CTM A;  1TS3 A;  1Q1B A;  3K5O A;  3EQL C;  3GTG B;  1GOZ A;  3SDZ A;  1HQM C;  1Y1V B;  4CJ2 C;  3A56 A;  2VUM B;  2NYZ D;  2A69 C;  1LV9 A;  4OO1 I;  2XNA C;  4RKL A;  5M5X B;  2PCF B;  2R93 B;  5I2Y A;  4RH6 A;  1I4H A;  4V19 0;  3GTP B;  1VDZ A;  2ICI A;  2JEA I;  1O7Y A;  1TWA B;  2B2Y A;  1JB3 A;  3FRP B;  2BOS A;  1OXS C;  4BS9 A;  2FJ2 A;  4K5X A;  5C4J B;  1J9O A;  2EY6 A;  2DNC A;  5EPL A;  3TP5 A;  3E6Z X;  1I4R A;  4QUC A;  1D5X C;  3KBX A;  4K2K A;  1WTO A;  3RZD B;  1HRJ A;  4IAL A;  2C5C A;  1H9S A;  1FNU A;  3SEB A;  3H94 A;  2BDO A;  1F9S A;  1KDA A;  5DNF A;  2CHB D;  2A6H D;  5EKI A;  4NP5 A;  1HQR D;  1ONL A;  4XQJ A;  2HQE A;  2L5T A;  1JOO A;  2F0L A;  3CQZ B;  3CRK C;  3DWQ A;  1F2L A;  1S4Z A;  2L0C A;  1CM9 A;  1LTT D;  5EBD A;  1F2Z A;  4KV6 A;  5EBC A;  4N9T A;  5C4X B;  2PO4 A;  3R2I A;  3VYU A;  4G57 A;  2NTT A;  1EL0 A;  5I9O A;  1GXD C;  4RHR A;  5A35 A;  3HZX A;  1B9M A;  2EPB A;  3GD7 A;  1ESF A;  1M4V A;  5E3F A;  2EZV A;  3RZO B;  5G3L D;  1V43 A;  1JWS D;  3QO2 A;  2IX0 A;  1QWY A;  3NUC A;  2MPM A;  1MD2 D;  1LT3 D;  1W6J A;  1SSO A;  1B2T A;  2WKC A;  2IL8 A;  3G6J B;  2D5D A;  3V05 A;  3VR4 A;  1LT5 D;  4N9P A;  2D2C C;  3FVQ A;  3OSO A;  1RTN A;  1E2W A;  1G29 1;  5HGT A;  5JVH 3;  1SYG A;  1M8A A;  2RA4 A;  1C48 A;  3NP8 A;  1B4O A;  4IUR A;  4PQX A;  4Y7N B;  3NBH A;  3X3N A;  3K58 A;  3MFG A;  5F2D A;  1PTO C;  3KLS A;  2JSO A;  4B08 A;  4ULL A;  4IFD I;  1TT2 A;  4C3J G;  4FF1 A;  2J4X A;  4EQP A;  3TSS A;  3T13 A;  1PTO H;  5I6Y A;  3V96 A;  1E2V A;  2WAQ B;  1SNO A;  1EYA A;  5KYI A;  1LTG D;  2PNR C;  5K36 G;  2K5D A;  4HCS A;  5BN4 A;  1EU3 A;  4XQQ A;  3PMF A;  3MZ5 A;  4EVO A;  2M9V A;  1LAC A;  1U4L A;  2MGS A;  4KN4 C;  1PLF A;  1R4P B;  4CJ0 B;  2A69 D;  1WD0 A;  2F0N A;  5IGD A;  3K7A B;  2I46 A;  1EZ8 A;  3Q24 A;  4A93 B;  2V4D A;  1CA6 A;  3TBI B;  1SE3 A;  4KD4 A;  5M3M B;  1STY A;  1YNN D;  3IL8 A;  3M85 A;  1PMR A;  4ZRZ A;  2L11 A;  4KY6 A;  2E2J B;  4HMJ A;  2KUM A;  1XX8 A;  2IJ0 A;  1ZYR D;  1RCV D;  1EY6 A;  2Q8R E;  3PUZ A;  1KNE A;  5EKL A;  4CGY B;  3BDL A;  3HS0 C;  3LWU A;  3KLS X;  2A74 C;  2H4O A;  4A3K B;  3R3O A;  1O7L A;  1IW7 D;  5C0X G;  2WB1 B;  5C44 B;  4QCL A;  2G9H D;  2PZT A;  3HOV B;  3DHQ A;  3SR1 A;  1XTC D;  1EOT A;  3TZU A;  1WTV A;  2EY1 A;  1TWF B;  4G7H C;  2F0E A;  2BE5 D;  4XT1 B;  2QCP X;  5JEA H;  2QKI C;  4K8I A;  2SNM A;  2Z4H A;  3D4W A;  1STA A;  4RAU C;  3DEO A;  4HN7 A;  1PXU A;  4L6T B;  1V8Q A;  1MGS A;  1RDP D;  4K2L A;  1WD1 A;  1TWH B;  3NXW A;  2B2T C;  4BA1 I;  2NN6 G;  1PFB A;  2LFN A;  4G4K A;  1F9P A;  1G8Z D;  1QG7 A;  2HDM A;  2K05 A;  3A8J E;  1HFN A;  4FVM A;  3SK4 A;  3MXP A;  1I3Q B;  3T4A C;  2M2L A;  2A6E C;  4EQN A;  4XDX A;  3S17 B;  3HRZ C;  4M1U B;  1I4P A;  1D2B A;  4RGO S;  3NE5 B;  2LMC B;  1PZI D;  4LMQ D;  5ELC A;  1G2S A;  1ILP A;  5EPJ A;  5D3I B;  1RHP A;  1R4Q B;  5CV8 A;  1ZKO A;  2KCN A;  3MXU A;  1IYU A;  4G7O C;  3MXG A;  1E2Z A;  1BNZ A;  3K57 A;  1SXT A;  3J81 E;  2OF1 A;  4X3U A;  3U9S A;  1JOR A;  5FK9 C;  4JBW A;  2B2U C;  1XWE A;  1S5F D;  4KMU C;  4HAE A;  2AUK A;  3NHH A;  3V2T A;  1TWC B;  1SNP A;  2Q8T A;  3FPU B;  4U68 A;  2KOL A;  3VR2 A;  3AU7 A;  2QIL A;  1I6V C;  3MC0 B;  1K8M A;  5KIX A;  1BF4 A;  1WTW A;  4KKU A;  1F77 A;  3C1E A;  2RSN A;  3GP7 A;  5C0X I;  3BVG A;  2IX3 A;  2RQX A;  1G91 A;  1CZW A;  5JOB A;  1SE2 A;  5KNC A;  4OHJ A;  4MHE A;  4QUF A;  1SFO B;  5KND A;  4QB4 A;  1STH A;  3M4Y A;  4ZQ3 A;  4K6D A;  1ML0 D;  1F2Y A;  2XWB B;  4C3I G;  2PZU A;  1BR9 A;  1QOH A;  3QOL A;  3D8G A;  3EFX D;  4C3H G;  5C0X J;  2TMP A;  1LTI D;  5J39 A;  1IYV A;  3HOU B;  4Z9C B;  1H9K A;  5CC4 A;  3QB3 A;  5CMD A;  4CKB A;  2F0Q A;  4WRD A;  1HTL D;  1OXU A;  1ET6 A;  3I3C A;  4IUU A;  4F88 A;  2NN6 I;  3H91 A;  2X6L A;  3M7N A;  3VR5 A;  5I4D A;  2Z4I A;  2FIN B;  4RA8 A;  3K5N A;  4OL7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...