4DUZL

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u13c, bound with streptomycin
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
124
structure length
123
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 13
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4duzL00
3OTOL 2QEXA 2OQ0A 2JEAI 5C0XG 4DR1Q 3H3VH 4X6AH 4BY7H 2ID0A 1PH5A 3CPWA 3CCUA 4J15A 1X56A 3K8AA 3PUXA 2I5LX 2ALYB 2E5LQ 1JMCA 3UDGA 4O0AA 1N33Q 4GOPA 3TREA 4APVA 1X65A 5C4XH 5IP7G 4BA2I 4IOAA 3CQZH 1SMXA 3PIPA 2A8VA 4DV3Q 2LSSA 3VDYA 1Y1VG 3GD7A 1KRSA 1VQDA 4ME3A 4OWWB 4IJLA 1TWGH 4IPCA 5IWAQ 4A3LH 4UP7A 2VQEL 3PF5A 2Q2IA 4BBSH 3KF6B 4JC0A 1IBLL 3I4NH 3IRBA 2E5LL 1N33L 2R7ZH 3B6YA 2PI2E 3CD6A 4A3DH 3I7FA 1HNZQ 2NVQH 2K52A 1OTCA 1QUQA 4DR5Q 4JI1L 1QUQB 1D8LA 4JG2A 4HJ9A 5IY0A 4OXPA 2VY3A 5M3FG 5ELNA 1YVCA 5IYCG 1GM5A 2RHQB 3TS0A 4LNQA 2CQOA 1XNQQ 5IYDG 2VUMH 4KI0A 3K7AH 3I4NG 2I5MX 1XNQL 2E2JH 3ULPA 3CCVA 1PA6A 1XMOL 3T1YL 2E2IH 4MZ9A 4HJ7A 2YTYA 3S1QH 5C44H 1HZAA 1MJCA 4X62Q 1HR0W 5GADC 3D0FA 1H95A 2JE6I 2YV5A 4QGUA 3J7ZC 5DLQE 3K0XA 3RLNA 4A93H 3S2HH 4DR2Q 1CSQA 2I5HA 4DAMA 2VQFQ 4B3ML 3KLWA 1GVPA 4PZ7A 1SE8A 2WAQG 1PH9A 1Q81C 1HZ9A 4IOCA 4DR4Q 3GO5A 2VZAA 1VQFA 1VQKA 4H02A 1JJCB 4ALPA 4LW1A 4LF5L 1OXUA 1KXLA 2OCEA 4JI7L 1Y1VH 3ERSX 4A3FG 4OONA 2B29A 1IL2A 4R4CA 2VQEQ 3KFUA 1PVOA 4B3TL 4DR3Q 3F2DA 1YJ9A 4OWTB 4OWXB 1K73C 4B3SQ 4C3IH 4BXXH 4R4OA 4DK6C 4GNXB 5C3EH 4RMFA 2IX1A 1Z9FA 3PF4A 2UUBL 3CMEA 3L7ZC 4LUOA 1Y1WG 1Q46A 4P73A 3T1HL 2JEBI 1N36L 5BR8Q 1RL2A 3JAMi 2L15A 3H0GG 2KHIA 3PO2H 2MNAA 1S3OA 4OO1G 5HY6A 3SGIA 5BR8L 4IFDG 1GKHA 3G4SA 2YTXA 3S1RH 2XGTA 4YY3Q 5M3FH 2UU9Q 2Y0SG 2WP8J 2AKWB 4PZ6A 4DV1Q 1EOVA 4DV7L 1T9HA 1QZGA 1N8RC 1IBKL 4DR7Q 4A3EH 4B3RQ 4A93G 4A3IG 1IYJB 1WJJA 1HZBA 3RZDH 3HOWH 2ZJPA 4B3RL 4KHPL 1I50H 1GO3E 4X65Q 2MO0A 1NE3A 4IPHA 4LF7Q 4LF8Q 3PO2G 2PMZE 4DR5L 3OTOQ 1JB7A 1XPUA 5LMUQ 1AH9A 1WOCA 4BA1I 1E22A 1YI2A 4DPGA 4HIKA 2Z6KA 2PQAB 1N36Q 2WB1G 2CWPA 4GKKL 1PYBA 1HNWQ 4IPGA 1C0AA 4DAYB 1BBUA 3CXCA 2UUAQ 3RNUA 4QY7A 3S24A 1VS0A 3A74A 3S16H 1VQOA 2IHEA 4JI5L 3DM3A 4X66Q 4LF4Q 2YTVA 3HOXH 3G71A 4O2DA 5LMNL 4GOPC 4AQYQ 1Q8KA 3PGZA 4JI6Q 3RR5A 3E9IA 1PV4A 1RIPA 5GROA 4Y52H 2ZTCA 3KYHC 1YITA 2VL6A 4WJ3M 2RCNA 2R6GA 4EX5A 2UXBQ 1BVSA 3S15H 2D0PA 4GN5A 3STBD 2KCMA 5JJIA 2HIVA 3NBHB 3MEFA 2RHSB 3M85A 1FJGQ 3J7A5 4AYBE 1IXRA 3H0GH 2C35B 4LFBQ 1P8LA 1K3RA 3NEMA 4DNIA 2NZHA 5IP9G 1UE7A 4LWCA 2B63H 1VQ9A 4GS3A 5FJ8G 4DV1L 4DR2L 1HJPA 3KDFB 1K83H 3HOVH 2BA0A 1JE5A 4IPDA 3HOYH 4JBJA 4DR6Q 1SFOH 2KENA 1YJWA 1Q86C 1QZHA 1X55A 4A3GH 2VNUD 3CCSA 1CKOA 1IBMQ 4JYAQ 1N34Q 1V9PA 2UUCQ 1Q1BA 4LFCL 4A3IH 4LF6L 1PYSB 5IYDH 3W1BA 1A62A 4YWMA 5M5WH 1FJGL 5H1SE 3ICEA 1GD7A 3L2PA 4BBRG 3AYHB 4P71A 4JI6L 3FKIH 3HKSA 1NTGA 3EIVA 3FHWA 2LXKA 4YHHL 4R4TA 1PH2A 1ASZA 1CKNA 3ER0A 4C3HH 1VQ8A 2N49A 4DUZL 1V43A 2A19A 1VQCA 1UEBA 3CPFA 1CSPA 3UDIA 5FLMG 3HFZB 5M3MH 4L5RC 3U58A 1FL0A 2Y0SE 1X3GA 1OXTA 2E8GA 1PH6A 1XNRL 4JBKA 4IJHA 3T1YQ 2QGQA 1SROA 2DGYA 4AH6A 3J81j 4DV5L 5GAEC 1Q7YC 1JJGA 4L5QA 4KHPQ 4BY1H 1PH3A 1EQQA 4AYBG 1J5EQ 2IT1A 4GN4B 5JEAG 4A3MH 1HZCA 5FLMH 3J81c 3CCEA 1O7IA 5C4JH 4NXML 1KRTA 4NXNL 2GVBA 2NVXH 3PUZA 2OTLA 3S2DH 2UXDQ 3PO3H 3NELA 3I4MH 4DR3L 5FJ8H 3TS2A 2MQHA 1Y14B 2H5XA 1A8VA 4LFAQ 3GTKH 1WCMH 2PQAA 3CW2C 3M4PA 4PG3A 4LF9Q 1SRUA 1XMOQ 2FXQA 2ZJRA 2D62A 3BZKA 1TWFH 5J3BA 4NB3A 2JK8A 4DUYQ 2K50A 1A0IA 1KQSA 3UDFA 1VQLA 4JI0L 1G51A 1WFQA 4DV0L 1VQJA 2K4KA 2LXJA 5IE8A 1LUZA 5C44G 3CC7A 1KHIA 1PH7A 1HNZL 3GTQH 1OXSC 2Q2UA 4GKJQ 1YZ6A 1Q82C 1B8AA 2A1AA 2UXCL 3U4VA 1YEZA 1J6QA 3AFQA 1C9OA 2F4VQ 1V1QA 1EIYB 1A63A 1KIXA 1PFSA 1CKMA 2HT1A 4C3JH 1L1OC 4Y7NH 2D0OA 2Q2HA 1VCIA 1C7YA 4AQYL 2UUAL 2YU9H 4JI7Q 3HOZH 1VQHA 4AIMA 4R4QA 4YWKA 4C2MH 4A3MG 1R9TH 4X66L 4JI5Q 4GKJL 3RLFA 4X62L 2K14A 1B7YB 2NZOA 2BH2A 3K81C 1XTDA 2UXCQ 1YHBA 1OXVA 4TVAB 4LF8L 2UXBL 2N8NA 3EN2A 3TEHB 2JA5G 2OWOA 1YHAA 3M4QA 4QJFA 3CAMA 3ULLA 3GTLH 4YCVA 1UE6A 2RF4A 3KF8B 2IX0A 3G48A 3PIOA 1EYGA 1YNXA 1EFWA 3PO3G 4X64Q 2Z6KC 2ATWA 5K36G 3PV0A 4DR7L 3JAMc 2JA7G 1AE2A 2VW9A 2JJQA 2IY5B 2R7DA 4K0KQ 5JJLA 1VQMA 1L0WA 4HIDA 3RN5A 1S40A 3TQYA 3S1MH 1TWHH 4A3DG 1SLJA 5LMUL 4QQBX 3GTMH 4IO9A 4A3KG 4MTNA 2UXDL 3GTGH 2QA4A 1VQ6A 2AHOB 1E1OA 1LTLA 1G6PA 1NMGA 1XMQQ 2JA7H 1NBWA 1I3QH 2R7FA 1EQRA 3J80i 1LYLA 4PMWA 2KCTA 2PI2A 3U4ZA 2CCZA 2ZJQA 5EAYA 2CFMA 4EQ5A 1IBLQ 3RN2A 2EQSA 1X3FA 1E1TA 4HJ5A 3HOUG 4DK3C 4DUZQ 2DUDA 3HOXG 4A3GG 4JOIA 3HKZE 3CCJA 2KBNA 1VQNA 4GNXC 4GNXA 2AWNA 1VQAA 2OTJA 4L5TA 3F2CA 3U50C 3L0OA 3W1GA 3H3VI 3I4OA 1HH2P 3CF5A 1VQGA 3HOZG 1K8GA 1E24A 5IWAL 3GTOH 4X65L 1S72A 4LF7L 3LGJA 1FGUA 1I6HH 2ZTDA 3I56A 4UY8C 4A3FH 4DV2L 2R92G 2B3GA 3I55A 1VQ4A 4B3TQ 1QVGA 1N9WA 1W2BA 3BZCA 4DV2Q 4GOPB 3GDEA 4JBMA 4XTCS 2JA5H 1X6OA 5IP9H 2R92H 4DV4L 4BXXG 1G291 4A3CH 1I94L 1JJ2A 4A4IA 5IP7H 3KJOA 3KF6A 1KAWA 4A76A 5C4XG 4OO1I 4A3BG 3RZOH 3I2ZA 2ES2A 2JA6G 4GLAC 4JOIC 5ELOA 2HQLA 2MFIA 4GLXA 4B3SL 2EIFA 2OQKA 3HOVG 1SR3A 3OW2A 1K9MC 3PUVA 1W3SA 4DUYL 1XNRQ 3BJUA 4LF4L 2AMCB 1M90C 1HNXL 1AE3A 2HIXA 3PUWA 4QIWE 1HR0Q 3PSIA 3CC2A 4DV5Q 4LFBL 1UWVA 3ZJYC 5GAGC 3S14H 4BBSG 4L5SA 1BBWA 3S1NH 2K5VA 4R1JA 2JA6H 4A3KH 1YBYA 4A3EG 4OX9Q 2WB1E 1N32L 4DKAC 2HHHL 2E2HH 3CC4A 1NMFA 2ASBA 1Q1EA 3BU2A 2PNHA 2HHHQ 2K5HA 2IHFA 4KHZA 4LUZA 1UE1A 4XIGS 5GAHC 2UUBQ 1E3PA 2WFWA 4DV3L 1CKNB 3A0JA 2KHJA 1P16A 2N78A 3HOWG 4IFDI 5M3MG 1YIJA 4LF6Q 3NENA 4LFCQ 4GKKQ 1HNWL 1L1OB 5E7NA 5AJ3Q 1YHQA 1L1OA 4UP8A 2I0QA 2F4VL 3A5ZB 3G6EA 1DGSA 1XJVA 4HIMA 1MJEA 1NY4A 1X9NA 4BY1G 4JI8L 1SN8A 3STBC 1PHJA 2Q2TA 3UE1A 4NXMQ 3J80c 4R4IA 4JI2Q 2JA8H 3PCOB 3S17H 1CUKA 5IYBH 1YJNA 2N3SA 5JEAJ 1EIFA 4POFA 4P74A 2ZTEA 3K80C 2K75A 5LMNQ 1TWAH 1VQPA 3J81i 3AQQA 1VQEA 3HKZG 3CMAA 2UUCL 3A5UA 3MXNB 1PH1A 1MKHA 3KOJA 5C0XJ 5IYCH 1WYDA 4A3BH 1ASYA 4FDBA 5JJKA 1E7ZA 2B63G 3M9BA 1X3EA 2CKZB 2AWOA 4X64L 2R93H 1KC8C 4NXNQ 3M7NA 2JQOA 3F1ZA 1N32Q 3WWVA 1K0RA 1U5KA 3FP9A 3E9HA 1OXXK 4NPSA 3CP0A 2ZM6Q 4DV6L 1I94Q 2WAQE 1N34L 3F2BA 5FLXc 4JI3L 4JI4L 3HOYG 4DV6Q 1JT8A 1HR0L 3PUYA 2VS1A 1VQIA 4BBRH 1Z47A 2NN6I 2F3IA 4WJ4A 3W5OA 4POGA 5HGQA 1Q12A 3FKIG 4A3JH 4HIOA 4YHHQ 1X54A 1XPRA 4RG1A 4DV0Q 4HJ8A 4JBWA 4YY3L 1PH4A 4A75A 2UU9L 5C0XI 1VQ5A 4JI2L 5GQOA 2YYZA 4BY7G 1IBKQ 1L2FA 4B3MQ 1I5FA 1QVCA 4JV5L 4JI4Q 3F8TA 1EUJA 1VQ7A 4JYAL 4PZ8A 2JA8G 2MO1A 1TWCH 4QL5A 3HOUH 5IYBG 5C3EG 3DLLA 2EXDA 3CCMA 4LUVA 1J5EL 2NN6G 1KL9A 5IT9c 4DR4L 4YCUA 1FVIA 5M5YH 2JA9A 1BKBA 2K5NA 4JI8Q 3GTJH 3TRZA 2CWAA 3EBEA 1XPOA 3CCLA 3KJPA 1PH8A 4GN3B 2NVTH 3AEVA 4GLVB 2V1CC 2VQFL 1WCMG 4JI3Q 4A3LG 4LF9L 1Y1WH 3E0EA 4JI1Q 3I4MG 3D31A 4JV5Q 2R93G 3KDFA 4JCVE 3UDXA 4LFAL 5LMNW 4DR6L 1B70B 1WI5A 4KLKA 3Q8DA 2R7ZG 1LM0A 1D7QA 1UE5A 1M1KC 4UPAA 5AJ3L 4P75A 3GTPH 1XMQL 1TXYA 4JI0Q 3T1HQ 2GN5A 4LF5Q 4A3CG 3JC66 4DR1L 1HNXQ 4P72A 3OYYA 4YWLA 2F52A 2Z0SA 4TQUS 3RLOA 4DV7Q 3K7UC 3H15A 3CCQA 4DV4Q 2GVAA 2XTIA 3M3YH 4K0KL 4MNOA 2BH8A 3CCRA 2BA1A 4IFDJ 4OX9L 1EWIA 1U0LA 3ULJA 5M5XH 1NJIC 3UE0A 4HJAA 3M4OH 4A3JG 1QVFA 3AFPA 2VUMG 1MIUA 4UP9A 4YCWA 1IBML 2ZM6L 1VQBA 1K8AC 2NVYH 1KD1C 1IZ6A
chains in the Genus database with same CATH superfamily
2JYOA 5C0XG 4BY7H 2ID0A 3CPWA 4J15A 1X56A 3K8AA 2O4XA 1Y1WB 1SNCA 5I2XA 2ALYB 1PZJD 4GOPA 1MGSA 4APVA 2B2UA 5IP7G 2A8VA 1STGA 1HFGA 5IGBA 4DV3Q 3VDYA 1D1IA 3DWAA 1JOKA 3I90A 4ME3A 1JORA 3D4DA 3GV6A 2A69C 2VQEL 5BN4A 2Q2IA 4BBSH 3KF6B 3P20A 1K8MA 3R2IA 1XWEA 2R7ZH 3B6YA 3CD6A 3I7FA 1HNZQ 1QUQA 1ICFB 2F0QA 1QUQB 2F0MA 4KTAA 2PMZB 1BDOA 1GHKA 2ES2A 5IY0A 2VY3A 1GM5A 1TS5A 1CK1A 2XRQD 1GHJA 2MHVA 5A2QL 3ULPA 1XMOL 3T1YL 4MZ9A 5EPJA 5C44H 2VB2X 2B2VA 3D0FA 2JE6I 4ULLA 5DLQE 4A93H 1GUOA 1I4PA 5KYLA 4EVOA 4DR2Q 1KDBA 2L4NA 4C3IB 1CSQA 1YNJC 4DAMA 2VQFQ 1GVPA 2D5DA 1HQMC 3VR5A 1PH9A 1H9SB 1WCMB 1CZGA 3C1FA 2PZTA 1VQKA 5KGUA 1JJCB 4ALPA 4LF5L 1OXUA 3I73A 2F0HA 2H1EA 3KFUA 4OONA 2L11A 2VQEQ 1HFNA 5CV7A 5L37A 4DR3Q 1TS4A 4XDXA 4R4OA 3L3OC 2IX1A 1Z9FA 3L7ZC 1Q46A 3T1HL 1K0SA 5BR8Q 1RL2A 5C3EB 3H0GG 4OO1G 2KHIA 3SGIA 4IFDG 2YTXA 5IGFA 5M3FH 1MD2D 3NQTA 3A8KE 4DV1Q 1QZGA 4A3EH 1QILA 1IYJB 3MA2B 3HOWH 3EVQA 3BVMA 1GO3E 1SNMA 3OTOQ 2JA7B 1WOCA 4C3HG 4CDFC 2CWPA 1TWGB 1QJOA 4IPGA 4DAYB 3GTKB 4QY7A 3S16H 2IHEA 4X66Q 5FK9C 1NR2A 2YTVA 3MC0B 2NWGA 4J8QA 3HOXH 4O2DA 3PIO3 2EY2A 4JI6Q 3RR5A 3E9IA 5GROA 1KAAA 1DJRD 1BCPB 1DZ1A 1YITA 5IT9E 3K7AB 1S5FD 2UXBQ 1TS2A 4NMZA 2HIVA 3MEFA 2RHSB 3M85A 1FJGQ 4J6HA 1U4MA 4AYBE 5LL6X 1RD9D 5KYIA 1UE7A 4LWCA 1VQ9A 1PTOH 5FJ8G 4DV1L 4HN7A 3C1EA 3HOVH 1Y1VB 2BA0A 1JE5A 1EYDA 2SEBD 1MBYA 4JBJA 4DR6Q 1Q86C 1PDQA 1NUCA 2A5HA 4JYAQ 1Q1BA 4A3IH 5IYDH 1FJGL 4YWMA 4KD3A 3NE5B 1GD7A 1GUWA 3AYHB 2KEDA 3HKSA 1A3UA 4CDDC 1VQ8A 3SK8A 4RHSA 3CPFA 3IFTA 5FLMG 3UDIA 3I4NB 1L0XB 2DJGC 3VYUA 1LTTD 1X3GA 1OXTA 2E8GA 3S9WA 5GAEC 4MTKA 2B2WC 1PH3A 3VA5A 5C5LA 5JEAG 4NXML 1HZCA 3J81c 1XTCD 1HUNA 5C4JH 2PW7A 3PIP3 1ET9A 1FD7D 1E2VA 5DNFA 3NELA 3I4MH 1SXTA 2B2TC 3PO2B 3GTKH 1WCMH 1DOLA 1BCPF 4PG3A 1SRUA 3X3MA 1PRTC 2Z6BA 2FXQA 2ZJRA 4DA2A 1PYWD 2D62A 5E4WC 1M8AA 3TDQA 4RGOS 3QR8A 1WTXA 1G2SA 2I46A 2Q8IB 1VQJA 2K4KA 1J8IA 1LUZA 4IFDH 3GTQH 1K3BC 4RH6A 4GKJQ 3NTIA 2UXCL 5FO9B 5KNBA 2F0JA 3ONAB 2RQXA 2AUKA 1EY0A 3NBHA 3MFGA 4Y7NH 4ODGA 3SR1A 1GUSA 2D0OA 3CHBD 4C1NI 3KK7A 1SYBA 4HMJA 2FFKB 1C7YA 3I70A 2YU9H 4A93B 4YWKA 4A3MG 1M4VA 1YNNC 2H4OA 3RLFA 4GKJL 2NZOA 5M5WB 3DWQA 3HOWB 1RTNA 4TVAB 4LF8L 4PMBA 1B3AA 2N8NA 2JA5G 2HUGA 4QB4A 4QJFA 3CAMA 3ULLA 4YCVA 1UE6A 2IX0A 1EY9A 2L9HA 2ATWA 4DR7L 1GJXA 1PZKD 1AE2A 2R92B 4K0KQ 4QCLA 3RN5A 4WFN3 3GTMH 2UXDL 2QA4A 1VQ6A 3K57A 1G6PA 5CGKA 2EPBA 1TWCB 1SYDA 2JA7H 3DEOA 1I3QH 4KY6A 2O2LD 1MI2A 1EQRA 1IYUA 4C3JG 3QIAA 1VDZA 2RDHA 3U9OA 3HOUG 3J7AV 3GTPB 2KCCA 2KBNA 2IPKD 3CCJA 4RAUC 2IJ0A 3H3VI 3HOZG 1CQVA 2HQEA 3W3AA 4LF7L 3R2TA 1S72A 1ICWA 1FGUA 1RDPD 1SE2A 2ZTDA 2FHTA 4HR7B 3I56A 4UY8C 4A3FH 4B3TQ 3FKIB 3BZCA 4GOPB 1NSNS 2MPMA 4XTCS 3AMUA 1S5BD 5C4XG 1Q8IA 4OO1I 3RZOH 3I2ZA 1TR5A 5ELOA 2MFIA 3HOVG 2EIFA 4F7XA 3OW2A 1F9QA 4LF4L 3OWEB 1EY7A 4QIWE 1ZXTA 1I3QB 3GQBA 2DY7A 2L0CA 3QOJA 3S1NH 2JA6H 4A3KH 2JSOA 4A3EG 4DK0A 4DKAC 3X3NA 2PNHA 2HHHQ 4JPBW 5T1IA 5KRUA 5GAHC 2KUMA 1EY8A 1NR4A 3TSSA 4LF6Q 4LFCQ 1L1OB 1YNND 1L1OA 2F4VL 1DGSA 1XJVA 2QF7A 1SDFA 1NAPA 4H7BA 2AQ1B 4DAVA 2ICIA 2Q2TA 3BZDB 2E2HB 4R4IA 1ILQA 3S17H 2X6LA 2N3SA 4P74A 2ZTEA 3K80C 3S14B 2WACA 3J81i 4ZKBB 2VUMB 1UAPA 2TMPA 2KOLA 2UUCL 1CM9A 2RA4A 2N55A 1ASYA 2B63G 2CKZB 3EROA 3M7NA 3T56B 2X69A 2JQOA 3SDZA 1N32Q 2VB3X 4IALA 3WWVA 1EQVA 4NPSA 3RD4A 2ZM6Q 1TY0A 4NP5A 4DV6Q 4PNYA 1VQIA 4OGQC 2K33A 4HIOA 4G4KA 1GUNA 3MXNA 1KDCA 4N8FA 4DV0Q 4CKBA 4YY3L 2QDBA 4A75A 5C0XI 2LFNA 3KBGA 4B3MQ 4KHVA 4JI4Q 1EUJA 2KA7A 2Q8RE 5IYBG 3OHXC 1BBXC 4A3JB 1FR3A 5E3FA 5C3XA 5IT9c 4DR4L 2F0IA 2HCIA 2JA9A 2K5NA 1W6KA 3KLSX 2CWAA 3KJPA 2F0KA 1PH8A 4FP5D 3AEVA 4GLVB 1II3A 3S1MB 1B44D 1S5ED 3E6ZX 4A3LG 3E0EA 1TU2B 5HURA 3O13A 2R7ZG 1LM0A 1M1KC 5AJ3L 3GTPH 5J22A 4A3CG 4DR1L 4XYOA 1HNXQ 4P72A 2HDLA 3HRZC 2F52A 3WOEA 4TQUS 5I6WA 3H15A 2BOSA 4K6DA 4MNOA 5TSSA 3D8GA 1EWIA 1U0LA 4UHVA 5CV9A 3A7LA 4CJ1B 5M5XH 4UDUC 1L0YB 1QVFA 3NP8A 4UP9A 4H0LC 2ZM6L 1VQBA 1Q3LA 4LF4Q 3OIQA 1KD1C 3EQLC 2J4XA 2OQ0A 4DR1Q 4ZQ3A 1EY4A 3NTKA 4K5VA 3PUXA 1CQFA 2K5QA 2E5LQ 2R93B 3UDGA 4O0AA 2RSNA 5C4XH 4BA2I 2FMMA 3CQZH 3NQIA 2PZUA 2LSSA 3W2DA 3S1QB 3HOXB 4KMUC 3GD7A 3CRLC 1VQDA 2E2JB 4OWWB 2KECA 4IJLA 1TWGH 5IWAQ 4A3LH 1V8QA 1FYCA 1QNUA 2A68D 4CHTB 4UP7A 1EQTA 2EE1A 2N88A 3PF5A 5M3MB 5I9OA 2CW0C 2E5LL 5C4HA 1OTCA 4JI1L 4KKUA 2O5JC 4RKBA 4OXPA 2PYKA 3TS0A 4HMIA 1XNQL 1JE4A 3CCVA 1F2YA 2E2IH 5T1GA 1BXTA 1HR0W 1H95A 5GADC 1HCZA 5IGCA 2YV5A 1O7ZA 2F0GA 4DXGA 4B3ML 3KLWA 2IW3A 4K8IA 2B2VC 1KXLA 3J80E 2OCEA 4HAEA 2E75C 4JI7L 2B29A 1PVOA 1SMYD 4B3TL 5IGDA 3GP7A 5J39A 3TN2A 3MFYA 1YJ9A 4BXXH 2CQAA 2UUBL 3DUZA 4LUOA 3S16B 1I4XA 3TBIB 4G7ZC 2PW5A 3JAMi 2X6GA 2L15A 1ZKOA 3S1RH 2K1BA 1DOKA 1TWAB 4TSSA 2UU9Q 2F3WA 2DNEA 4FXDA 1B2TA 1T9HA 5EKIA 1IBKL 1DM0B 2KCNA 2JP1A 2R3ZA 3J7AF 4B3RL 2ZJPA 1LTSD 1DOMA 4LF7Q 2MO0A 4LF8Q 2PMZE 4DR5L 1YI2A 4DU9A 4DPGA 1Z7TA 2LY7A 2EYOA 4GKKL 1PYBA 2QKIC 1HNWQ 1C0AA 1HXYD 1B3QA 4RGTA 4C1NK 3S24A 3HS0C 1VQOA 4JI5L 5CYUA 3SVMA 4ZUIA 5LMNL 4GOPC 2Z1CA 3PGZA 4AQYQ 1LT4D 1SNQA 3ITPA 1PV4A 1RIPA 4Y52H 2E2IB 4U673 3KYHC 5JEAH 4WJ3M 2RCNA 4DNRB 4GN5A 3STBD 3NBHB 2K04A 1ENAA 3N52A 1IXRA 4LFBQ 1P8LA 1K3RA 2L5TA 3NEMA 4DNIA 2B8FA 2RDGA 4DR2L 1X3QA 2PQEA 2WB1B 4XT1B 1SFOH 1YJWA 1X55A 2DJFC 3HGBA 4A3GH 1CKOA 2F03A 3BVGA 3W1BA 2NTTA 5H1SE 1E2ZA 3BG3A 5KNDA 1Y8OB 4P71A 1NTGA 2R92H 4R4TA 5IOCA 3ER0A 2N49A 3H94A 1VMCA 2NYZD 1VQCA 1UEBA 1H9RA 3HP3A 3HFZB 5M3MH 4L5RC 4R8NA 1GOZA 1PXUA 1R4PB 1ENFA 2QGQA 1F9RA 4AH6A 3NSWA 1I50B 4BY1H 1AEXA 1EQQA 4GN4B 2RCFA 4A3MH 5FLMH 3CCEA 1QOHA 2CVRA 4NXNL 1O7LA 2NVXH 3PUZA 2UXDQ 5FJ8H 1EOTA 3TS2A 5EJWA 2H5XA 1A8VA 2V4DA 3MAQA 2PQAA 4S3SA 4ABNA 1V1OA 4RWSC 2JK8A 1FNUA 1KQSA 4DAYA 2RKSA 1G51A 4DV0L 3S15B 1C8CA 5IE8A 4P2CB 3NK9A 3R3OA 1FNWA 1STNA 1SYCA 1KLGD 5CC4A 4MHEA 2A1AA 1YEZA 2RSOA 2F0SA 4FO2A 1C9OA 1D1KA 1PFSA 1CKMA 2P5ZX 5JVH3 2HT1A 1L1OC 3RZOB 4BBSB 4AQYL 1B53A 2K6AA 2Z9HA 1YNJD 1VQHA 4AIMA 4R4QA 4EQNA 1TS3A 2K14A 1B7YB 2EXZA 1U9RA 2BH2A 1JICA 2UXCQ 1TY2A 1CTMA 3OMCA 1YHBA 1OXVA 2XRSD 4XQNA 2UXBL 5FLXL 3EN2A 3TEHB 1YHAA 2EYHA 3M4QA 4K8JA 1UEAB 2RF4A 2PO4A 1YNXA 5EBCA 5K36G 5JOBA 5IIFA 2NVYB 4HIDA 1IYVA 1SLJA 1HTPA 4IO9A 4MTNA 1BCPC 4BY1B 3T51B 2A69D 1E1OA 1LTLA 1T5EA 2NVXB 3J80i 2PI2A 2CFMA 4EQ5A 1IBLQ 1X3FA 1A3VA 1E1TA 2R7ZB 4LJZC 1VQNA 4GNXC 3MXGA 4EGVA 4ZK9B 1HA6A 4L5TA 3F2CA 3D6CA 4X3SA 3ND8A 1VQGA 1K8GA 1E24A 3MEHA 2JXMB 2K03A 1HPCA 1LLRD 1EFID 4X65L 1EYAA 3LGJA 2TSSA 3TZDA 3JAME 1DYQA 1PTOD 3I55A 4M1UB 1R4QB 1QVGA 1N9WA 2BE5D 4OIJA 4DV2Q 4JBMA 3GTOB 3HOYB 1BO0A 1G291 1I94L 5IP7H 3KJOA 4G7OC 4A3BG 3NUCA 2JA6G 2Z4IA 4JOIC 1EZ8A 2HQLA 2OQKA 1AP0A 3KLRA 4KK7A 1XNRQ 1M90C 1AE3A 1GUGA 4ME5A 4QUCA 1H9MA 5GAGC 3ZJYC 4MN3A 3WDNA 1D5MC 3H91A 2K5VA 3Q23A 1LT3D 4OX9Q 4ZCKA 3NWTA 2ASBA 2IHFA 5C5MA 1UE1A 4XIGS 1IKLA 1CKNB 3A0JA 2KHJA 3HOWG 2N78A 1LTID 4JVZA 5M3MG 4GKKQ 1HNWL 2WIIB 3K59A 1SEBD 3TP5A 3A5ZB 5JPNC 3SHLA 3I4MB 5NUCA 1U4RA 4HCSA 2F4IA 2F0NA 1PHJA 2F3VA 1FNVA 1AZQA 5KEEA 1LTAD 3J80c 1VMPA 3SK5A 4KD4A 3CKIB 3URYA 3I8ZA 5LMNQ 2K75A 3P7JA 1F2MA 1SYEA 1XYIA 3LNNA 2D2CC 3AQQA 3CU7A 2ZXOA 3HKZG 2C9OA 3A5UA 3P1HA 1EYCA 3MXNB 1PH1A 4KKSA 5IYCH 5JJKA 5D65A 3M9BA 4X64L 2YU9B 2NBFA 1RJTA 4OHJA 3F1ZA 2EYFA 1K0RA 1AN8A 1U5KA 3FP9A 1EEFD 3CP0A 1I94Q 4DV6L 4F88A 1HR0L 2K5DA 4BBRH 4RKLA 1SE4A 4WJ4A 3W5OA 1KTKA 1Z6HA 4CDCC 3IKJA 1EIHA 5EPKA 1X54A 2M9VA 1XPRA 2ICEC 3EA6A 4RG1A 4JBWA 1PH4A 3PO3B 4YIJA 5FKAC 5GQOA 3H3VC 2AUJD 1IBKQ 1L2FA 5CBAE 4JV5L 2JA8G 5EKKA 4QL5A 2NZ1D 4LUVA 1JR0D 1KL9A 5IT9L 5M5YH 1FVIA 3GTJH 1TWHB 3GTQB 2B2YA 4H13C 5BN3A 3CCLA 3OPOA 2NVTH 1TQOA 2Y0SB 3F2UA 1Y1WH 4JV5Q 1XXGA 2R93G 3AB9A 3KDFA 4JCVE 4F8MA 2XSCA 2XN9C 3CRKC 4KLKA 3RMHA 4DR6L 4Y7NB 1F77A 4JI0Q 4IN3A 3JC66 3OYYA 3QOLA 4CKCA 3N6RA 3RLOA 4DV7Q 3FVQA 5C4JB 3CCQA 1WTVA 2GVAA 2XTIA 4K0KL 2BH8A 3M7GA 5CV6A 3CCRA 3HOVB 4XQJA 2EDGA 1PLFA 3AFPA 1LTRD 1MIUA 3PQIA 1IZ6A 3R93A 3ND9A 2JEAI 3HEJA 3H3VH 1UNSA 2ZXRA 1PH5A 3CCUA 4QIWB 2I5LX 2PNRC 3NHHA 1PFMA 1SJHD 2BCOA 4HEDA 1JMCA 3FRPB 1A2UA 1N33Q 2EYLA 1RODA 3FMCA 1KRSA 1VF7A 4B9WA 4L6TB 4IPCA 4RGNA 2CHBD 4IZ8A 2E76C 1E2WA 3VYSA 4JC0A 3I4NH 3ERQA 1WTPA 1N33L 3P75A 4QMGA 4QF4A 2NVQH 5C6AA 2K52A 1Y69U 4DR5Q 2BE5C 1D8LA 4BS9A 3BS1A 4JG2A 4HJ9A 5ELNA 1YVCA 5IYCG 1XNQQ 2RHQB 2CQOA 2VUMH 4K14A 5IYDG 4KI0A 3GTLB 1Y8NB 1ML0D 2I5MX 1PA6A 3S17B 1LACA 4HJ7A 2YTYA 3S1QH 1DCZA 1MJCA 1SJED 4EQPA 4QGUA 1LT5D 2B2UC 3J7ZC 3RLNA 3S2HH 1K83B 4IURA 2PZWA 2I5HA 1VF5C 2EOTA 4PZ7A 1SE8A 4WJWA 1HZ9A 4IOCA 4DR4Q 3GO5A 4BBRB 1VQFA 4H02A 5CV8A 4XQQA 2J0TD 3ERSX 1PTOF 3I3CA 3MXPA 4A3FG 2XVSA 3PMFA 4FVMA 3M4YA 1B50A 5M3FB 3V05A 3F2DA 1STHA 1CHQD 2QDLA 4OWTB 4OWXB 4C3IH 2MJ8A 4B3SQ 4DK6C 1U4LA 3SK4A 5C3EH 4RMFA 1Y1WG 4P73A 4B9XA 1N36L 2KQ3A 1JCKB 1PFBA 5G3LF 5I2YA 2MNAA 5HY6A 5BR8L 1GKHA 3G4SA 2EY6A 1HQRD 1QWYA 2WAQB 2WP8J 1KNEA 5KNCA 1EU3A 1N8RC 4B3RQ 4DR7Q 1CA6A 4A3IG 1HZBA 4KHPL 1I50H 3BDCA 3GTJB 5IODA 1B1ZA 4X65Q 3PO2G 5G3LD 1JB7A 1D5ZC 4N9PA 1AH9A 4BA1I 4FXKC 4HIKA 2WB1G 2KHSA 3Q22A 2UUAQ 3CXCA 5I4DA 3A74A 1RF2D 3G71A 1RHPA 1Q8KA 4LAAA 1HTLD 1BQQT 1X32A 1A6XA 1WTQA 2R6GA 1TT2A 3S15H 1PMRA 4KJNA 5JJIA 2KCMA 5ISRA 2Z8LA 4BY7B 3J7A5 4KN7C 1SYGA 2WINB 2NZHA 1HUMA 4C2MB 2B63H 3NTHA 5D3DA 4F87A 2F0PA 5CR3A 4IPDA 3HOYH 4XYQA 2A73B 3G7LA 2A6HD 4A3MB 2VNUD 1IBMQ 1V9PA 4KKTA 1PYSB 2B2WA 4LK1C 4K2LA 5DEHA 3DM1A 3FKIH 4RFBA 1IW7C 3EIVA 4GZYC 1CKNA 4DUZL 1V43A 3H0GB 1FL0A 1EWCA 1I6VC 1ENCA 1PH6A 1XNRL 5E4XA 3M4OB 2DGYA 4DV5L 3DEPA 1WD1A 4IUTA 4AYBG 2CH4W 2IT1A 1J5EQ 4A3GB 4G7HC 1SSOA 2LKVA 5ELCA 1O7IA 4DAPA 1SNDA 2EY1A 1DD2A 2GVBA 2OTLA 3Q6SA 4NW2A 1RCVD 5BN5A 2F0TA 1WD0A 5A35A 4DR3L 4FYDA 4QUFA 3M4PA 3BYYB 4RHRA 5FO8B 4LF9Q 1XMOQ 5DM63 1TWFH 4NB3A 1STAA 4DUYQ 2K7VA 2K50A 5K36H 1A2TA 2NTSA 3UDFA 4JI0L 1CZWA 1KDAA 5C44G 2LXJA 3CC7A 3DMUA 1KHIA 1HNZL 2BDOA 1Q82C 2ZT9C 4OIKA 4FF2A 2LMCB 3V2TA 3U4VA 1J6QA 3FPUB 2F1MA 1V1QA 1EIYB 2F4VQ 1KIXA 1B4OA 2G9HD 1C4QA 3WOFA 2Q2HA 1VCIA 2HCCA 3HZXA 1LABA 3HOZH 1OO9B 1R9TH 4X66L 5KIXA 4X62L 1IW7D 3K81C 3K5NA 2FMCA 4FXGC 2OWOA 1Q90A 5HGTA 3GTLH 1GXDC 3KF8B 1F9SA 2EYJA 3T53B 1EFWA 3PO3G 3IAYA 3BVZA 3JAMc 4N8X1 1IL8A 2K32A 1V1PA 2VW9A 2EJFC 3S2HB 2R7DA 2VXWA 5J1ZA 1VQMA 3TQYA 3K6OA 1TWHH 4A3DG 5LMUL 4QQBX 1CA5A 5M5YB 1HA5A 1F9PA 2SNSA 5CMDA 4DK1A 3GTGH 2F0EA 2AHOB 1NBWA 1BOSA 1LYLA 2SNMA 4PMWA 2JN4A 2KCTA 3CQZB 2CCZA 5EAYA 2EQSA 1EEID 1BNZA 3QG1A 4DUZQ 2DUDA 5AFWA 3HOXG 1PTOB 4JOIA 3HKZE 4ZYSA 1QG7A 1I4RA 2AWNA 2EYMA 1WTOA 3AU7A 2OTJA 3W1GA 3Q0AA 1HH2P 3CF5A 4RA8A 5IWAL 1RKNA 2F0VA 2NVTB 5CBEE 1VQ4A 4OELB 1W2BA 3K58A 4RGMA 1LTGD 3GDEA 1X6OA 3DWPA 3D4RA 4A3KB 3OIPA 4A3CH 4A4IA 3KF6A 4L63B 4GLAC 4B3SL 5EKLA 5IGGA 1STEA 4TKOB 2AMCB 2HIXA 3PUWA 1HR0Q 3CC2A 3PSIA 1ONLA 4DV5Q 3H6MA 4LFBL 3S14H 2A6EC 1AZPA 1BBWA 4CBVA 4R1JA 2G9DA 2JA5B 3D6WA 2WKCA 2I07B 2HHHL 3CC4A 1F2LA 3BU2A 4NDXA 3BDOA 5IGEA 2K5HA 4I65A 4K6LA 4KHZA 1E3PA 2WFWA 4FF4A 3V96A 4X3UA 4V190 4IFDI 3NENA 4C56C 4HTHA 5AJ3Q 4UP8A 3C46A 1A15A 3L9AX 1MJEA 5FOBB 2EJGC 1LV9A 1NY4A 2CH4A 5JJZA 2B2YC 5ELBA 3STBC 3UE1A 4NXMQ 4JI2Q 1CUKA 5IYBH 5JEAJ 1EIFA 1CHPD 1TWAH 3S1RB 3C2PA 3HOUB 4MIUA 1VQEA 5DAUA 3CMAA 5K5PA 4CDEC 4C3JB 1MKHA 4A3BH 1WYDA 1E0BA 1LT6D 3QWNA 1E7ZA 1X3PA 4DXFA 3E0JA 3HOZB 3UI2A 3D3RA 1G8ZD 1OXXK 1IKMA 2EY5A 2WAQE 1F2ZA 5FLXc 3A8IE 1J9OA 3MXUA 4JI3L 2VS1A 2KVMA 5C4XB 5HGQA 3FKIG 4A3JH 3MHBA 4U68A 2M00A 2OF1A 4HJ8A 2UU9L 4JW0A 5LL6S 1VQ5A 5JVG3 1KLUD 3VR2A 5JAVA 4A3BB 3VA7A 5I9PA 3I91A 1SYFA 3F8TA 1EZ6A 1BUVT 2RBMA 4DNTB 4JYAL 2MO1A 5CORA 3HOUH 5M5XB 3D4WA 3CCMA 3LX0A 1J5EL 2NN6G 4X3KA 1JOQA 4JI8Q 1BKBA 3A55A 4EQOA 2QCPX 1XPOA 2KJXA 4GN3B 2V1CC 2VQFL 1WCMG 4JI3Q 4LF9L 1DONA 1CFMA 4JI1Q 2A6ED 3OW7A 4KV6A 3UDXA 5LMNW 1D7QA 1WI5A 2WV6D 3MWYW 1UE5A 3HG9A 1XMQL 1TXYA 1HRJA 3QB3A 3JAML 4LF5Q 2E2DC 4C3HB 4YWLA 2Z0SA 3Q24A 3K7UC 2BA1A 3E5SA 5C3WA 3ULJA 5JPMC 4E6IA 1NJIC 4HJAA 3GTGB 2VUMG 3A8JE 3OOCA 2M2LA 4KN4C 2QW7A 3OTOL 2A6HC 4CKEA 2QEXA 1ZEQX 4X6AH 1BCPD 4N9TA 3RUZA 1AW7A 4CGYB 3NXWA 3TREA 2B2TA 1X65A 1DXMA 4IOAA 3FEWX 1SMXA 3PIPA 1O78A 4IQZA 3J81L 1Y1VG 5EGTA 4K2KA 1D2BA 1A3TA 3MTSA 1QNKA 2F0UA 1IBLL 2XWBB 3IRBA 2PI2E 4A3DH 5EPLA 5M3FG 4KHPQ 3HKZB 4LNQA 3I72A 2AQ3B 4IUNA 3K7AH 4PV1C 2B39A 3I4NG 1PZID 1STYA 2G5DA 2NB0A 2QEJC 2E2JH 1CI3M 1MSHA 5CV5A 2JA8B 3BYTB 5C4ZA 1HZAA 4X62Q 1EU4A 3K0XA 3KUPA 2Z4HA 3KLSA 1SAPA 2EJMA 2NUCA 2KEEA 2WAQG 2RDFA 1PRTB 1Q81C 2SDFA 3EFXD 4A3IB 2VZAA 4LW1A 3J7YW 2XNAC 1IL2A 1Y1VH 3KF8A 4KJOA 1G6ZA 4R4CA 3S1NB 1H9KA 1QE6A 3M3YB 1JC7A 1K73C 4GNXB 3PF4A 3K5LA 3CMEA 1G91A 4WORA 1D5XC 2JEBI 3PO2H 1JB3A 1S3OA 4CJ0B 1ESFA 3DXJC 4C3IG 2ZXPA 2OXPA 2WKDA 2XGTA 4YY3Q 2Y0SG 4PZ6A 2AKWB 3VYRA 3S1MH 1EOVA 4DV7L 3OWFA 4A93G 2D9UA 2LS01 1WJJA 4UAIA 3RZDH 4H44C 1SFOB 4IPHA 1NE3A 2XWJB 1XPUA 1TWFB 5LMUQ 2K01A 1E22A 1N36Q 2Z6KA 2PQAB 3R8BA 1EY5A 3QJYA 4FNFA 1BBUA 3RNUA 1VS0A 4DN4M 1I4GA 1LTBD 1RTOA 3DM3A 3SXHA 2IWHA 3SEBA 4O1NA 1PFNA 2ZTCA 2VL6A 1I4QA 2DY8A 4EX5A 1BVSA 1PRTF 2CW0D 2D0PA 1I6HB 2RVLA 3MVVA 3OSOA 5COYA 3FDTA 2B8GA 2C35B 2K05A 3H0GH 4O42A 4OO1H 1PTOC 5IP9G 1R9TB 2PPBC 4GS3A 1G2TA 1SMYC 4I7AA 1HJPA 3KDFB 1K83H 2KENA 4HSVA 1QZHA 3CCSA 2FJ2A 1N34Q 2HDMA 2UUCQ 3DHQA 4LFCL 4LF6L 1A62A 3ICEA 2MUYA 5M5WH 4TRDA 3L2PA 4OEMB 1WTRA 4XT3B 4BBRG 2L1BA 4JI6L 5EQ0A 3C3LA 3TZUA 3FHWA 2LXKA 1EL0A 4YHHL 1PH2A 1ASZA 4C3HH 1IHZA 1UUPA 4R9WA 2NVQB 2A19A 2MP1A 5C44B 1CSPA 3T16A 1GUTA 1H9SA 1MSGA 3U58A 2Y0SE 3SK6A 4ZKCB 4JBKA 5DM73 4Q5VA 4IJHA 3T1YQ 1SROA 3J81j 1Q7YC 1TKWB 3TP7A 2EZVA 3J81E 1JJGA 2E74C 4L5QA 5D3IB 5ELFA 5FO7B 3GTMB 3T4AC 5F2DA 1KRTA 1I4HA 1K28A 3S2DH 3PO3H 2PCFB 2MQHA 1Y14B 4LFAQ 3CW2C 4DGZA 2GA4B 3BZKA 4XXEA 2K5WA 5J3BA 1W6JA 2O5IC 1A0IA 5E1FA 1VQLA 1WFQA 1PH7A 1OXSC 2Q2UA 5FLXE 1YZ6A 1B8AA 3VR3A 3AFQA 1A63A 4KY7A 4C3JH 1O7YA 1SE3A 3A54A 4HCEA 4IUQA 4PQXA 5C0XH 1D6EC 1SNOA 2UUAL 4JI7Q 4C2MH 2B63B 2F0FA 4JI5Q 1T5XD 4V0BA 1XTDA 4Z9CB 4M8AA 1B9MA 4DFAA 3G48A 3PIOA 1EYGA 4X64Q 2Z6KC 5EBDA 3PV0A 4B08A 3QO2A 2JA7G 3SE0A 2F0LA 3NWSA 1WVLA 1ZYRC 2JJQA 2ENBA 2IY5B 4Q0FA 5JJLA 1Y8PB 4FF3A 1L0WA 1SBBB 1S40A 1ET6A 2OT2A 3K5OA 1S5DD 4DF7A 2Q8TA 4A3KG 1MHWC 1NMGA 1S4ZA 1XMQQ 1KNAA 2OEOA 2R7FA 4KY5A 1O80A 2ZJQA 3U4ZA 4ID6A 1XX8A 3RN2A 4HJ5A 4DK3C 3TMEA 1JWSD 3OMGA 3K5MA 1LO5D 5ELDA 4A3GG 1BR9A 2QILA 4GNXA 1VQAA 3U50C 3L0OA 3LWUA 3I4OA 3IFDA 1B9NA 3K0YA 3GTOH 1U4PA 3RZDB 1I6HH 4ILWA 4DV2L 2R92G 2B3GA 2JA5H 5IP9H 4DV4L 4BXXG 1JJ2A 1PRTD 4A76A 1KAWA 1TIID 4CJ2C 3MZ5A 2IL8A 3H09A 4GLXA 2DN8A 1SR3A 3BDLA 3NBIA 1K9MC 3PUVA 1JWUD 1W3SA 4DUYL 3ZYYX 3BJUA 1HNXL 1UWVA 4ZLTF 4BBSG 4L5SA 5I6YA 3LWEA 1YBYA 2WB1E 3S2DB 1N32L 2E2HH 1NMFA 1BF4A 1Q1EA 2F0WA 2EYPA 4RCNA 5LHY1 2HD3A 1EWHA 5A2QE 4LUZA 3GV3A 2UUBQ 4DV3L 4RCOA 4K5XA 1P16A 2FINB 4JK1C 1YIJA 4G57A 4ZUJA 3VR4A 5E7NA 1YHQA 2I0QA 4IUVA 4LMQD 3G6EA 4HSPA 4IUPA 1FGBD 4HIMA 3A7AB 4I7ZC 3TP8A 1X9NA 4BY1G 3A56A 1SN8A 4JI8L 1JQYD 2IX3A 1H9JA 2JA8H 3PCOB 1JOOA 2AQ2B 1YJNA 4POFA 2A68C 1HHVA 1VQPA 5D14A 4OL7A 4PMCA 1ZYRD 4A3EB 3TP6A 2DNCA 3KOJA 5C0XJ 4L8JA 4FDBA 1X3EA 1C48A 2AWOA 4J1MA 2R93H 1KC8C 4NXNQ 4R8IA 1V1PB 2SOBA 3E9HA 1AFPA 1N34L 5ELEA 3F2BA 4JI4L 3HOYG 2F0DA 1JT8A 3PUYA 4BWGB 1TVXA 2J7ZA 1Z47A 2R61A 2NN6I 2F3IA 1CT1D 3NPPA 3J80L 4POGA 1Q12A 1QB5D 2BDNA 2JA6B 3KBXA 3T13A 3FPPA 4YHHQ 2F0OA 4WRDA 4A3DB 2EVBA 3E3XA 4FF1A 4JI2L 2YYZA 3IL8A 4IUUA 4BY7G 2L12A 1I5FA 1QVCA 1KABA 1S5CD 1VQ7A 4PZ8A 1SNPA 1TWCH 2K28A 5C3EG 3DLLA 2EXDA 2XIWA 1STBA 2A74C 4YCUA 3TRZA 3EBEA 1WTWA 1EIGA 4ZRZA 1JWMD 2C5CA 4ZAIA 3D31A 1NCVA 2NN6H 3I4MG 2MGSA 4LFAL 1B70B 3Q8DA 1WTHA 4UPAA 5M9OA 4P75A 3T1HQ 2GN5A 1EY6A 4X3TA 4DV4Q 3I4LA 3M3YH 3VR6A 3EJIA 4IFDJ 3VYTA 2L55A 4OX9L 1K8OA 1NNXA 1QCBD 3UE0A 3M4OH 4A3FB 4A3JG 5CV4A 4K5WA 4YCWA 1IBML 1ESRA 1ILPA 3G6JB 4NKLA 3U9SA 1K8AC 2NVYH 4AYBB
chains in the Genus database with same CATH topology
3OTOL 2QEXA 2OQ0A 2JEAI 5C0XG 4DR1Q 3H3VH 4X6AH 4BY7H 2ID0A 1PH5A 3CPWA 3CCUA 4J15A 1X56A 3K8AA 3PUXA 2I5LX 2ALYB 2E5LQ 1JMCA 3UDGA 4O0AA 1N33Q 4GOPA 3TREA 4APVA 1X65A 5C4XH 5IP7G 4BA2I 4IOAA 3CQZH 1SMXA 3PIPA 2A8VA 4DV3Q 2LSSA 3VDYA 1Y1VG 3GD7A 1KRSA 1VQDA 4ME3A 4OWWB 4IJLA 1TWGH 4IPCA 5IWAQ 4A3LH 4UP7A 2VQEL 3PF5A 2Q2IA 4BBSH 3KF6B 4JC0A 1IBLL 3I4NH 3IRBA 2E5LL 1N33L 2R7ZH 3B6YA 2PI2E 3CD6A 4A3DH 3I7FA 1HNZQ 2NVQH 2K52A 1OTCA 1QUQA 4DR5Q 4JI1L 1QUQB 1D8LA 4JG2A 4HJ9A 5IY0A 4OXPA 2VY3A 5M3FG 5ELNA 1YVCA 5IYCG 1GM5A 2RHQB 3TS0A 4LNQA 2CQOA 1XNQQ 5IYDG 2VUMH 4KI0A 3K7AH 3I4NG 2I5MX 1XNQL 2E2JH 3ULPA 3CCVA 1PA6A 1XMOL 3T1YL 2E2IH 4MZ9A 4HJ7A 2YTYA 3S1QH 5C44H 1HZAA 1MJCA 4X62Q 1HR0W 5GADC 3D0FA 1H95A 2JE6I 2YV5A 4QGUA 3J7ZC 5DLQE 3K0XA 3RLNA 4A93H 3S2HH 4DR2Q 1CSQA 2I5HA 4DAMA 2VQFQ 4B3ML 3KLWA 1GVPA 4PZ7A 1SE8A 2WAQG 1PH9A 1Q81C 1HZ9A 4IOCA 4DR4Q 3GO5A 2VZAA 1VQFA 1VQKA 4H02A 1JJCB 4ALPA 4LW1A 4LF5L 1OXUA 1KXLA 2OCEA 4JI7L 1Y1VH 3ERSX 4A3FG 4OONA 2B29A 1IL2A 4R4CA 2VQEQ 3KFUA 1PVOA 4B3TL 4DR3Q 3F2DA 1YJ9A 4OWTB 4OWXB 1K73C 4B3SQ 4C3IH 4BXXH 4R4OA 4DK6C 4GNXB 5C3EH 4RMFA 2IX1A 1Z9FA 3PF4A 2UUBL 3CMEA 3L7ZC 4LUOA 1Y1WG 1Q46A 4P73A 3T1HL 2JEBI 1N36L 5BR8Q 1RL2A 3JAMi 2L15A 3H0GG 2KHIA 3PO2H 2MNAA 1S3OA 4OO1G 5HY6A 3SGIA 5BR8L 4IFDG 1GKHA 3G4SA 2YTXA 3S1RH 2XGTA 4YY3Q 5M3FH 2UU9Q 2Y0SG 2WP8J 2AKWB 4PZ6A 4DV1Q 1EOVA 4DV7L 1T9HA 1QZGA 1N8RC 1IBKL 4DR7Q 4A3EH 4B3RQ 4A93G 4A3IG 1IYJB 1WJJA 1HZBA 3RZDH 3HOWH 2ZJPA 4B3RL 4KHPL 1I50H 1GO3E 4X65Q 2MO0A 1NE3A 4IPHA 4LF7Q 4LF8Q 3PO2G 2PMZE 4DR5L 3OTOQ 1JB7A 1XPUA 5LMUQ 1AH9A 1WOCA 4BA1I 1E22A 1YI2A 4DPGA 4HIKA 2Z6KA 2PQAB 1N36Q 2WB1G 2CWPA 4GKKL 1PYBA 1HNWQ 4IPGA 1C0AA 4DAYB 1BBUA 3CXCA 2UUAQ 3RNUA 4QY7A 3S24A 1VS0A 3A74A 3S16H 1VQOA 2IHEA 4JI5L 3DM3A 4X66Q 4LF4Q 2YTVA 3HOXH 3G71A 4O2DA 5LMNL 4GOPC 4AQYQ 1Q8KA 3PGZA 4JI6Q 3RR5A 3E9IA 1PV4A 1RIPA 5GROA 4Y52H 2ZTCA 3KYHC 1YITA 2VL6A 4WJ3M 2RCNA 2R6GA 4EX5A 2UXBQ 1BVSA 3S15H 2D0PA 4GN5A 3STBD 2KCMA 5JJIA 2HIVA 3NBHB 3MEFA 2RHSB 3M85A 1FJGQ 3J7A5 4AYBE 1IXRA 3H0GH 2C35B 4LFBQ 1P8LA 1K3RA 3NEMA 4DNIA 2NZHA 5IP9G 1UE7A 4LWCA 2B63H 1VQ9A 4GS3A 5FJ8G 4DV1L 4DR2L 1HJPA 3KDFB 1K83H 3HOVH 2BA0A 1JE5A 4IPDA 3HOYH 4JBJA 4DR6Q 1SFOH 2KENA 1YJWA 1Q86C 1QZHA 1X55A 4A3GH 2VNUD 3CCSA 1CKOA 1IBMQ 4JYAQ 1N34Q 1V9PA 2UUCQ 1Q1BA 4LFCL 4A3IH 4LF6L 1PYSB 5IYDH 3W1BA 1A62A 4YWMA 5M5WH 1FJGL 5H1SE 3ICEA 1GD7A 3L2PA 4BBRG 3AYHB 4P71A 4JI6L 3FKIH 3HKSA 1NTGA 3EIVA 3FHWA 2LXKA 4YHHL 4R4TA 1PH2A 1ASZA 1CKNA 3ER0A 4C3HH 1VQ8A 2N49A 4DUZL 1V43A 2A19A 1VQCA 1UEBA 3CPFA 1CSPA 3UDIA 5FLMG 3HFZB 5M3MH 4L5RC 3U58A 1FL0A 2Y0SE 1X3GA 1OXTA 2E8GA 1PH6A 1XNRL 4JBKA 4IJHA 3T1YQ 2QGQA 1SROA 2DGYA 4AH6A 3J81j 4DV5L 5GAEC 1Q7YC 1JJGA 4L5QA 4KHPQ 4BY1H 1PH3A 1EQQA 4AYBG 1J5EQ 2IT1A 4GN4B 5JEAG 4A3MH 1HZCA 5FLMH 3J81c 3CCEA 1O7IA 5C4JH 4NXML 1KRTA 4NXNL 2GVBA 2NVXH 3PUZA 2OTLA 3S2DH 2UXDQ 3PO3H 3NELA 3I4MH 4DR3L 5FJ8H 3TS2A 2MQHA 1Y14B 2H5XA 1A8VA 4LFAQ 3GTKH 1WCMH 2PQAA 3CW2C 3M4PA 4PG3A 4LF9Q 1SRUA 1XMOQ 2FXQA 2ZJRA 2D62A 3BZKA 1TWFH 5J3BA 4NB3A 2JK8A 4DUYQ 2K50A 1A0IA 1KQSA 3UDFA 1VQLA 4JI0L 1G51A 1WFQA 4DV0L 1VQJA 2K4KA 2LXJA 5IE8A 1LUZA 5C44G 3CC7A 1KHIA 1PH7A 1HNZL 3GTQH 1OXSC 2Q2UA 4GKJQ 1YZ6A 1Q82C 1B8AA 2A1AA 2UXCL 3U4VA 1YEZA 1J6QA 3AFQA 1C9OA 2F4VQ 1V1QA 1EIYB 1A63A 1KIXA 1PFSA 1CKMA 2HT1A 4C3JH 1L1OC 4Y7NH 2D0OA 2Q2HA 1VCIA 1C7YA 4AQYL 2UUAL 2YU9H 4JI7Q 3HOZH 1VQHA 4AIMA 4R4QA 4YWKA 4C2MH 4A3MG 1R9TH 4X66L 4JI5Q 4GKJL 3RLFA 4X62L 2K14A 1B7YB 2NZOA 2BH2A 3K81C 1XTDA 2UXCQ 1YHBA 1OXVA 4TVAB 4LF8L 2UXBL 2N8NA 3EN2A 3TEHB 2JA5G 2OWOA 1YHAA 3M4QA 4QJFA 3CAMA 3ULLA 3GTLH 4YCVA 1UE6A 2RF4A 3KF8B 2IX0A 3G48A 3PIOA 1EYGA 1YNXA 1EFWA 3PO3G 4X64Q 2Z6KC 2ATWA 5K36G 3PV0A 4DR7L 3JAMc 2JA7G 1AE2A 2VW9A 2JJQA 2IY5B 2R7DA 4K0KQ 5JJLA 1VQMA 1L0WA 4HIDA 3RN5A 1S40A 3TQYA 3S1MH 1TWHH 4A3DG 1SLJA 5LMUL 4QQBX 3GTMH 4IO9A 4A3KG 4MTNA 2UXDL 3GTGH 2QA4A 1VQ6A 2AHOB 1E1OA 1LTLA 1G6PA 1NMGA 1XMQQ 2JA7H 1NBWA 1I3QH 2R7FA 1EQRA 3J80i 1LYLA 4PMWA 2KCTA 2PI2A 3U4ZA 2CCZA 2ZJQA 5EAYA 2CFMA 4EQ5A 1IBLQ 3RN2A 2EQSA 1X3FA 1E1TA 4HJ5A 3HOUG 4DK3C 4DUZQ 2DUDA 3HOXG 4A3GG 4JOIA 3HKZE 3CCJA 2KBNA 1VQNA 4GNXC 4GNXA 2AWNA 1VQAA 2OTJA 4L5TA 3F2CA 3U50C 3L0OA 3W1GA 3H3VI 3I4OA 1HH2P 3CF5A 1VQGA 3HOZG 1K8GA 1E24A 5IWAL 3GTOH 4X65L 1S72A 4LF7L 3LGJA 1FGUA 1I6HH 2ZTDA 3I56A 4UY8C 4A3FH 4DV2L 2R92G 2B3GA 3I55A 1VQ4A 4B3TQ 1QVGA 1N9WA 1W2BA 3BZCA 4DV2Q 4GOPB 3GDEA 4JBMA 4XTCS 2JA5H 1X6OA 5IP9H 2R92H 4DV4L 4BXXG 1G291 4A3CH 1I94L 1JJ2A 4A4IA 5IP7H 3KJOA 3KF6A 1KAWA 4A76A 5C4XG 4OO1I 4A3BG 3RZOH 3I2ZA 2ES2A 2JA6G 4GLAC 4JOIC 5ELOA 2HQLA 2MFIA 4GLXA 4B3SL 2EIFA 2OQKA 3HOVG 1SR3A 3OW2A 1K9MC 3PUVA 1W3SA 4DUYL 1XNRQ 3BJUA 4LF4L 2AMCB 1M90C 1HNXL 1AE3A 2HIXA 3PUWA 4QIWE 1HR0Q 3PSIA 3CC2A 4DV5Q 4LFBL 1UWVA 3ZJYC 5GAGC 3S14H 4BBSG 4L5SA 1BBWA 3S1NH 2K5VA 4R1JA 2JA6H 4A3KH 1YBYA 4A3EG 4OX9Q 2WB1E 1N32L 4DKAC 2HHHL 2E2HH 3CC4A 1NMFA 2ASBA 1Q1EA 3BU2A 2PNHA 2HHHQ 2K5HA 2IHFA 4KHZA 4LUZA 1UE1A 4XIGS 5GAHC 2UUBQ 1E3PA 2WFWA 4DV3L 1CKNB 3A0JA 2KHJA 1P16A 2N78A 3HOWG 4IFDI 5M3MG 1YIJA 4LF6Q 3NENA 4LFCQ 4GKKQ 1HNWL 1L1OB 5E7NA 5AJ3Q 1YHQA 1L1OA 4UP8A 2I0QA 2F4VL 3A5ZB 3G6EA 1DGSA 1XJVA 4HIMA 1MJEA 1NY4A 1X9NA 4BY1G 4JI8L 1SN8A 3STBC 1PHJA 2Q2TA 3UE1A 4NXMQ 3J80c 4R4IA 4JI2Q 2JA8H 3PCOB 3S17H 1CUKA 5IYBH 1YJNA 2N3SA 5JEAJ 1EIFA 4POFA 4P74A 2ZTEA 3K80C 2K75A 5LMNQ 1TWAH 1VQPA 3J81i 3AQQA 1VQEA 3HKZG 3CMAA 2UUCL 3A5UA 3MXNB 1PH1A 1MKHA 3KOJA 5C0XJ 5IYCH 1WYDA 4A3BH 1ASYA 4FDBA 5JJKA 1E7ZA 2B63G 3M9BA 1X3EA 2CKZB 2AWOA 4X64L 2R93H 1KC8C 4NXNQ 3M7NA 2JQOA 3F1ZA 1N32Q 3WWVA 1K0RA 1U5KA 3FP9A 3E9HA 1OXXK 4NPSA 3CP0A 2ZM6Q 4DV6L 1I94Q 2WAQE 1N34L 3F2BA 5FLXc 4JI3L 4JI4L 3HOYG 4DV6Q 1JT8A 1HR0L 3PUYA 2VS1A 1VQIA 4BBRH 1Z47A 2NN6I 2F3IA 4WJ4A 3W5OA 4POGA 5HGQA 1Q12A 3FKIG 4A3JH 4HIOA 4YHHQ 1X54A 1XPRA 4RG1A 4DV0Q 4HJ8A 4JBWA 4YY3L 1PH4A 4A75A 2UU9L 5C0XI 1VQ5A 4JI2L 5GQOA 2YYZA 4BY7G 1IBKQ 1L2FA 4B3MQ 1I5FA 1QVCA 4JV5L 4JI4Q 3F8TA 1EUJA 1VQ7A 4JYAL 4PZ8A 2JA8G 2MO1A 1TWCH 4QL5A 3HOUH 5IYBG 5C3EG 3DLLA 2EXDA 3CCMA 4LUVA 1J5EL 2NN6G 1KL9A 5IT9c 4DR4L 4YCUA 1FVIA 5M5YH 2JA9A 1BKBA 2K5NA 4JI8Q 3GTJH 3TRZA 2CWAA 3EBEA 1XPOA 3CCLA 3KJPA 1PH8A 4GN3B 2NVTH 3AEVA 4GLVB 2V1CC 2VQFL 1WCMG 4JI3Q 4A3LG 4LF9L 1Y1WH 3E0EA 4JI1Q 3I4MG 3D31A 4JV5Q 2R93G 3KDFA 4JCVE 3UDXA 4LFAL 5LMNW 4DR6L 1B70B 1WI5A 4KLKA 3Q8DA 2R7ZG 1LM0A 1D7QA 1UE5A 1M1KC 4UPAA 5AJ3L 4P75A 3GTPH 1XMQL 1TXYA 4JI0Q 3T1HQ 2GN5A 4LF5Q 4A3CG 3JC66 4DR1L 1HNXQ 4P72A 3OYYA 4YWLA 2F52A 2Z0SA 4TQUS 3RLOA 4DV7Q 3K7UC 3H15A 3CCQA 4DV4Q 2GVAA 2XTIA 3M3YH 4K0KL 4MNOA 2BH8A 3CCRA 2BA1A 4IFDJ 4OX9L 1EWIA 1U0LA 3ULJA 5M5XH 1NJIC 3UE0A 4HJAA 3M4OH 4A3JG 1QVFA 3AFPA 2VUMG 1MIUA 4UP9A 4YCWA 1IBML 2ZM6L 1VQBA 1K8AC 2NVYH 1KD1C 1IZ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OTO L;  2QEX A;  2OQ0 A;  2JEA I;  5C0X G;  4DR1 Q;  3H3V H;  4X6A H;  4BY7 H;  2ID0 A;  1PH5 A;  3CPW A;  3CCU A;  4J15 A;  1X56 A;  3K8A A;  3PUX A;  2I5L X;  2ALY B;  2E5L Q;  1JMC A;  3UDG A;  4O0A A;  1N33 Q;  4GOP A;  3TRE A;  4APV A;  1X65 A;  5C4X H;  5IP7 G;  4BA2 I;  4IOA A;  3CQZ H;  1SMX A;  3PIP A;  2A8V A;  4DV3 Q;  2LSS A;  3VDY A;  1Y1V G;  3GD7 A;  1KRS A;  1VQD A;  4ME3 A;  4OWW B;  4IJL A;  1TWG H;  4IPC A;  5IWA Q;  4A3L H;  4UP7 A;  2VQE L;  3PF5 A;  2Q2I A;  4BBS H;  3KF6 B;  4JC0 A;  1IBL L;  3I4N H;  3IRB A;  2E5L L;  1N33 L;  2R7Z H;  3B6Y A;  2PI2 E;  3CD6 A;  4A3D H;  3I7F A;  1HNZ Q;  2NVQ H;  2K52 A;  1OTC A;  1QUQ A;  4DR5 Q;  4JI1 L;  1QUQ B;  1D8L A;  4JG2 A;  4HJ9 A;  5IY0 A;  4OXP A;  2VY3 A;  5M3F G;  5ELN A;  1YVC A;  5IYC G;  1GM5 A;  2RHQ B;  3TS0 A;  4LNQ A;  2CQO A;  1XNQ Q;  5IYD G;  2VUM H;  4KI0 A;  3K7A H;  3I4N G;  2I5M X;  1XNQ L;  2E2J H;  3ULP A;  3CCV A;  1PA6 A;  1XMO L;  3T1Y L;  2E2I H;  4MZ9 A;  4HJ7 A;  2YTY A;  3S1Q H;  5C44 H;  1HZA A;  1MJC A;  4X62 Q;  1HR0 W;  5GAD C;  3D0F A;  1H95 A;  2JE6 I;  2YV5 A;  4QGU A;  3J7Z C;  5DLQ E;  3K0X A;  3RLN A;  4A93 H;  3S2H H;  4DR2 Q;  1CSQ A;  2I5H A;  4DAM A;  2VQF Q;  4B3M L;  3KLW A;  1GVP A;  4PZ7 A;  1SE8 A;  2WAQ G;  1PH9 A;  1Q81 C;  1HZ9 A;  4IOC A;  4DR4 Q;  3GO5 A;  2VZA A;  1VQF A;  1VQK A;  4H02 A;  1JJC B;  4ALP A;  4LW1 A;  4LF5 L;  1OXU A;  1KXL A;  2OCE A;  4JI7 L;  1Y1V H;  3ERS X;  4A3F G;  4OON A;  2B29 A;  1IL2 A;  4R4C A;  2VQE Q;  3KFU A;  1PVO A;  4B3T L;  4DR3 Q;  3F2D A;  1YJ9 A;  4OWT B;  4OWX B;  1K73 C;  4B3S Q;  4C3I H;  4BXX H;  4R4O A;  4DK6 C;  4GNX B;  5C3E H;  4RMF A;  2IX1 A;  1Z9F A;  3PF4 A;  2UUB L;  3CME A;  3L7Z C;  4LUO A;  1Y1W G;  1Q46 A;  4P73 A;  3T1H L;  2JEB I;  1N36 L;  5BR8 Q;  1RL2 A;  3JAM i;  2L15 A;  3H0G G;  2KHI A;  3PO2 H;  2MNA A;  1S3O A;  4OO1 G;  5HY6 A;  3SGI A;  5BR8 L;  4IFD G;  1GKH A;  3G4S A;  2YTX A;  3S1R H;  2XGT A;  4YY3 Q;  5M3F H;  2UU9 Q;  2Y0S G;  2WP8 J;  2AKW B;  4PZ6 A;  4DV1 Q;  1EOV A;  4DV7 L;  1T9H A;  1QZG A;  1N8R C;  1IBK L;  4DR7 Q;  4A3E H;  4B3R Q;  4A93 G;  4A3I G;  1IYJ B;  1WJJ A;  1HZB A;  3RZD H;  3HOW H;  2ZJP A;  4B3R L;  4KHP L;  1I50 H;  1GO3 E;  4X65 Q;  2MO0 A;  1NE3 A;  4IPH A;  4LF7 Q;  4LF8 Q;  3PO2 G;  2PMZ E;  4DR5 L;  3OTO Q;  1JB7 A;  1XPU A;  5LMU Q;  1AH9 A;  1WOC A;  4BA1 I;  1E22 A;  1YI2 A;  4DPG A;  4HIK A;  2Z6K A;  2PQA B;  1N36 Q;  2WB1 G;  2CWP A;  4GKK L;  1PYB A;  1HNW Q;  4IPG A;  1C0A A;  4DAY B;  1BBU A;  3CXC A;  2UUA Q;  3RNU A;  4QY7 A;  3S24 A;  1VS0 A;  3A74 A;  3S16 H;  1VQO A;  2IHE A;  4JI5 L;  3DM3 A;  4X66 Q;  4LF4 Q;  2YTV A;  3HOX H;  3G71 A;  4O2D A;  5LMN L;  4GOP C;  4AQY Q;  1Q8K A;  3PGZ A;  4JI6 Q;  3RR5 A;  3E9I A;  1PV4 A;  1RIP A;  5GRO A;  4Y52 H;  2ZTC A;  3KYH C;  1YIT A;  2VL6 A;  4WJ3 M;  2RCN A;  2R6G A;  4EX5 A;  2UXB Q;  1BVS A;  3S15 H;  2D0P A;  4GN5 A;  3STB D;  2KCM A;  5JJI A;  2HIV A;  3NBH B;  3MEF A;  2RHS B;  3M85 A;  1FJG Q;  3J7A 5;  4AYB E;  1IXR A;  3H0G H;  2C35 B;  4LFB Q;  1P8L A;  1K3R A;  3NEM A;  4DNI A;  2NZH A;  5IP9 G;  1UE7 A;  4LWC A;  2B63 H;  1VQ9 A;  4GS3 A;  5FJ8 G;  4DV1 L;  4DR2 L;  1HJP A;  3KDF B;  1K83 H;  3HOV H;  2BA0 A;  1JE5 A;  4IPD A;  3HOY H;  4JBJ A;  4DR6 Q;  1SFO H;  2KEN A;  1YJW A;  1Q86 C;  1QZH A;  1X55 A;  4A3G H;  2VNU D;  3CCS A;  1CKO A;  1IBM Q;  4JYA Q;  1N34 Q;  1V9P A;  2UUC Q;  1Q1B A;  4LFC L;  4A3I H;  4LF6 L;  1PYS B;  5IYD H;  3W1B A;  1A62 A;  4YWM A;  5M5W H;  1FJG L;  5H1S E;  3ICE A;  1GD7 A;  3L2P A;  4BBR G;  3AYH B;  4P71 A;  4JI6 L;  3FKI H;  3HKS A;  1NTG A;  3EIV A;  3FHW A;  2LXK A;  4YHH L;  4R4T A;  1PH2 A;  1ASZ A;  1CKN A;  3ER0 A;  4C3H H;  1VQ8 A;  2N49 A;  4DUZ L;  1V43 A;  2A19 A;  1VQC A;  1UEB A;  3CPF A;  1CSP A;  3UDI A;  5FLM G;  3HFZ B;  5M3M H;  4L5R C;  3U58 A;  1FL0 A;  2Y0S E;  1X3G A;  1OXT A;  2E8G A;  1PH6 A;  1XNR L;  4JBK A;  4IJH A;  3T1Y Q;  2QGQ A;  1SRO A;  2DGY A;  4AH6 A;  3J81 j;  4DV5 L;  5GAE C;  1Q7Y C;  1JJG A;  4L5Q A;  4KHP Q;  4BY1 H;  1PH3 A;  1EQQ A;  4AYB G;  1J5E Q;  2IT1 A;  4GN4 B;  5JEA G;  4A3M H;  1HZC A;  5FLM H;  3J81 c;  3CCE A;  1O7I A;  5C4J H;  4NXM L;  1KRT A;  4NXN L;  2GVB A;  2NVX H;  3PUZ A;  2OTL A;  3S2D H;  2UXD Q;  3PO3 H;  3NEL A;  3I4M H;  4DR3 L;  5FJ8 H;  3TS2 A;  2MQH A;  1Y14 B;  2H5X A;  1A8V A;  4LFA Q;  3GTK H;  1WCM H;  2PQA A;  3CW2 C;  3M4P A;  4PG3 A;  4LF9 Q;  1SRU A;  1XMO Q;  2FXQ A;  2ZJR A;  2D62 A;  3BZK A;  1TWF H;  5J3B A;  4NB3 A;  2JK8 A;  4DUY Q;  2K50 A;  1A0I A;  1KQS A;  3UDF A;  1VQL A;  4JI0 L;  1G51 A;  1WFQ A;  4DV0 L;  1VQJ A;  2K4K A;  2LXJ A;  5IE8 A;  1LUZ A;  5C44 G;  3CC7 A;  1KHI A;  1PH7 A;  1HNZ L;  3GTQ H;  1OXS C;  2Q2U A;  4GKJ Q;  1YZ6 A;  1Q82 C;  1B8A A;  2A1A A;  2UXC L;  3U4V A;  1YEZ A;  1J6Q A;  3AFQ A;  1C9O A;  2F4V Q;  1V1Q A;  1EIY B;  1A63 A;  1KIX A;  1PFS A;  1CKM A;  2HT1 A;  4C3J H;  1L1O C;  4Y7N H;  2D0O A;  2Q2H A;  1VCI A;  1C7Y A;  4AQY L;  2UUA L;  2YU9 H;  4JI7 Q;  3HOZ H;  1VQH A;  4AIM A;  4R4Q A;  4YWK A;  4C2M H;  4A3M G;  1R9T H;  4X66 L;  4JI5 Q;  4GKJ L;  3RLF A;  4X62 L;  2K14 A;  1B7Y B;  2NZO A;  2BH2 A;  3K81 C;  1XTD A;  2UXC Q;  1YHB A;  1OXV A;  4TVA B;  4LF8 L;  2UXB L;  2N8N A;  3EN2 A;  3TEH B;  2JA5 G;  2OWO A;  1YHA A;  3M4Q A;  4QJF A;  3CAM A;  3ULL A;  3GTL H;  4YCV A;  1UE6 A;  2RF4 A;  3KF8 B;  2IX0 A;  3G48 A;  3PIO A;  1EYG A;  1YNX A;  1EFW A;  3PO3 G;  4X64 Q;  2Z6K C;  2ATW A;  5K36 G;  3PV0 A;  4DR7 L;  3JAM c;  2JA7 G;  1AE2 A;  2VW9 A;  2JJQ A;  2IY5 B;  2R7D A;  4K0K Q;  5JJL A;  1VQM A;  1L0W A;  4HID A;  3RN5 A;  1S40 A;  3TQY A;  3S1M H;  1TWH H;  4A3D G;  1SLJ A;  5LMU L;  4QQB X;  3GTM H;  4IO9 A;  4A3K G;  4MTN A;  2UXD L;  3GTG H;  2QA4 A;  1VQ6 A;  2AHO B;  1E1O A;  1LTL A;  1G6P A;  1NMG A;  1XMQ Q;  2JA7 H;  1NBW A;  1I3Q H;  2R7F A;  1EQR A;  3J80 i;  1LYL A;  4PMW A;  2KCT A;  2PI2 A;  3U4Z A;  2CCZ A;  2ZJQ A;  5EAY A;  2CFM A;  4EQ5 A;  1IBL Q;  3RN2 A;  2EQS A;  1X3F A;  1E1T A;  4HJ5 A;  3HOU G;  4DK3 C;  4DUZ Q;  2DUD A;  3HOX G;  4A3G G;  4JOI A;  3HKZ E;  3CCJ A;  2KBN A;  1VQN A;  4GNX C;  4GNX A;  2AWN A;  1VQA A;  2OTJ A;  4L5T A;  3F2C A;  3U50 C;  3L0O A;  3W1G A;  3H3V I;  3I4O A;  1HH2 P;  3CF5 A;  1VQG A;  3HOZ G;  1K8G A;  1E24 A;  5IWA L;  3GTO H;  4X65 L;  1S72 A;  4LF7 L;  3LGJ A;  1FGU A;  1I6H H;  2ZTD A;  3I56 A;  4UY8 C;  4A3F H;  4DV2 L;  2R92 G;  2B3G A;  3I55 A;  1VQ4 A;  4B3T Q;  1QVG A;  1N9W A;  1W2B A;  3BZC A;  4DV2 Q;  4GOP B;  3GDE A;  4JBM A;  4XTC S;  2JA5 H;  1X6O A;  5IP9 H;  2R92 H;  4DV4 L;  4BXX G;  1G29 1;  4A3C H;  1I94 L;  1JJ2 A;  4A4I A;  5IP7 H;  3KJO A;  3KF6 A;  1KAW A;  4A76 A;  5C4X G;  4OO1 I;  4A3B G;  3RZO H;  3I2Z A;  2ES2 A;  2JA6 G;  4GLA C;  4JOI C;  5ELO A;  2HQL A;  2MFI A;  4GLX A;  4B3S L;  2EIF A;  2OQK A;  3HOV G;  1SR3 A;  3OW2 A;  1K9M C;  3PUV A;  1W3S A;  4DUY L;  1XNR Q;  3BJU A;  4LF4 L;  2AMC B;  1M90 C;  1HNX L;  1AE3 A;  2HIX A;  3PUW A;  4QIW E;  1HR0 Q;  3PSI A;  3CC2 A;  4DV5 Q;  4LFB L;  1UWV A;  3ZJY C;  5GAG C;  3S14 H;  4BBS G;  4L5S A;  1BBW A;  3S1N H;  2K5V A;  4R1J A;  2JA6 H;  4A3K H;  1YBY A;  4A3E G;  4OX9 Q;  2WB1 E;  1N32 L;  4DKA C;  2HHH L;  2E2H H;  3CC4 A;  1NMF A;  2ASB A;  1Q1E A;  3BU2 A;  2PNH A;  2HHH Q;  2K5H A;  2IHF A;  4KHZ A;  4LUZ A;  1UE1 A;  4XIG S;  5GAH C;  2UUB Q;  1E3P A;  2WFW A;  4DV3 L;  1CKN B;  3A0J A;  2KHJ A;  1P16 A;  2N78 A;  3HOW G;  4IFD I;  5M3M G;  1YIJ A;  4LF6 Q;  3NEN A;  4LFC Q;  4GKK Q;  1HNW L;  1L1O B;  5E7N A;  5AJ3 Q;  1YHQ A;  1L1O A;  4UP8 A;  2I0Q A;  2F4V L;  3A5Z B;  3G6E A;  1DGS A;  1XJV A;  4HIM A;  1MJE A;  1NY4 A;  1X9N A;  4BY1 G;  4JI8 L;  1SN8 A;  3STB C;  1PHJ A;  2Q2T A;  3UE1 A;  4NXM Q;  3J80 c;  4R4I A;  4JI2 Q;  2JA8 H;  3PCO B;  3S17 H;  1CUK A;  5IYB H;  1YJN A;  2N3S A;  5JEA J;  1EIF A;  4POF A;  4P74 A;  2ZTE A;  3K80 C;  2K75 A;  5LMN Q;  1TWA H;  1VQP A;  3J81 i;  3AQQ A;  1VQE A;  3HKZ G;  3CMA A;  2UUC L;  3A5U A;  3MXN B;  1PH1 A;  1MKH A;  3KOJ A;  5C0X J;  5IYC H;  1WYD A;  4A3B H;  1ASY A;  4FDB A;  5JJK A;  1E7Z A;  2B63 G;  3M9B A;  1X3E A;  2CKZ B;  2AWO A;  4X64 L;  2R93 H;  1KC8 C;  4NXN Q;  3M7N A;  2JQO A;  3F1Z A;  1N32 Q;  3WWV A;  1K0R A;  1U5K A;  3FP9 A;  3E9H A;  1OXX K;  4NPS A;  3CP0 A;  2ZM6 Q;  4DV6 L;  1I94 Q;  2WAQ E;  1N34 L;  3F2B A;  5FLX c;  4JI3 L;  4JI4 L;  3HOY G;  4DV6 Q;  1JT8 A;  1HR0 L;  3PUY A;  2VS1 A;  1VQI A;  4BBR H;  1Z47 A;  2NN6 I;  2F3I A;  4WJ4 A;  3W5O A;  4POG A;  5HGQ A;  1Q12 A;  3FKI G;  4A3J H;  4HIO A;  4YHH Q;  1X54 A;  1XPR A;  4RG1 A;  4DV0 Q;  4HJ8 A;  4JBW A;  4YY3 L;  1PH4 A;  4A75 A;  2UU9 L;  5C0X I;  1VQ5 A;  4JI2 L;  5GQO A;  2YYZ A;  4BY7 G;  1IBK Q;  1L2F A;  4B3M Q;  1I5F A;  1QVC A;  4JV5 L;  4JI4 Q;  3F8T A;  1EUJ A;  1VQ7 A;  4JYA L;  4PZ8 A;  2JA8 G;  2MO1 A;  1TWC H;  4QL5 A;  3HOU H;  5IYB G;  5C3E G;  3DLL A;  2EXD A;  3CCM A;  4LUV A;  1J5E L;  2NN6 G;  1KL9 A;  5IT9 c;  4DR4 L;  4YCU A;  1FVI A;  5M5Y H;  2JA9 A;  1BKB A;  2K5N A;  4JI8 Q;  3GTJ H;  3TRZ A;  2CWA A;  3EBE A;  1XPO A;  3CCL A;  3KJP A;  1PH8 A;  4GN3 B;  2NVT H;  3AEV A;  4GLV B;  2V1C C;  2VQF L;  1WCM G;  4JI3 Q;  4A3L G;  4LF9 L;  1Y1W H;  3E0E A;  4JI1 Q;  3I4M G;  3D31 A;  4JV5 Q;  2R93 G;  3KDF A;  4JCV E;  3UDX A;  4LFA L;  5LMN W;  4DR6 L;  1B70 B;  1WI5 A;  4KLK A;  3Q8D A;  2R7Z G;  1LM0 A;  1D7Q A;  1UE5 A;  1M1K C;  4UPA A;  5AJ3 L;  4P75 A;  3GTP H;  1XMQ L;  1TXY A;  4JI0 Q;  3T1H Q;  2GN5 A;  4LF5 Q;  4A3C G;  3JC6 6;  4DR1 L;  1HNX Q;  4P72 A;  3OYY A;  4YWL A;  2F52 A;  2Z0S A;  4TQU S;  3RLO A;  4DV7 Q;  3K7U C;  3H15 A;  3CCQ A;  4DV4 Q;  2GVA A;  2XTI A;  3M3Y H;  4K0K L;  4MNO A;  2BH8 A;  3CCR A;  2BA1 A;  4IFD J;  4OX9 L;  1EWI A;  1U0L A;  3ULJ A;  5M5X H;  1NJI C;  3UE0 A;  4HJA A;  3M4O H;  4A3J G;  1QVF A;  3AFP A;  2VUM G;  1MIU A;  4UP9 A;  4YCW A;  1IBM L;  2ZM6 L;  1VQB A;  1K8A C;  2NVY H;  1KD1 C;  1IZ6 A; 
#chains in the Genus database with same CATH topology
 2JYO A;  5C0X G;  4BY7 H;  2ID0 A;  3CPW A;  4J15 A;  1X56 A;  3K8A A;  2O4X A;  1Y1W B;  1SNC A;  5I2X A;  2ALY B;  1PZJ D;  4GOP A;  1MGS A;  4APV A;  2B2U A;  5IP7 G;  2A8V A;  1STG A;  1HFG A;  5IGB A;  4DV3 Q;  3VDY A;  1D1I A;  3DWA A;  1JOK A;  3I90 A;  4ME3 A;  1JOR A;  3D4D A;  3GV6 A;  2A69 C;  2VQE L;  5BN4 A;  2Q2I A;  4BBS H;  3KF6 B;  3P20 A;  1K8M A;  3R2I A;  1XWE A;  2R7Z H;  3B6Y A;  3CD6 A;  3I7F A;  1HNZ Q;  1QUQ A;  1ICF B;  2F0Q A;  1QUQ B;  2F0M A;  4KTA A;  2PMZ B;  1BDO A;  1GHK A;  2ES2 A;  5IY0 A;  2VY3 A;  1GM5 A;  1TS5 A;  1CK1 A;  2XRQ D;  1GHJ A;  2MHV A;  5A2Q L;  3ULP A;  1XMO L;  3T1Y L;  4MZ9 A;  5EPJ A;  5C44 H;  2VB2 X;  2B2V A;  3D0F A;  2JE6 I;  4ULL A;  5DLQ E;  4A93 H;  1GUO A;  1I4P A;  5KYL A;  4EVO A;  4DR2 Q;  1KDB A;  2L4N A;  4C3I B;  1CSQ A;  1YNJ C;  4DAM A;  2VQF Q;  1GVP A;  2D5D A;  1HQM C;  3VR5 A;  1PH9 A;  1H9S B;  1WCM B;  1CZG A;  3C1F A;  2PZT A;  1VQK A;  5KGU A;  1JJC B;  4ALP A;  4LF5 L;  1OXU A;  3I73 A;  2F0H A;  2H1E A;  3KFU A;  4OON A;  2L11 A;  2VQE Q;  1HFN A;  5CV7 A;  5L37 A;  4DR3 Q;  1TS4 A;  4XDX A;  4R4O A;  3L3O C;  2IX1 A;  1Z9F A;  3L7Z C;  1Q46 A;  3T1H L;  1K0S A;  5BR8 Q;  1RL2 A;  5C3E B;  3H0G G;  4OO1 G;  2KHI A;  3SGI A;  4IFD G;  2YTX A;  5IGF A;  5M3F H;  1MD2 D;  3NQT A;  3A8K E;  4DV1 Q;  1QZG A;  4A3E H;  1QIL A;  1IYJ B;  3MA2 B;  3HOW H;  3EVQ A;  3BVM A;  1GO3 E;  1SNM A;  3OTO Q;  2JA7 B;  1WOC A;  4C3H G;  4CDF C;  2CWP A;  1TWG B;  1QJO A;  4IPG A;  4DAY B;  3GTK B;  4QY7 A;  3S16 H;  2IHE A;  4X66 Q;  5FK9 C;  1NR2 A;  2YTV A;  3MC0 B;  2NWG A;  4J8Q A;  3HOX H;  4O2D A;  3PIO 3;  2EY2 A;  4JI6 Q;  3RR5 A;  3E9I A;  5GRO A;  1KAA A;  1DJR D;  1BCP B;  1DZ1 A;  1YIT A;  5IT9 E;  3K7A B;  1S5F D;  2UXB Q;  1TS2 A;  4NMZ A;  2HIV A;  3MEF A;  2RHS B;  3M85 A;  1FJG Q;  4J6H A;  1U4M A;  4AYB E;  5LL6 X;  1RD9 D;  5KYI A;  1UE7 A;  4LWC A;  1VQ9 A;  1PTO H;  5FJ8 G;  4DV1 L;  4HN7 A;  3C1E A;  3HOV H;  1Y1V B;  2BA0 A;  1JE5 A;  1EYD A;  2SEB D;  1MBY A;  4JBJ A;  4DR6 Q;  1Q86 C;  1PDQ A;  1NUC A;  2A5H A;  4JYA Q;  1Q1B A;  4A3I H;  5IYD H;  1FJG L;  4YWM A;  4KD3 A;  3NE5 B;  1GD7 A;  1GUW A;  3AYH B;  2KED A;  3HKS A;  1A3U A;  4CDD C;  1VQ8 A;  3SK8 A;  4RHS A;  3CPF A;  3IFT A;  5FLM G;  3UDI A;  3I4N B;  1L0X B;  2DJG C;  3VYU A;  1LTT D;  1X3G A;  1OXT A;  2E8G A;  3S9W A;  5GAE C;  4MTK A;  2B2W C;  1PH3 A;  3VA5 A;  5C5L A;  5JEA G;  4NXM L;  1HZC A;  3J81 c;  1XTC D;  1HUN A;  5C4J H;  2PW7 A;  3PIP 3;  1ET9 A;  1FD7 D;  1E2V A;  5DNF A;  3NEL A;  3I4M H;  1SXT A;  2B2T C;  3PO2 B;  3GTK H;  1WCM H;  1DOL A;  1BCP F;  4PG3 A;  1SRU A;  3X3M A;  1PRT C;  2Z6B A;  2FXQ A;  2ZJR A;  4DA2 A;  1PYW D;  2D62 A;  5E4W C;  1M8A A;  3TDQ A;  4RGO S;  3QR8 A;  1WTX A;  1G2S A;  2I46 A;  2Q8I B;  1VQJ A;  2K4K A;  1J8I A;  1LUZ A;  4IFD H;  3GTQ H;  1K3B C;  4RH6 A;  4GKJ Q;  3NTI A;  2UXC L;  5FO9 B;  5KNB A;  2F0J A;  3ONA B;  2RQX A;  2AUK A;  1EY0 A;  3NBH A;  3MFG A;  4Y7N H;  4ODG A;  3SR1 A;  1GUS A;  2D0O A;  3CHB D;  4C1N I;  3KK7 A;  1SYB A;  4HMJ A;  2FFK B;  1C7Y A;  3I70 A;  2YU9 H;  4A93 B;  4YWK A;  4A3M G;  1M4V A;  1YNN C;  2H4O A;  3RLF A;  4GKJ L;  2NZO A;  5M5W B;  3DWQ A;  3HOW B;  1RTN A;  4TVA B;  4LF8 L;  4PMB A;  1B3A A;  2N8N A;  2JA5 G;  2HUG A;  4QB4 A;  4QJF A;  3CAM A;  3ULL A;  4YCV A;  1UE6 A;  2IX0 A;  1EY9 A;  2L9H A;  2ATW A;  4DR7 L;  1GJX A;  1PZK D;  1AE2 A;  2R92 B;  4K0K Q;  4QCL A;  3RN5 A;  4WFN 3;  3GTM H;  2UXD L;  2QA4 A;  1VQ6 A;  3K57 A;  1G6P A;  5CGK A;  2EPB A;  1TWC B;  1SYD A;  2JA7 H;  3DEO A;  1I3Q H;  4KY6 A;  2O2L D;  1MI2 A;  1EQR A;  1IYU A;  4C3J G;  3QIA A;  1VDZ A;  2RDH A;  3U9O A;  3HOU G;  3J7A V;  3GTP B;  2KCC A;  2KBN A;  2IPK D;  3CCJ A;  4RAU C;  2IJ0 A;  3H3V I;  3HOZ G;  1CQV A;  2HQE A;  3W3A A;  4LF7 L;  3R2T A;  1S72 A;  1ICW A;  1FGU A;  1RDP D;  1SE2 A;  2ZTD A;  2FHT A;  4HR7 B;  3I56 A;  4UY8 C;  4A3F H;  4B3T Q;  3FKI B;  3BZC A;  4GOP B;  1NSN S;  2MPM A;  4XTC S;  3AMU A;  1S5B D;  5C4X G;  1Q8I A;  4OO1 I;  3RZO H;  3I2Z A;  1TR5 A;  5ELO A;  2MFI A;  3HOV G;  2EIF A;  4F7X A;  3OW2 A;  1F9Q A;  4LF4 L;  3OWE B;  1EY7 A;  4QIW E;  1ZXT A;  1I3Q B;  3GQB A;  2DY7 A;  2L0C A;  3QOJ A;  3S1N H;  2JA6 H;  4A3K H;  2JSO A;  4A3E G;  4DK0 A;  4DKA C;  3X3N A;  2PNH A;  2HHH Q;  4JPB W;  5T1I A;  5KRU A;  5GAH C;  2KUM A;  1EY8 A;  1NR4 A;  3TSS A;  4LF6 Q;  4LFC Q;  1L1O B;  1YNN D;  1L1O A;  2F4V L;  1DGS A;  1XJV A;  2QF7 A;  1SDF A;  1NAP A;  4H7B A;  2AQ1 B;  4DAV A;  2ICI A;  2Q2T A;  3BZD B;  2E2H B;  4R4I A;  1ILQ A;  3S17 H;  2X6L A;  2N3S A;  4P74 A;  2ZTE A;  3K80 C;  3S14 B;  2WAC A;  3J81 i;  4ZKB B;  2VUM B;  1UAP A;  2TMP A;  2KOL A;  2UUC L;  1CM9 A;  2RA4 A;  2N55 A;  1ASY A;  2B63 G;  2CKZ B;  3ERO A;  3M7N A;  3T56 B;  2X69 A;  2JQO A;  3SDZ A;  1N32 Q;  2VB3 X;  4IAL A;  3WWV A;  1EQV A;  4NPS A;  3RD4 A;  2ZM6 Q;  1TY0 A;  4NP5 A;  4DV6 Q;  4PNY A;  1VQI A;  4OGQ C;  2K33 A;  4HIO A;  4G4K A;  1GUN A;  3MXN A;  1KDC A;  4N8F A;  4DV0 Q;  4CKB A;  4YY3 L;  2QDB A;  4A75 A;  5C0X I;  2LFN A;  3KBG A;  4B3M Q;  4KHV A;  4JI4 Q;  1EUJ A;  2KA7 A;  2Q8R E;  5IYB G;  3OHX C;  1BBX C;  4A3J B;  1FR3 A;  5E3F A;  5C3X A;  5IT9 c;  4DR4 L;  2F0I A;  2HCI A;  2JA9 A;  2K5N A;  1W6K A;  3KLS X;  2CWA A;  3KJP A;  2F0K A;  1PH8 A;  4FP5 D;  3AEV A;  4GLV B;  1II3 A;  3S1M B;  1B44 D;  1S5E D;  3E6Z X;  4A3L G;  3E0E A;  1TU2 B;  5HUR A;  3O13 A;  2R7Z G;  1LM0 A;  1M1K C;  5AJ3 L;  3GTP H;  5J22 A;  4A3C G;  4DR1 L;  4XYO A;  1HNX Q;  4P72 A;  2HDL A;  3HRZ C;  2F52 A;  3WOE A;  4TQU S;  5I6W A;  3H15 A;  2BOS A;  4K6D A;  4MNO A;  5TSS A;  3D8G A;  1EWI A;  1U0L A;  4UHV A;  5CV9 A;  3A7L A;  4CJ1 B;  5M5X H;  4UDU C;  1L0Y B;  1QVF A;  3NP8 A;  4UP9 A;  4H0L C;  2ZM6 L;  1VQB A;  1Q3L A;  4LF4 Q;  3OIQ A;  1KD1 C;  3EQL C;  2J4X A;  2OQ0 A;  4DR1 Q;  4ZQ3 A;  1EY4 A;  3NTK A;  4K5V A;  3PUX A;  1CQF A;  2K5Q A;  2E5L Q;  2R93 B;  3UDG A;  4O0A A;  2RSN A;  5C4X H;  4BA2 I;  2FMM A;  3CQZ H;  3NQI A;  2PZU A;  2LSS A;  3W2D A;  3S1Q B;  3HOX B;  4KMU C;  3GD7 A;  3CRL C;  1VQD A;  2E2J B;  4OWW B;  2KEC A;  4IJL A;  1TWG H;  5IWA Q;  4A3L H;  1V8Q A;  1FYC A;  1QNU A;  2A68 D;  4CHT B;  4UP7 A;  1EQT A;  2EE1 A;  2N88 A;  3PF5 A;  5M3M B;  5I9O A;  2CW0 C;  2E5L L;  5C4H A;  1OTC A;  4JI1 L;  4KKU A;  2O5J C;  4RKB A;  4OXP A;  2PYK A;  3TS0 A;  4HMI A;  1XNQ L;  1JE4 A;  3CCV A;  1F2Y A;  2E2I H;  5T1G A;  1BXT A;  1HR0 W;  1H95 A;  5GAD C;  1HCZ A;  5IGC A;  2YV5 A;  1O7Z A;  2F0G A;  4DXG A;  4B3M L;  3KLW A;  2IW3 A;  4K8I A;  2B2V C;  1KXL A;  3J80 E;  2OCE A;  4HAE A;  2E75 C;  4JI7 L;  2B29 A;  1PVO A;  1SMY D;  4B3T L;  5IGD A;  3GP7 A;  5J39 A;  3TN2 A;  3MFY A;  1YJ9 A;  4BXX H;  2CQA A;  2UUB L;  3DUZ A;  4LUO A;  3S16 B;  1I4X A;  3TBI B;  4G7Z C;  2PW5 A;  3JAM i;  2X6G A;  2L15 A;  1ZKO A;  3S1R H;  2K1B A;  1DOK A;  1TWA B;  4TSS A;  2UU9 Q;  2F3W A;  2DNE A;  4FXD A;  1B2T A;  1T9H A;  5EKI A;  1IBK L;  1DM0 B;  2KCN A;  2JP1 A;  2R3Z A;  3J7A F;  4B3R L;  2ZJP A;  1LTS D;  1DOM A;  4LF7 Q;  2MO0 A;  4LF8 Q;  2PMZ E;  4DR5 L;  1YI2 A;  4DU9 A;  4DPG A;  1Z7T A;  2LY7 A;  2EYO A;  4GKK L;  1PYB A;  2QKI C;  1HNW Q;  1C0A A;  1HXY D;  1B3Q A;  4RGT A;  4C1N K;  3S24 A;  3HS0 C;  1VQO A;  4JI5 L;  5CYU A;  3SVM A;  4ZUI A;  5LMN L;  4GOP C;  2Z1C A;  3PGZ A;  4AQY Q;  1LT4 D;  1SNQ A;  3ITP A;  1PV4 A;  1RIP A;  4Y52 H;  2E2I B;  4U67 3;  3KYH C;  5JEA H;  4WJ3 M;  2RCN A;  4DNR B;  4GN5 A;  3STB D;  3NBH B;  2K04 A;  1ENA A;  3N52 A;  1IXR A;  4LFB Q;  1P8L A;  1K3R A;  2L5T A;  3NEM A;  4DNI A;  2B8F A;  2RDG A;  4DR2 L;  1X3Q A;  2PQE A;  2WB1 B;  4XT1 B;  1SFO H;  1YJW A;  1X55 A;  2DJF C;  3HGB A;  4A3G H;  1CKO A;  2F03 A;  3BVG A;  3W1B A;  2NTT A;  5H1S E;  1E2Z A;  3BG3 A;  5KND A;  1Y8O B;  4P71 A;  1NTG A;  2R92 H;  4R4T A;  5IOC A;  3ER0 A;  2N49 A;  3H94 A;  1VMC A;  2NYZ D;  1VQC A;  1UEB A;  1H9R A;  3HP3 A;  3HFZ B;  5M3M H;  4L5R C;  4R8N A;  1GOZ A;  1PXU A;  1R4P B;  1ENF A;  2QGQ A;  1F9R A;  4AH6 A;  3NSW A;  1I50 B;  4BY1 H;  1AEX A;  1EQQ A;  4GN4 B;  2RCF A;  4A3M H;  5FLM H;  3CCE A;  1QOH A;  2CVR A;  4NXN L;  1O7L A;  2NVX H;  3PUZ A;  2UXD Q;  5FJ8 H;  1EOT A;  3TS2 A;  5EJW A;  2H5X A;  1A8V A;  2V4D A;  3MAQ A;  2PQA A;  4S3S A;  4ABN A;  1V1O A;  4RWS C;  2JK8 A;  1FNU A;  1KQS A;  4DAY A;  2RKS A;  1G51 A;  4DV0 L;  3S15 B;  1C8C A;  5IE8 A;  4P2C B;  3NK9 A;  3R3O A;  1FNW A;  1STN A;  1SYC A;  1KLG D;  5CC4 A;  4MHE A;  2A1A A;  1YEZ A;  2RSO A;  2F0S A;  4FO2 A;  1C9O A;  1D1K A;  1PFS A;  1CKM A;  2P5Z X;  5JVH 3;  2HT1 A;  1L1O C;  3RZO B;  4BBS B;  4AQY L;  1B53 A;  2K6A A;  2Z9H A;  1YNJ D;  1VQH A;  4AIM A;  4R4Q A;  4EQN A;  1TS3 A;  2K14 A;  1B7Y B;  2EXZ A;  1U9R A;  2BH2 A;  1JIC A;  2UXC Q;  1TY2 A;  1CTM A;  3OMC A;  1YHB A;  1OXV A;  2XRS D;  4XQN A;  2UXB L;  5FLX L;  3EN2 A;  3TEH B;  1YHA A;  2EYH A;  3M4Q A;  4K8J A;  1UEA B;  2RF4 A;  2PO4 A;  1YNX A;  5EBC A;  5K36 G;  5JOB A;  5IIF A;  2NVY B;  4HID A;  1IYV A;  1SLJ A;  1HTP A;  4IO9 A;  4MTN A;  1BCP C;  4BY1 B;  3T51 B;  2A69 D;  1E1O A;  1LTL A;  1T5E A;  2NVX B;  3J80 i;  2PI2 A;  2CFM A;  4EQ5 A;  1IBL Q;  1X3F A;  1A3V A;  1E1T A;  2R7Z B;  4LJZ C;  1VQN A;  4GNX C;  3MXG A;  4EGV A;  4ZK9 B;  1HA6 A;  4L5T A;  3F2C A;  3D6C A;  4X3S A;  3ND8 A;  1VQG A;  1K8G A;  1E24 A;  3MEH A;  2JXM B;  2K03 A;  1HPC A;  1LLR D;  1EFI D;  4X65 L;  1EYA A;  3LGJ A;  2TSS A;  3TZD A;  3JAM E;  1DYQ A;  1PTO D;  3I55 A;  4M1U B;  1R4Q B;  1QVG A;  1N9W A;  2BE5 D;  4OIJ A;  4DV2 Q;  4JBM A;  3GTO B;  3HOY B;  1BO0 A;  1G29 1;  1I94 L;  5IP7 H;  3KJO A;  4G7O C;  4A3B G;  3NUC A;  2JA6 G;  2Z4I A;  4JOI C;  1EZ8 A;  2HQL A;  2OQK A;  1AP0 A;  3KLR A;  4KK7 A;  1XNR Q;  1M90 C;  1AE3 A;  1GUG A;  4ME5 A;  4QUC A;  1H9M A;  5GAG C;  3ZJY C;  4MN3 A;  3WDN A;  1D5M C;  3H91 A;  2K5V A;  3Q23 A;  1LT3 D;  4OX9 Q;  4ZCK A;  3NWT A;  2ASB A;  2IHF A;  5C5M A;  1UE1 A;  4XIG S;  1IKL A;  1CKN B;  3A0J A;  2KHJ A;  3HOW G;  2N78 A;  1LTI D;  4JVZ A;  5M3M G;  4GKK Q;  1HNW L;  2WII B;  3K59 A;  1SEB D;  3TP5 A;  3A5Z B;  5JPN C;  3SHL A;  3I4M B;  5NUC A;  1U4R A;  4HCS A;  2F4I A;  2F0N A;  1PHJ A;  2F3V A;  1FNV A;  1AZQ A;  5KEE A;  1LTA D;  3J80 c;  1VMP A;  3SK5 A;  4KD4 A;  3CKI B;  3URY A;  3I8Z A;  5LMN Q;  2K75 A;  3P7J A;  1F2M A;  1SYE A;  1XYI A;  3LNN A;  2D2C C;  3AQQ A;  3CU7 A;  2ZXO A;  3HKZ G;  2C9O A;  3A5U A;  3P1H A;  1EYC A;  3MXN B;  1PH1 A;  4KKS A;  5IYC H;  5JJK A;  5D65 A;  3M9B A;  4X64 L;  2YU9 B;  2NBF A;  1RJT A;  4OHJ A;  3F1Z A;  2EYF A;  1K0R A;  1AN8 A;  1U5K A;  3FP9 A;  1EEF D;  3CP0 A;  1I94 Q;  4DV6 L;  4F88 A;  1HR0 L;  2K5D A;  4BBR H;  4RKL A;  1SE4 A;  4WJ4 A;  3W5O A;  1KTK A;  1Z6H A;  4CDC C;  3IKJ A;  1EIH A;  5EPK A;  1X54 A;  2M9V A;  1XPR A;  2ICE C;  3EA6 A;  4RG1 A;  4JBW A;  1PH4 A;  3PO3 B;  4YIJ A;  5FKA C;  5GQO A;  3H3V C;  2AUJ D;  1IBK Q;  1L2F A;  5CBA E;  4JV5 L;  2JA8 G;  5EKK A;  4QL5 A;  2NZ1 D;  4LUV A;  1JR0 D;  1KL9 A;  5IT9 L;  5M5Y H;  1FVI A;  3GTJ H;  1TWH B;  3GTQ B;  2B2Y A;  4H13 C;  5BN3 A;  3CCL A;  3OPO A;  2NVT H;  1TQO A;  2Y0S B;  3F2U A;  1Y1W H;  4JV5 Q;  1XXG A;  2R93 G;  3AB9 A;  3KDF A;  4JCV E;  4F8M A;  2XSC A;  2XN9 C;  3CRK C;  4KLK A;  3RMH A;  4DR6 L;  4Y7N B;  1F77 A;  4JI0 Q;  4IN3 A;  3JC6 6;  3OYY A;  3QOL A;  4CKC A;  3N6R A;  3RLO A;  4DV7 Q;  3FVQ A;  5C4J B;  3CCQ A;  1WTV A;  2GVA A;  2XTI A;  4K0K L;  2BH8 A;  3M7G A;  5CV6 A;  3CCR A;  3HOV B;  4XQJ A;  2EDG A;  1PLF A;  3AFP A;  1LTR D;  1MIU A;  3PQI A;  1IZ6 A;  3R93 A;  3ND9 A;  2JEA I;  3HEJ A;  3H3V H;  1UNS A;  2ZXR A;  1PH5 A;  3CCU A;  4QIW B;  2I5L X;  2PNR C;  3NHH A;  1PFM A;  1SJH D;  2BCO A;  4HED A;  1JMC A;  3FRP B;  1A2U A;  1N33 Q;  2EYL A;  1ROD A;  3FMC A;  1KRS A;  1VF7 A;  4B9W A;  4L6T B;  4IPC A;  4RGN A;  2CHB D;  4IZ8 A;  2E76 C;  1E2W A;  3VYS A;  4JC0 A;  3I4N H;  3ERQ A;  1WTP A;  1N33 L;  3P75 A;  4QMG A;  4QF4 A;  2NVQ H;  5C6A A;  2K52 A;  1Y69 U;  4DR5 Q;  2BE5 C;  1D8L A;  4BS9 A;  3BS1 A;  4JG2 A;  4HJ9 A;  5ELN A;  1YVC A;  5IYC G;  1XNQ Q;  2RHQ B;  2CQO A;  2VUM H;  4K14 A;  5IYD G;  4KI0 A;  3GTL B;  1Y8N B;  1ML0 D;  2I5M X;  1PA6 A;  3S17 B;  1LAC A;  4HJ7 A;  2YTY A;  3S1Q H;  1DCZ A;  1MJC A;  1SJE D;  4EQP A;  4QGU A;  1LT5 D;  2B2U C;  3J7Z C;  3RLN A;  3S2H H;  1K83 B;  4IUR A;  2PZW A;  2I5H A;  1VF5 C;  2EOT A;  4PZ7 A;  1SE8 A;  4WJW A;  1HZ9 A;  4IOC A;  4DR4 Q;  3GO5 A;  4BBR B;  1VQF A;  4H02 A;  5CV8 A;  4XQQ A;  2J0T D;  3ERS X;  1PTO F;  3I3C A;  3MXP A;  4A3F G;  2XVS A;  3PMF A;  4FVM A;  3M4Y A;  1B50 A;  5M3F B;  3V05 A;  3F2D A;  1STH A;  1CHQ D;  2QDL A;  4OWT B;  4OWX B;  4C3I H;  2MJ8 A;  4B3S Q;  4DK6 C;  1U4L A;  3SK4 A;  5C3E H;  4RMF A;  1Y1W G;  4P73 A;  4B9X A;  1N36 L;  2KQ3 A;  1JCK B;  1PFB A;  5G3L F;  5I2Y A;  2MNA A;  5HY6 A;  5BR8 L;  1GKH A;  3G4S A;  2EY6 A;  1HQR D;  1QWY A;  2WAQ B;  2WP8 J;  1KNE A;  5KNC A;  1EU3 A;  1N8R C;  4B3R Q;  4DR7 Q;  1CA6 A;  4A3I G;  1HZB A;  4KHP L;  1I50 H;  3BDC A;  3GTJ B;  5IOD A;  1B1Z A;  4X65 Q;  3PO2 G;  5G3L D;  1JB7 A;  1D5Z C;  4N9P A;  1AH9 A;  4BA1 I;  4FXK C;  4HIK A;  2WB1 G;  2KHS A;  3Q22 A;  2UUA Q;  3CXC A;  5I4D A;  3A74 A;  1RF2 D;  3G71 A;  1RHP A;  1Q8K A;  4LAA A;  1HTL D;  1BQQ T;  1X32 A;  1A6X A;  1WTQ A;  2R6G A;  1TT2 A;  3S15 H;  1PMR A;  4KJN A;  5JJI A;  2KCM A;  5ISR A;  2Z8L A;  4BY7 B;  3J7A 5;  4KN7 C;  1SYG A;  2WIN B;  2NZH A;  1HUM A;  4C2M B;  2B63 H;  3NTH A;  5D3D A;  4F87 A;  2F0P A;  5CR3 A;  4IPD A;  3HOY H;  4XYQ A;  2A73 B;  3G7L A;  2A6H D;  4A3M B;  2VNU D;  1IBM Q;  1V9P A;  4KKT A;  1PYS B;  2B2W A;  4LK1 C;  4K2L A;  5DEH A;  3DM1 A;  3FKI H;  4RFB A;  1IW7 C;  3EIV A;  4GZY C;  1CKN A;  4DUZ L;  1V43 A;  3H0G B;  1FL0 A;  1EWC A;  1I6V C;  1ENC A;  1PH6 A;  1XNR L;  5E4X A;  3M4O B;  2DGY A;  4DV5 L;  3DEP A;  1WD1 A;  4IUT A;  4AYB G;  2CH4 W;  2IT1 A;  1J5E Q;  4A3G B;  4G7H C;  1SSO A;  2LKV A;  5ELC A;  1O7I A;  4DAP A;  1SND A;  2EY1 A;  1DD2 A;  2GVB A;  2OTL A;  3Q6S A;  4NW2 A;  1RCV D;  5BN5 A;  2F0T A;  1WD0 A;  5A35 A;  4DR3 L;  4FYD A;  4QUF A;  3M4P A;  3BYY B;  4RHR A;  5FO8 B;  4LF9 Q;  1XMO Q;  5DM6 3;  1TWF H;  4NB3 A;  1STA A;  4DUY Q;  2K7V A;  2K50 A;  5K36 H;  1A2T A;  2NTS A;  3UDF A;  4JI0 L;  1CZW A;  1KDA A;  5C44 G;  2LXJ A;  3CC7 A;  3DMU A;  1KHI A;  1HNZ L;  2BDO A;  1Q82 C;  2ZT9 C;  4OIK A;  4FF2 A;  2LMC B;  3V2T A;  3U4V A;  1J6Q A;  3FPU B;  2F1M A;  1V1Q A;  1EIY B;  2F4V Q;  1KIX A;  1B4O A;  2G9H D;  1C4Q A;  3WOF A;  2Q2H A;  1VCI A;  2HCC A;  3HZX A;  1LAB A;  3HOZ H;  1OO9 B;  1R9T H;  4X66 L;  5KIX A;  4X62 L;  1IW7 D;  3K81 C;  3K5N A;  2FMC A;  4FXG C;  2OWO A;  1Q90 A;  5HGT A;  3GTL H;  1GXD C;  3KF8 B;  1F9S A;  2EYJ A;  3T53 B;  1EFW A;  3PO3 G;  3IAY A;  3BVZ A;  3JAM c;  4N8X 1;  1IL8 A;  2K32 A;  1V1P A;  2VW9 A;  2EJF C;  3S2H B;  2R7D A;  2VXW A;  5J1Z A;  1VQM A;  3TQY A;  3K6O A;  1TWH H;  4A3D G;  5LMU L;  4QQB X;  1CA5 A;  5M5Y B;  1HA5 A;  1F9P A;  2SNS A;  5CMD A;  4DK1 A;  3GTG H;  2F0E A;  2AHO B;  1NBW A;  1BOS A;  1LYL A;  2SNM A;  4PMW A;  2JN4 A;  2KCT A;  3CQZ B;  2CCZ A;  5EAY A;  2EQS A;  1EEI D;  1BNZ A;  3QG1 A;  4DUZ Q;  2DUD A;  5AFW A;  3HOX G;  1PTO B;  4JOI A;  3HKZ E;  4ZYS A;  1QG7 A;  1I4R A;  2AWN A;  2EYM A;  1WTO A;  3AU7 A;  2OTJ A;  3W1G A;  3Q0A A;  1HH2 P;  3CF5 A;  4RA8 A;  5IWA L;  1RKN A;  2F0V A;  2NVT B;  5CBE E;  1VQ4 A;  4OEL B;  1W2B A;  3K58 A;  4RGM A;  1LTG D;  3GDE A;  1X6O A;  3DWP A;  3D4R A;  4A3K B;  3OIP A;  4A3C H;  4A4I A;  3KF6 A;  4L63 B;  4GLA C;  4B3S L;  5EKL A;  5IGG A;  1STE A;  4TKO B;  2AMC B;  2HIX A;  3PUW A;  1HR0 Q;  3CC2 A;  3PSI A;  1ONL A;  4DV5 Q;  3H6M A;  4LFB L;  3S14 H;  2A6E C;  1AZP A;  1BBW A;  4CBV A;  4R1J A;  2G9D A;  2JA5 B;  3D6W A;  2WKC A;  2I07 B;  2HHH L;  3CC4 A;  1F2L A;  3BU2 A;  4NDX A;  3BDO A;  5IGE A;  2K5H A;  4I65 A;  4K6L A;  4KHZ A;  1E3P A;  2WFW A;  4FF4 A;  3V96 A;  4X3U A;  4V19 0;  4IFD I;  3NEN A;  4C56 C;  4HTH A;  5AJ3 Q;  4UP8 A;  3C46 A;  1A15 A;  3L9A X;  1MJE A;  5FOB B;  2EJG C;  1LV9 A;  1NY4 A;  2CH4 A;  5JJZ A;  2B2Y C;  5ELB A;  3STB C;  3UE1 A;  4NXM Q;  4JI2 Q;  1CUK A;  5IYB H;  5JEA J;  1EIF A;  1CHP D;  1TWA H;  3S1R B;  3C2P A;  3HOU B;  4MIU A;  1VQE A;  5DAU A;  3CMA A;  5K5P A;  4CDE C;  4C3J B;  1MKH A;  4A3B H;  1WYD A;  1E0B A;  1LT6 D;  3QWN A;  1E7Z A;  1X3P A;  4DXF A;  3E0J A;  3HOZ B;  3UI2 A;  3D3R A;  1G8Z D;  1OXX K;  1IKM A;  2EY5 A;  2WAQ E;  1F2Z A;  5FLX c;  3A8I E;  1J9O A;  3MXU A;  4JI3 L;  2VS1 A;  2KVM A;  5C4X B;  5HGQ A;  3FKI G;  4A3J H;  3MHB A;  4U68 A;  2M00 A;  2OF1 A;  4HJ8 A;  2UU9 L;  4JW0 A;  5LL6 S;  1VQ5 A;  5JVG 3;  1KLU D;  3VR2 A;  5JAV A;  4A3B B;  3VA7 A;  5I9P A;  3I91 A;  1SYF A;  3F8T A;  1EZ6 A;  1BUV T;  2RBM A;  4DNT B;  4JYA L;  2MO1 A;  5COR A;  3HOU H;  5M5X B;  3D4W A;  3CCM A;  3LX0 A;  1J5E L;  2NN6 G;  4X3K A;  1JOQ A;  4JI8 Q;  1BKB A;  3A55 A;  4EQO A;  2QCP X;  1XPO A;  2KJX A;  4GN3 B;  2V1C C;  2VQF L;  1WCM G;  4JI3 Q;  4LF9 L;  1DON A;  1CFM A;  4JI1 Q;  2A6E D;  3OW7 A;  4KV6 A;  3UDX A;  5LMN W;  1D7Q A;  1WI5 A;  2WV6 D;  3MWY W;  1UE5 A;  3HG9 A;  1XMQ L;  1TXY A;  1HRJ A;  3QB3 A;  3JAM L;  4LF5 Q;  2E2D C;  4C3H B;  4YWL A;  2Z0S A;  3Q24 A;  3K7U C;  2BA1 A;  3E5S A;  5C3W A;  3ULJ A;  5JPM C;  4E6I A;  1NJI C;  4HJA A;  3GTG B;  2VUM G;  3A8J E;  3OOC A;  2M2L A;  4KN4 C;  2QW7 A;  3OTO L;  2A6H C;  4CKE A;  2QEX A;  1ZEQ X;  4X6A H;  1BCP D;  4N9T A;  3RUZ A;  1AW7 A;  4CGY B;  3NXW A;  3TRE A;  2B2T A;  1X65 A;  1DXM A;  4IOA A;  3FEW X;  1SMX A;  3PIP A;  1O78 A;  4IQZ A;  3J81 L;  1Y1V G;  5EGT A;  4K2K A;  1D2B A;  1A3T A;  3MTS A;  1QNK A;  2F0U A;  1IBL L;  2XWB B;  3IRB A;  2PI2 E;  4A3D H;  5EPL A;  5M3F G;  4KHP Q;  3HKZ B;  4LNQ A;  3I72 A;  2AQ3 B;  4IUN A;  3K7A H;  4PV1 C;  2B39 A;  3I4N G;  1PZI D;  1STY A;  2G5D A;  2NB0 A;  2QEJ C;  2E2J H;  1CI3 M;  1MSH A;  5CV5 A;  2JA8 B;  3BYT B;  5C4Z A;  1HZA A;  4X62 Q;  1EU4 A;  3K0X A;  3KUP A;  2Z4H A;  3KLS A;  1SAP A;  2EJM A;  2NUC A;  2KEE A;  2WAQ G;  2RDF A;  1PRT B;  1Q81 C;  2SDF A;  3EFX D;  4A3I B;  2VZA A;  4LW1 A;  3J7Y W;  2XNA C;  1IL2 A;  1Y1V H;  3KF8 A;  4KJO A;  1G6Z A;  4R4C A;  3S1N B;  1H9K A;  1QE6 A;  3M3Y B;  1JC7 A;  1K73 C;  4GNX B;  3PF4 A;  3K5L A;  3CME A;  1G91 A;  4WOR A;  1D5X C;  2JEB I;  3PO2 H;  1JB3 A;  1S3O A;  4CJ0 B;  1ESF A;  3DXJ C;  4C3I G;  2ZXP A;  2OXP A;  2WKD A;  2XGT A;  4YY3 Q;  2Y0S G;  4PZ6 A;  2AKW B;  3VYR A;  3S1M H;  1EOV A;  4DV7 L;  3OWF A;  4A93 G;  2D9U A;  2LS0 1;  1WJJ A;  4UAI A;  3RZD H;  4H44 C;  1SFO B;  4IPH A;  1NE3 A;  2XWJ B;  1XPU A;  1TWF B;  5LMU Q;  2K01 A;  1E22 A;  1N36 Q;  2Z6K A;  2PQA B;  3R8B A;  1EY5 A;  3QJY A;  4FNF A;  1BBU A;  3RNU A;  1VS0 A;  4DN4 M;  1I4G A;  1LTB D;  1RTO A;  3DM3 A;  3SXH A;  2IWH A;  3SEB A;  4O1N A;  1PFN A;  2ZTC A;  2VL6 A;  1I4Q A;  2DY8 A;  4EX5 A;  1BVS A;  1PRT F;  2CW0 D;  2D0P A;  1I6H B;  2RVL A;  3MVV A;  3OSO A;  5COY A;  3FDT A;  2B8G A;  2C35 B;  2K05 A;  3H0G H;  4O42 A;  4OO1 H;  1PTO C;  5IP9 G;  1R9T B;  2PPB C;  4GS3 A;  1G2T A;  1SMY C;  4I7A A;  1HJP A;  3KDF B;  1K83 H;  2KEN A;  4HSV A;  1QZH A;  3CCS A;  2FJ2 A;  1N34 Q;  2HDM A;  2UUC Q;  3DHQ A;  4LFC L;  4LF6 L;  1A62 A;  3ICE A;  2MUY A;  5M5W H;  4TRD A;  3L2P A;  4OEM B;  1WTR A;  4XT3 B;  4BBR G;  2L1B A;  4JI6 L;  5EQ0 A;  3C3L A;  3TZU A;  3FHW A;  2LXK A;  1EL0 A;  4YHH L;  1PH2 A;  1ASZ A;  4C3H H;  1IHZ A;  1UUP A;  4R9W A;  2NVQ B;  2A19 A;  2MP1 A;  5C44 B;  1CSP A;  3T16 A;  1GUT A;  1H9S A;  1MSG A;  3U58 A;  2Y0S E;  3SK6 A;  4ZKC B;  4JBK A;  5DM7 3;  4Q5V A;  4IJH A;  3T1Y Q;  1SRO A;  3J81 j;  1Q7Y C;  1TKW B;  3TP7 A;  2EZV A;  3J81 E;  1JJG A;  2E74 C;  4L5Q A;  5D3I B;  5ELF A;  5FO7 B;  3GTM B;  3T4A C;  5F2D A;  1KRT A;  1I4H A;  1K28 A;  3S2D H;  3PO3 H;  2PCF B;  2MQH A;  1Y14 B;  4LFA Q;  3CW2 C;  4DGZ A;  2GA4 B;  3BZK A;  4XXE A;  2K5W A;  5J3B A;  1W6J A;  2O5I C;  1A0I A;  5E1F A;  1VQL A;  1WFQ A;  1PH7 A;  1OXS C;  2Q2U A;  5FLX E;  1YZ6 A;  1B8A A;  3VR3 A;  3AFQ A;  1A63 A;  4KY7 A;  4C3J H;  1O7Y A;  1SE3 A;  3A54 A;  4HCE A;  4IUQ A;  4PQX A;  5C0X H;  1D6E C;  1SNO A;  2UUA L;  4JI7 Q;  4C2M H;  2B63 B;  2F0F A;  4JI5 Q;  1T5X D;  4V0B A;  1XTD A;  4Z9C B;  4M8A A;  1B9M A;  4DFA A;  3G48 A;  3PIO A;  1EYG A;  4X64 Q;  2Z6K C;  5EBD A;  3PV0 A;  4B08 A;  3QO2 A;  2JA7 G;  3SE0 A;  2F0L A;  3NWS A;  1WVL A;  1ZYR C;  2JJQ A;  2ENB A;  2IY5 B;  4Q0F A;  5JJL A;  1Y8P B;  4FF3 A;  1L0W A;  1SBB B;  1S40 A;  1ET6 A;  2OT2 A;  3K5O A;  1S5D D;  4DF7 A;  2Q8T A;  4A3K G;  1MHW C;  1NMG A;  1S4Z A;  1XMQ Q;  1KNA A;  2OEO A;  2R7F A;  4KY5 A;  1O80 A;  2ZJQ A;  3U4Z A;  4ID6 A;  1XX8 A;  3RN2 A;  4HJ5 A;  4DK3 C;  3TME A;  1JWS D;  3OMG A;  3K5M A;  1LO5 D;  5ELD A;  4A3G G;  1BR9 A;  2QIL A;  4GNX A;  1VQA A;  3U50 C;  3L0O A;  3LWU A;  3I4O A;  3IFD A;  1B9N A;  3K0Y A;  3GTO H;  1U4P A;  3RZD B;  1I6H H;  4ILW A;  4DV2 L;  2R92 G;  2B3G A;  2JA5 H;  5IP9 H;  4DV4 L;  4BXX G;  1JJ2 A;  1PRT D;  4A76 A;  1KAW A;  1TII D;  4CJ2 C;  3MZ5 A;  2IL8 A;  3H09 A;  4GLX A;  2DN8 A;  1SR3 A;  3BDL A;  3NBI A;  1K9M C;  3PUV A;  1JWU D;  1W3S A;  4DUY L;  3ZYY X;  3BJU A;  1HNX L;  1UWV A;  4ZLT F;  4BBS G;  4L5S A;  5I6Y A;  3LWE A;  1YBY A;  2WB1 E;  3S2D B;  1N32 L;  2E2H H;  1NMF A;  1BF4 A;  1Q1E A;  2F0W A;  2EYP A;  4RCN A;  5LHY 1;  2HD3 A;  1EWH A;  5A2Q E;  4LUZ A;  3GV3 A;  2UUB Q;  4DV3 L;  4RCO A;  4K5X A;  1P16 A;  2FIN B;  4JK1 C;  1YIJ A;  4G57 A;  4ZUJ A;  3VR4 A;  5E7N A;  1YHQ A;  2I0Q A;  4IUV A;  4LMQ D;  3G6E A;  4HSP A;  4IUP A;  1FGB D;  4HIM A;  3A7A B;  4I7Z C;  3TP8 A;  1X9N A;  4BY1 G;  3A56 A;  1SN8 A;  4JI8 L;  1JQY D;  2IX3 A;  1H9J A;  2JA8 H;  3PCO B;  1JOO A;  2AQ2 B;  1YJN A;  4POF A;  2A68 C;  1HHV A;  1VQP A;  5D14 A;  4OL7 A;  4PMC A;  1ZYR D;  4A3E B;  3TP6 A;  2DNC A;  3KOJ A;  5C0X J;  4L8J A;  4FDB A;  1X3E A;  1C48 A;  2AWO A;  4J1M A;  2R93 H;  1KC8 C;  4NXN Q;  4R8I A;  1V1P B;  2SOB A;  3E9H A;  1AFP A;  1N34 L;  5ELE A;  3F2B A;  4JI4 L;  3HOY G;  2F0D A;  1JT8 A;  3PUY A;  4BWG B;  1TVX A;  2J7Z A;  1Z47 A;  2R61 A;  2NN6 I;  2F3I A;  1CT1 D;  3NPP A;  3J80 L;  4POG A;  1Q12 A;  1QB5 D;  2BDN A;  2JA6 B;  3KBX A;  3T13 A;  3FPP A;  4YHH Q;  2F0O A;  4WRD A;  4A3D B;  2EVB A;  3E3X A;  4FF1 A;  4JI2 L;  2YYZ A;  3IL8 A;  4IUU A;  4BY7 G;  2L12 A;  1I5F A;  1QVC A;  1KAB A;  1S5C D;  1VQ7 A;  4PZ8 A;  1SNP A;  1TWC H;  2K28 A;  5C3E G;  3DLL A;  2EXD A;  2XIW A;  1STB A;  2A74 C;  4YCU A;  3TRZ A;  3EBE A;  1WTW A;  1EIG A;  4ZRZ A;  1JWM D;  2C5C A;  4ZAI A;  3D31 A;  1NCV A;  2NN6 H;  3I4M G;  2MGS A;  4LFA L;  1B70 B;  3Q8D A;  1WTH A;  4UPA A;  5M9O A;  4P75 A;  3T1H Q;  2GN5 A;  1EY6 A;  4X3T A;  4DV4 Q;  3I4L A;  3M3Y H;  3VR6 A;  3EJI A;  4IFD J;  3VYT A;  2L55 A;  4OX9 L;  1K8O A;  1NNX A;  1QCB D;  3UE0 A;  3M4O H;  4A3F B;  4A3J G;  5CV4 A;  4K5W A;  4YCW A;  1IBM L;  1ESR A;  1ILP A;  3G6J B;  4NKL A;  3U9S A;  1K8A C;  2NVY H;  4AYB B; 
#chains in the Genus database with same CATH homology
 3OTO L;  2QEX A;  2OQ0 A;  2JEA I;  5C0X G;  4DR1 Q;  3H3V H;  4X6A H;  4BY7 H;  2ID0 A;  1PH5 A;  3CPW A;  3CCU A;  4J15 A;  1X56 A;  3K8A A;  3PUX A;  2I5L X;  2ALY B;  2E5L Q;  1JMC A;  3UDG A;  4O0A A;  1N33 Q;  4GOP A;  3TRE A;  4APV A;  1X65 A;  5C4X H;  5IP7 G;  4BA2 I;  4IOA A;  3CQZ H;  1SMX A;  3PIP A;  2A8V A;  4DV3 Q;  2LSS A;  3VDY A;  1Y1V G;  3GD7 A;  1KRS A;  1VQD A;  4ME3 A;  4OWW B;  4IJL A;  1TWG H;  4IPC A;  5IWA Q;  4A3L H;  4UP7 A;  2VQE L;  3PF5 A;  2Q2I A;  4BBS H;  3KF6 B;  4JC0 A;  1IBL L;  3I4N H;  3IRB A;  2E5L L;  1N33 L;  2R7Z H;  3B6Y A;  2PI2 E;  3CD6 A;  4A3D H;  3I7F A;  1HNZ Q;  2NVQ H;  2K52 A;  1OTC A;  1QUQ A;  4DR5 Q;  4JI1 L;  1QUQ B;  1D8L A;  4JG2 A;  4HJ9 A;  5IY0 A;  4OXP A;  2VY3 A;  5M3F G;  5ELN A;  1YVC A;  5IYC G;  1GM5 A;  2RHQ B;  3TS0 A;  4LNQ A;  2CQO A;  1XNQ Q;  5IYD G;  2VUM H;  4KI0 A;  3K7A H;  3I4N G;  2I5M X;  1XNQ L;  2E2J H;  3ULP A;  3CCV A;  1PA6 A;  1XMO L;  3T1Y L;  2E2I H;  4MZ9 A;  4HJ7 A;  2YTY A;  3S1Q H;  5C44 H;  1HZA A;  1MJC A;  4X62 Q;  1HR0 W;  5GAD C;  3D0F A;  1H95 A;  2JE6 I;  2YV5 A;  4QGU A;  3J7Z C;  5DLQ E;  3K0X A;  3RLN A;  4A93 H;  3S2H H;  4DR2 Q;  1CSQ A;  2I5H A;  4DAM A;  2VQF Q;  4B3M L;  3KLW A;  1GVP A;  4PZ7 A;  1SE8 A;  2WAQ G;  1PH9 A;  1Q81 C;  1HZ9 A;  4IOC A;  4DR4 Q;  3GO5 A;  2VZA A;  1VQF A;  1VQK A;  4H02 A;  1JJC B;  4ALP A;  4LW1 A;  4LF5 L;  1OXU A;  1KXL A;  2OCE A;  4JI7 L;  1Y1V H;  3ERS X;  4A3F G;  4OON A;  2B29 A;  1IL2 A;  4R4C A;  2VQE Q;  3KFU A;  1PVO A;  4B3T L;  4DR3 Q;  3F2D A;  1YJ9 A;  4OWT B;  4OWX B;  1K73 C;  4B3S Q;  4C3I H;  4BXX H;  4R4O A;  4DK6 C;  4GNX B;  5C3E H;  4RMF A;  2IX1 A;  1Z9F A;  3PF4 A;  2UUB L;  3CME A;  3L7Z C;  4LUO A;  1Y1W G;  1Q46 A;  4P73 A;  3T1H L;  2JEB I;  1N36 L;  5BR8 Q;  1RL2 A;  3JAM i;  2L15 A;  3H0G G;  2KHI A;  3PO2 H;  2MNA A;  1S3O A;  4OO1 G;  5HY6 A;  3SGI A;  5BR8 L;  4IFD G;  1GKH A;  3G4S A;  2YTX A;  3S1R H;  2XGT A;  4YY3 Q;  5M3F H;  2UU9 Q;  2Y0S G;  2WP8 J;  2AKW B;  4PZ6 A;  4DV1 Q;  1EOV A;  4DV7 L;  1T9H A;  1QZG A;  1N8R C;  1IBK L;  4DR7 Q;  4A3E H;  4B3R Q;  4A93 G;  4A3I G;  1IYJ B;  1WJJ A;  1HZB A;  3RZD H;  3HOW H;  2ZJP A;  4B3R L;  4KHP L;  1I50 H;  1GO3 E;  4X65 Q;  2MO0 A;  1NE3 A;  4IPH A;  4LF7 Q;  4LF8 Q;  3PO2 G;  2PMZ E;  4DR5 L;  3OTO Q;  1JB7 A;  1XPU A;  5LMU Q;  1AH9 A;  1WOC A;  4BA1 I;  1E22 A;  1YI2 A;  4DPG A;  4HIK A;  2Z6K A;  2PQA B;  1N36 Q;  2WB1 G;  2CWP A;  4GKK L;  1PYB A;  1HNW Q;  4IPG A;  1C0A A;  4DAY B;  1BBU A;  3CXC A;  2UUA Q;  3RNU A;  4QY7 A;  3S24 A;  1VS0 A;  3A74 A;  3S16 H;  1VQO A;  2IHE A;  4JI5 L;  3DM3 A;  4X66 Q;  4LF4 Q;  2YTV A;  3HOX H;  3G71 A;  4O2D A;  5LMN L;  4GOP C;  4AQY Q;  1Q8K A;  3PGZ A;  4JI6 Q;  3RR5 A;  3E9I A;  1PV4 A;  1RIP A;  5GRO A;  4Y52 H;  2ZTC A;  3KYH C;  1YIT A;  2VL6 A;  4WJ3 M;  2RCN A;  2R6G A;  4EX5 A;  2UXB Q;  1BVS A;  3S15 H;  2D0P A;  4GN5 A;  3STB D;  2KCM A;  5JJI A;  2HIV A;  3NBH B;  3MEF A;  2RHS B;  3M85 A;  1FJG Q;  3J7A 5;  4AYB E;  1IXR A;  3H0G H;  2C35 B;  4LFB Q;  1P8L A;  1K3R A;  3NEM A;  4DNI A;  2NZH A;  5IP9 G;  1UE7 A;  4LWC A;  2B63 H;  1VQ9 A;  4GS3 A;  5FJ8 G;  4DV1 L;  4DR2 L;  1HJP A;  3KDF B;  1K83 H;  3HOV H;  2BA0 A;  1JE5 A;  4IPD A;  3HOY H;  4JBJ A;  4DR6 Q;  1SFO H;  2KEN A;  1YJW A;  1Q86 C;  1QZH A;  1X55 A;  4A3G H;  2VNU D;  3CCS A;  1CKO A;  1IBM Q;  4JYA Q;  1N34 Q;  1V9P A;  2UUC Q;  1Q1B A;  4LFC L;  4A3I H;  4LF6 L;  1PYS B;  5IYD H;  3W1B A;  1A62 A;  4YWM A;  5M5W H;  1FJG L;  5H1S E;  3ICE A;  1GD7 A;  3L2P A;  4BBR G;  3AYH B;  4P71 A;  4JI6 L;  3FKI H;  3HKS A;  1NTG A;  3EIV A;  3FHW A;  2LXK A;  4YHH L;  4R4T A;  1PH2 A;  1ASZ A;  1CKN A;  3ER0 A;  4C3H H;  1VQ8 A;  2N49 A;  4DUZ L;  1V43 A;  2A19 A;  1VQC A;  1UEB A;  3CPF A;  1CSP A;  3UDI A;  5FLM G;  3HFZ B;  5M3M H;  4L5R C;  3U58 A;  1FL0 A;  2Y0S E;  1X3G A;  1OXT A;  2E8G A;  1PH6 A;  1XNR L;  4JBK A;  4IJH A;  3T1Y Q;  2QGQ A;  1SRO A;  2DGY A;  4AH6 A;  3J81 j;  4DV5 L;  5GAE C;  1Q7Y C;  1JJG A;  4L5Q A;  4KHP Q;  4BY1 H;  1PH3 A;  1EQQ A;  4AYB G;  1J5E Q;  2IT1 A;  4GN4 B;  5JEA G;  4A3M H;  1HZC A;  5FLM H;  3J81 c;  3CCE A;  1O7I A;  5C4J H;  4NXM L;  1KRT A;  4NXN L;  2GVB A;  2NVX H;  3PUZ A;  2OTL A;  3S2D H;  2UXD Q;  3PO3 H;  3NEL A;  3I4M H;  4DR3 L;  5FJ8 H;  3TS2 A;  2MQH A;  1Y14 B;  2H5X A;  1A8V A;  4LFA Q;  3GTK H;  1WCM H;  2PQA A;  3CW2 C;  3M4P A;  4PG3 A;  4LF9 Q;  1SRU A;  1XMO Q;  2FXQ A;  2ZJR A;  2D62 A;  3BZK A;  1TWF H;  5J3B A;  4NB3 A;  2JK8 A;  4DUY Q;  2K50 A;  1A0I A;  1KQS A;  3UDF A;  1VQL A;  4JI0 L;  1G51 A;  1WFQ A;  4DV0 L;  1VQJ A;  2K4K A;  2LXJ A;  5IE8 A;  1LUZ A;  5C44 G;  3CC7 A;  1KHI A;  1PH7 A;  1HNZ L;  3GTQ H;  1OXS C;  2Q2U A;  4GKJ Q;  1YZ6 A;  1Q82 C;  1B8A A;  2A1A A;  2UXC L;  3U4V A;  1YEZ A;  1J6Q A;  3AFQ A;  1C9O A;  2F4V Q;  1V1Q A;  1EIY B;  1A63 A;  1KIX A;  1PFS A;  1CKM A;  2HT1 A;  4C3J H;  1L1O C;  4Y7N H;  2D0O A;  2Q2H A;  1VCI A;  1C7Y A;  4AQY L;  2UUA L;  2YU9 H;  4JI7 Q;  3HOZ H;  1VQH A;  4AIM A;  4R4Q A;  4YWK A;  4C2M H;  4A3M G;  1R9T H;  4X66 L;  4JI5 Q;  4GKJ L;  3RLF A;  4X62 L;  2K14 A;  1B7Y B;  2NZO A;  2BH2 A;  3K81 C;  1XTD A;  2UXC Q;  1YHB A;  1OXV A;  4TVA B;  4LF8 L;  2UXB L;  2N8N A;  3EN2 A;  3TEH B;  2JA5 G;  2OWO A;  1YHA A;  3M4Q A;  4QJF A;  3CAM A;  3ULL A;  3GTL H;  4YCV A;  1UE6 A;  2RF4 A;  3KF8 B;  2IX0 A;  3G48 A;  3PIO A;  1EYG A;  1YNX A;  1EFW A;  3PO3 G;  4X64 Q;  2Z6K C;  2ATW A;  5K36 G;  3PV0 A;  4DR7 L;  3JAM c;  2JA7 G;  1AE2 A;  2VW9 A;  2JJQ A;  2IY5 B;  2R7D A;  4K0K Q;  5JJL A;  1VQM A;  1L0W A;  4HID A;  3RN5 A;  1S40 A;  3TQY A;  3S1M H;  1TWH H;  4A3D G;  1SLJ A;  5LMU L;  4QQB X;  3GTM H;  4IO9 A;  4A3K G;  4MTN A;  2UXD L;  3GTG H;  2QA4 A;  1VQ6 A;  2AHO B;  1E1O A;  1LTL A;  1G6P A;  1NMG A;  1XMQ Q;  2JA7 H;  1NBW A;  1I3Q H;  2R7F A;  1EQR A;  3J80 i;  1LYL A;  4PMW A;  2KCT A;  2PI2 A;  3U4Z A;  2CCZ A;  2ZJQ A;  5EAY A;  2CFM A;  4EQ5 A;  1IBL Q;  3RN2 A;  2EQS A;  1X3F A;  1E1T A;  4HJ5 A;  3HOU G;  4DK3 C;  4DUZ Q;  2DUD A;  3HOX G;  4A3G G;  4JOI A;  3HKZ E;  3CCJ A;  2KBN A;  1VQN A;  4GNX C;  4GNX A;  2AWN A;  1VQA A;  2OTJ A;  4L5T A;  3F2C A;  3U50 C;  3L0O A;  3W1G A;  3H3V I;  3I4O A;  1HH2 P;  3CF5 A;  1VQG A;  3HOZ G;  1K8G A;  1E24 A;  5IWA L;  3GTO H;  4X65 L;  1S72 A;  4LF7 L;  3LGJ A;  1FGU A;  1I6H H;  2ZTD A;  3I56 A;  4UY8 C;  4A3F H;  4DV2 L;  2R92 G;  2B3G A;  3I55 A;  1VQ4 A;  4B3T Q;  1QVG A;  1N9W A;  1W2B A;  3BZC A;  4DV2 Q;  4GOP B;  3GDE A;  4JBM A;  4XTC S;  2JA5 H;  1X6O A;  5IP9 H;  2R92 H;  4DV4 L;  4BXX G;  1G29 1;  4A3C H;  1I94 L;  1JJ2 A;  4A4I A;  5IP7 H;  3KJO A;  3KF6 A;  1KAW A;  4A76 A;  5C4X G;  4OO1 I;  4A3B G;  3RZO H;  3I2Z A;  2ES2 A;  2JA6 G;  4GLA C;  4JOI C;  5ELO A;  2HQL A;  2MFI A;  4GLX A;  4B3S L;  2EIF A;  2OQK A;  3HOV G;  1SR3 A;  3OW2 A;  1K9M C;  3PUV A;  1W3S A;  4DUY L;  1XNR Q;  3BJU A;  4LF4 L;  2AMC B;  1M90 C;  1HNX L;  1AE3 A;  2HIX A;  3PUW A;  4QIW E;  1HR0 Q;  3PSI A;  3CC2 A;  4DV5 Q;  4LFB L;  1UWV A;  3ZJY C;  5GAG C;  3S14 H;  4BBS G;  4L5S A;  1BBW A;  3S1N H;  2K5V A;  4R1J A;  2JA6 H;  4A3K H;  1YBY A;  4A3E G;  4OX9 Q;  2WB1 E;  1N32 L;  4DKA C;  2HHH L;  2E2H H;  3CC4 A;  1NMF A;  2ASB A;  1Q1E A;  3BU2 A;  2PNH A;  2HHH Q;  2K5H A;  2IHF A;  4KHZ A;  4LUZ A;  1UE1 A;  4XIG S;  5GAH C;  2UUB Q;  1E3P A;  2WFW A;  4DV3 L;  1CKN B;  3A0J A;  2KHJ A;  1P16 A;  2N78 A;  3HOW G;  4IFD I;  5M3M G;  1YIJ A;  4LF6 Q;  3NEN A;  4LFC Q;  4GKK Q;  1HNW L;  1L1O B;  5E7N A;  5AJ3 Q;  1YHQ A;  1L1O A;  4UP8 A;  2I0Q A;  2F4V L;  3A5Z B;  3G6E A;  1DGS A;  1XJV A;  4HIM A;  1MJE A;  1NY4 A;  1X9N A;  4BY1 G;  4JI8 L;  1SN8 A;  3STB C;  1PHJ A;  2Q2T A;  3UE1 A;  4NXM Q;  3J80 c;  4R4I A;  4JI2 Q;  2JA8 H;  3PCO B;  3S17 H;  1CUK A;  5IYB H;  1YJN A;  2N3S A;  5JEA J;  1EIF A;  4POF A;  4P74 A;  2ZTE A;  3K80 C;  2K75 A;  5LMN Q;  1TWA H;  1VQP A;  3J81 i;  3AQQ A;  1VQE A;  3HKZ G;  3CMA A;  2UUC L;  3A5U A;  3MXN B;  1PH1 A;  1MKH A;  3KOJ A;  5C0X J;  5IYC H;  1WYD A;  4A3B H;  1ASY A;  4FDB A;  5JJK A;  1E7Z A;  2B63 G;  3M9B A;  1X3E A;  2CKZ B;  2AWO A;  4X64 L;  2R93 H;  1KC8 C;  4NXN Q;  3M7N A;  2JQO A;  3F1Z A;  1N32 Q;  3WWV A;  1K0R A;  1U5K A;  3FP9 A;  3E9H A;  1OXX K;  4NPS A;  3CP0 A;  2ZM6 Q;  4DV6 L;  1I94 Q;  2WAQ E;  1N34 L;  3F2B A;  5FLX c;  4JI3 L;  4JI4 L;  3HOY G;  4DV6 Q;  1JT8 A;  1HR0 L;  3PUY A;  2VS1 A;  1VQI A;  4BBR H;  1Z47 A;  2NN6 I;  2F3I A;  4WJ4 A;  3W5O A;  4POG A;  5HGQ A;  1Q12 A;  3FKI G;  4A3J H;  4HIO A;  4YHH Q;  1X54 A;  1XPR A;  4RG1 A;  4DV0 Q;  4HJ8 A;  4JBW A;  4YY3 L;  1PH4 A;  4A75 A;  2UU9 L;  5C0X I;  1VQ5 A;  4JI2 L;  5GQO A;  2YYZ A;  4BY7 G;  1IBK Q;  1L2F A;  4B3M Q;  1I5F A;  1QVC A;  4JV5 L;  4JI4 Q;  3F8T A;  1EUJ A;  1VQ7 A;  4JYA L;  4PZ8 A;  2JA8 G;  2MO1 A;  1TWC H;  4QL5 A;  3HOU H;  5IYB G;  5C3E G;  3DLL A;  2EXD A;  3CCM A;  4LUV A;  1J5E L;  2NN6 G;  1KL9 A;  5IT9 c;  4DR4 L;  4YCU A;  1FVI A;  5M5Y H;  2JA9 A;  1BKB A;  2K5N A;  4JI8 Q;  3GTJ H;  3TRZ A;  2CWA A;  3EBE A;  1XPO A;  3CCL A;  3KJP A;  1PH8 A;  4GN3 B;  2NVT H;  3AEV A;  4GLV B;  2V1C C;  2VQF L;  1WCM G;  4JI3 Q;  4A3L G;  4LF9 L;  1Y1W H;  3E0E A;  4JI1 Q;  3I4M G;  3D31 A;  4JV5 Q;  2R93 G;  3KDF A;  4JCV E;  3UDX A;  4LFA L;  5LMN W;  4DR6 L;  1B70 B;  1WI5 A;  4KLK A;  3Q8D A;  2R7Z G;  1LM0 A;  1D7Q A;  1UE5 A;  1M1K C;  4UPA A;  5AJ3 L;  4P75 A;  3GTP H;  1XMQ L;  1TXY A;  4JI0 Q;  3T1H Q;  2GN5 A;  4LF5 Q;  4A3C G;  3JC6 6;  4DR1 L;  1HNX Q;  4P72 A;  3OYY A;  4YWL A;  2F52 A;  2Z0S A;  4TQU S;  3RLO A;  4DV7 Q;  3K7U C;  3H15 A;  3CCQ A;  4DV4 Q;  2GVA A;  2XTI A;  3M3Y H;  4K0K L;  4MNO A;  2BH8 A;  3CCR A;  2BA1 A;  4IFD J;  4OX9 L;  1EWI A;  1U0L A;  3ULJ A;  5M5X H;  1NJI C;  3UE0 A;  4HJA A;  3M4O H;  4A3J G;  1QVF A;  3AFP A;  2VUM G;  1MIU A;  4UP9 A;  4YCW A;  1IBM L;  2ZM6 L;  1VQB A;  1K8A C;  2NVY H;  1KD1 C;  1IZ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...