3A8IE

Crystal structure of et-ehred-5-ch3-thf complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
128
structure length
127
Chain Sequence
b'SNVPAELKYSKEHEWLRKEADGTYTVGITEHAQELLGDMVFVDLPEVGATVSAGDDCAVAESVAASDIYAPVSGEIVAVNDALSDSPELVNSEPYAGGWIFKIKASDESELESLLDATAYEALLEDE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aminomethyltransferase
publication title Crystal structure of aminomethyltransferase in complex with dihydrolipoyl-H-protein of the glycine cleavage system: implications for recognition of lipoyl protein substrate, disease-related mutations, and reaction mechanism
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/transport protein
total genus 29
structure length 127
sequence length 128
chains with identical sequence F
ec nomenclature
pdb deposition date 2009-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01597 GCV_H Glycine cleavage H-protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3a8iE00
1GUOA 2R6GA 3VR5A 2A69D 1FR3A 3T53B 3A8JE 5A35A 3D31A 2LMCB 3HGBA 1E2WA 3EQLC 2BA0A 2A6HC 4OGQC 3OOCA 5BN4A 1O78A 2CW0C 4H44C 4KMUC 3M7NA 1OXVA 4XIGS 1H9RA 4RCNA 1QJOA 1HPCA 3GD7A 3I73A 4PV1C 4DK1A 2KCCA 2E75C 5JEAG 1FYCA 4KKUA 3SDZA 4JBWA 3CRKC 4DNRB 2JE6I 1OXTA 1GHJA 1Y8PB 3W3AA 2PCFB 4KKTA 3VR6A 2D62A 5K36H 2ZT9C 3KLRA 4TKOB 1IW7D 1Q12A 3M4YA 1VF7A 2A6EC 1HQMC 2E74C 4DK0A 3M85A 1BDOA 4BA2I 3FPPA 1ZYRC 4OO1H 3H94A 2KA7A 3LNNA 1B9MA 2AUJD 1ONLA 2F1MA 4HR7B 4IQZA 5C0XG 1EWHA 1K8OA 3PUVA 4TQUS 3PV0A 5BN3A 2K7VA 3AB9A 3QIAA 1Q1EA 2NN6H 1HCZA 4KHZA 1H9JA 4L8JA 2BE5C 2Q8IB 3T56B 3VR2A 2E76C 2L5TA 3RLFA 1VCIA 1OXXK 4IFDG 2D5DA 1A6XA 1GHKA 2BA1A 1E2ZA 2K32A 3A7AB 3MFYA 3VR3A 1K8MA 1VF5C 1OXSC 2O5JC 2A68C 1LACA 3DXJC 3N6RA 3QG1A 3CRLC 4JK1C 1YNNC 4GZYC 5BN5A 2JEAI 3GQBA 4BA1I 1O7LA 4H0LC 4KN7C 3BDOA 2EJFC 2V4DA 2A69C 1HTPA 3BG3A 3OPOA 4I7ZC 3NE5B 4LK1C 1IYVA 1GUTA 1Z7TA 1DXMA 4KN4C 3IKJA 1YNJC 1B9NA 2EVBA 2AWOA 3IFTA 1E2VA 2DNEA 2QF7A 3A8KE 1H9MA 1T5EA 3WDNA 5K36G 2A6HD 1CTMA 3OW7A 3QJYA 3T51B 1H9SB 3U9SA 2BE5D 1GUGA 3FMCA 3ND8A 1G291 2EJMA 1Q90A 3P20A 1GUSA 2EJGC 3PUXA 1OXUA 2DNCA 1H9KA 4KI0A 4OO1G 3PUWA 2BDOA 3I4LA 1DCZA 2A68D 4G7OC 1CFMA 2YYZA 1V8QA 1Z6HA 1H9SA 5KNCA 2AUKA 2DN8A 4IFDH 3A7LA 5KNBA 5JEAH 1Q1BA 1Y69U 1GJXA 4G7HC 2PPBC 1TKWB 3VR4A 4DNTB 2A6ED 1IYUA 1Y8OB 3PUYA 1DD2A 1CI3M 4XTCS 3TZUA 5KNDA 2NN6I 1V43A 1ZKOA 4KKSA 3LWUA 1SMYC 2D2CC 3PUZA 1LABA 3MXUA 2JEBI 2O5IC 2IT1A 2PNRC 1VDZA 2K33A 3ND9A 3VA7A 4G7ZC 3D4RA 1I6VC 5C0XH 1TU2B 3A8IE 1PMRA 1IW7C 2EDGA 3SE0A 3I72A 2B8FA 3L7ZC 4LJZC 2B8GA 1Y8NB 1GUNA 4H13C 2NN6G 2JXMB
chains in the Genus database with same CATH superfamily
1FGUA 2K14A 1EY9A 2O4XA 1XYIA 1QNUA 3KDFA 1NNXA 1KRSA 2AHOB 2B39A 2B63H 1Y1WB 3L9AX 1AE3A 2EXZA 3F8TA 5EKKA 1GVPA 5CV4A 4S3SA 4DNRB 2QEXA 1U4LA 1IBMQ 1Y8PB 3TP5A 1SE2A 2G5DA 1IBKQ 2E74C 4A3JB 1HA5A 2IWHA 3MXPA 1LO5D 1LTID 4BBSG 4OO1H 4JYAL 1MSHA 2JA6B 1T9HA 4AQYL 2N49A 2H4OA 2NZ1D 2UUCQ 2RSNA 4R8IA 2EYOA 1A0IA 5J39A 4C3HB 4A76A 3R93A 3K58A 1N33L 1D5ZC 3A7AB 4HIKA 1CHPD 3CKIB 1C8CA 4UY8C 1AN8A 3OWEB 2O5JC 1QVGA 3OW2A 4DV0L 1CA5A 3D0FA 2B63G 4JI8Q 4I7ZC 3NE5B 4JI7Q 5D65A 2R93G 2QW7A 1S5ED 2CQOA 2AWOA 4DV7Q 4B3RL 1YHBA 2DNEA 2UUBQ 3I90A 4IFDJ 1KDBA 1S3OA 4AYBE 2WAQB 1H9SB 4Y52H 3FP9A 4P72A 4H7BA 1G291 5EQ0A 4OO1G 2VUMB 1PTOD 3DWPA 3HOWB 3UI2A 1EYCA 2G9HD 2RBMA 1V8QA 5AJ3L 2DN8A 5JJZA 1Q86C 3MZ5A 2RCNA 3MWYW 2L9HA 3K57A 3ER0A 1ZKOA 4EVOA 4OIJA 1SMYC 1PXUA 2XNAC 3BS1A 2I5HA 4GLXA 2I46A 2HDMA 4KJOA 3RMHA 1IBLQ 3R3OA 1SYFA 5D3IB 1I6VC 3VDYA 1I3QH 3F2DA 4PNYA 2BH8A 3TSSA 2F0VA 4ZLTF 1YJNA 2UUAQ 2Q2TA 3L7ZC 1QCBD 1SNCA 4A3EH 2UXBQ 3S15B 3U50C 4GLAC 3HGBA 4IO9A 2UU9L 5T1IA 4OONA 3PIPA 1QZHA 4Q0FA 3HOXB 1SEBD 3FDTA 3K5NA 1OXVA 3A5ZB 3OSOA 1A62A 2ZJRA 2VQFL 4LF5Q 1ET9A 2KCCA 4LF6Q 1SFOB 5DM63 1B53A 1FYCA 5LHY1 1BR9A 1I4RA 4JYAQ 3M3YB 3S24A 2GVAA 5IYDG 4FXGC 2O2LD 4LWCA 1HQMC 3K5OA 1UE5A 3NPPA 3FHWA 1PYSB 3AU7A 3RD4A 1C7YA 1ASZA 1FNUA 2A74C 1EWHA 4IPGA 4O42A 3WOFA 2HIXA 2OEOA 1QZGA 4DV0Q 4XQNA 3W1GA 4DGZA 1HNZL 2JA7G 4B3TL 3RLNA 4A3EG 1L0YB 4OWXB 1QG7A 3CCEA 4B3RQ 4QQBX 3MEHA 3S2HH 3TP8A 1I4GA 4QUFA 1GKHA 4KTAA 3TP6A 1MBYA 1VMPA 1T5XD 1ML0D 3AFPA 4JW0A 3A8KE 3PMFA 3RNUA 5FLXc 3ULLA 2EJMA 3PUXA 3P20A 1GUSA 5C4HA 1K3RA 5M3FG 2BDOA 1UE7A 1JJGA 1H9SA 2E5LL 1B8AA 4CDCC 4IUUA 3K8AA 4C1NI 2NVXB 1ET6A 4HJ9A 3UDGA 3KF8B 3D6WA 5M3MH 4HJ8A 2D2CC 5LMUL 1Y1WH 3CPWA 2VQEL 4JI6L 1C0AA 1KC8C 3J80E 1DZ1A 2KHIA 3U4ZA 5C0XH 3C1EA 2H5XA 1X3GA 1JC7A 2PMZB 1YI2A 1L1OB 3R2TA 2B8FA 2PI2E 4DPGA 1A3TA 4A3JH 1X55A 4DR3L 4BBRG 2QGQA 4DF7A 1KHIA 4F88A 2OQ0A 3NEMA 3D31A 2E2HB 3CCUA 5GAEC 4EGVA 2KCMA 2IPKD 4KMUC 2K04A 2MP1A 4A3FG 2BDNA 4XIGS 1TIID 1X6OA 1PTOC 1B2TA 4DXFA 2Z6BA 1WD1A 2F0DA 2R7ZG 5IY0A 4ME5A 1TXYA 4HJ7A 4FF2A 3KLRA 1BO0A 5M3MG 4A3BG 4A3LH 1BCPD 2I5MX 3M85A 3CCQA 4A3IB 3S16B 3FPPA 1HNZQ 1CHQD 2F1MA 1MHWC 2CWAA 5GROA 3BYYB 4FO2A 3V2TA 5C0XG 4UAIA 1JT8A 1C48A 3AB9A 3D8GA 3K80C 3TBIB 2PQAB 2VUMH 2N3SA 2AQ3B 1GXDC 3DLLA 2EYFA 3N6RA 1Q8IA 2Y0SE 4GZYC 4C3IB 1G2SA 5J22A 2OWOA 2IX1A 1VQLA 1G2TA 3BG3A 2C5CA 2QKIC 4L6TB 4CDEC 1LUZA 1D1IA 1STEA 1ENCA 2K01A 3KYHC 4A3LG 1FGBD 3QWNA 2PQEA 2F3IA 1Q90A 3GV3A 4QIWE 3I4LA 2E2DC 1SJHD 2YYZA 5IT9E 3ONAB 1Y1VG 5KNCA 5LMUQ 4DV3L 4JI6Q 3NWSA 5FO9B 3S15H 1Q1BA 2ID0A 3E5SA 3KLWA 1GJXA 1CQFA 1JORA 3U4VA 1X3EA 1I94L 1V1PB 4BY1G 3HOXH 1EUJA 3LWUA 3PUZA 4UHVA 5DM73 1M8AA 2HDLA 3BVMA 1VDZA 3HKSA 2C35B 2LS01 1TWAB 2AWNA 4PG3A 3MXNA 1LTGD 2XGTA 5EPKA 2BCOA 5D14A 1ESFA 3KF8A 3GTGB 1ENFA 3SR1A 5KGUA 1U4RA 4YIJA 4JV5L 2F0HA 3I2ZA 2R6GA 2RDGA 2EIFA 4JG2A 5JJLA 3OOCA 3GV6A 2NUCA 4B08A 2WB1E 3CQZH 4KLKA 4KKUA 3J81i 1LV9A 5K36H 1N34L 1SNDA 1PFSA 3HKZB 4M1UB 1VQBA 3KK7A 3ULPA 2FFKB 4HMJA 2CHBD 4KHPQ 3H94A 4DR6L 2KA7A 1NBWA 1J6QA 4MTKA 2K5HA 5IYBH 3PV0A 4BY7B 1X56A 4JOIC 1HUMA 3T56B 3A74A 5M5YB 3UE0A 4A93H 3P1HA 2OQKA 5IGGA 4H0LC 4DKAC 2PQAA 4OEMB 3HOYB 4K2KA 2NVXH 3T4AC 1YZ6A 1JJCB 1BKBA 4U673 2CVRA 5K36G 4UPAA 4JI1L 1CQVA 4HJAA 3IL8A 1O7YA 1QVFA 1S72A 2KCTA 2WIIB 3LX0A 2Q8TA 1W2BA 1J5EQ 1DOLA 3F2BA 1WTXA 1VQJA 2F4IA 4J6HA 3A5UA 4YCUA 1LT5D 2A5HA 4EQ5A 5IYBG 1VQHA 1VQ7A 4LF8L 3RUZA 4G7HC 1SRUA 3VR4A 2R92B 4DR1L 1G6PA 3J80L 2E2HH 3TZUA 4OX9L 4J8QA 4PZ6A 1GD7A 2K1BA 1VQ8A 1SNPA 5CYUA 4MIUA 1SLJA 1TQOA 4RHSA 4JV5Q 2R61A 1EYDA 2ZXOA 3ERSX 1PMRA 1V1PA 4GOPB 1YITA 3F2CA 4DR2Q 4IUQA 4IURA 3BVGA 1EIFA 1PH3A 1Y8NB 1KD1C 3S16H 1ENAA 2NN6G 3CCJA 5M5WB 3A8JE 5TSSA 2K5DA 4A3KH 4QGUA 2EY2A 4Y7NB 3KF6A 2QDLA 1N34Q 4RH6A 2L4NA 5ELNA 1QVCA 1YVCA 1HPCA 3MC0B 5I2XA 2HUGA 3HOVB 3PF5A 2YU9H 2NYZD 3E6ZX 3KDFB 2RKSA 4KKTA 1WI5A 3T1HL 4HIOA 4OHJA 1B50A 3JC66 3SXHA 4DK3C 4F8MA 3I4NH 3LNNA 3HOUB 1U0LA 3UE1A 1SBBB 5HGQA 3EVQA 3HS0C 2OCEA 3P75A 4QJFA 1EY5A 4WJ4A 5NUCA 1RTOA 3K6OA 1OXXK 1A6XA 3PCOB 1E2ZA 3IRBA 2ZJPA 2CFMA 1MJEA 2ZJQA 4FYDA 3EBEA 4DV6Q 1SE3A 1M4VA 4A3KG 5KEEA 3KJPA 1RCVD 1FJGQ 1GUTA 2FJ2A 1R4PB 5ELFA 1TWCH 4CGYB 4LF9L 1PRTB 2B2VA 2RSOA 3M4OB 4DR5L 4RGTA 5IT9L 1TWAH 4LF4Q 3FMCA 3ND8A 4LF8Q 1EWCA 1HH2P 3WOEA 1FVIA 3I4NG 2NTTA 2K6AA 4CKBA 4ALPA 2A68D 4ILWA 5J1ZA 3MVVA 3A7LA 1DYQA 1IYUA 1CKOA 1CI3M 1TS2A 1KL9A 2IHEA 2NN6I 4NXML 4XT1B 4C1NK 1XJVA 1HFGA 1WJJA 1B3AA 1Q8KA 4IOCA 2EY1A 4JI0Q 3ND9A 3RLOA 4IALA 4JI7L 2VL6A 2PZWA 2RHSB 3GTKB 1EQVA 3UDIA 4DV7L 2UUBL 4Q5VA 1SE8A 4HCEA 5C44B 1SSOA 1YNND 1EYAA 3G4SA 2EPBA 1TS5A 3HOZB 2ES2A 2A69D 3URYA 5A35A 5I6WA 5C3EH 2MQHA 3TREA 3EQLC 2KECA 2SNSA 2LXKA 4JVZA 2E2IH 1G6ZA 4H44C 4IPHA 5M5YH 1JOKA 3RZOH 4A3GH 4X3UA 1WTOA 5FJ8G 1OTCA 1KQSA 1OXTA 1X65A 4PMBA 1ZXTA 3BZKA 2QCPX 1A2UA 4CBVA 1E7ZA 1O7IA 3FPUB 3S14B 5L37A 4MHEA 1PV4A 3F2UA 2IHFA 1ZYRC 1CM9A 3GTJB 3TS2A 4CKEA 1AH9A 2F0UA 2UUAL 1JICA 5LMNW 1NJIC 1UWVA 2RDHA 4ZUIA 3H3VH 1RDPD 2E76C 4DNIA 1I4QA 3RLFA 1TWHB 4L5QA 2B2UA 2UXBL 2BA1A 5A2QE 1VF5C 3NELA 5C3EG 3H15A 3DXJC 3DMUA 3AFQA 2E2JH 4LF9Q 1XX8A 4C2MH 3FKIH 5IIFA 4DR5Q 3S1QB 2R92H 2WB1G 3AYHB 4FNFA 4LK1C 4LF5L 4LF6L 3VYRA 1LTSD 4KN4C 4RCOA 2MNAA 3K59A 1K83B 4A3GG 1J9OA 2LFNA 2EVBA 1EQTA 2WINB 2A6HD 2B2UC 1JE4A 2KBNA 2PZTA 1XPRA 3A54A 5M5XH 2WAQE 1IKMA 1MKHA 3S1NB 1H9KA 3H0GB 2J7ZA 4NXMQ 3CMEA 5JAVA 1JOOA 5FLMH 4Z9CB 5G3LF 1N36Q 2HHHQ 1I6HB 1EIGA 4Y7NH 3DHQA 1TWFB 4BXXH 2JA8B 1YBYA 2F0EA 1JWUD 3NTHA 4UP8A 5EPLA 2O5IC 5ELOA 2WV6D 1SAPA 3FKIG 3RN2A 3HOVH 4A3DB 1KDAA 2JJQA 4G7ZC 4XQQA 1EY6A 3NUCA 3E0JA 2OF1A 1TU2B 1YHAA 5EKIA 3PO3H 2B2TC 1RD9D 1VMCA 4IUTA 4RAUC 3S2DB 1PH2A 2CQAA 1BUVT 2RDFA 3S1MH 1EFID 1PTOB 1EIHA 4NXNQ 2NBFA 2J4XA 4K6LA 3BU2A 3S17B 4DV4Q 4JI3L 1XTCD 2A73B 3CRKC 1KNAA 3G6EA 1VS0A 2JE6I 4E6IA 1NTGA 1IW7D 1ICWA 3Q6SA 5BR8Q 1II3A 1VF7A 1YJ9A 2TMPA 3CAMA 4N8X1 3F1ZA 5LL6X 1EQQA 1BBWA 1B9MA 2A1AA 3MAQA 1RKNA 2M00A 4AYBB 2JSOA 5BN3A 3PO3G 3CP0A 1K8GA 4R8NA 1YHQA 2A8VA 4K6DA 1HNXL 3AQQA 3MEFA 3VR3A 5K5PA 5EJWA 4JI5L 2MGSA 2Z4IA 3CCMA 1E24A 2N55A 1YNNC 2FXQA 1GM5A 2B2WC 4B9WA 1WD0A 3I4MH 4J1MA 2A69C 3WWVA 1VQCA 1Z7TA 1CZWA 2YTYA 1HRJA 2IY5B 2NVYB 1C9OA 1STGA 1BBUA 4I7AA 1EQRA 1JOQA 3A56A 1S5FD 1XWEA 3EJIA 1PRTF 3GTKH 4P71A 1M90C 2EJGC 4UDUC 3R8BA 1EZ6A 3GP7A 3KJOA 2X69A 4OO1I 3L2PA 3EA6A 3W2DA 4IFDH 1F2YA 3S1RB 1D7QA 5DEHA 4LF7L 2LY7A 2N78A 3J81c 4ZAIA 2IT1A 1STHA 2DY8A 5IGFA 5C4XB 3I4MG 3GTQB 1JJ2A 1WTHA 2F0QA 3PO2H 3RZDH 2N88A 3A8IE 4ZKBB 4HJ5A 2K75A 3CW2C 4X3KA 3S14H 2PMZE 1PH6A 5EAYA 5ISRA 4QB4A 2B8GA 2JXMB 1RTNA 1FR3A 3MXNB 1AP0A 4JI3Q 2A6HC 1SROA 2FINB 3VYSA 1STNA 5KIXA 2ALYB 4K2LA 4KV6A 1TWHH 4RCNA 4X66Q 4RMFA 5CV5A 4WORA 2JYOA 1A8VA 3NSWA 5FLXE 3HG9A 3SK8A 1UE6A 2Q2HA 2D0OA 3DEOA 1WCMB 2Z1CA 1F2MA 5T1GA 2WFWA 2ZXRA 1TVXA 4KK7A 1MSGA 4YCVA 4CHTB 3J81j 4GNXC 1HNXQ 3GO5A 2KEEA 2RCFA 2CKZB 4ZRZA 5IP7H 4YWKA 2JA6H 2RF4A 3GTPB 5A2QL 4CDDC 4JI5Q 4IQZA 3PO2G 1U9RA 4LFAQ 1SN8A 1WOCA 4C3HH 2XRQD 3K0XA 3CMAA 3S1NH 2KUMA 4JC0A 3TRZA 1C4QA 4K14A 4R4CA 3H91A 4QCLA 3KUPA 3VYTA 3J7YW 4DR4L 4X6AH 1TR5A 4LFBQ 3BYTB 3K5MA 1CZGA 1Y1WG 2Z8LA 1JR0D 4N9TA 1I6HH 1IYVA 4DV1L 3EIVA 5GAHC 3IKJA 2K5NA 4A3MB 1PFBA 1J8IA 1I50B 3T1YQ 2HD3A 3K7AB 4IUVA 1WTWA 2EYHA 3U9SA 3A0JA 1PH1A 2MO1A 4A3JG 1K0RA 4QY7A 3E0EA 4KHPL 4C3JB 2DNCA 1LTBD 4LF7Q 3HOWH 3GDEA 2JA6G 2MHVA 4CJ2C 1CSPA 1TWGB 2ATWA 1LTTD 1QOHA 2MUYA 4C3HG 4DV5L 2PPBC 1KLUD 1RF2D 3DM1A 4JI4L 2ZTDA 2ZXPA 3MXUA 2XIWA 4AIMA 4YY3L 1FD7D 4O1NA 1OO9B 1N32Q 3VA7A 3S17H 1EU3A 2ASBA 1MIUA 3TMEA 1UUPA 2G9DA 5I2YA 3PIO3 3OTOQ 3S9WA 4LJZC 4N9PA 5IWAL 2WAQG 4XXEA 2EE1A 3T16A 1RL2A 3VR5A 1J5EL 4FF1A 3I4OA 2VUMG 2YV5A 4HIMA 3HOWG 1LTLA 1S4ZA 5M9OA 5JVH3 2F3VA 1IZ6A 4OWTB 3U9OA 3JAMi 1VQMA 3CCLA 2H1EA 3NXWA 1O80A 5CV6A 2F0OA 1PTOF 1SFOH 2Y0SB 2C9OA 3M3YH 2MJ8A 4P73A 4B9XA 4ID6A 4PQXA 2F0MA 2D62A 2ZT9C 3BZCA 3KF6B 1DM0B 3CCSA 2GA4B 1BDOA 4YHHL 1LYLA 2JQOA 1SNMA 3TZDA 1K8OA 4DUZQ 4DR2L 1NR4A 4EQOA 1SYCA 1EY7A 2Q8IB 4DR4Q 4K8IA 5C0XI 4OWWB 4QIWB 2Z4HA 1PYWD 2D5DA 1JCKB 3SGIA 1ILQA 2F0NA 1IHZA 3NTKA 4RWSC 3QOJA 4JOIA 4APVA 4DV1Q 1OXSC 1B3QA 2F0JA 2K05A 4JK1C 4X62Q 1HA6A 4WJ3M 2AMCB 5HY6A 3HOXG 1O7LA 4IPDA 5CGKA 3S1RH 1CA6A 3O13A 1EFWA 1I4XA 1HZ9A 5JVG3 2JA5B 4EQNA 1KTKA 3NQTA 4ULLA 2XN9C 3SEBA 1T5EA 3CC2A 2D0PA 4L5TA 2EY6A 2HIVA 3CU7A 5JEAJ 2IX0A 4PZ8A 3V05A 1ASYA 3GTQH 2BE5D 3E9HA 3FEWX 2B29A 2K5WA 2LKVA 2F52A 5C5MA 2YTXA 4DV5Q 4ZK9B 2NVQB 1HR0W 1F77A 1PZJD 1CFMA 4JI4Q 2F0KA 4XT3B 2HQEA 1Y69U 4YY3Q 4NPSA 2PI2A 4DV6L 3BZDB 1HJPA 2IX3A 4KY7A 1KLGD 3QB3A 4DAPA 3NENA 3CC7A 3MFGA 4GKJQ 3I70A 4BBSB 2CH4A 1FJGL 5IWAQ 2AQ2B 2RQXA 2Q2UA 2KEDA 4NB3A 1VQOA 2P5ZX 3Q24A 3M4PA 5IGCA 1VQ4A 1BCPC 4CJ0B 1VQEA 1I4HA 4F7XA 2KVMA 3J7ZC 4H13C 4LF4L 1K0SA 1EL0A 3GTPH 2RHQB 4RKBA 4JBKA 3EROA 1E2WA 4P74A 4OGQC 1E3PA 1EOTA 4A93G 5FLXL 2K5VA 3PGZA 2B63B 1H9RA 3GD7A 2VB2X 4WJWA 1JMCA 2R93B 4YHHQ 1GUWA 3EN2A 1Q46A 1A15A 4YCWA 2DGYA 3I3CA 3KOJA 4TSSA 1Q12A 1QUQA 4JI0L 4A3IH 1VQAA 4HR7B 1SYBA 1PH5A 5E4XA 3QIAA 1A63A 3NP8A 2VNUD 4FVMA 3T13A 3B6YA 3EFXD 1YNXA 1Z47A 4KD4A 1RHPA 4C3IH 2JEAI 2V1CC 1NR2A 1K9MC 1PHJA 1AEXA 1VQ6A 4DA2A 1IXRA 3IFTA 3TS0A 1RJTA 4X64Q 3QO2A 2F4VQ 3OW7A 3T51B 5JJKA 4G57A 4A3IG 4NKLA 2K03A 1BNZA 1Y14B 3C2PA 1DONA 1B7YB 1PFNA 4KHVA 3PF4A 1DD2A 1TKWB 1ICFB 1E22A 2FMMA 5KNDA 1PDQA 5J3BA 4GKKQ 2NWGA 4DU9A 4C3IG 4N8FA 1XMQQ 1ZEQX 2XSCA 2K4KA 1E0BA 4FF4A 1PRTD 2WKCA 2ZTEA 2PYKA 4X65L 1I3QB 3U58A 3GTGH 2UXDQ 1IYJB 1FNWA 3I72A 2NVTB 1MI2A 1Q82C 1XNQL 2JA7B 1TY0A 2F0FA 3MHBA 1TT2A 1PH7A 2K52A 4A3EB 2AKWB 5IP9H 1I5FA 3TDQA 1L0XB 4DV2L 1YIJA 1KIXA 3C1FA 1HQRD 3H09A 1HNWQ 3M7NA 3FRPB 1PH8A 4GN4B 2MO0A 1QJOA 3I56A 1N36L 2HHHL 4DK1A 1SJED 2E75C 1A2TA 2GN5A 3RR5A 4O0AA 4X3SA 3VR6A 4AH6A 4GS3A 1LTRD 4UP7A 1EEID 1S40A 3D4WA 2UXCQ 3G6JB 4U68A 4NDXA 5M3FB 4GN3B 1PYBA 3DWAA 3D3RA 2XWBB 1V9PA 5KYLA 4BY7H 4PMWA 1L0WA 1EEFD 5C4ZA 1AZQA 1H9JA 1SNQA 2L11A 1VCIA 3K7UC 2NVQH 3NHHA 1VQFA 5IP9G 4IJHA 3H3VC 1TY2A 3PIP3 4NXNL 5CV8A 1Z9FA 3S2HB 2EJFC 5CMDA 1B4OA 3HOYH 1H95A 2CCZA 4DV4L 2VXWA 1B9NA 5KYIA 3KBGA 3IAYA 5LMNL 5C5LA 5BR8L 3DM3A 1BVSA 4BBRB 3HKZG 5DNFA 2CW0D 4IOAA 2F0IA 1GUGA 1LT3D 3BVZA 3L0OA 4EX5A 1OXUA 1R9TB 1K8AC 2F0WA 4XYQA 4G7OC 4RG1A 4CDFC 4ZUJA 4BY7G 4GOPC 4A3FB 4R4QA 1HHVA 4B3SQ 2Z6KC 5CORA 1SYDA 4K8JA 2A6ED 1Y8OB 1D1KA 2HCCA 2R7ZB 1B70B 1EOVA 3BJUA 1LT4D 1JQYD 4X65Q 5M3MB 4X3TA 4XDXA 2X6GA 4A3BB 2NTSA 1WTQA 2R93H 1WTRA 4POFA 3VYUA 1XNQQ 1GOZA 1PVOA 3HOYG 2B2YC 3N52A 4DV2Q 4FF3A 1W6KA 1CKNB 4MNOA 1SYEA 3MA2B 4LFCQ 2EZVA 3OYYA 4KY5A 3AEVA 1JB3A 1P16A 1GUNA 1GO3E 3A55A 4TVAB 1K3BC 2B2TA 5M5WH 2SNMA 5I4DA 1NY4A 2F03A 5AFWA 2MFIA 2R3ZA 2R7FA 3QOLA 4DAVA 4F87A 1W6JA 3D6CA 1DJRD 4M8AA 5EBCA 3TN2A 4HTHA 1D2BA 2R92G 1ESRA 1JWMD 4R1JA 3W3AA 2PCFB 4GNXB 2PW7A 3M4YA 3OIPA 4KJNA 1F9PA 1K73C 2M9VA 5ELEA 3HOUH 4LAAA 1QE6A 2NZOA 5KRUA 1V1OA 3PUVA 4JI2Q 3OMGA 1Y1VB 3SVMA 1WYDA 1Q1EA 4L8JA 1PRTC 5JJIA 5FLMG 1VQNA 3IFDA 3MFYA 2R7DA 5FOBB 1LM0A 4BY1B 2A68C 3E3XA 5C3WA 2HT1A 3G71A 5LMNQ 5GQOA 4BXXG 1D5XC 4X66L 1HTPA 3OPOA 1NE3A 4B3ML 2B2WA 1D6EC 3HOVG 2VY3A 2VW9A 3LWEA 1X3QA 2ZM6L 3DEPA 4L5SA 5IYDH 3TEHB 1H9MA 4V190 2N8NA 3M4OH 4RA8A 3AMUA 2JK8A 3I91A 1LLRD 5E1FA 5IOCA 1M1KC 2TSSA 2EYJA 4KI0A 4DAMA 1K28A 3ZJYC 3HOUG 3KLSA 5D3DA 4DUYL 4LFAL 3TP7A 2NVTH 3PQIA 2E8GA 2RVLA 2AUKA 2JA7H 4YWMA 3JAMc 5KNBA 4IN3A 1EY0A 1UEAB 5C0XJ 3M7GA 1VQDA 5FO8B 1X54A 4LUVA 3K5LA 3TQYA 3H3VI 2FMCA 1VQKA 2DJGC 1EU4A 1WVLA 1VQPA 2JEBI 1F9SA 4LFBL 1WTVA 5IE8A 1CT1D 1G8ZD 4JBMA 4O2DA 5FK9C 3HZXA 4ZQ3A 5HURA 2I07B 1EWIA 2OTLA 4AQYQ 4GLVB 3C46A 4GN5A 3DWQA 3CD6A 1XTDA 3T1YL 1YEZA 2EDGA 5C44H 2Q8RE 4K5VA 1SYGA 1UEBA 4YWLA 1KABA 1STAA 3DUZA 5M3FH 1N33Q 1O7ZA 3HOZH 1MJCA 3T53B 4RGNA 3JAME 1BXTA 1CKNA 2BA0A 4BS9A 2CW0C 4BWGB 5IGBA 2HCIA 5IODA 2RA4A 4XYOA 3CQZB 3W5OA 1TS4A 2I5LX 5CC4A 1EYGA 2DUDA 4DFAA 3NBIA 1RODA 2ICEC 3I7FA 1FL0A 2QA4A 1KAWA 1XMOL 1QWYA 2A6EC 1N32L 4DK0A 5JPNC 3V96A 4ABNA 4RGMA 2AUJD 1IL8A 3GTJH 4GNXA 3J80c 3OTOL 4H02A 4BBRH 5DLQE 5AJ3Q 3J81E 5C44G 1PH9A 3HEJA 5IYCH 1QB5D 4IFDG 1SR3A 1X3PA 1R9TH 2ZTCA 3HOZG 4B3MQ 2EOTA 4FDBA 5ELCA 1F9QA 4A93B 2ZM6Q 4A3FH 5BN5A 3J7AV 1VQIA 1VQ5A 4P75A 3S1QH 2R7ZH 1DOKA 1K83H 5EBDA 4L63B 2PNHA 4A3BH 4DUYQ 4OL7A 2F0SA 2IJ0A 2WP8J 3R2IA 4JCVE 4KD3A 1KDCA 5DAUA 5HGTA 2PW5A 4QL5A 1JB7A 1UNSA 3H0GH 2QEJC 2JN4A 2Z0SA 3PUWA 4ZYSA 2UU9Q 3UDXA 4DUZL 4K5WA 3GTOB 3NTIA 3MXGA 2NB0A 5ELDA 2GVBA 5E7NA 1AE2A 2VQFQ 3CF5A 4DNTB 5IYCG 1AFPA 5CR3A 2OT2A 1V43A 1XXGA 1TWFH 2JA8H 4X62L 1LABA 1UAPA 1DGSA 1PZID 2IW3A 2PNRC 3I55A 4A3DH 1HXYD 2KCNA 1STBA 3ITPA 5CBAE 3ICEA 1BCPB 1R4QB 1IBLL 4L5RC 5IP7G 1IW7C 3NK9A 2CWPA 1RIPA 3GTLB 4NMZA 5GAGC 3S2DH 1GUOA 4B3TQ 4HSVA 4A3KB 3H0GG 1Y1VH 1EY8A 4LW1A 1PTOH 1YNJD 4HEDA 5BN4A 3I8ZA 4QUCA 1XMOQ 2J0TD 3I73A 1EZ8A 2XWJB 4PV1C 5ELBA 5IT9c 4HCSA 4BY1H 2YU9B 1HUNA 4IFDI 2BOSA 1SE4A 5CV7A 1GHJA 4TKOB 4K0KL 4RHRA 1PZKD 1UE1A 2JA8G 3GTMB 4GKJL 4MN3A 1PA6A 4A3DG 3I4NB 5I9PA 4FP5D 4I65A 1ILPA 1Q3LA 4TQUS 3CC4A 4OELB 2K7VA 2E5LQ 4KHZA 4CKCA 2SDFA 2EXDA 1QUQB 2L5TA 2SOBA 2L0CA 1GHKA 4K5XA 2K32A 5FO7B 1KAAA 4RGOS 1K8MA 3CXCA 1LACA 3QG1A 1X9NA 2VQEQ 3BDOA 3OHXC 1U4PA 2V4DA 4IJLA 3HKZE 4NP5A 2KJXA 2NVYH 1TWCB 3M4QA 4DR7L 1HZCA 1XPUA 3C3LA 4DR3Q 1XPOA 3X3MA 1WFQA 1BQQT 3STBD 1NSNS 1DCZA 1F9RA 2F3WA 4AYBG 4R4OA 4DAYB 4ZCKA 2WACA 3SHLA 1CSQA 1SDFA 3Q8DA 3PUYA 1D5MC 4EQPA 3ERQA 4XTCS 1L1OA 2L12A 5EKLA 1QILA 2NZHA 4KY6A 4J15A 3H6MA 2A19A 3CCRA 1KXLA 1S5CD 4QF4A 5C4XH 5C4JB 2ICIA 1HR0L 1KNEA 4TRDA 4R4TA 4X64L 3JAML 4PZ7A 3J80i 2F4VL 3KFUA 1LTAD 1G51A 4LMQD 1L1OC 1X3FA 2K5QA 1EY4A 3K0YA 5C3EB 2KQ3A 2LMCB 3NBHB 4DXGA 3J7AF 2E2IB 4K0KQ 5JOBA 3KLSX 2WB1B 5COYA 2WKDA 3LGJA 3RZOB 1EIYB 2OTJA 4A3GB 1SXTA 1W3SA 4JBJA 1SMXA 2DY7A 1XNRL 4GKKL 1WCMH 3OIQA 4V0BA 2FHTA 2EQSA 4ODGA 1XMQL 1V1QA 1VQ9A 3J81L 4WFN3 5G3LD 5C4XG 4ZKCB 4WRDA 5LL6S 1ONLA 3Q22A 1HFNA 2PZUA 2UXDL 4P2CB 4C56C 2XVSA 2EYLA 3ZYYX 2F0TA 2NN6H 4DV3Q 4FXDA 3NWTA 2I0QA 2DJFC 3M9BA 1LT6D 1U5KA 5E3FA 3P7JA 1I94Q 2EY5A 1N9WA 3GTOH 2E2JB 4C2MB 1HNWL 3GQBA 4DR7Q 1NMGA 4KN7C 3FKIB 1MGSA 2B3GA 4OIKA 1QNKA 1U4MA 1ZYRD 4CJ1B 2Z9HA 3SK4A 1YNJC 2VB3X 4A3MH 4R4IA 1I50H 2KHJA 2QF7A 3PIOA 1Q81C 3K7AH 3WDNA 1WCMG 1CTMA 4MTNA 5H1SE 2QDBA 1CK1A 1A3UA 2UXCL 5M5XB 4NW2A 1IL2A 3HFZB 4C3JH 1I4PA 2X6LA 2L55A 2JA9A 1Z6HA 1SNOA 1TWGH 2CH4W 4A4IA 1N8RC 3GTLH 2D9UA 5JEAH 1PLFA 2EYMA 1WTPA 5E4WC 4LUOA 1MD2D 1L2FA 4DK6C 5CV9A 5CBEE 4HIDA 4A75A 1IKLA 2KENA 4G4KA 4JPBW 4DN4M 2K50A 1HR0Q 3SK5A 1NUCA 4KKSA 2M2LA 3J7A5 4IPCA 4DAYA 1A3VA 2HQLA 2BH2A 1F2ZA 3MTSA 4HAEA 4DR6Q 2LSSA 1E1OA 4IUPA 4R9WA 4A3MG 3PO3B 3GTMH 1JWSD 2XRSD 1BCPF 1CUKA 2F0GA 4HSPA 4A3CH 2XTIA 4C3JG 3S1MB 1XNRQ 1O78A 5I6YA 5EGTA 4OXPA 1AZPA 1E1TA 4B3SL 4FXKC 1KRTA 3STBC 5JEAG 1BOSA 1G91A 3SDZA 3NBHA 3OMCA 4JBWA 3BDCA 5GADC 2PO4A 2LXJA 1BBXC 3CPFA 5C6AA 4JI1Q 3Q0AA 4BA2I 3OWFA 2L15A 1IBML 1S5BD 4RKLA 2AQ1B 2JP1A 1JE5A 4LFCL 2ENBA 1IBKL 4RFBA 2KOLA 1HCZA 2BE5C 1SMYD 1X32A 3VR2A 4IUNA 3UDFA 4POGA 2VZAA 1PH4A 4DR1Q 4A3CG 2QILA 5IGDA 4OX9Q 1Q7YC 2UUCL 1F2LA 3PSIA 3CRLC 4MZ9A 3HRZC 5JPMC 5I9OA 2YTVA 5EPJA 2EYPA 4BA1I 4IZ8A 3I4MB 3SK6A 2JA5H 5FJ8H 4PMCA 4HMIA 1DXMA 2B2VC 2Y0SG 1D8LA 1E2VA 3L3OC 5F2DA 2MPMA 3ULJA 2IL8A 5FKAC 3QJYA 1HZBA 3VA5A 4JI8L 5C4JH 1NMFA 2F0LA 2F0PA 3D4DA 3NQIA 3G7LA 3BDLA 2L1BA 5C3XA 1TS3A 1NCVA 4UP9A 4JI2L 3CHBD 3QR8A 1B1ZA 1PFMA 2KHSA 3FVQA 2K28A 1P8LA 1S5DD 3E9IA 3HP3A 4XQJA 4GOPA 2Z6KA 1BF4A 3KBXA 4HN7A 4QMGA 4LNQA 1VQGA 1YJWA 3T1HQ 1AW7A 3K81C 3Q23A 2VS1A 1B44D 2K33A 2Q2IA 4BBSH 1DOMA 1FNVA 2JA5G 2OXPA 3D4RA 3RN5A 3PO2B 3G48A 3RZDB 1HZAA 3W1BA 2SEBD 4LUZA 3SE0A 2B2YA 4ME3A 3CCVA 3X3NA 1HTLD 1STYA 1CKMA 5IGEA 1NAPA
chains in the Genus database with same CATH topology
1EY9A 2O4XA 1XYIA 1QNUA 2B39A 1Y1WB 3L9AX 2EXZA 5EKKA 5CV4A 4S3SA 4DNRB 1U4LA 1Y8PB 3TP5A 1SE2A 2E74C 4A3JB 1HA5A 2IWHA 3MXPA 1LO5D 1LTID 4OO1H 1MSHA 2JA6B 2H4OA 2NZ1D 2RSNA 4R8IA 2EYOA 5J39A 4C3HB 3R93A 3K58A 1D5ZC 3A7AB 1CHPD 3CKIB 1C8CA 1AN8A 3OWEB 2O5JC 1CA5A 4I7ZC 3NE5B 5D65A 1S5ED 2AWOA 2DNEA 3I90A 4IFDJ 1KDBA 2WAQB 1H9SB 4H7BA 1G291 5EQ0A 4OO1G 2VUMB 1PTOD 3DWPA 3HOWB 3UI2A 1EYCA 2G9HD 2RBMA 1V8QA 2DN8A 5JJZA 3MZ5A 3MWYW 2L9HA 3K57A 1ZKOA 4EVOA 4OIJA 1SMYC 1PXUA 2XNAC 3BS1A 2I46A 2HDMA 4KJOA 3RMHA 3R3OA 1SYFA 5D3IB 1I6VC 4PNYA 3TSSA 2F0VA 4ZLTF 3L7ZC 1QCBD 1SNCA 3S15B 3HGBA 5T1IA 4Q0FA 3HOXB 1SEBD 3FDTA 3K5NA 1OXVA 3OSOA 1ET9A 2KCCA 1SFOB 5DM63 1B53A 1FYCA 5LHY1 1BR9A 1I4RA 3M3YB 4FXGC 2O2LD 1HQMC 3K5OA 3NPPA 3AU7A 3RD4A 1FNUA 2A74C 1EWHA 4O42A 3WOFA 2OEOA 4XQNA 4DGZA 1L0YB 1QG7A 3MEHA 3TP8A 1I4GA 4QUFA 4KTAA 3TP6A 1MBYA 1VMPA 1T5XD 1ML0D 3A8KE 3PMFA 2EJMA 3PUXA 3P20A 1GUSA 5C4HA 2BDOA 1H9SA 4IUUA 4C1NI 2NVXB 1ET6A 3D6WA 2D2CC 3J80E 1DZ1A 5C0XH 3C1EA 2PMZB 1JC7A 3R2TA 2B8FA 1A3TA 4DF7A 4F88A 3D31A 2E2HB 4EGVA 2IPKD 4KMUC 2K04A 2MP1A 2BDNA 4XIGS 1TIID 1PTOC 1B2TA 4DXFA 1WD1A 2F0DA 4ME5A 4FF2A 3KLRA 1BO0A 1BCPD 3M85A 4A3IB 3S16B 3FPPA 1CHQD 2F1MA 5C0XG 3BYYB 4FO2A 3V2TA 4UAIA 1C48A 3AB9A 3D8GA 3TBIB 2AQ3B 1GXDC 2EYFA 3N6RA 1Q8IA 4GZYC 4C3IB 1G2SA 5J22A 2IX1A 1G2TA 3BG3A 2C5CA 2QKIC 4L6TB 1D1IA 1STEA 1ENCA 2K01A 1FGBD 2PQEA 3QWNA 1Q90A 3GV3A 3I4LA 2E2DC 1SJHD 2YYZA 5IT9E 3ONAB 5KNCA 3NWSA 5FO9B 1Q1BA 2ID0A 3E5SA 1GJXA 1CQFA 1JORA 1V1PB 3LWUA 3PUZA 5DM73 1M8AA 2HDLA 3BVMA 1VDZA 2LS01 1TWAB 2AWNA 3MXNA 1LTGD 5EPKA 2BCOA 5D14A 1ESFA 3KF8A 3GTGB 1ENFA 3SR1A 5KGUA 1U4RA 4YIJA 2F0HA 2R6GA 2RDGA 3OOCA 3GV6A 2NUCA 4B08A 4KKUA 1LV9A 5K36H 1SNDA 3HKZB 4M1UB 3KK7A 2FFKB 4HMJA 2CHBD 3H94A 2KA7A 3PV0A 4BY7B 1HUMA 3T56B 5M5YB 3P1HA 5IGGA 4H0LC 3HOYB 4K2KA 3T4AC 4U673 2CVRA 5K36G 1CQVA 3IL8A 1O7YA 3LX0A 2WIIB 2Q8TA 1DOLA 1WTXA 2F4IA 4J6HA 1LT5D 2A5HA 3RUZA 4G7HC 3VR4A 2R92B 3J80L 3TZUA 4J8QA 2K1BA 1SNPA 5CYUA 4MIUA 1TQOA 4RHSA 2R61A 1EYDA 2ZXOA 1PMRA 1V1PA 4IUQA 4IURA 3BVGA 1Y8NB 1ENAA 2NN6G 5M5WB 3A8JE 5TSSA 2K5DA 2EY2A 4Y7NB 4RH6A 2L4NA 1HPCA 3MC0B 5I2XA 2HUGA 3HOVB 2NYZD 3E6ZX 2RKSA 4KKTA 4OHJA 1B50A 3SXHA 4F8MA 3LNNA 3HOUB 1SBBB 3EVQA 3HS0C 3P75A 1EY5A 5NUCA 1RTOA 3K6OA 1OXXK 1A6XA 1E2ZA 4FYDA 1SE3A 1M4VA 5KEEA 1RCVD 1GUTA 2FJ2A 1R4PB 5ELFA 4CGYB 1PRTB 2B2VA 2RSOA 3M4OB 4RGTA 5IT9L 3FMCA 3ND8A 1EWCA 3WOEA 2NTTA 2K6AA 4CKBA 2A68D 4ILWA 5J1ZA 3MVVA 3A7LA 1DYQA 1IYUA 1TS2A 1CI3M 2NN6I 4XT1B 4C1NK 1HFGA 1B3AA 2EY1A 3ND9A 4IALA 2PZWA 3GTKB 1EQVA 4Q5VA 4HCEA 5C44B 1SSOA 1YNND 1EYAA 2EPBA 1TS5A 3HOZB 2A69D 3URYA 5A35A 5I6WA 3EQLC 2KECA 2SNSA 1G6ZA 4H44C 1JOKA 4X3UA 1WTOA 1OXTA 4PMBA 1ZXTA 2QCPX 1A2UA 4CBVA 3FPUB 3S14B 4MHEA 3F2UA 1ZYRC 1CM9A 3GTJB 4CKEA 2F0UA 1JICA 4ZUIA 2RDHA 1RDPD 2E76C 1I4QA 3RLFA 1TWHB 2B2UA 2BA1A 5A2QE 1VF5C 3DXJC 3DMUA 1XX8A 5IIFA 3S1QB 4FNFA 4LK1C 3VYRA 1LTSD 4KN4C 4RCOA 3K59A 1K83B 1J9OA 2LFNA 2EVBA 1EQTA 2WINB 2A6HD 2B2UC 1JE4A 2PZTA 3A54A 1IKMA 3S1NB 1H9KA 3H0GB 2J7ZA 5JAVA 1JOOA 4Z9CB 5G3LF 1I6HB 1EIGA 3DHQA 1TWFB 2JA8B 2F0EA 1JWUD 3NTHA 2O5IC 5EPLA 2WV6D 1SAPA 4A3DB 1KDAA 4G7ZC 4XQQA 1EY6A 3NUCA 3E0JA 2OF1A 1TU2B 5EKIA 2B2TC 1RD9D 1VMCA 4IUTA 4RAUC 3S2DB 2CQAA 1BUVT 2RDFA 1EFID 1PTOB 1EIHA 2NBFA 2J4XA 4K6LA 3S17B 1XTCD 2A73B 3CRKC 1KNAA 2JE6I 4E6IA 1IW7D 1ICWA 3Q6SA 1II3A 1VF7A 2TMPA 5LL6X 1B9MA 3MAQA 1RKNA 2M00A 4AYBB 2JSOA 5BN3A 4R8NA 4K6DA 3VR3A 5K5PA 5EJWA 2MGSA 2Z4IA 2N55A 1YNNC 2B2WC 4B9WA 1WD0A 4J1MA 2A69C 1Z7TA 1CZWA 1HRJA 2NVYB 1STGA 1JOQA 3A56A 1S5FD 1XWEA 3EJIA 1PRTF 2EJGC 4UDUC 3R8BA 1EZ6A 3GP7A 2X69A 4OO1I 3EA6A 3W2DA 4IFDH 1F2YA 3S1RB 5DEHA 2LY7A 4ZAIA 2IT1A 1STHA 2DY8A 5IGFA 5C4XB 3GTQB 2F0QA 2N88A 3A8IE 4ZKBB 4X3KA 5ISRA 4QB4A 2B8GA 2JXMB 1RTNA 1FR3A 1AP0A 2A6HC 2FINB 3VYSA 1STNA 5KIXA 4K2LA 4KV6A 4RCNA 5CV5A 4WORA 2JYOA 3NSWA 5FLXE 3HG9A 3SK8A 3DEOA 1WCMB 2Z1CA 1F2MA 5T1GA 2ZXRA 1TVXA 4KK7A 1MSGA 4CHTB 3GO5A 2KEEA 4ZRZA 3GTPB 5A2QL 4IQZA 1U9RA 2XRQD 2KUMA 1C4QA 4K14A 3H91A 4QCLA 3KUPA 3VYTA 3J7YW 1TR5A 3BYTB 3K5MA 1CZGA 2Z8LA 1JR0D 4N9TA 1IYVA 3IKJA 4A3MB 1PFBA 1J8IA 1I50B 3K7AB 4IUVA 1WTWA 2EYHA 3U9SA 4C3JB 2DNCA 1LTBD 2MHVA 4CJ2C 1TWGB 1LTTD 1QOHA 2MUYA 4C3HG 2PPBC 1KLUD 1RF2D 3DM1A 2ZXPA 3MXUA 2XIWA 1FD7D 4O1NA 1OO9B 3VA7A 1EU3A 3TMEA 1UUPA 2G9DA 5I2YA 3PIO3 3S9WA 4LJZC 4N9PA 4XXEA 2EE1A 3T16A 3VR5A 4FF1A 1S4ZA 5M9OA 5JVH3 2F3VA 3U9OA 2H1EA 3NXWA 1O80A 5CV6A 2F0OA 1PTOF 2Y0SB 2C9OA 2MJ8A 4B9XA 4ID6A 4PQXA 2F0MA 2D62A 2ZT9C 1DM0B 2GA4B 1BDOA 1SNMA 3TZDA 1K8OA 1NR4A 4EQOA 1SYCA 1EY7A 2Q8IB 4K8IA 5C0XI 4QIWB 2Z4HA 1PYWD 2D5DA 1JCKB 1ILQA 2F0NA 1IHZA 3NTKA 4RWSC 3QOJA 1OXSC 2F0JA 2K05A 4JK1C 1HA6A 1O7LA 5CGKA 1CA6A 3O13A 1I4XA 5JVG3 2JA5B 4EQNA 1KTKA 3NQTA 4ULLA 2XN9C 3SEBA 1T5EA 2EY6A 3CU7A 5JEAJ 2IX0A 3V05A 2BE5D 3FEWX 2K5WA 2LKVA 5C5MA 4ZK9B 2NVQB 1F77A 1PZJD 1CFMA 2F0KA 4XT3B 2HQEA 1Y69U 3BZDB 2IX3A 4KY7A 1KLGD 3QB3A 4DAPA 3MFGA 3I70A 4BBSB 2AQ2B 2RQXA 2KEDA 3Q24A 5IGCA 1BCPC 4CJ0B 1I4HA 4F7XA 2KVMA 4H13C 1EL0A 4RKBA 3EROA 1E2WA 4OGQC 1EOTA 5FLXL 2B63B 1H9RA 3GD7A 2VB2X 4WJWA 2R93B 1GUWA 1A15A 3I3CA 4TSSA 1Q12A 4HR7B 1SYBA 5E4XA 3QIAA 3NP8A 2VNUD 4FVMA 3T13A 3EFXD 1Z47A 4KD4A 1RHPA 2JEAI 1NR2A 1AEXA 4DA2A 3IFTA 1RJTA 3QO2A 3OW7A 3T51B 4G57A 4NKLA 2K03A 1BNZA 3C2PA 1DONA 1PFNA 4KHVA 1DD2A 1TKWB 2FMMA 5KNDA 1PDQA 2NWGA 4DU9A 4C3IG 1ZEQX 2XSCA 1E0BA 4FF4A 1PRTD 2WKCA 2PYKA 1I3QB 1FNWA 3I72A 2NVTB 1MI2A 2JA7B 1TY0A 2F0FA 3MHBA 1TT2A 4A3EB 3TDQA 1L0XB 3C1FA 1HQRD 3H09A 3M7NA 3FRPB 1QJOA 4DK1A 1SJED 2E75C 1A2TA 4X3SA 3VR6A 1LTRD 1EEID 3D4WA 3G6JB 4U68A 4NDXA 5M3FB 3DWAA 3D3RA 2XWBB 5KYLA 4PMWA 1EEFD 5C4ZA 1AZQA 1H9JA 1SNQA 2L11A 1VCIA 3NHHA 3H3VC 1TY2A 3PIP3 5CV8A 3S2HB 2EJFC 5CMDA 1B4OA 2VXWA 1B9NA 5KYIA 3KBGA 3IAYA 5C5LA 4BBRB 5DNFA 2CW0D 2F0IA 1GUGA 1LT3D 3BVZA 1OXUA 1R9TB 2F0WA 4XYQA 4G7OC 4ZUJA 4A3FB 1HHVA 5CORA 1SYDA 4K8JA 2A6ED 1Y8OB 1D1KA 2HCCA 2R7ZB 1LT4D 1JQYD 5M3MB 4X3TA 4XDXA 2X6GA 4A3BB 2NTSA 1WTQA 1WTRA 3VYUA 1GOZA 2B2YC 3N52A 4FF3A 1W6KA 1SYEA 3MA2B 2EZVA 4KY5A 1JB3A 1GUNA 3A55A 2B2TA 2SNMA 5I4DA 2F03A 5AFWA 2R3ZA 3QOLA 4DAVA 4F87A 1W6JA 3D6CA 1DJRD 4M8AA 5EBCA 3TN2A 4HTHA 1D2BA 1ESRA 1JWMD 3W3AA 2PCFB 2PW7A 3M4YA 3OIPA 4KJNA 1F9PA 2M9VA 5ELEA 4LAAA 1QE6A 5KRUA 1V1OA 3PUVA 3OMGA 1Y1VB 3SVMA 1Q1EA 4L8JA 1PRTC 3IFDA 3MFYA 5FOBB 4BY1B 2A68C 5C3WA 1D5XC 1HTPA 3OPOA 2B2WA 1D6EC 3LWEA 1X3QA 3DEPA 1H9MA 4V190 4RA8A 3AMUA 3I91A 1LLRD 5E1FA 5IOCA 2TSSA 2EYJA 4KI0A 3KLSA 5D3DA 3TP7A 2RVLA 2AUKA 5KNBA 4IN3A 1EY0A 1UEAB 5C0XJ 3M7GA 5FO8B 3K5LA 2FMCA 1EU4A 1WVLA 2JEBI 1F9SA 1WTVA 1CT1D 1G8ZD 5FK9C 3HZXA 4ZQ3A 5HURA 2I07B 3C46A 3DWQA 2EDGA 2Q8RE 4K5VA 1SYGA 1KABA 1STAA 3DUZA 1O7ZA 3T53B 4RGNA 3JAME 1BXTA 2BA0A 4BS9A 2CW0C 4BWGB 5IGBA 2HCIA 5IODA 2RA4A 4XYOA 3CQZB 1TS4A 5CC4A 4DFAA 3NBIA 1RODA 2ICEC 1QWYA 2A6EC 4DK0A 5JPNC 3V96A 4ABNA 4RGMA 2AUJD 1IL8A 3J81E 3HEJA 1QB5D 4IFDG 1X3PA 2EOTA 5ELCA 1F9QA 4A93B 5BN5A 3J7AV 1DOKA 5EBDA 4L63B 4OL7A 2F0SA 2IJ0A 2WP8J 3R2IA 4KD3A 1KDCA 5DAUA 5HGTA 2PW5A 1UNSA 2QEJC 3PUWA 4ZYSA 4K5WA 3GTOB 3NTIA 3MXGA 2NB0A 5ELDA 4DNTB 1AFPA 5CR3A 2OT2A 1V43A 1XXGA 1LABA 1UAPA 1PZID 2IW3A 2PNRC 1HXYD 2KCNA 1STBA 3ITPA 5CBAE 1BCPB 1R4QB 1IW7C 3NK9A 3GTLB 4NMZA 1GUOA 4HSVA 4A3KB 1EY8A 1PTOH 1YNJD 4HEDA 5BN4A 3I8ZA 4QUCA 2J0TD 3I73A 1EZ8A 2XWJB 4PV1C 5ELBA 4HCSA 2YU9B 1HUNA 4IFDI 2BOSA 1SE4A 5CV7A 1GHJA 4TKOB 4RHRA 1PZKD 3GTMB 4MN3A 3I4NB 5I9PA 4FP5D 4I65A 1ILPA 1Q3LA 4TQUS 2K7VA 4KHZA 4CKCA 2SDFA 2L5TA 2SOBA 2L0CA 1GHKA 4K5XA 2K32A 5FO7B 1KAAA 4RGOS 1K8MA 1LACA 3QG1A 3BDOA 3OHXC 1U4PA 2V4DA 4NP5A 2KJXA 1TWCB 3C3LA 3X3MA 1BQQT 1NSNS 1DCZA 1F9RA 2F3WA 2WACA 3SHLA 1SDFA 3PUYA 1D5MC 4EQPA 3ERQA 4XTCS 2L12A 5EKLA 1QILA 4KY6A 3H6MA 1S5CD 4QF4A 5C4JB 2ICIA 1KNEA 4TRDA 3JAML 1LTAD 4LMQD 2K5QA 1EY4A 3K0YA 5C3EB 2KQ3A 2LMCB 4DXGA 3J7AF 2E2IB 5JOBA 3KLSX 2WB1B 5COYA 2WKDA 3RZOB 4A3GB 1SXTA 2DY7A 3OIQA 4V0BA 2FHTA 4ODGA 3J81L 4WFN3 5G3LD 4ZKCB 4WRDA 5LL6S 1ONLA 3Q22A 1HFNA 2PZUA 4P2CB 4C56C 2XVSA 2EYLA 3ZYYX 2F0TA 2NN6H 4FXDA 3NWTA 1LT6D 5E3FA 3P7JA 2EY5A 2E2JB 4C2MB 3GQBA 4KN7C 3FKIB 1MGSA 4OIKA 1QNKA 1U4MA 1ZYRD 4CJ1B 3SK4A 1YNJC 2VB3X 2QF7A 3WDNA 1CTMA 2QDBA 1CK1A 1A3UA 5M5XB 4NW2A 1I4PA 2X6LA 2L55A 1Z6HA 1SNOA 2D9UA 5JEAH 1PLFA 2EYMA 1WTPA 5E4WC 1MD2D 5CV9A 5CBEE 1IKLA 4DN4M 4G4KA 3SK5A 1NUCA 4KKSA 2M2LA 4DAYA 1A3VA 1F2ZA 3MTSA 4HAEA 4IUPA 4R9WA 3PO3B 1JWSD 2XRSD 1BCPF 2F0GA 4HSPA 4C3JG 3S1MB 1O78A 5I6YA 5EGTA 1AZPA 4FXKC 5JEAG 1BOSA 1G91A 3SDZA 3NBHA 3OMCA 4JBWA 3BDCA 2PO4A 1BBXC 5C6AA 3Q0AA 4BA2I 3OWFA 1S5BD 4RKLA 2AQ1B 2JP1A 2ENBA 4RFBA 2KOLA 1HCZA 2BE5C 1SMYD 1X32A 3VR2A 4IUNA 2QILA 5IGDA 1F2LA 3CRLC 3HRZC 5JPMC 5I9OA 5EPJA 4BA1I 2EYPA 4IZ8A 3I4MB 3SK6A 4PMCA 4HMIA 1DXMA 2B2VC 1E2VA 3L3OC 5F2DA 2MPMA 2IL8A 5FKAC 3QJYA 3VA5A 2F0LA 2F0PA 3D4DA 3NQIA 3G7LA 3BDLA 2L1BA 5C3XA 1TS3A 1NCVA 3CHBD 1B1ZA 1PFMA 2KHSA 3FVQA 2K28A 1S5DD 3HP3A 4XQJA 1BF4A 3KBXA 4HN7A 4QMGA 1AW7A 3Q23A 1B44D 2K33A 1DOMA 1FNVA 2OXPA 3D4RA 3PO2B 3RZDB 2SEBD 3SE0A 2B2YA 3X3NA 1HTLD 1STYA 5IGEA 1NAPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GUO A;  2R6G A;  3VR5 A;  2A69 D;  1FR3 A;  3T53 B;  3A8J E;  5A35 A;  3D31 A;  2LMC B;  3HGB A;  1E2W A;  3EQL C;  2BA0 A;  2A6H C;  4OGQ C;  3OOC A;  5BN4 A;  1O78 A;  2CW0 C;  4H44 C;  4KMU C;  3M7N A;  1OXV A;  4XIG S;  1H9R A;  4RCN A;  1QJO A;  1HPC A;  3GD7 A;  3I73 A;  4PV1 C;  4DK1 A;  2KCC A;  2E75 C;  5JEA G;  1FYC A;  4KKU A;  3SDZ A;  4JBW A;  3CRK C;  4DNR B;  2JE6 I;  1OXT A;  1GHJ A;  1Y8P B;  3W3A A;  2PCF B;  4KKT A;  3VR6 A;  2D62 A;  5K36 H;  2ZT9 C;  3KLR A;  4TKO B;  1IW7 D;  1Q12 A;  3M4Y A;  1VF7 A;  2A6E C;  1HQM C;  2E74 C;  4DK0 A;  3M85 A;  1BDO A;  4BA2 I;  3FPP A;  1ZYR C;  4OO1 H;  3H94 A;  2KA7 A;  3LNN A;  1B9M A;  2AUJ D;  1ONL A;  2F1M A;  4HR7 B;  4IQZ A;  5C0X G;  1EWH A;  1K8O A;  3PUV A;  4TQU S;  3PV0 A;  5BN3 A;  2K7V A;  3AB9 A;  3QIA A;  1Q1E A;  2NN6 H;  1HCZ A;  4KHZ A;  1H9J A;  4L8J A;  2BE5 C;  2Q8I B;  3T56 B;  3VR2 A;  2E76 C;  2L5T A;  3RLF A;  1VCI A;  1OXX K;  4IFD G;  2D5D A;  1A6X A;  1GHK A;  2BA1 A;  1E2Z A;  2K32 A;  3A7A B;  3MFY A;  3VR3 A;  1K8M A;  1VF5 C;  1OXS C;  2O5J C;  2A68 C;  1LAC A;  3DXJ C;  3N6R A;  3QG1 A;  3CRL C;  4JK1 C;  1YNN C;  4GZY C;  5BN5 A;  2JEA I;  3GQB A;  4BA1 I;  1O7L A;  4H0L C;  4KN7 C;  3BDO A;  2EJF C;  2V4D A;  2A69 C;  1HTP A;  3BG3 A;  3OPO A;  4I7Z C;  3NE5 B;  4LK1 C;  1IYV A;  1GUT A;  1Z7T A;  1DXM A;  4KN4 C;  3IKJ A;  1YNJ C;  1B9N A;  2EVB A;  2AWO A;  3IFT A;  1E2V A;  2DNE A;  2QF7 A;  3A8K E;  1H9M A;  1T5E A;  3WDN A;  5K36 G;  2A6H D;  1CTM A;  3OW7 A;  3QJY A;  3T51 B;  1H9S B;  3U9S A;  2BE5 D;  1GUG A;  3FMC A;  3ND8 A;  1G29 1;  2EJM A;  1Q90 A;  3P20 A;  1GUS A;  2EJG C;  3PUX A;  1OXU A;  2DNC A;  1H9K A;  4KI0 A;  4OO1 G;  3PUW A;  2BDO A;  3I4L A;  1DCZ A;  2A68 D;  4G7O C;  1CFM A;  2YYZ A;  1V8Q A;  1Z6H A;  1H9S A;  5KNC A;  2AUK A;  2DN8 A;  4IFD H;  3A7L A;  5KNB A;  5JEA H;  1Q1B A;  1Y69 U;  1GJX A;  4G7H C;  2PPB C;  1TKW B;  3VR4 A;  4DNT B;  2A6E D;  1IYU A;  1Y8O B;  3PUY A;  1DD2 A;  1CI3 M;  4XTC S;  3TZU A;  5KND A;  2NN6 I;  1V43 A;  1ZKO A;  4KKS A;  3LWU A;  1SMY C;  2D2C C;  3PUZ A;  1LAB A;  3MXU A;  2JEB I;  2O5I C;  2IT1 A;  2PNR C;  1VDZ A;  2K33 A;  3ND9 A;  3VA7 A;  4G7Z C;  3D4R A;  1I6V C;  5C0X H;  1TU2 B;  3A8I E;  1PMR A;  1IW7 C;  2EDG A;  3SE0 A;  3I72 A;  2B8F A;  3L7Z C;  4LJZ C;  2B8G A;  1Y8N B;  1GUN A;  4H13 C;  2NN6 G;  2JXM B; 
#chains in the Genus database with same CATH topology
 1FGU A;  2K14 A;  1EY9 A;  2O4X A;  1XYI A;  1QNU A;  3KDF A;  1NNX A;  1KRS A;  2AHO B;  2B39 A;  2B63 H;  1Y1W B;  3L9A X;  1AE3 A;  2EXZ A;  3F8T A;  5EKK A;  1GVP A;  5CV4 A;  4S3S A;  4DNR B;  2QEX A;  1U4L A;  1IBM Q;  1Y8P B;  3TP5 A;  1SE2 A;  2G5D A;  1IBK Q;  2E74 C;  4A3J B;  1HA5 A;  2IWH A;  3MXP A;  1LO5 D;  1LTI D;  4BBS G;  4OO1 H;  4JYA L;  1MSH A;  2JA6 B;  1T9H A;  4AQY L;  2N49 A;  2H4O A;  2NZ1 D;  2UUC Q;  2RSN A;  4R8I A;  2EYO A;  1A0I A;  5J39 A;  4C3H B;  4A76 A;  3R93 A;  3K58 A;  1N33 L;  1D5Z C;  3A7A B;  4HIK A;  1CHP D;  3CKI B;  1C8C A;  4UY8 C;  1AN8 A;  3OWE B;  2O5J C;  1QVG A;  3OW2 A;  4DV0 L;  1CA5 A;  3D0F A;  2B63 G;  4JI8 Q;  4I7Z C;  3NE5 B;  4JI7 Q;  5D65 A;  2R93 G;  2QW7 A;  1S5E D;  2CQO A;  2AWO A;  4DV7 Q;  4B3R L;  1YHB A;  2DNE A;  2UUB Q;  3I90 A;  4IFD J;  1KDB A;  1S3O A;  4AYB E;  2WAQ B;  1H9S B;  4Y52 H;  3FP9 A;  4P72 A;  4H7B A;  1G29 1;  5EQ0 A;  4OO1 G;  2VUM B;  1PTO D;  3DWP A;  3HOW B;  3UI2 A;  1EYC A;  2G9H D;  2RBM A;  1V8Q A;  5AJ3 L;  2DN8 A;  5JJZ A;  1Q86 C;  3MZ5 A;  2RCN A;  3MWY W;  2L9H A;  3K57 A;  3ER0 A;  1ZKO A;  4EVO A;  4OIJ A;  1SMY C;  1PXU A;  2XNA C;  3BS1 A;  2I5H A;  4GLX A;  2I46 A;  2HDM A;  4KJO A;  3RMH A;  1IBL Q;  3R3O A;  1SYF A;  5D3I B;  1I6V C;  3VDY A;  1I3Q H;  3F2D A;  4PNY A;  2BH8 A;  3TSS A;  2F0V A;  4ZLT F;  1YJN A;  2UUA Q;  2Q2T A;  3L7Z C;  1QCB D;  1SNC A;  4A3E H;  2UXB Q;  3S15 B;  3U50 C;  4GLA C;  3HGB A;  4IO9 A;  2UU9 L;  5T1I A;  4OON A;  3PIP A;  1QZH A;  4Q0F A;  3HOX B;  1SEB D;  3FDT A;  3K5N A;  1OXV A;  3A5Z B;  3OSO A;  1A62 A;  2ZJR A;  2VQF L;  4LF5 Q;  1ET9 A;  2KCC A;  4LF6 Q;  1SFO B;  5DM6 3;  1B53 A;  1FYC A;  5LHY 1;  1BR9 A;  1I4R A;  4JYA Q;  3M3Y B;  3S24 A;  2GVA A;  5IYD G;  4FXG C;  2O2L D;  4LWC A;  1HQM C;  3K5O A;  1UE5 A;  3NPP A;  3FHW A;  1PYS B;  3AU7 A;  3RD4 A;  1C7Y A;  1ASZ A;  1FNU A;  2A74 C;  1EWH A;  4IPG A;  4O42 A;  3WOF A;  2HIX A;  2OEO A;  1QZG A;  4DV0 Q;  4XQN A;  3W1G A;  4DGZ A;  1HNZ L;  2JA7 G;  4B3T L;  3RLN A;  4A3E G;  1L0Y B;  4OWX B;  1QG7 A;  3CCE A;  4B3R Q;  4QQB X;  3MEH A;  3S2H H;  3TP8 A;  1I4G A;  4QUF A;  1GKH A;  4KTA A;  3TP6 A;  1MBY A;  1VMP A;  1T5X D;  1ML0 D;  3AFP A;  4JW0 A;  3A8K E;  3PMF A;  3RNU A;  5FLX c;  3ULL A;  2EJM A;  3PUX A;  3P20 A;  1GUS A;  5C4H A;  1K3R A;  5M3F G;  2BDO A;  1UE7 A;  1JJG A;  1H9S A;  2E5L L;  1B8A A;  4CDC C;  4IUU A;  3K8A A;  4C1N I;  2NVX B;  1ET6 A;  4HJ9 A;  3UDG A;  3KF8 B;  3D6W A;  5M3M H;  4HJ8 A;  2D2C C;  5LMU L;  1Y1W H;  3CPW A;  2VQE L;  4JI6 L;  1C0A A;  1KC8 C;  3J80 E;  1DZ1 A;  2KHI A;  3U4Z A;  5C0X H;  3C1E A;  2H5X A;  1X3G A;  1JC7 A;  2PMZ B;  1YI2 A;  1L1O B;  3R2T A;  2B8F A;  2PI2 E;  4DPG A;  1A3T A;  4A3J H;  1X55 A;  4DR3 L;  4BBR G;  2QGQ A;  4DF7 A;  1KHI A;  4F88 A;  2OQ0 A;  3NEM A;  3D31 A;  2E2H B;  3CCU A;  5GAE C;  4EGV A;  2KCM A;  2IPK D;  4KMU C;  2K04 A;  2MP1 A;  4A3F G;  2BDN A;  4XIG S;  1TII D;  1X6O A;  1PTO C;  1B2T A;  4DXF A;  2Z6B A;  1WD1 A;  2F0D A;  2R7Z G;  5IY0 A;  4ME5 A;  1TXY A;  4HJ7 A;  4FF2 A;  3KLR A;  1BO0 A;  5M3M G;  4A3B G;  4A3L H;  1BCP D;  2I5M X;  3M85 A;  3CCQ A;  4A3I B;  3S16 B;  3FPP A;  1HNZ Q;  1CHQ D;  2F1M A;  1MHW C;  2CWA A;  5GRO A;  3BYY B;  4FO2 A;  3V2T A;  5C0X G;  4UAI A;  1JT8 A;  1C48 A;  3AB9 A;  3D8G A;  3K80 C;  3TBI B;  2PQA B;  2VUM H;  2N3S A;  2AQ3 B;  1GXD C;  3DLL A;  2EYF A;  3N6R A;  1Q8I A;  2Y0S E;  4GZY C;  4C3I B;  1G2S A;  5J22 A;  2OWO A;  2IX1 A;  1VQL A;  1G2T A;  3BG3 A;  2C5C A;  2QKI C;  4L6T B;  4CDE C;  1LUZ A;  1D1I A;  1STE A;  1ENC A;  2K01 A;  3KYH C;  4A3L G;  1FGB D;  3QWN A;  2PQE A;  2F3I A;  1Q90 A;  3GV3 A;  4QIW E;  3I4L A;  2E2D C;  1SJH D;  2YYZ A;  5IT9 E;  3ONA B;  1Y1V G;  5KNC A;  5LMU Q;  4DV3 L;  4JI6 Q;  3NWS A;  5FO9 B;  3S15 H;  1Q1B A;  2ID0 A;  3E5S A;  3KLW A;  1GJX A;  1CQF A;  1JOR A;  3U4V A;  1X3E A;  1I94 L;  1V1P B;  4BY1 G;  3HOX H;  1EUJ A;  3LWU A;  3PUZ A;  4UHV A;  5DM7 3;  1M8A A;  2HDL A;  3BVM A;  1VDZ A;  3HKS A;  2C35 B;  2LS0 1;  1TWA B;  2AWN A;  4PG3 A;  3MXN A;  1LTG D;  2XGT A;  5EPK A;  2BCO A;  5D14 A;  1ESF A;  3KF8 A;  3GTG B;  1ENF A;  3SR1 A;  5KGU A;  1U4R A;  4YIJ A;  4JV5 L;  2F0H A;  3I2Z A;  2R6G A;  2RDG A;  2EIF A;  4JG2 A;  5JJL A;  3OOC A;  3GV6 A;  2NUC A;  4B08 A;  2WB1 E;  3CQZ H;  4KLK A;  4KKU A;  3J81 i;  1LV9 A;  5K36 H;  1N34 L;  1SND A;  1PFS A;  3HKZ B;  4M1U B;  1VQB A;  3KK7 A;  3ULP A;  2FFK B;  4HMJ A;  2CHB D;  4KHP Q;  3H94 A;  4DR6 L;  2KA7 A;  1NBW A;  1J6Q A;  4MTK A;  2K5H A;  5IYB H;  3PV0 A;  4BY7 B;  1X56 A;  4JOI C;  1HUM A;  3T56 B;  3A74 A;  5M5Y B;  3UE0 A;  4A93 H;  3P1H A;  2OQK A;  5IGG A;  4H0L C;  4DKA C;  2PQA A;  4OEM B;  3HOY B;  4K2K A;  2NVX H;  3T4A C;  1YZ6 A;  1JJC B;  1BKB A;  4U67 3;  2CVR A;  5K36 G;  4UPA A;  4JI1 L;  1CQV A;  4HJA A;  3IL8 A;  1O7Y A;  1QVF A;  1S72 A;  2KCT A;  2WII B;  3LX0 A;  2Q8T A;  1W2B A;  1J5E Q;  1DOL A;  3F2B A;  1WTX A;  1VQJ A;  2F4I A;  4J6H A;  3A5U A;  4YCU A;  1LT5 D;  2A5H A;  4EQ5 A;  5IYB G;  1VQH A;  1VQ7 A;  4LF8 L;  3RUZ A;  4G7H C;  1SRU A;  3VR4 A;  2R92 B;  4DR1 L;  1G6P A;  3J80 L;  2E2H H;  3TZU A;  4OX9 L;  4J8Q A;  4PZ6 A;  1GD7 A;  2K1B A;  1VQ8 A;  1SNP A;  5CYU A;  4MIU A;  1SLJ A;  1TQO A;  4RHS A;  4JV5 Q;  2R61 A;  1EYD A;  2ZXO A;  3ERS X;  1PMR A;  1V1P A;  4GOP B;  1YIT A;  3F2C A;  4DR2 Q;  4IUQ A;  4IUR A;  3BVG A;  1EIF A;  1PH3 A;  1Y8N B;  1KD1 C;  3S16 H;  1ENA A;  2NN6 G;  3CCJ A;  5M5W B;  3A8J E;  5TSS A;  2K5D A;  4A3K H;  4QGU A;  2EY2 A;  4Y7N B;  3KF6 A;  2QDL A;  1N34 Q;  4RH6 A;  2L4N A;  5ELN A;  1QVC A;  1YVC A;  1HPC A;  3MC0 B;  5I2X A;  2HUG A;  3HOV B;  3PF5 A;  2YU9 H;  2NYZ D;  3E6Z X;  3KDF B;  2RKS A;  4KKT A;  1WI5 A;  3T1H L;  4HIO A;  4OHJ A;  1B50 A;  3JC6 6;  3SXH A;  4DK3 C;  4F8M A;  3I4N H;  3LNN A;  3HOU B;  1U0L A;  3UE1 A;  1SBB B;  5HGQ A;  3EVQ A;  3HS0 C;  2OCE A;  3P75 A;  4QJF A;  1EY5 A;  4WJ4 A;  5NUC A;  1RTO A;  3K6O A;  1OXX K;  1A6X A;  3PCO B;  1E2Z A;  3IRB A;  2ZJP A;  2CFM A;  1MJE A;  2ZJQ A;  4FYD A;  3EBE A;  4DV6 Q;  1SE3 A;  1M4V A;  4A3K G;  5KEE A;  3KJP A;  1RCV D;  1FJG Q;  1GUT A;  2FJ2 A;  1R4P B;  5ELF A;  1TWC H;  4CGY B;  4LF9 L;  1PRT B;  2B2V A;  2RSO A;  3M4O B;  4DR5 L;  4RGT A;  5IT9 L;  1TWA H;  4LF4 Q;  3FMC A;  3ND8 A;  4LF8 Q;  1EWC A;  1HH2 P;  3WOE A;  1FVI A;  3I4N G;  2NTT A;  2K6A A;  4CKB A;  4ALP A;  2A68 D;  4ILW A;  5J1Z A;  3MVV A;  3A7L A;  1DYQ A;  1IYU A;  1CKO A;  1CI3 M;  1TS2 A;  1KL9 A;  2IHE A;  2NN6 I;  4NXM L;  4XT1 B;  4C1N K;  1XJV A;  1HFG A;  1WJJ A;  1B3A A;  1Q8K A;  4IOC A;  2EY1 A;  4JI0 Q;  3ND9 A;  3RLO A;  4IAL A;  4JI7 L;  2VL6 A;  2PZW A;  2RHS B;  3GTK B;  1EQV A;  3UDI A;  4DV7 L;  2UUB L;  4Q5V A;  1SE8 A;  4HCE A;  5C44 B;  1SSO A;  1YNN D;  1EYA A;  3G4S A;  2EPB A;  1TS5 A;  3HOZ B;  2ES2 A;  2A69 D;  3URY A;  5A35 A;  5I6W A;  5C3E H;  2MQH A;  3TRE A;  3EQL C;  2KEC A;  2SNS A;  2LXK A;  4JVZ A;  2E2I H;  1G6Z A;  4H44 C;  4IPH A;  5M5Y H;  1JOK A;  3RZO H;  4A3G H;  4X3U A;  1WTO A;  5FJ8 G;  1OTC A;  1KQS A;  1OXT A;  1X65 A;  4PMB A;  1ZXT A;  3BZK A;  2QCP X;  1A2U A;  4CBV A;  1E7Z A;  1O7I A;  3FPU B;  3S14 B;  5L37 A;  4MHE A;  1PV4 A;  3F2U A;  2IHF A;  1ZYR C;  1CM9 A;  3GTJ B;  3TS2 A;  4CKE A;  1AH9 A;  2F0U A;  2UUA L;  1JIC A;  5LMN W;  1NJI C;  1UWV A;  2RDH A;  4ZUI A;  3H3V H;  1RDP D;  2E76 C;  4DNI A;  1I4Q A;  3RLF A;  1TWH B;  4L5Q A;  2B2U A;  2UXB L;  2BA1 A;  5A2Q E;  1VF5 C;  3NEL A;  5C3E G;  3H15 A;  3DXJ C;  3DMU A;  3AFQ A;  2E2J H;  4LF9 Q;  1XX8 A;  4C2M H;  3FKI H;  5IIF A;  4DR5 Q;  3S1Q B;  2R92 H;  2WB1 G;  3AYH B;  4FNF A;  4LK1 C;  4LF5 L;  4LF6 L;  3VYR A;  1LTS D;  4KN4 C;  4RCO A;  2MNA A;  3K59 A;  1K83 B;  4A3G G;  1J9O A;  2LFN A;  2EVB A;  1EQT A;  2WIN B;  2A6H D;  2B2U C;  1JE4 A;  2KBN A;  2PZT A;  1XPR A;  3A54 A;  5M5X H;  2WAQ E;  1IKM A;  1MKH A;  3S1N B;  1H9K A;  3H0G B;  2J7Z A;  4NXM Q;  3CME A;  5JAV A;  1JOO A;  5FLM H;  4Z9C B;  5G3L F;  1N36 Q;  2HHH Q;  1I6H B;  1EIG A;  4Y7N H;  3DHQ A;  1TWF B;  4BXX H;  2JA8 B;  1YBY A;  2F0E A;  1JWU D;  3NTH A;  4UP8 A;  5EPL A;  2O5I C;  5ELO A;  2WV6 D;  1SAP A;  3FKI G;  3RN2 A;  3HOV H;  4A3D B;  1KDA A;  2JJQ A;  4G7Z C;  4XQQ A;  1EY6 A;  3NUC A;  3E0J A;  2OF1 A;  1TU2 B;  1YHA A;  5EKI A;  3PO3 H;  2B2T C;  1RD9 D;  1VMC A;  4IUT A;  4RAU C;  3S2D B;  1PH2 A;  2CQA A;  1BUV T;  2RDF A;  3S1M H;  1EFI D;  1PTO B;  1EIH A;  4NXN Q;  2NBF A;  2J4X A;  4K6L A;  3BU2 A;  3S17 B;  4DV4 Q;  4JI3 L;  1XTC D;  2A73 B;  3CRK C;  1KNA A;  3G6E A;  1VS0 A;  2JE6 I;  4E6I A;  1NTG A;  1IW7 D;  1ICW A;  3Q6S A;  5BR8 Q;  1II3 A;  1VF7 A;  1YJ9 A;  2TMP A;  3CAM A;  4N8X 1;  3F1Z A;  5LL6 X;  1EQQ A;  1BBW A;  1B9M A;  2A1A A;  3MAQ A;  1RKN A;  2M00 A;  4AYB B;  2JSO A;  5BN3 A;  3PO3 G;  3CP0 A;  1K8G A;  4R8N A;  1YHQ A;  2A8V A;  4K6D A;  1HNX L;  3AQQ A;  3MEF A;  3VR3 A;  5K5P A;  5EJW A;  4JI5 L;  2MGS A;  2Z4I A;  3CCM A;  1E24 A;  2N55 A;  1YNN C;  2FXQ A;  1GM5 A;  2B2W C;  4B9W A;  1WD0 A;  3I4M H;  4J1M A;  2A69 C;  3WWV A;  1VQC A;  1Z7T A;  1CZW A;  2YTY A;  1HRJ A;  2IY5 B;  2NVY B;  1C9O A;  1STG A;  1BBU A;  4I7A A;  1EQR A;  1JOQ A;  3A56 A;  1S5F D;  1XWE A;  3EJI A;  1PRT F;  3GTK H;  4P71 A;  1M90 C;  2EJG C;  4UDU C;  3R8B A;  1EZ6 A;  3GP7 A;  3KJO A;  2X69 A;  4OO1 I;  3L2P A;  3EA6 A;  3W2D A;  4IFD H;  1F2Y A;  3S1R B;  1D7Q A;  5DEH A;  4LF7 L;  2LY7 A;  2N78 A;  3J81 c;  4ZAI A;  2IT1 A;  1STH A;  2DY8 A;  5IGF A;  5C4X B;  3I4M G;  3GTQ B;  1JJ2 A;  1WTH A;  2F0Q A;  3PO2 H;  3RZD H;  2N88 A;  3A8I E;  4ZKB B;  4HJ5 A;  2K75 A;  3CW2 C;  4X3K A;  3S14 H;  2PMZ E;  1PH6 A;  5EAY A;  5ISR A;  4QB4 A;  2B8G A;  2JXM B;  1RTN A;  1FR3 A;  3MXN B;  1AP0 A;  4JI3 Q;  2A6H C;  1SRO A;  2FIN B;  3VYS A;  1STN A;  5KIX A;  2ALY B;  4K2L A;  4KV6 A;  1TWH H;  4RCN A;  4X66 Q;  4RMF A;  5CV5 A;  4WOR A;  2JYO A;  1A8V A;  3NSW A;  5FLX E;  3HG9 A;  3SK8 A;  1UE6 A;  2Q2H A;  2D0O A;  3DEO A;  1WCM B;  2Z1C A;  1F2M A;  5T1G A;  2WFW A;  2ZXR A;  1TVX A;  4KK7 A;  1MSG A;  4YCV A;  4CHT B;  3J81 j;  4GNX C;  1HNX Q;  3GO5 A;  2KEE A;  2RCF A;  2CKZ B;  4ZRZ A;  5IP7 H;  4YWK A;  2JA6 H;  2RF4 A;  3GTP B;  5A2Q L;  4CDD C;  4JI5 Q;  4IQZ A;  3PO2 G;  1U9R A;  4LFA Q;  1SN8 A;  1WOC A;  4C3H H;  2XRQ D;  3K0X A;  3CMA A;  3S1N H;  2KUM A;  4JC0 A;  3TRZ A;  1C4Q A;  4K14 A;  4R4C A;  3H91 A;  4QCL A;  3KUP A;  3VYT A;  3J7Y W;  4DR4 L;  4X6A H;  1TR5 A;  4LFB Q;  3BYT B;  3K5M A;  1CZG A;  1Y1W G;  2Z8L A;  1JR0 D;  4N9T A;  1I6H H;  1IYV A;  4DV1 L;  3EIV A;  5GAH C;  3IKJ A;  2K5N A;  4A3M B;  1PFB A;  1J8I A;  1I50 B;  3T1Y Q;  2HD3 A;  3K7A B;  4IUV A;  1WTW A;  2EYH A;  3U9S A;  3A0J A;  1PH1 A;  2MO1 A;  4A3J G;  1K0R A;  4QY7 A;  3E0E A;  4KHP L;  4C3J B;  2DNC A;  1LTB D;  4LF7 Q;  3HOW H;  3GDE A;  2JA6 G;  2MHV A;  4CJ2 C;  1CSP A;  1TWG B;  2ATW A;  1LTT D;  1QOH A;  2MUY A;  4C3H G;  4DV5 L;  2PPB C;  1KLU D;  1RF2 D;  3DM1 A;  4JI4 L;  2ZTD A;  2ZXP A;  3MXU A;  2XIW A;  4AIM A;  4YY3 L;  1FD7 D;  4O1N A;  1OO9 B;  1N32 Q;  3VA7 A;  3S17 H;  1EU3 A;  2ASB A;  1MIU A;  3TME A;  1UUP A;  2G9D A;  5I2Y A;  3PIO 3;  3OTO Q;  3S9W A;  4LJZ C;  4N9P A;  5IWA L;  2WAQ G;  4XXE A;  2EE1 A;  3T16 A;  1RL2 A;  3VR5 A;  1J5E L;  4FF1 A;  3I4O A;  2VUM G;  2YV5 A;  4HIM A;  3HOW G;  1LTL A;  1S4Z A;  5M9O A;  5JVH 3;  2F3V A;  1IZ6 A;  4OWT B;  3U9O A;  3JAM i;  1VQM A;  3CCL A;  2H1E A;  3NXW A;  1O80 A;  5CV6 A;  2F0O A;  1PTO F;  1SFO H;  2Y0S B;  2C9O A;  3M3Y H;  2MJ8 A;  4P73 A;  4B9X A;  4ID6 A;  4PQX A;  2F0M A;  2D62 A;  2ZT9 C;  3BZC A;  3KF6 B;  1DM0 B;  3CCS A;  2GA4 B;  1BDO A;  4YHH L;  1LYL A;  2JQO A;  1SNM A;  3TZD A;  1K8O A;  4DUZ Q;  4DR2 L;  1NR4 A;  4EQO A;  1SYC A;  1EY7 A;  2Q8I B;  4DR4 Q;  4K8I A;  5C0X I;  4OWW B;  4QIW B;  2Z4H A;  1PYW D;  2D5D A;  1JCK B;  3SGI A;  1ILQ A;  2F0N A;  1IHZ A;  3NTK A;  4RWS C;  3QOJ A;  4JOI A;  4APV A;  4DV1 Q;  1OXS C;  1B3Q A;  2F0J A;  2K05 A;  4JK1 C;  4X62 Q;  1HA6 A;  4WJ3 M;  2AMC B;  5HY6 A;  3HOX G;  1O7L A;  4IPD A;  5CGK A;  3S1R H;  1CA6 A;  3O13 A;  1EFW A;  1I4X A;  1HZ9 A;  5JVG 3;  2JA5 B;  4EQN A;  1KTK A;  3NQT A;  4ULL A;  2XN9 C;  3SEB A;  1T5E A;  3CC2 A;  2D0P A;  4L5T A;  2EY6 A;  2HIV A;  3CU7 A;  5JEA J;  2IX0 A;  4PZ8 A;  3V05 A;  1ASY A;  3GTQ H;  2BE5 D;  3E9H A;  3FEW X;  2B29 A;  2K5W A;  2LKV A;  2F52 A;  5C5M A;  2YTX A;  4DV5 Q;  4ZK9 B;  2NVQ B;  1HR0 W;  1F77 A;  1PZJ D;  1CFM A;  4JI4 Q;  2F0K A;  4XT3 B;  2HQE A;  1Y69 U;  4YY3 Q;  4NPS A;  2PI2 A;  4DV6 L;  3BZD B;  1HJP A;  2IX3 A;  4KY7 A;  1KLG D;  3QB3 A;  4DAP A;  3NEN A;  3CC7 A;  3MFG A;  4GKJ Q;  3I70 A;  4BBS B;  2CH4 A;  1FJG L;  5IWA Q;  2AQ2 B;  2RQX A;  2Q2U A;  2KED A;  4NB3 A;  1VQO A;  2P5Z X;  3Q24 A;  3M4P A;  5IGC A;  1VQ4 A;  1BCP C;  4CJ0 B;  1VQE A;  1I4H A;  4F7X A;  2KVM A;  3J7Z C;  4H13 C;  4LF4 L;  1K0S A;  1EL0 A;  3GTP H;  2RHQ B;  4RKB A;  4JBK A;  3ERO A;  1E2W A;  4P74 A;  4OGQ C;  1E3P A;  1EOT A;  4A93 G;  5FLX L;  2K5V A;  3PGZ A;  2B63 B;  1H9R A;  3GD7 A;  2VB2 X;  4WJW A;  1JMC A;  2R93 B;  4YHH Q;  1GUW A;  3EN2 A;  1Q46 A;  1A15 A;  4YCW A;  2DGY A;  3I3C A;  3KOJ A;  4TSS A;  1Q12 A;  1QUQ A;  4JI0 L;  4A3I H;  1VQA A;  4HR7 B;  1SYB A;  1PH5 A;  5E4X A;  3QIA A;  1A63 A;  3NP8 A;  2VNU D;  4FVM A;  3T13 A;  3B6Y A;  3EFX D;  1YNX A;  1Z47 A;  4KD4 A;  1RHP A;  4C3I H;  2JEA I;  2V1C C;  1NR2 A;  1K9M C;  1PHJ A;  1AEX A;  1VQ6 A;  4DA2 A;  1IXR A;  3IFT A;  3TS0 A;  1RJT A;  4X64 Q;  3QO2 A;  2F4V Q;  3OW7 A;  3T51 B;  5JJK A;  4G57 A;  4A3I G;  4NKL A;  2K03 A;  1BNZ A;  1Y14 B;  3C2P A;  1DON A;  1B7Y B;  1PFN A;  4KHV A;  3PF4 A;  1DD2 A;  1TKW B;  1ICF B;  1E22 A;  2FMM A;  5KND A;  1PDQ A;  5J3B A;  4GKK Q;  2NWG A;  4DU9 A;  4C3I G;  4N8F A;  1XMQ Q;  1ZEQ X;  2XSC A;  2K4K A;  1E0B A;  4FF4 A;  1PRT D;  2WKC A;  2ZTE A;  2PYK A;  4X65 L;  1I3Q B;  3U58 A;  3GTG H;  2UXD Q;  1IYJ B;  1FNW A;  3I72 A;  2NVT B;  1MI2 A;  1Q82 C;  1XNQ L;  2JA7 B;  1TY0 A;  2F0F A;  3MHB A;  1TT2 A;  1PH7 A;  2K52 A;  4A3E B;  2AKW B;  5IP9 H;  1I5F A;  3TDQ A;  1L0X B;  4DV2 L;  1YIJ A;  1KIX A;  3C1F A;  1HQR D;  3H09 A;  1HNW Q;  3M7N A;  3FRP B;  1PH8 A;  4GN4 B;  2MO0 A;  1QJO A;  3I56 A;  1N36 L;  2HHH L;  4DK1 A;  1SJE D;  2E75 C;  1A2T A;  2GN5 A;  3RR5 A;  4O0A A;  4X3S A;  3VR6 A;  4AH6 A;  4GS3 A;  1LTR D;  4UP7 A;  1EEI D;  1S40 A;  3D4W A;  2UXC Q;  3G6J B;  4U68 A;  4NDX A;  5M3F B;  4GN3 B;  1PYB A;  3DWA A;  3D3R A;  2XWB B;  1V9P A;  5KYL A;  4BY7 H;  4PMW A;  1L0W A;  1EEF D;  5C4Z A;  1AZQ A;  1H9J A;  1SNQ A;  2L11 A;  1VCI A;  3K7U C;  2NVQ H;  3NHH A;  1VQF A;  5IP9 G;  4IJH A;  3H3V C;  1TY2 A;  3PIP 3;  4NXN L;  5CV8 A;  1Z9F A;  3S2H B;  2EJF C;  5CMD A;  1B4O A;  3HOY H;  1H95 A;  2CCZ A;  4DV4 L;  2VXW A;  1B9N A;  5KYI A;  3KBG A;  3IAY A;  5LMN L;  5C5L A;  5BR8 L;  3DM3 A;  1BVS A;  4BBR B;  3HKZ G;  5DNF A;  2CW0 D;  4IOA A;  2F0I A;  1GUG A;  1LT3 D;  3BVZ A;  3L0O A;  4EX5 A;  1OXU A;  1R9T B;  1K8A C;  2F0W A;  4XYQ A;  4G7O C;  4RG1 A;  4CDF C;  4ZUJ A;  4BY7 G;  4GOP C;  4A3F B;  4R4Q A;  1HHV A;  4B3S Q;  2Z6K C;  5COR A;  1SYD A;  4K8J A;  2A6E D;  1Y8O B;  1D1K A;  2HCC A;  2R7Z B;  1B70 B;  1EOV A;  3BJU A;  1LT4 D;  1JQY D;  4X65 Q;  5M3M B;  4X3T A;  4XDX A;  2X6G A;  4A3B B;  2NTS A;  1WTQ A;  2R93 H;  1WTR A;  4POF A;  3VYU A;  1XNQ Q;  1GOZ A;  1PVO A;  3HOY G;  2B2Y C;  3N52 A;  4DV2 Q;  4FF3 A;  1W6K A;  1CKN B;  4MNO A;  1SYE A;  3MA2 B;  4LFC Q;  2EZV A;  3OYY A;  4KY5 A;  3AEV A;  1JB3 A;  1P16 A;  1GUN A;  1GO3 E;  3A55 A;  4TVA B;  1K3B C;  2B2T A;  5M5W H;  2SNM A;  5I4D A;  1NY4 A;  2F03 A;  5AFW A;  2MFI A;  2R3Z A;  2R7F A;  3QOL A;  4DAV A;  4F87 A;  1W6J A;  3D6C A;  1DJR D;  4M8A A;  5EBC A;  3TN2 A;  4HTH A;  1D2B A;  2R92 G;  1ESR A;  1JWM D;  4R1J A;  3W3A A;  2PCF B;  4GNX B;  2PW7 A;  3M4Y A;  3OIP A;  4KJN A;  1F9P A;  1K73 C;  2M9V A;  5ELE A;  3HOU H;  4LAA A;  1QE6 A;  2NZO A;  5KRU A;  1V1O A;  3PUV A;  4JI2 Q;  3OMG A;  1Y1V B;  3SVM A;  1WYD A;  1Q1E A;  4L8J A;  1PRT C;  5JJI A;  5FLM G;  1VQN A;  3IFD A;  3MFY A;  2R7D A;  5FOB B;  1LM0 A;  4BY1 B;  2A68 C;  3E3X A;  5C3W A;  2HT1 A;  3G71 A;  5LMN Q;  5GQO A;  4BXX G;  1D5X C;  4X66 L;  1HTP A;  3OPO A;  1NE3 A;  4B3M L;  2B2W A;  1D6E C;  3HOV G;  2VY3 A;  2VW9 A;  3LWE A;  1X3Q A;  2ZM6 L;  3DEP A;  4L5S A;  5IYD H;  3TEH B;  1H9M A;  4V19 0;  2N8N A;  3M4O H;  4RA8 A;  3AMU A;  2JK8 A;  3I91 A;  1LLR D;  5E1F A;  5IOC A;  1M1K C;  2TSS A;  2EYJ A;  4KI0 A;  4DAM A;  1K28 A;  3ZJY C;  3HOU G;  3KLS A;  5D3D A;  4DUY L;  4LFA L;  3TP7 A;  2NVT H;  3PQI A;  2E8G A;  2RVL A;  2AUK A;  2JA7 H;  4YWM A;  3JAM c;  5KNB A;  4IN3 A;  1EY0 A;  1UEA B;  5C0X J;  3M7G A;  1VQD A;  5FO8 B;  1X54 A;  4LUV A;  3K5L A;  3TQY A;  3H3V I;  2FMC A;  1VQK A;  2DJG C;  1EU4 A;  1WVL A;  1VQP A;  2JEB I;  1F9S A;  4LFB L;  1WTV A;  5IE8 A;  1CT1 D;  1G8Z D;  4JBM A;  4O2D A;  5FK9 C;  3HZX A;  4ZQ3 A;  5HUR A;  2I07 B;  1EWI A;  2OTL A;  4AQY Q;  4GLV B;  3C46 A;  4GN5 A;  3DWQ A;  3CD6 A;  1XTD A;  3T1Y L;  1YEZ A;  2EDG A;  5C44 H;  2Q8R E;  4K5V A;  1SYG A;  1UEB A;  4YWL A;  1KAB A;  1STA A;  3DUZ A;  5M3F H;  1N33 Q;  1O7Z A;  3HOZ H;  1MJC A;  3T53 B;  4RGN A;  3JAM E;  1BXT A;  1CKN A;  2BA0 A;  4BS9 A;  2CW0 C;  4BWG B;  5IGB A;  2HCI A;  5IOD A;  2RA4 A;  4XYO A;  3CQZ B;  3W5O A;  1TS4 A;  2I5L X;  5CC4 A;  1EYG A;  2DUD A;  4DFA A;  3NBI A;  1ROD A;  2ICE C;  3I7F A;  1FL0 A;  2QA4 A;  1KAW A;  1XMO L;  1QWY A;  2A6E C;  1N32 L;  4DK0 A;  5JPN C;  3V96 A;  4ABN A;  4RGM A;  2AUJ D;  1IL8 A;  3GTJ H;  4GNX A;  3J80 c;  3OTO L;  4H02 A;  4BBR H;  5DLQ E;  5AJ3 Q;  3J81 E;  5C44 G;  1PH9 A;  3HEJ A;  5IYC H;  1QB5 D;  4IFD G;  1SR3 A;  1X3P A;  1R9T H;  2ZTC A;  3HOZ G;  4B3M Q;  2EOT A;  4FDB A;  5ELC A;  1F9Q A;  4A93 B;  2ZM6 Q;  4A3F H;  5BN5 A;  3J7A V;  1VQI A;  1VQ5 A;  4P75 A;  3S1Q H;  2R7Z H;  1DOK A;  1K83 H;  5EBD A;  4L63 B;  2PNH A;  4A3B H;  4DUY Q;  4OL7 A;  2F0S A;  2IJ0 A;  2WP8 J;  3R2I A;  4JCV E;  4KD3 A;  1KDC A;  5DAU A;  5HGT A;  2PW5 A;  4QL5 A;  1JB7 A;  1UNS A;  3H0G H;  2QEJ C;  2JN4 A;  2Z0S A;  3PUW A;  4ZYS A;  2UU9 Q;  3UDX A;  4DUZ L;  4K5W A;  3GTO B;  3NTI A;  3MXG A;  2NB0 A;  5ELD A;  2GVB A;  5E7N A;  1AE2 A;  2VQF Q;  3CF5 A;  4DNT B;  5IYC G;  1AFP A;  5CR3 A;  2OT2 A;  1V43 A;  1XXG A;  1TWF H;  2JA8 H;  4X62 L;  1LAB A;  1UAP A;  1DGS A;  1PZI D;  2IW3 A;  2PNR C;  3I55 A;  4A3D H;  1HXY D;  2KCN A;  1STB A;  3ITP A;  5CBA E;  3ICE A;  1BCP B;  1R4Q B;  1IBL L;  4L5R C;  5IP7 G;  1IW7 C;  3NK9 A;  2CWP A;  1RIP A;  3GTL B;  4NMZ A;  5GAG C;  3S2D H;  1GUO A;  4B3T Q;  4HSV A;  4A3K B;  3H0G G;  1Y1V H;  1EY8 A;  4LW1 A;  1PTO H;  1YNJ D;  4HED A;  5BN4 A;  3I8Z A;  4QUC A;  1XMO Q;  2J0T D;  3I73 A;  1EZ8 A;  2XWJ B;  4PV1 C;  5ELB A;  5IT9 c;  4HCS A;  4BY1 H;  2YU9 B;  1HUN A;  4IFD I;  2BOS A;  1SE4 A;  5CV7 A;  1GHJ A;  4TKO B;  4K0K L;  4RHR A;  1PZK D;  1UE1 A;  2JA8 G;  3GTM B;  4GKJ L;  4MN3 A;  1PA6 A;  4A3D G;  3I4N B;  5I9P A;  4FP5 D;  4I65 A;  1ILP A;  1Q3L A;  4TQU S;  3CC4 A;  4OEL B;  2K7V A;  2E5L Q;  4KHZ A;  4CKC A;  2SDF A;  2EXD A;  1QUQ B;  2L5T A;  2SOB A;  2L0C A;  1GHK A;  4K5X A;  2K32 A;  5FO7 B;  1KAA A;  4RGO S;  1K8M A;  3CXC A;  1LAC A;  3QG1 A;  1X9N A;  2VQE Q;  3BDO A;  3OHX C;  1U4P A;  2V4D A;  4IJL A;  3HKZ E;  4NP5 A;  2KJX A;  2NVY H;  1TWC B;  3M4Q A;  4DR7 L;  1HZC A;  1XPU A;  3C3L A;  4DR3 Q;  1XPO A;  3X3M A;  1WFQ A;  1BQQ T;  3STB D;  1NSN S;  1DCZ A;  1F9R A;  2F3W A;  4AYB G;  4R4O A;  4DAY B;  4ZCK A;  2WAC A;  3SHL A;  1CSQ A;  1SDF A;  3Q8D A;  3PUY A;  1D5M C;  4EQP A;  3ERQ A;  4XTC S;  1L1O A;  2L12 A;  5EKL A;  1QIL A;  2NZH A;  4KY6 A;  4J15 A;  3H6M A;  2A19 A;  3CCR A;  1KXL A;  1S5C D;  4QF4 A;  5C4X H;  5C4J B;  2ICI A;  1HR0 L;  1KNE A;  4TRD A;  4R4T A;  4X64 L;  3JAM L;  4PZ7 A;  3J80 i;  2F4V L;  3KFU A;  1LTA D;  1G51 A;  4LMQ D;  1L1O C;  1X3F A;  2K5Q A;  1EY4 A;  3K0Y A;  5C3E B;  2KQ3 A;  2LMC B;  3NBH B;  4DXG A;  3J7A F;  2E2I B;  4K0K Q;  5JOB A;  3KLS X;  2WB1 B;  5COY A;  2WKD A;  3LGJ A;  3RZO B;  1EIY B;  2OTJ A;  4A3G B;  1SXT A;  1W3S A;  4JBJ A;  1SMX A;  2DY7 A;  1XNR L;  4GKK L;  1WCM H;  3OIQ A;  4V0B A;  2FHT A;  2EQS A;  4ODG A;  1XMQ L;  1V1Q A;  1VQ9 A;  3J81 L;  4WFN 3;  5G3L D;  5C4X G;  4ZKC B;  4WRD A;  5LL6 S;  1ONL A;  3Q22 A;  1HFN A;  2PZU A;  2UXD L;  4P2C B;  4C56 C;  2XVS A;  2EYL A;  3ZYY X;  2F0T A;  2NN6 H;  4DV3 Q;  4FXD A;  3NWT A;  2I0Q A;  2DJF C;  3M9B A;  1LT6 D;  1U5K A;  5E3F A;  3P7J A;  1I94 Q;  2EY5 A;  1N9W A;  3GTO H;  2E2J B;  4C2M B;  1HNW L;  3GQB A;  4DR7 Q;  1NMG A;  4KN7 C;  3FKI B;  1MGS A;  2B3G A;  4OIK A;  1QNK A;  1U4M A;  1ZYR D;  4CJ1 B;  2Z9H A;  3SK4 A;  1YNJ C;  2VB3 X;  4A3M H;  4R4I A;  1I50 H;  2KHJ A;  2QF7 A;  3PIO A;  1Q81 C;  3K7A H;  3WDN A;  1WCM G;  1CTM A;  4MTN A;  5H1S E;  2QDB A;  1CK1 A;  1A3U A;  2UXC L;  5M5X B;  4NW2 A;  1IL2 A;  3HFZ B;  4C3J H;  1I4P A;  2X6L A;  2L55 A;  2JA9 A;  1Z6H A;  1SNO A;  1TWG H;  2CH4 W;  4A4I A;  1N8R C;  3GTL H;  2D9U A;  5JEA H;  1PLF A;  2EYM A;  1WTP A;  5E4W C;  4LUO A;  1MD2 D;  1L2F A;  4DK6 C;  5CV9 A;  5CBE E;  4HID A;  4A75 A;  1IKL A;  2KEN A;  4G4K A;  4JPB W;  4DN4 M;  2K50 A;  1HR0 Q;  3SK5 A;  1NUC A;  4KKS A;  2M2L A;  3J7A 5;  4IPC A;  4DAY A;  1A3V A;  2HQL A;  2BH2 A;  1F2Z A;  3MTS A;  4HAE A;  4DR6 Q;  2LSS A;  1E1O A;  4IUP A;  4R9W A;  4A3M G;  3PO3 B;  3GTM H;  1JWS D;  2XRS D;  1BCP F;  1CUK A;  2F0G A;  4HSP A;  4A3C H;  2XTI A;  4C3J G;  3S1M B;  1XNR Q;  1O78 A;  5I6Y A;  5EGT A;  4OXP A;  1AZP A;  1E1T A;  4B3S L;  4FXK C;  1KRT A;  3STB C;  5JEA G;  1BOS A;  1G91 A;  3SDZ A;  3NBH A;  3OMC A;  4JBW A;  3BDC A;  5GAD C;  2PO4 A;  2LXJ A;  1BBX C;  3CPF A;  5C6A A;  4JI1 Q;  3Q0A A;  4BA2 I;  3OWF A;  2L15 A;  1IBM L;  1S5B D;  4RKL A;  2AQ1 B;  2JP1 A;  1JE5 A;  4LFC L;  2ENB A;  1IBK L;  4RFB A;  2KOL A;  1HCZ A;  2BE5 C;  1SMY D;  1X32 A;  3VR2 A;  4IUN A;  3UDF A;  4POG A;  2VZA A;  1PH4 A;  4DR1 Q;  4A3C G;  2QIL A;  5IGD A;  4OX9 Q;  1Q7Y C;  2UUC L;  1F2L A;  3PSI A;  3CRL C;  4MZ9 A;  3HRZ C;  5JPM C;  5I9O A;  2YTV A;  5EPJ A;  2EYP A;  4BA1 I;  4IZ8 A;  3I4M B;  3SK6 A;  2JA5 H;  5FJ8 H;  4PMC A;  4HMI A;  1DXM A;  2B2V C;  2Y0S G;  1D8L A;  1E2V A;  3L3O C;  5F2D A;  2MPM A;  3ULJ A;  2IL8 A;  5FKA C;  3QJY A;  1HZB A;  3VA5 A;  4JI8 L;  5C4J H;  1NMF A;  2F0L A;  2F0P A;  3D4D A;  3NQI A;  3G7L A;  3BDL A;  2L1B A;  5C3X A;  1TS3 A;  1NCV A;  4UP9 A;  4JI2 L;  3CHB D;  3QR8 A;  1B1Z A;  1PFM A;  2KHS A;  3FVQ A;  2K28 A;  1P8L A;  1S5D D;  3E9I A;  3HP3 A;  4XQJ A;  4GOP A;  2Z6K A;  1BF4 A;  3KBX A;  4HN7 A;  4QMG A;  4LNQ A;  1VQG A;  1YJW A;  3T1H Q;  1AW7 A;  3K81 C;  3Q23 A;  2VS1 A;  1B44 D;  2K33 A;  2Q2I A;  4BBS H;  1DOM A;  1FNV A;  2JA5 G;  2OXP A;  3D4R A;  3RN5 A;  3PO2 B;  3G48 A;  3RZD B;  1HZA A;  3W1B A;  2SEB D;  4LUZ A;  3SE0 A;  2B2Y A;  4ME3 A;  3CCV A;  3X3N A;  1HTL D;  1STY A;  1CKM A;  5IGE A;  1NAP A; 
#chains in the Genus database with same CATH homology
 1EY9 A;  2O4X A;  1XYI A;  1QNU A;  2B39 A;  1Y1W B;  3L9A X;  2EXZ A;  5EKK A;  5CV4 A;  4S3S A;  4DNR B;  1U4L A;  1Y8P B;  3TP5 A;  1SE2 A;  2E74 C;  4A3J B;  1HA5 A;  2IWH A;  3MXP A;  1LO5 D;  1LTI D;  4OO1 H;  1MSH A;  2JA6 B;  2H4O A;  2NZ1 D;  2RSN A;  4R8I A;  2EYO A;  5J39 A;  4C3H B;  3R93 A;  3K58 A;  1D5Z C;  3A7A B;  1CHP D;  3CKI B;  1C8C A;  1AN8 A;  3OWE B;  2O5J C;  1CA5 A;  4I7Z C;  3NE5 B;  5D65 A;  1S5E D;  2AWO A;  2DNE A;  3I90 A;  4IFD J;  1KDB A;  2WAQ B;  1H9S B;  4H7B A;  1G29 1;  5EQ0 A;  4OO1 G;  2VUM B;  1PTO D;  3DWP A;  3HOW B;  3UI2 A;  1EYC A;  2G9H D;  2RBM A;  1V8Q A;  2DN8 A;  5JJZ A;  3MZ5 A;  3MWY W;  2L9H A;  3K57 A;  1ZKO A;  4EVO A;  4OIJ A;  1SMY C;  1PXU A;  2XNA C;  3BS1 A;  2I46 A;  2HDM A;  4KJO A;  3RMH A;  3R3O A;  1SYF A;  5D3I B;  1I6V C;  4PNY A;  3TSS A;  2F0V A;  4ZLT F;  3L7Z C;  1QCB D;  1SNC A;  3S15 B;  3HGB A;  5T1I A;  4Q0F A;  3HOX B;  1SEB D;  3FDT A;  3K5N A;  1OXV A;  3OSO A;  1ET9 A;  2KCC A;  1SFO B;  5DM6 3;  1B53 A;  1FYC A;  5LHY 1;  1BR9 A;  1I4R A;  3M3Y B;  4FXG C;  2O2L D;  1HQM C;  3K5O A;  3NPP A;  3AU7 A;  3RD4 A;  1FNU A;  2A74 C;  1EWH A;  4O42 A;  3WOF A;  2OEO A;  4XQN A;  4DGZ A;  1L0Y B;  1QG7 A;  3MEH A;  3TP8 A;  1I4G A;  4QUF A;  4KTA A;  3TP6 A;  1MBY A;  1VMP A;  1T5X D;  1ML0 D;  3A8K E;  3PMF A;  2EJM A;  3PUX A;  3P20 A;  1GUS A;  5C4H A;  2BDO A;  1H9S A;  4IUU A;  4C1N I;  2NVX B;  1ET6 A;  3D6W A;  2D2C C;  3J80 E;  1DZ1 A;  5C0X H;  3C1E A;  2PMZ B;  1JC7 A;  3R2T A;  2B8F A;  1A3T A;  4DF7 A;  4F88 A;  3D31 A;  2E2H B;  4EGV A;  2IPK D;  4KMU C;  2K04 A;  2MP1 A;  2BDN A;  4XIG S;  1TII D;  1PTO C;  1B2T A;  4DXF A;  1WD1 A;  2F0D A;  4ME5 A;  4FF2 A;  3KLR A;  1BO0 A;  1BCP D;  3M85 A;  4A3I B;  3S16 B;  3FPP A;  1CHQ D;  2F1M A;  5C0X G;  3BYY B;  4FO2 A;  3V2T A;  4UAI A;  1C48 A;  3AB9 A;  3D8G A;  3TBI B;  2AQ3 B;  1GXD C;  2EYF A;  3N6R A;  1Q8I A;  4GZY C;  4C3I B;  1G2S A;  5J22 A;  2IX1 A;  1G2T A;  3BG3 A;  2C5C A;  2QKI C;  4L6T B;  1D1I A;  1STE A;  1ENC A;  2K01 A;  1FGB D;  2PQE A;  3QWN A;  1Q90 A;  3GV3 A;  3I4L A;  2E2D C;  1SJH D;  2YYZ A;  5IT9 E;  3ONA B;  5KNC A;  3NWS A;  5FO9 B;  1Q1B A;  2ID0 A;  3E5S A;  1GJX A;  1CQF A;  1JOR A;  1V1P B;  3LWU A;  3PUZ A;  5DM7 3;  1M8A A;  2HDL A;  3BVM A;  1VDZ A;  2LS0 1;  1TWA B;  2AWN A;  3MXN A;  1LTG D;  5EPK A;  2BCO A;  5D14 A;  1ESF A;  3KF8 A;  3GTG B;  1ENF A;  3SR1 A;  5KGU A;  1U4R A;  4YIJ A;  2F0H A;  2R6G A;  2RDG A;  3OOC A;  3GV6 A;  2NUC A;  4B08 A;  4KKU A;  1LV9 A;  5K36 H;  1SND A;  3HKZ B;  4M1U B;  3KK7 A;  2FFK B;  4HMJ A;  2CHB D;  3H94 A;  2KA7 A;  3PV0 A;  4BY7 B;  1HUM A;  3T56 B;  5M5Y B;  3P1H A;  5IGG A;  4H0L C;  3HOY B;  4K2K A;  3T4A C;  4U67 3;  2CVR A;  5K36 G;  1CQV A;  3IL8 A;  1O7Y A;  3LX0 A;  2WII B;  2Q8T A;  1DOL A;  1WTX A;  2F4I A;  4J6H A;  1LT5 D;  2A5H A;  3RUZ A;  4G7H C;  3VR4 A;  2R92 B;  3J80 L;  3TZU A;  4J8Q A;  2K1B A;  1SNP A;  5CYU A;  4MIU A;  1TQO A;  4RHS A;  2R61 A;  1EYD A;  2ZXO A;  1PMR A;  1V1P A;  4IUQ A;  4IUR A;  3BVG A;  1Y8N B;  1ENA A;  2NN6 G;  5M5W B;  3A8J E;  5TSS A;  2K5D A;  2EY2 A;  4Y7N B;  4RH6 A;  2L4N A;  1HPC A;  3MC0 B;  5I2X A;  2HUG A;  3HOV B;  2NYZ D;  3E6Z X;  2RKS A;  4KKT A;  4OHJ A;  1B50 A;  3SXH A;  4F8M A;  3LNN A;  3HOU B;  1SBB B;  3EVQ A;  3HS0 C;  3P75 A;  1EY5 A;  5NUC A;  1RTO A;  3K6O A;  1OXX K;  1A6X A;  1E2Z A;  4FYD A;  1SE3 A;  1M4V A;  5KEE A;  1RCV D;  1GUT A;  2FJ2 A;  1R4P B;  5ELF A;  4CGY B;  1PRT B;  2B2V A;  2RSO A;  3M4O B;  4RGT A;  5IT9 L;  3FMC A;  3ND8 A;  1EWC A;  3WOE A;  2NTT A;  2K6A A;  4CKB A;  2A68 D;  4ILW A;  5J1Z A;  3MVV A;  3A7L A;  1DYQ A;  1IYU A;  1TS2 A;  1CI3 M;  2NN6 I;  4XT1 B;  4C1N K;  1HFG A;  1B3A A;  2EY1 A;  3ND9 A;  4IAL A;  2PZW A;  3GTK B;  1EQV A;  4Q5V A;  4HCE A;  5C44 B;  1SSO A;  1YNN D;  1EYA A;  2EPB A;  1TS5 A;  3HOZ B;  2A69 D;  3URY A;  5A35 A;  5I6W A;  3EQL C;  2KEC A;  2SNS A;  1G6Z A;  4H44 C;  1JOK A;  4X3U A;  1WTO A;  1OXT A;  4PMB A;  1ZXT A;  2QCP X;  1A2U A;  4CBV A;  3FPU B;  3S14 B;  4MHE A;  3F2U A;  1ZYR C;  1CM9 A;  3GTJ B;  4CKE A;  2F0U A;  1JIC A;  4ZUI A;  2RDH A;  1RDP D;  2E76 C;  1I4Q A;  3RLF A;  1TWH B;  2B2U A;  2BA1 A;  5A2Q E;  1VF5 C;  3DXJ C;  3DMU A;  1XX8 A;  5IIF A;  3S1Q B;  4FNF A;  4LK1 C;  3VYR A;  1LTS D;  4KN4 C;  4RCO A;  3K59 A;  1K83 B;  1J9O A;  2LFN A;  2EVB A;  1EQT A;  2WIN B;  2A6H D;  2B2U C;  1JE4 A;  2PZT A;  3A54 A;  1IKM A;  3S1N B;  1H9K A;  3H0G B;  2J7Z A;  5JAV A;  1JOO A;  4Z9C B;  5G3L F;  1I6H B;  1EIG A;  3DHQ A;  1TWF B;  2JA8 B;  2F0E A;  1JWU D;  3NTH A;  2O5I C;  5EPL A;  2WV6 D;  1SAP A;  4A3D B;  1KDA A;  4G7Z C;  4XQQ A;  1EY6 A;  3NUC A;  3E0J A;  2OF1 A;  1TU2 B;  5EKI A;  2B2T C;  1RD9 D;  1VMC A;  4IUT A;  4RAU C;  3S2D B;  2CQA A;  1BUV T;  2RDF A;  1EFI D;  1PTO B;  1EIH A;  2NBF A;  2J4X A;  4K6L A;  3S17 B;  1XTC D;  2A73 B;  3CRK C;  1KNA A;  2JE6 I;  4E6I A;  1IW7 D;  1ICW A;  3Q6S A;  1II3 A;  1VF7 A;  2TMP A;  5LL6 X;  1B9M A;  3MAQ A;  1RKN A;  2M00 A;  4AYB B;  2JSO A;  5BN3 A;  4R8N A;  4K6D A;  3VR3 A;  5K5P A;  5EJW A;  2MGS A;  2Z4I A;  2N55 A;  1YNN C;  2B2W C;  4B9W A;  1WD0 A;  4J1M A;  2A69 C;  1Z7T A;  1CZW A;  1HRJ A;  2NVY B;  1STG A;  1JOQ A;  3A56 A;  1S5F D;  1XWE A;  3EJI A;  1PRT F;  2EJG C;  4UDU C;  3R8B A;  1EZ6 A;  3GP7 A;  2X69 A;  4OO1 I;  3EA6 A;  3W2D A;  4IFD H;  1F2Y A;  3S1R B;  5DEH A;  2LY7 A;  4ZAI A;  2IT1 A;  1STH A;  2DY8 A;  5IGF A;  5C4X B;  3GTQ B;  2F0Q A;  2N88 A;  3A8I E;  4ZKB B;  4X3K A;  5ISR A;  4QB4 A;  2B8G A;  2JXM B;  1RTN A;  1FR3 A;  1AP0 A;  2A6H C;  2FIN B;  3VYS A;  1STN A;  5KIX A;  4K2L A;  4KV6 A;  4RCN A;  5CV5 A;  4WOR A;  2JYO A;  3NSW A;  5FLX E;  3HG9 A;  3SK8 A;  3DEO A;  1WCM B;  2Z1C A;  1F2M A;  5T1G A;  2ZXR A;  1TVX A;  4KK7 A;  1MSG A;  4CHT B;  3GO5 A;  2KEE A;  4ZRZ A;  3GTP B;  5A2Q L;  4IQZ A;  1U9R A;  2XRQ D;  2KUM A;  1C4Q A;  4K14 A;  3H91 A;  4QCL A;  3KUP A;  3VYT A;  3J7Y W;  1TR5 A;  3BYT B;  3K5M A;  1CZG A;  2Z8L A;  1JR0 D;  4N9T A;  1IYV A;  3IKJ A;  4A3M B;  1PFB A;  1J8I A;  1I50 B;  3K7A B;  4IUV A;  1WTW A;  2EYH A;  3U9S A;  4C3J B;  2DNC A;  1LTB D;  2MHV A;  4CJ2 C;  1TWG B;  1LTT D;  1QOH A;  2MUY A;  4C3H G;  2PPB C;  1KLU D;  1RF2 D;  3DM1 A;  2ZXP A;  3MXU A;  2XIW A;  1FD7 D;  4O1N A;  1OO9 B;  3VA7 A;  1EU3 A;  3TME A;  1UUP A;  2G9D A;  5I2Y A;  3PIO 3;  3S9W A;  4LJZ C;  4N9P A;  4XXE A;  2EE1 A;  3T16 A;  3VR5 A;  4FF1 A;  1S4Z A;  5M9O A;  5JVH 3;  2F3V A;  3U9O A;  2H1E A;  3NXW A;  1O80 A;  5CV6 A;  2F0O A;  1PTO F;  2Y0S B;  2C9O A;  2MJ8 A;  4B9X A;  4ID6 A;  4PQX A;  2F0M A;  2D62 A;  2ZT9 C;  1DM0 B;  2GA4 B;  1BDO A;  1SNM A;  3TZD A;  1K8O A;  1NR4 A;  4EQO A;  1SYC A;  1EY7 A;  2Q8I B;  4K8I A;  5C0X I;  4QIW B;  2Z4H A;  1PYW D;  2D5D A;  1JCK B;  1ILQ A;  2F0N A;  1IHZ A;  3NTK A;  4RWS C;  3QOJ A;  1OXS C;  2F0J A;  2K05 A;  4JK1 C;  1HA6 A;  1O7L A;  5CGK A;  1CA6 A;  3O13 A;  1I4X A;  5JVG 3;  2JA5 B;  4EQN A;  1KTK A;  3NQT A;  4ULL A;  2XN9 C;  3SEB A;  1T5E A;  2EY6 A;  3CU7 A;  5JEA J;  2IX0 A;  3V05 A;  2BE5 D;  3FEW X;  2K5W A;  2LKV A;  5C5M A;  4ZK9 B;  2NVQ B;  1F77 A;  1PZJ D;  1CFM A;  2F0K A;  4XT3 B;  2HQE A;  1Y69 U;  3BZD B;  2IX3 A;  4KY7 A;  1KLG D;  3QB3 A;  4DAP A;  3MFG A;  3I70 A;  4BBS B;  2AQ2 B;  2RQX A;  2KED A;  3Q24 A;  5IGC A;  1BCP C;  4CJ0 B;  1I4H A;  4F7X A;  2KVM A;  4H13 C;  1EL0 A;  4RKB A;  3ERO A;  1E2W A;  4OGQ C;  1EOT A;  5FLX L;  2B63 B;  1H9R A;  3GD7 A;  2VB2 X;  4WJW A;  2R93 B;  1GUW A;  1A15 A;  3I3C A;  4TSS A;  1Q12 A;  4HR7 B;  1SYB A;  5E4X A;  3QIA A;  3NP8 A;  2VNU D;  4FVM A;  3T13 A;  3EFX D;  1Z47 A;  4KD4 A;  1RHP A;  2JEA I;  1NR2 A;  1AEX A;  4DA2 A;  3IFT A;  1RJT A;  3QO2 A;  3OW7 A;  3T51 B;  4G57 A;  4NKL A;  2K03 A;  1BNZ A;  3C2P A;  1DON A;  1PFN A;  4KHV A;  1DD2 A;  1TKW B;  2FMM A;  5KND A;  1PDQ A;  2NWG A;  4DU9 A;  4C3I G;  1ZEQ X;  2XSC A;  1E0B A;  4FF4 A;  1PRT D;  2WKC A;  2PYK A;  1I3Q B;  1FNW A;  3I72 A;  2NVT B;  1MI2 A;  2JA7 B;  1TY0 A;  2F0F A;  3MHB A;  1TT2 A;  4A3E B;  3TDQ A;  1L0X B;  3C1F A;  1HQR D;  3H09 A;  3M7N A;  3FRP B;  1QJO A;  4DK1 A;  1SJE D;  2E75 C;  1A2T A;  4X3S A;  3VR6 A;  1LTR D;  1EEI D;  3D4W A;  3G6J B;  4U68 A;  4NDX A;  5M3F B;  3DWA A;  3D3R A;  2XWB B;  5KYL A;  4PMW A;  1EEF D;  5C4Z A;  1AZQ A;  1H9J A;  1SNQ A;  2L11 A;  1VCI A;  3NHH A;  3H3V C;  1TY2 A;  3PIP 3;  5CV8 A;  3S2H B;  2EJF C;  5CMD A;  1B4O A;  2VXW A;  1B9N A;  5KYI A;  3KBG A;  3IAY A;  5C5L A;  4BBR B;  5DNF A;  2CW0 D;  2F0I A;  1GUG A;  1LT3 D;  3BVZ A;  1OXU A;  1R9T B;  2F0W A;  4XYQ A;  4G7O C;  4ZUJ A;  4A3F B;  1HHV A;  5COR A;  1SYD A;  4K8J A;  2A6E D;  1Y8O B;  1D1K A;  2HCC A;  2R7Z B;  1LT4 D;  1JQY D;  5M3M B;  4X3T A;  4XDX A;  2X6G A;  4A3B B;  2NTS A;  1WTQ A;  1WTR A;  3VYU A;  1GOZ A;  2B2Y C;  3N52 A;  4FF3 A;  1W6K A;  1SYE A;  3MA2 B;  2EZV A;  4KY5 A;  1JB3 A;  1GUN A;  3A55 A;  2B2T A;  2SNM A;  5I4D A;  2F03 A;  5AFW A;  2R3Z A;  3QOL A;  4DAV A;  4F87 A;  1W6J A;  3D6C A;  1DJR D;  4M8A A;  5EBC A;  3TN2 A;  4HTH A;  1D2B A;  1ESR A;  1JWM D;  3W3A A;  2PCF B;  2PW7 A;  3M4Y A;  3OIP A;  4KJN A;  1F9P A;  2M9V A;  5ELE A;  4LAA A;  1QE6 A;  5KRU A;  1V1O A;  3PUV A;  3OMG A;  1Y1V B;  3SVM A;  1Q1E A;  4L8J A;  1PRT C;  3IFD A;  3MFY A;  5FOB B;  4BY1 B;  2A68 C;  5C3W A;  1D5X C;  1HTP A;  3OPO A;  2B2W A;  1D6E C;  3LWE A;  1X3Q A;  3DEP A;  1H9M A;  4V19 0;  4RA8 A;  3AMU A;  3I91 A;  1LLR D;  5E1F A;  5IOC A;  2TSS A;  2EYJ A;  4KI0 A;  3KLS A;  5D3D A;  3TP7 A;  2RVL A;  2AUK A;  5KNB A;  4IN3 A;  1EY0 A;  1UEA B;  5C0X J;  3M7G A;  5FO8 B;  3K5L A;  2FMC A;  1EU4 A;  1WVL A;  2JEB I;  1F9S A;  1WTV A;  1CT1 D;  1G8Z D;  5FK9 C;  3HZX A;  4ZQ3 A;  5HUR A;  2I07 B;  3C46 A;  3DWQ A;  2EDG A;  2Q8R E;  4K5V A;  1SYG A;  1KAB A;  1STA A;  3DUZ A;  1O7Z A;  3T53 B;  4RGN A;  3JAM E;  1BXT A;  2BA0 A;  4BS9 A;  2CW0 C;  4BWG B;  5IGB A;  2HCI A;  5IOD A;  2RA4 A;  4XYO A;  3CQZ B;  1TS4 A;  5CC4 A;  4DFA A;  3NBI A;  1ROD A;  2ICE C;  1QWY A;  2A6E C;  4DK0 A;  5JPN C;  3V96 A;  4ABN A;  4RGM A;  2AUJ D;  1IL8 A;  3J81 E;  3HEJ A;  1QB5 D;  4IFD G;  1X3P A;  2EOT A;  5ELC A;  1F9Q A;  4A93 B;  5BN5 A;  3J7A V;  1DOK A;  5EBD A;  4L63 B;  4OL7 A;  2F0S A;  2IJ0 A;  2WP8 J;  3R2I A;  4KD3 A;  1KDC A;  5DAU A;  5HGT A;  2PW5 A;  1UNS A;  2QEJ C;  3PUW A;  4ZYS A;  4K5W A;  3GTO B;  3NTI A;  3MXG A;  2NB0 A;  5ELD A;  4DNT B;  1AFP A;  5CR3 A;  2OT2 A;  1V43 A;  1XXG A;  1LAB A;  1UAP A;  1PZI D;  2IW3 A;  2PNR C;  1HXY D;  2KCN A;  1STB A;  3ITP A;  5CBA E;  1BCP B;  1R4Q B;  1IW7 C;  3NK9 A;  3GTL B;  4NMZ A;  1GUO A;  4HSV A;  4A3K B;  1EY8 A;  1PTO H;  1YNJ D;  4HED A;  5BN4 A;  3I8Z A;  4QUC A;  2J0T D;  3I73 A;  1EZ8 A;  2XWJ B;  4PV1 C;  5ELB A;  4HCS A;  2YU9 B;  1HUN A;  4IFD I;  2BOS A;  1SE4 A;  5CV7 A;  1GHJ A;  4TKO B;  4RHR A;  1PZK D;  3GTM B;  4MN3 A;  3I4N B;  5I9P A;  4FP5 D;  4I65 A;  1ILP A;  1Q3L A;  4TQU S;  2K7V A;  4KHZ A;  4CKC A;  2SDF A;  2L5T A;  2SOB A;  2L0C A;  1GHK A;  4K5X A;  2K32 A;  5FO7 B;  1KAA A;  4RGO S;  1K8M A;  1LAC A;  3QG1 A;  3BDO A;  3OHX C;  1U4P A;  2V4D A;  4NP5 A;  2KJX A;  1TWC B;  3C3L A;  3X3M A;  1BQQ T;  1NSN S;  1DCZ A;  1F9R A;  2F3W A;  2WAC A;  3SHL A;  1SDF A;  3PUY A;  1D5M C;  4EQP A;  3ERQ A;  4XTC S;  2L12 A;  5EKL A;  1QIL A;  4KY6 A;  3H6M A;  1S5C D;  4QF4 A;  5C4J B;  2ICI A;  1KNE A;  4TRD A;  3JAM L;  1LTA D;  4LMQ D;  2K5Q A;  1EY4 A;  3K0Y A;  5C3E B;  2KQ3 A;  2LMC B;  4DXG A;  3J7A F;  2E2I B;  5JOB A;  3KLS X;  2WB1 B;  5COY A;  2WKD A;  3RZO B;  4A3G B;  1SXT A;  2DY7 A;  3OIQ A;  4V0B A;  2FHT A;  4ODG A;  3J81 L;  4WFN 3;  5G3L D;  4ZKC B;  4WRD A;  5LL6 S;  1ONL A;  3Q22 A;  1HFN A;  2PZU A;  4P2C B;  4C56 C;  2XVS A;  2EYL A;  3ZYY X;  2F0T A;  2NN6 H;  4FXD A;  3NWT A;  1LT6 D;  5E3F A;  3P7J A;  2EY5 A;  2E2J B;  4C2M B;  3GQB A;  4KN7 C;  3FKI B;  1MGS A;  4OIK A;  1QNK A;  1U4M A;  1ZYR D;  4CJ1 B;  3SK4 A;  1YNJ C;  2VB3 X;  2QF7 A;  3WDN A;  1CTM A;  2QDB A;  1CK1 A;  1A3U A;  5M5X B;  4NW2 A;  1I4P A;  2X6L A;  2L55 A;  1Z6H A;  1SNO A;  2D9U A;  5JEA H;  1PLF A;  2EYM A;  1WTP A;  5E4W C;  1MD2 D;  5CV9 A;  5CBE E;  1IKL A;  4DN4 M;  4G4K A;  3SK5 A;  1NUC A;  4KKS A;  2M2L A;  4DAY A;  1A3V A;  1F2Z A;  3MTS A;  4HAE A;  4IUP A;  4R9W A;  3PO3 B;  1JWS D;  2XRS D;  1BCP F;  2F0G A;  4HSP A;  4C3J G;  3S1M B;  1O78 A;  5I6Y A;  5EGT A;  1AZP A;  4FXK C;  5JEA G;  1BOS A;  1G91 A;  3SDZ A;  3NBH A;  3OMC A;  4JBW A;  3BDC A;  2PO4 A;  1BBX C;  5C6A A;  3Q0A A;  4BA2 I;  3OWF A;  1S5B D;  4RKL A;  2AQ1 B;  2JP1 A;  2ENB A;  4RFB A;  2KOL A;  1HCZ A;  2BE5 C;  1SMY D;  1X32 A;  3VR2 A;  4IUN A;  2QIL A;  5IGD A;  1F2L A;  3CRL C;  3HRZ C;  5JPM C;  5I9O A;  5EPJ A;  4BA1 I;  2EYP A;  4IZ8 A;  3I4M B;  3SK6 A;  4PMC A;  4HMI A;  1DXM A;  2B2V C;  1E2V A;  3L3O C;  5F2D A;  2MPM A;  2IL8 A;  5FKA C;  3QJY A;  3VA5 A;  2F0L A;  2F0P A;  3D4D A;  3NQI A;  3G7L A;  3BDL A;  2L1B A;  5C3X A;  1TS3 A;  1NCV A;  3CHB D;  1B1Z A;  1PFM A;  2KHS A;  3FVQ A;  2K28 A;  1S5D D;  3HP3 A;  4XQJ A;  1BF4 A;  3KBX A;  4HN7 A;  4QMG A;  1AW7 A;  3Q23 A;  1B44 D;  2K33 A;  1DOM A;  1FNV A;  2OXP A;  3D4R A;  3PO2 B;  3RZD B;  2SEB D;  3SE0 A;  2B2Y A;  3X3N A;  1HTL D;  1STY A;  5IGE A;  1NAP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...