2EYHA

Crystal structure of staphylococcal nuclease mutant t62s
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
135
structure length
135
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFSKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Staphylococcal nuclease
publication title Threonine mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 38
structure length 135
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2005-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2eyhA00
1SNDA 3EVQA 3OWFA 3BDCA 4LAAA 5K5PA 4KJOA 4KD4A 5J39A 2F0DA 5IGCA 5CV6A 4EQNA 4ODGA 3QB3A 2EYOA 4MIUA 3DHQA 4J6HA 1SYDA 1EYDA 4NDXA 4F7XA 5ISRA 1SYGA 3OSOA 4DF7A 2EYLA 2F0OA 1EYAA 3SK6A 4F8MA 5CC4A 2PW5A 4QB4A 1STHA 5CV4A 3RUZA 3SHLA 3SK4A 2EY2A 2F3VA 2PZUA 1F2MA 4IALA 5KIXA 5CV9A 2HQEA 3ITPA 3LX0A 4RKBA 3PMFA 4KJNA 1A3TA 4IUNA 4N9TA 2M00A 3R3OA 5KRUA 4ME5A 2SNMA 2PYKA 2O4XA 5KYIA 1KDCA 5EGTA 2PZWA 5E3FA 2EYMA 5CR3A 4K8JA 2EXZA 1KDBA 1TQOA 4OL7A 2F0PA 4PMBA 5DEHA 4B9WA 3NP8A 1EY6A 1SYBA 2NUCA 4PMCA 2F0IA 5CV5A 3NHHA 4HMJA 4PNYA 4KD3A 5E1FA 1TT2A 4NMZA 4QMGA 1KDAA 1STBA 5EKKA 1A3VA 3TP8A 3U9OA 1SYFA 1EY0A 5JOBA 5C3XA 5KEEA 2RBMA 4K5WA 5CV8A 3E5SA 5NUCA 1RKNA 2F0GA 5DAUA 2EY6A 2SNSA 3H6MA 3NK9A 3NQTA 2EYHA 1EY4A 1SYEA 4S3SA 2KQ3A 2F0EA 4KY7A 1JOQA 3C1EA 3NXWA 5C4ZA 1U9RA 5HGTA 3SK5A 5IODA 1TR5A 3D4WA 3SK8A 5J22A 3HEJA 3TP7A 1SNCA 3TP5A 2F0MA 2WACA 3P75A 4ZUJA 4KHVA 3D8GA 2RKSA 4QF4A 4HMIA 2F3WA 3NUCA 2OF1A 4EQPA 3TP6A 5KGUA 3MXPA 1SNMA 2EYPA 5F2DA 5IGFA 5IGEA 3OMGA 1AEXA 4WRDA 2LKVA 5I6YA 1SYCA 5IGGA 2EY1A 2PQEA 2EY5A 4K6DA 3SXHA 4G57A 2F0TA 4B9XA 5I9OA 1NUCA 3MVVA 3T16A 1JORA 4IZ8A 3MHBA 3EROA 5KYLA 1EZ8A 5CGKA 1STAA 3D6CA 4H7BA 3P1HA 1EY7A 3DMUA 3T13A 4NKLA 4EVOA 5C5LA 1F2ZA 3TMEA 5HURA 4HTHA 2PZTA 3QOJA 5IGBA 1STNA 2F0LA 3D4DA 4ZQ3A 5J1ZA 4KY5A 2OXPA 1KABA 3BDLA 4KY6A 3S9WA 2F0SA 2F0JA 1ENAA 1EQVA 2EYFA 3QOLA 3ERQA 3HZXA 4K5XA 5C3WA 3MZ5A 1JOKA 1EYCA 1SNPA 1ENCA 2F0KA 2PW7A 3MEHA 4N9PA 1II3A 4R8NA 3VA5A 2F0UA 2KHSA 4DU9A 5JAVA 2F0QA 5CV7A 5C5MA 4K2LA 1A2TA 1SNOA 4YIJA 4EQOA 5IIFA 3V2TA 2SOBA 1KAAA 4DGZA 2OEOA 4RKLA 5I9PA 1EY8A 4TRDA 3SR1A 5M9OA 2ENBA 5EKLA 2F0HA 4ID6A 5IOCA 2F0VA 4K8IA 1EY5A 3OMCA 5IGDA 4I65A 4E6IA 1A2UA 4KV6A 3EJIA 4NP5A 4J1MA 4ZUIA 1NSNS 5C6AA 1IHZA 1A3UA 1EY9A 1SNQA 4K2KA 1F2YA 1STYA 4K5VA 4KTAA 2EYJA 5I6WA 1JOOA 1EZ6A 2RDFA 4WORA 4DFAA 2F0NA 5C4HA 1STGA 2QDBA 4K14A 2F0WA 2F0FA 3C1FA
chains in the Genus database with same CATH superfamily
2JA6H 1KIXA 1PLFA 2K6AA 5D14A 4DXGA 3NWTA 2VXWA 5FKAC 1ENFA 1WCMH 4ZCKA 3ONAB 3V96A 3AFPA 3FEWX 3S15B 4DF7A 3W5OA 2JA6G 3KK7A 3SK4A 1FJGL 3KDFB 3G4SA 1E1OA 4LF4L 3FP9A 1WCMG 4FNFA 3DWQA 1Q90A 4C3JG 2BH2A 2PYKA 4A76A 4PV1C 1N36Q 2EYMA 2ZT9C 4P71A 1EU4A 2DNCA 3G6JB 4JI8L 4POGA 1H95A 3ND9A 1U5KA 2C9OA 1RDPD 3PIP3 2ICIA 4UPAA 3I4NB 1EY0A 4X6AH 1Z7TA 3VR4A 3WDNA 2F4VL 1LACA 4KKSA 4QY7A 2KQ3A 5IYDH 4C3IG 4KY7A 5JEAJ 2AUKA 1JOQA 1E1TA 4IUUA 3F2DA 1VQ5A 2K33A 3QO2A 2UXDL 1ET9A 2ZM6L 2E2JH 3ULLA 4R8IA 1PH4A 1HFNA 1YI2A 5LHY1 4JG2A 1SYCA 4XTCS 1Q8IA 4YWLA 5ELDA 2F3IA 2IL8A 4G57A 3SXHA 3MVVA 1IW7D 1I5FA 3I4NH 4MZ9A 1X55A 1PH3A 4LFCL 4GOPB 4G7HC 2BDNA 3J7AF 4ZYSA 1NTGA 5E4XA 2JA5H 1TWFB 5GAGC 4A3FB 4KKTA 1QE6A 2I5LX 4HJ9A 4A3DB 1EYCA 1K8GA 2F0KA 1GUSA 5JAVA 1V1PB 2KCTA 3HFZB 1DONA 2K03A 5EBDA 1WJJA 1PFNA 3DEPA 3OTOL 1E2ZA 4A3KB 5CMDA 3P7JA 3MXNA 4K2KA 4BY7B 2IWHA 4DFAA 2K28A 1STGA 3UDIA 1ZYRD 2F0WA 4X3KA 1NJIC 1CHQD 4JI2L 1NE3A 3RLOA 3GO5A 2NVYB 4KD4A 1TWFH 1Y1VB 2JE6I 1VQMA 4JBKA 2HCIA 1YNJC 4A3FH 2EYOA 1VS0A 4A3DH 4J6HA 1RTOA 3PO3B 3A0JA 4F7XA 1SJHD 2VB3X 5FLXE 4GOPC 2EPBA 5CV4A 2B2TA 3M85A 4A3JH 1GUWA 2N88A 1P16A 5M3FG 3KJOA 3PMFA 4HCSA 4FDBA 2BCOA 2V4DA 2E5LL 2KENA 2M00A 2XN9C 5KRUA 3I4MG 4AH6A 3F2CA 4ALPA 4A3KH 2Z9HA 1KDBA 3SEBA 4LF8L 4UDUC 4BY7H 5CV5A 4C1NI 4QMGA 1STBA 3KBXA 5NUCA 3KBGA 2G5DA 3DWPA 1D5XC 3PO3H 5CBEE 3S24A 1D8LA 3T4AC 1N33Q 1X54A 4S3SA 4B3SL 3PF5A 1M8AA 3MEFA 3SK5A 2D0PA 1Y1VG 2R7FA 3CCLA 1HR0Q 4C3HH 2VUMG 3TSSA 4A3MB 1PRTB 5FK9C 3P75A 3CCRA 3LNNA 1ET6A 2F4IA 3DM3A 5IP9H 3DM1A 4OWWB 3S2HB 4LF9L 1DOLA 4BS9A 4OEMB 3K0YA 2VQEQ 1H9KA 3NPPA 3I2ZA 1I50B 4C2MB 1CZWA 2ZTEA 3DMUA 3A56A 1HUNA 1TS4A 3FRPB 1I3QB 1N32L 3UE1A 5H1SE 3RD4A 4MTKA 1HTPA 1BCPF 1Y14B 4IO9A 1WOCA 5DM63 2I5MX 3GV6A 2UUBL 1U4LA 4A3MH 4K5XA 5C3WA 3RR5A 4N9PA 1MIUA 1OTCA 4DAMA 5C5MA 4L5TA 4K0KQ 3QR8A 1XMOQ 5GAEC 1WI5A 2L55A 3S2HH 3S17B 1K0RA 1KNAA 4ID6A 2R7DA 1TWHB 1EU3A 1PRTC 4IUVA 4KV6A 4P74A 5E4WC 3RZOB 1I50H 2A69D 4ZUIA 1MGSA 4BA2I 1OXXK 1I3QH 3OIPA 3EA6A 1PV4A 2D5DA 1LTGD 1FNWA 3I4LA 2YTVA 4LAAA 2DJGC 2B2VA 1MJEA 4X62Q 1G291 4XIGS 3T1YL 3CQZB 1V43A 1T5XD 5ELBA 5EPJA 5JPMC 1WTQA 4QQBX 3NBIA 2F3VA 1F2MA 3L0OA 4AYBE 2A68D 4GS3A 4N9TA 4JOIC 2NBFA 3HKZE 1JB7A 1HQMC 1TWHH 4YHHQ 3CD6A 4BXXG 2KCMA 3I73A 1PDQA 1PTOD 3RZOH 2QW7A 1BF4A 3VR5A 2K5VA 4R4OA 1HJPA 2OWOA 1G6ZA 2YV5A 4JBMA 4HN7A 1S3OA 5DLQE 4PNYA 4NMZA 4BBSB 2D9UA 5EKKA 1HNZL 1VMCA 1WTXA 3CPFA 3CQZH 1X56A 2HHHL 3H6MA 3T53B 4L5RC 1SYEA 2CWPA 2E2DC 2LS01 4K6LA 5BN4A 4IOAA 3NXWA 1D1KA 2J0TD 1E2VA 2BDOA 1PFSA 4R1JA 2LMCB 3Q22A 3CCSA 2SDFA 1HCZA 4HIMA 3B6YA 4B3TL 4UP8A 3CCJA 1I4QA 3K5MA 5I9OA 4BY1B 4B9XA 3MHBA 3J81L 5LMNW 4YCWA 5KYLA 3R8BA 4DAPA 1CQVA 1WTWA 4XYOA 5C5LA 5HURA 2B39A 1X65A 1Y1WB 1WTOA 1WFQA 3U4ZA 4BBSG 1N32Q 1A8VA 3I90A 5CBAE 3S2DB 2E76C 3ZYYX 3PF4A 1V8QA 1BOSA 1IKLA 3HOZB 1VQFA 2K7VA 1SFOB 1XXGA 2B2UA 1GUNA 3CMAA 1CHPD 3HG9A 4BY1H 3HOXH 1A2UA 1D2BA 4JI1Q 2LSSA 1KHIA 4R4TA 3J7AV 1GVPA 1A0IA 5AJ3L 1JOOA 1YIJA 4DR3L 2KBNA 4G7ZC 1Q12A 3GTMH 1D5ZC 4K14A 1S72A 5FO7B 1HA6A 1Y1WH 4RGNA 4HIDA 5EQ0A 2BE5D 2I5HA 2ZJRA 5GAHC 4IPCA 2E75C 1GXDC 1JJCB 3SK6A 2OQKA 1KRSA 2UXBQ 1MSGA 2PZUA 4IALA 3HOZH 1EOVA 4JI6Q 2EJMA 1SFOH 1ZXTA 1S40A 1AE2A 2KVMA 3A8KE 2SNMA 2WINB 2IX0A 3K5NA 3MWYW 3P20A 2KEDA 5M5YH 1QJOA 1H9MA 3HOZG 1FYCA 1GD7A 3S1QB 5EAYA 3W1BA 3F2UA 3U9SA 4FVMA 4J15A 3TP8A 5JOBA 3KLWA 2K4KA 3NK9A 3FKIB 2EYHA 1GHJA 2HHHQ 2R3ZA 1BCPB 4LUZA 4MNOA 2EXDA 5C3EH 5FLXL 1WTHA 4CDCC 3MTSA 3OYYA 4A4IA 4DV2L 5FLXc 2L5TA 1RODA 3RMHA 1CKOA 1YEZA 4IQZA 2UXCQ 3BZDB 4X3SA 3FPPA 1PH6A 2RVLA 3A54A 2JJQA 1C0AA 1ICFB 2R61A 3I70A 4FO2A 5DM73 3MAQA 1R4PB 2UUAL 3S1QH 5I6YA 4PZ7A 2R92B 4R9WA 2EY1A 1J5EQ 4ILWA 1L0XB 1NAPA 4B3TQ 1TS3A 2YYZA 3QIAA 1TWGB 3D6CA 4GN5A 5D65A 5EPKA 1L0WA 1EY7A 3HGBA 3FKIH 1X32A 5FLMG 2PZTA 4DUYL 1TS5A 3D4DA 1C4QA 3BDLA 1B3QA 2K5HA 4PG3A 4KHPL 4X65L 2A6HD 1PVOA 2F0JA 5BN3A 1Q3LA 2R93B 3MXUA 3FHWA 3RNUA 1JWSD 2G9DA 3TZDA 4ME3A 3FKIG 3BZKA 4A3LH 2PCFB 3OPOA 1SNOA 1KRTA 2K75A 4IOCA 3V2TA 2OEOA 4RKLA 3I3CA 3SR1A 5EKLA 3J7YW 5IOCA 3E0JA 3K0XA 1VQGA 4U68A 4LNQA 2HIXA 3ZJYC 2R92H 4Q0FA 4DR1L 3I4OA 1IHZA 4JK1C 3J80E 5C44H 1XPUA 5IYCH 4MHEA 3NWSA 4ODGA 2R93H 3TQYA 4PZ8A 3DUZA 3CC2A 1XTCD 2MJ8A 2M2LA 5EKIA 1V1QA 3BS1A 2R93G 3AYHB 1VQOA 1E24A 4ZK9B 5BR8Q 3GTKB 3TBIB 4YWMA 1M90C 3H15A 1TQOA 4DAYA 2PMZB 1H9SA 1SRUA 3OOCA 3X3NA 4IPHA 2BH8A 3HOUH 1PZID 2WP8J 4CDDC 4R4IA 1MI2A 4GNXB 2ZTCA 1B4OA 2CKZB 4XT1B 5DAUA 3CAMA 3J81i 4HSVA 1DGSA 1EQRA 1STEA 1U9RA 5HGTA 4BBRG 4JCVE 3HOYB 1DM0B 1Z6HA 2A6EC 2ZJPA 3TP7A 2CFMA 3D4RA 4LW1A 1CQFA 3GTKH 1HR0W 4DR5Q 1QWYA 1NR2A 4HMIA 4JV5Q 2MFIA 5M3MH 4KHZA 3U50C 4LFBL 2Q2UA 1K73C 4YY3Q 1CTMA 1XWEA 2Y0SB 3HRZC 2KA7A 4NXNL 3R93A 4DXFA 1BBXC 4JYAQ 1UNSA 3S1NB 1SR3A 1RJTA 1EYGA 2JN4A 4OONA 1HPCA 2OTJA 1F77A 1VQDA 1K3BC 3KYHC 1LTSD 3K58A 3JAME 3MC0B 5GADC 3HOYH 4C1NK 1TY2A 4GNXC 3M3YB 1A2TA 1AW7A 1HZCA 1XYIA 3BU2A 2I0QA 2N8NA 4LFAL 4RGOS 4N8X1 3STBD 1SXTA 1AZPA 3CHBD 1HHVA 1BO0A 1HNXQ 4L5SA 1SE3A 3EN2A 1LV9A 3S1NH 1UUPA 1YNNC 5FJ8H 1C8CA 1XNRQ 2IHEA 1SNDA 2Y0SG 1UE6A 4OIJA 1JB3A 1BR9A 4LF6Q 2TMPA 4O0AA 4EQNA 4X3UA 5LL6X 3M3YH 3HP3A 1EYAA 5A2QL 4V0BA 1E22A 1IYUA 3C3LA 5D3IB 2K32A 2WAQG 5ELCA 1ILQA 1KD1C 4HJ5A 4FYDA 1PH8A 1AN8A 3H0GG 3NE5B 3VR3A 1EEFD 4BWGB 1Y8NB 1E0BA 5DEHA 4KN4C 2KCCA 2AUJD 1SE4A 1YHQA 2N49A 1SYBA 5KNCA 1LT4D 1H9JA 3CF5A 1L0YB 1FGBD 2UU9Q 2CH4A 4PZ6A 3UE0A 2JP1A 4GKJL 1IBLL 1AFPA 1MBYA 4DR6Q 2SNSA 4P75A 3NQIA 2F0EA 2WV6D 2IW3A 4GOPA 1GM5A 4Q5VA 4DV5Q 3RN2A 2LXJA 1PFBA 2WACA 2E2JB 4H02A 2HIVA 3W3AA 2B3GA 1TIID 1MSHA 2IX1A 3NTKA 2XNAC 1V1PA 3AU7A 1C7YA 4DK3C 5F2DA 5IGEA 2ZXPA 2QEJC 1JORA 1I94L 2F0TA 2D0OA 2HDLA 1MD2D 2RHSB 3CCVA 2QA4A 2XWJB 1ZKOA 5CGKA 1PTOF 4NXNQ 2L15A 1SEBD 5IWAQ 4JI3L 3PV0A 5C0XH 1PH5A 4ZRZA 3LWUA 2O5JC 2JA5B 4GKKL 4LF7L 3M4OH 1KABA 1YZ6A 4X66Q 2IPKD 3Q23A 1G51A 4LMQD 1VQBA 1ENAA 5IYDG 2RDHA 3KLSA 1GHKA 5C0XG 4XYQA 2AMCB 4DN4M 2X6LA 1RIPA 2Z8LA 2F52A 4DV0L 1K8AC 1ASYA 2ENBA 3BVGA 4L5QA 3GDEA 4LFAQ 2VW9A 3PUVA 1L1OB 3S1RB 1L2FA 2K5NA 4R4CA 1I4XA 2IX3A 4DKAC 4LWCA 3ITPA 1LTBD 3I4NG 3T1HL 3N6RA 4X64L 3AEVA 5J39A 2F0DA 3X3MA 4A3CH 1VQCA 1EYDA 4A3JB 4NDXA 1SBBB 2JA5G 1E2WA 3Q24A 3IKJA 5KIXA 4YCVA 5CV9A 3TZUA 1F9SA 1F9PA 4IUNA 4F88A 1JICA 1ESRA 2QDLA 4JPBW 1YNJD 2EQSA 5KYIA 1QZGA 3S1RH 4IURA 5E3FA 4TQUS 1HQRD 1FNUA 3I56A 1PA6A 4GZYC 1CSQA 1LTTD 3J80c 3SE0A 4A3IH 3PUXA 5C3XA 5CV8A 3C46A 2B63B 4RH6A 4WJ3M 1IBLQ 1DOKA 1X3GA 4J8QA 1LYLA 4C3HB 4A3FG 5C4ZA 2B2YC 2MO0A 4A3DG 3QWNA 1BQQT 1TR5A 1FJGQ 3HEJA 4JOIA 4LF4Q 3AQQA 4A3JG 2IJ0A 5KNBA 3Q8DA 3CCMA 2PNHA 3EFXD 4DV4L 1N34L 4IUPA 4DV3L 1IYJB 1SN8A 2NVTB 3CKIB 4ZLTF 1HH2P 1O80A 1T9HA 2EYPA 4JI8Q 1XJVA 5LL6S 2PQEA 4A3KG 1NUCA 1WVLA 2UUCL 3OW2A 3CCEA 4BY7G 2B63H 3TMEA 2F4VQ 2CVRA 1UE1A 1GUGA 4NPSA 4RMFA 3PO3G 4GKKQ 2EYFA 1KTKA 2O5IC 1UWVA 1Q82C 5CV7A 2UXDQ 4C3HG 2ZM6Q 2NVTH 1KAAA 1KC8C 2SEBD 4JI4L 5IP9G 1SE8A 1I4HA 2HT1A 2VQFL 1HNWL 3AB9A 1SLJA 1S5FD 3MXNB 2NYZD 4LFCQ 1TVXA 5FOBB 2K50A 3HS0C 2N78A 3AMUA 2JK8A 3PIOA 2YTYA 1PRTD 2ASBA 1V1OA 1ONLA 3JAML 5CC4A 2Q2TA 3JAMc 1UE7A 1YVCA 4A3MG 1A3TA 2XVSA 3OTOQ 3VA7A 3A74A 4K8JA 4QIWB 1K9MC 3A8IE 1O78A 2EJGC 1BVSA 4JI2Q 1CKNA 1Y8PB 1E7ZA 5T1GA 4G4KA 5JVH3 2V1CC 3D6WA 3K6OA 3SGIA 4JI0L 1EY4A 2F1MA 1S5ED 3BVZA 3CC4A 3C1EA 2M9VA 3NBHB 4GLXA 2E5LQ 4HAEA 1J6QA 2HUGA 3D8GA 4KHVA 1Q81C 2A69C 1WTPA 3KF8B 2RA4A 3NUCA 1TKWB 1C9OA 2WFWA 1SNMA 3ULPA 4DV4Q 4LF8Q 1KL9A 3E9HA 2B2WC 3OMGA 4DA2A 2XWBB 3IL8A 1BDOA 2XRQD 2ZXOA 1BUVT 3GQBA 1KLGD 1TS2A 4DK0A 1A15A 4XQJA 3RLFA 1GOZA 1PYWD 1PTOH 2ZXRA 4RHSA 1VQ4A 4ZQ3A 3PO2H 1RCVD 4B3SQ 4IPDA 1KAWA 2JA8B 3F2BA 4B3ML 3UDFA 4QUFA 1XPOA 2F03A 3S14B 4EQOA 2HQLA 5HY6A 2K14A 4OIKA 3FPUB 4CKEA 4RFBA 4TRDA 3WOFA 1YJ9A 3HOXB 4LF9Q 1G91A 3I91A 4FP5D 1GKHA 3Q0AA 3GTMB 1A3UA 4K5VA 4TKOB 1Q8KA 2EYJA 2JEBI 4WORA 1HNWQ 1Q7YC 3GP7A 2PQAB 3EVQA 3OWFA 1PYSB 2BOSA 2JA8H 3PIPA 3L7ZC 4XDXA 2UUBQ 1MHWC 2F0OA 1PXUA 2PW5A 4QB4A 3K59A 3S14H 2JA9A 3G48A 2AHOB 3TREA 1ICWA 4FF1A 3M7NA 5IYBH 2Z4HA 4UY8C 3VR2A 5M5YB 1EFWA 4YCUA 2NWGA 5I4DA 2R7ZB 2H1EA 5CR3A 4F87A 3E0EA 4BY1G 3HOXG 4DR2L 1X3FA 4L6TB 3GTQH 3EIVA 3HKZB 4WFN3 2KEEA 4HJAA 1RHPA 1QUQA 4CJ2C 4OELB 3N52A 3T1YQ 3A55A 1Y1WG 5C3EB 5IT9E 2C35B 1FNVA 3V05A 3H09A 2Z6KC 2QKIC 4QF4A 1A63A 2R7ZH 1PHJA 5KGUA 2CW0C 1EL0A 1MJCA 5IGGA 2NZ1D 2BE5C 4P72A 1JQYD 1HNZQ 1JE4A 4NKLA 1LT3D 2Q8TA 3QOJA 3LWEA 4M1UB 2DJFC 1K28A 1BBUA 1I4GA 1GUOA 1WD0A 4B3RL 5M5WB 1BKBA 1VQAA 3QOLA 5ELFA 1W2BA 2JSOA 4PMWA 5C3EG 3W2DA 4KMUC 4B3MQ 3ICEA 3VYUA 1SMYD 2SOBA 1EEID 3EBEA 5M9OA 1IBML 2PMZE 3KFUA 4OO1H 1FR3A 1TWAH 4POFA 4C56C 4LF5L 3MFYA 5C44B 2AWNA 3WWVA 2F0NA 3M4PA 4HCEA 3GTJB 4OO1G 1LM0A 1ZEQX 3BDCA 5K5PA 2WB1B 5M5WH 4NXML 1TWCB 1TXYA 3DHQA 1O7ZA 3L2PA 4GNXA 1EIHA 1EIGA 1N9WA 2NZHA 4APVA 4QUCA 1BCPC 4OWXB 3WOEA 4RKBA 4A3LG 3K5LA 1SSOA 2FMMA 4KKUA 2Z4IA 2L11A 2QF7A 4A93H 2MQHA 1PH1A 2Y0SE 1JWMD 2RCNA 2O4XA 2EOTA 5IP7H 3HOUB 2R92G 1JC7A 5AJ3Q 3L9AX 4PMCA 1EIYB 1PFMA 3GTJH 4DR3Q 1VQJA 1O7IA 2A6HC 2CQOA 3DXJC 2Z0SA 4H0LC 1GJXA 4K5WA 1IZ6A 2WAQE 5C44G 1TWCH 2Q8RE 3HOVB 5LMUL 5IYCG 2CCZA 3CP0A 2E2HB 4LK1C 4MTNA 4LJZC 3A7LA 3UI2A 2YU9B 3RZDB 1VQLA 4H44C 5M3MB 1VMPA 2OF1A 4EQPA 3T51B 5A35A 4XQNA 1B2TA 2LKVA 1DOMA 3PCOB 1JCKB 3IRBA 2K1BA 2K5WA 5C0XI 5D3DA 2A6ED 1HUMA 3PUZA 2NN6H 4IFDH 3CRLC 3HOUG 3HOVH 3K81C 4RGMA 1NR4A 4EVOA 3CXCA 3R2TA 2E2HH 2OXPA 3G6EA 4YWKA 4DNIA 2E2IB 2XRSD 4CDEC 4O42A 4CKCA 1K8OA 2YU9H 1LTRD 1JOKA 1OXVA 3RZDH 4DV2Q 1II3A 1YBYA 3TDQA 1VQ7A 1W6KA 4YIJA 4JBJA 2HD3A 1QB5D 1PZKD 1NMFA 4CGYB 3ND8A 2RHQB 1XMQL 3HKSA 5C0XJ 2A8VA 5FO9B 2UUAQ 2F0VA 1PMRA 2MHVA 4X3TA 1EY5A 2MPMA 1J8IA 3KLSX 5M3MG 1N36L 4J1MA 2MNAA 1Z47A 1F2YA 1STYA 5I6WA 3PUWA 4LUOA 1EZ6A 1BBWA 4P2CB 2PZWA 2B29A 1IYVA 2OT2A 4DUYQ 4WJWA 2E2IH 3GTGH 3U58A 1YHAA 2DGYA 2WIIB 2BA0A 4X65Q 4KHPQ 1UEAB 4OGQC 2K01A 1B53A 1YNND 4ZAIA 4UHVA 3HOWB 2O2LD 2TSSA 3KDFA 3TS0A 3HOYG 3K7UC 2DUDA 3R3OA 1SMXA 4A3BB 5M5XB 5I2XA 2A73B 5EGTA 4DR1Q 3E6ZX 4DV6L 4A3GB 3TRZA 2PO4A 1U4PA 1EY6A 2NUCA 2MP1A 1X6OA 3VDYA 4RGTA 3KJPA 1EQQA 5E1FA 1B8AA 5C4JB 1SYFA 5FJ8G 4ABNA 3FDTA 1FL0A 1NCVA 2F0GA 4RA8A 5JVG3 4JI7L 1PH7A 4DUZL 1DZ1A 2A74C 1KQSA 3KF6B 4AIMA 3HOWH 1B44D 1NBWA 4DNRB 4TSSA 3STBC 2JEAI 1U4MA 3SK8A 3I8ZA 2F0MA 4RCNA 1PRTF 4A3BH 5M5XH 1YJWA 4C3JB 1LT6D 1CM9A 2A5HA 4A3GH 3M9BA 4A3BG 1X3PA 5C4JH 1LLRD 3GTLB 1A6XA 1STAA 2L4NA 1E3PA 5JPNC 4R4QA 2ES2A 3OWEB 3M4OB 1Q86C 5IGBA 2VL6A 5J1ZA 2RQXA 4KY6A 2X6GA 2EZVA 3E9IA 2B2YA 4C3IB 4FXKC 3I55A 4GLVB 1JT8A 3ERQA 5IT9c 4JW0A 1SNPA 2PW7A 4O2DA 5T1IA 2PPBC 2GVBA 2GVAA 4C3JH 5EPLA 5I9PA 5EBCA 1B9NA 1XPRA 4LFBQ 1X9NA 4K8IA 1WYDA 5K36H 4I65A 4JC0A 2H4OA 1XMQQ 1GO3E 1NSNS 3GTLH 2LY7A 1PH9A 2KHIA 3O13A 4DV7L 1C48A 4DPGA 3C1FA 5TSSA 5K36G 4KLKA 1VQ6A 2Q2HA 4C3IH 3J81E 1LABA 3RLNA 1N33L 1CI3M 1QZHA 1HA5A 1LTID 3BG3A 2Z6BA 3S15H 1RD9D 1EWCA 1HR0L 2HQEA 3LX0A 2VNUD 4KJNA 5C4XB 2OCEA 1JJGA 4FF2A 4ME5A 1K0SA 4HJ8A 2A1AA 2EXZA 3PSIA 4Z9CB 1S5CD 4PMBA 1I4PA 2CQAA 1IBKL 1Y8OB 2VQEL 4HMJA 4A3IB 4DV6Q 1TT2A 2EJFC 1DJRD 3TS2A 1EIFA 4HJ7A 3E5SA 1RKNA 1WTRA 3W1GA 2K5QA 3EQLC 2IY5B 1B7YB 2EVBA 1KNEA 2JXMB 4JI7Q 4A3CG 4PQXA 4DUZQ 1DD2A 1IL8A 1IW7C 5C4XH 5M3FB 1LTAD 1V9PA 4K0KL 1XMOL 2F3WA 3I4MB 3C2PA 3TP6A 2B8GA 1S4ZA 3MXGA 1A62A 3J80L 1PYBA 3BJUA 5C4XG 2AQ2B 2WKDA 3Q6SA 2K05A 1L1OC 5COYA 2RDGA 1ML0D 2CH4W 4GKJQ 3M7GA 3H94A 4A3IG 1VQNA 2D62A 4EQ5A 2LXKA 3KUPA 4X62L 3A8JE 3K8AA 2L9HA 3J7ZC 2D2CC 2OQ0A 1HXYD 2RCFA 2L0CA 1UE5A 5E7NA 3MZ5A 4N8FA 5M3FH 2RSOA 3MEHA 2VUMB 5JJIA 2CWAA 4I7AA 3URYA 3BDOA 3JC66 3I4MH 1ZYRC 3MA2B 3RN5A 2LFNA 4QIWE 5ELOA 1HRJA 2B2WA 2Q8IB 1EUJA 4YHHL 3OMCA 3H3VH 2B8FA 5IGDA 1VQKA 1EOTA 1XNQL 1I94Q 3M4QA 4KI0A 1B9MA 1EY9A 4QJFA 2I46A 1QNUA 2RDFA 4CKBA 3CMEA 1OO9B 4JI3Q 3CC7A 2FJ2A 5EJWA 4CBVA 4RAUC 1EWIA 4KJOA 4LF7Q 2J7ZA 3NSWA 3H3VC 4DV7Q 5CV6A 2N3SA 2B63G 1JMCA 2NVYH 4MIUA 5JJLA 1Y1VH 1FVIA 2WKCA 2VUMH 3KLRA 4GN4B 2EYLA 1QG7A 4CDFC 2NTSA 2QILA 2Q2IA 5BN5A 3MFGA 4IJLA 1QVFA 5FO8B 1SROA 4DV0Q 1I6HB 3NBHA 5AFWA 4MN3A 2RF4A 2L1BA 5JEAH 2EE1A 2E74C 3ERSX 4TVAB 1TU2B 3KF8A 1U4RA 2F0PA 5G3LD 1NMGA 3S16B 2OTLA 2MGSA 1R9TB 1H9RA 2VB2X 5JJZA 5JEAG 3T1HQ 1A3VA 3CCQA 1IBKQ 1DCZA 4X64Q 1ESFA 2JA7B 1KLUD 2PI2E 1VQIA 3DLLA 2JQOA 3K80C 2A19A 2FINB 2RSNA 3D4WA 1I6HH 1SJED 2PI2A 2FHTA 1Q46A 5J3BA 1G2TA 1IL2A 3MXPA 1JWUD 4HEDA 2JYOA 1QNKA 3S16H 3QJYA 1CT1D 1R9TH 4JI1L 1PTOB 3LGJA 4OWTB 3NTHA 4IN3A 2JA7H 3T13A 3K57A 3PO2B 4C2MH 4ULLA 1F2ZA 4WJ4A 1QVCA 4HTHA 4HIOA 3A5ZB 1RF2D 2DN8A 2F0SA 2PQAA 5CYUA 1B70B 1BNZA 1EQVA 4DR7L 1X3EA 4UAIA 3DWAA 2JA7G 3OHXC 3VA5A 2Z6KA 2F0UA 2PNRC 3ER0A 2UXBL 2F0QA 4K2LA 4U673 3CW2C 4OO1I 1N8RC 2B2TC 4ZKBB 1N34Q 4DV3Q 4JI6L 4BXXH 4XT3B 4DGZA 2KOLA 4HSPA 1QILA 3S17H 4IJHA 1LUZA 1CZGA 5C6AA 4Y52H 2UUCQ 1R4QB 2L12A 1XNQQ 1IKMA 5C4HA 2A68C 4OXPA 4DV1L 2KCNA 1VQ9A 1KXLA 3VYTA 2XGTA 3J81j 1Q1EA 2IHFA 3QB3A 1PTOC 3PO2G 1CFMA 5ISRA 1SYGA 4CHTB 3RUZA 5ELEA 3SHLA 4P73A 1OXTA 5GROA 2C5CA 1SE2A 4JI4Q 1UEBA 2UXCL 1F2LA 2XTIA 1KDCA 2VQFQ 4OL7A 1OXUA 2I07B 1YHBA 3GTQB 2DNEA 3NP8A 1J5EL 2F0IA 4BA1I 2R6GA 4OX9L 2G9HD 3J80i 1CKNB 3U9OA 1K83B 4XXEA 1ASZA 3J7A5 4BBSH 3PUYA 4UP7A 2EY6A 3NQTA 4A75A 5IY0A 2NVQB 2MO1A 1W3SA 4RCOA 3J81c 2JA8G 2QGQA 1HFGA 1IXRA 2NB0A 5GQOA 4XQQA 5HGQA 1CKMA 2N55A 3GTPB 5A2QE 3DEOA 1AP0A 1SDFA 4NB3A 3BZCA 5IYBG 4AYBB 2NN6I 1AEXA 4IFDI 4K6DA 4DNTB 4H13C 1K83H 3EROA 1EZ8A 1D7QA 1B3AA 2WB1E 2NVQH 1ILPA 4JI0Q 2F0LA 2CW0D 4KY5A 5I2YA 1PZJD 1VCIA 5ELNA 2B2VC 1LO5D 4L63B 2QEXA 4DR7Q 4RHRA 3GTPH 1HZAA 3S2DH 1OXSC 2AWOA 1HZ9A 1XX8A 4IFDJ 4DAVA 1QVGA 1TWAB 1NY4A 4B08A 5BR8L 2ATWA 4JVZA 2NZOA 2R7ZG 2IT1A 2KJXA 1VQHA 3BVMA 4KTAA 1O7YA 4AYBG 1I4RA 1W6JA 3HKZG 3K7AB 2QDBA 1VDZA 1TY0A 3AFQA 5IGCA 4DV1Q 3A7AB 2AKWB 1JE5A 4F8MA 1Q1BA 1STHA 3JAMi 1Z9FA 4AQYL 2EY2A 1PH2A 3UDXA 4A93B 2FMCA 4FXGC 4QCLA 4A3EB 4DR5L 2YTXA 3VYRA 4JV5L 2ZJQA 1QCBD 3PQIA 1SAPA 4OHJA 1UAPA 2P5ZX 4YY3L 1BCPD 1LT5D 2AQ3B 3K7AH 2QCPX 4KD3A 4JYAL 5FLMH 3CPWA 1QUQB 1RL2A 4OX9Q 2ALYB 4EGVA 2VS1A 2NVXB 2E8GA 2HDMA 1O7LA 1S5BD 1VQEA 3BYYB 1SMYC 4FF3A 1G6PA 2K5DA 1GUTA 5IODA 1M1KC 5J22A 4DK6C 1I6VC 4ZKCB 4A3EH 4Y7NB 4DK1A 3D3RA 3FMCA 2RKSA 4HIKA 1JR0D 3IFTA 5LMNL 1K3RA 2Z1CA 2GN5A 5IGFA 2B2UC 4A93G 4QGUA 1HNXL 4A3EG 2EY5A 4DR2Q 1AE3A 2VZAA 5IP7G 3FVQA 3T16A 1DYQA 4IZ8A 1HZBA 3L3OC 1B1ZA 3A5UA 4UP9A 1XNRL 2NVXH 4RG1A 1TWGH 2FXQA 1STNA 4RWSC 4LF6L 2WB1G 4JI5L 1M4VA 1LTLA 5JJKA 1EQTA 4GN3B 3HZXA 3GD7A 4BBRB 4R8NA 4Y7NH 3VYSA 5IIFA 4M8AA 4DR4L 1X3QA 1RTNA 4GLAC 3NELA 2XSCA 2HCCA 2MUYA 1D1IA 3F8TA 1G8ZD 2CHBD 1YITA 4NP5A 3I72A 3VR6A 2J4XA 3IFDA 3R2IA 1VQ8A 4JBWA 3UDGA 2KUMA 2F0FA 5DNFA 2NN6G 2AQ1B 1D6EC 4IFDG 2UU9L 3GTGB 3KOJA 3HOVG 1K8MA 3U4VA 1EWHA 4DR6L 1FGUA 2ID0A 4B3RQ 1FD7D 4IUTA 4BBRH 1SYDA 4FF4A 2K52A 3ULJA 3OSOA 3T56B 2ZTDA 1P8LA 3KF6A 4DV5L 5IE8A 5KNDA 4AQYQ 1J9OA 2KHJA 1IBMQ 4KN7C 3S1MB 1BXTA 1WTVA 4HR7B 1VF5C 1F9QA 2H5XA 4LF5Q 3K5OA 1XTDA 2EDGA 4B9WA 3G7LA 3NHHA 1U0LA 3M4YA 3PIO3 2DY7A 1KDAA 2DY8A 4NW2A 3H91A 2FFKB 3TEHB 5KEEA 5IWAL 1NNXA 2RBMA 4NXMQ 3NTIA 2K04A 4X66L 3IAYA 2VY3A 1Y69U 1S5DD 5L37A 3PGZA 3GV3A 3D0FA 3TP5A 3GTOB 1HTLD 1F9RA 2WAQB 4ZUJA 3I7FA 3S1MH 4LUVA 4G7OC 4L8JA 4DAYB 2EIFA 1H9SB 1CUKA 2ICEC 3CRKC 3H0GB 1B50A 4WRDA 5LMNQ 1CA6A 1CA5A 3D31A 2KECA 3E3XA 4KK7A 1MKHA 4H7BA 3P1HA 3CU7A 2XIWA 4IUQA 1CK1A 5G3LF 5LMUQ 1D5MC 1YJNA 2JA6B 4EX5A 3S9WA 3OW7A 1DXMA 4QL5A 1VQPA 4CJ0B 4V190 5CORA 1CSPA 1WCMB 4CJ1B 4JI5Q 3SDZA 3GTOH 1ENCA 4DU9A 3HOWG 2KHSA 1EFID 3G71A 3BYTB 2BA1A 3TN2A 3SVMA 3H3VI 2NTTA 4O1NA 1EY8A 3F1ZA 3H0GH 1WD1A 2F0HA 4DR4Q 1G2SA 4IPGA 3OIQA 1L1OA 4E6IA 1AZQA 1YNXA 3EJIA 4A3GG 1AH9A 3CCUA 2GA4B 3NEMA 3QG1A 1SNQA 1T5EA 2X69A 1JJ2A 4FXDA 1VF7A 3NENA 1QOHA 4I7ZC 1SNCA 5IT9L
chains in the Genus database with same CATH topology
1PLFA 2K6AA 5D14A 4DXGA 3NWTA 2VXWA 5FKAC 1ENFA 3ONAB 3V96A 3FEWX 3S15B 4DF7A 3KK7A 3SK4A 4FNFA 3DWQA 1Q90A 4C3JG 2PYKA 4PV1C 2EYMA 2ZT9C 1EU4A 2DNCA 3G6JB 3ND9A 2C9OA 1RDPD 3PIP3 2ICIA 3I4NB 1EY0A 1Z7TA 3VR4A 3WDNA 1LACA 4KKSA 2KQ3A 4C3IG 4KY7A 5JEAJ 2AUKA 1JOQA 4IUUA 2K33A 3QO2A 1ET9A 4R8IA 1HFNA 5LHY1 1SYCA 4XTCS 1Q8IA 3SXHA 5ELDA 2IL8A 4G57A 3MVVA 1IW7D 4G7HC 2BDNA 3J7AF 4ZYSA 5E4XA 1TWFB 4A3FB 4KKTA 1QE6A 4A3DB 1EYCA 2F0KA 1GUSA 5JAVA 1V1PB 1DONA 2K03A 5EBDA 1PFNA 3DEPA 1E2ZA 4A3KB 5CMDA 3P7JA 3MXNA 4K2KA 4BY7B 2IWHA 4DFAA 2K28A 1STGA 1ZYRD 2F0WA 4X3KA 1CHQD 3GO5A 2NVYB 4KD4A 1Y1VB 2JE6I 2HCIA 1YNJC 2EYOA 4J6HA 1RTOA 3PO3B 4F7XA 1SJHD 2VB3X 5FLXE 2EPBA 5CV4A 2B2TA 3M85A 1GUWA 2N88A 3PMFA 4HCSA 2BCOA 2V4DA 2M00A 2XN9C 5KRUA 1KDBA 3SEBA 4UDUC 5CV5A 4C1NI 4QMGA 1STBA 3KBXA 5NUCA 3KBGA 3DWPA 1D5XC 5CBEE 3T4AC 4S3SA 1M8AA 3SK5A 3TSSA 4A3MB 1PRTB 5FK9C 3P75A 3LNNA 1ET6A 2F4IA 3DM1A 3S2HB 1DOLA 4BS9A 3K0YA 1H9KA 3NPPA 1I50B 4C2MB 1CZWA 3DMUA 3A56A 1HUNA 1TS4A 3FRPB 1I3QB 3RD4A 1HTPA 1BCPF 5DM63 3GV6A 1U4LA 4K5XA 5C3WA 4N9PA 5C5MA 2L55A 3S17B 1KNAA 4ID6A 1TWHB 1EU3A 1PRTC 4IUVA 4KV6A 5E4WC 3RZOB 2A69D 4ZUIA 1MGSA 4BA2I 1OXXK 3OIPA 3EA6A 2D5DA 1LTGD 1FNWA 3I4LA 4LAAA 2B2VA 1G291 4XIGS 3CQZB 1V43A 1T5XD 5ELBA 5EPJA 5JPMC 1WTQA 3NBIA 2F3VA 1F2MA 2A68D 4N9TA 2NBFA 1HQMC 3I73A 1PDQA 1PTOD 1BF4A 3VR5A 1G6ZA 4HN7A 4PNYA 4NMZA 4BBSB 2D9UA 5EKKA 1VMCA 1WTXA 3H6MA 3T53B 1SYEA 2E2DC 2LS01 4K6LA 5BN4A 3NXWA 1D1KA 2J0TD 1E2VA 2BDOA 2LMCB 3Q22A 2SDFA 1HCZA 1I4QA 3K5MA 5I9OA 4BY1B 4B9XA 3MHBA 3J81L 5KYLA 3R8BA 4DAPA 1CQVA 1WTWA 4XYOA 5C5LA 5HURA 2B39A 1Y1WB 1WTOA 3I90A 5CBAE 3S2DB 2E76C 3ZYYX 1V8QA 1BOSA 1IKLA 3HOZB 2K7VA 1SFOB 1XXGA 2B2UA 1GUNA 1CHPD 3HG9A 1A2UA 1D2BA 3J7AV 1JOOA 4G7ZC 1Q12A 1D5ZC 4K14A 5FO7B 1HA6A 4RGNA 5EQ0A 2BE5D 2E75C 1GXDC 3SK6A 1MSGA 2PZUA 4IALA 2EJMA 1ZXTA 2KVMA 3A8KE 2SNMA 2WINB 2IX0A 3K5NA 3MWYW 3P20A 2KEDA 1QJOA 1H9MA 1FYCA 3S1QB 3F2UA 3U9SA 4FVMA 3TP8A 5JOBA 3NK9A 3FKIB 2EYHA 1GHJA 2R3ZA 1BCPB 5FLXL 3MTSA 2L5TA 1RODA 3RMHA 4IQZA 3BZDB 4X3SA 3FPPA 2RVLA 3A54A 2R61A 3I70A 4FO2A 5DM73 3MAQA 1R4PB 5I6YA 2R92B 4R9WA 2EY1A 4ILWA 1L0XB 1NAPA 1TS3A 5EPKA 2YYZA 3QIAA 1TWGB 3D6CA 5D65A 1EY7A 3HGBA 1X32A 2PZTA 1TS5A 3D4DA 1C4QA 3BDLA 2A6HD 2F0JA 5BN3A 1Q3LA 2R93B 3MXUA 1JWSD 2G9DA 3TZDA 2PCFB 3OPOA 1SNOA 3V2TA 2OEOA 4RKLA 3I3CA 3SR1A 5EKLA 3J7YW 5IOCA 3E0JA 4U68A 4Q0FA 1IHZA 4JK1C 3J80E 4MHEA 3NWSA 4ODGA 3DUZA 1XTCD 2MJ8A 2M2LA 5EKIA 3BS1A 4ZK9B 3GTKB 3TBIB 1TQOA 4DAYA 2PMZB 1H9SA 3OOCA 3X3NA 1PZID 2WP8J 1MI2A 1B4OA 4XT1B 5DAUA 4HSVA 1STEA 1U9RA 5HGTA 3HOYB 1DM0B 1Z6HA 2A6EC 3TP7A 3D4RA 1CQFA 1QWYA 1NR2A 4HMIA 4KHZA 1CTMA 1XWEA 2Y0SB 3HRZC 2KA7A 3R93A 4DXFA 1BBXC 1UNSA 3S1NB 1RJTA 1HPCA 1F77A 1LTSD 3K58A 3JAME 3MC0B 4C1NK 1TY2A 3M3YB 1A2TA 1AW7A 1XYIA 4RGOS 1SXTA 1AZPA 3CHBD 1HHVA 1BO0A 1SE3A 1LV9A 1UUPA 1YNNC 1C8CA 1SNDA 4OIJA 1JB3A 1BR9A 2TMPA 4EQNA 4X3UA 5LL6X 3HP3A 1EYAA 5A2QL 4V0BA 3C3LA 1IYUA 5D3IB 2K32A 5ELCA 1ILQA 4FYDA 1AN8A 3NE5B 3VR3A 1EEFD 4BWGB 1Y8NB 1E0BA 5DEHA 4KN4C 2KCCA 2AUJD 1SE4A 1SYBA 5KNCA 1LT4D 1H9JA 1L0YB 1FGBD 2JP1A 1AFPA 1MBYA 2SNSA 3NQIA 2F0EA 2WV6D 2IW3A 4Q5VA 1PFBA 2WACA 2E2JB 3W3AA 1TIID 1MSHA 2IX1A 3NTKA 2XNAC 1V1PA 3AU7A 5F2DA 5IGEA 2ZXPA 2QEJC 1JORA 2F0TA 2HDLA 1MD2D 2XWJB 1ZKOA 5CGKA 1PTOF 1SEBD 3PV0A 5C0XH 4ZRZA 3LWUA 2O5JC 2JA5B 1KABA 3Q23A 2IPKD 4LMQD 1ENAA 2RDHA 3KLSA 1GHKA 5C0XG 4XYQA 4DN4M 2X6LA 2Z8LA 2ENBA 3BVGA 3PUVA 3S1RB 2IX3A 3ITPA 1LTBD 3N6RA 5J39A 2F0DA 3X3MA 1EYDA 4A3JB 4NDXA 1SBBB 1E2WA 3Q24A 3IKJA 5KIXA 3TZUA 5CV9A 1F9SA 1F9PA 4IUNA 4F88A 1JICA 1ESRA 1YNJD 5KYIA 4IURA 5E3FA 4TQUS 1HQRD 1FNUA 4GZYC 1LTTD 3SE0A 3PUXA 5C3XA 5CV8A 3C46A 2B63B 4RH6A 1DOKA 4J8QA 4C3HB 5C4ZA 2B2YC 3QWNA 1BQQT 1TR5A 3HEJA 2IJ0A 5KNBA 3EFXD 4IUPA 2NVTB 3CKIB 4ZLTF 1O80A 2EYPA 5LL6S 2PQEA 1NUCA 1WVLA 3TMEA 2CVRA 1GUGA 2EYFA 1KTKA 2O5IC 5CV7A 4C3HG 1KAAA 2SEBD 1I4HA 3AB9A 1S5FD 2NYZD 1TVXA 5FOBB 3HS0C 3AMUA 1PRTD 1V1OA 1ONLA 3JAML 5CC4A 1A3TA 2XVSA 3VA7A 4K8JA 4QIWB 3A8IE 1O78A 2EJGC 1Y8PB 5T1GA 4G4KA 5JVH3 3D6WA 3K6OA 1EY4A 2F1MA 1S5ED 3BVZA 3C1EA 2M9VA 4HAEA 2HUGA 3D8GA 4KHVA 2A69C 1WTPA 2RA4A 3NUCA 1TKWB 1SNMA 2B2WC 3OMGA 4DA2A 2XWBB 3IL8A 1BDOA 2XRQD 2ZXOA 1BUVT 3GQBA 1KLGD 1TS2A 4DK0A 1A15A 4XQJA 3RLFA 1GOZA 1PYWD 1PTOH 2ZXRA 4RHSA 4ZQ3A 1RCVD 2JA8B 4QUFA 2F03A 3S14B 4EQOA 4OIKA 4CKEA 3FPUB 4RFBA 3WOFA 4TRDA 3HOXB 1G91A 3I91A 4FP5D 3Q0AA 3GTMB 1A3UA 4K5VA 4TKOB 2EYJA 2JEBI 4WORA 3GP7A 3EVQA 3OWFA 2BOSA 3L7ZC 4XDXA 2F0OA 1PXUA 2PW5A 4QB4A 3K59A 1ICWA 4FF1A 3M7NA 2Z4HA 3VR2A 5M5YB 2NWGA 5I4DA 2R7ZB 2H1EA 5CR3A 4F87A 4L6TB 3HKZB 4WFN3 2KEEA 1RHPA 4CJ2C 3N52A 3A55A 5C3EB 5IT9E 1FNVA 3V05A 3H09A 2QKIC 4QF4A 5KGUA 2CW0C 1EL0A 5IGGA 2NZ1D 2BE5C 1JQYD 1JE4A 4NKLA 1LT3D 2Q8TA 3QOJA 3LWEA 4M1UB 1I4GA 1GUOA 1WD0A 5M5WB 3QOLA 5ELFA 2JSOA 4PMWA 3W2DA 4KMUC 3VYUA 1SMYD 2SOBA 1EEID 5M9OA 4OO1H 1FR3A 4C56C 3MFYA 5C44B 2AWNA 2F0NA 4HCEA 3GTJB 4OO1G 1ZEQX 3BDCA 5K5PA 2WB1B 1TWCB 3DHQA 1O7ZA 1EIHA 1EIGA 4QUCA 1BCPC 3WOEA 4RKBA 3K5LA 1SSOA 2FMMA 4KKUA 2Z4IA 2L11A 2QF7A 1JWMD 2O4XA 2EOTA 3HOUB 1JC7A 3L9AX 4PMCA 1PFMA 2A6HC 3DXJC 4H0LC 1GJXA 4K5WA 2Q8RE 3HOVB 2E2HB 4LK1C 4LJZC 3A7LA 3UI2A 2YU9B 3RZDB 4H44C 5M3MB 1VMPA 2OF1A 4EQPA 3T51B 5A35A 4XQNA 1B2TA 2LKVA 1DOMA 1JCKB 2K1BA 2K5WA 5C0XI 5D3DA 2A6ED 1HUMA 3PUZA 2NN6H 4IFDH 3CRLC 4RGMA 1NR4A 4EVOA 3R2TA 2OXPA 2E2IB 2XRSD 4O42A 4CKCA 1K8OA 1LTRD 1JOKA 1OXVA 1II3A 3TDQA 1W6KA 4YIJA 1QB5D 1PZKD 4CGYB 3ND8A 5C0XJ 5FO9B 2F0VA 1PMRA 2MHVA 4X3TA 1EY5A 2MPMA 1J8IA 3KLSX 4J1MA 1Z47A 1F2YA 1STYA 5I6WA 3PUWA 1EZ6A 4P2CB 2PZWA 1IYVA 2OT2A 4WJWA 2WIIB 2BA0A 1UEAB 4OGQC 2K01A 1B53A 1YNND 4ZAIA 3HOWB 2O2LD 2TSSA 3R3OA 4A3BB 5M5XB 5I2XA 2A73B 5EGTA 3E6ZX 4A3GB 2PO4A 1U4PA 1EY6A 2NUCA 2MP1A 4RGTA 5E1FA 5C4JB 1SYFA 4ABNA 3FDTA 1NCVA 2F0GA 4RA8A 5JVG3 1DZ1A 2A74C 1B44D 4DNRB 4TSSA 2JEAI 1U4MA 3SK8A 3I8ZA 2F0MA 4RCNA 1PRTF 4C3JB 1LT6D 1CM9A 2A5HA 1X3PA 1LLRD 3GTLB 1A6XA 1STAA 2L4NA 5JPNC 3OWEB 3M4OB 5IGBA 5J1ZA 2RQXA 4KY6A 2X6GA 2EZVA 2B2YA 4C3IB 4FXKC 3ERQA 1SNPA 2PW7A 5T1IA 2PPBC 5EPLA 5I9PA 5EBCA 1B9NA 4K8IA 5K36H 4I65A 2H4OA 1NSNS 2LY7A 3O13A 1C48A 3C1FA 5TSSA 5K36G 3J81E 1LABA 1CI3M 1HA5A 1LTID 3BG3A 1RD9D 1EWCA 2HQEA 3LX0A 2VNUD 4KJNA 5C4XB 4FF2A 4ME5A 2EXZA 4Z9CB 1S5CD 4PMBA 1I4PA 2CQAA 1Y8OB 4HMJA 4A3IB 1TT2A 2EJFC 1DJRD 3E5SA 1RKNA 1WTRA 2K5QA 3EQLC 2EVBA 1KNEA 2JXMB 4PQXA 1DD2A 1IL8A 1IW7C 5M3FB 1LTAD 2F3WA 3I4MB 3C2PA 3TP6A 2B8GA 1S4ZA 3MXGA 3J80L 2AQ2B 2WKDA 3Q6SA 2K05A 5COYA 2RDGA 1ML0D 3M7GA 3H94A 2D62A 3KUPA 3A8JE 2L9HA 2D2CC 1HXYD 2L0CA 3MZ5A 2RSOA 3MEHA 2VUMB 3URYA 3BDOA 1ZYRC 3MA2B 2LFNA 1HRJA 2B2WA 2Q8IB 3OMCA 2B8FA 5IGDA 1EOTA 4KI0A 1B9MA 1EY9A 2I46A 1QNUA 2RDFA 4CKBA 1OO9B 2FJ2A 5EJWA 4CBVA 4RAUC 4KJOA 2J7ZA 3NSWA 3H3VC 5CV6A 4MIUA 2WKCA 3KLRA 2EYLA 1QG7A 2NTSA 2QILA 5BN5A 3MFGA 5FO8B 1I6HB 3NBHA 5AFWA 4MN3A 2L1BA 5JEAH 2EE1A 2E74C 1TU2B 3KF8A 1U4RA 2F0PA 5G3LD 3S16B 2MGSA 1R9TB 1H9RA 2VB2X 5JJZA 5JEAG 1A3VA 1DCZA 1ESFA 2JA7B 1KLUD 2FINB 2RSNA 3D4WA 1SNCA 1SJED 2FHTA 1G2TA 3MXPA 1JWUD 4HEDA 2JYOA 1QNKA 3QJYA 1CT1D 1PTOB 3NTHA 4IN3A 3T13A 3K57A 3PO2B 4ULLA 1F2ZA 4HTHA 1RF2D 2DN8A 2F0SA 5CYUA 1BNZA 1EQVA 4UAIA 3DWAA 3OHXC 3VA5A 2F0UA 2PNRC 2F0QA 4K2LA 4U673 4OO1I 2B2TC 4ZKBB 4XT3B 4DGZA 2KOLA 4HSPA 1QILA 1CZGA 5C6AA 1R4QB 2L12A 1IKMA 5C4HA 2A68C 2KCNA 3VYTA 1Q1EA 3QB3A 1PTOC 1CFMA 5ISRA 1SYGA 4CHTB 3RUZA 5ELEA 3SHLA 1OXTA 2C5CA 1SE2A 1F2LA 1KDCA 4OL7A 1OXUA 2I07B 3GTQB 2DNEA 3NP8A 2F0IA 4BA1I 2R6GA 2G9HD 3U9OA 1K83B 4XXEA 3PUYA 2EY6A 3NQTA 2NVQB 4RCOA 1HFGA 2NB0A 4XQQA 2N55A 3GTPB 5A2QE 3DEOA 1AP0A 1SDFA 4AYBB 2NN6I 1AEXA 4IFDI 4K6DA 4DNTB 4H13C 3EROA 1EZ8A 1B3AA 1ILPA 2F0LA 2CW0D 4KY5A 5I2YA 1PZJD 1VCIA 2B2VC 1LO5D 4L63B 4RHRA 1OXSC 2AWOA 1XX8A 4IFDJ 4DAVA 1TWAB 4B08A 2IT1A 2KJXA 3BVMA 4KTAA 1O7YA 1I4RA 1W6JA 3K7AB 2QDBA 1VDZA 1TY0A 5IGCA 3A7AB 4F8MA 1Q1BA 1STHA 2EY2A 4A93B 2FMCA 4FXGC 4QCLA 4A3EB 3VYRA 1QCBD 1SAPA 4OHJA 1UAPA 1BCPD 1LT5D 2AQ3B 2QCPX 4KD3A 4EGVA 2NVXB 2HDMA 1O7LA 1S5BD 3BYYB 1SMYC 4FF3A 2K5DA 1GUTA 5IODA 5J22A 1I6VC 4ZKCB 4Y7NB 4DK1A 3D3RA 3FMCA 2RKSA 1JR0D 3IFTA 2Z1CA 5IGFA 2B2UC 2EY5A 3FVQA 3T16A 1DYQA 4IZ8A 3L3OC 1B1ZA 1STNA 4RWSC 1M4VA 1EQTA 3HZXA 3GD7A 4BBRB 4R8NA 3VYSA 5IIFA 4M8AA 1X3QA 1RTNA 2XSCA 2HCCA 2MUYA 1D1IA 1G8ZD 2CHBD 4NP5A 3I72A 3VR6A 2J4XA 3IFDA 3R2IA 4JBWA 2KUMA 2F0FA 5DNFA 2NN6G 2AQ1B 1D6EC 4IFDG 3GTGB 1K8MA 1EWHA 2ID0A 1FD7D 4IUTA 1SYDA 4FF4A 3OSOA 3T56B 5KNDA 1J9OA 4KN7C 3S1MB 1BXTA 1WTVA 4HR7B 1VF5C 1F9QA 3K5OA 4B9WA 2EDGA 3G7LA 3NHHA 3M4YA 3PIO3 2DY7A 1KDAA 2DY8A 4NW2A 3H91A 2FFKB 5KEEA 2RBMA 3NTIA 2K04A 3IAYA 1Y69U 1S5DD 3GV3A 3TP5A 3GTOB 1HTLD 1F9RA 2WAQB 4ZUJA 4G7OC 4L8JA 1H9SB 2ICEC 3CRKC 3H0GB 1B50A 4WRDA 1CA6A 1CA5A 3D31A 2KECA 4KK7A 4H7BA 3P1HA 3CU7A 2XIWA 4IUQA 1CK1A 5G3LF 1D5MC 2JA6B 3S9WA 3OW7A 1DXMA 4CJ0B 4V190 5CORA 1WCMB 4CJ1B 3SDZA 1ENCA 4DU9A 2KHSA 1EFID 3BYTB 2BA1A 3TN2A 3SVMA 2NTTA 4O1NA 1EY8A 1WD1A 2F0HA 1G2SA 3OIQA 4E6IA 1AZQA 3EJIA 2GA4B 3QG1A 1SNQA 1T5EA 2X69A 4FXDA 1VF7A 1QOHA 4I7ZC 1I4XA 5IT9L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SND A;  3EVQ A;  3OWF A;  3BDC A;  4LAA A;  5K5P A;  4KJO A;  4KD4 A;  5J39 A;  2F0D A;  5IGC A;  5CV6 A;  4EQN A;  4ODG A;  3QB3 A;  2EYO A;  4MIU A;  3DHQ A;  4J6H A;  1SYD A;  1EYD A;  4NDX A;  4F7X A;  5ISR A;  1SYG A;  3OSO A;  4DF7 A;  2EYL A;  2F0O A;  1EYA A;  3SK6 A;  4F8M A;  5CC4 A;  2PW5 A;  4QB4 A;  1STH A;  5CV4 A;  3RUZ A;  3SHL A;  3SK4 A;  2EY2 A;  2F3V A;  2PZU A;  1F2M A;  4IAL A;  5KIX A;  5CV9 A;  2HQE A;  3ITP A;  3LX0 A;  4RKB A;  3PMF A;  4KJN A;  1A3T A;  4IUN A;  4N9T A;  2M00 A;  3R3O A;  5KRU A;  4ME5 A;  2SNM A;  2PYK A;  2O4X A;  5KYI A;  1KDC A;  5EGT A;  2PZW A;  5E3F A;  2EYM A;  5CR3 A;  4K8J A;  2EXZ A;  1KDB A;  1TQO A;  4OL7 A;  2F0P A;  4PMB A;  5DEH A;  4B9W A;  3NP8 A;  1EY6 A;  1SYB A;  2NUC A;  4PMC A;  2F0I A;  5CV5 A;  3NHH A;  4HMJ A;  4PNY A;  4KD3 A;  5E1F A;  1TT2 A;  4NMZ A;  4QMG A;  1KDA A;  1STB A;  5EKK A;  1A3V A;  3TP8 A;  3U9O A;  1SYF A;  1EY0 A;  5JOB A;  5C3X A;  5KEE A;  2RBM A;  4K5W A;  5CV8 A;  3E5S A;  5NUC A;  1RKN A;  2F0G A;  5DAU A;  2EY6 A;  2SNS A;  3H6M A;  3NK9 A;  3NQT A;  2EYH A;  1EY4 A;  1SYE A;  4S3S A;  2KQ3 A;  2F0E A;  4KY7 A;  1JOQ A;  3C1E A;  3NXW A;  5C4Z A;  1U9R A;  5HGT A;  3SK5 A;  5IOD A;  1TR5 A;  3D4W A;  3SK8 A;  5J22 A;  3HEJ A;  3TP7 A;  1SNC A;  3TP5 A;  2F0M A;  2WAC A;  3P75 A;  4ZUJ A;  4KHV A;  3D8G A;  2RKS A;  4QF4 A;  4HMI A;  2F3W A;  3NUC A;  2OF1 A;  4EQP A;  3TP6 A;  5KGU A;  3MXP A;  1SNM A;  2EYP A;  5F2D A;  5IGF A;  5IGE A;  3OMG A;  1AEX A;  4WRD A;  2LKV A;  5I6Y A;  1SYC A;  5IGG A;  2EY1 A;  2PQE A;  2EY5 A;  4K6D A;  3SXH A;  4G57 A;  2F0T A;  4B9X A;  5I9O A;  1NUC A;  3MVV A;  3T16 A;  1JOR A;  4IZ8 A;  3MHB A;  3ERO A;  5KYL A;  1EZ8 A;  5CGK A;  1STA A;  3D6C A;  4H7B A;  3P1H A;  1EY7 A;  3DMU A;  3T13 A;  4NKL A;  4EVO A;  5C5L A;  1F2Z A;  3TME A;  5HUR A;  4HTH A;  2PZT A;  3QOJ A;  5IGB A;  1STN A;  2F0L A;  3D4D A;  4ZQ3 A;  5J1Z A;  4KY5 A;  2OXP A;  1KAB A;  3BDL A;  4KY6 A;  3S9W A;  2F0S A;  2F0J A;  1ENA A;  1EQV A;  2EYF A;  3QOL A;  3ERQ A;  3HZX A;  4K5X A;  5C3W A;  3MZ5 A;  1JOK A;  1EYC A;  1SNP A;  1ENC A;  2F0K A;  2PW7 A;  3MEH A;  4N9P A;  1II3 A;  4R8N A;  3VA5 A;  2F0U A;  2KHS A;  4DU9 A;  5JAV A;  2F0Q A;  5CV7 A;  5C5M A;  4K2L A;  1A2T A;  1SNO A;  4YIJ A;  4EQO A;  5IIF A;  3V2T A;  2SOB A;  1KAA A;  4DGZ A;  2OEO A;  4RKL A;  5I9P A;  1EY8 A;  4TRD A;  3SR1 A;  5M9O A;  2ENB A;  5EKL A;  2F0H A;  4ID6 A;  5IOC A;  2F0V A;  4K8I A;  1EY5 A;  3OMC A;  5IGD A;  4I65 A;  4E6I A;  1A2U A;  4KV6 A;  3EJI A;  4NP5 A;  4J1M A;  4ZUI A;  1NSN S;  5C6A A;  1IHZ A;  1A3U A;  1EY9 A;  1SNQ A;  4K2K A;  1F2Y A;  1STY A;  4K5V A;  4KTA A;  2EYJ A;  5I6W A;  1JOO A;  1EZ6 A;  2RDF A;  4WOR A;  4DFA A;  2F0N A;  5C4H A;  1STG A;  2QDB A;  4K14 A;  2F0W A;  2F0F A;  3C1F A; 
#chains in the Genus database with same CATH topology
 2JA6 H;  1KIX A;  1PLF A;  2K6A A;  5D14 A;  4DXG A;  3NWT A;  2VXW A;  5FKA C;  1ENF A;  1WCM H;  4ZCK A;  3ONA B;  3V96 A;  3AFP A;  3FEW X;  3S15 B;  4DF7 A;  3W5O A;  2JA6 G;  3KK7 A;  3SK4 A;  1FJG L;  3KDF B;  3G4S A;  1E1O A;  4LF4 L;  3FP9 A;  1WCM G;  4FNF A;  3DWQ A;  1Q90 A;  4C3J G;  2BH2 A;  2PYK A;  4A76 A;  4PV1 C;  1N36 Q;  2EYM A;  2ZT9 C;  4P71 A;  1EU4 A;  2DNC A;  3G6J B;  4JI8 L;  4POG A;  1H95 A;  3ND9 A;  1U5K A;  2C9O A;  1RDP D;  3PIP 3;  2ICI A;  4UPA A;  3I4N B;  1EY0 A;  4X6A H;  1Z7T A;  3VR4 A;  3WDN A;  2F4V L;  1LAC A;  4KKS A;  4QY7 A;  2KQ3 A;  5IYD H;  4C3I G;  4KY7 A;  5JEA J;  2AUK A;  1JOQ A;  1E1T A;  4IUU A;  3F2D A;  1VQ5 A;  2K33 A;  3QO2 A;  2UXD L;  1ET9 A;  2ZM6 L;  2E2J H;  3ULL A;  4R8I A;  1PH4 A;  1HFN A;  1YI2 A;  5LHY 1;  4JG2 A;  1SYC A;  4XTC S;  1Q8I A;  4YWL A;  5ELD A;  2F3I A;  2IL8 A;  4G57 A;  3SXH A;  3MVV A;  1IW7 D;  1I5F A;  3I4N H;  4MZ9 A;  1X55 A;  1PH3 A;  4LFC L;  4GOP B;  4G7H C;  2BDN A;  3J7A F;  4ZYS A;  1NTG A;  5E4X A;  2JA5 H;  1TWF B;  5GAG C;  4A3F B;  4KKT A;  1QE6 A;  2I5L X;  4HJ9 A;  4A3D B;  1EYC A;  1K8G A;  2F0K A;  1GUS A;  5JAV A;  1V1P B;  2KCT A;  3HFZ B;  1DON A;  2K03 A;  5EBD A;  1WJJ A;  1PFN A;  3DEP A;  3OTO L;  1E2Z A;  4A3K B;  5CMD A;  3P7J A;  3MXN A;  4K2K A;  4BY7 B;  2IWH A;  4DFA A;  2K28 A;  1STG A;  3UDI A;  1ZYR D;  2F0W A;  4X3K A;  1NJI C;  1CHQ D;  4JI2 L;  1NE3 A;  3RLO A;  3GO5 A;  2NVY B;  4KD4 A;  1TWF H;  1Y1V B;  2JE6 I;  1VQM A;  4JBK A;  2HCI A;  1YNJ C;  4A3F H;  2EYO A;  1VS0 A;  4A3D H;  4J6H A;  1RTO A;  3PO3 B;  3A0J A;  4F7X A;  1SJH D;  2VB3 X;  5FLX E;  4GOP C;  2EPB A;  5CV4 A;  2B2T A;  3M85 A;  4A3J H;  1GUW A;  2N88 A;  1P16 A;  5M3F G;  3KJO A;  3PMF A;  4HCS A;  4FDB A;  2BCO A;  2V4D A;  2E5L L;  2KEN A;  2M00 A;  2XN9 C;  5KRU A;  3I4M G;  4AH6 A;  3F2C A;  4ALP A;  4A3K H;  2Z9H A;  1KDB A;  3SEB A;  4LF8 L;  4UDU C;  4BY7 H;  5CV5 A;  4C1N I;  4QMG A;  1STB A;  3KBX A;  5NUC A;  3KBG A;  2G5D A;  3DWP A;  1D5X C;  3PO3 H;  5CBE E;  3S24 A;  1D8L A;  3T4A C;  1N33 Q;  1X54 A;  4S3S A;  4B3S L;  3PF5 A;  1M8A A;  3MEF A;  3SK5 A;  2D0P A;  1Y1V G;  2R7F A;  3CCL A;  1HR0 Q;  4C3H H;  2VUM G;  3TSS A;  4A3M B;  1PRT B;  5FK9 C;  3P75 A;  3CCR A;  3LNN A;  1ET6 A;  2F4I A;  3DM3 A;  5IP9 H;  3DM1 A;  4OWW B;  3S2H B;  4LF9 L;  1DOL A;  4BS9 A;  4OEM B;  3K0Y A;  2VQE Q;  1H9K A;  3NPP A;  3I2Z A;  1I50 B;  4C2M B;  1CZW A;  2ZTE A;  3DMU A;  3A56 A;  1HUN A;  1TS4 A;  3FRP B;  1I3Q B;  1N32 L;  3UE1 A;  5H1S E;  3RD4 A;  4MTK A;  1HTP A;  1BCP F;  1Y14 B;  4IO9 A;  1WOC A;  5DM6 3;  2I5M X;  3GV6 A;  2UUB L;  1U4L A;  4A3M H;  4K5X A;  5C3W A;  3RR5 A;  4N9P A;  1MIU A;  1OTC A;  4DAM A;  5C5M A;  4L5T A;  4K0K Q;  3QR8 A;  1XMO Q;  5GAE C;  1WI5 A;  2L55 A;  3S2H H;  3S17 B;  1K0R A;  1KNA A;  4ID6 A;  2R7D A;  1TWH B;  1EU3 A;  1PRT C;  4IUV A;  4KV6 A;  4P74 A;  5E4W C;  3RZO B;  1I50 H;  2A69 D;  4ZUI A;  1MGS A;  4BA2 I;  1OXX K;  1I3Q H;  3OIP A;  3EA6 A;  1PV4 A;  2D5D A;  1LTG D;  1FNW A;  3I4L A;  2YTV A;  4LAA A;  2DJG C;  2B2V A;  1MJE A;  4X62 Q;  1G29 1;  4XIG S;  3T1Y L;  3CQZ B;  1V43 A;  1T5X D;  5ELB A;  5EPJ A;  5JPM C;  1WTQ A;  4QQB X;  3NBI A;  2F3V A;  1F2M A;  3L0O A;  4AYB E;  2A68 D;  4GS3 A;  4N9T A;  4JOI C;  2NBF A;  3HKZ E;  1JB7 A;  1HQM C;  1TWH H;  4YHH Q;  3CD6 A;  4BXX G;  2KCM A;  3I73 A;  1PDQ A;  1PTO D;  3RZO H;  2QW7 A;  1BF4 A;  3VR5 A;  2K5V A;  4R4O A;  1HJP A;  2OWO A;  1G6Z A;  2YV5 A;  4JBM A;  4HN7 A;  1S3O A;  5DLQ E;  4PNY A;  4NMZ A;  4BBS B;  2D9U A;  5EKK A;  1HNZ L;  1VMC A;  1WTX A;  3CPF A;  3CQZ H;  1X56 A;  2HHH L;  3H6M A;  3T53 B;  4L5R C;  1SYE A;  2CWP A;  2E2D C;  2LS0 1;  4K6L A;  5BN4 A;  4IOA A;  3NXW A;  1D1K A;  2J0T D;  1E2V A;  2BDO A;  1PFS A;  4R1J A;  2LMC B;  3Q22 A;  3CCS A;  2SDF A;  1HCZ A;  4HIM A;  3B6Y A;  4B3T L;  4UP8 A;  3CCJ A;  1I4Q A;  3K5M A;  5I9O A;  4BY1 B;  4B9X A;  3MHB A;  3J81 L;  5LMN W;  4YCW A;  5KYL A;  3R8B A;  4DAP A;  1CQV A;  1WTW A;  4XYO A;  5C5L A;  5HUR A;  2B39 A;  1X65 A;  1Y1W B;  1WTO A;  1WFQ A;  3U4Z A;  4BBS G;  1N32 Q;  1A8V A;  3I90 A;  5CBA E;  3S2D B;  2E76 C;  3ZYY X;  3PF4 A;  1V8Q A;  1BOS A;  1IKL A;  3HOZ B;  1VQF A;  2K7V A;  1SFO B;  1XXG A;  2B2U A;  1GUN A;  3CMA A;  1CHP D;  3HG9 A;  4BY1 H;  3HOX H;  1A2U A;  1D2B A;  4JI1 Q;  2LSS A;  1KHI A;  4R4T A;  3J7A V;  1GVP A;  1A0I A;  5AJ3 L;  1JOO A;  1YIJ A;  4DR3 L;  2KBN A;  4G7Z C;  1Q12 A;  3GTM H;  1D5Z C;  4K14 A;  1S72 A;  5FO7 B;  1HA6 A;  1Y1W H;  4RGN A;  4HID A;  5EQ0 A;  2BE5 D;  2I5H A;  2ZJR A;  5GAH C;  4IPC A;  2E75 C;  1GXD C;  1JJC B;  3SK6 A;  2OQK A;  1KRS A;  2UXB Q;  1MSG A;  2PZU A;  4IAL A;  3HOZ H;  1EOV A;  4JI6 Q;  2EJM A;  1SFO H;  1ZXT A;  1S40 A;  1AE2 A;  2KVM A;  3A8K E;  2SNM A;  2WIN B;  2IX0 A;  3K5N A;  3MWY W;  3P20 A;  2KED A;  5M5Y H;  1QJO A;  1H9M A;  3HOZ G;  1FYC A;  1GD7 A;  3S1Q B;  5EAY A;  3W1B A;  3F2U A;  3U9S A;  4FVM A;  4J15 A;  3TP8 A;  5JOB A;  3KLW A;  2K4K A;  3NK9 A;  3FKI B;  2EYH A;  1GHJ A;  2HHH Q;  2R3Z A;  1BCP B;  4LUZ A;  4MNO A;  2EXD A;  5C3E H;  5FLX L;  1WTH A;  4CDC C;  3MTS A;  3OYY A;  4A4I A;  4DV2 L;  5FLX c;  2L5T A;  1ROD A;  3RMH A;  1CKO A;  1YEZ A;  4IQZ A;  2UXC Q;  3BZD B;  4X3S A;  3FPP A;  1PH6 A;  2RVL A;  3A54 A;  2JJQ A;  1C0A A;  1ICF B;  2R61 A;  3I70 A;  4FO2 A;  5DM7 3;  3MAQ A;  1R4P B;  2UUA L;  3S1Q H;  5I6Y A;  4PZ7 A;  2R92 B;  4R9W A;  2EY1 A;  1J5E Q;  4ILW A;  1L0X B;  1NAP A;  4B3T Q;  1TS3 A;  2YYZ A;  3QIA A;  1TWG B;  3D6C A;  4GN5 A;  5D65 A;  5EPK A;  1L0W A;  1EY7 A;  3HGB A;  3FKI H;  1X32 A;  5FLM G;  2PZT A;  4DUY L;  1TS5 A;  3D4D A;  1C4Q A;  3BDL A;  1B3Q A;  2K5H A;  4PG3 A;  4KHP L;  4X65 L;  2A6H D;  1PVO A;  2F0J A;  5BN3 A;  1Q3L A;  2R93 B;  3MXU A;  3FHW A;  3RNU A;  1JWS D;  2G9D A;  3TZD A;  4ME3 A;  3FKI G;  3BZK A;  4A3L H;  2PCF B;  3OPO A;  1SNO A;  1KRT A;  2K75 A;  4IOC A;  3V2T A;  2OEO A;  4RKL A;  3I3C A;  3SR1 A;  5EKL A;  3J7Y W;  5IOC A;  3E0J A;  3K0X A;  1VQG A;  4U68 A;  4LNQ A;  2HIX A;  3ZJY C;  2R92 H;  4Q0F A;  4DR1 L;  3I4O A;  1IHZ A;  4JK1 C;  3J80 E;  5C44 H;  1XPU A;  5IYC H;  4MHE A;  3NWS A;  4ODG A;  2R93 H;  3TQY A;  4PZ8 A;  3DUZ A;  3CC2 A;  1XTC D;  2MJ8 A;  2M2L A;  5EKI A;  1V1Q A;  3BS1 A;  2R93 G;  3AYH B;  1VQO A;  1E24 A;  4ZK9 B;  5BR8 Q;  3GTK B;  3TBI B;  4YWM A;  1M90 C;  3H15 A;  1TQO A;  4DAY A;  2PMZ B;  1H9S A;  1SRU A;  3OOC A;  3X3N A;  4IPH A;  2BH8 A;  3HOU H;  1PZI D;  2WP8 J;  4CDD C;  4R4I A;  1MI2 A;  4GNX B;  2ZTC A;  1B4O A;  2CKZ B;  4XT1 B;  5DAU A;  3CAM A;  3J81 i;  4HSV A;  1DGS A;  1EQR A;  1STE A;  1U9R A;  5HGT A;  4BBR G;  4JCV E;  3HOY B;  1DM0 B;  1Z6H A;  2A6E C;  2ZJP A;  3TP7 A;  2CFM A;  3D4R A;  4LW1 A;  1CQF A;  3GTK H;  1HR0 W;  4DR5 Q;  1QWY A;  1NR2 A;  4HMI A;  4JV5 Q;  2MFI A;  5M3M H;  4KHZ A;  3U50 C;  4LFB L;  2Q2U A;  1K73 C;  4YY3 Q;  1CTM A;  1XWE A;  2Y0S B;  3HRZ C;  2KA7 A;  4NXN L;  3R93 A;  4DXF A;  1BBX C;  4JYA Q;  1UNS A;  3S1N B;  1SR3 A;  1RJT A;  1EYG A;  2JN4 A;  4OON A;  1HPC A;  2OTJ A;  1F77 A;  1VQD A;  1K3B C;  3KYH C;  1LTS D;  3K58 A;  3JAM E;  3MC0 B;  5GAD C;  3HOY H;  4C1N K;  1TY2 A;  4GNX C;  3M3Y B;  1A2T A;  1AW7 A;  1HZC A;  1XYI A;  3BU2 A;  2I0Q A;  2N8N A;  4LFA L;  4RGO S;  4N8X 1;  3STB D;  1SXT A;  1AZP A;  3CHB D;  1HHV A;  1BO0 A;  1HNX Q;  4L5S A;  1SE3 A;  3EN2 A;  1LV9 A;  3S1N H;  1UUP A;  1YNN C;  5FJ8 H;  1C8C A;  1XNR Q;  2IHE A;  1SND A;  2Y0S G;  1UE6 A;  4OIJ A;  1JB3 A;  1BR9 A;  4LF6 Q;  2TMP A;  4O0A A;  4EQN A;  4X3U A;  5LL6 X;  3M3Y H;  3HP3 A;  1EYA A;  5A2Q L;  4V0B A;  1E22 A;  1IYU A;  3C3L A;  5D3I B;  2K32 A;  2WAQ G;  5ELC A;  1ILQ A;  1KD1 C;  4HJ5 A;  4FYD A;  1PH8 A;  1AN8 A;  3H0G G;  3NE5 B;  3VR3 A;  1EEF D;  4BWG B;  1Y8N B;  1E0B A;  5DEH A;  4KN4 C;  2KCC A;  2AUJ D;  1SE4 A;  1YHQ A;  2N49 A;  1SYB A;  5KNC A;  1LT4 D;  1H9J A;  3CF5 A;  1L0Y B;  1FGB D;  2UU9 Q;  2CH4 A;  4PZ6 A;  3UE0 A;  2JP1 A;  4GKJ L;  1IBL L;  1AFP A;  1MBY A;  4DR6 Q;  2SNS A;  4P75 A;  3NQI A;  2F0E A;  2WV6 D;  2IW3 A;  4GOP A;  1GM5 A;  4Q5V A;  4DV5 Q;  3RN2 A;  2LXJ A;  1PFB A;  2WAC A;  2E2J B;  4H02 A;  2HIV A;  3W3A A;  2B3G A;  1TII D;  1MSH A;  2IX1 A;  3NTK A;  2XNA C;  1V1P A;  3AU7 A;  1C7Y A;  4DK3 C;  5F2D A;  5IGE A;  2ZXP A;  2QEJ C;  1JOR A;  1I94 L;  2F0T A;  2D0O A;  2HDL A;  1MD2 D;  2RHS B;  3CCV A;  2QA4 A;  2XWJ B;  1ZKO A;  5CGK A;  1PTO F;  4NXN Q;  2L15 A;  1SEB D;  5IWA Q;  4JI3 L;  3PV0 A;  5C0X H;  1PH5 A;  4ZRZ A;  3LWU A;  2O5J C;  2JA5 B;  4GKK L;  4LF7 L;  3M4O H;  1KAB A;  1YZ6 A;  4X66 Q;  2IPK D;  3Q23 A;  1G51 A;  4LMQ D;  1VQB A;  1ENA A;  5IYD G;  2RDH A;  3KLS A;  1GHK A;  5C0X G;  4XYQ A;  2AMC B;  4DN4 M;  2X6L A;  1RIP A;  2Z8L A;  2F52 A;  4DV0 L;  1K8A C;  1ASY A;  2ENB A;  3BVG A;  4L5Q A;  3GDE A;  4LFA Q;  2VW9 A;  3PUV A;  1L1O B;  3S1R B;  1L2F A;  2K5N A;  4R4C A;  1I4X A;  2IX3 A;  4DKA C;  4LWC A;  3ITP A;  1LTB D;  3I4N G;  3T1H L;  3N6R A;  4X64 L;  3AEV A;  5J39 A;  2F0D A;  3X3M A;  4A3C H;  1VQC A;  1EYD A;  4A3J B;  4NDX A;  1SBB B;  2JA5 G;  1E2W A;  3Q24 A;  3IKJ A;  5KIX A;  4YCV A;  5CV9 A;  3TZU A;  1F9S A;  1F9P A;  4IUN A;  4F88 A;  1JIC A;  1ESR A;  2QDL A;  4JPB W;  1YNJ D;  2EQS A;  5KYI A;  1QZG A;  3S1R H;  4IUR A;  5E3F A;  4TQU S;  1HQR D;  1FNU A;  3I56 A;  1PA6 A;  4GZY C;  1CSQ A;  1LTT D;  3J80 c;  3SE0 A;  4A3I H;  3PUX A;  5C3X A;  5CV8 A;  3C46 A;  2B63 B;  4RH6 A;  4WJ3 M;  1IBL Q;  1DOK A;  1X3G A;  4J8Q A;  1LYL A;  4C3H B;  4A3F G;  5C4Z A;  2B2Y C;  2MO0 A;  4A3D G;  3QWN A;  1BQQ T;  1TR5 A;  1FJG Q;  3HEJ A;  4JOI A;  4LF4 Q;  3AQQ A;  4A3J G;  2IJ0 A;  5KNB A;  3Q8D A;  3CCM A;  2PNH A;  3EFX D;  4DV4 L;  1N34 L;  4IUP A;  4DV3 L;  1IYJ B;  1SN8 A;  2NVT B;  3CKI B;  4ZLT F;  1HH2 P;  1O80 A;  1T9H A;  2EYP A;  4JI8 Q;  1XJV A;  5LL6 S;  2PQE A;  4A3K G;  1NUC A;  1WVL A;  2UUC L;  3OW2 A;  3CCE A;  4BY7 G;  2B63 H;  3TME A;  2F4V Q;  2CVR A;  1UE1 A;  1GUG A;  4NPS A;  4RMF A;  3PO3 G;  4GKK Q;  2EYF A;  1KTK A;  2O5I C;  1UWV A;  1Q82 C;  5CV7 A;  2UXD Q;  4C3H G;  2ZM6 Q;  2NVT H;  1KAA A;  1KC8 C;  2SEB D;  4JI4 L;  5IP9 G;  1SE8 A;  1I4H A;  2HT1 A;  2VQF L;  1HNW L;  3AB9 A;  1SLJ A;  1S5F D;  3MXN B;  2NYZ D;  4LFC Q;  1TVX A;  5FOB B;  2K50 A;  3HS0 C;  2N78 A;  3AMU A;  2JK8 A;  3PIO A;  2YTY A;  1PRT D;  2ASB A;  1V1O A;  1ONL A;  3JAM L;  5CC4 A;  2Q2T A;  3JAM c;  1UE7 A;  1YVC A;  4A3M G;  1A3T A;  2XVS A;  3OTO Q;  3VA7 A;  3A74 A;  4K8J A;  4QIW B;  1K9M C;  3A8I E;  1O78 A;  2EJG C;  1BVS A;  4JI2 Q;  1CKN A;  1Y8P B;  1E7Z A;  5T1G A;  4G4K A;  5JVH 3;  2V1C C;  3D6W A;  3K6O A;  3SGI A;  4JI0 L;  1EY4 A;  2F1M A;  1S5E D;  3BVZ A;  3CC4 A;  3C1E A;  2M9V A;  3NBH B;  4GLX A;  2E5L Q;  4HAE A;  1J6Q A;  2HUG A;  3D8G A;  4KHV A;  1Q81 C;  2A69 C;  1WTP A;  3KF8 B;  2RA4 A;  3NUC A;  1TKW B;  1C9O A;  2WFW A;  1SNM A;  3ULP A;  4DV4 Q;  4LF8 Q;  1KL9 A;  3E9H A;  2B2W C;  3OMG A;  4DA2 A;  2XWB B;  3IL8 A;  1BDO A;  2XRQ D;  2ZXO A;  1BUV T;  3GQB A;  1KLG D;  1TS2 A;  4DK0 A;  1A15 A;  4XQJ A;  3RLF A;  1GOZ A;  1PYW D;  1PTO H;  2ZXR A;  4RHS A;  1VQ4 A;  4ZQ3 A;  3PO2 H;  1RCV D;  4B3S Q;  4IPD A;  1KAW A;  2JA8 B;  3F2B A;  4B3M L;  3UDF A;  4QUF A;  1XPO A;  2F03 A;  3S14 B;  4EQO A;  2HQL A;  5HY6 A;  2K14 A;  4OIK A;  3FPU B;  4CKE A;  4RFB A;  4TRD A;  3WOF A;  1YJ9 A;  3HOX B;  4LF9 Q;  1G91 A;  3I91 A;  4FP5 D;  1GKH A;  3Q0A A;  3GTM B;  1A3U A;  4K5V A;  4TKO B;  1Q8K A;  2EYJ A;  2JEB I;  4WOR A;  1HNW Q;  1Q7Y C;  3GP7 A;  2PQA B;  3EVQ A;  3OWF A;  1PYS B;  2BOS A;  2JA8 H;  3PIP A;  3L7Z C;  4XDX A;  2UUB Q;  1MHW C;  2F0O A;  1PXU A;  2PW5 A;  4QB4 A;  3K59 A;  3S14 H;  2JA9 A;  3G48 A;  2AHO B;  3TRE A;  1ICW A;  4FF1 A;  3M7N A;  5IYB H;  2Z4H A;  4UY8 C;  3VR2 A;  5M5Y B;  1EFW A;  4YCU A;  2NWG A;  5I4D A;  2R7Z B;  2H1E A;  5CR3 A;  4F87 A;  3E0E A;  4BY1 G;  3HOX G;  4DR2 L;  1X3F A;  4L6T B;  3GTQ H;  3EIV A;  3HKZ B;  4WFN 3;  2KEE A;  4HJA A;  1RHP A;  1QUQ A;  4CJ2 C;  4OEL B;  3N52 A;  3T1Y Q;  3A55 A;  1Y1W G;  5C3E B;  5IT9 E;  2C35 B;  1FNV A;  3V05 A;  3H09 A;  2Z6K C;  2QKI C;  4QF4 A;  1A63 A;  2R7Z H;  1PHJ A;  5KGU A;  2CW0 C;  1EL0 A;  1MJC A;  5IGG A;  2NZ1 D;  2BE5 C;  4P72 A;  1JQY D;  1HNZ Q;  1JE4 A;  4NKL A;  1LT3 D;  2Q8T A;  3QOJ A;  3LWE A;  4M1U B;  2DJF C;  1K28 A;  1BBU A;  1I4G A;  1GUO A;  1WD0 A;  4B3R L;  5M5W B;  1BKB A;  1VQA A;  3QOL A;  5ELF A;  1W2B A;  2JSO A;  4PMW A;  5C3E G;  3W2D A;  4KMU C;  4B3M Q;  3ICE A;  3VYU A;  1SMY D;  2SOB A;  1EEI D;  3EBE A;  5M9O A;  1IBM L;  2PMZ E;  3KFU A;  4OO1 H;  1FR3 A;  1TWA H;  4POF A;  4C56 C;  4LF5 L;  3MFY A;  5C44 B;  2AWN A;  3WWV A;  2F0N A;  3M4P A;  4HCE A;  3GTJ B;  4OO1 G;  1LM0 A;  1ZEQ X;  3BDC A;  5K5P A;  2WB1 B;  5M5W H;  4NXM L;  1TWC B;  1TXY A;  3DHQ A;  1O7Z A;  3L2P A;  4GNX A;  1EIH A;  1EIG A;  1N9W A;  2NZH A;  4APV A;  4QUC A;  1BCP C;  4OWX B;  3WOE A;  4RKB A;  4A3L G;  3K5L A;  1SSO A;  2FMM A;  4KKU A;  2Z4I A;  2L11 A;  2QF7 A;  4A93 H;  2MQH A;  1PH1 A;  2Y0S E;  1JWM D;  2RCN A;  2O4X A;  2EOT A;  5IP7 H;  3HOU B;  2R92 G;  1JC7 A;  5AJ3 Q;  3L9A X;  4PMC A;  1EIY B;  1PFM A;  3GTJ H;  4DR3 Q;  1VQJ A;  1O7I A;  2A6H C;  2CQO A;  3DXJ C;  2Z0S A;  4H0L C;  1GJX A;  4K5W A;  1IZ6 A;  2WAQ E;  5C44 G;  1TWC H;  2Q8R E;  3HOV B;  5LMU L;  5IYC G;  2CCZ A;  3CP0 A;  2E2H B;  4LK1 C;  4MTN A;  4LJZ C;  3A7L A;  3UI2 A;  2YU9 B;  3RZD B;  1VQL A;  4H44 C;  5M3M B;  1VMP A;  2OF1 A;  4EQP A;  3T51 B;  5A35 A;  4XQN A;  1B2T A;  2LKV A;  1DOM A;  3PCO B;  1JCK B;  3IRB A;  2K1B A;  2K5W A;  5C0X I;  5D3D A;  2A6E D;  1HUM A;  3PUZ A;  2NN6 H;  4IFD H;  3CRL C;  3HOU G;  3HOV H;  3K81 C;  4RGM A;  1NR4 A;  4EVO A;  3CXC A;  3R2T A;  2E2H H;  2OXP A;  3G6E A;  4YWK A;  4DNI A;  2E2I B;  2XRS D;  4CDE C;  4O42 A;  4CKC A;  1K8O A;  2YU9 H;  1LTR D;  1JOK A;  1OXV A;  3RZD H;  4DV2 Q;  1II3 A;  1YBY A;  3TDQ A;  1VQ7 A;  1W6K A;  4YIJ A;  4JBJ A;  2HD3 A;  1QB5 D;  1PZK D;  1NMF A;  4CGY B;  3ND8 A;  2RHQ B;  1XMQ L;  3HKS A;  5C0X J;  2A8V A;  5FO9 B;  2UUA Q;  2F0V A;  1PMR A;  2MHV A;  4X3T A;  1EY5 A;  2MPM A;  1J8I A;  3KLS X;  5M3M G;  1N36 L;  4J1M A;  2MNA A;  1Z47 A;  1F2Y A;  1STY A;  5I6W A;  3PUW A;  4LUO A;  1EZ6 A;  1BBW A;  4P2C B;  2PZW A;  2B29 A;  1IYV A;  2OT2 A;  4DUY Q;  4WJW A;  2E2I H;  3GTG H;  3U58 A;  1YHA A;  2DGY A;  2WII B;  2BA0 A;  4X65 Q;  4KHP Q;  1UEA B;  4OGQ C;  2K01 A;  1B53 A;  1YNN D;  4ZAI A;  4UHV A;  3HOW B;  2O2L D;  2TSS A;  3KDF A;  3TS0 A;  3HOY G;  3K7U C;  2DUD A;  3R3O A;  1SMX A;  4A3B B;  5M5X B;  5I2X A;  2A73 B;  5EGT A;  4DR1 Q;  3E6Z X;  4DV6 L;  4A3G B;  3TRZ A;  2PO4 A;  1U4P A;  1EY6 A;  2NUC A;  2MP1 A;  1X6O A;  3VDY A;  4RGT A;  3KJP A;  1EQQ A;  5E1F A;  1B8A A;  5C4J B;  1SYF A;  5FJ8 G;  4ABN A;  3FDT A;  1FL0 A;  1NCV A;  2F0G A;  4RA8 A;  5JVG 3;  4JI7 L;  1PH7 A;  4DUZ L;  1DZ1 A;  2A74 C;  1KQS A;  3KF6 B;  4AIM A;  3HOW H;  1B44 D;  1NBW A;  4DNR B;  4TSS A;  3STB C;  2JEA I;  1U4M A;  3SK8 A;  3I8Z A;  2F0M A;  4RCN A;  1PRT F;  4A3B H;  5M5X H;  1YJW A;  4C3J B;  1LT6 D;  1CM9 A;  2A5H A;  4A3G H;  3M9B A;  4A3B G;  1X3P A;  5C4J H;  1LLR D;  3GTL B;  1A6X A;  1STA A;  2L4N A;  1E3P A;  5JPN C;  4R4Q A;  2ES2 A;  3OWE B;  3M4O B;  1Q86 C;  5IGB A;  2VL6 A;  5J1Z A;  2RQX A;  4KY6 A;  2X6G A;  2EZV A;  3E9I A;  2B2Y A;  4C3I B;  4FXK C;  3I55 A;  4GLV B;  1JT8 A;  3ERQ A;  5IT9 c;  4JW0 A;  1SNP A;  2PW7 A;  4O2D A;  5T1I A;  2PPB C;  2GVB A;  2GVA A;  4C3J H;  5EPL A;  5I9P A;  5EBC A;  1B9N A;  1XPR A;  4LFB Q;  1X9N A;  4K8I A;  1WYD A;  5K36 H;  4I65 A;  4JC0 A;  2H4O A;  1XMQ Q;  1GO3 E;  1NSN S;  3GTL H;  2LY7 A;  1PH9 A;  2KHI A;  3O13 A;  4DV7 L;  1C48 A;  4DPG A;  3C1F A;  5TSS A;  5K36 G;  4KLK A;  1VQ6 A;  2Q2H A;  4C3I H;  3J81 E;  1LAB A;  3RLN A;  1N33 L;  1CI3 M;  1QZH A;  1HA5 A;  1LTI D;  3BG3 A;  2Z6B A;  3S15 H;  1RD9 D;  1EWC A;  1HR0 L;  2HQE A;  3LX0 A;  2VNU D;  4KJN A;  5C4X B;  2OCE A;  1JJG A;  4FF2 A;  4ME5 A;  1K0S A;  4HJ8 A;  2A1A A;  2EXZ A;  3PSI A;  4Z9C B;  1S5C D;  4PMB A;  1I4P A;  2CQA A;  1IBK L;  1Y8O B;  2VQE L;  4HMJ A;  4A3I B;  4DV6 Q;  1TT2 A;  2EJF C;  1DJR D;  3TS2 A;  1EIF A;  4HJ7 A;  3E5S A;  1RKN A;  1WTR A;  3W1G A;  2K5Q A;  3EQL C;  2IY5 B;  1B7Y B;  2EVB A;  1KNE A;  2JXM B;  4JI7 Q;  4A3C G;  4PQX A;  4DUZ Q;  1DD2 A;  1IL8 A;  1IW7 C;  5C4X H;  5M3F B;  1LTA D;  1V9P A;  4K0K L;  1XMO L;  2F3W A;  3I4M B;  3C2P A;  3TP6 A;  2B8G A;  1S4Z A;  3MXG A;  1A62 A;  3J80 L;  1PYB A;  3BJU A;  5C4X G;  2AQ2 B;  2WKD A;  3Q6S A;  2K05 A;  1L1O C;  5COY A;  2RDG A;  1ML0 D;  2CH4 W;  4GKJ Q;  3M7G A;  3H94 A;  4A3I G;  1VQN A;  2D62 A;  4EQ5 A;  2LXK A;  3KUP A;  4X62 L;  3A8J E;  3K8A A;  2L9H A;  3J7Z C;  2D2C C;  2OQ0 A;  1HXY D;  2RCF A;  2L0C A;  1UE5 A;  5E7N A;  3MZ5 A;  4N8F A;  5M3F H;  2RSO A;  3MEH A;  2VUM B;  5JJI A;  2CWA A;  4I7A A;  3URY A;  3BDO A;  3JC6 6;  3I4M H;  1ZYR C;  3MA2 B;  3RN5 A;  2LFN A;  4QIW E;  5ELO A;  1HRJ A;  2B2W A;  2Q8I B;  1EUJ A;  4YHH L;  3OMC A;  3H3V H;  2B8F A;  5IGD A;  1VQK A;  1EOT A;  1XNQ L;  1I94 Q;  3M4Q A;  4KI0 A;  1B9M A;  1EY9 A;  4QJF A;  2I46 A;  1QNU A;  2RDF A;  4CKB A;  3CME A;  1OO9 B;  4JI3 Q;  3CC7 A;  2FJ2 A;  5EJW A;  4CBV A;  4RAU C;  1EWI A;  4KJO A;  4LF7 Q;  2J7Z A;  3NSW A;  3H3V C;  4DV7 Q;  5CV6 A;  2N3S A;  2B63 G;  1JMC A;  2NVY H;  4MIU A;  5JJL A;  1Y1V H;  1FVI A;  2WKC A;  2VUM H;  3KLR A;  4GN4 B;  2EYL A;  1QG7 A;  4CDF C;  2NTS A;  2QIL A;  2Q2I A;  5BN5 A;  3MFG A;  4IJL A;  1QVF A;  5FO8 B;  1SRO A;  4DV0 Q;  1I6H B;  3NBH A;  5AFW A;  4MN3 A;  2RF4 A;  2L1B A;  5JEA H;  2EE1 A;  2E74 C;  3ERS X;  4TVA B;  1TU2 B;  3KF8 A;  1U4R A;  2F0P A;  5G3L D;  1NMG A;  3S16 B;  2OTL A;  2MGS A;  1R9T B;  1H9R A;  2VB2 X;  5JJZ A;  5JEA G;  3T1H Q;  1A3V A;  3CCQ A;  1IBK Q;  1DCZ A;  4X64 Q;  1ESF A;  2JA7 B;  1KLU D;  2PI2 E;  1VQI A;  3DLL A;  2JQO A;  3K80 C;  2A19 A;  2FIN B;  2RSN A;  3D4W A;  1I6H H;  1SJE D;  2PI2 A;  2FHT A;  1Q46 A;  5J3B A;  1G2T A;  1IL2 A;  3MXP A;  1JWU D;  4HED A;  2JYO A;  1QNK A;  3S16 H;  3QJY A;  1CT1 D;  1R9T H;  4JI1 L;  1PTO B;  3LGJ A;  4OWT B;  3NTH A;  4IN3 A;  2JA7 H;  3T13 A;  3K57 A;  3PO2 B;  4C2M H;  4ULL A;  1F2Z A;  4WJ4 A;  1QVC A;  4HTH A;  4HIO A;  3A5Z B;  1RF2 D;  2DN8 A;  2F0S A;  2PQA A;  5CYU A;  1B70 B;  1BNZ A;  1EQV A;  4DR7 L;  1X3E A;  4UAI A;  3DWA A;  2JA7 G;  3OHX C;  3VA5 A;  2Z6K A;  2F0U A;  2PNR C;  3ER0 A;  2UXB L;  2F0Q A;  4K2L A;  4U67 3;  3CW2 C;  4OO1 I;  1N8R C;  2B2T C;  4ZKB B;  1N34 Q;  4DV3 Q;  4JI6 L;  4BXX H;  4XT3 B;  4DGZ A;  2KOL A;  4HSP A;  1QIL A;  3S17 H;  4IJH A;  1LUZ A;  1CZG A;  5C6A A;  4Y52 H;  2UUC Q;  1R4Q B;  2L12 A;  1XNQ Q;  1IKM A;  5C4H A;  2A68 C;  4OXP A;  4DV1 L;  2KCN A;  1VQ9 A;  1KXL A;  3VYT A;  2XGT A;  3J81 j;  1Q1E A;  2IHF A;  3QB3 A;  1PTO C;  3PO2 G;  1CFM A;  5ISR A;  1SYG A;  4CHT B;  3RUZ A;  5ELE A;  3SHL A;  4P73 A;  1OXT A;  5GRO A;  2C5C A;  1SE2 A;  4JI4 Q;  1UEB A;  2UXC L;  1F2L A;  2XTI A;  1KDC A;  2VQF Q;  4OL7 A;  1OXU A;  2I07 B;  1YHB A;  3GTQ B;  2DNE A;  3NP8 A;  1J5E L;  2F0I A;  4BA1 I;  2R6G A;  4OX9 L;  2G9H D;  3J80 i;  1CKN B;  3U9O A;  1K83 B;  4XXE A;  1ASZ A;  3J7A 5;  4BBS H;  3PUY A;  4UP7 A;  2EY6 A;  3NQT A;  4A75 A;  5IY0 A;  2NVQ B;  2MO1 A;  1W3S A;  4RCO A;  3J81 c;  2JA8 G;  2QGQ A;  1HFG A;  1IXR A;  2NB0 A;  5GQO A;  4XQQ A;  5HGQ A;  1CKM A;  2N55 A;  3GTP B;  5A2Q E;  3DEO A;  1AP0 A;  1SDF A;  4NB3 A;  3BZC A;  5IYB G;  4AYB B;  2NN6 I;  1AEX A;  4IFD I;  4K6D A;  4DNT B;  4H13 C;  1K83 H;  3ERO A;  1EZ8 A;  1D7Q A;  1B3A A;  2WB1 E;  2NVQ H;  1ILP A;  4JI0 Q;  2F0L A;  2CW0 D;  4KY5 A;  5I2Y A;  1PZJ D;  1VCI A;  5ELN A;  2B2V C;  1LO5 D;  4L63 B;  2QEX A;  4DR7 Q;  4RHR A;  3GTP H;  1HZA A;  3S2D H;  1OXS C;  2AWO A;  1HZ9 A;  1XX8 A;  4IFD J;  4DAV A;  1QVG A;  1TWA B;  1NY4 A;  4B08 A;  5BR8 L;  2ATW A;  4JVZ A;  2NZO A;  2R7Z G;  2IT1 A;  2KJX A;  1VQH A;  3BVM A;  4KTA A;  1O7Y A;  4AYB G;  1I4R A;  1W6J A;  3HKZ G;  3K7A B;  2QDB A;  1VDZ A;  1TY0 A;  3AFQ A;  5IGC A;  4DV1 Q;  3A7A B;  2AKW B;  1JE5 A;  4F8M A;  1Q1B A;  1STH A;  3JAM i;  1Z9F A;  4AQY L;  2EY2 A;  1PH2 A;  3UDX A;  4A93 B;  2FMC A;  4FXG C;  4QCL A;  4A3E B;  4DR5 L;  2YTX A;  3VYR A;  4JV5 L;  2ZJQ A;  1QCB D;  3PQI A;  1SAP A;  4OHJ A;  1UAP A;  2P5Z X;  4YY3 L;  1BCP D;  1LT5 D;  2AQ3 B;  3K7A H;  2QCP X;  4KD3 A;  4JYA L;  5FLM H;  3CPW A;  1QUQ B;  1RL2 A;  4OX9 Q;  2ALY B;  4EGV A;  2VS1 A;  2NVX B;  2E8G A;  2HDM A;  1O7L A;  1S5B D;  1VQE A;  3BYY B;  1SMY C;  4FF3 A;  1G6P A;  2K5D A;  1GUT A;  5IOD A;  1M1K C;  5J22 A;  4DK6 C;  1I6V C;  4ZKC B;  4A3E H;  4Y7N B;  4DK1 A;  3D3R A;  3FMC A;  2RKS A;  4HIK A;  1JR0 D;  3IFT A;  5LMN L;  1K3R A;  2Z1C A;  2GN5 A;  5IGF A;  2B2U C;  4A93 G;  4QGU A;  1HNX L;  4A3E G;  2EY5 A;  4DR2 Q;  1AE3 A;  2VZA A;  5IP7 G;  3FVQ A;  3T16 A;  1DYQ A;  4IZ8 A;  1HZB A;  3L3O C;  1B1Z A;  3A5U A;  4UP9 A;  1XNR L;  2NVX H;  4RG1 A;  1TWG H;  2FXQ A;  1STN A;  4RWS C;  4LF6 L;  2WB1 G;  4JI5 L;  1M4V A;  1LTL A;  5JJK A;  1EQT A;  4GN3 B;  3HZX A;  3GD7 A;  4BBR B;  4R8N A;  4Y7N H;  3VYS A;  5IIF A;  4M8A A;  4DR4 L;  1X3Q A;  1RTN A;  4GLA C;  3NEL A;  2XSC A;  2HCC A;  2MUY A;  1D1I A;  3F8T A;  1G8Z D;  2CHB D;  1YIT A;  4NP5 A;  3I72 A;  3VR6 A;  2J4X A;  3IFD A;  3R2I A;  1VQ8 A;  4JBW A;  3UDG A;  2KUM A;  2F0F A;  5DNF A;  2NN6 G;  2AQ1 B;  1D6E C;  4IFD G;  2UU9 L;  3GTG B;  3KOJ A;  3HOV G;  1K8M A;  3U4V A;  1EWH A;  4DR6 L;  1FGU A;  2ID0 A;  4B3R Q;  1FD7 D;  4IUT A;  4BBR H;  1SYD A;  4FF4 A;  2K52 A;  3ULJ A;  3OSO A;  3T56 B;  2ZTD A;  1P8L A;  3KF6 A;  4DV5 L;  5IE8 A;  5KND A;  4AQY Q;  1J9O A;  2KHJ A;  1IBM Q;  4KN7 C;  3S1M B;  1BXT A;  1WTV A;  4HR7 B;  1VF5 C;  1F9Q A;  2H5X A;  4LF5 Q;  3K5O A;  1XTD A;  2EDG A;  4B9W A;  3G7L A;  3NHH A;  1U0L A;  3M4Y A;  3PIO 3;  2DY7 A;  1KDA A;  2DY8 A;  4NW2 A;  3H91 A;  2FFK B;  3TEH B;  5KEE A;  5IWA L;  1NNX A;  2RBM A;  4NXM Q;  3NTI A;  2K04 A;  4X66 L;  3IAY A;  2VY3 A;  1Y69 U;  1S5D D;  5L37 A;  3PGZ A;  3GV3 A;  3D0F A;  3TP5 A;  3GTO B;  1HTL D;  1F9R A;  2WAQ B;  4ZUJ A;  3I7F A;  3S1M H;  4LUV A;  4G7O C;  4L8J A;  4DAY B;  2EIF A;  1H9S B;  1CUK A;  2ICE C;  3CRK C;  3H0G B;  1B50 A;  4WRD A;  5LMN Q;  1CA6 A;  1CA5 A;  3D31 A;  2KEC A;  3E3X A;  4KK7 A;  1MKH A;  4H7B A;  3P1H A;  3CU7 A;  2XIW A;  4IUQ A;  1CK1 A;  5G3L F;  5LMU Q;  1D5M C;  1YJN A;  2JA6 B;  4EX5 A;  3S9W A;  3OW7 A;  1DXM A;  4QL5 A;  1VQP A;  4CJ0 B;  4V19 0;  5COR A;  1CSP A;  1WCM B;  4CJ1 B;  4JI5 Q;  3SDZ A;  3GTO H;  1ENC A;  4DU9 A;  3HOW G;  2KHS A;  1EFI D;  3G71 A;  3BYT B;  2BA1 A;  3TN2 A;  3SVM A;  3H3V I;  2NTT A;  4O1N A;  1EY8 A;  3F1Z A;  3H0G H;  1WD1 A;  2F0H A;  4DR4 Q;  1G2S A;  4IPG A;  3OIQ A;  1L1O A;  4E6I A;  1AZQ A;  1YNX A;  3EJI A;  4A3G G;  1AH9 A;  3CCU A;  2GA4 B;  3NEM A;  3QG1 A;  1SNQ A;  1T5E A;  2X69 A;  1JJ2 A;  4FXD A;  1VF7 A;  3NEN A;  1QOH A;  4I7Z C;  1SNC A;  5IT9 L; 
#chains in the Genus database with same CATH homology
 1PLF A;  2K6A A;  5D14 A;  4DXG A;  3NWT A;  2VXW A;  5FKA C;  1ENF A;  3ONA B;  3V96 A;  3FEW X;  3S15 B;  4DF7 A;  3KK7 A;  3SK4 A;  4FNF A;  3DWQ A;  1Q90 A;  4C3J G;  2PYK A;  4PV1 C;  2EYM A;  2ZT9 C;  1EU4 A;  2DNC A;  3G6J B;  3ND9 A;  2C9O A;  1RDP D;  3PIP 3;  2ICI A;  3I4N B;  1EY0 A;  1Z7T A;  3VR4 A;  3WDN A;  1LAC A;  4KKS A;  2KQ3 A;  4C3I G;  4KY7 A;  5JEA J;  2AUK A;  1JOQ A;  4IUU A;  2K33 A;  3QO2 A;  1ET9 A;  4R8I A;  1HFN A;  5LHY 1;  1SYC A;  4XTC S;  1Q8I A;  3SXH A;  5ELD A;  2IL8 A;  4G57 A;  3MVV A;  1IW7 D;  4G7H C;  2BDN A;  3J7A F;  4ZYS A;  5E4X A;  1TWF B;  4A3F B;  4KKT A;  1QE6 A;  4A3D B;  1EYC A;  2F0K A;  1GUS A;  5JAV A;  1V1P B;  1DON A;  2K03 A;  5EBD A;  1PFN A;  3DEP A;  1E2Z A;  4A3K B;  5CMD A;  3P7J A;  3MXN A;  4K2K A;  4BY7 B;  2IWH A;  4DFA A;  2K28 A;  1STG A;  1ZYR D;  2F0W A;  4X3K A;  1CHQ D;  3GO5 A;  2NVY B;  4KD4 A;  1Y1V B;  2JE6 I;  2HCI A;  1YNJ C;  2EYO A;  4J6H A;  1RTO A;  3PO3 B;  4F7X A;  1SJH D;  2VB3 X;  5FLX E;  2EPB A;  5CV4 A;  2B2T A;  3M85 A;  1GUW A;  2N88 A;  3PMF A;  4HCS A;  2BCO A;  2V4D A;  2M00 A;  2XN9 C;  5KRU A;  1KDB A;  3SEB A;  4UDU C;  5CV5 A;  4C1N I;  4QMG A;  1STB A;  3KBX A;  5NUC A;  3KBG A;  3DWP A;  1D5X C;  5CBE E;  3T4A C;  4S3S A;  1M8A A;  3SK5 A;  3TSS A;  4A3M B;  1PRT B;  5FK9 C;  3P75 A;  3LNN A;  1ET6 A;  2F4I A;  3DM1 A;  3S2H B;  1DOL A;  4BS9 A;  3K0Y A;  1H9K A;  3NPP A;  1I50 B;  4C2M B;  1CZW A;  3DMU A;  3A56 A;  1HUN A;  1TS4 A;  3FRP B;  1I3Q B;  3RD4 A;  1HTP A;  1BCP F;  5DM6 3;  3GV6 A;  1U4L A;  4K5X A;  5C3W A;  4N9P A;  5C5M A;  2L55 A;  3S17 B;  1KNA A;  4ID6 A;  1TWH B;  1EU3 A;  1PRT C;  4IUV A;  4KV6 A;  5E4W C;  3RZO B;  2A69 D;  4ZUI A;  1MGS A;  4BA2 I;  1OXX K;  3OIP A;  3EA6 A;  2D5D A;  1LTG D;  1FNW A;  3I4L A;  4LAA A;  2B2V A;  1G29 1;  4XIG S;  3CQZ B;  1V43 A;  1T5X D;  5ELB A;  5EPJ A;  5JPM C;  1WTQ A;  3NBI A;  2F3V A;  1F2M A;  2A68 D;  4N9T A;  2NBF A;  1HQM C;  3I73 A;  1PDQ A;  1PTO D;  1BF4 A;  3VR5 A;  1G6Z A;  4HN7 A;  4PNY A;  4NMZ A;  4BBS B;  2D9U A;  5EKK A;  1VMC A;  1WTX A;  3H6M A;  3T53 B;  1SYE A;  2E2D C;  2LS0 1;  4K6L A;  5BN4 A;  3NXW A;  1D1K A;  2J0T D;  1E2V A;  2BDO A;  2LMC B;  3Q22 A;  2SDF A;  1HCZ A;  1I4Q A;  3K5M A;  5I9O A;  4BY1 B;  4B9X A;  3MHB A;  3J81 L;  5KYL A;  3R8B A;  4DAP A;  1CQV A;  1WTW A;  4XYO A;  5C5L A;  5HUR A;  2B39 A;  1Y1W B;  1WTO A;  3I90 A;  5CBA E;  3S2D B;  2E76 C;  3ZYY X;  1V8Q A;  1BOS A;  1IKL A;  3HOZ B;  2K7V A;  1SFO B;  1XXG A;  2B2U A;  1GUN A;  1CHP D;  3HG9 A;  1A2U A;  1D2B A;  3J7A V;  1JOO A;  4G7Z C;  1Q12 A;  1D5Z C;  4K14 A;  5FO7 B;  1HA6 A;  4RGN A;  5EQ0 A;  2BE5 D;  2E75 C;  1GXD C;  3SK6 A;  1MSG A;  2PZU A;  4IAL A;  2EJM A;  1ZXT A;  2KVM A;  3A8K E;  2SNM A;  2WIN B;  2IX0 A;  3K5N A;  3MWY W;  3P20 A;  2KED A;  1QJO A;  1H9M A;  1FYC A;  3S1Q B;  3F2U A;  3U9S A;  4FVM A;  3TP8 A;  5JOB A;  3NK9 A;  3FKI B;  2EYH A;  1GHJ A;  2R3Z A;  1BCP B;  5FLX L;  3MTS A;  2L5T A;  1ROD A;  3RMH A;  4IQZ A;  3BZD B;  4X3S A;  3FPP A;  2RVL A;  3A54 A;  2R61 A;  3I70 A;  4FO2 A;  5DM7 3;  3MAQ A;  1R4P B;  5I6Y A;  2R92 B;  4R9W A;  2EY1 A;  4ILW A;  1L0X B;  1NAP A;  1TS3 A;  5EPK A;  2YYZ A;  3QIA A;  1TWG B;  3D6C A;  5D65 A;  1EY7 A;  3HGB A;  1X32 A;  2PZT A;  1TS5 A;  3D4D A;  1C4Q A;  3BDL A;  2A6H D;  2F0J A;  5BN3 A;  1Q3L A;  2R93 B;  3MXU A;  1JWS D;  2G9D A;  3TZD A;  2PCF B;  3OPO A;  1SNO A;  3V2T A;  2OEO A;  4RKL A;  3I3C A;  3SR1 A;  5EKL A;  3J7Y W;  5IOC A;  3E0J A;  4U68 A;  4Q0F A;  1IHZ A;  4JK1 C;  3J80 E;  4MHE A;  3NWS A;  4ODG A;  3DUZ A;  1XTC D;  2MJ8 A;  2M2L A;  5EKI A;  3BS1 A;  4ZK9 B;  3GTK B;  3TBI B;  1TQO A;  4DAY A;  2PMZ B;  1H9S A;  3OOC A;  3X3N A;  1PZI D;  2WP8 J;  1MI2 A;  1B4O A;  4XT1 B;  5DAU A;  4HSV A;  1STE A;  1U9R A;  5HGT A;  3HOY B;  1DM0 B;  1Z6H A;  2A6E C;  3TP7 A;  3D4R A;  1CQF A;  1QWY A;  1NR2 A;  4HMI A;  4KHZ A;  1CTM A;  1XWE A;  2Y0S B;  3HRZ C;  2KA7 A;  3R93 A;  4DXF A;  1BBX C;  1UNS A;  3S1N B;  1RJT A;  1HPC A;  1F77 A;  1LTS D;  3K58 A;  3JAM E;  3MC0 B;  4C1N K;  1TY2 A;  3M3Y B;  1A2T A;  1AW7 A;  1XYI A;  4RGO S;  1SXT A;  1AZP A;  3CHB D;  1HHV A;  1BO0 A;  1SE3 A;  1LV9 A;  1UUP A;  1YNN C;  1C8C A;  1SND A;  4OIJ A;  1JB3 A;  1BR9 A;  2TMP A;  4EQN A;  4X3U A;  5LL6 X;  3HP3 A;  1EYA A;  5A2Q L;  4V0B A;  3C3L A;  1IYU A;  5D3I B;  2K32 A;  5ELC A;  1ILQ A;  4FYD A;  1AN8 A;  3NE5 B;  3VR3 A;  1EEF D;  4BWG B;  1Y8N B;  1E0B A;  5DEH A;  4KN4 C;  2KCC A;  2AUJ D;  1SE4 A;  1SYB A;  5KNC A;  1LT4 D;  1H9J A;  1L0Y B;  1FGB D;  2JP1 A;  1AFP A;  1MBY A;  2SNS A;  3NQI A;  2F0E A;  2WV6 D;  2IW3 A;  4Q5V A;  1PFB A;  2WAC A;  2E2J B;  3W3A A;  1TII D;  1MSH A;  2IX1 A;  3NTK A;  2XNA C;  1V1P A;  3AU7 A;  5F2D A;  5IGE A;  2ZXP A;  2QEJ C;  1JOR A;  2F0T A;  2HDL A;  1MD2 D;  2XWJ B;  1ZKO A;  5CGK A;  1PTO F;  1SEB D;  3PV0 A;  5C0X H;  4ZRZ A;  3LWU A;  2O5J C;  2JA5 B;  1KAB A;  3Q23 A;  2IPK D;  4LMQ D;  1ENA A;  2RDH A;  3KLS A;  1GHK A;  5C0X G;  4XYQ A;  4DN4 M;  2X6L A;  2Z8L A;  2ENB A;  3BVG A;  3PUV A;  3S1R B;  2IX3 A;  3ITP A;  1LTB D;  3N6R A;  5J39 A;  2F0D A;  3X3M A;  1EYD A;  4A3J B;  4NDX A;  1SBB B;  1E2W A;  3Q24 A;  3IKJ A;  5KIX A;  3TZU A;  5CV9 A;  1F9S A;  1F9P A;  4IUN A;  4F88 A;  1JIC A;  1ESR A;  1YNJ D;  5KYI A;  4IUR A;  5E3F A;  4TQU S;  1HQR D;  1FNU A;  4GZY C;  1LTT D;  3SE0 A;  3PUX A;  5C3X A;  5CV8 A;  3C46 A;  2B63 B;  4RH6 A;  1DOK A;  4J8Q A;  4C3H B;  5C4Z A;  2B2Y C;  3QWN A;  1BQQ T;  1TR5 A;  3HEJ A;  2IJ0 A;  5KNB A;  3EFX D;  4IUP A;  2NVT B;  3CKI B;  4ZLT F;  1O80 A;  2EYP A;  5LL6 S;  2PQE A;  1NUC A;  1WVL A;  3TME A;  2CVR A;  1GUG A;  2EYF A;  1KTK A;  2O5I C;  5CV7 A;  4C3H G;  1KAA A;  2SEB D;  1I4H A;  3AB9 A;  1S5F D;  2NYZ D;  1TVX A;  5FOB B;  3HS0 C;  3AMU A;  1PRT D;  1V1O A;  1ONL A;  3JAM L;  5CC4 A;  1A3T A;  2XVS A;  3VA7 A;  4K8J A;  4QIW B;  3A8I E;  1O78 A;  2EJG C;  1Y8P B;  5T1G A;  4G4K A;  5JVH 3;  3D6W A;  3K6O A;  1EY4 A;  2F1M A;  1S5E D;  3BVZ A;  3C1E A;  2M9V A;  4HAE A;  2HUG A;  3D8G A;  4KHV A;  2A69 C;  1WTP A;  2RA4 A;  3NUC A;  1TKW B;  1SNM A;  2B2W C;  3OMG A;  4DA2 A;  2XWB B;  3IL8 A;  1BDO A;  2XRQ D;  2ZXO A;  1BUV T;  3GQB A;  1KLG D;  1TS2 A;  4DK0 A;  1A15 A;  4XQJ A;  3RLF A;  1GOZ A;  1PYW D;  1PTO H;  2ZXR A;  4RHS A;  4ZQ3 A;  1RCV D;  2JA8 B;  4QUF A;  2F03 A;  3S14 B;  4EQO A;  4OIK A;  4CKE A;  3FPU B;  4RFB A;  3WOF A;  4TRD A;  3HOX B;  1G91 A;  3I91 A;  4FP5 D;  3Q0A A;  3GTM B;  1A3U A;  4K5V A;  4TKO B;  2EYJ A;  2JEB I;  4WOR A;  3GP7 A;  3EVQ A;  3OWF A;  2BOS A;  3L7Z C;  4XDX A;  2F0O A;  1PXU A;  2PW5 A;  4QB4 A;  3K59 A;  1ICW A;  4FF1 A;  3M7N A;  2Z4H A;  3VR2 A;  5M5Y B;  2NWG A;  5I4D A;  2R7Z B;  2H1E A;  5CR3 A;  4F87 A;  4L6T B;  3HKZ B;  4WFN 3;  2KEE A;  1RHP A;  4CJ2 C;  3N52 A;  3A55 A;  5C3E B;  5IT9 E;  1FNV A;  3V05 A;  3H09 A;  2QKI C;  4QF4 A;  5KGU A;  2CW0 C;  1EL0 A;  5IGG A;  2NZ1 D;  2BE5 C;  1JQY D;  1JE4 A;  4NKL A;  1LT3 D;  2Q8T A;  3QOJ A;  3LWE A;  4M1U B;  1I4G A;  1GUO A;  1WD0 A;  5M5W B;  3QOL A;  5ELF A;  2JSO A;  4PMW A;  3W2D A;  4KMU C;  3VYU A;  1SMY D;  2SOB A;  1EEI D;  5M9O A;  4OO1 H;  1FR3 A;  4C56 C;  3MFY A;  5C44 B;  2AWN A;  2F0N A;  4HCE A;  3GTJ B;  4OO1 G;  1ZEQ X;  3BDC A;  5K5P A;  2WB1 B;  1TWC B;  3DHQ A;  1O7Z A;  1EIH A;  1EIG A;  4QUC A;  1BCP C;  3WOE A;  4RKB A;  3K5L A;  1SSO A;  2FMM A;  4KKU A;  2Z4I A;  2L11 A;  2QF7 A;  1JWM D;  2O4X A;  2EOT A;  3HOU B;  1JC7 A;  3L9A X;  4PMC A;  1PFM A;  2A6H C;  3DXJ C;  4H0L C;  1GJX A;  4K5W A;  2Q8R E;  3HOV B;  2E2H B;  4LK1 C;  4LJZ C;  3A7L A;  3UI2 A;  2YU9 B;  3RZD B;  4H44 C;  5M3M B;  1VMP A;  2OF1 A;  4EQP A;  3T51 B;  5A35 A;  4XQN A;  1B2T A;  2LKV A;  1DOM A;  1JCK B;  2K1B A;  2K5W A;  5C0X I;  5D3D A;  2A6E D;  1HUM A;  3PUZ A;  2NN6 H;  4IFD H;  3CRL C;  4RGM A;  1NR4 A;  4EVO A;  3R2T A;  2OXP A;  2E2I B;  2XRS D;  4O42 A;  4CKC A;  1K8O A;  1LTR D;  1JOK A;  1OXV A;  1II3 A;  3TDQ A;  1W6K A;  4YIJ A;  1QB5 D;  1PZK D;  4CGY B;  3ND8 A;  5C0X J;  5FO9 B;  2F0V A;  1PMR A;  2MHV A;  4X3T A;  1EY5 A;  2MPM A;  1J8I A;  3KLS X;  4J1M A;  1Z47 A;  1F2Y A;  1STY A;  5I6W A;  3PUW A;  1EZ6 A;  4P2C B;  2PZW A;  1IYV A;  2OT2 A;  4WJW A;  2WII B;  2BA0 A;  1UEA B;  4OGQ C;  2K01 A;  1B53 A;  1YNN D;  4ZAI A;  3HOW B;  2O2L D;  2TSS A;  3R3O A;  4A3B B;  5M5X B;  5I2X A;  2A73 B;  5EGT A;  3E6Z X;  4A3G B;  2PO4 A;  1U4P A;  1EY6 A;  2NUC A;  2MP1 A;  4RGT A;  5E1F A;  5C4J B;  1SYF A;  4ABN A;  3FDT A;  1NCV A;  2F0G A;  4RA8 A;  5JVG 3;  1DZ1 A;  2A74 C;  1B44 D;  4DNR B;  4TSS A;  2JEA I;  1U4M A;  3SK8 A;  3I8Z A;  2F0M A;  4RCN A;  1PRT F;  4C3J B;  1LT6 D;  1CM9 A;  2A5H A;  1X3P A;  1LLR D;  3GTL B;  1A6X A;  1STA A;  2L4N A;  5JPN C;  3OWE B;  3M4O B;  5IGB A;  5J1Z A;  2RQX A;  4KY6 A;  2X6G A;  2EZV A;  2B2Y A;  4C3I B;  4FXK C;  3ERQ A;  1SNP A;  2PW7 A;  5T1I A;  2PPB C;  5EPL A;  5I9P A;  5EBC A;  1B9N A;  4K8I A;  5K36 H;  4I65 A;  2H4O A;  1NSN S;  2LY7 A;  3O13 A;  1C48 A;  3C1F A;  5TSS A;  5K36 G;  3J81 E;  1LAB A;  1CI3 M;  1HA5 A;  1LTI D;  3BG3 A;  1RD9 D;  1EWC A;  2HQE A;  3LX0 A;  2VNU D;  4KJN A;  5C4X B;  4FF2 A;  4ME5 A;  2EXZ A;  4Z9C B;  1S5C D;  4PMB A;  1I4P A;  2CQA A;  1Y8O B;  4HMJ A;  4A3I B;  1TT2 A;  2EJF C;  1DJR D;  3E5S A;  1RKN A;  1WTR A;  2K5Q A;  3EQL C;  2EVB A;  1KNE A;  2JXM B;  4PQX A;  1DD2 A;  1IL8 A;  1IW7 C;  5M3F B;  1LTA D;  2F3W A;  3I4M B;  3C2P A;  3TP6 A;  2B8G A;  1S4Z A;  3MXG A;  3J80 L;  2AQ2 B;  2WKD A;  3Q6S A;  2K05 A;  5COY A;  2RDG A;  1ML0 D;  3M7G A;  3H94 A;  2D62 A;  3KUP A;  3A8J E;  2L9H A;  2D2C C;  1HXY D;  2L0C A;  3MZ5 A;  2RSO A;  3MEH A;  2VUM B;  3URY A;  3BDO A;  1ZYR C;  3MA2 B;  2LFN A;  1HRJ A;  2B2W A;  2Q8I B;  3OMC A;  2B8F A;  5IGD A;  1EOT A;  4KI0 A;  1B9M A;  1EY9 A;  2I46 A;  1QNU A;  2RDF A;  4CKB A;  1OO9 B;  2FJ2 A;  5EJW A;  4CBV A;  4RAU C;  4KJO A;  2J7Z A;  3NSW A;  3H3V C;  5CV6 A;  4MIU A;  2WKC A;  3KLR A;  2EYL A;  1QG7 A;  2NTS A;  2QIL A;  5BN5 A;  3MFG A;  5FO8 B;  1I6H B;  3NBH A;  5AFW A;  4MN3 A;  2L1B A;  5JEA H;  2EE1 A;  2E74 C;  1TU2 B;  3KF8 A;  1U4R A;  2F0P A;  5G3L D;  3S16 B;  2MGS A;  1R9T B;  1H9R A;  2VB2 X;  5JJZ A;  5JEA G;  1A3V A;  1DCZ A;  1ESF A;  2JA7 B;  1KLU D;  2FIN B;  2RSN A;  3D4W A;  1SNC A;  1SJE D;  2FHT A;  1G2T A;  3MXP A;  1JWU D;  4HED A;  2JYO A;  1QNK A;  3QJY A;  1CT1 D;  1PTO B;  3NTH A;  4IN3 A;  3T13 A;  3K57 A;  3PO2 B;  4ULL A;  1F2Z A;  4HTH A;  1RF2 D;  2DN8 A;  2F0S A;  5CYU A;  1BNZ A;  1EQV A;  4UAI A;  3DWA A;  3OHX C;  3VA5 A;  2F0U A;  2PNR C;  2F0Q A;  4K2L A;  4U67 3;  4OO1 I;  2B2T C;  4ZKB B;  4XT3 B;  4DGZ A;  2KOL A;  4HSP A;  1QIL A;  1CZG A;  5C6A A;  1R4Q B;  2L12 A;  1IKM A;  5C4H A;  2A68 C;  2KCN A;  3VYT A;  1Q1E A;  3QB3 A;  1PTO C;  1CFM A;  5ISR A;  1SYG A;  4CHT B;  3RUZ A;  5ELE A;  3SHL A;  1OXT A;  2C5C A;  1SE2 A;  1F2L A;  1KDC A;  4OL7 A;  1OXU A;  2I07 B;  3GTQ B;  2DNE A;  3NP8 A;  2F0I A;  4BA1 I;  2R6G A;  2G9H D;  3U9O A;  1K83 B;  4XXE A;  3PUY A;  2EY6 A;  3NQT A;  2NVQ B;  4RCO A;  1HFG A;  2NB0 A;  4XQQ A;  2N55 A;  3GTP B;  5A2Q E;  3DEO A;  1AP0 A;  1SDF A;  4AYB B;  2NN6 I;  1AEX A;  4IFD I;  4K6D A;  4DNT B;  4H13 C;  3ERO A;  1EZ8 A;  1B3A A;  1ILP A;  2F0L A;  2CW0 D;  4KY5 A;  5I2Y A;  1PZJ D;  1VCI A;  2B2V C;  1LO5 D;  4L63 B;  4RHR A;  1OXS C;  2AWO A;  1XX8 A;  4IFD J;  4DAV A;  1TWA B;  4B08 A;  2IT1 A;  2KJX A;  3BVM A;  4KTA A;  1O7Y A;  1I4R A;  1W6J A;  3K7A B;  2QDB A;  1VDZ A;  1TY0 A;  5IGC A;  3A7A B;  4F8M A;  1Q1B A;  1STH A;  2EY2 A;  4A93 B;  2FMC A;  4FXG C;  4QCL A;  4A3E B;  3VYR A;  1QCB D;  1SAP A;  4OHJ A;  1UAP A;  1BCP D;  1LT5 D;  2AQ3 B;  2QCP X;  4KD3 A;  4EGV A;  2NVX B;  2HDM A;  1O7L A;  1S5B D;  3BYY B;  1SMY C;  4FF3 A;  2K5D A;  1GUT A;  5IOD A;  5J22 A;  1I6V C;  4ZKC B;  4Y7N B;  4DK1 A;  3D3R A;  3FMC A;  2RKS A;  1JR0 D;  3IFT A;  2Z1C A;  5IGF A;  2B2U C;  2EY5 A;  3FVQ A;  3T16 A;  1DYQ A;  4IZ8 A;  3L3O C;  1B1Z A;  1STN A;  4RWS C;  1M4V A;  1EQT A;  3HZX A;  3GD7 A;  4BBR B;  4R8N A;  3VYS A;  5IIF A;  4M8A A;  1X3Q A;  1RTN A;  2XSC A;  2HCC A;  2MUY A;  1D1I A;  1G8Z D;  2CHB D;  4NP5 A;  3I72 A;  3VR6 A;  2J4X A;  3IFD A;  3R2I A;  4JBW A;  2KUM A;  2F0F A;  5DNF A;  2NN6 G;  2AQ1 B;  1D6E C;  4IFD G;  3GTG B;  1K8M A;  1EWH A;  2ID0 A;  1FD7 D;  4IUT A;  1SYD A;  4FF4 A;  3OSO A;  3T56 B;  5KND A;  1J9O A;  4KN7 C;  3S1M B;  1BXT A;  1WTV A;  4HR7 B;  1VF5 C;  1F9Q A;  3K5O A;  4B9W A;  2EDG A;  3G7L A;  3NHH A;  3M4Y A;  3PIO 3;  2DY7 A;  1KDA A;  2DY8 A;  4NW2 A;  3H91 A;  2FFK B;  5KEE A;  2RBM A;  3NTI A;  2K04 A;  3IAY A;  1Y69 U;  1S5D D;  3GV3 A;  3TP5 A;  3GTO B;  1HTL D;  1F9R A;  2WAQ B;  4ZUJ A;  4G7O C;  4L8J A;  1H9S B;  2ICE C;  3CRK C;  3H0G B;  1B50 A;  4WRD A;  1CA6 A;  1CA5 A;  3D31 A;  2KEC A;  4KK7 A;  4H7B A;  3P1H A;  3CU7 A;  2XIW A;  4IUQ A;  1CK1 A;  5G3L F;  1D5M C;  2JA6 B;  3S9W A;  3OW7 A;  1DXM A;  4CJ0 B;  4V19 0;  5COR A;  1WCM B;  4CJ1 B;  3SDZ A;  1ENC A;  4DU9 A;  2KHS A;  1EFI D;  3BYT B;  2BA1 A;  3TN2 A;  3SVM A;  2NTT A;  4O1N A;  1EY8 A;  1WD1 A;  2F0H A;  1G2S A;  3OIQ A;  4E6I A;  1AZQ A;  3EJI A;  2GA4 B;  3QG1 A;  1SNQ A;  1T5E A;  2X69 A;  4FXD A;  1VF7 A;  1QOH A;  4I7Z C;  1I4X A;  5IT9 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...