1TWAH

Rna polymerase ii complexed with atp
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase II largest subunit
publication title Structural basis of transcription: nucleotide selection by rotation in the RNA polymerase II active center.
pubmed doi rcsb
total genus 22
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2004-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1twaH00
1I50H 2L15A 2E2IH 3CCMA 4GOPA 4A3MG 1HZBA 4DR4Q 3UDGA 2VS1A 3EN2A 1X54A 4NPSA 5GAEC 2A8VA 2B63G 2CCZA 1EQQA 4JI2Q 3AEVA 5JEAG 1MJCA 5K36G 1XMOL 2JK8A 2K14A 3TS2A 1VQIA 4IO9A 5DLQE 1OXUA 4R4OA 3UE0A 4DR2Q 4AH6A 2NVTH 4DR6L 3BZKA 1PV4A 4PZ7A 1Q1BA 2A1AA 3EBEA 3RLOA 4X65Q 1XNRL 2R7ZH 4DAMA 3A5ZB 1X55A 3KDFB 1TWGH 2JE6I 2NVXH 2VNUD 4KHZA 3JAMc 4BY1H 3F2BA 1VQEA 1KRSA 4A3BG 4LFBQ 1I6HH 1PYBA 4P72A 3ULJA 5HGQA 4JI4Q 4A3FH 4QL5A 1FL0A 3MXNB 3ZJYC 4DV1Q 1YJ9A 3PO2H 1XPUA 4DV6L 1VQKA 2D0PA 1N36L 4L5QA 1YITA 1N8RC 3PUXA 1H95A 1HNWL 3NBHB 2RHQB 1SLJA 3UDFA 2UXBL 2VQEL 4KHPQ 3ER0A 1K73C 1W3SA 5M5WH 5IYDG 2UUBL 2QEXA 4A3EG 1PH2A 2R7FA 1EYGA 5LMNQ 4DV7Q 4X62Q 5AJ3L 1N33L 4YHHQ 4A3IH 4LFAL 1VQ4A 4R4QA 2N8NA 1J5EQ 2BH2A 3KF6A 3H3VI 4JI8L 4UP8A 4X66L 4DKAC 3PIPA 1PH1A 1B8AA 2IX1A 1M1KC 2JA7G 2UU9Q 1X6OA 3LGJA 3J81i 1EWIA 4YCUA 1X3FA 1M90C 4LF4L 1NTGA 4IJLA 4IOAA 1WCMH 2V1CC 2Y0SE 4UP9A 2ES2A 1CKMA 3RNUA 1HNXL 1QZHA 3FKIH 1IBKQ 3HOWG 1SRUA 3M85A 2K5VA 2YTXA 4O0AA 4PMWA 1YBYA 5C3EG 2R92H 1VQHA 4EQ5A 3RLNA 1PYSB 3D31A 4RG1A 1UE7A 4HJ8A 4DR7L 2IT1A 3KOJA 3HOXH 1L1OA 2Y0SG 3S1MH 2XTIA 4DK3C 4IPHA 4GKJQ 4BXXG 3EIVA 1PHJA 3UE1A 2JA5G 2K75A 1VQOA 3I4OA 1BBWA 3CPFA 1C7YA 1QUQB 4YWKA 2QGQA 4A93H 1CKNB 3U50C 4K0KQ 1XMOQ 1K9MC 3G4SA 4TVAB 1YHQA 2BA1A 2LXJA 1I94L 4GLVB 4A3GH 1EQRA 3HKZE 5ELOA 4BBSH 1A62A 1VCIA 2KCMA 3KJOA 4DR6Q 1LM0A 1XNRQ 3L7ZC 2Z6KC 3CPWA 3I7FA 4YWLA 3OW2A 4LF5L 3I4NG 4BY7H 3AYHB 2VW9A 4A3JG 4JI7L 3CF5A 4A3DH 1UE5A 2NZHA 1RL2A 3I4MH 4DV4L 3PUYA 1T9HA 1VQCA 4KI0A 1VQLA 1GO3E 2PQAB 3E9IA 3HKZG 4QJFA 3DLLA 4DV6Q 1N36Q 4IPCA 2DGYA 4A3KH 4LF6L 1S3OA 1HNWQ 3CXCA 1IZ6A 4GOPC 4AQYL 1HNZL 1D7QA 4A76A 5C4JH 2VQEQ 3I56A 1YNXA 4MZ9A 2ATWA 5LMUL 2PI2E 4P73A 1E3PA 2MNAA 1P16A 5AJ3Q 1MJEA 4LFAQ 1N33Q 1N32Q 1IYJB 4KLKA 5FJ8H 1HR0L 5E7NA 4XTCS 4JI8Q 4X66Q 4IOCA 1PH8A 4DV0L 1YHAA 1A8VA 3PUZA 4DUYL 1IXRA 4C2MH 3K7UC 3E0EA 5LMNW 2B63H 5C4XG 1OXXK 2JJQA 4LF4Q 1VQGA 4OX9L 3G6EA 1HZCA 3UDXA 4LF9L 3L0OA 1RIPA 1A0IA 1ASYA 2K5NA 1HNXQ 4LF7L 4YWMA 5GQOA 4BBRH 4LF8L 1JT8A 1Q1EA 1QVFA 4R4TA 1N9WA 2HHHL 4MNOA 1EUJA 2JEBI 4JI6L 3NENA 1C0AA 2C35B 4DR7Q 2PMZE 2VZAA 1B70B 1VQ5A 3PV0A 2CWAA 1VS0A 3ULPA 5C44G 2AWOA 2RCNA 1G291 2B3GA 2KCTA 4JBJA 4A3CG 5IWAL 3CAMA 4DR5L 2Q2HA 3S1NH 2LSSA 1E7ZA 3K0XA 1IL2A 2MQHA 4BA2I 2K50A 3KF6B 1VQNA 1TXYA 4HIOA 4JBWA 4B3RL 3S1QH 2ZTCA 4A3EH 3HOVG 1J6QA 1LUZA 4IFDJ 1PH7A 3AFPA 1I94Q 1YI2A 4IFDI 4UPAA 1HZAA 1SN8A 4DV5L 2JA7H 1E1OA 4LF5Q 1VQMA 1TWHH 2YTYA 4P74A 1YHBA 4JI7Q 3NEMA 4LNQA 1KD1C 1FGUA 2YV5A 2BH8A 4NXNL 4C3IH 4DV4Q 3W1GA 1IBML 5FLMG 1VQDA 1L1OC 1UEBA 4JOIA 4GKKL 3K81C 1BBUA 2ALYB 4DPGA 1L1OB 2D0OA 3ULLA 4A4IA 1PH9A 3AFQA 5IYCG 2ZM6L 1Y1VH 4LUVA 4LF6Q 4L5RC 1PA6A 4Y7NH 3U58A 4AQYQ 1HNZQ 2HIVA 1EIFA 3HOYG 1MKHA 1V43A 1KXLA 3GTOH 2IY5B 2I0QA 2AMCB 2R7DA 5IP9H 5LMUQ 2I5HA 4DNIA 4IFDG 2N49A 4LFCL 5BR8L 3WWVA 4JBMA 3CQZH 1S40A 2F52A 2WFWA 1HR0Q 2JA5H 5J3BA 4BXXH 1X9NA 2MO1A 4O2DA 1MIUA 1XPRA 4DUYQ 3CC7A 4JV5Q 2UXCQ 3J80i 2IHFA 4IJHA 3CC4A 2CQOA 3U4ZA 4DK6C 3CCVA 2R93G 4IPDA 4LF9Q 4UP7A 1I5FA 4HJ5A 4GNXA 3S2HH 4NXML 3E9HA 3MEFA 3HOZH 3S16H 1WYDA 5M3MH 1V9PA 4LF7Q 4YY3Q 1IBLL 4LF8Q 3H15A 2UUCL 2HHHQ 3J81c 1V1QA 4A3JH 4JCVE 1GM5A 4JI6Q 1D8LA 1AH9A 3KDFA 3I55A 4A3FG 5GAHC 1Y14B 2DUDA 2YYZA 3F2DA 3PO2G 5IT9c 4X64L 2WB1E 1X65A 4YCVA 3M3YH 1X3EA 5IWAQ 5M5YH 1EIYB 5C0XI 4DR5Q 4X6AH 2UUAL 3F8TA 1Z47A 4JC0A 4XIGS 1SMXA 2OWOA 2JA6H 1FJGL 2I5LX 4BA1I 3S14H 4R1JA 3BZCA 3GDEA 2K5HA 4B3RQ 3OTOL 2KENA 4A3IG 2NVQH 4GLAC 3CCEA 2VUMG 3RZOH 2YTVA 2WB1G 1C9OA 1EOVA 4PG3A 2WP8J 4DV5Q 1KQSA 1HJPA 3AQQA 3G48A 1Q86C 1E24A 4R4IA 1LYLA 4L5TA 3NELA 1NY4A 2AWNA 2HQLA 4DR2L 4Y52H 2N78A 4NXNQ 2IHEA 1UWVA 5C0XG 2VY3A 3M9BA 4GN4B 3STBD 3RZDH 1IBMQ 4B3SL 2JA8G 2AHOB 4X65L 4DV2L 4GKKQ 4A3LG 3PSIA 4RMFA 2R92G 3A5UA 3RN2A 2UUBQ 3UDIA 4GOPB 2ZM6Q 3A74A 2ZJPA 1N34L 4OXPA 5IYBG 1KC8C 2EXDA 3H0GG 4J15A 3CP0A 5C44H 1NE3A 1WFQA 1GD7A 2CFMA 4IPGA 5IE8A 4A3MH 1PH3A 4HIDA 3JC66 5BR8Q 4LFCQ 4GN5A 1A63A 2F4VL 3M7NA 2NVYH 2VL6A 3S1RH 1L2FA 1OXVA 2B29A 3T1YL 2E8GA 2NN6I 3CD6A 4A93G 2RF4A 2ZJRA 5JJKA 3KJPA 3S15H 2OTJA 4PZ6A 4QQBX 1TWAH 1VQ7A 2ZTDA 1K3RA 1QUQA 1L0WA 1HR0W 1U0LA 3PIOA 2KHIA 4OWWB 4JI0L 4JI5L 2IX0A 3I2ZA 4NXMQ 2ID0A 4JOIC 3GTPH 2ZTEA 1IBLQ 4A3BH 3F2CA 3B6YA 2UUCQ 3PF4A 4QY7A 1BVSA 4DUZL 3I4MG 4APVA 5M3FG 1R9TH 2ZJQA 3ICEA 1NMFA 4JI3L 1XTDA 1WOCA 3CCUA 4X64Q 4LUOA 3GTJH 1XMQL 1KHIA 1KL9A 1QVGA 3CCQA 3STBC 1TWFH 2NN6G 3J81j 3T1HL 3M4QA 1DGSA 5IYDH 5M5XH 3GD7A 2UUAQ 3PO3H 1FVIA 2PQAA 4PZ8A 3W5OA 1E22A 3TEHB 1FJGQ 1CSQA 3HOYH 3OTOQ 4P71A 1QVCA 1HH2P 2KHJA 2N3SA 5FJ8G 4AYBE 4A75A 4GLXA 1KAWA 4GNXC 2Q2IA 5IP7G 1JJCB 1YZ6A 1E1TA 3M4PA 2E5LL 2H5XA 2PNHA 4GNXB 4JI1L 1YJWA 1XJVA 4K0KL 2R93H 3G71A 5GROA 2QA4A 2OTLA 3HOWH 3TRZA 3PUVA 3J7ZC 4WJ4A 1OXSC 2UXDQ 4AYBG 5C3EH 3HOUG 2WAQE 4B3SQ 4BBRG 2UXBQ 1Y1WG 1PFSA 4JBKA 3D0FA 4DV2Q 1AE2A 2FXQA 4YCWA 2GVAA 4GN3B 4DR1L 3H3VH 4FDBA 3CMAA 2XGTA 1N34Q 3GTKH 3S17H 1O7IA 3K7AH 3GTLH 3PCOB 4JG2A 4DV0Q 3S24A 2VQFL 2WAQG 3K80C 2HT1A 2D62A 5EAYA 3PF5A 2EQSA 3RN5A 1KIXA 2F4VQ 1GVPA 2PI2A 1JB7A 1EFWA 2CWPA 4B3ML 4OX9Q 3T1YQ 1XPOA 1S72A 2EIFA 4HJ9A 4B3TL 3CMEA 1XNQL 4HIMA 4JYAL 2OQKA 3KLWA 3HFZB 3CW2C 2R7ZG 3GTMH 5JJIA 2VUMH 3KF8B 3A0JA 4OWXB 4DV3L 4POFA 4JI0Q 4GS3A 4JI5Q 4BY1G 3TQYA 3GTQH 3I4NH 4DR3L 4WJ3M 1PH6A 4NB3A 1K0RA 1Q82C 3GO5A 3FHWA 5C0XJ 3J80c 4DUZQ 2MFIA 4LW1A 1VQ9A 3TREA 4JI3Q 1JE5A 1NJIC 1G51A 3J7A5 3PGZA 3Q8DA 1K8GA 3CC2A 1Q8KA 2JA8H 1XMQQ 4TQUS 4A3LH 2OQ0A 4POGA 1Q7YC 5GAGC 1Y1VG 3RLFA 4HJAA 3T1HQ 5ELNA 3PO3G 1UE1A 3FP9A 3HOZG 3DM3A 3IRBA 5GADC 1W2BA 2JEAI 2K52A 2RHSB 1B7YB 1PH5A 5IYBH 2Q2UA 1P8LA 3H0GH 1VQFA 5IP9G 1LTLA 4DR4L 2A19A 1JJ2A 1G6PA 1VQAA 3HKSA 3TS0A 1UE6A 4JI2L 5C4XH 2UXDL 5FLXc 1WCMG 2K4KA 4DAYB 2E5LQ 3CCJA 4L5SA 1PH4A 1OTCA 1I3QH 3OYYA 2KBNA 4JI1Q 3FKIG 1OXTA 2GVBA 5HY6A 3K8AA 2BA0A 1VQ6A 4QIWE 1CUKA 2I5MX 4OWTB 3W1BA 5M3MG 2YU9H 4R4CA 1NBWA 5IY0A 4LFBL 4C3JH 2E2HH 3L2PA 1AE3A 3HOXG 3BU2A 1VQBA 4JI4L 4AIMA 4DV1L 4DR1Q 5JJLA 2NZOA 3CCRA 1SR3A 4A3CH 4HJ7A 1KRTA 5M3FH 2LXKA 1YEZA 4EX5A 1YVCA 1CKOA 3ERSX 3F1ZA 4MTNA 1SFOH 1GKHA 4KHPL 2Q2TA 3SGIA 1WI5A 2VQFQ 4OO1I 1BKBA 1VQJA 1X56A 5LMNL 3KYHC 4DV7L 4X62L 1N32L 4YHHL 2JA6G 1J5EL 3HOVH 4A3GG 4B3MQ 2HIXA 4P75A 1ASZA 1SROA 1HZ9A 1Z9FA 3PUWA 4BBSG 4H02A 4B3TQ 1XNQQ 1CKNA 1YIJA 1U5KA 2UU9L 3BJUA 4JYAQ 2GN5A 4LUZA 1CSPA 4BY7G 3CCSA 4DV3Q 1QZGA 2OCEA 1VQ8A 4A3DG 5IP7H 2R6GA 5JEAJ 3U4VA 4DR3Q 4JV5L 2UXCL 4OONA 1PVOA 1IBKL 2Z0SA 1Q12A 2MO0A 1SE8A 2F3IA 1K83H 1Q46A 1TWCH 2Z6KA 5FLMH 4ALPA 1K8AC 1JMCA 1WJJA 3GTGH 3RR5A 4UY8C 4A3KG 3KFUA 1X3GA 2CKZB 4OO1G 4LWCA 3HOUH 1Q81C 5IYCH 4YY3L 2ASBA 3S2DH 1Y1WH 1VQPA 4QGUA 2AKWB 4C3HH 2JA9A 3M4OH 1JJGA 1NMGA 3VDYA 4HIKA 2E2JH 2JQOA 1YJNA 5H1SE 4ME3A 4GKJL 3JAMi 3CCLA
chains in the Genus database with same CATH superfamily
1PTOD 2CH4A 5LL6X 3CCMA 4NPSA 4A3KB 5GAEC 1B4OA 1EQQA 3AEVA 4JVZA 4OIJA 1I4PA 1G91A 1JOKA 3UE0A 4AH6A 1Y8PB 2NVTH 3V2TA 4DR6L 1PV4A 1XX8A 4X3TA 1B9NA 4KHZA 3JAMc 4BY1H 3F2BA 1HUMA 3MXNB 4DV1Q 3PO2H 1VQKA 1N36L 4L5QA 4DXFA 5IGGA 1YITA 3RUZA 2J4XA 4RFBA 2NYZD 5M5WH 4G7ZC 2QEXA 1PH2A 1EYGA 4H13C 4DV7Q 3VR2A 1N33L 3HOZH 1J5EQ 2BH2A 2PYKA 4JI8L 4X66L 1UAPA 5TSSA 2A6EC 1STHA 2UU9Q 4B9XA 1CT1D 1D6EC 3PQIA 3T56B 3QB3A 1AZQA 1QOHA 3TDQA 1O78A 1IBKQ 2HDMA 2EYLA 2K5VA 4O0AA 5KNDA 4PMWA 1PXUA 1B9MA 1F9SA 1F2MA 1VQHA 3TBIB 4EQ5A 1STAA 2A5HA 1A15A 1EFID 4NKLA 1RF2D 1M8AA 2JA5G 2TMPA 2RSNA 2K75A 1BBWA 4Z9CB 4I65A 4Y7NB 1ZKOA 4RHRA 3U50C 4IURA 3G4SA 1I94L 2BA1A 2LXJA 3NWSA 4GLVB 1EQRA 1R4PB 3PMFA 5ELOA 1PMRA 5C6AA 2KCMA 3EA6A 4WORA 4DR6Q 1AN8A 1LM0A 4PMBA 3CPWA 3I7FA 4YWLA 3OW2A 3ERQA 4BY7H 2A6HC 3BDOA 4K6LA 4A3DH 1UE5A 3I4MH 2IW3A 4B08A 1VQCA 1VQLA 4KD4A 3E9IA 3JAME 2XN9C 3S16B 1CI3M 1UNSA 1N36Q 2DGYA 4H0LC 4GOPC 1CFMA 1HNZL 3GTQB 4A3JB 5NUCA 2KEDA 1I4QA 1N33Q 5I6WA 5FJ8H 5E7NA 4JI8Q 4X66Q 1ILQA 4CDEC 3MXUA 3OWFA 2BDNA 4V0BA 3E0EA 5C4XG 1OXXK 3VYTA 3LX0A 2I46A 5J39A 2K5NA 5EGTA 1QCBD 4LF7L 4YWMA 1JT8A 1QVFA 4R4TA 4K5WA 1EUJA 1DZ1A 4JI6L 4KKSA 4C3JG 2C35B 3L3OC 1VQ5A 2QW7A 3ULPA 5C44G 1G291 4WJWA 4U673 1I4XA 1E7ZA 3K0XA 1IL2A 4BA2I 3C1EA 1TXYA 4JBWA 4A3EH 4X3KA 1YNND 5IT9E 1NUCA 1I94Q 1YI2A 4HTHA 1BCPD 1MD2D 2FMMA 1LT6D 3MAQA 2NVYB 1U4LA 1TWHH 1HPCA 3NEMA 1FGUA 2OXPA 3W1GA 3V05A 5FLMG 1L0XB 2D2CC 3K81C 4MIUA 2ALYB 3SHLA 5L37A 3GTPB 3AFQA 4LUVA 4K8JA 1PA6A 1HNZQ 3U58A 2QKIC 5EQ0A 3HOYG 2IY5B 4IFDG 4HR7B 5BR8L 1S40A 2E74C 2VB3X 3J7YW 1XPRA 1EYCA 2SNMA 5M5XB 2A68C 3U9OA 3CC4A 2QEJC 1WVLA 1PRTC 4UP7A 4HJ5A 1PRTB 1S5ED 1Q8IA 4LF7Q 2O2LD 3K6OA 2UUCL 1AZPA 3J81c 4JI6Q 5JVH3 2BE5C 1JQYD 1EIHA 1S5FD 2L55A 3I55A 2NWGA 2YYZA 3WOFA 3M3YH 4EQNA 4X6AH 4ZRZA 2M00A 1TWGB 3MXNA 1SMXA 3K5OA 1WTPA 2K03A 2JA6H 1FJGL 1TKWB 2GA4B 3OTOL 4A3IG 2EOTA 3K7AB 4A3FB 3CCEA 2VUMG 5EBDA 1PLFA 1Q3LA 4RHSA 1KQSA 2PW5A 4OGQC 1E24A 2F0PA 1LYLA 3BDLA 2HQLA 3I8ZA 4DK0A 3TZUA 1EY6A 2N78A 3STBD 4OO1H 4X65L 4DV2L 2TSSA 3I4NB 4A3LG 3PSIA 3H94A 2R92G 2UUBQ 3A74A 2EY5A 2ZJPA 2B2YA 1GD7A 4IPGA 2V4DA 1PH3A 4HIDA 3JC66 5BR8Q 2JA8B 3HEJA 3M7NA 3P1HA 2VL6A 3T1YL 1LTGD 3WOEA 1H9SB 2NN6I 4R9WA 1HA6A 1KAAA 2F0QA 3S15H 4PZ6A 1A2UA 2F0KA 3PIOA 4OWWB 4JI5L 2CVRA 3H91A 3T53B 4JOIC 1EY8A 1MSHA 2JP1A 3R2TA 2UUCQ 4QY7A 1FGBD 1IHZA 3BS1A 4DF7A 5M3FG 1WTRA 1XTDA 3CCUA 1EY4A 2SNSA 1JORA 4FP5D 1QVGA 1TWFH 2PPBC 5DM73 5EKLA 4OEMB 1FJGQ 1BBXC 5FK9C 3Q22A 3OTOQ 4AYBE 4GLXA 1JOQA 4GNXC 5IIFA 2Q2IA 1E1TA 5CGKA 2PNHA 2EPBA 3FEWX 4GNXB 4K0KL 4ZYSA 1NNXA 2R93H 2QA4A 2KA7A 3DWPA 3VR5A 2WAQE 5FLXE 4DV2Q 4YCWA 4RGNA 1HUNA 4ZLTF 4UDUC 3S17H 3K5MA 4K5VA 1G8ZD 1WTOA 4AYBB 4BBRB 2D62A 1Y1WB 5CV5A 4O1NA 3RN5A 1HRJA 4C3HB 1GVPA 1EFWA 2CWPA 4NP5A 3T1YQ 1S72A 2EIFA 3HS0C 1STEA 4S3SA 5C3WA 3GTMH 1NCVA 2B2VA 3A0JA 4OWXB 5C4ZA 3CHBD 4POFA 4JI5Q 4BY1G 2WAQB 4DR3L 1Q82C 1WTQA 2D5DA 3D8GA 3FHWA 5ISRA 3MTSA 1NJIC 1O80A 1VF7A 1Q8KA 4L8JA 2CW0C 1C4QA 2KVMA 5E4WC 2CH4W 1H9JA 3A55A 3FVQA 4KKUA 3HOZG 1EYDA 5JPMC 2VB2X 1PH5A 2RHSB 2Q2UA 5IP9G 3H0GH 1VQFA 2HCCA 4EGVA 1OO9B 3TS0A 2F0MA 5C4XH 2L11A 1V1OA 2EYMA 1CHPD 3CCJA 2LKVA 2KECA 2BCOA 1SDFA 1STYA 4EVOA 2RA4A 4IUNA 4F7XA 2R61A 3F2UA 4R4CA 4LFBL 4C3JH 2E2HH 4UHVA 1WCMB 4AIMA 4HMJA 3FKIB 4HJ7A 2LXKA 1BR9A 1YVCA 3DEOA 1CKOA 3R93A 3F1ZA 4MTNA 1SFOH 2KJXA 2EY2A 3SGIA 1X56A 5LMNL 1GXDC 3HOXB 5IODA 1S5DD 2X6GA 3A8JE 1HZ9A 4FF4A 1D5MC 2ENBA 3NQIA 3BJUA 1ENAA 2GN5A 4OL7A 3PIP3 3OHXC 1CSPA 4BY7G 1QZGA 4A3DG 3HZXA 3U4VA 2B39A 4DR3Q 1JCKB 3A54A 1PVOA 2L9HA 1Q12A 5FLMH 4ALPA 1EU3A 4BBSB 2Z6KA 1JMCA 4XT1B 1CM9A 3HRZC 3VR4A 3EVQA 5DEHA 4RGOS 1SE3A 3M4OH 1NMGA 2MGSA 1ICFB 5I2XA 2JQOA 5H1SE 2L15A 2SDFA 2E2IH 1HZBA 1CTMA 1JICA 1X54A 3K5NA 2CCZA 3FRPB 1XMOL 2JXMB 2F0JA 1D2BA 4IO9A 5DLQE 1OXUA 4DR2Q 2QILA 3DHQA 3BZKA 4PZ7A 1Q1BA 1I4GA 3EBEA 3H6MA 3KUPA 1XNRL 1H9SA 5KYLA 2B63B 4LFBQ 2HQEA 3DWQA 1I6HH 4HCEA 3QIAA 4GZYC 4QL5A 3ZJYC 1YJ9A 1SAPA 4IZ8A 1XPUA 1KABA 5KNCA 1H95A 4NW2A 3NBHB 3GV6A 2RHQB 2BOSA 3UDFA 2VQEL 2DJFC 1W3SA 1K73C 1ZXTA 4IQZA 4A3EG 4FXGC 4ZKBB 2F4IA 5LMNQ 4A3BB 5AJ3L 4A3IH 1NSNS 4R4QA 2N8NA 2F0DA 4NDXA 1PH1A 1B8AA 4RKLA 5HGTA 1M1KC 3S1NB 5D3DA 3LGJA 4C1NI 1PTOC 1RTNA 4YCUA 3U9SA 1X3FA 1NTGA 5CYUA 3S1QB 2Y0SE 3S9WA 2ES2A 3RNUA 4JW0A 4J6HA 3M85A 1TIID 1TY2A 2RDFA 1HQRD 2JA7B 2R92H 3RLNA 5DNFA 4DR7L 4KY6A 2IT1A 3P20A 1L1OA 2O4XA 3C3LA 4C3IB 1BDOA 3EIVA 4G7HC 3I4OA 5C3EB 1QUQB 4YWKA 1Y1VB 3OW7A 1LT5D 4RWSC 1CKNB 2XWJB 1XMOQ 3GTOB 4TVAB 4A3GH 2Y0SB 3HKZE 4DA2A 2RSOA 1XNRQ 3L7ZC 2OF1A 4LF5L 3I4NG 3GQBA 4JI7L 2B2UA 3KBGA 1BQQT 5JJZA 3NSWA 1RL2A 3PUYA 2PQAB 2DY8A 4Q5VA 3CKIB 4IPCA 4A3KH 3VR3A 4LF6L 2VQEQ 3I56A 4LJZC 2CHBD 5AJ3Q 5T1GA 4XTCS 4CJ0B 1STNA 4DV0L 2K32A 3PUZA 3MHBA 4IALA 1SNDA 3AU7A 5LMNW 2JJQA 3S14B 1VQGA 4OX9L 1HZCA 3L0OA 3RZOB 2K28A 3Q23A 3D4WA 4DGZA 1C0AA 1PFNA 4DR7Q 2PMZE 2VZAA 1B70B 5KRUA 2CWAA 2AWOA 2F0LA 2XRQD 2B3GA 4JBJA 3S2HB 3RZDB 5A2QE 2F0UA 2K50A 3KF6B 4B3RL 4FF2A 1LTSD 1J6QA 4XXEA 3R2IA 4A3MB 1JR0D 1J9OA 1SN8A 2Z1CA 2ZXOA 2K5QA 3BVZA 3OWEB 2K5WA 4LF5Q 1VQMA 4P74A 2L12A 4DNRB 2K01A 4JI7Q 1KD1C 2PMZB 1TWAB 1WTWA 3HOVB 1VQDA 1UEBA 3BVGA 1BBUA 1FNVA 1DONA 3FPUB 4DPGA 3ULLA 1PH9A 1ET9A 3OOCA 2ZM6L 4LF6Q 4L5RC 4Y7NH 4C3HG 1V1PB 2MHVA 5EPKA 2AMCB 2R7DA 5IP9H 2I5HA 2F0GA 4IUPA 3NXWA 2N49A 3WWVA 5D14A 1K83B 3I4LA 1X9NA 5CORA 4C1NK 1MIUA 3J80i 2IHFA 2ICIA 2NB0A 3KLSX 2CQOA 3MEHA 2R93G 1I5FA 1YNNC 1NAPA 3S16H 2XIWA 4X3UA 4CKEA 1BCPC 1ZYRD 1IYUA 4A3JH 3J7AV 1AH9A 3SXHA 1X3QA 2L0CA 5GAHC 1Y14B 5IT9c 1CZWA 2NTTA 1D1KA 3D4DA 4ZQ3A 1EIYB 1I4HA 4XIGS 4DAPA 2I5LX 4BA1I 2K5HA 4B3RQ 2K05A 3NBHA 3GTKB 3GTLB 1I6VC 2WB1G 1C9OA 5CC4A 1EOVA 4PG3A 1LV9A 3A8KE 1C48A 3G48A 5ELFA 4L5TA 1NY4A 2AWNA 5BN4A 1SNMA 1VMPA 1JWUD 5G3LF 1B50A 1W6JA 3BG3A 1UWVA 5CV8A 5C0XG 4B3SL 1HTLD 1MBYA 3C1FA 4UAIA 4RMFA 4GOPB 2F0IA 2ZM6Q 2FHTA 4L6TB 1KC8C 2EXDA 3H0GG 1HA5A 2Z4IA 2CFMA 1A63A 5IGDA 2DJGC 4M1UB 1ICWA 2NVYH 1EEFD 4N9PA 4QUFA 5JJKA 3KJPA 2OTJA 4QQBX 3K59A 2F3VA 3Q24A 1QUQA 1L0WA 1HHVA 1L0YB 2AQ2B 2IX0A 3I2ZA 3NTKA 5IGCA 3GTPH 2ZTEA 3J81L 3NWTA 1AFPA 3PF4A 4LMQD 2EJGC 3ICEA 1NMFA 4JI3L 1WOCA 3NK9A 4PQXA 3K5LA 2B8GA 4LUOA 1XMQL 1KL9A 2JN4A 3CCQA 3STBC 1A3UA 5M5XH 2DY7A 2PQAA 1E22A 1QJOA 3A56A 5JOBA 1RCVD 3MZ5A 4HEDA 4H7BA 2H5XA 1F2YA 2B2VC 2WIIB 1YJWA 1XJVA 5ELBA 2OTLA 3OIQA 1LT3D 3TRZA 3J7ZC 4WJ4A 1X3PA 4B3SQ 1IYVA 4IN3A 2F0TA 1HFNA 2IWHA 1KTKA 1O7ZA 4DR1L 3H3VH 3CMAA 2J7ZA 4XQJA 1TWCB 3GTGB 3K7AH 4G7OC 4JG2A 1K28A 3HOUB 3K80C 2HT1A 3S2DB 1GUWA 1KIXA 3AB9A 1KLGD 3SR1A 1XPOA 1ILPA 2E2JB 4HJ9A 2BDOA 4ZKCB 4ABNA 4HIMA 2OQKA 1I50B 3HFZB 3M4YA 2Q8TA 3KF8B 4GS3A 3I4NH 1SMYD 2RKSA 3MA2B 4CKBA 3LWUA 5C0XJ 4IUQA 4JI3Q 2R7ZB 1PFMA 3J7A5 3PGZA 1SE2A 2JA8H 2B2WC 2NVXB 1XMQQ 4TQUS 4TSSA 1Y1VG 4HJAA 1F2ZA 5ELNA 1AW7A 3IRBA 2DNCA 1W2BA 3ZYYX 2K52A 2JEAI 1B7YB 1P8LA 4P2CB 2A19A 1VQAA 3HKSA 1UE6A 4JI2L 4CHTB 2EY1A 2LMCB 5FLXc 2XVSA 1HQMC 2K4KA 4L5SA 1OTCA 3PO3B 4DN4M 4ODGA 2JYOA 1WTXA 4KKTA 1QE6A 3D6WA 4KN7C 4QIWE 1CUKA 4DXGA 3ITPA 1EY5A 3CU7A 1AE3A 1R4QB 3DMUA 4DR1Q 2NZOA 3CCRA 1EY7A 1KRTA 1YEZA 4EX5A 4CBVA 2K04A 3GP7A 5CV7A 3LWEA 2F03A 3HGBA 1ESFA 4OO1I 1VQJA 2NN6H 4X62L 4A3GG 3QOJA 3S1MB 2HIXA 3PUWA 4H02A 1YIJA 1U5KA 4PV1C 3VYUA 4QIWB 3CCSA 4ZUJA 1VQ8A 4XQQA 5IP7H 1EY9A 5JEAJ 4JV5L 2AQ1B 4A93B 2UXCL 4OONA 3MFGA 1SYCA 2F3IA 1Q46A 4A3KG 3MC0B 1X3GA 1Q81C 4YY3L 2ASBA 1Y1WH 1VQPA 4QGUA 4C3HH 2JA9A 2D9UA 4HIKA 4N8X1 1YJNA 4GKJL 3CCLA 3KK7A 1LO5D 4GOPA 4IUUA 4A3MG 1HXYD 3UDGA 3C2PA 2A8VA 5KYIA 2PCFB 4JI2Q 5C4JB 1BXTA 1MJCA 1U9RA 2EZVA 5EJWA 2K14A 4ZK9B 5AFWA 2RQXA 4HCSA 4X65Q 1KDAA 3A5ZB 4C2MB 2JE6I 2PQEA 4RAUC 1VQEA 2ICEC 5JAVA 1KRSA 5EKKA 1E0BA 4P72A 3W3AA 3ULJA 2NUCA 5HGQA 3SK6A 5CV4A 2XWBB 4DV6L 1N8RC 1B44D 3E5SA 3BDCA 1HNWL 3N52A 1D5ZC 1SLJA 1F77A 3ER0A 1RODA 5IYDG 1CA5A 5D3IB 4X62Q 3C46A 1VQ4A 1VDZA 3PIPA 3I3CA 4BWGB 1X6OA 1EWIA 3I90A 1M90C 4ZUIA 4KMUC 1WCMH 3BVMA 3OPOA 4UP9A 3J7AF 1HNXL 1JWSD 2EYJA 1QZHA 2E75C 3FKIH 3URYA 5C0XH 1GUNA 1SRUA 2YTXA 1YBYA 1DXMA 5KEEA 1EZ6A 4KN4C 3TP5A 2P5ZX 4RG1A 1DD2A 4HJ8A 3KOJA 3HOXH 2IPKD 5I4DA 2XTIA 3VYSA 4U68A 4GKJQ 3T13A 1EOTA 1VQOA 1A3VA 3CPFA 1C7YA 5BN5A 2K33A 1H9KA 2QGQA 4K0KQ 1K9MC 4FF1A 1GOZA 1YHQA 1F9RA 4BBSH 1A62A 3CQZB 3S17B 3SK5A 1DJRD 3KJOA 2JA5B 1QWYA 1GJXA 3AYHB 4A3JG 2RBMA 3CF5A 3Q0AA 3KF8A 4DV4L 3D3RA 3G6JB 2Q8IB 2X69A 2RDGA 4QJFA 3EFXD 1EQTA 4DV6Q 5M3MB 2B2TC 1LT4D 1HNWQ 3CXCA 4A76A 1YNXA 1KDBA 2ATWA 5K5PA 2F0OA 2PI2E 5LMUL 4P73A 1E3PA 2MNAA 1MJEA 2C5CA 1IYJB 4KLKA 2A73B 4IOCA 4CJ2C 1HR0L 1PH8A 1F2LA 5M5YB 2L4NA 5EBCA 4DUYL 1IXRA 2B63H 1MGSA 5JEAH 5K36H 2F0EA 2WV6D 1LLRD 4LF9L 2IX3A 2NVQB 1IKMA 1RIPA 1A0IA 1HNXQ 1S5BD 4DU9A 1U4MA 1LTAD 1Q1EA 1N9WA 1MHWC 4MNOA 2JEBI 2G9HD 1WD1A 2HHHL 5T1IA 5A2QL 1K8OA 3CRLC 1SNOA 4QB4A 5I2YA 4LAAA 5J1ZA 2KCTA 4QUCA 3CAMA 4DR5L 2Q2HA 3S1NH 2EYOA 3NP8A 4KJOA 2EVBA 1PRTF 3G7LA 3NUCA 3A7LA 4HIOA 3S1QH 2ZTCA 3FDTA 1LUZA 5C44B 3ONAB 5CV6A 4IFDI 2F0HA 4R8IA 3BZDB 1G2SA 5J22A 5BN3A 2JA7H 3S1RB 1K3BC 1YHBA 1E2ZA 2BH8A 4C3IH 4DV4Q 5EPLA 1IBML 4JOIA 2SOBA 1GUSA 1HFGA 1Y1VH 4G57A 4OELB 1SYBA 1EIFA 1SJHD 1R9TB 3GTOH 3IFTA 2M2LA 2I0QA 5LMUQ 4HN7A 4LFCL 1GUGA 4JBMA 3GTJB 4BXXH 2WFWA 1HR0Q 5J3BA 2RDHA 4O2DA 1PTOB 4DUYQ 3CC7A 1LTID 4IJHA 1GHJA 3U4ZA 4DK6C 3CCVA 3HOYB 1PYWD 1IW7D 4IPDA 5CR3A 4LF9Q 2WACA 4GNXA 3R8BA 1IKLA 3D6CA 4NXML 3E9HA 3MEFA 2H1EA 1IBLL 3H15A 1V8QA 4DNTB 4FNFA 2HHHQ 5LL6S 3SEBA 1GM5A 2IL8A 1XWEA 4A3FG 4N9TA 3HOWB 4X64L 4YCVA 1WD0A 2F0FA 4ULLA 3SE0A 1X3EA 2QCPX 1WTVA 4DR5Q 2UUAL 3F8TA 1Z47A 4JC0A 1M4VA 5ELDA 2OWOA 2NBFA 3S14H 1K8MA 4ID6A 3P75A 2KHSA 3I91A 2AUKA 4GLAC 2WKDA 1II3A 5CBEE 4CJ1B 3RZOH 3JAML 4CKCA 1SYFA 4R4IA 1SJED 3NELA 1BF4A 4Y52H 4A3IB 4KD3A 2IHEA 3S2HH 2UXBL 2VY3A 5G3LD 3X3MA 2VUMB 3RZDH 1IBMQ 2JA8G 1J8IA 4KJNA 1S4ZA 3RN2A 3UDIA 1JWMD 1BOSA 1ZYRC 1N34L 1IL8A 2I07B 4OXPA 4CDDC 1SSOA 3HKZB 1EZ8A 3CP0A 5I9OA 5IE8A 4A3MH 3FMCA 3IL8A 4LFCQ 4JPBW 2EJFC 1ONLA 1OXVA 2B29A 2F0VA 1EWCA 4X3SA 2E8GA 1SNPA 5EKIA 4A93G 2RF4A 2F3WA 1TWAH 1VQ7A 1K3RA 4FF3A 1HR0W 4JI0L 2EJMA 4NXMQ 1KLUD 2ID0A 1IBLQ 3F2CA 1I3QB 1BVSA 4DUZL 1SNQA 4APVA 2F1MA 5IT9L 4M8AA 4X64Q 3CRKC 1KHIA 5D65A 2YU9B 2NN6G 2EXZA 3J81j 3T1HL 3M4QA 5IYDH 2UUAQ 2R3ZA 4PZ8A 3W5OA 4ZCKA 1B1ZA 3TEHB 1RKNA 3W2DA 1CSQA 2O5JC 5M3FB 4HSVA 4P71A 1HH2P 2KHJA 3VYRA 4RCNA 2F0SA 4A75A 1KAWA 5KNBA 5IP7G 1JJCB 1YZ6A 3M4PA 1STGA 3PUVA 1XXGA 5DM63 4AYBG 2UXBQ 1LABA 4BBRG 1Y1WG 1PFSA 4JBKA 3D0FA 1AE2A 1RHPA 4Q0FA 1ENFA 1Q90A 4O42A 4DAVA 2HD3A 1MSGA 1N34Q 1SXTA 4IUTA 3GTKH 4K2KA 3GTLH 3OSOA 4XYOA 4DV0Q 4PNYA 3VA7A 1LTTD 3S24A 2WAQG 1PDQA 1CHQD 2WINB 2EQSA 1JB7A 2PI2A 4OX9Q 4B3ML 4B3TL 3CMEA 3X3NA 1O7LA 1TT2A 5IGEA 1QNKA 4JI0Q 3GTQH 3TQYA 2E2DC 1BCPB 5E4XA 4NB3A 1K0RA 3RD4A 2PNRC 5HURA 1YNJD 1SBBB 1A3TA 1T5EA 4HSPA 3J80c 4DUZQ 2NVTB 2MFIA 2B2YC 1ML0D 3TREA 1JE5A 1G51A 3Q8DA 1K8GA 3CC2A 3QJYA 4BY1B 4POGA 1Q7YC 3RLFA 3T1HQ 4OIKA 1UE1A 3FP9A 2Z8LA 3DM3A 1ZEQX 5GADC 1TR5A 3PO2B 5IYBH 3DWAA 4DR4L 1LTLA 2K6AA 1JJ2A 1G6PA 4ILWA 3HG9A 5M5WB 1WCMG 4DAYB 2A69D 1FNWA 1HTPA 2Z4HA 1PH4A 1D1IA 3HOZB 1VQ6A 3FKIG 5HY6A 2K7VA 3K8AA 2BA0A 2IJ0A 4FVMA 1DYQA 1PZKD 3W1BA 5M3MG 2CQAA 1NBWA 4XDXA 3L2PA 4J8QA 3HOXG 4JI4L 2PO4A 1TQOA 4HMIA 1SMYC 1JB3A 3OMGA 1SR3A 3EJIA 3AMUA 2M9VA 1FNUA 3L9AX 4KHPL 2EYFA 1WI5A 3LNNA 5C5LA 1BKBA 5EPJA 3KYHC 4YHHL 3TN2A 1Y8NB 2NTSA 2F0NA 4B3MQ 4P75A 1BO0A 1SROA 4BBSG 4YIJA 4B3TQ 1B53A 1CKNA 5KIXA 4R8NA 4DFAA 4CDFC 2R6GA 1LACA 4HAEA 2EYPA 4K5XA 1PZJD 1SE8A 1K8AC 1TWCH 3HP3A 3T16A 3GTGH 2AUJD 3KLSA 3RR5A 4UY8C 3UI2A 2RVLA 3WDNA 3HOUH 4BY7B 3S2DH 3T4AC 4XYQA 3J80E 4A3DB 3I4MB 2X6LA 1UEAB 4F87A 2E2JH 3EQLC 4ME3A 2A6ED 1I50H 1PTOF 3H09A 3ND9A 3MXPA 4DR4Q 1BUVT 2HCIA 5I9PA 2VS1A 3EN2A 5ELCA 2B63G 5FLXL 5FO9B 4G4KA 5JEAG 5K36G 4WFN3 2FINB 1SNCA 2JK8A 4MN3A 3TS2A 2N88A 1VQIA 2N55A 4R4OA 5I6YA 1A2TA 4KHVA 4FXDA 4V190 2A1AA 3RLOA 2R7ZH 4DAMA 3KDFB 1X55A 3TP7A 1TWGH 3MVVA 2NVXH 2VNUD 2MUYA 4A3BG 3MWYW 1PYBA 4JI4Q 1CQFA 4A3FH 4CGYB 1FL0A 2KQ3A 4RKBA 2D0PA 3PUXA 3I70A 3KBXA 4KHPQ 1FR3A 2UUBL 3NE5B 2R7FA 2O5IC 1U4PA 3PO3H 4YHHQ 4LFAL 1N32L 1CK1A 3H3VI 1B2TA 2LS01 3KF6A 4UP8A 4DKAC 4DK1A 2IX1A 1AEXA 3K58A 2JSOA 4RCOA 2JA7G 1E2WA 2A6HD 4FO2A 3J81i 2KCNA 2A74C 4LF4L 3O13A 4IJLA 1TU2B 4IOAA 2V1CC 4A3EB 4K14A 4C3IG 1CKMA 1RJTA 3HOWG 1EQVA 1C8CA 5FO7B 5C3EG 1PYSB 3D31A 1UE7A 1TWHB 3TP6A 3TSSA 3GV3A 1RTOA 2Y0SG 3S1MH 4DK3C 4I7ZC 4IPHA 4E6IA 4BXXG 2QDLA 1PHJA 1CQVA 3UE1A 1V1PA 5C5MA 1VMCA 2KEEA 1K0SA 1SEBD 2L1BA 3H3VC 1DCZA 4A93H 3QOLA 4FYDA 1QB5D 2DN8A 4EQOA 3SVMA 2H4OA 5CV9A 1VCIA 2KUMA 2WKCA 2Z6KC 2VW9A 1B3QA 2NZHA 2MP1A 2XRSD 1T9HA 4KI0A 1GO3E 3HKZG 3DLLA 2ZXPA 4ZAIA 1S3OA 2QDBA 1IZ6A 4AQYL 1D7QA 5C4JH 1BNZA 2ZT9C 4MZ9A 4MHEA 1P16A 4LFAQ 1N32Q 3M3YB 1YHAA 1A8VA 2L5TA 1JE4A 4C2MH 1ENCA 3K7UC 3T51B 2JA6B 4LF4Q 2HUGA 4QCLA 3IAYA 3G6EA 3UDXA 3A7AB 2Z9HA 1ASYA 4BBRH 5GQOA 4DAYA 4LF8L 3P7JA 3VA5A 1ESRA 1G6ZA 3NENA 2LY7A 3EROA 1UUPA 3PV0A 1VS0A 2FMCA 2RCNA 3NHHA 4A3CG 5IWAL 1TVXA 2A68D 2LSSA 3QR8A 3J81E 2MQHA 3MFYA 1VQNA 1PRTD 2LFNA 2XSCA 4KV6A 3HOVG 4IFDJ 1PH7A 2K1BA 3AFPA 2J0TD 1BCPF 2RCFA 4RGTA 4UPAA 1HZAA 1SYGA 4DV5L 2OEOA 5LHY1 3SK8A 1E1OA 4K2LA 3RMHA 2BE5D 2YTYA 3I73A 4LNQA 4B9WA 3S15B 2KCCA 2YV5A 4NXNL 1PZID 1L1OC 4GKKL 3IFDA 4XT3B 3D4RA 1L1OB 2D0OA 4A4IA 1S5CD 5IYCG 5KGUA 1LTBD 1Y8OB 3I72A 3QO2A 2PZUA 2FJ2A 3VR6A 4AQYQ 2HIVA 1MKHA 1V43A 3QWNA 1KXLA 1T5XD 1XYIA 3DUZA 4DNIA 3KLRA 4KK7A 2SEBD 3A8IE 3CQZH 4NMZA 2F52A 2JA5H 1TWFB 3E3XA 2MO1A 4JV5Q 2UXCQ 5E1FA 3DXJC 2MPMA 2B2UC 4QF4A 4H44C 2QF7A 3IKJA 1H9MA 1I4RA 1GUOA 1WYDA 5M3MH 1V9PA 4YY3Q 4LF8Q 3MXGA 4J1MA 3PIO3 1GHKA 2VXWA 1V1QA 4JCVE 1DOMA 1D8LA 1KNEA 1TS4A 2KOLA 3KDFA 2R93B 4TKOB 2PZWA 5ELEA 2DUDA 3F2DA 3PO2G 3K57A 2WB1E 1X65A 1JOOA 5IWAQ 5M5YH 5C0XI 1TS2A 2AQ3B 1RD9D 4PMCA 4N8FA 4WRDA 5JVG3 4KY7A 4R1JA 3BZCA 3GDEA 2KENA 3E6ZX 5C4HA 1Z7TA 2NVQH 2YTVA 1TS5A 4MTKA 5IOCA 1TY0A 2WP8J 4DV5Q 2FFKB 1HJPA 3AQQA 3SK4A 1Q86C 5JPNC 3ND8A 4LK1C 4DR2L 3GTMB 1Z6HA 4NXNQ 2UXDL 3M9BA 4GN4B 1IW7C 3OIPA 2WB1B 2AHOB 4GKKQ 1AP0A 2E76C 3NQTA 3A5UA 3R3OA 5IYBG 3N6RA 2MJ8A 4J15A 2B2WA 5C44H 1NE3A 1WFQA 2PW7A 4GN5A 2F4VL 3S1RH 1L2FA 3NBIA 3CD6A 1XTCD 2ZJRA 4FXKC 2ZTDA 3H0GB 5C3XA 1U0LA 1O7YA 2KHIA 1EIGA 4RGMA 1CA6A 3DEPA 5C4XB 4A3BH 3B6YA 4L63B 4I7AA 1EYAA 3I4MG 3K0YA 1LTRD 1R9TH 2ZJQA 4F8MA 2Z6BA 1EEID 1EY0A 1F9QA 1A6XA 3GTJH 4C3JB 2E2HB 1DGSA 1ET6A 3TMEA 1SE4A 1PTOH 1RDPD 3GD7A 3E0JA 1FVIA 3HOYH 4IFDH 1QVCA 2N3SA 5FOBB 5FJ8G 1SFOB 1H9RA 1DM0B 2E5LL 1MI2A 3NTHA 2XNAC 4JI1L 2OT2A 3G71A 5GROA 3HOWH 1SYDA 5FO8B 4RA8A 1OXSC 2UXDQ 5C3EH 3HOUG 2CW0D 1EWHA 2FXQA 5IGBA 2GVAA 4GN3B 2EYHA 4IUVA 1Y69U 4FDBA 1CZGA 1W6KA 1VF5C 2XGTA 1HCZA 1O7IA 5CMDA 3PCOB 4JK1C 3OMCA 2VQFL 5FKAC 5EAYA 3PF5A 2F4VQ 3M4OB 2DNEA 1GUTA 1XNQL 5M9OA 1DOKA 3KLWA 4JYAL 3CW2C 2R7ZG 2E2IB 5JJIA 2VUMH 4DV3L 4WJ3M 3DM1A 4F88A 1PH6A 3GO5A 2ZXRA 5DAUA 4LW1A 1VQ9A 4OHJA 1F9PA 3M7GA 4K6DA 4A3LH 1QNUA 2OQ0A 5GAGC 1I6HB 3PO3G 1STBA 4QMGA 4K8IA 1TS3A 1X32A 1B3AA 2HDLA 4TRDA 2F0WA 1D5XC 1KNAA 2E5LQ 1NR2A 1JC7A 1I3QH 5A35A 3OYYA 2KBNA 4ME5A 4JI1Q 1OXTA 2GVBA 3TZDA 4C56C 2G9DA 3TP8A 4KTAA 2I5MX 4OWTB 3BYTB 1EU4A 2PZTA 2YU9H 5IY0A 4CDCC 5COYA 3QG1A 3BU2A 1VQBA 3BYYB 4XQNA 4DV1L 3NTIA 5JJLA 4A3CH 1YNJC 5M3FH 2EY6A 4EQPA 5E3FA 3ERSX 5IGFA 1GKHA 1WTHA 2R92B 2Q2TA 2VQFQ 3Q6SA 3V96A 2EE1A 4DV7L 1FYCA 5F2DA 1J5EL 2JA6G 3HOVH 2C9OA 1ASZA 1Z9FA 5CBAE 4RH6A 3NPPA 1NR4A 1XNQQ 2EDGA 2K5DA 4JYAQ 2UU9L 4LUZA 1SYEA 4DV3Q 4KY5A 2OCEA 2Q8RE 3SDZA 3FPPA 3J80L 4A3GB 2A69C 1IBKL 2Z0SA 1KDCA 2MO0A 1K83H 1WJJA 1E2VA 1DOLA 3KFUA 2CKZB 4OO1G 1FD7D 4LWCA 5IYCH 1U4RA 4BS9A 2G5DA 2NZ1D 1QILA 2AKWB 1QG7A 1G2TA 1EL0A 1JJGA 3VDYA 1PFBA 3JAMi 2B2TA 2B8FA
chains in the Genus database with same CATH topology
1I50H 2L15A 2E2IH 3CCMA 4GOPA 4A3MG 1HZBA 4DR4Q 3UDGA 2VS1A 3EN2A 1X54A 4NPSA 5GAEC 2A8VA 2B63G 2CCZA 1EQQA 4JI2Q 3AEVA 5JEAG 1MJCA 5K36G 1XMOL 2JK8A 2K14A 3TS2A 1VQIA 4IO9A 5DLQE 1OXUA 4R4OA 3UE0A 4DR2Q 4AH6A 2NVTH 4DR6L 3BZKA 1PV4A 4PZ7A 1Q1BA 2A1AA 3EBEA 3RLOA 4X65Q 1XNRL 2R7ZH 4DAMA 3A5ZB 1X55A 3KDFB 1TWGH 2JE6I 2NVXH 2VNUD 4KHZA 3JAMc 4BY1H 3F2BA 1VQEA 1KRSA 4A3BG 4LFBQ 1I6HH 1PYBA 4P72A 3ULJA 5HGQA 4JI4Q 4A3FH 4QL5A 1FL0A 3MXNB 3ZJYC 4DV1Q 1YJ9A 3PO2H 1XPUA 4DV6L 1VQKA 2D0PA 1N36L 4L5QA 1YITA 1N8RC 3PUXA 1H95A 1HNWL 3NBHB 2RHQB 1SLJA 3UDFA 2UXBL 2VQEL 4KHPQ 3ER0A 1K73C 1W3SA 5M5WH 5IYDG 2UUBL 2QEXA 4A3EG 1PH2A 2R7FA 1EYGA 5LMNQ 4DV7Q 4X62Q 5AJ3L 1N33L 4YHHQ 4A3IH 4LFAL 1VQ4A 4R4QA 2N8NA 1J5EQ 2BH2A 3KF6A 3H3VI 4JI8L 4UP8A 4X66L 4DKAC 3PIPA 1PH1A 1B8AA 2IX1A 1M1KC 2JA7G 2UU9Q 1X6OA 3LGJA 3J81i 1EWIA 4YCUA 1X3FA 1M90C 4LF4L 1NTGA 4IJLA 4IOAA 1WCMH 2V1CC 2Y0SE 4UP9A 2ES2A 1CKMA 3RNUA 1HNXL 1QZHA 3FKIH 1IBKQ 3HOWG 1SRUA 3M85A 2K5VA 2YTXA 4O0AA 4PMWA 1YBYA 5C3EG 2R92H 1VQHA 4EQ5A 3RLNA 1PYSB 3D31A 4RG1A 1UE7A 4HJ8A 4DR7L 2IT1A 3KOJA 3HOXH 1L1OA 2Y0SG 3S1MH 2XTIA 4DK3C 4IPHA 4GKJQ 4BXXG 3EIVA 1PHJA 3UE1A 2JA5G 2K75A 1VQOA 3I4OA 1BBWA 3CPFA 1C7YA 1QUQB 4YWKA 2QGQA 4A93H 1CKNB 3U50C 4K0KQ 1XMOQ 1K9MC 3G4SA 4TVAB 1YHQA 2BA1A 2LXJA 1I94L 4GLVB 4A3GH 1EQRA 3HKZE 5ELOA 4BBSH 1A62A 1VCIA 2KCMA 3KJOA 4DR6Q 1LM0A 1XNRQ 3L7ZC 2Z6KC 3CPWA 3I7FA 4YWLA 3OW2A 4LF5L 3I4NG 4BY7H 3AYHB 2VW9A 4A3JG 4JI7L 3CF5A 4A3DH 1UE5A 2NZHA 1RL2A 3I4MH 4DV4L 3PUYA 1T9HA 1VQCA 4KI0A 1VQLA 1GO3E 2PQAB 3E9IA 3HKZG 4QJFA 3DLLA 4DV6Q 1N36Q 4IPCA 2DGYA 4A3KH 4LF6L 1S3OA 1HNWQ 3CXCA 1IZ6A 4GOPC 4AQYL 1HNZL 1D7QA 4A76A 5C4JH 2VQEQ 3I56A 1YNXA 4MZ9A 2ATWA 5LMUL 2PI2E 4P73A 1E3PA 2MNAA 1P16A 5AJ3Q 1MJEA 4LFAQ 1N33Q 1N32Q 1IYJB 4KLKA 5FJ8H 1HR0L 5E7NA 4XTCS 4JI8Q 4X66Q 4IOCA 1PH8A 4DV0L 1YHAA 1A8VA 3PUZA 4DUYL 1IXRA 4C2MH 3K7UC 3E0EA 5LMNW 2B63H 5C4XG 1OXXK 2JJQA 4LF4Q 1VQGA 4OX9L 3G6EA 1HZCA 3UDXA 4LF9L 3L0OA 1RIPA 1A0IA 1ASYA 2K5NA 1HNXQ 4LF7L 4YWMA 5GQOA 4BBRH 4LF8L 1JT8A 1Q1EA 1QVFA 4R4TA 1N9WA 2HHHL 4MNOA 1EUJA 2JEBI 4JI6L 3NENA 1C0AA 2C35B 4DR7Q 2PMZE 2VZAA 1B70B 1VQ5A 3PV0A 2CWAA 1VS0A 3ULPA 5C44G 2AWOA 2RCNA 1G291 2B3GA 2KCTA 4JBJA 4A3CG 5IWAL 3CAMA 4DR5L 2Q2HA 3S1NH 2LSSA 1E7ZA 3K0XA 1IL2A 2MQHA 4BA2I 2K50A 3KF6B 1VQNA 1TXYA 4HIOA 4JBWA 4B3RL 3S1QH 2ZTCA 4A3EH 3HOVG 1J6QA 1LUZA 4IFDJ 1PH7A 3AFPA 1I94Q 1YI2A 4IFDI 4UPAA 1HZAA 1SN8A 4DV5L 2JA7H 1E1OA 4LF5Q 1VQMA 1TWHH 2YTYA 4P74A 1YHBA 4JI7Q 3NEMA 4LNQA 1KD1C 1FGUA 2YV5A 2BH8A 4NXNL 4C3IH 4DV4Q 3W1GA 1IBML 5FLMG 1VQDA 1L1OC 1UEBA 4JOIA 4GKKL 3K81C 1BBUA 2ALYB 4DPGA 1L1OB 2D0OA 3ULLA 4A4IA 1PH9A 3AFQA 5IYCG 2ZM6L 1Y1VH 4LUVA 4LF6Q 4L5RC 1PA6A 4Y7NH 3U58A 4AQYQ 1HNZQ 2HIVA 1EIFA 3HOYG 1MKHA 1V43A 1KXLA 3GTOH 2IY5B 2I0QA 2AMCB 2R7DA 5IP9H 5LMUQ 2I5HA 4DNIA 4IFDG 2N49A 4LFCL 5BR8L 3WWVA 4JBMA 3CQZH 1S40A 2F52A 2WFWA 1HR0Q 2JA5H 5J3BA 4BXXH 1X9NA 2MO1A 4O2DA 1MIUA 1XPRA 4DUYQ 3CC7A 4JV5Q 2UXCQ 3J80i 2IHFA 4IJHA 3CC4A 2CQOA 3U4ZA 4DK6C 3CCVA 2R93G 4IPDA 4LF9Q 4UP7A 1I5FA 4HJ5A 4GNXA 3S2HH 4NXML 3E9HA 3MEFA 3HOZH 3S16H 1WYDA 5M3MH 1V9PA 4LF7Q 4YY3Q 1IBLL 4LF8Q 3H15A 2UUCL 2HHHQ 3J81c 1V1QA 4A3JH 4JCVE 1GM5A 4JI6Q 1D8LA 1AH9A 3KDFA 3I55A 4A3FG 5GAHC 1Y14B 2DUDA 2YYZA 3F2DA 3PO2G 5IT9c 4X64L 2WB1E 1X65A 4YCVA 3M3YH 1X3EA 5IWAQ 5M5YH 1EIYB 5C0XI 4DR5Q 4X6AH 2UUAL 3F8TA 1Z47A 4JC0A 4XIGS 1SMXA 2OWOA 2JA6H 1FJGL 2I5LX 4BA1I 3S14H 4R1JA 3BZCA 3GDEA 2K5HA 4B3RQ 3OTOL 2KENA 4A3IG 2NVQH 4GLAC 3CCEA 2VUMG 3RZOH 2YTVA 2WB1G 1C9OA 1EOVA 4PG3A 2WP8J 4DV5Q 1KQSA 1HJPA 3AQQA 3G48A 1Q86C 1E24A 4R4IA 1LYLA 4L5TA 3NELA 1NY4A 2AWNA 2HQLA 4DR2L 4Y52H 2N78A 4NXNQ 2IHEA 1UWVA 5C0XG 2VY3A 3M9BA 4GN4B 3STBD 3RZDH 1IBMQ 4B3SL 2JA8G 2AHOB 4X65L 4DV2L 4GKKQ 4A3LG 3PSIA 4RMFA 2R92G 3A5UA 3RN2A 2UUBQ 3UDIA 4GOPB 2ZM6Q 3A74A 2ZJPA 1N34L 4OXPA 5IYBG 1KC8C 2EXDA 3H0GG 4J15A 3CP0A 5C44H 1NE3A 1WFQA 1GD7A 2CFMA 4IPGA 5IE8A 4A3MH 1PH3A 4HIDA 3JC66 5BR8Q 4LFCQ 4GN5A 1A63A 2F4VL 3M7NA 2NVYH 2VL6A 3S1RH 1L2FA 1OXVA 2B29A 3T1YL 2E8GA 2NN6I 3CD6A 4A93G 2RF4A 2ZJRA 5JJKA 3KJPA 3S15H 2OTJA 4PZ6A 4QQBX 1TWAH 1VQ7A 2ZTDA 1K3RA 1QUQA 1L0WA 1HR0W 1U0LA 3PIOA 2KHIA 4OWWB 4JI0L 4JI5L 2IX0A 3I2ZA 4NXMQ 2ID0A 4JOIC 3GTPH 2ZTEA 1IBLQ 4A3BH 3F2CA 3B6YA 2UUCQ 3PF4A 4QY7A 1BVSA 4DUZL 3I4MG 4APVA 5M3FG 1R9TH 2ZJQA 3ICEA 1NMFA 4JI3L 1XTDA 1WOCA 3CCUA 4X64Q 4LUOA 3GTJH 1XMQL 1KHIA 1KL9A 1QVGA 3CCQA 3STBC 1TWFH 2NN6G 3J81j 3T1HL 3M4QA 1DGSA 5IYDH 5M5XH 3GD7A 2UUAQ 3PO3H 1FVIA 2PQAA 4PZ8A 3W5OA 1E22A 3TEHB 1FJGQ 1CSQA 3HOYH 3OTOQ 4P71A 1QVCA 1HH2P 2KHJA 2N3SA 5FJ8G 4AYBE 4A75A 4GLXA 1KAWA 4GNXC 2Q2IA 5IP7G 1JJCB 1YZ6A 1E1TA 3M4PA 2E5LL 2H5XA 2PNHA 4GNXB 4JI1L 1YJWA 1XJVA 4K0KL 2R93H 3G71A 5GROA 2QA4A 2OTLA 3HOWH 3TRZA 3PUVA 3J7ZC 4WJ4A 1OXSC 2UXDQ 4AYBG 5C3EH 3HOUG 2WAQE 4B3SQ 4BBRG 2UXBQ 1Y1WG 1PFSA 4JBKA 3D0FA 4DV2Q 1AE2A 2FXQA 4YCWA 2GVAA 4GN3B 4DR1L 3H3VH 4FDBA 3CMAA 2XGTA 1N34Q 3GTKH 3S17H 1O7IA 3K7AH 3GTLH 3PCOB 4JG2A 4DV0Q 3S24A 2VQFL 2WAQG 3K80C 2HT1A 2D62A 5EAYA 3PF5A 2EQSA 3RN5A 1KIXA 2F4VQ 1GVPA 2PI2A 1JB7A 1EFWA 2CWPA 4B3ML 4OX9Q 3T1YQ 1XPOA 1S72A 2EIFA 4HJ9A 4B3TL 3CMEA 1XNQL 4HIMA 4JYAL 2OQKA 3KLWA 3HFZB 3CW2C 2R7ZG 3GTMH 5JJIA 2VUMH 3KF8B 3A0JA 4OWXB 4DV3L 4POFA 4JI0Q 4GS3A 4JI5Q 4BY1G 3TQYA 3GTQH 3I4NH 4DR3L 4WJ3M 1PH6A 4NB3A 1K0RA 1Q82C 3GO5A 3FHWA 5C0XJ 3J80c 4DUZQ 2MFIA 4LW1A 1VQ9A 3TREA 4JI3Q 1JE5A 1NJIC 1G51A 3J7A5 3PGZA 3Q8DA 1K8GA 3CC2A 1Q8KA 2JA8H 1XMQQ 4TQUS 4A3LH 2OQ0A 4POGA 1Q7YC 5GAGC 1Y1VG 3RLFA 4HJAA 3T1HQ 5ELNA 3PO3G 1UE1A 3FP9A 3HOZG 3DM3A 3IRBA 5GADC 1W2BA 2JEAI 2K52A 2RHSB 1B7YB 1PH5A 5IYBH 2Q2UA 1P8LA 3H0GH 1VQFA 5IP9G 1LTLA 4DR4L 2A19A 1JJ2A 1G6PA 1VQAA 3HKSA 3TS0A 1UE6A 4JI2L 5C4XH 2UXDL 5FLXc 1WCMG 2K4KA 4DAYB 2E5LQ 3CCJA 4L5SA 1PH4A 1OTCA 1I3QH 3OYYA 2KBNA 4JI1Q 3FKIG 1OXTA 2GVBA 5HY6A 3K8AA 2BA0A 1VQ6A 4QIWE 1CUKA 2I5MX 4OWTB 3W1BA 5M3MG 2YU9H 4R4CA 1NBWA 5IY0A 4LFBL 4C3JH 2E2HH 3L2PA 1AE3A 3HOXG 3BU2A 1VQBA 4JI4L 4AIMA 4DV1L 4DR1Q 5JJLA 2NZOA 3CCRA 1SR3A 4A3CH 4HJ7A 1KRTA 5M3FH 2LXKA 1YEZA 4EX5A 1YVCA 1CKOA 3ERSX 3F1ZA 4MTNA 1SFOH 1GKHA 4KHPL 2Q2TA 3SGIA 1WI5A 2VQFQ 4OO1I 1BKBA 1VQJA 1X56A 5LMNL 3KYHC 4DV7L 4X62L 1N32L 4YHHL 2JA6G 1J5EL 3HOVH 4A3GG 4B3MQ 2HIXA 4P75A 1ASZA 1SROA 1HZ9A 1Z9FA 3PUWA 4BBSG 4H02A 4B3TQ 1XNQQ 1CKNA 1YIJA 1U5KA 2UU9L 3BJUA 4JYAQ 2GN5A 4LUZA 1CSPA 4BY7G 3CCSA 4DV3Q 1QZGA 2OCEA 1VQ8A 4A3DG 5IP7H 2R6GA 5JEAJ 3U4VA 4DR3Q 4JV5L 2UXCL 4OONA 1PVOA 1IBKL 2Z0SA 1Q12A 2MO0A 1SE8A 2F3IA 1K83H 1Q46A 1TWCH 2Z6KA 5FLMH 4ALPA 1K8AC 1JMCA 1WJJA 3GTGH 3RR5A 4UY8C 4A3KG 3KFUA 1X3GA 2CKZB 4OO1G 4LWCA 3HOUH 1Q81C 5IYCH 4YY3L 2ASBA 3S2DH 1Y1WH 1VQPA 4QGUA 2AKWB 4C3HH 2JA9A 3M4OH 1JJGA 1NMGA 3VDYA 4HIKA 2E2JH 2JQOA 1YJNA 5H1SE 4ME3A 4GKJL 3JAMi 3CCLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I50 H;  2L15 A;  2E2I H;  3CCM A;  4GOP A;  4A3M G;  1HZB A;  4DR4 Q;  3UDG A;  2VS1 A;  3EN2 A;  1X54 A;  4NPS A;  5GAE C;  2A8V A;  2B63 G;  2CCZ A;  1EQQ A;  4JI2 Q;  3AEV A;  5JEA G;  1MJC A;  5K36 G;  1XMO L;  2JK8 A;  2K14 A;  3TS2 A;  1VQI A;  4IO9 A;  5DLQ E;  1OXU A;  4R4O A;  3UE0 A;  4DR2 Q;  4AH6 A;  2NVT H;  4DR6 L;  3BZK A;  1PV4 A;  4PZ7 A;  1Q1B A;  2A1A A;  3EBE A;  3RLO A;  4X65 Q;  1XNR L;  2R7Z H;  4DAM A;  3A5Z B;  1X55 A;  3KDF B;  1TWG H;  2JE6 I;  2NVX H;  2VNU D;  4KHZ A;  3JAM c;  4BY1 H;  3F2B A;  1VQE A;  1KRS A;  4A3B G;  4LFB Q;  1I6H H;  1PYB A;  4P72 A;  3ULJ A;  5HGQ A;  4JI4 Q;  4A3F H;  4QL5 A;  1FL0 A;  3MXN B;  3ZJY C;  4DV1 Q;  1YJ9 A;  3PO2 H;  1XPU A;  4DV6 L;  1VQK A;  2D0P A;  1N36 L;  4L5Q A;  1YIT A;  1N8R C;  3PUX A;  1H95 A;  1HNW L;  3NBH B;  2RHQ B;  1SLJ A;  3UDF A;  2UXB L;  2VQE L;  4KHP Q;  3ER0 A;  1K73 C;  1W3S A;  5M5W H;  5IYD G;  2UUB L;  2QEX A;  4A3E G;  1PH2 A;  2R7F A;  1EYG A;  5LMN Q;  4DV7 Q;  4X62 Q;  5AJ3 L;  1N33 L;  4YHH Q;  4A3I H;  4LFA L;  1VQ4 A;  4R4Q A;  2N8N A;  1J5E Q;  2BH2 A;  3KF6 A;  3H3V I;  4JI8 L;  4UP8 A;  4X66 L;  4DKA C;  3PIP A;  1PH1 A;  1B8A A;  2IX1 A;  1M1K C;  2JA7 G;  2UU9 Q;  1X6O A;  3LGJ A;  3J81 i;  1EWI A;  4YCU A;  1X3F A;  1M90 C;  4LF4 L;  1NTG A;  4IJL A;  4IOA A;  1WCM H;  2V1C C;  2Y0S E;  4UP9 A;  2ES2 A;  1CKM A;  3RNU A;  1HNX L;  1QZH A;  3FKI H;  1IBK Q;  3HOW G;  1SRU A;  3M85 A;  2K5V A;  2YTX A;  4O0A A;  4PMW A;  1YBY A;  5C3E G;  2R92 H;  1VQH A;  4EQ5 A;  3RLN A;  1PYS B;  3D31 A;  4RG1 A;  1UE7 A;  4HJ8 A;  4DR7 L;  2IT1 A;  3KOJ A;  3HOX H;  1L1O A;  2Y0S G;  3S1M H;  2XTI A;  4DK3 C;  4IPH A;  4GKJ Q;  4BXX G;  3EIV A;  1PHJ A;  3UE1 A;  2JA5 G;  2K75 A;  1VQO A;  3I4O A;  1BBW A;  3CPF A;  1C7Y A;  1QUQ B;  4YWK A;  2QGQ A;  4A93 H;  1CKN B;  3U50 C;  4K0K Q;  1XMO Q;  1K9M C;  3G4S A;  4TVA B;  1YHQ A;  2BA1 A;  2LXJ A;  1I94 L;  4GLV B;  4A3G H;  1EQR A;  3HKZ E;  5ELO A;  4BBS H;  1A62 A;  1VCI A;  2KCM A;  3KJO A;  4DR6 Q;  1LM0 A;  1XNR Q;  3L7Z C;  2Z6K C;  3CPW A;  3I7F A;  4YWL A;  3OW2 A;  4LF5 L;  3I4N G;  4BY7 H;  3AYH B;  2VW9 A;  4A3J G;  4JI7 L;  3CF5 A;  4A3D H;  1UE5 A;  2NZH A;  1RL2 A;  3I4M H;  4DV4 L;  3PUY A;  1T9H A;  1VQC A;  4KI0 A;  1VQL A;  1GO3 E;  2PQA B;  3E9I A;  3HKZ G;  4QJF A;  3DLL A;  4DV6 Q;  1N36 Q;  4IPC A;  2DGY A;  4A3K H;  4LF6 L;  1S3O A;  1HNW Q;  3CXC A;  1IZ6 A;  4GOP C;  4AQY L;  1HNZ L;  1D7Q A;  4A76 A;  5C4J H;  2VQE Q;  3I56 A;  1YNX A;  4MZ9 A;  2ATW A;  5LMU L;  2PI2 E;  4P73 A;  1E3P A;  2MNA A;  1P16 A;  5AJ3 Q;  1MJE A;  4LFA Q;  1N33 Q;  1N32 Q;  1IYJ B;  4KLK A;  5FJ8 H;  1HR0 L;  5E7N A;  4XTC S;  4JI8 Q;  4X66 Q;  4IOC A;  1PH8 A;  4DV0 L;  1YHA A;  1A8V A;  3PUZ A;  4DUY L;  1IXR A;  4C2M H;  3K7U C;  3E0E A;  5LMN W;  2B63 H;  5C4X G;  1OXX K;  2JJQ A;  4LF4 Q;  1VQG A;  4OX9 L;  3G6E A;  1HZC A;  3UDX A;  4LF9 L;  3L0O A;  1RIP A;  1A0I A;  1ASY A;  2K5N A;  1HNX Q;  4LF7 L;  4YWM A;  5GQO A;  4BBR H;  4LF8 L;  1JT8 A;  1Q1E A;  1QVF A;  4R4T A;  1N9W A;  2HHH L;  4MNO A;  1EUJ A;  2JEB I;  4JI6 L;  3NEN A;  1C0A A;  2C35 B;  4DR7 Q;  2PMZ E;  2VZA A;  1B70 B;  1VQ5 A;  3PV0 A;  2CWA A;  1VS0 A;  3ULP A;  5C44 G;  2AWO A;  2RCN A;  1G29 1;  2B3G A;  2KCT A;  4JBJ A;  4A3C G;  5IWA L;  3CAM A;  4DR5 L;  2Q2H A;  3S1N H;  2LSS A;  1E7Z A;  3K0X A;  1IL2 A;  2MQH A;  4BA2 I;  2K50 A;  3KF6 B;  1VQN A;  1TXY A;  4HIO A;  4JBW A;  4B3R L;  3S1Q H;  2ZTC A;  4A3E H;  3HOV G;  1J6Q A;  1LUZ A;  4IFD J;  1PH7 A;  3AFP A;  1I94 Q;  1YI2 A;  4IFD I;  4UPA A;  1HZA A;  1SN8 A;  4DV5 L;  2JA7 H;  1E1O A;  4LF5 Q;  1VQM A;  1TWH H;  2YTY A;  4P74 A;  1YHB A;  4JI7 Q;  3NEM A;  4LNQ A;  1KD1 C;  1FGU A;  2YV5 A;  2BH8 A;  4NXN L;  4C3I H;  4DV4 Q;  3W1G A;  1IBM L;  5FLM G;  1VQD A;  1L1O C;  1UEB A;  4JOI A;  4GKK L;  3K81 C;  1BBU A;  2ALY B;  4DPG A;  1L1O B;  2D0O A;  3ULL A;  4A4I A;  1PH9 A;  3AFQ A;  5IYC G;  2ZM6 L;  1Y1V H;  4LUV A;  4LF6 Q;  4L5R C;  1PA6 A;  4Y7N H;  3U58 A;  4AQY Q;  1HNZ Q;  2HIV A;  1EIF A;  3HOY G;  1MKH A;  1V43 A;  1KXL A;  3GTO H;  2IY5 B;  2I0Q A;  2AMC B;  2R7D A;  5IP9 H;  5LMU Q;  2I5H A;  4DNI A;  4IFD G;  2N49 A;  4LFC L;  5BR8 L;  3WWV A;  4JBM A;  3CQZ H;  1S40 A;  2F52 A;  2WFW A;  1HR0 Q;  2JA5 H;  5J3B A;  4BXX H;  1X9N A;  2MO1 A;  4O2D A;  1MIU A;  1XPR A;  4DUY Q;  3CC7 A;  4JV5 Q;  2UXC Q;  3J80 i;  2IHF A;  4IJH A;  3CC4 A;  2CQO A;  3U4Z A;  4DK6 C;  3CCV A;  2R93 G;  4IPD A;  4LF9 Q;  4UP7 A;  1I5F A;  4HJ5 A;  4GNX A;  3S2H H;  4NXM L;  3E9H A;  3MEF A;  3HOZ H;  3S16 H;  1WYD A;  5M3M H;  1V9P A;  4LF7 Q;  4YY3 Q;  1IBL L;  4LF8 Q;  3H15 A;  2UUC L;  2HHH Q;  3J81 c;  1V1Q A;  4A3J H;  4JCV E;  1GM5 A;  4JI6 Q;  1D8L A;  1AH9 A;  3KDF A;  3I55 A;  4A3F G;  5GAH C;  1Y14 B;  2DUD A;  2YYZ A;  3F2D A;  3PO2 G;  5IT9 c;  4X64 L;  2WB1 E;  1X65 A;  4YCV A;  3M3Y H;  1X3E A;  5IWA Q;  5M5Y H;  1EIY B;  5C0X I;  4DR5 Q;  4X6A H;  2UUA L;  3F8T A;  1Z47 A;  4JC0 A;  4XIG S;  1SMX A;  2OWO A;  2JA6 H;  1FJG L;  2I5L X;  4BA1 I;  3S14 H;  4R1J A;  3BZC A;  3GDE A;  2K5H A;  4B3R Q;  3OTO L;  2KEN A;  4A3I G;  2NVQ H;  4GLA C;  3CCE A;  2VUM G;  3RZO H;  2YTV A;  2WB1 G;  1C9O A;  1EOV A;  4PG3 A;  2WP8 J;  4DV5 Q;  1KQS A;  1HJP A;  3AQQ A;  3G48 A;  1Q86 C;  1E24 A;  4R4I A;  1LYL A;  4L5T A;  3NEL A;  1NY4 A;  2AWN A;  2HQL A;  4DR2 L;  4Y52 H;  2N78 A;  4NXN Q;  2IHE A;  1UWV A;  5C0X G;  2VY3 A;  3M9B A;  4GN4 B;  3STB D;  3RZD H;  1IBM Q;  4B3S L;  2JA8 G;  2AHO B;  4X65 L;  4DV2 L;  4GKK Q;  4A3L G;  3PSI A;  4RMF A;  2R92 G;  3A5U A;  3RN2 A;  2UUB Q;  3UDI A;  4GOP B;  2ZM6 Q;  3A74 A;  2ZJP A;  1N34 L;  4OXP A;  5IYB G;  1KC8 C;  2EXD A;  3H0G G;  4J15 A;  3CP0 A;  5C44 H;  1NE3 A;  1WFQ A;  1GD7 A;  2CFM A;  4IPG A;  5IE8 A;  4A3M H;  1PH3 A;  4HID A;  3JC6 6;  5BR8 Q;  4LFC Q;  4GN5 A;  1A63 A;  2F4V L;  3M7N A;  2NVY H;  2VL6 A;  3S1R H;  1L2F A;  1OXV A;  2B29 A;  3T1Y L;  2E8G A;  2NN6 I;  3CD6 A;  4A93 G;  2RF4 A;  2ZJR A;  5JJK A;  3KJP A;  3S15 H;  2OTJ A;  4PZ6 A;  4QQB X;  1TWA H;  1VQ7 A;  2ZTD A;  1K3R A;  1QUQ A;  1L0W A;  1HR0 W;  1U0L A;  3PIO A;  2KHI A;  4OWW B;  4JI0 L;  4JI5 L;  2IX0 A;  3I2Z A;  4NXM Q;  2ID0 A;  4JOI C;  3GTP H;  2ZTE A;  1IBL Q;  4A3B H;  3F2C A;  3B6Y A;  2UUC Q;  3PF4 A;  4QY7 A;  1BVS A;  4DUZ L;  3I4M G;  4APV A;  5M3F G;  1R9T H;  2ZJQ A;  3ICE A;  1NMF A;  4JI3 L;  1XTD A;  1WOC A;  3CCU A;  4X64 Q;  4LUO A;  3GTJ H;  1XMQ L;  1KHI A;  1KL9 A;  1QVG A;  3CCQ A;  3STB C;  1TWF H;  2NN6 G;  3J81 j;  3T1H L;  3M4Q A;  1DGS A;  5IYD H;  5M5X H;  3GD7 A;  2UUA Q;  3PO3 H;  1FVI A;  2PQA A;  4PZ8 A;  3W5O A;  1E22 A;  3TEH B;  1FJG Q;  1CSQ A;  3HOY H;  3OTO Q;  4P71 A;  1QVC A;  1HH2 P;  2KHJ A;  2N3S A;  5FJ8 G;  4AYB E;  4A75 A;  4GLX A;  1KAW A;  4GNX C;  2Q2I A;  5IP7 G;  1JJC B;  1YZ6 A;  1E1T A;  3M4P A;  2E5L L;  2H5X A;  2PNH A;  4GNX B;  4JI1 L;  1YJW A;  1XJV A;  4K0K L;  2R93 H;  3G71 A;  5GRO A;  2QA4 A;  2OTL A;  3HOW H;  3TRZ A;  3PUV A;  3J7Z C;  4WJ4 A;  1OXS C;  2UXD Q;  4AYB G;  5C3E H;  3HOU G;  2WAQ E;  4B3S Q;  4BBR G;  2UXB Q;  1Y1W G;  1PFS A;  4JBK A;  3D0F A;  4DV2 Q;  1AE2 A;  2FXQ A;  4YCW A;  2GVA A;  4GN3 B;  4DR1 L;  3H3V H;  4FDB A;  3CMA A;  2XGT A;  1N34 Q;  3GTK H;  3S17 H;  1O7I A;  3K7A H;  3GTL H;  3PCO B;  4JG2 A;  4DV0 Q;  3S24 A;  2VQF L;  2WAQ G;  3K80 C;  2HT1 A;  2D62 A;  5EAY A;  3PF5 A;  2EQS A;  3RN5 A;  1KIX A;  2F4V Q;  1GVP A;  2PI2 A;  1JB7 A;  1EFW A;  2CWP A;  4B3M L;  4OX9 Q;  3T1Y Q;  1XPO A;  1S72 A;  2EIF A;  4HJ9 A;  4B3T L;  3CME A;  1XNQ L;  4HIM A;  4JYA L;  2OQK A;  3KLW A;  3HFZ B;  3CW2 C;  2R7Z G;  3GTM H;  5JJI A;  2VUM H;  3KF8 B;  3A0J A;  4OWX B;  4DV3 L;  4POF A;  4JI0 Q;  4GS3 A;  4JI5 Q;  4BY1 G;  3TQY A;  3GTQ H;  3I4N H;  4DR3 L;  4WJ3 M;  1PH6 A;  4NB3 A;  1K0R A;  1Q82 C;  3GO5 A;  3FHW A;  5C0X J;  3J80 c;  4DUZ Q;  2MFI A;  4LW1 A;  1VQ9 A;  3TRE A;  4JI3 Q;  1JE5 A;  1NJI C;  1G51 A;  3J7A 5;  3PGZ A;  3Q8D A;  1K8G A;  3CC2 A;  1Q8K A;  2JA8 H;  1XMQ Q;  4TQU S;  4A3L H;  2OQ0 A;  4POG A;  1Q7Y C;  5GAG C;  1Y1V G;  3RLF A;  4HJA A;  3T1H Q;  5ELN A;  3PO3 G;  1UE1 A;  3FP9 A;  3HOZ G;  3DM3 A;  3IRB A;  5GAD C;  1W2B A;  2JEA I;  2K52 A;  2RHS B;  1B7Y B;  1PH5 A;  5IYB H;  2Q2U A;  1P8L A;  3H0G H;  1VQF A;  5IP9 G;  1LTL A;  4DR4 L;  2A19 A;  1JJ2 A;  1G6P A;  1VQA A;  3HKS A;  3TS0 A;  1UE6 A;  4JI2 L;  5C4X H;  2UXD L;  5FLX c;  1WCM G;  2K4K A;  4DAY B;  2E5L Q;  3CCJ A;  4L5S A;  1PH4 A;  1OTC A;  1I3Q H;  3OYY A;  2KBN A;  4JI1 Q;  3FKI G;  1OXT A;  2GVB A;  5HY6 A;  3K8A A;  2BA0 A;  1VQ6 A;  4QIW E;  1CUK A;  2I5M X;  4OWT B;  3W1B A;  5M3M G;  2YU9 H;  4R4C A;  1NBW A;  5IY0 A;  4LFB L;  4C3J H;  2E2H H;  3L2P A;  1AE3 A;  3HOX G;  3BU2 A;  1VQB A;  4JI4 L;  4AIM A;  4DV1 L;  4DR1 Q;  5JJL A;  2NZO A;  3CCR A;  1SR3 A;  4A3C H;  4HJ7 A;  1KRT A;  5M3F H;  2LXK A;  1YEZ A;  4EX5 A;  1YVC A;  1CKO A;  3ERS X;  3F1Z A;  4MTN A;  1SFO H;  1GKH A;  4KHP L;  2Q2T A;  3SGI A;  1WI5 A;  2VQF Q;  4OO1 I;  1BKB A;  1VQJ A;  1X56 A;  5LMN L;  3KYH C;  4DV7 L;  4X62 L;  1N32 L;  4YHH L;  2JA6 G;  1J5E L;  3HOV H;  4A3G G;  4B3M Q;  2HIX A;  4P75 A;  1ASZ A;  1SRO A;  1HZ9 A;  1Z9F A;  3PUW A;  4BBS G;  4H02 A;  4B3T Q;  1XNQ Q;  1CKN A;  1YIJ A;  1U5K A;  2UU9 L;  3BJU A;  4JYA Q;  2GN5 A;  4LUZ A;  1CSP A;  4BY7 G;  3CCS A;  4DV3 Q;  1QZG A;  2OCE A;  1VQ8 A;  4A3D G;  5IP7 H;  2R6G A;  5JEA J;  3U4V A;  4DR3 Q;  4JV5 L;  2UXC L;  4OON A;  1PVO A;  1IBK L;  2Z0S A;  1Q12 A;  2MO0 A;  1SE8 A;  2F3I A;  1K83 H;  1Q46 A;  1TWC H;  2Z6K A;  5FLM H;  4ALP A;  1K8A C;  1JMC A;  1WJJ A;  3GTG H;  3RR5 A;  4UY8 C;  4A3K G;  3KFU A;  1X3G A;  2CKZ B;  4OO1 G;  4LWC A;  3HOU H;  1Q81 C;  5IYC H;  4YY3 L;  2ASB A;  3S2D H;  1Y1W H;  1VQP A;  4QGU A;  2AKW B;  4C3H H;  2JA9 A;  3M4O H;  1JJG A;  1NMG A;  3VDY A;  4HIK A;  2E2J H;  2JQO A;  1YJN A;  5H1S E;  4ME3 A;  4GKJ L;  3JAM i;  3CCL A; 
#chains in the Genus database with same CATH topology
 1PTO D;  2CH4 A;  5LL6 X;  3CCM A;  4NPS A;  4A3K B;  5GAE C;  1B4O A;  1EQQ A;  3AEV A;  4JVZ A;  4OIJ A;  1I4P A;  1G91 A;  1JOK A;  3UE0 A;  4AH6 A;  1Y8P B;  2NVT H;  3V2T A;  4DR6 L;  1PV4 A;  1XX8 A;  4X3T A;  1B9N A;  4KHZ A;  3JAM c;  4BY1 H;  3F2B A;  1HUM A;  3MXN B;  4DV1 Q;  3PO2 H;  1VQK A;  1N36 L;  4L5Q A;  4DXF A;  5IGG A;  1YIT A;  3RUZ A;  2J4X A;  4RFB A;  2NYZ D;  5M5W H;  4G7Z C;  2QEX A;  1PH2 A;  1EYG A;  4H13 C;  4DV7 Q;  3VR2 A;  1N33 L;  3HOZ H;  1J5E Q;  2BH2 A;  2PYK A;  4JI8 L;  4X66 L;  1UAP A;  5TSS A;  2A6E C;  1STH A;  2UU9 Q;  4B9X A;  1CT1 D;  1D6E C;  3PQI A;  3T56 B;  3QB3 A;  1AZQ A;  1QOH A;  3TDQ A;  1O78 A;  1IBK Q;  2HDM A;  2EYL A;  2K5V A;  4O0A A;  5KND A;  4PMW A;  1PXU A;  1B9M A;  1F9S A;  1F2M A;  1VQH A;  3TBI B;  4EQ5 A;  1STA A;  2A5H A;  1A15 A;  1EFI D;  4NKL A;  1RF2 D;  1M8A A;  2JA5 G;  2TMP A;  2RSN A;  2K75 A;  1BBW A;  4Z9C B;  4I65 A;  4Y7N B;  1ZKO A;  4RHR A;  3U50 C;  4IUR A;  3G4S A;  1I94 L;  2BA1 A;  2LXJ A;  3NWS A;  4GLV B;  1EQR A;  1R4P B;  3PMF A;  5ELO A;  1PMR A;  5C6A A;  2KCM A;  3EA6 A;  4WOR A;  4DR6 Q;  1AN8 A;  1LM0 A;  4PMB A;  3CPW A;  3I7F A;  4YWL A;  3OW2 A;  3ERQ A;  4BY7 H;  2A6H C;  3BDO A;  4K6L A;  4A3D H;  1UE5 A;  3I4M H;  2IW3 A;  4B08 A;  1VQC A;  1VQL A;  4KD4 A;  3E9I A;  3JAM E;  2XN9 C;  3S16 B;  1CI3 M;  1UNS A;  1N36 Q;  2DGY A;  4H0L C;  4GOP C;  1CFM A;  1HNZ L;  3GTQ B;  4A3J B;  5NUC A;  2KED A;  1I4Q A;  1N33 Q;  5I6W A;  5FJ8 H;  5E7N A;  4JI8 Q;  4X66 Q;  1ILQ A;  4CDE C;  3MXU A;  3OWF A;  2BDN A;  4V0B A;  3E0E A;  5C4X G;  1OXX K;  3VYT A;  3LX0 A;  2I46 A;  5J39 A;  2K5N A;  5EGT A;  1QCB D;  4LF7 L;  4YWM A;  1JT8 A;  1QVF A;  4R4T A;  4K5W A;  1EUJ A;  1DZ1 A;  4JI6 L;  4KKS A;  4C3J G;  2C35 B;  3L3O C;  1VQ5 A;  2QW7 A;  3ULP A;  5C44 G;  1G29 1;  4WJW A;  4U67 3;  1I4X A;  1E7Z A;  3K0X A;  1IL2 A;  4BA2 I;  3C1E A;  1TXY A;  4JBW A;  4A3E H;  4X3K A;  1YNN D;  5IT9 E;  1NUC A;  1I94 Q;  1YI2 A;  4HTH A;  1BCP D;  1MD2 D;  2FMM A;  1LT6 D;  3MAQ A;  2NVY B;  1U4L A;  1TWH H;  1HPC A;  3NEM A;  1FGU A;  2OXP A;  3W1G A;  3V05 A;  5FLM G;  1L0X B;  2D2C C;  3K81 C;  4MIU A;  2ALY B;  3SHL A;  5L37 A;  3GTP B;  3AFQ A;  4LUV A;  4K8J A;  1PA6 A;  1HNZ Q;  3U58 A;  2QKI C;  5EQ0 A;  3HOY G;  2IY5 B;  4IFD G;  4HR7 B;  5BR8 L;  1S40 A;  2E74 C;  2VB3 X;  3J7Y W;  1XPR A;  1EYC A;  2SNM A;  5M5X B;  2A68 C;  3U9O A;  3CC4 A;  2QEJ C;  1WVL A;  1PRT C;  4UP7 A;  4HJ5 A;  1PRT B;  1S5E D;  1Q8I A;  4LF7 Q;  2O2L D;  3K6O A;  2UUC L;  1AZP A;  3J81 c;  4JI6 Q;  5JVH 3;  2BE5 C;  1JQY D;  1EIH A;  1S5F D;  2L55 A;  3I55 A;  2NWG A;  2YYZ A;  3WOF A;  3M3Y H;  4EQN A;  4X6A H;  4ZRZ A;  2M00 A;  1TWG B;  3MXN A;  1SMX A;  3K5O A;  1WTP A;  2K03 A;  2JA6 H;  1FJG L;  1TKW B;  2GA4 B;  3OTO L;  4A3I G;  2EOT A;  3K7A B;  4A3F B;  3CCE A;  2VUM G;  5EBD A;  1PLF A;  1Q3L A;  4RHS A;  1KQS A;  2PW5 A;  4OGQ C;  1E24 A;  2F0P A;  1LYL A;  3BDL A;  2HQL A;  3I8Z A;  4DK0 A;  3TZU A;  1EY6 A;  2N78 A;  3STB D;  4OO1 H;  4X65 L;  4DV2 L;  2TSS A;  3I4N B;  4A3L G;  3PSI A;  3H94 A;  2R92 G;  2UUB Q;  3A74 A;  2EY5 A;  2ZJP A;  2B2Y A;  1GD7 A;  4IPG A;  2V4D A;  1PH3 A;  4HID A;  3JC6 6;  5BR8 Q;  2JA8 B;  3HEJ A;  3M7N A;  3P1H A;  2VL6 A;  3T1Y L;  1LTG D;  3WOE A;  1H9S B;  2NN6 I;  4R9W A;  1HA6 A;  1KAA A;  2F0Q A;  3S15 H;  4PZ6 A;  1A2U A;  2F0K A;  3PIO A;  4OWW B;  4JI5 L;  2CVR A;  3H91 A;  3T53 B;  4JOI C;  1EY8 A;  1MSH A;  2JP1 A;  3R2T A;  2UUC Q;  4QY7 A;  1FGB D;  1IHZ A;  3BS1 A;  4DF7 A;  5M3F G;  1WTR A;  1XTD A;  3CCU A;  1EY4 A;  2SNS A;  1JOR A;  4FP5 D;  1QVG A;  1TWF H;  2PPB C;  5DM7 3;  5EKL A;  4OEM B;  1FJG Q;  1BBX C;  5FK9 C;  3Q22 A;  3OTO Q;  4AYB E;  4GLX A;  1JOQ A;  4GNX C;  5IIF A;  2Q2I A;  1E1T A;  5CGK A;  2PNH A;  2EPB A;  3FEW X;  4GNX B;  4K0K L;  4ZYS A;  1NNX A;  2R93 H;  2QA4 A;  2KA7 A;  3DWP A;  3VR5 A;  2WAQ E;  5FLX E;  4DV2 Q;  4YCW A;  4RGN A;  1HUN A;  4ZLT F;  4UDU C;  3S17 H;  3K5M A;  4K5V A;  1G8Z D;  1WTO A;  4AYB B;  4BBR B;  2D62 A;  1Y1W B;  5CV5 A;  4O1N A;  3RN5 A;  1HRJ A;  4C3H B;  1GVP A;  1EFW A;  2CWP A;  4NP5 A;  3T1Y Q;  1S72 A;  2EIF A;  3HS0 C;  1STE A;  4S3S A;  5C3W A;  3GTM H;  1NCV A;  2B2V A;  3A0J A;  4OWX B;  5C4Z A;  3CHB D;  4POF A;  4JI5 Q;  4BY1 G;  2WAQ B;  4DR3 L;  1Q82 C;  1WTQ A;  2D5D A;  3D8G A;  3FHW A;  5ISR A;  3MTS A;  1NJI C;  1O80 A;  1VF7 A;  1Q8K A;  4L8J A;  2CW0 C;  1C4Q A;  2KVM A;  5E4W C;  2CH4 W;  1H9J A;  3A55 A;  3FVQ A;  4KKU A;  3HOZ G;  1EYD A;  5JPM C;  2VB2 X;  1PH5 A;  2RHS B;  2Q2U A;  5IP9 G;  3H0G H;  1VQF A;  2HCC A;  4EGV A;  1OO9 B;  3TS0 A;  2F0M A;  5C4X H;  2L11 A;  1V1O A;  2EYM A;  1CHP D;  3CCJ A;  2LKV A;  2KEC A;  2BCO A;  1SDF A;  1STY A;  4EVO A;  2RA4 A;  4IUN A;  4F7X A;  2R61 A;  3F2U A;  4R4C A;  4LFB L;  4C3J H;  2E2H H;  4UHV A;  1WCM B;  4AIM A;  4HMJ A;  3FKI B;  4HJ7 A;  2LXK A;  1BR9 A;  1YVC A;  3DEO A;  1CKO A;  3R93 A;  3F1Z A;  4MTN A;  1SFO H;  2KJX A;  2EY2 A;  3SGI A;  1X56 A;  5LMN L;  1GXD C;  3HOX B;  5IOD A;  1S5D D;  2X6G A;  3A8J E;  1HZ9 A;  4FF4 A;  1D5M C;  2ENB A;  3NQI A;  3BJU A;  1ENA A;  2GN5 A;  4OL7 A;  3PIP 3;  3OHX C;  1CSP A;  4BY7 G;  1QZG A;  4A3D G;  3HZX A;  3U4V A;  2B39 A;  4DR3 Q;  1JCK B;  3A54 A;  1PVO A;  2L9H A;  1Q12 A;  5FLM H;  4ALP A;  1EU3 A;  4BBS B;  2Z6K A;  1JMC A;  4XT1 B;  1CM9 A;  3HRZ C;  3VR4 A;  3EVQ A;  5DEH A;  4RGO S;  1SE3 A;  3M4O H;  1NMG A;  2MGS A;  1ICF B;  5I2X A;  2JQO A;  5H1S E;  2L15 A;  2SDF A;  2E2I H;  1HZB A;  1CTM A;  1JIC A;  1X54 A;  3K5N A;  2CCZ A;  3FRP B;  1XMO L;  2JXM B;  2F0J A;  1D2B A;  4IO9 A;  5DLQ E;  1OXU A;  4DR2 Q;  2QIL A;  3DHQ A;  3BZK A;  4PZ7 A;  1Q1B A;  1I4G A;  3EBE A;  3H6M A;  3KUP A;  1XNR L;  1H9S A;  5KYL A;  2B63 B;  4LFB Q;  2HQE A;  3DWQ A;  1I6H H;  4HCE A;  3QIA A;  4GZY C;  4QL5 A;  3ZJY C;  1YJ9 A;  1SAP A;  4IZ8 A;  1XPU A;  1KAB A;  5KNC A;  1H95 A;  4NW2 A;  3NBH B;  3GV6 A;  2RHQ B;  2BOS A;  3UDF A;  2VQE L;  2DJF C;  1W3S A;  1K73 C;  1ZXT A;  4IQZ A;  4A3E G;  4FXG C;  4ZKB B;  2F4I A;  5LMN Q;  4A3B B;  5AJ3 L;  4A3I H;  1NSN S;  4R4Q A;  2N8N A;  2F0D A;  4NDX A;  1PH1 A;  1B8A A;  4RKL A;  5HGT A;  1M1K C;  3S1N B;  5D3D A;  3LGJ A;  4C1N I;  1PTO C;  1RTN A;  4YCU A;  3U9S A;  1X3F A;  1NTG A;  5CYU A;  3S1Q B;  2Y0S E;  3S9W A;  2ES2 A;  3RNU A;  4JW0 A;  4J6H A;  3M85 A;  1TII D;  1TY2 A;  2RDF A;  1HQR D;  2JA7 B;  2R92 H;  3RLN A;  5DNF A;  4DR7 L;  4KY6 A;  2IT1 A;  3P20 A;  1L1O A;  2O4X A;  3C3L A;  4C3I B;  1BDO A;  3EIV A;  4G7H C;  3I4O A;  5C3E B;  1QUQ B;  4YWK A;  1Y1V B;  3OW7 A;  1LT5 D;  4RWS C;  1CKN B;  2XWJ B;  1XMO Q;  3GTO B;  4TVA B;  4A3G H;  2Y0S B;  3HKZ E;  4DA2 A;  2RSO A;  1XNR Q;  3L7Z C;  2OF1 A;  4LF5 L;  3I4N G;  3GQB A;  4JI7 L;  2B2U A;  3KBG A;  1BQQ T;  5JJZ A;  3NSW A;  1RL2 A;  3PUY A;  2PQA B;  2DY8 A;  4Q5V A;  3CKI B;  4IPC A;  4A3K H;  3VR3 A;  4LF6 L;  2VQE Q;  3I56 A;  4LJZ C;  2CHB D;  5AJ3 Q;  5T1G A;  4XTC S;  4CJ0 B;  1STN A;  4DV0 L;  2K32 A;  3PUZ A;  3MHB A;  4IAL A;  1SND A;  3AU7 A;  5LMN W;  2JJQ A;  3S14 B;  1VQG A;  4OX9 L;  1HZC A;  3L0O A;  3RZO B;  2K28 A;  3Q23 A;  3D4W A;  4DGZ A;  1C0A A;  1PFN A;  4DR7 Q;  2PMZ E;  2VZA A;  1B70 B;  5KRU A;  2CWA A;  2AWO A;  2F0L A;  2XRQ D;  2B3G A;  4JBJ A;  3S2H B;  3RZD B;  5A2Q E;  2F0U A;  2K50 A;  3KF6 B;  4B3R L;  4FF2 A;  1LTS D;  1J6Q A;  4XXE A;  3R2I A;  4A3M B;  1JR0 D;  1J9O A;  1SN8 A;  2Z1C A;  2ZXO A;  2K5Q A;  3BVZ A;  3OWE B;  2K5W A;  4LF5 Q;  1VQM A;  4P74 A;  2L12 A;  4DNR B;  2K01 A;  4JI7 Q;  1KD1 C;  2PMZ B;  1TWA B;  1WTW A;  3HOV B;  1VQD A;  1UEB A;  3BVG A;  1BBU A;  1FNV A;  1DON A;  3FPU B;  4DPG A;  3ULL A;  1PH9 A;  1ET9 A;  3OOC A;  2ZM6 L;  4LF6 Q;  4L5R C;  4Y7N H;  4C3H G;  1V1P B;  2MHV A;  5EPK A;  2AMC B;  2R7D A;  5IP9 H;  2I5H A;  2F0G A;  4IUP A;  3NXW A;  2N49 A;  3WWV A;  5D14 A;  1K83 B;  3I4L A;  1X9N A;  5COR A;  4C1N K;  1MIU A;  3J80 i;  2IHF A;  2ICI A;  2NB0 A;  3KLS X;  2CQO A;  3MEH A;  2R93 G;  1I5F A;  1YNN C;  1NAP A;  3S16 H;  2XIW A;  4X3U A;  4CKE A;  1BCP C;  1ZYR D;  1IYU A;  4A3J H;  3J7A V;  1AH9 A;  3SXH A;  1X3Q A;  2L0C A;  5GAH C;  1Y14 B;  5IT9 c;  1CZW A;  2NTT A;  1D1K A;  3D4D A;  4ZQ3 A;  1EIY B;  1I4H A;  4XIG S;  4DAP A;  2I5L X;  4BA1 I;  2K5H A;  4B3R Q;  2K05 A;  3NBH A;  3GTK B;  3GTL B;  1I6V C;  2WB1 G;  1C9O A;  5CC4 A;  1EOV A;  4PG3 A;  1LV9 A;  3A8K E;  1C48 A;  3G48 A;  5ELF A;  4L5T A;  1NY4 A;  2AWN A;  5BN4 A;  1SNM A;  1VMP A;  1JWU D;  5G3L F;  1B50 A;  1W6J A;  3BG3 A;  1UWV A;  5CV8 A;  5C0X G;  4B3S L;  1HTL D;  1MBY A;  3C1F A;  4UAI A;  4RMF A;  4GOP B;  2F0I A;  2ZM6 Q;  2FHT A;  4L6T B;  1KC8 C;  2EXD A;  3H0G G;  1HA5 A;  2Z4I A;  2CFM A;  1A63 A;  5IGD A;  2DJG C;  4M1U B;  1ICW A;  2NVY H;  1EEF D;  4N9P A;  4QUF A;  5JJK A;  3KJP A;  2OTJ A;  4QQB X;  3K59 A;  2F3V A;  3Q24 A;  1QUQ A;  1L0W A;  1HHV A;  1L0Y B;  2AQ2 B;  2IX0 A;  3I2Z A;  3NTK A;  5IGC A;  3GTP H;  2ZTE A;  3J81 L;  3NWT A;  1AFP A;  3PF4 A;  4LMQ D;  2EJG C;  3ICE A;  1NMF A;  4JI3 L;  1WOC A;  3NK9 A;  4PQX A;  3K5L A;  2B8G A;  4LUO A;  1XMQ L;  1KL9 A;  2JN4 A;  3CCQ A;  3STB C;  1A3U A;  5M5X H;  2DY7 A;  2PQA A;  1E22 A;  1QJO A;  3A56 A;  5JOB A;  1RCV D;  3MZ5 A;  4HED A;  4H7B A;  2H5X A;  1F2Y A;  2B2V C;  2WII B;  1YJW A;  1XJV A;  5ELB A;  2OTL A;  3OIQ A;  1LT3 D;  3TRZ A;  3J7Z C;  4WJ4 A;  1X3P A;  4B3S Q;  1IYV A;  4IN3 A;  2F0T A;  1HFN A;  2IWH A;  1KTK A;  1O7Z A;  4DR1 L;  3H3V H;  3CMA A;  2J7Z A;  4XQJ A;  1TWC B;  3GTG B;  3K7A H;  4G7O C;  4JG2 A;  1K28 A;  3HOU B;  3K80 C;  2HT1 A;  3S2D B;  1GUW A;  1KIX A;  3AB9 A;  1KLG D;  3SR1 A;  1XPO A;  1ILP A;  2E2J B;  4HJ9 A;  2BDO A;  4ZKC B;  4ABN A;  4HIM A;  2OQK A;  1I50 B;  3HFZ B;  3M4Y A;  2Q8T A;  3KF8 B;  4GS3 A;  3I4N H;  1SMY D;  2RKS A;  3MA2 B;  4CKB A;  3LWU A;  5C0X J;  4IUQ A;  4JI3 Q;  2R7Z B;  1PFM A;  3J7A 5;  3PGZ A;  1SE2 A;  2JA8 H;  2B2W C;  2NVX B;  1XMQ Q;  4TQU S;  4TSS A;  1Y1V G;  4HJA A;  1F2Z A;  5ELN A;  1AW7 A;  3IRB A;  2DNC A;  1W2B A;  3ZYY X;  2K52 A;  2JEA I;  1B7Y B;  1P8L A;  4P2C B;  2A19 A;  1VQA A;  3HKS A;  1UE6 A;  4JI2 L;  4CHT B;  2EY1 A;  2LMC B;  5FLX c;  2XVS A;  1HQM C;  2K4K A;  4L5S A;  1OTC A;  3PO3 B;  4DN4 M;  4ODG A;  2JYO A;  1WTX A;  4KKT A;  1QE6 A;  3D6W A;  4KN7 C;  4QIW E;  1CUK A;  4DXG A;  3ITP A;  1EY5 A;  3CU7 A;  1AE3 A;  1R4Q B;  3DMU A;  4DR1 Q;  2NZO A;  3CCR A;  1EY7 A;  1KRT A;  1YEZ A;  4EX5 A;  4CBV A;  2K04 A;  3GP7 A;  5CV7 A;  3LWE A;  2F03 A;  3HGB A;  1ESF A;  4OO1 I;  1VQJ A;  2NN6 H;  4X62 L;  4A3G G;  3QOJ A;  3S1M B;  2HIX A;  3PUW A;  4H02 A;  1YIJ A;  1U5K A;  4PV1 C;  3VYU A;  4QIW B;  3CCS A;  4ZUJ A;  1VQ8 A;  4XQQ A;  5IP7 H;  1EY9 A;  5JEA J;  4JV5 L;  2AQ1 B;  4A93 B;  2UXC L;  4OON A;  3MFG A;  1SYC A;  2F3I A;  1Q46 A;  4A3K G;  3MC0 B;  1X3G A;  1Q81 C;  4YY3 L;  2ASB A;  1Y1W H;  1VQP A;  4QGU A;  4C3H H;  2JA9 A;  2D9U A;  4HIK A;  4N8X 1;  1YJN A;  4GKJ L;  3CCL A;  3KK7 A;  1LO5 D;  4GOP A;  4IUU A;  4A3M G;  1HXY D;  3UDG A;  3C2P A;  2A8V A;  5KYI A;  2PCF B;  4JI2 Q;  5C4J B;  1BXT A;  1MJC A;  1U9R A;  2EZV A;  5EJW A;  2K14 A;  4ZK9 B;  5AFW A;  2RQX A;  4HCS A;  4X65 Q;  1KDA A;  3A5Z B;  4C2M B;  2JE6 I;  2PQE A;  4RAU C;  1VQE A;  2ICE C;  5JAV A;  1KRS A;  5EKK A;  1E0B A;  4P72 A;  3W3A A;  3ULJ A;  2NUC A;  5HGQ A;  3SK6 A;  5CV4 A;  2XWB B;  4DV6 L;  1N8R C;  1B44 D;  3E5S A;  3BDC A;  1HNW L;  3N52 A;  1D5Z C;  1SLJ A;  1F77 A;  3ER0 A;  1ROD A;  5IYD G;  1CA5 A;  5D3I B;  4X62 Q;  3C46 A;  1VQ4 A;  1VDZ A;  3PIP A;  3I3C A;  4BWG B;  1X6O A;  1EWI A;  3I90 A;  1M90 C;  4ZUI A;  4KMU C;  1WCM H;  3BVM A;  3OPO A;  4UP9 A;  3J7A F;  1HNX L;  1JWS D;  2EYJ A;  1QZH A;  2E75 C;  3FKI H;  3URY A;  5C0X H;  1GUN A;  1SRU A;  2YTX A;  1YBY A;  1DXM A;  5KEE A;  1EZ6 A;  4KN4 C;  3TP5 A;  2P5Z X;  4RG1 A;  1DD2 A;  4HJ8 A;  3KOJ A;  3HOX H;  2IPK D;  5I4D A;  2XTI A;  3VYS A;  4U68 A;  4GKJ Q;  3T13 A;  1EOT A;  1VQO A;  1A3V A;  3CPF A;  1C7Y A;  5BN5 A;  2K33 A;  1H9K A;  2QGQ A;  4K0K Q;  1K9M C;  4FF1 A;  1GOZ A;  1YHQ A;  1F9R A;  4BBS H;  1A62 A;  3CQZ B;  3S17 B;  3SK5 A;  1DJR D;  3KJO A;  2JA5 B;  1QWY A;  1GJX A;  3AYH B;  4A3J G;  2RBM A;  3CF5 A;  3Q0A A;  3KF8 A;  4DV4 L;  3D3R A;  3G6J B;  2Q8I B;  2X69 A;  2RDG A;  4QJF A;  3EFX D;  1EQT A;  4DV6 Q;  5M3M B;  2B2T C;  1LT4 D;  1HNW Q;  3CXC A;  4A76 A;  1YNX A;  1KDB A;  2ATW A;  5K5P A;  2F0O A;  2PI2 E;  5LMU L;  4P73 A;  1E3P A;  2MNA A;  1MJE A;  2C5C A;  1IYJ B;  4KLK A;  2A73 B;  4IOC A;  4CJ2 C;  1HR0 L;  1PH8 A;  1F2L A;  5M5Y B;  2L4N A;  5EBC A;  4DUY L;  1IXR A;  2B63 H;  1MGS A;  5JEA H;  5K36 H;  2F0E A;  2WV6 D;  1LLR D;  4LF9 L;  2IX3 A;  2NVQ B;  1IKM A;  1RIP A;  1A0I A;  1HNX Q;  1S5B D;  4DU9 A;  1U4M A;  1LTA D;  1Q1E A;  1N9W A;  1MHW C;  4MNO A;  2JEB I;  2G9H D;  1WD1 A;  2HHH L;  5T1I A;  5A2Q L;  1K8O A;  3CRL C;  1SNO A;  4QB4 A;  5I2Y A;  4LAA A;  5J1Z A;  2KCT A;  4QUC A;  3CAM A;  4DR5 L;  2Q2H A;  3S1N H;  2EYO A;  3NP8 A;  4KJO A;  2EVB A;  1PRT F;  3G7L A;  3NUC A;  3A7L A;  4HIO A;  3S1Q H;  2ZTC A;  3FDT A;  1LUZ A;  5C44 B;  3ONA B;  5CV6 A;  4IFD I;  2F0H A;  4R8I A;  3BZD B;  1G2S A;  5J22 A;  5BN3 A;  2JA7 H;  3S1R B;  1K3B C;  1YHB A;  1E2Z A;  2BH8 A;  4C3I H;  4DV4 Q;  5EPL A;  1IBM L;  4JOI A;  2SOB A;  1GUS A;  1HFG A;  1Y1V H;  4G57 A;  4OEL B;  1SYB A;  1EIF A;  1SJH D;  1R9T B;  3GTO H;  3IFT A;  2M2L A;  2I0Q A;  5LMU Q;  4HN7 A;  4LFC L;  1GUG A;  4JBM A;  3GTJ B;  4BXX H;  2WFW A;  1HR0 Q;  5J3B A;  2RDH A;  4O2D A;  1PTO B;  4DUY Q;  3CC7 A;  1LTI D;  4IJH A;  1GHJ A;  3U4Z A;  4DK6 C;  3CCV A;  3HOY B;  1PYW D;  1IW7 D;  4IPD A;  5CR3 A;  4LF9 Q;  2WAC A;  4GNX A;  3R8B A;  1IKL A;  3D6C A;  4NXM L;  3E9H A;  3MEF A;  2H1E A;  1IBL L;  3H15 A;  1V8Q A;  4DNT B;  4FNF A;  2HHH Q;  5LL6 S;  3SEB A;  1GM5 A;  2IL8 A;  1XWE A;  4A3F G;  4N9T A;  3HOW B;  4X64 L;  4YCV A;  1WD0 A;  2F0F A;  4ULL A;  3SE0 A;  1X3E A;  2QCP X;  1WTV A;  4DR5 Q;  2UUA L;  3F8T A;  1Z47 A;  4JC0 A;  1M4V A;  5ELD A;  2OWO A;  2NBF A;  3S14 H;  1K8M A;  4ID6 A;  3P75 A;  2KHS A;  3I91 A;  2AUK A;  4GLA C;  2WKD A;  1II3 A;  5CBE E;  4CJ1 B;  3RZO H;  3JAM L;  4CKC A;  1SYF A;  4R4I A;  1SJE D;  3NEL A;  1BF4 A;  4Y52 H;  4A3I B;  4KD3 A;  2IHE A;  3S2H H;  2UXB L;  2VY3 A;  5G3L D;  3X3M A;  2VUM B;  3RZD H;  1IBM Q;  2JA8 G;  1J8I A;  4KJN A;  1S4Z A;  3RN2 A;  3UDI A;  1JWM D;  1BOS A;  1ZYR C;  1N34 L;  1IL8 A;  2I07 B;  4OXP A;  4CDD C;  1SSO A;  3HKZ B;  1EZ8 A;  3CP0 A;  5I9O A;  5IE8 A;  4A3M H;  3FMC A;  3IL8 A;  4LFC Q;  4JPB W;  2EJF C;  1ONL A;  1OXV A;  2B29 A;  2F0V A;  1EWC A;  4X3S A;  2E8G A;  1SNP A;  5EKI A;  4A93 G;  2RF4 A;  2F3W A;  1TWA H;  1VQ7 A;  1K3R A;  4FF3 A;  1HR0 W;  4JI0 L;  2EJM A;  4NXM Q;  1KLU D;  2ID0 A;  1IBL Q;  3F2C A;  1I3Q B;  1BVS A;  4DUZ L;  1SNQ A;  4APV A;  2F1M A;  5IT9 L;  4M8A A;  4X64 Q;  3CRK C;  1KHI A;  5D65 A;  2YU9 B;  2NN6 G;  2EXZ A;  3J81 j;  3T1H L;  3M4Q A;  5IYD H;  2UUA Q;  2R3Z A;  4PZ8 A;  3W5O A;  4ZCK A;  1B1Z A;  3TEH B;  1RKN A;  3W2D A;  1CSQ A;  2O5J C;  5M3F B;  4HSV A;  4P71 A;  1HH2 P;  2KHJ A;  3VYR A;  4RCN A;  2F0S A;  4A75 A;  1KAW A;  5KNB A;  5IP7 G;  1JJC B;  1YZ6 A;  3M4P A;  1STG A;  3PUV A;  1XXG A;  5DM6 3;  4AYB G;  2UXB Q;  1LAB A;  4BBR G;  1Y1W G;  1PFS A;  4JBK A;  3D0F A;  1AE2 A;  1RHP A;  4Q0F A;  1ENF A;  1Q90 A;  4O42 A;  4DAV A;  2HD3 A;  1MSG A;  1N34 Q;  1SXT A;  4IUT A;  3GTK H;  4K2K A;  3GTL H;  3OSO A;  4XYO A;  4DV0 Q;  4PNY A;  3VA7 A;  1LTT D;  3S24 A;  2WAQ G;  1PDQ A;  1CHQ D;  2WIN B;  2EQS A;  1JB7 A;  2PI2 A;  4OX9 Q;  4B3M L;  4B3T L;  3CME A;  3X3N A;  1O7L A;  1TT2 A;  5IGE A;  1QNK A;  4JI0 Q;  3GTQ H;  3TQY A;  2E2D C;  1BCP B;  5E4X A;  4NB3 A;  1K0R A;  3RD4 A;  2PNR C;  5HUR A;  1YNJ D;  1SBB B;  1A3T A;  1T5E A;  4HSP A;  3J80 c;  4DUZ Q;  2NVT B;  2MFI A;  2B2Y C;  1ML0 D;  3TRE A;  1JE5 A;  1G51 A;  3Q8D A;  1K8G A;  3CC2 A;  3QJY A;  4BY1 B;  4POG A;  1Q7Y C;  3RLF A;  3T1H Q;  4OIK A;  1UE1 A;  3FP9 A;  2Z8L A;  3DM3 A;  1ZEQ X;  5GAD C;  1TR5 A;  3PO2 B;  5IYB H;  3DWA A;  4DR4 L;  1LTL A;  2K6A A;  1JJ2 A;  1G6P A;  4ILW A;  3HG9 A;  5M5W B;  1WCM G;  4DAY B;  2A69 D;  1FNW A;  1HTP A;  2Z4H A;  1PH4 A;  1D1I A;  3HOZ B;  1VQ6 A;  3FKI G;  5HY6 A;  2K7V A;  3K8A A;  2BA0 A;  2IJ0 A;  4FVM A;  1DYQ A;  1PZK D;  3W1B A;  5M3M G;  2CQA A;  1NBW A;  4XDX A;  3L2P A;  4J8Q A;  3HOX G;  4JI4 L;  2PO4 A;  1TQO A;  4HMI A;  1SMY C;  1JB3 A;  3OMG A;  1SR3 A;  3EJI A;  3AMU A;  2M9V A;  1FNU A;  3L9A X;  4KHP L;  2EYF A;  1WI5 A;  3LNN A;  5C5L A;  1BKB A;  5EPJ A;  3KYH C;  4YHH L;  3TN2 A;  1Y8N B;  2NTS A;  2F0N A;  4B3M Q;  4P75 A;  1BO0 A;  1SRO A;  4BBS G;  4YIJ A;  4B3T Q;  1B53 A;  1CKN A;  5KIX A;  4R8N A;  4DFA A;  4CDF C;  2R6G A;  1LAC A;  4HAE A;  2EYP A;  4K5X A;  1PZJ D;  1SE8 A;  1K8A C;  1TWC H;  3HP3 A;  3T16 A;  3GTG H;  2AUJ D;  3KLS A;  3RR5 A;  4UY8 C;  3UI2 A;  2RVL A;  3WDN A;  3HOU H;  4BY7 B;  3S2D H;  3T4A C;  4XYQ A;  3J80 E;  4A3D B;  3I4M B;  2X6L A;  1UEA B;  4F87 A;  2E2J H;  3EQL C;  4ME3 A;  2A6E D;  1I50 H;  1PTO F;  3H09 A;  3ND9 A;  3MXP A;  4DR4 Q;  1BUV T;  2HCI A;  5I9P A;  2VS1 A;  3EN2 A;  5ELC A;  2B63 G;  5FLX L;  5FO9 B;  4G4K A;  5JEA G;  5K36 G;  4WFN 3;  2FIN B;  1SNC A;  2JK8 A;  4MN3 A;  3TS2 A;  2N88 A;  1VQI A;  2N55 A;  4R4O A;  5I6Y A;  1A2T A;  4KHV A;  4FXD A;  4V19 0;  2A1A A;  3RLO A;  2R7Z H;  4DAM A;  3KDF B;  1X55 A;  3TP7 A;  1TWG H;  3MVV A;  2NVX H;  2VNU D;  2MUY A;  4A3B G;  3MWY W;  1PYB A;  4JI4 Q;  1CQF A;  4A3F H;  4CGY B;  1FL0 A;  2KQ3 A;  4RKB A;  2D0P A;  3PUX A;  3I70 A;  3KBX A;  4KHP Q;  1FR3 A;  2UUB L;  3NE5 B;  2R7F A;  2O5I C;  1U4P A;  3PO3 H;  4YHH Q;  4LFA L;  1N32 L;  1CK1 A;  3H3V I;  1B2T A;  2LS0 1;  3KF6 A;  4UP8 A;  4DKA C;  4DK1 A;  2IX1 A;  1AEX A;  3K58 A;  2JSO A;  4RCO A;  2JA7 G;  1E2W A;  2A6H D;  4FO2 A;  3J81 i;  2KCN A;  2A74 C;  4LF4 L;  3O13 A;  4IJL A;  1TU2 B;  4IOA A;  2V1C C;  4A3E B;  4K14 A;  4C3I G;  1CKM A;  1RJT A;  3HOW G;  1EQV A;  1C8C A;  5FO7 B;  5C3E G;  1PYS B;  3D31 A;  1UE7 A;  1TWH B;  3TP6 A;  3TSS A;  3GV3 A;  1RTO A;  2Y0S G;  3S1M H;  4DK3 C;  4I7Z C;  4IPH A;  4E6I A;  4BXX G;  2QDL A;  1PHJ A;  1CQV A;  3UE1 A;  1V1P A;  5C5M A;  1VMC A;  2KEE A;  1K0S A;  1SEB D;  2L1B A;  3H3V C;  1DCZ A;  4A93 H;  3QOL A;  4FYD A;  1QB5 D;  2DN8 A;  4EQO A;  3SVM A;  2H4O A;  5CV9 A;  1VCI A;  2KUM A;  2WKC A;  2Z6K C;  2VW9 A;  1B3Q A;  2NZH A;  2MP1 A;  2XRS D;  1T9H A;  4KI0 A;  1GO3 E;  3HKZ G;  3DLL A;  2ZXP A;  4ZAI A;  1S3O A;  2QDB A;  1IZ6 A;  4AQY L;  1D7Q A;  5C4J H;  1BNZ A;  2ZT9 C;  4MZ9 A;  4MHE A;  1P16 A;  4LFA Q;  1N32 Q;  3M3Y B;  1YHA A;  1A8V A;  2L5T A;  1JE4 A;  4C2M H;  1ENC A;  3K7U C;  3T51 B;  2JA6 B;  4LF4 Q;  2HUG A;  4QCL A;  3IAY A;  3G6E A;  3UDX A;  3A7A B;  2Z9H A;  1ASY A;  4BBR H;  5GQO A;  4DAY A;  4LF8 L;  3P7J A;  3VA5 A;  1ESR A;  1G6Z A;  3NEN A;  2LY7 A;  3ERO A;  1UUP A;  3PV0 A;  1VS0 A;  2FMC A;  2RCN A;  3NHH A;  4A3C G;  5IWA L;  1TVX A;  2A68 D;  2LSS A;  3QR8 A;  3J81 E;  2MQH A;  3MFY A;  1VQN A;  1PRT D;  2LFN A;  2XSC A;  4KV6 A;  3HOV G;  4IFD J;  1PH7 A;  2K1B A;  3AFP A;  2J0T D;  1BCP F;  2RCF A;  4RGT A;  4UPA A;  1HZA A;  1SYG A;  4DV5 L;  2OEO A;  5LHY 1;  3SK8 A;  1E1O A;  4K2L A;  3RMH A;  2BE5 D;  2YTY A;  3I73 A;  4LNQ A;  4B9W A;  3S15 B;  2KCC A;  2YV5 A;  4NXN L;  1PZI D;  1L1O C;  4GKK L;  3IFD A;  4XT3 B;  3D4R A;  1L1O B;  2D0O A;  4A4I A;  1S5C D;  5IYC G;  5KGU A;  1LTB D;  1Y8O B;  3I72 A;  3QO2 A;  2PZU A;  2FJ2 A;  3VR6 A;  4AQY Q;  2HIV A;  1MKH A;  1V43 A;  3QWN A;  1KXL A;  1T5X D;  1XYI A;  3DUZ A;  4DNI A;  3KLR A;  4KK7 A;  2SEB D;  3A8I E;  3CQZ H;  4NMZ A;  2F52 A;  2JA5 H;  1TWF B;  3E3X A;  2MO1 A;  4JV5 Q;  2UXC Q;  5E1F A;  3DXJ C;  2MPM A;  2B2U C;  4QF4 A;  4H44 C;  2QF7 A;  3IKJ A;  1H9M A;  1I4R A;  1GUO A;  1WYD A;  5M3M H;  1V9P A;  4YY3 Q;  4LF8 Q;  3MXG A;  4J1M A;  3PIO 3;  1GHK A;  2VXW A;  1V1Q A;  4JCV E;  1DOM A;  1D8L A;  1KNE A;  1TS4 A;  2KOL A;  3KDF A;  2R93 B;  4TKO B;  2PZW A;  5ELE A;  2DUD A;  3F2D A;  3PO2 G;  3K57 A;  2WB1 E;  1X65 A;  1JOO A;  5IWA Q;  5M5Y H;  5C0X I;  1TS2 A;  2AQ3 B;  1RD9 D;  4PMC A;  4N8F A;  4WRD A;  5JVG 3;  4KY7 A;  4R1J A;  3BZC A;  3GDE A;  2KEN A;  3E6Z X;  5C4H A;  1Z7T A;  2NVQ H;  2YTV A;  1TS5 A;  4MTK A;  5IOC A;  1TY0 A;  2WP8 J;  4DV5 Q;  2FFK B;  1HJP A;  3AQQ A;  3SK4 A;  1Q86 C;  5JPN C;  3ND8 A;  4LK1 C;  4DR2 L;  3GTM B;  1Z6H A;  4NXN Q;  2UXD L;  3M9B A;  4GN4 B;  1IW7 C;  3OIP A;  2WB1 B;  2AHO B;  4GKK Q;  1AP0 A;  2E76 C;  3NQT A;  3A5U A;  3R3O A;  5IYB G;  3N6R A;  2MJ8 A;  4J15 A;  2B2W A;  5C44 H;  1NE3 A;  1WFQ A;  2PW7 A;  4GN5 A;  2F4V L;  3S1R H;  1L2F A;  3NBI A;  3CD6 A;  1XTC D;  2ZJR A;  4FXK C;  2ZTD A;  3H0G B;  5C3X A;  1U0L A;  1O7Y A;  2KHI A;  1EIG A;  4RGM A;  1CA6 A;  3DEP A;  5C4X B;  4A3B H;  3B6Y A;  4L63 B;  4I7A A;  1EYA A;  3I4M G;  3K0Y A;  1LTR D;  1R9T H;  2ZJQ A;  4F8M A;  2Z6B A;  1EEI D;  1EY0 A;  1F9Q A;  1A6X A;  3GTJ H;  4C3J B;  2E2H B;  1DGS A;  1ET6 A;  3TME A;  1SE4 A;  1PTO H;  1RDP D;  3GD7 A;  3E0J A;  1FVI A;  3HOY H;  4IFD H;  1QVC A;  2N3S A;  5FOB B;  5FJ8 G;  1SFO B;  1H9R A;  1DM0 B;  2E5L L;  1MI2 A;  3NTH A;  2XNA C;  4JI1 L;  2OT2 A;  3G71 A;  5GRO A;  3HOW H;  1SYD A;  5FO8 B;  4RA8 A;  1OXS C;  2UXD Q;  5C3E H;  3HOU G;  2CW0 D;  1EWH A;  2FXQ A;  5IGB A;  2GVA A;  4GN3 B;  2EYH A;  4IUV A;  1Y69 U;  4FDB A;  1CZG A;  1W6K A;  1VF5 C;  2XGT A;  1HCZ A;  1O7I A;  5CMD A;  3PCO B;  4JK1 C;  3OMC A;  2VQF L;  5FKA C;  5EAY A;  3PF5 A;  2F4V Q;  3M4O B;  2DNE A;  1GUT A;  1XNQ L;  5M9O A;  1DOK A;  3KLW A;  4JYA L;  3CW2 C;  2R7Z G;  2E2I B;  5JJI A;  2VUM H;  4DV3 L;  4WJ3 M;  3DM1 A;  4F88 A;  1PH6 A;  3GO5 A;  2ZXR A;  5DAU A;  4LW1 A;  1VQ9 A;  4OHJ A;  1F9P A;  3M7G A;  4K6D A;  4A3L H;  1QNU A;  2OQ0 A;  5GAG C;  1I6H B;  3PO3 G;  1STB A;  4QMG A;  4K8I A;  1TS3 A;  1X32 A;  1B3A A;  2HDL A;  4TRD A;  2F0W A;  1D5X C;  1KNA A;  2E5L Q;  1NR2 A;  1JC7 A;  1I3Q H;  5A35 A;  3OYY A;  2KBN A;  4ME5 A;  4JI1 Q;  1OXT A;  2GVB A;  3TZD A;  4C56 C;  2G9D A;  3TP8 A;  4KTA A;  2I5M X;  4OWT B;  3BYT B;  1EU4 A;  2PZT A;  2YU9 H;  5IY0 A;  4CDC C;  5COY A;  3QG1 A;  3BU2 A;  1VQB A;  3BYY B;  4XQN A;  4DV1 L;  3NTI A;  5JJL A;  4A3C H;  1YNJ C;  5M3F H;  2EY6 A;  4EQP A;  5E3F A;  3ERS X;  5IGF A;  1GKH A;  1WTH A;  2R92 B;  2Q2T A;  2VQF Q;  3Q6S A;  3V96 A;  2EE1 A;  4DV7 L;  1FYC A;  5F2D A;  1J5E L;  2JA6 G;  3HOV H;  2C9O A;  1ASZ A;  1Z9F A;  5CBA E;  4RH6 A;  3NPP A;  1NR4 A;  1XNQ Q;  2EDG A;  2K5D A;  4JYA Q;  2UU9 L;  4LUZ A;  1SYE A;  4DV3 Q;  4KY5 A;  2OCE A;  2Q8R E;  3SDZ A;  3FPP A;  3J80 L;  4A3G B;  2A69 C;  1IBK L;  2Z0S A;  1KDC A;  2MO0 A;  1K83 H;  1WJJ A;  1E2V A;  1DOL A;  3KFU A;  2CKZ B;  4OO1 G;  1FD7 D;  4LWC A;  5IYC H;  1U4R A;  4BS9 A;  2G5D A;  2NZ1 D;  1QIL A;  2AKW B;  1QG7 A;  1G2T A;  1EL0 A;  1JJG A;  3VDY A;  1PFB A;  3JAM i;  2B2T A;  2B8F A; 
#chains in the Genus database with same CATH homology
 1I50 H;  2L15 A;  2E2I H;  3CCM A;  4GOP A;  4A3M G;  1HZB A;  4DR4 Q;  3UDG A;  2VS1 A;  3EN2 A;  1X54 A;  4NPS A;  5GAE C;  2A8V A;  2B63 G;  2CCZ A;  1EQQ A;  4JI2 Q;  3AEV A;  5JEA G;  1MJC A;  5K36 G;  1XMO L;  2JK8 A;  2K14 A;  3TS2 A;  1VQI A;  4IO9 A;  5DLQ E;  1OXU A;  4R4O A;  3UE0 A;  4DR2 Q;  4AH6 A;  2NVT H;  4DR6 L;  3BZK A;  1PV4 A;  4PZ7 A;  1Q1B A;  2A1A A;  3EBE A;  3RLO A;  4X65 Q;  1XNR L;  2R7Z H;  4DAM A;  3A5Z B;  1X55 A;  3KDF B;  1TWG H;  2JE6 I;  2NVX H;  2VNU D;  4KHZ A;  3JAM c;  4BY1 H;  3F2B A;  1VQE A;  1KRS A;  4A3B G;  4LFB Q;  1I6H H;  1PYB A;  4P72 A;  3ULJ A;  5HGQ A;  4JI4 Q;  4A3F H;  4QL5 A;  1FL0 A;  3MXN B;  3ZJY C;  4DV1 Q;  1YJ9 A;  3PO2 H;  1XPU A;  4DV6 L;  1VQK A;  2D0P A;  1N36 L;  4L5Q A;  1YIT A;  1N8R C;  3PUX A;  1H95 A;  1HNW L;  3NBH B;  2RHQ B;  1SLJ A;  3UDF A;  2UXB L;  2VQE L;  4KHP Q;  3ER0 A;  1K73 C;  1W3S A;  5M5W H;  5IYD G;  2UUB L;  2QEX A;  4A3E G;  1PH2 A;  2R7F A;  1EYG A;  5LMN Q;  4DV7 Q;  4X62 Q;  5AJ3 L;  1N33 L;  4YHH Q;  4A3I H;  4LFA L;  1VQ4 A;  4R4Q A;  2N8N A;  1J5E Q;  2BH2 A;  3KF6 A;  3H3V I;  4JI8 L;  4UP8 A;  4X66 L;  4DKA C;  3PIP A;  1PH1 A;  1B8A A;  2IX1 A;  1M1K C;  2JA7 G;  2UU9 Q;  1X6O A;  3LGJ A;  3J81 i;  1EWI A;  4YCU A;  1X3F A;  1M90 C;  4LF4 L;  1NTG A;  4IJL A;  4IOA A;  1WCM H;  2V1C C;  2Y0S E;  4UP9 A;  2ES2 A;  1CKM A;  3RNU A;  1HNX L;  1QZH A;  3FKI H;  1IBK Q;  3HOW G;  1SRU A;  3M85 A;  2K5V A;  2YTX A;  4O0A A;  4PMW A;  1YBY A;  5C3E G;  2R92 H;  1VQH A;  4EQ5 A;  3RLN A;  1PYS B;  3D31 A;  4RG1 A;  1UE7 A;  4HJ8 A;  4DR7 L;  2IT1 A;  3KOJ A;  3HOX H;  1L1O A;  2Y0S G;  3S1M H;  2XTI A;  4DK3 C;  4IPH A;  4GKJ Q;  4BXX G;  3EIV A;  1PHJ A;  3UE1 A;  2JA5 G;  2K75 A;  1VQO A;  3I4O A;  1BBW A;  3CPF A;  1C7Y A;  1QUQ B;  4YWK A;  2QGQ A;  4A93 H;  1CKN B;  3U50 C;  4K0K Q;  1XMO Q;  1K9M C;  3G4S A;  4TVA B;  1YHQ A;  2BA1 A;  2LXJ A;  1I94 L;  4GLV B;  4A3G H;  1EQR A;  3HKZ E;  5ELO A;  4BBS H;  1A62 A;  1VCI A;  2KCM A;  3KJO A;  4DR6 Q;  1LM0 A;  1XNR Q;  3L7Z C;  2Z6K C;  3CPW A;  3I7F A;  4YWL A;  3OW2 A;  4LF5 L;  3I4N G;  4BY7 H;  3AYH B;  2VW9 A;  4A3J G;  4JI7 L;  3CF5 A;  4A3D H;  1UE5 A;  2NZH A;  1RL2 A;  3I4M H;  4DV4 L;  3PUY A;  1T9H A;  1VQC A;  4KI0 A;  1VQL A;  1GO3 E;  2PQA B;  3E9I A;  3HKZ G;  4QJF A;  3DLL A;  4DV6 Q;  1N36 Q;  4IPC A;  2DGY A;  4A3K H;  4LF6 L;  1S3O A;  1HNW Q;  3CXC A;  1IZ6 A;  4GOP C;  4AQY L;  1HNZ L;  1D7Q A;  4A76 A;  5C4J H;  2VQE Q;  3I56 A;  1YNX A;  4MZ9 A;  2ATW A;  5LMU L;  2PI2 E;  4P73 A;  1E3P A;  2MNA A;  1P16 A;  5AJ3 Q;  1MJE A;  4LFA Q;  1N33 Q;  1N32 Q;  1IYJ B;  4KLK A;  5FJ8 H;  1HR0 L;  5E7N A;  4XTC S;  4JI8 Q;  4X66 Q;  4IOC A;  1PH8 A;  4DV0 L;  1YHA A;  1A8V A;  3PUZ A;  4DUY L;  1IXR A;  4C2M H;  3K7U C;  3E0E A;  5LMN W;  2B63 H;  5C4X G;  1OXX K;  2JJQ A;  4LF4 Q;  1VQG A;  4OX9 L;  3G6E A;  1HZC A;  3UDX A;  4LF9 L;  3L0O A;  1RIP A;  1A0I A;  1ASY A;  2K5N A;  1HNX Q;  4LF7 L;  4YWM A;  5GQO A;  4BBR H;  4LF8 L;  1JT8 A;  1Q1E A;  1QVF A;  4R4T A;  1N9W A;  2HHH L;  4MNO A;  1EUJ A;  2JEB I;  4JI6 L;  3NEN A;  1C0A A;  2C35 B;  4DR7 Q;  2PMZ E;  2VZA A;  1B70 B;  1VQ5 A;  3PV0 A;  2CWA A;  1VS0 A;  3ULP A;  5C44 G;  2AWO A;  2RCN A;  1G29 1;  2B3G A;  2KCT A;  4JBJ A;  4A3C G;  5IWA L;  3CAM A;  4DR5 L;  2Q2H A;  3S1N H;  2LSS A;  1E7Z A;  3K0X A;  1IL2 A;  2MQH A;  4BA2 I;  2K50 A;  3KF6 B;  1VQN A;  1TXY A;  4HIO A;  4JBW A;  4B3R L;  3S1Q H;  2ZTC A;  4A3E H;  3HOV G;  1J6Q A;  1LUZ A;  4IFD J;  1PH7 A;  3AFP A;  1I94 Q;  1YI2 A;  4IFD I;  4UPA A;  1HZA A;  1SN8 A;  4DV5 L;  2JA7 H;  1E1O A;  4LF5 Q;  1VQM A;  1TWH H;  2YTY A;  4P74 A;  1YHB A;  4JI7 Q;  3NEM A;  4LNQ A;  1KD1 C;  1FGU A;  2YV5 A;  2BH8 A;  4NXN L;  4C3I H;  4DV4 Q;  3W1G A;  1IBM L;  5FLM G;  1VQD A;  1L1O C;  1UEB A;  4JOI A;  4GKK L;  3K81 C;  1BBU A;  2ALY B;  4DPG A;  1L1O B;  2D0O A;  3ULL A;  4A4I A;  1PH9 A;  3AFQ A;  5IYC G;  2ZM6 L;  1Y1V H;  4LUV A;  4LF6 Q;  4L5R C;  1PA6 A;  4Y7N H;  3U58 A;  4AQY Q;  1HNZ Q;  2HIV A;  1EIF A;  3HOY G;  1MKH A;  1V43 A;  1KXL A;  3GTO H;  2IY5 B;  2I0Q A;  2AMC B;  2R7D A;  5IP9 H;  5LMU Q;  2I5H A;  4DNI A;  4IFD G;  2N49 A;  4LFC L;  5BR8 L;  3WWV A;  4JBM A;  3CQZ H;  1S40 A;  2F52 A;  2WFW A;  1HR0 Q;  2JA5 H;  5J3B A;  4BXX H;  1X9N A;  2MO1 A;  4O2D A;  1MIU A;  1XPR A;  4DUY Q;  3CC7 A;  4JV5 Q;  2UXC Q;  3J80 i;  2IHF A;  4IJH A;  3CC4 A;  2CQO A;  3U4Z A;  4DK6 C;  3CCV A;  2R93 G;  4IPD A;  4LF9 Q;  4UP7 A;  1I5F A;  4HJ5 A;  4GNX A;  3S2H H;  4NXM L;  3E9H A;  3MEF A;  3HOZ H;  3S16 H;  1WYD A;  5M3M H;  1V9P A;  4LF7 Q;  4YY3 Q;  1IBL L;  4LF8 Q;  3H15 A;  2UUC L;  2HHH Q;  3J81 c;  1V1Q A;  4A3J H;  4JCV E;  1GM5 A;  4JI6 Q;  1D8L A;  1AH9 A;  3KDF A;  3I55 A;  4A3F G;  5GAH C;  1Y14 B;  2DUD A;  2YYZ A;  3F2D A;  3PO2 G;  5IT9 c;  4X64 L;  2WB1 E;  1X65 A;  4YCV A;  3M3Y H;  1X3E A;  5IWA Q;  5M5Y H;  1EIY B;  5C0X I;  4DR5 Q;  4X6A H;  2UUA L;  3F8T A;  1Z47 A;  4JC0 A;  4XIG S;  1SMX A;  2OWO A;  2JA6 H;  1FJG L;  2I5L X;  4BA1 I;  3S14 H;  4R1J A;  3BZC A;  3GDE A;  2K5H A;  4B3R Q;  3OTO L;  2KEN A;  4A3I G;  2NVQ H;  4GLA C;  3CCE A;  2VUM G;  3RZO H;  2YTV A;  2WB1 G;  1C9O A;  1EOV A;  4PG3 A;  2WP8 J;  4DV5 Q;  1KQS A;  1HJP A;  3AQQ A;  3G48 A;  1Q86 C;  1E24 A;  4R4I A;  1LYL A;  4L5T A;  3NEL A;  1NY4 A;  2AWN A;  2HQL A;  4DR2 L;  4Y52 H;  2N78 A;  4NXN Q;  2IHE A;  1UWV A;  5C0X G;  2VY3 A;  3M9B A;  4GN4 B;  3STB D;  3RZD H;  1IBM Q;  4B3S L;  2JA8 G;  2AHO B;  4X65 L;  4DV2 L;  4GKK Q;  4A3L G;  3PSI A;  4RMF A;  2R92 G;  3A5U A;  3RN2 A;  2UUB Q;  3UDI A;  4GOP B;  2ZM6 Q;  3A74 A;  2ZJP A;  1N34 L;  4OXP A;  5IYB G;  1KC8 C;  2EXD A;  3H0G G;  4J15 A;  3CP0 A;  5C44 H;  1NE3 A;  1WFQ A;  1GD7 A;  2CFM A;  4IPG A;  5IE8 A;  4A3M H;  1PH3 A;  4HID A;  3JC6 6;  5BR8 Q;  4LFC Q;  4GN5 A;  1A63 A;  2F4V L;  3M7N A;  2NVY H;  2VL6 A;  3S1R H;  1L2F A;  1OXV A;  2B29 A;  3T1Y L;  2E8G A;  2NN6 I;  3CD6 A;  4A93 G;  2RF4 A;  2ZJR A;  5JJK A;  3KJP A;  3S15 H;  2OTJ A;  4PZ6 A;  4QQB X;  1TWA H;  1VQ7 A;  2ZTD A;  1K3R A;  1QUQ A;  1L0W A;  1HR0 W;  1U0L A;  3PIO A;  2KHI A;  4OWW B;  4JI0 L;  4JI5 L;  2IX0 A;  3I2Z A;  4NXM Q;  2ID0 A;  4JOI C;  3GTP H;  2ZTE A;  1IBL Q;  4A3B H;  3F2C A;  3B6Y A;  2UUC Q;  3PF4 A;  4QY7 A;  1BVS A;  4DUZ L;  3I4M G;  4APV A;  5M3F G;  1R9T H;  2ZJQ A;  3ICE A;  1NMF A;  4JI3 L;  1XTD A;  1WOC A;  3CCU A;  4X64 Q;  4LUO A;  3GTJ H;  1XMQ L;  1KHI A;  1KL9 A;  1QVG A;  3CCQ A;  3STB C;  1TWF H;  2NN6 G;  3J81 j;  3T1H L;  3M4Q A;  1DGS A;  5IYD H;  5M5X H;  3GD7 A;  2UUA Q;  3PO3 H;  1FVI A;  2PQA A;  4PZ8 A;  3W5O A;  1E22 A;  3TEH B;  1FJG Q;  1CSQ A;  3HOY H;  3OTO Q;  4P71 A;  1QVC A;  1HH2 P;  2KHJ A;  2N3S A;  5FJ8 G;  4AYB E;  4A75 A;  4GLX A;  1KAW A;  4GNX C;  2Q2I A;  5IP7 G;  1JJC B;  1YZ6 A;  1E1T A;  3M4P A;  2E5L L;  2H5X A;  2PNH A;  4GNX B;  4JI1 L;  1YJW A;  1XJV A;  4K0K L;  2R93 H;  3G71 A;  5GRO A;  2QA4 A;  2OTL A;  3HOW H;  3TRZ A;  3PUV A;  3J7Z C;  4WJ4 A;  1OXS C;  2UXD Q;  4AYB G;  5C3E H;  3HOU G;  2WAQ E;  4B3S Q;  4BBR G;  2UXB Q;  1Y1W G;  1PFS A;  4JBK A;  3D0F A;  4DV2 Q;  1AE2 A;  2FXQ A;  4YCW A;  2GVA A;  4GN3 B;  4DR1 L;  3H3V H;  4FDB A;  3CMA A;  2XGT A;  1N34 Q;  3GTK H;  3S17 H;  1O7I A;  3K7A H;  3GTL H;  3PCO B;  4JG2 A;  4DV0 Q;  3S24 A;  2VQF L;  2WAQ G;  3K80 C;  2HT1 A;  2D62 A;  5EAY A;  3PF5 A;  2EQS A;  3RN5 A;  1KIX A;  2F4V Q;  1GVP A;  2PI2 A;  1JB7 A;  1EFW A;  2CWP A;  4B3M L;  4OX9 Q;  3T1Y Q;  1XPO A;  1S72 A;  2EIF A;  4HJ9 A;  4B3T L;  3CME A;  1XNQ L;  4HIM A;  4JYA L;  2OQK A;  3KLW A;  3HFZ B;  3CW2 C;  2R7Z G;  3GTM H;  5JJI A;  2VUM H;  3KF8 B;  3A0J A;  4OWX B;  4DV3 L;  4POF A;  4JI0 Q;  4GS3 A;  4JI5 Q;  4BY1 G;  3TQY A;  3GTQ H;  3I4N H;  4DR3 L;  4WJ3 M;  1PH6 A;  4NB3 A;  1K0R A;  1Q82 C;  3GO5 A;  3FHW A;  5C0X J;  3J80 c;  4DUZ Q;  2MFI A;  4LW1 A;  1VQ9 A;  3TRE A;  4JI3 Q;  1JE5 A;  1NJI C;  1G51 A;  3J7A 5;  3PGZ A;  3Q8D A;  1K8G A;  3CC2 A;  1Q8K A;  2JA8 H;  1XMQ Q;  4TQU S;  4A3L H;  2OQ0 A;  4POG A;  1Q7Y C;  5GAG C;  1Y1V G;  3RLF A;  4HJA A;  3T1H Q;  5ELN A;  3PO3 G;  1UE1 A;  3FP9 A;  3HOZ G;  3DM3 A;  3IRB A;  5GAD C;  1W2B A;  2JEA I;  2K52 A;  2RHS B;  1B7Y B;  1PH5 A;  5IYB H;  2Q2U A;  1P8L A;  3H0G H;  1VQF A;  5IP9 G;  1LTL A;  4DR4 L;  2A19 A;  1JJ2 A;  1G6P A;  1VQA A;  3HKS A;  3TS0 A;  1UE6 A;  4JI2 L;  5C4X H;  2UXD L;  5FLX c;  1WCM G;  2K4K A;  4DAY B;  2E5L Q;  3CCJ A;  4L5S A;  1PH4 A;  1OTC A;  1I3Q H;  3OYY A;  2KBN A;  4JI1 Q;  3FKI G;  1OXT A;  2GVB A;  5HY6 A;  3K8A A;  2BA0 A;  1VQ6 A;  4QIW E;  1CUK A;  2I5M X;  4OWT B;  3W1B A;  5M3M G;  2YU9 H;  4R4C A;  1NBW A;  5IY0 A;  4LFB L;  4C3J H;  2E2H H;  3L2P A;  1AE3 A;  3HOX G;  3BU2 A;  1VQB A;  4JI4 L;  4AIM A;  4DV1 L;  4DR1 Q;  5JJL A;  2NZO A;  3CCR A;  1SR3 A;  4A3C H;  4HJ7 A;  1KRT A;  5M3F H;  2LXK A;  1YEZ A;  4EX5 A;  1YVC A;  1CKO A;  3ERS X;  3F1Z A;  4MTN A;  1SFO H;  1GKH A;  4KHP L;  2Q2T A;  3SGI A;  1WI5 A;  2VQF Q;  4OO1 I;  1BKB A;  1VQJ A;  1X56 A;  5LMN L;  3KYH C;  4DV7 L;  4X62 L;  1N32 L;  4YHH L;  2JA6 G;  1J5E L;  3HOV H;  4A3G G;  4B3M Q;  2HIX A;  4P75 A;  1ASZ A;  1SRO A;  1HZ9 A;  1Z9F A;  3PUW A;  4BBS G;  4H02 A;  4B3T Q;  1XNQ Q;  1CKN A;  1YIJ A;  1U5K A;  2UU9 L;  3BJU A;  4JYA Q;  2GN5 A;  4LUZ A;  1CSP A;  4BY7 G;  3CCS A;  4DV3 Q;  1QZG A;  2OCE A;  1VQ8 A;  4A3D G;  5IP7 H;  2R6G A;  5JEA J;  3U4V A;  4DR3 Q;  4JV5 L;  2UXC L;  4OON A;  1PVO A;  1IBK L;  2Z0S A;  1Q12 A;  2MO0 A;  1SE8 A;  2F3I A;  1K83 H;  1Q46 A;  1TWC H;  2Z6K A;  5FLM H;  4ALP A;  1K8A C;  1JMC A;  1WJJ A;  3GTG H;  3RR5 A;  4UY8 C;  4A3K G;  3KFU A;  1X3G A;  2CKZ B;  4OO1 G;  4LWC A;  3HOU H;  1Q81 C;  5IYC H;  4YY3 L;  2ASB A;  3S2D H;  1Y1W H;  1VQP A;  4QGU A;  2AKW B;  4C3H H;  2JA9 A;  3M4O H;  1JJG A;  1NMG A;  3VDY A;  4HIK A;  2E2J H;  2JQO A;  1YJN A;  5H1S E;  4ME3 A;  4GKJ L;  3JAM i;  3CCL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...