1TWAH

Rna polymerase ii complexed with atp
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: nucleotide selection by rotation in the RNA polymerase II active center.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase II largest subunit
total genus 22
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2004-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1twaH00
4DV0Q 2WFWA 2K5NA 1J5EL 2YTXA 3PUVA 3F8TA 4DV4Q 3ULJA 4BA2I 2I5MX 1HZ9A 1V9PA 3I55A 1YEZA 1N34L 5IYBG 4B3RL 4YWMA 1L1OA 3GD7A 3PUXA 2K14A 4PMWA 4HIKA 2UXBL 1A0IA 3HFZB 3S2DH 2NN6I 2RF4A 4O2DA 4R4CA 3GTQH 3KDFB 3PO3H 4A3EG 2IX1A 4B3SQ 1VQFA 1K83H 1UE5A 2B3GA 1SRUA 2VY3A 3I2ZA 3AYHB 1X6OA 4IFDG 1FGUA 2K50A 4C3HH 1SE8A 1KXLA 3PUWA 1HNWQ 4BBSG 2EXDA 1OXUA 5FJ8G 3G71A 2K4KA 4DNIA 1YHAA 4JI1L 4Y52H 4DV0L 3S1NH 5LMUL 3IRBA 2E2IH 1OXXK 4A75A 2JA5G 2K5HA 1VQGA 1YBYA 2F3IA 1K73C 2L15A 2LXKA 4MTNA 5ELOA 4DR7L 4POGA 4YHHL 1YI2A 3HOXH 3HKZG 5M5YH 1GO3E 3CW2C 1Q8KA 5EAYA 2A1AA 4DR1Q 4IPDA 3MXNB 4HIDA 1JJ2A 4AIMA 4DUZL 3RZOH 1VQ6A 1KIXA 1N32Q 3G48A 4MZ9A 1E3PA 2HIXA 4DR1L 1KHIA 2KENA 1VQAA 1YITA 3AFPA 3PUZA 4L5RC 4LF8L 2WAQE 3OYYA 4L5QA 4NPSA 3TEHB 1L0WA 1GM5A 1X3EA 4DR5L 5IT9c 4LFBQ 3T1YL 4JV5L 3PV0A 3I4NG 1QZHA 1I94L 3NBHB 1BKBA 3J80i 3ULLA 2KHIA 3HOZH 4BBSH 4LF7Q 4A3LG 3RZDH 3I4OA 4LUOA 1OTCA 2JA7H 2NVQH 4LF9Q 1I94Q 1PVOA 3S17H 2Y0SE 4OXPA 1JJGA 1HJPA 2JJQA 5M3FH 4LFCQ 4DUZQ 2VQFQ 3PSIA 1YZ6A 1I5FA 2JE6I 3ER0A 4AH6A 1G6PA 2D62A 3L7ZC 3DLLA 2BH2A 1XMOQ 1PH7A 4X6AH 1IBLQ 3DM3A 3HOVH 1E1OA 2IHFA 3I7FA 4DR6L 2YYZA 4O0AA 4QGUA 3BZCA 4BXXH 5IYBH 1TWCH 5M5WH 3KF8B 2UXCQ 4DV7Q 2MFIA 3KDFA 4KHZA 1TXYA 1UE6A 4TVAB 1PH4A 1K8AC 1JMCA 4QL5A 4BA1I 1XPOA 2ES2A 4K0KL 3SGIA 1Q1EA 2NN6G 2N49A 3D0FA 4XTCS 4JC0A 2KBNA 4GNXC 3KLWA 1IBMQ 3I4MG 1Q12A 1I3QH 3J80c 1EYGA 4K0KQ 1SLJA 2R7DA 4A76A 4KHPQ 1VQEA 3CCJA 1NJIC 3RLNA 3U4VA 4AYBE 1K8GA 4A3DH 5LMUQ 4UPAA 1HZBA 3GTOH 1OXTA 2F52A 4UP8A 5IP7G 4DR3Q 4DR4Q 1MJCA 1E7ZA 1J6QA 3K8AA 2UUBL 3I4NH 4PZ7A 4JYAQ 1N9WA 2NZHA 3GTMH 4RMFA 5IP9H 4DV7L 2Q2IA 1FVIA 1VQDA 2R92G 3GTLH 3STBD 1B70B 3T1YQ 2YTYA 4DR2L 3HKZE 4GNXA 4JI5L 3PF5A 1C7YA 4IJHA 4GLAC 3HOXG 2D0PA 4X64L 3CMEA 5M3FG 4UY8C 4BY7H 2JQOA 3CPFA 4PZ6A 3H3VI 2CFMA 4DR2Q 2NVTH 2OCEA 3Q8DA 4POFA 4JI5Q 3CD6A 4DR4L 4BXXG 1N32L 2MO0A 1DGSA 2A19A 5M3MG 4JI0Q 2LXJA 1UE1A 4DV6L 3UDGA 4YWLA 1KD1C 5C4JH 4NXNL 2AWOA 5M5XH 4IOAA 3A74A 1QUQA 4DR3L 4JBMA 4A3JG 4JI3L 5C3EG 1X9NA 1XPUA 1X54A 3PF4A 3OW2A 3UE1A 2NVYH 4LUVA 3K7UC 2ZTEA 3PIOA 1S72A 3JC66 3UDFA 1Z9FA 1HZAA 4DK6C 1PHJA 4JI7Q 5C4XG 3K81C 4JI6Q 2DGYA 4BY1H 2R93G 3RR5A 1GKHA 3S14H 5IYCG 2Z0SA 1EIFA 1GD7A 1L2FA 3FKIH 3BU2A 3CCEA 1JE5A 4A3MH 2I5HA 4BY7G 4DAMA 4X65Q 2Z6KA 5JJIA 2C35B 1SFOH 1E24A 2QEXA 4OWXB 2JA7G 4KHPL 4JI0L 1IXRA 4DV2L 3M9BA 1EQRA 1LYLA 1Q46A 2K75A 3CP0A 1L1OB 5E7NA 5IP9G 4HIMA 1XNRL 3F2DA 4KLKA 5JJKA 1QVCA 2UU9L 1KAWA 4LF4Q 1CKOA 2PI2A 3E0EA 3KYHC 2E2JH 4L5SA 5FLMG 1G51A 3TS0A 2LSSA 4B3RQ 1CKNB 3GTJH 2VNUD 1JT8A 3F2CA 3HOUG 3S16H 1PH8A 3M4PA 1VQ8A 4FDBA 5FLXc 2Q2TA 3J7A5 4UP9A 4BBRH 4NXML 2N78A 4GLVB 4B3TQ 2YV5A 2AWNA 1M90C 2UUAL 1KL9A 1PH2A 1KQSA 1Y1VG 4HJ7A 4P75A 1HNZQ 5IP7H 4DV5L 2JK8A 3F1ZA 3S2HH 4A3KH 1U0LA 1YJ9A 2ZM6Q 4KI0A 2UUAQ 3EN2A 2BA1A 2YU9H 4AYBG 3UE0A 4GOPB 1XNRQ 1MKHA 1CKMA 3W5OA 3CCUA 2OTJA 2JA8G 2VUMH 1Q7YC 4WJ4A 2IT1A 3KF6B 2I0QA 1VQPA 3HOWG 2PI2E 1VQCA 5IYCH 1RL2A 2GN5A 1VQMA 3S1RH 3TRZA 4PG3A 4QJFA 4X66Q 3CQZH 1X65A 1B8AA 4DAYB 2YTVA 4C2MH 4DPGA 1O7IA 2PQAA 3L0OA 4R1JA 3EBEA 1YJNA 4R4IA 4HJ5A 1VQJA 1YJWA 4A93G 4GN3B 1XMQQ 4APVA 2WAQG 4A4IA 2WB1G 3PO3G 4YCWA 4DV5Q 4HJ9A 3CCRA 4DV4L 1UWVA 1OXSC 4DUYL 1X56A 4HJ8A 3HOUH 2JA8H 1XMOL 2Y0SG 4A93H 3CCVA 1IBLL 4P73A 4P74A 3MEFA 4JV5Q 1VQOA 3TREA 3VDYA 2ZJRA 2B63G 1HZCA 4A3BH 2AKWB 3H3VH 5GAGC 4JBWA 4NB3A 4BY1G 1IZ6A 4JI4L 3CAMA 4LF8Q 2R93H 2UXDL 2OTLA 3AFQA 1UE7A 3NENA 2CCZA 2IHEA 1S3OA 4DV2Q 3A0JA 2UXDQ 1NMFA 3M4QA 2PMZE 1WI5A 3OTOL 1VQIA 1GVPA 2B29A 3G4SA 3GTPH 1X3GA 4R4TA 4A3CH 4Y7NH 3J7ZC 4DV1Q 4GOPA 2GVBA 3BZKA 5FLMH 3ULPA 3OTOQ 4QY7A 4DUYQ 3NELA 4OONA 2H5XA 4XIGS 3CC4A 4DV1L 3I56A 3E9IA 1BBUA 4R4QA 1YHBA 1R9TH 1N33L 1UEBA 5FJ8H 2Q2HA 4BBRG 4YWKA 3A5ZB 4B3TL 4A3DG 4JI2Q 2OQKA 3CCSA 4ALPA 5J3BA 2RHQB 3CF5A 4LF7L 2UXBQ 2R7FA 1PH9A 3U4ZA 1Y14B 1MIUA 1NTGA 2WB1E 4A3EH 2Z6KC 2KHJA 1KC8C 3H0GH 5AJ3L 1EFWA 3PO2G 3D31A 1VQ5A 3B6YA 2HIVA 4YHHQ 1Q86C 3GDEA 5IE8A 1AE2A 1VQBA 3EIVA 1XMQL 3FHWA 1NY4A 2N3SA 2VQFL 2PQAB 4TQUS 4OWTB 3U50C 4JI8L 1WYDA 5C0XJ 1Q81C 2E8GA 5AJ3Q 1QZGA 2MO1A 3H15A 3S1MH 2VQEL 4GLXA 4IPHA 4UP7A 1I50H 2HHHQ 4YY3Q 5IWAQ 4C3JH 5C0XG 4OO1I 1T9HA 4LUZA 1Q82C 1N33Q 2ZTDA 2DUDA 2XGTA 2XTIA 5K36G 1YIJA 4DR7Q 1QUQB 1PYSB 2JA9A 2VW9A 2HHHL 5IWAL 1PH1A 4HIOA 1VQNA 1SN8A 1A62A 1I6HH 2JEAI 4JI6L 4A3CG 4ME3A 3PUYA 1QVFA 4LFAQ 2UUCQ 4GKKL 3KF6A 5JEAJ 1K3RA 5HGQA 4HJAA 2E5LL 4JBKA 4OWWB 5JJLA 2VS1A 2IY5B 2E2HH 3M85A 2VZAA 4A3JH 4DV6Q 4A3LH 1VS0A 2AHOB 3RN2A 1CUKA 4A3IH 3KJOA 1V1QA 4LF9L 1YNXA 3U58A 3RNUA 3G6EA 2E5LQ 1W2BA 3CMAA 4GKJQ 4A3GG 2BA0A 1HNXL 3ERSX 5C4XH 3CPWA 1HNWL 4A3BG 1KRSA 4QIWE 3CCLA 3M4OH 4IFDJ 1FJGQ 1WOCA 3J81i 1N34Q 4IFDI 4JI4Q 4DV3L 4LF5L 4LFBL 3L2PA 2ZTCA 3JAMi 4A3KG 3S1QH 1N36L 1PYBA 1FJGL 5IYDH 2N8NA 3JAMc 2R92H 4A3GH 2UXCL 3CXCA 5M3MH 3T1HL 3RLFA 2R7ZH 3CCMA 1HR0Q 3HOWH 4QQBX 2Q2UA 3HOYH 1SR3A 4JOIA 3W1GA 2WP8J 4EX5A 3A5UA 1JJCB 1VQHA 2QA4A 1TWGH 5BR8L 2ALYB 2VL6A 4JG2A 5C3EH 2ZJQA 2A8VA 3M7NA 1HR0L 4P72A 2MNAA 3UDIA 4YY3L 1NBWA 1OXVA 2CQOA 2IX0A 5LMNW 2UU9Q 4LF4L 4GKJL 1FL0A 1M1KC 4JI3Q 2VQEQ 4DR6Q 1BVSA 5DLQE 5HY6A 3HOYG 1C0AA 4P71A 4AQYL 1XPRA 4DV3Q 4GN5A 3W1BA 1TWHH 4DR5Q 4LF5Q 1KRTA 1B7YB 3K7AH 4A3FH 2JA6H 5GQOA 4JYAL 1L1OC 2OQ0A 3KJPA 4NXMQ 1PH5A 2K52A 4MNOA 3GTKH 4X62L 1XJVA 2F4VL 4H02A 1PFSA 4GS3A 3GTGH 1SMXA 1A8VA 2D0OA 3CCQA 3RN5A 5JEAG 1VQ7A 3PO2H 3GO5A 4LFCL 5GADC 4IPCA 4DK3C 1BBWA 5IY0A 1ASZA 1K0RA 4B3MQ 1SROA 2PNHA 5GAHC 4GNXB 5C0XI 3S24A 2RHSB 4LF6Q 1HNXQ 3ZJYC 4YCUA 5GAEC 5C44G 4NXNQ 3J81c 1EWIA 4B3ML 1RIPA 1EOVA 3BJUA 3FKIG 3PCOB 3NEMA 4A3MG 1E1TA 1MJEA 3F2BA 2HT1A 3HOVG 1YVCA 2OWOA 2R7ZG 1N8RC 1IBKL 1G291 2RCNA 2UUCL 3CC7A 4LFAL 1XTDA 4GOPC 1TWFH 1CSPA 2BH8A 4JBJA 4GKKQ 4IJLA 1YHQA 1IBML 1WFQA 3K80C 5C44H 1IBKQ 4JI7L 4LF6L 3M3YH 1HNZL 1IYJB 4EQ5A 4B3SL 2JA6G 4X65L 2NZOA 1P16A 3HKSA 4JCVE 2JA5H 1J5EQ 2HQLA 1H95A 1X55A 2ZJPA 4A3IG 1QVGA 2JEBI 3H0GG 5ELNA 1PV4A 1WCMG 3FP9A 3K0XA 1PH6A 2V1CC 1HR0W 2KCTA 1S40A 4LNQA 4OX9L 5H1SE 2CWAA 3LGJA 1N36Q 2NVXH 2ID0A 4AQYQ 3STBC 4LWCA 4X66L 2K5VA 2KCMA 1D7QA 1A63A 4YCVA 1VQ4A 1V43A 2QGQA 3T1HQ 1K9MC 4OX9Q 1CSQA 3WWVA 1VQLA 1EQQA 4X64Q 1W3SA 3E9HA 1E22A 1WJJA 4X62Q 1PH3A 4JI2L 1LM0A 5BR8Q 1Z47A 1VCIA 4C3IH 4IOCA 2ASBA 4GN4B 1U5KA 3UDXA 1C9OA 1VQKA 3RLOA 2UUBQ 4DKAC 1EUJA 1XNQQ 1IL2A 4IO9A 4L5TA 1Y1WG 1HH2P 1Y1VH 2ATWA 1X3FA 4PZ8A 2I5LX 4A3FG 1VQ9A 2ZM6L 1WCMH 1JB7A 2EQSA 4IPGA 1TWAH 3KFUA 1EIYB 3PIPA 1XNQL 3AEVA 2MQHA 3I4MH 2GVAA 1NMGA 3TQYA 2VUMG 3AQQA 2CWPA 2FXQA 2F4VQ 2EIFA 1Y1WH 4WJ3M 1P8LA 3KOJA 2B63H 2AMCB 4JOIC 3CC2A 1LUZA 1NE3A 1AE3A 5LMNL 1PA6A 3PGZA 3HOZG 1LTLA 4LW1A 4JI8Q 2CKZB 4J15A 3TS2A 1D8LA 1Q1BA 5IYDG 1AH9A 5LMNQ 5GROA 1ASYA 3ICEA 3S15H 2R6GA 4R4OA 1CKNA 3J81j 4OO1G 4RG1A 4JI1Q
chains in the Genus database with same CATH superfamily
4DV0Q 2R3ZA 2WFWA 2YTXA 3F8TA 2I5MX 2RVLA 5CV7A 1HZ9A 2QCPX 3I55A 1N34L 2EY2A 3AU7A 2OXPA 4YWMA 3GD7A 4PMWA 1EZ8A 4ZKCB 3D4RA 2RF4A 3OIQA 3PO3H 2VXWA 3KDFB 3GTQH 2IX1A 1RKNA 1VQFA 5EKLA 1K83H 1UE5A 2VY3A 2VUMB 3AYHB 1X6OA 1FGUA 2K50A 1XTCD 4PMBA 2I46A 1KXLA 3PUWA 2SNSA 4A3IB 3IFTA 4QB4A 4Y52H 1K83B 3D6CA 2JA5G 1VQGA 1TS4A 2F3IA 5E1FA 2L15A 2LXKA 1MSHA 5ELOA 4MIUA 5KYIA 4FF3A 3HKZG 3K7AB 1KNAA 1Q8KA 3K0YA 3MXNA 2A6EC 3HOUB 4RCOA 5I6YA 1N32Q 4MZ9A 4DR1L 2KENA 1STNA 1FGBD 5C5MA 1RCVD 4NPSA 3TEHB 1JCKB 2HUGA 1L0WA 1PRTD 4WJWA 1X3EA 1EU3A 1G2TA 1I3QB 1LTTD 4DK0A 4JV5L 1TS3A 5FO8B 4K5XA 4LF7Q 1ZKOA 2B2YC 3VR2A 4IFDH 1ICFB 4FF4A 2HCCA 1I94Q 3S17H 2Y0SE 1HJPA 2J7ZA 3D8GA 3VA5A 4LFCQ 3PIP3 1MSGA 4G7ZC 2VQFQ 4XQNA 4J1MA 3ER0A 2Z9HA 3L7ZC 1Y69U 1QNUA 4A3KB 4X6AH 3DM3A 1SJHD 3I7FA 2IHFA 1NUCA 4E6IA 2UXCQ 4LF8L 4OGQC 2EYOA 1PH4A 4BA1I 1SE4A 5D3IB 1XPOA 4LJZC 3D0FA 4GNXC 1IBMQ 1SLJA 2R7DA 1EFID 4O42A 1VQEA 2JYOA 5ELDA 3U4VA 4AYBE 3NTKA 3I8ZA 3CRKC 1C8CA 4CDFC 2N88A 1J6QA 2K04A 3K8AA 3I4NH 5KIXA 4L6TB 1QB5D 2NZHA 3VYSA 1FVIA 1RD9D 4GNXA 4JI5L 1II3A 4GLAC 3HOXG 5M3FG 1EY4A 4ZK9B 1IW7C 1ET9A 3X3MA 3H3VI 2NVTH 3Q8DA 1SSOA 3QG1A 1N32L 1BCPD 1PTOD 4RCNA 4YWLA 3A74A 4JBMA 2F0GA 4A3JG 1IYVA 2F0OA 3A8JE 3EQLC 3A56A 4LUVA 3K7UC 2ZTEA 5DEHA 4BBRB 1KDBA 4J8QA 2B2YA 3K81C 4BY1H 2XIWA 3D4DA 5IYCG 3GTJB 2Z0SA 3FKIH 4QF4A 3A7AB 3T4AC 1JE5A 3CCEA 2PZTA 4KY5A 1B44D 1S5DD 2ZXPA 3R8BA 3S1MB 1Q46A 2A6HC 3F2DA 4KLKA 1KAWA 3MXUA 1CKOA 3KYHC 1CZGA 1SYDA 1JQYD 4N8X1 1G51A 2RCFA 1NSNS 1STYA 5JVH3 1CKNB 3DEPA 1MHWC 5I6WA 3J7A5 5CBAE 4X3UA 5F2DA 2QILA 3HRZC 1G8ZD 2G5DA 4P75A 1HNZQ 3F1ZA 1YJ9A 4IUPA 2YU9H 3J7YW 5CGKA 1CKMA 3CCUA 4FF1A 2VUMH 1Q7YC 3KF6B 4RGOS 2I0QA 3HOWG 3PO3B 1BBXC 1WTPA 4R9WA 1DONA 4DAYB 1SMYD 4A3FB 1O7IA 5IGDA 4R1JA 4R4IA 1YJWA 4A93G 1ZEQX 2WAQG 2WB1G 4YCWA 1TT2A 1U4PA 5IOCA 3O13A 3SVMA 2B2UC 1PFBA 3S9WA 4P73A 4CJ0B 3HOWB 4A3EB 3V2TA 3FKIB 2B63G 3I73A 3KBXA 2XWBB 3DM1A 4IUQA 2R93H 4LF8Q 5E4XA 1UE7A 2IHEA 1FNVA 2F0SA 1NMFA 3C1EA 1PYWD 3M4QA 3V05A 3TN2A 3TP8A 1F9RA 3GTPH 4A3CH 2F0UA 3OWEB 2GVBA 2N55A 3BZKA 2PMZB 3CU7A 1E2VA 4OONA 4XIGS 1FNWA 1YHBA 2JA7B 1UEBA 4DAVA 3A5ZB 1GUOA 1NNXA 4ZLTF 4CDEC 4RGMA 2RHQB 2XNAC 3U4ZA 1NTGA 1KC8C 5AJ3L 3D31A 3GDEA 1XMQL 2VQFL 1NY4A 1QZGA 1WYDA 2DY7A 1CK1A 4IUVA 3TBIB 2H4OA 2MO1A 3H15A 4IPHA 1L0XB 3MHBA 2I07B 4UP7A 2BOSA 4OO1I 3OMGA 5C44B 5CR3A 1CQFA 4DFAA 5JAVA 3S14B 1QUQB 2A68C 2HHHL 5IWAL 4HIOA 1B9NA 3P1HA 3PUYA 3KF6A 1UNSA 5JEAJ 1AZQA 2E5LL 3M4OB 2L5TA 3M85A 1CUKA 3KJOA 5KEEA 3A54A 2X69A 2BA0A 4HAEA 1HNWL 4A3JB 4A3BG 1FJGQ 3GTGB 2EJMA 4NMZA 1Y8PB 2PW5A 5EGTA 1QILA 3L2PA 1HFGA 4QMGA 1EWCA 2UXCL 3OW7A 1KDAA 2R7ZH 3DXJC 4KJNA 1HR0Q 3HOWH 1JJCB 3NWTA 3SHLA 4P72A 1AN8A 5JVG3 1U4LA 1NBWA 3BVGA 2CQOA 5I9PA 4UDUC 1M1KC 3FDTA 2TMPA 3IKJA 5C6AA 1C0AA 4P71A 2PO4A 4AQYL 4LF5Q 4GN5A 3K7AH 2JA6H 1YNND 4A3FH 4KY7A 4A3GB 4JYAL 2OQ0A 3KJPA 1PH5A 1STAA 4X62L 1XJVA 3IAYA 1SXTA 3U9OA 2A6HD 3TDQA 3RN5A 5CMDA 1XX8A 4R8IA 3LX0A 2EYFA 2YU9B 1BBWA 5KNCA 5FO7B 4J6HA 3QR8A 3K5NA 3QB3A 3FPUB 2NB0A 4GNXB 1EU4A 3S24A 3NWSA 1HNXQ 1RIPA 3GTQB 4BY7H 4NKLA 3HOVG 2OWOA 4QIWB 3K59A 1IBKL 1G291 2BH8A 4JBJA 4IJLA 3QO2A 2NZ1D 3M3YH 2FMCA 3SR1A 2IJ0A 4EQ5A 1HNZL 2H1EA 4XYQA 2JA6G 4X65L 4JCVE 1BUVT 2HQLA 4DR4L 5ELNA 3SK6A 2ENBA 4IZ8A 2CWAA 5H1SE 2ID0A 1BCPC 1PTOC 4LWCA 3SK5A 1KABA 4YCVA 3WWVA 5E3FA 4OIKA 2X6LA 1PH3A 1PRTF 1Y1VB 2K5WA 3UDXA 3SEBA 3RLOA 2UUBQ 4IO9A 1UUPA 2KJXA 1KLUD 2QKIC 3DWQA 4C3IB 2EQSA 1TWAH 4C3IG 1EIYB 3PIPA 1XNQL 2GVAA 4DXFA 5FLXL 1IHZA 2VUMG 2P5ZX 3BZDB 3MWYW 2AMCB 3ONAB 3TZDA 1J8IA 3J81E 5LMNL 1D5XC 2K5DA 2F03A 2DJGC 4J15A 1HCZA 1D5ZC 1F9QA 1D8LA 2DN8A 1ASYA 3S15H 5JEAH 3J81j 4RG1A 3TP5A 2CH4A 2K5NA 3RD4A 1TIID 2Z8LA 5IYBG 4BWGB 3HOXB 1L1OA 1NR2A 4HIKA 3S1QB 3KBGA 1SNPA 2UXBL 1A0IA 4OL7A 5I9OA 4R4CA 1TWAB 4KV6A 2E2IB 2B3GA 3HS0C 3I2ZA 1QCBD 4IFDG 2EE1A 1HNWQ 3GTPB 2EXDA 1OXUA 4CBVA 5FJ8G 1G6ZA 2K4KA 1X3QA 1YHAA 4DNIA 1MI2A 5LMUL 3N52A 3S17B 1YBYA 1D2BA 5HGTA 1DYQA 4YHHL 5CYUA 1GO3E 3CW2C 1QJOA 2G9HD 3BG3A 3MXNB 3MA2B 4AIMA 4RH6A 4B08A 4C56C 4JK1C 3RZOH 1FR3A 3G48A 5JOBA 2AQ2B 4C3HG 1EQVA 1VQAA 3AFPA 3PUZA 2WAQE 2NWGA 4HMJA 3J80E 1DXMA 5FK9C 3PV0A 1PZJD 5JPMC 5BN4A 3I4NG 1QZHA 1I94L 3NBHB 3ULLA 2L1BA 3WDNA 3I4OA 4BY7B 4LUOA 2AUJD 4LF9Q 1JJGA 3R2TA 5M3FH 4YIJA 5C4XB 2V4DA 3K5MA 1I5FA 5M5XB 2JE6I 1D1IA 4I7ZC 1G6PA 1Q90A 1XMOQ 4QCLA 1LTSD 3Q0AA 2YYZA 4QGUA 3KF8B 4DV7Q 2F0IA 4KHZA 4TVAB 1TXYA 1K8AC 1S5CD 2KOLA 1Q1EA 3K5OA 1A3TA 2L9HA 4JC0A 4XTCS 3KLWA 3I4MG 1EYGA 5D65A 3J80c 4K0KQ 1D5MC 1LACA 2SDFA 3CCJA 2J4XA 1NJIC 4UPAA 1QWYA 1OXTA 2LMCB 4KKTA 2VB3X 4UP8A 5IP7G 4DR3Q 3T53B 2R92G 1B70B 3URYA 3T1YQ 1C7YA 4DF7A 3BDOA 3CMEA 4UY8C 1U4MA 3C3LA 1SYBA 2PYKA 3I4MB 2KEDA 2OCEA 3FEWX 2WV6D 5TSSA 2MO0A 4IUTA 1DGSA 2A19A 1CQVA 5M3MG 1TU2B 4DV6L 1OO9B 1RODA 5C4JH 3MTSA 1HFNA 1XPUA 5C3EG 1I4XA 3UE1A 2A69C 3QOJA 3PIOA 3GTKB 1S72A 3JC66 4BBSB 5C4XG 1HZAA 1PHJA 4L63B 4JI6Q 1O7ZA 3RR5A 3S14H 1L2FA 4BY7G 3J7AF 3FPPA 2E2JB 5C0XH 1BF4A 1CTMA 2JA8B 3KK7A 1BCPF 1PTOF 2JA7G 4KHPL 2A73B 3M9BA 1CHPD 2K75A 1EY0A 4KD4A 1H9RA 5E7NA 4G7OC 1HHVA 1XNRL 5JJKA 1YNJD 2Z6BA 4LF4Q 5K36H 1C4QA 2OEOA 2PI2A 3E0EA 3I3CA 1EQTA 3FMCA 5FLMG 3TS0A 2F0HA 2E75C 1TWFB 2VNUD 4C2MB 4NP5A 1T5XD 3UI2A 4FDBA 2HD3A 4WRDA 4NXML 4MHEA 1CT1D 3ND9A 5I2XA 1KL9A 1KQSA 2XN9C 4RHRA 1RJTA 4DV5L 2JK8A 3J80L 4A3KH 1U0LA 2ZM6Q 4KI0A 3T51B 2UUAQ 5E4WC 3EN2A 4C3HB 2E76C 4DAYA 1LO5D 3UE0A 4GOPB 1MKHA 4WJ4A 2JA8G 5FO9B 4C1NK 1VQPA 2TSSA 3BVMA 1RL2A 1VQMA 4QJFA 3ND8A 2A6ED 2F3WA 1HA5A 3H94A 5IT9L 3TMEA 1JE4A 2PQAA 3L0OA 3EBEA 2XRSD 4GN3B 4A4IA 3PO3G 1BO0A 5DM63 4DV4L 4H13C 1O78A 2EYMA 2CW0D 1SBBB 4IUUA 1OXSC 2E74C 1SFOB 4RGNA 4HJ8A 3HOUH 4HSVA 4A93H 3MEFA 4JV5Q 4PNYA 5EBCA 3TREA 4A3MB 3BVZA 4JBWA 4NB3A 4BY1G 4JI4L 3QJYA 3CAMA 2UXDL 2F0LA 3NBIA 5DNFA 2GA4B 4WORA 4H44C 2NVYB 2CW0C 3A0JA 2SEBD 3A8IE 2O5JC 1WTOA 2B29A 5JPNC 1LTGD 4DV1Q 4GOPA 3HZXA 4P2CB 2AQ1B 4OHJA 5C4HA 4DUYQ 3NK9A 4V0BA 4NW2A 4R4QA 5FJ8H 3CHBD 4YWKA 4BBRG 4H7BA 1STBA 2UXBQ 1PH9A 4PQXA 1Y14B 2Z6KC 3MFYA 3H0GH 1EFWA 1K0SA 4OELB 4CDDC 4TSSA 5ELCA 2N3SA 2KHSA 3U50C 1WD1A 5BN5A 2VQEL 3S1MH 4GLXA 2PW7A 1I4QA 2HHHQ 2B2WC 1WD0A 4C3JH 5C0XG 4LUZA 3NE5B 2RDGA 3DWAA 2XGTA 5M5YB 1YIJA 2VW9A 2KA7A 2EYJA 1KTKA 1VQNA 1S5FD 5CV6A 3W2DA 1I6HH 1IW7D 3ZYYX 5J39A 4JI6L 2EPBA 4LFAQ 2UUCQ 4GKKL 1JICA 1K3RA 4HJAA 2XVSA 4B9WA 2IY5B 3HOVB 4EQNA 1GJXA 1V1QA 1YNXA 3U58A 5IGFA 4XDXA 3GQBA 1ESRA 1GUGA 5A35A 1EOTA 4IFDI 3PIO3 2NVQB 2NVTB 4LF5L 4CGYB 3AB9A 4A3KG 2FHTA 4HTHA 1PYBA 3IFDA 3E3XA 4K6LA 5IYDH 2N8NA 3WOFA 3JAMc 5KNBA 1EYAA 3T1HL 3HG9A 4U68A 3CCMA 2Q2UA 4C3JG 3HOYH 2WKDA 1SR3A 4JOIA 3W1GA 4EX5A 5ELFA 2ZJQA 2ALYB 2D9UA 3WOEA 3UDIA 2F0QA 2IX0A 2KVMA 4LF4L 4GKJL 3EVQA 1X32A 1EEID 3BDCA 2WKCA 1S4ZA 1JORA 1XPRA 2EY5A 4L8JA 3W1BA 2MP1A 4DR5Q 3TZUA 1L1OC 1O7YA 4NXMQ 3SK8A 2K52A 4F87A 2AQ3B 2G9DA 4DU9A 1X3PA 4H02A 2F4IA 4K5VA 1A8VA 3KF8A 4XT3B 5L37A 4S3SA 1DCZA 1TY2A 3PO2H 2D2CC 3GO5A 5GADC 1K0RA 1STHA 4B3MQ 3S2HB 2PNHA 5GAHC 3OHXC 1SNCA 1F2ZA 3J81c 1EWIA 3E0JA 3K57A 2M00A 3NEMA 4EQPA 3F2BA 1MJEA 2F0MA 3HP3A 1EY9A 2UUCL 4LFAL 4GKKQ 5IODA 4DAPA 2NUCA 1YHQA 1RTNA 2F0TA 3GTOB 1H9JA 2SNMA 2NZOA 1DOMA 1V1OA 4JI1Q 1TWGB 2JA5H 1QOHA 1J5EQ 4C1NI 4A3IG 2ZJPA 1QVGA 3H0GG 4FNFA 3K0XA 3V96A 2Y0SB 1PH6A 2B2TA 3LGJA 2NVXH 4AQYQ 4LAAA 1D7QA 4X66L 1A63A 1VQ4A 4I65A 1K9MC 1VQLA 4X64Q 3KLSX 3E9HA 3E5SA 1E22A 1LM0A 2QF7A 1Z47A 1VCIA 2WACA 4KHVA 1STEA 1PDQA 3IL8A 3FRPB 3PMFA 1XNQQ 1IL2A 1Y1WG 1HH2P 1HPCA 4ZRZA 4MTKA 2K1BA 1X3FA 1O7LA 5EJWA 1WCMH 1JB7A 4IPGA 3AEVA 2KCNA 2X6GA 2MQHA 1B9MA 3M4YA 1JWSD 1Q8IA 4WJ3M 1P8LA 3KOJA 2B63H 2K5QA 4JOIC 4KTAA 4X3TA 3GTMB 4TKOB 1PA6A 1AE3A 1WTQA 1LTLA 3OWFA 2EOTA 3LWEA 4TRDA 4OIJA 5IYDG 1AH9A 2R6GA 3OTOL 5CV4A 5IGGA 4DV4Q 3DWPA 1G91A 4RKLA 5LHY1 1V9PA 5A2QE 4B3RL 3PUXA 1F2LA 4IALA 4N9PA 3QOLA 1F77A 4HSPA 3HFZB 3S2DH 1YNJC 2NN6I 4O2DA 4A3EG 1TS2A 1TQOA 5G3LF 2JP1A 1BNZA 2L0CA 2PZWA 1SE8A 5C4JB 2F0JA 3NP8A 3W3AA 4JI1L 3S1NH 3IRBA 1I4HA 3J81L 4A75A 5EPKA 2HQEA 3GV3A 5FLXE 1YI2A 5M5YH 3U9SA 4KN7C 5EAYA 4DR1Q 3MEHA 1E3PA 2HIXA 1LABA 1K3BC 2PNRC 5C3EB 1YITA 1ILPA 1A3VA 4L5RC 3OYYA 1GM5A 2EY1A 2B39A 4DR5L 5IT9c 1C48A 3BS1A 5FKAC 5M3MB 4RFBA 2R92B 1UAPA 1BKBA 3J80i 2EYHA 3HOZH 4A3LG 3S1RB 1OTCA 4UAIA 3ERQA 1WVLA 2K05A 2KCCA 4CHTB 4OXPA 1LT6D 5CV9A 4DXGA 4DUZQ 4OO1H 2IL8A 1PRTC 3H09A 1XWEA 3DLLA 2EYLA 2BH2A 1EY5A 1K8OA 1EL0A 4DR6L 1QE6A 1EY8A 1ZXTA 3BZCA 2K33A 5M5WH 2WIIB 1JOKA 2C5CA 2MFIA 2ES2A 1TVXA 3SGIA 2BCOA 2NN6G 1ILQA 3JAML 2KBNA 1MGSA 1Q12A 1ZYRD 4A76A 4V190 1BDOA 1I50B 4ODGA 4OO1G 3DUZA 3NQIA 3D4WA 5LMUQ 4MN3A 1BOSA 3GTOH 2F52A 4DR4Q 1MJCA 1E7ZA 5M9OA 2UUBL 2EDGA 4CKBA 1N9WA 3GTLH 4RMFA 2Q2IA 2ZT9C 1VQDA 3STBD 5KRUA 4ZUIA 1PMRA 3HKZE 3PF5A 4K5WA 1VF5C 2EJGC 2IW3A 2QDLA 1FYCA 1B53A 1CM9A 4DR2Q 3CD6A 4JI5Q 5ELBA 1BCPB 1PTOB 2LXJA 1A15A 1UE1A 3UDGA 1KD1C 1ENAA 4NXNL 3VR4A 2AWOA 4IOAA 4HMIA 3PO2B 3QIAA 1QUQA 2F0PA 4F8MA 2E2HB 4IURA 3PF4A 2CH4W 1RHPA 4G7HC 4ZYSA 4JI7Q 1U4RA 5LL6S 4NDXA 4DNRB 1I6VC 3RZDH 1EIFA 1S5ED 3BU2A 1TR5A 2I5HA 1XYIA 4DAMA 2Z6KA 4U673 2C35B 2M9VA 3VR5A 4G57A 2B8FA 2QEXA 4JI0L 4DV2L 1EQRA 1B3QA 1L1OB 4HR7B 4A3DB 5IP9G 4HIMA 1SYFA 4XYOA 1QVCA 1I4GA 4DK1A 2E2JH 1Z7TA 3I72A 1VDZA 1GHJA 2LSSA 1ICWA 2RSOA 4B3RQ 1RTOA 1JT8A 4QUFA 3HOUG 3MVVA 3S16H 1PH8A 3M4PA 1VQ8A 5FLXc 1JOOA 4UP9A 4ZKBB 2MJ8A 4B3TQ 2YV5A 2AWNA 1M90C 2UUAL 3NUCA 1TWCB 4IQZA 4HJ7A 5C3XA 5T1GA 3EFXD 1PXUA 2BA1A 4AYBG 3NHHA 1H9KA 2OTJA 3W5OA 3G7LA 1D1KA 2PI2E 2GN5A 2Z4IA 4X66Q 3GP7A 1X65A 1B8AA 1V8QA 1RDPD 1RF2D 2YTVA 3VR6A 2NTTA 1YJNA 4HJ5A 1VQJA 1CFMA 4EQOA 2XRQD 4HJ9A 3CCRA 2NN6H 2F0EA 4LK1C 4DUYL 3HEJA 1X56A 1XMOL 2Y0SG 1SYCA 3CCVA 3H0GB 1FNUA 2XSCA 1H9MA 4IUNA 3VDYA 4A3BH 1GUWA 5GAGC 4KY6A 2Z1CA 4KK7A 3SK4A 2OTLA 3RMHA 3CQZB 2F0NA 3AFQA 3NENA 1HQRD 2CCZA 2A74C 1S3OA 1LT4D 1KDCA 2F0KA 5IT9E 1WI5A 2MPMA 2Q8RE 3G4SA 1GVPA 4R4TA 4Y7NH 3J7ZC 3T16A 3ULPA 1PTOH 5I4DA 3OTOQ 2BE5C 4KJOA 3NELA 5M3FB 2H5XA 3CC4A 1K28A 3KUPA 1VMPA 5A2QL 3H6MA 3EJIA 2Q2HA 1DOLA 2IWHA 2M2LA 1CA6A 3MC0B 3Q24A 4JI2Q 4ALPA 4B3TL 4A3DG 3CF5A 4K2LA 2JA6B 2BE5D 1MIUA 3B6YA 2HIVA 4YHHQ 1Q86C 2KUMA 2C9OA 3EIVA 4OWTB 4JI8L 5C0XJ 2K32A 2JN4A 2E8GA 3G6JB 1I50H 3VR3A 5IWAQ 2O4XA 3VYUA 2CHBD 2EZVA 2XWJB 4R8NA 1YNNC 4CJ2C 1N33Q 2ZTDA 5K36G 1F9SA 2JA9A 1SN8A 4DGZA 1ESFA 1H9SA 1GUNA 1HTLD 4ME3A 1QVFA 1GOZA 3OMCA 4JBKA 1E2ZA 1EZ6A 4WFN3 2VZAA 3MFGA 4DV6Q 4A3JH 1VS0A 2AHOB 2PCFB 4A3LH 3RN2A 4LF9L 2SOBA 3RNUA 4Y7NB 1SE3A 1WTVA 3CMAA 4GKJQ 4ILWA 4A3GG 1HNXL 3ERSX 3R2IA 3CPWA 2DJFC 3CCLA 3M4OH 4JPBW 1LLRD 4JI4Q 2OF1A 1IKMA 4LFBL 1ET6A 2WINB 3S1QH 1ZYRC 1A2TA 1N36L 1EY6A 2R92H 4A3BB 3CXCA 1SNDA 5M3MH 3CKIB 1SNMA 4QQBX 3L3OC 1JOQA 3A5UA 3M7NA 5BR8L 5EPLA 1KAAA 2VL6A 4JG2A 5C3EH 1WTHA 1HR0L 5DAUA 2MNAA 1GUSA 5LMNW 3BYYB 5KYLA 1FL0A 4JI3Q 3MXPA 2VQEQ 3NTHA 4DR6Q 3E6ZX 4XQJA 4KN4C 5COYA 5DLQE 4FVMA 5HY6A 3HOYG 3K6OA 4DV3Q 2F1MA 1KRTA 2EJFC 1XXGA 3GTKH 2F4VL 1PFSA 3QWNA 5JEAG 1VQ7A 4LFCL 1ASZA 4IPCA 5IY0A 1QG7A 3T13A 4X3SA 1CI3M 3EA6A 4FXDA 1IYUA 3LNNA 4FXGC 5DM73 5AFWA 4YCUA 5C44G 1A2UA 4NXNQ 4A3MG 2HT1A 3S2DB 3BDLA 1BQQT 1N8RC 3S16B 2RCNA 3C46A 3CC7A 1CSPA 3A7LA 5EKIA 4XXEA 2RSNA 3F2UA 1IBML 4JI7L 1GHKA 2LKVA 1Y8OB 1IBKQ 1IYJB 1ML0D 1TKWB 4XQQA 4B3SL 1VF7A 3NSWA 1EYCA 1P16A 5ELEA 1HRJA 3SDZA 5J1ZA 1X55A 4LF6L 4FP5D 1HR0W 3FP9A 2JSOA 1S40A 4LNQA 2FFKB 2F0DA 3STBC 4EVOA 2B63B 1HUNA 2QGQA 3T1HQ 4JVZA 4OX9Q 1EQQA 1LV9A 1WJJA 4X62Q 1SE2A 4JI2L 2RKSA 1PLFA 1WCMB 3MZ5A 4RWSC 2ASBA 5D3DA 1MD2D 1Y8NB 2WB1B 4LMQD 3Q22A 1LTRD 1G2SA 1ENCA 2FMMA 4PZ8A 2I5LX 4A3FG 3DHQA 2ZM6L 1JR0D 3AQQA 2FXQA 3GV6A 4F7XA 5C4ZA 2F4VQ 2EIFA 1JWMD 3OIPA 4ZQ3A 1Y1WH 4KMUC 2B2VA 2NVXB 3GTLB 3CC2A 1Q3LA 2IPKD 1LUZA 4A93B 1FD7D 4CKEA 4LW1A 1A6XA 4JI8Q 1SYEA 1GXDC 2CKZB 2Q8TA 3TS2A 2L4NA 3R3OA 3ICEA 1UEAB 1J5EL 3PUVA 3ULJA 4BA2I 3TP6A 2R7ZB 1YEZA 2QEJC 1Y1WB 4HN7A 1BXTA 2K14A 4K8JA 2D5DA 1WTRA 1AFPA 4N8FA 4B3SQ 4OEMB 4ZCKA 1AW7A 1SRUA 4KKSA 5J22A 5D14A 1M8AA 3EROA 3NBHA 4C3HH 1PZKD 2K6AA 4BBSG 5EQ0A 2F3VA 3G71A 1EIGA 4DV0L 2E2IH 3I91A 1OXXK 1JWUD 5IGBA 4KKUA 2RDHA 5LL6X 2K5HA 1K73C 4MTNA 4DR7L 1I4RA 4POGA 3TP7A 2L55A 3HOXH 4ZAIA 2A1AA 4IPDA 2MUYA 4HIDA 1JJ2A 3NXWA 4DUZL 5G3LD 1VQ6A 1KIXA 1SEBD 1KHIA 4K14A 4ME5A 5EKKA 4L5QA 3HOYB 2FJ2A 3C2PA 3T1YL 4LFBQ 4QUCA 3L9AX 3I90A 4Q0FA 2DNEA 1ONLA 2KHIA 4BBSH 1F2MA 5KGUA 1SAPA 2JA7H 4HEDA 2NVQH 1PVOA 2F0VA 3X3NA 2JJQA 5HURA 2BDOA 3PSIA 1YZ6A 3HGBA 5ISRA 4AH6A 3BYTB 2D62A 4FYDA 2EXZA 2A5HA 3D6WA 1PH7A 1IBLQ 3HOVH 1E1OA 1D6EC 4O0AA 1R4QB 3OOCA 5IYBH 1TWCH 3C1FA 4BXXH 2RA4A 3KDFA 4RKBA 1UE6A 3DEOA 1JMCA 1CA5A 4QL5A 1TS5A 2PQEA 1AEXA 4K0KL 1HUMA 2R93B 4DN4M 3ITPA 2N49A 5IGEA 2NYZD 3I70A 1CZWA 1I3QH 1NR4A 4IN3A 1LTID 4PMCA 4C3JB 2DNCA 4KHPQ 3RLNA 1K8GA 4A3DH 1HZBA 1STGA 2MGSA 4PZ7A 4JYAQ 2L12A 4CKCA 2QDBA 3GTMH 5IP9H 4DV7L 3RZDB 3VYTA 2YTYA 4DR2L 4IJHA 2D0PA 4X64L 5K5PA 1PFNA 2JQOA 3CPFA 4PZ6A 2CFMA 4BXXG 4POFA 5CC4A 1T5EA 4X3KA 1TY0A 4RA8A 5CV8A 5IIFA 4JI0Q 4Z9CB 5EBDA 4ABNA 5M5XH 1JB3A 1AZPA 1HA6A 4DR3L 1X9NA 4JI3L 1X54A 3OW2A 2NVYH 1O80A 1WTWA 1Z6HA 3I4LA 3N6RA 1Z9FA 3UDFA 2B8GA 4DK6C 3PQIA 3JAME 2DGYA 2R93G 1GKHA 5EPJA 1GD7A 4A3MH 3HKZB 4FF2A 2RQXA 4M1UB 4X65Q 1DZ1A 4JW0A 5JJIA 2HDMA 1E24A 1SFOH 4OWXB 1IXRA 4RGTA 2JA5B 2K7VA 1LYLA 3CP0A 2ZXRA 4ID6A 2KECA 3MXGA 2DY8A 3RZOB 1A3UA 2UU9L 2L11A 4L5SA 2A68D 3RUZA 3GTJH 4EGVA 2BDNA 3F2CA 2Q2TA 2NTSA 4BBRH 2N78A 4GLVB 5M5WB 5C3WA 1PH2A 1Y1VG 4N9TA 5IP7H 2K28A 3S2HH 2J0TD 1E0BA 1EY7A 4K8IA 1XNRQ 3SXHA 4XT1B 4B9XA 1EWHA 1PFMA 2IT1A 1EYDA 1VQCA 2B2UA 5IYCH 2RDFA 3S1RH 3TRZA 4PG3A 2K01A 3HOZB 3CQZH 2ZXOA 4ZUJA 2HDLA 2VB2X 5T1IA 4C2MH 4DPGA 2EY6A 5CORA 3P7JA 1WTXA 1XMQQ 4APVA 4F88A 1LT3D 2K03A 2KEEA 4DV5Q 1H9SB 2PPBC 1E2WA 4CDCC 1UWVA 3KLRA 1DJRD 4AYBB 4UHVA 2JA8H 1VMCA 1IBLL 4P74A 2B2TC 1W6KA 1VQOA 5KNDA 2ZJRA 1HZCA 1HQMC 2AKWB 3H3VH 1IZ6A 4DA2A 3Q23A 1DM0B 3K58A 4H0LC 4DV2Q 2UXDQ 3FVQA 3S1NB 2PMZE 1VQIA 1SNQA 1X3GA 1EIHA 1I4PA 4KD3A 5FLMH 4FXKC 4QY7A 2WAQB 5NUCA 4DV1L 3I56A 3P75A 3E9IA 1AP0A 1BBUA 2ICIA 1R9TH 1N33L 1I6HB 2B2VC 1PRTB 2F0WA 2OQKA 3CCSA 5J3BA 4LF7L 2R7FA 1TWHB 1GUTA 2WB1E 4A3EH 2KHJA 3PO2G 3SE0A 1VQ5A 5IE8A 1AE2A 1VQBA 1EEFD 3FHWA 4G4KA 2PQAB 2A69D 4TQUS 1M4VA 1Q81C 5AJ3Q 1F9PA 1NCVA 1SYGA 1F2YA 5JJZA 3NQTA 4YY3Q 2QW7A 1B2TA 1T9HA 3M3YB 1V1PA 1Q82C 2DUDA 2XTIA 4DR7Q 1PYSB 1PH1A 1A62A 2HCIA 2CQAA 4HCEA 2JEAI 1KNEA 4A3CG 1MBYA 5IGCA 5JJLA 5HGQA 4OWWB 2VS1A 2E2HH 1CHQD 4A3IH 4O1NA 3OPOA 1QNKA 3G6EA 2E5LQ 1W2BA 1W6JA 1SNOA 5C4XH 1KRSA 3NTIA 4QIWE 4IFDJ 1WOCA 3KLSA 3J81i 1N34Q 4RAUC 5BN3A 4DV3L 1B50A 1J9OA 3VYRA 2ZTCA 3JAMi 1B1ZA 3CRLC 1FJGL 3T56B 4A3GH 1SMYC 2F0FA 3M7GA 3RLFA 3Q6SA 2EYPA 4K2KA 1B4OA 3A8KE 2WP8J 1VQHA 4RHSA 1TWGH 2QA4A 2A8VA 2R61A 2E2DC 1BR9A 1OXVA 2UU9Q 1DD2A 1V1PB 1BVSA 1TWHH 2B2WA 3K5LA 2ICEC 1B7YB 4Q5VA 5I2YA 5GQOA 4DNTB 4BY1B 3LWUA 1B3AA 4MNOA 1R9TB 4GZYC 2PZUA 4GS3A 3GTGH 1SMXA 2D0OA 3CCQA 3DMUA 5CV5A 4DK3C 2Z4HA 1U9RA 1SROA 3MAQA 5C0XI 2RHSB 4LF6Q 3ZJYC 5GAEC 4M8AA 4B3ML 1EOVA 3BJUA 3FKIG 3PCOB 1E1TA 2R7ZG 1YVCA 1SJED 1NAPA 2LS01 3J7AV 4K6DA 1LT5D 3AMUA 1XTDA 2AUKA 1TWFH 2MHVA 1K8MA 4GOPC 4CJ1B 1WFQA 2RBMA 3K80C 2LY7A 5C44H 3I4NB 2EVBA 2NBFA 3S15B 2IX3A 1HTPA 1PZID 3HKSA 3NPPA 1H95A 1IL8A 1PV4A 2JEBI 2O5IC 1WCMG 2V1CC 2FINB 2KCTA 1S5BD 4OX9L 1N36Q 4PV1C 3A55A 2K5VA 2KCMA 3P20A 1V43A 1CSQA 1L0YB 1W3SA 5C5LA 1LTAD 4FO2A 5BR8Q 3OSOA 4C3IH 4IOCA 1R4PB 2O2LD 4GN4B 1U5KA 1C9OA 1VQKA 4DKAC 1EUJA 1HXYD 4L5TA 3H3VC 1DOKA 1Y1VH 4HCSA 2ATWA 1VQ9A 2OT2A 4ULLA 3KFUA 3I4MH 1NMGA 3TQYA 4I7AA 2CWPA 1IKLA 1LTBD 3TSSA 2KQ3A 2LFNA 3R93A 1KLGD 4BS9A 3VA7A 1NE3A 3PGZA 2CVRA 3HOZG 5CBEE 2JXMB 5FOBB 2Q8IB 3D3RA 1Q1BA 5LMNQ 5GROA 3H91A 1ENFA 4R4OA 1CKNA 1SDFA 4YY3L 1JC7A
chains in the Genus database with same CATH topology
4DV0Q 2WFWA 2K5NA 1J5EL 2YTXA 3PUVA 3F8TA 4DV4Q 3ULJA 4BA2I 2I5MX 1HZ9A 1V9PA 3I55A 1YEZA 1N34L 5IYBG 4B3RL 4YWMA 1L1OA 3GD7A 3PUXA 2K14A 4PMWA 4HIKA 2UXBL 1A0IA 3HFZB 3S2DH 2NN6I 2RF4A 4O2DA 4R4CA 3GTQH 3KDFB 3PO3H 4A3EG 2IX1A 4B3SQ 1VQFA 1K83H 1UE5A 2B3GA 1SRUA 2VY3A 3I2ZA 3AYHB 1X6OA 4IFDG 1FGUA 2K50A 4C3HH 1SE8A 1KXLA 3PUWA 1HNWQ 4BBSG 2EXDA 1OXUA 5FJ8G 3G71A 2K4KA 4DNIA 1YHAA 4JI1L 4Y52H 4DV0L 3S1NH 5LMUL 3IRBA 2E2IH 1OXXK 4A75A 2JA5G 2K5HA 1VQGA 1YBYA 2F3IA 1K73C 2L15A 2LXKA 4MTNA 5ELOA 4DR7L 4POGA 4YHHL 1YI2A 3HOXH 3HKZG 5M5YH 1GO3E 3CW2C 1Q8KA 5EAYA 2A1AA 4DR1Q 4IPDA 3MXNB 4HIDA 1JJ2A 4AIMA 4DUZL 3RZOH 1VQ6A 1KIXA 1N32Q 3G48A 4MZ9A 1E3PA 2HIXA 4DR1L 1KHIA 2KENA 1VQAA 1YITA 3AFPA 3PUZA 4L5RC 4LF8L 2WAQE 3OYYA 4L5QA 4NPSA 3TEHB 1L0WA 1GM5A 1X3EA 4DR5L 5IT9c 4LFBQ 3T1YL 4JV5L 3PV0A 3I4NG 1QZHA 1I94L 3NBHB 1BKBA 3J80i 3ULLA 2KHIA 3HOZH 4BBSH 4LF7Q 4A3LG 3RZDH 3I4OA 4LUOA 1OTCA 2JA7H 2NVQH 4LF9Q 1I94Q 1PVOA 3S17H 2Y0SE 4OXPA 1JJGA 1HJPA 2JJQA 5M3FH 4LFCQ 4DUZQ 2VQFQ 3PSIA 1YZ6A 1I5FA 2JE6I 3ER0A 4AH6A 1G6PA 2D62A 3L7ZC 3DLLA 2BH2A 1XMOQ 1PH7A 4X6AH 1IBLQ 3DM3A 3HOVH 1E1OA 2IHFA 3I7FA 4DR6L 2YYZA 4O0AA 4QGUA 3BZCA 4BXXH 5IYBH 1TWCH 5M5WH 3KF8B 2UXCQ 4DV7Q 2MFIA 3KDFA 4KHZA 1TXYA 1UE6A 4TVAB 1PH4A 1K8AC 1JMCA 4QL5A 4BA1I 1XPOA 2ES2A 4K0KL 3SGIA 1Q1EA 2NN6G 2N49A 3D0FA 4XTCS 4JC0A 2KBNA 4GNXC 3KLWA 1IBMQ 3I4MG 1Q12A 1I3QH 3J80c 1EYGA 4K0KQ 1SLJA 2R7DA 4A76A 4KHPQ 1VQEA 3CCJA 1NJIC 3RLNA 3U4VA 4AYBE 1K8GA 4A3DH 5LMUQ 4UPAA 1HZBA 3GTOH 1OXTA 2F52A 4UP8A 5IP7G 4DR3Q 4DR4Q 1MJCA 1E7ZA 1J6QA 3K8AA 2UUBL 3I4NH 4PZ7A 4JYAQ 1N9WA 2NZHA 3GTMH 4RMFA 5IP9H 4DV7L 2Q2IA 1FVIA 1VQDA 2R92G 3GTLH 3STBD 1B70B 3T1YQ 2YTYA 4DR2L 3HKZE 4GNXA 4JI5L 3PF5A 1C7YA 4IJHA 4GLAC 3HOXG 2D0PA 4X64L 3CMEA 5M3FG 4UY8C 4BY7H 2JQOA 3CPFA 4PZ6A 3H3VI 2CFMA 4DR2Q 2NVTH 2OCEA 3Q8DA 4POFA 4JI5Q 3CD6A 4DR4L 4BXXG 1N32L 2MO0A 1DGSA 2A19A 5M3MG 4JI0Q 2LXJA 1UE1A 4DV6L 3UDGA 4YWLA 1KD1C 5C4JH 4NXNL 2AWOA 5M5XH 4IOAA 3A74A 1QUQA 4DR3L 4JBMA 4A3JG 4JI3L 5C3EG 1X9NA 1XPUA 1X54A 3PF4A 3OW2A 3UE1A 2NVYH 4LUVA 3K7UC 2ZTEA 3PIOA 1S72A 3JC66 3UDFA 1Z9FA 1HZAA 4DK6C 1PHJA 4JI7Q 5C4XG 3K81C 4JI6Q 2DGYA 4BY1H 2R93G 3RR5A 1GKHA 3S14H 5IYCG 2Z0SA 1EIFA 1GD7A 1L2FA 3FKIH 3BU2A 3CCEA 1JE5A 4A3MH 2I5HA 4BY7G 4DAMA 4X65Q 2Z6KA 5JJIA 2C35B 1SFOH 1E24A 2QEXA 4OWXB 2JA7G 4KHPL 4JI0L 1IXRA 4DV2L 3M9BA 1EQRA 1LYLA 1Q46A 2K75A 3CP0A 1L1OB 5E7NA 5IP9G 4HIMA 1XNRL 3F2DA 4KLKA 5JJKA 1QVCA 2UU9L 1KAWA 4LF4Q 1CKOA 2PI2A 3E0EA 3KYHC 2E2JH 4L5SA 5FLMG 1G51A 3TS0A 2LSSA 4B3RQ 1CKNB 3GTJH 2VNUD 1JT8A 3F2CA 3HOUG 3S16H 1PH8A 3M4PA 1VQ8A 4FDBA 5FLXc 2Q2TA 3J7A5 4UP9A 4BBRH 4NXML 2N78A 4GLVB 4B3TQ 2YV5A 2AWNA 1M90C 2UUAL 1KL9A 1PH2A 1KQSA 1Y1VG 4HJ7A 4P75A 1HNZQ 5IP7H 4DV5L 2JK8A 3F1ZA 3S2HH 4A3KH 1U0LA 1YJ9A 2ZM6Q 4KI0A 2UUAQ 3EN2A 2BA1A 2YU9H 4AYBG 3UE0A 4GOPB 1XNRQ 1MKHA 1CKMA 3W5OA 3CCUA 2OTJA 2JA8G 2VUMH 1Q7YC 4WJ4A 2IT1A 3KF6B 2I0QA 1VQPA 3HOWG 2PI2E 1VQCA 5IYCH 1RL2A 2GN5A 1VQMA 3S1RH 3TRZA 4PG3A 4QJFA 4X66Q 3CQZH 1X65A 1B8AA 4DAYB 2YTVA 4C2MH 4DPGA 1O7IA 2PQAA 3L0OA 4R1JA 3EBEA 1YJNA 4R4IA 4HJ5A 1VQJA 1YJWA 4A93G 4GN3B 1XMQQ 4APVA 2WAQG 4A4IA 2WB1G 3PO3G 4YCWA 4DV5Q 4HJ9A 3CCRA 4DV4L 1UWVA 1OXSC 4DUYL 1X56A 4HJ8A 3HOUH 2JA8H 1XMOL 2Y0SG 4A93H 3CCVA 1IBLL 4P73A 4P74A 3MEFA 4JV5Q 1VQOA 3TREA 3VDYA 2ZJRA 2B63G 1HZCA 4A3BH 2AKWB 3H3VH 5GAGC 4JBWA 4NB3A 4BY1G 1IZ6A 4JI4L 3CAMA 4LF8Q 2R93H 2UXDL 2OTLA 3AFQA 1UE7A 3NENA 2CCZA 2IHEA 1S3OA 4DV2Q 3A0JA 2UXDQ 1NMFA 3M4QA 2PMZE 1WI5A 3OTOL 1VQIA 1GVPA 2B29A 3G4SA 3GTPH 1X3GA 4R4TA 4A3CH 4Y7NH 3J7ZC 4DV1Q 4GOPA 2GVBA 3BZKA 5FLMH 3ULPA 3OTOQ 4QY7A 4DUYQ 3NELA 4OONA 2H5XA 4XIGS 3CC4A 4DV1L 3I56A 3E9IA 1BBUA 4R4QA 1YHBA 1R9TH 1N33L 1UEBA 5FJ8H 2Q2HA 4BBRG 4YWKA 3A5ZB 4B3TL 4A3DG 4JI2Q 2OQKA 3CCSA 4ALPA 5J3BA 2RHQB 3CF5A 4LF7L 2UXBQ 2R7FA 1PH9A 3U4ZA 1Y14B 1MIUA 1NTGA 2WB1E 4A3EH 2Z6KC 2KHJA 1KC8C 3H0GH 5AJ3L 1EFWA 3PO2G 3D31A 1VQ5A 3B6YA 2HIVA 4YHHQ 1Q86C 3GDEA 5IE8A 1AE2A 1VQBA 3EIVA 1XMQL 3FHWA 1NY4A 2N3SA 2VQFL 2PQAB 4TQUS 4OWTB 3U50C 4JI8L 1WYDA 5C0XJ 1Q81C 2E8GA 5AJ3Q 1QZGA 2MO1A 3H15A 3S1MH 2VQEL 4GLXA 4IPHA 4UP7A 1I50H 2HHHQ 4YY3Q 5IWAQ 4C3JH 5C0XG 4OO1I 1T9HA 4LUZA 1Q82C 1N33Q 2ZTDA 2DUDA 2XGTA 2XTIA 5K36G 1YIJA 4DR7Q 1QUQB 1PYSB 2JA9A 2VW9A 2HHHL 5IWAL 1PH1A 4HIOA 1VQNA 1SN8A 1A62A 1I6HH 2JEAI 4JI6L 4A3CG 4ME3A 3PUYA 1QVFA 4LFAQ 2UUCQ 4GKKL 3KF6A 5JEAJ 1K3RA 5HGQA 4HJAA 2E5LL 4JBKA 4OWWB 5JJLA 2VS1A 2IY5B 2E2HH 3M85A 2VZAA 4A3JH 4DV6Q 4A3LH 1VS0A 2AHOB 3RN2A 1CUKA 4A3IH 3KJOA 1V1QA 4LF9L 1YNXA 3U58A 3RNUA 3G6EA 2E5LQ 1W2BA 3CMAA 4GKJQ 4A3GG 2BA0A 1HNXL 3ERSX 5C4XH 3CPWA 1HNWL 4A3BG 1KRSA 4QIWE 3CCLA 3M4OH 4IFDJ 1FJGQ 1WOCA 3J81i 1N34Q 4IFDI 4JI4Q 4DV3L 4LF5L 4LFBL 3L2PA 2ZTCA 3JAMi 4A3KG 3S1QH 1N36L 1PYBA 1FJGL 5IYDH 2N8NA 3JAMc 2R92H 4A3GH 2UXCL 3CXCA 5M3MH 3T1HL 3RLFA 2R7ZH 3CCMA 1HR0Q 3HOWH 4QQBX 2Q2UA 3HOYH 1SR3A 4JOIA 3W1GA 2WP8J 4EX5A 3A5UA 1JJCB 1VQHA 2QA4A 1TWGH 5BR8L 2ALYB 2VL6A 4JG2A 5C3EH 2ZJQA 2A8VA 3M7NA 1HR0L 4P72A 2MNAA 3UDIA 4YY3L 1NBWA 1OXVA 2CQOA 2IX0A 5LMNW 2UU9Q 4LF4L 4GKJL 1FL0A 1M1KC 4JI3Q 2VQEQ 4DR6Q 1BVSA 5DLQE 5HY6A 3HOYG 1C0AA 4P71A 4AQYL 1XPRA 4DV3Q 4GN5A 3W1BA 1TWHH 4DR5Q 4LF5Q 1KRTA 1B7YB 3K7AH 4A3FH 2JA6H 5GQOA 4JYAL 1L1OC 2OQ0A 3KJPA 4NXMQ 1PH5A 2K52A 4MNOA 3GTKH 4X62L 1XJVA 2F4VL 4H02A 1PFSA 4GS3A 3GTGH 1SMXA 1A8VA 2D0OA 3CCQA 3RN5A 5JEAG 1VQ7A 3PO2H 3GO5A 4LFCL 5GADC 4IPCA 4DK3C 1BBWA 5IY0A 1ASZA 1K0RA 4B3MQ 1SROA 2PNHA 5GAHC 4GNXB 5C0XI 3S24A 2RHSB 4LF6Q 1HNXQ 3ZJYC 4YCUA 5GAEC 5C44G 4NXNQ 3J81c 1EWIA 4B3ML 1RIPA 1EOVA 3BJUA 3FKIG 3PCOB 3NEMA 4A3MG 1E1TA 1MJEA 3F2BA 2HT1A 3HOVG 1YVCA 2OWOA 2R7ZG 1N8RC 1IBKL 1G291 2RCNA 2UUCL 3CC7A 4LFAL 1XTDA 4GOPC 1TWFH 1CSPA 2BH8A 4JBJA 4GKKQ 4IJLA 1YHQA 1IBML 1WFQA 3K80C 5C44H 1IBKQ 4JI7L 4LF6L 3M3YH 1HNZL 1IYJB 4EQ5A 4B3SL 2JA6G 4X65L 2NZOA 1P16A 3HKSA 4JCVE 2JA5H 1J5EQ 2HQLA 1H95A 1X55A 2ZJPA 4A3IG 1QVGA 2JEBI 3H0GG 5ELNA 1PV4A 1WCMG 3FP9A 3K0XA 1PH6A 2V1CC 1HR0W 2KCTA 1S40A 4LNQA 4OX9L 5H1SE 2CWAA 3LGJA 1N36Q 2NVXH 2ID0A 4AQYQ 3STBC 4LWCA 4X66L 2K5VA 2KCMA 1D7QA 1A63A 4YCVA 1VQ4A 1V43A 2QGQA 3T1HQ 1K9MC 4OX9Q 1CSQA 3WWVA 1VQLA 1EQQA 4X64Q 1W3SA 3E9HA 1E22A 1WJJA 4X62Q 1PH3A 4JI2L 1LM0A 5BR8Q 1Z47A 1VCIA 4C3IH 4IOCA 2ASBA 4GN4B 1U5KA 3UDXA 1C9OA 1VQKA 3RLOA 2UUBQ 4DKAC 1EUJA 1XNQQ 1IL2A 4IO9A 4L5TA 1Y1WG 1HH2P 1Y1VH 2ATWA 1X3FA 4PZ8A 2I5LX 4A3FG 1VQ9A 2ZM6L 1WCMH 1JB7A 2EQSA 4IPGA 1TWAH 3KFUA 1EIYB 3PIPA 1XNQL 3AEVA 2MQHA 3I4MH 2GVAA 1NMGA 3TQYA 2VUMG 3AQQA 2CWPA 2FXQA 2F4VQ 2EIFA 1Y1WH 4WJ3M 1P8LA 3KOJA 2B63H 2AMCB 4JOIC 3CC2A 1LUZA 1NE3A 1AE3A 5LMNL 1PA6A 3PGZA 3HOZG 1LTLA 4LW1A 4JI8Q 2CKZB 4J15A 3TS2A 1D8LA 1Q1BA 5IYDG 1AH9A 5LMNQ 5GROA 1ASYA 3ICEA 3S15H 2R6GA 4R4OA 1CKNA 3J81j 4OO1G 4RG1A 4JI1Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV0 Q;  2WFW A;  2K5N A;  1J5E L;  2YTX A;  3PUV A;  3F8T A;  4DV4 Q;  3ULJ A;  4BA2 I;  2I5M X;  1HZ9 A;  1V9P A;  3I55 A;  1YEZ A;  1N34 L;  5IYB G;  4B3R L;  4YWM A;  1L1O A;  3GD7 A;  3PUX A;  2K14 A;  4PMW A;  4HIK A;  2UXB L;  1A0I A;  3HFZ B;  3S2D H;  2NN6 I;  2RF4 A;  4O2D A;  4R4C A;  3GTQ H;  3KDF B;  3PO3 H;  4A3E G;  2IX1 A;  4B3S Q;  1VQF A;  1K83 H;  1UE5 A;  2B3G A;  1SRU A;  2VY3 A;  3I2Z A;  3AYH B;  1X6O A;  4IFD G;  1FGU A;  2K50 A;  4C3H H;  1SE8 A;  1KXL A;  3PUW A;  1HNW Q;  4BBS G;  2EXD A;  1OXU A;  5FJ8 G;  3G71 A;  2K4K A;  4DNI A;  1YHA A;  4JI1 L;  4Y52 H;  4DV0 L;  3S1N H;  5LMU L;  3IRB A;  2E2I H;  1OXX K;  4A75 A;  2JA5 G;  2K5H A;  1VQG A;  1YBY A;  2F3I A;  1K73 C;  2L15 A;  2LXK A;  4MTN A;  5ELO A;  4DR7 L;  4POG A;  4YHH L;  1YI2 A;  3HOX H;  3HKZ G;  5M5Y H;  1GO3 E;  3CW2 C;  1Q8K A;  5EAY A;  2A1A A;  4DR1 Q;  4IPD A;  3MXN B;  4HID A;  1JJ2 A;  4AIM A;  4DUZ L;  3RZO H;  1VQ6 A;  1KIX A;  1N32 Q;  3G48 A;  4MZ9 A;  1E3P A;  2HIX A;  4DR1 L;  1KHI A;  2KEN A;  1VQA A;  1YIT A;  3AFP A;  3PUZ A;  4L5R C;  4LF8 L;  2WAQ E;  3OYY A;  4L5Q A;  4NPS A;  3TEH B;  1L0W A;  1GM5 A;  1X3E A;  4DR5 L;  5IT9 c;  4LFB Q;  3T1Y L;  4JV5 L;  3PV0 A;  3I4N G;  1QZH A;  1I94 L;  3NBH B;  1BKB A;  3J80 i;  3ULL A;  2KHI A;  3HOZ H;  4BBS H;  4LF7 Q;  4A3L G;  3RZD H;  3I4O A;  4LUO A;  1OTC A;  2JA7 H;  2NVQ H;  4LF9 Q;  1I94 Q;  1PVO A;  3S17 H;  2Y0S E;  4OXP A;  1JJG A;  1HJP A;  2JJQ A;  5M3F H;  4LFC Q;  4DUZ Q;  2VQF Q;  3PSI A;  1YZ6 A;  1I5F A;  2JE6 I;  3ER0 A;  4AH6 A;  1G6P A;  2D62 A;  3L7Z C;  3DLL A;  2BH2 A;  1XMO Q;  1PH7 A;  4X6A H;  1IBL Q;  3DM3 A;  3HOV H;  1E1O A;  2IHF A;  3I7F A;  4DR6 L;  2YYZ A;  4O0A A;  4QGU A;  3BZC A;  4BXX H;  5IYB H;  1TWC H;  5M5W H;  3KF8 B;  2UXC Q;  4DV7 Q;  2MFI A;  3KDF A;  4KHZ A;  1TXY A;  1UE6 A;  4TVA B;  1PH4 A;  1K8A C;  1JMC A;  4QL5 A;  4BA1 I;  1XPO A;  2ES2 A;  4K0K L;  3SGI A;  1Q1E A;  2NN6 G;  2N49 A;  3D0F A;  4XTC S;  4JC0 A;  2KBN A;  4GNX C;  3KLW A;  1IBM Q;  3I4M G;  1Q12 A;  1I3Q H;  3J80 c;  1EYG A;  4K0K Q;  1SLJ A;  2R7D A;  4A76 A;  4KHP Q;  1VQE A;  3CCJ A;  1NJI C;  3RLN A;  3U4V A;  4AYB E;  1K8G A;  4A3D H;  5LMU Q;  4UPA A;  1HZB A;  3GTO H;  1OXT A;  2F52 A;  4UP8 A;  5IP7 G;  4DR3 Q;  4DR4 Q;  1MJC A;  1E7Z A;  1J6Q A;  3K8A A;  2UUB L;  3I4N H;  4PZ7 A;  4JYA Q;  1N9W A;  2NZH A;  3GTM H;  4RMF A;  5IP9 H;  4DV7 L;  2Q2I A;  1FVI A;  1VQD A;  2R92 G;  3GTL H;  3STB D;  1B70 B;  3T1Y Q;  2YTY A;  4DR2 L;  3HKZ E;  4GNX A;  4JI5 L;  3PF5 A;  1C7Y A;  4IJH A;  4GLA C;  3HOX G;  2D0P A;  4X64 L;  3CME A;  5M3F G;  4UY8 C;  4BY7 H;  2JQO A;  3CPF A;  4PZ6 A;  3H3V I;  2CFM A;  4DR2 Q;  2NVT H;  2OCE A;  3Q8D A;  4POF A;  4JI5 Q;  3CD6 A;  4DR4 L;  4BXX G;  1N32 L;  2MO0 A;  1DGS A;  2A19 A;  5M3M G;  4JI0 Q;  2LXJ A;  1UE1 A;  4DV6 L;  3UDG A;  4YWL A;  1KD1 C;  5C4J H;  4NXN L;  2AWO A;  5M5X H;  4IOA A;  3A74 A;  1QUQ A;  4DR3 L;  4JBM A;  4A3J G;  4JI3 L;  5C3E G;  1X9N A;  1XPU A;  1X54 A;  3PF4 A;  3OW2 A;  3UE1 A;  2NVY H;  4LUV A;  3K7U C;  2ZTE A;  3PIO A;  1S72 A;  3JC6 6;  3UDF A;  1Z9F A;  1HZA A;  4DK6 C;  1PHJ A;  4JI7 Q;  5C4X G;  3K81 C;  4JI6 Q;  2DGY A;  4BY1 H;  2R93 G;  3RR5 A;  1GKH A;  3S14 H;  5IYC G;  2Z0S A;  1EIF A;  1GD7 A;  1L2F A;  3FKI H;  3BU2 A;  3CCE A;  1JE5 A;  4A3M H;  2I5H A;  4BY7 G;  4DAM A;  4X65 Q;  2Z6K A;  5JJI A;  2C35 B;  1SFO H;  1E24 A;  2QEX A;  4OWX B;  2JA7 G;  4KHP L;  4JI0 L;  1IXR A;  4DV2 L;  3M9B A;  1EQR A;  1LYL A;  1Q46 A;  2K75 A;  3CP0 A;  1L1O B;  5E7N A;  5IP9 G;  4HIM A;  1XNR L;  3F2D A;  4KLK A;  5JJK A;  1QVC A;  2UU9 L;  1KAW A;  4LF4 Q;  1CKO A;  2PI2 A;  3E0E A;  3KYH C;  2E2J H;  4L5S A;  5FLM G;  1G51 A;  3TS0 A;  2LSS A;  4B3R Q;  1CKN B;  3GTJ H;  2VNU D;  1JT8 A;  3F2C A;  3HOU G;  3S16 H;  1PH8 A;  3M4P A;  1VQ8 A;  4FDB A;  5FLX c;  2Q2T A;  3J7A 5;  4UP9 A;  4BBR H;  4NXM L;  2N78 A;  4GLV B;  4B3T Q;  2YV5 A;  2AWN A;  1M90 C;  2UUA L;  1KL9 A;  1PH2 A;  1KQS A;  1Y1V G;  4HJ7 A;  4P75 A;  1HNZ Q;  5IP7 H;  4DV5 L;  2JK8 A;  3F1Z A;  3S2H H;  4A3K H;  1U0L A;  1YJ9 A;  2ZM6 Q;  4KI0 A;  2UUA Q;  3EN2 A;  2BA1 A;  2YU9 H;  4AYB G;  3UE0 A;  4GOP B;  1XNR Q;  1MKH A;  1CKM A;  3W5O A;  3CCU A;  2OTJ A;  2JA8 G;  2VUM H;  1Q7Y C;  4WJ4 A;  2IT1 A;  3KF6 B;  2I0Q A;  1VQP A;  3HOW G;  2PI2 E;  1VQC A;  5IYC H;  1RL2 A;  2GN5 A;  1VQM A;  3S1R H;  3TRZ A;  4PG3 A;  4QJF A;  4X66 Q;  3CQZ H;  1X65 A;  1B8A A;  4DAY B;  2YTV A;  4C2M H;  4DPG A;  1O7I A;  2PQA A;  3L0O A;  4R1J A;  3EBE A;  1YJN A;  4R4I A;  4HJ5 A;  1VQJ A;  1YJW A;  4A93 G;  4GN3 B;  1XMQ Q;  4APV A;  2WAQ G;  4A4I A;  2WB1 G;  3PO3 G;  4YCW A;  4DV5 Q;  4HJ9 A;  3CCR A;  4DV4 L;  1UWV A;  1OXS C;  4DUY L;  1X56 A;  4HJ8 A;  3HOU H;  2JA8 H;  1XMO L;  2Y0S G;  4A93 H;  3CCV A;  1IBL L;  4P73 A;  4P74 A;  3MEF A;  4JV5 Q;  1VQO A;  3TRE A;  3VDY A;  2ZJR A;  2B63 G;  1HZC A;  4A3B H;  2AKW B;  3H3V H;  5GAG C;  4JBW A;  4NB3 A;  4BY1 G;  1IZ6 A;  4JI4 L;  3CAM A;  4LF8 Q;  2R93 H;  2UXD L;  2OTL A;  3AFQ A;  1UE7 A;  3NEN A;  2CCZ A;  2IHE A;  1S3O A;  4DV2 Q;  3A0J A;  2UXD Q;  1NMF A;  3M4Q A;  2PMZ E;  1WI5 A;  3OTO L;  1VQI A;  1GVP A;  2B29 A;  3G4S A;  3GTP H;  1X3G A;  4R4T A;  4A3C H;  4Y7N H;  3J7Z C;  4DV1 Q;  4GOP A;  2GVB A;  3BZK A;  5FLM H;  3ULP A;  3OTO Q;  4QY7 A;  4DUY Q;  3NEL A;  4OON A;  2H5X A;  4XIG S;  3CC4 A;  4DV1 L;  3I56 A;  3E9I A;  1BBU A;  4R4Q A;  1YHB A;  1R9T H;  1N33 L;  1UEB A;  5FJ8 H;  2Q2H A;  4BBR G;  4YWK A;  3A5Z B;  4B3T L;  4A3D G;  4JI2 Q;  2OQK A;  3CCS A;  4ALP A;  5J3B A;  2RHQ B;  3CF5 A;  4LF7 L;  2UXB Q;  2R7F A;  1PH9 A;  3U4Z A;  1Y14 B;  1MIU A;  1NTG A;  2WB1 E;  4A3E H;  2Z6K C;  2KHJ A;  1KC8 C;  3H0G H;  5AJ3 L;  1EFW A;  3PO2 G;  3D31 A;  1VQ5 A;  3B6Y A;  2HIV A;  4YHH Q;  1Q86 C;  3GDE A;  5IE8 A;  1AE2 A;  1VQB A;  3EIV A;  1XMQ L;  3FHW A;  1NY4 A;  2N3S A;  2VQF L;  2PQA B;  4TQU S;  4OWT B;  3U50 C;  4JI8 L;  1WYD A;  5C0X J;  1Q81 C;  2E8G A;  5AJ3 Q;  1QZG A;  2MO1 A;  3H15 A;  3S1M H;  2VQE L;  4GLX A;  4IPH A;  4UP7 A;  1I50 H;  2HHH Q;  4YY3 Q;  5IWA Q;  4C3J H;  5C0X G;  4OO1 I;  1T9H A;  4LUZ A;  1Q82 C;  1N33 Q;  2ZTD A;  2DUD A;  2XGT A;  2XTI A;  5K36 G;  1YIJ A;  4DR7 Q;  1QUQ B;  1PYS B;  2JA9 A;  2VW9 A;  2HHH L;  5IWA L;  1PH1 A;  4HIO A;  1VQN A;  1SN8 A;  1A62 A;  1I6H H;  2JEA I;  4JI6 L;  4A3C G;  4ME3 A;  3PUY A;  1QVF A;  4LFA Q;  2UUC Q;  4GKK L;  3KF6 A;  5JEA J;  1K3R A;  5HGQ A;  4HJA A;  2E5L L;  4JBK A;  4OWW B;  5JJL A;  2VS1 A;  2IY5 B;  2E2H H;  3M85 A;  2VZA A;  4A3J H;  4DV6 Q;  4A3L H;  1VS0 A;  2AHO B;  3RN2 A;  1CUK A;  4A3I H;  3KJO A;  1V1Q A;  4LF9 L;  1YNX A;  3U58 A;  3RNU A;  3G6E A;  2E5L Q;  1W2B A;  3CMA A;  4GKJ Q;  4A3G G;  2BA0 A;  1HNX L;  3ERS X;  5C4X H;  3CPW A;  1HNW L;  4A3B G;  1KRS A;  4QIW E;  3CCL A;  3M4O H;  4IFD J;  1FJG Q;  1WOC A;  3J81 i;  1N34 Q;  4IFD I;  4JI4 Q;  4DV3 L;  4LF5 L;  4LFB L;  3L2P A;  2ZTC A;  3JAM i;  4A3K G;  3S1Q H;  1N36 L;  1PYB A;  1FJG L;  5IYD H;  2N8N A;  3JAM c;  2R92 H;  4A3G H;  2UXC L;  3CXC A;  5M3M H;  3T1H L;  3RLF A;  2R7Z H;  3CCM A;  1HR0 Q;  3HOW H;  4QQB X;  2Q2U A;  3HOY H;  1SR3 A;  4JOI A;  3W1G A;  2WP8 J;  4EX5 A;  3A5U A;  1JJC B;  1VQH A;  2QA4 A;  1TWG H;  5BR8 L;  2ALY B;  2VL6 A;  4JG2 A;  5C3E H;  2ZJQ A;  2A8V A;  3M7N A;  1HR0 L;  4P72 A;  2MNA A;  3UDI A;  4YY3 L;  1NBW A;  1OXV A;  2CQO A;  2IX0 A;  5LMN W;  2UU9 Q;  4LF4 L;  4GKJ L;  1FL0 A;  1M1K C;  4JI3 Q;  2VQE Q;  4DR6 Q;  1BVS A;  5DLQ E;  5HY6 A;  3HOY G;  1C0A A;  4P71 A;  4AQY L;  1XPR A;  4DV3 Q;  4GN5 A;  3W1B A;  1TWH H;  4DR5 Q;  4LF5 Q;  1KRT A;  1B7Y B;  3K7A H;  4A3F H;  2JA6 H;  5GQO A;  4JYA L;  1L1O C;  2OQ0 A;  3KJP A;  4NXM Q;  1PH5 A;  2K52 A;  4MNO A;  3GTK H;  4X62 L;  1XJV A;  2F4V L;  4H02 A;  1PFS A;  4GS3 A;  3GTG H;  1SMX A;  1A8V A;  2D0O A;  3CCQ A;  3RN5 A;  5JEA G;  1VQ7 A;  3PO2 H;  3GO5 A;  4LFC L;  5GAD C;  4IPC A;  4DK3 C;  1BBW A;  5IY0 A;  1ASZ A;  1K0R A;  4B3M Q;  1SRO A;  2PNH A;  5GAH C;  4GNX B;  5C0X I;  3S24 A;  2RHS B;  4LF6 Q;  1HNX Q;  3ZJY C;  4YCU A;  5GAE C;  5C44 G;  4NXN Q;  3J81 c;  1EWI A;  4B3M L;  1RIP A;  1EOV A;  3BJU A;  3FKI G;  3PCO B;  3NEM A;  4A3M G;  1E1T A;  1MJE A;  3F2B A;  2HT1 A;  3HOV G;  1YVC A;  2OWO A;  2R7Z G;  1N8R C;  1IBK L;  1G29 1;  2RCN A;  2UUC L;  3CC7 A;  4LFA L;  1XTD A;  4GOP C;  1TWF H;  1CSP A;  2BH8 A;  4JBJ A;  4GKK Q;  4IJL A;  1YHQ A;  1IBM L;  1WFQ A;  3K80 C;  5C44 H;  1IBK Q;  4JI7 L;  4LF6 L;  3M3Y H;  1HNZ L;  1IYJ B;  4EQ5 A;  4B3S L;  2JA6 G;  4X65 L;  2NZO A;  1P16 A;  3HKS A;  4JCV E;  2JA5 H;  1J5E Q;  2HQL A;  1H95 A;  1X55 A;  2ZJP A;  4A3I G;  1QVG A;  2JEB I;  3H0G G;  5ELN A;  1PV4 A;  1WCM G;  3FP9 A;  3K0X A;  1PH6 A;  2V1C C;  1HR0 W;  2KCT A;  1S40 A;  4LNQ A;  4OX9 L;  5H1S E;  2CWA A;  3LGJ A;  1N36 Q;  2NVX H;  2ID0 A;  4AQY Q;  3STB C;  4LWC A;  4X66 L;  2K5V A;  2KCM A;  1D7Q A;  1A63 A;  4YCV A;  1VQ4 A;  1V43 A;  2QGQ A;  3T1H Q;  1K9M C;  4OX9 Q;  1CSQ A;  3WWV A;  1VQL A;  1EQQ A;  4X64 Q;  1W3S A;  3E9H A;  1E22 A;  1WJJ A;  4X62 Q;  1PH3 A;  4JI2 L;  1LM0 A;  5BR8 Q;  1Z47 A;  1VCI A;  4C3I H;  4IOC A;  2ASB A;  4GN4 B;  1U5K A;  3UDX A;  1C9O A;  1VQK A;  3RLO A;  2UUB Q;  4DKA C;  1EUJ A;  1XNQ Q;  1IL2 A;  4IO9 A;  4L5T A;  1Y1W G;  1HH2 P;  1Y1V H;  2ATW A;  1X3F A;  4PZ8 A;  2I5L X;  4A3F G;  1VQ9 A;  2ZM6 L;  1WCM H;  1JB7 A;  2EQS A;  4IPG A;  1TWA H;  3KFU A;  1EIY B;  3PIP A;  1XNQ L;  3AEV A;  2MQH A;  3I4M H;  2GVA A;  1NMG A;  3TQY A;  2VUM G;  3AQQ A;  2CWP A;  2FXQ A;  2F4V Q;  2EIF A;  1Y1W H;  4WJ3 M;  1P8L A;  3KOJ A;  2B63 H;  2AMC B;  4JOI C;  3CC2 A;  1LUZ A;  1NE3 A;  1AE3 A;  5LMN L;  1PA6 A;  3PGZ A;  3HOZ G;  1LTL A;  4LW1 A;  4JI8 Q;  2CKZ B;  4J15 A;  3TS2 A;  1D8L A;  1Q1B A;  5IYD G;  1AH9 A;  5LMN Q;  5GRO A;  1ASY A;  3ICE A;  3S15 H;  2R6G A;  4R4O A;  1CKN A;  3J81 j;  4OO1 G;  4RG1 A;  4JI1 Q; 
#chains in the Genus database with same CATH topology
 4DV0 Q;  2R3Z A;  2WFW A;  2YTX A;  3F8T A;  2I5M X;  2RVL A;  5CV7 A;  1HZ9 A;  2QCP X;  3I55 A;  1N34 L;  2EY2 A;  3AU7 A;  2OXP A;  4YWM A;  3GD7 A;  4PMW A;  1EZ8 A;  4ZKC B;  3D4R A;  2RF4 A;  3OIQ A;  3PO3 H;  2VXW A;  3KDF B;  3GTQ H;  2IX1 A;  1RKN A;  1VQF A;  5EKL A;  1K83 H;  1UE5 A;  2VY3 A;  2VUM B;  3AYH B;  1X6O A;  1FGU A;  2K50 A;  1XTC D;  4PMB A;  2I46 A;  1KXL A;  3PUW A;  2SNS A;  4A3I B;  3IFT A;  4QB4 A;  4Y52 H;  1K83 B;  3D6C A;  2JA5 G;  1VQG A;  1TS4 A;  2F3I A;  5E1F A;  2L15 A;  2LXK A;  1MSH A;  5ELO A;  4MIU A;  5KYI A;  4FF3 A;  3HKZ G;  3K7A B;  1KNA A;  1Q8K A;  3K0Y A;  3MXN A;  2A6E C;  3HOU B;  4RCO A;  5I6Y A;  1N32 Q;  4MZ9 A;  4DR1 L;  2KEN A;  1STN A;  1FGB D;  5C5M A;  1RCV D;  4NPS A;  3TEH B;  1JCK B;  2HUG A;  1L0W A;  1PRT D;  4WJW A;  1X3E A;  1EU3 A;  1G2T A;  1I3Q B;  1LTT D;  4DK0 A;  4JV5 L;  1TS3 A;  5FO8 B;  4K5X A;  4LF7 Q;  1ZKO A;  2B2Y C;  3VR2 A;  4IFD H;  1ICF B;  4FF4 A;  2HCC A;  1I94 Q;  3S17 H;  2Y0S E;  1HJP A;  2J7Z A;  3D8G A;  3VA5 A;  4LFC Q;  3PIP 3;  1MSG A;  4G7Z C;  2VQF Q;  4XQN A;  4J1M A;  3ER0 A;  2Z9H A;  3L7Z C;  1Y69 U;  1QNU A;  4A3K B;  4X6A H;  3DM3 A;  1SJH D;  3I7F A;  2IHF A;  1NUC A;  4E6I A;  2UXC Q;  4LF8 L;  4OGQ C;  2EYO A;  1PH4 A;  4BA1 I;  1SE4 A;  5D3I B;  1XPO A;  4LJZ C;  3D0F A;  4GNX C;  1IBM Q;  1SLJ A;  2R7D A;  1EFI D;  4O42 A;  1VQE A;  2JYO A;  5ELD A;  3U4V A;  4AYB E;  3NTK A;  3I8Z A;  3CRK C;  1C8C A;  4CDF C;  2N88 A;  1J6Q A;  2K04 A;  3K8A A;  3I4N H;  5KIX A;  4L6T B;  1QB5 D;  2NZH A;  3VYS A;  1FVI A;  1RD9 D;  4GNX A;  4JI5 L;  1II3 A;  4GLA C;  3HOX G;  5M3F G;  1EY4 A;  4ZK9 B;  1IW7 C;  1ET9 A;  3X3M A;  3H3V I;  2NVT H;  3Q8D A;  1SSO A;  3QG1 A;  1N32 L;  1BCP D;  1PTO D;  4RCN A;  4YWL A;  3A74 A;  4JBM A;  2F0G A;  4A3J G;  1IYV A;  2F0O A;  3A8J E;  3EQL C;  3A56 A;  4LUV A;  3K7U C;  2ZTE A;  5DEH A;  4BBR B;  1KDB A;  4J8Q A;  2B2Y A;  3K81 C;  4BY1 H;  2XIW A;  3D4D A;  5IYC G;  3GTJ B;  2Z0S A;  3FKI H;  4QF4 A;  3A7A B;  3T4A C;  1JE5 A;  3CCE A;  2PZT A;  4KY5 A;  1B44 D;  1S5D D;  2ZXP A;  3R8B A;  3S1M B;  1Q46 A;  2A6H C;  3F2D A;  4KLK A;  1KAW A;  3MXU A;  1CKO A;  3KYH C;  1CZG A;  1SYD A;  1JQY D;  4N8X 1;  1G51 A;  2RCF A;  1NSN S;  1STY A;  5JVH 3;  1CKN B;  3DEP A;  1MHW C;  5I6W A;  3J7A 5;  5CBA E;  4X3U A;  5F2D A;  2QIL A;  3HRZ C;  1G8Z D;  2G5D A;  4P75 A;  1HNZ Q;  3F1Z A;  1YJ9 A;  4IUP A;  2YU9 H;  3J7Y W;  5CGK A;  1CKM A;  3CCU A;  4FF1 A;  2VUM H;  1Q7Y C;  3KF6 B;  4RGO S;  2I0Q A;  3HOW G;  3PO3 B;  1BBX C;  1WTP A;  4R9W A;  1DON A;  4DAY B;  1SMY D;  4A3F B;  1O7I A;  5IGD A;  4R1J A;  4R4I A;  1YJW A;  4A93 G;  1ZEQ X;  2WAQ G;  2WB1 G;  4YCW A;  1TT2 A;  1U4P A;  5IOC A;  3O13 A;  3SVM A;  2B2U C;  1PFB A;  3S9W A;  4P73 A;  4CJ0 B;  3HOW B;  4A3E B;  3V2T A;  3FKI B;  2B63 G;  3I73 A;  3KBX A;  2XWB B;  3DM1 A;  4IUQ A;  2R93 H;  4LF8 Q;  5E4X A;  1UE7 A;  2IHE A;  1FNV A;  2F0S A;  1NMF A;  3C1E A;  1PYW D;  3M4Q A;  3V05 A;  3TN2 A;  3TP8 A;  1F9R A;  3GTP H;  4A3C H;  2F0U A;  3OWE B;  2GVB A;  2N55 A;  3BZK A;  2PMZ B;  3CU7 A;  1E2V A;  4OON A;  4XIG S;  1FNW A;  1YHB A;  2JA7 B;  1UEB A;  4DAV A;  3A5Z B;  1GUO A;  1NNX A;  4ZLT F;  4CDE C;  4RGM A;  2RHQ B;  2XNA C;  3U4Z A;  1NTG A;  1KC8 C;  5AJ3 L;  3D31 A;  3GDE A;  1XMQ L;  2VQF L;  1NY4 A;  1QZG A;  1WYD A;  2DY7 A;  1CK1 A;  4IUV A;  3TBI B;  2H4O A;  2MO1 A;  3H15 A;  4IPH A;  1L0X B;  3MHB A;  2I07 B;  4UP7 A;  2BOS A;  4OO1 I;  3OMG A;  5C44 B;  5CR3 A;  1CQF A;  4DFA A;  5JAV A;  3S14 B;  1QUQ B;  2A68 C;  2HHH L;  5IWA L;  4HIO A;  1B9N A;  3P1H A;  3PUY A;  3KF6 A;  1UNS A;  5JEA J;  1AZQ A;  2E5L L;  3M4O B;  2L5T A;  3M85 A;  1CUK A;  3KJO A;  5KEE A;  3A54 A;  2X69 A;  2BA0 A;  4HAE A;  1HNW L;  4A3J B;  4A3B G;  1FJG Q;  3GTG B;  2EJM A;  4NMZ A;  1Y8P B;  2PW5 A;  5EGT A;  1QIL A;  3L2P A;  1HFG A;  4QMG A;  1EWC A;  2UXC L;  3OW7 A;  1KDA A;  2R7Z H;  3DXJ C;  4KJN A;  1HR0 Q;  3HOW H;  1JJC B;  3NWT A;  3SHL A;  4P72 A;  1AN8 A;  5JVG 3;  1U4L A;  1NBW A;  3BVG A;  2CQO A;  5I9P A;  4UDU C;  1M1K C;  3FDT A;  2TMP A;  3IKJ A;  5C6A A;  1C0A A;  4P71 A;  2PO4 A;  4AQY L;  4LF5 Q;  4GN5 A;  3K7A H;  2JA6 H;  1YNN D;  4A3F H;  4KY7 A;  4A3G B;  4JYA L;  2OQ0 A;  3KJP A;  1PH5 A;  1STA A;  4X62 L;  1XJV A;  3IAY A;  1SXT A;  3U9O A;  2A6H D;  3TDQ A;  3RN5 A;  5CMD A;  1XX8 A;  4R8I A;  3LX0 A;  2EYF A;  2YU9 B;  1BBW A;  5KNC A;  5FO7 B;  4J6H A;  3QR8 A;  3K5N A;  3QB3 A;  3FPU B;  2NB0 A;  4GNX B;  1EU4 A;  3S24 A;  3NWS A;  1HNX Q;  1RIP A;  3GTQ B;  4BY7 H;  4NKL A;  3HOV G;  2OWO A;  4QIW B;  3K59 A;  1IBK L;  1G29 1;  2BH8 A;  4JBJ A;  4IJL A;  3QO2 A;  2NZ1 D;  3M3Y H;  2FMC A;  3SR1 A;  2IJ0 A;  4EQ5 A;  1HNZ L;  2H1E A;  4XYQ A;  2JA6 G;  4X65 L;  4JCV E;  1BUV T;  2HQL A;  4DR4 L;  5ELN A;  3SK6 A;  2ENB A;  4IZ8 A;  2CWA A;  5H1S E;  2ID0 A;  1BCP C;  1PTO C;  4LWC A;  3SK5 A;  1KAB A;  4YCV A;  3WWV A;  5E3F A;  4OIK A;  2X6L A;  1PH3 A;  1PRT F;  1Y1V B;  2K5W A;  3UDX A;  3SEB A;  3RLO A;  2UUB Q;  4IO9 A;  1UUP A;  2KJX A;  1KLU D;  2QKI C;  3DWQ A;  4C3I B;  2EQS A;  1TWA H;  4C3I G;  1EIY B;  3PIP A;  1XNQ L;  2GVA A;  4DXF A;  5FLX L;  1IHZ A;  2VUM G;  2P5Z X;  3BZD B;  3MWY W;  2AMC B;  3ONA B;  3TZD A;  1J8I A;  3J81 E;  5LMN L;  1D5X C;  2K5D A;  2F03 A;  2DJG C;  4J15 A;  1HCZ A;  1D5Z C;  1F9Q A;  1D8L A;  2DN8 A;  1ASY A;  3S15 H;  5JEA H;  3J81 j;  4RG1 A;  3TP5 A;  2CH4 A;  2K5N A;  3RD4 A;  1TII D;  2Z8L A;  5IYB G;  4BWG B;  3HOX B;  1L1O A;  1NR2 A;  4HIK A;  3S1Q B;  3KBG A;  1SNP A;  2UXB L;  1A0I A;  4OL7 A;  5I9O A;  4R4C A;  1TWA B;  4KV6 A;  2E2I B;  2B3G A;  3HS0 C;  3I2Z A;  1QCB D;  4IFD G;  2EE1 A;  1HNW Q;  3GTP B;  2EXD A;  1OXU A;  4CBV A;  5FJ8 G;  1G6Z A;  2K4K A;  1X3Q A;  1YHA A;  4DNI A;  1MI2 A;  5LMU L;  3N52 A;  3S17 B;  1YBY A;  1D2B A;  5HGT A;  1DYQ A;  4YHH L;  5CYU A;  1GO3 E;  3CW2 C;  1QJO A;  2G9H D;  3BG3 A;  3MXN B;  3MA2 B;  4AIM A;  4RH6 A;  4B08 A;  4C56 C;  4JK1 C;  3RZO H;  1FR3 A;  3G48 A;  5JOB A;  2AQ2 B;  4C3H G;  1EQV A;  1VQA A;  3AFP A;  3PUZ A;  2WAQ E;  2NWG A;  4HMJ A;  3J80 E;  1DXM A;  5FK9 C;  3PV0 A;  1PZJ D;  5JPM C;  5BN4 A;  3I4N G;  1QZH A;  1I94 L;  3NBH B;  3ULL A;  2L1B A;  3WDN A;  3I4O A;  4BY7 B;  4LUO A;  2AUJ D;  4LF9 Q;  1JJG A;  3R2T A;  5M3F H;  4YIJ A;  5C4X B;  2V4D A;  3K5M A;  1I5F A;  5M5X B;  2JE6 I;  1D1I A;  4I7Z C;  1G6P A;  1Q90 A;  1XMO Q;  4QCL A;  1LTS D;  3Q0A A;  2YYZ A;  4QGU A;  3KF8 B;  4DV7 Q;  2F0I A;  4KHZ A;  4TVA B;  1TXY A;  1K8A C;  1S5C D;  2KOL A;  1Q1E A;  3K5O A;  1A3T A;  2L9H A;  4JC0 A;  4XTC S;  3KLW A;  3I4M G;  1EYG A;  5D65 A;  3J80 c;  4K0K Q;  1D5M C;  1LAC A;  2SDF A;  3CCJ A;  2J4X A;  1NJI C;  4UPA A;  1QWY A;  1OXT A;  2LMC B;  4KKT A;  2VB3 X;  4UP8 A;  5IP7 G;  4DR3 Q;  3T53 B;  2R92 G;  1B70 B;  3URY A;  3T1Y Q;  1C7Y A;  4DF7 A;  3BDO A;  3CME A;  4UY8 C;  1U4M A;  3C3L A;  1SYB A;  2PYK A;  3I4M B;  2KED A;  2OCE A;  3FEW X;  2WV6 D;  5TSS A;  2MO0 A;  4IUT A;  1DGS A;  2A19 A;  1CQV A;  5M3M G;  1TU2 B;  4DV6 L;  1OO9 B;  1ROD A;  5C4J H;  3MTS A;  1HFN A;  1XPU A;  5C3E G;  1I4X A;  3UE1 A;  2A69 C;  3QOJ A;  3PIO A;  3GTK B;  1S72 A;  3JC6 6;  4BBS B;  5C4X G;  1HZA A;  1PHJ A;  4L63 B;  4JI6 Q;  1O7Z A;  3RR5 A;  3S14 H;  1L2F A;  4BY7 G;  3J7A F;  3FPP A;  2E2J B;  5C0X H;  1BF4 A;  1CTM A;  2JA8 B;  3KK7 A;  1BCP F;  1PTO F;  2JA7 G;  4KHP L;  2A73 B;  3M9B A;  1CHP D;  2K75 A;  1EY0 A;  4KD4 A;  1H9R A;  5E7N A;  4G7O C;  1HHV A;  1XNR L;  5JJK A;  1YNJ D;  2Z6B A;  4LF4 Q;  5K36 H;  1C4Q A;  2OEO A;  2PI2 A;  3E0E A;  3I3C A;  1EQT A;  3FMC A;  5FLM G;  3TS0 A;  2F0H A;  2E75 C;  1TWF B;  2VNU D;  4C2M B;  4NP5 A;  1T5X D;  3UI2 A;  4FDB A;  2HD3 A;  4WRD A;  4NXM L;  4MHE A;  1CT1 D;  3ND9 A;  5I2X A;  1KL9 A;  1KQS A;  2XN9 C;  4RHR A;  1RJT A;  4DV5 L;  2JK8 A;  3J80 L;  4A3K H;  1U0L A;  2ZM6 Q;  4KI0 A;  3T51 B;  2UUA Q;  5E4W C;  3EN2 A;  4C3H B;  2E76 C;  4DAY A;  1LO5 D;  3UE0 A;  4GOP B;  1MKH A;  4WJ4 A;  2JA8 G;  5FO9 B;  4C1N K;  1VQP A;  2TSS A;  3BVM A;  1RL2 A;  1VQM A;  4QJF A;  3ND8 A;  2A6E D;  2F3W A;  1HA5 A;  3H94 A;  5IT9 L;  3TME A;  1JE4 A;  2PQA A;  3L0O A;  3EBE A;  2XRS D;  4GN3 B;  4A4I A;  3PO3 G;  1BO0 A;  5DM6 3;  4DV4 L;  4H13 C;  1O78 A;  2EYM A;  2CW0 D;  1SBB B;  4IUU A;  1OXS C;  2E74 C;  1SFO B;  4RGN A;  4HJ8 A;  3HOU H;  4HSV A;  4A93 H;  3MEF A;  4JV5 Q;  4PNY A;  5EBC A;  3TRE A;  4A3M B;  3BVZ A;  4JBW A;  4NB3 A;  4BY1 G;  4JI4 L;  3QJY A;  3CAM A;  2UXD L;  2F0L A;  3NBI A;  5DNF A;  2GA4 B;  4WOR A;  4H44 C;  2NVY B;  2CW0 C;  3A0J A;  2SEB D;  3A8I E;  2O5J C;  1WTO A;  2B29 A;  5JPN C;  1LTG D;  4DV1 Q;  4GOP A;  3HZX A;  4P2C B;  2AQ1 B;  4OHJ A;  5C4H A;  4DUY Q;  3NK9 A;  4V0B A;  4NW2 A;  4R4Q A;  5FJ8 H;  3CHB D;  4YWK A;  4BBR G;  4H7B A;  1STB A;  2UXB Q;  1PH9 A;  4PQX A;  1Y14 B;  2Z6K C;  3MFY A;  3H0G H;  1EFW A;  1K0S A;  4OEL B;  4CDD C;  4TSS A;  5ELC A;  2N3S A;  2KHS A;  3U50 C;  1WD1 A;  5BN5 A;  2VQE L;  3S1M H;  4GLX A;  2PW7 A;  1I4Q A;  2HHH Q;  2B2W C;  1WD0 A;  4C3J H;  5C0X G;  4LUZ A;  3NE5 B;  2RDG A;  3DWA A;  2XGT A;  5M5Y B;  1YIJ A;  2VW9 A;  2KA7 A;  2EYJ A;  1KTK A;  1VQN A;  1S5F D;  5CV6 A;  3W2D A;  1I6H H;  1IW7 D;  3ZYY X;  5J39 A;  4JI6 L;  2EPB A;  4LFA Q;  2UUC Q;  4GKK L;  1JIC A;  1K3R A;  4HJA A;  2XVS A;  4B9W A;  2IY5 B;  3HOV B;  4EQN A;  1GJX A;  1V1Q A;  1YNX A;  3U58 A;  5IGF A;  4XDX A;  3GQB A;  1ESR A;  1GUG A;  5A35 A;  1EOT A;  4IFD I;  3PIO 3;  2NVQ B;  2NVT B;  4LF5 L;  4CGY B;  3AB9 A;  4A3K G;  2FHT A;  4HTH A;  1PYB A;  3IFD A;  3E3X A;  4K6L A;  5IYD H;  2N8N A;  3WOF A;  3JAM c;  5KNB A;  1EYA A;  3T1H L;  3HG9 A;  4U68 A;  3CCM A;  2Q2U A;  4C3J G;  3HOY H;  2WKD A;  1SR3 A;  4JOI A;  3W1G A;  4EX5 A;  5ELF A;  2ZJQ A;  2ALY B;  2D9U A;  3WOE A;  3UDI A;  2F0Q A;  2IX0 A;  2KVM A;  4LF4 L;  4GKJ L;  3EVQ A;  1X32 A;  1EEI D;  3BDC A;  2WKC A;  1S4Z A;  1JOR A;  1XPR A;  2EY5 A;  4L8J A;  3W1B A;  2MP1 A;  4DR5 Q;  3TZU A;  1L1O C;  1O7Y A;  4NXM Q;  3SK8 A;  2K52 A;  4F87 A;  2AQ3 B;  2G9D A;  4DU9 A;  1X3P A;  4H02 A;  2F4I A;  4K5V A;  1A8V A;  3KF8 A;  4XT3 B;  5L37 A;  4S3S A;  1DCZ A;  1TY2 A;  3PO2 H;  2D2C C;  3GO5 A;  5GAD C;  1K0R A;  1STH A;  4B3M Q;  3S2H B;  2PNH A;  5GAH C;  3OHX C;  1SNC A;  1F2Z A;  3J81 c;  1EWI A;  3E0J A;  3K57 A;  2M00 A;  3NEM A;  4EQP A;  3F2B A;  1MJE A;  2F0M A;  3HP3 A;  1EY9 A;  2UUC L;  4LFA L;  4GKK Q;  5IOD A;  4DAP A;  2NUC A;  1YHQ A;  1RTN A;  2F0T A;  3GTO B;  1H9J A;  2SNM A;  2NZO A;  1DOM A;  1V1O A;  4JI1 Q;  1TWG B;  2JA5 H;  1QOH A;  1J5E Q;  4C1N I;  4A3I G;  2ZJP A;  1QVG A;  3H0G G;  4FNF A;  3K0X A;  3V96 A;  2Y0S B;  1PH6 A;  2B2T A;  3LGJ A;  2NVX H;  4AQY Q;  4LAA A;  1D7Q A;  4X66 L;  1A63 A;  1VQ4 A;  4I65 A;  1K9M C;  1VQL A;  4X64 Q;  3KLS X;  3E9H A;  3E5S A;  1E22 A;  1LM0 A;  2QF7 A;  1Z47 A;  1VCI A;  2WAC A;  4KHV A;  1STE A;  1PDQ A;  3IL8 A;  3FRP B;  3PMF A;  1XNQ Q;  1IL2 A;  1Y1W G;  1HH2 P;  1HPC A;  4ZRZ A;  4MTK A;  2K1B A;  1X3F A;  1O7L A;  5EJW A;  1WCM H;  1JB7 A;  4IPG A;  3AEV A;  2KCN A;  2X6G A;  2MQH A;  1B9M A;  3M4Y A;  1JWS D;  1Q8I A;  4WJ3 M;  1P8L A;  3KOJ A;  2B63 H;  2K5Q A;  4JOI C;  4KTA A;  4X3T A;  3GTM B;  4TKO B;  1PA6 A;  1AE3 A;  1WTQ A;  1LTL A;  3OWF A;  2EOT A;  3LWE A;  4TRD A;  4OIJ A;  5IYD G;  1AH9 A;  2R6G A;  3OTO L;  5CV4 A;  5IGG A;  4DV4 Q;  3DWP A;  1G91 A;  4RKL A;  5LHY 1;  1V9P A;  5A2Q E;  4B3R L;  3PUX A;  1F2L A;  4IAL A;  4N9P A;  3QOL A;  1F77 A;  4HSP A;  3HFZ B;  3S2D H;  1YNJ C;  2NN6 I;  4O2D A;  4A3E G;  1TS2 A;  1TQO A;  5G3L F;  2JP1 A;  1BNZ A;  2L0C A;  2PZW A;  1SE8 A;  5C4J B;  2F0J A;  3NP8 A;  3W3A A;  4JI1 L;  3S1N H;  3IRB A;  1I4H A;  3J81 L;  4A75 A;  5EPK A;  2HQE A;  3GV3 A;  5FLX E;  1YI2 A;  5M5Y H;  3U9S A;  4KN7 C;  5EAY A;  4DR1 Q;  3MEH A;  1E3P A;  2HIX A;  1LAB A;  1K3B C;  2PNR C;  5C3E B;  1YIT A;  1ILP A;  1A3V A;  4L5R C;  3OYY A;  1GM5 A;  2EY1 A;  2B39 A;  4DR5 L;  5IT9 c;  1C48 A;  3BS1 A;  5FKA C;  5M3M B;  4RFB A;  2R92 B;  1UAP A;  1BKB A;  3J80 i;  2EYH A;  3HOZ H;  4A3L G;  3S1R B;  1OTC A;  4UAI A;  3ERQ A;  1WVL A;  2K05 A;  2KCC A;  4CHT B;  4OXP A;  1LT6 D;  5CV9 A;  4DXG A;  4DUZ Q;  4OO1 H;  2IL8 A;  1PRT C;  3H09 A;  1XWE A;  3DLL A;  2EYL A;  2BH2 A;  1EY5 A;  1K8O A;  1EL0 A;  4DR6 L;  1QE6 A;  1EY8 A;  1ZXT A;  3BZC A;  2K33 A;  5M5W H;  2WII B;  1JOK A;  2C5C A;  2MFI A;  2ES2 A;  1TVX A;  3SGI A;  2BCO A;  2NN6 G;  1ILQ A;  3JAM L;  2KBN A;  1MGS A;  1Q12 A;  1ZYR D;  4A76 A;  4V19 0;  1BDO A;  1I50 B;  4ODG A;  4OO1 G;  3DUZ A;  3NQI A;  3D4W A;  5LMU Q;  4MN3 A;  1BOS A;  3GTO H;  2F52 A;  4DR4 Q;  1MJC A;  1E7Z A;  5M9O A;  2UUB L;  2EDG A;  4CKB A;  1N9W A;  3GTL H;  4RMF A;  2Q2I A;  2ZT9 C;  1VQD A;  3STB D;  5KRU A;  4ZUI A;  1PMR A;  3HKZ E;  3PF5 A;  4K5W A;  1VF5 C;  2EJG C;  2IW3 A;  2QDL A;  1FYC A;  1B53 A;  1CM9 A;  4DR2 Q;  3CD6 A;  4JI5 Q;  5ELB A;  1BCP B;  1PTO B;  2LXJ A;  1A15 A;  1UE1 A;  3UDG A;  1KD1 C;  1ENA A;  4NXN L;  3VR4 A;  2AWO A;  4IOA A;  4HMI A;  3PO2 B;  3QIA A;  1QUQ A;  2F0P A;  4F8M A;  2E2H B;  4IUR A;  3PF4 A;  2CH4 W;  1RHP A;  4G7H C;  4ZYS A;  4JI7 Q;  1U4R A;  5LL6 S;  4NDX A;  4DNR B;  1I6V C;  3RZD H;  1EIF A;  1S5E D;  3BU2 A;  1TR5 A;  2I5H A;  1XYI A;  4DAM A;  2Z6K A;  4U67 3;  2C35 B;  2M9V A;  3VR5 A;  4G57 A;  2B8F A;  2QEX A;  4JI0 L;  4DV2 L;  1EQR A;  1B3Q A;  1L1O B;  4HR7 B;  4A3D B;  5IP9 G;  4HIM A;  1SYF A;  4XYO A;  1QVC A;  1I4G A;  4DK1 A;  2E2J H;  1Z7T A;  3I72 A;  1VDZ A;  1GHJ A;  2LSS A;  1ICW A;  2RSO A;  4B3R Q;  1RTO A;  1JT8 A;  4QUF A;  3HOU G;  3MVV A;  3S16 H;  1PH8 A;  3M4P A;  1VQ8 A;  5FLX c;  1JOO A;  4UP9 A;  4ZKB B;  2MJ8 A;  4B3T Q;  2YV5 A;  2AWN A;  1M90 C;  2UUA L;  3NUC A;  1TWC B;  4IQZ A;  4HJ7 A;  5C3X A;  5T1G A;  3EFX D;  1PXU A;  2BA1 A;  4AYB G;  3NHH A;  1H9K A;  2OTJ A;  3W5O A;  3G7L A;  1D1K A;  2PI2 E;  2GN5 A;  2Z4I A;  4X66 Q;  3GP7 A;  1X65 A;  1B8A A;  1V8Q A;  1RDP D;  1RF2 D;  2YTV A;  3VR6 A;  2NTT A;  1YJN A;  4HJ5 A;  1VQJ A;  1CFM A;  4EQO A;  2XRQ D;  4HJ9 A;  3CCR A;  2NN6 H;  2F0E A;  4LK1 C;  4DUY L;  3HEJ A;  1X56 A;  1XMO L;  2Y0S G;  1SYC A;  3CCV A;  3H0G B;  1FNU A;  2XSC A;  1H9M A;  4IUN A;  3VDY A;  4A3B H;  1GUW A;  5GAG C;  4KY6 A;  2Z1C A;  4KK7 A;  3SK4 A;  2OTL A;  3RMH A;  3CQZ B;  2F0N A;  3AFQ A;  3NEN A;  1HQR D;  2CCZ A;  2A74 C;  1S3O A;  1LT4 D;  1KDC A;  2F0K A;  5IT9 E;  1WI5 A;  2MPM A;  2Q8R E;  3G4S A;  1GVP A;  4R4T A;  4Y7N H;  3J7Z C;  3T16 A;  3ULP A;  1PTO H;  5I4D A;  3OTO Q;  2BE5 C;  4KJO A;  3NEL A;  5M3F B;  2H5X A;  3CC4 A;  1K28 A;  3KUP A;  1VMP A;  5A2Q L;  3H6M A;  3EJI A;  2Q2H A;  1DOL A;  2IWH A;  2M2L A;  1CA6 A;  3MC0 B;  3Q24 A;  4JI2 Q;  4ALP A;  4B3T L;  4A3D G;  3CF5 A;  4K2L A;  2JA6 B;  2BE5 D;  1MIU A;  3B6Y A;  2HIV A;  4YHH Q;  1Q86 C;  2KUM A;  2C9O A;  3EIV A;  4OWT B;  4JI8 L;  5C0X J;  2K32 A;  2JN4 A;  2E8G A;  3G6J B;  1I50 H;  3VR3 A;  5IWA Q;  2O4X A;  3VYU A;  2CHB D;  2EZV A;  2XWJ B;  4R8N A;  1YNN C;  4CJ2 C;  1N33 Q;  2ZTD A;  5K36 G;  1F9S A;  2JA9 A;  1SN8 A;  4DGZ A;  1ESF A;  1H9S A;  1GUN A;  1HTL D;  4ME3 A;  1QVF A;  1GOZ A;  3OMC A;  4JBK A;  1E2Z A;  1EZ6 A;  4WFN 3;  2VZA A;  3MFG A;  4DV6 Q;  4A3J H;  1VS0 A;  2AHO B;  2PCF B;  4A3L H;  3RN2 A;  4LF9 L;  2SOB A;  3RNU A;  4Y7N B;  1SE3 A;  1WTV A;  3CMA A;  4GKJ Q;  4ILW A;  4A3G G;  1HNX L;  3ERS X;  3R2I A;  3CPW A;  2DJF C;  3CCL A;  3M4O H;  4JPB W;  1LLR D;  4JI4 Q;  2OF1 A;  1IKM A;  4LFB L;  1ET6 A;  2WIN B;  3S1Q H;  1ZYR C;  1A2T A;  1N36 L;  1EY6 A;  2R92 H;  4A3B B;  3CXC A;  1SND A;  5M3M H;  3CKI B;  1SNM A;  4QQB X;  3L3O C;  1JOQ A;  3A5U A;  3M7N A;  5BR8 L;  5EPL A;  1KAA A;  2VL6 A;  4JG2 A;  5C3E H;  1WTH A;  1HR0 L;  5DAU A;  2MNA A;  1GUS A;  5LMN W;  3BYY B;  5KYL A;  1FL0 A;  4JI3 Q;  3MXP A;  2VQE Q;  3NTH A;  4DR6 Q;  3E6Z X;  4XQJ A;  4KN4 C;  5COY A;  5DLQ E;  4FVM A;  5HY6 A;  3HOY G;  3K6O A;  4DV3 Q;  2F1M A;  1KRT A;  2EJF C;  1XXG A;  3GTK H;  2F4V L;  1PFS A;  3QWN A;  5JEA G;  1VQ7 A;  4LFC L;  1ASZ A;  4IPC A;  5IY0 A;  1QG7 A;  3T13 A;  4X3S A;  1CI3 M;  3EA6 A;  4FXD A;  1IYU A;  3LNN A;  4FXG C;  5DM7 3;  5AFW A;  4YCU A;  5C44 G;  1A2U A;  4NXN Q;  4A3M G;  2HT1 A;  3S2D B;  3BDL A;  1BQQ T;  1N8R C;  3S16 B;  2RCN A;  3C46 A;  3CC7 A;  1CSP A;  3A7L A;  5EKI A;  4XXE A;  2RSN A;  3F2U A;  1IBM L;  4JI7 L;  1GHK A;  2LKV A;  1Y8O B;  1IBK Q;  1IYJ B;  1ML0 D;  1TKW B;  4XQQ A;  4B3S L;  1VF7 A;  3NSW A;  1EYC A;  1P16 A;  5ELE A;  1HRJ A;  3SDZ A;  5J1Z A;  1X55 A;  4LF6 L;  4FP5 D;  1HR0 W;  3FP9 A;  2JSO A;  1S40 A;  4LNQ A;  2FFK B;  2F0D A;  3STB C;  4EVO A;  2B63 B;  1HUN A;  2QGQ A;  3T1H Q;  4JVZ A;  4OX9 Q;  1EQQ A;  1LV9 A;  1WJJ A;  4X62 Q;  1SE2 A;  4JI2 L;  2RKS A;  1PLF A;  1WCM B;  3MZ5 A;  4RWS C;  2ASB A;  5D3D A;  1MD2 D;  1Y8N B;  2WB1 B;  4LMQ D;  3Q22 A;  1LTR D;  1G2S A;  1ENC A;  2FMM A;  4PZ8 A;  2I5L X;  4A3F G;  3DHQ A;  2ZM6 L;  1JR0 D;  3AQQ A;  2FXQ A;  3GV6 A;  4F7X A;  5C4Z A;  2F4V Q;  2EIF A;  1JWM D;  3OIP A;  4ZQ3 A;  1Y1W H;  4KMU C;  2B2V A;  2NVX B;  3GTL B;  3CC2 A;  1Q3L A;  2IPK D;  1LUZ A;  4A93 B;  1FD7 D;  4CKE A;  4LW1 A;  1A6X A;  4JI8 Q;  1SYE A;  1GXD C;  2CKZ B;  2Q8T A;  3TS2 A;  2L4N A;  3R3O A;  3ICE A;  1UEA B;  1J5E L;  3PUV A;  3ULJ A;  4BA2 I;  3TP6 A;  2R7Z B;  1YEZ A;  2QEJ C;  1Y1W B;  4HN7 A;  1BXT A;  2K14 A;  4K8J A;  2D5D A;  1WTR A;  1AFP A;  4N8F A;  4B3S Q;  4OEM B;  4ZCK A;  1AW7 A;  1SRU A;  4KKS A;  5J22 A;  5D14 A;  1M8A A;  3ERO A;  3NBH A;  4C3H H;  1PZK D;  2K6A A;  4BBS G;  5EQ0 A;  2F3V A;  3G71 A;  1EIG A;  4DV0 L;  2E2I H;  3I91 A;  1OXX K;  1JWU D;  5IGB A;  4KKU A;  2RDH A;  5LL6 X;  2K5H A;  1K73 C;  4MTN A;  4DR7 L;  1I4R A;  4POG A;  3TP7 A;  2L55 A;  3HOX H;  4ZAI A;  2A1A A;  4IPD A;  2MUY A;  4HID A;  1JJ2 A;  3NXW A;  4DUZ L;  5G3L D;  1VQ6 A;  1KIX A;  1SEB D;  1KHI A;  4K14 A;  4ME5 A;  5EKK A;  4L5Q A;  3HOY B;  2FJ2 A;  3C2P A;  3T1Y L;  4LFB Q;  4QUC A;  3L9A X;  3I90 A;  4Q0F A;  2DNE A;  1ONL A;  2KHI A;  4BBS H;  1F2M A;  5KGU A;  1SAP A;  2JA7 H;  4HED A;  2NVQ H;  1PVO A;  2F0V A;  3X3N A;  2JJQ A;  5HUR A;  2BDO A;  3PSI A;  1YZ6 A;  3HGB A;  5ISR A;  4AH6 A;  3BYT B;  2D62 A;  4FYD A;  2EXZ A;  2A5H A;  3D6W A;  1PH7 A;  1IBL Q;  3HOV H;  1E1O A;  1D6E C;  4O0A A;  1R4Q B;  3OOC A;  5IYB H;  1TWC H;  3C1F A;  4BXX H;  2RA4 A;  3KDF A;  4RKB A;  1UE6 A;  3DEO A;  1JMC A;  1CA5 A;  4QL5 A;  1TS5 A;  2PQE A;  1AEX A;  4K0K L;  1HUM A;  2R93 B;  4DN4 M;  3ITP A;  2N49 A;  5IGE A;  2NYZ D;  3I70 A;  1CZW A;  1I3Q H;  1NR4 A;  4IN3 A;  1LTI D;  4PMC A;  4C3J B;  2DNC A;  4KHP Q;  3RLN A;  1K8G A;  4A3D H;  1HZB A;  1STG A;  2MGS A;  4PZ7 A;  4JYA Q;  2L12 A;  4CKC A;  2QDB A;  3GTM H;  5IP9 H;  4DV7 L;  3RZD B;  3VYT A;  2YTY A;  4DR2 L;  4IJH A;  2D0P A;  4X64 L;  5K5P A;  1PFN A;  2JQO A;  3CPF A;  4PZ6 A;  2CFM A;  4BXX G;  4POF A;  5CC4 A;  1T5E A;  4X3K A;  1TY0 A;  4RA8 A;  5CV8 A;  5IIF A;  4JI0 Q;  4Z9C B;  5EBD A;  4ABN A;  5M5X H;  1JB3 A;  1AZP A;  1HA6 A;  4DR3 L;  1X9N A;  4JI3 L;  1X54 A;  3OW2 A;  2NVY H;  1O80 A;  1WTW A;  1Z6H A;  3I4L A;  3N6R A;  1Z9F A;  3UDF A;  2B8G A;  4DK6 C;  3PQI A;  3JAM E;  2DGY A;  2R93 G;  1GKH A;  5EPJ A;  1GD7 A;  4A3M H;  3HKZ B;  4FF2 A;  2RQX A;  4M1U B;  4X65 Q;  1DZ1 A;  4JW0 A;  5JJI A;  2HDM A;  1E24 A;  1SFO H;  4OWX B;  1IXR A;  4RGT A;  2JA5 B;  2K7V A;  1LYL A;  3CP0 A;  2ZXR A;  4ID6 A;  2KEC A;  3MXG A;  2DY8 A;  3RZO B;  1A3U A;  2UU9 L;  2L11 A;  4L5S A;  2A68 D;  3RUZ A;  3GTJ H;  4EGV A;  2BDN A;  3F2C A;  2Q2T A;  2NTS A;  4BBR H;  2N78 A;  4GLV B;  5M5W B;  5C3W A;  1PH2 A;  1Y1V G;  4N9T A;  5IP7 H;  2K28 A;  3S2H H;  2J0T D;  1E0B A;  1EY7 A;  4K8I A;  1XNR Q;  3SXH A;  4XT1 B;  4B9X A;  1EWH A;  1PFM A;  2IT1 A;  1EYD A;  1VQC A;  2B2U A;  5IYC H;  2RDF A;  3S1R H;  3TRZ A;  4PG3 A;  2K01 A;  3HOZ B;  3CQZ H;  2ZXO A;  4ZUJ A;  2HDL A;  2VB2 X;  5T1I A;  4C2M H;  4DPG A;  2EY6 A;  5COR A;  3P7J A;  1WTX A;  1XMQ Q;  4APV A;  4F88 A;  1LT3 D;  2K03 A;  2KEE A;  4DV5 Q;  1H9S B;  2PPB C;  1E2W A;  4CDC C;  1UWV A;  3KLR A;  1DJR D;  4AYB B;  4UHV A;  2JA8 H;  1VMC A;  1IBL L;  4P74 A;  2B2T C;  1W6K A;  1VQO A;  5KND A;  2ZJR A;  1HZC A;  1HQM C;  2AKW B;  3H3V H;  1IZ6 A;  4DA2 A;  3Q23 A;  1DM0 B;  3K58 A;  4H0L C;  4DV2 Q;  2UXD Q;  3FVQ A;  3S1N B;  2PMZ E;  1VQI A;  1SNQ A;  1X3G A;  1EIH A;  1I4P A;  4KD3 A;  5FLM H;  4FXK C;  4QY7 A;  2WAQ B;  5NUC A;  4DV1 L;  3I56 A;  3P75 A;  3E9I A;  1AP0 A;  1BBU A;  2ICI A;  1R9T H;  1N33 L;  1I6H B;  2B2V C;  1PRT B;  2F0W A;  2OQK A;  3CCS A;  5J3B A;  4LF7 L;  2R7F A;  1TWH B;  1GUT A;  2WB1 E;  4A3E H;  2KHJ A;  3PO2 G;  3SE0 A;  1VQ5 A;  5IE8 A;  1AE2 A;  1VQB A;  1EEF D;  3FHW A;  4G4K A;  2PQA B;  2A69 D;  4TQU S;  1M4V A;  1Q81 C;  5AJ3 Q;  1F9P A;  1NCV A;  1SYG A;  1F2Y A;  5JJZ A;  3NQT A;  4YY3 Q;  2QW7 A;  1B2T A;  1T9H A;  3M3Y B;  1V1P A;  1Q82 C;  2DUD A;  2XTI A;  4DR7 Q;  1PYS B;  1PH1 A;  1A62 A;  2HCI A;  2CQA A;  4HCE A;  2JEA I;  1KNE A;  4A3C G;  1MBY A;  5IGC A;  5JJL A;  5HGQ A;  4OWW B;  2VS1 A;  2E2H H;  1CHQ D;  4A3I H;  4O1N A;  3OPO A;  1QNK A;  3G6E A;  2E5L Q;  1W2B A;  1W6J A;  1SNO A;  5C4X H;  1KRS A;  3NTI A;  4QIW E;  4IFD J;  1WOC A;  3KLS A;  3J81 i;  1N34 Q;  4RAU C;  5BN3 A;  4DV3 L;  1B50 A;  1J9O A;  3VYR A;  2ZTC A;  3JAM i;  1B1Z A;  3CRL C;  1FJG L;  3T56 B;  4A3G H;  1SMY C;  2F0F A;  3M7G A;  3RLF A;  3Q6S A;  2EYP A;  4K2K A;  1B4O A;  3A8K E;  2WP8 J;  1VQH A;  4RHS A;  1TWG H;  2QA4 A;  2A8V A;  2R61 A;  2E2D C;  1BR9 A;  1OXV A;  2UU9 Q;  1DD2 A;  1V1P B;  1BVS A;  1TWH H;  2B2W A;  3K5L A;  2ICE C;  1B7Y B;  4Q5V A;  5I2Y A;  5GQO A;  4DNT B;  4BY1 B;  3LWU A;  1B3A A;  4MNO A;  1R9T B;  4GZY C;  2PZU A;  4GS3 A;  3GTG H;  1SMX A;  2D0O A;  3CCQ A;  3DMU A;  5CV5 A;  4DK3 C;  2Z4H A;  1U9R A;  1SRO A;  3MAQ A;  5C0X I;  2RHS B;  4LF6 Q;  3ZJY C;  5GAE C;  4M8A A;  4B3M L;  1EOV A;  3BJU A;  3FKI G;  3PCO B;  1E1T A;  2R7Z G;  1YVC A;  1SJE D;  1NAP A;  2LS0 1;  3J7A V;  4K6D A;  1LT5 D;  3AMU A;  1XTD A;  2AUK A;  1TWF H;  2MHV A;  1K8M A;  4GOP C;  4CJ1 B;  1WFQ A;  2RBM A;  3K80 C;  2LY7 A;  5C44 H;  3I4N B;  2EVB A;  2NBF A;  3S15 B;  2IX3 A;  1HTP A;  1PZI D;  3HKS A;  3NPP A;  1H95 A;  1IL8 A;  1PV4 A;  2JEB I;  2O5I C;  1WCM G;  2V1C C;  2FIN B;  2KCT A;  1S5B D;  4OX9 L;  1N36 Q;  4PV1 C;  3A55 A;  2K5V A;  2KCM A;  3P20 A;  1V43 A;  1CSQ A;  1L0Y B;  1W3S A;  5C5L A;  1LTA D;  4FO2 A;  5BR8 Q;  3OSO A;  4C3I H;  4IOC A;  1R4P B;  2O2L D;  4GN4 B;  1U5K A;  1C9O A;  1VQK A;  4DKA C;  1EUJ A;  1HXY D;  4L5T A;  3H3V C;  1DOK A;  1Y1V H;  4HCS A;  2ATW A;  1VQ9 A;  2OT2 A;  4ULL A;  3KFU A;  3I4M H;  1NMG A;  3TQY A;  4I7A A;  2CWP A;  1IKL A;  1LTB D;  3TSS A;  2KQ3 A;  2LFN A;  3R93 A;  1KLG D;  4BS9 A;  3VA7 A;  1NE3 A;  3PGZ A;  2CVR A;  3HOZ G;  5CBE E;  2JXM B;  5FOB B;  2Q8I B;  3D3R A;  1Q1B A;  5LMN Q;  5GRO A;  3H91 A;  1ENF A;  4R4O A;  1CKN A;  1SDF A;  4YY3 L;  1JC7 A; 
#chains in the Genus database with same CATH homology
 4DV0 Q;  2WFW A;  2K5N A;  1J5E L;  2YTX A;  3PUV A;  3F8T A;  4DV4 Q;  3ULJ A;  4BA2 I;  2I5M X;  1HZ9 A;  1V9P A;  3I55 A;  1YEZ A;  1N34 L;  5IYB G;  4B3R L;  4YWM A;  1L1O A;  3GD7 A;  3PUX A;  2K14 A;  4PMW A;  4HIK A;  2UXB L;  1A0I A;  3HFZ B;  3S2D H;  2NN6 I;  2RF4 A;  4O2D A;  4R4C A;  3GTQ H;  3KDF B;  3PO3 H;  4A3E G;  2IX1 A;  4B3S Q;  1VQF A;  1K83 H;  1UE5 A;  2B3G A;  1SRU A;  2VY3 A;  3I2Z A;  3AYH B;  1X6O A;  4IFD G;  1FGU A;  2K50 A;  4C3H H;  1SE8 A;  1KXL A;  3PUW A;  1HNW Q;  4BBS G;  2EXD A;  1OXU A;  5FJ8 G;  3G71 A;  2K4K A;  4DNI A;  1YHA A;  4JI1 L;  4Y52 H;  4DV0 L;  3S1N H;  5LMU L;  3IRB A;  2E2I H;  1OXX K;  4A75 A;  2JA5 G;  2K5H A;  1VQG A;  1YBY A;  2F3I A;  1K73 C;  2L15 A;  2LXK A;  4MTN A;  5ELO A;  4DR7 L;  4POG A;  4YHH L;  1YI2 A;  3HOX H;  3HKZ G;  5M5Y H;  1GO3 E;  3CW2 C;  1Q8K A;  5EAY A;  2A1A A;  4DR1 Q;  4IPD A;  3MXN B;  4HID A;  1JJ2 A;  4AIM A;  4DUZ L;  3RZO H;  1VQ6 A;  1KIX A;  1N32 Q;  3G48 A;  4MZ9 A;  1E3P A;  2HIX A;  4DR1 L;  1KHI A;  2KEN A;  1VQA A;  1YIT A;  3AFP A;  3PUZ A;  4L5R C;  4LF8 L;  2WAQ E;  3OYY A;  4L5Q A;  4NPS A;  3TEH B;  1L0W A;  1GM5 A;  1X3E A;  4DR5 L;  5IT9 c;  4LFB Q;  3T1Y L;  4JV5 L;  3PV0 A;  3I4N G;  1QZH A;  1I94 L;  3NBH B;  1BKB A;  3J80 i;  3ULL A;  2KHI A;  3HOZ H;  4BBS H;  4LF7 Q;  4A3L G;  3RZD H;  3I4O A;  4LUO A;  1OTC A;  2JA7 H;  2NVQ H;  4LF9 Q;  1I94 Q;  1PVO A;  3S17 H;  2Y0S E;  4OXP A;  1JJG A;  1HJP A;  2JJQ A;  5M3F H;  4LFC Q;  4DUZ Q;  2VQF Q;  3PSI A;  1YZ6 A;  1I5F A;  2JE6 I;  3ER0 A;  4AH6 A;  1G6P A;  2D62 A;  3L7Z C;  3DLL A;  2BH2 A;  1XMO Q;  1PH7 A;  4X6A H;  1IBL Q;  3DM3 A;  3HOV H;  1E1O A;  2IHF A;  3I7F A;  4DR6 L;  2YYZ A;  4O0A A;  4QGU A;  3BZC A;  4BXX H;  5IYB H;  1TWC H;  5M5W H;  3KF8 B;  2UXC Q;  4DV7 Q;  2MFI A;  3KDF A;  4KHZ A;  1TXY A;  1UE6 A;  4TVA B;  1PH4 A;  1K8A C;  1JMC A;  4QL5 A;  4BA1 I;  1XPO A;  2ES2 A;  4K0K L;  3SGI A;  1Q1E A;  2NN6 G;  2N49 A;  3D0F A;  4XTC S;  4JC0 A;  2KBN A;  4GNX C;  3KLW A;  1IBM Q;  3I4M G;  1Q12 A;  1I3Q H;  3J80 c;  1EYG A;  4K0K Q;  1SLJ A;  2R7D A;  4A76 A;  4KHP Q;  1VQE A;  3CCJ A;  1NJI C;  3RLN A;  3U4V A;  4AYB E;  1K8G A;  4A3D H;  5LMU Q;  4UPA A;  1HZB A;  3GTO H;  1OXT A;  2F52 A;  4UP8 A;  5IP7 G;  4DR3 Q;  4DR4 Q;  1MJC A;  1E7Z A;  1J6Q A;  3K8A A;  2UUB L;  3I4N H;  4PZ7 A;  4JYA Q;  1N9W A;  2NZH A;  3GTM H;  4RMF A;  5IP9 H;  4DV7 L;  2Q2I A;  1FVI A;  1VQD A;  2R92 G;  3GTL H;  3STB D;  1B70 B;  3T1Y Q;  2YTY A;  4DR2 L;  3HKZ E;  4GNX A;  4JI5 L;  3PF5 A;  1C7Y A;  4IJH A;  4GLA C;  3HOX G;  2D0P A;  4X64 L;  3CME A;  5M3F G;  4UY8 C;  4BY7 H;  2JQO A;  3CPF A;  4PZ6 A;  3H3V I;  2CFM A;  4DR2 Q;  2NVT H;  2OCE A;  3Q8D A;  4POF A;  4JI5 Q;  3CD6 A;  4DR4 L;  4BXX G;  1N32 L;  2MO0 A;  1DGS A;  2A19 A;  5M3M G;  4JI0 Q;  2LXJ A;  1UE1 A;  4DV6 L;  3UDG A;  4YWL A;  1KD1 C;  5C4J H;  4NXN L;  2AWO A;  5M5X H;  4IOA A;  3A74 A;  1QUQ A;  4DR3 L;  4JBM A;  4A3J G;  4JI3 L;  5C3E G;  1X9N A;  1XPU A;  1X54 A;  3PF4 A;  3OW2 A;  3UE1 A;  2NVY H;  4LUV A;  3K7U C;  2ZTE A;  3PIO A;  1S72 A;  3JC6 6;  3UDF A;  1Z9F A;  1HZA A;  4DK6 C;  1PHJ A;  4JI7 Q;  5C4X G;  3K81 C;  4JI6 Q;  2DGY A;  4BY1 H;  2R93 G;  3RR5 A;  1GKH A;  3S14 H;  5IYC G;  2Z0S A;  1EIF A;  1GD7 A;  1L2F A;  3FKI H;  3BU2 A;  3CCE A;  1JE5 A;  4A3M H;  2I5H A;  4BY7 G;  4DAM A;  4X65 Q;  2Z6K A;  5JJI A;  2C35 B;  1SFO H;  1E24 A;  2QEX A;  4OWX B;  2JA7 G;  4KHP L;  4JI0 L;  1IXR A;  4DV2 L;  3M9B A;  1EQR A;  1LYL A;  1Q46 A;  2K75 A;  3CP0 A;  1L1O B;  5E7N A;  5IP9 G;  4HIM A;  1XNR L;  3F2D A;  4KLK A;  5JJK A;  1QVC A;  2UU9 L;  1KAW A;  4LF4 Q;  1CKO A;  2PI2 A;  3E0E A;  3KYH C;  2E2J H;  4L5S A;  5FLM G;  1G51 A;  3TS0 A;  2LSS A;  4B3R Q;  1CKN B;  3GTJ H;  2VNU D;  1JT8 A;  3F2C A;  3HOU G;  3S16 H;  1PH8 A;  3M4P A;  1VQ8 A;  4FDB A;  5FLX c;  2Q2T A;  3J7A 5;  4UP9 A;  4BBR H;  4NXM L;  2N78 A;  4GLV B;  4B3T Q;  2YV5 A;  2AWN A;  1M90 C;  2UUA L;  1KL9 A;  1PH2 A;  1KQS A;  1Y1V G;  4HJ7 A;  4P75 A;  1HNZ Q;  5IP7 H;  4DV5 L;  2JK8 A;  3F1Z A;  3S2H H;  4A3K H;  1U0L A;  1YJ9 A;  2ZM6 Q;  4KI0 A;  2UUA Q;  3EN2 A;  2BA1 A;  2YU9 H;  4AYB G;  3UE0 A;  4GOP B;  1XNR Q;  1MKH A;  1CKM A;  3W5O A;  3CCU A;  2OTJ A;  2JA8 G;  2VUM H;  1Q7Y C;  4WJ4 A;  2IT1 A;  3KF6 B;  2I0Q A;  1VQP A;  3HOW G;  2PI2 E;  1VQC A;  5IYC H;  1RL2 A;  2GN5 A;  1VQM A;  3S1R H;  3TRZ A;  4PG3 A;  4QJF A;  4X66 Q;  3CQZ H;  1X65 A;  1B8A A;  4DAY B;  2YTV A;  4C2M H;  4DPG A;  1O7I A;  2PQA A;  3L0O A;  4R1J A;  3EBE A;  1YJN A;  4R4I A;  4HJ5 A;  1VQJ A;  1YJW A;  4A93 G;  4GN3 B;  1XMQ Q;  4APV A;  2WAQ G;  4A4I A;  2WB1 G;  3PO3 G;  4YCW A;  4DV5 Q;  4HJ9 A;  3CCR A;  4DV4 L;  1UWV A;  1OXS C;  4DUY L;  1X56 A;  4HJ8 A;  3HOU H;  2JA8 H;  1XMO L;  2Y0S G;  4A93 H;  3CCV A;  1IBL L;  4P73 A;  4P74 A;  3MEF A;  4JV5 Q;  1VQO A;  3TRE A;  3VDY A;  2ZJR A;  2B63 G;  1HZC A;  4A3B H;  2AKW B;  3H3V H;  5GAG C;  4JBW A;  4NB3 A;  4BY1 G;  1IZ6 A;  4JI4 L;  3CAM A;  4LF8 Q;  2R93 H;  2UXD L;  2OTL A;  3AFQ A;  1UE7 A;  3NEN A;  2CCZ A;  2IHE A;  1S3O A;  4DV2 Q;  3A0J A;  2UXD Q;  1NMF A;  3M4Q A;  2PMZ E;  1WI5 A;  3OTO L;  1VQI A;  1GVP A;  2B29 A;  3G4S A;  3GTP H;  1X3G A;  4R4T A;  4A3C H;  4Y7N H;  3J7Z C;  4DV1 Q;  4GOP A;  2GVB A;  3BZK A;  5FLM H;  3ULP A;  3OTO Q;  4QY7 A;  4DUY Q;  3NEL A;  4OON A;  2H5X A;  4XIG S;  3CC4 A;  4DV1 L;  3I56 A;  3E9I A;  1BBU A;  4R4Q A;  1YHB A;  1R9T H;  1N33 L;  1UEB A;  5FJ8 H;  2Q2H A;  4BBR G;  4YWK A;  3A5Z B;  4B3T L;  4A3D G;  4JI2 Q;  2OQK A;  3CCS A;  4ALP A;  5J3B A;  2RHQ B;  3CF5 A;  4LF7 L;  2UXB Q;  2R7F A;  1PH9 A;  3U4Z A;  1Y14 B;  1MIU A;  1NTG A;  2WB1 E;  4A3E H;  2Z6K C;  2KHJ A;  1KC8 C;  3H0G H;  5AJ3 L;  1EFW A;  3PO2 G;  3D31 A;  1VQ5 A;  3B6Y A;  2HIV A;  4YHH Q;  1Q86 C;  3GDE A;  5IE8 A;  1AE2 A;  1VQB A;  3EIV A;  1XMQ L;  3FHW A;  1NY4 A;  2N3S A;  2VQF L;  2PQA B;  4TQU S;  4OWT B;  3U50 C;  4JI8 L;  1WYD A;  5C0X J;  1Q81 C;  2E8G A;  5AJ3 Q;  1QZG A;  2MO1 A;  3H15 A;  3S1M H;  2VQE L;  4GLX A;  4IPH A;  4UP7 A;  1I50 H;  2HHH Q;  4YY3 Q;  5IWA Q;  4C3J H;  5C0X G;  4OO1 I;  1T9H A;  4LUZ A;  1Q82 C;  1N33 Q;  2ZTD A;  2DUD A;  2XGT A;  2XTI A;  5K36 G;  1YIJ A;  4DR7 Q;  1QUQ B;  1PYS B;  2JA9 A;  2VW9 A;  2HHH L;  5IWA L;  1PH1 A;  4HIO A;  1VQN A;  1SN8 A;  1A62 A;  1I6H H;  2JEA I;  4JI6 L;  4A3C G;  4ME3 A;  3PUY A;  1QVF A;  4LFA Q;  2UUC Q;  4GKK L;  3KF6 A;  5JEA J;  1K3R A;  5HGQ A;  4HJA A;  2E5L L;  4JBK A;  4OWW B;  5JJL A;  2VS1 A;  2IY5 B;  2E2H H;  3M85 A;  2VZA A;  4A3J H;  4DV6 Q;  4A3L H;  1VS0 A;  2AHO B;  3RN2 A;  1CUK A;  4A3I H;  3KJO A;  1V1Q A;  4LF9 L;  1YNX A;  3U58 A;  3RNU A;  3G6E A;  2E5L Q;  1W2B A;  3CMA A;  4GKJ Q;  4A3G G;  2BA0 A;  1HNX L;  3ERS X;  5C4X H;  3CPW A;  1HNW L;  4A3B G;  1KRS A;  4QIW E;  3CCL A;  3M4O H;  4IFD J;  1FJG Q;  1WOC A;  3J81 i;  1N34 Q;  4IFD I;  4JI4 Q;  4DV3 L;  4LF5 L;  4LFB L;  3L2P A;  2ZTC A;  3JAM i;  4A3K G;  3S1Q H;  1N36 L;  1PYB A;  1FJG L;  5IYD H;  2N8N A;  3JAM c;  2R92 H;  4A3G H;  2UXC L;  3CXC A;  5M3M H;  3T1H L;  3RLF A;  2R7Z H;  3CCM A;  1HR0 Q;  3HOW H;  4QQB X;  2Q2U A;  3HOY H;  1SR3 A;  4JOI A;  3W1G A;  2WP8 J;  4EX5 A;  3A5U A;  1JJC B;  1VQH A;  2QA4 A;  1TWG H;  5BR8 L;  2ALY B;  2VL6 A;  4JG2 A;  5C3E H;  2ZJQ A;  2A8V A;  3M7N A;  1HR0 L;  4P72 A;  2MNA A;  3UDI A;  4YY3 L;  1NBW A;  1OXV A;  2CQO A;  2IX0 A;  5LMN W;  2UU9 Q;  4LF4 L;  4GKJ L;  1FL0 A;  1M1K C;  4JI3 Q;  2VQE Q;  4DR6 Q;  1BVS A;  5DLQ E;  5HY6 A;  3HOY G;  1C0A A;  4P71 A;  4AQY L;  1XPR A;  4DV3 Q;  4GN5 A;  3W1B A;  1TWH H;  4DR5 Q;  4LF5 Q;  1KRT A;  1B7Y B;  3K7A H;  4A3F H;  2JA6 H;  5GQO A;  4JYA L;  1L1O C;  2OQ0 A;  3KJP A;  4NXM Q;  1PH5 A;  2K52 A;  4MNO A;  3GTK H;  4X62 L;  1XJV A;  2F4V L;  4H02 A;  1PFS A;  4GS3 A;  3GTG H;  1SMX A;  1A8V A;  2D0O A;  3CCQ A;  3RN5 A;  5JEA G;  1VQ7 A;  3PO2 H;  3GO5 A;  4LFC L;  5GAD C;  4IPC A;  4DK3 C;  1BBW A;  5IY0 A;  1ASZ A;  1K0R A;  4B3M Q;  1SRO A;  2PNH A;  5GAH C;  4GNX B;  5C0X I;  3S24 A;  2RHS B;  4LF6 Q;  1HNX Q;  3ZJY C;  4YCU A;  5GAE C;  5C44 G;  4NXN Q;  3J81 c;  1EWI A;  4B3M L;  1RIP A;  1EOV A;  3BJU A;  3FKI G;  3PCO B;  3NEM A;  4A3M G;  1E1T A;  1MJE A;  3F2B A;  2HT1 A;  3HOV G;  1YVC A;  2OWO A;  2R7Z G;  1N8R C;  1IBK L;  1G29 1;  2RCN A;  2UUC L;  3CC7 A;  4LFA L;  1XTD A;  4GOP C;  1TWF H;  1CSP A;  2BH8 A;  4JBJ A;  4GKK Q;  4IJL A;  1YHQ A;  1IBM L;  1WFQ A;  3K80 C;  5C44 H;  1IBK Q;  4JI7 L;  4LF6 L;  3M3Y H;  1HNZ L;  1IYJ B;  4EQ5 A;  4B3S L;  2JA6 G;  4X65 L;  2NZO A;  1P16 A;  3HKS A;  4JCV E;  2JA5 H;  1J5E Q;  2HQL A;  1H95 A;  1X55 A;  2ZJP A;  4A3I G;  1QVG A;  2JEB I;  3H0G G;  5ELN A;  1PV4 A;  1WCM G;  3FP9 A;  3K0X A;  1PH6 A;  2V1C C;  1HR0 W;  2KCT A;  1S40 A;  4LNQ A;  4OX9 L;  5H1S E;  2CWA A;  3LGJ A;  1N36 Q;  2NVX H;  2ID0 A;  4AQY Q;  3STB C;  4LWC A;  4X66 L;  2K5V A;  2KCM A;  1D7Q A;  1A63 A;  4YCV A;  1VQ4 A;  1V43 A;  2QGQ A;  3T1H Q;  1K9M C;  4OX9 Q;  1CSQ A;  3WWV A;  1VQL A;  1EQQ A;  4X64 Q;  1W3S A;  3E9H A;  1E22 A;  1WJJ A;  4X62 Q;  1PH3 A;  4JI2 L;  1LM0 A;  5BR8 Q;  1Z47 A;  1VCI A;  4C3I H;  4IOC A;  2ASB A;  4GN4 B;  1U5K A;  3UDX A;  1C9O A;  1VQK A;  3RLO A;  2UUB Q;  4DKA C;  1EUJ A;  1XNQ Q;  1IL2 A;  4IO9 A;  4L5T A;  1Y1W G;  1HH2 P;  1Y1V H;  2ATW A;  1X3F A;  4PZ8 A;  2I5L X;  4A3F G;  1VQ9 A;  2ZM6 L;  1WCM H;  1JB7 A;  2EQS A;  4IPG A;  1TWA H;  3KFU A;  1EIY B;  3PIP A;  1XNQ L;  3AEV A;  2MQH A;  3I4M H;  2GVA A;  1NMG A;  3TQY A;  2VUM G;  3AQQ A;  2CWP A;  2FXQ A;  2F4V Q;  2EIF A;  1Y1W H;  4WJ3 M;  1P8L A;  3KOJ A;  2B63 H;  2AMC B;  4JOI C;  3CC2 A;  1LUZ A;  1NE3 A;  1AE3 A;  5LMN L;  1PA6 A;  3PGZ A;  3HOZ G;  1LTL A;  4LW1 A;  4JI8 Q;  2CKZ B;  4J15 A;  3TS2 A;  1D8L A;  1Q1B A;  5IYD G;  1AH9 A;  5LMN Q;  5GRO A;  1ASY A;  3ICE A;  3S15 H;  2R6G A;  4R4O A;  1CKN A;  3J81 j;  4OO1 G;  4RG1 A;  4JI1 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...