2EYHA

Crystal structure of staphylococcal nuclease mutant t62s
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
135
structure length
135
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFSKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Threonine mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Staphylococcal nuclease
total genus 38
structure length 135
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2005-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2eyhA00
4K5VA 2EYLA 3QB3A 2RKSA 2EYHA 1EY5A 5CV4A 3SK4A 4ZUIA 5DAUA 1EYDA 1EY4A 1IHZA 2F0UA 2F0OA 3DHQA 3EROA 1STNA 4ODGA 4R8NA 1A3UA 4F8MA 5C4HA 3TMEA 3MXPA 1F2YA 5CR3A 4MIUA 4ZUJA 4QB4A 3SR1A 1TT2A 4I65A 2F0IA 2F0WA 4IUNA 5IIFA 5M9OA 2EXZA 2F0MA 1EY7A 2RBMA 5C5MA 2EY5A 2OEOA 1KAAA 2F3WA 2PZUA 4B9XA 2EYMA 5IGCA 3ITPA 4ZQ3A 5JOBA 4EQOA 4S3SA 4PNYA 3PMFA 4KY7A 4N9TA 2M00A 5KEEA 5C5LA 3SXHA 3TP7A 4DF7A 4G57A 1STYA 1SYGA 2SNMA 3R3OA 4KY5A 1A3VA 4WORA 2PW5A 5C3XA 2F0PA 2PW7A 1NUCA 1STHA 4K14A 1SNCA 4N9PA 5CV5A 2EYFA 2WACA 3EJIA 4K5XA 5EGTA 5EKLA 5J1ZA 3V2TA 5IODA 5KYLA 4E6IA 4PMBA 2F0NA 5CV9A 5CV8A 3TP6A 1EY6A 3SK8A 5IOCA 5I6YA 4KD4A 5J22A 1EY9A 4NDXA 2PZWA 4QMGA 1STAA 1JORA 2NUCA 1JOKA 1EQVA 1EYCA 1SNDA 4H7BA 4KJNA 3E5SA 3TP8A 5K5PA 3MZ5A 3HZXA 2ENBA 4ME5A 5KIXA 3OMCA 4HMIA 2EY2A 4IZ8A 2PZTA 1STGA 3SK6A 2EY6A 4F7XA 4KTAA 1SYBA 1SNQA 4RKBA 5EKKA 1JOQA 1A2TA 1ENAA 2F0EA 3RUZA 1SYFA 2F0JA 3OSOA 4J1MA 2F0QA 1II3A 4EVOA 1EY8A 3NQTA 5J39A 2EYOA 5HGTA 5I9OA 3TP5A 1KABA 3HEJA 3MEHA 5IGBA 4K8IA 3NHHA 5IGEA 1KDCA 4LAAA 5JAVA 2KQ3A 5DEHA 4K2KA 1EZ6A 4NKLA 1KDBA 3NXWA 3NK9A 4K5WA 5E3FA 5CGKA 5KGUA 5C4ZA 3LX0A 2F0LA 2EYJA 2F0TA 5I9PA 1RKNA 3DMUA 2SOBA 2PQEA 1STBA 3EVQA 4DU9A 1NSNS 3H6MA 2F0FA 3D6CA 5NUCA 3MHBA 2OF1A 2LKVA 1SYDA 2F0HA 3P1HA 5IGFA 1ENCA 4IALA 1SYCA 3MVVA 3OWFA 3D4WA 1F2ZA 1TQOA 3P75A 4HTHA 4EQPA 2KHSA 1JOOA 5C6AA 5KYIA 1KDAA 2SNSA 4ID6A 4KY6A 3NP8A 3NUCA 3D8GA 3T13A 3VA5A 2F0DA 4TRDA 5ISRA 1SNMA 4WRDA 4DFAA 4RKLA 4YIJA 1SNPA 2HQEA 5CV7A 2O4XA 4HMJA 1AEXA 3C1EA 4KHVA 1U9RA 1SYEA 5F2DA 3QOJA 3U9OA 2EYPA 1TR5A 4KD3A 3BDCA 3QOLA 4K8JA 5E1FA 2F0KA 4PMCA 3SK5A 5IGGA 3ERQA 4DGZA 1EY0A 5CV6A 4NMZA 4EQNA 5I6WA 2QDBA 5CC4A 1EYAA 2OXPA 5KRUA 1SNOA 3SHLA 4NP5A 5HURA 4KJOA 1A2UA 2PYKA 1EZ8A 4K2LA 3S9WA 5IGDA 5C3WA 4J6HA 1A3TA 2F0SA 2RDFA 4K6DA 4KV6A 4QF4A 3C1FA 3T16A 3D4DA 2F0VA 1F2MA 2EY1A 2F0GA 2F3VA 3OMGA 4OL7A 3BDLA 4B9WA
chains in the Genus database with same CATH superfamily
2OT2A 1XWEA 1QOHA 2I5LX 1EY5A 2M2LA 2UUBQ 3CHBD 2F03A 2CWAA 4A3FG 3CCJA 3GTGB 3PIO3 2I46A 2J7ZA 1R4QB 4TQUS 4A3KB 1PFMA 4MIUA 4QB4A 1FL0A 1WD0A 2NN6H 2EPBA 2OEOA 1WFQA 2O5JC 2PZUA 3RZDB 2IX0A 4Z9CB 4R4TA 5DLQE 3KDFB 3CPWA 1O7LA 2E2HH 1X3FA 3S1RH 1SYGA 4ILWA 2NTTA 4IJHA 1CHQD 4IPDA 2BOSA 1SE3A 4FF3A 1EY9A 3HOUH 5IYBH 1ASYA 4MZ9A 4NXNQ 4B3SL 3E5SA 3HZXA 3S14H 1X32A 2K5NA 2PMZB 4IZ8A 2PZTA 1ONLA 2SEBD 2ZXRA 1WCMH 2A6EC 3S24A 4C2MB 1SYFA 2L0CA 4K0KL 3SE0A 1HFGA 1KABA 3MEHA 2F4IA 1BNZA 2UU9Q 4OWTB 5DEHA 4FF1A 3NK9A 1GUOA 1EWCA 4BY1G 3E0JA 4CGYB 1HUMA 1UAPA 1I3QH 4DAMA 2TSSA 4L5SA 4H13C 4HSVA 3GD7A 4A3BG 5FOBB 3A7AB 4DKAC 5KYIA 1S5ED 3T53B 1WTQA 2PCFB 3RN5A 1V43A 3HOVH 5IYCH 4Q5VA 3CCSA 1ASZA 3BVZA 4JCVE 5J39A 2C35B 1TWGH 4DUYL 2LXJA 2JEAI 2R92B 1CZWA 3JC66 2R7ZG 2JSOA 1HZBA 4IUQA 1AE3A 1EZ8A 5GADC 2F0SA 3I4MB 2K03A 2Q2UA 1AW7A 3T1HQ 4H0LC 2I5HA 4GKKQ 4KLKA 2KVMA 5CV4A 3V05A 5M3MB 4DUZQ 3HOZH 2E75C 4POFA 4Y7NH 2A5HA 2F4VQ 1K0SA 4HJ5A 2K4KA 2RCFA 2DJGC 4CDEC 1MSHA 1E2WA 2JA5H 2EQSA 1PV4A 2NVYB 3DM1A 1H9RA 4A3EB 3GDEA 1N34Q 1DJRD 1Q1BA 4JI5Q 4DUZL 1NTGA 5FJ8G 4U673 3RNUA 1QZHA 5A2QL 5I6YA 2Q8RE 3BG3A 4LJZC 5AJ3Q 2K33A 4DNRB 5HGQA 4A76A 1LT3D 3TP8A 2NVXH 3CU7A 1EUJA 5D65A 1SFOH 2EOTA 4LWCA 3U9SA 2E2JB 1ENAA 4BBRG 4DR5Q 1WTPA 2KECA 4B9WA 3Q8DA 2JA5B 5IGBA 2Z4HA 1SROA 3B6YA 1KDBA 2WIIB 4L5QA 1H95A 1CKOA 5E3FA 5CGKA 3A5ZB 4XTCS 5KGUA 1L1OA 5DM73 3WOFA 4DR6Q 3RLOA 1Q1EA 1B2TA 2JA8H 3MHBA 4JW0A 4M1UB 2LKVA 2Z4IA 1R9TH 2VUMB 2NB0A 1RCVD 4DR5L 2EVBA 3D4WA 1F2ZA 2RDHA 3A8KE 4EQPA 1YNXA 3EQLC 3J80c 3J7ZC 1T5XD 1X3PA 1VQDA 3NQIA 1K0RA 3TSSA 3NPPA 2FMCA 4R4CA 4RCNA 3ULLA 1G6PA 4GOPB 4QJFA 2FMMA 4DR6L 4RA8A 3VYTA 1KIXA 2IPKD 4YWLA 1VCIA 3NE5B 1VQLA 4NXML 3PCOB 1E0BA 1SFOB 5IWAL 2JA7G 1SNOA 3S16B 4J6HA 2RDFA 1LTRD 3C1FA 3NTHA 1EWIA 4A3GG 2EY1A 5M5YH 4OL7A 4R8IA 1J9OA 4RHSA 3K5MA 2Q2HA 4A93H 4BBSB 4N8FA 1WCMG 2LSSA 3GTOB 4NXMQ 2B2VC 2EE1A 2VQEQ 4I7AA 1VQ7A 5JJZA 2F0IA 2F0WA 2K1BA 4A3CG 5D3DA 1HUNA 3S2DH 3KYHC 1UE7A 1KNEA 1SRUA 1X55A 4LFAL 4G7HC 2AHOB 2ASBA 1YNND 2R3ZA 3PO2H 2HCCA 2MJ8A 4GN5A 4HSPA 3S14B 1XMQL 1M8AA 4NDXA 4UAIA 3J7AV 1NY4A 1EQQA 4LF4L 4C3JB 1EFWA 3BDOA 4DV3Q 2RSOA 2EXDA 1BXTA 2VUMG 2Y0SG 1VQ8A 4KHZA 2OCEA 5I2XA 1TWGB 4CKEA 3TEHB 3S15B 2GVBA 3MAQA 3M3YH 1EY8A 2B29A 2EYOA 2D0OA 4JI0L 5KNBA 5JAVA 3ND8A 4X6AH 2BH8A 3QIAA 3UE1A 4WJ3M 1L2FA 4KMUC 1X54A 3JAML 4AYBG 2VQFL 1Y14B 3K5OA 1LT4D 3HGBA 2DY8A 4UDUC 3CCMA 1IBLQ 2F0FA 1Z47A 3PF4A 1KHIA 4FDBA 4UP8A 3I8ZA 4BY1H 3SVMA 3OWFA 4PZ6A 2A8VA 1Q90A 3MEFA 1S3OA 3KDFA 4OONA 1ZXTA 3KOJA 1SNMA 1LTAD 4DFAA 2PO4A 1C0AA 3SDZA 4B3RQ 4DAYB 4YWKA 2P5ZX 1PFSA 4FXGC 1BUVT 2UUBL 5LMNQ 2VQFQ 2E76C 2YU9H 1RL2A 4DXFA 4DGZA 3K0XA 4LFBL 5CC4A 2B2UA 2HCIA 2N55A 1PXUA 2IJ0A 4KV6A 1VMPA 3RR5A 1K28A 4M8AA 2WV6D 2V1CC 2EYHA 5M3FB 2WB1B 2UXCQ 3UDIA 3PQIA 3RMHA 1I3QB 1PDQA 1XYIA 2R92G 1WTRA 5CR3A 4ZUJA 1AZQA 1X3EA 4C3HG 4QL5A 2XRSD 4B9XA 3VYRA 4C3IB 4ZQ3A 1Q86C 1JB3A 4C2MH 2JA6G 5IT9E 3R2TA 1LO5D 1STYA 2B63G 2HDLA 1SXTA 4DV5L 2CQAA 1O7YA 3J80E 1VQMA 3N6RA 4BWGB 4F87A 4K0KQ 1VF5C 4R4IA 5IP9G 3TP6A 3CC2A 3BYYB 1KRSA 4JI4Q 2Z6BA 5LMUL 3G6JB 2WAQG 3L7ZC 4C1NK 4DV2Q 3HOYH 2OTJA 3QO2A 3TN2A 1RODA 4KKTA 4MNOA 2KCCA 3URYA 4A3EG 5JJIA 1IYUA 2K50A 1WVLA 1EL0A 1V1QA 1T5EA 4P73A 3TS2A 1A2TA 3HOXG 3NQTA 1Q8IA 1A62A 3EBEA 5BN3A 3S2DB 3DUZA 4X64L 3HKZE 2F0LA 3I3CA 2JEBI 5ELOA 3DM3A 2JK8A 3G48A 1XMOL 1MKHA 2QGQA 5ELCA 4A3IG 1E22A 4Y52H 1A6XA 1YNNC 4A3MG 3I4LA 4IALA 2A6HD 3GV3A 4JI1Q 3GP7A 2L1BA 4X66L 2WB1G 5C4JH 3M4PA 2R93G 5M3MG 4JYAL 3I7FA 3S16H 1Q3LA 3IAYA 2K32A 4UP7A 3M3YB 3EA6A 1VQGA 3BDCA 2XTIA 4K8JA 2ZXPA 1D6EC 5JEAG 3CF5A 1K3BC 4P2CB 2DGYA 1CUKA 4O1NA 1X3QA 3RD4A 2FINB 2K7VA 2NZOA 3PV0A 2M9VA 1QNUA 2BA1A 2JA9A 4NKLA 3MXGA 4GN3B 3T4AC 2VUMH 3NTKA 1DOKA 5M5XB 1X3GA 3U50C 2K5DA 1XJVA 4JI5L 3CAMA 1RDPD 3N52A 2KBNA 3A56A 4APVA 5AJ3L 4LW1A 4C3IH 4KHPL 2EY5A 1PLFA 3H0GH 4K6LA 4HJ9A 3G7LA 1IXRA 5FO7B 5C5LA 3SXHA 1IBML 1Z6HA 5FO8B 1U4MA 1B53A 1Q82C 4K14A 5HURA 4DAYA 4FXKC 4IJLA 3K6OA 4GN4B 1LUZA 1H9SA 1W6KA 4DR2Q 3J81E 3BZDB 2JA8G 2KUMA 3GTMH 1K8MA 3KBXA 1EYCA 2J0TD 3CCEA 2ZTEA 4GS3A 2Q2IA 4ME5A 3F2DA 1SAPA 1M4VA 4IUVA 1C48A 4OIJA 1P8LA 2DY7A 1TWHH 3ZJYC 2F0EA 1PFBA 4YY3Q 2F0QA 5CBEE 1B8AA 1OXUA 4XDXA 4YWMA 1UWVA 2I0QA 5FLXE 2FFKB 4ZK9B 1ILPA 4LAAA 1MJCA 1XNRQ 1FGBD 1SR3A 3AB9A 1I4PA 4RMFA 3KJOA 1GHKA 4CDDC 2ZJPA 1FNWA 2EYJA 3DWPA 2F0TA 3H91A 1HA6A 3NWSA 4A3JB 4IFDG 1DXMA 1PRTB 4ALPA 2K52A 5IYDH 1QNKA 4GNXA 1N34L 3VR2A 3L2PA 1AH9A 1TQOA 4BY7G 2NN6G 1LT5D 2KHSA 2QW7A 4DV1L 4ID6A 1T9HA 1F2LA 5IT9L 1HZCA 4C3HH 3GTJB 3LGJA 3T1YQ 5ISRA 1XNRL 1X6OA 3PUZA 4YHHL 1NAPA 4QGUA 3I4NG 4A3CH 2B63H 4OIKA 4XYOA 3NBIA 2KJXA 1CA5A 3CQZB 3HOVB 3D4RA 1JB7A 1KC8C 1ENFA 4MN3A 1O78A 4LFAQ 3T1YL 4UY8C 2F3VA 1I94L 3OW7A 4XT1B 3D6WA 1XNQQ 2JA8B 2RA4A 1A8VA 5EPJA 3KBGA 4A3EH 5KEEA 2F0UA 3DEPA 1SE2A 3RN2A 1TT2A 4DR4L 2D0PA 2EJMA 5C4XG 1Y8NB 2AUKA 4HR7B 5IGCA 3FPPA 2KCNA 3I90A 4PZ7A 3A8JE 5FLMH 3I55A 1LLRD 4NB3A 3A55A 3PUWA 4A4IA 4BBSH 4A75A 4A93B 1N36Q 1SNCA 5CV5A 5EKLA 3VYSA 3CD6A 4LUZA 1D8LA 4DNTB 5A35A 4KD4A 3RZOB 2ICEC 5EPLA 3LWUA 2KENA 2H1EA 1L0WA 4H7BA 1UNSA 2IWHA 5K5PA 3EIVA 3HKZG 3MFGA 4JC0A 1HTLD 4U68A 4X62L 1YJ9A 2B63B 3J81L 3L0OA 1SYBA 1JOQA 3K81C 2RHQB 1G8ZD 2AKWB 1CA6A 2VQEL 4HIKA 1MHWC 2VZAA 1GXDC 3KLRA 1KDCA 4JV5L 4GLXA 1ZYRD 1KD1C 1TWAH 3S2HH 2R7ZH 4JI8L 1HH2P 3UDFA 2WAQB 4JI6Q 1SE8A 3JAMc 3DMUA 2SOBA 1DONA 2UUCQ 4CKCA 3TZUA 1G91A 1BVSA 3NBHB 4B3TQ 4BXXH 3AYHB 3PSIA 1EIHA 4LF8L 1LT6D 1PH7A 2IL8A 4DK0A 2JA5G 5IE8A 2E74C 2CW0D 4UHVA 2Q8IB 1GD7A 4A3GB 1SMXA 1FNVA 4OX9Q 2R92H 2O4XA 1D5MC 1ET6A 1Y8PB 1VQ5A 1BBXC 1DM0B 2AQ1B 1QB5D 2WKCA 2G9DA 5IGGA 3F2UA 5C44H 1WCMB 1BCPC 3NTIA 3W1GA 3S1MB 4LF7Q 3GTLB 3F2CA 1ZYRC 1DYQA 3T51B 4K6DA 3OMGA 1OXVA 4L5TA 3M4OH 1N32Q 2AMCB 1FD7D 3X3NA 1H9KA 2BH2A 3D0FA 1ZEQX 4DV5Q 3CRKC 1VS0A 4B3ML 1HJPA 3S1RB 5E4XA 1JQYD 1BKBA 3SR1A 2E2HB 3O13A 1PTOF 1B9NA 1GVPA 4DV6Q 2EXZA 5LMUQ 2CH4W 2RBMA 5C5MA 3CQZH 4QCLA 1KAAA 2QDLA 4V190 3PO3B 1Y1VH 3I72A 4CJ0B 1YJNA 4JI2Q 2A69C 3IKJA 4A3KH 1JMCA 4QUFA 1STHA 5EGTA 4DR1L 4B3MQ 4IFDI 1WYDA 4E6IA 1QVFA 4LFBQ 5K36H 2ID0A 3SK8A 1GO3E 3CRLC 2CHBD 4A3IH 3HOUB 3HOWB 4ULLA 4X64Q 3BVMA 2LFNA 1JWMD 1QUQB 3MZ5A 5C0XG 1B70B 4HMIA 2IX3A 1VQ4A 1VQ6A 2UXCL 5GAHC 3VDYA 3I4NH 2NTSA 5IP7G 4OEMB 2HT1A 2DNEA 5E7NA 2KCMA 5HGTA 1E7ZA 4RGNA 2XVSA 1PZKD 3UI2A 1D1KA 5CBAE 1ICFB 2YV5A 1SSOA 4PMWA 3E9IA 2L11A 1IZ6A 5I9PA 3H3VI 1Z7TA 2C5CA 2FHTA 1Y8OB 1WTHA 1UEAB 1TVXA 1QVGA 3VR5A 1I6HB 2GN5A 1DZ1A 3P1HA 3A5UA 1ET9A 1LTLA 3GTMB 1S5CD 1JOOA 1JE5A 3PGZA 4RGMA 2KHJA 4KY6A 1PRTD 4DA2A 3IRBA 3OHXC 4WRDA 1M90C 1WOCA 3CC4A 2BA0A 4B3SQ 4LUVA 3R2IA 1PTOC 3C1EA 4AYBB 2SDFA 1XXGA 1X56A 4KD3A 3M7GA 1G2SA 1M1KC 1I5FA 5FKAC 2RHSB 2AWNA 3TQYA 4EQNA 3H09A 4LF6L 1EU3A 3C2PA 4KHPQ 3U4VA 3KK7A 2PYKA 4K2LA 2UU9L 2NZHA 4IUTA 3T16A 3I4OA 3I91A 4DV4Q 1BCPD 4JPBW 3K7AB 4KKUA 2JN4A 5JJKA 5C3EB 4ZUIA 4ZRZA 3HOWG 4OXPA 4H44C 2JA7H 5DAUA 1EY4A 1K8AC 1A3UA 1YHBA 4CKBA 2PQAB 4DK3C 4JI1L 1CM9A 2I5MX 1FGUA 4X66Q 2NVTH 2F3IA 4LF5L 4H02A 4HIDA 3ITPA 1Y1WG 2R7DA 3NENA 1HR0Q 4DV4L 4DV0Q 2B2WC 2NZ1D 3OTOL 1IL2A 3HOXB 1SN8A 1A0IA 1EEFD 4POGA 1CTMA 1CKNA 3KLSX 4P71A 5IYDG 1AP0A 4BBSG 1S5FD 1PZJD 1GJXA 2KEEA 3PO2G 4R9WA 1E1TA 1JE4A 4ZAIA 3S1QB 4QIWE 4DV0L 1I4QA 3I56A 1C4QA 3HOYG 1GUTA 1SBBB 4HCSA 4FXDA 4RH6A 4P75A 4GOPC 1LTGD 4XQNA 3CP0A 3CW2C 1IKLA 5LL6S 3NXWA 4V0BA 1CI3M 1ICWA 5T1GA 5C4ZA 4GOPA 1JR0D 2JE6I 2OTLA 2PQEA 1STBA 4F88A 1MJEA 1FYCA 2JJQA 4FF4A 3PF5A 3D6CA 5NUCA 4X3UA 4JBKA 2VXWA 3K7AH 4UP9A 4QQBX 1SYCA 1YNJC 2HQLA 2YTYA 1YEZA 2UUAQ 1BDOA 4DR2L 1NCVA 3D8GA 3OYYA 3VA5A 1JWUD 3FPUB 2JA6H 3VR4A 4HMJA 1RTOA 2KA7A 3QG1A 1G6ZA 1Y1VG 4DR7L 1XNQL 2A74C 4KHVA 2ICIA 1HNZQ 2ZTDA 1UE5A 5C4XB 4RGOS 1JCKB 2D9UA 2WINB 1GUGA 4DR4Q 5KRUA 4G7OC 4NP5A 4GKJL 2UUAL 1BQQT 5C3WA 1B44D 3U4ZA 4X3SA 1ESRA 5JEAH 3RLFA 1F2MA 4K5VA 2VNUD 2DUDA 2ZTCA 1K73C 3QB3A 1PZID 2N78A 1I6HH 1N36L 3S17B 1IYJB 3DHQA 3PO2B 5M5WH 1STNA 1W3SA 3TMEA 2FXQA 1F2YA 5CMDA 4GNXC 2NVQH 4IUNA 5M9OA 2O2LD 4HAEA 3VR6A 1VQKA 2F3WA 5E4WC 2OQKA 5EBCA 1C7YA 4J8QA 2K01A 4KY7A 4PNYA 5C44B 3CMAA 2YU9B 4WORA 4KY5A 2PW7A 2B2YC 4N9PA 5GAGC 1YJWA 1PYBA 1HHVA 5CV8A 5M5YB 5IOCA 2CH4A 2BE5C 4A3MH 1G51A 1O7IA 5ELFA 3M7NA 4JI8Q 1BCPB 3PO3G 3OPOA 2AQ2B 2UXDQ 1A15A 4ZKCB 1EQRA 3G71A 3K59A 4MTNA 2EY2A 3TDQA 1YNJD 4PZ8A 4UPAA 2JQOA 3SK6A 4RCOA 3CXCA 4X3TA 3VYUA 3I70A 3TBIB 4OWXB 2L55A 4IOCA 1Y1VB 3TP5A 1V8QA 2QKIC 3R93A 5ELBA 3W2DA 1W6JA 4K5WA 4GLVB 1EFID 2PQAA 1BCPF 2CKZB 2PI2A 2WFWA 1F9RA 1XX8A 3J7A5 3I4NB 3UDXA 4IPHA 1I50B 3F1ZA 4KI0A 3E0EA 1VQNA 1IL8A 2EJGC 1H9JA 1CKMA 3K5LA 1WTOA 3TREA 5C6AA 3H0GG 1QG7A 5JJLA 2F0DA 3E3XA 4RKLA 3L9AX 3A54A 4MHEA 5FO9B 2BE5D 2E2IB 2GA4B 2PMZE 4A3JG 3J80i 2IX1A 1YZ6A 3U9OA 3AU7A 2EYPA 1TR5A 1B50A 1FJGL 1NR4A 1IW7C 4DV6L 1BBUA 3TRZA 3SHLA 2D5DA 1K8GA 4OO1H 3KF6B 1TS4A 3VR3A 4JI2L 4JI6L 3GTOH 3BDLA 3C46A 4FF2A 3A74A 5IT9c 1C8CA 1FVIA 5C0XJ 4I7ZC 3HS0C 3SK4A 3GV6A 4DR1Q 2R93B 1HXYD 3FHWA 2F0OA 1Q12A 1MIUA 4FO2A 1IBKL 1FJGQ 3PUVA 1TXYA 1TWCH 4JG2A 4QUCA 3S2HB 2A68C 2D2CC 1B1ZA 1KAWA 4RWSC 4OWWB 1PH1A 1EU4A 3HOZB 1U4RA 1GOZA 1SMYC 3F8TA 1NUCA 4BY7H 3BU2A 4RFBA 2A1AA 1Y1WH 3AFQA 2BCOA 4JBMA 4X65L 3MXNB 3H3VC 2AWOA 5IY0A 1HQRD 1D2BA 2XN9C 3BZKA 1Y1WB 1SJHD 1STGA 2XIWA 1GKHA 3X3MA 1ML0D 2PNRC 3MA2B 4R1JA 2J4XA 3EN2A 1PH8A 1LTID 1IYVA 2E8GA 2N8NA 3E6ZX 3Q6SA 4PG3A 1TWCB 5JVH3 1L0YB 3HKZB 1RKNA 2HUGA 3OWEB 3K80C 4PQXA 1CQVA 1PH2A 3FDTA 3J81i 2OF1A 3PIPA 3PUXA 4LF6Q 3UDGA 2K28A 1Q8KA 4RHRA 4DR3Q 2MFIA 4CJ2C 4OGQC 1X65A 3M85A 4IFDH 2XGTA 3EFXD 1HNXL 4YIJA 1AE2A 2HQEA 3AFPA 1D5ZC 4GZYC 1B3QA 2Q8TA 1MSGA 2B8GA 3STBC 5C4XH 2QCPX 2ZT9C 2KEDA 2B2UC 2WB1E 4PMCA 1YIJA 4JVZA 1U4PA 4NMZA 2E5LQ 2HHHQ 2A69D 1CK1A 1DD2A 1D7QA 1BOSA 1RJTA 4LF5Q 2DJFC 3CCQA 1PMRA 1DGSA 1NE3A 2F0VA 1EIYB 4PMBA 1Q7YC 1C9OA 2L12A 2RKSA 2Z9HA 4DXGA 3S17H 3OIQA 1WTXA 1QVCA 2LXKA 3EROA 4KN4C 1LTSD 3H3VH 3MTSA 3KUPA 3I4MH 2R6GA 2A73B 1I4GA 2CQOA 1VDZA 2F0MA 1E1OA 4JYAQ 4HJAA 5FJ8H 1XPRA 1GUSA 3PMFA 5JPNC 1Y69U 5GQOA 1PHJA 4IFDJ 4YCUA 4JOIC 4ZCKA 1KLUD 4QIWB 1HZ9A 2N3SA 5A2QE 3AMUA 3STBD 4A3KG 2VY3A 1L1OB 1LTBD 3MC0B 3GTKB 1PTOH 5ELNA 1JORA 4NW2A 1LYLA 4DPGA 1CQFA 1J8IA 1SJED 5BR8Q 2ENBA 3KJPA 5FK9C 5C44G 3NWTA 2FJ2A 4CJ1B 4F7XA 2R61A 3H94A 3HFZB 4A3JH 2R7FA 4DUYQ 2L5TA 3QR8A 2RF4A 3GQBA 4J1MA 5C0XH 1RD9D 2Z0SA 5I9OA 1PRTC 1OXTA 2CVRA 2K04A 2KQ3A 4A3DB 1YVCA 2Z6KA 3DEOA 2NVQB 1LTTD 1D1IA 3PUYA 2YTVA 1TWHB 4Q0FA 3T1HL 4DU9A 4GKKL 1TS2A 5FLXc 2H4OA 1WD1A 3OTOQ 3H6MA 1OO9B 5ELEA 4DAVA 1XTDA 4EQ5A 5I2YA 3P75A 4HEDA 1VQEA 3T56B 4ZLTF 3J81j 1JJCB 3T13A 1BR9A 1O80A 1U0LA 1Z9FA 3JAME 2NBFA 1KTKA 3BYTB 3J81c 1VQPA 5C0XI 1VQAA 1HPCA 4BXXG 4IOAA 1SYEA 1A63A 2VL6A 3QOLA 2F0KA 5JVG3 2C9OA 2B2TA 2WP8J 1CSPA 1E2ZA 2OXPA 3RZDH 2LY7A 3GTJH 1QZGA 1OXXK 2TMPA 1Q81C 4A3MB 5K36G 2F0GA 2WACA 5EJWA 1NJIC 2RCNA 5IP7H 1N33Q 5M3FH 3WDNA 1VQIA 3GTPH 5GAEC 2B8FA 1EYDA 4C3JG 4R8NA 1K3RA 4ODGA 4ZKBB 3G4SA 1EIGA 4G7ZC 2LS01 1QUQA 5JEAJ 1TS3A 4OELB 4OHJA 4A3DH 2MP1A 1RF2D 3FKIH 3MXUA 1DCZA 4EQOA 1S5BD 4S3SA 4XIGS 3J7AF 4DR7Q 2ES2A 2EDGA 3IL8A 4G57A 1HQMC 2SNMA 1EWHA 3A0JA 2IY5B 4KK7A 3WOEA 3EJIA 1HNWL 3A7LA 4K5XA 3V2TA 3S1QH 3HP3A 2F0NA 5J22A 1JOKA 1IW7D 1SNDA 1DOMA 3CCRA 2F52A 1D5XC 5H1SE 2WKDA 5KIXA 2XSCA 4KN7C 3NBHA 1YHQA 1SNQA 1R4PB 3RUZA 2F0JA 2K05A 4EVOA 3K57A 4IN3A 2KCTA 1NMGA 1BBWA 4K8IA 4TSSA 2ZM6Q 1J6QA 4K2KA 4C1NI 4ZYSA 3FP9A 2MNAA 1AFPA 3S15H 1F9PA 4RGTA 1VQOA 3CC7A 4LF9L 2JYOA 1ZKOA 1WI5A 3P7JA 5C3EH 2HD3A 3HOYB 3MVVA 2Z6KC 4HCEA 3HOWH 5L37A 1CT1D 2SNSA 1NBWA 1QJOA 3NP8A 4ABNA 1PFNA 4CBVA 2LMCB 4TRDA 2ZM6L 2QEXA 1SNPA 5CV7A 1AEXA 1AN8A 2AQ3B 1GUNA 2UXBQ 3QOJA 1B4OA 4X62Q 1XPOA 1CZGA 4LF9Q 3E9HA 4A3FB 1JJ2A 2Z1CA 1NNXA 1SLJA 2X6LA 2JA6B 1L1OC 1VF7A 1A2UA 4KJOA 1KRTA 3HOZG 1SDFA 2MO1A 1OTCA 4DV3L 1RIPA 3D4DA 1VQBA 2BDNA 2RVLA 1BF4A 1PH5A 1F9SA 1J5EQ 4DNIA 2ZXOA 5LHY1 2XWJB 4R4OA 1HR0W 4B3TL 4F8MA 4LF8Q 1GUWA 3MXPA 1S40A 4X65Q 1TY2A 2DN8A 5EKIA 4EX5A 1CSQA 1VQJA 4HN7A 3KF8A 2EYMA 3G6EA 2A19A 5IP9H 1JWSD 3KF8B 3K0YA 1AZPA 1TS5A 3HOVG 4L8JA 3R3OA 1MI2A 1A3VA 4O42A 2G5DA 1WTVA 3GTPB 1XTCD 4L6TB 5CYUA 1I4XA 2MGSA 2CCZA 4WFN3 5CV9A 1PH3A 4LF7L 1PRTF 1PTOB 2B3GA 4QMGA 4A3IB 3IFTA 1YBYA 5AFWA 4BY1B 2E2DC 2K6AA 1R9TB 1G291 2XNAC 3NELA 1TU2B 4OO1I 3OMCA 2OWOA 1HFNA 4JK1C 2Y0SE 1HA5A 4ME3A 5CORA 1N9WA 2X69A 1O7ZA 3I2ZA 3OSOA 4A3BB 4DR3L 1N8RC 2CFMA 2NVTB 1EZ6A 5GROA 1HNXQ 2RQXA 4LNQA 1E2VA 2YTXA 2Y0SB 3Q24A 2JA7B 2E2JH 2R93H 1VQFA 1LABA 1RTNA 4LMQD 1P16A 2A6ED 2F0HA 2NN6I 3QJYA 5IGFA 2HHHL 4C3JH 1V1PA 1KQSA 1V1PB 2HDMA 1TY0A 3S1MH 3OOCA 1E3PA 2MPMA 4DV7L 4XXEA 5KNDA 2L4NA 2DNCA 2MUYA 3ERQA 1EY0A 1WTWA 1EOVA 3CCLA 4JI4L 2KOLA 2IW3A 1CFMA 5LL6X 1PH6A 2V4DA 4Y7NB 1EYGA 3FMCA 4NXNL 1A3TA 4QF4A 3GTKH 3CKIB 4DV2L 3ICEA 3ULJA 1EQTA 3K58A 4XQJA 1QCBD 1I6VC 2B2VA 5BN4A 1U4LA 1FR3A 4DV7Q 4R4QA 4O2DA 2H5XA 2BDOA 3LWEA 2K5HA 5KNCA 4JI3Q 4XQQA 2R7ZB 2RSNA 5ELDA 2K5WA 4JBJA 3HRZC 2K5QA 2IT1A 3KLWA 1UUPA 2IHEA 1F77A 4YCVA 2K5VA 2GVAA 3TP7A 4DN4M 1XMOQ 2F1MA 3UE0A 4GLAC 1F9QA 2F0PA 4A3DG 3QWNA 1VQHA 2L9HA 5KYLA 5BN5A 1I4RA 2E5LL 1B3AA 4FP5D 1EY6A 4MTKA 4AIMA 4C3HB 1X9NA 2D62A 3ND9A 4G4KA 4WJ4A 1QE6A 2NUCA 4O0AA 4KJNA 1IKMA 4CHTB 4BBRH 3KLSA 4YCWA 3C3LA 1E24A 4PV1C 4BY7B 3J7YW 3HG9A 1KLGD 1EIFA 4AQYQ 1HZAA 3AEVA 3HKSA 4L5RC 3PO3H 1GHJA 4HIMA 3HEJA 1DOLA 2B2WA 1CKNB 1EOTA 1YITA 4JI7L 2A6HC 2XRQD 1JT8A 2Z8LA 3DWAA 3CCVA 4AYBE 5M5WB 1HR0L 5DM63 1TKWB 1NSNS 3HOUG 3K7UC 5IYBG 4HJ7A 3TZDA 3ZYYX 4IURA 1FNUA 3W5OA 4BBRB 1ENCA 1CHPD 4DK1A 4AQYL 4X3KA 4HTHA 1HCZA 5M3FG 4J15A 1KL9A 1TWAB 3NUCA 4L63B 3OW2A 3OIPA 2CWPA 4JI7Q 4LFCL 1VQCA 2XWBB 3I73A 5BR8L 4NPSA 1IBMQ 1MGSA 3A8IE 2QILA 4BS9A 2NVYH 2Q2TA 2E2IH 2HIXA 5I6WA 1I4HA 2QA4A 4CDCC 3DXJC 5TSSA 4A3GH 1K8OA 3S9WA 3CMEA 3KFUA 5IGDA 2VB3X 4LK1C 5LMNW 3RZOH 5I4DA 4LFCQ 2B2YA 2EYLA 3VA7A 2EZVA 2MHVA 5DNFA 3V96A 2L15A 4BA1I 1HNWQ 3MXNA 2N88A 4YY3L 2NWGA 5FLMG 4OO1G 4A3LH 2PNHA 5C4HA 1K83H 2B39A 4I65A 4TKOB 2MQHA 2K14A 4DK6C 2JXMB 1RHPA 2M00A 1S4ZA 1PA6A 1HNZL 5T1IA 4QY7A 1VMCA 2JP1A 5C3XA 2PW5A 2RDGA 4EGVA 2EYFA 5IODA 2NVXB 3M9BA 5COYA 4DV1Q 1NMFA 4GKJQ 1BO0A 4IUUA 2F4VL 3Q23A 2QF7A 4YHHQ 3IFDA 3F2BA 4P74A 4WJWA 2YYZA 1N33L 4A3FH 4IQZA 3ERSX 1PTOD 3LNNA 2B2TC 1GM5A 1JJGA 2EJFC 1II3A 5IWAQ 2IHFA 3J80L 2CW0C 2G9HD 3ULPA 3H0GB 1K9MC 1H9SB 3NHHA 3P20A 2KHIA 3SEBA 3SGIA 2VS1A 1I94Q 4A3BH 3BZCA 3DWQA 2UXBL 1SEBD 3ONAB 5M3MH 1YHAA 3TS0A 4XT3B 5M5XH 1I50H 3L3OC 1QWYA 3JAMi 2EIFA 2MO0A 3KF6A 3BJUA 5D3IB 5EPKA 3I4MG 2I07B 1Q46A 1STEA 2UXDL 3BS1A 1S72A 5G3LD 4N8X1 3W1BA 3SK5A 1KXLA 1KNAA 1XMQQ 2QDBA 3ER0A 4XYQA 4DAPA 2VB2X 1PVOA 4LF4Q 4C56C 4C3IG 3Q0AA 1PH4A 1JICA 2HIVA 1LACA 3WWVA 3K5NA 2ALYB 3S1NB 5EAYA 5J1ZA 1UE1A 1IHZA 5FLXL 1W2BA 4JI0Q 3FRPB 2VW9A 4JOIA 2NYZD 5IIFA 3K8AA 4JV5Q 1EY7A 3FKIB 3DLLA 1G2TA 1TWFB 1MBYA 1V1OA 3BVGA 5IYCG 1UEBA 1V9PA 5JOBA 3FEWX 4N9TA 2UUCL 1OXSC 3M4QA 2QEJC 4DF7A 1HTPA 5G3LF 1IBLL 3FVQA 5J3BA 1HRJA 5HY6A 1MD2D 1QILA 1U5KA 3M4YA 3NEMA 5D14A 3W3AA 2K75A 2PZWA 4BA2I 1STAA 3D31A 1XPUA 1EQVA 2ZJQA 4RAUC 4OX9L 2PPBC 4B3RL 3GTQB 1UE6A 1B9MA 3HOXH 1WJJA 2X6GA 1YI2A 1LM0A 1TIID 1PYWD 5LMNL 4IUPA 1VQ9A 1J5EL 2EY6A 1EEID 4IPGA 4KTAA 3MFYA 4RKBA 5EKKA 4FNFA 4KKSA 1IBKQ 1H9MA 3NSWA 1S5DD 3RLNA 2O5IC 5IGEA 1JC7A 5C4JB 1ESFA 1N32L 3LX0A 2WAQE 3D3RA 3Q22A 4HIOA 3GTGH 1SMYD 3EVQA 4LUOA 3H15A 2PI2E 4FVMA 1SYDA 3S1NH 1LV9A 3GTQH 1L0XB 4P72A 4CDFC 4B08A 4A3LG 1PH9A 2ATWA 3M4OB 1B7YB 1KDAA 4RG1A 2A68D 4IPCA 5C3EG 3U58A 4AH6A 4HJ8A 1NR2A 3CPFA 3GTLH 3PIOA 5EBDA 4IO9A 1U9RA 5F2DA 1ILQA 5JPMC 3FKIG 4JBWA 3CCUA 3PIP3 5E1FA 4JI3L 5CV6A 3AQQA 1EYAA 3GO5A 1TWFH 1SE4A 4GNXB 2OQ0A 3MWYW 2ZJRA 4FYDA 4A93G 1K83B 2AUJD 2N49A 4TVAB 3R8BA 5EQ0A 1PYSB
chains in the Genus database with same CATH topology
2OT2A 1XWEA 1QOHA 1EY5A 2M2LA 3CHBD 2F03A 3GTGB 3PIO3 2I46A 2J7ZA 1R4QB 4TQUS 4A3KB 1PFMA 4MIUA 4QB4A 1WD0A 2NN6H 2EPBA 2OEOA 2O5JC 2PZUA 3RZDB 2IX0A 4Z9CB 1O7LA 1SYGA 4ILWA 2NTTA 1CHQD 2BOSA 1SE3A 4FF3A 1EY9A 3E5SA 3HZXA 1X32A 2PMZB 4IZ8A 2PZTA 1ONLA 2SEBD 2ZXRA 2A6EC 4C2MB 1SYFA 2L0CA 3SE0A 1HFGA 1KABA 3MEHA 2F4IA 1BNZA 5DEHA 4FF1A 3NK9A 1GUOA 1EWCA 3E0JA 4CGYB 1HUMA 1UAPA 2TSSA 4H13C 4HSVA 3GD7A 5FOBB 3A7AB 5KYIA 1S5ED 3T53B 1WTQA 2PCFB 1V43A 4Q5VA 3BVZA 5J39A 2JEAI 2R92B 1CZWA 2JSOA 4IUQA 1EZ8A 2F0SA 3I4MB 2K03A 1AW7A 4H0LC 2KVMA 5CV4A 3V05A 5M3MB 2E75C 2A5HA 1MSHA 1E2WA 2NVYB 3DM1A 1H9RA 4A3EB 1DJRD 1Q1BA 4U673 5A2QL 5I6YA 2Q8RE 3BG3A 4LJZC 2K33A 4DNRB 1LT3D 3TP8A 3CU7A 5D65A 2EOTA 3U9SA 2E2JB 1ENAA 1WTPA 2KECA 2JA5B 5IGBA 2Z4HA 1KDBA 2WIIB 5E3FA 5CGKA 4XTCS 5KGUA 5DM73 3WOFA 1Q1EA 1B2TA 3MHBA 4M1UB 2LKVA 2Z4IA 2VUMB 2NB0A 1RCVD 2EVBA 4EQPA 1F2ZA 2RDHA 3A8KE 3D4WA 3EQLC 1T5XD 1X3PA 3NQIA 3TSSA 3NPPA 2FMCA 4RCNA 2FMMA 4RA8A 3VYTA 2IPKD 1VCIA 3NE5B 1E0BA 1SFOB 1SNOA 3S16B 4J6HA 2RDFA 1LTRD 3C1FA 3NTHA 2EY1A 4OL7A 4R8IA 1J9OA 4RHSA 3K5MA 4BBSB 3GTOB 2B2VC 2EE1A 5JJZA 2F0IA 2F0WA 2K1BA 1HUNA 5D3DA 1KNEA 4G7HC 1YNND 2R3ZA 2HCCA 2MJ8A 4HSPA 3S14B 1M8AA 4NDXA 4UAIA 3J7AV 4C3JB 3BDOA 2RSOA 1BXTA 4KHZA 5I2XA 1TWGB 4CKEA 3S15B 3MAQA 1EY8A 2EYOA 5KNBA 5JAVA 3ND8A 3QIAA 4KMUC 3JAML 3K5OA 1LT4D 3HGBA 2DY8A 4UDUC 2F0FA 1Z47A 3I8ZA 3SVMA 3OWFA 1Q90A 1ZXTA 4DFAA 1LTAD 1SNMA 2PO4A 3SDZA 4FXGC 1BUVT 2E76C 4DXFA 4DGZA 5CC4A 2B2UA 2HCIA 2N55A 1PXUA 2IJ0A 4KV6A 1VMPA 4M8AA 2WV6D 2EYHA 5M3FB 2WB1B 3RMHA 1I3QB 1PDQA 1XYIA 1WTRA 5CR3A 4ZUJA 1AZQA 4C3HG 2XRSD 4B9XA 3VYRA 4C3IB 4ZQ3A 1JB3A 5IT9E 3R2TA 1LO5D 1STYA 2HDLA 1SXTA 2CQAA 1O7YA 3J80E 3N6RA 4BWGB 4F87A 1VF5C 3TP6A 3BYYB 3G6JB 3L7ZC 4C1NK 3QO2A 3TN2A 1RODA 4KKTA 2KCCA 3URYA 1IYUA 1EL0A 1WVLA 1T5EA 1A2TA 3NQTA 1Q8IA 5BN3A 3S2DB 3DUZA 2F0LA 2JEBI 3I3CA 5ELCA 1A6XA 1YNNC 3I4LA 4IALA 2A6HD 3GV3A 3GP7A 2L1BA 1Q3LA 3IAYA 2K32A 3M3YB 3EA6A 3BDCA 4K8JA 2ZXPA 1D6EC 5JEAG 4P2CB 3RD4A 1X3QA 4O1NA 2FINB 2K7VA 3PV0A 2M9VA 1QNUA 2BA1A 4NKLA 3MXGA 3T4AC 3NTKA 1DOKA 5M5XB 2K5DA 1RDPD 3N52A 3A56A 2EY5A 1PLFA 4K6LA 3G7LA 5FO7B 5C5LA 3SXHA 1Z6HA 5FO8B 1U4MA 1B53A 4K14A 5HURA 4DAYA 4FXKC 3K6OA 1H9SA 1W6KA 3J81E 3BZDB 2KUMA 1K8MA 3KBXA 1EYCA 2J0TD 4ME5A 1SAPA 1M4VA 4IUVA 1C48A 4OIJA 2DY7A 2F0EA 1PFBA 2F0QA 5CBEE 1OXUA 4XDXA 5FLXE 2FFKB 4ZK9B 1ILPA 4LAAA 1FGBD 3AB9A 1I4PA 1GHKA 1FNWA 2EYJA 3DWPA 2F0TA 3H91A 1HA6A 3NWSA 4A3JB 4IFDG 1DXMA 1PRTB 1QNKA 3VR2A 1TQOA 2NN6G 1LT5D 2KHSA 4ID6A 1F2LA 5IT9L 3GTJB 5ISRA 3PUZA 1NAPA 4OIKA 4XYOA 3NBIA 2KJXA 1CA5A 3CQZB 3HOVB 3D4RA 1ENFA 4MN3A 1O78A 2F3VA 3OW7A 4XT1B 3D6WA 2JA8B 2RA4A 5EPJA 3KBGA 5KEEA 2F0UA 3DEPA 1SE2A 1TT2A 2EJMA 1Y8NB 2AUKA 4HR7B 5IGCA 3FPPA 2KCNA 3I90A 3A8JE 1LLRD 3A55A 3PUWA 4A93B 1SNCA 5CV5A 5EKLA 3VYSA 4DNTB 5A35A 4KD4A 3RZOB 2ICEC 5EPLA 3LWUA 2H1EA 4H7BA 1UNSA 2IWHA 5K5PA 3MFGA 1HTLD 4U68A 2B63B 3J81L 1SYBA 1JOQA 1G8ZD 1CA6A 1GXDC 3KLRA 1KDCA 1ZYRD 2WAQB 3DMUA 2SOBA 1DONA 4CKCA 3TZUA 1G91A 1EIHA 1LT6D 2IL8A 4DK0A 2E74C 2CW0D 2Q8IB 4A3GB 1FNVA 2O4XA 1D5MC 1ET6A 1Y8PB 1BBXC 1DM0B 2AQ1B 1QB5D 2WKCA 2G9DA 5IGGA 3F2UA 1WCMB 1BCPC 3NTIA 3S1MB 3GTLB 1ZYRC 1DYQA 3T51B 4K6DA 3OMGA 1OXVA 1FD7D 3X3NA 1H9KA 1ZEQX 3CRKC 3S1RB 5E4XA 1JQYD 2E2HB 3SR1A 3O13A 1PTOF 1B9NA 2EXZA 2RBMA 5C5MA 4QCLA 1KAAA 4V190 3PO3B 3I72A 4CJ0B 2A69C 3IKJA 4QUFA 1STHA 5EGTA 4IFDI 4E6IA 5K36H 2ID0A 3SK8A 3CRLC 2CHBD 3HOUB 3HOWB 4ULLA 3BVMA 2LFNA 1JWMD 3MZ5A 5C0XG 4HMIA 2IX3A 2NTSA 2DNEA 5HGTA 4RGNA 2XVSA 1PZKD 3UI2A 1D1KA 5CBAE 1SSOA 4PMWA 2L11A 5I9PA 1Z7TA 2C5CA 2FHTA 1Y8OB 1UEAB 1TVXA 3VR5A 1I6HB 1DZ1A 3P1HA 1ET9A 3GTMB 1S5CD 1JOOA 4RGMA 4KY6A 1PRTD 4DA2A 3OHXC 4WRDA 2BA0A 3R2IA 1PTOC 3C1EA 4AYBB 2SDFA 1XXGA 4KD3A 3M7GA 1G2SA 5FKAC 2AWNA 4EQNA 3H09A 1EU3A 3C2PA 3KK7A 2PYKA 4K2LA 4IUTA 3T16A 3I91A 1BCPD 3K7AB 4KKUA 5C3EB 4ZUIA 4ZRZA 4H44C 5DAUA 1EY4A 1A3UA 4CKBA 1CM9A 3ITPA 2B2WC 2NZ1D 3HOXB 1EEFD 1CTMA 3KLSX 1AP0A 1S5FD 1PZJD 1GJXA 2KEEA 4R9WA 1JE4A 4ZAIA 3S1QB 1I4QA 1C4QA 1GUTA 1SBBB 4HCSA 4FXDA 4RH6A 1LTGD 4XQNA 1IKLA 5LL6S 3NXWA 4V0BA 1CI3M 1ICWA 5T1GA 5C4ZA 1JR0D 2JE6I 2PQEA 1STBA 4F88A 1FYCA 4FF4A 3D6CA 5NUCA 4X3UA 2VXWA 1SYCA 1YNJC 1BDOA 1NCVA 3D8GA 3VA5A 1JWUD 3FPUB 3VR4A 4HMJA 1RTOA 2KA7A 3QG1A 1G6ZA 2A74C 4KHVA 2ICIA 5C4XB 4RGOS 1JCKB 2D9UA 2WINB 1GUGA 5KRUA 4G7OC 4NP5A 1BQQT 5C3WA 1B44D 4X3SA 1ESRA 5JEAH 3RLFA 1F2MA 4K5VA 2VNUD 3QB3A 1PZID 3S17B 3DHQA 3PO2B 1STNA 3TMEA 1F2YA 5CMDA 4IUNA 5M9OA 2O2LD 4HAEA 3VR6A 2F3WA 5E4WC 5EBCA 4J8QA 2K01A 4KY7A 4PNYA 5C44B 2YU9B 4WORA 4KY5A 2PW7A 2B2YC 4N9PA 1HHVA 5CV8A 5M5YB 5IOCA 2BE5C 5ELFA 3M7NA 1BCPB 3OPOA 2AQ2B 1A15A 4ZKCB 3K59A 2EY2A 3TDQA 1YNJD 3SK6A 4RCOA 4X3TA 3VYUA 3I70A 3TBIB 2L55A 1Y1VB 3TP5A 1V8QA 2QKIC 3R93A 5ELBA 3W2DA 1W6JA 4K5WA 1EFID 1BCPF 1F9RA 1XX8A 3I4NB 1I50B 4KI0A 1IL8A 2EJGC 1H9JA 3K5LA 1WTOA 5C6AA 1QG7A 2F0DA 4RKLA 3L9AX 3A54A 4MHEA 5FO9B 2BE5D 2E2IB 2GA4B 2IX1A 3U9OA 3AU7A 2EYPA 1TR5A 1B50A 1NR4A 1IW7C 3SHLA 2D5DA 4OO1H 1TS4A 3VR3A 3BDLA 3C46A 4FF2A 1C8CA 5C0XJ 4I7ZC 3HS0C 3SK4A 3GV6A 2R93B 1HXYD 2F0OA 1Q12A 4FO2A 3PUVA 4QUCA 3S2HB 2A68C 2D2CC 1B1ZA 4RWSC 1EU4A 3HOZB 1U4RA 1GOZA 1SMYC 1NUCA 4RFBA 2BCOA 3H3VC 2AWOA 1HQRD 1D2BA 2XN9C 1Y1WB 1SJHD 1STGA 2XIWA 3X3MA 1ML0D 2PNRC 3MA2B 2J4XA 1LTID 1IYVA 3E6ZX 3Q6SA 1TWCB 5JVH3 1L0YB 3HKZB 1RKNA 2HUGA 3OWEB 4PQXA 1CQVA 3FDTA 2OF1A 3PUXA 2K28A 4RHRA 4CJ2C 4OGQC 3M85A 4IFDH 3EFXD 4YIJA 2HQEA 1D5ZC 4GZYC 2Q8TA 1MSGA 2B8GA 2QCPX 2ZT9C 2KEDA 2B2UC 4PMCA 1U4PA 4NMZA 2A69D 1CK1A 1DD2A 1BOSA 1RJTA 1PMRA 2F0VA 4PMBA 2L12A 2RKSA 4DXGA 3OIQA 1WTXA 3EROA 4KN4C 1LTSD 3MTSA 3KUPA 2R6GA 2A73B 1I4GA 1VDZA 2F0MA 1GUSA 3PMFA 5JPNC 1Y69U 4IFDJ 1KLUD 4QIWB 5A2QE 3AMUA 1LTBD 3MC0B 3GTKB 1PTOH 1JORA 4NW2A 1CQFA 1J8IA 1SJED 2ENBA 5FK9C 3NWTA 2FJ2A 4CJ1B 4F7XA 2R61A 3H94A 2L5TA 3GQBA 4J1MA 5C0XH 1RD9D 5I9OA 1PRTC 1OXTA 2CVRA 2K04A 2KQ3A 4A3DB 3DEOA 2NVQB 1LTTD 1D1IA 3PUYA 1TWHB 4Q0FA 4DU9A 1TS2A 2H4OA 1WD1A 3H6MA 1OO9B 5ELEA 4DAVA 5I2YA 3P75A 4HEDA 3T56B 4ZLTF 3T13A 1BR9A 1O80A 3JAME 2NBFA 1KTKA 3BYTB 5C0XI 1HPCA 1SYEA 3QOLA 2F0KA 5JVG3 2C9OA 2B2TA 2WP8J 1E2ZA 2OXPA 2LY7A 1OXXK 2TMPA 4A3MB 5K36G 2F0GA 2WACA 5EJWA 3WDNA 2B8FA 1EYDA 4C3JG 4R8NA 4ZKBB 4ODGA 1EIGA 4G7ZC 2LS01 5JEAJ 1TS3A 4OHJA 2MP1A 1RF2D 3MXUA 1DCZA 4EQOA 1S5BD 4S3SA 4XIGS 3J7AF 2EDGA 3IL8A 4G57A 1HQMC 2SNMA 1EWHA 4KK7A 3WOEA 3EJIA 3A7LA 4K5XA 3V2TA 3HP3A 2F0NA 5J22A 1JOKA 1IW7D 1SNDA 1DOMA 1D5XC 2WKDA 5KIXA 2XSCA 4KN7C 3NBHA 1SNQA 1R4PB 3RUZA 2F0JA 2K05A 4EVOA 3K57A 4IN3A 4K8IA 4TSSA 4K2KA 4C1NI 4ZYSA 1AFPA 1F9PA 4RGTA 2JYOA 1ZKOA 3P7JA 3HOYB 3MVVA 4HCEA 1CT1D 2SNSA 1QJOA 3NP8A 4ABNA 1PFNA 4CBVA 2LMCB 4TRDA 1SNPA 5CV7A 1AEXA 1AN8A 2AQ3B 1GUNA 3QOJA 1B4OA 1CZGA 4A3FB 2Z1CA 2X6LA 2JA6B 1VF7A 1A2UA 4KJOA 1SDFA 3D4DA 2BDNA 2RVLA 1BF4A 1F9SA 2ZXOA 5LHY1 2XWJB 4F8MA 1GUWA 3MXPA 1TY2A 2DN8A 5EKIA 4HN7A 3KF8A 2EYMA 1JWSD 3K0YA 1AZPA 1TS5A 4L8JA 3R3OA 1MI2A 1A3VA 4O42A 1WTVA 3GTPB 1XTCD 4L6TB 5CYUA 1I4XA 2MGSA 4WFN3 5CV9A 1PRTF 1PTOB 4QMGA 4A3IB 3IFTA 5AFWA 4BY1B 2E2DC 2K6AA 1R9TB 1G291 2XNAC 1TU2B 4OO1I 3OMCA 1HFNA 4JK1C 1HA5A 5CORA 2X69A 1O7ZA 3OSOA 4A3BB 2NVTB 1EZ6A 2RQXA 1E2VA 2Y0SB 3Q24A 2JA7B 1LABA 1RTNA 4LMQD 2A6ED 2F0HA 2NN6I 3QJYA 5IGFA 1V1PA 1V1PB 2HDMA 1TY0A 3OOCA 2MPMA 4XXEA 5KNDA 2L4NA 2DNCA 2MUYA 3ERQA 1EY0A 1WTWA 2KOLA 2IW3A 1CFMA 5LL6X 2V4DA 4Y7NB 3FMCA 1A3TA 4QF4A 3CKIB 1EQTA 3K58A 4XQJA 1QCBD 1I6VC 2B2VA 5BN4A 1U4LA 1FR3A 2BDOA 3LWEA 5KNCA 4XQQA 2R7ZB 2RSNA 5ELDA 2K5WA 3HRZC 2K5QA 2IT1A 1UUPA 1F77A 3TP7A 4DN4M 2F1MA 1F9QA 2F0PA 3QWNA 2L9HA 5KYLA 5BN5A 1I4RA 1B3AA 4FP5D 1EY6A 4C3HB 2D62A 3ND9A 4G4KA 1QE6A 2NUCA 4KJNA 1IKMA 4CHTB 3KLSA 3C3LA 4PV1C 4BY7B 3J7YW 3HG9A 1KLGD 1GHJA 3HEJA 1DOLA 2B2WA 1EOTA 2A6HC 2XRQD 2Z8LA 3DWAA 5M5WB 5DM63 1TKWB 1NSNS 3TZDA 3ZYYX 4IURA 1FNUA 4BBRB 1ENCA 1CHPD 4DK1A 4X3KA 4HTHA 1HCZA 1TWAB 3NUCA 4L63B 3OIPA 3I73A 2XWBB 1MGSA 3A8IE 4BS9A 2QILA 5I6WA 1I4HA 3DXJC 5TSSA 1K8OA 3S9WA 5IGDA 2VB3X 4LK1C 5I4DA 2B2YA 2EYLA 3VA7A 2EZVA 2MHVA 5DNFA 3V96A 4BA1I 3MXNA 2N88A 2NWGA 4OO1G 5C4HA 2B39A 4I65A 4TKOB 2JXMB 1RHPA 2M00A 1S4ZA 5T1IA 1VMCA 2JP1A 5C3XA 2PW5A 2RDGA 4EGVA 2EYFA 5IODA 2NVXB 5COYA 1BO0A 4IUUA 3Q23A 2QF7A 3IFDA 4WJWA 2YYZA 4IQZA 1PTOD 3LNNA 2B2TC 2EJFC 1II3A 3J80L 2CW0C 2G9HD 3H0GB 1H9SB 3NHHA 3P20A 3SEBA 3DWQA 1SEBD 3ONAB 4XT3B 3L3OC 1QWYA 5D3IB 5EPKA 2I07B 1STEA 3BS1A 5G3LD 3SK5A 1KNAA 2QDBA 4XYQA 4DAPA 2VB2X 4C56C 4C3IG 3Q0AA 1JICA 1LACA 3K5NA 3S1NB 5J1ZA 1IHZA 5FLXL 3FRPB 5IIFA 2NYZD 1EY7A 3FKIB 1G2TA 1TWFB 1MBYA 1V1OA 3BVGA 5JOBA 3FEWX 4N9TA 1OXSC 2QEJC 4DF7A 1HTPA 5G3LF 3FVQA 1HRJA 1MD2D 1QILA 3M4YA 5D14A 3W3AA 2PZWA 4BA2I 1STAA 3D31A 1EQVA 4RAUC 2PPBC 3GTQB 1B9MA 2X6GA 1TIID 1PYWD 4IUPA 2EY6A 1EEID 4KTAA 3MFYA 4RKBA 5EKKA 4FNFA 4KKSA 1H9MA 3NSWA 1S5DD 2O5IC 5IGEA 1JC7A 5C4JB 1ESFA 3LX0A 3D3RA 3Q22A 1SMYD 3EVQA 4FVMA 1SYDA 1LV9A 1L0XB 4B08A 3M4OB 1KDAA 2A68D 1NR2A 5EBDA 1U9RA 5F2DA 1ILQA 5JPMC 4JBWA 3PIP3 5E1FA 5CV6A 1EYAA 3GO5A 1SE4A 3MWYW 4FYDA 1K83B 2AUJD 3R8BA 5EQ0A 4B9WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K5V A;  2EYL A;  3QB3 A;  2RKS A;  2EYH A;  1EY5 A;  5CV4 A;  3SK4 A;  4ZUI A;  5DAU A;  1EYD A;  1EY4 A;  1IHZ A;  2F0U A;  2F0O A;  3DHQ A;  3ERO A;  1STN A;  4ODG A;  4R8N A;  1A3U A;  4F8M A;  5C4H A;  3TME A;  3MXP A;  1F2Y A;  5CR3 A;  4MIU A;  4ZUJ A;  4QB4 A;  3SR1 A;  1TT2 A;  4I65 A;  2F0I A;  2F0W A;  4IUN A;  5IIF A;  5M9O A;  2EXZ A;  2F0M A;  1EY7 A;  2RBM A;  5C5M A;  2EY5 A;  2OEO A;  1KAA A;  2F3W A;  2PZU A;  4B9X A;  2EYM A;  5IGC A;  3ITP A;  4ZQ3 A;  5JOB A;  4EQO A;  4S3S A;  4PNY A;  3PMF A;  4KY7 A;  4N9T A;  2M00 A;  5KEE A;  5C5L A;  3SXH A;  3TP7 A;  4DF7 A;  4G57 A;  1STY A;  1SYG A;  2SNM A;  3R3O A;  4KY5 A;  1A3V A;  4WOR A;  2PW5 A;  5C3X A;  2F0P A;  2PW7 A;  1NUC A;  1STH A;  4K14 A;  1SNC A;  4N9P A;  5CV5 A;  2EYF A;  2WAC A;  3EJI A;  4K5X A;  5EGT A;  5EKL A;  5J1Z A;  3V2T A;  5IOD A;  5KYL A;  4E6I A;  4PMB A;  2F0N A;  5CV9 A;  5CV8 A;  3TP6 A;  1EY6 A;  3SK8 A;  5IOC A;  5I6Y A;  4KD4 A;  5J22 A;  1EY9 A;  4NDX A;  2PZW A;  4QMG A;  1STA A;  1JOR A;  2NUC A;  1JOK A;  1EQV A;  1EYC A;  1SND A;  4H7B A;  4KJN A;  3E5S A;  3TP8 A;  5K5P A;  3MZ5 A;  3HZX A;  2ENB A;  4ME5 A;  5KIX A;  3OMC A;  4HMI A;  2EY2 A;  4IZ8 A;  2PZT A;  1STG A;  3SK6 A;  2EY6 A;  4F7X A;  4KTA A;  1SYB A;  1SNQ A;  4RKB A;  5EKK A;  1JOQ A;  1A2T A;  1ENA A;  2F0E A;  3RUZ A;  1SYF A;  2F0J A;  3OSO A;  4J1M A;  2F0Q A;  1II3 A;  4EVO A;  1EY8 A;  3NQT A;  5J39 A;  2EYO A;  5HGT A;  5I9O A;  3TP5 A;  1KAB A;  3HEJ A;  3MEH A;  5IGB A;  4K8I A;  3NHH A;  5IGE A;  1KDC A;  4LAA A;  5JAV A;  2KQ3 A;  5DEH A;  4K2K A;  1EZ6 A;  4NKL A;  1KDB A;  3NXW A;  3NK9 A;  4K5W A;  5E3F A;  5CGK A;  5KGU A;  5C4Z A;  3LX0 A;  2F0L A;  2EYJ A;  2F0T A;  5I9P A;  1RKN A;  3DMU A;  2SOB A;  2PQE A;  1STB A;  3EVQ A;  4DU9 A;  1NSN S;  3H6M A;  2F0F A;  3D6C A;  5NUC A;  3MHB A;  2OF1 A;  2LKV A;  1SYD A;  2F0H A;  3P1H A;  5IGF A;  1ENC A;  4IAL A;  1SYC A;  3MVV A;  3OWF A;  3D4W A;  1F2Z A;  1TQO A;  3P75 A;  4HTH A;  4EQP A;  2KHS A;  1JOO A;  5C6A A;  5KYI A;  1KDA A;  2SNS A;  4ID6 A;  4KY6 A;  3NP8 A;  3NUC A;  3D8G A;  3T13 A;  3VA5 A;  2F0D A;  4TRD A;  5ISR A;  1SNM A;  4WRD A;  4DFA A;  4RKL A;  4YIJ A;  1SNP A;  2HQE A;  5CV7 A;  2O4X A;  4HMJ A;  1AEX A;  3C1E A;  4KHV A;  1U9R A;  1SYE A;  5F2D A;  3QOJ A;  3U9O A;  2EYP A;  1TR5 A;  4KD3 A;  3BDC A;  3QOL A;  4K8J A;  5E1F A;  2F0K A;  4PMC A;  3SK5 A;  5IGG A;  3ERQ A;  4DGZ A;  1EY0 A;  5CV6 A;  4NMZ A;  4EQN A;  5I6W A;  2QDB A;  5CC4 A;  1EYA A;  2OXP A;  5KRU A;  1SNO A;  3SHL A;  4NP5 A;  5HUR A;  4KJO A;  1A2U A;  2PYK A;  1EZ8 A;  4K2L A;  3S9W A;  5IGD A;  5C3W A;  4J6H A;  1A3T A;  2F0S A;  2RDF A;  4K6D A;  4KV6 A;  4QF4 A;  3C1F A;  3T16 A;  3D4D A;  2F0V A;  1F2M A;  2EY1 A;  2F0G A;  2F3V A;  3OMG A;  4OL7 A;  3BDL A;  4B9W A; 
#chains in the Genus database with same CATH topology
 2OT2 A;  1XWE A;  1QOH A;  2I5L X;  1EY5 A;  2M2L A;  2UUB Q;  3CHB D;  2F03 A;  2CWA A;  4A3F G;  3CCJ A;  3GTG B;  3PIO 3;  2I46 A;  2J7Z A;  1R4Q B;  4TQU S;  4A3K B;  1PFM A;  4MIU A;  4QB4 A;  1FL0 A;  1WD0 A;  2NN6 H;  2EPB A;  2OEO A;  1WFQ A;  2O5J C;  2PZU A;  3RZD B;  2IX0 A;  4Z9C B;  4R4T A;  5DLQ E;  3KDF B;  3CPW A;  1O7L A;  2E2H H;  1X3F A;  3S1R H;  1SYG A;  4ILW A;  2NTT A;  4IJH A;  1CHQ D;  4IPD A;  2BOS A;  1SE3 A;  4FF3 A;  1EY9 A;  3HOU H;  5IYB H;  1ASY A;  4MZ9 A;  4NXN Q;  4B3S L;  3E5S A;  3HZX A;  3S14 H;  1X32 A;  2K5N A;  2PMZ B;  4IZ8 A;  2PZT A;  1ONL A;  2SEB D;  2ZXR A;  1WCM H;  2A6E C;  3S24 A;  4C2M B;  1SYF A;  2L0C A;  4K0K L;  3SE0 A;  1HFG A;  1KAB A;  3MEH A;  2F4I A;  1BNZ A;  2UU9 Q;  4OWT B;  5DEH A;  4FF1 A;  3NK9 A;  1GUO A;  1EWC A;  4BY1 G;  3E0J A;  4CGY B;  1HUM A;  1UAP A;  1I3Q H;  4DAM A;  2TSS A;  4L5S A;  4H13 C;  4HSV A;  3GD7 A;  4A3B G;  5FOB B;  3A7A B;  4DKA C;  5KYI A;  1S5E D;  3T53 B;  1WTQ A;  2PCF B;  3RN5 A;  1V43 A;  3HOV H;  5IYC H;  4Q5V A;  3CCS A;  1ASZ A;  3BVZ A;  4JCV E;  5J39 A;  2C35 B;  1TWG H;  4DUY L;  2LXJ A;  2JEA I;  2R92 B;  1CZW A;  3JC6 6;  2R7Z G;  2JSO A;  1HZB A;  4IUQ A;  1AE3 A;  1EZ8 A;  5GAD C;  2F0S A;  3I4M B;  2K03 A;  2Q2U A;  1AW7 A;  3T1H Q;  4H0L C;  2I5H A;  4GKK Q;  4KLK A;  2KVM A;  5CV4 A;  3V05 A;  5M3M B;  4DUZ Q;  3HOZ H;  2E75 C;  4POF A;  4Y7N H;  2A5H A;  2F4V Q;  1K0S A;  4HJ5 A;  2K4K A;  2RCF A;  2DJG C;  4CDE C;  1MSH A;  1E2W A;  2JA5 H;  2EQS A;  1PV4 A;  2NVY B;  3DM1 A;  1H9R A;  4A3E B;  3GDE A;  1N34 Q;  1DJR D;  1Q1B A;  4JI5 Q;  4DUZ L;  1NTG A;  5FJ8 G;  4U67 3;  3RNU A;  1QZH A;  5A2Q L;  5I6Y A;  2Q8R E;  3BG3 A;  4LJZ C;  5AJ3 Q;  2K33 A;  4DNR B;  5HGQ A;  4A76 A;  1LT3 D;  3TP8 A;  2NVX H;  3CU7 A;  1EUJ A;  5D65 A;  1SFO H;  2EOT A;  4LWC A;  3U9S A;  2E2J B;  1ENA A;  4BBR G;  4DR5 Q;  1WTP A;  2KEC A;  4B9W A;  3Q8D A;  2JA5 B;  5IGB A;  2Z4H A;  1SRO A;  3B6Y A;  1KDB A;  2WII B;  4L5Q A;  1H95 A;  1CKO A;  5E3F A;  5CGK A;  3A5Z B;  4XTC S;  5KGU A;  1L1O A;  5DM7 3;  3WOF A;  4DR6 Q;  3RLO A;  1Q1E A;  1B2T A;  2JA8 H;  3MHB A;  4JW0 A;  4M1U B;  2LKV A;  2Z4I A;  1R9T H;  2VUM B;  2NB0 A;  1RCV D;  4DR5 L;  2EVB A;  3D4W A;  1F2Z A;  2RDH A;  3A8K E;  4EQP A;  1YNX A;  3EQL C;  3J80 c;  3J7Z C;  1T5X D;  1X3P A;  1VQD A;  3NQI A;  1K0R A;  3TSS A;  3NPP A;  2FMC A;  4R4C A;  4RCN A;  3ULL A;  1G6P A;  4GOP B;  4QJF A;  2FMM A;  4DR6 L;  4RA8 A;  3VYT A;  1KIX A;  2IPK D;  4YWL A;  1VCI A;  3NE5 B;  1VQL A;  4NXM L;  3PCO B;  1E0B A;  1SFO B;  5IWA L;  2JA7 G;  1SNO A;  3S16 B;  4J6H A;  2RDF A;  1LTR D;  3C1F A;  3NTH A;  1EWI A;  4A3G G;  2EY1 A;  5M5Y H;  4OL7 A;  4R8I A;  1J9O A;  4RHS A;  3K5M A;  2Q2H A;  4A93 H;  4BBS B;  4N8F A;  1WCM G;  2LSS A;  3GTO B;  4NXM Q;  2B2V C;  2EE1 A;  2VQE Q;  4I7A A;  1VQ7 A;  5JJZ A;  2F0I A;  2F0W A;  2K1B A;  4A3C G;  5D3D A;  1HUN A;  3S2D H;  3KYH C;  1UE7 A;  1KNE A;  1SRU A;  1X55 A;  4LFA L;  4G7H C;  2AHO B;  2ASB A;  1YNN D;  2R3Z A;  3PO2 H;  2HCC A;  2MJ8 A;  4GN5 A;  4HSP A;  3S14 B;  1XMQ L;  1M8A A;  4NDX A;  4UAI A;  3J7A V;  1NY4 A;  1EQQ A;  4LF4 L;  4C3J B;  1EFW A;  3BDO A;  4DV3 Q;  2RSO A;  2EXD A;  1BXT A;  2VUM G;  2Y0S G;  1VQ8 A;  4KHZ A;  2OCE A;  5I2X A;  1TWG B;  4CKE A;  3TEH B;  3S15 B;  2GVB A;  3MAQ A;  3M3Y H;  1EY8 A;  2B29 A;  2EYO A;  2D0O A;  4JI0 L;  5KNB A;  5JAV A;  3ND8 A;  4X6A H;  2BH8 A;  3QIA A;  3UE1 A;  4WJ3 M;  1L2F A;  4KMU C;  1X54 A;  3JAM L;  4AYB G;  2VQF L;  1Y14 B;  3K5O A;  1LT4 D;  3HGB A;  2DY8 A;  4UDU C;  3CCM A;  1IBL Q;  2F0F A;  1Z47 A;  3PF4 A;  1KHI A;  4FDB A;  4UP8 A;  3I8Z A;  4BY1 H;  3SVM A;  3OWF A;  4PZ6 A;  2A8V A;  1Q90 A;  3MEF A;  1S3O A;  3KDF A;  4OON A;  1ZXT A;  3KOJ A;  1SNM A;  1LTA D;  4DFA A;  2PO4 A;  1C0A A;  3SDZ A;  4B3R Q;  4DAY B;  4YWK A;  2P5Z X;  1PFS A;  4FXG C;  1BUV T;  2UUB L;  5LMN Q;  2VQF Q;  2E76 C;  2YU9 H;  1RL2 A;  4DXF A;  4DGZ A;  3K0X A;  4LFB L;  5CC4 A;  2B2U A;  2HCI A;  2N55 A;  1PXU A;  2IJ0 A;  4KV6 A;  1VMP A;  3RR5 A;  1K28 A;  4M8A A;  2WV6 D;  2V1C C;  2EYH A;  5M3F B;  2WB1 B;  2UXC Q;  3UDI A;  3PQI A;  3RMH A;  1I3Q B;  1PDQ A;  1XYI A;  2R92 G;  1WTR A;  5CR3 A;  4ZUJ A;  1AZQ A;  1X3E A;  4C3H G;  4QL5 A;  2XRS D;  4B9X A;  3VYR A;  4C3I B;  4ZQ3 A;  1Q86 C;  1JB3 A;  4C2M H;  2JA6 G;  5IT9 E;  3R2T A;  1LO5 D;  1STY A;  2B63 G;  2HDL A;  1SXT A;  4DV5 L;  2CQA A;  1O7Y A;  3J80 E;  1VQM A;  3N6R A;  4BWG B;  4F87 A;  4K0K Q;  1VF5 C;  4R4I A;  5IP9 G;  3TP6 A;  3CC2 A;  3BYY B;  1KRS A;  4JI4 Q;  2Z6B A;  5LMU L;  3G6J B;  2WAQ G;  3L7Z C;  4C1N K;  4DV2 Q;  3HOY H;  2OTJ A;  3QO2 A;  3TN2 A;  1ROD A;  4KKT A;  4MNO A;  2KCC A;  3URY A;  4A3E G;  5JJI A;  1IYU A;  2K50 A;  1WVL A;  1EL0 A;  1V1Q A;  1T5E A;  4P73 A;  3TS2 A;  1A2T A;  3HOX G;  3NQT A;  1Q8I A;  1A62 A;  3EBE A;  5BN3 A;  3S2D B;  3DUZ A;  4X64 L;  3HKZ E;  2F0L A;  3I3C A;  2JEB I;  5ELO A;  3DM3 A;  2JK8 A;  3G48 A;  1XMO L;  1MKH A;  2QGQ A;  5ELC A;  4A3I G;  1E22 A;  4Y52 H;  1A6X A;  1YNN C;  4A3M G;  3I4L A;  4IAL A;  2A6H D;  3GV3 A;  4JI1 Q;  3GP7 A;  2L1B A;  4X66 L;  2WB1 G;  5C4J H;  3M4P A;  2R93 G;  5M3M G;  4JYA L;  3I7F A;  3S16 H;  1Q3L A;  3IAY A;  2K32 A;  4UP7 A;  3M3Y B;  3EA6 A;  1VQG A;  3BDC A;  2XTI A;  4K8J A;  2ZXP A;  1D6E C;  5JEA G;  3CF5 A;  1K3B C;  4P2C B;  2DGY A;  1CUK A;  4O1N A;  1X3Q A;  3RD4 A;  2FIN B;  2K7V A;  2NZO A;  3PV0 A;  2M9V A;  1QNU A;  2BA1 A;  2JA9 A;  4NKL A;  3MXG A;  4GN3 B;  3T4A C;  2VUM H;  3NTK A;  1DOK A;  5M5X B;  1X3G A;  3U50 C;  2K5D A;  1XJV A;  4JI5 L;  3CAM A;  1RDP D;  3N52 A;  2KBN A;  3A56 A;  4APV A;  5AJ3 L;  4LW1 A;  4C3I H;  4KHP L;  2EY5 A;  1PLF A;  3H0G H;  4K6L A;  4HJ9 A;  3G7L A;  1IXR A;  5FO7 B;  5C5L A;  3SXH A;  1IBM L;  1Z6H A;  5FO8 B;  1U4M A;  1B53 A;  1Q82 C;  4K14 A;  5HUR A;  4DAY A;  4FXK C;  4IJL A;  3K6O A;  4GN4 B;  1LUZ A;  1H9S A;  1W6K A;  4DR2 Q;  3J81 E;  3BZD B;  2JA8 G;  2KUM A;  3GTM H;  1K8M A;  3KBX A;  1EYC A;  2J0T D;  3CCE A;  2ZTE A;  4GS3 A;  2Q2I A;  4ME5 A;  3F2D A;  1SAP A;  1M4V A;  4IUV A;  1C48 A;  4OIJ A;  1P8L A;  2DY7 A;  1TWH H;  3ZJY C;  2F0E A;  1PFB A;  4YY3 Q;  2F0Q A;  5CBE E;  1B8A A;  1OXU A;  4XDX A;  4YWM A;  1UWV A;  2I0Q A;  5FLX E;  2FFK B;  4ZK9 B;  1ILP A;  4LAA A;  1MJC A;  1XNR Q;  1FGB D;  1SR3 A;  3AB9 A;  1I4P A;  4RMF A;  3KJO A;  1GHK A;  4CDD C;  2ZJP A;  1FNW A;  2EYJ A;  3DWP A;  2F0T A;  3H91 A;  1HA6 A;  3NWS A;  4A3J B;  4IFD G;  1DXM A;  1PRT B;  4ALP A;  2K52 A;  5IYD H;  1QNK A;  4GNX A;  1N34 L;  3VR2 A;  3L2P A;  1AH9 A;  1TQO A;  4BY7 G;  2NN6 G;  1LT5 D;  2KHS A;  2QW7 A;  4DV1 L;  4ID6 A;  1T9H A;  1F2L A;  5IT9 L;  1HZC A;  4C3H H;  3GTJ B;  3LGJ A;  3T1Y Q;  5ISR A;  1XNR L;  1X6O A;  3PUZ A;  4YHH L;  1NAP A;  4QGU A;  3I4N G;  4A3C H;  2B63 H;  4OIK A;  4XYO A;  3NBI A;  2KJX A;  1CA5 A;  3CQZ B;  3HOV B;  3D4R A;  1JB7 A;  1KC8 C;  1ENF A;  4MN3 A;  1O78 A;  4LFA Q;  3T1Y L;  4UY8 C;  2F3V A;  1I94 L;  3OW7 A;  4XT1 B;  3D6W A;  1XNQ Q;  2JA8 B;  2RA4 A;  1A8V A;  5EPJ A;  3KBG A;  4A3E H;  5KEE A;  2F0U A;  3DEP A;  1SE2 A;  3RN2 A;  1TT2 A;  4DR4 L;  2D0P A;  2EJM A;  5C4X G;  1Y8N B;  2AUK A;  4HR7 B;  5IGC A;  3FPP A;  2KCN A;  3I90 A;  4PZ7 A;  3A8J E;  5FLM H;  3I55 A;  1LLR D;  4NB3 A;  3A55 A;  3PUW A;  4A4I A;  4BBS H;  4A75 A;  4A93 B;  1N36 Q;  1SNC A;  5CV5 A;  5EKL A;  3VYS A;  3CD6 A;  4LUZ A;  1D8L A;  4DNT B;  5A35 A;  4KD4 A;  3RZO B;  2ICE C;  5EPL A;  3LWU A;  2KEN A;  2H1E A;  1L0W A;  4H7B A;  1UNS A;  2IWH A;  5K5P A;  3EIV A;  3HKZ G;  3MFG A;  4JC0 A;  1HTL D;  4U68 A;  4X62 L;  1YJ9 A;  2B63 B;  3J81 L;  3L0O A;  1SYB A;  1JOQ A;  3K81 C;  2RHQ B;  1G8Z D;  2AKW B;  1CA6 A;  2VQE L;  4HIK A;  1MHW C;  2VZA A;  1GXD C;  3KLR A;  1KDC A;  4JV5 L;  4GLX A;  1ZYR D;  1KD1 C;  1TWA H;  3S2H H;  2R7Z H;  4JI8 L;  1HH2 P;  3UDF A;  2WAQ B;  4JI6 Q;  1SE8 A;  3JAM c;  3DMU A;  2SOB A;  1DON A;  2UUC Q;  4CKC A;  3TZU A;  1G91 A;  1BVS A;  3NBH B;  4B3T Q;  4BXX H;  3AYH B;  3PSI A;  1EIH A;  4LF8 L;  1LT6 D;  1PH7 A;  2IL8 A;  4DK0 A;  2JA5 G;  5IE8 A;  2E74 C;  2CW0 D;  4UHV A;  2Q8I B;  1GD7 A;  4A3G B;  1SMX A;  1FNV A;  4OX9 Q;  2R92 H;  2O4X A;  1D5M C;  1ET6 A;  1Y8P B;  1VQ5 A;  1BBX C;  1DM0 B;  2AQ1 B;  1QB5 D;  2WKC A;  2G9D A;  5IGG A;  3F2U A;  5C44 H;  1WCM B;  1BCP C;  3NTI A;  3W1G A;  3S1M B;  4LF7 Q;  3GTL B;  3F2C A;  1ZYR C;  1DYQ A;  3T51 B;  4K6D A;  3OMG A;  1OXV A;  4L5T A;  3M4O H;  1N32 Q;  2AMC B;  1FD7 D;  3X3N A;  1H9K A;  2BH2 A;  3D0F A;  1ZEQ X;  4DV5 Q;  3CRK C;  1VS0 A;  4B3M L;  1HJP A;  3S1R B;  5E4X A;  1JQY D;  1BKB A;  3SR1 A;  2E2H B;  3O13 A;  1PTO F;  1B9N A;  1GVP A;  4DV6 Q;  2EXZ A;  5LMU Q;  2CH4 W;  2RBM A;  5C5M A;  3CQZ H;  4QCL A;  1KAA A;  2QDL A;  4V19 0;  3PO3 B;  1Y1V H;  3I72 A;  4CJ0 B;  1YJN A;  4JI2 Q;  2A69 C;  3IKJ A;  4A3K H;  1JMC A;  4QUF A;  1STH A;  5EGT A;  4DR1 L;  4B3M Q;  4IFD I;  1WYD A;  4E6I A;  1QVF A;  4LFB Q;  5K36 H;  2ID0 A;  3SK8 A;  1GO3 E;  3CRL C;  2CHB D;  4A3I H;  3HOU B;  3HOW B;  4ULL A;  4X64 Q;  3BVM A;  2LFN A;  1JWM D;  1QUQ B;  3MZ5 A;  5C0X G;  1B70 B;  4HMI A;  2IX3 A;  1VQ4 A;  1VQ6 A;  2UXC L;  5GAH C;  3VDY A;  3I4N H;  2NTS A;  5IP7 G;  4OEM B;  2HT1 A;  2DNE A;  5E7N A;  2KCM A;  5HGT A;  1E7Z A;  4RGN A;  2XVS A;  1PZK D;  3UI2 A;  1D1K A;  5CBA E;  1ICF B;  2YV5 A;  1SSO A;  4PMW A;  3E9I A;  2L11 A;  1IZ6 A;  5I9P A;  3H3V I;  1Z7T A;  2C5C A;  2FHT A;  1Y8O B;  1WTH A;  1UEA B;  1TVX A;  1QVG A;  3VR5 A;  1I6H B;  2GN5 A;  1DZ1 A;  3P1H A;  3A5U A;  1ET9 A;  1LTL A;  3GTM B;  1S5C D;  1JOO A;  1JE5 A;  3PGZ A;  4RGM A;  2KHJ A;  4KY6 A;  1PRT D;  4DA2 A;  3IRB A;  3OHX C;  4WRD A;  1M90 C;  1WOC A;  3CC4 A;  2BA0 A;  4B3S Q;  4LUV A;  3R2I A;  1PTO C;  3C1E A;  4AYB B;  2SDF A;  1XXG A;  1X56 A;  4KD3 A;  3M7G A;  1G2S A;  1M1K C;  1I5F A;  5FKA C;  2RHS B;  2AWN A;  3TQY A;  4EQN A;  3H09 A;  4LF6 L;  1EU3 A;  3C2P A;  4KHP Q;  3U4V A;  3KK7 A;  2PYK A;  4K2L A;  2UU9 L;  2NZH A;  4IUT A;  3T16 A;  3I4O A;  3I91 A;  4DV4 Q;  1BCP D;  4JPB W;  3K7A B;  4KKU A;  2JN4 A;  5JJK A;  5C3E B;  4ZUI A;  4ZRZ A;  3HOW G;  4OXP A;  4H44 C;  2JA7 H;  5DAU A;  1EY4 A;  1K8A C;  1A3U A;  1YHB A;  4CKB A;  2PQA B;  4DK3 C;  4JI1 L;  1CM9 A;  2I5M X;  1FGU A;  4X66 Q;  2NVT H;  2F3I A;  4LF5 L;  4H02 A;  4HID A;  3ITP A;  1Y1W G;  2R7D A;  3NEN A;  1HR0 Q;  4DV4 L;  4DV0 Q;  2B2W C;  2NZ1 D;  3OTO L;  1IL2 A;  3HOX B;  1SN8 A;  1A0I A;  1EEF D;  4POG A;  1CTM A;  1CKN A;  3KLS X;  4P71 A;  5IYD G;  1AP0 A;  4BBS G;  1S5F D;  1PZJ D;  1GJX A;  2KEE A;  3PO2 G;  4R9W A;  1E1T A;  1JE4 A;  4ZAI A;  3S1Q B;  4QIW E;  4DV0 L;  1I4Q A;  3I56 A;  1C4Q A;  3HOY G;  1GUT A;  1SBB B;  4HCS A;  4FXD A;  4RH6 A;  4P75 A;  4GOP C;  1LTG D;  4XQN A;  3CP0 A;  3CW2 C;  1IKL A;  5LL6 S;  3NXW A;  4V0B A;  1CI3 M;  1ICW A;  5T1G A;  5C4Z A;  4GOP A;  1JR0 D;  2JE6 I;  2OTL A;  2PQE A;  1STB A;  4F88 A;  1MJE A;  1FYC A;  2JJQ A;  4FF4 A;  3PF5 A;  3D6C A;  5NUC A;  4X3U A;  4JBK A;  2VXW A;  3K7A H;  4UP9 A;  4QQB X;  1SYC A;  1YNJ C;  2HQL A;  2YTY A;  1YEZ A;  2UUA Q;  1BDO A;  4DR2 L;  1NCV A;  3D8G A;  3OYY A;  3VA5 A;  1JWU D;  3FPU B;  2JA6 H;  3VR4 A;  4HMJ A;  1RTO A;  2KA7 A;  3QG1 A;  1G6Z A;  1Y1V G;  4DR7 L;  1XNQ L;  2A74 C;  4KHV A;  2ICI A;  1HNZ Q;  2ZTD A;  1UE5 A;  5C4X B;  4RGO S;  1JCK B;  2D9U A;  2WIN B;  1GUG A;  4DR4 Q;  5KRU A;  4G7O C;  4NP5 A;  4GKJ L;  2UUA L;  1BQQ T;  5C3W A;  1B44 D;  3U4Z A;  4X3S A;  1ESR A;  5JEA H;  3RLF A;  1F2M A;  4K5V A;  2VNU D;  2DUD A;  2ZTC A;  1K73 C;  3QB3 A;  1PZI D;  2N78 A;  1I6H H;  1N36 L;  3S17 B;  1IYJ B;  3DHQ A;  3PO2 B;  5M5W H;  1STN A;  1W3S A;  3TME A;  2FXQ A;  1F2Y A;  5CMD A;  4GNX C;  2NVQ H;  4IUN A;  5M9O A;  2O2L D;  4HAE A;  3VR6 A;  1VQK A;  2F3W A;  5E4W C;  2OQK A;  5EBC A;  1C7Y A;  4J8Q A;  2K01 A;  4KY7 A;  4PNY A;  5C44 B;  3CMA A;  2YU9 B;  4WOR A;  4KY5 A;  2PW7 A;  2B2Y C;  4N9P A;  5GAG C;  1YJW A;  1PYB A;  1HHV A;  5CV8 A;  5M5Y B;  5IOC A;  2CH4 A;  2BE5 C;  4A3M H;  1G51 A;  1O7I A;  5ELF A;  3M7N A;  4JI8 Q;  1BCP B;  3PO3 G;  3OPO A;  2AQ2 B;  2UXD Q;  1A15 A;  4ZKC B;  1EQR A;  3G71 A;  3K59 A;  4MTN A;  2EY2 A;  3TDQ A;  1YNJ D;  4PZ8 A;  4UPA A;  2JQO A;  3SK6 A;  4RCO A;  3CXC A;  4X3T A;  3VYU A;  3I70 A;  3TBI B;  4OWX B;  2L55 A;  4IOC A;  1Y1V B;  3TP5 A;  1V8Q A;  2QKI C;  3R93 A;  5ELB A;  3W2D A;  1W6J A;  4K5W A;  4GLV B;  1EFI D;  2PQA A;  1BCP F;  2CKZ B;  2PI2 A;  2WFW A;  1F9R A;  1XX8 A;  3J7A 5;  3I4N B;  3UDX A;  4IPH A;  1I50 B;  3F1Z A;  4KI0 A;  3E0E A;  1VQN A;  1IL8 A;  2EJG C;  1H9J A;  1CKM A;  3K5L A;  1WTO A;  3TRE A;  5C6A A;  3H0G G;  1QG7 A;  5JJL A;  2F0D A;  3E3X A;  4RKL A;  3L9A X;  3A54 A;  4MHE A;  5FO9 B;  2BE5 D;  2E2I B;  2GA4 B;  2PMZ E;  4A3J G;  3J80 i;  2IX1 A;  1YZ6 A;  3U9O A;  3AU7 A;  2EYP A;  1TR5 A;  1B50 A;  1FJG L;  1NR4 A;  1IW7 C;  4DV6 L;  1BBU A;  3TRZ A;  3SHL A;  2D5D A;  1K8G A;  4OO1 H;  3KF6 B;  1TS4 A;  3VR3 A;  4JI2 L;  4JI6 L;  3GTO H;  3BDL A;  3C46 A;  4FF2 A;  3A74 A;  5IT9 c;  1C8C A;  1FVI A;  5C0X J;  4I7Z C;  3HS0 C;  3SK4 A;  3GV6 A;  4DR1 Q;  2R93 B;  1HXY D;  3FHW A;  2F0O A;  1Q12 A;  1MIU A;  4FO2 A;  1IBK L;  1FJG Q;  3PUV A;  1TXY A;  1TWC H;  4JG2 A;  4QUC A;  3S2H B;  2A68 C;  2D2C C;  1B1Z A;  1KAW A;  4RWS C;  4OWW B;  1PH1 A;  1EU4 A;  3HOZ B;  1U4R A;  1GOZ A;  1SMY C;  3F8T A;  1NUC A;  4BY7 H;  3BU2 A;  4RFB A;  2A1A A;  1Y1W H;  3AFQ A;  2BCO A;  4JBM A;  4X65 L;  3MXN B;  3H3V C;  2AWO A;  5IY0 A;  1HQR D;  1D2B A;  2XN9 C;  3BZK A;  1Y1W B;  1SJH D;  1STG A;  2XIW A;  1GKH A;  3X3M A;  1ML0 D;  2PNR C;  3MA2 B;  4R1J A;  2J4X A;  3EN2 A;  1PH8 A;  1LTI D;  1IYV A;  2E8G A;  2N8N A;  3E6Z X;  3Q6S A;  4PG3 A;  1TWC B;  5JVH 3;  1L0Y B;  3HKZ B;  1RKN A;  2HUG A;  3OWE B;  3K80 C;  4PQX A;  1CQV A;  1PH2 A;  3FDT A;  3J81 i;  2OF1 A;  3PIP A;  3PUX A;  4LF6 Q;  3UDG A;  2K28 A;  1Q8K A;  4RHR A;  4DR3 Q;  2MFI A;  4CJ2 C;  4OGQ C;  1X65 A;  3M85 A;  4IFD H;  2XGT A;  3EFX D;  1HNX L;  4YIJ A;  1AE2 A;  2HQE A;  3AFP A;  1D5Z C;  4GZY C;  1B3Q A;  2Q8T A;  1MSG A;  2B8G A;  3STB C;  5C4X H;  2QCP X;  2ZT9 C;  2KED A;  2B2U C;  2WB1 E;  4PMC A;  1YIJ A;  4JVZ A;  1U4P A;  4NMZ A;  2E5L Q;  2HHH Q;  2A69 D;  1CK1 A;  1DD2 A;  1D7Q A;  1BOS A;  1RJT A;  4LF5 Q;  2DJF C;  3CCQ A;  1PMR A;  1DGS A;  1NE3 A;  2F0V A;  1EIY B;  4PMB A;  1Q7Y C;  1C9O A;  2L12 A;  2RKS A;  2Z9H A;  4DXG A;  3S17 H;  3OIQ A;  1WTX A;  1QVC A;  2LXK A;  3ERO A;  4KN4 C;  1LTS D;  3H3V H;  3MTS A;  3KUP A;  3I4M H;  2R6G A;  2A73 B;  1I4G A;  2CQO A;  1VDZ A;  2F0M A;  1E1O A;  4JYA Q;  4HJA A;  5FJ8 H;  1XPR A;  1GUS A;  3PMF A;  5JPN C;  1Y69 U;  5GQO A;  1PHJ A;  4IFD J;  4YCU A;  4JOI C;  4ZCK A;  1KLU D;  4QIW B;  1HZ9 A;  2N3S A;  5A2Q E;  3AMU A;  3STB D;  4A3K G;  2VY3 A;  1L1O B;  1LTB D;  3MC0 B;  3GTK B;  1PTO H;  5ELN A;  1JOR A;  4NW2 A;  1LYL A;  4DPG A;  1CQF A;  1J8I A;  1SJE D;  5BR8 Q;  2ENB A;  3KJP A;  5FK9 C;  5C44 G;  3NWT A;  2FJ2 A;  4CJ1 B;  4F7X A;  2R61 A;  3H94 A;  3HFZ B;  4A3J H;  2R7F A;  4DUY Q;  2L5T A;  3QR8 A;  2RF4 A;  3GQB A;  4J1M A;  5C0X H;  1RD9 D;  2Z0S A;  5I9O A;  1PRT C;  1OXT A;  2CVR A;  2K04 A;  2KQ3 A;  4A3D B;  1YVC A;  2Z6K A;  3DEO A;  2NVQ B;  1LTT D;  1D1I A;  3PUY A;  2YTV A;  1TWH B;  4Q0F A;  3T1H L;  4DU9 A;  4GKK L;  1TS2 A;  5FLX c;  2H4O A;  1WD1 A;  3OTO Q;  3H6M A;  1OO9 B;  5ELE A;  4DAV A;  1XTD A;  4EQ5 A;  5I2Y A;  3P75 A;  4HED A;  1VQE A;  3T56 B;  4ZLT F;  3J81 j;  1JJC B;  3T13 A;  1BR9 A;  1O80 A;  1U0L A;  1Z9F A;  3JAM E;  2NBF A;  1KTK A;  3BYT B;  3J81 c;  1VQP A;  5C0X I;  1VQA A;  1HPC A;  4BXX G;  4IOA A;  1SYE A;  1A63 A;  2VL6 A;  3QOL A;  2F0K A;  5JVG 3;  2C9O A;  2B2T A;  2WP8 J;  1CSP A;  1E2Z A;  2OXP A;  3RZD H;  2LY7 A;  3GTJ H;  1QZG A;  1OXX K;  2TMP A;  1Q81 C;  4A3M B;  5K36 G;  2F0G A;  2WAC A;  5EJW A;  1NJI C;  2RCN A;  5IP7 H;  1N33 Q;  5M3F H;  3WDN A;  1VQI A;  3GTP H;  5GAE C;  2B8F A;  1EYD A;  4C3J G;  4R8N A;  1K3R A;  4ODG A;  4ZKB B;  3G4S A;  1EIG A;  4G7Z C;  2LS0 1;  1QUQ A;  5JEA J;  1TS3 A;  4OEL B;  4OHJ A;  4A3D H;  2MP1 A;  1RF2 D;  3FKI H;  3MXU A;  1DCZ A;  4EQO A;  1S5B D;  4S3S A;  4XIG S;  3J7A F;  4DR7 Q;  2ES2 A;  2EDG A;  3IL8 A;  4G57 A;  1HQM C;  2SNM A;  1EWH A;  3A0J A;  2IY5 B;  4KK7 A;  3WOE A;  3EJI A;  1HNW L;  3A7L A;  4K5X A;  3V2T A;  3S1Q H;  3HP3 A;  2F0N A;  5J22 A;  1JOK A;  1IW7 D;  1SND A;  1DOM A;  3CCR A;  2F52 A;  1D5X C;  5H1S E;  2WKD A;  5KIX A;  2XSC A;  4KN7 C;  3NBH A;  1YHQ A;  1SNQ A;  1R4P B;  3RUZ A;  2F0J A;  2K05 A;  4EVO A;  3K57 A;  4IN3 A;  2KCT A;  1NMG A;  1BBW A;  4K8I A;  4TSS A;  2ZM6 Q;  1J6Q A;  4K2K A;  4C1N I;  4ZYS A;  3FP9 A;  2MNA A;  1AFP A;  3S15 H;  1F9P A;  4RGT A;  1VQO A;  3CC7 A;  4LF9 L;  2JYO A;  1ZKO A;  1WI5 A;  3P7J A;  5C3E H;  2HD3 A;  3HOY B;  3MVV A;  2Z6K C;  4HCE A;  3HOW H;  5L37 A;  1CT1 D;  2SNS A;  1NBW A;  1QJO A;  3NP8 A;  4ABN A;  1PFN A;  4CBV A;  2LMC B;  4TRD A;  2ZM6 L;  2QEX A;  1SNP A;  5CV7 A;  1AEX A;  1AN8 A;  2AQ3 B;  1GUN A;  2UXB Q;  3QOJ A;  1B4O A;  4X62 Q;  1XPO A;  1CZG A;  4LF9 Q;  3E9H A;  4A3F B;  1JJ2 A;  2Z1C A;  1NNX A;  1SLJ A;  2X6L A;  2JA6 B;  1L1O C;  1VF7 A;  1A2U A;  4KJO A;  1KRT A;  3HOZ G;  1SDF A;  2MO1 A;  1OTC A;  4DV3 L;  1RIP A;  3D4D A;  1VQB A;  2BDN A;  2RVL A;  1BF4 A;  1PH5 A;  1F9S A;  1J5E Q;  4DNI A;  2ZXO A;  5LHY 1;  2XWJ B;  4R4O A;  1HR0 W;  4B3T L;  4F8M A;  4LF8 Q;  1GUW A;  3MXP A;  1S40 A;  4X65 Q;  1TY2 A;  2DN8 A;  5EKI A;  4EX5 A;  1CSQ A;  1VQJ A;  4HN7 A;  3KF8 A;  2EYM A;  3G6E A;  2A19 A;  5IP9 H;  1JWS D;  3KF8 B;  3K0Y A;  1AZP A;  1TS5 A;  3HOV G;  4L8J A;  3R3O A;  1MI2 A;  1A3V A;  4O42 A;  2G5D A;  1WTV A;  3GTP B;  1XTC D;  4L6T B;  5CYU A;  1I4X A;  2MGS A;  2CCZ A;  4WFN 3;  5CV9 A;  1PH3 A;  4LF7 L;  1PRT F;  1PTO B;  2B3G A;  4QMG A;  4A3I B;  3IFT A;  1YBY A;  5AFW A;  4BY1 B;  2E2D C;  2K6A A;  1R9T B;  1G29 1;  2XNA C;  3NEL A;  1TU2 B;  4OO1 I;  3OMC A;  2OWO A;  1HFN A;  4JK1 C;  2Y0S E;  1HA5 A;  4ME3 A;  5COR A;  1N9W A;  2X69 A;  1O7Z A;  3I2Z A;  3OSO A;  4A3B B;  4DR3 L;  1N8R C;  2CFM A;  2NVT B;  1EZ6 A;  5GRO A;  1HNX Q;  2RQX A;  4LNQ A;  1E2V A;  2YTX A;  2Y0S B;  3Q24 A;  2JA7 B;  2E2J H;  2R93 H;  1VQF A;  1LAB A;  1RTN A;  4LMQ D;  1P16 A;  2A6E D;  2F0H A;  2NN6 I;  3QJY A;  5IGF A;  2HHH L;  4C3J H;  1V1P A;  1KQS A;  1V1P B;  2HDM A;  1TY0 A;  3S1M H;  3OOC A;  1E3P A;  2MPM A;  4DV7 L;  4XXE A;  5KND A;  2L4N A;  2DNC A;  2MUY A;  3ERQ A;  1EY0 A;  1WTW A;  1EOV A;  3CCL A;  4JI4 L;  2KOL A;  2IW3 A;  1CFM A;  5LL6 X;  1PH6 A;  2V4D A;  4Y7N B;  1EYG A;  3FMC A;  4NXN L;  1A3T A;  4QF4 A;  3GTK H;  3CKI B;  4DV2 L;  3ICE A;  3ULJ A;  1EQT A;  3K58 A;  4XQJ A;  1QCB D;  1I6V C;  2B2V A;  5BN4 A;  1U4L A;  1FR3 A;  4DV7 Q;  4R4Q A;  4O2D A;  2H5X A;  2BDO A;  3LWE A;  2K5H A;  5KNC A;  4JI3 Q;  4XQQ A;  2R7Z B;  2RSN A;  5ELD A;  2K5W A;  4JBJ A;  3HRZ C;  2K5Q A;  2IT1 A;  3KLW A;  1UUP A;  2IHE A;  1F77 A;  4YCV A;  2K5V A;  2GVA A;  3TP7 A;  4DN4 M;  1XMO Q;  2F1M A;  3UE0 A;  4GLA C;  1F9Q A;  2F0P A;  4A3D G;  3QWN A;  1VQH A;  2L9H A;  5KYL A;  5BN5 A;  1I4R A;  2E5L L;  1B3A A;  4FP5 D;  1EY6 A;  4MTK A;  4AIM A;  4C3H B;  1X9N A;  2D62 A;  3ND9 A;  4G4K A;  4WJ4 A;  1QE6 A;  2NUC A;  4O0A A;  4KJN A;  1IKM A;  4CHT B;  4BBR H;  3KLS A;  4YCW A;  3C3L A;  1E24 A;  4PV1 C;  4BY7 B;  3J7Y W;  3HG9 A;  1KLG D;  1EIF A;  4AQY Q;  1HZA A;  3AEV A;  3HKS A;  4L5R C;  3PO3 H;  1GHJ A;  4HIM A;  3HEJ A;  1DOL A;  2B2W A;  1CKN B;  1EOT A;  1YIT A;  4JI7 L;  2A6H C;  2XRQ D;  1JT8 A;  2Z8L A;  3DWA A;  3CCV A;  4AYB E;  5M5W B;  1HR0 L;  5DM6 3;  1TKW B;  1NSN S;  3HOU G;  3K7U C;  5IYB G;  4HJ7 A;  3TZD A;  3ZYY X;  4IUR A;  1FNU A;  3W5O A;  4BBR B;  1ENC A;  1CHP D;  4DK1 A;  4AQY L;  4X3K A;  4HTH A;  1HCZ A;  5M3F G;  4J15 A;  1KL9 A;  1TWA B;  3NUC A;  4L63 B;  3OW2 A;  3OIP A;  2CWP A;  4JI7 Q;  4LFC L;  1VQC A;  2XWB B;  3I73 A;  5BR8 L;  4NPS A;  1IBM Q;  1MGS A;  3A8I E;  2QIL A;  4BS9 A;  2NVY H;  2Q2T A;  2E2I H;  2HIX A;  5I6W A;  1I4H A;  2QA4 A;  4CDC C;  3DXJ C;  5TSS A;  4A3G H;  1K8O A;  3S9W A;  3CME A;  3KFU A;  5IGD A;  2VB3 X;  4LK1 C;  5LMN W;  3RZO H;  5I4D A;  4LFC Q;  2B2Y A;  2EYL A;  3VA7 A;  2EZV A;  2MHV A;  5DNF A;  3V96 A;  2L15 A;  4BA1 I;  1HNW Q;  3MXN A;  2N88 A;  4YY3 L;  2NWG A;  5FLM G;  4OO1 G;  4A3L H;  2PNH A;  5C4H A;  1K83 H;  2B39 A;  4I65 A;  4TKO B;  2MQH A;  2K14 A;  4DK6 C;  2JXM B;  1RHP A;  2M00 A;  1S4Z A;  1PA6 A;  1HNZ L;  5T1I A;  4QY7 A;  1VMC A;  2JP1 A;  5C3X A;  2PW5 A;  2RDG A;  4EGV A;  2EYF A;  5IOD A;  2NVX B;  3M9B A;  5COY A;  4DV1 Q;  1NMF A;  4GKJ Q;  1BO0 A;  4IUU A;  2F4V L;  3Q23 A;  2QF7 A;  4YHH Q;  3IFD A;  3F2B A;  4P74 A;  4WJW A;  2YYZ A;  1N33 L;  4A3F H;  4IQZ A;  3ERS X;  1PTO D;  3LNN A;  2B2T C;  1GM5 A;  1JJG A;  2EJF C;  1II3 A;  5IWA Q;  2IHF A;  3J80 L;  2CW0 C;  2G9H D;  3ULP A;  3H0G B;  1K9M C;  1H9S B;  3NHH A;  3P20 A;  2KHI A;  3SEB A;  3SGI A;  2VS1 A;  1I94 Q;  4A3B H;  3BZC A;  3DWQ A;  2UXB L;  1SEB D;  3ONA B;  5M3M H;  1YHA A;  3TS0 A;  4XT3 B;  5M5X H;  1I50 H;  3L3O C;  1QWY A;  3JAM i;  2EIF A;  2MO0 A;  3KF6 A;  3BJU A;  5D3I B;  5EPK A;  3I4M G;  2I07 B;  1Q46 A;  1STE A;  2UXD L;  3BS1 A;  1S72 A;  5G3L D;  4N8X 1;  3W1B A;  3SK5 A;  1KXL A;  1KNA A;  1XMQ Q;  2QDB A;  3ER0 A;  4XYQ A;  4DAP A;  2VB2 X;  1PVO A;  4LF4 Q;  4C56 C;  4C3I G;  3Q0A A;  1PH4 A;  1JIC A;  2HIV A;  1LAC A;  3WWV A;  3K5N A;  2ALY B;  3S1N B;  5EAY A;  5J1Z A;  1UE1 A;  1IHZ A;  5FLX L;  1W2B A;  4JI0 Q;  3FRP B;  2VW9 A;  4JOI A;  2NYZ D;  5IIF A;  3K8A A;  4JV5 Q;  1EY7 A;  3FKI B;  3DLL A;  1G2T A;  1TWF B;  1MBY A;  1V1O A;  3BVG A;  5IYC G;  1UEB A;  1V9P A;  5JOB A;  3FEW X;  4N9T A;  2UUC L;  1OXS C;  3M4Q A;  2QEJ C;  4DF7 A;  1HTP A;  5G3L F;  1IBL L;  3FVQ A;  5J3B A;  1HRJ A;  5HY6 A;  1MD2 D;  1QIL A;  1U5K A;  3M4Y A;  3NEM A;  5D14 A;  3W3A A;  2K75 A;  2PZW A;  4BA2 I;  1STA A;  3D31 A;  1XPU A;  1EQV A;  2ZJQ A;  4RAU C;  4OX9 L;  2PPB C;  4B3R L;  3GTQ B;  1UE6 A;  1B9M A;  3HOX H;  1WJJ A;  2X6G A;  1YI2 A;  1LM0 A;  1TII D;  1PYW D;  5LMN L;  4IUP A;  1VQ9 A;  1J5E L;  2EY6 A;  1EEI D;  4IPG A;  4KTA A;  3MFY A;  4RKB A;  5EKK A;  4FNF A;  4KKS A;  1IBK Q;  1H9M A;  3NSW A;  1S5D D;  3RLN A;  2O5I C;  5IGE A;  1JC7 A;  5C4J B;  1ESF A;  1N32 L;  3LX0 A;  2WAQ E;  3D3R A;  3Q22 A;  4HIO A;  3GTG H;  1SMY D;  3EVQ A;  4LUO A;  3H15 A;  2PI2 E;  4FVM A;  1SYD A;  3S1N H;  1LV9 A;  3GTQ H;  1L0X B;  4P72 A;  4CDF C;  4B08 A;  4A3L G;  1PH9 A;  2ATW A;  3M4O B;  1B7Y B;  1KDA A;  4RG1 A;  2A68 D;  4IPC A;  5C3E G;  3U58 A;  4AH6 A;  4HJ8 A;  1NR2 A;  3CPF A;  3GTL H;  3PIO A;  5EBD A;  4IO9 A;  1U9R A;  5F2D A;  1ILQ A;  5JPM C;  3FKI G;  4JBW A;  3CCU A;  3PIP 3;  5E1F A;  4JI3 L;  5CV6 A;  3AQQ A;  1EYA A;  3GO5 A;  1TWF H;  1SE4 A;  4GNX B;  2OQ0 A;  3MWY W;  2ZJR A;  4FYD A;  4A93 G;  1K83 B;  2AUJ D;  2N49 A;  4TVA B;  3R8B A;  5EQ0 A;  1PYS B; 
#chains in the Genus database with same CATH homology
 2OT2 A;  1XWE A;  1QOH A;  1EY5 A;  2M2L A;  3CHB D;  2F03 A;  3GTG B;  3PIO 3;  2I46 A;  2J7Z A;  1R4Q B;  4TQU S;  4A3K B;  1PFM A;  4MIU A;  4QB4 A;  1WD0 A;  2NN6 H;  2EPB A;  2OEO A;  2O5J C;  2PZU A;  3RZD B;  2IX0 A;  4Z9C B;  1O7L A;  1SYG A;  4ILW A;  2NTT A;  1CHQ D;  2BOS A;  1SE3 A;  4FF3 A;  1EY9 A;  3E5S A;  3HZX A;  1X32 A;  2PMZ B;  4IZ8 A;  2PZT A;  1ONL A;  2SEB D;  2ZXR A;  2A6E C;  4C2M B;  1SYF A;  2L0C A;  3SE0 A;  1HFG A;  1KAB A;  3MEH A;  2F4I A;  1BNZ A;  5DEH A;  4FF1 A;  3NK9 A;  1GUO A;  1EWC A;  3E0J A;  4CGY B;  1HUM A;  1UAP A;  2TSS A;  4H13 C;  4HSV A;  3GD7 A;  5FOB B;  3A7A B;  5KYI A;  1S5E D;  3T53 B;  1WTQ A;  2PCF B;  1V43 A;  4Q5V A;  3BVZ A;  5J39 A;  2JEA I;  2R92 B;  1CZW A;  2JSO A;  4IUQ A;  1EZ8 A;  2F0S A;  3I4M B;  2K03 A;  1AW7 A;  4H0L C;  2KVM A;  5CV4 A;  3V05 A;  5M3M B;  2E75 C;  2A5H A;  1MSH A;  1E2W A;  2NVY B;  3DM1 A;  1H9R A;  4A3E B;  1DJR D;  1Q1B A;  4U67 3;  5A2Q L;  5I6Y A;  2Q8R E;  3BG3 A;  4LJZ C;  2K33 A;  4DNR B;  1LT3 D;  3TP8 A;  3CU7 A;  5D65 A;  2EOT A;  3U9S A;  2E2J B;  1ENA A;  1WTP A;  2KEC A;  2JA5 B;  5IGB A;  2Z4H A;  1KDB A;  2WII B;  5E3F A;  5CGK A;  4XTC S;  5KGU A;  5DM7 3;  3WOF A;  1Q1E A;  1B2T A;  3MHB A;  4M1U B;  2LKV A;  2Z4I A;  2VUM B;  2NB0 A;  1RCV D;  2EVB A;  4EQP A;  1F2Z A;  2RDH A;  3A8K E;  3D4W A;  3EQL C;  1T5X D;  1X3P A;  3NQI A;  3TSS A;  3NPP A;  2FMC A;  4RCN A;  2FMM A;  4RA8 A;  3VYT A;  2IPK D;  1VCI A;  3NE5 B;  1E0B A;  1SFO B;  1SNO A;  3S16 B;  4J6H A;  2RDF A;  1LTR D;  3C1F A;  3NTH A;  2EY1 A;  4OL7 A;  4R8I A;  1J9O A;  4RHS A;  3K5M A;  4BBS B;  3GTO B;  2B2V C;  2EE1 A;  5JJZ A;  2F0I A;  2F0W A;  2K1B A;  1HUN A;  5D3D A;  1KNE A;  4G7H C;  1YNN D;  2R3Z A;  2HCC A;  2MJ8 A;  4HSP A;  3S14 B;  1M8A A;  4NDX A;  4UAI A;  3J7A V;  4C3J B;  3BDO A;  2RSO A;  1BXT A;  4KHZ A;  5I2X A;  1TWG B;  4CKE A;  3S15 B;  3MAQ A;  1EY8 A;  2EYO A;  5KNB A;  5JAV A;  3ND8 A;  3QIA A;  4KMU C;  3JAM L;  3K5O A;  1LT4 D;  3HGB A;  2DY8 A;  4UDU C;  2F0F A;  1Z47 A;  3I8Z A;  3SVM A;  3OWF A;  1Q90 A;  1ZXT A;  4DFA A;  1LTA D;  1SNM A;  2PO4 A;  3SDZ A;  4FXG C;  1BUV T;  2E76 C;  4DXF A;  4DGZ A;  5CC4 A;  2B2U A;  2HCI A;  2N55 A;  1PXU A;  2IJ0 A;  4KV6 A;  1VMP A;  4M8A A;  2WV6 D;  2EYH A;  5M3F B;  2WB1 B;  3RMH A;  1I3Q B;  1PDQ A;  1XYI A;  1WTR A;  5CR3 A;  4ZUJ A;  1AZQ A;  4C3H G;  2XRS D;  4B9X A;  3VYR A;  4C3I B;  4ZQ3 A;  1JB3 A;  5IT9 E;  3R2T A;  1LO5 D;  1STY A;  2HDL A;  1SXT A;  2CQA A;  1O7Y A;  3J80 E;  3N6R A;  4BWG B;  4F87 A;  1VF5 C;  3TP6 A;  3BYY B;  3G6J B;  3L7Z C;  4C1N K;  3QO2 A;  3TN2 A;  1ROD A;  4KKT A;  2KCC A;  3URY A;  1IYU A;  1EL0 A;  1WVL A;  1T5E A;  1A2T A;  3NQT A;  1Q8I A;  5BN3 A;  3S2D B;  3DUZ A;  2F0L A;  2JEB I;  3I3C A;  5ELC A;  1A6X A;  1YNN C;  3I4L A;  4IAL A;  2A6H D;  3GV3 A;  3GP7 A;  2L1B A;  1Q3L A;  3IAY A;  2K32 A;  3M3Y B;  3EA6 A;  3BDC A;  4K8J A;  2ZXP A;  1D6E C;  5JEA G;  4P2C B;  3RD4 A;  1X3Q A;  4O1N A;  2FIN B;  2K7V A;  3PV0 A;  2M9V A;  1QNU A;  2BA1 A;  4NKL A;  3MXG A;  3T4A C;  3NTK A;  1DOK A;  5M5X B;  2K5D A;  1RDP D;  3N52 A;  3A56 A;  2EY5 A;  1PLF A;  4K6L A;  3G7L A;  5FO7 B;  5C5L A;  3SXH A;  1Z6H A;  5FO8 B;  1U4M A;  1B53 A;  4K14 A;  5HUR A;  4DAY A;  4FXK C;  3K6O A;  1H9S A;  1W6K A;  3J81 E;  3BZD B;  2KUM A;  1K8M A;  3KBX A;  1EYC A;  2J0T D;  4ME5 A;  1SAP A;  1M4V A;  4IUV A;  1C48 A;  4OIJ A;  2DY7 A;  2F0E A;  1PFB A;  2F0Q A;  5CBE E;  1OXU A;  4XDX A;  5FLX E;  2FFK B;  4ZK9 B;  1ILP A;  4LAA A;  1FGB D;  3AB9 A;  1I4P A;  1GHK A;  1FNW A;  2EYJ A;  3DWP A;  2F0T A;  3H91 A;  1HA6 A;  3NWS A;  4A3J B;  4IFD G;  1DXM A;  1PRT B;  1QNK A;  3VR2 A;  1TQO A;  2NN6 G;  1LT5 D;  2KHS A;  4ID6 A;  1F2L A;  5IT9 L;  3GTJ B;  5ISR A;  3PUZ A;  1NAP A;  4OIK A;  4XYO A;  3NBI A;  2KJX A;  1CA5 A;  3CQZ B;  3HOV B;  3D4R A;  1ENF A;  4MN3 A;  1O78 A;  2F3V A;  3OW7 A;  4XT1 B;  3D6W A;  2JA8 B;  2RA4 A;  5EPJ A;  3KBG A;  5KEE A;  2F0U A;  3DEP A;  1SE2 A;  1TT2 A;  2EJM A;  1Y8N B;  2AUK A;  4HR7 B;  5IGC A;  3FPP A;  2KCN A;  3I90 A;  3A8J E;  1LLR D;  3A55 A;  3PUW A;  4A93 B;  1SNC A;  5CV5 A;  5EKL A;  3VYS A;  4DNT B;  5A35 A;  4KD4 A;  3RZO B;  2ICE C;  5EPL A;  3LWU A;  2H1E A;  4H7B A;  1UNS A;  2IWH A;  5K5P A;  3MFG A;  1HTL D;  4U68 A;  2B63 B;  3J81 L;  1SYB A;  1JOQ A;  1G8Z D;  1CA6 A;  1GXD C;  3KLR A;  1KDC A;  1ZYR D;  2WAQ B;  3DMU A;  2SOB A;  1DON A;  4CKC A;  3TZU A;  1G91 A;  1EIH A;  1LT6 D;  2IL8 A;  4DK0 A;  2E74 C;  2CW0 D;  2Q8I B;  4A3G B;  1FNV A;  2O4X A;  1D5M C;  1ET6 A;  1Y8P B;  1BBX C;  1DM0 B;  2AQ1 B;  1QB5 D;  2WKC A;  2G9D A;  5IGG A;  3F2U A;  1WCM B;  1BCP C;  3NTI A;  3S1M B;  3GTL B;  1ZYR C;  1DYQ A;  3T51 B;  4K6D A;  3OMG A;  1OXV A;  1FD7 D;  3X3N A;  1H9K A;  1ZEQ X;  3CRK C;  3S1R B;  5E4X A;  1JQY D;  2E2H B;  3SR1 A;  3O13 A;  1PTO F;  1B9N A;  2EXZ A;  2RBM A;  5C5M A;  4QCL A;  1KAA A;  4V19 0;  3PO3 B;  3I72 A;  4CJ0 B;  2A69 C;  3IKJ A;  4QUF A;  1STH A;  5EGT A;  4IFD I;  4E6I A;  5K36 H;  2ID0 A;  3SK8 A;  3CRL C;  2CHB D;  3HOU B;  3HOW B;  4ULL A;  3BVM A;  2LFN A;  1JWM D;  3MZ5 A;  5C0X G;  4HMI A;  2IX3 A;  2NTS A;  2DNE A;  5HGT A;  4RGN A;  2XVS A;  1PZK D;  3UI2 A;  1D1K A;  5CBA E;  1SSO A;  4PMW A;  2L11 A;  5I9P A;  1Z7T A;  2C5C A;  2FHT A;  1Y8O B;  1UEA B;  1TVX A;  3VR5 A;  1I6H B;  1DZ1 A;  3P1H A;  1ET9 A;  3GTM B;  1S5C D;  1JOO A;  4RGM A;  4KY6 A;  1PRT D;  4DA2 A;  3OHX C;  4WRD A;  2BA0 A;  3R2I A;  1PTO C;  3C1E A;  4AYB B;  2SDF A;  1XXG A;  4KD3 A;  3M7G A;  1G2S A;  5FKA C;  2AWN A;  4EQN A;  3H09 A;  1EU3 A;  3C2P A;  3KK7 A;  2PYK A;  4K2L A;  4IUT A;  3T16 A;  3I91 A;  1BCP D;  3K7A B;  4KKU A;  5C3E B;  4ZUI A;  4ZRZ A;  4H44 C;  5DAU A;  1EY4 A;  1A3U A;  4CKB A;  1CM9 A;  3ITP A;  2B2W C;  2NZ1 D;  3HOX B;  1EEF D;  1CTM A;  3KLS X;  1AP0 A;  1S5F D;  1PZJ D;  1GJX A;  2KEE A;  4R9W A;  1JE4 A;  4ZAI A;  3S1Q B;  1I4Q A;  1C4Q A;  1GUT A;  1SBB B;  4HCS A;  4FXD A;  4RH6 A;  1LTG D;  4XQN A;  1IKL A;  5LL6 S;  3NXW A;  4V0B A;  1CI3 M;  1ICW A;  5T1G A;  5C4Z A;  1JR0 D;  2JE6 I;  2PQE A;  1STB A;  4F88 A;  1FYC A;  4FF4 A;  3D6C A;  5NUC A;  4X3U A;  2VXW A;  1SYC A;  1YNJ C;  1BDO A;  1NCV A;  3D8G A;  3VA5 A;  1JWU D;  3FPU B;  3VR4 A;  4HMJ A;  1RTO A;  2KA7 A;  3QG1 A;  1G6Z A;  2A74 C;  4KHV A;  2ICI A;  5C4X B;  4RGO S;  1JCK B;  2D9U A;  2WIN B;  1GUG A;  5KRU A;  4G7O C;  4NP5 A;  1BQQ T;  5C3W A;  1B44 D;  4X3S A;  1ESR A;  5JEA H;  3RLF A;  1F2M A;  4K5V A;  2VNU D;  3QB3 A;  1PZI D;  3S17 B;  3DHQ A;  3PO2 B;  1STN A;  3TME A;  1F2Y A;  5CMD A;  4IUN A;  5M9O A;  2O2L D;  4HAE A;  3VR6 A;  2F3W A;  5E4W C;  5EBC A;  4J8Q A;  2K01 A;  4KY7 A;  4PNY A;  5C44 B;  2YU9 B;  4WOR A;  4KY5 A;  2PW7 A;  2B2Y C;  4N9P A;  1HHV A;  5CV8 A;  5M5Y B;  5IOC A;  2BE5 C;  5ELF A;  3M7N A;  1BCP B;  3OPO A;  2AQ2 B;  1A15 A;  4ZKC B;  3K59 A;  2EY2 A;  3TDQ A;  1YNJ D;  3SK6 A;  4RCO A;  4X3T A;  3VYU A;  3I70 A;  3TBI B;  2L55 A;  1Y1V B;  3TP5 A;  1V8Q A;  2QKI C;  3R93 A;  5ELB A;  3W2D A;  1W6J A;  4K5W A;  1EFI D;  1BCP F;  1F9R A;  1XX8 A;  3I4N B;  1I50 B;  4KI0 A;  1IL8 A;  2EJG C;  1H9J A;  3K5L A;  1WTO A;  5C6A A;  1QG7 A;  2F0D A;  4RKL A;  3L9A X;  3A54 A;  4MHE A;  5FO9 B;  2BE5 D;  2E2I B;  2GA4 B;  2IX1 A;  3U9O A;  3AU7 A;  2EYP A;  1TR5 A;  1B50 A;  1NR4 A;  1IW7 C;  3SHL A;  2D5D A;  4OO1 H;  1TS4 A;  3VR3 A;  3BDL A;  3C46 A;  4FF2 A;  1C8C A;  5C0X J;  4I7Z C;  3HS0 C;  3SK4 A;  3GV6 A;  2R93 B;  1HXY D;  2F0O A;  1Q12 A;  4FO2 A;  3PUV A;  4QUC A;  3S2H B;  2A68 C;  2D2C C;  1B1Z A;  4RWS C;  1EU4 A;  3HOZ B;  1U4R A;  1GOZ A;  1SMY C;  1NUC A;  4RFB A;  2BCO A;  3H3V C;  2AWO A;  1HQR D;  1D2B A;  2XN9 C;  1Y1W B;  1SJH D;  1STG A;  2XIW A;  3X3M A;  1ML0 D;  2PNR C;  3MA2 B;  2J4X A;  1LTI D;  1IYV A;  3E6Z X;  3Q6S A;  1TWC B;  5JVH 3;  1L0Y B;  3HKZ B;  1RKN A;  2HUG A;  3OWE B;  4PQX A;  1CQV A;  3FDT A;  2OF1 A;  3PUX A;  2K28 A;  4RHR A;  4CJ2 C;  4OGQ C;  3M85 A;  4IFD H;  3EFX D;  4YIJ A;  2HQE A;  1D5Z C;  4GZY C;  2Q8T A;  1MSG A;  2B8G A;  2QCP X;  2ZT9 C;  2KED A;  2B2U C;  4PMC A;  1U4P A;  4NMZ A;  2A69 D;  1CK1 A;  1DD2 A;  1BOS A;  1RJT A;  1PMR A;  2F0V A;  4PMB A;  2L12 A;  2RKS A;  4DXG A;  3OIQ A;  1WTX A;  3ERO A;  4KN4 C;  1LTS D;  3MTS A;  3KUP A;  2R6G A;  2A73 B;  1I4G A;  1VDZ A;  2F0M A;  1GUS A;  3PMF A;  5JPN C;  1Y69 U;  4IFD J;  1KLU D;  4QIW B;  5A2Q E;  3AMU A;  1LTB D;  3MC0 B;  3GTK B;  1PTO H;  1JOR A;  4NW2 A;  1CQF A;  1J8I A;  1SJE D;  2ENB A;  5FK9 C;  3NWT A;  2FJ2 A;  4CJ1 B;  4F7X A;  2R61 A;  3H94 A;  2L5T A;  3GQB A;  4J1M A;  5C0X H;  1RD9 D;  5I9O A;  1PRT C;  1OXT A;  2CVR A;  2K04 A;  2KQ3 A;  4A3D B;  3DEO A;  2NVQ B;  1LTT D;  1D1I A;  3PUY A;  1TWH B;  4Q0F A;  4DU9 A;  1TS2 A;  2H4O A;  1WD1 A;  3H6M A;  1OO9 B;  5ELE A;  4DAV A;  5I2Y A;  3P75 A;  4HED A;  3T56 B;  4ZLT F;  3T13 A;  1BR9 A;  1O80 A;  3JAM E;  2NBF A;  1KTK A;  3BYT B;  5C0X I;  1HPC A;  1SYE A;  3QOL A;  2F0K A;  5JVG 3;  2C9O A;  2B2T A;  2WP8 J;  1E2Z A;  2OXP A;  2LY7 A;  1OXX K;  2TMP A;  4A3M B;  5K36 G;  2F0G A;  2WAC A;  5EJW A;  3WDN A;  2B8F A;  1EYD A;  4C3J G;  4R8N A;  4ZKB B;  4ODG A;  1EIG A;  4G7Z C;  2LS0 1;  5JEA J;  1TS3 A;  4OHJ A;  2MP1 A;  1RF2 D;  3MXU A;  1DCZ A;  4EQO A;  1S5B D;  4S3S A;  4XIG S;  3J7A F;  2EDG A;  3IL8 A;  4G57 A;  1HQM C;  2SNM A;  1EWH A;  4KK7 A;  3WOE A;  3EJI A;  3A7L A;  4K5X A;  3V2T A;  3HP3 A;  2F0N A;  5J22 A;  1JOK A;  1IW7 D;  1SND A;  1DOM A;  1D5X C;  2WKD A;  5KIX A;  2XSC A;  4KN7 C;  3NBH A;  1SNQ A;  1R4P B;  3RUZ A;  2F0J A;  2K05 A;  4EVO A;  3K57 A;  4IN3 A;  4K8I A;  4TSS A;  4K2K A;  4C1N I;  4ZYS A;  1AFP A;  1F9P A;  4RGT A;  2JYO A;  1ZKO A;  3P7J A;  3HOY B;  3MVV A;  4HCE A;  1CT1 D;  2SNS A;  1QJO A;  3NP8 A;  4ABN A;  1PFN A;  4CBV A;  2LMC B;  4TRD A;  1SNP A;  5CV7 A;  1AEX A;  1AN8 A;  2AQ3 B;  1GUN A;  3QOJ A;  1B4O A;  1CZG A;  4A3F B;  2Z1C A;  2X6L A;  2JA6 B;  1VF7 A;  1A2U A;  4KJO A;  1SDF A;  3D4D A;  2BDN A;  2RVL A;  1BF4 A;  1F9S A;  2ZXO A;  5LHY 1;  2XWJ B;  4F8M A;  1GUW A;  3MXP A;  1TY2 A;  2DN8 A;  5EKI A;  4HN7 A;  3KF8 A;  2EYM A;  1JWS D;  3K0Y A;  1AZP A;  1TS5 A;  4L8J A;  3R3O A;  1MI2 A;  1A3V A;  4O42 A;  1WTV A;  3GTP B;  1XTC D;  4L6T B;  5CYU A;  1I4X A;  2MGS A;  4WFN 3;  5CV9 A;  1PRT F;  1PTO B;  4QMG A;  4A3I B;  3IFT A;  5AFW A;  4BY1 B;  2E2D C;  2K6A A;  1R9T B;  1G29 1;  2XNA C;  1TU2 B;  4OO1 I;  3OMC A;  1HFN A;  4JK1 C;  1HA5 A;  5COR A;  2X69 A;  1O7Z A;  3OSO A;  4A3B B;  2NVT B;  1EZ6 A;  2RQX A;  1E2V A;  2Y0S B;  3Q24 A;  2JA7 B;  1LAB A;  1RTN A;  4LMQ D;  2A6E D;  2F0H A;  2NN6 I;  3QJY A;  5IGF A;  1V1P A;  1V1P B;  2HDM A;  1TY0 A;  3OOC A;  2MPM A;  4XXE A;  5KND A;  2L4N A;  2DNC A;  2MUY A;  3ERQ A;  1EY0 A;  1WTW A;  2KOL A;  2IW3 A;  1CFM A;  5LL6 X;  2V4D A;  4Y7N B;  3FMC A;  1A3T A;  4QF4 A;  3CKI B;  1EQT A;  3K58 A;  4XQJ A;  1QCB D;  1I6V C;  2B2V A;  5BN4 A;  1U4L A;  1FR3 A;  2BDO A;  3LWE A;  5KNC A;  4XQQ A;  2R7Z B;  2RSN A;  5ELD A;  2K5W A;  3HRZ C;  2K5Q A;  2IT1 A;  1UUP A;  1F77 A;  3TP7 A;  4DN4 M;  2F1M A;  1F9Q A;  2F0P A;  3QWN A;  2L9H A;  5KYL A;  5BN5 A;  1I4R A;  1B3A A;  4FP5 D;  1EY6 A;  4C3H B;  2D62 A;  3ND9 A;  4G4K A;  1QE6 A;  2NUC A;  4KJN A;  1IKM A;  4CHT B;  3KLS A;  3C3L A;  4PV1 C;  4BY7 B;  3J7Y W;  3HG9 A;  1KLG D;  1GHJ A;  3HEJ A;  1DOL A;  2B2W A;  1EOT A;  2A6H C;  2XRQ D;  2Z8L A;  3DWA A;  5M5W B;  5DM6 3;  1TKW B;  1NSN S;  3TZD A;  3ZYY X;  4IUR A;  1FNU A;  4BBR B;  1ENC A;  1CHP D;  4DK1 A;  4X3K A;  4HTH A;  1HCZ A;  1TWA B;  3NUC A;  4L63 B;  3OIP A;  3I73 A;  2XWB B;  1MGS A;  3A8I E;  4BS9 A;  2QIL A;  5I6W A;  1I4H A;  3DXJ C;  5TSS A;  1K8O A;  3S9W A;  5IGD A;  2VB3 X;  4LK1 C;  5I4D A;  2B2Y A;  2EYL A;  3VA7 A;  2EZV A;  2MHV A;  5DNF A;  3V96 A;  4BA1 I;  3MXN A;  2N88 A;  2NWG A;  4OO1 G;  5C4H A;  2B39 A;  4I65 A;  4TKO B;  2JXM B;  1RHP A;  2M00 A;  1S4Z A;  5T1I A;  1VMC A;  2JP1 A;  5C3X A;  2PW5 A;  2RDG A;  4EGV A;  2EYF A;  5IOD A;  2NVX B;  5COY A;  1BO0 A;  4IUU A;  3Q23 A;  2QF7 A;  3IFD A;  4WJW A;  2YYZ A;  4IQZ A;  1PTO D;  3LNN A;  2B2T C;  2EJF C;  1II3 A;  3J80 L;  2CW0 C;  2G9H D;  3H0G B;  1H9S B;  3NHH A;  3P20 A;  3SEB A;  3DWQ A;  1SEB D;  3ONA B;  4XT3 B;  3L3O C;  1QWY A;  5D3I B;  5EPK A;  2I07 B;  1STE A;  3BS1 A;  5G3L D;  3SK5 A;  1KNA A;  2QDB A;  4XYQ A;  4DAP A;  2VB2 X;  4C56 C;  4C3I G;  3Q0A A;  1JIC A;  1LAC A;  3K5N A;  3S1N B;  5J1Z A;  1IHZ A;  5FLX L;  3FRP B;  5IIF A;  2NYZ D;  1EY7 A;  3FKI B;  1G2T A;  1TWF B;  1MBY A;  1V1O A;  3BVG A;  5JOB A;  3FEW X;  4N9T A;  1OXS C;  2QEJ C;  4DF7 A;  1HTP A;  5G3L F;  3FVQ A;  1HRJ A;  1MD2 D;  1QIL A;  3M4Y A;  5D14 A;  3W3A A;  2PZW A;  4BA2 I;  1STA A;  3D31 A;  1EQV A;  4RAU C;  2PPB C;  3GTQ B;  1B9M A;  2X6G A;  1TII D;  1PYW D;  4IUP A;  2EY6 A;  1EEI D;  4KTA A;  3MFY A;  4RKB A;  5EKK A;  4FNF A;  4KKS A;  1H9M A;  3NSW A;  1S5D D;  2O5I C;  5IGE A;  1JC7 A;  5C4J B;  1ESF A;  3LX0 A;  3D3R A;  3Q22 A;  1SMY D;  3EVQ A;  4FVM A;  1SYD A;  1LV9 A;  1L0X B;  4B08 A;  3M4O B;  1KDA A;  2A68 D;  1NR2 A;  5EBD A;  1U9R A;  5F2D A;  1ILQ A;  5JPM C;  4JBW A;  3PIP 3;  5E1F A;  5CV6 A;  1EYA A;  3GO5 A;  1SE4 A;  3MWY W;  4FYD A;  1K83 B;  2AUJ D;  3R8B A;  5EQ0 A;  4B9W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...