4DUZL

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u13c, bound with streptomycin
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
124
structure length
123
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 13
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4duzL00
1ASZA 2R93H 1IL2A 2NVXH 2Y0SE 4DUYL 3FHWA 4R4IA 5HGQA 3RNUA 4DV1Q 1YJWA 3T1YL 4BBSH 4DV4L 4A3LH 2JA7G 4BA2I 3M4QA 4IO9A 5IP7G 1EYGA 2UU9L 4OXPA 4B3RQ 3W5OA 3ULPA 3S17H 1HNXQ 1QUQB 1VQIA 1YHBA 4HJAA 5C0XG 1NBWA 2I0QA 1UEBA 2HIXA 4YCWA 2ASBA 5M5YH 2IX1A 4Y52H 2KHJA 2A19A 2NN6I 3KDFB 3LGJA 4DV6L 4DNIA 3E9HA 3MEFA 1OTCA 2K50A 3J80c 1X65A 1WI5A 1Q82C 5LMNW 1M90C 3K8AA 5IYBG 4UY8C 4JV5Q 3S15H 3FP9A 4DAMA 1VQNA 2OQ0A 1QVFA 1X56A 4B3MQ 4DR7Q 1JJ2A 1G51A 4KHPL 3AFQA 1OXUA 2NVYH 4JI7Q 1Y1WH 4TQUS 4A3EG 1BBUA 4LF6L 2GN5A 3CW2C 4BXXH 4O0AA 1K83H 3M9BA 1L1OB 1YI2A 3G4SA 1XJVA 4NPSA 5GADC 2R7ZH 1HNZQ 2FXQA 3GDEA 3W1GA 4IOCA 4A76A 4GS3A 4X66Q 2JEBI 1B70B 1TXYA 5C44G 2MQHA 2BH8A 2JA9A 2WB1E 5LMNQ 4BY1H 4GKKQ 4QJFA 4DKAC 2QA4A 4DR5Q 4DV0Q 3CCMA 1S40A 3HOVH 2MO0A 3A0JA 2K5NA 3RN5A 2VQFL 3CCEA 4KI0A 2VQEL 4ALPA 5J3BA 4TVAB 1KAWA 3TS0A 1YZ6A 4JOIC 2E2HH 1V1QA 3GTKH 4LUOA 5C4JH 1NTGA 1VQDA 1UWVA 1D8LA 1KRTA 1N32L 2PI2E 3PSIA 1N36L 1G6PA 1A63A 1WJJA 2KHIA 1I50H 4A93G 4DR6L 1EQQA 2YU9H 3K7AH 4IJLA 3OTOL 1A8VA 2UUBQ 4L5RC 4POGA 1N34Q 4DV5L 1TWGH 4MNOA 2VUMG 4WJ3M 3I56A 1UE5A 1Q86C 2OWOA 5BR8Q 1A0IA 1FVIA 4JI1L 1PH4A 3M4PA 1VQJA 3H3VI 5GQOA 4QGUA 4YWKA 3U4ZA 3HOZH 2ZTCA 2DUDA 3I4MG 1SE8A 4O2DA 3K7UC 3WWVA 1PH1A 3PF5A 1HNWQ 3AQQA 4FDBA 4X62L 3K81C 4JI0L 2AWOA 1Q81C 2Z6KC 1Y1VH 1N8RC 2VW9A 2B3GA 4XTCS 5IY0A 4LFCL 4DK6C 5AJ3L 4HIOA 2ZM6L 5FJ8H 1OXSC 4R4CA 2QEXA 2N8NA 4LNQA 4BY7H 1AE2A 4K0KL 3BJUA 3KDFA 3S14H 3PUZA 1SROA 1SFOH 2R93G 4LFAL 2GVBA 4YCVA 1LTLA 1WFQA 3I55A 1EOVA 4BY1G 1QUQA 1YHAA 1PYBA 1Z47A 2CQOA 3HKSA 3AFPA 4JCVE 3GTJH 2Q2UA 4JYAQ 3A5UA 4GLAC 4A3DG 1I6HH 3S2DH 4A3MH 1OXVA 1PH5A 5IWAL 1VQGA 5LMUQ 3PF4A 4GNXC 2VZAA 4P71A 4X64Q 4JV5L 1IBMQ 3ULLA 3H3VH 1U0LA 1KXLA 3H0GH 3K0XA 4JI4Q 2UXBQ 4EX5A 3GD7A 4LF5L 5C0XJ 2UXDL 1YNXA 2CKZB 1X3FA 4JI7L 2VUMH 4OWTB 1T9HA 2BA1A 1BVSA 5M5WH 1XNQL 1WYDA 2YV5A 2K4KA 1OXTA 5M3MH 1TWCH 3PV0A 5IYCG 1KIXA 1HZ9A 3S2HH 4A3MG 4A3DH 3CCJA 1E1TA 4KLKA 4IFDG 1TWFH 2Y0SG 4HJ5A 1PH3A 3E0EA 1HZAA 3KJOA 3CCVA 2RF4A 1VQBA 4H02A 4DV0L 2ZJQA 3RLFA 1VQ6A 5C3EH 1YVCA 3AYHB 5IP7H 1PFSA 3CCLA 3S1QH 1GM5A 3PO2G 1HH2P 3PUVA 4DPGA 2K75A 1Q1EA 1N32Q 4A3CG 1E7ZA 5K36G 4DV2L 1KQSA 4GKJQ 1HZBA 1IXRA 3Q8DA 1J5EL 3L0OA 3CXCA 2F4VQ 3OW2A 4HJ9A 3VDYA 2JA5G 3OTOQ 1NJIC 1X9NA 4DV5Q 3RZOH 3G71A 1YJNA 3MXNB 4DV7Q 2R7FA 4X65Q 1Y1WG 2NVTH 3GTPH 4HIMA 4C3HH 2NZOA 4A75A 1X3EA 4GOPA 1UE6A 2ZJPA 2XGTA 4J15A 2B63G 1E3PA 1FGUA 3L7ZC 3I4NG 2ALYB 1FJGL 2Q2TA 5IP9H 4GOPC 2K5HA 4NXMQ 3PGZA 4B3SQ 3S1MH 2WP8J 1IBLQ 2N49A 1MJEA 3FKIG 4IFDI 5ELOA 1VQFA 4DR4Q 2E2JH 4OWXB 1W2BA 3KJPA 1I94Q 1VQ8A 5IT9c 4L5TA 5AJ3Q 1QZHA 1WCMG 1RL2A 2JK8A 3M3YH 2R92H 2UXCL 3CD6A 2YTVA 1N33Q 4A3BH 4K0KQ 2OQKA 4DR3L 4YHHQ 1PHJA 4Y7NH 1K8GA 2HT1A 4LFAQ 3J80i 4POFA 2F3IA 3JC66 4A3LG 3CCUA 3I4NH 3U4VA 3TRZA 1S72A 4DV1L 4A3JH 3KYHC 4NXNL 5C0XI 3CC2A 5JJKA 1KD1C 5IWAQ 1NY4A 3T1HQ 2YTYA 1X55A 2NN6G 4IPDA 3S16H 4OO1I 1EWIA 3CF5A 2NVQH 2I5MX 4B3RL 4YCUA 1PH9A 1XNRQ 2PMZE 4DR1Q 4JI4L 2UXBL 1QVCA 4JI3L 5GAGC 3PIOA 4A3EH 1PH7A 1Z9FA 3RLOA 1Q12A 4OX9Q 3F2DA 2BH2A 2VNUD 1E22A 3J81j 4JBJA 1HR0W 2RHQB 3CCSA 1VQHA 3PO3H 3KF6B 1VQEA 4PG3A 2CWAA 4AYBE 4LF9Q 3A74A 5C3EG 2VL6A 2EIFA 1OXXK 1XNQQ 3TREA 2PI2A 4GN4B 3HOXG 1VQCA 4DV3L 2OTLA 1Q8KA 4JBMA 2Q2HA 3K80C 4IJHA 1DGSA 2BA0A 4EQ5A 4DR7L 3PUWA 4UPAA 2JA6H 4KHPQ 3F2BA 4IFDJ 4JI2Q 1S3OA 5M5XH 3U50C 5M3FH 1I3QH 4MTNA 1XTDA 1B7YB 1HJPA 4R4OA 2N78A 4LF8Q 3B6YA 3NBHB 5C4XH 3H15A 3RR5A 1AH9A 2C35B 2MNAA 1BBWA 2HQLA 4PZ8A 2UUCQ 3I2ZA 1CKNA 3BZKA 3L2PA 4DAYB 2B63H 3UDXA 3CCQA 2OTJA 1QVGA 3TEHB 4A3GG 3OYYA 4GKJL 5FLXc 3NEMA 4HJ7A 4AIMA 4DR5L 4AH6A 3CCRA 4LF4L 2VQFQ 5JJLA 2VQEQ 4P73A 2KCTA 4KHZA 4P72A 4DV7L 4HIKA 5IE8A 4JI5Q 3KFUA 5IYDH 2A8VA 4BA1I 3KLWA 4GN5A 3UDFA 2QGQA 2B29A 1N36Q 4LWCA 2E8GA 4MZ9A 1FJGQ 2VY3A 4LW1A 2V1CC 1PYSB 4L5QA 2PQAB 2ES2A 1C9OA 1XMQL 4GKKL 1TWAH 2Z0SA 2D62A 5JEAJ 1I94L 2UUAQ 1KHIA 4P74A 1JE5A 3E9IA 4DK3C 2KCMA 4PMWA 2WAQG 1FL0A 1SN8A 4GNXA 1RIPA 4A3IG 5E7NA 1KC8C 2E5LQ 3W1BA 2UU9Q 4DR3Q 1D7QA 1L1OC 3KF6A 4YHHL 1Q7YC 1N9WA 2F52A 3ERSX 3KF8B 2WAQE 1GD7A 4C3IH 2YYZA 1NMFA 2K52A 1Q46A 3J7A5 1VS0A 4X62Q 3PO3G 2XTIA 3HOWH 1JB7A 1HZCA 3I7FA 1JT8A 2MO1A 1MIUA 1H95A 2LXKA 4HIDA 1X6OA 3S1RH 2ZM6Q 1XPRA 4QIWE 1HR0L 3HOYH 3HOWG 2D0PA 2JA5H 1PH2A 1C7YA 3HFZB 2DGYA 3BU2A 4DR1L 4JI3Q 5FLMG 4OX9L 5H1SE 4JBKA 1E1OA 3J7ZC 1EUJA 1AE3A 2Q2IA 1VQKA 3ICEA 3CMAA 2ZTEA 1G291 4UP8A 2H5XA 2CWPA 4PZ6A 2PNHA 1QZGA 2K14A 2E2IH 1V43A 1CKMA 4JBWA 4ME3A 4GNXB 1PV4A 1VQ7A 1UE1A 1K0RA 4RG1A 4LF9L 1E24A 1CSPA 3HOUG 4A3KH 2JA8H 4A3BG 1GVPA 2N3SA 2JA8G 4DV3Q 1R9TH 3HOVG 4BY7G 2D0OA 3F8TA 5FJ8G 5GROA 3CAMA 3PIPA 4LF5Q 1UE7A 2PQAA 4LFBQ 4GLVB 2UXDQ 1KL9A 1VQPA 4X66L 1YEZA 1CUKA 1IZ6A 2K5VA 3RN2A 1XPUA 4JI2L 1V9PA 4DUZQ 3FKIH 3M7NA 2AMCB 1VQOA 5M3MG 5IYCH 5LMNL 1WOCA 4IOAA 1MJCA 1X54A 5DLQE 5FLMH 4B3TL 1XMOL 3RLNA 4A3FG 1HR0Q 4LUZA 4GOPB 4R4TA 3HOZG 3TQYA 4JI8Q 3CC7A 3U58A 3GTMH 1X3GA 3F2CA 2WB1G 2HHHL 5HY6A 1B8AA 4QL5A 3DLLA 1PH8A 1LM0A 1JMCA 3CP0A 1YBYA 4YWMA 3ZJYC 1GO3E 1K9MC 3H0GG 2I5HA 3I4OA 4IPHA 5ELNA 1P16A 1SMXA 1Q1BA 4DR6Q 2GVAA 4A3FH 5JJIA 4C3JH 1CKNB 4LF4Q 4LF7L 3UDGA 2OCEA 2LSSA 3CC4A 4JI6Q 4JI5L 4HJ8A 1GKHA 1W3SA 1NMGA 4JI1Q 3G6EA 1NE3A 4APVA 1U5KA 1LUZA 4DV2Q 1CKOA 2LXJA 3EIVA 2CCZA 4QY7A 2JEAI 3TS2A 2EQSA 3HOXH 1HNWL 1SRUA 3STBC 4AQYL 5C44H 4JI0Q 2MFIA 2UUAL 3A5ZB 2KBNA 3EBEA 4UP7A 1Y1VG 4YY3L 3JAMi 1IBKQ 4LFCQ 3UE0A 5IYDG 2E5LL 4DR2Q 3UDIA 2IHEA 1IBLL 1SR3A 3J81i 3J81c 3HOYG 4DR4L 4JYAL 4DUYQ 3GTQH 3BZCA 4WJ4A 1TWHH 4YWLA 3T1YQ 4DV4Q 3HKZG 3S24A 5LMUL 3S1NH 2EXDA 3HKZE 3JAMc 4X64L 1K3RA 3AEVA 1IBML 4A93H 1P8LA 2A1AA 5C4XG 2L15A 1HNXL 4PZ7A 2YTXA 5IYBH 3IRBA 3PUXA 4A3IH 4LF6Q 3NELA 2R92G 1L2FA 2AWNA 1YITA 1WCMH 4DV6Q 4NXNQ 1KRSA 1J6QA 1VCIA 2JA6G 2JQOA 2CFMA 3T1HL 1Y14B 3D31A 3RZDH 1VQMA 3HOUH 4IPCA 3UE1A 1XNRL 1MKHA 2VS1A 4B3ML 4R1JA 4LFBL 5IP9G 1XPOA 4P75A 4L5SA 2R6GA 3G48A 3D0FA 3M85A 4DUZL 4RMFA 1PH6A 1VQ5A 3PCOB 2R7ZG 3CQZH 4GLXA 4OWWB 3CMEA 4B3TQ 3I4MH 1IYJB 1O7IA 1XMOQ 2KENA 1VQAA 4A3KG 2I5LX 4BXXG 1VQ4A 4JI8L 1HNZL 3GTGH 1VQ9A 3GTOH 5JEAG 4A3GH 1EIFA 2IX0A 2HHHQ 5GAHC 2HIVA 1YJ9A 5GAEC 2IY5B 1SLJA 2Z6KA 4A3JG 2IT1A 1EIYB 4A3CH 2R7DA 1M1KC 4C2MH 2IHFA 3PO2H 4JG2A 1EQRA 2RHSB 1L0WA 3ER0A 1J5EQ 4NB3A 3STBD 2F4VL 1CSQA 2ZTDA 4LF8L 4LF7Q 4BBRH 5M3FG 1BKBA 5EAYA 3PUYA 4JI6L 1C0AA 3GTLH 2JJQA 4X65L 2UUCL 3F1ZA 2NZHA 4OO1G 1JJCB 3GO5A 4OONA 3SGIA 4GN3B 4R4QA 3ULJA 1ASYA 4QQBX 2RCNA 3EN2A 4NXML 3CPFA 4XIGS 2AHOB 4BBRG 4A4IA 4B3SL 2ZJRA 1A62A 2WFWA 4X6AH 2UUBL 1I5FA 4IPGA 1YIJA 4AQYQ 1PA6A 1N34L 2AKWB 2JA7H 2ID0A 1EFWA 2ATWA 4BBSG 1PVOA 1LYLA 5BR8L 3M4OH 1IBKL 3NENA 1K73C 3KOJA 4YY3Q 3CPWA 1L1OA 4JOIA 1YHQA 2JE6I 4AYBG 3DM3A 1K8AC 4DR2L 1VQLA 1N33L 2UXCQ 1JJGA 4JC0A 4LUVA 4UP9A 1XMQQ
chains in the Genus database with same CATH superfamily
1E2VA 4N8X1 4R4IA 4DV1Q 4BBSH 4DV4L 4EGVA 4HSPA 1TS2A 3IKJA 5IP7G 1EYGA 1W6JA 2IX3A 2HCCA 2XNAC 3ULPA 3ND9A 5EKKA 2VB2X 1VQIA 5M5YB 1NBWA 5T1IA 1UEBA 2HIXA 2Z9HA 3M7GA 4OO1H 3NE5B 2A19A 3TP5A 3F2UA 1OTCA 2L55A 3MXUA 4IUPA 2K50A 1X65A 5EPLA 5LMNW 4C3HB 1M90C 5E1FA 2KHSA 1VQNA 1SEBD 1NNXA 3J81L 1BBXC 1X56A 3FPUB 4GZYC 1DOKA 1OXUA 3GTMB 1Y1WH 1ET6A 1BBUA 2F0MA 3SVMA 3M9BA 3G4SA 5ELBA 1EY6A 1WTWA 2A6HC 1HNZQ 4GS3A 4X66Q 2EPBA 2JEBI 4IQZA 1EY7A 1PFNA 2MQHA 2JA9A 2WB1E 4DKAC 4DR5Q 2R93H 2MO0A 1HR0L 2K5NA 4KI0A 4ALPA 2E2HB 5J3BA 5C5LA 1YZ6A 4CKEA 5C4JH 1N36L 1A63A 1WJJA 3VR5A 2QW7A 1YNJC 2UUBQ 1BCPB 2Z8LA 2VUMG 5M5WB 2X69A 2OWOA 4WJ3M 3Q0AA 1FVIA 1I4QA 1BXTA 2EYLA 5AFWA 4YWKA 3HOZH 4M1UB 1SE8A 2CVRA 3A8JE 4V190 3VA5A 1G2SA 4FDBA 2AWOA 1MSHA 2F0QA 3FPPA 5FO7B 1N8RC 2PO4A 4LFCL 2TMPA 1RTNA 3E3XA 5CBAE 3PUZA 2R93G 3KLSA 3J80L 3DM1A 1YHAA 1PYBA 3NUCA 4K8JA 5M9OA 4JYAQ 1EY8A 1JR0D 2JA6B 2PW7A 3IFDA 4GNXC 4IALA 4P71A 4JV5L 1RD9D 3H3VH 1KXLA 2WB1B 3H0GH 4RFBA 4ZAIA 1NR2A 4LF5L 3OHXC 2AUKA 2NYZD 2UXDL 1LTGD 1YNXA 3CKIB 3TZDA 5K5PA 1FNWA 1D2BA 1QJOA 5M5WH 1XNQL 5IYCG 4K6LA 5D14A 3LWEA 4A3MG 1F2ZA 4IFDG 2RSOA 1V1PA 3KJOA 3HZXA 1VQBA 3AB9A 4DV0L 1GUGA 2KCNA 4OIKA 5A2QE 3AYHB 5IP7H 2VUMB 1GM5A 1SNCA 5K36G 3U9SA 5C5MA 2MPMA 5NUCA 2A6EC 3EQLC 1WTXA 3CXCA 2D9UA 2ZT9C 1X9NA 3MXNB 1Z7TA 3VYUA 1GHJA 1KDBA 2ZJPA 3K5OA 3P1HA 3GTJB 2ALYB 1VMCA 3PGZA 4F7XA 3VR6A 1IBLQ 4WJWA 4CGYB 2K32A 1VQFA 1EWHA 1W2BA 1I94Q 4O42A 3TZUA 2O5IC 4A3BH 2PQEA 3CRLC 5M5XB 4WORA 2XN9C 3I4NH 1S72A 5IGBA 4NXNL 1D1IA 2O2LD 3T1HQ 2YTYA 1O7YA 4R8IA 1PRTD 4B3RL 1XNRQ 1QVCA 4LAAA 1SSOA 2RHQB 1U4RA 3QWNA 2NWGA 3KF6B 1VQEA 1LTBD 4LF9Q 1NSNS 3A74A 2EIFA 1XNQQ 3TREA 3HOXG 4K5XA 2PZWA 1WD1A 1VQCA 2OTLA 2Q2HA 3K80C 3X3MA 1SNDA 3PUWA 4UPAA 1EL0A 4ME5A 5M3FH 1B7YB 4R4OA 4Z9CB 5C4XH 1K83B 3RR5A 4DK0A 2C35B 2MNAA 2HQLA 1Q3LA 2UUCQ 1CKNA 4DAYB 5EJWA 2E2JB 3UDXA 4KTAA 2F0NA 3MVVA 4K5VA 2OTJA 5JEAH 3OYYA 2BDNA 3DMUA 4A3GB 4HJ7A 4EQPA 1G2TA 3RZDB 4KKSA 1NCVA 4KV6A 3KLWA 3NBHA 4GN5A 2B29A 1N36Q 2E8GA 1UAPA 2XVSA 3H0GB 1PYSB 4L5QA 1C9OA 1I50B 1NR4A 4QB4A 3JAME 4ZKBB 1ZXTA 1JE5A 4A3IG 4DK3C 1HPCA 4K2LA 1RIPA 3QG1A 3S2DB 3W1BA 1RHPA 4DR3Q 1L1OC 3KF6A 3PO3B 1N9WA 2YYZA 1NMFA 5EBDA 1XYIA 3J7A5 1VS0A 3P7JA 4K8IA 4RGMA 1QOHA 1JB7A 1IW7C 1TS4A 3NSWA 3MEHA 4A3DB 2LXKA 4K5WA 1X6OA 4K14A 4KY5A 5ISRA 4JI3Q 5H1SE 2B39A 1G91A 3KF8A 1EUJA 1AE3A 1VQKA 3HKZB 5D65A 2H5XA 2CWPA 1QZGA 1ENFA 1EZ8A 2K14A 2B2WC 4K2KA 4LF6Q 4A3BB 2NZ1D 1UE1A 4IUVA 4G57A 1GVPA 2JA8G 3LWUA 3HOVG 4BY7G 1KTKA 1DOMA 3SE0A 5GROA 3PIPA 1K28A 4LFBQ 4KD4A 2V4DA 1LT4D 1VQPA 1YEZA 4JI2L 2BCOA 1SNOA 5IYCH 4IOAA 1WOCA 2F0FA 4HCSA 2OEOA 5DLQE 1O7ZA 5FLMH 4XYQA 2WACA 4A3FG 4IUUA 4FNFA 5HGTA 3U58A 4JI8Q 2E76C 3MXNA 3F2CA 1JMCA 1YBYA 5F2DA 2NVXB 3H0GG 5CV7A 4R8NA 2GVAA 4C3JH 2ICEC 1XX8A 4LF7L 2OCEA 4I65A 2F0DA 1F2LA 1V1OA 4JI1Q 4A3IB 2LXJA 3J80E 2CCZA 1V1PB 3TS2A 2EQSA 3QOJA 1EY4A 1SAPA 2KEDA 3HOXH 3STBC 2WKCA 4AQYL 4DN4M 1IBKQ 3EBEA 4UP7A 1EY0A 4LFCQ 1WCMB 3JAMi 3NHHA 3UE0A 5IYDG 3PMFA 2EE1A 3UDIA 1GUWA 1GXDC 5BN4A 3BG3A 4Q0FA 2E2DC 3ERQA 3I73A 4DR4L 3BZCA 3TDQA 3DWPA 3HOYB 3S24A 5LMUL 2EXDA 3FRPB 5A35A 5CV4A 1M4VA 3AEVA 4IUTA 2L15A 1HTPA 3P20A 1HNXL 3IRBA 2CW0D 2HDLA 3KUPA 3NELA 2AWNA 5EBCA 1YITA 1LT5D 1RDPD 1B44D 2JP1A 4K6DA 4IURA 2BE5C 4RGNA 1ENCA 1I6VC 3HOUH 1TVXA 3RZDH 5IGDA 1R9TB 3C3LA 4A3FB 3HRZC 2RDFA 5IGCA 1SYFA 4FF2A 1EFID 2F3VA 5KYIA 4DNTB 3PCOB 4A3KB 2MHVA 2AQ2B 2K03A 1KABA 1IYJB 1O7IA 3SK5A 2KENA 4CKBA 1A3TA 4ABNA 1Z6HA 3QIAA 5JOBA 3SXHA 2FJ2A 4C2MH 4JG2A 5CV5A 2RHSB 1J5EQ 3ER0A 5LL6X 5EPKA 1MD2D 4FO2A 3NWTA 2K6AA 4BBRH 1B50A 3DXJC 3GTLH 4X65L 2DNEA 3F1ZA 2NZHA 3S9WA 4OO1G 4OONA 4XDXA 1STAA 4GN3B 3ULJA 4RKLA 4BBRG 1LT3D 4A4IA 4B3SL 2M9VA 2UUBL 1E2ZA 1N34L 2JA5B 1PVOA 1DM0B 4KHVA 3QO2A 4BBSG 3KOJA 2JE6I 3DM3A 4TSSA 4DR2L 3I4LA 4JC0A 2R3ZA 2M2LA 5I9PA 4LUVA 1W6KA 5DNFA 3R2IA 3E0JA 3A8IE 1LT6D 3RNUA 4I7AA 1YJWA 2K33A 3FDTA 3URYA 4BA2I 3HOXB 3M4QA 4IO9A 3N52A 1U4PA 2EY6A 1JICA 4L63B 3IAYA 2I0QA 1CA6A 1ML0D 5M5YH 2KHJA 2HCIA 4PV1C 2D2CC 3GV3A 4Q5VA 4B9XA 4JV5Q 2A6ED 1PZJD 5I9OA 2C5CA 3VYRA 1X3QA 1SJED 3HP3A 4CDCC 1G51A 4KHPL 5C4ZA 4ZUJA 4JI7Q 5EPJA 4C3IB 3CRKC 2O4XA 5EKLA 1VF5C 1K83H 2QDBA 1XJVA 4NPSA 5GADC 3T56B 5FOBB 3GDEA 2FMCA 4F88A 3S16B 1JWMD 1HXYD 4F87A 1TXYA 1KNAA 2BH8A 5LMNQ 2KA7A 1A6XA 3A0JA 3CCEA 1K3BC 2VQEL 1ILQA 4TVAB 1KAWA 1MBYA 4JOIC 3VR3A 1V1QA 2F0SA 3GTKH 5DM73 1ESRA 1D8LA 1UWVA 1CT1D 2PI2E 3K59A 1DOLA 4RGOS 3AMUA 1I50H 1E0BA 5LHY1 3SHLA 2WINB 3K7AH 4IJLA 1A8VA 1C4QA 4L5RC 4DV5L 3OMGA 3I56A 1UE5A 1LTTD 1HUMA 4JI1L 1BDOA 3BDOA 1VQJA 2ZTCA 3VA7A 4O2DA 1I4HA 1HNWQ 4X62L 3K81C 4JI0L 3V96A 1PMRA 3TSSA 2B3GA 5AJ3L 1I6HB 1AZPA 2QEXA 4CBVA 4BY7H 3X3NA 4RCNA 1Y69U 4YCVA 3H3VI 1G6ZA 1QUQA 3GTJH 2R92B 2R93B 1DZ1A 3SK6A 1I6HH 1VQGA 3PF4A 3A8KE 2A68D 4X64Q 5CV6A 1FD7D 4DXGA 1SMYD 2XSCA 2LKVA 4EX5A 3GD7A 1EYCA 2MP1A 4PMCA 1IYVA 1NAPA 5CYUA 3JAML 4XQNA 3D6WA 4M8AA 2NVTB 4OWTB 1JORA 2L0CA 5IIFA 1T9HA 4PMBA 2BA1A 5EQ0A 3H91A 2Z1CA 1OXTA 5M3MH 1TWCH 1PTOH 2YU9B 2N55A 3S2HH 1HQMC 1XTCD 1E1TA 4KLKA 1RTOA 2LFNA 2Y0SG 4HJ5A 2B2VC 1HZAA 3CCVA 4H02A 3NP8A 2ZJQA 3BVGA 3RLFA 1EZ6A 1YVCA 3PO2G 3PUVA 1ZYRD 3OSOA 1D6EC 1QNUA 4DV2L 3FVQA 3NPPA 1IXRA 1WTHA 3HS0C 3W3AA 3ND8A 3VDYA 2DY8A 1GUSA 3H09A 4DV5Q 4DV7Q 2P5ZX 2R7FA 2XIWA 3R93A 5I2YA 4X65Q 2RDGA 3BYYB 4A75A 4GOPA 5G3LF 1S5CD 1E3PA 3L7ZC 1M8AA 2Q8IB 2K5HA 4NXMQ 5JAVA 4N8FA 1MJEA 5JVH3 2DJGC 4H44C 4ZLTF 3FKIG 1UNSA 2E2JH 4QCLA 1VQ8A 4L5TA 1EY5A 1RL2A 2R92H 4ILWA 3CD6A 4K0KQ 5E3FA 4Y7NH 2HT1A 2F3IA 2K01A 3LX0A 4A3LG 1BCPC 3TRZA 4EQNA 5C0XI 3CC2A 5JJKA 2F0UA 2RA4A 1NY4A 2EJGC 1X55A 5KRUA 3C46A 4OO1I 1ENAA 2NVQH 1ET9A 1EEFD 4YIJA 4JI4L 1SNMA 5FO9B 3K57A 5GAGC 3OIPA 3GTQH 2UXBL 4CKCA 1C8CA 1Q12A 5ELCA 4RA8A 1SBBB 1E22A 1D5MC 1STEA 2K7VA 4JBJA 4KY6A 4EVOA 3CCSA 3OIQA 3DEPA 1IW7D 1SNQA 2B2TC 4PG3A 1S5ED 1AFPA 2VL6A 1OXXK 2EJFC 2PI2A 4GN4B 1Q8KA 1JOOA 2BA0A 4DR7L 1SYCA 3MZ5A 2JA6H 4KHPQ 1VF7A 4QUFA 5J39A 3GTKB 1I3QH 1XTDA 1HJPA 1J8IA 1SJHD 3B6YA 3NBHB 3H15A 4LF8Q 3BDCA 1BBWA 4PZ8A 1MHWC 2AUJD 2G9DA 1A2TA 4GKJL 4C1NI 3NEMA 4AIMA 3WOEA 4E6IA 2VQFQ 2BE5D 2ZXRA 2VQEQ 4CDEC 3J7AF 3CHBD 4P73A 4G7HC 4KHZA 4P72A 4HIKA 4JI5Q 1B2TA 2QDLA 2QGQA 5I4DA 5JJZA 4MZ9A 2V1CC 2LY7A 2SNSA 3SK8A 2PQAB 4BBRB 1WTPA 4GKKL 1SE4A 2D62A 1B1ZA 2UUAQ 1HFGA 1KHIA 1TWCB 4P74A 3S2HB 4FVMA 2CHBD 2KCMA 2WAQG 1FL0A 1KC8C 2E2IB 5E7NA 4QMGA 1Q7YC 2K52A 4BY1B 3E6ZX 1CQVA 4KY7A 3PO3G 1QE6A 2O5JC 5CC4A 2MO1A 1Y1VB 3S1RH 1XPRA 3HOWG 2D0PA 2F0PA 4ZYSA 1C7YA 3MHBA 2DGYA 4DR1L 2EOTA 3I4MB 1QNKA 1E1OA 3J7ZC 3ICEA 2L11A 4KD3A 3CMAA 1PXUA 2ZTEA 3S2DH 1V43A 4ME3A 4GNXB 1PV4A 1VQ7A 5KYLA 4B9WA 1CSPA 3HOUG 4DF7A 2N3SA 2K28A 5EKIA 4CDDC 4LF5Q 1UE7A 4KN7C 2K5VA 1V9PA 1VQOA 5LMNL 2VXWA 4UHVA 1D1KA 4ID6A 4RHSA 4HCEA 4LUZA 1GUTA 4R4TA 3HOZG 4FXGC 1EU3A 2B8GA 4QL5A 1CZGA 2FINB 1DJRD 2RSNA 2DY7A 4IPHA 1CHPD 2Q8RE 5JJIA 1PTOC 1CKNB 4LF4Q 3DEOA 2LSSA 1TT2A 4JI5L 3TP6A 3G6EA 4APVA 1LABA 1U5KA 1CKOA 1OO9B 2WKDA 2WAQB 4ZK9B 4QY7A 3RD4A 1L0YB 1SRUA 1B4OA 2MFIA 1T5XD 1QWYA 1Y1VG 2E5LL 1EU4A 4C3JG 2K1BA 3G6JB 4JYAL 5FO8B 4DUYQ 4RH6A 5J1ZA 1TWHH 4YWLA 3T1YQ 1IHZA 1EYAA 2EY1A 1STHA 2OXPA 2A1AA 3HOUB 4PZ7A 2NB0A 3PUXA 5COYA 1WCMH 2L1BA 4NXNQ 3QJYA 1J6QA 1VCIA 1B9NA 2VB3X 4IPCA 2F0OA 2B2YA 4H13C 2JXMB 3BDLA 4P75A 1STBA 4UAIA 1ICFB 4HMJA 4C3HG 1BCPD 3IL8A 3CQZH 2R7ZG 2BOSA 3DUZA 3CMEA 4B3TQ 3I4MH 1XMOQ 1R4PB 3VR2A 4BXXG 1QG7A 2NN6H 3GTOH 1EIFA 1H9KA 5GAHC 1YJ9A 5GAEC 2IY5B 4IUQA 4A3JG 4A3CH 2R7DA 2OF1A 4ZUIA 2IHFA 3A54A 1EQRA 1PFMA 1IKMA 4NB3A 2F0EA 3FEWX 4XT1B 4LF8L 1BKBA 3S1QB 4JI6L 2JJQA 1S4ZA 2NTSA 5M3FB 3GTLB 3KBGA 3GO5A 1SMYC 4R4QA 1ASYA 2AHOB 1HRJA 4CHTB 2ZJRA 4FF1A 1A62A 2F0IA 4H0LC 1AP0A 5T1GA 4AQYQ 2JA7H 4FXDA 1EOTA 1K73C 3GTGB 2A69C 3C1FA 3NK9A 3GP7A 3Q24A 1K8AC 1VQLA 1N33L 4A3KH 5KEEA 3FKIB 2Z4IA 4DUYL 3FHWA 3GQBA 5HGQA 2F0KA 3T1YL 4A3LH 1H9MA 1SYGA 2M00A 3D4RA 3HG9A 1VDZA 3S17H 4CJ1B 4LJZC 1DCZA 5C0XG 3H6MA 2ASBA 3I70A 4Y52H 2IX1A 4C1NK 4U673 3LGJA 4DV6L 1Q82C 1WI5A 2JYOA 1ESFA 4HAEA 4UY8C 1K0SA 3S15H 1HA5A 3FP9A 2OQ0A 1K8MA 4DR7Q 1JJ2A 2TSSA 3AFQA 2K5WA 2NVYH 4TQUS 4LF6L 2CW0C 2B2UA 1STYA 4O0AA 2B2YC 3WOFA 3IFTA 3EA6A 3W1GA 1Y8PB 4IOCA 3VYTA 4RGTA 4A76A 2A6HD 1B70B 1KDCA 4BY1H 1TS5A 3KK7A 1O7LA 3CCMA 4DV0Q 3HOVH 3RN5A 2VQFL 3MTSA 2E2HH 3I3CA 1KRTA 2DNCA 4BY7B 1N32L 2XRQD 2ZXOA 3PSIA 1G6PA 2F0TA 1EY9A 3S1NB 1B3AA 4KKTA 4A93G 2B2VA 3MA2B 1BCPF 2RCFA 5C3XA 1Q86C 5BR8Q 2ZXPA 3HOWB 3R3OA 1A0IA 3I8ZA 1PH4A 1E2WA 3M4PA 5GQOA 5DEHA 3GV6A 3I4MG 2PMZB 4R9WA 1S5BD 1TWGB 2A5HA 3PF5A 3AQQA 3OPOA 3L9AX 5K36H 2Z6KC 5C4HA 5L37A 5IY0A 3OMCA 4DK6C 3MXPA 4HIOA 2ZM6L 5FJ8H 1OXSC 2LMCB 3NXWA 2N8NA 4LNQA 1EIGA 1AE2A 2WV6D 3KDFA 5IT9L 2F0JA 1SROA 2GVBA 1LTLA 1WFQA 3I55A 1EOVA 4BY1G 3CC7A 1Z47A 2CQOA 4JCVE 4ODGA 4DAVA 4GLAC 4FP5D 4A3MH 1PH5A 3D3RA 5LMUQ 1X3PA 3RZOB 2VZAA 4KJNA 4G7OC 1IBMQ 2EYJA 3ULLA 4DAPA 2UXBQ 1BOSA 1D5XC 2CKZB 3T51B 1XXGA 3GTQB 1VMPA 1WYDA 2YV5A 4X3TA 2K4KA 3PV0A 4HMIA 3ITPA 3NTKA 3J7YW 2H4OA 2RQXA 1PH3A 4HN7A 3Q6SA 2HQEA 1EWCA 5J22A 1PZKD 1VQ6A 1WVLA 4ZKCB 3HOZB 3CCLA 1PFSA 3KBXA 3DWQA 3S1QH 1HH2P 4DPGA 3PO2B 1KQSA 2F1MA 4BWGB 2KUMA 3Q8DA 1J5EL 2NBFA 3L0OA 4DXFA 4OELB 3OW2A 1H9JA 4HJ9A 2JA5G 4JVZA 3OTOQ 3BS1A 1NJIC 2L12A 1JWSD 4HIMA 1BNZA 2EYMA 2XGTA 2B63G 1CQFA 5C4XB 3I4NG 5IP9H 5ELDA 2XWJB 1PRTF 5BN5A 1RCVD 1BQQT 2FFKB 5ELOA 2Z6BA 3VR4A 4OWXB 3KJPA 3Q23A 1TU2B 1IL8A 3W2DA 5JPMC 1QZHA 1O80A 4L6TB 3M3YH 2UXCL 1N33Q 2OQKA 4DR3L 1HQRD 1PHJA 1K8GA 4LFAQ 1A3VA 1U9RA 5D3IB 2G9HD 1EEID 4POFA 3S17B 4DV1L 3NTIA 1UUPA 3KYHC 4A3JH 5IWAQ 4BBSB 2NN6G 1GUOA 1SE3A 4IPDA 3S16H 1EWIA 3CF5A 2I5MX 4S3SA 1TWHB 1PH9A 2J7ZA 4AYBB 4DR1Q 2SEBD 4JI3L 3PIOA 4IUNA 2BH2A 1Z9FA 2F0LA 1DONA 1C48A 3F2DA 2X6LA 2F0VA 3PO3H 2NUCA 5C3EB 3C2PA 5KNCA 2JA7B 4JBMA 1MI2A 2C9OA 4IFDH 4JI2Q 4MTNA 3EROA 2RBMA 1LO5D 3P75A 3HOVB 1AZQA 3BZKA 2F03A 5LL6S 3QOLA 1RJTA 1QVGA 2LS01 3KLSX 5FLXc 4PNYA 1DXMA 1WTOA 3CCRA 3SDZA 3R8BA 4G7ZC 2KCTA 3KFUA 3MC0B 1GJXA 4BA1I 4B08A 3UDFA 4TRDA 2AQ3B 4LW1A 2FHTA 4X3SA 2ES2A 3O13A 1XMQL 1TWAH 3T13A 3D8GA 3TBIB 5JEAJ 3HEJA 2Q8TA 4G4KA 2UU9Q 2KCCA 1D7QA 4DNRB 4YHHL 1B53A 2WAQE 1GD7A 3T53B 4X62Q 3I7FA 1JT8A 1LACA 1H95A 1PRTB 1PTOB 3Q22A 4HIDA 2D5DA 3K7AB 4QIWE 2JA5H 1LV9A 1PH2A 4RAUC 3BU2A 2K5QA 5KGUA 4HEDA 1BO0A 4JBKA 5FK9C 3BVZA 1A15A 2Q2IA 3TMEA 4OWWB 4PZ6A 2E2IH 4JBWA 1CKMA 4LF9L 1K0RA 1AW7A 5I2XA 1TWFB 1TR5A 2QKIC 4XQQA 1R9TH 2D0OA 3F8TA 2PQAA 5G3LD 2UXDQ 1KL9A 1Q90A 3SR1A 2F3WA 4X66L 1CUKA 1IZ6A 5C4JB 3RN2A 1XPUA 1K8OA 4DUZQ 3FKIH 3M7NA 1IYUA 2AMCB 1X54A 3SEBA 3RLNA 1XMOL 1DD2A 1SNPA 3MAQA 5HY6A 1B8AA 1BR9A 2OT2A 1V8QA 4X3UA 3DLLA 1KDAA 3M4OB 3CP0A 3NTHA 4YWMA 3ZJYC 1GO3E 2I5HA 1SMXA 1Q1BA 4DR6Q 4A3FH 4DAYA 1HFNA 4XQJA 4RWSC 1Y1WB 5IOCA 4HJ8A 2PW5A 1W3SA 1NMGA 5IGFA 4NDXA 4DV2Q 1HCZA 1CK1A 5CBEE 1JB3A 1HNWL 1HUNA 5C44H 4JI0Q 3KLRA 2KBNA 3ZYYX 2A74C 4YY3L 1JOKA 4DR2Q 1CZWA 1LTID 2EY5A 3H3VC 1GHKA 3PIP3 2SOBA 3CQZB 4F8MA 2N88A 1JWUD 1Y8NB 4WJ4A 1ILPA 2L5TA 3NWSA 4X3KA 3S1RB 4DV4Q 3HKZG 2X6GA 2QF7A 1I4PA 4ZQ3A 3HKZE 4X64L 1K3RA 4HR7B 1IBML 4IZ8A 4A93H 1TWAB 2A69D 2JA8B 5IYBH 1BF4A 2A68C 4A3IH 1S5FD 1L2FA 3MWYW 3PIO3 4DV6Q 2JA6G 4J1MA 4DK1A 4NP5A 1EQTA 2CFMA 2CQAA 1Y14B 3D31A 1G8ZD 3A55A 1FGBD 2EVBA 1XNRL 1F2YA 2VS1A 4R1JA 5IP9G 4OEMB 2KOLA 1KNEA 4L5SA 3G48A 1SXTA 3M85A 4DUZL 1PH6A 2I5LX 3GTGH 4XXEA 5JEAG 2IJ0A 2IX0A 5IT9E 2HHHQ 3U9OA 3H94A 2Z6KA 1EIYB 1XWEA 2B8FA 1M1KC 5I6YA 5DM63 4C3IG 1L0WA 4A3JB 1QILA 4LF7Q 1HA6A 5EGTA 5M3FG 5EAYA 3PUYA 3NQIA 1T5EA 4FF4A 2PZTA 4QQBX 5C0XH 5C44B 4NXML 1PRTC 3CPFA 1LLRD 4RKBA 4HTHA 1WTRA 4X6AH 4IPGA 1PA6A 2AKWB 4L8JA 1LYLA 3CPWA 1L1OA 4N9PA 4AYBG 3I4NB 5CV8A 2ENBA 4UP9A 3TP8A 1XMQQ 1KAAA 1ASZA 1L0XB 5TSSA 4EQOA 1IL2A 1CTMA 1F9PA 2NVXH 2Y0SE 1JQYD 4CJ2C 2JA7G 1AEXA 4MTKA 2UU9L 1F2MA 4IN3A 3M4YA 4OXPA 4B3RQ 3W5OA 4C56C 2B2UC 1HNXQ 1QUQB 1JE4A 4HJAA 1YHBA 2JN4A 4YCWA 1B9MA 2EYPA 1ONLA 2NN6I 3KDFB 4DNIA 3E9HA 3MEFA 1IKLA 3J80c 1HHVA 3K8AA 5IYBG 3D6CA 4DAMA 5JPNC 1X32A 2XWBB 4XT3B 5CMDA 1QVFA 4B3MQ 1A3UA 4KK7A 1SE2A 4A3EG 2EZVA 2SNMA 2GN5A 3CW2C 3TP7A 4BXXH 2G5DA 1D5ZC 1L1OB 1YI2A 1SYDA 3OWEB 2IW3A 1ZYRC 2R7ZH 1R4QB 2FXQA 5BN3A 2IL8A 3OW7A 2PZUA 1ICWA 5C44G 2EDGA 2F4IA 4QJFA 2B2TA 2QA4A 4LMQD 2E74C 1S40A 2NTTA 3S1MB 1O78A 3TS0A 4KKUA 2A73B 1TQOA 4LUOA 1NTGA 3EVQA 1VQDA 4OL7A 2J0TD 5ELFA 2Y0SB 4A93B 4NW2A 4MN3A 4ZRZA 2KHIA 4DR6L 5JJLA 1EQQA 5M3MB 3RUZA 2YU9H 3OTOL 4POGA 1N34Q 3GTOB 1TWGH 4MNOA 4P2CB 1RODA 3T4AC 4MIUA 4CJ0B 1JCKB 4QGUA 4V0BA 3U4ZA 3UI2A 3BZDB 2DUDA 3TN2A 2RDHA 3K7UC 3WWVA 3G7LA 1PH1A 1JC7A 2MGSA 4UDUC 5JVG3 1WTQA 1Q81C 1Y1VH 2VW9A 4XTCS 4DGZA 4R4CA 1LTRD 4K0KL 3BJUA 3S14H 2EJMA 4JW0A 1SFOH 2F0HA 4LFAL 2I07B 5CV9A 4QUCA 4PQXA 2SDFA 1EQVA 3AFPA 3HKSA 3A5UA 4A3DG 5E4WC 1NUCA 1OXVA 5IWAL 3BYTB 4LK1C 2AQ1B 1S5DD 2DN8A 2IPKD 1U0LA 3K0XA 4JI4Q 2EXZA 4KN4C 5C0XJ 3T16A 2HUGA 1X3FA 1TIID 4JI7L 4NMZA 2VUMH 2NVYB 5FLXL 2DJFC 1DYQA 1EYDA 1BVSA 4Y7NB 2ICIA 3E5SA 2XRSD 4ZCKA 2MUYA 1KIXA 1HZ9A 4A3DH 3OWFA 3CCJA 1TWFH 1H9SB 3SK4A 3E0EA 4DA2A 5IODA 2RF4A 1TY2A 3J7AV 2IWHA 1I3QB 1SYBA 3FMCA 5C3EH 1H9RA 2PYKA 2K75A 1Q1EA 3GTPB 1N32Q 4A3CG 1E7ZA 4C2MB 4HSVA 4GKJQ 1HZBA 1BUVT 1SYEA 3I72A 3K6OA 2EYFA 2F4VQ 4FXKC 2R7ZB 1PTOD 4RCOA 3RZOH 3G71A 1YJNA 1CM9A 2B63B 1Y1WG 4WFN3 2NVTH 3GTPH 4C3HH 4J8QA 2NZOA 5CGKA 1X3EA 1UE6A 2K5DA 3K0YA 4J15A 4DU9A 2F0WA 1FGUA 3L3OC 2PPBC 1HTLD 2Q2TA 4GOPC 1FJGL 3K5NA 1FYCA 3NQTA 1YNNC 4B3SQ 4OGQC 2WP8J 3S1MH 1Y8OB 2N49A 3ONAB 4IFDI 4DR4Q 3AU7A 5IT9c 4KJOA 5AJ3Q 1WCMG 2JK8A 2YTVA 1SDFA 4YHHQ 4BS9A 3J80i 5HURA 1GUNA 3JC66 3NBIA 3CCUA 3U4VA 3I90A 5IGGA 1KD1C 1Q8IA 4YCUA 1FR3A 2HD3A 2PMZE 1JJGA 1PLFA 4OX9Q 4A3EH 4JPBW 2QCPX 1PH7A 2J4XA 3RLOA 2CH4W 2VNUD 3J81j 4I7ZC 1HR0W 4N9TA 3EJIA 1VQHA 5KNBA 5IGEA 3BVMA 1YNJD 2CWAA 4AYBE 1PTOF 5C3EG 5KIXA 4U68A 4QIWB 4DV3L 4IJHA 4EQ5A 1DGSA 1STGA 3MXGA 3F2BA 4IFDJ 1S3OA 5M5XH 3U50C 5C6AA 2EYOA 1LTSD 4JK1C 2N78A 1QCBD 3A7LA 3M3YB 1AH9A 4KMUC 3I2ZA 3L2PA 1F77A 4O1NA 2L4NA 2B63H 2KEEA 3CCQA 3DHQA 3TEHB 4A3GG 5C3WA 4DR5L 4AH6A 1PFBA 3HGBA 4LF4L 1WTVA 2H1EA 4DV7L 3R2TA 5IE8A 5IYDH 1PYWD 2A8VA 2EY2A 4LWCA 1FJGQ 1II3A 1KLUD 2VY3A 3D4WA 1TY0A 3K58A 2QEJC 2Z0SA 3QR8A 3MFGA 1I94L 2HDMA 1YIJA 3E9IA 4GNXA 4CDFC 4PMWA 2Q2UA 1SN8A 2E5LQ 3J81E 1TS3A 1MGSA 2F52A 3ERSX 3KF8B 4C3IH 1Q46A 2RVLA 2XTIA 4A3EB 3HOWH 1HZCA 1MIUA 2PCFB 3HOYH 2ZM6Q 3V05A 3LNNA 1ZKOA 3HFZB 2CH4A 4OX9L 5FLMG 1CI3M 1F9RA 1CA5A 2KJXA 1G291 4UP8A 1SFOB 2PNHA 4RG1A 1E24A 2JA8H 4A3BG 1GOZA 4DV3Q 4A3MB 4MHEA 5FJ8G 3CAMA 5D3DA 2Z4HA 4GLVB 2FMMA 5FKAC 3A7AB 4FF3A 3A56A 1KLGD 5M3MG 3OOCA 1MJCA 2BDOA 4B3TL 2MJ8A 3QB3A 1HR0Q 1ZEQX 4GOPB 1STNA 2JSOA 3TQYA 3GTMH 1X3GA 1QB5D 2WB1G 2HHHL 3WDNA 1PH8A 1LM0A 1FNUA 4NKLA 2K04A 3I91A 4OIJA 1K9MC 3I4OA 3DWAA 4TKOB 5ELNA 1P16A 3RMHA 3S15B 5KNDA 3UDGA 3CC4A 4JI6Q 4DFAA 2EYHA 1GKHA 5CORA 2QILA 1NE3A 3V2TA 1LUZA 1LTAD 3EIVA 1H9SA 3N6RA 2JEAI 2KECA 2GA4B 1CHQD 1PZID 1MSGA 5A2QL 2UUAL 3A5ZB 1J9OA 1CFMA 5CR3A 1U4MA 2IHEA 1IBLL 1SR3A 2K05A 2L9HA 3J81i 3J81c 3HOYG 2E75C 3D4DA 5E4XA 4OHJA 5I6WA 2WIIB 3S1NH 3JAMc 2KQ3A 1P8LA 5C4XG 2YTXA 1F9SA 2R61A 2R92G 3S14B 1KRSA 4ULLA 2JQOA 3T1HL 1YNND 2I46A 1VQMA 1U4LA 3UE1A 1MKHA 1EIHA 4B3ML 4WRDA 1I4GA 1PDQA 4LFBL 4H7BA 1XPOA 2R6GA 3D0FA 4RMFA 1VQ5A 1RKNA 1JOQA 2PNRC 3C1EA 4QF4A 3VYSA 4GLXA 3CU7A 2F0GA 3MFYA 1VQAA 4A3KG 4RHRA 4XYOA 1VQ4A 4JI8L 1HNZL 3K5LA 1VQ9A 4A3GH 1A2UA 2HIVA 2KVMA 1WD0A 1TKWB 1I4RA 1SLJA 2IT1A 3PO2H 1B3QA 2B2WA 3STBD 2F4VL 1CSQA 2ZTDA 1C0AA 1I4XA 2UUCL 5ELEA 1JJCB 3SGIA 1AN8A 4FYDA 2RCNA 3EN2A 4XIGS 4C3JB 1RF2D 1F9QA 2WFWA 3PQIA 5FLXE 1I5FA 3EFXD 3K5MA 2NVQB 2ID0A 1EFWA 2ATWA 1FNVA 5BR8L 3M4OH 1IBKL 3NENA 4YY3Q 5DAUA 2RKSA 4J6HA 4JOIA 1YHQA 2UXCQ 1UEAB 4GKKQ
chains in the Genus database with same CATH topology
1ASZA 2R93H 1IL2A 2NVXH 2Y0SE 4DUYL 3FHWA 4R4IA 5HGQA 3RNUA 4DV1Q 1YJWA 3T1YL 4BBSH 4DV4L 4A3LH 2JA7G 4BA2I 3M4QA 4IO9A 5IP7G 1EYGA 2UU9L 4OXPA 4B3RQ 3W5OA 3ULPA 3S17H 1HNXQ 1QUQB 1VQIA 1YHBA 4HJAA 5C0XG 1NBWA 2I0QA 1UEBA 2HIXA 4YCWA 2ASBA 5M5YH 2IX1A 4Y52H 2KHJA 2A19A 2NN6I 3KDFB 3LGJA 4DV6L 4DNIA 3E9HA 3MEFA 1OTCA 2K50A 3J80c 1X65A 1WI5A 1Q82C 5LMNW 1M90C 3K8AA 5IYBG 4UY8C 4JV5Q 3S15H 3FP9A 4DAMA 1VQNA 2OQ0A 1QVFA 1X56A 4B3MQ 4DR7Q 1JJ2A 1G51A 4KHPL 3AFQA 1OXUA 2NVYH 4JI7Q 1Y1WH 4TQUS 4A3EG 1BBUA 4LF6L 2GN5A 3CW2C 4BXXH 4O0AA 1K83H 3M9BA 1L1OB 1YI2A 3G4SA 1XJVA 4NPSA 5GADC 2R7ZH 1HNZQ 2FXQA 3GDEA 3W1GA 4IOCA 4A76A 4GS3A 4X66Q 2JEBI 1B70B 1TXYA 5C44G 2MQHA 2BH8A 2JA9A 2WB1E 5LMNQ 4BY1H 4GKKQ 4QJFA 4DKAC 2QA4A 4DR5Q 4DV0Q 3CCMA 1S40A 3HOVH 2MO0A 3A0JA 2K5NA 3RN5A 2VQFL 3CCEA 4KI0A 2VQEL 4ALPA 5J3BA 4TVAB 1KAWA 3TS0A 1YZ6A 4JOIC 2E2HH 1V1QA 3GTKH 4LUOA 5C4JH 1NTGA 1VQDA 1UWVA 1D8LA 1KRTA 1N32L 2PI2E 3PSIA 1N36L 1G6PA 1A63A 1WJJA 2KHIA 1I50H 4A93G 4DR6L 1EQQA 2YU9H 3K7AH 4IJLA 3OTOL 1A8VA 2UUBQ 4L5RC 4POGA 1N34Q 4DV5L 1TWGH 4MNOA 2VUMG 4WJ3M 3I56A 1UE5A 1Q86C 2OWOA 5BR8Q 1A0IA 1FVIA 4JI1L 1PH4A 3M4PA 1VQJA 3H3VI 5GQOA 4QGUA 4YWKA 3U4ZA 3HOZH 2ZTCA 2DUDA 3I4MG 1SE8A 4O2DA 3K7UC 3WWVA 1PH1A 3PF5A 1HNWQ 3AQQA 4FDBA 4X62L 3K81C 4JI0L 2AWOA 1Q81C 2Z6KC 1Y1VH 1N8RC 2VW9A 2B3GA 4XTCS 5IY0A 4LFCL 4DK6C 5AJ3L 4HIOA 2ZM6L 5FJ8H 1OXSC 4R4CA 2QEXA 2N8NA 4LNQA 4BY7H 1AE2A 4K0KL 3BJUA 3KDFA 3S14H 3PUZA 1SROA 1SFOH 2R93G 4LFAL 2GVBA 4YCVA 1LTLA 1WFQA 3I55A 1EOVA 4BY1G 1QUQA 1YHAA 1PYBA 1Z47A 2CQOA 3HKSA 3AFPA 4JCVE 3GTJH 2Q2UA 4JYAQ 3A5UA 4GLAC 4A3DG 1I6HH 3S2DH 4A3MH 1OXVA 1PH5A 5IWAL 1VQGA 5LMUQ 3PF4A 4GNXC 2VZAA 4P71A 4X64Q 4JV5L 1IBMQ 3ULLA 3H3VH 1U0LA 1KXLA 3H0GH 3K0XA 4JI4Q 2UXBQ 4EX5A 3GD7A 4LF5L 5C0XJ 2UXDL 1YNXA 2CKZB 1X3FA 4JI7L 2VUMH 4OWTB 1T9HA 2BA1A 1BVSA 5M5WH 1XNQL 1WYDA 2YV5A 2K4KA 1OXTA 5M3MH 1TWCH 3PV0A 5IYCG 1KIXA 1HZ9A 3S2HH 4A3MG 4A3DH 3CCJA 1E1TA 4KLKA 4IFDG 1TWFH 2Y0SG 4HJ5A 1PH3A 3E0EA 1HZAA 3KJOA 3CCVA 2RF4A 1VQBA 4H02A 4DV0L 2ZJQA 3RLFA 1VQ6A 5C3EH 1YVCA 3AYHB 5IP7H 1PFSA 3CCLA 3S1QH 1GM5A 3PO2G 1HH2P 3PUVA 4DPGA 2K75A 1Q1EA 1N32Q 4A3CG 1E7ZA 5K36G 4DV2L 1KQSA 4GKJQ 1HZBA 1IXRA 3Q8DA 1J5EL 3L0OA 3CXCA 2F4VQ 3OW2A 4HJ9A 3VDYA 2JA5G 3OTOQ 1NJIC 1X9NA 4DV5Q 3RZOH 3G71A 1YJNA 3MXNB 4DV7Q 2R7FA 4X65Q 1Y1WG 2NVTH 3GTPH 4HIMA 4C3HH 2NZOA 4A75A 1X3EA 4GOPA 1UE6A 2ZJPA 2XGTA 4J15A 2B63G 1E3PA 1FGUA 3L7ZC 3I4NG 2ALYB 1FJGL 2Q2TA 5IP9H 4GOPC 2K5HA 4NXMQ 3PGZA 4B3SQ 3S1MH 2WP8J 1IBLQ 2N49A 1MJEA 3FKIG 4IFDI 5ELOA 1VQFA 4DR4Q 2E2JH 4OWXB 1W2BA 3KJPA 1I94Q 1VQ8A 5IT9c 4L5TA 5AJ3Q 1QZHA 1WCMG 1RL2A 2JK8A 3M3YH 2R92H 2UXCL 3CD6A 2YTVA 1N33Q 4A3BH 4K0KQ 2OQKA 4DR3L 4YHHQ 1PHJA 4Y7NH 1K8GA 2HT1A 4LFAQ 3J80i 4POFA 2F3IA 3JC66 4A3LG 3CCUA 3I4NH 3U4VA 3TRZA 1S72A 4DV1L 4A3JH 3KYHC 4NXNL 5C0XI 3CC2A 5JJKA 1KD1C 5IWAQ 1NY4A 3T1HQ 2YTYA 1X55A 2NN6G 4IPDA 3S16H 4OO1I 1EWIA 3CF5A 2NVQH 2I5MX 4B3RL 4YCUA 1PH9A 1XNRQ 2PMZE 4DR1Q 4JI4L 2UXBL 1QVCA 4JI3L 5GAGC 3PIOA 4A3EH 1PH7A 1Z9FA 3RLOA 1Q12A 4OX9Q 3F2DA 2BH2A 2VNUD 1E22A 3J81j 4JBJA 1HR0W 2RHQB 3CCSA 1VQHA 3PO3H 3KF6B 1VQEA 4PG3A 2CWAA 4AYBE 4LF9Q 3A74A 5C3EG 2VL6A 2EIFA 1OXXK 1XNQQ 3TREA 2PI2A 4GN4B 3HOXG 1VQCA 4DV3L 2OTLA 1Q8KA 4JBMA 2Q2HA 3K80C 4IJHA 1DGSA 2BA0A 4EQ5A 4DR7L 3PUWA 4UPAA 2JA6H 4KHPQ 3F2BA 4IFDJ 4JI2Q 1S3OA 5M5XH 3U50C 5M3FH 1I3QH 4MTNA 1XTDA 1B7YB 1HJPA 4R4OA 2N78A 4LF8Q 3B6YA 3NBHB 5C4XH 3H15A 3RR5A 1AH9A 2C35B 2MNAA 1BBWA 2HQLA 4PZ8A 2UUCQ 3I2ZA 1CKNA 3BZKA 3L2PA 4DAYB 2B63H 3UDXA 3CCQA 2OTJA 1QVGA 3TEHB 4A3GG 3OYYA 4GKJL 5FLXc 3NEMA 4HJ7A 4AIMA 4DR5L 4AH6A 3CCRA 4LF4L 2VQFQ 5JJLA 2VQEQ 4P73A 2KCTA 4KHZA 4P72A 4DV7L 4HIKA 5IE8A 4JI5Q 3KFUA 5IYDH 2A8VA 4BA1I 3KLWA 4GN5A 3UDFA 2QGQA 2B29A 1N36Q 4LWCA 2E8GA 4MZ9A 1FJGQ 2VY3A 4LW1A 2V1CC 1PYSB 4L5QA 2PQAB 2ES2A 1C9OA 1XMQL 4GKKL 1TWAH 2Z0SA 2D62A 5JEAJ 1I94L 2UUAQ 1KHIA 4P74A 1JE5A 3E9IA 4DK3C 2KCMA 4PMWA 2WAQG 1FL0A 1SN8A 4GNXA 1RIPA 4A3IG 5E7NA 1KC8C 2E5LQ 3W1BA 2UU9Q 4DR3Q 1D7QA 1L1OC 3KF6A 4YHHL 1Q7YC 1N9WA 2F52A 3ERSX 3KF8B 2WAQE 1GD7A 4C3IH 2YYZA 1NMFA 2K52A 1Q46A 3J7A5 1VS0A 4X62Q 3PO3G 2XTIA 3HOWH 1JB7A 1HZCA 3I7FA 1JT8A 2MO1A 1MIUA 1H95A 2LXKA 4HIDA 1X6OA 3S1RH 2ZM6Q 1XPRA 4QIWE 1HR0L 3HOYH 3HOWG 2D0PA 2JA5H 1PH2A 1C7YA 3HFZB 2DGYA 3BU2A 4DR1L 4JI3Q 5FLMG 4OX9L 5H1SE 4JBKA 1E1OA 3J7ZC 1EUJA 1AE3A 2Q2IA 1VQKA 3ICEA 3CMAA 2ZTEA 1G291 4UP8A 2H5XA 2CWPA 4PZ6A 2PNHA 1QZGA 2K14A 2E2IH 1V43A 1CKMA 4JBWA 4ME3A 4GNXB 1PV4A 1VQ7A 1UE1A 1K0RA 4RG1A 4LF9L 1E24A 1CSPA 3HOUG 4A3KH 2JA8H 4A3BG 1GVPA 2N3SA 2JA8G 4DV3Q 1R9TH 3HOVG 4BY7G 2D0OA 3F8TA 5FJ8G 5GROA 3CAMA 3PIPA 4LF5Q 1UE7A 2PQAA 4LFBQ 4GLVB 2UXDQ 1KL9A 1VQPA 4X66L 1YEZA 1CUKA 1IZ6A 2K5VA 3RN2A 1XPUA 4JI2L 1V9PA 4DUZQ 3FKIH 3M7NA 2AMCB 1VQOA 5M3MG 5IYCH 5LMNL 1WOCA 4IOAA 1MJCA 1X54A 5DLQE 5FLMH 4B3TL 1XMOL 3RLNA 4A3FG 1HR0Q 4LUZA 4GOPB 4R4TA 3HOZG 3TQYA 4JI8Q 3CC7A 3U58A 3GTMH 1X3GA 3F2CA 2WB1G 2HHHL 5HY6A 1B8AA 4QL5A 3DLLA 1PH8A 1LM0A 1JMCA 3CP0A 1YBYA 4YWMA 3ZJYC 1GO3E 1K9MC 3H0GG 2I5HA 3I4OA 4IPHA 5ELNA 1P16A 1SMXA 1Q1BA 4DR6Q 2GVAA 4A3FH 5JJIA 4C3JH 1CKNB 4LF4Q 4LF7L 3UDGA 2OCEA 2LSSA 3CC4A 4JI6Q 4JI5L 4HJ8A 1GKHA 1W3SA 1NMGA 4JI1Q 3G6EA 1NE3A 4APVA 1U5KA 1LUZA 4DV2Q 1CKOA 2LXJA 3EIVA 2CCZA 4QY7A 2JEAI 3TS2A 2EQSA 3HOXH 1HNWL 1SRUA 3STBC 4AQYL 5C44H 4JI0Q 2MFIA 2UUAL 3A5ZB 2KBNA 3EBEA 4UP7A 1Y1VG 4YY3L 3JAMi 1IBKQ 4LFCQ 3UE0A 5IYDG 2E5LL 4DR2Q 3UDIA 2IHEA 1IBLL 1SR3A 3J81i 3J81c 3HOYG 4DR4L 4JYAL 4DUYQ 3GTQH 3BZCA 4WJ4A 1TWHH 4YWLA 3T1YQ 4DV4Q 3HKZG 3S24A 5LMUL 3S1NH 2EXDA 3HKZE 3JAMc 4X64L 1K3RA 3AEVA 1IBML 4A93H 1P8LA 2A1AA 5C4XG 2L15A 1HNXL 4PZ7A 2YTXA 5IYBH 3IRBA 3PUXA 4A3IH 4LF6Q 3NELA 2R92G 1L2FA 2AWNA 1YITA 1WCMH 4DV6Q 4NXNQ 1KRSA 1J6QA 1VCIA 2JA6G 2JQOA 2CFMA 3T1HL 1Y14B 3D31A 3RZDH 1VQMA 3HOUH 4IPCA 3UE1A 1XNRL 1MKHA 2VS1A 4B3ML 4R1JA 4LFBL 5IP9G 1XPOA 4P75A 4L5SA 2R6GA 3G48A 3D0FA 3M85A 4DUZL 4RMFA 1PH6A 1VQ5A 3PCOB 2R7ZG 3CQZH 4GLXA 4OWWB 3CMEA 4B3TQ 3I4MH 1IYJB 1O7IA 1XMOQ 2KENA 1VQAA 4A3KG 2I5LX 4BXXG 1VQ4A 4JI8L 1HNZL 3GTGH 1VQ9A 3GTOH 5JEAG 4A3GH 1EIFA 2IX0A 2HHHQ 5GAHC 2HIVA 1YJ9A 5GAEC 2IY5B 1SLJA 2Z6KA 4A3JG 2IT1A 1EIYB 4A3CH 2R7DA 1M1KC 4C2MH 2IHFA 3PO2H 4JG2A 1EQRA 2RHSB 1L0WA 3ER0A 1J5EQ 4NB3A 3STBD 2F4VL 1CSQA 2ZTDA 4LF8L 4LF7Q 4BBRH 5M3FG 1BKBA 5EAYA 3PUYA 4JI6L 1C0AA 3GTLH 2JJQA 4X65L 2UUCL 3F1ZA 2NZHA 4OO1G 1JJCB 3GO5A 4OONA 3SGIA 4GN3B 4R4QA 3ULJA 1ASYA 4QQBX 2RCNA 3EN2A 4NXML 3CPFA 4XIGS 2AHOB 4BBRG 4A4IA 4B3SL 2ZJRA 1A62A 2WFWA 4X6AH 2UUBL 1I5FA 4IPGA 1YIJA 4AQYQ 1PA6A 1N34L 2AKWB 2JA7H 2ID0A 1EFWA 2ATWA 4BBSG 1PVOA 1LYLA 5BR8L 3M4OH 1IBKL 3NENA 1K73C 3KOJA 4YY3Q 3CPWA 1L1OA 4JOIA 1YHQA 2JE6I 4AYBG 3DM3A 1K8AC 4DR2L 1VQLA 1N33L 2UXCQ 1JJGA 4JC0A 4LUVA 4UP9A 1XMQQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ASZ A;  2R93 H;  1IL2 A;  2NVX H;  2Y0S E;  4DUY L;  3FHW A;  4R4I A;  5HGQ A;  3RNU A;  4DV1 Q;  1YJW A;  3T1Y L;  4BBS H;  4DV4 L;  4A3L H;  2JA7 G;  4BA2 I;  3M4Q A;  4IO9 A;  5IP7 G;  1EYG A;  2UU9 L;  4OXP A;  4B3R Q;  3W5O A;  3ULP A;  3S17 H;  1HNX Q;  1QUQ B;  1VQI A;  1YHB A;  4HJA A;  5C0X G;  1NBW A;  2I0Q A;  1UEB A;  2HIX A;  4YCW A;  2ASB A;  5M5Y H;  2IX1 A;  4Y52 H;  2KHJ A;  2A19 A;  2NN6 I;  3KDF B;  3LGJ A;  4DV6 L;  4DNI A;  3E9H A;  3MEF A;  1OTC A;  2K50 A;  3J80 c;  1X65 A;  1WI5 A;  1Q82 C;  5LMN W;  1M90 C;  3K8A A;  5IYB G;  4UY8 C;  4JV5 Q;  3S15 H;  3FP9 A;  4DAM A;  1VQN A;  2OQ0 A;  1QVF A;  1X56 A;  4B3M Q;  4DR7 Q;  1JJ2 A;  1G51 A;  4KHP L;  3AFQ A;  1OXU A;  2NVY H;  4JI7 Q;  1Y1W H;  4TQU S;  4A3E G;  1BBU A;  4LF6 L;  2GN5 A;  3CW2 C;  4BXX H;  4O0A A;  1K83 H;  3M9B A;  1L1O B;  1YI2 A;  3G4S A;  1XJV A;  4NPS A;  5GAD C;  2R7Z H;  1HNZ Q;  2FXQ A;  3GDE A;  3W1G A;  4IOC A;  4A76 A;  4GS3 A;  4X66 Q;  2JEB I;  1B70 B;  1TXY A;  5C44 G;  2MQH A;  2BH8 A;  2JA9 A;  2WB1 E;  5LMN Q;  4BY1 H;  4GKK Q;  4QJF A;  4DKA C;  2QA4 A;  4DR5 Q;  4DV0 Q;  3CCM A;  1S40 A;  3HOV H;  2MO0 A;  3A0J A;  2K5N A;  3RN5 A;  2VQF L;  3CCE A;  4KI0 A;  2VQE L;  4ALP A;  5J3B A;  4TVA B;  1KAW A;  3TS0 A;  1YZ6 A;  4JOI C;  2E2H H;  1V1Q A;  3GTK H;  4LUO A;  5C4J H;  1NTG A;  1VQD A;  1UWV A;  1D8L A;  1KRT A;  1N32 L;  2PI2 E;  3PSI A;  1N36 L;  1G6P A;  1A63 A;  1WJJ A;  2KHI A;  1I50 H;  4A93 G;  4DR6 L;  1EQQ A;  2YU9 H;  3K7A H;  4IJL A;  3OTO L;  1A8V A;  2UUB Q;  4L5R C;  4POG A;  1N34 Q;  4DV5 L;  1TWG H;  4MNO A;  2VUM G;  4WJ3 M;  3I56 A;  1UE5 A;  1Q86 C;  2OWO A;  5BR8 Q;  1A0I A;  1FVI A;  4JI1 L;  1PH4 A;  3M4P A;  1VQJ A;  3H3V I;  5GQO A;  4QGU A;  4YWK A;  3U4Z A;  3HOZ H;  2ZTC A;  2DUD A;  3I4M G;  1SE8 A;  4O2D A;  3K7U C;  3WWV A;  1PH1 A;  3PF5 A;  1HNW Q;  3AQQ A;  4FDB A;  4X62 L;  3K81 C;  4JI0 L;  2AWO A;  1Q81 C;  2Z6K C;  1Y1V H;  1N8R C;  2VW9 A;  2B3G A;  4XTC S;  5IY0 A;  4LFC L;  4DK6 C;  5AJ3 L;  4HIO A;  2ZM6 L;  5FJ8 H;  1OXS C;  4R4C A;  2QEX A;  2N8N A;  4LNQ A;  4BY7 H;  1AE2 A;  4K0K L;  3BJU A;  3KDF A;  3S14 H;  3PUZ A;  1SRO A;  1SFO H;  2R93 G;  4LFA L;  2GVB A;  4YCV A;  1LTL A;  1WFQ A;  3I55 A;  1EOV A;  4BY1 G;  1QUQ A;  1YHA A;  1PYB A;  1Z47 A;  2CQO A;  3HKS A;  3AFP A;  4JCV E;  3GTJ H;  2Q2U A;  4JYA Q;  3A5U A;  4GLA C;  4A3D G;  1I6H H;  3S2D H;  4A3M H;  1OXV A;  1PH5 A;  5IWA L;  1VQG A;  5LMU Q;  3PF4 A;  4GNX C;  2VZA A;  4P71 A;  4X64 Q;  4JV5 L;  1IBM Q;  3ULL A;  3H3V H;  1U0L A;  1KXL A;  3H0G H;  3K0X A;  4JI4 Q;  2UXB Q;  4EX5 A;  3GD7 A;  4LF5 L;  5C0X J;  2UXD L;  1YNX A;  2CKZ B;  1X3F A;  4JI7 L;  2VUM H;  4OWT B;  1T9H A;  2BA1 A;  1BVS A;  5M5W H;  1XNQ L;  1WYD A;  2YV5 A;  2K4K A;  1OXT A;  5M3M H;  1TWC H;  3PV0 A;  5IYC G;  1KIX A;  1HZ9 A;  3S2H H;  4A3M G;  4A3D H;  3CCJ A;  1E1T A;  4KLK A;  4IFD G;  1TWF H;  2Y0S G;  4HJ5 A;  1PH3 A;  3E0E A;  1HZA A;  3KJO A;  3CCV A;  2RF4 A;  1VQB A;  4H02 A;  4DV0 L;  2ZJQ A;  3RLF A;  1VQ6 A;  5C3E H;  1YVC A;  3AYH B;  5IP7 H;  1PFS A;  3CCL A;  3S1Q H;  1GM5 A;  3PO2 G;  1HH2 P;  3PUV A;  4DPG A;  2K75 A;  1Q1E A;  1N32 Q;  4A3C G;  1E7Z A;  5K36 G;  4DV2 L;  1KQS A;  4GKJ Q;  1HZB A;  1IXR A;  3Q8D A;  1J5E L;  3L0O A;  3CXC A;  2F4V Q;  3OW2 A;  4HJ9 A;  3VDY A;  2JA5 G;  3OTO Q;  1NJI C;  1X9N A;  4DV5 Q;  3RZO H;  3G71 A;  1YJN A;  3MXN B;  4DV7 Q;  2R7F A;  4X65 Q;  1Y1W G;  2NVT H;  3GTP H;  4HIM A;  4C3H H;  2NZO A;  4A75 A;  1X3E A;  4GOP A;  1UE6 A;  2ZJP A;  2XGT A;  4J15 A;  2B63 G;  1E3P A;  1FGU A;  3L7Z C;  3I4N G;  2ALY B;  1FJG L;  2Q2T A;  5IP9 H;  4GOP C;  2K5H A;  4NXM Q;  3PGZ A;  4B3S Q;  3S1M H;  2WP8 J;  1IBL Q;  2N49 A;  1MJE A;  3FKI G;  4IFD I;  5ELO A;  1VQF A;  4DR4 Q;  2E2J H;  4OWX B;  1W2B A;  3KJP A;  1I94 Q;  1VQ8 A;  5IT9 c;  4L5T A;  5AJ3 Q;  1QZH A;  1WCM G;  1RL2 A;  2JK8 A;  3M3Y H;  2R92 H;  2UXC L;  3CD6 A;  2YTV A;  1N33 Q;  4A3B H;  4K0K Q;  2OQK A;  4DR3 L;  4YHH Q;  1PHJ A;  4Y7N H;  1K8G A;  2HT1 A;  4LFA Q;  3J80 i;  4POF A;  2F3I A;  3JC6 6;  4A3L G;  3CCU A;  3I4N H;  3U4V A;  3TRZ A;  1S72 A;  4DV1 L;  4A3J H;  3KYH C;  4NXN L;  5C0X I;  3CC2 A;  5JJK A;  1KD1 C;  5IWA Q;  1NY4 A;  3T1H Q;  2YTY A;  1X55 A;  2NN6 G;  4IPD A;  3S16 H;  4OO1 I;  1EWI A;  3CF5 A;  2NVQ H;  2I5M X;  4B3R L;  4YCU A;  1PH9 A;  1XNR Q;  2PMZ E;  4DR1 Q;  4JI4 L;  2UXB L;  1QVC A;  4JI3 L;  5GAG C;  3PIO A;  4A3E H;  1PH7 A;  1Z9F A;  3RLO A;  1Q12 A;  4OX9 Q;  3F2D A;  2BH2 A;  2VNU D;  1E22 A;  3J81 j;  4JBJ A;  1HR0 W;  2RHQ B;  3CCS A;  1VQH A;  3PO3 H;  3KF6 B;  1VQE A;  4PG3 A;  2CWA A;  4AYB E;  4LF9 Q;  3A74 A;  5C3E G;  2VL6 A;  2EIF A;  1OXX K;  1XNQ Q;  3TRE A;  2PI2 A;  4GN4 B;  3HOX G;  1VQC A;  4DV3 L;  2OTL A;  1Q8K A;  4JBM A;  2Q2H A;  3K80 C;  4IJH A;  1DGS A;  2BA0 A;  4EQ5 A;  4DR7 L;  3PUW A;  4UPA A;  2JA6 H;  4KHP Q;  3F2B A;  4IFD J;  4JI2 Q;  1S3O A;  5M5X H;  3U50 C;  5M3F H;  1I3Q H;  4MTN A;  1XTD A;  1B7Y B;  1HJP A;  4R4O A;  2N78 A;  4LF8 Q;  3B6Y A;  3NBH B;  5C4X H;  3H15 A;  3RR5 A;  1AH9 A;  2C35 B;  2MNA A;  1BBW A;  2HQL A;  4PZ8 A;  2UUC Q;  3I2Z A;  1CKN A;  3BZK A;  3L2P A;  4DAY B;  2B63 H;  3UDX A;  3CCQ A;  2OTJ A;  1QVG A;  3TEH B;  4A3G G;  3OYY A;  4GKJ L;  5FLX c;  3NEM A;  4HJ7 A;  4AIM A;  4DR5 L;  4AH6 A;  3CCR A;  4LF4 L;  2VQF Q;  5JJL A;  2VQE Q;  4P73 A;  2KCT A;  4KHZ A;  4P72 A;  4DV7 L;  4HIK A;  5IE8 A;  4JI5 Q;  3KFU A;  5IYD H;  2A8V A;  4BA1 I;  3KLW A;  4GN5 A;  3UDF A;  2QGQ A;  2B29 A;  1N36 Q;  4LWC A;  2E8G A;  4MZ9 A;  1FJG Q;  2VY3 A;  4LW1 A;  2V1C C;  1PYS B;  4L5Q A;  2PQA B;  2ES2 A;  1C9O A;  1XMQ L;  4GKK L;  1TWA H;  2Z0S A;  2D62 A;  5JEA J;  1I94 L;  2UUA Q;  1KHI A;  4P74 A;  1JE5 A;  3E9I A;  4DK3 C;  2KCM A;  4PMW A;  2WAQ G;  1FL0 A;  1SN8 A;  4GNX A;  1RIP A;  4A3I G;  5E7N A;  1KC8 C;  2E5L Q;  3W1B A;  2UU9 Q;  4DR3 Q;  1D7Q A;  1L1O C;  3KF6 A;  4YHH L;  1Q7Y C;  1N9W A;  2F52 A;  3ERS X;  3KF8 B;  2WAQ E;  1GD7 A;  4C3I H;  2YYZ A;  1NMF A;  2K52 A;  1Q46 A;  3J7A 5;  1VS0 A;  4X62 Q;  3PO3 G;  2XTI A;  3HOW H;  1JB7 A;  1HZC A;  3I7F A;  1JT8 A;  2MO1 A;  1MIU A;  1H95 A;  2LXK A;  4HID A;  1X6O A;  3S1R H;  2ZM6 Q;  1XPR A;  4QIW E;  1HR0 L;  3HOY H;  3HOW G;  2D0P A;  2JA5 H;  1PH2 A;  1C7Y A;  3HFZ B;  2DGY A;  3BU2 A;  4DR1 L;  4JI3 Q;  5FLM G;  4OX9 L;  5H1S E;  4JBK A;  1E1O A;  3J7Z C;  1EUJ A;  1AE3 A;  2Q2I A;  1VQK A;  3ICE A;  3CMA A;  2ZTE A;  1G29 1;  4UP8 A;  2H5X A;  2CWP A;  4PZ6 A;  2PNH A;  1QZG A;  2K14 A;  2E2I H;  1V43 A;  1CKM A;  4JBW A;  4ME3 A;  4GNX B;  1PV4 A;  1VQ7 A;  1UE1 A;  1K0R A;  4RG1 A;  4LF9 L;  1E24 A;  1CSP A;  3HOU G;  4A3K H;  2JA8 H;  4A3B G;  1GVP A;  2N3S A;  2JA8 G;  4DV3 Q;  1R9T H;  3HOV G;  4BY7 G;  2D0O A;  3F8T A;  5FJ8 G;  5GRO A;  3CAM A;  3PIP A;  4LF5 Q;  1UE7 A;  2PQA A;  4LFB Q;  4GLV B;  2UXD Q;  1KL9 A;  1VQP A;  4X66 L;  1YEZ A;  1CUK A;  1IZ6 A;  2K5V A;  3RN2 A;  1XPU A;  4JI2 L;  1V9P A;  4DUZ Q;  3FKI H;  3M7N A;  2AMC B;  1VQO A;  5M3M G;  5IYC H;  5LMN L;  1WOC A;  4IOA A;  1MJC A;  1X54 A;  5DLQ E;  5FLM H;  4B3T L;  1XMO L;  3RLN A;  4A3F G;  1HR0 Q;  4LUZ A;  4GOP B;  4R4T A;  3HOZ G;  3TQY A;  4JI8 Q;  3CC7 A;  3U58 A;  3GTM H;  1X3G A;  3F2C A;  2WB1 G;  2HHH L;  5HY6 A;  1B8A A;  4QL5 A;  3DLL A;  1PH8 A;  1LM0 A;  1JMC A;  3CP0 A;  1YBY A;  4YWM A;  3ZJY C;  1GO3 E;  1K9M C;  3H0G G;  2I5H A;  3I4O A;  4IPH A;  5ELN A;  1P16 A;  1SMX A;  1Q1B A;  4DR6 Q;  2GVA A;  4A3F H;  5JJI A;  4C3J H;  1CKN B;  4LF4 Q;  4LF7 L;  3UDG A;  2OCE A;  2LSS A;  3CC4 A;  4JI6 Q;  4JI5 L;  4HJ8 A;  1GKH A;  1W3S A;  1NMG A;  4JI1 Q;  3G6E A;  1NE3 A;  4APV A;  1U5K A;  1LUZ A;  4DV2 Q;  1CKO A;  2LXJ A;  3EIV A;  2CCZ A;  4QY7 A;  2JEA I;  3TS2 A;  2EQS A;  3HOX H;  1HNW L;  1SRU A;  3STB C;  4AQY L;  5C44 H;  4JI0 Q;  2MFI A;  2UUA L;  3A5Z B;  2KBN A;  3EBE A;  4UP7 A;  1Y1V G;  4YY3 L;  3JAM i;  1IBK Q;  4LFC Q;  3UE0 A;  5IYD G;  2E5L L;  4DR2 Q;  3UDI A;  2IHE A;  1IBL L;  1SR3 A;  3J81 i;  3J81 c;  3HOY G;  4DR4 L;  4JYA L;  4DUY Q;  3GTQ H;  3BZC A;  4WJ4 A;  1TWH H;  4YWL A;  3T1Y Q;  4DV4 Q;  3HKZ G;  3S24 A;  5LMU L;  3S1N H;  2EXD A;  3HKZ E;  3JAM c;  4X64 L;  1K3R A;  3AEV A;  1IBM L;  4A93 H;  1P8L A;  2A1A A;  5C4X G;  2L15 A;  1HNX L;  4PZ7 A;  2YTX A;  5IYB H;  3IRB A;  3PUX A;  4A3I H;  4LF6 Q;  3NEL A;  2R92 G;  1L2F A;  2AWN A;  1YIT A;  1WCM H;  4DV6 Q;  4NXN Q;  1KRS A;  1J6Q A;  1VCI A;  2JA6 G;  2JQO A;  2CFM A;  3T1H L;  1Y14 B;  3D31 A;  3RZD H;  1VQM A;  3HOU H;  4IPC A;  3UE1 A;  1XNR L;  1MKH A;  2VS1 A;  4B3M L;  4R1J A;  4LFB L;  5IP9 G;  1XPO A;  4P75 A;  4L5S A;  2R6G A;  3G48 A;  3D0F A;  3M85 A;  4DUZ L;  4RMF A;  1PH6 A;  1VQ5 A;  3PCO B;  2R7Z G;  3CQZ H;  4GLX A;  4OWW B;  3CME A;  4B3T Q;  3I4M H;  1IYJ B;  1O7I A;  1XMO Q;  2KEN A;  1VQA A;  4A3K G;  2I5L X;  4BXX G;  1VQ4 A;  4JI8 L;  1HNZ L;  3GTG H;  1VQ9 A;  3GTO H;  5JEA G;  4A3G H;  1EIF A;  2IX0 A;  2HHH Q;  5GAH C;  2HIV A;  1YJ9 A;  5GAE C;  2IY5 B;  1SLJ A;  2Z6K A;  4A3J G;  2IT1 A;  1EIY B;  4A3C H;  2R7D A;  1M1K C;  4C2M H;  2IHF A;  3PO2 H;  4JG2 A;  1EQR A;  2RHS B;  1L0W A;  3ER0 A;  1J5E Q;  4NB3 A;  3STB D;  2F4V L;  1CSQ A;  2ZTD A;  4LF8 L;  4LF7 Q;  4BBR H;  5M3F G;  1BKB A;  5EAY A;  3PUY A;  4JI6 L;  1C0A A;  3GTL H;  2JJQ A;  4X65 L;  2UUC L;  3F1Z A;  2NZH A;  4OO1 G;  1JJC B;  3GO5 A;  4OON A;  3SGI A;  4GN3 B;  4R4Q A;  3ULJ A;  1ASY A;  4QQB X;  2RCN A;  3EN2 A;  4NXM L;  3CPF A;  4XIG S;  2AHO B;  4BBR G;  4A4I A;  4B3S L;  2ZJR A;  1A62 A;  2WFW A;  4X6A H;  2UUB L;  1I5F A;  4IPG A;  1YIJ A;  4AQY Q;  1PA6 A;  1N34 L;  2AKW B;  2JA7 H;  2ID0 A;  1EFW A;  2ATW A;  4BBS G;  1PVO A;  1LYL A;  5BR8 L;  3M4O H;  1IBK L;  3NEN A;  1K73 C;  3KOJ A;  4YY3 Q;  3CPW A;  1L1O A;  4JOI A;  1YHQ A;  2JE6 I;  4AYB G;  3DM3 A;  1K8A C;  4DR2 L;  1VQL A;  1N33 L;  2UXC Q;  1JJG A;  4JC0 A;  4LUV A;  4UP9 A;  1XMQ Q; 
#chains in the Genus database with same CATH topology
 1E2V A;  4N8X 1;  4R4I A;  4DV1 Q;  4BBS H;  4DV4 L;  4EGV A;  4HSP A;  1TS2 A;  3IKJ A;  5IP7 G;  1EYG A;  1W6J A;  2IX3 A;  2HCC A;  2XNA C;  3ULP A;  3ND9 A;  5EKK A;  2VB2 X;  1VQI A;  5M5Y B;  1NBW A;  5T1I A;  1UEB A;  2HIX A;  2Z9H A;  3M7G A;  4OO1 H;  3NE5 B;  2A19 A;  3TP5 A;  3F2U A;  1OTC A;  2L55 A;  3MXU A;  4IUP A;  2K50 A;  1X65 A;  5EPL A;  5LMN W;  4C3H B;  1M90 C;  5E1F A;  2KHS A;  1VQN A;  1SEB D;  1NNX A;  3J81 L;  1BBX C;  1X56 A;  3FPU B;  4GZY C;  1DOK A;  1OXU A;  3GTM B;  1Y1W H;  1ET6 A;  1BBU A;  2F0M A;  3SVM A;  3M9B A;  3G4S A;  5ELB A;  1EY6 A;  1WTW A;  2A6H C;  1HNZ Q;  4GS3 A;  4X66 Q;  2EPB A;  2JEB I;  4IQZ A;  1EY7 A;  1PFN A;  2MQH A;  2JA9 A;  2WB1 E;  4DKA C;  4DR5 Q;  2R93 H;  2MO0 A;  1HR0 L;  2K5N A;  4KI0 A;  4ALP A;  2E2H B;  5J3B A;  5C5L A;  1YZ6 A;  4CKE A;  5C4J H;  1N36 L;  1A63 A;  1WJJ A;  3VR5 A;  2QW7 A;  1YNJ C;  2UUB Q;  1BCP B;  2Z8L A;  2VUM G;  5M5W B;  2X69 A;  2OWO A;  4WJ3 M;  3Q0A A;  1FVI A;  1I4Q A;  1BXT A;  2EYL A;  5AFW A;  4YWK A;  3HOZ H;  4M1U B;  1SE8 A;  2CVR A;  3A8J E;  4V19 0;  3VA5 A;  1G2S A;  4FDB A;  2AWO A;  1MSH A;  2F0Q A;  3FPP A;  5FO7 B;  1N8R C;  2PO4 A;  4LFC L;  2TMP A;  1RTN A;  3E3X A;  5CBA E;  3PUZ A;  2R93 G;  3KLS A;  3J80 L;  3DM1 A;  1YHA A;  1PYB A;  3NUC A;  4K8J A;  5M9O A;  4JYA Q;  1EY8 A;  1JR0 D;  2JA6 B;  2PW7 A;  3IFD A;  4GNX C;  4IAL A;  4P71 A;  4JV5 L;  1RD9 D;  3H3V H;  1KXL A;  2WB1 B;  3H0G H;  4RFB A;  4ZAI A;  1NR2 A;  4LF5 L;  3OHX C;  2AUK A;  2NYZ D;  2UXD L;  1LTG D;  1YNX A;  3CKI B;  3TZD A;  5K5P A;  1FNW A;  1D2B A;  1QJO A;  5M5W H;  1XNQ L;  5IYC G;  4K6L A;  5D14 A;  3LWE A;  4A3M G;  1F2Z A;  4IFD G;  2RSO A;  1V1P A;  3KJO A;  3HZX A;  1VQB A;  3AB9 A;  4DV0 L;  1GUG A;  2KCN A;  4OIK A;  5A2Q E;  3AYH B;  5IP7 H;  2VUM B;  1GM5 A;  1SNC A;  5K36 G;  3U9S A;  5C5M A;  2MPM A;  5NUC A;  2A6E C;  3EQL C;  1WTX A;  3CXC A;  2D9U A;  2ZT9 C;  1X9N A;  3MXN B;  1Z7T A;  3VYU A;  1GHJ A;  1KDB A;  2ZJP A;  3K5O A;  3P1H A;  3GTJ B;  2ALY B;  1VMC A;  3PGZ A;  4F7X A;  3VR6 A;  1IBL Q;  4WJW A;  4CGY B;  2K32 A;  1VQF A;  1EWH A;  1W2B A;  1I94 Q;  4O42 A;  3TZU A;  2O5I C;  4A3B H;  2PQE A;  3CRL C;  5M5X B;  4WOR A;  2XN9 C;  3I4N H;  1S72 A;  5IGB A;  4NXN L;  1D1I A;  2O2L D;  3T1H Q;  2YTY A;  1O7Y A;  4R8I A;  1PRT D;  4B3R L;  1XNR Q;  1QVC A;  4LAA A;  1SSO A;  2RHQ B;  1U4R A;  3QWN A;  2NWG A;  3KF6 B;  1VQE A;  1LTB D;  4LF9 Q;  1NSN S;  3A74 A;  2EIF A;  1XNQ Q;  3TRE A;  3HOX G;  4K5X A;  2PZW A;  1WD1 A;  1VQC A;  2OTL A;  2Q2H A;  3K80 C;  3X3M A;  1SND A;  3PUW A;  4UPA A;  1EL0 A;  4ME5 A;  5M3F H;  1B7Y B;  4R4O A;  4Z9C B;  5C4X H;  1K83 B;  3RR5 A;  4DK0 A;  2C35 B;  2MNA A;  2HQL A;  1Q3L A;  2UUC Q;  1CKN A;  4DAY B;  5EJW A;  2E2J B;  3UDX A;  4KTA A;  2F0N A;  3MVV A;  4K5V A;  2OTJ A;  5JEA H;  3OYY A;  2BDN A;  3DMU A;  4A3G B;  4HJ7 A;  4EQP A;  1G2T A;  3RZD B;  4KKS A;  1NCV A;  4KV6 A;  3KLW A;  3NBH A;  4GN5 A;  2B29 A;  1N36 Q;  2E8G A;  1UAP A;  2XVS A;  3H0G B;  1PYS B;  4L5Q A;  1C9O A;  1I50 B;  1NR4 A;  4QB4 A;  3JAM E;  4ZKB B;  1ZXT A;  1JE5 A;  4A3I G;  4DK3 C;  1HPC A;  4K2L A;  1RIP A;  3QG1 A;  3S2D B;  3W1B A;  1RHP A;  4DR3 Q;  1L1O C;  3KF6 A;  3PO3 B;  1N9W A;  2YYZ A;  1NMF A;  5EBD A;  1XYI A;  3J7A 5;  1VS0 A;  3P7J A;  4K8I A;  4RGM A;  1QOH A;  1JB7 A;  1IW7 C;  1TS4 A;  3NSW A;  3MEH A;  4A3D B;  2LXK A;  4K5W A;  1X6O A;  4K14 A;  4KY5 A;  5ISR A;  4JI3 Q;  5H1S E;  2B39 A;  1G91 A;  3KF8 A;  1EUJ A;  1AE3 A;  1VQK A;  3HKZ B;  5D65 A;  2H5X A;  2CWP A;  1QZG A;  1ENF A;  1EZ8 A;  2K14 A;  2B2W C;  4K2K A;  4LF6 Q;  4A3B B;  2NZ1 D;  1UE1 A;  4IUV A;  4G57 A;  1GVP A;  2JA8 G;  3LWU A;  3HOV G;  4BY7 G;  1KTK A;  1DOM A;  3SE0 A;  5GRO A;  3PIP A;  1K28 A;  4LFB Q;  4KD4 A;  2V4D A;  1LT4 D;  1VQP A;  1YEZ A;  4JI2 L;  2BCO A;  1SNO A;  5IYC H;  4IOA A;  1WOC A;  2F0F A;  4HCS A;  2OEO A;  5DLQ E;  1O7Z A;  5FLM H;  4XYQ A;  2WAC A;  4A3F G;  4IUU A;  4FNF A;  5HGT A;  3U58 A;  4JI8 Q;  2E76 C;  3MXN A;  3F2C A;  1JMC A;  1YBY A;  5F2D A;  2NVX B;  3H0G G;  5CV7 A;  4R8N A;  2GVA A;  4C3J H;  2ICE C;  1XX8 A;  4LF7 L;  2OCE A;  4I65 A;  2F0D A;  1F2L A;  1V1O A;  4JI1 Q;  4A3I B;  2LXJ A;  3J80 E;  2CCZ A;  1V1P B;  3TS2 A;  2EQS A;  3QOJ A;  1EY4 A;  1SAP A;  2KED A;  3HOX H;  3STB C;  2WKC A;  4AQY L;  4DN4 M;  1IBK Q;  3EBE A;  4UP7 A;  1EY0 A;  4LFC Q;  1WCM B;  3JAM i;  3NHH A;  3UE0 A;  5IYD G;  3PMF A;  2EE1 A;  3UDI A;  1GUW A;  1GXD C;  5BN4 A;  3BG3 A;  4Q0F A;  2E2D C;  3ERQ A;  3I73 A;  4DR4 L;  3BZC A;  3TDQ A;  3DWP A;  3HOY B;  3S24 A;  5LMU L;  2EXD A;  3FRP B;  5A35 A;  5CV4 A;  1M4V A;  3AEV A;  4IUT A;  2L15 A;  1HTP A;  3P20 A;  1HNX L;  3IRB A;  2CW0 D;  2HDL A;  3KUP A;  3NEL A;  2AWN A;  5EBC A;  1YIT A;  1LT5 D;  1RDP D;  1B44 D;  2JP1 A;  4K6D A;  4IUR A;  2BE5 C;  4RGN A;  1ENC A;  1I6V C;  3HOU H;  1TVX A;  3RZD H;  5IGD A;  1R9T B;  3C3L A;  4A3F B;  3HRZ C;  2RDF A;  5IGC A;  1SYF A;  4FF2 A;  1EFI D;  2F3V A;  5KYI A;  4DNT B;  3PCO B;  4A3K B;  2MHV A;  2AQ2 B;  2K03 A;  1KAB A;  1IYJ B;  1O7I A;  3SK5 A;  2KEN A;  4CKB A;  1A3T A;  4ABN A;  1Z6H A;  3QIA A;  5JOB A;  3SXH A;  2FJ2 A;  4C2M H;  4JG2 A;  5CV5 A;  2RHS B;  1J5E Q;  3ER0 A;  5LL6 X;  5EPK A;  1MD2 D;  4FO2 A;  3NWT A;  2K6A A;  4BBR H;  1B50 A;  3DXJ C;  3GTL H;  4X65 L;  2DNE A;  3F1Z A;  2NZH A;  3S9W A;  4OO1 G;  4OON A;  4XDX A;  1STA A;  4GN3 B;  3ULJ A;  4RKL A;  4BBR G;  1LT3 D;  4A4I A;  4B3S L;  2M9V A;  2UUB L;  1E2Z A;  1N34 L;  2JA5 B;  1PVO A;  1DM0 B;  4KHV A;  3QO2 A;  4BBS G;  3KOJ A;  2JE6 I;  3DM3 A;  4TSS A;  4DR2 L;  3I4L A;  4JC0 A;  2R3Z A;  2M2L A;  5I9P A;  4LUV A;  1W6K A;  5DNF A;  3R2I A;  3E0J A;  3A8I E;  1LT6 D;  3RNU A;  4I7A A;  1YJW A;  2K33 A;  3FDT A;  3URY A;  4BA2 I;  3HOX B;  3M4Q A;  4IO9 A;  3N52 A;  1U4P A;  2EY6 A;  1JIC A;  4L63 B;  3IAY A;  2I0Q A;  1CA6 A;  1ML0 D;  5M5Y H;  2KHJ A;  2HCI A;  4PV1 C;  2D2C C;  3GV3 A;  4Q5V A;  4B9X A;  4JV5 Q;  2A6E D;  1PZJ D;  5I9O A;  2C5C A;  3VYR A;  1X3Q A;  1SJE D;  3HP3 A;  4CDC C;  1G51 A;  4KHP L;  5C4Z A;  4ZUJ A;  4JI7 Q;  5EPJ A;  4C3I B;  3CRK C;  2O4X A;  5EKL A;  1VF5 C;  1K83 H;  2QDB A;  1XJV A;  4NPS A;  5GAD C;  3T56 B;  5FOB B;  3GDE A;  2FMC A;  4F88 A;  3S16 B;  1JWM D;  1HXY D;  4F87 A;  1TXY A;  1KNA A;  2BH8 A;  5LMN Q;  2KA7 A;  1A6X A;  3A0J A;  3CCE A;  1K3B C;  2VQE L;  1ILQ A;  4TVA B;  1KAW A;  1MBY A;  4JOI C;  3VR3 A;  1V1Q A;  2F0S A;  3GTK H;  5DM7 3;  1ESR A;  1D8L A;  1UWV A;  1CT1 D;  2PI2 E;  3K59 A;  1DOL A;  4RGO S;  3AMU A;  1I50 H;  1E0B A;  5LHY 1;  3SHL A;  2WIN B;  3K7A H;  4IJL A;  1A8V A;  1C4Q A;  4L5R C;  4DV5 L;  3OMG A;  3I56 A;  1UE5 A;  1LTT D;  1HUM A;  4JI1 L;  1BDO A;  3BDO A;  1VQJ A;  2ZTC A;  3VA7 A;  4O2D A;  1I4H A;  1HNW Q;  4X62 L;  3K81 C;  4JI0 L;  3V96 A;  1PMR A;  3TSS A;  2B3G A;  5AJ3 L;  1I6H B;  1AZP A;  2QEX A;  4CBV A;  4BY7 H;  3X3N A;  4RCN A;  1Y69 U;  4YCV A;  3H3V I;  1G6Z A;  1QUQ A;  3GTJ H;  2R92 B;  2R93 B;  1DZ1 A;  3SK6 A;  1I6H H;  1VQG A;  3PF4 A;  3A8K E;  2A68 D;  4X64 Q;  5CV6 A;  1FD7 D;  4DXG A;  1SMY D;  2XSC A;  2LKV A;  4EX5 A;  3GD7 A;  1EYC A;  2MP1 A;  4PMC A;  1IYV A;  1NAP A;  5CYU A;  3JAM L;  4XQN A;  3D6W A;  4M8A A;  2NVT B;  4OWT B;  1JOR A;  2L0C A;  5IIF A;  1T9H A;  4PMB A;  2BA1 A;  5EQ0 A;  3H91 A;  2Z1C A;  1OXT A;  5M3M H;  1TWC H;  1PTO H;  2YU9 B;  2N55 A;  3S2H H;  1HQM C;  1XTC D;  1E1T A;  4KLK A;  1RTO A;  2LFN A;  2Y0S G;  4HJ5 A;  2B2V C;  1HZA A;  3CCV A;  4H02 A;  3NP8 A;  2ZJQ A;  3BVG A;  3RLF A;  1EZ6 A;  1YVC A;  3PO2 G;  3PUV A;  1ZYR D;  3OSO A;  1D6E C;  1QNU A;  4DV2 L;  3FVQ A;  3NPP A;  1IXR A;  1WTH A;  3HS0 C;  3W3A A;  3ND8 A;  3VDY A;  2DY8 A;  1GUS A;  3H09 A;  4DV5 Q;  4DV7 Q;  2P5Z X;  2R7F A;  2XIW A;  3R93 A;  5I2Y A;  4X65 Q;  2RDG A;  3BYY B;  4A75 A;  4GOP A;  5G3L F;  1S5C D;  1E3P A;  3L7Z C;  1M8A A;  2Q8I B;  2K5H A;  4NXM Q;  5JAV A;  4N8F A;  1MJE A;  5JVH 3;  2DJG C;  4H44 C;  4ZLT F;  3FKI G;  1UNS A;  2E2J H;  4QCL A;  1VQ8 A;  4L5T A;  1EY5 A;  1RL2 A;  2R92 H;  4ILW A;  3CD6 A;  4K0K Q;  5E3F A;  4Y7N H;  2HT1 A;  2F3I A;  2K01 A;  3LX0 A;  4A3L G;  1BCP C;  3TRZ A;  4EQN A;  5C0X I;  3CC2 A;  5JJK A;  2F0U A;  2RA4 A;  1NY4 A;  2EJG C;  1X55 A;  5KRU A;  3C46 A;  4OO1 I;  1ENA A;  2NVQ H;  1ET9 A;  1EEF D;  4YIJ A;  4JI4 L;  1SNM A;  5FO9 B;  3K57 A;  5GAG C;  3OIP A;  3GTQ H;  2UXB L;  4CKC A;  1C8C A;  1Q12 A;  5ELC A;  4RA8 A;  1SBB B;  1E22 A;  1D5M C;  1STE A;  2K7V A;  4JBJ A;  4KY6 A;  4EVO A;  3CCS A;  3OIQ A;  3DEP A;  1IW7 D;  1SNQ A;  2B2T C;  4PG3 A;  1S5E D;  1AFP A;  2VL6 A;  1OXX K;  2EJF C;  2PI2 A;  4GN4 B;  1Q8K A;  1JOO A;  2BA0 A;  4DR7 L;  1SYC A;  3MZ5 A;  2JA6 H;  4KHP Q;  1VF7 A;  4QUF A;  5J39 A;  3GTK B;  1I3Q H;  1XTD A;  1HJP A;  1J8I A;  1SJH D;  3B6Y A;  3NBH B;  3H15 A;  4LF8 Q;  3BDC A;  1BBW A;  4PZ8 A;  1MHW C;  2AUJ D;  2G9D A;  1A2T A;  4GKJ L;  4C1N I;  3NEM A;  4AIM A;  3WOE A;  4E6I A;  2VQF Q;  2BE5 D;  2ZXR A;  2VQE Q;  4CDE C;  3J7A F;  3CHB D;  4P73 A;  4G7H C;  4KHZ A;  4P72 A;  4HIK A;  4JI5 Q;  1B2T A;  2QDL A;  2QGQ A;  5I4D A;  5JJZ A;  4MZ9 A;  2V1C C;  2LY7 A;  2SNS A;  3SK8 A;  2PQA B;  4BBR B;  1WTP A;  4GKK L;  1SE4 A;  2D62 A;  1B1Z A;  2UUA Q;  1HFG A;  1KHI A;  1TWC B;  4P74 A;  3S2H B;  4FVM A;  2CHB D;  2KCM A;  2WAQ G;  1FL0 A;  1KC8 C;  2E2I B;  5E7N A;  4QMG A;  1Q7Y C;  2K52 A;  4BY1 B;  3E6Z X;  1CQV A;  4KY7 A;  3PO3 G;  1QE6 A;  2O5J C;  5CC4 A;  2MO1 A;  1Y1V B;  3S1R H;  1XPR A;  3HOW G;  2D0P A;  2F0P A;  4ZYS A;  1C7Y A;  3MHB A;  2DGY A;  4DR1 L;  2EOT A;  3I4M B;  1QNK A;  1E1O A;  3J7Z C;  3ICE A;  2L11 A;  4KD3 A;  3CMA A;  1PXU A;  2ZTE A;  3S2D H;  1V43 A;  4ME3 A;  4GNX B;  1PV4 A;  1VQ7 A;  5KYL A;  4B9W A;  1CSP A;  3HOU G;  4DF7 A;  2N3S A;  2K28 A;  5EKI A;  4CDD C;  4LF5 Q;  1UE7 A;  4KN7 C;  2K5V A;  1V9P A;  1VQO A;  5LMN L;  2VXW A;  4UHV A;  1D1K A;  4ID6 A;  4RHS A;  4HCE A;  4LUZ A;  1GUT A;  4R4T A;  3HOZ G;  4FXG C;  1EU3 A;  2B8G A;  4QL5 A;  1CZG A;  2FIN B;  1DJR D;  2RSN A;  2DY7 A;  4IPH A;  1CHP D;  2Q8R E;  5JJI A;  1PTO C;  1CKN B;  4LF4 Q;  3DEO A;  2LSS A;  1TT2 A;  4JI5 L;  3TP6 A;  3G6E A;  4APV A;  1LAB A;  1U5K A;  1CKO A;  1OO9 B;  2WKD A;  2WAQ B;  4ZK9 B;  4QY7 A;  3RD4 A;  1L0Y B;  1SRU A;  1B4O A;  2MFI A;  1T5X D;  1QWY A;  1Y1V G;  2E5L L;  1EU4 A;  4C3J G;  2K1B A;  3G6J B;  4JYA L;  5FO8 B;  4DUY Q;  4RH6 A;  5J1Z A;  1TWH H;  4YWL A;  3T1Y Q;  1IHZ A;  1EYA A;  2EY1 A;  1STH A;  2OXP A;  2A1A A;  3HOU B;  4PZ7 A;  2NB0 A;  3PUX A;  5COY A;  1WCM H;  2L1B A;  4NXN Q;  3QJY A;  1J6Q A;  1VCI A;  1B9N A;  2VB3 X;  4IPC A;  2F0O A;  2B2Y A;  4H13 C;  2JXM B;  3BDL A;  4P75 A;  1STB A;  4UAI A;  1ICF B;  4HMJ A;  4C3H G;  1BCP D;  3IL8 A;  3CQZ H;  2R7Z G;  2BOS A;  3DUZ A;  3CME A;  4B3T Q;  3I4M H;  1XMO Q;  1R4P B;  3VR2 A;  4BXX G;  1QG7 A;  2NN6 H;  3GTO H;  1EIF A;  1H9K A;  5GAH C;  1YJ9 A;  5GAE C;  2IY5 B;  4IUQ A;  4A3J G;  4A3C H;  2R7D A;  2OF1 A;  4ZUI A;  2IHF A;  3A54 A;  1EQR A;  1PFM A;  1IKM A;  4NB3 A;  2F0E A;  3FEW X;  4XT1 B;  4LF8 L;  1BKB A;  3S1Q B;  4JI6 L;  2JJQ A;  1S4Z A;  2NTS A;  5M3F B;  3GTL B;  3KBG A;  3GO5 A;  1SMY C;  4R4Q A;  1ASY A;  2AHO B;  1HRJ A;  4CHT B;  2ZJR A;  4FF1 A;  1A62 A;  2F0I A;  4H0L C;  1AP0 A;  5T1G A;  4AQY Q;  2JA7 H;  4FXD A;  1EOT A;  1K73 C;  3GTG B;  2A69 C;  3C1F A;  3NK9 A;  3GP7 A;  3Q24 A;  1K8A C;  1VQL A;  1N33 L;  4A3K H;  5KEE A;  3FKI B;  2Z4I A;  4DUY L;  3FHW A;  3GQB A;  5HGQ A;  2F0K A;  3T1Y L;  4A3L H;  1H9M A;  1SYG A;  2M00 A;  3D4R A;  3HG9 A;  1VDZ A;  3S17 H;  4CJ1 B;  4LJZ C;  1DCZ A;  5C0X G;  3H6M A;  2ASB A;  3I70 A;  4Y52 H;  2IX1 A;  4C1N K;  4U67 3;  3LGJ A;  4DV6 L;  1Q82 C;  1WI5 A;  2JYO A;  1ESF A;  4HAE A;  4UY8 C;  1K0S A;  3S15 H;  1HA5 A;  3FP9 A;  2OQ0 A;  1K8M A;  4DR7 Q;  1JJ2 A;  2TSS A;  3AFQ A;  2K5W A;  2NVY H;  4TQU S;  4LF6 L;  2CW0 C;  2B2U A;  1STY A;  4O0A A;  2B2Y C;  3WOF A;  3IFT A;  3EA6 A;  3W1G A;  1Y8P B;  4IOC A;  3VYT A;  4RGT A;  4A76 A;  2A6H D;  1B70 B;  1KDC A;  4BY1 H;  1TS5 A;  3KK7 A;  1O7L A;  3CCM A;  4DV0 Q;  3HOV H;  3RN5 A;  2VQF L;  3MTS A;  2E2H H;  3I3C A;  1KRT A;  2DNC A;  4BY7 B;  1N32 L;  2XRQ D;  2ZXO A;  3PSI A;  1G6P A;  2F0T A;  1EY9 A;  3S1N B;  1B3A A;  4KKT A;  4A93 G;  2B2V A;  3MA2 B;  1BCP F;  2RCF A;  5C3X A;  1Q86 C;  5BR8 Q;  2ZXP A;  3HOW B;  3R3O A;  1A0I A;  3I8Z A;  1PH4 A;  1E2W A;  3M4P A;  5GQO A;  5DEH A;  3GV6 A;  3I4M G;  2PMZ B;  4R9W A;  1S5B D;  1TWG B;  2A5H A;  3PF5 A;  3AQQ A;  3OPO A;  3L9A X;  5K36 H;  2Z6K C;  5C4H A;  5L37 A;  5IY0 A;  3OMC A;  4DK6 C;  3MXP A;  4HIO A;  2ZM6 L;  5FJ8 H;  1OXS C;  2LMC B;  3NXW A;  2N8N A;  4LNQ A;  1EIG A;  1AE2 A;  2WV6 D;  3KDF A;  5IT9 L;  2F0J A;  1SRO A;  2GVB A;  1LTL A;  1WFQ A;  3I55 A;  1EOV A;  4BY1 G;  3CC7 A;  1Z47 A;  2CQO A;  4JCV E;  4ODG A;  4DAV A;  4GLA C;  4FP5 D;  4A3M H;  1PH5 A;  3D3R A;  5LMU Q;  1X3P A;  3RZO B;  2VZA A;  4KJN A;  4G7O C;  1IBM Q;  2EYJ A;  3ULL A;  4DAP A;  2UXB Q;  1BOS A;  1D5X C;  2CKZ B;  3T51 B;  1XXG A;  3GTQ B;  1VMP A;  1WYD A;  2YV5 A;  4X3T A;  2K4K A;  3PV0 A;  4HMI A;  3ITP A;  3NTK A;  3J7Y W;  2H4O A;  2RQX A;  1PH3 A;  4HN7 A;  3Q6S A;  2HQE A;  1EWC A;  5J22 A;  1PZK D;  1VQ6 A;  1WVL A;  4ZKC B;  3HOZ B;  3CCL A;  1PFS A;  3KBX A;  3DWQ A;  3S1Q H;  1HH2 P;  4DPG A;  3PO2 B;  1KQS A;  2F1M A;  4BWG B;  2KUM A;  3Q8D A;  1J5E L;  2NBF A;  3L0O A;  4DXF A;  4OEL B;  3OW2 A;  1H9J A;  4HJ9 A;  2JA5 G;  4JVZ A;  3OTO Q;  3BS1 A;  1NJI C;  2L12 A;  1JWS D;  4HIM A;  1BNZ A;  2EYM A;  2XGT A;  2B63 G;  1CQF A;  5C4X B;  3I4N G;  5IP9 H;  5ELD A;  2XWJ B;  1PRT F;  5BN5 A;  1RCV D;  1BQQ T;  2FFK B;  5ELO A;  2Z6B A;  3VR4 A;  4OWX B;  3KJP A;  3Q23 A;  1TU2 B;  1IL8 A;  3W2D A;  5JPM C;  1QZH A;  1O80 A;  4L6T B;  3M3Y H;  2UXC L;  1N33 Q;  2OQK A;  4DR3 L;  1HQR D;  1PHJ A;  1K8G A;  4LFA Q;  1A3V A;  1U9R A;  5D3I B;  2G9H D;  1EEI D;  4POF A;  3S17 B;  4DV1 L;  3NTI A;  1UUP A;  3KYH C;  4A3J H;  5IWA Q;  4BBS B;  2NN6 G;  1GUO A;  1SE3 A;  4IPD A;  3S16 H;  1EWI A;  3CF5 A;  2I5M X;  4S3S A;  1TWH B;  1PH9 A;  2J7Z A;  4AYB B;  4DR1 Q;  2SEB D;  4JI3 L;  3PIO A;  4IUN A;  2BH2 A;  1Z9F A;  2F0L A;  1DON A;  1C48 A;  3F2D A;  2X6L A;  2F0V A;  3PO3 H;  2NUC A;  5C3E B;  3C2P A;  5KNC A;  2JA7 B;  4JBM A;  1MI2 A;  2C9O A;  4IFD H;  4JI2 Q;  4MTN A;  3ERO A;  2RBM A;  1LO5 D;  3P75 A;  3HOV B;  1AZQ A;  3BZK A;  2F03 A;  5LL6 S;  3QOL A;  1RJT A;  1QVG A;  2LS0 1;  3KLS X;  5FLX c;  4PNY A;  1DXM A;  1WTO A;  3CCR A;  3SDZ A;  3R8B A;  4G7Z C;  2KCT A;  3KFU A;  3MC0 B;  1GJX A;  4BA1 I;  4B08 A;  3UDF A;  4TRD A;  2AQ3 B;  4LW1 A;  2FHT A;  4X3S A;  2ES2 A;  3O13 A;  1XMQ L;  1TWA H;  3T13 A;  3D8G A;  3TBI B;  5JEA J;  3HEJ A;  2Q8T A;  4G4K A;  2UU9 Q;  2KCC A;  1D7Q A;  4DNR B;  4YHH L;  1B53 A;  2WAQ E;  1GD7 A;  3T53 B;  4X62 Q;  3I7F A;  1JT8 A;  1LAC A;  1H95 A;  1PRT B;  1PTO B;  3Q22 A;  4HID A;  2D5D A;  3K7A B;  4QIW E;  2JA5 H;  1LV9 A;  1PH2 A;  4RAU C;  3BU2 A;  2K5Q A;  5KGU A;  4HED A;  1BO0 A;  4JBK A;  5FK9 C;  3BVZ A;  1A15 A;  2Q2I A;  3TME A;  4OWW B;  4PZ6 A;  2E2I H;  4JBW A;  1CKM A;  4LF9 L;  1K0R A;  1AW7 A;  5I2X A;  1TWF B;  1TR5 A;  2QKI C;  4XQQ A;  1R9T H;  2D0O A;  3F8T A;  2PQA A;  5G3L D;  2UXD Q;  1KL9 A;  1Q90 A;  3SR1 A;  2F3W A;  4X66 L;  1CUK A;  1IZ6 A;  5C4J B;  3RN2 A;  1XPU A;  1K8O A;  4DUZ Q;  3FKI H;  3M7N A;  1IYU A;  2AMC B;  1X54 A;  3SEB A;  3RLN A;  1XMO L;  1DD2 A;  1SNP A;  3MAQ A;  5HY6 A;  1B8A A;  1BR9 A;  2OT2 A;  1V8Q A;  4X3U A;  3DLL A;  1KDA A;  3M4O B;  3CP0 A;  3NTH A;  4YWM A;  3ZJY C;  1GO3 E;  2I5H A;  1SMX A;  1Q1B A;  4DR6 Q;  4A3F H;  4DAY A;  1HFN A;  4XQJ A;  4RWS C;  1Y1W B;  5IOC A;  4HJ8 A;  2PW5 A;  1W3S A;  1NMG A;  5IGF A;  4NDX A;  4DV2 Q;  1HCZ A;  1CK1 A;  5CBE E;  1JB3 A;  1HNW L;  1HUN A;  5C44 H;  4JI0 Q;  3KLR A;  2KBN A;  3ZYY X;  2A74 C;  4YY3 L;  1JOK A;  4DR2 Q;  1CZW A;  1LTI D;  2EY5 A;  3H3V C;  1GHK A;  3PIP 3;  2SOB A;  3CQZ B;  4F8M A;  2N88 A;  1JWU D;  1Y8N B;  4WJ4 A;  1ILP A;  2L5T A;  3NWS A;  4X3K A;  3S1R B;  4DV4 Q;  3HKZ G;  2X6G A;  2QF7 A;  1I4P A;  4ZQ3 A;  3HKZ E;  4X64 L;  1K3R A;  4HR7 B;  1IBM L;  4IZ8 A;  4A93 H;  1TWA B;  2A69 D;  2JA8 B;  5IYB H;  1BF4 A;  2A68 C;  4A3I H;  1S5F D;  1L2F A;  3MWY W;  3PIO 3;  4DV6 Q;  2JA6 G;  4J1M A;  4DK1 A;  4NP5 A;  1EQT A;  2CFM A;  2CQA A;  1Y14 B;  3D31 A;  1G8Z D;  3A55 A;  1FGB D;  2EVB A;  1XNR L;  1F2Y A;  2VS1 A;  4R1J A;  5IP9 G;  4OEM B;  2KOL A;  1KNE A;  4L5S A;  3G48 A;  1SXT A;  3M85 A;  4DUZ L;  1PH6 A;  2I5L X;  3GTG H;  4XXE A;  5JEA G;  2IJ0 A;  2IX0 A;  5IT9 E;  2HHH Q;  3U9O A;  3H94 A;  2Z6K A;  1EIY B;  1XWE A;  2B8F A;  1M1K C;  5I6Y A;  5DM6 3;  4C3I G;  1L0W A;  4A3J B;  1QIL A;  4LF7 Q;  1HA6 A;  5EGT A;  5M3F G;  5EAY A;  3PUY A;  3NQI A;  1T5E A;  4FF4 A;  2PZT A;  4QQB X;  5C0X H;  5C44 B;  4NXM L;  1PRT C;  3CPF A;  1LLR D;  4RKB A;  4HTH A;  1WTR A;  4X6A H;  4IPG A;  1PA6 A;  2AKW B;  4L8J A;  1LYL A;  3CPW A;  1L1O A;  4N9P A;  4AYB G;  3I4N B;  5CV8 A;  2ENB A;  4UP9 A;  3TP8 A;  1XMQ Q;  1KAA A;  1ASZ A;  1L0X B;  5TSS A;  4EQO A;  1IL2 A;  1CTM A;  1F9P A;  2NVX H;  2Y0S E;  1JQY D;  4CJ2 C;  2JA7 G;  1AEX A;  4MTK A;  2UU9 L;  1F2M A;  4IN3 A;  3M4Y A;  4OXP A;  4B3R Q;  3W5O A;  4C56 C;  2B2U C;  1HNX Q;  1QUQ B;  1JE4 A;  4HJA A;  1YHB A;  2JN4 A;  4YCW A;  1B9M A;  2EYP A;  1ONL A;  2NN6 I;  3KDF B;  4DNI A;  3E9H A;  3MEF A;  1IKL A;  3J80 c;  1HHV A;  3K8A A;  5IYB G;  3D6C A;  4DAM A;  5JPN C;  1X32 A;  2XWB B;  4XT3 B;  5CMD A;  1QVF A;  4B3M Q;  1A3U A;  4KK7 A;  1SE2 A;  4A3E G;  2EZV A;  2SNM A;  2GN5 A;  3CW2 C;  3TP7 A;  4BXX H;  2G5D A;  1D5Z C;  1L1O B;  1YI2 A;  1SYD A;  3OWE B;  2IW3 A;  1ZYR C;  2R7Z H;  1R4Q B;  2FXQ A;  5BN3 A;  2IL8 A;  3OW7 A;  2PZU A;  1ICW A;  5C44 G;  2EDG A;  2F4I A;  4QJF A;  2B2T A;  2QA4 A;  4LMQ D;  2E74 C;  1S40 A;  2NTT A;  3S1M B;  1O78 A;  3TS0 A;  4KKU A;  2A73 B;  1TQO A;  4LUO A;  1NTG A;  3EVQ A;  1VQD A;  4OL7 A;  2J0T D;  5ELF A;  2Y0S B;  4A93 B;  4NW2 A;  4MN3 A;  4ZRZ A;  2KHI A;  4DR6 L;  5JJL A;  1EQQ A;  5M3M B;  3RUZ A;  2YU9 H;  3OTO L;  4POG A;  1N34 Q;  3GTO B;  1TWG H;  4MNO A;  4P2C B;  1ROD A;  3T4A C;  4MIU A;  4CJ0 B;  1JCK B;  4QGU A;  4V0B A;  3U4Z A;  3UI2 A;  3BZD B;  2DUD A;  3TN2 A;  2RDH A;  3K7U C;  3WWV A;  3G7L A;  1PH1 A;  1JC7 A;  2MGS A;  4UDU C;  5JVG 3;  1WTQ A;  1Q81 C;  1Y1V H;  2VW9 A;  4XTC S;  4DGZ A;  4R4C A;  1LTR D;  4K0K L;  3BJU A;  3S14 H;  2EJM A;  4JW0 A;  1SFO H;  2F0H A;  4LFA L;  2I07 B;  5CV9 A;  4QUC A;  4PQX A;  2SDF A;  1EQV A;  3AFP A;  3HKS A;  3A5U A;  4A3D G;  5E4W C;  1NUC A;  1OXV A;  5IWA L;  3BYT B;  4LK1 C;  2AQ1 B;  1S5D D;  2DN8 A;  2IPK D;  1U0L A;  3K0X A;  4JI4 Q;  2EXZ A;  4KN4 C;  5C0X J;  3T16 A;  2HUG A;  1X3F A;  1TII D;  4JI7 L;  4NMZ A;  2VUM H;  2NVY B;  5FLX L;  2DJF C;  1DYQ A;  1EYD A;  1BVS A;  4Y7N B;  2ICI A;  3E5S A;  2XRS D;  4ZCK A;  2MUY A;  1KIX A;  1HZ9 A;  4A3D H;  3OWF A;  3CCJ A;  1TWF H;  1H9S B;  3SK4 A;  3E0E A;  4DA2 A;  5IOD A;  2RF4 A;  1TY2 A;  3J7A V;  2IWH A;  1I3Q B;  1SYB A;  3FMC A;  5C3E H;  1H9R A;  2PYK A;  2K75 A;  1Q1E A;  3GTP B;  1N32 Q;  4A3C G;  1E7Z A;  4C2M B;  4HSV A;  4GKJ Q;  1HZB A;  1BUV T;  1SYE A;  3I72 A;  3K6O A;  2EYF A;  2F4V Q;  4FXK C;  2R7Z B;  1PTO D;  4RCO A;  3RZO H;  3G71 A;  1YJN A;  1CM9 A;  2B63 B;  1Y1W G;  4WFN 3;  2NVT H;  3GTP H;  4C3H H;  4J8Q A;  2NZO A;  5CGK A;  1X3E A;  1UE6 A;  2K5D A;  3K0Y A;  4J15 A;  4DU9 A;  2F0W A;  1FGU A;  3L3O C;  2PPB C;  1HTL D;  2Q2T A;  4GOP C;  1FJG L;  3K5N A;  1FYC A;  3NQT A;  1YNN C;  4B3S Q;  4OGQ C;  2WP8 J;  3S1M H;  1Y8O B;  2N49 A;  3ONA B;  4IFD I;  4DR4 Q;  3AU7 A;  5IT9 c;  4KJO A;  5AJ3 Q;  1WCM G;  2JK8 A;  2YTV A;  1SDF A;  4YHH Q;  4BS9 A;  3J80 i;  5HUR A;  1GUN A;  3JC6 6;  3NBI A;  3CCU A;  3U4V A;  3I90 A;  5IGG A;  1KD1 C;  1Q8I A;  4YCU A;  1FR3 A;  2HD3 A;  2PMZ E;  1JJG A;  1PLF A;  4OX9 Q;  4A3E H;  4JPB W;  2QCP X;  1PH7 A;  2J4X A;  3RLO A;  2CH4 W;  2VNU D;  3J81 j;  4I7Z C;  1HR0 W;  4N9T A;  3EJI A;  1VQH A;  5KNB A;  5IGE A;  3BVM A;  1YNJ D;  2CWA A;  4AYB E;  1PTO F;  5C3E G;  5KIX A;  4U68 A;  4QIW B;  4DV3 L;  4IJH A;  4EQ5 A;  1DGS A;  1STG A;  3MXG A;  3F2B A;  4IFD J;  1S3O A;  5M5X H;  3U50 C;  5C6A A;  2EYO A;  1LTS D;  4JK1 C;  2N78 A;  1QCB D;  3A7L A;  3M3Y B;  1AH9 A;  4KMU C;  3I2Z A;  3L2P A;  1F77 A;  4O1N A;  2L4N A;  2B63 H;  2KEE A;  3CCQ A;  3DHQ A;  3TEH B;  4A3G G;  5C3W A;  4DR5 L;  4AH6 A;  1PFB A;  3HGB A;  4LF4 L;  1WTV A;  2H1E A;  4DV7 L;  3R2T A;  5IE8 A;  5IYD H;  1PYW D;  2A8V A;  2EY2 A;  4LWC A;  1FJG Q;  1II3 A;  1KLU D;  2VY3 A;  3D4W A;  1TY0 A;  3K58 A;  2QEJ C;  2Z0S A;  3QR8 A;  3MFG A;  1I94 L;  2HDM A;  1YIJ A;  3E9I A;  4GNX A;  4CDF C;  4PMW A;  2Q2U A;  1SN8 A;  2E5L Q;  3J81 E;  1TS3 A;  1MGS A;  2F52 A;  3ERS X;  3KF8 B;  4C3I H;  1Q46 A;  2RVL A;  2XTI A;  4A3E B;  3HOW H;  1HZC A;  1MIU A;  2PCF B;  3HOY H;  2ZM6 Q;  3V05 A;  3LNN A;  1ZKO A;  3HFZ B;  2CH4 A;  4OX9 L;  5FLM G;  1CI3 M;  1F9R A;  1CA5 A;  2KJX A;  1G29 1;  4UP8 A;  1SFO B;  2PNH A;  4RG1 A;  1E24 A;  2JA8 H;  4A3B G;  1GOZ A;  4DV3 Q;  4A3M B;  4MHE A;  5FJ8 G;  3CAM A;  5D3D A;  2Z4H A;  4GLV B;  2FMM A;  5FKA C;  3A7A B;  4FF3 A;  3A56 A;  1KLG D;  5M3M G;  3OOC A;  1MJC A;  2BDO A;  4B3T L;  2MJ8 A;  3QB3 A;  1HR0 Q;  1ZEQ X;  4GOP B;  1STN A;  2JSO A;  3TQY A;  3GTM H;  1X3G A;  1QB5 D;  2WB1 G;  2HHH L;  3WDN A;  1PH8 A;  1LM0 A;  1FNU A;  4NKL A;  2K04 A;  3I91 A;  4OIJ A;  1K9M C;  3I4O A;  3DWA A;  4TKO B;  5ELN A;  1P16 A;  3RMH A;  3S15 B;  5KND A;  3UDG A;  3CC4 A;  4JI6 Q;  4DFA A;  2EYH A;  1GKH A;  5COR A;  2QIL A;  1NE3 A;  3V2T A;  1LUZ A;  1LTA D;  3EIV A;  1H9S A;  3N6R A;  2JEA I;  2KEC A;  2GA4 B;  1CHQ D;  1PZI D;  1MSG A;  5A2Q L;  2UUA L;  3A5Z B;  1J9O A;  1CFM A;  5CR3 A;  1U4M A;  2IHE A;  1IBL L;  1SR3 A;  2K05 A;  2L9H A;  3J81 i;  3J81 c;  3HOY G;  2E75 C;  3D4D A;  5E4X A;  4OHJ A;  5I6W A;  2WII B;  3S1N H;  3JAM c;  2KQ3 A;  1P8L A;  5C4X G;  2YTX A;  1F9S A;  2R61 A;  2R92 G;  3S14 B;  1KRS A;  4ULL A;  2JQO A;  3T1H L;  1YNN D;  2I46 A;  1VQM A;  1U4L A;  3UE1 A;  1MKH A;  1EIH A;  4B3M L;  4WRD A;  1I4G A;  1PDQ A;  4LFB L;  4H7B A;  1XPO A;  2R6G A;  3D0F A;  4RMF A;  1VQ5 A;  1RKN A;  1JOQ A;  2PNR C;  3C1E A;  4QF4 A;  3VYS A;  4GLX A;  3CU7 A;  2F0G A;  3MFY A;  1VQA A;  4A3K G;  4RHR A;  4XYO A;  1VQ4 A;  4JI8 L;  1HNZ L;  3K5L A;  1VQ9 A;  4A3G H;  1A2U A;  2HIV A;  2KVM A;  1WD0 A;  1TKW B;  1I4R A;  1SLJ A;  2IT1 A;  3PO2 H;  1B3Q A;  2B2W A;  3STB D;  2F4V L;  1CSQ A;  2ZTD A;  1C0A A;  1I4X A;  2UUC L;  5ELE A;  1JJC B;  3SGI A;  1AN8 A;  4FYD A;  2RCN A;  3EN2 A;  4XIG S;  4C3J B;  1RF2 D;  1F9Q A;  2WFW A;  3PQI A;  5FLX E;  1I5F A;  3EFX D;  3K5M A;  2NVQ B;  2ID0 A;  1EFW A;  2ATW A;  1FNV A;  5BR8 L;  3M4O H;  1IBK L;  3NEN A;  4YY3 Q;  5DAU A;  2RKS A;  4J6H A;  4JOI A;  1YHQ A;  2UXC Q;  1UEA B;  4GKK Q; 
#chains in the Genus database with same CATH homology
 1ASZ A;  2R93 H;  1IL2 A;  2NVX H;  2Y0S E;  4DUY L;  3FHW A;  4R4I A;  5HGQ A;  3RNU A;  4DV1 Q;  1YJW A;  3T1Y L;  4BBS H;  4DV4 L;  4A3L H;  2JA7 G;  4BA2 I;  3M4Q A;  4IO9 A;  5IP7 G;  1EYG A;  2UU9 L;  4OXP A;  4B3R Q;  3W5O A;  3ULP A;  3S17 H;  1HNX Q;  1QUQ B;  1VQI A;  1YHB A;  4HJA A;  5C0X G;  1NBW A;  2I0Q A;  1UEB A;  2HIX A;  4YCW A;  2ASB A;  5M5Y H;  2IX1 A;  4Y52 H;  2KHJ A;  2A19 A;  2NN6 I;  3KDF B;  3LGJ A;  4DV6 L;  4DNI A;  3E9H A;  3MEF A;  1OTC A;  2K50 A;  3J80 c;  1X65 A;  1WI5 A;  1Q82 C;  5LMN W;  1M90 C;  3K8A A;  5IYB G;  4UY8 C;  4JV5 Q;  3S15 H;  3FP9 A;  4DAM A;  1VQN A;  2OQ0 A;  1QVF A;  1X56 A;  4B3M Q;  4DR7 Q;  1JJ2 A;  1G51 A;  4KHP L;  3AFQ A;  1OXU A;  2NVY H;  4JI7 Q;  1Y1W H;  4TQU S;  4A3E G;  1BBU A;  4LF6 L;  2GN5 A;  3CW2 C;  4BXX H;  4O0A A;  1K83 H;  3M9B A;  1L1O B;  1YI2 A;  3G4S A;  1XJV A;  4NPS A;  5GAD C;  2R7Z H;  1HNZ Q;  2FXQ A;  3GDE A;  3W1G A;  4IOC A;  4A76 A;  4GS3 A;  4X66 Q;  2JEB I;  1B70 B;  1TXY A;  5C44 G;  2MQH A;  2BH8 A;  2JA9 A;  2WB1 E;  5LMN Q;  4BY1 H;  4GKK Q;  4QJF A;  4DKA C;  2QA4 A;  4DR5 Q;  4DV0 Q;  3CCM A;  1S40 A;  3HOV H;  2MO0 A;  3A0J A;  2K5N A;  3RN5 A;  2VQF L;  3CCE A;  4KI0 A;  2VQE L;  4ALP A;  5J3B A;  4TVA B;  1KAW A;  3TS0 A;  1YZ6 A;  4JOI C;  2E2H H;  1V1Q A;  3GTK H;  4LUO A;  5C4J H;  1NTG A;  1VQD A;  1UWV A;  1D8L A;  1KRT A;  1N32 L;  2PI2 E;  3PSI A;  1N36 L;  1G6P A;  1A63 A;  1WJJ A;  2KHI A;  1I50 H;  4A93 G;  4DR6 L;  1EQQ A;  2YU9 H;  3K7A H;  4IJL A;  3OTO L;  1A8V A;  2UUB Q;  4L5R C;  4POG A;  1N34 Q;  4DV5 L;  1TWG H;  4MNO A;  2VUM G;  4WJ3 M;  3I56 A;  1UE5 A;  1Q86 C;  2OWO A;  5BR8 Q;  1A0I A;  1FVI A;  4JI1 L;  1PH4 A;  3M4P A;  1VQJ A;  3H3V I;  5GQO A;  4QGU A;  4YWK A;  3U4Z A;  3HOZ H;  2ZTC A;  2DUD A;  3I4M G;  1SE8 A;  4O2D A;  3K7U C;  3WWV A;  1PH1 A;  3PF5 A;  1HNW Q;  3AQQ A;  4FDB A;  4X62 L;  3K81 C;  4JI0 L;  2AWO A;  1Q81 C;  2Z6K C;  1Y1V H;  1N8R C;  2VW9 A;  2B3G A;  4XTC S;  5IY0 A;  4LFC L;  4DK6 C;  5AJ3 L;  4HIO A;  2ZM6 L;  5FJ8 H;  1OXS C;  4R4C A;  2QEX A;  2N8N A;  4LNQ A;  4BY7 H;  1AE2 A;  4K0K L;  3BJU A;  3KDF A;  3S14 H;  3PUZ A;  1SRO A;  1SFO H;  2R93 G;  4LFA L;  2GVB A;  4YCV A;  1LTL A;  1WFQ A;  3I55 A;  1EOV A;  4BY1 G;  1QUQ A;  1YHA A;  1PYB A;  1Z47 A;  2CQO A;  3HKS A;  3AFP A;  4JCV E;  3GTJ H;  2Q2U A;  4JYA Q;  3A5U A;  4GLA C;  4A3D G;  1I6H H;  3S2D H;  4A3M H;  1OXV A;  1PH5 A;  5IWA L;  1VQG A;  5LMU Q;  3PF4 A;  4GNX C;  2VZA A;  4P71 A;  4X64 Q;  4JV5 L;  1IBM Q;  3ULL A;  3H3V H;  1U0L A;  1KXL A;  3H0G H;  3K0X A;  4JI4 Q;  2UXB Q;  4EX5 A;  3GD7 A;  4LF5 L;  5C0X J;  2UXD L;  1YNX A;  2CKZ B;  1X3F A;  4JI7 L;  2VUM H;  4OWT B;  1T9H A;  2BA1 A;  1BVS A;  5M5W H;  1XNQ L;  1WYD A;  2YV5 A;  2K4K A;  1OXT A;  5M3M H;  1TWC H;  3PV0 A;  5IYC G;  1KIX A;  1HZ9 A;  3S2H H;  4A3M G;  4A3D H;  3CCJ A;  1E1T A;  4KLK A;  4IFD G;  1TWF H;  2Y0S G;  4HJ5 A;  1PH3 A;  3E0E A;  1HZA A;  3KJO A;  3CCV A;  2RF4 A;  1VQB A;  4H02 A;  4DV0 L;  2ZJQ A;  3RLF A;  1VQ6 A;  5C3E H;  1YVC A;  3AYH B;  5IP7 H;  1PFS A;  3CCL A;  3S1Q H;  1GM5 A;  3PO2 G;  1HH2 P;  3PUV A;  4DPG A;  2K75 A;  1Q1E A;  1N32 Q;  4A3C G;  1E7Z A;  5K36 G;  4DV2 L;  1KQS A;  4GKJ Q;  1HZB A;  1IXR A;  3Q8D A;  1J5E L;  3L0O A;  3CXC A;  2F4V Q;  3OW2 A;  4HJ9 A;  3VDY A;  2JA5 G;  3OTO Q;  1NJI C;  1X9N A;  4DV5 Q;  3RZO H;  3G71 A;  1YJN A;  3MXN B;  4DV7 Q;  2R7F A;  4X65 Q;  1Y1W G;  2NVT H;  3GTP H;  4HIM A;  4C3H H;  2NZO A;  4A75 A;  1X3E A;  4GOP A;  1UE6 A;  2ZJP A;  2XGT A;  4J15 A;  2B63 G;  1E3P A;  1FGU A;  3L7Z C;  3I4N G;  2ALY B;  1FJG L;  2Q2T A;  5IP9 H;  4GOP C;  2K5H A;  4NXM Q;  3PGZ A;  4B3S Q;  3S1M H;  2WP8 J;  1IBL Q;  2N49 A;  1MJE A;  3FKI G;  4IFD I;  5ELO A;  1VQF A;  4DR4 Q;  2E2J H;  4OWX B;  1W2B A;  3KJP A;  1I94 Q;  1VQ8 A;  5IT9 c;  4L5T A;  5AJ3 Q;  1QZH A;  1WCM G;  1RL2 A;  2JK8 A;  3M3Y H;  2R92 H;  2UXC L;  3CD6 A;  2YTV A;  1N33 Q;  4A3B H;  4K0K Q;  2OQK A;  4DR3 L;  4YHH Q;  1PHJ A;  4Y7N H;  1K8G A;  2HT1 A;  4LFA Q;  3J80 i;  4POF A;  2F3I A;  3JC6 6;  4A3L G;  3CCU A;  3I4N H;  3U4V A;  3TRZ A;  1S72 A;  4DV1 L;  4A3J H;  3KYH C;  4NXN L;  5C0X I;  3CC2 A;  5JJK A;  1KD1 C;  5IWA Q;  1NY4 A;  3T1H Q;  2YTY A;  1X55 A;  2NN6 G;  4IPD A;  3S16 H;  4OO1 I;  1EWI A;  3CF5 A;  2NVQ H;  2I5M X;  4B3R L;  4YCU A;  1PH9 A;  1XNR Q;  2PMZ E;  4DR1 Q;  4JI4 L;  2UXB L;  1QVC A;  4JI3 L;  5GAG C;  3PIO A;  4A3E H;  1PH7 A;  1Z9F A;  3RLO A;  1Q12 A;  4OX9 Q;  3F2D A;  2BH2 A;  2VNU D;  1E22 A;  3J81 j;  4JBJ A;  1HR0 W;  2RHQ B;  3CCS A;  1VQH A;  3PO3 H;  3KF6 B;  1VQE A;  4PG3 A;  2CWA A;  4AYB E;  4LF9 Q;  3A74 A;  5C3E G;  2VL6 A;  2EIF A;  1OXX K;  1XNQ Q;  3TRE A;  2PI2 A;  4GN4 B;  3HOX G;  1VQC A;  4DV3 L;  2OTL A;  1Q8K A;  4JBM A;  2Q2H A;  3K80 C;  4IJH A;  1DGS A;  2BA0 A;  4EQ5 A;  4DR7 L;  3PUW A;  4UPA A;  2JA6 H;  4KHP Q;  3F2B A;  4IFD J;  4JI2 Q;  1S3O A;  5M5X H;  3U50 C;  5M3F H;  1I3Q H;  4MTN A;  1XTD A;  1B7Y B;  1HJP A;  4R4O A;  2N78 A;  4LF8 Q;  3B6Y A;  3NBH B;  5C4X H;  3H15 A;  3RR5 A;  1AH9 A;  2C35 B;  2MNA A;  1BBW A;  2HQL A;  4PZ8 A;  2UUC Q;  3I2Z A;  1CKN A;  3BZK A;  3L2P A;  4DAY B;  2B63 H;  3UDX A;  3CCQ A;  2OTJ A;  1QVG A;  3TEH B;  4A3G G;  3OYY A;  4GKJ L;  5FLX c;  3NEM A;  4HJ7 A;  4AIM A;  4DR5 L;  4AH6 A;  3CCR A;  4LF4 L;  2VQF Q;  5JJL A;  2VQE Q;  4P73 A;  2KCT A;  4KHZ A;  4P72 A;  4DV7 L;  4HIK A;  5IE8 A;  4JI5 Q;  3KFU A;  5IYD H;  2A8V A;  4BA1 I;  3KLW A;  4GN5 A;  3UDF A;  2QGQ A;  2B29 A;  1N36 Q;  4LWC A;  2E8G A;  4MZ9 A;  1FJG Q;  2VY3 A;  4LW1 A;  2V1C C;  1PYS B;  4L5Q A;  2PQA B;  2ES2 A;  1C9O A;  1XMQ L;  4GKK L;  1TWA H;  2Z0S A;  2D62 A;  5JEA J;  1I94 L;  2UUA Q;  1KHI A;  4P74 A;  1JE5 A;  3E9I A;  4DK3 C;  2KCM A;  4PMW A;  2WAQ G;  1FL0 A;  1SN8 A;  4GNX A;  1RIP A;  4A3I G;  5E7N A;  1KC8 C;  2E5L Q;  3W1B A;  2UU9 Q;  4DR3 Q;  1D7Q A;  1L1O C;  3KF6 A;  4YHH L;  1Q7Y C;  1N9W A;  2F52 A;  3ERS X;  3KF8 B;  2WAQ E;  1GD7 A;  4C3I H;  2YYZ A;  1NMF A;  2K52 A;  1Q46 A;  3J7A 5;  1VS0 A;  4X62 Q;  3PO3 G;  2XTI A;  3HOW H;  1JB7 A;  1HZC A;  3I7F A;  1JT8 A;  2MO1 A;  1MIU A;  1H95 A;  2LXK A;  4HID A;  1X6O A;  3S1R H;  2ZM6 Q;  1XPR A;  4QIW E;  1HR0 L;  3HOY H;  3HOW G;  2D0P A;  2JA5 H;  1PH2 A;  1C7Y A;  3HFZ B;  2DGY A;  3BU2 A;  4DR1 L;  4JI3 Q;  5FLM G;  4OX9 L;  5H1S E;  4JBK A;  1E1O A;  3J7Z C;  1EUJ A;  1AE3 A;  2Q2I A;  1VQK A;  3ICE A;  3CMA A;  2ZTE A;  1G29 1;  4UP8 A;  2H5X A;  2CWP A;  4PZ6 A;  2PNH A;  1QZG A;  2K14 A;  2E2I H;  1V43 A;  1CKM A;  4JBW A;  4ME3 A;  4GNX B;  1PV4 A;  1VQ7 A;  1UE1 A;  1K0R A;  4RG1 A;  4LF9 L;  1E24 A;  1CSP A;  3HOU G;  4A3K H;  2JA8 H;  4A3B G;  1GVP A;  2N3S A;  2JA8 G;  4DV3 Q;  1R9T H;  3HOV G;  4BY7 G;  2D0O A;  3F8T A;  5FJ8 G;  5GRO A;  3CAM A;  3PIP A;  4LF5 Q;  1UE7 A;  2PQA A;  4LFB Q;  4GLV B;  2UXD Q;  1KL9 A;  1VQP A;  4X66 L;  1YEZ A;  1CUK A;  1IZ6 A;  2K5V A;  3RN2 A;  1XPU A;  4JI2 L;  1V9P A;  4DUZ Q;  3FKI H;  3M7N A;  2AMC B;  1VQO A;  5M3M G;  5IYC H;  5LMN L;  1WOC A;  4IOA A;  1MJC A;  1X54 A;  5DLQ E;  5FLM H;  4B3T L;  1XMO L;  3RLN A;  4A3F G;  1HR0 Q;  4LUZ A;  4GOP B;  4R4T A;  3HOZ G;  3TQY A;  4JI8 Q;  3CC7 A;  3U58 A;  3GTM H;  1X3G A;  3F2C A;  2WB1 G;  2HHH L;  5HY6 A;  1B8A A;  4QL5 A;  3DLL A;  1PH8 A;  1LM0 A;  1JMC A;  3CP0 A;  1YBY A;  4YWM A;  3ZJY C;  1GO3 E;  1K9M C;  3H0G G;  2I5H A;  3I4O A;  4IPH A;  5ELN A;  1P16 A;  1SMX A;  1Q1B A;  4DR6 Q;  2GVA A;  4A3F H;  5JJI A;  4C3J H;  1CKN B;  4LF4 Q;  4LF7 L;  3UDG A;  2OCE A;  2LSS A;  3CC4 A;  4JI6 Q;  4JI5 L;  4HJ8 A;  1GKH A;  1W3S A;  1NMG A;  4JI1 Q;  3G6E A;  1NE3 A;  4APV A;  1U5K A;  1LUZ A;  4DV2 Q;  1CKO A;  2LXJ A;  3EIV A;  2CCZ A;  4QY7 A;  2JEA I;  3TS2 A;  2EQS A;  3HOX H;  1HNW L;  1SRU A;  3STB C;  4AQY L;  5C44 H;  4JI0 Q;  2MFI A;  2UUA L;  3A5Z B;  2KBN A;  3EBE A;  4UP7 A;  1Y1V G;  4YY3 L;  3JAM i;  1IBK Q;  4LFC Q;  3UE0 A;  5IYD G;  2E5L L;  4DR2 Q;  3UDI A;  2IHE A;  1IBL L;  1SR3 A;  3J81 i;  3J81 c;  3HOY G;  4DR4 L;  4JYA L;  4DUY Q;  3GTQ H;  3BZC A;  4WJ4 A;  1TWH H;  4YWL A;  3T1Y Q;  4DV4 Q;  3HKZ G;  3S24 A;  5LMU L;  3S1N H;  2EXD A;  3HKZ E;  3JAM c;  4X64 L;  1K3R A;  3AEV A;  1IBM L;  4A93 H;  1P8L A;  2A1A A;  5C4X G;  2L15 A;  1HNX L;  4PZ7 A;  2YTX A;  5IYB H;  3IRB A;  3PUX A;  4A3I H;  4LF6 Q;  3NEL A;  2R92 G;  1L2F A;  2AWN A;  1YIT A;  1WCM H;  4DV6 Q;  4NXN Q;  1KRS A;  1J6Q A;  1VCI A;  2JA6 G;  2JQO A;  2CFM A;  3T1H L;  1Y14 B;  3D31 A;  3RZD H;  1VQM A;  3HOU H;  4IPC A;  3UE1 A;  1XNR L;  1MKH A;  2VS1 A;  4B3M L;  4R1J A;  4LFB L;  5IP9 G;  1XPO A;  4P75 A;  4L5S A;  2R6G A;  3G48 A;  3D0F A;  3M85 A;  4DUZ L;  4RMF A;  1PH6 A;  1VQ5 A;  3PCO B;  2R7Z G;  3CQZ H;  4GLX A;  4OWW B;  3CME A;  4B3T Q;  3I4M H;  1IYJ B;  1O7I A;  1XMO Q;  2KEN A;  1VQA A;  4A3K G;  2I5L X;  4BXX G;  1VQ4 A;  4JI8 L;  1HNZ L;  3GTG H;  1VQ9 A;  3GTO H;  5JEA G;  4A3G H;  1EIF A;  2IX0 A;  2HHH Q;  5GAH C;  2HIV A;  1YJ9 A;  5GAE C;  2IY5 B;  1SLJ A;  2Z6K A;  4A3J G;  2IT1 A;  1EIY B;  4A3C H;  2R7D A;  1M1K C;  4C2M H;  2IHF A;  3PO2 H;  4JG2 A;  1EQR A;  2RHS B;  1L0W A;  3ER0 A;  1J5E Q;  4NB3 A;  3STB D;  2F4V L;  1CSQ A;  2ZTD A;  4LF8 L;  4LF7 Q;  4BBR H;  5M3F G;  1BKB A;  5EAY A;  3PUY A;  4JI6 L;  1C0A A;  3GTL H;  2JJQ A;  4X65 L;  2UUC L;  3F1Z A;  2NZH A;  4OO1 G;  1JJC B;  3GO5 A;  4OON A;  3SGI A;  4GN3 B;  4R4Q A;  3ULJ A;  1ASY A;  4QQB X;  2RCN A;  3EN2 A;  4NXM L;  3CPF A;  4XIG S;  2AHO B;  4BBR G;  4A4I A;  4B3S L;  2ZJR A;  1A62 A;  2WFW A;  4X6A H;  2UUB L;  1I5F A;  4IPG A;  1YIJ A;  4AQY Q;  1PA6 A;  1N34 L;  2AKW B;  2JA7 H;  2ID0 A;  1EFW A;  2ATW A;  4BBS G;  1PVO A;  1LYL A;  5BR8 L;  3M4O H;  1IBK L;  3NEN A;  1K73 C;  3KOJ A;  4YY3 Q;  3CPW A;  1L1O A;  4JOI A;  1YHQ A;  2JE6 I;  4AYB G;  3DM3 A;  1K8A C;  4DR2 L;  1VQL A;  1N33 L;  2UXC Q;  1JJG A;  4JC0 A;  4LUV A;  4UP9 A;  1XMQ Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...