4DUZL

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u13c, bound with streptomycin
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
124
structure length
123
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
total genus 13
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4duzL00
4UP8A 2RHSB 4A3FH 4IPHA 2UXBQ 1X65A 3I2ZA 3KJOA 5FLMH 1C7YA 2E2HH 1OTCA 4DV6Q 4GOPB 4L5SA 3HOWG 3AFPA 4DV1Q 4YWKA 5LMNQ 5JJLA 1I5FA 5AJ3L 5M5WH 1Q82C 2WAQG 3TREA 4DV6L 4MNOA 1JJ2A 3I4OA 4X62Q 4DV1L 4B3ML 1Q81C 5LMNL 4DUZQ 3CCJA 4LF5L 4BBSH 1PYBA 1MIUA 3K7AH 3PCOB 4DR4Q 4JI2Q 4X62L 1R9TH 4DV3Q 4DUZL 4DR7Q 2BH8A 3HOZG 2WFWA 4WJ3M 3OTOL 2HHHQ 1OXXK 2Q2TA 4DR4L 4JI2L 2K52A 3GTQH 1C0AA 1XJVA 4AQYQ 4DV3L 2VNUD 3M4QA 1XTDA 1JJCB 4YCUA 5GAHC 1GVPA 1YHBA 1CUKA 1K73C 4IJHA 2JA5H 4HJAA 1JMCA 4UP9A 2PMZE 3F2CA 4AQYL 1PH9A 4JI6Q 3FKIH 3K81C 4O2DA 3D31A 1PV4A 1CKNB 1IYJB 3GTMH 1EUJA 1G51A 3RLNA 4JI6L 3MEFA 4LWCA 2K5HA 3F2DA 1BVSA 2YTYA 2VUMG 1N33Q 3M4PA 4X64Q 2A19A 3W5OA 4JOIA 3KLWA 1EQRA 1L1OA 1VQOA 1XNQL 3T1HQ 4A3JH 2OWOA 2KHJA 1N33L 1PFSA 1QUQB 4BY1H 2Z6KC 4A3EG 4DK3C 3MXNB 2OQ0A 2QEXA 3TS2A 1YJ9A 1HJPA 3T1HL 5H1SE 4JI7Q 1GKHA 4P75A 3OW2A 2LSSA 3PO3G 4LFAQ 4KHZA 4DAMA 4YY3L 1EIFA 3CCEA 3M9BA 3RLFA 4K0KL 1HH2P 2N3SA 3NEMA 3I4NH 4BBSG 2K5VA 1H95A 3B6YA 4C3HH 4OWWB 1VQ8A 3EBEA 3CD6A 4XIGS 4IPCA 3GTPH 4YHHQ 2I5LX 2Q2IA 2IX0A 4A3IG 1UEBA 1Q7YC 1K8GA 2UUAL 2WAQE 4LUVA 1VQCA 5IY0A 4OO1G 1MJEA 4UPAA 1E1TA 1B8AA 2AWOA 4YHHL 4HIMA 4P71A 1UE1A 2EIFA 2YYZA 3ERSX 1E1OA 5IYCG 2A8VA 2NVYH 4P74A 4A3LG 3FKIG 5FJ8G 4GLXA 1Q86C 2VQEQ 2RHQB 5JJIA 1WOCA 1KQSA 5C44G 3PO2G 2HQLA 1K0RA 4B3TL 4LFCL 3PUWA 3TEHB 3DLLA 4DV7Q 1PH7A 2OTJA 4LF8L 5EAYA 3KOJA 2NZOA 2JQOA 1B70B 2R7DA 2YV5A 5J3BA 4C3IH 3GTJH 4DV7L 4GKKL 5BR8L 4P73A 3J81j 1VS0A 1TWFH 2NVTH 3A5ZB 1VQGA 1XMQL 3CC4A 3F1ZA 2YU9H 4JBJA 1BBUA 4QY7A 1Y14B 5IP9G 1KD1C 4A93G 2UXCL 4R1JA 3S24A 2IT1A 1TXYA 2NN6G 4B3SL 4DAYB 1VQ6A 3E0EA 4FDBA 3S17H 3RNUA 3GTOH 3HOXH 1SLJA 1X54A 3G4SA 3L0OA 4BY7G 3CAMA 2AKWB 2F4VQ 4KHPL 5GROA 4GN5A 1X3FA 1S40A 3ULPA 1P16A 1WI5A 2LXKA 4NXML 1S3OA 4EX5A 1K3RA 1E22A 4Y52H 1QZGA 1UE6A 4NXNL 2ZJQA 1IBLQ 4YWLA 4PZ7A 3PSIA 2VQFL 1KL9A 4JI3L 4JYAQ 3K0XA 1EWIA 1V9PA 4ALPA 1YNXA 1G291 2D62A 3GO5A 4OONA 2LXJA 4DR5Q 1RIPA 4LF9Q 3RN5A 3KF8B 1GD7A 1HNWQ 4DV4Q 1C9OA 2ZTDA 3A74A 4IPGA 3PIPA 5DLQE 1YI2A 4LF9L 4TVAB 1VQIA 1PH4A 4EQ5A 1YIJA 4X66L 1OXSC 4DPGA 5LMUQ 4DV0Q 1I6HH 2JK8A 1VQDA 4JI0Q 1HNZQ 1Z9FA 2CQOA 4QL5A 5C3EG 2IY5B 2UUBL 3E9HA 4DV0L 2JJQA 4AYBG 1HNZL 3T1YQ 1AE2A 1HNXQ 3CCLA 1W2BA 4C2MH 2R7ZG 4LUZA 3JAMi 2NVXH 3CQZH 1P8LA 1V1QA 3GTKH 3HKZG 1HNXL 4GKJQ 3HOYH 4IFDI 2MQHA 2NN6I 4R4CA 3NENA 1Q46A 2UXBL 4PG3A 4LFBQ 3STBD 1SR3A 2C35B 2KCTA 5ELNA 1I94Q 3M3YH 5IYDG 1UE7A 1HR0W 4BXXH 3CXCA 4YCVA 1J6QA 2UUCQ 5IWAQ 3I55A 5M3MG 4R4IA 2N8NA 1L1OB 4IFDJ 1U5KA 3HOVG 2H5XA 3CPFA 1YBYA 2UUCL 1FJGQ 3LGJA 4GNXC 4HIOA 4DR3Q 4DR7L 1N32Q 3I4MH 1X6OA 4NB3A 1WCMH 3U4VA 4QGUA 3RN2A 1Z47A 1PH1A 3KJPA 1TWHH 2HHHL 1FJGL 5ELOA 2FXQA 1YEZA 2EQSA 3KDFA 4UP7A 4A3GH 2XGTA 1N32L 2JA8G 3RZDH 1CSPA 1KIXA 4L5TA 5C0XG 2GVBA 4JI8Q 1YJWA 3CC2A 4LUOA 3HOUH 3PF4A 4GLAC 1GO3E 4JCVE 3S1QH 2D0PA 4JI8L 3W1BA 2ES2A 2I0QA 1EFWA 3KF6A 1OXTA 2KHIA 1YHAA 4DV5Q 1X55A 2QGQA 3H0GH 4X64L 1UE5A 4A3MH 1IBMQ 3UE0A 4LNQA 4A3FG 2E5LQ 1IZ6A 4BA1I 5FLMG 2BH2A 3EIVA 3TQYA 3CC7A 2B63H 4GOPA 1QVFA 3PGZA 2R6GA 1VQ9A 2KCMA 2R92H 4AIMA 2E5LL 3HKSA 1SN8A 3CMEA 4JI7L 2WP8J 3RLOA 2XTIA 4DR2Q 2F52A 4AYBE 3BZCA 2ZTEA 1Y1WH 4LFAL 2CWPA 3J80c 1KAWA 2WB1G 4JBWA 4HJ5A 4DR2L 1HZCA 3ZJYC 4HJ7A 3CW2C 1YITA 3PV0A 1MJCA 4A4IA 1FVIA 2GN5A 1LTLA 1N36Q 4L5QA 1YHQA 1ASYA 2I5MX 4GN4B 2VZAA 3J81c 2ZM6Q 1VQBA 2JA5G 2IX1A 3F2BA 1Q8KA 3UDFA 2JA7H 1D8LA 3FHWA 3UDIA 3W1GA 4HJ8A 1N8RC 3S1NH 1PYSB 3L7ZC 3H3VI 4GNXA 1VQ5A 3CCQA 2CFMA 4A3KH 1VQMA 2JE6I 1BKBA 1Y1VH 3IRBA 1CSQA 2HIXA 1M90C 1K9MC 1DGSA 1Q1EA 2GVAA 2VQEL 1AH9A 5C0XI 4LW1A 1QVCA 3M85A 1WFQA 1V43A 3AFQA 2ASBA 4A3JG 2AWNA 2D0OA 1SFOH 2K14A 4BY1G 2R93H 5IYBH 3S16H 1E7ZA 4A3DH 4IFDG 2F3IA 5C0XJ 1SROA 3CCMA 2RCNA 2NVQH 1EQQA 2RF4A 4LF7Q 1AE3A 5C4JH 1IBKQ 1EOVA 5M3FH 3K8AA 4LF6Q 2ALYB 4LF7L 3I4NG 3KYHC 3STBC 1Y1WG 3G48A 1YJNA 2JA6H 1LUZA 1KRSA 2NZHA 1O7IA 4A3CH 2F4VL 3J7A5 5JJKA 3VDYA 4RG1A 2E8GA 1VQFA 2KENA 4JG2A 2L15A 4AH6A 2UU9Q 1IBLL 1Q12A 1T9HA 4JYAL 1YVCA 3D0FA 1U0LA 4X65Q 3HOWH 2MFIA 2Z0SA 3UDGA 1QVGA 1JJGA 2K4KA 4A75A 4DR5L 1EIYB 1HNWL 4JV5Q 2PI2E 2K5NA 2VS1A 4DV4L 1VQ7A 4HIKA 3I56A 1N34Q 1X56A 1XNRQ 4JI4Q 3KFUA 1K83H 5M5XH 4JV5L 4B3RQ 2VL6A 1L0WA 4OX9Q 3ULLA 3M4OH 1N34L 4LF4Q 5LMUL 4GOPC 3E9IA 3U50C 5GAGC 3HOZH 3BJUA 5HY6A 4JI0L 4B3RL 1E3PA 1WJJA 1L2FA 2VW9A 2HT1A 4GN3B 3UDXA 4A76A 2PI2A 2JA9A 3JC66 4APVA 3T1YL 2E2JH 1PH8A 1VQKA 3KDFB 4YCWA 3HOXG 4JI5Q 4OXPA 4BA2I 1JB7A 3S2DH 3S1MH 4GKJL 1TWCH 4QJFA 4JI1Q 3M7NA 2VUMH 4XTCS 4DR1Q 4LFBL 1XPOA 3HFZB 1NMFA 1I94L 3AEVA 3KF6B 3TRZA 3BZKA 1ASZA 1HZAA 4OWXB 2ZJRA 1G6PA 1X3EA 2N78A 5IWAL 3GTLH 3A0JA 4A3EH 1PA6A 3RZOH 1E24A 2E2IH 3PUXA 1FGUA 5AJ3Q 2CWAA 2EXDA 2PNHA 1M1KC 1KHIA 1D7QA 1KXLA 4IO9A 4Y7NH 3L2PA 4DR3L 2JEAI 4WJ4A 4B3MQ 4QQBX 3S15H 3CCUA 4LF5Q 1TWAH 4DR6Q 3PO3H 4BBRH 2ATWA 1GM5A 4DK6C 3GD7A 2PQAA 4TQUS 1VQEA 5IP7H 5FLXc 1S72A 2B3GA 1PH6A 4R4TA 1PH3A 4DV2Q 4DR6L 2KBNA 3OTOQ 2V1CC 4NPSA 4YWMA 1NY4A 3I7FA 5C4XH 4R4OA 4DV2L 4A3IH 2R7FA 2I5HA 4L5RC 2IHEA 5M5YH 4DV5L 1VQPA 1B7YB 4DKAC 1XPRA 5K36G 1A63A 1VQLA 4DNIA 4P72A 3FP9A 2N49A 3DM3A 5IYCH 1IBML 3HOYG 1UWVA 4A3LH 1OXUA 5FJ8H 2B29A 2OCEA 5IT9c 4GNXB 2MNAA 2ID0A 2YTVA 4QIWE 3PUYA 1X3GA 5C44H 3PO2H 1VQ4A 1JT8A 2IHFA 4IJLA 3BU2A 1IXRA 1XNQQ 4BXXG 3S14H 1PHJA 1EYGA 1NMGA 4RMFA 3J7ZC 2DUDA 3HKZE 4A3BH 1KRTA 1X9NA 2K75A 3CCSA 5JEAJ 1PH5A 3I4MG 1LM0A 5IP9H 1WCMG 4A93H 4PZ8A 1NBWA 2Y0SG 1MKHA 4YY3Q 3CF5A 4A3GG 1YZ6A 1W3SA 3NELA 2DGYA 1BBWA 1I3QH 2ZM6L 1N36L 4K0KQ 3U4ZA 1CKNA 2MO1A 3U58A 4BBRG 4BY7H 5IP7G 4POFA 1Q1BA 4C3JH 1WYDA 3HOUG 4IOAA 2UXDQ 1VQJA 2YTXA 3OYYA 2UUAQ 3CP0A 1HZBA 2A1AA 4OWTB 1CKOA 2UXDL 5C4XG 4JC0A 3AYHB 3RR5A 3H0GG 5LMNW 1QUQA 1VQHA 5E7NA 4A3MG 3K80C 3CCRA 2CKZB 1HR0Q 3S2HH 3NBHB 3G6EA 4ME3A 5GAEC 4IOCA 2B63G 1NJIC 4MZ9A 1VQAA 3G71A 4X6AH 2Q2UA 2R92G 1TWGH 4H02A 4B3TQ 1HR0L 4LFCQ 4LF8Q 4GS3A 3ULJA 5IE8A 3H15A 3S1RH 5GADC 1VCIA 2MO0A 4GKKQ 4DUYQ 4HIDA 5BR8Q 1J5EQ 2K50A 3PF5A 1NTGA 3J80i 4KLKA 3CMAA 1IBKL 1XMQQ 1NE3A 4PMWA 5C3EH 4LF6L 3GTGH 3PUZA 4DUYL 5HGQA 2ZJPA 1J5EL 1SE8A 4A3BG 2UXCQ 3ER0A 1PVOA 4B3SQ 3K7UC 2JEBI 3J81i 3TS0A 2R7ZH 3GDEA 3JAMc 4HJ9A 4POGA 2UU9L 3AQQA 2JA7G 1CKMA 2HIVA 1SMXA 4KHPQ 2WB1E 4PZ6A 4J15A 3Q8DA 2Z6KA 3SGIA 4A3KG 2AMCB 2VY3A 4NXMQ 1QZHA 1SRUA 4X65L 1Y1VG 3PUVA 4NXNQ 1XPUA 2VQFQ 4JI3Q 5IYDH 5GQOA 2Q2HA 2Y0SE 2OTLA 1JE5A 3ICEA 2ZTCA 1XNRL 5M3MH 4JI4L 1A62A 3F8TA 1KC8C 3HOVH 2CCZA 4OX9L 3UE1A 4LF4L 2BA1A 2R93G 2BA0A 3EN2A 5IYBG 4A3DG 4KI0A 4IPDA 4R4QA 1FL0A 5JEAG 3CCVA 4JBKA 1XMOQ 3H3VH 1A8VA 4OO1I 2QA4A 1RL2A 4X66Q 4JOIC 2JA8H 2AHOB 1L1OC 3WWVA 4UY8C 1LYLA 5M3FG 1XMOL 1IL2A 2OQKA 1PH2A 2UUBQ 3PIOA 1I50H 2PQAB 4JI5L 2JA6G 1K8AC 1OXVA 3CPWA 4A3CG 4GLVB 1A0IA 4JI1L 3A5UA 4O0AA 1VQNA 4MTNA 1HZ9A 4DR1L 4JBMA 1N9WA
chains in the Genus database with same CATH superfamily
1SJHD 2M00A 3IAYA 4IPHA 3I2ZA 3KJOA 5FLMH 2E2HH 3G7LA 1JCKB 1JC7A 3WOFA 5IGGA 5EJWA 1I5FA 1JWMD 2WAQG 4HCSA 1JJ2A 4DV1L 2E75C 2EXZA 4BBSH 4UAIA 3S1RB 4DUZL 4DR7Q 1EEFD 1DOLA 5C3EB 2VNUD 2BDNA 1XTDA 4KKTA 5GAHC 1CUKA 1K73C 2JA5H 1ZYRC 4JI6Q 2M9VA 1PH9A 1QNUA 4O2DA 2R7ZB 1IYJB 1EUJA 3MEFA 3S17B 4LWCA 1A3VA 3F2DA 3M4PA 1VQOA 1XNQL 3T1HQ 1N33L 1Z6HA 4DK3C 2OQ0A 2L0CA 5HURA 3MHBA 2DNEA 2LSSA 4ZK9B 2XNAC 4YY3L 1EIFA 3CCEA 1A3UA 3RLFA 1F2MA 5CV9A 1HH2P 2N3SA 3C1EA 1WTRA 2K5VA 3QIAA 4XT1B 1QILA 1XYIA 4Q5VA 3VR5A 1CHQD 4XIGS 4IPCA 3DWQA 1I6HB 2Q2IA 2IPKD 3MVVA 2JSOA 4CGYB 4PQXA 3CRKC 4RHRA 1PLFA 2YYZA 3ERSX 4P71A 4A3LG 5FJ8G 2E2HB 2CW0D 2EJGC 1WOCA 2HQLA 1K0RA 4LFCL 3PUWA 3TP6A 4DV7Q 5IGBA 4KY5A 2F4IA 5E1FA 3KOJA 4IUPA 1B70B 4C3IH 3GTJH 4KKUA 4GKKL 1PZJD 4P73A 5BR8L 1V1PB 1E0BA 1V1OA 2UXCL 1Y14B 2C5CA 3S24A 3HP3A 2IT1A 2NN6G 2EYJA 5ELEA 3E0EA 4FDBA 3T16A 2KVMA 5CV4A 3HOXH 3RNUA 3GTOH 2NBFA 3G4SA 2F0MA 5KRUA 1TWHB 2RQXA 2RDGA 3VR4A 2K28A 4PV1C 5GROA 2D2CC 5IODA 2F4VQ 4KHPL 1WI5A 1S3OA 4EX5A 1E22A 3H94A 3C1FA 2EY2A 5G3LD 1IBLQ 4YWLA 3PSIA 1KL9A 2Z8LA 4JI3L 4JYAQ 4F8MA 2RA4A 4K5WA 1ICFB 2LXJA 2PYKA 1HNWQ 3RN5A 3KF8B 2RDFA 3R2IA 4DV4Q 1IW7D 1GUNA 1QWYA 3PIPA 4K5XA 4PMCA 1SE2A 3SK8A 2KEDA 1PH4A 2SEBD 2F1MA 5LMUQ 1OXSC 2JK8A 3K6OA 2UUBL 1TS2A 1C48A 3T1YQ 1AE2A 3CCLA 1W2BA 1KDAA 4H13C 1P8LA 2G9HD 2AUKA 1HNXL 2MQHA 2JA7B 4PG3A 4LFBQ 1S5ED 5JOBA 4U673 1HR0W 3CXCA 2UUCQ 3I55A 2N8NA 1AP0A 4CDEC 4IFDJ 3HOVG 3LNNA 2PMZB 3DXJC 3LGJA 4RGOS 3A8IE 4C3IB 1N32Q 2HHHL 1SFOB 2CHBD 3CU7A 4HSPA 3RZDH 2EYMA 1BO0A 4WRDA 3JAME 3NUCA 3QR8A 3HOXB 3TP8A 2D0PA 2I0QA 4DV5Q 4FO2A 2RDHA 1EQTA 5JJZA 1IBMQ 5CV5A 2B2VA 4BA1I 3EIVA 3PGZA 1LLRD 5FO8B 2L12A 3W2DA 4AIMA 1SNQA 3HS0C 3RLOA 3SK4A 2XTIA 4KHVA 3OPOA 4DR2Q 3A56A 3KLSX 4LFAL 2WAQB 2WB1G 1HZCA 4HJ7A 4RGMA 2KOLA 1YITA 4OGQC 4CHTB 1LTLA 1N36Q 2ZM6Q 4GN4B 2VZAA 3KK7A 1VQBA 1D8LA 2JYOA 1N8RC 1PYSB 2XRSD 4GNXA 4A3KH 2JE6I 4FF1A 2CH4A 1Y1VH 4KD4A 2LFNA 2NB0A 3OIPA 4LW1A 3MFYA 1S5BD 1ENCA 3AFQA 1LT6D 1UUPA 4BY1G 4IN3A 2F0NA 2FINB 4EQOA 4IFDG 1RJTA 3NTIA 5C0XJ 1SROA 1J8IA 5IGEA 1EYCA 2RCNA 3A7AB 4JK1C 1SAPA 3I8ZA 2I07B 2ALYB 3I4NG 1O7LA 1Y1WG 4TRDA 4C3HG 3RZDB 2NZHA 3K5OA 5EKKA 2HQEA 1VQFA 2L15A 2LY7A 5C6AA 3E0JA 2MUYA 1YVCA 2Z0SA 3I73A 1NUCA 4DR5L 2PI2E 2K5NA 1BCPD 2E74C 1SNPA 1N34Q 4XQNA 2B2UC 2VL6A 4OX9Q 3ULLA 2Z6BA 1AEXA 2K1BA 5GAGC 3U50C 3BJUA 4JI0L 1SNDA 1TY0A 1WJJA 2I46A 2VW9A 2IWHA 2PI2A 2RBMA 4IALA 4APVA 3KDFB 1H9MA 1UNSA 3VR3A 3S2DH 3S1MH 3ND8A 1EY7A 1PXUA 3M7NA 1I3QB 2RSOA 4K8IA 1DD2A 1JE4A 4A3KB 2RKSA 4DR1Q 4G7HC 1G6ZA 5J39A 2MHVA 1NMFA 1I94L 1ENFA 2ZT9C 1EY0A 4OWXB 2N78A 5DNFA 4A3EH 1EEID 3PIP3 5ELFA 3A55A 1FGUA 4ZKBB 5AJ3Q 2EXDA 4WORA 3OWEB 4Y7NH 5IGFA 3L2PA 2JEAI 2HD3A 3S15H 4DR6Q 2BE5D 5IP7H 5FLXc 1PH3A 1XX8A 5EBDA 2V1CC 4H7BA 1NY4A 1B7YB 5K36G 4K2LA 1T5XD 3V2TA 3A54A 2GA4B 2Q8TA 1OXUA 2ICEC 4KY7A 1PRTC 2IW3A 2ID0A 3H91A 5JPMC 1X3GA 3PO2H 1VQ4A 2IHFA 3S14H 1EYGA 5I6YA 3HKZE 3Q0AA 2K75A 3I4LA 2JN4A 3CCSA 1SYCA 1PH5A 1F2ZA 4DXGA 3L3OC 1ZEQX 3MFGA 3SEBA 5IP9H 4A93H 4O1NA 3GV6A 3VR2A 1WTXA 2WACA 1BBWA 2B2WA 1CKNA 3U4ZA 4KMUC 3U58A 4HR7B 4POFA 1Q1BA 2K5QA 3KLSA 2UXDQ 4HCEA 3S2DB 2UUAQ 1VF7A 4JPBW 3N6RA 3S1MB 1CTMA 3I90A 2PW7A 1YNND 5C4XG 1O78A 2DY7A 2O4XA 4JC0A 3H0GG 2VB3X 1QUQA 3K57A 4A3MG 4NDXA 3CCRA 2CKZB 2AQ3B 5GAEC 4FXDA 1VQAA 4CJ0B 2Q2UA 3HGBA 4A3EB 2Z4IA 3ULJA 3MC0B 5I9PA 3H09A 4DUYQ 4HIDA 2K03A 1J5EQ 1LT3D 3S15B 2F0JA 1PTOC 4OHJA 1NE3A 4LF6L 4DNTB 4A3BG 1SE8A 3TP5A 3ER0A 4O42A 4B3SQ 3K7UC 3TS0A 3J81i 1CA5A 1KNAA 1GHKA 4HJ9A 2UU9L 3AQQA 5I2YA 3QG1A 4I7ZC 1SMXA 3J7AV 4ZYSA 4NXNQ 3A8KE 2F0FA 1D5XC 1JE5A 1XNRL 4JI4L 3D4WA 2KECA 3S14B 4H0LC 5JVH3 4LF4L 2BA1A 1U4LA 2R93G 4KV6A 4A3DG 4KI0A 4DAYA 4IPDA 2A6HC 2A68C 3NTHA 3CCVA 4JBKA 4L63B 3O13A 4A93B 1AN8A 3P75A 2A74C 3WWVA 4UY8C 5M3FG 1IL2A 3HG9A 1I50H 1U4MA 4IUVA 1SNOA 1SEBD 4O0AA 2EPBA 3I4NB 3NHHA 2H4OA 4N9PA 2RHSB 4A3FH 2UXBQ 1C7YA 1OTCA 3PQIA 3HOWG 1Q82C 1EYDA 5M5WH 3CKIB 4HAEA 1BUVT 1CHPD 5FO9B 4X62Q 1SYGA 3K7AH 3MA2B 1R9TH 1RTNA 1WTVA 4WJ3M 1OXXK 4AQYQ 4XT3B 1HTPA 4YCUA 1F2LA 1GVPA 4IJHA 1TWFB 4HJAA 1EIGA 1JMCA 1D6EC 3FKIH 1ESFA 1EQVA 5A2QE 3R2TA 1G51A 4JI6L 1XXGA 4J1MA 1BVSA 1PZKD 2YTYA 1O80A 2KA7A 2VUMG 4JOIA 5ELDA 3KLWA 2A69C 2KHJA 2KCNA 2Z6KC 3DM1A 3DUZA 2HCIA 3T1HL 5H1SE 4L6TB 1CI3M 5FLXL 1K3BC 4WJWA 2BDOA 4DAMA 1HCZA 4K0KL 3NEMA 4BBSG 3B6YA 4OWWB 1AW7A 1I50B 2AQ1B 2HUGA 3GTPH 2I5LX 5IY0A 2CQAA 1VQCA 3M7GA 4UPAA 4XYQA 1MJEA 1E1TA 1B8AA 1ML0D 2AWOA 4HIMA 2A8VA 1E2VA 1E1OA 2KJXA 2EZVA 1STEA 1PTOF 4JVZA 4GLXA 4OL7A 4A3FB 1Q86C 2VQEQ 2RHQB 3CQZB 3J80L 4B9XA 1G8ZD 4RKBA 3AMUA 4LF8L 5M5WB 3R3OA 4G4KA 5J3BA 4DV7L 1F9SA 1E2WA 1X3QA 3J81j 4RHSA 5FLXE 3CC4A 3K7AB 1XMQL 3F1ZA 2YU9H 1R9TB 1QE6A 2WKCA 1WD0A 1TXYA 1VQ6A 3T13A 3S17H 5LL6S 3L0OA 2JP1A 1FNUA 1S40A 1P16A 4NXML 2KHSA 1K3RA 2EY1A 4PZ7A 2VQFL 3HRZC 1V9PA 2O2LD 4ILWA 1G291 1ESRA 4LF9Q 4DXFA 4N8X1 2K01A 1RF2D 4A3MB 1IHZA 3K5LA 1YI2A 4K6DA 2OF1A 2IX3A 4X66L 4DV0Q 1I6HH 1VQDA 1HNZQ 1KTKA 2CQOA 4ODGA 4DN4M 3IKJA 2K6AA 5DM63 2SNSA 3AB9A 1CA6A 3T4AC 4C2MH 5I2XA 3GTPB 1V1QA 3HKZG 2NTSA 4GKJQ 3HOYH 4IFDI 3NWTA 2C35B 2TSSA 2K33A 5IYDG 4BXXH 4YCVA 1J6QA 1Q90A 5M3MG 1L1OB 1U5KA 2UUCL 3MWYW 1AFPA 4GNXC 4DR3Q 4NP5A 3K58A 1X6OA 4NB3A 3EROA 3U4VA 3I4MH 3KJPA 1TWHH 2YU9B 2EQSA 4A3GH 1N32L 3R8BA 1E2ZA 2JA8G 1G2TA 4IZ8A 1HQRD 2F0DA 2CW0C 2GVBA 4JI8Q 1YJWA 3CC2A 3NP8A 3HOUH 5JAVA 2CVRA 5DEHA 2K5WA 1U4RA 1ZXTA 2ES2A 3W1BA 5M3FB 1EFWA 3KF6A 1OXTA 2KHIA 1X55A 3NBIA 2QGQA 4X64L 1ET9A 3NSWA 1FD7D 2E5LQ 3K5MA 4J6HA 3RUZA 4V0BA 4RAUC 1SN8A 4EQPA 1QOHA 4JI7L 4FF2A 1D5ZC 5DM73 3OMCA 2F52A 4FNFA 4AYBE 5L37A 3BZCA 1NR4A 2C9OA 5TSSA 2CWPA 1KAWA 4DR2L 3ZJYC 4A4IA 2BCOA 2KCCA 3M4OB 5C4HA 1SXTA 4L5QA 2JA7H 3FHWA 3W1GA 4DAPA 4ZAIA 3S1NH 1IW7C 3KLRA 4C2MB 3CCQA 2CFMA 1VQMA 3ERQA 1CSQA 3HOYB 1DGSA 2EYLA 4DA2A 5C0XI 1WTWA 1AH9A 1JQYD 1WFQA 1TWCB 1CQVA 4RKLA 4A3JG 2AWNA 1SFOH 5IYBH 1TT2A 1STGA 2K5DA 2G5DA 2NVQH 3I4MB 1AE3A 2Y0SB 2F0WA 1F9PA 3K8AA 4KN4C 4A3GB 3BYYB 4E6IA 4KJOA 2N55A 3G48A 1MSGA 2JA6H 2B2YA 4BBRB 4A3CH 2EY6A 4KN7C 3J7A5 4NW2A 3HOUB 4F88A 3VDYA 4RG1A 3OW7A 2KEEA 1BR9A 1T9HA 3NBHA 5FK9C 1B44D 2X6GA 3MXPA 4X65Q 3UDGA 1JJGA 2K4KA 4A75A 5CV8A 4JV5Q 2PO4A 4MN3A 4HIKA 1VQ7A 1X56A 4QUFA 1SSOA 4B3RQ 1L0WA 3QO2A 3V96A 1N34L 4Z9CB 4GOPC 2ZXRA 1YNJD 3JAML 5HY6A 1I4RA 1I4HA 1TKWB 3E3XA 3JC66 3BVGA 3UI2A 5IGDA 4F87A 3MEHA 4JI5Q 2NYZD 4LAAA 4JI1Q 3S1NB 2PW5A 4XTCS 1JWUD 1MGSA 1ASZA 2ZJRA 5IWAL 3RMHA 1PA6A 1F77A 1HHVA 1KXLA 2PNHA 3CCUA 1TWAH 3T56B 1S5FD 4M8AA 3SDZA 1GM5A 1DXMA 1TWGB 1S72A 2NVQB 5EQ0A 1NNXA 2B2TA 4DR6L 2KBNA 4NPSA 1EZ8A 4L8JA 2LKVA 1C4QA 2JA6B 2R7FA 2I5HA 1A63A 1NSNS 2FHTA 4DKAC 3Q6SA 4Q0FA 1VQLA 3H3VC 1I4GA 3TN2A 2PZTA 3FP9A 2J4XA 3DM3A 2ZXPA 4DK0A 1UWVA 1KAAA 5JPNC 4A3LH 5FJ8H 4YIJA 4CJ2C 1IKMA 2B29A 2E2DC 2OCEA 5G3LF 2YTVA 4RWSC 3BU2A 1XNQQ 5KNDA 1A15A 3TZDA 4RCNA 3J7ZC 2XWJB 2DUDA 1ONLA 4X3KA 5JEAJ 4XXEA 1WCMG 3LWEA 5HGTA 5NUCA 2NN6H 1T5EA 1BDOA 4ID6A 1MKHA 4YY3Q 4CDDC 2PPBC 1I3QH 2MO1A 2K05A 4DNRB 5IP7G 1BCPC 3BZDB 4M1UB 1VQJA 4R8NA 1MD2D 3VYUA 3CP0A 1ZKOA 5IGCA 2UXDL 5ELBA 5LMNW 4RA8A 1EY4A 1HA5A 2E76C 3K80C 4CJ1B 4MTKA 1HR0Q 3S2HH 3G6EA 4IOCA 4ME3A 2B63G 4MZ9A 2R92G 3F2UA 4LFCQ 4U68A 3URYA 3VYTA 4XQJA 2N88A 3U9OA 5IE8A 3H15A 2CH4W 5GADC 3QJYA 2MO0A 3BYTB 4GKKQ 5BR8Q 1NTGA 1TWAB 4KLKA 3J80i 4NMZA 1IBKL 4DUYL 2UXCQ 1J5EL 1QNKA 1B3QA 2F0IA 1WTPA 3MXGA 2HIVA 2XIWA 4QUCA 4KHPQ 1RKNA 4PZ6A 1QZHA 1BQQT 1ICWA 4GZYC 2BE5C 3SXHA 4JI3Q 4KJNA 1D5MC 1ILQA 1U9RA 1XTCD 2Y0SE 4C1NI 4FYDA 1A62A 3HOVH 1V1PA 4EQNA 1LTAD 1LABA 2BA0A 4CDFC 3HEJA 1FL0A 4H44C 5JEAG 1DM0B 2B8GA 2FMMA 2QA4A 2G9DA 4QCLA 1RL2A 1Y8PB 3G6JB 1LTBD 4JOIC 1DOKA 2AHOB 4PMBA 1LYLA 5E4WC 2OQKA 2PZUA 2UUBQ 3PIOA 2PQAB 1BOSA 4ZUJA 3D4DA 4GLVB 2RCFA 3A5UA 4MTNA 2KUMA 1A3TA 1N9WA 4AYBG 5BN4A 4UP8A 3OSOA 3QOJA 3KF8A 1LTSD 2MGSA 4DV6Q 5C4ZA 2MPMA 1JOQA 5LMNQ 3S2HB 3R93A 3GP7A 1GUSA 4MNOA 1MHWC 2NVYB 1LTTD 3NQIA 4B3ML 2F0UA 3CCJA 2OXPA 4LF5L 1PYBA 4DR4Q 1EYAA 4JI2Q 4X62L 4DV3Q 1DONA 3HOZG 1YNNC 2WFWA 3OTOL 2HHHQ 2Q2TA 4TKOB 4KK7A 1JJCB 1UEAB 3DMUA 4QIWB 4FF3A 3TMEA 5D3DA 2PMZE 3F2CA 1I4PA 4AQYL 3K81C 3D31A 1PFNA 3GTMH 3RLNA 2DN8A 3NE5B 1H9SB 2A19A 1PDQA 5BN5A 1PTOH 2OWOA 1KDBA 1PFSA 4BY1H 2QW7A 1LT5D 3GQBA 3PMFA 3MXNB 1BCPF 1YJ9A 4IFDH 3HOVB 4R9WA 1GKHA 2XVSA 5IOCA 3PO3G 4LFAQ 4KHZA 3M9BA 3ND9A 3I4NH 1H95A 4C3HH 3IFTA 3EBEA 3CD6A 1PRTB 3SHLA 4YHHQ 4A3IG 1Q7YC 2WAQE 4LUVA 1L0XB 4OO1G 1STNA 3IL8A 3OOCA 1HFGA 2EIFA 4DGZA 5EBCA 5IYCG 1A6XA 2EYOA 1EY5A 3I72A 3FKIG 2NVXB 4K8JA 5I6WA 5JJIA 5C5LA 5C44G 4B3TL 1PH7A 3DLLA 2OTJA 1KABA 5EAYA 1VDZA 3P1HA 2NZOA 1B9MA 2JQOA 3A8JE 1WTOA 1VS0A 1TWFH 1SNCA 2NVTH 1VQGA 1C8CA 4BS9A 2WB1B 4JBJA 4QY7A 4R1JA 1AZQA 5EPJA 3HZXA 1B53A 1SLJA 1JICA 4BY7G 3CAMA 4ABNA 4C3JG 3L9AX 4GN5A 3FDTA 3ULPA 2LXKA 3BDOA 1STHA 3GTMB 2ZJQA 3CRLC 5ELCA 1EWIA 5LL6X 1LT4D 4ALPA 4QB4A 2D62A 1PTOB 4RCOA 4DR5Q 1GD7A 3RD4A 4BY1B 4IPGA 5DLQE 4LF9L 2EY5A 1V8QA 2B63B 1VQIA 5C0XH 1A2UA 1YIJA 4DPGA 4N8FA 1EFID 4JI0Q 4QL5A 5C3EG 5A2QL 4IQZA 4DV0L 2JJQA 1Y1WB 1HNZL 4C3HB 4TSSA 5K36H 2R7ZG 4LUZA 3JAMi 3CQZH 2LS01 3GTKH 2NN6I 4R4CA 3NENA 1Q46A 1HUMA 2NTTA 4K6LA 1TS4A 1FR3A 1WD1A 3STBD 1I94Q 3M3YH 2KCTA 5ELNA 1UE7A 2SNMA 2O5JC 2M2LA 1HA6A 2F0KA 4R4IA 2H5XA 3CPFA 3MXUA 1FJGQ 1QJOA 1PRTF 4G57A 2MJ8A 5F2DA 4HIOA 4DR7L 1EWCA 2DY8A 4QGUA 2QILA 3RN2A 2NVTB 5ELOA 4UP7A 1X3PA 3KDFA 3PIO3 2PCFB 1CSPA 4K5VA 5COYA 4GLAC 4KD3A 1IL8A 3S1QH 4JI8L 5D3IB 4HTHA 3BVZA 4N9TA 3BS1A 3H0GH 2MP1A 4A3MH 2B2UA 3UE0A 5JVG3 1IZ6A 4XDXA 5FLMG 2BH2A 3CC7A 2R6GA 2F0VA 1VQ9A 2KCMA 1O7YA 1DYQA 2XN9C 2B2YC 4ULLA 2E5LL 3CMEA 2WP8J 1VMCA 3C2PA 1D1KA 2ZTEA 1Y69U 2QDLA 2PNRC 4JBWA 4HJ5A 5DAUA 3CW2C 2L5TA 1MJCA 4DAVA 1FVIA 2GN5A 1YHQA 2XSCA 3J81c 4HSVA 2JA5G 2VB2X 3F2BA 1Q8KA 3SVMA 3UDFA 1K28A 3L7ZC 4BWGB 1VQ5A 2E2JB 1BKBA 3GTKB 3IRBA 4LMQD 3ZYYX 1B1ZA 1M90C 1K9MC 1Q1EA 4ZLTF 5IIFA 3TDQA 1H9SA 1QVCA 3DWPA 3M85A 3M3YB 3H6MA 3OHXC 4XYOA 2K04A 3CHBD 3WDNA 2R93H 4A3DH 1E7ZA 5KNCA 1Q8IA 2XRQD 2J0TD 1EQQA 3M4YA 4LF7Q 1D2BA 1WTHA 5M3FH 3FMCA 4LF6Q 4OELB 3KYHC 4KTAA 2EJMA 1KDCA 2HDLA 2RSNA 1YJNA 2EVBA 3VA7A 1KRSA 1O7IA 2F4VL 1ET6A 1NR2A 2R61A 2KENA 2R3ZA 4AH6A 1GUWA 2UU9Q 3S1QB 1IBLL 1TIID 4JYAL 5C4XB 3D0FA 1U0LA 2B8FA 5CC4A 3H0GB 5KIXA 3HOWH 2B2TC 2Z9HA 1HNWL 1M8AA 2VS1A 4DV4L 2K7VA 1XNRQ 4JI4Q 2F0EA 4RGNA 3KFUA 4JV5L 2B2VC 4C3IG 3M4OH 4LF4Q 3SR1A 5LMUL 1RD9D 4B3RL 1GOZA 2KQ3A 3EJIA 3Q23A 2HT1A 4GN3B 4A76A 4A3BB 1ILPA 2X69A 3T1YL 2HDMA 3FPPA 1HTLD 1LTGD 4YCWA 4P2CB 5ISRA 3HOXG 4BA2I 2IL8A 1IYUA 1TWCH 4QJFA 4X3SA 2VUMH 3OWFA 4LFBL 1K0SA 1I6VC 4R8IA 3OMGA 3GTLH 3A0JA 2ZXOA 1E24A 2E2IH 3PUXA 1M1KC 1D7QA 3SK5A 2B39A 3BVMA 2R93B 1DCZA 3E5SA 4A3DB 4BBRH 3FEWX 2AQ2B 4DK6C 1VQEA 3TZUA 2BOSA 4S3SA 1PH6A 4I65A 4X3TA 4DV2Q 3V05A 4YWMA 1GHJA 1LACA 1VQPA 4DV5L 4JW0A 5CV6A 1XPRA 4P72A 2N49A 1HPCA 5CORA 1IBML 1DJRD 5CMDA 2Z1CA 1S4ZA 1HXYD 2Q8RE 5IT9c 4GNXB 2MNAA 3HOWB 1JT8A 4IURA 2IJ0A 3SK6A 2A73B 3K5NA 3Q24A 2RVLA 3NXWA 5T1IA 4K2KA 1CT1D 4DFAA 1NBWA 3CF5A 1N36L 2DGYA 4K0KQ 2ZM6L 2F0SA 2D5DA 1WYDA 4MHEA 2YTXA 2Z4HA 4OWTB 2A1AA 2NUCA 3A7LA 1CKOA 3DHQA 3RR5A 1RTOA 1YNJC 2VUMB 1SYBA 2OT2A 4ZRZA 3P7JA 2O5IC 3MTSA 1ZYRD 2F0HA 1NJIC 4X6AH 1CM9A 3GTLB 1TWGH 3I91A 1HR0L 3IFDA 2E2IB 4LF8Q 4WFN3 1ENAA 3CMAA 1XMQQ 3GTGH 4B9WA 2SOBA 3PUZA 5CR3A 2LMCB 3J81L 1II3A 2SDFA 4BBSB 1EY6A 4HMJA 5J1ZA 3TBIB 5C3WA 4CKEA 1S5CD 1CKMA 1F9QA 4J15A 3Q8DA 2Z6KA 3SGIA 4A3KG 2AMCB 4NXMQ 2JA5B 1SRUA 1Y1VG 3X3NA 2VQFQ 5IYDH 1LO5D 2Q2HA 4FF4A 1QCBD 3ICEA 1QG7A 2ZTCA 3BDLA 4KKSA 5M3MH 1K8OA 1Y8NB 2QKIC 2Q8IB 3SE0A 5I9OA 1AZPA 2HCCA 4LJZC 4OX9L 3EN2A 4HEDA 1SYEA 5FOBB 3EQLC 3H3VH 4OO1I 1XMOQ 4X66Q 5D14A 1R4PB 2JA8H 1EU3A 2PQEA 1H9KA 3J81E 1PH2A 3NQTA 1QB5D 2ENBA 1LTRD 1OXVA 3CPWA 4ZKCB 3D6WA 1SYFA 2EYFA 1LTID 4DR1L 2B2WC 1X65A 4L5SA 4GOPB 3AFPA 4DV1Q 4YWKA 5JJLA 5AJ3L 2F03A 3TREA 4DV6L 3I4OA 1Q81C 5LMNL 4DUZQ 1MIUA 3PCOB 1GXDC 2BH8A 2EDGA 1B3AA 4DR4L 4JI2L 2K52A 3GTQH 1C0AA 1XJVA 4FXKC 1LV9A 3LWUA 4DV3L 3M4QA 3GTJB 3GTGB 5EKIA 1EZ6A 1YHBA 3TP7A 4FXGC 4UP9A 1H9RA 1BXTA 1CKNB 1PV4A 4CBVA 4CDCC 3HKZB 1MSHA 2K5HA 4K14A 3GTOB 3QOLA 1RODA 3D6CA 1N33Q 4X64Q 5FKAC 3W5OA 4IUNA 1EQRA 1L1OA 4EGVA 1JWSD 3DEPA 1RDPD 1TQOA 4A3JH 1QUQB 1R4QB 4A3EG 5M3MB 2QEXA 3TS2A 1EY9A 1HJPA 2A6EC 4JI7Q 5A35A 1SNMA 4P75A 3NTKA 3OW2A 3P20A 4QMGA 1G2SA 2JA8B 3EA6A 1VQ8A 1I4QA 3FPUB 1X32A 4G7ZC 1BF4A 1K8GA 2IX0A 1UEBA 1DOMA 2UUAL 5FO7B 5T1GA 5IT9L 4YHHL 1UE1A 4CKCA 2NVYH 4P74A 3TSSA 1KQSA 2ICIA 3PO2G 3TEHB 1HUNA 1CZGA 1TS3A 2R7DA 2YV5A 5KEEA 1BCPB 3A5ZB 2A5HA 1BBUA 2A6ED 5IP9G 1MBYA 1KD1C 1B4OA 4A93G 4B3SL 4DAYB 1GUOA 3GTQB 1D1IA 5EPKA 1X54A 2X6LA 1RCVD 4IUTA 1SYDA 1TS5A 2AKWB 2F3VA 1X3FA 2DJFC 3VA5A 2WV6D 4Y52H 1QZGA 1UE6A 4NXNL 1KLUD 5IT9E 1FNWA 2L11A 1KLGD 3K0XA 2AUJD 3S9WA 5CYUA 1YNXA 1JOOA 5AFWA 3GO5A 3KUPA 4OONA 1JORA 3J7AF 1RIPA 4A3JB 1EU4A 1C9OA 2ZTDA 4RGTA 3A74A 2EJFC 2QEJC 1EY8A 4TVAB 3J7YW 1Q3LA 4EQ5A 1TVXA 2WKDA 1HRJA 1Z9FA 2IY5B 1S5DD 1U4PA 3E9HA 3C3LA 1EOTA 2L9HA 1HNXQ 3C46A 2NVXH 2J7ZA 3D4RA 1J9OA 5D65A 2UXBL 1JOKA 1GUTA 3EFXD 4IUQA 1EIHA 1SR3A 2NWGA 2JXMB 1PFBA 5IWAQ 1Y1VB 1EL0A 4FVMA 3BG3A 3MZ5A 5J22A 1YBYA 1DZ1A 5KGUA 5KYIA 1WCMH 3QWNA 2L1BA 1Z47A 1PH1A 1FJGL 4NKLA 2FXQA 1YEZA 2XGTA 3DWAA 1KIXA 4L5TA 5C0XG 4LUOA 4XQQA 3PF4A 5EKLA 1GO3E 5CGKA 4JCVE 1MI2A 1VMPA 3KBXA 5LHY1 1YHAA 2NZ1D 1UE5A 1GJXA 3I70A 4LNQA 4A3FG 3TQYA 2B63H 4GOPA 1QVFA 1SE4A 2FJ2A 2R92H 5K5PA 3HKSA 2PZWA 2K32A 2EYPA 3T53B 4UHVA 2FFKB 2EE1A 4HN7A 3K59A 1Y1WH 3J80c 4ZQ3A 3FRPB 3QB3A 3PV0A 3Q22A 5C3XA 1JB3A 4B08A 1HQMC 1ASYA 2I5MX 2IX1A 1B9NA 2FMCA 3UDIA 4HJ8A 3H3VI 2HIXA 2GVAA 2VQEL 2DJGC 1UAPA 1JR0D 2WIIB 1V43A 4X3UA 3WOEA 2ASBA 1Z7TA 2D0OA 2K14A 4I7AA 3ONAB 1PZID 4CKBA 3S16H 5KYLA 2F3IA 4OIKA 5JEAH 3CCMA 1FYCA 2RF4A 1PRTD 1WCMB 2F0PA 4G7OC 1VF5C 1K8MA 5C4JH 1IBKQ 1EOVA 2XWBB 4Y7NB 1G91A 1W6JA 5C5MA 4LF7L 1SJED 3STBC 2EOTA 3BDCA 1LUZA 4DU9A 1CQFA 1KNEA 3N52A 5JJKA 2E8GA 3E6ZX 4JG2A 1Q12A 4UDUC 4KY6A 3GV3A 2L55A 1PYWD 4IUUA 3MAQA 1H9JA 2MFIA 1QVGA 1EIYB 1NCVA 3D8GA 1M4VA 5EPLA 3I56A 2R92B 2L4NA 1GUGA 1K83H 5M5XH 1I4XA 2F0TA 3PO2B 1STYA 3LX0A 4C56C 3E9IA 3HOZH 1SBBB 1E3PA 1XWEA 1L2FA 3UDXA 2JA9A 1IYVA 2F3WA 2E2JH 1PH8A 1VQKA 1NAPA 4OXPA 1JB7A 1A2TA 2QF7A 4GKJL 3FVQA 5I4DA 1PTOD 2P5ZX 3U9SA 1XPOA 3HFZB 3AEVA 1PFMA 3KF6B 1PMRA 1RHPA 3BZKA 3TRZA 1HZAA 4RH6A 1G6PA 1EWHA 1X3EA 5E3FA 2OEOA 3KBGA 3RZOH 5CV7A 2CWAA 1KHIA 4IO9A 4DR3L 4WJ4A 4B3MQ 3K0YA 4QQBX 3T51B 4LF5Q 3I3CA 3S16B 3PO3H 2ATWA 1B50A 3GD7A 2PQAA 4TQUS 1STAA 2QCPX 2B3GA 4R4TA 1BNZA 3OTOQ 5C4JB 4FP5D 3I7FA 5C4XH 4R4OA 4DV2L 4A3IH 2H1EA 4L5RC 2IHEA 5M5YH 2V4DA 4OO1H 3OIQA 2A6HD 4DNIA 2A68D 5IYCH 1W6KA 4AYBB 3HOYG 3NPPA 4OIJA 4DK1A 5M9OA 2F0OA 4QIWE 4RFBA 2WINB 3PUYA 4EVOA 5C44H 1CK1A 4IJLA 5CBAE 1IXRA 4BXXG 1TY2A 1PHJA 1WTQA 1NMGA 3EVQA 4RMFA 3DEOA 4A3BH 1KRTA 1X9NA 1K83B 5M5XB 2F0GA 3ITPA 3I4MG 1LM0A 4PZ8A 2Y0SG 1STBA 3D3RA 3HOZB 4A3GG 1YZ6A 1W3SA 3NELA 5E4XA 4PNYA 4BBRG 2F0LA 4BY7H 1F2YA 1TU2B 3HOUG 4C3JH 4IOAA 3OYYA 4F7XA 1Y8OB 1HZBA 2F0QA 5EGTA 3W3AA 3AYHB 1VQHA 1O7ZA 5E7NA 4ZCKA 2VXWA 3NK9A 3MXNA 2QDBA 1HFNA 3NBHB 3G71A 4H02A 4J8QA 4B3TQ 3RZOB 1F9RA 4GS3A 3VR6A 2DNCA 3S1RH 1SMYC 1VCIA 2D9UA 2K50A 3PF5A 3PO3B 4PMWA 5C3EH 2A69D 3VYRA 5HGQA 2ZJPA 1PVOA 2TMPA 4MIUA 4LK1C 5BN3A 1SDFA 1B2TA 2JEBI 4ME5A 2R7ZH 1IKLA 3GDEA 3JAMc 4A3IB 4POGA 2JA7G 5M5YB 2WB1E 3X3MA 2VY3A 4X65L 1CFMA 3PUVA 4QF4A 1SE3A 1XPUA 3FKIB 5KNBA 5GQOA 4DF7A 2OTLA 1FNVA 5C44B 3F8TA 1KC8C 2CCZA 1CZWA 5CBEE 3UE1A 1FGBD 4C1NK 5IYBG 3J80E 4R4QA 1A8VA 1L0YB 3VYSA 1BBXC 1L1OC 1SMYD 1XMOL 4OEMB 1TR5A 4V190 4JI5L 1WVLA 2JA6G 1K8AC 3NWSA 4A3CG 2EYHA 4ZUIA 4BY7B 1A0IA 1OO9B 3AU7A 4JI1L 4C3JB 1VQNA 1HZ9A 4JBMA 4HMIA
chains in the Genus database with same CATH topology
4UP8A 2RHSB 4A3FH 4IPHA 2UXBQ 1X65A 3I2ZA 3KJOA 5FLMH 1C7YA 2E2HH 1OTCA 4DV6Q 4GOPB 4L5SA 3HOWG 3AFPA 4DV1Q 4YWKA 5LMNQ 5JJLA 1I5FA 5AJ3L 5M5WH 1Q82C 2WAQG 3TREA 4DV6L 4MNOA 1JJ2A 3I4OA 4X62Q 4DV1L 4B3ML 1Q81C 5LMNL 4DUZQ 3CCJA 4LF5L 4BBSH 1PYBA 1MIUA 3K7AH 3PCOB 4DR4Q 4JI2Q 4X62L 1R9TH 4DV3Q 4DUZL 4DR7Q 2BH8A 3HOZG 2WFWA 4WJ3M 3OTOL 2HHHQ 1OXXK 2Q2TA 4DR4L 4JI2L 2K52A 3GTQH 1C0AA 1XJVA 4AQYQ 4DV3L 2VNUD 3M4QA 1XTDA 1JJCB 4YCUA 5GAHC 1GVPA 1YHBA 1CUKA 1K73C 4IJHA 2JA5H 4HJAA 1JMCA 4UP9A 2PMZE 3F2CA 4AQYL 1PH9A 4JI6Q 3FKIH 3K81C 4O2DA 3D31A 1PV4A 1CKNB 1IYJB 3GTMH 1EUJA 1G51A 3RLNA 4JI6L 3MEFA 4LWCA 2K5HA 3F2DA 1BVSA 2YTYA 2VUMG 1N33Q 3M4PA 4X64Q 2A19A 3W5OA 4JOIA 3KLWA 1EQRA 1L1OA 1VQOA 1XNQL 3T1HQ 4A3JH 2OWOA 2KHJA 1N33L 1PFSA 1QUQB 4BY1H 2Z6KC 4A3EG 4DK3C 3MXNB 2OQ0A 2QEXA 3TS2A 1YJ9A 1HJPA 3T1HL 5H1SE 4JI7Q 1GKHA 4P75A 3OW2A 2LSSA 3PO3G 4LFAQ 4KHZA 4DAMA 4YY3L 1EIFA 3CCEA 3M9BA 3RLFA 4K0KL 1HH2P 2N3SA 3NEMA 3I4NH 4BBSG 2K5VA 1H95A 3B6YA 4C3HH 4OWWB 1VQ8A 3EBEA 3CD6A 4XIGS 4IPCA 3GTPH 4YHHQ 2I5LX 2Q2IA 2IX0A 4A3IG 1UEBA 1Q7YC 1K8GA 2UUAL 2WAQE 4LUVA 1VQCA 5IY0A 4OO1G 1MJEA 4UPAA 1E1TA 1B8AA 2AWOA 4YHHL 4HIMA 4P71A 1UE1A 2EIFA 2YYZA 3ERSX 1E1OA 5IYCG 2A8VA 2NVYH 4P74A 4A3LG 3FKIG 5FJ8G 4GLXA 1Q86C 2VQEQ 2RHQB 5JJIA 1WOCA 1KQSA 5C44G 3PO2G 2HQLA 1K0RA 4B3TL 4LFCL 3PUWA 3TEHB 3DLLA 4DV7Q 1PH7A 2OTJA 4LF8L 5EAYA 3KOJA 2NZOA 2JQOA 1B70B 2R7DA 2YV5A 5J3BA 4C3IH 3GTJH 4DV7L 4GKKL 5BR8L 4P73A 3J81j 1VS0A 1TWFH 2NVTH 3A5ZB 1VQGA 1XMQL 3CC4A 3F1ZA 2YU9H 4JBJA 1BBUA 4QY7A 1Y14B 5IP9G 1KD1C 4A93G 2UXCL 4R1JA 3S24A 2IT1A 1TXYA 2NN6G 4B3SL 4DAYB 1VQ6A 3E0EA 4FDBA 3S17H 3RNUA 3GTOH 3HOXH 1SLJA 1X54A 3G4SA 3L0OA 4BY7G 3CAMA 2AKWB 2F4VQ 4KHPL 5GROA 4GN5A 1X3FA 1S40A 3ULPA 1P16A 1WI5A 2LXKA 4NXML 1S3OA 4EX5A 1K3RA 1E22A 4Y52H 1QZGA 1UE6A 4NXNL 2ZJQA 1IBLQ 4YWLA 4PZ7A 3PSIA 2VQFL 1KL9A 4JI3L 4JYAQ 3K0XA 1EWIA 1V9PA 4ALPA 1YNXA 1G291 2D62A 3GO5A 4OONA 2LXJA 4DR5Q 1RIPA 4LF9Q 3RN5A 3KF8B 1GD7A 1HNWQ 4DV4Q 1C9OA 2ZTDA 3A74A 4IPGA 3PIPA 5DLQE 1YI2A 4LF9L 4TVAB 1VQIA 1PH4A 4EQ5A 1YIJA 4X66L 1OXSC 4DPGA 5LMUQ 4DV0Q 1I6HH 2JK8A 1VQDA 4JI0Q 1HNZQ 1Z9FA 2CQOA 4QL5A 5C3EG 2IY5B 2UUBL 3E9HA 4DV0L 2JJQA 4AYBG 1HNZL 3T1YQ 1AE2A 1HNXQ 3CCLA 1W2BA 4C2MH 2R7ZG 4LUZA 3JAMi 2NVXH 3CQZH 1P8LA 1V1QA 3GTKH 3HKZG 1HNXL 4GKJQ 3HOYH 4IFDI 2MQHA 2NN6I 4R4CA 3NENA 1Q46A 2UXBL 4PG3A 4LFBQ 3STBD 1SR3A 2C35B 2KCTA 5ELNA 1I94Q 3M3YH 5IYDG 1UE7A 1HR0W 4BXXH 3CXCA 4YCVA 1J6QA 2UUCQ 5IWAQ 3I55A 5M3MG 4R4IA 2N8NA 1L1OB 4IFDJ 1U5KA 3HOVG 2H5XA 3CPFA 1YBYA 2UUCL 1FJGQ 3LGJA 4GNXC 4HIOA 4DR3Q 4DR7L 1N32Q 3I4MH 1X6OA 4NB3A 1WCMH 3U4VA 4QGUA 3RN2A 1Z47A 1PH1A 3KJPA 1TWHH 2HHHL 1FJGL 5ELOA 2FXQA 1YEZA 2EQSA 3KDFA 4UP7A 4A3GH 2XGTA 1N32L 2JA8G 3RZDH 1CSPA 1KIXA 4L5TA 5C0XG 2GVBA 4JI8Q 1YJWA 3CC2A 4LUOA 3HOUH 3PF4A 4GLAC 1GO3E 4JCVE 3S1QH 2D0PA 4JI8L 3W1BA 2ES2A 2I0QA 1EFWA 3KF6A 1OXTA 2KHIA 1YHAA 4DV5Q 1X55A 2QGQA 3H0GH 4X64L 1UE5A 4A3MH 1IBMQ 3UE0A 4LNQA 4A3FG 2E5LQ 1IZ6A 4BA1I 5FLMG 2BH2A 3EIVA 3TQYA 3CC7A 2B63H 4GOPA 1QVFA 3PGZA 2R6GA 1VQ9A 2KCMA 2R92H 4AIMA 2E5LL 3HKSA 1SN8A 3CMEA 4JI7L 2WP8J 3RLOA 2XTIA 4DR2Q 2F52A 4AYBE 3BZCA 2ZTEA 1Y1WH 4LFAL 2CWPA 3J80c 1KAWA 2WB1G 4JBWA 4HJ5A 4DR2L 1HZCA 3ZJYC 4HJ7A 3CW2C 1YITA 3PV0A 1MJCA 4A4IA 1FVIA 2GN5A 1LTLA 1N36Q 4L5QA 1YHQA 1ASYA 2I5MX 4GN4B 2VZAA 3J81c 2ZM6Q 1VQBA 2JA5G 2IX1A 3F2BA 1Q8KA 3UDFA 2JA7H 1D8LA 3FHWA 3UDIA 3W1GA 4HJ8A 1N8RC 3S1NH 1PYSB 3L7ZC 3H3VI 4GNXA 1VQ5A 3CCQA 2CFMA 4A3KH 1VQMA 2JE6I 1BKBA 1Y1VH 3IRBA 1CSQA 2HIXA 1M90C 1K9MC 1DGSA 1Q1EA 2GVAA 2VQEL 1AH9A 5C0XI 4LW1A 1QVCA 3M85A 1WFQA 1V43A 3AFQA 2ASBA 4A3JG 2AWNA 2D0OA 1SFOH 2K14A 4BY1G 2R93H 5IYBH 3S16H 1E7ZA 4A3DH 4IFDG 2F3IA 5C0XJ 1SROA 3CCMA 2RCNA 2NVQH 1EQQA 2RF4A 4LF7Q 1AE3A 5C4JH 1IBKQ 1EOVA 5M3FH 3K8AA 4LF6Q 2ALYB 4LF7L 3I4NG 3KYHC 3STBC 1Y1WG 3G48A 1YJNA 2JA6H 1LUZA 1KRSA 2NZHA 1O7IA 4A3CH 2F4VL 3J7A5 5JJKA 3VDYA 4RG1A 2E8GA 1VQFA 2KENA 4JG2A 2L15A 4AH6A 2UU9Q 1IBLL 1Q12A 1T9HA 4JYAL 1YVCA 3D0FA 1U0LA 4X65Q 3HOWH 2MFIA 2Z0SA 3UDGA 1QVGA 1JJGA 2K4KA 4A75A 4DR5L 1EIYB 1HNWL 4JV5Q 2PI2E 2K5NA 2VS1A 4DV4L 1VQ7A 4HIKA 3I56A 1N34Q 1X56A 1XNRQ 4JI4Q 3KFUA 1K83H 5M5XH 4JV5L 4B3RQ 2VL6A 1L0WA 4OX9Q 3ULLA 3M4OH 1N34L 4LF4Q 5LMUL 4GOPC 3E9IA 3U50C 5GAGC 3HOZH 3BJUA 5HY6A 4JI0L 4B3RL 1E3PA 1WJJA 1L2FA 2VW9A 2HT1A 4GN3B 3UDXA 4A76A 2PI2A 2JA9A 3JC66 4APVA 3T1YL 2E2JH 1PH8A 1VQKA 3KDFB 4YCWA 3HOXG 4JI5Q 4OXPA 4BA2I 1JB7A 3S2DH 3S1MH 4GKJL 1TWCH 4QJFA 4JI1Q 3M7NA 2VUMH 4XTCS 4DR1Q 4LFBL 1XPOA 3HFZB 1NMFA 1I94L 3AEVA 3KF6B 3TRZA 3BZKA 1ASZA 1HZAA 4OWXB 2ZJRA 1G6PA 1X3EA 2N78A 5IWAL 3GTLH 3A0JA 4A3EH 1PA6A 3RZOH 1E24A 2E2IH 3PUXA 1FGUA 5AJ3Q 2CWAA 2EXDA 2PNHA 1M1KC 1KHIA 1D7QA 1KXLA 4IO9A 4Y7NH 3L2PA 4DR3L 2JEAI 4WJ4A 4B3MQ 4QQBX 3S15H 3CCUA 4LF5Q 1TWAH 4DR6Q 3PO3H 4BBRH 2ATWA 1GM5A 4DK6C 3GD7A 2PQAA 4TQUS 1VQEA 5IP7H 5FLXc 1S72A 2B3GA 1PH6A 4R4TA 1PH3A 4DV2Q 4DR6L 2KBNA 3OTOQ 2V1CC 4NPSA 4YWMA 1NY4A 3I7FA 5C4XH 4R4OA 4DV2L 4A3IH 2R7FA 2I5HA 4L5RC 2IHEA 5M5YH 4DV5L 1VQPA 1B7YB 4DKAC 1XPRA 5K36G 1A63A 1VQLA 4DNIA 4P72A 3FP9A 2N49A 3DM3A 5IYCH 1IBML 3HOYG 1UWVA 4A3LH 1OXUA 5FJ8H 2B29A 2OCEA 5IT9c 4GNXB 2MNAA 2ID0A 2YTVA 4QIWE 3PUYA 1X3GA 5C44H 3PO2H 1VQ4A 1JT8A 2IHFA 4IJLA 3BU2A 1IXRA 1XNQQ 4BXXG 3S14H 1PHJA 1EYGA 1NMGA 4RMFA 3J7ZC 2DUDA 3HKZE 4A3BH 1KRTA 1X9NA 2K75A 3CCSA 5JEAJ 1PH5A 3I4MG 1LM0A 5IP9H 1WCMG 4A93H 4PZ8A 1NBWA 2Y0SG 1MKHA 4YY3Q 3CF5A 4A3GG 1YZ6A 1W3SA 3NELA 2DGYA 1BBWA 1I3QH 2ZM6L 1N36L 4K0KQ 3U4ZA 1CKNA 2MO1A 3U58A 4BBRG 4BY7H 5IP7G 4POFA 1Q1BA 4C3JH 1WYDA 3HOUG 4IOAA 2UXDQ 1VQJA 2YTXA 3OYYA 2UUAQ 3CP0A 1HZBA 2A1AA 4OWTB 1CKOA 2UXDL 5C4XG 4JC0A 3AYHB 3RR5A 3H0GG 5LMNW 1QUQA 1VQHA 5E7NA 4A3MG 3K80C 3CCRA 2CKZB 1HR0Q 3S2HH 3NBHB 3G6EA 4ME3A 5GAEC 4IOCA 2B63G 1NJIC 4MZ9A 1VQAA 3G71A 4X6AH 2Q2UA 2R92G 1TWGH 4H02A 4B3TQ 1HR0L 4LFCQ 4LF8Q 4GS3A 3ULJA 5IE8A 3H15A 3S1RH 5GADC 1VCIA 2MO0A 4GKKQ 4DUYQ 4HIDA 5BR8Q 1J5EQ 2K50A 3PF5A 1NTGA 3J80i 4KLKA 3CMAA 1IBKL 1XMQQ 1NE3A 4PMWA 5C3EH 4LF6L 3GTGH 3PUZA 4DUYL 5HGQA 2ZJPA 1J5EL 1SE8A 4A3BG 2UXCQ 3ER0A 1PVOA 4B3SQ 3K7UC 2JEBI 3J81i 3TS0A 2R7ZH 3GDEA 3JAMc 4HJ9A 4POGA 2UU9L 3AQQA 2JA7G 1CKMA 2HIVA 1SMXA 4KHPQ 2WB1E 4PZ6A 4J15A 3Q8DA 2Z6KA 3SGIA 4A3KG 2AMCB 2VY3A 4NXMQ 1QZHA 1SRUA 4X65L 1Y1VG 3PUVA 4NXNQ 1XPUA 2VQFQ 4JI3Q 5IYDH 5GQOA 2Q2HA 2Y0SE 2OTLA 1JE5A 3ICEA 2ZTCA 1XNRL 5M3MH 4JI4L 1A62A 3F8TA 1KC8C 3HOVH 2CCZA 4OX9L 3UE1A 4LF4L 2BA1A 2R93G 2BA0A 3EN2A 5IYBG 4A3DG 4KI0A 4IPDA 4R4QA 1FL0A 5JEAG 3CCVA 4JBKA 1XMOQ 3H3VH 1A8VA 4OO1I 2QA4A 1RL2A 4X66Q 4JOIC 2JA8H 2AHOB 1L1OC 3WWVA 4UY8C 1LYLA 5M3FG 1XMOL 1IL2A 2OQKA 1PH2A 2UUBQ 3PIOA 1I50H 2PQAB 4JI5L 2JA6G 1K8AC 1OXVA 3CPWA 4A3CG 4GLVB 1A0IA 4JI1L 3A5UA 4O0AA 1VQNA 4MTNA 1HZ9A 4DR1L 4JBMA 1N9WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UP8 A;  2RHS B;  4A3F H;  4IPH A;  2UXB Q;  1X65 A;  3I2Z A;  3KJO A;  5FLM H;  1C7Y A;  2E2H H;  1OTC A;  4DV6 Q;  4GOP B;  4L5S A;  3HOW G;  3AFP A;  4DV1 Q;  4YWK A;  5LMN Q;  5JJL A;  1I5F A;  5AJ3 L;  5M5W H;  1Q82 C;  2WAQ G;  3TRE A;  4DV6 L;  4MNO A;  1JJ2 A;  3I4O A;  4X62 Q;  4DV1 L;  4B3M L;  1Q81 C;  5LMN L;  4DUZ Q;  3CCJ A;  4LF5 L;  4BBS H;  1PYB A;  1MIU A;  3K7A H;  3PCO B;  4DR4 Q;  4JI2 Q;  4X62 L;  1R9T H;  4DV3 Q;  4DUZ L;  4DR7 Q;  2BH8 A;  3HOZ G;  2WFW A;  4WJ3 M;  3OTO L;  2HHH Q;  1OXX K;  2Q2T A;  4DR4 L;  4JI2 L;  2K52 A;  3GTQ H;  1C0A A;  1XJV A;  4AQY Q;  4DV3 L;  2VNU D;  3M4Q A;  1XTD A;  1JJC B;  4YCU A;  5GAH C;  1GVP A;  1YHB A;  1CUK A;  1K73 C;  4IJH A;  2JA5 H;  4HJA A;  1JMC A;  4UP9 A;  2PMZ E;  3F2C A;  4AQY L;  1PH9 A;  4JI6 Q;  3FKI H;  3K81 C;  4O2D A;  3D31 A;  1PV4 A;  1CKN B;  1IYJ B;  3GTM H;  1EUJ A;  1G51 A;  3RLN A;  4JI6 L;  3MEF A;  4LWC A;  2K5H A;  3F2D A;  1BVS A;  2YTY A;  2VUM G;  1N33 Q;  3M4P A;  4X64 Q;  2A19 A;  3W5O A;  4JOI A;  3KLW A;  1EQR A;  1L1O A;  1VQO A;  1XNQ L;  3T1H Q;  4A3J H;  2OWO A;  2KHJ A;  1N33 L;  1PFS A;  1QUQ B;  4BY1 H;  2Z6K C;  4A3E G;  4DK3 C;  3MXN B;  2OQ0 A;  2QEX A;  3TS2 A;  1YJ9 A;  1HJP A;  3T1H L;  5H1S E;  4JI7 Q;  1GKH A;  4P75 A;  3OW2 A;  2LSS A;  3PO3 G;  4LFA Q;  4KHZ A;  4DAM A;  4YY3 L;  1EIF A;  3CCE A;  3M9B A;  3RLF A;  4K0K L;  1HH2 P;  2N3S A;  3NEM A;  3I4N H;  4BBS G;  2K5V A;  1H95 A;  3B6Y A;  4C3H H;  4OWW B;  1VQ8 A;  3EBE A;  3CD6 A;  4XIG S;  4IPC A;  3GTP H;  4YHH Q;  2I5L X;  2Q2I A;  2IX0 A;  4A3I G;  1UEB A;  1Q7Y C;  1K8G A;  2UUA L;  2WAQ E;  4LUV A;  1VQC A;  5IY0 A;  4OO1 G;  1MJE A;  4UPA A;  1E1T A;  1B8A A;  2AWO A;  4YHH L;  4HIM A;  4P71 A;  1UE1 A;  2EIF A;  2YYZ A;  3ERS X;  1E1O A;  5IYC G;  2A8V A;  2NVY H;  4P74 A;  4A3L G;  3FKI G;  5FJ8 G;  4GLX A;  1Q86 C;  2VQE Q;  2RHQ B;  5JJI A;  1WOC A;  1KQS A;  5C44 G;  3PO2 G;  2HQL A;  1K0R A;  4B3T L;  4LFC L;  3PUW A;  3TEH B;  3DLL A;  4DV7 Q;  1PH7 A;  2OTJ A;  4LF8 L;  5EAY A;  3KOJ A;  2NZO A;  2JQO A;  1B70 B;  2R7D A;  2YV5 A;  5J3B A;  4C3I H;  3GTJ H;  4DV7 L;  4GKK L;  5BR8 L;  4P73 A;  3J81 j;  1VS0 A;  1TWF H;  2NVT H;  3A5Z B;  1VQG A;  1XMQ L;  3CC4 A;  3F1Z A;  2YU9 H;  4JBJ A;  1BBU A;  4QY7 A;  1Y14 B;  5IP9 G;  1KD1 C;  4A93 G;  2UXC L;  4R1J A;  3S24 A;  2IT1 A;  1TXY A;  2NN6 G;  4B3S L;  4DAY B;  1VQ6 A;  3E0E A;  4FDB A;  3S17 H;  3RNU A;  3GTO H;  3HOX H;  1SLJ A;  1X54 A;  3G4S A;  3L0O A;  4BY7 G;  3CAM A;  2AKW B;  2F4V Q;  4KHP L;  5GRO A;  4GN5 A;  1X3F A;  1S40 A;  3ULP A;  1P16 A;  1WI5 A;  2LXK A;  4NXM L;  1S3O A;  4EX5 A;  1K3R A;  1E22 A;  4Y52 H;  1QZG A;  1UE6 A;  4NXN L;  2ZJQ A;  1IBL Q;  4YWL A;  4PZ7 A;  3PSI A;  2VQF L;  1KL9 A;  4JI3 L;  4JYA Q;  3K0X A;  1EWI A;  1V9P A;  4ALP A;  1YNX A;  1G29 1;  2D62 A;  3GO5 A;  4OON A;  2LXJ A;  4DR5 Q;  1RIP A;  4LF9 Q;  3RN5 A;  3KF8 B;  1GD7 A;  1HNW Q;  4DV4 Q;  1C9O A;  2ZTD A;  3A74 A;  4IPG A;  3PIP A;  5DLQ E;  1YI2 A;  4LF9 L;  4TVA B;  1VQI A;  1PH4 A;  4EQ5 A;  1YIJ A;  4X66 L;  1OXS C;  4DPG A;  5LMU Q;  4DV0 Q;  1I6H H;  2JK8 A;  1VQD A;  4JI0 Q;  1HNZ Q;  1Z9F A;  2CQO A;  4QL5 A;  5C3E G;  2IY5 B;  2UUB L;  3E9H A;  4DV0 L;  2JJQ A;  4AYB G;  1HNZ L;  3T1Y Q;  1AE2 A;  1HNX Q;  3CCL A;  1W2B A;  4C2M H;  2R7Z G;  4LUZ A;  3JAM i;  2NVX H;  3CQZ H;  1P8L A;  1V1Q A;  3GTK H;  3HKZ G;  1HNX L;  4GKJ Q;  3HOY H;  4IFD I;  2MQH A;  2NN6 I;  4R4C A;  3NEN A;  1Q46 A;  2UXB L;  4PG3 A;  4LFB Q;  3STB D;  1SR3 A;  2C35 B;  2KCT A;  5ELN A;  1I94 Q;  3M3Y H;  5IYD G;  1UE7 A;  1HR0 W;  4BXX H;  3CXC A;  4YCV A;  1J6Q A;  2UUC Q;  5IWA Q;  3I55 A;  5M3M G;  4R4I A;  2N8N A;  1L1O B;  4IFD J;  1U5K A;  3HOV G;  2H5X A;  3CPF A;  1YBY A;  2UUC L;  1FJG Q;  3LGJ A;  4GNX C;  4HIO A;  4DR3 Q;  4DR7 L;  1N32 Q;  3I4M H;  1X6O A;  4NB3 A;  1WCM H;  3U4V A;  4QGU A;  3RN2 A;  1Z47 A;  1PH1 A;  3KJP A;  1TWH H;  2HHH L;  1FJG L;  5ELO A;  2FXQ A;  1YEZ A;  2EQS A;  3KDF A;  4UP7 A;  4A3G H;  2XGT A;  1N32 L;  2JA8 G;  3RZD H;  1CSP A;  1KIX A;  4L5T A;  5C0X G;  2GVB A;  4JI8 Q;  1YJW A;  3CC2 A;  4LUO A;  3HOU H;  3PF4 A;  4GLA C;  1GO3 E;  4JCV E;  3S1Q H;  2D0P A;  4JI8 L;  3W1B A;  2ES2 A;  2I0Q A;  1EFW A;  3KF6 A;  1OXT A;  2KHI A;  1YHA A;  4DV5 Q;  1X55 A;  2QGQ A;  3H0G H;  4X64 L;  1UE5 A;  4A3M H;  1IBM Q;  3UE0 A;  4LNQ A;  4A3F G;  2E5L Q;  1IZ6 A;  4BA1 I;  5FLM G;  2BH2 A;  3EIV A;  3TQY A;  3CC7 A;  2B63 H;  4GOP A;  1QVF A;  3PGZ A;  2R6G A;  1VQ9 A;  2KCM A;  2R92 H;  4AIM A;  2E5L L;  3HKS A;  1SN8 A;  3CME A;  4JI7 L;  2WP8 J;  3RLO A;  2XTI A;  4DR2 Q;  2F52 A;  4AYB E;  3BZC A;  2ZTE A;  1Y1W H;  4LFA L;  2CWP A;  3J80 c;  1KAW A;  2WB1 G;  4JBW A;  4HJ5 A;  4DR2 L;  1HZC A;  3ZJY C;  4HJ7 A;  3CW2 C;  1YIT A;  3PV0 A;  1MJC A;  4A4I A;  1FVI A;  2GN5 A;  1LTL A;  1N36 Q;  4L5Q A;  1YHQ A;  1ASY A;  2I5M X;  4GN4 B;  2VZA A;  3J81 c;  2ZM6 Q;  1VQB A;  2JA5 G;  2IX1 A;  3F2B A;  1Q8K A;  3UDF A;  2JA7 H;  1D8L A;  3FHW A;  3UDI A;  3W1G A;  4HJ8 A;  1N8R C;  3S1N H;  1PYS B;  3L7Z C;  3H3V I;  4GNX A;  1VQ5 A;  3CCQ A;  2CFM A;  4A3K H;  1VQM A;  2JE6 I;  1BKB A;  1Y1V H;  3IRB A;  1CSQ A;  2HIX A;  1M90 C;  1K9M C;  1DGS A;  1Q1E A;  2GVA A;  2VQE L;  1AH9 A;  5C0X I;  4LW1 A;  1QVC A;  3M85 A;  1WFQ A;  1V43 A;  3AFQ A;  2ASB A;  4A3J G;  2AWN A;  2D0O A;  1SFO H;  2K14 A;  4BY1 G;  2R93 H;  5IYB H;  3S16 H;  1E7Z A;  4A3D H;  4IFD G;  2F3I A;  5C0X J;  1SRO A;  3CCM A;  2RCN A;  2NVQ H;  1EQQ A;  2RF4 A;  4LF7 Q;  1AE3 A;  5C4J H;  1IBK Q;  1EOV A;  5M3F H;  3K8A A;  4LF6 Q;  2ALY B;  4LF7 L;  3I4N G;  3KYH C;  3STB C;  1Y1W G;  3G48 A;  1YJN A;  2JA6 H;  1LUZ A;  1KRS A;  2NZH A;  1O7I A;  4A3C H;  2F4V L;  3J7A 5;  5JJK A;  3VDY A;  4RG1 A;  2E8G A;  1VQF A;  2KEN A;  4JG2 A;  2L15 A;  4AH6 A;  2UU9 Q;  1IBL L;  1Q12 A;  1T9H A;  4JYA L;  1YVC A;  3D0F A;  1U0L A;  4X65 Q;  3HOW H;  2MFI A;  2Z0S A;  3UDG A;  1QVG A;  1JJG A;  2K4K A;  4A75 A;  4DR5 L;  1EIY B;  1HNW L;  4JV5 Q;  2PI2 E;  2K5N A;  2VS1 A;  4DV4 L;  1VQ7 A;  4HIK A;  3I56 A;  1N34 Q;  1X56 A;  1XNR Q;  4JI4 Q;  3KFU A;  1K83 H;  5M5X H;  4JV5 L;  4B3R Q;  2VL6 A;  1L0W A;  4OX9 Q;  3ULL A;  3M4O H;  1N34 L;  4LF4 Q;  5LMU L;  4GOP C;  3E9I A;  3U50 C;  5GAG C;  3HOZ H;  3BJU A;  5HY6 A;  4JI0 L;  4B3R L;  1E3P A;  1WJJ A;  1L2F A;  2VW9 A;  2HT1 A;  4GN3 B;  3UDX A;  4A76 A;  2PI2 A;  2JA9 A;  3JC6 6;  4APV A;  3T1Y L;  2E2J H;  1PH8 A;  1VQK A;  3KDF B;  4YCW A;  3HOX G;  4JI5 Q;  4OXP A;  4BA2 I;  1JB7 A;  3S2D H;  3S1M H;  4GKJ L;  1TWC H;  4QJF A;  4JI1 Q;  3M7N A;  2VUM H;  4XTC S;  4DR1 Q;  4LFB L;  1XPO A;  3HFZ B;  1NMF A;  1I94 L;  3AEV A;  3KF6 B;  3TRZ A;  3BZK A;  1ASZ A;  1HZA A;  4OWX B;  2ZJR A;  1G6P A;  1X3E A;  2N78 A;  5IWA L;  3GTL H;  3A0J A;  4A3E H;  1PA6 A;  3RZO H;  1E24 A;  2E2I H;  3PUX A;  1FGU A;  5AJ3 Q;  2CWA A;  2EXD A;  2PNH A;  1M1K C;  1KHI A;  1D7Q A;  1KXL A;  4IO9 A;  4Y7N H;  3L2P A;  4DR3 L;  2JEA I;  4WJ4 A;  4B3M Q;  4QQB X;  3S15 H;  3CCU A;  4LF5 Q;  1TWA H;  4DR6 Q;  3PO3 H;  4BBR H;  2ATW A;  1GM5 A;  4DK6 C;  3GD7 A;  2PQA A;  4TQU S;  1VQE A;  5IP7 H;  5FLX c;  1S72 A;  2B3G A;  1PH6 A;  4R4T A;  1PH3 A;  4DV2 Q;  4DR6 L;  2KBN A;  3OTO Q;  2V1C C;  4NPS A;  4YWM A;  1NY4 A;  3I7F A;  5C4X H;  4R4O A;  4DV2 L;  4A3I H;  2R7F A;  2I5H A;  4L5R C;  2IHE A;  5M5Y H;  4DV5 L;  1VQP A;  1B7Y B;  4DKA C;  1XPR A;  5K36 G;  1A63 A;  1VQL A;  4DNI A;  4P72 A;  3FP9 A;  2N49 A;  3DM3 A;  5IYC H;  1IBM L;  3HOY G;  1UWV A;  4A3L H;  1OXU A;  5FJ8 H;  2B29 A;  2OCE A;  5IT9 c;  4GNX B;  2MNA A;  2ID0 A;  2YTV A;  4QIW E;  3PUY A;  1X3G A;  5C44 H;  3PO2 H;  1VQ4 A;  1JT8 A;  2IHF A;  4IJL A;  3BU2 A;  1IXR A;  1XNQ Q;  4BXX G;  3S14 H;  1PHJ A;  1EYG A;  1NMG A;  4RMF A;  3J7Z C;  2DUD A;  3HKZ E;  4A3B H;  1KRT A;  1X9N A;  2K75 A;  3CCS A;  5JEA J;  1PH5 A;  3I4M G;  1LM0 A;  5IP9 H;  1WCM G;  4A93 H;  4PZ8 A;  1NBW A;  2Y0S G;  1MKH A;  4YY3 Q;  3CF5 A;  4A3G G;  1YZ6 A;  1W3S A;  3NEL A;  2DGY A;  1BBW A;  1I3Q H;  2ZM6 L;  1N36 L;  4K0K Q;  3U4Z A;  1CKN A;  2MO1 A;  3U58 A;  4BBR G;  4BY7 H;  5IP7 G;  4POF A;  1Q1B A;  4C3J H;  1WYD A;  3HOU G;  4IOA A;  2UXD Q;  1VQJ A;  2YTX A;  3OYY A;  2UUA Q;  3CP0 A;  1HZB A;  2A1A A;  4OWT B;  1CKO A;  2UXD L;  5C4X G;  4JC0 A;  3AYH B;  3RR5 A;  3H0G G;  5LMN W;  1QUQ A;  1VQH A;  5E7N A;  4A3M G;  3K80 C;  3CCR A;  2CKZ B;  1HR0 Q;  3S2H H;  3NBH B;  3G6E A;  4ME3 A;  5GAE C;  4IOC A;  2B63 G;  1NJI C;  4MZ9 A;  1VQA A;  3G71 A;  4X6A H;  2Q2U A;  2R92 G;  1TWG H;  4H02 A;  4B3T Q;  1HR0 L;  4LFC Q;  4LF8 Q;  4GS3 A;  3ULJ A;  5IE8 A;  3H15 A;  3S1R H;  5GAD C;  1VCI A;  2MO0 A;  4GKK Q;  4DUY Q;  4HID A;  5BR8 Q;  1J5E Q;  2K50 A;  3PF5 A;  1NTG A;  3J80 i;  4KLK A;  3CMA A;  1IBK L;  1XMQ Q;  1NE3 A;  4PMW A;  5C3E H;  4LF6 L;  3GTG H;  3PUZ A;  4DUY L;  5HGQ A;  2ZJP A;  1J5E L;  1SE8 A;  4A3B G;  2UXC Q;  3ER0 A;  1PVO A;  4B3S Q;  3K7U C;  2JEB I;  3J81 i;  3TS0 A;  2R7Z H;  3GDE A;  3JAM c;  4HJ9 A;  4POG A;  2UU9 L;  3AQQ A;  2JA7 G;  1CKM A;  2HIV A;  1SMX A;  4KHP Q;  2WB1 E;  4PZ6 A;  4J15 A;  3Q8D A;  2Z6K A;  3SGI A;  4A3K G;  2AMC B;  2VY3 A;  4NXM Q;  1QZH A;  1SRU A;  4X65 L;  1Y1V G;  3PUV A;  4NXN Q;  1XPU A;  2VQF Q;  4JI3 Q;  5IYD H;  5GQO A;  2Q2H A;  2Y0S E;  2OTL A;  1JE5 A;  3ICE A;  2ZTC A;  1XNR L;  5M3M H;  4JI4 L;  1A62 A;  3F8T A;  1KC8 C;  3HOV H;  2CCZ A;  4OX9 L;  3UE1 A;  4LF4 L;  2BA1 A;  2R93 G;  2BA0 A;  3EN2 A;  5IYB G;  4A3D G;  4KI0 A;  4IPD A;  4R4Q A;  1FL0 A;  5JEA G;  3CCV A;  4JBK A;  1XMO Q;  3H3V H;  1A8V A;  4OO1 I;  2QA4 A;  1RL2 A;  4X66 Q;  4JOI C;  2JA8 H;  2AHO B;  1L1O C;  3WWV A;  4UY8 C;  1LYL A;  5M3F G;  1XMO L;  1IL2 A;  2OQK A;  1PH2 A;  2UUB Q;  3PIO A;  1I50 H;  2PQA B;  4JI5 L;  2JA6 G;  1K8A C;  1OXV A;  3CPW A;  4A3C G;  4GLV B;  1A0I A;  4JI1 L;  3A5U A;  4O0A A;  1VQN A;  4MTN A;  1HZ9 A;  4DR1 L;  4JBM A;  1N9W A; 
#chains in the Genus database with same CATH topology
 1SJH D;  2M00 A;  3IAY A;  4IPH A;  3I2Z A;  3KJO A;  5FLM H;  2E2H H;  3G7L A;  1JCK B;  1JC7 A;  3WOF A;  5IGG A;  5EJW A;  1I5F A;  1JWM D;  2WAQ G;  4HCS A;  1JJ2 A;  4DV1 L;  2E75 C;  2EXZ A;  4BBS H;  4UAI A;  3S1R B;  4DUZ L;  4DR7 Q;  1EEF D;  1DOL A;  5C3E B;  2VNU D;  2BDN A;  1XTD A;  4KKT A;  5GAH C;  1CUK A;  1K73 C;  2JA5 H;  1ZYR C;  4JI6 Q;  2M9V A;  1PH9 A;  1QNU A;  4O2D A;  2R7Z B;  1IYJ B;  1EUJ A;  3MEF A;  3S17 B;  4LWC A;  1A3V A;  3F2D A;  3M4P A;  1VQO A;  1XNQ L;  3T1H Q;  1N33 L;  1Z6H A;  4DK3 C;  2OQ0 A;  2L0C A;  5HUR A;  3MHB A;  2DNE A;  2LSS A;  4ZK9 B;  2XNA C;  4YY3 L;  1EIF A;  3CCE A;  1A3U A;  3RLF A;  1F2M A;  5CV9 A;  1HH2 P;  2N3S A;  3C1E A;  1WTR A;  2K5V A;  3QIA A;  4XT1 B;  1QIL A;  1XYI A;  4Q5V A;  3VR5 A;  1CHQ D;  4XIG S;  4IPC A;  3DWQ A;  1I6H B;  2Q2I A;  2IPK D;  3MVV A;  2JSO A;  4CGY B;  4PQX A;  3CRK C;  4RHR A;  1PLF A;  2YYZ A;  3ERS X;  4P71 A;  4A3L G;  5FJ8 G;  2E2H B;  2CW0 D;  2EJG C;  1WOC A;  2HQL A;  1K0R A;  4LFC L;  3PUW A;  3TP6 A;  4DV7 Q;  5IGB A;  4KY5 A;  2F4I A;  5E1F A;  3KOJ A;  4IUP A;  1B70 B;  4C3I H;  3GTJ H;  4KKU A;  4GKK L;  1PZJ D;  4P73 A;  5BR8 L;  1V1P B;  1E0B A;  1V1O A;  2UXC L;  1Y14 B;  2C5C A;  3S24 A;  3HP3 A;  2IT1 A;  2NN6 G;  2EYJ A;  5ELE A;  3E0E A;  4FDB A;  3T16 A;  2KVM A;  5CV4 A;  3HOX H;  3RNU A;  3GTO H;  2NBF A;  3G4S A;  2F0M A;  5KRU A;  1TWH B;  2RQX A;  2RDG A;  3VR4 A;  2K28 A;  4PV1 C;  5GRO A;  2D2C C;  5IOD A;  2F4V Q;  4KHP L;  1WI5 A;  1S3O A;  4EX5 A;  1E22 A;  3H94 A;  3C1F A;  2EY2 A;  5G3L D;  1IBL Q;  4YWL A;  3PSI A;  1KL9 A;  2Z8L A;  4JI3 L;  4JYA Q;  4F8M A;  2RA4 A;  4K5W A;  1ICF B;  2LXJ A;  2PYK A;  1HNW Q;  3RN5 A;  3KF8 B;  2RDF A;  3R2I A;  4DV4 Q;  1IW7 D;  1GUN A;  1QWY A;  3PIP A;  4K5X A;  4PMC A;  1SE2 A;  3SK8 A;  2KED A;  1PH4 A;  2SEB D;  2F1M A;  5LMU Q;  1OXS C;  2JK8 A;  3K6O A;  2UUB L;  1TS2 A;  1C48 A;  3T1Y Q;  1AE2 A;  3CCL A;  1W2B A;  1KDA A;  4H13 C;  1P8L A;  2G9H D;  2AUK A;  1HNX L;  2MQH A;  2JA7 B;  4PG3 A;  4LFB Q;  1S5E D;  5JOB A;  4U67 3;  1HR0 W;  3CXC A;  2UUC Q;  3I55 A;  2N8N A;  1AP0 A;  4CDE C;  4IFD J;  3HOV G;  3LNN A;  2PMZ B;  3DXJ C;  3LGJ A;  4RGO S;  3A8I E;  4C3I B;  1N32 Q;  2HHH L;  1SFO B;  2CHB D;  3CU7 A;  4HSP A;  3RZD H;  2EYM A;  1BO0 A;  4WRD A;  3JAM E;  3NUC A;  3QR8 A;  3HOX B;  3TP8 A;  2D0P A;  2I0Q A;  4DV5 Q;  4FO2 A;  2RDH A;  1EQT A;  5JJZ A;  1IBM Q;  5CV5 A;  2B2V A;  4BA1 I;  3EIV A;  3PGZ A;  1LLR D;  5FO8 B;  2L12 A;  3W2D A;  4AIM A;  1SNQ A;  3HS0 C;  3RLO A;  3SK4 A;  2XTI A;  4KHV A;  3OPO A;  4DR2 Q;  3A56 A;  3KLS X;  4LFA L;  2WAQ B;  2WB1 G;  1HZC A;  4HJ7 A;  4RGM A;  2KOL A;  1YIT A;  4OGQ C;  4CHT B;  1LTL A;  1N36 Q;  2ZM6 Q;  4GN4 B;  2VZA A;  3KK7 A;  1VQB A;  1D8L A;  2JYO A;  1N8R C;  1PYS B;  2XRS D;  4GNX A;  4A3K H;  2JE6 I;  4FF1 A;  2CH4 A;  1Y1V H;  4KD4 A;  2LFN A;  2NB0 A;  3OIP A;  4LW1 A;  3MFY A;  1S5B D;  1ENC A;  3AFQ A;  1LT6 D;  1UUP A;  4BY1 G;  4IN3 A;  2F0N A;  2FIN B;  4EQO A;  4IFD G;  1RJT A;  3NTI A;  5C0X J;  1SRO A;  1J8I A;  5IGE A;  1EYC A;  2RCN A;  3A7A B;  4JK1 C;  1SAP A;  3I8Z A;  2I07 B;  2ALY B;  3I4N G;  1O7L A;  1Y1W G;  4TRD A;  4C3H G;  3RZD B;  2NZH A;  3K5O A;  5EKK A;  2HQE A;  1VQF A;  2L15 A;  2LY7 A;  5C6A A;  3E0J A;  2MUY A;  1YVC A;  2Z0S A;  3I73 A;  1NUC A;  4DR5 L;  2PI2 E;  2K5N A;  1BCP D;  2E74 C;  1SNP A;  1N34 Q;  4XQN A;  2B2U C;  2VL6 A;  4OX9 Q;  3ULL A;  2Z6B A;  1AEX A;  2K1B A;  5GAG C;  3U50 C;  3BJU A;  4JI0 L;  1SND A;  1TY0 A;  1WJJ A;  2I46 A;  2VW9 A;  2IWH A;  2PI2 A;  2RBM A;  4IAL A;  4APV A;  3KDF B;  1H9M A;  1UNS A;  3VR3 A;  3S2D H;  3S1M H;  3ND8 A;  1EY7 A;  1PXU A;  3M7N A;  1I3Q B;  2RSO A;  4K8I A;  1DD2 A;  1JE4 A;  4A3K B;  2RKS A;  4DR1 Q;  4G7H C;  1G6Z A;  5J39 A;  2MHV A;  1NMF A;  1I94 L;  1ENF A;  2ZT9 C;  1EY0 A;  4OWX B;  2N78 A;  5DNF A;  4A3E H;  1EEI D;  3PIP 3;  5ELF A;  3A55 A;  1FGU A;  4ZKB B;  5AJ3 Q;  2EXD A;  4WOR A;  3OWE B;  4Y7N H;  5IGF A;  3L2P A;  2JEA I;  2HD3 A;  3S15 H;  4DR6 Q;  2BE5 D;  5IP7 H;  5FLX c;  1PH3 A;  1XX8 A;  5EBD A;  2V1C C;  4H7B A;  1NY4 A;  1B7Y B;  5K36 G;  4K2L A;  1T5X D;  3V2T A;  3A54 A;  2GA4 B;  2Q8T A;  1OXU A;  2ICE C;  4KY7 A;  1PRT C;  2IW3 A;  2ID0 A;  3H91 A;  5JPM C;  1X3G A;  3PO2 H;  1VQ4 A;  2IHF A;  3S14 H;  1EYG A;  5I6Y A;  3HKZ E;  3Q0A A;  2K75 A;  3I4L A;  2JN4 A;  3CCS A;  1SYC A;  1PH5 A;  1F2Z A;  4DXG A;  3L3O C;  1ZEQ X;  3MFG A;  3SEB A;  5IP9 H;  4A93 H;  4O1N A;  3GV6 A;  3VR2 A;  1WTX A;  2WAC A;  1BBW A;  2B2W A;  1CKN A;  3U4Z A;  4KMU C;  3U58 A;  4HR7 B;  4POF A;  1Q1B A;  2K5Q A;  3KLS A;  2UXD Q;  4HCE A;  3S2D B;  2UUA Q;  1VF7 A;  4JPB W;  3N6R A;  3S1M B;  1CTM A;  3I90 A;  2PW7 A;  1YNN D;  5C4X G;  1O78 A;  2DY7 A;  2O4X A;  4JC0 A;  3H0G G;  2VB3 X;  1QUQ A;  3K57 A;  4A3M G;  4NDX A;  3CCR A;  2CKZ B;  2AQ3 B;  5GAE C;  4FXD A;  1VQA A;  4CJ0 B;  2Q2U A;  3HGB A;  4A3E B;  2Z4I A;  3ULJ A;  3MC0 B;  5I9P A;  3H09 A;  4DUY Q;  4HID A;  2K03 A;  1J5E Q;  1LT3 D;  3S15 B;  2F0J A;  1PTO C;  4OHJ A;  1NE3 A;  4LF6 L;  4DNT B;  4A3B G;  1SE8 A;  3TP5 A;  3ER0 A;  4O42 A;  4B3S Q;  3K7U C;  3TS0 A;  3J81 i;  1CA5 A;  1KNA A;  1GHK A;  4HJ9 A;  2UU9 L;  3AQQ A;  5I2Y A;  3QG1 A;  4I7Z C;  1SMX A;  3J7A V;  4ZYS A;  4NXN Q;  3A8K E;  2F0F A;  1D5X C;  1JE5 A;  1XNR L;  4JI4 L;  3D4W A;  2KEC A;  3S14 B;  4H0L C;  5JVH 3;  4LF4 L;  2BA1 A;  1U4L A;  2R93 G;  4KV6 A;  4A3D G;  4KI0 A;  4DAY A;  4IPD A;  2A6H C;  2A68 C;  3NTH A;  3CCV A;  4JBK A;  4L63 B;  3O13 A;  4A93 B;  1AN8 A;  3P75 A;  2A74 C;  3WWV A;  4UY8 C;  5M3F G;  1IL2 A;  3HG9 A;  1I50 H;  1U4M A;  4IUV A;  1SNO A;  1SEB D;  4O0A A;  2EPB A;  3I4N B;  3NHH A;  2H4O A;  4N9P A;  2RHS B;  4A3F H;  2UXB Q;  1C7Y A;  1OTC A;  3PQI A;  3HOW G;  1Q82 C;  1EYD A;  5M5W H;  3CKI B;  4HAE A;  1BUV T;  1CHP D;  5FO9 B;  4X62 Q;  1SYG A;  3K7A H;  3MA2 B;  1R9T H;  1RTN A;  1WTV A;  4WJ3 M;  1OXX K;  4AQY Q;  4XT3 B;  1HTP A;  4YCU A;  1F2L A;  1GVP A;  4IJH A;  1TWF B;  4HJA A;  1EIG A;  1JMC A;  1D6E C;  3FKI H;  1ESF A;  1EQV A;  5A2Q E;  3R2T A;  1G51 A;  4JI6 L;  1XXG A;  4J1M A;  1BVS A;  1PZK D;  2YTY A;  1O80 A;  2KA7 A;  2VUM G;  4JOI A;  5ELD A;  3KLW A;  2A69 C;  2KHJ A;  2KCN A;  2Z6K C;  3DM1 A;  3DUZ A;  2HCI A;  3T1H L;  5H1S E;  4L6T B;  1CI3 M;  5FLX L;  1K3B C;  4WJW A;  2BDO A;  4DAM A;  1HCZ A;  4K0K L;  3NEM A;  4BBS G;  3B6Y A;  4OWW B;  1AW7 A;  1I50 B;  2AQ1 B;  2HUG A;  3GTP H;  2I5L X;  5IY0 A;  2CQA A;  1VQC A;  3M7G A;  4UPA A;  4XYQ A;  1MJE A;  1E1T A;  1B8A A;  1ML0 D;  2AWO A;  4HIM A;  2A8V A;  1E2V A;  1E1O A;  2KJX A;  2EZV A;  1STE A;  1PTO F;  4JVZ A;  4GLX A;  4OL7 A;  4A3F B;  1Q86 C;  2VQE Q;  2RHQ B;  3CQZ B;  3J80 L;  4B9X A;  1G8Z D;  4RKB A;  3AMU A;  4LF8 L;  5M5W B;  3R3O A;  4G4K A;  5J3B A;  4DV7 L;  1F9S A;  1E2W A;  1X3Q A;  3J81 j;  4RHS A;  5FLX E;  3CC4 A;  3K7A B;  1XMQ L;  3F1Z A;  2YU9 H;  1R9T B;  1QE6 A;  2WKC A;  1WD0 A;  1TXY A;  1VQ6 A;  3T13 A;  3S17 H;  5LL6 S;  3L0O A;  2JP1 A;  1FNU A;  1S40 A;  1P16 A;  4NXM L;  2KHS A;  1K3R A;  2EY1 A;  4PZ7 A;  2VQF L;  3HRZ C;  1V9P A;  2O2L D;  4ILW A;  1G29 1;  1ESR A;  4LF9 Q;  4DXF A;  4N8X 1;  2K01 A;  1RF2 D;  4A3M B;  1IHZ A;  3K5L A;  1YI2 A;  4K6D A;  2OF1 A;  2IX3 A;  4X66 L;  4DV0 Q;  1I6H H;  1VQD A;  1HNZ Q;  1KTK A;  2CQO A;  4ODG A;  4DN4 M;  3IKJ A;  2K6A A;  5DM6 3;  2SNS A;  3AB9 A;  1CA6 A;  3T4A C;  4C2M H;  5I2X A;  3GTP B;  1V1Q A;  3HKZ G;  2NTS A;  4GKJ Q;  3HOY H;  4IFD I;  3NWT A;  2C35 B;  2TSS A;  2K33 A;  5IYD G;  4BXX H;  4YCV A;  1J6Q A;  1Q90 A;  5M3M G;  1L1O B;  1U5K A;  2UUC L;  3MWY W;  1AFP A;  4GNX C;  4DR3 Q;  4NP5 A;  3K58 A;  1X6O A;  4NB3 A;  3ERO A;  3U4V A;  3I4M H;  3KJP A;  1TWH H;  2YU9 B;  2EQS A;  4A3G H;  1N32 L;  3R8B A;  1E2Z A;  2JA8 G;  1G2T A;  4IZ8 A;  1HQR D;  2F0D A;  2CW0 C;  2GVB A;  4JI8 Q;  1YJW A;  3CC2 A;  3NP8 A;  3HOU H;  5JAV A;  2CVR A;  5DEH A;  2K5W A;  1U4R A;  1ZXT A;  2ES2 A;  3W1B A;  5M3F B;  1EFW A;  3KF6 A;  1OXT A;  2KHI A;  1X55 A;  3NBI A;  2QGQ A;  4X64 L;  1ET9 A;  3NSW A;  1FD7 D;  2E5L Q;  3K5M A;  4J6H A;  3RUZ A;  4V0B A;  4RAU C;  1SN8 A;  4EQP A;  1QOH A;  4JI7 L;  4FF2 A;  1D5Z C;  5DM7 3;  3OMC A;  2F52 A;  4FNF A;  4AYB E;  5L37 A;  3BZC A;  1NR4 A;  2C9O A;  5TSS A;  2CWP A;  1KAW A;  4DR2 L;  3ZJY C;  4A4I A;  2BCO A;  2KCC A;  3M4O B;  5C4H A;  1SXT A;  4L5Q A;  2JA7 H;  3FHW A;  3W1G A;  4DAP A;  4ZAI A;  3S1N H;  1IW7 C;  3KLR A;  4C2M B;  3CCQ A;  2CFM A;  1VQM A;  3ERQ A;  1CSQ A;  3HOY B;  1DGS A;  2EYL A;  4DA2 A;  5C0X I;  1WTW A;  1AH9 A;  1JQY D;  1WFQ A;  1TWC B;  1CQV A;  4RKL A;  4A3J G;  2AWN A;  1SFO H;  5IYB H;  1TT2 A;  1STG A;  2K5D A;  2G5D A;  2NVQ H;  3I4M B;  1AE3 A;  2Y0S B;  2F0W A;  1F9P A;  3K8A A;  4KN4 C;  4A3G B;  3BYY B;  4E6I A;  4KJO A;  2N55 A;  3G48 A;  1MSG A;  2JA6 H;  2B2Y A;  4BBR B;  4A3C H;  2EY6 A;  4KN7 C;  3J7A 5;  4NW2 A;  3HOU B;  4F88 A;  3VDY A;  4RG1 A;  3OW7 A;  2KEE A;  1BR9 A;  1T9H A;  3NBH A;  5FK9 C;  1B44 D;  2X6G A;  3MXP A;  4X65 Q;  3UDG A;  1JJG A;  2K4K A;  4A75 A;  5CV8 A;  4JV5 Q;  2PO4 A;  4MN3 A;  4HIK A;  1VQ7 A;  1X56 A;  4QUF A;  1SSO A;  4B3R Q;  1L0W A;  3QO2 A;  3V96 A;  1N34 L;  4Z9C B;  4GOP C;  2ZXR A;  1YNJ D;  3JAM L;  5HY6 A;  1I4R A;  1I4H A;  1TKW B;  3E3X A;  3JC6 6;  3BVG A;  3UI2 A;  5IGD A;  4F87 A;  3MEH A;  4JI5 Q;  2NYZ D;  4LAA A;  4JI1 Q;  3S1N B;  2PW5 A;  4XTC S;  1JWU D;  1MGS A;  1ASZ A;  2ZJR A;  5IWA L;  3RMH A;  1PA6 A;  1F77 A;  1HHV A;  1KXL A;  2PNH A;  3CCU A;  1TWA H;  3T56 B;  1S5F D;  4M8A A;  3SDZ A;  1GM5 A;  1DXM A;  1TWG B;  1S72 A;  2NVQ B;  5EQ0 A;  1NNX A;  2B2T A;  4DR6 L;  2KBN A;  4NPS A;  1EZ8 A;  4L8J A;  2LKV A;  1C4Q A;  2JA6 B;  2R7F A;  2I5H A;  1A63 A;  1NSN S;  2FHT A;  4DKA C;  3Q6S A;  4Q0F A;  1VQL A;  3H3V C;  1I4G A;  3TN2 A;  2PZT A;  3FP9 A;  2J4X A;  3DM3 A;  2ZXP A;  4DK0 A;  1UWV A;  1KAA A;  5JPN C;  4A3L H;  5FJ8 H;  4YIJ A;  4CJ2 C;  1IKM A;  2B29 A;  2E2D C;  2OCE A;  5G3L F;  2YTV A;  4RWS C;  3BU2 A;  1XNQ Q;  5KND A;  1A15 A;  3TZD A;  4RCN A;  3J7Z C;  2XWJ B;  2DUD A;  1ONL A;  4X3K A;  5JEA J;  4XXE A;  1WCM G;  3LWE A;  5HGT A;  5NUC A;  2NN6 H;  1T5E A;  1BDO A;  4ID6 A;  1MKH A;  4YY3 Q;  4CDD C;  2PPB C;  1I3Q H;  2MO1 A;  2K05 A;  4DNR B;  5IP7 G;  1BCP C;  3BZD B;  4M1U B;  1VQJ A;  4R8N A;  1MD2 D;  3VYU A;  3CP0 A;  1ZKO A;  5IGC A;  2UXD L;  5ELB A;  5LMN W;  4RA8 A;  1EY4 A;  1HA5 A;  2E76 C;  3K80 C;  4CJ1 B;  4MTK A;  1HR0 Q;  3S2H H;  3G6E A;  4IOC A;  4ME3 A;  2B63 G;  4MZ9 A;  2R92 G;  3F2U A;  4LFC Q;  4U68 A;  3URY A;  3VYT A;  4XQJ A;  2N88 A;  3U9O A;  5IE8 A;  3H15 A;  2CH4 W;  5GAD C;  3QJY A;  2MO0 A;  3BYT B;  4GKK Q;  5BR8 Q;  1NTG A;  1TWA B;  4KLK A;  3J80 i;  4NMZ A;  1IBK L;  4DUY L;  2UXC Q;  1J5E L;  1QNK A;  1B3Q A;  2F0I A;  1WTP A;  3MXG A;  2HIV A;  2XIW A;  4QUC A;  4KHP Q;  1RKN A;  4PZ6 A;  1QZH A;  1BQQ T;  1ICW A;  4GZY C;  2BE5 C;  3SXH A;  4JI3 Q;  4KJN A;  1D5M C;  1ILQ A;  1U9R A;  1XTC D;  2Y0S E;  4C1N I;  4FYD A;  1A62 A;  3HOV H;  1V1P A;  4EQN A;  1LTA D;  1LAB A;  2BA0 A;  4CDF C;  3HEJ A;  1FL0 A;  4H44 C;  5JEA G;  1DM0 B;  2B8G A;  2FMM A;  2QA4 A;  2G9D A;  4QCL A;  1RL2 A;  1Y8P B;  3G6J B;  1LTB D;  4JOI C;  1DOK A;  2AHO B;  4PMB A;  1LYL A;  5E4W C;  2OQK A;  2PZU A;  2UUB Q;  3PIO A;  2PQA B;  1BOS A;  4ZUJ A;  3D4D A;  4GLV B;  2RCF A;  3A5U A;  4MTN A;  2KUM A;  1A3T A;  1N9W A;  4AYB G;  5BN4 A;  4UP8 A;  3OSO A;  3QOJ A;  3KF8 A;  1LTS D;  2MGS A;  4DV6 Q;  5C4Z A;  2MPM A;  1JOQ A;  5LMN Q;  3S2H B;  3R93 A;  3GP7 A;  1GUS A;  4MNO A;  1MHW C;  2NVY B;  1LTT D;  3NQI A;  4B3M L;  2F0U A;  3CCJ A;  2OXP A;  4LF5 L;  1PYB A;  4DR4 Q;  1EYA A;  4JI2 Q;  4X62 L;  4DV3 Q;  1DON A;  3HOZ G;  1YNN C;  2WFW A;  3OTO L;  2HHH Q;  2Q2T A;  4TKO B;  4KK7 A;  1JJC B;  1UEA B;  3DMU A;  4QIW B;  4FF3 A;  3TME A;  5D3D A;  2PMZ E;  3F2C A;  1I4P A;  4AQY L;  3K81 C;  3D31 A;  1PFN A;  3GTM H;  3RLN A;  2DN8 A;  3NE5 B;  1H9S B;  2A19 A;  1PDQ A;  5BN5 A;  1PTO H;  2OWO A;  1KDB A;  1PFS A;  4BY1 H;  2QW7 A;  1LT5 D;  3GQB A;  3PMF A;  3MXN B;  1BCP F;  1YJ9 A;  4IFD H;  3HOV B;  4R9W A;  1GKH A;  2XVS A;  5IOC A;  3PO3 G;  4LFA Q;  4KHZ A;  3M9B A;  3ND9 A;  3I4N H;  1H95 A;  4C3H H;  3IFT A;  3EBE A;  3CD6 A;  1PRT B;  3SHL A;  4YHH Q;  4A3I G;  1Q7Y C;  2WAQ E;  4LUV A;  1L0X B;  4OO1 G;  1STN A;  3IL8 A;  3OOC A;  1HFG A;  2EIF A;  4DGZ A;  5EBC A;  5IYC G;  1A6X A;  2EYO A;  1EY5 A;  3I72 A;  3FKI G;  2NVX B;  4K8J A;  5I6W A;  5JJI A;  5C5L A;  5C44 G;  4B3T L;  1PH7 A;  3DLL A;  2OTJ A;  1KAB A;  5EAY A;  1VDZ A;  3P1H A;  2NZO A;  1B9M A;  2JQO A;  3A8J E;  1WTO A;  1VS0 A;  1TWF H;  1SNC A;  2NVT H;  1VQG A;  1C8C A;  4BS9 A;  2WB1 B;  4JBJ A;  4QY7 A;  4R1J A;  1AZQ A;  5EPJ A;  3HZX A;  1B53 A;  1SLJ A;  1JIC A;  4BY7 G;  3CAM A;  4ABN A;  4C3J G;  3L9A X;  4GN5 A;  3FDT A;  3ULP A;  2LXK A;  3BDO A;  1STH A;  3GTM B;  2ZJQ A;  3CRL C;  5ELC A;  1EWI A;  5LL6 X;  1LT4 D;  4ALP A;  4QB4 A;  2D62 A;  1PTO B;  4RCO A;  4DR5 Q;  1GD7 A;  3RD4 A;  4BY1 B;  4IPG A;  5DLQ E;  4LF9 L;  2EY5 A;  1V8Q A;  2B63 B;  1VQI A;  5C0X H;  1A2U A;  1YIJ A;  4DPG A;  4N8F A;  1EFI D;  4JI0 Q;  4QL5 A;  5C3E G;  5A2Q L;  4IQZ A;  4DV0 L;  2JJQ A;  1Y1W B;  1HNZ L;  4C3H B;  4TSS A;  5K36 H;  2R7Z G;  4LUZ A;  3JAM i;  3CQZ H;  2LS0 1;  3GTK H;  2NN6 I;  4R4C A;  3NEN A;  1Q46 A;  1HUM A;  2NTT A;  4K6L A;  1TS4 A;  1FR3 A;  1WD1 A;  3STB D;  1I94 Q;  3M3Y H;  2KCT A;  5ELN A;  1UE7 A;  2SNM A;  2O5J C;  2M2L A;  1HA6 A;  2F0K A;  4R4I A;  2H5X A;  3CPF A;  3MXU A;  1FJG Q;  1QJO A;  1PRT F;  4G57 A;  2MJ8 A;  5F2D A;  4HIO A;  4DR7 L;  1EWC A;  2DY8 A;  4QGU A;  2QIL A;  3RN2 A;  2NVT B;  5ELO A;  4UP7 A;  1X3P A;  3KDF A;  3PIO 3;  2PCF B;  1CSP A;  4K5V A;  5COY A;  4GLA C;  4KD3 A;  1IL8 A;  3S1Q H;  4JI8 L;  5D3I B;  4HTH A;  3BVZ A;  4N9T A;  3BS1 A;  3H0G H;  2MP1 A;  4A3M H;  2B2U A;  3UE0 A;  5JVG 3;  1IZ6 A;  4XDX A;  5FLM G;  2BH2 A;  3CC7 A;  2R6G A;  2F0V A;  1VQ9 A;  2KCM A;  1O7Y A;  1DYQ A;  2XN9 C;  2B2Y C;  4ULL A;  2E5L L;  3CME A;  2WP8 J;  1VMC A;  3C2P A;  1D1K A;  2ZTE A;  1Y69 U;  2QDL A;  2PNR C;  4JBW A;  4HJ5 A;  5DAU A;  3CW2 C;  2L5T A;  1MJC A;  4DAV A;  1FVI A;  2GN5 A;  1YHQ A;  2XSC A;  3J81 c;  4HSV A;  2JA5 G;  2VB2 X;  3F2B A;  1Q8K A;  3SVM A;  3UDF A;  1K28 A;  3L7Z C;  4BWG B;  1VQ5 A;  2E2J B;  1BKB A;  3GTK B;  3IRB A;  4LMQ D;  3ZYY X;  1B1Z A;  1M90 C;  1K9M C;  1Q1E A;  4ZLT F;  5IIF A;  3TDQ A;  1H9S A;  1QVC A;  3DWP A;  3M85 A;  3M3Y B;  3H6M A;  3OHX C;  4XYO A;  2K04 A;  3CHB D;  3WDN A;  2R93 H;  4A3D H;  1E7Z A;  5KNC A;  1Q8I A;  2XRQ D;  2J0T D;  1EQQ A;  3M4Y A;  4LF7 Q;  1D2B A;  1WTH A;  5M3F H;  3FMC A;  4LF6 Q;  4OEL B;  3KYH C;  4KTA A;  2EJM A;  1KDC A;  2HDL A;  2RSN A;  1YJN A;  2EVB A;  3VA7 A;  1KRS A;  1O7I A;  2F4V L;  1ET6 A;  1NR2 A;  2R61 A;  2KEN A;  2R3Z A;  4AH6 A;  1GUW A;  2UU9 Q;  3S1Q B;  1IBL L;  1TII D;  4JYA L;  5C4X B;  3D0F A;  1U0L A;  2B8F A;  5CC4 A;  3H0G B;  5KIX A;  3HOW H;  2B2T C;  2Z9H A;  1HNW L;  1M8A A;  2VS1 A;  4DV4 L;  2K7V A;  1XNR Q;  4JI4 Q;  2F0E A;  4RGN A;  3KFU A;  4JV5 L;  2B2V C;  4C3I G;  3M4O H;  4LF4 Q;  3SR1 A;  5LMU L;  1RD9 D;  4B3R L;  1GOZ A;  2KQ3 A;  3EJI A;  3Q23 A;  2HT1 A;  4GN3 B;  4A76 A;  4A3B B;  1ILP A;  2X69 A;  3T1Y L;  2HDM A;  3FPP A;  1HTL D;  1LTG D;  4YCW A;  4P2C B;  5ISR A;  3HOX G;  4BA2 I;  2IL8 A;  1IYU A;  1TWC H;  4QJF A;  4X3S A;  2VUM H;  3OWF A;  4LFB L;  1K0S A;  1I6V C;  4R8I A;  3OMG A;  3GTL H;  3A0J A;  2ZXO A;  1E24 A;  2E2I H;  3PUX A;  1M1K C;  1D7Q A;  3SK5 A;  2B39 A;  3BVM A;  2R93 B;  1DCZ A;  3E5S A;  4A3D B;  4BBR H;  3FEW X;  2AQ2 B;  4DK6 C;  1VQE A;  3TZU A;  2BOS A;  4S3S A;  1PH6 A;  4I65 A;  4X3T A;  4DV2 Q;  3V05 A;  4YWM A;  1GHJ A;  1LAC A;  1VQP A;  4DV5 L;  4JW0 A;  5CV6 A;  1XPR A;  4P72 A;  2N49 A;  1HPC A;  5COR A;  1IBM L;  1DJR D;  5CMD A;  2Z1C A;  1S4Z A;  1HXY D;  2Q8R E;  5IT9 c;  4GNX B;  2MNA A;  3HOW B;  1JT8 A;  4IUR A;  2IJ0 A;  3SK6 A;  2A73 B;  3K5N A;  3Q24 A;  2RVL A;  3NXW A;  5T1I A;  4K2K A;  1CT1 D;  4DFA A;  1NBW A;  3CF5 A;  1N36 L;  2DGY A;  4K0K Q;  2ZM6 L;  2F0S A;  2D5D A;  1WYD A;  4MHE A;  2YTX A;  2Z4H A;  4OWT B;  2A1A A;  2NUC A;  3A7L A;  1CKO A;  3DHQ A;  3RR5 A;  1RTO A;  1YNJ C;  2VUM B;  1SYB A;  2OT2 A;  4ZRZ A;  3P7J A;  2O5I C;  3MTS A;  1ZYR D;  2F0H A;  1NJI C;  4X6A H;  1CM9 A;  3GTL B;  1TWG H;  3I91 A;  1HR0 L;  3IFD A;  2E2I B;  4LF8 Q;  4WFN 3;  1ENA A;  3CMA A;  1XMQ Q;  3GTG H;  4B9W A;  2SOB A;  3PUZ A;  5CR3 A;  2LMC B;  3J81 L;  1II3 A;  2SDF A;  4BBS B;  1EY6 A;  4HMJ A;  5J1Z A;  3TBI B;  5C3W A;  4CKE A;  1S5C D;  1CKM A;  1F9Q A;  4J15 A;  3Q8D A;  2Z6K A;  3SGI A;  4A3K G;  2AMC B;  4NXM Q;  2JA5 B;  1SRU A;  1Y1V G;  3X3N A;  2VQF Q;  5IYD H;  1LO5 D;  2Q2H A;  4FF4 A;  1QCB D;  3ICE A;  1QG7 A;  2ZTC A;  3BDL A;  4KKS A;  5M3M H;  1K8O A;  1Y8N B;  2QKI C;  2Q8I B;  3SE0 A;  5I9O A;  1AZP A;  2HCC A;  4LJZ C;  4OX9 L;  3EN2 A;  4HED A;  1SYE A;  5FOB B;  3EQL C;  3H3V H;  4OO1 I;  1XMO Q;  4X66 Q;  5D14 A;  1R4P B;  2JA8 H;  1EU3 A;  2PQE A;  1H9K A;  3J81 E;  1PH2 A;  3NQT A;  1QB5 D;  2ENB A;  1LTR D;  1OXV A;  3CPW A;  4ZKC B;  3D6W A;  1SYF A;  2EYF A;  1LTI D;  4DR1 L;  2B2W C;  1X65 A;  4L5S A;  4GOP B;  3AFP A;  4DV1 Q;  4YWK A;  5JJL A;  5AJ3 L;  2F03 A;  3TRE A;  4DV6 L;  3I4O A;  1Q81 C;  5LMN L;  4DUZ Q;  1MIU A;  3PCO B;  1GXD C;  2BH8 A;  2EDG A;  1B3A A;  4DR4 L;  4JI2 L;  2K52 A;  3GTQ H;  1C0A A;  1XJV A;  4FXK C;  1LV9 A;  3LWU A;  4DV3 L;  3M4Q A;  3GTJ B;  3GTG B;  5EKI A;  1EZ6 A;  1YHB A;  3TP7 A;  4FXG C;  4UP9 A;  1H9R A;  1BXT A;  1CKN B;  1PV4 A;  4CBV A;  4CDC C;  3HKZ B;  1MSH A;  2K5H A;  4K14 A;  3GTO B;  3QOL A;  1ROD A;  3D6C A;  1N33 Q;  4X64 Q;  5FKA C;  3W5O A;  4IUN A;  1EQR A;  1L1O A;  4EGV A;  1JWS D;  3DEP A;  1RDP D;  1TQO A;  4A3J H;  1QUQ B;  1R4Q B;  4A3E G;  5M3M B;  2QEX A;  3TS2 A;  1EY9 A;  1HJP A;  2A6E C;  4JI7 Q;  5A35 A;  1SNM A;  4P75 A;  3NTK A;  3OW2 A;  3P20 A;  4QMG A;  1G2S A;  2JA8 B;  3EA6 A;  1VQ8 A;  1I4Q A;  3FPU B;  1X32 A;  4G7Z C;  1BF4 A;  1K8G A;  2IX0 A;  1UEB A;  1DOM A;  2UUA L;  5FO7 B;  5T1G A;  5IT9 L;  4YHH L;  1UE1 A;  4CKC A;  2NVY H;  4P74 A;  3TSS A;  1KQS A;  2ICI A;  3PO2 G;  3TEH B;  1HUN A;  1CZG A;  1TS3 A;  2R7D A;  2YV5 A;  5KEE A;  1BCP B;  3A5Z B;  2A5H A;  1BBU A;  2A6E D;  5IP9 G;  1MBY A;  1KD1 C;  1B4O A;  4A93 G;  4B3S L;  4DAY B;  1GUO A;  3GTQ B;  1D1I A;  5EPK A;  1X54 A;  2X6L A;  1RCV D;  4IUT A;  1SYD A;  1TS5 A;  2AKW B;  2F3V A;  1X3F A;  2DJF C;  3VA5 A;  2WV6 D;  4Y52 H;  1QZG A;  1UE6 A;  4NXN L;  1KLU D;  5IT9 E;  1FNW A;  2L11 A;  1KLG D;  3K0X A;  2AUJ D;  3S9W A;  5CYU A;  1YNX A;  1JOO A;  5AFW A;  3GO5 A;  3KUP A;  4OON A;  1JOR A;  3J7A F;  1RIP A;  4A3J B;  1EU4 A;  1C9O A;  2ZTD A;  4RGT A;  3A74 A;  2EJF C;  2QEJ C;  1EY8 A;  4TVA B;  3J7Y W;  1Q3L A;  4EQ5 A;  1TVX A;  2WKD A;  1HRJ A;  1Z9F A;  2IY5 B;  1S5D D;  1U4P A;  3E9H A;  3C3L A;  1EOT A;  2L9H A;  1HNX Q;  3C46 A;  2NVX H;  2J7Z A;  3D4R A;  1J9O A;  5D65 A;  2UXB L;  1JOK A;  1GUT A;  3EFX D;  4IUQ A;  1EIH A;  1SR3 A;  2NWG A;  2JXM B;  1PFB A;  5IWA Q;  1Y1V B;  1EL0 A;  4FVM A;  3BG3 A;  3MZ5 A;  5J22 A;  1YBY A;  1DZ1 A;  5KGU A;  5KYI A;  1WCM H;  3QWN A;  2L1B A;  1Z47 A;  1PH1 A;  1FJG L;  4NKL A;  2FXQ A;  1YEZ A;  2XGT A;  3DWA A;  1KIX A;  4L5T A;  5C0X G;  4LUO A;  4XQQ A;  3PF4 A;  5EKL A;  1GO3 E;  5CGK A;  4JCV E;  1MI2 A;  1VMP A;  3KBX A;  5LHY 1;  1YHA A;  2NZ1 D;  1UE5 A;  1GJX A;  3I70 A;  4LNQ A;  4A3F G;  3TQY A;  2B63 H;  4GOP A;  1QVF A;  1SE4 A;  2FJ2 A;  2R92 H;  5K5P A;  3HKS A;  2PZW A;  2K32 A;  2EYP A;  3T53 B;  4UHV A;  2FFK B;  2EE1 A;  4HN7 A;  3K59 A;  1Y1W H;  3J80 c;  4ZQ3 A;  3FRP B;  3QB3 A;  3PV0 A;  3Q22 A;  5C3X A;  1JB3 A;  4B08 A;  1HQM C;  1ASY A;  2I5M X;  2IX1 A;  1B9N A;  2FMC A;  3UDI A;  4HJ8 A;  3H3V I;  2HIX A;  2GVA A;  2VQE L;  2DJG C;  1UAP A;  1JR0 D;  2WII B;  1V43 A;  4X3U A;  3WOE A;  2ASB A;  1Z7T A;  2D0O A;  2K14 A;  4I7A A;  3ONA B;  1PZI D;  4CKB A;  3S16 H;  5KYL A;  2F3I A;  4OIK A;  5JEA H;  3CCM A;  1FYC A;  2RF4 A;  1PRT D;  1WCM B;  2F0P A;  4G7O C;  1VF5 C;  1K8M A;  5C4J H;  1IBK Q;  1EOV A;  2XWB B;  4Y7N B;  1G91 A;  1W6J A;  5C5M A;  4LF7 L;  1SJE D;  3STB C;  2EOT A;  3BDC A;  1LUZ A;  4DU9 A;  1CQF A;  1KNE A;  3N52 A;  5JJK A;  2E8G A;  3E6Z X;  4JG2 A;  1Q12 A;  4UDU C;  4KY6 A;  3GV3 A;  2L55 A;  1PYW D;  4IUU A;  3MAQ A;  1H9J A;  2MFI A;  1QVG A;  1EIY B;  1NCV A;  3D8G A;  1M4V A;  5EPL A;  3I56 A;  2R92 B;  2L4N A;  1GUG A;  1K83 H;  5M5X H;  1I4X A;  2F0T A;  3PO2 B;  1STY A;  3LX0 A;  4C56 C;  3E9I A;  3HOZ H;  1SBB B;  1E3P A;  1XWE A;  1L2F A;  3UDX A;  2JA9 A;  1IYV A;  2F3W A;  2E2J H;  1PH8 A;  1VQK A;  1NAP A;  4OXP A;  1JB7 A;  1A2T A;  2QF7 A;  4GKJ L;  3FVQ A;  5I4D A;  1PTO D;  2P5Z X;  3U9S A;  1XPO A;  3HFZ B;  3AEV A;  1PFM A;  3KF6 B;  1PMR A;  1RHP A;  3BZK A;  3TRZ A;  1HZA A;  4RH6 A;  1G6P A;  1EWH A;  1X3E A;  5E3F A;  2OEO A;  3KBG A;  3RZO H;  5CV7 A;  2CWA A;  1KHI A;  4IO9 A;  4DR3 L;  4WJ4 A;  4B3M Q;  3K0Y A;  4QQB X;  3T51 B;  4LF5 Q;  3I3C A;  3S16 B;  3PO3 H;  2ATW A;  1B50 A;  3GD7 A;  2PQA A;  4TQU S;  1STA A;  2QCP X;  2B3G A;  4R4T A;  1BNZ A;  3OTO Q;  5C4J B;  4FP5 D;  3I7F A;  5C4X H;  4R4O A;  4DV2 L;  4A3I H;  2H1E A;  4L5R C;  2IHE A;  5M5Y H;  2V4D A;  4OO1 H;  3OIQ A;  2A6H D;  4DNI A;  2A68 D;  5IYC H;  1W6K A;  4AYB B;  3HOY G;  3NPP A;  4OIJ A;  4DK1 A;  5M9O A;  2F0O A;  4QIW E;  4RFB A;  2WIN B;  3PUY A;  4EVO A;  5C44 H;  1CK1 A;  4IJL A;  5CBA E;  1IXR A;  4BXX G;  1TY2 A;  1PHJ A;  1WTQ A;  1NMG A;  3EVQ A;  4RMF A;  3DEO A;  4A3B H;  1KRT A;  1X9N A;  1K83 B;  5M5X B;  2F0G A;  3ITP A;  3I4M G;  1LM0 A;  4PZ8 A;  2Y0S G;  1STB A;  3D3R A;  3HOZ B;  4A3G G;  1YZ6 A;  1W3S A;  3NEL A;  5E4X A;  4PNY A;  4BBR G;  2F0L A;  4BY7 H;  1F2Y A;  1TU2 B;  3HOU G;  4C3J H;  4IOA A;  3OYY A;  4F7X A;  1Y8O B;  1HZB A;  2F0Q A;  5EGT A;  3W3A A;  3AYH B;  1VQH A;  1O7Z A;  5E7N A;  4ZCK A;  2VXW A;  3NK9 A;  3MXN A;  2QDB A;  1HFN A;  3NBH B;  3G71 A;  4H02 A;  4J8Q A;  4B3T Q;  3RZO B;  1F9R A;  4GS3 A;  3VR6 A;  2DNC A;  3S1R H;  1SMY C;  1VCI A;  2D9U A;  2K50 A;  3PF5 A;  3PO3 B;  4PMW A;  5C3E H;  2A69 D;  3VYR A;  5HGQ A;  2ZJP A;  1PVO A;  2TMP A;  4MIU A;  4LK1 C;  5BN3 A;  1SDF A;  1B2T A;  2JEB I;  4ME5 A;  2R7Z H;  1IKL A;  3GDE A;  3JAM c;  4A3I B;  4POG A;  2JA7 G;  5M5Y B;  2WB1 E;  3X3M A;  2VY3 A;  4X65 L;  1CFM A;  3PUV A;  4QF4 A;  1SE3 A;  1XPU A;  3FKI B;  5KNB A;  5GQO A;  4DF7 A;  2OTL A;  1FNV A;  5C44 B;  3F8T A;  1KC8 C;  2CCZ A;  1CZW A;  5CBE E;  3UE1 A;  1FGB D;  4C1N K;  5IYB G;  3J80 E;  4R4Q A;  1A8V A;  1L0Y B;  3VYS A;  1BBX C;  1L1O C;  1SMY D;  1XMO L;  4OEM B;  1TR5 A;  4V19 0;  4JI5 L;  1WVL A;  2JA6 G;  1K8A C;  3NWS A;  4A3C G;  2EYH A;  4ZUI A;  4BY7 B;  1A0I A;  1OO9 B;  3AU7 A;  4JI1 L;  4C3J B;  1VQN A;  1HZ9 A;  4JBM A;  4HMI A; 
#chains in the Genus database with same CATH homology
 4UP8 A;  2RHS B;  4A3F H;  4IPH A;  2UXB Q;  1X65 A;  3I2Z A;  3KJO A;  5FLM H;  1C7Y A;  2E2H H;  1OTC A;  4DV6 Q;  4GOP B;  4L5S A;  3HOW G;  3AFP A;  4DV1 Q;  4YWK A;  5LMN Q;  5JJL A;  1I5F A;  5AJ3 L;  5M5W H;  1Q82 C;  2WAQ G;  3TRE A;  4DV6 L;  4MNO A;  1JJ2 A;  3I4O A;  4X62 Q;  4DV1 L;  4B3M L;  1Q81 C;  5LMN L;  4DUZ Q;  3CCJ A;  4LF5 L;  4BBS H;  1PYB A;  1MIU A;  3K7A H;  3PCO B;  4DR4 Q;  4JI2 Q;  4X62 L;  1R9T H;  4DV3 Q;  4DUZ L;  4DR7 Q;  2BH8 A;  3HOZ G;  2WFW A;  4WJ3 M;  3OTO L;  2HHH Q;  1OXX K;  2Q2T A;  4DR4 L;  4JI2 L;  2K52 A;  3GTQ H;  1C0A A;  1XJV A;  4AQY Q;  4DV3 L;  2VNU D;  3M4Q A;  1XTD A;  1JJC B;  4YCU A;  5GAH C;  1GVP A;  1YHB A;  1CUK A;  1K73 C;  4IJH A;  2JA5 H;  4HJA A;  1JMC A;  4UP9 A;  2PMZ E;  3F2C A;  4AQY L;  1PH9 A;  4JI6 Q;  3FKI H;  3K81 C;  4O2D A;  3D31 A;  1PV4 A;  1CKN B;  1IYJ B;  3GTM H;  1EUJ A;  1G51 A;  3RLN A;  4JI6 L;  3MEF A;  4LWC A;  2K5H A;  3F2D A;  1BVS A;  2YTY A;  2VUM G;  1N33 Q;  3M4P A;  4X64 Q;  2A19 A;  3W5O A;  4JOI A;  3KLW A;  1EQR A;  1L1O A;  1VQO A;  1XNQ L;  3T1H Q;  4A3J H;  2OWO A;  2KHJ A;  1N33 L;  1PFS A;  1QUQ B;  4BY1 H;  2Z6K C;  4A3E G;  4DK3 C;  3MXN B;  2OQ0 A;  2QEX A;  3TS2 A;  1YJ9 A;  1HJP A;  3T1H L;  5H1S E;  4JI7 Q;  1GKH A;  4P75 A;  3OW2 A;  2LSS A;  3PO3 G;  4LFA Q;  4KHZ A;  4DAM A;  4YY3 L;  1EIF A;  3CCE A;  3M9B A;  3RLF A;  4K0K L;  1HH2 P;  2N3S A;  3NEM A;  3I4N H;  4BBS G;  2K5V A;  1H95 A;  3B6Y A;  4C3H H;  4OWW B;  1VQ8 A;  3EBE A;  3CD6 A;  4XIG S;  4IPC A;  3GTP H;  4YHH Q;  2I5L X;  2Q2I A;  2IX0 A;  4A3I G;  1UEB A;  1Q7Y C;  1K8G A;  2UUA L;  2WAQ E;  4LUV A;  1VQC A;  5IY0 A;  4OO1 G;  1MJE A;  4UPA A;  1E1T A;  1B8A A;  2AWO A;  4YHH L;  4HIM A;  4P71 A;  1UE1 A;  2EIF A;  2YYZ A;  3ERS X;  1E1O A;  5IYC G;  2A8V A;  2NVY H;  4P74 A;  4A3L G;  3FKI G;  5FJ8 G;  4GLX A;  1Q86 C;  2VQE Q;  2RHQ B;  5JJI A;  1WOC A;  1KQS A;  5C44 G;  3PO2 G;  2HQL A;  1K0R A;  4B3T L;  4LFC L;  3PUW A;  3TEH B;  3DLL A;  4DV7 Q;  1PH7 A;  2OTJ A;  4LF8 L;  5EAY A;  3KOJ A;  2NZO A;  2JQO A;  1B70 B;  2R7D A;  2YV5 A;  5J3B A;  4C3I H;  3GTJ H;  4DV7 L;  4GKK L;  5BR8 L;  4P73 A;  3J81 j;  1VS0 A;  1TWF H;  2NVT H;  3A5Z B;  1VQG A;  1XMQ L;  3CC4 A;  3F1Z A;  2YU9 H;  4JBJ A;  1BBU A;  4QY7 A;  1Y14 B;  5IP9 G;  1KD1 C;  4A93 G;  2UXC L;  4R1J A;  3S24 A;  2IT1 A;  1TXY A;  2NN6 G;  4B3S L;  4DAY B;  1VQ6 A;  3E0E A;  4FDB A;  3S17 H;  3RNU A;  3GTO H;  3HOX H;  1SLJ A;  1X54 A;  3G4S A;  3L0O A;  4BY7 G;  3CAM A;  2AKW B;  2F4V Q;  4KHP L;  5GRO A;  4GN5 A;  1X3F A;  1S40 A;  3ULP A;  1P16 A;  1WI5 A;  2LXK A;  4NXM L;  1S3O A;  4EX5 A;  1K3R A;  1E22 A;  4Y52 H;  1QZG A;  1UE6 A;  4NXN L;  2ZJQ A;  1IBL Q;  4YWL A;  4PZ7 A;  3PSI A;  2VQF L;  1KL9 A;  4JI3 L;  4JYA Q;  3K0X A;  1EWI A;  1V9P A;  4ALP A;  1YNX A;  1G29 1;  2D62 A;  3GO5 A;  4OON A;  2LXJ A;  4DR5 Q;  1RIP A;  4LF9 Q;  3RN5 A;  3KF8 B;  1GD7 A;  1HNW Q;  4DV4 Q;  1C9O A;  2ZTD A;  3A74 A;  4IPG A;  3PIP A;  5DLQ E;  1YI2 A;  4LF9 L;  4TVA B;  1VQI A;  1PH4 A;  4EQ5 A;  1YIJ A;  4X66 L;  1OXS C;  4DPG A;  5LMU Q;  4DV0 Q;  1I6H H;  2JK8 A;  1VQD A;  4JI0 Q;  1HNZ Q;  1Z9F A;  2CQO A;  4QL5 A;  5C3E G;  2IY5 B;  2UUB L;  3E9H A;  4DV0 L;  2JJQ A;  4AYB G;  1HNZ L;  3T1Y Q;  1AE2 A;  1HNX Q;  3CCL A;  1W2B A;  4C2M H;  2R7Z G;  4LUZ A;  3JAM i;  2NVX H;  3CQZ H;  1P8L A;  1V1Q A;  3GTK H;  3HKZ G;  1HNX L;  4GKJ Q;  3HOY H;  4IFD I;  2MQH A;  2NN6 I;  4R4C A;  3NEN A;  1Q46 A;  2UXB L;  4PG3 A;  4LFB Q;  3STB D;  1SR3 A;  2C35 B;  2KCT A;  5ELN A;  1I94 Q;  3M3Y H;  5IYD G;  1UE7 A;  1HR0 W;  4BXX H;  3CXC A;  4YCV A;  1J6Q A;  2UUC Q;  5IWA Q;  3I55 A;  5M3M G;  4R4I A;  2N8N A;  1L1O B;  4IFD J;  1U5K A;  3HOV G;  2H5X A;  3CPF A;  1YBY A;  2UUC L;  1FJG Q;  3LGJ A;  4GNX C;  4HIO A;  4DR3 Q;  4DR7 L;  1N32 Q;  3I4M H;  1X6O A;  4NB3 A;  1WCM H;  3U4V A;  4QGU A;  3RN2 A;  1Z47 A;  1PH1 A;  3KJP A;  1TWH H;  2HHH L;  1FJG L;  5ELO A;  2FXQ A;  1YEZ A;  2EQS A;  3KDF A;  4UP7 A;  4A3G H;  2XGT A;  1N32 L;  2JA8 G;  3RZD H;  1CSP A;  1KIX A;  4L5T A;  5C0X G;  2GVB A;  4JI8 Q;  1YJW A;  3CC2 A;  4LUO A;  3HOU H;  3PF4 A;  4GLA C;  1GO3 E;  4JCV E;  3S1Q H;  2D0P A;  4JI8 L;  3W1B A;  2ES2 A;  2I0Q A;  1EFW A;  3KF6 A;  1OXT A;  2KHI A;  1YHA A;  4DV5 Q;  1X55 A;  2QGQ A;  3H0G H;  4X64 L;  1UE5 A;  4A3M H;  1IBM Q;  3UE0 A;  4LNQ A;  4A3F G;  2E5L Q;  1IZ6 A;  4BA1 I;  5FLM G;  2BH2 A;  3EIV A;  3TQY A;  3CC7 A;  2B63 H;  4GOP A;  1QVF A;  3PGZ A;  2R6G A;  1VQ9 A;  2KCM A;  2R92 H;  4AIM A;  2E5L L;  3HKS A;  1SN8 A;  3CME A;  4JI7 L;  2WP8 J;  3RLO A;  2XTI A;  4DR2 Q;  2F52 A;  4AYB E;  3BZC A;  2ZTE A;  1Y1W H;  4LFA L;  2CWP A;  3J80 c;  1KAW A;  2WB1 G;  4JBW A;  4HJ5 A;  4DR2 L;  1HZC A;  3ZJY C;  4HJ7 A;  3CW2 C;  1YIT A;  3PV0 A;  1MJC A;  4A4I A;  1FVI A;  2GN5 A;  1LTL A;  1N36 Q;  4L5Q A;  1YHQ A;  1ASY A;  2I5M X;  4GN4 B;  2VZA A;  3J81 c;  2ZM6 Q;  1VQB A;  2JA5 G;  2IX1 A;  3F2B A;  1Q8K A;  3UDF A;  2JA7 H;  1D8L A;  3FHW A;  3UDI A;  3W1G A;  4HJ8 A;  1N8R C;  3S1N H;  1PYS B;  3L7Z C;  3H3V I;  4GNX A;  1VQ5 A;  3CCQ A;  2CFM A;  4A3K H;  1VQM A;  2JE6 I;  1BKB A;  1Y1V H;  3IRB A;  1CSQ A;  2HIX A;  1M90 C;  1K9M C;  1DGS A;  1Q1E A;  2GVA A;  2VQE L;  1AH9 A;  5C0X I;  4LW1 A;  1QVC A;  3M85 A;  1WFQ A;  1V43 A;  3AFQ A;  2ASB A;  4A3J G;  2AWN A;  2D0O A;  1SFO H;  2K14 A;  4BY1 G;  2R93 H;  5IYB H;  3S16 H;  1E7Z A;  4A3D H;  4IFD G;  2F3I A;  5C0X J;  1SRO A;  3CCM A;  2RCN A;  2NVQ H;  1EQQ A;  2RF4 A;  4LF7 Q;  1AE3 A;  5C4J H;  1IBK Q;  1EOV A;  5M3F H;  3K8A A;  4LF6 Q;  2ALY B;  4LF7 L;  3I4N G;  3KYH C;  3STB C;  1Y1W G;  3G48 A;  1YJN A;  2JA6 H;  1LUZ A;  1KRS A;  2NZH A;  1O7I A;  4A3C H;  2F4V L;  3J7A 5;  5JJK A;  3VDY A;  4RG1 A;  2E8G A;  1VQF A;  2KEN A;  4JG2 A;  2L15 A;  4AH6 A;  2UU9 Q;  1IBL L;  1Q12 A;  1T9H A;  4JYA L;  1YVC A;  3D0F A;  1U0L A;  4X65 Q;  3HOW H;  2MFI A;  2Z0S A;  3UDG A;  1QVG A;  1JJG A;  2K4K A;  4A75 A;  4DR5 L;  1EIY B;  1HNW L;  4JV5 Q;  2PI2 E;  2K5N A;  2VS1 A;  4DV4 L;  1VQ7 A;  4HIK A;  3I56 A;  1N34 Q;  1X56 A;  1XNR Q;  4JI4 Q;  3KFU A;  1K83 H;  5M5X H;  4JV5 L;  4B3R Q;  2VL6 A;  1L0W A;  4OX9 Q;  3ULL A;  3M4O H;  1N34 L;  4LF4 Q;  5LMU L;  4GOP C;  3E9I A;  3U50 C;  5GAG C;  3HOZ H;  3BJU A;  5HY6 A;  4JI0 L;  4B3R L;  1E3P A;  1WJJ A;  1L2F A;  2VW9 A;  2HT1 A;  4GN3 B;  3UDX A;  4A76 A;  2PI2 A;  2JA9 A;  3JC6 6;  4APV A;  3T1Y L;  2E2J H;  1PH8 A;  1VQK A;  3KDF B;  4YCW A;  3HOX G;  4JI5 Q;  4OXP A;  4BA2 I;  1JB7 A;  3S2D H;  3S1M H;  4GKJ L;  1TWC H;  4QJF A;  4JI1 Q;  3M7N A;  2VUM H;  4XTC S;  4DR1 Q;  4LFB L;  1XPO A;  3HFZ B;  1NMF A;  1I94 L;  3AEV A;  3KF6 B;  3TRZ A;  3BZK A;  1ASZ A;  1HZA A;  4OWX B;  2ZJR A;  1G6P A;  1X3E A;  2N78 A;  5IWA L;  3GTL H;  3A0J A;  4A3E H;  1PA6 A;  3RZO H;  1E24 A;  2E2I H;  3PUX A;  1FGU A;  5AJ3 Q;  2CWA A;  2EXD A;  2PNH A;  1M1K C;  1KHI A;  1D7Q A;  1KXL A;  4IO9 A;  4Y7N H;  3L2P A;  4DR3 L;  2JEA I;  4WJ4 A;  4B3M Q;  4QQB X;  3S15 H;  3CCU A;  4LF5 Q;  1TWA H;  4DR6 Q;  3PO3 H;  4BBR H;  2ATW A;  1GM5 A;  4DK6 C;  3GD7 A;  2PQA A;  4TQU S;  1VQE A;  5IP7 H;  5FLX c;  1S72 A;  2B3G A;  1PH6 A;  4R4T A;  1PH3 A;  4DV2 Q;  4DR6 L;  2KBN A;  3OTO Q;  2V1C C;  4NPS A;  4YWM A;  1NY4 A;  3I7F A;  5C4X H;  4R4O A;  4DV2 L;  4A3I H;  2R7F A;  2I5H A;  4L5R C;  2IHE A;  5M5Y H;  4DV5 L;  1VQP A;  1B7Y B;  4DKA C;  1XPR A;  5K36 G;  1A63 A;  1VQL A;  4DNI A;  4P72 A;  3FP9 A;  2N49 A;  3DM3 A;  5IYC H;  1IBM L;  3HOY G;  1UWV A;  4A3L H;  1OXU A;  5FJ8 H;  2B29 A;  2OCE A;  5IT9 c;  4GNX B;  2MNA A;  2ID0 A;  2YTV A;  4QIW E;  3PUY A;  1X3G A;  5C44 H;  3PO2 H;  1VQ4 A;  1JT8 A;  2IHF A;  4IJL A;  3BU2 A;  1IXR A;  1XNQ Q;  4BXX G;  3S14 H;  1PHJ A;  1EYG A;  1NMG A;  4RMF A;  3J7Z C;  2DUD A;  3HKZ E;  4A3B H;  1KRT A;  1X9N A;  2K75 A;  3CCS A;  5JEA J;  1PH5 A;  3I4M G;  1LM0 A;  5IP9 H;  1WCM G;  4A93 H;  4PZ8 A;  1NBW A;  2Y0S G;  1MKH A;  4YY3 Q;  3CF5 A;  4A3G G;  1YZ6 A;  1W3S A;  3NEL A;  2DGY A;  1BBW A;  1I3Q H;  2ZM6 L;  1N36 L;  4K0K Q;  3U4Z A;  1CKN A;  2MO1 A;  3U58 A;  4BBR G;  4BY7 H;  5IP7 G;  4POF A;  1Q1B A;  4C3J H;  1WYD A;  3HOU G;  4IOA A;  2UXD Q;  1VQJ A;  2YTX A;  3OYY A;  2UUA Q;  3CP0 A;  1HZB A;  2A1A A;  4OWT B;  1CKO A;  2UXD L;  5C4X G;  4JC0 A;  3AYH B;  3RR5 A;  3H0G G;  5LMN W;  1QUQ A;  1VQH A;  5E7N A;  4A3M G;  3K80 C;  3CCR A;  2CKZ B;  1HR0 Q;  3S2H H;  3NBH B;  3G6E A;  4ME3 A;  5GAE C;  4IOC A;  2B63 G;  1NJI C;  4MZ9 A;  1VQA A;  3G71 A;  4X6A H;  2Q2U A;  2R92 G;  1TWG H;  4H02 A;  4B3T Q;  1HR0 L;  4LFC Q;  4LF8 Q;  4GS3 A;  3ULJ A;  5IE8 A;  3H15 A;  3S1R H;  5GAD C;  1VCI A;  2MO0 A;  4GKK Q;  4DUY Q;  4HID A;  5BR8 Q;  1J5E Q;  2K50 A;  3PF5 A;  1NTG A;  3J80 i;  4KLK A;  3CMA A;  1IBK L;  1XMQ Q;  1NE3 A;  4PMW A;  5C3E H;  4LF6 L;  3GTG H;  3PUZ A;  4DUY L;  5HGQ A;  2ZJP A;  1J5E L;  1SE8 A;  4A3B G;  2UXC Q;  3ER0 A;  1PVO A;  4B3S Q;  3K7U C;  2JEB I;  3J81 i;  3TS0 A;  2R7Z H;  3GDE A;  3JAM c;  4HJ9 A;  4POG A;  2UU9 L;  3AQQ A;  2JA7 G;  1CKM A;  2HIV A;  1SMX A;  4KHP Q;  2WB1 E;  4PZ6 A;  4J15 A;  3Q8D A;  2Z6K A;  3SGI A;  4A3K G;  2AMC B;  2VY3 A;  4NXM Q;  1QZH A;  1SRU A;  4X65 L;  1Y1V G;  3PUV A;  4NXN Q;  1XPU A;  2VQF Q;  4JI3 Q;  5IYD H;  5GQO A;  2Q2H A;  2Y0S E;  2OTL A;  1JE5 A;  3ICE A;  2ZTC A;  1XNR L;  5M3M H;  4JI4 L;  1A62 A;  3F8T A;  1KC8 C;  3HOV H;  2CCZ A;  4OX9 L;  3UE1 A;  4LF4 L;  2BA1 A;  2R93 G;  2BA0 A;  3EN2 A;  5IYB G;  4A3D G;  4KI0 A;  4IPD A;  4R4Q A;  1FL0 A;  5JEA G;  3CCV A;  4JBK A;  1XMO Q;  3H3V H;  1A8V A;  4OO1 I;  2QA4 A;  1RL2 A;  4X66 Q;  4JOI C;  2JA8 H;  2AHO B;  1L1O C;  3WWV A;  4UY8 C;  1LYL A;  5M3F G;  1XMO L;  1IL2 A;  2OQK A;  1PH2 A;  2UUB Q;  3PIO A;  1I50 H;  2PQA B;  4JI5 L;  2JA6 G;  1K8A C;  1OXV A;  3CPW A;  4A3C G;  4GLV B;  1A0I A;  4JI1 L;  3A5U A;  4O0A A;  1VQN A;  4MTN A;  1HZ9 A;  4DR1 L;  4JBM A;  1N9W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...