3A8IE

Crystal structure of et-ehred-5-ch3-thf complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
128
structure length
127
Chain Sequence
SNVPAELKYSKEHEWLRKEADGTYTVGITEHAQELLGDMVFVDLPEVGATVSAGDDCAVAESVAASDIYAPVSGEIVAVNDALSDSPELVNSEPYAGGWIFKIKASDESELESLLDATAYEALLEDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aminomethyltransferase
publication title Crystal structure of aminomethyltransferase in complex with dihydrolipoyl-H-protein of the glycine cleavage system: implications for recognition of lipoyl protein substrate, disease-related mutations, and reaction mechanism
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/transport protein
total genus 29
structure length 127
sequence length 128
chains with identical sequence F
ec nomenclature
pdb deposition date 2009-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01597 GCV_H Glycine cleavage H-protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3a8iE00
1VF7A 4OGQC 3TZUA 3P20A 4DK0A 4DNRB 3A7LA 4JK1C 3VA7A 4G7HC 4IQZA 1HTPA 2O5JC 1H9MA 1CI3M 2D62A 2AWOA 1EWHA 1OXVA 3QIAA 4IFDH 4TQUS 2F1MA 4KKSA 2CW0C 3VR3A 4XTCS 1GHKA 1LABA 3SDZA 1FR3A 1OXUA 1Q1EA 3CRKC 3CRLC 3IKJA 3ND8A 5BN5A 2JXMB 1Y69U 3AB9A 4TKOB 2JE6I 3HGBA 1IW7D 2E76C 4KHZA 2EJMA 2R6GA 2K33A 3I73A 1H9RA 4KN7C 5BN3A 1CFMA 1DD2A 4PV1C 3PV0A 5KNDA 3KLRA 3GD7A 1H9JA 4IFDG 3FMCA 3L7ZC 1VF5C 1ONLA 3W3AA 1Q1BA 2L5TA 1Z6HA 4OO1G 1Q12A 4H13C 2QF7A 1Q90A 3QJYA 1GUNA 3T56B 2LMCB 4KMUC 5KNBA 1E2ZA 3D31A 4H44C 2A6HC 1VCIA 4GZYC 1H9KA 3T51B 1YNNC 4BA1I 3VR2A 2PPBC 3I72A 1K8MA 5C0XG 1CTMA 3U9SA 5JEAH 1H9SA 1Z7TA 1E2VA 1FYCA 2B8FA 3M4YA 4DK1A 2Q8IB 3FPPA 2D5DA 1GUGA 3DXJC 1V8QA 1IYVA 2JEBI 1DCZA 3A8KE 1QJOA 1V43A 3A8IE 5A35A 5BN4A 3I4LA 1SMYC 2KCCA 3A7AB 1GUTA 5K36H 2NN6I 2E74C 3PUVA 1GUOA 1G291 1PMRA 3OW7A 2DNEA 1A6XA 1IYUA 1H9SB 2NN6H 2O5IC 3A8JE 3LNNA 3NE5B 3OPOA 2A69C 3D4RA 4RCNA 4DNTB 4XIGS 3PUWA 3MXUA 2JEAI 1DXMA 3ND9A 2PNRC 2V4DA 1GUSA 1B9MA 2BE5C 2A69D 2ZT9C 1HQMC 2A68C 4I7ZC 2BDOA 2A6HD 2K32A 4LK1C 4G7ZC 4HR7B 3VR5A 5KNCA 2EVBA 2NN6G 4L8JA 4KKUA 3RLFA 1Y8NB 4KKTA 1LACA 2AUKA 3BDOA 2K7VA 3IFTA 2YYZA 1TU2B 3LWUA 3SE0A 3VR4A 2A6EC 3WDNA 3T53B 1O7LA 4JBWA 3M7NA 1B9NA 3H94A 3N6RA 1ZYRC 2D2CC 1ZKOA 1E2WA 1I6VC 3PUYA 2B8GA 1Y8OB 2BA1A 3OOCA 2A6ED 4H0LC 3M85A 4BA2I 4LJZC 3BG3A 2KA7A 4G7OC 1Y8PB 1IW7C 1O78A 3PUZA 3VR6A 1GHJA 1VDZA 4OO1H 1TKWB 2E75C 4KN4C 3MFYA 2IT1A 1YNJC 3PUXA 1T5EA 2DNCA 5K36G 5JEAG 2EJGC 3EQLC 2EJFC 1OXSC 2BA0A 1K8OA 3GQBA 2DN8A 2BE5D 1HPCA 1OXTA 2A68D 1HCZA 3QG1A 4KI0A 1BDOA 5C0XH 1OXXK 2AUJD 1GJXA 2PCFB 2EDGA
chains in the Genus database with same CATH superfamily
2K5QA 1CUKA 3UI2A 3TZUA 4PQXA 2CFMA 1HTLD 3D8GA 3GTKB 3A7LA 5BR8Q 4IFDI 4OONA 2BCOA 3J7ZC 3HOWG 2H1EA 5AFWA 4KD3A 1Q46A 2RQXA 4GN3B 5CV7A 4A3MB 2JA8H 2I0QA 2XVSA 3NBHB 4R4QA 2IL8A 1HNZQ 1N32Q 2E2IB 2B63G 2EJMA 1DD2A 3VA5A 3CCMA 5EQ0A 2ZXOA 1A15A 2PI2E 1MIUA 2Q8RE 3RZDH 1ASZA 4OO1G 4K5WA 4IOCA 2EY2A 1NNXA 2HCIA 4LF7Q 3S17H 1GO3E 1EQQA 2IW3A 5HURA 3FRPB 2K5VA 4C56C 4BA1I 2EIFA 1K8MA 1BR9A 1PTOH 4LF8L 2PYKA 2JA7B 3PF4A 2EZVA 1K8GA 1UEBA 1VQBA 3STBD 1IHZA 1Y1VH 3X3MA 5A35A 4K5XA 2F0PA 1F9RA 5H1SE 1B7YB 2KCCA 2NN6I 2ICEC 1JOQA 2DGYA 1U9RA 4HIKA 1OO9B 3KYHC 4O1NA 4ID6A 4KLKA 3CPFA 2QEJC 4JC0A 4Q0FA 4YIJA 2KCNA 2QA4A 4DUYQ 4FXGC 2N49A 1PHJA 2MO1A 1PYSB 1GUWA 4FP5D 4IALA 2UUAQ 3GTJB 3T53B 4JBWA 1PH5A 2UXCL 2F52A 5CMDA 1ZYRC 2EYHA 1XYIA 5IGDA 4KD4A 1I50B 2CVRA 2N3SA 1S5CD 3KDFA 3O13A 2R92G 1PH8A 1ZYRD 1O78A 4C3JB 1IBKQ 1QWYA 1U4MA 4LF7L 3K57A 2OCEA 3R2IA 5D3DA 2VNUD 1JT8A 3JAMc 1HR0L 2IY5B 3M3YH 3HOZG 3Q0AA 1O7IA 2UXBL 4LFBQ 3S1MB 1N36Q 1K3RA 3NBHA 1VQOA 2N8NA 3NXWA 4A3FG 2Z4HA 4ZAIA 1QCBD 1NR2A 1WTHA 3NSWA 3GP7A 3OWEB 3R3OA 4BBSG 2QILA 4JI2L 3VR3A 4A3JH 1HUNA 3CRLC 2XSCA 4TKOB 3Q24A 4GZYC 3JC66 1CZGA 2F0MA 5BN3A 3I4NG 4JI3Q 3LGJA 3FHWA 3T1HL 3PO3H 1UWVA 4KY7A 3CQZH 2EE1A 3HFZB 1L2FA 1FGUA 1ET6A 2UUAL 3K58A 4H44C 3S2HB 3E6ZX 1BKBA 2KCTA 2K05A 3EA6A 4KHVA 1ASYA 1VQGA 3MXPA 1VQJA 2F0LA 1FYCA 4MTNA 2X69A 1WOCA 1IBKL 4IN3A 4DV1Q 5M3FB 3A8IE 1XPUA 1PRTD 4A4IA 3A7AB 2JYOA 1RCVD 2K28A 3NEMA 3GO5A 2XGTA 5G3LD 4LFBL 1D8LA 1GD7A 5IIFA 4BY1H 1H9SB 3HOVH 5CV8A 4X66L 1N36L 4QJFA 2H5XA 3G48A 4K6DA 3C3LA 2JEAI 3CC7A 1SMXA 1XX8A 1VQEA 1XNQQ 1CM9A 1E24A 1S5DD 4L5QA 2I5LX 1HQMC 3W1GA 1JJ2A 1YJNA 1X54A 4PMBA 1IYJB 2IHFA 4KKTA 1AP0A 3IFTA 1ENAA 4NXNQ 1D2BA 3QO2A 5M5WH 5HY6A 2JA8B 3N6RA 1PH1A 4JI3L 4Y52H 1ZKOA 1Y8OB 3ERQA 2YTYA 4R9WA 3NQTA 4G7OC 1IW7C 4CJ0B 1G8ZD 2F0WA 1TKWB 1I3QH 2IT1A 3KK7A 4LF4Q 2I07B 1K0RA 1D5MC 1KIXA 4AYBG 3I8ZA 4GLVB 2CH4A 2UUCQ 1OTCA 3J7A5 3S17B 2A68D 5GAGC 2WFWA 2ZJPA 5DNFA 5CBEE 1PTOB 3G71A 1BOSA 4AIMA 2B39A 4RGOS 3CCJA 4PZ8A 1H9MA 1CI3M 5DLQE 4YWMA 3J80i 3MEFA 3HOUB 4RH6A 4R8IA 4RGNA 1ET9A 3P1HA 3GTQH 1Y1VB 1HA6A 1OXUA 3CRKC 1I94L 5IYBG 3AB9A 4GS3A 2JE6I 3HGBA 4O2DA 2NB0A 2DUDA 2ZXPA 4DR7Q 4GLAC 1XNQL 2R7FA 3FMCA 3J80E 1EOTA 4Z9CB 1EIYB 2VQFQ 3PIPA 3ERSX 4R4IA 3F2BA 1D7QA 2KHIA 4X3SA 4NXNL 1RJTA 4J15A 1VCIA 1DYQA 1YVCA 4GNXA 1B44D 1YNNC 2NWGA 3VR2A 3NP8A 3D6CA 1IL2A 1FJGQ 1H9SA 5L37A 1CHQD 4JCVE 1N34L 4DR3Q 4XXEA 3S1QB 1VS0A 1EQTA 4EX5A 4OEMB 4ZKCB 1DCZA 4LF4L 4JPBW 1EQRA 1QUQA 2F3WA 3GV6A 3W2DA 4DXGA 4PZ6A 2UUCL 1SYBA 3PUVA 1M90C 1RIPA 3L2PA 3FEWX 4FF4A 4IZ8A 3M3YB 3A8JE 1EIFA 1TWGH 1PLFA 3F2CA 1XMQQ 3PO2H 3RN2A 1SE8A 1STEA 2WAQE 2PNRC 2GN5A 1RTOA 2OT2A 4R4OA 5IT9c 3KF6B 3CP0A 1KNAA 4EGVA 1XPOA 1EY0A 5FLXE 1Y8NB 2KBNA 3S16B 3P7JA 2NZOA 4A3JB 2QDLA 2JA6H 4DR7L 4RKLA 4A3KB 3QR8A 2QKIC 3CC2A 2NVQH 5E3FA 3M4OH 4BA2I 4QF4A 1EWIA 4WJWA 3RLOA 2RF4A 2VQFL 2A19A 2PO4A 1TT2A 4ZYSA 4CDEC 2D0PA 2LS01 3EROA 4GNXC 3PUZA 3PO3B 3TP7A 2X6GA 3T13A 1K28A 1J8IA 4RA8A 1TVXA 1RD9D 4POGA 3GDEA 1LTID 4I7AA 1U5KA 4A3EG 1SNMA 2DN8A 1C0AA 1FJGL 4AYBE 2OXPA 1GJXA 4F87A 1K73C 5FLMH 1D6EC 1ZXTA 2JA5H 4APVA 1DZ1A 4C3IG 4B3SQ 3F8TA 2Z6KA 3VA7A 4G7HC 3RR5A 1Q82C 3J7AV 4JI1Q 5JJZA 3QIAA 1X9NA 4HJAA 4K0KQ 4RWSC 4Q5VA 1L0YB 2K5DA 2L11A 1MKHA 1Y1WH 2Z8LA 1XMQL 1SEBD 5A2QE 4QUFA 1YJ9A 4BY1B 3HOVB 5CV9A 3AU7A 2MPMA 5DEHA 4DKAC 1F9SA 4ZQ3A 4PG3A 4DF7A 1H95A 2QF7A 2LMCB 3R93A 5CBAE 1FNVA 2K52A 1TR5A 1G6PA 3TP8A 2XRQD 1PTOC 4MZ9A 4IPDA 3I4MG 3DHQA 4CHTB 5C0XG 2XN9C 1KAWA 5M5WB 3S2DB 1UEAB 2B8FA 1WCMG 1PTOD 5JOBA 2IX0A 3FPPA 3DXJC 4N9TA 1EZ6A 3BYTB 2J0TD 3JAMi 1RDPD 2G5DA 2Z6KC 1I3QB 4P73A 3TBIB 3NTIA 4QQBX 1LTGD 4DN4M 3NE5B 4XIGS 1SBBB 1WTXA 4A3MG 1DXMA 2NBFA 2V4DA 4BBRH 1YIJA 2VS1A 3T1YQ 5M5YH 3BDLA 3JAME 4HIMA 1Q81C 3P75A 1JJGA 4L8JA 1D5XC 1FNWA 2NVYH 2ZM6Q 2KUMA 4FYDA 1TU2B 3VR4A 2PW5A 3WDNA 3GTQB 1UUPA 2N55A 4U68A 1HA5A 4M8AA 4JI0L 3CF5A 1A3UA 1L1OA 3SK6A 1WD1A 2KA7A 2RDHA 2CHBD 3HRZC 2JA7G 2DNCA 5K36G 4HCSA 3NWSA 1VQAA 1EFID 1QOHA 2DY8A 5JJIA 3CCVA 3X3NA 1GM5A 3Q6SA 1PMRA 1OXXK 4ZKBB 3EVQA 3FKIH 4ME5A 3NUCA 2F0EA 3IRBA 2O5JC 3HOXH 1WVLA 3S1NH 4JYAQ 5K5PA 3E5SA 4OWWB 3MTSA 2D0OA 1BNZA 4XTCS 1JICA 3KJOA 5COYA 1IBMQ 1ILQA 1WJJA 1G2SA 4IO9A 5C6AA 2FJ2A 3OSOA 3RN5A 1A63A 2B2WA 4BXXH 1PH2A 1NMGA 5LMNW 1SYFA 4IOAA 2NVXH 3OIQA 1TWGB 1ONLA 4CGYB 5EJWA 4U673 2ZM6L 1F77A 4QGUA 3K8AA 5C4XH 2IWHA 1RL2A 2JN4A 1C48A 4C3JG 1YI2A 1QZGA 4A3BB 2K5WA 2FHTA 3E9HA 2JA6B 1S5FD 2LFNA 3HKZE 4KHPQ 2NVQB 3M4OB 3Q22A 3QWNA 1G51A 1EU3A 1XTDA 3M7GA 4CKEA 4NW2A 2R7ZH 2EOTA 3UDFA 3CC4A 3H0GB 1VMCA 3TSSA 4HJ5A 2PQAA 1FGBD 4B3MQ 5EBDA 1AH9A 4TRDA 1EY4A 1ICFB 4GLXA 1VQMA 4DR1Q 5CGKA 2HIVA 5I6WA 4LAAA 2R61A 2JA5B 1CZWA 1S4ZA 4NKLA 1VQ8A 1EL0A 1STYA 4HR7B 1SNQA 4MN3A 4B9WA 3RLFA 4DV6L 1B3AA 1JMCA 4C1NI 1O7YA 2FINB 3NK9A 2IPKD 2I5MX 2Q8TA 3L0OA 4DV0Q 3GV3A 2N78A 1D1KA 3OYYA 2Q2IA 3KUPA 1I6VC 3B6YA 4J8QA 1SJED 3DWQA 5IYCH 4YCUA 1W2BA 3UE1A 3RZOB 1VDZA 3K7AH 3PCOB 3MFYA 2A5HA 1EU4A 4G4KA 2EY5A 1CK1A 1LYLA 3A56A 2VUMH 3ER0A 3GTOH 1NE3A 1VQLA 1HCZA 4KI0A 2IJ0A 2A8VA 1VF7A 4KHPL 1F2ZA 1PV4A 3P20A 4DK0A 1B2TA 1Q7YC 2D62A 2OTLA 1QVGA 3D6WA 3VDYA 1B53A 4B3ML 3E3XA 2AQ3B 2Z0SA 2VW9A 1B8AA 1FL0A 2P5ZX 2JXMB 3HKZB 3BYYB 4X3TA 1LTSD 4DR1L 1S5ED 3U4ZA 1CFMA 2SOBA 3BZCA 5KNDA 2OF1A 4DV5Q 5IODA 5DAUA 1BCPC 3KDFB 2WACA 2JA8G 4X64L 4ZLTF 2EQSA 2OWOA 4BBRB 4IUVA 4XYOA 4ZK9B 5M5YB 3QJYA 3QB3A 1LT4D 4OWTB 3ICEA 1E2ZA 2GVAA 1SE2A 1TWHH 3W5OA 4CKBA 2XIWA 5JEAH 4A3DH 2RCNA 1E7ZA 3HOYH 5IT9E 3M4YA 2EYPA 3R2TA 1EY7A 1NAPA 2Z1CA 5D65A 1X6OA 3MXGA 4L6TB 1IKLA 3G6EA 2PW7A 4M1UB 1SMYC 1EWCA 3NTKA 3AFPA 1LLRD 4N9PA 1PH6A 3HOUG 2F0DA 3GTGB 3H3VI 3DM1A 3HEJA 3RNUA 3AQQA 3WOEA 1DOMA 3JAML 1EYAA 5EKLA 4ME3A 3URYA 4J1MA 3HOWH 1TS3A 4C2MH 3HOXB 3S1NB 1E1TA 1HH2P 3OMCA 1HR0W 1KRTA 1R9TH 5I9PA 1AN8A 1W3SA 5IYDH 1SE4A 2B63H 1XTCD 4QL5A 2ENBA 1HNXQ 3OOCA 1MSHA 1WD0A 2HDMA 4H0LC 1N8RC 1IL8A 1TXYA 4V190 1PYWD 2AQ2B 4OO1H 1YEZA 2NVXB 1C4QA 1I4XA 4YCWA 1J9OA 5BR8L 3J81c 4RGMA 4NPSA 1PZKD 1YITA 1G2TA 2KJXA 5C4XB 4R4TA 4UP9A 4JI5Q 3K7UC 1OXTA 1HPCA 1K3BC 1LV9A 4JI7Q 2K01A 1HNZL 2OQKA 1N32L 1E0BA 1ENCA 2NYZD 4BS9A 5C4JB 1X3FA 3H91A 3RD4A 3CCUA 4LF5Q 3GTLH 4EQOA 2WB1B 4TQUS 3CCLA 2OTJA 1BQQT 1S72A 1Q1EA 5LL6S 1ML0D 3PGZA 2R7ZB 4KHZA 1KLUD 5FJ8H 1RHPA 2MNAA 2CWPA 3TDQA 4NDXA 1Z6HA 4FVMA 4A3KG 3U50C 3SK4A 1JR0D 1PH7A 3UDIA 5KNBA 3A5UA 4RFBA 5IGBA 4GOPA 1U4LA 2O2LD 3PO3G 1W6JA 1HUMA 1N9WA 1HNXL 3PIP3 2ATWA 4DPGA 1VQDA 2JQOA 2R92H 2J4XA 4QCLA 1AW7A 2NTTA 5M3MH 5CR3A 2WKCA 5BN4A 4JOIA 3ITPA 4DUYL 3K7AB 2EYJA 1DGSA 4C3HB 4HJ9A 3HOZH 1G291 4C1NK 1FNUA 1K9MC 4JI7L 4RCNA 3CAMA 4HIOA 3GTOB 5CV6A 2M00A 2F0SA 4A3FH 2NVTB 1CKNB 2BE5C 1Q86C 4LF5L 3M4QA 2OEOA 4BY1G 1WTQA 3HOVG 4YWKA 2K5HA 2LXJA 4BBSH 2F0OA 1NTGA 2Y0SB 3BDOA 3OIPA 3D4DA 1C7YA 2F0QA 3PMFA 1EYGA 4IUPA 4GNXB 5ELCA 4HTHA 4X65Q 2OQ0A 5JAVA 1TQOA 5HGQA 5C44H 2XWJB 2IX1A 2WAQG 2WP8J 4GOPC 2UU9Q 2SNSA 2Q2HA 1SFOH 1E22A 2RVLA 1QILA 4HCEA 2MP1A 1YNJC 3PUXA 1QUQB 1X55A 3CCQA 4A3CH 1I6HH 5GADC 2C5CA 1BCPF 2D9UA 1CT1D 4JOIC 5DM73 3CPWA 1L0XB 1QNKA 1V1PB 4OHJA 3G7LA 1KNEA 4A3DB 3HOYB 3MEHA 3ULLA 1C9OA 1I4HA 2SDFA 1I5FA 4JI8Q 2CQOA 5JPMC 5JJLA 2H4OA 2K14A 5EPKA 3MVVA 3RZDB 1YHQA 4JBMA 1IW7D 1BXTA 3KF8A 5J1ZA 1F2LA 1TS4A 1H9JA 2E8GA 3DEPA 1WYDA 4N8X1 4WJ3M 3W1BA 1DOLA 3H15A 2ZJRA 1A3TA 4DV1L 2B2YA 1GUNA 1STHA 4F8MA 2QDBA 1LT6D 1XNRQ 3K5MA 4C2MB 3MWYW 1KRSA 3K0XA 3SK8A 4X65L 1GKHA 5IT9L 2F3VA 3EIVA 2F0IA 2UU9L 1JCKB 2Q8IB 2Z4IA 3UDGA 2JEBI 1JWMD 1QJOA 1CKNA 1VMPA 1WI5A 1SNPA 1LTBD 2ZXRA 4MNOA 4WFN3 2BOSA 2MUYA 4HMIA 4DNTB 1STAA 4A3GG 2A74C 1JQYD 4I7ZC 2BDOA 2K32A 4JI8L 1SRUA 4XT3B 4DV2Q 1YNND 2F4VQ 2RDGA 3K0YA 1RF2D 3DM3A 5ISRA 2PZTA 5LMUQ 2V1CC 2MGSA 1I4PA 3TN2A 1T5XD 2YTXA 1ESFA 2B2YC 4DFAA 5EGTA 3TREA 3LWEA 3M85A 2HT1A 4P72A 4RAUC 1KXLA 4OX9Q 4UAIA 2GVBA 4RMFA 1V1PA 3CCEA 1V1OA 2EYMA 4A3BG 2UUBQ 2JA6G 1ICWA 5C4HA 2F0TA 1XNRL 2EJFC 1MJEA 4LFAQ 3ULPA 3PQIA 1B50A 3NBIA 2XNAC 4DV7Q 4RHSA 3S24A 2LXKA 3H0GG 4JV5Q 1SYGA 1MHWC 5IP9H 2Z6BA 1ILPA 2R92B 2YV5A 1F9PA 2NUCA 5E4WC 5M3MB 3CMAA 1TS2A 5FLMG 4A3IH 3VYSA 1XJVA 1CQFA 4LF6Q 4NP5A 3CQZB 2JA5G 5JJKA 2DJFC 1D1IA 1RTNA 3I73A 1UE7A 3E0EA 1S3OA 4R8NA 1L1OB 4RHRA 1CQVA 1W6KA 3W3AA 3T16A 2B2UA 4OL7A 3AMUA 2F4VL 4DR3L 1ENFA 1EY8A 2MJ8A 3OMGA 2F3IA 1UE5A 4BBSB 3I72A 4LFCQ 2ZTEA 4DUZQ 2WIIB 2PZWA 4K2KA 4OX9L 1BBXC 1GUGA 3DEOA 3KJPA 5C44B 3ONAB 2UUBL 1QG7A 3I4LA 4EQNA 4A3LG 2FXQA 4LFAL 4DR4Q 4TSSA 1HFGA 4DV7L 2SNMA 2VB2X 3K6OA 3BU2A 4A3EH 3LNNA 4AH6A 1I6HB 4JV5L 1PVOA 4N8FA 5ELEA 3ND9A 4C3IH 5JEAJ 1PRTF 3HKZG 5J3BA 4LK1C 4G7ZC 1MSGA 1EUJA 1VQ6A 3VR5A 5JVH3 4J6HA 3SR1A 1KC8C 1HNWQ 2PZUA 3I3CA 1CKMA 1BBUA 2B2UC 1O7LA 1B9NA 4K6LA 4BBRG 1KL9A 2VB3X 4IUTA 4DA2A 2O4XA 2B8GA 2AMCB 1Y8PB 3RLNA 5EPLA 4DAMA 4B3SL 2K1BA 1JE5A 4JI1L 1A8VA 4RGTA 2L9HA 4K14A 3V2TA 3D0FA 5IP7G 2BA0A 4K0KL 2PQAB 3GQBA 1B4OA 1SXTA 4DUZL 4LNQA 1U4RA 3I4MH 3L3OC 5C0XH 3M9BA 4HN7A 2EDGA 1J5EQ 2E2JH 4MHEA 4DNRB 4YHHQ 5IE8A 1HFNA 4DK3C 2M9VA 1UE1A 1M8AA 1X3QA 4P74A 4DR4L 2F1MA 1X3EA 4IFDH 5TSSA 3GTKH 4FF3A 1CKOA 4UP8A 3I2ZA 2GA4B 1BCPB 2E76C 4XYQA 1T9HA 5IGCA 4DK6C 3HOXG 5C3XA 2YTVA 4DR6Q 2EXZA 4H13C 3IAYA 1HNWL 1Q90A 1KDAA 1X65A 2L12A 3UDXA 3HS0C 1VQCA 1WTRA 5I4DA 5I9OA 3CXCA 4K8IA 2BH8A 2LY7A 1TWAH 1EEFD 2A1AA 3U58A 3H3VH 1EY5A 3G4SA 2KEEA 5I2YA 1YHBA 5C4XG 1CA5A 2G9DA 1IYVA 4H7BA 2RHSB 3I4OA 1JB7A 5AJ3Q 4HIDA 1DONA 3T1YL 2JA7H 3PO2B 5K36H 4OXPA 4WORA 5C5MA 5LMNQ 5IWAQ 2DNEA 1PFMA 2NN6H 1L1OC 1P16A 1WFQA 4FXKC 1MI2A 1UE6A 2LSSA 3NWTA 3S14H 3MC0B 3N52A 2R7ZG 2ZT9C 1N33Q 1SR3A 2KEDA 1G6ZA 1EY9A 2EPBA 3HKSA 4YWLA 2LKVA 2ALYB 2YYZA 2Z9HA 1LTRD 2KENA 2UXDQ 1KQSA 4B3RQ 4A3IB 3EBEA 5FO9B 5FO8B 4QB4A 5C3EH 2EXDA 4UPAA 4DR6L 2MFIA 3CHBD 2HCCA 5HGTA 1TS5A 3J7AF 2E2DC 4KN4C 2L0CA 1IBLQ 1I50H 3BJUA 1T5EA 4JYAL 2B2WC 2EJGC 4NMZA 4XQNA 5IYCG 4DV3Q 1RKNA 3BZDB 4GKJQ 1K8OA 1IBML 4HEDA 1BDOA 1SNCA 4ABNA 2PCFB 1VQHA 3H6MA 4C3HG 2K75A 4A93H 1EIHA 4P71A 4IQZA 1QVFA 1YHAA 2CCZA 5AJ3L 1Y1WB 4NXMQ 3DWPA 3S1RH 2FFKB 1B3QA 3TMEA 1LT5D 4O42A 2CW0C 4KTAA 4XQJA 4LW1A 3WWVA 5LMNL 5IWAL 2FMCA 5JVG3 4DGZA 2RCFA 4BY7H 2RA4A 1XMOQ 3VYUA 4A76A 1S40A 5M3FG 1U0LA 1SDFA 4IUQA 5IGGA 1Q1BA 1N33L 1Z9FA 1Y14B 2N88A 4B3TQ 4JBJA 2R93H 2RHQB 3ZJYC 2A6HC 1PA6A 2UXDL 4B3RL 1KDCA 1IKMA 2L55A 1Z7TA 2B2TA 3C2PA 3TS0A 5M9OA 1XWEA 5EKIA 1PXUA 1WTOA 4Y7NH 1LT3D 3A55A 1IBLL 4FXDA 4F88A 5KEEA 2DY7A 1SNOA 1GUTA 4GKJL 4A3DG 5ELFA 4CDCC 4LF8Q 3HOYG 1EZ8A 3OHXC 1BCPD 3FP9A 4BWGB 2K5NA 4X6AH 3OPOA 3PUWA 2ZTDA 1BVSA 4DV0L 3J81L 2NVYB 2WB1E 1AZQA 4NXML 4JI4Q 2ES2A 2E2JB 1QNUA 3DMUA 1PH4A 5KNCA 4EQPA 4HMJA 5KRUA 1LACA 3SE0A 4JW0A 1GOZA 4ZUJA 4GOPB 1XMOL 1K83H 3H94A 4P2CB 2F0FA 3K5NA 4MTKA 5M5XH 3NELA 5FKAC 1SMYD 4LJZC 4KJNA 1PRTB 1PDQA 4B3TL 1Y1VG 1K8AC 3QOJA 5ELDA 5IY0A 5C3WA 2B2TC 1SJHD 4HAEA 4QUCA 3TEHB 5IYDG 4K5VA 1YJWA 3EQLC 1E1OA 3FKIB 5KYLA 2UXCQ 3VYTA 1O7ZA 1TWFH 2EYOA 1Q8KA 3SK5A 2AUJD 4RCOA 4OGQC 4LUZA 1TWAB 2PQEA 1HTPA 5ELBA 1BF4A 4DV5L 1HR0Q 1EWHA 1EYDA 1NBWA 5IGEA 1VQPA 1D5ZC 4KKSA 5FO7B 1KABA 4YCVA 2UXBQ 1M1KC 3STBC 3L9AX 2HIXA 2L4NA 4KJOA 2K33A 1LUZA 3V05A 3HOUH 2AKWB 1DM0B 4I65A 5LL6X 3E9IA 4PNYA 4R1JA 4JI4L 1JWSD 1JOOA 1NY4A 1TY0A 1V9PA 2L5TA 5ELNA 3S14B 4JI2Q 4DV4Q 2Y0SE 5DM63 2WKDA 3CCSA 4WRDA 5FJ8G 1B70B 4ZCKA 4CJ1B 1SE3A 3T1HQ 4FNFA 3U9SA 2R7DA 2KHSA 1FD7D 1WTPA 5D3IB 4DK1A 2XRSD 2D5DA 5C3EB 3F2DA 2B29A 2HDLA 1QE6A 1V43A 4RG1A 1V1QA 3GTMH 3K5LA 4A3JG 1SROA 1U4PA 2ZJQA 3S1QH 2AHOB 3OW7A 3OTOQ 2ZTCA 3DUZA 3HG9A 5GQOA 1KDBA 3A74A 5M3MG 2QW7A 3EJIA 4GN5A 3KF8B 1G91A 4H02A 1HHVA 1B9MA 4L5SA 4IUUA 1GVPA 4IPCA 4A93B 4TVAB 2KOLA 1EQVA 1STBA 3S1RB 4X66Q 1HZBA 4ZRZA 1YZ6A 1JB3A 3V96A 1KLGD 4CJ2C 2YU9H 2BA1A 2QGQA 4JI5L 1NR4A 4LF9Q 3CD6A 3S16H 4BY7B 1PFSA 2VZAA 4DV4L 4LUOA 2VUMB 4A3KH 4DAPA 3E0JA 1I4RA 5C44G 2KHJA 1JWUD 4FF2A 2BE5D 1AE3A 1NSNS 2R93B 1EIGA 1A0IA 1ESRA 3TZDA 3SXHA 1VQ4A 5LHY1 3G6JB 4A3CG 1JC7A 4JG2A 3I4NH 2KECA 1YNXA 1OXVA 2XWBB 2MQHA 4L63B 4Y7NB 1GHKA 4HJ8A 1LABA 3OW2A 3OTOL 3BVMA 3IKJA 1NMFA 5GROA 1M4VA 4XQQA 1Y69U 1YBYA 4B9XA 2K50A 1PRTC 4IJHA 5IOCA 2JK8A 3MXNB 4PV1C 5J39A 3TS2A 1STNA 1YNJD 3GD7A 5C0XJ 1HXYD 1PYBA 3L7ZC 1UAPA 1TWHB 1MGSA 3D4WA 1Q12A 1I94Q 2HQLA 2NZ1D 4IFDJ 1LTAD 4OIKA 1SSOA 4ULLA 1EY6A 4XDXA 5CYUA 3H3VC 4LF9L 3TP5A 1K83B 3A0JA 2AQ1B 5NUCA 3QOLA 1HRJA 2NTSA 1C8CA 2CH4W 5M5XB 2RKSA 2F0VA 2F0GA 2HHHQ 2HQEA 3A8KE 1NCVA 2JSOA 1LO5D 1AZPA 2TMPA 4LWCA 3S2DH 3ULJA 3DLLA 5F2DA 3PF5A 2F0KA 2PI2A 1A6XA 1AFPA 1IYUA 2O5IC 2RBMA 2WV6D 3HOWB 3Q8DA 1N34Q 4JI6Q 2A69C 2HD3A 3D4RA 3M4PA 1TWFB 3VYRA 1I4GA 3IFDA 2A69D 1R9TB 2A68C 3LX0A 5I2XA 1VQ9A 2B63B 3SVMA 4IUNA 1KHIA 3C46A 2K04A 1PH3A 2C35B 3PUYA 3SGIA 1DOKA 5IGFA 4OO1I 1PZID 1DJRD 3BZKA 1CA6A 4QMGA 3VR6A 4CBVA 1AEXA 5ELOA 1EYCA 5E7NA 4QIWE 1O80A 2VQEQ 1MBYA 1QZHA 3F1ZA 2MHVA 3SHLA 3UE0A 2E2HH 1OXSC 5C5LA 3J7YW 2HUGA 4OELB 4UHVA 3PO2G 3KLWA 3GTLB 1TWCH 4K2LA 5IYBH 3KBXA 2HHHL 3MXNA 1EFWA 3BDCA 1X32A 3S15H 2ID0A 1CHPD 3KFUA 2MO0A 4ILWA 2RSOA 1Q3LA 5BN5A 3GTMB 4JI6L 4KN7C 1XPRA 5IP9G 5T1GA 3KBGA 3GTPH 2NZHA 2CQAA 2EY1A 3KLRA 4A3GH 2EYFA 4ZUIA 3MFGA 4A3IG 5CC4A 1VQKA 3IL8A 4L5RC 2I46A 1WTVA 1HZCA 3WOFA 3T51B 4CDFC 2EYLA 2PPBC 3I70A 2KQ3A 2CKZB 3AFQA 1SN8A 5JPNC 3I56A 1WTWA 3BVGA 2YU9B 4X3KA 3HOZB 2KCMA 4A3BH 3KLSA 4ODGA 2PNHA 2VQEL 3PIO3 5EBCA 3K5OA 4DR5Q 1PFBA 4DV2L 5E4XA 4A3FB 1GUOA 1TY2A 1NJIC 1Y1WG 4DAYB 5LMUL 5I6YA 5E1FA 2G9HD 3CU7A 4IURA 3H0GH 1XXGA 1VQFA 1HJPA 3RMHA 3TRZA 3T4AC 1MD2D 4QIWB 4X62Q 1SNDA 2JJQA 4UDUC 3TP6A 2F03A 4KKUA 4NB3A 3I4NB 1SYEA 3HZXA 3I90A 1GXDC 2AUKA 3LWUA 3J81i 4G57A 4KK7A 3C1EA 2A6EC 1SFOB 5CV5A 5D14A 3K81C 4V0BA 2F0JA 1E2WA 1F2YA 4JBKA 2A6ED 4DR2Q 2QCPX 4HSPA 2Q2TA 3R8BA 3BG3A 3F2UA 2J7ZA 1GHJA 3FPUB 1ZEQX 2CWAA 4IJLA 3J81E 5GAHC 3Q23A 3RZOH 1B1ZA 1LM0A 4JI0Q 5G3LF 1P8LA 1KD1C 3CW2C 1QVCA 2WINB 4LF6L 1F2MA 4RKBA 2FMMA 2VXWA 3BS1A 4EQ5A 1CSPA 3D3RA 3FDTA 3S9WA 2AWOA 2WAQB 4HSVA 4DR5L 4A3LH 1IXRA 2B3GA 4HJ7A 3ND8A 1A62A 2R6GA 1SYCA 3K59A 1H9RA 3U9OA 1VQ7A 2K6AA 2VY3A 4DNIA 3U4VA 4FF1A 4IFDG 2SEBD 4LFCL 4X62L 1VF5C 1IZ6A 3KF6A 4KY6A 4UP7A 2I5HA 4AQYQ 1UNSA 1WCMH 1QB5D 3MHBA 1JJCB 2L15A 1PZJD 1VQNA 4LUVA 1VQ5A 3PSIA 1Q8IA 1CTMA 4DR2L 4IPHA 1PH9A 4DAYA 1E2VA 3FKIG 2ICIA 4AYBB 4DAVA 2RSNA 1KTKA 1V8QA 1L0WA 4A3MH 5FK9C 1Z47A 4F7XA 2E2IH 4PZ7A 2X6LA 4YY3Q 3NENA 5IP7H 1A2UA 1JE4A 4BXXG 1BO0A 1X3GA 2E2HB 4GKKQ 3EN2A 1GUSA 1FVIA 3PIOA 2M2LA 1TWCB 1SYDA 3GTGH 2EVBA 2NN6G 1KAAA 3I55A 3S15B 2K4KA 3SEBA 1RODA 1A3VA 3NPPA 2F4IA 4PMCA 4CKCA 2D2CC 1BUVT 4LMQD 4KY5A 2E5LQ 2F0NA 1HZ9A 1R4QB 2K03A 5CV4A 2VL6A 2WB1G 1J5EL 3GTPB 2XTIA 4PMWA 4DV6Q 4AQYL 3AEVA 4YHHL 4A3GB 4IPGA 5EAYA 4MIUA 3ZYYX 4A75A 5C3EG 1F9QA 3J80L 5CORA 3NHHA 1LTLA 4GN4B 1A2TA 2B2VA 4X3UA 3QG1A 1VQIA 4FDBA 2R3ZA 1MJCA 1X3PA 4JK1C 1TIID 1LTTD 1E3PA 5FOBB 4QY7A 3GTJH 1AE2A 3A54A 4YY3L 3KOJA 4DXFA 1HZAA 1SAPA 4EVOA 3SDZA 5C4JH 1FR3A 4K8JA 4KV6A 3CKIB 3NTHA 4A93G 4GKKL 1R4PB 5C4ZA 3PV0A 4C3JH 5KIXA 5GAEC 2IX3A 3RUZA 3C1FA 1K0SA 2F0HA 3OWFA 2PMZE 2TSSA 3EFXD 3CMEA 1JOKA 3T56B 4WJ4A 4BY7G 4KMUC 3D31A 1SLJA 4UY8C 3S1MH 2VUMG 1S5BD 1H9KA 3AYHB 4CDDC 2JP1A 3K80C 2Q2UA 4OWXB 2E5LL 1J6QA 3MAQA 5FLXL 2CW0D 4X64Q 3CCRA 2B2VC 2R93G 1EOVA 3J80c 4A3EB 2Y0SG 4L5TA 3NQIA 3H09A 4P75A 2E74C 3MA2B 1EEID 2JA9A 4C3IB 2BDNA 1X56A 2F0UA 4JVZA 3FVQA 4ALPA 3MXUA 4C3HH 4E6IA 3MZ5A 2ASBA 3I91A 2A6HD 4R4CA 5KGUA 2BH2A 3S2HH 4B08A 1JORA 2EY6A 2NVTH 3DWAA 2K7VA 2A73B 1I4QA 2AWNA 3M7NA 1STGA 3I7FA 4DV3L 5EKKA 2RDFA 2QEXA 2IHEA 2KVMA 5T1IA 5JEAG 4S3SA 5J22A 1PFNA 2L1BA 4FO2A 4O0AA 5M3FH 1PTOF 4OIJA 3BVZA 3J81j 3HP3A 2E75C 3I4MB 1NUCA 3A5ZB 1II3A 5EPJA 1CSQA 5A2QL 1HQRD 4DU9A 4POFA 1WCMB 5C0XI 2DJGC 2C9OA 5FLXc 1BBWA 3TQYA 3KLSX 4XT1B 5KYIA 2PMZB
chains in the Genus database with same CATH topology
2K5QA 3UI2A 3TZUA 4PQXA 1HTLD 3D8GA 3GTKB 3A7LA 4IFDI 2BCOA 2H1EA 5AFWA 4KD3A 2RQXA 5CV7A 4A3MB 2XVSA 2E2IB 2IL8A 2EJMA 1DD2A 3VA5A 5EQ0A 2ZXOA 1A15A 2Q8RE 4OO1G 4K5WA 2EY2A 2HCIA 2IW3A 5HURA 3FRPB 4C56C 4BA1I 1K8MA 1BR9A 1PTOH 2PYKA 2JA7B 2EZVA 1IHZA 3X3MA 5A35A 4K5XA 2F0PA 1F9RA 2KCCA 2NN6I 2ICEC 1JOQA 1U9RA 1OO9B 4O1NA 4ID6A 2QEJC 4Q0FA 4YIJA 2KCNA 4FXGC 1GUWA 4FP5D 4IALA 3GTJB 3T53B 4JBWA 5CMDA 1ZYRC 2EYHA 1XYIA 5IGDA 4KD4A 1I50B 2CVRA 1S5CD 3O13A 1ZYRD 1O78A 4C3JB 1QWYA 1U4MA 3K57A 3R2IA 5D3DA 2VNUD 3Q0AA 3S1MB 3NBHA 3NXWA 2Z4HA 4ZAIA 1QCBD 1NR2A 3NSWA 3GP7A 3OWEB 3R3OA 2QILA 3VR3A 1HUNA 3CRLC 2XSCA 4TKOB 3Q24A 4GZYC 1CZGA 2F0MA 5BN3A 4KY7A 2EE1A 1ET6A 3K58A 4H44C 3S2HB 3E6ZX 2K05A 3EA6A 4KHVA 3MXPA 2F0LA 1FYCA 2X69A 4IN3A 5M3FB 3A8IE 1PRTD 3A7AB 2JYOA 1RCVD 2K28A 3GO5A 5G3LD 5IIFA 1H9SB 5CV8A 4K6DA 3C3LA 2JEAI 1XX8A 1CM9A 1S5DD 1HQMC 4PMBA 4KKTA 1AP0A 3IFTA 1ENAA 1D2BA 3QO2A 2JA8B 3N6RA 1ZKOA 1Y8OB 3ERQA 4R9WA 3NQTA 4G7OC 1IW7C 4CJ0B 1G8ZD 2F0WA 1TKWB 2IT1A 3KK7A 2I07B 1D5MC 3I8ZA 3S17B 2A68D 5DNFA 5CBEE 1PTOB 1BOSA 2B39A 4RGOS 1H9MA 1CI3M 3HOUB 4RH6A 4R8IA 4RGNA 1ET9A 3P1HA 1Y1VB 1HA6A 1OXUA 3CRKC 3AB9A 2JE6I 3HGBA 2NB0A 2ZXPA 3FMCA 3J80E 1EOTA 4Z9CB 4X3SA 1RJTA 1VCIA 1DYQA 1B44D 1YNNC 2NWGA 3VR2A 3NP8A 3D6CA 1H9SA 1CHQD 4XXEA 3S1QB 1EQTA 4ZKCB 1DCZA 2F3WA 3GV6A 3W2DA 4DXGA 1SYBA 3PUVA 3FEWX 4FF4A 4IZ8A 3M3YB 3A8JE 1PLFA 1STEA 2PNRC 1RTOA 2OT2A 1KNAA 4EGVA 1EY0A 5FLXE 1Y8NB 3S16B 3P7JA 4A3JB 4RKLA 4A3KB 2QKIC 5E3FA 4BA2I 4QF4A 4WJWA 2PO4A 1TT2A 4ZYSA 3EROA 2LS01 3PUZA 3PO3B 3TP7A 2X6GA 3T13A 1J8IA 4RA8A 1TVXA 1RD9D 1LTID 1SNMA 2DN8A 1GJXA 2OXPA 4F87A 1D6EC 1ZXTA 1DZ1A 4C3IG 3VA7A 4G7HC 3J7AV 5JJZA 3QIAA 4RWSC 4Q5VA 1L0YB 2K5DA 2L11A 2Z8LA 1SEBD 5A2QE 4QUFA 4BY1B 3HOVB 5CV9A 3AU7A 2MPMA 5DEHA 1F9SA 4ZQ3A 4DF7A 2QF7A 2LMCB 3R93A 5CBAE 1FNVA 1TR5A 3TP8A 2XRQD 1PTOC 3DHQA 4CHTB 5C0XG 2XN9C 5M5WB 3S2DB 1UEAB 2B8FA 1PTOD 5JOBA 2IX0A 3FPPA 3DXJC 4N9TA 1EZ6A 3BYTB 2J0TD 1RDPD 1I3QB 3TBIB 3NTIA 1LTGD 4DN4M 3NE5B 4XIGS 1SBBB 1WTXA 1DXMA 2NBFA 2V4DA 3BDLA 3JAME 3P75A 4L8JA 1D5XC 1FNWA 2KUMA 4FYDA 1TU2B 3VR4A 2PW5A 3WDNA 3GTQB 1UUPA 2N55A 4U68A 1HA5A 4M8AA 1A3UA 3SK6A 1WD1A 2KA7A 2RDHA 2CHBD 3HRZC 2DNCA 5K36G 4HCSA 3NWSA 1EFID 1QOHA 2DY8A 3X3NA 3Q6SA 1PMRA 1OXXK 4ZKBB 3EVQA 4ME5A 3NUCA 2F0EA 2O5JC 1WVLA 5K5PA 3E5SA 3MTSA 1BNZA 4XTCS 1JICA 5COYA 1ILQA 1G2SA 5C6AA 2FJ2A 3OSOA 2B2WA 1SYFA 3OIQA 1TWGB 1ONLA 4CGYB 5EJWA 4U673 1F77A 2IWHA 1C48A 4C3JG 4A3BB 2K5WA 2FHTA 2JA6B 1S5FD 2LFNA 2NVQB 3M4OB 3Q22A 3QWNA 1EU3A 3M7GA 4CKEA 4NW2A 2EOTA 3H0GB 1VMCA 3TSSA 1FGBD 5EBDA 4TRDA 1EY4A 5CGKA 5I6WA 4LAAA 2R61A 2JA5B 1CZWA 1S4ZA 4NKLA 1EL0A 1STYA 4HR7B 1SNQA 4MN3A 4B9WA 3RLFA 1B3AA 4C1NI 1O7YA 2FINB 3NK9A 2IPKD 2Q8TA 3GV3A 1D1KA 3KUPA 1I6VC 4J8QA 1SJED 3DWQA 3RZOB 1VDZA 3MFYA 2A5HA 1EU4A 4G4KA 2EY5A 1CK1A 3A56A 1HCZA 4KI0A 2IJ0A 1VF7A 1F2ZA 3P20A 4DK0A 1B2TA 2D62A 3D6WA 1B53A 2AQ3B 2JXMB 3HKZB 3BYYB 4X3TA 1LTSD 1S5ED 1CFMA 2SOBA 5KNDA 2OF1A 5IODA 5DAUA 1BCPC 2WACA 4ZLTF 4BBRB 4IUVA 4XYOA 4ZK9B 5M5YB 3QJYA 3QB3A 1LT4D 1E2ZA 1SE2A 4CKBA 2XIWA 5JEAH 5IT9E 3M4YA 2EYPA 3R2TA 1EY7A 1NAPA 2Z1CA 5D65A 3MXGA 4L6TB 1IKLA 2PW7A 4M1UB 1SMYC 1EWCA 3NTKA 1LLRD 4N9PA 2F0DA 3GTGB 3DM1A 3HEJA 3WOEA 1DOMA 3JAML 1EYAA 5EKLA 3URYA 4J1MA 1TS3A 3HOXB 3S1NB 3OMCA 5I9PA 1AN8A 1SE4A 1XTCD 2ENBA 3OOCA 1MSHA 1WD0A 2HDMA 4H0LC 1IL8A 4V190 1PYWD 2AQ2B 4OO1H 2NVXB 1C4QA 1I4XA 1J9OA 4RGMA 1PZKD 1G2TA 2KJXA 5C4XB 1HPCA 1OXTA 1LV9A 2K01A 1E0BA 1ENCA 2NYZD 4BS9A 5C4JB 3H91A 3RD4A 4EQOA 2WB1B 4TQUS 1BQQT 1Q1EA 5LL6S 1ML0D 2R7ZB 4KHZA 1KLUD 1RHPA 3TDQA 4NDXA 1Z6HA 4FVMA 3SK4A 1JR0D 5KNBA 4RFBA 5IGBA 1U4LA 2O2LD 1W6JA 1HUMA 3PIP3 2J4XA 4QCLA 1AW7A 2NTTA 5CR3A 2WKCA 5BN4A 3ITPA 3K7AB 2EYJA 4C3HB 1G291 4C1NK 1FNUA 4RCNA 3GTOB 5CV6A 2M00A 2F0SA 2NVTB 2BE5C 2OEOA 1WTQA 2F0OA 2Y0SB 3BDOA 3OIPA 3D4DA 2F0QA 3PMFA 4IUPA 5ELCA 4HTHA 5JAVA 1TQOA 2XWJB 2IX1A 2WP8J 2SNSA 2RVLA 1QILA 4HCEA 2MP1A 1YNJC 3PUXA 2C5CA 1BCPF 2D9UA 1CT1D 5DM73 1L0XB 1QNKA 1V1PB 4OHJA 3G7LA 1KNEA 4A3DB 3HOYB 3MEHA 1I4HA 2SDFA 5JPMC 2H4OA 5EPKA 3MVVA 3RZDB 1IW7D 1BXTA 3KF8A 5J1ZA 1F2LA 1TS4A 1H9JA 3DEPA 1DOLA 1A3TA 2B2YA 1GUNA 1STHA 4F8MA 2QDBA 1LT6D 3K5MA 4C2MB 3MWYW 3SK8A 5IT9L 2F3VA 2F0IA 1JCKB 2Q8IB 2Z4IA 2JEBI 1JWMD 1QJOA 1VMPA 1SNPA 1LTBD 2ZXRA 4WFN3 2BOSA 2MUYA 4HMIA 4DNTB 1STAA 2A74C 1JQYD 4I7ZC 2BDOA 2K32A 4XT3B 1YNND 2RDGA 3K0YA 1RF2D 5ISRA 2PZTA 2MGSA 1I4PA 3TN2A 1T5XD 1ESFA 2B2YC 4DFAA 5EGTA 3LWEA 3M85A 4RAUC 4UAIA 1V1PA 1V1OA 2EYMA 1ICWA 5C4HA 2F0TA 2EJFC 1B50A 3NBIA 2XNAC 4RHSA 1SYGA 1ILPA 2R92B 1F9PA 2NUCA 5E4WC 5M3MB 1TS2A 3VYSA 1CQFA 4NP5A 3CQZB 1D1IA 1RTNA 3I73A 4R8NA 4RHRA 1CQVA 1W6KA 3W3AA 3T16A 2B2UA 4OL7A 3AMUA 1ENFA 1EY8A 2MJ8A 3OMGA 4BBSB 3I72A 2WIIB 2PZWA 4K2KA 1BBXC 1GUGA 3DEOA 5C44B 3ONAB 1QG7A 3I4LA 4EQNA 4TSSA 1HFGA 2SNMA 2VB2X 3K6OA 3LNNA 1I6HB 5ELEA 3ND9A 5JEAJ 1PRTF 4LK1C 4G7ZC 1MSGA 3VR5A 5JVH3 4J6HA 3SR1A 2PZUA 3I3CA 2B2UC 1O7LA 1B9NA 4K6LA 2VB3X 4IUTA 4DA2A 2O4XA 2B8GA 1Y8PB 5EPLA 2K1BA 4RGTA 2L9HA 4K14A 3V2TA 2BA0A 3GQBA 1B4OA 1SXTA 1U4RA 3L3OC 5C0XH 4HN7A 2EDGA 4MHEA 4DNRB 1HFNA 2M9VA 1M8AA 1X3QA 4IFDH 2F1MA 5TSSA 4FF3A 2GA4B 1BCPB 2E76C 4XYQA 5IGCA 5C3XA 2EXZA 4H13C 3IAYA 1Q90A 1KDAA 2L12A 3HS0C 1WTRA 5I4DA 5I9OA 4K8IA 2LY7A 1EEFD 1EY5A 2KEEA 5I2YA 1CA5A 2G9DA 1IYVA 4H7BA 1DONA 3PO2B 5K36H 4WORA 5C5MA 2DNEA 1PFMA 2NN6H 4FXKC 1MI2A 3NWTA 3MC0B 3N52A 2ZT9C 2KEDA 1G6ZA 1EY9A 2EPBA 2LKVA 2YYZA 1LTRD 4A3IB 5FO9B 5FO8B 4QB4A 3CHBD 2HCCA 5HGTA 1TS5A 3J7AF 2E2DC 4KN4C 2L0CA 1T5EA 2B2WC 2EJGC 4NMZA 4XQNA 1RKNA 3BZDB 1K8OA 4HEDA 1BDOA 1SNCA 4ABNA 2PCFB 3H6MA 4C3HG 1EIHA 4IQZA 1Y1WB 3DWPA 2FFKB 3TMEA 1LT5D 4O42A 2CW0C 4KTAA 4XQJA 2FMCA 5JVG3 4DGZA 2RA4A 3VYUA 1SDFA 4IUQA 5IGGA 1Q1BA 2N88A 2A6HC 1KDCA 1IKMA 2L55A 1Z7TA 2B2TA 3C2PA 5M9OA 1XWEA 5EKIA 1PXUA 1WTOA 1LT3D 3A55A 4FXDA 4F88A 5KEEA 2DY7A 1SNOA 1GUTA 5ELFA 1EZ8A 3OHXC 1BCPD 4BWGB 3OPOA 3PUWA 3J81L 2NVYB 1AZQA 2E2JB 1QNUA 3DMUA 5KNCA 4EQPA 4HMJA 5KRUA 1LACA 3SE0A 1GOZA 4ZUJA 3H94A 4P2CB 2F0FA 3K5NA 5FKAC 1SMYD 4LJZC 4KJNA 1PRTB 1PDQA 3QOJA 5ELDA 5C3WA 2B2TC 1SJHD 4HAEA 4QUCA 4K5VA 3EQLC 3FKIB 5KYLA 3VYTA 1O7ZA 2EYOA 3SK5A 2AUJD 4RCOA 4OGQC 1TWAB 2PQEA 1HTPA 5ELBA 1BF4A 1EWHA 1EYDA 5IGEA 1D5ZC 4KKSA 5FO7B 1KABA 3L9AX 2L4NA 4KJOA 2K33A 3V05A 1DM0B 4I65A 5LL6X 4PNYA 1JWSD 1JOOA 1TY0A 2L5TA 3S14B 5DM63 2WKDA 4WRDA 4CJ1B 1SE3A 4FNFA 3U9SA 1WTPA 2KHSA 1FD7D 5D3IB 4DK1A 2XRSD 2D5DA 5C3EB 2HDLA 1QE6A 1V43A 3K5LA 1U4PA 3OW7A 3DUZA 3HG9A 1KDBA 3EJIA 1HHVA 1G91A 1B9MA 4IUUA 4A93B 2KOLA 1EQVA 1STBA 3S1RB 4ZRZA 1JB3A 3V96A 1KLGD 4CJ2C 2BA1A 1NR4A 4BY7B 2VUMB 4DAPA 3E0JA 1I4RA 1JWUD 4FF2A 2BE5D 1NSNS 2R93B 1EIGA 1ESRA 3TZDA 3SXHA 5LHY1 3G6JB 1JC7A 2KECA 1OXVA 2XWBB 4L63B 4Y7NB 1GHKA 1LABA 3BVMA 3IKJA 1M4VA 4XQQA 1Y69U 4B9XA 1PRTC 5IOCA 4PV1C 5J39A 1STNA 1YNJD 3GD7A 5C0XJ 1HXYD 3L7ZC 1UAPA 1TWHB 1MGSA 3D4WA 1Q12A 2NZ1D 4IFDJ 1LTAD 4OIKA 1SSOA 4ULLA 1EY6A 4XDXA 5CYUA 3H3VC 3TP5A 1K83B 2AQ1B 5NUCA 3QOLA 1HRJA 2NTSA 1C8CA 5M5XB 2RKSA 2F0VA 2F0GA 2HQEA 3A8KE 1NCVA 2JSOA 1LO5D 1AZPA 2TMPA 5F2DA 2F0KA 1A6XA 1AFPA 1IYUA 2O5IC 2RBMA 2WV6D 3HOWB 2A69C 3D4RA 1TWFB 3VYRA 1I4GA 3IFDA 2A69D 1R9TB 2A68C 3LX0A 5I2XA 2B63B 3SVMA 4IUNA 3C46A 2K04A 3PUYA 5IGFA 1DOKA 4OO1I 1PZID 1DJRD 1CA6A 4QMGA 3VR6A 4CBVA 1AEXA 1EYCA 1O80A 1MBYA 2MHVA 3SHLA 1OXSC 5C5LA 3J7YW 2HUGA 3GTLB 4K2LA 3KBXA 3MXNA 3BDCA 1X32A 2ID0A 1CHPD 4ILWA 2RSOA 1Q3LA 5BN5A 3GTMB 4KN7C 5T1GA 3KBGA 2CQAA 2EY1A 3KLRA 2EYFA 4ZUIA 3MFGA 5CC4A 3IL8A 2I46A 1WTVA 3WOFA 3T51B 2PPBC 2EYLA 3I70A 2KQ3A 5JPNC 1WTWA 3BVGA 2YU9B 4X3KA 3HOZB 3KLSA 4ODGA 3PIO3 5EBCA 3K5OA 1PFBA 5E4XA 4A3FB 1GUOA 1TY2A 5I6YA 5E1FA 2G9HD 3CU7A 4IURA 1XXGA 3RMHA 3T4AC 1MD2D 4QIWB 1SNDA 4UDUC 3TP6A 2F03A 4KKUA 3I4NB 1SYEA 3HZXA 3I90A 1GXDC 2AUKA 3LWUA 4G57A 4KK7A 3C1EA 2A6EC 1SFOB 5CV5A 5D14A 4V0BA 2F0JA 1E2WA 1F2YA 2A6ED 2QCPX 4HSPA 3R8BA 3BG3A 3F2UA 2J7ZA 1GHJA 3FPUB 1ZEQX 3J81E 3Q23A 1B1ZA 5G3LF 2WINB 1F2MA 4RKBA 2FMMA 2VXWA 3BS1A 3D3RA 3FDTA 3S9WA 2AWOA 2WAQB 4HSVA 3ND8A 2R6GA 1SYCA 3K59A 1H9RA 3U9OA 2K6AA 4FF1A 4IFDG 2SEBD 1VF5C 4KY6A 1UNSA 1QB5D 3MHBA 1PZJD 1Q8IA 1CTMA 4DAYA 1E2VA 2ICIA 4AYBB 4DAVA 2RSNA 1KTKA 1V8QA 5FK9C 1Z47A 4F7XA 2X6LA 1A2UA 1JE4A 1BO0A 2E2HB 1GUSA 2M2LA 1TWCB 1SYDA 2EVBA 2NN6G 1KAAA 3S15B 3SEBA 1RODA 1A3VA 3NPPA 2F4IA 4PMCA 4CKCA 2D2CC 1BUVT 4LMQD 4KY5A 2F0NA 1R4QB 2K03A 5CV4A 3GTPB 4PMWA 4A3GB 4MIUA 3ZYYX 1F9QA 3J80L 5CORA 3NHHA 1A2TA 2B2VA 4X3UA 3QG1A 2R3ZA 1X3PA 4JK1C 1TIID 1LTTD 5FOBB 3A54A 4DXFA 1SAPA 4EVOA 3SDZA 1FR3A 4K8JA 4KV6A 3CKIB 3NTHA 1R4PB 5C4ZA 3PV0A 5KIXA 2IX3A 3RUZA 3C1FA 2F0HA 3OWFA 3EFXD 2TSSA 1JOKA 3T56B 4KMUC 3D31A 1S5BD 1H9KA 2JP1A 3MAQA 5FLXL 2CW0D 2B2VC 4A3EB 3NQIA 3H09A 2E74C 3MA2B 1EEID 4C3IB 2BDNA 2F0UA 3FVQA 3MXUA 4E6IA 3MZ5A 3I91A 2A6HD 5KGUA 4B08A 1JORA 2EY6A 3DWAA 2K7VA 2A73B 1I4QA 2AWNA 3M7NA 1STGA 5EKKA 2RDFA 2KVMA 5T1IA 5JEAG 4S3SA 5J22A 1PFNA 2L1BA 4FO2A 1PTOF 4OIJA 3BVZA 3HP3A 2E75C 3I4MB 1NUCA 1II3A 5EPJA 5A2QL 1HQRD 4DU9A 1WCMB 5C0XI 2C9OA 3KLSX 4XT1B 5KYIA 2PMZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VF7 A;  4OGQ C;  3TZU A;  3P20 A;  4DK0 A;  4DNR B;  3A7L A;  4JK1 C;  3VA7 A;  4G7H C;  4IQZ A;  1HTP A;  2O5J C;  1H9M A;  1CI3 M;  2D62 A;  2AWO A;  1EWH A;  1OXV A;  3QIA A;  4IFD H;  4TQU S;  2F1M A;  4KKS A;  2CW0 C;  3VR3 A;  4XTC S;  1GHK A;  1LAB A;  3SDZ A;  1FR3 A;  1OXU A;  1Q1E A;  3CRK C;  3CRL C;  3IKJ A;  3ND8 A;  5BN5 A;  2JXM B;  1Y69 U;  3AB9 A;  4TKO B;  2JE6 I;  3HGB A;  1IW7 D;  2E76 C;  4KHZ A;  2EJM A;  2R6G A;  2K33 A;  3I73 A;  1H9R A;  4KN7 C;  5BN3 A;  1CFM A;  1DD2 A;  4PV1 C;  3PV0 A;  5KND A;  3KLR A;  3GD7 A;  1H9J A;  4IFD G;  3FMC A;  3L7Z C;  1VF5 C;  1ONL A;  3W3A A;  1Q1B A;  2L5T A;  1Z6H A;  4OO1 G;  1Q12 A;  4H13 C;  2QF7 A;  1Q90 A;  3QJY A;  1GUN A;  3T56 B;  2LMC B;  4KMU C;  5KNB A;  1E2Z A;  3D31 A;  4H44 C;  2A6H C;  1VCI A;  4GZY C;  1H9K A;  3T51 B;  1YNN C;  4BA1 I;  3VR2 A;  2PPB C;  3I72 A;  1K8M A;  5C0X G;  1CTM A;  3U9S A;  5JEA H;  1H9S A;  1Z7T A;  1E2V A;  1FYC A;  2B8F A;  3M4Y A;  4DK1 A;  2Q8I B;  3FPP A;  2D5D A;  1GUG A;  3DXJ C;  1V8Q A;  1IYV A;  2JEB I;  1DCZ A;  3A8K E;  1QJO A;  1V43 A;  3A8I E;  5A35 A;  5BN4 A;  3I4L A;  1SMY C;  2KCC A;  3A7A B;  1GUT A;  5K36 H;  2NN6 I;  2E74 C;  3PUV A;  1GUO A;  1G29 1;  1PMR A;  3OW7 A;  2DNE A;  1A6X A;  1IYU A;  1H9S B;  2NN6 H;  2O5I C;  3A8J E;  3LNN A;  3NE5 B;  3OPO A;  2A69 C;  3D4R A;  4RCN A;  4DNT B;  4XIG S;  3PUW A;  3MXU A;  2JEA I;  1DXM A;  3ND9 A;  2PNR C;  2V4D A;  1GUS A;  1B9M A;  2BE5 C;  2A69 D;  2ZT9 C;  1HQM C;  2A68 C;  4I7Z C;  2BDO A;  2A6H D;  2K32 A;  4LK1 C;  4G7Z C;  4HR7 B;  3VR5 A;  5KNC A;  2EVB A;  2NN6 G;  4L8J A;  4KKU A;  3RLF A;  1Y8N B;  4KKT A;  1LAC A;  2AUK A;  3BDO A;  2K7V A;  3IFT A;  2YYZ A;  1TU2 B;  3LWU A;  3SE0 A;  3VR4 A;  2A6E C;  3WDN A;  3T53 B;  1O7L A;  4JBW A;  3M7N A;  1B9N A;  3H94 A;  3N6R A;  1ZYR C;  2D2C C;  1ZKO A;  1E2W A;  1I6V C;  3PUY A;  2B8G A;  1Y8O B;  2BA1 A;  3OOC A;  2A6E D;  4H0L C;  3M85 A;  4BA2 I;  4LJZ C;  3BG3 A;  2KA7 A;  4G7O C;  1Y8P B;  1IW7 C;  1O78 A;  3PUZ A;  3VR6 A;  1GHJ A;  1VDZ A;  4OO1 H;  1TKW B;  2E75 C;  4KN4 C;  3MFY A;  2IT1 A;  1YNJ C;  3PUX A;  1T5E A;  2DNC A;  5K36 G;  5JEA G;  2EJG C;  3EQL C;  2EJF C;  1OXS C;  2BA0 A;  1K8O A;  3GQB A;  2DN8 A;  2BE5 D;  1HPC A;  1OXT A;  2A68 D;  1HCZ A;  3QG1 A;  4KI0 A;  1BDO A;  5C0X H;  1OXX K;  2AUJ D;  1GJX A;  2PCF B;  2EDG A; 
#chains in the Genus database with same CATH topology
 2K5Q A;  1CUK A;  3UI2 A;  3TZU A;  4PQX A;  2CFM A;  1HTL D;  3D8G A;  3GTK B;  3A7L A;  5BR8 Q;  4IFD I;  4OON A;  2BCO A;  3J7Z C;  3HOW G;  2H1E A;  5AFW A;  4KD3 A;  1Q46 A;  2RQX A;  4GN3 B;  5CV7 A;  4A3M B;  2JA8 H;  2I0Q A;  2XVS A;  3NBH B;  4R4Q A;  2IL8 A;  1HNZ Q;  1N32 Q;  2E2I B;  2B63 G;  2EJM A;  1DD2 A;  3VA5 A;  3CCM A;  5EQ0 A;  2ZXO A;  1A15 A;  2PI2 E;  1MIU A;  2Q8R E;  3RZD H;  1ASZ A;  4OO1 G;  4K5W A;  4IOC A;  2EY2 A;  1NNX A;  2HCI A;  4LF7 Q;  3S17 H;  1GO3 E;  1EQQ A;  2IW3 A;  5HUR A;  3FRP B;  2K5V A;  4C56 C;  4BA1 I;  2EIF A;  1K8M A;  1BR9 A;  1PTO H;  4LF8 L;  2PYK A;  2JA7 B;  3PF4 A;  2EZV A;  1K8G A;  1UEB A;  1VQB A;  3STB D;  1IHZ A;  1Y1V H;  3X3M A;  5A35 A;  4K5X A;  2F0P A;  1F9R A;  5H1S E;  1B7Y B;  2KCC A;  2NN6 I;  2ICE C;  1JOQ A;  2DGY A;  1U9R A;  4HIK A;  1OO9 B;  3KYH C;  4O1N A;  4ID6 A;  4KLK A;  3CPF A;  2QEJ C;  4JC0 A;  4Q0F A;  4YIJ A;  2KCN A;  2QA4 A;  4DUY Q;  4FXG C;  2N49 A;  1PHJ A;  2MO1 A;  1PYS B;  1GUW A;  4FP5 D;  4IAL A;  2UUA Q;  3GTJ B;  3T53 B;  4JBW A;  1PH5 A;  2UXC L;  2F52 A;  5CMD A;  1ZYR C;  2EYH A;  1XYI A;  5IGD A;  4KD4 A;  1I50 B;  2CVR A;  2N3S A;  1S5C D;  3KDF A;  3O13 A;  2R92 G;  1PH8 A;  1ZYR D;  1O78 A;  4C3J B;  1IBK Q;  1QWY A;  1U4M A;  4LF7 L;  3K57 A;  2OCE A;  3R2I A;  5D3D A;  2VNU D;  1JT8 A;  3JAM c;  1HR0 L;  2IY5 B;  3M3Y H;  3HOZ G;  3Q0A A;  1O7I A;  2UXB L;  4LFB Q;  3S1M B;  1N36 Q;  1K3R A;  3NBH A;  1VQO A;  2N8N A;  3NXW A;  4A3F G;  2Z4H A;  4ZAI A;  1QCB D;  1NR2 A;  1WTH A;  3NSW A;  3GP7 A;  3OWE B;  3R3O A;  4BBS G;  2QIL A;  4JI2 L;  3VR3 A;  4A3J H;  1HUN A;  3CRL C;  2XSC A;  4TKO B;  3Q24 A;  4GZY C;  3JC6 6;  1CZG A;  2F0M A;  5BN3 A;  3I4N G;  4JI3 Q;  3LGJ A;  3FHW A;  3T1H L;  3PO3 H;  1UWV A;  4KY7 A;  3CQZ H;  2EE1 A;  3HFZ B;  1L2F A;  1FGU A;  1ET6 A;  2UUA L;  3K58 A;  4H44 C;  3S2H B;  3E6Z X;  1BKB A;  2KCT A;  2K05 A;  3EA6 A;  4KHV A;  1ASY A;  1VQG A;  3MXP A;  1VQJ A;  2F0L A;  1FYC A;  4MTN A;  2X69 A;  1WOC A;  1IBK L;  4IN3 A;  4DV1 Q;  5M3F B;  3A8I E;  1XPU A;  1PRT D;  4A4I A;  3A7A B;  2JYO A;  1RCV D;  2K28 A;  3NEM A;  3GO5 A;  2XGT A;  5G3L D;  4LFB L;  1D8L A;  1GD7 A;  5IIF A;  4BY1 H;  1H9S B;  3HOV H;  5CV8 A;  4X66 L;  1N36 L;  4QJF A;  2H5X A;  3G48 A;  4K6D A;  3C3L A;  2JEA I;  3CC7 A;  1SMX A;  1XX8 A;  1VQE A;  1XNQ Q;  1CM9 A;  1E24 A;  1S5D D;  4L5Q A;  2I5L X;  1HQM C;  3W1G A;  1JJ2 A;  1YJN A;  1X54 A;  4PMB A;  1IYJ B;  2IHF A;  4KKT A;  1AP0 A;  3IFT A;  1ENA A;  4NXN Q;  1D2B A;  3QO2 A;  5M5W H;  5HY6 A;  2JA8 B;  3N6R A;  1PH1 A;  4JI3 L;  4Y52 H;  1ZKO A;  1Y8O B;  3ERQ A;  2YTY A;  4R9W A;  3NQT A;  4G7O C;  1IW7 C;  4CJ0 B;  1G8Z D;  2F0W A;  1TKW B;  1I3Q H;  2IT1 A;  3KK7 A;  4LF4 Q;  2I07 B;  1K0R A;  1D5M C;  1KIX A;  4AYB G;  3I8Z A;  4GLV B;  2CH4 A;  2UUC Q;  1OTC A;  3J7A 5;  3S17 B;  2A68 D;  5GAG C;  2WFW A;  2ZJP A;  5DNF A;  5CBE E;  1PTO B;  3G71 A;  1BOS A;  4AIM A;  2B39 A;  4RGO S;  3CCJ A;  4PZ8 A;  1H9M A;  1CI3 M;  5DLQ E;  4YWM A;  3J80 i;  3MEF A;  3HOU B;  4RH6 A;  4R8I A;  4RGN A;  1ET9 A;  3P1H A;  3GTQ H;  1Y1V B;  1HA6 A;  1OXU A;  3CRK C;  1I94 L;  5IYB G;  3AB9 A;  4GS3 A;  2JE6 I;  3HGB A;  4O2D A;  2NB0 A;  2DUD A;  2ZXP A;  4DR7 Q;  4GLA C;  1XNQ L;  2R7F A;  3FMC A;  3J80 E;  1EOT A;  4Z9C B;  1EIY B;  2VQF Q;  3PIP A;  3ERS X;  4R4I A;  3F2B A;  1D7Q A;  2KHI A;  4X3S A;  4NXN L;  1RJT A;  4J15 A;  1VCI A;  1DYQ A;  1YVC A;  4GNX A;  1B44 D;  1YNN C;  2NWG A;  3VR2 A;  3NP8 A;  3D6C A;  1IL2 A;  1FJG Q;  1H9S A;  5L37 A;  1CHQ D;  4JCV E;  1N34 L;  4DR3 Q;  4XXE A;  3S1Q B;  1VS0 A;  1EQT A;  4EX5 A;  4OEM B;  4ZKC B;  1DCZ A;  4LF4 L;  4JPB W;  1EQR A;  1QUQ A;  2F3W A;  3GV6 A;  3W2D A;  4DXG A;  4PZ6 A;  2UUC L;  1SYB A;  3PUV A;  1M90 C;  1RIP A;  3L2P A;  3FEW X;  4FF4 A;  4IZ8 A;  3M3Y B;  3A8J E;  1EIF A;  1TWG H;  1PLF A;  3F2C A;  1XMQ Q;  3PO2 H;  3RN2 A;  1SE8 A;  1STE A;  2WAQ E;  2PNR C;  2GN5 A;  1RTO A;  2OT2 A;  4R4O A;  5IT9 c;  3KF6 B;  3CP0 A;  1KNA A;  4EGV A;  1XPO A;  1EY0 A;  5FLX E;  1Y8N B;  2KBN A;  3S16 B;  3P7J A;  2NZO A;  4A3J B;  2QDL A;  2JA6 H;  4DR7 L;  4RKL A;  4A3K B;  3QR8 A;  2QKI C;  3CC2 A;  2NVQ H;  5E3F A;  3M4O H;  4BA2 I;  4QF4 A;  1EWI A;  4WJW A;  3RLO A;  2RF4 A;  2VQF L;  2A19 A;  2PO4 A;  1TT2 A;  4ZYS A;  4CDE C;  2D0P A;  2LS0 1;  3ERO A;  4GNX C;  3PUZ A;  3PO3 B;  3TP7 A;  2X6G A;  3T13 A;  1K28 A;  1J8I A;  4RA8 A;  1TVX A;  1RD9 D;  4POG A;  3GDE A;  1LTI D;  4I7A A;  1U5K A;  4A3E G;  1SNM A;  2DN8 A;  1C0A A;  1FJG L;  4AYB E;  2OXP A;  1GJX A;  4F87 A;  1K73 C;  5FLM H;  1D6E C;  1ZXT A;  2JA5 H;  4APV A;  1DZ1 A;  4C3I G;  4B3S Q;  3F8T A;  2Z6K A;  3VA7 A;  4G7H C;  3RR5 A;  1Q82 C;  3J7A V;  4JI1 Q;  5JJZ A;  3QIA A;  1X9N A;  4HJA A;  4K0K Q;  4RWS C;  4Q5V A;  1L0Y B;  2K5D A;  2L11 A;  1MKH A;  1Y1W H;  2Z8L A;  1XMQ L;  1SEB D;  5A2Q E;  4QUF A;  1YJ9 A;  4BY1 B;  3HOV B;  5CV9 A;  3AU7 A;  2MPM A;  5DEH A;  4DKA C;  1F9S A;  4ZQ3 A;  4PG3 A;  4DF7 A;  1H95 A;  2QF7 A;  2LMC B;  3R93 A;  5CBA E;  1FNV A;  2K52 A;  1TR5 A;  1G6P A;  3TP8 A;  2XRQ D;  1PTO C;  4MZ9 A;  4IPD A;  3I4M G;  3DHQ A;  4CHT B;  5C0X G;  2XN9 C;  1KAW A;  5M5W B;  3S2D B;  1UEA B;  2B8F A;  1WCM G;  1PTO D;  5JOB A;  2IX0 A;  3FPP A;  3DXJ C;  4N9T A;  1EZ6 A;  3BYT B;  2J0T D;  3JAM i;  1RDP D;  2G5D A;  2Z6K C;  1I3Q B;  4P73 A;  3TBI B;  3NTI A;  4QQB X;  1LTG D;  4DN4 M;  3NE5 B;  4XIG S;  1SBB B;  1WTX A;  4A3M G;  1DXM A;  2NBF A;  2V4D A;  4BBR H;  1YIJ A;  2VS1 A;  3T1Y Q;  5M5Y H;  3BDL A;  3JAM E;  4HIM A;  1Q81 C;  3P75 A;  1JJG A;  4L8J A;  1D5X C;  1FNW A;  2NVY H;  2ZM6 Q;  2KUM A;  4FYD A;  1TU2 B;  3VR4 A;  2PW5 A;  3WDN A;  3GTQ B;  1UUP A;  2N55 A;  4U68 A;  1HA5 A;  4M8A A;  4JI0 L;  3CF5 A;  1A3U A;  1L1O A;  3SK6 A;  1WD1 A;  2KA7 A;  2RDH A;  2CHB D;  3HRZ C;  2JA7 G;  2DNC A;  5K36 G;  4HCS A;  3NWS A;  1VQA A;  1EFI D;  1QOH A;  2DY8 A;  5JJI A;  3CCV A;  3X3N A;  1GM5 A;  3Q6S A;  1PMR A;  1OXX K;  4ZKB B;  3EVQ A;  3FKI H;  4ME5 A;  3NUC A;  2F0E A;  3IRB A;  2O5J C;  3HOX H;  1WVL A;  3S1N H;  4JYA Q;  5K5P A;  3E5S A;  4OWW B;  3MTS A;  2D0O A;  1BNZ A;  4XTC S;  1JIC A;  3KJO A;  5COY A;  1IBM Q;  1ILQ A;  1WJJ A;  1G2S A;  4IO9 A;  5C6A A;  2FJ2 A;  3OSO A;  3RN5 A;  1A63 A;  2B2W A;  4BXX H;  1PH2 A;  1NMG A;  5LMN W;  1SYF A;  4IOA A;  2NVX H;  3OIQ A;  1TWG B;  1ONL A;  4CGY B;  5EJW A;  4U67 3;  2ZM6 L;  1F77 A;  4QGU A;  3K8A A;  5C4X H;  2IWH A;  1RL2 A;  2JN4 A;  1C48 A;  4C3J G;  1YI2 A;  1QZG A;  4A3B B;  2K5W A;  2FHT A;  3E9H A;  2JA6 B;  1S5F D;  2LFN A;  3HKZ E;  4KHP Q;  2NVQ B;  3M4O B;  3Q22 A;  3QWN A;  1G51 A;  1EU3 A;  1XTD A;  3M7G A;  4CKE A;  4NW2 A;  2R7Z H;  2EOT A;  3UDF A;  3CC4 A;  3H0G B;  1VMC A;  3TSS A;  4HJ5 A;  2PQA A;  1FGB D;  4B3M Q;  5EBD A;  1AH9 A;  4TRD A;  1EY4 A;  1ICF B;  4GLX A;  1VQM A;  4DR1 Q;  5CGK A;  2HIV A;  5I6W A;  4LAA A;  2R61 A;  2JA5 B;  1CZW A;  1S4Z A;  4NKL A;  1VQ8 A;  1EL0 A;  1STY A;  4HR7 B;  1SNQ A;  4MN3 A;  4B9W A;  3RLF A;  4DV6 L;  1B3A A;  1JMC A;  4C1N I;  1O7Y A;  2FIN B;  3NK9 A;  2IPK D;  2I5M X;  2Q8T A;  3L0O A;  4DV0 Q;  3GV3 A;  2N78 A;  1D1K A;  3OYY A;  2Q2I A;  3KUP A;  1I6V C;  3B6Y A;  4J8Q A;  1SJE D;  3DWQ A;  5IYC H;  4YCU A;  1W2B A;  3UE1 A;  3RZO B;  1VDZ A;  3K7A H;  3PCO B;  3MFY A;  2A5H A;  1EU4 A;  4G4K A;  2EY5 A;  1CK1 A;  1LYL A;  3A56 A;  2VUM H;  3ER0 A;  3GTO H;  1NE3 A;  1VQL A;  1HCZ A;  4KI0 A;  2IJ0 A;  2A8V A;  1VF7 A;  4KHP L;  1F2Z A;  1PV4 A;  3P20 A;  4DK0 A;  1B2T A;  1Q7Y C;  2D62 A;  2OTL A;  1QVG A;  3D6W A;  3VDY A;  1B53 A;  4B3M L;  3E3X A;  2AQ3 B;  2Z0S A;  2VW9 A;  1B8A A;  1FL0 A;  2P5Z X;  2JXM B;  3HKZ B;  3BYY B;  4X3T A;  1LTS D;  4DR1 L;  1S5E D;  3U4Z A;  1CFM A;  2SOB A;  3BZC A;  5KND A;  2OF1 A;  4DV5 Q;  5IOD A;  5DAU A;  1BCP C;  3KDF B;  2WAC A;  2JA8 G;  4X64 L;  4ZLT F;  2EQS A;  2OWO A;  4BBR B;  4IUV A;  4XYO A;  4ZK9 B;  5M5Y B;  3QJY A;  3QB3 A;  1LT4 D;  4OWT B;  3ICE A;  1E2Z A;  2GVA A;  1SE2 A;  1TWH H;  3W5O A;  4CKB A;  2XIW A;  5JEA H;  4A3D H;  2RCN A;  1E7Z A;  3HOY H;  5IT9 E;  3M4Y A;  2EYP A;  3R2T A;  1EY7 A;  1NAP A;  2Z1C A;  5D65 A;  1X6O A;  3MXG A;  4L6T B;  1IKL A;  3G6E A;  2PW7 A;  4M1U B;  1SMY C;  1EWC A;  3NTK A;  3AFP A;  1LLR D;  4N9P A;  1PH6 A;  3HOU G;  2F0D A;  3GTG B;  3H3V I;  3DM1 A;  3HEJ A;  3RNU A;  3AQQ A;  3WOE A;  1DOM A;  3JAM L;  1EYA A;  5EKL A;  4ME3 A;  3URY A;  4J1M A;  3HOW H;  1TS3 A;  4C2M H;  3HOX B;  3S1N B;  1E1T A;  1HH2 P;  3OMC A;  1HR0 W;  1KRT A;  1R9T H;  5I9P A;  1AN8 A;  1W3S A;  5IYD H;  1SE4 A;  2B63 H;  1XTC D;  4QL5 A;  2ENB A;  1HNX Q;  3OOC A;  1MSH A;  1WD0 A;  2HDM A;  4H0L C;  1N8R C;  1IL8 A;  1TXY A;  4V19 0;  1PYW D;  2AQ2 B;  4OO1 H;  1YEZ A;  2NVX B;  1C4Q A;  1I4X A;  4YCW A;  1J9O A;  5BR8 L;  3J81 c;  4RGM A;  4NPS A;  1PZK D;  1YIT A;  1G2T A;  2KJX A;  5C4X B;  4R4T A;  4UP9 A;  4JI5 Q;  3K7U C;  1OXT A;  1HPC A;  1K3B C;  1LV9 A;  4JI7 Q;  2K01 A;  1HNZ L;  2OQK A;  1N32 L;  1E0B A;  1ENC A;  2NYZ D;  4BS9 A;  5C4J B;  1X3F A;  3H91 A;  3RD4 A;  3CCU A;  4LF5 Q;  3GTL H;  4EQO A;  2WB1 B;  4TQU S;  3CCL A;  2OTJ A;  1BQQ T;  1S72 A;  1Q1E A;  5LL6 S;  1ML0 D;  3PGZ A;  2R7Z B;  4KHZ A;  1KLU D;  5FJ8 H;  1RHP A;  2MNA A;  2CWP A;  3TDQ A;  4NDX A;  1Z6H A;  4FVM A;  4A3K G;  3U50 C;  3SK4 A;  1JR0 D;  1PH7 A;  3UDI A;  5KNB A;  3A5U A;  4RFB A;  5IGB A;  4GOP A;  1U4L A;  2O2L D;  3PO3 G;  1W6J A;  1HUM A;  1N9W A;  1HNX L;  3PIP 3;  2ATW A;  4DPG A;  1VQD A;  2JQO A;  2R92 H;  2J4X A;  4QCL A;  1AW7 A;  2NTT A;  5M3M H;  5CR3 A;  2WKC A;  5BN4 A;  4JOI A;  3ITP A;  4DUY L;  3K7A B;  2EYJ A;  1DGS A;  4C3H B;  4HJ9 A;  3HOZ H;  1G29 1;  4C1N K;  1FNU A;  1K9M C;  4JI7 L;  4RCN A;  3CAM A;  4HIO A;  3GTO B;  5CV6 A;  2M00 A;  2F0S A;  4A3F H;  2NVT B;  1CKN B;  2BE5 C;  1Q86 C;  4LF5 L;  3M4Q A;  2OEO A;  4BY1 G;  1WTQ A;  3HOV G;  4YWK A;  2K5H A;  2LXJ A;  4BBS H;  2F0O A;  1NTG A;  2Y0S B;  3BDO A;  3OIP A;  3D4D A;  1C7Y A;  2F0Q A;  3PMF A;  1EYG A;  4IUP A;  4GNX B;  5ELC A;  4HTH A;  4X65 Q;  2OQ0 A;  5JAV A;  1TQO A;  5HGQ A;  5C44 H;  2XWJ B;  2IX1 A;  2WAQ G;  2WP8 J;  4GOP C;  2UU9 Q;  2SNS A;  2Q2H A;  1SFO H;  1E22 A;  2RVL A;  1QIL A;  4HCE A;  2MP1 A;  1YNJ C;  3PUX A;  1QUQ B;  1X55 A;  3CCQ A;  4A3C H;  1I6H H;  5GAD C;  2C5C A;  1BCP F;  2D9U A;  1CT1 D;  4JOI C;  5DM7 3;  3CPW A;  1L0X B;  1QNK A;  1V1P B;  4OHJ A;  3G7L A;  1KNE A;  4A3D B;  3HOY B;  3MEH A;  3ULL A;  1C9O A;  1I4H A;  2SDF A;  1I5F A;  4JI8 Q;  2CQO A;  5JPM C;  5JJL A;  2H4O A;  2K14 A;  5EPK A;  3MVV A;  3RZD B;  1YHQ A;  4JBM A;  1IW7 D;  1BXT A;  3KF8 A;  5J1Z A;  1F2L A;  1TS4 A;  1H9J A;  2E8G A;  3DEP A;  1WYD A;  4N8X 1;  4WJ3 M;  3W1B A;  1DOL A;  3H15 A;  2ZJR A;  1A3T A;  4DV1 L;  2B2Y A;  1GUN A;  1STH A;  4F8M A;  2QDB A;  1LT6 D;  1XNR Q;  3K5M A;  4C2M B;  3MWY W;  1KRS A;  3K0X A;  3SK8 A;  4X65 L;  1GKH A;  5IT9 L;  2F3V A;  3EIV A;  2F0I A;  2UU9 L;  1JCK B;  2Q8I B;  2Z4I A;  3UDG A;  2JEB I;  1JWM D;  1QJO A;  1CKN A;  1VMP A;  1WI5 A;  1SNP A;  1LTB D;  2ZXR A;  4MNO A;  4WFN 3;  2BOS A;  2MUY A;  4HMI A;  4DNT B;  1STA A;  4A3G G;  2A74 C;  1JQY D;  4I7Z C;  2BDO A;  2K32 A;  4JI8 L;  1SRU A;  4XT3 B;  4DV2 Q;  1YNN D;  2F4V Q;  2RDG A;  3K0Y A;  1RF2 D;  3DM3 A;  5ISR A;  2PZT A;  5LMU Q;  2V1C C;  2MGS A;  1I4P A;  3TN2 A;  1T5X D;  2YTX A;  1ESF A;  2B2Y C;  4DFA A;  5EGT A;  3TRE A;  3LWE A;  3M85 A;  2HT1 A;  4P72 A;  4RAU C;  1KXL A;  4OX9 Q;  4UAI A;  2GVB A;  4RMF A;  1V1P A;  3CCE A;  1V1O A;  2EYM A;  4A3B G;  2UUB Q;  2JA6 G;  1ICW A;  5C4H A;  2F0T A;  1XNR L;  2EJF C;  1MJE A;  4LFA Q;  3ULP A;  3PQI A;  1B50 A;  3NBI A;  2XNA C;  4DV7 Q;  4RHS A;  3S24 A;  2LXK A;  3H0G G;  4JV5 Q;  1SYG A;  1MHW C;  5IP9 H;  2Z6B A;  1ILP A;  2R92 B;  2YV5 A;  1F9P A;  2NUC A;  5E4W C;  5M3M B;  3CMA A;  1TS2 A;  5FLM G;  4A3I H;  3VYS A;  1XJV A;  1CQF A;  4LF6 Q;  4NP5 A;  3CQZ B;  2JA5 G;  5JJK A;  2DJF C;  1D1I A;  1RTN A;  3I73 A;  1UE7 A;  3E0E A;  1S3O A;  4R8N A;  1L1O B;  4RHR A;  1CQV A;  1W6K A;  3W3A A;  3T16 A;  2B2U A;  4OL7 A;  3AMU A;  2F4V L;  4DR3 L;  1ENF A;  1EY8 A;  2MJ8 A;  3OMG A;  2F3I A;  1UE5 A;  4BBS B;  3I72 A;  4LFC Q;  2ZTE A;  4DUZ Q;  2WII B;  2PZW A;  4K2K A;  4OX9 L;  1BBX C;  1GUG A;  3DEO A;  3KJP A;  5C44 B;  3ONA B;  2UUB L;  1QG7 A;  3I4L A;  4EQN A;  4A3L G;  2FXQ A;  4LFA L;  4DR4 Q;  4TSS A;  1HFG A;  4DV7 L;  2SNM A;  2VB2 X;  3K6O A;  3BU2 A;  4A3E H;  3LNN A;  4AH6 A;  1I6H B;  4JV5 L;  1PVO A;  4N8F A;  5ELE A;  3ND9 A;  4C3I H;  5JEA J;  1PRT F;  3HKZ G;  5J3B A;  4LK1 C;  4G7Z C;  1MSG A;  1EUJ A;  1VQ6 A;  3VR5 A;  5JVH 3;  4J6H A;  3SR1 A;  1KC8 C;  1HNW Q;  2PZU A;  3I3C A;  1CKM A;  1BBU A;  2B2U C;  1O7L A;  1B9N A;  4K6L A;  4BBR G;  1KL9 A;  2VB3 X;  4IUT A;  4DA2 A;  2O4X A;  2B8G A;  2AMC B;  1Y8P B;  3RLN A;  5EPL A;  4DAM A;  4B3S L;  2K1B A;  1JE5 A;  4JI1 L;  1A8V A;  4RGT A;  2L9H A;  4K14 A;  3V2T A;  3D0F A;  5IP7 G;  2BA0 A;  4K0K L;  2PQA B;  3GQB A;  1B4O A;  1SXT A;  4DUZ L;  4LNQ A;  1U4R A;  3I4M H;  3L3O C;  5C0X H;  3M9B A;  4HN7 A;  2EDG A;  1J5E Q;  2E2J H;  4MHE A;  4DNR B;  4YHH Q;  5IE8 A;  1HFN A;  4DK3 C;  2M9V A;  1UE1 A;  1M8A A;  1X3Q A;  4P74 A;  4DR4 L;  2F1M A;  1X3E A;  4IFD H;  5TSS A;  3GTK H;  4FF3 A;  1CKO A;  4UP8 A;  3I2Z A;  2GA4 B;  1BCP B;  2E76 C;  4XYQ A;  1T9H A;  5IGC A;  4DK6 C;  3HOX G;  5C3X A;  2YTV A;  4DR6 Q;  2EXZ A;  4H13 C;  3IAY A;  1HNW L;  1Q90 A;  1KDA A;  1X65 A;  2L12 A;  3UDX A;  3HS0 C;  1VQC A;  1WTR A;  5I4D A;  5I9O A;  3CXC A;  4K8I A;  2BH8 A;  2LY7 A;  1TWA H;  1EEF D;  2A1A A;  3U58 A;  3H3V H;  1EY5 A;  3G4S A;  2KEE A;  5I2Y A;  1YHB A;  5C4X G;  1CA5 A;  2G9D A;  1IYV A;  4H7B A;  2RHS B;  3I4O A;  1JB7 A;  5AJ3 Q;  4HID A;  1DON A;  3T1Y L;  2JA7 H;  3PO2 B;  5K36 H;  4OXP A;  4WOR A;  5C5M A;  5LMN Q;  5IWA Q;  2DNE A;  1PFM A;  2NN6 H;  1L1O C;  1P16 A;  1WFQ A;  4FXK C;  1MI2 A;  1UE6 A;  2LSS A;  3NWT A;  3S14 H;  3MC0 B;  3N52 A;  2R7Z G;  2ZT9 C;  1N33 Q;  1SR3 A;  2KED A;  1G6Z A;  1EY9 A;  2EPB A;  3HKS A;  4YWL A;  2LKV A;  2ALY B;  2YYZ A;  2Z9H A;  1LTR D;  2KEN A;  2UXD Q;  1KQS A;  4B3R Q;  4A3I B;  3EBE A;  5FO9 B;  5FO8 B;  4QB4 A;  5C3E H;  2EXD A;  4UPA A;  4DR6 L;  2MFI A;  3CHB D;  2HCC A;  5HGT A;  1TS5 A;  3J7A F;  2E2D C;  4KN4 C;  2L0C A;  1IBL Q;  1I50 H;  3BJU A;  1T5E A;  4JYA L;  2B2W C;  2EJG C;  4NMZ A;  4XQN A;  5IYC G;  4DV3 Q;  1RKN A;  3BZD B;  4GKJ Q;  1K8O A;  1IBM L;  4HED A;  1BDO A;  1SNC A;  4ABN A;  2PCF B;  1VQH A;  3H6M A;  4C3H G;  2K75 A;  4A93 H;  1EIH A;  4P71 A;  4IQZ A;  1QVF A;  1YHA A;  2CCZ A;  5AJ3 L;  1Y1W B;  4NXM Q;  3DWP A;  3S1R H;  2FFK B;  1B3Q A;  3TME A;  1LT5 D;  4O42 A;  2CW0 C;  4KTA A;  4XQJ A;  4LW1 A;  3WWV A;  5LMN L;  5IWA L;  2FMC A;  5JVG 3;  4DGZ A;  2RCF A;  4BY7 H;  2RA4 A;  1XMO Q;  3VYU A;  4A76 A;  1S40 A;  5M3F G;  1U0L A;  1SDF A;  4IUQ A;  5IGG A;  1Q1B A;  1N33 L;  1Z9F A;  1Y14 B;  2N88 A;  4B3T Q;  4JBJ A;  2R93 H;  2RHQ B;  3ZJY C;  2A6H C;  1PA6 A;  2UXD L;  4B3R L;  1KDC A;  1IKM A;  2L55 A;  1Z7T A;  2B2T A;  3C2P A;  3TS0 A;  5M9O A;  1XWE A;  5EKI A;  1PXU A;  1WTO A;  4Y7N H;  1LT3 D;  3A55 A;  1IBL L;  4FXD A;  4F88 A;  5KEE A;  2DY7 A;  1SNO A;  1GUT A;  4GKJ L;  4A3D G;  5ELF A;  4CDC C;  4LF8 Q;  3HOY G;  1EZ8 A;  3OHX C;  1BCP D;  3FP9 A;  4BWG B;  2K5N A;  4X6A H;  3OPO A;  3PUW A;  2ZTD A;  1BVS A;  4DV0 L;  3J81 L;  2NVY B;  2WB1 E;  1AZQ A;  4NXM L;  4JI4 Q;  2ES2 A;  2E2J B;  1QNU A;  3DMU A;  1PH4 A;  5KNC A;  4EQP A;  4HMJ A;  5KRU A;  1LAC A;  3SE0 A;  4JW0 A;  1GOZ A;  4ZUJ A;  4GOP B;  1XMO L;  1K83 H;  3H94 A;  4P2C B;  2F0F A;  3K5N A;  4MTK A;  5M5X H;  3NEL A;  5FKA C;  1SMY D;  4LJZ C;  4KJN A;  1PRT B;  1PDQ A;  4B3T L;  1Y1V G;  1K8A C;  3QOJ A;  5ELD A;  5IY0 A;  5C3W A;  2B2T C;  1SJH D;  4HAE A;  4QUC A;  3TEH B;  5IYD G;  4K5V A;  1YJW A;  3EQL C;  1E1O A;  3FKI B;  5KYL A;  2UXC Q;  3VYT A;  1O7Z A;  1TWF H;  2EYO A;  1Q8K A;  3SK5 A;  2AUJ D;  4RCO A;  4OGQ C;  4LUZ A;  1TWA B;  2PQE A;  1HTP A;  5ELB A;  1BF4 A;  4DV5 L;  1HR0 Q;  1EWH A;  1EYD A;  1NBW A;  5IGE A;  1VQP A;  1D5Z C;  4KKS A;  5FO7 B;  1KAB A;  4YCV A;  2UXB Q;  1M1K C;  3STB C;  3L9A X;  2HIX A;  2L4N A;  4KJO A;  2K33 A;  1LUZ A;  3V05 A;  3HOU H;  2AKW B;  1DM0 B;  4I65 A;  5LL6 X;  3E9I A;  4PNY A;  4R1J A;  4JI4 L;  1JWS D;  1JOO A;  1NY4 A;  1TY0 A;  1V9P A;  2L5T A;  5ELN A;  3S14 B;  4JI2 Q;  4DV4 Q;  2Y0S E;  5DM6 3;  2WKD A;  3CCS A;  4WRD A;  5FJ8 G;  1B70 B;  4ZCK A;  4CJ1 B;  1SE3 A;  3T1H Q;  4FNF A;  3U9S A;  2R7D A;  2KHS A;  1FD7 D;  1WTP A;  5D3I B;  4DK1 A;  2XRS D;  2D5D A;  5C3E B;  3F2D A;  2B29 A;  2HDL A;  1QE6 A;  1V43 A;  4RG1 A;  1V1Q A;  3GTM H;  3K5L A;  4A3J G;  1SRO A;  1U4P A;  2ZJQ A;  3S1Q H;  2AHO B;  3OW7 A;  3OTO Q;  2ZTC A;  3DUZ A;  3HG9 A;  5GQO A;  1KDB A;  3A74 A;  5M3M G;  2QW7 A;  3EJI A;  4GN5 A;  3KF8 B;  1G91 A;  4H02 A;  1HHV A;  1B9M A;  4L5S A;  4IUU A;  1GVP A;  4IPC A;  4A93 B;  4TVA B;  2KOL A;  1EQV A;  1STB A;  3S1R B;  4X66 Q;  1HZB A;  4ZRZ A;  1YZ6 A;  1JB3 A;  3V96 A;  1KLG D;  4CJ2 C;  2YU9 H;  2BA1 A;  2QGQ A;  4JI5 L;  1NR4 A;  4LF9 Q;  3CD6 A;  3S16 H;  4BY7 B;  1PFS A;  2VZA A;  4DV4 L;  4LUO A;  2VUM B;  4A3K H;  4DAP A;  3E0J A;  1I4R A;  5C44 G;  2KHJ A;  1JWU D;  4FF2 A;  2BE5 D;  1AE3 A;  1NSN S;  2R93 B;  1EIG A;  1A0I A;  1ESR A;  3TZD A;  3SXH A;  1VQ4 A;  5LHY 1;  3G6J B;  4A3C G;  1JC7 A;  4JG2 A;  3I4N H;  2KEC A;  1YNX A;  1OXV A;  2XWB B;  2MQH A;  4L63 B;  4Y7N B;  1GHK A;  4HJ8 A;  1LAB A;  3OW2 A;  3OTO L;  3BVM A;  3IKJ A;  1NMF A;  5GRO A;  1M4V A;  4XQQ A;  1Y69 U;  1YBY A;  4B9X A;  2K50 A;  1PRT C;  4IJH A;  5IOC A;  2JK8 A;  3MXN B;  4PV1 C;  5J39 A;  3TS2 A;  1STN A;  1YNJ D;  3GD7 A;  5C0X J;  1HXY D;  1PYB A;  3L7Z C;  1UAP A;  1TWH B;  1MGS A;  3D4W A;  1Q12 A;  1I94 Q;  2HQL A;  2NZ1 D;  4IFD J;  1LTA D;  4OIK A;  1SSO A;  4ULL A;  1EY6 A;  4XDX A;  5CYU A;  3H3V C;  4LF9 L;  3TP5 A;  1K83 B;  3A0J A;  2AQ1 B;  5NUC A;  3QOL A;  1HRJ A;  2NTS A;  1C8C A;  2CH4 W;  5M5X B;  2RKS A;  2F0V A;  2F0G A;  2HHH Q;  2HQE A;  3A8K E;  1NCV A;  2JSO A;  1LO5 D;  1AZP A;  2TMP A;  4LWC A;  3S2D H;  3ULJ A;  3DLL A;  5F2D A;  3PF5 A;  2F0K A;  2PI2 A;  1A6X A;  1AFP A;  1IYU A;  2O5I C;  2RBM A;  2WV6 D;  3HOW B;  3Q8D A;  1N34 Q;  4JI6 Q;  2A69 C;  2HD3 A;  3D4R A;  3M4P A;  1TWF B;  3VYR A;  1I4G A;  3IFD A;  2A69 D;  1R9T B;  2A68 C;  3LX0 A;  5I2X A;  1VQ9 A;  2B63 B;  3SVM A;  4IUN A;  1KHI A;  3C46 A;  2K04 A;  1PH3 A;  2C35 B;  3PUY A;  3SGI A;  1DOK A;  5IGF A;  4OO1 I;  1PZI D;  1DJR D;  3BZK A;  1CA6 A;  4QMG A;  3VR6 A;  4CBV A;  1AEX A;  5ELO A;  1EYC A;  5E7N A;  4QIW E;  1O80 A;  2VQE Q;  1MBY A;  1QZH A;  3F1Z A;  2MHV A;  3SHL A;  3UE0 A;  2E2H H;  1OXS C;  5C5L A;  3J7Y W;  2HUG A;  4OEL B;  4UHV A;  3PO2 G;  3KLW A;  3GTL B;  1TWC H;  4K2L A;  5IYB H;  3KBX A;  2HHH L;  3MXN A;  1EFW A;  3BDC A;  1X32 A;  3S15 H;  2ID0 A;  1CHP D;  3KFU A;  2MO0 A;  4ILW A;  2RSO A;  1Q3L A;  5BN5 A;  3GTM B;  4JI6 L;  4KN7 C;  1XPR A;  5IP9 G;  5T1G A;  3KBG A;  3GTP H;  2NZH A;  2CQA A;  2EY1 A;  3KLR A;  4A3G H;  2EYF A;  4ZUI A;  3MFG A;  4A3I G;  5CC4 A;  1VQK A;  3IL8 A;  4L5R C;  2I46 A;  1WTV A;  1HZC A;  3WOF A;  3T51 B;  4CDF C;  2EYL A;  2PPB C;  3I70 A;  2KQ3 A;  2CKZ B;  3AFQ A;  1SN8 A;  5JPN C;  3I56 A;  1WTW A;  3BVG A;  2YU9 B;  4X3K A;  3HOZ B;  2KCM A;  4A3B H;  3KLS A;  4ODG A;  2PNH A;  2VQE L;  3PIO 3;  5EBC A;  3K5O A;  4DR5 Q;  1PFB A;  4DV2 L;  5E4X A;  4A3F B;  1GUO A;  1TY2 A;  1NJI C;  1Y1W G;  4DAY B;  5LMU L;  5I6Y A;  5E1F A;  2G9H D;  3CU7 A;  4IUR A;  3H0G H;  1XXG A;  1VQF A;  1HJP A;  3RMH A;  3TRZ A;  3T4A C;  1MD2 D;  4QIW B;  4X62 Q;  1SND A;  2JJQ A;  4UDU C;  3TP6 A;  2F03 A;  4KKU A;  4NB3 A;  3I4N B;  1SYE A;  3HZX A;  3I90 A;  1GXD C;  2AUK A;  3LWU A;  3J81 i;  4G57 A;  4KK7 A;  3C1E A;  2A6E C;  1SFO B;  5CV5 A;  5D14 A;  3K81 C;  4V0B A;  2F0J A;  1E2W A;  1F2Y A;  4JBK A;  2A6E D;  4DR2 Q;  2QCP X;  4HSP A;  2Q2T A;  3R8B A;  3BG3 A;  3F2U A;  2J7Z A;  1GHJ A;  3FPU B;  1ZEQ X;  2CWA A;  4IJL A;  3J81 E;  5GAH C;  3Q23 A;  3RZO H;  1B1Z A;  1LM0 A;  4JI0 Q;  5G3L F;  1P8L A;  1KD1 C;  3CW2 C;  1QVC A;  2WIN B;  4LF6 L;  1F2M A;  4RKB A;  2FMM A;  2VXW A;  3BS1 A;  4EQ5 A;  1CSP A;  3D3R A;  3FDT A;  3S9W A;  2AWO A;  2WAQ B;  4HSV A;  4DR5 L;  4A3L H;  1IXR A;  2B3G A;  4HJ7 A;  3ND8 A;  1A62 A;  2R6G A;  1SYC A;  3K59 A;  1H9R A;  3U9O A;  1VQ7 A;  2K6A A;  2VY3 A;  4DNI A;  3U4V A;  4FF1 A;  4IFD G;  2SEB D;  4LFC L;  4X62 L;  1VF5 C;  1IZ6 A;  3KF6 A;  4KY6 A;  4UP7 A;  2I5H A;  4AQY Q;  1UNS A;  1WCM H;  1QB5 D;  3MHB A;  1JJC B;  2L15 A;  1PZJ D;  1VQN A;  4LUV A;  1VQ5 A;  3PSI A;  1Q8I A;  1CTM A;  4DR2 L;  4IPH A;  1PH9 A;  4DAY A;  1E2V A;  3FKI G;  2ICI A;  4AYB B;  4DAV A;  2RSN A;  1KTK A;  1V8Q A;  1L0W A;  4A3M H;  5FK9 C;  1Z47 A;  4F7X A;  2E2I H;  4PZ7 A;  2X6L A;  4YY3 Q;  3NEN A;  5IP7 H;  1A2U A;  1JE4 A;  4BXX G;  1BO0 A;  1X3G A;  2E2H B;  4GKK Q;  3EN2 A;  1GUS A;  1FVI A;  3PIO A;  2M2L A;  1TWC B;  1SYD A;  3GTG H;  2EVB A;  2NN6 G;  1KAA A;  3I55 A;  3S15 B;  2K4K A;  3SEB A;  1ROD A;  1A3V A;  3NPP A;  2F4I A;  4PMC A;  4CKC A;  2D2C C;  1BUV T;  4LMQ D;  4KY5 A;  2E5L Q;  2F0N A;  1HZ9 A;  1R4Q B;  2K03 A;  5CV4 A;  2VL6 A;  2WB1 G;  1J5E L;  3GTP B;  2XTI A;  4PMW A;  4DV6 Q;  4AQY L;  3AEV A;  4YHH L;  4A3G B;  4IPG A;  5EAY A;  4MIU A;  3ZYY X;  4A75 A;  5C3E G;  1F9Q A;  3J80 L;  5COR A;  3NHH A;  1LTL A;  4GN4 B;  1A2T A;  2B2V A;  4X3U A;  3QG1 A;  1VQI A;  4FDB A;  2R3Z A;  1MJC A;  1X3P A;  4JK1 C;  1TII D;  1LTT D;  1E3P A;  5FOB B;  4QY7 A;  3GTJ H;  1AE2 A;  3A54 A;  4YY3 L;  3KOJ A;  4DXF A;  1HZA A;  1SAP A;  4EVO A;  3SDZ A;  5C4J H;  1FR3 A;  4K8J A;  4KV6 A;  3CKI B;  3NTH A;  4A93 G;  4GKK L;  1R4P B;  5C4Z A;  3PV0 A;  4C3J H;  5KIX A;  5GAE C;  2IX3 A;  3RUZ A;  3C1F A;  1K0S A;  2F0H A;  3OWF A;  2PMZ E;  2TSS A;  3EFX D;  3CME A;  1JOK A;  3T56 B;  4WJ4 A;  4BY7 G;  4KMU C;  3D31 A;  1SLJ A;  4UY8 C;  3S1M H;  2VUM G;  1S5B D;  1H9K A;  3AYH B;  4CDD C;  2JP1 A;  3K80 C;  2Q2U A;  4OWX B;  2E5L L;  1J6Q A;  3MAQ A;  5FLX L;  2CW0 D;  4X64 Q;  3CCR A;  2B2V C;  2R93 G;  1EOV A;  3J80 c;  4A3E B;  2Y0S G;  4L5T A;  3NQI A;  3H09 A;  4P75 A;  2E74 C;  3MA2 B;  1EEI D;  2JA9 A;  4C3I B;  2BDN A;  1X56 A;  2F0U A;  4JVZ A;  3FVQ A;  4ALP A;  3MXU A;  4C3H H;  4E6I A;  3MZ5 A;  2ASB A;  3I91 A;  2A6H D;  4R4C A;  5KGU A;  2BH2 A;  3S2H H;  4B08 A;  1JOR A;  2EY6 A;  2NVT H;  3DWA A;  2K7V A;  2A73 B;  1I4Q A;  2AWN A;  3M7N A;  1STG A;  3I7F A;  4DV3 L;  5EKK A;  2RDF A;  2QEX A;  2IHE A;  2KVM A;  5T1I A;  5JEA G;  4S3S A;  5J22 A;  1PFN A;  2L1B A;  4FO2 A;  4O0A A;  5M3F H;  1PTO F;  4OIJ A;  3BVZ A;  3J81 j;  3HP3 A;  2E75 C;  3I4M B;  1NUC A;  3A5Z B;  1II3 A;  5EPJ A;  1CSQ A;  5A2Q L;  1HQR D;  4DU9 A;  4POF A;  1WCM B;  5C0X I;  2DJG C;  2C9O A;  5FLX c;  1BBW A;  3TQY A;  3KLS X;  4XT1 B;  5KYI A;  2PMZ B; 
#chains in the Genus database with same CATH homology
 2K5Q A;  3UI2 A;  3TZU A;  4PQX A;  1HTL D;  3D8G A;  3GTK B;  3A7L A;  4IFD I;  2BCO A;  2H1E A;  5AFW A;  4KD3 A;  2RQX A;  5CV7 A;  4A3M B;  2XVS A;  2E2I B;  2IL8 A;  2EJM A;  1DD2 A;  3VA5 A;  5EQ0 A;  2ZXO A;  1A15 A;  2Q8R E;  4OO1 G;  4K5W A;  2EY2 A;  2HCI A;  2IW3 A;  5HUR A;  3FRP B;  4C56 C;  4BA1 I;  1K8M A;  1BR9 A;  1PTO H;  2PYK A;  2JA7 B;  2EZV A;  1IHZ A;  3X3M A;  5A35 A;  4K5X A;  2F0P A;  1F9R A;  2KCC A;  2NN6 I;  2ICE C;  1JOQ A;  1U9R A;  1OO9 B;  4O1N A;  4ID6 A;  2QEJ C;  4Q0F A;  4YIJ A;  2KCN A;  4FXG C;  1GUW A;  4FP5 D;  4IAL A;  3GTJ B;  3T53 B;  4JBW A;  5CMD A;  1ZYR C;  2EYH A;  1XYI A;  5IGD A;  4KD4 A;  1I50 B;  2CVR A;  1S5C D;  3O13 A;  1ZYR D;  1O78 A;  4C3J B;  1QWY A;  1U4M A;  3K57 A;  3R2I A;  5D3D A;  2VNU D;  3Q0A A;  3S1M B;  3NBH A;  3NXW A;  2Z4H A;  4ZAI A;  1QCB D;  1NR2 A;  3NSW A;  3GP7 A;  3OWE B;  3R3O A;  2QIL A;  3VR3 A;  1HUN A;  3CRL C;  2XSC A;  4TKO B;  3Q24 A;  4GZY C;  1CZG A;  2F0M A;  5BN3 A;  4KY7 A;  2EE1 A;  1ET6 A;  3K58 A;  4H44 C;  3S2H B;  3E6Z X;  2K05 A;  3EA6 A;  4KHV A;  3MXP A;  2F0L A;  1FYC A;  2X69 A;  4IN3 A;  5M3F B;  3A8I E;  1PRT D;  3A7A B;  2JYO A;  1RCV D;  2K28 A;  3GO5 A;  5G3L D;  5IIF A;  1H9S B;  5CV8 A;  4K6D A;  3C3L A;  2JEA I;  1XX8 A;  1CM9 A;  1S5D D;  1HQM C;  4PMB A;  4KKT A;  1AP0 A;  3IFT A;  1ENA A;  1D2B A;  3QO2 A;  2JA8 B;  3N6R A;  1ZKO A;  1Y8O B;  3ERQ A;  4R9W A;  3NQT A;  4G7O C;  1IW7 C;  4CJ0 B;  1G8Z D;  2F0W A;  1TKW B;  2IT1 A;  3KK7 A;  2I07 B;  1D5M C;  3I8Z A;  3S17 B;  2A68 D;  5DNF A;  5CBE E;  1PTO B;  1BOS A;  2B39 A;  4RGO S;  1H9M A;  1CI3 M;  3HOU B;  4RH6 A;  4R8I A;  4RGN A;  1ET9 A;  3P1H A;  1Y1V B;  1HA6 A;  1OXU A;  3CRK C;  3AB9 A;  2JE6 I;  3HGB A;  2NB0 A;  2ZXP A;  3FMC A;  3J80 E;  1EOT A;  4Z9C B;  4X3S A;  1RJT A;  1VCI A;  1DYQ A;  1B44 D;  1YNN C;  2NWG A;  3VR2 A;  3NP8 A;  3D6C A;  1H9S A;  1CHQ D;  4XXE A;  3S1Q B;  1EQT A;  4ZKC B;  1DCZ A;  2F3W A;  3GV6 A;  3W2D A;  4DXG A;  1SYB A;  3PUV A;  3FEW X;  4FF4 A;  4IZ8 A;  3M3Y B;  3A8J E;  1PLF A;  1STE A;  2PNR C;  1RTO A;  2OT2 A;  1KNA A;  4EGV A;  1EY0 A;  5FLX E;  1Y8N B;  3S16 B;  3P7J A;  4A3J B;  4RKL A;  4A3K B;  2QKI C;  5E3F A;  4BA2 I;  4QF4 A;  4WJW A;  2PO4 A;  1TT2 A;  4ZYS A;  3ERO A;  2LS0 1;  3PUZ A;  3PO3 B;  3TP7 A;  2X6G A;  3T13 A;  1J8I A;  4RA8 A;  1TVX A;  1RD9 D;  1LTI D;  1SNM A;  2DN8 A;  1GJX A;  2OXP A;  4F87 A;  1D6E C;  1ZXT A;  1DZ1 A;  4C3I G;  3VA7 A;  4G7H C;  3J7A V;  5JJZ A;  3QIA A;  4RWS C;  4Q5V A;  1L0Y B;  2K5D A;  2L11 A;  2Z8L A;  1SEB D;  5A2Q E;  4QUF A;  4BY1 B;  3HOV B;  5CV9 A;  3AU7 A;  2MPM A;  5DEH A;  1F9S A;  4ZQ3 A;  4DF7 A;  2QF7 A;  2LMC B;  3R93 A;  5CBA E;  1FNV A;  1TR5 A;  3TP8 A;  2XRQ D;  1PTO C;  3DHQ A;  4CHT B;  5C0X G;  2XN9 C;  5M5W B;  3S2D B;  1UEA B;  2B8F A;  1PTO D;  5JOB A;  2IX0 A;  3FPP A;  3DXJ C;  4N9T A;  1EZ6 A;  3BYT B;  2J0T D;  1RDP D;  1I3Q B;  3TBI B;  3NTI A;  1LTG D;  4DN4 M;  3NE5 B;  4XIG S;  1SBB B;  1WTX A;  1DXM A;  2NBF A;  2V4D A;  3BDL A;  3JAM E;  3P75 A;  4L8J A;  1D5X C;  1FNW A;  2KUM A;  4FYD A;  1TU2 B;  3VR4 A;  2PW5 A;  3WDN A;  3GTQ B;  1UUP A;  2N55 A;  4U68 A;  1HA5 A;  4M8A A;  1A3U A;  3SK6 A;  1WD1 A;  2KA7 A;  2RDH A;  2CHB D;  3HRZ C;  2DNC A;  5K36 G;  4HCS A;  3NWS A;  1EFI D;  1QOH A;  2DY8 A;  3X3N A;  3Q6S A;  1PMR A;  1OXX K;  4ZKB B;  3EVQ A;  4ME5 A;  3NUC A;  2F0E A;  2O5J C;  1WVL A;  5K5P A;  3E5S A;  3MTS A;  1BNZ A;  4XTC S;  1JIC A;  5COY A;  1ILQ A;  1G2S A;  5C6A A;  2FJ2 A;  3OSO A;  2B2W A;  1SYF A;  3OIQ A;  1TWG B;  1ONL A;  4CGY B;  5EJW A;  4U67 3;  1F77 A;  2IWH A;  1C48 A;  4C3J G;  4A3B B;  2K5W A;  2FHT A;  2JA6 B;  1S5F D;  2LFN A;  2NVQ B;  3M4O B;  3Q22 A;  3QWN A;  1EU3 A;  3M7G A;  4CKE A;  4NW2 A;  2EOT A;  3H0G B;  1VMC A;  3TSS A;  1FGB D;  5EBD A;  4TRD A;  1EY4 A;  5CGK A;  5I6W A;  4LAA A;  2R61 A;  2JA5 B;  1CZW A;  1S4Z A;  4NKL A;  1EL0 A;  1STY A;  4HR7 B;  1SNQ A;  4MN3 A;  4B9W A;  3RLF A;  1B3A A;  4C1N I;  1O7Y A;  2FIN B;  3NK9 A;  2IPK D;  2Q8T A;  3GV3 A;  1D1K A;  3KUP A;  1I6V C;  4J8Q A;  1SJE D;  3DWQ A;  3RZO B;  1VDZ A;  3MFY A;  2A5H A;  1EU4 A;  4G4K A;  2EY5 A;  1CK1 A;  3A56 A;  1HCZ A;  4KI0 A;  2IJ0 A;  1VF7 A;  1F2Z A;  3P20 A;  4DK0 A;  1B2T A;  2D62 A;  3D6W A;  1B53 A;  2AQ3 B;  2JXM B;  3HKZ B;  3BYY B;  4X3T A;  1LTS D;  1S5E D;  1CFM A;  2SOB A;  5KND A;  2OF1 A;  5IOD A;  5DAU A;  1BCP C;  2WAC A;  4ZLT F;  4BBR B;  4IUV A;  4XYO A;  4ZK9 B;  5M5Y B;  3QJY A;  3QB3 A;  1LT4 D;  1E2Z A;  1SE2 A;  4CKB A;  2XIW A;  5JEA H;  5IT9 E;  3M4Y A;  2EYP A;  3R2T A;  1EY7 A;  1NAP A;  2Z1C A;  5D65 A;  3MXG A;  4L6T B;  1IKL A;  2PW7 A;  4M1U B;  1SMY C;  1EWC A;  3NTK A;  1LLR D;  4N9P A;  2F0D A;  3GTG B;  3DM1 A;  3HEJ A;  3WOE A;  1DOM A;  3JAM L;  1EYA A;  5EKL A;  3URY A;  4J1M A;  1TS3 A;  3HOX B;  3S1N B;  3OMC A;  5I9P A;  1AN8 A;  1SE4 A;  1XTC D;  2ENB A;  3OOC A;  1MSH A;  1WD0 A;  2HDM A;  4H0L C;  1IL8 A;  4V19 0;  1PYW D;  2AQ2 B;  4OO1 H;  2NVX B;  1C4Q A;  1I4X A;  1J9O A;  4RGM A;  1PZK D;  1G2T A;  2KJX A;  5C4X B;  1HPC A;  1OXT A;  1LV9 A;  2K01 A;  1E0B A;  1ENC A;  2NYZ D;  4BS9 A;  5C4J B;  3H91 A;  3RD4 A;  4EQO A;  2WB1 B;  4TQU S;  1BQQ T;  1Q1E A;  5LL6 S;  1ML0 D;  2R7Z B;  4KHZ A;  1KLU D;  1RHP A;  3TDQ A;  4NDX A;  1Z6H A;  4FVM A;  3SK4 A;  1JR0 D;  5KNB A;  4RFB A;  5IGB A;  1U4L A;  2O2L D;  1W6J A;  1HUM A;  3PIP 3;  2J4X A;  4QCL A;  1AW7 A;  2NTT A;  5CR3 A;  2WKC A;  5BN4 A;  3ITP A;  3K7A B;  2EYJ A;  4C3H B;  1G29 1;  4C1N K;  1FNU A;  4RCN A;  3GTO B;  5CV6 A;  2M00 A;  2F0S A;  2NVT B;  2BE5 C;  2OEO A;  1WTQ A;  2F0O A;  2Y0S B;  3BDO A;  3OIP A;  3D4D A;  2F0Q A;  3PMF A;  4IUP A;  5ELC A;  4HTH A;  5JAV A;  1TQO A;  2XWJ B;  2IX1 A;  2WP8 J;  2SNS A;  2RVL A;  1QIL A;  4HCE A;  2MP1 A;  1YNJ C;  3PUX A;  2C5C A;  1BCP F;  2D9U A;  1CT1 D;  5DM7 3;  1L0X B;  1QNK A;  1V1P B;  4OHJ A;  3G7L A;  1KNE A;  4A3D B;  3HOY B;  3MEH A;  1I4H A;  2SDF A;  5JPM C;  2H4O A;  5EPK A;  3MVV A;  3RZD B;  1IW7 D;  1BXT A;  3KF8 A;  5J1Z A;  1F2L A;  1TS4 A;  1H9J A;  3DEP A;  1DOL A;  1A3T A;  2B2Y A;  1GUN A;  1STH A;  4F8M A;  2QDB A;  1LT6 D;  3K5M A;  4C2M B;  3MWY W;  3SK8 A;  5IT9 L;  2F3V A;  2F0I A;  1JCK B;  2Q8I B;  2Z4I A;  2JEB I;  1JWM D;  1QJO A;  1VMP A;  1SNP A;  1LTB D;  2ZXR A;  4WFN 3;  2BOS A;  2MUY A;  4HMI A;  4DNT B;  1STA A;  2A74 C;  1JQY D;  4I7Z C;  2BDO A;  2K32 A;  4XT3 B;  1YNN D;  2RDG A;  3K0Y A;  1RF2 D;  5ISR A;  2PZT A;  2MGS A;  1I4P A;  3TN2 A;  1T5X D;  1ESF A;  2B2Y C;  4DFA A;  5EGT A;  3LWE A;  3M85 A;  4RAU C;  4UAI A;  1V1P A;  1V1O A;  2EYM A;  1ICW A;  5C4H A;  2F0T A;  2EJF C;  1B50 A;  3NBI A;  2XNA C;  4RHS A;  1SYG A;  1ILP A;  2R92 B;  1F9P A;  2NUC A;  5E4W C;  5M3M B;  1TS2 A;  3VYS A;  1CQF A;  4NP5 A;  3CQZ B;  1D1I A;  1RTN A;  3I73 A;  4R8N A;  4RHR A;  1CQV A;  1W6K A;  3W3A A;  3T16 A;  2B2U A;  4OL7 A;  3AMU A;  1ENF A;  1EY8 A;  2MJ8 A;  3OMG A;  4BBS B;  3I72 A;  2WII B;  2PZW A;  4K2K A;  1BBX C;  1GUG A;  3DEO A;  5C44 B;  3ONA B;  1QG7 A;  3I4L A;  4EQN A;  4TSS A;  1HFG A;  2SNM A;  2VB2 X;  3K6O A;  3LNN A;  1I6H B;  5ELE A;  3ND9 A;  5JEA J;  1PRT F;  4LK1 C;  4G7Z C;  1MSG A;  3VR5 A;  5JVH 3;  4J6H A;  3SR1 A;  2PZU A;  3I3C A;  2B2U C;  1O7L A;  1B9N A;  4K6L A;  2VB3 X;  4IUT A;  4DA2 A;  2O4X A;  2B8G A;  1Y8P B;  5EPL A;  2K1B A;  4RGT A;  2L9H A;  4K14 A;  3V2T A;  2BA0 A;  3GQB A;  1B4O A;  1SXT A;  1U4R A;  3L3O C;  5C0X H;  4HN7 A;  2EDG A;  4MHE A;  4DNR B;  1HFN A;  2M9V A;  1M8A A;  1X3Q A;  4IFD H;  2F1M A;  5TSS A;  4FF3 A;  2GA4 B;  1BCP B;  2E76 C;  4XYQ A;  5IGC A;  5C3X A;  2EXZ A;  4H13 C;  3IAY A;  1Q90 A;  1KDA A;  2L12 A;  3HS0 C;  1WTR A;  5I4D A;  5I9O A;  4K8I A;  2LY7 A;  1EEF D;  1EY5 A;  2KEE A;  5I2Y A;  1CA5 A;  2G9D A;  1IYV A;  4H7B A;  1DON A;  3PO2 B;  5K36 H;  4WOR A;  5C5M A;  2DNE A;  1PFM A;  2NN6 H;  4FXK C;  1MI2 A;  3NWT A;  3MC0 B;  3N52 A;  2ZT9 C;  2KED A;  1G6Z A;  1EY9 A;  2EPB A;  2LKV A;  2YYZ A;  1LTR D;  4A3I B;  5FO9 B;  5FO8 B;  4QB4 A;  3CHB D;  2HCC A;  5HGT A;  1TS5 A;  3J7A F;  2E2D C;  4KN4 C;  2L0C A;  1T5E A;  2B2W C;  2EJG C;  4NMZ A;  4XQN A;  1RKN A;  3BZD B;  1K8O A;  4HED A;  1BDO A;  1SNC A;  4ABN A;  2PCF B;  3H6M A;  4C3H G;  1EIH A;  4IQZ A;  1Y1W B;  3DWP A;  2FFK B;  3TME A;  1LT5 D;  4O42 A;  2CW0 C;  4KTA A;  4XQJ A;  2FMC A;  5JVG 3;  4DGZ A;  2RA4 A;  3VYU A;  1SDF A;  4IUQ A;  5IGG A;  1Q1B A;  2N88 A;  2A6H C;  1KDC A;  1IKM A;  2L55 A;  1Z7T A;  2B2T A;  3C2P A;  5M9O A;  1XWE A;  5EKI A;  1PXU A;  1WTO A;  1LT3 D;  3A55 A;  4FXD A;  4F88 A;  5KEE A;  2DY7 A;  1SNO A;  1GUT A;  5ELF A;  1EZ8 A;  3OHX C;  1BCP D;  4BWG B;  3OPO A;  3PUW A;  3J81 L;  2NVY B;  1AZQ A;  2E2J B;  1QNU A;  3DMU A;  5KNC A;  4EQP A;  4HMJ A;  5KRU A;  1LAC A;  3SE0 A;  1GOZ A;  4ZUJ A;  3H94 A;  4P2C B;  2F0F A;  3K5N A;  5FKA C;  1SMY D;  4LJZ C;  4KJN A;  1PRT B;  1PDQ A;  3QOJ A;  5ELD A;  5C3W A;  2B2T C;  1SJH D;  4HAE A;  4QUC A;  4K5V A;  3EQL C;  3FKI B;  5KYL A;  3VYT A;  1O7Z A;  2EYO A;  3SK5 A;  2AUJ D;  4RCO A;  4OGQ C;  1TWA B;  2PQE A;  1HTP A;  5ELB A;  1BF4 A;  1EWH A;  1EYD A;  5IGE A;  1D5Z C;  4KKS A;  5FO7 B;  1KAB A;  3L9A X;  2L4N A;  4KJO A;  2K33 A;  3V05 A;  1DM0 B;  4I65 A;  5LL6 X;  4PNY A;  1JWS D;  1JOO A;  1TY0 A;  2L5T A;  3S14 B;  5DM6 3;  2WKD A;  4WRD A;  4CJ1 B;  1SE3 A;  4FNF A;  3U9S A;  1WTP A;  2KHS A;  1FD7 D;  5D3I B;  4DK1 A;  2XRS D;  2D5D A;  5C3E B;  2HDL A;  1QE6 A;  1V43 A;  3K5L A;  1U4P A;  3OW7 A;  3DUZ A;  3HG9 A;  1KDB A;  3EJI A;  1HHV A;  1G91 A;  1B9M A;  4IUU A;  4A93 B;  2KOL A;  1EQV A;  1STB A;  3S1R B;  4ZRZ A;  1JB3 A;  3V96 A;  1KLG D;  4CJ2 C;  2BA1 A;  1NR4 A;  4BY7 B;  2VUM B;  4DAP A;  3E0J A;  1I4R A;  1JWU D;  4FF2 A;  2BE5 D;  1NSN S;  2R93 B;  1EIG A;  1ESR A;  3TZD A;  3SXH A;  5LHY 1;  3G6J B;  1JC7 A;  2KEC A;  1OXV A;  2XWB B;  4L63 B;  4Y7N B;  1GHK A;  1LAB A;  3BVM A;  3IKJ A;  1M4V A;  4XQQ A;  1Y69 U;  4B9X A;  1PRT C;  5IOC A;  4PV1 C;  5J39 A;  1STN A;  1YNJ D;  3GD7 A;  5C0X J;  1HXY D;  3L7Z C;  1UAP A;  1TWH B;  1MGS A;  3D4W A;  1Q12 A;  2NZ1 D;  4IFD J;  1LTA D;  4OIK A;  1SSO A;  4ULL A;  1EY6 A;  4XDX A;  5CYU A;  3H3V C;  3TP5 A;  1K83 B;  2AQ1 B;  5NUC A;  3QOL A;  1HRJ A;  2NTS A;  1C8C A;  5M5X B;  2RKS A;  2F0V A;  2F0G A;  2HQE A;  3A8K E;  1NCV A;  2JSO A;  1LO5 D;  1AZP A;  2TMP A;  5F2D A;  2F0K A;  1A6X A;  1AFP A;  1IYU A;  2O5I C;  2RBM A;  2WV6 D;  3HOW B;  2A69 C;  3D4R A;  1TWF B;  3VYR A;  1I4G A;  3IFD A;  2A69 D;  1R9T B;  2A68 C;  3LX0 A;  5I2X A;  2B63 B;  3SVM A;  4IUN A;  3C46 A;  2K04 A;  3PUY A;  5IGF A;  1DOK A;  4OO1 I;  1PZI D;  1DJR D;  1CA6 A;  4QMG A;  3VR6 A;  4CBV A;  1AEX A;  1EYC A;  1O80 A;  1MBY A;  2MHV A;  3SHL A;  1OXS C;  5C5L A;  3J7Y W;  2HUG A;  3GTL B;  4K2L A;  3KBX A;  3MXN A;  3BDC A;  1X32 A;  2ID0 A;  1CHP D;  4ILW A;  2RSO A;  1Q3L A;  5BN5 A;  3GTM B;  4KN7 C;  5T1G A;  3KBG A;  2CQA A;  2EY1 A;  3KLR A;  2EYF A;  4ZUI A;  3MFG A;  5CC4 A;  3IL8 A;  2I46 A;  1WTV A;  3WOF A;  3T51 B;  2PPB C;  2EYL A;  3I70 A;  2KQ3 A;  5JPN C;  1WTW A;  3BVG A;  2YU9 B;  4X3K A;  3HOZ B;  3KLS A;  4ODG A;  3PIO 3;  5EBC A;  3K5O A;  1PFB A;  5E4X A;  4A3F B;  1GUO A;  1TY2 A;  5I6Y A;  5E1F A;  2G9H D;  3CU7 A;  4IUR A;  1XXG A;  3RMH A;  3T4A C;  1MD2 D;  4QIW B;  1SND A;  4UDU C;  3TP6 A;  2F03 A;  4KKU A;  3I4N B;  1SYE A;  3HZX A;  3I90 A;  1GXD C;  2AUK A;  3LWU A;  4G57 A;  4KK7 A;  3C1E A;  2A6E C;  1SFO B;  5CV5 A;  5D14 A;  4V0B A;  2F0J A;  1E2W A;  1F2Y A;  2A6E D;  2QCP X;  4HSP A;  3R8B A;  3BG3 A;  3F2U A;  2J7Z A;  1GHJ A;  3FPU B;  1ZEQ X;  3J81 E;  3Q23 A;  1B1Z A;  5G3L F;  2WIN B;  1F2M A;  4RKB A;  2FMM A;  2VXW A;  3BS1 A;  3D3R A;  3FDT A;  3S9W A;  2AWO A;  2WAQ B;  4HSV A;  3ND8 A;  2R6G A;  1SYC A;  3K59 A;  1H9R A;  3U9O A;  2K6A A;  4FF1 A;  4IFD G;  2SEB D;  1VF5 C;  4KY6 A;  1UNS A;  1QB5 D;  3MHB A;  1PZJ D;  1Q8I A;  1CTM A;  4DAY A;  1E2V A;  2ICI A;  4AYB B;  4DAV A;  2RSN A;  1KTK A;  1V8Q A;  5FK9 C;  1Z47 A;  4F7X A;  2X6L A;  1A2U A;  1JE4 A;  1BO0 A;  2E2H B;  1GUS A;  2M2L A;  1TWC B;  1SYD A;  2EVB A;  2NN6 G;  1KAA A;  3S15 B;  3SEB A;  1ROD A;  1A3V A;  3NPP A;  2F4I A;  4PMC A;  4CKC A;  2D2C C;  1BUV T;  4LMQ D;  4KY5 A;  2F0N A;  1R4Q B;  2K03 A;  5CV4 A;  3GTP B;  4PMW A;  4A3G B;  4MIU A;  3ZYY X;  1F9Q A;  3J80 L;  5COR A;  3NHH A;  1A2T A;  2B2V A;  4X3U A;  3QG1 A;  2R3Z A;  1X3P A;  4JK1 C;  1TII D;  1LTT D;  5FOB B;  3A54 A;  4DXF A;  1SAP A;  4EVO A;  3SDZ A;  1FR3 A;  4K8J A;  4KV6 A;  3CKI B;  3NTH A;  1R4P B;  5C4Z A;  3PV0 A;  5KIX A;  2IX3 A;  3RUZ A;  3C1F A;  2F0H A;  3OWF A;  3EFX D;  2TSS A;  1JOK A;  3T56 B;  4KMU C;  3D31 A;  1S5B D;  1H9K A;  2JP1 A;  3MAQ A;  5FLX L;  2CW0 D;  2B2V C;  4A3E B;  3NQI A;  3H09 A;  2E74 C;  3MA2 B;  1EEI D;  4C3I B;  2BDN A;  2F0U A;  3FVQ A;  3MXU A;  4E6I A;  3MZ5 A;  3I91 A;  2A6H D;  5KGU A;  4B08 A;  1JOR A;  2EY6 A;  3DWA A;  2K7V A;  2A73 B;  1I4Q A;  2AWN A;  3M7N A;  1STG A;  5EKK A;  2RDF A;  2KVM A;  5T1I A;  5JEA G;  4S3S A;  5J22 A;  1PFN A;  2L1B A;  4FO2 A;  1PTO F;  4OIJ A;  3BVZ A;  3HP3 A;  2E75 C;  3I4M B;  1NUC A;  1II3 A;  5EPJ A;  5A2Q L;  1HQR D;  4DU9 A;  1WCM B;  5C0X I;  2C9O A;  3KLS X;  4XT1 B;  5KYI A;  2PMZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...