3A8IE

Crystal structure of et-ehred-5-ch3-thf complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
128
structure length
127
Chain Sequence
SNVPAELKYSKEHEWLRKEADGTYTVGITEHAQELLGDMVFVDLPEVGATVSAGDDCAVAESVAASDIYAPVSGEIVAVNDALSDSPELVNSEPYAGGWIFKIKASDESELESLLDATAYEALLEDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transport protein
molecule keywords Aminomethyltransferase
publication title Crystal structure of aminomethyltransferase in complex with dihydrolipoyl-H-protein of the glycine cleavage system: implications for recognition of lipoyl protein substrate, disease-related mutations, and reaction mechanism
pubmed doi rcsb
source organism Escherichia coli
total genus 29
structure length 127
sequence length 128
chains with identical sequence F
ec nomenclature
pdb deposition date 2009-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01597 GCV_H Glycine cleavage H-protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3a8iE00
2DNEA 4I7ZC 1Y8PB 2O5JC 3RLFA 4G7HC 1IYVA 2EJMA 1E2WA 4LK1C 4IFDG 1OXUA 4JK1C 3W3AA 4KKUA 1H9MA 3VR6A 5BN4A 2EJGC 5KNDA 3PV0A 2IT1A 2BE5C 2D2CC 3QIAA 1GJXA 3VR4A 3NE5B 1OXTA 3PUWA 3T56B 3CRLC 1HCZA 2A6HD 3CRKC 1O78A 5C0XH 1O7LA 3A7LA 3IKJA 2A6HC 2PCFB 1H9SB 1K8MA 2ZT9C 3A8KE 3ND9A 3SE0A 2NN6G 1H9JA 3TZUA 2LMCB 1GUSA 2JE6I 3BG3A 2D5DA 4BA2I 1DD2A 4OO1G 3LNNA 4GZYC 1LACA 2QF7A 1SMYC 3WDNA 2R6GA 3H94A 3AB9A 5BN3A 1E2ZA 4JBWA 3SDZA 1ONLA 4KMUC 1GHKA 1Z7TA 3T53B 4IFDH 3ND8A 4XTCS 3DXJC 4KKSA 3P20A 3OOCA 5JEAG 1OXSC 1ZKOA 2BA1A 1H9SA 1HPCA 1VF5C 2JEBI 1GUNA 2F1MA 4KI0A 4G7ZC 1GHJA 1CI3M 1Q1BA 1Q1EA 1Y8OB 2CW0C 3A8IE 4L8JA 5KNCA 4KN7C 1V43A 4LJZC 4RCNA 5BN5A 3A7AB 3I73A 4H13C 2NN6H 4TQUS 2YYZA 1GUOA 2EDGA 4KKTA 1YNJC 3FMCA 2DN8A 4OGQC 1PMRA 4OO1H 2BA0A 4HR7B 3MXUA 4H0LC 1Z6HA 4DNTB 1TU2B 5K36G 3A8JE 1FR3A 3U9SA 2A68D 3VR2A 4DNRB 3M85A 1DXMA 2D62A 4XIGS 5KNBA 2A68C 2KCCA 3M4YA 3L7ZC 1DCZA 2V4DA 1YNNC 5A35A 1K8OA 1BDOA 5JEAH 3OPOA 2L5TA 1Y69U 2JEAI 1HTPA 1IW7D 2NN6I 1IYUA 3D31A 2O5IC 2B8GA 1VCIA 2Q8IB 1A6XA 1IW7C 1H9RA 2A6ED 1B9NA 1HQMC 3LWUA 3KLRA 1Y8NB 1QJOA 1I6VC 1VF7A 2A69D 2EJFC 1E2VA 3QG1A 3QJYA 4PV1C 4IQZA 2A69C 5K36H 5C0XG 3GQBA 3PUXA 1GUGA 2EVBA 4KN4C 1LABA 1TKWB 4H44C 3VR5A 3VR3A 2AUJD 2BE5D 2JXMB 3FPPA 1B9MA 1OXXK 1ZYRC 1Q12A 2E75C 3GD7A 1FYCA 1GUTA 1OXVA 2AUKA 3HGBA 2E76C 1CTMA 4DK1A 3PUVA 3EQLC 1T5EA 2KA7A 4DK0A 3T51B 4BA1I 3PUZA 1VDZA 1CFMA 3N6RA 2K32A 1G291 3M7NA 4G7OC 2K7VA 3I72A 2PNRC 3BDOA 3D4RA 3I4LA 2AWOA 1Q90A 2A6EC 3VA7A 2E74C 2B8FA 2PPBC 4KHZA 3IFTA 3MFYA 2K33A 3OW7A 4TKOB 1V8QA 3PUYA 1H9KA 2DNCA 2BDOA 1EWHA
chains in the Genus database with same CATH superfamily
4XDXA 4ZK9B 2N3SA 2UUAQ 2F3WA 3PV0A 3BDCA 4A3FB 2R93B 5IODA 1Q8IA 1K83H 3PUWA 5ELCA 3VYTA 3I4NH 2A6HD 3HG9A 3JAMc 2OQ0A 1BF4A 3M7GA 2BOSA 4A3GH 3K6OA 4BA2I 1EQTA 2HIXA 1N36Q 3NXWA 5CMDA 3HOVG 4IPCA 3SDZA 1ILQA 4L5SA 1J6QA 1GKHA 3S1QH 2MUYA 1SNMA 4A3CH 2K5NA 1PH4A 5I2YA 1H9SA 4N9PA 4BXXH 2EYPA 3L2PA 1QNUA 1VQBA 3BJUA 3QWNA 4G4KA 4G7ZC 5IYBH 2CW0C 3A8IE 4DUYL 2NZ1D 5M5WB 3UDIA 5IP7H 1GUOA 3F2BA 1LT4D 2AMCB 3RLOA 4UY8C 3FEWX 3S2DB 2JA5B 1WTHA 5JVG3 3M4OB 2KUMA 2A68D 3A0JA 4JBKA 1IL8A 4IFDJ 1PVOA 2NYZD 1TWCB 2F0EA 1PH3A 1T9HA 1EQVA 1PYBA 5A2QE 3Q0AA 3QB3A 4DV2Q 1FGUA 3A74A 5IP9G 1IW7D 3D31A 4R8NA 2EE1A 5JJZA 2EQSA 2L1BA 1N33Q 4GKJL 1EY5A 1NSNS 1Z9FA 1QVGA 3F8TA 4DNIA 4JI1Q 2PYKA 1N33L 4DN4M 3QJYA 1XMQL 3CC4A 3S1MB 2VS1A 3GQBA 3PO2B 2F3VA 5FLXL 1DYQA 1II3A 1TS2A 5CORA 4FF2A 4QUCA 1KD1C 4RKBA 4AQYQ 1S40A 3F2CA 4K8JA 4DK1A 2H5XA 1STEA 2KA7A 1BVSA 1EOVA 1AN8A 2NVXH 2K14A 2PNRC 1X6OA 2XWJB 1J9OA 4HN7A 4LUOA 2F0OA 1KHIA 1VS0A 3K0YA 1XJVA 1HFGA 1TWFH 2DNEA 4RGOS 1Y8PB 3BZKA 1W2BA 1PLFA 1F9SA 4FDBA 2F0SA 4C3IG 1JJCB 2CWPA 1ASZA 1S4ZA 3MXGA 1ICWA 3J7AF 1ZXTA 2K6AA 3QIAA 1I6HH 3RZOB 2Q2IA 2XIWA 1OXTA 2EYLA 2WB1B 2PMZB 1HUNA 4UDUC 4B9XA 3CPWA 1O78A 4HAEA 2NVTB 4X65Q 2A6HC 5TSSA 5KYIA 1HRJA 4X65L 4AYBB 3HKZG 1LT6D 5HY6A 1IZ6A 3CP0A 4LFCQ 4A3DG 4YCWA 2FHTA 1Q3LA 2WAQB 2B2TA 4KMUC 1UEBA 3CCEA 4MHEA 4XTCS 2BH8A 1I50H 3J80i 4JI8Q 4BY7G 2AQ3B 2YTVA 3CCLA 3WWVA 1PH1A 5KIXA 4OWTB 4JI8L 3H0GH 4L8JA 1GVPA 3J80E 3HOZH 3OWEB 4DV4Q 2DN8A 3FDTA 1AW7A 2D0PA 1EIYB 1WTXA 3KJPA 1Z6HA 3RNUA 4QCLA 5IY0A 4BBSH 1DXMA 1LTSD 1CZGA 2RHQB 3DWQA 3F1ZA 1YNND 1XNRL 1HZBA 2A68C 2KCCA 3MC0B 4A3GB 1SYEA 2OEOA 2FMCA 4KLKA 1HHVA 1JCKB 4DV3Q 4UAIA 1U9RA 4XYQA 1HTLD 1LTLA 3S1QB 3R8BA 5DAUA 1IW7C 1VQKA 1H9RA 3F2DA 3LGJA 5JPMC 3D8GA 3PO3H 4DR2L 1KQSA 4GLVB 5C4XG 1LTTD 4DV0Q 1O7IA 4A3FG 4JI0L 1A3VA 4LF4Q 2LS01 2R93G 5K36H 4GOPC 2EVBA 4KN4C 2L9HA 2QILA 2M2LA 1EZ6A 4DV0L 2DGYA 4C3JH 3A56A 3HP3A 4A3IH 1WVLA 1LT3D 4WFN3 1F2YA 3I3CA 4V0BA 1ENAA 2QCPX 1GO3E 3M7NA 4IUNA 1O7YA 3I4LA 3G71A 2AWOA 3NQIA 3NWSA 4KJOA 3A54A 4X3TA 2EY6A 3OMCA 1UE5A 5M3FG 5IYDH 1MSHA 4XT1B 1D1IA 5CV5A 2VQEQ 4X3SA 5IWAQ 3S15H 2KENA 4KKUA 2D2CC 2CFMA 2VQEL 3M3YB 4DR6Q 1IBML 5JJLA 3CRKC 2IX0A 2EYOA 4DR6L 4LFBL 3ULPA 4C3HH 2UXBQ 1X3GA 1H9JA 1F2ZA 2G9HD 4JI4Q 2WINB 1DD2A 3SHLA 1EZ8A 1EU3A 2UXBL 3L9AX 2F0PA 4JI4L 2PW7A 2NVXB 2PQAA 1Z7TA 5EAYA 5CV8A 1VQ7A 4DV7L 1LM0A 3D6WA 3QOLA 5I9PA 3JAML 4P75A 2JEBI 1TWFB 1JOQA 1GHJA 1Q1EA 5CV9A 1QZHA 1STNA 1VQJA 1N8RC 1PHJA 2L11A 1PA6A 4KKTA 5ELFA 3DLLA 1TWAH 4LMQD 4CHTB 3J7YW 3HOVH 1TU2B 4R4TA 4GNXC 2ZM6Q 4ZRZA 4WORA 2D62A 3EN2A 1PZKD 4KHPL 3L7ZC 1YNNC 3IAYA 2ZM6L 2RBMA 5A35A 1L0YB 4UHVA 1D1KA 2PI2E 2R92G 1UWVA 2K5HA 3P75A 3FVQA 4ZKCB 2K75A 2RVLA 2EY5A 4ODGA 3LWUA 1UUPA 1SE8A 2X69A 1I50B 1J5EQ 3E0EA 1A15A 1E7ZA 4JBJA 2DJFC 2F0TA 1B3AA 2N49A 4X64L 1J5EL 1EUJA 3X3MA 1G51A 1GUGA 2WB1G 1KAAA 3HOZB 3KLSX 2F0KA 3EIVA 4IZ8A 1M90C 3HRZC 5FO7B 4JV5Q 3GD7A 1EY9A 1I4RA 3HGBA 3TZDA 2Y0SG 1CTMA 5HGQA 5IP9H 4AYBG 1CKNA 3TP8A 3ULLA 1T5XD 3OTOQ 3W1BA 5CGKA 4X6AH 2WAQG 3J80c 1F2LA 5EKIA 3T16A 2D0OA 2FJ2A 1IBLQ 3I8ZA 5CR3A 4FXKC 2YTXA 3OW7A 4TKOB 3P7JA 1IBLL 3S17H 5LL6S 3PO3B 1TWHB 3W3AA 4GN5A 3C1EA 2BE5C 3HOXG 1RCVD 2KBNA 4DV1Q 2MO0A 3K5NA 4JI5Q 1C0AA 4BY1B 4EQPA 4DR3Q 2B39A 4DV1L 4JI5L 2C35B 4DR3L 4CJ2C 5BR8Q 4F8MA 4F7XA 2G5DA 3MVVA 5IE8A 2RA4A 1QCBD 3ER0A 1SNDA 3H94A 2K28A 1ONLA 5BR8L 4C3IH 1QILA 2Z4IA 2QEJC 3KF6A 3HOUG 1KDAA 4A3JB 2OQKA 3A55A 5JEAG 4DXGA 1ET6A 2F0UA 1BKBA 1G8ZD 4NB3A 1EIGA 4NKLA 4B9WA 2SDFA 1K0RA 3L0OA 2EDGA 1S5FD 1F9QA 4HR7B 1OO9B 3D0FA 4M8AA 2ZTEA 1TS3A 1ML0D 4E6IA 4YHHQ 4A3DH 3MFGA 2WACA 4B3SQ 3M85A 1A3UA 4LF7Q 4CKCA 4C3HB 3CQZB 1S3OA 4YHHL 4MN3A 4B3SL 1OTCA 3TREA 1PRTD 2RKSA 5CV4A 4BY7H 4WJWA 2XN9C 1MD2D 4QGUA 1JJ2A 2DUDA 4K5WA 3U58A 2WFWA 3MTSA 2B2VC 3J7A5 2KHSA 4JI2Q 1PH8A 1YJWA 3T4AC 4FYDA 4IQZA 5C0XG 1FJGQ 1I4QA 4JYAQ 5J22A 2AHOB 4DA2A 3UDGA 1VQPA 3SK4A 4JI2L 4IUPA 5E4WC 1TWAB 3I4MH 1Q8KA 2YU9H 4JYAL 4LNQA 1X32A 2ZJQA 1JWUD 4I65A 1T5EA 2UXDQ 4O2DA 2K32A 4G7OC 5CV6A 1HNXQ 4X3KA 4LF8Q 1CUKA 3ONAB 4ID6A 1CKNB 4DFAA 1D6EC 3WOFA 1XMOL 2UXDL 5C4XH 3A5ZB 4A3FH 2R93H 2M00A 4QY7A 1SNOA 2VQFQ 1U4MA 1RJTA 5G3LD 1QZGA 1V1PB 1OXUA 1H9MA 4FXDA 4WJ4A 2PNHA 3W2DA 4O42A 2XTIA 1STAA 5C5LA 3SK6A 3SK8A 4B08A 5M3MG 1HCZA 3NBIA 1CM9A 4NMZA 5C0XI 3JC66 4K6LA 2X6GA 4YY3L 1NCVA 3CAMA 1LLRD 4NP5A 3SR1A 5M3FH 3NTIA 3AB9A 4OONA 5A2QL 3U9OA 1CA6A 4LF9Q 4O0AA 1B2TA 4APVA 1HR0W 3TEHB 2JJQA 3KF6B 2LFNA 4LF9L 4KTAA 1YNXA 4K6DA 1VQEA 3UI2A 4K2KA 2FFKB 1STGA 5GROA 5BN5A 4K0KL 2JN4A 3I73A 1TR5A 4MTKA 3MA2B 1SE3A 1PMRA 5EQ0A 3VYSA 1IXRA 4DNTB 1PZID 1CZWA 4HCEA 3UDFA 1EEFD 1HUMA 1LTRD 1AEXA 1V1QA 1X3PA 4GS3A 4RHSA 4R4OA 2V4DA 2H4OA 2Z4HA 3K5LA 1PDQA 1PRTC 3OPOA 1IYUA 5GAGC 5DNFA 5E7NA 4KY7A 3K81C 4EQ5A 1Y8NB 3EVQA 1PH2A 3OSOA 4LWCA 1AE2A 2E2JH 3QOJA 5CC4A 2ASBA 1A3TA 3T1HL 4L6TB 4BY1G 4QF4A 4DF7A 1U5KA 3H09A 5EKLA 3CD6A 2R7ZB 4A3DB 3PUVA 2R92H 5H1SE 5E3FA 3EQLC 1RL2A 3T51B 1FNVA 2MGSA 2A74C 2N78A 3H3VI 1NE3A 1WYDA 5IT9E 3PF4A 3RR5A 3FKIB 4OXPA 4BY7B 4BBRB 4EGVA 1RTOA 4R8IA 3CXCA 4A3JG 5D3DA 4WJ3M 3PUYA 2LKVA 5GAEC 1AZPA 2WIIB 2PZTA 2E2DC 3AEVA 1G6ZA 2EYMA 5M5YH 3J80L 1VQNA 2LY7A 1SJED 1HFNA 1O7LA 4F87A 3RMHA 2NB0A 2DJGC 4L63B 2YU9B 4DR4L 2LMCB 4HJ5A 3RUZA 4OO1G 1DONA 1E2ZA 4I7AA 5ISRA 1DZ1A 1PZJD 1I4GA 2WP8J 3HZXA 2CCZA 5C4XB 5G3LF 2XGTA 4S3SA 3ZYYX 3HOXH 5IGCA 1EY7A 3GDEA 3TN2A 4ZUJA 1NMFA 1YIJA 2K03A 4A4IA 3SVMA 5LMUQ 3PGZA 1V1OA 3ITPA 5EBCA 4LF6L 3MXUA 4NXNL 1A62A 1O80A 5LMUL 1Q82C 3VR2A 2NWGA 1ZYRD 1PFMA 1B44D 1YZ6A 3B6YA 3HOUH 4JOIA 1EWIA 5JEAH 4DUYQ 5M3FB 5EGTA 4YCVA 4OO1I 2A6ED 2EPBA 1LTGD 2TMPA 1GM5A 4ALPA 1AZQA 4PQXA 3QG1A 2VB3X 3Q23A 3SGIA 1TY2A 2OF1A 1B4OA 1JMCA 3CC2A 4XYOA 3NSWA 1X55A 1LO5D 2RSNA 1CT1D 3FPPA 4PG3A 1GUTA 1HZ9A 3Q8DA 3TSSA 3ERSX 3H6MA 3KUPA 2F0JA 4GKJQ 1X54A 5JJIA 1G91A 2K7VA 2GA4B 4IPGA 4A3EG 1QVFA 1GD7A 1XMQQ 4ZCKA 4DUZL 3I55A 1CQVA 2K5WA 5LL6X 2K33A 3V05A 3EA6A 3MZ5A 3ICEA 5C0XH 2KCMA 3M3YH 1YITA 3GV3A 3BYTB 4A3MG 4XQNA 5AJ3L 2O4XA 1L1OC 4PMCA 1N34L 4L5TA 2K04A 2EYJA 2F0HA 2R61A 1HZAA 4OL7A 2E2JB 1MJEA 3M9BA 3K7AH 2O2LD 5J39A 3H15A 2ICIA 1KTKA 2R92B 1EY0A 1Q81C 1H95A 1EYCA 5BN3A 4J6HA 2HCIA 1X9NA 4A3BB 4Q5VA 1GHKA 4HJ7A 4CJ1B 4KK7A 2ATWA 2HIVA 2VZAA 4DK6C 2Q8RE 2Z6KC 1HA5A 1R9TB 5M3MH 4R4IA 4ZQ3A 4B3RL 3KLWA 5IT9c 1Y8OB 3G48A 2NZHA 4LJZC 3A7AB 1X65A 2Y0SB 5M5YB 3DWPA 4P74A 4HIMA 3IFDA 3LWEA 2R7ZG 2AQ2B 1JE5A 4YWKA 1MIUA 1DGSA 3AFPA 2JA6G 3CPFA 3E6ZX 3FKIG 1VQIA 3NUCA 4BBRG 3NEMA 2A73B 1BCPB 5I6WA 5FOBB 2I5HA 2SNSA 3HOXB 3I56A 1QJOA 1VF7A 1L0WA 1NTGA 3H3VH 2EJFC 3HFZB 4LFAL 3CMAA 2XVSA 1BBXC 1XNRQ 4FVMA 3KF8A 1JT8A 1XYIA 1NNXA 3CC7A 4FNFA 1ICFB 4M1UB 2AUJD 4JG2A 1PYSB 4R1JA 1VQ9A 5IOCA 3D4WA 1UE1A 3M4PA 1TWGH 4H7BA 3VYUA 4DR2Q 3R2IA 4NPSA 3HOUB 3CCMA 2MQHA 4DV5Q 4OIJA 1Q90A 4JI0Q 1TWHH 1N9WA 3QO2A 3KBXA 3HKSA 3IFTA 4DV5L 4OX9L 1EWHA 1HNWL 2O5JC 2UUBQ 4IN3A 2B2UC 1E24A 4LUZA 4LK1C 4BY1H 3VR6A 2UUBL 1AFPA 3S2HB 1HZCA 4V190 3T56B 1WTWA 1NAPA 4CJ0B 1GXDC 1EYAA 2JSOA 3N52A 3I7FA 1SMYD 1TT2A 2F4IA 2B63G 4A3JH 3WDNA 1GUWA 4DR5Q 1IBMQ 2B2YA 4LFBQ 3MXPA 1K8GA 2XWBB 4IUUA 2KECA 1JJGA 4A3KG 1V43A 1TQOA 1PTOH 2AKWB 3CQZH 1QOHA 1FVIA 4OO1H 1EY4A 3HKZE 3S14H 4AIMA 3K7AB 4DNRB 1NUCA 4DV7Q 3VDYA 5KNBA 1CQFA 4P72A 2RF4A 3G6EA 2O5IC 4K5VA 4A3LG 5EPLA 1D5ZC 1F2MA 2EYFA 3KLRA 2N88A 1BXTA 1F9PA 1I6VC 1STBA 5T1IA 5M3MB 1I4XA 4KHPQ 5IIFA 4XQJA 1VQ5A 4XXEA 4DXFA 1VQ8A 2VW9A 3S1NH 2YV5A 3KF8B 5C3EG 1Q46A 1EFID 2AUKA 3EROA 1WTVA 4CDCC 1Q86C 2AWNA 1L0XB 3BZDB 5ELOA 5COYA 2CQOA 4YWMA 1R4QB 3I72A 4K8IA 2F0WA 1X3FA 3RN2A 1K3RA 4X64Q 4A3BG 1SAPA 1SYDA 1WTQA 2E74C 3X3NA 4BS9A 1ENFA 5C44G 1FL0A 3TS0A 1EU4A 1EYDA 5CYUA 1DOLA 3CCUA 1HR0L 4Z9CB 5LMNQ 1XNQL 2EIFA 1E1TA 1EYGA 3SK5A 4IFDG 2SOBA 1S72A 4LUVA 2E5LQ 2JA8B 5LMNL 1GJXA 1AH9A 2UU9L 1RHPA 1IKLA 4L5QA 1N32Q 2IX3A 2E5LL 2QKIC 3J81j 4RGMA 1P8LA 1LTAD 1A8VA 4LF5Q 2ZT9C 4O1NA 3T1YL 1N32L 4RKLA 4A3EH 2F0MA 1TWGB 1YHAA 2D5DA 5GADC 2KVMA 4LF5L 2SNMA 2Z1CA 4GZYC 1V1PA 1SMYC 2B2WA 1K8AC 2HCCA 1LT5D 4RFBA 5ELEA 4A3MH 3K8AA 4ABNA 2FMMA 4K14A 2F4VQ 1JE4A 4C56C 3ULJA 4N9TA 3K57A 1VQCA 2BA1A 3CF5A 2K1BA 1GUNA 2UUCQ 2F4VL 4P71A 1SYBA 5FK9C 1G6PA 2BH2A 2VXWA 4UPAA 2EOTA 1PFSA 1P16A 1CHPD 4UP8A 4GKKQ 1HXYD 4TQUS 2UUCL 1XWEA 2B2TC 1MKHA 1SR3A 4IFDI 3NTKA 1A0IA 1XXGA 2WKDA 3RZDH 4RHRA 4GKKL 1TS4A 1VQGA 4JI6Q 5EBDA 2MP1A 1JQYD 2QA4A 1STHA 2VUMB 2KHIA 3LX0A 4JI6L 5IT9L 4IUQA 4POFA 3I4NG 5IGFA 4XQQA 3K5OA 1HQMC 1KLGD 1QG7A 2F03A 3Q24A 5KEEA 1IL2A 2R7ZH 4KJNA 2A8VA 1PTOB 1WOCA 2RDGA 1M8AA 1D8LA 1VQDA 4QIWB 2JA6H 5JOBA 2E76C 3FKIH 1UE7A 4UP9A 3S14B 4BBRH 1CFMA 1I94L 3HOWB 3J81i 3KK7A 1LYLA 4J8QA 2CKZB 2XRSD 2R3ZA 2B8FA 1RDPD 4CDDC 2ALYB 1H9KA 1BBUA 2JA9A 1Q7YC 3HS0C 2WB1E 2Z9HA 2LXJA 2PMZE 2K5VA 4CKEA 4G7HC 1KC8C 2EJMA 1RODA 1KXLA 4JI3L 5KNDA 2IT1A 3TRZA 2Y0SE 1PFBA 1MI2A 2F0DA 4DK3C 1IKMA 5JPNC 2AQ1B 4JPBW 4AYBE 1ESFA 1TY0A 1B7YB 3S1NB 1XMOQ 2PCFB 2WAQE 1RF2D 4X66L 2KHJA 4H02A 2J7ZA 3TZUA 1GUSA 4JVZA 1PXUA 2BDNA 3LNNA 3TBIB 1WTPA 3NWTA 1S5BD 4DV6L 1WI5A 3K7UC 3MEHA 3NP8A 1ENCA 2ZXPA 3DXJC 4B3TL 3P20A 3CMEA 1ZKOA 4BWGB 4Y52H 3H91A 1WTRA 5C6AA 2F0LA 1NR4A 5IGBA 4YY3Q 5M9OA 2RCFA 4GN3B 4RA8A 3M4QA 4H13C 5I4DA 2ES2A 4JBMA 1VQAA 4QQBX 1ZEQX 3WOEA 2B63H 2PW5A 1MBYA 1W6JA 1JORA 4A3EB 1IHZA 1C7YA 1EWCA 1K8OA 2HDMA 5C3WA 5C4JH 1E1OA 3NTHA 3OHXC 4K0KQ 2PI2A 4KV6A 2OTJA 2B8GA 4Q0FA 4A3MB 1IBKQ 5I2XA 1B9NA 4QB4A 4A3KH 3PCOB 1Y1VG 3L3OC 2A19A 3PF5A 1IBKL 2IJ0A 1B3QA 1WJJA 2CWAA 2JA8G 4KY6A 2ZXRA 4JW0A 3TDQA 3FRPB 1LABA 2OT2A 4IPHA 3S1RH 1SRUA 2RDHA 5GQOA 1E0BA 5HURA 2JYOA 3RZDB 3QR8A 3UE1A 4PMWA 4J15A 2NBFA 1SDFA 4YIJA 1KRTA 1PTOF 3R93A 1XTCD 4ULLA 4A3LH 1VQMA 2E8GA 3R2TA 3BDOA 5DEHA 1F9RA 1B70B 3C2PA 2FINB 4R4QA 1KNAA 3T1HQ 1V8QA 2DNCA 4HEDA 4NDXA 4NXMQ 1LV9A 4FF3A 1LTBD 4ME5A 1KLUD 3TP5A 4NXML 2GN5A 5C3EH 2ZXOA 2CW0D 2RQXA 3GP7A 1L2FA 1LTID 1SNPA 4CDEC 4QUFA 1RIPA 3I91A 3FP9A 3EBEA 1EEID 3GTJB 4QJFA 5I9OA 3A7LA 2JA7G 4DR5L 4ZAIA 2JA6B 2ID0A 4A3BH 1JB7A 1VQFA 2M9VA 1QUQA 5C44H 2Q2TA 5DM63 2VUMG 5FO8B 1NMGA 1R9TH 4JBWA 4CGYB 4IFDH 5FJ8G 3D3RA 4KKSA 4ZKBB 1KDCA 2K4KA 3MEFA 1VMPA 2N55A 1E22A 2F1MA 2LSSA 4DR4Q 1SN8A 5IGEA 2Z8LA 1TIID 2PZUA 4MZ9A 2P5ZX 4H0LC 2ZJPA 1I3QH 5ELNA 3UDXA 5IYDG 5IYCG 3A8JE 1FR3A 3I70A 3J81c 2KEEA 1YHQA 3U9SA 4IUVA 4POGA 3DMUA 2XNAC 3HOWG 3U4ZA 1KAWA 4GOPA 3STBD 1JWMD 4OEMB 1A6XA 2V1CC 1ASYA 3E3XA 3MHBA 4ZLTF 4LF6Q 4NXNQ 1RKNA 1GOZA 4LAAA 2I07B 4PZ8A 4XT3B 2OWOA 1FGBD 1VQ4A 2A1AA 2HHHL 1SROA 1KDBA 3OYYA 2RSOA 4TSSA 3K0XA 5C4ZA 2RHSB 3K58A 2UUAL 1U4LA 2K05A 3OIQA 5KYLA 2B63B 3EFXD 3CHBD 4QMGA 1BBWA 1UAPA 1RTNA 5C3XA 1MJCA 2CHBD 2F0IA 3N6RA 1I4PA 1PYWD 2EY2A 2MPMA 4CKBA 3C1FA 1MGSA 5C4JB 2RCNA 2J4XA 1SXTA 2VB2X 1Z47A 1N36L 3S2HH 4A3KB 1D2BA 3RLFA 3K59A 3GTPH 2LXKA 3E0JA 4JK1C 5AFWA 5JVH3 1U4RA 3DUZA 3NE5B 3VR4A 2E2HH 4DR7Q 1HH2P 4PNYA 5FKAC 3T13A 3KDFA 3D4DA 3IKJA 1UE6A 4DUZQ 3S1RB 4DR7L 4FP5D 1KNEA 1X3EA 2F52A 5E1FA 3UE0A 1VMCA 2FXQA 4TVAB 2HQEA 1DM0B 2QGQA 5AJ3Q 5C4HA 1N34Q 1EIHA 2CQAA 1WCMG 1STYA 4J1MA 1SYFA 2G9DA 3T53B 1NY4A 1QUQB 2EYHA 3GTMH 3ND8A 4RH6A 4YCUA 3BU2A 4GNXA 4GLAC 2EY1A 2ENBA 2B3GA 3KLSA 1EIFA 4DV2L 4U68A 3W1GA 1G2SA 1A2TA 4KN7C 2F3IA 3G7LA 4RG1A 5C3EB 2YYZA 4OGQC 4QIWE 5D14A 1FNUA 2ZTDA 4K5XA 3J7AV 1TXYA 2NTSA 4Y7NH 5T1GA 1K0SA 4DGZA 4JI1L 4A93G 4FF4A 1DCZA 4HJ9A 1LUZA 5C44B 2Z6BA 4C1NK 4B3RQ 5KRUA 1ESRA 2K5QA 2L5TA 2JEAI 3STBC 2NVYH 4AQYL 2J0TD 3NBHB 5FO9B 4HIKA 4GOPB 1K73C 3DHQA 1EQRA 5CBAE 4B3MQ 1QE6A 1XPUA 4YWLA 3F2UA 1BCPD 3HOYG 4B3ML 1W3SA 3VR3A 3CKIB 2R7FA 1B9MA 1ZYRC 1JOOA 2E75C 4HCSA 1C48A 1I3QB 4PZ7A 5JEAJ 4OWWB 3HEJA 3MXNA 4BA1I 2IHEA 4AH6A 1SBBB 1SYCA 4UP7A 5HGTA 2HD3A 4FO2A 4GN4B 4LFAQ 3FHWA 3D4RA 1Y1VH 5IGDA 1C8CA 1I4HA 2A6EC 3VA7A 4RGTA 4DAMA 2CH4A 1QB5D 3C3LA 2JA8H 4KHZA 3IL8A 4OELB 1FYCA 3KOJA 3GTOB 2MJ8A 3FPUB 4LFCL 5BN4A 2KCTA 1U4PA 3PIP3 3RD4A 3GTLH 3AQQA 3NK9A 5EJWA 2R7DA 3VA5A 1H9SB 1K9MC 2GVBA 4P2CB 3E9IA 1B1ZA 5FLMG 2NN6G 4EVOA 3BG3A 3KDFB 1K83B 3PIPA 4OX9Q 3BS1A 3I4NB 1BOSA 1HNWQ 1PH9A 4ILWA 4DV4L 5C0XJ 4LW1A 3TS2A 4CBVA 3I4MG 1PFNA 1EFWA 1BR9A 5E4XA 2VY3A 2A5HA 3RLNA 1OXSC 4DV3L 2EXDA 4GNXB 3TP7A 3GTPB 1Y1WG 1V9PA 2JA7H 4RCNA 3BYYB 2E2HB 3V2TA 1FNWA 2E2IH 3NQTA 1AP0A 2VUMH 3S16H 2B29A 2B2VA 4XIGS 3KJOA 1HQRD 4F88A 4RMFA 4LF4L 5FJ8H 1S5ED 1UEAB 4KHVA 5EKKA 1BDOA 2KEDA 2NN6I 4C2MH 1WD0A 4ZUIA 3KYHC 1EOTA 1JWSD 4HSVA 3MWYW 3GTMB 5M5XH 3GTGH 2I5MX 2IHFA 4EQNA 5ELBA 3J81L 3BZCA 1TVXA 3AFQA 1BCPC 4OIKA 5IYCH 3GTKH 4IOAA 4JOIC 4GLXA 4H44C 1W6KA 2BE5D 4HSPA 1EY6A 3D6CA 1B53A 4KY5A 1Q12A 3HOWH 3K80C 4FF1A 5IWAL 2MO1A 4Y7NB 1FD7D 2MFIA 2JA5G 3VYRA 1CHQD 3U50C 2Q2HA 3MXNB 3AYHB 2IL8A 1EY8A 3AU7A 5GAHC 2PPBC 2NVYB 3OWFA 2NUCA 1OXVA 1BCPF 1WD1A 2BDOA 4JCVE 2EXZA 4HTHA 3KFUA 1K3BC 1IYVA 1QNKA 1SNCA 1E2WA 2F0NA 2YTYA 2EJGC 3G4SA 5D3IB 5FLXE 1RD9D 4OHJA 3ZJYC 1B8AA 1QVCA 3O13A 5KGUA 2QEXA 3PO2G 2TSSA 1BQQT 3A8KE 1I6HB 3SE0A 2OCEA 4IALA 1HR0Q 3DEPA 2PQEA 4HIOA 1XNQQ 4P73A 1LACA 2QF7A 1SJHD 3ERQA 4DAVA 4HIDA 1Y1VB 2UU9Q 1ILPA 1DJRD 5ELDA 4HJ8A 4DAYA 1CKMA 1HNZQ 1HPCA 1VF5C 3T1YQ 2QDBA 2XSCA 1S5DD 1HNZL 4ME3A 2X6LA 4DAPA 4K2LA 3TMEA 1SLJA 1SE4A 3DEOA 3GTLB 3TQYA 2VL6A 2BA0A 2WKCA 3EJIA 1PH7A 2F0QA 2QW7A 3H0GB 1A2UA 4DKAC 1WCMH 1E3PA 3CCQA 2HT1A 3PIO3 3G6JB 1SNQA 2I5LX 3E5SA 4FXGC 1Y69U 4BBSB 4JV5L 1YEZA 4MNOA 1D5XC 5JJKA 1HA6A 3KBGA 1VQHA 3PIOA 4PMBA 3NHHA 3OTOL 1HJPA 4EX5A 2A69D 1PV4A 5IGGA 4N8FA 4PV1C 3K5MA 1K28A 4A93H 1TKWB 4NW2A 4A75A 2JA7B 1I5FA 2JQOA 1OXXK 1SMXA 3CCSA 1O7ZA 4IOCA 3IRBA 4WRDA 2E2IB 3GV6A 1YI2A 4N8X1 3S16B 1PTOD 4DK0A 5J1ZA 5C5MA 1VQOA 4C3JB 1CSPA 1G291 4A3IB 4IJHA 2L15A 1C9OA 3C46A 1C4QA 1TS5A 3MAQA 4A3GG 5J3BA 2HUGA 5DLQE 4MTNA 3S24A 3HOYH 4C2MB 4RGNA 1XX8A 5M5XB 3GTGB 4I7ZC 3I4OA 3NENA 3GTJH 1F77A 2F0VA 4A3CG 1DOKA 1I94Q 2PQAB 4IJLA 2EZVA 3GTKB 4BXXG 5I6YA 3S15B 5L37A 5IYBG 1ET9A 1K8MA 3H3VC 4L5RC 1JB3A 5IP7G 2JE6I 3V96A 1KL9A 5NUCA 1M1KC 2IX1A 4JI3Q 2R6GA 2CVRA 2NVQH 3J81E 1MHWC 4OWXB 1XPOA 4LF7L 3OMGA 3NELA 4KD4A 1PH6A 3CU7A 3OOCA 2XRQD 2NZOA 3S9WA 3BDLA 4X66Q 4R9WA 1EL0A 2RDFA 5CBEE 4KI0A 1CI3M 1Q1BA 3GO5A 3BVMA 5KNCA 4DAYB 3OW2A 1YNJD 1B50A 2NTTA 5FLMH 1XTDA 2NN6H 4DU9A 2MHVA 4DV6Q 1PRTB 2C9OA 1VQLA 3RN5A 4JI7Q 1PH5A 4B3TQ 1SE2A 2B2YC 1D7QA 3GTQH 3M4YA 1NJIC 1FJGL 3JAMi 1NBWA 2BCOA 5FLXc 2K5DA 4JI7L 3HOVB 4IUTA 2H1EA 2ZTCA 1HTPA 1VQ6A 1EQQA 1VCIA 2Q8IB 1SFOH 4CDFC 1Y1WH 3CCVA 3JAME 3PMFA 2WV6D 2KQ3A 3NPPA 3AMUA 1HNXL 2DY7A 4HMJA 1E2VA 4LF8L 5JAVA 2K50A 2KOLA 1BNZA 2A69C 2SEBD 3PUXA 3VR5A 1KABA 3SXHA 2QDLA 2L55A 2JXMB 4HMIA 4DR1Q 1CA5A 1YJ9A 2VQFL 1JICA 4RCOA 2MNAA 1J8IA 2L0CA 4A76A 4DR1L 1L1OA 2HQLA 3BVZA 2F0GA 3URYA 1WCMB 1VDZA 3OIPA 1PTOC 4PZ6A 1Y14B 1IYJB 3A5UA 3PQIA 4QL5A 5DM73 5LHY1 4X3UA 4U673 4IPDA 3MFYA 1KIXA 1A63A 1BUVT 1M4VA 5M5WH 3R3OA 1YBYA 3E9HA 3S17B 1YVCA 2N8NA 4R4CA 3U4VA 4A93B 3CRLC 1R4PB 2JA5H 1WTOA 3S2DH 2HDLA 4IO9A 3M4OH 2I46A 2IY5B 3Q6SA 5LMNW 2C5CA 3H0GG 2Z6KA 5EPKA 4MIUA 3ND9A 3CCRA 1AE3A 3HOZG 1TWCH 1MSGA 4G57A 4C1NI 4TRDA 3SEBA 1CSQA 2K52A 4RWSC 4BBSG 2F0FA 1JOKA 3W5OA 3BVGA 2OTLA 3HOYB 5EPJA 1CKOA 4X62Q 3DWAA 4C3IB 3DM1A 2DY8A 1D5MC 3S1MH 4KD3A 2ZJRA 1XPRA 3PO2H 4X62L 4ZYSA 3PO3G 2B2WC 1CK1A 2JP1A 1S5CD 1YNJC 2K01A 3FMCA 5F2DA 1YJNA 3I90A 1QWYA 4JC0A 5K36G 3I2ZA 2D9UA 2KJXA 4C3JG 1JR0D 2KCNA 1SYGA 4A3IG 2Q8TA 3HKZB 1PRTF 1YHBA 3J7ZC 2NVQB 2VNUD 3CCJA 1WFQA 1X3QA 2OXPA 1JC7A 3TP6A 3Q22A 2I0QA 2GVAA 1SEBD 2IPKD 4DPGA 1DOMA 2L12A 1UNSA 2CH4W 2UXCQ 3RZOH 4HJAA 2Q2UA 1U0LA 4EQOA 1X56A 2IWHA 2NVTH 2UXCL 2ICEC 1BO0A 3DM3A 3PSIA 5K5PA 3CW2C 3NBHA 4IURA 1NR2A 2IW3A 3P1HA 2B2UA 3PUZA 1KRSA 3GTQB 3I4MB 3GTOH 1SSOA 4C3HG 1L1OB 2JK8A 2PZWA 2Z0SA 2HHHQ 1G2TA 5CV7A 4RAUC 5D65A 1SFOB 2L4NA 1Y1WB 2PO4A
chains in the Genus database with same CATH topology
4XDXA 4ZK9B 2F3WA 3PV0A 3BDCA 4A3FB 2R93B 5IODA 1Q8IA 3PUWA 5ELCA 3VYTA 2A6HD 3HG9A 1BF4A 3M7GA 2BOSA 3K6OA 4BA2I 1EQTA 3NXWA 5CMDA 3SDZA 1ILQA 2MUYA 1SNMA 5I2YA 1H9SA 4N9PA 2EYPA 1QNUA 3QWNA 4G4KA 4G7ZC 2CW0C 3A8IE 2NZ1D 5M5WB 1GUOA 1LT4D 3FEWX 3S2DB 2JA5B 5JVG3 3M4OB 2KUMA 2A68D 1IL8A 4IFDJ 2NYZD 1TWCB 2F0EA 1EQVA 5A2QE 3Q0AA 3QB3A 1IW7D 3D31A 4R8NA 2EE1A 5JJZA 2L1BA 1EY5A 1NSNS 2PYKA 4DN4M 3QJYA 3S1MB 3GQBA 3PO2B 2F3VA 5FLXL 1DYQA 1II3A 1TS2A 5CORA 4FF2A 4QUCA 4RKBA 4K8JA 4DK1A 1STEA 2KA7A 1AN8A 2PNRC 2XWJB 1J9OA 4HN7A 2F0OA 3K0YA 1HFGA 2DNEA 4RGOS 1Y8PB 1PLFA 1F9SA 2F0SA 4C3IG 1S4ZA 3MXGA 1ICWA 3J7AF 1ZXTA 2K6AA 3QIAA 3RZOB 2XIWA 1OXTA 2EYLA 2WB1B 2PMZB 1HUNA 4UDUC 4B9XA 2NVTB 1O78A 4HAEA 2A6HC 5TSSA 5KYIA 1HRJA 4AYBB 1LT6D 2FHTA 1Q3LA 2WAQB 2B2TA 4KMUC 4MHEA 4XTCS 2AQ3B 5KIXA 4L8JA 3J80E 3OWEB 2DN8A 3FDTA 1AW7A 1WTXA 1Z6HA 4QCLA 1DXMA 1LTSD 1CZGA 3DWQA 1YNND 2A68C 2KCCA 3MC0B 4A3GB 1SYEA 2OEOA 2FMCA 1HHVA 1JCKB 4UAIA 1U9RA 4XYQA 1HTLD 3S1QB 3R8BA 5DAUA 1IW7C 1H9RA 5JPMC 3D8GA 1LTTD 1A3VA 5K36H 2LS01 2EVBA 4KN4C 2L9HA 2QILA 2M2LA 1EZ6A 3A56A 3HP3A 1WVLA 1LT3D 4WFN3 1F2YA 3I3CA 4V0BA 1ENAA 2QCPX 3M7NA 4IUNA 1O7YA 3I4LA 2AWOA 3NQIA 3NWSA 4KJOA 3A54A 4X3TA 2EY6A 3OMCA 1MSHA 4XT1B 1D1IA 5CV5A 4X3SA 4KKUA 2D2CC 3M3YB 3CRKC 2IX0A 2EYOA 1H9JA 1F2ZA 2G9HD 2WINB 1DD2A 3SHLA 1EZ8A 1EU3A 3L9AX 2F0PA 2NVXB 2PW7A 1Z7TA 5CV8A 3D6WA 3QOLA 5I9PA 3JAML 2JEBI 1TWFB 1JOQA 1GHJA 1Q1EA 5CV9A 1STNA 2L11A 4KKTA 5ELFA 4LMQD 4CHTB 3J7YW 1TU2B 4ZRZA 4WORA 2D62A 1PZKD 3L7ZC 1YNNC 3IAYA 2RBMA 5A35A 1L0YB 1D1KA 3P75A 3FVQA 4ZKCB 2RVLA 2EY5A 4ODGA 3LWUA 1UUPA 2X69A 1I50B 1A15A 2F0TA 1B3AA 3X3MA 1GUGA 1KAAA 3HOZB 3KLSX 2F0KA 4IZ8A 3HRZC 5FO7B 3GD7A 1EY9A 1I4RA 3HGBA 3TZDA 1CTMA 3TP8A 1T5XD 5CGKA 1F2LA 5EKIA 3T16A 2FJ2A 3I8ZA 5CR3A 4FXKC 3OW7A 4TKOB 3P7JA 5LL6S 3PO3B 1TWHB 3W3AA 3C1EA 2BE5C 1RCVD 3K5NA 4BY1B 4EQPA 2B39A 4CJ2C 4F8MA 4F7XA 3MVVA 2RA4A 1QCBD 1SNDA 3H94A 2K28A 1ONLA 1QILA 2Z4IA 2QEJC 1KDAA 4A3JB 3A55A 5JEAG 4DXGA 1ET6A 2F0UA 1G8ZD 1EIGA 4NKLA 4B9WA 2SDFA 2EDGA 1S5FD 1F9QA 4HR7B 1OO9B 4M8AA 1TS3A 1ML0D 4E6IA 3MFGA 2WACA 3M85A 1A3UA 4CKCA 4C3HB 3CQZB 4MN3A 1PRTD 2RKSA 5CV4A 4WJWA 2XN9C 1MD2D 4K5WA 3MTSA 2B2VC 2KHSA 3T4AC 4FYDA 4IQZA 5C0XG 1I4QA 5J22A 4DA2A 3SK4A 4IUPA 5E4WC 1TWAB 1X32A 1JWUD 4I65A 1T5EA 2K32A 4G7OC 5CV6A 4X3KA 3ONAB 4ID6A 4DFAA 1D6EC 3WOFA 2M00A 1SNOA 1U4MA 1RJTA 5G3LD 1V1PB 1OXUA 1H9MA 4FXDA 3W2DA 4O42A 1STAA 5C5LA 3SK6A 3SK8A 4B08A 1HCZA 3NBIA 1CM9A 4NMZA 5C0XI 4K6LA 2X6GA 1NCVA 1LLRD 4NP5A 3SR1A 3NTIA 3AB9A 5A2QL 3U9OA 1CA6A 1B2TA 2LFNA 4KTAA 4K6DA 3UI2A 4K2KA 2FFKB 1STGA 5BN5A 3I73A 1TR5A 3MA2B 1SE3A 1PMRA 5EQ0A 3VYSA 4DNTB 1PZID 1CZWA 4HCEA 1EEFD 1HUMA 1LTRD 1AEXA 1X3PA 4RHSA 2V4DA 2H4OA 2Z4HA 3K5LA 1PDQA 1PRTC 3OPOA 1IYUA 5DNFA 4KY7A 1Y8NB 3EVQA 3OSOA 3QOJA 5CC4A 1A3TA 4L6TB 4QF4A 4DF7A 3H09A 5EKLA 2R7ZB 4A3DB 3PUVA 5E3FA 3EQLC 3T51B 1FNVA 2MGSA 2A74C 5IT9E 3FKIB 4BY7B 4BBRB 4EGVA 1RTOA 4R8IA 5D3DA 3PUYA 2LKVA 1AZPA 2WIIB 2PZTA 2E2DC 1G6ZA 2EYMA 3J80L 2LY7A 1SJED 1HFNA 1O7LA 4F87A 3RMHA 2NB0A 4L63B 2YU9B 2LMCB 3RUZA 4OO1G 1DONA 1E2ZA 5ISRA 1DZ1A 1PZJD 1I4GA 2WP8J 3HZXA 5C4XB 5G3LF 4S3SA 3ZYYX 5IGCA 1EY7A 3TN2A 4ZUJA 2K03A 3SVMA 1V1OA 3ITPA 5EBCA 3MXUA 1O80A 3VR2A 2NWGA 1ZYRD 1PFMA 1B44D 5JEAH 5M3FB 5EGTA 4OO1I 2A6ED 2EPBA 1LTGD 2TMPA 1AZQA 4PQXA 3QG1A 2VB3X 3Q23A 1TY2A 2OF1A 1B4OA 4XYOA 3NSWA 1LO5D 2RSNA 1CT1D 3FPPA 1GUTA 3TSSA 3H6MA 3KUPA 2F0JA 1G91A 2K7VA 2GA4B 1CQVA 2K5WA 5LL6X 3V05A 2K33A 3EA6A 3MZ5A 5C0XH 3GV3A 3BYTB 4XQNA 2O4XA 4PMCA 2K04A 2EYJA 2F0HA 2R61A 4OL7A 2E2JB 2O2LD 5J39A 2ICIA 1KTKA 2R92B 1EY0A 1EYCA 5BN3A 4J6HA 2HCIA 4A3BB 4Q5VA 1GHKA 4CJ1B 4KK7A 2Q8RE 1HA5A 1R9TB 4ZQ3A 1Y8OB 4LJZC 3A7AB 2Y0SB 5M5YB 3DWPA 3IFDA 3LWEA 2AQ2B 3E6ZX 3NUCA 2A73B 1BCPB 5I6WA 5FOBB 2SNSA 3HOXB 1QJOA 1VF7A 2EJFC 1BBXC 2XVSA 3KF8A 4FVMA 1XYIA 4FNFA 4M1UB 2AUJD 5IOCA 3D4WA 4H7BA 3VYUA 3R2IA 3HOUB 4OIJA 1Q90A 3QO2A 3KBXA 3IFTA 1EWHA 2O5JC 4IN3A 2B2UC 4LK1C 3VR6A 1AFPA 3S2HB 4V190 3T56B 1WTWA 1NAPA 4CJ0B 1GXDC 1EYAA 2JSOA 3N52A 1SMYD 1TT2A 2F4IA 3WDNA 1GUWA 2B2YA 3MXPA 2XWBB 4IUUA 2KECA 1V43A 1TQOA 1PTOH 1QOHA 4OO1H 1EY4A 3K7AB 4DNRB 1NUCA 5KNBA 1CQFA 2O5IC 4K5VA 5EPLA 1D5ZC 1F2MA 2EYFA 3KLRA 2N88A 1BXTA 1F9PA 1I6VC 1STBA 5T1IA 5M3MB 1I4XA 5IIFA 4XQJA 4XXEA 4DXFA 1EFID 2AUKA 3EROA 1WTVA 2AWNA 1L0XB 3BZDB 5COYA 1R4QB 3I72A 4K8IA 2F0WA 1SAPA 1SYDA 1WTQA 2E74C 3X3NA 4BS9A 1ENFA 1EU4A 5CYUA 1EYDA 1DOLA 4Z9CB 3SK5A 4IFDG 2SOBA 2JA8B 1GJXA 1RHPA 1IKLA 2IX3A 2QKIC 4RGMA 1LTAD 2ZT9C 4O1NA 4RKLA 2F0MA 1TWGB 2D5DA 2KVMA 2SNMA 2Z1CA 4GZYC 1V1PA 1SMYC 2B2WA 2HCCA 1LT5D 4RFBA 5ELEA 4ABNA 2FMMA 4K14A 1JE4A 4C56C 4N9TA 3K57A 2BA1A 2K1BA 1GUNA 5FK9C 1SYBA 2VXWA 2EOTA 1CHPD 1HXYD 4TQUS 1XWEA 2B2TC 4IFDI 3NTKA 1XXGA 2WKDA 4RHRA 1TS4A 5EBDA 2MP1A 1JQYD 1STHA 2VUMB 3LX0A 5IT9L 4IUQA 5IGFA 4XQQA 3K5OA 1HQMC 1KLGD 1QG7A 2F03A 3Q24A 5KEEA 4KJNA 1PTOB 2RDGA 1M8AA 4QIWB 5JOBA 2E76C 3S14B 1CFMA 3HOWB 3KK7A 4J8QA 2XRSD 2R3ZA 2B8FA 1RDPD 1H9KA 3HS0C 4CKEA 4G7HC 2EJMA 1RODA 5KNDA 2IT1A 1PFBA 1MI2A 2F0DA 1IKMA 5JPNC 2AQ1B 1ESFA 1TY0A 3S1NB 2PCFB 1RF2D 2J7ZA 3TZUA 1GUSA 1PXUA 2BDNA 3LNNA 3TBIB 1WTPA 3NWTA 1S5BD 3MEHA 3NP8A 1ENCA 2ZXPA 3DXJC 3P20A 1ZKOA 4BWGB 3H91A 1WTRA 5C6AA 2F0LA 1NR4A 5IGBA 5M9OA 4RA8A 4H13C 5I4DA 1ZEQX 3WOEA 2PW5A 1MBYA 1W6JA 1JORA 4A3EB 1IHZA 1EWCA 1K8OA 2HDMA 5C3WA 3NTHA 3OHXC 4KV6A 2B8GA 4Q0FA 4A3MB 5I2XA 1B9NA 4QB4A 3L3OC 2IJ0A 4KY6A 2ZXRA 3TDQA 3FRPB 1LABA 2OT2A 2RDHA 1E0BA 5HURA 2JYOA 3RZDB 4PMWA 2NBFA 1SDFA 4YIJA 1PTOF 3R93A 1XTCD 4ULLA 3R2TA 3BDOA 5DEHA 1F9RA 3C2PA 2FINB 1KNAA 1V8QA 2DNCA 4HEDA 4NDXA 1LV9A 4FF3A 1LTBD 4ME5A 1KLUD 3TP5A 2ZXOA 2CW0D 2RQXA 3GP7A 1SNPA 1LTID 4QUFA 3I91A 1EEID 3GTJB 5I9OA 3A7LA 4ZAIA 2JA6B 2ID0A 2M9VA 5DM63 5FO8B 4JBWA 4CGYB 4IFDH 3D3RA 4KKSA 4ZKBB 1KDCA 1VMPA 2N55A 2F1MA 5IGEA 2Z8LA 1TIID 2PZUA 4H0LC 3A8JE 1FR3A 3I70A 2KEEA 3U9SA 4IUVA 3DMUA 2XNAC 1JWMD 1A6XA 3MHBA 4ZLTF 1RKNA 1GOZA 4LAAA 2I07B 4XT3B 1FGBD 1KDBA 2RSOA 4TSSA 5C4ZA 3K58A 1U4LA 2K05A 3OIQA 5KYLA 2B63B 3EFXD 3CHBD 4QMGA 1UAPA 1RTNA 5C3XA 2CHBD 2F0IA 3N6RA 1I4PA 1PYWD 2EY2A 2MPMA 4CKBA 3C1FA 1MGSA 5C4JB 2J4XA 1SXTA 2VB2X 1Z47A 4A3KB 1D2BA 3RLFA 3K59A 3E0JA 4JK1C 5AFWA 5JVH3 1U4RA 3DUZA 3NE5B 3VR4A 4PNYA 5FKAC 3T13A 3D4DA 3IKJA 3S1RB 4FP5D 1KNEA 5E1FA 1VMCA 2HQEA 1DM0B 5C4HA 1EIHA 2CQAA 1STYA 4J1MA 1SYFA 2G9DA 3T53B 2EYHA 3ND8A 4RH6A 2EY1A 2ENBA 3KLSA 4U68A 1G2SA 1A2TA 4KN7C 5C3EB 3G7LA 2YYZA 4OGQC 5D14A 1FNUA 4K5XA 3J7AV 2NTSA 5T1GA 4DGZA 4FF4A 1DCZA 5C44B 4C1NK 5KRUA 1ESRA 2K5QA 2L5TA 2JEAI 2J0TD 5FO9B 3DHQA 5CBAE 1QE6A 3F2UA 1BCPD 3VR3A 3CKIB 1B9MA 1ZYRC 1JOOA 2E75C 4HCSA 1C48A 1I3QB 5JEAJ 3HEJA 3MXNA 4BA1I 5HGTA 1SBBB 1SYCA 4FO2A 3D4RA 5IGDA 1C8CA 1I4HA 2A6EC 3VA7A 4RGTA 1QB5D 3C3LA 4KHZA 3IL8A 1FYCA 3GTOB 2MJ8A 3FPUB 5BN4A 1U4PA 3PIP3 3RD4A 3NK9A 5EJWA 3VA5A 1H9SB 4P2CB 1B1ZA 2NN6G 4EVOA 3BG3A 1K83B 3BS1A 3I4NB 1BOSA 4ILWA 5C0XJ 4CBVA 1PFNA 1BR9A 5E4XA 2A5HA 1OXSC 3TP7A 3GTPB 4RCNA 3BYYB 2E2HB 3V2TA 1FNWA 3NQTA 1AP0A 2B2VA 4XIGS 1HQRD 4F88A 1S5ED 1UEAB 4KHVA 5EKKA 1BDOA 2KEDA 2NN6I 1WD0A 4ZUIA 1EOTA 1JWSD 4HSVA 3MWYW 3GTMB 4EQNA 5ELBA 3J81L 1TVXA 1BCPC 4OIKA 4H44C 1W6KA 2BE5D 4HSPA 1EY6A 3D6CA 1B53A 4KY5A 1Q12A 4FF1A 4Y7NB 1FD7D 3VYRA 1CHQD 2IL8A 1EY8A 3AU7A 2PPBC 2NVYB 3OWFA 2NUCA 1OXVA 1BCPF 1WD1A 2BDOA 2EXZA 4HTHA 1IYVA 1QNKA 1SNCA 1E2WA 2F0NA 2EJGC 5D3IB 5FLXE 1RD9D 4OHJA 3O13A 5KGUA 2TSSA 1BQQT 3A8KE 1I6HB 3SE0A 4IALA 3DEPA 2PQEA 1LACA 2QF7A 1SJHD 3ERQA 4DAVA 1Y1VB 1ILPA 1DJRD 5ELDA 4DAYA 1HPCA 1VF5C 2QDBA 2XSCA 1S5DD 2X6LA 4DAPA 4K2LA 3TMEA 3DEOA 1SE4A 3GTLB 2BA0A 2WKCA 3EJIA 2F0QA 3H0GB 1A2UA 3PIO3 3G6JB 1SNQA 3E5SA 4FXGC 1Y69U 4BBSB 1D5XC 1HA6A 3KBGA 4PMBA 3NHHA 2A69D 5IGGA 4PV1C 3K5MA 1TKWB 4NW2A 2JA7B 1OXXK 1O7ZA 2E2IB 4WRDA 3GV6A 3S16B 1PTOD 4DK0A 5J1ZA 5C5MA 4C3JB 1G291 4A3IB 3C46A 1C4QA 1TS5A 3MAQA 2HUGA 4C2MB 4RGNA 1XX8A 5M5XB 3GTGB 4I7ZC 1F77A 2F0VA 1DOKA 2EZVA 3GTKB 5I6YA 3S15B 1ET9A 1K8MA 3H3VC 1JB3A 2JE6I 3V96A 2IX1A 5NUCA 2R6GA 2CVRA 3J81E 3OMGA 4KD4A 3CU7A 3OOCA 2XRQD 3S9WA 3BDLA 4R9WA 1EL0A 2RDFA 5CBEE 4KI0A 1CI3M 1Q1BA 3GO5A 3BVMA 5KNCA 1YNJD 1B50A 2NTTA 2NN6H 4DU9A 2MHVA 1PRTB 2C9OA 1SE2A 2B2YC 3M4YA 2BCOA 2K5DA 3HOVB 4IUTA 2H1EA 1HTPA 1VCIA 2Q8IB 3JAME 3PMFA 2WV6D 2KQ3A 3NPPA 3AMUA 2DY7A 4HMJA 1E2VA 5JAVA 2KOLA 1BNZA 2A69C 2SEBD 3PUXA 3VR5A 1KABA 3SXHA 2L55A 2JXMB 4HMIA 1CA5A 1JICA 4RCOA 1J8IA 2L0CA 3BVZA 2F0GA 3URYA 1WCMB 1VDZA 3OIPA 1PTOC 5DM73 5LHY1 4X3UA 4U673 3MFYA 1BUVT 1M4VA 3R3OA 3S17B 4A93B 3CRLC 1R4PB 1WTOA 2HDLA 2I46A 3Q6SA 2C5CA 5EPKA 4MIUA 3ND9A 1MSGA 4G57A 4C1NI 4TRDA 3SEBA 4RWSC 2F0FA 1JOKA 3BVGA 3HOYB 5EPJA 3DWAA 4C3IB 3DM1A 2DY8A 1D5MC 4KD3A 4ZYSA 2B2WC 1CK1A 2JP1A 1S5CD 1YNJC 2K01A 3FMCA 5F2DA 3I90A 1QWYA 5K36G 2D9UA 2KJXA 4C3JG 1JR0D 2KCNA 1SYGA 2Q8TA 3HKZB 1PRTF 2NVQB 2VNUD 1X3QA 2OXPA 1JC7A 3TP6A 3Q22A 1SEBD 2IPKD 1DOMA 2L12A 1UNSA 4EQOA 2IWHA 2ICEC 1BO0A 5K5PA 3NBHA 4IURA 1NR2A 2IW3A 3P1HA 2B2UA 3PUZA 3GTQB 3I4MB 1SSOA 4C3HG 2PZWA 1G2TA 5CV7A 4RAUC 5D65A 1SFOB 2L4NA 1Y1WB 2PO4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DNE A;  4I7Z C;  1Y8P B;  2O5J C;  3RLF A;  4G7H C;  1IYV A;  2EJM A;  1E2W A;  4LK1 C;  4IFD G;  1OXU A;  4JK1 C;  3W3A A;  4KKU A;  1H9M A;  3VR6 A;  5BN4 A;  2EJG C;  5KND A;  3PV0 A;  2IT1 A;  2BE5 C;  2D2C C;  3QIA A;  1GJX A;  3VR4 A;  3NE5 B;  1OXT A;  3PUW A;  3T56 B;  3CRL C;  1HCZ A;  2A6H D;  3CRK C;  1O78 A;  5C0X H;  1O7L A;  3A7L A;  3IKJ A;  2A6H C;  2PCF B;  1H9S B;  1K8M A;  2ZT9 C;  3A8K E;  3ND9 A;  3SE0 A;  2NN6 G;  1H9J A;  3TZU A;  2LMC B;  1GUS A;  2JE6 I;  3BG3 A;  2D5D A;  4BA2 I;  1DD2 A;  4OO1 G;  3LNN A;  4GZY C;  1LAC A;  2QF7 A;  1SMY C;  3WDN A;  2R6G A;  3H94 A;  3AB9 A;  5BN3 A;  1E2Z A;  4JBW A;  3SDZ A;  1ONL A;  4KMU C;  1GHK A;  1Z7T A;  3T53 B;  4IFD H;  3ND8 A;  4XTC S;  3DXJ C;  4KKS A;  3P20 A;  3OOC A;  5JEA G;  1OXS C;  1ZKO A;  2BA1 A;  1H9S A;  1HPC A;  1VF5 C;  2JEB I;  1GUN A;  2F1M A;  4KI0 A;  4G7Z C;  1GHJ A;  1CI3 M;  1Q1B A;  1Q1E A;  1Y8O B;  2CW0 C;  3A8I E;  4L8J A;  5KNC A;  4KN7 C;  1V43 A;  4LJZ C;  4RCN A;  5BN5 A;  3A7A B;  3I73 A;  4H13 C;  2NN6 H;  4TQU S;  2YYZ A;  1GUO A;  2EDG A;  4KKT A;  1YNJ C;  3FMC A;  2DN8 A;  4OGQ C;  1PMR A;  4OO1 H;  2BA0 A;  4HR7 B;  3MXU A;  4H0L C;  1Z6H A;  4DNT B;  1TU2 B;  5K36 G;  3A8J E;  1FR3 A;  3U9S A;  2A68 D;  3VR2 A;  4DNR B;  3M85 A;  1DXM A;  2D62 A;  4XIG S;  5KNB A;  2A68 C;  2KCC A;  3M4Y A;  3L7Z C;  1DCZ A;  2V4D A;  1YNN C;  5A35 A;  1K8O A;  1BDO A;  5JEA H;  3OPO A;  2L5T A;  1Y69 U;  2JEA I;  1HTP A;  1IW7 D;  2NN6 I;  1IYU A;  3D31 A;  2O5I C;  2B8G A;  1VCI A;  2Q8I B;  1A6X A;  1IW7 C;  1H9R A;  2A6E D;  1B9N A;  1HQM C;  3LWU A;  3KLR A;  1Y8N B;  1QJO A;  1I6V C;  1VF7 A;  2A69 D;  2EJF C;  1E2V A;  3QG1 A;  3QJY A;  4PV1 C;  4IQZ A;  2A69 C;  5K36 H;  5C0X G;  3GQB A;  3PUX A;  1GUG A;  2EVB A;  4KN4 C;  1LAB A;  1TKW B;  4H44 C;  3VR5 A;  3VR3 A;  2AUJ D;  2BE5 D;  2JXM B;  3FPP A;  1B9M A;  1OXX K;  1ZYR C;  1Q12 A;  2E75 C;  3GD7 A;  1FYC A;  1GUT A;  1OXV A;  2AUK A;  3HGB A;  2E76 C;  1CTM A;  4DK1 A;  3PUV A;  3EQL C;  1T5E A;  2KA7 A;  4DK0 A;  3T51 B;  4BA1 I;  3PUZ A;  1VDZ A;  1CFM A;  3N6R A;  2K32 A;  1G29 1;  3M7N A;  4G7O C;  2K7V A;  3I72 A;  2PNR C;  3BDO A;  3D4R A;  3I4L A;  2AWO A;  1Q90 A;  2A6E C;  3VA7 A;  2E74 C;  2B8F A;  2PPB C;  4KHZ A;  3IFT A;  3MFY A;  2K33 A;  3OW7 A;  4TKO B;  1V8Q A;  3PUY A;  1H9K A;  2DNC A;  2BDO A;  1EWH A; 
#chains in the Genus database with same CATH topology
 4XDX A;  4ZK9 B;  2N3S A;  2UUA Q;  2F3W A;  3PV0 A;  3BDC A;  4A3F B;  2R93 B;  5IOD A;  1Q8I A;  1K83 H;  3PUW A;  5ELC A;  3VYT A;  3I4N H;  2A6H D;  3HG9 A;  3JAM c;  2OQ0 A;  1BF4 A;  3M7G A;  2BOS A;  4A3G H;  3K6O A;  4BA2 I;  1EQT A;  2HIX A;  1N36 Q;  3NXW A;  5CMD A;  3HOV G;  4IPC A;  3SDZ A;  1ILQ A;  4L5S A;  1J6Q A;  1GKH A;  3S1Q H;  2MUY A;  1SNM A;  4A3C H;  2K5N A;  1PH4 A;  5I2Y A;  1H9S A;  4N9P A;  4BXX H;  2EYP A;  3L2P A;  1QNU A;  1VQB A;  3BJU A;  3QWN A;  4G4K A;  4G7Z C;  5IYB H;  2CW0 C;  3A8I E;  4DUY L;  2NZ1 D;  5M5W B;  3UDI A;  5IP7 H;  1GUO A;  3F2B A;  1LT4 D;  2AMC B;  3RLO A;  4UY8 C;  3FEW X;  3S2D B;  2JA5 B;  1WTH A;  5JVG 3;  3M4O B;  2KUM A;  2A68 D;  3A0J A;  4JBK A;  1IL8 A;  4IFD J;  1PVO A;  2NYZ D;  1TWC B;  2F0E A;  1PH3 A;  1T9H A;  1EQV A;  1PYB A;  5A2Q E;  3Q0A A;  3QB3 A;  4DV2 Q;  1FGU A;  3A74 A;  5IP9 G;  1IW7 D;  3D31 A;  4R8N A;  2EE1 A;  5JJZ A;  2EQS A;  2L1B A;  1N33 Q;  4GKJ L;  1EY5 A;  1NSN S;  1Z9F A;  1QVG A;  3F8T A;  4DNI A;  4JI1 Q;  2PYK A;  1N33 L;  4DN4 M;  3QJY A;  1XMQ L;  3CC4 A;  3S1M B;  2VS1 A;  3GQB A;  3PO2 B;  2F3V A;  5FLX L;  1DYQ A;  1II3 A;  1TS2 A;  5COR A;  4FF2 A;  4QUC A;  1KD1 C;  4RKB A;  4AQY Q;  1S40 A;  3F2C A;  4K8J A;  4DK1 A;  2H5X A;  1STE A;  2KA7 A;  1BVS A;  1EOV A;  1AN8 A;  2NVX H;  2K14 A;  2PNR C;  1X6O A;  2XWJ B;  1J9O A;  4HN7 A;  4LUO A;  2F0O A;  1KHI A;  1VS0 A;  3K0Y A;  1XJV A;  1HFG A;  1TWF H;  2DNE A;  4RGO S;  1Y8P B;  3BZK A;  1W2B A;  1PLF A;  1F9S A;  4FDB A;  2F0S A;  4C3I G;  1JJC B;  2CWP A;  1ASZ A;  1S4Z A;  3MXG A;  1ICW A;  3J7A F;  1ZXT A;  2K6A A;  3QIA A;  1I6H H;  3RZO B;  2Q2I A;  2XIW A;  1OXT A;  2EYL A;  2WB1 B;  2PMZ B;  1HUN A;  4UDU C;  4B9X A;  3CPW A;  1O78 A;  4HAE A;  2NVT B;  4X65 Q;  2A6H C;  5TSS A;  5KYI A;  1HRJ A;  4X65 L;  4AYB B;  3HKZ G;  1LT6 D;  5HY6 A;  1IZ6 A;  3CP0 A;  4LFC Q;  4A3D G;  4YCW A;  2FHT A;  1Q3L A;  2WAQ B;  2B2T A;  4KMU C;  1UEB A;  3CCE A;  4MHE A;  4XTC S;  2BH8 A;  1I50 H;  3J80 i;  4JI8 Q;  4BY7 G;  2AQ3 B;  2YTV A;  3CCL A;  3WWV A;  1PH1 A;  5KIX A;  4OWT B;  4JI8 L;  3H0G H;  4L8J A;  1GVP A;  3J80 E;  3HOZ H;  3OWE B;  4DV4 Q;  2DN8 A;  3FDT A;  1AW7 A;  2D0P A;  1EIY B;  1WTX A;  3KJP A;  1Z6H A;  3RNU A;  4QCL A;  5IY0 A;  4BBS H;  1DXM A;  1LTS D;  1CZG A;  2RHQ B;  3DWQ A;  3F1Z A;  1YNN D;  1XNR L;  1HZB A;  2A68 C;  2KCC A;  3MC0 B;  4A3G B;  1SYE A;  2OEO A;  2FMC A;  4KLK A;  1HHV A;  1JCK B;  4DV3 Q;  4UAI A;  1U9R A;  4XYQ A;  1HTL D;  1LTL A;  3S1Q B;  3R8B A;  5DAU A;  1IW7 C;  1VQK A;  1H9R A;  3F2D A;  3LGJ A;  5JPM C;  3D8G A;  3PO3 H;  4DR2 L;  1KQS A;  4GLV B;  5C4X G;  1LTT D;  4DV0 Q;  1O7I A;  4A3F G;  4JI0 L;  1A3V A;  4LF4 Q;  2LS0 1;  2R93 G;  5K36 H;  4GOP C;  2EVB A;  4KN4 C;  2L9H A;  2QIL A;  2M2L A;  1EZ6 A;  4DV0 L;  2DGY A;  4C3J H;  3A56 A;  3HP3 A;  4A3I H;  1WVL A;  1LT3 D;  4WFN 3;  1F2Y A;  3I3C A;  4V0B A;  1ENA A;  2QCP X;  1GO3 E;  3M7N A;  4IUN A;  1O7Y A;  3I4L A;  3G71 A;  2AWO A;  3NQI A;  3NWS A;  4KJO A;  3A54 A;  4X3T A;  2EY6 A;  3OMC A;  1UE5 A;  5M3F G;  5IYD H;  1MSH A;  4XT1 B;  1D1I A;  5CV5 A;  2VQE Q;  4X3S A;  5IWA Q;  3S15 H;  2KEN A;  4KKU A;  2D2C C;  2CFM A;  2VQE L;  3M3Y B;  4DR6 Q;  1IBM L;  5JJL A;  3CRK C;  2IX0 A;  2EYO A;  4DR6 L;  4LFB L;  3ULP A;  4C3H H;  2UXB Q;  1X3G A;  1H9J A;  1F2Z A;  2G9H D;  4JI4 Q;  2WIN B;  1DD2 A;  3SHL A;  1EZ8 A;  1EU3 A;  2UXB L;  3L9A X;  2F0P A;  4JI4 L;  2PW7 A;  2NVX B;  2PQA A;  1Z7T A;  5EAY A;  5CV8 A;  1VQ7 A;  4DV7 L;  1LM0 A;  3D6W A;  3QOL A;  5I9P A;  3JAM L;  4P75 A;  2JEB I;  1TWF B;  1JOQ A;  1GHJ A;  1Q1E A;  5CV9 A;  1QZH A;  1STN A;  1VQJ A;  1N8R C;  1PHJ A;  2L11 A;  1PA6 A;  4KKT A;  5ELF A;  3DLL A;  1TWA H;  4LMQ D;  4CHT B;  3J7Y W;  3HOV H;  1TU2 B;  4R4T A;  4GNX C;  2ZM6 Q;  4ZRZ A;  4WOR A;  2D62 A;  3EN2 A;  1PZK D;  4KHP L;  3L7Z C;  1YNN C;  3IAY A;  2ZM6 L;  2RBM A;  5A35 A;  1L0Y B;  4UHV A;  1D1K A;  2PI2 E;  2R92 G;  1UWV A;  2K5H A;  3P75 A;  3FVQ A;  4ZKC B;  2K75 A;  2RVL A;  2EY5 A;  4ODG A;  3LWU A;  1UUP A;  1SE8 A;  2X69 A;  1I50 B;  1J5E Q;  3E0E A;  1A15 A;  1E7Z A;  4JBJ A;  2DJF C;  2F0T A;  1B3A A;  2N49 A;  4X64 L;  1J5E L;  1EUJ A;  3X3M A;  1G51 A;  1GUG A;  2WB1 G;  1KAA A;  3HOZ B;  3KLS X;  2F0K A;  3EIV A;  4IZ8 A;  1M90 C;  3HRZ C;  5FO7 B;  4JV5 Q;  3GD7 A;  1EY9 A;  1I4R A;  3HGB A;  3TZD A;  2Y0S G;  1CTM A;  5HGQ A;  5IP9 H;  4AYB G;  1CKN A;  3TP8 A;  3ULL A;  1T5X D;  3OTO Q;  3W1B A;  5CGK A;  4X6A H;  2WAQ G;  3J80 c;  1F2L A;  5EKI A;  3T16 A;  2D0O A;  2FJ2 A;  1IBL Q;  3I8Z A;  5CR3 A;  4FXK C;  2YTX A;  3OW7 A;  4TKO B;  3P7J A;  1IBL L;  3S17 H;  5LL6 S;  3PO3 B;  1TWH B;  3W3A A;  4GN5 A;  3C1E A;  2BE5 C;  3HOX G;  1RCV D;  2KBN A;  4DV1 Q;  2MO0 A;  3K5N A;  4JI5 Q;  1C0A A;  4BY1 B;  4EQP A;  4DR3 Q;  2B39 A;  4DV1 L;  4JI5 L;  2C35 B;  4DR3 L;  4CJ2 C;  5BR8 Q;  4F8M A;  4F7X A;  2G5D A;  3MVV A;  5IE8 A;  2RA4 A;  1QCB D;  3ER0 A;  1SND A;  3H94 A;  2K28 A;  1ONL A;  5BR8 L;  4C3I H;  1QIL A;  2Z4I A;  2QEJ C;  3KF6 A;  3HOU G;  1KDA A;  4A3J B;  2OQK A;  3A55 A;  5JEA G;  4DXG A;  1ET6 A;  2F0U A;  1BKB A;  1G8Z D;  4NB3 A;  1EIG A;  4NKL A;  4B9W A;  2SDF A;  1K0R A;  3L0O A;  2EDG A;  1S5F D;  1F9Q A;  4HR7 B;  1OO9 B;  3D0F A;  4M8A A;  2ZTE A;  1TS3 A;  1ML0 D;  4E6I A;  4YHH Q;  4A3D H;  3MFG A;  2WAC A;  4B3S Q;  3M85 A;  1A3U A;  4LF7 Q;  4CKC A;  4C3H B;  3CQZ B;  1S3O A;  4YHH L;  4MN3 A;  4B3S L;  1OTC A;  3TRE A;  1PRT D;  2RKS A;  5CV4 A;  4BY7 H;  4WJW A;  2XN9 C;  1MD2 D;  4QGU A;  1JJ2 A;  2DUD A;  4K5W A;  3U58 A;  2WFW A;  3MTS A;  2B2V C;  3J7A 5;  2KHS A;  4JI2 Q;  1PH8 A;  1YJW A;  3T4A C;  4FYD A;  4IQZ A;  5C0X G;  1FJG Q;  1I4Q A;  4JYA Q;  5J22 A;  2AHO B;  4DA2 A;  3UDG A;  1VQP A;  3SK4 A;  4JI2 L;  4IUP A;  5E4W C;  1TWA B;  3I4M H;  1Q8K A;  2YU9 H;  4JYA L;  4LNQ A;  1X32 A;  2ZJQ A;  1JWU D;  4I65 A;  1T5E A;  2UXD Q;  4O2D A;  2K32 A;  4G7O C;  5CV6 A;  1HNX Q;  4X3K A;  4LF8 Q;  1CUK A;  3ONA B;  4ID6 A;  1CKN B;  4DFA A;  1D6E C;  3WOF A;  1XMO L;  2UXD L;  5C4X H;  3A5Z B;  4A3F H;  2R93 H;  2M00 A;  4QY7 A;  1SNO A;  2VQF Q;  1U4M A;  1RJT A;  5G3L D;  1QZG A;  1V1P B;  1OXU A;  1H9M A;  4FXD A;  4WJ4 A;  2PNH A;  3W2D A;  4O42 A;  2XTI A;  1STA A;  5C5L A;  3SK6 A;  3SK8 A;  4B08 A;  5M3M G;  1HCZ A;  3NBI A;  1CM9 A;  4NMZ A;  5C0X I;  3JC6 6;  4K6L A;  2X6G A;  4YY3 L;  1NCV A;  3CAM A;  1LLR D;  4NP5 A;  3SR1 A;  5M3F H;  3NTI A;  3AB9 A;  4OON A;  5A2Q L;  3U9O A;  1CA6 A;  4LF9 Q;  4O0A A;  1B2T A;  4APV A;  1HR0 W;  3TEH B;  2JJQ A;  3KF6 B;  2LFN A;  4LF9 L;  4KTA A;  1YNX A;  4K6D A;  1VQE A;  3UI2 A;  4K2K A;  2FFK B;  1STG A;  5GRO A;  5BN5 A;  4K0K L;  2JN4 A;  3I73 A;  1TR5 A;  4MTK A;  3MA2 B;  1SE3 A;  1PMR A;  5EQ0 A;  3VYS A;  1IXR A;  4DNT B;  1PZI D;  1CZW A;  4HCE A;  3UDF A;  1EEF D;  1HUM A;  1LTR D;  1AEX A;  1V1Q A;  1X3P A;  4GS3 A;  4RHS A;  4R4O A;  2V4D A;  2H4O A;  2Z4H A;  3K5L A;  1PDQ A;  1PRT C;  3OPO A;  1IYU A;  5GAG C;  5DNF A;  5E7N A;  4KY7 A;  3K81 C;  4EQ5 A;  1Y8N B;  3EVQ A;  1PH2 A;  3OSO A;  4LWC A;  1AE2 A;  2E2J H;  3QOJ A;  5CC4 A;  2ASB A;  1A3T A;  3T1H L;  4L6T B;  4BY1 G;  4QF4 A;  4DF7 A;  1U5K A;  3H09 A;  5EKL A;  3CD6 A;  2R7Z B;  4A3D B;  3PUV A;  2R92 H;  5H1S E;  5E3F A;  3EQL C;  1RL2 A;  3T51 B;  1FNV A;  2MGS A;  2A74 C;  2N78 A;  3H3V I;  1NE3 A;  1WYD A;  5IT9 E;  3PF4 A;  3RR5 A;  3FKI B;  4OXP A;  4BY7 B;  4BBR B;  4EGV A;  1RTO A;  4R8I A;  3CXC A;  4A3J G;  5D3D A;  4WJ3 M;  3PUY A;  2LKV A;  5GAE C;  1AZP A;  2WII B;  2PZT A;  2E2D C;  3AEV A;  1G6Z A;  2EYM A;  5M5Y H;  3J80 L;  1VQN A;  2LY7 A;  1SJE D;  1HFN A;  1O7L A;  4F87 A;  3RMH A;  2NB0 A;  2DJG C;  4L63 B;  2YU9 B;  4DR4 L;  2LMC B;  4HJ5 A;  3RUZ A;  4OO1 G;  1DON A;  1E2Z A;  4I7A A;  5ISR A;  1DZ1 A;  1PZJ D;  1I4G A;  2WP8 J;  3HZX A;  2CCZ A;  5C4X B;  5G3L F;  2XGT A;  4S3S A;  3ZYY X;  3HOX H;  5IGC A;  1EY7 A;  3GDE A;  3TN2 A;  4ZUJ A;  1NMF A;  1YIJ A;  2K03 A;  4A4I A;  3SVM A;  5LMU Q;  3PGZ A;  1V1O A;  3ITP A;  5EBC A;  4LF6 L;  3MXU A;  4NXN L;  1A62 A;  1O80 A;  5LMU L;  1Q82 C;  3VR2 A;  2NWG A;  1ZYR D;  1PFM A;  1B44 D;  1YZ6 A;  3B6Y A;  3HOU H;  4JOI A;  1EWI A;  5JEA H;  4DUY Q;  5M3F B;  5EGT A;  4YCV A;  4OO1 I;  2A6E D;  2EPB A;  1LTG D;  2TMP A;  1GM5 A;  4ALP A;  1AZQ A;  4PQX A;  3QG1 A;  2VB3 X;  3Q23 A;  3SGI A;  1TY2 A;  2OF1 A;  1B4O A;  1JMC A;  3CC2 A;  4XYO A;  3NSW A;  1X55 A;  1LO5 D;  2RSN A;  1CT1 D;  3FPP A;  4PG3 A;  1GUT A;  1HZ9 A;  3Q8D A;  3TSS A;  3ERS X;  3H6M A;  3KUP A;  2F0J A;  4GKJ Q;  1X54 A;  5JJI A;  1G91 A;  2K7V A;  2GA4 B;  4IPG A;  4A3E G;  1QVF A;  1GD7 A;  1XMQ Q;  4ZCK A;  4DUZ L;  3I55 A;  1CQV A;  2K5W A;  5LL6 X;  2K33 A;  3V05 A;  3EA6 A;  3MZ5 A;  3ICE A;  5C0X H;  2KCM A;  3M3Y H;  1YIT A;  3GV3 A;  3BYT B;  4A3M G;  4XQN A;  5AJ3 L;  2O4X A;  1L1O C;  4PMC A;  1N34 L;  4L5T A;  2K04 A;  2EYJ A;  2F0H A;  2R61 A;  1HZA A;  4OL7 A;  2E2J B;  1MJE A;  3M9B A;  3K7A H;  2O2L D;  5J39 A;  3H15 A;  2ICI A;  1KTK A;  2R92 B;  1EY0 A;  1Q81 C;  1H95 A;  1EYC A;  5BN3 A;  4J6H A;  2HCI A;  1X9N A;  4A3B B;  4Q5V A;  1GHK A;  4HJ7 A;  4CJ1 B;  4KK7 A;  2ATW A;  2HIV A;  2VZA A;  4DK6 C;  2Q8R E;  2Z6K C;  1HA5 A;  1R9T B;  5M3M H;  4R4I A;  4ZQ3 A;  4B3R L;  3KLW A;  5IT9 c;  1Y8O B;  3G48 A;  2NZH A;  4LJZ C;  3A7A B;  1X65 A;  2Y0S B;  5M5Y B;  3DWP A;  4P74 A;  4HIM A;  3IFD A;  3LWE A;  2R7Z G;  2AQ2 B;  1JE5 A;  4YWK A;  1MIU A;  1DGS A;  3AFP A;  2JA6 G;  3CPF A;  3E6Z X;  3FKI G;  1VQI A;  3NUC A;  4BBR G;  3NEM A;  2A73 B;  1BCP B;  5I6W A;  5FOB B;  2I5H A;  2SNS A;  3HOX B;  3I56 A;  1QJO A;  1VF7 A;  1L0W A;  1NTG A;  3H3V H;  2EJF C;  3HFZ B;  4LFA L;  3CMA A;  2XVS A;  1BBX C;  1XNR Q;  4FVM A;  3KF8 A;  1JT8 A;  1XYI A;  1NNX A;  3CC7 A;  4FNF A;  1ICF B;  4M1U B;  2AUJ D;  4JG2 A;  1PYS B;  4R1J A;  1VQ9 A;  5IOC A;  3D4W A;  1UE1 A;  3M4P A;  1TWG H;  4H7B A;  3VYU A;  4DR2 Q;  3R2I A;  4NPS A;  3HOU B;  3CCM A;  2MQH A;  4DV5 Q;  4OIJ A;  1Q90 A;  4JI0 Q;  1TWH H;  1N9W A;  3QO2 A;  3KBX A;  3HKS A;  3IFT A;  4DV5 L;  4OX9 L;  1EWH A;  1HNW L;  2O5J C;  2UUB Q;  4IN3 A;  2B2U C;  1E24 A;  4LUZ A;  4LK1 C;  4BY1 H;  3VR6 A;  2UUB L;  1AFP A;  3S2H B;  1HZC A;  4V19 0;  3T56 B;  1WTW A;  1NAP A;  4CJ0 B;  1GXD C;  1EYA A;  2JSO A;  3N52 A;  3I7F A;  1SMY D;  1TT2 A;  2F4I A;  2B63 G;  4A3J H;  3WDN A;  1GUW A;  4DR5 Q;  1IBM Q;  2B2Y A;  4LFB Q;  3MXP A;  1K8G A;  2XWB B;  4IUU A;  2KEC A;  1JJG A;  4A3K G;  1V43 A;  1TQO A;  1PTO H;  2AKW B;  3CQZ H;  1QOH A;  1FVI A;  4OO1 H;  1EY4 A;  3HKZ E;  3S14 H;  4AIM A;  3K7A B;  4DNR B;  1NUC A;  4DV7 Q;  3VDY A;  5KNB A;  1CQF A;  4P72 A;  2RF4 A;  3G6E A;  2O5I C;  4K5V A;  4A3L G;  5EPL A;  1D5Z C;  1F2M A;  2EYF A;  3KLR A;  2N88 A;  1BXT A;  1F9P A;  1I6V C;  1STB A;  5T1I A;  5M3M B;  1I4X A;  4KHP Q;  5IIF A;  4XQJ A;  1VQ5 A;  4XXE A;  4DXF A;  1VQ8 A;  2VW9 A;  3S1N H;  2YV5 A;  3KF8 B;  5C3E G;  1Q46 A;  1EFI D;  2AUK A;  3ERO A;  1WTV A;  4CDC C;  1Q86 C;  2AWN A;  1L0X B;  3BZD B;  5ELO A;  5COY A;  2CQO A;  4YWM A;  1R4Q B;  3I72 A;  4K8I A;  2F0W A;  1X3F A;  3RN2 A;  1K3R A;  4X64 Q;  4A3B G;  1SAP A;  1SYD A;  1WTQ A;  2E74 C;  3X3N A;  4BS9 A;  1ENF A;  5C44 G;  1FL0 A;  3TS0 A;  1EU4 A;  1EYD A;  5CYU A;  1DOL A;  3CCU A;  1HR0 L;  4Z9C B;  5LMN Q;  1XNQ L;  2EIF A;  1E1T A;  1EYG A;  3SK5 A;  4IFD G;  2SOB A;  1S72 A;  4LUV A;  2E5L Q;  2JA8 B;  5LMN L;  1GJX A;  1AH9 A;  2UU9 L;  1RHP A;  1IKL A;  4L5Q A;  1N32 Q;  2IX3 A;  2E5L L;  2QKI C;  3J81 j;  4RGM A;  1P8L A;  1LTA D;  1A8V A;  4LF5 Q;  2ZT9 C;  4O1N A;  3T1Y L;  1N32 L;  4RKL A;  4A3E H;  2F0M A;  1TWG B;  1YHA A;  2D5D A;  5GAD C;  2KVM A;  4LF5 L;  2SNM A;  2Z1C A;  4GZY C;  1V1P A;  1SMY C;  2B2W A;  1K8A C;  2HCC A;  1LT5 D;  4RFB A;  5ELE A;  4A3M H;  3K8A A;  4ABN A;  2FMM A;  4K14 A;  2F4V Q;  1JE4 A;  4C56 C;  3ULJ A;  4N9T A;  3K57 A;  1VQC A;  2BA1 A;  3CF5 A;  2K1B A;  1GUN A;  2UUC Q;  2F4V L;  4P71 A;  1SYB A;  5FK9 C;  1G6P A;  2BH2 A;  2VXW A;  4UPA A;  2EOT A;  1PFS A;  1P16 A;  1CHP D;  4UP8 A;  4GKK Q;  1HXY D;  4TQU S;  2UUC L;  1XWE A;  2B2T C;  1MKH A;  1SR3 A;  4IFD I;  3NTK A;  1A0I A;  1XXG A;  2WKD A;  3RZD H;  4RHR A;  4GKK L;  1TS4 A;  1VQG A;  4JI6 Q;  5EBD A;  2MP1 A;  1JQY D;  2QA4 A;  1STH A;  2VUM B;  2KHI A;  3LX0 A;  4JI6 L;  5IT9 L;  4IUQ A;  4POF A;  3I4N G;  5IGF A;  4XQQ A;  3K5O A;  1HQM C;  1KLG D;  1QG7 A;  2F03 A;  3Q24 A;  5KEE A;  1IL2 A;  2R7Z H;  4KJN A;  2A8V A;  1PTO B;  1WOC A;  2RDG A;  1M8A A;  1D8L A;  1VQD A;  4QIW B;  2JA6 H;  5JOB A;  2E76 C;  3FKI H;  1UE7 A;  4UP9 A;  3S14 B;  4BBR H;  1CFM A;  1I94 L;  3HOW B;  3J81 i;  3KK7 A;  1LYL A;  4J8Q A;  2CKZ B;  2XRS D;  2R3Z A;  2B8F A;  1RDP D;  4CDD C;  2ALY B;  1H9K A;  1BBU A;  2JA9 A;  1Q7Y C;  3HS0 C;  2WB1 E;  2Z9H A;  2LXJ A;  2PMZ E;  2K5V A;  4CKE A;  4G7H C;  1KC8 C;  2EJM A;  1ROD A;  1KXL A;  4JI3 L;  5KND A;  2IT1 A;  3TRZ A;  2Y0S E;  1PFB A;  1MI2 A;  2F0D A;  4DK3 C;  1IKM A;  5JPN C;  2AQ1 B;  4JPB W;  4AYB E;  1ESF A;  1TY0 A;  1B7Y B;  3S1N B;  1XMO Q;  2PCF B;  2WAQ E;  1RF2 D;  4X66 L;  2KHJ A;  4H02 A;  2J7Z A;  3TZU A;  1GUS A;  4JVZ A;  1PXU A;  2BDN A;  3LNN A;  3TBI B;  1WTP A;  3NWT A;  1S5B D;  4DV6 L;  1WI5 A;  3K7U C;  3MEH A;  3NP8 A;  1ENC A;  2ZXP A;  3DXJ C;  4B3T L;  3P20 A;  3CME A;  1ZKO A;  4BWG B;  4Y52 H;  3H91 A;  1WTR A;  5C6A A;  2F0L A;  1NR4 A;  5IGB A;  4YY3 Q;  5M9O A;  2RCF A;  4GN3 B;  4RA8 A;  3M4Q A;  4H13 C;  5I4D A;  2ES2 A;  4JBM A;  1VQA A;  4QQB X;  1ZEQ X;  3WOE A;  2B63 H;  2PW5 A;  1MBY A;  1W6J A;  1JOR A;  4A3E B;  1IHZ A;  1C7Y A;  1EWC A;  1K8O A;  2HDM A;  5C3W A;  5C4J H;  1E1O A;  3NTH A;  3OHX C;  4K0K Q;  2PI2 A;  4KV6 A;  2OTJ A;  2B8G A;  4Q0F A;  4A3M B;  1IBK Q;  5I2X A;  1B9N A;  4QB4 A;  4A3K H;  3PCO B;  1Y1V G;  3L3O C;  2A19 A;  3PF5 A;  1IBK L;  2IJ0 A;  1B3Q A;  1WJJ A;  2CWA A;  2JA8 G;  4KY6 A;  2ZXR A;  4JW0 A;  3TDQ A;  3FRP B;  1LAB A;  2OT2 A;  4IPH A;  3S1R H;  1SRU A;  2RDH A;  5GQO A;  1E0B A;  5HUR A;  2JYO A;  3RZD B;  3QR8 A;  3UE1 A;  4PMW A;  4J15 A;  2NBF A;  1SDF A;  4YIJ A;  1KRT A;  1PTO F;  3R93 A;  1XTC D;  4ULL A;  4A3L H;  1VQM A;  2E8G A;  3R2T A;  3BDO A;  5DEH A;  1F9R A;  1B70 B;  3C2P A;  2FIN B;  4R4Q A;  1KNA A;  3T1H Q;  1V8Q A;  2DNC A;  4HED A;  4NDX A;  4NXM Q;  1LV9 A;  4FF3 A;  1LTB D;  4ME5 A;  1KLU D;  3TP5 A;  4NXM L;  2GN5 A;  5C3E H;  2ZXO A;  2CW0 D;  2RQX A;  3GP7 A;  1L2F A;  1LTI D;  1SNP A;  4CDE C;  4QUF A;  1RIP A;  3I91 A;  3FP9 A;  3EBE A;  1EEI D;  3GTJ B;  4QJF A;  5I9O A;  3A7L A;  2JA7 G;  4DR5 L;  4ZAI A;  2JA6 B;  2ID0 A;  4A3B H;  1JB7 A;  1VQF A;  2M9V A;  1QUQ A;  5C44 H;  2Q2T A;  5DM6 3;  2VUM G;  5FO8 B;  1NMG A;  1R9T H;  4JBW A;  4CGY B;  4IFD H;  5FJ8 G;  3D3R A;  4KKS A;  4ZKB B;  1KDC A;  2K4K A;  3MEF A;  1VMP A;  2N55 A;  1E22 A;  2F1M A;  2LSS A;  4DR4 Q;  1SN8 A;  5IGE A;  2Z8L A;  1TII D;  2PZU A;  4MZ9 A;  2P5Z X;  4H0L C;  2ZJP A;  1I3Q H;  5ELN A;  3UDX A;  5IYD G;  5IYC G;  3A8J E;  1FR3 A;  3I70 A;  3J81 c;  2KEE A;  1YHQ A;  3U9S A;  4IUV A;  4POG A;  3DMU A;  2XNA C;  3HOW G;  3U4Z A;  1KAW A;  4GOP A;  3STB D;  1JWM D;  4OEM B;  1A6X A;  2V1C C;  1ASY A;  3E3X A;  3MHB A;  4ZLT F;  4LF6 Q;  4NXN Q;  1RKN A;  1GOZ A;  4LAA A;  2I07 B;  4PZ8 A;  4XT3 B;  2OWO A;  1FGB D;  1VQ4 A;  2A1A A;  2HHH L;  1SRO A;  1KDB A;  3OYY A;  2RSO A;  4TSS A;  3K0X A;  5C4Z A;  2RHS B;  3K58 A;  2UUA L;  1U4L A;  2K05 A;  3OIQ A;  5KYL A;  2B63 B;  3EFX D;  3CHB D;  4QMG A;  1BBW A;  1UAP A;  1RTN A;  5C3X A;  1MJC A;  2CHB D;  2F0I A;  3N6R A;  1I4P A;  1PYW D;  2EY2 A;  2MPM A;  4CKB A;  3C1F A;  1MGS A;  5C4J B;  2RCN A;  2J4X A;  1SXT A;  2VB2 X;  1Z47 A;  1N36 L;  3S2H H;  4A3K B;  1D2B A;  3RLF A;  3K59 A;  3GTP H;  2LXK A;  3E0J A;  4JK1 C;  5AFW A;  5JVH 3;  1U4R A;  3DUZ A;  3NE5 B;  3VR4 A;  2E2H H;  4DR7 Q;  1HH2 P;  4PNY A;  5FKA C;  3T13 A;  3KDF A;  3D4D A;  3IKJ A;  1UE6 A;  4DUZ Q;  3S1R B;  4DR7 L;  4FP5 D;  1KNE A;  1X3E A;  2F52 A;  5E1F A;  3UE0 A;  1VMC A;  2FXQ A;  4TVA B;  2HQE A;  1DM0 B;  2QGQ A;  5AJ3 Q;  5C4H A;  1N34 Q;  1EIH A;  2CQA A;  1WCM G;  1STY A;  4J1M A;  1SYF A;  2G9D A;  3T53 B;  1NY4 A;  1QUQ B;  2EYH A;  3GTM H;  3ND8 A;  4RH6 A;  4YCU A;  3BU2 A;  4GNX A;  4GLA C;  2EY1 A;  2ENB A;  2B3G A;  3KLS A;  1EIF A;  4DV2 L;  4U68 A;  3W1G A;  1G2S A;  1A2T A;  4KN7 C;  2F3I A;  3G7L A;  4RG1 A;  5C3E B;  2YYZ A;  4OGQ C;  4QIW E;  5D14 A;  1FNU A;  2ZTD A;  4K5X A;  3J7A V;  1TXY A;  2NTS A;  4Y7N H;  5T1G A;  1K0S A;  4DGZ A;  4JI1 L;  4A93 G;  4FF4 A;  1DCZ A;  4HJ9 A;  1LUZ A;  5C44 B;  2Z6B A;  4C1N K;  4B3R Q;  5KRU A;  1ESR A;  2K5Q A;  2L5T A;  2JEA I;  3STB C;  2NVY H;  4AQY L;  2J0T D;  3NBH B;  5FO9 B;  4HIK A;  4GOP B;  1K73 C;  3DHQ A;  1EQR A;  5CBA E;  4B3M Q;  1QE6 A;  1XPU A;  4YWL A;  3F2U A;  1BCP D;  3HOY G;  4B3M L;  1W3S A;  3VR3 A;  3CKI B;  2R7F A;  1B9M A;  1ZYR C;  1JOO A;  2E75 C;  4HCS A;  1C48 A;  1I3Q B;  4PZ7 A;  5JEA J;  4OWW B;  3HEJ A;  3MXN A;  4BA1 I;  2IHE A;  4AH6 A;  1SBB B;  1SYC A;  4UP7 A;  5HGT A;  2HD3 A;  4FO2 A;  4GN4 B;  4LFA Q;  3FHW A;  3D4R A;  1Y1V H;  5IGD A;  1C8C A;  1I4H A;  2A6E C;  3VA7 A;  4RGT A;  4DAM A;  2CH4 A;  1QB5 D;  3C3L A;  2JA8 H;  4KHZ A;  3IL8 A;  4OEL B;  1FYC A;  3KOJ A;  3GTO B;  2MJ8 A;  3FPU B;  4LFC L;  5BN4 A;  2KCT A;  1U4P A;  3PIP 3;  3RD4 A;  3GTL H;  3AQQ A;  3NK9 A;  5EJW A;  2R7D A;  3VA5 A;  1H9S B;  1K9M C;  2GVB A;  4P2C B;  3E9I A;  1B1Z A;  5FLM G;  2NN6 G;  4EVO A;  3BG3 A;  3KDF B;  1K83 B;  3PIP A;  4OX9 Q;  3BS1 A;  3I4N B;  1BOS A;  1HNW Q;  1PH9 A;  4ILW A;  4DV4 L;  5C0X J;  4LW1 A;  3TS2 A;  4CBV A;  3I4M G;  1PFN A;  1EFW A;  1BR9 A;  5E4X A;  2VY3 A;  2A5H A;  3RLN A;  1OXS C;  4DV3 L;  2EXD A;  4GNX B;  3TP7 A;  3GTP B;  1Y1W G;  1V9P A;  2JA7 H;  4RCN A;  3BYY B;  2E2H B;  3V2T A;  1FNW A;  2E2I H;  3NQT A;  1AP0 A;  2VUM H;  3S16 H;  2B29 A;  2B2V A;  4XIG S;  3KJO A;  1HQR D;  4F88 A;  4RMF A;  4LF4 L;  5FJ8 H;  1S5E D;  1UEA B;  4KHV A;  5EKK A;  1BDO A;  2KED A;  2NN6 I;  4C2M H;  1WD0 A;  4ZUI A;  3KYH C;  1EOT A;  1JWS D;  4HSV A;  3MWY W;  3GTM B;  5M5X H;  3GTG H;  2I5M X;  2IHF A;  4EQN A;  5ELB A;  3J81 L;  3BZC A;  1TVX A;  3AFQ A;  1BCP C;  4OIK A;  5IYC H;  3GTK H;  4IOA A;  4JOI C;  4GLX A;  4H44 C;  1W6K A;  2BE5 D;  4HSP A;  1EY6 A;  3D6C A;  1B53 A;  4KY5 A;  1Q12 A;  3HOW H;  3K80 C;  4FF1 A;  5IWA L;  2MO1 A;  4Y7N B;  1FD7 D;  2MFI A;  2JA5 G;  3VYR A;  1CHQ D;  3U50 C;  2Q2H A;  3MXN B;  3AYH B;  2IL8 A;  1EY8 A;  3AU7 A;  5GAH C;  2PPB C;  2NVY B;  3OWF A;  2NUC A;  1OXV A;  1BCP F;  1WD1 A;  2BDO A;  4JCV E;  2EXZ A;  4HTH A;  3KFU A;  1K3B C;  1IYV A;  1QNK A;  1SNC A;  1E2W A;  2F0N A;  2YTY A;  2EJG C;  3G4S A;  5D3I B;  5FLX E;  1RD9 D;  4OHJ A;  3ZJY C;  1B8A A;  1QVC A;  3O13 A;  5KGU A;  2QEX A;  3PO2 G;  2TSS A;  1BQQ T;  3A8K E;  1I6H B;  3SE0 A;  2OCE A;  4IAL A;  1HR0 Q;  3DEP A;  2PQE A;  4HIO A;  1XNQ Q;  4P73 A;  1LAC A;  2QF7 A;  1SJH D;  3ERQ A;  4DAV A;  4HID A;  1Y1V B;  2UU9 Q;  1ILP A;  1DJR D;  5ELD A;  4HJ8 A;  4DAY A;  1CKM A;  1HNZ Q;  1HPC A;  1VF5 C;  3T1Y Q;  2QDB A;  2XSC A;  1S5D D;  1HNZ L;  4ME3 A;  2X6L A;  4DAP A;  4K2L A;  3TME A;  1SLJ A;  1SE4 A;  3DEO A;  3GTL B;  3TQY A;  2VL6 A;  2BA0 A;  2WKC A;  3EJI A;  1PH7 A;  2F0Q A;  2QW7 A;  3H0G B;  1A2U A;  4DKA C;  1WCM H;  1E3P A;  3CCQ A;  2HT1 A;  3PIO 3;  3G6J B;  1SNQ A;  2I5L X;  3E5S A;  4FXG C;  1Y69 U;  4BBS B;  4JV5 L;  1YEZ A;  4MNO A;  1D5X C;  5JJK A;  1HA6 A;  3KBG A;  1VQH A;  3PIO A;  4PMB A;  3NHH A;  3OTO L;  1HJP A;  4EX5 A;  2A69 D;  1PV4 A;  5IGG A;  4N8F A;  4PV1 C;  3K5M A;  1K28 A;  4A93 H;  1TKW B;  4NW2 A;  4A75 A;  2JA7 B;  1I5F A;  2JQO A;  1OXX K;  1SMX A;  3CCS A;  1O7Z A;  4IOC A;  3IRB A;  4WRD A;  2E2I B;  3GV6 A;  1YI2 A;  4N8X 1;  3S16 B;  1PTO D;  4DK0 A;  5J1Z A;  5C5M A;  1VQO A;  4C3J B;  1CSP A;  1G29 1;  4A3I B;  4IJH A;  2L15 A;  1C9O A;  3C46 A;  1C4Q A;  1TS5 A;  3MAQ A;  4A3G G;  5J3B A;  2HUG A;  5DLQ E;  4MTN A;  3S24 A;  3HOY H;  4C2M B;  4RGN A;  1XX8 A;  5M5X B;  3GTG B;  4I7Z C;  3I4O A;  3NEN A;  3GTJ H;  1F77 A;  2F0V A;  4A3C G;  1DOK A;  1I94 Q;  2PQA B;  4IJL A;  2EZV A;  3GTK B;  4BXX G;  5I6Y A;  3S15 B;  5L37 A;  5IYB G;  1ET9 A;  1K8M A;  3H3V C;  4L5R C;  1JB3 A;  5IP7 G;  2JE6 I;  3V96 A;  1KL9 A;  5NUC A;  1M1K C;  2IX1 A;  4JI3 Q;  2R6G A;  2CVR A;  2NVQ H;  3J81 E;  1MHW C;  4OWX B;  1XPO A;  4LF7 L;  3OMG A;  3NEL A;  4KD4 A;  1PH6 A;  3CU7 A;  3OOC A;  2XRQ D;  2NZO A;  3S9W A;  3BDL A;  4X66 Q;  4R9W A;  1EL0 A;  2RDF A;  5CBE E;  4KI0 A;  1CI3 M;  1Q1B A;  3GO5 A;  3BVM A;  5KNC A;  4DAY B;  3OW2 A;  1YNJ D;  1B50 A;  2NTT A;  5FLM H;  1XTD A;  2NN6 H;  4DU9 A;  2MHV A;  4DV6 Q;  1PRT B;  2C9O A;  1VQL A;  3RN5 A;  4JI7 Q;  1PH5 A;  4B3T Q;  1SE2 A;  2B2Y C;  1D7Q A;  3GTQ H;  3M4Y A;  1NJI C;  1FJG L;  3JAM i;  1NBW A;  2BCO A;  5FLX c;  2K5D A;  4JI7 L;  3HOV B;  4IUT A;  2H1E A;  2ZTC A;  1HTP A;  1VQ6 A;  1EQQ A;  1VCI A;  2Q8I B;  1SFO H;  4CDF C;  1Y1W H;  3CCV A;  3JAM E;  3PMF A;  2WV6 D;  2KQ3 A;  3NPP A;  3AMU A;  1HNX L;  2DY7 A;  4HMJ A;  1E2V A;  4LF8 L;  5JAV A;  2K50 A;  2KOL A;  1BNZ A;  2A69 C;  2SEB D;  3PUX A;  3VR5 A;  1KAB A;  3SXH A;  2QDL A;  2L55 A;  2JXM B;  4HMI A;  4DR1 Q;  1CA5 A;  1YJ9 A;  2VQF L;  1JIC A;  4RCO A;  2MNA A;  1J8I A;  2L0C A;  4A76 A;  4DR1 L;  1L1O A;  2HQL A;  3BVZ A;  2F0G A;  3URY A;  1WCM B;  1VDZ A;  3OIP A;  1PTO C;  4PZ6 A;  1Y14 B;  1IYJ B;  3A5U A;  3PQI A;  4QL5 A;  5DM7 3;  5LHY 1;  4X3U A;  4U67 3;  4IPD A;  3MFY A;  1KIX A;  1A63 A;  1BUV T;  1M4V A;  5M5W H;  3R3O A;  1YBY A;  3E9H A;  3S17 B;  1YVC A;  2N8N A;  4R4C A;  3U4V A;  4A93 B;  3CRL C;  1R4P B;  2JA5 H;  1WTO A;  3S2D H;  2HDL A;  4IO9 A;  3M4O H;  2I46 A;  2IY5 B;  3Q6S A;  5LMN W;  2C5C A;  3H0G G;  2Z6K A;  5EPK A;  4MIU A;  3ND9 A;  3CCR A;  1AE3 A;  3HOZ G;  1TWC H;  1MSG A;  4G57 A;  4C1N I;  4TRD A;  3SEB A;  1CSQ A;  2K52 A;  4RWS C;  4BBS G;  2F0F A;  1JOK A;  3W5O A;  3BVG A;  2OTL A;  3HOY B;  5EPJ A;  1CKO A;  4X62 Q;  3DWA A;  4C3I B;  3DM1 A;  2DY8 A;  1D5M C;  3S1M H;  4KD3 A;  2ZJR A;  1XPR A;  3PO2 H;  4X62 L;  4ZYS A;  3PO3 G;  2B2W C;  1CK1 A;  2JP1 A;  1S5C D;  1YNJ C;  2K01 A;  3FMC A;  5F2D A;  1YJN A;  3I90 A;  1QWY A;  4JC0 A;  5K36 G;  3I2Z A;  2D9U A;  2KJX A;  4C3J G;  1JR0 D;  2KCN A;  1SYG A;  4A3I G;  2Q8T A;  3HKZ B;  1PRT F;  1YHB A;  3J7Z C;  2NVQ B;  2VNU D;  3CCJ A;  1WFQ A;  1X3Q A;  2OXP A;  1JC7 A;  3TP6 A;  3Q22 A;  2I0Q A;  2GVA A;  1SEB D;  2IPK D;  4DPG A;  1DOM A;  2L12 A;  1UNS A;  2CH4 W;  2UXC Q;  3RZO H;  4HJA A;  2Q2U A;  1U0L A;  4EQO A;  1X56 A;  2IWH A;  2NVT H;  2UXC L;  2ICE C;  1BO0 A;  3DM3 A;  3PSI A;  5K5P A;  3CW2 C;  3NBH A;  4IUR A;  1NR2 A;  2IW3 A;  3P1H A;  2B2U A;  3PUZ A;  1KRS A;  3GTQ B;  3I4M B;  3GTO H;  1SSO A;  4C3H G;  1L1O B;  2JK8 A;  2PZW A;  2Z0S A;  2HHH Q;  1G2T A;  5CV7 A;  4RAU C;  5D65 A;  1SFO B;  2L4N A;  1Y1W B;  2PO4 A; 
#chains in the Genus database with same CATH homology
 4XDX A;  4ZK9 B;  2F3W A;  3PV0 A;  3BDC A;  4A3F B;  2R93 B;  5IOD A;  1Q8I A;  3PUW A;  5ELC A;  3VYT A;  2A6H D;  3HG9 A;  1BF4 A;  3M7G A;  2BOS A;  3K6O A;  4BA2 I;  1EQT A;  3NXW A;  5CMD A;  3SDZ A;  1ILQ A;  2MUY A;  1SNM A;  5I2Y A;  1H9S A;  4N9P A;  2EYP A;  1QNU A;  3QWN A;  4G4K A;  4G7Z C;  2CW0 C;  3A8I E;  2NZ1 D;  5M5W B;  1GUO A;  1LT4 D;  3FEW X;  3S2D B;  2JA5 B;  5JVG 3;  3M4O B;  2KUM A;  2A68 D;  1IL8 A;  4IFD J;  2NYZ D;  1TWC B;  2F0E A;  1EQV A;  5A2Q E;  3Q0A A;  3QB3 A;  1IW7 D;  3D31 A;  4R8N A;  2EE1 A;  5JJZ A;  2L1B A;  1EY5 A;  1NSN S;  2PYK A;  4DN4 M;  3QJY A;  3S1M B;  3GQB A;  3PO2 B;  2F3V A;  5FLX L;  1DYQ A;  1II3 A;  1TS2 A;  5COR A;  4FF2 A;  4QUC A;  4RKB A;  4K8J A;  4DK1 A;  1STE A;  2KA7 A;  1AN8 A;  2PNR C;  2XWJ B;  1J9O A;  4HN7 A;  2F0O A;  3K0Y A;  1HFG A;  2DNE A;  4RGO S;  1Y8P B;  1PLF A;  1F9S A;  2F0S A;  4C3I G;  1S4Z A;  3MXG A;  1ICW A;  3J7A F;  1ZXT A;  2K6A A;  3QIA A;  3RZO B;  2XIW A;  1OXT A;  2EYL A;  2WB1 B;  2PMZ B;  1HUN A;  4UDU C;  4B9X A;  2NVT B;  1O78 A;  4HAE A;  2A6H C;  5TSS A;  5KYI A;  1HRJ A;  4AYB B;  1LT6 D;  2FHT A;  1Q3L A;  2WAQ B;  2B2T A;  4KMU C;  4MHE A;  4XTC S;  2AQ3 B;  5KIX A;  4L8J A;  3J80 E;  3OWE B;  2DN8 A;  3FDT A;  1AW7 A;  1WTX A;  1Z6H A;  4QCL A;  1DXM A;  1LTS D;  1CZG A;  3DWQ A;  1YNN D;  2A68 C;  2KCC A;  3MC0 B;  4A3G B;  1SYE A;  2OEO A;  2FMC A;  1HHV A;  1JCK B;  4UAI A;  1U9R A;  4XYQ A;  1HTL D;  3S1Q B;  3R8B A;  5DAU A;  1IW7 C;  1H9R A;  5JPM C;  3D8G A;  1LTT D;  1A3V A;  5K36 H;  2LS0 1;  2EVB A;  4KN4 C;  2L9H A;  2QIL A;  2M2L A;  1EZ6 A;  3A56 A;  3HP3 A;  1WVL A;  1LT3 D;  4WFN 3;  1F2Y A;  3I3C A;  4V0B A;  1ENA A;  2QCP X;  3M7N A;  4IUN A;  1O7Y A;  3I4L A;  2AWO A;  3NQI A;  3NWS A;  4KJO A;  3A54 A;  4X3T A;  2EY6 A;  3OMC A;  1MSH A;  4XT1 B;  1D1I A;  5CV5 A;  4X3S A;  4KKU A;  2D2C C;  3M3Y B;  3CRK C;  2IX0 A;  2EYO A;  1H9J A;  1F2Z A;  2G9H D;  2WIN B;  1DD2 A;  3SHL A;  1EZ8 A;  1EU3 A;  3L9A X;  2F0P A;  2NVX B;  2PW7 A;  1Z7T A;  5CV8 A;  3D6W A;  3QOL A;  5I9P A;  3JAM L;  2JEB I;  1TWF B;  1JOQ A;  1GHJ A;  1Q1E A;  5CV9 A;  1STN A;  2L11 A;  4KKT A;  5ELF A;  4LMQ D;  4CHT B;  3J7Y W;  1TU2 B;  4ZRZ A;  4WOR A;  2D62 A;  1PZK D;  3L7Z C;  1YNN C;  3IAY A;  2RBM A;  5A35 A;  1L0Y B;  1D1K A;  3P75 A;  3FVQ A;  4ZKC B;  2RVL A;  2EY5 A;  4ODG A;  3LWU A;  1UUP A;  2X69 A;  1I50 B;  1A15 A;  2F0T A;  1B3A A;  3X3M A;  1GUG A;  1KAA A;  3HOZ B;  3KLS X;  2F0K A;  4IZ8 A;  3HRZ C;  5FO7 B;  3GD7 A;  1EY9 A;  1I4R A;  3HGB A;  3TZD A;  1CTM A;  3TP8 A;  1T5X D;  5CGK A;  1F2L A;  5EKI A;  3T16 A;  2FJ2 A;  3I8Z A;  5CR3 A;  4FXK C;  3OW7 A;  4TKO B;  3P7J A;  5LL6 S;  3PO3 B;  1TWH B;  3W3A A;  3C1E A;  2BE5 C;  1RCV D;  3K5N A;  4BY1 B;  4EQP A;  2B39 A;  4CJ2 C;  4F8M A;  4F7X A;  3MVV A;  2RA4 A;  1QCB D;  1SND A;  3H94 A;  2K28 A;  1ONL A;  1QIL A;  2Z4I A;  2QEJ C;  1KDA A;  4A3J B;  3A55 A;  5JEA G;  4DXG A;  1ET6 A;  2F0U A;  1G8Z D;  1EIG A;  4NKL A;  4B9W A;  2SDF A;  2EDG A;  1S5F D;  1F9Q A;  4HR7 B;  1OO9 B;  4M8A A;  1TS3 A;  1ML0 D;  4E6I A;  3MFG A;  2WAC A;  3M85 A;  1A3U A;  4CKC A;  4C3H B;  3CQZ B;  4MN3 A;  1PRT D;  2RKS A;  5CV4 A;  4WJW A;  2XN9 C;  1MD2 D;  4K5W A;  3MTS A;  2B2V C;  2KHS A;  3T4A C;  4FYD A;  4IQZ A;  5C0X G;  1I4Q A;  5J22 A;  4DA2 A;  3SK4 A;  4IUP A;  5E4W C;  1TWA B;  1X32 A;  1JWU D;  4I65 A;  1T5E A;  2K32 A;  4G7O C;  5CV6 A;  4X3K A;  3ONA B;  4ID6 A;  4DFA A;  1D6E C;  3WOF A;  2M00 A;  1SNO A;  1U4M A;  1RJT A;  5G3L D;  1V1P B;  1OXU A;  1H9M A;  4FXD A;  3W2D A;  4O42 A;  1STA A;  5C5L A;  3SK6 A;  3SK8 A;  4B08 A;  1HCZ A;  3NBI A;  1CM9 A;  4NMZ A;  5C0X I;  4K6L A;  2X6G A;  1NCV A;  1LLR D;  4NP5 A;  3SR1 A;  3NTI A;  3AB9 A;  5A2Q L;  3U9O A;  1CA6 A;  1B2T A;  2LFN A;  4KTA A;  4K6D A;  3UI2 A;  4K2K A;  2FFK B;  1STG A;  5BN5 A;  3I73 A;  1TR5 A;  3MA2 B;  1SE3 A;  1PMR A;  5EQ0 A;  3VYS A;  4DNT B;  1PZI D;  1CZW A;  4HCE A;  1EEF D;  1HUM A;  1LTR D;  1AEX A;  1X3P A;  4RHS A;  2V4D A;  2H4O A;  2Z4H A;  3K5L A;  1PDQ A;  1PRT C;  3OPO A;  1IYU A;  5DNF A;  4KY7 A;  1Y8N B;  3EVQ A;  3OSO A;  3QOJ A;  5CC4 A;  1A3T A;  4L6T B;  4QF4 A;  4DF7 A;  3H09 A;  5EKL A;  2R7Z B;  4A3D B;  3PUV A;  5E3F A;  3EQL C;  3T51 B;  1FNV A;  2MGS A;  2A74 C;  5IT9 E;  3FKI B;  4BY7 B;  4BBR B;  4EGV A;  1RTO A;  4R8I A;  5D3D A;  3PUY A;  2LKV A;  1AZP A;  2WII B;  2PZT A;  2E2D C;  1G6Z A;  2EYM A;  3J80 L;  2LY7 A;  1SJE D;  1HFN A;  1O7L A;  4F87 A;  3RMH A;  2NB0 A;  4L63 B;  2YU9 B;  2LMC B;  3RUZ A;  4OO1 G;  1DON A;  1E2Z A;  5ISR A;  1DZ1 A;  1PZJ D;  1I4G A;  2WP8 J;  3HZX A;  5C4X B;  5G3L F;  4S3S A;  3ZYY X;  5IGC A;  1EY7 A;  3TN2 A;  4ZUJ A;  2K03 A;  3SVM A;  1V1O A;  3ITP A;  5EBC A;  3MXU A;  1O80 A;  3VR2 A;  2NWG A;  1ZYR D;  1PFM A;  1B44 D;  5JEA H;  5M3F B;  5EGT A;  4OO1 I;  2A6E D;  2EPB A;  1LTG D;  2TMP A;  1AZQ A;  4PQX A;  3QG1 A;  2VB3 X;  3Q23 A;  1TY2 A;  2OF1 A;  1B4O A;  4XYO A;  3NSW A;  1LO5 D;  2RSN A;  1CT1 D;  3FPP A;  1GUT A;  3TSS A;  3H6M A;  3KUP A;  2F0J A;  1G91 A;  2K7V A;  2GA4 B;  1CQV A;  2K5W A;  5LL6 X;  3V05 A;  2K33 A;  3EA6 A;  3MZ5 A;  5C0X H;  3GV3 A;  3BYT B;  4XQN A;  2O4X A;  4PMC A;  2K04 A;  2EYJ A;  2F0H A;  2R61 A;  4OL7 A;  2E2J B;  2O2L D;  5J39 A;  2ICI A;  1KTK A;  2R92 B;  1EY0 A;  1EYC A;  5BN3 A;  4J6H A;  2HCI A;  4A3B B;  4Q5V A;  1GHK A;  4CJ1 B;  4KK7 A;  2Q8R E;  1HA5 A;  1R9T B;  4ZQ3 A;  1Y8O B;  4LJZ C;  3A7A B;  2Y0S B;  5M5Y B;  3DWP A;  3IFD A;  3LWE A;  2AQ2 B;  3E6Z X;  3NUC A;  2A73 B;  1BCP B;  5I6W A;  5FOB B;  2SNS A;  3HOX B;  1QJO A;  1VF7 A;  2EJF C;  1BBX C;  2XVS A;  3KF8 A;  4FVM A;  1XYI A;  4FNF A;  4M1U B;  2AUJ D;  5IOC A;  3D4W A;  4H7B A;  3VYU A;  3R2I A;  3HOU B;  4OIJ A;  1Q90 A;  3QO2 A;  3KBX A;  3IFT A;  1EWH A;  2O5J C;  4IN3 A;  2B2U C;  4LK1 C;  3VR6 A;  1AFP A;  3S2H B;  4V19 0;  3T56 B;  1WTW A;  1NAP A;  4CJ0 B;  1GXD C;  1EYA A;  2JSO A;  3N52 A;  1SMY D;  1TT2 A;  2F4I A;  3WDN A;  1GUW A;  2B2Y A;  3MXP A;  2XWB B;  4IUU A;  2KEC A;  1V43 A;  1TQO A;  1PTO H;  1QOH A;  4OO1 H;  1EY4 A;  3K7A B;  4DNR B;  1NUC A;  5KNB A;  1CQF A;  2O5I C;  4K5V A;  5EPL A;  1D5Z C;  1F2M A;  2EYF A;  3KLR A;  2N88 A;  1BXT A;  1F9P A;  1I6V C;  1STB A;  5T1I A;  5M3M B;  1I4X A;  5IIF A;  4XQJ A;  4XXE A;  4DXF A;  1EFI D;  2AUK A;  3ERO A;  1WTV A;  2AWN A;  1L0X B;  3BZD B;  5COY A;  1R4Q B;  3I72 A;  4K8I A;  2F0W A;  1SAP A;  1SYD A;  1WTQ A;  2E74 C;  3X3N A;  4BS9 A;  1ENF A;  1EU4 A;  5CYU A;  1EYD A;  1DOL A;  4Z9C B;  3SK5 A;  4IFD G;  2SOB A;  2JA8 B;  1GJX A;  1RHP A;  1IKL A;  2IX3 A;  2QKI C;  4RGM A;  1LTA D;  2ZT9 C;  4O1N A;  4RKL A;  2F0M A;  1TWG B;  2D5D A;  2KVM A;  2SNM A;  2Z1C A;  4GZY C;  1V1P A;  1SMY C;  2B2W A;  2HCC A;  1LT5 D;  4RFB A;  5ELE A;  4ABN A;  2FMM A;  4K14 A;  1JE4 A;  4C56 C;  4N9T A;  3K57 A;  2BA1 A;  2K1B A;  1GUN A;  5FK9 C;  1SYB A;  2VXW A;  2EOT A;  1CHP D;  1HXY D;  4TQU S;  1XWE A;  2B2T C;  4IFD I;  3NTK A;  1XXG A;  2WKD A;  4RHR A;  1TS4 A;  5EBD A;  2MP1 A;  1JQY D;  1STH A;  2VUM B;  3LX0 A;  5IT9 L;  4IUQ A;  5IGF A;  4XQQ A;  3K5O A;  1HQM C;  1KLG D;  1QG7 A;  2F03 A;  3Q24 A;  5KEE A;  4KJN A;  1PTO B;  2RDG A;  1M8A A;  4QIW B;  5JOB A;  2E76 C;  3S14 B;  1CFM A;  3HOW B;  3KK7 A;  4J8Q A;  2XRS D;  2R3Z A;  2B8F A;  1RDP D;  1H9K A;  3HS0 C;  4CKE A;  4G7H C;  2EJM A;  1ROD A;  5KND A;  2IT1 A;  1PFB A;  1MI2 A;  2F0D A;  1IKM A;  5JPN C;  2AQ1 B;  1ESF A;  1TY0 A;  3S1N B;  2PCF B;  1RF2 D;  2J7Z A;  3TZU A;  1GUS A;  1PXU A;  2BDN A;  3LNN A;  3TBI B;  1WTP A;  3NWT A;  1S5B D;  3MEH A;  3NP8 A;  1ENC A;  2ZXP A;  3DXJ C;  3P20 A;  1ZKO A;  4BWG B;  3H91 A;  1WTR A;  5C6A A;  2F0L A;  1NR4 A;  5IGB A;  5M9O A;  4RA8 A;  4H13 C;  5I4D A;  1ZEQ X;  3WOE A;  2PW5 A;  1MBY A;  1W6J A;  1JOR A;  4A3E B;  1IHZ A;  1EWC A;  1K8O A;  2HDM A;  5C3W A;  3NTH A;  3OHX C;  4KV6 A;  2B8G A;  4Q0F A;  4A3M B;  5I2X A;  1B9N A;  4QB4 A;  3L3O C;  2IJ0 A;  4KY6 A;  2ZXR A;  3TDQ A;  3FRP B;  1LAB A;  2OT2 A;  2RDH A;  1E0B A;  5HUR A;  2JYO A;  3RZD B;  4PMW A;  2NBF A;  1SDF A;  4YIJ A;  1PTO F;  3R93 A;  1XTC D;  4ULL A;  3R2T A;  3BDO A;  5DEH A;  1F9R A;  3C2P A;  2FIN B;  1KNA A;  1V8Q A;  2DNC A;  4HED A;  4NDX A;  1LV9 A;  4FF3 A;  1LTB D;  4ME5 A;  1KLU D;  3TP5 A;  2ZXO A;  2CW0 D;  2RQX A;  3GP7 A;  1SNP A;  1LTI D;  4QUF A;  3I91 A;  1EEI D;  3GTJ B;  5I9O A;  3A7L A;  4ZAI A;  2JA6 B;  2ID0 A;  2M9V A;  5DM6 3;  5FO8 B;  4JBW A;  4CGY B;  4IFD H;  3D3R A;  4KKS A;  4ZKB B;  1KDC A;  1VMP A;  2N55 A;  2F1M A;  5IGE A;  2Z8L A;  1TII D;  2PZU A;  4H0L C;  3A8J E;  1FR3 A;  3I70 A;  2KEE A;  3U9S A;  4IUV A;  3DMU A;  2XNA C;  1JWM D;  1A6X A;  3MHB A;  4ZLT F;  1RKN A;  1GOZ A;  4LAA A;  2I07 B;  4XT3 B;  1FGB D;  1KDB A;  2RSO A;  4TSS A;  5C4Z A;  3K58 A;  1U4L A;  2K05 A;  3OIQ A;  5KYL A;  2B63 B;  3EFX D;  3CHB D;  4QMG A;  1UAP A;  1RTN A;  5C3X A;  2CHB D;  2F0I A;  3N6R A;  1I4P A;  1PYW D;  2EY2 A;  2MPM A;  4CKB A;  3C1F A;  1MGS A;  5C4J B;  2J4X A;  1SXT A;  2VB2 X;  1Z47 A;  4A3K B;  1D2B A;  3RLF A;  3K59 A;  3E0J A;  4JK1 C;  5AFW A;  5JVH 3;  1U4R A;  3DUZ A;  3NE5 B;  3VR4 A;  4PNY A;  5FKA C;  3T13 A;  3D4D A;  3IKJ A;  3S1R B;  4FP5 D;  1KNE A;  5E1F A;  1VMC A;  2HQE A;  1DM0 B;  5C4H A;  1EIH A;  2CQA A;  1STY A;  4J1M A;  1SYF A;  2G9D A;  3T53 B;  2EYH A;  3ND8 A;  4RH6 A;  2EY1 A;  2ENB A;  3KLS A;  4U68 A;  1G2S A;  1A2T A;  4KN7 C;  5C3E B;  3G7L A;  2YYZ A;  4OGQ C;  5D14 A;  1FNU A;  4K5X A;  3J7A V;  2NTS A;  5T1G A;  4DGZ A;  4FF4 A;  1DCZ A;  5C44 B;  4C1N K;  5KRU A;  1ESR A;  2K5Q A;  2L5T A;  2JEA I;  2J0T D;  5FO9 B;  3DHQ A;  5CBA E;  1QE6 A;  3F2U A;  1BCP D;  3VR3 A;  3CKI B;  1B9M A;  1ZYR C;  1JOO A;  2E75 C;  4HCS A;  1C48 A;  1I3Q B;  5JEA J;  3HEJ A;  3MXN A;  4BA1 I;  5HGT A;  1SBB B;  1SYC A;  4FO2 A;  3D4R A;  5IGD A;  1C8C A;  1I4H A;  2A6E C;  3VA7 A;  4RGT A;  1QB5 D;  3C3L A;  4KHZ A;  3IL8 A;  1FYC A;  3GTO B;  2MJ8 A;  3FPU B;  5BN4 A;  1U4P A;  3PIP 3;  3RD4 A;  3NK9 A;  5EJW A;  3VA5 A;  1H9S B;  4P2C B;  1B1Z A;  2NN6 G;  4EVO A;  3BG3 A;  1K83 B;  3BS1 A;  3I4N B;  1BOS A;  4ILW A;  5C0X J;  4CBV A;  1PFN A;  1BR9 A;  5E4X A;  2A5H A;  1OXS C;  3TP7 A;  3GTP B;  4RCN A;  3BYY B;  2E2H B;  3V2T A;  1FNW A;  3NQT A;  1AP0 A;  2B2V A;  4XIG S;  1HQR D;  4F88 A;  1S5E D;  1UEA B;  4KHV A;  5EKK A;  1BDO A;  2KED A;  2NN6 I;  1WD0 A;  4ZUI A;  1EOT A;  1JWS D;  4HSV A;  3MWY W;  3GTM B;  4EQN A;  5ELB A;  3J81 L;  1TVX A;  1BCP C;  4OIK A;  4H44 C;  1W6K A;  2BE5 D;  4HSP A;  1EY6 A;  3D6C A;  1B53 A;  4KY5 A;  1Q12 A;  4FF1 A;  4Y7N B;  1FD7 D;  3VYR A;  1CHQ D;  2IL8 A;  1EY8 A;  3AU7 A;  2PPB C;  2NVY B;  3OWF A;  2NUC A;  1OXV A;  1BCP F;  1WD1 A;  2BDO A;  2EXZ A;  4HTH A;  1IYV A;  1QNK A;  1SNC A;  1E2W A;  2F0N A;  2EJG C;  5D3I B;  5FLX E;  1RD9 D;  4OHJ A;  3O13 A;  5KGU A;  2TSS A;  1BQQ T;  3A8K E;  1I6H B;  3SE0 A;  4IAL A;  3DEP A;  2PQE A;  1LAC A;  2QF7 A;  1SJH D;  3ERQ A;  4DAV A;  1Y1V B;  1ILP A;  1DJR D;  5ELD A;  4DAY A;  1HPC A;  1VF5 C;  2QDB A;  2XSC A;  1S5D D;  2X6L A;  4DAP A;  4K2L A;  3TME A;  3DEO A;  1SE4 A;  3GTL B;  2BA0 A;  2WKC A;  3EJI A;  2F0Q A;  3H0G B;  1A2U A;  3PIO 3;  3G6J B;  1SNQ A;  3E5S A;  4FXG C;  1Y69 U;  4BBS B;  1D5X C;  1HA6 A;  3KBG A;  4PMB A;  3NHH A;  2A69 D;  5IGG A;  4PV1 C;  3K5M A;  1TKW B;  4NW2 A;  2JA7 B;  1OXX K;  1O7Z A;  2E2I B;  4WRD A;  3GV6 A;  3S16 B;  1PTO D;  4DK0 A;  5J1Z A;  5C5M A;  4C3J B;  1G29 1;  4A3I B;  3C46 A;  1C4Q A;  1TS5 A;  3MAQ A;  2HUG A;  4C2M B;  4RGN A;  1XX8 A;  5M5X B;  3GTG B;  4I7Z C;  1F77 A;  2F0V A;  1DOK A;  2EZV A;  3GTK B;  5I6Y A;  3S15 B;  1ET9 A;  1K8M A;  3H3V C;  1JB3 A;  2JE6 I;  3V96 A;  2IX1 A;  5NUC A;  2R6G A;  2CVR A;  3J81 E;  3OMG A;  4KD4 A;  3CU7 A;  3OOC A;  2XRQ D;  3S9W A;  3BDL A;  4R9W A;  1EL0 A;  2RDF A;  5CBE E;  4KI0 A;  1CI3 M;  1Q1B A;  3GO5 A;  3BVM A;  5KNC A;  1YNJ D;  1B50 A;  2NTT A;  2NN6 H;  4DU9 A;  2MHV A;  1PRT B;  2C9O A;  1SE2 A;  2B2Y C;  3M4Y A;  2BCO A;  2K5D A;  3HOV B;  4IUT A;  2H1E A;  1HTP A;  1VCI A;  2Q8I B;  3JAM E;  3PMF A;  2WV6 D;  2KQ3 A;  3NPP A;  3AMU A;  2DY7 A;  4HMJ A;  1E2V A;  5JAV A;  2KOL A;  1BNZ A;  2A69 C;  2SEB D;  3PUX A;  3VR5 A;  1KAB A;  3SXH A;  2L55 A;  2JXM B;  4HMI A;  1CA5 A;  1JIC A;  4RCO A;  1J8I A;  2L0C A;  3BVZ A;  2F0G A;  3URY A;  1WCM B;  1VDZ A;  3OIP A;  1PTO C;  5DM7 3;  5LHY 1;  4X3U A;  4U67 3;  3MFY A;  1BUV T;  1M4V A;  3R3O A;  3S17 B;  4A93 B;  3CRL C;  1R4P B;  1WTO A;  2HDL A;  2I46 A;  3Q6S A;  2C5C A;  5EPK A;  4MIU A;  3ND9 A;  1MSG A;  4G57 A;  4C1N I;  4TRD A;  3SEB A;  4RWS C;  2F0F A;  1JOK A;  3BVG A;  3HOY B;  5EPJ A;  3DWA A;  4C3I B;  3DM1 A;  2DY8 A;  1D5M C;  4KD3 A;  4ZYS A;  2B2W C;  1CK1 A;  2JP1 A;  1S5C D;  1YNJ C;  2K01 A;  3FMC A;  5F2D A;  3I90 A;  1QWY A;  5K36 G;  2D9U A;  2KJX A;  4C3J G;  1JR0 D;  2KCN A;  1SYG A;  2Q8T A;  3HKZ B;  1PRT F;  2NVQ B;  2VNU D;  1X3Q A;  2OXP A;  1JC7 A;  3TP6 A;  3Q22 A;  1SEB D;  2IPK D;  1DOM A;  2L12 A;  1UNS A;  4EQO A;  2IWH A;  2ICE C;  1BO0 A;  5K5P A;  3NBH A;  4IUR A;  1NR2 A;  2IW3 A;  3P1H A;  2B2U A;  3PUZ A;  3GTQ B;  3I4M B;  1SSO A;  4C3H G;  2PZW A;  1G2T A;  5CV7 A;  4RAU C;  5D65 A;  1SFO B;  2L4N A;  1Y1W B;  2PO4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...