4DUZL

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u13c, bound with streptomycin
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
124
structure length
123
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
total genus 13
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4duzL00
2B3GA 2UUAQ 2A19A 2VQEL 1E22A 2E8GA 2WB1E 3NELA 4YHHL 4KHPQ 1HNZQ 1SE8A 1KRTA 2CFMA 4R4QA 3CCRA 2JA7H 3S14H 5GAEC 5GQOA 1D8LA 4A4IA 1HR0W 1OTCA 1X55A 2EQSA 1TXYA 2EXDA 2VUMH 1G51A 2VL6A 3J81i 3NBHB 1YHBA 5AJ3L 1VQLA 4JV5Q 1PH4A 1Y1VG 4BBRH 4QIWE 3PO2H 1IZ6A 1S72A 2LSSA 1VQMA 1V9PA 1YHAA 2K14A 2WAQG 2Z6KA 3H15A 2VQFQ 3GTLH 2IX1A 4X66Q 1Q81C 4HJ7A 4DK6C 4TVAB 1K8GA 1IBLQ 4OO1G 4LFCQ 5FJ8H 3PUXA 1XMQQ 4DR1Q 4LFBL 3KJOA 2PQAA 1K9MC 1I50H 1SN8A 1EQQA 1PH6A 4A3BG 4A3DG 1N32L 4DR6Q 4IPDA 3CPWA 1JJ2A 3B6YA 1D7QA 4LUOA 2OCEA 1N36L 2OQ0A 3HOXH 3S16H 4L5QA 3CCLA 2K5VA 3L0OA 4A3GG 1HJPA 4IFDG 5M3MG 1PV4A 4JI7L 4JI1Q 4GNXB 4MTNA 2YYZA 4OWXB 1UEBA 2Y0SG 1PH3A 4IPCA 1BBWA 3KDFA 5M5WH 5C0XI 4KLKA 1XNRQ 3U4ZA 3A5UA 1AH9A 1X6OA 1YJ9A 2UUBL 3L7ZC 5M5XH 3I56A 1TWCH 4DV1L 1UE6A 2K50A 4L5RC 1BVSA 4A75A 4UP9A 4R4IA 3M9BA 3T1YL 4BY1G 3CMEA 2E2JH 5M3FG 1Z47A 2F4VQ 3EN2A 5LMUL 1FGUA 4DUZL 4GOPC 2B29A 1C0AA 1KRSA 5GAHC 3T1HQ 3H0GG 2XTIA 2D0OA 1BBUA 1N9WA 3A74A 5LMNW 4DV7L 1PH5A 2JA6H 4IOAA 1YIJA 4GN4B 2OTJA 4C3HH 4DV2Q 1V43A 3UDXA 2UXBQ 1KIXA 4HJ9A 2R92H 3I4OA 1YITA 2UUAL 4KHPL 4JBWA 1TWAH 2KENA 1CUKA 4A3JH 1HNZL 1NBWA 4IPHA 4P75A 4R1JA 4YCVA 1FJGQ 4WJ4A 3FKIH 2VUMG 2JA5H 1HR0Q 5IY0A 4GOPA 1XJVA 3PO2G 4BBRG 2K4KA 1SRUA 2KBNA 4JI4Q 3S1RH 4A3CH 1P16A 3CAMA 4JV5L 1WCMH 1A8VA 3GTOH 2I5LX 2JA8H 4DV3Q 1YHQA 3HOUH 3PV0A 2VQFL 3RZOH 5IE8A 1AE2A 1W3SA 4X66L 3BU2A 3F2CA 1Y14B 1IBLL 3AFPA 4JI0Q 5JEAJ 4BY7H 4AQYQ 3TS2A 4PZ8A 1Z9FA 3M4QA 4DR1L 2E2HH 3GTGH 3RR5A 2MO0A 4DR6L 1N32Q 4JI6Q 4DR2Q 1K8AC 2JK8A 2K52A 3M4OH 2HIXA 4OXPA 4DPGA 5JJIA 4P74A 3F2BA 1Q12A 1E1OA 1UE7A 1MKHA 2WB1G 3I4MH 2NZHA 4X65Q 2RHSB 2Q2UA 2R93G 3BZKA 4JI1L 4JI7Q 3RLNA 2RF4A 5J3BA 1PFSA 1GM5A 1KXLA 3CP0A 4EX5A 5JJLA 5ELNA 4YWKA 3UE1A 4UY8C 1XNRL 1OXTA 3CCSA 3LGJA 3J80i 3CCVA 5C3EH 1XPUA 5C4XH 4GNXA 2RHQB 3RNUA 4RG1A 1MIUA 1B7YB 2F4VL 3T1YQ 2QGQA 4IPGA 1VQFA 1XPRA 2JA6G 4NB3A 1L1OA 3T1HL 1YJWA 5E7NA 5LMNQ 2IHEA 3K81C 4DV7Q 3KF6A 1I94Q 1H95A 2NN6G 1EIFA 4DV2L 1VQ7A 4JBMA 2UXCQ 2R92G 2UXBL 5DLQE 4NPSA 2Z6KC 4PZ6A 2N3SA 4LF9Q 2PMZE 1EUJA 3PF4A 4X62Q 1G6PA 3D31A 1VQPA 5JEAG 4JBKA 4A3JG 4LUZA 2GN5A 4DV4L 1SROA 3FKIG 1IBMQ 5K36G 1K73C 2JA5G 1JJCB 4DR5L 3PUZA 1FJGL 2CQOA 4IJHA 2JQOA 2V1CC 3M4PA 3CCJA 3F2DA 1HR0L 3D0FA 4P71A 1A62A 4A93H 2YTXA 1WCMG 5FLXc 2MO1A 4A3CG 1I3QH 2JA8G 3OW2A 2R7DA 1O7IA 4LWCA 1VCIA 3M85A 2QEXA 3WWVA 1PH7A 4JI4L 3CXCA 1E24A 3HOUG 4DV3L 2MFIA 3IRBA 3KYHC 1YEZA 5IWAQ 3PO3H 3PIPA 2IHFA 4JI0L 3ULLA 4AQYL 3G6EA 2PI2E 3KJPA 3S1QH 4JI5Q 4R4OA 3I55A 3GD7A 2K5HA 3RLOA 3FP9A 3K80C 4XIGS 3CCUA 4JOIC 4JI6L 4IJLA 4C3JH 2HIVA 4XTCS 4DR2L 4PMWA 1NTGA 1E3PA 2BH8A 1LYLA 4QY7A 3H3VI 3I4MG 2JA9A 2LXKA 2IX0A 3W1BA 1XPOA 4DNIA 4X65L 3RN2A 3PCOB 4ALPA 1HNWQ 3MEFA 1WOCA 1GKHA 5C44H 3VDYA 3CPFA 2R93H 5C3EG 5C4XG 1S40A 2KHIA 2BH2A 3KOJA 4R4TA 4L5SA 1EYGA 4GLVB 4B3TQ 3I4NH 4TQUS 1L1OB 3CMAA 1PYBA 4GN5A 1ASYA 1CSPA 2CKZB 4JOIA 1XMOQ 3KF6B 2YTVA 3JC66 4GLAC 4LUVA 2Q2TA 1VQ9A 4LF8Q 1MJEA 1J5EL 3CC2A 2R7ZH 4B3MQ 5LMNL 2OWOA 4JI3Q 4L5TA 3M3YH 1I94L 3CCMA 4A3LH 5IYDH 1K3RA 1C7YA 2KCTA 4HIOA 2UXCL 2JEBI 4FDBA 4LNQA 1U5KA 5JJKA 4LF9L 4X62L 1HZAA 4OWTB 5HGQA 1IL2A 2JEAI 1K0RA 2D0PA 1UE1A 1OXSC 4JCVE 4DUYQ 1IBML 2K5NA 1T9HA 4DAYB 1OXXK 1VQIA 4MZ9A 1VQJA 5C0XJ 3GTJH 4DV4Q 1VQEA 3JAMc 4DR5Q 5GROA 3CC4A 2YU9H 4A93G 1G291 2LXJA 4NXNL 4BBSH 1QVCA 2NVYH 2VNUD 1X9NA 4BXXH 1KAWA 4K0KL 1SR3A 3PO3G 2YV5A 1YVCA 1UE5A 2R7FA 5GADC 4AYBE 3CQZH 2ZJPA 1Q46A 2AMCB 4K0KQ 5IWAL 3PUYA 1YJNA 1KHIA 3GTPH 4DR3Q 3J80c 5IT9c 1B8AA 2JE6I 4JI5L 3UDIA 2AKWB 1FVIA 5FLMH 4GNXC 2HHHQ 4HIKA 2HT1A 1IBKL 4QL5A 3GTKH 3JAMi 4BY7G 2GVAA 1UWVA 4BA1I 1Q1EA 1L1OC 4A3KH 2NZOA 1TWGH 2N49A 5C44G 1HNXQ 4JI2Q 3BJUA 4OO1I 1KQSA 1GVPA 2ALYB 3EIVA 1HNWL 5IYCH 4H02A 1NMFA 3I4NG 2HQLA 3I2ZA 1Q7YC 4X6AH 1CKNA 1EWIA 4HIDA 3CD6A 2ZTCA 4YCWA 5ELOA 4B3TL 5C4JH 1VQBA 3A0JA 3TQYA 3KLWA 3GTQH 3U4VA 1W2BA 1Q1BA 1HH2P 3PUWA 4AIMA 3HKZE 4DV5Q 1XMOL 1VQ5A 2NVQH 2R7ZG 4IFDI 1LUZA 3K0XA 4P73A 4LF8L 3ICEA 1VS0A 5IYDG 4B3ML 4A3LG 2CWAA 1E7ZA 4JI3L 1J5EQ 2E2IH 2GVBA 5M5YH 4OX9L 4C2MH 4HIMA 1VQAA 2ZTEA 1L0WA 3TS0A 1PA6A 2VS1A 3BZCA 2MQHA 2B63H 1NY4A 4YWLA 4B3RQ 3ER0A 2JJQA 2WFWA 2Z0SA 1HZCA 3SGIA 1CKMA 4YY3Q 3HOZH 3CCQA 4DUYL 2CCZA 2ZM6Q 1RL2A 4JG2A 3E0EA 1GO3E 4BBSG 3K7UC 4UP7A 2OTLA 1N34Q 4BXXG 1X65A 2K75A 4APVA 1N8RC 3ZJYC 4NXNQ 5IP9H 3HFZB 2YTYA 3K7AH 1SMXA 2IT1A 1TWFH 1VQCA 4YWMA 1LM0A 4IFDJ 4A76A 1N33Q 1X3EA 2CWPA 1M90C 2A8VA 1C9OA 1Q8KA 1E1TA 4POFA 4HJ5A 1PH1A 3FHWA 3G48A 1DGSA 2OQKA 2Q2IA 4DR3L 2QA4A 3TEHB 2BA1A 5FLMG 1EOVA 4DV6Q 1VQOA 1EQRA 3U50C 1HZBA 3ULPA 3OTOL 1SFOH 4P72A 1WYDA 3Q8DA 4A3MH 4GKJQ 2H5XA 4X64L 2HHHL 4DR7Q 4JI8Q 4HJ8A 1KC8C 3HOYH 1QVGA 2R6GA 3RLFA 4HJAA 4A3KG 1IBKQ 1XTDA 4J15A 3DM3A 4UPAA 3KF8B 4A3FH 4YCUA 1CKNB 4GKKQ 3NENA 3S24A 5IYCG 1R9TH 1KD1C 1L2FA 3NEMA 1HNXL 2UUCQ 3EBEA 3E9IA 4JI2L 4A3IH 2KCMA 4GLXA 3KFUA 3GTMH 2DUDA 2UXDQ 1JMCA 1VQKA 4IOCA 3H3VH 1EIYB 2ASBA 3UE0A 3AYHB 4AYBG 4EQ5A 1NJIC 3K8AA 4JYAL 3TRZA 2ZJQA 1PH8A 1Y1WH 4B3SQ 3STBD 1KL9A 4A3EG 4DV5L 2IY5B 2N78A 1X3GA 4UP8A 3J81j 4NXMQ 5IYBH 2VW9A 4WJ3M 3L2PA 2AWNA 3HKSA 4OONA 4ME3A 3M7NA 3TREA 1IYJB 2B63G 1YZ6A 4OX9Q 4GS3A 1K83H 2UU9Q 2DGYA 3HOWH 3W5OA 2ZTDA 3OYYA 4B3RL 2FXQA 1SLJA 5H1SE 4O0AA 4LFAL 1CKOA 1GD7A 3HOZG 2C35B 4DR4Q 4IO9A 1PH9A 3RN5A 4YY3L 5IP7H 4R4CA 4LF4Q 1B70B 1YBYA 3W1GA 2ZM6L 1QZGA 3AFQA 2MNAA 2ID0A 1OXUA 3PSIA 4POGA 1N34L 5IP9G 4KI0A 4Y52H 3CF5A 1X54A 3STBC 3PF5A 4DK3C 2VZAA 1MJCA 3UDFA 3A5ZB 3PIOA 2WAQE 2NN6I 3E9HA 5HY6A 2EIFA 2E5LQ 1NE3A 3GO5A 3F8TA 3HKZG 1CSQA 5BR8Q 1N33L 3MXNB 4OWWB 4JC0A 4QGUA 3J7A5 3HOVH 4DV0Q 3S1MH 2ATWA 1JT8A 1QUQA 3S17H 3F1ZA 1XNQQ 2A1AA 4A3MG 3DLLA 3U58A 4DV6L 4LF7Q 1WI5A 2PI2A 3HOYG 3CW2C 3OTOQ 4KHZA 2ES2A 4DR7L 4GKJL 4JI8L 1A63A 4LF6Q 2JA7G 2N8NA 2I5HA 4X64Q 1X56A 4A3FG 2VQEQ 2D62A 4YHHQ 3S1NH 3ULJA 2F3IA 2WP8J 1RIPA 3PGZA 1VQDA 4A3IG 1ASZA 2ZJRA 4LW1A 4GKKL 2Y0SE 4LF5L 1I6HH 2UUCL 1YNXA 1P8LA 3J7ZC 1AE3A 2L15A 4DKAC 1HZ9A 5EAYA 5AJ3Q 4JBJA 1Q86C 2UXDL 2PQAB 1QVFA 5FJ8G 1EFWA 1Y1VH 1Y1WG 4LFCL 1S3OA 1XMQL 2Q2HA 1TWHH 5IYBG 4B3SL 4JYAQ 2BA0A 2I5MX 1PH2A 2NVTH 3GDEA 5C0XG 4LFBQ 4NXML 4PZ7A 3HOXG 2VY3A 4A3EH 4O2DA 1A0IA 1VQHA 3S2DH 1N36Q 4A3BH 4A3DH 1OXVA 3HOWG 3KDFB 2UU9L 4LF5Q 3I7FA 1J6QA 1WJJA 4A3GH 1YI2A 2I0QA 5IP7G 1VQ6A 5M3MH 2XGTA 4DR4L 1JJGA 1I5FA 4LFAQ 1U0LA 1V1QA 2RCNA 1X3FA 4RMFA 1IXRA 1PHJA 1PYSB 4DAMA 5GAGC 4LF4L 2UUBQ 1QZHA 2KHJA 3G71A 4DV1Q 2PNHA 1VQGA 3G4SA 1NMGA 3CCEA 4C3IH 4QJFA 3AEVA 3S15H 1FL0A 1Q82C 3PUVA 3CC7A 1JB7A 1JE5A 1QUQB 4PG3A 2E5LL 1WFQA 3J81c 5LMUQ 4DUZQ 1VQNA 4GN3B 3HOVG 4BY1H 4AH6A 5BR8L 5M3FH 3ERSX 3AQQA 1LTLA 1VQ4A 2NVXH 3RZDH 4DV0L 1M1KC 4BA2I 3UDGA 3H0GH 3S2HH 1XNQL 2F52A 2AWOA 4MNOA 4QQBX 4LF7L 4Y7NH 2AHOB 4GOPB 1BKBA 1PVOA 1VQ8A 4LF6L
chains in the Genus database with same CATH superfamily
2UUAQ 2A19A 3KLSX 4KHPQ 1B9MA 2WB1E 1H9RA 1HNZQ 1SE8A 2Z9HA 2QW7A 1KLGD 1PRTF 1H9SB 2JA7H 3S14H 5GAEC 5GQOA 4A4IA 1OTCA 2EQSA 1G51A 3X3NA 1VQLA 3PO2H 4BBRH 1HA5A 4BY7G 1YHAA 3GTLH 1EYAA 1ENAA 2IX1A 2FINB 4X66Q 4OO1G 1GOZA 4LFCQ 1HA6A 5JPMC 1LV9A 1STNA 4I65A 1ESRA 4IZ8A 1I50H 1ICWA 1PH6A 1N32L 4IN3A 3B6YA 4CKBA 2K5VA 1LT5D 1D1KA 4IFDG 4JI7L 3TBIB 1UEBA 1IKLA 2Y0SG 1SNDA 1BBWA 4RAUC 4KLKA 3U4ZA 4K8JA 2B2WA 4EQPA 2Q8TA 2PPBC 1TWCH 1UE6A 3CU7A 4UP9A 1O78A 3M9BA 3CMEA 5M3FG 1SYGA 5LMUL 5IT9L 2K5WA 1EQVA 2XTIA 1N9WA 1BBUA 5LMNW 2JA6H 1YIJA 3I4LA 2K33A 4DV2Q 4A3GB 4EVOA 1KIXA 2K04A 2NN6H 3I4OA 3P7JA 2UUAL 4KHPL 2KENA 5JEAH 2X69A 1HNZL 1NBWA 4YCVA 1AP0A 3A7LA 2EE1A 2VUMG 5K36H 2FFKB 1SRUA 4KKTA 4JI4Q 3S1RH 1P16A 3CAMA 5KNCA 1A8VA 2I5LX 3GV3A 3T56B 1YHQA 3S2HB 1W3SA 4X66L 3F2CA 5JPNC 5JEAJ 4AQYQ 4KKSA 3VYSA 5D3DA 2XWJB 1DOMA 2B2UA 3HG9A 1CT1D 1CZGA 4JI6Q 4G7ZC 1K8AC 4X3KA 2B2YC 5C3WA 5J3BA 5TSSA 4H44C 3TZUA 3PQIA 3NTIA 3SK8A 2F0OA 5JJLA 3MWYW 1RTNA 5EBCA 4UHVA 3CCSA 5C3EH 1IW7D 1ML0D 3MHBA 4ZKCB 3RNUA 1JOOA 4LJZC 3J7YW 2K28A 5IOCA 5ELCA 3SXHA 3T1YQ 4DAVA 2DY7A 1JORA 4NB3A 4C3HG 5FO9B 4B9XA 1TY2A 3K81C 4DV7Q 1EIFA 4DV2L 1VQ7A 4JBMA 2HCIA 2Z6KC 3WDNA 4LF9Q 2K6AA 3T13A 4A3JG 2PZUA 2QILA 3RUZA 3FKIG 1K73C 2JA5G 3PUZA 4IJHA 2KCNA 4HMJA 5I2YA 4JVZA 3FMCA 1NR4A 3CCJA 3QO2A 2F0IA 2YTXA 4L8JA 3CRLC 2JA8G 3OW2A 2R7DA 5ELEA 5IGGA 3M85A 2QEXA 4JI4L 1RODA 4ZLTF 1SNQA 2MFIA 3PO3H 1EQTA 1EZ6A 4AQYL 1KNAA 3DWAA 3I55A 3RLOA 2K5HA 3GTJB 3I91A 4XIGS 4JI6L 1MSHA 1E3PA 3H3VI 3I4MG 3KUPA 1PRTB 1HHVA 4DXGA 2LXKA 3NHHA 4DNIA 2KHSA 1HNWQ 3MEFA 1S5BD 1GKHA 2OT2A 5C44H 4PQXA 3HOUB 3RZOB 3GTPB 5C4XG 1JICA 2BH2A 3KOJA 4X3UA 4HEDA 5EGTA 2EY6A 3KBXA 3GV6A 4GN5A 5HURA 3GTGB 1CSPA 2CKZB 1XMOQ 1QOHA 2A73B 1NAPA 3T4AC 1DXMA 1MJEA 4XQQA 5EQ0A 1AEXA 1R4PB 3CCMA 1QCBD 1PMRA 5CV8A 4LF9L 1PXUA 5HGQA 1IL2A 1TS2A 1C8CA 2KJXA 2NTTA 5CV5A 1OXSC 4DUYQ 2K5NA 4HCSA 3GTJH 1VQIA 3DMUA 5C0XJ 1VQEA 1HCZA 5GROA 2O4XA 1G291 2EOTA 2LXJA 2XSCA 4BBSH 2AUKA 1X9NA 2ZT9C 3HEJA 1V1PA 2F0UA 4CJ2C 3PUYA 1YJNA 3GTPH 4J1MA 1EY4A 3J80c 4DU9A 1TR5A 2TMPA 1FVIA 2HHHQ 2NUCA 3NXWA 4KN7C 2K03A 1TIID 4UDUC 3NK9A 2GVAA 1UWVA 4BA1I 1SEBD 2F0FA 2NZOA 4JI2Q 2NYZD 3LWUA 3EIVA 1HNWL 1EY7A 3I4NG 2HQLA 3I2ZA 2PYKA 1Q7YC 1VQBA 3IFTA 1ICFB 3J81L 3KLWA 2IWHA 3S1QB 3R2IA 1KLUD 4A3MB 1XMOL 2RA4A 1LUZA 3K0XA 2DJGC 1E0BA 1KNEA 3ICEA 2RSNA 5IYDG 2CWAA 2BDNA 1VQAA 2ZTEA 1L0WA 4N9PA 3BZCA 2MQHA 5KNDA 4FF1A 1EU3A 1NY4A 3I3CA 3ER0A 1TKWB 2L9HA 4YY3Q 2PW5A 4DUYL 1O7LA 3CHBD 3JAME 1T5EA 1M4VA 2YTYA 4IUPA 2R7ZB 4LAAA 2RBMA 4YWMA 1SYFA 1LM0A 2K32A 3VR5A 2CWPA 5D65A 4POFA 2CH4A 3U9SA 3FHWA 4HJ5A 4ME5A 2OQKA 2Z4HA 3NTHA 2BA1A 5FLMG 5CBAE 5CR3A 4P72A 3Q8DA 3BDLA 4KN4C 5CV7A 4A3MH 2HHHL 4HJ8A 2I46A 5ELDA 4XYQA 2Z8LA 3RLFA 4A3KG 1IBKQ 1XTDA 2NVYB 4A3FH 3KF8B 4RKBA 2XRSD 4GKKQ 3NENA 2MHVA 5IYCG 1R9TH 4LF5Q 1L2FA 3NEMA 4JI2L 3EBEA 1QILA 4A3IH 1SBBB 2K05A 3GTMH 1F9SA 4MHEA 2UXDQ 1JMCA 1VQKA 2M00A 2XNAC 3NQIA 2A69C 5IGFA 2JSOA 1CZWA 1LACA 2ZJQA 2VB2X 1PH8A 1Y1WH 1SJHD 1QNKA 1I4HA 2N78A 3J81j 4NXMQ 1WTRA 4TRDA 4OONA 1PTOC 3M7NA 3TREA 2A6EC 4ABNA 1TT2A 1PRTD 4DF7A 2DGYA 3L3OC 3TP6A 4DR4Q 3A7AB 2F0MA 4YY3L 4CJ0B 1YNJD 4LF4Q 3W1GA 1TWHB 1OXUA 3PSIA 5IP9G 3CF5A 5BN3A 5EKIA 4JPBW 4WFN3 2F0PA 2RDGA 4JC0A 4IUQA 3S1MH 3DM1A 2B63B 2AQ3B 1XNQQ 3U58A 2PI2A 1SXTA 4KKUA 5LL6X 2CQAA 2Y0SB 1LO5D 1NR2A 2CW0D 2VQEQ 3OSOA 2R3ZA 3BDOA 4YHHQ 1QWYA 1WTHA 2ZJRA 4LW1A 4GKKL 1I6HH 4LF5L 2L1BA 3J7ZC 1TS5A 5M3FB 2MPMA 5EAYA 3N52A 2UXDL 5EBDA 3KF8A 2PQAB 1LTID 1U4RA 3HKZB 5FJ8G 4FF3A 1QVFA 1BO0A 2A6HD 1O80A 3GP7A 3BYTB 3R2TA 1TWHH 4JYAQ 4OO1H 5C0XG 4NXML 3HOYB 4O2DA 4OEMB 4B9WA 5I2XA 1OXVA 2WKDA 3KDFB 3SHLA 3MXGA 3EVQA 1BCPF 4IFDH 1VQ6A 4DR4L 3J7AF 1I5FA 4LFAQ 2RCNA 3H91A 3VR3A 1JOQA 1PYSB 3LNNA 5GAGC 4LF4L 5KRUA 3NE5B 2UUBQ 3G71A 1ESFA 2RDHA 4DXFA 1QUQB 4PG3A 2B2YA 1I4XA 4GN3B 1AZPA 5M3FH 2E74C 1IYUA 3AQQA 5HGTA 3RZDH 2XN9C 4OHJA 2EY2A 4XDXA 1XNQL 2F52A 5ELBA 4U673 2F0GA 1NNXA 4MIUA 4GOPB 4CKCA 2VQEL 4YHHL 2JN4A 5ELFA 1DJRD 1F2MA 1X55A 4C1NK 2EXDA 2VUMH 1SYEA 1YHBA 1K8OA 1PH4A 1IZ6A 4F8MA 5IGCA 3FRPB 3HOVB 2K14A 1XXGA 2WAQG 4QF4A 2Z6KA 5CYUA 3QR8A 4HJ7A 4DK6C 1IBLQ 2I07B 1FR3A 2HDLA 3D3RA 3KJOA 1EWHA 2PQAA 1GUTA 1EQQA 4A3BG 4A3DG 4DR6Q 4IPDA 1O7YA 1STEA 2OCEA 2JA5B 1S5CD 2G9HD 3S16H 3L0OA 2F0QA 3GTOB 2JA8B 5ISRA 4MTNA 5EPJA 1CK1A 4IPCA 3KDFA 1Y1VB 3D8GA 1ILPA 3HP3A 1X6OA 2UUBL 3L7ZC 3I56A 3EJIA 5CC4A 1B50A 2E2HB 2K7VA 4A75A 2EJFC 4R4IA 2E2JH 3ND8A 1Z47A 1TVXA 3J80L 1IL8A 1FGUA 5IODA 4PMBA 1C0AA 3OOCA 2MP1A 2X6GA 3A74A 5M9OA 4IOAA 2EPBA 1PZJD 4GN4B 4ZYSA 2OTJA 4C3HH 2MUYA 1ZXTA 5M3MB 1V43A 3UDXA 5DEHA 1DM0B 3HRZC 1KTKA 1YITA 1LTAD 5C4XB 2IPKD 4JBWA 3NBIA 4OGQC 4A3JH 1A6XA 2F0SA 4IPHA 5FO7B 2AQ1B 3FKIH 2JA5H 2D2CC 4JK1C 5IY0A 2Z1CA 4GOPA 1XJVA 1GJXA 3TZDA 4F7XA 1PFNA 3GTOH 3Q23A 2JA8H 5FKAC 2EZVA 2C5CA 3H0GB 2PZTA 3PV0A 3VR2A 4WJWA 4BWGB 1IBLL 4JW0A 3AFPA 3TN2A 1S4ZA 3M4QA 4CDFC 2E2HH 5BN4A 2MO0A 4DR6L 1N32Q 1U9RA 2K52A 3AU7A 4OXPA 4DPGA 3S14B 4HAEA 4P74A 3F2BA 1Q12A 1E1OA 2LY7A 2WB1G 3FEWX 2MGSA 3K6OA 2NZHA 5C3XA 4X65Q 3I4MH 3BZKA 4JI7Q 3PO2B 3SK4A 3GTLB 4UY8C 3RMHA 1OXTA 3J80i 3CCVA 1Q3LA 5C4XH 2RHQB 1I50B 2WACA 4IUNA 1B7YB 5E7NA 2IHEA 1BCPB 2L12A 1H95A 4OL7A 2UXCQ 2R92G 5DLQE 2R93B 3I70A 4NMZA 3M4YA 4JBKA 1Y8NB 2OEOA 1EY0A 3QG1A 1TWCB 2CQOA 2LKVA 2JQOA 1TS4A 2V1CC 4QIWB 1G2TA 3F2DA 3Q22A 1WTOA 1A62A 4Z9CB 4LWCA 4DAYA 3WWVA 3D6WA 3CXCA 2JA6B 4RHRA 3DXJC 3PIPA 3E6ZX 3MTSA 1VF7A 3ULLA 2PI2E 3KJPA 3URYA 2F0LA 4R4OA 3GD7A 5IGBA 1EIHA 1PZID 3OIQA 4JOIC 4IJLA 2HIVA 3BZDB 5E4WC 2BH8A 3DUZA 2JA9A 3W1BA 5BN5A 4X65L 3S1RB 5KIXA 1AN8A 3VDYA 3CPFA 2R93H 2DNEA 4O42A 3TSSA 2KHIA 3SDZA 1EYGA 4GLVB 2EYLA 4B3TQ 3I4NH 1PZKD 4F88A 5J22A 1X32A 2PW7A 4A3LG 1RJTA 5E3FA 3MFGA 4K5WA 1J5EL 3CC2A 2KA7A 4B3MQ 1EFID 5IYDH 2UXCL 4HR7B 4P2CB 4V190 1U5KA 1EEFD 3I90A 1UAPA 5KYIA 3ERQA 1K0RA 2D0PA 4K2KA 3KLRA 3GTQB 4K6LA 4JCVE 5C3EB 3QWNA 3RD4A 4A93G 3JAMc 3CC4A 4I7ZC 5FLXE 4NXNL 1GUOA 4L63B 2YV5A 5GADC 1Q46A 3EQLC 4X3SA 3MXUA 1B8AA 2JE6I 4L6TB 3UDIA 3L9AX 2AKWB 4C3JG 5FLMH 4GNXC 3PIO3 5C5LA 1EL0A 1ENCA 3V2TA 3R8BA 3GTKH 3I72A 3OHXC 1L1OC 4A3KH 1TWFB 3A55A 1YNNC 2EYMA 4EQOA 5IYCH 1WTVA 3PO3B 1BF4A 4DNRB 1CKNA 1EWIA 3CD6A 1U4LA 2ZTCA 3BVMA 5ELOA 4B3TL 3MA2B 4IUUA 3GTQH 3MXPA 1SFOB 2QCPX 1HH2P 3PUWA 3HKZE 4BS9A 2NVQH 3N6RA 1FD7D 4P73A 1VS0A 4B3ML 3QIAA 2E2IH 2PQEA 3TS0A 3TP5A 4YWLA 5C44B 4Q0FA 2EJMA 1MI2A 1DZ1A 3CCQA 2CCZA 2ZM6Q 3OMGA 3E0EA 3K7UC 1V1PB 4BXXG 2HCCA 1ZYRD 4KJOA 4APVA 3ZJYC 5IP9H 3HFZB 2A68D 1Y69U 2IT1A 1TWFH 1WD0A 2MJ8A 3DHQA 4FNFA 4A76A 1GXDC 2EDGA 1C9OA 2A69D 1E1TA 3SK6A 1PH1A 4TSSA 1D5XC 2Q2IA 1PFMA 1BCPD 2QEJC 4DV6Q 1VQOA 1HZBA 2F0WA 3ULPA 3OTOL 1SFOH 1WYDA 4GKJQ 1MBYA 4DR7Q 2LS01 2ICIA 4HJAA 4XXEA 3K5MA 1JB3A 4CBVA 4J15A 4BBSB 4YCUA 2F3WA 3A8JE 3QJYA 3C3LA 1TQOA 4OELB 2FMMA 3A54A 2KCMA 4GLXA 3SR1A 3EFXD 2DJFC 2RVLA 4KTAA 1MHWC 2E75C 3UE0A 3AYHB 3DWPA 5T1GA 4EQ5A 2L11A 1NJIC 3MZ5A 1CQFA 4A3EG 3NPPA 2K5DA 3Q6SA 1X3GA 4WJ3M 1I4GA 3HKSA 5C0XH 4ME3A 2E76C 1DCZA 1YZ6A 4GS3A 3PIP3 1LABA 2ZTDA 3FPUB 1CA5A 1SLJA 5H1SE 4ZUJA 5EKLA 3HOZG 1CKOA 1GD7A 3K5OA 4Q5VA 4R4CA 4UAIA 1DOKA 2ZM6L 3AFQA 2MNAA 2ID0A 1E2VA 1STGA 2NVTB 4NKLA 4AYBB 3PF5A 4DK3C 1D6EC 2NN6I 3S2DB 3E9HA 5HY6A 1B53A 3V05A 2R61A 3GO5A 2NTSA 4RGMA 4H7BA 4FYDA 1GUWA 4IUVA 2IX3A 3S17H 4IQZA 2A1AA 1QG7A 1UUPA 1SMYD 4RCNA 4DV6L 2EY1A 2EVBA 4GKJL 2ES2A 4DR7L 2JA7G 2D62A 4C3IB 3S1NH 3S15B 2WP8J 1RIPA 4NP5A 1AE3A 1W6KA 4DKAC 3IL8A 4QUFA 5D3IB 4QUCA 2B2VC 2J0TD 4NDXA 1S3OA 1XMQL 2PNRC 2Q2HA 5IYBG 2I5MX 5CV4A 2AQ2B 1LTSD 2NVTH 1ET6A 3HGBA 1KAAA 4XT1B 1VQHA 3S2DH 4A3FB 1N36Q 4A3BH 4A3DH 1SAPA 4N8FA 3HOWG 1R9TB 5EPKA 4A3IB 1J6QA 1WJJA 1YI2A 3GTMB 4ODGA 5IP7G 2XGTA 3PMFA 1V1QA 5CV9A 1D2BA 1E2WA 1QZHA 2H1EA 2KHJA 1SE4A 4DV1Q 2PNHA 1VQGA 3G4SA 1Y1WB 2WKCA 4C3IH 4QJFA 3AEVA 3S15H 1Q82C 1JB7A 3CC7A 1BXTA 3P75A 1WFQA 4DUZQ 3HOXB 1LT3D 3ERSX 3KBGA 1VQ4A 5M5WB 1F2LA 1WTWA 2L0CA 1F2YA 1A3TA 2B3GA 1E22A 3NELA 1IW7C 1KRTA 3T53B 4R4QA 3CCRA 1HUMA 1TXYA 2VL6A 3J81i 5JVH3 4QIWE 1RHPA 1S72A 1VQMA 1V9PA 3S1MB 4J8QA 1Q81C 1K8GA 4TVAB 1BBXC 4DR1Q 1VF5C 1SN8A 3E5SA 1Z6HA 3ONAB 3CPWA 1JJ2A 3H3VC 1D7QA 4LUOA 2HD3A 4N9TA 1KABA 1N36L 3HOXH 3OMCA 1I6HB 1SNCA 3CCLA 4A3GG 2DY8A 1HJPA 1FNVA 1PV4A 2RCFA 4GNXB 1XTCD 2P5ZX 3JAML 2YYZA 4I7AA 5M5WH 4ILWA 4U68A 5C0XI 1XNRQ 3A5UA 4BY7B 1NUCA 4DV1L 3C1FA 4HMIA 2LFNA 5C4HA 2A5HA 5A2QE 3EN2A 4WRDA 4K5XA 3M4OB 4DUZL 2B29A 1KRSA 1PH5A 1LLRD 4MN3A 2OF1A 1K3BC 5COYA 4ID6A 2B8FA 2UXBQ 2R92H 1G2SA 2F0NA 1TWAH 1L0YB 3AB9A 4R1JA 5LHY1 1FJGQ 4WJ4A 3C46A 1HR0Q 4IALA 2KEEA 1LTTD 2KBNA 1ONLA 2L55A 3RZDB 5IE8A 4X3TA 1AE2A 3BU2A 3BVZA 1Y14B 1RDPD 4JI0Q 3VA7A 2F0TA 1M8AA 4BY7H 4PZ8A 2D9UA 3ND9A 4DR1L 1Y8OB 5I4DA 1JOKA 3K5LA 4O1NA 2JK8A 3M4OH 2HIXA 4A93B 2VUMB 2RHSB 2GA4B 2D5DA 2RF4A 1DOLA 1X3QA 1PFSA 1GM5A 1KXLA 4EX5A 5ELNA 4YWKA 1WTPA 3UE1A 3D4RA 1XNRL 4KY6A 5FK9C 1PTOF 5J1ZA 3LGJA 1RCVD 4GNXA 3K57A 4RG1A 1MIUA 4DAPA 1VQFA 1L1OA 4ZUIA 1G8ZD 1QE6A 4RHSA 1WVLA 3S16B 1EU4A 3UI2A 3KF6A 1VMCA 2Q8RE 4E6IA 2CHBD 2UXBL 4PZ6A 1G6PA 2N3SA 1DD2A 1EUJA 1K28A 4X62Q 2XRQD 3D31A 2M9VA 1VQPA 4DV4L 3EA6A 1JJCB 4DR5L 1FJGL 2RSOA 1LT6D 3M4PA 1HR0L 3D0FA 4P71A 4A3CG 4A93H 5FLXc 1WCMG 2E2JB 1BDOA 2K01A 4CKEA 1JWSD 1O7IA 3TP7A 4K0KQ 3HOUG 1PH7A 1E24A 4EGVA 5IWAQ 4C3HB 3DEPA 2F0HA 2IHFA 3A8KE 5JJZA 4JI0L 3K59A 3SK5A 5KNBA 1HQMC 4JI5Q 2J7ZA 1RD9D 4A3JB 3CCUA 3GQBA 1F9PA 2EYHA 4C3JH 1HFNA 4XTCS 4PMWA 1NTGA 4QY7A 3FKIB 1LT4D 1IKMA 3HS0C 2IX0A 1XPOA 5EJWA 1RF2D 2BE5C 1B1ZA 3RN2A 3A8IE 3PCOB 3CQZB 4HCEA 4HSVA 1SE2A 4HN7A 4DK1A 1J8IA 4L5SA 4R4TA 3T16A 4DNTB 3EROA 3P1HA 4R9WA 3JC66 4LUVA 2Q2TA 1CM9A 1VQ9A 4LF8Q 5KYLA 5CMDA 1BQQT 3M3YH 3I4MB 1EYDA 1K3RA 1C7YA 2KCTA 4RWSC 3W3AA 2JEBI 4FDBA 4LNQA 1LTBD 2ICEC 5JJKA 4X62L 1HZAA 4OWTB 1G6ZA 2FJ2A 2JEAI 1UE1A 1XWEA 1T9HA 4DAYB 4MZ9A 1VQJA 1QNUA 3QB3A 1H9MA 2YU9H 3U9OA 2OXPA 1EY8A 3G6JB 2VNUD 4QB4A 4BXXH 4K0KL 5C6AA 5M5YB 1YVCA 2QDBA 4AYBE 3CQZH 1U4MA 2AMCB 5IWAL 3DWQA 1PRTC 1KHIA 2F0JA 4DR3Q 4RH6A 1JR0D 1S5DD 4JI5L 4ZK9B 3HOZB 2K1BA 1Y8PB 3FDTA 2HT1A 2Z4IA 1V1OA 4ZAIA 4ZQ3A 1L0XB 3K7AB 3Q0AA 2N49A 3BJUA 4OO1I 2ALYB 4B08A 1HXYD 1JWUD 1AZQA 4X6AH 5LL6S 3BG3A 4HIDA 4K6DA 5C4JH 1PLFA 3NP8A 3A0JA 3TQYA 5C4ZA 3U4VA 1Q1BA 4AIMA 4K8IA 4DV5Q 1VQ5A 2NBFA 2R7ZG 4IFDI 4R8NA 4LF8L 5G3LD 2G9DA 4PNYA 5L37A 1KDCA 5FOBB 1E7ZA 2PMZB 4K14A 1J5EQ 1HPCA 3SEBA 3VA5A 5M5YH 4OX9L 4C2MH 1EIGA 1PA6A 2O5IC 3VYRA 4B3RQ 1XYIA 2B2VA 4LF6L 2JJQA 2Z0SA 3SGIA 1CKMA 2EYJA 3I4NB 3HOZH 1PTOB 1RL2A 2A6HC 4JG2A 4UP7A 3OWFA 1X65A 1NCVA 4RGNA 1HQRD 4NXNQ 4GZYC 3K7AH 1SMXA 4H0LC 1JWMD 1X3EA 2SEBD 1M90C 2A8VA 3HOWB 2LMCB 2JXMB 4DK0A 1DGSA 5IT9E 4DR3L 1LTGD 2Q8IB 2QA4A 3TEHB 4IUTA 1EQRA 1C48A 2H5XA 3NUCA 5C5MA 4X64L 4M1UB 4JI8Q 1QVGA 2R6GA 5EKKA 2KEDA 1CKNB 3S24A 1VMPA 2DUDA 1MD2D 4RGOS 4NW2A 3SE0A 4IOCA 3H3VH 5I9OA 3M7GA 1EIYB 1PTOH 2KOLA 3TRZA 4DV5L 4UP8A 4H13C 5IYBH 2NB0A 2X6LA 3MEHA 3L2PA 2AWNA 2L4NA 3GTKB 2QF7A 4XT3B 2N88A 4A3KB 4RCOA 2B63G 1QJOA 2NZ1D 3S9WA 3HOWH 3W5OA 1A3UA 3OYYA 1WTQA 4OIJA 4B3RL 2FXQA 1TU2B 2Z6BA 2ENBA 4O0AA 1UEAB 4IO9A 1PH9A 1B4OA 5IP7H 1FYCA 1QZGA 4POGA 3R3OA 1D5ZC 4ULLA 5CGKA 2NVQB 1X54A 1RTOA 4KHVA 3STBC 1MJCA 3UDFA 2EIFA 3BYYB 1NE3A 4KMUC 2E2IB 3HKZG 5KEEA 4OWWB 4QGUA 3J7A5 1JT8A 3K58A 3WOEA 4R8IA 3F1ZA 5IIFA 4QCLA 1WI5A 1NSNS 3CRKC 3MFYA 3CW2C 4XQNA 3OTOQ 3HOYG 2O5JC 4JI8L 2JP1A 1A63A 2N8NA 2I5HA 1X56A 1SYCA 1JCKB 3ULJA 2F03A 4FO2A 2KQ3A 3P20A 1VQDA 2Y0SE 1P8LA 5DNFA 3T51B 1HZ9A 2VB3X 5AJ3Q 4JBJA 1H9SA 2NWGA 1O7ZA 1BR9A 1EFWA 1S5ED 4LFCL 1D5MC 4TKOB 5JVG3 1PH2A 1FNUA 4LFBQ 3GDEA 3H6MA 1I4PA 2VY3A 4FP5D 4XYOA 2PCFB 3I7FA 1X3PA 3D6CA 4A3GH 3FVQA 1X3FA 4RMFA 4N8X1 5FLXL 4ZCKA 2QDLA 2XWBB 3PUVA 1B3AA 1JE4A 1JE5A 1VQNA 3HOVG 4KD4A 4M8AA 1V8QA 1EY9A 1U4PA 1M1KC 3S2HH 2JYOA 2AWOA 3AMUA 5E1FA 2AHOB 5M5XB 3NTKA 2E8GA 1B44D 2TSSA 1PTOD 2CFMA 5AFWA 2A6ED 1D8LA 5IGEA 1HR0W 3LX0A 5FO8B 3NBHB 4JV5Q 5AJ3L 1Y1VG 1HRJA 2F0DA 2RKSA 2LSSA 3H15A 2VQFQ 3S17B 2F0EA 5FJ8H 3PUXA 1XMQQ 2CVRA 3X3MA 2F0VA 1GUSA 4LFBL 4EQNA 5CBEE 1K9MC 1G91A 1CHPD 3S1NB 1DYQA 2OQ0A 4L5QA 2BOSA 5M3MG 1WCMB 4JI1Q 2C9OA 4RFBA 2B2TC 3IKJA 4OWXB 1PH3A 1F9RA 1HTPA 2G5DA 1GHKA 1I4QA 1UNSA 1PDQA 2WAQB 3A56A 1YJ9A 2XVSA 1AH9A 5M5XH 2K50A 3BDCA 4L5RC 1BVSA 4KY7A 1EYCA 3T1YL 4RGTA 4BY1G 1B3QA 3J81E 2HUGA 2F4VQ 4GOPC 5GAHC 4A3DB 4A3BB 3T1HQ 1CQVA 2D0OA 3H0GG 2E2DC 4DV7L 1EZ8A 4G57A 1F2ZA 1CHQD 2DNCA 2IJ0A 1CFMA 1HFGA 3BVGA 4ZRZA 4HJ9A 2HDMA 1BOSA 5G3LF 1CUKA 4P75A 5NUCA 2M2LA 1WD1A 3PO2G 4BBRG 2K4KA 4A3CH 1IYVA 4JV5L 1WCMH 4DV3Q 2SNMA 3V96A 3K5NA 3HOUH 1SYDA 2BDOA 2VQFL 3RZOH 2KUMA 4V0BA 5EPLA 3NBHA 3TS2A 1STAA 1Z9FA 2XIWA 2WINB 3GTGH 3IAYA 3RR5A 1HUNA 4DR2Q 1OO9B 5JJIA 1I3QB 4DGZA 2O2LD 1UE7A 1MKHA 2Q2UA 1VDZA 2R93G 4JI1L 3RLNA 1JC7A 1GUNA 3Q24A 3CP0A 1H9JA 1IHZA 3OW7A 1ET9A 1XPUA 3TP8A 4HSPA 2K5QA 2RQXA 2EYOA 2F4VL 2QGQA 2N55A 3QOJA 4IPGA 2JA6G 1XPRA 1AFPA 2KVMA 3T1HL 1YJWA 5LMNQ 2PZWA 4XQJA 1I94Q 3KLSA 1PFBA 2A74C 2NN6G 3MVVA 2WB1B 5CORA 1T5XD 4NPSA 3PF4A 1BNZA 2PMZE 3LWEA 1H9KA 5JEAG 1SJED 4LUZA 2GN5A 4DFAA 1SROA 1IBMQ 5K36G 1A15A 3TMEA 1II3A 2BE5D 2MO1A 4RA8A 1I3QH 4K2LA 1SNMA 2CH4W 1VCIA 5F2DA 3ZYYX 1ILQA 4DV3L 3KYHC 3IRBA 1STBA 1YEZA 4CHTB 3NQTA 2FHTA 2IL8A 3VYTA 5DM73 3G6EA 3S1QH 4MTKA 2R92B 2B2WC 1EY6A 1Q8IA 1TWAB 4KD3A 3FP9A 4FXKC 3K80C 4DR2L 1W6JA 1LYLA 3OWEB 5CV6A 1ZYRC 4G7OC 4PMCA 2A68C 3H09A 3I73A 1EY5A 3G7LA 2KCCA 4ALPA 1I6VC 1WOCA 1LTRD 5KGUA 2DN8A 4QMGA 5C3EG 1ZKOA 4KJNA 5JOBA 1S40A 4TQUS 1BCPC 4LK1C 1A3VA 1L1OB 5DM63 3CMAA 1PYBA 1ASYA 1D1IA 4RKLA 1ENFA 4JOIA 3KF6B 4KY5A 2YTVA 3F2UA 4GLAC 5D14A 1FGBD 2ZXOA 3NSWA 2R7ZH 5E4XA 5LMNL 2OWOA 4JI3Q 4L5TA 1TWGB 2V4DA 1I94L 4A3LH 5J39A 5DAUA 2H4OA 3FPPA 2ZXPA 1KDBA 4HIOA 1CA6A 2J4XA 3C2PA 4LMQD 1IBML 1K0SA 4DV4Q 2B2UC 1OXXK 4DR5Q 1SDFA 1QVCA 2NVYH 5I9PA 2SOBA 1ZEQX 1KAWA 4FF2A 1SR3A 1CI3M 5A35A 3PO3G 5IGDA 1UE5A 2R7FA 2ZJPA 1TY0A 4G7HC 5IT9c 1F77A 1HTLD 2F4IA 1SE3A 1TS3A 4HIKA 2WIIB 4IURA 1IBKL 4QL5A 2L5TA 3JAMi 4YIJA 1KDAA 1Q1EA 1FNWA 4FXDA 2IW3A 1TWGH 5C44G 1HNXQ 4CDEC 1KQSA 1GVPA 3E3XA 4H02A 1NMFA 3QOLA 4YCWA 5A2QL 1EOTA 1GUGA 2EXZA 1SMYC 1W2BA 4FF4A 4C3JB 1R4QB 1BUVT 4FXGC 4JI3L 2GVBA 4HIMA 1SYBA 2AUJD 1A2UA 2VS1A 2B63H 2FMCA 3BS1A 2WFWA 1HZCA 3SVMA 1GHJA 1GO3E 4BBSG 3K0YA 2OTLA 1N34Q 2K75A 3CKIB 1S5FD 1N8RC 3VR6A 2SDFA 1VQCA 4IFDJ 3M3YB 1K83B 2HQEA 1N33Q 4WORA 1K8MA 1Q8KA 1QB5D 3W2DA 4CDDC 4KK7A 3G48A 3J80E 5I6WA 3OIPA 1EOVA 1F9QA 3U50C 3TDQA 5T1IA 1J9OA 1KC8C 1Z7TA 3HOYH 2YU9B 4UPAA 3DM3A 1STHA 4CGYB 1HNXL 1KD1C 2UUCQ 4FVMA 3E9IA 3NWSA 3OPOA 3KFUA 2B39A 1E2ZA 2EY5A 2ASBA 3IFDA 4AYBG 3K8AA 4JYAL 4B3SQ 3STBD 1KL9A 2IY5B 2VW9A 2PO4A 1A2TA 1EEID 1WTXA 3I8ZA 2F3VA 1IYJB 2F1MA 1B9NA 4OX9Q 2EJGC 3MC0B 1K83H 2F0KA 2UU9Q 4C1NI 4LFAL 2C35B 1I4RA 3RN5A 5C4JB 4C3IG 1B70B 1YBYA 4G4KA 1MSGA 1N34L 3DEOA 4KI0A 5I6YA 4Y52H 2VZAA 4A3EB 3A5ZB 3PIOA 2WAQE 2E5LQ 1YNND 2EYPA 4CJ1B 3VR4A 3F8TA 1CSQA 5BR8Q 4C2MB 1N33L 3KK7A 3MXNB 4J6HA 3HOVH 4DV0Q 2B2TA 2ATWA 1QUQA 3D4WA 4S3SA 4ZKBB 4A3MG 3DLLA 4DN4M 4LF7Q 3WOFA 1SNPA 4KHZA 4LF6Q 1YNJC 4X64Q 4A3FG 1SNOA 4PV1C 1EWCA 2F3IA 3PGZA 4A3IG 1ASZA 2ZXRA 2UUCL 1YNXA 3MAQA 1XX8A 3NWTA 4BY1B 2L15A 4HTHA 2EYFA 3J7AV 1Q86C 2NVXB 3D4DA 1C4QA 3HZXA 1JQYD 1Y1VH 1PYWD 1Y1WG 4Y7NB 1SSOA 4B3SL 2BA0A 1STYA 4PZ7A 3E0JA 3HOXG 4A3EH 2CW0C 1MGSA 1A0IA 3H94A 2JA7B 5JAVA 2SNSA 4CDCC 2B8GA 2UU9L 3C1EA 4BBRB 3ITPA 2I0QA 1JJGA 5M3MH 1RKNA 1DONA 1U0LA 3O13A 4DA2A 1IXRA 3R93A 1PHJA 4DAMA 1CTMA 5K5PA 4K5VA 3CCEA 1NMGA 4OIKA 3VYUA 2VXWA 1FL0A 2E5LL 3J81c 5LMUQ 4BY1H 4AH6A 5BR8L 1LTLA 2NVXH 4DV0L 4BA2I 2BCOA 2QKIC 3H0GH 3UDGA 4F87A 4MNOA 4C56C 4QQBX 4LF7L 2RDFA 1B2TA 4Y7NH 2KECA 4KV6A 3MXNA 1BKBA 1PVOA 1VQ8A 1Q90A 1AW7A 2WV6D
chains in the Genus database with same CATH topology
2B3GA 2UUAQ 2A19A 2VQEL 1E22A 2E8GA 2WB1E 3NELA 4YHHL 4KHPQ 1HNZQ 1SE8A 1KRTA 2CFMA 4R4QA 3CCRA 2JA7H 3S14H 5GAEC 5GQOA 1D8LA 4A4IA 1HR0W 1OTCA 1X55A 2EQSA 1TXYA 2EXDA 2VUMH 1G51A 2VL6A 3J81i 3NBHB 1YHBA 5AJ3L 1VQLA 4JV5Q 1PH4A 1Y1VG 4BBRH 4QIWE 3PO2H 1IZ6A 1S72A 2LSSA 1VQMA 1V9PA 1YHAA 2K14A 2WAQG 2Z6KA 3H15A 2VQFQ 3GTLH 2IX1A 4X66Q 1Q81C 4HJ7A 4DK6C 4TVAB 1K8GA 1IBLQ 4OO1G 4LFCQ 5FJ8H 3PUXA 1XMQQ 4DR1Q 4LFBL 3KJOA 2PQAA 1K9MC 1I50H 1SN8A 1EQQA 1PH6A 4A3BG 4A3DG 1N32L 4DR6Q 4IPDA 3CPWA 1JJ2A 3B6YA 1D7QA 4LUOA 2OCEA 1N36L 2OQ0A 3HOXH 3S16H 4L5QA 3CCLA 2K5VA 3L0OA 4A3GG 1HJPA 4IFDG 5M3MG 1PV4A 4JI7L 4JI1Q 4GNXB 4MTNA 2YYZA 4OWXB 1UEBA 2Y0SG 1PH3A 4IPCA 1BBWA 3KDFA 5M5WH 5C0XI 4KLKA 1XNRQ 3U4ZA 3A5UA 1AH9A 1X6OA 1YJ9A 2UUBL 3L7ZC 5M5XH 3I56A 1TWCH 4DV1L 1UE6A 2K50A 4L5RC 1BVSA 4A75A 4UP9A 4R4IA 3M9BA 3T1YL 4BY1G 3CMEA 2E2JH 5M3FG 1Z47A 2F4VQ 3EN2A 5LMUL 1FGUA 4DUZL 4GOPC 2B29A 1C0AA 1KRSA 5GAHC 3T1HQ 3H0GG 2XTIA 2D0OA 1BBUA 1N9WA 3A74A 5LMNW 4DV7L 1PH5A 2JA6H 4IOAA 1YIJA 4GN4B 2OTJA 4C3HH 4DV2Q 1V43A 3UDXA 2UXBQ 1KIXA 4HJ9A 2R92H 3I4OA 1YITA 2UUAL 4KHPL 4JBWA 1TWAH 2KENA 1CUKA 4A3JH 1HNZL 1NBWA 4IPHA 4P75A 4R1JA 4YCVA 1FJGQ 4WJ4A 3FKIH 2VUMG 2JA5H 1HR0Q 5IY0A 4GOPA 1XJVA 3PO2G 4BBRG 2K4KA 1SRUA 2KBNA 4JI4Q 3S1RH 4A3CH 1P16A 3CAMA 4JV5L 1WCMH 1A8VA 3GTOH 2I5LX 2JA8H 4DV3Q 1YHQA 3HOUH 3PV0A 2VQFL 3RZOH 5IE8A 1AE2A 1W3SA 4X66L 3BU2A 3F2CA 1Y14B 1IBLL 3AFPA 4JI0Q 5JEAJ 4BY7H 4AQYQ 3TS2A 4PZ8A 1Z9FA 3M4QA 4DR1L 2E2HH 3GTGH 3RR5A 2MO0A 4DR6L 1N32Q 4JI6Q 4DR2Q 1K8AC 2JK8A 2K52A 3M4OH 2HIXA 4OXPA 4DPGA 5JJIA 4P74A 3F2BA 1Q12A 1E1OA 1UE7A 1MKHA 2WB1G 3I4MH 2NZHA 4X65Q 2RHSB 2Q2UA 2R93G 3BZKA 4JI1L 4JI7Q 3RLNA 2RF4A 5J3BA 1PFSA 1GM5A 1KXLA 3CP0A 4EX5A 5JJLA 5ELNA 4YWKA 3UE1A 4UY8C 1XNRL 1OXTA 3CCSA 3LGJA 3J80i 3CCVA 5C3EH 1XPUA 5C4XH 4GNXA 2RHQB 3RNUA 4RG1A 1MIUA 1B7YB 2F4VL 3T1YQ 2QGQA 4IPGA 1VQFA 1XPRA 2JA6G 4NB3A 1L1OA 3T1HL 1YJWA 5E7NA 5LMNQ 2IHEA 3K81C 4DV7Q 3KF6A 1I94Q 1H95A 2NN6G 1EIFA 4DV2L 1VQ7A 4JBMA 2UXCQ 2R92G 2UXBL 5DLQE 4NPSA 2Z6KC 4PZ6A 2N3SA 4LF9Q 2PMZE 1EUJA 3PF4A 4X62Q 1G6PA 3D31A 1VQPA 5JEAG 4JBKA 4A3JG 4LUZA 2GN5A 4DV4L 1SROA 3FKIG 1IBMQ 5K36G 1K73C 2JA5G 1JJCB 4DR5L 3PUZA 1FJGL 2CQOA 4IJHA 2JQOA 2V1CC 3M4PA 3CCJA 3F2DA 1HR0L 3D0FA 4P71A 1A62A 4A93H 2YTXA 1WCMG 5FLXc 2MO1A 4A3CG 1I3QH 2JA8G 3OW2A 2R7DA 1O7IA 4LWCA 1VCIA 3M85A 2QEXA 3WWVA 1PH7A 4JI4L 3CXCA 1E24A 3HOUG 4DV3L 2MFIA 3IRBA 3KYHC 1YEZA 5IWAQ 3PO3H 3PIPA 2IHFA 4JI0L 3ULLA 4AQYL 3G6EA 2PI2E 3KJPA 3S1QH 4JI5Q 4R4OA 3I55A 3GD7A 2K5HA 3RLOA 3FP9A 3K80C 4XIGS 3CCUA 4JOIC 4JI6L 4IJLA 4C3JH 2HIVA 4XTCS 4DR2L 4PMWA 1NTGA 1E3PA 2BH8A 1LYLA 4QY7A 3H3VI 3I4MG 2JA9A 2LXKA 2IX0A 3W1BA 1XPOA 4DNIA 4X65L 3RN2A 3PCOB 4ALPA 1HNWQ 3MEFA 1WOCA 1GKHA 5C44H 3VDYA 3CPFA 2R93H 5C3EG 5C4XG 1S40A 2KHIA 2BH2A 3KOJA 4R4TA 4L5SA 1EYGA 4GLVB 4B3TQ 3I4NH 4TQUS 1L1OB 3CMAA 1PYBA 4GN5A 1ASYA 1CSPA 2CKZB 4JOIA 1XMOQ 3KF6B 2YTVA 3JC66 4GLAC 4LUVA 2Q2TA 1VQ9A 4LF8Q 1MJEA 1J5EL 3CC2A 2R7ZH 4B3MQ 5LMNL 2OWOA 4JI3Q 4L5TA 3M3YH 1I94L 3CCMA 4A3LH 5IYDH 1K3RA 1C7YA 2KCTA 4HIOA 2UXCL 2JEBI 4FDBA 4LNQA 1U5KA 5JJKA 4LF9L 4X62L 1HZAA 4OWTB 5HGQA 1IL2A 2JEAI 1K0RA 2D0PA 1UE1A 1OXSC 4JCVE 4DUYQ 1IBML 2K5NA 1T9HA 4DAYB 1OXXK 1VQIA 4MZ9A 1VQJA 5C0XJ 3GTJH 4DV4Q 1VQEA 3JAMc 4DR5Q 5GROA 3CC4A 2YU9H 4A93G 1G291 2LXJA 4NXNL 4BBSH 1QVCA 2NVYH 2VNUD 1X9NA 4BXXH 1KAWA 4K0KL 1SR3A 3PO3G 2YV5A 1YVCA 1UE5A 2R7FA 5GADC 4AYBE 3CQZH 2ZJPA 1Q46A 2AMCB 4K0KQ 5IWAL 3PUYA 1YJNA 1KHIA 3GTPH 4DR3Q 3J80c 5IT9c 1B8AA 2JE6I 4JI5L 3UDIA 2AKWB 1FVIA 5FLMH 4GNXC 2HHHQ 4HIKA 2HT1A 1IBKL 4QL5A 3GTKH 3JAMi 4BY7G 2GVAA 1UWVA 4BA1I 1Q1EA 1L1OC 4A3KH 2NZOA 1TWGH 2N49A 5C44G 1HNXQ 4JI2Q 3BJUA 4OO1I 1KQSA 1GVPA 2ALYB 3EIVA 1HNWL 5IYCH 4H02A 1NMFA 3I4NG 2HQLA 3I2ZA 1Q7YC 4X6AH 1CKNA 1EWIA 4HIDA 3CD6A 2ZTCA 4YCWA 5ELOA 4B3TL 5C4JH 1VQBA 3A0JA 3TQYA 3KLWA 3GTQH 3U4VA 1W2BA 1Q1BA 1HH2P 3PUWA 4AIMA 3HKZE 4DV5Q 1XMOL 1VQ5A 2NVQH 2R7ZG 4IFDI 1LUZA 3K0XA 4P73A 4LF8L 3ICEA 1VS0A 5IYDG 4B3ML 4A3LG 2CWAA 1E7ZA 4JI3L 1J5EQ 2E2IH 2GVBA 5M5YH 4OX9L 4C2MH 4HIMA 1VQAA 2ZTEA 1L0WA 3TS0A 1PA6A 2VS1A 3BZCA 2MQHA 2B63H 1NY4A 4YWLA 4B3RQ 3ER0A 2JJQA 2WFWA 2Z0SA 1HZCA 3SGIA 1CKMA 4YY3Q 3HOZH 3CCQA 4DUYL 2CCZA 2ZM6Q 1RL2A 4JG2A 3E0EA 1GO3E 4BBSG 3K7UC 4UP7A 2OTLA 1N34Q 4BXXG 1X65A 2K75A 4APVA 1N8RC 3ZJYC 4NXNQ 5IP9H 3HFZB 2YTYA 3K7AH 1SMXA 2IT1A 1TWFH 1VQCA 4YWMA 1LM0A 4IFDJ 4A76A 1N33Q 1X3EA 2CWPA 1M90C 2A8VA 1C9OA 1Q8KA 1E1TA 4POFA 4HJ5A 1PH1A 3FHWA 3G48A 1DGSA 2OQKA 2Q2IA 4DR3L 2QA4A 3TEHB 2BA1A 5FLMG 1EOVA 4DV6Q 1VQOA 1EQRA 3U50C 1HZBA 3ULPA 3OTOL 1SFOH 4P72A 1WYDA 3Q8DA 4A3MH 4GKJQ 2H5XA 4X64L 2HHHL 4DR7Q 4JI8Q 4HJ8A 1KC8C 3HOYH 1QVGA 2R6GA 3RLFA 4HJAA 4A3KG 1IBKQ 1XTDA 4J15A 3DM3A 4UPAA 3KF8B 4A3FH 4YCUA 1CKNB 4GKKQ 3NENA 3S24A 5IYCG 1R9TH 1KD1C 1L2FA 3NEMA 1HNXL 2UUCQ 3EBEA 3E9IA 4JI2L 4A3IH 2KCMA 4GLXA 3KFUA 3GTMH 2DUDA 2UXDQ 1JMCA 1VQKA 4IOCA 3H3VH 1EIYB 2ASBA 3UE0A 3AYHB 4AYBG 4EQ5A 1NJIC 3K8AA 4JYAL 3TRZA 2ZJQA 1PH8A 1Y1WH 4B3SQ 3STBD 1KL9A 4A3EG 4DV5L 2IY5B 2N78A 1X3GA 4UP8A 3J81j 4NXMQ 5IYBH 2VW9A 4WJ3M 3L2PA 2AWNA 3HKSA 4OONA 4ME3A 3M7NA 3TREA 1IYJB 2B63G 1YZ6A 4OX9Q 4GS3A 1K83H 2UU9Q 2DGYA 3HOWH 3W5OA 2ZTDA 3OYYA 4B3RL 2FXQA 1SLJA 5H1SE 4O0AA 4LFAL 1CKOA 1GD7A 3HOZG 2C35B 4DR4Q 4IO9A 1PH9A 3RN5A 4YY3L 5IP7H 4R4CA 4LF4Q 1B70B 1YBYA 3W1GA 2ZM6L 1QZGA 3AFQA 2MNAA 2ID0A 1OXUA 3PSIA 4POGA 1N34L 5IP9G 4KI0A 4Y52H 3CF5A 1X54A 3STBC 3PF5A 4DK3C 2VZAA 1MJCA 3UDFA 3A5ZB 3PIOA 2WAQE 2NN6I 3E9HA 5HY6A 2EIFA 2E5LQ 1NE3A 3GO5A 3F8TA 3HKZG 1CSQA 5BR8Q 1N33L 3MXNB 4OWWB 4JC0A 4QGUA 3J7A5 3HOVH 4DV0Q 3S1MH 2ATWA 1JT8A 1QUQA 3S17H 3F1ZA 1XNQQ 2A1AA 4A3MG 3DLLA 3U58A 4DV6L 4LF7Q 1WI5A 2PI2A 3HOYG 3CW2C 3OTOQ 4KHZA 2ES2A 4DR7L 4GKJL 4JI8L 1A63A 4LF6Q 2JA7G 2N8NA 2I5HA 4X64Q 1X56A 4A3FG 2VQEQ 2D62A 4YHHQ 3S1NH 3ULJA 2F3IA 2WP8J 1RIPA 3PGZA 1VQDA 4A3IG 1ASZA 2ZJRA 4LW1A 4GKKL 2Y0SE 4LF5L 1I6HH 2UUCL 1YNXA 1P8LA 3J7ZC 1AE3A 2L15A 4DKAC 1HZ9A 5EAYA 5AJ3Q 4JBJA 1Q86C 2UXDL 2PQAB 1QVFA 5FJ8G 1EFWA 1Y1VH 1Y1WG 4LFCL 1S3OA 1XMQL 2Q2HA 1TWHH 5IYBG 4B3SL 4JYAQ 2BA0A 2I5MX 1PH2A 2NVTH 3GDEA 5C0XG 4LFBQ 4NXML 4PZ7A 3HOXG 2VY3A 4A3EH 4O2DA 1A0IA 1VQHA 3S2DH 1N36Q 4A3BH 4A3DH 1OXVA 3HOWG 3KDFB 2UU9L 4LF5Q 3I7FA 1J6QA 1WJJA 4A3GH 1YI2A 2I0QA 5IP7G 1VQ6A 5M3MH 2XGTA 4DR4L 1JJGA 1I5FA 4LFAQ 1U0LA 1V1QA 2RCNA 1X3FA 4RMFA 1IXRA 1PHJA 1PYSB 4DAMA 5GAGC 4LF4L 2UUBQ 1QZHA 2KHJA 3G71A 4DV1Q 2PNHA 1VQGA 3G4SA 1NMGA 3CCEA 4C3IH 4QJFA 3AEVA 3S15H 1FL0A 1Q82C 3PUVA 3CC7A 1JB7A 1JE5A 1QUQB 4PG3A 2E5LL 1WFQA 3J81c 5LMUQ 4DUZQ 1VQNA 4GN3B 3HOVG 4BY1H 4AH6A 5BR8L 5M3FH 3ERSX 3AQQA 1LTLA 1VQ4A 2NVXH 3RZDH 4DV0L 1M1KC 4BA2I 3UDGA 3H0GH 3S2HH 1XNQL 2F52A 2AWOA 4MNOA 4QQBX 4LF7L 4Y7NH 2AHOB 4GOPB 1BKBA 1PVOA 1VQ8A 4LF6L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B3G A;  2UUA Q;  2A19 A;  2VQE L;  1E22 A;  2E8G A;  2WB1 E;  3NEL A;  4YHH L;  4KHP Q;  1HNZ Q;  1SE8 A;  1KRT A;  2CFM A;  4R4Q A;  3CCR A;  2JA7 H;  3S14 H;  5GAE C;  5GQO A;  1D8L A;  4A4I A;  1HR0 W;  1OTC A;  1X55 A;  2EQS A;  1TXY A;  2EXD A;  2VUM H;  1G51 A;  2VL6 A;  3J81 i;  3NBH B;  1YHB A;  5AJ3 L;  1VQL A;  4JV5 Q;  1PH4 A;  1Y1V G;  4BBR H;  4QIW E;  3PO2 H;  1IZ6 A;  1S72 A;  2LSS A;  1VQM A;  1V9P A;  1YHA A;  2K14 A;  2WAQ G;  2Z6K A;  3H15 A;  2VQF Q;  3GTL H;  2IX1 A;  4X66 Q;  1Q81 C;  4HJ7 A;  4DK6 C;  4TVA B;  1K8G A;  1IBL Q;  4OO1 G;  4LFC Q;  5FJ8 H;  3PUX A;  1XMQ Q;  4DR1 Q;  4LFB L;  3KJO A;  2PQA A;  1K9M C;  1I50 H;  1SN8 A;  1EQQ A;  1PH6 A;  4A3B G;  4A3D G;  1N32 L;  4DR6 Q;  4IPD A;  3CPW A;  1JJ2 A;  3B6Y A;  1D7Q A;  4LUO A;  2OCE A;  1N36 L;  2OQ0 A;  3HOX H;  3S16 H;  4L5Q A;  3CCL A;  2K5V A;  3L0O A;  4A3G G;  1HJP A;  4IFD G;  5M3M G;  1PV4 A;  4JI7 L;  4JI1 Q;  4GNX B;  4MTN A;  2YYZ A;  4OWX B;  1UEB A;  2Y0S G;  1PH3 A;  4IPC A;  1BBW A;  3KDF A;  5M5W H;  5C0X I;  4KLK A;  1XNR Q;  3U4Z A;  3A5U A;  1AH9 A;  1X6O A;  1YJ9 A;  2UUB L;  3L7Z C;  5M5X H;  3I56 A;  1TWC H;  4DV1 L;  1UE6 A;  2K50 A;  4L5R C;  1BVS A;  4A75 A;  4UP9 A;  4R4I A;  3M9B A;  3T1Y L;  4BY1 G;  3CME A;  2E2J H;  5M3F G;  1Z47 A;  2F4V Q;  3EN2 A;  5LMU L;  1FGU A;  4DUZ L;  4GOP C;  2B29 A;  1C0A A;  1KRS A;  5GAH C;  3T1H Q;  3H0G G;  2XTI A;  2D0O A;  1BBU A;  1N9W A;  3A74 A;  5LMN W;  4DV7 L;  1PH5 A;  2JA6 H;  4IOA A;  1YIJ A;  4GN4 B;  2OTJ A;  4C3H H;  4DV2 Q;  1V43 A;  3UDX A;  2UXB Q;  1KIX A;  4HJ9 A;  2R92 H;  3I4O A;  1YIT A;  2UUA L;  4KHP L;  4JBW A;  1TWA H;  2KEN A;  1CUK A;  4A3J H;  1HNZ L;  1NBW A;  4IPH A;  4P75 A;  4R1J A;  4YCV A;  1FJG Q;  4WJ4 A;  3FKI H;  2VUM G;  2JA5 H;  1HR0 Q;  5IY0 A;  4GOP A;  1XJV A;  3PO2 G;  4BBR G;  2K4K A;  1SRU A;  2KBN A;  4JI4 Q;  3S1R H;  4A3C H;  1P16 A;  3CAM A;  4JV5 L;  1WCM H;  1A8V A;  3GTO H;  2I5L X;  2JA8 H;  4DV3 Q;  1YHQ A;  3HOU H;  3PV0 A;  2VQF L;  3RZO H;  5IE8 A;  1AE2 A;  1W3S A;  4X66 L;  3BU2 A;  3F2C A;  1Y14 B;  1IBL L;  3AFP A;  4JI0 Q;  5JEA J;  4BY7 H;  4AQY Q;  3TS2 A;  4PZ8 A;  1Z9F A;  3M4Q A;  4DR1 L;  2E2H H;  3GTG H;  3RR5 A;  2MO0 A;  4DR6 L;  1N32 Q;  4JI6 Q;  4DR2 Q;  1K8A C;  2JK8 A;  2K52 A;  3M4O H;  2HIX A;  4OXP A;  4DPG A;  5JJI A;  4P74 A;  3F2B A;  1Q12 A;  1E1O A;  1UE7 A;  1MKH A;  2WB1 G;  3I4M H;  2NZH A;  4X65 Q;  2RHS B;  2Q2U A;  2R93 G;  3BZK A;  4JI1 L;  4JI7 Q;  3RLN A;  2RF4 A;  5J3B A;  1PFS A;  1GM5 A;  1KXL A;  3CP0 A;  4EX5 A;  5JJL A;  5ELN A;  4YWK A;  3UE1 A;  4UY8 C;  1XNR L;  1OXT A;  3CCS A;  3LGJ A;  3J80 i;  3CCV A;  5C3E H;  1XPU A;  5C4X H;  4GNX A;  2RHQ B;  3RNU A;  4RG1 A;  1MIU A;  1B7Y B;  2F4V L;  3T1Y Q;  2QGQ A;  4IPG A;  1VQF A;  1XPR A;  2JA6 G;  4NB3 A;  1L1O A;  3T1H L;  1YJW A;  5E7N A;  5LMN Q;  2IHE A;  3K81 C;  4DV7 Q;  3KF6 A;  1I94 Q;  1H95 A;  2NN6 G;  1EIF A;  4DV2 L;  1VQ7 A;  4JBM A;  2UXC Q;  2R92 G;  2UXB L;  5DLQ E;  4NPS A;  2Z6K C;  4PZ6 A;  2N3S A;  4LF9 Q;  2PMZ E;  1EUJ A;  3PF4 A;  4X62 Q;  1G6P A;  3D31 A;  1VQP A;  5JEA G;  4JBK A;  4A3J G;  4LUZ A;  2GN5 A;  4DV4 L;  1SRO A;  3FKI G;  1IBM Q;  5K36 G;  1K73 C;  2JA5 G;  1JJC B;  4DR5 L;  3PUZ A;  1FJG L;  2CQO A;  4IJH A;  2JQO A;  2V1C C;  3M4P A;  3CCJ A;  3F2D A;  1HR0 L;  3D0F A;  4P71 A;  1A62 A;  4A93 H;  2YTX A;  1WCM G;  5FLX c;  2MO1 A;  4A3C G;  1I3Q H;  2JA8 G;  3OW2 A;  2R7D A;  1O7I A;  4LWC A;  1VCI A;  3M85 A;  2QEX A;  3WWV A;  1PH7 A;  4JI4 L;  3CXC A;  1E24 A;  3HOU G;  4DV3 L;  2MFI A;  3IRB A;  3KYH C;  1YEZ A;  5IWA Q;  3PO3 H;  3PIP A;  2IHF A;  4JI0 L;  3ULL A;  4AQY L;  3G6E A;  2PI2 E;  3KJP A;  3S1Q H;  4JI5 Q;  4R4O A;  3I55 A;  3GD7 A;  2K5H A;  3RLO A;  3FP9 A;  3K80 C;  4XIG S;  3CCU A;  4JOI C;  4JI6 L;  4IJL A;  4C3J H;  2HIV A;  4XTC S;  4DR2 L;  4PMW A;  1NTG A;  1E3P A;  2BH8 A;  1LYL A;  4QY7 A;  3H3V I;  3I4M G;  2JA9 A;  2LXK A;  2IX0 A;  3W1B A;  1XPO A;  4DNI A;  4X65 L;  3RN2 A;  3PCO B;  4ALP A;  1HNW Q;  3MEF A;  1WOC A;  1GKH A;  5C44 H;  3VDY A;  3CPF A;  2R93 H;  5C3E G;  5C4X G;  1S40 A;  2KHI A;  2BH2 A;  3KOJ A;  4R4T A;  4L5S A;  1EYG A;  4GLV B;  4B3T Q;  3I4N H;  4TQU S;  1L1O B;  3CMA A;  1PYB A;  4GN5 A;  1ASY A;  1CSP A;  2CKZ B;  4JOI A;  1XMO Q;  3KF6 B;  2YTV A;  3JC6 6;  4GLA C;  4LUV A;  2Q2T A;  1VQ9 A;  4LF8 Q;  1MJE A;  1J5E L;  3CC2 A;  2R7Z H;  4B3M Q;  5LMN L;  2OWO A;  4JI3 Q;  4L5T A;  3M3Y H;  1I94 L;  3CCM A;  4A3L H;  5IYD H;  1K3R A;  1C7Y A;  2KCT A;  4HIO A;  2UXC L;  2JEB I;  4FDB A;  4LNQ A;  1U5K A;  5JJK A;  4LF9 L;  4X62 L;  1HZA A;  4OWT B;  5HGQ A;  1IL2 A;  2JEA I;  1K0R A;  2D0P A;  1UE1 A;  1OXS C;  4JCV E;  4DUY Q;  1IBM L;  2K5N A;  1T9H A;  4DAY B;  1OXX K;  1VQI A;  4MZ9 A;  1VQJ A;  5C0X J;  3GTJ H;  4DV4 Q;  1VQE A;  3JAM c;  4DR5 Q;  5GRO A;  3CC4 A;  2YU9 H;  4A93 G;  1G29 1;  2LXJ A;  4NXN L;  4BBS H;  1QVC A;  2NVY H;  2VNU D;  1X9N A;  4BXX H;  1KAW A;  4K0K L;  1SR3 A;  3PO3 G;  2YV5 A;  1YVC A;  1UE5 A;  2R7F A;  5GAD C;  4AYB E;  3CQZ H;  2ZJP A;  1Q46 A;  2AMC B;  4K0K Q;  5IWA L;  3PUY A;  1YJN A;  1KHI A;  3GTP H;  4DR3 Q;  3J80 c;  5IT9 c;  1B8A A;  2JE6 I;  4JI5 L;  3UDI A;  2AKW B;  1FVI A;  5FLM H;  4GNX C;  2HHH Q;  4HIK A;  2HT1 A;  1IBK L;  4QL5 A;  3GTK H;  3JAM i;  4BY7 G;  2GVA A;  1UWV A;  4BA1 I;  1Q1E A;  1L1O C;  4A3K H;  2NZO A;  1TWG H;  2N49 A;  5C44 G;  1HNX Q;  4JI2 Q;  3BJU A;  4OO1 I;  1KQS A;  1GVP A;  2ALY B;  3EIV A;  1HNW L;  5IYC H;  4H02 A;  1NMF A;  3I4N G;  2HQL A;  3I2Z A;  1Q7Y C;  4X6A H;  1CKN A;  1EWI A;  4HID A;  3CD6 A;  2ZTC A;  4YCW A;  5ELO A;  4B3T L;  5C4J H;  1VQB A;  3A0J A;  3TQY A;  3KLW A;  3GTQ H;  3U4V A;  1W2B A;  1Q1B A;  1HH2 P;  3PUW A;  4AIM A;  3HKZ E;  4DV5 Q;  1XMO L;  1VQ5 A;  2NVQ H;  2R7Z G;  4IFD I;  1LUZ A;  3K0X A;  4P73 A;  4LF8 L;  3ICE A;  1VS0 A;  5IYD G;  4B3M L;  4A3L G;  2CWA A;  1E7Z A;  4JI3 L;  1J5E Q;  2E2I H;  2GVB A;  5M5Y H;  4OX9 L;  4C2M H;  4HIM A;  1VQA A;  2ZTE A;  1L0W A;  3TS0 A;  1PA6 A;  2VS1 A;  3BZC A;  2MQH A;  2B63 H;  1NY4 A;  4YWL A;  4B3R Q;  3ER0 A;  2JJQ A;  2WFW A;  2Z0S A;  1HZC A;  3SGI A;  1CKM A;  4YY3 Q;  3HOZ H;  3CCQ A;  4DUY L;  2CCZ A;  2ZM6 Q;  1RL2 A;  4JG2 A;  3E0E A;  1GO3 E;  4BBS G;  3K7U C;  4UP7 A;  2OTL A;  1N34 Q;  4BXX G;  1X65 A;  2K75 A;  4APV A;  1N8R C;  3ZJY C;  4NXN Q;  5IP9 H;  3HFZ B;  2YTY A;  3K7A H;  1SMX A;  2IT1 A;  1TWF H;  1VQC A;  4YWM A;  1LM0 A;  4IFD J;  4A76 A;  1N33 Q;  1X3E A;  2CWP A;  1M90 C;  2A8V A;  1C9O A;  1Q8K A;  1E1T A;  4POF A;  4HJ5 A;  1PH1 A;  3FHW A;  3G48 A;  1DGS A;  2OQK A;  2Q2I A;  4DR3 L;  2QA4 A;  3TEH B;  2BA1 A;  5FLM G;  1EOV A;  4DV6 Q;  1VQO A;  1EQR A;  3U50 C;  1HZB A;  3ULP A;  3OTO L;  1SFO H;  4P72 A;  1WYD A;  3Q8D A;  4A3M H;  4GKJ Q;  2H5X A;  4X64 L;  2HHH L;  4DR7 Q;  4JI8 Q;  4HJ8 A;  1KC8 C;  3HOY H;  1QVG A;  2R6G A;  3RLF A;  4HJA A;  4A3K G;  1IBK Q;  1XTD A;  4J15 A;  3DM3 A;  4UPA A;  3KF8 B;  4A3F H;  4YCU A;  1CKN B;  4GKK Q;  3NEN A;  3S24 A;  5IYC G;  1R9T H;  1KD1 C;  1L2F A;  3NEM A;  1HNX L;  2UUC Q;  3EBE A;  3E9I A;  4JI2 L;  4A3I H;  2KCM A;  4GLX A;  3KFU A;  3GTM H;  2DUD A;  2UXD Q;  1JMC A;  1VQK A;  4IOC A;  3H3V H;  1EIY B;  2ASB A;  3UE0 A;  3AYH B;  4AYB G;  4EQ5 A;  1NJI C;  3K8A A;  4JYA L;  3TRZ A;  2ZJQ A;  1PH8 A;  1Y1W H;  4B3S Q;  3STB D;  1KL9 A;  4A3E G;  4DV5 L;  2IY5 B;  2N78 A;  1X3G A;  4UP8 A;  3J81 j;  4NXM Q;  5IYB H;  2VW9 A;  4WJ3 M;  3L2P A;  2AWN A;  3HKS A;  4OON A;  4ME3 A;  3M7N A;  3TRE A;  1IYJ B;  2B63 G;  1YZ6 A;  4OX9 Q;  4GS3 A;  1K83 H;  2UU9 Q;  2DGY A;  3HOW H;  3W5O A;  2ZTD A;  3OYY A;  4B3R L;  2FXQ A;  1SLJ A;  5H1S E;  4O0A A;  4LFA L;  1CKO A;  1GD7 A;  3HOZ G;  2C35 B;  4DR4 Q;  4IO9 A;  1PH9 A;  3RN5 A;  4YY3 L;  5IP7 H;  4R4C A;  4LF4 Q;  1B70 B;  1YBY A;  3W1G A;  2ZM6 L;  1QZG A;  3AFQ A;  2MNA A;  2ID0 A;  1OXU A;  3PSI A;  4POG A;  1N34 L;  5IP9 G;  4KI0 A;  4Y52 H;  3CF5 A;  1X54 A;  3STB C;  3PF5 A;  4DK3 C;  2VZA A;  1MJC A;  3UDF A;  3A5Z B;  3PIO A;  2WAQ E;  2NN6 I;  3E9H A;  5HY6 A;  2EIF A;  2E5L Q;  1NE3 A;  3GO5 A;  3F8T A;  3HKZ G;  1CSQ A;  5BR8 Q;  1N33 L;  3MXN B;  4OWW B;  4JC0 A;  4QGU A;  3J7A 5;  3HOV H;  4DV0 Q;  3S1M H;  2ATW A;  1JT8 A;  1QUQ A;  3S17 H;  3F1Z A;  1XNQ Q;  2A1A A;  4A3M G;  3DLL A;  3U58 A;  4DV6 L;  4LF7 Q;  1WI5 A;  2PI2 A;  3HOY G;  3CW2 C;  3OTO Q;  4KHZ A;  2ES2 A;  4DR7 L;  4GKJ L;  4JI8 L;  1A63 A;  4LF6 Q;  2JA7 G;  2N8N A;  2I5H A;  4X64 Q;  1X56 A;  4A3F G;  2VQE Q;  2D62 A;  4YHH Q;  3S1N H;  3ULJ A;  2F3I A;  2WP8 J;  1RIP A;  3PGZ A;  1VQD A;  4A3I G;  1ASZ A;  2ZJR A;  4LW1 A;  4GKK L;  2Y0S E;  4LF5 L;  1I6H H;  2UUC L;  1YNX A;  1P8L A;  3J7Z C;  1AE3 A;  2L15 A;  4DKA C;  1HZ9 A;  5EAY A;  5AJ3 Q;  4JBJ A;  1Q86 C;  2UXD L;  2PQA B;  1QVF A;  5FJ8 G;  1EFW A;  1Y1V H;  1Y1W G;  4LFC L;  1S3O A;  1XMQ L;  2Q2H A;  1TWH H;  5IYB G;  4B3S L;  4JYA Q;  2BA0 A;  2I5M X;  1PH2 A;  2NVT H;  3GDE A;  5C0X G;  4LFB Q;  4NXM L;  4PZ7 A;  3HOX G;  2VY3 A;  4A3E H;  4O2D A;  1A0I A;  1VQH A;  3S2D H;  1N36 Q;  4A3B H;  4A3D H;  1OXV A;  3HOW G;  3KDF B;  2UU9 L;  4LF5 Q;  3I7F A;  1J6Q A;  1WJJ A;  4A3G H;  1YI2 A;  2I0Q A;  5IP7 G;  1VQ6 A;  5M3M H;  2XGT A;  4DR4 L;  1JJG A;  1I5F A;  4LFA Q;  1U0L A;  1V1Q A;  2RCN A;  1X3F A;  4RMF A;  1IXR A;  1PHJ A;  1PYS B;  4DAM A;  5GAG C;  4LF4 L;  2UUB Q;  1QZH A;  2KHJ A;  3G71 A;  4DV1 Q;  2PNH A;  1VQG A;  3G4S A;  1NMG A;  3CCE A;  4C3I H;  4QJF A;  3AEV A;  3S15 H;  1FL0 A;  1Q82 C;  3PUV A;  3CC7 A;  1JB7 A;  1JE5 A;  1QUQ B;  4PG3 A;  2E5L L;  1WFQ A;  3J81 c;  5LMU Q;  4DUZ Q;  1VQN A;  4GN3 B;  3HOV G;  4BY1 H;  4AH6 A;  5BR8 L;  5M3F H;  3ERS X;  3AQQ A;  1LTL A;  1VQ4 A;  2NVX H;  3RZD H;  4DV0 L;  1M1K C;  4BA2 I;  3UDG A;  3H0G H;  3S2H H;  1XNQ L;  2F52 A;  2AWO A;  4MNO A;  4QQB X;  4LF7 L;  4Y7N H;  2AHO B;  4GOP B;  1BKB A;  1PVO A;  1VQ8 A;  4LF6 L; 
#chains in the Genus database with same CATH topology
 2UUA Q;  2A19 A;  3KLS X;  4KHP Q;  1B9M A;  2WB1 E;  1H9R A;  1HNZ Q;  1SE8 A;  2Z9H A;  2QW7 A;  1KLG D;  1PRT F;  1H9S B;  2JA7 H;  3S14 H;  5GAE C;  5GQO A;  4A4I A;  1OTC A;  2EQS A;  1G51 A;  3X3N A;  1VQL A;  3PO2 H;  4BBR H;  1HA5 A;  4BY7 G;  1YHA A;  3GTL H;  1EYA A;  1ENA A;  2IX1 A;  2FIN B;  4X66 Q;  4OO1 G;  1GOZ A;  4LFC Q;  1HA6 A;  5JPM C;  1LV9 A;  1STN A;  4I65 A;  1ESR A;  4IZ8 A;  1I50 H;  1ICW A;  1PH6 A;  1N32 L;  4IN3 A;  3B6Y A;  4CKB A;  2K5V A;  1LT5 D;  1D1K A;  4IFD G;  4JI7 L;  3TBI B;  1UEB A;  1IKL A;  2Y0S G;  1SND A;  1BBW A;  4RAU C;  4KLK A;  3U4Z A;  4K8J A;  2B2W A;  4EQP A;  2Q8T A;  2PPB C;  1TWC H;  1UE6 A;  3CU7 A;  4UP9 A;  1O78 A;  3M9B A;  3CME A;  5M3F G;  1SYG A;  5LMU L;  5IT9 L;  2K5W A;  1EQV A;  2XTI A;  1N9W A;  1BBU A;  5LMN W;  2JA6 H;  1YIJ A;  3I4L A;  2K33 A;  4DV2 Q;  4A3G B;  4EVO A;  1KIX A;  2K04 A;  2NN6 H;  3I4O A;  3P7J A;  2UUA L;  4KHP L;  2KEN A;  5JEA H;  2X69 A;  1HNZ L;  1NBW A;  4YCV A;  1AP0 A;  3A7L A;  2EE1 A;  2VUM G;  5K36 H;  2FFK B;  1SRU A;  4KKT A;  4JI4 Q;  3S1R H;  1P16 A;  3CAM A;  5KNC A;  1A8V A;  2I5L X;  3GV3 A;  3T56 B;  1YHQ A;  3S2H B;  1W3S A;  4X66 L;  3F2C A;  5JPN C;  5JEA J;  4AQY Q;  4KKS A;  3VYS A;  5D3D A;  2XWJ B;  1DOM A;  2B2U A;  3HG9 A;  1CT1 D;  1CZG A;  4JI6 Q;  4G7Z C;  1K8A C;  4X3K A;  2B2Y C;  5C3W A;  5J3B A;  5TSS A;  4H44 C;  3TZU A;  3PQI A;  3NTI A;  3SK8 A;  2F0O A;  5JJL A;  3MWY W;  1RTN A;  5EBC A;  4UHV A;  3CCS A;  5C3E H;  1IW7 D;  1ML0 D;  3MHB A;  4ZKC B;  3RNU A;  1JOO A;  4LJZ C;  3J7Y W;  2K28 A;  5IOC A;  5ELC A;  3SXH A;  3T1Y Q;  4DAV A;  2DY7 A;  1JOR A;  4NB3 A;  4C3H G;  5FO9 B;  4B9X A;  1TY2 A;  3K81 C;  4DV7 Q;  1EIF A;  4DV2 L;  1VQ7 A;  4JBM A;  2HCI A;  2Z6K C;  3WDN A;  4LF9 Q;  2K6A A;  3T13 A;  4A3J G;  2PZU A;  2QIL A;  3RUZ A;  3FKI G;  1K73 C;  2JA5 G;  3PUZ A;  4IJH A;  2KCN A;  4HMJ A;  5I2Y A;  4JVZ A;  3FMC A;  1NR4 A;  3CCJ A;  3QO2 A;  2F0I A;  2YTX A;  4L8J A;  3CRL C;  2JA8 G;  3OW2 A;  2R7D A;  5ELE A;  5IGG A;  3M85 A;  2QEX A;  4JI4 L;  1ROD A;  4ZLT F;  1SNQ A;  2MFI A;  3PO3 H;  1EQT A;  1EZ6 A;  4AQY L;  1KNA A;  3DWA A;  3I55 A;  3RLO A;  2K5H A;  3GTJ B;  3I91 A;  4XIG S;  4JI6 L;  1MSH A;  1E3P A;  3H3V I;  3I4M G;  3KUP A;  1PRT B;  1HHV A;  4DXG A;  2LXK A;  3NHH A;  4DNI A;  2KHS A;  1HNW Q;  3MEF A;  1S5B D;  1GKH A;  2OT2 A;  5C44 H;  4PQX A;  3HOU B;  3RZO B;  3GTP B;  5C4X G;  1JIC A;  2BH2 A;  3KOJ A;  4X3U A;  4HED A;  5EGT A;  2EY6 A;  3KBX A;  3GV6 A;  4GN5 A;  5HUR A;  3GTG B;  1CSP A;  2CKZ B;  1XMO Q;  1QOH A;  2A73 B;  1NAP A;  3T4A C;  1DXM A;  1MJE A;  4XQQ A;  5EQ0 A;  1AEX A;  1R4P B;  3CCM A;  1QCB D;  1PMR A;  5CV8 A;  4LF9 L;  1PXU A;  5HGQ A;  1IL2 A;  1TS2 A;  1C8C A;  2KJX A;  2NTT A;  5CV5 A;  1OXS C;  4DUY Q;  2K5N A;  4HCS A;  3GTJ H;  1VQI A;  3DMU A;  5C0X J;  1VQE A;  1HCZ A;  5GRO A;  2O4X A;  1G29 1;  2EOT A;  2LXJ A;  2XSC A;  4BBS H;  2AUK A;  1X9N A;  2ZT9 C;  3HEJ A;  1V1P A;  2F0U A;  4CJ2 C;  3PUY A;  1YJN A;  3GTP H;  4J1M A;  1EY4 A;  3J80 c;  4DU9 A;  1TR5 A;  2TMP A;  1FVI A;  2HHH Q;  2NUC A;  3NXW A;  4KN7 C;  2K03 A;  1TII D;  4UDU C;  3NK9 A;  2GVA A;  1UWV A;  4BA1 I;  1SEB D;  2F0F A;  2NZO A;  4JI2 Q;  2NYZ D;  3LWU A;  3EIV A;  1HNW L;  1EY7 A;  3I4N G;  2HQL A;  3I2Z A;  2PYK A;  1Q7Y C;  1VQB A;  3IFT A;  1ICF B;  3J81 L;  3KLW A;  2IWH A;  3S1Q B;  3R2I A;  1KLU D;  4A3M B;  1XMO L;  2RA4 A;  1LUZ A;  3K0X A;  2DJG C;  1E0B A;  1KNE A;  3ICE A;  2RSN A;  5IYD G;  2CWA A;  2BDN A;  1VQA A;  2ZTE A;  1L0W A;  4N9P A;  3BZC A;  2MQH A;  5KND A;  4FF1 A;  1EU3 A;  1NY4 A;  3I3C A;  3ER0 A;  1TKW B;  2L9H A;  4YY3 Q;  2PW5 A;  4DUY L;  1O7L A;  3CHB D;  3JAM E;  1T5E A;  1M4V A;  2YTY A;  4IUP A;  2R7Z B;  4LAA A;  2RBM A;  4YWM A;  1SYF A;  1LM0 A;  2K32 A;  3VR5 A;  2CWP A;  5D65 A;  4POF A;  2CH4 A;  3U9S A;  3FHW A;  4HJ5 A;  4ME5 A;  2OQK A;  2Z4H A;  3NTH A;  2BA1 A;  5FLM G;  5CBA E;  5CR3 A;  4P72 A;  3Q8D A;  3BDL A;  4KN4 C;  5CV7 A;  4A3M H;  2HHH L;  4HJ8 A;  2I46 A;  5ELD A;  4XYQ A;  2Z8L A;  3RLF A;  4A3K G;  1IBK Q;  1XTD A;  2NVY B;  4A3F H;  3KF8 B;  4RKB A;  2XRS D;  4GKK Q;  3NEN A;  2MHV A;  5IYC G;  1R9T H;  4LF5 Q;  1L2F A;  3NEM A;  4JI2 L;  3EBE A;  1QIL A;  4A3I H;  1SBB B;  2K05 A;  3GTM H;  1F9S A;  4MHE A;  2UXD Q;  1JMC A;  1VQK A;  2M00 A;  2XNA C;  3NQI A;  2A69 C;  5IGF A;  2JSO A;  1CZW A;  1LAC A;  2ZJQ A;  2VB2 X;  1PH8 A;  1Y1W H;  1SJH D;  1QNK A;  1I4H A;  2N78 A;  3J81 j;  4NXM Q;  1WTR A;  4TRD A;  4OON A;  1PTO C;  3M7N A;  3TRE A;  2A6E C;  4ABN A;  1TT2 A;  1PRT D;  4DF7 A;  2DGY A;  3L3O C;  3TP6 A;  4DR4 Q;  3A7A B;  2F0M A;  4YY3 L;  4CJ0 B;  1YNJ D;  4LF4 Q;  3W1G A;  1TWH B;  1OXU A;  3PSI A;  5IP9 G;  3CF5 A;  5BN3 A;  5EKI A;  4JPB W;  4WFN 3;  2F0P A;  2RDG A;  4JC0 A;  4IUQ A;  3S1M H;  3DM1 A;  2B63 B;  2AQ3 B;  1XNQ Q;  3U58 A;  2PI2 A;  1SXT A;  4KKU A;  5LL6 X;  2CQA A;  2Y0S B;  1LO5 D;  1NR2 A;  2CW0 D;  2VQE Q;  3OSO A;  2R3Z A;  3BDO A;  4YHH Q;  1QWY A;  1WTH A;  2ZJR A;  4LW1 A;  4GKK L;  1I6H H;  4LF5 L;  2L1B A;  3J7Z C;  1TS5 A;  5M3F B;  2MPM A;  5EAY A;  3N52 A;  2UXD L;  5EBD A;  3KF8 A;  2PQA B;  1LTI D;  1U4R A;  3HKZ B;  5FJ8 G;  4FF3 A;  1QVF A;  1BO0 A;  2A6H D;  1O80 A;  3GP7 A;  3BYT B;  3R2T A;  1TWH H;  4JYA Q;  4OO1 H;  5C0X G;  4NXM L;  3HOY B;  4O2D A;  4OEM B;  4B9W A;  5I2X A;  1OXV A;  2WKD A;  3KDF B;  3SHL A;  3MXG A;  3EVQ A;  1BCP F;  4IFD H;  1VQ6 A;  4DR4 L;  3J7A F;  1I5F A;  4LFA Q;  2RCN A;  3H91 A;  3VR3 A;  1JOQ A;  1PYS B;  3LNN A;  5GAG C;  4LF4 L;  5KRU A;  3NE5 B;  2UUB Q;  3G71 A;  1ESF A;  2RDH A;  4DXF A;  1QUQ B;  4PG3 A;  2B2Y A;  1I4X A;  4GN3 B;  1AZP A;  5M3F H;  2E74 C;  1IYU A;  3AQQ A;  5HGT A;  3RZD H;  2XN9 C;  4OHJ A;  2EY2 A;  4XDX A;  1XNQ L;  2F52 A;  5ELB A;  4U67 3;  2F0G A;  1NNX A;  4MIU A;  4GOP B;  4CKC A;  2VQE L;  4YHH L;  2JN4 A;  5ELF A;  1DJR D;  1F2M A;  1X55 A;  4C1N K;  2EXD A;  2VUM H;  1SYE A;  1YHB A;  1K8O A;  1PH4 A;  1IZ6 A;  4F8M A;  5IGC A;  3FRP B;  3HOV B;  2K14 A;  1XXG A;  2WAQ G;  4QF4 A;  2Z6K A;  5CYU A;  3QR8 A;  4HJ7 A;  4DK6 C;  1IBL Q;  2I07 B;  1FR3 A;  2HDL A;  3D3R A;  3KJO A;  1EWH A;  2PQA A;  1GUT A;  1EQQ A;  4A3B G;  4A3D G;  4DR6 Q;  4IPD A;  1O7Y A;  1STE A;  2OCE A;  2JA5 B;  1S5C D;  2G9H D;  3S16 H;  3L0O A;  2F0Q A;  3GTO B;  2JA8 B;  5ISR A;  4MTN A;  5EPJ A;  1CK1 A;  4IPC A;  3KDF A;  1Y1V B;  3D8G A;  1ILP A;  3HP3 A;  1X6O A;  2UUB L;  3L7Z C;  3I56 A;  3EJI A;  5CC4 A;  1B50 A;  2E2H B;  2K7V A;  4A75 A;  2EJF C;  4R4I A;  2E2J H;  3ND8 A;  1Z47 A;  1TVX A;  3J80 L;  1IL8 A;  1FGU A;  5IOD A;  4PMB A;  1C0A A;  3OOC A;  2MP1 A;  2X6G A;  3A74 A;  5M9O A;  4IOA A;  2EPB A;  1PZJ D;  4GN4 B;  4ZYS A;  2OTJ A;  4C3H H;  2MUY A;  1ZXT A;  5M3M B;  1V43 A;  3UDX A;  5DEH A;  1DM0 B;  3HRZ C;  1KTK A;  1YIT A;  1LTA D;  5C4X B;  2IPK D;  4JBW A;  3NBI A;  4OGQ C;  4A3J H;  1A6X A;  2F0S A;  4IPH A;  5FO7 B;  2AQ1 B;  3FKI H;  2JA5 H;  2D2C C;  4JK1 C;  5IY0 A;  2Z1C A;  4GOP A;  1XJV A;  1GJX A;  3TZD A;  4F7X A;  1PFN A;  3GTO H;  3Q23 A;  2JA8 H;  5FKA C;  2EZV A;  2C5C A;  3H0G B;  2PZT A;  3PV0 A;  3VR2 A;  4WJW A;  4BWG B;  1IBL L;  4JW0 A;  3AFP A;  3TN2 A;  1S4Z A;  3M4Q A;  4CDF C;  2E2H H;  5BN4 A;  2MO0 A;  4DR6 L;  1N32 Q;  1U9R A;  2K52 A;  3AU7 A;  4OXP A;  4DPG A;  3S14 B;  4HAE A;  4P74 A;  3F2B A;  1Q12 A;  1E1O A;  2LY7 A;  2WB1 G;  3FEW X;  2MGS A;  3K6O A;  2NZH A;  5C3X A;  4X65 Q;  3I4M H;  3BZK A;  4JI7 Q;  3PO2 B;  3SK4 A;  3GTL B;  4UY8 C;  3RMH A;  1OXT A;  3J80 i;  3CCV A;  1Q3L A;  5C4X H;  2RHQ B;  1I50 B;  2WAC A;  4IUN A;  1B7Y B;  5E7N A;  2IHE A;  1BCP B;  2L12 A;  1H95 A;  4OL7 A;  2UXC Q;  2R92 G;  5DLQ E;  2R93 B;  3I70 A;  4NMZ A;  3M4Y A;  4JBK A;  1Y8N B;  2OEO A;  1EY0 A;  3QG1 A;  1TWC B;  2CQO A;  2LKV A;  2JQO A;  1TS4 A;  2V1C C;  4QIW B;  1G2T A;  3F2D A;  3Q22 A;  1WTO A;  1A62 A;  4Z9C B;  4LWC A;  4DAY A;  3WWV A;  3D6W A;  3CXC A;  2JA6 B;  4RHR A;  3DXJ C;  3PIP A;  3E6Z X;  3MTS A;  1VF7 A;  3ULL A;  2PI2 E;  3KJP A;  3URY A;  2F0L A;  4R4O A;  3GD7 A;  5IGB A;  1EIH A;  1PZI D;  3OIQ A;  4JOI C;  4IJL A;  2HIV A;  3BZD B;  5E4W C;  2BH8 A;  3DUZ A;  2JA9 A;  3W1B A;  5BN5 A;  4X65 L;  3S1R B;  5KIX A;  1AN8 A;  3VDY A;  3CPF A;  2R93 H;  2DNE A;  4O42 A;  3TSS A;  2KHI A;  3SDZ A;  1EYG A;  4GLV B;  2EYL A;  4B3T Q;  3I4N H;  1PZK D;  4F88 A;  5J22 A;  1X32 A;  2PW7 A;  4A3L G;  1RJT A;  5E3F A;  3MFG A;  4K5W A;  1J5E L;  3CC2 A;  2KA7 A;  4B3M Q;  1EFI D;  5IYD H;  2UXC L;  4HR7 B;  4P2C B;  4V19 0;  1U5K A;  1EEF D;  3I90 A;  1UAP A;  5KYI A;  3ERQ A;  1K0R A;  2D0P A;  4K2K A;  3KLR A;  3GTQ B;  4K6L A;  4JCV E;  5C3E B;  3QWN A;  3RD4 A;  4A93 G;  3JAM c;  3CC4 A;  4I7Z C;  5FLX E;  4NXN L;  1GUO A;  4L63 B;  2YV5 A;  5GAD C;  1Q46 A;  3EQL C;  4X3S A;  3MXU A;  1B8A A;  2JE6 I;  4L6T B;  3UDI A;  3L9A X;  2AKW B;  4C3J G;  5FLM H;  4GNX C;  3PIO 3;  5C5L A;  1EL0 A;  1ENC A;  3V2T A;  3R8B A;  3GTK H;  3I72 A;  3OHX C;  1L1O C;  4A3K H;  1TWF B;  3A55 A;  1YNN C;  2EYM A;  4EQO A;  5IYC H;  1WTV A;  3PO3 B;  1BF4 A;  4DNR B;  1CKN A;  1EWI A;  3CD6 A;  1U4L A;  2ZTC A;  3BVM A;  5ELO A;  4B3T L;  3MA2 B;  4IUU A;  3GTQ H;  3MXP A;  1SFO B;  2QCP X;  1HH2 P;  3PUW A;  3HKZ E;  4BS9 A;  2NVQ H;  3N6R A;  1FD7 D;  4P73 A;  1VS0 A;  4B3M L;  3QIA A;  2E2I H;  2PQE A;  3TS0 A;  3TP5 A;  4YWL A;  5C44 B;  4Q0F A;  2EJM A;  1MI2 A;  1DZ1 A;  3CCQ A;  2CCZ A;  2ZM6 Q;  3OMG A;  3E0E A;  3K7U C;  1V1P B;  4BXX G;  2HCC A;  1ZYR D;  4KJO A;  4APV A;  3ZJY C;  5IP9 H;  3HFZ B;  2A68 D;  1Y69 U;  2IT1 A;  1TWF H;  1WD0 A;  2MJ8 A;  3DHQ A;  4FNF A;  4A76 A;  1GXD C;  2EDG A;  1C9O A;  2A69 D;  1E1T A;  3SK6 A;  1PH1 A;  4TSS A;  1D5X C;  2Q2I A;  1PFM A;  1BCP D;  2QEJ C;  4DV6 Q;  1VQO A;  1HZB A;  2F0W A;  3ULP A;  3OTO L;  1SFO H;  1WYD A;  4GKJ Q;  1MBY A;  4DR7 Q;  2LS0 1;  2ICI A;  4HJA A;  4XXE A;  3K5M A;  1JB3 A;  4CBV A;  4J15 A;  4BBS B;  4YCU A;  2F3W A;  3A8J E;  3QJY A;  3C3L A;  1TQO A;  4OEL B;  2FMM A;  3A54 A;  2KCM A;  4GLX A;  3SR1 A;  3EFX D;  2DJF C;  2RVL A;  4KTA A;  1MHW C;  2E75 C;  3UE0 A;  3AYH B;  3DWP A;  5T1G A;  4EQ5 A;  2L11 A;  1NJI C;  3MZ5 A;  1CQF A;  4A3E G;  3NPP A;  2K5D A;  3Q6S A;  1X3G A;  4WJ3 M;  1I4G A;  3HKS A;  5C0X H;  4ME3 A;  2E76 C;  1DCZ A;  1YZ6 A;  4GS3 A;  3PIP 3;  1LAB A;  2ZTD A;  3FPU B;  1CA5 A;  1SLJ A;  5H1S E;  4ZUJ A;  5EKL A;  3HOZ G;  1CKO A;  1GD7 A;  3K5O A;  4Q5V A;  4R4C A;  4UAI A;  1DOK A;  2ZM6 L;  3AFQ A;  2MNA A;  2ID0 A;  1E2V A;  1STG A;  2NVT B;  4NKL A;  4AYB B;  3PF5 A;  4DK3 C;  1D6E C;  2NN6 I;  3S2D B;  3E9H A;  5HY6 A;  1B53 A;  3V05 A;  2R61 A;  3GO5 A;  2NTS A;  4RGM A;  4H7B A;  4FYD A;  1GUW A;  4IUV A;  2IX3 A;  3S17 H;  4IQZ A;  2A1A A;  1QG7 A;  1UUP A;  1SMY D;  4RCN A;  4DV6 L;  2EY1 A;  2EVB A;  4GKJ L;  2ES2 A;  4DR7 L;  2JA7 G;  2D62 A;  4C3I B;  3S1N H;  3S15 B;  2WP8 J;  1RIP A;  4NP5 A;  1AE3 A;  1W6K A;  4DKA C;  3IL8 A;  4QUF A;  5D3I B;  4QUC A;  2B2V C;  2J0T D;  4NDX A;  1S3O A;  1XMQ L;  2PNR C;  2Q2H A;  5IYB G;  2I5M X;  5CV4 A;  2AQ2 B;  1LTS D;  2NVT H;  1ET6 A;  3HGB A;  1KAA A;  4XT1 B;  1VQH A;  3S2D H;  4A3F B;  1N36 Q;  4A3B H;  4A3D H;  1SAP A;  4N8F A;  3HOW G;  1R9T B;  5EPK A;  4A3I B;  1J6Q A;  1WJJ A;  1YI2 A;  3GTM B;  4ODG A;  5IP7 G;  2XGT A;  3PMF A;  1V1Q A;  5CV9 A;  1D2B A;  1E2W A;  1QZH A;  2H1E A;  2KHJ A;  1SE4 A;  4DV1 Q;  2PNH A;  1VQG A;  3G4S A;  1Y1W B;  2WKC A;  4C3I H;  4QJF A;  3AEV A;  3S15 H;  1Q82 C;  1JB7 A;  3CC7 A;  1BXT A;  3P75 A;  1WFQ A;  4DUZ Q;  3HOX B;  1LT3 D;  3ERS X;  3KBG A;  1VQ4 A;  5M5W B;  1F2L A;  1WTW A;  2L0C A;  1F2Y A;  1A3T A;  2B3G A;  1E22 A;  3NEL A;  1IW7 C;  1KRT A;  3T53 B;  4R4Q A;  3CCR A;  1HUM A;  1TXY A;  2VL6 A;  3J81 i;  5JVH 3;  4QIW E;  1RHP A;  1S72 A;  1VQM A;  1V9P A;  3S1M B;  4J8Q A;  1Q81 C;  1K8G A;  4TVA B;  1BBX C;  4DR1 Q;  1VF5 C;  1SN8 A;  3E5S A;  1Z6H A;  3ONA B;  3CPW A;  1JJ2 A;  3H3V C;  1D7Q A;  4LUO A;  2HD3 A;  4N9T A;  1KAB A;  1N36 L;  3HOX H;  3OMC A;  1I6H B;  1SNC A;  3CCL A;  4A3G G;  2DY8 A;  1HJP A;  1FNV A;  1PV4 A;  2RCF A;  4GNX B;  1XTC D;  2P5Z X;  3JAM L;  2YYZ A;  4I7A A;  5M5W H;  4ILW A;  4U68 A;  5C0X I;  1XNR Q;  3A5U A;  4BY7 B;  1NUC A;  4DV1 L;  3C1F A;  4HMI A;  2LFN A;  5C4H A;  2A5H A;  5A2Q E;  3EN2 A;  4WRD A;  4K5X A;  3M4O B;  4DUZ L;  2B29 A;  1KRS A;  1PH5 A;  1LLR D;  4MN3 A;  2OF1 A;  1K3B C;  5COY A;  4ID6 A;  2B8F A;  2UXB Q;  2R92 H;  1G2S A;  2F0N A;  1TWA H;  1L0Y B;  3AB9 A;  4R1J A;  5LHY 1;  1FJG Q;  4WJ4 A;  3C46 A;  1HR0 Q;  4IAL A;  2KEE A;  1LTT D;  2KBN A;  1ONL A;  2L55 A;  3RZD B;  5IE8 A;  4X3T A;  1AE2 A;  3BU2 A;  3BVZ A;  1Y14 B;  1RDP D;  4JI0 Q;  3VA7 A;  2F0T A;  1M8A A;  4BY7 H;  4PZ8 A;  2D9U A;  3ND9 A;  4DR1 L;  1Y8O B;  5I4D A;  1JOK A;  3K5L A;  4O1N A;  2JK8 A;  3M4O H;  2HIX A;  4A93 B;  2VUM B;  2RHS B;  2GA4 B;  2D5D A;  2RF4 A;  1DOL A;  1X3Q A;  1PFS A;  1GM5 A;  1KXL A;  4EX5 A;  5ELN A;  4YWK A;  1WTP A;  3UE1 A;  3D4R A;  1XNR L;  4KY6 A;  5FK9 C;  1PTO F;  5J1Z A;  3LGJ A;  1RCV D;  4GNX A;  3K57 A;  4RG1 A;  1MIU A;  4DAP A;  1VQF A;  1L1O A;  4ZUI A;  1G8Z D;  1QE6 A;  4RHS A;  1WVL A;  3S16 B;  1EU4 A;  3UI2 A;  3KF6 A;  1VMC A;  2Q8R E;  4E6I A;  2CHB D;  2UXB L;  4PZ6 A;  1G6P A;  2N3S A;  1DD2 A;  1EUJ A;  1K28 A;  4X62 Q;  2XRQ D;  3D31 A;  2M9V A;  1VQP A;  4DV4 L;  3EA6 A;  1JJC B;  4DR5 L;  1FJG L;  2RSO A;  1LT6 D;  3M4P A;  1HR0 L;  3D0F A;  4P71 A;  4A3C G;  4A93 H;  5FLX c;  1WCM G;  2E2J B;  1BDO A;  2K01 A;  4CKE A;  1JWS D;  1O7I A;  3TP7 A;  4K0K Q;  3HOU G;  1PH7 A;  1E24 A;  4EGV A;  5IWA Q;  4C3H B;  3DEP A;  2F0H A;  2IHF A;  3A8K E;  5JJZ A;  4JI0 L;  3K59 A;  3SK5 A;  5KNB A;  1HQM C;  4JI5 Q;  2J7Z A;  1RD9 D;  4A3J B;  3CCU A;  3GQB A;  1F9P A;  2EYH A;  4C3J H;  1HFN A;  4XTC S;  4PMW A;  1NTG A;  4QY7 A;  3FKI B;  1LT4 D;  1IKM A;  3HS0 C;  2IX0 A;  1XPO A;  5EJW A;  1RF2 D;  2BE5 C;  1B1Z A;  3RN2 A;  3A8I E;  3PCO B;  3CQZ B;  4HCE A;  4HSV A;  1SE2 A;  4HN7 A;  4DK1 A;  1J8I A;  4L5S A;  4R4T A;  3T16 A;  4DNT B;  3ERO A;  3P1H A;  4R9W A;  3JC6 6;  4LUV A;  2Q2T A;  1CM9 A;  1VQ9 A;  4LF8 Q;  5KYL A;  5CMD A;  1BQQ T;  3M3Y H;  3I4M B;  1EYD A;  1K3R A;  1C7Y A;  2KCT A;  4RWS C;  3W3A A;  2JEB I;  4FDB A;  4LNQ A;  1LTB D;  2ICE C;  5JJK A;  4X62 L;  1HZA A;  4OWT B;  1G6Z A;  2FJ2 A;  2JEA I;  1UE1 A;  1XWE A;  1T9H A;  4DAY B;  4MZ9 A;  1VQJ A;  1QNU A;  3QB3 A;  1H9M A;  2YU9 H;  3U9O A;  2OXP A;  1EY8 A;  3G6J B;  2VNU D;  4QB4 A;  4BXX H;  4K0K L;  5C6A A;  5M5Y B;  1YVC A;  2QDB A;  4AYB E;  3CQZ H;  1U4M A;  2AMC B;  5IWA L;  3DWQ A;  1PRT C;  1KHI A;  2F0J A;  4DR3 Q;  4RH6 A;  1JR0 D;  1S5D D;  4JI5 L;  4ZK9 B;  3HOZ B;  2K1B A;  1Y8P B;  3FDT A;  2HT1 A;  2Z4I A;  1V1O A;  4ZAI A;  4ZQ3 A;  1L0X B;  3K7A B;  3Q0A A;  2N49 A;  3BJU A;  4OO1 I;  2ALY B;  4B08 A;  1HXY D;  1JWU D;  1AZQ A;  4X6A H;  5LL6 S;  3BG3 A;  4HID A;  4K6D A;  5C4J H;  1PLF A;  3NP8 A;  3A0J A;  3TQY A;  5C4Z A;  3U4V A;  1Q1B A;  4AIM A;  4K8I A;  4DV5 Q;  1VQ5 A;  2NBF A;  2R7Z G;  4IFD I;  4R8N A;  4LF8 L;  5G3L D;  2G9D A;  4PNY A;  5L37 A;  1KDC A;  5FOB B;  1E7Z A;  2PMZ B;  4K14 A;  1J5E Q;  1HPC A;  3SEB A;  3VA5 A;  5M5Y H;  4OX9 L;  4C2M H;  1EIG A;  1PA6 A;  2O5I C;  3VYR A;  4B3R Q;  1XYI A;  2B2V A;  4LF6 L;  2JJQ A;  2Z0S A;  3SGI A;  1CKM A;  2EYJ A;  3I4N B;  3HOZ H;  1PTO B;  1RL2 A;  2A6H C;  4JG2 A;  4UP7 A;  3OWF A;  1X65 A;  1NCV A;  4RGN A;  1HQR D;  4NXN Q;  4GZY C;  3K7A H;  1SMX A;  4H0L C;  1JWM D;  1X3E A;  2SEB D;  1M90 C;  2A8V A;  3HOW B;  2LMC B;  2JXM B;  4DK0 A;  1DGS A;  5IT9 E;  4DR3 L;  1LTG D;  2Q8I B;  2QA4 A;  3TEH B;  4IUT A;  1EQR A;  1C48 A;  2H5X A;  3NUC A;  5C5M A;  4X64 L;  4M1U B;  4JI8 Q;  1QVG A;  2R6G A;  5EKK A;  2KED A;  1CKN B;  3S24 A;  1VMP A;  2DUD A;  1MD2 D;  4RGO S;  4NW2 A;  3SE0 A;  4IOC A;  3H3V H;  5I9O A;  3M7G A;  1EIY B;  1PTO H;  2KOL A;  3TRZ A;  4DV5 L;  4UP8 A;  4H13 C;  5IYB H;  2NB0 A;  2X6L A;  3MEH A;  3L2P A;  2AWN A;  2L4N A;  3GTK B;  2QF7 A;  4XT3 B;  2N88 A;  4A3K B;  4RCO A;  2B63 G;  1QJO A;  2NZ1 D;  3S9W A;  3HOW H;  3W5O A;  1A3U A;  3OYY A;  1WTQ A;  4OIJ A;  4B3R L;  2FXQ A;  1TU2 B;  2Z6B A;  2ENB A;  4O0A A;  1UEA B;  4IO9 A;  1PH9 A;  1B4O A;  5IP7 H;  1FYC A;  1QZG A;  4POG A;  3R3O A;  1D5Z C;  4ULL A;  5CGK A;  2NVQ B;  1X54 A;  1RTO A;  4KHV A;  3STB C;  1MJC A;  3UDF A;  2EIF A;  3BYY B;  1NE3 A;  4KMU C;  2E2I B;  3HKZ G;  5KEE A;  4OWW B;  4QGU A;  3J7A 5;  1JT8 A;  3K58 A;  3WOE A;  4R8I A;  3F1Z A;  5IIF A;  4QCL A;  1WI5 A;  1NSN S;  3CRK C;  3MFY A;  3CW2 C;  4XQN A;  3OTO Q;  3HOY G;  2O5J C;  4JI8 L;  2JP1 A;  1A63 A;  2N8N A;  2I5H A;  1X56 A;  1SYC A;  1JCK B;  3ULJ A;  2F03 A;  4FO2 A;  2KQ3 A;  3P20 A;  1VQD A;  2Y0S E;  1P8L A;  5DNF A;  3T51 B;  1HZ9 A;  2VB3 X;  5AJ3 Q;  4JBJ A;  1H9S A;  2NWG A;  1O7Z A;  1BR9 A;  1EFW A;  1S5E D;  4LFC L;  1D5M C;  4TKO B;  5JVG 3;  1PH2 A;  1FNU A;  4LFB Q;  3GDE A;  3H6M A;  1I4P A;  2VY3 A;  4FP5 D;  4XYO A;  2PCF B;  3I7F A;  1X3P A;  3D6C A;  4A3G H;  3FVQ A;  1X3F A;  4RMF A;  4N8X 1;  5FLX L;  4ZCK A;  2QDL A;  2XWB B;  3PUV A;  1B3A A;  1JE4 A;  1JE5 A;  1VQN A;  3HOV G;  4KD4 A;  4M8A A;  1V8Q A;  1EY9 A;  1U4P A;  1M1K C;  3S2H H;  2JYO A;  2AWO A;  3AMU A;  5E1F A;  2AHO B;  5M5X B;  3NTK A;  2E8G A;  1B44 D;  2TSS A;  1PTO D;  2CFM A;  5AFW A;  2A6E D;  1D8L A;  5IGE A;  1HR0 W;  3LX0 A;  5FO8 B;  3NBH B;  4JV5 Q;  5AJ3 L;  1Y1V G;  1HRJ A;  2F0D A;  2RKS A;  2LSS A;  3H15 A;  2VQF Q;  3S17 B;  2F0E A;  5FJ8 H;  3PUX A;  1XMQ Q;  2CVR A;  3X3M A;  2F0V A;  1GUS A;  4LFB L;  4EQN A;  5CBE E;  1K9M C;  1G91 A;  1CHP D;  3S1N B;  1DYQ A;  2OQ0 A;  4L5Q A;  2BOS A;  5M3M G;  1WCM B;  4JI1 Q;  2C9O A;  4RFB A;  2B2T C;  3IKJ A;  4OWX B;  1PH3 A;  1F9R A;  1HTP A;  2G5D A;  1GHK A;  1I4Q A;  1UNS A;  1PDQ A;  2WAQ B;  3A56 A;  1YJ9 A;  2XVS A;  1AH9 A;  5M5X H;  2K50 A;  3BDC A;  4L5R C;  1BVS A;  4KY7 A;  1EYC A;  3T1Y L;  4RGT A;  4BY1 G;  1B3Q A;  3J81 E;  2HUG A;  2F4V Q;  4GOP C;  5GAH C;  4A3D B;  4A3B B;  3T1H Q;  1CQV A;  2D0O A;  3H0G G;  2E2D C;  4DV7 L;  1EZ8 A;  4G57 A;  1F2Z A;  1CHQ D;  2DNC A;  2IJ0 A;  1CFM A;  1HFG A;  3BVG A;  4ZRZ A;  4HJ9 A;  2HDM A;  1BOS A;  5G3L F;  1CUK A;  4P75 A;  5NUC A;  2M2L A;  1WD1 A;  3PO2 G;  4BBR G;  2K4K A;  4A3C H;  1IYV A;  4JV5 L;  1WCM H;  4DV3 Q;  2SNM A;  3V96 A;  3K5N A;  3HOU H;  1SYD A;  2BDO A;  2VQF L;  3RZO H;  2KUM A;  4V0B A;  5EPL A;  3NBH A;  3TS2 A;  1STA A;  1Z9F A;  2XIW A;  2WIN B;  3GTG H;  3IAY A;  3RR5 A;  1HUN A;  4DR2 Q;  1OO9 B;  5JJI A;  1I3Q B;  4DGZ A;  2O2L D;  1UE7 A;  1MKH A;  2Q2U A;  1VDZ A;  2R93 G;  4JI1 L;  3RLN A;  1JC7 A;  1GUN A;  3Q24 A;  3CP0 A;  1H9J A;  1IHZ A;  3OW7 A;  1ET9 A;  1XPU A;  3TP8 A;  4HSP A;  2K5Q A;  2RQX A;  2EYO A;  2F4V L;  2QGQ A;  2N55 A;  3QOJ A;  4IPG A;  2JA6 G;  1XPR A;  1AFP A;  2KVM A;  3T1H L;  1YJW A;  5LMN Q;  2PZW A;  4XQJ A;  1I94 Q;  3KLS A;  1PFB A;  2A74 C;  2NN6 G;  3MVV A;  2WB1 B;  5COR A;  1T5X D;  4NPS A;  3PF4 A;  1BNZ A;  2PMZ E;  3LWE A;  1H9K A;  5JEA G;  1SJE D;  4LUZ A;  2GN5 A;  4DFA A;  1SRO A;  1IBM Q;  5K36 G;  1A15 A;  3TME A;  1II3 A;  2BE5 D;  2MO1 A;  4RA8 A;  1I3Q H;  4K2L A;  1SNM A;  2CH4 W;  1VCI A;  5F2D A;  3ZYY X;  1ILQ A;  4DV3 L;  3KYH C;  3IRB A;  1STB A;  1YEZ A;  4CHT B;  3NQT A;  2FHT A;  2IL8 A;  3VYT A;  5DM7 3;  3G6E A;  3S1Q H;  4MTK A;  2R92 B;  2B2W C;  1EY6 A;  1Q8I A;  1TWA B;  4KD3 A;  3FP9 A;  4FXK C;  3K80 C;  4DR2 L;  1W6J A;  1LYL A;  3OWE B;  5CV6 A;  1ZYR C;  4G7O C;  4PMC A;  2A68 C;  3H09 A;  3I73 A;  1EY5 A;  3G7L A;  2KCC A;  4ALP A;  1I6V C;  1WOC A;  1LTR D;  5KGU A;  2DN8 A;  4QMG A;  5C3E G;  1ZKO A;  4KJN A;  5JOB A;  1S40 A;  4TQU S;  1BCP C;  4LK1 C;  1A3V A;  1L1O B;  5DM6 3;  3CMA A;  1PYB A;  1ASY A;  1D1I A;  4RKL A;  1ENF A;  4JOI A;  3KF6 B;  4KY5 A;  2YTV A;  3F2U A;  4GLA C;  5D14 A;  1FGB D;  2ZXO A;  3NSW A;  2R7Z H;  5E4X A;  5LMN L;  2OWO A;  4JI3 Q;  4L5T A;  1TWG B;  2V4D A;  1I94 L;  4A3L H;  5J39 A;  5DAU A;  2H4O A;  3FPP A;  2ZXP A;  1KDB A;  4HIO A;  1CA6 A;  2J4X A;  3C2P A;  4LMQ D;  1IBM L;  1K0S A;  4DV4 Q;  2B2U C;  1OXX K;  4DR5 Q;  1SDF A;  1QVC A;  2NVY H;  5I9P A;  2SOB A;  1ZEQ X;  1KAW A;  4FF2 A;  1SR3 A;  1CI3 M;  5A35 A;  3PO3 G;  5IGD A;  1UE5 A;  2R7F A;  2ZJP A;  1TY0 A;  4G7H C;  5IT9 c;  1F77 A;  1HTL D;  2F4I A;  1SE3 A;  1TS3 A;  4HIK A;  2WII B;  4IUR A;  1IBK L;  4QL5 A;  2L5T A;  3JAM i;  4YIJ A;  1KDA A;  1Q1E A;  1FNW A;  4FXD A;  2IW3 A;  1TWG H;  5C44 G;  1HNX Q;  4CDE C;  1KQS A;  1GVP A;  3E3X A;  4H02 A;  1NMF A;  3QOL A;  4YCW A;  5A2Q L;  1EOT A;  1GUG A;  2EXZ A;  1SMY C;  1W2B A;  4FF4 A;  4C3J B;  1R4Q B;  1BUV T;  4FXG C;  4JI3 L;  2GVB A;  4HIM A;  1SYB A;  2AUJ D;  1A2U A;  2VS1 A;  2B63 H;  2FMC A;  3BS1 A;  2WFW A;  1HZC A;  3SVM A;  1GHJ A;  1GO3 E;  4BBS G;  3K0Y A;  2OTL A;  1N34 Q;  2K75 A;  3CKI B;  1S5F D;  1N8R C;  3VR6 A;  2SDF A;  1VQC A;  4IFD J;  3M3Y B;  1K83 B;  2HQE A;  1N33 Q;  4WOR A;  1K8M A;  1Q8K A;  1QB5 D;  3W2D A;  4CDD C;  4KK7 A;  3G48 A;  3J80 E;  5I6W A;  3OIP A;  1EOV A;  1F9Q A;  3U50 C;  3TDQ A;  5T1I A;  1J9O A;  1KC8 C;  1Z7T A;  3HOY H;  2YU9 B;  4UPA A;  3DM3 A;  1STH A;  4CGY B;  1HNX L;  1KD1 C;  2UUC Q;  4FVM A;  3E9I A;  3NWS A;  3OPO A;  3KFU A;  2B39 A;  1E2Z A;  2EY5 A;  2ASB A;  3IFD A;  4AYB G;  3K8A A;  4JYA L;  4B3S Q;  3STB D;  1KL9 A;  2IY5 B;  2VW9 A;  2PO4 A;  1A2T A;  1EEI D;  1WTX A;  3I8Z A;  2F3V A;  1IYJ B;  2F1M A;  1B9N A;  4OX9 Q;  2EJG C;  3MC0 B;  1K83 H;  2F0K A;  2UU9 Q;  4C1N I;  4LFA L;  2C35 B;  1I4R A;  3RN5 A;  5C4J B;  4C3I G;  1B70 B;  1YBY A;  4G4K A;  1MSG A;  1N34 L;  3DEO A;  4KI0 A;  5I6Y A;  4Y52 H;  2VZA A;  4A3E B;  3A5Z B;  3PIO A;  2WAQ E;  2E5L Q;  1YNN D;  2EYP A;  4CJ1 B;  3VR4 A;  3F8T A;  1CSQ A;  5BR8 Q;  4C2M B;  1N33 L;  3KK7 A;  3MXN B;  4J6H A;  3HOV H;  4DV0 Q;  2B2T A;  2ATW A;  1QUQ A;  3D4W A;  4S3S A;  4ZKB B;  4A3M G;  3DLL A;  4DN4 M;  4LF7 Q;  3WOF A;  1SNP A;  4KHZ A;  4LF6 Q;  1YNJ C;  4X64 Q;  4A3F G;  1SNO A;  4PV1 C;  1EWC A;  2F3I A;  3PGZ A;  4A3I G;  1ASZ A;  2ZXR A;  2UUC L;  1YNX A;  3MAQ A;  1XX8 A;  3NWT A;  4BY1 B;  2L15 A;  4HTH A;  2EYF A;  3J7A V;  1Q86 C;  2NVX B;  3D4D A;  1C4Q A;  3HZX A;  1JQY D;  1Y1V H;  1PYW D;  1Y1W G;  4Y7N B;  1SSO A;  4B3S L;  2BA0 A;  1STY A;  4PZ7 A;  3E0J A;  3HOX G;  4A3E H;  2CW0 C;  1MGS A;  1A0I A;  3H94 A;  2JA7 B;  5JAV A;  2SNS A;  4CDC C;  2B8G A;  2UU9 L;  3C1E A;  4BBR B;  3ITP A;  2I0Q A;  1JJG A;  5M3M H;  1RKN A;  1DON A;  1U0L A;  3O13 A;  4DA2 A;  1IXR A;  3R93 A;  1PHJ A;  4DAM A;  1CTM A;  5K5P A;  4K5V A;  3CCE A;  1NMG A;  4OIK A;  3VYU A;  2VXW A;  1FL0 A;  2E5L L;  3J81 c;  5LMU Q;  4BY1 H;  4AH6 A;  5BR8 L;  1LTL A;  2NVX H;  4DV0 L;  4BA2 I;  2BCO A;  2QKI C;  3H0G H;  3UDG A;  4F87 A;  4MNO A;  4C56 C;  4QQB X;  4LF7 L;  2RDF A;  1B2T A;  4Y7N H;  2KEC A;  4KV6 A;  3MXN A;  1BKB A;  1PVO A;  1VQ8 A;  1Q90 A;  1AW7 A;  2WV6 D; 
#chains in the Genus database with same CATH homology
 2B3G A;  2UUA Q;  2A19 A;  2VQE L;  1E22 A;  2E8G A;  2WB1 E;  3NEL A;  4YHH L;  4KHP Q;  1HNZ Q;  1SE8 A;  1KRT A;  2CFM A;  4R4Q A;  3CCR A;  2JA7 H;  3S14 H;  5GAE C;  5GQO A;  1D8L A;  4A4I A;  1HR0 W;  1OTC A;  1X55 A;  2EQS A;  1TXY A;  2EXD A;  2VUM H;  1G51 A;  2VL6 A;  3J81 i;  3NBH B;  1YHB A;  5AJ3 L;  1VQL A;  4JV5 Q;  1PH4 A;  1Y1V G;  4BBR H;  4QIW E;  3PO2 H;  1IZ6 A;  1S72 A;  2LSS A;  1VQM A;  1V9P A;  1YHA A;  2K14 A;  2WAQ G;  2Z6K A;  3H15 A;  2VQF Q;  3GTL H;  2IX1 A;  4X66 Q;  1Q81 C;  4HJ7 A;  4DK6 C;  4TVA B;  1K8G A;  1IBL Q;  4OO1 G;  4LFC Q;  5FJ8 H;  3PUX A;  1XMQ Q;  4DR1 Q;  4LFB L;  3KJO A;  2PQA A;  1K9M C;  1I50 H;  1SN8 A;  1EQQ A;  1PH6 A;  4A3B G;  4A3D G;  1N32 L;  4DR6 Q;  4IPD A;  3CPW A;  1JJ2 A;  3B6Y A;  1D7Q A;  4LUO A;  2OCE A;  1N36 L;  2OQ0 A;  3HOX H;  3S16 H;  4L5Q A;  3CCL A;  2K5V A;  3L0O A;  4A3G G;  1HJP A;  4IFD G;  5M3M G;  1PV4 A;  4JI7 L;  4JI1 Q;  4GNX B;  4MTN A;  2YYZ A;  4OWX B;  1UEB A;  2Y0S G;  1PH3 A;  4IPC A;  1BBW A;  3KDF A;  5M5W H;  5C0X I;  4KLK A;  1XNR Q;  3U4Z A;  3A5U A;  1AH9 A;  1X6O A;  1YJ9 A;  2UUB L;  3L7Z C;  5M5X H;  3I56 A;  1TWC H;  4DV1 L;  1UE6 A;  2K50 A;  4L5R C;  1BVS A;  4A75 A;  4UP9 A;  4R4I A;  3M9B A;  3T1Y L;  4BY1 G;  3CME A;  2E2J H;  5M3F G;  1Z47 A;  2F4V Q;  3EN2 A;  5LMU L;  1FGU A;  4DUZ L;  4GOP C;  2B29 A;  1C0A A;  1KRS A;  5GAH C;  3T1H Q;  3H0G G;  2XTI A;  2D0O A;  1BBU A;  1N9W A;  3A74 A;  5LMN W;  4DV7 L;  1PH5 A;  2JA6 H;  4IOA A;  1YIJ A;  4GN4 B;  2OTJ A;  4C3H H;  4DV2 Q;  1V43 A;  3UDX A;  2UXB Q;  1KIX A;  4HJ9 A;  2R92 H;  3I4O A;  1YIT A;  2UUA L;  4KHP L;  4JBW A;  1TWA H;  2KEN A;  1CUK A;  4A3J H;  1HNZ L;  1NBW A;  4IPH A;  4P75 A;  4R1J A;  4YCV A;  1FJG Q;  4WJ4 A;  3FKI H;  2VUM G;  2JA5 H;  1HR0 Q;  5IY0 A;  4GOP A;  1XJV A;  3PO2 G;  4BBR G;  2K4K A;  1SRU A;  2KBN A;  4JI4 Q;  3S1R H;  4A3C H;  1P16 A;  3CAM A;  4JV5 L;  1WCM H;  1A8V A;  3GTO H;  2I5L X;  2JA8 H;  4DV3 Q;  1YHQ A;  3HOU H;  3PV0 A;  2VQF L;  3RZO H;  5IE8 A;  1AE2 A;  1W3S A;  4X66 L;  3BU2 A;  3F2C A;  1Y14 B;  1IBL L;  3AFP A;  4JI0 Q;  5JEA J;  4BY7 H;  4AQY Q;  3TS2 A;  4PZ8 A;  1Z9F A;  3M4Q A;  4DR1 L;  2E2H H;  3GTG H;  3RR5 A;  2MO0 A;  4DR6 L;  1N32 Q;  4JI6 Q;  4DR2 Q;  1K8A C;  2JK8 A;  2K52 A;  3M4O H;  2HIX A;  4OXP A;  4DPG A;  5JJI A;  4P74 A;  3F2B A;  1Q12 A;  1E1O A;  1UE7 A;  1MKH A;  2WB1 G;  3I4M H;  2NZH A;  4X65 Q;  2RHS B;  2Q2U A;  2R93 G;  3BZK A;  4JI1 L;  4JI7 Q;  3RLN A;  2RF4 A;  5J3B A;  1PFS A;  1GM5 A;  1KXL A;  3CP0 A;  4EX5 A;  5JJL A;  5ELN A;  4YWK A;  3UE1 A;  4UY8 C;  1XNR L;  1OXT A;  3CCS A;  3LGJ A;  3J80 i;  3CCV A;  5C3E H;  1XPU A;  5C4X H;  4GNX A;  2RHQ B;  3RNU A;  4RG1 A;  1MIU A;  1B7Y B;  2F4V L;  3T1Y Q;  2QGQ A;  4IPG A;  1VQF A;  1XPR A;  2JA6 G;  4NB3 A;  1L1O A;  3T1H L;  1YJW A;  5E7N A;  5LMN Q;  2IHE A;  3K81 C;  4DV7 Q;  3KF6 A;  1I94 Q;  1H95 A;  2NN6 G;  1EIF A;  4DV2 L;  1VQ7 A;  4JBM A;  2UXC Q;  2R92 G;  2UXB L;  5DLQ E;  4NPS A;  2Z6K C;  4PZ6 A;  2N3S A;  4LF9 Q;  2PMZ E;  1EUJ A;  3PF4 A;  4X62 Q;  1G6P A;  3D31 A;  1VQP A;  5JEA G;  4JBK A;  4A3J G;  4LUZ A;  2GN5 A;  4DV4 L;  1SRO A;  3FKI G;  1IBM Q;  5K36 G;  1K73 C;  2JA5 G;  1JJC B;  4DR5 L;  3PUZ A;  1FJG L;  2CQO A;  4IJH A;  2JQO A;  2V1C C;  3M4P A;  3CCJ A;  3F2D A;  1HR0 L;  3D0F A;  4P71 A;  1A62 A;  4A93 H;  2YTX A;  1WCM G;  5FLX c;  2MO1 A;  4A3C G;  1I3Q H;  2JA8 G;  3OW2 A;  2R7D A;  1O7I A;  4LWC A;  1VCI A;  3M85 A;  2QEX A;  3WWV A;  1PH7 A;  4JI4 L;  3CXC A;  1E24 A;  3HOU G;  4DV3 L;  2MFI A;  3IRB A;  3KYH C;  1YEZ A;  5IWA Q;  3PO3 H;  3PIP A;  2IHF A;  4JI0 L;  3ULL A;  4AQY L;  3G6E A;  2PI2 E;  3KJP A;  3S1Q H;  4JI5 Q;  4R4O A;  3I55 A;  3GD7 A;  2K5H A;  3RLO A;  3FP9 A;  3K80 C;  4XIG S;  3CCU A;  4JOI C;  4JI6 L;  4IJL A;  4C3J H;  2HIV A;  4XTC S;  4DR2 L;  4PMW A;  1NTG A;  1E3P A;  2BH8 A;  1LYL A;  4QY7 A;  3H3V I;  3I4M G;  2JA9 A;  2LXK A;  2IX0 A;  3W1B A;  1XPO A;  4DNI A;  4X65 L;  3RN2 A;  3PCO B;  4ALP A;  1HNW Q;  3MEF A;  1WOC A;  1GKH A;  5C44 H;  3VDY A;  3CPF A;  2R93 H;  5C3E G;  5C4X G;  1S40 A;  2KHI A;  2BH2 A;  3KOJ A;  4R4T A;  4L5S A;  1EYG A;  4GLV B;  4B3T Q;  3I4N H;  4TQU S;  1L1O B;  3CMA A;  1PYB A;  4GN5 A;  1ASY A;  1CSP A;  2CKZ B;  4JOI A;  1XMO Q;  3KF6 B;  2YTV A;  3JC6 6;  4GLA C;  4LUV A;  2Q2T A;  1VQ9 A;  4LF8 Q;  1MJE A;  1J5E L;  3CC2 A;  2R7Z H;  4B3M Q;  5LMN L;  2OWO A;  4JI3 Q;  4L5T A;  3M3Y H;  1I94 L;  3CCM A;  4A3L H;  5IYD H;  1K3R A;  1C7Y A;  2KCT A;  4HIO A;  2UXC L;  2JEB I;  4FDB A;  4LNQ A;  1U5K A;  5JJK A;  4LF9 L;  4X62 L;  1HZA A;  4OWT B;  5HGQ A;  1IL2 A;  2JEA I;  1K0R A;  2D0P A;  1UE1 A;  1OXS C;  4JCV E;  4DUY Q;  1IBM L;  2K5N A;  1T9H A;  4DAY B;  1OXX K;  1VQI A;  4MZ9 A;  1VQJ A;  5C0X J;  3GTJ H;  4DV4 Q;  1VQE A;  3JAM c;  4DR5 Q;  5GRO A;  3CC4 A;  2YU9 H;  4A93 G;  1G29 1;  2LXJ A;  4NXN L;  4BBS H;  1QVC A;  2NVY H;  2VNU D;  1X9N A;  4BXX H;  1KAW A;  4K0K L;  1SR3 A;  3PO3 G;  2YV5 A;  1YVC A;  1UE5 A;  2R7F A;  5GAD C;  4AYB E;  3CQZ H;  2ZJP A;  1Q46 A;  2AMC B;  4K0K Q;  5IWA L;  3PUY A;  1YJN A;  1KHI A;  3GTP H;  4DR3 Q;  3J80 c;  5IT9 c;  1B8A A;  2JE6 I;  4JI5 L;  3UDI A;  2AKW B;  1FVI A;  5FLM H;  4GNX C;  2HHH Q;  4HIK A;  2HT1 A;  1IBK L;  4QL5 A;  3GTK H;  3JAM i;  4BY7 G;  2GVA A;  1UWV A;  4BA1 I;  1Q1E A;  1L1O C;  4A3K H;  2NZO A;  1TWG H;  2N49 A;  5C44 G;  1HNX Q;  4JI2 Q;  3BJU A;  4OO1 I;  1KQS A;  1GVP A;  2ALY B;  3EIV A;  1HNW L;  5IYC H;  4H02 A;  1NMF A;  3I4N G;  2HQL A;  3I2Z A;  1Q7Y C;  4X6A H;  1CKN A;  1EWI A;  4HID A;  3CD6 A;  2ZTC A;  4YCW A;  5ELO A;  4B3T L;  5C4J H;  1VQB A;  3A0J A;  3TQY A;  3KLW A;  3GTQ H;  3U4V A;  1W2B A;  1Q1B A;  1HH2 P;  3PUW A;  4AIM A;  3HKZ E;  4DV5 Q;  1XMO L;  1VQ5 A;  2NVQ H;  2R7Z G;  4IFD I;  1LUZ A;  3K0X A;  4P73 A;  4LF8 L;  3ICE A;  1VS0 A;  5IYD G;  4B3M L;  4A3L G;  2CWA A;  1E7Z A;  4JI3 L;  1J5E Q;  2E2I H;  2GVB A;  5M5Y H;  4OX9 L;  4C2M H;  4HIM A;  1VQA A;  2ZTE A;  1L0W A;  3TS0 A;  1PA6 A;  2VS1 A;  3BZC A;  2MQH A;  2B63 H;  1NY4 A;  4YWL A;  4B3R Q;  3ER0 A;  2JJQ A;  2WFW A;  2Z0S A;  1HZC A;  3SGI A;  1CKM A;  4YY3 Q;  3HOZ H;  3CCQ A;  4DUY L;  2CCZ A;  2ZM6 Q;  1RL2 A;  4JG2 A;  3E0E A;  1GO3 E;  4BBS G;  3K7U C;  4UP7 A;  2OTL A;  1N34 Q;  4BXX G;  1X65 A;  2K75 A;  4APV A;  1N8R C;  3ZJY C;  4NXN Q;  5IP9 H;  3HFZ B;  2YTY A;  3K7A H;  1SMX A;  2IT1 A;  1TWF H;  1VQC A;  4YWM A;  1LM0 A;  4IFD J;  4A76 A;  1N33 Q;  1X3E A;  2CWP A;  1M90 C;  2A8V A;  1C9O A;  1Q8K A;  1E1T A;  4POF A;  4HJ5 A;  1PH1 A;  3FHW A;  3G48 A;  1DGS A;  2OQK A;  2Q2I A;  4DR3 L;  2QA4 A;  3TEH B;  2BA1 A;  5FLM G;  1EOV A;  4DV6 Q;  1VQO A;  1EQR A;  3U50 C;  1HZB A;  3ULP A;  3OTO L;  1SFO H;  4P72 A;  1WYD A;  3Q8D A;  4A3M H;  4GKJ Q;  2H5X A;  4X64 L;  2HHH L;  4DR7 Q;  4JI8 Q;  4HJ8 A;  1KC8 C;  3HOY H;  1QVG A;  2R6G A;  3RLF A;  4HJA A;  4A3K G;  1IBK Q;  1XTD A;  4J15 A;  3DM3 A;  4UPA A;  3KF8 B;  4A3F H;  4YCU A;  1CKN B;  4GKK Q;  3NEN A;  3S24 A;  5IYC G;  1R9T H;  1KD1 C;  1L2F A;  3NEM A;  1HNX L;  2UUC Q;  3EBE A;  3E9I A;  4JI2 L;  4A3I H;  2KCM A;  4GLX A;  3KFU A;  3GTM H;  2DUD A;  2UXD Q;  1JMC A;  1VQK A;  4IOC A;  3H3V H;  1EIY B;  2ASB A;  3UE0 A;  3AYH B;  4AYB G;  4EQ5 A;  1NJI C;  3K8A A;  4JYA L;  3TRZ A;  2ZJQ A;  1PH8 A;  1Y1W H;  4B3S Q;  3STB D;  1KL9 A;  4A3E G;  4DV5 L;  2IY5 B;  2N78 A;  1X3G A;  4UP8 A;  3J81 j;  4NXM Q;  5IYB H;  2VW9 A;  4WJ3 M;  3L2P A;  2AWN A;  3HKS A;  4OON A;  4ME3 A;  3M7N A;  3TRE A;  1IYJ B;  2B63 G;  1YZ6 A;  4OX9 Q;  4GS3 A;  1K83 H;  2UU9 Q;  2DGY A;  3HOW H;  3W5O A;  2ZTD A;  3OYY A;  4B3R L;  2FXQ A;  1SLJ A;  5H1S E;  4O0A A;  4LFA L;  1CKO A;  1GD7 A;  3HOZ G;  2C35 B;  4DR4 Q;  4IO9 A;  1PH9 A;  3RN5 A;  4YY3 L;  5IP7 H;  4R4C A;  4LF4 Q;  1B70 B;  1YBY A;  3W1G A;  2ZM6 L;  1QZG A;  3AFQ A;  2MNA A;  2ID0 A;  1OXU A;  3PSI A;  4POG A;  1N34 L;  5IP9 G;  4KI0 A;  4Y52 H;  3CF5 A;  1X54 A;  3STB C;  3PF5 A;  4DK3 C;  2VZA A;  1MJC A;  3UDF A;  3A5Z B;  3PIO A;  2WAQ E;  2NN6 I;  3E9H A;  5HY6 A;  2EIF A;  2E5L Q;  1NE3 A;  3GO5 A;  3F8T A;  3HKZ G;  1CSQ A;  5BR8 Q;  1N33 L;  3MXN B;  4OWW B;  4JC0 A;  4QGU A;  3J7A 5;  3HOV H;  4DV0 Q;  3S1M H;  2ATW A;  1JT8 A;  1QUQ A;  3S17 H;  3F1Z A;  1XNQ Q;  2A1A A;  4A3M G;  3DLL A;  3U58 A;  4DV6 L;  4LF7 Q;  1WI5 A;  2PI2 A;  3HOY G;  3CW2 C;  3OTO Q;  4KHZ A;  2ES2 A;  4DR7 L;  4GKJ L;  4JI8 L;  1A63 A;  4LF6 Q;  2JA7 G;  2N8N A;  2I5H A;  4X64 Q;  1X56 A;  4A3F G;  2VQE Q;  2D62 A;  4YHH Q;  3S1N H;  3ULJ A;  2F3I A;  2WP8 J;  1RIP A;  3PGZ A;  1VQD A;  4A3I G;  1ASZ A;  2ZJR A;  4LW1 A;  4GKK L;  2Y0S E;  4LF5 L;  1I6H H;  2UUC L;  1YNX A;  1P8L A;  3J7Z C;  1AE3 A;  2L15 A;  4DKA C;  1HZ9 A;  5EAY A;  5AJ3 Q;  4JBJ A;  1Q86 C;  2UXD L;  2PQA B;  1QVF A;  5FJ8 G;  1EFW A;  1Y1V H;  1Y1W G;  4LFC L;  1S3O A;  1XMQ L;  2Q2H A;  1TWH H;  5IYB G;  4B3S L;  4JYA Q;  2BA0 A;  2I5M X;  1PH2 A;  2NVT H;  3GDE A;  5C0X G;  4LFB Q;  4NXM L;  4PZ7 A;  3HOX G;  2VY3 A;  4A3E H;  4O2D A;  1A0I A;  1VQH A;  3S2D H;  1N36 Q;  4A3B H;  4A3D H;  1OXV A;  3HOW G;  3KDF B;  2UU9 L;  4LF5 Q;  3I7F A;  1J6Q A;  1WJJ A;  4A3G H;  1YI2 A;  2I0Q A;  5IP7 G;  1VQ6 A;  5M3M H;  2XGT A;  4DR4 L;  1JJG A;  1I5F A;  4LFA Q;  1U0L A;  1V1Q A;  2RCN A;  1X3F A;  4RMF A;  1IXR A;  1PHJ A;  1PYS B;  4DAM A;  5GAG C;  4LF4 L;  2UUB Q;  1QZH A;  2KHJ A;  3G71 A;  4DV1 Q;  2PNH A;  1VQG A;  3G4S A;  1NMG A;  3CCE A;  4C3I H;  4QJF A;  3AEV A;  3S15 H;  1FL0 A;  1Q82 C;  3PUV A;  3CC7 A;  1JB7 A;  1JE5 A;  1QUQ B;  4PG3 A;  2E5L L;  1WFQ A;  3J81 c;  5LMU Q;  4DUZ Q;  1VQN A;  4GN3 B;  3HOV G;  4BY1 H;  4AH6 A;  5BR8 L;  5M3F H;  3ERS X;  3AQQ A;  1LTL A;  1VQ4 A;  2NVX H;  3RZD H;  4DV0 L;  1M1K C;  4BA2 I;  3UDG A;  3H0G H;  3S2H H;  1XNQ L;  2F52 A;  2AWO A;  4MNO A;  4QQB X;  4LF7 L;  4Y7N H;  2AHO B;  4GOP B;  1BKB A;  1PVO A;  1VQ8 A;  4LF6 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...