2EYHA

Crystal structure of staphylococcal nuclease mutant t62s
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
135
structure length
135
Chain Sequence
b'LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFSKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Staphylococcal nuclease
publication title Threonine mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 38
structure length 135
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2005-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2eyhA00
1SNMA 1TT2A 4I65A 1KABA 1STAA 3NP8A 5EKKA 5CR3A 3VA5A 1F2ZA 5JAVA 3SK8A 1SNDA 3QOJA 5CV6A 3TP6A 2F3WA 4HMIA 3MHBA 4K2KA 1II3A 2SNSA 2HQEA 3SR1A 4ID6A 1F2MA 4N9PA 2F3VA 4KHVA 1SNPA 3D6CA 5I6WA 3U9OA 2F0GA 3NK9A 1SYCA 1EY7A 2EYLA 5IGCA 3P1HA 1A3UA 5J1ZA 2EXZA 2KQ3A 4EQPA 5C4HA 2PW7A 2OF1A 3P75A 5IGDA 5IGFA 5IGEA 4IALA 2F0HA 5IODA 4KV6A 5EKLA 5F2DA 3NQTA 3D4WA 5E3FA 5E1FA 4KD4A 3C1EA 4RKBA 5CV4A 3ERQA 1A2UA 2F0JA 5CC4A 2EY2A 4F8MA 3MZ5A 4J1MA 5NUCA 3SK4A 2EY6A 1U9RA 4DF7A 3DMUA 1F2YA 4TRDA 1SYDA 4WRDA 3V2TA 4H7BA 5KEEA 1JORA 1RKNA 3NXWA 3OMGA 4NP5A 1KDAA 2F0NA 2PZWA 3TP7A 5C5MA 4ODGA 3EVQA 2NUCA 3D4DA 5EGTA 5C4ZA 4ZUIA 2F0VA 4NDXA 1JOQA 3HEJA 4HTHA 2F0KA 4ME5A 2F0OA 4F7XA 3NHHA 5KIXA 3NUCA 1EY4A 4QB4A 1STGA 1A3VA 2F0DA 4K5WA 1STYA 4R8NA 5DEHA 2F0WA 2EYFA 4IUNA 3QOLA 1NUCA 5C3XA 5I9OA 3MXPA 5KRUA 2F0UA 5J22A 4B9WA 2EYPA 4KY6A 4K8JA 3SXHA 3BDCA 4WORA 3DHQA 2OXPA 1SYFA 3PMFA 2EYOA 1EQVA 2F0MA 5HGTA 2RBMA 1IHZA 4KTAA 2WACA 1EZ8A 2F0FA 2ENBA 1EY0A 5KGUA 4PMBA 5CV8A 4G57A 4K8IA 1KAAA 4NMZA 5CV5A 1KDBA 2SNMA 5KYLA 3OSOA 5CV9A 4HMJA 4DGZA 1SNCA 4J6HA 2RDFA 5J39A 5IOCA 3SHLA 4IZ8A 1EYCA 1JOOA 1KDCA 3OMCA 4QMGA 5CV7A 2SOBA 4ZUJA 1TR5A 2LKVA 2F0TA 2M00A 1EYAA 1EY9A 3BDLA 3R3OA 2PZUA 2EYMA 1STNA 4MIUA 2F0SA 1EY6A 2EYHA 4N9TA 1EY8A 1SNOA 5I6YA 4K6DA 3MVVA 3SK6A 4K14A 5IGGA 3TP8A 2OEOA 3HZXA 3TP5A 1SYGA 1NSNS 4KY5A 1A3TA 3QB3A 5IGBA 2EYJA 5I9PA 4RKLA 2QDBA 5ISRA 4QF4A 2O4XA 4DU9A 3T16A 4E6IA 4EVOA 3S9WA 4OL7A 2KHSA 5C5LA 4PMCA 2F0LA 3EROA 1STBA 2EY5A 5KYIA 3C1FA 1JOKA 3T13A 3MEHA 1EY5A 2F0IA 4LAAA 4KJOA 4S3SA 1STHA 5HURA 4KD3A 1EYDA 4ZQ3A 2PYKA 4YIJA 3E5SA 1AEXA 5DAUA 3RUZA 4EQNA 5K5PA 4K5XA 2RKSA 2F0QA 5JOBA 1SYBA 2EY1A 4K5VA 4KJNA 4KY7A 3EJIA 1TQOA 3D8GA 3SK5A 3H6MA 5IIFA 1EZ6A 2F0PA 1ENCA 4DFAA 4EQOA 4NKLA 3TMEA 5CGKA 2PZTA 2F0EA 2PW5A 1ENAA 1SYEA 5C6AA 5M9OA 1A2TA 3OWFA 3ITPA 1SNQA 4K2LA 4PNYA 3LX0A 5C3WA 2PQEA 4B9XA
chains in the Genus database with same CATH superfamily
1KABA 1CHPD 1CM9A 2BH8A 2NVXB 5A35A 1ESRA 2RQXA 3RLOA 2KEEA 3TS0A 1YNNC 1BBWA 4XT3B 1SMYD 2RHSB 3G71A 1I94L 1Z9FA 2PW7A 3I4LA 1YNJC 1VMCA 3T1YL 3BYTB 4L63B 3L7ZC 3D4WA 4KD4A 2HIXA 1ZXTA 1G2TA 2HD3A 4RKBA 4LF5Q 3ERQA 2EY2A 1OXTA 2O5JC 5BR8Q 1U9RA 3L0OA 1CKNB 4A3CG 1FL0A 3CCJA 1E7ZA 1X56A 2F0NA 1TWFB 2EPBA 3QIAA 3S15B 2NUCA 1LABA 5C0XG 3K5MA 4UHVA 3FKIG 4P71A 4GKKL 1FGBD 4KKTA 4DV0Q 1M4VA 1PLFA 5M3FG 3NHHA 2BA0A 2JA5B 5KNBA 4HAEA 4LFAL 5I9OA 1PTOH 3K7UC 3BVGA 3W1GA 3V96A 2ZTEA 2UXBQ 1TWHB 2CVRA 5ELCA 1Q82C 2RBMA 5LL6S 2IPKD 1Y14B 3KBXA 4G7HC 3CC7A 1B2TA 3J7A5 3JAML 4L5QA 1PZKD 5DM63 3T51B 4A3JH 1K8MA 4ZYSA 1N32L 4MHEA 1E3PA 4POFA 5JEAG 2B2YC 4KLKA 2YV5A 3H3VC 1RTNA 1EY8A 4BY7B 1C7YA 4CJ2C 5M5YH 1ICFB 1GHKA 1HCZA 1J5EL 3T16A 3HOWG 4R4IA 3DWPA 2Z1CA 1WTVA 3A8IE 4UAIA 1PH8A 1KXLA 2XN9C 3K8AA 3J81c 1K0SA 3F2BA 4X66Q 4FF3A 3UDIA 1EWHA 1P16A 1IYVA 5IP9H 4F87A 3BDOA 3RR5A 4U673 2XNAC 3PV0A 1ENCA 4X3UA 5DNFA 4JI7Q 5FLXL 4OWTB 1RODA 3F2UA 4NXMQ 1SNQA 5EJWA 1QJOA 1F9RA 1XNQL 5IYDH 3CHBD 2L4NA 3OYYA 2WAQG 2KHJA 1EU4A 3MHBA 4C1NI 2YYZA 1WOCA 4KI0A 3H0GG 3I91A 2VXWA 2R92B 4LMQD 5EBCA 4GOPA 5IGDA 3MWYW 3I4OA 4IALA 3LWUA 4RGNA 3CCSA 1Y69U 3H09A 1KRTA 5FKAC 4LUOA 2X6LA 1SMXA 1SRUA 2I5LX 3JAMc 5IWAQ 3H91A 4LF9Q 1L1OA 1K3BC 4H7BA 5KEEA 4C2MB 3M7NA 4APVA 3HFZB 4CDEC 3N52A 1IL8A 5C5MA 2QDLA 4ODGA 4A76A 2F0OA 2ZTCA 1K83B 3RZOB 4R8NA 1VQFA 1GVPA 1Y1VH 1I94Q 1U5KA 3PQIA 1EIFA 3GTJB 3T1YQ 3A55A 1PFNA 3GV6A 3KUPA 4X3KA 2WB1G 2E2JB 1HTLD 1SNCA 4I7AA 1JICA 1QILA 4KHZA 1IXRA 1KDCA 3OMCA 4B08A 4GN5A 3BZDB 2JA7H 4Y52H 1DM0B 4PZ7A 1WTRA 4GKKQ 5FLXc 1Q7YC 4C3IG 3MVVA 4A3IB 4K14A 1O78A 2E2DC 4HSVA 4LFAQ 3K58A 4OO1H 3S17H 4RKLA 1IYUA 2WKDA 1AW7A 4A3KB 3EROA 1H9SB 1BVSA 4IOAA 1FR3A 1N36L 4S3SA 2F0IA 4DV6L 1TWCB 4ZQ3A 3KF6A 1BBUA 1WCMG 4K5VA 5G3LD 4XYOA 2VY3A 4A3MH 3S1RH 1N32Q 1JJGA 4A3BB 3FMCA 4ULLA 3R2TA 5EAYA 2C35B 3KLSX 3CCUA 5FO8B 5FLMH 2VUMG 3EQLC 3VYSA 1X9NA 2GVAA 1SAPA 4DV3L 4HN7A 3CD6A 2G5DA 1W3SA 2VZAA 1SR3A 5C0XI 4DK1A 1STAA 1K8GA 2FJ2A 3VA5A 3SK8A 1EWCA 4AYBB 1J5EQ 3PCOB 4HIKA 2B63B 3HOZH 1CZGA 3TEHB 4DR1L 2UXDL 3U9OA 3UE1A 2KECA 5JVG3 4EQPA 2B8FA 2A6ED 3I3CA 3P75A 4OXPA 3HOYH 1F9SA 1K0RA 5E3FA 4BXXH 1UNSA 1A63A 5CV4A 5E4WC 4LF4L 2JA9A 1D7QA 4V0BA 3UE0A 2Q2TA 4ZKBB 4HJ5A 4NXNL 1HNZL 3S1NB 5COYA 3PF5A 1V43A 3GTPB 1XNQQ 2D0PA 3DM1A 3NBHB 3AQQA 4C1NK 3CW2C 1K8AC 3HOUG 3WWVA 4C3JG 3FDTA 2IWHA 3K5LA 1SE4A 1UE5A 2AUKA 4R8IA 4U68A 2F0DA 1GHJA 2NVXH 1STYA 2HIVA 1UEBA 5CYUA 5KRUA 4ZRZA 2KEDA 5C3EG 1FD7D 3C46A 4EX5A 3GTMH 3I4NB 1VQ6A 4HIDA 2DJGC 2KVMA 1D1KA 3R2IA 5LL6X 4DV5L 4J6HA 1J8IA 3CQZB 2JP1A 1EYCA 3S16B 3RNUA 1LT3D 2J7ZA 2SOBA 3PUVA 1DZ1A 2JA8B 3ZJYC 5EPJA 2BDOA 1STNA 1NY4A 1U4PA 4N9TA 1EY6A 4JW0A 1TWFH 1LYLA 3K7AB 4A3FB 2B2WC 3FHWA 5IT9E 1Z47A 2JA5H 2VQFL 1MI2A 4K6LA 4EVOA 3CMAA 2ZXRA 4Y7NB 4DNRB 1PRTF 4HIOA 3D31A 1TWHH 5M5XH 2UUBL 2KENA 1VQ9A 1VQHA 2A68D 3I72A 3CF5A 4ZK9B 1PRTB 1T5EA 4GS3A 5IYBH 5KNCA 2A5HA 3KLSA 5IE8A 3HOVG 1XMQL 1SYEA 4JV5L 4K2LA 1PFMA 2B2YA 1XTCD 2YTXA 1TT2A 1GM5A 4FP5D 1PH5A 4BY7H 3X3MA 1PRTD 4DR5L 4HMIA 4RA8A 3D0FA 1F2MA 1N36Q 3FVQA 4DV6Q 1A3UA 1D6EC 2JXMB 2OQ0A 3NQIA 4IUTA 4OWWB 1YNJD 1ML0D 5JVH3 1FYCA 4H13C 1U4MA 1Q12A 2EY6A 4LWCA 5M3MB 4DR4L 4BBRH 2K50A 2B3GA 3WOFA 4DV3Q 1S4ZA 2FMMA 4DV7L 1D1IA 1C8CA 4G4KA 4P73A 4O42A 1YIJA 1F2LA 2OWOA 1E2ZA 1I4GA 4Q5VA 3J7AV 2UXDQ 4DR1Q 3OTOL 2F0WA 2JK8A 2L11A 4Z9CB 1BO0A 2Y0SB 3MXPA 1HZAA 1MHWC 1TXYA 3A5UA 4KY6A 2K32A 3I55A 3SXHA 1VQKA 4HR7B 4RHRA 2EYOA 3NTHA 1O7YA 3J7ZC 1WTOA 2I46A 4GKJL 2WV6D 2IHEA 4A93B 4LF4Q 4K8IA 1KDBA 4B3SL 4JI3L 2A6HC 1Q1BA 2CH4A 1V1OA 1HNZQ 4NXNQ 4XQQA 4YWKA 2H4OA 4HCSA 3SE0A 3R3OA 3GDEA 4A3JG 1I3QH 3TBIB 1XTDA 3TP8A 1YNXA 2B29A 1D5MC 1LTID 1WTHA 2CQAA 3CMEA 3BU2A 1QWYA 1Q1EA 4AQYL 3RZOH 2O4XA 1PDQA 2K1BA 3MTSA 4PZ8A 4OL7A 3KDFB 3BS1A 3RN5A 4A3EB 1LV9A 1OXUA 1CHQD 4OELB 2AQ2B 2WAQE 5FO7B 4DV5Q 1B1ZA 3J80E 5JJIA 1WVLA 1XNRQ 3F8TA 2E2JH 3NENA 3P7JA 1RJTA 3I56A 1VQEA 3KK7A 5I4DA 5JJKA 1ILQA 3BZCA 3LWEA 5CR3A 5JAVA 2VQFQ 4A3IH 2A69D 2F3WA 1VQ4A 3TSSA 1HFGA 3D6WA 2JE6I 4YY3L 5IYDG 1SNPA 1A8VA 3CPWA 3U50C 2UUBQ 4JI6L 4A3KH 4B3RL 1ICWA 5C44B 1EFID 2I5MX 2RCFA 1DOKA 3G6JB 1SSOA 1FNUA 3EBEA 1NMGA 1GUTA 3D3RA 1Y8PB 1XMQQ 1SFOB 2QF7A 4JV5Q 1I6HB 4A3BH 3TP7A 1LUZA 3RLFA 1OXSC 1H9JA 2H5XA 4N8FA 4ZUIA 2XWJB 1L2FA 3HEJA 4DR5Q 2RHQB 1X3QA 4DN4M 1O7IA 1STGA 5C3XA 1V9PA 4IO9A 1XJVA 1BF4A 3BDCA 2ASBA 3NSWA 4BBSG 5HGTA 2I07B 1Y1VG 4PMBA 2BE5D 1JR0D 1C4QA 1ET6A 3W1BA 5I2YA 2A8VA 4DR4Q 4AIMA 1AH9A 3GTKH 3I4MB 4IJHA 4DV7Q 2J4XA 4L5SA 1K73C 1YI2A 1Y1WB 4O2DA 1ASZA 1I50B 3GTPH 1H95A 1HQMC 3G48A 1HQRD 1JWMD 3OTOQ 1VQOA 2JA7G 5TSSA 5I9PA 1VQ8A 2L5TA 2NN6I 2JQOA 2PNHA 4GKJQ 4OO1G 2N8NA 1HUMA 1AZQA 5IY0A 4JYAQ 3I4NH 4B3SQ 4JI3Q 1E22A 1BQQT 4PG3A 3J80c 3M4OH 1EU3A 5EQ0A 1K8OA 3ZYYX 4LUVA 1G91A 1RHPA 3EJIA 3I7FA 1VQGA 5KNDA 3MXUA 3PO2B 2NTTA 3CQZH 2L0CA 3M4PA 5IIFA 3Q23A 5M5WB 1G2SA 5BN3A 2JA6H 4IFDJ 2MPMA 4A3MG 1GXDC 2EJMA 2Z0SA 5C3WA 2KCTA 4AYBE 4POGA 4CGYB 5FLMG 4AQYQ 3QOJA 3A7AB 2LS01 3MEFA 3MFGA 2HDLA 3K7AH 2B2WA 3VDYA 2EYLA 2XSCA 3HOVH 3CC2A 3U58A 2K5NA 4JBJA 4Y7NH 3HOZG 4KK7A 5F2DA 2PQAA 1YHBA 1CFMA 5IWAL 4DAPA 3K6OA 4F8MA 2ZTDA 1NAPA 3HOYG 2PMZB 2NN6H 4GNXB 4JI5L 3DMUA 1EYGA 1LLRD 4TRDA 2N78A 4BXXG 1JORA 3K5NA 1RKNA 1WTQA 2WP8J 1R4QB 3S14B 2K5DA 3A56A 3K80C 2LXJA 4LFBL 5EPLA 5BN4A 3UDXA 3KOJA 2OCEA 4YY3Q 1ET9A 3HRZC 4QY7A 3J81L 4RAUC 2MQHA 2AQ1B 4JI6Q 4B3RQ 2EIFA 2F0MA 1EIHA 1JMCA 1CTMA 2M9VA 4R4CA 4IUUA 1EZ8A 1PXUA 2UU9L 1HPCA 4CJ0B 4RWSC 4DXFA 3KLWA 1CUKA 1XPRA 1CI3M 4GLAC 1RF2D 3EN2A 1LTGD 1ZEQX 4QMGA 3CP0A 2IJ0A 1QVGA 5K36H 1QUQB 4CHTB 3J80i 1YJ9A 1AP0A 3E0EA 1CKOA 2XTIA 1CK1A 3W5OA 1AE2A 2AWNA 1PV4A 3HKZB 3QJYA 5IGGA 1Z7TA 1SYGA 2KJXA 1TWGB 3NPPA 1GD7A 4LUZA 2QA4A 2F4VL 1I6VC 1NCVA 2Q8TA 3T13A 2JA5G 2KA7A 1B70B 2GA4B 4PV1C 4K5XA 1G291 1LTRD 1JE4A 1L0WA 3TREA 4DV2L 1PTOC 4ALPA 1XXGA 1G6PA 3PUZA 4DFAA 1HHVA 3KJPA 2PW5A 3KFUA 1VQBA 2Z6BA 5IYBG 3Q8DA 4XXEA 1NE3A 2Z4IA 1S5DD 2DNCA 1OXXK 4XIGS 3HOWB 2JN4A 1Q3LA 3K57A 4FDBA 1EIYB 1ENFA 4KHVA 2XGTA 2IHFA 4A3LH 5T1IA 4BY7G 5IGCA 2ES2A 2RVLA 2IX1A 2OF1A 1MSHA 2F0HA 3QO2A 3MXGA 1M1KC 3NQTA 4A3EH 1L0YB 5E7NA 1S5BD 1VQPA 2GVBA 4FYDA 1VF7A 3MXNA 2AMCB 2OTLA 1HA6A 2UXCL 1TS5A 2R6GA 1X3EA 1MJEA 2E75C 4BBRG 3M3YB 4KMUC 3CCMA 1NUCA 1X3GA 2V4DA 1LM0A 3HOXH 4JBMA 3GTLH 3GQBA 5L37A 3G4SA 1VQNA 2JEBI 4OO1I 2UUCQ 4DUYL 4YCVA 2WINB 4NMZA 1WYDA 5CV5A 5C44H 3Q24A 5CV9A 4DGZA 4JI5Q 4GLXA 1NMFA 4CDCC 1IYJB 1UE6A 2M00A 4LFBQ 1UAPA 4BBSH 3CCQA 3VR6A 3S2DB 3S24A 1AN8A 1X65A 2D5DA 1PYBA 1JB3A 3OW2A 1XPOA 2EXDA 1JWUD 1X55A 2IL8A 5IYCH 1IW7C 1W6JA 3VR3A 3FRPB 1PMRA 2F4IA 2UU9Q 3VR4A 3S1QB 2NVTB 4CKCA 4JI1L 1S5FD 3M9BA 1A6XA 1JWSD 3BVMA 1N33L 2RKSA 1G8ZD 2FFKB 5G3LF 1VMPA 4UPAA 1GOZA 2N3SA 4M1UB 4WJWA 4QUFA 4GOPB 5DM73 1EOTA 1N34L 2F0PA 3I4MH 3WOEA 4YWLA 3URYA 4C3IB 1A2TA 5DLQE 1KIXA 4A3GB 1BCPC 1TWAH 1I50H 1DJRD 1L1OB 1BR9A 5CV6A 1G51A 4RH6A 4LF8L 2F4VQ 3ULLA 1BOSA 5D14A 4QIWB 1VQ5A 4DAVA 4A3IG 3K81C 4X64L 5C4HA 1WTPA 1UE1A 2FMCA 1EEID 5GADC 3T53B 4DV2Q 2N88A 4RG1A 4J1MA 4K0KL 4A3KG 2WKCA 3JC66 4LFCL 3U9SA 2RF4A 3V2TA 1SYDA 2R93H 1CQFA 4H02A 3T4AC 4MN3A 4A75A 3PO2H 1KDAA 5C4ZA 3D4DA 1L0XB 4FXKC 5EKIA 2DY8A 2JJQA 5T1GA 2CQOA 3Q6SA 4A3BG 5EBDA 2Z8LA 2RSNA 2HUGA 3KF8A 3HKSA 1LTSD 3RD4A 3QOLA 1KNEA 4BS9A 3PUXA 1NR4A 4UP8A 1IKMA 4C56C 4B3ML 3NTKA 4YCWA 4AYBG 5KGUA 5CMDA 5CV8A 4ZKCB 3SGIA 3N6RA 4HMJA 2UXCQ 1JOOA 2KBNA 4KHPL 1B3AA 2NVYB 1CSPA 2NYZD 3KF6B 3CXCA 3MC0B 5C0XJ 3QR8A 3AFPA 3S14H 5AFWA 3SDZA 3STBC 4QJFA 4OEMB 4LJZC 3CCVA 1A3TA 3DM3A 4EGVA 5GAEC 1EQRA 5E4XA 1XMOL 2QDBA 2ZM6L 4P74A 5ELDA 2M2LA 2KHSA 1SMYC 3P20A 3OIPA 3F2DA 1M90C 4DUYQ 4ZCKA 3T1HL 1E0BA 1EYDA 4C3HB 1IBLL 2HHHL 3EIVA 3NWTA 1XNRL 1EL0A 1S72A 1EFWA 1KRSA 3A54A 1X3PA 2RCNA 1TQOA 3I4NG 5EPKA 3RMHA 3M4QA 2MJ8A 3S15H 4LNQA 1HR0W 5JEAJ 2DGYA 4IN3A 2PZTA 4PNYA 2PQEA 5EKKA 1LTAD 1F2ZA 1H9MA 2JA6G 3SR1A 2SNSA 1OXVA 5GAGC 5ELNA 1TWGH 4N9PA 3H94A 1A62A 1O7ZA 4IPGA 4JI1Q 4CKEA 5ELOA 2EXZA 2KQ3A 2L12A 4IOCA 1WD1A 1N33Q 4KV6A 5C4XB 5EKLA 3S2HB 1NNXA 5E1FA 2MHVA 1HJPA 2B2UC 1D5XC 1SN8A 1N34Q 4IUVA 1F2YA 2XWBB 4A3DB 2Q2IA 2CWPA 5IT9L 2L1BA 3NXWA 4DV1L 4DAYA 5JPNC 3IFDA 3W2DA 1HRJA 2NN6G 4NDXA 3U4VA 4LF8Q 1B4OA 4CDFC 4ME5A 2R7DA 5KIXA 1YNND 4IQZA 4MTKA 3PO3B 1V1QA 4XYQA 4B9WA 4XDXA 1PH9A 3FEWX 5GQOA 4X64Q 1YEZA 1IHZA 4JI4L 2R7ZB 1EY0A 2ENBA 3TZDA 2Z4HA 3H15A 2RDGA 4K0KQ 4B3TL 2SNMA 4LFCQ 1B3QA 4P72A 1GUGA 2A19A 4FXGC 2LFNA 2E76C 2CHBD 3OHXC 1J9OA 4CDDC 3K59A 1GUSA 4QGUA 5K36G 3S1MB 3BYYB 1WJJA 1LTTD 1B53A 1V1PA 3HZXA 3TP5A 4DK0A 3M3YH 4YWMA 3I70A 3UDFA 4JI8L 3PUYA 1JJ2A 4B3MQ 1SEBD 2R92H 1S3OA 3NELA 4PMCA 4JYAL 3C1FA 1JOKA 2IX0A 3CU7A 1I5FA 4WJ4A 4TSSA 2OT2A 3ERSX 4UP9A 1WFQA 3GTOB 2K28A 4KHPQ 4C2MH 4R4QA 1LTLA 1YHQA 3H6MA 4FF4A 1MBYA 2NWGA 1KL9A 2G9HD 1PTOD 4A3JB 4A93G 4ABNA 5IT9c 1ENAA 2CKZB 4ZLTF 4XTCS 2LY7A 1K83H 2EQSA 1JCKB 1SE8A 5LMUL 1EEFD 1S40A 4JCVE 4XQNA 1XMOQ 1PVOA 4PMWA 2ZM6Q 2ZXPA 1Q90A 4NB3A 5D65A 4K2KA 3ONAB 5M5YB 4X6AH 3GTJH 3X3NA 2F0GA 3NK9A 1PYSB 3T1HQ 1SYCA 1QNUA 1IBLQ 3GD7A 5IGFA 1CT1D 3CCRA 1JJCB 2HHHQ 4BY1B 3S1QH 2NVTH 4A3LG 4DK6C 4RCNA 1A2UA 2IT1A 4JG2A 1CZWA 1ONLA 4DF7A 3AFQA 4IUPA 4WRDA 4A3EG 1DXMA 1VF5C 1YBYA 3OIQA 3E3XA 3PUWA 2F0VA 2GN5A 3CAMA 3I90A 4F7XA 4A3GH 2Z9HA 1E24A 2JSOA 2K4KA 1QG7A 1IBML 2EYPA 3J80L 1W2BA 3PMFA 1TWCH 1STEA 2ICIA 2WACA 2ZT9C 2A74C 3HOXG 1AZPA 1KAAA 3FPUB 4L8JA 3R93A 5J39A 2RDFA 4DV4L 1R9TB 4DV1Q 4IURA 4ZUJA 5C44G 2PNRC 1GKHA 1HFNA 1GUNA 2HCCA 4L5RC 3NEMA 1PFBA 1MJCA 3J81j 1E1TA 1QZGA 2FINB 2VL6A 5I6YA 4FF1A 3SK6A 1C9OA 1C48A 2P5ZX 1PHJA 2B63H 2D0OA 4BA1I 1K9MC 2F03A 4J8QA 1UEAB 4AH6A 1VS0A 2XVSA 4JI4Q 1Y1VB 1IW7D 5KYIA 3C2PA 1LT4D 1HZ9A 5IYCG 4B3TQ 1FNWA 1SYBA 3QWNA 1SJHD 4KY7A 3S1NH 3J7YW 4JVZA 1T5XD 4YHHL 1JC7A 3TMEA 3M7GA 2NVYH 4N8X1 1S5ED 3LX0A 2VB2X 1NR2A 1PFSA 2QEJC 3I4MG 1DCZA 2CWAA 4JI8Q 2L15A 3O13A 5D3DA 1BCPD 4RCOA 1KC8C 2HQEA 2NZ1D 1HZCA 2R3ZA 1D8LA 3D6CA 1SXTA 3S17B 1CA5A 5IGEA 2HT1A 4FNFA 1UWVA 2KHIA 1FVIA 4DXGA 5FK9C 4C3HH 5CC4A 2F0JA 3S16H 4OONA 3M85A 1TY2A 1O7LA 2JA8H 1XX8A 4NP5A 1PH7A 4DAMA 4DR6L 3E9IA 5LMUQ 2MNAA 3W3AA 4A3FH 2R93G 2C9OA 3PO2G 1YJNA 2O2LD 4IUNA 1EIGA 5IP7H 4R9WA 4WORA 3HOZB 1RIPA 2OXPA 4H0LC 2UUCL 4RGTA 3AU7A 1Q81C 1CKNA 4DR7L 2DY7A 3TQYA 2AWOA 1KLGD 2B2VC 3GV3A 5C4XH 2NVQB 3S2HH 3NE5B 1RL2A 3IAYA 4IFDH 1VQAA 1I4RA 2B2UA 1TR5A 3KLRA 4DR3L 4J15A 2VQEL 1I4XA 4QUCA 4A3DH 2K6AA 3F2CA 2D2CC 4OWXB 1VQ7A 4JI2L 1IBMQ 1F9PA 1QE6A 3HG9A 1PRTC 1HH2P 1TS2A 3A74A 2X69A 4QF4A 4E6IA 3S9WA 3KJOA 4OX9L 3PO3H 1QCBD 2BCOA 1STBA 2EE1A 4LAAA 3A5ZB 3CCLA 1BXTA 4YIJA 5K5PA 2R7ZH 3GTMB 5M3MH 4NPSA 4DV4Q 2EJFC 3M4YA 5JOBA 3FKIB 1BKBA 2EZVA 1PH4A 2K52A 2CFMA 5M3FB 3RLNA 2F52A 1QZHA 1EZ6A 2QILA 2PQAB 2E74C 2UUAL 3JAME 1P8LA 1U4RA 1JOQA 3VA7A 3SVMA 3S1MH 4X65L 1SNDA 3B6YA 3TP6A 4ID6A 1VQMA 4IPHA 2YTVA 2LMCB 2F3VA 1ESFA 3GO5A 1VQIA 2D9UA 1QVFA 1DGSA 1KD1C 1QVCA 3HKZG 4A93H 2KCNA 3H3VH 2K5VA 2AHOB 5JJLA 3C1EA 5M5XB 4IUQA 3IKJA 1Q8IA 3NTIA 2E2HB 2K14A 1I4PA 3RZDB 4YHHQ 3GTOH 2LSSA 3DXJC 1X32A 3OOCA 2R7FA 2NZOA 1ZYRC 5HGQA 5H1SE 5EGTA 2L55A 4P2CB 1B8AA 3IRBA 4GLVB 3ULJA 4HJ9A 1BBXC 3CC4A 1HNWL 5BN5A 2F0KA 3TDQA 4QB4A 3CKIB 4JPBW 4K5WA 2K04A 2F3IA 4LF6L 2IX3A 5FLXE 1HTPA 2MO0A 3CPFA 4RGMA 3DHQA 2DNEA 1I4HA 4FVMA 2PO4A 1Y8OB 2F0FA 2IW3A 4BY1H 1LT5D 4NW2A 2BH2A 2DJFC 1V8QA 2WAQB 4DR6Q 4CBVA 1Q86C 4BBRB 4LF7L 3KBGA 1Q8KA 2EYHA 2F0SA 2Y0SE 3A8KE 3H0GB 1LT6D 3C3LA 1VQJA 2MUYA 4JI0L 2V1CC 4DNIA 2QGQA 2A69C 2B8GA 4DU9A 2KUMA 2Q2HA 3KYHC 5C5LA 4DR7Q 2B39A 1X54A 1ILPA 3MEHA 4KKSA 2DUDA 3EFXD 1STHA 1GJXA 2R92G 2TMPA 4KD3A 1AEXA 2B2TA 1JB7A 2A6HD 3MA2B 4EQ5A 4HIMA 1SFOH 4XT1B 3MFYA 4DR3Q 1UE7A 2EDGA 1YZ6A 2VQEQ 1I6HH 2ID0A 3PSIA 1R9TH 5D3IB 1KLUD 1B44D 5CGKA 4M8AA 1K28A 4JI2Q 4H44C 2NZHA 1PA6A 1SNMA 3MXNB 4HCEA 1H9SA 1LO5D 2WIIB 4GZYC 1SE2A 1CQVA 2K5HA 1I3QB 3HP3A 1HR0L 4OX9Q 2DN8A 4I7ZC 3PIO3 2JEAI 2X6GA 4GN4B 3I8ZA 1EWIA 2WB1B 1BDOA 5I6WA 4DKAC 3UDGA 4Q0FA 5J1ZA 5IODA 1CA6A 3E0JA 4DR2L 1VQCA 2Z6KC 3K0XA 5LHY1 5FJ8H 2BE5C 3MZ5A 5NUCA 4R4OA 1Y1WH 3VR5A 5AJ3L 3BG3A 4DNTB 4X62L 3AEVA 2UUAQ 3ER0A 1IBKL 2PZWA 3PF4A 4X65Q 1MGSA 4HTHA 3DEPA 1HXYD 3J81i 1ASYA 1E1OA 2I0QA 1QOHA 2MP1A 1AE3A 1WCMB 4P75A 4A3GG 3NBIA 1SROA 1AFPA 1A0IA 2QCPX 1WD0A 1GUWA 1QB5D 1DYQA 3TS2A 2CW0C 2VUMB 3NBHA 1D2BA 5KYLA 3VYRA 1G6ZA 4IJLA 5A2QE 2E2IB 5M5WH 3SHLA 1CSQA 2ZXOA 1QNKA 2F0TA 2L9HA 1EYAA 3BDLA 2PZUA 1HNWQ 1IL2A 4HSPA 3EA6A 3PIP3 2QKIC 1TKWB 1B9NA 4CJ1B 4LF6Q 2OEOA 2XIWA 4UP7A 3MAQA 1UUPA 3R8BA 4X3TA 1LACA 3IFTA 3JAMi 2PI2E 2RSOA 4DUZL 1OTCA 4RFBA 3DUZA 2B63G 2F1MA 1FNVA 5HURA 3RUZA 2PYKA 1E2WA 3E5SA 3OWEB 4R4TA 1PH2A 5A2QL 1MSGA 1XWEA 3HOUB 2WFWA 2B2VA 4C3JB 3K5OA 2NVQH 1IZ6A 1N8RC 5J3BA 4LF7Q 3GTKB 2F0EA 2IY5B 4JOIA 3TZUA 3ITPA 1MKHA 4FF2A 2OQKA 5C3EB 4B9XA 5ELFA 4I65A 4JI0Q 5FO9B 3NP8A 1KNAA 2PCFB 2XRSD 2E5LL 2FXQA 2K03A 1II3A 3BVZA 3DWAA 4GNXC 1EY7A 2N49A 3J7AF 3P1HA 1GUOA 1TS3A 2PPBC 4JBWA 1PH3A 5JJZA 4A3CH 2BDNA 3KF8B 4OHJA 1IKLA 2YU9B 2E8GA 3DWQA 3M4OB 2FHTA 3QG1A 5C0XH 5FOBB 1DOMA 3FKIH 3G7LA 4UDUC 3GTGB 5ELEA 5M3FH 4C3HG 2NB0A 4MNOA 3F1ZA 3A8JE 2VNUD 4ME3A 2K33A 1YHAA 3A0JA 2JA8G 2JA6B 1HR0Q 4DA2A 2BA1A 2G9DA 2EJGC 1EY4A 1FJGL 4TQUS 1XPUA 1S5CD 5J22A 4A3FG 1SLJA 2AUJD 2VW9A 3GTQB 4HJ7A 1SYFA 2EOTA 1EQVA 2QW7A 4G7ZC 2PMZE 4KTAA 1FGUA 1SBBB 2K7VA 3FPPA 4DR2Q 2SEBD 3HOVB 1GO3E 2MFIA 5IP7G 1WI5A 3GP7A 4OIKA 1MD2D 5JEAH 2D62A 5AJ3Q 1HUNA 5ELBA 5IOCA 4X62Q 3I73A 4KN7C 2E2HH 3T56B 5C4JB 1IBKQ 3UI2A 2LKVA 3RZDH 5C4XG 1EY9A 2I5HA 4IFDG 1N9WA 4MIUA 3OPOA 5JPMC 1KTKA 1F9QA 3I2ZA 3HOWH 1Y8NB 2VS1A 3DLLA 4OGQC 4A3DG 4KY5A 4G7OC 4BA2I 2EVBA 1R4PB 5ISRA 1EOVA 3FP9A 1VCIA 2CH4W 4HEDA 1E2VA 3D4RA 4JC0A 2R61A 3PO3G 5DAUA 4YCUA 5CORA 2F0QA 1KHIA 4KJNA 4WFN3 2K01A 3NWSA 3SK5A 2R7ZG 3AMUA 3HKZE 5M3MG 2J0TD 2NTSA 2ICEC 1PTOF 5M9OA 5C6AA 3K0YA 3KDFA 4OIJA 5LMNL 2OTJA 5HY6A 4R1JA 3H0GH 3TRZA 1U0LA 2H1EA 1PTOB 4DUZQ 4DAYB 3AYHB 1DD2A 2Y0SG 1A15A 1WTXA 2K5WA 4UY8C 1TY0A 1XYIA 4LW1A 1HNXL 4TKOB 1JE5A 1LTBD 3VYUA 2TSSA 4X3SA 4DPGA 1EQQA 3PGZA 4IPDA 3S2DH 3OMGA 3CRLC 3EVQA 2E5LQ 1PZJD 2K05A 5GAHC 1TIID 1ZYRD 4HJ8A 1KAWA 3BZKA 4L5TA 4RHSA 3HGBA 2HQLA 1DOLA 1WTWA 3NUCA 2ZJRA 1A3VA 5DEHA 2F0UA 4FXDA 2ATWA 3BJUA 4K8JA 3U4ZA 1K3RA 2YTYA 1V1PB 1Z6HA 4G57A 1O80A 2BOSA 1B7YB 1D5ZC 5GROA 3OSOA 1H9RA 3LGJA 4WJ3M 2Z6KA 5CV7A 4C3IH 1VDZA 4BY1G 4ZAIA 1TVXA 2EYMA 4QCLA 1OO9B 1YVCA 1BUVT 4K6DA 1PZID 1FJGQ 2O5IC 1TU2B 3OW7A 1EUJA 1SDFA 1NSNS 3RN2A 3QB3A 5IP9G 2KOLA 2EYJA 2PI2A 2B2TC 1EQTA 4GOPC 1NTGA 2XRQD 4JBKA 1WCMH 2EY5A 3HOXB 3VYTA 3GTLB 1RTOA 2CCZA 3CRKC 4EQNA 2Q8RE 1KQSA 2VUMH 3IL8A 1L1OC 4KN4C 3VR2A 4LF5L 3D8GA 4DK3C 4XQJA 3Q22A 2E2IH 5BR8L 4FO2A 4QL5A 4NKLA 2RA4A 3OWFA 3Q0AA 1VQDA 4BBSB 2Q8IB 4JK1C 1J6QA 1RD9D 5I2XA 3PIOA 1BCPF 2HCIA 4DV0L 2A73B 2C5CA 2WB1E 1TS4A 2QEXA 3HS0C 4LK1C 2A6EC 1PH6A 3L3OC 3ND9A 1RCVD 1BCPB 2UXBL 1F77A 4GN3B 5LMNW 3LNNA 2N55A 1RDPD 1X6OA 1JQYD 1YJWA 3SK4A 3HOUH 1SE3A 1HA5A 2KCMA 3DEOA 4C3JH 2SDFA 2MGSA 2JA7B 1T9HA 5FJ8G 2JYOA 5LMNQ 1X3FA 1M8AA 3AB9A 4PQXA 3A7LA 4RGOS 4IFDI 1Y1WG 4PZ6A 2KCCA 3L9AX 4QIWE 5C3EH 1TWAB 3L2PA 1B50A 4F88A 1SJED 1JT8A 2EYFA 3G6EA 4O0AA 5CBAE 1I4QA 4MTNA 3ND8A 2NBFA 3WDNA 4GNXA 1MIUA 4RMFA 2A1AA 1HNXQ 1Q46A 3S1RB 4A3MB 1HZBA 2CW0D 1BNZA 1NBWA 4X66L 2RDHA 2YU9H 4IZ8A 1U4LA 4ILWA 3GTGH 4A4IA 3CCEA 2AKWB 2LXKA 3PIPA 2R93B 1PYWD 1B9MA 2AQ3B 4JI7L 4L6TB 1SNOA 2MO1A 4NXML 1W6KA 4HJAA 1C0AA 5IGBA 3E6ZX 2K75A 2ALYB 3SEBA 2ZJQA 4V190 2ZJPA 2F0LA 2HDMA 3HOYB 3V05A 4IPCA 4MZ9A 5CBEE 1YITA 2A68C 1EY5A 3GTQH 4KJOA 1CKMA 4BWGB 1QUQA 2Q2UA 4JOIC 1ZKOA 2K5QA 3J81E 1H9KA 1VQLA 4QQBX 1DONA 2EY1A 3ULPA 1PH1A 4KKUA 4CKBA 3ICEA 2VB3X 4O1NA 3H3VI 4EQOA 4LF9L 3TN2A 5C4JH 1NJIC 3E9HA 4TVAB 3STBD
chains in the Genus database with same CATH topology
1KABA 1CHPD 1CM9A 2NVXB 5A35A 1ESRA 2RQXA 2KEEA 1YNNC 4XT3B 1SMYD 2PW7A 3I4LA 1YNJC 1VMCA 3BYTB 4L63B 3L7ZC 3D4WA 4KD4A 1ZXTA 1G2TA 4RKBA 3ERQA 2EY2A 1OXTA 2O5JC 1U9RA 2F0NA 1TWFB 2EPBA 3QIAA 3S15B 2NUCA 1LABA 5C0XG 3K5MA 1FGBD 4KKTA 1M4VA 1PLFA 3NHHA 2BA0A 2JA5B 5KNBA 4HAEA 5I9OA 1PTOH 3BVGA 3V96A 1TWHB 2CVRA 5ELCA 2RBMA 5LL6S 2IPKD 3KBXA 4G7HC 1B2TA 3JAML 1PZKD 5DM63 3T51B 1K8MA 4ZYSA 4MHEA 5JEAG 2B2YC 3H3VC 1RTNA 1EY8A 4BY7B 4CJ2C 1GHKA 1HCZA 3T16A 3DWPA 2Z1CA 1WTVA 3A8IE 4UAIA 2XN9C 4FF3A 1EWHA 1IYVA 4F87A 3BDOA 4U673 2XNAC 3PV0A 1ENCA 4X3UA 5DNFA 5FLXL 1RODA 3F2UA 1SNQA 5EJWA 1QJOA 1F9RA 3CHBD 2L4NA 3MHBA 1EU4A 4C1NI 2YYZA 4KI0A 3I91A 2VXWA 2R92B 4LMQD 5EBCA 5IGDA 3MWYW 4IALA 3LWUA 4RGNA 1Y69U 3H09A 5FKAC 2X6LA 3H91A 4H7BA 5KEEA 4C2MB 3M7NA 3N52A 1IL8A 5C5MA 4ODGA 2F0OA 1K83B 3RZOB 4R8NA 3GTJB 3A55A 1PFNA 3GV6A 3KUPA 4X3KA 2E2JB 1HTLD 1SNCA 1JICA 1QILA 4KHZA 1KDCA 3OMCA 4B08A 3BZDB 1DM0B 1WTRA 4C3IG 3MVVA 4A3IB 4K14A 1O78A 2E2DC 4HSVA 3K58A 4OO1H 4RKLA 1IYUA 2WKDA 1AW7A 4A3KB 3EROA 1H9SB 1FR3A 4S3SA 2F0IA 1TWCB 4ZQ3A 4K5VA 5G3LD 4XYOA 4A3BB 3FMCA 4ULLA 3R2TA 3KLSX 5FO8B 3EQLC 3VYSA 1SAPA 4HN7A 5C0XI 4DK1A 1STAA 2FJ2A 3VA5A 3SK8A 1EWCA 4AYBB 2B63B 1CZGA 3U9OA 2KECA 5JVG3 4EQPA 2B8FA 2A6ED 3I3CA 3P75A 1F9SA 5E3FA 1UNSA 5CV4A 5E4WC 4V0BA 4ZKBB 3S1NB 5COYA 1V43A 3GTPB 3DM1A 4C1NK 4C3JG 3FDTA 2IWHA 3K5LA 1SE4A 2AUKA 4R8IA 4U68A 2F0DA 1GHJA 1STYA 5CYUA 5KRUA 4ZRZA 2KEDA 1FD7D 3C46A 3I4NB 2KVMA 1D1KA 3R2IA 5LL6X 4J6HA 1J8IA 3CQZB 2JP1A 1EYCA 3S16B 1LT3D 2J7ZA 2SOBA 3PUVA 1DZ1A 2JA8B 5EPJA 2BDOA 1STNA 1U4PA 4N9TA 1EY6A 3K7AB 4A3FB 2B2WC 5IT9E 1Z47A 1MI2A 4K6LA 4EVOA 2ZXRA 4Y7NB 4DNRB 1PRTF 3D31A 2A68D 3I72A 4ZK9B 1PRTB 1T5EA 5KNCA 2A5HA 3KLSA 1SYEA 4K2LA 1PFMA 2B2YA 1XTCD 1TT2A 4FP5D 3X3MA 1PRTD 4HMIA 4RA8A 1F2MA 3FVQA 1A3UA 1D6EC 2JXMB 3NQIA 4IUTA 1YNJD 1ML0D 5JVH3 1FYCA 4H13C 1U4MA 1Q12A 2EY6A 5M3MB 3WOFA 1S4ZA 2FMMA 1D1IA 1C8CA 4G4KA 4O42A 1F2LA 1E2ZA 1I4GA 4Q5VA 3J7AV 2F0WA 2L11A 4Z9CB 1BO0A 2Y0SB 3MXPA 4KY6A 2K32A 3SXHA 4HR7B 4RHRA 2EYOA 3NTHA 1O7YA 1WTOA 2I46A 2WV6D 4A93B 4K8IA 1KDBA 2A6HC 1Q1BA 1V1OA 4XQQA 2H4OA 4HCSA 3SE0A 3R3OA 3TBIB 3TP8A 1D5MC 1LTID 2CQAA 1QWYA 1Q1EA 2O4XA 1PDQA 2K1BA 3MTSA 4OL7A 3BS1A 4A3EB 1LV9A 1OXUA 1CHQD 2AQ2B 5FO7B 1B1ZA 3J80E 1WVLA 3P7JA 1RJTA 3KK7A 5I4DA 1ILQA 3LWEA 5CR3A 5JAVA 2A69D 2F3WA 3TSSA 1HFGA 3D6WA 2JE6I 1SNPA 1ICWA 5C44B 1EFID 1DOKA 3G6JB 1SSOA 1FNUA 1GUTA 3D3RA 1Y8PB 1SFOB 2QF7A 1I6HB 3TP7A 3RLFA 1OXSC 1H9JA 4ZUIA 2XWJB 3HEJA 1X3QA 4DN4M 1STGA 5C3XA 1BF4A 3BDCA 3NSWA 5HGTA 2I07B 4PMBA 2BE5D 1JR0D 1C4QA 1ET6A 5I2YA 3I4MB 2J4XA 1Y1WB 1I50B 1HQMC 1HQRD 1JWMD 5TSSA 5I9PA 2L5TA 2NN6I 4OO1G 1HUMA 1AZQA 1BQQT 1EU3A 5EQ0A 1K8OA 3ZYYX 1G91A 1RHPA 3EJIA 5KNDA 3MXUA 3PO2B 2NTTA 2L0CA 5IIFA 3Q23A 5M5WB 1G2SA 5BN3A 4IFDJ 2MPMA 1GXDC 2EJMA 5C3WA 4CGYB 3QOJA 3A7AB 2LS01 3MFGA 2HDLA 2B2WA 2EYLA 2XSCA 4KK7A 5F2DA 1CFMA 4DAPA 3K6OA 4F8MA 1NAPA 2PMZB 2NN6H 3DMUA 1LLRD 4TRDA 1JORA 3K5NA 1RKNA 1WTQA 2WP8J 1R4QB 3S14B 2K5DA 3A56A 5EPLA 5BN4A 1ET9A 3HRZC 3J81L 4RAUC 2AQ1B 2F0MA 1EIHA 1CTMA 2M9VA 4IUUA 1EZ8A 1PXUA 1HPCA 4CJ0B 4RWSC 4DXFA 1CI3M 1RF2D 1LTGD 1ZEQX 4QMGA 5K36H 2IJ0A 4CHTB 1AP0A 1CK1A 2AWNA 3HKZB 3QJYA 5IGGA 1Z7TA 1SYGA 2KJXA 1TWGB 3NPPA 1I6VC 1NCVA 2Q8TA 3T13A 2KA7A 2GA4B 4PV1C 4K5XA 1G291 1LTRD 1JE4A 1PTOC 1XXGA 3PUZA 4DFAA 1HHVA 2PW5A 4XXEA 2Z4IA 1S5DD 2DNCA 1OXXK 4XIGS 3HOWB 1Q3LA 3K57A 1ENFA 4KHVA 5T1IA 5IGCA 2RVLA 2IX1A 2OF1A 1MSHA 2F0HA 3QO2A 3MXGA 3NQTA 1L0YB 1S5BD 4FYDA 1VF7A 3MXNA 1HA6A 1TS5A 2R6GA 2E75C 3M3YB 4KMUC 1NUCA 2V4DA 3GQBA 2JEBI 4OO1I 2WINB 4NMZA 3Q24A 5CV5A 5CV9A 4DGZA 2M00A 1UAPA 3VR6A 3S2DB 1AN8A 2D5DA 1JB3A 1JWUD 2IL8A 1IW7C 1W6JA 3VR3A 3FRPB 1PMRA 2F4IA 3S1QB 3VR4A 2NVTB 4CKCA 1S5FD 1A6XA 1JWSD 3BVMA 2RKSA 1G8ZD 2FFKB 5G3LF 1VMPA 1GOZA 4M1UB 4WJWA 4QUFA 5DM73 1EOTA 2F0PA 3WOEA 3URYA 4C3IB 1A2TA 4A3GB 1BCPC 1DJRD 1BR9A 5CV6A 4RH6A 1BOSA 5D14A 4QIWB 4DAVA 1WTPA 5C4HA 2FMCA 1EEID 3T53B 2N88A 4J1MA 2WKCA 3U9SA 3V2TA 1SYDA 1CQFA 3T4AC 4MN3A 1KDAA 5C4ZA 3D4DA 1L0XB 4FXKC 5EKIA 2DY8A 5T1GA 3Q6SA 5EBDA 2Z8LA 2RSNA 2HUGA 3RD4A 3KF8A 1LTSD 1KNEA 3QOLA 4BS9A 3PUXA 1NR4A 1IKMA 4C56C 3NTKA 5KGUA 5CMDA 5CV8A 4ZKCB 3N6RA 4HMJA 1JOOA 1B3AA 2NVYB 2NYZD 3MC0B 5C0XJ 5AFWA 3SDZA 4LJZC 1A3TA 4EGVA 5E4XA 2QDBA 5ELDA 2M2LA 2KHSA 1SMYC 3P20A 3OIPA 1E0BA 1EYDA 4C3HB 1EL0A 3NWTA 3A54A 1X3PA 1TQOA 5EPKA 3RMHA 2MJ8A 5JEAJ 4IN3A 2PZTA 4PNYA 2PQEA 5EKKA 1LTAD 1F2ZA 1H9MA 3SR1A 2SNSA 1OXVA 4N9PA 3H94A 1O7ZA 4CKEA 2EXZA 2KQ3A 2L12A 1WD1A 4KV6A 5C4XB 5EKLA 3S2HB 5E1FA 2MHVA 2B2UC 1D5XC 4IUVA 1F2YA 2XWBB 4A3DB 5IT9L 2L1BA 3NXWA 4DAYA 5JPNC 3IFDA 3W2DA 1HRJA 2NN6G 4NDXA 1B4OA 4ME5A 5KIXA 1YNND 4IQZA 3PO3B 4XYQA 4B9WA 4XDXA 3FEWX 1IHZA 2R7ZB 1EY0A 2ENBA 3TZDA 2Z4HA 2RDGA 2SNMA 1GUGA 4FXGC 2LFNA 2E76C 2CHBD 3OHXC 1J9OA 3K59A 1GUSA 5K36G 3S1MB 3BYYB 1LTTD 1B53A 1V1PA 3HZXA 3TP5A 4DK0A 3I70A 3PUYA 1SEBD 4PMCA 3C1FA 1JOKA 2IX0A 3CU7A 4TSSA 2OT2A 3GTOB 2K28A 3H6MA 4FF4A 1MBYA 2NWGA 2G9HD 1PTOD 4A3JB 4ABNA 1ENAA 4ZLTF 4XTCS 2LY7A 1JCKB 1EEFD 4XQNA 4PMWA 2ZXPA 1Q90A 5D65A 4K2KA 3ONAB 5M5YB 3X3NA 2F0GA 3NK9A 1SYCA 1QNUA 3GD7A 5IGFA 1CT1D 4BY1B 4RCNA 1A2UA 2IT1A 1CZWA 1ONLA 4DF7A 4IUPA 4WRDA 1DXMA 1VF5C 3OIQA 3PUWA 2F0VA 3I90A 4F7XA 2JSOA 1QG7A 2EYPA 3J80L 3PMFA 1STEA 2ICIA 2WACA 2ZT9C 2A74C 1AZPA 1KAAA 3FPUB 4L8JA 3R93A 5J39A 2RDFA 1R9TB 4IURA 4ZUJA 2PNRC 1HFNA 1GUNA 2HCCA 1PFBA 2FINB 5I6YA 4FF1A 3SK6A 1C48A 4BA1I 2F03A 4J8QA 1UEAB 2XVSA 1Y1VB 1IW7D 5KYIA 3C2PA 1LT4D 1FNWA 1SYBA 3QWNA 1SJHD 4KY7A 3J7YW 1T5XD 1JC7A 3TMEA 3M7GA 1S5ED 3LX0A 2VB2X 1NR2A 2QEJC 1DCZA 3O13A 5D3DA 1BCPD 4RCOA 2HQEA 2NZ1D 2R3ZA 3D6CA 1SXTA 3S17B 1CA5A 5IGEA 4FNFA 4DXGA 5FK9C 5CC4A 2F0JA 3M85A 1TY2A 1O7LA 1XX8A 4NP5A 3W3AA 2C9OA 2O2LD 4IUNA 1EIGA 4R9WA 4WORA 3HOZB 2OXPA 4H0LC 4RGTA 3AU7A 2DY7A 2AWOA 1KLGD 2B2VC 3GV3A 2NVQB 3NE5B 3IAYA 4IFDH 1I4RA 2B2UA 1TR5A 3KLRA 1I4XA 4QUCA 2K6AA 2D2CC 1F9PA 1QE6A 3HG9A 1PRTC 1TS2A 4QF4A 2X69A 3S9WA 4E6IA 1QCBD 2BCOA 1STBA 2EE1A 4LAAA 1BXTA 4YIJA 5K5PA 3GTMB 2EJFC 3M4YA 5JOBA 3FKIB 2EZVA 5M3FB 1EZ6A 2QILA 2E74C 3JAME 1U4RA 1JOQA 3VA7A 3SVMA 1SNDA 3TP6A 4ID6A 2LMCB 2F3VA 1ESFA 3GO5A 2D9UA 2KCNA 3C1EA 5M5XB 4IUQA 3IKJA 1Q8IA 3NTIA 2E2HB 1I4PA 3RZDB 3DXJC 1X32A 3OOCA 1ZYRC 5EGTA 2L55A 4P2CB 1BBXC 5BN5A 2F0KA 3TDQA 4QB4A 3CKIB 4K5WA 2K04A 2IX3A 5FLXE 1HTPA 4RGMA 3DHQA 2DNEA 1I4HA 4FVMA 2PO4A 1Y8OB 2F0FA 2IW3A 1LT5D 4NW2A 1V8QA 2WAQB 4CBVA 4BBRB 3KBGA 2F0SA 2EYHA 3A8KE 3H0GB 1LT6D 3C3LA 2MUYA 2A69C 4DU9A 2B8GA 2KUMA 5C5LA 2B39A 1ILPA 3MEHA 4KKSA 3EFXD 1STHA 1GJXA 2TMPA 4KD3A 1AEXA 2B2TA 2A6HD 3MA2B 4XT1B 3MFYA 2EDGA 2ID0A 5D3IB 1KLUD 1B44D 5CGKA 4M8AA 4H44C 1SNMA 4HCEA 1H9SA 1LO5D 2WIIB 4GZYC 1SE2A 1CQVA 3HP3A 1I3QB 2DN8A 4I7ZC 3PIO3 2JEAI 2X6GA 3I8ZA 2WB1B 1BDOA 5I6WA 4Q0FA 5J1ZA 5IODA 1CA6A 3E0JA 5LHY1 2BE5C 3MZ5A 5NUCA 3VR5A 3BG3A 4DNTB 2PZWA 1MGSA 4HTHA 3DEPA 1HXYD 1QOHA 2MP1A 1WCMB 3NBIA 1AFPA 2QCPX 1WD0A 1GUWA 1QB5D 1DYQA 2CW0C 2VUMB 3NBHA 1D2BA 5KYLA 3VYRA 1G6ZA 5A2QE 2E2IB 3SHLA 2ZXOA 1QNKA 2F0TA 2L9HA 1EYAA 3BDLA 2PZUA 4HSPA 3EA6A 3PIP3 2QKIC 1TKWB 1B9NA 4CJ1B 2OEOA 2XIWA 3MAQA 1UUPA 3R8BA 4X3TA 1LACA 3IFTA 2RSOA 4RFBA 3DUZA 2F1MA 1FNVA 5HURA 3RUZA 2PYKA 1E2WA 3E5SA 3OWEB 5A2QL 1MSGA 1XWEA 3HOUB 2B2VA 4C3JB 3K5OA 3GTKB 2F0EA 3TZUA 3ITPA 4FF2A 5C3EB 4B9XA 5ELFA 4I65A 5FO9B 3NP8A 1KNAA 2PCFB 2XRSD 2K03A 1II3A 3BVZA 3DWAA 1EY7A 3J7AF 3P1HA 1GUOA 1TS3A 2PPBC 4JBWA 5JJZA 2BDNA 4OHJA 1IKLA 2YU9B 3DWQA 3M4OB 2FHTA 3QG1A 5C0XH 5FOBB 1DOMA 3G7LA 4UDUC 3GTGB 5ELEA 4C3HG 2NB0A 3A8JE 2VNUD 2K33A 2JA6B 4DA2A 2BA1A 2G9DA 2EJGC 1EY4A 4TQUS 1S5CD 5J22A 2AUJD 3GTQB 1SYFA 2EOTA 1EQVA 4G7ZC 4KTAA 2K7VA 1SBBB 3FPPA 2SEBD 3HOVB 3GP7A 4OIKA 1MD2D 5JEAH 2D62A 1HUNA 5ELBA 5IOCA 3I73A 4KN7C 3T56B 5C4JB 3UI2A 2LKVA 1EY9A 4IFDG 4MIUA 3OPOA 5JPMC 1KTKA 1F9QA 1Y8NB 4OGQC 4KY5A 4G7OC 4BA2I 2EVBA 1R4PB 5ISRA 1VCIA 4HEDA 1E2VA 3D4RA 2R61A 5DAUA 5CORA 2F0QA 4KJNA 4WFN3 2K01A 3NWSA 3SK5A 3AMUA 2J0TD 2NTSA 2ICEC 1PTOF 5M9OA 5C6AA 3K0YA 4OIJA 2H1EA 1PTOB 1DD2A 1A15A 1WTXA 2K5WA 1TY0A 1XYIA 4TKOB 1LTBD 3VYUA 2TSSA 4X3SA 3OMGA 3CRLC 3EVQA 1PZJD 2K05A 1TIID 1ZYRD 4RHSA 3HGBA 1DOLA 1WTWA 3NUCA 1A3VA 5DEHA 2F0UA 4FXDA 4K8JA 1V1PB 1Z6HA 1O80A 2BOSA 4G57A 1D5ZC 3OSOA 1H9RA 5CV7A 1VDZA 4ZAIA 1TVXA 2EYMA 4QCLA 1OO9B 1BUVT 4K6DA 1PZID 2O5IC 1TU2B 3OW7A 1SDFA 1NSNS 3QB3A 2KOLA 2EYJA 2B2TC 1EQTA 2XRQD 2EY5A 3HOXB 3VYTA 3GTLB 1RTOA 3CRKC 4EQNA 2Q8RE 3IL8A 4KN4C 3VR2A 3D8GA 4XQJA 3Q22A 4FO2A 4NKLA 2RA4A 3OWFA 3Q0AA 4BBSB 2Q8IB 4JK1C 1RD9D 5I2XA 1BCPF 2HCIA 2A73B 2C5CA 1TS4A 3HS0C 4LK1C 2A6EC 3L3OC 3ND9A 1RCVD 1BCPB 1F77A 3LNNA 2N55A 1RDPD 1JQYD 3SK4A 1SE3A 1HA5A 3DEOA 2JA7B 2SDFA 2MGSA 2JYOA 1M8AA 3AB9A 4PQXA 3A7LA 4RGOS 4IFDI 2KCCA 3L9AX 1TWAB 1B50A 4F88A 1SJED 2EYFA 5CBAE 1I4QA 3ND8A 2NBFA 3WDNA 3S1RB 4A3MB 2CW0D 1BNZA 2RDHA 4IZ8A 1U4LA 4ILWA 2R93B 1PYWD 1B9MA 2AQ3B 4L6TB 1SNOA 1W6KA 5IGBA 3E6ZX 3SEBA 4V190 2F0LA 2HDMA 3HOYB 3V05A 5CBEE 2A68C 1EY5A 4KJOA 4BWGB 3J81E 1ZKOA 2K5QA 1H9KA 1DONA 2EY1A 4KKUA 4CKBA 2VB3X 4O1NA 4EQOA 3TN2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SNM A;  1TT2 A;  4I65 A;  1KAB A;  1STA A;  3NP8 A;  5EKK A;  5CR3 A;  3VA5 A;  1F2Z A;  5JAV A;  3SK8 A;  1SND A;  3QOJ A;  5CV6 A;  3TP6 A;  2F3W A;  4HMI A;  3MHB A;  4K2K A;  1II3 A;  2SNS A;  2HQE A;  3SR1 A;  4ID6 A;  1F2M A;  4N9P A;  2F3V A;  4KHV A;  1SNP A;  3D6C A;  5I6W A;  3U9O A;  2F0G A;  3NK9 A;  1SYC A;  1EY7 A;  2EYL A;  5IGC A;  3P1H A;  1A3U A;  5J1Z A;  2EXZ A;  2KQ3 A;  4EQP A;  5C4H A;  2PW7 A;  2OF1 A;  3P75 A;  5IGD A;  5IGF A;  5IGE A;  4IAL A;  2F0H A;  5IOD A;  4KV6 A;  5EKL A;  5F2D A;  3NQT A;  3D4W A;  5E3F A;  5E1F A;  4KD4 A;  3C1E A;  4RKB A;  5CV4 A;  3ERQ A;  1A2U A;  2F0J A;  5CC4 A;  2EY2 A;  4F8M A;  3MZ5 A;  4J1M A;  5NUC A;  3SK4 A;  2EY6 A;  1U9R A;  4DF7 A;  3DMU A;  1F2Y A;  4TRD A;  1SYD A;  4WRD A;  3V2T A;  4H7B A;  5KEE A;  1JOR A;  1RKN A;  3NXW A;  3OMG A;  4NP5 A;  1KDA A;  2F0N A;  2PZW A;  3TP7 A;  5C5M A;  4ODG A;  3EVQ A;  2NUC A;  3D4D A;  5EGT A;  5C4Z A;  4ZUI A;  2F0V A;  4NDX A;  1JOQ A;  3HEJ A;  4HTH A;  2F0K A;  4ME5 A;  2F0O A;  4F7X A;  3NHH A;  5KIX A;  3NUC A;  1EY4 A;  4QB4 A;  1STG A;  1A3V A;  2F0D A;  4K5W A;  1STY A;  4R8N A;  5DEH A;  2F0W A;  2EYF A;  4IUN A;  3QOL A;  1NUC A;  5C3X A;  5I9O A;  3MXP A;  5KRU A;  2F0U A;  5J22 A;  4B9W A;  2EYP A;  4KY6 A;  4K8J A;  3SXH A;  3BDC A;  4WOR A;  3DHQ A;  2OXP A;  1SYF A;  3PMF A;  2EYO A;  1EQV A;  2F0M A;  5HGT A;  2RBM A;  1IHZ A;  4KTA A;  2WAC A;  1EZ8 A;  2F0F A;  2ENB A;  1EY0 A;  5KGU A;  4PMB A;  5CV8 A;  4G57 A;  4K8I A;  1KAA A;  4NMZ A;  5CV5 A;  1KDB A;  2SNM A;  5KYL A;  3OSO A;  5CV9 A;  4HMJ A;  4DGZ A;  1SNC A;  4J6H A;  2RDF A;  5J39 A;  5IOC A;  3SHL A;  4IZ8 A;  1EYC A;  1JOO A;  1KDC A;  3OMC A;  4QMG A;  5CV7 A;  2SOB A;  4ZUJ A;  1TR5 A;  2LKV A;  2F0T A;  2M00 A;  1EYA A;  1EY9 A;  3BDL A;  3R3O A;  2PZU A;  2EYM A;  1STN A;  4MIU A;  2F0S A;  1EY6 A;  2EYH A;  4N9T A;  1EY8 A;  1SNO A;  5I6Y A;  4K6D A;  3MVV A;  3SK6 A;  4K14 A;  5IGG A;  3TP8 A;  2OEO A;  3HZX A;  3TP5 A;  1SYG A;  1NSN S;  4KY5 A;  1A3T A;  3QB3 A;  5IGB A;  2EYJ A;  5I9P A;  4RKL A;  2QDB A;  5ISR A;  4QF4 A;  2O4X A;  4DU9 A;  3T16 A;  4E6I A;  4EVO A;  3S9W A;  4OL7 A;  2KHS A;  5C5L A;  4PMC A;  2F0L A;  3ERO A;  1STB A;  2EY5 A;  5KYI A;  3C1F A;  1JOK A;  3T13 A;  3MEH A;  1EY5 A;  2F0I A;  4LAA A;  4KJO A;  4S3S A;  1STH A;  5HUR A;  4KD3 A;  1EYD A;  4ZQ3 A;  2PYK A;  4YIJ A;  3E5S A;  1AEX A;  5DAU A;  3RUZ A;  4EQN A;  5K5P A;  4K5X A;  2RKS A;  2F0Q A;  5JOB A;  1SYB A;  2EY1 A;  4K5V A;  4KJN A;  4KY7 A;  3EJI A;  1TQO A;  3D8G A;  3SK5 A;  3H6M A;  5IIF A;  1EZ6 A;  2F0P A;  1ENC A;  4DFA A;  4EQO A;  4NKL A;  3TME A;  5CGK A;  2PZT A;  2F0E A;  2PW5 A;  1ENA A;  1SYE A;  5C6A A;  5M9O A;  1A2T A;  3OWF A;  3ITP A;  1SNQ A;  4K2L A;  4PNY A;  3LX0 A;  5C3W A;  2PQE A;  4B9X A; 
#chains in the Genus database with same CATH topology
 1KAB A;  1CHP D;  1CM9 A;  2BH8 A;  2NVX B;  5A35 A;  1ESR A;  2RQX A;  3RLO A;  2KEE A;  3TS0 A;  1YNN C;  1BBW A;  4XT3 B;  1SMY D;  2RHS B;  3G71 A;  1I94 L;  1Z9F A;  2PW7 A;  3I4L A;  1YNJ C;  1VMC A;  3T1Y L;  3BYT B;  4L63 B;  3L7Z C;  3D4W A;  4KD4 A;  2HIX A;  1ZXT A;  1G2T A;  2HD3 A;  4RKB A;  4LF5 Q;  3ERQ A;  2EY2 A;  1OXT A;  2O5J C;  5BR8 Q;  1U9R A;  3L0O A;  1CKN B;  4A3C G;  1FL0 A;  3CCJ A;  1E7Z A;  1X56 A;  2F0N A;  1TWF B;  2EPB A;  3QIA A;  3S15 B;  2NUC A;  1LAB A;  5C0X G;  3K5M A;  4UHV A;  3FKI G;  4P71 A;  4GKK L;  1FGB D;  4KKT A;  4DV0 Q;  1M4V A;  1PLF A;  5M3F G;  3NHH A;  2BA0 A;  2JA5 B;  5KNB A;  4HAE A;  4LFA L;  5I9O A;  1PTO H;  3K7U C;  3BVG A;  3W1G A;  3V96 A;  2ZTE A;  2UXB Q;  1TWH B;  2CVR A;  5ELC A;  1Q82 C;  2RBM A;  5LL6 S;  2IPK D;  1Y14 B;  3KBX A;  4G7H C;  3CC7 A;  1B2T A;  3J7A 5;  3JAM L;  4L5Q A;  1PZK D;  5DM6 3;  3T51 B;  4A3J H;  1K8M A;  4ZYS A;  1N32 L;  4MHE A;  1E3P A;  4POF A;  5JEA G;  2B2Y C;  4KLK A;  2YV5 A;  3H3V C;  1RTN A;  1EY8 A;  4BY7 B;  1C7Y A;  4CJ2 C;  5M5Y H;  1ICF B;  1GHK A;  1HCZ A;  1J5E L;  3T16 A;  3HOW G;  4R4I A;  3DWP A;  2Z1C A;  1WTV A;  3A8I E;  4UAI A;  1PH8 A;  1KXL A;  2XN9 C;  3K8A A;  3J81 c;  1K0S A;  3F2B A;  4X66 Q;  4FF3 A;  3UDI A;  1EWH A;  1P16 A;  1IYV A;  5IP9 H;  4F87 A;  3BDO A;  3RR5 A;  4U67 3;  2XNA C;  3PV0 A;  1ENC A;  4X3U A;  5DNF A;  4JI7 Q;  5FLX L;  4OWT B;  1ROD A;  3F2U A;  4NXM Q;  1SNQ A;  5EJW A;  1QJO A;  1F9R A;  1XNQ L;  5IYD H;  3CHB D;  2L4N A;  3OYY A;  2WAQ G;  2KHJ A;  1EU4 A;  3MHB A;  4C1N I;  2YYZ A;  1WOC A;  4KI0 A;  3H0G G;  3I91 A;  2VXW A;  2R92 B;  4LMQ D;  5EBC A;  4GOP A;  5IGD A;  3MWY W;  3I4O A;  4IAL A;  3LWU A;  4RGN A;  3CCS A;  1Y69 U;  3H09 A;  1KRT A;  5FKA C;  4LUO A;  2X6L A;  1SMX A;  1SRU A;  2I5L X;  3JAM c;  5IWA Q;  3H91 A;  4LF9 Q;  1L1O A;  1K3B C;  4H7B A;  5KEE A;  4C2M B;  3M7N A;  4APV A;  3HFZ B;  4CDE C;  3N52 A;  1IL8 A;  5C5M A;  2QDL A;  4ODG A;  4A76 A;  2F0O A;  2ZTC A;  1K83 B;  3RZO B;  4R8N A;  1VQF A;  1GVP A;  1Y1V H;  1I94 Q;  1U5K A;  3PQI A;  1EIF A;  3GTJ B;  3T1Y Q;  3A55 A;  1PFN A;  3GV6 A;  3KUP A;  4X3K A;  2WB1 G;  2E2J B;  1HTL D;  1SNC A;  4I7A A;  1JIC A;  1QIL A;  4KHZ A;  1IXR A;  1KDC A;  3OMC A;  4B08 A;  4GN5 A;  3BZD B;  2JA7 H;  4Y52 H;  1DM0 B;  4PZ7 A;  1WTR A;  4GKK Q;  5FLX c;  1Q7Y C;  4C3I G;  3MVV A;  4A3I B;  4K14 A;  1O78 A;  2E2D C;  4HSV A;  4LFA Q;  3K58 A;  4OO1 H;  3S17 H;  4RKL A;  1IYU A;  2WKD A;  1AW7 A;  4A3K B;  3ERO A;  1H9S B;  1BVS A;  4IOA A;  1FR3 A;  1N36 L;  4S3S A;  2F0I A;  4DV6 L;  1TWC B;  4ZQ3 A;  3KF6 A;  1BBU A;  1WCM G;  4K5V A;  5G3L D;  4XYO A;  2VY3 A;  4A3M H;  3S1R H;  1N32 Q;  1JJG A;  4A3B B;  3FMC A;  4ULL A;  3R2T A;  5EAY A;  2C35 B;  3KLS X;  3CCU A;  5FO8 B;  5FLM H;  2VUM G;  3EQL C;  3VYS A;  1X9N A;  2GVA A;  1SAP A;  4DV3 L;  4HN7 A;  3CD6 A;  2G5D A;  1W3S A;  2VZA A;  1SR3 A;  5C0X I;  4DK1 A;  1STA A;  1K8G A;  2FJ2 A;  3VA5 A;  3SK8 A;  1EWC A;  4AYB B;  1J5E Q;  3PCO B;  4HIK A;  2B63 B;  3HOZ H;  1CZG A;  3TEH B;  4DR1 L;  2UXD L;  3U9O A;  3UE1 A;  2KEC A;  5JVG 3;  4EQP A;  2B8F A;  2A6E D;  3I3C A;  3P75 A;  4OXP A;  3HOY H;  1F9S A;  1K0R A;  5E3F A;  4BXX H;  1UNS A;  1A63 A;  5CV4 A;  5E4W C;  4LF4 L;  2JA9 A;  1D7Q A;  4V0B A;  3UE0 A;  2Q2T A;  4ZKB B;  4HJ5 A;  4NXN L;  1HNZ L;  3S1N B;  5COY A;  3PF5 A;  1V43 A;  3GTP B;  1XNQ Q;  2D0P A;  3DM1 A;  3NBH B;  3AQQ A;  4C1N K;  3CW2 C;  1K8A C;  3HOU G;  3WWV A;  4C3J G;  3FDT A;  2IWH A;  3K5L A;  1SE4 A;  1UE5 A;  2AUK A;  4R8I A;  4U68 A;  2F0D A;  1GHJ A;  2NVX H;  1STY A;  2HIV A;  1UEB A;  5CYU A;  5KRU A;  4ZRZ A;  2KED A;  5C3E G;  1FD7 D;  3C46 A;  4EX5 A;  3GTM H;  3I4N B;  1VQ6 A;  4HID A;  2DJG C;  2KVM A;  1D1K A;  3R2I A;  5LL6 X;  4DV5 L;  4J6H A;  1J8I A;  3CQZ B;  2JP1 A;  1EYC A;  3S16 B;  3RNU A;  1LT3 D;  2J7Z A;  2SOB A;  3PUV A;  1DZ1 A;  2JA8 B;  3ZJY C;  5EPJ A;  2BDO A;  1STN A;  1NY4 A;  1U4P A;  4N9T A;  1EY6 A;  4JW0 A;  1TWF H;  1LYL A;  3K7A B;  4A3F B;  2B2W C;  3FHW A;  5IT9 E;  1Z47 A;  2JA5 H;  2VQF L;  1MI2 A;  4K6L A;  4EVO A;  3CMA A;  2ZXR A;  4Y7N B;  4DNR B;  1PRT F;  4HIO A;  3D31 A;  1TWH H;  5M5X H;  2UUB L;  2KEN A;  1VQ9 A;  1VQH A;  2A68 D;  3I72 A;  3CF5 A;  4ZK9 B;  1PRT B;  1T5E A;  4GS3 A;  5IYB H;  5KNC A;  2A5H A;  3KLS A;  5IE8 A;  3HOV G;  1XMQ L;  1SYE A;  4JV5 L;  4K2L A;  1PFM A;  2B2Y A;  1XTC D;  2YTX A;  1TT2 A;  1GM5 A;  4FP5 D;  1PH5 A;  4BY7 H;  3X3M A;  1PRT D;  4DR5 L;  4HMI A;  4RA8 A;  3D0F A;  1F2M A;  1N36 Q;  3FVQ A;  4DV6 Q;  1A3U A;  1D6E C;  2JXM B;  2OQ0 A;  3NQI A;  4IUT A;  4OWW B;  1YNJ D;  1ML0 D;  5JVH 3;  1FYC A;  4H13 C;  1U4M A;  1Q12 A;  2EY6 A;  4LWC A;  5M3M B;  4DR4 L;  4BBR H;  2K50 A;  2B3G A;  3WOF A;  4DV3 Q;  1S4Z A;  2FMM A;  4DV7 L;  1D1I A;  1C8C A;  4G4K A;  4P73 A;  4O42 A;  1YIJ A;  1F2L A;  2OWO A;  1E2Z A;  1I4G A;  4Q5V A;  3J7A V;  2UXD Q;  4DR1 Q;  3OTO L;  2F0W A;  2JK8 A;  2L11 A;  4Z9C B;  1BO0 A;  2Y0S B;  3MXP A;  1HZA A;  1MHW C;  1TXY A;  3A5U A;  4KY6 A;  2K32 A;  3I55 A;  3SXH A;  1VQK A;  4HR7 B;  4RHR A;  2EYO A;  3NTH A;  1O7Y A;  3J7Z C;  1WTO A;  2I46 A;  4GKJ L;  2WV6 D;  2IHE A;  4A93 B;  4LF4 Q;  4K8I A;  1KDB A;  4B3S L;  4JI3 L;  2A6H C;  1Q1B A;  2CH4 A;  1V1O A;  1HNZ Q;  4NXN Q;  4XQQ A;  4YWK A;  2H4O A;  4HCS A;  3SE0 A;  3R3O A;  3GDE A;  4A3J G;  1I3Q H;  3TBI B;  1XTD A;  3TP8 A;  1YNX A;  2B29 A;  1D5M C;  1LTI D;  1WTH A;  2CQA A;  3CME A;  3BU2 A;  1QWY A;  1Q1E A;  4AQY L;  3RZO H;  2O4X A;  1PDQ A;  2K1B A;  3MTS A;  4PZ8 A;  4OL7 A;  3KDF B;  3BS1 A;  3RN5 A;  4A3E B;  1LV9 A;  1OXU A;  1CHQ D;  4OEL B;  2AQ2 B;  2WAQ E;  5FO7 B;  4DV5 Q;  1B1Z A;  3J80 E;  5JJI A;  1WVL A;  1XNR Q;  3F8T A;  2E2J H;  3NEN A;  3P7J A;  1RJT A;  3I56 A;  1VQE A;  3KK7 A;  5I4D A;  5JJK A;  1ILQ A;  3BZC A;  3LWE A;  5CR3 A;  5JAV A;  2VQF Q;  4A3I H;  2A69 D;  2F3W A;  1VQ4 A;  3TSS A;  1HFG A;  3D6W A;  2JE6 I;  4YY3 L;  5IYD G;  1SNP A;  1A8V A;  3CPW A;  3U50 C;  2UUB Q;  4JI6 L;  4A3K H;  4B3R L;  1ICW A;  5C44 B;  1EFI D;  2I5M X;  2RCF A;  1DOK A;  3G6J B;  1SSO A;  1FNU A;  3EBE A;  1NMG A;  1GUT A;  3D3R A;  1Y8P B;  1XMQ Q;  1SFO B;  2QF7 A;  4JV5 Q;  1I6H B;  4A3B H;  3TP7 A;  1LUZ A;  3RLF A;  1OXS C;  1H9J A;  2H5X A;  4N8F A;  4ZUI A;  2XWJ B;  1L2F A;  3HEJ A;  4DR5 Q;  2RHQ B;  1X3Q A;  4DN4 M;  1O7I A;  1STG A;  5C3X A;  1V9P A;  4IO9 A;  1XJV A;  1BF4 A;  3BDC A;  2ASB A;  3NSW A;  4BBS G;  5HGT A;  2I07 B;  1Y1V G;  4PMB A;  2BE5 D;  1JR0 D;  1C4Q A;  1ET6 A;  3W1B A;  5I2Y A;  2A8V A;  4DR4 Q;  4AIM A;  1AH9 A;  3GTK H;  3I4M B;  4IJH A;  4DV7 Q;  2J4X A;  4L5S A;  1K73 C;  1YI2 A;  1Y1W B;  4O2D A;  1ASZ A;  1I50 B;  3GTP H;  1H95 A;  1HQM C;  3G48 A;  1HQR D;  1JWM D;  3OTO Q;  1VQO A;  2JA7 G;  5TSS A;  5I9P A;  1VQ8 A;  2L5T A;  2NN6 I;  2JQO A;  2PNH A;  4GKJ Q;  4OO1 G;  2N8N A;  1HUM A;  1AZQ A;  5IY0 A;  4JYA Q;  3I4N H;  4B3S Q;  4JI3 Q;  1E22 A;  1BQQ T;  4PG3 A;  3J80 c;  3M4O H;  1EU3 A;  5EQ0 A;  1K8O A;  3ZYY X;  4LUV A;  1G91 A;  1RHP A;  3EJI A;  3I7F A;  1VQG A;  5KND A;  3MXU A;  3PO2 B;  2NTT A;  3CQZ H;  2L0C A;  3M4P A;  5IIF A;  3Q23 A;  5M5W B;  1G2S A;  5BN3 A;  2JA6 H;  4IFD J;  2MPM A;  4A3M G;  1GXD C;  2EJM A;  2Z0S A;  5C3W A;  2KCT A;  4AYB E;  4POG A;  4CGY B;  5FLM G;  4AQY Q;  3QOJ A;  3A7A B;  2LS0 1;  3MEF A;  3MFG A;  2HDL A;  3K7A H;  2B2W A;  3VDY A;  2EYL A;  2XSC A;  3HOV H;  3CC2 A;  3U58 A;  2K5N A;  4JBJ A;  4Y7N H;  3HOZ G;  4KK7 A;  5F2D A;  2PQA A;  1YHB A;  1CFM A;  5IWA L;  4DAP A;  3K6O A;  4F8M A;  2ZTD A;  1NAP A;  3HOY G;  2PMZ B;  2NN6 H;  4GNX B;  4JI5 L;  3DMU A;  1EYG A;  1LLR D;  4TRD A;  2N78 A;  4BXX G;  1JOR A;  3K5N A;  1RKN A;  1WTQ A;  2WP8 J;  1R4Q B;  3S14 B;  2K5D A;  3A56 A;  3K80 C;  2LXJ A;  4LFB L;  5EPL A;  5BN4 A;  3UDX A;  3KOJ A;  2OCE A;  4YY3 Q;  1ET9 A;  3HRZ C;  4QY7 A;  3J81 L;  4RAU C;  2MQH A;  2AQ1 B;  4JI6 Q;  4B3R Q;  2EIF A;  2F0M A;  1EIH A;  1JMC A;  1CTM A;  2M9V A;  4R4C A;  4IUU A;  1EZ8 A;  1PXU A;  2UU9 L;  1HPC A;  4CJ0 B;  4RWS C;  4DXF A;  3KLW A;  1CUK A;  1XPR A;  1CI3 M;  4GLA C;  1RF2 D;  3EN2 A;  1LTG D;  1ZEQ X;  4QMG A;  3CP0 A;  2IJ0 A;  1QVG A;  5K36 H;  1QUQ B;  4CHT B;  3J80 i;  1YJ9 A;  1AP0 A;  3E0E A;  1CKO A;  2XTI A;  1CK1 A;  3W5O A;  1AE2 A;  2AWN A;  1PV4 A;  3HKZ B;  3QJY A;  5IGG A;  1Z7T A;  1SYG A;  2KJX A;  1TWG B;  3NPP A;  1GD7 A;  4LUZ A;  2QA4 A;  2F4V L;  1I6V C;  1NCV A;  2Q8T A;  3T13 A;  2JA5 G;  2KA7 A;  1B70 B;  2GA4 B;  4PV1 C;  4K5X A;  1G29 1;  1LTR D;  1JE4 A;  1L0W A;  3TRE A;  4DV2 L;  1PTO C;  4ALP A;  1XXG A;  1G6P A;  3PUZ A;  4DFA A;  1HHV A;  3KJP A;  2PW5 A;  3KFU A;  1VQB A;  2Z6B A;  5IYB G;  3Q8D A;  4XXE A;  1NE3 A;  2Z4I A;  1S5D D;  2DNC A;  1OXX K;  4XIG S;  3HOW B;  2JN4 A;  1Q3L A;  3K57 A;  4FDB A;  1EIY B;  1ENF A;  4KHV A;  2XGT A;  2IHF A;  4A3L H;  5T1I A;  4BY7 G;  5IGC A;  2ES2 A;  2RVL A;  2IX1 A;  2OF1 A;  1MSH A;  2F0H A;  3QO2 A;  3MXG A;  1M1K C;  3NQT A;  4A3E H;  1L0Y B;  5E7N A;  1S5B D;  1VQP A;  2GVB A;  4FYD A;  1VF7 A;  3MXN A;  2AMC B;  2OTL A;  1HA6 A;  2UXC L;  1TS5 A;  2R6G A;  1X3E A;  1MJE A;  2E75 C;  4BBR G;  3M3Y B;  4KMU C;  3CCM A;  1NUC A;  1X3G A;  2V4D A;  1LM0 A;  3HOX H;  4JBM A;  3GTL H;  3GQB A;  5L37 A;  3G4S A;  1VQN A;  2JEB I;  4OO1 I;  2UUC Q;  4DUY L;  4YCV A;  2WIN B;  4NMZ A;  1WYD A;  5CV5 A;  5C44 H;  3Q24 A;  5CV9 A;  4DGZ A;  4JI5 Q;  4GLX A;  1NMF A;  4CDC C;  1IYJ B;  1UE6 A;  2M00 A;  4LFB Q;  1UAP A;  4BBS H;  3CCQ A;  3VR6 A;  3S2D B;  3S24 A;  1AN8 A;  1X65 A;  2D5D A;  1PYB A;  1JB3 A;  3OW2 A;  1XPO A;  2EXD A;  1JWU D;  1X55 A;  2IL8 A;  5IYC H;  1IW7 C;  1W6J A;  3VR3 A;  3FRP B;  1PMR A;  2F4I A;  2UU9 Q;  3VR4 A;  3S1Q B;  2NVT B;  4CKC A;  4JI1 L;  1S5F D;  3M9B A;  1A6X A;  1JWS D;  3BVM A;  1N33 L;  2RKS A;  1G8Z D;  2FFK B;  5G3L F;  1VMP A;  4UPA A;  1GOZ A;  2N3S A;  4M1U B;  4WJW A;  4QUF A;  4GOP B;  5DM7 3;  1EOT A;  1N34 L;  2F0P A;  3I4M H;  3WOE A;  4YWL A;  3URY A;  4C3I B;  1A2T A;  5DLQ E;  1KIX A;  4A3G B;  1BCP C;  1TWA H;  1I50 H;  1DJR D;  1L1O B;  1BR9 A;  5CV6 A;  1G51 A;  4RH6 A;  4LF8 L;  2F4V Q;  3ULL A;  1BOS A;  5D14 A;  4QIW B;  1VQ5 A;  4DAV A;  4A3I G;  3K81 C;  4X64 L;  5C4H A;  1WTP A;  1UE1 A;  2FMC A;  1EEI D;  5GAD C;  3T53 B;  4DV2 Q;  2N88 A;  4RG1 A;  4J1M A;  4K0K L;  4A3K G;  2WKC A;  3JC6 6;  4LFC L;  3U9S A;  2RF4 A;  3V2T A;  1SYD A;  2R93 H;  1CQF A;  4H02 A;  3T4A C;  4MN3 A;  4A75 A;  3PO2 H;  1KDA A;  5C4Z A;  3D4D A;  1L0X B;  4FXK C;  5EKI A;  2DY8 A;  2JJQ A;  5T1G A;  2CQO A;  3Q6S A;  4A3B G;  5EBD A;  2Z8L A;  2RSN A;  2HUG A;  3KF8 A;  3HKS A;  1LTS D;  3RD4 A;  3QOL A;  1KNE A;  4BS9 A;  3PUX A;  1NR4 A;  4UP8 A;  1IKM A;  4C56 C;  4B3M L;  3NTK A;  4YCW A;  4AYB G;  5KGU A;  5CMD A;  5CV8 A;  4ZKC B;  3SGI A;  3N6R A;  4HMJ A;  2UXC Q;  1JOO A;  2KBN A;  4KHP L;  1B3A A;  2NVY B;  1CSP A;  2NYZ D;  3KF6 B;  3CXC A;  3MC0 B;  5C0X J;  3QR8 A;  3AFP A;  3S14 H;  5AFW A;  3SDZ A;  3STB C;  4QJF A;  4OEM B;  4LJZ C;  3CCV A;  1A3T A;  3DM3 A;  4EGV A;  5GAE C;  1EQR A;  5E4X A;  1XMO L;  2QDB A;  2ZM6 L;  4P74 A;  5ELD A;  2M2L A;  2KHS A;  1SMY C;  3P20 A;  3OIP A;  3F2D A;  1M90 C;  4DUY Q;  4ZCK A;  3T1H L;  1E0B A;  1EYD A;  4C3H B;  1IBL L;  2HHH L;  3EIV A;  3NWT A;  1XNR L;  1EL0 A;  1S72 A;  1EFW A;  1KRS A;  3A54 A;  1X3P A;  2RCN A;  1TQO A;  3I4N G;  5EPK A;  3RMH A;  3M4Q A;  2MJ8 A;  3S15 H;  4LNQ A;  1HR0 W;  5JEA J;  2DGY A;  4IN3 A;  2PZT A;  4PNY A;  2PQE A;  5EKK A;  1LTA D;  1F2Z A;  1H9M A;  2JA6 G;  3SR1 A;  2SNS A;  1OXV A;  5GAG C;  5ELN A;  1TWG H;  4N9P A;  3H94 A;  1A62 A;  1O7Z A;  4IPG A;  4JI1 Q;  4CKE A;  5ELO A;  2EXZ A;  2KQ3 A;  2L12 A;  4IOC A;  1WD1 A;  1N33 Q;  4KV6 A;  5C4X B;  5EKL A;  3S2H B;  1NNX A;  5E1F A;  2MHV A;  1HJP A;  2B2U C;  1D5X C;  1SN8 A;  1N34 Q;  4IUV A;  1F2Y A;  2XWB B;  4A3D B;  2Q2I A;  2CWP A;  5IT9 L;  2L1B A;  3NXW A;  4DV1 L;  4DAY A;  5JPN C;  3IFD A;  3W2D A;  1HRJ A;  2NN6 G;  4NDX A;  3U4V A;  4LF8 Q;  1B4O A;  4CDF C;  4ME5 A;  2R7D A;  5KIX A;  1YNN D;  4IQZ A;  4MTK A;  3PO3 B;  1V1Q A;  4XYQ A;  4B9W A;  4XDX A;  1PH9 A;  3FEW X;  5GQO A;  4X64 Q;  1YEZ A;  1IHZ A;  4JI4 L;  2R7Z B;  1EY0 A;  2ENB A;  3TZD A;  2Z4H A;  3H15 A;  2RDG A;  4K0K Q;  4B3T L;  2SNM A;  4LFC Q;  1B3Q A;  4P72 A;  1GUG A;  2A19 A;  4FXG C;  2LFN A;  2E76 C;  2CHB D;  3OHX C;  1J9O A;  4CDD C;  3K59 A;  1GUS A;  4QGU A;  5K36 G;  3S1M B;  3BYY B;  1WJJ A;  1LTT D;  1B53 A;  1V1P A;  3HZX A;  3TP5 A;  4DK0 A;  3M3Y H;  4YWM A;  3I70 A;  3UDF A;  4JI8 L;  3PUY A;  1JJ2 A;  4B3M Q;  1SEB D;  2R92 H;  1S3O A;  3NEL A;  4PMC A;  4JYA L;  3C1F A;  1JOK A;  2IX0 A;  3CU7 A;  1I5F A;  4WJ4 A;  4TSS A;  2OT2 A;  3ERS X;  4UP9 A;  1WFQ A;  3GTO B;  2K28 A;  4KHP Q;  4C2M H;  4R4Q A;  1LTL A;  1YHQ A;  3H6M A;  4FF4 A;  1MBY A;  2NWG A;  1KL9 A;  2G9H D;  1PTO D;  4A3J B;  4A93 G;  4ABN A;  5IT9 c;  1ENA A;  2CKZ B;  4ZLT F;  4XTC S;  2LY7 A;  1K83 H;  2EQS A;  1JCK B;  1SE8 A;  5LMU L;  1EEF D;  1S40 A;  4JCV E;  4XQN A;  1XMO Q;  1PVO A;  4PMW A;  2ZM6 Q;  2ZXP A;  1Q90 A;  4NB3 A;  5D65 A;  4K2K A;  3ONA B;  5M5Y B;  4X6A H;  3GTJ H;  3X3N A;  2F0G A;  3NK9 A;  1PYS B;  3T1H Q;  1SYC A;  1QNU A;  1IBL Q;  3GD7 A;  5IGF A;  1CT1 D;  3CCR A;  1JJC B;  2HHH Q;  4BY1 B;  3S1Q H;  2NVT H;  4A3L G;  4DK6 C;  4RCN A;  1A2U A;  2IT1 A;  4JG2 A;  1CZW A;  1ONL A;  4DF7 A;  3AFQ A;  4IUP A;  4WRD A;  4A3E G;  1DXM A;  1VF5 C;  1YBY A;  3OIQ A;  3E3X A;  3PUW A;  2F0V A;  2GN5 A;  3CAM A;  3I90 A;  4F7X A;  4A3G H;  2Z9H A;  1E24 A;  2JSO A;  2K4K A;  1QG7 A;  1IBM L;  2EYP A;  3J80 L;  1W2B A;  3PMF A;  1TWC H;  1STE A;  2ICI A;  2WAC A;  2ZT9 C;  2A74 C;  3HOX G;  1AZP A;  1KAA A;  3FPU B;  4L8J A;  3R93 A;  5J39 A;  2RDF A;  4DV4 L;  1R9T B;  4DV1 Q;  4IUR A;  4ZUJ A;  5C44 G;  2PNR C;  1GKH A;  1HFN A;  1GUN A;  2HCC A;  4L5R C;  3NEM A;  1PFB A;  1MJC A;  3J81 j;  1E1T A;  1QZG A;  2FIN B;  2VL6 A;  5I6Y A;  4FF1 A;  3SK6 A;  1C9O A;  1C48 A;  2P5Z X;  1PHJ A;  2B63 H;  2D0O A;  4BA1 I;  1K9M C;  2F03 A;  4J8Q A;  1UEA B;  4AH6 A;  1VS0 A;  2XVS A;  4JI4 Q;  1Y1V B;  1IW7 D;  5KYI A;  3C2P A;  1LT4 D;  1HZ9 A;  5IYC G;  4B3T Q;  1FNW A;  1SYB A;  3QWN A;  1SJH D;  4KY7 A;  3S1N H;  3J7Y W;  4JVZ A;  1T5X D;  4YHH L;  1JC7 A;  3TME A;  3M7G A;  2NVY H;  4N8X 1;  1S5E D;  3LX0 A;  2VB2 X;  1NR2 A;  1PFS A;  2QEJ C;  3I4M G;  1DCZ A;  2CWA A;  4JI8 Q;  2L15 A;  3O13 A;  5D3D A;  1BCP D;  4RCO A;  1KC8 C;  2HQE A;  2NZ1 D;  1HZC A;  2R3Z A;  1D8L A;  3D6C A;  1SXT A;  3S17 B;  1CA5 A;  5IGE A;  2HT1 A;  4FNF A;  1UWV A;  2KHI A;  1FVI A;  4DXG A;  5FK9 C;  4C3H H;  5CC4 A;  2F0J A;  3S16 H;  4OON A;  3M85 A;  1TY2 A;  1O7L A;  2JA8 H;  1XX8 A;  4NP5 A;  1PH7 A;  4DAM A;  4DR6 L;  3E9I A;  5LMU Q;  2MNA A;  3W3A A;  4A3F H;  2R93 G;  2C9O A;  3PO2 G;  1YJN A;  2O2L D;  4IUN A;  1EIG A;  5IP7 H;  4R9W A;  4WOR A;  3HOZ B;  1RIP A;  2OXP A;  4H0L C;  2UUC L;  4RGT A;  3AU7 A;  1Q81 C;  1CKN A;  4DR7 L;  2DY7 A;  3TQY A;  2AWO A;  1KLG D;  2B2V C;  3GV3 A;  5C4X H;  2NVQ B;  3S2H H;  3NE5 B;  1RL2 A;  3IAY A;  4IFD H;  1VQA A;  1I4R A;  2B2U A;  1TR5 A;  3KLR A;  4DR3 L;  4J15 A;  2VQE L;  1I4X A;  4QUC A;  4A3D H;  2K6A A;  3F2C A;  2D2C C;  4OWX B;  1VQ7 A;  4JI2 L;  1IBM Q;  1F9P A;  1QE6 A;  3HG9 A;  1PRT C;  1HH2 P;  1TS2 A;  3A74 A;  2X69 A;  4QF4 A;  4E6I A;  3S9W A;  3KJO A;  4OX9 L;  3PO3 H;  1QCB D;  2BCO A;  1STB A;  2EE1 A;  4LAA A;  3A5Z B;  3CCL A;  1BXT A;  4YIJ A;  5K5P A;  2R7Z H;  3GTM B;  5M3M H;  4NPS A;  4DV4 Q;  2EJF C;  3M4Y A;  5JOB A;  3FKI B;  1BKB A;  2EZV A;  1PH4 A;  2K52 A;  2CFM A;  5M3F B;  3RLN A;  2F52 A;  1QZH A;  1EZ6 A;  2QIL A;  2PQA B;  2E74 C;  2UUA L;  3JAM E;  1P8L A;  1U4R A;  1JOQ A;  3VA7 A;  3SVM A;  3S1M H;  4X65 L;  1SND A;  3B6Y A;  3TP6 A;  4ID6 A;  1VQM A;  4IPH A;  2YTV A;  2LMC B;  2F3V A;  1ESF A;  3GO5 A;  1VQI A;  2D9U A;  1QVF A;  1DGS A;  1KD1 C;  1QVC A;  3HKZ G;  4A93 H;  2KCN A;  3H3V H;  2K5V A;  2AHO B;  5JJL A;  3C1E A;  5M5X B;  4IUQ A;  3IKJ A;  1Q8I A;  3NTI A;  2E2H B;  2K14 A;  1I4P A;  3RZD B;  4YHH Q;  3GTO H;  2LSS A;  3DXJ C;  1X32 A;  3OOC A;  2R7F A;  2NZO A;  1ZYR C;  5HGQ A;  5H1S E;  5EGT A;  2L55 A;  4P2C B;  1B8A A;  3IRB A;  4GLV B;  3ULJ A;  4HJ9 A;  1BBX C;  3CC4 A;  1HNW L;  5BN5 A;  2F0K A;  3TDQ A;  4QB4 A;  3CKI B;  4JPB W;  4K5W A;  2K04 A;  2F3I A;  4LF6 L;  2IX3 A;  5FLX E;  1HTP A;  2MO0 A;  3CPF A;  4RGM A;  3DHQ A;  2DNE A;  1I4H A;  4FVM A;  2PO4 A;  1Y8O B;  2F0F A;  2IW3 A;  4BY1 H;  1LT5 D;  4NW2 A;  2BH2 A;  2DJF C;  1V8Q A;  2WAQ B;  4DR6 Q;  4CBV A;  1Q86 C;  4BBR B;  4LF7 L;  3KBG A;  1Q8K A;  2EYH A;  2F0S A;  2Y0S E;  3A8K E;  3H0G B;  1LT6 D;  3C3L A;  1VQJ A;  2MUY A;  4JI0 L;  2V1C C;  4DNI A;  2QGQ A;  2A69 C;  2B8G A;  4DU9 A;  2KUM A;  2Q2H A;  3KYH C;  5C5L A;  4DR7 Q;  2B39 A;  1X54 A;  1ILP A;  3MEH A;  4KKS A;  2DUD A;  3EFX D;  1STH A;  1GJX A;  2R92 G;  2TMP A;  4KD3 A;  1AEX A;  2B2T A;  1JB7 A;  2A6H D;  3MA2 B;  4EQ5 A;  4HIM A;  1SFO H;  4XT1 B;  3MFY A;  4DR3 Q;  1UE7 A;  2EDG A;  1YZ6 A;  2VQE Q;  1I6H H;  2ID0 A;  3PSI A;  1R9T H;  5D3I B;  1KLU D;  1B44 D;  5CGK A;  4M8A A;  1K28 A;  4JI2 Q;  4H44 C;  2NZH A;  1PA6 A;  1SNM A;  3MXN B;  4HCE A;  1H9S A;  1LO5 D;  2WII B;  4GZY C;  1SE2 A;  1CQV A;  2K5H A;  1I3Q B;  3HP3 A;  1HR0 L;  4OX9 Q;  2DN8 A;  4I7Z C;  3PIO 3;  2JEA I;  2X6G A;  4GN4 B;  3I8Z A;  1EWI A;  2WB1 B;  1BDO A;  5I6W A;  4DKA C;  3UDG A;  4Q0F A;  5J1Z A;  5IOD A;  1CA6 A;  3E0J A;  4DR2 L;  1VQC A;  2Z6K C;  3K0X A;  5LHY 1;  5FJ8 H;  2BE5 C;  3MZ5 A;  5NUC A;  4R4O A;  1Y1W H;  3VR5 A;  5AJ3 L;  3BG3 A;  4DNT B;  4X62 L;  3AEV A;  2UUA Q;  3ER0 A;  1IBK L;  2PZW A;  3PF4 A;  4X65 Q;  1MGS A;  4HTH A;  3DEP A;  1HXY D;  3J81 i;  1ASY A;  1E1O A;  2I0Q A;  1QOH A;  2MP1 A;  1AE3 A;  1WCM B;  4P75 A;  4A3G G;  3NBI A;  1SRO A;  1AFP A;  1A0I A;  2QCP X;  1WD0 A;  1GUW A;  1QB5 D;  1DYQ A;  3TS2 A;  2CW0 C;  2VUM B;  3NBH A;  1D2B A;  5KYL A;  3VYR A;  1G6Z A;  4IJL A;  5A2Q E;  2E2I B;  5M5W H;  3SHL A;  1CSQ A;  2ZXO A;  1QNK A;  2F0T A;  2L9H A;  1EYA A;  3BDL A;  2PZU A;  1HNW Q;  1IL2 A;  4HSP A;  3EA6 A;  3PIP 3;  2QKI C;  1TKW B;  1B9N A;  4CJ1 B;  4LF6 Q;  2OEO A;  2XIW A;  4UP7 A;  3MAQ A;  1UUP A;  3R8B A;  4X3T A;  1LAC A;  3IFT A;  3JAM i;  2PI2 E;  2RSO A;  4DUZ L;  1OTC A;  4RFB A;  3DUZ A;  2B63 G;  2F1M A;  1FNV A;  5HUR A;  3RUZ A;  2PYK A;  1E2W A;  3E5S A;  3OWE B;  4R4T A;  1PH2 A;  5A2Q L;  1MSG A;  1XWE A;  3HOU B;  2WFW A;  2B2V A;  4C3J B;  3K5O A;  2NVQ H;  1IZ6 A;  1N8R C;  5J3B A;  4LF7 Q;  3GTK B;  2F0E A;  2IY5 B;  4JOI A;  3TZU A;  3ITP A;  1MKH A;  4FF2 A;  2OQK A;  5C3E B;  4B9X A;  5ELF A;  4I65 A;  4JI0 Q;  5FO9 B;  3NP8 A;  1KNA A;  2PCF B;  2XRS D;  2E5L L;  2FXQ A;  2K03 A;  1II3 A;  3BVZ A;  3DWA A;  4GNX C;  1EY7 A;  2N49 A;  3J7A F;  3P1H A;  1GUO A;  1TS3 A;  2PPB C;  4JBW A;  1PH3 A;  5JJZ A;  4A3C H;  2BDN A;  3KF8 B;  4OHJ A;  1IKL A;  2YU9 B;  2E8G A;  3DWQ A;  3M4O B;  2FHT A;  3QG1 A;  5C0X H;  5FOB B;  1DOM A;  3FKI H;  3G7L A;  4UDU C;  3GTG B;  5ELE A;  5M3F H;  4C3H G;  2NB0 A;  4MNO A;  3F1Z A;  3A8J E;  2VNU D;  4ME3 A;  2K33 A;  1YHA A;  3A0J A;  2JA8 G;  2JA6 B;  1HR0 Q;  4DA2 A;  2BA1 A;  2G9D A;  2EJG C;  1EY4 A;  1FJG L;  4TQU S;  1XPU A;  1S5C D;  5J22 A;  4A3F G;  1SLJ A;  2AUJ D;  2VW9 A;  3GTQ B;  4HJ7 A;  1SYF A;  2EOT A;  1EQV A;  2QW7 A;  4G7Z C;  2PMZ E;  4KTA A;  1FGU A;  1SBB B;  2K7V A;  3FPP A;  4DR2 Q;  2SEB D;  3HOV B;  1GO3 E;  2MFI A;  5IP7 G;  1WI5 A;  3GP7 A;  4OIK A;  1MD2 D;  5JEA H;  2D62 A;  5AJ3 Q;  1HUN A;  5ELB A;  5IOC A;  4X62 Q;  3I73 A;  4KN7 C;  2E2H H;  3T56 B;  5C4J B;  1IBK Q;  3UI2 A;  2LKV A;  3RZD H;  5C4X G;  1EY9 A;  2I5H A;  4IFD G;  1N9W A;  4MIU A;  3OPO A;  5JPM C;  1KTK A;  1F9Q A;  3I2Z A;  3HOW H;  1Y8N B;  2VS1 A;  3DLL A;  4OGQ C;  4A3D G;  4KY5 A;  4G7O C;  4BA2 I;  2EVB A;  1R4P B;  5ISR A;  1EOV A;  3FP9 A;  1VCI A;  2CH4 W;  4HED A;  1E2V A;  3D4R A;  4JC0 A;  2R61 A;  3PO3 G;  5DAU A;  4YCU A;  5COR A;  2F0Q A;  1KHI A;  4KJN A;  4WFN 3;  2K01 A;  3NWS A;  3SK5 A;  2R7Z G;  3AMU A;  3HKZ E;  5M3M G;  2J0T D;  2NTS A;  2ICE C;  1PTO F;  5M9O A;  5C6A A;  3K0Y A;  3KDF A;  4OIJ A;  5LMN L;  2OTJ A;  5HY6 A;  4R1J A;  3H0G H;  3TRZ A;  1U0L A;  2H1E A;  1PTO B;  4DUZ Q;  4DAY B;  3AYH B;  1DD2 A;  2Y0S G;  1A15 A;  1WTX A;  2K5W A;  4UY8 C;  1TY0 A;  1XYI A;  4LW1 A;  1HNX L;  4TKO B;  1JE5 A;  1LTB D;  3VYU A;  2TSS A;  4X3S A;  4DPG A;  1EQQ A;  3PGZ A;  4IPD A;  3S2D H;  3OMG A;  3CRL C;  3EVQ A;  2E5L Q;  1PZJ D;  2K05 A;  5GAH C;  1TII D;  1ZYR D;  4HJ8 A;  1KAW A;  3BZK A;  4L5T A;  4RHS A;  3HGB A;  2HQL A;  1DOL A;  1WTW A;  3NUC A;  2ZJR A;  1A3V A;  5DEH A;  2F0U A;  4FXD A;  2ATW A;  3BJU A;  4K8J A;  3U4Z A;  1K3R A;  2YTY A;  1V1P B;  1Z6H A;  4G57 A;  1O80 A;  2BOS A;  1B7Y B;  1D5Z C;  5GRO A;  3OSO A;  1H9R A;  3LGJ A;  4WJ3 M;  2Z6K A;  5CV7 A;  4C3I H;  1VDZ A;  4BY1 G;  4ZAI A;  1TVX A;  2EYM A;  4QCL A;  1OO9 B;  1YVC A;  1BUV T;  4K6D A;  1PZI D;  1FJG Q;  2O5I C;  1TU2 B;  3OW7 A;  1EUJ A;  1SDF A;  1NSN S;  3RN2 A;  3QB3 A;  5IP9 G;  2KOL A;  2EYJ A;  2PI2 A;  2B2T C;  1EQT A;  4GOP C;  1NTG A;  2XRQ D;  4JBK A;  1WCM H;  2EY5 A;  3HOX B;  3VYT A;  3GTL B;  1RTO A;  2CCZ A;  3CRK C;  4EQN A;  2Q8R E;  1KQS A;  2VUM H;  3IL8 A;  1L1O C;  4KN4 C;  3VR2 A;  4LF5 L;  3D8G A;  4DK3 C;  4XQJ A;  3Q22 A;  2E2I H;  5BR8 L;  4FO2 A;  4QL5 A;  4NKL A;  2RA4 A;  3OWF A;  3Q0A A;  1VQD A;  4BBS B;  2Q8I B;  4JK1 C;  1J6Q A;  1RD9 D;  5I2X A;  3PIO A;  1BCP F;  2HCI A;  4DV0 L;  2A73 B;  2C5C A;  2WB1 E;  1TS4 A;  2QEX A;  3HS0 C;  4LK1 C;  2A6E C;  1PH6 A;  3L3O C;  3ND9 A;  1RCV D;  1BCP B;  2UXB L;  1F77 A;  4GN3 B;  5LMN W;  3LNN A;  2N55 A;  1RDP D;  1X6O A;  1JQY D;  1YJW A;  3SK4 A;  3HOU H;  1SE3 A;  1HA5 A;  2KCM A;  3DEO A;  4C3J H;  2SDF A;  2MGS A;  2JA7 B;  1T9H A;  5FJ8 G;  2JYO A;  5LMN Q;  1X3F A;  1M8A A;  3AB9 A;  4PQX A;  3A7L A;  4RGO S;  4IFD I;  1Y1W G;  4PZ6 A;  2KCC A;  3L9A X;  4QIW E;  5C3E H;  1TWA B;  3L2P A;  1B50 A;  4F88 A;  1SJE D;  1JT8 A;  2EYF A;  3G6E A;  4O0A A;  5CBA E;  1I4Q A;  4MTN A;  3ND8 A;  2NBF A;  3WDN A;  4GNX A;  1MIU A;  4RMF A;  2A1A A;  1HNX Q;  1Q46 A;  3S1R B;  4A3M B;  1HZB A;  2CW0 D;  1BNZ A;  1NBW A;  4X66 L;  2RDH A;  2YU9 H;  4IZ8 A;  1U4L A;  4ILW A;  3GTG H;  4A4I A;  3CCE A;  2AKW B;  2LXK A;  3PIP A;  2R93 B;  1PYW D;  1B9M A;  2AQ3 B;  4JI7 L;  4L6T B;  1SNO A;  2MO1 A;  4NXM L;  1W6K A;  4HJA A;  1C0A A;  5IGB A;  3E6Z X;  2K75 A;  2ALY B;  3SEB A;  2ZJQ A;  4V19 0;  2ZJP A;  2F0L A;  2HDM A;  3HOY B;  3V05 A;  4IPC A;  4MZ9 A;  5CBE E;  1YIT A;  2A68 C;  1EY5 A;  3GTQ H;  4KJO A;  1CKM A;  4BWG B;  1QUQ A;  2Q2U A;  4JOI C;  1ZKO A;  2K5Q A;  3J81 E;  1H9K A;  1VQL A;  4QQB X;  1DON A;  2EY1 A;  3ULP A;  1PH1 A;  4KKU A;  4CKB A;  3ICE A;  2VB3 X;  4O1N A;  3H3V I;  4EQO A;  4LF9 L;  3TN2 A;  5C4J H;  1NJI C;  3E9H A;  4TVA B;  3STB D; 
#chains in the Genus database with same CATH homology
 1KAB A;  1CHP D;  1CM9 A;  2NVX B;  5A35 A;  1ESR A;  2RQX A;  2KEE A;  1YNN C;  4XT3 B;  1SMY D;  2PW7 A;  3I4L A;  1YNJ C;  1VMC A;  3BYT B;  4L63 B;  3L7Z C;  3D4W A;  4KD4 A;  1ZXT A;  1G2T A;  4RKB A;  3ERQ A;  2EY2 A;  1OXT A;  2O5J C;  1U9R A;  2F0N A;  1TWF B;  2EPB A;  3QIA A;  3S15 B;  2NUC A;  1LAB A;  5C0X G;  3K5M A;  1FGB D;  4KKT A;  1M4V A;  1PLF A;  3NHH A;  2BA0 A;  2JA5 B;  5KNB A;  4HAE A;  5I9O A;  1PTO H;  3BVG A;  3V96 A;  1TWH B;  2CVR A;  5ELC A;  2RBM A;  5LL6 S;  2IPK D;  3KBX A;  4G7H C;  1B2T A;  3JAM L;  1PZK D;  5DM6 3;  3T51 B;  1K8M A;  4ZYS A;  4MHE A;  5JEA G;  2B2Y C;  3H3V C;  1RTN A;  1EY8 A;  4BY7 B;  4CJ2 C;  1GHK A;  1HCZ A;  3T16 A;  3DWP A;  2Z1C A;  1WTV A;  3A8I E;  4UAI A;  2XN9 C;  4FF3 A;  1EWH A;  1IYV A;  4F87 A;  3BDO A;  4U67 3;  2XNA C;  3PV0 A;  1ENC A;  4X3U A;  5DNF A;  5FLX L;  1ROD A;  3F2U A;  1SNQ A;  5EJW A;  1QJO A;  1F9R A;  3CHB D;  2L4N A;  3MHB A;  1EU4 A;  4C1N I;  2YYZ A;  4KI0 A;  3I91 A;  2VXW A;  2R92 B;  4LMQ D;  5EBC A;  5IGD A;  3MWY W;  4IAL A;  3LWU A;  4RGN A;  1Y69 U;  3H09 A;  5FKA C;  2X6L A;  3H91 A;  4H7B A;  5KEE A;  4C2M B;  3M7N A;  3N52 A;  1IL8 A;  5C5M A;  4ODG A;  2F0O A;  1K83 B;  3RZO B;  4R8N A;  3GTJ B;  3A55 A;  1PFN A;  3GV6 A;  3KUP A;  4X3K A;  2E2J B;  1HTL D;  1SNC A;  1JIC A;  1QIL A;  4KHZ A;  1KDC A;  3OMC A;  4B08 A;  3BZD B;  1DM0 B;  1WTR A;  4C3I G;  3MVV A;  4A3I B;  4K14 A;  1O78 A;  2E2D C;  4HSV A;  3K58 A;  4OO1 H;  4RKL A;  1IYU A;  2WKD A;  1AW7 A;  4A3K B;  3ERO A;  1H9S B;  1FR3 A;  4S3S A;  2F0I A;  1TWC B;  4ZQ3 A;  4K5V A;  5G3L D;  4XYO A;  4A3B B;  3FMC A;  4ULL A;  3R2T A;  3KLS X;  5FO8 B;  3EQL C;  3VYS A;  1SAP A;  4HN7 A;  5C0X I;  4DK1 A;  1STA A;  2FJ2 A;  3VA5 A;  3SK8 A;  1EWC A;  4AYB B;  2B63 B;  1CZG A;  3U9O A;  2KEC A;  5JVG 3;  4EQP A;  2B8F A;  2A6E D;  3I3C A;  3P75 A;  1F9S A;  5E3F A;  1UNS A;  5CV4 A;  5E4W C;  4V0B A;  4ZKB B;  3S1N B;  5COY A;  1V43 A;  3GTP B;  3DM1 A;  4C1N K;  4C3J G;  3FDT A;  2IWH A;  3K5L A;  1SE4 A;  2AUK A;  4R8I A;  4U68 A;  2F0D A;  1GHJ A;  1STY A;  5CYU A;  5KRU A;  4ZRZ A;  2KED A;  1FD7 D;  3C46 A;  3I4N B;  2KVM A;  1D1K A;  3R2I A;  5LL6 X;  4J6H A;  1J8I A;  3CQZ B;  2JP1 A;  1EYC A;  3S16 B;  1LT3 D;  2J7Z A;  2SOB A;  3PUV A;  1DZ1 A;  2JA8 B;  5EPJ A;  2BDO A;  1STN A;  1U4P A;  4N9T A;  1EY6 A;  3K7A B;  4A3F B;  2B2W C;  5IT9 E;  1Z47 A;  1MI2 A;  4K6L A;  4EVO A;  2ZXR A;  4Y7N B;  4DNR B;  1PRT F;  3D31 A;  2A68 D;  3I72 A;  4ZK9 B;  1PRT B;  1T5E A;  5KNC A;  2A5H A;  3KLS A;  1SYE A;  4K2L A;  1PFM A;  2B2Y A;  1XTC D;  1TT2 A;  4FP5 D;  3X3M A;  1PRT D;  4HMI A;  4RA8 A;  1F2M A;  3FVQ A;  1A3U A;  1D6E C;  2JXM B;  3NQI A;  4IUT A;  1YNJ D;  1ML0 D;  5JVH 3;  1FYC A;  4H13 C;  1U4M A;  1Q12 A;  2EY6 A;  5M3M B;  3WOF A;  1S4Z A;  2FMM A;  1D1I A;  1C8C A;  4G4K A;  4O42 A;  1F2L A;  1E2Z A;  1I4G A;  4Q5V A;  3J7A V;  2F0W A;  2L11 A;  4Z9C B;  1BO0 A;  2Y0S B;  3MXP A;  4KY6 A;  2K32 A;  3SXH A;  4HR7 B;  4RHR A;  2EYO A;  3NTH A;  1O7Y A;  1WTO A;  2I46 A;  2WV6 D;  4A93 B;  4K8I A;  1KDB A;  2A6H C;  1Q1B A;  1V1O A;  4XQQ A;  2H4O A;  4HCS A;  3SE0 A;  3R3O A;  3TBI B;  3TP8 A;  1D5M C;  1LTI D;  2CQA A;  1QWY A;  1Q1E A;  2O4X A;  1PDQ A;  2K1B A;  3MTS A;  4OL7 A;  3BS1 A;  4A3E B;  1LV9 A;  1OXU A;  1CHQ D;  2AQ2 B;  5FO7 B;  1B1Z A;  3J80 E;  1WVL A;  3P7J A;  1RJT A;  3KK7 A;  5I4D A;  1ILQ A;  3LWE A;  5CR3 A;  5JAV A;  2A69 D;  2F3W A;  3TSS A;  1HFG A;  3D6W A;  2JE6 I;  1SNP A;  1ICW A;  5C44 B;  1EFI D;  1DOK A;  3G6J B;  1SSO A;  1FNU A;  1GUT A;  3D3R A;  1Y8P B;  1SFO B;  2QF7 A;  1I6H B;  3TP7 A;  3RLF A;  1OXS C;  1H9J A;  4ZUI A;  2XWJ B;  3HEJ A;  1X3Q A;  4DN4 M;  1STG A;  5C3X A;  1BF4 A;  3BDC A;  3NSW A;  5HGT A;  2I07 B;  4PMB A;  2BE5 D;  1JR0 D;  1C4Q A;  1ET6 A;  5I2Y A;  3I4M B;  2J4X A;  1Y1W B;  1I50 B;  1HQM C;  1HQR D;  1JWM D;  5TSS A;  5I9P A;  2L5T A;  2NN6 I;  4OO1 G;  1HUM A;  1AZQ A;  1BQQ T;  1EU3 A;  5EQ0 A;  1K8O A;  3ZYY X;  1G91 A;  1RHP A;  3EJI A;  5KND A;  3MXU A;  3PO2 B;  2NTT A;  2L0C A;  5IIF A;  3Q23 A;  5M5W B;  1G2S A;  5BN3 A;  4IFD J;  2MPM A;  1GXD C;  2EJM A;  5C3W A;  4CGY B;  3QOJ A;  3A7A B;  2LS0 1;  3MFG A;  2HDL A;  2B2W A;  2EYL A;  2XSC A;  4KK7 A;  5F2D A;  1CFM A;  4DAP A;  3K6O A;  4F8M A;  1NAP A;  2PMZ B;  2NN6 H;  3DMU A;  1LLR D;  4TRD A;  1JOR A;  3K5N A;  1RKN A;  1WTQ A;  2WP8 J;  1R4Q B;  3S14 B;  2K5D A;  3A56 A;  5EPL A;  5BN4 A;  1ET9 A;  3HRZ C;  3J81 L;  4RAU C;  2AQ1 B;  2F0M A;  1EIH A;  1CTM A;  2M9V A;  4IUU A;  1EZ8 A;  1PXU A;  1HPC A;  4CJ0 B;  4RWS C;  4DXF A;  1CI3 M;  1RF2 D;  1LTG D;  1ZEQ X;  4QMG A;  5K36 H;  2IJ0 A;  4CHT B;  1AP0 A;  1CK1 A;  2AWN A;  3HKZ B;  3QJY A;  5IGG A;  1Z7T A;  1SYG A;  2KJX A;  1TWG B;  3NPP A;  1I6V C;  1NCV A;  2Q8T A;  3T13 A;  2KA7 A;  2GA4 B;  4PV1 C;  4K5X A;  1G29 1;  1LTR D;  1JE4 A;  1PTO C;  1XXG A;  3PUZ A;  4DFA A;  1HHV A;  2PW5 A;  4XXE A;  2Z4I A;  1S5D D;  2DNC A;  1OXX K;  4XIG S;  3HOW B;  1Q3L A;  3K57 A;  1ENF A;  4KHV A;  5T1I A;  5IGC A;  2RVL A;  2IX1 A;  2OF1 A;  1MSH A;  2F0H A;  3QO2 A;  3MXG A;  3NQT A;  1L0Y B;  1S5B D;  4FYD A;  1VF7 A;  3MXN A;  1HA6 A;  1TS5 A;  2R6G A;  2E75 C;  3M3Y B;  4KMU C;  1NUC A;  2V4D A;  3GQB A;  2JEB I;  4OO1 I;  2WIN B;  4NMZ A;  3Q24 A;  5CV5 A;  5CV9 A;  4DGZ A;  2M00 A;  1UAP A;  3VR6 A;  3S2D B;  1AN8 A;  2D5D A;  1JB3 A;  1JWU D;  2IL8 A;  1IW7 C;  1W6J A;  3VR3 A;  3FRP B;  1PMR A;  2F4I A;  3S1Q B;  3VR4 A;  2NVT B;  4CKC A;  1S5F D;  1A6X A;  1JWS D;  3BVM A;  2RKS A;  1G8Z D;  2FFK B;  5G3L F;  1VMP A;  1GOZ A;  4M1U B;  4WJW A;  4QUF A;  5DM7 3;  1EOT A;  2F0P A;  3WOE A;  3URY A;  4C3I B;  1A2T A;  4A3G B;  1BCP C;  1DJR D;  1BR9 A;  5CV6 A;  4RH6 A;  1BOS A;  5D14 A;  4QIW B;  4DAV A;  1WTP A;  5C4H A;  2FMC A;  1EEI D;  3T53 B;  2N88 A;  4J1M A;  2WKC A;  3U9S A;  3V2T A;  1SYD A;  1CQF A;  3T4A C;  4MN3 A;  1KDA A;  5C4Z A;  3D4D A;  1L0X B;  4FXK C;  5EKI A;  2DY8 A;  5T1G A;  3Q6S A;  5EBD A;  2Z8L A;  2RSN A;  2HUG A;  3RD4 A;  3KF8 A;  1LTS D;  1KNE A;  3QOL A;  4BS9 A;  3PUX A;  1NR4 A;  1IKM A;  4C56 C;  3NTK A;  5KGU A;  5CMD A;  5CV8 A;  4ZKC B;  3N6R A;  4HMJ A;  1JOO A;  1B3A A;  2NVY B;  2NYZ D;  3MC0 B;  5C0X J;  5AFW A;  3SDZ A;  4LJZ C;  1A3T A;  4EGV A;  5E4X A;  2QDB A;  5ELD A;  2M2L A;  2KHS A;  1SMY C;  3P20 A;  3OIP A;  1E0B A;  1EYD A;  4C3H B;  1EL0 A;  3NWT A;  3A54 A;  1X3P A;  1TQO A;  5EPK A;  3RMH A;  2MJ8 A;  5JEA J;  4IN3 A;  2PZT A;  4PNY A;  2PQE A;  5EKK A;  1LTA D;  1F2Z A;  1H9M A;  3SR1 A;  2SNS A;  1OXV A;  4N9P A;  3H94 A;  1O7Z A;  4CKE A;  2EXZ A;  2KQ3 A;  2L12 A;  1WD1 A;  4KV6 A;  5C4X B;  5EKL A;  3S2H B;  5E1F A;  2MHV A;  2B2U C;  1D5X C;  4IUV A;  1F2Y A;  2XWB B;  4A3D B;  5IT9 L;  2L1B A;  3NXW A;  4DAY A;  5JPN C;  3IFD A;  3W2D A;  1HRJ A;  2NN6 G;  4NDX A;  1B4O A;  4ME5 A;  5KIX A;  1YNN D;  4IQZ A;  3PO3 B;  4XYQ A;  4B9W A;  4XDX A;  3FEW X;  1IHZ A;  2R7Z B;  1EY0 A;  2ENB A;  3TZD A;  2Z4H A;  2RDG A;  2SNM A;  1GUG A;  4FXG C;  2LFN A;  2E76 C;  2CHB D;  3OHX C;  1J9O A;  3K59 A;  1GUS A;  5K36 G;  3S1M B;  3BYY B;  1LTT D;  1B53 A;  1V1P A;  3HZX A;  3TP5 A;  4DK0 A;  3I70 A;  3PUY A;  1SEB D;  4PMC A;  3C1F A;  1JOK A;  2IX0 A;  3CU7 A;  4TSS A;  2OT2 A;  3GTO B;  2K28 A;  3H6M A;  4FF4 A;  1MBY A;  2NWG A;  2G9H D;  1PTO D;  4A3J B;  4ABN A;  1ENA A;  4ZLT F;  4XTC S;  2LY7 A;  1JCK B;  1EEF D;  4XQN A;  4PMW A;  2ZXP A;  1Q90 A;  5D65 A;  4K2K A;  3ONA B;  5M5Y B;  3X3N A;  2F0G A;  3NK9 A;  1SYC A;  1QNU A;  3GD7 A;  5IGF A;  1CT1 D;  4BY1 B;  4RCN A;  1A2U A;  2IT1 A;  1CZW A;  1ONL A;  4DF7 A;  4IUP A;  4WRD A;  1DXM A;  1VF5 C;  3OIQ A;  3PUW A;  2F0V A;  3I90 A;  4F7X A;  2JSO A;  1QG7 A;  2EYP A;  3J80 L;  3PMF A;  1STE A;  2ICI A;  2WAC A;  2ZT9 C;  2A74 C;  1AZP A;  1KAA A;  3FPU B;  4L8J A;  3R93 A;  5J39 A;  2RDF A;  1R9T B;  4IUR A;  4ZUJ A;  2PNR C;  1HFN A;  1GUN A;  2HCC A;  1PFB A;  2FIN B;  5I6Y A;  4FF1 A;  3SK6 A;  1C48 A;  4BA1 I;  2F03 A;  4J8Q A;  1UEA B;  2XVS A;  1Y1V B;  1IW7 D;  5KYI A;  3C2P A;  1LT4 D;  1FNW A;  1SYB A;  3QWN A;  1SJH D;  4KY7 A;  3J7Y W;  1T5X D;  1JC7 A;  3TME A;  3M7G A;  1S5E D;  3LX0 A;  2VB2 X;  1NR2 A;  2QEJ C;  1DCZ A;  3O13 A;  5D3D A;  1BCP D;  4RCO A;  2HQE A;  2NZ1 D;  2R3Z A;  3D6C A;  1SXT A;  3S17 B;  1CA5 A;  5IGE A;  4FNF A;  4DXG A;  5FK9 C;  5CC4 A;  2F0J A;  3M85 A;  1TY2 A;  1O7L A;  1XX8 A;  4NP5 A;  3W3A A;  2C9O A;  2O2L D;  4IUN A;  1EIG A;  4R9W A;  4WOR A;  3HOZ B;  2OXP A;  4H0L C;  4RGT A;  3AU7 A;  2DY7 A;  2AWO A;  1KLG D;  2B2V C;  3GV3 A;  2NVQ B;  3NE5 B;  3IAY A;  4IFD H;  1I4R A;  2B2U A;  1TR5 A;  3KLR A;  1I4X A;  4QUC A;  2K6A A;  2D2C C;  1F9P A;  1QE6 A;  3HG9 A;  1PRT C;  1TS2 A;  4QF4 A;  2X69 A;  3S9W A;  4E6I A;  1QCB D;  2BCO A;  1STB A;  2EE1 A;  4LAA A;  1BXT A;  4YIJ A;  5K5P A;  3GTM B;  2EJF C;  3M4Y A;  5JOB A;  3FKI B;  2EZV A;  5M3F B;  1EZ6 A;  2QIL A;  2E74 C;  3JAM E;  1U4R A;  1JOQ A;  3VA7 A;  3SVM A;  1SND A;  3TP6 A;  4ID6 A;  2LMC B;  2F3V A;  1ESF A;  3GO5 A;  2D9U A;  2KCN A;  3C1E A;  5M5X B;  4IUQ A;  3IKJ A;  1Q8I A;  3NTI A;  2E2H B;  1I4P A;  3RZD B;  3DXJ C;  1X32 A;  3OOC A;  1ZYR C;  5EGT A;  2L55 A;  4P2C B;  1BBX C;  5BN5 A;  2F0K A;  3TDQ A;  4QB4 A;  3CKI B;  4K5W A;  2K04 A;  2IX3 A;  5FLX E;  1HTP A;  4RGM A;  3DHQ A;  2DNE A;  1I4H A;  4FVM A;  2PO4 A;  1Y8O B;  2F0F A;  2IW3 A;  1LT5 D;  4NW2 A;  1V8Q A;  2WAQ B;  4CBV A;  4BBR B;  3KBG A;  2F0S A;  2EYH A;  3A8K E;  3H0G B;  1LT6 D;  3C3L A;  2MUY A;  2A69 C;  4DU9 A;  2B8G A;  2KUM A;  5C5L A;  2B39 A;  1ILP A;  3MEH A;  4KKS A;  3EFX D;  1STH A;  1GJX A;  2TMP A;  4KD3 A;  1AEX A;  2B2T A;  2A6H D;  3MA2 B;  4XT1 B;  3MFY A;  2EDG A;  2ID0 A;  5D3I B;  1KLU D;  1B44 D;  5CGK A;  4M8A A;  4H44 C;  1SNM A;  4HCE A;  1H9S A;  1LO5 D;  2WII B;  4GZY C;  1SE2 A;  1CQV A;  3HP3 A;  1I3Q B;  2DN8 A;  4I7Z C;  3PIO 3;  2JEA I;  2X6G A;  3I8Z A;  2WB1 B;  1BDO A;  5I6W A;  4Q0F A;  5J1Z A;  5IOD A;  1CA6 A;  3E0J A;  5LHY 1;  2BE5 C;  3MZ5 A;  5NUC A;  3VR5 A;  3BG3 A;  4DNT B;  2PZW A;  1MGS A;  4HTH A;  3DEP A;  1HXY D;  1QOH A;  2MP1 A;  1WCM B;  3NBI A;  1AFP A;  2QCP X;  1WD0 A;  1GUW A;  1QB5 D;  1DYQ A;  2CW0 C;  2VUM B;  3NBH A;  1D2B A;  5KYL A;  3VYR A;  1G6Z A;  5A2Q E;  2E2I B;  3SHL A;  2ZXO A;  1QNK A;  2F0T A;  2L9H A;  1EYA A;  3BDL A;  2PZU A;  4HSP A;  3EA6 A;  3PIP 3;  2QKI C;  1TKW B;  1B9N A;  4CJ1 B;  2OEO A;  2XIW A;  3MAQ A;  1UUP A;  3R8B A;  4X3T A;  1LAC A;  3IFT A;  2RSO A;  4RFB A;  3DUZ A;  2F1M A;  1FNV A;  5HUR A;  3RUZ A;  2PYK A;  1E2W A;  3E5S A;  3OWE B;  5A2Q L;  1MSG A;  1XWE A;  3HOU B;  2B2V A;  4C3J B;  3K5O A;  3GTK B;  2F0E A;  3TZU A;  3ITP A;  4FF2 A;  5C3E B;  4B9X A;  5ELF A;  4I65 A;  5FO9 B;  3NP8 A;  1KNA A;  2PCF B;  2XRS D;  2K03 A;  1II3 A;  3BVZ A;  3DWA A;  1EY7 A;  3J7A F;  3P1H A;  1GUO A;  1TS3 A;  2PPB C;  4JBW A;  5JJZ A;  2BDN A;  4OHJ A;  1IKL A;  2YU9 B;  3DWQ A;  3M4O B;  2FHT A;  3QG1 A;  5C0X H;  5FOB B;  1DOM A;  3G7L A;  4UDU C;  3GTG B;  5ELE A;  4C3H G;  2NB0 A;  3A8J E;  2VNU D;  2K33 A;  2JA6 B;  4DA2 A;  2BA1 A;  2G9D A;  2EJG C;  1EY4 A;  4TQU S;  1S5C D;  5J22 A;  2AUJ D;  3GTQ B;  1SYF A;  2EOT A;  1EQV A;  4G7Z C;  4KTA A;  2K7V A;  1SBB B;  3FPP A;  2SEB D;  3HOV B;  3GP7 A;  4OIK A;  1MD2 D;  5JEA H;  2D62 A;  1HUN A;  5ELB A;  5IOC A;  3I73 A;  4KN7 C;  3T56 B;  5C4J B;  3UI2 A;  2LKV A;  1EY9 A;  4IFD G;  4MIU A;  3OPO A;  5JPM C;  1KTK A;  1F9Q A;  1Y8N B;  4OGQ C;  4KY5 A;  4G7O C;  4BA2 I;  2EVB A;  1R4P B;  5ISR A;  1VCI A;  4HED A;  1E2V A;  3D4R A;  2R61 A;  5DAU A;  5COR A;  2F0Q A;  4KJN A;  4WFN 3;  2K01 A;  3NWS A;  3SK5 A;  3AMU A;  2J0T D;  2NTS A;  2ICE C;  1PTO F;  5M9O A;  5C6A A;  3K0Y A;  4OIJ A;  2H1E A;  1PTO B;  1DD2 A;  1A15 A;  1WTX A;  2K5W A;  1TY0 A;  1XYI A;  4TKO B;  1LTB D;  3VYU A;  2TSS A;  4X3S A;  3OMG A;  3CRL C;  3EVQ A;  1PZJ D;  2K05 A;  1TII D;  1ZYR D;  4RHS A;  3HGB A;  1DOL A;  1WTW A;  3NUC A;  1A3V A;  5DEH A;  2F0U A;  4FXD A;  4K8J A;  1V1P B;  1Z6H A;  1O80 A;  2BOS A;  4G57 A;  1D5Z C;  3OSO A;  1H9R A;  5CV7 A;  1VDZ A;  4ZAI A;  1TVX A;  2EYM A;  4QCL A;  1OO9 B;  1BUV T;  4K6D A;  1PZI D;  2O5I C;  1TU2 B;  3OW7 A;  1SDF A;  1NSN S;  3QB3 A;  2KOL A;  2EYJ A;  2B2T C;  1EQT A;  2XRQ D;  2EY5 A;  3HOX B;  3VYT A;  3GTL B;  1RTO A;  3CRK C;  4EQN A;  2Q8R E;  3IL8 A;  4KN4 C;  3VR2 A;  3D8G A;  4XQJ A;  3Q22 A;  4FO2 A;  4NKL A;  2RA4 A;  3OWF A;  3Q0A A;  4BBS B;  2Q8I B;  4JK1 C;  1RD9 D;  5I2X A;  1BCP F;  2HCI A;  2A73 B;  2C5C A;  1TS4 A;  3HS0 C;  4LK1 C;  2A6E C;  3L3O C;  3ND9 A;  1RCV D;  1BCP B;  1F77 A;  3LNN A;  2N55 A;  1RDP D;  1JQY D;  3SK4 A;  1SE3 A;  1HA5 A;  3DEO A;  2JA7 B;  2SDF A;  2MGS A;  2JYO A;  1M8A A;  3AB9 A;  4PQX A;  3A7L A;  4RGO S;  4IFD I;  2KCC A;  3L9A X;  1TWA B;  1B50 A;  4F88 A;  1SJE D;  2EYF A;  5CBA E;  1I4Q A;  3ND8 A;  2NBF A;  3WDN A;  3S1R B;  4A3M B;  2CW0 D;  1BNZ A;  2RDH A;  4IZ8 A;  1U4L A;  4ILW A;  2R93 B;  1PYW D;  1B9M A;  2AQ3 B;  4L6T B;  1SNO A;  1W6K A;  5IGB A;  3E6Z X;  3SEB A;  4V19 0;  2F0L A;  2HDM A;  3HOY B;  3V05 A;  5CBE E;  2A68 C;  1EY5 A;  4KJO A;  4BWG B;  3J81 E;  1ZKO A;  2K5Q A;  1H9K A;  1DON A;  2EY1 A;  4KKU A;  4CKB A;  2VB3 X;  4O1N A;  4EQO A;  3TN2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...