3A8IE

Crystal structure of et-ehred-5-ch3-thf complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
128
structure length
127
Chain Sequence
SNVPAELKYSKEHEWLRKEADGTYTVGITEHAQELLGDMVFVDLPEVGATVSAGDDCAVAESVAASDIYAPVSGEIVAVNDALSDSPELVNSEPYAGGWIFKIKASDESELESLLDATAYEALLEDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of aminomethyltransferase in complex with dihydrolipoyl-H-protein of the glycine cleavage system: implications for recognition of lipoyl protein substrate, disease-related mutations, and reaction mechanism
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/transport protein
molecule keywords Aminomethyltransferase
total genus 29
structure length 127
sequence length 128
chains with identical sequence F
ec nomenclature
pdb deposition date 2009-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01597 GCV_H Glycine cleavage H-protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3a8iE00
5A35A 1E2WA 2A6EC 3IFTA 2Q8IB 4DK0A 5BN5A 5K36H 1Q1BA 1CFMA 1ONLA 1PMRA 5KNDA 3QJYA 1YNNC 3ND9A 3IKJA 1Q12A 1Y69U 2E74C 1Y8PB 2EDGA 1B9NA 2AUKA 4XIGS 4OO1G 1Y8OB 3KLRA 3NE5B 5C0XG 4G7OC 2JEBI 3BG3A 2F1MA 3P20A 3PV0A 3LWUA 3OPOA 4G7HC 2K33A 2EJGC 4OGQC 2EJMA 1GUTA 1O7LA 1K8MA 3L7ZC 1I6VC 2A68C 4GZYC 1H9SA 2CW0C 5JEAG 1ZKOA 1OXUA 2B8GA 1IW7D 1OXSC 1IYVA 2PPBC 3D4RA 3TZUA 1Q1EA 2O5JC 2E76C 3PUZA 1VDZA 3U9SA 1HPCA 3FMCA 2A68D 3PUWA 2D2CC 1O78A 1H9SB 3HGBA 4KN4C 3T53B 2KA7A 4KKSA 3AB9A 4IQZA 1G291 2BDOA 1E2VA 1Q90A 2DN8A 2E75C 4KHZA 1IYUA 2JE6I 2PNRC 5KNCA 4HR7B 3CRKC 2D62A 1IW7C 4PV1C 2NN6G 2YYZA 3RLFA 3M85A 1DD2A 3I72A 1HTPA 1BDOA 3EQLC 3ND8A 3I73A 1OXXK 4XTCS 4TKOB 1TKWB 3H94A 1VCIA 2O5IC 2A69D 4KMUC 2DNEA 4KN7C 2EVBA 3A8KE 3PUXA 1H9KA 3VR3A 4IFDG 3VR2A 1Y8NB 3VA7A 1A6XA 4KI0A 1GHJA 2AWOA 3W3AA 1HQMC 1SMYC 2JXMB 4G7ZC 1GJXA 1VF7A 3VR6A 2A6ED 2QF7A 3M4YA 3PUYA 1CI3M 4DNRB 3T51B 4DK1A 3PUVA 2L5TA 3LNNA 4BA1I 2LMCB 4H13C 2AUJD 4KKTA 4TQUS 1GUSA 1LACA 4H44C 3QG1A 4H0LC 1OXVA 3A8JE 4OO1H 1GUGA 2EJFC 2B8FA 4KKUA 1GUOA 1FR3A 2R6GA 3GD7A 1H9MA 1HCZA 2BA1A 2K32A 1T5EA 3BDOA 4LK1C 2V4DA 3VR4A 2ZT9C 4JK1C 1Z6HA 3SE0A 5C0XH 1V43A 3A7AB 2A69C 1ZYRC 1GHKA 5KNBA 3A7LA 1H9JA 4DNTB 1H9RA 4RCNA 1B9MA 4L8JA 4I7ZC 3GQBA 1YNJC 1GUNA 1LABA 1DXMA 2PCFB 2KCCA 1DCZA 1Z7TA 1QJOA 3N6RA 4BA2I 3CRLC 5JEAH 2D5DA 3M7NA 3OW7A 1EWHA 1VF5C 2IT1A 2A6HC 3VR5A 1TU2B 4IFDH 2DNCA 3DXJC 3I4LA 1CTMA 1OXTA 2A6HD 3MXUA 3A8IE 3D31A 2BA0A 3SDZA 3MFYA 2JEAI 2NN6H 4LJZC 5BN4A 2BE5C 3WDNA 1E2ZA 5K36G 1K8OA 1FYCA 2K7VA 3QIAA 2BE5D 3FPPA 4JBWA 3T56B 5BN3A 1V8QA 3OOCA 2NN6I
chains in the Genus database with same CATH superfamily
4IOCA 2B63H 3C3LA 2A6EC 4PZ8A 1S5ED 3M4QA 4L5RC 4C3IG 2PZUA 2VZAA 2E74C 1Y69U 3GTMH 1U4LA 1MJCA 2VL6A 2JEBI 1UNSA 3R3OA 5ELOA 4C56C 1QVGA 3LWUA 1X54A 2F03A 4QQBX 5M3MG 4G4KA 1FD7D 3W2DA 5IT9E 4DV6L 2Z0SA 2HHHL 3GTQH 1ZKOA 4GOPB 1OXSC 2B3GA 4IUQA 4JBMA 1A62A 1TT2A 3TEHB 2CVRA 3EIVA 3SK5A 1BR9A 4RG1A 3FP9A 1HZCA 5KIXA 4FF3A 3O13A 1IYUA 2NZ1D 2XWJB 1JWUD 1KAAA 1X32A 3EQLC 3HOWG 1WTRA 3HOZB 1A2UA 2OXPA 2RHQB 3PMFA 4C2MH 1KC8C 3S15B 4QGUA 1CQVA 1VCIA 1X55A 2SDFA 4XQQA 1RHPA 4JI0L 3RZOH 5CV6A 1G8ZD 2FJ2A 4B9XA 3SHLA 1GHJA 4PZ6A 4G7ZC 4LUVA 1U5KA 3OWFA 3CCUA 5I6YA 5LMNQ 1IL8A 2PO4A 1PYWD 1XXGA 4XQNA 4LF4L 2VUMH 2NVTH 1QNKA 1X3GA 1DOLA 3HOUB 4LFCL 3U50C 4A3IG 5HGQA 4C1NK 3DMUA 2Z4HA 4X66Q 2RDHA 4JG2A 3PO2B 4F87A 4GNXB 3BVMA 2E2HH 3K0YA 5I2XA 4FP5D 2EXZA 2NVQB 3PF5A 5EPJA 4HMIA 5KYIA 3KLWA 4BXXG 5KNBA 4DV4Q 3V96A 4DK3C 2D9UA 1CK1A 3FHWA 2PCFB 2WB1G 1DXMA 3MVVA 3ULLA 1QZGA 2RDGA 3OW7A 4PNYA 3VYRA 1EUJA 1Z47A 2DY8A 1HZAA 2UUAQ 3GV3A 5IT9L 1PYBA 1B3AA 4LJZC 1TR5A 4K5WA 4CKCA 4ZAIA 1S4ZA 4X66L 3CCLA 1DOKA 2JEAI 2K5HA 3K80C 3NTKA 1XYIA 1JQYD 2CH4W 2E2JH 4JI1L 4EQPA 3BDCA 2Z6KA 4K6DA 2ZM6Q 2MHVA 4QUCA 1YJ9A 4DKAC 1SJED 4DR4L 5FLMH 1VQEA 2UXBL 2L15A 1KL9A 1CSPA 2EJGC 4BBSB 2VXWA 1K8MA 2FINB 2A8VA 1JC7A 5LL6S 2L0CA 5JJLA 2PPBC 4FXDA 2O5JC 2UXCQ 4XYQA 1PH2A 2CWPA 2NTSA 3KF6B 4DV7L 2JK8A 2Q2UA 2C35B 2JA9A 4YHHL 1KHIA 2H5XA 4A3BH 1MGSA 2F0MA 3GTLH 3KLSA 4KHZA 5AFWA 5KNCA 4X64Q 3CRKC 4JI1Q 1S3OA 1UWVA 2NN6G 4DR1L 3RZDB 4L5SA 1PXUA 3K59A 3T16A 1WTOA 4TKOB 4JYAL 4EVOA 4DAVA 3UI2A 1HQRD 2ZJPA 5C3WA 3PUXA 4HIKA 3BZCA 3RZOB 1PTOB 4YCVA 1STHA 3P75A 5I9PA 2AQ3B 3H0GH 2IHFA 1UE7A 1GJXA 1CKOA 1JJCB 2HCIA 2VW9A 1II3A 5M5YB 4A4IA 1PRTD 4K14A 2ZTEA 3TQYA 4CDEC 3KF8A 1SMXA 3IFDA 3CCJA 1I4QA 5IYBH 4CGYB 4A75A 1IKLA 2BH2A 1D1IA 1RD9D 2LY7A 2L12A 3GTQB 4FO2A 3A7AB 1KDAA 1EFID 4CKEA 5CR3A 1KDBA 3PSIA 1VQMA 3JAME 4RKBA 1TWCH 2NVYH 3J7AV 3T1YQ 4NW2A 1CHQD 1JCKB 3U58A 3K81C 4FXGC 4WJ4A 3BJUA 3MXUA 2VB3X 1FJGQ 1MI2A 1EIYB 2B39A 1E2ZA 2IHEA 5FKAC 5IYCG 2SNSA 4C3HH 3Q22A 3ZYYX 2PQAA 3BYTB 3KJPA 1U4MA 4HSVA 5EKLA 5EPLA 1IBLL 1VQGA 4WRDA 3ND9A 4JI4L 3I4NG 1SN8A 2XNAC 3IKJA 2EZVA 4OO1G 5C0XG 1XTDA 1U9RA 4IFDI 4A3BB 1SNMA 3PV0A 5IWAL 4OWXB 1VQIA 2PQEA 1YHQA 4FXKC 1I94Q 1JR0D 2JA8B 5E4WC 4A3FH 4A3EB 4ALPA 3DEOA 3F8TA 3H3VC 1TXYA 4F88A 2NTTA 2UXDL 3FKIH 1O78A 1HNWL 1NUCA 4DR5Q 4KN4C 3MEFA 2UXBQ 3DHQA 3H0GB 2F0KA 2K75A 2JE6I 4I65A 2YU9B 2PMZB 3Q23A 5LL6X 4LF7L 1BBXC 3HFZB 3RZDH 2A69D 3S16B 4KN7C 5EBDA 4IURA 5IGCA 4HJ7A 1GUWA 1WTWA 1X6OA 3W3AA 1YJWA 1S72A 1STGA 1SJHD 1UE1A 3WWVA 1GM5A 1B1ZA 4HCEA 3PGZA 3E9HA 3MTSA 3HOXH 1CT1D 1PZID 1PLFA 5HGTA 4CJ0B 3X3MA 4DR5L 3S1RH 4BY1H 1HNXQ 2I46A 3NBHB 2EYPA 5IGGA 1ICFB 3SXHA 2LKVA 2MJ8A 4A3KG 3CXCA 3UE0A 1VQHA 4A3JG 1H9MA 3AFPA 3OHXC 4A3MG 2Q8RE 2CHBD 4CJ2C 1O7YA 4LK1C 3CD6A 3A5UA 2ZT9C 3J80i 3S2HH 5C0XH 2N55A 4DNTB 5CV5A 1SE3A 4M1UB 4FF1A 2TMPA 3IRBA 4WORA 4JI7L 3S1MH 1Q3LA 4P72A 4B3SL 4RGMA 4KHPQ 1TWFH 1I6HH 3D8GA 3A8IE 4G57A 3J81j 3PIO3 1Q7YC 1TIID 3OTOL 3HOVB 4O2DA 1IYJB 2GVBA 3OWEB 4HIMA 4N8FA 4DR7Q 1VQNA 2B2VC 5BN5A 3QJYA 4LUOA 4V0BA 1WTHA 4YWLA 4JI6Q 5C0XJ 1C9OA 1SEBD 2CKZB 2HDLA 1MHWC 1Y8OB 3MFGA 4K0KL 2HDMA 1YI2A 2VB2X 2F1MA 2XTIA 4RGTA 2O2LD 2YTVA 4F8MA 4JI7Q 4LWCA 1NR4A 2X6LA 4NXNL 3HS0C 5JEAG 1IW7D 1LUZA 3NPPA 2Q2TA 1TS5A 4JOIC 3GTOH 1UEAB 5CV7A 3NEMA 4X3UA 1RKNA 4A3BG 2K5DA 1EZ8A 1Q46A 5ISRA 4IQZA 2R61A 1NBWA 2G9DA 5IP7H 3M3YH 5KGUA 3KF6A 3SEBA 3D3RA 4DXFA 4PG3A 4OWTB 1OXXK 3DWAA 1XMQL 4KMUC 3I56A 2MFIA 5DAUA 1Y8NB 4RWSC 3OIQA 4R1JA 3CPWA 1X3EA 2MO0A 3K7UC 2VUMG 1BXTA 1G91A 5M9OA 4JV5Q 3HKZB 1DOMA 3JAMc 3S17B 1J5EQ 3VA5A 4KKTA 3MA2B 4H44C 3HOYH 4YY3L 3PIP3 2EJFC 3PIPA 1RJTA 2B2TA 1GUOA 3QR8A 1PH3A 1HZ9A 3B6YA 4AQYQ 3QOLA 3CQZB 3SE0A 4WFN3 1N32Q 2F0NA 2OTJA 1EY8A 2F0PA 2H4OA 1MKHA 3NTHA 1YNJC 1K28A 2R7ZG 1SLJA 3NP8A 2KJXA 2CQOA 3QOJA 4B3RL 4IFDH 1SYEA 3DXJC 2XVSA 2NUCA 1HA5A 4V190 3GTKB 5T1GA 2CWAA 4BY7B 1Y1WG 5IE8A 3QO2A 1W2BA 1ASYA 5E7NA 1PH8A 3I4NH 3KJOA 5E1FA 1EIFA 3G71A 3PO2H 2F4VL 1AH9A 3L2PA 3KK7A 1VQJA 3I70A 1VQKA 2OT2A 4FF4A 1Q8IA 1HUMA 3E5SA 2EDGA 5TSSA 4HJ9A 3M3YB 2K50A 4UPAA 1C8CA 2RA4A 3VYTA 1XPRA 1QCBD 4OGQC 5C3EH 3K58A 2F0SA 4HAEA 1IHZA 4CDCC 4TSSA 3CCMA 3I4MG 3HOZG 3MC0B 5JAVA 3RMHA 2WFWA 1LO5D 5I2YA 2PI2A 5JJIA 5M5XB 2KA7A 4C2MB 1G291 3URYA 1TS2A 1V1QA 1STEA 1VQDA 4DN4M 2DN8A 1SAPA 4OELB 1MBYA 1YNJD 3S1NB 1MD2D 3W1GA 1IW7C 1IZ6A 2IX1A 1EQQA 4JI0Q 4MIUA 1KLUD 2K5VA 5M5XH 4DV3Q 2L1BA 3CKIB 4NXML 4Y52H 4X3TA 4JI5L 4LFBQ 3U4ZA 2B2YA 1WCMB 1F9PA 4X6AH 5EKKA 5C44B 3HKSA 3GTPB 1SROA 4C3IB 5IYDH 1CI3M 4BBRH 4FVMA 4C1NI 1YJNA 1XWEA 2OTLA 1O7ZA 1E0BA 2XGTA 4UY8C 3GTMB 4B08A 2IW3A 2MO1A 2L4NA 1GKHA 4OIKA 2F0LA 5CC4A 2ID0A 3HOYB 3I4NB 1XJVA 4DV4L 1M4VA 5JEAJ 4LF9L 2RKSA 3NUCA 4LF8Q 4OIJA 4HJAA 1Z6HA 2M2LA 3GTGH 2A69C 2PW7A 1X65A 4HTHA 5KYLA 5EQ0A 1L2FA 1DJRD 1CKMA 4I7ZC 3ZJYC 1DCZA 1WVLA 3HOXB 1C4QA 2ASBA 1CTMA 1HZBA 1PTOC 4F7XA 5IGDA 3RLNA 1EU4A 3HOUH 2Z6BA 3I7FA 1ILPA 3CQZH 2BE5C 3WDNA 4ZCKA 2X6GA 3A56A 5JPMC 2Z9HA 5ELDA 2L5TA 5ELFA 4AQYL 2OF1A 1WJJA 4EQOA 1I4RA 4LF9Q 4X3KA 3ERQA 1Q1BA 1HNXL 4XIGS 1PFNA 2C5CA 4NKLA 3VDYA 3J7A5 3P20A 1A3TA 4GZYC 3FRPB 5C5LA 4GKKL 2UXCL 2AWNA 1IXRA 4ID6A 1H9SA 5A2QL 3D6WA 3K57A 4DV0Q 3J80c 4S3SA 1MJEA 2JA8H 1EY0A 3U9SA 1M8AA 2K05A 4A93H 3CU7A 3R2IA 1VS0A 1AZPA 1E2VA 3EA6A 4X65L 1YZ6A 3TN2A 1L1OC 3J81i 3CCRA 4K2LA 2KEDA 2KHIA 2F52A 3H6MA 4PMBA 1YITA 1CZWA 2M9VA 1TY2A 4A3GH 5LHY1 4IFDG 2KENA 2QKIC 2VNUD 1GXDC 1K8GA 1YHAA 2HT1A 4DV0L 2RSOA 3D6CA 5EKIA 1AEXA 2F0JA 3PUVA 2QDLA 1SNOA 2KQ3A 2IWHA 1HXYD 4BA1I 4DV1L 2JA7G 1BQQT 2UUCQ 1GUSA 5D14A 3CC4A 1EYCA 1OXVA 4TRDA 1HUNA 1HFGA 2A19A 3ICEA 3OTOQ 4HSPA 5ELNA 4J8QA 3KF8B 4JK1C 1IKMA 1TY0A 2WIIB 5CYUA 3I4MB 1XMOL 1WYDA 2RHSB 3OW2A 1C48A 1V1PA 2M00A 4K0KQ 5AJ3L 1EWHA 3S1MB 1K9MC 1X3PA 2R7ZH 2E2DC 3H09A 1H95A 4KJOA 4M8AA 4HCSA 3SK8A 3MWYW 1FYCA 1V8QA 3D4DA 2N78A 5COYA 3JC66 5A35A 1V1OA 1OTCA 2SEBD 4DK0A 2PYKA 1I3QB 1PA6A 2SOBA 4A3LG 1RTNA 3RUZA 3AU7A 1NAPA 1Y8PB 2PQAB 3HOVH 3PO2G 5K5PA 1JMCA 1AW7A 4A3IB 4G7HC 1K3RA 3M7GA 4ZLTF 4DV5L 5C4XB 4RKLA 2Z4IA 1MSHA 2EY1A 1EL0A 1LTAD 1K83H 2YV5A 1HNWQ 3LGJA 3MXPA 2F3VA 4CKBA 4A93G 3KFUA 2EY6A 4OXPA 1SYDA 4XT1B 5CGKA 2A68D 5C4JH 1AN8A 1G2SA 1KNEA 4DXGA 2BDOA 4X62L 1Q90A 3S1QH 2E75C 1F9SA 4RMFA 5IOCA 1D6EC 5HY6A 2HUGA 4ZUJA 2Y0SG 4EX5A 2E2JB 3J7AF 3NENA 5LMNL 4AH6A 4WJWA 1HR0L 1NJIC 1K0RA 2DNEA 1CUKA 3A8KE 4OEMB 4ME5A 3AMUA 5LMUQ 5IP9G 2JP1A 3BZKA 3HOXG 1D7QA 1W6JA 4RAUC 2QGQA 4R8NA 4IPGA 1FNVA 3PUYA 1K8AC 2BDNA 1LYLA 4DR2Q 4K8IA 1FNWA 2HD3A 1A63A 1E24A 5M3MB 4DFAA 5D3IB 1T9HA 4A3MH 2YU9H 3H3VH 2R93B 3HOYG 2HHHQ 3BZDB 1E1OA 3UDFA 1D1KA 3NBHA 3P1HA 4FYDA 1N36Q 3Q24A 4K5XA 5LMNW 1R9TH 2B2UA 3U4VA 3SVMA 1CZGA 1JICA 1VQBA 2LXJA 3A54A 3EN2A 5CV9A 3CRLC 4RFBA 1JJ2A 3K7AB 2UUCL 4A3GB 1SMYD 4DR2L 5DM63 4CDFC 3NWTA 3KLSX 5FK9C 5FJ8H 1QNUA 5C6AA 5IGBA 4DAMA 4JBWA 1YVCA 4KKUA 3DWQA 1KLGD 1SFOB 4LFCQ 2Q8IB 4MZ9A 4RGOS 4H02A 4UDUC 4YY3Q 2WAQB 5GAGC 1BCPF 3KLRA 2R92H 4GKJL 1BO0A 1NCVA 1K3BC 1R9TB 1Q82C 4HMJA 2C9OA 2PZWA 1TWCB 2BH8A 3NWSA 4A3DH 1OXUA 2MP1A 2D0PA 2OEOA 3EROA 2UU9Q 2VQFL 3MXGA 3TBIB 4HJ8A 1TVXA 1H9SB 3S2DB 3AB9A 1STAA 4A3KB 3EVQA 4DV5Q 4IPCA 4NP5A 5BR8Q 4FF2A 1I4PA 2N49A 3RLFA 4DAPA 1Y1WB 4ZKBB 2PMZE 2Z6KC 5ELBA 3NQTA 3GTJH 4B3ML 2ZJQA 1QZHA 3I90A 1PVOA 2Q2IA 4YWKA 2F0FA 4BBRG 4CBVA 3T51B 3PF4A 4DAYA 3GTGB 1EY4A 3F2DA 4GKKQ 3RN2A 3DWPA 4N9PA 2E5LQ 5FJ8G 5JVG3 1IBKQ 4GS3A 2PZTA 1NMFA 3MEHA 3A8JE 3TP6A 2E2HB 1XPUA 4OO1H 3PO3G 2B8FA 3A74A 2EY2A 3STBC 2R7DA 4IPDA 2IX0A 4LUZA 3TMEA 3E6ZX 3K8AA 5KRUA 3TS0A 3ULPA 3T1YL 1V1PB 4JI8Q 2L55A 4LAAA 1DYQA 3CW2C 1H9RA 2KBNA 1FJGL 1B9MA 2FXQA 4GN5A 1NTGA 4DUYQ 1BBUA 1BBWA 3N52A 4NB3A 3FKIG 1QJOA 2HIXA 2EQSA 1BNZA 2D5DA 1VQOA 2IT1A 1TU2B 1K0SA 2DNCA 1KNAA 2VQEL 3S15H 4GLXA 1A8VA 3SDZA 1R4QB 1XNQL 3H3VI 1PRTC 1QUQB 3S14B 1ET6A 4DV1Q 1XNRQ 4WJ3M 2XRSD 5IP9H 3T1HQ 4APVA 1P16A 3TP7A 1RIPA 1F2MA 1B8AA 1L0WA 3GTPH 1VQ9A 2NVTB 3IL8A 4QIWE 3ULJA 4DR6Q 4HIDA 1BVSA 3Q0AA 1CKNA 1F9RA 1SDFA 1PDQA 2WKCA 3C1EA 5G3LD 1EY5A 1U4RA 2EYLA 1JWMD 2KOLA 2N3SA 2ZXOA 2HIVA 1I4GA 3SGIA 2B2UC 1S5CD 2NVXH 1VQ6A 4P74A 1QVFA 1WD1A 3EBEA 1O7IA 3OIPA 1XMQQ 3KDFB 4FNFA 5CORA 1KABA 4MHEA 1XNRL 3CPFA 1L0YB 1O80A 3P7JA 4PV1C 4UP7A 3PIOA 4GKJQ 1BDOA 1Y1WH 3BDLA 4ZRZA 4IUPA 2YTXA 2HCCA 2RCFA 1CA5A 1EEID 3W1BA 4BBRB 4JYAQ 4P73A 5H1SE 3VA7A 3CMEA 1A6XA 2B2YC 3R93A 5JJZA 1TWHB 1WCMH 3I8ZA 5JVH3 4MN3A 1VMPA 1UE6A 2A6ED 3NHHA 4DR4Q 2F0WA 2I5LX 1J8IA 2GVAA 4DA2A 4MTNA 3D0FA 3QWNA 3G6JB 5IIFA 2LFNA 3HKZE 4A3DB 4DV7Q 4TQUS 3I55A 1LACA 3HOZH 4MTKA 1N32L 1N33L 1HNZL 2ICEC 3S14H 3S1NH 3GD7A 4UAIA 2K01A 2B63B 2EYMA 4FDBA 1HCZA 3TP8A 3GTKH 4OO1I 4A3CH 1LLRD 4LNQA 1Q8KA 1SNPA 3CCEA 4Y7NH 1STYA 1QOHA 1SNDA 4DU9A 1D5XC 3J81c 1ZYRD 2N8NA 1E7ZA 2K5NA 4BXXH 4OL7A 4QIWB 4BBSG 4A3FG 1KTKA 5EGTA 3WOEA 2OWOA 3NSWA 4IUVA 3HEJA 3R8BA 2F0TA 2ENBA 3D31A 1JOQA 2JA7H 2NN6H 1UEBA 2OQ0A 5K36G 1B44D 2QEXA 1SYFA 3FPPA 4OHJA 1YEZA 4IUNA 2JA7B 1JORA 5M3FB 1L0XB 4Z9CB 2ZXRA 2F0UA 5J22A 1W3SA 2JA6B 4XT3B 1LV9A 3BVZA 3L3OC 3H0GG 3LWEA 5M5WH 1DONA 3F2CA 1JT8A 1WI5A 3L7ZC 1B4OA 3F2UA 3GO5A 3JAML 4C3JG 3MZ5A 3LX0A 1B50A 5I4DA 2K52A 3D4RA 5HURA 1QVCA 2JJQA 5LMUL 4JOIA 4L6TB 2XWBB 3I2ZA 5IGEA 4R8IA 2EE1A 3S9WA 2B2WC 4A3KH 3T1HL 4JCVE 2OCEA 4ILWA 2CFMA 4AYBG 1Z9FA 1V9PA 5C3XA 1EOVA 1TWGB 1PZKD 2B2VA 1HTPA 3I72A 2X69A 3BU2A 3H94A 1SE2A 3J80E 4R4CA 4PQXA 4IFDJ 5C0XI 1EZ6A 1IBLQ 1BCPB 5NUCA 4NXMQ 4N9TA 1PFBA 1YIJA 5D65A 3G6EA 4JI3Q 3A5ZB 5C4JB 2KCMA 3CCVA 2K28A 4IJHA 4O1NA 1EWIA 2QA4A 4GN4B 4JI6L 4NXNQ 4QF4A 3DM1A 2Y0SB 3HZXA 1ILQA 2AUJD 1S5FD 2PW5A 1FVIA 4H0LC 4JI2Q 2J0TD 2F0HA 5C4XH 4XXEA 2DJFC 1WTVA 4A3IH 3M4PA 5GQOA 4ME3A 1WTXA 3PO3H 4LF6L 1NY4A 4IN3A 4DPGA 3HOWH 1HRJA 1SYGA 2F0EA 2FMMA 1I3QH 3RLOA 1X56A 3A7LA 1BOSA 1BF4A 4QMGA 3GTOB 1QILA 1HHVA 4IZ8A 5E3FA 1F2LA 2DJGC 1GUNA 1LABA 1N33Q 2KCCA 3KUPA 4K8JA 4ZYSA 4BA2I 5JEAH 4C3JH 1B3QA 2R7FA 4NMZA 1CHPD 1LTBD 4KLKA 1RCVD 1DZ1A 4JV5L 3T13A 5J39A 1S5BD 5BN4A 4E6IA 1GD7A 1YHBA 4Q0FA 3E0JA 3FVQA 3NQIA 2NN6I 2K14A 2KUMA 1E2WA 3UDGA 4PMWA 1LTTD 5ELEA 2ALYB 3MAQA 2J7ZA 4LF4Q 1B53A 1LT3D 3TDQA 2R93G 1WCMG 1CKNB 1SE8A 4EQ5A 4HJ5A 4OX9L 3BG3A 1YNND 1KIXA 4BS9A 5BR8L 3ONAB 5FLMG 2F0GA 3DEPA 3G48A 2CW0C 4JI8L 3OMGA 1IYVA 1SNQA 2UUBL 1VDZA 5JPNC 1NE3A 4ZUIA 1I5FA 5J3BA 4X64L 1TS3A 3CCQA 4DV6Q 4HIOA 4X65Q 3S1QB 2Z1CA 2K6AA 4RHRA 4K2KA 1RL2A 2D62A 2E5LL 3EFXD 4JI5Q 2IY5B 3I73A 5IYCH 3KDFA 3H15A 1S5DD 3L0OA 5M3FH 3KYHC 1FL0A 1HH2P 3HG9A 2EVBA 1EU3A 4KHVA 4A3LH 2NZOA 2I5MX 5EJWA 1SMYC 4A93B 1B70B 1F2YA 1ENFA 1A15A 1EYGA 4DK1A 2ZM6L 4DR6L 3UDXA 1D2BA 2BCOA 3HRZC 5FLXE 2FHTA 5C4XG 2WP8J 1NMGA 4A3JH 4X3SA 3QG1A 2B2TC 1GUGA 2JSOA 5GADC 4IOAA 2KVMA 4GLVB 4JI4Q 1F77A 4RCOA 5IYBG 1I94L 1N34Q 1T5EA 1K73C 5IWAQ 2R7ZB 3NBIA 1QE6A 1A2TA 3NTIA 1XX8A 1XMOQ 5C4ZA 2EYFA 1VQ4A 2R92B 3ITPA 3RN5A 3MXNB 1UAPA 1QB5D 1JJGA 1KRTA 5IODA 1IL2A 1Q81C 4LF6Q 4JBJA 4L63B 1TWAH 5G3LF 4TVAB 3QB3A 3QIAA 1VMCA 4B3TQ 3HOWB 4LF5L 3T56B 4QJFA 5EAYA 1A3VA 1CM9A 4LF7Q 5K36H 4AIMA 1ONLA 3DLLA 4Y7NB 1T5XD 3BYYB 2NB0A 1Q12A 3CHBD 2E2IB 1HNZQ 4UHVA 3NE5B 1JE5A 4QY7A 5KEEA 1G2TA 4UP9A 4NDXA 1PH6A 4ULLA 1PRTB 4KV6A 1NR2A 1ESRA 2AMCB 4QUFA 1D8LA 3AYHB 5FO9B 3RR5A 5JOBA 3E0EA 2G5DA 2I07B 4R4TA 3TREA 1IBML 3AQQA 4AYBB 3K6OA 3SR1A 2D2CC 1VQFA 3HGBA 4MNOA 2FMCA 1EY7A 2O4XA 4X62Q 3CF5A 1PH5A 2LXKA 1TWGH 3CMAA 2F3IA 1VQCA 1K83B 2CW0D 3K5OA 1PH4A 1SNCA 4A3CG 2V1CC 2NWGA 2RCNA 1U0LA 2UUBQ 2O5IC 1X3QA 2PI2E 5IT9c 1SR3A 5EPKA 2JN4A 4RGNA 5C5MA 1P8LA 5DM73 3OSOA 4DR1Q 2AWOA 3TZDA 4DR7L 5IY0A 4CHTB 1AZQA 2F0QA 2P5ZX 1NSNS 5FO7B 1Y1VH 2ZTCA 4GN3B 2IL8A 1HJPA 1SBBB 3V2TA 2F0OA 1Q86C 5FOBB 1N36L 2XRQD 3HOVG 4IALA 3FDTA 2JA6H 1PRTF 4DAYB 1FR3A 2YTYA 1RF2D 3IAYA 5L37A 3V05A 3SK4A 5I9OA 1PH7A 3BDOA 4ZKCB 5AJ3Q 4A3FB 1PHJA 4ZQ3A 2K1BA 1ZYRC 2Y0SE 1H9JA 3TRZA 1E3PA 4B3SQ 1VQ5A 4DNIA 4BY7H 3N6RA 2OQKA 1PH9A 4LFAQ 1WTPA 1SSOA 2GA4B 2GN5A 2Z8LA 3UDIA 1LT4D 2LSSA 3K5NA 2NZHA 4LFBL 4BBSH 3VYUA 1OXTA 1N34L 1EYAA 3C2PA 1VQ8A 3M4OH 3Q8DA 2QW7A 4Q5VA 2ES2A 4GLAC 5IGFA 2BE5D 3OOCA 2DGYA 1FNUA 4BWGB 3MHBA 3ER0A 4OWWB 3GV6A 1PMRA 3PQIA 1QUQA 4IUUA 5ELCA 4JI2L 4JBKA 1B9NA 4GOPA 3OYYA 1AP0A 5FLXc 4O0AA 3E3XA 1M90C 2Q2HA 3R2TA 4DUZL 2UU9L 2EIFA 4L5TA 1TWHH 5C3EG 3S17H 2KHJA 1XTCD 3CC2A 1G6PA 5C44G 2VQFQ 4POFA 1EQRA 1CQFA 3T53B 1I4XA 2ZXPA 1HR0Q 3KOJA 4DF7A 4YCWA 2JQOA 2PNRC 1A0IA 2WACA 2UXDQ 5M3FG 3JAMi 4XDXA 1F2ZA 3J7ZC 4A3EG 1TKWB 5CV4A 3HKZG 3KBXA 2QDBA 2NVXB 2F3WA 4LW1A 2VUMB 2DUDA 2EPBA 4ABNA 2K03A 3J7YW 2AQ2B 3S24A 4OX9Q 4R4OA 2QF7A 3M4YA 3C46A 3F1ZA 1BKBA 4J6HA 2F4VQ 2RQXA 5C4HA 1JOOA 1LT6D 1KRSA 2E8GA 2RVLA 2AQ1B 2R6GA 2IJ0A 1WTQA 2ZJRA 4IO9A 1AFPA 1SE4A 1KQSA 2R93H 1EIGA 3M4OB 1J9OA 4DR3L 1KDCA 4BY7G 1EIHA 4KJNA 1JB3A 4DUYL 4L8JA 1D5ZC 3M9BA 1STNA 1HR0W 2RBMA 3AFQA 1RDPD 3BVGA 1DGSA 4R4QA 4KY7A 2R3ZA 2L11A 1L1OB 2F4IA 2HQEA 2RDFA 3VYSA 4KD3A 1U4PA 3K7AH 5DLQE 2EYOA 2ICIA 1K8OA 4DV3L 2K7VA 3TSSA 5IYDG 3TP5A 4C3IH 5T1IA 2F0VA 1QWYA 3S2HB 1JE4A 2MUYA 4G7OC 3FPUB 4DV2Q 4KK7A 2WINB 1RODA 1DM0B 1J5EL 3OPOA 3FEWX 1F9QA 1UE5A 1Y1VB 1I6VC 2H1EA 1ASZA 3J81L 5M3MH 1KAWA 4I7AA 1N8RC 1ENAA 1PTOF 4H7BA 1Q1EA 3T4AC 5E4XA 4EGVA 3GTJB 3K5MA 3RNUA 1PH1A 4J1MA 5GAEC 4YHHQ 1EY9A 3STBD 3S16H 3K0XA 4LMQD 3CCSA 2YYZA 3M85A 1BCPC 2I5HA 2PNHA 4DV2L 1VQ7A 1TWAB 1LTRD 2QEJC 1ZEQX 4JI3L 1E22A 1MIUA 3VR3A 1SXTA 1EY6A 3VR2A 1HA6A 3NK9A 1GOZA 2TSSA 1HQMC 2JXMB 3FKIB 3VR6A 2MNAA 2XN9C 4C3JB 1KD1C 4R4IA 1R4PB 2CQAA 1I50H 4KY6A 4U673 5CV8A 1BUVT 1FGUA 1GO3E 4RHSA 3SK6A 1S40A 2I0QA 4YCUA 4PMCA 3DUZA 1C7YA 1W6KA 1N9WA 5GROA 2JA6G 3PO3B 2EY5A 3E9IA 4P2CB 5IP7G 4HN7A 1B2TA 4K6LA 4P75A 1I6HB 1E1TA 2KCNA 4R9WA 5J1ZA 5C3EB 4K5VA 4UP8A 2CCZA 4RA8A 1Z7TA 3CP0A 5A2QE 3NELA 1CSQA 4KHPL 1KXLA 3CC7A 1WD0A 1TS4A 2JYOA 3J81E 1LTSD 2E2IH 4B3MQ 1LTGD 5EBCA 2EOTA 1EWCA 5BN3A 2EYJA 3H91A 2RF4A 1ESFA 3I4OA 2JA5H 1NNXA 2IX3A 5KNDA 4A3MB 2B63G 1VQPA 4A3JB 2AUKA 2QILA 5DNFA 1WOCA 3WOFA 4KTAA 2J4XA 2K33A 2EJMA 1GUTA 1O7LA 4A3DG 2A68C 3G4SA 3G7LA 4AYBE 4J15A 3GP7A 2A5HA 1MSGA 3GDEA 4GOPC 1PV4A 1LT5D 2B8GA 1XPOA 2XIWA 2K4KA 2BOSA 2E76C 1Y1VG 1EQVA 1PYSB 1TQOA 1HPCA 2CH4A 3FMCA 5JJKA 3PUWA 3Q6SA 5D3DA 3S2DH 2KHSA 2WAQG 1PZJD 1EOTA 3J80L 1PTOH 1HTLD 4JVZA 1UUPA 4B9WA 3KBGA 1EFWA 2K5QA 2NYZD 2WAQE 3ND8A 5DEHA 5CBEE 2ATWA 4EQNA 2WB1E 4CJ1B 4DK6C 4KI0A 2A74C 3PCOB 1D5MC 1ENCA 2LS01 1SRUA 1VF7A 1I4HA 4JC0A 1SFOH 1YNXA 1EQTA 2EYHA 4YWMA 2JA8G 4GNXA 1PFMA 3RD4A 3I3CA 2LMCB 4H13C 4JW0A 5F2DA 2MPMA 5FLXL 3W5OA 4QB4A 2KEEA 1YBYA 3A55A 2AKWB 1TWFB 4DGZA 3EJIA 2JA5G 2BA1A 4OONA 1ZXTA 4P71A 2V4DA 2QCPX 3A0JA 2EXDA 3CAMA 1GHKA 1STBA 2A1AA 3ERSX 3GQBA 5FO8B 4ZK9B 1EYDA 4PZ7A 1G51A 1VF5C 2K04A 4QCLA 3VR5A 1X9NA 4N8X1 3I4LA 4QL5A 3TS2A 5GAHC 4KD4A 2SNMA 3MFYA 2MGSA 3MXNA 3X3NA 3C1FA 2ZTDA 2VQEQ 4GNXC 2WKDA 4B3RQ 1L1OA 1IBKL 1HFNA 5CBAE 1XNQQ 4C3HG 1AE2A 3IFTA 3OMCA 4NPSA 1PTOD 1CFMA 2N88A 2IPKD 1YNNC 2B29A 5M5YH 2NVQH 1CA6A 4HEDA 2RSNA 1JB7A 2R92G 3F2BA 2DY7A 2WB1B 3BS1A 1IBMQ 2K5WA 3UE1A 2VY3A 4O42A 4DR3Q 1ET9A 1G6ZA 3L9AX 4IPHA 2L9HA 3TZUA 5M5WB 3PUZA 1OO9B 1X3FA 4JPBW 4BY1G 2G9HD 1SYCA 5C44H 1J6QA 4KKSA 3K5LA 1JOKA 1QG7A 2WV6D 3HP3A 3GTLB 3S1RB 4BY1B 4HR7B 4IUTA 5CMDA 3HOUG 4A3EH 1DD2A 2XSCA 2FFKB 1ICWA 4XTCS 1BCPD 4L5QA 4ODGA 1I50B 2F0IA 1H9KA 1B7YB 1LTLA 2F0DA 4KY5A 1LTID 4XYOA 4IJLA 3U9OA 4U68A 2KCTA 4DNRB 4DUZQ 1JWSD 4C3HB 1Y14B 3LNNA 1FGBD 1RTOA 2A73B 4POGA 5I6WA 1M1KC 3AEVA 1WFQA 2NVYB 2B2WA 1GVPA 2VS1A 3D4WA 2UUAL 4XQJA 2K32A 3DM3A 3VR4A 4LF8L 1V43A 1VQLA 3I4MH 4LFAL 1C0AA 2KECA 4RCNA 1EEFD 3NXWA 1VQAA 4YIJA 1ML0D 2Q8TA 2NBFA 4RH6A 1LM0A 4A76A 3M7NA 4A3GG 2A6HC 4B3TL 3I91A 2JA5B 2A6HD 2D0OA 2BA0A 4CDDC 1A3UA 1PFSA 1AE3A 1SYBA 2HQLA 2AHOB 4LF5Q 2MQHA
chains in the Genus database with same CATH topology
3C3LA 2A6EC 1S5ED 4C3IG 2PZUA 1Y69U 2E74C 1U4LA 2JEBI 1UNSA 3R3OA 4C56C 3LWUA 2F03A 4G4KA 1FD7D 3W2DA 5IT9E 1ZKOA 1OXSC 4IUQA 1TT2A 2CVRA 3SK5A 1BR9A 5KIXA 4FF3A 3O13A 1IYUA 2NZ1D 2XWJB 1JWUD 1KAAA 1X32A 3EQLC 3HOZB 1WTRA 1A2UA 2OXPA 3PMFA 3S15B 1CQVA 1VCIA 2SDFA 4XQQA 1RHPA 5CV6A 1G8ZD 2FJ2A 4B9XA 3SHLA 1GHJA 4G7ZC 3OWFA 5I6YA 1IL8A 2PO4A 1PYWD 1XXGA 4XQNA 1QNKA 1DOLA 3HOUB 4C1NK 3DMUA 2Z4HA 2RDHA 3PO2B 4F87A 3BVMA 3K0YA 5I2XA 4FP5D 2EXZA 2NVQB 5EPJA 4HMIA 5KYIA 5KNBA 3V96A 2D9UA 1CK1A 2PCFB 1DXMA 3MVVA 2RDGA 3OW7A 4PNYA 3VYRA 1Z47A 2DY8A 3GV3A 5IT9L 1B3AA 4LJZC 1TR5A 4K5WA 4CKCA 4ZAIA 1S4ZA 1DOKA 2JEAI 3NTKA 1XYIA 1JQYD 4EQPA 3BDCA 4K6DA 2MHVA 4QUCA 1SJED 2EJGC 4BBSB 2VXWA 1K8MA 2FINB 1JC7A 5LL6S 2L0CA 2PPBC 4FXDA 2O5JC 4XYQA 2NTSA 1MGSA 2F0MA 3KLSA 4KHZA 5AFWA 5KNCA 3CRKC 2NN6G 3RZDB 1PXUA 3K59A 3T16A 1WTOA 4TKOB 4EVOA 4DAVA 3UI2A 1HQRD 5C3WA 3PUXA 3RZOB 1PTOB 1STHA 3P75A 5I9PA 2AQ3B 1GJXA 2HCIA 1II3A 5M5YB 1PRTD 4K14A 3KF8A 3IFDA 1I4QA 4CGYB 1IKLA 1D1IA 1RD9D 2LY7A 2L12A 3GTQB 4FO2A 3A7AB 1KDAA 1EFID 4CKEA 5CR3A 1KDBA 3JAME 4RKBA 3J7AV 4NW2A 1CHQD 1JCKB 4FXGC 3MXUA 2VB3X 1MI2A 2B39A 1E2ZA 5FKAC 3Q22A 2SNSA 3ZYYX 3BYTB 1U4MA 4HSVA 5EKLA 5EPLA 4WRDA 3ND9A 3IKJA 2XNAC 2EZVA 4OO1G 5C0XG 1U9RA 4IFDI 4A3BB 1SNMA 3PV0A 2PQEA 4FXKC 1JR0D 2JA8B 5E4WC 4A3EB 3DEOA 3H3VC 4F88A 2NTTA 1O78A 1NUCA 4KN4C 3DHQA 3H0GB 2F0KA 2JE6I 4I65A 2YU9B 2PMZB 3Q23A 5LL6X 1BBXC 2A69D 3S16B 4KN7C 5EBDA 4IURA 5IGCA 1GUWA 1WTWA 3W3AA 1STGA 1SJHD 1B1ZA 4HCEA 3MTSA 1CT1D 1PZID 1PLFA 5HGTA 4CJ0B 3X3MA 2I46A 2EYPA 5IGGA 3SXHA 2LKVA 2MJ8A 1H9MA 3OHXC 2Q8RE 2CHBD 4CJ2C 1O7YA 4LK1C 2ZT9C 5C0XH 2N55A 4DNTB 5CV5A 1SE3A 4M1UB 4FF1A 2TMPA 4WORA 1Q3LA 4RGMA 3D8GA 3A8IE 4G57A 3PIO3 1TIID 3HOVB 3OWEB 2B2VC 5BN5A 3QJYA 4V0BA 5C0XJ 1SEBD 2HDLA 1Y8OB 3MFGA 2HDMA 2VB2X 2F1MA 4RGTA 2O2LD 4F8MA 1NR4A 2X6LA 3HS0C 5JEAG 1IW7D 3NPPA 1TS5A 1UEAB 5CV7A 4X3UA 1RKNA 2K5DA 1EZ8A 5ISRA 4IQZA 2R61A 2G9DA 5KGUA 3SEBA 3D3RA 4DXFA 1OXXK 3DWAA 4KMUC 5DAUA 1Y8NB 4RWSC 3OIQA 1BXTA 1G91A 5M9OA 3HKZB 1DOMA 3S17B 3VA5A 4KKTA 3MA2B 4H44C 3PIP3 2EJFC 1RJTA 2B2TA 1GUOA 3QOLA 3CQZB 3SE0A 4WFN3 2F0NA 1EY8A 2F0PA 2H4OA 3NTHA 1YNJC 3NP8A 2KJXA 3QOJA 4IFDH 1SYEA 3DXJC 2XVSA 2NUCA 1HA5A 4V190 3GTKB 5T1GA 4BY7B 3QO2A 5E1FA 3KK7A 3I70A 2OT2A 4FF4A 1Q8IA 1HUMA 3E5SA 2EDGA 5TSSA 3M3YB 1C8CA 2RA4A 3VYTA 1QCBD 4OGQC 3K58A 2F0SA 4HAEA 1IHZA 4TSSA 3MC0B 5JAVA 3RMHA 1LO5D 5I2YA 5M5XB 2KA7A 4C2MB 1G291 3URYA 1TS2A 1STEA 4DN4M 2DN8A 1SAPA 1MBYA 1YNJD 3S1NB 1MD2D 1IW7C 2IX1A 4MIUA 1KLUD 2L1BA 3CKIB 4X3TA 2B2YA 1WCMB 1F9PA 5EKKA 5C44B 3GTPB 4C3IB 1CI3M 4FVMA 4C1NI 1XWEA 1O7ZA 1E0BA 3GTMB 4B08A 2IW3A 2L4NA 4OIKA 2F0LA 5CC4A 2ID0A 3HOYB 3I4NB 1M4VA 5JEAJ 2RKSA 3NUCA 4OIJA 1Z6HA 2M2LA 2A69C 2PW7A 4HTHA 5KYLA 5EQ0A 1DJRD 4I7ZC 1DCZA 1WVLA 3HOXB 1C4QA 1CTMA 5IGDA 1PTOC 4F7XA 1EU4A 1ILPA 2BE5C 3WDNA 2X6GA 3A56A 5JPMC 5ELDA 2L5TA 5ELFA 2OF1A 4EQOA 1I4RA 4X3KA 3ERQA 1Q1BA 4XIGS 1PFNA 2C5CA 4NKLA 3P20A 1A3TA 4GZYC 3FRPB 5C5LA 2AWNA 4ID6A 1H9SA 5A2QL 3D6WA 3K57A 4S3SA 1EY0A 3U9SA 1M8AA 2K05A 3CU7A 3R2IA 1AZPA 1E2VA 3EA6A 3TN2A 4K2LA 2KEDA 3H6MA 4PMBA 1CZWA 2M9VA 1TY2A 5LHY1 4IFDG 2QKIC 2VNUD 1GXDC 2RSOA 3D6CA 5EKIA 1AEXA 2F0JA 3PUVA 1SNOA 2KQ3A 2IWHA 1HXYD 4BA1I 1BQQT 1GUSA 5D14A 1HUNA 1EYCA 1OXVA 4TRDA 1HFGA 4HSPA 4J8QA 4JK1C 1IKMA 1TY0A 2WIIB 5CYUA 3I4MB 1C48A 1V1PA 2M00A 1EWHA 3S1MB 1X3PA 2E2DC 3H09A 4KJOA 4M8AA 4HCSA 3SK8A 3MWYW 1FYCA 1V8QA 3D4DA 5COYA 5A35A 1V1OA 2SEBD 4DK0A 2PYKA 1I3QB 2SOBA 1RTNA 3RUZA 3AU7A 1NAPA 1Y8PB 5K5PA 1AW7A 4A3IB 4G7HC 3M7GA 4ZLTF 5C4XB 4RKLA 2Z4IA 1MSHA 2EY1A 1EL0A 1LTAD 3MXPA 2F3VA 4CKBA 2EY6A 1SYDA 4XT1B 5CGKA 2A68D 1AN8A 1G2SA 1KNEA 4DXGA 2BDOA 1Q90A 2E75C 1F9SA 5IOCA 1D6EC 2HUGA 4ZUJA 2E2JB 3J7AF 4WJWA 2DNEA 3A8KE 4ME5A 3AMUA 2JP1A 1W6JA 4RAUC 4R8NA 1FNVA 3PUYA 2BDNA 4K8IA 1FNWA 5M3MB 4DFAA 5D3IB 2R93B 3BZDB 1D1KA 3NBHA 3P1HA 4FYDA 3Q24A 4K5XA 2B2UA 3SVMA 1CZGA 1JICA 3A54A 5CV9A 3CRLC 4RFBA 3K7AB 4A3GB 1SMYD 5DM63 3NWTA 3KLSX 5FK9C 1QNUA 5C6AA 5IGBA 4JBWA 4KKUA 3DWQA 1KLGD 1SFOB 2Q8IB 4RGOS 4UDUC 2WAQB 1BCPF 3KLRA 1BO0A 1NCVA 1R9TB 4HMJA 2C9OA 2PZWA 1TWCB 3NWSA 1OXUA 2MP1A 2OEOA 3EROA 3MXGA 3TBIB 1TVXA 1H9SB 3S2DB 3AB9A 1STAA 4A3KB 3EVQA 4NP5A 4FF2A 1I4PA 3RLFA 4DAPA 1Y1WB 4ZKBB 5ELBA 3NQTA 3I90A 2F0FA 4CBVA 3T51B 4DAYA 3GTGB 1EY4A 3DWPA 4N9PA 5JVG3 2PZTA 3MEHA 3TP6A 3A8JE 2E2HB 4OO1H 2B8FA 2EY2A 2IX0A 3TMEA 3E6ZX 5KRUA 1V1PB 2L55A 4LAAA 1DYQA 1H9RA 1B9MA 3N52A 1QJOA 1BNZA 2D5DA 2IT1A 1TU2B 2DNCA 1KNAA 3SDZA 1R4QB 1PRTC 3S14B 1ET6A 2XRSD 3TP7A 1F2MA 2NVTB 3IL8A 3Q0AA 1F9RA 2WKCA 1SDFA 1PDQA 3C1EA 5G3LD 1EY5A 1U4RA 2EYLA 1JWMD 2KOLA 2ZXOA 1I4GA 2B2UC 1S5CD 1WD1A 3OIPA 4FNFA 5CORA 1KABA 4MHEA 1L0YB 1O80A 3P7JA 4PV1C 1BDOA 3BDLA 4ZRZA 4IUPA 2HCCA 1CA5A 1EEID 4BBRB 3VA7A 1A6XA 2B2YC 5JVH3 5JJZA 1TWHB 3R93A 3I8ZA 4MN3A 1VMPA 3NHHA 2A6ED 2F0WA 1J8IA 4DA2A 3QWNA 5IIFA 3G6JB 2LFNA 4A3DB 4TQUS 1LACA 2ICEC 3GD7A 4UAIA 2K01A 2B63B 2EYMA 1HCZA 3TP8A 4OO1I 1LLRD 1SNPA 1STYA 1QOHA 1SNDA 4DU9A 1D5XC 1ZYRD 4OL7A 4QIWB 1KTKA 5EGTA 3WOEA 3NSWA 4IUVA 3HEJA 3R8BA 2F0TA 2ENBA 3D31A 1JOQA 2NN6H 5K36G 1B44D 1SYFA 3FPPA 4OHJA 4IUNA 2JA7B 1JORA 5M3FB 1L0XB 4Z9CB 2ZXRA 2F0UA 5J22A 2JA6B 4XT3B 1LV9A 3BVZA 3L3OC 3LWEA 1DONA 3L7ZC 1B4OA 3F2UA 3GO5A 3JAML 4C3JG 3MZ5A 3LX0A 1B50A 5I4DA 3D4RA 5HURA 4L6TB 2XWBB 5IGEA 4R8IA 2EE1A 3S9WA 2B2WC 4ILWA 5C3XA 1TWGB 1PZKD 2B2VA 1HTPA 3I72A 2X69A 3H94A 1SE2A 3J80E 4PQXA 4IFDJ 5C0XI 1EZ6A 1BCPB 5NUCA 4N9TA 1PFBA 5D65A 5C4JB 2K28A 4O1NA 4QF4A 3DM1A 2Y0SB 3HZXA 1ILQA 2AUJD 1S5FD 2PW5A 4H0LC 2J0TD 2F0HA 4XXEA 1WTVA 1WTXA 4IN3A 1HRJA 1SYGA 2F0EA 2FMMA 3A7LA 1BOSA 1BF4A 4QMGA 3GTOB 1QILA 1HHVA 4IZ8A 5E3FA 1F2LA 1GUNA 1LABA 2KCCA 3KUPA 4K8JA 4ZYSA 4BA2I 5JEAH 4NMZA 1CHPD 1LTBD 1RCVD 1DZ1A 3T13A 5J39A 1S5BD 5BN4A 4E6IA 4Q0FA 3E0JA 3FVQA 3NQIA 2NN6I 2KUMA 1E2WA 4PMWA 1LTTD 5ELEA 3MAQA 2J7ZA 1B53A 1LT3D 3TDQA 3BG3A 1YNND 4BS9A 3ONAB 2F0GA 3DEPA 2CW0C 3OMGA 1IYVA 1SNQA 1VDZA 5JPNC 4ZUIA 1TS3A 3S1QB 2Z1CA 2K6AA 4RHRA 4K2KA 2D62A 3EFXD 3I73A 1S5DD 3HG9A 2EVBA 1EU3A 4KHVA 5EJWA 1SMYC 4A93B 1F2YA 1ENFA 1A15A 4DK1A 1D2BA 2BCOA 3HRZC 5FLXE 2FHTA 2WP8J 4X3SA 3QG1A 2B2TC 1GUGA 2JSOA 2KVMA 1F77A 4RCOA 1T5EA 2R7ZB 3NBIA 1QE6A 1A2TA 3NTIA 1XX8A 5C4ZA 2EYFA 2R92B 3ITPA 1UAPA 1QB5D 5IODA 4L63B 5G3LF 3QB3A 3QIAA 1VMCA 3HOWB 3T56B 1A3VA 1CM9A 5K36H 1ONLA 4Y7NB 1T5XD 3BYYB 2NB0A 1Q12A 3CHBD 2E2IB 3NE5B 5KEEA 1G2TA 4NDXA 4ULLA 1PRTB 4KV6A 1NR2A 1ESRA 4QUFA 5FO9B 5JOBA 2I07B 4AYBB 3K6OA 3SR1A 2D2CC 3HGBA 2FMCA 1EY7A 2O4XA 1K83B 2CW0D 3K5OA 1SNCA 2NWGA 2O5IC 1X3QA 5EPKA 4RGNA 5C5MA 5DM73 3OSOA 2AWOA 3TZDA 4CHTB 1AZQA 2F0QA 1NSNS 5FO7B 2IL8A 1SBBB 3V2TA 2F0OA 5FOBB 2XRQD 4IALA 3FDTA 1PRTF 1FR3A 1RF2D 3IAYA 3V05A 3SK4A 5I9OA 3BDOA 4ZKCB 4A3FB 4ZQ3A 2K1BA 1ZYRC 1H9JA 3N6RA 1WTPA 1SSOA 2GA4B 2Z8LA 1LT4D 3K5NA 3VYUA 1OXTA 1EYAA 3C2PA 4Q5VA 5IGFA 2BE5D 3OOCA 1FNUA 4BWGB 3MHBA 3GV6A 1PMRA 4IUUA 5ELCA 1B9NA 1AP0A 3R2TA 1XTCD 1CQFA 3T53B 1I4XA 2ZXPA 4DF7A 2PNRC 2WACA 4XDXA 1F2ZA 1TKWB 5CV4A 3KBXA 2QDBA 2NVXB 2F3WA 2VUMB 2EPBA 4ABNA 2K03A 3J7YW 2AQ2B 2QF7A 3M4YA 3C46A 4J6HA 2RQXA 5C4HA 1JOOA 1LT6D 2RVLA 2AQ1B 2R6GA 2IJ0A 1WTQA 1AFPA 1SE4A 1EIGA 3M4OB 1J9OA 1KDCA 1EIHA 4KJNA 1JB3A 4L8JA 1D5ZC 1STNA 2RBMA 3BVGA 1RDPD 4KY7A 2R3ZA 2L11A 2F4IA 2HQEA 2RDFA 3VYSA 4KD3A 1U4PA 2EYOA 2ICIA 1K8OA 2K7VA 3TSSA 3TP5A 5T1IA 2F0VA 1QWYA 3S2HB 1JE4A 2MUYA 4G7OC 3FPUB 4KK7A 2WINB 1RODA 1DM0B 3OPOA 3FEWX 1F9QA 1Y1VB 1I6VC 2H1EA 3J81L 1ENAA 1PTOF 4H7BA 1Q1EA 3T4AC 5E4XA 4EGVA 3GTJB 3K5MA 4J1MA 1EY9A 4LMQD 2YYZA 3M85A 1BCPC 1TWAB 1LTRD 2QEJC 1ZEQX 3VR3A 1SXTA 1EY6A 3VR2A 1HA6A 3NK9A 1GOZA 2TSSA 1HQMC 2JXMB 3FKIB 3VR6A 2XN9C 4C3JB 1R4PB 2CQAA 4KY6A 4U673 5CV8A 1BUVT 4RHSA 3SK6A 4PMCA 3DUZA 1W6KA 3PO3B 2EY5A 4P2CB 4HN7A 1B2TA 4K6LA 1I6HB 2KCNA 4R9WA 5J1ZA 5C3EB 4K5VA 4RA8A 1Z7TA 5A2QE 1WD0A 1TS4A 2JYOA 3J81E 1LTSD 1LTGD 5EBCA 2EOTA 1EWCA 5BN3A 2EYJA 3H91A 1ESFA 2IX3A 5KNDA 4A3MB 4A3JB 2AUKA 2QILA 5DNFA 3WOFA 4KTAA 2J4XA 2K33A 2EJMA 1GUTA 1O7LA 2A68C 3G7LA 3GP7A 2A5HA 1MSGA 1LT5D 2B8GA 2XIWA 2BOSA 2E76C 1EQVA 1TQOA 1HPCA 3FMCA 3PUWA 3Q6SA 5D3DA 2KHSA 1PZJD 1EOTA 3J80L 1PTOH 1HTLD 1UUPA 4B9WA 3KBGA 2K5QA 2NYZD 5DEHA 3ND8A 5CBEE 4EQNA 4CJ1B 4KI0A 2A74C 1D5MC 1ENCA 2LS01 1VF7A 1I4HA 1EQTA 2EYHA 1PFMA 3RD4A 3I3CA 2LMCB 4H13C 5F2DA 2MPMA 5FLXL 4QB4A 2KEEA 3A55A 1TWFB 4DGZA 3EJIA 2BA1A 1ZXTA 2V4DA 2QCPX 1GHKA 1STBA 3GQBA 5FO8B 4ZK9B 1EYDA 1VF5C 2K04A 4QCLA 3VR5A 3I4LA 4KD4A 2SNMA 3MFYA 2MGSA 3MXNA 3X3NA 3C1FA 2WKDA 1HFNA 5CBAE 4C3HG 3IFTA 3OMCA 1PTOD 1CFMA 2N88A 2IPKD 1YNNC 1CA6A 4HEDA 2RSNA 2DY7A 2WB1B 3BS1A 2K5WA 4O42A 1ET9A 1G6ZA 3L9AX 2L9HA 3TZUA 5M5WB 3PUZA 1OO9B 2G9HD 1SYCA 4KKSA 3K5LA 1JOKA 1QG7A 2WV6D 3HP3A 3GTLB 3S1RB 4BY1B 4HR7B 4IUTA 5CMDA 1DD2A 2XSCA 2FFKB 1ICWA 4XTCS 1BCPD 4ODGA 1I50B 2F0IA 1H9KA 2F0DA 4KY5A 1LTID 4XYOA 3U9OA 4U68A 4DNRB 1JWSD 4C3HB 3LNNA 1FGBD 1RTOA 2A73B 5I6WA 2NVYB 2B2WA 3D4WA 4XQJA 2K32A 3VR4A 1V43A 2KECA 4RCNA 1EEFD 3NXWA 4YIJA 1ML0D 2Q8TA 2NBFA 4RH6A 3M7NA 2A6HC 2JA5B 3I91A 2A6HD 2BA0A 1A3UA 1SYBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A35 A;  1E2W A;  2A6E C;  3IFT A;  2Q8I B;  4DK0 A;  5BN5 A;  5K36 H;  1Q1B A;  1CFM A;  1ONL A;  1PMR A;  5KND A;  3QJY A;  1YNN C;  3ND9 A;  3IKJ A;  1Q12 A;  1Y69 U;  2E74 C;  1Y8P B;  2EDG A;  1B9N A;  2AUK A;  4XIG S;  4OO1 G;  1Y8O B;  3KLR A;  3NE5 B;  5C0X G;  4G7O C;  2JEB I;  3BG3 A;  2F1M A;  3P20 A;  3PV0 A;  3LWU A;  3OPO A;  4G7H C;  2K33 A;  2EJG C;  4OGQ C;  2EJM A;  1GUT A;  1O7L A;  1K8M A;  3L7Z C;  1I6V C;  2A68 C;  4GZY C;  1H9S A;  2CW0 C;  5JEA G;  1ZKO A;  1OXU A;  2B8G A;  1IW7 D;  1OXS C;  1IYV A;  2PPB C;  3D4R A;  3TZU A;  1Q1E A;  2O5J C;  2E76 C;  3PUZ A;  1VDZ A;  3U9S A;  1HPC A;  3FMC A;  2A68 D;  3PUW A;  2D2C C;  1O78 A;  1H9S B;  3HGB A;  4KN4 C;  3T53 B;  2KA7 A;  4KKS A;  3AB9 A;  4IQZ A;  1G29 1;  2BDO A;  1E2V A;  1Q90 A;  2DN8 A;  2E75 C;  4KHZ A;  1IYU A;  2JE6 I;  2PNR C;  5KNC A;  4HR7 B;  3CRK C;  2D62 A;  1IW7 C;  4PV1 C;  2NN6 G;  2YYZ A;  3RLF A;  3M85 A;  1DD2 A;  3I72 A;  1HTP A;  1BDO A;  3EQL C;  3ND8 A;  3I73 A;  1OXX K;  4XTC S;  4TKO B;  1TKW B;  3H94 A;  1VCI A;  2O5I C;  2A69 D;  4KMU C;  2DNE A;  4KN7 C;  2EVB A;  3A8K E;  3PUX A;  1H9K A;  3VR3 A;  4IFD G;  3VR2 A;  1Y8N B;  3VA7 A;  1A6X A;  4KI0 A;  1GHJ A;  2AWO A;  3W3A A;  1HQM C;  1SMY C;  2JXM B;  4G7Z C;  1GJX A;  1VF7 A;  3VR6 A;  2A6E D;  2QF7 A;  3M4Y A;  3PUY A;  1CI3 M;  4DNR B;  3T51 B;  4DK1 A;  3PUV A;  2L5T A;  3LNN A;  4BA1 I;  2LMC B;  4H13 C;  2AUJ D;  4KKT A;  4TQU S;  1GUS A;  1LAC A;  4H44 C;  3QG1 A;  4H0L C;  1OXV A;  3A8J E;  4OO1 H;  1GUG A;  2EJF C;  2B8F A;  4KKU A;  1GUO A;  1FR3 A;  2R6G A;  3GD7 A;  1H9M A;  1HCZ A;  2BA1 A;  2K32 A;  1T5E A;  3BDO A;  4LK1 C;  2V4D A;  3VR4 A;  2ZT9 C;  4JK1 C;  1Z6H A;  3SE0 A;  5C0X H;  1V43 A;  3A7A B;  2A69 C;  1ZYR C;  1GHK A;  5KNB A;  3A7L A;  1H9J A;  4DNT B;  1H9R A;  4RCN A;  1B9M A;  4L8J A;  4I7Z C;  3GQB A;  1YNJ C;  1GUN A;  1LAB A;  1DXM A;  2PCF B;  2KCC A;  1DCZ A;  1Z7T A;  1QJO A;  3N6R A;  4BA2 I;  3CRL C;  5JEA H;  2D5D A;  3M7N A;  3OW7 A;  1EWH A;  1VF5 C;  2IT1 A;  2A6H C;  3VR5 A;  1TU2 B;  4IFD H;  2DNC A;  3DXJ C;  3I4L A;  1CTM A;  1OXT A;  2A6H D;  3MXU A;  3A8I E;  3D31 A;  2BA0 A;  3SDZ A;  3MFY A;  2JEA I;  2NN6 H;  4LJZ C;  5BN4 A;  2BE5 C;  3WDN A;  1E2Z A;  5K36 G;  1K8O A;  1FYC A;  2K7V A;  3QIA A;  2BE5 D;  3FPP A;  4JBW A;  3T56 B;  5BN3 A;  1V8Q A;  3OOC A;  2NN6 I; 
#chains in the Genus database with same CATH topology
 4IOC A;  2B63 H;  3C3L A;  2A6E C;  4PZ8 A;  1S5E D;  3M4Q A;  4L5R C;  4C3I G;  2PZU A;  2VZA A;  2E74 C;  1Y69 U;  3GTM H;  1U4L A;  1MJC A;  2VL6 A;  2JEB I;  1UNS A;  3R3O A;  5ELO A;  4C56 C;  1QVG A;  3LWU A;  1X54 A;  2F03 A;  4QQB X;  5M3M G;  4G4K A;  1FD7 D;  3W2D A;  5IT9 E;  4DV6 L;  2Z0S A;  2HHH L;  3GTQ H;  1ZKO A;  4GOP B;  1OXS C;  2B3G A;  4IUQ A;  4JBM A;  1A62 A;  1TT2 A;  3TEH B;  2CVR A;  3EIV A;  3SK5 A;  1BR9 A;  4RG1 A;  3FP9 A;  1HZC A;  5KIX A;  4FF3 A;  3O13 A;  1IYU A;  2NZ1 D;  2XWJ B;  1JWU D;  1KAA A;  1X32 A;  3EQL C;  3HOW G;  1WTR A;  3HOZ B;  1A2U A;  2OXP A;  2RHQ B;  3PMF A;  4C2M H;  1KC8 C;  3S15 B;  4QGU A;  1CQV A;  1VCI A;  1X55 A;  2SDF A;  4XQQ A;  1RHP A;  4JI0 L;  3RZO H;  5CV6 A;  1G8Z D;  2FJ2 A;  4B9X A;  3SHL A;  1GHJ A;  4PZ6 A;  4G7Z C;  4LUV A;  1U5K A;  3OWF A;  3CCU A;  5I6Y A;  5LMN Q;  1IL8 A;  2PO4 A;  1PYW D;  1XXG A;  4XQN A;  4LF4 L;  2VUM H;  2NVT H;  1QNK A;  1X3G A;  1DOL A;  3HOU B;  4LFC L;  3U50 C;  4A3I G;  5HGQ A;  4C1N K;  3DMU A;  2Z4H A;  4X66 Q;  2RDH A;  4JG2 A;  3PO2 B;  4F87 A;  4GNX B;  3BVM A;  2E2H H;  3K0Y A;  5I2X A;  4FP5 D;  2EXZ A;  2NVQ B;  3PF5 A;  5EPJ A;  4HMI A;  5KYI A;  3KLW A;  4BXX G;  5KNB A;  4DV4 Q;  3V96 A;  4DK3 C;  2D9U A;  1CK1 A;  3FHW A;  2PCF B;  2WB1 G;  1DXM A;  3MVV A;  3ULL A;  1QZG A;  2RDG A;  3OW7 A;  4PNY A;  3VYR A;  1EUJ A;  1Z47 A;  2DY8 A;  1HZA A;  2UUA Q;  3GV3 A;  5IT9 L;  1PYB A;  1B3A A;  4LJZ C;  1TR5 A;  4K5W A;  4CKC A;  4ZAI A;  1S4Z A;  4X66 L;  3CCL A;  1DOK A;  2JEA I;  2K5H A;  3K80 C;  3NTK A;  1XYI A;  1JQY D;  2CH4 W;  2E2J H;  4JI1 L;  4EQP A;  3BDC A;  2Z6K A;  4K6D A;  2ZM6 Q;  2MHV A;  4QUC A;  1YJ9 A;  4DKA C;  1SJE D;  4DR4 L;  5FLM H;  1VQE A;  2UXB L;  2L15 A;  1KL9 A;  1CSP A;  2EJG C;  4BBS B;  2VXW A;  1K8M A;  2FIN B;  2A8V A;  1JC7 A;  5LL6 S;  2L0C A;  5JJL A;  2PPB C;  4FXD A;  2O5J C;  2UXC Q;  4XYQ A;  1PH2 A;  2CWP A;  2NTS A;  3KF6 B;  4DV7 L;  2JK8 A;  2Q2U A;  2C35 B;  2JA9 A;  4YHH L;  1KHI A;  2H5X A;  4A3B H;  1MGS A;  2F0M A;  3GTL H;  3KLS A;  4KHZ A;  5AFW A;  5KNC A;  4X64 Q;  3CRK C;  4JI1 Q;  1S3O A;  1UWV A;  2NN6 G;  4DR1 L;  3RZD B;  4L5S A;  1PXU A;  3K59 A;  3T16 A;  1WTO A;  4TKO B;  4JYA L;  4EVO A;  4DAV A;  3UI2 A;  1HQR D;  2ZJP A;  5C3W A;  3PUX A;  4HIK A;  3BZC A;  3RZO B;  1PTO B;  4YCV A;  1STH A;  3P75 A;  5I9P A;  2AQ3 B;  3H0G H;  2IHF A;  1UE7 A;  1GJX A;  1CKO A;  1JJC B;  2HCI A;  2VW9 A;  1II3 A;  5M5Y B;  4A4I A;  1PRT D;  4K14 A;  2ZTE A;  3TQY A;  4CDE C;  3KF8 A;  1SMX A;  3IFD A;  3CCJ A;  1I4Q A;  5IYB H;  4CGY B;  4A75 A;  1IKL A;  2BH2 A;  1D1I A;  1RD9 D;  2LY7 A;  2L12 A;  3GTQ B;  4FO2 A;  3A7A B;  1KDA A;  1EFI D;  4CKE A;  5CR3 A;  1KDB A;  3PSI A;  1VQM A;  3JAM E;  4RKB A;  1TWC H;  2NVY H;  3J7A V;  3T1Y Q;  4NW2 A;  1CHQ D;  1JCK B;  3U58 A;  3K81 C;  4FXG C;  4WJ4 A;  3BJU A;  3MXU A;  2VB3 X;  1FJG Q;  1MI2 A;  1EIY B;  2B39 A;  1E2Z A;  2IHE A;  5FKA C;  5IYC G;  2SNS A;  4C3H H;  3Q22 A;  3ZYY X;  2PQA A;  3BYT B;  3KJP A;  1U4M A;  4HSV A;  5EKL A;  5EPL A;  1IBL L;  1VQG A;  4WRD A;  3ND9 A;  4JI4 L;  3I4N G;  1SN8 A;  2XNA C;  3IKJ A;  2EZV A;  4OO1 G;  5C0X G;  1XTD A;  1U9R A;  4IFD I;  4A3B B;  1SNM A;  3PV0 A;  5IWA L;  4OWX B;  1VQI A;  2PQE A;  1YHQ A;  4FXK C;  1I94 Q;  1JR0 D;  2JA8 B;  5E4W C;  4A3F H;  4A3E B;  4ALP A;  3DEO A;  3F8T A;  3H3V C;  1TXY A;  4F88 A;  2NTT A;  2UXD L;  3FKI H;  1O78 A;  1HNW L;  1NUC A;  4DR5 Q;  4KN4 C;  3MEF A;  2UXB Q;  3DHQ A;  3H0G B;  2F0K A;  2K75 A;  2JE6 I;  4I65 A;  2YU9 B;  2PMZ B;  3Q23 A;  5LL6 X;  4LF7 L;  1BBX C;  3HFZ B;  3RZD H;  2A69 D;  3S16 B;  4KN7 C;  5EBD A;  4IUR A;  5IGC A;  4HJ7 A;  1GUW A;  1WTW A;  1X6O A;  3W3A A;  1YJW A;  1S72 A;  1STG A;  1SJH D;  1UE1 A;  3WWV A;  1GM5 A;  1B1Z A;  4HCE A;  3PGZ A;  3E9H A;  3MTS A;  3HOX H;  1CT1 D;  1PZI D;  1PLF A;  5HGT A;  4CJ0 B;  3X3M A;  4DR5 L;  3S1R H;  4BY1 H;  1HNX Q;  2I46 A;  3NBH B;  2EYP A;  5IGG A;  1ICF B;  3SXH A;  2LKV A;  2MJ8 A;  4A3K G;  3CXC A;  3UE0 A;  1VQH A;  4A3J G;  1H9M A;  3AFP A;  3OHX C;  4A3M G;  2Q8R E;  2CHB D;  4CJ2 C;  1O7Y A;  4LK1 C;  3CD6 A;  3A5U A;  2ZT9 C;  3J80 i;  3S2H H;  5C0X H;  2N55 A;  4DNT B;  5CV5 A;  1SE3 A;  4M1U B;  4FF1 A;  2TMP A;  3IRB A;  4WOR A;  4JI7 L;  3S1M H;  1Q3L A;  4P72 A;  4B3S L;  4RGM A;  4KHP Q;  1TWF H;  1I6H H;  3D8G A;  3A8I E;  4G57 A;  3J81 j;  3PIO 3;  1Q7Y C;  1TII D;  3OTO L;  3HOV B;  4O2D A;  1IYJ B;  2GVB A;  3OWE B;  4HIM A;  4N8F A;  4DR7 Q;  1VQN A;  2B2V C;  5BN5 A;  3QJY A;  4LUO A;  4V0B A;  1WTH A;  4YWL A;  4JI6 Q;  5C0X J;  1C9O A;  1SEB D;  2CKZ B;  2HDL A;  1MHW C;  1Y8O B;  3MFG A;  4K0K L;  2HDM A;  1YI2 A;  2VB2 X;  2F1M A;  2XTI A;  4RGT A;  2O2L D;  2YTV A;  4F8M A;  4JI7 Q;  4LWC A;  1NR4 A;  2X6L A;  4NXN L;  3HS0 C;  5JEA G;  1IW7 D;  1LUZ A;  3NPP A;  2Q2T A;  1TS5 A;  4JOI C;  3GTO H;  1UEA B;  5CV7 A;  3NEM A;  4X3U A;  1RKN A;  4A3B G;  2K5D A;  1EZ8 A;  1Q46 A;  5ISR A;  4IQZ A;  2R61 A;  1NBW A;  2G9D A;  5IP7 H;  3M3Y H;  5KGU A;  3KF6 A;  3SEB A;  3D3R A;  4DXF A;  4PG3 A;  4OWT B;  1OXX K;  3DWA A;  1XMQ L;  4KMU C;  3I56 A;  2MFI A;  5DAU A;  1Y8N B;  4RWS C;  3OIQ A;  4R1J A;  3CPW A;  1X3E A;  2MO0 A;  3K7U C;  2VUM G;  1BXT A;  1G91 A;  5M9O A;  4JV5 Q;  3HKZ B;  1DOM A;  3JAM c;  3S17 B;  1J5E Q;  3VA5 A;  4KKT A;  3MA2 B;  4H44 C;  3HOY H;  4YY3 L;  3PIP 3;  2EJF C;  3PIP A;  1RJT A;  2B2T A;  1GUO A;  3QR8 A;  1PH3 A;  1HZ9 A;  3B6Y A;  4AQY Q;  3QOL A;  3CQZ B;  3SE0 A;  4WFN 3;  1N32 Q;  2F0N A;  2OTJ A;  1EY8 A;  2F0P A;  2H4O A;  1MKH A;  3NTH A;  1YNJ C;  1K28 A;  2R7Z G;  1SLJ A;  3NP8 A;  2KJX A;  2CQO A;  3QOJ A;  4B3R L;  4IFD H;  1SYE A;  3DXJ C;  2XVS A;  2NUC A;  1HA5 A;  4V19 0;  3GTK B;  5T1G A;  2CWA A;  4BY7 B;  1Y1W G;  5IE8 A;  3QO2 A;  1W2B A;  1ASY A;  5E7N A;  1PH8 A;  3I4N H;  3KJO A;  5E1F A;  1EIF A;  3G71 A;  3PO2 H;  2F4V L;  1AH9 A;  3L2P A;  3KK7 A;  1VQJ A;  3I70 A;  1VQK A;  2OT2 A;  4FF4 A;  1Q8I A;  1HUM A;  3E5S A;  2EDG A;  5TSS A;  4HJ9 A;  3M3Y B;  2K50 A;  4UPA A;  1C8C A;  2RA4 A;  3VYT A;  1XPR A;  1QCB D;  4OGQ C;  5C3E H;  3K58 A;  2F0S A;  4HAE A;  1IHZ A;  4CDC C;  4TSS A;  3CCM A;  3I4M G;  3HOZ G;  3MC0 B;  5JAV A;  3RMH A;  2WFW A;  1LO5 D;  5I2Y A;  2PI2 A;  5JJI A;  5M5X B;  2KA7 A;  4C2M B;  1G29 1;  3URY A;  1TS2 A;  1V1Q A;  1STE A;  1VQD A;  4DN4 M;  2DN8 A;  1SAP A;  4OEL B;  1MBY A;  1YNJ D;  3S1N B;  1MD2 D;  3W1G A;  1IW7 C;  1IZ6 A;  2IX1 A;  1EQQ A;  4JI0 Q;  4MIU A;  1KLU D;  2K5V A;  5M5X H;  4DV3 Q;  2L1B A;  3CKI B;  4NXM L;  4Y52 H;  4X3T A;  4JI5 L;  4LFB Q;  3U4Z A;  2B2Y A;  1WCM B;  1F9P A;  4X6A H;  5EKK A;  5C44 B;  3HKS A;  3GTP B;  1SRO A;  4C3I B;  5IYD H;  1CI3 M;  4BBR H;  4FVM A;  4C1N I;  1YJN A;  1XWE A;  2OTL A;  1O7Z A;  1E0B A;  2XGT A;  4UY8 C;  3GTM B;  4B08 A;  2IW3 A;  2MO1 A;  2L4N A;  1GKH A;  4OIK A;  2F0L A;  5CC4 A;  2ID0 A;  3HOY B;  3I4N B;  1XJV A;  4DV4 L;  1M4V A;  5JEA J;  4LF9 L;  2RKS A;  3NUC A;  4LF8 Q;  4OIJ A;  4HJA A;  1Z6H A;  2M2L A;  3GTG H;  2A69 C;  2PW7 A;  1X65 A;  4HTH A;  5KYL A;  5EQ0 A;  1L2F A;  1DJR D;  1CKM A;  4I7Z C;  3ZJY C;  1DCZ A;  1WVL A;  3HOX B;  1C4Q A;  2ASB A;  1CTM A;  1HZB A;  1PTO C;  4F7X A;  5IGD A;  3RLN A;  1EU4 A;  3HOU H;  2Z6B A;  3I7F A;  1ILP A;  3CQZ H;  2BE5 C;  3WDN A;  4ZCK A;  2X6G A;  3A56 A;  5JPM C;  2Z9H A;  5ELD A;  2L5T A;  5ELF A;  4AQY L;  2OF1 A;  1WJJ A;  4EQO A;  1I4R A;  4LF9 Q;  4X3K A;  3ERQ A;  1Q1B A;  1HNX L;  4XIG S;  1PFN A;  2C5C A;  4NKL A;  3VDY A;  3J7A 5;  3P20 A;  1A3T A;  4GZY C;  3FRP B;  5C5L A;  4GKK L;  2UXC L;  2AWN A;  1IXR A;  4ID6 A;  1H9S A;  5A2Q L;  3D6W A;  3K57 A;  4DV0 Q;  3J80 c;  4S3S A;  1MJE A;  2JA8 H;  1EY0 A;  3U9S A;  1M8A A;  2K05 A;  4A93 H;  3CU7 A;  3R2I A;  1VS0 A;  1AZP A;  1E2V A;  3EA6 A;  4X65 L;  1YZ6 A;  3TN2 A;  1L1O C;  3J81 i;  3CCR A;  4K2L A;  2KED A;  2KHI A;  2F52 A;  3H6M A;  4PMB A;  1YIT A;  1CZW A;  2M9V A;  1TY2 A;  4A3G H;  5LHY 1;  4IFD G;  2KEN A;  2QKI C;  2VNU D;  1GXD C;  1K8G A;  1YHA A;  2HT1 A;  4DV0 L;  2RSO A;  3D6C A;  5EKI A;  1AEX A;  2F0J A;  3PUV A;  2QDL A;  1SNO A;  2KQ3 A;  2IWH A;  1HXY D;  4BA1 I;  4DV1 L;  2JA7 G;  1BQQ T;  2UUC Q;  1GUS A;  5D14 A;  3CC4 A;  1EYC A;  1OXV A;  4TRD A;  1HUN A;  1HFG A;  2A19 A;  3ICE A;  3OTO Q;  4HSP A;  5ELN A;  4J8Q A;  3KF8 B;  4JK1 C;  1IKM A;  1TY0 A;  2WII B;  5CYU A;  3I4M B;  1XMO L;  1WYD A;  2RHS B;  3OW2 A;  1C48 A;  1V1P A;  2M00 A;  4K0K Q;  5AJ3 L;  1EWH A;  3S1M B;  1K9M C;  1X3P A;  2R7Z H;  2E2D C;  3H09 A;  1H95 A;  4KJO A;  4M8A A;  4HCS A;  3SK8 A;  3MWY W;  1FYC A;  1V8Q A;  3D4D A;  2N78 A;  5COY A;  3JC6 6;  5A35 A;  1V1O A;  1OTC A;  2SEB D;  4DK0 A;  2PYK A;  1I3Q B;  1PA6 A;  2SOB A;  4A3L G;  1RTN A;  3RUZ A;  3AU7 A;  1NAP A;  1Y8P B;  2PQA B;  3HOV H;  3PO2 G;  5K5P A;  1JMC A;  1AW7 A;  4A3I B;  4G7H C;  1K3R A;  3M7G A;  4ZLT F;  4DV5 L;  5C4X B;  4RKL A;  2Z4I A;  1MSH A;  2EY1 A;  1EL0 A;  1LTA D;  1K83 H;  2YV5 A;  1HNW Q;  3LGJ A;  3MXP A;  2F3V A;  4CKB A;  4A93 G;  3KFU A;  2EY6 A;  4OXP A;  1SYD A;  4XT1 B;  5CGK A;  2A68 D;  5C4J H;  1AN8 A;  1G2S A;  1KNE A;  4DXG A;  2BDO A;  4X62 L;  1Q90 A;  3S1Q H;  2E75 C;  1F9S A;  4RMF A;  5IOC A;  1D6E C;  5HY6 A;  2HUG A;  4ZUJ A;  2Y0S G;  4EX5 A;  2E2J B;  3J7A F;  3NEN A;  5LMN L;  4AH6 A;  4WJW A;  1HR0 L;  1NJI C;  1K0R A;  2DNE A;  1CUK A;  3A8K E;  4OEM B;  4ME5 A;  3AMU A;  5LMU Q;  5IP9 G;  2JP1 A;  3BZK A;  3HOX G;  1D7Q A;  1W6J A;  4RAU C;  2QGQ A;  4R8N A;  4IPG A;  1FNV A;  3PUY A;  1K8A C;  2BDN A;  1LYL A;  4DR2 Q;  4K8I A;  1FNW A;  2HD3 A;  1A63 A;  1E24 A;  5M3M B;  4DFA A;  5D3I B;  1T9H A;  4A3M H;  2YU9 H;  3H3V H;  2R93 B;  3HOY G;  2HHH Q;  3BZD B;  1E1O A;  3UDF A;  1D1K A;  3NBH A;  3P1H A;  4FYD A;  1N36 Q;  3Q24 A;  4K5X A;  5LMN W;  1R9T H;  2B2U A;  3U4V A;  3SVM A;  1CZG A;  1JIC A;  1VQB A;  2LXJ A;  3A54 A;  3EN2 A;  5CV9 A;  3CRL C;  4RFB A;  1JJ2 A;  3K7A B;  2UUC L;  4A3G B;  1SMY D;  4DR2 L;  5DM6 3;  4CDF C;  3NWT A;  3KLS X;  5FK9 C;  5FJ8 H;  1QNU A;  5C6A A;  5IGB A;  4DAM A;  4JBW A;  1YVC A;  4KKU A;  3DWQ A;  1KLG D;  1SFO B;  4LFC Q;  2Q8I B;  4MZ9 A;  4RGO S;  4H02 A;  4UDU C;  4YY3 Q;  2WAQ B;  5GAG C;  1BCP F;  3KLR A;  2R92 H;  4GKJ L;  1BO0 A;  1NCV A;  1K3B C;  1R9T B;  1Q82 C;  4HMJ A;  2C9O A;  2PZW A;  1TWC B;  2BH8 A;  3NWS A;  4A3D H;  1OXU A;  2MP1 A;  2D0P A;  2OEO A;  3ERO A;  2UU9 Q;  2VQF L;  3MXG A;  3TBI B;  4HJ8 A;  1TVX A;  1H9S B;  3S2D B;  3AB9 A;  1STA A;  4A3K B;  3EVQ A;  4DV5 Q;  4IPC A;  4NP5 A;  5BR8 Q;  4FF2 A;  1I4P A;  2N49 A;  3RLF A;  4DAP A;  1Y1W B;  4ZKB B;  2PMZ E;  2Z6K C;  5ELB A;  3NQT A;  3GTJ H;  4B3M L;  2ZJQ A;  1QZH A;  3I90 A;  1PVO A;  2Q2I A;  4YWK A;  2F0F A;  4BBR G;  4CBV A;  3T51 B;  3PF4 A;  4DAY A;  3GTG B;  1EY4 A;  3F2D A;  4GKK Q;  3RN2 A;  3DWP A;  4N9P A;  2E5L Q;  5FJ8 G;  5JVG 3;  1IBK Q;  4GS3 A;  2PZT A;  1NMF A;  3MEH A;  3A8J E;  3TP6 A;  2E2H B;  1XPU A;  4OO1 H;  3PO3 G;  2B8F A;  3A74 A;  2EY2 A;  3STB C;  2R7D A;  4IPD A;  2IX0 A;  4LUZ A;  3TME A;  3E6Z X;  3K8A A;  5KRU A;  3TS0 A;  3ULP A;  3T1Y L;  1V1P B;  4JI8 Q;  2L55 A;  4LAA A;  1DYQ A;  3CW2 C;  1H9R A;  2KBN A;  1FJG L;  1B9M A;  2FXQ A;  4GN5 A;  1NTG A;  4DUY Q;  1BBU A;  1BBW A;  3N52 A;  4NB3 A;  3FKI G;  1QJO A;  2HIX A;  2EQS A;  1BNZ A;  2D5D A;  1VQO A;  2IT1 A;  1TU2 B;  1K0S A;  2DNC A;  1KNA A;  2VQE L;  3S15 H;  4GLX A;  1A8V A;  3SDZ A;  1R4Q B;  1XNQ L;  3H3V I;  1PRT C;  1QUQ B;  3S14 B;  1ET6 A;  4DV1 Q;  1XNR Q;  4WJ3 M;  2XRS D;  5IP9 H;  3T1H Q;  4APV A;  1P16 A;  3TP7 A;  1RIP A;  1F2M A;  1B8A A;  1L0W A;  3GTP H;  1VQ9 A;  2NVT B;  3IL8 A;  4QIW E;  3ULJ A;  4DR6 Q;  4HID A;  1BVS A;  3Q0A A;  1CKN A;  1F9R A;  1SDF A;  1PDQ A;  2WKC A;  3C1E A;  5G3L D;  1EY5 A;  1U4R A;  2EYL A;  1JWM D;  2KOL A;  2N3S A;  2ZXO A;  2HIV A;  1I4G A;  3SGI A;  2B2U C;  1S5C D;  2NVX H;  1VQ6 A;  4P74 A;  1QVF A;  1WD1 A;  3EBE A;  1O7I A;  3OIP A;  1XMQ Q;  3KDF B;  4FNF A;  5COR A;  1KAB A;  4MHE A;  1XNR L;  3CPF A;  1L0Y B;  1O80 A;  3P7J A;  4PV1 C;  4UP7 A;  3PIO A;  4GKJ Q;  1BDO A;  1Y1W H;  3BDL A;  4ZRZ A;  4IUP A;  2YTX A;  2HCC A;  2RCF A;  1CA5 A;  1EEI D;  3W1B A;  4BBR B;  4JYA Q;  4P73 A;  5H1S E;  3VA7 A;  3CME A;  1A6X A;  2B2Y C;  3R93 A;  5JJZ A;  1TWH B;  1WCM H;  3I8Z A;  5JVH 3;  4MN3 A;  1VMP A;  1UE6 A;  2A6E D;  3NHH A;  4DR4 Q;  2F0W A;  2I5L X;  1J8I A;  2GVA A;  4DA2 A;  4MTN A;  3D0F A;  3QWN A;  3G6J B;  5IIF A;  2LFN A;  3HKZ E;  4A3D B;  4DV7 Q;  4TQU S;  3I55 A;  1LAC A;  3HOZ H;  4MTK A;  1N32 L;  1N33 L;  1HNZ L;  2ICE C;  3S14 H;  3S1N H;  3GD7 A;  4UAI A;  2K01 A;  2B63 B;  2EYM A;  4FDB A;  1HCZ A;  3TP8 A;  3GTK H;  4OO1 I;  4A3C H;  1LLR D;  4LNQ A;  1Q8K A;  1SNP A;  3CCE A;  4Y7N H;  1STY A;  1QOH A;  1SND A;  4DU9 A;  1D5X C;  3J81 c;  1ZYR D;  2N8N A;  1E7Z A;  2K5N A;  4BXX H;  4OL7 A;  4QIW B;  4BBS G;  4A3F G;  1KTK A;  5EGT A;  3WOE A;  2OWO A;  3NSW A;  4IUV A;  3HEJ A;  3R8B A;  2F0T A;  2ENB A;  3D31 A;  1JOQ A;  2JA7 H;  2NN6 H;  1UEB A;  2OQ0 A;  5K36 G;  1B44 D;  2QEX A;  1SYF A;  3FPP A;  4OHJ A;  1YEZ A;  4IUN A;  2JA7 B;  1JOR A;  5M3F B;  1L0X B;  4Z9C B;  2ZXR A;  2F0U A;  5J22 A;  1W3S A;  2JA6 B;  4XT3 B;  1LV9 A;  3BVZ A;  3L3O C;  3H0G G;  3LWE A;  5M5W H;  1DON A;  3F2C A;  1JT8 A;  1WI5 A;  3L7Z C;  1B4O A;  3F2U A;  3GO5 A;  3JAM L;  4C3J G;  3MZ5 A;  3LX0 A;  1B50 A;  5I4D A;  2K52 A;  3D4R A;  5HUR A;  1QVC A;  2JJQ A;  5LMU L;  4JOI A;  4L6T B;  2XWB B;  3I2Z A;  5IGE A;  4R8I A;  2EE1 A;  3S9W A;  2B2W C;  4A3K H;  3T1H L;  4JCV E;  2OCE A;  4ILW A;  2CFM A;  4AYB G;  1Z9F A;  1V9P A;  5C3X A;  1EOV A;  1TWG B;  1PZK D;  2B2V A;  1HTP A;  3I72 A;  2X69 A;  3BU2 A;  3H94 A;  1SE2 A;  3J80 E;  4R4C A;  4PQX A;  4IFD J;  5C0X I;  1EZ6 A;  1IBL Q;  1BCP B;  5NUC A;  4NXM Q;  4N9T A;  1PFB A;  1YIJ A;  5D65 A;  3G6E A;  4JI3 Q;  3A5Z B;  5C4J B;  2KCM A;  3CCV A;  2K28 A;  4IJH A;  4O1N A;  1EWI A;  2QA4 A;  4GN4 B;  4JI6 L;  4NXN Q;  4QF4 A;  3DM1 A;  2Y0S B;  3HZX A;  1ILQ A;  2AUJ D;  1S5F D;  2PW5 A;  1FVI A;  4H0L C;  4JI2 Q;  2J0T D;  2F0H A;  5C4X H;  4XXE A;  2DJF C;  1WTV A;  4A3I H;  3M4P A;  5GQO A;  4ME3 A;  1WTX A;  3PO3 H;  4LF6 L;  1NY4 A;  4IN3 A;  4DPG A;  3HOW H;  1HRJ A;  1SYG A;  2F0E A;  2FMM A;  1I3Q H;  3RLO A;  1X56 A;  3A7L A;  1BOS A;  1BF4 A;  4QMG A;  3GTO B;  1QIL A;  1HHV A;  4IZ8 A;  5E3F A;  1F2L A;  2DJG C;  1GUN A;  1LAB A;  1N33 Q;  2KCC A;  3KUP A;  4K8J A;  4ZYS A;  4BA2 I;  5JEA H;  4C3J H;  1B3Q A;  2R7F A;  4NMZ A;  1CHP D;  1LTB D;  4KLK A;  1RCV D;  1DZ1 A;  4JV5 L;  3T13 A;  5J39 A;  1S5B D;  5BN4 A;  4E6I A;  1GD7 A;  1YHB A;  4Q0F A;  3E0J A;  3FVQ A;  3NQI A;  2NN6 I;  2K14 A;  2KUM A;  1E2W A;  3UDG A;  4PMW A;  1LTT D;  5ELE A;  2ALY B;  3MAQ A;  2J7Z A;  4LF4 Q;  1B53 A;  1LT3 D;  3TDQ A;  2R93 G;  1WCM G;  1CKN B;  1SE8 A;  4EQ5 A;  4HJ5 A;  4OX9 L;  3BG3 A;  1YNN D;  1KIX A;  4BS9 A;  5BR8 L;  3ONA B;  5FLM G;  2F0G A;  3DEP A;  3G48 A;  2CW0 C;  4JI8 L;  3OMG A;  1IYV A;  1SNQ A;  2UUB L;  1VDZ A;  5JPN C;  1NE3 A;  4ZUI A;  1I5F A;  5J3B A;  4X64 L;  1TS3 A;  3CCQ A;  4DV6 Q;  4HIO A;  4X65 Q;  3S1Q B;  2Z1C A;  2K6A A;  4RHR A;  4K2K A;  1RL2 A;  2D62 A;  2E5L L;  3EFX D;  4JI5 Q;  2IY5 B;  3I73 A;  5IYC H;  3KDF A;  3H15 A;  1S5D D;  3L0O A;  5M3F H;  3KYH C;  1FL0 A;  1HH2 P;  3HG9 A;  2EVB A;  1EU3 A;  4KHV A;  4A3L H;  2NZO A;  2I5M X;  5EJW A;  1SMY C;  4A93 B;  1B70 B;  1F2Y A;  1ENF A;  1A15 A;  1EYG A;  4DK1 A;  2ZM6 L;  4DR6 L;  3UDX A;  1D2B A;  2BCO A;  3HRZ C;  5FLX E;  2FHT A;  5C4X G;  2WP8 J;  1NMG A;  4A3J H;  4X3S A;  3QG1 A;  2B2T C;  1GUG A;  2JSO A;  5GAD C;  4IOA A;  2KVM A;  4GLV B;  4JI4 Q;  1F77 A;  4RCO A;  5IYB G;  1I94 L;  1N34 Q;  1T5E A;  1K73 C;  5IWA Q;  2R7Z B;  3NBI A;  1QE6 A;  1A2T A;  3NTI A;  1XX8 A;  1XMO Q;  5C4Z A;  2EYF A;  1VQ4 A;  2R92 B;  3ITP A;  3RN5 A;  3MXN B;  1UAP A;  1QB5 D;  1JJG A;  1KRT A;  5IOD A;  1IL2 A;  1Q81 C;  4LF6 Q;  4JBJ A;  4L63 B;  1TWA H;  5G3L F;  4TVA B;  3QB3 A;  3QIA A;  1VMC A;  4B3T Q;  3HOW B;  4LF5 L;  3T56 B;  4QJF A;  5EAY A;  1A3V A;  1CM9 A;  4LF7 Q;  5K36 H;  4AIM A;  1ONL A;  3DLL A;  4Y7N B;  1T5X D;  3BYY B;  2NB0 A;  1Q12 A;  3CHB D;  2E2I B;  1HNZ Q;  4UHV A;  3NE5 B;  1JE5 A;  4QY7 A;  5KEE A;  1G2T A;  4UP9 A;  4NDX A;  1PH6 A;  4ULL A;  1PRT B;  4KV6 A;  1NR2 A;  1ESR A;  2AMC B;  4QUF A;  1D8L A;  3AYH B;  5FO9 B;  3RR5 A;  5JOB A;  3E0E A;  2G5D A;  2I07 B;  4R4T A;  3TRE A;  1IBM L;  3AQQ A;  4AYB B;  3K6O A;  3SR1 A;  2D2C C;  1VQF A;  3HGB A;  4MNO A;  2FMC A;  1EY7 A;  2O4X A;  4X62 Q;  3CF5 A;  1PH5 A;  2LXK A;  1TWG H;  3CMA A;  2F3I A;  1VQC A;  1K83 B;  2CW0 D;  3K5O A;  1PH4 A;  1SNC A;  4A3C G;  2V1C C;  2NWG A;  2RCN A;  1U0L A;  2UUB Q;  2O5I C;  1X3Q A;  2PI2 E;  5IT9 c;  1SR3 A;  5EPK A;  2JN4 A;  4RGN A;  5C5M A;  1P8L A;  5DM7 3;  3OSO A;  4DR1 Q;  2AWO A;  3TZD A;  4DR7 L;  5IY0 A;  4CHT B;  1AZQ A;  2F0Q A;  2P5Z X;  1NSN S;  5FO7 B;  1Y1V H;  2ZTC A;  4GN3 B;  2IL8 A;  1HJP A;  1SBB B;  3V2T A;  2F0O A;  1Q86 C;  5FOB B;  1N36 L;  2XRQ D;  3HOV G;  4IAL A;  3FDT A;  2JA6 H;  1PRT F;  4DAY B;  1FR3 A;  2YTY A;  1RF2 D;  3IAY A;  5L37 A;  3V05 A;  3SK4 A;  5I9O A;  1PH7 A;  3BDO A;  4ZKC B;  5AJ3 Q;  4A3F B;  1PHJ A;  4ZQ3 A;  2K1B A;  1ZYR C;  2Y0S E;  1H9J A;  3TRZ A;  1E3P A;  4B3S Q;  1VQ5 A;  4DNI A;  4BY7 H;  3N6R A;  2OQK A;  1PH9 A;  4LFA Q;  1WTP A;  1SSO A;  2GA4 B;  2GN5 A;  2Z8L A;  3UDI A;  1LT4 D;  2LSS A;  3K5N A;  2NZH A;  4LFB L;  4BBS H;  3VYU A;  1OXT A;  1N34 L;  1EYA A;  3C2P A;  1VQ8 A;  3M4O H;  3Q8D A;  2QW7 A;  4Q5V A;  2ES2 A;  4GLA C;  5IGF A;  2BE5 D;  3OOC A;  2DGY A;  1FNU A;  4BWG B;  3MHB A;  3ER0 A;  4OWW B;  3GV6 A;  1PMR A;  3PQI A;  1QUQ A;  4IUU A;  5ELC A;  4JI2 L;  4JBK A;  1B9N A;  4GOP A;  3OYY A;  1AP0 A;  5FLX c;  4O0A A;  3E3X A;  1M90 C;  2Q2H A;  3R2T A;  4DUZ L;  2UU9 L;  2EIF A;  4L5T A;  1TWH H;  5C3E G;  3S17 H;  2KHJ A;  1XTC D;  3CC2 A;  1G6P A;  5C44 G;  2VQF Q;  4POF A;  1EQR A;  1CQF A;  3T53 B;  1I4X A;  2ZXP A;  1HR0 Q;  3KOJ A;  4DF7 A;  4YCW A;  2JQO A;  2PNR C;  1A0I A;  2WAC A;  2UXD Q;  5M3F G;  3JAM i;  4XDX A;  1F2Z A;  3J7Z C;  4A3E G;  1TKW B;  5CV4 A;  3HKZ G;  3KBX A;  2QDB A;  2NVX B;  2F3W A;  4LW1 A;  2VUM B;  2DUD A;  2EPB A;  4ABN A;  2K03 A;  3J7Y W;  2AQ2 B;  3S24 A;  4OX9 Q;  4R4O A;  2QF7 A;  3M4Y A;  3C46 A;  3F1Z A;  1BKB A;  4J6H A;  2F4V Q;  2RQX A;  5C4H A;  1JOO A;  1LT6 D;  1KRS A;  2E8G A;  2RVL A;  2AQ1 B;  2R6G A;  2IJ0 A;  1WTQ A;  2ZJR A;  4IO9 A;  1AFP A;  1SE4 A;  1KQS A;  2R93 H;  1EIG A;  3M4O B;  1J9O A;  4DR3 L;  1KDC A;  4BY7 G;  1EIH A;  4KJN A;  1JB3 A;  4DUY L;  4L8J A;  1D5Z C;  3M9B A;  1STN A;  1HR0 W;  2RBM A;  3AFQ A;  1RDP D;  3BVG A;  1DGS A;  4R4Q A;  4KY7 A;  2R3Z A;  2L11 A;  1L1O B;  2F4I A;  2HQE A;  2RDF A;  3VYS A;  4KD3 A;  1U4P A;  3K7A H;  5DLQ E;  2EYO A;  2ICI A;  1K8O A;  4DV3 L;  2K7V A;  3TSS A;  5IYD G;  3TP5 A;  4C3I H;  5T1I A;  2F0V A;  1QWY A;  3S2H B;  1JE4 A;  2MUY A;  4G7O C;  3FPU B;  4DV2 Q;  4KK7 A;  2WIN B;  1ROD A;  1DM0 B;  1J5E L;  3OPO A;  3FEW X;  1F9Q A;  1UE5 A;  1Y1V B;  1I6V C;  2H1E A;  1ASZ A;  3J81 L;  5M3M H;  1KAW A;  4I7A A;  1N8R C;  1ENA A;  1PTO F;  4H7B A;  1Q1E A;  3T4A C;  5E4X A;  4EGV A;  3GTJ B;  3K5M A;  3RNU A;  1PH1 A;  4J1M A;  5GAE C;  4YHH Q;  1EY9 A;  3STB D;  3S16 H;  3K0X A;  4LMQ D;  3CCS A;  2YYZ A;  3M85 A;  1BCP C;  2I5H A;  2PNH A;  4DV2 L;  1VQ7 A;  1TWA B;  1LTR D;  2QEJ C;  1ZEQ X;  4JI3 L;  1E22 A;  1MIU A;  3VR3 A;  1SXT A;  1EY6 A;  3VR2 A;  1HA6 A;  3NK9 A;  1GOZ A;  2TSS A;  1HQM C;  2JXM B;  3FKI B;  3VR6 A;  2MNA A;  2XN9 C;  4C3J B;  1KD1 C;  4R4I A;  1R4P B;  2CQA A;  1I50 H;  4KY6 A;  4U67 3;  5CV8 A;  1BUV T;  1FGU A;  1GO3 E;  4RHS A;  3SK6 A;  1S40 A;  2I0Q A;  4YCU A;  4PMC A;  3DUZ A;  1C7Y A;  1W6K A;  1N9W A;  5GRO A;  2JA6 G;  3PO3 B;  2EY5 A;  3E9I A;  4P2C B;  5IP7 G;  4HN7 A;  1B2T A;  4K6L A;  4P75 A;  1I6H B;  1E1T A;  2KCN A;  4R9W A;  5J1Z A;  5C3E B;  4K5V A;  4UP8 A;  2CCZ A;  4RA8 A;  1Z7T A;  3CP0 A;  5A2Q E;  3NEL A;  1CSQ A;  4KHP L;  1KXL A;  3CC7 A;  1WD0 A;  1TS4 A;  2JYO A;  3J81 E;  1LTS D;  2E2I H;  4B3M Q;  1LTG D;  5EBC A;  2EOT A;  1EWC A;  5BN3 A;  2EYJ A;  3H91 A;  2RF4 A;  1ESF A;  3I4O A;  2JA5 H;  1NNX A;  2IX3 A;  5KND A;  4A3M B;  2B63 G;  1VQP A;  4A3J B;  2AUK A;  2QIL A;  5DNF A;  1WOC A;  3WOF A;  4KTA A;  2J4X A;  2K33 A;  2EJM A;  1GUT A;  1O7L A;  4A3D G;  2A68 C;  3G4S A;  3G7L A;  4AYB E;  4J15 A;  3GP7 A;  2A5H A;  1MSG A;  3GDE A;  4GOP C;  1PV4 A;  1LT5 D;  2B8G A;  1XPO A;  2XIW A;  2K4K A;  2BOS A;  2E76 C;  1Y1V G;  1EQV A;  1PYS B;  1TQO A;  1HPC A;  2CH4 A;  3FMC A;  5JJK A;  3PUW A;  3Q6S A;  5D3D A;  3S2D H;  2KHS A;  2WAQ G;  1PZJ D;  1EOT A;  3J80 L;  1PTO H;  1HTL D;  4JVZ A;  1UUP A;  4B9W A;  3KBG A;  1EFW A;  2K5Q A;  2NYZ D;  2WAQ E;  3ND8 A;  5DEH A;  5CBE E;  2ATW A;  4EQN A;  2WB1 E;  4CJ1 B;  4DK6 C;  4KI0 A;  2A74 C;  3PCO B;  1D5M C;  1ENC A;  2LS0 1;  1SRU A;  1VF7 A;  1I4H A;  4JC0 A;  1SFO H;  1YNX A;  1EQT A;  2EYH A;  4YWM A;  2JA8 G;  4GNX A;  1PFM A;  3RD4 A;  3I3C A;  2LMC B;  4H13 C;  4JW0 A;  5F2D A;  2MPM A;  5FLX L;  3W5O A;  4QB4 A;  2KEE A;  1YBY A;  3A55 A;  2AKW B;  1TWF B;  4DGZ A;  3EJI A;  2JA5 G;  2BA1 A;  4OON A;  1ZXT A;  4P71 A;  2V4D A;  2QCP X;  3A0J A;  2EXD A;  3CAM A;  1GHK A;  1STB A;  2A1A A;  3ERS X;  3GQB A;  5FO8 B;  4ZK9 B;  1EYD A;  4PZ7 A;  1G51 A;  1VF5 C;  2K04 A;  4QCL A;  3VR5 A;  1X9N A;  4N8X 1;  3I4L A;  4QL5 A;  3TS2 A;  5GAH C;  4KD4 A;  2SNM A;  3MFY A;  2MGS A;  3MXN A;  3X3N A;  3C1F A;  2ZTD A;  2VQE Q;  4GNX C;  2WKD A;  4B3R Q;  1L1O A;  1IBK L;  1HFN A;  5CBA E;  1XNQ Q;  4C3H G;  1AE2 A;  3IFT A;  3OMC A;  4NPS A;  1PTO D;  1CFM A;  2N88 A;  2IPK D;  1YNN C;  2B29 A;  5M5Y H;  2NVQ H;  1CA6 A;  4HED A;  2RSN A;  1JB7 A;  2R92 G;  3F2B A;  2DY7 A;  2WB1 B;  3BS1 A;  1IBM Q;  2K5W A;  3UE1 A;  2VY3 A;  4O42 A;  4DR3 Q;  1ET9 A;  1G6Z A;  3L9A X;  4IPH A;  2L9H A;  3TZU A;  5M5W B;  3PUZ A;  1OO9 B;  1X3F A;  4JPB W;  4BY1 G;  2G9H D;  1SYC A;  5C44 H;  1J6Q A;  4KKS A;  3K5L A;  1JOK A;  1QG7 A;  2WV6 D;  3HP3 A;  3GTL B;  3S1R B;  4BY1 B;  4HR7 B;  4IUT A;  5CMD A;  3HOU G;  4A3E H;  1DD2 A;  2XSC A;  2FFK B;  1ICW A;  4XTC S;  1BCP D;  4L5Q A;  4ODG A;  1I50 B;  2F0I A;  1H9K A;  1B7Y B;  1LTL A;  2F0D A;  4KY5 A;  1LTI D;  4XYO A;  4IJL A;  3U9O A;  4U68 A;  2KCT A;  4DNR B;  4DUZ Q;  1JWS D;  4C3H B;  1Y14 B;  3LNN A;  1FGB D;  1RTO A;  2A73 B;  4POG A;  5I6W A;  1M1K C;  3AEV A;  1WFQ A;  2NVY B;  2B2W A;  1GVP A;  2VS1 A;  3D4W A;  2UUA L;  4XQJ A;  2K32 A;  3DM3 A;  3VR4 A;  4LF8 L;  1V43 A;  1VQL A;  3I4M H;  4LFA L;  1C0A A;  2KEC A;  4RCN A;  1EEF D;  3NXW A;  1VQA A;  4YIJ A;  1ML0 D;  2Q8T A;  2NBF A;  4RH6 A;  1LM0 A;  4A76 A;  3M7N A;  4A3G G;  2A6H C;  4B3T L;  3I91 A;  2JA5 B;  2A6H D;  2D0O A;  2BA0 A;  4CDD C;  1A3U A;  1PFS A;  1AE3 A;  1SYB A;  2HQL A;  2AHO B;  4LF5 Q;  2MQH A; 
#chains in the Genus database with same CATH homology
 3C3L A;  2A6E C;  1S5E D;  4C3I G;  2PZU A;  1Y69 U;  2E74 C;  1U4L A;  2JEB I;  1UNS A;  3R3O A;  4C56 C;  3LWU A;  2F03 A;  4G4K A;  1FD7 D;  3W2D A;  5IT9 E;  1ZKO A;  1OXS C;  4IUQ A;  1TT2 A;  2CVR A;  3SK5 A;  1BR9 A;  5KIX A;  4FF3 A;  3O13 A;  1IYU A;  2NZ1 D;  2XWJ B;  1JWU D;  1KAA A;  1X32 A;  3EQL C;  3HOZ B;  1WTR A;  1A2U A;  2OXP A;  3PMF A;  3S15 B;  1CQV A;  1VCI A;  2SDF A;  4XQQ A;  1RHP A;  5CV6 A;  1G8Z D;  2FJ2 A;  4B9X A;  3SHL A;  1GHJ A;  4G7Z C;  3OWF A;  5I6Y A;  1IL8 A;  2PO4 A;  1PYW D;  1XXG A;  4XQN A;  1QNK A;  1DOL A;  3HOU B;  4C1N K;  3DMU A;  2Z4H A;  2RDH A;  3PO2 B;  4F87 A;  3BVM A;  3K0Y A;  5I2X A;  4FP5 D;  2EXZ A;  2NVQ B;  5EPJ A;  4HMI A;  5KYI A;  5KNB A;  3V96 A;  2D9U A;  1CK1 A;  2PCF B;  1DXM A;  3MVV A;  2RDG A;  3OW7 A;  4PNY A;  3VYR A;  1Z47 A;  2DY8 A;  3GV3 A;  5IT9 L;  1B3A A;  4LJZ C;  1TR5 A;  4K5W A;  4CKC A;  4ZAI A;  1S4Z A;  1DOK A;  2JEA I;  3NTK A;  1XYI A;  1JQY D;  4EQP A;  3BDC A;  4K6D A;  2MHV A;  4QUC A;  1SJE D;  2EJG C;  4BBS B;  2VXW A;  1K8M A;  2FIN B;  1JC7 A;  5LL6 S;  2L0C A;  2PPB C;  4FXD A;  2O5J C;  4XYQ A;  2NTS A;  1MGS A;  2F0M A;  3KLS A;  4KHZ A;  5AFW A;  5KNC A;  3CRK C;  2NN6 G;  3RZD B;  1PXU A;  3K59 A;  3T16 A;  1WTO A;  4TKO B;  4EVO A;  4DAV A;  3UI2 A;  1HQR D;  5C3W A;  3PUX A;  3RZO B;  1PTO B;  1STH A;  3P75 A;  5I9P A;  2AQ3 B;  1GJX A;  2HCI A;  1II3 A;  5M5Y B;  1PRT D;  4K14 A;  3KF8 A;  3IFD A;  1I4Q A;  4CGY B;  1IKL A;  1D1I A;  1RD9 D;  2LY7 A;  2L12 A;  3GTQ B;  4FO2 A;  3A7A B;  1KDA A;  1EFI D;  4CKE A;  5CR3 A;  1KDB A;  3JAM E;  4RKB A;  3J7A V;  4NW2 A;  1CHQ D;  1JCK B;  4FXG C;  3MXU A;  2VB3 X;  1MI2 A;  2B39 A;  1E2Z A;  5FKA C;  3Q22 A;  2SNS A;  3ZYY X;  3BYT B;  1U4M A;  4HSV A;  5EKL A;  5EPL A;  4WRD A;  3ND9 A;  3IKJ A;  2XNA C;  2EZV A;  4OO1 G;  5C0X G;  1U9R A;  4IFD I;  4A3B B;  1SNM A;  3PV0 A;  2PQE A;  4FXK C;  1JR0 D;  2JA8 B;  5E4W C;  4A3E B;  3DEO A;  3H3V C;  4F88 A;  2NTT A;  1O78 A;  1NUC A;  4KN4 C;  3DHQ A;  3H0G B;  2F0K A;  2JE6 I;  4I65 A;  2YU9 B;  2PMZ B;  3Q23 A;  5LL6 X;  1BBX C;  2A69 D;  3S16 B;  4KN7 C;  5EBD A;  4IUR A;  5IGC A;  1GUW A;  1WTW A;  3W3A A;  1STG A;  1SJH D;  1B1Z A;  4HCE A;  3MTS A;  1CT1 D;  1PZI D;  1PLF A;  5HGT A;  4CJ0 B;  3X3M A;  2I46 A;  2EYP A;  5IGG A;  3SXH A;  2LKV A;  2MJ8 A;  1H9M A;  3OHX C;  2Q8R E;  2CHB D;  4CJ2 C;  1O7Y A;  4LK1 C;  2ZT9 C;  5C0X H;  2N55 A;  4DNT B;  5CV5 A;  1SE3 A;  4M1U B;  4FF1 A;  2TMP A;  4WOR A;  1Q3L A;  4RGM A;  3D8G A;  3A8I E;  4G57 A;  3PIO 3;  1TII D;  3HOV B;  3OWE B;  2B2V C;  5BN5 A;  3QJY A;  4V0B A;  5C0X J;  1SEB D;  2HDL A;  1Y8O B;  3MFG A;  2HDM A;  2VB2 X;  2F1M A;  4RGT A;  2O2L D;  4F8M A;  1NR4 A;  2X6L A;  3HS0 C;  5JEA G;  1IW7 D;  3NPP A;  1TS5 A;  1UEA B;  5CV7 A;  4X3U A;  1RKN A;  2K5D A;  1EZ8 A;  5ISR A;  4IQZ A;  2R61 A;  2G9D A;  5KGU A;  3SEB A;  3D3R A;  4DXF A;  1OXX K;  3DWA A;  4KMU C;  5DAU A;  1Y8N B;  4RWS C;  3OIQ A;  1BXT A;  1G91 A;  5M9O A;  3HKZ B;  1DOM A;  3S17 B;  3VA5 A;  4KKT A;  3MA2 B;  4H44 C;  3PIP 3;  2EJF C;  1RJT A;  2B2T A;  1GUO A;  3QOL A;  3CQZ B;  3SE0 A;  4WFN 3;  2F0N A;  1EY8 A;  2F0P A;  2H4O A;  3NTH A;  1YNJ C;  3NP8 A;  2KJX A;  3QOJ A;  4IFD H;  1SYE A;  3DXJ C;  2XVS A;  2NUC A;  1HA5 A;  4V19 0;  3GTK B;  5T1G A;  4BY7 B;  3QO2 A;  5E1F A;  3KK7 A;  3I70 A;  2OT2 A;  4FF4 A;  1Q8I A;  1HUM A;  3E5S A;  2EDG A;  5TSS A;  3M3Y B;  1C8C A;  2RA4 A;  3VYT A;  1QCB D;  4OGQ C;  3K58 A;  2F0S A;  4HAE A;  1IHZ A;  4TSS A;  3MC0 B;  5JAV A;  3RMH A;  1LO5 D;  5I2Y A;  5M5X B;  2KA7 A;  4C2M B;  1G29 1;  3URY A;  1TS2 A;  1STE A;  4DN4 M;  2DN8 A;  1SAP A;  1MBY A;  1YNJ D;  3S1N B;  1MD2 D;  1IW7 C;  2IX1 A;  4MIU A;  1KLU D;  2L1B A;  3CKI B;  4X3T A;  2B2Y A;  1WCM B;  1F9P A;  5EKK A;  5C44 B;  3GTP B;  4C3I B;  1CI3 M;  4FVM A;  4C1N I;  1XWE A;  1O7Z A;  1E0B A;  3GTM B;  4B08 A;  2IW3 A;  2L4N A;  4OIK A;  2F0L A;  5CC4 A;  2ID0 A;  3HOY B;  3I4N B;  1M4V A;  5JEA J;  2RKS A;  3NUC A;  4OIJ A;  1Z6H A;  2M2L A;  2A69 C;  2PW7 A;  4HTH A;  5KYL A;  5EQ0 A;  1DJR D;  4I7Z C;  1DCZ A;  1WVL A;  3HOX B;  1C4Q A;  1CTM A;  5IGD A;  1PTO C;  4F7X A;  1EU4 A;  1ILP A;  2BE5 C;  3WDN A;  2X6G A;  3A56 A;  5JPM C;  5ELD A;  2L5T A;  5ELF A;  2OF1 A;  4EQO A;  1I4R A;  4X3K A;  3ERQ A;  1Q1B A;  4XIG S;  1PFN A;  2C5C A;  4NKL A;  3P20 A;  1A3T A;  4GZY C;  3FRP B;  5C5L A;  2AWN A;  4ID6 A;  1H9S A;  5A2Q L;  3D6W A;  3K57 A;  4S3S A;  1EY0 A;  3U9S A;  1M8A A;  2K05 A;  3CU7 A;  3R2I A;  1AZP A;  1E2V A;  3EA6 A;  3TN2 A;  4K2L A;  2KED A;  3H6M A;  4PMB A;  1CZW A;  2M9V A;  1TY2 A;  5LHY 1;  4IFD G;  2QKI C;  2VNU D;  1GXD C;  2RSO A;  3D6C A;  5EKI A;  1AEX A;  2F0J A;  3PUV A;  1SNO A;  2KQ3 A;  2IWH A;  1HXY D;  4BA1 I;  1BQQ T;  1GUS A;  5D14 A;  1HUN A;  1EYC A;  1OXV A;  4TRD A;  1HFG A;  4HSP A;  4J8Q A;  4JK1 C;  1IKM A;  1TY0 A;  2WII B;  5CYU A;  3I4M B;  1C48 A;  1V1P A;  2M00 A;  1EWH A;  3S1M B;  1X3P A;  2E2D C;  3H09 A;  4KJO A;  4M8A A;  4HCS A;  3SK8 A;  3MWY W;  1FYC A;  1V8Q A;  3D4D A;  5COY A;  5A35 A;  1V1O A;  2SEB D;  4DK0 A;  2PYK A;  1I3Q B;  2SOB A;  1RTN A;  3RUZ A;  3AU7 A;  1NAP A;  1Y8P B;  5K5P A;  1AW7 A;  4A3I B;  4G7H C;  3M7G A;  4ZLT F;  5C4X B;  4RKL A;  2Z4I A;  1MSH A;  2EY1 A;  1EL0 A;  1LTA D;  3MXP A;  2F3V A;  4CKB A;  2EY6 A;  1SYD A;  4XT1 B;  5CGK A;  2A68 D;  1AN8 A;  1G2S A;  1KNE A;  4DXG A;  2BDO A;  1Q90 A;  2E75 C;  1F9S A;  5IOC A;  1D6E C;  2HUG A;  4ZUJ A;  2E2J B;  3J7A F;  4WJW A;  2DNE A;  3A8K E;  4ME5 A;  3AMU A;  2JP1 A;  1W6J A;  4RAU C;  4R8N A;  1FNV A;  3PUY A;  2BDN A;  4K8I A;  1FNW A;  5M3M B;  4DFA A;  5D3I B;  2R93 B;  3BZD B;  1D1K A;  3NBH A;  3P1H A;  4FYD A;  3Q24 A;  4K5X A;  2B2U A;  3SVM A;  1CZG A;  1JIC A;  3A54 A;  5CV9 A;  3CRL C;  4RFB A;  3K7A B;  4A3G B;  1SMY D;  5DM6 3;  3NWT A;  3KLS X;  5FK9 C;  1QNU A;  5C6A A;  5IGB A;  4JBW A;  4KKU A;  3DWQ A;  1KLG D;  1SFO B;  2Q8I B;  4RGO S;  4UDU C;  2WAQ B;  1BCP F;  3KLR A;  1BO0 A;  1NCV A;  1R9T B;  4HMJ A;  2C9O A;  2PZW A;  1TWC B;  3NWS A;  1OXU A;  2MP1 A;  2OEO A;  3ERO A;  3MXG A;  3TBI B;  1TVX A;  1H9S B;  3S2D B;  3AB9 A;  1STA A;  4A3K B;  3EVQ A;  4NP5 A;  4FF2 A;  1I4P A;  3RLF A;  4DAP A;  1Y1W B;  4ZKB B;  5ELB A;  3NQT A;  3I90 A;  2F0F A;  4CBV A;  3T51 B;  4DAY A;  3GTG B;  1EY4 A;  3DWP A;  4N9P A;  5JVG 3;  2PZT A;  3MEH A;  3TP6 A;  3A8J E;  2E2H B;  4OO1 H;  2B8F A;  2EY2 A;  2IX0 A;  3TME A;  3E6Z X;  5KRU A;  1V1P B;  2L55 A;  4LAA A;  1DYQ A;  1H9R A;  1B9M A;  3N52 A;  1QJO A;  1BNZ A;  2D5D A;  2IT1 A;  1TU2 B;  2DNC A;  1KNA A;  3SDZ A;  1R4Q B;  1PRT C;  3S14 B;  1ET6 A;  2XRS D;  3TP7 A;  1F2M A;  2NVT B;  3IL8 A;  3Q0A A;  1F9R A;  2WKC A;  1SDF A;  1PDQ A;  3C1E A;  5G3L D;  1EY5 A;  1U4R A;  2EYL A;  1JWM D;  2KOL A;  2ZXO A;  1I4G A;  2B2U C;  1S5C D;  1WD1 A;  3OIP A;  4FNF A;  5COR A;  1KAB A;  4MHE A;  1L0Y B;  1O80 A;  3P7J A;  4PV1 C;  1BDO A;  3BDL A;  4ZRZ A;  4IUP A;  2HCC A;  1CA5 A;  1EEI D;  4BBR B;  3VA7 A;  1A6X A;  2B2Y C;  5JVH 3;  5JJZ A;  1TWH B;  3R93 A;  3I8Z A;  4MN3 A;  1VMP A;  3NHH A;  2A6E D;  2F0W A;  1J8I A;  4DA2 A;  3QWN A;  5IIF A;  3G6J B;  2LFN A;  4A3D B;  4TQU S;  1LAC A;  2ICE C;  3GD7 A;  4UAI A;  2K01 A;  2B63 B;  2EYM A;  1HCZ A;  3TP8 A;  4OO1 I;  1LLR D;  1SNP A;  1STY A;  1QOH A;  1SND A;  4DU9 A;  1D5X C;  1ZYR D;  4OL7 A;  4QIW B;  1KTK A;  5EGT A;  3WOE A;  3NSW A;  4IUV A;  3HEJ A;  3R8B A;  2F0T A;  2ENB A;  3D31 A;  1JOQ A;  2NN6 H;  5K36 G;  1B44 D;  1SYF A;  3FPP A;  4OHJ A;  4IUN A;  2JA7 B;  1JOR A;  5M3F B;  1L0X B;  4Z9C B;  2ZXR A;  2F0U A;  5J22 A;  2JA6 B;  4XT3 B;  1LV9 A;  3BVZ A;  3L3O C;  3LWE A;  1DON A;  3L7Z C;  1B4O A;  3F2U A;  3GO5 A;  3JAM L;  4C3J G;  3MZ5 A;  3LX0 A;  1B50 A;  5I4D A;  3D4R A;  5HUR A;  4L6T B;  2XWB B;  5IGE A;  4R8I A;  2EE1 A;  3S9W A;  2B2W C;  4ILW A;  5C3X A;  1TWG B;  1PZK D;  2B2V A;  1HTP A;  3I72 A;  2X69 A;  3H94 A;  1SE2 A;  3J80 E;  4PQX A;  4IFD J;  5C0X I;  1EZ6 A;  1BCP B;  5NUC A;  4N9T A;  1PFB A;  5D65 A;  5C4J B;  2K28 A;  4O1N A;  4QF4 A;  3DM1 A;  2Y0S B;  3HZX A;  1ILQ A;  2AUJ D;  1S5F D;  2PW5 A;  4H0L C;  2J0T D;  2F0H A;  4XXE A;  1WTV A;  1WTX A;  4IN3 A;  1HRJ A;  1SYG A;  2F0E A;  2FMM A;  3A7L A;  1BOS A;  1BF4 A;  4QMG A;  3GTO B;  1QIL A;  1HHV A;  4IZ8 A;  5E3F A;  1F2L A;  1GUN A;  1LAB A;  2KCC A;  3KUP A;  4K8J A;  4ZYS A;  4BA2 I;  5JEA H;  4NMZ A;  1CHP D;  1LTB D;  1RCV D;  1DZ1 A;  3T13 A;  5J39 A;  1S5B D;  5BN4 A;  4E6I A;  4Q0F A;  3E0J A;  3FVQ A;  3NQI A;  2NN6 I;  2KUM A;  1E2W A;  4PMW A;  1LTT D;  5ELE A;  3MAQ A;  2J7Z A;  1B53 A;  1LT3 D;  3TDQ A;  3BG3 A;  1YNN D;  4BS9 A;  3ONA B;  2F0G A;  3DEP A;  2CW0 C;  3OMG A;  1IYV A;  1SNQ A;  1VDZ A;  5JPN C;  4ZUI A;  1TS3 A;  3S1Q B;  2Z1C A;  2K6A A;  4RHR A;  4K2K A;  2D62 A;  3EFX D;  3I73 A;  1S5D D;  3HG9 A;  2EVB A;  1EU3 A;  4KHV A;  5EJW A;  1SMY C;  4A93 B;  1F2Y A;  1ENF A;  1A15 A;  4DK1 A;  1D2B A;  2BCO A;  3HRZ C;  5FLX E;  2FHT A;  2WP8 J;  4X3S A;  3QG1 A;  2B2T C;  1GUG A;  2JSO A;  2KVM A;  1F77 A;  4RCO A;  1T5E A;  2R7Z B;  3NBI A;  1QE6 A;  1A2T A;  3NTI A;  1XX8 A;  5C4Z A;  2EYF A;  2R92 B;  3ITP A;  1UAP A;  1QB5 D;  5IOD A;  4L63 B;  5G3L F;  3QB3 A;  3QIA A;  1VMC A;  3HOW B;  3T56 B;  1A3V A;  1CM9 A;  5K36 H;  1ONL A;  4Y7N B;  1T5X D;  3BYY B;  2NB0 A;  1Q12 A;  3CHB D;  2E2I B;  3NE5 B;  5KEE A;  1G2T A;  4NDX A;  4ULL A;  1PRT B;  4KV6 A;  1NR2 A;  1ESR A;  4QUF A;  5FO9 B;  5JOB A;  2I07 B;  4AYB B;  3K6O A;  3SR1 A;  2D2C C;  3HGB A;  2FMC A;  1EY7 A;  2O4X A;  1K83 B;  2CW0 D;  3K5O A;  1SNC A;  2NWG A;  2O5I C;  1X3Q A;  5EPK A;  4RGN A;  5C5M A;  5DM7 3;  3OSO A;  2AWO A;  3TZD A;  4CHT B;  1AZQ A;  2F0Q A;  1NSN S;  5FO7 B;  2IL8 A;  1SBB B;  3V2T A;  2F0O A;  5FOB B;  2XRQ D;  4IAL A;  3FDT A;  1PRT F;  1FR3 A;  1RF2 D;  3IAY A;  3V05 A;  3SK4 A;  5I9O A;  3BDO A;  4ZKC B;  4A3F B;  4ZQ3 A;  2K1B A;  1ZYR C;  1H9J A;  3N6R A;  1WTP A;  1SSO A;  2GA4 B;  2Z8L A;  1LT4 D;  3K5N A;  3VYU A;  1OXT A;  1EYA A;  3C2P A;  4Q5V A;  5IGF A;  2BE5 D;  3OOC A;  1FNU A;  4BWG B;  3MHB A;  3GV6 A;  1PMR A;  4IUU A;  5ELC A;  1B9N A;  1AP0 A;  3R2T A;  1XTC D;  1CQF A;  3T53 B;  1I4X A;  2ZXP A;  4DF7 A;  2PNR C;  2WAC A;  4XDX A;  1F2Z A;  1TKW B;  5CV4 A;  3KBX A;  2QDB A;  2NVX B;  2F3W A;  2VUM B;  2EPB A;  4ABN A;  2K03 A;  3J7Y W;  2AQ2 B;  2QF7 A;  3M4Y A;  3C46 A;  4J6H A;  2RQX A;  5C4H A;  1JOO A;  1LT6 D;  2RVL A;  2AQ1 B;  2R6G A;  2IJ0 A;  1WTQ A;  1AFP A;  1SE4 A;  1EIG A;  3M4O B;  1J9O A;  1KDC A;  1EIH A;  4KJN A;  1JB3 A;  4L8J A;  1D5Z C;  1STN A;  2RBM A;  3BVG A;  1RDP D;  4KY7 A;  2R3Z A;  2L11 A;  2F4I A;  2HQE A;  2RDF A;  3VYS A;  4KD3 A;  1U4P A;  2EYO A;  2ICI A;  1K8O A;  2K7V A;  3TSS A;  3TP5 A;  5T1I A;  2F0V A;  1QWY A;  3S2H B;  1JE4 A;  2MUY A;  4G7O C;  3FPU B;  4KK7 A;  2WIN B;  1ROD A;  1DM0 B;  3OPO A;  3FEW X;  1F9Q A;  1Y1V B;  1I6V C;  2H1E A;  3J81 L;  1ENA A;  1PTO F;  4H7B A;  1Q1E A;  3T4A C;  5E4X A;  4EGV A;  3GTJ B;  3K5M A;  4J1M A;  1EY9 A;  4LMQ D;  2YYZ A;  3M85 A;  1BCP C;  1TWA B;  1LTR D;  2QEJ C;  1ZEQ X;  3VR3 A;  1SXT A;  1EY6 A;  3VR2 A;  1HA6 A;  3NK9 A;  1GOZ A;  2TSS A;  1HQM C;  2JXM B;  3FKI B;  3VR6 A;  2XN9 C;  4C3J B;  1R4P B;  2CQA A;  4KY6 A;  4U67 3;  5CV8 A;  1BUV T;  4RHS A;  3SK6 A;  4PMC A;  3DUZ A;  1W6K A;  3PO3 B;  2EY5 A;  4P2C B;  4HN7 A;  1B2T A;  4K6L A;  1I6H B;  2KCN A;  4R9W A;  5J1Z A;  5C3E B;  4K5V A;  4RA8 A;  1Z7T A;  5A2Q E;  1WD0 A;  1TS4 A;  2JYO A;  3J81 E;  1LTS D;  1LTG D;  5EBC A;  2EOT A;  1EWC A;  5BN3 A;  2EYJ A;  3H91 A;  1ESF A;  2IX3 A;  5KND A;  4A3M B;  4A3J B;  2AUK A;  2QIL A;  5DNF A;  3WOF A;  4KTA A;  2J4X A;  2K33 A;  2EJM A;  1GUT A;  1O7L A;  2A68 C;  3G7L A;  3GP7 A;  2A5H A;  1MSG A;  1LT5 D;  2B8G A;  2XIW A;  2BOS A;  2E76 C;  1EQV A;  1TQO A;  1HPC A;  3FMC A;  3PUW A;  3Q6S A;  5D3D A;  2KHS A;  1PZJ D;  1EOT A;  3J80 L;  1PTO H;  1HTL D;  1UUP A;  4B9W A;  3KBG A;  2K5Q A;  2NYZ D;  5DEH A;  3ND8 A;  5CBE E;  4EQN A;  4CJ1 B;  4KI0 A;  2A74 C;  1D5M C;  1ENC A;  2LS0 1;  1VF7 A;  1I4H A;  1EQT A;  2EYH A;  1PFM A;  3RD4 A;  3I3C A;  2LMC B;  4H13 C;  5F2D A;  2MPM A;  5FLX L;  4QB4 A;  2KEE A;  3A55 A;  1TWF B;  4DGZ A;  3EJI A;  2BA1 A;  1ZXT A;  2V4D A;  2QCP X;  1GHK A;  1STB A;  3GQB A;  5FO8 B;  4ZK9 B;  1EYD A;  1VF5 C;  2K04 A;  4QCL A;  3VR5 A;  3I4L A;  4KD4 A;  2SNM A;  3MFY A;  2MGS A;  3MXN A;  3X3N A;  3C1F A;  2WKD A;  1HFN A;  5CBA E;  4C3H G;  3IFT A;  3OMC A;  1PTO D;  1CFM A;  2N88 A;  2IPK D;  1YNN C;  1CA6 A;  4HED A;  2RSN A;  2DY7 A;  2WB1 B;  3BS1 A;  2K5W A;  4O42 A;  1ET9 A;  1G6Z A;  3L9A X;  2L9H A;  3TZU A;  5M5W B;  3PUZ A;  1OO9 B;  2G9H D;  1SYC A;  4KKS A;  3K5L A;  1JOK A;  1QG7 A;  2WV6 D;  3HP3 A;  3GTL B;  3S1R B;  4BY1 B;  4HR7 B;  4IUT A;  5CMD A;  1DD2 A;  2XSC A;  2FFK B;  1ICW A;  4XTC S;  1BCP D;  4ODG A;  1I50 B;  2F0I A;  1H9K A;  2F0D A;  4KY5 A;  1LTI D;  4XYO A;  3U9O A;  4U68 A;  4DNR B;  1JWS D;  4C3H B;  3LNN A;  1FGB D;  1RTO A;  2A73 B;  5I6W A;  2NVY B;  2B2W A;  3D4W A;  4XQJ A;  2K32 A;  3VR4 A;  1V43 A;  2KEC A;  4RCN A;  1EEF D;  3NXW A;  4YIJ A;  1ML0 D;  2Q8T A;  2NBF A;  4RH6 A;  3M7N A;  2A6H C;  2JA5 B;  3I91 A;  2A6H D;  2BA0 A;  1A3U A;  1SYB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...